2O2LD

Crystal structure of human heat-labile enterotoxin in complex with a blood group a antigen analog
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
98
Chain Sequence
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Heat-labile enterotoxin B chain
publication title Blood Group Antigen Recognition by Escherichia coli Heat-labile Enterotoxin
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 98
sequence length 103
chains with identical sequence E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2o2lD00
1PRTD 1ET6A 3BYTB 3BVGA 1JCKB 1FNWA 1RF2D 1AW7A 1BCPD 3MFGA 1LTGD 4UDUC 5ELBA 1AN8A 1PZID 2J4XA 3OWEB 3V05A 4RGMA 1PZKD 1D5XC 1BXTA 1G8ZD 3R2TA 4RFBA 1CK1A 2XNAC 3DWAA 5ELCA 1PRTF 3R2IA 1PTOH 1HA5A 1UNSA 2IPKD 1PTOC 5ELDA 2CHBD 2IJ0A 3BZDB 1RCVD 2ICIA 1D5ZC 1TS4A 1V1OA 1T5XD 1LT5D 4RGOS 2Z8LA 1EEID 1DYQA 2NTTA 1S5DD 1CT1D 1SE3A 1D6EC 1LTSD 1HXYD 1KTKA 1JQYD 1LTBD 1PYWD 4OHJA 4L6TB 3BYYB 4K6LA 4BWGB 5ELEA 3W2DA 5FK9C 1HTLD 1I4GA 1LT3D 4Z9CB 1EFID 1KLGD 1TS5A 2O2LD 1KLUD 1LLRD 1SE2A 2G9HD 1FNUA 1DJRD 2XRSD 1TS3A 1B44D 1PTOD 1LT4D 1F77A 3URYA 1JR0D 2AQ2B 3O13A 5D3IB 4RCOA 3R8BA 1BCPF 1V1PB 1XTCD 1ENFA 3KLSX 1I4PA 1EWCA 3DWPA 1LO5D 3BVMA 5ELFA 1SBBB 1PRTB 4RGTA 1S5CD 2TSSA 3MC0B 1I4RA 4ZYSA 5I4DA 1L0YB 4RHRA 1BCPB 1PTOF 1ET9A 1MD2D 1SEBD 2XN9C 1HQRD 3BVZA 1EU3A 4DXGA 1STEA 1CHPD 1L0XB 3SEBA 1LTID 2WV6D 2QILA 2AQ1B 1RD9D 4RH6A 1JWUD 1LTTD 1M4VA 1JWMD 2XRQD 1LTRD 3CHBD 2QEJC 2RDHA 1V1PA 2NTSA 1PRTC 1ESFA 3DWQA 4RHSA 1JWSD 1SXTA 4O1NA 1QILA 1LT6D 1TY2A 1B1ZA 1UUPA 1BCPC 1EEFD 4DXFA 4C56C 2R61A 1I4HA 1SE4A 1LTAD 1XXGA 5TSSA 1FGBD 1EU4A 2AQ3B 3EA6A 1I4QA 4L63B 3EFXD 1FNVA 1RDPD 1S5BD 1SJED 4RGNA 5D3DA 3TSSA 1GOZA 1TY0A 3GP7A 1D5MC 1S5ED 1SJHD 1TS2A 2RDGA 1PZJD 1I4XA 1PTOB 1CHQD 1S5FD 1CQVA 5FKAC 1FD7D 2SEBD 4TSSA
chains in the Genus database with same CATH superfamily
1PRTD 1I94Q 3BJUA 3MXPA 3S15H 1UE5A 2EYLA 3OYYA 4XYOA 1SMYD 4P71A 4AH6A 4HCEA 4HEDA 3JAML 2ZTEA 4HJ5A 2K14A 4XQQA 3Q22A 4UP9A 3Q6SA 5CC4A 1N32L 4RA8A 1LUZA 2CHBD 2VQFL 1PH4A 1ILPA 3MVVA 1RJTA 1TS4A 3CCMA 4JI3L 3VDYA 2ENBA 4A3GH 2VNUD 4JI2Q 2Q2TA 4IURA 3T56B 1LTSD 1KTKA 2WB1B 2LS01 4L6TB 1DONA 2EYMA 1P8LA 2D62A 2PW5A 2PZTA 2Z4IA 2L55A 4V0BA 2N8NA 3VYUA 4PZ6A 3DHQA 1KLUD 3IFTA 1VMPA 3MAQA 1QNKA 2L4NA 1Z47A 1U4LA 4LK1C 2NN6H 1GO3E 4HMIA 4GOPC 2K7VA 3M9BA 4P74A 3I4MB 2A6HC 1BR9A 2Q2HA 3S1MH 2B2TA 3CAMA 2HIVA 3PF5A 4DR3L 1A6XA 1CZWA 1OXUA 4PQXA 3F2BA 1BNZA 2BOSA 3P20A 4Q0FA 3GTKB 1VQLA 5CV7A 5IWAQ 2IHFA 3KJPA 3PO2G 1PDQA 1QWYA 5EJWA 3MEFA 5G3LD 4Q5VA 3SK6A 3K57A 2BCOA 1IXRA 2JXMB 3A8JE 3ERQA 1SXTA 2EDGA 1YI2A 3W3AA 4YHHQ 5BN3A 3Q24A 1FGUA 1KRTA 2BDOA 3VR3A 3KF6A 1QE6A 4DK3C 2V4DA 1HR0Q 4DV0L 1LTAD 3PUVA 3X3NA 4LFAL 4I65A 2A5HA 1MGSA 4DV6L 4XYQA 4POFA 1EQRA 1GOZA 1TWAB 1G6ZA 3HOXG 5EKKA 2K33A 1CQVA 1K83H 3GTPB 1KIXA 1XX8A 3BVGA 2F0DA 1AW7A 1SDFA 1N33Q 3D4WA 4X64Q 3OWEB 3NQTA 3RMHA 2DJFC 1H9JA 1I50B 2Y0SE 4R1JA 1QZGA 2JA6H 4DF7A 2AHOB 2NZOA 4B3SQ 1OO9B 1HNZQ 4OGQC 3M7NA 1CSQA 1STAA 1K8OA 4C3HB 2A68C 3J80i 1Q1BA 4NXNL 3CCSA 4GOPB 1N36L 3F2UA 2NUCA 4MZ9A 1VDZA 4AQYL 3VR6A 4X62Q 1AE3A 1ILQA 4K6LA 1EYAA 3NSWA 2SDFA 3W2DA 4ZKBB 1SE8A 1LT3D 3A7LA 4NKLA 4PZ8A 3K6OA 3MXNA 4KD4A 5IYDG 3DEPA 1NE3A 4GKKL 4C3JB 3K5NA 1V1PB 4A76A 1N9WA 1B9NA 3S17B 1WCMH 1XJVA 1ZXTA 3KJOA 3BZKA 4XQJA 3W5OA 4J15A 5C44B 2AUKA 1IHZA 2JE6I 3HOUH 1PTOF 2R92B 1AH9A 1IL8A 1A3VA 3I4LA 4EX5A 4LF9L 3EQLC 5M5YH 4MTNA 1YEZA 1Q7YC 5JJLA 1Q8KA 3KLRA 2IT1A 1IBKL 2PO4A 3E5SA 4A3KG 1C7YA 1HNWL 3T1HQ 1JOKA 2QEJC 1Y8NB 4P2CB 3EN2A 3OHXC 3C3LA 1F9QA 3SR1A 4DR4L 4DR2L 4IPDA 3RR5A 3G4SA 4OWTB 3H3VC 1OXSC 3BDCA 4WJ4A 2VQEL 4DV3Q 1YZ6A 3MWYW 4C56C 4DV4L 1JICA 1NCVA 1I5FA 2NZHA 3J7A5 1EQTA 1IYJB 4B3RQ 1G6PA 1RL2A 1BQQT 1K8GA 1EYGA 3NTHA 4BY1G 3GTOB 2EYHA 3A0JA 3NQIA 1BO0A 1H9MA 2I0QA 3IRBA 3D4DA 2SEBD 1GHKA 2K5HA 2YTVA 5EQ0A 5CYUA 2KHSA 2B39A 4AYBG 3J7AF 1VQ5A 1Q1EA 2FMMA 2NVXB 3S2HH 2OXPA 4R8IA 3UDGA 3K0XA 3NELA 4C1NK 5A2QL 1TT2A 3PGZA 2QKIC 1CK1A 4IFDJ 5JPNC 1PTOH 2L1BA 4LNQA 3BG3A 4GLXA 1J6QA 4CDDC 1HUNA 3F2CA 1MJCA 4CHTB 5K5PA 3BZDB 5J1ZA 3GTQB 3CQZH 4BBRG 1L1OA 1NMGA 3DMUA 3FPUB 1SFOB 2E5LL 1WTVA 4LWCA 5IP9H 3K5LA 2J7ZA 3BYYB 4GN3B 1XYIA 3TDQA 4JYAL 2UUAL 1TVXA 5FLXc 1Y1WG 2L12A 1HZBA 4JI0Q 2NZ1D 3CF5A 4N9TA 1B44D 1XMOL 3P75A 2UU9Q 1BBWA 2F4VL 2UXCQ 2JA5G 1E22A 2F0IA 3FRPB 1X3PA 3CKIB 2BE5C 1J5EQ 1O78A 1LO5D 1N8RC 3FKIG 5ELFA 2Z4HA 3E0EA 4MIUA 2WB1G 4A3EG 1W2BA 4RHRA 3H91A 1C0AA 2XN9C 2JEAI 3PO2H 3H09A 1WTWA 2WIIB 3KUPA 2L9HA 4IPGA 5IYBH 1QCBD 3V96A 3AMUA 3M85A 3GTGH 4QUCA 5IP7G 2K75A 3OWFA 3S16H 5IOCA 3J80c 4DV2Q 3HOWG 4HSPA 4RHSA 1M1KC 5FLXE 2NWGA 1ZEQX 4IOAA 1BCPC 4BA1I 1SR3A 5J39A 1X9NA 4LF8Q 1CM9A 2E2HH 3DUZA 1N34Q 2EZVA 4OIKA 1V43A 4FF3A 4EQOA 2AQ3B 3H94A 1PH5A 1GHJA 3GV6A 4JG2A 3HOXH 5IE8A 2DNCA 1TS2A 3AFPA 2XGTA 2K04A 3J81i 2QEXA 4KV6A 1IKLA 2E2IB 3E3XA 2L5TA 1Y8PB 5COYA 4DV1L 2YU9B 1G291 1HZAA 4DKAC 1H9SB 3MFGA 3OMGA 1QUQA 4LF5L 1PZKD 3NBHA 1HA6A 4JI8L 5KEEA 3CC4A 2KENA 4RKBA 1FYCA 2A69C 2F0WA 3J80E 1WTXA 1WD0A 3F1ZA 1EZ6A 2EXDA 4JI6L 4FP5D 5IT9c 2OEOA 1VQPA 1OXTA 4KHPL 2F0SA 2PW7A 3N52A 2OT2A 1O7LA 4DV5Q 1YNND 1D6EC 3A54A 1IYVA 1GUGA 3L3OC 3QOJA 2EYOA 2B63B 5FOBB 2IX0A 2E76C 2Z9HA 1KNEA 1WI5A 4JI4Q 3K59A 2B2WA 1HTLD 2F1MA 3PIOA 1VQ6A 2D9UA 1K73C 5IYDH 5EPLA 5FO7B 2E74C 4B3ML 4X3UA 4DK0A 4HIDA 1HJPA 2C35B 4IPCA 5EGTA 1VQBA 3HOVB 4ZKCB 2HQLA 1YIJA 2PYKA 2HIXA 2DN8A 4P73A 5C5MA 4F88A 3D6WA 3CC2A 3QWNA 1EWCA 2JA7B 2WKDA 4C3HG 2KHIA 4XQNA 5NUCA 4DV7Q 4PG3A 4IPHA 4A3MB 3H0GH 1QVCA 2B2WC 1BCPB 2PQAA 1NAPA 1STEA 5IT9E 1CHPD 4QJFA 3CPWA 4A3KH 1GM5A 1DD2A 1Y14B 2OF1A 3GQBA 3LWUA 5C0XG 5I6YA 1I94L 1JOQA 4RWSC 2KCMA 3TREA 4A4IA 3S2DB 4B9WA 5DM63 1E0BA 4DAVA 4A3JB 3DWQA 3I91A 2HDMA 3S1NH 2JSOA 3LWEA 4N8FA 1EEFD 5C44G 4DXFA 4R8NA 1KL9A 4EGVA 4MTKA 1DOLA 3NE5B 3ERSX 2R92G 4BY1H 4QUFA 5BR8Q 4LFCQ 1JB7A 3I8ZA 2BA1A 4HJ7A 4FF4A 3G6JB 4JI2L 2F0TA 1DOMA 4ZCKA 3E9IA 3PIO3 2DUDA 1STHA 4CDEC 1F9SA 1JJGA 4PMWA 2VB2X 2GVAA 1TWFH 2M2LA 1C48A 1MJEA 4PMCA 1WTOA 1LM0A 1LTGD 4UDUC 1PZID 3V05A 4RGMA 2F0GA 3OOCA 3NXWA 1KRSA 2GVBA 4U68A 2F0VA 4IUPA 4ZRZA 1PH3A 2P5ZX 4BBRH 3CC7A 3QJYA 1X32A 2EVBA 1T5XD 1PH8A 3T13A 2OTLA 4JBKA 4H02A 1HRJA 2EY1A 1CT1D 4KJOA 1K3BC 4HJ8A 2F0FA 3I56A 4IJLA 1Y1WH 2X69A 5IWAL 1JE4A 2KOLA 4CDFC 4FF2A 2MUYA 3L7ZC 3CMAA 4Z9CB 1EFID 3EVQA 4DGZA 2JA5H 2E75C 4OELB 4YY3Q 1MSGA 5DNFA 4A3BB 3RLNA 4YHHL 4LUOA 1YVCA 4DNIA 3FKIH 4JV5Q 5AJ3L 5EPKA 3J81L 1HR0L 2CW0C 4R4OA 4XT1B 4A3EH 4KD3A 2LY7A 3BVMA 4OL7A 2TSSA 1RODA 3AFQA 1KDCA 3G71A 1B9MA 5JEAH 3AEVA 4XIGS 1Q86C 4JBMA 5HGQA 5IP7H 3GTMH 3ICEA 1K28A 5EBDA 3HOWH 1Y1VB 3K7AH 1M4VA 1LTRD 3M7GA 4DAPA 2B2YA 4GKJQ 1N33L 1PRTC 4A3CG 1ONLA 4X64L 2ALYB 1BVSA 3HRZC 5CORA 4OX9Q 1SMYC 1KABA 4B3SL 1T9HA 4JI5Q 2AWOA 1HNZL 5E3FA 4JC0A 1HPCA 1O7IA 5IGBA 3CP0A 5KYIA 4JBJA 1U4RA 4B9XA 4TKOB 3D6CA 1BOSA 3WOEA 2RDGA 2B2YC 5D14A 4K2KA 1QNUA 4Y7NH 4LFBQ 1BBXC 2H5XA 2MJ8A 5C6AA 5FLMG 4X62L 5ISRA 3CCRA 1CA6A 1TIID 5IY0A 5IGEA 2EQSA 2NVQB 2I46A 3FDTA 3NEMA 1AP0A 1I6HH 2K1BA 1BUVT 1STYA 1AN8A 1E3PA 4IZ8A 3FHWA 1BXTA 2O4XA 4L8JA 4OEMB 4A3FH 1TWAH 4G4KA 1K0SA 1QOHA 1ASYA 2XNAC 3R2IA 1UNSA 1HA5A 2HT1A 5M9OA 1PMRA 2SOBA 3AQQA 1RCVD 1SYFA 3GTPH 1ICWA 4EVOA 3RN5A 2ZXPA 1ENCA 4CKBA 1NSNS 5I6WA 1ESRA 4ILWA 3RD4A 2F3IA 2DGYA 1HXYD 3K80C 4CJ1B 5E4WC 1WTPA 3T16A 1I3QB 1I50H 1YJ9A 1SNQA 4YCWA 2A8VA 5FK9C 4HTHA 5DLQE 4J8QA 3T1HL 1HZCA 1YHQA 1F77A 4C3HH 1KDAA 1PFNA 3HOYG 4DU9A 3QB3A 1GUTA 3HKZE 1Q8IA 1F2YA 4DV3L 4OONA 1TWGB 3SXHA 4A3DG 1KDBA 2A1AA 2F0LA 3U4ZA 1SMXA 3H3VI 5C3EH 3IKJA 1PRTB 4GOPA 2JQOA 1MKHA 1JJCB 2B63G 4DUYQ 3I3CA 4B3RL 2DNEA 3U9OA 4DXGA 4H0LC 1HFGA 5DEHA 4CDCC 4GN4B 4QB4A 4RMFA 1NNXA 2Z1CA 4RH6A 4POGA 4QCLA 3SE0A 3A8IE 1JWMD 5M3MH 1VQ4A 1IBMQ 1V1PA 2GN5A 2NTSA 4IUQA 2JA7G 4O1NA 5I9OA 4KHVA 5C44H 2I5HA 1QILA 1ZKOA 2NB0A 4A3MG 3M4QA 1L2FA 1PA6A 4OO1G 1A2TA 1YJWA 1YNXA 3AB9A 2C5CA 3C1EA 2CWPA 2IW3A 2E2DC 3JC66 4L63B 1FNVA 1XNRL 4C2MH 2KUMA 2NBFA 3TSSA 1TY0A 1AEXA 2YTYA 3PUXA 5IGFA 1EY5A 1GUNA 5C4ZA 1G91A 3S14H 1II3A 5LMNQ 4DR1L 5F2DA 1KAAA 1NUCA 1F2LA 4ZUJA 4JI0L 3Q0AA 3NP8A 1RHPA 3S1RH 1FJGL 1EUJA 1WTHA 4K14A 2KJXA 1UAPA 1G8ZD 3D8GA 2UU9L 2UXCL 3GTJH 2X6GA 1J5EL 4DR5Q 2R93B 3HKZB 2GA4B 4BXXG 3EBEA 1UE1A 5LHY1 4RGOS 1DYQA 4BY7B 2R7ZB 2NVXH 1CZGA 2VXWA 2CQOA 4BBSB 3KBGA 3I72A 4CJ2C 2O5IC 4P75A 3F8TA 1SYBA 4N8X1 3A55A 3MFYA 5I2YA 2UXBL 1O7ZA 4DV2L 1R9TB 3GTQH 4M8AA 4FO2A 1SRUA 1JMCA 1JR0D 4X65Q 1LABA 1X3FA 4LF8L 1VF5C 1SFOH 2EIFA 3K58A 3FMCA 2A6HD 4HCSA 4HJAA 5C4JH 3OTOL 1I4RA 4H7BA 5CMDA 2K5QA 4IFDG 1L0YB 1ET9A 1F2ZA 2Q2UA 2PZUA 1W6JA 4F87A 2JEBI 1EYCA 4X66Q 3G6EA 1RTOA 4K5WA 2QA4A 1V1QA 5M5WB 3S1QH 2AQ1B 1AZQA 4A3CH 1JWUD 4A3BG 2PZWA 1EIGA 4HIMA 1A63A 3TP8A 1ESFA 1SYCA 2PCFB 1STGA 1TY2A 2PNRC 2FINB 4DK1A 3H3VH 2JJQA 1DZ1A 5LMUL 1CSPA 3KK7A 4FXKC 1QVGA 3IAYA 2D5DA 1GD7A 4TVAB 2EJGC 5BN4A 4GNXB 1SJED 5FLMH 3HZXA 4N9PA 2K50A 2L15A 1Y1VG 3WOFA 5ELOA 1I6VC 1X6OA 4WJWA 3CCVA 3CCJA 1Q81C 4JI4L 1XPOA 4A3IB 1RF2D 3S1MB 3S24A 4ABNA 2SNMA 1IBLQ 5FO8B 2Y0SB 4ME3A 1KHIA 5AFWA 5C4XB 2F0MA 2IL8A 4BS9A 2LKVA 2E2JB 2XVSA 2N88A 3CW2C 1YITA 1VQCA 4DV7L 2MO1A 2QCPX 2E2IH 1A2UA 3E9HA 4HIKA 2YU9H 2IX1A 2A68D 3BZCA 4E6IA 4A93B 4IFDI 3MXGA 1TR5A 4C3IB 2F03A 4DN4M 1FL0A 5KNCA 5EKIA 3PSIA 3DLLA 1P16A 1H9SA 3D0FA 2FMCA 1SYGA 2HDLA 5FJ8G 4KKSA 4GLAC 2B3GA 3HOYH 2PI2E 1LYLA 5HGTA 2ZJQA 3DM1A 1HZ9A 4A3DH 1VQMA 2WAQE 2JA8B 2KBNA 3K5MA 5EBCA 3MC0B 1PFBA 5BR8L 1EY8A 4LFCL 4UY8C 4ZYSA 4WJ3M 3NTKA 4X6AH 4U673 1CI3M 1Y69U 2EXZA 3BVZA 1B3AA 4OWXB 1EY0A 3SEBA 2MQHA 1WTQA 4KHZA 5CV6A 2JA6B 2UXDQ 4DR3Q 1WJJA 1EWIA 2OWOA 5C4HA 2QILA 2L0CA 4RAUC 1TXYA 5FLXL 4HSVA 4YIJA 2JA7H 4EQNA 3CHBD 1QJOA 3CRLC 4A3MH 2CH4A 4DAYB 3QR8A 3ONAB 4OO1H 2WACA 1J9OA 2A6EC 1UUPA 2K05A 3NWTA 3U50C 4LF6Q 3KLWA 5KYLA 3L9AX 3RZOB 3M4OB 3T53B 4QL5A 4RGNA 4IJHA 3OPOA 3S2DH 3C1FA 1GVPA 4JI1Q 1ICFB 1BKBA 2JA9A 2RSNA 5FKAC 2ZJPA 1B70B 2F0EA 3STBD 1WTRA 1YNNC 3CCEA 1VMCA 3LGJA 1ET6A 5C3WA 1SNOA 2F0UA 4KY5A 3I4MG 1MSHA 1X55A 4NPSA 3J80L 1XPRA 1XTDA 2R3ZA 5E7NA 3I4OA 4PZ7A 4YY3L 1A8VA 5E1FA 1IKMA 3R2TA 2B2VC 1XWEA 5M5YB 2TMPA 4BXXH 2WAQB 4HAEA 1D5ZC 1DGSA 2Z8LA 2NTTA 4HMJA 2ES2A 1SE3A 1EIHA 4PMBA 1JQYD 4OHJA 2B2UC 3FP9A 3F2DA 1ASZA 4QIWE 4JCVE 5CR3A 2NVYH 4UPAA 1YJNA 1R4QB 1I4GA 3I55A 2IY5B 1TS5A 1PV4A 1XNQQ 1VQNA 2CH4W 4GKJL 1TS3A 2CQAA 1U9RA 1YHAA 4TQUS 1PTOD 3I4NB 3O13A 4OX9L 4RCOA 3KLSX 2BE5D 3PUWA 2KECA 4JI5L 4IFDH 4BY7G 2K5WA 4RGTA 3PV0A 1YNJC 5CBEE 5KGUA 1D7QA 2MGSA 4O0AA 2RBMA 5IT9L 1VQKA 4BBSG 5GAEC 1PYBA 2LXJA 1SEBD 2K4KA 4ZQ3A 3S2HB 1X3QA 2X6LA 2Z0SA 4WRDA 1FR3A 4LFBL 3ND9A 1VCIA 3MHBA 4A3BH 3QO2A 2WV6D 1LTTD 3PUYA 5L37A 3QIAA 4DR7Q 1JC7A 2NVTH 1TWHB 3CQZB 1VQDA 3SK8A 4FVMA 2BA0A 1S40A 3DEOA 2JN4A 3DXJC 3I70A 1ZYRD 1VQ8A 4DR2Q 1K8AC 1SE4A 5H1SE 4KN7C 1IZ6A 4QY7A 2RCNA 3NENA 3W1GA 3R3OA 1U0LA 1EL0A 3EFXD 3MEHA 4O42A 3HFZB 5D3DA 1AZPA 1D5MC 1SJHD 4EQPA 3T51B 5JEAJ 2L11A 4GN5A 4C3JG 1Z6HA 3NWSA 4TSSA 3UDIA 3CRKC 2K6AA 4QIWB 4OWWB 1PXUA 2PNHA 4YWMA 2VY3A 1SAPA 4DUZQ 2B8GA 2K01A 2A69D 1H9RA 3TEHB 1PRTF 3VR4A 1EY4A 4MHEA 3GTGB 5M3FB 1HUMA 3I73A 1BDOA 4DUYL 3S16B 1X56A 5J3BA 2VL6A 3TS0A 4A3IG 2KA7A 3RLOA 5FJ8H 3J7YW 4NMZA 3JAMi 4FYDA 3CCUA 4IQZA 2EYFA 1IL2A 2F52A 2Y0SG 3A5ZB 3KF8B 2RDFA 2PQEA 5C4XG 1FNUA 1IBML 4FXDA 2UUAQ 2G9DA 1LTLA 3HOXB 4LF7Q 2AQ2B 3I2ZA 1KD1C 2XSCA 4IUTA 4R4CA 2A19A 3A8KE 4L5QA 4UP8A 3SK5A 1VF7A 4A93G 4MN3A 4C3IG 2A73B 2ZT9C 4NP5A 2CWAA 3GTLB 3EIVA 2K5DA 1EOTA 1SLJA 1HQRD 4KY6A 3Q23A 3P7JA 5C0XI 1SNDA 1IW7D 1TWCB 2Q8TA 3A7AB 2I5LX 1PLFA 1UEBA 2JA8G 1BBUA 4TRDA 4A3LG 1GXDC 1Q3LA 2ICEC 1QZHA 2HCIA 1CKOA 2HHHQ 1WOCA 2HD3A 4JBWA 4DR5L 4I7AA 5G3LF 1GUWA 4WFN3 4KN4C 2M9VA 1I4QA 3HOZB 4QQBX 1D2BA 4G57A 1I4XA 1F9RA 3I4MH 1DXMA 2IX3A 1S3OA 4J6HA 4S3SA 4ZUIA 3BYTB 3K7UC 2F0JA 3H0GB 3KLSA 3CXCA 2J4XA 3GTKH 1D5XC 2VUMB 1OXVA 3TMEA 4X65L 2LFNA 2FHTA 2K28A 2IHEA 2IPKD 4LUZA 2ZTDA 1GKHA 1LACA 5IGDA 1HH2P 2YTXA 2KEDA 3VA7A 2QGQA 4LW1A 4KHPQ 3D31A 1VQFA 5IYCG 4IUNA 2WB1E 1E2WA 4BWGB 2RQXA 1KLGD 3EJIA 5LMNW 1E2ZA 2WINB 1Z7TA 4UAIA 1JE5A 3VYSA 5M5XB 2XRSD 2ZM6Q 2EY6A 1EY9A 2KCNA 3KFUA 2WAQG 2FXQA 4GZYC 5LL6X 3H15A 1A15A 3DWPA 4BBSH 2CW0D 1B7YB 2F3WA 1S5CD 2EPBA 1TWFB 1MD2D 1H9KA 1JJ2A 2XTIA 2YYZA 3UE1A 3CD6A 4UHVA 3ULLA 1JT8A 3V2TA 4G7ZC 1XPUA 5ELNA 3D3RA 3MTSA 5T1GA 2XRQD 4BBRB 3I4NG 1EQQA 4X3SA 5K36G 3ITPA 1IBLL 3BU2A 3JAMc 1HNXQ 2OTJA 2WP8J 3TN2A 2R61A 4JOIC 1Y1WB 1K9MC 4X3KA 5I9PA 1NY4A 3CMEA 3T1YQ 3EROA 5M5WH 3HG9A 5C0XH 4NW2A 3TP7A 2FFKB 3J7AV 4C3JH 1VQAA 1PYSB 1S5ED 2JA5B 3S17H 3HOVG 3R93A 4KJNA 1DOKA 3FKIB 3PO3B 1DM0B 4ODGA 5JJKA 3KOJA 4A3EB 3K0YA 1NR4A 3C46A 2R92H 4CGYB 2H4OA 4CKEA 1Q90A 5IP9G 1C8CA 1E1OA 1M90C 3ULJA 3A74A 4YWLA 4DR6Q 5ELCA 2RF4A 1SYEA 4GNXA 3GTMB 3KDFB 1V9PA 3JAME 1XMQQ 1VQ9A 1EIFA 4K8JA 1MIUA 2QDBA 4HN7A 2F0KA 2UUBQ 3HOWB 3K7AB 1Q12A 4A3IH 1RTNA 3RZDB 2KCTA 1M8AA 4A3JG 3D4RA 1PYWD 1G51A 4APVA 4G7HC 1K0RA 4OIJA 1SN8A 5C4XH 2UXDL 3CU7A 2K5NA 4EQ5A 2AMCB 2E2JH 4GNXC 1CA5A 4ZLTF 3GTOH 1DJRD 2CVRA 2G5DA 2MFIA 3P1HA 5IYBG 4K0KQ 1JB3A 3I7FA 4YWKA 1LT4D 1J8IA 3HP3A 3URYA 5M3FG 3OSOA 2EJMA 5CV8A 4A93H 3NK9A 1ENFA 3HKSA 4ME5A 4LF6L 4C3IH 4Y7NB 4RKLA 1I4PA 1SSOA 5CV4A 3U9SA 1B53A 1NMFA 2B2TC 1E24A 4K5XA 5GQOA 5GROA 5AJ3Q 1H95A 1NBWA 1CKNB 4H13C 1I6HB 4P72A 4XT3B 3TQYA 3TRZA 4JI1L 2ATWA 2MPMA 3C2PA 4LAAA 4KLKA 2UUCQ 4B3TQ 1PH9A 4A3FB 4KKTA 2SNSA 3KYHC 3W1BA 1C4QA 4LUVA 3G48A 4AIMA 2JA8H 3SDZA 3M3YB 3H6MA 4HIOA 4A3LH 2ZXRA 1A62A 1N34L 1DCZA 1LT6D 4OO1I 5JJIA 2R6GA 2Q8IB 1ML0D 4H44C 3S15B 2RCFA 2KVMA 3Q8DA 4IOCA 1FGBD 3CCQA 3EA6A 3ND8A 2Q8RE 1RDPD 2QF7A 3QOLA 3SHLA 1PHJA 4R9WA 4JI7Q 2NYZD 4HJ9A 1CHQD 1S5FD 5GAHC 1FD7D 4NXMQ 4DAYA 4A3GB 1S72A 5JPMC 3BS1A 1PH2A 3SVMA 5DM73 3IFDA 5C3EB 1XNQL 3M4YA 2AWNA 2XWBB 1WD1A 4FDBA 3RZOH 3M4OH 2R7DA 1PH7A 1VQJA 1CUKA 3LNNA 3PQIA 4ZK9B 4G7OC 3HOZG 5CBAE 4LF4Q 2ASBA 4KI0A 4DV5L 4QMGA 1Q46A 5M3MB 3M4PA 5IYCH 1KC8C 2KQ3A 4DAMA 1X54A 4B08A 1FVIA 1STBA 3TZDA 2D0OA 3OW7A 3H0GG 1MBYA 1W3SA 2K52A 5ELEA 1SROA 2VUMG 1KQSA 1LLRD 2PI2A 2G9HD 4DR7L 1B8AA 4KY7A 1BF4A 1WVLA 2AUJD 1CTMA 5EKLA 3VYTA 1AE2A 4C2MB 1EWHA 1HHVA 3PMFA 1BCPF 5HY6A 1EIYB 2F0HA 3ER0A 2ZTCA 1UWVA 1N32Q 1GJXA 4ULLA 2VQFQ 4K5VA 2JP1A 3CCLA 3S14B 4LJZC 2OCEA 5J22A 3KF6B 4JI3Q 4PNYA 4L5SA 4R4QA 2KHJA 1B2TA 3MZ5A 1JORA 3VR2A 5KRUA 3S1RB 2BDNA 1S4ZA 2Z6BA 3TBIB 2WFWA 1UEAB 4K2LA 3GTJB 1NTGA 3MA2B 4JK1C 3VA5A 3I4NH 4NDXA 4X3TA 5K36H 1K8MA 2HQEA 1X65A 3STBC 2RDHA 3UE0A 4DUZL 2B63H 4KMUC 1AFPA 5BN5A 5IGGA 4XTCS 3TZUA 1K83B 1EY6A 2WKCA 3GV3A 5TSSA 3E6ZX 3LX0A 1EU4A 3NUCA 3SGIA 1VQ7A 2LXKA 4RG1A 2OQKA 3HOVH 1OXXK 3GP7A 2CFMA 1PZJD 4ZAIA 1TWHH 1XNRQ 5DAUA 1STNA 3PF4A 2K32A 5C4JB 4DR1Q 2RHQB 5ELBA 2K03A 4C1NI 3B6YA 4LF7L 1EOVA 2MO0A 1FJGQ 3MXNB 2O5JC 3AYHB 4DNRB 4DV0Q 1PTOC 2RKSA 4KTAA 4F8MA 1SNCA 5A2QE 2B2VA 2DY7A 3S1QB 1HCZA 1HQMC 1L1OC 3NPPA 4DPGA 4A3JH 4LFAQ 4DV6Q 4XXEA 3NTIA 1LT5D 3PO3G 4GLVB 3RNUA 1WCMB 1CQFA 2VS1A 2F3VA 1GUOA 1MI2A 5KIXA 2B2UA 3PIPA 3HOUB 1YHBA 5JEAG 3VYRA 1W6KA 1RKNA 1SE2A 5M3FH 1HFNA 1O7YA 4JV5L 4M1UB 4QGUA 2ID0A 2UXBQ 3R8BA 4O2DA 5D3IB 5IGCA 1XTCD 5HURA 2CCZA 2HHHL 1ZYRC 2F0QA 1F2MA 3OIPA 3NBIA 3K81C 1KXLA 1E1TA 3K5OA 1N36Q 4NXNQ 3UI2A 3OTOQ 4FNFA 1TQOA 2EJFC 1PH6A 1PVOA 4AQYQ 3S9WA 1L0XB 3KF8A 1EZ8A 4F7XA 1LTID 4FF1A 3RUZA 3TP6A 4L5RC 4DNTB 1JOOA 1VQGA 2R7FA 1RIPA 2R93G 1G2TA 3HKZG 2B29A 4JW0A 4R4IA 4GKKQ 3GTLH 1QB5D 1VS0A 2PMZE 1LV9A 2A6ED 4IUUA 1QVFA 1OTCA 2R7ZG 4NB3A 4DFAA 2IWHA 3T4AC 4DA2A 1D1KA 4IO9A 1SYDA 1V8QA 4UP7A 5LMUQ 5C3XA 1D1IA 1TWCH 2LSSA 3HS0C 4L5TA 4A3FG 1TU2B 3HOYB 1U4MA 1CFMA 1Z9FA 3PIP3 1PTOB 1WYDA 4LF9Q 2AKWB 3RN2A 4A3DB 3AU7A 1UE7A 1L1OB 2FJ2A 1IYUA 1IBKQ 2N78A 5JVG3 1JCKB 1HNWQ 1A3TA 1FNWA 3N6RA 4Y52H 1BCPD 2V1CC 3G7LA 2ZM6L 4DR4Q 2D0PA 4A75A 3HOZH 4K6DA 1WFQA 2VQEQ 4DV4Q 4LMQD 2EY2A 2VB3X 1Y1VH 5ELDA 1EFWA 3GDEA 1G2SA 2IJ0A 1SNPA 1VQEA 4GS3A 2ICIA 4BA2I 1V1OA 4RCNA 2DJGC 2N55A 3SK4A 1EEID 5I2XA 2HCCA 1S5DD 1U5KA 3TP5A 2RVLA 2BH2A 3WDNA 1LTBD 4A3GG 1NJIC 1KNAA 2RHSB 3ZYYX 3QG1A 3J81j 1A0IA 2VUMH 5C3EG 3GD7A 5JOBA 1VQOA 2O2LD 2QW7A 5D65A 1IW7C 2MP1A 4FXGC 3PO2B 5E4XA 3OIQA 3U4VA 4KKUA 5GADC 2N3SA 1HNXL 2KEEA 4IN3A 2I07B 2OQ0A 2PMZB 4MNOA 3UDFA 5M3MG 5JJZA 2NVQH 1VQIA 3OMCA 2NN6G 3X3MA 3T1YL 1SBBB 5GAGC 1YNJD 3MXUA 2RA4A 5I4DA 2VZAA 5M5XH 2MNAA 1EU3A 2E5LQ 2E2HB 5JVH3 2KCCA 1D8LA 1E2VA 4DK6C 2VW9A 4JYAQ 1YBYA 1RD9D 1EY7A 2LMCB 5EPJA 5CV5A 1C9OA 3NHHA 1XMOQ 4J1MA 2A74C 3FEWX 4R4TA 2F4VQ 1U4PA 1F9PA 1L0WA 2YV5A 3RLFA 1I3QH 2B8FA 3FVQA 4DR6L 1QUQB 1GUSA 3NBHB 1XXGA 2JK8A 2DY8A 2NVYB 1XMQL 2N49A 4CBVA 1Q82C 2UUBL 2RSOA 3IL8A 3BDLA 4YCUA 2E8GA 1SNMA 4ID6A 2Z6KA 3VR5A 1EQVA 1O80A 1R4PB 5LMNL 3KBXA 2BH8A 2QDLA 1TWGH 2XIWA 4PV1C 2HUGA 3I90A 5CV9A 4ALPA 1NR2A 1Y8OB 3TS2A 3ZJYC 2JYOA 5KNBA 4I7ZC 1E7ZA 4HR7B 3L0OA 4JPBW 4AYBE 1ENAA 4K0KL 2EE1A 1T5EA 2Z6KC 1B3QA 3HGBA 2F0PA 4RFBA 3DWAA 3J81c 3DM3A 4KK7A 2ZXOA 1QG7A 1TKWB 1A3UA 2JA6G 5LL6S 2NN6I 3PO3H 2CKZB 4IUVA 4XDXA 1EYDA 5C0XJ 3E0JA 1UE6A 2NVTB 2I5MX 1PH1A 2UUCL 4YCVA 2F0NA 3BDOA 4B3TL 5IIFA 2PQAB 4CKCA 5CGKA 2C9OA 2EYPA 2PPBC 1B50A 4DV1Q 5T1IA 2D2CC 5JAVA 3PCOB 2K5VA 4QF4A 5FO9B 4LF5Q 3UDXA 4A3KB 2EYJA 3GO5A 4JI8Q 3ULPA 3KDFA 3RZDH 5A35A 5EAYA 4JI6Q 4CJ0B 1MHWC 2F0OA 4JVZA 1X3EA 4X66L 1WCMG 3S1NB 3J81E 1X3GA 1PFSA 2J0TD 3CPFA 1K3RA 5IODA 4JI7L 3HOUG 2F4IA 3J7ZC 3L2PA 2H1EA 2XWJB 2R93H 1PFMA 4BY1B 4NXML 3HEJA 4IALA 5C5LA 1HTPA 2ZJRA 4BY7H 4B3MQ 2M00A 2R7ZH 1JWSD 3A56A 4AYBB 1CKMA 1B1ZA 4K8IA 4OXPA 1VQHA 1B4OA 3U58A 3K8AA 1I4HA 4V190 3A5UA 4LF4L 2MHVA 1CKNA 2EOTA 3OW2A 1R9TH 2Q2IA 1KAWA 4JOIA 1S5BD 3WWVA 3M3YH 3FPPA 1HR0W 4WORA 3PUZA 5KNDA 2EY5A
chains in the Genus database with same CATH topology
1PRTD 3MXPA 2EYLA 4XYOA 1SMYD 4HCEA 4HEDA 3JAML 4XQQA 3Q22A 3Q6SA 5CC4A 4RA8A 2CHBD 1ILPA 3MVVA 1RJTA 1TS4A 2ENBA 2VNUD 4IURA 3T56B 1LTSD 1KTKA 2WB1B 2LS01 4L6TB 1DONA 2EYMA 2PZTA 2D62A 2PW5A 2Z4IA 2L55A 4V0BA 3VYUA 3DHQA 1KLUD 3IFTA 1VMPA 3MAQA 1QNKA 2L4NA 1Z47A 1U4LA 4LK1C 2NN6H 4HMIA 2K7VA 3I4MB 2A6HC 1BR9A 2B2TA 1A6XA 1CZWA 1OXUA 4PQXA 1BNZA 2BOSA 3P20A 4Q0FA 3GTKB 5CV7A 1PDQA 1QWYA 5EJWA 5G3LD 4Q5VA 3SK6A 3K57A 2BCOA 2JXMB 3A8JE 3ERQA 1SXTA 2EDGA 3W3AA 5BN3A 3Q24A 2BDOA 3VR3A 1QE6A 2V4DA 1LTAD 3PUVA 3X3NA 4I65A 2A5HA 1MGSA 4XYQA 1GOZA 1TWAB 1G6ZA 5EKKA 2K33A 1CQVA 3GTPB 1XX8A 3BVGA 2F0DA 1AW7A 1SDFA 3D4WA 3OWEB 3NQTA 3RMHA 1H9JA 1I50B 4DF7A 1OO9B 4OGQC 3M7NA 1STAA 1K8OA 4C3HB 2A68C 1Q1BA 3F2UA 2NUCA 1VDZA 3VR6A 1ILQA 4K6LA 1EYAA 3NSWA 2SDFA 3W2DA 4ZKBB 1LT3D 3A7LA 4NKLA 3K6OA 3MXNA 4KD4A 3DEPA 4C3JB 3K5NA 1V1PB 1B9NA 3S17B 1ZXTA 4XQJA 5C44B 2AUKA 1IHZA 2JE6I 1PTOF 2R92B 1IL8A 1A3VA 3I4LA 3EQLC 3KLRA 2IT1A 2PO4A 3E5SA 1JOKA 2QEJC 1Y8NB 4P2CB 3C3LA 3OHXC 1F9QA 3SR1A 3H3VC 1OXSC 3BDCA 3MWYW 4C56C 1JICA 1NCVA 1EQTA 1BQQT 3NTHA 3GTOB 2EYHA 3NQIA 1BO0A 1H9MA 3D4DA 2SEBD 1GHKA 5EQ0A 5CYUA 2KHSA 2B39A 3J7AF 1Q1EA 2FMMA 2NVXB 2OXPA 4R8IA 4C1NK 5A2QL 1TT2A 2QKIC 1CK1A 4IFDJ 5JPNC 1PTOH 2L1BA 3BG3A 1HUNA 4CHTB 5K5PA 3BZDB 5J1ZA 3GTQB 3DMUA 3FPUB 1SFOB 1WTVA 3K5LA 2J7ZA 3BYYB 1XYIA 3TDQA 1TVXA 2L12A 2NZ1D 4N9TA 1B44D 3P75A 3FRPB 2F0IA 1X3PA 3CKIB 2BE5C 1O78A 1LO5D 5ELFA 2Z4HA 4MIUA 4RHRA 3H91A 2XN9C 2JEAI 3H09A 1WTWA 2WIIB 3KUPA 2L9HA 1QCBD 3V96A 3AMUA 3M85A 4QUCA 3OWFA 5IOCA 4HSPA 4RHSA 5FLXE 2NWGA 1ZEQX 1BCPC 4BA1I 5J39A 1CM9A 3DUZA 2EZVA 4OIKA 1V43A 4FF3A 4EQOA 2AQ3B 3H94A 1GHJA 3GV6A 2DNCA 1TS2A 2K04A 4KV6A 1IKLA 2E2IB 2L5TA 1Y8PB 5COYA 2YU9B 1G291 1H9SB 3MFGA 3OMGA 1HA6A 1PZKD 3NBHA 5KEEA 4RKBA 1FYCA 2A69C 2F0WA 3J80E 1WTXA 1WD0A 1EZ6A 4FP5D 2OEOA 1OXTA 2F0SA 2PW7A 3N52A 2OT2A 1O7LA 1YNND 1D6EC 3A54A 1IYVA 1GUGA 3L3OC 3QOJA 2EYOA 2B63B 5FOBB 2IX0A 2E76C 1KNEA 3K59A 2B2WA 1HTLD 2F1MA 2D9UA 5EPLA 5FO7B 2E74C 4X3UA 4DK0A 5EGTA 3HOVB 4ZKCB 2PYKA 2DN8A 5C5MA 4F88A 3D6WA 2JA7B 3QWNA 1EWCA 2WKDA 4C3HG 4XQNA 5NUCA 4A3MB 2B2WC 1BCPB 1NAPA 1STEA 5IT9E 1CHPD 1DD2A 2OF1A 3GQBA 3LWUA 5C0XG 5I6YA 1JOQA 4RWSC 3S2DB 4B9WA 5DM63 1E0BA 4DAVA 4A3JB 3DWQA 3I91A 2HDMA 2JSOA 3LWEA 1EEFD 4DXFA 4R8NA 4EGVA 1DOLA 3NE5B 4QUFA 3I8ZA 2BA1A 4FF4A 3G6JB 2F0TA 1DOMA 3PIO3 1STHA 1F9SA 4PMWA 2VB2X 2M2LA 1C48A 4PMCA 1WTOA 1LTGD 4UDUC 1PZID 3V05A 4RGMA 2F0GA 3OOCA 3NXWA 4U68A 2F0VA 4IUPA 4ZRZA 3QJYA 1X32A 2EVBA 1T5XD 3T13A 1HRJA 2EY1A 1CT1D 4KJOA 2F0FA 2X69A 1JE4A 2KOLA 4FF2A 2MUYA 3L7ZC 4Z9CB 1EFID 3EVQA 4DGZA 2E75C 1MSGA 5DNFA 4A3BB 5EPKA 3J81L 2CW0C 4XT1B 4KD3A 2LY7A 3BVMA 4OL7A 2TSSA 1RODA 1KDCA 1B9MA 5JEAH 4XIGS 5EBDA 1Y1VB 1M4VA 1LTRD 3M7GA 4DAPA 2B2YA 1PRTC 1ONLA 3HRZC 5CORA 1SMYC 1KABA 2AWOA 5E3FA 1HPCA 5IGBA 5KYIA 1U4RA 4B9XA 4TKOB 3D6CA 1BOSA 3WOEA 2RDGA 2B2YC 5D14A 4K2KA 1QNUA 1BBXC 2MJ8A 5C6AA 5ISRA 1CA6A 1TIID 5IGEA 2NVQB 2I46A 3FDTA 1AP0A 2K1BA 1BUVT 1STYA 1AN8A 4IZ8A 1BXTA 2O4XA 4L8JA 4G4KA 1QOHA 2XNAC 3R2IA 1UNSA 1HA5A 5M9OA 1PMRA 2SOBA 1RCVD 1SYFA 1ICWA 4EVOA 2ZXPA 1ENCA 4CKBA 1NSNS 5I6WA 1ESRA 4ILWA 3RD4A 1HXYD 4CJ1B 5E4WC 1WTPA 3T16A 1I3QB 1SNQA 5FK9C 4HTHA 4J8QA 1F77A 1KDAA 1PFNA 4DU9A 3QB3A 1GUTA 1Q8IA 1F2YA 1TWGB 3SXHA 1KDBA 2F0LA 3IKJA 1PRTB 3I3CA 2DNEA 3U9OA 4DXGA 4H0LC 1HFGA 5DEHA 4QB4A 2Z1CA 4RH6A 4QCLA 3SE0A 3A8IE 1JWMD 1V1PA 2NTSA 4IUQA 4O1NA 5I9OA 4KHVA 1QILA 1ZKOA 2NB0A 4OO1G 1A2TA 3AB9A 2C5CA 3C1EA 2IW3A 2E2DC 4L63B 1FNVA 2KUMA 2NBFA 3TSSA 1TY0A 1AEXA 3PUXA 5IGFA 1EY5A 1GUNA 5C4ZA 1G91A 1II3A 5F2DA 1KAAA 1NUCA 1F2LA 4ZUJA 3Q0AA 3NP8A 1RHPA 4K14A 2KJXA 1UAPA 1G8ZD 3D8GA 2X6GA 2R93B 3HKZB 2GA4B 5LHY1 4RGOS 1DYQA 4BY7B 2R7ZB 1CZGA 2VXWA 4BBSB 3KBGA 3I72A 4CJ2C 2O5IC 1SYBA 3A55A 5I2YA 3MFYA 1O7ZA 1R9TB 4M8AA 4FO2A 1JR0D 1LABA 1VF5C 3K58A 3FMCA 2A6HD 4HCSA 1I4RA 4H7BA 5CMDA 2K5QA 4IFDG 1L0YB 1ET9A 1F2ZA 2PZUA 1W6JA 4F87A 2JEBI 1EYCA 1RTOA 4K5WA 5M5WB 2AQ1B 1AZQA 1JWUD 2PZWA 1EIGA 3TP8A 1ESFA 1SYCA 2PCFB 1STGA 1TY2A 2PNRC 2FINB 4DK1A 1DZ1A 3KK7A 4FXKC 3IAYA 2D5DA 2EJGC 5BN4A 1SJED 3HZXA 4N9PA 3WOFA 1I6VC 4WJWA 4A3IB 1RF2D 3S1MB 4ABNA 2SNMA 5FO8B 2Y0SB 5AFWA 5C4XB 2F0MA 2IL8A 4BS9A 2LKVA 2E2JB 2XVSA 2N88A 2QCPX 1A2UA 2IX1A 2A68D 4E6IA 4A93B 4IFDI 3MXGA 1TR5A 4C3IB 2F03A 4DN4M 5KNCA 5EKIA 1H9SA 2FMCA 1SYGA 2HDLA 4KKSA 5HGTA 3DM1A 2JA8B 3K5MA 5EBCA 3MC0B 1PFBA 1EY8A 4ZYSA 3NTKA 4U673 1CI3M 1Y69U 2EXZA 3BVZA 1B3AA 1EY0A 3SEBA 1WTQA 4KHZA 5CV6A 2JA6B 5C4HA 2QILA 2L0CA 4RAUC 5FLXL 4HSVA 4YIJA 4EQNA 3CHBD 1QJOA 3CRLC 3ONAB 4OO1H 2WACA 1J9OA 2A6EC 1UUPA 2K05A 3NWTA 5KYLA 3L9AX 3RZOB 3M4OB 3T53B 4RGNA 3OPOA 3C1FA 2RSNA 5FKAC 2F0EA 1WTRA 1YNNC 1VMCA 1ET6A 5C3WA 1SNOA 2F0UA 4KY5A 1MSHA 3J80L 2R3ZA 5E1FA 1IKMA 3R2TA 2B2VC 1XWEA 5M5YB 2TMPA 2WAQB 4HAEA 1D5ZC 2Z8LA 2NTTA 4HMJA 1SE3A 1EIHA 4PMBA 1JQYD 4OHJA 2B2UC 5CR3A 1R4QB 1I4GA 1TS5A 1TS3A 2CQAA 1U9RA 4TQUS 1PTOD 3I4NB 3O13A 4RCOA 3KLSX 2BE5D 3PUWA 2KECA 4IFDH 2K5WA 4RGTA 3PV0A 1YNJC 5CBEE 5KGUA 2MGSA 2RBMA 5IT9L 1SEBD 4ZQ3A 3S2HB 1X3QA 2X6LA 4WRDA 1FR3A 3ND9A 1VCIA 3MHBA 3QO2A 2WV6D 1LTTD 3PUYA 3QIAA 1JC7A 1TWHB 3CQZB 3SK8A 4FVMA 2BA0A 3DEOA 3DXJC 3I70A 1ZYRD 1SE4A 4KN7C 3R3OA 1EL0A 3EFXD 3MEHA 4O42A 5D3DA 1AZPA 1D5MC 1SJHD 4EQPA 3T51B 5JEAJ 2L11A 4C3JG 1Z6HA 3NWSA 4TSSA 3CRKC 2K6AA 4QIWB 1PXUA 1SAPA 2B8GA 2K01A 2A69D 1H9RA 1PRTF 3VR4A 1EY4A 4MHEA 3GTGB 5M3FB 1HUMA 3I73A 1BDOA 3S16B 2KA7A 3J7YW 4NMZA 4FYDA 4IQZA 2EYFA 2RDFA 2PQEA 1FNUA 4FXDA 2G9DA 3HOXB 2AQ2B 2XSCA 4IUTA 3A8KE 3SK5A 1VF7A 4MN3A 4C3IG 2A73B 2ZT9C 4NP5A 3GTLB 2K5DA 1EOTA 1HQRD 4KY6A 3Q23A 3P7JA 5C0XI 1SNDA 1IW7D 1TWCB 2Q8TA 3A7AB 1PLFA 4TRDA 1GXDC 1Q3LA 2ICEC 2HCIA 4JBWA 5G3LF 1GUWA 4WFN3 4KN4C 2M9VA 1I4QA 3HOZB 1D2BA 4G57A 1I4XA 1F9RA 1DXMA 2IX3A 4S3SA 4J6HA 4ZUIA 3BYTB 2F0JA 3H0GB 3KLSA 2J4XA 1D5XC 2VUMB 1OXVA 3TMEA 2LFNA 2FHTA 2K28A 2IPKD 1LACA 5IGDA 2KEDA 3VA7A 3D31A 4IUNA 1E2WA 4BWGB 2RQXA 1KLGD 3EJIA 1E2ZA 2WINB 1Z7TA 4UAIA 5M5XB 3VYSA 2XRSD 2EY6A 1EY9A 2KCNA 4GZYC 5LL6X 1A15A 3DWPA 2CW0D 2F3WA 1S5CD 2EPBA 1TWFB 1MD2D 1H9KA 2YYZA 3V2TA 4G7ZC 3D3RA 3MTSA 5T1GA 2XRQD 4BBRB 4X3SA 5K36G 3ITPA 2WP8J 3TN2A 2R61A 1Y1WB 4X3KA 5I9PA 3EROA 3HG9A 5C0XH 4NW2A 3TP7A 2FFKB 3J7AV 2JA5B 1S5ED 3R93A 4KJNA 1DOKA 3FKIB 3PO3B 1DM0B 4ODGA 4A3EB 3K0YA 1NR4A 3C46A 4CGYB 2H4OA 4CKEA 1Q90A 1C8CA 5ELCA 1SYEA 3GTMB 3JAME 4K8JA 2QDBA 4HN7A 2F0KA 3HOWB 3K7AB 1Q12A 1RTNA 3RZDB 1M8AA 3D4RA 1PYWD 4G7HC 4OIJA 3CU7A 1CA5A 4ZLTF 1DJRD 2CVRA 3P1HA 1JB3A 1LT4D 1J8IA 3HP3A 3URYA 3OSOA 2EJMA 5CV8A 3NK9A 1ENFA 4ME5A 4Y7NB 3U9SA 4RKLA 1I4PA 1SSOA 5CV4A 1B53A 2B2TC 4K5XA 4H13C 1I6HB 4XT3B 2MPMA 3C2PA 4LAAA 4A3FB 4KKTA 2SNSA 1C4QA 3SDZA 3M3YB 3H6MA 2ZXRA 1DCZA 1LT6D 4OO1I 2R6GA 2Q8IB 1ML0D 4H44C 3S15B 2KVMA 1FGBD 3EA6A 3ND8A 2Q8RE 1RDPD 2QF7A 3QOLA 3SHLA 4R9WA 2NYZD 1CHQD 1S5FD 1FD7D 4DAYA 4A3GB 5JPMC 3BS1A 3SVMA 5DM73 3IFDA 5C3EB 3M4YA 2AWNA 2XWBB 1WD1A 3LNNA 4ZK9B 4G7OC 5CBAE 4KI0A 4QMGA 5M3MB 2KQ3A 4B08A 1STBA 3TZDA 3OW7A 1MBYA 5ELEA 1LLRD 2G9HD 4KY7A 1BF4A 1WVLA 2AUJD 1CTMA 5EKLA 3VYTA 4C2MB 1EWHA 1HHVA 3PMFA 1BCPF 2F0HA 1GJXA 4ULLA 4K5VA 2JP1A 3S14B 4LJZC 5J22A 4PNYA 1B2TA 3MZ5A 1JORA 3VR2A 5KRUA 3S1RB 2BDNA 1S4ZA 3TBIB 1UEAB 4K2LA 3GTJB 3MA2B 4JK1C 3VA5A 4NDXA 4X3TA 5K36H 1K8MA 2HQEA 2RDHA 4KMUC 1AFPA 5BN5A 5IGGA 4XTCS 3TZUA 1K83B 1EY6A 2WKCA 3GV3A 5TSSA 3E6ZX 3LX0A 1EU4A 3NUCA 1OXXK 3GP7A 1PZJD 4ZAIA 5DAUA 1STNA 2K32A 5C4JB 5ELBA 2K03A 4C1NI 2O5JC 4DNRB 1PTOC 2RKSA 4KTAA 4F8MA 1SNCA 5A2QE 2B2VA 2DY7A 3S1QB 1HCZA 1HQMC 3NPPA 4XXEA 3NTIA 1LT5D 1WCMB 1CQFA 2F3VA 1GUOA 1MI2A 5KIXA 2B2UA 3HOUB 5JEAG 3VYRA 1W6KA 1RKNA 1SE2A 1HFNA 1O7YA 4M1UB 2ID0A 3R8BA 5D3IB 5IGCA 1XTCD 5HURA 1ZYRC 2F0QA 1F2MA 3OIPA 3NBIA 3K5OA 3UI2A 4FNFA 1TQOA 2EJFC 3S9WA 1L0XB 3KF8A 1EZ8A 4F7XA 1LTID 4FF1A 3RUZA 3TP6A 4DNTB 1JOOA 1G2TA 1QB5D 1LV9A 2A6ED 4IUUA 4DFAA 2IWHA 3T4AC 4DA2A 1D1KA 1SYDA 1V8QA 5C3XA 1D1IA 3HS0C 1TU2B 3HOYB 1U4MA 1CFMA 3PIP3 1PTOB 4A3DB 3AU7A 2FJ2A 1IYUA 5JVG3 1JCKB 1A3TA 1FNWA 3N6RA 1BCPD 3G7LA 4K6DA 4LMQD 2EY2A 2VB3X 5ELDA 1G2SA 2IJ0A 1SNPA 2ICIA 4BA2I 1V1OA 4RCNA 2N55A 3SK4A 1EEID 5I2XA 2HCCA 1S5DD 3TP5A 2RVLA 3WDNA 1LTBD 1KNAA 3ZYYX 3QG1A 3GD7A 5JOBA 2O2LD 5D65A 1IW7C 2MP1A 4FXGC 3PO2B 5E4XA 3OIQA 4KKUA 2KEEA 4IN3A 2I07B 2PMZB 5JJZA 3OMCA 2NN6G 3X3MA 1SBBB 1YNJD 3MXUA 2RA4A 5I4DA 1EU3A 2E2HB 5JVH3 2KCCA 1E2VA 1RD9D 1EY7A 2LMCB 5EPJA 5CV5A 3NHHA 4J1MA 2A74C 3FEWX 1U4PA 1F9PA 3RLFA 2B8FA 3FVQA 1GUSA 1XXGA 2DY8A 2NVYB 4CBVA 2RSOA 3IL8A 3BDLA 1SNMA 4ID6A 3VR5A 1EQVA 1O80A 1R4PB 3KBXA 2XIWA 4PV1C 2HUGA 3I90A 5CV9A 1NR2A 1Y8OB 2JYOA 5KNBA 4I7ZC 4HR7B 1ENAA 2EE1A 1T5EA 4RFBA 3HGBA 2F0PA 3DWAA 4KK7A 2ZXOA 1QG7A 1TKWB 1A3UA 5LL6S 2NN6I 4IUVA 4XDXA 1EYDA 5C0XJ 3E0JA 2NVTB 2F0NA 3BDOA 5IIFA 4CKCA 5CGKA 2C9OA 2EYPA 2PPBC 1B50A 5T1IA 2D2CC 5JAVA 4QF4A 5FO9B 4A3KB 2EYJA 3GO5A 5A35A 4CJ0B 2F0OA 3S1NB 3J81E 2J0TD 5IODA 2F4IA 2H1EA 2XWJB 1PFMA 4BY1B 3HEJA 4IALA 5C5LA 1HTPA 2M00A 1JWSD 3A56A 4AYBB 1B1ZA 4K8IA 1B4OA 1I4HA 4V190 2MHVA 2EOTA 1S5BD 3FPPA 4WORA 3PUZA 5KNDA 2EY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRT D;  1ET6 A;  3BYT B;  3BVG A;  1JCK B;  1FNW A;  1RF2 D;  1AW7 A;  1BCP D;  3MFG A;  1LTG D;  4UDU C;  5ELB A;  1AN8 A;  1PZI D;  2J4X A;  3OWE B;  3V05 A;  4RGM A;  1PZK D;  1D5X C;  1BXT A;  1G8Z D;  3R2T A;  4RFB A;  1CK1 A;  2XNA C;  3DWA A;  5ELC A;  1PRT F;  3R2I A;  1PTO H;  1HA5 A;  1UNS A;  2IPK D;  1PTO C;  5ELD A;  2CHB D;  2IJ0 A;  3BZD B;  1RCV D;  2ICI A;  1D5Z C;  1TS4 A;  1V1O A;  1T5X D;  1LT5 D;  4RGO S;  2Z8L A;  1EEI D;  1DYQ A;  2NTT A;  1S5D D;  1CT1 D;  1SE3 A;  1D6E C;  1LTS D;  1HXY D;  1KTK A;  1JQY D;  1LTB D;  1PYW D;  4OHJ A;  4L6T B;  3BYY B;  4K6L A;  4BWG B;  5ELE A;  3W2D A;  5FK9 C;  1HTL D;  1I4G A;  1LT3 D;  4Z9C B;  1EFI D;  1KLG D;  1TS5 A;  2O2L D;  1KLU D;  1LLR D;  1SE2 A;  2G9H D;  1FNU A;  1DJR D;  2XRS D;  1TS3 A;  1B44 D;  1PTO D;  1LT4 D;  1F77 A;  3URY A;  1JR0 D;  2AQ2 B;  3O13 A;  5D3I B;  4RCO A;  3R8B A;  1BCP F;  1V1P B;  1XTC D;  1ENF A;  3KLS X;  1I4P A;  1EWC A;  3DWP A;  1LO5 D;  3BVM A;  5ELF A;  1SBB B;  1PRT B;  4RGT A;  1S5C D;  2TSS A;  3MC0 B;  1I4R A;  4ZYS A;  5I4D A;  1L0Y B;  4RHR A;  1BCP B;  1PTO F;  1ET9 A;  1MD2 D;  1SEB D;  2XN9 C;  1HQR D;  3BVZ A;  1EU3 A;  4DXG A;  1STE A;  1CHP D;  1L0X B;  3SEB A;  1LTI D;  2WV6 D;  2QIL A;  2AQ1 B;  1RD9 D;  4RH6 A;  1JWU D;  1LTT D;  1M4V A;  1JWM D;  2XRQ D;  1LTR D;  3CHB D;  2QEJ C;  2RDH A;  1V1P A;  2NTS A;  1PRT C;  1ESF A;  3DWQ A;  4RHS A;  1JWS D;  1SXT A;  4O1N A;  1QIL A;  1LT6 D;  1TY2 A;  1B1Z A;  1UUP A;  1BCP C;  1EEF D;  4DXF A;  4C56 C;  2R61 A;  1I4H A;  1SE4 A;  1LTA D;  1XXG A;  5TSS A;  1FGB D;  1EU4 A;  2AQ3 B;  3EA6 A;  1I4Q A;  4L63 B;  3EFX D;  1FNV A;  1RDP D;  1S5B D;  1SJE D;  4RGN A;  5D3D A;  3TSS A;  1GOZ A;  1TY0 A;  3GP7 A;  1D5M C;  1S5E D;  1SJH D;  1TS2 A;  2RDG A;  1PZJ D;  1I4X A;  1PTO B;  1CHQ D;  1S5F D;  1CQV A;  5FKA C;  1FD7 D;  2SEB D;  4TSS A; 
#chains in the Genus database with same CATH topology
 1PRT D;  1I94 Q;  3BJU A;  3MXP A;  3S15 H;  1UE5 A;  2EYL A;  3OYY A;  4XYO A;  1SMY D;  4P71 A;  4AH6 A;  4HCE A;  4HED A;  3JAM L;  2ZTE A;  4HJ5 A;  2K14 A;  4XQQ A;  3Q22 A;  4UP9 A;  3Q6S A;  5CC4 A;  1N32 L;  4RA8 A;  1LUZ A;  2CHB D;  2VQF L;  1PH4 A;  1ILP A;  3MVV A;  1RJT A;  1TS4 A;  3CCM A;  4JI3 L;  3VDY A;  2ENB A;  4A3G H;  2VNU D;  4JI2 Q;  2Q2T A;  4IUR A;  3T56 B;  1LTS D;  1KTK A;  2WB1 B;  2LS0 1;  4L6T B;  1DON A;  2EYM A;  1P8L A;  2D62 A;  2PW5 A;  2PZT A;  2Z4I A;  2L55 A;  4V0B A;  2N8N A;  3VYU A;  4PZ6 A;  3DHQ A;  1KLU D;  3IFT A;  1VMP A;  3MAQ A;  1QNK A;  2L4N A;  1Z47 A;  1U4L A;  4LK1 C;  2NN6 H;  1GO3 E;  4HMI A;  4GOP C;  2K7V A;  3M9B A;  4P74 A;  3I4M B;  2A6H C;  1BR9 A;  2Q2H A;  3S1M H;  2B2T A;  3CAM A;  2HIV A;  3PF5 A;  4DR3 L;  1A6X A;  1CZW A;  1OXU A;  4PQX A;  3F2B A;  1BNZ A;  2BOS A;  3P20 A;  4Q0F A;  3GTK B;  1VQL A;  5CV7 A;  5IWA Q;  2IHF A;  3KJP A;  3PO2 G;  1PDQ A;  1QWY A;  5EJW A;  3MEF A;  5G3L D;  4Q5V A;  3SK6 A;  3K57 A;  2BCO A;  1IXR A;  2JXM B;  3A8J E;  3ERQ A;  1SXT A;  2EDG A;  1YI2 A;  3W3A A;  4YHH Q;  5BN3 A;  3Q24 A;  1FGU A;  1KRT A;  2BDO A;  3VR3 A;  3KF6 A;  1QE6 A;  4DK3 C;  2V4D A;  1HR0 Q;  4DV0 L;  1LTA D;  3PUV A;  3X3N A;  4LFA L;  4I65 A;  2A5H A;  1MGS A;  4DV6 L;  4XYQ A;  4POF A;  1EQR A;  1GOZ A;  1TWA B;  1G6Z A;  3HOX G;  5EKK A;  2K33 A;  1CQV A;  1K83 H;  3GTP B;  1KIX A;  1XX8 A;  3BVG A;  2F0D A;  1AW7 A;  1SDF A;  1N33 Q;  3D4W A;  4X64 Q;  3OWE B;  3NQT A;  3RMH A;  2DJF C;  1H9J A;  1I50 B;  2Y0S E;  4R1J A;  1QZG A;  2JA6 H;  4DF7 A;  2AHO B;  2NZO A;  4B3S Q;  1OO9 B;  1HNZ Q;  4OGQ C;  3M7N A;  1CSQ A;  1STA A;  1K8O A;  4C3H B;  2A68 C;  3J80 i;  1Q1B A;  4NXN L;  3CCS A;  4GOP B;  1N36 L;  3F2U A;  2NUC A;  4MZ9 A;  1VDZ A;  4AQY L;  3VR6 A;  4X62 Q;  1AE3 A;  1ILQ A;  4K6L A;  1EYA A;  3NSW A;  2SDF A;  3W2D A;  4ZKB B;  1SE8 A;  1LT3 D;  3A7L A;  4NKL A;  4PZ8 A;  3K6O A;  3MXN A;  4KD4 A;  5IYD G;  3DEP A;  1NE3 A;  4GKK L;  4C3J B;  3K5N A;  1V1P B;  4A76 A;  1N9W A;  1B9N A;  3S17 B;  1WCM H;  1XJV A;  1ZXT A;  3KJO A;  3BZK A;  4XQJ A;  3W5O A;  4J15 A;  5C44 B;  2AUK A;  1IHZ A;  2JE6 I;  3HOU H;  1PTO F;  2R92 B;  1AH9 A;  1IL8 A;  1A3V A;  3I4L A;  4EX5 A;  4LF9 L;  3EQL C;  5M5Y H;  4MTN A;  1YEZ A;  1Q7Y C;  5JJL A;  1Q8K A;  3KLR A;  2IT1 A;  1IBK L;  2PO4 A;  3E5S A;  4A3K G;  1C7Y A;  1HNW L;  3T1H Q;  1JOK A;  2QEJ C;  1Y8N B;  4P2C B;  3EN2 A;  3OHX C;  3C3L A;  1F9Q A;  3SR1 A;  4DR4 L;  4DR2 L;  4IPD A;  3RR5 A;  3G4S A;  4OWT B;  3H3V C;  1OXS C;  3BDC A;  4WJ4 A;  2VQE L;  4DV3 Q;  1YZ6 A;  3MWY W;  4C56 C;  4DV4 L;  1JIC A;  1NCV A;  1I5F A;  2NZH A;  3J7A 5;  1EQT A;  1IYJ B;  4B3R Q;  1G6P A;  1RL2 A;  1BQQ T;  1K8G A;  1EYG A;  3NTH A;  4BY1 G;  3GTO B;  2EYH A;  3A0J A;  3NQI A;  1BO0 A;  1H9M A;  2I0Q A;  3IRB A;  3D4D A;  2SEB D;  1GHK A;  2K5H A;  2YTV A;  5EQ0 A;  5CYU A;  2KHS A;  2B39 A;  4AYB G;  3J7A F;  1VQ5 A;  1Q1E A;  2FMM A;  2NVX B;  3S2H H;  2OXP A;  4R8I A;  3UDG A;  3K0X A;  3NEL A;  4C1N K;  5A2Q L;  1TT2 A;  3PGZ A;  2QKI C;  1CK1 A;  4IFD J;  5JPN C;  1PTO H;  2L1B A;  4LNQ A;  3BG3 A;  4GLX A;  1J6Q A;  4CDD C;  1HUN A;  3F2C A;  1MJC A;  4CHT B;  5K5P A;  3BZD B;  5J1Z A;  3GTQ B;  3CQZ H;  4BBR G;  1L1O A;  1NMG A;  3DMU A;  3FPU B;  1SFO B;  2E5L L;  1WTV A;  4LWC A;  5IP9 H;  3K5L A;  2J7Z A;  3BYY B;  4GN3 B;  1XYI A;  3TDQ A;  4JYA L;  2UUA L;  1TVX A;  5FLX c;  1Y1W G;  2L12 A;  1HZB A;  4JI0 Q;  2NZ1 D;  3CF5 A;  4N9T A;  1B44 D;  1XMO L;  3P75 A;  2UU9 Q;  1BBW A;  2F4V L;  2UXC Q;  2JA5 G;  1E22 A;  2F0I A;  3FRP B;  1X3P A;  3CKI B;  2BE5 C;  1J5E Q;  1O78 A;  1LO5 D;  1N8R C;  3FKI G;  5ELF A;  2Z4H A;  3E0E A;  4MIU A;  2WB1 G;  4A3E G;  1W2B A;  4RHR A;  3H91 A;  1C0A A;  2XN9 C;  2JEA I;  3PO2 H;  3H09 A;  1WTW A;  2WII B;  3KUP A;  2L9H A;  4IPG A;  5IYB H;  1QCB D;  3V96 A;  3AMU A;  3M85 A;  3GTG H;  4QUC A;  5IP7 G;  2K75 A;  3OWF A;  3S16 H;  5IOC A;  3J80 c;  4DV2 Q;  3HOW G;  4HSP A;  4RHS A;  1M1K C;  5FLX E;  2NWG A;  1ZEQ X;  4IOA A;  1BCP C;  4BA1 I;  1SR3 A;  5J39 A;  1X9N A;  4LF8 Q;  1CM9 A;  2E2H H;  3DUZ A;  1N34 Q;  2EZV A;  4OIK A;  1V43 A;  4FF3 A;  4EQO A;  2AQ3 B;  3H94 A;  1PH5 A;  1GHJ A;  3GV6 A;  4JG2 A;  3HOX H;  5IE8 A;  2DNC A;  1TS2 A;  3AFP A;  2XGT A;  2K04 A;  3J81 i;  2QEX A;  4KV6 A;  1IKL A;  2E2I B;  3E3X A;  2L5T A;  1Y8P B;  5COY A;  4DV1 L;  2YU9 B;  1G29 1;  1HZA A;  4DKA C;  1H9S B;  3MFG A;  3OMG A;  1QUQ A;  4LF5 L;  1PZK D;  3NBH A;  1HA6 A;  4JI8 L;  5KEE A;  3CC4 A;  2KEN A;  4RKB A;  1FYC A;  2A69 C;  2F0W A;  3J80 E;  1WTX A;  1WD0 A;  3F1Z A;  1EZ6 A;  2EXD A;  4JI6 L;  4FP5 D;  5IT9 c;  2OEO A;  1VQP A;  1OXT A;  4KHP L;  2F0S A;  2PW7 A;  3N52 A;  2OT2 A;  1O7L A;  4DV5 Q;  1YNN D;  1D6E C;  3A54 A;  1IYV A;  1GUG A;  3L3O C;  3QOJ A;  2EYO A;  2B63 B;  5FOB B;  2IX0 A;  2E76 C;  2Z9H A;  1KNE A;  1WI5 A;  4JI4 Q;  3K59 A;  2B2W A;  1HTL D;  2F1M A;  3PIO A;  1VQ6 A;  2D9U A;  1K73 C;  5IYD H;  5EPL A;  5FO7 B;  2E74 C;  4B3M L;  4X3U A;  4DK0 A;  4HID A;  1HJP A;  2C35 B;  4IPC A;  5EGT A;  1VQB A;  3HOV B;  4ZKC B;  2HQL A;  1YIJ A;  2PYK A;  2HIX A;  2DN8 A;  4P73 A;  5C5M A;  4F88 A;  3D6W A;  3CC2 A;  3QWN A;  1EWC A;  2JA7 B;  2WKD A;  4C3H G;  2KHI A;  4XQN A;  5NUC A;  4DV7 Q;  4PG3 A;  4IPH A;  4A3M B;  3H0G H;  1QVC A;  2B2W C;  1BCP B;  2PQA A;  1NAP A;  1STE A;  5IT9 E;  1CHP D;  4QJF A;  3CPW A;  4A3K H;  1GM5 A;  1DD2 A;  1Y14 B;  2OF1 A;  3GQB A;  3LWU A;  5C0X G;  5I6Y A;  1I94 L;  1JOQ A;  4RWS C;  2KCM A;  3TRE A;  4A4I A;  3S2D B;  4B9W A;  5DM6 3;  1E0B A;  4DAV A;  4A3J B;  3DWQ A;  3I91 A;  2HDM A;  3S1N H;  2JSO A;  3LWE A;  4N8F A;  1EEF D;  5C44 G;  4DXF A;  4R8N A;  1KL9 A;  4EGV A;  4MTK A;  1DOL A;  3NE5 B;  3ERS X;  2R92 G;  4BY1 H;  4QUF A;  5BR8 Q;  4LFC Q;  1JB7 A;  3I8Z A;  2BA1 A;  4HJ7 A;  4FF4 A;  3G6J B;  4JI2 L;  2F0T A;  1DOM A;  4ZCK A;  3E9I A;  3PIO 3;  2DUD A;  1STH A;  4CDE C;  1F9S A;  1JJG A;  4PMW A;  2VB2 X;  2GVA A;  1TWF H;  2M2L A;  1C48 A;  1MJE A;  4PMC A;  1WTO A;  1LM0 A;  1LTG D;  4UDU C;  1PZI D;  3V05 A;  4RGM A;  2F0G A;  3OOC A;  3NXW A;  1KRS A;  2GVB A;  4U68 A;  2F0V A;  4IUP A;  4ZRZ A;  1PH3 A;  2P5Z X;  4BBR H;  3CC7 A;  3QJY A;  1X32 A;  2EVB A;  1T5X D;  1PH8 A;  3T13 A;  2OTL A;  4JBK A;  4H02 A;  1HRJ A;  2EY1 A;  1CT1 D;  4KJO A;  1K3B C;  4HJ8 A;  2F0F A;  3I56 A;  4IJL A;  1Y1W H;  2X69 A;  5IWA L;  1JE4 A;  2KOL A;  4CDF C;  4FF2 A;  2MUY A;  3L7Z C;  3CMA A;  4Z9C B;  1EFI D;  3EVQ A;  4DGZ A;  2JA5 H;  2E75 C;  4OEL B;  4YY3 Q;  1MSG A;  5DNF A;  4A3B B;  3RLN A;  4YHH L;  4LUO A;  1YVC A;  4DNI A;  3FKI H;  4JV5 Q;  5AJ3 L;  5EPK A;  3J81 L;  1HR0 L;  2CW0 C;  4R4O A;  4XT1 B;  4A3E H;  4KD3 A;  2LY7 A;  3BVM A;  4OL7 A;  2TSS A;  1ROD A;  3AFQ A;  1KDC A;  3G71 A;  1B9M A;  5JEA H;  3AEV A;  4XIG S;  1Q86 C;  4JBM A;  5HGQ A;  5IP7 H;  3GTM H;  3ICE A;  1K28 A;  5EBD A;  3HOW H;  1Y1V B;  3K7A H;  1M4V A;  1LTR D;  3M7G A;  4DAP A;  2B2Y A;  4GKJ Q;  1N33 L;  1PRT C;  4A3C G;  1ONL A;  4X64 L;  2ALY B;  1BVS A;  3HRZ C;  5COR A;  4OX9 Q;  1SMY C;  1KAB A;  4B3S L;  1T9H A;  4JI5 Q;  2AWO A;  1HNZ L;  5E3F A;  4JC0 A;  1HPC A;  1O7I A;  5IGB A;  3CP0 A;  5KYI A;  4JBJ A;  1U4R A;  4B9X A;  4TKO B;  3D6C A;  1BOS A;  3WOE A;  2RDG A;  2B2Y C;  5D14 A;  4K2K A;  1QNU A;  4Y7N H;  4LFB Q;  1BBX C;  2H5X A;  2MJ8 A;  5C6A A;  5FLM G;  4X62 L;  5ISR A;  3CCR A;  1CA6 A;  1TII D;  5IY0 A;  5IGE A;  2EQS A;  2NVQ B;  2I46 A;  3FDT A;  3NEM A;  1AP0 A;  1I6H H;  2K1B A;  1BUV T;  1STY A;  1AN8 A;  1E3P A;  4IZ8 A;  3FHW A;  1BXT A;  2O4X A;  4L8J A;  4OEM B;  4A3F H;  1TWA H;  4G4K A;  1K0S A;  1QOH A;  1ASY A;  2XNA C;  3R2I A;  1UNS A;  1HA5 A;  2HT1 A;  5M9O A;  1PMR A;  2SOB A;  3AQQ A;  1RCV D;  1SYF A;  3GTP H;  1ICW A;  4EVO A;  3RN5 A;  2ZXP A;  1ENC A;  4CKB A;  1NSN S;  5I6W A;  1ESR A;  4ILW A;  3RD4 A;  2F3I A;  2DGY A;  1HXY D;  3K80 C;  4CJ1 B;  5E4W C;  1WTP A;  3T16 A;  1I3Q B;  1I50 H;  1YJ9 A;  1SNQ A;  4YCW A;  2A8V A;  5FK9 C;  4HTH A;  5DLQ E;  4J8Q A;  3T1H L;  1HZC A;  1YHQ A;  1F77 A;  4C3H H;  1KDA A;  1PFN A;  3HOY G;  4DU9 A;  3QB3 A;  1GUT A;  3HKZ E;  1Q8I A;  1F2Y A;  4DV3 L;  4OON A;  1TWG B;  3SXH A;  4A3D G;  1KDB A;  2A1A A;  2F0L A;  3U4Z A;  1SMX A;  3H3V I;  5C3E H;  3IKJ A;  1PRT B;  4GOP A;  2JQO A;  1MKH A;  1JJC B;  2B63 G;  4DUY Q;  3I3C A;  4B3R L;  2DNE A;  3U9O A;  4DXG A;  4H0L C;  1HFG A;  5DEH A;  4CDC C;  4GN4 B;  4QB4 A;  4RMF A;  1NNX A;  2Z1C A;  4RH6 A;  4POG A;  4QCL A;  3SE0 A;  3A8I E;  1JWM D;  5M3M H;  1VQ4 A;  1IBM Q;  1V1P A;  2GN5 A;  2NTS A;  4IUQ A;  2JA7 G;  4O1N A;  5I9O A;  4KHV A;  5C44 H;  2I5H A;  1QIL A;  1ZKO A;  2NB0 A;  4A3M G;  3M4Q A;  1L2F A;  1PA6 A;  4OO1 G;  1A2T A;  1YJW A;  1YNX A;  3AB9 A;  2C5C A;  3C1E A;  2CWP A;  2IW3 A;  2E2D C;  3JC6 6;  4L63 B;  1FNV A;  1XNR L;  4C2M H;  2KUM A;  2NBF A;  3TSS A;  1TY0 A;  1AEX A;  2YTY A;  3PUX A;  5IGF A;  1EY5 A;  1GUN A;  5C4Z A;  1G91 A;  3S14 H;  1II3 A;  5LMN Q;  4DR1 L;  5F2D A;  1KAA A;  1NUC A;  1F2L A;  4ZUJ A;  4JI0 L;  3Q0A A;  3NP8 A;  1RHP A;  3S1R H;  1FJG L;  1EUJ A;  1WTH A;  4K14 A;  2KJX A;  1UAP A;  1G8Z D;  3D8G A;  2UU9 L;  2UXC L;  3GTJ H;  2X6G A;  1J5E L;  4DR5 Q;  2R93 B;  3HKZ B;  2GA4 B;  4BXX G;  3EBE A;  1UE1 A;  5LHY 1;  4RGO S;  1DYQ A;  4BY7 B;  2R7Z B;  2NVX H;  1CZG A;  2VXW A;  2CQO A;  4BBS B;  3KBG A;  3I72 A;  4CJ2 C;  2O5I C;  4P75 A;  3F8T A;  1SYB A;  4N8X 1;  3A55 A;  3MFY A;  5I2Y A;  2UXB L;  1O7Z A;  4DV2 L;  1R9T B;  3GTQ H;  4M8A A;  4FO2 A;  1SRU A;  1JMC A;  1JR0 D;  4X65 Q;  1LAB A;  1X3F A;  4LF8 L;  1VF5 C;  1SFO H;  2EIF A;  3K58 A;  3FMC A;  2A6H D;  4HCS A;  4HJA A;  5C4J H;  3OTO L;  1I4R A;  4H7B A;  5CMD A;  2K5Q A;  4IFD G;  1L0Y B;  1ET9 A;  1F2Z A;  2Q2U A;  2PZU A;  1W6J A;  4F87 A;  2JEB I;  1EYC A;  4X66 Q;  3G6E A;  1RTO A;  4K5W A;  2QA4 A;  1V1Q A;  5M5W B;  3S1Q H;  2AQ1 B;  1AZQ A;  4A3C H;  1JWU D;  4A3B G;  2PZW A;  1EIG A;  4HIM A;  1A63 A;  3TP8 A;  1ESF A;  1SYC A;  2PCF B;  1STG A;  1TY2 A;  2PNR C;  2FIN B;  4DK1 A;  3H3V H;  2JJQ A;  1DZ1 A;  5LMU L;  1CSP A;  3KK7 A;  4FXK C;  1QVG A;  3IAY A;  2D5D A;  1GD7 A;  4TVA B;  2EJG C;  5BN4 A;  4GNX B;  1SJE D;  5FLM H;  3HZX A;  4N9P A;  2K50 A;  2L15 A;  1Y1V G;  3WOF A;  5ELO A;  1I6V C;  1X6O A;  4WJW A;  3CCV A;  3CCJ A;  1Q81 C;  4JI4 L;  1XPO A;  4A3I B;  1RF2 D;  3S1M B;  3S24 A;  4ABN A;  2SNM A;  1IBL Q;  5FO8 B;  2Y0S B;  4ME3 A;  1KHI A;  5AFW A;  5C4X B;  2F0M A;  2IL8 A;  4BS9 A;  2LKV A;  2E2J B;  2XVS A;  2N88 A;  3CW2 C;  1YIT A;  1VQC A;  4DV7 L;  2MO1 A;  2QCP X;  2E2I H;  1A2U A;  3E9H A;  4HIK A;  2YU9 H;  2IX1 A;  2A68 D;  3BZC A;  4E6I A;  4A93 B;  4IFD I;  3MXG A;  1TR5 A;  4C3I B;  2F03 A;  4DN4 M;  1FL0 A;  5KNC A;  5EKI A;  3PSI A;  3DLL A;  1P16 A;  1H9S A;  3D0F A;  2FMC A;  1SYG A;  2HDL A;  5FJ8 G;  4KKS A;  4GLA C;  2B3G A;  3HOY H;  2PI2 E;  1LYL A;  5HGT A;  2ZJQ A;  3DM1 A;  1HZ9 A;  4A3D H;  1VQM A;  2WAQ E;  2JA8 B;  2KBN A;  3K5M A;  5EBC A;  3MC0 B;  1PFB A;  5BR8 L;  1EY8 A;  4LFC L;  4UY8 C;  4ZYS A;  4WJ3 M;  3NTK A;  4X6A H;  4U67 3;  1CI3 M;  1Y69 U;  2EXZ A;  3BVZ A;  1B3A A;  4OWX B;  1EY0 A;  3SEB A;  2MQH A;  1WTQ A;  4KHZ A;  5CV6 A;  2JA6 B;  2UXD Q;  4DR3 Q;  1WJJ A;  1EWI A;  2OWO A;  5C4H A;  2QIL A;  2L0C A;  4RAU C;  1TXY A;  5FLX L;  4HSV A;  4YIJ A;  2JA7 H;  4EQN A;  3CHB D;  1QJO A;  3CRL C;  4A3M H;  2CH4 A;  4DAY B;  3QR8 A;  3ONA B;  4OO1 H;  2WAC A;  1J9O A;  2A6E C;  1UUP A;  2K05 A;  3NWT A;  3U50 C;  4LF6 Q;  3KLW A;  5KYL A;  3L9A X;  3RZO B;  3M4O B;  3T53 B;  4QL5 A;  4RGN A;  4IJH A;  3OPO A;  3S2D H;  3C1F A;  1GVP A;  4JI1 Q;  1ICF B;  1BKB A;  2JA9 A;  2RSN A;  5FKA C;  2ZJP A;  1B70 B;  2F0E A;  3STB D;  1WTR A;  1YNN C;  3CCE A;  1VMC A;  3LGJ A;  1ET6 A;  5C3W A;  1SNO A;  2F0U A;  4KY5 A;  3I4M G;  1MSH A;  1X55 A;  4NPS A;  3J80 L;  1XPR A;  1XTD A;  2R3Z A;  5E7N A;  3I4O A;  4PZ7 A;  4YY3 L;  1A8V A;  5E1F A;  1IKM A;  3R2T A;  2B2V C;  1XWE A;  5M5Y B;  2TMP A;  4BXX H;  2WAQ B;  4HAE A;  1D5Z C;  1DGS A;  2Z8L A;  2NTT A;  4HMJ A;  2ES2 A;  1SE3 A;  1EIH A;  4PMB A;  1JQY D;  4OHJ A;  2B2U C;  3FP9 A;  3F2D A;  1ASZ A;  4QIW E;  4JCV E;  5CR3 A;  2NVY H;  4UPA A;  1YJN A;  1R4Q B;  1I4G A;  3I55 A;  2IY5 B;  1TS5 A;  1PV4 A;  1XNQ Q;  1VQN A;  2CH4 W;  4GKJ L;  1TS3 A;  2CQA A;  1U9R A;  1YHA A;  4TQU S;  1PTO D;  3I4N B;  3O13 A;  4OX9 L;  4RCO A;  3KLS X;  2BE5 D;  3PUW A;  2KEC A;  4JI5 L;  4IFD H;  4BY7 G;  2K5W A;  4RGT A;  3PV0 A;  1YNJ C;  5CBE E;  5KGU A;  1D7Q A;  2MGS A;  4O0A A;  2RBM A;  5IT9 L;  1VQK A;  4BBS G;  5GAE C;  1PYB A;  2LXJ A;  1SEB D;  2K4K A;  4ZQ3 A;  3S2H B;  1X3Q A;  2X6L A;  2Z0S A;  4WRD A;  1FR3 A;  4LFB L;  3ND9 A;  1VCI A;  3MHB A;  4A3B H;  3QO2 A;  2WV6 D;  1LTT D;  3PUY A;  5L37 A;  3QIA A;  4DR7 Q;  1JC7 A;  2NVT H;  1TWH B;  3CQZ B;  1VQD A;  3SK8 A;  4FVM A;  2BA0 A;  1S40 A;  3DEO A;  2JN4 A;  3DXJ C;  3I70 A;  1ZYR D;  1VQ8 A;  4DR2 Q;  1K8A C;  1SE4 A;  5H1S E;  4KN7 C;  1IZ6 A;  4QY7 A;  2RCN A;  3NEN A;  3W1G A;  3R3O A;  1U0L A;  1EL0 A;  3EFX D;  3MEH A;  4O42 A;  3HFZ B;  5D3D A;  1AZP A;  1D5M C;  1SJH D;  4EQP A;  3T51 B;  5JEA J;  2L11 A;  4GN5 A;  4C3J G;  1Z6H A;  3NWS A;  4TSS A;  3UDI A;  3CRK C;  2K6A A;  4QIW B;  4OWW B;  1PXU A;  2PNH A;  4YWM A;  2VY3 A;  1SAP A;  4DUZ Q;  2B8G A;  2K01 A;  2A69 D;  1H9R A;  3TEH B;  1PRT F;  3VR4 A;  1EY4 A;  4MHE A;  3GTG B;  5M3F B;  1HUM A;  3I73 A;  1BDO A;  4DUY L;  3S16 B;  1X56 A;  5J3B A;  2VL6 A;  3TS0 A;  4A3I G;  2KA7 A;  3RLO A;  5FJ8 H;  3J7Y W;  4NMZ A;  3JAM i;  4FYD A;  3CCU A;  4IQZ A;  2EYF A;  1IL2 A;  2F52 A;  2Y0S G;  3A5Z B;  3KF8 B;  2RDF A;  2PQE A;  5C4X G;  1FNU A;  1IBM L;  4FXD A;  2UUA Q;  2G9D A;  1LTL A;  3HOX B;  4LF7 Q;  2AQ2 B;  3I2Z A;  1KD1 C;  2XSC A;  4IUT A;  4R4C A;  2A19 A;  3A8K E;  4L5Q A;  4UP8 A;  3SK5 A;  1VF7 A;  4A93 G;  4MN3 A;  4C3I G;  2A73 B;  2ZT9 C;  4NP5 A;  2CWA A;  3GTL B;  3EIV A;  2K5D A;  1EOT A;  1SLJ A;  1HQR D;  4KY6 A;  3Q23 A;  3P7J A;  5C0X I;  1SND A;  1IW7 D;  1TWC B;  2Q8T A;  3A7A B;  2I5L X;  1PLF A;  1UEB A;  2JA8 G;  1BBU A;  4TRD A;  4A3L G;  1GXD C;  1Q3L A;  2ICE C;  1QZH A;  2HCI A;  1CKO A;  2HHH Q;  1WOC A;  2HD3 A;  4JBW A;  4DR5 L;  4I7A A;  5G3L F;  1GUW A;  4WFN 3;  4KN4 C;  2M9V A;  1I4Q A;  3HOZ B;  4QQB X;  1D2B A;  4G57 A;  1I4X A;  1F9R A;  3I4M H;  1DXM A;  2IX3 A;  1S3O A;  4J6H A;  4S3S A;  4ZUI A;  3BYT B;  3K7U C;  2F0J A;  3H0G B;  3KLS A;  3CXC A;  2J4X A;  3GTK H;  1D5X C;  2VUM B;  1OXV A;  3TME A;  4X65 L;  2LFN A;  2FHT A;  2K28 A;  2IHE A;  2IPK D;  4LUZ A;  2ZTD A;  1GKH A;  1LAC A;  5IGD A;  1HH2 P;  2YTX A;  2KED A;  3VA7 A;  2QGQ A;  4LW1 A;  4KHP Q;  3D31 A;  1VQF A;  5IYC G;  4IUN A;  2WB1 E;  1E2W A;  4BWG B;  2RQX A;  1KLG D;  3EJI A;  5LMN W;  1E2Z A;  2WIN B;  1Z7T A;  4UAI A;  1JE5 A;  3VYS A;  5M5X B;  2XRS D;  2ZM6 Q;  2EY6 A;  1EY9 A;  2KCN A;  3KFU A;  2WAQ G;  2FXQ A;  4GZY C;  5LL6 X;  3H15 A;  1A15 A;  3DWP A;  4BBS H;  2CW0 D;  1B7Y B;  2F3W A;  1S5C D;  2EPB A;  1TWF B;  1MD2 D;  1H9K A;  1JJ2 A;  2XTI A;  2YYZ A;  3UE1 A;  3CD6 A;  4UHV A;  3ULL A;  1JT8 A;  3V2T A;  4G7Z C;  1XPU A;  5ELN A;  3D3R A;  3MTS A;  5T1G A;  2XRQ D;  4BBR B;  3I4N G;  1EQQ A;  4X3S A;  5K36 G;  3ITP A;  1IBL L;  3BU2 A;  3JAM c;  1HNX Q;  2OTJ A;  2WP8 J;  3TN2 A;  2R61 A;  4JOI C;  1Y1W B;  1K9M C;  4X3K A;  5I9P A;  1NY4 A;  3CME A;  3T1Y Q;  3ERO A;  5M5W H;  3HG9 A;  5C0X H;  4NW2 A;  3TP7 A;  2FFK B;  3J7A V;  4C3J H;  1VQA A;  1PYS B;  1S5E D;  2JA5 B;  3S17 H;  3HOV G;  3R93 A;  4KJN A;  1DOK A;  3FKI B;  3PO3 B;  1DM0 B;  4ODG A;  5JJK A;  3KOJ A;  4A3E B;  3K0Y A;  1NR4 A;  3C46 A;  2R92 H;  4CGY B;  2H4O A;  4CKE A;  1Q90 A;  5IP9 G;  1C8C A;  1E1O A;  1M90 C;  3ULJ A;  3A74 A;  4YWL A;  4DR6 Q;  5ELC A;  2RF4 A;  1SYE A;  4GNX A;  3GTM B;  3KDF B;  1V9P A;  3JAM E;  1XMQ Q;  1VQ9 A;  1EIF A;  4K8J A;  1MIU A;  2QDB A;  4HN7 A;  2F0K A;  2UUB Q;  3HOW B;  3K7A B;  1Q12 A;  4A3I H;  1RTN A;  3RZD B;  2KCT A;  1M8A A;  4A3J G;  3D4R A;  1PYW D;  1G51 A;  4APV A;  4G7H C;  1K0R A;  4OIJ A;  1SN8 A;  5C4X H;  2UXD L;  3CU7 A;  2K5N A;  4EQ5 A;  2AMC B;  2E2J H;  4GNX C;  1CA5 A;  4ZLT F;  3GTO H;  1DJR D;  2CVR A;  2G5D A;  2MFI A;  3P1H A;  5IYB G;  4K0K Q;  1JB3 A;  3I7F A;  4YWK A;  1LT4 D;  1J8I A;  3HP3 A;  3URY A;  5M3F G;  3OSO A;  2EJM A;  5CV8 A;  4A93 H;  3NK9 A;  1ENF A;  3HKS A;  4ME5 A;  4LF6 L;  4C3I H;  4Y7N B;  4RKL A;  1I4P A;  1SSO A;  5CV4 A;  3U9S A;  1B53 A;  1NMF A;  2B2T C;  1E24 A;  4K5X A;  5GQO A;  5GRO A;  5AJ3 Q;  1H95 A;  1NBW A;  1CKN B;  4H13 C;  1I6H B;  4P72 A;  4XT3 B;  3TQY A;  3TRZ A;  4JI1 L;  2ATW A;  2MPM A;  3C2P A;  4LAA A;  4KLK A;  2UUC Q;  4B3T Q;  1PH9 A;  4A3F B;  4KKT A;  2SNS A;  3KYH C;  3W1B A;  1C4Q A;  4LUV A;  3G48 A;  4AIM A;  2JA8 H;  3SDZ A;  3M3Y B;  3H6M A;  4HIO A;  4A3L H;  2ZXR A;  1A62 A;  1N34 L;  1DCZ A;  1LT6 D;  4OO1 I;  5JJI A;  2R6G A;  2Q8I B;  1ML0 D;  4H44 C;  3S15 B;  2RCF A;  2KVM A;  3Q8D A;  4IOC A;  1FGB D;  3CCQ A;  3EA6 A;  3ND8 A;  2Q8R E;  1RDP D;  2QF7 A;  3QOL A;  3SHL A;  1PHJ A;  4R9W A;  4JI7 Q;  2NYZ D;  4HJ9 A;  1CHQ D;  1S5F D;  5GAH C;  1FD7 D;  4NXM Q;  4DAY A;  4A3G B;  1S72 A;  5JPM C;  3BS1 A;  1PH2 A;  3SVM A;  5DM7 3;  3IFD A;  5C3E B;  1XNQ L;  3M4Y A;  2AWN A;  2XWB B;  1WD1 A;  4FDB A;  3RZO H;  3M4O H;  2R7D A;  1PH7 A;  1VQJ A;  1CUK A;  3LNN A;  3PQI A;  4ZK9 B;  4G7O C;  3HOZ G;  5CBA E;  4LF4 Q;  2ASB A;  4KI0 A;  4DV5 L;  4QMG A;  1Q46 A;  5M3M B;  3M4P A;  5IYC H;  1KC8 C;  2KQ3 A;  4DAM A;  1X54 A;  4B08 A;  1FVI A;  1STB A;  3TZD A;  2D0O A;  3OW7 A;  3H0G G;  1MBY A;  1W3S A;  2K52 A;  5ELE A;  1SRO A;  2VUM G;  1KQS A;  1LLR D;  2PI2 A;  2G9H D;  4DR7 L;  1B8A A;  4KY7 A;  1BF4 A;  1WVL A;  2AUJ D;  1CTM A;  5EKL A;  3VYT A;  1AE2 A;  4C2M B;  1EWH A;  1HHV A;  3PMF A;  1BCP F;  5HY6 A;  1EIY B;  2F0H A;  3ER0 A;  2ZTC A;  1UWV A;  1N32 Q;  1GJX A;  4ULL A;  2VQF Q;  4K5V A;  2JP1 A;  3CCL A;  3S14 B;  4LJZ C;  2OCE A;  5J22 A;  3KF6 B;  4JI3 Q;  4PNY A;  4L5S A;  4R4Q A;  2KHJ A;  1B2T A;  3MZ5 A;  1JOR A;  3VR2 A;  5KRU A;  3S1R B;  2BDN A;  1S4Z A;  2Z6B A;  3TBI B;  2WFW A;  1UEA B;  4K2L A;  3GTJ B;  1NTG A;  3MA2 B;  4JK1 C;  3VA5 A;  3I4N H;  4NDX A;  4X3T A;  5K36 H;  1K8M A;  2HQE A;  1X65 A;  3STB C;  2RDH A;  3UE0 A;  4DUZ L;  2B63 H;  4KMU C;  1AFP A;  5BN5 A;  5IGG A;  4XTC S;  3TZU A;  1K83 B;  1EY6 A;  2WKC A;  3GV3 A;  5TSS A;  3E6Z X;  3LX0 A;  1EU4 A;  3NUC A;  3SGI A;  1VQ7 A;  2LXK A;  4RG1 A;  2OQK A;  3HOV H;  1OXX K;  3GP7 A;  2CFM A;  1PZJ D;  4ZAI A;  1TWH H;  1XNR Q;  5DAU A;  1STN A;  3PF4 A;  2K32 A;  5C4J B;  4DR1 Q;  2RHQ B;  5ELB A;  2K03 A;  4C1N I;  3B6Y A;  4LF7 L;  1EOV A;  2MO0 A;  1FJG Q;  3MXN B;  2O5J C;  3AYH B;  4DNR B;  4DV0 Q;  1PTO C;  2RKS A;  4KTA A;  4F8M A;  1SNC A;  5A2Q E;  2B2V A;  2DY7 A;  3S1Q B;  1HCZ A;  1HQM C;  1L1O C;  3NPP A;  4DPG A;  4A3J H;  4LFA Q;  4DV6 Q;  4XXE A;  3NTI A;  1LT5 D;  3PO3 G;  4GLV B;  3RNU A;  1WCM B;  1CQF A;  2VS1 A;  2F3V A;  1GUO A;  1MI2 A;  5KIX A;  2B2U A;  3PIP A;  3HOU B;  1YHB A;  5JEA G;  3VYR A;  1W6K A;  1RKN A;  1SE2 A;  5M3F H;  1HFN A;  1O7Y A;  4JV5 L;  4M1U B;  4QGU A;  2ID0 A;  2UXB Q;  3R8B A;  4O2D A;  5D3I B;  5IGC A;  1XTC D;  5HUR A;  2CCZ A;  2HHH L;  1ZYR C;  2F0Q A;  1F2M A;  3OIP A;  3NBI A;  3K81 C;  1KXL A;  1E1T A;  3K5O A;  1N36 Q;  4NXN Q;  3UI2 A;  3OTO Q;  4FNF A;  1TQO A;  2EJF C;  1PH6 A;  1PVO A;  4AQY Q;  3S9W A;  1L0X B;  3KF8 A;  1EZ8 A;  4F7X A;  1LTI D;  4FF1 A;  3RUZ A;  3TP6 A;  4L5R C;  4DNT B;  1JOO A;  1VQG A;  2R7F A;  1RIP A;  2R93 G;  1G2T A;  3HKZ G;  2B29 A;  4JW0 A;  4R4I A;  4GKK Q;  3GTL H;  1QB5 D;  1VS0 A;  2PMZ E;  1LV9 A;  2A6E D;  4IUU A;  1QVF A;  1OTC A;  2R7Z G;  4NB3 A;  4DFA A;  2IWH A;  3T4A C;  4DA2 A;  1D1K A;  4IO9 A;  1SYD A;  1V8Q A;  4UP7 A;  5LMU Q;  5C3X A;  1D1I A;  1TWC H;  2LSS A;  3HS0 C;  4L5T A;  4A3F G;  1TU2 B;  3HOY B;  1U4M A;  1CFM A;  1Z9F A;  3PIP 3;  1PTO B;  1WYD A;  4LF9 Q;  2AKW B;  3RN2 A;  4A3D B;  3AU7 A;  1UE7 A;  1L1O B;  2FJ2 A;  1IYU A;  1IBK Q;  2N78 A;  5JVG 3;  1JCK B;  1HNW Q;  1A3T A;  1FNW A;  3N6R A;  4Y52 H;  1BCP D;  2V1C C;  3G7L A;  2ZM6 L;  4DR4 Q;  2D0P A;  4A75 A;  3HOZ H;  4K6D A;  1WFQ A;  2VQE Q;  4DV4 Q;  4LMQ D;  2EY2 A;  2VB3 X;  1Y1V H;  5ELD A;  1EFW A;  3GDE A;  1G2S A;  2IJ0 A;  1SNP A;  1VQE A;  4GS3 A;  2ICI A;  4BA2 I;  1V1O A;  4RCN A;  2DJG C;  2N55 A;  3SK4 A;  1EEI D;  5I2X A;  2HCC A;  1S5D D;  1U5K A;  3TP5 A;  2RVL A;  2BH2 A;  3WDN A;  1LTB D;  4A3G G;  1NJI C;  1KNA A;  2RHS B;  3ZYY X;  3QG1 A;  3J81 j;  1A0I A;  2VUM H;  5C3E G;  3GD7 A;  5JOB A;  1VQO A;  2O2L D;  2QW7 A;  5D65 A;  1IW7 C;  2MP1 A;  4FXG C;  3PO2 B;  5E4X A;  3OIQ A;  3U4V A;  4KKU A;  5GAD C;  2N3S A;  1HNX L;  2KEE A;  4IN3 A;  2I07 B;  2OQ0 A;  2PMZ B;  4MNO A;  3UDF A;  5M3M G;  5JJZ A;  2NVQ H;  1VQI A;  3OMC A;  2NN6 G;  3X3M A;  3T1Y L;  1SBB B;  5GAG C;  1YNJ D;  3MXU A;  2RA4 A;  5I4D A;  2VZA A;  5M5X H;  2MNA A;  1EU3 A;  2E5L Q;  2E2H B;  5JVH 3;  2KCC A;  1D8L A;  1E2V A;  4DK6 C;  2VW9 A;  4JYA Q;  1YBY A;  1RD9 D;  1EY7 A;  2LMC B;  5EPJ A;  5CV5 A;  1C9O A;  3NHH A;  1XMO Q;  4J1M A;  2A74 C;  3FEW X;  4R4T A;  2F4V Q;  1U4P A;  1F9P A;  1L0W A;  2YV5 A;  3RLF A;  1I3Q H;  2B8F A;  3FVQ A;  4DR6 L;  1QUQ B;  1GUS A;  3NBH B;  1XXG A;  2JK8 A;  2DY8 A;  2NVY B;  1XMQ L;  2N49 A;  4CBV A;  1Q82 C;  2UUB L;  2RSO A;  3IL8 A;  3BDL A;  4YCU A;  2E8G A;  1SNM A;  4ID6 A;  2Z6K A;  3VR5 A;  1EQV A;  1O80 A;  1R4P B;  5LMN L;  3KBX A;  2BH8 A;  2QDL A;  1TWG H;  2XIW A;  4PV1 C;  2HUG A;  3I90 A;  5CV9 A;  4ALP A;  1NR2 A;  1Y8O B;  3TS2 A;  3ZJY C;  2JYO A;  5KNB A;  4I7Z C;  1E7Z A;  4HR7 B;  3L0O A;  4JPB W;  4AYB E;  1ENA A;  4K0K L;  2EE1 A;  1T5E A;  2Z6K C;  1B3Q A;  3HGB A;  2F0P A;  4RFB A;  3DWA A;  3J81 c;  3DM3 A;  4KK7 A;  2ZXO A;  1QG7 A;  1TKW B;  1A3U A;  2JA6 G;  5LL6 S;  2NN6 I;  3PO3 H;  2CKZ B;  4IUV A;  4XDX A;  1EYD A;  5C0X J;  3E0J A;  1UE6 A;  2NVT B;  2I5M X;  1PH1 A;  2UUC L;  4YCV A;  2F0N A;  3BDO A;  4B3T L;  5IIF A;  2PQA B;  4CKC A;  5CGK A;  2C9O A;  2EYP A;  2PPB C;  1B50 A;  4DV1 Q;  5T1I A;  2D2C C;  5JAV A;  3PCO B;  2K5V A;  4QF4 A;  5FO9 B;  4LF5 Q;  3UDX A;  4A3K B;  2EYJ A;  3GO5 A;  4JI8 Q;  3ULP A;  3KDF A;  3RZD H;  5A35 A;  5EAY A;  4JI6 Q;  4CJ0 B;  1MHW C;  2F0O A;  4JVZ A;  1X3E A;  4X66 L;  1WCM G;  3S1N B;  3J81 E;  1X3G A;  1PFS A;  2J0T D;  3CPF A;  1K3R A;  5IOD A;  4JI7 L;  3HOU G;  2F4I A;  3J7Z C;  3L2P A;  2H1E A;  2XWJ B;  2R93 H;  1PFM A;  4BY1 B;  4NXM L;  3HEJ A;  4IAL A;  5C5L A;  1HTP A;  2ZJR A;  4BY7 H;  4B3M Q;  2M00 A;  2R7Z H;  1JWS D;  3A56 A;  4AYB B;  1CKM A;  1B1Z A;  4K8I A;  4OXP A;  1VQH A;  1B4O A;  3U58 A;  3K8A A;  1I4H A;  4V19 0;  3A5U A;  4LF4 L;  2MHV A;  1CKN A;  2EOT A;  3OW2 A;  1R9T H;  2Q2I A;  1KAW A;  4JOI A;  1S5B D;  3WWV A;  3M3Y H;  3FPP A;  1HR0 W;  4WOR A;  3PUZ A;  5KND A;  2EY5 A; 
#chains in the Genus database with same CATH homology
 1PRT D;  3MXP A;  2EYL A;  4XYO A;  1SMY D;  4HCE A;  4HED A;  3JAM L;  4XQQ A;  3Q22 A;  3Q6S A;  5CC4 A;  4RA8 A;  2CHB D;  1ILP A;  3MVV A;  1RJT A;  1TS4 A;  2ENB A;  2VNU D;  4IUR A;  3T56 B;  1LTS D;  1KTK A;  2WB1 B;  2LS0 1;  4L6T B;  1DON A;  2EYM A;  2PZT A;  2D62 A;  2PW5 A;  2Z4I A;  2L55 A;  4V0B A;  3VYU A;  3DHQ A;  1KLU D;  3IFT A;  1VMP A;  3MAQ A;  1QNK A;  2L4N A;  1Z47 A;  1U4L A;  4LK1 C;  2NN6 H;  4HMI A;  2K7V A;  3I4M B;  2A6H C;  1BR9 A;  2B2T A;  1A6X A;  1CZW A;  1OXU A;  4PQX A;  1BNZ A;  2BOS A;  3P20 A;  4Q0F A;  3GTK B;  5CV7 A;  1PDQ A;  1QWY A;  5EJW A;  5G3L D;  4Q5V A;  3SK6 A;  3K57 A;  2BCO A;  2JXM B;  3A8J E;  3ERQ A;  1SXT A;  2EDG A;  3W3A A;  5BN3 A;  3Q24 A;  2BDO A;  3VR3 A;  1QE6 A;  2V4D A;  1LTA D;  3PUV A;  3X3N A;  4I65 A;  2A5H A;  1MGS A;  4XYQ A;  1GOZ A;  1TWA B;  1G6Z A;  5EKK A;  2K33 A;  1CQV A;  3GTP B;  1XX8 A;  3BVG A;  2F0D A;  1AW7 A;  1SDF A;  3D4W A;  3OWE B;  3NQT A;  3RMH A;  1H9J A;  1I50 B;  4DF7 A;  1OO9 B;  4OGQ C;  3M7N A;  1STA A;  1K8O A;  4C3H B;  2A68 C;  1Q1B A;  3F2U A;  2NUC A;  1VDZ A;  3VR6 A;  1ILQ A;  4K6L A;  1EYA A;  3NSW A;  2SDF A;  3W2D A;  4ZKB B;  1LT3 D;  3A7L A;  4NKL A;  3K6O A;  3MXN A;  4KD4 A;  3DEP A;  4C3J B;  3K5N A;  1V1P B;  1B9N A;  3S17 B;  1ZXT A;  4XQJ A;  5C44 B;  2AUK A;  1IHZ A;  2JE6 I;  1PTO F;  2R92 B;  1IL8 A;  1A3V A;  3I4L A;  3EQL C;  3KLR A;  2IT1 A;  2PO4 A;  3E5S A;  1JOK A;  2QEJ C;  1Y8N B;  4P2C B;  3C3L A;  3OHX C;  1F9Q A;  3SR1 A;  3H3V C;  1OXS C;  3BDC A;  3MWY W;  4C56 C;  1JIC A;  1NCV A;  1EQT A;  1BQQ T;  3NTH A;  3GTO B;  2EYH A;  3NQI A;  1BO0 A;  1H9M A;  3D4D A;  2SEB D;  1GHK A;  5EQ0 A;  5CYU A;  2KHS A;  2B39 A;  3J7A F;  1Q1E A;  2FMM A;  2NVX B;  2OXP A;  4R8I A;  4C1N K;  5A2Q L;  1TT2 A;  2QKI C;  1CK1 A;  4IFD J;  5JPN C;  1PTO H;  2L1B A;  3BG3 A;  1HUN A;  4CHT B;  5K5P A;  3BZD B;  5J1Z A;  3GTQ B;  3DMU A;  3FPU B;  1SFO B;  1WTV A;  3K5L A;  2J7Z A;  3BYY B;  1XYI A;  3TDQ A;  1TVX A;  2L12 A;  2NZ1 D;  4N9T A;  1B44 D;  3P75 A;  3FRP B;  2F0I A;  1X3P A;  3CKI B;  2BE5 C;  1O78 A;  1LO5 D;  5ELF A;  2Z4H A;  4MIU A;  4RHR A;  3H91 A;  2XN9 C;  2JEA I;  3H09 A;  1WTW A;  2WII B;  3KUP A;  2L9H A;  1QCB D;  3V96 A;  3AMU A;  3M85 A;  4QUC A;  3OWF A;  5IOC A;  4HSP A;  4RHS A;  5FLX E;  2NWG A;  1ZEQ X;  1BCP C;  4BA1 I;  5J39 A;  1CM9 A;  3DUZ A;  2EZV A;  4OIK A;  1V43 A;  4FF3 A;  4EQO A;  2AQ3 B;  3H94 A;  1GHJ A;  3GV6 A;  2DNC A;  1TS2 A;  2K04 A;  4KV6 A;  1IKL A;  2E2I B;  2L5T A;  1Y8P B;  5COY A;  2YU9 B;  1G29 1;  1H9S B;  3MFG A;  3OMG A;  1HA6 A;  1PZK D;  3NBH A;  5KEE A;  4RKB A;  1FYC A;  2A69 C;  2F0W A;  3J80 E;  1WTX A;  1WD0 A;  1EZ6 A;  4FP5 D;  2OEO A;  1OXT A;  2F0S A;  2PW7 A;  3N52 A;  2OT2 A;  1O7L A;  1YNN D;  1D6E C;  3A54 A;  1IYV A;  1GUG A;  3L3O C;  3QOJ A;  2EYO A;  2B63 B;  5FOB B;  2IX0 A;  2E76 C;  1KNE A;  3K59 A;  2B2W A;  1HTL D;  2F1M A;  2D9U A;  5EPL A;  5FO7 B;  2E74 C;  4X3U A;  4DK0 A;  5EGT A;  3HOV B;  4ZKC B;  2PYK A;  2DN8 A;  5C5M A;  4F88 A;  3D6W A;  2JA7 B;  3QWN A;  1EWC A;  2WKD A;  4C3H G;  4XQN A;  5NUC A;  4A3M B;  2B2W C;  1BCP B;  1NAP A;  1STE A;  5IT9 E;  1CHP D;  1DD2 A;  2OF1 A;  3GQB A;  3LWU A;  5C0X G;  5I6Y A;  1JOQ A;  4RWS C;  3S2D B;  4B9W A;  5DM6 3;  1E0B A;  4DAV A;  4A3J B;  3DWQ A;  3I91 A;  2HDM A;  2JSO A;  3LWE A;  1EEF D;  4DXF A;  4R8N A;  4EGV A;  1DOL A;  3NE5 B;  4QUF A;  3I8Z A;  2BA1 A;  4FF4 A;  3G6J B;  2F0T A;  1DOM A;  3PIO 3;  1STH A;  1F9S A;  4PMW A;  2VB2 X;  2M2L A;  1C48 A;  4PMC A;  1WTO A;  1LTG D;  4UDU C;  1PZI D;  3V05 A;  4RGM A;  2F0G A;  3OOC A;  3NXW A;  4U68 A;  2F0V A;  4IUP A;  4ZRZ A;  3QJY A;  1X32 A;  2EVB A;  1T5X D;  3T13 A;  1HRJ A;  2EY1 A;  1CT1 D;  4KJO A;  2F0F A;  2X69 A;  1JE4 A;  2KOL A;  4FF2 A;  2MUY A;  3L7Z C;  4Z9C B;  1EFI D;  3EVQ A;  4DGZ A;  2E75 C;  1MSG A;  5DNF A;  4A3B B;  5EPK A;  3J81 L;  2CW0 C;  4XT1 B;  4KD3 A;  2LY7 A;  3BVM A;  4OL7 A;  2TSS A;  1ROD A;  1KDC A;  1B9M A;  5JEA H;  4XIG S;  5EBD A;  1Y1V B;  1M4V A;  1LTR D;  3M7G A;  4DAP A;  2B2Y A;  1PRT C;  1ONL A;  3HRZ C;  5COR A;  1SMY C;  1KAB A;  2AWO A;  5E3F A;  1HPC A;  5IGB A;  5KYI A;  1U4R A;  4B9X A;  4TKO B;  3D6C A;  1BOS A;  3WOE A;  2RDG A;  2B2Y C;  5D14 A;  4K2K A;  1QNU A;  1BBX C;  2MJ8 A;  5C6A A;  5ISR A;  1CA6 A;  1TII D;  5IGE A;  2NVQ B;  2I46 A;  3FDT A;  1AP0 A;  2K1B A;  1BUV T;  1STY A;  1AN8 A;  4IZ8 A;  1BXT A;  2O4X A;  4L8J A;  4G4K A;  1QOH A;  2XNA C;  3R2I A;  1UNS A;  1HA5 A;  5M9O A;  1PMR A;  2SOB A;  1RCV D;  1SYF A;  1ICW A;  4EVO A;  2ZXP A;  1ENC A;  4CKB A;  1NSN S;  5I6W A;  1ESR A;  4ILW A;  3RD4 A;  1HXY D;  4CJ1 B;  5E4W C;  1WTP A;  3T16 A;  1I3Q B;  1SNQ A;  5FK9 C;  4HTH A;  4J8Q A;  1F77 A;  1KDA A;  1PFN A;  4DU9 A;  3QB3 A;  1GUT A;  1Q8I A;  1F2Y A;  1TWG B;  3SXH A;  1KDB A;  2F0L A;  3IKJ A;  1PRT B;  3I3C A;  2DNE A;  3U9O A;  4DXG A;  4H0L C;  1HFG A;  5DEH A;  4QB4 A;  2Z1C A;  4RH6 A;  4QCL A;  3SE0 A;  3A8I E;  1JWM D;  1V1P A;  2NTS A;  4IUQ A;  4O1N A;  5I9O A;  4KHV A;  1QIL A;  1ZKO A;  2NB0 A;  4OO1 G;  1A2T A;  3AB9 A;  2C5C A;  3C1E A;  2IW3 A;  2E2D C;  4L63 B;  1FNV A;  2KUM A;  2NBF A;  3TSS A;  1TY0 A;  1AEX A;  3PUX A;  5IGF A;  1EY5 A;  1GUN A;  5C4Z A;  1G91 A;  1II3 A;  5F2D A;  1KAA A;  1NUC A;  1F2L A;  4ZUJ A;  3Q0A A;  3NP8 A;  1RHP A;  4K14 A;  2KJX A;  1UAP A;  1G8Z D;  3D8G A;  2X6G A;  2R93 B;  3HKZ B;  2GA4 B;  5LHY 1;  4RGO S;  1DYQ A;  4BY7 B;  2R7Z B;  1CZG A;  2VXW A;  4BBS B;  3KBG A;  3I72 A;  4CJ2 C;  2O5I C;  1SYB A;  3A55 A;  5I2Y A;  3MFY A;  1O7Z A;  1R9T B;  4M8A A;  4FO2 A;  1JR0 D;  1LAB A;  1VF5 C;  3K58 A;  3FMC A;  2A6H D;  4HCS A;  1I4R A;  4H7B A;  5CMD A;  2K5Q A;  4IFD G;  1L0Y B;  1ET9 A;  1F2Z A;  2PZU A;  1W6J A;  4F87 A;  2JEB I;  1EYC A;  1RTO A;  4K5W A;  5M5W B;  2AQ1 B;  1AZQ A;  1JWU D;  2PZW A;  1EIG A;  3TP8 A;  1ESF A;  1SYC A;  2PCF B;  1STG A;  1TY2 A;  2PNR C;  2FIN B;  4DK1 A;  1DZ1 A;  3KK7 A;  4FXK C;  3IAY A;  2D5D A;  2EJG C;  5BN4 A;  1SJE D;  3HZX A;  4N9P A;  3WOF A;  1I6V C;  4WJW A;  4A3I B;  1RF2 D;  3S1M B;  4ABN A;  2SNM A;  5FO8 B;  2Y0S B;  5AFW A;  5C4X B;  2F0M A;  2IL8 A;  4BS9 A;  2LKV A;  2E2J B;  2XVS A;  2N88 A;  2QCP X;  1A2U A;  2IX1 A;  2A68 D;  4E6I A;  4A93 B;  4IFD I;  3MXG A;  1TR5 A;  4C3I B;  2F03 A;  4DN4 M;  5KNC A;  5EKI A;  1H9S A;  2FMC A;  1SYG A;  2HDL A;  4KKS A;  5HGT A;  3DM1 A;  2JA8 B;  3K5M A;  5EBC A;  3MC0 B;  1PFB A;  1EY8 A;  4ZYS A;  3NTK A;  4U67 3;  1CI3 M;  1Y69 U;  2EXZ A;  3BVZ A;  1B3A A;  1EY0 A;  3SEB A;  1WTQ A;  4KHZ A;  5CV6 A;  2JA6 B;  5C4H A;  2QIL A;  2L0C A;  4RAU C;  5FLX L;  4HSV A;  4YIJ A;  4EQN A;  3CHB D;  1QJO A;  3CRL C;  3ONA B;  4OO1 H;  2WAC A;  1J9O A;  2A6E C;  1UUP A;  2K05 A;  3NWT A;  5KYL A;  3L9A X;  3RZO B;  3M4O B;  3T53 B;  4RGN A;  3OPO A;  3C1F A;  2RSN A;  5FKA C;  2F0E A;  1WTR A;  1YNN C;  1VMC A;  1ET6 A;  5C3W A;  1SNO A;  2F0U A;  4KY5 A;  1MSH A;  3J80 L;  2R3Z A;  5E1F A;  1IKM A;  3R2T A;  2B2V C;  1XWE A;  5M5Y B;  2TMP A;  2WAQ B;  4HAE A;  1D5Z C;  2Z8L A;  2NTT A;  4HMJ A;  1SE3 A;  1EIH A;  4PMB A;  1JQY D;  4OHJ A;  2B2U C;  5CR3 A;  1R4Q B;  1I4G A;  1TS5 A;  1TS3 A;  2CQA A;  1U9R A;  4TQU S;  1PTO D;  3I4N B;  3O13 A;  4RCO A;  3KLS X;  2BE5 D;  3PUW A;  2KEC A;  4IFD H;  2K5W A;  4RGT A;  3PV0 A;  1YNJ C;  5CBE E;  5KGU A;  2MGS A;  2RBM A;  5IT9 L;  1SEB D;  4ZQ3 A;  3S2H B;  1X3Q A;  2X6L A;  4WRD A;  1FR3 A;  3ND9 A;  1VCI A;  3MHB A;  3QO2 A;  2WV6 D;  1LTT D;  3PUY A;  3QIA A;  1JC7 A;  1TWH B;  3CQZ B;  3SK8 A;  4FVM A;  2BA0 A;  3DEO A;  3DXJ C;  3I70 A;  1ZYR D;  1SE4 A;  4KN7 C;  3R3O A;  1EL0 A;  3EFX D;  3MEH A;  4O42 A;  5D3D A;  1AZP A;  1D5M C;  1SJH D;  4EQP A;  3T51 B;  5JEA J;  2L11 A;  4C3J G;  1Z6H A;  3NWS A;  4TSS A;  3CRK C;  2K6A A;  4QIW B;  1PXU A;  1SAP A;  2B8G A;  2K01 A;  2A69 D;  1H9R A;  1PRT F;  3VR4 A;  1EY4 A;  4MHE A;  3GTG B;  5M3F B;  1HUM A;  3I73 A;  1BDO A;  3S16 B;  2KA7 A;  3J7Y W;  4NMZ A;  4FYD A;  4IQZ A;  2EYF A;  2RDF A;  2PQE A;  1FNU A;  4FXD A;  2G9D A;  3HOX B;  2AQ2 B;  2XSC A;  4IUT A;  3A8K E;  3SK5 A;  1VF7 A;  4MN3 A;  4C3I G;  2A73 B;  2ZT9 C;  4NP5 A;  3GTL B;  2K5D A;  1EOT A;  1HQR D;  4KY6 A;  3Q23 A;  3P7J A;  5C0X I;  1SND A;  1IW7 D;  1TWC B;  2Q8T A;  3A7A B;  1PLF A;  4TRD A;  1GXD C;  1Q3L A;  2ICE C;  2HCI A;  4JBW A;  5G3L F;  1GUW A;  4WFN 3;  4KN4 C;  2M9V A;  1I4Q A;  3HOZ B;  1D2B A;  4G57 A;  1I4X A;  1F9R A;  1DXM A;  2IX3 A;  4S3S A;  4J6H A;  4ZUI A;  3BYT B;  2F0J A;  3H0G B;  3KLS A;  2J4X A;  1D5X C;  2VUM B;  1OXV A;  3TME A;  2LFN A;  2FHT A;  2K28 A;  2IPK D;  1LAC A;  5IGD A;  2KED A;  3VA7 A;  3D31 A;  4IUN A;  1E2W A;  4BWG B;  2RQX A;  1KLG D;  3EJI A;  1E2Z A;  2WIN B;  1Z7T A;  4UAI A;  5M5X B;  3VYS A;  2XRS D;  2EY6 A;  1EY9 A;  2KCN A;  4GZY C;  5LL6 X;  1A15 A;  3DWP A;  2CW0 D;  2F3W A;  1S5C D;  2EPB A;  1TWF B;  1MD2 D;  1H9K A;  2YYZ A;  3V2T A;  4G7Z C;  3D3R A;  3MTS A;  5T1G A;  2XRQ D;  4BBR B;  4X3S A;  5K36 G;  3ITP A;  2WP8 J;  3TN2 A;  2R61 A;  1Y1W B;  4X3K A;  5I9P A;  3ERO A;  3HG9 A;  5C0X H;  4NW2 A;  3TP7 A;  2FFK B;  3J7A V;  2JA5 B;  1S5E D;  3R93 A;  4KJN A;  1DOK A;  3FKI B;  3PO3 B;  1DM0 B;  4ODG A;  4A3E B;  3K0Y A;  1NR4 A;  3C46 A;  4CGY B;  2H4O A;  4CKE A;  1Q90 A;  1C8C A;  5ELC A;  1SYE A;  3GTM B;  3JAM E;  4K8J A;  2QDB A;  4HN7 A;  2F0K A;  3HOW B;  3K7A B;  1Q12 A;  1RTN A;  3RZD B;  1M8A A;  3D4R A;  1PYW D;  4G7H C;  4OIJ A;  3CU7 A;  1CA5 A;  4ZLT F;  1DJR D;  2CVR A;  3P1H A;  1JB3 A;  1LT4 D;  1J8I A;  3HP3 A;  3URY A;  3OSO A;  2EJM A;  5CV8 A;  3NK9 A;  1ENF A;  4ME5 A;  4Y7N B;  3U9S A;  4RKL A;  1I4P A;  1SSO A;  5CV4 A;  1B53 A;  2B2T C;  4K5X A;  4H13 C;  1I6H B;  4XT3 B;  2MPM A;  3C2P A;  4LAA A;  4A3F B;  4KKT A;  2SNS A;  1C4Q A;  3SDZ A;  3M3Y B;  3H6M A;  2ZXR A;  1DCZ A;  1LT6 D;  4OO1 I;  2R6G A;  2Q8I B;  1ML0 D;  4H44 C;  3S15 B;  2KVM A;  1FGB D;  3EA6 A;  3ND8 A;  2Q8R E;  1RDP D;  2QF7 A;  3QOL A;  3SHL A;  4R9W A;  2NYZ D;  1CHQ D;  1S5F D;  1FD7 D;  4DAY A;  4A3G B;  5JPM C;  3BS1 A;  3SVM A;  5DM7 3;  3IFD A;  5C3E B;  3M4Y A;  2AWN A;  2XWB B;  1WD1 A;  3LNN A;  4ZK9 B;  4G7O C;  5CBA E;  4KI0 A;  4QMG A;  5M3M B;  2KQ3 A;  4B08 A;  1STB A;  3TZD A;  3OW7 A;  1MBY A;  5ELE A;  1LLR D;  2G9H D;  4KY7 A;  1BF4 A;  1WVL A;  2AUJ D;  1CTM A;  5EKL A;  3VYT A;  4C2M B;  1EWH A;  1HHV A;  3PMF A;  1BCP F;  2F0H A;  1GJX A;  4ULL A;  4K5V A;  2JP1 A;  3S14 B;  4LJZ C;  5J22 A;  4PNY A;  1B2T A;  3MZ5 A;  1JOR A;  3VR2 A;  5KRU A;  3S1R B;  2BDN A;  1S4Z A;  3TBI B;  1UEA B;  4K2L A;  3GTJ B;  3MA2 B;  4JK1 C;  3VA5 A;  4NDX A;  4X3T A;  5K36 H;  1K8M A;  2HQE A;  2RDH A;  4KMU C;  1AFP A;  5BN5 A;  5IGG A;  4XTC S;  3TZU A;  1K83 B;  1EY6 A;  2WKC A;  3GV3 A;  5TSS A;  3E6Z X;  3LX0 A;  1EU4 A;  3NUC A;  1OXX K;  3GP7 A;  1PZJ D;  4ZAI A;  5DAU A;  1STN A;  2K32 A;  5C4J B;  5ELB A;  2K03 A;  4C1N I;  2O5J C;  4DNR B;  1PTO C;  2RKS A;  4KTA A;  4F8M A;  1SNC A;  5A2Q E;  2B2V A;  2DY7 A;  3S1Q B;  1HCZ A;  1HQM C;  3NPP A;  4XXE A;  3NTI A;  1LT5 D;  1WCM B;  1CQF A;  2F3V A;  1GUO A;  1MI2 A;  5KIX A;  2B2U A;  3HOU B;  5JEA G;  3VYR A;  1W6K A;  1RKN A;  1SE2 A;  1HFN A;  1O7Y A;  4M1U B;  2ID0 A;  3R8B A;  5D3I B;  5IGC A;  1XTC D;  5HUR A;  1ZYR C;  2F0Q A;  1F2M A;  3OIP A;  3NBI A;  3K5O A;  3UI2 A;  4FNF A;  1TQO A;  2EJF C;  3S9W A;  1L0X B;  3KF8 A;  1EZ8 A;  4F7X A;  1LTI D;  4FF1 A;  3RUZ A;  3TP6 A;  4DNT B;  1JOO A;  1G2T A;  1QB5 D;  1LV9 A;  2A6E D;  4IUU A;  4DFA A;  2IWH A;  3T4A C;  4DA2 A;  1D1K A;  1SYD A;  1V8Q A;  5C3X A;  1D1I A;  3HS0 C;  1TU2 B;  3HOY B;  1U4M A;  1CFM A;  3PIP 3;  1PTO B;  4A3D B;  3AU7 A;  2FJ2 A;  1IYU A;  5JVG 3;  1JCK B;  1A3T A;  1FNW A;  3N6R A;  1BCP D;  3G7L A;  4K6D A;  4LMQ D;  2EY2 A;  2VB3 X;  5ELD A;  1G2S A;  2IJ0 A;  1SNP A;  2ICI A;  4BA2 I;  1V1O A;  4RCN A;  2N55 A;  3SK4 A;  1EEI D;  5I2X A;  2HCC A;  1S5D D;  3TP5 A;  2RVL A;  3WDN A;  1LTB D;  1KNA A;  3ZYY X;  3QG1 A;  3GD7 A;  5JOB A;  2O2L D;  5D65 A;  1IW7 C;  2MP1 A;  4FXG C;  3PO2 B;  5E4X A;  3OIQ A;  4KKU A;  2KEE A;  4IN3 A;  2I07 B;  2PMZ B;  5JJZ A;  3OMC A;  2NN6 G;  3X3M A;  1SBB B;  1YNJ D;  3MXU A;  2RA4 A;  5I4D A;  1EU3 A;  2E2H B;  5JVH 3;  2KCC A;  1E2V A;  1RD9 D;  1EY7 A;  2LMC B;  5EPJ A;  5CV5 A;  3NHH A;  4J1M A;  2A74 C;  3FEW X;  1U4P A;  1F9P A;  3RLF A;  2B8F A;  3FVQ A;  1GUS A;  1XXG A;  2DY8 A;  2NVY B;  4CBV A;  2RSO A;  3IL8 A;  3BDL A;  1SNM A;  4ID6 A;  3VR5 A;  1EQV A;  1O80 A;  1R4P B;  3KBX A;  2XIW A;  4PV1 C;  2HUG A;  3I90 A;  5CV9 A;  1NR2 A;  1Y8O B;  2JYO A;  5KNB A;  4I7Z C;  4HR7 B;  1ENA A;  2EE1 A;  1T5E A;  4RFB A;  3HGB A;  2F0P A;  3DWA A;  4KK7 A;  2ZXO A;  1QG7 A;  1TKW B;  1A3U A;  5LL6 S;  2NN6 I;  4IUV A;  4XDX A;  1EYD A;  5C0X J;  3E0J A;  2NVT B;  2F0N A;  3BDO A;  5IIF A;  4CKC A;  5CGK A;  2C9O A;  2EYP A;  2PPB C;  1B50 A;  5T1I A;  2D2C C;  5JAV A;  4QF4 A;  5FO9 B;  4A3K B;  2EYJ A;  3GO5 A;  5A35 A;  4CJ0 B;  2F0O A;  3S1N B;  3J81 E;  2J0T D;  5IOD A;  2F4I A;  2H1E A;  2XWJ B;  1PFM A;  4BY1 B;  3HEJ A;  4IAL A;  5C5L A;  1HTP A;  2M00 A;  1JWS D;  3A56 A;  4AYB B;  1B1Z A;  4K8I A;  1B4O A;  1I4H A;  4V19 0;  2MHV A;  2EOT A;  1S5B D;  3FPP A;  4WOR A;  3PUZ A;  5KND A;  2EY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...