2L5TA

Solution nmr structure of e2 lipoyl domain from thermoplasma acidophilum
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
77
structure length
77
Chain Sequence
b'MYEFKLPDIGEGVTEGEIVRWDVKEGDMVEKDQDLVEVMTDKVTVKIPSPVRGKIVKILYREGQVVPVGSTLLQIDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoamide acyltransferase
publication title Solution NMR structure of E2 lipoyl domain from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 3
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l5tA00
2K33A 4G7HC 3HGBA 2BDOA 2B8GA 4KN7C 3MFYA 1H9SA 1GHKA 1V43A 4KKTA 3RLFA 3QJYA 2A6HC 2KCCA 4XIGS 2A6ED 3GQBA 4L8JA 4JK1C 2JEAI 1OXVA 1OXUA 1BDOA 4DNTB 3QIAA 2A6HD 1H9SB 3OPOA 1E2VA 3D31A 2KA7A 4LK1C 5KNBA 3I4LA 1YNNC 3LNNA 3ND9A 3WDNA 4IFDH 4KN4C 1G291 1QJOA 2R6GA 1YNJC 5KNCA 1Q12A 5BN5A 1Y8PB 2E74C 2JEBI 3CRLC 1TU2B 2JXMB 3BDOA 3NE5B 2EDGA 3D4RA 1GUOA 1HPCA 2D5DA 2EJGC 2CW0C 3QG1A 1IYUA 3EQLC 5JEAH 1GHJA 3A7LA 3PUZA 3KLRA 4DK0A 5K36H 2YYZA 4OO1H 2A6EC 4JBWA 5KNDA 1K8MA 2NN6H 4IQZA 3N6RA 3M85A 3U9SA 4KKSA 1GJXA 3T51B 2O5IC 1K8OA 3I72A 3SE0A 3TZUA 1E2ZA 1T5EA 2PCFB 1ONLA 2Q8IB 1E2WA 5BN4A 2PPBC 2B8FA 1O78A 2A68D 4DNRB 1Y8NB 5C0XH 2DN8A 3A8IE 3A7AB 2LMCB 2PNRC 3IKJA 2AUKA 3PUYA 4OGQC 1FR3A 1ZKOA 4GZYC 2D62A 1FYCA 4DK1A 5A35A 3H94A 1OXTA 4IFDG 1VCIA 4OO1G 2AUJD 1DD2A 1HTPA 2AWOA 3A8KE 3ND8A 1A6XA 1OXSC 3P20A 4RCNA 1IW7C 4BA1I 2E76C 1Z7TA 1TKWB 1Q1EA 4LJZC 3VA7A 3VR4A 2A69D 4PV1C 1H9MA 1I6VC 1IW7D 4H0LC 3A8JE 1H9JA 1Q90A 2IT1A 2ZT9C 3VR3A 1Y8OB 1HQMC 2A68C 3PV0A 1CTMA 3OOCA 2BA0A 1Y69U 4BA2I 3CRKC 1DXMA 1OXXK 1VDZA 4KMUC 3T56B 3VR2A 3VR6A 3AB9A 3T53B 3PUWA 3IFTA 1EWHA 2BE5D 2O5JC 2EJFC 2K7VA 2EVBA 5C0XG 1V8QA 4G7OC 1ZYRC 2K32A 1HCZA 2D2CC 3BG3A 3L7ZC 2NN6I 1CFMA 1CI3M 3MXUA 2BA1A 3I73A 2A69C 2E75C 4KKUA 2L5TA 5BN3A 3DXJC 2JE6I 1Q1BA 3FMCA 2EJMA 3FPPA 2V4DA 3M4YA 1GUSA 5JEAG 1H9RA 5K36G 1H9KA 1DCZA 1O7LA 1SMYC 4KI0A 4TKOB 1PMRA 2NN6G 4G7ZC 1GUNA 1LABA 3M7NA 3LWUA 1VF5C 4I7ZC 2BE5C 4XTCS 3SDZA 1GUTA 1B9MA 4H44C 1IYVA 2DNCA 3VR5A 1Z6HA 3GD7A 4HR7B 4TQUS 3OW7A 1LACA 1B9NA 3PUXA 2DNEA 4KHZA 2F1MA 3PUVA 1VF7A 3W3AA 1GUGA 4H13C 2QF7A
chains in the Genus database with same CATH superfamily
4XYQA 2ZXOA 1YJNA 1PH5A 1CA6A 1MHWC 2VB2X 3G6JB 3D6WA 3OWFA 3D6CA 4ILWA 1IZ6A 1WTHA 4C3IG 1W3SA 1JC7A 3DWAA 2Z6KA 3HZXA 2B2VC 3CCVA 2K1BA 4K14A 1CZWA 4R4IA 3S17B 3UE1A 4KN4C 1QJOA 4HSVA 1D1KA 1QVCA 1LT4D 2E74C 3S24A 3SR1A 5I6WA 5ISRA 3T4AC 1MBYA 1EWCA 1I4GA 3K7AB 2ID0A 3DMUA 3GTPH 4OWTB 2KEEA 3K5LA 3HKSA 1GJXA 5C5LA 1B8AA 3BU2A 1ML0D 1PFBA 4DV7L 1K83H 4HJ7A 5EPLA 1Y8NB 3A7AB 5CV6A 2F0FA 4KJOA 3J7AV 3NPPA 4ZYSA 4KLKA 5A35A 1A3TA 5M5XB 2ATWA 3GTMB 1D5XC 2SNMA 4BS9A 1IL8A 4B3ML 2HIVA 3ND8A 4KY7A 3SK6A 1NNXA 2FJ2A 1F9RA 1KDAA 3J7ZC 4HCEA 1RF2D 4HCSA 5JAVA 2Y0SB 3F2BA 4DR1Q 1EIYB 1SYCA 1VQJA 4JBKA 4GKJQ 3KF8A 2JA7B 2Z4HA 3OOCA 2B63B 1EYGA 4C56C 4ZRZA 2K7VA 3RZDH 4DV3Q 4J8QA 3CHBD 2OQKA 2F0DA 4DR4Q 1CFMA 1N8RC 4QB4A 1FNWA 1JE5A 4RHSA 4A3JH 4LF9Q 5ELFA 4ZK9B 2F0VA 3A56A 3H09A 3NWSA 1VMPA 3OIPA 1GUNA 2X69A 3S2HH 3QB3A 3K8AA 2E2HH 2F0QA 1TS4A 2GN5A 3LWEA 4X65Q 4TQUS 1SLJA 1TQOA 3NBIA 1PTOB 1GM5A 1CA5A 2YU9H 4JI1Q 1EUJA 3PUVA 4OEMB 4UPAA 1RKNA 4YCVA 2F03A 1D5MC 3UDXA 4RKLA 3CQZH 1SNCA 3GDEA 4HMIA 4UP7A 4LF7L 4IUVA 2JA5H 1LTAD 2KJXA 3DEPA 2JJQA 4A3EH 1W6KA 4XDXA 3DWPA 1N32L 3GTQH 1HA6A 1PYBA 4P72A 1X55A 4IALA 2VQEQ 1NTGA 4NW2A 2F0TA 5KYLA 1L1OA 5LMUQ 5D3IB 1WCMG 3A7LA 4MNOA 2L9HA 3HP3A 3RN5A 1A63A 1STNA 1SN8A 1TWCB 2E2DC 2F4IA 1PRTD 3T16A 4I65A 4V0BA 2DJFC 1MSHA 1HJPA 2PZTA 5DAUA 3S1MB 4EQNA 3S16H 3VYTA 1E1TA 1WCMB 3SEBA 2F0LA 5ELNA 1QOHA 3HOVH 5AFWA 5GAHC 4UHVA 3M4OH 3AFQA 5M3FB 4K8JA 2HHHL 3CCSA 3VA7A 1T9HA 4RGNA 4LFCQ 2F3VA 2B2VA 1V1PA 1BBXC 4ZKCB 1SJHD 2OF1A 2FINB 2NVYH 5IOCA 1QG7A 4A3EG 1BNZA 3V2TA 5C3EG 5CV9A 1I4QA 3STBC 4KKUA 3S15B 2E2JH 1F2MA 5ELOA 4FP5D 1VQ4A 4BY7B 3FMCA 3WOEA 2RCNA 1NE3A 2K5DA 1HFNA 1TIID 2RCFA 5C4XB 1SMYC 2E2IB 5FO9B 3LWUA 3I4MB 2CH4A 1A8VA 2HCIA 5IODA 3BDLA 2IPKD 1GUTA 3NBHA 2NZ1D 3CCMA 4CDDC 3MHBA 3J81c 1LACA 1EY9A 1WYDA 1EEFD 2K6AA 2OQ0A 4H13C 3K81C 2BDOA 3MFYA 3KLSA 1GHKA 4YCWA 2KHJA 1ICFB 2TSSA 3QJYA 4BBSG 1KRTA 1OXVA 2AWNA 2BH8A 3T1HQ 4JI0Q 5I4DA 1HTLD 1LT6D 3ND9A 2F0SA 2A74C 4CKEA 1HH2P 2NZOA 3U4ZA 4B3RQ 3C3LA 1FNUA 4X64Q 3RLNA 1EY5A 4BBSB 3P7JA 2Z6BA 3KBXA 5M5YH 4ODGA 4DAPA 3BS1A 2JA6B 4R8NA 2NVQH 4DUZQ 2BDNA 5E1FA 3U9SA 3M85A 1LTID 4PQXA 1OTCA 4KD4A 1K8OA 1YITA 1GVPA 1Y1VH 1B44D 3SHLA 2R93H 3K80C 1A2TA 2N88A 3M7GA 4XQNA 5IP7H 2EXDA 2NUCA 4DNRB 3V96A 4JI7Q 1ENCA 1KLGD 2AQ1B 1X3QA 1K73C 2NTTA 4IFDJ 4K5WA 2AUJD 1QB5D 5GQOA 3TREA 2K50A 2OEOA 2WINB 3OHXC 3J80c 1JWMD 2XSCA 5A2QE 1CZGA 1XJVA 1ESRA 3HOYB 1WTXA 4DUYQ 3J7A5 3GV6A 3S1RH 1DOLA 4RFBA 4GOPB 1OXXK 3L0OA 3VR2A 3VR6A 5J22A 4ZUIA 1HUMA 5JJKA 1EQTA 1DJRD 1G51A 2R7ZB 1SNDA 1BCPD 2VS1A 1I5FA 4S3SA 1J5EQ 2Z8LA 2BA1A 5I6YA 3CAMA 4HJ5A 1Q1BA 4IUPA 3NEMA 4ZLTF 1RIPA 3K0YA 2CFMA 2JP1A 1H9RA 2PYKA 4JYAL 1JMCA 4LF8L 1N33L 4CBVA 4IUUA 1PLFA 1BKBA 1Y1VG 2WB1B 3BVMA 1VQMA 1R9TH 3RNUA 5IP7G 3J7AF 1A62A 1VMCA 2PNHA 4L6TB 1G2TA 4DV0Q 1I50B 1VQGA 3HRZC 4WRDA 1IL2A 4OELB 4YWMA 3MVVA 3AYHB 2MQHA 3VYUA 1LM0A 2A6ED 3GQBA 1X65A 3DUZA 2IY5B 3KYHC 4JI3Q 3UDFA 3GTKH 2P5ZX 3HFZB 2C5CA 1PZJD 1VQCA 3MXNB 2UUCQ 1PTOD 5M5WH 1Q12A 3RZOH 5IP9G 3CRLC 4A3GB 3Q22A 2UXCQ 3PO3B 4N8FA 2EJGC 3KUPA 3D4DA 2M9VA 2AHOB 4DK0A 1B70B 3OTOL 4MTKA 1II3A 2FFKB 3WOFA 1MD2D 3SE0A 2EYJA 2J4XA 1I3QB 1EFWA 2HT1A 3CC7A 1NUCA 1VQEA 2LFNA 4LWCA 5J3BA 2A68D 1FD7D 2IX3A 1WTRA 2EYOA 3FKIB 5CYUA 1FR3A 2ZJPA 2SDFA 3OMGA 3NTKA 4R4CA 4L5RC 4OWWB 1X3FA 3GP7A 1CQFA 3M3YH 1TKWB 4JI6L 1PRTC 2I46A 1IXRA 4FXGC 1Q46A 4X62L 3B6YA 1YEZA 2K5VA 4MIUA 1QE6A 3K5NA 1PH7A 5EGTA 1IBMQ 2UUBL 1C9OA 2F0WA 2FMMA 4C3JH 1ZEQX 2O4XA 2VZAA 1J8IA 4ME5A 1J9OA 2D0OA 2E5LL 5CORA 5M9OA 4DR3Q 4LF4Q 3J81E 4POFA 4R9WA 4DXFA 1WTWA 3GTJH 4DR6Q 3M4YA 1U4LA 4AYBE 3J7YW 4DV1L 1W6JA 1EZ6A 3S14H 5A2QL 1SNPA 1VQKA 1WFQA 2PMZE 3DEOA 3S1NB 4A3IH 2EY5A 2LXJA 3E5SA 4DV4L 1YNJD 1TWAH 1K8AC 1IBKQ 2EY2A 2IL8A 4KKTA 1XWEA 4G7HC 1UEAB 3R8BA 3H0GG 1HNZQ 1HQRD 2IX0A 1RODA 4CKCA 1FNVA 5FLMH 1YHAA 4RCOA 4ULLA 1ENAA 4DNTB 3QIAA 1E2VA 5EKKA 2KA7A 2K5WA 3I4LA 4NXML 4IFDH 1A15A 1G291 2JA8H 4JV5Q 2RDHA 4LF5Q 2EY1A 4A3KG 4B9WA 3A55A 1UE6A 3OWEB 4H02A 5CR3A 3EQLC 4K0KQ 5IWAQ 2MPMA 3M9BA 4POGA 3OW2A 4E6IA 3CU7A 3J80E 2F0MA 2PCFB 1D5ZC 1BCPF 2ZJRA 2Q8IB 3RN2A 3PO2H 1I4XA 2B3GA 3EA6A 3PCOB 4R4TA 2D62A 1FYCA 2SEBD 1BR9A 1DYQA 1R4PB 3FHWA 2KOLA 1LTBD 5D14A 1SAPA 1QVFA 4NDXA 5G3LD 1N34L 2G9DA 1Q7YC 4OX9Q 2C35B 5T1IA 4GN5A 4X3UA 3VR3A 3CMAA 1PFNA 4DV2Q 1YNXA 1BF4A 4IZ8A 1YVCA 1B2TA 5AJ3L 2ICIA 3DM3A 5FLMG 3S17H 3PIOA 3SXHA 2BE5D 1B4OA 4C3HB 5CBAE 3PIPA 4MHEA 5C5MA 3UDIA 2VXWA 2JA8G 3H91A 2KCNA 3I7FA 4DR5Q 2PQAA 1XPUA 1I4PA 2JA9A 1JOKA 4PMCA 1X9NA 5IYDG 2KCTA 2RVLA 1VQOA 4QUCA 3M4PA 1WD0A 3T1YL 4KI0A 1MJEA 1Q81C 4Q5VA 4JI2Q 2VUMB 1L0YB 1B9MA 3UDGA 3GD7A 3PO2G 4QQBX 3TP5A 4KHZA 5M5XH 1ICWA 3GTMH 3OYYA 3HGBA 3MZ5A 1HNXQ 3IL8A 4CHTB 5EKLA 1AH9A 1JJGA 3DWQA 3BZCA 1CSQA 4L8JA 2JEAI 1JCKB 1VQPA 1D2BA 1H9SB 5ELBA 2JA7H 3S2DB 3J81L 5I9PA 3KJOA 1PH2A 4KHPL 1Q8IA 1RJTA 5IY0A 4OL7A 4PMWA 2DJGC 4CGYB 5DM73 2JXMB 3AEVA 4WJ4A 4YY3Q 1EY4A 3ICEA 1XNQQ 1W2BA 4O0AA 1S5FD 3TN2A 2XRSD 2YYZA 2A6EC 1AN8A 4B3SQ 1XMQQ 3I8ZA 3T51B 4XQJA 2WAQE 4J6HA 3GTLB 1E2ZA 2DY8A 1V1OA 2L15A 3CCLA 1PTOC 3KBGA 3DHQA 2DN8A 2PNRC 4JCVE 1ZKOA 2XTIA 1JJCB 2QA4A 4LF6Q 3MWYW 2PZWA 4Z9CB 1PTOH 1KHIA 3VYRA 1CSPA 4K8IA 3HS0C 4B3TL 1O7YA 5IGDA 2C9OA 2XGTA 3NUCA 2Q2HA 1L2FA 4JBMA 2ZXPA 2Q8RE 3E9IA 2A68C 3DLLA 2YTVA 2L12A 2F0NA 3PQIA 2Y0SG 4BXXG 3RUZA 4FF3A 1TXYA 4YWLA 4DV7Q 3BZDB 2JA7G 3KJPA 4I7AA 3J80L 1IBLL 5C0XG 4A3DB 2B63G 4OO1I 2RDGA 1AEXA 3MXUA 3E3XA 5KIXA 1PH8A 3HOWB 2NZHA 2HCCA 4B3MQ 2PZUA 3A0JA 2XVSA 4PZ6A 3TZDA 4KY5A 1TWCH 1N36L 4IJHA 2RHSB 4NPSA 4F88A 2H5XA 3GTOH 1VF5C 4I7ZC 1NMGA 2H4OA 1UNSA 4UP8A 1B3AA 3H3VI 2EE1A 1SE3A 1WCMH 3H15A 4J15A 2G5DA 2IW3A 2QF7A 5CV8A 2ES2A 3F2DA 2D0PA 3Q23A 5GADC 1FGBD 1RCVD 4BY1B 1U0LA 4QMGA 1QUQB 1TWFB 1O7ZA 1XTCD 1VQNA 1KAAA 3LNNA 1XTDA 1YNJC 1LUZA 2QDBA 4FF4A 4R4QA 1Y8PB 4A3BB 4FF1A 1VS0A 3WWVA 3D4WA 5LL6S 1UE1A 2F0PA 1X54A 3S15H 5HGTA 1SNQA 4OO1H 1XXGA 1XNRL 4BY7H 3JAMc 2O5IC 4X65L 2NBFA 4A93B 3I4OA 4UDUC 5C4XH 4JI1L 5C3WA 4LF7Q 4DAYB 2E2IH 1F2ZA 3I4MH 2HUGA 4JI8Q 4DKAC 5BR8L 3H3VC 5E3FA 1VQ6A 4KHVA 5C3EH 1TT2A 3GTPB 1DD2A 2QGQA 4HIKA 2L1BA 3H3VH 2CQAA 4IPGA 3PF5A 2I5MX 5ELDA 1KDCA 1PVOA 3GV3A 3NSWA 1GO3E 2M2LA 1MGSA 1RHPA 3RD4A 5M3FG 5FJ8H 3K59A 2PW5A 3PV0A 1E7ZA 2Q8TA 1TWGB 1BVSA 2VQEL 4HAEA 1Y69U 1VDZA 2PQEA 5LMUL 3FPUB 3T53B 3IFTA 1YBYA 1Q8KA 3HKZE 2K04A 1PH9A 2VB3X 2CHBD 2VL6A 2YTXA 4BBSH 1K3RA 1LV9A 2GVBA 1NY4A 2JA6H 1S5DD 3D8GA 4TVAB 1EQRA 2B2TC 5FO8B 2HHHQ 1PZKD 1RDPD 4OO1G 5CV7A 1CT1D 4WJWA 4BY7G 1S5BD 3E0EA 4K5VA 2BE5C 4IN3A 2UXBL 4P71A 3RZDB 1A2UA 3HOUB 4NB3A 5J39A 5C4XG 1B50A 3I4MG 2MP1A 3HKZB 1TS2A 4HJ9A 1PH1A 3GTGB 3X3MA 4LFCL 2UU9L 2MJ8A 5IGBA 4O42A 4A3JB 4DR2L 2R7DA 4AQYQ 3SK4A 4FDBA 4DFAA 5C4HA 1F9QA 1HR0L 1XX8A 3EJIA 3I91A 4DNIA 3CP0A 4GOPC 4FYDA 4RHRA 3AFPA 3OPOA 1LO5D 4LK1C 1PA6A 5D65A 1JR0D 4G57A 3W1BA 1KNAA 1YIJA 4QUFA 4KJNA 5FJ8G 1KDBA 2KENA 2XRQD 4YCUA 1U4RA 3EN2A 2KHSA 3I55A 1VQHA 3TRZA 2QCPX 1CKNB 1GUOA 2B2YC 3W5OA 4UY8C 2JA5B 4IQZA 4B9XA 4GKKL 4B08A 4LFAQ 2OXPA 4JG2A 1B7YB 1HFGA 3TZUA 4JOIC 5GAEC 5KYIA 2JA6G 1UE7A 4QIWE 2EYMA 1A3VA 4HIDA 2NVXH 1EU3A 4MTNA 1VCIA 1Y1WB 1HZCA 5NUCA 3BJUA 2JK8A 1EWIA 5EPKA 3T1HL 1I50H 4Y52H 4JI0L 5JVH3 2O2LD 3VR4A 3TP7A 1BBWA 2EYFA 3Q8DA 3CCJA 1VQAA 4GN3B 3G71A 2IX1A 4B3RL 4ZAIA 4X64L 1SBBB 2BH2A 3HOYG 1FGUA 2UUAL 4DV5L 5JJIA 3AB9A 3G48A 5FO7B 4ZKBB 3AU7A 5EBCA 2ICEC 1CHQD 4CDFC 5EAYA 5HURA 1TS5A 4AH6A 4A3GH 2A73B 3PO3H 3QR8A 1KL9A 3FDTA 3CCEA 2AKWB 2ZM6L 1KRSA 2M00A 2DGYA 2LY7A 2QDLA 2R61A 4GNXB 2R7ZG 5DM63 2KEDA 4G7ZC 1I3QH 1F9SA 4IUQA 1HZBA 4LW1A 1SYDA 5IP9H 3EIVA 1EIHA 5I2XA 2R92B 3FKIH 1HZAA 3OW7A 4DR7Q 4ABNA 2F1MA 1F9PA 4U68A 4NXNL 4DA2A 1VF7A 2F0HA 1VQ7A 2E2JB 4DF7A 4DUYL 2WB1G 1EY7A 3BVZA 3PIO3 2VQFL 1K8GA 2CKZB 3VA5A 3TP6A 3PIP3 1G8ZD 1QWYA 3NENA 2OTJA 4C2MB 5IT9c 4LAAA 4GLVB 1PRTF 3NHHA 3KDFB 4KY6A 4CJ2C 2HD3A 1U4MA 1HNWL 5JEAH 1C7YA 1LTTD 1N9WA 4A76A 2WFWA 5K36H 3I90A 2B2TA 4A3GG 5HY6A 4KKSA 3PO3G 2CWPA 1T5EA 2JQOA 4L5QA 1SMXA 1U5KA 4Y7NH 4TSSA 1G6PA 2UXDL 2EY6A 4DV6Q 3S1NH 3FRPB 1SXTA 5EPJA 1B3QA 3U9OA 3MTSA 2YV5A 5M5YB 1L0XB 1DGSA 4BA1I 3FKIG 1RL2A 1D7QA 2L0CA 3CC2A 3FVQA 4JI5L 4XT1B 4HSPA 5COYA 2ASBA 2K75A 4GOPA 4A3MB 2RBMA 3NTHA 2R93B 4CDCC 4K5XA 3OTOQ 1CKMA 1UAPA 2UXCL 2F0EA 3I56A 1SSOA 2A19A 1QCBD 1BO0A 2B2YA 3TSSA 1FJGL 3H0GH 1PDQA 1P8LA 3KF6B 5J1ZA 3OMCA 2WIIB 5LMNL 3FPPA 4RH6A 4JOIA 2HQEA 5JEAG 3Q0AA 2JSOA 3K7UC 2KECA 5K36G 4IPDA 2VNUD 1Z9FA 1JORA 3F2UA 4X62Q 2DNCA 3E0JA 4A3KH 4EVOA 2UUBQ 1S4ZA 2QILA 4HN7A 1TWHB 4JBJA 2KBNA 1TVXA 2B2UC 2MO1A 1NJIC 3RR5A 2E5LQ 4UP9A 2WACA 5IIFA 3MXNA 4X66L 4F7XA 2XN9C 2K5NA 3MAQA 2PW7A 3AQQA 3UE0A 1S72A 3VDYA 1XPRA 3E6ZX 4M1UB 4DV1Q 4BWGB 4HTHA 1TU2B 1PH6A 4F87A 4C3HH 3NE5B 2OWOA 4ME3A 1K0SA 5C44G 2K28A 1GHJA 1ZXTA 4DV4Q 1EZ8A 4BBRB 5TSSA 3HG9A 1KAWA 4JW0A 4YHHQ 5FKAC 3GTKB 2PI2A 1JOQA 1AZQA 1GD7A 4AYBB 5CGKA 3ULLA 2B8FA 2X6LA 5M5WB 2VUMH 5KEEA 3PUYA 5C44B 4HEDA 2NVTB 2PMZB 3J81i 4NXMQ 1XMOL 5IYDH 5CBEE 1ZYRD 2KVMA 1IW7C 5FOBB 3JAML 4LFBQ 1Z7TA 2NB0A 4M8AA 1DONA 5D3DA 5GAGC 1I94L 3CCUA 2YTYA 2IT1A 1Y8OB 5JPNC 3ONAB 1LT3D 4P75A 2KCMA 2WKCA 3TEHB 2XWJB 1M4VA 3S2DH 4C1NK 1ET9A 4DAVA 3ERQA 2V1CC 3SK8A 2N49A 1E3PA 1V8QA 4NP5A 3CMEA 4OWXB 1EOVA 3M3YB 3BYYB 3F1ZA 4N9TA 3I2ZA 2JE6I 4C3HG 1X32A 3I4NB 3DM1A 3SGIA 3C1FA 3HOZB 5C0XI 1SEBD 1P16A 3GTLH 1H9KA 1N34Q 3CF5A 1IYVA 1TY2A 1EFID 1JICA 5T1GA 1JQYD 3W2DA 2CVRA 4HR7B 2A5HA 4G4KA 2VUMG 1TR5A 3Q6SA 3PUZA 5DEHA 3EFXD 5IT9E 3K7AH 2NWGA 1GXDC 2F4VL 1IKLA 4OIJA 3J80i 4APVA 4JI4L 4L5SA 3RLFA 3VYSA 1PTOF 2A6HC 2KQ3A 4LUVA 3S1QB 4XQQA 4X3KA 1BDOA 1JB7A 2IJ0A 2DY7A 3D31A 2EXZA 4DGZA 2LKVA 4A3IB 1K3BC 3T1YQ 2L4NA 1WTQA 5ELEA 1XYIA 4NMZA 5IGEA 2CW0C 2F0GA 3KLSX 5KRUA 1AP0A 1R4QB 3PSIA 1ILQA 4JBWA 3S9WA 3HOXB 3HOWH 4FVMA 4LMQD 4OHJA 3I72A 4A3FB 4RGMA 4BXXH 1BUVT 1E2WA 2PPBC 3U58A 3NTIA 1O78A 3KLWA 5IYCH 4RGOS 2OTLA 5C0XH 5C4JB 5M3MB 2B63H 4ID6A 4OGQC 1HNXL 2LS01 1PXUA 3ZYYX 2QW7A 2F0JA 5E7NA 4KHPQ 2B2UA 1K28A 2EIFA 4IOCA 2BCOA 4K2KA 1Q1EA 4HMJA 3U4VA 1H9MA 1PH4A 4H0LC 1ILPA 2F0KA 4BY1H 5K5PA 2F0UA 2B2WC 1X3GA 2N78A 1C8CA 2L11A 1DXMA 4KMUC 4PNYA 3T56B 3CKIB 1SJED 1CKOA 2Z0SA 3M4QA 3E9HA 3KF8B 1ESFA 2LXKA 3JC66 1WTOA 4UAIA 1QNKA 2D2CC 3ER0A 1XMQL 4IOAA 3A74A 1SR3A 1CI3M 3K5MA 4LUOA 4A3DG 1SYFA 1EY8A 2K03A 2EJMA 1D1IA 1F2YA 1GUSA 1QZHA 1IKMA 1MI2A 3QOLA 4B3TQ 4EQOA 4LF6L 1J6QA 3CXCA 2WAQB 3HOWG 1DZ1A 4A93H 1KIXA 1SE8A 1VQIA 1HR0W 2JN4A 4PMBA 3O13A 1YNND 1DOMA 4WORA 4HIMA 3KFUA 1B9NA 5H1SE 5IYCG 4C3IB 2KHIA 1IBLQ 2Y0SE 1H9SA 2BOSA 3URYA 4DPGA 1JB3A 1I6HB 1ENFA 1WOCA 4GLAC 2WP8J 1PYWD 3SK5A 2DUDA 5EBDA 2MO0A 1TWGH 3MEFA 1N36Q 4BY1G 2ZTDA 1UUPA 5CV5A 3S1MH 3GO5A 1PFSA 4V190 1X56A 3MEHA 2OCEA 3PF4A 2D9UA 1STBA 1PFMA 5IYBG 1BCPB 4DR1L 3QG1A 1IYUA 1BXTA 3NXWA 4GKJL 4A3BG 3CPFA 1GOZA 4XT3B 5M3FH 4FXDA 1WD1A 1L1OB 2B29A 1SNMA 1FVIA 1X3PA 2JYOA 3BDCA 4O2DA 5IT9L 5DLQE 5BN4A 1BOSA 4DV3L 2RKSA 1ASZA 3A8IE 4DR4L 1HHVA 5G3LF 3IFDA 1LLRD 2SOBA 1SFOB 3HOUH 4A93G 1SNOA 3A8KE 5LL6X 2RSOA 4LF9L 3F8TA 3GTGH 5JJLA 5LHY1 1KQSA 3N52A 1BQQT 5EKIA 2ENBA 4LJZC 2A69D 3KOJA 1S5CD 2XWBB 3MFGA 4DK3C 3RMHA 1EYDA 5HGQA 1MIUA 2HQLA 3SVMA 4FNFA 2CH4W 2FMCA 1XNRQ 2HIXA 1VQ8A 4BA2I 1X6OA 1IYJB 1STEA 2K05A 3MC0B 1V1PB 1EWHA 1RTOA 1VQ5A 1EIFA 2GVAA 5ELCA 3BVGA 1KLUD 2EVBA 2MUYA 4G7OC 1ZYRC 2HDLA 1NBWA 1S3OA 3BG3A 4FF2A 2WV6D 5BR8Q 4XYOA 1N32Q 3I73A 2K01A 1YI2A 2K5QA 1SYEA 1GUWA 1A3UA 3K6OA 4JI8L 5JEAJ 2QKIC 1K83B 1E0BA 1I4RA 2RF4A 3ZJYC 3M7NA 2MNAA 4YWKA 1E1OA 3CCQA 1KD1C 4R8IA 1LTGD 4KD3A 3IAYA 5C4ZA 4KK7A 1Y1WH 2F52A 3CW2C 4JC0A 3NBHB 1GUGA 3HOUG 2K33A 4MN3A 4RAUC 3TDQA 5JPMC 1QUQA 1YHBA 3HKZG 2RHQB 4IUNA 3TBIB 2F3IA 4H7BA 2IHFA 2B2WA 3GTOB 3FP9A 4A3JG 3RLOA 1E24A 1SROA 1T5XD 5JOBA 2F0IA 1UE5A 2H1EA 1JE4A 2UXBQ 3NQTA 4GNXC 4QL5A 3QWNA 2TMPA 1S5ED 4DAYA 2I07B 4P73A 5KNDA 2ALYB 2F3WA 2G9HD 3L2PA 4IO9A 2UU9Q 2CCZA 3HOYH 4DR2Q 2KUMA 3G7LA 2JA5G 3S2HB 2QEXA 2E2HB 4P2CB 4R4OA 1HR0Q 2LMCB 3IKJA 2AUKA 1VQDA 2YU9B 2RDFA 2Z1CA 3TS0A 3PGZA 4AQYL 2R92H 4GLXA 2EQSA 3G6EA 1A6XA 5DNFA 3CQZB 4RCNA 2R7ZH 1NCVA 4ALPA 1VQBA 5CMDA 1JT8A 3F2CA 1Y1WG 1IW7D 1JWUD 3W1GA 1H9JA 5FLXc 1Q90A 4FO2A 4A3EB 1CTMA 5C6AA 4GKKQ 1DOKA 5LMNW 2BA0A 5CC4A 2RSNA 2EYHA 3GTQB 3AMUA 5C3EB 3PUWA 1C0AA 4C2MH 4RMFA 2K32A 3P1HA 3L7ZC 4HIOA 4LFAL 4QJFA 3C46A 5IE8A 4U673 3DXJC 3HOVG 1B53A 1S40A 2FHTA 3BZKA 1M1KC 1LYLA 1LABA 3QO2A 1AFPA 4K6DA 2L55A 3S16B 4XTCS 3SDZA 4QIWB 5EQ0A 1KNEA 4N8X1 3PUXA 3HOVB 2VY3A 4NKLA 1K0RA 2UUAQ 4DUZL 4DV5Q 1MJCA 3M4OB 3R2IA 2R92G 2N8NA 1QVGA 1V43A 3NK9A 3T13A 2K4KA 4XIGS 4JI7L 4DAMA 4JK1C 4A3MH 1G91A 1OXUA 4OXPA 1STYA 2A6HD 5JJZA 2ZM6Q 5KNBA 1CKNA 1YNNC 2NVYB 3C2PA 4KTAA 4ZCKA 4OONA 2JEBI 3X3NA 4ZQ3A 3K0XA 1WVLA 3BDOA 2EDGA 2IHEA 1HRJA 2D5DA 1PZID 3A54A 3KLRA 3MXGA 5E4WC 4A75A 2CW0D 4NXNQ 1UWVA 1MKHA 3TP8A 4O1NA 4DR7L 3I3CA 3K5OA 2WB1E 1G6ZA 2VQFQ 4RWSC 3JAME 1J5EL 1M8AA 4EQPA 4JYAQ 4DK1A 4LF8Q 4WJ3M 1N33Q 3CD6A 2RA4A 5FK9C 5KGUA 1TWHH 1VQFA 2E76C 1L0WA 5IGFA 1DM0B 1Q82C 4EGVA 4PV1C 3KK7A 2J7ZA 3A8JE 5E4XA 1HNWQ 2I5LX 2ZT9C 1HQMC 2CWAA 1LTRD 1NR4A 3H6MA 1V1QA 4DK6C 4N9PA 2PO4A 5C3XA 1KXLA 2NVXB 2NYZD 3CRKC 4A3MG 3A5UA 2R93G 4DV0L 2MFIA 2O5JC 3FEWX 2UXDQ 4X3SA 4GNXA 2NN6I 4IPCA 2A69C 2E75C 2QEJC 2Z4IA 3P75A 4JI3L 2NVQB 2AQ3B 3MXPA 4DU9A 1PH3A 4BBRH 2V4DA 3J81j 1WI5A 4L63B 4RKBA 5I9OA 2R3ZA 1Y1VB 1EY6A 3PMFA 1AE2A 4WFN3 2R7FA 3JAMi 2UUCL 4TKOB 4DV6L 2GA4B 1TY0A 5IGCA 4JI5Q 4Q0FA 1G2SA 3NQIA 1VQLA 1EQQA 2AMCB 2HDMA 2PI2E 4H44C 3EBEA 3VR5A 1Z6HA 4PZ7A 4CJ0B 5C44H 3U50C 1A0IA 2NVTH 2FXQA 4CJ1B 5C0XJ 3CC4A 1D8LA 1STHA 2Q2UA 3ULJA 2SNSA 1KC8C 4IUTA 4EQ5A 2B8GA 4KN7C 1M90C 3CPWA 3V05A 1SE2A 1FJGQ 3S1RB 1EQVA 2EOTA 3C1EA 5LMNQ 4JI6Q 2J0TD 3KDFA 4L5TA 4R1JA 2XNAC 3G4SA 1EY0A 4AIMA 5BN5A 1QZGA 1KABA 3ERSX 4PG3A 2OT2A 4QF4A 1Q3LA 3OSOA 1EIGA 4GS3A 1IBML 2MGSA 4QCLA 1STGA 1GKHA 1FL0A 1K8MA 1NSNS 2NN6H 2RQXA 3N6RA 3I4NH 4EX5A 3K58A 1EYCA 4IFDI 1Y14B 5F2DA 1C48A 3HOZH 1CHPD 5I2YA 4K6LA 4P74A 4BBRG 1RD9D 3R3OA 5FLXE 3Q24A 1AZPA 2XIWA 4FXKC 4K2LA 3L9AX 4X66Q 1R9TB 4DR3L 1QNUA 5EJWA 4LF4L 4AYBG 2ZXRA 1HTPA 2F0OA 4DR6L 3P20A 1O80A 1HZ9A 5CV4A 3BYTB 4RGTA 1EOTA 1HUNA 3ITPA 4Y7NB 4DXGA 3S1QH 1E22A 1VQ9A 2Z6KC 1PYSB 1IBKL 1AW7A 3EVQA 1JWSD 4A3LH 2Q2IA 3NP8A 3RZOB 2Z9HA 2EJFC 2K5HA 3KF6A 1U4PA 1H95A 4TRDA 4LNQA 4KV6A 5L37A 4YHHL 1HNZL 3LX0A 1EU4A 2L5TA 2AQ2B 2B39A 1F77A 3HOXH 1XMOQ 4X3TA 2PQAB 1SDFA 1SRUA 4A3FH 4JV5L 1O7LA 1DCZA 1EYAA 4A3CH 2NN6G 1I94Q 4JPBW 1WTVA 3I4NG 4PZ8A 1XPOA 4LF5L 1NAPA 4IJLA 1EL0A 3HOZG 5C4JH 1YHQA 5M3MH 4LFBL 4C1NI 4K0KL 1B1ZA 4C3JG 5IWAL 2N3SA 1D6EC 2DNEA 4QGUA 3H0GB 4RA8A 1LTLA 1YJ9A 1C4QA 3K57A 1TS3A 4IURA 2CQOA 1LTSD 1WTPA 1BBUA 2KCCA 2A8VA 1CK1A 4F8MA 1PRTB 1AE3A 4C3JB 2I5HA 1QILA 3TS2A 4A3KB 2EPBA 3WDNA 1ET6A 2R6GA 5KNCA 1YJWA 4J1MA 3HEJA 1Z47A 2A1AA 1SE4A 4IPHA 2X6GA 1CM9A 3D4RA 1HPCA 4MZ9A 5AJ3Q 4A3IG 4OX9L 4A3LG 1I4HA 1V9PA 2ZTCA 3L3OC 4XXEA 5IGGA 2IWHA 3GTJB 4DV2L 1K9MC 3MA2B 5JVG3 1STAA 2ZJQA 1MSGA 2LSSA 3I70A 1ONLA 3UI2A 1PV4A 2F4VQ 1JOOA 4JI4Q 3NELA 3EROA 1YZ6A 3HOXG 3S14B 1WJJA 3TQYA 2MHVA 4A3FG 2EZVA 4CDEC 4DR5L 4A3CG 4GZYC 1TWAB 2EYLA 3H94A 1OXTA 3NWTA 4IFDG 2K52A 1ASYA 2AWOA 4ZUJA 4A3DH 3TMEA 4C3IH 5M3MG 1OXSC 1SYBA 1CQVA 3R2TA 5GROA 2EYPA 1O7IA 3STBD 1I6VC 2Q2TA 4JI2L 3QOJA 1I6HH 3IRBA 4DN4M 4JVZA 4YIJA 3ULPA 3D3RA 4RG1A 4CKBA 1SMYD 2JA8B 3LGJA 1PHJA 1IHZA 1BCPC 1CUKA 4GN4B 3CCRA 1HCZA 3D0FA 1HA5A 3OIQA 2I0QA 5FLXL 1U9RA 5BN3A 1X3EA 2NTSA 1L1OC 4HJAA 1UEBA 1SYGA 4QY7A 2VW9A 1EEID 1KTKA 4X6AH 3PO2B 3R93A 3A5ZB 1NMFA 1PMRA 2K14A 2WKDA 4OIKA 1LT5D 1TWFH 4YY3L 4LUZA 1OO9B 1XNQL 1HXYD 1F2LA 1NR2A 1RTNA 5IYBH 1Q86C 4A4IA 2WAQG 1SFOH 4A3BH 2ZTEA 1JJ2A 2N55A 4HJ8A 4B3SL 3W3AA 2E8GA
chains in the Genus database with same CATH topology
4XYQA 2ZXOA 1CA6A 2VB2X 3G6JB 3D6WA 3OWFA 3D6CA 4ILWA 4C3IG 1JC7A 3DWAA 3HZXA 2B2VC 2K1BA 4K14A 1CZWA 3S17B 4KN4C 1QJOA 4HSVA 1D1KA 1LT4D 2E74C 5I6WA 3SR1A 5ISRA 3T4AC 1MBYA 1EWCA 1I4GA 3K7AB 2ID0A 3DMUA 2KEEA 3K5LA 1GJXA 5C5LA 1ML0D 1PFBA 5EPLA 1Y8NB 3A7AB 5CV6A 2F0FA 4KJOA 3J7AV 3NPPA 4ZYSA 5A35A 1A3TA 5M5XB 3GTMB 1D5XC 2SNMA 4BS9A 1IL8A 3ND8A 4KY7A 3SK6A 2FJ2A 1F9RA 1KDAA 4HCEA 1RF2D 4HCSA 5JAVA 2Y0SB 1SYCA 3KF8A 2JA7B 2Z4HA 3OOCA 2B63B 4C56C 4ZRZA 2K7VA 4J8QA 3CHBD 2F0DA 1CFMA 4QB4A 1FNWA 4RHSA 5ELFA 4ZK9B 2F0VA 3A56A 3H09A 3NWSA 1VMPA 3OIPA 1GUNA 2X69A 3QB3A 2F0QA 1TS4A 3LWEA 4TQUS 3NBIA 1TQOA 1PTOB 1CA5A 3PUVA 2F03A 1RKNA 1D5MC 4RKLA 1SNCA 4HMIA 4IUVA 1LTAD 2KJXA 3DEPA 1W6KA 4XDXA 3DWPA 1HA6A 4IALA 4NW2A 2F0TA 5KYLA 5D3IB 3A7LA 2L9HA 3HP3A 1STNA 1TWCB 2E2DC 2F4IA 1PRTD 3T16A 4I65A 4V0BA 1MSHA 2PZTA 5DAUA 3S1MB 4EQNA 3VYTA 1WCMB 3SEBA 2F0LA 1QOHA 5AFWA 5M3FB 4K8JA 3VA7A 4RGNA 2F3VA 2B2VA 1V1PA 1BBXC 4ZKCB 1SJHD 2OF1A 2FINB 5IOCA 1QG7A 1BNZA 3V2TA 5CV9A 1I4QA 4KKUA 3S15B 1F2MA 4FP5D 4BY7B 3FMCA 3WOEA 2K5DA 1HFNA 1TIID 5C4XB 1SMYC 2E2IB 5FO9B 3LWUA 3I4MB 2HCIA 5IODA 3BDLA 2IPKD 1GUTA 3NBHA 2NZ1D 3MHBA 1LACA 1EY9A 1EEFD 2K6AA 4H13C 2BDOA 3MFYA 3KLSA 1GHKA 3QJYA 2TSSA 1OXVA 2AWNA 5I4DA 1HTLD 1LT6D 3ND9A 2F0SA 2A74C 4CKEA 3C3LA 1FNUA 1EY5A 4BBSB 3P7JA 3KBXA 4ODGA 4DAPA 3BS1A 2JA6B 4R8NA 2BDNA 5E1FA 3U9SA 3M85A 1LTID 4PQXA 4KD4A 1K8OA 1B44D 3SHLA 1A2TA 2N88A 3M7GA 4XQNA 2NUCA 4DNRB 3V96A 1ENCA 1KLGD 2AQ1B 1X3QA 2NTTA 4IFDJ 4K5WA 2AUJD 1QB5D 2OEOA 2WINB 3OHXC 1JWMD 2XSCA 5A2QE 1CZGA 1ESRA 3HOYB 1WTXA 3GV6A 1DOLA 4RFBA 1OXXK 3VR6A 3VR2A 5J22A 4ZUIA 1HUMA 1EQTA 1DJRD 2R7ZB 1SNDA 1BCPD 4S3SA 2Z8LA 2BA1A 5I6YA 1Q1BA 4IUPA 4ZLTF 3K0YA 2JP1A 1H9RA 2PYKA 4CBVA 4IUUA 1PLFA 2WB1B 3BVMA 3J7AF 1VMCA 4L6TB 1G2TA 1I50B 3HRZC 4WRDA 3MVVA 3VYUA 2A6ED 3GQBA 3DUZA 2C5CA 1PZJD 1PTOD 1Q12A 3CRLC 4A3GB 3Q22A 3PO3B 2EJGC 3KUPA 3D4DA 2M9VA 4DK0A 1II3A 2FFKB 3WOFA 1MD2D 3SE0A 2EYJA 2J4XA 1I3QB 1NUCA 2LFNA 2A68D 1FD7D 2IX3A 1WTRA 2EYOA 3FKIB 5CYUA 1FR3A 2SDFA 3OMGA 3NTKA 3GP7A 1CQFA 1TKWB 1PRTC 2I46A 4FXGC 4MIUA 1QE6A 3K5NA 5EGTA 2F0WA 2FMMA 1ZEQX 2O4XA 1J8IA 4ME5A 1J9OA 5CORA 5M9OA 3J81E 4R9WA 4DXFA 1WTWA 3M4YA 1U4LA 3J7YW 1W6JA 1EZ6A 5A2QL 1SNPA 3DEOA 3S1NB 2EY5A 3E5SA 1YNJD 2EY2A 2IL8A 4KKTA 1XWEA 4G7HC 1UEAB 3R8BA 1HQRD 2IX0A 1RODA 4CKCA 1FNVA 4RCOA 4ULLA 1ENAA 4DNTB 3QIAA 1E2VA 5EKKA 2KA7A 2K5WA 3I4LA 4IFDH 1A15A 1G291 2RDHA 2EY1A 4B9WA 3A55A 3OWEB 5CR3A 3EQLC 2MPMA 4E6IA 3CU7A 3J80E 2F0MA 2PCFB 1D5ZC 1BCPF 2Q8IB 1I4XA 3EA6A 2D62A 1FYCA 2SEBD 1BR9A 1DYQA 1R4PB 2KOLA 1LTBD 5D14A 1SAPA 4NDXA 5G3LD 2G9DA 5T1IA 4X3UA 3VR3A 1PFNA 1BF4A 4IZ8A 1B2TA 2ICIA 3SXHA 2BE5D 1B4OA 4C3HB 5CBAE 4MHEA 5C5MA 2VXWA 3H91A 2KCNA 1I4PA 1JOKA 4PMCA 2RVLA 4QUCA 1WD0A 4KI0A 4Q5VA 2VUMB 1L0YB 1B9MA 3GD7A 3TP5A 4KHZA 1ICWA 3HGBA 3MZ5A 3IL8A 4CHTB 5EKLA 3DWQA 4L8JA 2JEAI 1JCKB 1D2BA 1H9SB 5ELBA 3S2DB 3J81L 5I9PA 1Q8IA 1RJTA 4OL7A 4PMWA 4CGYB 5DM73 2JXMB 1EY4A 1S5FD 3TN2A 2XRSD 2YYZA 2A6EC 1AN8A 3I8ZA 3T51B 4XQJA 4J6HA 3GTLB 1E2ZA 2DY8A 1V1OA 1PTOC 3KBGA 3DHQA 2DN8A 2PNRC 1ZKOA 3MWYW 2PZWA 4Z9CB 1PTOH 3VYRA 4K8IA 3HS0C 1O7YA 5IGDA 2C9OA 3NUCA 2ZXPA 2Q8RE 2A68C 2L12A 2F0NA 3RUZA 4FF3A 3BZDB 4A3DB 3J80L 5C0XG 4OO1I 2RDGA 1AEXA 3MXUA 5KIXA 3HOWB 2HCCA 2PZUA 2XVSA 3TZDA 4KY5A 4F88A 1VF5C 4I7ZC 2H4OA 1UNSA 1B3AA 2EE1A 1SE3A 2IW3A 2QF7A 5CV8A 3Q23A 1FGBD 1RCVD 4BY1B 4QMGA 1TWFB 1O7ZA 1XTCD 1KAAA 3LNNA 1YNJC 2QDBA 4FF4A 1Y8PB 4A3BB 4FF1A 3D4WA 5LL6S 2F0PA 5HGTA 1SNQA 4OO1H 1XXGA 2O5IC 2NBFA 4A93B 4UDUC 5C3WA 1F2ZA 2HUGA 3H3VC 5E3FA 4KHVA 1TT2A 3GTPB 1DD2A 2L1BA 2CQAA 5ELDA 1KDCA 3GV3A 3NSWA 2M2LA 1MGSA 1RHPA 3RD4A 3K59A 2PW5A 3PV0A 2Q8TA 1TWGB 4HAEA 1Y69U 1VDZA 2PQEA 3FPUB 3T53B 3IFTA 2K04A 2VB3X 2CHBD 1LV9A 1S5DD 3D8GA 2B2TC 5FO8B 1PZKD 1RDPD 4OO1G 5CV7A 1CT1D 4WJWA 1S5BD 4K5VA 2BE5C 4IN3A 3RZDB 1A2UA 3HOUB 5J39A 1B50A 2MP1A 3HKZB 1TS2A 3GTGB 3X3MA 2MJ8A 5IGBA 4O42A 4A3JB 3SK4A 4DFAA 5C4HA 1F9QA 1XX8A 3EJIA 3I91A 4FYDA 4RHRA 3OPOA 1LO5D 4LK1C 5D65A 1JR0D 4G57A 1KNAA 4QUFA 4KJNA 1KDBA 2XRQD 1U4RA 2KHSA 2QCPX 1GUOA 2B2YC 2JA5B 4IQZA 4B9XA 4B08A 2OXPA 1HFGA 3TZUA 5KYIA 2EYMA 1A3VA 1EU3A 1VCIA 1Y1WB 5NUCA 5EPKA 5JVH3 2O2LD 3VR4A 3TP7A 2EYFA 2IX1A 4ZAIA 1SBBB 3AB9A 5FO7B 4ZKBB 3AU7A 5EBCA 2ICEC 1CHQD 5HURA 1TS5A 2A73B 3FDTA 2M00A 2LY7A 2R61A 5DM63 2KEDA 4G7ZC 1F9SA 4IUQA 1SYDA 1EIHA 5I2XA 2R92B 3OW7A 4ABNA 2F1MA 1F9PA 4U68A 4DA2A 1VF7A 2F0HA 2E2JB 4DF7A 1EY7A 3BVZA 3PIO3 3VA5A 3TP6A 3PIP3 1G8ZD 1QWYA 4C2MB 4LAAA 1PRTF 3NHHA 4KY6A 4CJ2C 1U4MA 5JEAH 1LTTD 5K36H 3I90A 2B2TA 4KKSA 1T5EA 4TSSA 2EY6A 3FRPB 1SXTA 5EPJA 3U9OA 3MTSA 5M5YB 1L0XB 4BA1I 2L0CA 3FVQA 4XT1B 4HSPA 5COYA 4A3MB 2RBMA 3NTHA 2R93B 4K5XA 1UAPA 2F0EA 1SSOA 1QCBD 1BO0A 2B2YA 3TSSA 1PDQA 5J1ZA 3OMCA 2WIIB 3FPPA 4RH6A 2HQEA 5JEAG 3Q0AA 2JSOA 2KECA 5K36G 2VNUD 1JORA 3F2UA 2DNCA 3E0JA 4EVOA 1S4ZA 2QILA 4HN7A 1TWHB 1TVXA 2B2UC 2WACA 5IIFA 3MXNA 4F7XA 2XN9C 3MAQA 2PW7A 3E6ZX 4M1UB 4BWGB 4HTHA 1TU2B 4F87A 3NE5B 2K28A 1GHJA 1ZXTA 1EZ8A 4BBRB 5TSSA 3HG9A 5FKAC 3GTKB 1JOQA 1AZQA 4AYBB 5CGKA 2B8FA 2X6LA 5M5WB 5KEEA 3PUYA 5C44B 4HEDA 2NVTB 2PMZB 5CBEE 1ZYRD 2KVMA 1IW7C 5FOBB 3JAML 1Z7TA 2NB0A 4M8AA 1DONA 5D3DA 2IT1A 1Y8OB 5JPNC 3ONAB 1LT3D 2WKCA 2XWJB 1M4VA 4C1NK 1ET9A 4DAVA 3ERQA 3SK8A 1V8QA 4NP5A 3M3YB 3BYYB 4N9TA 2JE6I 4C3HG 1X32A 3I4NB 3DM1A 3C1FA 3HOZB 5C0XI 1SEBD 1H9KA 1IYVA 1TY2A 1EFID 1JICA 5T1GA 1JQYD 3W2DA 2CVRA 4HR7B 2A5HA 4G4KA 1TR5A 3Q6SA 3PUZA 5DEHA 3EFXD 5IT9E 2NWGA 1GXDC 1IKLA 4OIJA 3RLFA 3VYSA 1PTOF 2A6HC 2KQ3A 3S1QB 4XQQA 4X3KA 1BDOA 2IJ0A 2DY7A 3D31A 2EXZA 4DGZA 2LKVA 4A3IB 2L4NA 1WTQA 5ELEA 1XYIA 4NMZA 5IGEA 2CW0C 2F0GA 3KLSX 5KRUA 1AP0A 1R4QB 1ILQA 4JBWA 3S9WA 3HOXB 4FVMA 4LMQD 4OHJA 3I72A 4A3FB 4RGMA 1BUVT 1E2WA 2PPBC 3NTIA 1O78A 4RGOS 5C0XH 5C4JB 5M3MB 4ID6A 4OGQC 2LS01 1PXUA 3ZYYX 2F0JA 2B2UA 2BCOA 4K2KA 1Q1EA 4HMJA 1H9MA 4H0LC 1ILPA 2F0KA 5K5PA 2F0UA 2B2WC 1C8CA 2L11A 4PNYA 3T56B 1DXMA 4KMUC 3CKIB 1SJED 1ESFA 1WTOA 4UAIA 1QNKA 2D2CC 1CI3M 3K5MA 1SYFA 1EY8A 2K03A 2EJMA 1D1IA 1F2YA 1GUSA 1IKMA 1MI2A 3QOLA 4EQOA 1DZ1A 2WAQB 4PMBA 3O13A 1YNND 1DOMA 4WORA 1B9NA 4C3IB 1H9SA 2BOSA 3URYA 1JB3A 1I6HB 1ENFA 2WP8J 1PYWD 3SK5A 5EBDA 1UUPA 5CV5A 3GO5A 4V190 3MEHA 2D9UA 1STBA 1PFMA 1BCPB 3QG1A 1IYUA 1BXTA 3NXWA 1GOZA 4XT3B 4FXDA 1WD1A 1SNMA 1X3PA 2JYOA 3BDCA 5IT9L 5BN4A 1BOSA 2RKSA 3A8IE 1HHVA 5G3LF 3IFDA 1LLRD 2SOBA 1SFOB 1SNOA 3A8KE 5LL6X 2RSOA 5LHY1 3N52A 1BQQT 5EKIA 2ENBA 4LJZC 2A69D 1S5CD 2XWBB 3MFGA 3RMHA 1EYDA 3SVMA 4FNFA 2FMCA 4BA2I 1STEA 2K05A 3MC0B 1V1PB 1EWHA 1RTOA 5ELCA 3BVGA 1KLUD 2EVBA 2MUYA 4G7OC 1ZYRC 2HDLA 3BG3A 4FF2A 2WV6D 4XYOA 3I73A 2K01A 2K5QA 1SYEA 1GUWA 1A3UA 3K6OA 5JEAJ 2QKIC 1K83B 1E0BA 1I4RA 3M7NA 4R8IA 1LTGD 4KD3A 3IAYA 5C4ZA 4KK7A 1GUGA 2K33A 4MN3A 4RAUC 3TDQA 5JPMC 4IUNA 3TBIB 4H7BA 2B2WA 3GTOB 1T5XD 5JOBA 2F0IA 2H1EA 1JE4A 3NQTA 3QWNA 2TMPA 1S5ED 4DAYA 2I07B 5KNDA 2F3WA 2G9HD 2KUMA 3G7LA 3S2HB 2E2HB 4P2CB 2LMCB 3IKJA 2AUKA 2YU9B 2RDFA 2Z1CA 1A6XA 5DNFA 3CQZB 4RCNA 1NCVA 5CMDA 1IW7D 1JWUD 1H9JA 1Q90A 4FO2A 4A3EB 1CTMA 5C6AA 1DOKA 2BA0A 5CC4A 2RSNA 2EYHA 3GTQB 3AMUA 5C3EB 3PUWA 2K32A 3P1HA 3L7ZC 3C46A 4U673 3DXJC 1B53A 2FHTA 1LABA 3QO2A 1AFPA 4K6DA 2L55A 3S16B 4XTCS 3SDZA 4QIWB 5EQ0A 1KNEA 3PUXA 3HOVB 4NKLA 3M4OB 3R2IA 1V43A 3NK9A 3T13A 4XIGS 4JK1C 1G91A 1OXUA 1STYA 2A6HD 5JJZA 5KNBA 1YNNC 2NVYB 3C2PA 4KTAA 2JEBI 3X3NA 4ZQ3A 1WVLA 3BDOA 2EDGA 1HRJA 2D5DA 1PZID 3A54A 3KLRA 3MXGA 5E4WC 2CW0D 3TP8A 4O1NA 3I3CA 3K5OA 1G6ZA 4RWSC 3JAME 1M8AA 4EQPA 4DK1A 2RA4A 5FK9C 5KGUA 2E76C 5IGFA 1DM0B 4EGVA 4PV1C 3KK7A 2J7ZA 3A8JE 5E4XA 2ZT9C 1HQMC 1LTRD 1NR4A 3H6MA 5C3XA 4N9PA 2PO4A 2NVXB 2NYZD 3CRKC 2O5JC 3FEWX 4X3SA 2NN6I 2A69C 2E75C 2QEJC 2Z4IA 3P75A 2NVQB 2AQ3B 3MXPA 4DU9A 2V4DA 4L63B 4RKBA 5I9OA 2R3ZA 1Y1VB 1EY6A 3PMFA 4WFN3 4TKOB 2GA4B 1TY0A 5IGCA 4Q0FA 1G2SA 3NQIA 2HDMA 4H44C 3VR5A 1Z6HA 4CJ0B 4CJ1B 5C0XJ 1STHA 2SNSA 4IUTA 2B8GA 4KN7C 3V05A 1SE2A 3S1RB 1EQVA 2EOTA 3C1EA 2J0TD 2XNAC 1EY0A 5BN5A 1KABA 2OT2A 4QF4A 1Q3LA 3OSOA 1EIGA 2MGSA 4QCLA 1STGA 1K8MA 1NSNS 2NN6H 2RQXA 3N6RA 3K58A 1EYCA 4IFDI 5F2DA 1C48A 1CHPD 5I2YA 4K6LA 1RD9D 3R3OA 5FLXE 3Q24A 1AZPA 2XIWA 4FXKC 4K2LA 3L9AX 1R9TB 1QNUA 5EJWA 2ZXRA 1HTPA 2F0OA 3P20A 1O80A 5CV4A 3BYTB 4RGTA 1EOTA 1HUNA 3ITPA 4Y7NB 4DXGA 1AW7A 3EVQA 1JWSD 3RZOB 3NP8A 2EJFC 1U4PA 4TRDA 4KV6A 3LX0A 1EU4A 2L5TA 2AQ2B 2B39A 1F77A 4X3TA 1SDFA 1DCZA 1O7LA 1EYAA 2NN6G 1WTVA 1NAPA 1EL0A 4C1NI 1B1ZA 4C3JG 1D6EC 2DNEA 3H0GB 4RA8A 1C4QA 3K57A 1TS3A 4IURA 1LTSD 1WTPA 2KCCA 1CK1A 4F8MA 1PRTB 4C3JB 1QILA 4A3KB 2EPBA 3WDNA 1ET6A 2R6GA 5KNCA 4J1MA 1Z47A 3HEJA 1SE4A 2X6GA 1CM9A 3D4RA 1HPCA 1I4HA 3L3OC 4XXEA 5IGGA 2IWHA 3GTJB 3MA2B 5JVG3 1STAA 1MSGA 3I70A 1ONLA 3UI2A 1JOOA 3EROA 3S14B 2MHVA 2EZVA 4GZYC 1TWAB 2EYLA 3H94A 1OXTA 3NWTA 4IFDG 2AWOA 4ZUJA 3TMEA 1OXSC 1SYBA 1CQVA 3R2TA 2EYPA 1I6VC 3QOJA 4DN4M 4YIJA 3D3RA 4CKBA 1SMYD 2JA8B 1IHZA 1BCPC 1HCZA 1HA5A 3OIQA 5FLXL 1U9RA 5BN3A 2NTSA 1SYGA 1EEID 1KTKA 3PO2B 3R93A 1PMRA 2WKDA 4OIKA 1LT5D 1OO9B 1HXYD 1F2LA 1NR2A 1RTNA 2N55A 3W3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K33 A;  4G7H C;  3HGB A;  2BDO A;  2B8G A;  4KN7 C;  3MFY A;  1H9S A;  1GHK A;  1V43 A;  4KKT A;  3RLF A;  3QJY A;  2A6H C;  2KCC A;  4XIG S;  2A6E D;  3GQB A;  4L8J A;  4JK1 C;  2JEA I;  1OXV A;  1OXU A;  1BDO A;  4DNT B;  3QIA A;  2A6H D;  1H9S B;  3OPO A;  1E2V A;  3D31 A;  2KA7 A;  4LK1 C;  5KNB A;  3I4L A;  1YNN C;  3LNN A;  3ND9 A;  3WDN A;  4IFD H;  4KN4 C;  1G29 1;  1QJO A;  2R6G A;  1YNJ C;  5KNC A;  1Q12 A;  5BN5 A;  1Y8P B;  2E74 C;  2JEB I;  3CRL C;  1TU2 B;  2JXM B;  3BDO A;  3NE5 B;  2EDG A;  3D4R A;  1GUO A;  1HPC A;  2D5D A;  2EJG C;  2CW0 C;  3QG1 A;  1IYU A;  3EQL C;  5JEA H;  1GHJ A;  3A7L A;  3PUZ A;  3KLR A;  4DK0 A;  5K36 H;  2YYZ A;  4OO1 H;  2A6E C;  4JBW A;  5KND A;  1K8M A;  2NN6 H;  4IQZ A;  3N6R A;  3M85 A;  3U9S A;  4KKS A;  1GJX A;  3T51 B;  2O5I C;  1K8O A;  3I72 A;  3SE0 A;  3TZU A;  1E2Z A;  1T5E A;  2PCF B;  1ONL A;  2Q8I B;  1E2W A;  5BN4 A;  2PPB C;  2B8F A;  1O78 A;  2A68 D;  4DNR B;  1Y8N B;  5C0X H;  2DN8 A;  3A8I E;  3A7A B;  2LMC B;  2PNR C;  3IKJ A;  2AUK A;  3PUY A;  4OGQ C;  1FR3 A;  1ZKO A;  4GZY C;  2D62 A;  1FYC A;  4DK1 A;  5A35 A;  3H94 A;  1OXT A;  4IFD G;  1VCI A;  4OO1 G;  2AUJ D;  1DD2 A;  1HTP A;  2AWO A;  3A8K E;  3ND8 A;  1A6X A;  1OXS C;  3P20 A;  4RCN A;  1IW7 C;  4BA1 I;  2E76 C;  1Z7T A;  1TKW B;  1Q1E A;  4LJZ C;  3VA7 A;  3VR4 A;  2A69 D;  4PV1 C;  1H9M A;  1I6V C;  1IW7 D;  4H0L C;  3A8J E;  1H9J A;  1Q90 A;  2IT1 A;  2ZT9 C;  3VR3 A;  1Y8O B;  1HQM C;  2A68 C;  3PV0 A;  1CTM A;  3OOC A;  2BA0 A;  1Y69 U;  4BA2 I;  3CRK C;  1DXM A;  1OXX K;  1VDZ A;  4KMU C;  3T56 B;  3VR2 A;  3VR6 A;  3AB9 A;  3T53 B;  3PUW A;  3IFT A;  1EWH A;  2BE5 D;  2O5J C;  2EJF C;  2K7V A;  2EVB A;  5C0X G;  1V8Q A;  4G7O C;  1ZYR C;  2K32 A;  1HCZ A;  2D2C C;  3BG3 A;  3L7Z C;  2NN6 I;  1CFM A;  1CI3 M;  3MXU A;  2BA1 A;  3I73 A;  2A69 C;  2E75 C;  4KKU A;  2L5T A;  5BN3 A;  3DXJ C;  2JE6 I;  1Q1B A;  3FMC A;  2EJM A;  3FPP A;  2V4D A;  3M4Y A;  1GUS A;  5JEA G;  1H9R A;  5K36 G;  1H9K A;  1DCZ A;  1O7L A;  1SMY C;  4KI0 A;  4TKO B;  1PMR A;  2NN6 G;  4G7Z C;  1GUN A;  1LAB A;  3M7N A;  3LWU A;  1VF5 C;  4I7Z C;  2BE5 C;  4XTC S;  3SDZ A;  1GUT A;  1B9M A;  4H44 C;  1IYV A;  2DNC A;  3VR5 A;  1Z6H A;  3GD7 A;  4HR7 B;  4TQU S;  3OW7 A;  1LAC A;  1B9N A;  3PUX A;  2DNE A;  4KHZ A;  2F1M A;  3PUV A;  1VF7 A;  3W3A A;  1GUG A;  4H13 C;  2QF7 A; 
#chains in the Genus database with same CATH topology
 4XYQ A;  2ZXO A;  1YJN A;  1PH5 A;  1CA6 A;  1MHW C;  2VB2 X;  3G6J B;  3D6W A;  3OWF A;  3D6C A;  4ILW A;  1IZ6 A;  1WTH A;  4C3I G;  1W3S A;  1JC7 A;  3DWA A;  2Z6K A;  3HZX A;  2B2V C;  3CCV A;  2K1B A;  4K14 A;  1CZW A;  4R4I A;  3S17 B;  3UE1 A;  4KN4 C;  1QJO A;  4HSV A;  1D1K A;  1QVC A;  1LT4 D;  2E74 C;  3S24 A;  3SR1 A;  5I6W A;  5ISR A;  3T4A C;  1MBY A;  1EWC A;  1I4G A;  3K7A B;  2ID0 A;  3DMU A;  3GTP H;  4OWT B;  2KEE A;  3K5L A;  3HKS A;  1GJX A;  5C5L A;  1B8A A;  3BU2 A;  1ML0 D;  1PFB A;  4DV7 L;  1K83 H;  4HJ7 A;  5EPL A;  1Y8N B;  3A7A B;  5CV6 A;  2F0F A;  4KJO A;  3J7A V;  3NPP A;  4ZYS A;  4KLK A;  5A35 A;  1A3T A;  5M5X B;  2ATW A;  3GTM B;  1D5X C;  2SNM A;  4BS9 A;  1IL8 A;  4B3M L;  2HIV A;  3ND8 A;  4KY7 A;  3SK6 A;  1NNX A;  2FJ2 A;  1F9R A;  1KDA A;  3J7Z C;  4HCE A;  1RF2 D;  4HCS A;  5JAV A;  2Y0S B;  3F2B A;  4DR1 Q;  1EIY B;  1SYC A;  1VQJ A;  4JBK A;  4GKJ Q;  3KF8 A;  2JA7 B;  2Z4H A;  3OOC A;  2B63 B;  1EYG A;  4C56 C;  4ZRZ A;  2K7V A;  3RZD H;  4DV3 Q;  4J8Q A;  3CHB D;  2OQK A;  2F0D A;  4DR4 Q;  1CFM A;  1N8R C;  4QB4 A;  1FNW A;  1JE5 A;  4RHS A;  4A3J H;  4LF9 Q;  5ELF A;  4ZK9 B;  2F0V A;  3A56 A;  3H09 A;  3NWS A;  1VMP A;  3OIP A;  1GUN A;  2X69 A;  3S2H H;  3QB3 A;  3K8A A;  2E2H H;  2F0Q A;  1TS4 A;  2GN5 A;  3LWE A;  4X65 Q;  4TQU S;  1SLJ A;  1TQO A;  3NBI A;  1PTO B;  1GM5 A;  1CA5 A;  2YU9 H;  4JI1 Q;  1EUJ A;  3PUV A;  4OEM B;  4UPA A;  1RKN A;  4YCV A;  2F03 A;  1D5M C;  3UDX A;  4RKL A;  3CQZ H;  1SNC A;  3GDE A;  4HMI A;  4UP7 A;  4LF7 L;  4IUV A;  2JA5 H;  1LTA D;  2KJX A;  3DEP A;  2JJQ A;  4A3E H;  1W6K A;  4XDX A;  3DWP A;  1N32 L;  3GTQ H;  1HA6 A;  1PYB A;  4P72 A;  1X55 A;  4IAL A;  2VQE Q;  1NTG A;  4NW2 A;  2F0T A;  5KYL A;  1L1O A;  5LMU Q;  5D3I B;  1WCM G;  3A7L A;  4MNO A;  2L9H A;  3HP3 A;  3RN5 A;  1A63 A;  1STN A;  1SN8 A;  1TWC B;  2E2D C;  2F4I A;  1PRT D;  3T16 A;  4I65 A;  4V0B A;  2DJF C;  1MSH A;  1HJP A;  2PZT A;  5DAU A;  3S1M B;  4EQN A;  3S16 H;  3VYT A;  1E1T A;  1WCM B;  3SEB A;  2F0L A;  5ELN A;  1QOH A;  3HOV H;  5AFW A;  5GAH C;  4UHV A;  3M4O H;  3AFQ A;  5M3F B;  4K8J A;  2HHH L;  3CCS A;  3VA7 A;  1T9H A;  4RGN A;  4LFC Q;  2F3V A;  2B2V A;  1V1P A;  1BBX C;  4ZKC B;  1SJH D;  2OF1 A;  2FIN B;  2NVY H;  5IOC A;  1QG7 A;  4A3E G;  1BNZ A;  3V2T A;  5C3E G;  5CV9 A;  1I4Q A;  3STB C;  4KKU A;  3S15 B;  2E2J H;  1F2M A;  5ELO A;  4FP5 D;  1VQ4 A;  4BY7 B;  3FMC A;  3WOE A;  2RCN A;  1NE3 A;  2K5D A;  1HFN A;  1TII D;  2RCF A;  5C4X B;  1SMY C;  2E2I B;  5FO9 B;  3LWU A;  3I4M B;  2CH4 A;  1A8V A;  2HCI A;  5IOD A;  3BDL A;  2IPK D;  1GUT A;  3NBH A;  2NZ1 D;  3CCM A;  4CDD C;  3MHB A;  3J81 c;  1LAC A;  1EY9 A;  1WYD A;  1EEF D;  2K6A A;  2OQ0 A;  4H13 C;  3K81 C;  2BDO A;  3MFY A;  3KLS A;  1GHK A;  4YCW A;  2KHJ A;  1ICF B;  2TSS A;  3QJY A;  4BBS G;  1KRT A;  1OXV A;  2AWN A;  2BH8 A;  3T1H Q;  4JI0 Q;  5I4D A;  1HTL D;  1LT6 D;  3ND9 A;  2F0S A;  2A74 C;  4CKE A;  1HH2 P;  2NZO A;  3U4Z A;  4B3R Q;  3C3L A;  1FNU A;  4X64 Q;  3RLN A;  1EY5 A;  4BBS B;  3P7J A;  2Z6B A;  3KBX A;  5M5Y H;  4ODG A;  4DAP A;  3BS1 A;  2JA6 B;  4R8N A;  2NVQ H;  4DUZ Q;  2BDN A;  5E1F A;  3U9S A;  3M85 A;  1LTI D;  4PQX A;  1OTC A;  4KD4 A;  1K8O A;  1YIT A;  1GVP A;  1Y1V H;  1B44 D;  3SHL A;  2R93 H;  3K80 C;  1A2T A;  2N88 A;  3M7G A;  4XQN A;  5IP7 H;  2EXD A;  2NUC A;  4DNR B;  3V96 A;  4JI7 Q;  1ENC A;  1KLG D;  2AQ1 B;  1X3Q A;  1K73 C;  2NTT A;  4IFD J;  4K5W A;  2AUJ D;  1QB5 D;  5GQO A;  3TRE A;  2K50 A;  2OEO A;  2WIN B;  3OHX C;  3J80 c;  1JWM D;  2XSC A;  5A2Q E;  1CZG A;  1XJV A;  1ESR A;  3HOY B;  1WTX A;  4DUY Q;  3J7A 5;  3GV6 A;  3S1R H;  1DOL A;  4RFB A;  4GOP B;  1OXX K;  3L0O A;  3VR2 A;  3VR6 A;  5J22 A;  4ZUI A;  1HUM A;  5JJK A;  1EQT A;  1DJR D;  1G51 A;  2R7Z B;  1SND A;  1BCP D;  2VS1 A;  1I5F A;  4S3S A;  1J5E Q;  2Z8L A;  2BA1 A;  5I6Y A;  3CAM A;  4HJ5 A;  1Q1B A;  4IUP A;  3NEM A;  4ZLT F;  1RIP A;  3K0Y A;  2CFM A;  2JP1 A;  1H9R A;  2PYK A;  4JYA L;  1JMC A;  4LF8 L;  1N33 L;  4CBV A;  4IUU A;  1PLF A;  1BKB A;  1Y1V G;  2WB1 B;  3BVM A;  1VQM A;  1R9T H;  3RNU A;  5IP7 G;  3J7A F;  1A62 A;  1VMC A;  2PNH A;  4L6T B;  1G2T A;  4DV0 Q;  1I50 B;  1VQG A;  3HRZ C;  4WRD A;  1IL2 A;  4OEL B;  4YWM A;  3MVV A;  3AYH B;  2MQH A;  3VYU A;  1LM0 A;  2A6E D;  3GQB A;  1X65 A;  3DUZ A;  2IY5 B;  3KYH C;  4JI3 Q;  3UDF A;  3GTK H;  2P5Z X;  3HFZ B;  2C5C A;  1PZJ D;  1VQC A;  3MXN B;  2UUC Q;  1PTO D;  5M5W H;  1Q12 A;  3RZO H;  5IP9 G;  3CRL C;  4A3G B;  3Q22 A;  2UXC Q;  3PO3 B;  4N8F A;  2EJG C;  3KUP A;  3D4D A;  2M9V A;  2AHO B;  4DK0 A;  1B70 B;  3OTO L;  4MTK A;  1II3 A;  2FFK B;  3WOF A;  1MD2 D;  3SE0 A;  2EYJ A;  2J4X A;  1I3Q B;  1EFW A;  2HT1 A;  3CC7 A;  1NUC A;  1VQE A;  2LFN A;  4LWC A;  5J3B A;  2A68 D;  1FD7 D;  2IX3 A;  1WTR A;  2EYO A;  3FKI B;  5CYU A;  1FR3 A;  2ZJP A;  2SDF A;  3OMG A;  3NTK A;  4R4C A;  4L5R C;  4OWW B;  1X3F A;  3GP7 A;  1CQF A;  3M3Y H;  1TKW B;  4JI6 L;  1PRT C;  2I46 A;  1IXR A;  4FXG C;  1Q46 A;  4X62 L;  3B6Y A;  1YEZ A;  2K5V A;  4MIU A;  1QE6 A;  3K5N A;  1PH7 A;  5EGT A;  1IBM Q;  2UUB L;  1C9O A;  2F0W A;  2FMM A;  4C3J H;  1ZEQ X;  2O4X A;  2VZA A;  1J8I A;  4ME5 A;  1J9O A;  2D0O A;  2E5L L;  5COR A;  5M9O A;  4DR3 Q;  4LF4 Q;  3J81 E;  4POF A;  4R9W A;  4DXF A;  1WTW A;  3GTJ H;  4DR6 Q;  3M4Y A;  1U4L A;  4AYB E;  3J7Y W;  4DV1 L;  1W6J A;  1EZ6 A;  3S14 H;  5A2Q L;  1SNP A;  1VQK A;  1WFQ A;  2PMZ E;  3DEO A;  3S1N B;  4A3I H;  2EY5 A;  2LXJ A;  3E5S A;  4DV4 L;  1YNJ D;  1TWA H;  1K8A C;  1IBK Q;  2EY2 A;  2IL8 A;  4KKT A;  1XWE A;  4G7H C;  1UEA B;  3R8B A;  3H0G G;  1HNZ Q;  1HQR D;  2IX0 A;  1ROD A;  4CKC A;  1FNV A;  5FLM H;  1YHA A;  4RCO A;  4ULL A;  1ENA A;  4DNT B;  3QIA A;  1E2V A;  5EKK A;  2KA7 A;  2K5W A;  3I4L A;  4NXM L;  4IFD H;  1A15 A;  1G29 1;  2JA8 H;  4JV5 Q;  2RDH A;  4LF5 Q;  2EY1 A;  4A3K G;  4B9W A;  3A55 A;  1UE6 A;  3OWE B;  4H02 A;  5CR3 A;  3EQL C;  4K0K Q;  5IWA Q;  2MPM A;  3M9B A;  4POG A;  3OW2 A;  4E6I A;  3CU7 A;  3J80 E;  2F0M A;  2PCF B;  1D5Z C;  1BCP F;  2ZJR A;  2Q8I B;  3RN2 A;  3PO2 H;  1I4X A;  2B3G A;  3EA6 A;  3PCO B;  4R4T A;  2D62 A;  1FYC A;  2SEB D;  1BR9 A;  1DYQ A;  1R4P B;  3FHW A;  2KOL A;  1LTB D;  5D14 A;  1SAP A;  1QVF A;  4NDX A;  5G3L D;  1N34 L;  2G9D A;  1Q7Y C;  4OX9 Q;  2C35 B;  5T1I A;  4GN5 A;  4X3U A;  3VR3 A;  3CMA A;  1PFN A;  4DV2 Q;  1YNX A;  1BF4 A;  4IZ8 A;  1YVC A;  1B2T A;  5AJ3 L;  2ICI A;  3DM3 A;  5FLM G;  3S17 H;  3PIO A;  3SXH A;  2BE5 D;  1B4O A;  4C3H B;  5CBA E;  3PIP A;  4MHE A;  5C5M A;  3UDI A;  2VXW A;  2JA8 G;  3H91 A;  2KCN A;  3I7F A;  4DR5 Q;  2PQA A;  1XPU A;  1I4P A;  2JA9 A;  1JOK A;  4PMC A;  1X9N A;  5IYD G;  2KCT A;  2RVL A;  1VQO A;  4QUC A;  3M4P A;  1WD0 A;  3T1Y L;  4KI0 A;  1MJE A;  1Q81 C;  4Q5V A;  4JI2 Q;  2VUM B;  1L0Y B;  1B9M A;  3UDG A;  3GD7 A;  3PO2 G;  4QQB X;  3TP5 A;  4KHZ A;  5M5X H;  1ICW A;  3GTM H;  3OYY A;  3HGB A;  3MZ5 A;  1HNX Q;  3IL8 A;  4CHT B;  5EKL A;  1AH9 A;  1JJG A;  3DWQ A;  3BZC A;  1CSQ A;  4L8J A;  2JEA I;  1JCK B;  1VQP A;  1D2B A;  1H9S B;  5ELB A;  2JA7 H;  3S2D B;  3J81 L;  5I9P A;  3KJO A;  1PH2 A;  4KHP L;  1Q8I A;  1RJT A;  5IY0 A;  4OL7 A;  4PMW A;  2DJG C;  4CGY B;  5DM7 3;  2JXM B;  3AEV A;  4WJ4 A;  4YY3 Q;  1EY4 A;  3ICE A;  1XNQ Q;  1W2B A;  4O0A A;  1S5F D;  3TN2 A;  2XRS D;  2YYZ A;  2A6E C;  1AN8 A;  4B3S Q;  1XMQ Q;  3I8Z A;  3T51 B;  4XQJ A;  2WAQ E;  4J6H A;  3GTL B;  1E2Z A;  2DY8 A;  1V1O A;  2L15 A;  3CCL A;  1PTO C;  3KBG A;  3DHQ A;  2DN8 A;  2PNR C;  4JCV E;  1ZKO A;  2XTI A;  1JJC B;  2QA4 A;  4LF6 Q;  3MWY W;  2PZW A;  4Z9C B;  1PTO H;  1KHI A;  3VYR A;  1CSP A;  4K8I A;  3HS0 C;  4B3T L;  1O7Y A;  5IGD A;  2C9O A;  2XGT A;  3NUC A;  2Q2H A;  1L2F A;  4JBM A;  2ZXP A;  2Q8R E;  3E9I A;  2A68 C;  3DLL A;  2YTV A;  2L12 A;  2F0N A;  3PQI A;  2Y0S G;  4BXX G;  3RUZ A;  4FF3 A;  1TXY A;  4YWL A;  4DV7 Q;  3BZD B;  2JA7 G;  3KJP A;  4I7A A;  3J80 L;  1IBL L;  5C0X G;  4A3D B;  2B63 G;  4OO1 I;  2RDG A;  1AEX A;  3MXU A;  3E3X A;  5KIX A;  1PH8 A;  3HOW B;  2NZH A;  2HCC A;  4B3M Q;  2PZU A;  3A0J A;  2XVS A;  4PZ6 A;  3TZD A;  4KY5 A;  1TWC H;  1N36 L;  4IJH A;  2RHS B;  4NPS A;  4F88 A;  2H5X A;  3GTO H;  1VF5 C;  4I7Z C;  1NMG A;  2H4O A;  1UNS A;  4UP8 A;  1B3A A;  3H3V I;  2EE1 A;  1SE3 A;  1WCM H;  3H15 A;  4J15 A;  2G5D A;  2IW3 A;  2QF7 A;  5CV8 A;  2ES2 A;  3F2D A;  2D0P A;  3Q23 A;  5GAD C;  1FGB D;  1RCV D;  4BY1 B;  1U0L A;  4QMG A;  1QUQ B;  1TWF B;  1O7Z A;  1XTC D;  1VQN A;  1KAA A;  3LNN A;  1XTD A;  1YNJ C;  1LUZ A;  2QDB A;  4FF4 A;  4R4Q A;  1Y8P B;  4A3B B;  4FF1 A;  1VS0 A;  3WWV A;  3D4W A;  5LL6 S;  1UE1 A;  2F0P A;  1X54 A;  3S15 H;  5HGT A;  1SNQ A;  4OO1 H;  1XXG A;  1XNR L;  4BY7 H;  3JAM c;  2O5I C;  4X65 L;  2NBF A;  4A93 B;  3I4O A;  4UDU C;  5C4X H;  4JI1 L;  5C3W A;  4LF7 Q;  4DAY B;  2E2I H;  1F2Z A;  3I4M H;  2HUG A;  4JI8 Q;  4DKA C;  5BR8 L;  3H3V C;  5E3F A;  1VQ6 A;  4KHV A;  5C3E H;  1TT2 A;  3GTP B;  1DD2 A;  2QGQ A;  4HIK A;  2L1B A;  3H3V H;  2CQA A;  4IPG A;  3PF5 A;  2I5M X;  5ELD A;  1KDC A;  1PVO A;  3GV3 A;  3NSW A;  1GO3 E;  2M2L A;  1MGS A;  1RHP A;  3RD4 A;  5M3F G;  5FJ8 H;  3K59 A;  2PW5 A;  3PV0 A;  1E7Z A;  2Q8T A;  1TWG B;  1BVS A;  2VQE L;  4HAE A;  1Y69 U;  1VDZ A;  2PQE A;  5LMU L;  3FPU B;  3T53 B;  3IFT A;  1YBY A;  1Q8K A;  3HKZ E;  2K04 A;  1PH9 A;  2VB3 X;  2CHB D;  2VL6 A;  2YTX A;  4BBS H;  1K3R A;  1LV9 A;  2GVB A;  1NY4 A;  2JA6 H;  1S5D D;  3D8G A;  4TVA B;  1EQR A;  2B2T C;  5FO8 B;  2HHH Q;  1PZK D;  1RDP D;  4OO1 G;  5CV7 A;  1CT1 D;  4WJW A;  4BY7 G;  1S5B D;  3E0E A;  4K5V A;  2BE5 C;  4IN3 A;  2UXB L;  4P71 A;  3RZD B;  1A2U A;  3HOU B;  4NB3 A;  5J39 A;  5C4X G;  1B50 A;  3I4M G;  2MP1 A;  3HKZ B;  1TS2 A;  4HJ9 A;  1PH1 A;  3GTG B;  3X3M A;  4LFC L;  2UU9 L;  2MJ8 A;  5IGB A;  4O42 A;  4A3J B;  4DR2 L;  2R7D A;  4AQY Q;  3SK4 A;  4FDB A;  4DFA A;  5C4H A;  1F9Q A;  1HR0 L;  1XX8 A;  3EJI A;  3I91 A;  4DNI A;  3CP0 A;  4GOP C;  4FYD A;  4RHR A;  3AFP A;  3OPO A;  1LO5 D;  4LK1 C;  1PA6 A;  5D65 A;  1JR0 D;  4G57 A;  3W1B A;  1KNA A;  1YIJ A;  4QUF A;  4KJN A;  5FJ8 G;  1KDB A;  2KEN A;  2XRQ D;  4YCU A;  1U4R A;  3EN2 A;  2KHS A;  3I55 A;  1VQH A;  3TRZ A;  2QCP X;  1CKN B;  1GUO A;  2B2Y C;  3W5O A;  4UY8 C;  2JA5 B;  4IQZ A;  4B9X A;  4GKK L;  4B08 A;  4LFA Q;  2OXP A;  4JG2 A;  1B7Y B;  1HFG A;  3TZU A;  4JOI C;  5GAE C;  5KYI A;  2JA6 G;  1UE7 A;  4QIW E;  2EYM A;  1A3V A;  4HID A;  2NVX H;  1EU3 A;  4MTN A;  1VCI A;  1Y1W B;  1HZC A;  5NUC A;  3BJU A;  2JK8 A;  1EWI A;  5EPK A;  3T1H L;  1I50 H;  4Y52 H;  4JI0 L;  5JVH 3;  2O2L D;  3VR4 A;  3TP7 A;  1BBW A;  2EYF A;  3Q8D A;  3CCJ A;  1VQA A;  4GN3 B;  3G71 A;  2IX1 A;  4B3R L;  4ZAI A;  4X64 L;  1SBB B;  2BH2 A;  3HOY G;  1FGU A;  2UUA L;  4DV5 L;  5JJI A;  3AB9 A;  3G48 A;  5FO7 B;  4ZKB B;  3AU7 A;  5EBC A;  2ICE C;  1CHQ D;  4CDF C;  5EAY A;  5HUR A;  1TS5 A;  4AH6 A;  4A3G H;  2A73 B;  3PO3 H;  3QR8 A;  1KL9 A;  3FDT A;  3CCE A;  2AKW B;  2ZM6 L;  1KRS A;  2M00 A;  2DGY A;  2LY7 A;  2QDL A;  2R61 A;  4GNX B;  2R7Z G;  5DM6 3;  2KED A;  4G7Z C;  1I3Q H;  1F9S A;  4IUQ A;  1HZB A;  4LW1 A;  1SYD A;  5IP9 H;  3EIV A;  1EIH A;  5I2X A;  2R92 B;  3FKI H;  1HZA A;  3OW7 A;  4DR7 Q;  4ABN A;  2F1M A;  1F9P A;  4U68 A;  4NXN L;  4DA2 A;  1VF7 A;  2F0H A;  1VQ7 A;  2E2J B;  4DF7 A;  4DUY L;  2WB1 G;  1EY7 A;  3BVZ A;  3PIO 3;  2VQF L;  1K8G A;  2CKZ B;  3VA5 A;  3TP6 A;  3PIP 3;  1G8Z D;  1QWY A;  3NEN A;  2OTJ A;  4C2M B;  5IT9 c;  4LAA A;  4GLV B;  1PRT F;  3NHH A;  3KDF B;  4KY6 A;  4CJ2 C;  2HD3 A;  1U4M A;  1HNW L;  5JEA H;  1C7Y A;  1LTT D;  1N9W A;  4A76 A;  2WFW A;  5K36 H;  3I90 A;  2B2T A;  4A3G G;  5HY6 A;  4KKS A;  3PO3 G;  2CWP A;  1T5E A;  2JQO A;  4L5Q A;  1SMX A;  1U5K A;  4Y7N H;  4TSS A;  1G6P A;  2UXD L;  2EY6 A;  4DV6 Q;  3S1N H;  3FRP B;  1SXT A;  5EPJ A;  1B3Q A;  3U9O A;  3MTS A;  2YV5 A;  5M5Y B;  1L0X B;  1DGS A;  4BA1 I;  3FKI G;  1RL2 A;  1D7Q A;  2L0C A;  3CC2 A;  3FVQ A;  4JI5 L;  4XT1 B;  4HSP A;  5COY A;  2ASB A;  2K75 A;  4GOP A;  4A3M B;  2RBM A;  3NTH A;  2R93 B;  4CDC C;  4K5X A;  3OTO Q;  1CKM A;  1UAP A;  2UXC L;  2F0E A;  3I56 A;  1SSO A;  2A19 A;  1QCB D;  1BO0 A;  2B2Y A;  3TSS A;  1FJG L;  3H0G H;  1PDQ A;  1P8L A;  3KF6 B;  5J1Z A;  3OMC A;  2WII B;  5LMN L;  3FPP A;  4RH6 A;  4JOI A;  2HQE A;  5JEA G;  3Q0A A;  2JSO A;  3K7U C;  2KEC A;  5K36 G;  4IPD A;  2VNU D;  1Z9F A;  1JOR A;  3F2U A;  4X62 Q;  2DNC A;  3E0J A;  4A3K H;  4EVO A;  2UUB Q;  1S4Z A;  2QIL A;  4HN7 A;  1TWH B;  4JBJ A;  2KBN A;  1TVX A;  2B2U C;  2MO1 A;  1NJI C;  3RR5 A;  2E5L Q;  4UP9 A;  2WAC A;  5IIF A;  3MXN A;  4X66 L;  4F7X A;  2XN9 C;  2K5N A;  3MAQ A;  2PW7 A;  3AQQ A;  3UE0 A;  1S72 A;  3VDY A;  1XPR A;  3E6Z X;  4M1U B;  4DV1 Q;  4BWG B;  4HTH A;  1TU2 B;  1PH6 A;  4F87 A;  4C3H H;  3NE5 B;  2OWO A;  4ME3 A;  1K0S A;  5C44 G;  2K28 A;  1GHJ A;  1ZXT A;  4DV4 Q;  1EZ8 A;  4BBR B;  5TSS A;  3HG9 A;  1KAW A;  4JW0 A;  4YHH Q;  5FKA C;  3GTK B;  2PI2 A;  1JOQ A;  1AZQ A;  1GD7 A;  4AYB B;  5CGK A;  3ULL A;  2B8F A;  2X6L A;  5M5W B;  2VUM H;  5KEE A;  3PUY A;  5C44 B;  4HED A;  2NVT B;  2PMZ B;  3J81 i;  4NXM Q;  1XMO L;  5IYD H;  5CBE E;  1ZYR D;  2KVM A;  1IW7 C;  5FOB B;  3JAM L;  4LFB Q;  1Z7T A;  2NB0 A;  4M8A A;  1DON A;  5D3D A;  5GAG C;  1I94 L;  3CCU A;  2YTY A;  2IT1 A;  1Y8O B;  5JPN C;  3ONA B;  1LT3 D;  4P75 A;  2KCM A;  2WKC A;  3TEH B;  2XWJ B;  1M4V A;  3S2D H;  4C1N K;  1ET9 A;  4DAV A;  3ERQ A;  2V1C C;  3SK8 A;  2N49 A;  1E3P A;  1V8Q A;  4NP5 A;  3CME A;  4OWX B;  1EOV A;  3M3Y B;  3BYY B;  3F1Z A;  4N9T A;  3I2Z A;  2JE6 I;  4C3H G;  1X32 A;  3I4N B;  3DM1 A;  3SGI A;  3C1F A;  3HOZ B;  5C0X I;  1SEB D;  1P16 A;  3GTL H;  1H9K A;  1N34 Q;  3CF5 A;  1IYV A;  1TY2 A;  1EFI D;  1JIC A;  5T1G A;  1JQY D;  3W2D A;  2CVR A;  4HR7 B;  2A5H A;  4G4K A;  2VUM G;  1TR5 A;  3Q6S A;  3PUZ A;  5DEH A;  3EFX D;  5IT9 E;  3K7A H;  2NWG A;  1GXD C;  2F4V L;  1IKL A;  4OIJ A;  3J80 i;  4APV A;  4JI4 L;  4L5S A;  3RLF A;  3VYS A;  1PTO F;  2A6H C;  2KQ3 A;  4LUV A;  3S1Q B;  4XQQ A;  4X3K A;  1BDO A;  1JB7 A;  2IJ0 A;  2DY7 A;  3D31 A;  2EXZ A;  4DGZ A;  2LKV A;  4A3I B;  1K3B C;  3T1Y Q;  2L4N A;  1WTQ A;  5ELE A;  1XYI A;  4NMZ A;  5IGE A;  2CW0 C;  2F0G A;  3KLS X;  5KRU A;  1AP0 A;  1R4Q B;  3PSI A;  1ILQ A;  4JBW A;  3S9W A;  3HOX B;  3HOW H;  4FVM A;  4LMQ D;  4OHJ A;  3I72 A;  4A3F B;  4RGM A;  4BXX H;  1BUV T;  1E2W A;  2PPB C;  3U58 A;  3NTI A;  1O78 A;  3KLW A;  5IYC H;  4RGO S;  2OTL A;  5C0X H;  5C4J B;  5M3M B;  2B63 H;  4ID6 A;  4OGQ C;  1HNX L;  2LS0 1;  1PXU A;  3ZYY X;  2QW7 A;  2F0J A;  5E7N A;  4KHP Q;  2B2U A;  1K28 A;  2EIF A;  4IOC A;  2BCO A;  4K2K A;  1Q1E A;  4HMJ A;  3U4V A;  1H9M A;  1PH4 A;  4H0L C;  1ILP A;  2F0K A;  4BY1 H;  5K5P A;  2F0U A;  2B2W C;  1X3G A;  2N78 A;  1C8C A;  2L11 A;  1DXM A;  4KMU C;  4PNY A;  3T56 B;  3CKI B;  1SJE D;  1CKO A;  2Z0S A;  3M4Q A;  3E9H A;  3KF8 B;  1ESF A;  2LXK A;  3JC6 6;  1WTO A;  4UAI A;  1QNK A;  2D2C C;  3ER0 A;  1XMQ L;  4IOA A;  3A74 A;  1SR3 A;  1CI3 M;  3K5M A;  4LUO A;  4A3D G;  1SYF A;  1EY8 A;  2K03 A;  2EJM A;  1D1I A;  1F2Y A;  1GUS A;  1QZH A;  1IKM A;  1MI2 A;  3QOL A;  4B3T Q;  4EQO A;  4LF6 L;  1J6Q A;  3CXC A;  2WAQ B;  3HOW G;  1DZ1 A;  4A93 H;  1KIX A;  1SE8 A;  1VQI A;  1HR0 W;  2JN4 A;  4PMB A;  3O13 A;  1YNN D;  1DOM A;  4WOR A;  4HIM A;  3KFU A;  1B9N A;  5H1S E;  5IYC G;  4C3I B;  2KHI A;  1IBL Q;  2Y0S E;  1H9S A;  2BOS A;  3URY A;  4DPG A;  1JB3 A;  1I6H B;  1ENF A;  1WOC A;  4GLA C;  2WP8 J;  1PYW D;  3SK5 A;  2DUD A;  5EBD A;  2MO0 A;  1TWG H;  3MEF A;  1N36 Q;  4BY1 G;  2ZTD A;  1UUP A;  5CV5 A;  3S1M H;  3GO5 A;  1PFS A;  4V19 0;  1X56 A;  3MEH A;  2OCE A;  3PF4 A;  2D9U A;  1STB A;  1PFM A;  5IYB G;  1BCP B;  4DR1 L;  3QG1 A;  1IYU A;  1BXT A;  3NXW A;  4GKJ L;  4A3B G;  3CPF A;  1GOZ A;  4XT3 B;  5M3F H;  4FXD A;  1WD1 A;  1L1O B;  2B29 A;  1SNM A;  1FVI A;  1X3P A;  2JYO A;  3BDC A;  4O2D A;  5IT9 L;  5DLQ E;  5BN4 A;  1BOS A;  4DV3 L;  2RKS A;  1ASZ A;  3A8I E;  4DR4 L;  1HHV A;  5G3L F;  3IFD A;  1LLR D;  2SOB A;  1SFO B;  3HOU H;  4A93 G;  1SNO A;  3A8K E;  5LL6 X;  2RSO A;  4LF9 L;  3F8T A;  3GTG H;  5JJL A;  5LHY 1;  1KQS A;  3N52 A;  1BQQ T;  5EKI A;  2ENB A;  4LJZ C;  2A69 D;  3KOJ A;  1S5C D;  2XWB B;  3MFG A;  4DK3 C;  3RMH A;  1EYD A;  5HGQ A;  1MIU A;  2HQL A;  3SVM A;  4FNF A;  2CH4 W;  2FMC A;  1XNR Q;  2HIX A;  1VQ8 A;  4BA2 I;  1X6O A;  1IYJ B;  1STE A;  2K05 A;  3MC0 B;  1V1P B;  1EWH A;  1RTO A;  1VQ5 A;  1EIF A;  2GVA A;  5ELC A;  3BVG A;  1KLU D;  2EVB A;  2MUY A;  4G7O C;  1ZYR C;  2HDL A;  1NBW A;  1S3O A;  3BG3 A;  4FF2 A;  2WV6 D;  5BR8 Q;  4XYO A;  1N32 Q;  3I73 A;  2K01 A;  1YI2 A;  2K5Q A;  1SYE A;  1GUW A;  1A3U A;  3K6O A;  4JI8 L;  5JEA J;  2QKI C;  1K83 B;  1E0B A;  1I4R A;  2RF4 A;  3ZJY C;  3M7N A;  2MNA A;  4YWK A;  1E1O A;  3CCQ A;  1KD1 C;  4R8I A;  1LTG D;  4KD3 A;  3IAY A;  5C4Z A;  4KK7 A;  1Y1W H;  2F52 A;  3CW2 C;  4JC0 A;  3NBH B;  1GUG A;  3HOU G;  2K33 A;  4MN3 A;  4RAU C;  3TDQ A;  5JPM C;  1QUQ A;  1YHB A;  3HKZ G;  2RHQ B;  4IUN A;  3TBI B;  2F3I A;  4H7B A;  2IHF A;  2B2W A;  3GTO B;  3FP9 A;  4A3J G;  3RLO A;  1E24 A;  1SRO A;  1T5X D;  5JOB A;  2F0I A;  1UE5 A;  2H1E A;  1JE4 A;  2UXB Q;  3NQT A;  4GNX C;  4QL5 A;  3QWN A;  2TMP A;  1S5E D;  4DAY A;  2I07 B;  4P73 A;  5KND A;  2ALY B;  2F3W A;  2G9H D;  3L2P A;  4IO9 A;  2UU9 Q;  2CCZ A;  3HOY H;  4DR2 Q;  2KUM A;  3G7L A;  2JA5 G;  3S2H B;  2QEX A;  2E2H B;  4P2C B;  4R4O A;  1HR0 Q;  2LMC B;  3IKJ A;  2AUK A;  1VQD A;  2YU9 B;  2RDF A;  2Z1C A;  3TS0 A;  3PGZ A;  4AQY L;  2R92 H;  4GLX A;  2EQS A;  3G6E A;  1A6X A;  5DNF A;  3CQZ B;  4RCN A;  2R7Z H;  1NCV A;  4ALP A;  1VQB A;  5CMD A;  1JT8 A;  3F2C A;  1Y1W G;  1IW7 D;  1JWU D;  3W1G A;  1H9J A;  5FLX c;  1Q90 A;  4FO2 A;  4A3E B;  1CTM A;  5C6A A;  4GKK Q;  1DOK A;  5LMN W;  2BA0 A;  5CC4 A;  2RSN A;  2EYH A;  3GTQ B;  3AMU A;  5C3E B;  3PUW A;  1C0A A;  4C2M H;  4RMF A;  2K32 A;  3P1H A;  3L7Z C;  4HIO A;  4LFA L;  4QJF A;  3C46 A;  5IE8 A;  4U67 3;  3DXJ C;  3HOV G;  1B53 A;  1S40 A;  2FHT A;  3BZK A;  1M1K C;  1LYL A;  1LAB A;  3QO2 A;  1AFP A;  4K6D A;  2L55 A;  3S16 B;  4XTC S;  3SDZ A;  4QIW B;  5EQ0 A;  1KNE A;  4N8X 1;  3PUX A;  3HOV B;  2VY3 A;  4NKL A;  1K0R A;  2UUA Q;  4DUZ L;  4DV5 Q;  1MJC A;  3M4O B;  3R2I A;  2R92 G;  2N8N A;  1QVG A;  1V43 A;  3NK9 A;  3T13 A;  2K4K A;  4XIG S;  4JI7 L;  4DAM A;  4JK1 C;  4A3M H;  1G91 A;  1OXU A;  4OXP A;  1STY A;  2A6H D;  5JJZ A;  2ZM6 Q;  5KNB A;  1CKN A;  1YNN C;  2NVY B;  3C2P A;  4KTA A;  4ZCK A;  4OON A;  2JEB I;  3X3N A;  4ZQ3 A;  3K0X A;  1WVL A;  3BDO A;  2EDG A;  2IHE A;  1HRJ A;  2D5D A;  1PZI D;  3A54 A;  3KLR A;  3MXG A;  5E4W C;  4A75 A;  2CW0 D;  4NXN Q;  1UWV A;  1MKH A;  3TP8 A;  4O1N A;  4DR7 L;  3I3C A;  3K5O A;  2WB1 E;  1G6Z A;  2VQF Q;  4RWS C;  3JAM E;  1J5E L;  1M8A A;  4EQP A;  4JYA Q;  4DK1 A;  4LF8 Q;  4WJ3 M;  1N33 Q;  3CD6 A;  2RA4 A;  5FK9 C;  5KGU A;  1TWH H;  1VQF A;  2E76 C;  1L0W A;  5IGF A;  1DM0 B;  1Q82 C;  4EGV A;  4PV1 C;  3KK7 A;  2J7Z A;  3A8J E;  5E4X A;  1HNW Q;  2I5L X;  2ZT9 C;  1HQM C;  2CWA A;  1LTR D;  1NR4 A;  3H6M A;  1V1Q A;  4DK6 C;  4N9P A;  2PO4 A;  5C3X A;  1KXL A;  2NVX B;  2NYZ D;  3CRK C;  4A3M G;  3A5U A;  2R93 G;  4DV0 L;  2MFI A;  2O5J C;  3FEW X;  2UXD Q;  4X3S A;  4GNX A;  2NN6 I;  4IPC A;  2A69 C;  2E75 C;  2QEJ C;  2Z4I A;  3P75 A;  4JI3 L;  2NVQ B;  2AQ3 B;  3MXP A;  4DU9 A;  1PH3 A;  4BBR H;  2V4D A;  3J81 j;  1WI5 A;  4L63 B;  4RKB A;  5I9O A;  2R3Z A;  1Y1V B;  1EY6 A;  3PMF A;  1AE2 A;  4WFN 3;  2R7F A;  3JAM i;  2UUC L;  4TKO B;  4DV6 L;  2GA4 B;  1TY0 A;  5IGC A;  4JI5 Q;  4Q0F A;  1G2S A;  3NQI A;  1VQL A;  1EQQ A;  2AMC B;  2HDM A;  2PI2 E;  4H44 C;  3EBE A;  3VR5 A;  1Z6H A;  4PZ7 A;  4CJ0 B;  5C44 H;  3U50 C;  1A0I A;  2NVT H;  2FXQ A;  4CJ1 B;  5C0X J;  3CC4 A;  1D8L A;  1STH A;  2Q2U A;  3ULJ A;  2SNS A;  1KC8 C;  4IUT A;  4EQ5 A;  2B8G A;  4KN7 C;  1M90 C;  3CPW A;  3V05 A;  1SE2 A;  1FJG Q;  3S1R B;  1EQV A;  2EOT A;  3C1E A;  5LMN Q;  4JI6 Q;  2J0T D;  3KDF A;  4L5T A;  4R1J A;  2XNA C;  3G4S A;  1EY0 A;  4AIM A;  5BN5 A;  1QZG A;  1KAB A;  3ERS X;  4PG3 A;  2OT2 A;  4QF4 A;  1Q3L A;  3OSO A;  1EIG A;  4GS3 A;  1IBM L;  2MGS A;  4QCL A;  1STG A;  1GKH A;  1FL0 A;  1K8M A;  1NSN S;  2NN6 H;  2RQX A;  3N6R A;  3I4N H;  4EX5 A;  3K58 A;  1EYC A;  4IFD I;  1Y14 B;  5F2D A;  1C48 A;  3HOZ H;  1CHP D;  5I2Y A;  4K6L A;  4P74 A;  4BBR G;  1RD9 D;  3R3O A;  5FLX E;  3Q24 A;  1AZP A;  2XIW A;  4FXK C;  4K2L A;  3L9A X;  4X66 Q;  1R9T B;  4DR3 L;  1QNU A;  5EJW A;  4LF4 L;  4AYB G;  2ZXR A;  1HTP A;  2F0O A;  4DR6 L;  3P20 A;  1O80 A;  1HZ9 A;  5CV4 A;  3BYT B;  4RGT A;  1EOT A;  1HUN A;  3ITP A;  4Y7N B;  4DXG A;  3S1Q H;  1E22 A;  1VQ9 A;  2Z6K C;  1PYS B;  1IBK L;  1AW7 A;  3EVQ A;  1JWS D;  4A3L H;  2Q2I A;  3NP8 A;  3RZO B;  2Z9H A;  2EJF C;  2K5H A;  3KF6 A;  1U4P A;  1H95 A;  4TRD A;  4LNQ A;  4KV6 A;  5L37 A;  4YHH L;  1HNZ L;  3LX0 A;  1EU4 A;  2L5T A;  2AQ2 B;  2B39 A;  1F77 A;  3HOX H;  1XMO Q;  4X3T A;  2PQA B;  1SDF A;  1SRU A;  4A3F H;  4JV5 L;  1O7L A;  1DCZ A;  1EYA A;  4A3C H;  2NN6 G;  1I94 Q;  4JPB W;  1WTV A;  3I4N G;  4PZ8 A;  1XPO A;  4LF5 L;  1NAP A;  4IJL A;  1EL0 A;  3HOZ G;  5C4J H;  1YHQ A;  5M3M H;  4LFB L;  4C1N I;  4K0K L;  1B1Z A;  4C3J G;  5IWA L;  2N3S A;  1D6E C;  2DNE A;  4QGU A;  3H0G B;  4RA8 A;  1LTL A;  1YJ9 A;  1C4Q A;  3K57 A;  1TS3 A;  4IUR A;  2CQO A;  1LTS D;  1WTP A;  1BBU A;  2KCC A;  2A8V A;  1CK1 A;  4F8M A;  1PRT B;  1AE3 A;  4C3J B;  2I5H A;  1QIL A;  3TS2 A;  4A3K B;  2EPB A;  3WDN A;  1ET6 A;  2R6G A;  5KNC A;  1YJW A;  4J1M A;  3HEJ A;  1Z47 A;  2A1A A;  1SE4 A;  4IPH A;  2X6G A;  1CM9 A;  3D4R A;  1HPC A;  4MZ9 A;  5AJ3 Q;  4A3I G;  4OX9 L;  4A3L G;  1I4H A;  1V9P A;  2ZTC A;  3L3O C;  4XXE A;  5IGG A;  2IWH A;  3GTJ B;  4DV2 L;  1K9M C;  3MA2 B;  5JVG 3;  1STA A;  2ZJQ A;  1MSG A;  2LSS A;  3I70 A;  1ONL A;  3UI2 A;  1PV4 A;  2F4V Q;  1JOO A;  4JI4 Q;  3NEL A;  3ERO A;  1YZ6 A;  3HOX G;  3S14 B;  1WJJ A;  3TQY A;  2MHV A;  4A3F G;  2EZV A;  4CDE C;  4DR5 L;  4A3C G;  4GZY C;  1TWA B;  2EYL A;  3H94 A;  1OXT A;  3NWT A;  4IFD G;  2K52 A;  1ASY A;  2AWO A;  4ZUJ A;  4A3D H;  3TME A;  4C3I H;  5M3M G;  1OXS C;  1SYB A;  1CQV A;  3R2T A;  5GRO A;  2EYP A;  1O7I A;  3STB D;  1I6V C;  2Q2T A;  4JI2 L;  3QOJ A;  1I6H H;  3IRB A;  4DN4 M;  4JVZ A;  4YIJ A;  3ULP A;  3D3R A;  4RG1 A;  4CKB A;  1SMY D;  2JA8 B;  3LGJ A;  1PHJ A;  1IHZ A;  1BCP C;  1CUK A;  4GN4 B;  3CCR A;  1HCZ A;  3D0F A;  1HA5 A;  3OIQ A;  2I0Q A;  5FLX L;  1U9R A;  5BN3 A;  1X3E A;  2NTS A;  1L1O C;  4HJA A;  1UEB A;  1SYG A;  4QY7 A;  2VW9 A;  1EEI D;  1KTK A;  4X6A H;  3PO2 B;  3R93 A;  3A5Z B;  1NMF A;  1PMR A;  2K14 A;  2WKD A;  4OIK A;  1LT5 D;  1TWF H;  4YY3 L;  4LUZ A;  1OO9 B;  1XNQ L;  1HXY D;  1F2L A;  1NR2 A;  1RTN A;  5IYB H;  1Q86 C;  4A4I A;  2WAQ G;  1SFO H;  4A3B H;  2ZTE A;  1JJ2 A;  2N55 A;  4HJ8 A;  4B3S L;  3W3A A;  2E8G A; 
#chains in the Genus database with same CATH homology
 4XYQ A;  2ZXO A;  1CA6 A;  2VB2 X;  3G6J B;  3D6W A;  3OWF A;  3D6C A;  4ILW A;  4C3I G;  1JC7 A;  3DWA A;  3HZX A;  2B2V C;  2K1B A;  4K14 A;  1CZW A;  3S17 B;  4KN4 C;  1QJO A;  4HSV A;  1D1K A;  1LT4 D;  2E74 C;  5I6W A;  3SR1 A;  5ISR A;  3T4A C;  1MBY A;  1EWC A;  1I4G A;  3K7A B;  2ID0 A;  3DMU A;  2KEE A;  3K5L A;  1GJX A;  5C5L A;  1ML0 D;  1PFB A;  5EPL A;  1Y8N B;  3A7A B;  5CV6 A;  2F0F A;  4KJO A;  3J7A V;  3NPP A;  4ZYS A;  5A35 A;  1A3T A;  5M5X B;  3GTM B;  1D5X C;  2SNM A;  4BS9 A;  1IL8 A;  3ND8 A;  4KY7 A;  3SK6 A;  2FJ2 A;  1F9R A;  1KDA A;  4HCE A;  1RF2 D;  4HCS A;  5JAV A;  2Y0S B;  1SYC A;  3KF8 A;  2JA7 B;  2Z4H A;  3OOC A;  2B63 B;  4C56 C;  4ZRZ A;  2K7V A;  4J8Q A;  3CHB D;  2F0D A;  1CFM A;  4QB4 A;  1FNW A;  4RHS A;  5ELF A;  4ZK9 B;  2F0V A;  3A56 A;  3H09 A;  3NWS A;  1VMP A;  3OIP A;  1GUN A;  2X69 A;  3QB3 A;  2F0Q A;  1TS4 A;  3LWE A;  4TQU S;  3NBI A;  1TQO A;  1PTO B;  1CA5 A;  3PUV A;  2F03 A;  1RKN A;  1D5M C;  4RKL A;  1SNC A;  4HMI A;  4IUV A;  1LTA D;  2KJX A;  3DEP A;  1W6K A;  4XDX A;  3DWP A;  1HA6 A;  4IAL A;  4NW2 A;  2F0T A;  5KYL A;  5D3I B;  3A7L A;  2L9H A;  3HP3 A;  1STN A;  1TWC B;  2E2D C;  2F4I A;  1PRT D;  3T16 A;  4I65 A;  4V0B A;  1MSH A;  2PZT A;  5DAU A;  3S1M B;  4EQN A;  3VYT A;  1WCM B;  3SEB A;  2F0L A;  1QOH A;  5AFW A;  5M3F B;  4K8J A;  3VA7 A;  4RGN A;  2F3V A;  2B2V A;  1V1P A;  1BBX C;  4ZKC B;  1SJH D;  2OF1 A;  2FIN B;  5IOC A;  1QG7 A;  1BNZ A;  3V2T A;  5CV9 A;  1I4Q A;  4KKU A;  3S15 B;  1F2M A;  4FP5 D;  4BY7 B;  3FMC A;  3WOE A;  2K5D A;  1HFN A;  1TII D;  5C4X B;  1SMY C;  2E2I B;  5FO9 B;  3LWU A;  3I4M B;  2HCI A;  5IOD A;  3BDL A;  2IPK D;  1GUT A;  3NBH A;  2NZ1 D;  3MHB A;  1LAC A;  1EY9 A;  1EEF D;  2K6A A;  4H13 C;  2BDO A;  3MFY A;  3KLS A;  1GHK A;  3QJY A;  2TSS A;  1OXV A;  2AWN A;  5I4D A;  1HTL D;  1LT6 D;  3ND9 A;  2F0S A;  2A74 C;  4CKE A;  3C3L A;  1FNU A;  1EY5 A;  4BBS B;  3P7J A;  3KBX A;  4ODG A;  4DAP A;  3BS1 A;  2JA6 B;  4R8N A;  2BDN A;  5E1F A;  3U9S A;  3M85 A;  1LTI D;  4PQX A;  4KD4 A;  1K8O A;  1B44 D;  3SHL A;  1A2T A;  2N88 A;  3M7G A;  4XQN A;  2NUC A;  4DNR B;  3V96 A;  1ENC A;  1KLG D;  2AQ1 B;  1X3Q A;  2NTT A;  4IFD J;  4K5W A;  2AUJ D;  1QB5 D;  2OEO A;  2WIN B;  3OHX C;  1JWM D;  2XSC A;  5A2Q E;  1CZG A;  1ESR A;  3HOY B;  1WTX A;  3GV6 A;  1DOL A;  4RFB A;  1OXX K;  3VR6 A;  3VR2 A;  5J22 A;  4ZUI A;  1HUM A;  1EQT A;  1DJR D;  2R7Z B;  1SND A;  1BCP D;  4S3S A;  2Z8L A;  2BA1 A;  5I6Y A;  1Q1B A;  4IUP A;  4ZLT F;  3K0Y A;  2JP1 A;  1H9R A;  2PYK A;  4CBV A;  4IUU A;  1PLF A;  2WB1 B;  3BVM A;  3J7A F;  1VMC A;  4L6T B;  1G2T A;  1I50 B;  3HRZ C;  4WRD A;  3MVV A;  3VYU A;  2A6E D;  3GQB A;  3DUZ A;  2C5C A;  1PZJ D;  1PTO D;  1Q12 A;  3CRL C;  4A3G B;  3Q22 A;  3PO3 B;  2EJG C;  3KUP A;  3D4D A;  2M9V A;  4DK0 A;  1II3 A;  2FFK B;  3WOF A;  1MD2 D;  3SE0 A;  2EYJ A;  2J4X A;  1I3Q B;  1NUC A;  2LFN A;  2A68 D;  1FD7 D;  2IX3 A;  1WTR A;  2EYO A;  3FKI B;  5CYU A;  1FR3 A;  2SDF A;  3OMG A;  3NTK A;  3GP7 A;  1CQF A;  1TKW B;  1PRT C;  2I46 A;  4FXG C;  4MIU A;  1QE6 A;  3K5N A;  5EGT A;  2F0W A;  2FMM A;  1ZEQ X;  2O4X A;  1J8I A;  4ME5 A;  1J9O A;  5COR A;  5M9O A;  3J81 E;  4R9W A;  4DXF A;  1WTW A;  3M4Y A;  1U4L A;  3J7Y W;  1W6J A;  1EZ6 A;  5A2Q L;  1SNP A;  3DEO A;  3S1N B;  2EY5 A;  3E5S A;  1YNJ D;  2EY2 A;  2IL8 A;  4KKT A;  1XWE A;  4G7H C;  1UEA B;  3R8B A;  1HQR D;  2IX0 A;  1ROD A;  4CKC A;  1FNV A;  4RCO A;  4ULL A;  1ENA A;  4DNT B;  3QIA A;  1E2V A;  5EKK A;  2KA7 A;  2K5W A;  3I4L A;  4IFD H;  1A15 A;  1G29 1;  2RDH A;  2EY1 A;  4B9W A;  3A55 A;  3OWE B;  5CR3 A;  3EQL C;  2MPM A;  4E6I A;  3CU7 A;  3J80 E;  2F0M A;  2PCF B;  1D5Z C;  1BCP F;  2Q8I B;  1I4X A;  3EA6 A;  2D62 A;  1FYC A;  2SEB D;  1BR9 A;  1DYQ A;  1R4P B;  2KOL A;  1LTB D;  5D14 A;  1SAP A;  4NDX A;  5G3L D;  2G9D A;  5T1I A;  4X3U A;  3VR3 A;  1PFN A;  1BF4 A;  4IZ8 A;  1B2T A;  2ICI A;  3SXH A;  2BE5 D;  1B4O A;  4C3H B;  5CBA E;  4MHE A;  5C5M A;  2VXW A;  3H91 A;  2KCN A;  1I4P A;  1JOK A;  4PMC A;  2RVL A;  4QUC A;  1WD0 A;  4KI0 A;  4Q5V A;  2VUM B;  1L0Y B;  1B9M A;  3GD7 A;  3TP5 A;  4KHZ A;  1ICW A;  3HGB A;  3MZ5 A;  3IL8 A;  4CHT B;  5EKL A;  3DWQ A;  4L8J A;  2JEA I;  1JCK B;  1D2B A;  1H9S B;  5ELB A;  3S2D B;  3J81 L;  5I9P A;  1Q8I A;  1RJT A;  4OL7 A;  4PMW A;  4CGY B;  5DM7 3;  2JXM B;  1EY4 A;  1S5F D;  3TN2 A;  2XRS D;  2YYZ A;  2A6E C;  1AN8 A;  3I8Z A;  3T51 B;  4XQJ A;  4J6H A;  3GTL B;  1E2Z A;  2DY8 A;  1V1O A;  1PTO C;  3KBG A;  3DHQ A;  2DN8 A;  2PNR C;  1ZKO A;  3MWY W;  2PZW A;  4Z9C B;  1PTO H;  3VYR A;  4K8I A;  3HS0 C;  1O7Y A;  5IGD A;  2C9O A;  3NUC A;  2ZXP A;  2Q8R E;  2A68 C;  2L12 A;  2F0N A;  3RUZ A;  4FF3 A;  3BZD B;  4A3D B;  3J80 L;  5C0X G;  4OO1 I;  2RDG A;  1AEX A;  3MXU A;  5KIX A;  3HOW B;  2HCC A;  2PZU A;  2XVS A;  3TZD A;  4KY5 A;  4F88 A;  1VF5 C;  4I7Z C;  2H4O A;  1UNS A;  1B3A A;  2EE1 A;  1SE3 A;  2IW3 A;  2QF7 A;  5CV8 A;  3Q23 A;  1FGB D;  1RCV D;  4BY1 B;  4QMG A;  1TWF B;  1O7Z A;  1XTC D;  1KAA A;  3LNN A;  1YNJ C;  2QDB A;  4FF4 A;  1Y8P B;  4A3B B;  4FF1 A;  3D4W A;  5LL6 S;  2F0P A;  5HGT A;  1SNQ A;  4OO1 H;  1XXG A;  2O5I C;  2NBF A;  4A93 B;  4UDU C;  5C3W A;  1F2Z A;  2HUG A;  3H3V C;  5E3F A;  4KHV A;  1TT2 A;  3GTP B;  1DD2 A;  2L1B A;  2CQA A;  5ELD A;  1KDC A;  3GV3 A;  3NSW A;  2M2L A;  1MGS A;  1RHP A;  3RD4 A;  3K59 A;  2PW5 A;  3PV0 A;  2Q8T A;  1TWG B;  4HAE A;  1Y69 U;  1VDZ A;  2PQE A;  3FPU B;  3T53 B;  3IFT A;  2K04 A;  2VB3 X;  2CHB D;  1LV9 A;  1S5D D;  3D8G A;  2B2T C;  5FO8 B;  1PZK D;  1RDP D;  4OO1 G;  5CV7 A;  1CT1 D;  4WJW A;  1S5B D;  4K5V A;  2BE5 C;  4IN3 A;  3RZD B;  1A2U A;  3HOU B;  5J39 A;  1B50 A;  2MP1 A;  3HKZ B;  1TS2 A;  3GTG B;  3X3M A;  2MJ8 A;  5IGB A;  4O42 A;  4A3J B;  3SK4 A;  4DFA A;  5C4H A;  1F9Q A;  1XX8 A;  3EJI A;  3I91 A;  4FYD A;  4RHR A;  3OPO A;  1LO5 D;  4LK1 C;  5D65 A;  1JR0 D;  4G57 A;  1KNA A;  4QUF A;  4KJN A;  1KDB A;  2XRQ D;  1U4R A;  2KHS A;  2QCP X;  1GUO A;  2B2Y C;  2JA5 B;  4IQZ A;  4B9X A;  4B08 A;  2OXP A;  1HFG A;  3TZU A;  5KYI A;  2EYM A;  1A3V A;  1EU3 A;  1VCI A;  1Y1W B;  5NUC A;  5EPK A;  5JVH 3;  2O2L D;  3VR4 A;  3TP7 A;  2EYF A;  2IX1 A;  4ZAI A;  1SBB B;  3AB9 A;  5FO7 B;  4ZKB B;  3AU7 A;  5EBC A;  2ICE C;  1CHQ D;  5HUR A;  1TS5 A;  2A73 B;  3FDT A;  2M00 A;  2LY7 A;  2R61 A;  5DM6 3;  2KED A;  4G7Z C;  1F9S A;  4IUQ A;  1SYD A;  1EIH A;  5I2X A;  2R92 B;  3OW7 A;  4ABN A;  2F1M A;  1F9P A;  4U68 A;  4DA2 A;  1VF7 A;  2F0H A;  2E2J B;  4DF7 A;  1EY7 A;  3BVZ A;  3PIO 3;  3VA5 A;  3TP6 A;  3PIP 3;  1G8Z D;  1QWY A;  4C2M B;  4LAA A;  1PRT F;  3NHH A;  4KY6 A;  4CJ2 C;  1U4M A;  5JEA H;  1LTT D;  5K36 H;  3I90 A;  2B2T A;  4KKS A;  1T5E A;  4TSS A;  2EY6 A;  3FRP B;  1SXT A;  5EPJ A;  3U9O A;  3MTS A;  5M5Y B;  1L0X B;  4BA1 I;  2L0C A;  3FVQ A;  4XT1 B;  4HSP A;  5COY A;  4A3M B;  2RBM A;  3NTH A;  2R93 B;  4K5X A;  1UAP A;  2F0E A;  1SSO A;  1QCB D;  1BO0 A;  2B2Y A;  3TSS A;  1PDQ A;  5J1Z A;  3OMC A;  2WII B;  3FPP A;  4RH6 A;  2HQE A;  5JEA G;  3Q0A A;  2JSO A;  2KEC A;  5K36 G;  2VNU D;  1JOR A;  3F2U A;  2DNC A;  3E0J A;  4EVO A;  1S4Z A;  2QIL A;  4HN7 A;  1TWH B;  1TVX A;  2B2U C;  2WAC A;  5IIF A;  3MXN A;  4F7X A;  2XN9 C;  3MAQ A;  2PW7 A;  3E6Z X;  4M1U B;  4BWG B;  4HTH A;  1TU2 B;  4F87 A;  3NE5 B;  2K28 A;  1GHJ A;  1ZXT A;  1EZ8 A;  4BBR B;  5TSS A;  3HG9 A;  5FKA C;  3GTK B;  1JOQ A;  1AZQ A;  4AYB B;  5CGK A;  2B8F A;  2X6L A;  5M5W B;  5KEE A;  3PUY A;  5C44 B;  4HED A;  2NVT B;  2PMZ B;  5CBE E;  1ZYR D;  2KVM A;  1IW7 C;  5FOB B;  3JAM L;  1Z7T A;  2NB0 A;  4M8A A;  1DON A;  5D3D A;  2IT1 A;  1Y8O B;  5JPN C;  3ONA B;  1LT3 D;  2WKC A;  2XWJ B;  1M4V A;  4C1N K;  1ET9 A;  4DAV A;  3ERQ A;  3SK8 A;  1V8Q A;  4NP5 A;  3M3Y B;  3BYY B;  4N9T A;  2JE6 I;  4C3H G;  1X32 A;  3I4N B;  3DM1 A;  3C1F A;  3HOZ B;  5C0X I;  1SEB D;  1H9K A;  1IYV A;  1TY2 A;  1EFI D;  1JIC A;  5T1G A;  1JQY D;  3W2D A;  2CVR A;  4HR7 B;  2A5H A;  4G4K A;  1TR5 A;  3Q6S A;  3PUZ A;  5DEH A;  3EFX D;  5IT9 E;  2NWG A;  1GXD C;  1IKL A;  4OIJ A;  3RLF A;  3VYS A;  1PTO F;  2A6H C;  2KQ3 A;  3S1Q B;  4XQQ A;  4X3K A;  1BDO A;  2IJ0 A;  2DY7 A;  3D31 A;  2EXZ A;  4DGZ A;  2LKV A;  4A3I B;  2L4N A;  1WTQ A;  5ELE A;  1XYI A;  4NMZ A;  5IGE A;  2CW0 C;  2F0G A;  3KLS X;  5KRU A;  1AP0 A;  1R4Q B;  1ILQ A;  4JBW A;  3S9W A;  3HOX B;  4FVM A;  4LMQ D;  4OHJ A;  3I72 A;  4A3F B;  4RGM A;  1BUV T;  1E2W A;  2PPB C;  3NTI A;  1O78 A;  4RGO S;  5C0X H;  5C4J B;  5M3M B;  4ID6 A;  4OGQ C;  2LS0 1;  1PXU A;  3ZYY X;  2F0J A;  2B2U A;  2BCO A;  4K2K A;  1Q1E A;  4HMJ A;  1H9M A;  4H0L C;  1ILP A;  2F0K A;  5K5P A;  2F0U A;  2B2W C;  1C8C A;  2L11 A;  4PNY A;  3T56 B;  1DXM A;  4KMU C;  3CKI B;  1SJE D;  1ESF A;  1WTO A;  4UAI A;  1QNK A;  2D2C C;  1CI3 M;  3K5M A;  1SYF A;  1EY8 A;  2K03 A;  2EJM A;  1D1I A;  1F2Y A;  1GUS A;  1IKM A;  1MI2 A;  3QOL A;  4EQO A;  1DZ1 A;  2WAQ B;  4PMB A;  3O13 A;  1YNN D;  1DOM A;  4WOR A;  1B9N A;  4C3I B;  1H9S A;  2BOS A;  3URY A;  1JB3 A;  1I6H B;  1ENF A;  2WP8 J;  1PYW D;  3SK5 A;  5EBD A;  1UUP A;  5CV5 A;  3GO5 A;  4V19 0;  3MEH A;  2D9U A;  1STB A;  1PFM A;  1BCP B;  3QG1 A;  1IYU A;  1BXT A;  3NXW A;  1GOZ A;  4XT3 B;  4FXD A;  1WD1 A;  1SNM A;  1X3P A;  2JYO A;  3BDC A;  5IT9 L;  5BN4 A;  1BOS A;  2RKS A;  3A8I E;  1HHV A;  5G3L F;  3IFD A;  1LLR D;  2SOB A;  1SFO B;  1SNO A;  3A8K E;  5LL6 X;  2RSO A;  5LHY 1;  3N52 A;  1BQQ T;  5EKI A;  2ENB A;  4LJZ C;  2A69 D;  1S5C D;  2XWB B;  3MFG A;  3RMH A;  1EYD A;  3SVM A;  4FNF A;  2FMC A;  4BA2 I;  1STE A;  2K05 A;  3MC0 B;  1V1P B;  1EWH A;  1RTO A;  5ELC A;  3BVG A;  1KLU D;  2EVB A;  2MUY A;  4G7O C;  1ZYR C;  2HDL A;  3BG3 A;  4FF2 A;  2WV6 D;  4XYO A;  3I73 A;  2K01 A;  2K5Q A;  1SYE A;  1GUW A;  1A3U A;  3K6O A;  5JEA J;  2QKI C;  1K83 B;  1E0B A;  1I4R A;  3M7N A;  4R8I A;  1LTG D;  4KD3 A;  3IAY A;  5C4Z A;  4KK7 A;  1GUG A;  2K33 A;  4MN3 A;  4RAU C;  3TDQ A;  5JPM C;  4IUN A;  3TBI B;  4H7B A;  2B2W A;  3GTO B;  1T5X D;  5JOB A;  2F0I A;  2H1E A;  1JE4 A;  3NQT A;  3QWN A;  2TMP A;  1S5E D;  4DAY A;  2I07 B;  5KND A;  2F3W A;  2G9H D;  2KUM A;  3G7L A;  3S2H B;  2E2H B;  4P2C B;  2LMC B;  3IKJ A;  2AUK A;  2YU9 B;  2RDF A;  2Z1C A;  1A6X A;  5DNF A;  3CQZ B;  4RCN A;  1NCV A;  5CMD A;  1IW7 D;  1JWU D;  1H9J A;  1Q90 A;  4FO2 A;  4A3E B;  1CTM A;  5C6A A;  1DOK A;  2BA0 A;  5CC4 A;  2RSN A;  2EYH A;  3GTQ B;  3AMU A;  5C3E B;  3PUW A;  2K32 A;  3P1H A;  3L7Z C;  3C46 A;  4U67 3;  3DXJ C;  1B53 A;  2FHT A;  1LAB A;  3QO2 A;  1AFP A;  4K6D A;  2L55 A;  3S16 B;  4XTC S;  3SDZ A;  4QIW B;  5EQ0 A;  1KNE A;  3PUX A;  3HOV B;  4NKL A;  3M4O B;  3R2I A;  1V43 A;  3NK9 A;  3T13 A;  4XIG S;  4JK1 C;  1G91 A;  1OXU A;  1STY A;  2A6H D;  5JJZ A;  5KNB A;  1YNN C;  2NVY B;  3C2P A;  4KTA A;  2JEB I;  3X3N A;  4ZQ3 A;  1WVL A;  3BDO A;  2EDG A;  1HRJ A;  2D5D A;  1PZI D;  3A54 A;  3KLR A;  3MXG A;  5E4W C;  2CW0 D;  3TP8 A;  4O1N A;  3I3C A;  3K5O A;  1G6Z A;  4RWS C;  3JAM E;  1M8A A;  4EQP A;  4DK1 A;  2RA4 A;  5FK9 C;  5KGU A;  2E76 C;  5IGF A;  1DM0 B;  4EGV A;  4PV1 C;  3KK7 A;  2J7Z A;  3A8J E;  5E4X A;  2ZT9 C;  1HQM C;  1LTR D;  1NR4 A;  3H6M A;  5C3X A;  4N9P A;  2PO4 A;  2NVX B;  2NYZ D;  3CRK C;  2O5J C;  3FEW X;  4X3S A;  2NN6 I;  2A69 C;  2E75 C;  2QEJ C;  2Z4I A;  3P75 A;  2NVQ B;  2AQ3 B;  3MXP A;  4DU9 A;  2V4D A;  4L63 B;  4RKB A;  5I9O A;  2R3Z A;  1Y1V B;  1EY6 A;  3PMF A;  4WFN 3;  4TKO B;  2GA4 B;  1TY0 A;  5IGC A;  4Q0F A;  1G2S A;  3NQI A;  2HDM A;  4H44 C;  3VR5 A;  1Z6H A;  4CJ0 B;  4CJ1 B;  5C0X J;  1STH A;  2SNS A;  4IUT A;  2B8G A;  4KN7 C;  3V05 A;  1SE2 A;  3S1R B;  1EQV A;  2EOT A;  3C1E A;  2J0T D;  2XNA C;  1EY0 A;  5BN5 A;  1KAB A;  2OT2 A;  4QF4 A;  1Q3L A;  3OSO A;  1EIG A;  2MGS A;  4QCL A;  1STG A;  1K8M A;  1NSN S;  2NN6 H;  2RQX A;  3N6R A;  3K58 A;  1EYC A;  4IFD I;  5F2D A;  1C48 A;  1CHP D;  5I2Y A;  4K6L A;  1RD9 D;  3R3O A;  5FLX E;  3Q24 A;  1AZP A;  2XIW A;  4FXK C;  4K2L A;  3L9A X;  1R9T B;  1QNU A;  5EJW A;  2ZXR A;  1HTP A;  2F0O A;  3P20 A;  1O80 A;  5CV4 A;  3BYT B;  4RGT A;  1EOT A;  1HUN A;  3ITP A;  4Y7N B;  4DXG A;  1AW7 A;  3EVQ A;  1JWS D;  3RZO B;  3NP8 A;  2EJF C;  1U4P A;  4TRD A;  4KV6 A;  3LX0 A;  1EU4 A;  2L5T A;  2AQ2 B;  2B39 A;  1F77 A;  4X3T A;  1SDF A;  1DCZ A;  1O7L A;  1EYA A;  2NN6 G;  1WTV A;  1NAP A;  1EL0 A;  4C1N I;  1B1Z A;  4C3J G;  1D6E C;  2DNE A;  3H0G B;  4RA8 A;  1C4Q A;  3K57 A;  1TS3 A;  4IUR A;  1LTS D;  1WTP A;  2KCC A;  1CK1 A;  4F8M A;  1PRT B;  4C3J B;  1QIL A;  4A3K B;  2EPB A;  3WDN A;  1ET6 A;  2R6G A;  5KNC A;  4J1M A;  1Z47 A;  3HEJ A;  1SE4 A;  2X6G A;  1CM9 A;  3D4R A;  1HPC A;  1I4H A;  3L3O C;  4XXE A;  5IGG A;  2IWH A;  3GTJ B;  3MA2 B;  5JVG 3;  1STA A;  1MSG A;  3I70 A;  1ONL A;  3UI2 A;  1JOO A;  3ERO A;  3S14 B;  2MHV A;  2EZV A;  4GZY C;  1TWA B;  2EYL A;  3H94 A;  1OXT A;  3NWT A;  4IFD G;  2AWO A;  4ZUJ A;  3TME A;  1OXS C;  1SYB A;  1CQV A;  3R2T A;  2EYP A;  1I6V C;  3QOJ A;  4DN4 M;  4YIJ A;  3D3R A;  4CKB A;  1SMY D;  2JA8 B;  1IHZ A;  1BCP C;  1HCZ A;  1HA5 A;  3OIQ A;  5FLX L;  1U9R A;  5BN3 A;  2NTS A;  1SYG A;  1EEI D;  1KTK A;  3PO2 B;  3R93 A;  1PMR A;  2WKD A;  4OIK A;  1LT5 D;  1OO9 B;  1HXY D;  1F2L A;  1NR2 A;  1RTN A;  2N55 A;  3W3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...