2L5TA

Solution nmr structure of e2 lipoyl domain from thermoplasma acidophilum
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
77
structure length
77
Chain Sequence
MYEFKLPDIGEGVTEGEIVRWDVKEGDMVEKDQDLVEVMTDKVTVKIPSPVRGKIVKILYREGQVVPVGSTLLQIDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Lipoamide acyltransferase
publication title Solution NMR structure of E2 lipoyl domain from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
total genus 3
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l5tA00
3M7NA 2BE5C 2A68D 1T5EA 2JEAI 3MXUA 1E2VA 1Y8OB 5BN5A 4G7OC 4KMUC 1IW7D 5A35A 3A8JE 3H94A 4DK1A 4TKOB 1IYUA 1ZKOA 1H9SA 2AUJD 1TU2B 3T56B 1DCZA 1BDOA 4H44C 3M4YA 2D5DA 1HQMC 3FPPA 2CW0C 3BG3A 3PUXA 3PUZA 2A69C 1SMYC 2NN6G 3ND8A 1GHKA 3GD7A 3A7LA 3VR6A 4H0LC 3HGBA 2A6HD 1GHJA 4IFDG 1LABA 4DNTB 4KKTA 2NN6H 5BN4A 4G7ZC 2BA1A 3QIAA 3VR2A 2B8FA 5K36G 1Z7TA 3MFYA 1H9MA 1EWHA 3KLRA 1DXMA 4BA1I 2EJFC 2O5IC 1YNJC 4IFDH 1GJXA 1A6XA 1OXTA 2K32A 3PUYA 1Y8NB 1Z6HA 3NE5B 4GZYC 2EJMA 1H9SB 5K36H 3U9SA 2PNRC 3AB9A 3I4LA 3W3AA 3LWUA 1ZYRC 3EQLC 2E76C 2PPBC 3CRKC 2IT1A 4PV1C 4XTCS 4OGQC 4G7HC 2A68C 3L7ZC 3M85A 2D2CC 3ND9A 2BA0A 1OXXK 2PCFB 4L8JA 4KKUA 1IW7C 2DNCA 4LJZC 4BA2I 2D62A 3GQBA 4XIGS 1GUGA 4H13C 5BN3A 3OW7A 3PUWA 3WDNA 2O5JC 2EDGA 1LACA 2L5TA 1HTPA 3OOCA 2V4DA 4HR7B 3RLFA 2A6ED 1YNNC 1V8QA 1IYVA 1Y69U 2A6HC 1H9RA 3D4RA 3N6RA 2AUKA 3PV0A 3I73A 1B9MA 3TZUA 2DN8A 2EVBA 2JEBI 2NN6I 5KNBA 2R6GA 3I72A 4LK1C 1CFMA 1HCZA 2E74C 3BDOA 3VR3A 1Q1BA 1GUOA 2BE5D 3SE0A 1GUSA 3VR4A 3DXJC 2EJGC 4JBWA 2E75C 1Q12A 1VDZA 1GUTA 4I7ZC 2B8GA 2BDOA 1VF7A 4DNRB 3VA7A 3A8IE 1OXVA 3QG1A 3OPOA 2AWOA 1VF5C 1H9KA 2KA7A 3PUVA 3FMCA 3VR5A 1OXSC 1E2ZA 2A69D 2LMCB 3A7AB 4IQZA 3T53B 2YYZA 3P20A 4OO1G 4JK1C 3SDZA 2K33A 3LNNA 1PMRA 4DK0A 1FYCA 3D31A 4KKSA 1B9NA 3IFTA 2JE6I 2K7VA 1GUNA 1O7LA 1E2WA 1FR3A 4RCNA 4OO1H 1HPCA 1ONLA 1TKWB 1Y8PB 1G291 5C0XG 2ZT9C 2A6EC 4KHZA 5JEAG 1K8OA 3IKJA 5KNCA 1I6VC 1VCIA 2QF7A 1H9JA 3A8KE 4KI0A 2KCCA 2F1MA 1CTMA 4TQUS 3T51B 1OXUA 2Q8IB 1Q90A 5KNDA 1O78A 1CI3M 1DD2A 2DNEA 2JXMB 4KN7C 1K8MA 5C0XH 5JEAH 1Q1EA 3QJYA 4KN4C 1QJOA 1V43A 3CRLC
chains in the Genus database with same CATH superfamily
1LTID 1O7ZA 3G6EA 2EYJA 2R92B 1QVCA 1K8AC 2UXCQ 4X66L 1Y8OB 2QDBA 5BN5A 4RGMA 3ULPA 3L9AX 4LF8Q 4C3IB 3AMUA 4DK1A 5M5XH 1EYDA 1YHAA 4CBVA 2K75A 1SRUA 3U9OA 3DWQA 1U4LA 5C44B 4CDEC 3HOUB 1GHKA 1IYJB 2F3VA 4JI6L 1EU4A 4R4TA 4A75A 4Y7NB 2YTVA 2LXKA 3BDLA 1WCMH 1NE3A 2PW5A 2RBMA 3CMAA 1BBWA 1DXMA 5CC4A 5C6AA 1AEXA 2EJMA 1DOLA 1PRTB 2N8NA 4ME3A 4V0BA 3VYSA 4DK6C 3CHBD 1PH8A 1PYSB 4YCWA 1Q82C 1EIFA 4KHVA 3R8BA 4DV7Q 2L11A 3TRZA 4PV1C 1B53A 1HA6A 1LTLA 3T13A 2QGQA 2ES2A 4C3IG 2ZJRA 1MHWC 1IW7C 2VB3X 3S15B 4K14A 5C44G 3OWFA 2SNSA 2EY1A 5I2XA 3CAMA 1ESFA 3ERQA 3K6OA 2F03A 2UUCL 1QOHA 4ZKCB 2QDLA 4P71A 2B2YC 1Y1WH 2D0OA 3NPPA 1EEFD 1JJ2A 4HMIA 2YU9B 3QOLA 4NXNQ 2CQOA 4DR7Q 2AWNA 1J5EL 2E75C 1VDZA 4XQNA 4WJ4A 1SBBB 3VA7A 1JMCA 2KEEA 4B3MQ 3K7AB 3QG1A 3PUVA 1VF5C 3CCQA 1DM0B 5F2DA 1A3VA 4A3EH 1JWMD 3A7AB 4PQXA 3U58A 4DAPA 4B3RQ 2IL8A 3OSOA 4QIWE 4X3KA 3D31A 1QVGA 1PZKD 3F2UA 2WV6D 1PRTC 1HPCA 1ONLA 2MNAA 4H7BA 3UDFA 2QILA 2EYLA 1SYFA 1OXUA 4TRDA 3J80L 3DEOA 2F0FA 4OHJA 1GUWA 1F2ZA 1S5CD 1YJWA 4DA2A 2JEAI 1TIID 3R3OA 2F0UA 4A3DB 5J3BA 2B2VA 2SDFA 5LMUL 4WFN3 5JVH3 1WTXA 4AQYL 4G7OC 3F8TA 4GN5A 1PYBA 5A35A 1N36L 5FO8B 1IYUA 2AUJD 5I4DA 2LXJA 4BBRG 2B39A 5EKKA 4H44C 4JI0L 1LT4D 3I4NH 1PV4A 4H0LC 3OHXC 2KEDA 3K8AA 2EYPA 3RNUA 2VUMH 1YJ9A 4GLXA 1LABA 1HQRD 4KK7A 1I5FA 4POGA 3IL8A 4DR5L 1EWHA 4IFDH 3S14B 2EJFC 4JYAL 1BBXC 2RSNA 3ONAB 1K8GA 3HOXB 1IKMA 3D6WA 5C0XI 4DV0Q 2LS01 1F9RA 1P8LA 2IT1A 2Z9HA 1NJIC 1IL2A 3CC7A 3M85A 2FHTA 5FO7B 3SK6A 1ILQA 1EZ6A 3KF8A 2E5LQ 4DV5Q 3WDNA 1F9QA 5JVG3 3NTKA 4IUPA 1PH3A 1WCMB 1WTWA 4GNXC 1SJHD 4WORA 4K8JA 3I73A 3X3NA 2RCFA 1X3GA 4RKBA 2UU9Q 4QQBX 2PMZE 3SGIA 3HOXG 2IJ0A 3F2BA 1BKBA 3G6JB 1GUTA 5FOBB 2OF1A 2F0TA 4QMGA 1HNZQ 4QF4A 4XXEA 1B1ZA 1STAA 2CW0D 5IYDH 4A76A 1TWGH 2E8GA 2K1BA 2YYZA 1IZ6A 2GA4B 3WOFA 1PMRA 5CORA 3RZOH 3H09A 3D6CA 4CKCA 1LYLA 2NVXH 3L0OA 1YZ6A 3URYA 4YY3L 5IGBA 4Q5VA 4LF7L 1UE6A 1VQEA 4JI5L 4BXXH 5KRUA 4DV2Q 2K52A 3OWEB 1TWFH 1KAAA 1TS2A 2WKDA 1Y1VH 4JCVE 1SE4A 2EOTA 2WIIB 2BE5C 1XNQL 4DAYB 2MFIA 2ICEC 2DJGC 5JJZA 5E3FA 4DR3L 1E2VA 1FVIA 1A15A 1E1TA 4A3EB 3PCOB 3H94A 1S4ZA 4P73A 3T56B 1DCZA 3NQTA 5LMNW 5CMDA 4KJOA 4K5WA 1SMYC 3S1MB 1YNND 1K73C 1T5XD 1HZAA 2IWHA 4DV4Q 3CF5A 2ZTEA 5C3EH 2RDFA 3J81L 3GTJH 2ASBA 2IPKD 3PUYA 1VQBA 5IOCA 2JA5H 1EZ8A 2OXPA 3M4PA 2F0JA 3LWUA 2QA4A 4LF8L 2E76C 5HGQA 1FNVA 1TXYA 4OGQC 2A68C 3SR1A 3A5UA 1F9PA 2B63G 1CQVA 2D2CC 2N78A 2XN9C 3KDFB 1HR0L 3PO3H 1VQJA 3I4NB 1VQDA 4UP8A 3R2IA 2VUMB 4ZK9B 3J7ZC 1XMQQ 1V8QA 3BVMA 4C1NI 2KHJA 4F8MA 3SHLA 4X3SA 3S17B 1D6EC 2MO1A 1PH6A 4JI1Q 3CCMA 1G8ZD 2L15A 3BDOA 3E5SA 4DR4Q 4DV7L 2JSOA 3OIPA 4C56C 4G4KA 1WTVA 5ISRA 4DNRB 4ZCKA 3M3YH 1WTHA 1BVSA 2Z1CA 3NENA 1ET9A 2PO4A 4UPAA 3C2PA 3JAMc 4EQOA 5J22A 4RGTA 1FD7D 4POFA 2JA6B 3I3CA 5I9PA 1LT6D 2RDGA 1EY7A 5CBAE 2L1BA 5ELEA 1FR3A 2V1CC 4IUTA 2H1EA 1SEBD 2R93H 3PIPA 5KNCA 1GOZA 1QG7A 1L0YB 2B2WC 4DXGA 3KDFA 3TZDA 3J7YW 4FXDA 5E1FA 1FGBD 2AQ2B 2KBNA 4B08A 1F77A 4B3SQ 1MSGA 2PZWA 2Z6BA 2XSCA 4JI8Q 3CRLC 5FLXL 4LFAL 4GN3B 1BNZA 4L5SA 3PQIA 1IW7D 2ZTDA 1N32L 4A93G 4B3RL 1AH9A 1I4PA 2LSSA 3AFQA 5IODA 3RZOB 2JA6G 3CXCA 3STBD 2RCNA 2NVXB 1NNXA 4ZYSA 1JQYD 4RKLA 4HIOA 1EIHA 2ZXRA 4IOCA 1TWFB 3MFYA 4DR1Q 1SE2A 3NTIA 4A4IA 2PZUA 1Y1VB 1EYAA 3HKZG 4P74A 4RG1A 1D8LA 1IBKL 3S1QH 1EY6A 5D65A 3EQLC 3CRKC 3NUCA 1YHQA 3HOYH 2F0KA 1OXXK 2PZTA 3TDQA 2NZOA 1YEZA 2KCMA 1O7YA 2HCCA 4NPSA 3HOWG 3T16A 3PUWA 1PRTD 5C5LA 1UWVA 4Q0FA 1HTPA 3BZDB 3RLFA 2LFNA 1O80A 5C3EB 3GTJB 1H9RA 4KLKA 3AFPA 3I91A 2R6GA 2JA5B 4JC0A 1G2TA 3EVQA 3KLSX 3SE0A 4L63B 1NUCA 1VMCA 1B3AA 2O2LD 4FVMA 2A74C 1I4XA 3PF5A 1VQMA 2F0IA 3PIOA 2A73B 2BDOA 4MNOA 5BR8Q 3T1YQ 1H9KA 3D4WA 2KHSA 4RCOA 1LT3D 3PO3B 1S5DD 1C9OA 2E5LL 4DV5L 2SOBA 4DV6Q 1Q81C 3UDXA 1SE3A 4A3GH 3NHHA 2OQKA 3BZKA 4PG3A 1B70B 1EQTA 1B9NA 4GS3A 5C4HA 4DUZQ 5CV9A 4IUUA 2F0VA 2EY5A 2QF7A 2F1MA 3T51B 4OEMB 1Q90A 1CUKA 2WAQG 5KNDA 2DNEA 2I5MX 1X3PA 4R8NA 1ML0D 4HIMA 4DNIA 1HNZL 3TS2A 2I5LX 2JQOA 1VMPA 3M3YB 1RJTA 2F0NA 1XX8A 4B9XA 4RMFA 2ZTCA 4CJ1B 3FPPA 1HUNA 4JI2Q 2NN6G 1I6HH 5IP7H 2OCEA 3J80i 1B44D 3NP8A 4X3TA 1GHJA 2R93B 4HEDA 2OT2A 4DNTB 4DV2L 1TY2A 2B29A 3AEVA 1XJVA 1Z7TA 2HIVA 4QIWB 4FYDA 4IUQA 4HJ9A 1TWCH 1A6XA 4AYBE 2JA7H 4YIJA 4C3JH 5EKIA 3H0GG 3NELA 4X64L 3DLLA 3DHQA 4DR2L 3Q6SA 3FHWA 3ND9A 2UXDQ 1UUPA 5C0XJ 1A2UA 3T1HQ 3HOZG 5ELNA 1OTCA 1BCPC 3J80c 1KLUD 4N9TA 4A3MH 3A54A 1AN8A 3A55A 3MEFA 2M9VA 2F52A 1JJCB 1CT1D 2DUDA 2CH4A 3NXWA 1S40A 3W1BA 2Y0SE 5EJWA 2BE5D 1TWAB 3HG9A 2EQSA 4JI3L 3V05A 3A8IE 1MGSA 3I7FA 5IP9H 3EBEA 3HOYB 1EY9A 4A3IG 2MHVA 1N8RC 4HIKA 4K2LA 4DFAA 3CC2A 1NCVA 1XMQL 2ID0A 1WD0A 1NR4A 3GV3A 2HIXA 5IWAL 4UP9A 2XNAC 2JE6I 2J4XA 1GUNA 4A3CG 4L5TA 4HJ5A 4LMQD 4JI1L 2ZT9C 2A6EC 1PLFA 5IGFA 1ESRA 1CQFA 4IZ8A 4TQUS 1I3QH 2K04A 1X32A 5FJ8H 2R7ZG 2HCIA 1Q1EA 2VQFQ 2RHQB 4ID6A 2A68D 2HDLA 1E0BA 1JCKB 2UXBQ 5HURA 4A3FB 5CR3A 2PMZB 3BU2A 4X3UA 1FNUA 2PI2E 3SXHA 4TKOB 5CV8A 4JOIA 1H9SA 5E4WC 4OXPA 1CA6A 4BBSG 1KNEA 1E22A 3CCJA 3SK4A 1KLGD 1L2FA 4IO9A 4BY1H 2YV5A 1ENFA 1BBUA 1X9NA 1VQ7A 3NBHA 1D1KA 2F0MA 5IT9E 1EOTA 3FP9A 2AMCB 3KBXA 3LX0A 5CYUA 5I2YA 3HOVH 2WACA 4K0KL 3KLSA 3EN2A 1GJXA 5AFWA 4A3KB 1EQRA 4GZYC 2EIFA 4APVA 1VS0A 3P1HA 3IAYA 2YTYA 5FLMG 3CCRA 3ER0A 1PZJD 3L7ZC 5ELFA 2CH4W 1XWEA 4CKBA 1LT5D 4A3FG 1YJNA 1K9MC 2BA0A 4FP5D 5JEAJ 4DKAC 2KQ3A 4HSVA 3J81i 1VQ5A 1PA6A 2PQAA 5IYBG 3A5ZB 3KFUA 5LMNQ 1ENAA 4DV3Q 1LTGD 1LACA 4LF5L 5IGGA 4DR1L 3KK7A 2AUKA 4PMBA 1B9MA 3KOJA 1JOOA 1TWCB 2QW7A 1FJGL 4CJ2C 2JA7B 4MZ9A 1L0WA 3VR3A 4C3JB 3RN5A 5EPLA 2R92G 4A3KG 1PYWD 1HFNA 1YBYA 4CHTB 3W2DA 3BDCA 4R4IA 4DAVA 1KL9A 4IOAA 5CV7A 2K5DA 2HUGA 3J81c 3HOUG 2LMCB 4LF6Q 1CKNA 2WFWA 4A3MB 3S2HH 4OO1G 1M90C 2B2YA 3P75A 5C4ZA 1XTCD 1HA5A 3C46A 2F4VQ 1VQHA 3G4SA 5FO9B 3IKJA 4LUZA 4XYOA 1SYCA 2N3SA 3TP6A 1XPRA 2N55A 4XQJA 1QE6A 1G6PA 3QJYA 5DNFA 2Z6KC 1HNXQ 4DV6L 3BS1A 3S16H 2YTXA 1TU2B 1F2MA 3GTPH 4UHVA 4KY7A 1E3PA 1V9PA 4OIKA 4DUZL 5M5WH 5JJLA 3VR6A 3A7LA 4HJ7A 3EFXD 4DN4M 1EEID 3GTMH 4JG2A 4LFBL 4GKKQ 4B3TQ 3VR2A 2TMPA 3H15A 5K36G 1I3QB 1H9MA 4GNXB 4DAMA 4ALPA 5EKLA 1YNJC 1V1OA 1Z6HA 3FKIH 3NE5B 4LUVA 1IL8A 4DUYL 1GVPA 4O2DA 2A8VA 1ZYRC 1PH9A 1SSOA 1X54A 3ITPA 4N8FA 1IHZA 2A5HA 3KBGA 1S3OA 1IBLQ 2AKWB 1Y14B 5C4XH 1X3QA 4P72A 1AE2A 1ET6A 4BY1B 1RHPA 3OYYA 5D3DA 5BN3A 1KIXA 2E2JH 2CQAA 2O5JC 3ZYYX 4KY6A 5FLXc 2I0QA 3M4OB 4NDXA 3VYUA 3IRBA 1I50H 3KUPA 1KRTA 3HOVB 1STBA 3W1GA 1TWHH 2HT1A 3SEBA 3R2TA 1CFMA 5D3IB 1W3SA 1SNOA 1WD1A 3G71A 4A3DG 4MTKA 5M5XB 3M4QA 4BY7H 1JE5A 2B8GA 2KJXA 2UXDL 5E7NA 3T1HL 1XNRL 2X6LA 5D14A 1STYA 4GNXA 4FXGC 3GO5A 3OMCA 1G51A 3HS0C 2FINB 3FEWX 5M3MH 2F0HA 1S5FD 4RCNA 5ELCA 2F3IA 1Y8PB 3BZCA 3CPFA 1QILA 1H9JA 3HZXA 1K8OA 4NW2A 1Q86C 3ICEA 1V1PB 1I4HA 4PZ6A 4C2MH 5C0XH 2E2IH 2EXDA 1UE5A 1HJPA 2PQEA 4K5VA 5I6WA 1QNKA 2K03A 4KD4A 1DYQA 2BDNA 3TP8A 1BCPD 2R61A 3E6ZX 1EU3A 3S2HB 3S1RH 2D5DA 4LW1A 4IUNA 3FPUB 1WCMG 1Y1WB 4LF4L 4JI4L 1BO0A 4LUOA 5C5MA 3OTOL 2HDMA 1S72A 1HZBA 3K59A 1Q8KA 5DAUA 2NWGA 3K7UC 5HY6A 3CKIB 4MTNA 2IX0A 3U9SA 2UXBL 5IYCH 3CQZH 2K5QA 3MC0B 1QWYA 4X62Q 3L2PA 2AQ3B 1IBML 4NXMQ 3GTPB 3D0FA 3CCSA 1LV9A 4GOPC 4OX9Q 2JA8H 3GV6A 5M5WB 1KTKA 2VQEQ 1STGA 5EAYA 1V1PA 1AZQA 3GTGH 2X6GA 1Y1WG 3GTMB 1RD9D 1N34Q 1HR0W 2A6ED 3H91A 2K28A 5FKAC 1HNWQ 3Q22A 4KTAA 5GADC 1ENCA 2NN6I 1PH4A 1UEAB 1STNA 2UXCL 3NTHA 5KEEA 3FKIB 3I72A 1II3A 3AYHB 1Q1BA 1CSPA 4K2KA 3VR4A 3NSWA 5C4JH 2QKIC 4JBWA 4C3HH 4A3EG 3BYYB 1E1OA 1AFPA 3Q24A 5J1ZA 4LWCA 2Q2UA 3MZ5A 1BCPF 3S2DH 5HGTA 2XRQD 3JAMi 2N88A 4YWKA 3TSSA 4AYBB 3QB3A 3D3RA 5E4XA 3T53B 5CBEE 3H3VI 1MSHA 4DV3L 4DAYA 2E2JB 1VQKA 3HKSA 4E6IA 1EY4A 5GAHC 2XTIA 3HFZB 1WTQA 1X3EA 3FVQA 4KJNA 1H95A 2L0CA 4A3LH 1DGSA 2CVRA 1JB7A 1QNUA 4KD3A 4N8X1 2NVQH 5JEAH 4BY7B 3GTLH 1QJOA 1YITA 4PMWA 4L5QA 5KGUA 1VQOA 1T5EA 3MEHA 4LF6L 4KMUC 1VQGA 2Y0SB 4OWWB 3I4NG 3A56A 4FNFA 2OTLA 1L1OC 2VUMG 2C5CA 3TP5A 2IHEA 1FL0A 1KNAA 2GVBA 2F0PA 2F4VL 4LFCQ 2B2WA 2KVMA 5M3MB 2UUAQ 2VB2X 2K01A 3HGBA 2OTJA 3IFDA 4NXNL 1JOKA 4IFDG 4DR7L 2ZXPA 2F4IA 1LO5D 4U68A 1GO3E 1FGUA 1PTOF 2JJQA 5BN4A 2NUCA 2BA1A 5EPJA 1QVFA 3PIP3 2WB1B 4DV1Q 4B3ML 1D5MC 4ZUIA 3KLRA 3U4VA 4LF9Q 2E2IB 3GP7A 4C2MB 1OXTA 3E9IA 1NMFA 2K5NA 3KYHC 1TWGB 4TSSA 4KHPQ 2CWAA 3UDGA 1N33Q 2RF4A 3H6MA 1PTOH 4G7HC 3DUZA 2A19A 2K5VA 3LGJA 4EGVA 4R9WA 1MJEA 4A3BH 2Y0SG 2F0GA 3OIQA 4KKUA 1NMGA 3TP7A 1G6ZA 5CV4A 4IUVA 1E24A 1GUGA 2PNHA 1UNSA 1UE1A 1E7ZA 2EDGA 2JN4A 1U4RA 3J7A5 4B3TL 4TVAB 1DOMA 4PNYA 4IALA 4QUCA 5IIFA 5DLQE 4R1JA 3KJOA 2K6AA 4YWLA 1EL0A 1T9HA 4JI6Q 2I46A 1DONA 1ZEQX 4ZQ3A 3K5MA 2EJGC 5EBCA 3CCLA 1J8IA 5IYDG 3PO2H 1PHJA 1PFNA 1VF7A 1WFQA 4GN4B 4ABNA 4F88A 5LHY1 2EE1A 2JA8B 2MPMA 2N49A 4RA8A 1L0XB 3O13A 3P20A 2F0DA 4BXXG 3IFTA 2LKVA 2XWBB 2F0QA 1O7LA 4A3JH 4FDBA 1WOCA 4DV0L 4JV5Q 3A74A 1Y1VG 1YNJD 4HCSA 1ICFB 1EIYB 3RUZA 2B2UC 5C4JB 3I4MH 5A2QE 1ZYRD 1B4OA 3JC66 1BQQT 1VQ4A 5EBDA 5M3FH 3C3LA 3S2DB 2IY5B 2UUBQ 3PIO3 4Z9CB 2AQ1B 1N9WA 4QB4A 2PW7A 4NB3A 3RMHA 3A8JE 4IPHA 2ICIA 5GQOA 5JPNC 1BDOA 3M4YA 1J5EQ 2MQHA 4QJFA 1MD2D 5T1IA 3TMEA 2RSOA 4DXFA 4UAIA 1AZPA 5C3EG 1VQAA 2Q8RE 1GXDC 2UU9L 1LTSD 4ILWA 1BCPB 2BOSA 1K3RA 1TVXA 1JR0D 2JA5G 1VQCA 2Q2TA 2B8FA 1MJCA 3K57A 2NVQB 1GKHA 1A62A 3G48A 4DK3C 4QY7A 1Q46A 2NVTH 3K58A 1Q3LA 3PO3G 3BVZA 1NAPA 4EQNA 5I6YA 2GVAA 1M1KC 1VQ8A 2NYZD 4LJZC 4PZ8A 1BF4A 2R92H 1EYGA 3FRPB 3WOEA 4IFDJ 1I4RA 1B3QA 1JB3A 1A63A 3TQYA 5CV6A 5LMUQ 3I55A 4C3IH 4AQYQ 2Q2IA 2V4DA 1PH2A 2KENA 3SVMA 1N36Q 1D2BA 5C44H 3N6RA 1CA5A 2JEBI 1NTGA 5KIXA 4JI0Q 1I4QA 1KDAA 2VS1A 2G9HD 1WTOA 1GUOA 4IJHA 2Z4HA 3DXJC 4AH6A 5DM73 4UDUC 1EYCA 1PTOB 1D5XC 4NXML 1LTAD 3OPOA 2JYOA 1PFBA 3VR5A 1OXSC 1SLJA 1KXLA 1I4GA 4DV4L 2NTSA 1HUMA 4HCEA 2RHSB 4IQZA 1XXGA 1ASZA 1CZWA 2FXQA 3SDZA 4JI7Q 2R93G 1HNWL 3J7AV 3F2DA 1PVOA 4GLAC 1UEBA 2Q8TA 2EYFA 3S1QB 4R4OA 1K0SA 1EIGA 1VCIA 2WINB 4RFBA 2Q8IB 3OMGA 2B2TC 1WTRA 2D9UA 1BXTA 1LLRD 1X55A 3E0EA 2EY6A 4KN4C 4N9PA 3BYTB 1CHQD 1SMYD 1U9RA 3MXUA 4IPCA 5NUCA 1A0IA 1U0LA 2WB1E 1VQ9A 3MVVA 4YCVA 4ZLTF 2E2DC 1TS5A 3PUXA 1MBYA 2A69C 4IJLA 3GD7A 3HP3A 3U4ZA 3UI2A 4HN7A 3CP0A 5IT9L 4BBRH 4A3JB 3V96A 4DR4L 2L4NA 4OWTB 3RN2A 1R9TH 2NZHA 2OEOA 1PTOC 5G3LF 3I4MB 4BA1I 3JAME 4BWGB 5M3FB 1DJRD 1PZID 3HOYG 1K83H 2OQ0A 2Z8LA 3W3AA 3AB9A 4FF3A 4JI5Q 3NEMA 2NZ1D 1HFGA 3S1NH 4A3GB 4CDFC 1XPUA 4XDXA 1LTRD 4CKEA 4LFCL 2DNCA 4DF7A 2UUAL 4BA2I 2MO0A 3GQBA 5JJKA 3F1ZA 1W2BA 5EGTA 4H13C 2VL6A 1LUZA 4DR3Q 5IGEA 2M2LA 4B3SL 4EVOA 2M00A 4JI8L 2FFKB 3BJUA 2EPBA 1HTLD 2TSSA 2J7ZA 3SK5A 1HCZA 2E74C 2NVTB 3DEPA 4K5XA 1SYBA 3S14H 2X69A 4A3GG 2KA7A 1I6HB 3HOXH 1W6KA 5IGCA 1WTPA 2G5DA 4X65Q 4QGUA 3WWVA 4ULLA 4IPGA 3BVGA 4I65A 3HRZC 1SYGA 3Q8DA 4X6AH 4KKSA 1EFID 4K8IA 2F0WA 4RWSC 1YNXA 1HR0Q 1PFMA 1PXUA 2WAQE 5M5YH 1ILPA 1JT8A 2BH2A 4KI0A 1WJJA 1KHIA 3W5OA 2BH8A 1EUJA 2MGSA 2IW3A 2K32A 1VQFA 2EYHA 4OWXB 2DGYA 3QR8A 5DEHA 5LL6S 3DMUA 2EXZA 1QZGA 4DR6Q 3MHBA 5IP7G 3M7GA 3CD6A 3AU7A 1VQPA 1HXYD 4EQPA 1SFOH 2SEBD 2IX3A 1EQQA 1ZXTA 4I7AA 5JJIA 4PZ7A 1C8CA 4JV5L 3NBIA 3K0YA 2AHOB 1KDCA 4LAAA 4KKTA 5ELOA 1PDQA 4HMJA 2Z6KA 2JA7G 2MP1A 4C3JG 1JWSD 5BR8L 3T1YL 3STBC 2OWOA 1QZHA 3MXPA 1PH1A 1CM9A 2UUBL 4L6TB 5AJ3Q 4XYQA 3ULLA 2IHFA 3I4LA 3KLWA 1AE3A 2MUYA 1K28A 1SR3A 4WJWA 4BS9A 1FNWA 1X65A 2NBFA 4A3MG 1GD7A 5IGDA 4R4CA 1LM0A 4LFAQ 4BBRB 2B63H 4RAUC 1VQ6A 3DWPA 1TS4A 3ULJA 4DGZA 1R9TB 1CHPD 1N32Q 1HHVA 3EJIA 1Y69U 3D4RA 4MIUA 4J1MA 3S1MH 3KF6B 4M8AA 4H02A 4EQ5A 5IP9G 1Z47A 5IE8A 4IFDI 1K83B 1B2TA 1RIPA 4OIJA 5EQ0A 5GAGC 1YHBA 1STHA 2LY7A 4WJ3M 2ZM6Q 3U50C 4JI2L 3S1NB 1P16A 2HD3A 3KF8B 2K5HA 3QO2A 1IBKQ 2RKSA 2RVLA 4NMZA 4JK1C 1WVLA 1D1IA 3E3XA 2K33A 4OL7A 1TR5A 2B2VC 1K3BC 1B7YB 3CU7A 1E2WA 2HHHQ 1NSNS 3SK8A 5FJ8G 1R4PB 3A8KE 1F2LA 2F3WA 3B6YA 3K80C 1CI3M 1LTBD 1K8MA 1XTDA 2F0EA 4MN3A 3J80E 1V43A 4HTHA 3CC4A 2IX1A 3S17H 2JP1A 3GTKH 1Q8IA 2F0LA 4BY1G 1C0AA 4JI7L 4HAEA 3I56A 4J15A 3KF6A 1JICA 3HEJA 3VYTA 4KV6A 1EWCA 4A93H 4GOPB 3HOVG 1UE7A 1XMOQ 1SNCA 4DPGA 4RHRA 2P5ZX 5M5YB 1S5BD 1A2TA 3MAQA 2JA6H 2RDHA 4G7ZC 2Z4IA 1X3FA 3QIAA 2CWPA 2B3GA 2VXWA 5KYLA 1W6JA 3AQQA 3S9WA 1X56A 2K5WA 4PMCA 4V190 3K5NA 4XTCS 3DM1A 4GLVB 4QUFA 1JORA 1A3TA 3RZDH 2G9DA 1SDFA 4RHSA 2PCFB 4ZKBB 1SFOB 5JOBA 2XRSD 2Q2HA 3VDYA 2ENBA 1QUQB 1OO9B 2DJFC 4ME5A 3HOWH 2VQFL 2NB0A 2A6HC 3PV0A 2DN8A 1XPOA 2K05A 1SXTA 3CPWA 3E9HA 3S16B 3OW2A 1YIJA 3MA2B 4R4QA 5FK9C 4GOPA 3D4DA 1Q12A 2EZVA 3I70A 1DZ1A 1OXVA 1IXRA 1EOVA 2AWOA 3I8ZA 2FMMA 3FMCA 1TS3A 1PFSA 2A69D 4IN3A 2KUMA 2B63B 4X64Q 1MKHA 2GN5A 4J6HA 1L1OB 4DR2Q 2CHBD 1WYDA 4L5RC 1PTOD 4OELB 5J39A 4GKJQ 2VZAA 3K81C 5GAEC 1G291 4CDCC 3V2TA 1J6QA 1I6VC 3GTQH 2KCCA 1DD2A 4KY5A 4JBKA 1KDBA 1KD1C 1QCBD 4QCLA 2SNMA 1SN8A 2WP8J 1MIUA 1VQIA 5C4XB 5T1GA 3M7NA 1C48A 4U673 2KECA 4HIDA 1QUQA 2KHIA 2NVYH 5LMNL 4AIMA 4X65L 3GDEA 3F2CA 4ZRZA 4F87A 1F9SA 2FJ2A 5IY0A 5JAVA 3MXGA 1S5ED 4JI3Q 1HQMC 1STEA 1I50B 4EX5A 4ZUJA 5K5PA 3ND8A 2QEXA 1AW7A 1TWHB 1I94Q 1EFWA 1QB5D 2NN6H 3FKIG 1GM5A 5EPKA 4HSPA 2ZJPA 2C35B 2PYKA 3PF4A 4Y52H 3J81E 1TY0A 3LWEA 5H1SE 5IWAQ 4DU9A 1IKLA 2CKZB 1ICWA 1SE8A 1HZ9A 3NQIA 4YHHQ 3RR5A 3EIVA 5LL6X 4R8IA 1L1OA 3GTKB 2PNRC 1RDPD 5C4XG 4AYBG 4DR6L 1D5ZC 1KAWA 1M4VA 2XVSA 2H4OA 4RGNA 1RTOA 3H0GH 3H3VH 1SNQA 4L8JA 1WI5A 1KQSA 2KCNA 4A93B 3NWSA 3OW7A 2L5TA 3OOCA 4RGOS 3HOZH 4FF4A 3KJPA 3MXNB 3PSIA 2EYMA 4P75A 4QL5A 3X3MA 1RTNA 1M8AA 1C7YA 1HNXL 4BY7G 3RLOA 5AJ3L 4ODGA 1C4QA 1SYDA 1Z9FA 4UY8C 1JE4A 5IT9c 3HKZB 3S1RB 4P2CB 4HJ8A 3RZDB 1CKOA 1EY5A 4K0KQ 1X6OA 4X66Q 3RLNA 4O1NA 5M3MG 4GKKL 2CFMA 1EY0A 4A3IH 3DWAA 2I5HA 3GTOH 1SNMA 3HOWB 5ELDA 5CGKA 3VYRA 2WB1G 2MJ8A 5TSSA 3QOJA 4J8QA 1RCVD 5C0XG 4NP5A 3CQZB 2Z0SA 4A3CH 4CDDC 5A2QL 4CJ0B 3T4AC 2J0TD 3CMEA 2ZM6L 1IBLL 4LF5Q 4JBJA 4KN7C 4ZAIA 2L12A 4C1NK 2DY7A 2ATWA 3NK9A 2K14A 3I4OA 5FLXE 1FJGQ 3MXNA 1CZGA 3D8GA 2R7ZH 1TWAH 1PH7A 1KC8C 3GTGB 1SAPA 1NR2A 1SROA 4K6LA 2HHHL 2B2UA 4BBSH 4FO2A 2QCPX 4HJAA 3ERSX 5JPMC 3GTQB 4C3HB 2UUCQ 1AP0A 5IYCG 3N52A 5ELBA 2K50A 3S24A 2PI2A 3UE1A 3I2ZA 2WAQB 2NVYB 5GROA 3CCUA 3ZJYC 1RF2D 1G91A 4FF1A 2JA8G 4FXKC 1BOSA 2EYOA 1HH2P 1EWIA 1A8VA 3MFGA 2L55A 2VY3A 3A0JA 2D62A 3EA6A 5FLMH 2F0OA 3J7AF 1XMOL 1HRJA 4A3FH 4OO1I 3C1FA 4RH6A 1XYIA 2FMCA 2KCTA 4HR7B 1CK1A 2EY2A 1IYVA 5IYBH 2RQXA 3GTLB 3K5OA 4LNQA 3TZUA 1SYEA 2JA9A 4C3HG 3C1EA 4O0AA 4YCUA 3K0XA 2F0SA 4OONA 4G57A 1JWUD 1R4QB 3L3OC 1GUSA 4JW0A 2HQLA 4LFBQ 3QWNA 2E2HH 4K6DA 3PGZA 2QEJC 3H0GB 4A3KH 1E2ZA 1SNPA 4JBMA 2R7DA 4DUYQ 3MTSA 1K0RA 3LNNA 1RODA 3HOUH 3HOZB 4XT1B 1FYCA 2HQEA 2ZXOA 1YI2A 1PRTF 2K7VA 5I9OA 4A3LG 3DM3A 4OO1H 1KRSA 5G3LD 4Y7NH 4KHZA 5JEAG 3TBIB 1ASYA 2KOLA 1HZCA 4MHEA 4IPDA 1CTMA 2R7FA 3TREA 4X62L 5L37A 4DR5Q 5DM63 2JXMB 1U4PA 4A3BB 1TT2A 4M1UB 5C3WA 4JYAQ 4NKLA 4OX9L 4XQQA 2DY8A 1D7QA 1DOKA 2VQEL 5KYIA 3TS0A 1BUVT 1O7IA 1N34L 2C9OA 5C3XA 1ZKOA 2BCOA 4A3IB 2O4XA 3PUZA 2XIWA 2CW0C 3BG3A 3S15H 4CGYB 1EQVA 4GKJL 2I07B 2VW9A 4JVZA 3GTOB 3MWYW 3FDTA 1XNRQ 2A6HD 2CCZA 2B2TA 2H5XA 2JK8A 1PH5A 3EROA 3PO2B 1EY8A 3JAML 2O5IC 3H3VC 1JJGA 1Y8NB 1J9OA 2YU9H 1H9SB 5K36H 4A3BG 1B8AA 3K5LA 3CW2C 2ZJQA 3Q0AA 2R7ZB 2PPBC 3RD4A 3UDIA 3K7AH 1A3UA 3NBHB 1MI2A 4XIGS 3I90A 3G7LA 1I94L 2NTTA 1VQLA 3HKZE 4BBSB 1G2SA 3UE0A 1UAPA 1YNNC 5COYA 1BR9A 1F2YA 4F7XA 2EVBA 3J81j 5KNBA 4YY3Q 4YHHL 1TQOA 1SNDA 4LF7Q 3PO2G 4LK1C 1SJED 5M9OA 4LF4Q 3TEHB 3VA5A 4JI4Q 1NY4A 2L9HA 1V1QA 4I7ZC 3OTOQ 2PQAB 3P7JA 3NWTA 3M9BA 3TN2A 1XNQQ 4S3SA 4A3DH 4XT3B 1Q7YC 1CSQA 1RKNA 5CV5A 2ALYB 4O42A 4FF2A 2WKCA 3E0JA 2XWJB 4B9WA 4A3JG 2RA4A 4DV1L 1NBWA 2R3ZA 3CCEA 1LTTD 4LF9L 4WRDA 4DK0A 1CKMA 2K4KA 1IBMQ 4JOIC 1KABA 4IURA 2A1AA 2XGTA 1TKWB 3I4MG 4KHPL 1YVCA 2D0PA 2VNUD 1JC7A 1N33L 1B50A 1JOQA 5M3FG 1U4MA 1O78A 3M4OH 4JPBW 3Q23A 1VQNA 4YWMA 1U5KA 3CCVA 1RL2A 1SMXA 3PMFA 3R93A 2E2HB 4UP7A 1CKNB
chains in the Genus database with same CATH topology
1LTID 1O7ZA 2EYJA 2R92B 1Y8OB 2QDBA 5BN5A 4RGMA 3L9AX 3AMUA 4C3IB 4DK1A 1EYDA 4CBVA 3U9OA 3DWQA 1U4LA 5C44B 3HOUB 1GHKA 2F3VA 1EU4A 4Y7NB 3BDLA 2PW5A 2RBMA 1DXMA 5CC4A 5C6AA 1AEXA 2EJMA 1DOLA 1PRTB 4V0BA 3VYSA 3CHBD 4KHVA 3R8BA 2L11A 4PV1C 1B53A 1HA6A 3T13A 4C3IG 2VB3X 1IW7C 3S15B 4K14A 3OWFA 2SNSA 2EY1A 5I2XA 1ESFA 3ERQA 3K6OA 2F03A 1QOHA 4ZKCB 2B2YC 3NPPA 1EEFD 2YU9B 4HMIA 3QOLA 2AWNA 2E75C 1VDZA 4XQNA 1SBBB 3VA7A 2KEEA 3K7AB 3QG1A 3PUVA 1VF5C 1DM0B 5F2DA 1A3VA 1JWMD 3A7AB 4PQXA 4DAPA 2IL8A 3OSOA 4X3KA 3D31A 1PZKD 3F2UA 2WV6D 1PRTC 1HPCA 1ONLA 4H7BA 2QILA 2EYLA 1SYFA 1OXUA 4TRDA 3J80L 3DEOA 2F0FA 4OHJA 1GUWA 1F2ZA 1S5CD 4DA2A 2JEAI 1TIID 3R3OA 2F0UA 4A3DB 2B2VA 2SDFA 4WFN3 5JVH3 1WTXA 4G7OC 5A35A 5FO8B 1IYUA 2AUJD 5I4DA 2B39A 5EKKA 4H44C 1LT4D 4H0LC 3OHXC 2KEDA 2EYPA 1LABA 1HQRD 4KK7A 3IL8A 1EWHA 4IFDH 3S14B 2EJFC 1BBXC 2RSNA 3ONAB 3HOXB 1IKMA 3D6WA 5C0XI 2LS01 1F9RA 2IT1A 3M85A 2FHTA 5FO7B 3SK6A 1ILQA 1EZ6A 3KF8A 3WDNA 1F9QA 5JVG3 3NTKA 4IUPA 1WCMB 1WTWA 1SJHD 4WORA 4K8JA 3I73A 3X3NA 4RKBA 2IJ0A 3G6JB 1GUTA 5FOBB 2OF1A 2F0TA 4QMGA 4QF4A 4XXEA 1B1ZA 1STAA 2CW0D 2K1BA 2YYZA 2GA4B 3WOFA 1PMRA 5CORA 3H09A 3D6CA 4CKCA 3URYA 5IGBA 4Q5VA 5KRUA 3OWEB 1KAAA 1TS2A 2WKDA 1SE4A 2EOTA 2WIIB 2BE5C 2ICEC 5JJZA 5E3FA 1E2VA 1A15A 4A3EB 3H94A 1S4ZA 3T56B 1DCZA 3NQTA 5CMDA 4KJOA 4K5WA 1SMYC 3S1MB 1YNND 1T5XD 2IWHA 2RDFA 3J81L 2IPKD 3PUYA 5IOCA 1EZ8A 2OXPA 2F0JA 3LWUA 2E76C 1FNVA 4OGQC 2A68C 3SR1A 1F9PA 1CQVA 2D2CC 2XN9C 3I4NB 3R2IA 2VUMB 4ZK9B 1V8QA 3BVMA 4C1NI 4F8MA 3SHLA 4X3SA 3S17B 1D6EC 1G8ZD 3BDOA 3E5SA 2JSOA 3OIPA 4C56C 4G4KA 1WTVA 5ISRA 4DNRB 2Z1CA 3C2PA 1ET9A 2PO4A 4EQOA 5J22A 4RGTA 1FD7D 2JA6B 3I3CA 5I9PA 1LT6D 2RDGA 1EY7A 5CBAE 2L1BA 5ELEA 1FR3A 4IUTA 2H1EA 1SEBD 5KNCA 1GOZA 1QG7A 1L0YB 2B2WC 4DXGA 3TZDA 3J7YW 4FXDA 5E1FA 1FGBD 2AQ2B 4B08A 1F77A 1MSGA 2PZWA 2XSCA 3CRLC 5FLXL 1BNZA 1IW7D 1I4PA 5IODA 3RZOB 2NVXB 4ZYSA 1JQYD 4RKLA 1EIHA 2ZXRA 1TWFB 3MFYA 1SE2A 3NTIA 2PZUA 1Y1VB 1EYAA 1EY6A 5D65A 3EQLC 3CRKC 3NUCA 2F0KA 1OXXK 2PZTA 3TDQA 1O7YA 2HCCA 3T16A 3PUWA 1PRTD 5C5LA 4Q0FA 1HTPA 3BZDB 3RLFA 2LFNA 1O80A 5C3EB 3GTJB 1H9RA 3I91A 2R6GA 2JA5B 1G2TA 3EVQA 3KLSX 3SE0A 4L63B 1NUCA 1VMCA 1B3AA 2O2LD 4FVMA 2A74C 1I4XA 2F0IA 2A73B 2BDOA 1H9KA 3D4WA 2KHSA 4RCOA 1LT3D 3PO3B 1S5DD 2SOBA 1SE3A 3NHHA 1EQTA 1B9NA 5C4HA 5CV9A 4IUUA 2F0VA 2EY5A 2QF7A 2F1MA 3T51B 1Q90A 5KNDA 2DNEA 1X3PA 4R8NA 1ML0D 1VMPA 3M3YB 1RJTA 2F0NA 1XX8A 4B9XA 4CJ1B 3FPPA 1HUNA 2NN6G 1B44D 3NP8A 4X3TA 1GHJA 2R93B 4HEDA 2OT2A 4DNTB 1TY2A 1Z7TA 4QIWB 4FYDA 4IUQA 1A6XA 4YIJA 5EKIA 3DHQA 3Q6SA 3ND9A 1UUPA 5C0XJ 1A2UA 1BCPC 1KLUD 4N9TA 3A54A 1AN8A 3A55A 2M9VA 1CT1D 3NXWA 5EJWA 2BE5D 1TWAB 3HG9A 3V05A 3A8IE 1MGSA 3HOYB 1EY9A 2MHVA 4K2LA 4DFAA 1NCVA 2ID0A 1WD0A 1NR4A 3GV3A 2XNAC 2JE6I 2J4XA 1GUNA 4LMQD 2ZT9C 2A6EC 1PLFA 5IGFA 1ESRA 1CQFA 4IZ8A 4TQUS 2K04A 1X32A 2HCIA 1Q1EA 4ID6A 2A68D 2HDLA 1E0BA 1JCKB 5HURA 4A3FB 5CR3A 2PMZB 4X3UA 1FNUA 3SXHA 4TKOB 5CV8A 5E4WC 1H9SA 1CA6A 1KNEA 3SK4A 1KLGD 1ENFA 3NBHA 1D1KA 2F0MA 5IT9E 1EOTA 3KBXA 3LX0A 5CYUA 5I2YA 2WACA 3KLSA 1GJXA 5AFWA 4A3KB 4GZYC 3P1HA 3IAYA 1PZJD 3L7ZC 5ELFA 1XWEA 4CKBA 1LT5D 2BA0A 4FP5D 5JEAJ 2KQ3A 4HSVA 1ENAA 1LTGD 1LACA 5IGGA 3KK7A 2AUKA 4PMBA 1B9MA 1JOOA 1TWCB 4CJ2C 2JA7B 3VR3A 4C3JB 5EPLA 1PYWD 1HFNA 4CHTB 3W2DA 3BDCA 4DAVA 5CV7A 2K5DA 2HUGA 2LMCB 4A3MB 4OO1G 2B2YA 3P75A 5C4ZA 1XTCD 1HA5A 3C46A 5FO9B 3IKJA 4XYOA 1SYCA 3TP6A 2N55A 4XQJA 1QE6A 3QJYA 5DNFA 3BS1A 1TU2B 1F2MA 4KY7A 4OIKA 3VR6A 3A7LA 3EFXD 4DN4M 1EEID 3VR2A 2TMPA 5K36G 1I3QB 1H9MA 5EKLA 1YNJC 1V1OA 1Z6HA 3NE5B 1IL8A 1ZYRC 1SSOA 3ITPA 1IHZA 2A5HA 3KBGA 1X3QA 1ET6A 4BY1B 1RHPA 5D3DA 5BN3A 2CQAA 2O5JC 3ZYYX 4KY6A 3M4OB 4NDXA 3VYUA 3KUPA 3HOVB 1STBA 3SEBA 5D3IB 3R2TA 1CFMA 1SNOA 1WD1A 5M5XB 2B8GA 2KJXA 2X6LA 5D14A 1STYA 4FXGC 3GO5A 3OMCA 3HS0C 2FINB 3FEWX 2F0HA 1S5FD 4RCNA 5ELCA 1Y8PB 1QILA 1H9JA 3HZXA 1K8OA 4NW2A 1V1PB 1I4HA 5C0XH 2PQEA 4K5VA 5I6WA 1QNKA 2K03A 4KD4A 1DYQA 3TP8A 2BDNA 1BCPD 2R61A 3E6ZX 1EU3A 3S2HB 2D5DA 4IUNA 3FPUB 1Y1WB 1BO0A 5C5MA 2HDMA 3K59A 5DAUA 2NWGA 3CKIB 2IX0A 3U9SA 2K5QA 3MC0B 1QWYA 2AQ3B 3GTPB 1LV9A 3GV6A 5M5WB 1KTKA 1STGA 1V1PA 1AZQA 2X6GA 3GTMB 1RD9D 2A6ED 3H91A 2K28A 5FKAC 3Q22A 4KTAA 1ENCA 2NN6I 1UEAB 1STNA 3NTHA 5KEEA 3FKIB 3I72A 1II3A 1Q1BA 3VR4A 4K2KA 3NSWA 2QKIC 4JBWA 3BYYB 1AFPA 3Q24A 5J1ZA 3MZ5A 1BCPF 5HGTA 2XRQD 2N88A 4AYBB 3TSSA 3QB3A 3D3RA 5E4XA 3T53B 5CBEE 1MSHA 4DAYA 2E2JB 4E6IA 1EY4A 1WTQA 3FVQA 2L0CA 2CVRA 1QNUA 4KD3A 5JEAH 4BY7B 1QJOA 4PMWA 5KGUA 1T5EA 3MEHA 4KMUC 2Y0SB 3A56A 4FNFA 2C5CA 3TP5A 1KNAA 2F0PA 2B2WA 2KVMA 5M3MB 2VB2X 2K01A 3HGBA 3IFDA 1JOKA 4IFDG 2ZXPA 2F4IA 1LO5D 4U68A 5BN4A 1PTOF 2NUCA 2BA1A 5EPJA 3PIP3 2WB1B 1D5MC 4ZUIA 3KLRA 2E2IB 3GP7A 4C2MB 1OXTA 1TWGB 4TSSA 3H6MA 1PTOH 4G7HC 3DUZA 4EGVA 4R9WA 2F0GA 3OIQA 4KKUA 3TP7A 1G6ZA 5CV4A 4IUVA 1GUGA 1UNSA 2EDGA 1U4RA 1DOMA 4PNYA 4IALA 4QUCA 5IIFA 2K6AA 1EL0A 2I46A 1DONA 1ZEQX 4ZQ3A 3K5MA 2EJGC 5EBCA 1J8IA 1PFNA 1VF7A 4ABNA 4F88A 5LHY1 2EE1A 2JA8B 2MPMA 4RA8A 1L0XB 3O13A 3P20A 2F0DA 3IFTA 2LKVA 2XWBB 2F0QA 1O7LA 1YNJD 4HCSA 3RUZA 2B2UC 5C4JB 5A2QE 1ZYRD 1B4OA 1BQQT 5EBDA 3C3LA 3S2DB 3PIO3 4Z9CB 2AQ1B 4QB4A 2PW7A 3RMHA 3A8JE 2ICIA 5JPNC 1BDOA 3M4YA 1MD2D 5T1IA 3TMEA 2RSOA 4DXFA 4UAIA 1AZPA 2Q8RE 1GXDC 1LTSD 4ILWA 1BCPB 2BOSA 1TVXA 1JR0D 2B8FA 3K57A 2NVQB 3K58A 1Q3LA 3BVZA 1NAPA 4EQNA 5I6YA 2NYZD 4LJZC 1BF4A 3FRPB 3WOEA 4IFDJ 1I4RA 1JB3A 5CV6A 2V4DA 3SVMA 1D2BA 3N6RA 1CA5A 2JEBI 5KIXA 1I4QA 1KDAA 1WTOA 2G9HD 1GUOA 2Z4HA 3DXJC 5DM73 4UDUC 1EYCA 1PTOB 1D5XC 1LTAD 3OPOA 2JYOA 1PFBA 3VR5A 1OXSC 1I4GA 2NTSA 1HUMA 4HCEA 4IQZA 1XXGA 1CZWA 3SDZA 3J7AV 2Q8TA 2EYFA 3S1QB 1EIGA 1VCIA 2WINB 4RFBA 2Q8IB 3OMGA 2B2TC 1WTRA 2D9UA 1BXTA 1LLRD 2EY6A 4KN4C 4N9PA 3BYTB 1CHQD 1SMYD 1U9RA 3MXUA 5NUCA 3MVVA 4ZLTF 2E2DC 1TS5A 3PUXA 1MBYA 2A69C 3GD7A 3HP3A 3UI2A 4HN7A 5IT9L 4A3JB 3V96A 2L4NA 2OEOA 1PTOC 5G3LF 3I4MB 4BA1I 3JAME 4BWGB 5M3FB 1DJRD 1PZID 2Z8LA 3W3AA 3AB9A 4FF3A 4A3GB 2NZ1D 1HFGA 4XDXA 1LTRD 4CKEA 4DF7A 2DNCA 4BA2I 3GQBA 5EGTA 4H13C 5IGEA 2M2LA 4EVOA 2M00A 2FFKB 2EPBA 1HTLD 2TSSA 2J7ZA 3SK5A 1HCZA 2E74C 2NVTB 3DEPA 4K5XA 1SYBA 2X69A 2KA7A 1I6HB 1W6KA 5IGCA 1WTPA 4ULLA 3BVGA 4I65A 3HRZC 1SYGA 4KKSA 1EFID 4K8IA 2F0WA 4RWSC 1PFMA 1PXUA 1ILPA 4KI0A 2MGSA 2IW3A 2K32A 2EYHA 5DEHA 5LL6S 3DMUA 2EXZA 3MHBA 3M7GA 3AU7A 1HXYD 4EQPA 2SEBD 2IX3A 1ZXTA 1C8CA 3NBIA 3K0YA 1KDCA 4LAAA 4KKTA 1PDQA 4HMJA 2MP1A 4C3JG 1JWSD 3MXPA 1CM9A 4L6TB 4XYQA 3I4LA 2MUYA 4WJWA 4BS9A 1FNWA 2NBFA 5IGDA 4BBRB 4RAUC 3DWPA 1TS4A 4DGZA 1R9TB 1HHVA 1CHPD 3EJIA 1Y69U 3D4RA 4MIUA 4J1MA 4M8AA 1Z47A 4IFDI 1K83B 1B2TA 5EQ0A 4OIJA 1STHA 2LY7A 3S1NB 3QO2A 2RKSA 2RVLA 4NMZA 4JK1C 1WVLA 1D1IA 2K33A 4OL7A 1TR5A 2B2VC 3CU7A 1E2WA 1NSNS 3SK8A 1R4PB 3A8KE 1F2LA 2F3WA 1CI3M 1LTBD 1K8MA 2F0EA 4MN3A 3J80E 4HTHA 1V43A 2IX1A 2JP1A 1Q8IA 2F0LA 4HAEA 1JICA 3HEJA 3VYTA 4KV6A 1EWCA 1SNCA 4RHRA 5M5YB 1S5BD 1A2TA 3MAQA 2RDHA 4G7ZC 2Z4IA 3QIAA 2VXWA 5KYLA 1W6JA 3S9WA 2K5WA 4PMCA 4V190 3K5NA 4XTCS 3DM1A 4QUFA 1JORA 1A3TA 2G9DA 1SDFA 4RHSA 2PCFB 4ZKBB 1SFOB 5JOBA 2XRSD 2ENBA 1OO9B 4ME5A 2NB0A 2A6HC 3PV0A 2DN8A 2K05A 1SXTA 3S16B 3MA2B 5FK9C 3D4DA 1Q12A 2EZVA 3I70A 1DZ1A 1OXVA 2AWOA 3I8ZA 2FMMA 3FMCA 1TS3A 2A69D 4IN3A 2KUMA 2B63B 4J6HA 2CHBD 1PTOD 5J39A 1G291 3V2TA 1I6VC 2KCCA 1DD2A 4KY5A 1KDBA 1QCBD 4QCLA 2SNMA 2WP8J 5C4XB 5T1GA 3M7NA 1C48A 4U673 2KECA 4ZRZA 4F87A 1F9SA 2FJ2A 5JAVA 3MXGA 1S5ED 1HQMC 1STEA 1I50B 5K5PA 4ZUJA 3ND8A 1AW7A 1TWHB 1QB5D 2NN6H 5EPKA 4HSPA 2PYKA 3J81E 1TY0A 3LWEA 4DU9A 1IKLA 1ICWA 3NQIA 5LL6X 4R8IA 3GTKB 2PNRC 1RDPD 1D5ZC 1M4VA 2XVSA 2H4OA 4RGNA 1RTOA 1SNQA 4L8JA 2KCNA 4A93B 3NWSA 3OW7A 2L5TA 3OOCA 4RGOS 4FF4A 2EYMA 3X3MA 1RTNA 1M8AA 4ODGA 1C4QA 1SYDA 1JE4A 3HKZB 3S1RB 4P2CB 3RZDB 1EY5A 4O1NA 1EY0A 3DWAA 1SNMA 3HOWB 5ELDA 5CGKA 3VYRA 2MJ8A 5TSSA 3QOJA 4J8QA 1RCVD 5C0XG 4NP5A 3CQZB 5A2QL 4CJ0B 3T4AC 2J0TD 4KN7C 4ZAIA 2L12A 4C1NK 2DY7A 3NK9A 5FLXE 3MXNA 1CZGA 3D8GA 3GTGB 1SAPA 1NR2A 4K6LA 2B2UA 4FO2A 2QCPX 5JPMC 3GTQB 4C3HB 1AP0A 3N52A 5ELBA 2WAQB 2NVYB 1RF2D 1G91A 4FF1A 4FXKC 1BOSA 2EYOA 3MFGA 2L55A 2D62A 3EA6A 2F0OA 3J7AF 1HRJA 4OO1I 3C1FA 4RH6A 1XYIA 2FMCA 4HR7B 1CK1A 2EY2A 1IYVA 2RQXA 3GTLB 3K5OA 3TZUA 1SYEA 4C3HG 3C1EA 2F0SA 4G57A 1JWUD 1R4QB 3L3OC 1GUSA 3QWNA 4K6DA 2QEJC 3H0GB 1E2ZA 1SNPA 3MTSA 3LNNA 1RODA 3HOZB 4XT1B 1FYCA 2HQEA 2ZXOA 1PRTF 2K7VA 5I9OA 4OO1H 5G3LD 4KHZA 5JEAG 3TBIB 2KOLA 4MHEA 1CTMA 5DM63 2JXMB 1U4PA 4A3BB 1TT2A 4M1UB 5C3WA 4NKLA 4XQQA 2DY8A 1DOKA 5KYIA 1BUVT 2C9OA 5C3XA 1ZKOA 2BCOA 4A3IB 2O4XA 3PUZA 2XIWA 2CW0C 3BG3A 4CGYB 1EQVA 2I07B 3GTOB 3MWYW 3FDTA 2A6HD 2B2TA 3EROA 3PO2B 1EY8A 3JAML 2O5IC 3H3VC 1Y8NB 1J9OA 1H9SB 5K36H 3K5LA 3Q0AA 2R7ZB 2PPBC 3RD4A 1A3UA 1MI2A 4XIGS 3I90A 3G7LA 2NTTA 4BBSB 1G2SA 1UAPA 1YNNC 5COYA 1BR9A 1F2YA 4F7XA 2EVBA 5KNBA 1TQOA 1SNDA 4LK1C 1SJED 5M9OA 3VA5A 2L9HA 4I7ZC 3P7JA 3NWTA 3TN2A 4S3SA 4XT3B 1RKNA 5CV5A 4O42A 4FF2A 2WKCA 3E0JA 2XWJB 4B9WA 2RA4A 2R3ZA 1LTTD 4WRDA 4DK0A 1KABA 4IURA 1TKWB 2VNUD 1JC7A 1B50A 1JOQA 1U4MA 1O78A 3Q23A 2E2HB 4KJNA 3PMFA 3R93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7N A;  2BE5 C;  2A68 D;  1T5E A;  2JEA I;  3MXU A;  1E2V A;  1Y8O B;  5BN5 A;  4G7O C;  4KMU C;  1IW7 D;  5A35 A;  3A8J E;  3H94 A;  4DK1 A;  4TKO B;  1IYU A;  1ZKO A;  1H9S A;  2AUJ D;  1TU2 B;  3T56 B;  1DCZ A;  1BDO A;  4H44 C;  3M4Y A;  2D5D A;  1HQM C;  3FPP A;  2CW0 C;  3BG3 A;  3PUX A;  3PUZ A;  2A69 C;  1SMY C;  2NN6 G;  3ND8 A;  1GHK A;  3GD7 A;  3A7L A;  3VR6 A;  4H0L C;  3HGB A;  2A6H D;  1GHJ A;  4IFD G;  1LAB A;  4DNT B;  4KKT A;  2NN6 H;  5BN4 A;  4G7Z C;  2BA1 A;  3QIA A;  3VR2 A;  2B8F A;  5K36 G;  1Z7T A;  3MFY A;  1H9M A;  1EWH A;  3KLR A;  1DXM A;  4BA1 I;  2EJF C;  2O5I C;  1YNJ C;  4IFD H;  1GJX A;  1A6X A;  1OXT A;  2K32 A;  3PUY A;  1Y8N B;  1Z6H A;  3NE5 B;  4GZY C;  2EJM A;  1H9S B;  5K36 H;  3U9S A;  2PNR C;  3AB9 A;  3I4L A;  3W3A A;  3LWU A;  1ZYR C;  3EQL C;  2E76 C;  2PPB C;  3CRK C;  2IT1 A;  4PV1 C;  4XTC S;  4OGQ C;  4G7H C;  2A68 C;  3L7Z C;  3M85 A;  2D2C C;  3ND9 A;  2BA0 A;  1OXX K;  2PCF B;  4L8J A;  4KKU A;  1IW7 C;  2DNC A;  4LJZ C;  4BA2 I;  2D62 A;  3GQB A;  4XIG S;  1GUG A;  4H13 C;  5BN3 A;  3OW7 A;  3PUW A;  3WDN A;  2O5J C;  2EDG A;  1LAC A;  2L5T A;  1HTP A;  3OOC A;  2V4D A;  4HR7 B;  3RLF A;  2A6E D;  1YNN C;  1V8Q A;  1IYV A;  1Y69 U;  2A6H C;  1H9R A;  3D4R A;  3N6R A;  2AUK A;  3PV0 A;  3I73 A;  1B9M A;  3TZU A;  2DN8 A;  2EVB A;  2JEB I;  2NN6 I;  5KNB A;  2R6G A;  3I72 A;  4LK1 C;  1CFM A;  1HCZ A;  2E74 C;  3BDO A;  3VR3 A;  1Q1B A;  1GUO A;  2BE5 D;  3SE0 A;  1GUS A;  3VR4 A;  3DXJ C;  2EJG C;  4JBW A;  2E75 C;  1Q12 A;  1VDZ A;  1GUT A;  4I7Z C;  2B8G A;  2BDO A;  1VF7 A;  4DNR B;  3VA7 A;  3A8I E;  1OXV A;  3QG1 A;  3OPO A;  2AWO A;  1VF5 C;  1H9K A;  2KA7 A;  3PUV A;  3FMC A;  3VR5 A;  1OXS C;  1E2Z A;  2A69 D;  2LMC B;  3A7A B;  4IQZ A;  3T53 B;  2YYZ A;  3P20 A;  4OO1 G;  4JK1 C;  3SDZ A;  2K33 A;  3LNN A;  1PMR A;  4DK0 A;  1FYC A;  3D31 A;  4KKS A;  1B9N A;  3IFT A;  2JE6 I;  2K7V A;  1GUN A;  1O7L A;  1E2W A;  1FR3 A;  4RCN A;  4OO1 H;  1HPC A;  1ONL A;  1TKW B;  1Y8P B;  1G29 1;  5C0X G;  2ZT9 C;  2A6E C;  4KHZ A;  5JEA G;  1K8O A;  3IKJ A;  5KNC A;  1I6V C;  1VCI A;  2QF7 A;  1H9J A;  3A8K E;  4KI0 A;  2KCC A;  2F1M A;  1CTM A;  4TQU S;  3T51 B;  1OXU A;  2Q8I B;  1Q90 A;  5KND A;  1O78 A;  1CI3 M;  1DD2 A;  2DNE A;  2JXM B;  4KN7 C;  1K8M A;  5C0X H;  5JEA H;  1Q1E A;  3QJY A;  4KN4 C;  1QJO A;  1V43 A;  3CRL C; 
#chains in the Genus database with same CATH topology
 1LTI D;  1O7Z A;  3G6E A;  2EYJ A;  2R92 B;  1QVC A;  1K8A C;  2UXC Q;  4X66 L;  1Y8O B;  2QDB A;  5BN5 A;  4RGM A;  3ULP A;  3L9A X;  4LF8 Q;  4C3I B;  3AMU A;  4DK1 A;  5M5X H;  1EYD A;  1YHA A;  4CBV A;  2K75 A;  1SRU A;  3U9O A;  3DWQ A;  1U4L A;  5C44 B;  4CDE C;  3HOU B;  1GHK A;  1IYJ B;  2F3V A;  4JI6 L;  1EU4 A;  4R4T A;  4A75 A;  4Y7N B;  2YTV A;  2LXK A;  3BDL A;  1WCM H;  1NE3 A;  2PW5 A;  2RBM A;  3CMA A;  1BBW A;  1DXM A;  5CC4 A;  5C6A A;  1AEX A;  2EJM A;  1DOL A;  1PRT B;  2N8N A;  4ME3 A;  4V0B A;  3VYS A;  4DK6 C;  3CHB D;  1PH8 A;  1PYS B;  4YCW A;  1Q82 C;  1EIF A;  4KHV A;  3R8B A;  4DV7 Q;  2L11 A;  3TRZ A;  4PV1 C;  1B53 A;  1HA6 A;  1LTL A;  3T13 A;  2QGQ A;  2ES2 A;  4C3I G;  2ZJR A;  1MHW C;  1IW7 C;  2VB3 X;  3S15 B;  4K14 A;  5C44 G;  3OWF A;  2SNS A;  2EY1 A;  5I2X A;  3CAM A;  1ESF A;  3ERQ A;  3K6O A;  2F03 A;  2UUC L;  1QOH A;  4ZKC B;  2QDL A;  4P71 A;  2B2Y C;  1Y1W H;  2D0O A;  3NPP A;  1EEF D;  1JJ2 A;  4HMI A;  2YU9 B;  3QOL A;  4NXN Q;  2CQO A;  4DR7 Q;  2AWN A;  1J5E L;  2E75 C;  1VDZ A;  4XQN A;  4WJ4 A;  1SBB B;  3VA7 A;  1JMC A;  2KEE A;  4B3M Q;  3K7A B;  3QG1 A;  3PUV A;  1VF5 C;  3CCQ A;  1DM0 B;  5F2D A;  1A3V A;  4A3E H;  1JWM D;  3A7A B;  4PQX A;  3U58 A;  4DAP A;  4B3R Q;  2IL8 A;  3OSO A;  4QIW E;  4X3K A;  3D31 A;  1QVG A;  1PZK D;  3F2U A;  2WV6 D;  1PRT C;  1HPC A;  1ONL A;  2MNA A;  4H7B A;  3UDF A;  2QIL A;  2EYL A;  1SYF A;  1OXU A;  4TRD A;  3J80 L;  3DEO A;  2F0F A;  4OHJ A;  1GUW A;  1F2Z A;  1S5C D;  1YJW A;  4DA2 A;  2JEA I;  1TII D;  3R3O A;  2F0U A;  4A3D B;  5J3B A;  2B2V A;  2SDF A;  5LMU L;  4WFN 3;  5JVH 3;  1WTX A;  4AQY L;  4G7O C;  3F8T A;  4GN5 A;  1PYB A;  5A35 A;  1N36 L;  5FO8 B;  1IYU A;  2AUJ D;  5I4D A;  2LXJ A;  4BBR G;  2B39 A;  5EKK A;  4H44 C;  4JI0 L;  1LT4 D;  3I4N H;  1PV4 A;  4H0L C;  3OHX C;  2KED A;  3K8A A;  2EYP A;  3RNU A;  2VUM H;  1YJ9 A;  4GLX A;  1LAB A;  1HQR D;  4KK7 A;  1I5F A;  4POG A;  3IL8 A;  4DR5 L;  1EWH A;  4IFD H;  3S14 B;  2EJF C;  4JYA L;  1BBX C;  2RSN A;  3ONA B;  1K8G A;  3HOX B;  1IKM A;  3D6W A;  5C0X I;  4DV0 Q;  2LS0 1;  1F9R A;  1P8L A;  2IT1 A;  2Z9H A;  1NJI C;  1IL2 A;  3CC7 A;  3M85 A;  2FHT A;  5FO7 B;  3SK6 A;  1ILQ A;  1EZ6 A;  3KF8 A;  2E5L Q;  4DV5 Q;  3WDN A;  1F9Q A;  5JVG 3;  3NTK A;  4IUP A;  1PH3 A;  1WCM B;  1WTW A;  4GNX C;  1SJH D;  4WOR A;  4K8J A;  3I73 A;  3X3N A;  2RCF A;  1X3G A;  4RKB A;  2UU9 Q;  4QQB X;  2PMZ E;  3SGI A;  3HOX G;  2IJ0 A;  3F2B A;  1BKB A;  3G6J B;  1GUT A;  5FOB B;  2OF1 A;  2F0T A;  4QMG A;  1HNZ Q;  4QF4 A;  4XXE A;  1B1Z A;  1STA A;  2CW0 D;  5IYD H;  4A76 A;  1TWG H;  2E8G A;  2K1B A;  2YYZ A;  1IZ6 A;  2GA4 B;  3WOF A;  1PMR A;  5COR A;  3RZO H;  3H09 A;  3D6C A;  4CKC A;  1LYL A;  2NVX H;  3L0O A;  1YZ6 A;  3URY A;  4YY3 L;  5IGB A;  4Q5V A;  4LF7 L;  1UE6 A;  1VQE A;  4JI5 L;  4BXX H;  5KRU A;  4DV2 Q;  2K52 A;  3OWE B;  1TWF H;  1KAA A;  1TS2 A;  2WKD A;  1Y1V H;  4JCV E;  1SE4 A;  2EOT A;  2WII B;  2BE5 C;  1XNQ L;  4DAY B;  2MFI A;  2ICE C;  2DJG C;  5JJZ A;  5E3F A;  4DR3 L;  1E2V A;  1FVI A;  1A15 A;  1E1T A;  4A3E B;  3PCO B;  3H94 A;  1S4Z A;  4P73 A;  3T56 B;  1DCZ A;  3NQT A;  5LMN W;  5CMD A;  4KJO A;  4K5W A;  1SMY C;  3S1M B;  1YNN D;  1K73 C;  1T5X D;  1HZA A;  2IWH A;  4DV4 Q;  3CF5 A;  2ZTE A;  5C3E H;  2RDF A;  3J81 L;  3GTJ H;  2ASB A;  2IPK D;  3PUY A;  1VQB A;  5IOC A;  2JA5 H;  1EZ8 A;  2OXP A;  3M4P A;  2F0J A;  3LWU A;  2QA4 A;  4LF8 L;  2E76 C;  5HGQ A;  1FNV A;  1TXY A;  4OGQ C;  2A68 C;  3SR1 A;  3A5U A;  1F9P A;  2B63 G;  1CQV A;  2D2C C;  2N78 A;  2XN9 C;  3KDF B;  1HR0 L;  3PO3 H;  1VQJ A;  3I4N B;  1VQD A;  4UP8 A;  3R2I A;  2VUM B;  4ZK9 B;  3J7Z C;  1XMQ Q;  1V8Q A;  3BVM A;  4C1N I;  2KHJ A;  4F8M A;  3SHL A;  4X3S A;  3S17 B;  1D6E C;  2MO1 A;  1PH6 A;  4JI1 Q;  3CCM A;  1G8Z D;  2L15 A;  3BDO A;  3E5S A;  4DR4 Q;  4DV7 L;  2JSO A;  3OIP A;  4C56 C;  4G4K A;  1WTV A;  5ISR A;  4DNR B;  4ZCK A;  3M3Y H;  1WTH A;  1BVS A;  2Z1C A;  3NEN A;  1ET9 A;  2PO4 A;  4UPA A;  3C2P A;  3JAM c;  4EQO A;  5J22 A;  4RGT A;  1FD7 D;  4POF A;  2JA6 B;  3I3C A;  5I9P A;  1LT6 D;  2RDG A;  1EY7 A;  5CBA E;  2L1B A;  5ELE A;  1FR3 A;  2V1C C;  4IUT A;  2H1E A;  1SEB D;  2R93 H;  3PIP A;  5KNC A;  1GOZ A;  1QG7 A;  1L0Y B;  2B2W C;  4DXG A;  3KDF A;  3TZD A;  3J7Y W;  4FXD A;  5E1F A;  1FGB D;  2AQ2 B;  2KBN A;  4B08 A;  1F77 A;  4B3S Q;  1MSG A;  2PZW A;  2Z6B A;  2XSC A;  4JI8 Q;  3CRL C;  5FLX L;  4LFA L;  4GN3 B;  1BNZ A;  4L5S A;  3PQI A;  1IW7 D;  2ZTD A;  1N32 L;  4A93 G;  4B3R L;  1AH9 A;  1I4P A;  2LSS A;  3AFQ A;  5IOD A;  3RZO B;  2JA6 G;  3CXC A;  3STB D;  2RCN A;  2NVX B;  1NNX A;  4ZYS A;  1JQY D;  4RKL A;  4HIO A;  1EIH A;  2ZXR A;  4IOC A;  1TWF B;  3MFY A;  4DR1 Q;  1SE2 A;  3NTI A;  4A4I A;  2PZU A;  1Y1V B;  1EYA A;  3HKZ G;  4P74 A;  4RG1 A;  1D8L A;  1IBK L;  3S1Q H;  1EY6 A;  5D65 A;  3EQL C;  3CRK C;  3NUC A;  1YHQ A;  3HOY H;  2F0K A;  1OXX K;  2PZT A;  3TDQ A;  2NZO A;  1YEZ A;  2KCM A;  1O7Y A;  2HCC A;  4NPS A;  3HOW G;  3T16 A;  3PUW A;  1PRT D;  5C5L A;  1UWV A;  4Q0F A;  1HTP A;  3BZD B;  3RLF A;  2LFN A;  1O80 A;  5C3E B;  3GTJ B;  1H9R A;  4KLK A;  3AFP A;  3I91 A;  2R6G A;  2JA5 B;  4JC0 A;  1G2T A;  3EVQ A;  3KLS X;  3SE0 A;  4L63 B;  1NUC A;  1VMC A;  1B3A A;  2O2L D;  4FVM A;  2A74 C;  1I4X A;  3PF5 A;  1VQM A;  2F0I A;  3PIO A;  2A73 B;  2BDO A;  4MNO A;  5BR8 Q;  3T1Y Q;  1H9K A;  3D4W A;  2KHS A;  4RCO A;  1LT3 D;  3PO3 B;  1S5D D;  1C9O A;  2E5L L;  4DV5 L;  2SOB A;  4DV6 Q;  1Q81 C;  3UDX A;  1SE3 A;  4A3G H;  3NHH A;  2OQK A;  3BZK A;  4PG3 A;  1B70 B;  1EQT A;  1B9N A;  4GS3 A;  5C4H A;  4DUZ Q;  5CV9 A;  4IUU A;  2F0V A;  2EY5 A;  2QF7 A;  2F1M A;  3T51 B;  4OEM B;  1Q90 A;  1CUK A;  2WAQ G;  5KND A;  2DNE A;  2I5M X;  1X3P A;  4R8N A;  1ML0 D;  4HIM A;  4DNI A;  1HNZ L;  3TS2 A;  2I5L X;  2JQO A;  1VMP A;  3M3Y B;  1RJT A;  2F0N A;  1XX8 A;  4B9X A;  4RMF A;  2ZTC A;  4CJ1 B;  3FPP A;  1HUN A;  4JI2 Q;  2NN6 G;  1I6H H;  5IP7 H;  2OCE A;  3J80 i;  1B44 D;  3NP8 A;  4X3T A;  1GHJ A;  2R93 B;  4HED A;  2OT2 A;  4DNT B;  4DV2 L;  1TY2 A;  2B29 A;  3AEV A;  1XJV A;  1Z7T A;  2HIV A;  4QIW B;  4FYD A;  4IUQ A;  4HJ9 A;  1TWC H;  1A6X A;  4AYB E;  2JA7 H;  4YIJ A;  4C3J H;  5EKI A;  3H0G G;  3NEL A;  4X64 L;  3DLL A;  3DHQ A;  4DR2 L;  3Q6S A;  3FHW A;  3ND9 A;  2UXD Q;  1UUP A;  5C0X J;  1A2U A;  3T1H Q;  3HOZ G;  5ELN A;  1OTC A;  1BCP C;  3J80 c;  1KLU D;  4N9T A;  4A3M H;  3A54 A;  1AN8 A;  3A55 A;  3MEF A;  2M9V A;  2F52 A;  1JJC B;  1CT1 D;  2DUD A;  2CH4 A;  3NXW A;  1S40 A;  3W1B A;  2Y0S E;  5EJW A;  2BE5 D;  1TWA B;  3HG9 A;  2EQS A;  4JI3 L;  3V05 A;  3A8I E;  1MGS A;  3I7F A;  5IP9 H;  3EBE A;  3HOY B;  1EY9 A;  4A3I G;  2MHV A;  1N8R C;  4HIK A;  4K2L A;  4DFA A;  3CC2 A;  1NCV A;  1XMQ L;  2ID0 A;  1WD0 A;  1NR4 A;  3GV3 A;  2HIX A;  5IWA L;  4UP9 A;  2XNA C;  2JE6 I;  2J4X A;  1GUN A;  4A3C G;  4L5T A;  4HJ5 A;  4LMQ D;  4JI1 L;  2ZT9 C;  2A6E C;  1PLF A;  5IGF A;  1ESR A;  1CQF A;  4IZ8 A;  4TQU S;  1I3Q H;  2K04 A;  1X32 A;  5FJ8 H;  2R7Z G;  2HCI A;  1Q1E A;  2VQF Q;  2RHQ B;  4ID6 A;  2A68 D;  2HDL A;  1E0B A;  1JCK B;  2UXB Q;  5HUR A;  4A3F B;  5CR3 A;  2PMZ B;  3BU2 A;  4X3U A;  1FNU A;  2PI2 E;  3SXH A;  4TKO B;  5CV8 A;  4JOI A;  1H9S A;  5E4W C;  4OXP A;  1CA6 A;  4BBS G;  1KNE A;  1E22 A;  3CCJ A;  3SK4 A;  1KLG D;  1L2F A;  4IO9 A;  4BY1 H;  2YV5 A;  1ENF A;  1BBU A;  1X9N A;  1VQ7 A;  3NBH A;  1D1K A;  2F0M A;  5IT9 E;  1EOT A;  3FP9 A;  2AMC B;  3KBX A;  3LX0 A;  5CYU A;  5I2Y A;  3HOV H;  2WAC A;  4K0K L;  3KLS A;  3EN2 A;  1GJX A;  5AFW A;  4A3K B;  1EQR A;  4GZY C;  2EIF A;  4APV A;  1VS0 A;  3P1H A;  3IAY A;  2YTY A;  5FLM G;  3CCR A;  3ER0 A;  1PZJ D;  3L7Z C;  5ELF A;  2CH4 W;  1XWE A;  4CKB A;  1LT5 D;  4A3F G;  1YJN A;  1K9M C;  2BA0 A;  4FP5 D;  5JEA J;  4DKA C;  2KQ3 A;  4HSV A;  3J81 i;  1VQ5 A;  1PA6 A;  2PQA A;  5IYB G;  3A5Z B;  3KFU A;  5LMN Q;  1ENA A;  4DV3 Q;  1LTG D;  1LAC A;  4LF5 L;  5IGG A;  4DR1 L;  3KK7 A;  2AUK A;  4PMB A;  1B9M A;  3KOJ A;  1JOO A;  1TWC B;  2QW7 A;  1FJG L;  4CJ2 C;  2JA7 B;  4MZ9 A;  1L0W A;  3VR3 A;  4C3J B;  3RN5 A;  5EPL A;  2R92 G;  4A3K G;  1PYW D;  1HFN A;  1YBY A;  4CHT B;  3W2D A;  3BDC A;  4R4I A;  4DAV A;  1KL9 A;  4IOA A;  5CV7 A;  2K5D A;  2HUG A;  3J81 c;  3HOU G;  2LMC B;  4LF6 Q;  1CKN A;  2WFW A;  4A3M B;  3S2H H;  4OO1 G;  1M90 C;  2B2Y A;  3P75 A;  5C4Z A;  1XTC D;  1HA5 A;  3C46 A;  2F4V Q;  1VQH A;  3G4S A;  5FO9 B;  3IKJ A;  4LUZ A;  4XYO A;  1SYC A;  2N3S A;  3TP6 A;  1XPR A;  2N55 A;  4XQJ A;  1QE6 A;  1G6P A;  3QJY A;  5DNF A;  2Z6K C;  1HNX Q;  4DV6 L;  3BS1 A;  3S16 H;  2YTX A;  1TU2 B;  1F2M A;  3GTP H;  4UHV A;  4KY7 A;  1E3P A;  1V9P A;  4OIK A;  4DUZ L;  5M5W H;  5JJL A;  3VR6 A;  3A7L A;  4HJ7 A;  3EFX D;  4DN4 M;  1EEI D;  3GTM H;  4JG2 A;  4LFB L;  4GKK Q;  4B3T Q;  3VR2 A;  2TMP A;  3H15 A;  5K36 G;  1I3Q B;  1H9M A;  4GNX B;  4DAM A;  4ALP A;  5EKL A;  1YNJ C;  1V1O A;  1Z6H A;  3FKI H;  3NE5 B;  4LUV A;  1IL8 A;  4DUY L;  1GVP A;  4O2D A;  2A8V A;  1ZYR C;  1PH9 A;  1SSO A;  1X54 A;  3ITP A;  4N8F A;  1IHZ A;  2A5H A;  3KBG A;  1S3O A;  1IBL Q;  2AKW B;  1Y14 B;  5C4X H;  1X3Q A;  4P72 A;  1AE2 A;  1ET6 A;  4BY1 B;  1RHP A;  3OYY A;  5D3D A;  5BN3 A;  1KIX A;  2E2J H;  2CQA A;  2O5J C;  3ZYY X;  4KY6 A;  5FLX c;  2I0Q A;  3M4O B;  4NDX A;  3VYU A;  3IRB A;  1I50 H;  3KUP A;  1KRT A;  3HOV B;  1STB A;  3W1G A;  1TWH H;  2HT1 A;  3SEB A;  3R2T A;  1CFM A;  5D3I B;  1W3S A;  1SNO A;  1WD1 A;  3G71 A;  4A3D G;  4MTK A;  5M5X B;  3M4Q A;  4BY7 H;  1JE5 A;  2B8G A;  2KJX A;  2UXD L;  5E7N A;  3T1H L;  1XNR L;  2X6L A;  5D14 A;  1STY A;  4GNX A;  4FXG C;  3GO5 A;  3OMC A;  1G51 A;  3HS0 C;  2FIN B;  3FEW X;  5M3M H;  2F0H A;  1S5F D;  4RCN A;  5ELC A;  2F3I A;  1Y8P B;  3BZC A;  3CPF A;  1QIL A;  1H9J A;  3HZX A;  1K8O A;  4NW2 A;  1Q86 C;  3ICE A;  1V1P B;  1I4H A;  4PZ6 A;  4C2M H;  5C0X H;  2E2I H;  2EXD A;  1UE5 A;  1HJP A;  2PQE A;  4K5V A;  5I6W A;  1QNK A;  2K03 A;  4KD4 A;  1DYQ A;  2BDN A;  3TP8 A;  1BCP D;  2R61 A;  3E6Z X;  1EU3 A;  3S2H B;  3S1R H;  2D5D A;  4LW1 A;  4IUN A;  3FPU B;  1WCM G;  1Y1W B;  4LF4 L;  4JI4 L;  1BO0 A;  4LUO A;  5C5M A;  3OTO L;  2HDM A;  1S72 A;  1HZB A;  3K59 A;  1Q8K A;  5DAU A;  2NWG A;  3K7U C;  5HY6 A;  3CKI B;  4MTN A;  2IX0 A;  3U9S A;  2UXB L;  5IYC H;  3CQZ H;  2K5Q A;  3MC0 B;  1QWY A;  4X62 Q;  3L2P A;  2AQ3 B;  1IBM L;  4NXM Q;  3GTP B;  3D0F A;  3CCS A;  1LV9 A;  4GOP C;  4OX9 Q;  2JA8 H;  3GV6 A;  5M5W B;  1KTK A;  2VQE Q;  1STG A;  5EAY A;  1V1P A;  1AZQ A;  3GTG H;  2X6G A;  1Y1W G;  3GTM B;  1RD9 D;  1N34 Q;  1HR0 W;  2A6E D;  3H91 A;  2K28 A;  5FKA C;  1HNW Q;  3Q22 A;  4KTA A;  5GAD C;  1ENC A;  2NN6 I;  1PH4 A;  1UEA B;  1STN A;  2UXC L;  3NTH A;  5KEE A;  3FKI B;  3I72 A;  1II3 A;  3AYH B;  1Q1B A;  1CSP A;  4K2K A;  3VR4 A;  3NSW A;  5C4J H;  2QKI C;  4JBW A;  4C3H H;  4A3E G;  3BYY B;  1E1O A;  1AFP A;  3Q24 A;  5J1Z A;  4LWC A;  2Q2U A;  3MZ5 A;  1BCP F;  3S2D H;  5HGT A;  2XRQ D;  3JAM i;  2N88 A;  4YWK A;  3TSS A;  4AYB B;  3QB3 A;  3D3R A;  5E4X A;  3T53 B;  5CBE E;  3H3V I;  1MSH A;  4DV3 L;  4DAY A;  2E2J B;  1VQK A;  3HKS A;  4E6I A;  1EY4 A;  5GAH C;  2XTI A;  3HFZ B;  1WTQ A;  1X3E A;  3FVQ A;  4KJN A;  1H95 A;  2L0C A;  4A3L H;  1DGS A;  2CVR A;  1JB7 A;  1QNU A;  4KD3 A;  4N8X 1;  2NVQ H;  5JEA H;  4BY7 B;  3GTL H;  1QJO A;  1YIT A;  4PMW A;  4L5Q A;  5KGU A;  1VQO A;  1T5E A;  3MEH A;  4LF6 L;  4KMU C;  1VQG A;  2Y0S B;  4OWW B;  3I4N G;  3A56 A;  4FNF A;  2OTL A;  1L1O C;  2VUM G;  2C5C A;  3TP5 A;  2IHE A;  1FL0 A;  1KNA A;  2GVB A;  2F0P A;  2F4V L;  4LFC Q;  2B2W A;  2KVM A;  5M3M B;  2UUA Q;  2VB2 X;  2K01 A;  3HGB A;  2OTJ A;  3IFD A;  4NXN L;  1JOK A;  4IFD G;  4DR7 L;  2ZXP A;  2F4I A;  1LO5 D;  4U68 A;  1GO3 E;  1FGU A;  1PTO F;  2JJQ A;  5BN4 A;  2NUC A;  2BA1 A;  5EPJ A;  1QVF A;  3PIP 3;  2WB1 B;  4DV1 Q;  4B3M L;  1D5M C;  4ZUI A;  3KLR A;  3U4V A;  4LF9 Q;  2E2I B;  3GP7 A;  4C2M B;  1OXT A;  3E9I A;  1NMF A;  2K5N A;  3KYH C;  1TWG B;  4TSS A;  4KHP Q;  2CWA A;  3UDG A;  1N33 Q;  2RF4 A;  3H6M A;  1PTO H;  4G7H C;  3DUZ A;  2A19 A;  2K5V A;  3LGJ A;  4EGV A;  4R9W A;  1MJE A;  4A3B H;  2Y0S G;  2F0G A;  3OIQ A;  4KKU A;  1NMG A;  3TP7 A;  1G6Z A;  5CV4 A;  4IUV A;  1E24 A;  1GUG A;  2PNH A;  1UNS A;  1UE1 A;  1E7Z A;  2EDG A;  2JN4 A;  1U4R A;  3J7A 5;  4B3T L;  4TVA B;  1DOM A;  4PNY A;  4IAL A;  4QUC A;  5IIF A;  5DLQ E;  4R1J A;  3KJO A;  2K6A A;  4YWL A;  1EL0 A;  1T9H A;  4JI6 Q;  2I46 A;  1DON A;  1ZEQ X;  4ZQ3 A;  3K5M A;  2EJG C;  5EBC A;  3CCL A;  1J8I A;  5IYD G;  3PO2 H;  1PHJ A;  1PFN A;  1VF7 A;  1WFQ A;  4GN4 B;  4ABN A;  4F88 A;  5LHY 1;  2EE1 A;  2JA8 B;  2MPM A;  2N49 A;  4RA8 A;  1L0X B;  3O13 A;  3P20 A;  2F0D A;  4BXX G;  3IFT A;  2LKV A;  2XWB B;  2F0Q A;  1O7L A;  4A3J H;  4FDB A;  1WOC A;  4DV0 L;  4JV5 Q;  3A74 A;  1Y1V G;  1YNJ D;  4HCS A;  1ICF B;  1EIY B;  3RUZ A;  2B2U C;  5C4J B;  3I4M H;  5A2Q E;  1ZYR D;  1B4O A;  3JC6 6;  1BQQ T;  1VQ4 A;  5EBD A;  5M3F H;  3C3L A;  3S2D B;  2IY5 B;  2UUB Q;  3PIO 3;  4Z9C B;  2AQ1 B;  1N9W A;  4QB4 A;  2PW7 A;  4NB3 A;  3RMH A;  3A8J E;  4IPH A;  2ICI A;  5GQO A;  5JPN C;  1BDO A;  3M4Y A;  1J5E Q;  2MQH A;  4QJF A;  1MD2 D;  5T1I A;  3TME A;  2RSO A;  4DXF A;  4UAI A;  1AZP A;  5C3E G;  1VQA A;  2Q8R E;  1GXD C;  2UU9 L;  1LTS D;  4ILW A;  1BCP B;  2BOS A;  1K3R A;  1TVX A;  1JR0 D;  2JA5 G;  1VQC A;  2Q2T A;  2B8F A;  1MJC A;  3K57 A;  2NVQ B;  1GKH A;  1A62 A;  3G48 A;  4DK3 C;  4QY7 A;  1Q46 A;  2NVT H;  3K58 A;  1Q3L A;  3PO3 G;  3BVZ A;  1NAP A;  4EQN A;  5I6Y A;  2GVA A;  1M1K C;  1VQ8 A;  2NYZ D;  4LJZ C;  4PZ8 A;  1BF4 A;  2R92 H;  1EYG A;  3FRP B;  3WOE A;  4IFD J;  1I4R A;  1B3Q A;  1JB3 A;  1A63 A;  3TQY A;  5CV6 A;  5LMU Q;  3I55 A;  4C3I H;  4AQY Q;  2Q2I A;  2V4D A;  1PH2 A;  2KEN A;  3SVM A;  1N36 Q;  1D2B A;  5C44 H;  3N6R A;  1CA5 A;  2JEB I;  1NTG A;  5KIX A;  4JI0 Q;  1I4Q A;  1KDA A;  2VS1 A;  2G9H D;  1WTO A;  1GUO A;  4IJH A;  2Z4H A;  3DXJ C;  4AH6 A;  5DM7 3;  4UDU C;  1EYC A;  1PTO B;  1D5X C;  4NXM L;  1LTA D;  3OPO A;  2JYO A;  1PFB A;  3VR5 A;  1OXS C;  1SLJ A;  1KXL A;  1I4G A;  4DV4 L;  2NTS A;  1HUM A;  4HCE A;  2RHS B;  4IQZ A;  1XXG A;  1ASZ A;  1CZW A;  2FXQ A;  3SDZ A;  4JI7 Q;  2R93 G;  1HNW L;  3J7A V;  3F2D A;  1PVO A;  4GLA C;  1UEB A;  2Q8T A;  2EYF A;  3S1Q B;  4R4O A;  1K0S A;  1EIG A;  1VCI A;  2WIN B;  4RFB A;  2Q8I B;  3OMG A;  2B2T C;  1WTR A;  2D9U A;  1BXT A;  1LLR D;  1X55 A;  3E0E A;  2EY6 A;  4KN4 C;  4N9P A;  3BYT B;  1CHQ D;  1SMY D;  1U9R A;  3MXU A;  4IPC A;  5NUC A;  1A0I A;  1U0L A;  2WB1 E;  1VQ9 A;  3MVV A;  4YCV A;  4ZLT F;  2E2D C;  1TS5 A;  3PUX A;  1MBY A;  2A69 C;  4IJL A;  3GD7 A;  3HP3 A;  3U4Z A;  3UI2 A;  4HN7 A;  3CP0 A;  5IT9 L;  4BBR H;  4A3J B;  3V96 A;  4DR4 L;  2L4N A;  4OWT B;  3RN2 A;  1R9T H;  2NZH A;  2OEO A;  1PTO C;  5G3L F;  3I4M B;  4BA1 I;  3JAM E;  4BWG B;  5M3F B;  1DJR D;  1PZI D;  3HOY G;  1K83 H;  2OQ0 A;  2Z8L A;  3W3A A;  3AB9 A;  4FF3 A;  4JI5 Q;  3NEM A;  2NZ1 D;  1HFG A;  3S1N H;  4A3G B;  4CDF C;  1XPU A;  4XDX A;  1LTR D;  4CKE A;  4LFC L;  2DNC A;  4DF7 A;  2UUA L;  4BA2 I;  2MO0 A;  3GQB A;  5JJK A;  3F1Z A;  1W2B A;  5EGT A;  4H13 C;  2VL6 A;  1LUZ A;  4DR3 Q;  5IGE A;  2M2L A;  4B3S L;  4EVO A;  2M00 A;  4JI8 L;  2FFK B;  3BJU A;  2EPB A;  1HTL D;  2TSS A;  2J7Z A;  3SK5 A;  1HCZ A;  2E74 C;  2NVT B;  3DEP A;  4K5X A;  1SYB A;  3S14 H;  2X69 A;  4A3G G;  2KA7 A;  1I6H B;  3HOX H;  1W6K A;  5IGC A;  1WTP A;  2G5D A;  4X65 Q;  4QGU A;  3WWV A;  4ULL A;  4IPG A;  3BVG A;  4I65 A;  3HRZ C;  1SYG A;  3Q8D A;  4X6A H;  4KKS A;  1EFI D;  4K8I A;  2F0W A;  4RWS C;  1YNX A;  1HR0 Q;  1PFM A;  1PXU A;  2WAQ E;  5M5Y H;  1ILP A;  1JT8 A;  2BH2 A;  4KI0 A;  1WJJ A;  1KHI A;  3W5O A;  2BH8 A;  1EUJ A;  2MGS A;  2IW3 A;  2K32 A;  1VQF A;  2EYH A;  4OWX B;  2DGY A;  3QR8 A;  5DEH A;  5LL6 S;  3DMU A;  2EXZ A;  1QZG A;  4DR6 Q;  3MHB A;  5IP7 G;  3M7G A;  3CD6 A;  3AU7 A;  1VQP A;  1HXY D;  4EQP A;  1SFO H;  2SEB D;  2IX3 A;  1EQQ A;  1ZXT A;  4I7A A;  5JJI A;  4PZ7 A;  1C8C A;  4JV5 L;  3NBI A;  3K0Y A;  2AHO B;  1KDC A;  4LAA A;  4KKT A;  5ELO A;  1PDQ A;  4HMJ A;  2Z6K A;  2JA7 G;  2MP1 A;  4C3J G;  1JWS D;  5BR8 L;  3T1Y L;  3STB C;  2OWO A;  1QZH A;  3MXP A;  1PH1 A;  1CM9 A;  2UUB L;  4L6T B;  5AJ3 Q;  4XYQ A;  3ULL A;  2IHF A;  3I4L A;  3KLW A;  1AE3 A;  2MUY A;  1K28 A;  1SR3 A;  4WJW A;  4BS9 A;  1FNW A;  1X65 A;  2NBF A;  4A3M G;  1GD7 A;  5IGD A;  4R4C A;  1LM0 A;  4LFA Q;  4BBR B;  2B63 H;  4RAU C;  1VQ6 A;  3DWP A;  1TS4 A;  3ULJ A;  4DGZ A;  1R9T B;  1CHP D;  1N32 Q;  1HHV A;  3EJI A;  1Y69 U;  3D4R A;  4MIU A;  4J1M A;  3S1M H;  3KF6 B;  4M8A A;  4H02 A;  4EQ5 A;  5IP9 G;  1Z47 A;  5IE8 A;  4IFD I;  1K83 B;  1B2T A;  1RIP A;  4OIJ A;  5EQ0 A;  5GAG C;  1YHB A;  1STH A;  2LY7 A;  4WJ3 M;  2ZM6 Q;  3U50 C;  4JI2 L;  3S1N B;  1P16 A;  2HD3 A;  3KF8 B;  2K5H A;  3QO2 A;  1IBK Q;  2RKS A;  2RVL A;  4NMZ A;  4JK1 C;  1WVL A;  1D1I A;  3E3X A;  2K33 A;  4OL7 A;  1TR5 A;  2B2V C;  1K3B C;  1B7Y B;  3CU7 A;  1E2W A;  2HHH Q;  1NSN S;  3SK8 A;  5FJ8 G;  1R4P B;  3A8K E;  1F2L A;  2F3W A;  3B6Y A;  3K80 C;  1CI3 M;  1LTB D;  1K8M A;  1XTD A;  2F0E A;  4MN3 A;  3J80 E;  1V43 A;  4HTH A;  3CC4 A;  2IX1 A;  3S17 H;  2JP1 A;  3GTK H;  1Q8I A;  2F0L A;  4BY1 G;  1C0A A;  4JI7 L;  4HAE A;  3I56 A;  4J15 A;  3KF6 A;  1JIC A;  3HEJ A;  3VYT A;  4KV6 A;  1EWC A;  4A93 H;  4GOP B;  3HOV G;  1UE7 A;  1XMO Q;  1SNC A;  4DPG A;  4RHR A;  2P5Z X;  5M5Y B;  1S5B D;  1A2T A;  3MAQ A;  2JA6 H;  2RDH A;  4G7Z C;  2Z4I A;  1X3F A;  3QIA A;  2CWP A;  2B3G A;  2VXW A;  5KYL A;  1W6J A;  3AQQ A;  3S9W A;  1X56 A;  2K5W A;  4PMC A;  4V19 0;  3K5N A;  4XTC S;  3DM1 A;  4GLV B;  4QUF A;  1JOR A;  1A3T A;  3RZD H;  2G9D A;  1SDF A;  4RHS A;  2PCF B;  4ZKB B;  1SFO B;  5JOB A;  2XRS D;  2Q2H A;  3VDY A;  2ENB A;  1QUQ B;  1OO9 B;  2DJF C;  4ME5 A;  3HOW H;  2VQF L;  2NB0 A;  2A6H C;  3PV0 A;  2DN8 A;  1XPO A;  2K05 A;  1SXT A;  3CPW A;  3E9H A;  3S16 B;  3OW2 A;  1YIJ A;  3MA2 B;  4R4Q A;  5FK9 C;  4GOP A;  3D4D A;  1Q12 A;  2EZV A;  3I70 A;  1DZ1 A;  1OXV A;  1IXR A;  1EOV A;  2AWO A;  3I8Z A;  2FMM A;  3FMC A;  1TS3 A;  1PFS A;  2A69 D;  4IN3 A;  2KUM A;  2B63 B;  4X64 Q;  1MKH A;  2GN5 A;  4J6H A;  1L1O B;  4DR2 Q;  2CHB D;  1WYD A;  4L5R C;  1PTO D;  4OEL B;  5J39 A;  4GKJ Q;  2VZA A;  3K81 C;  5GAE C;  1G29 1;  4CDC C;  3V2T A;  1J6Q A;  1I6V C;  3GTQ H;  2KCC A;  1DD2 A;  4KY5 A;  4JBK A;  1KDB A;  1KD1 C;  1QCB D;  4QCL A;  2SNM A;  1SN8 A;  2WP8 J;  1MIU A;  1VQI A;  5C4X B;  5T1G A;  3M7N A;  1C48 A;  4U67 3;  2KEC A;  4HID A;  1QUQ A;  2KHI A;  2NVY H;  5LMN L;  4AIM A;  4X65 L;  3GDE A;  3F2C A;  4ZRZ A;  4F87 A;  1F9S A;  2FJ2 A;  5IY0 A;  5JAV A;  3MXG A;  1S5E D;  4JI3 Q;  1HQM C;  1STE A;  1I50 B;  4EX5 A;  4ZUJ A;  5K5P A;  3ND8 A;  2QEX A;  1AW7 A;  1TWH B;  1I94 Q;  1EFW A;  1QB5 D;  2NN6 H;  3FKI G;  1GM5 A;  5EPK A;  4HSP A;  2ZJP A;  2C35 B;  2PYK A;  3PF4 A;  4Y52 H;  3J81 E;  1TY0 A;  3LWE A;  5H1S E;  5IWA Q;  4DU9 A;  1IKL A;  2CKZ B;  1ICW A;  1SE8 A;  1HZ9 A;  3NQI A;  4YHH Q;  3RR5 A;  3EIV A;  5LL6 X;  4R8I A;  1L1O A;  3GTK B;  2PNR C;  1RDP D;  5C4X G;  4AYB G;  4DR6 L;  1D5Z C;  1KAW A;  1M4V A;  2XVS A;  2H4O A;  4RGN A;  1RTO A;  3H0G H;  3H3V H;  1SNQ A;  4L8J A;  1WI5 A;  1KQS A;  2KCN A;  4A93 B;  3NWS A;  3OW7 A;  2L5T A;  3OOC A;  4RGO S;  3HOZ H;  4FF4 A;  3KJP A;  3MXN B;  3PSI A;  2EYM A;  4P75 A;  4QL5 A;  3X3M A;  1RTN A;  1M8A A;  1C7Y A;  1HNX L;  4BY7 G;  3RLO A;  5AJ3 L;  4ODG A;  1C4Q A;  1SYD A;  1Z9F A;  4UY8 C;  1JE4 A;  5IT9 c;  3HKZ B;  3S1R B;  4P2C B;  4HJ8 A;  3RZD B;  1CKO A;  1EY5 A;  4K0K Q;  1X6O A;  4X66 Q;  3RLN A;  4O1N A;  5M3M G;  4GKK L;  2CFM A;  1EY0 A;  4A3I H;  3DWA A;  2I5H A;  3GTO H;  1SNM A;  3HOW B;  5ELD A;  5CGK A;  3VYR A;  2WB1 G;  2MJ8 A;  5TSS A;  3QOJ A;  4J8Q A;  1RCV D;  5C0X G;  4NP5 A;  3CQZ B;  2Z0S A;  4A3C H;  4CDD C;  5A2Q L;  4CJ0 B;  3T4A C;  2J0T D;  3CME A;  2ZM6 L;  1IBL L;  4LF5 Q;  4JBJ A;  4KN7 C;  4ZAI A;  2L12 A;  4C1N K;  2DY7 A;  2ATW A;  3NK9 A;  2K14 A;  3I4O A;  5FLX E;  1FJG Q;  3MXN A;  1CZG A;  3D8G A;  2R7Z H;  1TWA H;  1PH7 A;  1KC8 C;  3GTG B;  1SAP A;  1NR2 A;  1SRO A;  4K6L A;  2HHH L;  2B2U A;  4BBS H;  4FO2 A;  2QCP X;  4HJA A;  3ERS X;  5JPM C;  3GTQ B;  4C3H B;  2UUC Q;  1AP0 A;  5IYC G;  3N52 A;  5ELB A;  2K50 A;  3S24 A;  2PI2 A;  3UE1 A;  3I2Z A;  2WAQ B;  2NVY B;  5GRO A;  3CCU A;  3ZJY C;  1RF2 D;  1G91 A;  4FF1 A;  2JA8 G;  4FXK C;  1BOS A;  2EYO A;  1HH2 P;  1EWI A;  1A8V A;  3MFG A;  2L55 A;  2VY3 A;  3A0J A;  2D62 A;  3EA6 A;  5FLM H;  2F0O A;  3J7A F;  1XMO L;  1HRJ A;  4A3F H;  4OO1 I;  3C1F A;  4RH6 A;  1XYI A;  2FMC A;  2KCT A;  4HR7 B;  1CK1 A;  2EY2 A;  1IYV A;  5IYB H;  2RQX A;  3GTL B;  3K5O A;  4LNQ A;  3TZU A;  1SYE A;  2JA9 A;  4C3H G;  3C1E A;  4O0A A;  4YCU A;  3K0X A;  2F0S A;  4OON A;  4G57 A;  1JWU D;  1R4Q B;  3L3O C;  1GUS A;  4JW0 A;  2HQL A;  4LFB Q;  3QWN A;  2E2H H;  4K6D A;  3PGZ A;  2QEJ C;  3H0G B;  4A3K H;  1E2Z A;  1SNP A;  4JBM A;  2R7D A;  4DUY Q;  3MTS A;  1K0R A;  3LNN A;  1ROD A;  3HOU H;  3HOZ B;  4XT1 B;  1FYC A;  2HQE A;  2ZXO A;  1YI2 A;  1PRT F;  2K7V A;  5I9O A;  4A3L G;  3DM3 A;  4OO1 H;  1KRS A;  5G3L D;  4Y7N H;  4KHZ A;  5JEA G;  3TBI B;  1ASY A;  2KOL A;  1HZC A;  4MHE A;  4IPD A;  1CTM A;  2R7F A;  3TRE A;  4X62 L;  5L37 A;  4DR5 Q;  5DM6 3;  2JXM B;  1U4P A;  4A3B B;  1TT2 A;  4M1U B;  5C3W A;  4JYA Q;  4NKL A;  4OX9 L;  4XQQ A;  2DY8 A;  1D7Q A;  1DOK A;  2VQE L;  5KYI A;  3TS0 A;  1BUV T;  1O7I A;  1N34 L;  2C9O A;  5C3X A;  1ZKO A;  2BCO A;  4A3I B;  2O4X A;  3PUZ A;  2XIW A;  2CW0 C;  3BG3 A;  3S15 H;  4CGY B;  1EQV A;  4GKJ L;  2I07 B;  2VW9 A;  4JVZ A;  3GTO B;  3MWY W;  3FDT A;  1XNR Q;  2A6H D;  2CCZ A;  2B2T A;  2H5X A;  2JK8 A;  1PH5 A;  3ERO A;  3PO2 B;  1EY8 A;  3JAM L;  2O5I C;  3H3V C;  1JJG A;  1Y8N B;  1J9O A;  2YU9 H;  1H9S B;  5K36 H;  4A3B G;  1B8A A;  3K5L A;  3CW2 C;  2ZJQ A;  3Q0A A;  2R7Z B;  2PPB C;  3RD4 A;  3UDI A;  3K7A H;  1A3U A;  3NBH B;  1MI2 A;  4XIG S;  3I90 A;  3G7L A;  1I94 L;  2NTT A;  1VQL A;  3HKZ E;  4BBS B;  1G2S A;  3UE0 A;  1UAP A;  1YNN C;  5COY A;  1BR9 A;  1F2Y A;  4F7X A;  2EVB A;  3J81 j;  5KNB A;  4YY3 Q;  4YHH L;  1TQO A;  1SND A;  4LF7 Q;  3PO2 G;  4LK1 C;  1SJE D;  5M9O A;  4LF4 Q;  3TEH B;  3VA5 A;  4JI4 Q;  1NY4 A;  2L9H A;  1V1Q A;  4I7Z C;  3OTO Q;  2PQA B;  3P7J A;  3NWT A;  3M9B A;  3TN2 A;  1XNQ Q;  4S3S A;  4A3D H;  4XT3 B;  1Q7Y C;  1CSQ A;  1RKN A;  5CV5 A;  2ALY B;  4O42 A;  4FF2 A;  2WKC A;  3E0J A;  2XWJ B;  4B9W A;  4A3J G;  2RA4 A;  4DV1 L;  1NBW A;  2R3Z A;  3CCE A;  1LTT D;  4LF9 L;  4WRD A;  4DK0 A;  1CKM A;  2K4K A;  1IBM Q;  4JOI C;  1KAB A;  4IUR A;  2A1A A;  2XGT A;  1TKW B;  3I4M G;  4KHP L;  1YVC A;  2D0P A;  2VNU D;  1JC7 A;  1N33 L;  1B50 A;  1JOQ A;  5M3F G;  1U4M A;  1O78 A;  3M4O H;  4JPB W;  3Q23 A;  1VQN A;  4YWM A;  1U5K A;  3CCV A;  1RL2 A;  1SMX A;  3PMF A;  3R93 A;  2E2H B;  4UP7 A;  1CKN B; 
#chains in the Genus database with same CATH homology
 1LTI D;  1O7Z A;  2EYJ A;  2R92 B;  1Y8O B;  2QDB A;  5BN5 A;  4RGM A;  3L9A X;  3AMU A;  4C3I B;  4DK1 A;  1EYD A;  4CBV A;  3U9O A;  3DWQ A;  1U4L A;  5C44 B;  3HOU B;  1GHK A;  2F3V A;  1EU4 A;  4Y7N B;  3BDL A;  2PW5 A;  2RBM A;  1DXM A;  5CC4 A;  5C6A A;  1AEX A;  2EJM A;  1DOL A;  1PRT B;  4V0B A;  3VYS A;  3CHB D;  4KHV A;  3R8B A;  2L11 A;  4PV1 C;  1B53 A;  1HA6 A;  3T13 A;  4C3I G;  2VB3 X;  1IW7 C;  3S15 B;  4K14 A;  3OWF A;  2SNS A;  2EY1 A;  5I2X A;  1ESF A;  3ERQ A;  3K6O A;  2F03 A;  1QOH A;  4ZKC B;  2B2Y C;  3NPP A;  1EEF D;  2YU9 B;  4HMI A;  3QOL A;  2AWN A;  2E75 C;  1VDZ A;  4XQN A;  1SBB B;  3VA7 A;  2KEE A;  3K7A B;  3QG1 A;  3PUV A;  1VF5 C;  1DM0 B;  5F2D A;  1A3V A;  1JWM D;  3A7A B;  4PQX A;  4DAP A;  2IL8 A;  3OSO A;  4X3K A;  3D31 A;  1PZK D;  3F2U A;  2WV6 D;  1PRT C;  1HPC A;  1ONL A;  4H7B A;  2QIL A;  2EYL A;  1SYF A;  1OXU A;  4TRD A;  3J80 L;  3DEO A;  2F0F A;  4OHJ A;  1GUW A;  1F2Z A;  1S5C D;  4DA2 A;  2JEA I;  1TII D;  3R3O A;  2F0U A;  4A3D B;  2B2V A;  2SDF A;  4WFN 3;  5JVH 3;  1WTX A;  4G7O C;  5A35 A;  5FO8 B;  1IYU A;  2AUJ D;  5I4D A;  2B39 A;  5EKK A;  4H44 C;  1LT4 D;  4H0L C;  3OHX C;  2KED A;  2EYP A;  1LAB A;  1HQR D;  4KK7 A;  3IL8 A;  1EWH A;  4IFD H;  3S14 B;  2EJF C;  1BBX C;  2RSN A;  3ONA B;  3HOX B;  1IKM A;  3D6W A;  5C0X I;  2LS0 1;  1F9R A;  2IT1 A;  3M85 A;  2FHT A;  5FO7 B;  3SK6 A;  1ILQ A;  1EZ6 A;  3KF8 A;  3WDN A;  1F9Q A;  5JVG 3;  3NTK A;  4IUP A;  1WCM B;  1WTW A;  1SJH D;  4WOR A;  4K8J A;  3I73 A;  3X3N A;  4RKB A;  2IJ0 A;  3G6J B;  1GUT A;  5FOB B;  2OF1 A;  2F0T A;  4QMG A;  4QF4 A;  4XXE A;  1B1Z A;  1STA A;  2CW0 D;  2K1B A;  2YYZ A;  2GA4 B;  3WOF A;  1PMR A;  5COR A;  3H09 A;  3D6C A;  4CKC A;  3URY A;  5IGB A;  4Q5V A;  5KRU A;  3OWE B;  1KAA A;  1TS2 A;  2WKD A;  1SE4 A;  2EOT A;  2WII B;  2BE5 C;  2ICE C;  5JJZ A;  5E3F A;  1E2V A;  1A15 A;  4A3E B;  3H94 A;  1S4Z A;  3T56 B;  1DCZ A;  3NQT A;  5CMD A;  4KJO A;  4K5W A;  1SMY C;  3S1M B;  1YNN D;  1T5X D;  2IWH A;  2RDF A;  3J81 L;  2IPK D;  3PUY A;  5IOC A;  1EZ8 A;  2OXP A;  2F0J A;  3LWU A;  2E76 C;  1FNV A;  4OGQ C;  2A68 C;  3SR1 A;  1F9P A;  1CQV A;  2D2C C;  2XN9 C;  3I4N B;  3R2I A;  2VUM B;  4ZK9 B;  1V8Q A;  3BVM A;  4C1N I;  4F8M A;  3SHL A;  4X3S A;  3S17 B;  1D6E C;  1G8Z D;  3BDO A;  3E5S A;  2JSO A;  3OIP A;  4C56 C;  4G4K A;  1WTV A;  5ISR A;  4DNR B;  2Z1C A;  3C2P A;  1ET9 A;  2PO4 A;  4EQO A;  5J22 A;  4RGT A;  1FD7 D;  2JA6 B;  3I3C A;  5I9P A;  1LT6 D;  2RDG A;  1EY7 A;  5CBA E;  2L1B A;  5ELE A;  1FR3 A;  4IUT A;  2H1E A;  1SEB D;  5KNC A;  1GOZ A;  1QG7 A;  1L0Y B;  2B2W C;  4DXG A;  3TZD A;  3J7Y W;  4FXD A;  5E1F A;  1FGB D;  2AQ2 B;  4B08 A;  1F77 A;  1MSG A;  2PZW A;  2XSC A;  3CRL C;  5FLX L;  1BNZ A;  1IW7 D;  1I4P A;  5IOD A;  3RZO B;  2NVX B;  4ZYS A;  1JQY D;  4RKL A;  1EIH A;  2ZXR A;  1TWF B;  3MFY A;  1SE2 A;  3NTI A;  2PZU A;  1Y1V B;  1EYA A;  1EY6 A;  5D65 A;  3EQL C;  3CRK C;  3NUC A;  2F0K A;  1OXX K;  2PZT A;  3TDQ A;  1O7Y A;  2HCC A;  3T16 A;  3PUW A;  1PRT D;  5C5L A;  4Q0F A;  1HTP A;  3BZD B;  3RLF A;  2LFN A;  1O80 A;  5C3E B;  3GTJ B;  1H9R A;  3I91 A;  2R6G A;  2JA5 B;  1G2T A;  3EVQ A;  3KLS X;  3SE0 A;  4L63 B;  1NUC A;  1VMC A;  1B3A A;  2O2L D;  4FVM A;  2A74 C;  1I4X A;  2F0I A;  2A73 B;  2BDO A;  1H9K A;  3D4W A;  2KHS A;  4RCO A;  1LT3 D;  3PO3 B;  1S5D D;  2SOB A;  1SE3 A;  3NHH A;  1EQT A;  1B9N A;  5C4H A;  5CV9 A;  4IUU A;  2F0V A;  2EY5 A;  2QF7 A;  2F1M A;  3T51 B;  1Q90 A;  5KND A;  2DNE A;  1X3P A;  4R8N A;  1ML0 D;  1VMP A;  3M3Y B;  1RJT A;  2F0N A;  1XX8 A;  4B9X A;  4CJ1 B;  3FPP A;  1HUN A;  2NN6 G;  1B44 D;  3NP8 A;  4X3T A;  1GHJ A;  2R93 B;  4HED A;  2OT2 A;  4DNT B;  1TY2 A;  1Z7T A;  4QIW B;  4FYD A;  4IUQ A;  1A6X A;  4YIJ A;  5EKI A;  3DHQ A;  3Q6S A;  3ND9 A;  1UUP A;  5C0X J;  1A2U A;  1BCP C;  1KLU D;  4N9T A;  3A54 A;  1AN8 A;  3A55 A;  2M9V A;  1CT1 D;  3NXW A;  5EJW A;  2BE5 D;  1TWA B;  3HG9 A;  3V05 A;  3A8I E;  1MGS A;  3HOY B;  1EY9 A;  2MHV A;  4K2L A;  4DFA A;  1NCV A;  2ID0 A;  1WD0 A;  1NR4 A;  3GV3 A;  2XNA C;  2JE6 I;  2J4X A;  1GUN A;  4LMQ D;  2ZT9 C;  2A6E C;  1PLF A;  5IGF A;  1ESR A;  1CQF A;  4IZ8 A;  4TQU S;  2K04 A;  1X32 A;  2HCI A;  1Q1E A;  4ID6 A;  2A68 D;  2HDL A;  1E0B A;  1JCK B;  5HUR A;  4A3F B;  5CR3 A;  2PMZ B;  4X3U A;  1FNU A;  3SXH A;  4TKO B;  5CV8 A;  5E4W C;  1H9S A;  1CA6 A;  1KNE A;  3SK4 A;  1KLG D;  1ENF A;  3NBH A;  1D1K A;  2F0M A;  5IT9 E;  1EOT A;  3KBX A;  3LX0 A;  5CYU A;  5I2Y A;  2WAC A;  3KLS A;  1GJX A;  5AFW A;  4A3K B;  4GZY C;  3P1H A;  3IAY A;  1PZJ D;  3L7Z C;  5ELF A;  1XWE A;  4CKB A;  1LT5 D;  2BA0 A;  4FP5 D;  5JEA J;  2KQ3 A;  4HSV A;  1ENA A;  1LTG D;  1LAC A;  5IGG A;  3KK7 A;  2AUK A;  4PMB A;  1B9M A;  1JOO A;  1TWC B;  4CJ2 C;  2JA7 B;  3VR3 A;  4C3J B;  5EPL A;  1PYW D;  1HFN A;  4CHT B;  3W2D A;  3BDC A;  4DAV A;  5CV7 A;  2K5D A;  2HUG A;  2LMC B;  4A3M B;  4OO1 G;  2B2Y A;  3P75 A;  5C4Z A;  1XTC D;  1HA5 A;  3C46 A;  5FO9 B;  3IKJ A;  4XYO A;  1SYC A;  3TP6 A;  2N55 A;  4XQJ A;  1QE6 A;  3QJY A;  5DNF A;  3BS1 A;  1TU2 B;  1F2M A;  4KY7 A;  4OIK A;  3VR6 A;  3A7L A;  3EFX D;  4DN4 M;  1EEI D;  3VR2 A;  2TMP A;  5K36 G;  1I3Q B;  1H9M A;  5EKL A;  1YNJ C;  1V1O A;  1Z6H A;  3NE5 B;  1IL8 A;  1ZYR C;  1SSO A;  3ITP A;  1IHZ A;  2A5H A;  3KBG A;  1X3Q A;  1ET6 A;  4BY1 B;  1RHP A;  5D3D A;  5BN3 A;  2CQA A;  2O5J C;  3ZYY X;  4KY6 A;  3M4O B;  4NDX A;  3VYU A;  3KUP A;  3HOV B;  1STB A;  3SEB A;  5D3I B;  3R2T A;  1CFM A;  1SNO A;  1WD1 A;  5M5X B;  2B8G A;  2KJX A;  2X6L A;  5D14 A;  1STY A;  4FXG C;  3GO5 A;  3OMC A;  3HS0 C;  2FIN B;  3FEW X;  2F0H A;  1S5F D;  4RCN A;  5ELC A;  1Y8P B;  1QIL A;  1H9J A;  3HZX A;  1K8O A;  4NW2 A;  1V1P B;  1I4H A;  5C0X H;  2PQE A;  4K5V A;  5I6W A;  1QNK A;  2K03 A;  4KD4 A;  1DYQ A;  3TP8 A;  2BDN A;  1BCP D;  2R61 A;  3E6Z X;  1EU3 A;  3S2H B;  2D5D A;  4IUN A;  3FPU B;  1Y1W B;  1BO0 A;  5C5M A;  2HDM A;  3K59 A;  5DAU A;  2NWG A;  3CKI B;  2IX0 A;  3U9S A;  2K5Q A;  3MC0 B;  1QWY A;  2AQ3 B;  3GTP B;  1LV9 A;  3GV6 A;  5M5W B;  1KTK A;  1STG A;  1V1P A;  1AZQ A;  2X6G A;  3GTM B;  1RD9 D;  2A6E D;  3H91 A;  2K28 A;  5FKA C;  3Q22 A;  4KTA A;  1ENC A;  2NN6 I;  1UEA B;  1STN A;  3NTH A;  5KEE A;  3FKI B;  3I72 A;  1II3 A;  1Q1B A;  3VR4 A;  4K2K A;  3NSW A;  2QKI C;  4JBW A;  3BYY B;  1AFP A;  3Q24 A;  5J1Z A;  3MZ5 A;  1BCP F;  5HGT A;  2XRQ D;  2N88 A;  4AYB B;  3TSS A;  3QB3 A;  3D3R A;  5E4X A;  3T53 B;  5CBE E;  1MSH A;  4DAY A;  2E2J B;  4E6I A;  1EY4 A;  1WTQ A;  3FVQ A;  2L0C A;  2CVR A;  1QNU A;  4KD3 A;  5JEA H;  4BY7 B;  1QJO A;  4PMW A;  5KGU A;  1T5E A;  3MEH A;  4KMU C;  2Y0S B;  3A56 A;  4FNF A;  2C5C A;  3TP5 A;  1KNA A;  2F0P A;  2B2W A;  2KVM A;  5M3M B;  2VB2 X;  2K01 A;  3HGB A;  3IFD A;  1JOK A;  4IFD G;  2ZXP A;  2F4I A;  1LO5 D;  4U68 A;  5BN4 A;  1PTO F;  2NUC A;  2BA1 A;  5EPJ A;  3PIP 3;  2WB1 B;  1D5M C;  4ZUI A;  3KLR A;  2E2I B;  3GP7 A;  4C2M B;  1OXT A;  1TWG B;  4TSS A;  3H6M A;  1PTO H;  4G7H C;  3DUZ A;  4EGV A;  4R9W A;  2F0G A;  3OIQ A;  4KKU A;  3TP7 A;  1G6Z A;  5CV4 A;  4IUV A;  1GUG A;  1UNS A;  2EDG A;  1U4R A;  1DOM A;  4PNY A;  4IAL A;  4QUC A;  5IIF A;  2K6A A;  1EL0 A;  2I46 A;  1DON A;  1ZEQ X;  4ZQ3 A;  3K5M A;  2EJG C;  5EBC A;  1J8I A;  1PFN A;  1VF7 A;  4ABN A;  4F88 A;  5LHY 1;  2EE1 A;  2JA8 B;  2MPM A;  4RA8 A;  1L0X B;  3O13 A;  3P20 A;  2F0D A;  3IFT A;  2LKV A;  2XWB B;  2F0Q A;  1O7L A;  1YNJ D;  4HCS A;  3RUZ A;  2B2U C;  5C4J B;  5A2Q E;  1ZYR D;  1B4O A;  1BQQ T;  5EBD A;  3C3L A;  3S2D B;  3PIO 3;  4Z9C B;  2AQ1 B;  4QB4 A;  2PW7 A;  3RMH A;  3A8J E;  2ICI A;  5JPN C;  1BDO A;  3M4Y A;  1MD2 D;  5T1I A;  3TME A;  2RSO A;  4DXF A;  4UAI A;  1AZP A;  2Q8R E;  1GXD C;  1LTS D;  4ILW A;  1BCP B;  2BOS A;  1TVX A;  1JR0 D;  2B8F A;  3K57 A;  2NVQ B;  3K58 A;  1Q3L A;  3BVZ A;  1NAP A;  4EQN A;  5I6Y A;  2NYZ D;  4LJZ C;  1BF4 A;  3FRP B;  3WOE A;  4IFD J;  1I4R A;  1JB3 A;  5CV6 A;  2V4D A;  3SVM A;  1D2B A;  3N6R A;  1CA5 A;  2JEB I;  5KIX A;  1I4Q A;  1KDA A;  1WTO A;  2G9H D;  1GUO A;  2Z4H A;  3DXJ C;  5DM7 3;  4UDU C;  1EYC A;  1PTO B;  1D5X C;  1LTA D;  3OPO A;  2JYO A;  1PFB A;  3VR5 A;  1OXS C;  1I4G A;  2NTS A;  1HUM A;  4HCE A;  4IQZ A;  1XXG A;  1CZW A;  3SDZ A;  3J7A V;  2Q8T A;  2EYF A;  3S1Q B;  1EIG A;  1VCI A;  2WIN B;  4RFB A;  2Q8I B;  3OMG A;  2B2T C;  1WTR A;  2D9U A;  1BXT A;  1LLR D;  2EY6 A;  4KN4 C;  4N9P A;  3BYT B;  1CHQ D;  1SMY D;  1U9R A;  3MXU A;  5NUC A;  3MVV A;  4ZLT F;  2E2D C;  1TS5 A;  3PUX A;  1MBY A;  2A69 C;  3GD7 A;  3HP3 A;  3UI2 A;  4HN7 A;  5IT9 L;  4A3J B;  3V96 A;  2L4N A;  2OEO A;  1PTO C;  5G3L F;  3I4M B;  4BA1 I;  3JAM E;  4BWG B;  5M3F B;  1DJR D;  1PZI D;  2Z8L A;  3W3A A;  3AB9 A;  4FF3 A;  4A3G B;  2NZ1 D;  1HFG A;  4XDX A;  1LTR D;  4CKE A;  4DF7 A;  2DNC A;  4BA2 I;  3GQB A;  5EGT A;  4H13 C;  5IGE A;  2M2L A;  4EVO A;  2M00 A;  2FFK B;  2EPB A;  1HTL D;  2TSS A;  2J7Z A;  3SK5 A;  1HCZ A;  2E74 C;  2NVT B;  3DEP A;  4K5X A;  1SYB A;  2X69 A;  2KA7 A;  1I6H B;  1W6K A;  5IGC A;  1WTP A;  4ULL A;  3BVG A;  4I65 A;  3HRZ C;  1SYG A;  4KKS A;  1EFI D;  4K8I A;  2F0W A;  4RWS C;  1PFM A;  1PXU A;  1ILP A;  4KI0 A;  2MGS A;  2IW3 A;  2K32 A;  2EYH A;  5DEH A;  5LL6 S;  3DMU A;  2EXZ A;  3MHB A;  3M7G A;  3AU7 A;  1HXY D;  4EQP A;  2SEB D;  2IX3 A;  1ZXT A;  1C8C A;  3NBI A;  3K0Y A;  1KDC A;  4LAA A;  4KKT A;  1PDQ A;  4HMJ A;  2MP1 A;  4C3J G;  1JWS D;  3MXP A;  1CM9 A;  4L6T B;  4XYQ A;  3I4L A;  2MUY A;  4WJW A;  4BS9 A;  1FNW A;  2NBF A;  5IGD A;  4BBR B;  4RAU C;  3DWP A;  1TS4 A;  4DGZ A;  1R9T B;  1HHV A;  1CHP D;  3EJI A;  1Y69 U;  3D4R A;  4MIU A;  4J1M A;  4M8A A;  1Z47 A;  4IFD I;  1K83 B;  1B2T A;  5EQ0 A;  4OIJ A;  1STH A;  2LY7 A;  3S1N B;  3QO2 A;  2RKS A;  2RVL A;  4NMZ A;  4JK1 C;  1WVL A;  1D1I A;  2K33 A;  4OL7 A;  1TR5 A;  2B2V C;  3CU7 A;  1E2W A;  1NSN S;  3SK8 A;  1R4P B;  3A8K E;  1F2L A;  2F3W A;  1CI3 M;  1LTB D;  1K8M A;  2F0E A;  4MN3 A;  3J80 E;  4HTH A;  1V43 A;  2IX1 A;  2JP1 A;  1Q8I A;  2F0L A;  4HAE A;  1JIC A;  3HEJ A;  3VYT A;  4KV6 A;  1EWC A;  1SNC A;  4RHR A;  5M5Y B;  1S5B D;  1A2T A;  3MAQ A;  2RDH A;  4G7Z C;  2Z4I A;  3QIA A;  2VXW A;  5KYL A;  1W6J A;  3S9W A;  2K5W A;  4PMC A;  4V19 0;  3K5N A;  4XTC S;  3DM1 A;  4QUF A;  1JOR A;  1A3T A;  2G9D A;  1SDF A;  4RHS A;  2PCF B;  4ZKB B;  1SFO B;  5JOB A;  2XRS D;  2ENB A;  1OO9 B;  4ME5 A;  2NB0 A;  2A6H C;  3PV0 A;  2DN8 A;  2K05 A;  1SXT A;  3S16 B;  3MA2 B;  5FK9 C;  3D4D A;  1Q12 A;  2EZV A;  3I70 A;  1DZ1 A;  1OXV A;  2AWO A;  3I8Z A;  2FMM A;  3FMC A;  1TS3 A;  2A69 D;  4IN3 A;  2KUM A;  2B63 B;  4J6H A;  2CHB D;  1PTO D;  5J39 A;  1G29 1;  3V2T A;  1I6V C;  2KCC A;  1DD2 A;  4KY5 A;  1KDB A;  1QCB D;  4QCL A;  2SNM A;  2WP8 J;  5C4X B;  5T1G A;  3M7N A;  1C48 A;  4U67 3;  2KEC A;  4ZRZ A;  4F87 A;  1F9S A;  2FJ2 A;  5JAV A;  3MXG A;  1S5E D;  1HQM C;  1STE A;  1I50 B;  5K5P A;  4ZUJ A;  3ND8 A;  1AW7 A;  1TWH B;  1QB5 D;  2NN6 H;  5EPK A;  4HSP A;  2PYK A;  3J81 E;  1TY0 A;  3LWE A;  4DU9 A;  1IKL A;  1ICW A;  3NQI A;  5LL6 X;  4R8I A;  3GTK B;  2PNR C;  1RDP D;  1D5Z C;  1M4V A;  2XVS A;  2H4O A;  4RGN A;  1RTO A;  1SNQ A;  4L8J A;  2KCN A;  4A93 B;  3NWS A;  3OW7 A;  2L5T A;  3OOC A;  4RGO S;  4FF4 A;  2EYM A;  3X3M A;  1RTN A;  1M8A A;  4ODG A;  1C4Q A;  1SYD A;  1JE4 A;  3HKZ B;  3S1R B;  4P2C B;  3RZD B;  1EY5 A;  4O1N A;  1EY0 A;  3DWA A;  1SNM A;  3HOW B;  5ELD A;  5CGK A;  3VYR A;  2MJ8 A;  5TSS A;  3QOJ A;  4J8Q A;  1RCV D;  5C0X G;  4NP5 A;  3CQZ B;  5A2Q L;  4CJ0 B;  3T4A C;  2J0T D;  4KN7 C;  4ZAI A;  2L12 A;  4C1N K;  2DY7 A;  3NK9 A;  5FLX E;  3MXN A;  1CZG A;  3D8G A;  3GTG B;  1SAP A;  1NR2 A;  4K6L A;  2B2U A;  4FO2 A;  2QCP X;  5JPM C;  3GTQ B;  4C3H B;  1AP0 A;  3N52 A;  5ELB A;  2WAQ B;  2NVY B;  1RF2 D;  1G91 A;  4FF1 A;  4FXK C;  1BOS A;  2EYO A;  3MFG A;  2L55 A;  2D62 A;  3EA6 A;  2F0O A;  3J7A F;  1HRJ A;  4OO1 I;  3C1F A;  4RH6 A;  1XYI A;  2FMC A;  4HR7 B;  1CK1 A;  2EY2 A;  1IYV A;  2RQX A;  3GTL B;  3K5O A;  3TZU A;  1SYE A;  4C3H G;  3C1E A;  2F0S A;  4G57 A;  1JWU D;  1R4Q B;  3L3O C;  1GUS A;  3QWN A;  4K6D A;  2QEJ C;  3H0G B;  1E2Z A;  1SNP A;  3MTS A;  3LNN A;  1ROD A;  3HOZ B;  4XT1 B;  1FYC A;  2HQE A;  2ZXO A;  1PRT F;  2K7V A;  5I9O A;  4OO1 H;  5G3L D;  4KHZ A;  5JEA G;  3TBI B;  2KOL A;  4MHE A;  1CTM A;  5DM6 3;  2JXM B;  1U4P A;  4A3B B;  1TT2 A;  4M1U B;  5C3W A;  4NKL A;  4XQQ A;  2DY8 A;  1DOK A;  5KYI A;  1BUV T;  2C9O A;  5C3X A;  1ZKO A;  2BCO A;  4A3I B;  2O4X A;  3PUZ A;  2XIW A;  2CW0 C;  3BG3 A;  4CGY B;  1EQV A;  2I07 B;  3GTO B;  3MWY W;  3FDT A;  2A6H D;  2B2T A;  3ERO A;  3PO2 B;  1EY8 A;  3JAM L;  2O5I C;  3H3V C;  1Y8N B;  1J9O A;  1H9S B;  5K36 H;  3K5L A;  3Q0A A;  2R7Z B;  2PPB C;  3RD4 A;  1A3U A;  1MI2 A;  4XIG S;  3I90 A;  3G7L A;  2NTT A;  4BBS B;  1G2S A;  1UAP A;  1YNN C;  5COY A;  1BR9 A;  1F2Y A;  4F7X A;  2EVB A;  5KNB A;  1TQO A;  1SND A;  4LK1 C;  1SJE D;  5M9O A;  3VA5 A;  2L9H A;  4I7Z C;  3P7J A;  3NWT A;  3TN2 A;  4S3S A;  4XT3 B;  1RKN A;  5CV5 A;  4O42 A;  4FF2 A;  2WKC A;  3E0J A;  2XWJ B;  4B9W A;  2RA4 A;  2R3Z A;  1LTT D;  4WRD A;  4DK0 A;  1KAB A;  4IUR A;  1TKW B;  2VNU D;  1JC7 A;  1B50 A;  1JOQ A;  1U4M A;  1O78 A;  3Q23 A;  2E2H B;  4KJN A;  3PMF A;  3R93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...