3DM3A

Crystal structure of a domain of a replication factor a protein, from methanocaldococcus jannaschii. northeast structural genomics target mjr118e
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
DTYNIGELSPGMTATFEGEVISALPIKEFKRADGSIGKLKSFIVRDETGSIRVTLWDNLTDIDVGRGDYVRVRGYIREGYYGGLECTANYVEILKKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication factor A
publication title Crystal structure of a domain of a Replication factor A protein, from Methanocaldococcus jannaschii. NorthEast Structural Genomics target MjR118E
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Replication
total genus 21
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3dm3A00
4FDBA 1PH8A 1HR0W 1SRUA 1TWFH 3HOVG 1L2FA 4YCVA 4YWMA 1UE1A 4BBRH 2UXDQ 3PIOA 4GKKL 1PVOA 2R7DA 1IXRA 1XTDA 3PIPA 1YBYA 3JAMc 2K5NA 4P72A 3UDIA 3U4VA 1N8RC 1LM0A 1KHIA 5IYBH 3PO3H 4GOPB 3RZDH 1YZ6A 4YY3L 2Z6KC 3F1ZA 2IHFA 2KCMA 4LFBL 1A8VA 1HNXQ 2OTLA 2IT1A 1Q12A 2EIFA 4NXML 3AEVA 4BXXH 3T1YL 3CCUA 2ES2A 1MKHA 1YHBA 4LFAQ 5AJ3L 1N34Q 1WOCA 2NN6I 4LF6L 4DV4Q 1VQ5A 1M90C 1JJCB 3RR5A 4LF8Q 3S2DH 1N32L 2PMZE 5BR8L 3TEHB 4DV1Q 4HJ5A 4JYAQ 1XJVA 4BA2I 2ASBA 3J81j 1CKNA 2HIVA 2FXQA 2JA5G 1YNXA 2JA7G 1CUKA 3E9IA 4JI1Q 1UE6A 2HIXA 4P75A 3M4QA 5IP7H 5C4XH 1IBML 2E5LL 4X62Q 4JI6Q 4Y7NH 1UE5A 4X65Q 2YTYA 2V1CC 2VQFQ 1K73C 4LF9Q 1FL0A 3FP9A 2JA6G 4A3FG 4LF5L 1VQOA 3H15A 3PF4A 1KIXA 3HOYG 4GKKQ 3WWVA 1NE3A 2XGTA 1J6QA 2CQOA 3M9BA 2ZJRA 3EN2A 4HIOA 2WP8J 2NVXH 4LNQA 4APVA 5GAEC 1YJNA 4DR1L 1GD7A 4JBWA 4LWCA 4YY3Q 4X64L 3HOUG 2K4KA 5GADC 4LFBQ 1VQ4A 1GVPA 1E3PA 1PH4A 3A0JA 2LSSA 2MNAA 5M5YH 4NXMQ 4YCUA 2PQAB 2LXKA 3T1YQ 1C9OA 4IPGA 1Q82C 4L5RC 5AJ3Q 3LGJA 3CC2A 2JA6H 3M4OH 3PUVA 4QGUA 1IBLL 4LF6Q 3PO2G 1N32Q 1KL9A 5BR8Q 1SR3A 2IY5B 4JOIA 1X3FA 2I5MX 3CPWA 1I6HH 1C0AA 2PNHA 4RMFA 1VQJA 2ALYB 2I5HA 3K80C 2QA4A 4WJ4A 2K5VA 1CSQA 4KHZA 4DUZQ 1VQNA 2E5LQ 2OCEA 1D7QA 1OXTA 2B63G 3U4ZA 3AQQA 1X9NA 4JI6L 1VQLA 3K7AH 1NMFA 4NXNQ 4LF5Q 1W3SA 3GTQH 5DLQE 1B70B 5JJIA 1OXXK 4TVAB 1FJGL 3GTMH 3B6YA 2WAQE 4H02A 3FKIG 4YCWA 3I4OA 3K81C 4DNIA 2CKZB 5EAYA 5J3BA 1QUQB 1SE8A 2CWPA 3I4NG 4XTCS 4JI7Q 2L15A 3F2CA 1KQSA 4IJHA 1JB7A 3CMAA 3HOWH 4RG1A 4MTNA 4A3LG 5IYDG 1VQAA 4OONA 3RLFA 1EOVA 4A3CH 4X64Q 1Z9FA 3UDFA 4X66Q 3HOVH 5FLMH 1YITA 1AE3A 1B8AA 1K3RA 1WCMG 2I0QA 1PH7A 1HNXL 2ZTDA 5FLXc 4UP7A 3S1RH 1V1QA 4K0KL 3H3VI 2WB1G 2NN6G 3I4MH 3PUWA 3PSIA 4C3IH 3L7ZC 3JC66 2UUAL 4WJ3M 1BVSA 3CPFA 1IBLQ 1KRSA 4LUVA 4JI2L 2EQSA 1N34L 3GTKH 1VQBA 2NZHA 4A3BG 2PI2E 2VUMG 1Q1BA 4LF8L 1PYSB 1BKBA 5LMNW 4DV1L 4DV3L 3CCMA 4B3SL 4PZ7A 5ELOA 3F8TA 3GDEA 3CCEA 3PCOB 3CF5A 1YI2A 2BH2A 3CMEA 5IE8A 4B3RL 1CKOA 4DPGA 3KYHC 3SGIA 1HZ9A 5C0XI 4B3TQ 4BY7G 1TWHH 2QGQA 2RF4A 4HJ7A 2VQEL 3FHWA 1WFQA 2MFIA 3STBC 4X65L 5C3EG 2VQFL 3AFPA 4DK6C 1K9MC 4L5SA 1FJGQ 2RHSB 3W1BA 2CWAA 1YHQA 1E7ZA 1LTLA 4GN5A 3OYYA 3CCQA 1HZCA 3KDFA 2PQAA 4P74A 4IOAA 2JA5H 3I7FA 2CCZA 1IYJB 1OXVA 3GO5A 2JA7H 5IP9H 2VL6A 4UP9A 4AYBE 4MNOA 1VQ8A 4A3MG 1K8GA 2Q2TA 4IFDJ 1VQDA 4A3FH 3ERSX 5IYCG 3KF6B 3MXNB 4PZ8A 1WYDA 3BZCA 4R4OA 4HJAA 4GNXA 1PV4A 3HOYH 4K0KQ 3TS2A 1VQKA 3CAMA 3MEFA 2R92G 2UUCL 4OO1I 1TWCH 2HQLA 2K5HA 2R93H 2UUAQ 3L0OA 1HR0Q 4LF7L 4JI2Q 1I5FA 4YWKA 3DM3A 1EQQA 4GLAC 2CFMA 1EUJA 3M85A 4DUYL 3CCVA 1X54A 2MO0A 4DV3Q 3CC4A 3UDGA 4B3SQ 4DV5Q 1S72A 2PI2A 4JI0L 3GTLH 4HIMA 5FJ8G 3HOUH 4AQYL 3PGZA 4B3RQ 1PFSA 1YEZA 3OTOL 4HIKA 1LYLA 1I94L 4A3EG 5C44G 2GVBA 4UY8C 1VQHA 1C7YA 4DUZL 3CP0A 2JA8G 1L1OB 2EXDA 2VQEQ 1P8LA 3HOZH 3PO2H 2VW9A 4NXNL 4LUOA 1CSPA 2ID0A 2Y0SE 5HGQA 3D0FA 4GS3A 4GNXC 1TWAH 1D8LA 3CC7A 4BBSG 1VQIA 2GN5A 5ELNA 3U58A 1NY4A 3HOXG 1HNWL 3S2HH 3TRZA 2RCNA 1TXYA 1P16A 4JI7L 1U5KA 2R6GA 3G71A 1A62A 1G291 1YJWA 4LF4Q 2B63H 2Q2UA 1DGSA 1NTGA 3STBD 3KJOA 3CCSA 2HHHL 1T9HA 1X3GA 1ASYA 1N33L 2D62A 1NBWA 3GTOH 1K0RA 1X55A 4X66L 4JBMA 4DV0L 2ZTCA 3CD6A 2K50A 3IRBA 1SFOH 3EIVA 2UUCQ 4DAMA 3U50C 1PH1A 1QZGA 4KLKA 4HIDA 1FVIA 1Y1VG 4LF7Q 4DV6Q 1X56A 4O2DA 2R7FA 4ALPA 4R4QA 2E2HH 2KHIA 2YTXA 3DLLA 2UXBQ 5IT9c 1I50H 4A3KH 1QVFA 4A3LH 3RN2A 4DUYQ 5IYDH 3GTPH 1KC8C 4JBJA 1SMXA 4BY1H 2VNUD 4Y52H 4JI0Q 5K36G 3E9HA 1XMQL 4AQYQ 1WJJA 5C0XG 3KJPA 3OTOQ 4R1JA 1G51A 1WCMH 2QEXA 1I94Q 1PHJA 2JEAI 4JI5L 4POFA 5JEAG 1HJPA 2F4VL 4OWXB 4AIMA 2XTIA 4B3TL 3G6EA 1HZBA 2AWOA 4LFCL 4GOPA 4X6AH 2ZTEA 2Q2HA 4NPSA 2R7ZG 3KFUA 3PUXA 2VUMH 5C4XG 4A3GH 3A74A 3J7ZC 1B7YB 4A3JH 1X6OA 1HNWQ 1RIPA 3PUZA 5JJLA 4DR4L 1JJGA 1VS0A 3S24A 1MIUA 2E8GA 3ICEA 4DR2L 1K8AC 4DK3C 4BY7H 3AYHB 3Q8DA 4JOIC 3RN5A 2WAQG 4O0AA 2HHHQ 5LMNL 4QL5A 2JE6I 4A3IH 1N33Q 1Z47A 4JI8L 5C3EH 1U0LA 1Q8KA 4DV0Q 4OO1G 1EQRA 3W1GA 3TS0A 3K0XA 4POGA 3A5ZB 1Y1WG 1VQMA 3F2DA 1VQPA 1UWVA 3D31A 4GOPC 1HR0L 1JMCA 3AFQA 4DV7L 2R92H 1L0WA 4EQ5A 4QJFA 2AKWB 2JA9A 1J5EQ 1XMQQ 1E1TA 1EIYB 3PV0A 1EWIA 2KHJA 2AHOB 5IYCH 4DV5L 4PZ6A 2A19A 1CKMA 4DKAC 1S40A 4EX5A 2D0OA 1VQGA 2N3SA 1PH5A 4JI5Q 2F4VQ 4KHPL 3RLNA 1XNRL 4QY7A 4GLVB 1Q46A 1X65A 4LFCQ 2WFWA 4DV2L 3HKSA 2YV5A 1MJCA 3KLWA 1G6PA 1BBWA 1AE2A 3CW2C 2JK8A 1YVCA 5FJ8H 4DR4Q 3CCJA 1MJEA 1WI5A 1A63A 1ASZA 2VS1A 5C44H 4YHHL 4DR2Q 3M4PA 1E22A 4NB3A 3CXCA 2IX0A 5LMNQ 1KRTA 3RLOA 4JI8Q 1V43A 2KENA 1JJ2A 1HNZL 1QZHA 1GKHA 2BA1A 3KOJA 3NBHB 3GTJH 2H5XA 4A3DG 1OXSC 1SROA 1GM5A 5GQOA 4JV5L 1XNQL 4BBSH 4AYBG 1XPOA 3F2BA 4A93G 4A3CG 3H0GG 1N36L 3HOXH 4DR5L 2B3GA 5FLMG 3J80i 1N9WA 4P73A 3ULLA 2A1AA 2AMCB 1I3QH 1EYGA 2UUBQ 1TWGH 4DV6L 4HJ8A 4DV7Q 3I55A 2UXBL 1HH2P 2F3IA 4UP8A 4C3JH 4GKJQ 4JCVE 1VQCA 3I4MG 1KD1C 4DR6L 1M1KC 4DR7L 2Z0SA 2N78A 2LXJA 4HJ9A 2K75A 3H3VH 3S1QH 4OWWB 1QUQA 2AWNA 4ME3A 5M5XH 2A8VA 1Q1EA 3NENA 2N8NA 1Y1VH 5LMUL 2NVQH 4KHPQ 1XNRQ 3GD7A 4R4CA 3CCRA 1GO3E 4DV2Q 2IHEA 2E2IH 2DGYA 1VQFA 5IY0A 3L2PA 5M3FG 2YTVA 1LUZA 3K7UC 4AH6A 1BBUA 1VQ7A 1V9PA 5GAGC 2OTJA 5M3MG 2VZAA 1PA6A 4A75A 1EIFA 2JJQA 4JI4L 3S14H 2Y0SG 4QIWE 3S1MH 2K52A 4YHHQ 3ULPA 4BBRG 4XIGS 4P71A 3GTGH 1Q7YC 3S16H 4IFDI 5HY6A 3I56A 3W5OA 5GAHC 1HNZQ 3RZOH 2ZJPA 2BA0A 2NVTH 3UDXA 2R7ZH 3NELA 1KAWA 4IPCA 4GN4B 5IP9G 2C35B 1XNQQ 4JV5Q 1IBKL 1NMGA 1N36Q 4DR5Q 3FKIH 2GVAA 2B29A 4IPHA 5IYBG 1Q86C 3PO3G 1A0IA 2YYZA 2ZJQA 3JAMi 3I4NH 3CCLA 1IL2A 2IX1A 4PMWA 3NEMA 4IPDA 4JG2A 1KXLA 3J81c 1FGUA 2F52A 1VQEA 4GLXA 1XMOL 2R93G 4DR6Q 1VQ6A 4DR7Q 5IWAL 4BXXG 1J5EL 3CQZH 1OXUA 1OTCA 4A4IA 1K83H 1PH6A 2BH8A 4R4IA 1Y1WH 5LMUQ 4IOCA 2ZM6L 2UU9L 5H1SE 4LUZA 1E1OA 4OXPA 3UE0A 4J15A 3ULJA 3HKZE 4OWTB 3S1NH 1YIJA 3KDFB 1X3EA 5IP7G 3KF6A 3A5UA 4A3BH 1JT8A 2ATWA 4IO9A 4L5TA 3BZKA 3HOZG 2I5LX 4JI4Q 3HKZG 4L5QA 3E0EA 2Q2IA 3TREA 1VQ9A 1SN8A 4JI3L 3PF5A 2E2JH 2UXCL 3T1HL 4DR3L 4GNXB 3ZJYC 4JBKA 4LF9L 4OX9L 3TQYA 3BU2A 1IBMQ 4B3ML 2JEBI 4UPAA 1IBKQ 4GN3B 5JJKA 3J81i 3PUYA 2OQKA 4R4TA 5C0XJ 2K14A 1RL2A 1JE5A 1UEBA 1L1OA 1PH2A 2KCTA 2JQOA 5JEAJ 2OQ0A 2UUBL 4A93H 1UE7A 5M5WH 3VDYA 1XMOQ 2UXDL 1AH9A 1YJ9A 4A3MH 1CKNB 4GKJL 5IWAQ 4A3DH 3I2ZA 3J80c 4DAYB 1W2BA 4KI0A 3M3YH 1QVGA 2MQHA 4A3KG 1QVCA 1PYBA 4DR1Q 2NVYH 3G48A 4BY1G 1Y14B 1S3OA 3H0GH 2HT1A 1HZAA 2WB1E 2ZM6Q 1E24A 2UU9Q 5GROA 1O7IA 2RHQB 1H95A 2YU9H 2DUDA 1XPUA 4MZ9A 3S15H 3HFZB 3J7A5 4A76A 4IJLA 4QQBX 4C2MH 1XPRA 1L1OC 3UE1A 3M7NA 4IFDG 4JC0A 5E7NA 4C3HH 1PH3A 4LFAL 3KF8B 4PG3A 4DV4L 3RNUA 3ER0A 1YHAA 3EBEA 1PH9A 3OW2A 4A3GG 2MO1A 4A3EH 4A3JG 4JI3Q 2VY3A 2JA8H 1EFWA 4JYAL 2UXCQ 1VCIA 3T1HQ 3BJUA 4DR3Q 4LF4L 3S17H 1SLJA 3G4SA 2Z6KA 2NZOA 4B3MQ 4OX9Q 3K8AA 2D0PA 4LW1A 1IZ6A 5M3FH 4TQUS 1R9TH 4JI1L 2OWOA 2N49A 1Q81C 1NJIC 3HOWG 2KBNA 4BA1I 4YWLA 4X62L 5M3MH 4A3IG 5C4JH
chains in the Genus database with same CATH superfamily
4FDBA 1HR0W 1SRUA 3QWNA 1UE1A 1WTQA 2UXDQ 3FVQA 4L63B 1H9SB 3PIPA 2HDLA 1YBYA 5CV4A 4UHVA 3UDIA 1N8RC 1TWHB 2F0WA 4N9TA 1KHIA 5CV9A 3MAQA 1JWUD 1PRTF 3X3MA 3PO3H 3MEHA 3RZDH 1YZ6A 2Z6KC 4F87A 3K5LA 2Y0SB 3FPUB 2LMCB 3EFXD 3OIPA 3I4LA 1SDFA 2IT1A 1TIID 4N9PA 1Q12A 1TS2A 3OOCA 1YHBA 5C0XH 4LF6L 1VQ5A 3RR5A 5BR8L 4DV1Q 3K5OA 4HJ5A 4JYAQ 1PZID 3PO3B 2ASBA 3X3NA 1SE2A 2HIVA 1SYGA 1I4GA 3E9IA 1UE6A 4P75A 5IP7H 3DXJC 2E5LL 5C4XH 3R2IA 2Q8RE 4X65Q 3RD4A 2YTYA 1VQOA 1KIXA 3HOYG 4O1NA 1ESRA 5A35A 5IGGA 3WWVA 4K8IA 2SNMA 1ET6A 4MN3A 2NVXH 4LNQA 1GD7A 4YY3Q 4X64L 2K4KA 4RKBA 5KEEA 4LFBQ 3HKZB 3AB9A 4DN4M 4YCUA 4KKSA 1U4LA 1Q82C 1EY9A 3LGJA 2SNSA 2B2UA 1SR3A 2IY5B 1I6HH 2NVXB 2I5HA 3K80C 2K5VA 3Q22A 1CSQA 4K5WA 4DUZQ 1HPCA 4PNYA 1LTRD 3U4ZA 4OHJA 2RQXA 1IHZA 1EQVA 3TBIB 1I50B 1BNZA 1E2WA 2SDFA 5JJIA 4BY1B 2K5DA 3GTMH 2WAQE 3FKIG 4YCWA 3I4OA 2JN4A 1VF5C 3CMAA 4A3LG 4MTNA 5IYDG 4ZUJA 4X66Q 2EJGC 5FLMH 1AE3A 5IGDA 1K3RA 1HNXL 2A6EC 4LJZC 5CMDA 1SE3A 2NN6G 3I4MH 3PUWA 4C3IH 2L4NA 4WJ3M 1KRSA 2RSNA 2EQSA 3GTKH 4A3BG 2PI2E 2VUMG 1B2TA 4LF8L 1K8MA 4B3SL 4LK1C 3CCEA 3CF5A 5EKLA 5C0XI 2HUGA 4BY7G 2QGQA 1LV9A 2NWGA 3EVQA 5C3EG 2VQFL 1U4PA 2F0PA 3ONAB 3NWTA 1K9MC 4L5SA 3W1BA 2CWAA 1II3A 4ME5A 3EROA 2KUMA 1HZCA 5JOBA 1CA5A 1SNQA 5IP9H 1L0XB 4MNOA 1VQ8A 2Z6BA 3H6MA 4IFDJ 3SHLA 4F88A 1STGA 3ERSX 4PZ8A 3EQLC 4K0KQ 2WACA 3MEFA 1A6XA 1KDAA 3A55A 2UUAQ 3MZ5A 3IKJA 4GLAC 3BZDB 3CCVA 1X54A 4IUUA 3ERQA 2K04A 3UDGA 1H9JA 1S72A 3HOUH 4AQYL 3PGZA 4G7HC 1PFSA 3OTOL 5C44G 4UY8C 1VQHA 1X3PA 1L1OB 1PXUA 3EJIA 2OXPA 1P8LA 3R2TA 3PO2H 2VW9A 1CSPA 2B2TC 2XRSD 3BDOA 4GNXC 1GUGA 4BBSG 3U58A 1F77A 3VR2A 3HOUB 1F2ZA 2L55A 1BCPB 3S1QB 3T16A 1SE4A 4FYDA 1D6EC 1P16A 1V1PA 4JI7L 4HMJA 1DXMA 4EGVA 3KJOA 3STBD 4LMQD 1N33L 3GTOH 2D62A 3Q23A 3PO2B 2E2IB 5JJZA 5EGTA 4IQZA 4DV0L 3CD6A 2K50A 2UUCQ 4DAMA 4BS9A 1Y1VG 4LF7Q 1AN8A 1X56A 2E2HH 3DLLA 2UXBQ 1SMYC 4FF3A 3RN2A 3M4YA 1SMXA 1D1KA 4JI0Q 3I72A 5K36G 3GTOB 3E9HA 4K6LA 3BVMA 1H9SA 1O7ZA 1B44D 2JEAI 2B2WA 1S5FD 3G6EA 3I4NB 3SE0A 3OWFA 2E2HB 1GUNA 2PYKA 4A3JH 1ENCA 4K8JA 3O13A 1K83B 1VS0A 2B39A 3S24A 4DAVA 4J6HA 4DR2L 3AMUA 5I6WA 3Q8DA 1IW7C 2WB1B 3RN5A 2HHHQ 4A3IH 1A3VA 2IL8A 1TY2A 4OO1G 4ULLA 1EQRA 1STEA 4XXEA 1Y1WG 1VQMA 2HD3A 1HR0L 5C4ZA 4DV7L 3NPPA 2XRQD 2JYOA 1K8OA 3HG9A 1LT4D 2AHOB 2L5TA 4PZ6A 3GV3A 3OPOA 1ML0D 4X3UA 1PRTC 2Z9HA 5EBDA 3DUZA 1X65A 1D5MC 3ITPA 3NUCA 1G6PA 2D5DA 2F0DA 3CW2C 4DR4Q 2R92B 1LT6D 4NB3A 3Q0AA 1KRTA 4LF4L 4LF9Q 1F2LA 2KENA 3NBHB 3SXHA 2PZWA 1L0YB 1D5XC 1OXSC 5GQOA 5CC4A 4AYBG 2B2VC 1G6ZA 4A93G 3H0GG 4QB4A 4DR5L 1RKNA 3ULLA 4P73A 1TWGH 3MHBA 4FO2A 4K5XA 4A3EB 3NTKA 2JA8B 4C3JH 4GKJQ 2J0TD 4DR6L 1E2VA 1B53A 3E5SA 1IYVA 2BE5D 2RBMA 2AWNA 5M5XH 2CHBD 1ILPA 1Q1EA 4F8MA 2NVQH 5LMUL 5KIXA 1WTRA 1ZXTA 4DV2Q 3A7LA 1CQVA 3VYTA 3K7UC 1BBUA 4C3JB 1V9PA 2F0VA 2K28A 2SEBD 2L0CA 2F1MA 1PA6A 1BOSA 3S14H 3D8GA 2Y0SG 3IFDA 3S1MH 3ULPA 5M5XB 1XYIA 3GTGH 1DJRD 1KLUD 1HNZQ 2EYMA 1HRJA 1IL8A 2R7ZH 4DF7A 2H4OA 1XNQQ 1IBKL 3KLSX 1HUMA 2DNCA 4G4KA 3FKIH 4C1NI 3PO3G 4LAAA 3NEMA 1XTCD 4IPDA 3BG3A 4CJ2C 2F52A 3ZYYX 3DWAA 4DR7Q 4K14A 2QCPX 5IWAL 2AUJD 1J5EL 2R7ZB 1OXUA 1PH6A 2PNRC 2BH8A 2EJMA 3K59A 2KA7A 1GOZA 3FRPB 4ID6A 3SEBA 4IOCA 3MXUA 4B9XA 2NN6H 4LUZA 3OHXC 3GP7A 4FF1A 4J15A 1SNPA 1SJED 4RGNA 2RDHA 5IGCA 1YIJA 1X3EA 5IP7G 4A3BH 4ABNA 1Q3LA 5J1ZA 4L5TA 1S5CD 2I5LX 3HKZG 3E0EA 2Q2IA 4Q0FA 2FMMA 5CR3A 2E2JH 5IIFA 2UXCL 2WKCA 4GNXB 4DR3L 5DM63 3TQYA 3BU2A 4B3ML 1QOHA 2JEBI 5M5YB 4GN3B 3MXGA 4R4TA 2B2WC 1BF4A 1UEBA 1L1OA 5JEAJ 1Z6HA 2AUKA 4MIUA 1XMOQ 1RTNA 1STHA 1AH9A 5CV8A 4MHEA 2B8FA 3HS0C 2BDOA 1NCVA 4FF4A 1W2BA 4KI0A 3M3YH 2MQHA 2X6LA 1D1IA 3G48A 1Y14B 4BY1G 2HT1A 3BYYB 4OIKA 1W6KA 1O7IA 3C3LA 1PYWD 3GTQB 2Z4HA 1H95A 2DUDA 1XPUA 1RJTA 3N52A 4HMIA 4HCSA 2A68D 3UE1A 1MGSA 1F9RA 5J39A 1PH9A 3OW2A 1AZPA 4JI3Q 2VY3A 1TT2A 2LS01 1SLJA 1PFNA 2Z6KA 3CHBD 2XNAC 5D3IB 2A69D 5M3FH 4TQUS 2IW3A 2KBNA 4BA1I 4X62L 5M3MH 1FNUA 4CGYB 5I2XA 2GA4B 4YWMA 2J7ZA 2PCFB 4WJWA 3R3OA 1PDQA 1R4PB 2BOSA 4I7ZC 1PVOA 1XTDA 4OELB 1NR2A 2NZ1D 4FP5D 2X69A 3JAMc 4P72A 3U4VA 5M3FB 2K32A 1UUPA 1TS4A 4XYOA 2DN8A 3C1FA 5FO9B 3N6RA 5M3MB 1BXTA 3F1ZA 2KCMA 1HNXQ 1LTSD 4DNRB 2OTLA 1AP0A 3AEVA 3L9AX 2E2DC 1MKHA 5AJ3L 3VR4A 5NUCA 1WOCA 2NN6I 4DV4Q 4LF8Q 1PRTB 1N32L 1SYFA 1XJVA 4ZYSA 3J81j 4B08A 4PQXA 2A6ED 2Z4IA 4DAYA 1YNXA 5C5MA 2HIXA 4KD4A 4N8FA 3JAML 4JI6Q 4Y7NH 2WINB 2DJFC 2VQFQ 4IUVA 1K73C 3CU7A 4LF5L 1Y8NB 4DU9A 4GKKQ 2QDLA 1PLFA 3E3XA 1O7YA 4NKLA 2XGTA 1J6QA 1SNCA 5BN5A 1GHJA 3M9BA 3A7AB 1DYQA 5GAEC 1YJNA 4DR1L 4H44C 4JBWA 3HOUG 2PW5A 1A3UA 2F3WA 1GVPA 1PH4A 3A0JA 4RCOA 4JVZA 4U68A 2MNAA 4NXMQ 3T1YQ 1C9OA 4IN3A 3M4OH 3IL8A 3CC2A 3PO2G 1IBLL 3J80E 1LTAD 4RMFA 3D4DA 2QA4A 4G7ZC 4IALA 4KHZA 4ZKCB 1VQNA 4YIJA 4RA8A 5AFWA 2OCEA 1D7QA 1OXTA 5C5LA 3AQQA 4UAIA 3K7AH 1NMFA 1M4VA 3K5MA 1W3SA 1QILA 2CW0C 3P7JA 1OXXK 2F0GA 3B6YA 1ZYRD 3K81C 4DNIA 2JP1A 5EAYA 5J3BA 2CWPA 3I4NG 4JI7Q 1KQSA 3PMFA 2AQ1B 4OONA 1EOVA 4JPBW 5G3LF 3K7AB 3R93A 3HOVH 2ZXPA 1B8AA 4PMCA 2ZTDA 5FLXc 1B3QA 1MI2A 1I4XA 2FMCA 2WB1G 2EYFA 2VB2X 1LT3D 1MBYA 4JI2L 1N34L 2PW7A 1Q1BA 4HAEA 4DV3L 2K5QA 1F9QA 3PIP3 3HOVB 4PZ7A 3F8TA 2BH2A 1BDOA 3PCOB 4KJOA 3TZUA 3WOFA 3TP7A 3CMEA 1CKOA 4DPGA 3H3VC 3KYHC 2O2LD 1TWHH 1I6VC 1SMYD 2VQEL 1LABA 4DXGA 4DK6C 1FJGQ 2RHSB 5BN4A 1YNJC 4GN5A 2PQAA 4P74A 5FLXL 1CZWA 2EPBA 1CFMA 1EZ8A 3FPPA 2DJGC 3TP5A 1HHVA 4X3TA 4HJAA 2B2TA 1WYDA 4GNXA 1U9RA 1VQKA 2R92G 4FXGC 4OO1I 1TWCH 2HQLA 3MXPA 1HR0Q 1IKLA 1HCZA 3J81E 3NBIA 3DM3A 1F9PA 1LTBD 1O78A 2CFMA 2V4DA 4DUYL 2MO0A 2Z8LA 2JA6B 4FNFA 4B3RQ 2K05A 1R4QB 1LYLA 1I94L 4A3EG 2GVBA 2JA8G 2F0SA 1C7YA 4CJ1B 5K5PA 2EXDA 1TWCB 5I2YA 3H91A 4RH6A 4LUOA 2ID0A 2QEJC 3VYUA 3D0FA 4GS3A 1TWAH 1D8LA 3CC7A 4MTKA 3D6CA 1ICFB 2GN5A 5ELNA 1NY4A 1HNWL 3SK5A 4X3KA 3TRZA 2RCNA 1RHPA 3SVMA 3NE5B 2B63H 4LF4Q 4C3JG 4XQQA 1DGSA 1BR9A 1RCVD 1CQFA 2F0MA 1B50A 1I4PA 4JBMA 1TWAB 1JORA 1SFOH 4OIJA 3ND8A 4HIDA 1JICA 1ICWA 1FVIA 4ALPA 2R7FA 4R4QA 2KHIA 2YTXA 2ZT9C 5IT9c 1I50H 3S16B 3FMCA 3VYSA 1LLRD 2B63B 4WFN3 4BY1H 1XMQL 1WJJA 4GZYC 4Z9CB 1WCMH 1YNND 2RVLA 1SFOB 4JI5L 5COYA 3DHQA 4AIMA 5JPNC 1HZBA 2AWOA 4H0LC 1AW7A 4X6AH 2Q2HA 3VYRA 2R7ZG 5CBAE 1CTMA 3KFUA 1GUSA 3A74A 1X6OA 4M1UB 3PUZA 2A6HC 1JJGA 1WCMB 2PQEA 3URYA 4DK3C 3AYHB 1U4MA 4O0AA 5IT9L 5LMNL 4QL5A 2JE6I 3VA7A 1U0LA 2AQ3B 3S1NB 3W1GA 5EKKA 4EVOA 4I7AA 1BQQT 3Q24A 3I70A 1EYAA 2KVMA 2IX3A 3MFYA 4G7OC 1JMCA 3AFQA 4K2LA 1L0WA 4EQ5A 2MJ8A 1DZ1A 1J5EQ 1EIYB 3PV0A 1EWIA 2KHJA 5IYCH 4DV5L 3T56B 1PTOF 4EX5A 1HTLD 2EJFC 2OF1A 2F4VQ 2B2VA 3RLNA 1F9SA 4GLVB 1Q46A 4LFCQ 2WFWA 3HKSA 3NWSA 2LY7A 1JWSD 1MJCA 2YV5A 2Z1CA 1U4RA 1AE2A 1V1OA 3CCJA 1UAPA 1WI5A 1ASZA 3RLOA 4JI8Q 1G91A 1GKHA 1STAA 2H5XA 1HFNA 2PZUA 4DA2A 1SROA 3CKIB 1XPOA 4C2MB 3F2BA 4A3CG 1N36L 1VF7A 1XWEA 1QVFA 2EY2A 2FINB 3HRZC 5E4XA 5I6YA 4UP8A 3D3RA 4JCVE 1KD1C 3OMCA 2CVRA 2LXJA 4HJ9A 1DONA 3H3VH 3S1QH 3OW7A 3S9WA 3DM1A 1QNUA 2N8NA 1RF2D 4KHPQ 1TWFB 1XNRQ 3GD7A 3CCRA 1GO3E 4KHVA 2E2IH 2DGYA 2F3VA 1SNOA 5M3FG 1VQ7A 4AH6A 1E2ZA 3PQIA 5M3MG 2VZAA 3KLSA 4A75A 2JJQA 4JI4L 3LWUA 4DK0A 4QIWE 2K52A 4YHHQ 2KEDA 2XWJB 4XIGS 5JEAH 5HY6A 5KRUA 5GAHC 1CI3M 1ENFA 1TY0A 1LACA 1EWCA 1EWHA 2BA0A 3UDXA 3KUPA 4IPCA 4JV5Q 3TP8A 4ODGA 3MTSA 2GVAA 4ZLTF 2B29A 2ZJQA 5HURA 3CCLA 3I4NH 1UEAB 2IX1A 4JG2A 1VQEA 4GLXA 5I4DA 1TKWB 1QWYA 2Q8TA 4IURA 1OTCA 4KMUC 4A4IA 1K83H 2X6GA 2ZM6L 4JK1C 2UU9L 1DM0B 5H1SE 2QKIC 3UE0A 4E6IA 3KDFB 2WAQB 2ATWA 4KJNA 3TREA 2E74C 1JOQA 2EY5A 4OX9L 4UPAA 3PUYA 2OQKA 5C0XJ 5CV6A 2KCTA 2JQOA 2UXDL 1S5ED 3I3CA 3T53B 3I2ZA 5C3WA 4DAYB 3Q6SA 4DR1Q 2R92H 1E24A 5GROA 1OO9B 2RHQB 4S3SA 1SAPA 1MD2D 1A2TA 3I8ZA 4IJLA 3TDQA 1C8CA 2XVSA 4IFDG 5E7NA 1PH3A 4KY5A 3KF8B 2JSOA 1YHAA 3ER0A 4A3EH 2JA8H 3NHHA 4JYAL 3T1HQ 3BJUA 3J7YW 4IUQA 2D0PA 3J7AV 1R9TH 3S1RB 3A8IE 1NJIC 1DD2A 3HOVG 5KGUA 3BVZA 1MSGA 3PIOA 2HCCA 3WDNA 4KY7A 1IXRA 1R9TB 4FXKC 1LM0A 1NR4A 3SR1A 2TSSA 1X3QA 3TSSA 2N55A 4YY3L 2IHFA 4LFBL 2MGSA 3MVVA 1A8VA 5E1FA 2EY1A 1EY6A 1SYCA 3RUZA 2EIFA 2K03A 1PZJD 1B4OA 4LFAQ 1N34Q 1M90C 1JJCB 3S2DH 1GUOA 2PMZE 3TEHB 2DY8A 3KK7A 1SYDA 4DNTB 1WD1A 4WRDA 1CKNA 2RA4A 1EEFD 1KLGD 4JI1Q 3M4QA 2R93B 4HEDA 4KK7A 3A8JE 1UE5A 2JA6G 5EQ0A 1FL0A 4K5VA 3PF4A 3S2DB 5C6AA 2NBFA 2DY7A 1HXYD 1BCPD 2CQOA 4UDUC 4HIOA 4ZRZA 4CDEC 3HOZB 4LWCA 2B2YA 5GADC 1DOKA 1VQ4A 1E3PA 3NTIA 5M5YH 2PQAB 3U9OA 4R9WA 4L5RC 5JJLA 3QIAA 3QOJA 3PUVA 4LF6Q 1LTID 1KL9A 5BR8Q 4C1NK 4JOIA 1X3FA 4ZCKA 3CPWA 1PMRA 1C0AA 5I9OA 2ALYB 1D2BA 1AEXA 4WJ4A 4N8X1 1EU4A 1PTOC 2E5LQ 1BUVT 3QR8A 4CBVA 2B63G 1VQLA 1F2MA 4A3KB 3GTQH 2EXZA 4TVAB 4H02A 4HSVA 4G57A 4B9WA 2CKZB 1V8QA 1SE8A 2F0IA 2L15A 3F2CA 4IJHA 1JWMD 1JB7A 2A73B 4RG1A 3HOWH 1VQAA 4A3CH 2E75C 1LT5D 1Z9FA 4X64Q 1JB3A 4KD3A 3T13A 1YITA 2F0FA 1C4QA 4HR7B 1WCMG 2KCCA 2I0QA 2PZTA 1EEID 4K0KL 3DEPA 3KLRA 3OIQA 3IAYA 5DM73 3PSIA 3L7ZC 3JC66 2UUAL 1BVSA 4QUCA 1JOKA 1QJOA 3HOWB 1VQBA 2NZHA 3JAME 1PYSB 1BKBA 5LMNW 3CCMA 5CV7A 1STYA 2MP1A 3GDEA 5ELOA 2CH4A 1W6JA 3SGIA 2RF4A 4HJ7A 3FHWA 3K6OA 1EIHA 3STBC 2EE1A 3AFPA 1Q90A 3KBXA 3QG1A 2EYLA 3NQIA 4RKLA 2G9HD 5ELCA 1EFID 5FKAC 1E7ZA 1ESFA 1LTLA 3CCQA 3KDFA 4QF4A 2JA5H 2JA7H 1OXVA 5KNBA 2VL6A 4UP9A 4AYBE 4A3MG 2Q2TA 1VQDA 5LL6X 2O4XA 4K2KA 4A3FH 3OWEB 5IYCG 3KF6B 2KOLA 3MXNB 3BZCA 1LTGD 4R4OA 3TS2A 2UUCL 5FO8B 4LF7L 3CRKC 2JA7B 1I5FA 2JA5B 4YWKA 1DCZA 1HA6A 4B3SQ 1VMPA 4DV5Q 4JI0L 2PI2A 4A3FB 1YEZA 1DOMA 1NNXA 2K01A 1I3QB 5IODA 4CKBA 4NXNL 3SK8A 2Y0SE 3HGBA 1MSHA 5L37A 1BO0A 2WIIB 2TMPA 2R6GA 2NTSA 3G71A 1A62A 3C1EA 1YJWA 3KF8A 1G2TA 2F0QA 2HHHL 1B9NA 1X3GA 1ASYA 5ELDA 4CDFC 3A8KE 2EYPA 3MWYW 4RGMA 2ZTCA 3IRBA 3EIVA 3U50C 5ISRA 4KLKA 1Q8IA 4O2DA 1EL0A 3K57A 1GHKA 1Y8PB 1WTPA 4JBJA 4NP5A 2VNUD 5KNDA 4AQYQ 2EYOA 2XWBB 1RDPD 3KJPA 3OTOQ 3L3OC 4R1JA 1H9RA 3NTHA 1PHJA 4RCNA 5FK9C 4POFA 5JEAG 1HJPA 1K28A 4OWXB 2XTIA 4EQOA 4B3TL 2K6AA 2B2YC 5FLXE 4IFDH 2ZTEA 1SNMA 2VB3X 3VA5A 1B7YB 1EY7A 4NDXA 1HQMC 2FHTA 3DWQA 4DR4L 2AQ2B 3EA6A 3V2TA 5JPMC 1MIUA 4DFAA 2E8GA 3MA2B 3ND9A 4JOIC 2WAQG 1IYUA 1N33Q 2F03A 2JXMB 1Z47A 1TS3A 1Q8KA 2ZXOA 4DV0Q 2MPMA 1TU2B 3K0XA 2BE5C 1J8IA 3A5ZB 3M7GA 3T51B 3F2DA 1EYDA 1B1ZA 4GOPC 3UI2A 1ONLA 2L11A 1UNSA 2AKWB 2JA9A 1PTOH 2PPBC 2A19A 1CKMA 4DKAC 1JOOA 2K33A 1VQGA 1QE6A 2I07B 1H9MA 3J7AF 4QY7A 4DV2L 1LO5D 4XQJA 2FJ2A 1Y69U 1BBWA 3H09A 5I9PA 2JK8A 5FJ8H 2L12A 1PTOB 3FDTA 1ENAA 1TS5A 2EVBA 2M2LA 5G3LD 2M00A 4DR2Q 3M4PA 1S5BD 5C4HA 2IX0A 5D65A 1V43A 1HNZL 1JJ2A 2JA6H 1QZHA 2YU9B 3C2PA 3KOJA 3SDZA 3GTJH 1XNQL 4ZKBB 3HOXH 4PMBA 4TSSA 3J80i 3NK9A 2A1AA 4RHRA 1EYGA 3KBGA 5C3XA 4DV6L 4DV7Q 3I55A 1IW7D 1HH2P 2F3IA 1VQCA 1TVXA 3S17B 4XDXA 3TN2A 4C56C 4DR7L 2Z0SA 5D14A 3GTJB 2K75A 1SNDA 4FF2A 4HCEA 1TR5A 2O5IC 1FD7D 3HOXB 2R3ZA 3CRLC 1ZKOA 1D5ZC 3MC0B 1GJXA 4ZAIA 2YTVA 1LUZA 3LWEA 2IWHA 5IT9E 1SYBA 2OTJA 3HZXA 2CQAA 1EIFA 2D9UA 5JVH3 2SOBA 1PRTD 5A2QL 3S16H 2G5DA 4IFDI 3I56A 3W5OA 3RZDB 1G8ZD 2ZJPA 2NVTH 1PFMA 3R8BA 1JC7A 4GN4B 3DMUA 4DR5Q 3I91A 4RAUC 4IPHA 1S4ZA 3HEJA 1Q86C 1CM9A 1KAAA 1KNAA 2C9OA 4PMWA 2RDGA 1A2UA 3P20A 3E6ZX 3J81c 4RGOS 1XMOL 4K6DA 4DR6Q 1SYEA 1VQ6A 2R93G 2NVTB 4KV6A 2A68C 2PO4A 2XSCA 5C4XB 1H9KA 4R4IA 5LMUQ 4HN7A 2VXWA 1G2SA 1E1OA 5CORA 1T5XD 3S1NH 2K1BA 2RKSA 2A69C 3KF6A 1T5EA 3MXNA 3MFGA 5IGEA 4IO9A 3BZKA 1QNKA 3HOZG 4RFBA 4L8JA 1VQ9A 1SN8A 4JI3L 3PF5A 5KYLA 3NXWA 3ZJYC 1NSNS 3J81L 1QB5D 1EQTA 1RTOA 1IBKQ 5JJKA 3J81i 2K7VA 2K14A 1JE5A 2NUCA 2UUBL 1UE7A 2F0LA 1I6HB 5M5WH 5JVG3 2M9VA 4A3MH 1CKNB 2OT2A 4EQNA 5IWAQ 4A3DH 1WVLA 4XQNA 4A3KG 1S3OA 1HZAA 2WB1E 1XX8A 4J8QA 5T1IA 4CKCA 3GTMB 2ICEC 3S15H 5M5WB 2B8GA 4QQBX 4A3MB 4C2MH 3WOEA 4A3DB 4JC0A 4C3HH 2F0UA 5BN3A 2O5JC 4DV4L 4A3GG 1JCKB 1I4QA 2F0KA 1B9MA 1VCIA 2UXCQ 4DR3Q 3A54A 4RWSC 3G4SA 4B3MQ 3K8AA 4LW1A 3S15B 5LHY1 4A3IG 2OWOA 2N49A 3HOWG 3I4MB 4C3IB 2RSOA 4YWLA 1NUCA 4JI6L 5C4JH 1PH8A 1TWFH 4C3HB 4IUNA 1L2FA 4YCVA 2BCOA 3GTKB 4BBRH 2NB0A 4GKKL 1FNWA 3D4WA 2R7DA 1PTOD 4R8NA 1SBBB 2K5NA 5IYBH 4GOPB 4CJ0B 5C4JB 5LL6S 4J1MA 5IOCA 1QCBD 1VMCA 4BBRB 1I4RA 1JR0D 3H94A 4NXML 1WD0A 4BXXH 3U9SA 3T1YL 3CCUA 2ES2A 2KECA 3BS1A 4WORA 4BA2I 5IGFA 5CYUA 1ZYRC 4KKTA 2A5HA 2FXQA 3I90A 2JA5G 2JA7G 1CUKA 1IBML 4DAPA 2QW7A 4X62Q 1E0BA 2V1CC 4XT3B 3FP9A 4A3FG 3H15A 1HUNA 1AFPA 3T4AC 3V96A 1KDBA 2F0HA 2F0EA 1NE3A 2N88A 4KKUA 2ZJRA 4Q5VA 3EN2A 2L9HA 5FO7B 2WP8J 4APVA 3VR3A 1GXDC 2MUYA 1K0SA 2LSSA 3QOLA 5D3DA 5CGKA 2LXKA 4IPGA 1WTVA 5AJ3Q 4QGUA 3VR6A 1N32Q 2I5MX 1WTXA 2PNHA 4RHSA 1VQJA 3DWPA 4OL7A 1IKMA 1X9NA 4NXNQ 1HA5A 4LF5Q 1PZKD 5DLQE 4KN4C 1B70B 1FJGL 1QUQB 4QMGA 1EU3A 2B2UC 4XTCS 5EPLA 1WTWA 3OSOA 3BDLA 3GV6A 3RLFA 3UDFA 3LNNA 2KHSA 1B3AA 4A3JB 1S5DD 1PH7A 3S1RH 1C48A 2XN9C 4UP7A 1V1QA 4U673 3H3VI 2OEOA 3CPFA 1IBLQ 4LUVA 3PIO3 4A3IB 4DV1L 5M9OA 1YI2A 3G6JB 5IE8A 4B3RL 1FGBD 2IPKD 1HZ9A 2QILA 2XIWA 4B3TQ 1WFQA 2MFIA 4X65L 3D4RA 1Z7TA 1HQRD 1X32A 1YHQA 4L6TB 3OYYA 2QF7A 1STBA 3F2UA 4QUFA 4IOAA 2BDNA 3I7FA 2CCZA 1IYJB 3GO5A 3D6WA 1FYCA 1STNA 2G9DA 2RCFA 3SK4A 3W2DA 1K8GA 2CW0D 2KCNA 3K5NA 3HOYH 3K0YA 1PV4A 3CAMA 1YNNC 1WTOA 2K5HA 2R93H 3L0OA 3BYTB 1PFBA 1GUTA 4JI2Q 4QIWB 1EQQA 1SEBD 1EUJA 3M85A 1GUWA 4DV3Q 1CZGA 1RODA 3CC4A 1KNEA 3GTLH 4HIMA 5FJ8G 3HOYB 1BCPF 4HIKA 4NMZA 2HDMA 4DUZL 3CP0A 4IUTA 2R61A 4OEMB 2VQEQ 3A56A 1TWGB 4HTHA 3HOZH 5DEHA 4CDCC 5HGQA 3TP6A 4FXDA 1VQIA 3OMGA 4JW0A 3GTLB 3HOXG 4H13C 3S2HH 1SSOA 1TXYA 1U5KA 4ILWA 2NVQB 1G291 2F0OA 5ELFA 2F0JA 2Q2UA 1NTGA 3CCSA 1T9HA 1NBWA 1K0RA 1X55A 2LFNA 4X66L 1KTKA 1YNJD 1O80A 1PH1A 1QZGA 4DV6Q 5KYIA 3S2HB 3S14B 1JQYD 2HQEA 4X3SA 3S1MB 1RD9D 3GTGB 4A3KH 4A3LH 4DUYQ 3HP3A 3GTPH 5IYDH 1KC8C 3NQTA 5JAVA 4Y52H 2E76C 2H1EA 1EIGA 5C0XG 1G51A 2QEXA 1I94Q 1J9OA 2F4VL 1NAPA 3FKIB 5EJWA 4PV1C 1HFGA 4DXFA 1BBXC 4FVMA 3QO2A 5EPJA 4LFCL 4GOPA 1MHWC 4NPSA 5EKIA 1CHPD 3I73A 3P75A 3PUXA 2VUMH 3GTPB 4A3GH 5C4XG 3J7ZC 2P5ZX 2RDFA 1RIPA 1ZEQX 4NW2A 4TKOB 1HNWQ 5F2DA 1EY0A 2KEEA 4HSPA 2F4IA 3ICEA 1K8AC 4BY7H 3AU7A 3V05A 4JI8L 2L1BA 5C3EH 1EYCA 3P1HA 4XYQA 4CKEA 5IGBA 4A3BB 3TS0A 2VUMB 4A3GB 4POGA 4OGQC 5HGTA 3E0JA 1VQPA 2EY6A 1UWVA 3D31A 3LX0A 2D2CC 2EYJA 1QG7A 3G7LA 4QJFA 4BY7B 2E2JB 3K58A 1XMQQ 1E1TA 5C3EB 1S40A 2D0OA 1PH5A 1CK1A 2N3SA 3DEOA 4JI5Q 1EY4A 4QCLA 5J22A 5DNFA 4KHPL 1XNRL 2IJ0A 4IUPA 4XT1B 2F0NA 2FFKB 5E3FA 1KDCA 1O7LA 3KLWA 1M8AA 1YVCA 3W3AA 1MJEA 3M3YB 3BDCA 1DOLA 1ET9A 2EDGA 1A63A 2VS1A 3VR5A 5C44H 4YHHL 1E22A 3CXCA 4M8AA 5LMNQ 1FR3A 3NSWA 4A3DG 2BA1A 1GM5A 1EZ6A 4BBSH 4JV5L 2ZXRA 2A6HD 4I65A 2B3GA 1KABA 5FLMG 1N9WA 2F0TA 2UUBQ 2AMCB 1I3QH 4HJ8A 1CT1D 5C44B 2UXBL 2PMZB 3TZDA 4ZK9B 3SK6A 1AZQA 3I4MG 4C3IG 1M1KC 5TSSA 2N78A 5ELBA 4C3HG 4OWWB 1QUQA 1FNVA 4ME3A 4BBSB 2A8VA 3NENA 3QJYA 1Y1VH 2EYHA 2CH4W 4R4CA 4V0BA 2IHEA 1VQFA 5IY0A 3L2PA 4RGTA 5GAGC 5K36H 1TQOA 3FEWX 2KQ3A 4BBRG 4P71A 1Q7YC 1K3BC 2EZVA 1Y1VB 3RZOH 3IFTA 5EPKA 2DNEA 3NELA 1KAWA 1EOTA 5IP9G 2C35B 2C5CA 4BWGB 1NMGA 1N36Q 1Y8OB 1HTPA 4F7XA 5IYBG 1A0IA 1ILQA 2YYZA 3JAMi 2WV6D 1IL2A 1CHQD 4ZQ3A 1JE4A 1KXLA 1FGUA 5KNCA 3GQBA 3RZOB 4BXXG 3CQZH 1I4HA 4DGZA 4OO1H 2Q8IB 4DK1A 4Y7NB 1Y1WH 1EY8A 4O42A 4V190 2NTTA 4EQPA 3BVGA 2ENBA 4OXPA 4CDDC 3NBHA 3ULJA 3HKZE 4OWTB 5E4WC 3A5UA 4KY6A 1JT8A 2J4XA 3CQZB 4JI4Q 1F2YA 4TRDA 4L5QA 1VDZA 2WKDA 1Y1WB 1XXGA 3T1HL 2KJXA 3NP8A 1A3TA 1A15A 4JBKA 2MHVA 2HCIA 4LF9L 1IBMQ 1WTHA 1SXTA 3QB3A 3C46A 1LTTD 3M4OB 3RMHA 1RL2A 5FOBB 1PH2A 2OQ0A 4KN7C 4H7BA 3VDYA 2A74C 3TMEA 5CBEE 1YJ9A 4GKJL 3J80c 2K5WA 1QVGA 1QVCA 1PYBA 2NVYH 4A93H 3H0GH 5T1GA 2ZM6Q 2UU9Q 2YU9H 4MZ9A 1EY5A 5A2QE 2NYZD 3HFZB 2EOTA 5DAUA 3J7A5 4CHTB 4A76A 1SJHD 1XPRA 5CV5A 4P2CB 2LKVA 1L1OC 1V1PB 2I46A 3M7NA 2QDBA 4KTAA 4LFAL 3RNUA 4PG3A 5ELEA 3EBEA 4AYBB 2ICIA 2MO1A 2NVYB 4A3JG 3H0GB 4IZ8A 4A93B 1EFWA 4ZUIA 3S17H 1CA6A 4OX9Q 2NZOA 1BCPC 1IZ6A 4JI1L 5EBCA 3J80L 1Q81C 4R8IA
chains in the Genus database with same CATH topology
4FDBA 1PH8A 1HR0W 1SRUA 1TWFH 3HOVG 1L2FA 4YCVA 4YWMA 1UE1A 4BBRH 2UXDQ 3PIOA 4GKKL 1PVOA 2R7DA 1IXRA 1XTDA 3PIPA 1YBYA 3JAMc 2K5NA 4P72A 3UDIA 3U4VA 1N8RC 1LM0A 1KHIA 5IYBH 3PO3H 4GOPB 3RZDH 1YZ6A 4YY3L 2Z6KC 3F1ZA 2IHFA 2KCMA 4LFBL 1A8VA 1HNXQ 2OTLA 2IT1A 1Q12A 2EIFA 4NXML 3AEVA 4BXXH 3T1YL 3CCUA 2ES2A 1MKHA 1YHBA 4LFAQ 5AJ3L 1N34Q 1WOCA 2NN6I 4LF6L 4DV4Q 1VQ5A 1M90C 1JJCB 3RR5A 4LF8Q 3S2DH 1N32L 2PMZE 5BR8L 3TEHB 4DV1Q 4HJ5A 4JYAQ 1XJVA 4BA2I 2ASBA 3J81j 1CKNA 2HIVA 2FXQA 2JA5G 1YNXA 2JA7G 1CUKA 3E9IA 4JI1Q 1UE6A 2HIXA 4P75A 3M4QA 5IP7H 5C4XH 1IBML 2E5LL 4X62Q 4JI6Q 4Y7NH 1UE5A 4X65Q 2YTYA 2V1CC 2VQFQ 1K73C 4LF9Q 1FL0A 3FP9A 2JA6G 4A3FG 4LF5L 1VQOA 3H15A 3PF4A 1KIXA 3HOYG 4GKKQ 3WWVA 1NE3A 2XGTA 1J6QA 2CQOA 3M9BA 2ZJRA 3EN2A 4HIOA 2WP8J 2NVXH 4LNQA 4APVA 5GAEC 1YJNA 4DR1L 1GD7A 4JBWA 4LWCA 4YY3Q 4X64L 3HOUG 2K4KA 5GADC 4LFBQ 1VQ4A 1GVPA 1E3PA 1PH4A 3A0JA 2LSSA 2MNAA 5M5YH 4NXMQ 4YCUA 2PQAB 2LXKA 3T1YQ 1C9OA 4IPGA 1Q82C 4L5RC 5AJ3Q 3LGJA 3CC2A 2JA6H 3M4OH 3PUVA 4QGUA 1IBLL 4LF6Q 3PO2G 1N32Q 1KL9A 5BR8Q 1SR3A 2IY5B 4JOIA 1X3FA 2I5MX 3CPWA 1I6HH 1C0AA 2PNHA 4RMFA 1VQJA 2ALYB 2I5HA 3K80C 2QA4A 4WJ4A 2K5VA 1CSQA 4KHZA 4DUZQ 1VQNA 2E5LQ 2OCEA 1D7QA 1OXTA 2B63G 3U4ZA 3AQQA 1X9NA 4JI6L 1VQLA 3K7AH 1NMFA 4NXNQ 4LF5Q 1W3SA 3GTQH 5DLQE 1B70B 5JJIA 1OXXK 4TVAB 1FJGL 3GTMH 3B6YA 2WAQE 4H02A 3FKIG 4YCWA 3I4OA 3K81C 4DNIA 2CKZB 5EAYA 5J3BA 1QUQB 1SE8A 2CWPA 3I4NG 4XTCS 4JI7Q 2L15A 3F2CA 1KQSA 4IJHA 1JB7A 3CMAA 3HOWH 4RG1A 4MTNA 4A3LG 5IYDG 1VQAA 4OONA 3RLFA 1EOVA 4A3CH 4X64Q 1Z9FA 3UDFA 4X66Q 3HOVH 5FLMH 1YITA 1AE3A 1B8AA 1K3RA 1WCMG 2I0QA 1PH7A 1HNXL 2ZTDA 5FLXc 4UP7A 3S1RH 1V1QA 4K0KL 3H3VI 2WB1G 2NN6G 3I4MH 3PUWA 3PSIA 4C3IH 3L7ZC 3JC66 2UUAL 4WJ3M 1BVSA 3CPFA 1IBLQ 1KRSA 4LUVA 4JI2L 2EQSA 1N34L 3GTKH 1VQBA 2NZHA 4A3BG 2PI2E 2VUMG 1Q1BA 4LF8L 1PYSB 1BKBA 5LMNW 4DV1L 4DV3L 3CCMA 4B3SL 4PZ7A 5ELOA 3F8TA 3GDEA 3CCEA 3PCOB 3CF5A 1YI2A 2BH2A 3CMEA 5IE8A 4B3RL 1CKOA 4DPGA 3KYHC 3SGIA 1HZ9A 5C0XI 4B3TQ 4BY7G 1TWHH 2QGQA 2RF4A 4HJ7A 2VQEL 3FHWA 1WFQA 2MFIA 3STBC 4X65L 5C3EG 2VQFL 3AFPA 4DK6C 1K9MC 4L5SA 1FJGQ 2RHSB 3W1BA 2CWAA 1YHQA 1E7ZA 1LTLA 4GN5A 3OYYA 3CCQA 1HZCA 3KDFA 2PQAA 4P74A 4IOAA 2JA5H 3I7FA 2CCZA 1IYJB 1OXVA 3GO5A 2JA7H 5IP9H 2VL6A 4UP9A 4AYBE 4MNOA 1VQ8A 4A3MG 1K8GA 2Q2TA 4IFDJ 1VQDA 4A3FH 3ERSX 5IYCG 3KF6B 3MXNB 4PZ8A 1WYDA 3BZCA 4R4OA 4HJAA 4GNXA 1PV4A 3HOYH 4K0KQ 3TS2A 1VQKA 3CAMA 3MEFA 2R92G 2UUCL 4OO1I 1TWCH 2HQLA 2K5HA 2R93H 2UUAQ 3L0OA 1HR0Q 4LF7L 4JI2Q 1I5FA 4YWKA 3DM3A 1EQQA 4GLAC 2CFMA 1EUJA 3M85A 4DUYL 3CCVA 1X54A 2MO0A 4DV3Q 3CC4A 3UDGA 4B3SQ 4DV5Q 1S72A 2PI2A 4JI0L 3GTLH 4HIMA 5FJ8G 3HOUH 4AQYL 3PGZA 4B3RQ 1PFSA 1YEZA 3OTOL 4HIKA 1LYLA 1I94L 4A3EG 5C44G 2GVBA 4UY8C 1VQHA 1C7YA 4DUZL 3CP0A 2JA8G 1L1OB 2EXDA 2VQEQ 1P8LA 3HOZH 3PO2H 2VW9A 4NXNL 4LUOA 1CSPA 2ID0A 2Y0SE 5HGQA 3D0FA 4GS3A 4GNXC 1TWAH 1D8LA 3CC7A 4BBSG 1VQIA 2GN5A 5ELNA 3U58A 1NY4A 3HOXG 1HNWL 3S2HH 3TRZA 2RCNA 1TXYA 1P16A 4JI7L 1U5KA 2R6GA 3G71A 1A62A 1G291 1YJWA 4LF4Q 2B63H 2Q2UA 1DGSA 1NTGA 3STBD 3KJOA 3CCSA 2HHHL 1T9HA 1X3GA 1ASYA 1N33L 2D62A 1NBWA 3GTOH 1K0RA 1X55A 4X66L 4JBMA 4DV0L 2ZTCA 3CD6A 2K50A 3IRBA 1SFOH 3EIVA 2UUCQ 4DAMA 3U50C 1PH1A 1QZGA 4KLKA 4HIDA 1FVIA 1Y1VG 4LF7Q 4DV6Q 1X56A 4O2DA 2R7FA 4ALPA 4R4QA 2E2HH 2KHIA 2YTXA 3DLLA 2UXBQ 5IT9c 1I50H 4A3KH 1QVFA 4A3LH 3RN2A 4DUYQ 5IYDH 3GTPH 1KC8C 4JBJA 1SMXA 4BY1H 2VNUD 4Y52H 4JI0Q 5K36G 3E9HA 1XMQL 4AQYQ 1WJJA 5C0XG 3KJPA 3OTOQ 4R1JA 1G51A 1WCMH 2QEXA 1I94Q 1PHJA 2JEAI 4JI5L 4POFA 5JEAG 1HJPA 2F4VL 4OWXB 4AIMA 2XTIA 4B3TL 3G6EA 1HZBA 2AWOA 4LFCL 4GOPA 4X6AH 2ZTEA 2Q2HA 4NPSA 2R7ZG 3KFUA 3PUXA 2VUMH 5C4XG 4A3GH 3A74A 3J7ZC 1B7YB 4A3JH 1X6OA 1HNWQ 1RIPA 3PUZA 5JJLA 4DR4L 1JJGA 1VS0A 3S24A 1MIUA 2E8GA 3ICEA 4DR2L 1K8AC 4DK3C 4BY7H 3AYHB 3Q8DA 4JOIC 3RN5A 2WAQG 4O0AA 2HHHQ 5LMNL 4QL5A 2JE6I 4A3IH 1N33Q 1Z47A 4JI8L 5C3EH 1U0LA 1Q8KA 4DV0Q 4OO1G 1EQRA 3W1GA 3TS0A 3K0XA 4POGA 3A5ZB 1Y1WG 1VQMA 3F2DA 1VQPA 1UWVA 3D31A 4GOPC 1HR0L 1JMCA 3AFQA 4DV7L 2R92H 1L0WA 4EQ5A 4QJFA 2AKWB 2JA9A 1J5EQ 1XMQQ 1E1TA 1EIYB 3PV0A 1EWIA 2KHJA 2AHOB 5IYCH 4DV5L 4PZ6A 2A19A 1CKMA 4DKAC 1S40A 4EX5A 2D0OA 1VQGA 2N3SA 1PH5A 4JI5Q 2F4VQ 4KHPL 3RLNA 1XNRL 4QY7A 4GLVB 1Q46A 1X65A 4LFCQ 2WFWA 4DV2L 3HKSA 2YV5A 1MJCA 3KLWA 1G6PA 1BBWA 1AE2A 3CW2C 2JK8A 1YVCA 5FJ8H 4DR4Q 3CCJA 1MJEA 1WI5A 1A63A 1ASZA 2VS1A 5C44H 4YHHL 4DR2Q 3M4PA 1E22A 4NB3A 3CXCA 2IX0A 5LMNQ 1KRTA 3RLOA 4JI8Q 1V43A 2KENA 1JJ2A 1HNZL 1QZHA 1GKHA 2BA1A 3KOJA 3NBHB 3GTJH 2H5XA 4A3DG 1OXSC 1SROA 1GM5A 5GQOA 4JV5L 1XNQL 4BBSH 4AYBG 1XPOA 3F2BA 4A93G 4A3CG 3H0GG 1N36L 3HOXH 4DR5L 2B3GA 5FLMG 3J80i 1N9WA 4P73A 3ULLA 2A1AA 2AMCB 1I3QH 1EYGA 2UUBQ 1TWGH 4DV6L 4HJ8A 4DV7Q 3I55A 2UXBL 1HH2P 2F3IA 4UP8A 4C3JH 4GKJQ 4JCVE 1VQCA 3I4MG 1KD1C 4DR6L 1M1KC 4DR7L 2Z0SA 2N78A 2LXJA 4HJ9A 2K75A 3H3VH 3S1QH 4OWWB 1QUQA 2AWNA 4ME3A 5M5XH 2A8VA 1Q1EA 3NENA 2N8NA 1Y1VH 5LMUL 2NVQH 4KHPQ 1XNRQ 3GD7A 4R4CA 3CCRA 1GO3E 4DV2Q 2IHEA 2E2IH 2DGYA 1VQFA 5IY0A 3L2PA 5M3FG 2YTVA 1LUZA 3K7UC 4AH6A 1BBUA 1VQ7A 1V9PA 5GAGC 2OTJA 5M3MG 2VZAA 1PA6A 4A75A 1EIFA 2JJQA 4JI4L 3S14H 2Y0SG 4QIWE 3S1MH 2K52A 4YHHQ 3ULPA 4BBRG 4XIGS 4P71A 3GTGH 1Q7YC 3S16H 4IFDI 5HY6A 3I56A 3W5OA 5GAHC 1HNZQ 3RZOH 2ZJPA 2BA0A 2NVTH 3UDXA 2R7ZH 3NELA 1KAWA 4IPCA 4GN4B 5IP9G 2C35B 1XNQQ 4JV5Q 1IBKL 1NMGA 1N36Q 4DR5Q 3FKIH 2GVAA 2B29A 4IPHA 5IYBG 1Q86C 3PO3G 1A0IA 2YYZA 2ZJQA 3JAMi 3I4NH 3CCLA 1IL2A 2IX1A 4PMWA 3NEMA 4IPDA 4JG2A 1KXLA 3J81c 1FGUA 2F52A 1VQEA 4GLXA 1XMOL 2R93G 4DR6Q 1VQ6A 4DR7Q 5IWAL 4BXXG 1J5EL 3CQZH 1OXUA 1OTCA 4A4IA 1K83H 1PH6A 2BH8A 4R4IA 1Y1WH 5LMUQ 4IOCA 2ZM6L 2UU9L 5H1SE 4LUZA 1E1OA 4OXPA 3UE0A 4J15A 3ULJA 3HKZE 4OWTB 3S1NH 1YIJA 3KDFB 1X3EA 5IP7G 3KF6A 3A5UA 4A3BH 1JT8A 2ATWA 4IO9A 4L5TA 3BZKA 3HOZG 2I5LX 4JI4Q 3HKZG 4L5QA 3E0EA 2Q2IA 3TREA 1VQ9A 1SN8A 4JI3L 3PF5A 2E2JH 2UXCL 3T1HL 4DR3L 4GNXB 3ZJYC 4JBKA 4LF9L 4OX9L 3TQYA 3BU2A 1IBMQ 4B3ML 2JEBI 4UPAA 1IBKQ 4GN3B 5JJKA 3J81i 3PUYA 2OQKA 4R4TA 5C0XJ 2K14A 1RL2A 1JE5A 1UEBA 1L1OA 1PH2A 2KCTA 2JQOA 5JEAJ 2OQ0A 2UUBL 4A93H 1UE7A 5M5WH 3VDYA 1XMOQ 2UXDL 1AH9A 1YJ9A 4A3MH 1CKNB 4GKJL 5IWAQ 4A3DH 3I2ZA 3J80c 4DAYB 1W2BA 4KI0A 3M3YH 1QVGA 2MQHA 4A3KG 1QVCA 1PYBA 4DR1Q 2NVYH 3G48A 4BY1G 1Y14B 1S3OA 3H0GH 2HT1A 1HZAA 2WB1E 2ZM6Q 1E24A 2UU9Q 5GROA 1O7IA 2RHQB 1H95A 2YU9H 2DUDA 1XPUA 4MZ9A 3S15H 3HFZB 3J7A5 4A76A 4IJLA 4QQBX 4C2MH 1XPRA 1L1OC 3UE1A 3M7NA 4IFDG 4JC0A 5E7NA 4C3HH 1PH3A 4LFAL 3KF8B 4PG3A 4DV4L 3RNUA 3ER0A 1YHAA 3EBEA 1PH9A 3OW2A 4A3GG 2MO1A 4A3EH 4A3JG 4JI3Q 2VY3A 2JA8H 1EFWA 4JYAL 2UXCQ 1VCIA 3T1HQ 3BJUA 4DR3Q 4LF4L 3S17H 1SLJA 3G4SA 2Z6KA 2NZOA 4B3MQ 4OX9Q 3K8AA 2D0PA 4LW1A 1IZ6A 5M3FH 4TQUS 1R9TH 4JI1L 2OWOA 2N49A 1Q81C 1NJIC 3HOWG 2KBNA 4BA1I 4YWLA 4X62L 5M3MH 4A3IG 5C4JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FDB A;  1PH8 A;  1HR0 W;  1SRU A;  1TWF H;  3HOV G;  1L2F A;  4YCV A;  4YWM A;  1UE1 A;  4BBR H;  2UXD Q;  3PIO A;  4GKK L;  1PVO A;  2R7D A;  1IXR A;  1XTD A;  3PIP A;  1YBY A;  3JAM c;  2K5N A;  4P72 A;  3UDI A;  3U4V A;  1N8R C;  1LM0 A;  1KHI A;  5IYB H;  3PO3 H;  4GOP B;  3RZD H;  1YZ6 A;  4YY3 L;  2Z6K C;  3F1Z A;  2IHF A;  2KCM A;  4LFB L;  1A8V A;  1HNX Q;  2OTL A;  2IT1 A;  1Q12 A;  2EIF A;  4NXM L;  3AEV A;  4BXX H;  3T1Y L;  3CCU A;  2ES2 A;  1MKH A;  1YHB A;  4LFA Q;  5AJ3 L;  1N34 Q;  1WOC A;  2NN6 I;  4LF6 L;  4DV4 Q;  1VQ5 A;  1M90 C;  1JJC B;  3RR5 A;  4LF8 Q;  3S2D H;  1N32 L;  2PMZ E;  5BR8 L;  3TEH B;  4DV1 Q;  4HJ5 A;  4JYA Q;  1XJV A;  4BA2 I;  2ASB A;  3J81 j;  1CKN A;  2HIV A;  2FXQ A;  2JA5 G;  1YNX A;  2JA7 G;  1CUK A;  3E9I A;  4JI1 Q;  1UE6 A;  2HIX A;  4P75 A;  3M4Q A;  5IP7 H;  5C4X H;  1IBM L;  2E5L L;  4X62 Q;  4JI6 Q;  4Y7N H;  1UE5 A;  4X65 Q;  2YTY A;  2V1C C;  2VQF Q;  1K73 C;  4LF9 Q;  1FL0 A;  3FP9 A;  2JA6 G;  4A3F G;  4LF5 L;  1VQO A;  3H15 A;  3PF4 A;  1KIX A;  3HOY G;  4GKK Q;  3WWV A;  1NE3 A;  2XGT A;  1J6Q A;  2CQO A;  3M9B A;  2ZJR A;  3EN2 A;  4HIO A;  2WP8 J;  2NVX H;  4LNQ A;  4APV A;  5GAE C;  1YJN A;  4DR1 L;  1GD7 A;  4JBW A;  4LWC A;  4YY3 Q;  4X64 L;  3HOU G;  2K4K A;  5GAD C;  4LFB Q;  1VQ4 A;  1GVP A;  1E3P A;  1PH4 A;  3A0J A;  2LSS A;  2MNA A;  5M5Y H;  4NXM Q;  4YCU A;  2PQA B;  2LXK A;  3T1Y Q;  1C9O A;  4IPG A;  1Q82 C;  4L5R C;  5AJ3 Q;  3LGJ A;  3CC2 A;  2JA6 H;  3M4O H;  3PUV A;  4QGU A;  1IBL L;  4LF6 Q;  3PO2 G;  1N32 Q;  1KL9 A;  5BR8 Q;  1SR3 A;  2IY5 B;  4JOI A;  1X3F A;  2I5M X;  3CPW A;  1I6H H;  1C0A A;  2PNH A;  4RMF A;  1VQJ A;  2ALY B;  2I5H A;  3K80 C;  2QA4 A;  4WJ4 A;  2K5V A;  1CSQ A;  4KHZ A;  4DUZ Q;  1VQN A;  2E5L Q;  2OCE A;  1D7Q A;  1OXT A;  2B63 G;  3U4Z A;  3AQQ A;  1X9N A;  4JI6 L;  1VQL A;  3K7A H;  1NMF A;  4NXN Q;  4LF5 Q;  1W3S A;  3GTQ H;  5DLQ E;  1B70 B;  5JJI A;  1OXX K;  4TVA B;  1FJG L;  3GTM H;  3B6Y A;  2WAQ E;  4H02 A;  3FKI G;  4YCW A;  3I4O A;  3K81 C;  4DNI A;  2CKZ B;  5EAY A;  5J3B A;  1QUQ B;  1SE8 A;  2CWP A;  3I4N G;  4XTC S;  4JI7 Q;  2L15 A;  3F2C A;  1KQS A;  4IJH A;  1JB7 A;  3CMA A;  3HOW H;  4RG1 A;  4MTN A;  4A3L G;  5IYD G;  1VQA A;  4OON A;  3RLF A;  1EOV A;  4A3C H;  4X64 Q;  1Z9F A;  3UDF A;  4X66 Q;  3HOV H;  5FLM H;  1YIT A;  1AE3 A;  1B8A A;  1K3R A;  1WCM G;  2I0Q A;  1PH7 A;  1HNX L;  2ZTD A;  5FLX c;  4UP7 A;  3S1R H;  1V1Q A;  4K0K L;  3H3V I;  2WB1 G;  2NN6 G;  3I4M H;  3PUW A;  3PSI A;  4C3I H;  3L7Z C;  3JC6 6;  2UUA L;  4WJ3 M;  1BVS A;  3CPF A;  1IBL Q;  1KRS A;  4LUV A;  4JI2 L;  2EQS A;  1N34 L;  3GTK H;  1VQB A;  2NZH A;  4A3B G;  2PI2 E;  2VUM G;  1Q1B A;  4LF8 L;  1PYS B;  1BKB A;  5LMN W;  4DV1 L;  4DV3 L;  3CCM A;  4B3S L;  4PZ7 A;  5ELO A;  3F8T A;  3GDE A;  3CCE A;  3PCO B;  3CF5 A;  1YI2 A;  2BH2 A;  3CME A;  5IE8 A;  4B3R L;  1CKO A;  4DPG A;  3KYH C;  3SGI A;  1HZ9 A;  5C0X I;  4B3T Q;  4BY7 G;  1TWH H;  2QGQ A;  2RF4 A;  4HJ7 A;  2VQE L;  3FHW A;  1WFQ A;  2MFI A;  3STB C;  4X65 L;  5C3E G;  2VQF L;  3AFP A;  4DK6 C;  1K9M C;  4L5S A;  1FJG Q;  2RHS B;  3W1B A;  2CWA A;  1YHQ A;  1E7Z A;  1LTL A;  4GN5 A;  3OYY A;  3CCQ A;  1HZC A;  3KDF A;  2PQA A;  4P74 A;  4IOA A;  2JA5 H;  3I7F A;  2CCZ A;  1IYJ B;  1OXV A;  3GO5 A;  2JA7 H;  5IP9 H;  2VL6 A;  4UP9 A;  4AYB E;  4MNO A;  1VQ8 A;  4A3M G;  1K8G A;  2Q2T A;  4IFD J;  1VQD A;  4A3F H;  3ERS X;  5IYC G;  3KF6 B;  3MXN B;  4PZ8 A;  1WYD A;  3BZC A;  4R4O A;  4HJA A;  4GNX A;  1PV4 A;  3HOY H;  4K0K Q;  3TS2 A;  1VQK A;  3CAM A;  3MEF A;  2R92 G;  2UUC L;  4OO1 I;  1TWC H;  2HQL A;  2K5H A;  2R93 H;  2UUA Q;  3L0O A;  1HR0 Q;  4LF7 L;  4JI2 Q;  1I5F A;  4YWK A;  3DM3 A;  1EQQ A;  4GLA C;  2CFM A;  1EUJ A;  3M85 A;  4DUY L;  3CCV A;  1X54 A;  2MO0 A;  4DV3 Q;  3CC4 A;  3UDG A;  4B3S Q;  4DV5 Q;  1S72 A;  2PI2 A;  4JI0 L;  3GTL H;  4HIM A;  5FJ8 G;  3HOU H;  4AQY L;  3PGZ A;  4B3R Q;  1PFS A;  1YEZ A;  3OTO L;  4HIK A;  1LYL A;  1I94 L;  4A3E G;  5C44 G;  2GVB A;  4UY8 C;  1VQH A;  1C7Y A;  4DUZ L;  3CP0 A;  2JA8 G;  1L1O B;  2EXD A;  2VQE Q;  1P8L A;  3HOZ H;  3PO2 H;  2VW9 A;  4NXN L;  4LUO A;  1CSP A;  2ID0 A;  2Y0S E;  5HGQ A;  3D0F A;  4GS3 A;  4GNX C;  1TWA H;  1D8L A;  3CC7 A;  4BBS G;  1VQI A;  2GN5 A;  5ELN A;  3U58 A;  1NY4 A;  3HOX G;  1HNW L;  3S2H H;  3TRZ A;  2RCN A;  1TXY A;  1P16 A;  4JI7 L;  1U5K A;  2R6G A;  3G71 A;  1A62 A;  1G29 1;  1YJW A;  4LF4 Q;  2B63 H;  2Q2U A;  1DGS A;  1NTG A;  3STB D;  3KJO A;  3CCS A;  2HHH L;  1T9H A;  1X3G A;  1ASY A;  1N33 L;  2D62 A;  1NBW A;  3GTO H;  1K0R A;  1X55 A;  4X66 L;  4JBM A;  4DV0 L;  2ZTC A;  3CD6 A;  2K50 A;  3IRB A;  1SFO H;  3EIV A;  2UUC Q;  4DAM A;  3U50 C;  1PH1 A;  1QZG A;  4KLK A;  4HID A;  1FVI A;  1Y1V G;  4LF7 Q;  4DV6 Q;  1X56 A;  4O2D A;  2R7F A;  4ALP A;  4R4Q A;  2E2H H;  2KHI A;  2YTX A;  3DLL A;  2UXB Q;  5IT9 c;  1I50 H;  4A3K H;  1QVF A;  4A3L H;  3RN2 A;  4DUY Q;  5IYD H;  3GTP H;  1KC8 C;  4JBJ A;  1SMX A;  4BY1 H;  2VNU D;  4Y52 H;  4JI0 Q;  5K36 G;  3E9H A;  1XMQ L;  4AQY Q;  1WJJ A;  5C0X G;  3KJP A;  3OTO Q;  4R1J A;  1G51 A;  1WCM H;  2QEX A;  1I94 Q;  1PHJ A;  2JEA I;  4JI5 L;  4POF A;  5JEA G;  1HJP A;  2F4V L;  4OWX B;  4AIM A;  2XTI A;  4B3T L;  3G6E A;  1HZB A;  2AWO A;  4LFC L;  4GOP A;  4X6A H;  2ZTE A;  2Q2H A;  4NPS A;  2R7Z G;  3KFU A;  3PUX A;  2VUM H;  5C4X G;  4A3G H;  3A74 A;  3J7Z C;  1B7Y B;  4A3J H;  1X6O A;  1HNW Q;  1RIP A;  3PUZ A;  5JJL A;  4DR4 L;  1JJG A;  1VS0 A;  3S24 A;  1MIU A;  2E8G A;  3ICE A;  4DR2 L;  1K8A C;  4DK3 C;  4BY7 H;  3AYH B;  3Q8D A;  4JOI C;  3RN5 A;  2WAQ G;  4O0A A;  2HHH Q;  5LMN L;  4QL5 A;  2JE6 I;  4A3I H;  1N33 Q;  1Z47 A;  4JI8 L;  5C3E H;  1U0L A;  1Q8K A;  4DV0 Q;  4OO1 G;  1EQR A;  3W1G A;  3TS0 A;  3K0X A;  4POG A;  3A5Z B;  1Y1W G;  1VQM A;  3F2D A;  1VQP A;  1UWV A;  3D31 A;  4GOP C;  1HR0 L;  1JMC A;  3AFQ A;  4DV7 L;  2R92 H;  1L0W A;  4EQ5 A;  4QJF A;  2AKW B;  2JA9 A;  1J5E Q;  1XMQ Q;  1E1T A;  1EIY B;  3PV0 A;  1EWI A;  2KHJ A;  2AHO B;  5IYC H;  4DV5 L;  4PZ6 A;  2A19 A;  1CKM A;  4DKA C;  1S40 A;  4EX5 A;  2D0O A;  1VQG A;  2N3S A;  1PH5 A;  4JI5 Q;  2F4V Q;  4KHP L;  3RLN A;  1XNR L;  4QY7 A;  4GLV B;  1Q46 A;  1X65 A;  4LFC Q;  2WFW A;  4DV2 L;  3HKS A;  2YV5 A;  1MJC A;  3KLW A;  1G6P A;  1BBW A;  1AE2 A;  3CW2 C;  2JK8 A;  1YVC A;  5FJ8 H;  4DR4 Q;  3CCJ A;  1MJE A;  1WI5 A;  1A63 A;  1ASZ A;  2VS1 A;  5C44 H;  4YHH L;  4DR2 Q;  3M4P A;  1E22 A;  4NB3 A;  3CXC A;  2IX0 A;  5LMN Q;  1KRT A;  3RLO A;  4JI8 Q;  1V43 A;  2KEN A;  1JJ2 A;  1HNZ L;  1QZH A;  1GKH A;  2BA1 A;  3KOJ A;  3NBH B;  3GTJ H;  2H5X A;  4A3D G;  1OXS C;  1SRO A;  1GM5 A;  5GQO A;  4JV5 L;  1XNQ L;  4BBS H;  4AYB G;  1XPO A;  3F2B A;  4A93 G;  4A3C G;  3H0G G;  1N36 L;  3HOX H;  4DR5 L;  2B3G A;  5FLM G;  3J80 i;  1N9W A;  4P73 A;  3ULL A;  2A1A A;  2AMC B;  1I3Q H;  1EYG A;  2UUB Q;  1TWG H;  4DV6 L;  4HJ8 A;  4DV7 Q;  3I55 A;  2UXB L;  1HH2 P;  2F3I A;  4UP8 A;  4C3J H;  4GKJ Q;  4JCV E;  1VQC A;  3I4M G;  1KD1 C;  4DR6 L;  1M1K C;  4DR7 L;  2Z0S A;  2N78 A;  2LXJ A;  4HJ9 A;  2K75 A;  3H3V H;  3S1Q H;  4OWW B;  1QUQ A;  2AWN A;  4ME3 A;  5M5X H;  2A8V A;  1Q1E A;  3NEN A;  2N8N A;  1Y1V H;  5LMU L;  2NVQ H;  4KHP Q;  1XNR Q;  3GD7 A;  4R4C A;  3CCR A;  1GO3 E;  4DV2 Q;  2IHE A;  2E2I H;  2DGY A;  1VQF A;  5IY0 A;  3L2P A;  5M3F G;  2YTV A;  1LUZ A;  3K7U C;  4AH6 A;  1BBU A;  1VQ7 A;  1V9P A;  5GAG C;  2OTJ A;  5M3M G;  2VZA A;  1PA6 A;  4A75 A;  1EIF A;  2JJQ A;  4JI4 L;  3S14 H;  2Y0S G;  4QIW E;  3S1M H;  2K52 A;  4YHH Q;  3ULP A;  4BBR G;  4XIG S;  4P71 A;  3GTG H;  1Q7Y C;  3S16 H;  4IFD I;  5HY6 A;  3I56 A;  3W5O A;  5GAH C;  1HNZ Q;  3RZO H;  2ZJP A;  2BA0 A;  2NVT H;  3UDX A;  2R7Z H;  3NEL A;  1KAW A;  4IPC A;  4GN4 B;  5IP9 G;  2C35 B;  1XNQ Q;  4JV5 Q;  1IBK L;  1NMG A;  1N36 Q;  4DR5 Q;  3FKI H;  2GVA A;  2B29 A;  4IPH A;  5IYB G;  1Q86 C;  3PO3 G;  1A0I A;  2YYZ A;  2ZJQ A;  3JAM i;  3I4N H;  3CCL A;  1IL2 A;  2IX1 A;  4PMW A;  3NEM A;  4IPD A;  4JG2 A;  1KXL A;  3J81 c;  1FGU A;  2F52 A;  1VQE A;  4GLX A;  1XMO L;  2R93 G;  4DR6 Q;  1VQ6 A;  4DR7 Q;  5IWA L;  4BXX G;  1J5E L;  3CQZ H;  1OXU A;  1OTC A;  4A4I A;  1K83 H;  1PH6 A;  2BH8 A;  4R4I A;  1Y1W H;  5LMU Q;  4IOC A;  2ZM6 L;  2UU9 L;  5H1S E;  4LUZ A;  1E1O A;  4OXP A;  3UE0 A;  4J15 A;  3ULJ A;  3HKZ E;  4OWT B;  3S1N H;  1YIJ A;  3KDF B;  1X3E A;  5IP7 G;  3KF6 A;  3A5U A;  4A3B H;  1JT8 A;  2ATW A;  4IO9 A;  4L5T A;  3BZK A;  3HOZ G;  2I5L X;  4JI4 Q;  3HKZ G;  4L5Q A;  3E0E A;  2Q2I A;  3TRE A;  1VQ9 A;  1SN8 A;  4JI3 L;  3PF5 A;  2E2J H;  2UXC L;  3T1H L;  4DR3 L;  4GNX B;  3ZJY C;  4JBK A;  4LF9 L;  4OX9 L;  3TQY A;  3BU2 A;  1IBM Q;  4B3M L;  2JEB I;  4UPA A;  1IBK Q;  4GN3 B;  5JJK A;  3J81 i;  3PUY A;  2OQK A;  4R4T A;  5C0X J;  2K14 A;  1RL2 A;  1JE5 A;  1UEB A;  1L1O A;  1PH2 A;  2KCT A;  2JQO A;  5JEA J;  2OQ0 A;  2UUB L;  4A93 H;  1UE7 A;  5M5W H;  3VDY A;  1XMO Q;  2UXD L;  1AH9 A;  1YJ9 A;  4A3M H;  1CKN B;  4GKJ L;  5IWA Q;  4A3D H;  3I2Z A;  3J80 c;  4DAY B;  1W2B A;  4KI0 A;  3M3Y H;  1QVG A;  2MQH A;  4A3K G;  1QVC A;  1PYB A;  4DR1 Q;  2NVY H;  3G48 A;  4BY1 G;  1Y14 B;  1S3O A;  3H0G H;  2HT1 A;  1HZA A;  2WB1 E;  2ZM6 Q;  1E24 A;  2UU9 Q;  5GRO A;  1O7I A;  2RHQ B;  1H95 A;  2YU9 H;  2DUD A;  1XPU A;  4MZ9 A;  3S15 H;  3HFZ B;  3J7A 5;  4A76 A;  4IJL A;  4QQB X;  4C2M H;  1XPR A;  1L1O C;  3UE1 A;  3M7N A;  4IFD G;  4JC0 A;  5E7N A;  4C3H H;  1PH3 A;  4LFA L;  3KF8 B;  4PG3 A;  4DV4 L;  3RNU A;  3ER0 A;  1YHA A;  3EBE A;  1PH9 A;  3OW2 A;  4A3G G;  2MO1 A;  4A3E H;  4A3J G;  4JI3 Q;  2VY3 A;  2JA8 H;  1EFW A;  4JYA L;  2UXC Q;  1VCI A;  3T1H Q;  3BJU A;  4DR3 Q;  4LF4 L;  3S17 H;  1SLJ A;  3G4S A;  2Z6K A;  2NZO A;  4B3M Q;  4OX9 Q;  3K8A A;  2D0P A;  4LW1 A;  1IZ6 A;  5M3F H;  4TQU S;  1R9T H;  4JI1 L;  2OWO A;  2N49 A;  1Q81 C;  1NJI C;  3HOW G;  2KBN A;  4BA1 I;  4YWL A;  4X62 L;  5M3M H;  4A3I G;  5C4J H; 
#chains in the Genus database with same CATH topology
 4FDB A;  1HR0 W;  1SRU A;  3QWN A;  1UE1 A;  1WTQ A;  2UXD Q;  3FVQ A;  4L63 B;  1H9S B;  3PIP A;  2HDL A;  1YBY A;  5CV4 A;  4UHV A;  3UDI A;  1N8R C;  1TWH B;  2F0W A;  4N9T A;  1KHI A;  5CV9 A;  3MAQ A;  1JWU D;  1PRT F;  3X3M A;  3PO3 H;  3MEH A;  3RZD H;  1YZ6 A;  2Z6K C;  4F87 A;  3K5L A;  2Y0S B;  3FPU B;  2LMC B;  3EFX D;  3OIP A;  3I4L A;  1SDF A;  2IT1 A;  1TII D;  4N9P A;  1Q12 A;  1TS2 A;  3OOC A;  1YHB A;  5C0X H;  4LF6 L;  1VQ5 A;  3RR5 A;  5BR8 L;  4DV1 Q;  3K5O A;  4HJ5 A;  4JYA Q;  1PZI D;  3PO3 B;  2ASB A;  3X3N A;  1SE2 A;  2HIV A;  1SYG A;  1I4G A;  3E9I A;  1UE6 A;  4P75 A;  5IP7 H;  3DXJ C;  2E5L L;  5C4X H;  3R2I A;  2Q8R E;  4X65 Q;  3RD4 A;  2YTY A;  1VQO A;  1KIX A;  3HOY G;  4O1N A;  1ESR A;  5A35 A;  5IGG A;  3WWV A;  4K8I A;  2SNM A;  1ET6 A;  4MN3 A;  2NVX H;  4LNQ A;  1GD7 A;  4YY3 Q;  4X64 L;  2K4K A;  4RKB A;  5KEE A;  4LFB Q;  3HKZ B;  3AB9 A;  4DN4 M;  4YCU A;  4KKS A;  1U4L A;  1Q82 C;  1EY9 A;  3LGJ A;  2SNS A;  2B2U A;  1SR3 A;  2IY5 B;  1I6H H;  2NVX B;  2I5H A;  3K80 C;  2K5V A;  3Q22 A;  1CSQ A;  4K5W A;  4DUZ Q;  1HPC A;  4PNY A;  1LTR D;  3U4Z A;  4OHJ A;  2RQX A;  1IHZ A;  1EQV A;  3TBI B;  1I50 B;  1BNZ A;  1E2W A;  2SDF A;  5JJI A;  4BY1 B;  2K5D A;  3GTM H;  2WAQ E;  3FKI G;  4YCW A;  3I4O A;  2JN4 A;  1VF5 C;  3CMA A;  4A3L G;  4MTN A;  5IYD G;  4ZUJ A;  4X66 Q;  2EJG C;  5FLM H;  1AE3 A;  5IGD A;  1K3R A;  1HNX L;  2A6E C;  4LJZ C;  5CMD A;  1SE3 A;  2NN6 G;  3I4M H;  3PUW A;  4C3I H;  2L4N A;  4WJ3 M;  1KRS A;  2RSN A;  2EQS A;  3GTK H;  4A3B G;  2PI2 E;  2VUM G;  1B2T A;  4LF8 L;  1K8M A;  4B3S L;  4LK1 C;  3CCE A;  3CF5 A;  5EKL A;  5C0X I;  2HUG A;  4BY7 G;  2QGQ A;  1LV9 A;  2NWG A;  3EVQ A;  5C3E G;  2VQF L;  1U4P A;  2F0P A;  3ONA B;  3NWT A;  1K9M C;  4L5S A;  3W1B A;  2CWA A;  1II3 A;  4ME5 A;  3ERO A;  2KUM A;  1HZC A;  5JOB A;  1CA5 A;  1SNQ A;  5IP9 H;  1L0X B;  4MNO A;  1VQ8 A;  2Z6B A;  3H6M A;  4IFD J;  3SHL A;  4F88 A;  1STG A;  3ERS X;  4PZ8 A;  3EQL C;  4K0K Q;  2WAC A;  3MEF A;  1A6X A;  1KDA A;  3A55 A;  2UUA Q;  3MZ5 A;  3IKJ A;  4GLA C;  3BZD B;  3CCV A;  1X54 A;  4IUU A;  3ERQ A;  2K04 A;  3UDG A;  1H9J A;  1S72 A;  3HOU H;  4AQY L;  3PGZ A;  4G7H C;  1PFS A;  3OTO L;  5C44 G;  4UY8 C;  1VQH A;  1X3P A;  1L1O B;  1PXU A;  3EJI A;  2OXP A;  1P8L A;  3R2T A;  3PO2 H;  2VW9 A;  1CSP A;  2B2T C;  2XRS D;  3BDO A;  4GNX C;  1GUG A;  4BBS G;  3U58 A;  1F77 A;  3VR2 A;  3HOU B;  1F2Z A;  2L55 A;  1BCP B;  3S1Q B;  3T16 A;  1SE4 A;  4FYD A;  1D6E C;  1P16 A;  1V1P A;  4JI7 L;  4HMJ A;  1DXM A;  4EGV A;  3KJO A;  3STB D;  4LMQ D;  1N33 L;  3GTO H;  2D62 A;  3Q23 A;  3PO2 B;  2E2I B;  5JJZ A;  5EGT A;  4IQZ A;  4DV0 L;  3CD6 A;  2K50 A;  2UUC Q;  4DAM A;  4BS9 A;  1Y1V G;  4LF7 Q;  1AN8 A;  1X56 A;  2E2H H;  3DLL A;  2UXB Q;  1SMY C;  4FF3 A;  3RN2 A;  3M4Y A;  1SMX A;  1D1K A;  4JI0 Q;  3I72 A;  5K36 G;  3GTO B;  3E9H A;  4K6L A;  3BVM A;  1H9S A;  1O7Z A;  1B44 D;  2JEA I;  2B2W A;  1S5F D;  3G6E A;  3I4N B;  3SE0 A;  3OWF A;  2E2H B;  1GUN A;  2PYK A;  4A3J H;  1ENC A;  4K8J A;  3O13 A;  1K83 B;  1VS0 A;  2B39 A;  3S24 A;  4DAV A;  4J6H A;  4DR2 L;  3AMU A;  5I6W A;  3Q8D A;  1IW7 C;  2WB1 B;  3RN5 A;  2HHH Q;  4A3I H;  1A3V A;  2IL8 A;  1TY2 A;  4OO1 G;  4ULL A;  1EQR A;  1STE A;  4XXE A;  1Y1W G;  1VQM A;  2HD3 A;  1HR0 L;  5C4Z A;  4DV7 L;  3NPP A;  2XRQ D;  2JYO A;  1K8O A;  3HG9 A;  1LT4 D;  2AHO B;  2L5T A;  4PZ6 A;  3GV3 A;  3OPO A;  1ML0 D;  4X3U A;  1PRT C;  2Z9H A;  5EBD A;  3DUZ A;  1X65 A;  1D5M C;  3ITP A;  3NUC A;  1G6P A;  2D5D A;  2F0D A;  3CW2 C;  4DR4 Q;  2R92 B;  1LT6 D;  4NB3 A;  3Q0A A;  1KRT A;  4LF4 L;  4LF9 Q;  1F2L A;  2KEN A;  3NBH B;  3SXH A;  2PZW A;  1L0Y B;  1D5X C;  1OXS C;  5GQO A;  5CC4 A;  4AYB G;  2B2V C;  1G6Z A;  4A93 G;  3H0G G;  4QB4 A;  4DR5 L;  1RKN A;  3ULL A;  4P73 A;  1TWG H;  3MHB A;  4FO2 A;  4K5X A;  4A3E B;  3NTK A;  2JA8 B;  4C3J H;  4GKJ Q;  2J0T D;  4DR6 L;  1E2V A;  1B53 A;  3E5S A;  1IYV A;  2BE5 D;  2RBM A;  2AWN A;  5M5X H;  2CHB D;  1ILP A;  1Q1E A;  4F8M A;  2NVQ H;  5LMU L;  5KIX A;  1WTR A;  1ZXT A;  4DV2 Q;  3A7L A;  1CQV A;  3VYT A;  3K7U C;  1BBU A;  4C3J B;  1V9P A;  2F0V A;  2K28 A;  2SEB D;  2L0C A;  2F1M A;  1PA6 A;  1BOS A;  3S14 H;  3D8G A;  2Y0S G;  3IFD A;  3S1M H;  3ULP A;  5M5X B;  1XYI A;  3GTG H;  1DJR D;  1KLU D;  1HNZ Q;  2EYM A;  1HRJ A;  1IL8 A;  2R7Z H;  4DF7 A;  2H4O A;  1XNQ Q;  1IBK L;  3KLS X;  1HUM A;  2DNC A;  4G4K A;  3FKI H;  4C1N I;  3PO3 G;  4LAA A;  3NEM A;  1XTC D;  4IPD A;  3BG3 A;  4CJ2 C;  2F52 A;  3ZYY X;  3DWA A;  4DR7 Q;  4K14 A;  2QCP X;  5IWA L;  2AUJ D;  1J5E L;  2R7Z B;  1OXU A;  1PH6 A;  2PNR C;  2BH8 A;  2EJM A;  3K59 A;  2KA7 A;  1GOZ A;  3FRP B;  4ID6 A;  3SEB A;  4IOC A;  3MXU A;  4B9X A;  2NN6 H;  4LUZ A;  3OHX C;  3GP7 A;  4FF1 A;  4J15 A;  1SNP A;  1SJE D;  4RGN A;  2RDH A;  5IGC A;  1YIJ A;  1X3E A;  5IP7 G;  4A3B H;  4ABN A;  1Q3L A;  5J1Z A;  4L5T A;  1S5C D;  2I5L X;  3HKZ G;  3E0E A;  2Q2I A;  4Q0F A;  2FMM A;  5CR3 A;  2E2J H;  5IIF A;  2UXC L;  2WKC A;  4GNX B;  4DR3 L;  5DM6 3;  3TQY A;  3BU2 A;  4B3M L;  1QOH A;  2JEB I;  5M5Y B;  4GN3 B;  3MXG A;  4R4T A;  2B2W C;  1BF4 A;  1UEB A;  1L1O A;  5JEA J;  1Z6H A;  2AUK A;  4MIU A;  1XMO Q;  1RTN A;  1STH A;  1AH9 A;  5CV8 A;  4MHE A;  2B8F A;  3HS0 C;  2BDO A;  1NCV A;  4FF4 A;  1W2B A;  4KI0 A;  3M3Y H;  2MQH A;  2X6L A;  1D1I A;  3G48 A;  1Y14 B;  4BY1 G;  2HT1 A;  3BYY B;  4OIK A;  1W6K A;  1O7I A;  3C3L A;  1PYW D;  3GTQ B;  2Z4H A;  1H95 A;  2DUD A;  1XPU A;  1RJT A;  3N52 A;  4HMI A;  4HCS A;  2A68 D;  3UE1 A;  1MGS A;  1F9R A;  5J39 A;  1PH9 A;  3OW2 A;  1AZP A;  4JI3 Q;  2VY3 A;  1TT2 A;  2LS0 1;  1SLJ A;  1PFN A;  2Z6K A;  3CHB D;  2XNA C;  5D3I B;  2A69 D;  5M3F H;  4TQU S;  2IW3 A;  2KBN A;  4BA1 I;  4X62 L;  5M3M H;  1FNU A;  4CGY B;  5I2X A;  2GA4 B;  4YWM A;  2J7Z A;  2PCF B;  4WJW A;  3R3O A;  1PDQ A;  1R4P B;  2BOS A;  4I7Z C;  1PVO A;  1XTD A;  4OEL B;  1NR2 A;  2NZ1 D;  4FP5 D;  2X69 A;  3JAM c;  4P72 A;  3U4V A;  5M3F B;  2K32 A;  1UUP A;  1TS4 A;  4XYO A;  2DN8 A;  3C1F A;  5FO9 B;  3N6R A;  5M3M B;  1BXT A;  3F1Z A;  2KCM A;  1HNX Q;  1LTS D;  4DNR B;  2OTL A;  1AP0 A;  3AEV A;  3L9A X;  2E2D C;  1MKH A;  5AJ3 L;  3VR4 A;  5NUC A;  1WOC A;  2NN6 I;  4DV4 Q;  4LF8 Q;  1PRT B;  1N32 L;  1SYF A;  1XJV A;  4ZYS A;  3J81 j;  4B08 A;  4PQX A;  2A6E D;  2Z4I A;  4DAY A;  1YNX A;  5C5M A;  2HIX A;  4KD4 A;  4N8F A;  3JAM L;  4JI6 Q;  4Y7N H;  2WIN B;  2DJF C;  2VQF Q;  4IUV A;  1K73 C;  3CU7 A;  4LF5 L;  1Y8N B;  4DU9 A;  4GKK Q;  2QDL A;  1PLF A;  3E3X A;  1O7Y A;  4NKL A;  2XGT A;  1J6Q A;  1SNC A;  5BN5 A;  1GHJ A;  3M9B A;  3A7A B;  1DYQ A;  5GAE C;  1YJN A;  4DR1 L;  4H44 C;  4JBW A;  3HOU G;  2PW5 A;  1A3U A;  2F3W A;  1GVP A;  1PH4 A;  3A0J A;  4RCO A;  4JVZ A;  4U68 A;  2MNA A;  4NXM Q;  3T1Y Q;  1C9O A;  4IN3 A;  3M4O H;  3IL8 A;  3CC2 A;  3PO2 G;  1IBL L;  3J80 E;  1LTA D;  4RMF A;  3D4D A;  2QA4 A;  4G7Z C;  4IAL A;  4KHZ A;  4ZKC B;  1VQN A;  4YIJ A;  4RA8 A;  5AFW A;  2OCE A;  1D7Q A;  1OXT A;  5C5L A;  3AQQ A;  4UAI A;  3K7A H;  1NMF A;  1M4V A;  3K5M A;  1W3S A;  1QIL A;  2CW0 C;  3P7J A;  1OXX K;  2F0G A;  3B6Y A;  1ZYR D;  3K81 C;  4DNI A;  2JP1 A;  5EAY A;  5J3B A;  2CWP A;  3I4N G;  4JI7 Q;  1KQS A;  3PMF A;  2AQ1 B;  4OON A;  1EOV A;  4JPB W;  5G3L F;  3K7A B;  3R93 A;  3HOV H;  2ZXP A;  1B8A A;  4PMC A;  2ZTD A;  5FLX c;  1B3Q A;  1MI2 A;  1I4X A;  2FMC A;  2WB1 G;  2EYF A;  2VB2 X;  1LT3 D;  1MBY A;  4JI2 L;  1N34 L;  2PW7 A;  1Q1B A;  4HAE A;  4DV3 L;  2K5Q A;  1F9Q A;  3PIP 3;  3HOV B;  4PZ7 A;  3F8T A;  2BH2 A;  1BDO A;  3PCO B;  4KJO A;  3TZU A;  3WOF A;  3TP7 A;  3CME A;  1CKO A;  4DPG A;  3H3V C;  3KYH C;  2O2L D;  1TWH H;  1I6V C;  1SMY D;  2VQE L;  1LAB A;  4DXG A;  4DK6 C;  1FJG Q;  2RHS B;  5BN4 A;  1YNJ C;  4GN5 A;  2PQA A;  4P74 A;  5FLX L;  1CZW A;  2EPB A;  1CFM A;  1EZ8 A;  3FPP A;  2DJG C;  3TP5 A;  1HHV A;  4X3T A;  4HJA A;  2B2T A;  1WYD A;  4GNX A;  1U9R A;  1VQK A;  2R92 G;  4FXG C;  4OO1 I;  1TWC H;  2HQL A;  3MXP A;  1HR0 Q;  1IKL A;  1HCZ A;  3J81 E;  3NBI A;  3DM3 A;  1F9P A;  1LTB D;  1O78 A;  2CFM A;  2V4D A;  4DUY L;  2MO0 A;  2Z8L A;  2JA6 B;  4FNF A;  4B3R Q;  2K05 A;  1R4Q B;  1LYL A;  1I94 L;  4A3E G;  2GVB A;  2JA8 G;  2F0S A;  1C7Y A;  4CJ1 B;  5K5P A;  2EXD A;  1TWC B;  5I2Y A;  3H91 A;  4RH6 A;  4LUO A;  2ID0 A;  2QEJ C;  3VYU A;  3D0F A;  4GS3 A;  1TWA H;  1D8L A;  3CC7 A;  4MTK A;  3D6C A;  1ICF B;  2GN5 A;  5ELN A;  1NY4 A;  1HNW L;  3SK5 A;  4X3K A;  3TRZ A;  2RCN A;  1RHP A;  3SVM A;  3NE5 B;  2B63 H;  4LF4 Q;  4C3J G;  4XQQ A;  1DGS A;  1BR9 A;  1RCV D;  1CQF A;  2F0M A;  1B50 A;  1I4P A;  4JBM A;  1TWA B;  1JOR A;  1SFO H;  4OIJ A;  3ND8 A;  4HID A;  1JIC A;  1ICW A;  1FVI A;  4ALP A;  2R7F A;  4R4Q A;  2KHI A;  2YTX A;  2ZT9 C;  5IT9 c;  1I50 H;  3S16 B;  3FMC A;  3VYS A;  1LLR D;  2B63 B;  4WFN 3;  4BY1 H;  1XMQ L;  1WJJ A;  4GZY C;  4Z9C B;  1WCM H;  1YNN D;  2RVL A;  1SFO B;  4JI5 L;  5COY A;  3DHQ A;  4AIM A;  5JPN C;  1HZB A;  2AWO A;  4H0L C;  1AW7 A;  4X6A H;  2Q2H A;  3VYR A;  2R7Z G;  5CBA E;  1CTM A;  3KFU A;  1GUS A;  3A74 A;  1X6O A;  4M1U B;  3PUZ A;  2A6H C;  1JJG A;  1WCM B;  2PQE A;  3URY A;  4DK3 C;  3AYH B;  1U4M A;  4O0A A;  5IT9 L;  5LMN L;  4QL5 A;  2JE6 I;  3VA7 A;  1U0L A;  2AQ3 B;  3S1N B;  3W1G A;  5EKK A;  4EVO A;  4I7A A;  1BQQ T;  3Q24 A;  3I70 A;  1EYA A;  2KVM A;  2IX3 A;  3MFY A;  4G7O C;  1JMC A;  3AFQ A;  4K2L A;  1L0W A;  4EQ5 A;  2MJ8 A;  1DZ1 A;  1J5E Q;  1EIY B;  3PV0 A;  1EWI A;  2KHJ A;  5IYC H;  4DV5 L;  3T56 B;  1PTO F;  4EX5 A;  1HTL D;  2EJF C;  2OF1 A;  2F4V Q;  2B2V A;  3RLN A;  1F9S A;  4GLV B;  1Q46 A;  4LFC Q;  2WFW A;  3HKS A;  3NWS A;  2LY7 A;  1JWS D;  1MJC A;  2YV5 A;  2Z1C A;  1U4R A;  1AE2 A;  1V1O A;  3CCJ A;  1UAP A;  1WI5 A;  1ASZ A;  3RLO A;  4JI8 Q;  1G91 A;  1GKH A;  1STA A;  2H5X A;  1HFN A;  2PZU A;  4DA2 A;  1SRO A;  3CKI B;  1XPO A;  4C2M B;  3F2B A;  4A3C G;  1N36 L;  1VF7 A;  1XWE A;  1QVF A;  2EY2 A;  2FIN B;  3HRZ C;  5E4X A;  5I6Y A;  4UP8 A;  3D3R A;  4JCV E;  1KD1 C;  3OMC A;  2CVR A;  2LXJ A;  4HJ9 A;  1DON A;  3H3V H;  3S1Q H;  3OW7 A;  3S9W A;  3DM1 A;  1QNU A;  2N8N A;  1RF2 D;  4KHP Q;  1TWF B;  1XNR Q;  3GD7 A;  3CCR A;  1GO3 E;  4KHV A;  2E2I H;  2DGY A;  2F3V A;  1SNO A;  5M3F G;  1VQ7 A;  4AH6 A;  1E2Z A;  3PQI A;  5M3M G;  2VZA A;  3KLS A;  4A75 A;  2JJQ A;  4JI4 L;  3LWU A;  4DK0 A;  4QIW E;  2K52 A;  4YHH Q;  2KED A;  2XWJ B;  4XIG S;  5JEA H;  5HY6 A;  5KRU A;  5GAH C;  1CI3 M;  1ENF A;  1TY0 A;  1LAC A;  1EWC A;  1EWH A;  2BA0 A;  3UDX A;  3KUP A;  4IPC A;  4JV5 Q;  3TP8 A;  4ODG A;  3MTS A;  2GVA A;  4ZLT F;  2B29 A;  2ZJQ A;  5HUR A;  3CCL A;  3I4N H;  1UEA B;  2IX1 A;  4JG2 A;  1VQE A;  4GLX A;  5I4D A;  1TKW B;  1QWY A;  2Q8T A;  4IUR A;  1OTC A;  4KMU C;  4A4I A;  1K83 H;  2X6G A;  2ZM6 L;  4JK1 C;  2UU9 L;  1DM0 B;  5H1S E;  2QKI C;  3UE0 A;  4E6I A;  3KDF B;  2WAQ B;  2ATW A;  4KJN A;  3TRE A;  2E74 C;  1JOQ A;  2EY5 A;  4OX9 L;  4UPA A;  3PUY A;  2OQK A;  5C0X J;  5CV6 A;  2KCT A;  2JQO A;  2UXD L;  1S5E D;  3I3C A;  3T53 B;  3I2Z A;  5C3W A;  4DAY B;  3Q6S A;  4DR1 Q;  2R92 H;  1E24 A;  5GRO A;  1OO9 B;  2RHQ B;  4S3S A;  1SAP A;  1MD2 D;  1A2T A;  3I8Z A;  4IJL A;  3TDQ A;  1C8C A;  2XVS A;  4IFD G;  5E7N A;  1PH3 A;  4KY5 A;  3KF8 B;  2JSO A;  1YHA A;  3ER0 A;  4A3E H;  2JA8 H;  3NHH A;  4JYA L;  3T1H Q;  3BJU A;  3J7Y W;  4IUQ A;  2D0P A;  3J7A V;  1R9T H;  3S1R B;  3A8I E;  1NJI C;  1DD2 A;  3HOV G;  5KGU A;  3BVZ A;  1MSG A;  3PIO A;  2HCC A;  3WDN A;  4KY7 A;  1IXR A;  1R9T B;  4FXK C;  1LM0 A;  1NR4 A;  3SR1 A;  2TSS A;  1X3Q A;  3TSS A;  2N55 A;  4YY3 L;  2IHF A;  4LFB L;  2MGS A;  3MVV A;  1A8V A;  5E1F A;  2EY1 A;  1EY6 A;  1SYC A;  3RUZ A;  2EIF A;  2K03 A;  1PZJ D;  1B4O A;  4LFA Q;  1N34 Q;  1M90 C;  1JJC B;  3S2D H;  1GUO A;  2PMZ E;  3TEH B;  2DY8 A;  3KK7 A;  1SYD A;  4DNT B;  1WD1 A;  4WRD A;  1CKN A;  2RA4 A;  1EEF D;  1KLG D;  4JI1 Q;  3M4Q A;  2R93 B;  4HED A;  4KK7 A;  3A8J E;  1UE5 A;  2JA6 G;  5EQ0 A;  1FL0 A;  4K5V A;  3PF4 A;  3S2D B;  5C6A A;  2NBF A;  2DY7 A;  1HXY D;  1BCP D;  2CQO A;  4UDU C;  4HIO A;  4ZRZ A;  4CDE C;  3HOZ B;  4LWC A;  2B2Y A;  5GAD C;  1DOK A;  1VQ4 A;  1E3P A;  3NTI A;  5M5Y H;  2PQA B;  3U9O A;  4R9W A;  4L5R C;  5JJL A;  3QIA A;  3QOJ A;  3PUV A;  4LF6 Q;  1LTI D;  1KL9 A;  5BR8 Q;  4C1N K;  4JOI A;  1X3F A;  4ZCK A;  3CPW A;  1PMR A;  1C0A A;  5I9O A;  2ALY B;  1D2B A;  1AEX A;  4WJ4 A;  4N8X 1;  1EU4 A;  1PTO C;  2E5L Q;  1BUV T;  3QR8 A;  4CBV A;  2B63 G;  1VQL A;  1F2M A;  4A3K B;  3GTQ H;  2EXZ A;  4TVA B;  4H02 A;  4HSV A;  4G57 A;  4B9W A;  2CKZ B;  1V8Q A;  1SE8 A;  2F0I A;  2L15 A;  3F2C A;  4IJH A;  1JWM D;  1JB7 A;  2A73 B;  4RG1 A;  3HOW H;  1VQA A;  4A3C H;  2E75 C;  1LT5 D;  1Z9F A;  4X64 Q;  1JB3 A;  4KD3 A;  3T13 A;  1YIT A;  2F0F A;  1C4Q A;  4HR7 B;  1WCM G;  2KCC A;  2I0Q A;  2PZT A;  1EEI D;  4K0K L;  3DEP A;  3KLR A;  3OIQ A;  3IAY A;  5DM7 3;  3PSI A;  3L7Z C;  3JC6 6;  2UUA L;  1BVS A;  4QUC A;  1JOK A;  1QJO A;  3HOW B;  1VQB A;  2NZH A;  3JAM E;  1PYS B;  1BKB A;  5LMN W;  3CCM A;  5CV7 A;  1STY A;  2MP1 A;  3GDE A;  5ELO A;  2CH4 A;  1W6J A;  3SGI A;  2RF4 A;  4HJ7 A;  3FHW A;  3K6O A;  1EIH A;  3STB C;  2EE1 A;  3AFP A;  1Q90 A;  3KBX A;  3QG1 A;  2EYL A;  3NQI A;  4RKL A;  2G9H D;  5ELC A;  1EFI D;  5FKA C;  1E7Z A;  1ESF A;  1LTL A;  3CCQ A;  3KDF A;  4QF4 A;  2JA5 H;  2JA7 H;  1OXV A;  5KNB A;  2VL6 A;  4UP9 A;  4AYB E;  4A3M G;  2Q2T A;  1VQD A;  5LL6 X;  2O4X A;  4K2K A;  4A3F H;  3OWE B;  5IYC G;  3KF6 B;  2KOL A;  3MXN B;  3BZC A;  1LTG D;  4R4O A;  3TS2 A;  2UUC L;  5FO8 B;  4LF7 L;  3CRK C;  2JA7 B;  1I5F A;  2JA5 B;  4YWK A;  1DCZ A;  1HA6 A;  4B3S Q;  1VMP A;  4DV5 Q;  4JI0 L;  2PI2 A;  4A3F B;  1YEZ A;  1DOM A;  1NNX A;  2K01 A;  1I3Q B;  5IOD A;  4CKB A;  4NXN L;  3SK8 A;  2Y0S E;  3HGB A;  1MSH A;  5L37 A;  1BO0 A;  2WII B;  2TMP A;  2R6G A;  2NTS A;  3G71 A;  1A62 A;  3C1E A;  1YJW A;  3KF8 A;  1G2T A;  2F0Q A;  2HHH L;  1B9N A;  1X3G A;  1ASY A;  5ELD A;  4CDF C;  3A8K E;  2EYP A;  3MWY W;  4RGM A;  2ZTC A;  3IRB A;  3EIV A;  3U50 C;  5ISR A;  4KLK A;  1Q8I A;  4O2D A;  1EL0 A;  3K57 A;  1GHK A;  1Y8P B;  1WTP A;  4JBJ A;  4NP5 A;  2VNU D;  5KND A;  4AQY Q;  2EYO A;  2XWB B;  1RDP D;  3KJP A;  3OTO Q;  3L3O C;  4R1J A;  1H9R A;  3NTH A;  1PHJ A;  4RCN A;  5FK9 C;  4POF A;  5JEA G;  1HJP A;  1K28 A;  4OWX B;  2XTI A;  4EQO A;  4B3T L;  2K6A A;  2B2Y C;  5FLX E;  4IFD H;  2ZTE A;  1SNM A;  2VB3 X;  3VA5 A;  1B7Y B;  1EY7 A;  4NDX A;  1HQM C;  2FHT A;  3DWQ A;  4DR4 L;  2AQ2 B;  3EA6 A;  3V2T A;  5JPM C;  1MIU A;  4DFA A;  2E8G A;  3MA2 B;  3ND9 A;  4JOI C;  2WAQ G;  1IYU A;  1N33 Q;  2F03 A;  2JXM B;  1Z47 A;  1TS3 A;  1Q8K A;  2ZXO A;  4DV0 Q;  2MPM A;  1TU2 B;  3K0X A;  2BE5 C;  1J8I A;  3A5Z B;  3M7G A;  3T51 B;  3F2D A;  1EYD A;  1B1Z A;  4GOP C;  3UI2 A;  1ONL A;  2L11 A;  1UNS A;  2AKW B;  2JA9 A;  1PTO H;  2PPB C;  2A19 A;  1CKM A;  4DKA C;  1JOO A;  2K33 A;  1VQG A;  1QE6 A;  2I07 B;  1H9M A;  3J7A F;  4QY7 A;  4DV2 L;  1LO5 D;  4XQJ A;  2FJ2 A;  1Y69 U;  1BBW A;  3H09 A;  5I9P A;  2JK8 A;  5FJ8 H;  2L12 A;  1PTO B;  3FDT A;  1ENA A;  1TS5 A;  2EVB A;  2M2L A;  5G3L D;  2M00 A;  4DR2 Q;  3M4P A;  1S5B D;  5C4H A;  2IX0 A;  5D65 A;  1V43 A;  1HNZ L;  1JJ2 A;  2JA6 H;  1QZH A;  2YU9 B;  3C2P A;  3KOJ A;  3SDZ A;  3GTJ H;  1XNQ L;  4ZKB B;  3HOX H;  4PMB A;  4TSS A;  3J80 i;  3NK9 A;  2A1A A;  4RHR A;  1EYG A;  3KBG A;  5C3X A;  4DV6 L;  4DV7 Q;  3I55 A;  1IW7 D;  1HH2 P;  2F3I A;  1VQC A;  1TVX A;  3S17 B;  4XDX A;  3TN2 A;  4C56 C;  4DR7 L;  2Z0S A;  5D14 A;  3GTJ B;  2K75 A;  1SND A;  4FF2 A;  4HCE A;  1TR5 A;  2O5I C;  1FD7 D;  3HOX B;  2R3Z A;  3CRL C;  1ZKO A;  1D5Z C;  3MC0 B;  1GJX A;  4ZAI A;  2YTV A;  1LUZ A;  3LWE A;  2IWH A;  5IT9 E;  1SYB A;  2OTJ A;  3HZX A;  2CQA A;  1EIF A;  2D9U A;  5JVH 3;  2SOB A;  1PRT D;  5A2Q L;  3S16 H;  2G5D A;  4IFD I;  3I56 A;  3W5O A;  3RZD B;  1G8Z D;  2ZJP A;  2NVT H;  1PFM A;  3R8B A;  1JC7 A;  4GN4 B;  3DMU A;  4DR5 Q;  3I91 A;  4RAU C;  4IPH A;  1S4Z A;  3HEJ A;  1Q86 C;  1CM9 A;  1KAA A;  1KNA A;  2C9O A;  4PMW A;  2RDG A;  1A2U A;  3P20 A;  3E6Z X;  3J81 c;  4RGO S;  1XMO L;  4K6D A;  4DR6 Q;  1SYE A;  1VQ6 A;  2R93 G;  2NVT B;  4KV6 A;  2A68 C;  2PO4 A;  2XSC A;  5C4X B;  1H9K A;  4R4I A;  5LMU Q;  4HN7 A;  2VXW A;  1G2S A;  1E1O A;  5COR A;  1T5X D;  3S1N H;  2K1B A;  2RKS A;  2A69 C;  3KF6 A;  1T5E A;  3MXN A;  3MFG A;  5IGE A;  4IO9 A;  3BZK A;  1QNK A;  3HOZ G;  4RFB A;  4L8J A;  1VQ9 A;  1SN8 A;  4JI3 L;  3PF5 A;  5KYL A;  3NXW A;  3ZJY C;  1NSN S;  3J81 L;  1QB5 D;  1EQT A;  1RTO A;  1IBK Q;  5JJK A;  3J81 i;  2K7V A;  2K14 A;  1JE5 A;  2NUC A;  2UUB L;  1UE7 A;  2F0L A;  1I6H B;  5M5W H;  5JVG 3;  2M9V A;  4A3M H;  1CKN B;  2OT2 A;  4EQN A;  5IWA Q;  4A3D H;  1WVL A;  4XQN A;  4A3K G;  1S3O A;  1HZA A;  2WB1 E;  1XX8 A;  4J8Q A;  5T1I A;  4CKC A;  3GTM B;  2ICE C;  3S15 H;  5M5W B;  2B8G A;  4QQB X;  4A3M B;  4C2M H;  3WOE A;  4A3D B;  4JC0 A;  4C3H H;  2F0U A;  5BN3 A;  2O5J C;  4DV4 L;  4A3G G;  1JCK B;  1I4Q A;  2F0K A;  1B9M A;  1VCI A;  2UXC Q;  4DR3 Q;  3A54 A;  4RWS C;  3G4S A;  4B3M Q;  3K8A A;  4LW1 A;  3S15 B;  5LHY 1;  4A3I G;  2OWO A;  2N49 A;  3HOW G;  3I4M B;  4C3I B;  2RSO A;  4YWL A;  1NUC A;  4JI6 L;  5C4J H;  1PH8 A;  1TWF H;  4C3H B;  4IUN A;  1L2F A;  4YCV A;  2BCO A;  3GTK B;  4BBR H;  2NB0 A;  4GKK L;  1FNW A;  3D4W A;  2R7D A;  1PTO D;  4R8N A;  1SBB B;  2K5N A;  5IYB H;  4GOP B;  4CJ0 B;  5C4J B;  5LL6 S;  4J1M A;  5IOC A;  1QCB D;  1VMC A;  4BBR B;  1I4R A;  1JR0 D;  3H94 A;  4NXM L;  1WD0 A;  4BXX H;  3U9S A;  3T1Y L;  3CCU A;  2ES2 A;  2KEC A;  3BS1 A;  4WOR A;  4BA2 I;  5IGF A;  5CYU A;  1ZYR C;  4KKT A;  2A5H A;  2FXQ A;  3I90 A;  2JA5 G;  2JA7 G;  1CUK A;  1IBM L;  4DAP A;  2QW7 A;  4X62 Q;  1E0B A;  2V1C C;  4XT3 B;  3FP9 A;  4A3F G;  3H15 A;  1HUN A;  1AFP A;  3T4A C;  3V96 A;  1KDB A;  2F0H A;  2F0E A;  1NE3 A;  2N88 A;  4KKU A;  2ZJR A;  4Q5V A;  3EN2 A;  2L9H A;  5FO7 B;  2WP8 J;  4APV A;  3VR3 A;  1GXD C;  2MUY A;  1K0S A;  2LSS A;  3QOL A;  5D3D A;  5CGK A;  2LXK A;  4IPG A;  1WTV A;  5AJ3 Q;  4QGU A;  3VR6 A;  1N32 Q;  2I5M X;  1WTX A;  2PNH A;  4RHS A;  1VQJ A;  3DWP A;  4OL7 A;  1IKM A;  1X9N A;  4NXN Q;  1HA5 A;  4LF5 Q;  1PZK D;  5DLQ E;  4KN4 C;  1B70 B;  1FJG L;  1QUQ B;  4QMG A;  1EU3 A;  2B2U C;  4XTC S;  5EPL A;  1WTW A;  3OSO A;  3BDL A;  3GV6 A;  3RLF A;  3UDF A;  3LNN A;  2KHS A;  1B3A A;  4A3J B;  1S5D D;  1PH7 A;  3S1R H;  1C48 A;  2XN9 C;  4UP7 A;  1V1Q A;  4U67 3;  3H3V I;  2OEO A;  3CPF A;  1IBL Q;  4LUV A;  3PIO 3;  4A3I B;  4DV1 L;  5M9O A;  1YI2 A;  3G6J B;  5IE8 A;  4B3R L;  1FGB D;  2IPK D;  1HZ9 A;  2QIL A;  2XIW A;  4B3T Q;  1WFQ A;  2MFI A;  4X65 L;  3D4R A;  1Z7T A;  1HQR D;  1X32 A;  1YHQ A;  4L6T B;  3OYY A;  2QF7 A;  1STB A;  3F2U A;  4QUF A;  4IOA A;  2BDN A;  3I7F A;  2CCZ A;  1IYJ B;  3GO5 A;  3D6W A;  1FYC A;  1STN A;  2G9D A;  2RCF A;  3SK4 A;  3W2D A;  1K8G A;  2CW0 D;  2KCN A;  3K5N A;  3HOY H;  3K0Y A;  1PV4 A;  3CAM A;  1YNN C;  1WTO A;  2K5H A;  2R93 H;  3L0O A;  3BYT B;  1PFB A;  1GUT A;  4JI2 Q;  4QIW B;  1EQQ A;  1SEB D;  1EUJ A;  3M85 A;  1GUW A;  4DV3 Q;  1CZG A;  1ROD A;  3CC4 A;  1KNE A;  3GTL H;  4HIM A;  5FJ8 G;  3HOY B;  1BCP F;  4HIK A;  4NMZ A;  2HDM A;  4DUZ L;  3CP0 A;  4IUT A;  2R61 A;  4OEM B;  2VQE Q;  3A56 A;  1TWG B;  4HTH A;  3HOZ H;  5DEH A;  4CDC C;  5HGQ A;  3TP6 A;  4FXD A;  1VQI A;  3OMG A;  4JW0 A;  3GTL B;  3HOX G;  4H13 C;  3S2H H;  1SSO A;  1TXY A;  1U5K A;  4ILW A;  2NVQ B;  1G29 1;  2F0O A;  5ELF A;  2F0J A;  2Q2U A;  1NTG A;  3CCS A;  1T9H A;  1NBW A;  1K0R A;  1X55 A;  2LFN A;  4X66 L;  1KTK A;  1YNJ D;  1O80 A;  1PH1 A;  1QZG A;  4DV6 Q;  5KYI A;  3S2H B;  3S14 B;  1JQY D;  2HQE A;  4X3S A;  3S1M B;  1RD9 D;  3GTG B;  4A3K H;  4A3L H;  4DUY Q;  3HP3 A;  3GTP H;  5IYD H;  1KC8 C;  3NQT A;  5JAV A;  4Y52 H;  2E76 C;  2H1E A;  1EIG A;  5C0X G;  1G51 A;  2QEX A;  1I94 Q;  1J9O A;  2F4V L;  1NAP A;  3FKI B;  5EJW A;  4PV1 C;  1HFG A;  4DXF A;  1BBX C;  4FVM A;  3QO2 A;  5EPJ A;  4LFC L;  4GOP A;  1MHW C;  4NPS A;  5EKI A;  1CHP D;  3I73 A;  3P75 A;  3PUX A;  2VUM H;  3GTP B;  4A3G H;  5C4X G;  3J7Z C;  2P5Z X;  2RDF A;  1RIP A;  1ZEQ X;  4NW2 A;  4TKO B;  1HNW Q;  5F2D A;  1EY0 A;  2KEE A;  4HSP A;  2F4I A;  3ICE A;  1K8A C;  4BY7 H;  3AU7 A;  3V05 A;  4JI8 L;  2L1B A;  5C3E H;  1EYC A;  3P1H A;  4XYQ A;  4CKE A;  5IGB A;  4A3B B;  3TS0 A;  2VUM B;  4A3G B;  4POG A;  4OGQ C;  5HGT A;  3E0J A;  1VQP A;  2EY6 A;  1UWV A;  3D31 A;  3LX0 A;  2D2C C;  2EYJ A;  1QG7 A;  3G7L A;  4QJF A;  4BY7 B;  2E2J B;  3K58 A;  1XMQ Q;  1E1T A;  5C3E B;  1S40 A;  2D0O A;  1PH5 A;  1CK1 A;  2N3S A;  3DEO A;  4JI5 Q;  1EY4 A;  4QCL A;  5J22 A;  5DNF A;  4KHP L;  1XNR L;  2IJ0 A;  4IUP A;  4XT1 B;  2F0N A;  2FFK B;  5E3F A;  1KDC A;  1O7L A;  3KLW A;  1M8A A;  1YVC A;  3W3A A;  1MJE A;  3M3Y B;  3BDC A;  1DOL A;  1ET9 A;  2EDG A;  1A63 A;  2VS1 A;  3VR5 A;  5C44 H;  4YHH L;  1E22 A;  3CXC A;  4M8A A;  5LMN Q;  1FR3 A;  3NSW A;  4A3D G;  2BA1 A;  1GM5 A;  1EZ6 A;  4BBS H;  4JV5 L;  2ZXR A;  2A6H D;  4I65 A;  2B3G A;  1KAB A;  5FLM G;  1N9W A;  2F0T A;  2UUB Q;  2AMC B;  1I3Q H;  4HJ8 A;  1CT1 D;  5C44 B;  2UXB L;  2PMZ B;  3TZD A;  4ZK9 B;  3SK6 A;  1AZQ A;  3I4M G;  4C3I G;  1M1K C;  5TSS A;  2N78 A;  5ELB A;  4C3H G;  4OWW B;  1QUQ A;  1FNV A;  4ME3 A;  4BBS B;  2A8V A;  3NEN A;  3QJY A;  1Y1V H;  2EYH A;  2CH4 W;  4R4C A;  4V0B A;  2IHE A;  1VQF A;  5IY0 A;  3L2P A;  4RGT A;  5GAG C;  5K36 H;  1TQO A;  3FEW X;  2KQ3 A;  4BBR G;  4P71 A;  1Q7Y C;  1K3B C;  2EZV A;  1Y1V B;  3RZO H;  3IFT A;  5EPK A;  2DNE A;  3NEL A;  1KAW A;  1EOT A;  5IP9 G;  2C35 B;  2C5C A;  4BWG B;  1NMG A;  1N36 Q;  1Y8O B;  1HTP A;  4F7X A;  5IYB G;  1A0I A;  1ILQ A;  2YYZ A;  3JAM i;  2WV6 D;  1IL2 A;  1CHQ D;  4ZQ3 A;  1JE4 A;  1KXL A;  1FGU A;  5KNC A;  3GQB A;  3RZO B;  4BXX G;  3CQZ H;  1I4H A;  4DGZ A;  4OO1 H;  2Q8I B;  4DK1 A;  4Y7N B;  1Y1W H;  1EY8 A;  4O42 A;  4V19 0;  2NTT A;  4EQP A;  3BVG A;  2ENB A;  4OXP A;  4CDD C;  3NBH A;  3ULJ A;  3HKZ E;  4OWT B;  5E4W C;  3A5U A;  4KY6 A;  1JT8 A;  2J4X A;  3CQZ B;  4JI4 Q;  1F2Y A;  4TRD A;  4L5Q A;  1VDZ A;  2WKD A;  1Y1W B;  1XXG A;  3T1H L;  2KJX A;  3NP8 A;  1A3T A;  1A15 A;  4JBK A;  2MHV A;  2HCI A;  4LF9 L;  1IBM Q;  1WTH A;  1SXT A;  3QB3 A;  3C46 A;  1LTT D;  3M4O B;  3RMH A;  1RL2 A;  5FOB B;  1PH2 A;  2OQ0 A;  4KN7 C;  4H7B A;  3VDY A;  2A74 C;  3TME A;  5CBE E;  1YJ9 A;  4GKJ L;  3J80 c;  2K5W A;  1QVG A;  1QVC A;  1PYB A;  2NVY H;  4A93 H;  3H0G H;  5T1G A;  2ZM6 Q;  2UU9 Q;  2YU9 H;  4MZ9 A;  1EY5 A;  5A2Q E;  2NYZ D;  3HFZ B;  2EOT A;  5DAU A;  3J7A 5;  4CHT B;  4A76 A;  1SJH D;  1XPR A;  5CV5 A;  4P2C B;  2LKV A;  1L1O C;  1V1P B;  2I46 A;  3M7N A;  2QDB A;  4KTA A;  4LFA L;  3RNU A;  4PG3 A;  5ELE A;  3EBE A;  4AYB B;  2ICI A;  2MO1 A;  2NVY B;  4A3J G;  3H0G B;  4IZ8 A;  4A93 B;  1EFW A;  4ZUI A;  3S17 H;  1CA6 A;  4OX9 Q;  2NZO A;  1BCP C;  1IZ6 A;  4JI1 L;  5EBC A;  3J80 L;  1Q81 C;  4R8I A; 
#chains in the Genus database with same CATH homology
 4FDB A;  1PH8 A;  1HR0 W;  1SRU A;  1TWF H;  3HOV G;  1L2F A;  4YCV A;  4YWM A;  1UE1 A;  4BBR H;  2UXD Q;  3PIO A;  4GKK L;  1PVO A;  2R7D A;  1IXR A;  1XTD A;  3PIP A;  1YBY A;  3JAM c;  2K5N A;  4P72 A;  3UDI A;  3U4V A;  1N8R C;  1LM0 A;  1KHI A;  5IYB H;  3PO3 H;  4GOP B;  3RZD H;  1YZ6 A;  4YY3 L;  2Z6K C;  3F1Z A;  2IHF A;  2KCM A;  4LFB L;  1A8V A;  1HNX Q;  2OTL A;  2IT1 A;  1Q12 A;  2EIF A;  4NXM L;  3AEV A;  4BXX H;  3T1Y L;  3CCU A;  2ES2 A;  1MKH A;  1YHB A;  4LFA Q;  5AJ3 L;  1N34 Q;  1WOC A;  2NN6 I;  4LF6 L;  4DV4 Q;  1VQ5 A;  1M90 C;  1JJC B;  3RR5 A;  4LF8 Q;  3S2D H;  1N32 L;  2PMZ E;  5BR8 L;  3TEH B;  4DV1 Q;  4HJ5 A;  4JYA Q;  1XJV A;  4BA2 I;  2ASB A;  3J81 j;  1CKN A;  2HIV A;  2FXQ A;  2JA5 G;  1YNX A;  2JA7 G;  1CUK A;  3E9I A;  4JI1 Q;  1UE6 A;  2HIX A;  4P75 A;  3M4Q A;  5IP7 H;  5C4X H;  1IBM L;  2E5L L;  4X62 Q;  4JI6 Q;  4Y7N H;  1UE5 A;  4X65 Q;  2YTY A;  2V1C C;  2VQF Q;  1K73 C;  4LF9 Q;  1FL0 A;  3FP9 A;  2JA6 G;  4A3F G;  4LF5 L;  1VQO A;  3H15 A;  3PF4 A;  1KIX A;  3HOY G;  4GKK Q;  3WWV A;  1NE3 A;  2XGT A;  1J6Q A;  2CQO A;  3M9B A;  2ZJR A;  3EN2 A;  4HIO A;  2WP8 J;  2NVX H;  4LNQ A;  4APV A;  5GAE C;  1YJN A;  4DR1 L;  1GD7 A;  4JBW A;  4LWC A;  4YY3 Q;  4X64 L;  3HOU G;  2K4K A;  5GAD C;  4LFB Q;  1VQ4 A;  1GVP A;  1E3P A;  1PH4 A;  3A0J A;  2LSS A;  2MNA A;  5M5Y H;  4NXM Q;  4YCU A;  2PQA B;  2LXK A;  3T1Y Q;  1C9O A;  4IPG A;  1Q82 C;  4L5R C;  5AJ3 Q;  3LGJ A;  3CC2 A;  2JA6 H;  3M4O H;  3PUV A;  4QGU A;  1IBL L;  4LF6 Q;  3PO2 G;  1N32 Q;  1KL9 A;  5BR8 Q;  1SR3 A;  2IY5 B;  4JOI A;  1X3F A;  2I5M X;  3CPW A;  1I6H H;  1C0A A;  2PNH A;  4RMF A;  1VQJ A;  2ALY B;  2I5H A;  3K80 C;  2QA4 A;  4WJ4 A;  2K5V A;  1CSQ A;  4KHZ A;  4DUZ Q;  1VQN A;  2E5L Q;  2OCE A;  1D7Q A;  1OXT A;  2B63 G;  3U4Z A;  3AQQ A;  1X9N A;  4JI6 L;  1VQL A;  3K7A H;  1NMF A;  4NXN Q;  4LF5 Q;  1W3S A;  3GTQ H;  5DLQ E;  1B70 B;  5JJI A;  1OXX K;  4TVA B;  1FJG L;  3GTM H;  3B6Y A;  2WAQ E;  4H02 A;  3FKI G;  4YCW A;  3I4O A;  3K81 C;  4DNI A;  2CKZ B;  5EAY A;  5J3B A;  1QUQ B;  1SE8 A;  2CWP A;  3I4N G;  4XTC S;  4JI7 Q;  2L15 A;  3F2C A;  1KQS A;  4IJH A;  1JB7 A;  3CMA A;  3HOW H;  4RG1 A;  4MTN A;  4A3L G;  5IYD G;  1VQA A;  4OON A;  3RLF A;  1EOV A;  4A3C H;  4X64 Q;  1Z9F A;  3UDF A;  4X66 Q;  3HOV H;  5FLM H;  1YIT A;  1AE3 A;  1B8A A;  1K3R A;  1WCM G;  2I0Q A;  1PH7 A;  1HNX L;  2ZTD A;  5FLX c;  4UP7 A;  3S1R H;  1V1Q A;  4K0K L;  3H3V I;  2WB1 G;  2NN6 G;  3I4M H;  3PUW A;  3PSI A;  4C3I H;  3L7Z C;  3JC6 6;  2UUA L;  4WJ3 M;  1BVS A;  3CPF A;  1IBL Q;  1KRS A;  4LUV A;  4JI2 L;  2EQS A;  1N34 L;  3GTK H;  1VQB A;  2NZH A;  4A3B G;  2PI2 E;  2VUM G;  1Q1B A;  4LF8 L;  1PYS B;  1BKB A;  5LMN W;  4DV1 L;  4DV3 L;  3CCM A;  4B3S L;  4PZ7 A;  5ELO A;  3F8T A;  3GDE A;  3CCE A;  3PCO B;  3CF5 A;  1YI2 A;  2BH2 A;  3CME A;  5IE8 A;  4B3R L;  1CKO A;  4DPG A;  3KYH C;  3SGI A;  1HZ9 A;  5C0X I;  4B3T Q;  4BY7 G;  1TWH H;  2QGQ A;  2RF4 A;  4HJ7 A;  2VQE L;  3FHW A;  1WFQ A;  2MFI A;  3STB C;  4X65 L;  5C3E G;  2VQF L;  3AFP A;  4DK6 C;  1K9M C;  4L5S A;  1FJG Q;  2RHS B;  3W1B A;  2CWA A;  1YHQ A;  1E7Z A;  1LTL A;  4GN5 A;  3OYY A;  3CCQ A;  1HZC A;  3KDF A;  2PQA A;  4P74 A;  4IOA A;  2JA5 H;  3I7F A;  2CCZ A;  1IYJ B;  1OXV A;  3GO5 A;  2JA7 H;  5IP9 H;  2VL6 A;  4UP9 A;  4AYB E;  4MNO A;  1VQ8 A;  4A3M G;  1K8G A;  2Q2T A;  4IFD J;  1VQD A;  4A3F H;  3ERS X;  5IYC G;  3KF6 B;  3MXN B;  4PZ8 A;  1WYD A;  3BZC A;  4R4O A;  4HJA A;  4GNX A;  1PV4 A;  3HOY H;  4K0K Q;  3TS2 A;  1VQK A;  3CAM A;  3MEF A;  2R92 G;  2UUC L;  4OO1 I;  1TWC H;  2HQL A;  2K5H A;  2R93 H;  2UUA Q;  3L0O A;  1HR0 Q;  4LF7 L;  4JI2 Q;  1I5F A;  4YWK A;  3DM3 A;  1EQQ A;  4GLA C;  2CFM A;  1EUJ A;  3M85 A;  4DUY L;  3CCV A;  1X54 A;  2MO0 A;  4DV3 Q;  3CC4 A;  3UDG A;  4B3S Q;  4DV5 Q;  1S72 A;  2PI2 A;  4JI0 L;  3GTL H;  4HIM A;  5FJ8 G;  3HOU H;  4AQY L;  3PGZ A;  4B3R Q;  1PFS A;  1YEZ A;  3OTO L;  4HIK A;  1LYL A;  1I94 L;  4A3E G;  5C44 G;  2GVB A;  4UY8 C;  1VQH A;  1C7Y A;  4DUZ L;  3CP0 A;  2JA8 G;  1L1O B;  2EXD A;  2VQE Q;  1P8L A;  3HOZ H;  3PO2 H;  2VW9 A;  4NXN L;  4LUO A;  1CSP A;  2ID0 A;  2Y0S E;  5HGQ A;  3D0F A;  4GS3 A;  4GNX C;  1TWA H;  1D8L A;  3CC7 A;  4BBS G;  1VQI A;  2GN5 A;  5ELN A;  3U58 A;  1NY4 A;  3HOX G;  1HNW L;  3S2H H;  3TRZ A;  2RCN A;  1TXY A;  1P16 A;  4JI7 L;  1U5K A;  2R6G A;  3G71 A;  1A62 A;  1G29 1;  1YJW A;  4LF4 Q;  2B63 H;  2Q2U A;  1DGS A;  1NTG A;  3STB D;  3KJO A;  3CCS A;  2HHH L;  1T9H A;  1X3G A;  1ASY A;  1N33 L;  2D62 A;  1NBW A;  3GTO H;  1K0R A;  1X55 A;  4X66 L;  4JBM A;  4DV0 L;  2ZTC A;  3CD6 A;  2K50 A;  3IRB A;  1SFO H;  3EIV A;  2UUC Q;  4DAM A;  3U50 C;  1PH1 A;  1QZG A;  4KLK A;  4HID A;  1FVI A;  1Y1V G;  4LF7 Q;  4DV6 Q;  1X56 A;  4O2D A;  2R7F A;  4ALP A;  4R4Q A;  2E2H H;  2KHI A;  2YTX A;  3DLL A;  2UXB Q;  5IT9 c;  1I50 H;  4A3K H;  1QVF A;  4A3L H;  3RN2 A;  4DUY Q;  5IYD H;  3GTP H;  1KC8 C;  4JBJ A;  1SMX A;  4BY1 H;  2VNU D;  4Y52 H;  4JI0 Q;  5K36 G;  3E9H A;  1XMQ L;  4AQY Q;  1WJJ A;  5C0X G;  3KJP A;  3OTO Q;  4R1J A;  1G51 A;  1WCM H;  2QEX A;  1I94 Q;  1PHJ A;  2JEA I;  4JI5 L;  4POF A;  5JEA G;  1HJP A;  2F4V L;  4OWX B;  4AIM A;  2XTI A;  4B3T L;  3G6E A;  1HZB A;  2AWO A;  4LFC L;  4GOP A;  4X6A H;  2ZTE A;  2Q2H A;  4NPS A;  2R7Z G;  3KFU A;  3PUX A;  2VUM H;  5C4X G;  4A3G H;  3A74 A;  3J7Z C;  1B7Y B;  4A3J H;  1X6O A;  1HNW Q;  1RIP A;  3PUZ A;  5JJL A;  4DR4 L;  1JJG A;  1VS0 A;  3S24 A;  1MIU A;  2E8G A;  3ICE A;  4DR2 L;  1K8A C;  4DK3 C;  4BY7 H;  3AYH B;  3Q8D A;  4JOI C;  3RN5 A;  2WAQ G;  4O0A A;  2HHH Q;  5LMN L;  4QL5 A;  2JE6 I;  4A3I H;  1N33 Q;  1Z47 A;  4JI8 L;  5C3E H;  1U0L A;  1Q8K A;  4DV0 Q;  4OO1 G;  1EQR A;  3W1G A;  3TS0 A;  3K0X A;  4POG A;  3A5Z B;  1Y1W G;  1VQM A;  3F2D A;  1VQP A;  1UWV A;  3D31 A;  4GOP C;  1HR0 L;  1JMC A;  3AFQ A;  4DV7 L;  2R92 H;  1L0W A;  4EQ5 A;  4QJF A;  2AKW B;  2JA9 A;  1J5E Q;  1XMQ Q;  1E1T A;  1EIY B;  3PV0 A;  1EWI A;  2KHJ A;  2AHO B;  5IYC H;  4DV5 L;  4PZ6 A;  2A19 A;  1CKM A;  4DKA C;  1S40 A;  4EX5 A;  2D0O A;  1VQG A;  2N3S A;  1PH5 A;  4JI5 Q;  2F4V Q;  4KHP L;  3RLN A;  1XNR L;  4QY7 A;  4GLV B;  1Q46 A;  1X65 A;  4LFC Q;  2WFW A;  4DV2 L;  3HKS A;  2YV5 A;  1MJC A;  3KLW A;  1G6P A;  1BBW A;  1AE2 A;  3CW2 C;  2JK8 A;  1YVC A;  5FJ8 H;  4DR4 Q;  3CCJ A;  1MJE A;  1WI5 A;  1A63 A;  1ASZ A;  2VS1 A;  5C44 H;  4YHH L;  4DR2 Q;  3M4P A;  1E22 A;  4NB3 A;  3CXC A;  2IX0 A;  5LMN Q;  1KRT A;  3RLO A;  4JI8 Q;  1V43 A;  2KEN A;  1JJ2 A;  1HNZ L;  1QZH A;  1GKH A;  2BA1 A;  3KOJ A;  3NBH B;  3GTJ H;  2H5X A;  4A3D G;  1OXS C;  1SRO A;  1GM5 A;  5GQO A;  4JV5 L;  1XNQ L;  4BBS H;  4AYB G;  1XPO A;  3F2B A;  4A93 G;  4A3C G;  3H0G G;  1N36 L;  3HOX H;  4DR5 L;  2B3G A;  5FLM G;  3J80 i;  1N9W A;  4P73 A;  3ULL A;  2A1A A;  2AMC B;  1I3Q H;  1EYG A;  2UUB Q;  1TWG H;  4DV6 L;  4HJ8 A;  4DV7 Q;  3I55 A;  2UXB L;  1HH2 P;  2F3I A;  4UP8 A;  4C3J H;  4GKJ Q;  4JCV E;  1VQC A;  3I4M G;  1KD1 C;  4DR6 L;  1M1K C;  4DR7 L;  2Z0S A;  2N78 A;  2LXJ A;  4HJ9 A;  2K75 A;  3H3V H;  3S1Q H;  4OWW B;  1QUQ A;  2AWN A;  4ME3 A;  5M5X H;  2A8V A;  1Q1E A;  3NEN A;  2N8N A;  1Y1V H;  5LMU L;  2NVQ H;  4KHP Q;  1XNR Q;  3GD7 A;  4R4C A;  3CCR A;  1GO3 E;  4DV2 Q;  2IHE A;  2E2I H;  2DGY A;  1VQF A;  5IY0 A;  3L2P A;  5M3F G;  2YTV A;  1LUZ A;  3K7U C;  4AH6 A;  1BBU A;  1VQ7 A;  1V9P A;  5GAG C;  2OTJ A;  5M3M G;  2VZA A;  1PA6 A;  4A75 A;  1EIF A;  2JJQ A;  4JI4 L;  3S14 H;  2Y0S G;  4QIW E;  3S1M H;  2K52 A;  4YHH Q;  3ULP A;  4BBR G;  4XIG S;  4P71 A;  3GTG H;  1Q7Y C;  3S16 H;  4IFD I;  5HY6 A;  3I56 A;  3W5O A;  5GAH C;  1HNZ Q;  3RZO H;  2ZJP A;  2BA0 A;  2NVT H;  3UDX A;  2R7Z H;  3NEL A;  1KAW A;  4IPC A;  4GN4 B;  5IP9 G;  2C35 B;  1XNQ Q;  4JV5 Q;  1IBK L;  1NMG A;  1N36 Q;  4DR5 Q;  3FKI H;  2GVA A;  2B29 A;  4IPH A;  5IYB G;  1Q86 C;  3PO3 G;  1A0I A;  2YYZ A;  2ZJQ A;  3JAM i;  3I4N H;  3CCL A;  1IL2 A;  2IX1 A;  4PMW A;  3NEM A;  4IPD A;  4JG2 A;  1KXL A;  3J81 c;  1FGU A;  2F52 A;  1VQE A;  4GLX A;  1XMO L;  2R93 G;  4DR6 Q;  1VQ6 A;  4DR7 Q;  5IWA L;  4BXX G;  1J5E L;  3CQZ H;  1OXU A;  1OTC A;  4A4I A;  1K83 H;  1PH6 A;  2BH8 A;  4R4I A;  1Y1W H;  5LMU Q;  4IOC A;  2ZM6 L;  2UU9 L;  5H1S E;  4LUZ A;  1E1O A;  4OXP A;  3UE0 A;  4J15 A;  3ULJ A;  3HKZ E;  4OWT B;  3S1N H;  1YIJ A;  3KDF B;  1X3E A;  5IP7 G;  3KF6 A;  3A5U A;  4A3B H;  1JT8 A;  2ATW A;  4IO9 A;  4L5T A;  3BZK A;  3HOZ G;  2I5L X;  4JI4 Q;  3HKZ G;  4L5Q A;  3E0E A;  2Q2I A;  3TRE A;  1VQ9 A;  1SN8 A;  4JI3 L;  3PF5 A;  2E2J H;  2UXC L;  3T1H L;  4DR3 L;  4GNX B;  3ZJY C;  4JBK A;  4LF9 L;  4OX9 L;  3TQY A;  3BU2 A;  1IBM Q;  4B3M L;  2JEB I;  4UPA A;  1IBK Q;  4GN3 B;  5JJK A;  3J81 i;  3PUY A;  2OQK A;  4R4T A;  5C0X J;  2K14 A;  1RL2 A;  1JE5 A;  1UEB A;  1L1O A;  1PH2 A;  2KCT A;  2JQO A;  5JEA J;  2OQ0 A;  2UUB L;  4A93 H;  1UE7 A;  5M5W H;  3VDY A;  1XMO Q;  2UXD L;  1AH9 A;  1YJ9 A;  4A3M H;  1CKN B;  4GKJ L;  5IWA Q;  4A3D H;  3I2Z A;  3J80 c;  4DAY B;  1W2B A;  4KI0 A;  3M3Y H;  1QVG A;  2MQH A;  4A3K G;  1QVC A;  1PYB A;  4DR1 Q;  2NVY H;  3G48 A;  4BY1 G;  1Y14 B;  1S3O A;  3H0G H;  2HT1 A;  1HZA A;  2WB1 E;  2ZM6 Q;  1E24 A;  2UU9 Q;  5GRO A;  1O7I A;  2RHQ B;  1H95 A;  2YU9 H;  2DUD A;  1XPU A;  4MZ9 A;  3S15 H;  3HFZ B;  3J7A 5;  4A76 A;  4IJL A;  4QQB X;  4C2M H;  1XPR A;  1L1O C;  3UE1 A;  3M7N A;  4IFD G;  4JC0 A;  5E7N A;  4C3H H;  1PH3 A;  4LFA L;  3KF8 B;  4PG3 A;  4DV4 L;  3RNU A;  3ER0 A;  1YHA A;  3EBE A;  1PH9 A;  3OW2 A;  4A3G G;  2MO1 A;  4A3E H;  4A3J G;  4JI3 Q;  2VY3 A;  2JA8 H;  1EFW A;  4JYA L;  2UXC Q;  1VCI A;  3T1H Q;  3BJU A;  4DR3 Q;  4LF4 L;  3S17 H;  1SLJ A;  3G4S A;  2Z6K A;  2NZO A;  4B3M Q;  4OX9 Q;  3K8A A;  2D0P A;  4LW1 A;  1IZ6 A;  5M3F H;  4TQU S;  1R9T H;  4JI1 L;  2OWO A;  2N49 A;  1Q81 C;  1NJI C;  3HOW G;  2KBN A;  4BA1 I;  4YWL A;  4X62 L;  5M3M H;  4A3I G;  5C4J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...