2O2LD

Crystal structure of human heat-labile enterotoxin in complex with a blood group a antigen analog
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
98
Chain Sequence
b'APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat-labile enterotoxin B chain
publication title Blood Group Antigen Recognition by Escherichia coli Heat-labile Enterotoxin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 25
structure length 98
sequence length 103
chains with identical sequence E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2o2lD00
1LT6D 1FNWA 2XRQD 1CHPD 1JR0D 3BVMA 1PRTD 1PRTB 1SE4A 1JWUD 1EU3A 1FNVA 1UUPA 4UDUC 1I4QA 1DYQA 1I4RA 4RGMA 1PRTC 3CHBD 3W2DA 2AQ3B 2AQ1B 1TS2A 1JWMD 1RDPD 1PRTF 1S5CD 4OHJA 1LTSD 5ELCA 2O2LD 3BVZA 1LTGD 1LTRD 1EEID 1LLRD 1I4XA 4ZYSA 5ELEA 3V05A 1QILA 4DXFA 2J4XA 1M4VA 3R2IA 1L0XB 1D5ZC 1EU4A 4RCOA 3BYTB 1SE2A 1CQVA 1PTOF 1V1PB 1D6EC 1RCVD 3BVGA 1S5ED 1SXTA 4L6TB 1CT1D 1T5XD 4Z9CB 1KTKA 1JQYD 1LT4D 1RF2D 1TY0A 1TY2A 1SEBD 1ET9A 1RD9D 1I4HA 2AQ2B 5FK9C 2CHBD 1PZKD 1S5BD 1B44D 1EWCA 2IJ0A 1EEFD 3EA6A 4L63B 4K6LA 4BWGB 1PZID 3BYYB 1BCPD 1BCPB 1SBBB 5D3IB 1PYWD 1BCPC 1L0YB 1FGBD 1SJHD 3TSSA 5ELDA 2Z8LA 1DJRD 1V1PA 2ICIA 1PZJD 1G8ZD 2WV6D 4RHSA 5TSSA 1LT5D 1LTBD 1XTCD 3GP7A 4RGOS 1HA5A 1UNSA 5D3DA 1TS4A 3DWQA 1I4GA 1SE3A 3KLSX 1HXYD 3R8BA 3SEBA 2QILA 1XXGA 3EFXD 1BXTA 3BZDB 2XNAC 1F77A 3O13A 4RGTA 4TSSA 1ENFA 2NTSA 2R61A 2SEBD 5ELFA 1HTLD 3R2TA 1HQRD 1PTOH 1S5DD 1JCKB 1LO5D 1TS3A 1D5XC 2TSSA 1LTTD 2NTTA 1CK1A 1I4PA 4RH6A 1LT3D 3DWAA 1KLGD 3MFGA 3MC0B 1CHQD 1AN8A 1D5MC 3URYA 2RDHA 5ELBA 1LTID 1GOZA 5I4DA 1TS5A 1FD7D 1BCPF 2IPKD 4O1NA 4C56C 4DXGA 1SJED 1V1OA 2QEJC 1LTAD 3DWPA 3OWEB 2XN9C 1JWSD 1B1ZA 1AW7A 4RHRA 1MD2D 4RGNA 1PTOD 1PTOB 2G9HD 1STEA 1KLUD 1ESFA 1FNUA 1PTOC 1EFID 1S5FD 2RDGA 5FKAC 1ET6A 4RFBA 2XRSD
chains in the Genus database with same CATH superfamily
4H13C 5JJKA 1Q1BA 3GTMH 1SE4A 1Y8PB 1EU3A 4CKBA 3HOZG 1YNJD 1ICFB 3T1HQ 3PUYA 1F9SA 1VQCA 5IP9G 3S1NB 4KJOA 1BQQT 2VL6A 4IOCA 1XMQL 1EY6A 1N36Q 5M3MB 1IYUA 2FFKB 3PO2H 2KCTA 1UWVA 1ASZA 2A74C 1F9RA 3OW2A 3A8IE 3ERQA 4LF5L 1K28A 1PFSA 4ZKBB 1STBA 4YHHQ 2LXJA 4JI6Q 1B3AA 4B3TL 4DR6L 1G91A 1KTKA 3CQZH 2B2YC 1SEBD 1D2BA 2LKVA 1MGSA 4G57A 5FK9C 4K0KL 3S1QH 1Q82C 4U673 5EJWA 1BCPB 1BO0A 1O7ZA 4A3EB 2B8FA 1L0YB 1KL9A 1FGBD 3STBC 1R9TB 4NW2A 2E8GA 3GTOB 3T16A 1ESRA 3EROA 1YJNA 3DWQA 4OO1I 2DUDA 1RTNA 2UXBL 3SXHA 1UEAB 4DR4Q 3SK4A 2BE5C 1HFGA 5C6AA 4JBJA 2KHIA 4DUZQ 4DK6C 3DHQA 3RZDH 4HCEA 2PMZE 2DNEA 1GKHA 5IGGA 1LTTD 1Z7TA 3DWAA 1G2SA 3X3NA 1PYSB 1CQFA 4XDXA 4MTNA 4GLXA 3FVQA 1FJGQ 5GAHC 4DAYB 1BOSA 4E6IA 4DU9A 3OWEB 5EBCA 3RZOB 5COYA 3Q23A 1TWGH 1AW7A 1O7IA 5HGTA 3J80E 3H6MA 1P16A 1J5EL 4KTAA 1PTOB 2SNSA 3M9BA 1QE6A 3S17B 1H9SB 2RHQB 2B2VA 4DV0Q 3S2HH 4DGZA 3UI2A 1PH2A 1PXUA 3JC66 3J81L 2HHHQ 3FDTA 1IW7C 1UUPA 1FNVA 4LF6Q 2B29A 4CGYB 1R4PB 1K73C 3CAMA 1OXXK 4DV3Q 3UE0A 2B63G 4R8IA 1Q12A 3BG3A 3TBIB 3GQBA 1CA6A 3U4ZA 4JI0Q 2KCMA 2R92G 5C4JB 4GKJQ 4KY5A 1FYCA 3L0OA 1VQNA 3S24A 3A5UA 1I4XA 4DR3Q 4QGUA 3T53B 1VQLA 2RDFA 1STHA 1EU4A 4AYBB 1VMPA 2NWGA 2E2JH 4HN7A 4GOPA 1SXTA 2UUCL 4OIJA 5C5LA 5G3LF 3S16H 1A0IA 4G4KA 3D31A 1F9QA 3L3OC 2JA6H 2XTIA 2B8GA 4QMGA 2KHJA 4K6DA 4HSPA 2WKDA 4DA2A 4R8NA 3JAML 4LFBQ 1CUKA 1EWCA 4L63B 4K6LA 1WFQA 2LSSA 4F7XA 5LHY1 3K0XA 2HT1A 2EXDA 5D14A 3K57A 1N33Q 3GTLH 4IUUA 2K1BA 2PW5A 2EOTA 2F3VA 4DUYQ 2VW9A 2PZUA 4C3JB 4C1NK 2IT1A 3UDFA 1TQOA 2CCZA 1MIUA 1EY0A 4GNXA 5IY0A 1VQOA 1EIHA 1JCKB 1LT3D 3M7NA 2MQHA 3S1MH 1RTOA 3RLNA 1SSOA 1D1IA 1TS5A 3VYSA 3HOZH 2PNRC 1FGUA 5L37A 1B9MA 1O7YA 5IP9H 4KK7A 2E2DC 5J3BA 3BJUA 1A62A 1H9MA 3SE0A 4CDEC 4BY1B 2NVTH 4A3GB 3BZCA 3E0EA 3VA5A 5FLMH 3NK9A 2O5JC 4XT3B 3ULJA 3PIO3 4QUCA 4RAUC 1FNWA 4A93B 1VQBA 2K33A 2AUKA 4LMQD 2ICEC 3T51B 4JI2L 3C1EA 4X64Q 3TEHB 4P72A 2F0OA 5ELNA 4X3TA 1MJCA 2F0EA 3A7AB 4DR1Q 3PF4A 4DK3C 2NYZD 3HOVH 1C4QA 1WD0A 3OIPA 2L1BA 1Q81C 5DLQE 2B2UA 2J4XA 4JBKA 2WB1E 5GROA 1X6OA 1W3SA 1QVFA 3BVGA 1EIFA 3TS0A 1TWCH 1VQIA 4NXNL 4DNIA 4IURA 1GUTA 5HURA 1VQ9A 3HOUB 5DEHA 5JJZA 1I94L 4X3UA 3NELA 1STNA 2GVAA 3T4AC 4QCLA 1RL2A 2JA5G 3W3AA 4OX9Q 5I6YA 1JORA 1ZEQX 3STBD 1PYWD 3CW2C 1WTRA 2BDNA 2VUMB 4KY7A 4DV2L 1DJRD 2EY6A 4R4IA 1VQ5A 2Z6KC 4TVAB 2XVSA 3C2PA 5M5WB 4O42A 1PMRA 1VQHA 3HZXA 2BE5D 4C3IG 3VR3A 4EQNA 3O13A 2ES2A 2R93B 4ULLA 2R7FA 1U9RA 3FPUB 2F0PA 3KFUA 1I6HH 5GAEC 5IT9E 1WYDA 2EY1A 3TP5A 4GN4B 5M5XH 1D5XC 1WTHA 1Y1VG 5C0XI 2RA4A 3U9OA 1EYCA 3GV6A 4GOPB 4A3BB 1MKHA 4X65L 1HFNA 4X62L 3K7UC 3MTSA 2A6HC 4HCSA 4B3RL 4TQUS 2EYMA 4BBRH 2F0MA 2CVRA 1SE8A 2E75C 2MO1A 2B63H 3KOJA 4CBVA 3DWPA 2AMCB 3ND8A 2K50A 2UU9L 2R92H 4UPAA 4RGNA 4LF7L 1ICWA 1ESFA 1QVCA 2K01A 2KENA 4X3SA 4H7BA 3WOEA 2R7ZG 1IW7D 1LT6D 4B9WA 3F2UA 4GKKL 1K8GA 2HCIA 1Q7YC 4ME3A 5IGFA 1N32L 2GVBA 4A3KG 4UDUC 2E5LL 3HFZB 1PRTC 3A74A 4A3JB 3PIP3 4RA8A 4IJHA 3PIOA 4FP5D 4X66Q 4DR7L 1EY8A 1VF7A 3NUCA 1ML0D 4GNXB 3QOJA 1HA6A 1LTRD 5GADC 2JA9A 4OGQC 5HY6A 3KBXA 4OIKA 5C44B 4UP7A 4XIGS 4OEMB 5JJLA 2AWNA 2NVXB 1W2BA 2H5XA 4R4QA 1SE2A 1E3PA 1V1PB 1HH2P 4A3FG 3I4OA 1XYIA 1F2MA 2F0KA 4P75A 5C0XJ 4IFDG 3OWFA 4GLVB 3L2PA 4G7HC 5DM63 4XYOA 1U4LA 2CHBD 5BR8Q 5M5YH 1SFOH 4ZCKA 3J7A5 1C0AA 1SBBB 1JICA 3I2ZA 5F2DA 2PPBC 2Y0SE 4H02A 1XNRQ 1KABA 2F03A 3OTOQ 1ILQA 1N34Q 4NDXA 1NUCA 2LY7A 5IYDG 3OYYA 5D3DA 1DGSA 1HTPA 4YY3Q 3CMAA 4BY7G 2UXCL 2QILA 1XXGA 1VQKA 2CQOA 3TDQA 4DAPA 1TIID 5LMNQ 4IUPA 2X69A 3KLRA 1IKLA 1ENFA 5CV4A 2B2WA 3G71A 1TWFB 2Q2TA 3K7AB 2A1AA 2NTTA 4QB4A 1TWAB 3VA7A 4LF8Q 3IAYA 1RJTA 1K0SA 2VZAA 3AFPA 2I46A 3I72A 3H0GG 3QOLA 4QUFA 1I3QB 1AE3A 1JWSD 4BBSH 4JYAQ 1QJOA 2KEEA 3IFTA 3NEMA 2JA8G 1MD2D 4MIUA 1U5KA 1YHAA 3BS1A 3I4NG 5FLXc 3E6ZX 4HIMA 1DOMA 1E2ZA 2RDGA 1G8ZD 2EYHA 2KCCA 1PH5A 2D5DA 1B7YB 1DCZA 2BA0A 4EQ5A 3T13A 2ZJPA 1RIPA 2Z9HA 1MSGA 5JJIA 1GUSA 3J81i 1VQDA 2NBFA 3FKIB 3NXWA 4DN4M 4LFCL 1PV4A 1Q8KA 3S2DB 3IKJA 1NR2A 3HKZE 4KHPL 2YU9B 2K5QA 1BF4A 1XNQQ 3M4OB 1DZ1A 4JOIC 5ELCA 1Q8IA 2K7VA 1SRUA 2CW0C 3KYHC 4FDBA 5M3MG 2A6EC 4ZYSA 1HNZQ 4XTCS 4QJFA 2NVYB 4IZ8A 2FJ2A 2JA5H 3PIPA 3G6JB 5EKIA 2K28A 1BNZA 1SNMA 2OT2A 3QB3A 5E4XA 2JA7H 1JOKA 1YHQA 2AUJD 4GLAC 3HGBA 1G51A 4UHVA 1YEZA 1X3GA 3K0YA 4H44C 1B4OA 1U0LA 3N6RA 1B44D 1K83B 2D2CC 4BXXG 1QZGA 3M3YH 1PZID 1IBLQ 1JJCB 3AEVA 1BCPC 4A3EG 4JI8Q 1Y1VH 3TSSA 2SDFA 2ICIA 3S15H 1XTCD 4RGOS 2B2TC 1WTWA 5IWAL 3CRKC 2EJMA 3S14H 2X6LA 4OWXB 1Y69U 1E24A 4WORA 3E5SA 3EBEA 1BUVT 5CBAE 5A35A 2F0TA 4A3IH 1XX8A 3BDCA 2ZTEA 4QIWE 4JI7L 4DR5Q 4FXKC 4HSVA 3C46A 3GO5A 3VR5A 2BDOA 2A6HD 5E7NA 5IP7G 2R7ZH 2OWOA 4P71A 1IBKQ 1H95A 2N3SA 4NKLA 4A3KH 2LFNA 3V2TA 4PMWA 5IYBG 1VQGA 4G7ZC 1LTAD 2XN9C 5FJ8G 1B1ZA 3E3XA 3M4YA 4G7OC 3VR4A 4JI4Q 1ZYRC 2CWPA 1CKNA 3KK7A 1S72A 4LUOA 1TKWB 1PTOC 4YWLA 4DV5L 5JOBA 2EYPA 1X3EA 5JPMC 3T1YL 3SVMA 2ZXPA 1HQMC 2PQAA 1EQQA 3NQIA 3Q6SA 1JE5A 1PRTD 1KNAA 2EE1A 3D4DA 2UUBQ 1HR0Q 3HOWB 1DYQA 5JEAH 2RSOA 4A3FH 3SGIA 3T56B 1TWHH 4OO1G 3A56A 4IFDH 5C4XB 5LL6X 1S5CD 4OHJA 1IYVA 4DV7Q 1LV9A 1K3RA 3I90A 3QJYA 4R1JA 2D0PA 5ELEA 2GN5A 3Q0AA 3U9SA 3I4MB 4KHVA 4AYBG 5KYLA 4HJ5A 3R3OA 4EX5A 1RCVD 1QNUA 1I5FA 3SK6A 3CQZB 4I65A 4IUQA 2KCNA 5IYDH 2L11A 4Y7NB 3S1QB 2PQEA 1GD7A 3T1HL 4IPGA 4AQYQ 3CD6A 3GTPB 1DOKA 1E7ZA 4A76A 3CCJA 1N36L 2K5VA 5BN3A 2I07B 4ODGA 3H91A 2ID0A 3JAME 2BCOA 1PFBA 1WI5A 5ELDA 2HIXA 3A7LA 1L1OA 4ALPA 1HZBA 1E22A 5I9PA 1XMQQ 4XT1B 4FXDA 5IOCA 1NAPA 4C3JG 4JI6L 4R4TA 1M1KC 3RNUA 4Y52H 1IZ6A 3HOXB 3CP0A 2DGYA 1QZHA 5EPLA 1SAPA 2JA8H 1FVIA 3E9IA 3CCEA 3I4NH 2E2HH 5IGEA 3FMCA 1VQEA 3MC0B 1F2YA 4L5TA 2UUAL 4B3TQ 4DR6Q 1G2TA 3OMCA 2RSNA 5T1IA 2MPMA 2N8NA 4DXGA 2K4KA 4K0KQ 2QEJC 3I91A 2QF7A 3S1NH 1RHPA 3NWSA 1Q1EA 1B3QA 3S2HB 3MXGA 1ILPA 4BY1G 1K3BC 5M3MH 4A3GG 4DR4L 1KDAA 3J80c 1CZGA 3D4WA 2GA4B 3KF6A 3ZYYX 2FMCA 2ZT9C 4A93G 1O80A 4PZ7A 3I56A 4N8X1 1JOQA 2KUMA 1CFMA 1I4QA 1I4RA 2HD3A 2WAQE 4LF9Q 1QB5D 4DPGA 5CV8A 1EY9A 2EYLA 2L5TA 1FJGL 2AQ1B 1B53A 1XJVA 2CW0D 1EOVA 4DK1A 4FVMA 2B3GA 1HUMA 2VQEQ 1XPUA 5DM73 4P74A 1IBMQ 2K32A 1B2TA 4JK1C 3GTQH 4BXXH 4KN7C 1YVCA 1OXUA 1XWEA 3AB9A 4DV4Q 2Q2HA 3OIQA 2JK8A 3PCOB 3IFDA 1YI2A 4A3MB 5K36G 1AH9A 2HHHL 2KQ3A 3QO2A 1R9TH 4LF6L 3GTOH 1J5EQ 2IHFA 4DKAC 4DV3L 1SROA 1ET9A 3D6WA 3HOUG 1I4HA 4NMZA 2Q2UA 1YNXA 1CKNB 2F0GA 4KMUC 4JI0L 2HIVA 2PMZB 2IX3A 4KLKA 2F4VL 1GXDC 1S5BD 4J6HA 4GKJL 1EEFD 3GTLB 1ONLA 3CMEA 2B2VC 1PHJA 1B8AA 1BCPD 2PQAB 4DR3L 4HIDA 2QDBA 3OSOA 2VUMG 5IP7H 1PZJD 2MFIA 4RHSA 5TSSA 3L9AX 1EOTA 1VS0A 1XTDA 4DR2L 4B3SQ 1SE3A 1SN8A 2H4OA 5IYBH 3EQLC 3RZOH 5FJ8H 2R93G 4RGTA 1HPCA 5M9OA 2ATWA 4V190 1D1KA 1H9JA 1PTOH 2F0QA 3S17H 2WKCA 1TS3A 4DAVA 1KLGD 1AN8A 4A3BG 4F87A 3NBHA 1HUNA 1N33L 4GOPC 4LNQA 1PH3A 3P1HA 1NBWA 3RUZA 1JJ2A 2CQAA 1ZYRD 4HMIA 1K8OA 3U58A 3RN5A 2L9HA 1PTOD 5C4JH 1JOOA 4IPDA 1IL8A 4EQPA 2NN6G 4DV1L 4H0LC 5I9OA 3PGZA 2VQFQ 1K8AC 1A6XA 1E0BA 3PUWA 1SNPA 3RLOA 4KKSA 1DM0B 3A55A 4ZLTF 3H09A 3CHBD 4K5VA 4A3JG 2KA7A 3HOVB 4LF4Q 4S3SA 2E2IH 2JEBI 3OPOA 4K5XA 1K8MA 2WP8J 2XWJB 4C2MB 4IOAA 1LTGD 3L7ZC 3SR1A 4GNXC 2JSOA 1QILA 5C3XA 1PVOA 5HGQA 5C44G 4YCWA 1D5ZC 1L0XB 2K52A 4HEDA 2ZXRA 3GD7A 1II3A 4L6TB 3KBGA 4GS3A 3K5OA 1X65A 3J7YW 5KIXA 4LJZC 1YZ6A 2D62A 2EJGC 4C3JH 1HNWQ 4MNOA 1HCZA 1I6VC 2IJ0A 3EA6A 4I7AA 5D65A 2Q8TA 3SDZA 3KF6B 2N78A 4WFN3 5J22A 4FO2A 1LUZA 1TXYA 2KECA 5FO9B 2FINB 2WV6D 2XWBB 3MVVA 1JB7A 1KIXA 3H15A 5IGDA 1I4GA 3SEBA 2RHSB 1HXYD 3HG9A 2YTVA 2KOLA 1GHKA 4NXML 2D0OA 1DXMA 1CA5A 5ELOA 3DMUA 2VS1A 1SLJA 4JI5Q 1EWIA 4BY1H 1S5DD 2K5HA 4A3GH 2I0QA 2B2UC 5FO7B 1STAA 4K8IA 4NXNQ 4OX9L 5IT9c 4BBRB 4OL7A 2I5MX 4LAAA 2EJFC 4PMBA 5KEEA 1VQJA 1O7LA 5FOBB 3W5OA 1I94Q 4OONA 1SYCA 3F2DA 3MXUA 2EIFA 2VB3X 1BBXC 1EQRA 2WB1B 1KLUD 1OO9B 1K9MC 5E3FA 4NPSA 4IJLA 3A5ZB 2F1MA 1SNQA 1GUGA 1MI2A 1WOCA 1YIJA 2QA4A 1LYLA 3RR5A 1GHJA 3FKIG 3S9WA 5JVG3 1ZXTA 2R3ZA 1JWMD 1PRTF 1PYBA 2EY5A 2ZM6Q 4IO9A 1OTCA 3PMFA 4WJ3M 3NP8A 3OMGA 3HOUH 3KF8A 2N49A 1EEID 1B50A 3GTGH 1KRTA 2ENBA 4DXFA 1EZ6A 4K2KA 2Z1CA 1Q46A 4HJAA 3OW7A 3NBHB 2O4XA 2LMCB 3MEFA 2VUMH 5EKKA 2HDLA 1T5EA 4LFAQ 3GTKB 5C3WA 1WCMB 1SMYC 2KJXA 4LF7Q 3I7FA 1Y8NB 5M5WH 4ME5A 2UXDQ 4AH6A 1BBUA 3LWUA 4NP5A 1I50B 1WJJA 5EGTA 3NE5B 1N32Q 4CKCA 2L4NA 4A3DB 2E5LQ 3ONAB 4C3HB 5KYIA 4A3CG 1S40A 3U4VA 1SYGA 3BZKA 2JXMB 3HOYB 1EZ8A 1Z9FA 5GQOA 2RKSA 5LMUL 1EL0A 3R8BA 2RF4A 2DY8A 2OCEA 5IE8A 5CV7A 2NVQB 1HQRD 3LNNA 4KY6A 2NN6H 2OTLA 2K14A 5JPNC 2RDHA 3K59A 1WD1A 1XNRL 2ZXOA 2CWAA 3MXPA 4HIKA 4BBSB 4IUVA 1V1OA 3MFYA 3UE1A 3UDGA 1Y1WB 4A3JH 2K5NA 5IIFA 2IWHA 4YY3L 1SNDA 2AKWB 5LMNL 1HHVA 5G3LD 2OXPA 3J7ZC 5C44H 4MZ9A 3PUZA 1QOHA 5EPJA 4JI3Q 3FPPA 2A73B 5BN5A 3HOWG 4LF8L 4JV5L 4K14A 1JE4A 3W2DA 1V1QA 5CV5A 2V1CC 4C1NI 1A2TA 1RODA 3PO3B 1D8LA 4DK0A 5C4XG 3H3VC 1EIYB 3BVZA 3TMEA 1S3OA 2Y0SB 3J81j 5C3EB 3BDOA 3C3LA 2B2WC 4EVOA 3KLSA 4PQXA 2JA7B 2NZHA 2ZTDA 3I4MG 2E74C 2NZOA 1CQVA 2HCCA 2VNUD 1T5XD 3NWTA 4ZUJA 4KJNA 3S1RB 3MAQA 3K81C 2EXZA 2EYJA 3P7JA 4JW0A 2JN4A 3G7LA 3MEHA 4DAMA 3P20A 1PZKD 1SYFA 1H9RA 1PFMA 1XNQL 2K5WA 2M2LA 2D9UA 5D3IB 1HNZL 2OEOA 1SMXA 4PNYA 1TWFH 1Z47A 2WINB 1WTOA 1HRJA 3K7AH 2KBNA 2Z8LA 1A2UA 1TWAH 1Y14B 4KHPQ 1HA5A 4QQBX 1HNXQ 1AEXA 1B9NA 5I6WA 3C1FA 2Z0SA 3M4PA 3V96A 1I3QH 3HOXG 3KF8B 4K5WA 4A3IB 1VCIA 1Z6HA 4POFA 4C3IH 5M3FB 2HUGA 3P75A 5J1ZA 2Q8IB 1LO5D 1CK1A 5EAYA 1QCBD 3K5MA 1VQAA 2MJ8A 1IBLL 2F0SA 3VYUA 3TP8A 3VR2A 4OWTB 1PA6A 3HKZB 5AJ3Q 2PZTA 3NPPA 4R4OA 1SJED 3QR8A 1AE2A 3FKIH 3CPWA 3I70A 4P2CB 3CCMA 3S2DH 1H9KA 4AIMA 1QVGA 2I5LX 2A8VA 3GTJB 2YU9H 4FNFA 4ZKCB 3VR6A 2IHEA 4QY7A 1MHWC 4HAEA 1U4RA 5AFWA 4UP8A 2CKZB 1G6PA 2CFMA 2NVYH 2C5CA 2PCFB 2IL8A 2G5DA 4DR5L 5K5PA 1XMOQ 5IWAQ 2N88A 4F8MA 3F2BA 3A8JE 5JEAJ 5A2QL 3IRBA 1LTSD 3HRZC 3J81c 2Q2IA 3ZJYC 3K8AA 2VXWA 3KDFA 1ENCA 5H1SE 4JI4L 3I3CA 1K83H 4DNRB 1EUJA 3GTMB 3PUVA 5EPKA 3NQTA 3WWVA 1E1TA 4LK1C 4CHTB 1D6EC 2F0WA 1NR4A 3Q22A 2HDMA 4PG3A 4A3CH 2F0DA 1SMYD 2A68C 4A3MG 2F4IA 1A63A 2UUBL 2YYZA 3CCSA 2WACA 1HR0L 4QL5A 3J81E 4OWWB 1X3QA 4DV6L 2KVMA 3PO2B 1EY5A 4JG2A 1HZ9A 4B3MQ 4QIWB 2Z6BA 4X6AH 1HR0W 3A8KE 1JC7A 4BWGB 4DV7L 3VDYA 2C35B 1F2LA 5LL6S 2IY5B 3DM3A 1PH1A 3MWYW 4K8JA 1SJHD 3CCRA 1JT8A 3H94A 2JJQA 1AZQA 3JAMc 2Z4HA 1U4PA 1SYBA 3QWNA 2EDGA 3TRZA 3J80i 3AMUA 2XNAC 5CC4A 3CCQA 4BY7H 4JI1Q 4JC0A 4AQYL 2YTXA 1C7YA 3EJIA 3HP3A 4IN3A 4XQNA 4YIJA 4JCVE 3TZUA 3U50C 1E1OA 2EZVA 4CDFC 3E9HA 5FLXL 4PMCA 1YNNC 2IPKD 3HOWH 3DM1A 2B2YA 1WTVA 1BVSA 3SHLA 3H0GH 4YHHL 3F2CA 3FP9A 3GV3A 4R9WA 3H3VH 1K0RA 5FLMG 3RZDB 3D8GA 5C4XH 3HKSA 2G9HD 1TR5A 3SK5A 5CBEE 3PUXA 1ET6A 5BN4A 4LF5Q 4CKEA 4KHZA 3I4MH 1JWUD 4PZ6A 4IQZA 1L1OC 3NTIA 2F3IA 1TWGB 4ZAIA 1OXVA 2F52A 4DFAA 2BOSA 1KQSA 1AP0A 2AQ3B 2HQLA 4APVA 3PF5A 4ZRZA 4EQOA 3HOVG 4Y7NH 1T9HA 1UAPA 1UE5A 2RVLA 3GTQB 3GTPH 2UUAQ 1YJ9A 1Q3LA 3NENA 2DY7A 1HZAA 2FHTA 4HMJA 1BR9A 3BYTB 4DUZL 4FYDA 1KDCA 2BH8A 1PLFA 1YJWA 2K03A 1S5ED 4GZYC 2JYOA 1NCVA 2YV5A 2UXBQ 1NTGA 4RMFA 3MA2B 4LF9L 1RF2D 4WRDA 1RD9D 1M90C 1CSPA 1X56A 2AQ2B 2A6ED 2F0VA 2R7DA 3HOXH 3ND9A 2BH2A 2CH4W 2VQEL 4O0AA 2E2JB 1IBML 1WTPA 2RQXA 3G6EA 3F1ZA 1CSQA 4DV0L 1DONA 1WVLA 4AYBE 4A3EH 3S16B 2TMPA 2WIIB 3LGJA 4DV4L 2JA6B 1LT5D 2ZTCA 1Y8OB 1F2ZA 3NBIA 4LWCA 3N52A 1YBYA 4CJ0B 1EQVA 3D3RA 1QNKA 3KDFB 4A4IA 3K6OA 1EIGA 1SR3A 3R2TA 3K58A 2RCNA 2TSSA 3Q8DA 2DNCA 4J15A 4M8AA 4IPCA 2L12A 2WAQB 1JB3A 5IODA 3MFGA 2L15A 3ULLA 3URYA 1LABA 4BBRG 3CCLA 5IYCG 2MP1A 4L5RC 3CF5A 2F4VQ 3VYTA 4M1UB 1W6JA 4B3SL 2H1EA 1J8IA 2QGQA 5GAGC 5EQ0A 3I55A 2WB1G 3FRPB 4L5QA 4LFBL 1X54A 3S1MB 3VYRA 3QG1A 3CU7A 2UUCQ 2NUCA 1CHPD 2IW3A 3BVMA 3HOZB 4DR2Q 3AYHB 4HTHA 4J1MA 4RGMA 4UAIA 1VF5C 2IX0A 2PI2A 2LS01 3RD4A 3M4QA 2E2IB 4A3MH 4JVZA 4DUYL 3NTHA 1RDPD 2MUYA 1EYGA 1L0WA 2NVTB 1A15A 2K75A 1QG7A 4OO1H 2O2LD 2A19A 1KDBA 2MNAA 3RMHA 3IL8A 3V05A 5KNBA 1M4VA 1EWHA 2NZ1D 2A68D 3D6CA 2M00A 1CM9A 2VQFL 4P73A 1L1OB 1V8QA 2F0FA 1O78A 3DUZA 1CT1D 2QEXA 3DLLA 2K04A 1VMCA 4Z9CB 1GO3E 1WCMG 1XPRA 1LT4D 3EVQA 1NMFA 3I8ZA 4IPHA 1VQ8A 4J8QA 4DV1Q 1AFPA 4LF4L 1KXLA 1BBWA 3A54A 1A3VA 3BYYB 4UP9A 1EYDA 2EYOA 2MO0A 1V9PA 4A3DG 3OHXC 3NTKA 1IHZA 4C3HG 5C0XG 1TWCB 2F0UA 3DEOA 1V1PA 1JJGA 5CGKA 3TREA 3HOYG 3GP7A 2F0NA 1EFWA 2OQKA 3M7GA 4X64L 1U4MA 2PYKA 3BZDB 3WDNA 1X55A 2WFWA 4BA1I 2J7ZA 2A5HA 4ABNA 5EKLA 5CYUA 3AU7A 1HNWL 2R61A 1E2VA 2SEBD 5ELFA 1IKMA 4DR1L 1NNXA 1PH6A 4JI2Q 1STGA 1CHQD 1WTQA 3CCUA 3J7AF 1GJXA 1YNND 1CKOA 4R4CA 3J80L 1X3FA 3BDLA 1KNEA 4BBSG 4XXEA 2L55A 4HJ9A 1QWYA 3K5NA 1Y1WG 1Q90A 4YCUA 4RHRA 1I6HB 2NB0A 4FF1A 2AHOB 5M5XB 3ER0A 1GVPA 2F3WA 5JVH3 2ALYB 4FXGC 4C2MH 2O5IC 1S5FD 4XQJA 3K80C 4RFBA 2EPBA 2XRQD 4JI5L 5CV6A 2Z6KA 2N55A 2KEDA 1D7QA 3K5LA 5NUCA 4A93H 2B63B 2JP1A 1GUWA 1UE7A 1SNOA 1L2FA 1S4ZA 4NXMQ 4BS9A 2A69C 4MN3A 2R92B 1TS2A 2PI2E 4KD3A 3PO3G 3I73A 3GTGB 4N9PA 1UEBA 2NN6I 1JMCA 4KKUA 4UY8C 3HS0C 1OXTA 1SYDA 2Y0SG 4ZUIA 1P8LA 5C3EG 2RBMA 2PW7A 4DV2Q 1FL0A 2JA7G 1CI3M 3CXCA 4WJ4A 1VDZA 2K5DA 1A8VA 1DOLA 1IYJB 3CRLC 1IL2A 4ZQ3A 4XYQA 2BA1A 5K36H 2F0JA 3AQQA 1TY0A 3PSIA 1QUQA 5CORA 5IGCA 4EGVA 2FXQA 1KHIA 2E76C 4RKBA 2ZM6L 5T1GA 1X3PA 1F9PA 1EYAA 1NJIC 1MSHA 4TKOB 4CJ1B 5I2XA 4X65Q 1OXSC 5KNDA 4X62Q 4B3RQ 3ICEA 2MGSA 4ID6A 4ZK9B 1GUNA 3I4LA 1AZPA 5EBDA 4KI0A 2I5HA 1FR3A 4CDCC 5IYCH 1UNSA 2UU9Q 4L8JA 4TRDA 3MXNA 4A3LG 5FO8B 1HJPA 1BXTA 2MHVA 4Q5VA 1SFOB 4LFAL 5M5YB 1CZWA 4JBWA 1W6KA 4ILWA 4A3IG 2JEAI 1VQPA 5E4WC 3A0JA 4JPBW 5M3FG 2B39A 2UXDL 4X66L 2R93H 4GKKQ 4U68A 1I4PA 2DN8A 2L0CA 4FF3A 4LUVA 1G291 4KKTA 3B6YA 4A3BH 1Q86C 4YWKA 3HKZG 4C56C 3KLWA 1C8CA 4DR7Q 1BKBA 1LTLA 2J0TD 1PH7A 3UDXA 5CR3A 1NE3A 4IALA 1VQMA 3G48A 4GN5A 4RKLA 1R4QB 1FNUA 1M8AA 2EQSA 3CC7A 1DD2A 1EFID 1GUOA 4CDDC 5BR8L 5DNFA 2XRSD 1X32A 1B70B 5C4ZA 3CKIB 3CPFA 3ITPA 4XQQA 1E2WA 5JEAG 1N8RC 2ASBA 4KN4C 4NB3A 5KRUA 2XIWA 5LMUQ 3OTOL 1N34L 1YNJC 2LXKA 3PV0A 3G4SA 2OF1A 2XGTA 5CV9A 2K6AA 3GTKH 5ISRA 3EN2A 2RCFA 1WCMH 3KUPA 2EYFA 4KV6A 4LW1A 1TT2A 5A2QE 2C9OA 4KD4A 1ZKOA 3R2IA 4RCOA 4LUZA 4PV1C 1KC8C 1I50H 4DF7A 1KAAA 4A3DH 4C3HH 5C0XH 5JAVA 2NVXH 5LMNW 2UXCQ 2F0HA 1HZCA 1LM0A 1UE6A 1NY4A 5I2YA 4JI3L 3HOYH 2M9VA 1TY2A 4IUNA 2VB2X 2K05A 5J39A 2CH4A 2G9DA 4HJ8A 4HJ7A 3PO2G 2KHSA 5DAUA 1TU2B 1V43A 1YHBA 1N9WA 4GN3B 2JA5B 4JYAL 2QW7A 4YWMA 4FF2A 2PO4A 2NVQH 3DXJC 4HIOA 4JV5Q 3ULPA 3MHBA 4K2LA 3TQYA 1KAWA 5C4HA 4FF4A 2FMMA 3TP6A 2DJFC 3J7AV 1LTBD 4WJWA 4DNTB 5CMDA 3AFQA 1YITA 5IT9L 4C3IB 3EFXD 4JOIA 1IXRA 1STYA 3D4RA 1F77A 2PNHA 1Y1WH 1TVXA 3M3YB 3LX0A 4TSSA 2NTSA 2QCPX 3OOCA 2SNMA 3HEJA 1Y1VB 1PH4A 4RH6A 1J6QA 3S15B 4RG1A 1D5MC 4LFCQ 3M85A 2HQEA 1LTID 1GOZA 4MHEA 4A75A 4MTKA 1VQ6A 2X6GA 2Z4IA 3TN2A 1BCPF 4V0BA 4IFDI 4O1NA 1X9NA 1QUQB 3S14B 2P5ZX 5IGBA 3TP7A 3R93A 1SDFA 5FLXE 1HNXL 3CCVA 3PO3H 3TZDA 1STEA 1VQ7A 1PDQA 4I7ZC 2OQ0A 3RLFA 2JQOA 2IX1A 2YTYA 4X3KA 5FKAC 4RWSC 2R7ZB 1NMGA 3GDEA 4IUTA 5C3EH 1JR0D 2QKIC 1PRTB 1A3TA 4A3KB 2EY2A 3DEPA 1WTXA 5KGUA 1EY4A 2A69D 3D0FA 4JI8L 1XPOA 2B2TA 3MXNB 3LWEA 3KJPA 5AJ3L 1CKMA 4OXPA 1GM5A 3S1RH 4POGA 1SYEA 3BU2A 4QF4A 1LLRD 3X3MA 3M4OH 3JAMi 1SNCA 4O2DA 3PQIA 4B08A 3EIVA 1VQFA 4CJ2C 2F0LA 3WOFA 1EQTA 3FHWA 1PTOF 4A3FB 1A3UA 4HR7B 1TWHB 2EVBA 3CC2A 1XMOL 3H3VI 1IBKL 2OTJA 1JQYD 2XSCA 4DAYA 3E0JA 3W1BA 4A3LH 2VY3A 4Q0FA 2R6GA 4JI7Q 2V4DA 4N9TA 3CC4A 4IFDJ 1H9SA 1VQ4A 1LACA 5M3FH 1EY7A 1ENAA 4N8FA 2ZJRA 2PZWA 2AWOA 3RN2A 3TS2A 3SK8A 1PFNA 1C48A 5KNCA 4F88A 3ERSX 2JA6G 4OELB 4PZ8A 1ASYA 4BY7B 1CTMA 1TS4A 2Q8RE 3KLSX 4JBMA 4L5SA 4YCVA 1KD1C 4DV5Q 1KRSA 2QDLA 1G6ZA 3NSWA 3T1YQ 1J9OA 1HTLD 1MJEA 4B3ML 3GTJH 3FEWX 5E1FA 3NHHA 1PH8A 4BA2I 3MZ5A 1C9OA 2WAQG 2DJGC 1NSNS 2SOBA 5ELBA 2F0IA 2JE6I 5I4DA 4DV6Q 1FD7D 3H0GB 3Q24A 1BDOA 3W1GA 1UE1A 4RCNA 3QIAA 1MBYA 2JA8B 1PH9A 1RKNA 3F8TA 5C5MA 3KJOA 3I4NB 2E2HB 4JI1L 3UDIA 2ZJQA 4B9XA
chains in the Genus database with same CATH topology
4H13C 1Q1BA 1SE4A 1Y8PB 1EU3A 4CKBA 1YNJD 3PUYA 1F9SA 3S1NB 4KJOA 1BQQT 1EY6A 5M3MB 1IYUA 2FFKB 2A74C 1F9RA 3A8IE 3ERQA 4ZKBB 1STBA 1B3AA 1G91A 1KTKA 2B2YC 1SEBD 1D2BA 2LKVA 1MGSA 4G57A 5FK9C 4U673 5EJWA 1BCPB 1BO0A 1O7ZA 4A3EB 2B8FA 1L0YB 1FGBD 1R9TB 4NW2A 3GTOB 3T16A 1ESRA 3EROA 4OO1I 3DWQA 1RTNA 3SXHA 1UEAB 3SK4A 2BE5C 1HFGA 5C6AA 3DHQA 4HCEA 2DNEA 5IGGA 1LTTD 1Z7TA 3DWAA 1G2SA 3X3NA 1CQFA 4XDXA 3FVQA 1BOSA 4E6IA 4DU9A 3OWEB 5EBCA 3RZOB 5COYA 3Q23A 1AW7A 5HGTA 3J80E 3H6MA 4KTAA 1PTOB 2SNSA 1QE6A 3S17B 1H9SB 2B2VA 4DGZA 3UI2A 1PXUA 3J81L 3FDTA 1IW7C 1UUPA 1FNVA 4CGYB 1R4PB 1OXXK 4R8IA 1Q12A 3BG3A 3TBIB 3GQBA 1CA6A 5C4JB 4KY5A 1FYCA 1I4XA 3T53B 2RDFA 1STHA 1EU4A 4AYBB 1VMPA 2NWGA 4HN7A 1SXTA 4OIJA 5C5LA 5G3LF 4G4KA 3D31A 1F9QA 3L3OC 2B8GA 4QMGA 4K6DA 4HSPA 2WKDA 4DA2A 4R8NA 3JAML 1EWCA 4L63B 4K6LA 4F7XA 5LHY1 5D14A 3K57A 4IUUA 2K1BA 2PW5A 2EOTA 2F3VA 2PZUA 4C3JB 4C1NK 2IT1A 1TQOA 1EY0A 1EIHA 1JCKB 1LT3D 3M7NA 1RTOA 1SSOA 1D1IA 1TS5A 3VYSA 2PNRC 1B9MA 1O7YA 4KK7A 2E2DC 1H9MA 3SE0A 4BY1B 4A3GB 3VA5A 3NK9A 2O5JC 4XT3B 3PIO3 4QUCA 4RAUC 1FNWA 4A93B 2K33A 2AUKA 4LMQD 2ICEC 3T51B 3C1EA 2F0OA 4X3TA 2F0EA 3A7AB 2NYZD 1C4QA 1WD0A 3OIPA 2L1BA 2B2UA 2J4XA 3BVGA 4IURA 1GUTA 5HURA 3HOUB 5DEHA 5JJZA 4X3UA 1STNA 3T4AC 4QCLA 3W3AA 5I6YA 1JORA 1ZEQX 1PYWD 1WTRA 2BDNA 2VUMB 4KY7A 1DJRD 2EY6A 2XVSA 3C2PA 5M5WB 4O42A 1PMRA 3HZXA 2BE5D 4C3IG 3VR3A 4EQNA 3O13A 2R93B 4ULLA 1U9RA 3FPUB 2F0PA 5IT9E 2EY1A 3TP5A 1D5XC 5C0XI 2RA4A 3U9OA 1EYCA 3GV6A 4A3BB 1HFNA 3MTSA 2A6HC 4HCSA 4TQUS 2EYMA 2F0MA 2CVRA 2E75C 4CBVA 3DWPA 3ND8A 4RGNA 1ICWA 1ESFA 2K01A 4X3SA 4H7BA 3WOEA 1IW7D 1LT6D 4B9WA 3F2UA 2HCIA 5IGFA 4UDUC 1PRTC 4A3JB 3PIP3 4RA8A 4FP5D 1EY8A 1VF7A 3NUCA 1ML0D 3QOJA 1HA6A 1LTRD 4OGQC 3KBXA 4OIKA 5C44B 4XIGS 2AWNA 2NVXB 1SE2A 1V1PB 1XYIA 1F2MA 2F0KA 5C0XJ 4IFDG 3OWFA 4G7HC 5DM63 4XYOA 1U4LA 2CHBD 1SBBB 1JICA 5F2DA 2PPBC 1KABA 2F03A 1ILQA 4NDXA 1NUCA 2LY7A 5D3DA 1HTPA 2QILA 1XXGA 3TDQA 4DAPA 1TIID 4IUPA 2X69A 3KLRA 1ENFA 1IKLA 5CV4A 2B2WA 1TWFB 3K7AB 2NTTA 4QB4A 1TWAB 3VA7A 3IAYA 1RJTA 2I46A 3I72A 3QOLA 4QUFA 1I3QB 1JWSD 1QJOA 2KEEA 3IFTA 1MD2D 4MIUA 3BS1A 3E6ZX 1DOMA 1E2ZA 2RDGA 1G8ZD 2EYHA 2KCCA 2D5DA 1DCZA 2BA0A 3T13A 1MSGA 1GUSA 2NBFA 3FKIB 3NXWA 4DN4M 3S2DB 3IKJA 1NR2A 2YU9B 2K5QA 1BF4A 3M4OB 1DZ1A 5ELCA 1Q8IA 2K7VA 2CW0C 2A6EC 4ZYSA 4XTCS 2NVYB 4IZ8A 2FJ2A 3G6JB 5EKIA 2K28A 1BNZA 1SNMA 2OT2A 3QB3A 5E4XA 1JOKA 2AUJD 3HGBA 3K0YA 4H44C 1B4OA 3N6RA 1B44D 1K83B 2D2CC 1PZID 1BCPC 3TSSA 2SDFA 2ICIA 1XTCD 4RGOS 2B2TC 1WTWA 3CRKC 2EJMA 2X6LA 1Y69U 4WORA 3E5SA 1BUVT 5CBAE 5A35A 2F0TA 1XX8A 3BDCA 4FXKC 4HSVA 3C46A 3GO5A 3VR5A 2BDOA 2A6HD 4NKLA 2LFNA 3V2TA 4PMWA 4G7ZC 1LTAD 2XN9C 1B1ZA 3M4YA 4G7OC 3VR4A 1ZYRC 3KK7A 1TKWB 1PTOC 5JOBA 2EYPA 5JPMC 3SVMA 2ZXPA 1HQMC 3NQIA 3Q6SA 1PRTD 1KNAA 2EE1A 3D4DA 3HOWB 1DYQA 5JEAH 2RSOA 3T56B 4OO1G 3A56A 4IFDH 5C4XB 5LL6X 1S5CD 4OHJA 1IYVA 1LV9A 3I90A 3QJYA 5ELEA 3Q0AA 3U9SA 3I4MB 4KHVA 5KYLA 3R3OA 1RCVD 1QNUA 3SK6A 3CQZB 4I65A 4IUQA 2KCNA 2L11A 4Y7NB 3S1QB 2PQEA 3GTPB 1DOKA 5BN3A 2I07B 4ODGA 3H91A 2ID0A 3JAME 2BCOA 1PFBA 5ELDA 3A7LA 5I9PA 4XT1B 4FXDA 5IOCA 1NAPA 4C3JG 3HOXB 5EPLA 1SAPA 5IGEA 3FMCA 3MC0B 1F2YA 1G2TA 3OMCA 2RSNA 5T1IA 2MPMA 4DXGA 2QEJC 3I91A 2QF7A 1RHPA 3NWSA 1Q1EA 3S2HB 3MXGA 1ILPA 1KDAA 1CZGA 3D4WA 2GA4B 3ZYYX 2FMCA 2ZT9C 1O80A 1JOQA 2KUMA 1CFMA 1I4QA 1I4RA 1QB5D 5CV8A 1EY9A 2EYLA 2L5TA 2AQ1B 1B53A 2CW0D 4DK1A 4FVMA 1HUMA 5DM73 2K32A 1B2TA 4JK1C 4KN7C 1OXUA 1XWEA 3AB9A 3OIQA 3IFDA 4A3MB 5K36G 2KQ3A 3QO2A 1ET9A 3D6WA 1I4HA 4NMZA 2F0GA 4KMUC 2PMZB 2IX3A 1GXDC 1S5BD 4J6HA 1EEFD 3GTLB 1ONLA 2B2VC 1BCPD 2QDBA 3OSOA 1PZJD 4RHSA 5TSSA 3L9AX 1EOTA 1SE3A 2H4OA 3EQLC 4RGTA 1HPCA 5M9OA 4V190 1D1KA 1H9JA 1PTOH 2F0QA 2WKCA 1TS3A 4DAVA 1KLGD 1AN8A 4F87A 3NBHA 1HUNA 3P1HA 3RUZA 2CQAA 1ZYRD 4HMIA 1K8OA 2L9HA 1PTOD 1JOOA 1IL8A 4EQPA 2NN6G 4H0LC 5I9OA 1A6XA 1E0BA 3PUWA 1SNPA 4KKSA 1DM0B 3A55A 4ZLTF 3H09A 3CHBD 4K5VA 2KA7A 3HOVB 4S3SA 2JEBI 3OPOA 4K5XA 1K8MA 2WP8J 2XWJB 4C2MB 1LTGD 3L7ZC 3SR1A 2JSOA 1QILA 5C3XA 1D5ZC 1L0XB 4HEDA 2ZXRA 3GD7A 1II3A 4L6TB 3KBGA 3K5OA 3J7YW 5KIXA 4LJZC 2D62A 2EJGC 1HCZA 1I6VC 2IJ0A 3EA6A 5D65A 2Q8TA 3SDZA 4WFN3 5J22A 4FO2A 2KECA 5FO9B 2FINB 2WV6D 2XWBB 3MVVA 5IGDA 1I4GA 3SEBA 1HXYD 3HG9A 2KOLA 1GHKA 1CA5A 1DXMA 3DMUA 1S5DD 2B2UC 5FO7B 1STAA 4K8IA 4BBRB 4OL7A 4LAAA 2EJFC 4PMBA 5KEEA 1O7LA 5FOBB 1SYCA 3MXUA 2VB3X 1BBXC 2WB1B 1KLUD 1OO9B 5E3FA 2F1MA 1SNQA 1GUGA 1MI2A 1GHJA 3S9WA 5JVG3 1ZXTA 2R3ZA 1JWMD 1PRTF 2EY5A 3PMFA 3NP8A 3OMGA 3KF8A 1EEID 1B50A 2ENBA 4DXFA 1EZ6A 4K2KA 2Z1CA 3OW7A 2O4XA 2LMCB 5EKKA 2HDLA 1T5EA 3GTKB 5C3WA 1WCMB 1SMYC 2KJXA 1Y8NB 4ME5A 3LWUA 4NP5A 1I50B 5EGTA 3NE5B 4CKCA 2L4NA 4A3DB 3ONAB 4C3HB 5KYIA 1SYGA 2JXMB 3HOYB 1EZ8A 2RKSA 1EL0A 3R8BA 2DY8A 5CV7A 2NVQB 1HQRD 3LNNA 4KY6A 2NN6H 5JPNC 2RDHA 3K59A 1WD1A 2ZXOA 3MXPA 4BBSB 4IUVA 1V1OA 3MFYA 1Y1WB 5IIFA 2IWHA 1SNDA 1HHVA 5G3LD 2OXPA 3PUZA 1QOHA 5EPJA 3FPPA 2A73B 5BN5A 4K14A 1JE4A 3W2DA 5CV5A 4C1NI 1A2TA 1RODA 3PO3B 4DK0A 3H3VC 3BVZA 3TMEA 2Y0SB 5C3EB 3BDOA 3C3LA 2B2WC 4EVOA 3KLSA 4PQXA 2JA7B 2E74C 1CQVA 2HCCA 2VNUD 1T5XD 3NWTA 4ZUJA 4KJNA 3S1RB 3MAQA 2EXZA 2EYJA 3P7JA 3G7LA 3MEHA 3P20A 1PZKD 1SYFA 1H9RA 1PFMA 2K5WA 2M2LA 2D9UA 5D3IB 2OEOA 4PNYA 1Z47A 2WINB 1WTOA 1HRJA 2Z8LA 1A2UA 1HA5A 1AEXA 1B9NA 5I6WA 3C1FA 3V96A 4K5WA 4A3IB 1VCIA 1Z6HA 5M3FB 2HUGA 3P75A 5J1ZA 2Q8IB 1LO5D 1CK1A 1QCBD 3K5MA 2MJ8A 2F0SA 3VYUA 3TP8A 3VR2A 3HKZB 2PZTA 3NPPA 1SJED 3I70A 4P2CB 1H9KA 3GTJB 4FNFA 4ZKCB 3VR6A 4HAEA 1U4RA 5AFWA 2C5CA 2PCFB 2IL8A 5K5PA 2N88A 4F8MA 3A8JE 5JEAJ 5A2QL 1LTSD 3HRZC 2VXWA 1ENCA 3I3CA 4DNRB 3GTMB 3PUVA 5EPKA 3NQTA 4LK1C 4CHTB 1D6EC 2F0WA 1NR4A 3Q22A 2HDMA 2F0DA 1SMYD 2A68C 2F4IA 2YYZA 2WACA 3J81E 1X3QA 2KVMA 3PO2B 1EY5A 4QIWB 3A8KE 1JC7A 4BWGB 1F2LA 5LL6S 3MWYW 4K8JA 1SJHD 3H94A 1AZQA 2Z4HA 1U4PA 1SYBA 3QWNA 2EDGA 3AMUA 2XNAC 5CC4A 3EJIA 3HP3A 4IN3A 4XQNA 4YIJA 3TZUA 2EZVA 5FLXL 4PMCA 1YNNC 2IPKD 3DM1A 2B2YA 1WTVA 3SHLA 3GV3A 4R9WA 3RZDB 3D8GA 2G9HD 1TR5A 3SK5A 5CBEE 3PUXA 1ET6A 5BN4A 4CKEA 4KHZA 1JWUD 4IQZA 3NTIA 1TWGB 4ZAIA 1OXVA 4DFAA 2BOSA 1AP0A 2AQ3B 4ZRZA 4EQOA 1UAPA 2RVLA 3GTQB 1Q3LA 2DY7A 2FHTA 4HMJA 1BR9A 3BYTB 4FYDA 1KDCA 1PLFA 2K03A 1S5ED 4GZYC 2JYOA 1NCVA 3MA2B 1RF2D 4WRDA 1RD9D 2AQ2B 2A6ED 2F0VA 3ND9A 2E2JB 1WTPA 2RQXA 1DONA 1WVLA 3S16B 2TMPA 2WIIB 2JA6B 1LT5D 1Y8OB 1F2ZA 3NBIA 3N52A 4CJ0B 1EQVA 3D3RA 1QNKA 3K6OA 1EIGA 3R2TA 3K58A 2TSSA 2DNCA 4M8AA 2L12A 2WAQB 1JB3A 5IODA 3MFGA 3URYA 1LABA 2MP1A 3VYTA 4M1UB 1W6JA 2H1EA 1J8IA 5EQ0A 3FRPB 3S1MB 3VYRA 3QG1A 3CU7A 2NUCA 1CHPD 2IW3A 3BVMA 3HOZB 4HTHA 4J1MA 4RGMA 4UAIA 1VF5C 2IX0A 2LS01 3RD4A 2E2IB 3NTHA 1RDPD 2MUYA 2NVTB 1A15A 1QG7A 4OO1H 2O2LD 1KDBA 3RMHA 3IL8A 3V05A 5KNBA 1M4VA 1EWHA 2NZ1D 2A68D 3D6CA 2M00A 1CM9A 1V8QA 2F0FA 1O78A 3DUZA 1CT1D 2K04A 1VMCA 4Z9CB 1LT4D 3EVQA 3I8ZA 4J8QA 1AFPA 3A54A 1A3VA 3BYYB 1EYDA 2EYOA 3OHXC 3NTKA 1IHZA 4C3HG 5C0XG 1TWCB 2F0UA 3DEOA 1V1PA 5CGKA 3GP7A 2F0NA 3M7GA 1U4MA 2PYKA 3BZDB 3WDNA 4BA1I 2J7ZA 2A5HA 4ABNA 5EKLA 5CYUA 3AU7A 2R61A 1E2VA 2SEBD 5ELFA 1IKMA 1STGA 1CHQD 1WTQA 3J7AF 1GJXA 1YNND 3J80L 3BDLA 1KNEA 4XXEA 2L55A 1QWYA 3K5NA 1Q90A 4RHRA 1I6HB 2NB0A 4FF1A 5M5XB 2F3WA 5JVH3 4FXGC 2O5IC 1S5FD 4XQJA 4RFBA 2EPBA 2XRQD 5CV6A 2N55A 2KEDA 3K5LA 5NUCA 2B63B 2JP1A 1GUWA 1SNOA 1S4ZA 4BS9A 2A69C 4MN3A 2R92B 1TS2A 4KD3A 3I73A 3GTGB 4N9PA 2NN6I 4KKUA 3HS0C 1OXTA 1SYDA 4ZUIA 2RBMA 2PW7A 1CI3M 1VDZA 2K5DA 1DOLA 3CRLC 4XYQA 4ZQ3A 2BA1A 5K36H 2F0JA 1TY0A 5CORA 5IGCA 4EGVA 2E76C 4RKBA 5T1GA 1X3PA 1F9PA 1EYAA 1MSHA 4TKOB 4CJ1B 5I2XA 1OXSC 5KNDA 2MGSA 4ID6A 4ZK9B 1GUNA 3I4LA 1AZPA 5EBDA 4KI0A 1FR3A 1UNSA 4L8JA 4TRDA 3MXNA 5FO8B 5M5YB 1BXTA 2MHVA 4Q5VA 1SFOB 1CZWA 4JBWA 1W6KA 4ILWA 2JEAI 5E4WC 2B39A 4U68A 1I4PA 2DN8A 2L0CA 4FF3A 1G291 4KKTA 4C56C 1C8CA 2J0TD 5CR3A 4IALA 4RKLA 1R4QB 1FNUA 1M8AA 1DD2A 1EFID 1GUOA 5DNFA 2XRSD 1X32A 5C4ZA 3CKIB 3ITPA 4XQQA 1E2WA 5JEAG 4KN4C 5KRUA 2XIWA 1YNJC 3PV0A 2OF1A 5CV9A 2K6AA 5ISRA 3KUPA 2EYFA 4KV6A 1TT2A 5A2QE 2C9OA 4KD4A 1ZKOA 3R2IA 4RCOA 4PV1C 4DF7A 1KAAA 5C0XH 5JAVA 2F0HA 5I2YA 2M9VA 1TY2A 4IUNA 2VB2X 2K05A 5J39A 2G9DA 2KHSA 5DAUA 1TU2B 1V43A 2JA5B 4FF2A 2PO4A 3DXJC 3MHBA 4K2LA 5C4HA 4FF4A 2FMMA 3TP6A 3J7AV 1LTBD 4WJWA 4DNTB 5CMDA 5IT9L 4C3IB 3EFXD 1STYA 3D4RA 1F77A 1TVXA 3M3YB 3LX0A 4TSSA 2NTSA 2QCPX 3OOCA 2SNMA 3HEJA 1Y1VB 4RH6A 3S15B 1D5MC 3M85A 2HQEA 1LTID 1GOZA 4MHEA 2X6GA 2Z4IA 3TN2A 1BCPF 4V0BA 4IFDI 4O1NA 3S14B 5IGBA 3TP7A 3R93A 1SDFA 5FLXE 3TZDA 1STEA 1PDQA 4I7ZC 3RLFA 2IX1A 4X3KA 5FKAC 4RWSC 2R7ZB 4IUTA 1JR0D 2QKIC 1PRTB 1A3TA 4A3KB 2EY2A 3DEPA 1WTXA 5KGUA 1EY4A 2A69D 2B2TA 3LWEA 1SYEA 4QF4A 1LLRD 3X3MA 1SNCA 4B08A 4CJ2C 2F0LA 3WOFA 1EQTA 1PTOF 4A3FB 1A3UA 4HR7B 1TWHB 2EVBA 1JQYD 2XSCA 4DAYA 3E0JA 4Q0FA 2R6GA 2V4DA 4N9TA 4IFDJ 1H9SA 1LACA 1EY7A 1ENAA 2PZWA 2AWOA 3SK8A 1PFNA 1C48A 5KNCA 4F88A 4BY7B 1CTMA 1TS4A 2Q8RE 3KLSX 1G6ZA 3NSWA 1J9OA 1HTLD 3FEWX 5E1FA 3NHHA 4BA2I 3MZ5A 1NSNS 2SOBA 5ELBA 2F0IA 2JE6I 5I4DA 1FD7D 3H0GB 3Q24A 1BDOA 4RCNA 3QIAA 1MBYA 2JA8B 1RKNA 5C5MA 3I4NB 2E2HB 4B9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT6 D;  1FNW A;  2XRQ D;  1CHP D;  1JR0 D;  3BVM A;  1PRT D;  1PRT B;  1SE4 A;  1JWU D;  1EU3 A;  1FNV A;  1UUP A;  4UDU C;  1I4Q A;  1DYQ A;  1I4R A;  4RGM A;  1PRT C;  3CHB D;  3W2D A;  2AQ3 B;  2AQ1 B;  1TS2 A;  1JWM D;  1RDP D;  1PRT F;  1S5C D;  4OHJ A;  1LTS D;  5ELC A;  2O2L D;  3BVZ A;  1LTG D;  1LTR D;  1EEI D;  1LLR D;  1I4X A;  4ZYS A;  5ELE A;  3V05 A;  1QIL A;  4DXF A;  2J4X A;  1M4V A;  3R2I A;  1L0X B;  1D5Z C;  1EU4 A;  4RCO A;  3BYT B;  1SE2 A;  1CQV A;  1PTO F;  1V1P B;  1D6E C;  1RCV D;  3BVG A;  1S5E D;  1SXT A;  4L6T B;  1CT1 D;  1T5X D;  4Z9C B;  1KTK A;  1JQY D;  1LT4 D;  1RF2 D;  1TY0 A;  1TY2 A;  1SEB D;  1ET9 A;  1RD9 D;  1I4H A;  2AQ2 B;  5FK9 C;  2CHB D;  1PZK D;  1S5B D;  1B44 D;  1EWC A;  2IJ0 A;  1EEF D;  3EA6 A;  4L63 B;  4K6L A;  4BWG B;  1PZI D;  3BYY B;  1BCP D;  1BCP B;  1SBB B;  5D3I B;  1PYW D;  1BCP C;  1L0Y B;  1FGB D;  1SJH D;  3TSS A;  5ELD A;  2Z8L A;  1DJR D;  1V1P A;  2ICI A;  1PZJ D;  1G8Z D;  2WV6 D;  4RHS A;  5TSS A;  1LT5 D;  1LTB D;  1XTC D;  3GP7 A;  4RGO S;  1HA5 A;  1UNS A;  5D3D A;  1TS4 A;  3DWQ A;  1I4G A;  1SE3 A;  3KLS X;  1HXY D;  3R8B A;  3SEB A;  2QIL A;  1XXG A;  3EFX D;  1BXT A;  3BZD B;  2XNA C;  1F77 A;  3O13 A;  4RGT A;  4TSS A;  1ENF A;  2NTS A;  2R61 A;  2SEB D;  5ELF A;  1HTL D;  3R2T A;  1HQR D;  1PTO H;  1S5D D;  1JCK B;  1LO5 D;  1TS3 A;  1D5X C;  2TSS A;  1LTT D;  2NTT A;  1CK1 A;  1I4P A;  4RH6 A;  1LT3 D;  3DWA A;  1KLG D;  3MFG A;  3MC0 B;  1CHQ D;  1AN8 A;  1D5M C;  3URY A;  2RDH A;  5ELB A;  1LTI D;  1GOZ A;  5I4D A;  1TS5 A;  1FD7 D;  1BCP F;  2IPK D;  4O1N A;  4C56 C;  4DXG A;  1SJE D;  1V1O A;  2QEJ C;  1LTA D;  3DWP A;  3OWE B;  2XN9 C;  1JWS D;  1B1Z A;  1AW7 A;  4RHR A;  1MD2 D;  4RGN A;  1PTO D;  1PTO B;  2G9H D;  1STE A;  1KLU D;  1ESF A;  1FNU A;  1PTO C;  1EFI D;  1S5F D;  2RDG A;  5FKA C;  1ET6 A;  4RFB A;  2XRS D; 
#chains in the Genus database with same CATH topology
 4H13 C;  5JJK A;  1Q1B A;  3GTM H;  1SE4 A;  1Y8P B;  1EU3 A;  4CKB A;  3HOZ G;  1YNJ D;  1ICF B;  3T1H Q;  3PUY A;  1F9S A;  1VQC A;  5IP9 G;  3S1N B;  4KJO A;  1BQQ T;  2VL6 A;  4IOC A;  1XMQ L;  1EY6 A;  1N36 Q;  5M3M B;  1IYU A;  2FFK B;  3PO2 H;  2KCT A;  1UWV A;  1ASZ A;  2A74 C;  1F9R A;  3OW2 A;  3A8I E;  3ERQ A;  4LF5 L;  1K28 A;  1PFS A;  4ZKB B;  1STB A;  4YHH Q;  2LXJ A;  4JI6 Q;  1B3A A;  4B3T L;  4DR6 L;  1G91 A;  1KTK A;  3CQZ H;  2B2Y C;  1SEB D;  1D2B A;  2LKV A;  1MGS A;  4G57 A;  5FK9 C;  4K0K L;  3S1Q H;  1Q82 C;  4U67 3;  5EJW A;  1BCP B;  1BO0 A;  1O7Z A;  4A3E B;  2B8F A;  1L0Y B;  1KL9 A;  1FGB D;  3STB C;  1R9T B;  4NW2 A;  2E8G A;  3GTO B;  3T16 A;  1ESR A;  3ERO A;  1YJN A;  3DWQ A;  4OO1 I;  2DUD A;  1RTN A;  2UXB L;  3SXH A;  1UEA B;  4DR4 Q;  3SK4 A;  2BE5 C;  1HFG A;  5C6A A;  4JBJ A;  2KHI A;  4DUZ Q;  4DK6 C;  3DHQ A;  3RZD H;  4HCE A;  2PMZ E;  2DNE A;  1GKH A;  5IGG A;  1LTT D;  1Z7T A;  3DWA A;  1G2S A;  3X3N A;  1PYS B;  1CQF A;  4XDX A;  4MTN A;  4GLX A;  3FVQ A;  1FJG Q;  5GAH C;  4DAY B;  1BOS A;  4E6I A;  4DU9 A;  3OWE B;  5EBC A;  3RZO B;  5COY A;  3Q23 A;  1TWG H;  1AW7 A;  1O7I A;  5HGT A;  3J80 E;  3H6M A;  1P16 A;  1J5E L;  4KTA A;  1PTO B;  2SNS A;  3M9B A;  1QE6 A;  3S17 B;  1H9S B;  2RHQ B;  2B2V A;  4DV0 Q;  3S2H H;  4DGZ A;  3UI2 A;  1PH2 A;  1PXU A;  3JC6 6;  3J81 L;  2HHH Q;  3FDT A;  1IW7 C;  1UUP A;  1FNV A;  4LF6 Q;  2B29 A;  4CGY B;  1R4P B;  1K73 C;  3CAM A;  1OXX K;  4DV3 Q;  3UE0 A;  2B63 G;  4R8I A;  1Q12 A;  3BG3 A;  3TBI B;  3GQB A;  1CA6 A;  3U4Z A;  4JI0 Q;  2KCM A;  2R92 G;  5C4J B;  4GKJ Q;  4KY5 A;  1FYC A;  3L0O A;  1VQN A;  3S24 A;  3A5U A;  1I4X A;  4DR3 Q;  4QGU A;  3T53 B;  1VQL A;  2RDF A;  1STH A;  1EU4 A;  4AYB B;  1VMP A;  2NWG A;  2E2J H;  4HN7 A;  4GOP A;  1SXT A;  2UUC L;  4OIJ A;  5C5L A;  5G3L F;  3S16 H;  1A0I A;  4G4K A;  3D31 A;  1F9Q A;  3L3O C;  2JA6 H;  2XTI A;  2B8G A;  4QMG A;  2KHJ A;  4K6D A;  4HSP A;  2WKD A;  4DA2 A;  4R8N A;  3JAM L;  4LFB Q;  1CUK A;  1EWC A;  4L63 B;  4K6L A;  1WFQ A;  2LSS A;  4F7X A;  5LHY 1;  3K0X A;  2HT1 A;  2EXD A;  5D14 A;  3K57 A;  1N33 Q;  3GTL H;  4IUU A;  2K1B A;  2PW5 A;  2EOT A;  2F3V A;  4DUY Q;  2VW9 A;  2PZU A;  4C3J B;  4C1N K;  2IT1 A;  3UDF A;  1TQO A;  2CCZ A;  1MIU A;  1EY0 A;  4GNX A;  5IY0 A;  1VQO A;  1EIH A;  1JCK B;  1LT3 D;  3M7N A;  2MQH A;  3S1M H;  1RTO A;  3RLN A;  1SSO A;  1D1I A;  1TS5 A;  3VYS A;  3HOZ H;  2PNR C;  1FGU A;  5L37 A;  1B9M A;  1O7Y A;  5IP9 H;  4KK7 A;  2E2D C;  5J3B A;  3BJU A;  1A62 A;  1H9M A;  3SE0 A;  4CDE C;  4BY1 B;  2NVT H;  4A3G B;  3BZC A;  3E0E A;  3VA5 A;  5FLM H;  3NK9 A;  2O5J C;  4XT3 B;  3ULJ A;  3PIO 3;  4QUC A;  4RAU C;  1FNW A;  4A93 B;  1VQB A;  2K33 A;  2AUK A;  4LMQ D;  2ICE C;  3T51 B;  4JI2 L;  3C1E A;  4X64 Q;  3TEH B;  4P72 A;  2F0O A;  5ELN A;  4X3T A;  1MJC A;  2F0E A;  3A7A B;  4DR1 Q;  3PF4 A;  4DK3 C;  2NYZ D;  3HOV H;  1C4Q A;  1WD0 A;  3OIP A;  2L1B A;  1Q81 C;  5DLQ E;  2B2U A;  2J4X A;  4JBK A;  2WB1 E;  5GRO A;  1X6O A;  1W3S A;  1QVF A;  3BVG A;  1EIF A;  3TS0 A;  1TWC H;  1VQI A;  4NXN L;  4DNI A;  4IUR A;  1GUT A;  5HUR A;  1VQ9 A;  3HOU B;  5DEH A;  5JJZ A;  1I94 L;  4X3U A;  3NEL A;  1STN A;  2GVA A;  3T4A C;  4QCL A;  1RL2 A;  2JA5 G;  3W3A A;  4OX9 Q;  5I6Y A;  1JOR A;  1ZEQ X;  3STB D;  1PYW D;  3CW2 C;  1WTR A;  2BDN A;  2VUM B;  4KY7 A;  4DV2 L;  1DJR D;  2EY6 A;  4R4I A;  1VQ5 A;  2Z6K C;  4TVA B;  2XVS A;  3C2P A;  5M5W B;  4O42 A;  1PMR A;  1VQH A;  3HZX A;  2BE5 D;  4C3I G;  3VR3 A;  4EQN A;  3O13 A;  2ES2 A;  2R93 B;  4ULL A;  2R7F A;  1U9R A;  3FPU B;  2F0P A;  3KFU A;  1I6H H;  5GAE C;  5IT9 E;  1WYD A;  2EY1 A;  3TP5 A;  4GN4 B;  5M5X H;  1D5X C;  1WTH A;  1Y1V G;  5C0X I;  2RA4 A;  3U9O A;  1EYC A;  3GV6 A;  4GOP B;  4A3B B;  1MKH A;  4X65 L;  1HFN A;  4X62 L;  3K7U C;  3MTS A;  2A6H C;  4HCS A;  4B3R L;  4TQU S;  2EYM A;  4BBR H;  2F0M A;  2CVR A;  1SE8 A;  2E75 C;  2MO1 A;  2B63 H;  3KOJ A;  4CBV A;  3DWP A;  2AMC B;  3ND8 A;  2K50 A;  2UU9 L;  2R92 H;  4UPA A;  4RGN A;  4LF7 L;  1ICW A;  1ESF A;  1QVC A;  2K01 A;  2KEN A;  4X3S A;  4H7B A;  3WOE A;  2R7Z G;  1IW7 D;  1LT6 D;  4B9W A;  3F2U A;  4GKK L;  1K8G A;  2HCI A;  1Q7Y C;  4ME3 A;  5IGF A;  1N32 L;  2GVB A;  4A3K G;  4UDU C;  2E5L L;  3HFZ B;  1PRT C;  3A74 A;  4A3J B;  3PIP 3;  4RA8 A;  4IJH A;  3PIO A;  4FP5 D;  4X66 Q;  4DR7 L;  1EY8 A;  1VF7 A;  3NUC A;  1ML0 D;  4GNX B;  3QOJ A;  1HA6 A;  1LTR D;  5GAD C;  2JA9 A;  4OGQ C;  5HY6 A;  3KBX A;  4OIK A;  5C44 B;  4UP7 A;  4XIG S;  4OEM B;  5JJL A;  2AWN A;  2NVX B;  1W2B A;  2H5X A;  4R4Q A;  1SE2 A;  1E3P A;  1V1P B;  1HH2 P;  4A3F G;  3I4O A;  1XYI A;  1F2M A;  2F0K A;  4P75 A;  5C0X J;  4IFD G;  3OWF A;  4GLV B;  3L2P A;  4G7H C;  5DM6 3;  4XYO A;  1U4L A;  2CHB D;  5BR8 Q;  5M5Y H;  1SFO H;  4ZCK A;  3J7A 5;  1C0A A;  1SBB B;  1JIC A;  3I2Z A;  5F2D A;  2PPB C;  2Y0S E;  4H02 A;  1XNR Q;  1KAB A;  2F03 A;  3OTO Q;  1ILQ A;  1N34 Q;  4NDX A;  1NUC A;  2LY7 A;  5IYD G;  3OYY A;  5D3D A;  1DGS A;  1HTP A;  4YY3 Q;  3CMA A;  4BY7 G;  2UXC L;  2QIL A;  1XXG A;  1VQK A;  2CQO A;  3TDQ A;  4DAP A;  1TII D;  5LMN Q;  4IUP A;  2X69 A;  3KLR A;  1IKL A;  1ENF A;  5CV4 A;  2B2W A;  3G71 A;  1TWF B;  2Q2T A;  3K7A B;  2A1A A;  2NTT A;  4QB4 A;  1TWA B;  3VA7 A;  4LF8 Q;  3IAY A;  1RJT A;  1K0S A;  2VZA A;  3AFP A;  2I46 A;  3I72 A;  3H0G G;  3QOL A;  4QUF A;  1I3Q B;  1AE3 A;  1JWS D;  4BBS H;  4JYA Q;  1QJO A;  2KEE A;  3IFT A;  3NEM A;  2JA8 G;  1MD2 D;  4MIU A;  1U5K A;  1YHA A;  3BS1 A;  3I4N G;  5FLX c;  3E6Z X;  4HIM A;  1DOM A;  1E2Z A;  2RDG A;  1G8Z D;  2EYH A;  2KCC A;  1PH5 A;  2D5D A;  1B7Y B;  1DCZ A;  2BA0 A;  4EQ5 A;  3T13 A;  2ZJP A;  1RIP A;  2Z9H A;  1MSG A;  5JJI A;  1GUS A;  3J81 i;  1VQD A;  2NBF A;  3FKI B;  3NXW A;  4DN4 M;  4LFC L;  1PV4 A;  1Q8K A;  3S2D B;  3IKJ A;  1NR2 A;  3HKZ E;  4KHP L;  2YU9 B;  2K5Q A;  1BF4 A;  1XNQ Q;  3M4O B;  1DZ1 A;  4JOI C;  5ELC A;  1Q8I A;  2K7V A;  1SRU A;  2CW0 C;  3KYH C;  4FDB A;  5M3M G;  2A6E C;  4ZYS A;  1HNZ Q;  4XTC S;  4QJF A;  2NVY B;  4IZ8 A;  2FJ2 A;  2JA5 H;  3PIP A;  3G6J B;  5EKI A;  2K28 A;  1BNZ A;  1SNM A;  2OT2 A;  3QB3 A;  5E4X A;  2JA7 H;  1JOK A;  1YHQ A;  2AUJ D;  4GLA C;  3HGB A;  1G51 A;  4UHV A;  1YEZ A;  1X3G A;  3K0Y A;  4H44 C;  1B4O A;  1U0L A;  3N6R A;  1B44 D;  1K83 B;  2D2C C;  4BXX G;  1QZG A;  3M3Y H;  1PZI D;  1IBL Q;  1JJC B;  3AEV A;  1BCP C;  4A3E G;  4JI8 Q;  1Y1V H;  3TSS A;  2SDF A;  2ICI A;  3S15 H;  1XTC D;  4RGO S;  2B2T C;  1WTW A;  5IWA L;  3CRK C;  2EJM A;  3S14 H;  2X6L A;  4OWX B;  1Y69 U;  1E24 A;  4WOR A;  3E5S A;  3EBE A;  1BUV T;  5CBA E;  5A35 A;  2F0T A;  4A3I H;  1XX8 A;  3BDC A;  2ZTE A;  4QIW E;  4JI7 L;  4DR5 Q;  4FXK C;  4HSV A;  3C46 A;  3GO5 A;  3VR5 A;  2BDO A;  2A6H D;  5E7N A;  5IP7 G;  2R7Z H;  2OWO A;  4P71 A;  1IBK Q;  1H95 A;  2N3S A;  4NKL A;  4A3K H;  2LFN A;  3V2T A;  4PMW A;  5IYB G;  1VQG A;  4G7Z C;  1LTA D;  2XN9 C;  5FJ8 G;  1B1Z A;  3E3X A;  3M4Y A;  4G7O C;  3VR4 A;  4JI4 Q;  1ZYR C;  2CWP A;  1CKN A;  3KK7 A;  1S72 A;  4LUO A;  1TKW B;  1PTO C;  4YWL A;  4DV5 L;  5JOB A;  2EYP A;  1X3E A;  5JPM C;  3T1Y L;  3SVM A;  2ZXP A;  1HQM C;  2PQA A;  1EQQ A;  3NQI A;  3Q6S A;  1JE5 A;  1PRT D;  1KNA A;  2EE1 A;  3D4D A;  2UUB Q;  1HR0 Q;  3HOW B;  1DYQ A;  5JEA H;  2RSO A;  4A3F H;  3SGI A;  3T56 B;  1TWH H;  4OO1 G;  3A56 A;  4IFD H;  5C4X B;  5LL6 X;  1S5C D;  4OHJ A;  1IYV A;  4DV7 Q;  1LV9 A;  1K3R A;  3I90 A;  3QJY A;  4R1J A;  2D0P A;  5ELE A;  2GN5 A;  3Q0A A;  3U9S A;  3I4M B;  4KHV A;  4AYB G;  5KYL A;  4HJ5 A;  3R3O A;  4EX5 A;  1RCV D;  1QNU A;  1I5F A;  3SK6 A;  3CQZ B;  4I65 A;  4IUQ A;  2KCN A;  5IYD H;  2L11 A;  4Y7N B;  3S1Q B;  2PQE A;  1GD7 A;  3T1H L;  4IPG A;  4AQY Q;  3CD6 A;  3GTP B;  1DOK A;  1E7Z A;  4A76 A;  3CCJ A;  1N36 L;  2K5V A;  5BN3 A;  2I07 B;  4ODG A;  3H91 A;  2ID0 A;  3JAM E;  2BCO A;  1PFB A;  1WI5 A;  5ELD A;  2HIX A;  3A7L A;  1L1O A;  4ALP A;  1HZB A;  1E22 A;  5I9P A;  1XMQ Q;  4XT1 B;  4FXD A;  5IOC A;  1NAP A;  4C3J G;  4JI6 L;  4R4T A;  1M1K C;  3RNU A;  4Y52 H;  1IZ6 A;  3HOX B;  3CP0 A;  2DGY A;  1QZH A;  5EPL A;  1SAP A;  2JA8 H;  1FVI A;  3E9I A;  3CCE A;  3I4N H;  2E2H H;  5IGE A;  3FMC A;  1VQE A;  3MC0 B;  1F2Y A;  4L5T A;  2UUA L;  4B3T Q;  4DR6 Q;  1G2T A;  3OMC A;  2RSN A;  5T1I A;  2MPM A;  2N8N A;  4DXG A;  2K4K A;  4K0K Q;  2QEJ C;  3I91 A;  2QF7 A;  3S1N H;  1RHP A;  3NWS A;  1Q1E A;  1B3Q A;  3S2H B;  3MXG A;  1ILP A;  4BY1 G;  1K3B C;  5M3M H;  4A3G G;  4DR4 L;  1KDA A;  3J80 c;  1CZG A;  3D4W A;  2GA4 B;  3KF6 A;  3ZYY X;  2FMC A;  2ZT9 C;  4A93 G;  1O80 A;  4PZ7 A;  3I56 A;  4N8X 1;  1JOQ A;  2KUM A;  1CFM A;  1I4Q A;  1I4R A;  2HD3 A;  2WAQ E;  4LF9 Q;  1QB5 D;  4DPG A;  5CV8 A;  1EY9 A;  2EYL A;  2L5T A;  1FJG L;  2AQ1 B;  1B53 A;  1XJV A;  2CW0 D;  1EOV A;  4DK1 A;  4FVM A;  2B3G A;  1HUM A;  2VQE Q;  1XPU A;  5DM7 3;  4P74 A;  1IBM Q;  2K32 A;  1B2T A;  4JK1 C;  3GTQ H;  4BXX H;  4KN7 C;  1YVC A;  1OXU A;  1XWE A;  3AB9 A;  4DV4 Q;  2Q2H A;  3OIQ A;  2JK8 A;  3PCO B;  3IFD A;  1YI2 A;  4A3M B;  5K36 G;  1AH9 A;  2HHH L;  2KQ3 A;  3QO2 A;  1R9T H;  4LF6 L;  3GTO H;  1J5E Q;  2IHF A;  4DKA C;  4DV3 L;  1SRO A;  1ET9 A;  3D6W A;  3HOU G;  1I4H A;  4NMZ A;  2Q2U A;  1YNX A;  1CKN B;  2F0G A;  4KMU C;  4JI0 L;  2HIV A;  2PMZ B;  2IX3 A;  4KLK A;  2F4V L;  1GXD C;  1S5B D;  4J6H A;  4GKJ L;  1EEF D;  3GTL B;  1ONL A;  3CME A;  2B2V C;  1PHJ A;  1B8A A;  1BCP D;  2PQA B;  4DR3 L;  4HID A;  2QDB A;  3OSO A;  2VUM G;  5IP7 H;  1PZJ D;  2MFI A;  4RHS A;  5TSS A;  3L9A X;  1EOT A;  1VS0 A;  1XTD A;  4DR2 L;  4B3S Q;  1SE3 A;  1SN8 A;  2H4O A;  5IYB H;  3EQL C;  3RZO H;  5FJ8 H;  2R93 G;  4RGT A;  1HPC A;  5M9O A;  2ATW A;  4V19 0;  1D1K A;  1H9J A;  1PTO H;  2F0Q A;  3S17 H;  2WKC A;  1TS3 A;  4DAV A;  1KLG D;  1AN8 A;  4A3B G;  4F87 A;  3NBH A;  1HUN A;  1N33 L;  4GOP C;  4LNQ A;  1PH3 A;  3P1H A;  1NBW A;  3RUZ A;  1JJ2 A;  2CQA A;  1ZYR D;  4HMI A;  1K8O A;  3U58 A;  3RN5 A;  2L9H A;  1PTO D;  5C4J H;  1JOO A;  4IPD A;  1IL8 A;  4EQP A;  2NN6 G;  4DV1 L;  4H0L C;  5I9O A;  3PGZ A;  2VQF Q;  1K8A C;  1A6X A;  1E0B A;  3PUW A;  1SNP A;  3RLO A;  4KKS A;  1DM0 B;  3A55 A;  4ZLT F;  3H09 A;  3CHB D;  4K5V A;  4A3J G;  2KA7 A;  3HOV B;  4LF4 Q;  4S3S A;  2E2I H;  2JEB I;  3OPO A;  4K5X A;  1K8M A;  2WP8 J;  2XWJ B;  4C2M B;  4IOA A;  1LTG D;  3L7Z C;  3SR1 A;  4GNX C;  2JSO A;  1QIL A;  5C3X A;  1PVO A;  5HGQ A;  5C44 G;  4YCW A;  1D5Z C;  1L0X B;  2K52 A;  4HED A;  2ZXR A;  3GD7 A;  1II3 A;  4L6T B;  3KBG A;  4GS3 A;  3K5O A;  1X65 A;  3J7Y W;  5KIX A;  4LJZ C;  1YZ6 A;  2D62 A;  2EJG C;  4C3J H;  1HNW Q;  4MNO A;  1HCZ A;  1I6V C;  2IJ0 A;  3EA6 A;  4I7A A;  5D65 A;  2Q8T A;  3SDZ A;  3KF6 B;  2N78 A;  4WFN 3;  5J22 A;  4FO2 A;  1LUZ A;  1TXY A;  2KEC A;  5FO9 B;  2FIN B;  2WV6 D;  2XWB B;  3MVV A;  1JB7 A;  1KIX A;  3H15 A;  5IGD A;  1I4G A;  3SEB A;  2RHS B;  1HXY D;  3HG9 A;  2YTV A;  2KOL A;  1GHK A;  4NXM L;  2D0O A;  1DXM A;  1CA5 A;  5ELO A;  3DMU A;  2VS1 A;  1SLJ A;  4JI5 Q;  1EWI A;  4BY1 H;  1S5D D;  2K5H A;  4A3G H;  2I0Q A;  2B2U C;  5FO7 B;  1STA A;  4K8I A;  4NXN Q;  4OX9 L;  5IT9 c;  4BBR B;  4OL7 A;  2I5M X;  4LAA A;  2EJF C;  4PMB A;  5KEE A;  1VQJ A;  1O7L A;  5FOB B;  3W5O A;  1I94 Q;  4OON A;  1SYC A;  3F2D A;  3MXU A;  2EIF A;  2VB3 X;  1BBX C;  1EQR A;  2WB1 B;  1KLU D;  1OO9 B;  1K9M C;  5E3F A;  4NPS A;  4IJL A;  3A5Z B;  2F1M A;  1SNQ A;  1GUG A;  1MI2 A;  1WOC A;  1YIJ A;  2QA4 A;  1LYL A;  3RR5 A;  1GHJ A;  3FKI G;  3S9W A;  5JVG 3;  1ZXT A;  2R3Z A;  1JWM D;  1PRT F;  1PYB A;  2EY5 A;  2ZM6 Q;  4IO9 A;  1OTC A;  3PMF A;  4WJ3 M;  3NP8 A;  3OMG A;  3HOU H;  3KF8 A;  2N49 A;  1EEI D;  1B50 A;  3GTG H;  1KRT A;  2ENB A;  4DXF A;  1EZ6 A;  4K2K A;  2Z1C A;  1Q46 A;  4HJA A;  3OW7 A;  3NBH B;  2O4X A;  2LMC B;  3MEF A;  2VUM H;  5EKK A;  2HDL A;  1T5E A;  4LFA Q;  3GTK B;  5C3W A;  1WCM B;  1SMY C;  2KJX A;  4LF7 Q;  3I7F A;  1Y8N B;  5M5W H;  4ME5 A;  2UXD Q;  4AH6 A;  1BBU A;  3LWU A;  4NP5 A;  1I50 B;  1WJJ A;  5EGT A;  3NE5 B;  1N32 Q;  4CKC A;  2L4N A;  4A3D B;  2E5L Q;  3ONA B;  4C3H B;  5KYI A;  4A3C G;  1S40 A;  3U4V A;  1SYG A;  3BZK A;  2JXM B;  3HOY B;  1EZ8 A;  1Z9F A;  5GQO A;  2RKS A;  5LMU L;  1EL0 A;  3R8B A;  2RF4 A;  2DY8 A;  2OCE A;  5IE8 A;  5CV7 A;  2NVQ B;  1HQR D;  3LNN A;  4KY6 A;  2NN6 H;  2OTL A;  2K14 A;  5JPN C;  2RDH A;  3K59 A;  1WD1 A;  1XNR L;  2ZXO A;  2CWA A;  3MXP A;  4HIK A;  4BBS B;  4IUV A;  1V1O A;  3MFY A;  3UE1 A;  3UDG A;  1Y1W B;  4A3J H;  2K5N A;  5IIF A;  2IWH A;  4YY3 L;  1SND A;  2AKW B;  5LMN L;  1HHV A;  5G3L D;  2OXP A;  3J7Z C;  5C44 H;  4MZ9 A;  3PUZ A;  1QOH A;  5EPJ A;  4JI3 Q;  3FPP A;  2A73 B;  5BN5 A;  3HOW G;  4LF8 L;  4JV5 L;  4K14 A;  1JE4 A;  3W2D A;  1V1Q A;  5CV5 A;  2V1C C;  4C1N I;  1A2T A;  1ROD A;  3PO3 B;  1D8L A;  4DK0 A;  5C4X G;  3H3V C;  1EIY B;  3BVZ A;  3TME A;  1S3O A;  2Y0S B;  3J81 j;  5C3E B;  3BDO A;  3C3L A;  2B2W C;  4EVO A;  3KLS A;  4PQX A;  2JA7 B;  2NZH A;  2ZTD A;  3I4M G;  2E74 C;  2NZO A;  1CQV A;  2HCC A;  2VNU D;  1T5X D;  3NWT A;  4ZUJ A;  4KJN A;  3S1R B;  3MAQ A;  3K81 C;  2EXZ A;  2EYJ A;  3P7J A;  4JW0 A;  2JN4 A;  3G7L A;  3MEH A;  4DAM A;  3P20 A;  1PZK D;  1SYF A;  1H9R A;  1PFM A;  1XNQ L;  2K5W A;  2M2L A;  2D9U A;  5D3I B;  1HNZ L;  2OEO A;  1SMX A;  4PNY A;  1TWF H;  1Z47 A;  2WIN B;  1WTO A;  1HRJ A;  3K7A H;  2KBN A;  2Z8L A;  1A2U A;  1TWA H;  1Y14 B;  4KHP Q;  1HA5 A;  4QQB X;  1HNX Q;  1AEX A;  1B9N A;  5I6W A;  3C1F A;  2Z0S A;  3M4P A;  3V96 A;  1I3Q H;  3HOX G;  3KF8 B;  4K5W A;  4A3I B;  1VCI A;  1Z6H A;  4POF A;  4C3I H;  5M3F B;  2HUG A;  3P75 A;  5J1Z A;  2Q8I B;  1LO5 D;  1CK1 A;  5EAY A;  1QCB D;  3K5M A;  1VQA A;  2MJ8 A;  1IBL L;  2F0S A;  3VYU A;  3TP8 A;  3VR2 A;  4OWT B;  1PA6 A;  3HKZ B;  5AJ3 Q;  2PZT A;  3NPP A;  4R4O A;  1SJE D;  3QR8 A;  1AE2 A;  3FKI H;  3CPW A;  3I70 A;  4P2C B;  3CCM A;  3S2D H;  1H9K A;  4AIM A;  1QVG A;  2I5L X;  2A8V A;  3GTJ B;  2YU9 H;  4FNF A;  4ZKC B;  3VR6 A;  2IHE A;  4QY7 A;  1MHW C;  4HAE A;  1U4R A;  5AFW A;  4UP8 A;  2CKZ B;  1G6P A;  2CFM A;  2NVY H;  2C5C A;  2PCF B;  2IL8 A;  2G5D A;  4DR5 L;  5K5P A;  1XMO Q;  5IWA Q;  2N88 A;  4F8M A;  3F2B A;  3A8J E;  5JEA J;  5A2Q L;  3IRB A;  1LTS D;  3HRZ C;  3J81 c;  2Q2I A;  3ZJY C;  3K8A A;  2VXW A;  3KDF A;  1ENC A;  5H1S E;  4JI4 L;  3I3C A;  1K83 H;  4DNR B;  1EUJ A;  3GTM B;  3PUV A;  5EPK A;  3NQT A;  3WWV A;  1E1T A;  4LK1 C;  4CHT B;  1D6E C;  2F0W A;  1NR4 A;  3Q22 A;  2HDM A;  4PG3 A;  4A3C H;  2F0D A;  1SMY D;  2A68 C;  4A3M G;  2F4I A;  1A63 A;  2UUB L;  2YYZ A;  3CCS A;  2WAC A;  1HR0 L;  4QL5 A;  3J81 E;  4OWW B;  1X3Q A;  4DV6 L;  2KVM A;  3PO2 B;  1EY5 A;  4JG2 A;  1HZ9 A;  4B3M Q;  4QIW B;  2Z6B A;  4X6A H;  1HR0 W;  3A8K E;  1JC7 A;  4BWG B;  4DV7 L;  3VDY A;  2C35 B;  1F2L A;  5LL6 S;  2IY5 B;  3DM3 A;  1PH1 A;  3MWY W;  4K8J A;  1SJH D;  3CCR A;  1JT8 A;  3H94 A;  2JJQ A;  1AZQ A;  3JAM c;  2Z4H A;  1U4P A;  1SYB A;  3QWN A;  2EDG A;  3TRZ A;  3J80 i;  3AMU A;  2XNA C;  5CC4 A;  3CCQ A;  4BY7 H;  4JI1 Q;  4JC0 A;  4AQY L;  2YTX A;  1C7Y A;  3EJI A;  3HP3 A;  4IN3 A;  4XQN A;  4YIJ A;  4JCV E;  3TZU A;  3U50 C;  1E1O A;  2EZV A;  4CDF C;  3E9H A;  5FLX L;  4PMC A;  1YNN C;  2IPK D;  3HOW H;  3DM1 A;  2B2Y A;  1WTV A;  1BVS A;  3SHL A;  3H0G H;  4YHH L;  3F2C A;  3FP9 A;  3GV3 A;  4R9W A;  3H3V H;  1K0R A;  5FLM G;  3RZD B;  3D8G A;  5C4X H;  3HKS A;  2G9H D;  1TR5 A;  3SK5 A;  5CBE E;  3PUX A;  1ET6 A;  5BN4 A;  4LF5 Q;  4CKE A;  4KHZ A;  3I4M H;  1JWU D;  4PZ6 A;  4IQZ A;  1L1O C;  3NTI A;  2F3I A;  1TWG B;  4ZAI A;  1OXV A;  2F52 A;  4DFA A;  2BOS A;  1KQS A;  1AP0 A;  2AQ3 B;  2HQL A;  4APV A;  3PF5 A;  4ZRZ A;  4EQO A;  3HOV G;  4Y7N H;  1T9H A;  1UAP A;  1UE5 A;  2RVL A;  3GTQ B;  3GTP H;  2UUA Q;  1YJ9 A;  1Q3L A;  3NEN A;  2DY7 A;  1HZA A;  2FHT A;  4HMJ A;  1BR9 A;  3BYT B;  4DUZ L;  4FYD A;  1KDC A;  2BH8 A;  1PLF A;  1YJW A;  2K03 A;  1S5E D;  4GZY C;  2JYO A;  1NCV A;  2YV5 A;  2UXB Q;  1NTG A;  4RMF A;  3MA2 B;  4LF9 L;  1RF2 D;  4WRD A;  1RD9 D;  1M90 C;  1CSP A;  1X56 A;  2AQ2 B;  2A6E D;  2F0V A;  2R7D A;  3HOX H;  3ND9 A;  2BH2 A;  2CH4 W;  2VQE L;  4O0A A;  2E2J B;  1IBM L;  1WTP A;  2RQX A;  3G6E A;  3F1Z A;  1CSQ A;  4DV0 L;  1DON A;  1WVL A;  4AYB E;  4A3E H;  3S16 B;  2TMP A;  2WII B;  3LGJ A;  4DV4 L;  2JA6 B;  1LT5 D;  2ZTC A;  1Y8O B;  1F2Z A;  3NBI A;  4LWC A;  3N52 A;  1YBY A;  4CJ0 B;  1EQV A;  3D3R A;  1QNK A;  3KDF B;  4A4I A;  3K6O A;  1EIG A;  1SR3 A;  3R2T A;  3K58 A;  2RCN A;  2TSS A;  3Q8D A;  2DNC A;  4J15 A;  4M8A A;  4IPC A;  2L12 A;  2WAQ B;  1JB3 A;  5IOD A;  3MFG A;  2L15 A;  3ULL A;  3URY A;  1LAB A;  4BBR G;  3CCL A;  5IYC G;  2MP1 A;  4L5R C;  3CF5 A;  2F4V Q;  3VYT A;  4M1U B;  1W6J A;  4B3S L;  2H1E A;  1J8I A;  2QGQ A;  5GAG C;  5EQ0 A;  3I55 A;  2WB1 G;  3FRP B;  4L5Q A;  4LFB L;  1X54 A;  3S1M B;  3VYR A;  3QG1 A;  3CU7 A;  2UUC Q;  2NUC A;  1CHP D;  2IW3 A;  3BVM A;  3HOZ B;  4DR2 Q;  3AYH B;  4HTH A;  4J1M A;  4RGM A;  4UAI A;  1VF5 C;  2IX0 A;  2PI2 A;  2LS0 1;  3RD4 A;  3M4Q A;  2E2I B;  4A3M H;  4JVZ A;  4DUY L;  3NTH A;  1RDP D;  2MUY A;  1EYG A;  1L0W A;  2NVT B;  1A15 A;  2K75 A;  1QG7 A;  4OO1 H;  2O2L D;  2A19 A;  1KDB A;  2MNA A;  3RMH A;  3IL8 A;  3V05 A;  5KNB A;  1M4V A;  1EWH A;  2NZ1 D;  2A68 D;  3D6C A;  2M00 A;  1CM9 A;  2VQF L;  4P73 A;  1L1O B;  1V8Q A;  2F0F A;  1O78 A;  3DUZ A;  1CT1 D;  2QEX A;  3DLL A;  2K04 A;  1VMC A;  4Z9C B;  1GO3 E;  1WCM G;  1XPR A;  1LT4 D;  3EVQ A;  1NMF A;  3I8Z A;  4IPH A;  1VQ8 A;  4J8Q A;  4DV1 Q;  1AFP A;  4LF4 L;  1KXL A;  1BBW A;  3A54 A;  1A3V A;  3BYY B;  4UP9 A;  1EYD A;  2EYO A;  2MO0 A;  1V9P A;  4A3D G;  3OHX C;  3NTK A;  1IHZ A;  4C3H G;  5C0X G;  1TWC B;  2F0U A;  3DEO A;  1V1P A;  1JJG A;  5CGK A;  3TRE A;  3HOY G;  3GP7 A;  2F0N A;  1EFW A;  2OQK A;  3M7G A;  4X64 L;  1U4M A;  2PYK A;  3BZD B;  3WDN A;  1X55 A;  2WFW A;  4BA1 I;  2J7Z A;  2A5H A;  4ABN A;  5EKL A;  5CYU A;  3AU7 A;  1HNW L;  2R61 A;  1E2V A;  2SEB D;  5ELF A;  1IKM A;  4DR1 L;  1NNX A;  1PH6 A;  4JI2 Q;  1STG A;  1CHQ D;  1WTQ A;  3CCU A;  3J7A F;  1GJX A;  1YNN D;  1CKO A;  4R4C A;  3J80 L;  1X3F A;  3BDL A;  1KNE A;  4BBS G;  4XXE A;  2L55 A;  4HJ9 A;  1QWY A;  3K5N A;  1Y1W G;  1Q90 A;  4YCU A;  4RHR A;  1I6H B;  2NB0 A;  4FF1 A;  2AHO B;  5M5X B;  3ER0 A;  1GVP A;  2F3W A;  5JVH 3;  2ALY B;  4FXG C;  4C2M H;  2O5I C;  1S5F D;  4XQJ A;  3K80 C;  4RFB A;  2EPB A;  2XRQ D;  4JI5 L;  5CV6 A;  2Z6K A;  2N55 A;  2KED A;  1D7Q A;  3K5L A;  5NUC A;  4A93 H;  2B63 B;  2JP1 A;  1GUW A;  1UE7 A;  1SNO A;  1L2F A;  1S4Z A;  4NXM Q;  4BS9 A;  2A69 C;  4MN3 A;  2R92 B;  1TS2 A;  2PI2 E;  4KD3 A;  3PO3 G;  3I73 A;  3GTG B;  4N9P A;  1UEB A;  2NN6 I;  1JMC A;  4KKU A;  4UY8 C;  3HS0 C;  1OXT A;  1SYD A;  2Y0S G;  4ZUI A;  1P8L A;  5C3E G;  2RBM A;  2PW7 A;  4DV2 Q;  1FL0 A;  2JA7 G;  1CI3 M;  3CXC A;  4WJ4 A;  1VDZ A;  2K5D A;  1A8V A;  1DOL A;  1IYJ B;  3CRL C;  1IL2 A;  4ZQ3 A;  4XYQ A;  2BA1 A;  5K36 H;  2F0J A;  3AQQ A;  1TY0 A;  3PSI A;  1QUQ A;  5COR A;  5IGC A;  4EGV A;  2FXQ A;  1KHI A;  2E76 C;  4RKB A;  2ZM6 L;  5T1G A;  1X3P A;  1F9P A;  1EYA A;  1NJI C;  1MSH A;  4TKO B;  4CJ1 B;  5I2X A;  4X65 Q;  1OXS C;  5KND A;  4X62 Q;  4B3R Q;  3ICE A;  2MGS A;  4ID6 A;  4ZK9 B;  1GUN A;  3I4L A;  1AZP A;  5EBD A;  4KI0 A;  2I5H A;  1FR3 A;  4CDC C;  5IYC H;  1UNS A;  2UU9 Q;  4L8J A;  4TRD A;  3MXN A;  4A3L G;  5FO8 B;  1HJP A;  1BXT A;  2MHV A;  4Q5V A;  1SFO B;  4LFA L;  5M5Y B;  1CZW A;  4JBW A;  1W6K A;  4ILW A;  4A3I G;  2JEA I;  1VQP A;  5E4W C;  3A0J A;  4JPB W;  5M3F G;  2B39 A;  2UXD L;  4X66 L;  2R93 H;  4GKK Q;  4U68 A;  1I4P A;  2DN8 A;  2L0C A;  4FF3 A;  4LUV A;  1G29 1;  4KKT A;  3B6Y A;  4A3B H;  1Q86 C;  4YWK A;  3HKZ G;  4C56 C;  3KLW A;  1C8C A;  4DR7 Q;  1BKB A;  1LTL A;  2J0T D;  1PH7 A;  3UDX A;  5CR3 A;  1NE3 A;  4IAL A;  1VQM A;  3G48 A;  4GN5 A;  4RKL A;  1R4Q B;  1FNU A;  1M8A A;  2EQS A;  3CC7 A;  1DD2 A;  1EFI D;  1GUO A;  4CDD C;  5BR8 L;  5DNF A;  2XRS D;  1X32 A;  1B70 B;  5C4Z A;  3CKI B;  3CPF A;  3ITP A;  4XQQ A;  1E2W A;  5JEA G;  1N8R C;  2ASB A;  4KN4 C;  4NB3 A;  5KRU A;  2XIW A;  5LMU Q;  3OTO L;  1N34 L;  1YNJ C;  2LXK A;  3PV0 A;  3G4S A;  2OF1 A;  2XGT A;  5CV9 A;  2K6A A;  3GTK H;  5ISR A;  3EN2 A;  2RCF A;  1WCM H;  3KUP A;  2EYF A;  4KV6 A;  4LW1 A;  1TT2 A;  5A2Q E;  2C9O A;  4KD4 A;  1ZKO A;  3R2I A;  4RCO A;  4LUZ A;  4PV1 C;  1KC8 C;  1I50 H;  4DF7 A;  1KAA A;  4A3D H;  4C3H H;  5C0X H;  5JAV A;  2NVX H;  5LMN W;  2UXC Q;  2F0H A;  1HZC A;  1LM0 A;  1UE6 A;  1NY4 A;  5I2Y A;  4JI3 L;  3HOY H;  2M9V A;  1TY2 A;  4IUN A;  2VB2 X;  2K05 A;  5J39 A;  2CH4 A;  2G9D A;  4HJ8 A;  4HJ7 A;  3PO2 G;  2KHS A;  5DAU A;  1TU2 B;  1V43 A;  1YHB A;  1N9W A;  4GN3 B;  2JA5 B;  4JYA L;  2QW7 A;  4YWM A;  4FF2 A;  2PO4 A;  2NVQ H;  3DXJ C;  4HIO A;  4JV5 Q;  3ULP A;  3MHB A;  4K2L A;  3TQY A;  1KAW A;  5C4H A;  4FF4 A;  2FMM A;  3TP6 A;  2DJF C;  3J7A V;  1LTB D;  4WJW A;  4DNT B;  5CMD A;  3AFQ A;  1YIT A;  5IT9 L;  4C3I B;  3EFX D;  4JOI A;  1IXR A;  1STY A;  3D4R A;  1F77 A;  2PNH A;  1Y1W H;  1TVX A;  3M3Y B;  3LX0 A;  4TSS A;  2NTS A;  2QCP X;  3OOC A;  2SNM A;  3HEJ A;  1Y1V B;  1PH4 A;  4RH6 A;  1J6Q A;  3S15 B;  4RG1 A;  1D5M C;  4LFC Q;  3M85 A;  2HQE A;  1LTI D;  1GOZ A;  4MHE A;  4A75 A;  4MTK A;  1VQ6 A;  2X6G A;  2Z4I A;  3TN2 A;  1BCP F;  4V0B A;  4IFD I;  4O1N A;  1X9N A;  1QUQ B;  3S14 B;  2P5Z X;  5IGB A;  3TP7 A;  3R93 A;  1SDF A;  5FLX E;  1HNX L;  3CCV A;  3PO3 H;  3TZD A;  1STE A;  1VQ7 A;  1PDQ A;  4I7Z C;  2OQ0 A;  3RLF A;  2JQO A;  2IX1 A;  2YTY A;  4X3K A;  5FKA C;  4RWS C;  2R7Z B;  1NMG A;  3GDE A;  4IUT A;  5C3E H;  1JR0 D;  2QKI C;  1PRT B;  1A3T A;  4A3K B;  2EY2 A;  3DEP A;  1WTX A;  5KGU A;  1EY4 A;  2A69 D;  3D0F A;  4JI8 L;  1XPO A;  2B2T A;  3MXN B;  3LWE A;  3KJP A;  5AJ3 L;  1CKM A;  4OXP A;  1GM5 A;  3S1R H;  4POG A;  1SYE A;  3BU2 A;  4QF4 A;  1LLR D;  3X3M A;  3M4O H;  3JAM i;  1SNC A;  4O2D A;  3PQI A;  4B08 A;  3EIV A;  1VQF A;  4CJ2 C;  2F0L A;  3WOF A;  1EQT A;  3FHW A;  1PTO F;  4A3F B;  1A3U A;  4HR7 B;  1TWH B;  2EVB A;  3CC2 A;  1XMO L;  3H3V I;  1IBK L;  2OTJ A;  1JQY D;  2XSC A;  4DAY A;  3E0J A;  3W1B A;  4A3L H;  2VY3 A;  4Q0F A;  2R6G A;  4JI7 Q;  2V4D A;  4N9T A;  3CC4 A;  4IFD J;  1H9S A;  1VQ4 A;  1LAC A;  5M3F H;  1EY7 A;  1ENA A;  4N8F A;  2ZJR A;  2PZW A;  2AWO A;  3RN2 A;  3TS2 A;  3SK8 A;  1PFN A;  1C48 A;  5KNC A;  4F88 A;  3ERS X;  2JA6 G;  4OEL B;  4PZ8 A;  1ASY A;  4BY7 B;  1CTM A;  1TS4 A;  2Q8R E;  3KLS X;  4JBM A;  4L5S A;  4YCV A;  1KD1 C;  4DV5 Q;  1KRS A;  2QDL A;  1G6Z A;  3NSW A;  3T1Y Q;  1J9O A;  1HTL D;  1MJE A;  4B3M L;  3GTJ H;  3FEW X;  5E1F A;  3NHH A;  1PH8 A;  4BA2 I;  3MZ5 A;  1C9O A;  2WAQ G;  2DJG C;  1NSN S;  2SOB A;  5ELB A;  2F0I A;  2JE6 I;  5I4D A;  4DV6 Q;  1FD7 D;  3H0G B;  3Q24 A;  1BDO A;  3W1G A;  1UE1 A;  4RCN A;  3QIA A;  1MBY A;  2JA8 B;  1PH9 A;  1RKN A;  3F8T A;  5C5M A;  3KJO A;  3I4N B;  2E2H B;  4JI1 L;  3UDI A;  2ZJQ A;  4B9X A; 
#chains in the Genus database with same CATH homology
 4H13 C;  1Q1B A;  1SE4 A;  1Y8P B;  1EU3 A;  4CKB A;  1YNJ D;  3PUY A;  1F9S A;  3S1N B;  4KJO A;  1BQQ T;  1EY6 A;  5M3M B;  1IYU A;  2FFK B;  2A74 C;  1F9R A;  3A8I E;  3ERQ A;  4ZKB B;  1STB A;  1B3A A;  1G91 A;  1KTK A;  2B2Y C;  1SEB D;  1D2B A;  2LKV A;  1MGS A;  4G57 A;  5FK9 C;  4U67 3;  5EJW A;  1BCP B;  1BO0 A;  1O7Z A;  4A3E B;  2B8F A;  1L0Y B;  1FGB D;  1R9T B;  4NW2 A;  3GTO B;  3T16 A;  1ESR A;  3ERO A;  4OO1 I;  3DWQ A;  1RTN A;  3SXH A;  1UEA B;  3SK4 A;  2BE5 C;  1HFG A;  5C6A A;  3DHQ A;  4HCE A;  2DNE A;  5IGG A;  1LTT D;  1Z7T A;  3DWA A;  1G2S A;  3X3N A;  1CQF A;  4XDX A;  3FVQ A;  1BOS A;  4E6I A;  4DU9 A;  3OWE B;  5EBC A;  3RZO B;  5COY A;  3Q23 A;  1AW7 A;  5HGT A;  3J80 E;  3H6M A;  4KTA A;  1PTO B;  2SNS A;  1QE6 A;  3S17 B;  1H9S B;  2B2V A;  4DGZ A;  3UI2 A;  1PXU A;  3J81 L;  3FDT A;  1IW7 C;  1UUP A;  1FNV A;  4CGY B;  1R4P B;  1OXX K;  4R8I A;  1Q12 A;  3BG3 A;  3TBI B;  3GQB A;  1CA6 A;  5C4J B;  4KY5 A;  1FYC A;  1I4X A;  3T53 B;  2RDF A;  1STH A;  1EU4 A;  4AYB B;  1VMP A;  2NWG A;  4HN7 A;  1SXT A;  4OIJ A;  5C5L A;  5G3L F;  4G4K A;  3D31 A;  1F9Q A;  3L3O C;  2B8G A;  4QMG A;  4K6D A;  4HSP A;  2WKD A;  4DA2 A;  4R8N A;  3JAM L;  1EWC A;  4L63 B;  4K6L A;  4F7X A;  5LHY 1;  5D14 A;  3K57 A;  4IUU A;  2K1B A;  2PW5 A;  2EOT A;  2F3V A;  2PZU A;  4C3J B;  4C1N K;  2IT1 A;  1TQO A;  1EY0 A;  1EIH A;  1JCK B;  1LT3 D;  3M7N A;  1RTO A;  1SSO A;  1D1I A;  1TS5 A;  3VYS A;  2PNR C;  1B9M A;  1O7Y A;  4KK7 A;  2E2D C;  1H9M A;  3SE0 A;  4BY1 B;  4A3G B;  3VA5 A;  3NK9 A;  2O5J C;  4XT3 B;  3PIO 3;  4QUC A;  4RAU C;  1FNW A;  4A93 B;  2K33 A;  2AUK A;  4LMQ D;  2ICE C;  3T51 B;  3C1E A;  2F0O A;  4X3T A;  2F0E A;  3A7A B;  2NYZ D;  1C4Q A;  1WD0 A;  3OIP A;  2L1B A;  2B2U A;  2J4X A;  3BVG A;  4IUR A;  1GUT A;  5HUR A;  3HOU B;  5DEH A;  5JJZ A;  4X3U A;  1STN A;  3T4A C;  4QCL A;  3W3A A;  5I6Y A;  1JOR A;  1ZEQ X;  1PYW D;  1WTR A;  2BDN A;  2VUM B;  4KY7 A;  1DJR D;  2EY6 A;  2XVS A;  3C2P A;  5M5W B;  4O42 A;  1PMR A;  3HZX A;  2BE5 D;  4C3I G;  3VR3 A;  4EQN A;  3O13 A;  2R93 B;  4ULL A;  1U9R A;  3FPU B;  2F0P A;  5IT9 E;  2EY1 A;  3TP5 A;  1D5X C;  5C0X I;  2RA4 A;  3U9O A;  1EYC A;  3GV6 A;  4A3B B;  1HFN A;  3MTS A;  2A6H C;  4HCS A;  4TQU S;  2EYM A;  2F0M A;  2CVR A;  2E75 C;  4CBV A;  3DWP A;  3ND8 A;  4RGN A;  1ICW A;  1ESF A;  2K01 A;  4X3S A;  4H7B A;  3WOE A;  1IW7 D;  1LT6 D;  4B9W A;  3F2U A;  2HCI A;  5IGF A;  4UDU C;  1PRT C;  4A3J B;  3PIP 3;  4RA8 A;  4FP5 D;  1EY8 A;  1VF7 A;  3NUC A;  1ML0 D;  3QOJ A;  1HA6 A;  1LTR D;  4OGQ C;  3KBX A;  4OIK A;  5C44 B;  4XIG S;  2AWN A;  2NVX B;  1SE2 A;  1V1P B;  1XYI A;  1F2M A;  2F0K A;  5C0X J;  4IFD G;  3OWF A;  4G7H C;  5DM6 3;  4XYO A;  1U4L A;  2CHB D;  1SBB B;  1JIC A;  5F2D A;  2PPB C;  1KAB A;  2F03 A;  1ILQ A;  4NDX A;  1NUC A;  2LY7 A;  5D3D A;  1HTP A;  2QIL A;  1XXG A;  3TDQ A;  4DAP A;  1TII D;  4IUP A;  2X69 A;  3KLR A;  1ENF A;  1IKL A;  5CV4 A;  2B2W A;  1TWF B;  3K7A B;  2NTT A;  4QB4 A;  1TWA B;  3VA7 A;  3IAY A;  1RJT A;  2I46 A;  3I72 A;  3QOL A;  4QUF A;  1I3Q B;  1JWS D;  1QJO A;  2KEE A;  3IFT A;  1MD2 D;  4MIU A;  3BS1 A;  3E6Z X;  1DOM A;  1E2Z A;  2RDG A;  1G8Z D;  2EYH A;  2KCC A;  2D5D A;  1DCZ A;  2BA0 A;  3T13 A;  1MSG A;  1GUS A;  2NBF A;  3FKI B;  3NXW A;  4DN4 M;  3S2D B;  3IKJ A;  1NR2 A;  2YU9 B;  2K5Q A;  1BF4 A;  3M4O B;  1DZ1 A;  5ELC A;  1Q8I A;  2K7V A;  2CW0 C;  2A6E C;  4ZYS A;  4XTC S;  2NVY B;  4IZ8 A;  2FJ2 A;  3G6J B;  5EKI A;  2K28 A;  1BNZ A;  1SNM A;  2OT2 A;  3QB3 A;  5E4X A;  1JOK A;  2AUJ D;  3HGB A;  3K0Y A;  4H44 C;  1B4O A;  3N6R A;  1B44 D;  1K83 B;  2D2C C;  1PZI D;  1BCP C;  3TSS A;  2SDF A;  2ICI A;  1XTC D;  4RGO S;  2B2T C;  1WTW A;  3CRK C;  2EJM A;  2X6L A;  1Y69 U;  4WOR A;  3E5S A;  1BUV T;  5CBA E;  5A35 A;  2F0T A;  1XX8 A;  3BDC A;  4FXK C;  4HSV A;  3C46 A;  3GO5 A;  3VR5 A;  2BDO A;  2A6H D;  4NKL A;  2LFN A;  3V2T A;  4PMW A;  4G7Z C;  1LTA D;  2XN9 C;  1B1Z A;  3M4Y A;  4G7O C;  3VR4 A;  1ZYR C;  3KK7 A;  1TKW B;  1PTO C;  5JOB A;  2EYP A;  5JPM C;  3SVM A;  2ZXP A;  1HQM C;  3NQI A;  3Q6S A;  1PRT D;  1KNA A;  2EE1 A;  3D4D A;  3HOW B;  1DYQ A;  5JEA H;  2RSO A;  3T56 B;  4OO1 G;  3A56 A;  4IFD H;  5C4X B;  5LL6 X;  1S5C D;  4OHJ A;  1IYV A;  1LV9 A;  3I90 A;  3QJY A;  5ELE A;  3Q0A A;  3U9S A;  3I4M B;  4KHV A;  5KYL A;  3R3O A;  1RCV D;  1QNU A;  3SK6 A;  3CQZ B;  4I65 A;  4IUQ A;  2KCN A;  2L11 A;  4Y7N B;  3S1Q B;  2PQE A;  3GTP B;  1DOK A;  5BN3 A;  2I07 B;  4ODG A;  3H91 A;  2ID0 A;  3JAM E;  2BCO A;  1PFB A;  5ELD A;  3A7L A;  5I9P A;  4XT1 B;  4FXD A;  5IOC A;  1NAP A;  4C3J G;  3HOX B;  5EPL A;  1SAP A;  5IGE A;  3FMC A;  3MC0 B;  1F2Y A;  1G2T A;  3OMC A;  2RSN A;  5T1I A;  2MPM A;  4DXG A;  2QEJ C;  3I91 A;  2QF7 A;  1RHP A;  3NWS A;  1Q1E A;  3S2H B;  3MXG A;  1ILP A;  1KDA A;  1CZG A;  3D4W A;  2GA4 B;  3ZYY X;  2FMC A;  2ZT9 C;  1O80 A;  1JOQ A;  2KUM A;  1CFM A;  1I4Q A;  1I4R A;  1QB5 D;  5CV8 A;  1EY9 A;  2EYL A;  2L5T A;  2AQ1 B;  1B53 A;  2CW0 D;  4DK1 A;  4FVM A;  1HUM A;  5DM7 3;  2K32 A;  1B2T A;  4JK1 C;  4KN7 C;  1OXU A;  1XWE A;  3AB9 A;  3OIQ A;  3IFD A;  4A3M B;  5K36 G;  2KQ3 A;  3QO2 A;  1ET9 A;  3D6W A;  1I4H A;  4NMZ A;  2F0G A;  4KMU C;  2PMZ B;  2IX3 A;  1GXD C;  1S5B D;  4J6H A;  1EEF D;  3GTL B;  1ONL A;  2B2V C;  1BCP D;  2QDB A;  3OSO A;  1PZJ D;  4RHS A;  5TSS A;  3L9A X;  1EOT A;  1SE3 A;  2H4O A;  3EQL C;  4RGT A;  1HPC A;  5M9O A;  4V19 0;  1D1K A;  1H9J A;  1PTO H;  2F0Q A;  2WKC A;  1TS3 A;  4DAV A;  1KLG D;  1AN8 A;  4F87 A;  3NBH A;  1HUN A;  3P1H A;  3RUZ A;  2CQA A;  1ZYR D;  4HMI A;  1K8O A;  2L9H A;  1PTO D;  1JOO A;  1IL8 A;  4EQP A;  2NN6 G;  4H0L C;  5I9O A;  1A6X A;  1E0B A;  3PUW A;  1SNP A;  4KKS A;  1DM0 B;  3A55 A;  4ZLT F;  3H09 A;  3CHB D;  4K5V A;  2KA7 A;  3HOV B;  4S3S A;  2JEB I;  3OPO A;  4K5X A;  1K8M A;  2WP8 J;  2XWJ B;  4C2M B;  1LTG D;  3L7Z C;  3SR1 A;  2JSO A;  1QIL A;  5C3X A;  1D5Z C;  1L0X B;  4HED A;  2ZXR A;  3GD7 A;  1II3 A;  4L6T B;  3KBG A;  3K5O A;  3J7Y W;  5KIX A;  4LJZ C;  2D62 A;  2EJG C;  1HCZ A;  1I6V C;  2IJ0 A;  3EA6 A;  5D65 A;  2Q8T A;  3SDZ A;  4WFN 3;  5J22 A;  4FO2 A;  2KEC A;  5FO9 B;  2FIN B;  2WV6 D;  2XWB B;  3MVV A;  5IGD A;  1I4G A;  3SEB A;  1HXY D;  3HG9 A;  2KOL A;  1GHK A;  1CA5 A;  1DXM A;  3DMU A;  1S5D D;  2B2U C;  5FO7 B;  1STA A;  4K8I A;  4BBR B;  4OL7 A;  4LAA A;  2EJF C;  4PMB A;  5KEE A;  1O7L A;  5FOB B;  1SYC A;  3MXU A;  2VB3 X;  1BBX C;  2WB1 B;  1KLU D;  1OO9 B;  5E3F A;  2F1M A;  1SNQ A;  1GUG A;  1MI2 A;  1GHJ A;  3S9W A;  5JVG 3;  1ZXT A;  2R3Z A;  1JWM D;  1PRT F;  2EY5 A;  3PMF A;  3NP8 A;  3OMG A;  3KF8 A;  1EEI D;  1B50 A;  2ENB A;  4DXF A;  1EZ6 A;  4K2K A;  2Z1C A;  3OW7 A;  2O4X A;  2LMC B;  5EKK A;  2HDL A;  1T5E A;  3GTK B;  5C3W A;  1WCM B;  1SMY C;  2KJX A;  1Y8N B;  4ME5 A;  3LWU A;  4NP5 A;  1I50 B;  5EGT A;  3NE5 B;  4CKC A;  2L4N A;  4A3D B;  3ONA B;  4C3H B;  5KYI A;  1SYG A;  2JXM B;  3HOY B;  1EZ8 A;  2RKS A;  1EL0 A;  3R8B A;  2DY8 A;  5CV7 A;  2NVQ B;  1HQR D;  3LNN A;  4KY6 A;  2NN6 H;  5JPN C;  2RDH A;  3K59 A;  1WD1 A;  2ZXO A;  3MXP A;  4BBS B;  4IUV A;  1V1O A;  3MFY A;  1Y1W B;  5IIF A;  2IWH A;  1SND A;  1HHV A;  5G3L D;  2OXP A;  3PUZ A;  1QOH A;  5EPJ A;  3FPP A;  2A73 B;  5BN5 A;  4K14 A;  1JE4 A;  3W2D A;  5CV5 A;  4C1N I;  1A2T A;  1ROD A;  3PO3 B;  4DK0 A;  3H3V C;  3BVZ A;  3TME A;  2Y0S B;  5C3E B;  3BDO A;  3C3L A;  2B2W C;  4EVO A;  3KLS A;  4PQX A;  2JA7 B;  2E74 C;  1CQV A;  2HCC A;  2VNU D;  1T5X D;  3NWT A;  4ZUJ A;  4KJN A;  3S1R B;  3MAQ A;  2EXZ A;  2EYJ A;  3P7J A;  3G7L A;  3MEH A;  3P20 A;  1PZK D;  1SYF A;  1H9R A;  1PFM A;  2K5W A;  2M2L A;  2D9U A;  5D3I B;  2OEO A;  4PNY A;  1Z47 A;  2WIN B;  1WTO A;  1HRJ A;  2Z8L A;  1A2U A;  1HA5 A;  1AEX A;  1B9N A;  5I6W A;  3C1F A;  3V96 A;  4K5W A;  4A3I B;  1VCI A;  1Z6H A;  5M3F B;  2HUG A;  3P75 A;  5J1Z A;  2Q8I B;  1LO5 D;  1CK1 A;  1QCB D;  3K5M A;  2MJ8 A;  2F0S A;  3VYU A;  3TP8 A;  3VR2 A;  3HKZ B;  2PZT A;  3NPP A;  1SJE D;  3I70 A;  4P2C B;  1H9K A;  3GTJ B;  4FNF A;  4ZKC B;  3VR6 A;  4HAE A;  1U4R A;  5AFW A;  2C5C A;  2PCF B;  2IL8 A;  5K5P A;  2N88 A;  4F8M A;  3A8J E;  5JEA J;  5A2Q L;  1LTS D;  3HRZ C;  2VXW A;  1ENC A;  3I3C A;  4DNR B;  3GTM B;  3PUV A;  5EPK A;  3NQT A;  4LK1 C;  4CHT B;  1D6E C;  2F0W A;  1NR4 A;  3Q22 A;  2HDM A;  2F0D A;  1SMY D;  2A68 C;  2F4I A;  2YYZ A;  2WAC A;  3J81 E;  1X3Q A;  2KVM A;  3PO2 B;  1EY5 A;  4QIW B;  3A8K E;  1JC7 A;  4BWG B;  1F2L A;  5LL6 S;  3MWY W;  4K8J A;  1SJH D;  3H94 A;  1AZQ A;  2Z4H A;  1U4P A;  1SYB A;  3QWN A;  2EDG A;  3AMU A;  2XNA C;  5CC4 A;  3EJI A;  3HP3 A;  4IN3 A;  4XQN A;  4YIJ A;  3TZU A;  2EZV A;  5FLX L;  4PMC A;  1YNN C;  2IPK D;  3DM1 A;  2B2Y A;  1WTV A;  3SHL A;  3GV3 A;  4R9W A;  3RZD B;  3D8G A;  2G9H D;  1TR5 A;  3SK5 A;  5CBE E;  3PUX A;  1ET6 A;  5BN4 A;  4CKE A;  4KHZ A;  1JWU D;  4IQZ A;  3NTI A;  1TWG B;  4ZAI A;  1OXV A;  4DFA A;  2BOS A;  1AP0 A;  2AQ3 B;  4ZRZ A;  4EQO A;  1UAP A;  2RVL A;  3GTQ B;  1Q3L A;  2DY7 A;  2FHT A;  4HMJ A;  1BR9 A;  3BYT B;  4FYD A;  1KDC A;  1PLF A;  2K03 A;  1S5E D;  4GZY C;  2JYO A;  1NCV A;  3MA2 B;  1RF2 D;  4WRD A;  1RD9 D;  2AQ2 B;  2A6E D;  2F0V A;  3ND9 A;  2E2J B;  1WTP A;  2RQX A;  1DON A;  1WVL A;  3S16 B;  2TMP A;  2WII B;  2JA6 B;  1LT5 D;  1Y8O B;  1F2Z A;  3NBI A;  3N52 A;  4CJ0 B;  1EQV A;  3D3R A;  1QNK A;  3K6O A;  1EIG A;  3R2T A;  3K58 A;  2TSS A;  2DNC A;  4M8A A;  2L12 A;  2WAQ B;  1JB3 A;  5IOD A;  3MFG A;  3URY A;  1LAB A;  2MP1 A;  3VYT A;  4M1U B;  1W6J A;  2H1E A;  1J8I A;  5EQ0 A;  3FRP B;  3S1M B;  3VYR A;  3QG1 A;  3CU7 A;  2NUC A;  1CHP D;  2IW3 A;  3BVM A;  3HOZ B;  4HTH A;  4J1M A;  4RGM A;  4UAI A;  1VF5 C;  2IX0 A;  2LS0 1;  3RD4 A;  2E2I B;  3NTH A;  1RDP D;  2MUY A;  2NVT B;  1A15 A;  1QG7 A;  4OO1 H;  2O2L D;  1KDB A;  3RMH A;  3IL8 A;  3V05 A;  5KNB A;  1M4V A;  1EWH A;  2NZ1 D;  2A68 D;  3D6C A;  2M00 A;  1CM9 A;  1V8Q A;  2F0F A;  1O78 A;  3DUZ A;  1CT1 D;  2K04 A;  1VMC A;  4Z9C B;  1LT4 D;  3EVQ A;  3I8Z A;  4J8Q A;  1AFP A;  3A54 A;  1A3V A;  3BYY B;  1EYD A;  2EYO A;  3OHX C;  3NTK A;  1IHZ A;  4C3H G;  5C0X G;  1TWC B;  2F0U A;  3DEO A;  1V1P A;  5CGK A;  3GP7 A;  2F0N A;  3M7G A;  1U4M A;  2PYK A;  3BZD B;  3WDN A;  4BA1 I;  2J7Z A;  2A5H A;  4ABN A;  5EKL A;  5CYU A;  3AU7 A;  2R61 A;  1E2V A;  2SEB D;  5ELF A;  1IKM A;  1STG A;  1CHQ D;  1WTQ A;  3J7A F;  1GJX A;  1YNN D;  3J80 L;  3BDL A;  1KNE A;  4XXE A;  2L55 A;  1QWY A;  3K5N A;  1Q90 A;  4RHR A;  1I6H B;  2NB0 A;  4FF1 A;  5M5X B;  2F3W A;  5JVH 3;  4FXG C;  2O5I C;  1S5F D;  4XQJ A;  4RFB A;  2EPB A;  2XRQ D;  5CV6 A;  2N55 A;  2KED A;  3K5L A;  5NUC A;  2B63 B;  2JP1 A;  1GUW A;  1SNO A;  1S4Z A;  4BS9 A;  2A69 C;  4MN3 A;  2R92 B;  1TS2 A;  4KD3 A;  3I73 A;  3GTG B;  4N9P A;  2NN6 I;  4KKU A;  3HS0 C;  1OXT A;  1SYD A;  4ZUI A;  2RBM A;  2PW7 A;  1CI3 M;  1VDZ A;  2K5D A;  1DOL A;  3CRL C;  4XYQ A;  4ZQ3 A;  2BA1 A;  5K36 H;  2F0J A;  1TY0 A;  5COR A;  5IGC A;  4EGV A;  2E76 C;  4RKB A;  5T1G A;  1X3P A;  1F9P A;  1EYA A;  1MSH A;  4TKO B;  4CJ1 B;  5I2X A;  1OXS C;  5KND A;  2MGS A;  4ID6 A;  4ZK9 B;  1GUN A;  3I4L A;  1AZP A;  5EBD A;  4KI0 A;  1FR3 A;  1UNS A;  4L8J A;  4TRD A;  3MXN A;  5FO8 B;  5M5Y B;  1BXT A;  2MHV A;  4Q5V A;  1SFO B;  1CZW A;  4JBW A;  1W6K A;  4ILW A;  2JEA I;  5E4W C;  2B39 A;  4U68 A;  1I4P A;  2DN8 A;  2L0C A;  4FF3 A;  1G29 1;  4KKT A;  4C56 C;  1C8C A;  2J0T D;  5CR3 A;  4IAL A;  4RKL A;  1R4Q B;  1FNU A;  1M8A A;  1DD2 A;  1EFI D;  1GUO A;  5DNF A;  2XRS D;  1X32 A;  5C4Z A;  3CKI B;  3ITP A;  4XQQ A;  1E2W A;  5JEA G;  4KN4 C;  5KRU A;  2XIW A;  1YNJ C;  3PV0 A;  2OF1 A;  5CV9 A;  2K6A A;  5ISR A;  3KUP A;  2EYF A;  4KV6 A;  1TT2 A;  5A2Q E;  2C9O A;  4KD4 A;  1ZKO A;  3R2I A;  4RCO A;  4PV1 C;  4DF7 A;  1KAA A;  5C0X H;  5JAV A;  2F0H A;  5I2Y A;  2M9V A;  1TY2 A;  4IUN A;  2VB2 X;  2K05 A;  5J39 A;  2G9D A;  2KHS A;  5DAU A;  1TU2 B;  1V43 A;  2JA5 B;  4FF2 A;  2PO4 A;  3DXJ C;  3MHB A;  4K2L A;  5C4H A;  4FF4 A;  2FMM A;  3TP6 A;  3J7A V;  1LTB D;  4WJW A;  4DNT B;  5CMD A;  5IT9 L;  4C3I B;  3EFX D;  1STY A;  3D4R A;  1F77 A;  1TVX A;  3M3Y B;  3LX0 A;  4TSS A;  2NTS A;  2QCP X;  3OOC A;  2SNM A;  3HEJ A;  1Y1V B;  4RH6 A;  3S15 B;  1D5M C;  3M85 A;  2HQE A;  1LTI D;  1GOZ A;  4MHE A;  2X6G A;  2Z4I A;  3TN2 A;  1BCP F;  4V0B A;  4IFD I;  4O1N A;  3S14 B;  5IGB A;  3TP7 A;  3R93 A;  1SDF A;  5FLX E;  3TZD A;  1STE A;  1PDQ A;  4I7Z C;  3RLF A;  2IX1 A;  4X3K A;  5FKA C;  4RWS C;  2R7Z B;  4IUT A;  1JR0 D;  2QKI C;  1PRT B;  1A3T A;  4A3K B;  2EY2 A;  3DEP A;  1WTX A;  5KGU A;  1EY4 A;  2A69 D;  2B2T A;  3LWE A;  1SYE A;  4QF4 A;  1LLR D;  3X3M A;  1SNC A;  4B08 A;  4CJ2 C;  2F0L A;  3WOF A;  1EQT A;  1PTO F;  4A3F B;  1A3U A;  4HR7 B;  1TWH B;  2EVB A;  1JQY D;  2XSC A;  4DAY A;  3E0J A;  4Q0F A;  2R6G A;  2V4D A;  4N9T A;  4IFD J;  1H9S A;  1LAC A;  1EY7 A;  1ENA A;  2PZW A;  2AWO A;  3SK8 A;  1PFN A;  1C48 A;  5KNC A;  4F88 A;  4BY7 B;  1CTM A;  1TS4 A;  2Q8R E;  3KLS X;  1G6Z A;  3NSW A;  1J9O A;  1HTL D;  3FEW X;  5E1F A;  3NHH A;  4BA2 I;  3MZ5 A;  1NSN S;  2SOB A;  5ELB A;  2F0I A;  2JE6 I;  5I4D A;  1FD7 D;  3H0G B;  3Q24 A;  1BDO A;  4RCN A;  3QIA A;  1MBY A;  2JA8 B;  1RKN A;  5C5M A;  3I4N B;  2E2H B;  4B9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...