3DM3A

Crystal structure of a domain of a replication factor a protein, from methanocaldococcus jannaschii. northeast structural genomics target mjr118e
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
DTYNIGELSPGMTATFEGEVISALPIKEFKRADGSIGKLKSFIVRDETGSIRVTLWDNLTDIDVGRGDYVRVRGYIREGYYGGLECTANYVEILKKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Replication factor A
publication title Crystal structure of a domain of a Replication factor A protein, from Methanocaldococcus jannaschii. NorthEast Structural Genomics target MjR118E
rcsb
source organism Methanocaldococcus jannaschii
total genus 21
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3dm3A00
2VW9A 1SN8A 1KQSA 2ASBA 1XTDA 4JV5L 3CC7A 4DUYL 4GKJQ 3K0XA 4ALPA 4ME3A 2KBNA 3E9HA 2R7ZH 2OTJA 2ZTCA 4X64Q 2IHFA 4BA1I 3UDFA 2PMZE 2LXJA 3NEMA 2JA8H 4GNXB 1KIXA 4POGA 2UUCL 3GTJH 2HQLA 1HJPA 4DV1Q 1UEBA 1V1QA 4A3MH 1SR3A 4DV4Q 4B3TQ 2N78A 3A74A 1W2BA 2R93G 2KENA 5BR8Q 2AMCB 4A76A 1Q86C 2ZM6L 1VQGA 4JBWA 4A3EG 1XNRQ 1K0RA 4POFA 3UDGA 4NXNQ 4YWKA 3KF6A 4IJLA 3F2DA 1XMOL 1VS0A 3RN5A 1L1OC 1A8VA 2R6GA 1E24A 2YV5A 4DAYB 1Q12A 3EN2A 4EQ5A 1C7YA 4IFDI 3K81C 3S14H 3L0OA 1S40A 4LFBL 3HOUH 4APVA 4AQYQ 3NELA 4OXPA 4R4CA 4A3JG 4DR1Q 1EYGA 5FLMG 2IX0A 2UXBL 4DV3Q 3CC2A 5IE8A 1QVFA 4IOCA 3H0GG 4BY7H 1Q8KA 1IXRA 1QVGA 3RZOH 3M3YH 4P74A 1X54A 1T9HA 1X55A 2WB1E 4HJ9A 4DR4L 1VQAA 4BXXG 3AEVA 4A3DH 1KL9A 4OWXB 1VQJA 1CKNA 1U0LA 2H5XA 3K80C 1M90C 1VQIA 1VQ6A 2GVBA 1EQQA 3W5OA 2RHQB 4P75A 4X64L 3Q8DA 4DR6Q 2F4VQ 3I7FA 2Q2IA 2YTVA 1VQ4A 4JI1Q 4JCVE 4HJ5A 2UXCQ 1YIJA 5JJIA 4DV1L 1HZAA 4LUOA 4NPSA 4LUZA 1FJGL 1EWIA 1E1OA 3S24A 3S1NH 2B63H 1Y1WG 4DV4L 4B3TL 5JJLA 4BBSH 2VY3A 4A3KG 1QZGA 3CW2C 4R4OA 5BR8L 3J81c 3H15A 1VQOA 3HOVH 1AE3A 2CFMA 2GVAA 3CF5A 3M7NA 1JE5A 4NXNL 5IYBG 1YHBA 3KLWA 1BBUA 1I3QH 3FKIG 1N9WA 3A0JA 2V1CC 4DK3C 3PUZA 1XNQL 4L5QA 2Q2HA 2A1AA 2KHJA 3CCLA 3J7ZC 3EIVA 5C3EG 1I6HH 1GKHA 4DV2Q 4GNXC 4IFDJ 1J5EL 1E1TA 4A3DG 1NY4A 3CPFA 1HR0Q 1VQCA 1PYBA 4LF6Q 3U4ZA 3DM3A 4C3IH 3T1HQ 1PH2A 1AE2A 2ZJPA 4P73A 3JAMi 2QEXA 4JI8Q 5GAHC 1GM5A 1Q1EA 3J7A5 1KAWA 2CWAA 1QUQA 5M3MG 4MNOA 2L15A 4TVAB 2VQEQ 2WP8J 3STBD 1OTCA 4PMWA 1SE8A 5C44G 2F4VL 3ICEA 4GN4B 3ULPA 1WOCA 4LF9Q 2ALYB 2LXKA 3E0EA 4O2DA 4JI1L 3CCEA 4GKKQ 4A93G 5IP7G 1VQ7A 4JI7Q 2IHEA 2OQKA 3IRBA 1PFSA 1TWHH 4OWTB 1N32L 5IYDH 3PUXA 4HJ8A 4KLKA 3D0FA 3KDFB 5IP9H 4YHHL 4JI5Q 1WI5A 1UWVA 1JJCB 4JBKA 3GTMH 1VQ8A 4QIWE 3I55A 3GTPH 4MTNA 3M9BA 2EQSA 4HIOA 3J80c 2PQAA 4R4QA 3CPWA 4JI0L 4QQBX 4HJAA 5C0XI 2UUBQ 4R1JA 1VQHA 2K5VA 2NVTH 1NMGA 3JC66 3HOYH 1TXYA 4A3LH 4IPHA 5C4JH 3TEHB 4YY3L 4P72A 2HT1A 3HOZH 1NMFA 3F1ZA 3M4QA 1Q81C 3AFQA 1HR0L 2C35B 3ER0A 5H1SE 4LF6L 3TRZA 1NBWA 1SROA 3T1HL 5C4XH 3RLOA 2JK8A 2ID0A 4YWLA 3F2BA 1E7ZA 3KF8B 1IBKQ 1C9OA 3STBC 1A63A 4A3FH 2Y0SE 1N34Q 3M85A 3S16H 1IZ6A 3PUYA 4JI4L 5LMUL 4JI3Q 2MFIA 3GD7A 4RMFA 1VQ9A 1WYDA 3PIPA 3G6EA 1U5KA 4GLVB 1K8GA 2HHHQ 4JYAL 4LF9L 3F2CA 4J15A 4GKKL 2AHOB 4UP8A 3UE1A 1WCMH 3CD6A 4JOIA 2I5MX 3BJUA 1PHJA 1KC8C 3KJOA 3CMEA 3W1GA 2Q2TA 1Y1VG 3KFUA 2F3IA 1VQPA 4GLXA 1A62A 3G4SA 5LMNL 4L5SA 1M1KC 4UP9A 4A3CG 1HH2P 2I0QA 4A3IH 1CKOA 2UUAQ 4YWMA 1K73C 5C0XJ 2ZJRA 5LMNW 4H02A 3M4OH 2K4KA 2RF4A 1JB7A 5K36G 4GOPB 3I4MG 1BKBA 4A3BG 1OXUA 1QVCA 2F52A 4X62L 3HKZE 2YTYA 1X3GA 1X3EA 1EQRA 1Z47A 2NVYH 2R92G 4QY7A 4DV5Q 4DUZQ 3S2HH 1IL2A 3S1QH 4LWCA 3PGZA 5HGQA 1IBKL 1XMQL 5GROA 1N34L 1V43A 2Z6KA 3S17H 1NJIC 1MKHA 2RHSB 2JE6I 1KXLA 2R7ZG 2E5LQ 4FDBA 1DGSA 1TWFH 1VQFA 5M3FH 2AWOA 2JA8G 1XPUA 4B3SQ 1UE7A 4GKJL 1PH1A 3I4OA 4AYBG 1PA6A 4EX5A 4A3MG 5J3BA 4X66Q 1IBLQ 2JEBI 2CCZA 5ELNA 5GQOA 3CMAA 4QJFA 3ZJYC 1PYSB 2AWNA 1TWCH 2OCEA 1ASYA 2NZOA 3A5UA 2NZHA 2NN6I 3CCSA 2B63G 4PZ6A 4LFAQ 3PO3G 3PIOA 1EIFA 2QGQA 1N36Q 1JJ2A 2E2IH 2CWPA 1Z9FA 4LF5Q 4KHPQ 3HOXH 5IYCH 2HIXA 2RCNA 3GTKH 4IPDA 1XNRL 5IY0A 3HOUG 1MJCA 4IOAA 4DV5L 4IPCA 4C3HH 3NBHB 1KRTA 4DV6Q 5FJ8H 4Y52H 4B3RQ 1TWGH 2JEAI 4BY7G 2K50A 5C0XG 1C0AA 1TWAH 1Q82C 2MO0A 5HY6A 3G48A 1IBMQ 2ATWA 4AQYL 3TS0A 1HNWQ 4DR1L 3GTGH 4GOPC 1CKNB 4DV3L 1YEZA 4LUVA 3CCJA 3RR5A 1PH6A 2EIFA 1WJJA 3FHWA 1VQEA 4BY1H 4DR5Q 4DKAC 2GN5A 3HKSA 2CKZB 2AKWB 1X9NA 1QZHA 3M4PA 1HNZQ 4X66L 5IWAQ 3G71A 4L5TA 4OO1I 3KDFA 4QGUA 4BBSG 2Q2UA 4DR6L 1YJWA 1L1OA 5IYCG 3HOVG 2YU9H 1B8AA 1HZCA 1VQLA 4X65Q 1K9MC 2VUMH 3U50C 3CCRA 2B29A 2JA7H 4LFAL 4YCUA 1X56A 2BA0A 2OQ0A 4DV0Q 1LTLA 2PI2E 4JI6Q 4LF5L 1Q46A 2ZTEA 3U58A 4GN3B 1P8LA 2YYZA 2DUDA 3UDIA 2MO1A 4DV6L 2OTLA 4LF4Q 4YCVA 3RLFA 2UXCL 4JI2Q 1AH9A 2FXQA 3K7UC 2E2HH 4O0AA 1K8AC 4OX9Q 2CQOA 1G6PA 2NVQH 3S1MH 4DV2L 4RG1A 1KD1C 5EAYA 1IYJB 4C2MH 4HIDA 4A4IA 3H3VH 3HOWH 1QUQB 2XGTA 1KRSA 3CP0A 1BVSA 3PO2H 4AIMA 4UY8C 3L2PA 1GVPA 4JI8L 1HR0W 1RIPA 4NB3A 4BBRH 4DAMA 2E2JH 2VQEL 1FGUA 4R4TA 4YCWA 2BH8A 2JA9A 2I5HA 3I2ZA 4L5RC 3AQQA 2MQHA 4PG3A 4JG2A 5IYDG 2UUCQ 2UXDL 1FL0A 5IP9G 2WAQG 1YITA 1EUJA 4HIKA 2D0PA 4K0KQ 1H95A 3JAMc 2BH2A 1PH5A 4Y7NH 4GNXA 4JI7L 4XTCS 1GO3E 3HOYG 4A3LG 5JJKA 2PQAB 1X65A 2EXDA 3FP9A 1XPRA 4DV0L 4JI5L 1W3SA 3PSIA 3TREA 1PH7A 2BA1A 1SRUA 3HOZG 3TS2A 3PF4A 1XMOQ 3RN2A 1K83H 1Q1BA 1JT8A 1CSQA 4DR7Q 4LF4L 2UUBL 2R93H 5C4XG 1PH8A 4JI2L 3GTOH 1UE1A 2K52A 4A3EH 3I4NH 1OXTA 2NN6G 3D31A 4A3FG 4LNQA 4OWWB 1SFOH 1B7YB 4DR4Q 1B70B 3CQZH 1L0WA 3OTOQ 3BZCA 4OONA 4A3JH 3PV0A 2ZJQA 1VCIA 2Z0SA 3AYHB 5FLMH 4C3JH 3UDXA 3J81i 1WCMG 1OXXK 3H0GH 2PNHA 1VQBA 5M5WH 3RLNA 3RNUA 1RL2A 4JI3L 3K8AA 4LW1A 4BXXH 4TQUS 5M5YH 2HHHL 3ERSX 1ASZA 4K0KL 4DV7Q 2DGYA 3PUVA 4GS3A 2WFWA 2PI2A 1FJGQ 3S15H 1SLJA 3KOJA 1G291 3GDEA 1S3OA 2WB1G 3OYYA 4UP7A 5JEAJ 4HIMA 4A3IG 1VQKA 4WJ3M 4KHZA 5GADC 1YZ6A 2N3SA 1XPOA 2K5NA 2VQFQ 3I4NG 4IO9A 3H3VI 1K3RA 3TQYA 1XNQQ 3CAMA 1J6QA 1Y1WH 1YHAA 1R9TH 4OO1G 3PUWA 4DPGA 4DR7L 4A3KH 2UUAL 1J5EQ 3MXNB 5GAEC 1VQDA 1NE3A 3CXCA 1P16A 5IYBH 3KF6B 3FKIH 1O7IA 2K5HA 4PZ8A 3W1BA 3CCMA 4A3GH 1UE5A 5C3EH 3GTQH 3KYHC 3OTOL 3DLLA 1PV4A 1E3PA 4DUZL 1HNXQ 4LF8Q 1EFWA 1NTGA 4AYBE 4GN5A 5M3FG 1UE6A 1PH4A 1YHQA 2IY5B 4JBMA 4HJ7A 1N33Q 1N8RC 3J80i 1CUKA 4NXMQ 3EBEA 5M3MH 1HZBA 3AFPA 1VQMA 2E5LL 2I5LX 4DV7L 1CKMA 3T1YQ 3PCOB 1N32Q 5FLXc 1CSPA 1KHIA 4YHHQ 2MNAA 5C44H 4B3SL 2VS1A 1I5FA 4DR2Q 4GLAC 1D7QA 4A93H 1YBYA 3RZDH 1I50H 1E22A 2JQOA 2VQFL 3GO5A 5IP7H 1IBLL 2OWOA 3J81j 3CCQA 1LUZA 3CCUA 4JI0Q 1S72A 2K75A 3HOXG 3I56A 3PF5A 4A3GG 1EIYB 4YY3Q 2E8GA 3F8TA 4WJ4A 2NVXH 4DR3Q 3K7AH 4JOIC 5JEAG 5FJ8G 4AH6A 1JJGA 3UE0A 5ELOA 4IJHA 4PZ7A 1N36L 3BZKA 4X6AH 1X3FA 2JA6H 1GD7A 4KHPL 3VDYA 1I94Q 1JMCA 1YJ9A 4XIGS 3LGJA 1HNXL 1OXSC 4LF8L 2UXDQ 1YVCA 2UU9Q 5AJ3Q 4B3MQ 4B3RL 3SGIA 1YNXA 4JI4Q 2VZAA 5LMUQ 2JA5H 4MZ9A 1VQNA 1BBWA 2ES2A 1A0IA 4LFCQ 3GTLH 4BY1G 2HIVA 1PH9A 1IBML 1N33L 4JYAQ 4JBJA 1LM0A 4LF7Q 1PVOA 4NXML 1HNWL 1XJVA 4DK6C 4JV5Q 2D62A 2XTIA 4DUYQ 4P71A 3T1YL 1Y14B 4R4IA 4DNIA 3CCVA 2IX1A 3A5ZB 3L7ZC 1EOVA 5IT9c 1L1OB 4DR5L 4DR2L 2K14A 3WWVA 2N49A 2Y0SG 5LMNQ 2VUMG 2JJQA 1HNZL 1SMXA 2Z6KC 1D8LA 3ULLA 3CC4A 2B3GA 1OXVA 2R7DA 3HFZB 5IWAL 2JA7G 4BA2I 2KHIA 2JA6G 2YTXA 2ZTDA 1Y1VH 2N8NA 4QL5A 1VQ5A 4DR3L 4X65L 2KCTA 2VNUD 2D0OA 4X62Q 5E7NA 3KJPA 1LYLA 4A3CH 5M5XH 3E9IA 3PO3H 1YJNA 1Q7YC 2R7FA 2ZM6Q 4KI0A 4GOPA 1PH3A 2JA5G 4JI6L 4UPAA 2KCMA 1WFQA 3S1RH 1L2FA 1I94L 3I4MH 1HZ9A 1MIUA 4A3BH 3S2DH 3HOWG 2A8VA 2A19A 1G51A 2QA4A 3MEFA 1FVIA 1V9PA 3NENA 5AJ3L 4A75A 4JC0A 1YI2A 1XMQQ 2UU9L 4B3ML 3PO2G 5GAGC 2VL6A 1MJEA 4IPGA 4IFDG 4OX9L 2R92H 4LFBQ 2LSSA 4BBRG 2IT1A 4LFCL 1X6OA 3ULJA 3OW2A 3HKZG 2WAQE 2UXBQ 3U4VA 5DLQE 3BU2A 3B6YA 4LF7L
chains in the Genus database with same CATH superfamily
5G3LD 1SN8A 1PRTF 3K0YA 1IHZA 1QCBD 1E2ZA 1GUNA 4GKJQ 4ALPA 2VB3X 4FXDA 1NR2A 1S5CD 2JA8H 2F0EA 2I07B 3GTJH 5M5WB 3N52A 2E74C 1HJPA 3A55A 1F77A 4A3MH 1II3A 4RGOS 2L4NA 4DV4Q 2N78A 3OHXC 1W2BA 3LX0A 4X3UA 3H3VC 3UI2A 1VF5C 4JBWA 4U673 1XNRQ 2NBFA 4NXNQ 4YWKA 5LL6X 3PO3H 3I90A 1L1OC 2R6GA 4KMUC 1E24A 4CKBA 4PNYA 3EN2A 4EQ5A 4IFDI 1BDOA 1SJED 1Y1WB 2F0GA 4LFBL 5KIXA 3NELA 2UXBL 1QVFA 4IOCA 2XNAC 1SMYD 1Q8KA 4ILWA 1QVGA 4BY7H 4P74A 1X54A 1ZKOA 4DR4L 5LHY1 5EJWA 1M90C 2DNEA 3BZDB 2GVBA 3W5OA 1H9KA 4NDXA 2Q2IA 2ZT9C 1EY0A 2K1BA 4B9XA 1LT3D 1BR9A 4DV1L 5I4DA 4NPSA 4LUZA 2Z6BA 1E1OA 1FD7D 3K6OA 1Y1WG 4B3TL 3BYTB 4BBSH 5A2QE 1GUSA 1QZGA 5BR8L 1JWUD 2HDMA 1PRTC 1B2TA 3CRKC 1WTVA 1I3QH 2A1AA 1V8QA 2B2WA 3EIVA 5IGBA 1GKHA 4IFDJ 1J5EL 3CPFA 4H7BA 2NVXB 1PYBA 3KBXA 3PMFA 3D3RA 3U4ZA 3DM3A 4N8X1 1IKMA 2ZJPA 1KNEA 3R2TA 3GQBA 3J7A5 1NSNS 2CWAA 2IW3A 1QUQA 3A8IE 4DAVA 2TMPA 1LLRD 2NWGA 2WP8J 3MXPA 3QJYA 5EPLA 1SE2A 1SE8A 3STBD 1OTCA 1AZPA 2EYPA 3CCEA 4GKKQ 3GTLB 1VQ7A 2OQKA 1PFSA 1TWHH 4KLKA 3D0FA 2B2YA 4JI5Q 4UAIA 2OXPA 2RVLA 1D5XC 2ZXPA 4HIOA 2PQAA 4R4QA 4HJAA 2NVTH 3M7NA 1VQHA 2K5VA 4A3LH 5LL6S 2DY7A 1TIID 5IOCA 4P72A 2A68C 3F1ZA 2HUGA 3M4QA 3AFQA 4C1NI 1U4PA 2C35B 1HR0L 3OMGA 4LF6L 1NBWA 4XT3B 1WTXA 2HQEA 5M5XB 4K5VA 5I2YA 2JK8A 2ID0A 4YWLA 1FNUA 2L9HA 1C9OA 1KLUD 4L6TB 3S16H 1IZ6A 3AMUA 2Z1CA 2C5CA 3PIPA 1U5KA 4QMGA 4J15A 4UP8A 2JXMB 3UE1A 4JPBW 1KC8C 3CMEA 1GUGA 3I8ZA 5IIFA 1K3BC 1PTOH 1A62A 4L5SA 2A6EC 1HH2P 1LACA 1WTPA 1TS3A 3Q23A 3HRZC 2ZJRA 1WD0A 3E5SA 1OXUA 2F52A 4DU9A 1PLFA 1X3GA 1SYEA 1X3EA 1LTAD 4DV5Q 3S2HH 5J39A 1NCVA 4Q5VA 2B63B 1XMQL 3JAME 5GROA 2F0IA 4EQNA 3NUCA 3SK6A 2Z6KA 3KLSA 4A3KB 1KXLA 2E5LQ 1DGSA 4P2CB 3V05A 3HOUB 3C46A 3K58A 1SAPA 3HGBA 4B3SQ 4GKJL 5IGEA 3RZOB 3M3YB 3I4OA 1QG7A 2CCZA 2K32A 2WACA 4IALA 5FK9C 1JWSD 2AWNA 1TWCH 3FPPA 2B63G 2NZHA 3PIOA 2K7VA 1JJ2A 3VA5A 1E2VA 2E2IH 4MIUA 3HOXH 5E3FA 4XT1B 2HIXA 3DHQA 3HOUG 1XNRL 5IY0A 2PW7A 1GOZA 4IPCA 4N8FA 3NBHB 5J22A 3RZDB 4HR7B 1CI3M 1TWGH 1OO9B 5C0XG 4F8MA 1TWAH 2SOBA 4UDUC 1JR0D 1G6ZA 1QNUA 2HD3A 3FEWX 1SJHD 3RUZA 3TS0A 1CKNB 4LUVA 2NB0A 3FHWA 4DR5Q 3TP5A 2GN5A 3HKSA 2CKZB 4KJNA 5KGUA 3MA2B 1ZXTA 1YJWA 3QIAA 1L1OA 5IYCG 1IW7D 1YNJD 2R3ZA 4X65Q 3ND9A 3SHLA 1CTMA 3KK7A 4LFAL 1BBXC 2EVBA 2PI2E 1EY4A 4PMBA 4G7OC 3MC0B 1G2SA 1WTRA 4UHVA 1P8LA 3C1FA 2WAQB 1CFMA 3UDIA 2MO1A 3C1EA 4JI2Q 4O1NA 3K7UC 1TU2B 4O0AA 4OX9Q 1G6PA 5EAYA 4ZQ3A 3MXGA 4ZLTF 3H3VH 3HOWH 2XGTA 3QWNA 1KTKA 4AIMA 3K5LA 2CH4W 4BBRH 2K5DA 4RAUC 4YCWA 3I4MB 1DOKA 4H0LC 5IYDG 1MBYA 2AUKA 2WAQG 4JVZA 4NP5A 5COYA 1KDCA 4RHSA 3IFDA 4FF1A 1ML0D 5JJKA 4LK1C 3HG9A 1PH7A 4JI5L 1W3SA 2QEJC 1H9RA 3K5MA 2K33A 3TS2A 4IUQA 4FXKC 1CZGA 3PF4A 2J4XA 1XMOQ 2A69D 1K83H 1CSQA 4CDDC 2R93H 1UE1A 1H9SB 3GP7A 4ID6A 3EROA 4LNQA 1B7YB 4V190 1Y69U 2Z0SA 3AYHB 5FLMH 3J81i 1IYUA 4X3KA 2JSOA 2WIIB 1OXXK 3IFTA 5KEEA 1SYFA 2PNHA 2RA4A 1SYCA 3K8AA 1WTWA 1W6KA 3MVVA 2BDNA 4DV7Q 4GZYC 3PUVA 1FJGQ 2PI2A 1VQKA 1TWFB 4WJ3M 1STHA 1YZ6A 2N3SA 5D3DA 1K3RA 1ET9A 1I4PA 2R61A 1J6QA 4OO1G 1CZWA 3PUWA 4A3KH 3QOJA 1PZKD 1YNNC 3NBHA 3CXCA 1O7ZA 4J6HA 1XXGA 4FVMA 3FKIH 1O7IA 3W1BA 4A3GH 3MFGA 2CH4A 2VB2X 5C3EH 1ENCA 3GTQH 3OTOL 3GTKB 1NTGA 1GJXA 4AYBE 1D5MC 4GN5A 1G8ZD 1PH4A 1CA5A 2EYMA 1N33Q 3J80i 4K2LA 3EBEA 3X3MA 3AFPA 2E5LL 5TSSA 4ZAIA 2I5LX 2PZTA 2F0LA 4FYDA 5FLXc 3GTGB 1KHIA 1DD2A 4B3SL 5D65A 4DR2Q 3A7LA 2IX3A 3BG3A 3RZDH 1A2TA 2OWOA 2JQOA 1ENAA 5IP7H 3CCQA 1LUZA 4XXEA 1EY7A 1ZEQX 1EYDA 2E8GA 3Q22A 4DR3Q 1LTBD 3K7AH 1HXYD 2J0TD 5JEAG 2F0OA 2VUMB 4IJHA 2LFNA 3BZKA 4LF7L 5NUCA 2PCFB 1YJ9A 1BO0A 4CBVA 1HNXL 4LF8L 2BDOA 2UU9Q 3SGIA 1LTGD 2JA5H 2ES2A 1A0IA 2E2HB 2RDGA 4JYAQ 4JBJA 4LF7Q 2FINB 1Y14B 4K8JA 4IFDH 3CCVA 2IX1A 1I4HA 5IT9c 1LTTD 3T51B 4DR5L 2VUMG 2M9VA 4OHJA 1SMXA 2UXCL 3ULLA 4BA2I 1OXVA 3HFZB 5G3LF 1EEID 3I72A 1Y1VH 2D5DA 3FDTA 4X65L 2KCTA 2KCCA 1YJNA 3TDQA 5BN4A 1E0BA 4QB4A 2O4XA 1PTOF 1F2MA 3I4MH 1HZ9A 3ITPA 1S5DD 4A75A 2QA4A 4B3ML 4JC0A 4F7XA 5GAGC 4LFBQ 4OX9L 2R92H 2LSSA 2UXBQ 3HKZG 4A3EB 3VR5A 2VW9A 1KQSA 2ASBA 3G7LA 5CGKA 1PZJD 2AQ3B 2A6HC 2B2VC 3T16A 4K14A 4ME3A 1O7LA 2K5QA 3CQZB 2R7ZH 2OTJA 3MAQA 2B2WC 2ZTCA 4A3JB 4BA1I 1TY0A 3S1QB 3NEMA 4C3JB 4GNXB 4FNFA 4HSVA 2KJXA 4DV1Q 2EJFC 1V1QA 5M5YB 1MHWC 4K5XA 1T5EA 1U4LA 4B3TQ 4OIJA 2KENA 5BR8Q 1QILA 2AMCB 5KNCA 1SDFA 2XRQD 1VQGA 4A3EG 1K0RA 1RKNA 3UDGA 1X32A 4KY7A 3MFYA 1XMOL 5C5MA 1F9RA 4DAYB 1Q12A 3D4WA 1HRJA 1ESFA 3H91A 1R9TB 2KUMA 1S40A 5IODA 4A3JG 4ZKBB 1EYGA 2B2YC 4EGVA 4C3JG 4DV3Q 5IE8A 3H0GG 3NQIA 5JVG3 1IXRA 4K8IA 4DGZA 3AU7A 1X55A 4A3DH 1VQJA 1U0LA 1VQ6A 3QOLA 2M2LA 4X64L 1PTOC 3DXJC 4HJ5A 5JJIA 4HCEA 1FJGL 1EWIA 2EYLA 5DEHA 5M3MB 2Z4IA 4K2KA 3J81c 3H15A 1STGA 2OF1A 1VQOA 4N9PA 3VR4A 1JE5A 5ELDA 5IYBG 4DK3C 3EFXD 2RDHA 3J7ZC 1I6HH 3GV6A 1NY4A 1HR0Q 4LF6Q 1ESRA 2NUCA 3ONAB 3JAMi 4JI8Q 2O5JC 4XQJA 2JA6B 5M3MG 3MZ5A 4PMWA 3ICEA 1VF7A 1BCPB 2IPKD 1NUCA 2IHEA 3IRBA 3T53B 5JOBA 4DNRB 3PUXA 2LKVA 3KDFB 1QWYA 1UWVA 4JBKA 3QG1A 3GTMH 1VQ8A 3I55A 3GTPH 2KA7A 4KJOA 3J80c 1ICWA 1CHPD 5C0XI 4R1JA 3HOYH 3JC66 2K04A 1LTSD 4ULLA 1BCPD 1XX8A 1QNKA 1ENFA 3PQIA 5C4XH 3TP8A 3RLOA 1E7ZA 1TT2A 3S1RB 3STBC 1A63A 1F2ZA 2L0CA 4JI3Q 2MFIA 4RMFA 1WYDA 1K8GA 3G6EA 1EY5A 4JYAL 3F2CA 1DOMA 4S3SA 1RTNA 1WCMH 3DWQA 3BJUA 3KJOA 1CQVA 4WORA 2F3IA 5FOBB 3HS0C 2K01A 4A3CG 3I4LA 1CKOA 4YWMA 1UNSA 5C0XJ 1K73C 3L3OC 3M4OH 4NW2A 3MWYW 3FVQA 2YTYA 3EVQA 4LAAA 3S15B 4MHEA 1EQRA 3D6CA 1UEAB 2RQXA 1EZ8A 2I46A 2ENBA 5T1GA 3BDOA 3S1QH 1IBKL 1JOKA 3L9AX 1NR4A 5EBCA 4RHRA 2WKCA 3S17H 1NJIC 2JE6I 2KOLA 5C5LA 1VQFA 3SK5A 3E3XA 2AQ1B 1UE7A 1VMPA 1PH1A 2B8FA 2EDGA 4EX5A 2B2UC 2DJGC 2JEBI 5ELNA 3I70A 4QJFA 2RDFA 1PYSB 1ASYA 1Q90A 2XSCA 4ODGA 4K5WA 2EY6A 2PW5A 2K6AA 2NZOA 3X3NA 3A5UA 4LFAQ 2QGQA 3FPUB 2G9DA 3DEOA 3S1NB 3Q0AA 3P75A 2B2VA 2K50A 4RCOA 1Q82C 3G48A 4DA2A 2ATWA 1PZID 1CHQD 3R2IA 5A35A 5EQ0A 1PFNA 4DV3L 1YEZA 2PO4A 1PH6A 3Q6SA 1X9NA 3M4PA 4KTAA 3SXHA 5T1IA 5IWAQ 3G71A 4OO1I 3KDFA 2MPMA 4DK0A 4WFN3 3HOVG 2YU9H 1B8AA 1B50A 1VQLA 3U50C 1QJOA 3HZXA 1JCKB 3MEHA 1STBA 2JA7H 3MTSA 1NAPA 1EFID 2MJ8A 4LF5L 1Q46A 2ZTEA 2EY1A 2FMCA 4GN3B 3OIQA 2G5DA 3PIP3 4DV6L 4C3IG 2OTLA 2PNRC 2CQOA 2NVQH 3U9OA 1KD1C 5C4JB 2EYJA 2DJFC 2WKDA 2F0HA 3OOCA 4G57A 3CP0A 4FXGC 5I6WA 1BVSA 3PO2H 1HPCA 4JI8L 3IAYA 1HR0W 4NKLA 3TZDA 2I5HA 3I2ZA 2PZUA 5JAVA 4L5RC 2MQHA 3T13A 2QF7A 4JG2A 2UUCQ 1FL0A 5FKAC 1YNJC 5IP9G 1H9JA 1YITA 1B4OA 3K5OA 3JAMc 2BH2A 4EVOA 1GO3E 1X65A 2Z4HA 3TP7A 3TSSA 4DV0L 2BA1A 1SRUA 3HOZG 1TVXA 1JT8A 2F0NA 1PH8A 4A3IB 3I4NH 1JQYD 2FJ2A 2F1MA 2NN6G 4A3FG 3SEBA 2SDFA 1B70B 3OTOQ 1TS2A 1J9OA 2F0PA 2P5ZX 3RMHA 3PV0A 1I4QA 1VCIA 3UDXA 3CKIB 1RDPD 3RNUA 5M5WH 4JI3L 3R3OA 1ASZA 4K0KL 2DGYA 2KEEA 4RCNA 4CJ1B 5JJZA 3S15H 4A3IG 5JEAJ 2WB1G 2Q8TA 3K5NA 1D1IA 3U9SA 2K5NA 2A69C 4IO9A 5EBDA 3TQYA 1PRTD 1XNQQ 1Y1WH 1YHAA 4DPGA 4DR7L 2EXZA 4DK1A 2A73B 1S5BD 3KF6B 2V4DA 2K5HA 4PZ8A 4X3TA 3CCMA 1UE5A 2B8GA 1HNXQ 1HQRD 3DLLA 1S4ZA 4LF8Q 1TY2A 5JPNC 2CW0C 5M3FG 4TRDA 4DXFA 4HSPA 4JBMA 4HJ7A 3J7AV 5EKIA 3WDNA 1HZBA 3OWEB 4FF2A 3TZUA 4R9WA 4YHHQ 2MNAA 2BE5D 3V2TA 2NYZD 1RCVD 4BY1B 1SNOA 2VQFL 3BYYB 2UXCQ 2LMCB 3OIPA 2K75A 5ISRA 1F9QA 3PF5A 4A3GG 4YY3Q 2NVXH 2SNSA 4CKCA 2A68D 4C3HG 5FJ8G 4AH6A 3HP3A 1A15A 2AUJD 5ELOA 4M8AA 4X6AH 4XQNA 1GD7A 3VDYA 1KDBA 1ONLA 4B3MQ 2B2UA 5LMUQ 1JORA 3E6ZX 3DM1A 3GTLH 4BY1G 2HIVA 3S1MB 1PVOA 1XJVA 2PMZB 5CORA 1STNA 1SYDA 4P71A 4R4IA 3L7ZC 1EOVA 2N49A 2Y0SG 5LMNQ 2QW7A 2VXWA 2KVMA 4KKTA 1E2WA 5IWAL 2ZTDA 2NZ1D 4QL5A 4LMQD 2VNUD 2L12A 4X62Q 5M5XH 1HCZA 1EL0A 3M7GA 2JA5G 2Z9HA 1FNVA 1I94L 1V1PB 5CMDA 1AN8A 1L0XB 1G51A 4R8IA 3MEFA 1FVIA 1YI2A 2XN9C 4IFDG 4IPGA 2MHVA 2QKIC 3OW2A 3ULJA 3GTOB 2WAQE 4HAEA 3ZYYX 3B6YA 1VQCA 1TQOA 1XTDA 4JV5L 3NK9A 2QDLA 2L55A 1EYCA 1M4VA 3EA6A 1HA6A 4X64Q 2PMZE 4DF7A 1KIXA 4POGA 2UUCL 5DNFA 2N55A 1FGBD 1A6XA 4KKUA 4FP5D 1UEBA 1R4QB 3A74A 1UAPA 3SE0A 4A76A 2ZM6L 1GXDC 2F4IA 5D14A 4ZUIA 2SNMA 1SSOA 3IL8A 2B63H 3KF6A 3F2DA 1VS0A 1A8VA 2CHBD 1B9MA 3L0OA 1DXMA 3HOUH 4R4CA 4OXPA 5FO9B 4DR1Q 3FRPB 2IX0A 5C0XH 5EPKA 3RZOH 3WOFA 3KLRA 1FR3A 5EGTA 3M3YH 1EQVA 1T9HA 4BXXG 1VQAA 1KL9A 1CKNA 3K80C 4K6DA 1H9MA 2XWBB 3Q8DA 1PYWD 3I7FA 1XYIA 2YTVA 1D1KA 3QB3A 4JCVE 3J7YW 1YIJA 4DFAA 1HZAA 3S24A 5JJLA 1VMCA 2VY3A 3CW2C 4R4OA 2CFMA 2GVAA 5C44B 3CF5A 4A93B 1XNQL 3PUZA 5KNDA 4L5QA 2Q2HA 3D4DA 1PFBA 1EEFD 4IZ8A 4DXGA 4ME5A 4GNXC 4A3DG 2SEBD 1PH2A 1Y8OB 4OELB 4P73A 2QEXA 5GAHC 2KEDA 2VQEQ 2L15A 2D9UA 1QE6A 2F0WA 1BCPF 5C44G 2F4VL 2HCIA 2ALYB 2LXKA 4O2DA 4JI1L 4A93G 4C2MB 4JI7Q 4RGMA 4OWTB 1CQFA 5IYDH 4YHHL 1O78A 1WI5A 1Q3LA 3BVMA 4CDCC 2BCOA 2E2JB 1KNAA 1MSGA 5FLXL 3HKZB 2AQ2B 3CPWA 4QQBX 2UUBQ 3NHHA 3G6JB 4J1MA 4IPHA 4YY3L 2HT1A 1NMFA 1Q81C 5FO7B 4Y7NB 3ER0A 5H1SE 3TRZA 1SROA 1H9SA 3T1HL 4N9TA 4ZK9B 1SYBA 3KF8B 1IBKQ 3S2DB 4A3BB 5ELEA 5LMUL 3M4YA 5CV5A 2HHHQ 4GLVB 5J1ZA 5I2XA 4LF9L 3A8JE 4Z9CB 2AHOB 3CD6A 2I5MX 4QCLA 1RF2D 2Q2TA 1SFOB 1DM0B 4K6LA 4HEDA 1VQPA 4GLXA 3G4SA 5LMNL 3NQTA 2JYOA 4ZRZA 2L1BA 2I0QA 5IT9L 4C56C 3SVMA 2RCFA 2UUAQ 3H0GB 2XVSA 5LMNW 4H02A 2K4KA 5K36G 4GOPB 1BKBA 3GTJB 4A3BG 1RTOA 1STYA 1BCPC 4X62L 3HKZE 4OO1H 1AP0A 4HMJA 4ZKCB 5JVH3 4LWCA 3MHBA 3PO3B 3NPPA 1N34L 1SNPA 3BDCA 3NTIA 3WOEA 1MKHA 2RSNA 2RHSB 1EWCA 1QOHA 4ABNA 1TWFH 2EY2A 2O2LD 2XWJB 2AWOA 1Y8NB 1AFPA 2JA8G 4BY7B 5ELBA 1HQMC 3SK4A 4B08A 1PA6A 1BF4A 4A3MG 5J3BA 2F0SA 3DEPA 4L63B 1JOQA 3CMAA 1S5ED 1SNMA 3ZJYC 2OCEA 2ZXOA 4J8QA 3CCSA 1ZYRD 2NN6I 3PO3G 3J7AF 2CWPA 1Z9FA 4LF5Q 4KHPQ 4RGNA 4OEMB 2ZXRA 4BBSB 2RCNA 3GTKH 4IPDA 1MJCA 1LT4D 3Q24A 4DV6Q 1KRTA 5CV7A 5JEAH 5CV9A 1I50B 2GA4B 5ELFA 1I6VC 4BY7G 1I3QB 2B2TC 4XYOA 1IBMQ 1SBBB 3KLSX 1HNWQ 4DR1L 3GTGH 3C3LA 1SMYC 3URYA 1WJJA 4DKAC 1I4GA 1HNZQ 4X66L 4L5TA 2HCCA 3BVGA 5M9OA 2XRSD 4FF4A 1EU4A 5HGTA 2Q2UA 4BBSG 1SYGA 2HDLA 5IGGA 2VUMH 2IJ0A 2CVRA 2F0FA 3BDLA 3CCRA 2B29A 3P1HA 2BA0A 2OQ0A 4DV0Q 1LTLA 1TWHB 4JI6Q 4KN4C 4RH6A 3U58A 2YYZA 3R8BA 4TSSA 3J81L 1SNQA 3RLFA 2DNCA 3MXUA 2E2HH 1K8AC 2NVTB 2L11A 4I65A 1WTHA 1IYJB 4C2MH 3KF8A 1GUTA 1QUQB 1KRSA 2F0UA 3A54A 4UY8C 1GVPA 3NP8A 1PXUA 1RIPA 1C8CA 2E2JH 4DAPA 2VQEL 1JICA 2J7ZA 1D5ZC 2K28A 3H94A 2BH8A 2JA9A 3AQQA 4PG3A 2FFKB 1O7YA 3S16B 5CBAE 1EUJA 4K0KQ 2F3WA 1PH5A 4Y7NH 4GNXA 4JI7L 4IUTA 5K5PA 4A3LG 2PQAB 2EXDA 3PSIA 3TREA 3OWFA 2EYHA 1Q1BA 4DR7Q 4LF4L 2UUBL 1CT1D 5CV4A 2Q8IB 3DMUA 2K52A 4A3EH 3J80L 3SDZA 2ICEC 4DAYA 1IKLA 1OXTA 2F0MA 3D31A 1XTCD 1SFOH 2EE1A 3CQZH 3J80E 1CK1A 1JB3A 4A3JH 3NWSA 4TKOB 4XDXA 2QDBA 4C3JH 2F0VA 3S2HB 1SNDA 3H0GH 1VQBA 4G7ZC 2F0JA 1PTOD 1RL2A 4PQXA 4LW1A 1V1OA 3C2PA 3OMCA 5M5YH 2HHHL 2H4OA 3S14B 3ERSX 2KHSA 3TMEA 2DY8A 1F9PA 3SR1A 3KOJA 1G291 2K5WA 1S3OA 4UP7A 1B3QA 1U4RA 4KHZA 4CDEC 3SK8A 4O42A 2VQFQ 3I4NG 1TKWB 3CRLC 3CAMA 1R9TH 4V0BA 3W2DA 2UUAL 1VDZA 4JK1C 3MXNB 1VQDA 1NE3A 1TWCB 1EIGA 1T5XD 5IYBH 3BS1A 4PV1C 1LV9A 4QF4A 2E2IB 3ERQA 5FO8B 2JP1A 3A7AB 3HOXB 3HOVB 1PV4A 3D4RA 1DOLA 1UE6A 1TWGB 4RGTA 3O13A 5BN3A 1N8RC 5A2QL 5CBEE 4MTKA 5I6YA 1TWAB 1FYCA 2KQ3A 1K28A 3H09A 5M3MH 1SXTA 1CKMA 1N32Q 4E6IA 4C3IB 1CSPA 2MP1A 1TR5A 1FNWA 1D7QA 4ZUJA 1I50H 1E22A 1CM9A 3CCUA 4JI0Q 2ICIA 1S72A 3HOXG 3I56A 1EIYB 4WJ4A 1LT6D 4JOIC 3GV3A 1K8OA 1ET6A 3UE0A 4PZ7A 4WRDA 2JA6H 4KHPL 2PQEA 1I94Q 5IGDA 1JMCA 1G2TA 4XIGS 3LGJA 1OXSC 1YVCA 3CU7A 4JI4Q 4MZ9A 2FMMA 1IBML 3HOZB 4U68A 1PDQA 3HEJA 4NXML 1HNWL 4DK6C 4JV5Q 2D62A 2XTIA 4IUVA 3T1YL 3HOWB 2BE5C 2B39A 4KN7C 3A5ZB 1L1OB 2C9OA 3WWVA 4BBRB 1EU3A 1HNZL 2LS01 1D8LA 1HA5A 2B3GA 2R7DA 2O5IC 4A3FB 1IW7C 2KHIA 2YTXA 3DWAA 1VQ5A 3P20A 2B2TA 2D0OA 5E7NA 4A3CH 2E75C 4G7HC 2A74C 2R7FA 5CR3A 2F0DA 2ZM6Q 4KI0A 4JI6L 2E2DC 2KCMA 1WFQA 3S1RH 1HUMA 3HOWG 2A8VA 3OW7A 5C6AA 1K83B 2UXDL 5AJ3L 1Y8PB 1C4QA 1MD2D 2WB1B 1MJEA 2R93B 4BBRG 2IT1A 4LFCL 1KAAA 4IUNA 3BU2A 2TSSA 1DONA 3CC7A 5E4XA 4DUYL 1ICFB 1PRTB 2NVYB 3K0XA 2KBNA 4EQOA 3E9HA 5IGFA 4IN3A 2IHFA 3UDFA 2LXJA 5I9OA 3NWTA 3TN2A 3PIO3 4IURA 2HQLA 3NSWA 1SR3A 1IYVA 5DM63 2R93G 5M3FB 3N6RA 3MXNA 1Q86C 3JAML 4HMIA 4POFA 4OIKA 4IJLA 3RN5A 5CC4A 1EY8A 2YV5A 1C7YA 1EY9A 3K81C 2G9HD 3S14H 4APVA 4AQYQ 3LWEA 5FLMG 3CC2A 4EQPA 1SNCA 1RHPA 1B3AA 3FKIB 4HJ9A 2WB1E 2XIWA 4A3GB 1K8MA 3AEVA 4OWXB 1W6JA 5C3EB 3GTQB 2H5XA 4KK7A 1VQIA 5KYLA 4C3HB 1EQQA 2RHQB 4P75A 5AFWA 4DR6Q 2F4VQ 5EKKA 1VQ4A 4JI1Q 4QIWB 4QUCA 2JN4A 4LUOA 3S1NH 1GHJA 4DV4L 2E76C 4CJ2C 4A3KG 2OEOA 3HOVH 1AE3A 1DYQA 4NXNL 1LABA 1YHBA 3KLWA 1BBUA 3FKIG 1N9WA 3A0JA 2V1CC 1DJRD 3CCLA 2KHJA 1U9RA 4XQQA 5KYIA 4XYQA 5C3EG 1R4PB 4DV2Q 3OPOA 1E1TA 1BNZA 3V96A 1QB5D 4OGQC 2Y0SB 3K7AB 4C3IH 3T1HQ 1AE2A 2F03A 1I4XA 1GM5A 1Q1EA 3RD4A 1KAWA 1MI2A 4MNOA 4TVAB 2X6LA 3R93A 4GN4B 3ULPA 1WOCA 4LF9Q 2JA5B 3E0EA 2QILA 1F2YA 4B9WA 5IP7G 4YIJA 1BOSA 1N32L 5KRUA 4HJ8A 5IP9H 4RKBA 1JJCB 4QIWE 3D6WA 3M9BA 2EQSA 4MTNA 2A6ED 4BWGB 4JI0L 3OSOA 1NMGA 1Z6HA 1F9SA 1TXYA 5C4ZA 5C4JH 1BQQT 3W3AA 3TEHB 5IGCA 5E4WC 3HOZH 1LT5D 1Y1VB 2H1EA 1EOTA 1EIHA 1EZ6A 1STEA 3IKJA 1RODA 4KY5A 3VR2A 3F2BA 2NN6H 1O80A 3I3CA 4A3FH 2Y0SE 1N34Q 3M85A 3PUYA 4JI4L 2RBMA 1VQ9A 3GD7A 3T56B 4FO2A 5BN5A 2LY7A 2R92B 4GKKL 2RKSA 4JOIA 1PHJA 3W1GA 4KKSA 1Y1VG 2PYKA 3KFUA 1RJTA 1DZ1A 1M1KC 2IL8A 2Z8LA 4UP9A 1B53A 2R7ZB 4A3IH 1HFNA 3NE5B 5C3WA 1HUNA 1I4RA 2RF4A 1JB7A 3I4MG 1QVCA 4AYBB 5CV8A 4KD3A 2BOSA 1HFGA 1Z47A 2NVYH 5E1FA 2F0KA 4WJWA 2R92G 4QY7A 4DUZQ 3QR8A 1IL2A 2CQAA 1HTLD 3PGZA 3A56A 2CW0D 5HGQA 1HHVA 1B44D 1V43A 2F0TA 1A3TA 5D3IB 3KBGA 2R7ZG 4FDBA 3FMCA 5M3FH 4FF3A 1XPUA 1RD9D 1X3PA 1WTOA 4X3SA 4AYBG 2F3VA 4A3DB 4X66Q 3VYUA 1IBLQ 4R8NA 4KD4A 3H6MA 5GQOA 2EPBA 3LNNA 4M1UB 4PZ6A 1EIFA 1N36Q 3T4AC 5C3XA 2EOTA 5IYCH 2NTSA 1A2UA 2F0QA 4IOAA 4DV5L 4C3HH 4Y52H 5FJ8H 5DAUA 4B3RQ 4IUUA 2JEAI 4KHVA 5EKLA 4RA8A 1C0AA 1B1ZA 2MO0A 5HY6A 4H13C 4AQYL 1I6HB 1SE4A 4GOPC 3CCJA 1A3UA 3NTKA 4HCSA 3RR5A 2EIFA 5CV6A 1VQEA 4BY1H 2AKWB 1SE3A 1QZHA 4KY6A 1F2LA 4QGUA 4DR6L 5CYUA 1XWEA 1HZCA 1SEBD 1NNXA 1ZYRC 1K9MC 2L5TA 2D2CC 4QUFA 4YCUA 1X56A 1PMRA 4F88A 1X3QA 4G4KA 1DCZA 4RKLA 2K03A 1TS5A 2X6GA 2DUDA 3GTMB 1LO5D 4LF4Q 4YCVA 3GTPB 1C48A 1AH9A 2FXQA 2N88A 3F2UA 3HOYB 1JWMD 1V1PA 3BVZA 4F87A 3S1MH 4DV2L 4RG1A 5FLXE 1MSHA 1Z7TA 1JC7A 4A4IA 4HIDA 5JPMC 1KLGD 1IL8A 3L2PA 2K05A 2EJMA 2WINB 1PFMA 4NB3A 4DAMA 5C4XB 3NTHA 1FGUA 4R4TA 1EY6A 3NBIA 2KECA 5L37A 4HIKA 2D0PA 3EJIA 1H95A 4BS9A 1B9NA 4XTCS 5HURA 3HOYG 4PMCA 3FP9A 4ZCKA 1Q8IA 1WCMB 1XPRA 1J8IA 3KUPA 5F2DA 3RN2A 3K59A 2QCPX 5C4XG 3VA7A 4JI2L 2JA8B 3GTOH 1LTID 4OL7A 1YNND 3M4OB 2EYFA 5IT9E 2WV6D 4A3MB 1AW7A 4OWWB 3P7JA 2MUYA 3VYTA 4DR4Q 1L0WA 3BZCA 2DN8A 4OONA 3I73A 4HN7A 2ZJQA 5I9PA 1WCMG 3RLNA 3AB9A 4JW0A 4BXXH 4TQUS 2M00A 2NTTA 3S17B 1A3VA 4GS3A 2WFWA 2FHTA 1SLJA 3GDEA 3OYYA 3QO2A 4HIMA 5GADC 4DN4M 1XPOA 1KABA 4RFBA 3DUZA 3H3VI 4C1NK 3NXWA 3I91A 4L8JA 1ILPA 3S9WA 4RWSC 1BUVT 1M8AA 1J5EQ 5GAEC 4CDFC 2OT2A 1GUWA 2MGSA 3CHBD 1JOOA 1KDAA 1EWHA 1P16A 3TBIB 3DWPA 1UUPA 2PPBC 3KYHC 1E3PA 4DUZL 1EFWA 4CHTB 1BXTA 4LJZC 1YHQA 2IY5B 4NMZA 3VR6A 4CJ0B 2EZVA 1GHKA 1CUKA 1EQTA 4NXMQ 3TP6A 1VQMA 4DV7L 3T1YQ 3PCOB 1MGSA 5C44H 2VS1A 1I5FA 4GLAC 4A93H 1YBYA 1WTQA 1S5FD 3GO5A 1IBLL 3J81j 1JE4A 2EYOA 3D8GA 3F8TA 5EPJA 1CA6A 2YU9B 3LWUA 1JJGA 1N36L 4DNTB 4KV6A 4IQZA 1X3FA 2JA7B 2EY5A 3VYSA 3VYRA 1WD1A 4H44C 1TS4A 4CKEA 2UXDQ 5AJ3Q 1AEXA 4B3RL 1YNXA 2VZAA 1VQNA 1BBWA 4ZYSA 3E0JA 4LFCQ 4CGYB 1PH9A 1N33L 5DM73 1LM0A 4MN3A 2PZWA 3J81E 1HTPA 5ELCA 2NVQB 2RSOA 4DUYQ 4DNIA 2A6HD 3PO2B 3VR3A 1WVLA 4HTHA 4DR2L 2K14A 1GUOA 3ND8A 2JJQA 1AZQA 1EYAA 4I7AA 2Z6KC 3CC4A 2JA7G 2JA6G 2A5HA 2N8NA 5KNBA 4DR3L 2X69A 3KJPA 1LYLA 3E9IA 1Q7YC 2EJGC 4Q0FA 1D2BA 4GOPA 1PH3A 4IUPA 5C4HA 4UPAA 2Q8RE 4I7ZC 3S2DH 5K36H 1L2FA 2KCNA 3EQLC 1MIUA 3K57A 4A3BH 1PTOB 3A8KE 1L0YB 2A19A 1ILQA 1XMQQ 1V9PA 3NENA 2UU9L 3PO2G 1G91A 1K0SA 2VL6A 1U4MA 1STAA 1X6OA 1D6EC 3U4VA 5DLQE 2IWHA 3I4NB 1LTRD
chains in the Genus database with same CATH topology
2VW9A 1SN8A 1KQSA 2ASBA 1XTDA 4JV5L 3CC7A 4DUYL 4GKJQ 3K0XA 4ALPA 4ME3A 2KBNA 3E9HA 2R7ZH 2OTJA 2ZTCA 4X64Q 2IHFA 4BA1I 3UDFA 2PMZE 2LXJA 3NEMA 2JA8H 4GNXB 1KIXA 4POGA 2UUCL 3GTJH 2HQLA 1HJPA 4DV1Q 1UEBA 1V1QA 4A3MH 1SR3A 4DV4Q 4B3TQ 2N78A 3A74A 1W2BA 2R93G 2KENA 5BR8Q 2AMCB 4A76A 1Q86C 2ZM6L 1VQGA 4JBWA 4A3EG 1XNRQ 1K0RA 4POFA 3UDGA 4NXNQ 4YWKA 3KF6A 4IJLA 3F2DA 1XMOL 1VS0A 3RN5A 1L1OC 1A8VA 2R6GA 1E24A 2YV5A 4DAYB 1Q12A 3EN2A 4EQ5A 1C7YA 4IFDI 3K81C 3S14H 3L0OA 1S40A 4LFBL 3HOUH 4APVA 4AQYQ 3NELA 4OXPA 4R4CA 4A3JG 4DR1Q 1EYGA 5FLMG 2IX0A 2UXBL 4DV3Q 3CC2A 5IE8A 1QVFA 4IOCA 3H0GG 4BY7H 1Q8KA 1IXRA 1QVGA 3RZOH 3M3YH 4P74A 1X54A 1T9HA 1X55A 2WB1E 4HJ9A 4DR4L 1VQAA 4BXXG 3AEVA 4A3DH 1KL9A 4OWXB 1VQJA 1CKNA 1U0LA 2H5XA 3K80C 1M90C 1VQIA 1VQ6A 2GVBA 1EQQA 3W5OA 2RHQB 4P75A 4X64L 3Q8DA 4DR6Q 2F4VQ 3I7FA 2Q2IA 2YTVA 1VQ4A 4JI1Q 4JCVE 4HJ5A 2UXCQ 1YIJA 5JJIA 4DV1L 1HZAA 4LUOA 4NPSA 4LUZA 1FJGL 1EWIA 1E1OA 3S24A 3S1NH 2B63H 1Y1WG 4DV4L 4B3TL 5JJLA 4BBSH 2VY3A 4A3KG 1QZGA 3CW2C 4R4OA 5BR8L 3J81c 3H15A 1VQOA 3HOVH 1AE3A 2CFMA 2GVAA 3CF5A 3M7NA 1JE5A 4NXNL 5IYBG 1YHBA 3KLWA 1BBUA 1I3QH 3FKIG 1N9WA 3A0JA 2V1CC 4DK3C 3PUZA 1XNQL 4L5QA 2Q2HA 2A1AA 2KHJA 3CCLA 3J7ZC 3EIVA 5C3EG 1I6HH 1GKHA 4DV2Q 4GNXC 4IFDJ 1J5EL 1E1TA 4A3DG 1NY4A 3CPFA 1HR0Q 1VQCA 1PYBA 4LF6Q 3U4ZA 3DM3A 4C3IH 3T1HQ 1PH2A 1AE2A 2ZJPA 4P73A 3JAMi 2QEXA 4JI8Q 5GAHC 1GM5A 1Q1EA 3J7A5 1KAWA 2CWAA 1QUQA 5M3MG 4MNOA 2L15A 4TVAB 2VQEQ 2WP8J 3STBD 1OTCA 4PMWA 1SE8A 5C44G 2F4VL 3ICEA 4GN4B 3ULPA 1WOCA 4LF9Q 2ALYB 2LXKA 3E0EA 4O2DA 4JI1L 3CCEA 4GKKQ 4A93G 5IP7G 1VQ7A 4JI7Q 2IHEA 2OQKA 3IRBA 1PFSA 1TWHH 4OWTB 1N32L 5IYDH 3PUXA 4HJ8A 4KLKA 3D0FA 3KDFB 5IP9H 4YHHL 4JI5Q 1WI5A 1UWVA 1JJCB 4JBKA 3GTMH 1VQ8A 4QIWE 3I55A 3GTPH 4MTNA 3M9BA 2EQSA 4HIOA 3J80c 2PQAA 4R4QA 3CPWA 4JI0L 4QQBX 4HJAA 5C0XI 2UUBQ 4R1JA 1VQHA 2K5VA 2NVTH 1NMGA 3JC66 3HOYH 1TXYA 4A3LH 4IPHA 5C4JH 3TEHB 4YY3L 4P72A 2HT1A 3HOZH 1NMFA 3F1ZA 3M4QA 1Q81C 3AFQA 1HR0L 2C35B 3ER0A 5H1SE 4LF6L 3TRZA 1NBWA 1SROA 3T1HL 5C4XH 3RLOA 2JK8A 2ID0A 4YWLA 3F2BA 1E7ZA 3KF8B 1IBKQ 1C9OA 3STBC 1A63A 4A3FH 2Y0SE 1N34Q 3M85A 3S16H 1IZ6A 3PUYA 4JI4L 5LMUL 4JI3Q 2MFIA 3GD7A 4RMFA 1VQ9A 1WYDA 3PIPA 3G6EA 1U5KA 4GLVB 1K8GA 2HHHQ 4JYAL 4LF9L 3F2CA 4J15A 4GKKL 2AHOB 4UP8A 3UE1A 1WCMH 3CD6A 4JOIA 2I5MX 3BJUA 1PHJA 1KC8C 3KJOA 3CMEA 3W1GA 2Q2TA 1Y1VG 3KFUA 2F3IA 1VQPA 4GLXA 1A62A 3G4SA 5LMNL 4L5SA 1M1KC 4UP9A 4A3CG 1HH2P 2I0QA 4A3IH 1CKOA 2UUAQ 4YWMA 1K73C 5C0XJ 2ZJRA 5LMNW 4H02A 3M4OH 2K4KA 2RF4A 1JB7A 5K36G 4GOPB 3I4MG 1BKBA 4A3BG 1OXUA 1QVCA 2F52A 4X62L 3HKZE 2YTYA 1X3GA 1X3EA 1EQRA 1Z47A 2NVYH 2R92G 4QY7A 4DV5Q 4DUZQ 3S2HH 1IL2A 3S1QH 4LWCA 3PGZA 5HGQA 1IBKL 1XMQL 5GROA 1N34L 1V43A 2Z6KA 3S17H 1NJIC 1MKHA 2RHSB 2JE6I 1KXLA 2R7ZG 2E5LQ 4FDBA 1DGSA 1TWFH 1VQFA 5M3FH 2AWOA 2JA8G 1XPUA 4B3SQ 1UE7A 4GKJL 1PH1A 3I4OA 4AYBG 1PA6A 4EX5A 4A3MG 5J3BA 4X66Q 1IBLQ 2JEBI 2CCZA 5ELNA 5GQOA 3CMAA 4QJFA 3ZJYC 1PYSB 2AWNA 1TWCH 2OCEA 1ASYA 2NZOA 3A5UA 2NZHA 2NN6I 3CCSA 2B63G 4PZ6A 4LFAQ 3PO3G 3PIOA 1EIFA 2QGQA 1N36Q 1JJ2A 2E2IH 2CWPA 1Z9FA 4LF5Q 4KHPQ 3HOXH 5IYCH 2HIXA 2RCNA 3GTKH 4IPDA 1XNRL 5IY0A 3HOUG 1MJCA 4IOAA 4DV5L 4IPCA 4C3HH 3NBHB 1KRTA 4DV6Q 5FJ8H 4Y52H 4B3RQ 1TWGH 2JEAI 4BY7G 2K50A 5C0XG 1C0AA 1TWAH 1Q82C 2MO0A 5HY6A 3G48A 1IBMQ 2ATWA 4AQYL 3TS0A 1HNWQ 4DR1L 3GTGH 4GOPC 1CKNB 4DV3L 1YEZA 4LUVA 3CCJA 3RR5A 1PH6A 2EIFA 1WJJA 3FHWA 1VQEA 4BY1H 4DR5Q 4DKAC 2GN5A 3HKSA 2CKZB 2AKWB 1X9NA 1QZHA 3M4PA 1HNZQ 4X66L 5IWAQ 3G71A 4L5TA 4OO1I 3KDFA 4QGUA 4BBSG 2Q2UA 4DR6L 1YJWA 1L1OA 5IYCG 3HOVG 2YU9H 1B8AA 1HZCA 1VQLA 4X65Q 1K9MC 2VUMH 3U50C 3CCRA 2B29A 2JA7H 4LFAL 4YCUA 1X56A 2BA0A 2OQ0A 4DV0Q 1LTLA 2PI2E 4JI6Q 4LF5L 1Q46A 2ZTEA 3U58A 4GN3B 1P8LA 2YYZA 2DUDA 3UDIA 2MO1A 4DV6L 2OTLA 4LF4Q 4YCVA 3RLFA 2UXCL 4JI2Q 1AH9A 2FXQA 3K7UC 2E2HH 4O0AA 1K8AC 4OX9Q 2CQOA 1G6PA 2NVQH 3S1MH 4DV2L 4RG1A 1KD1C 5EAYA 1IYJB 4C2MH 4HIDA 4A4IA 3H3VH 3HOWH 1QUQB 2XGTA 1KRSA 3CP0A 1BVSA 3PO2H 4AIMA 4UY8C 3L2PA 1GVPA 4JI8L 1HR0W 1RIPA 4NB3A 4BBRH 4DAMA 2E2JH 2VQEL 1FGUA 4R4TA 4YCWA 2BH8A 2JA9A 2I5HA 3I2ZA 4L5RC 3AQQA 2MQHA 4PG3A 4JG2A 5IYDG 2UUCQ 2UXDL 1FL0A 5IP9G 2WAQG 1YITA 1EUJA 4HIKA 2D0PA 4K0KQ 1H95A 3JAMc 2BH2A 1PH5A 4Y7NH 4GNXA 4JI7L 4XTCS 1GO3E 3HOYG 4A3LG 5JJKA 2PQAB 1X65A 2EXDA 3FP9A 1XPRA 4DV0L 4JI5L 1W3SA 3PSIA 3TREA 1PH7A 2BA1A 1SRUA 3HOZG 3TS2A 3PF4A 1XMOQ 3RN2A 1K83H 1Q1BA 1JT8A 1CSQA 4DR7Q 4LF4L 2UUBL 2R93H 5C4XG 1PH8A 4JI2L 3GTOH 1UE1A 2K52A 4A3EH 3I4NH 1OXTA 2NN6G 3D31A 4A3FG 4LNQA 4OWWB 1SFOH 1B7YB 4DR4Q 1B70B 3CQZH 1L0WA 3OTOQ 3BZCA 4OONA 4A3JH 3PV0A 2ZJQA 1VCIA 2Z0SA 3AYHB 5FLMH 4C3JH 3UDXA 3J81i 1WCMG 1OXXK 3H0GH 2PNHA 1VQBA 5M5WH 3RLNA 3RNUA 1RL2A 4JI3L 3K8AA 4LW1A 4BXXH 4TQUS 5M5YH 2HHHL 3ERSX 1ASZA 4K0KL 4DV7Q 2DGYA 3PUVA 4GS3A 2WFWA 2PI2A 1FJGQ 3S15H 1SLJA 3KOJA 1G291 3GDEA 1S3OA 2WB1G 3OYYA 4UP7A 5JEAJ 4HIMA 4A3IG 1VQKA 4WJ3M 4KHZA 5GADC 1YZ6A 2N3SA 1XPOA 2K5NA 2VQFQ 3I4NG 4IO9A 3H3VI 1K3RA 3TQYA 1XNQQ 3CAMA 1J6QA 1Y1WH 1YHAA 1R9TH 4OO1G 3PUWA 4DPGA 4DR7L 4A3KH 2UUAL 1J5EQ 3MXNB 5GAEC 1VQDA 1NE3A 3CXCA 1P16A 5IYBH 3KF6B 3FKIH 1O7IA 2K5HA 4PZ8A 3W1BA 3CCMA 4A3GH 1UE5A 5C3EH 3GTQH 3KYHC 3OTOL 3DLLA 1PV4A 1E3PA 4DUZL 1HNXQ 4LF8Q 1EFWA 1NTGA 4AYBE 4GN5A 5M3FG 1UE6A 1PH4A 1YHQA 2IY5B 4JBMA 4HJ7A 1N33Q 1N8RC 3J80i 1CUKA 4NXMQ 3EBEA 5M3MH 1HZBA 3AFPA 1VQMA 2E5LL 2I5LX 4DV7L 1CKMA 3T1YQ 3PCOB 1N32Q 5FLXc 1CSPA 1KHIA 4YHHQ 2MNAA 5C44H 4B3SL 2VS1A 1I5FA 4DR2Q 4GLAC 1D7QA 4A93H 1YBYA 3RZDH 1I50H 1E22A 2JQOA 2VQFL 3GO5A 5IP7H 1IBLL 2OWOA 3J81j 3CCQA 1LUZA 3CCUA 4JI0Q 1S72A 2K75A 3HOXG 3I56A 3PF5A 4A3GG 1EIYB 4YY3Q 2E8GA 3F8TA 4WJ4A 2NVXH 4DR3Q 3K7AH 4JOIC 5JEAG 5FJ8G 4AH6A 1JJGA 3UE0A 5ELOA 4IJHA 4PZ7A 1N36L 3BZKA 4X6AH 1X3FA 2JA6H 1GD7A 4KHPL 3VDYA 1I94Q 1JMCA 1YJ9A 4XIGS 3LGJA 1HNXL 1OXSC 4LF8L 2UXDQ 1YVCA 2UU9Q 5AJ3Q 4B3MQ 4B3RL 3SGIA 1YNXA 4JI4Q 2VZAA 5LMUQ 2JA5H 4MZ9A 1VQNA 1BBWA 2ES2A 1A0IA 4LFCQ 3GTLH 4BY1G 2HIVA 1PH9A 1IBML 1N33L 4JYAQ 4JBJA 1LM0A 4LF7Q 1PVOA 4NXML 1HNWL 1XJVA 4DK6C 4JV5Q 2D62A 2XTIA 4DUYQ 4P71A 3T1YL 1Y14B 4R4IA 4DNIA 3CCVA 2IX1A 3A5ZB 3L7ZC 1EOVA 5IT9c 1L1OB 4DR5L 4DR2L 2K14A 3WWVA 2N49A 2Y0SG 5LMNQ 2VUMG 2JJQA 1HNZL 1SMXA 2Z6KC 1D8LA 3ULLA 3CC4A 2B3GA 1OXVA 2R7DA 3HFZB 5IWAL 2JA7G 4BA2I 2KHIA 2JA6G 2YTXA 2ZTDA 1Y1VH 2N8NA 4QL5A 1VQ5A 4DR3L 4X65L 2KCTA 2VNUD 2D0OA 4X62Q 5E7NA 3KJPA 1LYLA 4A3CH 5M5XH 3E9IA 3PO3H 1YJNA 1Q7YC 2R7FA 2ZM6Q 4KI0A 4GOPA 1PH3A 2JA5G 4JI6L 4UPAA 2KCMA 1WFQA 3S1RH 1L2FA 1I94L 3I4MH 1HZ9A 1MIUA 4A3BH 3S2DH 3HOWG 2A8VA 2A19A 1G51A 2QA4A 3MEFA 1FVIA 1V9PA 3NENA 5AJ3L 4A75A 4JC0A 1YI2A 1XMQQ 2UU9L 4B3ML 3PO2G 5GAGC 2VL6A 1MJEA 4IPGA 4IFDG 4OX9L 2R92H 4LFBQ 2LSSA 4BBRG 2IT1A 4LFCL 1X6OA 3ULJA 3OW2A 3HKZG 2WAQE 2UXBQ 3U4VA 5DLQE 3BU2A 3B6YA 4LF7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VW9 A;  1SN8 A;  1KQS A;  2ASB A;  1XTD A;  4JV5 L;  3CC7 A;  4DUY L;  4GKJ Q;  3K0X A;  4ALP A;  4ME3 A;  2KBN A;  3E9H A;  2R7Z H;  2OTJ A;  2ZTC A;  4X64 Q;  2IHF A;  4BA1 I;  3UDF A;  2PMZ E;  2LXJ A;  3NEM A;  2JA8 H;  4GNX B;  1KIX A;  4POG A;  2UUC L;  3GTJ H;  2HQL A;  1HJP A;  4DV1 Q;  1UEB A;  1V1Q A;  4A3M H;  1SR3 A;  4DV4 Q;  4B3T Q;  2N78 A;  3A74 A;  1W2B A;  2R93 G;  2KEN A;  5BR8 Q;  2AMC B;  4A76 A;  1Q86 C;  2ZM6 L;  1VQG A;  4JBW A;  4A3E G;  1XNR Q;  1K0R A;  4POF A;  3UDG A;  4NXN Q;  4YWK A;  3KF6 A;  4IJL A;  3F2D A;  1XMO L;  1VS0 A;  3RN5 A;  1L1O C;  1A8V A;  2R6G A;  1E24 A;  2YV5 A;  4DAY B;  1Q12 A;  3EN2 A;  4EQ5 A;  1C7Y A;  4IFD I;  3K81 C;  3S14 H;  3L0O A;  1S40 A;  4LFB L;  3HOU H;  4APV A;  4AQY Q;  3NEL A;  4OXP A;  4R4C A;  4A3J G;  4DR1 Q;  1EYG A;  5FLM G;  2IX0 A;  2UXB L;  4DV3 Q;  3CC2 A;  5IE8 A;  1QVF A;  4IOC A;  3H0G G;  4BY7 H;  1Q8K A;  1IXR A;  1QVG A;  3RZO H;  3M3Y H;  4P74 A;  1X54 A;  1T9H A;  1X55 A;  2WB1 E;  4HJ9 A;  4DR4 L;  1VQA A;  4BXX G;  3AEV A;  4A3D H;  1KL9 A;  4OWX B;  1VQJ A;  1CKN A;  1U0L A;  2H5X A;  3K80 C;  1M90 C;  1VQI A;  1VQ6 A;  2GVB A;  1EQQ A;  3W5O A;  2RHQ B;  4P75 A;  4X64 L;  3Q8D A;  4DR6 Q;  2F4V Q;  3I7F A;  2Q2I A;  2YTV A;  1VQ4 A;  4JI1 Q;  4JCV E;  4HJ5 A;  2UXC Q;  1YIJ A;  5JJI A;  4DV1 L;  1HZA A;  4LUO A;  4NPS A;  4LUZ A;  1FJG L;  1EWI A;  1E1O A;  3S24 A;  3S1N H;  2B63 H;  1Y1W G;  4DV4 L;  4B3T L;  5JJL A;  4BBS H;  2VY3 A;  4A3K G;  1QZG A;  3CW2 C;  4R4O A;  5BR8 L;  3J81 c;  3H15 A;  1VQO A;  3HOV H;  1AE3 A;  2CFM A;  2GVA A;  3CF5 A;  3M7N A;  1JE5 A;  4NXN L;  5IYB G;  1YHB A;  3KLW A;  1BBU A;  1I3Q H;  3FKI G;  1N9W A;  3A0J A;  2V1C C;  4DK3 C;  3PUZ A;  1XNQ L;  4L5Q A;  2Q2H A;  2A1A A;  2KHJ A;  3CCL A;  3J7Z C;  3EIV A;  5C3E G;  1I6H H;  1GKH A;  4DV2 Q;  4GNX C;  4IFD J;  1J5E L;  1E1T A;  4A3D G;  1NY4 A;  3CPF A;  1HR0 Q;  1VQC A;  1PYB A;  4LF6 Q;  3U4Z A;  3DM3 A;  4C3I H;  3T1H Q;  1PH2 A;  1AE2 A;  2ZJP A;  4P73 A;  3JAM i;  2QEX A;  4JI8 Q;  5GAH C;  1GM5 A;  1Q1E A;  3J7A 5;  1KAW A;  2CWA A;  1QUQ A;  5M3M G;  4MNO A;  2L15 A;  4TVA B;  2VQE Q;  2WP8 J;  3STB D;  1OTC A;  4PMW A;  1SE8 A;  5C44 G;  2F4V L;  3ICE A;  4GN4 B;  3ULP A;  1WOC A;  4LF9 Q;  2ALY B;  2LXK A;  3E0E A;  4O2D A;  4JI1 L;  3CCE A;  4GKK Q;  4A93 G;  5IP7 G;  1VQ7 A;  4JI7 Q;  2IHE A;  2OQK A;  3IRB A;  1PFS A;  1TWH H;  4OWT B;  1N32 L;  5IYD H;  3PUX A;  4HJ8 A;  4KLK A;  3D0F A;  3KDF B;  5IP9 H;  4YHH L;  4JI5 Q;  1WI5 A;  1UWV A;  1JJC B;  4JBK A;  3GTM H;  1VQ8 A;  4QIW E;  3I55 A;  3GTP H;  4MTN A;  3M9B A;  2EQS A;  4HIO A;  3J80 c;  2PQA A;  4R4Q A;  3CPW A;  4JI0 L;  4QQB X;  4HJA A;  5C0X I;  2UUB Q;  4R1J A;  1VQH A;  2K5V A;  2NVT H;  1NMG A;  3JC6 6;  3HOY H;  1TXY A;  4A3L H;  4IPH A;  5C4J H;  3TEH B;  4YY3 L;  4P72 A;  2HT1 A;  3HOZ H;  1NMF A;  3F1Z A;  3M4Q A;  1Q81 C;  3AFQ A;  1HR0 L;  2C35 B;  3ER0 A;  5H1S E;  4LF6 L;  3TRZ A;  1NBW A;  1SRO A;  3T1H L;  5C4X H;  3RLO A;  2JK8 A;  2ID0 A;  4YWL A;  3F2B A;  1E7Z A;  3KF8 B;  1IBK Q;  1C9O A;  3STB C;  1A63 A;  4A3F H;  2Y0S E;  1N34 Q;  3M85 A;  3S16 H;  1IZ6 A;  3PUY A;  4JI4 L;  5LMU L;  4JI3 Q;  2MFI A;  3GD7 A;  4RMF A;  1VQ9 A;  1WYD A;  3PIP A;  3G6E A;  1U5K A;  4GLV B;  1K8G A;  2HHH Q;  4JYA L;  4LF9 L;  3F2C A;  4J15 A;  4GKK L;  2AHO B;  4UP8 A;  3UE1 A;  1WCM H;  3CD6 A;  4JOI A;  2I5M X;  3BJU A;  1PHJ A;  1KC8 C;  3KJO A;  3CME A;  3W1G A;  2Q2T A;  1Y1V G;  3KFU A;  2F3I A;  1VQP A;  4GLX A;  1A62 A;  3G4S A;  5LMN L;  4L5S A;  1M1K C;  4UP9 A;  4A3C G;  1HH2 P;  2I0Q A;  4A3I H;  1CKO A;  2UUA Q;  4YWM A;  1K73 C;  5C0X J;  2ZJR A;  5LMN W;  4H02 A;  3M4O H;  2K4K A;  2RF4 A;  1JB7 A;  5K36 G;  4GOP B;  3I4M G;  1BKB A;  4A3B G;  1OXU A;  1QVC A;  2F52 A;  4X62 L;  3HKZ E;  2YTY A;  1X3G A;  1X3E A;  1EQR A;  1Z47 A;  2NVY H;  2R92 G;  4QY7 A;  4DV5 Q;  4DUZ Q;  3S2H H;  1IL2 A;  3S1Q H;  4LWC A;  3PGZ A;  5HGQ A;  1IBK L;  1XMQ L;  5GRO A;  1N34 L;  1V43 A;  2Z6K A;  3S17 H;  1NJI C;  1MKH A;  2RHS B;  2JE6 I;  1KXL A;  2R7Z G;  2E5L Q;  4FDB A;  1DGS A;  1TWF H;  1VQF A;  5M3F H;  2AWO A;  2JA8 G;  1XPU A;  4B3S Q;  1UE7 A;  4GKJ L;  1PH1 A;  3I4O A;  4AYB G;  1PA6 A;  4EX5 A;  4A3M G;  5J3B A;  4X66 Q;  1IBL Q;  2JEB I;  2CCZ A;  5ELN A;  5GQO A;  3CMA A;  4QJF A;  3ZJY C;  1PYS B;  2AWN A;  1TWC H;  2OCE A;  1ASY A;  2NZO A;  3A5U A;  2NZH A;  2NN6 I;  3CCS A;  2B63 G;  4PZ6 A;  4LFA Q;  3PO3 G;  3PIO A;  1EIF A;  2QGQ A;  1N36 Q;  1JJ2 A;  2E2I H;  2CWP A;  1Z9F A;  4LF5 Q;  4KHP Q;  3HOX H;  5IYC H;  2HIX A;  2RCN A;  3GTK H;  4IPD A;  1XNR L;  5IY0 A;  3HOU G;  1MJC A;  4IOA A;  4DV5 L;  4IPC A;  4C3H H;  3NBH B;  1KRT A;  4DV6 Q;  5FJ8 H;  4Y52 H;  4B3R Q;  1TWG H;  2JEA I;  4BY7 G;  2K50 A;  5C0X G;  1C0A A;  1TWA H;  1Q82 C;  2MO0 A;  5HY6 A;  3G48 A;  1IBM Q;  2ATW A;  4AQY L;  3TS0 A;  1HNW Q;  4DR1 L;  3GTG H;  4GOP C;  1CKN B;  4DV3 L;  1YEZ A;  4LUV A;  3CCJ A;  3RR5 A;  1PH6 A;  2EIF A;  1WJJ A;  3FHW A;  1VQE A;  4BY1 H;  4DR5 Q;  4DKA C;  2GN5 A;  3HKS A;  2CKZ B;  2AKW B;  1X9N A;  1QZH A;  3M4P A;  1HNZ Q;  4X66 L;  5IWA Q;  3G71 A;  4L5T A;  4OO1 I;  3KDF A;  4QGU A;  4BBS G;  2Q2U A;  4DR6 L;  1YJW A;  1L1O A;  5IYC G;  3HOV G;  2YU9 H;  1B8A A;  1HZC A;  1VQL A;  4X65 Q;  1K9M C;  2VUM H;  3U50 C;  3CCR A;  2B29 A;  2JA7 H;  4LFA L;  4YCU A;  1X56 A;  2BA0 A;  2OQ0 A;  4DV0 Q;  1LTL A;  2PI2 E;  4JI6 Q;  4LF5 L;  1Q46 A;  2ZTE A;  3U58 A;  4GN3 B;  1P8L A;  2YYZ A;  2DUD A;  3UDI A;  2MO1 A;  4DV6 L;  2OTL A;  4LF4 Q;  4YCV A;  3RLF A;  2UXC L;  4JI2 Q;  1AH9 A;  2FXQ A;  3K7U C;  2E2H H;  4O0A A;  1K8A C;  4OX9 Q;  2CQO A;  1G6P A;  2NVQ H;  3S1M H;  4DV2 L;  4RG1 A;  1KD1 C;  5EAY A;  1IYJ B;  4C2M H;  4HID A;  4A4I A;  3H3V H;  3HOW H;  1QUQ B;  2XGT A;  1KRS A;  3CP0 A;  1BVS A;  3PO2 H;  4AIM A;  4UY8 C;  3L2P A;  1GVP A;  4JI8 L;  1HR0 W;  1RIP A;  4NB3 A;  4BBR H;  4DAM A;  2E2J H;  2VQE L;  1FGU A;  4R4T A;  4YCW A;  2BH8 A;  2JA9 A;  2I5H A;  3I2Z A;  4L5R C;  3AQQ A;  2MQH A;  4PG3 A;  4JG2 A;  5IYD G;  2UUC Q;  2UXD L;  1FL0 A;  5IP9 G;  2WAQ G;  1YIT A;  1EUJ A;  4HIK A;  2D0P A;  4K0K Q;  1H95 A;  3JAM c;  2BH2 A;  1PH5 A;  4Y7N H;  4GNX A;  4JI7 L;  4XTC S;  1GO3 E;  3HOY G;  4A3L G;  5JJK A;  2PQA B;  1X65 A;  2EXD A;  3FP9 A;  1XPR A;  4DV0 L;  4JI5 L;  1W3S A;  3PSI A;  3TRE A;  1PH7 A;  2BA1 A;  1SRU A;  3HOZ G;  3TS2 A;  3PF4 A;  1XMO Q;  3RN2 A;  1K83 H;  1Q1B A;  1JT8 A;  1CSQ A;  4DR7 Q;  4LF4 L;  2UUB L;  2R93 H;  5C4X G;  1PH8 A;  4JI2 L;  3GTO H;  1UE1 A;  2K52 A;  4A3E H;  3I4N H;  1OXT A;  2NN6 G;  3D31 A;  4A3F G;  4LNQ A;  4OWW B;  1SFO H;  1B7Y B;  4DR4 Q;  1B70 B;  3CQZ H;  1L0W A;  3OTO Q;  3BZC A;  4OON A;  4A3J H;  3PV0 A;  2ZJQ A;  1VCI A;  2Z0S A;  3AYH B;  5FLM H;  4C3J H;  3UDX A;  3J81 i;  1WCM G;  1OXX K;  3H0G H;  2PNH A;  1VQB A;  5M5W H;  3RLN A;  3RNU A;  1RL2 A;  4JI3 L;  3K8A A;  4LW1 A;  4BXX H;  4TQU S;  5M5Y H;  2HHH L;  3ERS X;  1ASZ A;  4K0K L;  4DV7 Q;  2DGY A;  3PUV A;  4GS3 A;  2WFW A;  2PI2 A;  1FJG Q;  3S15 H;  1SLJ A;  3KOJ A;  1G29 1;  3GDE A;  1S3O A;  2WB1 G;  3OYY A;  4UP7 A;  5JEA J;  4HIM A;  4A3I G;  1VQK A;  4WJ3 M;  4KHZ A;  5GAD C;  1YZ6 A;  2N3S A;  1XPO A;  2K5N A;  2VQF Q;  3I4N G;  4IO9 A;  3H3V I;  1K3R A;  3TQY A;  1XNQ Q;  3CAM A;  1J6Q A;  1Y1W H;  1YHA A;  1R9T H;  4OO1 G;  3PUW A;  4DPG A;  4DR7 L;  4A3K H;  2UUA L;  1J5E Q;  3MXN B;  5GAE C;  1VQD A;  1NE3 A;  3CXC A;  1P16 A;  5IYB H;  3KF6 B;  3FKI H;  1O7I A;  2K5H A;  4PZ8 A;  3W1B A;  3CCM A;  4A3G H;  1UE5 A;  5C3E H;  3GTQ H;  3KYH C;  3OTO L;  3DLL A;  1PV4 A;  1E3P A;  4DUZ L;  1HNX Q;  4LF8 Q;  1EFW A;  1NTG A;  4AYB E;  4GN5 A;  5M3F G;  1UE6 A;  1PH4 A;  1YHQ A;  2IY5 B;  4JBM A;  4HJ7 A;  1N33 Q;  1N8R C;  3J80 i;  1CUK A;  4NXM Q;  3EBE A;  5M3M H;  1HZB A;  3AFP A;  1VQM A;  2E5L L;  2I5L X;  4DV7 L;  1CKM A;  3T1Y Q;  3PCO B;  1N32 Q;  5FLX c;  1CSP A;  1KHI A;  4YHH Q;  2MNA A;  5C44 H;  4B3S L;  2VS1 A;  1I5F A;  4DR2 Q;  4GLA C;  1D7Q A;  4A93 H;  1YBY A;  3RZD H;  1I50 H;  1E22 A;  2JQO A;  2VQF L;  3GO5 A;  5IP7 H;  1IBL L;  2OWO A;  3J81 j;  3CCQ A;  1LUZ A;  3CCU A;  4JI0 Q;  1S72 A;  2K75 A;  3HOX G;  3I56 A;  3PF5 A;  4A3G G;  1EIY B;  4YY3 Q;  2E8G A;  3F8T A;  4WJ4 A;  2NVX H;  4DR3 Q;  3K7A H;  4JOI C;  5JEA G;  5FJ8 G;  4AH6 A;  1JJG A;  3UE0 A;  5ELO A;  4IJH A;  4PZ7 A;  1N36 L;  3BZK A;  4X6A H;  1X3F A;  2JA6 H;  1GD7 A;  4KHP L;  3VDY A;  1I94 Q;  1JMC A;  1YJ9 A;  4XIG S;  3LGJ A;  1HNX L;  1OXS C;  4LF8 L;  2UXD Q;  1YVC A;  2UU9 Q;  5AJ3 Q;  4B3M Q;  4B3R L;  3SGI A;  1YNX A;  4JI4 Q;  2VZA A;  5LMU Q;  2JA5 H;  4MZ9 A;  1VQN A;  1BBW A;  2ES2 A;  1A0I A;  4LFC Q;  3GTL H;  4BY1 G;  2HIV A;  1PH9 A;  1IBM L;  1N33 L;  4JYA Q;  4JBJ A;  1LM0 A;  4LF7 Q;  1PVO A;  4NXM L;  1HNW L;  1XJV A;  4DK6 C;  4JV5 Q;  2D62 A;  2XTI A;  4DUY Q;  4P71 A;  3T1Y L;  1Y14 B;  4R4I A;  4DNI A;  3CCV A;  2IX1 A;  3A5Z B;  3L7Z C;  1EOV A;  5IT9 c;  1L1O B;  4DR5 L;  4DR2 L;  2K14 A;  3WWV A;  2N49 A;  2Y0S G;  5LMN Q;  2VUM G;  2JJQ A;  1HNZ L;  1SMX A;  2Z6K C;  1D8L A;  3ULL A;  3CC4 A;  2B3G A;  1OXV A;  2R7D A;  3HFZ B;  5IWA L;  2JA7 G;  4BA2 I;  2KHI A;  2JA6 G;  2YTX A;  2ZTD A;  1Y1V H;  2N8N A;  4QL5 A;  1VQ5 A;  4DR3 L;  4X65 L;  2KCT A;  2VNU D;  2D0O A;  4X62 Q;  5E7N A;  3KJP A;  1LYL A;  4A3C H;  5M5X H;  3E9I A;  3PO3 H;  1YJN A;  1Q7Y C;  2R7F A;  2ZM6 Q;  4KI0 A;  4GOP A;  1PH3 A;  2JA5 G;  4JI6 L;  4UPA A;  2KCM A;  1WFQ A;  3S1R H;  1L2F A;  1I94 L;  3I4M H;  1HZ9 A;  1MIU A;  4A3B H;  3S2D H;  3HOW G;  2A8V A;  2A19 A;  1G51 A;  2QA4 A;  3MEF A;  1FVI A;  1V9P A;  3NEN A;  5AJ3 L;  4A75 A;  4JC0 A;  1YI2 A;  1XMQ Q;  2UU9 L;  4B3M L;  3PO2 G;  5GAG C;  2VL6 A;  1MJE A;  4IPG A;  4IFD G;  4OX9 L;  2R92 H;  4LFB Q;  2LSS A;  4BBR G;  2IT1 A;  4LFC L;  1X6O A;  3ULJ A;  3OW2 A;  3HKZ G;  2WAQ E;  2UXB Q;  3U4V A;  5DLQ E;  3BU2 A;  3B6Y A;  4LF7 L; 
#chains in the Genus database with same CATH topology
 5G3L D;  1SN8 A;  1PRT F;  3K0Y A;  1IHZ A;  1QCB D;  1E2Z A;  1GUN A;  4GKJ Q;  4ALP A;  2VB3 X;  4FXD A;  1NR2 A;  1S5C D;  2JA8 H;  2F0E A;  2I07 B;  3GTJ H;  5M5W B;  3N52 A;  2E74 C;  1HJP A;  3A55 A;  1F77 A;  4A3M H;  1II3 A;  4RGO S;  2L4N A;  4DV4 Q;  2N78 A;  3OHX C;  1W2B A;  3LX0 A;  4X3U A;  3H3V C;  3UI2 A;  1VF5 C;  4JBW A;  4U67 3;  1XNR Q;  2NBF A;  4NXN Q;  4YWK A;  5LL6 X;  3PO3 H;  3I90 A;  1L1O C;  2R6G A;  4KMU C;  1E24 A;  4CKB A;  4PNY A;  3EN2 A;  4EQ5 A;  4IFD I;  1BDO A;  1SJE D;  1Y1W B;  2F0G A;  4LFB L;  5KIX A;  3NEL A;  2UXB L;  1QVF A;  4IOC A;  2XNA C;  1SMY D;  1Q8K A;  4ILW A;  1QVG A;  4BY7 H;  4P74 A;  1X54 A;  1ZKO A;  4DR4 L;  5LHY 1;  5EJW A;  1M90 C;  2DNE A;  3BZD B;  2GVB A;  3W5O A;  1H9K A;  4NDX A;  2Q2I A;  2ZT9 C;  1EY0 A;  2K1B A;  4B9X A;  1LT3 D;  1BR9 A;  4DV1 L;  5I4D A;  4NPS A;  4LUZ A;  2Z6B A;  1E1O A;  1FD7 D;  3K6O A;  1Y1W G;  4B3T L;  3BYT B;  4BBS H;  5A2Q E;  1GUS A;  1QZG A;  5BR8 L;  1JWU D;  2HDM A;  1PRT C;  1B2T A;  3CRK C;  1WTV A;  1I3Q H;  2A1A A;  1V8Q A;  2B2W A;  3EIV A;  5IGB A;  1GKH A;  4IFD J;  1J5E L;  3CPF A;  4H7B A;  2NVX B;  1PYB A;  3KBX A;  3PMF A;  3D3R A;  3U4Z A;  3DM3 A;  4N8X 1;  1IKM A;  2ZJP A;  1KNE A;  3R2T A;  3GQB A;  3J7A 5;  1NSN S;  2CWA A;  2IW3 A;  1QUQ A;  3A8I E;  4DAV A;  2TMP A;  1LLR D;  2NWG A;  2WP8 J;  3MXP A;  3QJY A;  5EPL A;  1SE2 A;  1SE8 A;  3STB D;  1OTC A;  1AZP A;  2EYP A;  3CCE A;  4GKK Q;  3GTL B;  1VQ7 A;  2OQK A;  1PFS A;  1TWH H;  4KLK A;  3D0F A;  2B2Y A;  4JI5 Q;  4UAI A;  2OXP A;  2RVL A;  1D5X C;  2ZXP A;  4HIO A;  2PQA A;  4R4Q A;  4HJA A;  2NVT H;  3M7N A;  1VQH A;  2K5V A;  4A3L H;  5LL6 S;  2DY7 A;  1TII D;  5IOC A;  4P72 A;  2A68 C;  3F1Z A;  2HUG A;  3M4Q A;  3AFQ A;  4C1N I;  1U4P A;  2C35 B;  1HR0 L;  3OMG A;  4LF6 L;  1NBW A;  4XT3 B;  1WTX A;  2HQE A;  5M5X B;  4K5V A;  5I2Y A;  2JK8 A;  2ID0 A;  4YWL A;  1FNU A;  2L9H A;  1C9O A;  1KLU D;  4L6T B;  3S16 H;  1IZ6 A;  3AMU A;  2Z1C A;  2C5C A;  3PIP A;  1U5K A;  4QMG A;  4J15 A;  4UP8 A;  2JXM B;  3UE1 A;  4JPB W;  1KC8 C;  3CME A;  1GUG A;  3I8Z A;  5IIF A;  1K3B C;  1PTO H;  1A62 A;  4L5S A;  2A6E C;  1HH2 P;  1LAC A;  1WTP A;  1TS3 A;  3Q23 A;  3HRZ C;  2ZJR A;  1WD0 A;  3E5S A;  1OXU A;  2F52 A;  4DU9 A;  1PLF A;  1X3G A;  1SYE A;  1X3E A;  1LTA D;  4DV5 Q;  3S2H H;  5J39 A;  1NCV A;  4Q5V A;  2B63 B;  1XMQ L;  3JAM E;  5GRO A;  2F0I A;  4EQN A;  3NUC A;  3SK6 A;  2Z6K A;  3KLS A;  4A3K B;  1KXL A;  2E5L Q;  1DGS A;  4P2C B;  3V05 A;  3HOU B;  3C46 A;  3K58 A;  1SAP A;  3HGB A;  4B3S Q;  4GKJ L;  5IGE A;  3RZO B;  3M3Y B;  3I4O A;  1QG7 A;  2CCZ A;  2K32 A;  2WAC A;  4IAL A;  5FK9 C;  1JWS D;  2AWN A;  1TWC H;  3FPP A;  2B63 G;  2NZH A;  3PIO A;  2K7V A;  1JJ2 A;  3VA5 A;  1E2V A;  2E2I H;  4MIU A;  3HOX H;  5E3F A;  4XT1 B;  2HIX A;  3DHQ A;  3HOU G;  1XNR L;  5IY0 A;  2PW7 A;  1GOZ A;  4IPC A;  4N8F A;  3NBH B;  5J22 A;  3RZD B;  4HR7 B;  1CI3 M;  1TWG H;  1OO9 B;  5C0X G;  4F8M A;  1TWA H;  2SOB A;  4UDU C;  1JR0 D;  1G6Z A;  1QNU A;  2HD3 A;  3FEW X;  1SJH D;  3RUZ A;  3TS0 A;  1CKN B;  4LUV A;  2NB0 A;  3FHW A;  4DR5 Q;  3TP5 A;  2GN5 A;  3HKS A;  2CKZ B;  4KJN A;  5KGU A;  3MA2 B;  1ZXT A;  1YJW A;  3QIA A;  1L1O A;  5IYC G;  1IW7 D;  1YNJ D;  2R3Z A;  4X65 Q;  3ND9 A;  3SHL A;  1CTM A;  3KK7 A;  4LFA L;  1BBX C;  2EVB A;  2PI2 E;  1EY4 A;  4PMB A;  4G7O C;  3MC0 B;  1G2S A;  1WTR A;  4UHV A;  1P8L A;  3C1F A;  2WAQ B;  1CFM A;  3UDI A;  2MO1 A;  3C1E A;  4JI2 Q;  4O1N A;  3K7U C;  1TU2 B;  4O0A A;  4OX9 Q;  1G6P A;  5EAY A;  4ZQ3 A;  3MXG A;  4ZLT F;  3H3V H;  3HOW H;  2XGT A;  3QWN A;  1KTK A;  4AIM A;  3K5L A;  2CH4 W;  4BBR H;  2K5D A;  4RAU C;  4YCW A;  3I4M B;  1DOK A;  4H0L C;  5IYD G;  1MBY A;  2AUK A;  2WAQ G;  4JVZ A;  4NP5 A;  5COY A;  1KDC A;  4RHS A;  3IFD A;  4FF1 A;  1ML0 D;  5JJK A;  4LK1 C;  3HG9 A;  1PH7 A;  4JI5 L;  1W3S A;  2QEJ C;  1H9R A;  3K5M A;  2K33 A;  3TS2 A;  4IUQ A;  4FXK C;  1CZG A;  3PF4 A;  2J4X A;  1XMO Q;  2A69 D;  1K83 H;  1CSQ A;  4CDD C;  2R93 H;  1UE1 A;  1H9S B;  3GP7 A;  4ID6 A;  3ERO A;  4LNQ A;  1B7Y B;  4V19 0;  1Y69 U;  2Z0S A;  3AYH B;  5FLM H;  3J81 i;  1IYU A;  4X3K A;  2JSO A;  2WII B;  1OXX K;  3IFT A;  5KEE A;  1SYF A;  2PNH A;  2RA4 A;  1SYC A;  3K8A A;  1WTW A;  1W6K A;  3MVV A;  2BDN A;  4DV7 Q;  4GZY C;  3PUV A;  1FJG Q;  2PI2 A;  1VQK A;  1TWF B;  4WJ3 M;  1STH A;  1YZ6 A;  2N3S A;  5D3D A;  1K3R A;  1ET9 A;  1I4P A;  2R61 A;  1J6Q A;  4OO1 G;  1CZW A;  3PUW A;  4A3K H;  3QOJ A;  1PZK D;  1YNN C;  3NBH A;  3CXC A;  1O7Z A;  4J6H A;  1XXG A;  4FVM A;  3FKI H;  1O7I A;  3W1B A;  4A3G H;  3MFG A;  2CH4 A;  2VB2 X;  5C3E H;  1ENC A;  3GTQ H;  3OTO L;  3GTK B;  1NTG A;  1GJX A;  4AYB E;  1D5M C;  4GN5 A;  1G8Z D;  1PH4 A;  1CA5 A;  2EYM A;  1N33 Q;  3J80 i;  4K2L A;  3EBE A;  3X3M A;  3AFP A;  2E5L L;  5TSS A;  4ZAI A;  2I5L X;  2PZT A;  2F0L A;  4FYD A;  5FLX c;  3GTG B;  1KHI A;  1DD2 A;  4B3S L;  5D65 A;  4DR2 Q;  3A7L A;  2IX3 A;  3BG3 A;  3RZD H;  1A2T A;  2OWO A;  2JQO A;  1ENA A;  5IP7 H;  3CCQ A;  1LUZ A;  4XXE A;  1EY7 A;  1ZEQ X;  1EYD A;  2E8G A;  3Q22 A;  4DR3 Q;  1LTB D;  3K7A H;  1HXY D;  2J0T D;  5JEA G;  2F0O A;  2VUM B;  4IJH A;  2LFN A;  3BZK A;  4LF7 L;  5NUC A;  2PCF B;  1YJ9 A;  1BO0 A;  4CBV A;  1HNX L;  4LF8 L;  2BDO A;  2UU9 Q;  3SGI A;  1LTG D;  2JA5 H;  2ES2 A;  1A0I A;  2E2H B;  2RDG A;  4JYA Q;  4JBJ A;  4LF7 Q;  2FIN B;  1Y14 B;  4K8J A;  4IFD H;  3CCV A;  2IX1 A;  1I4H A;  5IT9 c;  1LTT D;  3T51 B;  4DR5 L;  2VUM G;  2M9V A;  4OHJ A;  1SMX A;  2UXC L;  3ULL A;  4BA2 I;  1OXV A;  3HFZ B;  5G3L F;  1EEI D;  3I72 A;  1Y1V H;  2D5D A;  3FDT A;  4X65 L;  2KCT A;  2KCC A;  1YJN A;  3TDQ A;  5BN4 A;  1E0B A;  4QB4 A;  2O4X A;  1PTO F;  1F2M A;  3I4M H;  1HZ9 A;  3ITP A;  1S5D D;  4A75 A;  2QA4 A;  4B3M L;  4JC0 A;  4F7X A;  5GAG C;  4LFB Q;  4OX9 L;  2R92 H;  2LSS A;  2UXB Q;  3HKZ G;  4A3E B;  3VR5 A;  2VW9 A;  1KQS A;  2ASB A;  3G7L A;  5CGK A;  1PZJ D;  2AQ3 B;  2A6H C;  2B2V C;  3T16 A;  4K14 A;  4ME3 A;  1O7L A;  2K5Q A;  3CQZ B;  2R7Z H;  2OTJ A;  3MAQ A;  2B2W C;  2ZTC A;  4A3J B;  4BA1 I;  1TY0 A;  3S1Q B;  3NEM A;  4C3J B;  4GNX B;  4FNF A;  4HSV A;  2KJX A;  4DV1 Q;  2EJF C;  1V1Q A;  5M5Y B;  1MHW C;  4K5X A;  1T5E A;  1U4L A;  4B3T Q;  4OIJ A;  2KEN A;  5BR8 Q;  1QIL A;  2AMC B;  5KNC A;  1SDF A;  2XRQ D;  1VQG A;  4A3E G;  1K0R A;  1RKN A;  3UDG A;  1X32 A;  4KY7 A;  3MFY A;  1XMO L;  5C5M A;  1F9R A;  4DAY B;  1Q12 A;  3D4W A;  1HRJ A;  1ESF A;  3H91 A;  1R9T B;  2KUM A;  1S40 A;  5IOD A;  4A3J G;  4ZKB B;  1EYG A;  2B2Y C;  4EGV A;  4C3J G;  4DV3 Q;  5IE8 A;  3H0G G;  3NQI A;  5JVG 3;  1IXR A;  4K8I A;  4DGZ A;  3AU7 A;  1X55 A;  4A3D H;  1VQJ A;  1U0L A;  1VQ6 A;  3QOL A;  2M2L A;  4X64 L;  1PTO C;  3DXJ C;  4HJ5 A;  5JJI A;  4HCE A;  1FJG L;  1EWI A;  2EYL A;  5DEH A;  5M3M B;  2Z4I A;  4K2K A;  3J81 c;  3H15 A;  1STG A;  2OF1 A;  1VQO A;  4N9P A;  3VR4 A;  1JE5 A;  5ELD A;  5IYB G;  4DK3 C;  3EFX D;  2RDH A;  3J7Z C;  1I6H H;  3GV6 A;  1NY4 A;  1HR0 Q;  4LF6 Q;  1ESR A;  2NUC A;  3ONA B;  3JAM i;  4JI8 Q;  2O5J C;  4XQJ A;  2JA6 B;  5M3M G;  3MZ5 A;  4PMW A;  3ICE A;  1VF7 A;  1BCP B;  2IPK D;  1NUC A;  2IHE A;  3IRB A;  3T53 B;  5JOB A;  4DNR B;  3PUX A;  2LKV A;  3KDF B;  1QWY A;  1UWV A;  4JBK A;  3QG1 A;  3GTM H;  1VQ8 A;  3I55 A;  3GTP H;  2KA7 A;  4KJO A;  3J80 c;  1ICW A;  1CHP D;  5C0X I;  4R1J A;  3HOY H;  3JC6 6;  2K04 A;  1LTS D;  4ULL A;  1BCP D;  1XX8 A;  1QNK A;  1ENF A;  3PQI A;  5C4X H;  3TP8 A;  3RLO A;  1E7Z A;  1TT2 A;  3S1R B;  3STB C;  1A63 A;  1F2Z A;  2L0C A;  4JI3 Q;  2MFI A;  4RMF A;  1WYD A;  1K8G A;  3G6E A;  1EY5 A;  4JYA L;  3F2C A;  1DOM A;  4S3S A;  1RTN A;  1WCM H;  3DWQ A;  3BJU A;  3KJO A;  1CQV A;  4WOR A;  2F3I A;  5FOB B;  3HS0 C;  2K01 A;  4A3C G;  3I4L A;  1CKO A;  4YWM A;  1UNS A;  5C0X J;  1K73 C;  3L3O C;  3M4O H;  4NW2 A;  3MWY W;  3FVQ A;  2YTY A;  3EVQ A;  4LAA A;  3S15 B;  4MHE A;  1EQR A;  3D6C A;  1UEA B;  2RQX A;  1EZ8 A;  2I46 A;  2ENB A;  5T1G A;  3BDO A;  3S1Q H;  1IBK L;  1JOK A;  3L9A X;  1NR4 A;  5EBC A;  4RHR A;  2WKC A;  3S17 H;  1NJI C;  2JE6 I;  2KOL A;  5C5L A;  1VQF A;  3SK5 A;  3E3X A;  2AQ1 B;  1UE7 A;  1VMP A;  1PH1 A;  2B8F A;  2EDG A;  4EX5 A;  2B2U C;  2DJG C;  2JEB I;  5ELN A;  3I70 A;  4QJF A;  2RDF A;  1PYS B;  1ASY A;  1Q90 A;  2XSC A;  4ODG A;  4K5W A;  2EY6 A;  2PW5 A;  2K6A A;  2NZO A;  3X3N A;  3A5U A;  4LFA Q;  2QGQ A;  3FPU B;  2G9D A;  3DEO A;  3S1N B;  3Q0A A;  3P75 A;  2B2V A;  2K50 A;  4RCO A;  1Q82 C;  3G48 A;  4DA2 A;  2ATW A;  1PZI D;  1CHQ D;  3R2I A;  5A35 A;  5EQ0 A;  1PFN A;  4DV3 L;  1YEZ A;  2PO4 A;  1PH6 A;  3Q6S A;  1X9N A;  3M4P A;  4KTA A;  3SXH A;  5T1I A;  5IWA Q;  3G71 A;  4OO1 I;  3KDF A;  2MPM A;  4DK0 A;  4WFN 3;  3HOV G;  2YU9 H;  1B8A A;  1B50 A;  1VQL A;  3U50 C;  1QJO A;  3HZX A;  1JCK B;  3MEH A;  1STB A;  2JA7 H;  3MTS A;  1NAP A;  1EFI D;  2MJ8 A;  4LF5 L;  1Q46 A;  2ZTE A;  2EY1 A;  2FMC A;  4GN3 B;  3OIQ A;  2G5D A;  3PIP 3;  4DV6 L;  4C3I G;  2OTL A;  2PNR C;  2CQO A;  2NVQ H;  3U9O A;  1KD1 C;  5C4J B;  2EYJ A;  2DJF C;  2WKD A;  2F0H A;  3OOC A;  4G57 A;  3CP0 A;  4FXG C;  5I6W A;  1BVS A;  3PO2 H;  1HPC A;  4JI8 L;  3IAY A;  1HR0 W;  4NKL A;  3TZD A;  2I5H A;  3I2Z A;  2PZU A;  5JAV A;  4L5R C;  2MQH A;  3T13 A;  2QF7 A;  4JG2 A;  2UUC Q;  1FL0 A;  5FKA C;  1YNJ C;  5IP9 G;  1H9J A;  1YIT A;  1B4O A;  3K5O A;  3JAM c;  2BH2 A;  4EVO A;  1GO3 E;  1X65 A;  2Z4H A;  3TP7 A;  3TSS A;  4DV0 L;  2BA1 A;  1SRU A;  3HOZ G;  1TVX A;  1JT8 A;  2F0N A;  1PH8 A;  4A3I B;  3I4N H;  1JQY D;  2FJ2 A;  2F1M A;  2NN6 G;  4A3F G;  3SEB A;  2SDF A;  1B70 B;  3OTO Q;  1TS2 A;  1J9O A;  2F0P A;  2P5Z X;  3RMH A;  3PV0 A;  1I4Q A;  1VCI A;  3UDX A;  3CKI B;  1RDP D;  3RNU A;  5M5W H;  4JI3 L;  3R3O A;  1ASZ A;  4K0K L;  2DGY A;  2KEE A;  4RCN A;  4CJ1 B;  5JJZ A;  3S15 H;  4A3I G;  5JEA J;  2WB1 G;  2Q8T A;  3K5N A;  1D1I A;  3U9S A;  2K5N A;  2A69 C;  4IO9 A;  5EBD A;  3TQY A;  1PRT D;  1XNQ Q;  1Y1W H;  1YHA A;  4DPG A;  4DR7 L;  2EXZ A;  4DK1 A;  2A73 B;  1S5B D;  3KF6 B;  2V4D A;  2K5H A;  4PZ8 A;  4X3T A;  3CCM A;  1UE5 A;  2B8G A;  1HNX Q;  1HQR D;  3DLL A;  1S4Z A;  4LF8 Q;  1TY2 A;  5JPN C;  2CW0 C;  5M3F G;  4TRD A;  4DXF A;  4HSP A;  4JBM A;  4HJ7 A;  3J7A V;  5EKI A;  3WDN A;  1HZB A;  3OWE B;  4FF2 A;  3TZU A;  4R9W A;  4YHH Q;  2MNA A;  2BE5 D;  3V2T A;  2NYZ D;  1RCV D;  4BY1 B;  1SNO A;  2VQF L;  3BYY B;  2UXC Q;  2LMC B;  3OIP A;  2K75 A;  5ISR A;  1F9Q A;  3PF5 A;  4A3G G;  4YY3 Q;  2NVX H;  2SNS A;  4CKC A;  2A68 D;  4C3H G;  5FJ8 G;  4AH6 A;  3HP3 A;  1A15 A;  2AUJ D;  5ELO A;  4M8A A;  4X6A H;  4XQN A;  1GD7 A;  3VDY A;  1KDB A;  1ONL A;  4B3M Q;  2B2U A;  5LMU Q;  1JOR A;  3E6Z X;  3DM1 A;  3GTL H;  4BY1 G;  2HIV A;  3S1M B;  1PVO A;  1XJV A;  2PMZ B;  5COR A;  1STN A;  1SYD A;  4P71 A;  4R4I A;  3L7Z C;  1EOV A;  2N49 A;  2Y0S G;  5LMN Q;  2QW7 A;  2VXW A;  2KVM A;  4KKT A;  1E2W A;  5IWA L;  2ZTD A;  2NZ1 D;  4QL5 A;  4LMQ D;  2VNU D;  2L12 A;  4X62 Q;  5M5X H;  1HCZ A;  1EL0 A;  3M7G A;  2JA5 G;  2Z9H A;  1FNV A;  1I94 L;  1V1P B;  5CMD A;  1AN8 A;  1L0X B;  1G51 A;  4R8I A;  3MEF A;  1FVI A;  1YI2 A;  2XN9 C;  4IFD G;  4IPG A;  2MHV A;  2QKI C;  3OW2 A;  3ULJ A;  3GTO B;  2WAQ E;  4HAE A;  3ZYY X;  3B6Y A;  1VQC A;  1TQO A;  1XTD A;  4JV5 L;  3NK9 A;  2QDL A;  2L55 A;  1EYC A;  1M4V A;  3EA6 A;  1HA6 A;  4X64 Q;  2PMZ E;  4DF7 A;  1KIX A;  4POG A;  2UUC L;  5DNF A;  2N55 A;  1FGB D;  1A6X A;  4KKU A;  4FP5 D;  1UEB A;  1R4Q B;  3A74 A;  1UAP A;  3SE0 A;  4A76 A;  2ZM6 L;  1GXD C;  2F4I A;  5D14 A;  4ZUI A;  2SNM A;  1SSO A;  3IL8 A;  2B63 H;  3KF6 A;  3F2D A;  1VS0 A;  1A8V A;  2CHB D;  1B9M A;  3L0O A;  1DXM A;  3HOU H;  4R4C A;  4OXP A;  5FO9 B;  4DR1 Q;  3FRP B;  2IX0 A;  5C0X H;  5EPK A;  3RZO H;  3WOF A;  3KLR A;  1FR3 A;  5EGT A;  3M3Y H;  1EQV A;  1T9H A;  4BXX G;  1VQA A;  1KL9 A;  1CKN A;  3K80 C;  4K6D A;  1H9M A;  2XWB B;  3Q8D A;  1PYW D;  3I7F A;  1XYI A;  2YTV A;  1D1K A;  3QB3 A;  4JCV E;  3J7Y W;  1YIJ A;  4DFA A;  1HZA A;  3S24 A;  5JJL A;  1VMC A;  2VY3 A;  3CW2 C;  4R4O A;  2CFM A;  2GVA A;  5C44 B;  3CF5 A;  4A93 B;  1XNQ L;  3PUZ A;  5KND A;  4L5Q A;  2Q2H A;  3D4D A;  1PFB A;  1EEF D;  4IZ8 A;  4DXG A;  4ME5 A;  4GNX C;  4A3D G;  2SEB D;  1PH2 A;  1Y8O B;  4OEL B;  4P73 A;  2QEX A;  5GAH C;  2KED A;  2VQE Q;  2L15 A;  2D9U A;  1QE6 A;  2F0W A;  1BCP F;  5C44 G;  2F4V L;  2HCI A;  2ALY B;  2LXK A;  4O2D A;  4JI1 L;  4A93 G;  4C2M B;  4JI7 Q;  4RGM A;  4OWT B;  1CQF A;  5IYD H;  4YHH L;  1O78 A;  1WI5 A;  1Q3L A;  3BVM A;  4CDC C;  2BCO A;  2E2J B;  1KNA A;  1MSG A;  5FLX L;  3HKZ B;  2AQ2 B;  3CPW A;  4QQB X;  2UUB Q;  3NHH A;  3G6J B;  4J1M A;  4IPH A;  4YY3 L;  2HT1 A;  1NMF A;  1Q81 C;  5FO7 B;  4Y7N B;  3ER0 A;  5H1S E;  3TRZ A;  1SRO A;  1H9S A;  3T1H L;  4N9T A;  4ZK9 B;  1SYB A;  3KF8 B;  1IBK Q;  3S2D B;  4A3B B;  5ELE A;  5LMU L;  3M4Y A;  5CV5 A;  2HHH Q;  4GLV B;  5J1Z A;  5I2X A;  4LF9 L;  3A8J E;  4Z9C B;  2AHO B;  3CD6 A;  2I5M X;  4QCL A;  1RF2 D;  2Q2T A;  1SFO B;  1DM0 B;  4K6L A;  4HED A;  1VQP A;  4GLX A;  3G4S A;  5LMN L;  3NQT A;  2JYO A;  4ZRZ A;  2L1B A;  2I0Q A;  5IT9 L;  4C56 C;  3SVM A;  2RCF A;  2UUA Q;  3H0G B;  2XVS A;  5LMN W;  4H02 A;  2K4K A;  5K36 G;  4GOP B;  1BKB A;  3GTJ B;  4A3B G;  1RTO A;  1STY A;  1BCP C;  4X62 L;  3HKZ E;  4OO1 H;  1AP0 A;  4HMJ A;  4ZKC B;  5JVH 3;  4LWC A;  3MHB A;  3PO3 B;  3NPP A;  1N34 L;  1SNP A;  3BDC A;  3NTI A;  3WOE A;  1MKH A;  2RSN A;  2RHS B;  1EWC A;  1QOH A;  4ABN A;  1TWF H;  2EY2 A;  2O2L D;  2XWJ B;  2AWO A;  1Y8N B;  1AFP A;  2JA8 G;  4BY7 B;  5ELB A;  1HQM C;  3SK4 A;  4B08 A;  1PA6 A;  1BF4 A;  4A3M G;  5J3B A;  2F0S A;  3DEP A;  4L63 B;  1JOQ A;  3CMA A;  1S5E D;  1SNM A;  3ZJY C;  2OCE A;  2ZXO A;  4J8Q A;  3CCS A;  1ZYR D;  2NN6 I;  3PO3 G;  3J7A F;  2CWP A;  1Z9F A;  4LF5 Q;  4KHP Q;  4RGN A;  4OEM B;  2ZXR A;  4BBS B;  2RCN A;  3GTK H;  4IPD A;  1MJC A;  1LT4 D;  3Q24 A;  4DV6 Q;  1KRT A;  5CV7 A;  5JEA H;  5CV9 A;  1I50 B;  2GA4 B;  5ELF A;  1I6V C;  4BY7 G;  1I3Q B;  2B2T C;  4XYO A;  1IBM Q;  1SBB B;  3KLS X;  1HNW Q;  4DR1 L;  3GTG H;  3C3L A;  1SMY C;  3URY A;  1WJJ A;  4DKA C;  1I4G A;  1HNZ Q;  4X66 L;  4L5T A;  2HCC A;  3BVG A;  5M9O A;  2XRS D;  4FF4 A;  1EU4 A;  5HGT A;  2Q2U A;  4BBS G;  1SYG A;  2HDL A;  5IGG A;  2VUM H;  2IJ0 A;  2CVR A;  2F0F A;  3BDL A;  3CCR A;  2B29 A;  3P1H A;  2BA0 A;  2OQ0 A;  4DV0 Q;  1LTL A;  1TWH B;  4JI6 Q;  4KN4 C;  4RH6 A;  3U58 A;  2YYZ A;  3R8B A;  4TSS A;  3J81 L;  1SNQ A;  3RLF A;  2DNC A;  3MXU A;  2E2H H;  1K8A C;  2NVT B;  2L11 A;  4I65 A;  1WTH A;  1IYJ B;  4C2M H;  3KF8 A;  1GUT A;  1QUQ B;  1KRS A;  2F0U A;  3A54 A;  4UY8 C;  1GVP A;  3NP8 A;  1PXU A;  1RIP A;  1C8C A;  2E2J H;  4DAP A;  2VQE L;  1JIC A;  2J7Z A;  1D5Z C;  2K28 A;  3H94 A;  2BH8 A;  2JA9 A;  3AQQ A;  4PG3 A;  2FFK B;  1O7Y A;  3S16 B;  5CBA E;  1EUJ A;  4K0K Q;  2F3W A;  1PH5 A;  4Y7N H;  4GNX A;  4JI7 L;  4IUT A;  5K5P A;  4A3L G;  2PQA B;  2EXD A;  3PSI A;  3TRE A;  3OWF A;  2EYH A;  1Q1B A;  4DR7 Q;  4LF4 L;  2UUB L;  1CT1 D;  5CV4 A;  2Q8I B;  3DMU A;  2K52 A;  4A3E H;  3J80 L;  3SDZ A;  2ICE C;  4DAY A;  1IKL A;  1OXT A;  2F0M A;  3D31 A;  1XTC D;  1SFO H;  2EE1 A;  3CQZ H;  3J80 E;  1CK1 A;  1JB3 A;  4A3J H;  3NWS A;  4TKO B;  4XDX A;  2QDB A;  4C3J H;  2F0V A;  3S2H B;  1SND A;  3H0G H;  1VQB A;  4G7Z C;  2F0J A;  1PTO D;  1RL2 A;  4PQX A;  4LW1 A;  1V1O A;  3C2P A;  3OMC A;  5M5Y H;  2HHH L;  2H4O A;  3S14 B;  3ERS X;  2KHS A;  3TME A;  2DY8 A;  1F9P A;  3SR1 A;  3KOJ A;  1G29 1;  2K5W A;  1S3O A;  4UP7 A;  1B3Q A;  1U4R A;  4KHZ A;  4CDE C;  3SK8 A;  4O42 A;  2VQF Q;  3I4N G;  1TKW B;  3CRL C;  3CAM A;  1R9T H;  4V0B A;  3W2D A;  2UUA L;  1VDZ A;  4JK1 C;  3MXN B;  1VQD A;  1NE3 A;  1TWC B;  1EIG A;  1T5X D;  5IYB H;  3BS1 A;  4PV1 C;  1LV9 A;  4QF4 A;  2E2I B;  3ERQ A;  5FO8 B;  2JP1 A;  3A7A B;  3HOX B;  3HOV B;  1PV4 A;  3D4R A;  1DOL A;  1UE6 A;  1TWG B;  4RGT A;  3O13 A;  5BN3 A;  1N8R C;  5A2Q L;  5CBE E;  4MTK A;  5I6Y A;  1TWA B;  1FYC A;  2KQ3 A;  1K28 A;  3H09 A;  5M3M H;  1SXT A;  1CKM A;  1N32 Q;  4E6I A;  4C3I B;  1CSP A;  2MP1 A;  1TR5 A;  1FNW A;  1D7Q A;  4ZUJ A;  1I50 H;  1E22 A;  1CM9 A;  3CCU A;  4JI0 Q;  2ICI A;  1S72 A;  3HOX G;  3I56 A;  1EIY B;  4WJ4 A;  1LT6 D;  4JOI C;  3GV3 A;  1K8O A;  1ET6 A;  3UE0 A;  4PZ7 A;  4WRD A;  2JA6 H;  4KHP L;  2PQE A;  1I94 Q;  5IGD A;  1JMC A;  1G2T A;  4XIG S;  3LGJ A;  1OXS C;  1YVC A;  3CU7 A;  4JI4 Q;  4MZ9 A;  2FMM A;  1IBM L;  3HOZ B;  4U68 A;  1PDQ A;  3HEJ A;  4NXM L;  1HNW L;  4DK6 C;  4JV5 Q;  2D62 A;  2XTI A;  4IUV A;  3T1Y L;  3HOW B;  2BE5 C;  2B39 A;  4KN7 C;  3A5Z B;  1L1O B;  2C9O A;  3WWV A;  4BBR B;  1EU3 A;  1HNZ L;  2LS0 1;  1D8L A;  1HA5 A;  2B3G A;  2R7D A;  2O5I C;  4A3F B;  1IW7 C;  2KHI A;  2YTX A;  3DWA A;  1VQ5 A;  3P20 A;  2B2T A;  2D0O A;  5E7N A;  4A3C H;  2E75 C;  4G7H C;  2A74 C;  2R7F A;  5CR3 A;  2F0D A;  2ZM6 Q;  4KI0 A;  4JI6 L;  2E2D C;  2KCM A;  1WFQ A;  3S1R H;  1HUM A;  3HOW G;  2A8V A;  3OW7 A;  5C6A A;  1K83 B;  2UXD L;  5AJ3 L;  1Y8P B;  1C4Q A;  1MD2 D;  2WB1 B;  1MJE A;  2R93 B;  4BBR G;  2IT1 A;  4LFC L;  1KAA A;  4IUN A;  3BU2 A;  2TSS A;  1DON A;  3CC7 A;  5E4X A;  4DUY L;  1ICF B;  1PRT B;  2NVY B;  3K0X A;  2KBN A;  4EQO A;  3E9H A;  5IGF A;  4IN3 A;  2IHF A;  3UDF A;  2LXJ A;  5I9O A;  3NWT A;  3TN2 A;  3PIO 3;  4IUR A;  2HQL A;  3NSW A;  1SR3 A;  1IYV A;  5DM6 3;  2R93 G;  5M3F B;  3N6R A;  3MXN A;  1Q86 C;  3JAM L;  4HMI A;  4POF A;  4OIK A;  4IJL A;  3RN5 A;  5CC4 A;  1EY8 A;  2YV5 A;  1C7Y A;  1EY9 A;  3K81 C;  2G9H D;  3S14 H;  4APV A;  4AQY Q;  3LWE A;  5FLM G;  3CC2 A;  4EQP A;  1SNC A;  1RHP A;  1B3A A;  3FKI B;  4HJ9 A;  2WB1 E;  2XIW A;  4A3G B;  1K8M A;  3AEV A;  4OWX B;  1W6J A;  5C3E B;  3GTQ B;  2H5X A;  4KK7 A;  1VQI A;  5KYL A;  4C3H B;  1EQQ A;  2RHQ B;  4P75 A;  5AFW A;  4DR6 Q;  2F4V Q;  5EKK A;  1VQ4 A;  4JI1 Q;  4QIW B;  4QUC A;  2JN4 A;  4LUO A;  3S1N H;  1GHJ A;  4DV4 L;  2E76 C;  4CJ2 C;  4A3K G;  2OEO A;  3HOV H;  1AE3 A;  1DYQ A;  4NXN L;  1LAB A;  1YHB A;  3KLW A;  1BBU A;  3FKI G;  1N9W A;  3A0J A;  2V1C C;  1DJR D;  3CCL A;  2KHJ A;  1U9R A;  4XQQ A;  5KYI A;  4XYQ A;  5C3E G;  1R4P B;  4DV2 Q;  3OPO A;  1E1T A;  1BNZ A;  3V96 A;  1QB5 D;  4OGQ C;  2Y0S B;  3K7A B;  4C3I H;  3T1H Q;  1AE2 A;  2F03 A;  1I4X A;  1GM5 A;  1Q1E A;  3RD4 A;  1KAW A;  1MI2 A;  4MNO A;  4TVA B;  2X6L A;  3R93 A;  4GN4 B;  3ULP A;  1WOC A;  4LF9 Q;  2JA5 B;  3E0E A;  2QIL A;  1F2Y A;  4B9W A;  5IP7 G;  4YIJ A;  1BOS A;  1N32 L;  5KRU A;  4HJ8 A;  5IP9 H;  4RKB A;  1JJC B;  4QIW E;  3D6W A;  3M9B A;  2EQS A;  4MTN A;  2A6E D;  4BWG B;  4JI0 L;  3OSO A;  1NMG A;  1Z6H A;  1F9S A;  1TXY A;  5C4Z A;  5C4J H;  1BQQ T;  3W3A A;  3TEH B;  5IGC A;  5E4W C;  3HOZ H;  1LT5 D;  1Y1V B;  2H1E A;  1EOT A;  1EIH A;  1EZ6 A;  1STE A;  3IKJ A;  1ROD A;  4KY5 A;  3VR2 A;  3F2B A;  2NN6 H;  1O80 A;  3I3C A;  4A3F H;  2Y0S E;  1N34 Q;  3M85 A;  3PUY A;  4JI4 L;  2RBM A;  1VQ9 A;  3GD7 A;  3T56 B;  4FO2 A;  5BN5 A;  2LY7 A;  2R92 B;  4GKK L;  2RKS A;  4JOI A;  1PHJ A;  3W1G A;  4KKS A;  1Y1V G;  2PYK A;  3KFU A;  1RJT A;  1DZ1 A;  1M1K C;  2IL8 A;  2Z8L A;  4UP9 A;  1B53 A;  2R7Z B;  4A3I H;  1HFN A;  3NE5 B;  5C3W A;  1HUN A;  1I4R A;  2RF4 A;  1JB7 A;  3I4M G;  1QVC A;  4AYB B;  5CV8 A;  4KD3 A;  2BOS A;  1HFG A;  1Z47 A;  2NVY H;  5E1F A;  2F0K A;  4WJW A;  2R92 G;  4QY7 A;  4DUZ Q;  3QR8 A;  1IL2 A;  2CQA A;  1HTL D;  3PGZ A;  3A56 A;  2CW0 D;  5HGQ A;  1HHV A;  1B44 D;  1V43 A;  2F0T A;  1A3T A;  5D3I B;  3KBG A;  2R7Z G;  4FDB A;  3FMC A;  5M3F H;  4FF3 A;  1XPU A;  1RD9 D;  1X3P A;  1WTO A;  4X3S A;  4AYB G;  2F3V A;  4A3D B;  4X66 Q;  3VYU A;  1IBL Q;  4R8N A;  4KD4 A;  3H6M A;  5GQO A;  2EPB A;  3LNN A;  4M1U B;  4PZ6 A;  1EIF A;  1N36 Q;  3T4A C;  5C3X A;  2EOT A;  5IYC H;  2NTS A;  1A2U A;  2F0Q A;  4IOA A;  4DV5 L;  4C3H H;  4Y52 H;  5FJ8 H;  5DAU A;  4B3R Q;  4IUU A;  2JEA I;  4KHV A;  5EKL A;  4RA8 A;  1C0A A;  1B1Z A;  2MO0 A;  5HY6 A;  4H13 C;  4AQY L;  1I6H B;  1SE4 A;  4GOP C;  3CCJ A;  1A3U A;  3NTK A;  4HCS A;  3RR5 A;  2EIF A;  5CV6 A;  1VQE A;  4BY1 H;  2AKW B;  1SE3 A;  1QZH A;  4KY6 A;  1F2L A;  4QGU A;  4DR6 L;  5CYU A;  1XWE A;  1HZC A;  1SEB D;  1NNX A;  1ZYR C;  1K9M C;  2L5T A;  2D2C C;  4QUF A;  4YCU A;  1X56 A;  1PMR A;  4F88 A;  1X3Q A;  4G4K A;  1DCZ A;  4RKL A;  2K03 A;  1TS5 A;  2X6G A;  2DUD A;  3GTM B;  1LO5 D;  4LF4 Q;  4YCV A;  3GTP B;  1C48 A;  1AH9 A;  2FXQ A;  2N88 A;  3F2U A;  3HOY B;  1JWM D;  1V1P A;  3BVZ A;  4F87 A;  3S1M H;  4DV2 L;  4RG1 A;  5FLX E;  1MSH A;  1Z7T A;  1JC7 A;  4A4I A;  4HID A;  5JPM C;  1KLG D;  1IL8 A;  3L2P A;  2K05 A;  2EJM A;  2WIN B;  1PFM A;  4NB3 A;  4DAM A;  5C4X B;  3NTH A;  1FGU A;  4R4T A;  1EY6 A;  3NBI A;  2KEC A;  5L37 A;  4HIK A;  2D0P A;  3EJI A;  1H95 A;  4BS9 A;  1B9N A;  4XTC S;  5HUR A;  3HOY G;  4PMC A;  3FP9 A;  4ZCK A;  1Q8I A;  1WCM B;  1XPR A;  1J8I A;  3KUP A;  5F2D A;  3RN2 A;  3K59 A;  2QCP X;  5C4X G;  3VA7 A;  4JI2 L;  2JA8 B;  3GTO H;  1LTI D;  4OL7 A;  1YNN D;  3M4O B;  2EYF A;  5IT9 E;  2WV6 D;  4A3M B;  1AW7 A;  4OWW B;  3P7J A;  2MUY A;  3VYT A;  4DR4 Q;  1L0W A;  3BZC A;  2DN8 A;  4OON A;  3I73 A;  4HN7 A;  2ZJQ A;  5I9P A;  1WCM G;  3RLN A;  3AB9 A;  4JW0 A;  4BXX H;  4TQU S;  2M00 A;  2NTT A;  3S17 B;  1A3V A;  4GS3 A;  2WFW A;  2FHT A;  1SLJ A;  3GDE A;  3OYY A;  3QO2 A;  4HIM A;  5GAD C;  4DN4 M;  1XPO A;  1KAB A;  4RFB A;  3DUZ A;  3H3V I;  4C1N K;  3NXW A;  3I91 A;  4L8J A;  1ILP A;  3S9W A;  4RWS C;  1BUV T;  1M8A A;  1J5E Q;  5GAE C;  4CDF C;  2OT2 A;  1GUW A;  2MGS A;  3CHB D;  1JOO A;  1KDA A;  1EWH A;  1P16 A;  3TBI B;  3DWP A;  1UUP A;  2PPB C;  3KYH C;  1E3P A;  4DUZ L;  1EFW A;  4CHT B;  1BXT A;  4LJZ C;  1YHQ A;  2IY5 B;  4NMZ A;  3VR6 A;  4CJ0 B;  2EZV A;  1GHK A;  1CUK A;  1EQT A;  4NXM Q;  3TP6 A;  1VQM A;  4DV7 L;  3T1Y Q;  3PCO B;  1MGS A;  5C44 H;  2VS1 A;  1I5F A;  4GLA C;  4A93 H;  1YBY A;  1WTQ A;  1S5F D;  3GO5 A;  1IBL L;  3J81 j;  1JE4 A;  2EYO A;  3D8G A;  3F8T A;  5EPJ A;  1CA6 A;  2YU9 B;  3LWU A;  1JJG A;  1N36 L;  4DNT B;  4KV6 A;  4IQZ A;  1X3F A;  2JA7 B;  2EY5 A;  3VYS A;  3VYR A;  1WD1 A;  4H44 C;  1TS4 A;  4CKE A;  2UXD Q;  5AJ3 Q;  1AEX A;  4B3R L;  1YNX A;  2VZA A;  1VQN A;  1BBW A;  4ZYS A;  3E0J A;  4LFC Q;  4CGY B;  1PH9 A;  1N33 L;  5DM7 3;  1LM0 A;  4MN3 A;  2PZW A;  3J81 E;  1HTP A;  5ELC A;  2NVQ B;  2RSO A;  4DUY Q;  4DNI A;  2A6H D;  3PO2 B;  3VR3 A;  1WVL A;  4HTH A;  4DR2 L;  2K14 A;  1GUO A;  3ND8 A;  2JJQ A;  1AZQ A;  1EYA A;  4I7A A;  2Z6K C;  3CC4 A;  2JA7 G;  2JA6 G;  2A5H A;  2N8N A;  5KNB A;  4DR3 L;  2X69 A;  3KJP A;  1LYL A;  3E9I A;  1Q7Y C;  2EJG C;  4Q0F A;  1D2B A;  4GOP A;  1PH3 A;  4IUP A;  5C4H A;  4UPA A;  2Q8R E;  4I7Z C;  3S2D H;  5K36 H;  1L2F A;  2KCN A;  3EQL C;  1MIU A;  3K57 A;  4A3B H;  1PTO B;  3A8K E;  1L0Y B;  2A19 A;  1ILQ A;  1XMQ Q;  1V9P A;  3NEN A;  2UU9 L;  3PO2 G;  1G91 A;  1K0S A;  2VL6 A;  1U4M A;  1STA A;  1X6O A;  1D6E C;  3U4V A;  5DLQ E;  2IWH A;  3I4N B;  1LTR D; 
#chains in the Genus database with same CATH homology
 2VW9 A;  1SN8 A;  1KQS A;  2ASB A;  1XTD A;  4JV5 L;  3CC7 A;  4DUY L;  4GKJ Q;  3K0X A;  4ALP A;  4ME3 A;  2KBN A;  3E9H A;  2R7Z H;  2OTJ A;  2ZTC A;  4X64 Q;  2IHF A;  4BA1 I;  3UDF A;  2PMZ E;  2LXJ A;  3NEM A;  2JA8 H;  4GNX B;  1KIX A;  4POG A;  2UUC L;  3GTJ H;  2HQL A;  1HJP A;  4DV1 Q;  1UEB A;  1V1Q A;  4A3M H;  1SR3 A;  4DV4 Q;  4B3T Q;  2N78 A;  3A74 A;  1W2B A;  2R93 G;  2KEN A;  5BR8 Q;  2AMC B;  4A76 A;  1Q86 C;  2ZM6 L;  1VQG A;  4JBW A;  4A3E G;  1XNR Q;  1K0R A;  4POF A;  3UDG A;  4NXN Q;  4YWK A;  3KF6 A;  4IJL A;  3F2D A;  1XMO L;  1VS0 A;  3RN5 A;  1L1O C;  1A8V A;  2R6G A;  1E24 A;  2YV5 A;  4DAY B;  1Q12 A;  3EN2 A;  4EQ5 A;  1C7Y A;  4IFD I;  3K81 C;  3S14 H;  3L0O A;  1S40 A;  4LFB L;  3HOU H;  4APV A;  4AQY Q;  3NEL A;  4OXP A;  4R4C A;  4A3J G;  4DR1 Q;  1EYG A;  5FLM G;  2IX0 A;  2UXB L;  4DV3 Q;  3CC2 A;  5IE8 A;  1QVF A;  4IOC A;  3H0G G;  4BY7 H;  1Q8K A;  1IXR A;  1QVG A;  3RZO H;  3M3Y H;  4P74 A;  1X54 A;  1T9H A;  1X55 A;  2WB1 E;  4HJ9 A;  4DR4 L;  1VQA A;  4BXX G;  3AEV A;  4A3D H;  1KL9 A;  4OWX B;  1VQJ A;  1CKN A;  1U0L A;  2H5X A;  3K80 C;  1M90 C;  1VQI A;  1VQ6 A;  2GVB A;  1EQQ A;  3W5O A;  2RHQ B;  4P75 A;  4X64 L;  3Q8D A;  4DR6 Q;  2F4V Q;  3I7F A;  2Q2I A;  2YTV A;  1VQ4 A;  4JI1 Q;  4JCV E;  4HJ5 A;  2UXC Q;  1YIJ A;  5JJI A;  4DV1 L;  1HZA A;  4LUO A;  4NPS A;  4LUZ A;  1FJG L;  1EWI A;  1E1O A;  3S24 A;  3S1N H;  2B63 H;  1Y1W G;  4DV4 L;  4B3T L;  5JJL A;  4BBS H;  2VY3 A;  4A3K G;  1QZG A;  3CW2 C;  4R4O A;  5BR8 L;  3J81 c;  3H15 A;  1VQO A;  3HOV H;  1AE3 A;  2CFM A;  2GVA A;  3CF5 A;  3M7N A;  1JE5 A;  4NXN L;  5IYB G;  1YHB A;  3KLW A;  1BBU A;  1I3Q H;  3FKI G;  1N9W A;  3A0J A;  2V1C C;  4DK3 C;  3PUZ A;  1XNQ L;  4L5Q A;  2Q2H A;  2A1A A;  2KHJ A;  3CCL A;  3J7Z C;  3EIV A;  5C3E G;  1I6H H;  1GKH A;  4DV2 Q;  4GNX C;  4IFD J;  1J5E L;  1E1T A;  4A3D G;  1NY4 A;  3CPF A;  1HR0 Q;  1VQC A;  1PYB A;  4LF6 Q;  3U4Z A;  3DM3 A;  4C3I H;  3T1H Q;  1PH2 A;  1AE2 A;  2ZJP A;  4P73 A;  3JAM i;  2QEX A;  4JI8 Q;  5GAH C;  1GM5 A;  1Q1E A;  3J7A 5;  1KAW A;  2CWA A;  1QUQ A;  5M3M G;  4MNO A;  2L15 A;  4TVA B;  2VQE Q;  2WP8 J;  3STB D;  1OTC A;  4PMW A;  1SE8 A;  5C44 G;  2F4V L;  3ICE A;  4GN4 B;  3ULP A;  1WOC A;  4LF9 Q;  2ALY B;  2LXK A;  3E0E A;  4O2D A;  4JI1 L;  3CCE A;  4GKK Q;  4A93 G;  5IP7 G;  1VQ7 A;  4JI7 Q;  2IHE A;  2OQK A;  3IRB A;  1PFS A;  1TWH H;  4OWT B;  1N32 L;  5IYD H;  3PUX A;  4HJ8 A;  4KLK A;  3D0F A;  3KDF B;  5IP9 H;  4YHH L;  4JI5 Q;  1WI5 A;  1UWV A;  1JJC B;  4JBK A;  3GTM H;  1VQ8 A;  4QIW E;  3I55 A;  3GTP H;  4MTN A;  3M9B A;  2EQS A;  4HIO A;  3J80 c;  2PQA A;  4R4Q A;  3CPW A;  4JI0 L;  4QQB X;  4HJA A;  5C0X I;  2UUB Q;  4R1J A;  1VQH A;  2K5V A;  2NVT H;  1NMG A;  3JC6 6;  3HOY H;  1TXY A;  4A3L H;  4IPH A;  5C4J H;  3TEH B;  4YY3 L;  4P72 A;  2HT1 A;  3HOZ H;  1NMF A;  3F1Z A;  3M4Q A;  1Q81 C;  3AFQ A;  1HR0 L;  2C35 B;  3ER0 A;  5H1S E;  4LF6 L;  3TRZ A;  1NBW A;  1SRO A;  3T1H L;  5C4X H;  3RLO A;  2JK8 A;  2ID0 A;  4YWL A;  3F2B A;  1E7Z A;  3KF8 B;  1IBK Q;  1C9O A;  3STB C;  1A63 A;  4A3F H;  2Y0S E;  1N34 Q;  3M85 A;  3S16 H;  1IZ6 A;  3PUY A;  4JI4 L;  5LMU L;  4JI3 Q;  2MFI A;  3GD7 A;  4RMF A;  1VQ9 A;  1WYD A;  3PIP A;  3G6E A;  1U5K A;  4GLV B;  1K8G A;  2HHH Q;  4JYA L;  4LF9 L;  3F2C A;  4J15 A;  4GKK L;  2AHO B;  4UP8 A;  3UE1 A;  1WCM H;  3CD6 A;  4JOI A;  2I5M X;  3BJU A;  1PHJ A;  1KC8 C;  3KJO A;  3CME A;  3W1G A;  2Q2T A;  1Y1V G;  3KFU A;  2F3I A;  1VQP A;  4GLX A;  1A62 A;  3G4S A;  5LMN L;  4L5S A;  1M1K C;  4UP9 A;  4A3C G;  1HH2 P;  2I0Q A;  4A3I H;  1CKO A;  2UUA Q;  4YWM A;  1K73 C;  5C0X J;  2ZJR A;  5LMN W;  4H02 A;  3M4O H;  2K4K A;  2RF4 A;  1JB7 A;  5K36 G;  4GOP B;  3I4M G;  1BKB A;  4A3B G;  1OXU A;  1QVC A;  2F52 A;  4X62 L;  3HKZ E;  2YTY A;  1X3G A;  1X3E A;  1EQR A;  1Z47 A;  2NVY H;  2R92 G;  4QY7 A;  4DV5 Q;  4DUZ Q;  3S2H H;  1IL2 A;  3S1Q H;  4LWC A;  3PGZ A;  5HGQ A;  1IBK L;  1XMQ L;  5GRO A;  1N34 L;  1V43 A;  2Z6K A;  3S17 H;  1NJI C;  1MKH A;  2RHS B;  2JE6 I;  1KXL A;  2R7Z G;  2E5L Q;  4FDB A;  1DGS A;  1TWF H;  1VQF A;  5M3F H;  2AWO A;  2JA8 G;  1XPU A;  4B3S Q;  1UE7 A;  4GKJ L;  1PH1 A;  3I4O A;  4AYB G;  1PA6 A;  4EX5 A;  4A3M G;  5J3B A;  4X66 Q;  1IBL Q;  2JEB I;  2CCZ A;  5ELN A;  5GQO A;  3CMA A;  4QJF A;  3ZJY C;  1PYS B;  2AWN A;  1TWC H;  2OCE A;  1ASY A;  2NZO A;  3A5U A;  2NZH A;  2NN6 I;  3CCS A;  2B63 G;  4PZ6 A;  4LFA Q;  3PO3 G;  3PIO A;  1EIF A;  2QGQ A;  1N36 Q;  1JJ2 A;  2E2I H;  2CWP A;  1Z9F A;  4LF5 Q;  4KHP Q;  3HOX H;  5IYC H;  2HIX A;  2RCN A;  3GTK H;  4IPD A;  1XNR L;  5IY0 A;  3HOU G;  1MJC A;  4IOA A;  4DV5 L;  4IPC A;  4C3H H;  3NBH B;  1KRT A;  4DV6 Q;  5FJ8 H;  4Y52 H;  4B3R Q;  1TWG H;  2JEA I;  4BY7 G;  2K50 A;  5C0X G;  1C0A A;  1TWA H;  1Q82 C;  2MO0 A;  5HY6 A;  3G48 A;  1IBM Q;  2ATW A;  4AQY L;  3TS0 A;  1HNW Q;  4DR1 L;  3GTG H;  4GOP C;  1CKN B;  4DV3 L;  1YEZ A;  4LUV A;  3CCJ A;  3RR5 A;  1PH6 A;  2EIF A;  1WJJ A;  3FHW A;  1VQE A;  4BY1 H;  4DR5 Q;  4DKA C;  2GN5 A;  3HKS A;  2CKZ B;  2AKW B;  1X9N A;  1QZH A;  3M4P A;  1HNZ Q;  4X66 L;  5IWA Q;  3G71 A;  4L5T A;  4OO1 I;  3KDF A;  4QGU A;  4BBS G;  2Q2U A;  4DR6 L;  1YJW A;  1L1O A;  5IYC G;  3HOV G;  2YU9 H;  1B8A A;  1HZC A;  1VQL A;  4X65 Q;  1K9M C;  2VUM H;  3U50 C;  3CCR A;  2B29 A;  2JA7 H;  4LFA L;  4YCU A;  1X56 A;  2BA0 A;  2OQ0 A;  4DV0 Q;  1LTL A;  2PI2 E;  4JI6 Q;  4LF5 L;  1Q46 A;  2ZTE A;  3U58 A;  4GN3 B;  1P8L A;  2YYZ A;  2DUD A;  3UDI A;  2MO1 A;  4DV6 L;  2OTL A;  4LF4 Q;  4YCV A;  3RLF A;  2UXC L;  4JI2 Q;  1AH9 A;  2FXQ A;  3K7U C;  2E2H H;  4O0A A;  1K8A C;  4OX9 Q;  2CQO A;  1G6P A;  2NVQ H;  3S1M H;  4DV2 L;  4RG1 A;  1KD1 C;  5EAY A;  1IYJ B;  4C2M H;  4HID A;  4A4I A;  3H3V H;  3HOW H;  1QUQ B;  2XGT A;  1KRS A;  3CP0 A;  1BVS A;  3PO2 H;  4AIM A;  4UY8 C;  3L2P A;  1GVP A;  4JI8 L;  1HR0 W;  1RIP A;  4NB3 A;  4BBR H;  4DAM A;  2E2J H;  2VQE L;  1FGU A;  4R4T A;  4YCW A;  2BH8 A;  2JA9 A;  2I5H A;  3I2Z A;  4L5R C;  3AQQ A;  2MQH A;  4PG3 A;  4JG2 A;  5IYD G;  2UUC Q;  2UXD L;  1FL0 A;  5IP9 G;  2WAQ G;  1YIT A;  1EUJ A;  4HIK A;  2D0P A;  4K0K Q;  1H95 A;  3JAM c;  2BH2 A;  1PH5 A;  4Y7N H;  4GNX A;  4JI7 L;  4XTC S;  1GO3 E;  3HOY G;  4A3L G;  5JJK A;  2PQA B;  1X65 A;  2EXD A;  3FP9 A;  1XPR A;  4DV0 L;  4JI5 L;  1W3S A;  3PSI A;  3TRE A;  1PH7 A;  2BA1 A;  1SRU A;  3HOZ G;  3TS2 A;  3PF4 A;  1XMO Q;  3RN2 A;  1K83 H;  1Q1B A;  1JT8 A;  1CSQ A;  4DR7 Q;  4LF4 L;  2UUB L;  2R93 H;  5C4X G;  1PH8 A;  4JI2 L;  3GTO H;  1UE1 A;  2K52 A;  4A3E H;  3I4N H;  1OXT A;  2NN6 G;  3D31 A;  4A3F G;  4LNQ A;  4OWW B;  1SFO H;  1B7Y B;  4DR4 Q;  1B70 B;  3CQZ H;  1L0W A;  3OTO Q;  3BZC A;  4OON A;  4A3J H;  3PV0 A;  2ZJQ A;  1VCI A;  2Z0S A;  3AYH B;  5FLM H;  4C3J H;  3UDX A;  3J81 i;  1WCM G;  1OXX K;  3H0G H;  2PNH A;  1VQB A;  5M5W H;  3RLN A;  3RNU A;  1RL2 A;  4JI3 L;  3K8A A;  4LW1 A;  4BXX H;  4TQU S;  5M5Y H;  2HHH L;  3ERS X;  1ASZ A;  4K0K L;  4DV7 Q;  2DGY A;  3PUV A;  4GS3 A;  2WFW A;  2PI2 A;  1FJG Q;  3S15 H;  1SLJ A;  3KOJ A;  1G29 1;  3GDE A;  1S3O A;  2WB1 G;  3OYY A;  4UP7 A;  5JEA J;  4HIM A;  4A3I G;  1VQK A;  4WJ3 M;  4KHZ A;  5GAD C;  1YZ6 A;  2N3S A;  1XPO A;  2K5N A;  2VQF Q;  3I4N G;  4IO9 A;  3H3V I;  1K3R A;  3TQY A;  1XNQ Q;  3CAM A;  1J6Q A;  1Y1W H;  1YHA A;  1R9T H;  4OO1 G;  3PUW A;  4DPG A;  4DR7 L;  4A3K H;  2UUA L;  1J5E Q;  3MXN B;  5GAE C;  1VQD A;  1NE3 A;  3CXC A;  1P16 A;  5IYB H;  3KF6 B;  3FKI H;  1O7I A;  2K5H A;  4PZ8 A;  3W1B A;  3CCM A;  4A3G H;  1UE5 A;  5C3E H;  3GTQ H;  3KYH C;  3OTO L;  3DLL A;  1PV4 A;  1E3P A;  4DUZ L;  1HNX Q;  4LF8 Q;  1EFW A;  1NTG A;  4AYB E;  4GN5 A;  5M3F G;  1UE6 A;  1PH4 A;  1YHQ A;  2IY5 B;  4JBM A;  4HJ7 A;  1N33 Q;  1N8R C;  3J80 i;  1CUK A;  4NXM Q;  3EBE A;  5M3M H;  1HZB A;  3AFP A;  1VQM A;  2E5L L;  2I5L X;  4DV7 L;  1CKM A;  3T1Y Q;  3PCO B;  1N32 Q;  5FLX c;  1CSP A;  1KHI A;  4YHH Q;  2MNA A;  5C44 H;  4B3S L;  2VS1 A;  1I5F A;  4DR2 Q;  4GLA C;  1D7Q A;  4A93 H;  1YBY A;  3RZD H;  1I50 H;  1E22 A;  2JQO A;  2VQF L;  3GO5 A;  5IP7 H;  1IBL L;  2OWO A;  3J81 j;  3CCQ A;  1LUZ A;  3CCU A;  4JI0 Q;  1S72 A;  2K75 A;  3HOX G;  3I56 A;  3PF5 A;  4A3G G;  1EIY B;  4YY3 Q;  2E8G A;  3F8T A;  4WJ4 A;  2NVX H;  4DR3 Q;  3K7A H;  4JOI C;  5JEA G;  5FJ8 G;  4AH6 A;  1JJG A;  3UE0 A;  5ELO A;  4IJH A;  4PZ7 A;  1N36 L;  3BZK A;  4X6A H;  1X3F A;  2JA6 H;  1GD7 A;  4KHP L;  3VDY A;  1I94 Q;  1JMC A;  1YJ9 A;  4XIG S;  3LGJ A;  1HNX L;  1OXS C;  4LF8 L;  2UXD Q;  1YVC A;  2UU9 Q;  5AJ3 Q;  4B3M Q;  4B3R L;  3SGI A;  1YNX A;  4JI4 Q;  2VZA A;  5LMU Q;  2JA5 H;  4MZ9 A;  1VQN A;  1BBW A;  2ES2 A;  1A0I A;  4LFC Q;  3GTL H;  4BY1 G;  2HIV A;  1PH9 A;  1IBM L;  1N33 L;  4JYA Q;  4JBJ A;  1LM0 A;  4LF7 Q;  1PVO A;  4NXM L;  1HNW L;  1XJV A;  4DK6 C;  4JV5 Q;  2D62 A;  2XTI A;  4DUY Q;  4P71 A;  3T1Y L;  1Y14 B;  4R4I A;  4DNI A;  3CCV A;  2IX1 A;  3A5Z B;  3L7Z C;  1EOV A;  5IT9 c;  1L1O B;  4DR5 L;  4DR2 L;  2K14 A;  3WWV A;  2N49 A;  2Y0S G;  5LMN Q;  2VUM G;  2JJQ A;  1HNZ L;  1SMX A;  2Z6K C;  1D8L A;  3ULL A;  3CC4 A;  2B3G A;  1OXV A;  2R7D A;  3HFZ B;  5IWA L;  2JA7 G;  4BA2 I;  2KHI A;  2JA6 G;  2YTX A;  2ZTD A;  1Y1V H;  2N8N A;  4QL5 A;  1VQ5 A;  4DR3 L;  4X65 L;  2KCT A;  2VNU D;  2D0O A;  4X62 Q;  5E7N A;  3KJP A;  1LYL A;  4A3C H;  5M5X H;  3E9I A;  3PO3 H;  1YJN A;  1Q7Y C;  2R7F A;  2ZM6 Q;  4KI0 A;  4GOP A;  1PH3 A;  2JA5 G;  4JI6 L;  4UPA A;  2KCM A;  1WFQ A;  3S1R H;  1L2F A;  1I94 L;  3I4M H;  1HZ9 A;  1MIU A;  4A3B H;  3S2D H;  3HOW G;  2A8V A;  2A19 A;  1G51 A;  2QA4 A;  3MEF A;  1FVI A;  1V9P A;  3NEN A;  5AJ3 L;  4A75 A;  4JC0 A;  1YI2 A;  1XMQ Q;  2UU9 L;  4B3M L;  3PO2 G;  5GAG C;  2VL6 A;  1MJE A;  4IPG A;  4IFD G;  4OX9 L;  2R92 H;  4LFB Q;  2LSS A;  4BBR G;  2IT1 A;  4LFC L;  1X6O A;  3ULJ A;  3OW2 A;  3HKZ G;  2WAQ E;  2UXB Q;  3U4V A;  5DLQ E;  3BU2 A;  3B6Y A;  4LF7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...