2L5TA

Solution nmr structure of e2 lipoyl domain from thermoplasma acidophilum
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
77
structure length
77
Chain Sequence
MYEFKLPDIGEGVTEGEIVRWDVKEGDMVEKDQDLVEVMTDKVTVKIPSPVRGKIVKILYREGQVVPVGSTLLQIDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of E2 lipoyl domain from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
molecule keywords Lipoamide acyltransferase
total genus 3
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l5tA00
5A35A 4PV1C 2YYZA 2NN6G 2B8FA 2PCFB 1A6XA 2JEBI 1SMYC 4KN7C 1Z7TA 3OOCA 2F1MA 5KNBA 2E76C 2EDGA 4DNTB 2K32A 1OXVA 1VCIA 3SDZA 3I73A 4G7OC 4JK1C 2AUKA 3PUWA 1FR3A 3A7AB 1BDOA 3VR2A 4DNRB 1GJXA 2PPBC 1E2VA 1CTMA 1Q1EA 1GUGA 2EJFC 1LACA 3M4YA 2EVBA 1VF7A 1GUSA 3EQLC 1IW7D 5BN5A 4G7HC 2A6EC 5BN4A 1Y8NB 2NN6I 1T5EA 1OXXK 3MFYA 3P20A 4XIGS 2JXMB 4I7ZC 2BA0A 2NN6H 2D2CC 3VR3A 1TU2B 1Q90A 2A68C 1E2WA 4XTCS 3VR6A 1Y8OB 2DNCA 3I72A 5JEAG 1I6VC 1IW7C 1GUOA 1TKWB 2CW0C 2L5TA 3CRLC 1OXSC 3N6RA 4IQZA 4KKSA 4RCNA 3ND9A 3T56B 3A8KE 3BG3A 1VF5C 2BDOA 3TZUA 4OO1G 3CRKC 3RLFA 2PNRC 4H0LC 4KHZA 5KNCA 1YNNC 4IFDG 1IYVA 1Q12A 1HQMC 2V4DA 1Q1BA 1Z6HA 2K33A 3L7ZC 3M85A 3LNNA 5C0XH 2JE6I 4KKTA 3HGBA 3PUZA 2IT1A 1YNJC 1QJOA 1GUTA 2BA1A 3OW7A 4OGQC 3VA7A 1GHKA 1H9KA 1HCZA 3H94A 4KI0A 2E74C 1G291 3AB9A 2K7VA 4GZYC 4JBWA 3A8JE 3A7LA 4IFDH 4LK1C 1ONLA 2E75C 2A6ED 1B9NA 2B8GA 2LMCB 1O7LA 5K36H 5C0XG 4BA1I 1FYCA 1H9RA 2A6HD 4KMUC 4DK1A 2A69D 2AUJD 3IFTA 1K8OA 1CI3M 3KLRA 3VR4A 3QG1A 1H9SA 1K8MA 2AWOA 4OO1H 1OXUA 2EJMA 2ZT9C 3DXJC 3QJYA 1PMRA 3M7NA 3SE0A 2R6GA 1GHJA 1EWHA 2A6HC 2QF7A 3MXUA 3PUVA 3WDNA 1DCZA 4G7ZC 2O5JC 1VDZA 1O78A 3ND8A 3W3AA 3GQBA 2DN8A 4DK0A 2JEAI 2Q8IB 1GUNA 1V43A 2D5DA 3FPPA 1CFMA 5K36G 1LABA 1ZYRC 3OPOA 5BN3A 3D4RA 5KNDA 1H9MA 1B9MA 1HPCA 1ZKOA 4HR7B 1OXTA 4BA2I 3BDOA 4L8JA 2A69C 2A68D 2EJGC 2KA7A 3I4LA 5JEAH 1HTPA 2BE5D 4KKUA 3VR5A 1IYUA 2D62A 4H13C 4KN4C 4TQUS 2O5IC 4H44C 1H9SB 1DD2A 1Y8PB 3PV0A 3T53B 1V8QA 1DXMA 3FMCA 3U9SA 1Y69U 3D31A 3PUXA 1E2ZA 4LJZC 3IKJA 3NE5B 3QIAA 2KCCA 3GD7A 3PUYA 1H9JA 3LWUA 2BE5C 4TKOB 3A8IE 2DNEA 3T51B
chains in the Genus database with same CATH superfamily
1HJPA 1BR9A 1VQOA 1TWAB 1E24A 2HQLA 2OQKA 2G9HD 2F0VA 2WAQG 3OOCA 4FF4A 3M3YH 3TREA 3D6CA 1BDOA 1G2SA 4LF9L 3PMFA 4N8X1 5EQ0A 3E6ZX 1I6HH 3K7AH 2QDBA 4YCVA 3QR8A 4XIGS 3GTOB 2ENBA 2MFIA 2ALYB 1EIGA 1I94Q 1TY2A 3J81E 2F0LA 2X6GA 4JOIA 1SBBB 3I3CA 1SE3A 3CHBD 2CW0C 3NBIA 3F2UA 1FVIA 4DR6L 1IBKQ 3GTJB 1QUQB 1JQYD 3OW2A 5CGKA 4A3GH 3JAML 3I91A 1S72A 3TDQA 4C3JB 1R9TB 1BVSA 3D8GA 4DV0Q 2F4VL 4OO1I 5CYUA 1SROA 3GTLH 1EU4A 4AIMA 3H15A 3GO5A 1H9KA 3ULPA 1K73C 1PHJA 1O80A 4DV0L 3E9HA 4BXXG 5IYDH 4F87A 3BYTB 4A3BH 4JC0A 1STAA 4JW0A 3HOZH 4YWLA 3E9IA 1N8RC 3D4DA 4GNXA 1K8AC 2KEEA 1PZKD 1FNUA 3VR4A 1I94L 5CORA 1SMXA 2EYHA 1LT6D 3J7ZC 3J81j 4DR1Q 5IYBG 4OEMB 3FKIG 3CKIB 4R8NA 2ATWA 1KXLA 1Q82C 1W2BA 1DYQA 3F8TA 4PZ8A 1QVGA 2ZXRA 3OHXC 4NXML 1O7IA 3VA5A 1XPUA 4B3RQ 1WTOA 3V2TA 2F0FA 5KNDA 1SNQA 1JWUD 4JI8Q 3S15H 1EIYB 4YWKA 2YTYA 1MSGA 1FNWA 2K01A 3OWEB 1VQCA 3D31A 4C3HB 4R9WA 3GD7A 4A3BG 1XMQL 2N3SA 5IP7G 1GXDC 2DNEA 3NELA 3S1QB 4K6LA 4BXXH 4DV2L 1F9PA 3RZOB 3F1ZA 4PV1C 1SMYD 3NTHA 2NN6G 2PO4A 4X6AH 2VUMB 2XRQD 3CCEA 4KN7C 3V05A 3K8AA 1VQLA 1KQSA 3A7AB 4A3DH 1E2VA 2ZM6L 5IOCA 3S1MH 2QDLA 3W1BA 1YJ9A 1SYDA 5C0XI 1I3QB 4A3LH 4MTNA 3SGIA 1OXXK 4OX9L 2EPBA 1JOQA 5M3MB 4DR2L 1BXTA 5CBAE 5IWAL 2HHHL 2OTJA 3KF6A 2Y0SE 5EBDA 4JG2A 2DGYA 2YV5A 4A3IH 2CHBD 4HJAA 3H0GG 3BS1A 4JI0L 4HAEA 4DV3L 2EYJA 2EXZA 1BKBA 3MXNB 1VQJA 4K2KA 1BO0A 4K0KL 4RFBA 3PIO3 3PO3G 2M2LA 2WKDA 5IGEA 4KI0A 1HQRD 1EEFD 3E3XA 3GTMB 2HCIA 3S9WA 5C4XG 2R3ZA 5K5PA 4BY1B 2C5CA 4UAIA 2E75C 2RHSB 3RN5A 1A3UA 2JSOA 1ILQA 1PDQA 2I46A 4A3MB 4PMBA 2UXDQ 4AYBG 4K6DA 3IFTA 2B2VA 3KBGA 2HD3A 4FXGC 3TQYA 4LF8L 4OHJA 2LS01 1DOMA 2IW3A 1HNWQ 3MXPA 5IIFA 2VQFL 1KDBA 3U4VA 2JA6B 3CCLA 1HH2P 3H3VH 5BR8Q 1N33L 4UP8A 2A74C 3OTOQ 4JI4Q 1LTRD 2PW7A 2R6GA 1S5CD 4HCEA 1U5KA 2A6HC 3AMUA 2EE1A 5TSSA 1D8LA 3GQBA 1F9RA 2QEJC 1D2BA 1SDFA 1V43A 2ZJRA 1LTSD 3ZJYC 4A3KB 1QG7A 2OEOA 5C44G 2CH4A 4DK3C 1HNZQ 5EKKA 4P71A 4HJ8A 2A68D 1KC8C 1SJED 1O7YA 4H13C 5LHY1 1E1TA 3M4OB 4XQQA 2R7ZB 3A55A 4X66Q 3I7FA 2HIXA 2KCCA 1IHZA 1CKNA 5C3EG 3PIP3 3D3RA 2UXBL 1B44D 4GLVB 2K5NA 5LL6X 5C44H 4L63B 2RDHA 3NEMA 3E0EA 2F1MA 2E76C 2EDGA 2L55A 2EYOA 2VQEL 1SYBA 2KUMA 3K0XA 2IJ0A 2B63B 1EYDA 3R2IA 3CCJA 1XNRQ 1K9MC 1GUSA 4K5WA 2PI2E 1IKMA 2HUGA 2XRSD 4JI3L 4X62Q 2D2CC 2EIFA 1EY4A 4XTCS 1D1IA 4IQZA 2NVQB 4R4IA 3T16A 5EPKA 4LW1A 3RLFA 1GKHA 1SNDA 2RVLA 4A3FB 2V4DA 5HY6A 4LFBL 3PUZA 5GAHC 2GVAA 1YNJC 1E0BA 1Y14B 4ZRZA 1XMQQ 4QGUA 2E2JB 1LTTD 2Y0SB 2E74C 1AZPA 1A0IA 1GM5A 1F2ZA 3EJIA 1UWVA 2LMCB 2HCCA 1HR0L 2VNUD 2AUJD 4DR3L 1W3SA 2D9UA 2K6AA 5M5YH 4QMGA 3CAMA 1ASZA 1VQIA 2A19A 2I5MX 3EROA 1XX8A 4DK6C 4A93G 4FP5D 5E3FA 1PH8A 4ALPA 1D7QA 1MJEA 3BYYB 4QUCA 1EQVA 2CQOA 2ZTDA 4UHVA 5KYIA 1X55A 2QF7A 4OWTB 2E2DC 5GAGC 3H3VC 1EZ8A 1PYSB 4NXNL 4YY3Q 1CFMA 4IUQA 1W6KA 1Y1VB 1ZYRC 2NVYB 1DOLA 3D4RA 2NTSA 1B9MA 1HPCA 1PA6A 3BDOA 3G6JB 1JR0D 2A69C 3OIPA 4J15A 2CCZA 2UUBL 2Y0SG 2O5IC 1H9SB 1HFGA 1PLFA 1J6QA 3PV0A 1YITA 1CQVA 2R7DA 1VQ8A 5IGBA 3U9SA 3C1EA 3H09A 2JA8G 1C9OA 4KJOA 3NE5B 5C4ZA 4ILWA 1EWCA 4LFAQ 4LF7Q 1SEBD 2EYMA 1IBLL 4ZKBB 1PFBA 4DV7L 3TP8A 2JEBI 4I7AA 3OMGA 3HEJA 5EGTA 1RTNA 2AWNA 2R93H 4K0KQ 1NNXA 4ME3A 4P75A 4G7OC 1FD7D 4IPDA 3KDFB 1I6HB 1CSPA 3Q8DA 2NUCA 3O13A 3HKZE 4RCOA 1EYCA 3VYUA 4GKJL 2EY1A 4X3UA 5BN4A 1X32A 3S1RB 2A1AA 1B53A 2V1CC 2MGSA 4AYBE 1B7YB 4CBVA 5I2YA 1I50H 1EIHA 1VQGA 1LYLA 2B63G 2KQ3A 3HOWG 5JPMC 1DJRD 3BZCA 3PF5A 3H3VI 4KKSA 4DAMA 1F2YA 1WTXA 3HOYG 3CF5A 4DR7Q 2KOLA 4PMWA 1HQMC 4A3JB 3ERQA 1IBMQ 2I0QA 3HGBA 1F2MA 3CMAA 1N32L 4OWWB 2NYZD 4MTKA 4R4QA 1HRJA 2J7ZA 2PZTA 1VQMA 3A7LA 1TS2A 2DJGC 1LT3D 1NCVA 3NWSA 4APVA 4IO9A 5E4XA 5HGTA 3ULJA 3HOWB 4HN7A 2K5VA 3VYRA 4X65L 3MC0B 2PW5A 1TWFB 3DXJC 3CQZB 1DONA 1F77A 1CM9A 5IP9G 2ZJPA 1B3QA 4QIWB 1JORA 1ML0D 2WB1E 2LFNA 4OIJA 1GOZA 2DN8A 3DWPA 4A3IG 2Z4IA 1Z47A 3OPOA 1Q86C 3DM1A 3I90A 1SNCA 5BN3A 4B3ML 4QQBX 2KCTA 1HZCA 1U4MA 2QKIC 2AKWB 2I5LX 5C4XB 4B3SL 3H6MA 2MJ8A 3T1YQ 2IX3A 2QA4A 3SVMA 4JBKA 1XPOA 3UDXA 4KY7A 1JB3A 2JA8B 1SSOA 4AQYL 4H44C 4KY5A 4DUYL 3PCOB 3HOUG 3BDLA 3KBXA 3PUXA 5KIXA 3BDCA 1G6PA 1QCBD 3QIAA 2HQEA 3LWUA 4KY6A 1LLRD 1EIFA 3FPUB 3CCQA 4KTAA 5JJZA 1KD1C 1HNXQ 1SMYC 4NDXA 2C9OA 4IURA 4L5SA 4DAPA 4GOPC 1FGUA 1SLJA 3I73A 1KRSA 4IZ8A 5M5YB 3PSIA 3PIOA 2UXCL 1WCMB 2XTIA 3PQIA 4X3SA 2WP8J 1BCPC 2B29A 2F0MA 1UAPA 2JXMB 3HKSA 3J81L 2KHJA 1NTGA 4IPGA 4JI5L 1YJNA 1WCMG 4GKKL 5J1ZA 3UDGA 1QB5D 4GN3B 2DNCA 1CKNB 2R7FA 1TKWB 4X62L 4JI3Q 2BH2A 2VUMG 3BJUA 4R4CA 4A3EG 4OO1G 1VS0A 2Z0SA 1TXYA 1PRTC 4X64L 4FF3A 4V0BA 2PQAB 2K33A 1Q3LA 4IFDJ 2K1BA 2XSCA 1X3FA 1SNMA 3L2PA 3NBHB 4OGQC 2Q2TA 1BF4A 1JWSD 1HCZA 3OMCA 5JVG3 2F0TA 3RNUA 1Q8IA 4JBWA 5COYA 5C0XJ 1TWAH 1MD2D 4XDXA 4BA1I 1SFOH 2AQ1B 5GROA 3DM3A 3UDIA 4GLXA 2NVTH 2K4KA 1CI3M 1WI5A 1MI2A 4OXPA 5FLMH 2EJMA 2ZT9C 4LF4Q 4GKKQ 2AMCB 2ZXPA 2KJXA 4CDFC 3ULLA 4YWMA 3F2DA 1VMCA 1M4VA 3C2PA 1OTCA 2YTVA 1EQTA 2XNAC 1I50B 5KGUA 1KABA 3MXUA 1STBA 4NP5A 4YY3L 4NXNQ 1RTOA 2N49A 2ZTEA 5M3FH 3V96A 1LTAD 3TS2A 1KL9A 4LF5Q 3HOXH 4A3GG 5IYCH 1ZKOA 1RCVD 5LMUQ 3MA2B 3STBC 1PH3A 4BBSH 1VQ4A 1AN8A 4DV6Q 1BNZA 4QIWE 1F9QA 1FGBD 1G6ZA 1SYCA 1TS3A 1ET9A 2BCOA 1VQ7A 4GS3A 3HOYB 1SE4A 2L1BA 2IL8A 4OELB 1JB7A 4CDEC 3P7JA 1KIXA 1QVCA 1ZXTA 4JK1C 3EIVA 2UU9Q 1EY9A 2B3GA 4Y7NH 1RHPA 3M4YA 1K3BC 3NUCA 1N36L 4BBSG 2XGTA 4JV5Q 1OO9B 4RHSA 5M5XB 1IYJB 4HCSA 1MGSA 5D3IB 1TWHB 4OX9Q 1HA6A 1Q90A 3E0JA 3VR6A 2VQFQ 4FNFA 4XYOA 4JI5Q 3MZ5A 2E2IH 4UP7A 1K83B 1I4XA 3CRLC 4FF2A 4RCNA 4HTHA 4UY8C 3GV6A 3IL8A 4BY1G 4LWCA 3X3MA 1JOOA 1JJCB 3J81c 4RA8A 3RUZA 1JJ2A 1GUTA 4ZAIA 2Q2HA 4GN5A 4EQPA 1AEXA 2L11A 1CKOA 1B70B 1D1KA 2QW7A 1I4PA 3AB9A 1VQ9A 3PO2H 2WB1G 4JI0Q 4A3EB 4DXFA 2A6ED 1Y1VG 1SXTA 3LX0A 3BVMA 2A69D 4A4IA 4A3DB 1STYA 4XQJA 3B6YA 2B2WA 4IPHA 2FHTA 3D0FA 1X56A 4CDDC 1FJGL 4CHTB 4A93B 2MP1A 3HOVG 5D14A 1YBYA 4IUTA 4KHVA 3NXWA 1QVFA 4RGMA 3GTKB 2P5ZX 4FDBA 2Q8IB 1WYDA 4RAUC 4BWGB 3OTOL 2ZM6Q 4LF6L 2Z1CA 4YCUA 4KKUA 1BCPF 2A8VA 3ONAB 4RMFA 2LSSA 1VQHA 4LF7L 3U58A 1H9JA 2UUAL 1Z9FA 2WV6D 1JE5A 2FMMA 1N32Q 4JI8L 4IUUA 4U68A 1XNQQ 5F2DA 1XTDA 5J39A 2YTXA 3S17H 1L1OA 2OWOA 1FR3A 5ELNA 1BUVT 1IXRA 4MHEA 2PPBC 3HOUH 3R8BA 2F0DA 4HIDA 3CCRA 3GTPB 2SNSA 1SYEA 1E7ZA 3ERSX 2LXJA 3W1GA 2F0SA 1AE3A 4DUZQ 1LT4D 5CV8A 4DUZL 1NSNS 4ZK9B 1PH2A 1PH1A 2VB2X 3BZKA 4O1NA 3G6EA 1N36Q 1GUOA 3JAME 3I8ZA 2Z6KC 3RR5A 4IFDG 5C4JH 1J5EQ 2QCPX 1RL2A 1QZHA 1Q1BA 1Z6HA 1NJIC 2IT1A 1RIPA 4PNYA 1BOSA 5ELOA 1FL0A 2EYPA 5E4WC 1X3EA 3OW7A 3HKZG 2RQXA 1PYWD 5H1SE 1G291 3KYHC 1XNQL 5JJLA 1W6JA 5EKLA 5KEEA 3K7AB 4KV6A 4NB3A 2F4VQ 3HKZB 3S14B 4YIJA 4A75A 3GTMH 4A3CG 2E5LL 1TVXA 1JJGA 4LUZA 3SHLA 1C7YA 1YNJD 2YU9B 3JC66 4A3MH 1U4LA 2E8GA 3TN2A 4ABNA 3GTJH 5ELEA 5FLMG 3PUVA 1I4GA 1QE6A 1UEBA 5J22A 3QOLA 3KLWA 4C3JH 2E2IB 5GQOA 1CA5A 5LL6S 2OCEA 4GKJQ 3Q0AA 1EEID 3U50C 1PH9A 1ASYA 1SNOA 3AEVA 1EQQA 1KHIA 3L3OC 4BA2I 4IJLA 1Y1WH 4IN3A 1TWCH 1KNAA 4P72A 1WVLA 4TQUS 4YHHL 3PO3B 4ZLTF 4HMIA 3EA6A 3I4NB 1T9HA 2HDMA 1WOCA 2F0WA 3D4WA 4A3EH 4OIKA 3AFQA 4HJ9A 2VUMH 4CKCA 2B8FA 2KENA 4PZ6A 3CC4A 1Z7TA 3SK4A 1KDAA 2ICEC 5KNBA 4KHPQ 3AQQA 2ES2A 2K04A 1YNND 2RSOA 2EJFC 2CW0D 1BCPD 4IUPA 1CHPD 4RWSC 2JA5H 4DR5L 4U673 2JQOA 1XNRL 4IALA 4OONA 1HTLD 5LMNQ 2WACA 1JWMD 1B8AA 1PZID 1YJWA 1G8ZD 2DY7A 3JAMc 3NQTA 1BBWA 1TQOA 2XWBB 2F0GA 1KRTA 3K5LA 4C3HG 3K57A 3ITPA 5C0XH 3FHWA 1VQPA 2RCFA 1E3PA 1D6EC 1CUKA 3TS0A 4RGNA 5JJIA 4LFCQ 1B2TA 4BBRG 1XYIA 1NAPA 4BY7H 1PFMA 3TMEA 3WOFA 1I4QA 4ZQ3A 1KAAA 4P2CB 1B9NA 1SFOB 2D0PA 5C0XG 3OIQA 2B2TC 4RHRA 4DA2A 3MAQA 3J80E 3I4MH 2IWHA 4LUOA 1RF2D 3KLSX 4QL5A 2TSSA 3CMEA 1VQFA 1JCKB 2PQAA 2XWJB 2EOTA 1JC7A 5CV9A 4JPBW 4CJ0B 3DEOA 4DR4L 3RLNA 5M5WB 1EFID 4G7ZC 5M3FB 3A5UA 1MJCA 4HIOA 5BR8L 1N33Q 2K28A 2NTTA 1PH4A 1ICFB 1HNWL 4DR4Q 1S5BD 1U4PA 2K75A 1V1OA 4K8JA 2RSNA 3E5SA 3SEBA 2F03A 5C3EB 5JEAH 1YIJA 3S2DH 1YVCA 1O7ZA 4NMZA 1YHAA 1VQDA 1Y69U 3BVZA 4LJZC 4XYQA 4X3TA 4RH6A 1L0WA 2FXQA 3T1YL 5C44B 1A6XA 1MKHA 2NB0A 3DWAA 4MNOA 2R92B 3K6OA 2MNAA 1V1PA 2GN5A 3K59A 3NENA 3L0OA 4DNRB 3F2CA 3CQZH 5T1IA 1C4QA 5FJ8G 2VL6A 2AQ2B 4A3JG 3GTGB 1N34L 2KBNA 2IX1A 3MFYA 4K8IA 1DOKA 4A3GB 3GV3A 5JEAJ 5IT9E 5CR3A 1EFWA 4GLAC 5IT9L 1PH5A 2B39A 2L5TA 1IL2A 1EY8A 2Z8LA 1ESFA 1AE2A 5C4HA 1WTRA 2BDOA 3J7YW 4A3FH 2MO1A 1KNEA 3AYHB 1EZ6A 3LNNA 4EQOA 3Q6SA 2K50A 3KF8A 2NVXH 1X54A 2NZ1D 3VA7A 4WJWA 1EY7A 2WFWA 1L0XB 3TZDA 3H0GB 1S3OA 1X65A 4AH6A 1C0AA 3G71A 3NHHA 1HA5A 5E7NA 3MHBA 4JVZA 1BBUA 2A6HD 3CCVA 1K8OA 1K8MA 1GO3E 4K2LA 4JI2Q 4TSSA 1GVPA 2PMZB 2KHSA 2F0QA 3WDNA 1HZAA 1TWFH 1O78A 3JAMi 2RDGA 4HIKA 4JI2L 3S15B 2L15A 1MSHA 2JYOA 4JOIC 3J7AV 1PFNA 3KJOA 3TP7A 1EYGA 1ENAA 3HOVB 4HR7B 4LF9Q 1A2TA 2EJGC 2SOBA 3M4QA 4FVMA 5ELFA 3VR5A 2F0OA 3RZDH 5AJ3L 2L4NA 4A3DG 4DV6L 3G7LA 5ELBA 3WOEA 1HHVA 2BE5C 2BH8A 4K5VA 1WTHA 3UE0A 2O2LD 2WB1B 5IGFA 3GDEA 1CQFA 4DPGA 1I3QH 4DR7L 4DFAA 1TS4A 3K80C 2AUKA 3PUWA 4UP9A 3VR2A 1A3TA 2VXWA 1K28A 1S5ED 3P1HA 3FKIB 3GTPH 1GUGA 2IX0A 2AHOB 4RGOS 1VF7A 4FO2A 3HFZB 4A3FG 3T4AC 1LM0A 1SE8A 1T5EA 4FXKC 2KEDA 4ODGA 3VYTA 2OT2A 3D6WA 3FVQA 3HP3A 1XTCD 5CMDA 4P73A 1EY0A 4JI6Q 4QF4A 3S2HH 5FK9C 1L2FA 3BG3A 4GN4B 4PMCA 5M3MH 2CH4W 4LAAA 4A3JH 5IYBH 4BBSB 1Y1WG 1D5ZC 4DF7A 1QJOA 4UPAA 2Q2UA 2QEXA 4DV1Q 1LO5D 3K81C 2R93B 1DZ1A 4GOPA 4C3JG 2E2HH 2MHVA 4CKEA 4LFCL 2WIIB 1KDCA 4LFBQ 1H9RA 1V1QA 3FRPB 2R7ZG 4MZ9A 4BY1H 4ID6A 2B2UA 1QWYA 5FO8B 2UUBQ 1E1OA 1PVOA 3M7NA 1TR5A 4A3KH 1ICWA 1AZQA 1GD7A 1MIUA 1VDZA 3ND8A 3W3AA 4DR5Q 1G51A 2EQSA 2JEAI 1L1OB 2J0TD 1XJVA 2L12A 1M1KC 1ENFA 1ENCA 2VZAA 2XVSA 5HGQA 1CK1A 3NBHA 4ZUJA 4OL7A 3HS0C 4DR3Q 1AP0A 3CU7A 1R4QB 5ELCA 4L8JA 5E1FA 5IY0A 5IGGA 2SNMA 1P16A 4KN4C 5G3LD 1SAPA 2JA6G 2JA7H 3PO3H 3T53B 3HZXA 1JT8A 1QNUA 5A2QL 2K05A 1E2ZA 2JA7G 4UDUC 1WTVA 5CV4A 1QOHA 1R9TH 4Y52H 4I65A 5A2QE 5LMUL 2F0NA 1LTID 2JJQA 4ZYSA 1EOTA 2O4XA 1DM0B 2K32A 1OXVA 1VCIA 3SDZA 2LXKA 3NPPA 3KFUA 4NKLA 1ET6A 5CBEE 3I2ZA 5IYCG 3UDFA 5IE8A 3HOXG 4X64Q 5L37A 5BN5A 5C5LA 4C56C 3LWEA 3A56A 4Y7NB 2A68C 4Q0FA 3WWVA 2BOSA 3ER0A 2F0IA 3GP7A 1NUCA 2FJ2A 3BU2A 1RDPD 1IW7C 1OXSC 4JCVE 3M9BA 1K8GA 2F0HA 1VMPA 2MPMA 1IYVA 3OWFA 4LF8Q 4DXGA 1STGA 4DV5L 3KDFA 3L7ZC 3M85A 2NVQH 4DAYA 4EGVA 5FO9B 1PFSA 1U9RA 5EKIA 4Z9CB 1A62A 4J6HA 2I5HA 2EY2A 2RKSA 5HURA 2XN9C 5I6WA 5AJ3Q 2EZVA 2PZWA 5CV6A 1AFPA 3J80c 1YHBA 4IOCA 4B3SQ 2FMCA 3T13A 2NVTB 3HOZB 4DK1A 3RD4A 1XWEA 4DV3Q 1HNZL 1N9WA 1VQBA 4LMQD 3Q23A 5DAUA 1H9SA 2IHEA 1LTLA 4DNIA 4AQYQ 4QUFA 4OO1H 4JI1Q 1PMRA 4NXMQ 1BQQT 3BZDB 3H91A 3P75A 2NBFA 1EY6A 2L9HA 1WCMH 5DM63 1UUPA 2Z4HA 4A3IB 4LNQA 3S1MB 5M9OA 3HOZG 4B3TQ 3FPPA 4NW2A 3S1NB 1LABA 2F0KA 3S24A 3L9AX 3TSSA 3S2HB 1QILA 1WTWA 1H9MA 3IFDA 4JI4L 3QB3A 2ZJQA 2C35B 4XT3B 1S5FD 4J1MA 4ZCKA 1WD0A 2BE5D 4C2MB 3F2BA 5FKAC 1UE5A 4DU9A 5I9PA 2PYKA 3C3LA 5JAVA 3A8IE 4ME5A 5A35A 5JJKA 1VQKA 4HJ7A 3MWYW 1PYBA 5DNFA 3RZOH 1UE1A 4B3MQ 1F2LA 1UE7A 1WJJA 2PMZE 1J5EL 4R4TA 1X6OA 4POFA 4DNTB 5KRUA 3RMHA 3GTOH 1STEA 1G2TA 2QILA 4DAYB 4MN3A 4FXDA 4RGTA 4CGYB 4POGA 1B4OA 5KYLA 4O42A 4G7HC 1QZGA 3MVVA 5M5XH 1Y8NB 4HSVA 1Q8KA 3TP6A 2A5HA 3S17B 3EFXD 1SN8A 2UUCL 3A54A 1TU2B 3M7GA 5GADC 3T1HL 1UNSA 2JA6H 3VYSA 3GTQB 4X65Q 3KLSA 2A73B 3SK5A 1X3GA 5IODA 3NTKA 1WD1A 1H95A 3CCSA 5ELDA 3CP0A 3TZUA 2IPKD 1YNNC 4BS9A 3PGZA 4DV7Q 2JA7B 1XPRA 1EY5A 2EY6A 2F0PA 5C6AA 2OF1A 3I4NH 3FDTA 1SJHD 1TY0A 2FFKB 4AYBB 2JN4A 2WAQB 2Q2IA 2ICIA 1LTBD 3RLOA 3K5OA 3QOJA 5EPJA 1EUJA 2R7ZH 4H02A 4P74A 3M4OH 2B8GA 4C1NK 2Q8TA 4C3IB 2M9VA 5FLXL 2LY7A 4QB4A 4LF6Q 1FYCA 4X3KA 2MUYA 4QJFA 1T5XD 3RN2A 4K5XA 3BVGA 1PTOF 3SK6A 1XMOQ 2F3IA 1PH6A 3HOWH 2ASBA 3CW2C 2QGQA 4PZ7A 4TRDA 5FJ8H 3TEHB 3DWQA 3STBD 4JBJA 2B2UC 4WFN3 2F0JA 1K0SA 1N34Q 4L6TB 5M3MG 3DMUA 2JA9A 2JK8A 1F9SA 4JBMA 4N8FA 5FOBB 1RD9D 2RF4A 1HTPA 3ICEA 2R93G 5DM73 2MO0A 3CD6A 4R1JA 3PIPA 2IHFA 1V8QA 3U9OA 2X69A 2VW9A 4KLKA 3NP8A 1Y1WB 3PUYA 4XXEA 4TKOB 2OXPA 3I55A 1K3RA 1BBXC 2JA8H 4KJNA 2Z6KA 3PO2G 5ISRA 2YYZA 2PCFB 3DLLA 4QY7A 1E22A 2E2JH 2F3WA 4DAVA 1EQRA 5C5MA 3HOUB 1STHA 1L0YB 3NK9A 3EQLC 1IW7D 2PZUA 1I5FA 3LGJA 3UI2A 1PH7A 2R61A 3OYYA 3PF4A 1WFQA 4EQ5A 2BA0A 5T1GA 2F0UA 2SDFA 4JI1L 1S5DD 2RBMA 1JE4A 1Y8OB 2DY8A 3I72A 1ESRA 1B3AA 3A0JA 2F3VA 3I4MG 3A5ZB 3SK8A 2UXDL 2UUCQ 3K5NA 2BDNA 3A8KE 5DLQE 2WINB 5C4JB 1YI2A 2J4XA 3KF8B 3GTKH 1X3PA 3NWTA 3QWNA 4HJ5A 3S2DB 4BBRH 5FLXc 4M1UB 2JE6I 1AW7A 2Q8RE 1GHKA 3OSOA 3H94A 1CKMA 1Q7YC 4C3HH 4DV5Q 4G57A 1C48A 2XIWA 1SYGA 4EQNA 1VQ5A 1NE3A 4LUVA 4N9TA 2EYLA 1PTOB 4ZUIA 1O7LA 4RG1A 3S1RH 3MTSA 1EL0A 2KVMA 2K03A 5FLXE 3NQIA 1HZBA 3FP9A 1RKNA 1OXUA 1XXGA 2YU9H 4WJ4A 1R4PB 3GTGH 3HRZC 2K52A 4CJ1B 2JA5G 1HXYD 3DUZA 4PQXA 2MQHA 1PRTD 2OTLA 4A3KG 4B3TL 4IFDI 2O5JC 1EU3A 3C1FA 4O0AA 3Q24A 4C3IG 3IRBA 4JV5L 2RHQB 2X6LA 1VQEA 2I07B 2K5HA 2CWPA 4B9XA 3J81i 3K5MA 1A2UA 2K14A 1IYUA 1STNA 5EAYA 3HOYH 2CWAA 1Y8PB 1U0LA 1HUMA 4C1NI 3W2DA 4GNXC 1PTOD 3AU7A 5C3EH 5KNCA 3I4OA 2B63H 4WORA 3J7AF 4DUYQ 1Q81C 4DV1L 4M8AA 3M3YB 4QCLA 2CVRA 3SR1A 3CC7A 1PV4A 1RJTA 1LACA 4LF5L 2A6EC 2JA5B 3P20A 1QUQA 4OWXB 1YNXA 1NR4A 2HDLA 3VR3A 3TRZA 4RKBA 2NZHA 3UE1A 2GVBA 3CC2A 5JEAG 1I6VC 2F4IA 5J3BA 3N6RA 3K7UC 2R92G 4NPSA 2UXCQ 3ND9A 1TWHH 3NSWA 4XQNA 1VF5C 4LF4L 2TMPA 2H4OA 3FEWX 3TBIB 2PNRC 4H0LC 4KHZA 4KHPL 2DUDA 2B2WC 1K83H 1NMGA 4KKTA 2EYFA 4DV4L 1CZWA 4JYAQ 3CPFA 2CKZB 4ZKCB 1PZJD 3GTLB 5C4XH 1HNXL 3AFPA 4DN4M 4DGZA 4YHHQ 4IFDH 4WJ3M 2DJFC 1M8AA 1JOKA 5JPNC 4Q5VA 5K36H 4FYDA 4A3BB 3I4MB 4R8IA 3EN2A 4A93H 3H0GH 1TWGB 1MBYA 2AWOA 4B3RL 5IWAQ 2HHHQ 1S40A 4BY7G 5CV5A 1HZ9A 5JOBA 3SE0A 1AH9A 3Q22A 3CCUA 1GHJA 1SE2A 2RCNA 3N52A 4FF1A 3C46A 1XMOL 2Z6BA 1II3A 3W5OA 4DK0A 3G48A 2D5DA 4A3LG 5K36G 4HMJA 1CT1D 5I4DA 2GA4B 2B2TA 5GAEC 1ILPA 5IGDA 1OXTA 3U4ZA 5IP9H 2B2YA 2EXDA 3I4LA 4LFAL 3NTIA 1L1OC 1CHQD 5CV7A 1VQNA 5IT9c 1DXMA 2F52A 3R93A 2RDFA 4V190 5IP7H 3MXGA 1SR3A 2K5WA 1IL8A 3CCMA 4ULLA 1PRTF 2EY5A 5EBCA 1JMCA 2R92H 1CSQA 1I4RA 3A74A 4KK7A 4F8MA 3KJPA 3EVQA 1VQAA 1IBML 1U4RA 4YCWA 1CTMA 1YZ6A 2EVBA 1J8IA 4KD3A 2N8NA 2JP1A 2NZOA 4HEDA 3EBEA 4DR1L 1M90C 2NN6I 1GUWA 4DR6Q 4O2DA 1A15A 5FO7B 3S16H 2NWGA 3R3OA 1E2WA 3GTQH 3KOJA 1EOVA 1K0RA 1NMFA 4B08A 1Q46A 2WAQE 3T1HQ 2L0CA 2N55A 2AQ3B 1ZYRD 4E6IA 1S4ZA 2PI2A 1Y1VH 2NVYH 1YHQA 5C3XA 4PG3A 1WTQA 2N88A 3DHQA 1HR0W 5LMNW 4HIMA 4GOPB 2VB3X 3CPWA 4F88A 2NVXB 5IYDG 2BA1A 3MEHA 1P8LA 3MXNA 1VQ6A 3G4SA 4A3MG 3KUPA 3X3NA 2K7VA 1IBLQ 4B9WA 4H7BA 4LK1C 1ONLA 5I9OA 4C3IH 1SRUA 4JYAL 2LKVA 1QNKA 4A3CH 1G91A 5LMNL 3HG9A 4KMUC 3KF6B 3URYA 2E2HB 1UE6A 3QG1A 1ZEQX 3KK7A 3IAYA 1PRTB 4CKBA 3VDYA 1KLGD 4A76A 1TT2A 1EWHA 1NBWA 1TWCB 1EWIA 3J80i 2HIVA 2ID0A 1B1ZA 1EYAA 1SYFA 5G3LF 1CZGA 1IKLA 1FJGQ 2D0OA 1DGSA 3RZDB 4IJHA 4L5RC 1LUZA 1LT5D 4X66L 3K58A 4JI7L 3FMCA 4JI7Q 1HR0Q 4XT1B 5D3DA 3IKJA 5CC4A 3T51B 1C8CA 4DV4Q 1FNVA 2Z9HA 5AFWA 1V1PB 1CA6A 4IPCA 2SEBD 2G5DA 4MIUA 3I70A 1HFNA 1NR2A 3CXCA 2H5XA 1TWGH 2FINB 5NUCA 5M3FG 4K14A 2VY3A 1HUNA 1GJXA 2PQEA 1Q1EA 3J7A5 1B50A 3M4PA 2KCNA 4IUNA 1IBKL 4I7ZC 1V9PA 1PXUA 2NN6H 5C3WA 4WRDA 2G9DA 1SNPA 1MHWC 4GNXB 2RA4A 1JICA 2CQAA 2UU9L 4RKLA 5I6YA 5JVH3 3TP5A 3T56B 1KTKA 5EPLA 2ZXOA 3CRKC 2K5QA 4IOAA 1D5XC 1Q12A 2VS1A 4EX5A 4BBRB 2KHIA 2K5DA 4BY7B 5IGCA 2UXBQ 2VQEQ 3HOVH 1IZ6A 4L5TA 3I56A 1TS5A 3DEPA 3SXHA 2IY5B 4GZYC 2KCMA 3A8JE 3S1QH 1I4HA 3PO2B 1KLUD 2HT1A 3FKIH 3J80L 1PTOH 1TIID 4L5QA 4JI6L 2F0EA 1LV9A 1RODA 3KLRA 4S3SA 4CJ2C 5M5WH 3QJYA 5DEHA 3MEFA 4DR2Q 2B2YC 1PTOC 4EVOA 2KECA 2H1EA 4G4KA 5D65A 2WKCA 3HOXB 2ZTCA 1NY4A 3MFGA 3S16B 1DCZA 4F7XA 4IUVA 1A63A 3QO2A 2OQ0A 1GUNA 1KAWA 4CDCC 1D5MC 2M00A 1LTGD 2PNHA 1BCPB 1WTPA 2E5LQ 3ZYYX 4J8QA 2CFMA 1X9NA 4KD4A 1A3VA 1A8VA 5I2XA 2KA7A 3R2TA 4N9PA 2UUAQ 4DKAC 2D62A 1J9OA 3S1NH 3I4NG 1DD2A 5EJWA 1UEAB 2B2VC 4TVAB 4R4OA 1X3QA 4HSPA 4DV2Q 1YEZA 3S14H 3K0YA 4C2MH 2N78A
chains in the Genus database with same CATH topology
1BR9A 1TWAB 2G9HD 2F0VA 4FF4A 3OOCA 3D6CA 1BDOA 1G2SA 3PMFA 5EQ0A 3E6ZX 2QDBA 4XIGS 3GTOB 2ENBA 1EIGA 1TY2A 3J81E 2F0LA 2X6GA 1SBBB 3I3CA 1SE3A 3CHBD 2CW0C 3NBIA 3F2UA 3GTJB 1JQYD 5CGKA 3JAML 3I91A 3TDQA 4C3JB 1R9TB 3D8GA 4OO1I 5CYUA 1EU4A 3GO5A 1H9KA 1O80A 4F87A 3BYTB 1STAA 3D4DA 2KEEA 1PZKD 1FNUA 3VR4A 5CORA 2EYHA 1LT6D 4R8NA 3CKIB 1DYQA 2ZXRA 3OHXC 3VA5A 1WTOA 3V2TA 2F0FA 5KNDA 1SNQA 1JWUD 1MSGA 1FNWA 2K01A 3OWEB 3D31A 4C3HB 4R9WA 3GD7A 1GXDC 2DNEA 3S1QB 4K6LA 1F9PA 3RZOB 4PV1C 1SMYD 3NTHA 2NN6G 2PO4A 2VUMB 2XRQD 4KN7C 3V05A 3A7AB 1E2VA 5IOCA 1SYDA 5C0XI 1I3QB 1OXXK 2EPBA 1JOQA 5M3MB 1BXTA 5CBAE 5EBDA 2CHBD 3BS1A 4HAEA 2EYJA 2EXZA 4K2KA 1BO0A 4RFBA 3PIO3 2M2LA 2WKDA 5IGEA 4KI0A 1HQRD 1EEFD 3GTMB 2HCIA 3S9WA 2R3ZA 5K5PA 4BY1B 2C5CA 4UAIA 2E75C 1A3UA 2JSOA 1ILQA 1PDQA 2I46A 4A3MB 4PMBA 4K6DA 3IFTA 2B2VA 3KBGA 4FXGC 4OHJA 2LS01 1DOMA 2IW3A 3MXPA 5IIFA 2JA6B 1KDBA 2A74C 1LTRD 2PW7A 2R6GA 1S5CD 4HCEA 2A6HC 3AMUA 2EE1A 5TSSA 3GQBA 1F9RA 2QEJC 1D2BA 1SDFA 1V43A 1LTSD 4A3KB 1QG7A 2OEOA 5EKKA 2A68D 1SJED 1O7YA 4H13C 5LHY1 3M4OB 4XQQA 2R7ZB 3A55A 2KCCA 1IHZA 3PIP3 3D3RA 1B44D 5LL6X 4L63B 2RDHA 2F1MA 2E76C 2EDGA 2L55A 2EYOA 1SYBA 2KUMA 2IJ0A 2B63B 1EYDA 3R2IA 1GUSA 4K5WA 1IKMA 2HUGA 2XRSD 2D2CC 1EY4A 4XTCS 1D1IA 4IQZA 2NVQB 3T16A 5EPKA 3RLFA 2RVLA 1SNDA 4A3FB 2V4DA 3PUZA 4ZRZA 1YNJC 1E0BA 2E2JB 1LTTD 2Y0SB 2E74C 1AZPA 1F2ZA 3EJIA 2LMCB 2HCCA 2VNUD 2AUJD 2D9UA 2K6AA 4QMGA 3EROA 1XX8A 4FP5D 5E3FA 3BYYB 4QUCA 1EQVA 5KYIA 2QF7A 2E2DC 3H3VC 1EZ8A 1CFMA 4IUQA 1W6KA 1Y1VB 1ZYRC 2NVYB 1DOLA 3D4RA 2NTSA 1B9MA 1HPCA 3BDOA 3G6JB 1JR0D 2A69C 3OIPA 2O5IC 1H9SB 1HFGA 1PLFA 3PV0A 1CQVA 5IGBA 3U9SA 3C1EA 3H09A 4KJOA 3NE5B 5C4ZA 4ILWA 1EWCA 1SEBD 2EYMA 4ZKBB 1PFBA 3TP8A 2JEBI 3OMGA 3HEJA 5EGTA 1RTNA 2AWNA 4G7OC 1FD7D 1I6HB 2NUCA 3O13A 4RCOA 1EYCA 3VYUA 2EY1A 4X3UA 5BN4A 3S1RB 1X32A 1B53A 2MGSA 4CBVA 5I2YA 1EIHA 2KQ3A 5JPMC 1DJRD 4KKSA 1F2YA 1WTXA 2KOLA 4PMWA 1HQMC 4A3JB 3ERQA 3HGBA 1F2MA 2NYZD 1HRJA 2J7ZA 2PZTA 3A7LA 1TS2A 1LT3D 1NCVA 3NWSA 5E4XA 5HGTA 3HOWB 4HN7A 3VYRA 3MC0B 2PW5A 1TWFB 3DXJC 3CQZB 1DONA 1F77A 1CM9A 4QIWB 1JORA 1ML0D 2LFNA 4OIJA 1GOZA 2DN8A 3DWPA 2Z4IA 1Z47A 3OPOA 3DM1A 3I90A 1SNCA 5BN3A 1U4MA 2QKIC 5C4XB 3H6MA 2MJ8A 2IX3A 3SVMA 4KY7A 1JB3A 2JA8B 1SSOA 4H44C 4KY5A 3BDLA 3KBXA 5KIXA 3PUXA 3BDCA 1QCBD 3QIAA 2HQEA 3LWUA 4KY6A 1LLRD 3FPUB 4KTAA 5JJZA 1SMYC 4NDXA 2C9OA 4IURA 4DAPA 3I73A 4IZ8A 5M5YB 1WCMB 4X3SA 2WP8J 1BCPC 2F0MA 1UAPA 2JXMB 3J81L 5J1ZA 1QB5D 2DNCA 1TKWB 4OO1G 1PRTC 4FF3A 4V0BA 2K33A 1Q3LA 4IFDJ 2K1BA 2XSCA 1SNMA 4OGQC 1BF4A 1JWSD 1HCZA 3OMCA 5JVG3 2F0TA 1Q8IA 4JBWA 5COYA 5C0XJ 1MD2D 4XDXA 4BA1I 2AQ1B 1CI3M 1MI2A 2EJMA 2ZT9C 2ZXPA 2KJXA 1VMCA 1M4VA 3C2PA 1EQTA 2XNAC 1I50B 5KGUA 1KABA 3MXUA 1STBA 4NP5A 1RTOA 3V96A 1LTAD 1ZKOA 1RCVD 3MA2B 1AN8A 1BNZA 1F9QA 1FGBD 1G6ZA 1SYCA 1TS3A 1ET9A 2BCOA 3HOYB 1SE4A 2L1BA 2IL8A 3P7JA 1ZXTA 4JK1C 1EY9A 1RHPA 3M4YA 3NUCA 1OO9B 4RHSA 5M5XB 4HCSA 1MGSA 5D3IB 1TWHB 1HA6A 1Q90A 3E0JA 3VR6A 4FNFA 4XYOA 3MZ5A 1K83B 1I4XA 3CRLC 4FF2A 4RCNA 4HTHA 3GV6A 3IL8A 3X3MA 1JOOA 4RA8A 3RUZA 1GUTA 4ZAIA 4EQPA 1AEXA 2L11A 1D1KA 3AB9A 1I4PA 4A3EB 4DXFA 2A6ED 1SXTA 3LX0A 3BVMA 2A69D 4A3DB 1STYA 4XQJA 2B2WA 2FHTA 4CHTB 4A93B 2MP1A 5D14A 4IUTA 4KHVA 3NXWA 3GTKB 4RGMA 2Q8IB 4RAUC 4BWGB 2Z1CA 4KKUA 1BCPF 3ONAB 1H9JA 2WV6D 2FMMA 4IUUA 4U68A 5F2DA 5J39A 1FR3A 1BUVT 4MHEA 2PPBC 3R8BA 2F0DA 3GTPB 2SNSA 1SYEA 2F0SA 1LT4D 5CV8A 1NSNS 4ZK9B 2VB2X 4O1NA 1GUOA 3JAME 3I8ZA 4IFDG 2QCPX 1Q1BA 1Z6HA 2IT1A 4PNYA 1BOSA 2EYPA 5E4WC 3OW7A 2RQXA 1PYWD 1G291 1W6JA 5EKLA 5KEEA 3K7AB 4KV6A 3HKZB 3S14B 4YIJA 1TVXA 3SHLA 2YU9B 1YNJD 1U4LA 3TN2A 4ABNA 5ELEA 3PUVA 1I4GA 1QE6A 5J22A 3QOLA 2E2IB 1CA5A 5LL6S 3Q0AA 1EEID 1SNOA 3L3OC 4BA2I 4IN3A 1KNAA 1WVLA 4TQUS 3PO3B 4ZLTF 4HMIA 3EA6A 3I4NB 2HDMA 2F0WA 3D4WA 4OIKA 4CKCA 2B8FA 1Z7TA 3SK4A 1KDAA 2ICEC 5KNBA 2K04A 1YNND 2RSOA 2EJFC 2CW0D 1BCPD 4IUPA 1CHPD 4RWSC 4U673 4IALA 1HTLD 2WACA 1JWMD 1PZID 1G8ZD 2DY7A 3NQTA 1TQOA 2XWBB 2F0GA 3K5LA 4C3HG 3K57A 3ITPA 5C0XH 1D6EC 4RGNA 1B2TA 1XYIA 1NAPA 1PFMA 3TMEA 3WOFA 1I4QA 4ZQ3A 1KAAA 4P2CB 1B9NA 1SFOB 5C0XG 3OIQA 2B2TC 4RHRA 3MAQA 4DA2A 3J80E 2IWHA 1RF2D 3KLSX 2TSSA 1JCKB 2XWJB 2EOTA 1JC7A 5CV9A 4CJ0B 3DEOA 5M5WB 1EFID 4G7ZC 5M3FB 2K28A 2NTTA 1U4PA 1S5BD 1V1OA 4K8JA 2RSNA 3E5SA 3SEBA 2F03A 5C3EB 5JEAH 1O7ZA 4NMZA 1Y69U 3BVZA 4LJZC 4XYQA 4X3TA 4RH6A 5C44B 1A6XA 2NB0A 3DWAA 2R92B 3K6OA 1V1PA 3K59A 4DNRB 5T1IA 1C4QA 2AQ2B 3GTGB 2IX1A 3MFYA 4K8IA 1DOKA 4A3GB 3GV3A 5JEAJ 5IT9E 5CR3A 5IT9L 2B39A 2L5TA 1EY8A 2Z8LA 1ESFA 5C4HA 1WTRA 2BDOA 3J7YW 1KNEA 1EZ6A 3LNNA 4EQOA 3Q6SA 3KF8A 2NZ1D 3VA7A 4WJWA 1EY7A 1L0XB 3TZDA 3H0GB 3NHHA 1HA5A 3MHBA 2A6HD 1K8OA 1K8MA 4K2LA 4TSSA 2PMZB 2KHSA 2F0QA 3WDNA 1O78A 2RDGA 3S15B 1MSHA 2JYOA 3J7AV 1PFNA 3TP7A 1ENAA 3HOVB 4HR7B 1A2TA 2EJGC 2SOBA 4FVMA 5ELFA 3VR5A 2F0OA 2L4NA 3G7LA 5ELBA 3WOEA 1HHVA 2BE5C 4K5VA 2O2LD 2WB1B 5IGFA 1CQFA 4DFAA 1TS4A 2AUKA 3PUWA 3VR2A 1A3TA 2VXWA 3P1HA 1S5ED 3FKIB 1GUGA 2IX0A 4RGOS 1VF7A 4FO2A 3T4AC 1T5EA 4FXKC 3VYTA 2KEDA 4ODGA 2OT2A 3D6WA 3FVQA 3HP3A 1XTCD 5CMDA 1EY0A 4QF4A 5FK9C 3BG3A 4PMCA 4LAAA 4BBSB 1D5ZC 4DF7A 1QJOA 1LO5D 2R93B 1DZ1A 4C3JG 2MHVA 4CKEA 2WIIB 1KDCA 1H9RA 3FRPB 4ID6A 2B2UA 1QWYA 5FO8B 3M7NA 1TR5A 1ICWA 1AZQA 1VDZA 3ND8A 3W3AA 2JEAI 2J0TD 2L12A 1ENFA 1ENCA 2XVSA 1CK1A 3NBHA 4ZUJA 4OL7A 3HS0C 1AP0A 3CU7A 1R4QB 5ELCA 4L8JA 5E1FA 5IGGA 2SNMA 4KN4C 5G3LD 1SAPA 3T53B 3HZXA 1QNUA 5A2QL 2K05A 1E2ZA 4UDUC 1WTVA 5CV4A 1QOHA 4I65A 5A2QE 2F0NA 1LTID 4ZYSA 1EOTA 2O4XA 1DM0B 2K32A 1OXVA 1VCIA 3SDZA 3NPPA 4NKLA 1ET6A 5CBEE 5BN5A 5C5LA 4C56C 3LWEA 3A56A 4Y7NB 2A68C 4Q0FA 2BOSA 2F0IA 1NUCA 3GP7A 2FJ2A 1RDPD 1IW7C 1OXSC 2F0HA 1VMPA 2MPMA 1IYVA 3OWFA 4DXGA 1STGA 3L7ZC 3M85A 4DAYA 4EGVA 5FO9B 1U9RA 5EKIA 4Z9CB 4J6HA 2EY2A 2RKSA 5HURA 2XN9C 5I6WA 2EZVA 2PZWA 5CV6A 1AFPA 2NVTB 2FMCA 3T13A 3HOZB 4DK1A 3RD4A 1XWEA 3Q23A 4LMQD 5DAUA 1H9SA 4QUFA 4OO1H 1PMRA 1BQQT 3BZDB 3H91A 3P75A 2NBFA 1EY6A 2L9HA 5DM63 1UUPA 2Z4HA 4A3IB 3S1MB 5M9OA 3FPPA 4NW2A 3S1NB 3TSSA 1LABA 2F0KA 3L9AX 3S2HB 1QILA 1WTWA 1H9MA 3IFDA 3QB3A 4XT3B 1S5FD 4J1MA 1WD0A 2BE5D 4C2MB 5FKAC 4DU9A 5I9PA 2PYKA 3C3LA 5JAVA 3A8IE 4ME5A 5A35A 3MWYW 5DNFA 1F2LA 5KRUA 4DNTB 3RMHA 1STEA 1G2TA 2QILA 4MN3A 4FXDA 4RGTA 4CGYB 1B4OA 5KYLA 4O42A 4G7HC 3MVVA 1Y8NB 4HSVA 3TP6A 2A5HA 3S17B 3EFXD 3A54A 1TU2B 3M7GA 1UNSA 3VYSA 3GTQB 3KLSA 2A73B 3SK5A 5IODA 3NTKA 1WD1A 5ELDA 3TZUA 2IPKD 1YNNC 4BS9A 2JA7B 1EY5A 2EY6A 2F0PA 5C6AA 2OF1A 3FDTA 1SJHD 1TY0A 2FFKB 4AYBB 2WAQB 2ICIA 1LTBD 3K5OA 3QOJA 5EPJA 4C3IB 2B8GA 2Q8TA 4C1NK 2M9VA 5FLXL 2LY7A 4QB4A 1FYCA 4X3KA 2MUYA 1T5XD 4K5XA 3BVGA 1PTOF 3SK6A 4TRDA 3DWQA 2B2UC 4WFN3 2F0JA 4L6TB 3DMUA 1F9SA 5FOBB 1RD9D 1HTPA 5DM73 1V8QA 3U9OA 2X69A 3NP8A 1Y1WB 3PUYA 4XXEA 4TKOB 2OXPA 1BBXC 4KJNA 5ISRA 2YYZA 2PCFB 2F3WA 4DAVA 5C5MA 3HOUB 1STHA 1L0YB 3NK9A 3EQLC 1IW7D 2PZUA 3UI2A 2R61A 2BA0A 5T1GA 2F0UA 2SDFA 1S5DD 2RBMA 1JE4A 1Y8OB 2DY8A 3I72A 1ESRA 1B3AA 2F3VA 3SK8A 3K5NA 2BDNA 3A8KE 2WINB 5C4JB 2J4XA 1X3PA 3NWTA 3QWNA 3S2DB 4M1UB 2JE6I 1AW7A 2Q8RE 1GHKA 3OSOA 3H94A 4G57A 1C48A 2XIWA 1SYGA 4EQNA 4N9TA 2EYLA 1PTOB 4ZUIA 1O7LA 3MTSA 1EL0A 2KVMA 2K03A 5FLXE 3NQIA 1RKNA 1OXUA 1XXGA 1R4PB 3HRZC 4CJ1B 1HXYD 3DUZA 4PQXA 1PRTD 4IFDI 2O5JC 1EU3A 3C1FA 3Q24A 4C3IG 2X6LA 2I07B 4B9XA 3K5MA 1A2UA 1IYUA 1STNA 1Y8PB 1HUMA 4C1NI 3W2DA 1PTOD 3AU7A 5KNCA 4WORA 3J7AF 4M8AA 3M3YB 4QCLA 2CVRA 3SR1A 1RJTA 1LACA 2A6EC 2JA5B 3P20A 1NR4A 2HDLA 3VR3A 4RKBA 5JEAG 1I6VC 2F4IA 3N6RA 3ND9A 3NSWA 4XQNA 1VF5C 2TMPA 2H4OA 3FEWX 3TBIB 2PNRC 4H0LC 4KHZA 2B2WC 4KKTA 2EYFA 1CZWA 4ZKCB 1PZJD 3GTLB 4DN4M 4DGZA 4IFDH 1M8AA 1JOKA 5JPNC 4Q5VA 5K36H 4FYDA 4A3BB 3I4MB 4R8IA 1TWGB 1MBYA 2AWOA 5CV5A 5JOBA 3SE0A 3Q22A 1GHJA 1SE2A 4FF1A 3N52A 3C46A 1II3A 4DK0A 2D5DA 5K36G 4HMJA 1CT1D 5I4DA 2GA4B 2B2TA 1ILPA 5IGDA 1OXTA 2B2YA 3I4LA 3NTIA 1CHQD 5CV7A 1DXMA 3R93A 2RDFA 4V190 3MXGA 2K5WA 1IL8A 4ULLA 1PRTF 2EY5A 5EBCA 1I4RA 4KK7A 4F8MA 3EVQA 1U4RA 1CTMA 2EVBA 1J8IA 4KD3A 2JP1A 4HEDA 2NN6I 1GUWA 1A15A 5FO7B 2NWGA 3R3OA 1E2WA 4B08A 2L0CA 2N55A 2AQ3B 1ZYRD 4E6IA 1S4ZA 5C3XA 1WTQA 2N88A 3DHQA 2VB3X 4F88A 2NVXB 2BA1A 3MEHA 3MXNA 3KUPA 3X3NA 2K7VA 4B9WA 4H7BA 4LK1C 1ONLA 5I9OA 2LKVA 1QNKA 1G91A 3HG9A 4KMUC 3URYA 2E2HB 3QG1A 1ZEQX 3KK7A 3IAYA 1PRTB 4CKBA 1KLGD 1TT2A 1EWHA 1TWCB 2ID0A 1B1ZA 1EYAA 1SYFA 5G3LF 1CZGA 1IKLA 3RZDB 1LT5D 3K58A 3FMCA 4XT1B 5D3DA 3IKJA 5CC4A 3T51B 1C8CA 1FNVA 1CA6A 5AFWA 1V1PB 2SEBD 4MIUA 3I70A 1HFNA 1NR2A 2FINB 5NUCA 4K14A 1HUNA 1GJXA 2PQEA 1Q1EA 1B50A 2KCNA 4IUNA 4I7ZC 2NN6H 1PXUA 5C3WA 4WRDA 2G9DA 1SNPA 2RA4A 1JICA 2CQAA 4RKLA 5I6YA 5JVH3 3TP5A 3T56B 1KTKA 5EPLA 2ZXOA 3CRKC 2K5QA 1D5XC 1Q12A 4BBRB 2K5DA 4BY7B 5IGCA 1TS5A 3DEPA 3SXHA 4GZYC 3A8JE 1I4HA 3PO2B 1KLUD 3J80L 1PTOH 1TIID 2F0EA 1LV9A 1RODA 3KLRA 4S3SA 4CJ2C 3QJYA 5DEHA 2B2YC 1PTOC 4EVOA 2KECA 2H1EA 4G4KA 5D65A 2WKCA 3HOXB 3MFGA 3S16B 1DCZA 4F7XA 4IUVA 3QO2A 1GUNA 1D5MC 2M00A 1LTGD 1WTPA 1BCPB 3ZYYX 4J8QA 4KD4A 1A3VA 5I2XA 2KA7A 3R2TA 4N9PA 2D62A 1J9OA 1DD2A 5EJWA 1UEAB 2B2VC 1X3QA 4HSPA 3K0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A35 A;  4PV1 C;  2YYZ A;  2NN6 G;  2B8F A;  2PCF B;  1A6X A;  2JEB I;  1SMY C;  4KN7 C;  1Z7T A;  3OOC A;  2F1M A;  5KNB A;  2E76 C;  2EDG A;  4DNT B;  2K32 A;  1OXV A;  1VCI A;  3SDZ A;  3I73 A;  4G7O C;  4JK1 C;  2AUK A;  3PUW A;  1FR3 A;  3A7A B;  1BDO A;  3VR2 A;  4DNR B;  1GJX A;  2PPB C;  1E2V A;  1CTM A;  1Q1E A;  1GUG A;  2EJF C;  1LAC A;  3M4Y A;  2EVB A;  1VF7 A;  1GUS A;  3EQL C;  1IW7 D;  5BN5 A;  4G7H C;  2A6E C;  5BN4 A;  1Y8N B;  2NN6 I;  1T5E A;  1OXX K;  3MFY A;  3P20 A;  4XIG S;  2JXM B;  4I7Z C;  2BA0 A;  2NN6 H;  2D2C C;  3VR3 A;  1TU2 B;  1Q90 A;  2A68 C;  1E2W A;  4XTC S;  3VR6 A;  1Y8O B;  2DNC A;  3I72 A;  5JEA G;  1I6V C;  1IW7 C;  1GUO A;  1TKW B;  2CW0 C;  2L5T A;  3CRL C;  1OXS C;  3N6R A;  4IQZ A;  4KKS A;  4RCN A;  3ND9 A;  3T56 B;  3A8K E;  3BG3 A;  1VF5 C;  2BDO A;  3TZU A;  4OO1 G;  3CRK C;  3RLF A;  2PNR C;  4H0L C;  4KHZ A;  5KNC A;  1YNN C;  4IFD G;  1IYV A;  1Q12 A;  1HQM C;  2V4D A;  1Q1B A;  1Z6H A;  2K33 A;  3L7Z C;  3M85 A;  3LNN A;  5C0X H;  2JE6 I;  4KKT A;  3HGB A;  3PUZ A;  2IT1 A;  1YNJ C;  1QJO A;  1GUT A;  2BA1 A;  3OW7 A;  4OGQ C;  3VA7 A;  1GHK A;  1H9K A;  1HCZ A;  3H94 A;  4KI0 A;  2E74 C;  1G29 1;  3AB9 A;  2K7V A;  4GZY C;  4JBW A;  3A8J E;  3A7L A;  4IFD H;  4LK1 C;  1ONL A;  2E75 C;  2A6E D;  1B9N A;  2B8G A;  2LMC B;  1O7L A;  5K36 H;  5C0X G;  4BA1 I;  1FYC A;  1H9R A;  2A6H D;  4KMU C;  4DK1 A;  2A69 D;  2AUJ D;  3IFT A;  1K8O A;  1CI3 M;  3KLR A;  3VR4 A;  3QG1 A;  1H9S A;  1K8M A;  2AWO A;  4OO1 H;  1OXU A;  2EJM A;  2ZT9 C;  3DXJ C;  3QJY A;  1PMR A;  3M7N A;  3SE0 A;  2R6G A;  1GHJ A;  1EWH A;  2A6H C;  2QF7 A;  3MXU A;  3PUV A;  3WDN A;  1DCZ A;  4G7Z C;  2O5J C;  1VDZ A;  1O78 A;  3ND8 A;  3W3A A;  3GQB A;  2DN8 A;  4DK0 A;  2JEA I;  2Q8I B;  1GUN A;  1V43 A;  2D5D A;  3FPP A;  1CFM A;  5K36 G;  1LAB A;  1ZYR C;  3OPO A;  5BN3 A;  3D4R A;  5KND A;  1H9M A;  1B9M A;  1HPC A;  1ZKO A;  4HR7 B;  1OXT A;  4BA2 I;  3BDO A;  4L8J A;  2A69 C;  2A68 D;  2EJG C;  2KA7 A;  3I4L A;  5JEA H;  1HTP A;  2BE5 D;  4KKU A;  3VR5 A;  1IYU A;  2D62 A;  4H13 C;  4KN4 C;  4TQU S;  2O5I C;  4H44 C;  1H9S B;  1DD2 A;  1Y8P B;  3PV0 A;  3T53 B;  1V8Q A;  1DXM A;  3FMC A;  3U9S A;  1Y69 U;  3D31 A;  3PUX A;  1E2Z A;  4LJZ C;  3IKJ A;  3NE5 B;  3QIA A;  2KCC A;  3GD7 A;  3PUY A;  1H9J A;  3LWU A;  2BE5 C;  4TKO B;  3A8I E;  2DNE A;  3T51 B; 
#chains in the Genus database with same CATH topology
 1HJP A;  1BR9 A;  1VQO A;  1TWA B;  1E24 A;  2HQL A;  2OQK A;  2G9H D;  2F0V A;  2WAQ G;  3OOC A;  4FF4 A;  3M3Y H;  3TRE A;  3D6C A;  1BDO A;  1G2S A;  4LF9 L;  3PMF A;  4N8X 1;  5EQ0 A;  3E6Z X;  1I6H H;  3K7A H;  2QDB A;  4YCV A;  3QR8 A;  4XIG S;  3GTO B;  2ENB A;  2MFI A;  2ALY B;  1EIG A;  1I94 Q;  1TY2 A;  3J81 E;  2F0L A;  2X6G A;  4JOI A;  1SBB B;  3I3C A;  1SE3 A;  3CHB D;  2CW0 C;  3NBI A;  3F2U A;  1FVI A;  4DR6 L;  1IBK Q;  3GTJ B;  1QUQ B;  1JQY D;  3OW2 A;  5CGK A;  4A3G H;  3JAM L;  3I91 A;  1S72 A;  3TDQ A;  4C3J B;  1R9T B;  1BVS A;  3D8G A;  4DV0 Q;  2F4V L;  4OO1 I;  5CYU A;  1SRO A;  3GTL H;  1EU4 A;  4AIM A;  3H15 A;  3GO5 A;  1H9K A;  3ULP A;  1K73 C;  1PHJ A;  1O80 A;  4DV0 L;  3E9H A;  4BXX G;  5IYD H;  4F87 A;  3BYT B;  4A3B H;  4JC0 A;  1STA A;  4JW0 A;  3HOZ H;  4YWL A;  3E9I A;  1N8R C;  3D4D A;  4GNX A;  1K8A C;  2KEE A;  1PZK D;  1FNU A;  3VR4 A;  1I94 L;  5COR A;  1SMX A;  2EYH A;  1LT6 D;  3J7Z C;  3J81 j;  4DR1 Q;  5IYB G;  4OEM B;  3FKI G;  3CKI B;  4R8N A;  2ATW A;  1KXL A;  1Q82 C;  1W2B A;  1DYQ A;  3F8T A;  4PZ8 A;  1QVG A;  2ZXR A;  3OHX C;  4NXM L;  1O7I A;  3VA5 A;  1XPU A;  4B3R Q;  1WTO A;  3V2T A;  2F0F A;  5KND A;  1SNQ A;  1JWU D;  4JI8 Q;  3S15 H;  1EIY B;  4YWK A;  2YTY A;  1MSG A;  1FNW A;  2K01 A;  3OWE B;  1VQC A;  3D31 A;  4C3H B;  4R9W A;  3GD7 A;  4A3B G;  1XMQ L;  2N3S A;  5IP7 G;  1GXD C;  2DNE A;  3NEL A;  3S1Q B;  4K6L A;  4BXX H;  4DV2 L;  1F9P A;  3RZO B;  3F1Z A;  4PV1 C;  1SMY D;  3NTH A;  2NN6 G;  2PO4 A;  4X6A H;  2VUM B;  2XRQ D;  3CCE A;  4KN7 C;  3V05 A;  3K8A A;  1VQL A;  1KQS A;  3A7A B;  4A3D H;  1E2V A;  2ZM6 L;  5IOC A;  3S1M H;  2QDL A;  3W1B A;  1YJ9 A;  1SYD A;  5C0X I;  1I3Q B;  4A3L H;  4MTN A;  3SGI A;  1OXX K;  4OX9 L;  2EPB A;  1JOQ A;  5M3M B;  4DR2 L;  1BXT A;  5CBA E;  5IWA L;  2HHH L;  2OTJ A;  3KF6 A;  2Y0S E;  5EBD A;  4JG2 A;  2DGY A;  2YV5 A;  4A3I H;  2CHB D;  4HJA A;  3H0G G;  3BS1 A;  4JI0 L;  4HAE A;  4DV3 L;  2EYJ A;  2EXZ A;  1BKB A;  3MXN B;  1VQJ A;  4K2K A;  1BO0 A;  4K0K L;  4RFB A;  3PIO 3;  3PO3 G;  2M2L A;  2WKD A;  5IGE A;  4KI0 A;  1HQR D;  1EEF D;  3E3X A;  3GTM B;  2HCI A;  3S9W A;  5C4X G;  2R3Z A;  5K5P A;  4BY1 B;  2C5C A;  4UAI A;  2E75 C;  2RHS B;  3RN5 A;  1A3U A;  2JSO A;  1ILQ A;  1PDQ A;  2I46 A;  4A3M B;  4PMB A;  2UXD Q;  4AYB G;  4K6D A;  3IFT A;  2B2V A;  3KBG A;  2HD3 A;  4FXG C;  3TQY A;  4LF8 L;  4OHJ A;  2LS0 1;  1DOM A;  2IW3 A;  1HNW Q;  3MXP A;  5IIF A;  2VQF L;  1KDB A;  3U4V A;  2JA6 B;  3CCL A;  1HH2 P;  3H3V H;  5BR8 Q;  1N33 L;  4UP8 A;  2A74 C;  3OTO Q;  4JI4 Q;  1LTR D;  2PW7 A;  2R6G A;  1S5C D;  4HCE A;  1U5K A;  2A6H C;  3AMU A;  2EE1 A;  5TSS A;  1D8L A;  3GQB A;  1F9R A;  2QEJ C;  1D2B A;  1SDF A;  1V43 A;  2ZJR A;  1LTS D;  3ZJY C;  4A3K B;  1QG7 A;  2OEO A;  5C44 G;  2CH4 A;  4DK3 C;  1HNZ Q;  5EKK A;  4P71 A;  4HJ8 A;  2A68 D;  1KC8 C;  1SJE D;  1O7Y A;  4H13 C;  5LHY 1;  1E1T A;  3M4O B;  4XQQ A;  2R7Z B;  3A55 A;  4X66 Q;  3I7F A;  2HIX A;  2KCC A;  1IHZ A;  1CKN A;  5C3E G;  3PIP 3;  3D3R A;  2UXB L;  1B44 D;  4GLV B;  2K5N A;  5LL6 X;  5C44 H;  4L63 B;  2RDH A;  3NEM A;  3E0E A;  2F1M A;  2E76 C;  2EDG A;  2L55 A;  2EYO A;  2VQE L;  1SYB A;  2KUM A;  3K0X A;  2IJ0 A;  2B63 B;  1EYD A;  3R2I A;  3CCJ A;  1XNR Q;  1K9M C;  1GUS A;  4K5W A;  2PI2 E;  1IKM A;  2HUG A;  2XRS D;  4JI3 L;  4X62 Q;  2D2C C;  2EIF A;  1EY4 A;  4XTC S;  1D1I A;  4IQZ A;  2NVQ B;  4R4I A;  3T16 A;  5EPK A;  4LW1 A;  3RLF A;  1GKH A;  1SND A;  2RVL A;  4A3F B;  2V4D A;  5HY6 A;  4LFB L;  3PUZ A;  5GAH C;  2GVA A;  1YNJ C;  1E0B A;  1Y14 B;  4ZRZ A;  1XMQ Q;  4QGU A;  2E2J B;  1LTT D;  2Y0S B;  2E74 C;  1AZP A;  1A0I A;  1GM5 A;  1F2Z A;  3EJI A;  1UWV A;  2LMC B;  2HCC A;  1HR0 L;  2VNU D;  2AUJ D;  4DR3 L;  1W3S A;  2D9U A;  2K6A A;  5M5Y H;  4QMG A;  3CAM A;  1ASZ A;  1VQI A;  2A19 A;  2I5M X;  3ERO A;  1XX8 A;  4DK6 C;  4A93 G;  4FP5 D;  5E3F A;  1PH8 A;  4ALP A;  1D7Q A;  1MJE A;  3BYY B;  4QUC A;  1EQV A;  2CQO A;  2ZTD A;  4UHV A;  5KYI A;  1X55 A;  2QF7 A;  4OWT B;  2E2D C;  5GAG C;  3H3V C;  1EZ8 A;  1PYS B;  4NXN L;  4YY3 Q;  1CFM A;  4IUQ A;  1W6K A;  1Y1V B;  1ZYR C;  2NVY B;  1DOL A;  3D4R A;  2NTS A;  1B9M A;  1HPC A;  1PA6 A;  3BDO A;  3G6J B;  1JR0 D;  2A69 C;  3OIP A;  4J15 A;  2CCZ A;  2UUB L;  2Y0S G;  2O5I C;  1H9S B;  1HFG A;  1PLF A;  1J6Q A;  3PV0 A;  1YIT A;  1CQV A;  2R7D A;  1VQ8 A;  5IGB A;  3U9S A;  3C1E A;  3H09 A;  2JA8 G;  1C9O A;  4KJO A;  3NE5 B;  5C4Z A;  4ILW A;  1EWC A;  4LFA Q;  4LF7 Q;  1SEB D;  2EYM A;  1IBL L;  4ZKB B;  1PFB A;  4DV7 L;  3TP8 A;  2JEB I;  4I7A A;  3OMG A;  3HEJ A;  5EGT A;  1RTN A;  2AWN A;  2R93 H;  4K0K Q;  1NNX A;  4ME3 A;  4P75 A;  4G7O C;  1FD7 D;  4IPD A;  3KDF B;  1I6H B;  1CSP A;  3Q8D A;  2NUC A;  3O13 A;  3HKZ E;  4RCO A;  1EYC A;  3VYU A;  4GKJ L;  2EY1 A;  4X3U A;  5BN4 A;  1X32 A;  3S1R B;  2A1A A;  1B53 A;  2V1C C;  2MGS A;  4AYB E;  1B7Y B;  4CBV A;  5I2Y A;  1I50 H;  1EIH A;  1VQG A;  1LYL A;  2B63 G;  2KQ3 A;  3HOW G;  5JPM C;  1DJR D;  3BZC A;  3PF5 A;  3H3V I;  4KKS A;  4DAM A;  1F2Y A;  1WTX A;  3HOY G;  3CF5 A;  4DR7 Q;  2KOL A;  4PMW A;  1HQM C;  4A3J B;  3ERQ A;  1IBM Q;  2I0Q A;  3HGB A;  1F2M A;  3CMA A;  1N32 L;  4OWW B;  2NYZ D;  4MTK A;  4R4Q A;  1HRJ A;  2J7Z A;  2PZT A;  1VQM A;  3A7L A;  1TS2 A;  2DJG C;  1LT3 D;  1NCV A;  3NWS A;  4APV A;  4IO9 A;  5E4X A;  5HGT A;  3ULJ A;  3HOW B;  4HN7 A;  2K5V A;  3VYR A;  4X65 L;  3MC0 B;  2PW5 A;  1TWF B;  3DXJ C;  3CQZ B;  1DON A;  1F77 A;  1CM9 A;  5IP9 G;  2ZJP A;  1B3Q A;  4QIW B;  1JOR A;  1ML0 D;  2WB1 E;  2LFN A;  4OIJ A;  1GOZ A;  2DN8 A;  3DWP A;  4A3I G;  2Z4I A;  1Z47 A;  3OPO A;  1Q86 C;  3DM1 A;  3I90 A;  1SNC A;  5BN3 A;  4B3M L;  4QQB X;  2KCT A;  1HZC A;  1U4M A;  2QKI C;  2AKW B;  2I5L X;  5C4X B;  4B3S L;  3H6M A;  2MJ8 A;  3T1Y Q;  2IX3 A;  2QA4 A;  3SVM A;  4JBK A;  1XPO A;  3UDX A;  4KY7 A;  1JB3 A;  2JA8 B;  1SSO A;  4AQY L;  4H44 C;  4KY5 A;  4DUY L;  3PCO B;  3HOU G;  3BDL A;  3KBX A;  3PUX A;  5KIX A;  3BDC A;  1G6P A;  1QCB D;  3QIA A;  2HQE A;  3LWU A;  4KY6 A;  1LLR D;  1EIF A;  3FPU B;  3CCQ A;  4KTA A;  5JJZ A;  1KD1 C;  1HNX Q;  1SMY C;  4NDX A;  2C9O A;  4IUR A;  4L5S A;  4DAP A;  4GOP C;  1FGU A;  1SLJ A;  3I73 A;  1KRS A;  4IZ8 A;  5M5Y B;  3PSI A;  3PIO A;  2UXC L;  1WCM B;  2XTI A;  3PQI A;  4X3S A;  2WP8 J;  1BCP C;  2B29 A;  2F0M A;  1UAP A;  2JXM B;  3HKS A;  3J81 L;  2KHJ A;  1NTG A;  4IPG A;  4JI5 L;  1YJN A;  1WCM G;  4GKK L;  5J1Z A;  3UDG A;  1QB5 D;  4GN3 B;  2DNC A;  1CKN B;  2R7F A;  1TKW B;  4X62 L;  4JI3 Q;  2BH2 A;  2VUM G;  3BJU A;  4R4C A;  4A3E G;  4OO1 G;  1VS0 A;  2Z0S A;  1TXY A;  1PRT C;  4X64 L;  4FF3 A;  4V0B A;  2PQA B;  2K33 A;  1Q3L A;  4IFD J;  2K1B A;  2XSC A;  1X3F A;  1SNM A;  3L2P A;  3NBH B;  4OGQ C;  2Q2T A;  1BF4 A;  1JWS D;  1HCZ A;  3OMC A;  5JVG 3;  2F0T A;  3RNU A;  1Q8I A;  4JBW A;  5COY A;  5C0X J;  1TWA H;  1MD2 D;  4XDX A;  4BA1 I;  1SFO H;  2AQ1 B;  5GRO A;  3DM3 A;  3UDI A;  4GLX A;  2NVT H;  2K4K A;  1CI3 M;  1WI5 A;  1MI2 A;  4OXP A;  5FLM H;  2EJM A;  2ZT9 C;  4LF4 Q;  4GKK Q;  2AMC B;  2ZXP A;  2KJX A;  4CDF C;  3ULL A;  4YWM A;  3F2D A;  1VMC A;  1M4V A;  3C2P A;  1OTC A;  2YTV A;  1EQT A;  2XNA C;  1I50 B;  5KGU A;  1KAB A;  3MXU A;  1STB A;  4NP5 A;  4YY3 L;  4NXN Q;  1RTO A;  2N49 A;  2ZTE A;  5M3F H;  3V96 A;  1LTA D;  3TS2 A;  1KL9 A;  4LF5 Q;  3HOX H;  4A3G G;  5IYC H;  1ZKO A;  1RCV D;  5LMU Q;  3MA2 B;  3STB C;  1PH3 A;  4BBS H;  1VQ4 A;  1AN8 A;  4DV6 Q;  1BNZ A;  4QIW E;  1F9Q A;  1FGB D;  1G6Z A;  1SYC A;  1TS3 A;  1ET9 A;  2BCO A;  1VQ7 A;  4GS3 A;  3HOY B;  1SE4 A;  2L1B A;  2IL8 A;  4OEL B;  1JB7 A;  4CDE C;  3P7J A;  1KIX A;  1QVC A;  1ZXT A;  4JK1 C;  3EIV A;  2UU9 Q;  1EY9 A;  2B3G A;  4Y7N H;  1RHP A;  3M4Y A;  1K3B C;  3NUC A;  1N36 L;  4BBS G;  2XGT A;  4JV5 Q;  1OO9 B;  4RHS A;  5M5X B;  1IYJ B;  4HCS A;  1MGS A;  5D3I B;  1TWH B;  4OX9 Q;  1HA6 A;  1Q90 A;  3E0J A;  3VR6 A;  2VQF Q;  4FNF A;  4XYO A;  4JI5 Q;  3MZ5 A;  2E2I H;  4UP7 A;  1K83 B;  1I4X A;  3CRL C;  4FF2 A;  4RCN A;  4HTH A;  4UY8 C;  3GV6 A;  3IL8 A;  4BY1 G;  4LWC A;  3X3M A;  1JOO A;  1JJC B;  3J81 c;  4RA8 A;  3RUZ A;  1JJ2 A;  1GUT A;  4ZAI A;  2Q2H A;  4GN5 A;  4EQP A;  1AEX A;  2L11 A;  1CKO A;  1B70 B;  1D1K A;  2QW7 A;  1I4P A;  3AB9 A;  1VQ9 A;  3PO2 H;  2WB1 G;  4JI0 Q;  4A3E B;  4DXF A;  2A6E D;  1Y1V G;  1SXT A;  3LX0 A;  3BVM A;  2A69 D;  4A4I A;  4A3D B;  1STY A;  4XQJ A;  3B6Y A;  2B2W A;  4IPH A;  2FHT A;  3D0F A;  1X56 A;  4CDD C;  1FJG L;  4CHT B;  4A93 B;  2MP1 A;  3HOV G;  5D14 A;  1YBY A;  4IUT A;  4KHV A;  3NXW A;  1QVF A;  4RGM A;  3GTK B;  2P5Z X;  4FDB A;  2Q8I B;  1WYD A;  4RAU C;  4BWG B;  3OTO L;  2ZM6 Q;  4LF6 L;  2Z1C A;  4YCU A;  4KKU A;  1BCP F;  2A8V A;  3ONA B;  4RMF A;  2LSS A;  1VQH A;  4LF7 L;  3U58 A;  1H9J A;  2UUA L;  1Z9F A;  2WV6 D;  1JE5 A;  2FMM A;  1N32 Q;  4JI8 L;  4IUU A;  4U68 A;  1XNQ Q;  5F2D A;  1XTD A;  5J39 A;  2YTX A;  3S17 H;  1L1O A;  2OWO A;  1FR3 A;  5ELN A;  1BUV T;  1IXR A;  4MHE A;  2PPB C;  3HOU H;  3R8B A;  2F0D A;  4HID A;  3CCR A;  3GTP B;  2SNS A;  1SYE A;  1E7Z A;  3ERS X;  2LXJ A;  3W1G A;  2F0S A;  1AE3 A;  4DUZ Q;  1LT4 D;  5CV8 A;  4DUZ L;  1NSN S;  4ZK9 B;  1PH2 A;  1PH1 A;  2VB2 X;  3BZK A;  4O1N A;  3G6E A;  1N36 Q;  1GUO A;  3JAM E;  3I8Z A;  2Z6K C;  3RR5 A;  4IFD G;  5C4J H;  1J5E Q;  2QCP X;  1RL2 A;  1QZH A;  1Q1B A;  1Z6H A;  1NJI C;  2IT1 A;  1RIP A;  4PNY A;  1BOS A;  5ELO A;  1FL0 A;  2EYP A;  5E4W C;  1X3E A;  3OW7 A;  3HKZ G;  2RQX A;  1PYW D;  5H1S E;  1G29 1;  3KYH C;  1XNQ L;  5JJL A;  1W6J A;  5EKL A;  5KEE A;  3K7A B;  4KV6 A;  4NB3 A;  2F4V Q;  3HKZ B;  3S14 B;  4YIJ A;  4A75 A;  3GTM H;  4A3C G;  2E5L L;  1TVX A;  1JJG A;  4LUZ A;  3SHL A;  1C7Y A;  1YNJ D;  2YU9 B;  3JC6 6;  4A3M H;  1U4L A;  2E8G A;  3TN2 A;  4ABN A;  3GTJ H;  5ELE A;  5FLM G;  3PUV A;  1I4G A;  1QE6 A;  1UEB A;  5J22 A;  3QOL A;  3KLW A;  4C3J H;  2E2I B;  5GQO A;  1CA5 A;  5LL6 S;  2OCE A;  4GKJ Q;  3Q0A A;  1EEI D;  3U50 C;  1PH9 A;  1ASY A;  1SNO A;  3AEV A;  1EQQ A;  1KHI A;  3L3O C;  4BA2 I;  4IJL A;  1Y1W H;  4IN3 A;  1TWC H;  1KNA A;  4P72 A;  1WVL A;  4TQU S;  4YHH L;  3PO3 B;  4ZLT F;  4HMI A;  3EA6 A;  3I4N B;  1T9H A;  2HDM A;  1WOC A;  2F0W A;  3D4W A;  4A3E H;  4OIK A;  3AFQ A;  4HJ9 A;  2VUM H;  4CKC A;  2B8F A;  2KEN A;  4PZ6 A;  3CC4 A;  1Z7T A;  3SK4 A;  1KDA A;  2ICE C;  5KNB A;  4KHP Q;  3AQQ A;  2ES2 A;  2K04 A;  1YNN D;  2RSO A;  2EJF C;  2CW0 D;  1BCP D;  4IUP A;  1CHP D;  4RWS C;  2JA5 H;  4DR5 L;  4U67 3;  2JQO A;  1XNR L;  4IAL A;  4OON A;  1HTL D;  5LMN Q;  2WAC A;  1JWM D;  1B8A A;  1PZI D;  1YJW A;  1G8Z D;  2DY7 A;  3JAM c;  3NQT A;  1BBW A;  1TQO A;  2XWB B;  2F0G A;  1KRT A;  3K5L A;  4C3H G;  3K57 A;  3ITP A;  5C0X H;  3FHW A;  1VQP A;  2RCF A;  1E3P A;  1D6E C;  1CUK A;  3TS0 A;  4RGN A;  5JJI A;  4LFC Q;  1B2T A;  4BBR G;  1XYI A;  1NAP A;  4BY7 H;  1PFM A;  3TME A;  3WOF A;  1I4Q A;  4ZQ3 A;  1KAA A;  4P2C B;  1B9N A;  1SFO B;  2D0P A;  5C0X G;  3OIQ A;  2B2T C;  4RHR A;  4DA2 A;  3MAQ A;  3J80 E;  3I4M H;  2IWH A;  4LUO A;  1RF2 D;  3KLS X;  4QL5 A;  2TSS A;  3CME A;  1VQF A;  1JCK B;  2PQA A;  2XWJ B;  2EOT A;  1JC7 A;  5CV9 A;  4JPB W;  4CJ0 B;  3DEO A;  4DR4 L;  3RLN A;  5M5W B;  1EFI D;  4G7Z C;  5M3F B;  3A5U A;  1MJC A;  4HIO A;  5BR8 L;  1N33 Q;  2K28 A;  2NTT A;  1PH4 A;  1ICF B;  1HNW L;  4DR4 Q;  1S5B D;  1U4P A;  2K75 A;  1V1O A;  4K8J A;  2RSN A;  3E5S A;  3SEB A;  2F03 A;  5C3E B;  5JEA H;  1YIJ A;  3S2D H;  1YVC A;  1O7Z A;  4NMZ A;  1YHA A;  1VQD A;  1Y69 U;  3BVZ A;  4LJZ C;  4XYQ A;  4X3T A;  4RH6 A;  1L0W A;  2FXQ A;  3T1Y L;  5C44 B;  1A6X A;  1MKH A;  2NB0 A;  3DWA A;  4MNO A;  2R92 B;  3K6O A;  2MNA A;  1V1P A;  2GN5 A;  3K59 A;  3NEN A;  3L0O A;  4DNR B;  3F2C A;  3CQZ H;  5T1I A;  1C4Q A;  5FJ8 G;  2VL6 A;  2AQ2 B;  4A3J G;  3GTG B;  1N34 L;  2KBN A;  2IX1 A;  3MFY A;  4K8I A;  1DOK A;  4A3G B;  3GV3 A;  5JEA J;  5IT9 E;  5CR3 A;  1EFW A;  4GLA C;  5IT9 L;  1PH5 A;  2B39 A;  2L5T A;  1IL2 A;  1EY8 A;  2Z8L A;  1ESF A;  1AE2 A;  5C4H A;  1WTR A;  2BDO A;  3J7Y W;  4A3F H;  2MO1 A;  1KNE A;  3AYH B;  1EZ6 A;  3LNN A;  4EQO A;  3Q6S A;  2K50 A;  3KF8 A;  2NVX H;  1X54 A;  2NZ1 D;  3VA7 A;  4WJW A;  1EY7 A;  2WFW A;  1L0X B;  3TZD A;  3H0G B;  1S3O A;  1X65 A;  4AH6 A;  1C0A A;  3G71 A;  3NHH A;  1HA5 A;  5E7N A;  3MHB A;  4JVZ A;  1BBU A;  2A6H D;  3CCV A;  1K8O A;  1K8M A;  1GO3 E;  4K2L A;  4JI2 Q;  4TSS A;  1GVP A;  2PMZ B;  2KHS A;  2F0Q A;  3WDN A;  1HZA A;  1TWF H;  1O78 A;  3JAM i;  2RDG A;  4HIK A;  4JI2 L;  3S15 B;  2L15 A;  1MSH A;  2JYO A;  4JOI C;  3J7A V;  1PFN A;  3KJO A;  3TP7 A;  1EYG A;  1ENA A;  3HOV B;  4HR7 B;  4LF9 Q;  1A2T A;  2EJG C;  2SOB A;  3M4Q A;  4FVM A;  5ELF A;  3VR5 A;  2F0O A;  3RZD H;  5AJ3 L;  2L4N A;  4A3D G;  4DV6 L;  3G7L A;  5ELB A;  3WOE A;  1HHV A;  2BE5 C;  2BH8 A;  4K5V A;  1WTH A;  3UE0 A;  2O2L D;  2WB1 B;  5IGF A;  3GDE A;  1CQF A;  4DPG A;  1I3Q H;  4DR7 L;  4DFA A;  1TS4 A;  3K80 C;  2AUK A;  3PUW A;  4UP9 A;  3VR2 A;  1A3T A;  2VXW A;  1K28 A;  1S5E D;  3P1H A;  3FKI B;  3GTP H;  1GUG A;  2IX0 A;  2AHO B;  4RGO S;  1VF7 A;  4FO2 A;  3HFZ B;  4A3F G;  3T4A C;  1LM0 A;  1SE8 A;  1T5E A;  4FXK C;  2KED A;  4ODG A;  3VYT A;  2OT2 A;  3D6W A;  3FVQ A;  3HP3 A;  1XTC D;  5CMD A;  4P73 A;  1EY0 A;  4JI6 Q;  4QF4 A;  3S2H H;  5FK9 C;  1L2F A;  3BG3 A;  4GN4 B;  4PMC A;  5M3M H;  2CH4 W;  4LAA A;  4A3J H;  5IYB H;  4BBS B;  1Y1W G;  1D5Z C;  4DF7 A;  1QJO A;  4UPA A;  2Q2U A;  2QEX A;  4DV1 Q;  1LO5 D;  3K81 C;  2R93 B;  1DZ1 A;  4GOP A;  4C3J G;  2E2H H;  2MHV A;  4CKE A;  4LFC L;  2WII B;  1KDC A;  4LFB Q;  1H9R A;  1V1Q A;  3FRP B;  2R7Z G;  4MZ9 A;  4BY1 H;  4ID6 A;  2B2U A;  1QWY A;  5FO8 B;  2UUB Q;  1E1O A;  1PVO A;  3M7N A;  1TR5 A;  4A3K H;  1ICW A;  1AZQ A;  1GD7 A;  1MIU A;  1VDZ A;  3ND8 A;  3W3A A;  4DR5 Q;  1G51 A;  2EQS A;  2JEA I;  1L1O B;  2J0T D;  1XJV A;  2L12 A;  1M1K C;  1ENF A;  1ENC A;  2VZA A;  2XVS A;  5HGQ A;  1CK1 A;  3NBH A;  4ZUJ A;  4OL7 A;  3HS0 C;  4DR3 Q;  1AP0 A;  3CU7 A;  1R4Q B;  5ELC A;  4L8J A;  5E1F A;  5IY0 A;  5IGG A;  2SNM A;  1P16 A;  4KN4 C;  5G3L D;  1SAP A;  2JA6 G;  2JA7 H;  3PO3 H;  3T53 B;  3HZX A;  1JT8 A;  1QNU A;  5A2Q L;  2K05 A;  1E2Z A;  2JA7 G;  4UDU C;  1WTV A;  5CV4 A;  1QOH A;  1R9T H;  4Y52 H;  4I65 A;  5A2Q E;  5LMU L;  2F0N A;  1LTI D;  2JJQ A;  4ZYS A;  1EOT A;  2O4X A;  1DM0 B;  2K32 A;  1OXV A;  1VCI A;  3SDZ A;  2LXK A;  3NPP A;  3KFU A;  4NKL A;  1ET6 A;  5CBE E;  3I2Z A;  5IYC G;  3UDF A;  5IE8 A;  3HOX G;  4X64 Q;  5L37 A;  5BN5 A;  5C5L A;  4C56 C;  3LWE A;  3A56 A;  4Y7N B;  2A68 C;  4Q0F A;  3WWV A;  2BOS A;  3ER0 A;  2F0I A;  3GP7 A;  1NUC A;  2FJ2 A;  3BU2 A;  1RDP D;  1IW7 C;  1OXS C;  4JCV E;  3M9B A;  1K8G A;  2F0H A;  1VMP A;  2MPM A;  1IYV A;  3OWF A;  4LF8 Q;  4DXG A;  1STG A;  4DV5 L;  3KDF A;  3L7Z C;  3M85 A;  2NVQ H;  4DAY A;  4EGV A;  5FO9 B;  1PFS A;  1U9R A;  5EKI A;  4Z9C B;  1A62 A;  4J6H A;  2I5H A;  2EY2 A;  2RKS A;  5HUR A;  2XN9 C;  5I6W A;  5AJ3 Q;  2EZV A;  2PZW A;  5CV6 A;  1AFP A;  3J80 c;  1YHB A;  4IOC A;  4B3S Q;  2FMC A;  3T13 A;  2NVT B;  3HOZ B;  4DK1 A;  3RD4 A;  1XWE A;  4DV3 Q;  1HNZ L;  1N9W A;  1VQB A;  4LMQ D;  3Q23 A;  5DAU A;  1H9S A;  2IHE A;  1LTL A;  4DNI A;  4AQY Q;  4QUF A;  4OO1 H;  4JI1 Q;  1PMR A;  4NXM Q;  1BQQ T;  3BZD B;  3H91 A;  3P75 A;  2NBF A;  1EY6 A;  2L9H A;  1WCM H;  5DM6 3;  1UUP A;  2Z4H A;  4A3I B;  4LNQ A;  3S1M B;  5M9O A;  3HOZ G;  4B3T Q;  3FPP A;  4NW2 A;  3S1N B;  1LAB A;  2F0K A;  3S24 A;  3L9A X;  3TSS A;  3S2H B;  1QIL A;  1WTW A;  1H9M A;  3IFD A;  4JI4 L;  3QB3 A;  2ZJQ A;  2C35 B;  4XT3 B;  1S5F D;  4J1M A;  4ZCK A;  1WD0 A;  2BE5 D;  4C2M B;  3F2B A;  5FKA C;  1UE5 A;  4DU9 A;  5I9P A;  2PYK A;  3C3L A;  5JAV A;  3A8I E;  4ME5 A;  5A35 A;  5JJK A;  1VQK A;  4HJ7 A;  3MWY W;  1PYB A;  5DNF A;  3RZO H;  1UE1 A;  4B3M Q;  1F2L A;  1UE7 A;  1WJJ A;  2PMZ E;  1J5E L;  4R4T A;  1X6O A;  4POF A;  4DNT B;  5KRU A;  3RMH A;  3GTO H;  1STE A;  1G2T A;  2QIL A;  4DAY B;  4MN3 A;  4FXD A;  4RGT A;  4CGY B;  4POG A;  1B4O A;  5KYL A;  4O42 A;  4G7H C;  1QZG A;  3MVV A;  5M5X H;  1Y8N B;  4HSV A;  1Q8K A;  3TP6 A;  2A5H A;  3S17 B;  3EFX D;  1SN8 A;  2UUC L;  3A54 A;  1TU2 B;  3M7G A;  5GAD C;  3T1H L;  1UNS A;  2JA6 H;  3VYS A;  3GTQ B;  4X65 Q;  3KLS A;  2A73 B;  3SK5 A;  1X3G A;  5IOD A;  3NTK A;  1WD1 A;  1H95 A;  3CCS A;  5ELD A;  3CP0 A;  3TZU A;  2IPK D;  1YNN C;  4BS9 A;  3PGZ A;  4DV7 Q;  2JA7 B;  1XPR A;  1EY5 A;  2EY6 A;  2F0P A;  5C6A A;  2OF1 A;  3I4N H;  3FDT A;  1SJH D;  1TY0 A;  2FFK B;  4AYB B;  2JN4 A;  2WAQ B;  2Q2I A;  2ICI A;  1LTB D;  3RLO A;  3K5O A;  3QOJ A;  5EPJ A;  1EUJ A;  2R7Z H;  4H02 A;  4P74 A;  3M4O H;  2B8G A;  4C1N K;  2Q8T A;  4C3I B;  2M9V A;  5FLX L;  2LY7 A;  4QB4 A;  4LF6 Q;  1FYC A;  4X3K A;  2MUY A;  4QJF A;  1T5X D;  3RN2 A;  4K5X A;  3BVG A;  1PTO F;  3SK6 A;  1XMO Q;  2F3I A;  1PH6 A;  3HOW H;  2ASB A;  3CW2 C;  2QGQ A;  4PZ7 A;  4TRD A;  5FJ8 H;  3TEH B;  3DWQ A;  3STB D;  4JBJ A;  2B2U C;  4WFN 3;  2F0J A;  1K0S A;  1N34 Q;  4L6T B;  5M3M G;  3DMU A;  2JA9 A;  2JK8 A;  1F9S A;  4JBM A;  4N8F A;  5FOB B;  1RD9 D;  2RF4 A;  1HTP A;  3ICE A;  2R93 G;  5DM7 3;  2MO0 A;  3CD6 A;  4R1J A;  3PIP A;  2IHF A;  1V8Q A;  3U9O A;  2X69 A;  2VW9 A;  4KLK A;  3NP8 A;  1Y1W B;  3PUY A;  4XXE A;  4TKO B;  2OXP A;  3I55 A;  1K3R A;  1BBX C;  2JA8 H;  4KJN A;  2Z6K A;  3PO2 G;  5ISR A;  2YYZ A;  2PCF B;  3DLL A;  4QY7 A;  1E22 A;  2E2J H;  2F3W A;  4DAV A;  1EQR A;  5C5M A;  3HOU B;  1STH A;  1L0Y B;  3NK9 A;  3EQL C;  1IW7 D;  2PZU A;  1I5F A;  3LGJ A;  3UI2 A;  1PH7 A;  2R61 A;  3OYY A;  3PF4 A;  1WFQ A;  4EQ5 A;  2BA0 A;  5T1G A;  2F0U A;  2SDF A;  4JI1 L;  1S5D D;  2RBM A;  1JE4 A;  1Y8O B;  2DY8 A;  3I72 A;  1ESR A;  1B3A A;  3A0J A;  2F3V A;  3I4M G;  3A5Z B;  3SK8 A;  2UXD L;  2UUC Q;  3K5N A;  2BDN A;  3A8K E;  5DLQ E;  2WIN B;  5C4J B;  1YI2 A;  2J4X A;  3KF8 B;  3GTK H;  1X3P A;  3NWT A;  3QWN A;  4HJ5 A;  3S2D B;  4BBR H;  5FLX c;  4M1U B;  2JE6 I;  1AW7 A;  2Q8R E;  1GHK A;  3OSO A;  3H94 A;  1CKM A;  1Q7Y C;  4C3H H;  4DV5 Q;  4G57 A;  1C48 A;  2XIW A;  1SYG A;  4EQN A;  1VQ5 A;  1NE3 A;  4LUV A;  4N9T A;  2EYL A;  1PTO B;  4ZUI A;  1O7L A;  4RG1 A;  3S1R H;  3MTS A;  1EL0 A;  2KVM A;  2K03 A;  5FLX E;  3NQI A;  1HZB A;  3FP9 A;  1RKN A;  1OXU A;  1XXG A;  2YU9 H;  4WJ4 A;  1R4P B;  3GTG H;  3HRZ C;  2K52 A;  4CJ1 B;  2JA5 G;  1HXY D;  3DUZ A;  4PQX A;  2MQH A;  1PRT D;  2OTL A;  4A3K G;  4B3T L;  4IFD I;  2O5J C;  1EU3 A;  3C1F A;  4O0A A;  3Q24 A;  4C3I G;  3IRB A;  4JV5 L;  2RHQ B;  2X6L A;  1VQE A;  2I07 B;  2K5H A;  2CWP A;  4B9X A;  3J81 i;  3K5M A;  1A2U A;  2K14 A;  1IYU A;  1STN A;  5EAY A;  3HOY H;  2CWA A;  1Y8P B;  1U0L A;  1HUM A;  4C1N I;  3W2D A;  4GNX C;  1PTO D;  3AU7 A;  5C3E H;  5KNC A;  3I4O A;  2B63 H;  4WOR A;  3J7A F;  4DUY Q;  1Q81 C;  4DV1 L;  4M8A A;  3M3Y B;  4QCL A;  2CVR A;  3SR1 A;  3CC7 A;  1PV4 A;  1RJT A;  1LAC A;  4LF5 L;  2A6E C;  2JA5 B;  3P20 A;  1QUQ A;  4OWX B;  1YNX A;  1NR4 A;  2HDL A;  3VR3 A;  3TRZ A;  4RKB A;  2NZH A;  3UE1 A;  2GVB A;  3CC2 A;  5JEA G;  1I6V C;  2F4I A;  5J3B A;  3N6R A;  3K7U C;  2R92 G;  4NPS A;  2UXC Q;  3ND9 A;  1TWH H;  3NSW A;  4XQN A;  1VF5 C;  4LF4 L;  2TMP A;  2H4O A;  3FEW X;  3TBI B;  2PNR C;  4H0L C;  4KHZ A;  4KHP L;  2DUD A;  2B2W C;  1K83 H;  1NMG A;  4KKT A;  2EYF A;  4DV4 L;  1CZW A;  4JYA Q;  3CPF A;  2CKZ B;  4ZKC B;  1PZJ D;  3GTL B;  5C4X H;  1HNX L;  3AFP A;  4DN4 M;  4DGZ A;  4YHH Q;  4IFD H;  4WJ3 M;  2DJF C;  1M8A A;  1JOK A;  5JPN C;  4Q5V A;  5K36 H;  4FYD A;  4A3B B;  3I4M B;  4R8I A;  3EN2 A;  4A93 H;  3H0G H;  1TWG B;  1MBY A;  2AWO A;  4B3R L;  5IWA Q;  2HHH Q;  1S40 A;  4BY7 G;  5CV5 A;  1HZ9 A;  5JOB A;  3SE0 A;  1AH9 A;  3Q22 A;  3CCU A;  1GHJ A;  1SE2 A;  2RCN A;  3N52 A;  4FF1 A;  3C46 A;  1XMO L;  2Z6B A;  1II3 A;  3W5O A;  4DK0 A;  3G48 A;  2D5D A;  4A3L G;  5K36 G;  4HMJ A;  1CT1 D;  5I4D A;  2GA4 B;  2B2T A;  5GAE C;  1ILP A;  5IGD A;  1OXT A;  3U4Z A;  5IP9 H;  2B2Y A;  2EXD A;  3I4L A;  4LFA L;  3NTI A;  1L1O C;  1CHQ D;  5CV7 A;  1VQN A;  5IT9 c;  1DXM A;  2F52 A;  3R93 A;  2RDF A;  4V19 0;  5IP7 H;  3MXG A;  1SR3 A;  2K5W A;  1IL8 A;  3CCM A;  4ULL A;  1PRT F;  2EY5 A;  5EBC A;  1JMC A;  2R92 H;  1CSQ A;  1I4R A;  3A74 A;  4KK7 A;  4F8M A;  3KJP A;  3EVQ A;  1VQA A;  1IBM L;  1U4R A;  4YCW A;  1CTM A;  1YZ6 A;  2EVB A;  1J8I A;  4KD3 A;  2N8N A;  2JP1 A;  2NZO A;  4HED A;  3EBE A;  4DR1 L;  1M90 C;  2NN6 I;  1GUW A;  4DR6 Q;  4O2D A;  1A15 A;  5FO7 B;  3S16 H;  2NWG A;  3R3O A;  1E2W A;  3GTQ H;  3KOJ A;  1EOV A;  1K0R A;  1NMF A;  4B08 A;  1Q46 A;  2WAQ E;  3T1H Q;  2L0C A;  2N55 A;  2AQ3 B;  1ZYR D;  4E6I A;  1S4Z A;  2PI2 A;  1Y1V H;  2NVY H;  1YHQ A;  5C3X A;  4PG3 A;  1WTQ A;  2N88 A;  3DHQ A;  1HR0 W;  5LMN W;  4HIM A;  4GOP B;  2VB3 X;  3CPW A;  4F88 A;  2NVX B;  5IYD G;  2BA1 A;  3MEH A;  1P8L A;  3MXN A;  1VQ6 A;  3G4S A;  4A3M G;  3KUP A;  3X3N A;  2K7V A;  1IBL Q;  4B9W A;  4H7B A;  4LK1 C;  1ONL A;  5I9O A;  4C3I H;  1SRU A;  4JYA L;  2LKV A;  1QNK A;  4A3C H;  1G91 A;  5LMN L;  3HG9 A;  4KMU C;  3KF6 B;  3URY A;  2E2H B;  1UE6 A;  3QG1 A;  1ZEQ X;  3KK7 A;  3IAY A;  1PRT B;  4CKB A;  3VDY A;  1KLG D;  4A76 A;  1TT2 A;  1EWH A;  1NBW A;  1TWC B;  1EWI A;  3J80 i;  2HIV A;  2ID0 A;  1B1Z A;  1EYA A;  1SYF A;  5G3L F;  1CZG A;  1IKL A;  1FJG Q;  2D0O A;  1DGS A;  3RZD B;  4IJH A;  4L5R C;  1LUZ A;  1LT5 D;  4X66 L;  3K58 A;  4JI7 L;  3FMC A;  4JI7 Q;  1HR0 Q;  4XT1 B;  5D3D A;  3IKJ A;  5CC4 A;  3T51 B;  1C8C A;  4DV4 Q;  1FNV A;  2Z9H A;  5AFW A;  1V1P B;  1CA6 A;  4IPC A;  2SEB D;  2G5D A;  4MIU A;  3I70 A;  1HFN A;  1NR2 A;  3CXC A;  2H5X A;  1TWG H;  2FIN B;  5NUC A;  5M3F G;  4K14 A;  2VY3 A;  1HUN A;  1GJX A;  2PQE A;  1Q1E A;  3J7A 5;  1B50 A;  3M4P A;  2KCN A;  4IUN A;  1IBK L;  4I7Z C;  1V9P A;  1PXU A;  2NN6 H;  5C3W A;  4WRD A;  2G9D A;  1SNP A;  1MHW C;  4GNX B;  2RA4 A;  1JIC A;  2CQA A;  2UU9 L;  4RKL A;  5I6Y A;  5JVH 3;  3TP5 A;  3T56 B;  1KTK A;  5EPL A;  2ZXO A;  3CRK C;  2K5Q A;  4IOA A;  1D5X C;  1Q12 A;  2VS1 A;  4EX5 A;  4BBR B;  2KHI A;  2K5D A;  4BY7 B;  5IGC A;  2UXB Q;  2VQE Q;  3HOV H;  1IZ6 A;  4L5T A;  3I56 A;  1TS5 A;  3DEP A;  3SXH A;  2IY5 B;  4GZY C;  2KCM A;  3A8J E;  3S1Q H;  1I4H A;  3PO2 B;  1KLU D;  2HT1 A;  3FKI H;  3J80 L;  1PTO H;  1TII D;  4L5Q A;  4JI6 L;  2F0E A;  1LV9 A;  1ROD A;  3KLR A;  4S3S A;  4CJ2 C;  5M5W H;  3QJY A;  5DEH A;  3MEF A;  4DR2 Q;  2B2Y C;  1PTO C;  4EVO A;  2KEC A;  2H1E A;  4G4K A;  5D65 A;  2WKC A;  3HOX B;  2ZTC A;  1NY4 A;  3MFG A;  3S16 B;  1DCZ A;  4F7X A;  4IUV A;  1A63 A;  3QO2 A;  2OQ0 A;  1GUN A;  1KAW A;  4CDC C;  1D5M C;  2M00 A;  1LTG D;  2PNH A;  1BCP B;  1WTP A;  2E5L Q;  3ZYY X;  4J8Q A;  2CFM A;  1X9N A;  4KD4 A;  1A3V A;  1A8V A;  5I2X A;  2KA7 A;  3R2T A;  4N9P A;  2UUA Q;  4DKA C;  2D62 A;  1J9O A;  3S1N H;  3I4N G;  1DD2 A;  5EJW A;  1UEA B;  2B2V C;  4TVA B;  4R4O A;  1X3Q A;  4HSP A;  4DV2 Q;  1YEZ A;  3S14 H;  3K0Y A;  4C2M H;  2N78 A; 
#chains in the Genus database with same CATH homology
 1BR9 A;  1TWA B;  2G9H D;  2F0V A;  4FF4 A;  3OOC A;  3D6C A;  1BDO A;  1G2S A;  3PMF A;  5EQ0 A;  3E6Z X;  2QDB A;  4XIG S;  3GTO B;  2ENB A;  1EIG A;  1TY2 A;  3J81 E;  2F0L A;  2X6G A;  1SBB B;  3I3C A;  1SE3 A;  3CHB D;  2CW0 C;  3NBI A;  3F2U A;  3GTJ B;  1JQY D;  5CGK A;  3JAM L;  3I91 A;  3TDQ A;  4C3J B;  1R9T B;  3D8G A;  4OO1 I;  5CYU A;  1EU4 A;  3GO5 A;  1H9K A;  1O80 A;  4F87 A;  3BYT B;  1STA A;  3D4D A;  2KEE A;  1PZK D;  1FNU A;  3VR4 A;  5COR A;  2EYH A;  1LT6 D;  4R8N A;  3CKI B;  1DYQ A;  2ZXR A;  3OHX C;  3VA5 A;  1WTO A;  3V2T A;  2F0F A;  5KND A;  1SNQ A;  1JWU D;  1MSG A;  1FNW A;  2K01 A;  3OWE B;  3D31 A;  4C3H B;  4R9W A;  3GD7 A;  1GXD C;  2DNE A;  3S1Q B;  4K6L A;  1F9P A;  3RZO B;  4PV1 C;  1SMY D;  3NTH A;  2NN6 G;  2PO4 A;  2VUM B;  2XRQ D;  4KN7 C;  3V05 A;  3A7A B;  1E2V A;  5IOC A;  1SYD A;  5C0X I;  1I3Q B;  1OXX K;  2EPB A;  1JOQ A;  5M3M B;  1BXT A;  5CBA E;  5EBD A;  2CHB D;  3BS1 A;  4HAE A;  2EYJ A;  2EXZ A;  4K2K A;  1BO0 A;  4RFB A;  3PIO 3;  2M2L A;  2WKD A;  5IGE A;  4KI0 A;  1HQR D;  1EEF D;  3GTM B;  2HCI A;  3S9W A;  2R3Z A;  5K5P A;  4BY1 B;  2C5C A;  4UAI A;  2E75 C;  1A3U A;  2JSO A;  1ILQ A;  1PDQ A;  2I46 A;  4A3M B;  4PMB A;  4K6D A;  3IFT A;  2B2V A;  3KBG A;  4FXG C;  4OHJ A;  2LS0 1;  1DOM A;  2IW3 A;  3MXP A;  5IIF A;  2JA6 B;  1KDB A;  2A74 C;  1LTR D;  2PW7 A;  2R6G A;  1S5C D;  4HCE A;  2A6H C;  3AMU A;  2EE1 A;  5TSS A;  3GQB A;  1F9R A;  2QEJ C;  1D2B A;  1SDF A;  1V43 A;  1LTS D;  4A3K B;  1QG7 A;  2OEO A;  5EKK A;  2A68 D;  1SJE D;  1O7Y A;  4H13 C;  5LHY 1;  3M4O B;  4XQQ A;  2R7Z B;  3A55 A;  2KCC A;  1IHZ A;  3PIP 3;  3D3R A;  1B44 D;  5LL6 X;  4L63 B;  2RDH A;  2F1M A;  2E76 C;  2EDG A;  2L55 A;  2EYO A;  1SYB A;  2KUM A;  2IJ0 A;  2B63 B;  1EYD A;  3R2I A;  1GUS A;  4K5W A;  1IKM A;  2HUG A;  2XRS D;  2D2C C;  1EY4 A;  4XTC S;  1D1I A;  4IQZ A;  2NVQ B;  3T16 A;  5EPK A;  3RLF A;  2RVL A;  1SND A;  4A3F B;  2V4D A;  3PUZ A;  4ZRZ A;  1YNJ C;  1E0B A;  2E2J B;  1LTT D;  2Y0S B;  2E74 C;  1AZP A;  1F2Z A;  3EJI A;  2LMC B;  2HCC A;  2VNU D;  2AUJ D;  2D9U A;  2K6A A;  4QMG A;  3ERO A;  1XX8 A;  4FP5 D;  5E3F A;  3BYY B;  4QUC A;  1EQV A;  5KYI A;  2QF7 A;  2E2D C;  3H3V C;  1EZ8 A;  1CFM A;  4IUQ A;  1W6K A;  1Y1V B;  1ZYR C;  2NVY B;  1DOL A;  3D4R A;  2NTS A;  1B9M A;  1HPC A;  3BDO A;  3G6J B;  1JR0 D;  2A69 C;  3OIP A;  2O5I C;  1H9S B;  1HFG A;  1PLF A;  3PV0 A;  1CQV A;  5IGB A;  3U9S A;  3C1E A;  3H09 A;  4KJO A;  3NE5 B;  5C4Z A;  4ILW A;  1EWC A;  1SEB D;  2EYM A;  4ZKB B;  1PFB A;  3TP8 A;  2JEB I;  3OMG A;  3HEJ A;  5EGT A;  1RTN A;  2AWN A;  4G7O C;  1FD7 D;  1I6H B;  2NUC A;  3O13 A;  4RCO A;  1EYC A;  3VYU A;  2EY1 A;  4X3U A;  5BN4 A;  3S1R B;  1X32 A;  1B53 A;  2MGS A;  4CBV A;  5I2Y A;  1EIH A;  2KQ3 A;  5JPM C;  1DJR D;  4KKS A;  1F2Y A;  1WTX A;  2KOL A;  4PMW A;  1HQM C;  4A3J B;  3ERQ A;  3HGB A;  1F2M A;  2NYZ D;  1HRJ A;  2J7Z A;  2PZT A;  3A7L A;  1TS2 A;  1LT3 D;  1NCV A;  3NWS A;  5E4X A;  5HGT A;  3HOW B;  4HN7 A;  3VYR A;  3MC0 B;  2PW5 A;  1TWF B;  3DXJ C;  3CQZ B;  1DON A;  1F77 A;  1CM9 A;  4QIW B;  1JOR A;  1ML0 D;  2LFN A;  4OIJ A;  1GOZ A;  2DN8 A;  3DWP A;  2Z4I A;  1Z47 A;  3OPO A;  3DM1 A;  3I90 A;  1SNC A;  5BN3 A;  1U4M A;  2QKI C;  5C4X B;  3H6M A;  2MJ8 A;  2IX3 A;  3SVM A;  4KY7 A;  1JB3 A;  2JA8 B;  1SSO A;  4H44 C;  4KY5 A;  3BDL A;  3KBX A;  5KIX A;  3PUX A;  3BDC A;  1QCB D;  3QIA A;  2HQE A;  3LWU A;  4KY6 A;  1LLR D;  3FPU B;  4KTA A;  5JJZ A;  1SMY C;  4NDX A;  2C9O A;  4IUR A;  4DAP A;  3I73 A;  4IZ8 A;  5M5Y B;  1WCM B;  4X3S A;  2WP8 J;  1BCP C;  2F0M A;  1UAP A;  2JXM B;  3J81 L;  5J1Z A;  1QB5 D;  2DNC A;  1TKW B;  4OO1 G;  1PRT C;  4FF3 A;  4V0B A;  2K33 A;  1Q3L A;  4IFD J;  2K1B A;  2XSC A;  1SNM A;  4OGQ C;  1BF4 A;  1JWS D;  1HCZ A;  3OMC A;  5JVG 3;  2F0T A;  1Q8I A;  4JBW A;  5COY A;  5C0X J;  1MD2 D;  4XDX A;  4BA1 I;  2AQ1 B;  1CI3 M;  1MI2 A;  2EJM A;  2ZT9 C;  2ZXP A;  2KJX A;  1VMC A;  1M4V A;  3C2P A;  1EQT A;  2XNA C;  1I50 B;  5KGU A;  1KAB A;  3MXU A;  1STB A;  4NP5 A;  1RTO A;  3V96 A;  1LTA D;  1ZKO A;  1RCV D;  3MA2 B;  1AN8 A;  1BNZ A;  1F9Q A;  1FGB D;  1G6Z A;  1SYC A;  1TS3 A;  1ET9 A;  2BCO A;  3HOY B;  1SE4 A;  2L1B A;  2IL8 A;  3P7J A;  1ZXT A;  4JK1 C;  1EY9 A;  1RHP A;  3M4Y A;  3NUC A;  1OO9 B;  4RHS A;  5M5X B;  4HCS A;  1MGS A;  5D3I B;  1TWH B;  1HA6 A;  1Q90 A;  3E0J A;  3VR6 A;  4FNF A;  4XYO A;  3MZ5 A;  1K83 B;  1I4X A;  3CRL C;  4FF2 A;  4RCN A;  4HTH A;  3GV6 A;  3IL8 A;  3X3M A;  1JOO A;  4RA8 A;  3RUZ A;  1GUT A;  4ZAI A;  4EQP A;  1AEX A;  2L11 A;  1D1K A;  3AB9 A;  1I4P A;  4A3E B;  4DXF A;  2A6E D;  1SXT A;  3LX0 A;  3BVM A;  2A69 D;  4A3D B;  1STY A;  4XQJ A;  2B2W A;  2FHT A;  4CHT B;  4A93 B;  2MP1 A;  5D14 A;  4IUT A;  4KHV A;  3NXW A;  3GTK B;  4RGM A;  2Q8I B;  4RAU C;  4BWG B;  2Z1C A;  4KKU A;  1BCP F;  3ONA B;  1H9J A;  2WV6 D;  2FMM A;  4IUU A;  4U68 A;  5F2D A;  5J39 A;  1FR3 A;  1BUV T;  4MHE A;  2PPB C;  3R8B A;  2F0D A;  3GTP B;  2SNS A;  1SYE A;  2F0S A;  1LT4 D;  5CV8 A;  1NSN S;  4ZK9 B;  2VB2 X;  4O1N A;  1GUO A;  3JAM E;  3I8Z A;  4IFD G;  2QCP X;  1Q1B A;  1Z6H A;  2IT1 A;  4PNY A;  1BOS A;  2EYP A;  5E4W C;  3OW7 A;  2RQX A;  1PYW D;  1G29 1;  1W6J A;  5EKL A;  5KEE A;  3K7A B;  4KV6 A;  3HKZ B;  3S14 B;  4YIJ A;  1TVX A;  3SHL A;  2YU9 B;  1YNJ D;  1U4L A;  3TN2 A;  4ABN A;  5ELE A;  3PUV A;  1I4G A;  1QE6 A;  5J22 A;  3QOL A;  2E2I B;  1CA5 A;  5LL6 S;  3Q0A A;  1EEI D;  1SNO A;  3L3O C;  4BA2 I;  4IN3 A;  1KNA A;  1WVL A;  4TQU S;  3PO3 B;  4ZLT F;  4HMI A;  3EA6 A;  3I4N B;  2HDM A;  2F0W A;  3D4W A;  4OIK A;  4CKC A;  2B8F A;  1Z7T A;  3SK4 A;  1KDA A;  2ICE C;  5KNB A;  2K04 A;  1YNN D;  2RSO A;  2EJF C;  2CW0 D;  1BCP D;  4IUP A;  1CHP D;  4RWS C;  4U67 3;  4IAL A;  1HTL D;  2WAC A;  1JWM D;  1PZI D;  1G8Z D;  2DY7 A;  3NQT A;  1TQO A;  2XWB B;  2F0G A;  3K5L A;  4C3H G;  3K57 A;  3ITP A;  5C0X H;  1D6E C;  4RGN A;  1B2T A;  1XYI A;  1NAP A;  1PFM A;  3TME A;  3WOF A;  1I4Q A;  4ZQ3 A;  1KAA A;  4P2C B;  1B9N A;  1SFO B;  5C0X G;  3OIQ A;  2B2T C;  4RHR A;  3MAQ A;  4DA2 A;  3J80 E;  2IWH A;  1RF2 D;  3KLS X;  2TSS A;  1JCK B;  2XWJ B;  2EOT A;  1JC7 A;  5CV9 A;  4CJ0 B;  3DEO A;  5M5W B;  1EFI D;  4G7Z C;  5M3F B;  2K28 A;  2NTT A;  1U4P A;  1S5B D;  1V1O A;  4K8J A;  2RSN A;  3E5S A;  3SEB A;  2F03 A;  5C3E B;  5JEA H;  1O7Z A;  4NMZ A;  1Y69 U;  3BVZ A;  4LJZ C;  4XYQ A;  4X3T A;  4RH6 A;  5C44 B;  1A6X A;  2NB0 A;  3DWA A;  2R92 B;  3K6O A;  1V1P A;  3K59 A;  4DNR B;  5T1I A;  1C4Q A;  2AQ2 B;  3GTG B;  2IX1 A;  3MFY A;  4K8I A;  1DOK A;  4A3G B;  3GV3 A;  5JEA J;  5IT9 E;  5CR3 A;  5IT9 L;  2B39 A;  2L5T A;  1EY8 A;  2Z8L A;  1ESF A;  5C4H A;  1WTR A;  2BDO A;  3J7Y W;  1KNE A;  1EZ6 A;  3LNN A;  4EQO A;  3Q6S A;  3KF8 A;  2NZ1 D;  3VA7 A;  4WJW A;  1EY7 A;  1L0X B;  3TZD A;  3H0G B;  3NHH A;  1HA5 A;  3MHB A;  2A6H D;  1K8O A;  1K8M A;  4K2L A;  4TSS A;  2PMZ B;  2KHS A;  2F0Q A;  3WDN A;  1O78 A;  2RDG A;  3S15 B;  1MSH A;  2JYO A;  3J7A V;  1PFN A;  3TP7 A;  1ENA A;  3HOV B;  4HR7 B;  1A2T A;  2EJG C;  2SOB A;  4FVM A;  5ELF A;  3VR5 A;  2F0O A;  2L4N A;  3G7L A;  5ELB A;  3WOE A;  1HHV A;  2BE5 C;  4K5V A;  2O2L D;  2WB1 B;  5IGF A;  1CQF A;  4DFA A;  1TS4 A;  2AUK A;  3PUW A;  3VR2 A;  1A3T A;  2VXW A;  3P1H A;  1S5E D;  3FKI B;  1GUG A;  2IX0 A;  4RGO S;  1VF7 A;  4FO2 A;  3T4A C;  1T5E A;  4FXK C;  3VYT A;  2KED A;  4ODG A;  2OT2 A;  3D6W A;  3FVQ A;  3HP3 A;  1XTC D;  5CMD A;  1EY0 A;  4QF4 A;  5FK9 C;  3BG3 A;  4PMC A;  4LAA A;  4BBS B;  1D5Z C;  4DF7 A;  1QJO A;  1LO5 D;  2R93 B;  1DZ1 A;  4C3J G;  2MHV A;  4CKE A;  2WII B;  1KDC A;  1H9R A;  3FRP B;  4ID6 A;  2B2U A;  1QWY A;  5FO8 B;  3M7N A;  1TR5 A;  1ICW A;  1AZQ A;  1VDZ A;  3ND8 A;  3W3A A;  2JEA I;  2J0T D;  2L12 A;  1ENF A;  1ENC A;  2XVS A;  1CK1 A;  3NBH A;  4ZUJ A;  4OL7 A;  3HS0 C;  1AP0 A;  3CU7 A;  1R4Q B;  5ELC A;  4L8J A;  5E1F A;  5IGG A;  2SNM A;  4KN4 C;  5G3L D;  1SAP A;  3T53 B;  3HZX A;  1QNU A;  5A2Q L;  2K05 A;  1E2Z A;  4UDU C;  1WTV A;  5CV4 A;  1QOH A;  4I65 A;  5A2Q E;  2F0N A;  1LTI D;  4ZYS A;  1EOT A;  2O4X A;  1DM0 B;  2K32 A;  1OXV A;  1VCI A;  3SDZ A;  3NPP A;  4NKL A;  1ET6 A;  5CBE E;  5BN5 A;  5C5L A;  4C56 C;  3LWE A;  3A56 A;  4Y7N B;  2A68 C;  4Q0F A;  2BOS A;  2F0I A;  1NUC A;  3GP7 A;  2FJ2 A;  1RDP D;  1IW7 C;  1OXS C;  2F0H A;  1VMP A;  2MPM A;  1IYV A;  3OWF A;  4DXG A;  1STG A;  3L7Z C;  3M85 A;  4DAY A;  4EGV A;  5FO9 B;  1U9R A;  5EKI A;  4Z9C B;  4J6H A;  2EY2 A;  2RKS A;  5HUR A;  2XN9 C;  5I6W A;  2EZV A;  2PZW A;  5CV6 A;  1AFP A;  2NVT B;  2FMC A;  3T13 A;  3HOZ B;  4DK1 A;  3RD4 A;  1XWE A;  3Q23 A;  4LMQ D;  5DAU A;  1H9S A;  4QUF A;  4OO1 H;  1PMR A;  1BQQ T;  3BZD B;  3H91 A;  3P75 A;  2NBF A;  1EY6 A;  2L9H A;  5DM6 3;  1UUP A;  2Z4H A;  4A3I B;  3S1M B;  5M9O A;  3FPP A;  4NW2 A;  3S1N B;  3TSS A;  1LAB A;  2F0K A;  3L9A X;  3S2H B;  1QIL A;  1WTW A;  1H9M A;  3IFD A;  3QB3 A;  4XT3 B;  1S5F D;  4J1M A;  1WD0 A;  2BE5 D;  4C2M B;  5FKA C;  4DU9 A;  5I9P A;  2PYK A;  3C3L A;  5JAV A;  3A8I E;  4ME5 A;  5A35 A;  3MWY W;  5DNF A;  1F2L A;  5KRU A;  4DNT B;  3RMH A;  1STE A;  1G2T A;  2QIL A;  4MN3 A;  4FXD A;  4RGT A;  4CGY B;  1B4O A;  5KYL A;  4O42 A;  4G7H C;  3MVV A;  1Y8N B;  4HSV A;  3TP6 A;  2A5H A;  3S17 B;  3EFX D;  3A54 A;  1TU2 B;  3M7G A;  1UNS A;  3VYS A;  3GTQ B;  3KLS A;  2A73 B;  3SK5 A;  5IOD A;  3NTK A;  1WD1 A;  5ELD A;  3TZU A;  2IPK D;  1YNN C;  4BS9 A;  2JA7 B;  1EY5 A;  2EY6 A;  2F0P A;  5C6A A;  2OF1 A;  3FDT A;  1SJH D;  1TY0 A;  2FFK B;  4AYB B;  2WAQ B;  2ICI A;  1LTB D;  3K5O A;  3QOJ A;  5EPJ A;  4C3I B;  2B8G A;  2Q8T A;  4C1N K;  2M9V A;  5FLX L;  2LY7 A;  4QB4 A;  1FYC A;  4X3K A;  2MUY A;  1T5X D;  4K5X A;  3BVG A;  1PTO F;  3SK6 A;  4TRD A;  3DWQ A;  2B2U C;  4WFN 3;  2F0J A;  4L6T B;  3DMU A;  1F9S A;  5FOB B;  1RD9 D;  1HTP A;  5DM7 3;  1V8Q A;  3U9O A;  2X69 A;  3NP8 A;  1Y1W B;  3PUY A;  4XXE A;  4TKO B;  2OXP A;  1BBX C;  4KJN A;  5ISR A;  2YYZ A;  2PCF B;  2F3W A;  4DAV A;  5C5M A;  3HOU B;  1STH A;  1L0Y B;  3NK9 A;  3EQL C;  1IW7 D;  2PZU A;  3UI2 A;  2R61 A;  2BA0 A;  5T1G A;  2F0U A;  2SDF A;  1S5D D;  2RBM A;  1JE4 A;  1Y8O B;  2DY8 A;  3I72 A;  1ESR A;  1B3A A;  2F3V A;  3SK8 A;  3K5N A;  2BDN A;  3A8K E;  2WIN B;  5C4J B;  2J4X A;  1X3P A;  3NWT A;  3QWN A;  3S2D B;  4M1U B;  2JE6 I;  1AW7 A;  2Q8R E;  1GHK A;  3OSO A;  3H94 A;  4G57 A;  1C48 A;  2XIW A;  1SYG A;  4EQN A;  4N9T A;  2EYL A;  1PTO B;  4ZUI A;  1O7L A;  3MTS A;  1EL0 A;  2KVM A;  2K03 A;  5FLX E;  3NQI A;  1RKN A;  1OXU A;  1XXG A;  1R4P B;  3HRZ C;  4CJ1 B;  1HXY D;  3DUZ A;  4PQX A;  1PRT D;  4IFD I;  2O5J C;  1EU3 A;  3C1F A;  3Q24 A;  4C3I G;  2X6L A;  2I07 B;  4B9X A;  3K5M A;  1A2U A;  1IYU A;  1STN A;  1Y8P B;  1HUM A;  4C1N I;  3W2D A;  1PTO D;  3AU7 A;  5KNC A;  4WOR A;  3J7A F;  4M8A A;  3M3Y B;  4QCL A;  2CVR A;  3SR1 A;  1RJT A;  1LAC A;  2A6E C;  2JA5 B;  3P20 A;  1NR4 A;  2HDL A;  3VR3 A;  4RKB A;  5JEA G;  1I6V C;  2F4I A;  3N6R A;  3ND9 A;  3NSW A;  4XQN A;  1VF5 C;  2TMP A;  2H4O A;  3FEW X;  3TBI B;  2PNR C;  4H0L C;  4KHZ A;  2B2W C;  4KKT A;  2EYF A;  1CZW A;  4ZKC B;  1PZJ D;  3GTL B;  4DN4 M;  4DGZ A;  4IFD H;  1M8A A;  1JOK A;  5JPN C;  4Q5V A;  5K36 H;  4FYD A;  4A3B B;  3I4M B;  4R8I A;  1TWG B;  1MBY A;  2AWO A;  5CV5 A;  5JOB A;  3SE0 A;  3Q22 A;  1GHJ A;  1SE2 A;  4FF1 A;  3N52 A;  3C46 A;  1II3 A;  4DK0 A;  2D5D A;  5K36 G;  4HMJ A;  1CT1 D;  5I4D A;  2GA4 B;  2B2T A;  1ILP A;  5IGD A;  1OXT A;  2B2Y A;  3I4L A;  3NTI A;  1CHQ D;  5CV7 A;  1DXM A;  3R93 A;  2RDF A;  4V19 0;  3MXG A;  2K5W A;  1IL8 A;  4ULL A;  1PRT F;  2EY5 A;  5EBC A;  1I4R A;  4KK7 A;  4F8M A;  3EVQ A;  1U4R A;  1CTM A;  2EVB A;  1J8I A;  4KD3 A;  2JP1 A;  4HED A;  2NN6 I;  1GUW A;  1A15 A;  5FO7 B;  2NWG A;  3R3O A;  1E2W A;  4B08 A;  2L0C A;  2N55 A;  2AQ3 B;  1ZYR D;  4E6I A;  1S4Z A;  5C3X A;  1WTQ A;  2N88 A;  3DHQ A;  2VB3 X;  4F88 A;  2NVX B;  2BA1 A;  3MEH A;  3MXN A;  3KUP A;  3X3N A;  2K7V A;  4B9W A;  4H7B A;  4LK1 C;  1ONL A;  5I9O A;  2LKV A;  1QNK A;  1G91 A;  3HG9 A;  4KMU C;  3URY A;  2E2H B;  3QG1 A;  1ZEQ X;  3KK7 A;  3IAY A;  1PRT B;  4CKB A;  1KLG D;  1TT2 A;  1EWH A;  1TWC B;  2ID0 A;  1B1Z A;  1EYA A;  1SYF A;  5G3L F;  1CZG A;  1IKL A;  3RZD B;  1LT5 D;  3K58 A;  3FMC A;  4XT1 B;  5D3D A;  3IKJ A;  5CC4 A;  3T51 B;  1C8C A;  1FNV A;  1CA6 A;  5AFW A;  1V1P B;  2SEB D;  4MIU A;  3I70 A;  1HFN A;  1NR2 A;  2FIN B;  5NUC A;  4K14 A;  1HUN A;  1GJX A;  2PQE A;  1Q1E A;  1B50 A;  2KCN A;  4IUN A;  4I7Z C;  2NN6 H;  1PXU A;  5C3W A;  4WRD A;  2G9D A;  1SNP A;  2RA4 A;  1JIC A;  2CQA A;  4RKL A;  5I6Y A;  5JVH 3;  3TP5 A;  3T56 B;  1KTK A;  5EPL A;  2ZXO A;  3CRK C;  2K5Q A;  1D5X C;  1Q12 A;  4BBR B;  2K5D A;  4BY7 B;  5IGC A;  1TS5 A;  3DEP A;  3SXH A;  4GZY C;  3A8J E;  1I4H A;  3PO2 B;  1KLU D;  3J80 L;  1PTO H;  1TII D;  2F0E A;  1LV9 A;  1ROD A;  3KLR A;  4S3S A;  4CJ2 C;  3QJY A;  5DEH A;  2B2Y C;  1PTO C;  4EVO A;  2KEC A;  2H1E A;  4G4K A;  5D65 A;  2WKC A;  3HOX B;  3MFG A;  3S16 B;  1DCZ A;  4F7X A;  4IUV A;  3QO2 A;  1GUN A;  1D5M C;  2M00 A;  1LTG D;  1WTP A;  1BCP B;  3ZYY X;  4J8Q A;  4KD4 A;  1A3V A;  5I2X A;  2KA7 A;  3R2T A;  4N9P A;  2D62 A;  1J9O A;  1DD2 A;  5EJW A;  1UEA B;  2B2V C;  1X3Q A;  4HSP A;  3K0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...