2O2LD

Crystal structure of human heat-labile enterotoxin in complex with a blood group a antigen analog
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
98
Chain Sequence
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat-labile enterotoxin B chain
publication title Blood Group Antigen Recognition by Escherichia coli Heat-labile Enterotoxin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 25
structure length 98
sequence length 103
chains with identical sequence E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2o2lD00
1LLRD 1FNWA 2XNAC 2O2LD 1EWCA 3R2TA 1PRTB 1RF2D 3MFGA 1V1OA 5TSSA 1JQYD 1SJHD 1PRTF 1AW7A 1XTCD 1S5FD 1TY0A 1LT4D 1ET6A 1BCPD 1LT3D 1S5DD 1S5BD 1B44D 3O13A 1LT6D 3DWPA 1I4HA 4K6LA 2XN9C 3W2DA 4DXFA 1RCVD 1RDPD 1SJED 2IPKD 2RDHA 1CK1A 1HXYD 1AN8A 1GOZA 1I4RA 1SE2A 4RHSA 5ELEA 4BWGB 1PZKD 1I4PA 1SEBD 1JWUD 3EFXD 1DJRD 1PTOC 1DYQA 1JWMD 1I4GA 1V1PA 1LTID 1LTTD 2QILA 3BYTB 5I4DA 3BVGA 1FGBD 1EU3A 5ELDA 1D5MC 4RGOS 4RFBA 1F77A 4L6TB 1TS5A 3BZDB 4UDUC 3DWQA 3CHBD 1CHQD 1PTOD 1PYWD 3DWAA 1ET9A 1I4XA 1S5ED 2ICIA 3OWEB 1LTRD 1HTLD 1LO5D 1G8ZD 5ELFA 4OHJA 1FNVA 4RGNA 4O1NA 3BVMA 1BCPB 1V1PB 3URYA 1MD2D 5D3DA 1BCPF 1L0XB 3SEBA 1XXGA 2RDGA 3MC0B 1UUPA 4ZYSA 1PZID 1TY2A 1PTOH 1KLUD 1QILA 2NTTA 2WV6D 2AQ3B 1FD7D 3R2IA 1EFID 1KLGD 2XRSD 5ELCA 3BYYB 1PRTD 4DXGA 1EEID 1M4VA 1TS2A 5FKAC 2J4XA 2NTSA 1PZJD 1SE4A 4C56C 2R61A 1KTKA 3GP7A 4RGMA 1D5XC 1FNUA 2CHBD 1CHPD 4TSSA 1LTAD 1CT1D 1TS4A 1L0YB 1S5CD 1SXTA 5ELBA 4RH6A 1BXTA 3R8BA 1HA5A 1UNSA 3BVZA 5D3IB 1SBBB 1PRTC 1PTOB 4RHRA 1ENFA 1TS3A 2SEBD 3EA6A 1B1ZA 1JR0D 1T5XD 1EU4A 1PTOF 2AQ2B 4Z9CB 2TSSA 4RGTA 1CQVA 1JWSD 1D6EC 2IJ0A 2Z8LA 1SE3A 1HQRD 1D5ZC 3KLSX 2G9HD 1EEFD 1LT5D 1LTSD 3TSSA 2AQ1B 4RCOA 1LTGD 2XRQD 5FK9C 2QEJC 1JCKB 1ESFA 1I4QA 1LTBD 1RD9D 3V05A 1BCPC 4L63B 1STEA
chains in the Genus database with same CATH superfamily
1FNWA 4TRDA 4KHPL 2VB2X 3NTIA 1X3FA 4H13C 1TWGH 1AE3A 1AP0A 1CKNA 2MO0A 2RSNA 4DR2Q 3DEOA 4YCWA 1RHPA 2PQAA 4YWMA 4PMCA 4NXNL 1JJ2A 3DMUA 1BCPD 3GTKH 5KGUA 4NKLA 3SR1A 2EJGC 3QJYA 4LW1A 2XVSA 2BE5D 1XNRL 1TQOA 5EKLA 3TN2A 4XXEA 1GUOA 3M4QA 2VQEQ 1XWEA 1MJCA 1STNA 2L9HA 4F8MA 2VXWA 4LF4Q 4MHEA 2PZWA 4OO1I 1ONLA 1V1PA 3OYYA 3TEHB 2NN6G 4MTNA 5M3MG 1EU3A 2HUGA 4LF9Q 3HOXB 2CW0C 4JI6Q 2IW3A 4YIJA 3U58A 1EZ8A 3GD7A 4KHPQ 4DR7Q 2QDLA 2YTVA 1B2TA 4ODGA 3RLOA 1HPCA 3AFPA 1EY5A 5IGFA 5KNDA 4HEDA 3UE0A 2E76C 1BCPF 5I2YA 2P5ZX 1E0BA 4HCEA 1XNRQ 4PQXA 3RNUA 1A15A 1FD7D 1A3UA 2K5WA 3R2IA 4MTKA 1ENAA 5CBEE 3LWUA 1WD1A 3BYYB 4ID6A 2KOLA 5I6WA 2E2JB 2SDFA 4YCVA 2R7ZB 2EIFA 1SNCA 1TT2A 3SGIA 4IFDG 3VR4A 2KUMA 3Q0AA 4TSSA 5JAVA 1Q8KA 5M3FG 2IHFA 1VDZA 3H0GB 4C3JG 3HOWB 4KHVA 4RH6A 3RN5A 1L0WA 1EY6A 1QUQB 3FKIG 3FHWA 5IODA 4JG2A 2UUAL 1B1ZA 1N9WA 2B63G 4POFA 2IJ0A 3A0JA 1SYGA 2WB1G 3G48A 1YIJA 3KLSX 3UDXA 4HJAA 3W1GA 3UE1A 3HOZB 3CMAA 5JOBA 1XMQL 1WTRA 4BY7G 2E8GA 1JCKB 1I4QA 3QB3A 2M00A 1BNZA 3HS0C 1PYSB 3RLNA 4DAVA 3GTPH 1LLRD 3PO3G 4CKBA 2K6AA 3NTKA 5TSSA 2VW9A 4B08A 2MQHA 2K5QA 1S40A 3K7AB 5C3EH 1HR0Q 2ZTEA 1SNPA 3GTJH 3OWFA 3I3CA 5C5LA 4X3SA 5NUCA 5LMUQ 2F0LA 2RCNA 3TRZA 3IFDA 2I46A 3Q22A 4R9WA 4P73A 1FYCA 2Z4HA 4A3MB 1DGSA 1EWHA 4RCNA 1JWUD 4CDFC 4X66L 2WAQE 4IURA 1IKMA 4DUZL 4KI0A 1XMQQ 4R4TA 1LV9A 4XYQA 1BO0A 3L3OC 4K8IA 4LUZA 5LL6X 5IYBH 1R4PB 4IFDH 4A3BH 1NUCA 2MFIA 3E9HA 3HOUB 1NE3A 1S5ED 2B8GA 2QDBA 2B2UA 1XYIA 1KIXA 2DGYA 4DAPA 3VR5A 3MFYA 4UAIA 3SEBA 2HQLA 2EVBA 2B63H 2RDGA 1Z6HA 2Z1CA 1K8GA 2IL8A 5HGQA 4QUFA 3MXNA 2K33A 3CAMA 3NWSA 1NR2A 5ELCA 1M1KC 5J1ZA 5CV5A 2DJGC 3I7FA 5DM73 4ZKBB 5AJ3Q 1Q90A 4X66Q 4FVMA 3K6OA 3SE0A 1E2WA 2JA8G 4MZ9A 4DUZQ 5CYUA 4KY5A 3PO3H 1VQ9A 1WTXA 4N8FA 1UE6A 1R4QB 2R7ZG 1Y8OB 4FXKC 5D3IB 2D0PA 4RHRA 4K2LA 4JOIC 4K8JA 3TQYA 4I7AA 1SN8A 1EU4A 4RGTA 3HOWG 1YJWA 3PF4A 4DFAA 3MHBA 1B8AA 2L0CA 3DEPA 3T56B 1C48A 3MXUA 2ZXOA 2A6HC 1HNZL 1H9MA 4R4OA 1WTVA 1L2FA 1L1OA 3RD4A 4JYAL 1HTPA 2R3ZA 4ZUJA 1JOOA 2BH8A 3QG1A 2F0PA 1TY0A 1Y1WB 2GN5A 1B44D 3TMEA 2XN9C 3F8TA 1K28A 3HOXH 1BR9A 2PZUA 4IN3A 3OMGA 2IPKD 3GTOB 3ONAB 2K05A 1V9PA 3DHQA 3GQBA 2EQSA 1PYBA 1P16A 4FF2A 4PZ6A 1AFPA 2IHEA 4FXGC 4A3MG 4GLAC 5ELDA 4RGOS 1OXTA 1NTGA 2Y0SG 1Q7YC 4L5RC 3I4OA 1YNJC 1HNZQ 5G3LD 2Q8TA 3GV3A 3NWTA 4A3LG 1UEAB 3TZUA 4JYAQ 2E2JH 5KRUA 4L5QA 1LO5D 2C9OA 3A74A 1G8ZD 2R7ZH 3F2UA 3NUCA 1EQQA 3VYUA 3RMHA 1BCPB 1JOQA 3URYA 4DR4L 3QIAA 5E1FA 5KIXA 1XJVA 3HOUG 3F2DA 4WJ3M 3H0GH 2LKVA 1EY0A 2UU9Q 4AH6A 2KA7A 4XT3B 1WYDA 1II3A 3BDLA 3E6ZX 4Y7NH 2OF1A 1SYBA 1KLGD 3I56A 2SNMA 4DXGA 2Q8IB 3NHHA 3Q6SA 3GO5A 5GQOA 1UWVA 3K7UC 4JI0L 3HOZH 3TS2A 2K75A 4DV5L 2HD3A 3L0OA 3PUVA 1SBBB 3EA6A 4A3IB 5G3LF 1DZ1A 2TSSA 2UXCL 1P8LA 1JWSD 5M5WB 5CORA 3S1RH 2VUMH 4HJ5A 2A8VA 3KOJA 4EQNA 1O7ZA 1UE1A 4DR4Q 3M4YA 4CKEA 4N9TA 1EL0A 3CQZH 2DN8A 1BCPC 1STEA 2JEBI 1QE6A 4L5TA 4A3JG 4ULLA 4FF4A 3MFGA 3K0XA 2DNCA 1E2ZA 1BF4A 1N8RC 3DUZA 1SYFA 3ICEA 1JMCA 1B53A 4IPDA 5C4XH 4IOCA 3CCMA 4JI0Q 1VQMA 3J7AV 2FMMA 4DV5Q 5GAGC 1RDPD 4XIGS 3OIQA 1Y1WG 4XQNA 1HUNA 3QWNA 4OO1H 2X6LA 4DKAC 1JB7A 2UXCQ 1SEBD 3EFXD 2VY3A 1VQKA 2JA7B 2LFNA 2X69A 4LNQA 1WVLA 1XNQQ 5E4XA 2HIXA 1TIID 1XX8A 3VR6A 2RVLA 2B2VC 3FRPB 1V43A 3JAMi 2B2WA 3MAQA 1HNXL 1G6ZA 3CCVA 1PXUA 5IT9c 3BZDB 2ZM6L 2R92H 1CSPA 3WOEA 3I55A 3T13A 3MVVA 4LF5Q 3D4RA 4IUVA 4EX5A 3KUPA 3CF5A 3H15A 4R4CA 1SNDA 2CWPA 2K5VA 2KCNA 3JAMc 4DN4M 1GKHA 5D3DA 2RCFA 2GA4B 2PQAB 3K81C 1EYAA 4LFAL 1WTQA 4A75A 1VQBA 1EY8A 1W2BA 5E4WC 1WOCA 5I6YA 3IL8A 5FKAC 3NENA 4WFN3 4RA8A 1AE2A 4ZQ3A 2ATWA 1HNXQ 5ELBA 1HCZA 1NY4A 1RKNA 3CXCA 1IBML 4QJFA 4A3FB 3ZYYX 2JN4A 1C4QA 1UE5A 4A3CG 4A3GG 4Z9CB 1BUVT 2G5DA 4YCUA 2O5IC 3IAYA 5FJ8H 1ASYA 3OMCA 3M9BA 4JI3L 2PYKA 5C3WA 1O7IA 5LMNQ 1YJNA 2LMCB 1LTLA 2A5HA 2LXKA 1S3OA 3QOLA 3U50C 1Y1WH 1BQQT 2L55A 2F0SA 3TBIB 1PA6A 1SROA 4RCOA 3CC7A 5J39A 4YY3L 3BZKA 4LFAQ 4NB3A 4IUTA 5M5YB 2OQKA 4L63B 1C7YA 3WOFA 3HKZB 2ID0A 3AU7A 3L2PA 3NEMA 3R2TA 3I4NG 3N6RA 1V1OA 1B50A 4JI1L 3UI2A 2J0TD 3NK9A 3OOCA 4K0KL 3JAML 5ELNA 4C3IH 4CJ1B 3HGBA 3P20A 2UUBL 1KRSA 2EYFA 3QR8A 3I4LA 2UXDL 1IBMQ 1IYUA 4K5WA 3KLRA 2OTLA 2K1BA 1Y8NB 4K6DA 1PH4A 4DK1A 1KAAA 2ES2A 1PFBA 2A74C 1RL2A 4IOAA 4JI3Q 1KC8C 3DLLA 2LY7A 4KKTA 1HA6A 1SYCA 4NDXA 2XIWA 3NE5B 4YY3Q 2JA7G 4AIMA 1X56A 3CHBD 3M7NA 1PH9A 2H1EA 1PTOD 2XGTA 3CCQA 4QCLA 1ET9A 1WI5A 5IP7H 5EPJA 2AWNA 3I2ZA 1S72A 1LTRD 4JI1Q 4DK6C 1HZ9A 4DNRB 2R93B 3GTPB 4K0KQ 4QIWB 1T5EA 1XTDA 2NBFA 4A3CH 2Z0SA 3I73A 1JICA 2UXDQ 4E6IA 4JI5L 5HURA 4BY1H 3TP5A 1QILA 1GM5A 4CKCA 4A3IH 4POGA 4JV5L 4P71A 3T1HL 1A63A 2B2VA 4F87A 2RQXA 4OGQC 2F0GA 1EY7A 3HOVH 3KBGA 4BBRB 2ZJQA 3CD6A 5IE8A 4C1NK 4A3EH 1QZHA 3AMUA 4KV6A 1HQMC 1J9OA 3ULJA 4DAMA 4FNFA 1ILPA 3KJPA 4M1UB 2WAQG 1PTOF 1QZGA 1CQVA 2XWJB 4A3FG 1D5ZC 4OL7A 5I2XA 5BN3A 4A3BB 2LS01 3CCLA 3UDIA 4B3ML 3TP8A 1ML0D 2JA5H 3KFUA 4TKOB 4IUNA 2PCFB 4JI5Q 4TVAB 1F9QA 1X65A 2ZJPA 1IW7C 3PCOB 2O2LD 2AHOB 1RF2D 3T1HQ 5IT9E 1JQYD 3PIP3 4O42A 4HJ9A 1K8OA 3A5ZB 5C0XI 1PH3A 3BJUA 3HKZG 2K28A 1LT3D 2RBMA 3EIVA 1VQDA 2PI2A 1DD2A 1CI3M 1NMGA 1SSOA 1OO9B 3BDOA 4DR1L 4DUYL 4CDDC 1SE2A 5IYCH 2N8NA 5EJWA 3PF5A 2MP1A 3OIPA 1ICWA 3X3MA 1NBWA 4CDCC 5J22A 4DR7L 4B3MQ 3BVGA 4GN5A 3A5UA 1TS5A 3WWVA 5FOBB 2A6ED 5JPNC 1VQAA 2UXBL 4JBMA 1X3GA 1TXYA 4J1MA 5EQ0A 4DPGA 2B2UC 1STYA 2K14A 1WD0A 3UDFA 2OCEA 1L1OB 5A35A 1EQRA 5EAYA 1N36L 2QEXA 1FVIA 1QJOA 2KBNA 1UUPA 1U4RA 4A3FH 5C4JB 1ILQA 4DR1Q 4DUYQ 2CVRA 4ZKCB 3GV6A 4HIMA 1Q86C 5C3EG 1XMOL 4ZCKA 1QVFA 1BVSA 3X3NA 2VS1A 1UEBA 2Z9HA 1TWFH 1PFMA 4N9PA 2HDLA 5M5YH 1JJGA 2KVMA 2UXBQ 3CMEA 4CJ0B 5JVH3 4YWLA 3OSOA 3G6EA 5IYDH 4KTAA 2NVQB 2BOSA 2X6GA 2Z6KC 4KN4C 2A69D 2JK8A 4DF7A 1N36Q 1VMCA 5IYBG 1L1OC 4A3BG 1HR0L 5IWAL 3F1ZA 5IGEA 2CFMA 2SOBA 4AQYL 3M85A 5LMUL 1GXDC 2FFKB 4Y7NB 4K5VA 1EIHA 1XTCD 3I72A 2IY5B 3TP6A 1LM0A 3H94A 1XMOQ 3L9AX 5IY0A 5CGKA 4U673 2F0MA 3QO2A 2R6GA 2PI2E 1HZBA 4AYBE 2AMCB 1X54A 5CV6A 3CCUA 2N49A 1ZEQX 3CPWA 2R93H 3HOYB 1JWMD 4OWTB 1SYDA 1WTHA 3E5SA 3STBC 1UAPA 5EBCA 3S1RB 5GAHC 1F9PA 4FDBA 2VUMB 1Y1VB 1O80A 2RF4A 1EWIA 2XSCA 3T16A 5IWAQ 4CBVA 1G2TA 1GUWA 2KCMA 1HUMA 3TP7A 4K14A 2NVXB 1PH6A 3CQZB 4NMZA 4AQYQ 3PO2H 2KENA 2B2YA 1VMPA 2NWGA 5C44B 5CMDA 3K5LA 1E7ZA 2MUYA 1H9RA 1MSGA 5AJ3L 1VQ7A 4BA1I 4BBRH 4QUCA 3MC0B 5C4XB 4ZYSA 4JI8L 1CFMA 4X3UA 2NTTA 2WV6D 1YI2A 3A55A 1R9TB 3S2HB 3M4PA 4KJOA 4LF8Q 3KYHC 1UE7A 1D5XC 2CKZB 2E2DC 3HOXG 3C3LA 2D2CC 2PQEA 4OX9L 5COYA 5A2QE 3KBXA 3FPPA 2RKSA 1STHA 1PTOB 2F03A 1E2VA 1GO3E 4YWKA 3FMCA 3A56A 3HKZE 3FP9A 2R92B 4C2MB 2R7FA 2BA0A 1O7YA 2JP1A 4I7ZC 4J15A 2HT1A 2MNAA 4UPAA 1IKLA 1QWYA 2F0QA 4DR5L 4EGVA 2XTIA 1H9KA 3S2DB 4JI8Q 2K03A 2Q2IA 4HMJA 4IUQA 3T53B 4KY6A 4UHVA 1K73C 5BR8L 5E7NA 2F0NA 3LX0A 3J7YW 1AZPA 1SLJA 4GS3A 4JVZA 3H0GG 2F0JA 4OWXB 4KD4A 2C5CA 3ITPA 4WRDA 1SNQA 1NMFA 4B9XA 4OX9Q 3DWPA 3W2DA 1D2BA 1KD1C 4DNIA 1RTNA 4EQPA 1I6VC 1JC7A 2Z6KA 4JK1C 5EPLA 4KN7C 3S16H 2QA4A 1NR4A 4P74A 1DJRD 3HOZG 1PTOC 1K0RA 1DYQA 2B2WC 3SXHA 1LACA 1LTTD 2WP8J 4DR5Q 4QIWE 5I4DA 3PGZA 5LL6S 5KNCA 2OQ0A 4BBSB 3HOYG 1XPRA 3J7AF 2YTXA 3DWQA 5GROA 5C4JH 4IJLA 5F2DA 2UU9L 4ZLTF 2VUMG 5BR8Q 4B3SQ 1O7LA 3OWEB 1Q3LA 3EROA 2PMZE 3WDNA 1KRTA 5DNFA 4PMWA 3NSWA 4JI7Q 5KEEA 4UP7A 4C3IB 3NP8A 3J81j 2XRSD 1W6KA 2C35B 5C4XG 4P72A 4OWWB 2PW5A 1PRTD 2O4XA 4A3KH 1M4VA 2NVQH 3H09A 3IRBA 1SE4A 3K80C 3CCSA 1RJTA 2ZJRA 4RGMA 1PDQA 5GAEC 3V96A 1X32A 3R3OA 1TS4A 1L0YB 2FHTA 4X6AH 4LF7L 4J6HA 4H7BA 1HA5A 1YNND 4OO1G 1TS3A 4IALA 2SEBD 1T5XD 1STGA 3FPUB 4F88A 3OPOA 2DJFC 1EY9A 3CC4A 5K36H 1E1TA 1HQRD 2I5MX 1MI2A 4CDEC 2GVBA 4BS9A 4R1JA 4A76A 1LT5D 4JW0A 3CCEA 2M9VA 2R92G 2K32A 1Q82C 3V05A 1BDOA 2DUDA 4X64L 3PQIA 5I9PA 2CWAA 1CM9A 4BY1B 5C0XH 3FVQA 3HOYH 1VS0A 1PRTF 2K52A 4HJ8A 1Q81C 1LT4D 4G7OC 1GUTA 1ET6A 1AH9A 1QB5D 4U68A 1C9OA 4FF3A 3O13A 3K5OA 1Y1VH 4LF7Q 2KQ3A 1XNQL 3C46A 2RDHA 1YZ6A 4KHZA 1EQVA 3HOVB 3LGJA 1GOZA 2CW0D 2NVXH 2JA9A 2EYLA 3NQIA 4A3EB 2BE5C 2EY5A 3AQQA 5BN5A 3CCJA 5C44H 4LF5L 3CRKC 3BYTB 2F52A 3HG9A 2KEEA 4EVOA 3F2BA 5JEAJ 4RFBA 1IXRA 2KCTA 2OTJA 3RZOB 2GVAA 4X64Q 5FJ8G 3SK4A 2JA5B 1I4XA 3SHLA 1MGSA 3MZ5A 1R9TH 1VQ8A 4GN3B 3NTHA 4NP5A 3S2HH 5ELFA 3H3VI 3OHXC 1IBKL 2AKWB 1TR5A 4DAYB 1XXGA 2OWOA 1NCVA 4A4IA 3SVMA 4DR3L 2L1BA 1PTOH 1KLUD 1PFSA 3MXGA 3G71A 4AYBB 4G7ZC 4HN7A 4C2MH 2QGQA 4C3IG 2NTSA 4DK3C 1KL9A 4B3TL 5LMNL 2E74C 2JEAI 5FLMH 3S2DH 1UNSA 3S17H 2E2HB 2WACA 1QCBD 1ENFA 3AYHB 3G7LA 2NN6I 4LJZC 1PH8A 2B8FA 1AZQA 3D3RA 2Q2HA 1GHKA 3CRLC 2E75C 1IYVA 3T1YQ 1SDFA 1IBKQ 2VQFL 4TQUS 4S3SA 2Q8RE 3G6JB 1KXLA 2B39A 5IP7G 4DR3Q 4ME5A 2QF7A 4WJ4A 4J8QA 4C3HB 4KKSA 1LUZA 4OELB 4KMUC 1K3RA 5IOCA 2IT1A 1SNOA 1HJPA 1DCZA 1DOMA 3RUZA 4GZYC 4B3TQ 1RIPA 3DM1A 4A93B 4FXDA 4BY1G 1KDAA 4DXFA 1QNKA 4BBSH 4WJWA 3J80c 4A3IG 1M90C 2ZXPA 3EVQA 1TWFB 5IT9L 3MEHA 2F0KA 2WKDA 3KLWA 1D8LA 1E3PA 3U9OA 4BWGB 3R93A 3G4SA 3U4VA 1EOVA 3QOJA 4V0BA 3LWEA 4JI4L 3HOVG 1ASZA 1I4GA 5ELOA 5JPMC 1F9RA 1QVCA 2IX3A 2VQFQ 3SDZA 3U9SA 1HR0W 4A3EG 1ZYRD 1FR3A 2ZXRA 3M3YB 1GHJA 5JEAG 1VQPA 4NXML 4KLKA 4PZ7A 2JA5G 4DV4L 3GTLB 4P2CB 3KF8A 1IL8A 2L12A 1YEZA 1HNWL 4JI2L 5IGGA 1B70B 4H02A 1EY4A 2F0FA 1MBYA 1ICFB 2NVYH 1B4OA 3VYRA 1KNEA 5HY6A 4QGUA 3D0FA 5ISRA 1A3VA 2R61A 1PH7A 4JC0A 4JI4Q 4AYBG 2HHHL 1LTAD 4DV3L 3AB9A 1TWCH 1WCMH 2YTYA 3TS0A 2K5NA 4X3TA 1YJ9A 3ERQA 4B3RL 2PO4A 2EZVA 2Z6BA 3S15B 5IYCG 2EE1A 1VF7A 5JJLA 1OXVA 4X3KA 1CA6A 1CUKA 4Q0FA 2XWBB 1SFOB 2H4OA 5EGTA 4NXMQ 1I50B 4DV4Q 4FYDA 2F0IA 4GOPB 1BBWA 1IYJB 2EY1A 3TSSA 1BKBA 3S1NB 3PO2B 2PMZB 1B3AA 1F2ZA 4DK0A 2HCIA 1CSQA 3OW2A 1HNWQ 4JI2Q 5KYIA 1DM0B 2ZT9C 5M3MB 4BXXG 1PVOA 3GTGH 2DY7A 1U4PA 1SMXA 1PRTB 1EOTA 5FLXc 1AW7A 3KK7A 1H95A 4C3HG 3P7JA 3CPFA 1CZWA 2HHHQ 4DV3Q 4FP5D 1W6JA 2EJFC 5C5MA 5JEAH 3J7ZC 1PFNA 1RCVD 1A6XA 3RZOH 3K57A 2TMPA 4B3RQ 1AN8A 3VA7A 3PIOA 2R7DA 4UY8C 2D0OA 1N32L 1I5FA 1FL0A 3DXJC 4DAYA 1FGBD 1VQHA 1D5MC 1F77A 1X55A 2KCCA 5M3FB 5E3FA 3NBHB 3KDFB 5IYDG 1J8IA 2B2YC 2LSSA 3NXWA 3M7GA 1H9SB 1VQOA 5JJKA 1EQTA 2N78A 3DM3A 1VF5C 4NW2A 2WB1B 4XQJA 2BDNA 5JVG3 4K5XA 4KJNA 2HDMA 2EXDA 5CV7A 1PZID 4CJ2C 2E2HH 3W5OA 3A54A 4XT1B 4LFCQ 2ZTCA 3EN2A 1NSNS 3SK6A 1EFID 2LXJA 3S1MH 1O78A 4IPCA 2PPBC 2F3WA 1VQFA 4DR6L 1YNNC 2RHQB 5FLXL 1TS2A 2J4XA 4NPSA 1PZJD 1GUNA 3S14H 1KTKA 1Q12A 3BZCA 2IWHA 1B9NA 4BXXH 1N32Q 2CHBD 1X6OA 4LFBL 2BDOA 3HP3A 3ND8A 3S16B 4PNYA 1DXMA 5BN4A 1S5CD 1CKMA 1EUJA 4ALPA 4GLXA 2EYJA 2B2TA 4C3HH 1IBLL 3J80E 2D5DA 3LNNA 1HZAA 2R93G 2QW7A 4EQOA 1D6EC 1K0SA 4HJ7A 1FGUA 2K04A 4KD3A 4HIOA 1C8CA 3MA2B 2J7ZA 3E0JA 4A93H 2F0EA 5A2QL 3D4DA 2AQ1B 2XRQD 1S4ZA 3EQLC 1VQCA 2NZOA 2JQOA 3Q24A 3KF6A 3PO2G 1LYLA 2NYZD 3D6WA 1EWCA 4DR6Q 4ZUIA 1HZCA 5H1SE 5T1GA 1OTCA 2EJMA 3PUXA 3JC66 1B9MA 1E22A 5M5XH 4BBRG 3I4MB 4LFBQ 4A3KB 3C1EA 4UP9A 1G291 2CH4A 2JYOA 3PUZA 1K83B 3M3YH 1HXYD 3ULPA 1K8AC 1IBLQ 2I0QA 1EFWA 3BDCA 1EIFA 4DV0L 4NXNQ 4HSPA 1PMRA 2JA6H 3GTMH 1G51A 1KDCA 4HTHA 4RHSA 1N33L 1PZKD 2FXQA 3GTLH 3NBIA 5IP9G 4QB4A 2VZAA 3RZDB 2JA8B 1CTMA 4OIJA 2YYZA 3RLFA 4MN3A 3HEJA 1OXSC 1E24A 4CGYB 4Q5VA 3H3VH 1RTOA 4HR7B 5KYLA 5CC4A 3BVMA 3AEVA 4H44C 4IUPA 4LWCA 4LF8L 5C0XJ 4YHHL 5CV4A 2F0HA 4GN4B 2MGSA 2E2IB 3FEWX 4KKUA 3S15H 1QNUA 2N3SA 4DV0Q 3HZXA 2F0OA 1N33Q 1EEID 1SFOH 1TVXA 1J6QA 1QOHA 3V2TA 1I50H 1VQ4A 4G7HC 4DV1L 3PIO3 3M4OB 3S1NH 4GOPA 1VQJA 5FLXE 1SXTA 2AUJD 1JE5A 5DLQE 1BXTA 3T51B 3BVZA 3VDYA 3J81E 2NN6H 5M3MH 4R4QA 4H0LC 4IPHA 1MIUA 2ALYB 4N8X1 2VB3X 2K4KA 4JBWA 5C4HA 1WTOA 2VNUD 4PZ8A 2K7VA 4PMBA 4L8JA 4R8IA 1LTSD 1Q1EA 4YHHQ 2UUAQ 1HHVA 5FK9C 1GVPA 1ESFA 2QEJC 3CKIB 3MWYW 2A68D 3K5MA 1IZ6A 2AWOA 1A2UA 4ZK9B 4LUOA 3UDGA 5IP9H 1F2LA 3Q23A 5DM63 2Y0SB 2RDFA 2DY8A 5D14A 1C0AA 1XPOA 1SNMA 3E9IA 5LMNW 4K2KA 2F4IA 1S5FD 2CCZA 1D1KA 4DV1Q 3KJOA 3A7AB 4DU9A 2EYHA 1TKWB 1Y14B 1IHZA 1Z9FA 5M9OA 5M3FH 3W3AA 2YU9B 3EBEA 3NBHA 1EIGA 3I4MG 1KDBA 3U4ZA 4C3JH 4GLVB 3L7ZC 1ZYRC 2JSOA 3FKIH 4A3KG 3KDFA 1VCIA 3SK8A 3S17B 4CHTB 2EXZA 3C1FA 1GUGA 1Y69U 2BA1A 2Q2TA 1H9SA 3IFTA 2Z4IA 3BS1A 2OT2A 4GKJL 2QILA 2VL6A 4B3SL 2L15A 4LUVA 1V1QA 1KAWA 4BY7H 1JT8A 1U9RA 1PYWD 5C4ZA 1AEXA 2EPBA 2B3GA 2EY6A 4JI7L 3S1QB 5K36G 5D65A 4HCSA 1STAA 1HTLD 1FJGL 5IIFA 4OHJA 4RGNA 1CA5A 2NUCA 3K0YA 4ILWA 4O1NA 2SNSA 1QVGA 1MD2D 4HSVA 1TWHB 3ZJYC 1EYCA 3C2PA 1ENCA 1JE4A 2F0WA 1TY2A 1QG7A 3NPPA 2K5DA 2E5LL 4OONA 4P75A 3I90A 5C0XG 2A73B 2BCOA 1X9NA 4A3JB 1SMYD 1GD7A 2I07B 2WFWA 4GKJQ 1TU2B 1Y1VG 5JJZA 1SYEA 2I5LX 4RKBA 4ZAIA 4A3DB 3R8BA 1BBXC 1CQFA 1B7YB 4GKKL 5C44G 3PUWA 1FJGQ 4PV1C 5EBDA 2EYOA 1IW7D 4XYOA 3I4MH 1VQIA 2MO1A 3EJIA 1EEFD 4LK1C 2Q2UA 4DV7L 1KNAA 2IX0A 2I5HA 1K83H 3KF8B 4JCVE 2E5LQ 3HFZB 4RG1A 4M8AA 4OXPA 1MSHA 1G2SA 3OW7A 3PSIA 3CCRA 1ESRA 2NVYB 1S5DD 4HIDA 1I4HA 3RZDH 2JA8H 3N52A 1SJED 3P75A 1CK1A 2V4DA 5EPKA 1TWCB 3BG3A 1WCMB 1I4RA 2MPMA 1TWAB 4QY7A 2IX1A 5ELEA 2JXMB 4GKKQ 2EOTA 5GADC 5CV8A 3HOWH 5DAUA 5FLMG 1QUQA 3K59A 2PNRC 2OXPA 4JBKA 2QCPX 1X3QA 2WB1E 4DV7Q 1I6HB 2E2IH 1GUSA 1DOLA 1PHJA 1SAPA 4HIKA 1Z7TA 1D1IA 4XQQA 2ICIA 4GNXB 4RMFA 3K58A 4A3GB 1DOKA 3GTGB 2PNHA 3M4OH 4OIKA 5FO9B 4BA2I 1F2MA 1L0XB 2A6EC 4JBJA 5AFWA 2L4NA 2RSOA 4F7XA 4DV2L 2UUCL 3I70A 4IUUA 3CC2A 3MEFA 3NQTA 2DNEA 2NB0A 3K7AH 1KABA 1SRUA 2CQOA 1U4LA 2F0TA 2HCCA 3I4NB 2A19A 5JJIA 1VQNA 4BBSG 2WKCA 1KQSA 1CT1D 3K8AA 3VR3A 5FO8B 1VQ6A 3B6YA 3T1YL 1EIYB 1OXUA 1YNXA 4FF1A 4A3MH 1J5EL 2NZHA 2NVTB 3D31A 1N34L 2D62A 5K5PA 2FJ2A 1VQ5A 1VQLA 1PH1A 4A3DG 3PMFA 4JOIA 1K9MC 4Y52H 3P1HA 1NJIC 1G91A 1X3EA 4IJHA 4A3LH 3FDTA 1SR3A 3W1BA 2G9HD 1CKOA 2OEOA 1I94L 2B29A 4X62L 4DV2Q 4GNXC 2UUCQ 3HOUH 1E1OA 2YU9H 2F1MA 2K5HA 2WINB 1MJEA 3PUYA 3CW2C 3HKSA 4IO9A 2XNAC 2YV5A 1U4MA 2A69C 1BBUA 1HH2P 2RHSB 3MTSA 3S1MB 3ULLA 1JJCB 4G4KA 2RA4A 3GTQB 4V190 1SE8A 1A62A 4APVA 1D7QA 4RAUC 1LT6D 1I3QB 3A8KE 3ER0A 2EDGA 3S14B 4OEMB 4XDXA 3ERSX 1EYDA 1J5EQ 3STBD 3NELA 3S24A 1N34Q 2MJ8A 4KK7A 3S1QH 4IPGA 3CU7A 1KHIA 4X65L 3J80i 3A8IE 1CKNB 1TWGB 3S9WA 1K8MA 3MXPA 1LTID 1WCMG 1TWHH 3GDEA 2F0VA 3D4WA 5T1IA 3TZDA 4B9WA 4HMIA 3GTKB 1I94Q 4X62Q 3I91A 3PIPA 1ZXTA 2FINB 4UDUC 1CHQD 3DWAA 4FO2A 5CBAE 2ASBA 3D8GA 2CH4W 4A3JH 4IFDI 3KF6B 3RR5A 2WAQB 1FNVA 3PV0A 2FMCA 2N55A 2N88A 1HFNA 1V1PB 3A7LA 4LAAA 3F2CA 2ZM6Q 5CV9A 4A3DH 2KHSA 3AFQA 3K5NA 1WTWA 2KEDA 2L5TA 5M5XB 2KJXA 3SK5A 2F4VL 4ME3A 2D9UA 1EZ6A 2JJQA 2F3VA 5CR3A 5HGTA 4X65Q 1XPUA 1OXXK 4R8NA 3H91A 5C6AA 4MIUA 4XTCS 3VA5A 3OTOL 4IQZA 2JA6B 3GTMB 1FNUA 3GTOH 5FO7B 1CHPD 1EYGA 1CZGA 2B2TC 3HRZC 1GJXA 1IL2A 3KLSA 1JB3A 3H6MA 1X3PA 1H9JA 4MNOA 2F3IA 1JOKA 4L5SA 1M8AA 1Y8PB 2K50A 2Y0SE 2A68C 1YITA 1JORA 4LF6L 1SE3A 1Q46A 4O2DA 3I8ZA 1F2YA 2F0DA 1YVCA 3Q8DA 4IZ8A 1RD9D 1BOSA 1W3SA 2ICEC 2V1CC 5L37A 1HFGA 3J80L 2F4VQ 1TWAH 2EYMA 1YBYA 1YHBA 1SJHD 4RKLA 5IGDA 2A6HD 2JE6I 2HQEA 4G57A 3OTOQ 1U5KA 3IKJA 1S5BD 2KECA 1NNXA 2A1AA 4K6LA 1I6HH 2QKIC 4R4IA 3J81i 2WIIB 2KHIA 4DNTB 1VQEA 2PZTA 2UUBQ 1I4PA 4QF4A 4LF6Q 1Q1BA 4GNXA 2L11A 4A3GH 1YHAA 1A3TA 2PW7A 4DV6L 5C3EB 1G6PA 3GTJB 4C1NI 1HRJA 3VYTA 5LHY1 1B3QA 2O5JC 3J81c 4L6TB 5M5WH 1YHQA 4DGZA 2H5XA 1V8QA 1U0LA 2EYPA 3H3VC 4EQ5A 4LMQD 4LFCL 4UP8A 4RWSC 2K01A 2BH2A 3I4NH 4A93G 1PH2A 1DONA 1Q8IA 5EKKA 3RN2A 2CQAA 2NZ1D 3J7A5 3D6CA 3A8JE 1ZKOA 3E0EA 5C3XA 1YNJD 5IGCA 1SMYC 2ZTDA 4JPBW 2NVTH 1NAPA 2AQ3B 3CP0A 4ABNA 2KHJA 1MKHA 5DEHA 4IFDJ 3VYSA 5KNBA 2F0UA 1T9HA 4QL5A 4QMGA 1K3BC 4WORA 4ZRZA 4KY7A 1A0IA 4DR2L 4C3JB 4GOPC 1PH5A 4C56C 3E3XA 3FKIB 3GP7A 2M2LA 3T4AC 2HIVA 1WFQA 4DV6Q 5IGBA 2B63B 4I65A 4JV5Q 4HAEA 1VQGA 3TREA 1MHWC 3MXNB 2VQEL 2JA6G 1PRTC 1WTPA 3VR2A 2MHVA 3TDQA 4LF4L 2G9DA 2JA7H 1JR0D 5EKIA 1STBA 2AQ2B 1Z47A 2AUKA 5I9OA 1WJJA 2Z8LA 1RODA 4BY7B 5J3BA 1PV4A 3BU2A 3GTQH 1LABA 3JAME 3ND9A 1I3QH 4O0AA 4QQBX 1F9SA 3PO3B 1LTGD 4LF9L 4PG3A 3J81L 1LTBD 4DA2A 4JI6L 1A8VA 2ENBA 1A2TA 2EY2A 1PLFA
chains in the Genus database with same CATH topology
1FNWA 4TRDA 2VB2X 3NTIA 4H13C 1AP0A 2RSNA 3DEOA 1RHPA 4PMCA 3DMUA 1BCPD 5KGUA 4NKLA 3SR1A 2EJGC 3QJYA 2XVSA 2BE5D 1TQOA 5EKLA 3TN2A 4XXEA 1GUOA 1XWEA 2L9HA 1STNA 4F8MA 2VXWA 4MHEA 2PZWA 4OO1I 1ONLA 1V1PA 2NN6G 1EU3A 2HUGA 3HOXB 2CW0C 2IW3A 4YIJA 1EZ8A 3GD7A 1B2TA 4ODGA 1HPCA 1EY5A 5IGFA 5KNDA 4HEDA 2E76C 1BCPF 5I2YA 1E0BA 4HCEA 4PQXA 1A15A 1FD7D 1A3UA 2K5WA 3R2IA 1ENAA 5CBEE 3LWUA 1WD1A 3BYYB 4ID6A 2KOLA 5I6WA 2E2JB 2SDFA 2R7ZB 1SNCA 1TT2A 4IFDG 3VR4A 2KUMA 3Q0AA 4TSSA 5JAVA 1VDZA 3H0GB 4C3JG 3HOWB 4KHVA 4RH6A 1EY6A 5IODA 1B1ZA 2IJ0A 1SYGA 3KLSX 3HOZB 5JOBA 1WTRA 1JCKB 1I4QA 3QB3A 2M00A 1BNZA 3HS0C 4DAVA 1LLRD 4CKBA 2K6AA 3NTKA 5TSSA 4B08A 2K5QA 3K7AB 1SNPA 3OWFA 3I3CA 5C5LA 4X3SA 5NUCA 2F0LA 3IFDA 2I46A 3Q22A 4R9WA 1FYCA 2Z4HA 4A3MB 1EWHA 4RCNA 1JWUD 4IURA 1IKMA 4KI0A 1LV9A 4XYQA 1BO0A 3L3OC 4K8IA 5LL6X 1R4PB 4IFDH 1NUCA 3HOUB 1S5ED 2B8GA 2QDBA 2B2UA 1XYIA 4DAPA 3VR5A 3MFYA 4UAIA 3SEBA 2EVBA 2RDGA 1Z6HA 2Z1CA 2IL8A 4QUFA 3MXNA 2K33A 3NWSA 1NR2A 5ELCA 5J1ZA 5CV5A 5DM73 4ZKBB 1Q90A 4FVMA 3K6OA 3SE0A 1E2WA 5CYUA 4KY5A 1WTXA 1R4QB 1Y8OB 4FXKC 5D3IB 4RHRA 4K2LA 4K8JA 1EU4A 4RGTA 4DFAA 3MHBA 2L0CA 3DEPA 3T56B 1C48A 3MXUA 2ZXOA 2A6HC 1H9MA 1WTVA 3RD4A 1HTPA 2R3ZA 4ZUJA 1JOOA 3QG1A 2F0PA 1TY0A 1Y1WB 1B44D 3TMEA 2XN9C 1BR9A 2PZUA 4IN3A 3OMGA 2IPKD 3GTOB 3ONAB 2K05A 3DHQA 3GQBA 4FF2A 1AFPA 4FXGC 5ELDA 4RGOS 1OXTA 1YNJC 5G3LD 2Q8TA 3GV3A 3NWTA 1UEAB 3TZUA 5KRUA 1LO5D 2C9OA 1G8ZD 3F2UA 3NUCA 3VYUA 3RMHA 1BCPB 1JOQA 3URYA 3QIAA 5E1FA 5KIXA 2LKVA 1EY0A 2KA7A 4XT3B 1II3A 3BDLA 3E6ZX 2OF1A 1SYBA 1KLGD 2SNMA 4DXGA 2Q8IB 3NHHA 3Q6SA 3GO5A 3PUVA 1SBBB 3EA6A 4A3IB 5G3LF 1DZ1A 2TSSA 1JWSD 5M5WB 5CORA 4EQNA 1O7ZA 3M4YA 4CKEA 4N9TA 1EL0A 2DN8A 1BCPC 1STEA 2JEBI 1QE6A 4ULLA 4FF4A 3MFGA 2DNCA 1E2ZA 1BF4A 3DUZA 1SYFA 1B53A 3J7AV 2FMMA 1RDPD 4XIGS 3OIQA 1HUNA 4XQNA 3QWNA 4OO1H 2X6LA 1SEBD 3EFXD 2JA7B 2LFNA 2X69A 1WVLA 5E4XA 1TIID 1XX8A 3VR6A 2RVLA 2B2VC 3FRPB 1V43A 3MAQA 2B2WA 1G6ZA 1PXUA 3BZDB 3WOEA 3T13A 3MVVA 3D4RA 4IUVA 3KUPA 1SNDA 2KCNA 4DN4M 5D3DA 2GA4B 1EYAA 1WTQA 1EY8A 5E4WC 5I6YA 3IL8A 5FKAC 4WFN3 4RA8A 4ZQ3A 5ELBA 1HCZA 1RKNA 4A3FB 3ZYYX 1C4QA 4Z9CB 1BUVT 2O5IC 3IAYA 3OMCA 2PYKA 5C3WA 2LMCB 2A5HA 3QOLA 1BQQT 2L55A 2F0SA 3TBIB 4RCOA 5J39A 4IUTA 5M5YB 4L63B 3WOFA 3HKZB 2ID0A 3AU7A 3R2TA 3N6RA 1V1OA 1B50A 3UI2A 2J0TD 3NK9A 3OOCA 3JAML 4CJ1B 3HGBA 3P20A 2EYFA 3I4LA 1IYUA 4K5WA 3KLRA 2K1BA 1Y8NB 4K6DA 4DK1A 1KAAA 1PFBA 2A74C 2LY7A 4KKTA 1HA6A 1SYCA 4NDXA 2XIWA 3NE5B 3CHBD 3M7NA 2H1EA 1PTOD 4QCLA 1ET9A 5EPJA 2AWNA 1LTRD 4DNRB 2R93B 3GTPB 4QIWB 1T5EA 2NBFA 3I73A 1JICA 4E6IA 5HURA 3TP5A 1QILA 4CKCA 2B2VA 4F87A 2RQXA 4OGQC 2F0GA 1EY7A 3KBGA 4BBRB 4C1NK 3AMUA 4KV6A 1HQMC 1J9OA 4FNFA 1ILPA 4M1UB 1PTOF 1CQVA 2XWJB 1D5ZC 4OL7A 5I2XA 5BN3A 4A3BB 2LS01 3TP8A 1ML0D 4TKOB 4IUNA 2PCFB 1F9QA 1IW7C 2O2LD 1RF2D 5IT9E 1JQYD 3PIP3 4O42A 1K8OA 5C0XI 2K28A 1LT3D 2RBMA 1DD2A 1CI3M 1SSOA 1OO9B 3BDOA 1SE2A 5EJWA 2MP1A 3OIPA 1ICWA 3X3MA 5J22A 3BVGA 1TS5A 5FOBB 2A6ED 5JPNC 4J1MA 5EQ0A 2B2UC 1STYA 1WD0A 5A35A 1QJOA 1UUPA 1U4RA 5C4JB 1ILQA 2CVRA 4ZKCB 3GV6A 3X3NA 1PFMA 4N9PA 2HDLA 2KVMA 4CJ0B 5JVH3 3OSOA 4KTAA 2NVQB 2BOSA 2X6GA 4KN4C 2A69D 4DF7A 1VMCA 5IGEA 2SOBA 3M85A 1GXDC 2FFKB 4Y7NB 4K5VA 1EIHA 1XTCD 3I72A 3TP6A 3H94A 3L9AX 4U673 5CGKA 2F0MA 3QO2A 2R6GA 5CV6A 1ZEQX 3HOYB 1JWMD 1SYDA 3E5SA 1UAPA 5EBCA 3S1RB 1F9PA 2VUMB 1Y1VB 1O80A 2XSCA 3T16A 4CBVA 1G2TA 1GUWA 1HUMA 3TP7A 4K14A 2NVXB 3CQZB 4NMZA 2B2YA 1VMPA 2NWGA 5C44B 5CMDA 3K5LA 2MUYA 1H9RA 1MSGA 4BA1I 4QUCA 3MC0B 5C4XB 4ZYSA 1CFMA 4X3UA 2NTTA 2WV6D 3A55A 1R9TB 3S2HB 4KJOA 1D5XC 2E2DC 3C3LA 2D2CC 2PQEA 5COYA 5A2QE 3KBXA 3FPPA 2RKSA 1STHA 1PTOB 2F03A 1E2VA 3FMCA 3A56A 2R92B 4C2MB 2BA0A 1O7YA 2JP1A 4I7ZC 1IKLA 1QWYA 2F0QA 4EGVA 1H9KA 3S2DB 2K03A 4HMJA 4IUQA 3T53B 1PLFA 4KY6A 2F0NA 3LX0A 3J7YW 1AZPA 2F0JA 4KD4A 2C5CA 3ITPA 4WRDA 1SNQA 4B9XA 3DWPA 3W2DA 1D2BA 1RTNA 4EQPA 1I6VC 1JC7A 4JK1C 5EPLA 4KN7C 1NR4A 1DJRD 1PTOC 1DYQA 2B2WC 3SXHA 1LACA 1LTTD 2WP8J 5I4DA 5LL6S 5KNCA 4BBSB 3J7AF 3DWQA 5F2DA 4ZLTF 1O7LA 3OWEB 1Q3LA 3EROA 3WDNA 5DNFA 4PMWA 3NSWA 5KEEA 4C3IB 3NP8A 2XRSD 1W6KA 2PW5A 1PRTD 2O4XA 1M4VA 3H09A 1SE4A 1RJTA 4RGMA 1PDQA 3V96A 1X32A 3R3OA 1TS4A 1L0YB 2FHTA 4J6HA 4H7BA 1HA5A 1YNND 4OO1G 1TS3A 4IALA 2SEBD 1T5XD 1STGA 3FPUB 4F88A 3OPOA 1EY9A 5K36H 1HQRD 1MI2A 4BS9A 1LT5D 2M9VA 2K32A 3V05A 1BDOA 5I9PA 1CM9A 4BY1B 5C0XH 3FVQA 1PRTF 1LT4D 4G7OC 1GUTA 1ET6A 1QB5D 4U68A 4FF3A 3O13A 3K5OA 2KQ3A 3C46A 2RDHA 4KHZA 1EQVA 3HOVB 1GOZA 2CW0D 2EYLA 3NQIA 4A3EB 2BE5C 2EY5A 5BN5A 3CRKC 3BYTB 3HG9A 2KEEA 4EVOA 5JEAJ 4RFBA 3RZOB 3SK4A 2JA5B 1I4XA 3SHLA 1MGSA 3MZ5A 4NP5A 3NTHA 5ELFA 3OHXC 1TR5A 1XXGA 1NCVA 3SVMA 2L1BA 1PTOH 1KLUD 3MXGA 4AYBB 4G7ZC 4HN7A 4C3IG 2NTSA 2E74C 2JEAI 1UNSA 2E2HB 2WACA 1QCBD 1ENFA 3G7LA 2NN6I 4LJZC 2B8FA 1AZQA 3D3RA 1GHKA 3CRLC 2E75C 1IYVA 1SDFA 4TQUS 4S3SA 2Q8RE 3G6JB 2B39A 4ME5A 2QF7A 4J8QA 4C3HB 4KKSA 4KMUC 5IOCA 2IT1A 1SNOA 1DCZA 1DOMA 3RUZA 4GZYC 3DM1A 4A93B 4FXDA 1KDAA 4DXFA 1QNKA 4WJWA 2ZXPA 3EVQA 1TWFB 5IT9L 3MEHA 2F0KA 2WKDA 3U9OA 4BWGB 3R93A 3QOJA 4V0BA 3LWEA 1I4GA 5JPMC 1F9RA 2IX3A 3SDZA 3U9SA 1ZYRD 1FR3A 2ZXRA 3M3YB 1GHJA 5JEAG 3GTLB 4P2CB 3KF8A 1IL8A 2L12A 5IGGA 1EY4A 2F0FA 1MBYA 1B4OA 3VYRA 1KNEA 5ISRA 1A3VA 2R61A 1LTAD 3AB9A 4X3TA 3ERQA 2PO4A 2EZVA 3S15B 2EE1A 1VF7A 1OXVA 4X3KA 1CA6A 4Q0FA 2XWBB 1SFOB 2H4OA 5EGTA 1I50B 4FYDA 2F0IA 3TSSA 2EY1A 3S1NB 3PO2B 2PMZB 1B3AA 1F2ZA 4DK0A 2HCIA 5KYIA 1DM0B 2ZT9C 5M3MB 2DY7A 1U4PA 1PRTB 1EOTA 1AW7A 3KK7A 4C3HG 3P7JA 1CZWA 4FP5D 1W6JA 2EJFC 5C5MA 5JEAH 1PFNA 1RCVD 1A6XA 3K57A 2TMPA 1AN8A 3VA7A 3DXJC 4DAYA 1FGBD 1D5MC 1F77A 2KCCA 5M3FB 5E3FA 1J8IA 2B2YC 3NXWA 3M7GA 1H9SB 1EQTA 1VF5C 4NW2A 2WB1B 4XQJA 2BDNA 5JVG3 5CV7A 4K5XA 2HDMA 4KJNA 1PZID 4CJ2C 3A54A 4XT1B 3SK6A 1NSNS 1EFID 1O78A 2PPBC 2F3WA 1YNNC 5FLXL 1TS2A 2J4XA 1PZJD 1GUNA 1KTKA 1Q12A 2IWHA 1B9NA 2CHBD 2BDOA 3HP3A 3ND8A 3S16B 4PNYA 1DXMA 5BN4A 1S5CD 2EYJA 2B2TA 3J80E 2D5DA 3LNNA 4EQOA 1D6EC 2K04A 4KD3A 1C8CA 2J7ZA 3MA2B 3E0JA 2F0EA 5A2QL 3D4DA 2AQ1B 2XRQD 1S4ZA 3EQLC 3Q24A 2NYZD 3D6WA 1EWCA 4ZUIA 5T1GA 2EJMA 3PUXA 1B9MA 3I4MB 4A3KB 3C1EA 1G291 2JYOA 3PUZA 1K83B 1HXYD 3BDCA 4HSPA 1PMRA 1KDCA 4HTHA 4RHSA 1PZKD 3NBIA 4QB4A 3RZDB 2JA8B 1CTMA 4OIJA 2YYZA 3RLFA 4MN3A 3HEJA 1OXSC 4CGYB 4Q5VA 1RTOA 4HR7B 5KYLA 5CC4A 3BVMA 4H44C 4IUPA 5C0XJ 5CV4A 2F0HA 2MGSA 2E2IB 3FEWX 4KKUA 1QNUA 3HZXA 2F0OA 1EEID 1TVXA 1QOHA 3V2TA 4G7HC 3PIO3 3M4OB 5FLXE 1SXTA 2AUJD 1BXTA 3T51B 3BVZA 3J81E 2NN6H 4H0LC 2VB3X 4JBWA 5C4HA 1WTOA 2VNUD 2K7VA 4PMBA 4L8JA 4R8IA 1LTSD 1Q1EA 1HHVA 5FK9C 2QEJC 1ESFA 3CKIB 3MWYW 2A68D 3K5MA 2AWOA 4ZK9B 1F2LA 3Q23A 5DM63 2Y0SB 2RDFA 2DY8A 5D14A 1SNMA 4K2KA 2F4IA 1S5FD 1D1KA 3A7AB 4DU9A 2EYHA 1TKWB 1IHZA 5M9OA 3W3AA 2YU9B 3NBHA 1EIGA 1KDBA 3L7ZC 1ZYRC 2JSOA 1VCIA 3SK8A 3S17B 4CHTB 2EXZA 3C1FA 1GUGA 1Y69U 2BA1A 1H9SA 3IFTA 2Z4IA 3BS1A 2OT2A 2QILA 1U9RA 1PYWD 5C4ZA 1AEXA 2EPBA 2EY6A 3S1QB 5K36G 5D65A 4HCSA 1STAA 1HTLD 5IIFA 4OHJA 4RGNA 1CA5A 2NUCA 3K0YA 4ILWA 4O1NA 2SNSA 1MD2D 4HSVA 1TWHB 1EYCA 3C2PA 1ENCA 1JE4A 2F0WA 1TY2A 1QG7A 3NPPA 2K5DA 3I90A 5C0XG 2A73B 2BCOA 4A3JB 1SMYD 2I07B 1TU2B 5JJZA 1SYEA 4RKBA 4ZAIA 4A3DB 3R8BA 1BBXC 1CQFA 3PUWA 4PV1C 5EBDA 2EYOA 1IW7D 4XYOA 3EJIA 1EEFD 4LK1C 1KNAA 2IX0A 4M8AA 1MSHA 1G2SA 3OW7A 1ESRA 2NVYB 1S5DD 1I4HA 3N52A 1SJED 3P75A 1CK1A 2V4DA 5EPKA 1TWCB 3BG3A 1WCMB 1I4RA 2MPMA 1TWAB 2IX1A 5ELEA 2JXMB 2EOTA 5CV8A 5DAUA 3K59A 2PNRC 2OXPA 2QCPX 1X3QA 1I6HB 1GUSA 1DOLA 1SAPA 1Z7TA 1D1IA 4XQQA 2ICIA 3K58A 4A3GB 1DOKA 3GTGB 4OIKA 5FO9B 4BA2I 1F2MA 1L0XB 2A6EC 5AFWA 2L4NA 2RSOA 4F7XA 3I70A 4IUUA 3NQTA 2DNEA 2NB0A 1KABA 1U4LA 2F0TA 2HCCA 3I4NB 2WKCA 1CT1D 3VR3A 5FO8B 1OXUA 4FF1A 2NVTB 3D31A 2D62A 5K5PA 2FJ2A 3PMFA 3P1HA 1G91A 3FDTA 2G9HD 2OEOA 2F1MA 2WINB 3PUYA 2XNAC 1U4MA 2A69C 3MTSA 3S1MB 4G4KA 2RA4A 3GTQB 4V190 4RAUC 1LT6D 1I3QB 3A8KE 2EDGA 3S14B 4XDXA 1EYDA 2MJ8A 4KK7A 3CU7A 3A8IE 1TWGB 3S9WA 1K8MA 3MXPA 1LTID 2F0VA 3D4WA 5T1IA 3TZDA 4B9WA 4HMIA 3GTKB 3I91A 1ZXTA 2FINB 4UDUC 1CHQD 3DWAA 4FO2A 5CBAE 3D8GA 4IFDI 2WAQB 1FNVA 3PV0A 2FMCA 2N55A 2N88A 1HFNA 1V1PB 3A7LA 4LAAA 5CV9A 2KHSA 3K5NA 1WTWA 2KEDA 2L5TA 5M5XB 2KJXA 3SK5A 2D9UA 1EZ6A 2F3VA 5CR3A 5HGTA 1OXXK 4R8NA 3H91A 5C6AA 4MIUA 4XTCS 3VA5A 4IQZA 2JA6B 3GTMB 1FNUA 5FO7B 1CHPD 1CZGA 2B2TC 3HRZC 1GJXA 3KLSA 1JB3A 3H6MA 1X3PA 1H9JA 1JOKA 1M8AA 1Y8PB 2A68C 1JORA 1SE3A 3I8ZA 1F2YA 2F0DA 4IZ8A 1RD9D 1BOSA 2ICEC 3J80L 1HFGA 2EYMA 1SJHD 4RKLA 5IGDA 2A6HD 2JE6I 2HQEA 4G57A 3IKJA 1S5BD 2KECA 4K6LA 2QKIC 2WIIB 4DNTB 2PZTA 1I4PA 4QF4A 1Q1BA 2L11A 1A3TA 2PW7A 5C3EB 3GTJB 4C1NI 1HRJA 3VYTA 5LHY1 2O5JC 4L6TB 4DGZA 1V8QA 3H3VC 2EYPA 4LMQD 4RWSC 2K01A 1DONA 1Q8IA 5EKKA 2CQAA 2NZ1D 3D6CA 3A8JE 1ZKOA 5C3XA 1YNJD 5IGCA 1SMYC 1NAPA 2AQ3B 4ABNA 5DEHA 4IFDJ 3VYSA 5KNBA 2F0UA 4QMGA 4WORA 4ZRZA 4KY7A 4C3JB 4C56C 3FKIB 3GP7A 2M2LA 3T4AC 5IGBA 2B63B 4I65A 4HAEA 1PRTC 1WTPA 3VR2A 2MHVA 3TDQA 2G9DA 1JR0D 5EKIA 1STBA 2AQ2B 1Z47A 2AUKA 5I9OA 2Z8LA 1RODA 4BY7B 1LABA 3JAME 3ND9A 1F9SA 3PO3B 1LTGD 3J81L 1LTBD 4DA2A 2ENBA 1A2TA 2EY2A 1A2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LLR D;  1FNW A;  2XNA C;  2O2L D;  1EWC A;  3R2T A;  1PRT B;  1RF2 D;  3MFG A;  1V1O A;  5TSS A;  1JQY D;  1SJH D;  1PRT F;  1AW7 A;  1XTC D;  1S5F D;  1TY0 A;  1LT4 D;  1ET6 A;  1BCP D;  1LT3 D;  1S5D D;  1S5B D;  1B44 D;  3O13 A;  1LT6 D;  3DWP A;  1I4H A;  4K6L A;  2XN9 C;  3W2D A;  4DXF A;  1RCV D;  1RDP D;  1SJE D;  2IPK D;  2RDH A;  1CK1 A;  1HXY D;  1AN8 A;  1GOZ A;  1I4R A;  1SE2 A;  4RHS A;  5ELE A;  4BWG B;  1PZK D;  1I4P A;  1SEB D;  1JWU D;  3EFX D;  1DJR D;  1PTO C;  1DYQ A;  1JWM D;  1I4G A;  1V1P A;  1LTI D;  1LTT D;  2QIL A;  3BYT B;  5I4D A;  3BVG A;  1FGB D;  1EU3 A;  5ELD A;  1D5M C;  4RGO S;  4RFB A;  1F77 A;  4L6T B;  1TS5 A;  3BZD B;  4UDU C;  3DWQ A;  3CHB D;  1CHQ D;  1PTO D;  1PYW D;  3DWA A;  1ET9 A;  1I4X A;  1S5E D;  2ICI A;  3OWE B;  1LTR D;  1HTL D;  1LO5 D;  1G8Z D;  5ELF A;  4OHJ A;  1FNV A;  4RGN A;  4O1N A;  3BVM A;  1BCP B;  1V1P B;  3URY A;  1MD2 D;  5D3D A;  1BCP F;  1L0X B;  3SEB A;  1XXG A;  2RDG A;  3MC0 B;  1UUP A;  4ZYS A;  1PZI D;  1TY2 A;  1PTO H;  1KLU D;  1QIL A;  2NTT A;  2WV6 D;  2AQ3 B;  1FD7 D;  3R2I A;  1EFI D;  1KLG D;  2XRS D;  5ELC A;  3BYY B;  1PRT D;  4DXG A;  1EEI D;  1M4V A;  1TS2 A;  5FKA C;  2J4X A;  2NTS A;  1PZJ D;  1SE4 A;  4C56 C;  2R61 A;  1KTK A;  3GP7 A;  4RGM A;  1D5X C;  1FNU A;  2CHB D;  1CHP D;  4TSS A;  1LTA D;  1CT1 D;  1TS4 A;  1L0Y B;  1S5C D;  1SXT A;  5ELB A;  4RH6 A;  1BXT A;  3R8B A;  1HA5 A;  1UNS A;  3BVZ A;  5D3I B;  1SBB B;  1PRT C;  1PTO B;  4RHR A;  1ENF A;  1TS3 A;  2SEB D;  3EA6 A;  1B1Z A;  1JR0 D;  1T5X D;  1EU4 A;  1PTO F;  2AQ2 B;  4Z9C B;  2TSS A;  4RGT A;  1CQV A;  1JWS D;  1D6E C;  2IJ0 A;  2Z8L A;  1SE3 A;  1HQR D;  1D5Z C;  3KLS X;  2G9H D;  1EEF D;  1LT5 D;  1LTS D;  3TSS A;  2AQ1 B;  4RCO A;  1LTG D;  2XRQ D;  5FK9 C;  2QEJ C;  1JCK B;  1ESF A;  1I4Q A;  1LTB D;  1RD9 D;  3V05 A;  1BCP C;  4L63 B;  1STE A; 
#chains in the Genus database with same CATH topology
 1FNW A;  4TRD A;  4KHP L;  2VB2 X;  3NTI A;  1X3F A;  4H13 C;  1TWG H;  1AE3 A;  1AP0 A;  1CKN A;  2MO0 A;  2RSN A;  4DR2 Q;  3DEO A;  4YCW A;  1RHP A;  2PQA A;  4YWM A;  4PMC A;  4NXN L;  1JJ2 A;  3DMU A;  1BCP D;  3GTK H;  5KGU A;  4NKL A;  3SR1 A;  2EJG C;  3QJY A;  4LW1 A;  2XVS A;  2BE5 D;  1XNR L;  1TQO A;  5EKL A;  3TN2 A;  4XXE A;  1GUO A;  3M4Q A;  2VQE Q;  1XWE A;  1MJC A;  1STN A;  2L9H A;  4F8M A;  2VXW A;  4LF4 Q;  4MHE A;  2PZW A;  4OO1 I;  1ONL A;  1V1P A;  3OYY A;  3TEH B;  2NN6 G;  4MTN A;  5M3M G;  1EU3 A;  2HUG A;  4LF9 Q;  3HOX B;  2CW0 C;  4JI6 Q;  2IW3 A;  4YIJ A;  3U58 A;  1EZ8 A;  3GD7 A;  4KHP Q;  4DR7 Q;  2QDL A;  2YTV A;  1B2T A;  4ODG A;  3RLO A;  1HPC A;  3AFP A;  1EY5 A;  5IGF A;  5KND A;  4HED A;  3UE0 A;  2E76 C;  1BCP F;  5I2Y A;  2P5Z X;  1E0B A;  4HCE A;  1XNR Q;  4PQX A;  3RNU A;  1A15 A;  1FD7 D;  1A3U A;  2K5W A;  3R2I A;  4MTK A;  1ENA A;  5CBE E;  3LWU A;  1WD1 A;  3BYY B;  4ID6 A;  2KOL A;  5I6W A;  2E2J B;  2SDF A;  4YCV A;  2R7Z B;  2EIF A;  1SNC A;  1TT2 A;  3SGI A;  4IFD G;  3VR4 A;  2KUM A;  3Q0A A;  4TSS A;  5JAV A;  1Q8K A;  5M3F G;  2IHF A;  1VDZ A;  3H0G B;  4C3J G;  3HOW B;  4KHV A;  4RH6 A;  3RN5 A;  1L0W A;  1EY6 A;  1QUQ B;  3FKI G;  3FHW A;  5IOD A;  4JG2 A;  2UUA L;  1B1Z A;  1N9W A;  2B63 G;  4POF A;  2IJ0 A;  3A0J A;  1SYG A;  2WB1 G;  3G48 A;  1YIJ A;  3KLS X;  3UDX A;  4HJA A;  3W1G A;  3UE1 A;  3HOZ B;  3CMA A;  5JOB A;  1XMQ L;  1WTR A;  4BY7 G;  2E8G A;  1JCK B;  1I4Q A;  3QB3 A;  2M00 A;  1BNZ A;  3HS0 C;  1PYS B;  3RLN A;  4DAV A;  3GTP H;  1LLR D;  3PO3 G;  4CKB A;  2K6A A;  3NTK A;  5TSS A;  2VW9 A;  4B08 A;  2MQH A;  2K5Q A;  1S40 A;  3K7A B;  5C3E H;  1HR0 Q;  2ZTE A;  1SNP A;  3GTJ H;  3OWF A;  3I3C A;  5C5L A;  4X3S A;  5NUC A;  5LMU Q;  2F0L A;  2RCN A;  3TRZ A;  3IFD A;  2I46 A;  3Q22 A;  4R9W A;  4P73 A;  1FYC A;  2Z4H A;  4A3M B;  1DGS A;  1EWH A;  4RCN A;  1JWU D;  4CDF C;  4X66 L;  2WAQ E;  4IUR A;  1IKM A;  4DUZ L;  4KI0 A;  1XMQ Q;  4R4T A;  1LV9 A;  4XYQ A;  1BO0 A;  3L3O C;  4K8I A;  4LUZ A;  5LL6 X;  5IYB H;  1R4P B;  4IFD H;  4A3B H;  1NUC A;  2MFI A;  3E9H A;  3HOU B;  1NE3 A;  1S5E D;  2B8G A;  2QDB A;  2B2U A;  1XYI A;  1KIX A;  2DGY A;  4DAP A;  3VR5 A;  3MFY A;  4UAI A;  3SEB A;  2HQL A;  2EVB A;  2B63 H;  2RDG A;  1Z6H A;  2Z1C A;  1K8G A;  2IL8 A;  5HGQ A;  4QUF A;  3MXN A;  2K33 A;  3CAM A;  3NWS A;  1NR2 A;  5ELC A;  1M1K C;  5J1Z A;  5CV5 A;  2DJG C;  3I7F A;  5DM7 3;  4ZKB B;  5AJ3 Q;  1Q90 A;  4X66 Q;  4FVM A;  3K6O A;  3SE0 A;  1E2W A;  2JA8 G;  4MZ9 A;  4DUZ Q;  5CYU A;  4KY5 A;  3PO3 H;  1VQ9 A;  1WTX A;  4N8F A;  1UE6 A;  1R4Q B;  2R7Z G;  1Y8O B;  4FXK C;  5D3I B;  2D0P A;  4RHR A;  4K2L A;  4JOI C;  4K8J A;  3TQY A;  4I7A A;  1SN8 A;  1EU4 A;  4RGT A;  3HOW G;  1YJW A;  3PF4 A;  4DFA A;  3MHB A;  1B8A A;  2L0C A;  3DEP A;  3T56 B;  1C48 A;  3MXU A;  2ZXO A;  2A6H C;  1HNZ L;  1H9M A;  4R4O A;  1WTV A;  1L2F A;  1L1O A;  3RD4 A;  4JYA L;  1HTP A;  2R3Z A;  4ZUJ A;  1JOO A;  2BH8 A;  3QG1 A;  2F0P A;  1TY0 A;  1Y1W B;  2GN5 A;  1B44 D;  3TME A;  2XN9 C;  3F8T A;  1K28 A;  3HOX H;  1BR9 A;  2PZU A;  4IN3 A;  3OMG A;  2IPK D;  3GTO B;  3ONA B;  2K05 A;  1V9P A;  3DHQ A;  3GQB A;  2EQS A;  1PYB A;  1P16 A;  4FF2 A;  4PZ6 A;  1AFP A;  2IHE A;  4FXG C;  4A3M G;  4GLA C;  5ELD A;  4RGO S;  1OXT A;  1NTG A;  2Y0S G;  1Q7Y C;  4L5R C;  3I4O A;  1YNJ C;  1HNZ Q;  5G3L D;  2Q8T A;  3GV3 A;  3NWT A;  4A3L G;  1UEA B;  3TZU A;  4JYA Q;  2E2J H;  5KRU A;  4L5Q A;  1LO5 D;  2C9O A;  3A74 A;  1G8Z D;  2R7Z H;  3F2U A;  3NUC A;  1EQQ A;  3VYU A;  3RMH A;  1BCP B;  1JOQ A;  3URY A;  4DR4 L;  3QIA A;  5E1F A;  5KIX A;  1XJV A;  3HOU G;  3F2D A;  4WJ3 M;  3H0G H;  2LKV A;  1EY0 A;  2UU9 Q;  4AH6 A;  2KA7 A;  4XT3 B;  1WYD A;  1II3 A;  3BDL A;  3E6Z X;  4Y7N H;  2OF1 A;  1SYB A;  1KLG D;  3I56 A;  2SNM A;  4DXG A;  2Q8I B;  3NHH A;  3Q6S A;  3GO5 A;  5GQO A;  1UWV A;  3K7U C;  4JI0 L;  3HOZ H;  3TS2 A;  2K75 A;  4DV5 L;  2HD3 A;  3L0O A;  3PUV A;  1SBB B;  3EA6 A;  4A3I B;  5G3L F;  1DZ1 A;  2TSS A;  2UXC L;  1P8L A;  1JWS D;  5M5W B;  5COR A;  3S1R H;  2VUM H;  4HJ5 A;  2A8V A;  3KOJ A;  4EQN A;  1O7Z A;  1UE1 A;  4DR4 Q;  3M4Y A;  4CKE A;  4N9T A;  1EL0 A;  3CQZ H;  2DN8 A;  1BCP C;  1STE A;  2JEB I;  1QE6 A;  4L5T A;  4A3J G;  4ULL A;  4FF4 A;  3MFG A;  3K0X A;  2DNC A;  1E2Z A;  1BF4 A;  1N8R C;  3DUZ A;  1SYF A;  3ICE A;  1JMC A;  1B53 A;  4IPD A;  5C4X H;  4IOC A;  3CCM A;  4JI0 Q;  1VQM A;  3J7A V;  2FMM A;  4DV5 Q;  5GAG C;  1RDP D;  4XIG S;  3OIQ A;  1Y1W G;  4XQN A;  1HUN A;  3QWN A;  4OO1 H;  2X6L A;  4DKA C;  1JB7 A;  2UXC Q;  1SEB D;  3EFX D;  2VY3 A;  1VQK A;  2JA7 B;  2LFN A;  2X69 A;  4LNQ A;  1WVL A;  1XNQ Q;  5E4X A;  2HIX A;  1TII D;  1XX8 A;  3VR6 A;  2RVL A;  2B2V C;  3FRP B;  1V43 A;  3JAM i;  2B2W A;  3MAQ A;  1HNX L;  1G6Z A;  3CCV A;  1PXU A;  5IT9 c;  3BZD B;  2ZM6 L;  2R92 H;  1CSP A;  3WOE A;  3I55 A;  3T13 A;  3MVV A;  4LF5 Q;  3D4R A;  4IUV A;  4EX5 A;  3KUP A;  3CF5 A;  3H15 A;  4R4C A;  1SND A;  2CWP A;  2K5V A;  2KCN A;  3JAM c;  4DN4 M;  1GKH A;  5D3D A;  2RCF A;  2GA4 B;  2PQA B;  3K81 C;  1EYA A;  4LFA L;  1WTQ A;  4A75 A;  1VQB A;  1EY8 A;  1W2B A;  5E4W C;  1WOC A;  5I6Y A;  3IL8 A;  5FKA C;  3NEN A;  4WFN 3;  4RA8 A;  1AE2 A;  4ZQ3 A;  2ATW A;  1HNX Q;  5ELB A;  1HCZ A;  1NY4 A;  1RKN A;  3CXC A;  1IBM L;  4QJF A;  4A3F B;  3ZYY X;  2JN4 A;  1C4Q A;  1UE5 A;  4A3C G;  4A3G G;  4Z9C B;  1BUV T;  2G5D A;  4YCU A;  2O5I C;  3IAY A;  5FJ8 H;  1ASY A;  3OMC A;  3M9B A;  4JI3 L;  2PYK A;  5C3W A;  1O7I A;  5LMN Q;  1YJN A;  2LMC B;  1LTL A;  2A5H A;  2LXK A;  1S3O A;  3QOL A;  3U50 C;  1Y1W H;  1BQQ T;  2L55 A;  2F0S A;  3TBI B;  1PA6 A;  1SRO A;  4RCO A;  3CC7 A;  5J39 A;  4YY3 L;  3BZK A;  4LFA Q;  4NB3 A;  4IUT A;  5M5Y B;  2OQK A;  4L63 B;  1C7Y A;  3WOF A;  3HKZ B;  2ID0 A;  3AU7 A;  3L2P A;  3NEM A;  3R2T A;  3I4N G;  3N6R A;  1V1O A;  1B50 A;  4JI1 L;  3UI2 A;  2J0T D;  3NK9 A;  3OOC A;  4K0K L;  3JAM L;  5ELN A;  4C3I H;  4CJ1 B;  3HGB A;  3P20 A;  2UUB L;  1KRS A;  2EYF A;  3QR8 A;  3I4L A;  2UXD L;  1IBM Q;  1IYU A;  4K5W A;  3KLR A;  2OTL A;  2K1B A;  1Y8N B;  4K6D A;  1PH4 A;  4DK1 A;  1KAA A;  2ES2 A;  1PFB A;  2A74 C;  1RL2 A;  4IOA A;  4JI3 Q;  1KC8 C;  3DLL A;  2LY7 A;  4KKT A;  1HA6 A;  1SYC A;  4NDX A;  2XIW A;  3NE5 B;  4YY3 Q;  2JA7 G;  4AIM A;  1X56 A;  3CHB D;  3M7N A;  1PH9 A;  2H1E A;  1PTO D;  2XGT A;  3CCQ A;  4QCL A;  1ET9 A;  1WI5 A;  5IP7 H;  5EPJ A;  2AWN A;  3I2Z A;  1S72 A;  1LTR D;  4JI1 Q;  4DK6 C;  1HZ9 A;  4DNR B;  2R93 B;  3GTP B;  4K0K Q;  4QIW B;  1T5E A;  1XTD A;  2NBF A;  4A3C H;  2Z0S A;  3I73 A;  1JIC A;  2UXD Q;  4E6I A;  4JI5 L;  5HUR A;  4BY1 H;  3TP5 A;  1QIL A;  1GM5 A;  4CKC A;  4A3I H;  4POG A;  4JV5 L;  4P71 A;  3T1H L;  1A63 A;  2B2V A;  4F87 A;  2RQX A;  4OGQ C;  2F0G A;  1EY7 A;  3HOV H;  3KBG A;  4BBR B;  2ZJQ A;  3CD6 A;  5IE8 A;  4C1N K;  4A3E H;  1QZH A;  3AMU A;  4KV6 A;  1HQM C;  1J9O A;  3ULJ A;  4DAM A;  4FNF A;  1ILP A;  3KJP A;  4M1U B;  2WAQ G;  1PTO F;  1QZG A;  1CQV A;  2XWJ B;  4A3F G;  1D5Z C;  4OL7 A;  5I2X A;  5BN3 A;  4A3B B;  2LS0 1;  3CCL A;  3UDI A;  4B3M L;  3TP8 A;  1ML0 D;  2JA5 H;  3KFU A;  4TKO B;  4IUN A;  2PCF B;  4JI5 Q;  4TVA B;  1F9Q A;  1X65 A;  2ZJP A;  1IW7 C;  3PCO B;  2O2L D;  2AHO B;  1RF2 D;  3T1H Q;  5IT9 E;  1JQY D;  3PIP 3;  4O42 A;  4HJ9 A;  1K8O A;  3A5Z B;  5C0X I;  1PH3 A;  3BJU A;  3HKZ G;  2K28 A;  1LT3 D;  2RBM A;  3EIV A;  1VQD A;  2PI2 A;  1DD2 A;  1CI3 M;  1NMG A;  1SSO A;  1OO9 B;  3BDO A;  4DR1 L;  4DUY L;  4CDD C;  1SE2 A;  5IYC H;  2N8N A;  5EJW A;  3PF5 A;  2MP1 A;  3OIP A;  1ICW A;  3X3M A;  1NBW A;  4CDC C;  5J22 A;  4DR7 L;  4B3M Q;  3BVG A;  4GN5 A;  3A5U A;  1TS5 A;  3WWV A;  5FOB B;  2A6E D;  5JPN C;  1VQA A;  2UXB L;  4JBM A;  1X3G A;  1TXY A;  4J1M A;  5EQ0 A;  4DPG A;  2B2U C;  1STY A;  2K14 A;  1WD0 A;  3UDF A;  2OCE A;  1L1O B;  5A35 A;  1EQR A;  5EAY A;  1N36 L;  2QEX A;  1FVI A;  1QJO A;  2KBN A;  1UUP A;  1U4R A;  4A3F H;  5C4J B;  1ILQ A;  4DR1 Q;  4DUY Q;  2CVR A;  4ZKC B;  3GV6 A;  4HIM A;  1Q86 C;  5C3E G;  1XMO L;  4ZCK A;  1QVF A;  1BVS A;  3X3N A;  2VS1 A;  1UEB A;  2Z9H A;  1TWF H;  1PFM A;  4N9P A;  2HDL A;  5M5Y H;  1JJG A;  2KVM A;  2UXB Q;  3CME A;  4CJ0 B;  5JVH 3;  4YWL A;  3OSO A;  3G6E A;  5IYD H;  4KTA A;  2NVQ B;  2BOS A;  2X6G A;  2Z6K C;  4KN4 C;  2A69 D;  2JK8 A;  4DF7 A;  1N36 Q;  1VMC A;  5IYB G;  1L1O C;  4A3B G;  1HR0 L;  5IWA L;  3F1Z A;  5IGE A;  2CFM A;  2SOB A;  4AQY L;  3M85 A;  5LMU L;  1GXD C;  2FFK B;  4Y7N B;  4K5V A;  1EIH A;  1XTC D;  3I72 A;  2IY5 B;  3TP6 A;  1LM0 A;  3H94 A;  1XMO Q;  3L9A X;  5IY0 A;  5CGK A;  4U67 3;  2F0M A;  3QO2 A;  2R6G A;  2PI2 E;  1HZB A;  4AYB E;  2AMC B;  1X54 A;  5CV6 A;  3CCU A;  2N49 A;  1ZEQ X;  3CPW A;  2R93 H;  3HOY B;  1JWM D;  4OWT B;  1SYD A;  1WTH A;  3E5S A;  3STB C;  1UAP A;  5EBC A;  3S1R B;  5GAH C;  1F9P A;  4FDB A;  2VUM B;  1Y1V B;  1O80 A;  2RF4 A;  1EWI A;  2XSC A;  3T16 A;  5IWA Q;  4CBV A;  1G2T A;  1GUW A;  2KCM A;  1HUM A;  3TP7 A;  4K14 A;  2NVX B;  1PH6 A;  3CQZ B;  4NMZ A;  4AQY Q;  3PO2 H;  2KEN A;  2B2Y A;  1VMP A;  2NWG A;  5C44 B;  5CMD A;  3K5L A;  1E7Z A;  2MUY A;  1H9R A;  1MSG A;  5AJ3 L;  1VQ7 A;  4BA1 I;  4BBR H;  4QUC A;  3MC0 B;  5C4X B;  4ZYS A;  4JI8 L;  1CFM A;  4X3U A;  2NTT A;  2WV6 D;  1YI2 A;  3A55 A;  1R9T B;  3S2H B;  3M4P A;  4KJO A;  4LF8 Q;  3KYH C;  1UE7 A;  1D5X C;  2CKZ B;  2E2D C;  3HOX G;  3C3L A;  2D2C C;  2PQE A;  4OX9 L;  5COY A;  5A2Q E;  3KBX A;  3FPP A;  2RKS A;  1STH A;  1PTO B;  2F03 A;  1E2V A;  1GO3 E;  4YWK A;  3FMC A;  3A56 A;  3HKZ E;  3FP9 A;  2R92 B;  4C2M B;  2R7F A;  2BA0 A;  1O7Y A;  2JP1 A;  4I7Z C;  4J15 A;  2HT1 A;  2MNA A;  4UPA A;  1IKL A;  1QWY A;  2F0Q A;  4DR5 L;  4EGV A;  2XTI A;  1H9K A;  3S2D B;  4JI8 Q;  2K03 A;  2Q2I A;  4HMJ A;  4IUQ A;  3T53 B;  4KY6 A;  4UHV A;  1K73 C;  5BR8 L;  5E7N A;  2F0N A;  3LX0 A;  3J7Y W;  1AZP A;  1SLJ A;  4GS3 A;  4JVZ A;  3H0G G;  2F0J A;  4OWX B;  4KD4 A;  2C5C A;  3ITP A;  4WRD A;  1SNQ A;  1NMF A;  4B9X A;  4OX9 Q;  3DWP A;  3W2D A;  1D2B A;  1KD1 C;  4DNI A;  1RTN A;  4EQP A;  1I6V C;  1JC7 A;  2Z6K A;  4JK1 C;  5EPL A;  4KN7 C;  3S16 H;  2QA4 A;  1NR4 A;  4P74 A;  1DJR D;  3HOZ G;  1PTO C;  1K0R A;  1DYQ A;  2B2W C;  3SXH A;  1LAC A;  1LTT D;  2WP8 J;  4DR5 Q;  4QIW E;  5I4D A;  3PGZ A;  5LL6 S;  5KNC A;  2OQ0 A;  4BBS B;  3HOY G;  1XPR A;  3J7A F;  2YTX A;  3DWQ A;  5GRO A;  5C4J H;  4IJL A;  5F2D A;  2UU9 L;  4ZLT F;  2VUM G;  5BR8 Q;  4B3S Q;  1O7L A;  3OWE B;  1Q3L A;  3ERO A;  2PMZ E;  3WDN A;  1KRT A;  5DNF A;  4PMW A;  3NSW A;  4JI7 Q;  5KEE A;  4UP7 A;  4C3I B;  3NP8 A;  3J81 j;  2XRS D;  1W6K A;  2C35 B;  5C4X G;  4P72 A;  4OWW B;  2PW5 A;  1PRT D;  2O4X A;  4A3K H;  1M4V A;  2NVQ H;  3H09 A;  3IRB A;  1SE4 A;  3K80 C;  3CCS A;  1RJT A;  2ZJR A;  4RGM A;  1PDQ A;  5GAE C;  3V96 A;  1X32 A;  3R3O A;  1TS4 A;  1L0Y B;  2FHT A;  4X6A H;  4LF7 L;  4J6H A;  4H7B A;  1HA5 A;  1YNN D;  4OO1 G;  1TS3 A;  4IAL A;  2SEB D;  1T5X D;  1STG A;  3FPU B;  4F88 A;  3OPO A;  2DJF C;  1EY9 A;  3CC4 A;  5K36 H;  1E1T A;  1HQR D;  2I5M X;  1MI2 A;  4CDE C;  2GVB A;  4BS9 A;  4R1J A;  4A76 A;  1LT5 D;  4JW0 A;  3CCE A;  2M9V A;  2R92 G;  2K32 A;  1Q82 C;  3V05 A;  1BDO A;  2DUD A;  4X64 L;  3PQI A;  5I9P A;  2CWA A;  1CM9 A;  4BY1 B;  5C0X H;  3FVQ A;  3HOY H;  1VS0 A;  1PRT F;  2K52 A;  4HJ8 A;  1Q81 C;  1LT4 D;  4G7O C;  1GUT A;  1ET6 A;  1AH9 A;  1QB5 D;  4U68 A;  1C9O A;  4FF3 A;  3O13 A;  3K5O A;  1Y1V H;  4LF7 Q;  2KQ3 A;  1XNQ L;  3C46 A;  2RDH A;  1YZ6 A;  4KHZ A;  1EQV A;  3HOV B;  3LGJ A;  1GOZ A;  2CW0 D;  2NVX H;  2JA9 A;  2EYL A;  3NQI A;  4A3E B;  2BE5 C;  2EY5 A;  3AQQ A;  5BN5 A;  3CCJ A;  5C44 H;  4LF5 L;  3CRK C;  3BYT B;  2F52 A;  3HG9 A;  2KEE A;  4EVO A;  3F2B A;  5JEA J;  4RFB A;  1IXR A;  2KCT A;  2OTJ A;  3RZO B;  2GVA A;  4X64 Q;  5FJ8 G;  3SK4 A;  2JA5 B;  1I4X A;  3SHL A;  1MGS A;  3MZ5 A;  1R9T H;  1VQ8 A;  4GN3 B;  3NTH A;  4NP5 A;  3S2H H;  5ELF A;  3H3V I;  3OHX C;  1IBK L;  2AKW B;  1TR5 A;  4DAY B;  1XXG A;  2OWO A;  1NCV A;  4A4I A;  3SVM A;  4DR3 L;  2L1B A;  1PTO H;  1KLU D;  1PFS A;  3MXG A;  3G71 A;  4AYB B;  4G7Z C;  4HN7 A;  4C2M H;  2QGQ A;  4C3I G;  2NTS A;  4DK3 C;  1KL9 A;  4B3T L;  5LMN L;  2E74 C;  2JEA I;  5FLM H;  3S2D H;  1UNS A;  3S17 H;  2E2H B;  2WAC A;  1QCB D;  1ENF A;  3AYH B;  3G7L A;  2NN6 I;  4LJZ C;  1PH8 A;  2B8F A;  1AZQ A;  3D3R A;  2Q2H A;  1GHK A;  3CRL C;  2E75 C;  1IYV A;  3T1Y Q;  1SDF A;  1IBK Q;  2VQF L;  4TQU S;  4S3S A;  2Q8R E;  3G6J B;  1KXL A;  2B39 A;  5IP7 G;  4DR3 Q;  4ME5 A;  2QF7 A;  4WJ4 A;  4J8Q A;  4C3H B;  4KKS A;  1LUZ A;  4OEL B;  4KMU C;  1K3R A;  5IOC A;  2IT1 A;  1SNO A;  1HJP A;  1DCZ A;  1DOM A;  3RUZ A;  4GZY C;  4B3T Q;  1RIP A;  3DM1 A;  4A93 B;  4FXD A;  4BY1 G;  1KDA A;  4DXF A;  1QNK A;  4BBS H;  4WJW A;  3J80 c;  4A3I G;  1M90 C;  2ZXP A;  3EVQ A;  1TWF B;  5IT9 L;  3MEH A;  2F0K A;  2WKD A;  3KLW A;  1D8L A;  1E3P A;  3U9O A;  4BWG B;  3R93 A;  3G4S A;  3U4V A;  1EOV A;  3QOJ A;  4V0B A;  3LWE A;  4JI4 L;  3HOV G;  1ASZ A;  1I4G A;  5ELO A;  5JPM C;  1F9R A;  1QVC A;  2IX3 A;  2VQF Q;  3SDZ A;  3U9S A;  1HR0 W;  4A3E G;  1ZYR D;  1FR3 A;  2ZXR A;  3M3Y B;  1GHJ A;  5JEA G;  1VQP A;  4NXM L;  4KLK A;  4PZ7 A;  2JA5 G;  4DV4 L;  3GTL B;  4P2C B;  3KF8 A;  1IL8 A;  2L12 A;  1YEZ A;  1HNW L;  4JI2 L;  5IGG A;  1B70 B;  4H02 A;  1EY4 A;  2F0F A;  1MBY A;  1ICF B;  2NVY H;  1B4O A;  3VYR A;  1KNE A;  5HY6 A;  4QGU A;  3D0F A;  5ISR A;  1A3V A;  2R61 A;  1PH7 A;  4JC0 A;  4JI4 Q;  4AYB G;  2HHH L;  1LTA D;  4DV3 L;  3AB9 A;  1TWC H;  1WCM H;  2YTY A;  3TS0 A;  2K5N A;  4X3T A;  1YJ9 A;  3ERQ A;  4B3R L;  2PO4 A;  2EZV A;  2Z6B A;  3S15 B;  5IYC G;  2EE1 A;  1VF7 A;  5JJL A;  1OXV A;  4X3K A;  1CA6 A;  1CUK A;  4Q0F A;  2XWB B;  1SFO B;  2H4O A;  5EGT A;  4NXM Q;  1I50 B;  4DV4 Q;  4FYD A;  2F0I A;  4GOP B;  1BBW A;  1IYJ B;  2EY1 A;  3TSS A;  1BKB A;  3S1N B;  3PO2 B;  2PMZ B;  1B3A A;  1F2Z A;  4DK0 A;  2HCI A;  1CSQ A;  3OW2 A;  1HNW Q;  4JI2 Q;  5KYI A;  1DM0 B;  2ZT9 C;  5M3M B;  4BXX G;  1PVO A;  3GTG H;  2DY7 A;  1U4P A;  1SMX A;  1PRT B;  1EOT A;  5FLX c;  1AW7 A;  3KK7 A;  1H95 A;  4C3H G;  3P7J A;  3CPF A;  1CZW A;  2HHH Q;  4DV3 Q;  4FP5 D;  1W6J A;  2EJF C;  5C5M A;  5JEA H;  3J7Z C;  1PFN A;  1RCV D;  1A6X A;  3RZO H;  3K57 A;  2TMP A;  4B3R Q;  1AN8 A;  3VA7 A;  3PIO A;  2R7D A;  4UY8 C;  2D0O A;  1N32 L;  1I5F A;  1FL0 A;  3DXJ C;  4DAY A;  1FGB D;  1VQH A;  1D5M C;  1F77 A;  1X55 A;  2KCC A;  5M3F B;  5E3F A;  3NBH B;  3KDF B;  5IYD G;  1J8I A;  2B2Y C;  2LSS A;  3NXW A;  3M7G A;  1H9S B;  1VQO A;  5JJK A;  1EQT A;  2N78 A;  3DM3 A;  1VF5 C;  4NW2 A;  2WB1 B;  4XQJ A;  2BDN A;  5JVG 3;  4K5X A;  4KJN A;  2HDM A;  2EXD A;  5CV7 A;  1PZI D;  4CJ2 C;  2E2H H;  3W5O A;  3A54 A;  4XT1 B;  4LFC Q;  2ZTC A;  3EN2 A;  1NSN S;  3SK6 A;  1EFI D;  2LXJ A;  3S1M H;  1O78 A;  4IPC A;  2PPB C;  2F3W A;  1VQF A;  4DR6 L;  1YNN C;  2RHQ B;  5FLX L;  1TS2 A;  2J4X A;  4NPS A;  1PZJ D;  1GUN A;  3S14 H;  1KTK A;  1Q12 A;  3BZC A;  2IWH A;  1B9N A;  4BXX H;  1N32 Q;  2CHB D;  1X6O A;  4LFB L;  2BDO A;  3HP3 A;  3ND8 A;  3S16 B;  4PNY A;  1DXM A;  5BN4 A;  1S5C D;  1CKM A;  1EUJ A;  4ALP A;  4GLX A;  2EYJ A;  2B2T A;  4C3H H;  1IBL L;  3J80 E;  2D5D A;  3LNN A;  1HZA A;  2R93 G;  2QW7 A;  4EQO A;  1D6E C;  1K0S A;  4HJ7 A;  1FGU A;  2K04 A;  4KD3 A;  4HIO A;  1C8C A;  3MA2 B;  2J7Z A;  3E0J A;  4A93 H;  2F0E A;  5A2Q L;  3D4D A;  2AQ1 B;  2XRQ D;  1S4Z A;  3EQL C;  1VQC A;  2NZO A;  2JQO A;  3Q24 A;  3KF6 A;  3PO2 G;  1LYL A;  2NYZ D;  3D6W A;  1EWC A;  4DR6 Q;  4ZUI A;  1HZC A;  5H1S E;  5T1G A;  1OTC A;  2EJM A;  3PUX A;  3JC6 6;  1B9M A;  1E22 A;  5M5X H;  4BBR G;  3I4M B;  4LFB Q;  4A3K B;  3C1E A;  4UP9 A;  1G29 1;  2CH4 A;  2JYO A;  3PUZ A;  1K83 B;  3M3Y H;  1HXY D;  3ULP A;  1K8A C;  1IBL Q;  2I0Q A;  1EFW A;  3BDC A;  1EIF A;  4DV0 L;  4NXN Q;  4HSP A;  1PMR A;  2JA6 H;  3GTM H;  1G51 A;  1KDC A;  4HTH A;  4RHS A;  1N33 L;  1PZK D;  2FXQ A;  3GTL H;  3NBI A;  5IP9 G;  4QB4 A;  2VZA A;  3RZD B;  2JA8 B;  1CTM A;  4OIJ A;  2YYZ A;  3RLF A;  4MN3 A;  3HEJ A;  1OXS C;  1E24 A;  4CGY B;  4Q5V A;  3H3V H;  1RTO A;  4HR7 B;  5KYL A;  5CC4 A;  3BVM A;  3AEV A;  4H44 C;  4IUP A;  4LWC A;  4LF8 L;  5C0X J;  4YHH L;  5CV4 A;  2F0H A;  4GN4 B;  2MGS A;  2E2I B;  3FEW X;  4KKU A;  3S15 H;  1QNU A;  2N3S A;  4DV0 Q;  3HZX A;  2F0O A;  1N33 Q;  1EEI D;  1SFO H;  1TVX A;  1J6Q A;  1QOH A;  3V2T A;  1I50 H;  1VQ4 A;  4G7H C;  4DV1 L;  3PIO 3;  3M4O B;  3S1N H;  4GOP A;  1VQJ A;  5FLX E;  1SXT A;  2AUJ D;  1JE5 A;  5DLQ E;  1BXT A;  3T51 B;  3BVZ A;  3VDY A;  3J81 E;  2NN6 H;  5M3M H;  4R4Q A;  4H0L C;  4IPH A;  1MIU A;  2ALY B;  4N8X 1;  2VB3 X;  2K4K A;  4JBW A;  5C4H A;  1WTO A;  2VNU D;  4PZ8 A;  2K7V A;  4PMB A;  4L8J A;  4R8I A;  1LTS D;  1Q1E A;  4YHH Q;  2UUA Q;  1HHV A;  5FK9 C;  1GVP A;  1ESF A;  2QEJ C;  3CKI B;  3MWY W;  2A68 D;  3K5M A;  1IZ6 A;  2AWO A;  1A2U A;  4ZK9 B;  4LUO A;  3UDG A;  5IP9 H;  1F2L A;  3Q23 A;  5DM6 3;  2Y0S B;  2RDF A;  2DY8 A;  5D14 A;  1C0A A;  1XPO A;  1SNM A;  3E9I A;  5LMN W;  4K2K A;  2F4I A;  1S5F D;  2CCZ A;  1D1K A;  4DV1 Q;  3KJO A;  3A7A B;  4DU9 A;  2EYH A;  1TKW B;  1Y14 B;  1IHZ A;  1Z9F A;  5M9O A;  5M3F H;  3W3A A;  2YU9 B;  3EBE A;  3NBH A;  1EIG A;  3I4M G;  1KDB A;  3U4Z A;  4C3J H;  4GLV B;  3L7Z C;  1ZYR C;  2JSO A;  3FKI H;  4A3K G;  3KDF A;  1VCI A;  3SK8 A;  3S17 B;  4CHT B;  2EXZ A;  3C1F A;  1GUG A;  1Y69 U;  2BA1 A;  2Q2T A;  1H9S A;  3IFT A;  2Z4I A;  3BS1 A;  2OT2 A;  4GKJ L;  2QIL A;  2VL6 A;  4B3S L;  2L15 A;  4LUV A;  1V1Q A;  1KAW A;  4BY7 H;  1JT8 A;  1U9R A;  1PYW D;  5C4Z A;  1AEX A;  2EPB A;  2B3G A;  2EY6 A;  4JI7 L;  3S1Q B;  5K36 G;  5D65 A;  4HCS A;  1STA A;  1HTL D;  1FJG L;  5IIF A;  4OHJ A;  4RGN A;  1CA5 A;  2NUC A;  3K0Y A;  4ILW A;  4O1N A;  2SNS A;  1QVG A;  1MD2 D;  4HSV A;  1TWH B;  3ZJY C;  1EYC A;  3C2P A;  1ENC A;  1JE4 A;  2F0W A;  1TY2 A;  1QG7 A;  3NPP A;  2K5D A;  2E5L L;  4OON A;  4P75 A;  3I90 A;  5C0X G;  2A73 B;  2BCO A;  1X9N A;  4A3J B;  1SMY D;  1GD7 A;  2I07 B;  2WFW A;  4GKJ Q;  1TU2 B;  1Y1V G;  5JJZ A;  1SYE A;  2I5L X;  4RKB A;  4ZAI A;  4A3D B;  3R8B A;  1BBX C;  1CQF A;  1B7Y B;  4GKK L;  5C44 G;  3PUW A;  1FJG Q;  4PV1 C;  5EBD A;  2EYO A;  1IW7 D;  4XYO A;  3I4M H;  1VQI A;  2MO1 A;  3EJI A;  1EEF D;  4LK1 C;  2Q2U A;  4DV7 L;  1KNA A;  2IX0 A;  2I5H A;  1K83 H;  3KF8 B;  4JCV E;  2E5L Q;  3HFZ B;  4RG1 A;  4M8A A;  4OXP A;  1MSH A;  1G2S A;  3OW7 A;  3PSI A;  3CCR A;  1ESR A;  2NVY B;  1S5D D;  4HID A;  1I4H A;  3RZD H;  2JA8 H;  3N52 A;  1SJE D;  3P75 A;  1CK1 A;  2V4D A;  5EPK A;  1TWC B;  3BG3 A;  1WCM B;  1I4R A;  2MPM A;  1TWA B;  4QY7 A;  2IX1 A;  5ELE A;  2JXM B;  4GKK Q;  2EOT A;  5GAD C;  5CV8 A;  3HOW H;  5DAU A;  5FLM G;  1QUQ A;  3K59 A;  2PNR C;  2OXP A;  4JBK A;  2QCP X;  1X3Q A;  2WB1 E;  4DV7 Q;  1I6H B;  2E2I H;  1GUS A;  1DOL A;  1PHJ A;  1SAP A;  4HIK A;  1Z7T A;  1D1I A;  4XQQ A;  2ICI A;  4GNX B;  4RMF A;  3K58 A;  4A3G B;  1DOK A;  3GTG B;  2PNH A;  3M4O H;  4OIK A;  5FO9 B;  4BA2 I;  1F2M A;  1L0X B;  2A6E C;  4JBJ A;  5AFW A;  2L4N A;  2RSO A;  4F7X A;  4DV2 L;  2UUC L;  3I70 A;  4IUU A;  3CC2 A;  3MEF A;  3NQT A;  2DNE A;  2NB0 A;  3K7A H;  1KAB A;  1SRU A;  2CQO A;  1U4L A;  2F0T A;  2HCC A;  3I4N B;  2A19 A;  5JJI A;  1VQN A;  4BBS G;  2WKC A;  1KQS A;  1CT1 D;  3K8A A;  3VR3 A;  5FO8 B;  1VQ6 A;  3B6Y A;  3T1Y L;  1EIY B;  1OXU A;  1YNX A;  4FF1 A;  4A3M H;  1J5E L;  2NZH A;  2NVT B;  3D31 A;  1N34 L;  2D62 A;  5K5P A;  2FJ2 A;  1VQ5 A;  1VQL A;  1PH1 A;  4A3D G;  3PMF A;  4JOI A;  1K9M C;  4Y52 H;  3P1H A;  1NJI C;  1G91 A;  1X3E A;  4IJH A;  4A3L H;  3FDT A;  1SR3 A;  3W1B A;  2G9H D;  1CKO A;  2OEO A;  1I94 L;  2B29 A;  4X62 L;  4DV2 Q;  4GNX C;  2UUC Q;  3HOU H;  1E1O A;  2YU9 H;  2F1M A;  2K5H A;  2WIN B;  1MJE A;  3PUY A;  3CW2 C;  3HKS A;  4IO9 A;  2XNA C;  2YV5 A;  1U4M A;  2A69 C;  1BBU A;  1HH2 P;  2RHS B;  3MTS A;  3S1M B;  3ULL A;  1JJC B;  4G4K A;  2RA4 A;  3GTQ B;  4V19 0;  1SE8 A;  1A62 A;  4APV A;  1D7Q A;  4RAU C;  1LT6 D;  1I3Q B;  3A8K E;  3ER0 A;  2EDG A;  3S14 B;  4OEM B;  4XDX A;  3ERS X;  1EYD A;  1J5E Q;  3STB D;  3NEL A;  3S24 A;  1N34 Q;  2MJ8 A;  4KK7 A;  3S1Q H;  4IPG A;  3CU7 A;  1KHI A;  4X65 L;  3J80 i;  3A8I E;  1CKN B;  1TWG B;  3S9W A;  1K8M A;  3MXP A;  1LTI D;  1WCM G;  1TWH H;  3GDE A;  2F0V A;  3D4W A;  5T1I A;  3TZD A;  4B9W A;  4HMI A;  3GTK B;  1I94 Q;  4X62 Q;  3I91 A;  3PIP A;  1ZXT A;  2FIN B;  4UDU C;  1CHQ D;  3DWA A;  4FO2 A;  5CBA E;  2ASB A;  3D8G A;  2CH4 W;  4A3J H;  4IFD I;  3KF6 B;  3RR5 A;  2WAQ B;  1FNV A;  3PV0 A;  2FMC A;  2N55 A;  2N88 A;  1HFN A;  1V1P B;  3A7L A;  4LAA A;  3F2C A;  2ZM6 Q;  5CV9 A;  4A3D H;  2KHS A;  3AFQ A;  3K5N A;  1WTW A;  2KED A;  2L5T A;  5M5X B;  2KJX A;  3SK5 A;  2F4V L;  4ME3 A;  2D9U A;  1EZ6 A;  2JJQ A;  2F3V A;  5CR3 A;  5HGT A;  4X65 Q;  1XPU A;  1OXX K;  4R8N A;  3H91 A;  5C6A A;  4MIU A;  4XTC S;  3VA5 A;  3OTO L;  4IQZ A;  2JA6 B;  3GTM B;  1FNU A;  3GTO H;  5FO7 B;  1CHP D;  1EYG A;  1CZG A;  2B2T C;  3HRZ C;  1GJX A;  1IL2 A;  3KLS A;  1JB3 A;  3H6M A;  1X3P A;  1H9J A;  4MNO A;  2F3I A;  1JOK A;  4L5S A;  1M8A A;  1Y8P B;  2K50 A;  2Y0S E;  2A68 C;  1YIT A;  1JOR A;  4LF6 L;  1SE3 A;  1Q46 A;  4O2D A;  3I8Z A;  1F2Y A;  2F0D A;  1YVC A;  3Q8D A;  4IZ8 A;  1RD9 D;  1BOS A;  1W3S A;  2ICE C;  2V1C C;  5L37 A;  1HFG A;  3J80 L;  2F4V Q;  1TWA H;  2EYM A;  1YBY A;  1YHB A;  1SJH D;  4RKL A;  5IGD A;  2A6H D;  2JE6 I;  2HQE A;  4G57 A;  3OTO Q;  1U5K A;  3IKJ A;  1S5B D;  2KEC A;  1NNX A;  2A1A A;  4K6L A;  1I6H H;  2QKI C;  4R4I A;  3J81 i;  2WII B;  2KHI A;  4DNT B;  1VQE A;  2PZT A;  2UUB Q;  1I4P A;  4QF4 A;  4LF6 Q;  1Q1B A;  4GNX A;  2L11 A;  4A3G H;  1YHA A;  1A3T A;  2PW7 A;  4DV6 L;  5C3E B;  1G6P A;  3GTJ B;  4C1N I;  1HRJ A;  3VYT A;  5LHY 1;  1B3Q A;  2O5J C;  3J81 c;  4L6T B;  5M5W H;  1YHQ A;  4DGZ A;  2H5X A;  1V8Q A;  1U0L A;  2EYP A;  3H3V C;  4EQ5 A;  4LMQ D;  4LFC L;  4UP8 A;  4RWS C;  2K01 A;  2BH2 A;  3I4N H;  4A93 G;  1PH2 A;  1DON A;  1Q8I A;  5EKK A;  3RN2 A;  2CQA A;  2NZ1 D;  3J7A 5;  3D6C A;  3A8J E;  1ZKO A;  3E0E A;  5C3X A;  1YNJ D;  5IGC A;  1SMY C;  2ZTD A;  4JPB W;  2NVT H;  1NAP A;  2AQ3 B;  3CP0 A;  4ABN A;  2KHJ A;  1MKH A;  5DEH A;  4IFD J;  3VYS A;  5KNB A;  2F0U A;  1T9H A;  4QL5 A;  4QMG A;  1K3B C;  4WOR A;  4ZRZ A;  4KY7 A;  1A0I A;  4DR2 L;  4C3J B;  4GOP C;  1PH5 A;  4C56 C;  3E3X A;  3FKI B;  3GP7 A;  2M2L A;  3T4A C;  2HIV A;  1WFQ A;  4DV6 Q;  5IGB A;  2B63 B;  4I65 A;  4JV5 Q;  4HAE A;  1VQG A;  3TRE A;  1MHW C;  3MXN B;  2VQE L;  2JA6 G;  1PRT C;  1WTP A;  3VR2 A;  2MHV A;  3TDQ A;  4LF4 L;  2G9D A;  2JA7 H;  1JR0 D;  5EKI A;  1STB A;  2AQ2 B;  1Z47 A;  2AUK A;  5I9O A;  1WJJ A;  2Z8L A;  1ROD A;  4BY7 B;  5J3B A;  1PV4 A;  3BU2 A;  3GTQ H;  1LAB A;  3JAM E;  3ND9 A;  1I3Q H;  4O0A A;  4QQB X;  1F9S A;  3PO3 B;  1LTG D;  4LF9 L;  4PG3 A;  3J81 L;  1LTB D;  4DA2 A;  4JI6 L;  1A8V A;  2ENB A;  1A2T A;  2EY2 A;  1PLF A; 
#chains in the Genus database with same CATH homology
 1FNW A;  4TRD A;  2VB2 X;  3NTI A;  4H13 C;  1AP0 A;  2RSN A;  3DEO A;  1RHP A;  4PMC A;  3DMU A;  1BCP D;  5KGU A;  4NKL A;  3SR1 A;  2EJG C;  3QJY A;  2XVS A;  2BE5 D;  1TQO A;  5EKL A;  3TN2 A;  4XXE A;  1GUO A;  1XWE A;  2L9H A;  1STN A;  4F8M A;  2VXW A;  4MHE A;  2PZW A;  4OO1 I;  1ONL A;  1V1P A;  2NN6 G;  1EU3 A;  2HUG A;  3HOX B;  2CW0 C;  2IW3 A;  4YIJ A;  1EZ8 A;  3GD7 A;  1B2T A;  4ODG A;  1HPC A;  1EY5 A;  5IGF A;  5KND A;  4HED A;  2E76 C;  1BCP F;  5I2Y A;  1E0B A;  4HCE A;  4PQX A;  1A15 A;  1FD7 D;  1A3U A;  2K5W A;  3R2I A;  1ENA A;  5CBE E;  3LWU A;  1WD1 A;  3BYY B;  4ID6 A;  2KOL A;  5I6W A;  2E2J B;  2SDF A;  2R7Z B;  1SNC A;  1TT2 A;  4IFD G;  3VR4 A;  2KUM A;  3Q0A A;  4TSS A;  5JAV A;  1VDZ A;  3H0G B;  4C3J G;  3HOW B;  4KHV A;  4RH6 A;  1EY6 A;  5IOD A;  1B1Z A;  2IJ0 A;  1SYG A;  3KLS X;  3HOZ B;  5JOB A;  1WTR A;  1JCK B;  1I4Q A;  3QB3 A;  2M00 A;  1BNZ A;  3HS0 C;  4DAV A;  1LLR D;  4CKB A;  2K6A A;  3NTK A;  5TSS A;  4B08 A;  2K5Q A;  3K7A B;  1SNP A;  3OWF A;  3I3C A;  5C5L A;  4X3S A;  5NUC A;  2F0L A;  3IFD A;  2I46 A;  3Q22 A;  4R9W A;  1FYC A;  2Z4H A;  4A3M B;  1EWH A;  4RCN A;  1JWU D;  4IUR A;  1IKM A;  4KI0 A;  1LV9 A;  4XYQ A;  1BO0 A;  3L3O C;  4K8I A;  5LL6 X;  1R4P B;  4IFD H;  1NUC A;  3HOU B;  1S5E D;  2B8G A;  2QDB A;  2B2U A;  1XYI A;  4DAP A;  3VR5 A;  3MFY A;  4UAI A;  3SEB A;  2EVB A;  2RDG A;  1Z6H A;  2Z1C A;  2IL8 A;  4QUF A;  3MXN A;  2K33 A;  3NWS A;  1NR2 A;  5ELC A;  5J1Z A;  5CV5 A;  5DM7 3;  4ZKB B;  1Q90 A;  4FVM A;  3K6O A;  3SE0 A;  1E2W A;  5CYU A;  4KY5 A;  1WTX A;  1R4Q B;  1Y8O B;  4FXK C;  5D3I B;  4RHR A;  4K2L A;  4K8J A;  1EU4 A;  4RGT A;  4DFA A;  3MHB A;  2L0C A;  3DEP A;  3T56 B;  1C48 A;  3MXU A;  2ZXO A;  2A6H C;  1H9M A;  1WTV A;  3RD4 A;  1HTP A;  2R3Z A;  4ZUJ A;  1JOO A;  3QG1 A;  2F0P A;  1TY0 A;  1Y1W B;  1B44 D;  3TME A;  2XN9 C;  1BR9 A;  2PZU A;  4IN3 A;  3OMG A;  2IPK D;  3GTO B;  3ONA B;  2K05 A;  3DHQ A;  3GQB A;  4FF2 A;  1AFP A;  4FXG C;  5ELD A;  4RGO S;  1OXT A;  1YNJ C;  5G3L D;  2Q8T A;  3GV3 A;  3NWT A;  1UEA B;  3TZU A;  5KRU A;  1LO5 D;  2C9O A;  1G8Z D;  3F2U A;  3NUC A;  3VYU A;  3RMH A;  1BCP B;  1JOQ A;  3URY A;  3QIA A;  5E1F A;  5KIX A;  2LKV A;  1EY0 A;  2KA7 A;  4XT3 B;  1II3 A;  3BDL A;  3E6Z X;  2OF1 A;  1SYB A;  1KLG D;  2SNM A;  4DXG A;  2Q8I B;  3NHH A;  3Q6S A;  3GO5 A;  3PUV A;  1SBB B;  3EA6 A;  4A3I B;  5G3L F;  1DZ1 A;  2TSS A;  1JWS D;  5M5W B;  5COR A;  4EQN A;  1O7Z A;  3M4Y A;  4CKE A;  4N9T A;  1EL0 A;  2DN8 A;  1BCP C;  1STE A;  2JEB I;  1QE6 A;  4ULL A;  4FF4 A;  3MFG A;  2DNC A;  1E2Z A;  1BF4 A;  3DUZ A;  1SYF A;  1B53 A;  3J7A V;  2FMM A;  1RDP D;  4XIG S;  3OIQ A;  1HUN A;  4XQN A;  3QWN A;  4OO1 H;  2X6L A;  1SEB D;  3EFX D;  2JA7 B;  2LFN A;  2X69 A;  1WVL A;  5E4X A;  1TII D;  1XX8 A;  3VR6 A;  2RVL A;  2B2V C;  3FRP B;  1V43 A;  3MAQ A;  2B2W A;  1G6Z A;  1PXU A;  3BZD B;  3WOE A;  3T13 A;  3MVV A;  3D4R A;  4IUV A;  3KUP A;  1SND A;  2KCN A;  4DN4 M;  5D3D A;  2GA4 B;  1EYA A;  1WTQ A;  1EY8 A;  5E4W C;  5I6Y A;  3IL8 A;  5FKA C;  4WFN 3;  4RA8 A;  4ZQ3 A;  5ELB A;  1HCZ A;  1RKN A;  4A3F B;  3ZYY X;  1C4Q A;  4Z9C B;  1BUV T;  2O5I C;  3IAY A;  3OMC A;  2PYK A;  5C3W A;  2LMC B;  2A5H A;  3QOL A;  1BQQ T;  2L55 A;  2F0S A;  3TBI B;  4RCO A;  5J39 A;  4IUT A;  5M5Y B;  4L63 B;  3WOF A;  3HKZ B;  2ID0 A;  3AU7 A;  3R2T A;  3N6R A;  1V1O A;  1B50 A;  3UI2 A;  2J0T D;  3NK9 A;  3OOC A;  3JAM L;  4CJ1 B;  3HGB A;  3P20 A;  2EYF A;  3I4L A;  1IYU A;  4K5W A;  3KLR A;  2K1B A;  1Y8N B;  4K6D A;  4DK1 A;  1KAA A;  1PFB A;  2A74 C;  2LY7 A;  4KKT A;  1HA6 A;  1SYC A;  4NDX A;  2XIW A;  3NE5 B;  3CHB D;  3M7N A;  2H1E A;  1PTO D;  4QCL A;  1ET9 A;  5EPJ A;  2AWN A;  1LTR D;  4DNR B;  2R93 B;  3GTP B;  4QIW B;  1T5E A;  2NBF A;  3I73 A;  1JIC A;  4E6I A;  5HUR A;  3TP5 A;  1QIL A;  4CKC A;  2B2V A;  4F87 A;  2RQX A;  4OGQ C;  2F0G A;  1EY7 A;  3KBG A;  4BBR B;  4C1N K;  3AMU A;  4KV6 A;  1HQM C;  1J9O A;  4FNF A;  1ILP A;  4M1U B;  1PTO F;  1CQV A;  2XWJ B;  1D5Z C;  4OL7 A;  5I2X A;  5BN3 A;  4A3B B;  2LS0 1;  3TP8 A;  1ML0 D;  4TKO B;  4IUN A;  2PCF B;  1F9Q A;  1IW7 C;  2O2L D;  1RF2 D;  5IT9 E;  1JQY D;  3PIP 3;  4O42 A;  1K8O A;  5C0X I;  2K28 A;  1LT3 D;  2RBM A;  1DD2 A;  1CI3 M;  1SSO A;  1OO9 B;  3BDO A;  1SE2 A;  5EJW A;  2MP1 A;  3OIP A;  1ICW A;  3X3M A;  5J22 A;  3BVG A;  1TS5 A;  5FOB B;  2A6E D;  5JPN C;  4J1M A;  5EQ0 A;  2B2U C;  1STY A;  1WD0 A;  5A35 A;  1QJO A;  1UUP A;  1U4R A;  5C4J B;  1ILQ A;  2CVR A;  4ZKC B;  3GV6 A;  3X3N A;  1PFM A;  4N9P A;  2HDL A;  2KVM A;  4CJ0 B;  5JVH 3;  3OSO A;  4KTA A;  2NVQ B;  2BOS A;  2X6G A;  4KN4 C;  2A69 D;  4DF7 A;  1VMC A;  5IGE A;  2SOB A;  3M85 A;  1GXD C;  2FFK B;  4Y7N B;  4K5V A;  1EIH A;  1XTC D;  3I72 A;  3TP6 A;  3H94 A;  3L9A X;  4U67 3;  5CGK A;  2F0M A;  3QO2 A;  2R6G A;  5CV6 A;  1ZEQ X;  3HOY B;  1JWM D;  1SYD A;  3E5S A;  1UAP A;  5EBC A;  3S1R B;  1F9P A;  2VUM B;  1Y1V B;  1O80 A;  2XSC A;  3T16 A;  4CBV A;  1G2T A;  1GUW A;  1HUM A;  3TP7 A;  4K14 A;  2NVX B;  3CQZ B;  4NMZ A;  2B2Y A;  1VMP A;  2NWG A;  5C44 B;  5CMD A;  3K5L A;  2MUY A;  1H9R A;  1MSG A;  4BA1 I;  4QUC A;  3MC0 B;  5C4X B;  4ZYS A;  1CFM A;  4X3U A;  2NTT A;  2WV6 D;  3A55 A;  1R9T B;  3S2H B;  4KJO A;  1D5X C;  2E2D C;  3C3L A;  2D2C C;  2PQE A;  5COY A;  5A2Q E;  3KBX A;  3FPP A;  2RKS A;  1STH A;  1PTO B;  2F03 A;  1E2V A;  3FMC A;  3A56 A;  2R92 B;  4C2M B;  2BA0 A;  1O7Y A;  2JP1 A;  4I7Z C;  1IKL A;  1QWY A;  2F0Q A;  4EGV A;  1H9K A;  3S2D B;  2K03 A;  4HMJ A;  4IUQ A;  3T53 B;  1PLF A;  4KY6 A;  2F0N A;  3LX0 A;  3J7Y W;  1AZP A;  2F0J A;  4KD4 A;  2C5C A;  3ITP A;  4WRD A;  1SNQ A;  4B9X A;  3DWP A;  3W2D A;  1D2B A;  1RTN A;  4EQP A;  1I6V C;  1JC7 A;  4JK1 C;  5EPL A;  4KN7 C;  1NR4 A;  1DJR D;  1PTO C;  1DYQ A;  2B2W C;  3SXH A;  1LAC A;  1LTT D;  2WP8 J;  5I4D A;  5LL6 S;  5KNC A;  4BBS B;  3J7A F;  3DWQ A;  5F2D A;  4ZLT F;  1O7L A;  3OWE B;  1Q3L A;  3ERO A;  3WDN A;  5DNF A;  4PMW A;  3NSW A;  5KEE A;  4C3I B;  3NP8 A;  2XRS D;  1W6K A;  2PW5 A;  1PRT D;  2O4X A;  1M4V A;  3H09 A;  1SE4 A;  1RJT A;  4RGM A;  1PDQ A;  3V96 A;  1X32 A;  3R3O A;  1TS4 A;  1L0Y B;  2FHT A;  4J6H A;  4H7B A;  1HA5 A;  1YNN D;  4OO1 G;  1TS3 A;  4IAL A;  2SEB D;  1T5X D;  1STG A;  3FPU B;  4F88 A;  3OPO A;  1EY9 A;  5K36 H;  1HQR D;  1MI2 A;  4BS9 A;  1LT5 D;  2M9V A;  2K32 A;  3V05 A;  1BDO A;  5I9P A;  1CM9 A;  4BY1 B;  5C0X H;  3FVQ A;  1PRT F;  1LT4 D;  4G7O C;  1GUT A;  1ET6 A;  1QB5 D;  4U68 A;  4FF3 A;  3O13 A;  3K5O A;  2KQ3 A;  3C46 A;  2RDH A;  4KHZ A;  1EQV A;  3HOV B;  1GOZ A;  2CW0 D;  2EYL A;  3NQI A;  4A3E B;  2BE5 C;  2EY5 A;  5BN5 A;  3CRK C;  3BYT B;  3HG9 A;  2KEE A;  4EVO A;  5JEA J;  4RFB A;  3RZO B;  3SK4 A;  2JA5 B;  1I4X A;  3SHL A;  1MGS A;  3MZ5 A;  4NP5 A;  3NTH A;  5ELF A;  3OHX C;  1TR5 A;  1XXG A;  1NCV A;  3SVM A;  2L1B A;  1PTO H;  1KLU D;  3MXG A;  4AYB B;  4G7Z C;  4HN7 A;  4C3I G;  2NTS A;  2E74 C;  2JEA I;  1UNS A;  2E2H B;  2WAC A;  1QCB D;  1ENF A;  3G7L A;  2NN6 I;  4LJZ C;  2B8F A;  1AZQ A;  3D3R A;  1GHK A;  3CRL C;  2E75 C;  1IYV A;  1SDF A;  4TQU S;  4S3S A;  2Q8R E;  3G6J B;  2B39 A;  4ME5 A;  2QF7 A;  4J8Q A;  4C3H B;  4KKS A;  4KMU C;  5IOC A;  2IT1 A;  1SNO A;  1DCZ A;  1DOM A;  3RUZ A;  4GZY C;  3DM1 A;  4A93 B;  4FXD A;  1KDA A;  4DXF A;  1QNK A;  4WJW A;  2ZXP A;  3EVQ A;  1TWF B;  5IT9 L;  3MEH A;  2F0K A;  2WKD A;  3U9O A;  4BWG B;  3R93 A;  3QOJ A;  4V0B A;  3LWE A;  1I4G A;  5JPM C;  1F9R A;  2IX3 A;  3SDZ A;  3U9S A;  1ZYR D;  1FR3 A;  2ZXR A;  3M3Y B;  1GHJ A;  5JEA G;  3GTL B;  4P2C B;  3KF8 A;  1IL8 A;  2L12 A;  5IGG A;  1EY4 A;  2F0F A;  1MBY A;  1B4O A;  3VYR A;  1KNE A;  5ISR A;  1A3V A;  2R61 A;  1LTA D;  3AB9 A;  4X3T A;  3ERQ A;  2PO4 A;  2EZV A;  3S15 B;  2EE1 A;  1VF7 A;  1OXV A;  4X3K A;  1CA6 A;  4Q0F A;  2XWB B;  1SFO B;  2H4O A;  5EGT A;  1I50 B;  4FYD A;  2F0I A;  3TSS A;  2EY1 A;  3S1N B;  3PO2 B;  2PMZ B;  1B3A A;  1F2Z A;  4DK0 A;  2HCI A;  5KYI A;  1DM0 B;  2ZT9 C;  5M3M B;  2DY7 A;  1U4P A;  1PRT B;  1EOT A;  1AW7 A;  3KK7 A;  4C3H G;  3P7J A;  1CZW A;  4FP5 D;  1W6J A;  2EJF C;  5C5M A;  5JEA H;  1PFN A;  1RCV D;  1A6X A;  3K57 A;  2TMP A;  1AN8 A;  3VA7 A;  3DXJ C;  4DAY A;  1FGB D;  1D5M C;  1F77 A;  2KCC A;  5M3F B;  5E3F A;  1J8I A;  2B2Y C;  3NXW A;  3M7G A;  1H9S B;  1EQT A;  1VF5 C;  4NW2 A;  2WB1 B;  4XQJ A;  2BDN A;  5JVG 3;  5CV7 A;  4K5X A;  2HDM A;  4KJN A;  1PZI D;  4CJ2 C;  3A54 A;  4XT1 B;  3SK6 A;  1NSN S;  1EFI D;  1O78 A;  2PPB C;  2F3W A;  1YNN C;  5FLX L;  1TS2 A;  2J4X A;  1PZJ D;  1GUN A;  1KTK A;  1Q12 A;  2IWH A;  1B9N A;  2CHB D;  2BDO A;  3HP3 A;  3ND8 A;  3S16 B;  4PNY A;  1DXM A;  5BN4 A;  1S5C D;  2EYJ A;  2B2T A;  3J80 E;  2D5D A;  3LNN A;  4EQO A;  1D6E C;  2K04 A;  4KD3 A;  1C8C A;  2J7Z A;  3MA2 B;  3E0J A;  2F0E A;  5A2Q L;  3D4D A;  2AQ1 B;  2XRQ D;  1S4Z A;  3EQL C;  3Q24 A;  2NYZ D;  3D6W A;  1EWC A;  4ZUI A;  5T1G A;  2EJM A;  3PUX A;  1B9M A;  3I4M B;  4A3K B;  3C1E A;  1G29 1;  2JYO A;  3PUZ A;  1K83 B;  1HXY D;  3BDC A;  4HSP A;  1PMR A;  1KDC A;  4HTH A;  4RHS A;  1PZK D;  3NBI A;  4QB4 A;  3RZD B;  2JA8 B;  1CTM A;  4OIJ A;  2YYZ A;  3RLF A;  4MN3 A;  3HEJ A;  1OXS C;  4CGY B;  4Q5V A;  1RTO A;  4HR7 B;  5KYL A;  5CC4 A;  3BVM A;  4H44 C;  4IUP A;  5C0X J;  5CV4 A;  2F0H A;  2MGS A;  2E2I B;  3FEW X;  4KKU A;  1QNU A;  3HZX A;  2F0O A;  1EEI D;  1TVX A;  1QOH A;  3V2T A;  4G7H C;  3PIO 3;  3M4O B;  5FLX E;  1SXT A;  2AUJ D;  1BXT A;  3T51 B;  3BVZ A;  3J81 E;  2NN6 H;  4H0L C;  2VB3 X;  4JBW A;  5C4H A;  1WTO A;  2VNU D;  2K7V A;  4PMB A;  4L8J A;  4R8I A;  1LTS D;  1Q1E A;  1HHV A;  5FK9 C;  2QEJ C;  1ESF A;  3CKI B;  3MWY W;  2A68 D;  3K5M A;  2AWO A;  4ZK9 B;  1F2L A;  3Q23 A;  5DM6 3;  2Y0S B;  2RDF A;  2DY8 A;  5D14 A;  1SNM A;  4K2K A;  2F4I A;  1S5F D;  1D1K A;  3A7A B;  4DU9 A;  2EYH A;  1TKW B;  1IHZ A;  5M9O A;  3W3A A;  2YU9 B;  3NBH A;  1EIG A;  1KDB A;  3L7Z C;  1ZYR C;  2JSO A;  1VCI A;  3SK8 A;  3S17 B;  4CHT B;  2EXZ A;  3C1F A;  1GUG A;  1Y69 U;  2BA1 A;  1H9S A;  3IFT A;  2Z4I A;  3BS1 A;  2OT2 A;  2QIL A;  1U9R A;  1PYW D;  5C4Z A;  1AEX A;  2EPB A;  2EY6 A;  3S1Q B;  5K36 G;  5D65 A;  4HCS A;  1STA A;  1HTL D;  5IIF A;  4OHJ A;  4RGN A;  1CA5 A;  2NUC A;  3K0Y A;  4ILW A;  4O1N A;  2SNS A;  1MD2 D;  4HSV A;  1TWH B;  1EYC A;  3C2P A;  1ENC A;  1JE4 A;  2F0W A;  1TY2 A;  1QG7 A;  3NPP A;  2K5D A;  3I90 A;  5C0X G;  2A73 B;  2BCO A;  4A3J B;  1SMY D;  2I07 B;  1TU2 B;  5JJZ A;  1SYE A;  4RKB A;  4ZAI A;  4A3D B;  3R8B A;  1BBX C;  1CQF A;  3PUW A;  4PV1 C;  5EBD A;  2EYO A;  1IW7 D;  4XYO A;  3EJI A;  1EEF D;  4LK1 C;  1KNA A;  2IX0 A;  4M8A A;  1MSH A;  1G2S A;  3OW7 A;  1ESR A;  2NVY B;  1S5D D;  1I4H A;  3N52 A;  1SJE D;  3P75 A;  1CK1 A;  2V4D A;  5EPK A;  1TWC B;  3BG3 A;  1WCM B;  1I4R A;  2MPM A;  1TWA B;  2IX1 A;  5ELE A;  2JXM B;  2EOT A;  5CV8 A;  5DAU A;  3K59 A;  2PNR C;  2OXP A;  2QCP X;  1X3Q A;  1I6H B;  1GUS A;  1DOL A;  1SAP A;  1Z7T A;  1D1I A;  4XQQ A;  2ICI A;  3K58 A;  4A3G B;  1DOK A;  3GTG B;  4OIK A;  5FO9 B;  4BA2 I;  1F2M A;  1L0X B;  2A6E C;  5AFW A;  2L4N A;  2RSO A;  4F7X A;  3I70 A;  4IUU A;  3NQT A;  2DNE A;  2NB0 A;  1KAB A;  1U4L A;  2F0T A;  2HCC A;  3I4N B;  2WKC A;  1CT1 D;  3VR3 A;  5FO8 B;  1OXU A;  4FF1 A;  2NVT B;  3D31 A;  2D62 A;  5K5P A;  2FJ2 A;  3PMF A;  3P1H A;  1G91 A;  3FDT A;  2G9H D;  2OEO A;  2F1M A;  2WIN B;  3PUY A;  2XNA C;  1U4M A;  2A69 C;  3MTS A;  3S1M B;  4G4K A;  2RA4 A;  3GTQ B;  4V19 0;  4RAU C;  1LT6 D;  1I3Q B;  3A8K E;  2EDG A;  3S14 B;  4XDX A;  1EYD A;  2MJ8 A;  4KK7 A;  3CU7 A;  3A8I E;  1TWG B;  3S9W A;  1K8M A;  3MXP A;  1LTI D;  2F0V A;  3D4W A;  5T1I A;  3TZD A;  4B9W A;  4HMI A;  3GTK B;  3I91 A;  1ZXT A;  2FIN B;  4UDU C;  1CHQ D;  3DWA A;  4FO2 A;  5CBA E;  3D8G A;  4IFD I;  2WAQ B;  1FNV A;  3PV0 A;  2FMC A;  2N55 A;  2N88 A;  1HFN A;  1V1P B;  3A7L A;  4LAA A;  5CV9 A;  2KHS A;  3K5N A;  1WTW A;  2KED A;  2L5T A;  5M5X B;  2KJX A;  3SK5 A;  2D9U A;  1EZ6 A;  2F3V A;  5CR3 A;  5HGT A;  1OXX K;  4R8N A;  3H91 A;  5C6A A;  4MIU A;  4XTC S;  3VA5 A;  4IQZ A;  2JA6 B;  3GTM B;  1FNU A;  5FO7 B;  1CHP D;  1CZG A;  2B2T C;  3HRZ C;  1GJX A;  3KLS A;  1JB3 A;  3H6M A;  1X3P A;  1H9J A;  1JOK A;  1M8A A;  1Y8P B;  2A68 C;  1JOR A;  1SE3 A;  3I8Z A;  1F2Y A;  2F0D A;  4IZ8 A;  1RD9 D;  1BOS A;  2ICE C;  3J80 L;  1HFG A;  2EYM A;  1SJH D;  4RKL A;  5IGD A;  2A6H D;  2JE6 I;  2HQE A;  4G57 A;  3IKJ A;  1S5B D;  2KEC A;  4K6L A;  2QKI C;  2WII B;  4DNT B;  2PZT A;  1I4P A;  4QF4 A;  1Q1B A;  2L11 A;  1A3T A;  2PW7 A;  5C3E B;  3GTJ B;  4C1N I;  1HRJ A;  3VYT A;  5LHY 1;  2O5J C;  4L6T B;  4DGZ A;  1V8Q A;  3H3V C;  2EYP A;  4LMQ D;  4RWS C;  2K01 A;  1DON A;  1Q8I A;  5EKK A;  2CQA A;  2NZ1 D;  3D6C A;  3A8J E;  1ZKO A;  5C3X A;  1YNJ D;  5IGC A;  1SMY C;  1NAP A;  2AQ3 B;  4ABN A;  5DEH A;  4IFD J;  3VYS A;  5KNB A;  2F0U A;  4QMG A;  4WOR A;  4ZRZ A;  4KY7 A;  4C3J B;  4C56 C;  3FKI B;  3GP7 A;  2M2L A;  3T4A C;  5IGB A;  2B63 B;  4I65 A;  4HAE A;  1PRT C;  1WTP A;  3VR2 A;  2MHV A;  3TDQ A;  2G9D A;  1JR0 D;  5EKI A;  1STB A;  2AQ2 B;  1Z47 A;  2AUK A;  5I9O A;  2Z8L A;  1ROD A;  4BY7 B;  1LAB A;  3JAM E;  3ND9 A;  1F9S A;  3PO3 B;  1LTG D;  3J81 L;  1LTB D;  4DA2 A;  2ENB A;  1A2T A;  2EY2 A;  1A2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...