2L5TA

Solution nmr structure of e2 lipoyl domain from thermoplasma acidophilum
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
77
structure length
77
Chain Sequence
MYEFKLPDIGEGVTEGEIVRWDVKEGDMVEKDQDLVEVMTDKVTVKIPSPVRGKIVKILYREGQVVPVGSTLLQIDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoamide acyltransferase
publication title Solution NMR structure of E2 lipoyl domain from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 3
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l5tA00
3PUVA 1HQMC 1FR3A 3M85A 2B8GA 1Y8NB 3ND9A 3U9SA 4KN4C 3N6RA 1HPCA 1Y8PB 2ZT9C 2DNEA 1Z6HA 5K36H 5KNBA 1DCZA 1K8OA 2KCCA 3OW7A 3P20A 4JBWA 3H94A 2DN8A 1TU2B 1OXVA 3QJYA 3I4LA 2A6HD 1LACA 3CRLC 1H9KA 4G7ZC 3SE0A 1GUTA 2A68D 3A8KE 3L7ZC 1G291 1VDZA 1Q1EA 3VR6A 3M4YA 3PUXA 3VR5A 1IW7C 2K32A 4OGQC 1GUSA 2DNCA 1YNNC 3VA7A 4KKUA 4XIGS 3GD7A 2QF7A 1VF7A 4BA1I 2EJMA 1H9SA 5A35A 1GJXA 2A69C 4H13C 3M7NA 2NN6G 3KLRA 2LMCB 3PUYA 3T53B 3W3AA 1E2WA 2D5DA 4L8JA 3QG1A 3ND8A 2K33A 2JE6I 1Q1BA 4TKOB 3T51B 5BN4A 1V43A 2O5JC 2L5TA 2D62A 5BN5A 1IYVA 1H9SB 3VR3A 3BG3A 2YYZA 1Q12A 1IYUA 2BE5D 2AWOA 2JEBI 1BDOA 3A8JE 4OO1G 2NN6H 2A6HC 1OXSC 3IFTA 5BN3A 1PMRA 3TZUA 1SMYC 4RCNA 1H9JA 3OPOA 2PPBC 1Q90A 2V4DA 3A7LA 1Y69U 1ZKOA 1T5EA 3A8IE 4PV1C 2EVBA 4G7HC 1OXUA 1A6XA 2JXMB 3AB9A 2AUKA 4I7ZC 4OO1H 3QIAA 3DXJC 2R6GA 4DK1A 1OXTA 3PV0A 1HTPA 4KHZA 2Q8IB 3A7AB 2NN6I 4KMUC 2BA0A 3I73A 4GZYC 1LABA 2KA7A 4XTCS 1GHJA 4DNRB 1GHKA 2IT1A 4H0LC 4IFDG 2F1MA 2BDOA 1IW7D 2A6ED 4TQUS 3BDOA 4DNTB 3VR4A 1DD2A 4JK1C 2JEAI 2A68C 1I6VC 2AUJD 2E75C 1K8MA 1FYCA 1O78A 1ONLA 2A69D 3IKJA 4IQZA 1CFMA 4LJZC 1QJOA 1HCZA 3PUZA 1B9NA 5C0XH 3PUWA 5KNCA 1TKWB 3FPPA 1CI3M 4IFDH 4LK1C 3OOCA 1ZYRC 1O7LA 1E2ZA 4KKTA 3FMCA 2K7VA 3WDNA 2BA1A 1EWHA 1E2VA 4G7OC 4KI0A 3GQBA 1YNJC 3HGBA 5JEAH 1CTMA 2EJFC 2PNRC 5KNDA 2PCFB 4BA2I 4KKSA 1OXXK 2E76C 1H9MA 4DK0A 5C0XG 3SDZA 1Z7TA 2EJGC 3D31A 3NE5B 4HR7B 2BE5C 3CRKC 1GUOA 1V8QA 3I72A 4KN7C 1VF5C 3EQLC 3MXUA 3T56B 1H9RA 2E74C 2B8FA 2A6EC 3LWUA 5K36G 2D2CC 4H44C 3D4RA 1GUNA 2CW0C 2EDGA 3LNNA 3MFYA 3RLFA 1GUGA 1Y8OB 5JEAG 1DXMA 2O5IC 1B9MA 3VR2A 1VCIA
chains in the Genus database with same CATH superfamily
1A3TA 3HFZB 1UUPA 2F0SA 5EKIA 1J5EQ 1A62A 4JBMA 2N78A 1FJGL 4P73A 3CCJA 1LTSD 4K2KA 2KENA 3K5OA 1K8OA 1X32A 1NTGA 1KDCA 1LACA 4HMIA 4LFBQ 3I2ZA 2E2IB 1C4QA 3S1MB 1J8IA 3T13A 3I70A 3S17B 1STAA 3NTKA 1U5KA 4XIGS 2R92G 1HRJA 1B1ZA 2NVTB 3BDCA 3EJIA 1WD1A 3GTOH 2FHTA 2F0QA 3IRBA 2LY7A 4H02A 1JQYD 1J9OA 2JA7B 2DUDA 1TWAH 1O7YA 4DK3C 2O5JC 5I2XA 2ICEC 3GTKB 3UE0A 3TDQA 1VQ8A 4EQNA 1ICWA 5EQ0A 3HOYH 3CQZH 4X66Q 3S1QH 1A2UA 2F0WA 4IN3A 5BN3A 3FRPB 1MHWC 2O2LD 4GKKL 5I6WA 3EROA 1SXTA 1TY0A 1WCMH 5T1IA 2EYJA 5EBCA 2R3ZA 2XSCA 4K0KQ 3DXJC 4I7AA 3AYHB 1WFQA 2UXBQ 4KHZA 1DOMA 1CK1A 2FJ2A 3STBD 3I4MG 1V1PB 1LTAD 4C1NI 3PO2G 5JAVA 2PMZE 1SNDA 1P16A 2L4NA 1TWHH 5FLMG 1SFOB 3A55A 4KTAA 5DM63 1NAPA 1A15A 4XYQA 3SEBA 2CW0D 1I4HA 1RF2D 2EY6A 2EY1A 3QO2A 2L1BA 4N9PA 4X3SA 3QOLA 4A3IH 1XJVA 5G3LD 4M1UB 3ONAB 5LMNW 4MHEA 2XIWA 2F4VL 2NBFA 4BBSG 2K5WA 2WP8J 2Y0SB 2IY5B 1EQVA 4FXKC 3E6ZX 3PF4A 2HCIA 3TBIB 3RN2A 3KDFB 4RKLA 3NHHA 4MIUA 1V8QA 3H0GB 1VF5C 5M3FG 4NKLA 2JA5B 3P7JA 5I4DA 1ET9A 1IZ6A 3MTSA 4R4CA 4IFDI 1VQKA 2HQLA 1HZBA 1STBA 5ELCA 3GTLH 1SNOA 4XXEA 1QOHA 4RAUC 1SE4A 2N55A 4GNXC 1LLRD 3A56A 1IKMA 1EY0A 3D3RA 1Z47A 5C4XG 1K83B 1N34Q 4Y7NB 3MXNB 1SR3A 4PG3A 2HD3A 2NYZD 3KJOA 1Y1WG 4IUNA 3S9WA 2RDGA 5JJZA 4R4TA 1VQGA 3X3MA 4K6DA 5IOCA 1WTXA 1PTOB 1JOQA 1VS0A 2Q2UA 1A8VA 2G9DA 3E9IA 1LUZA 1R4PB 4K0KL 4HTHA 2B2WC 4BA1I 2UXBL 2C9OA 3T4AC 2NN6G 3F2DA 3I56A 1EYDA 3I8ZA 3HOWB 1V1QA 3VYTA 2HCCA 2ID0A 3MXGA 3F8TA 2B2TA 2PW5A 2HUGA 1C9OA 1X55A 2HIVA 2KJXA 1TT2A 1Q3LA 3MAQA 3G6JB 5FLXc 2F0IA 1WTRA 3CPFA 1JT8A 1B7YB 4WRDA 2V4DA 3PCOB 1T9HA 2CQOA 1ZKOA 2NTTA 5M3MH 1V1PA 3Q6SA 1EIGA 3G48A 4A3BH 3HOVG 1MJCA 1PTOF 3DHQA 1PFNA 1DONA 1KRSA 2YTYA 4U68A 1GOZA 1TS4A 1O80A 1YI2A 2VQFQ 1EWIA 1PFSA 1XPRA 4HCEA 2CHBD 2HDLA 2VZAA 1WVLA 1PYWD 3DLLA 1PZID 4WORA 5JJIA 1K8MA 1FYCA 1EZ8A 1RJTA 4JI8Q 5IWAL 2EPBA 4A93B 2YU9B 4NB3A 2E2DC 3KDFA 2EYPA 5LL6X 4HJAA 2R93H 2R61A 5ELNA 2EJFC 1WOCA 1G91A 2RHSB 1OXXK 2Q2TA 3S14H 2LS01 2JN4A 5CV7A 4UDUC 1EFWA 4R8NA 1BNZA 1WTPA 4PMBA 1S5FD 3J7YW 1GUGA 3MXNA 4DV7Q 3KUPA 2UUBQ 3ITPA 3K8AA 2KHIA 2B8GA 2E2JB 2K50A 4WFN3 1UAPA 3N6RA 1A2TA 3AFPA 1DCZA 3H94A 2DN8A 3TP5A 5A2QL 4AQYQ 2K5HA 1CQVA 1SMYD 4YWMA 3BVMA 2NVYB 2Z9HA 3M7GA 3PUXA 1N33Q 4JVZA 3OIQA 4OWTB 2OTLA 4PQXA 2F0NA 2F0UA 4QF4A 2UUAL 3KLSA 1E22A 2LMCB 2UU9Q 2UXCQ 1V43A 3FKIG 2NVXH 4DV4Q 5C3WA 1EIHA 4HJ7A 3H15A 1I4GA 4OXPA 2JA6G 4IO9A 3I91A 4JI8L 4LF8L 2SNMA 3M4OH 4BBRG 1X3FA 1EFID 4AIMA 4K5VA 2Z1CA 5IYBH 3BVGA 4RHSA 5FK9C 3AU7A 5LMNQ 1XNQQ 3U4VA 1X9NA 1ZXTA 2KA7A 4A3MB 1LO5D 4ZLTF 4DR7Q 2F1MA 2BDOA 4DKAC 1SYBA 2LSSA 1PH7A 4HIMA 3Q22A 4LW1A 4DR5Q 1QZGA 1PTOD 4DV7L 1TVXA 1EWCA 2UUBL 1FL0A 2VW9A 2Y0SG 4KY7A 5IP9G 4IURA 4C3HH 1I4PA 1ZYRC 2KHJA 4CHTB 1TY2A 4QMGA 1M8AA 3MEFA 1E2VA 1IBMQ 1M1KC 1YNJC 3H0GG 4CDEC 5E7NA 4EQPA 4TVAB 2JA5G 4A3DB 2L0CA 1SLJA 4ZYSA 2E5LL 4A75A 1N33L 1W2BA 1KAAA 2KUMA 1HUNA 5KGUA 2B2UA 3S17H 1HNZQ 1DM0B 1EQQA 1N32L 3VR2A 3E9HA 1EYGA 2NVTH 4JI2L 1FR3A 1BCPC 3PO3B 1VQOA 2WACA 4B3TL 2NVQB 4HJ8A 1KNEA 2JA7H 3WOFA 4K5WA 4MTKA 3RZDB 2ATWA 1SYCA 2XRSD 2FMCA 1WYDA 2DJGC 1WTWA 5C0XJ 3OMGA 1FGUA 3KF8B 2CFMA 5C3EB 5E4XA 1WD0A 4QIWE 1SRUA 4FXDA 3HOWG 4XQQA 3GD7A 4KJNA 2EJMA 1K9MC 3Q23A 1AH9A 1STNA 2B2YC 1RIPA 3OWEB 4B9XA 5EAYA 4DXGA 5LMNL 1I94Q 4X3TA 1XNQL 3T51B 1IYVA 1STHA 2L5TA 1IL8A 1I50B 1MSGA 3VR3A 2BDNA 3AQQA 4DR7L 1CKNA 1IYUA 1Q46A 4DR5L 4JI7Q 3GTQB 2KCNA 1SNPA 3OTOQ 3GP7A 4A3LH 5COYA 3J81i 3QWNA 3TZUA 3ICEA 1SMXA 1SFOH 1Q90A 1IHZA 3HOZG 2QW7A 2AUKA 4OO1H 1SE2A 3CF5A 4QQBX 4YWKA 1ML0D 1F9PA 2ALYB 2NN6I 2BA0A 2R7ZG 4PZ8A 1WJJA 4DR1Q 2F3VA 4H0LC 2IX0A 2A6ED 4POFA 4L6TB 2XTIA 1HNZL 1DD2A 1JWUD 4C3IH 1ASZA 4A93G 2JA5H 4DAPA 3DM3A 5C5LA 4CKBA 5KNCA 4GKJL 1L1OA 1TKWB 1D7QA 4LNQA 2WAQB 1IBLQ 3FMCA 2VS1A 4I65A 3U50C 2H4OA 3K57A 3RR5A 5ELFA 1Q81C 4RGNA 3PMFA 4Y7NH 3HKSA 4A4IA 3PO2B 4JW0A 1XWEA 2WKCA 1F77A 4FO2A 5ELOA 1I6HB 1PLFA 4UP7A 3R3OA 4C3JG 1PTOH 1TWFB 2CW0C 3MVVA 4UP8A 3CU7A 1NSNS 3KLSX 4DAVA 1HZ9A 2Q2HA 2SDFA 5CBEE 3Q0AA 4DV2Q 1XPOA 4QY7A 4KN4C 3TP8A 1X56A 2DNEA 4JBKA 1TWGB 4Q5VA 1EU4A 4JI7L 4BBSB 3OTOL 3J81j 1XMQL 2MGSA 3MWYW 1TR5A 1VQFA 2K32A 1JWSD 3K81C 3CCRA 2JA8B 4KKUA 3L2PA 5AJ3Q 2L55A 2QF7A 2ZM6Q 5M3FB 3FEWX 4OWWB 1QILA 4X65Q 1TS2A 4O0AA 5E3FA 3V2TA 1MKHA 3RUZA 2MNAA 4OHJA 5C4XB 4LMQD 3BZKA 3Q24A 1PRTC 1STGA 4ILWA 1Y1WB 4BWGB 2AHOB 1BQQT 2VB2X 3A7LA 2I46A 5ELBA 3D6WA 3GTJB 5EJWA 1AW7A 3AB9A 2F0FA 5GADC 4WJ3M 2LKVA 5FO8B 1FNWA 4YCVA 2K05A 4A3MG 5E1FA 5C44G 2I07B 4GS3A 4A93H 4DR2L 4KMUC 2YU9H 3I4OA 1RL2A 3CCLA 1QVCA 4FDBA 5M5WB 3G6EA 4DK6C 1KTKA 1AN8A 5EKLA 1R9TH 3V96A 5FO9B 2F0DA 4JI5Q 1JORA 4P74A 1X6OA 3R93A 4IUUA 4IQZA 2A73B 2LXKA 3S2DH 1M4VA 3NENA 1E24A 4DV2L 1BF4A 3HOUH 4DA2A 1EY7A 4IFDH 5M5YB 1ASYA 3JAML 4CDCC 4XDXA 4A3DG 2PI2A 2E2JH 1G2TA 1YJNA 1HQRD 1E3PA 5GQOA 3S1RB 3HOXG 4X6AH 2IX1A 2OTJA 3D31A 2WB1E 1FNVA 3T56B 5AJ3L 3R2IA 4A3KG 1HH2P 3LWUA 2ZM6L 2NVYH 1Y8OB 4ID6A 4DV1L 2EYFA 2F0HA 2DJFC 1QG7A 2F3IA 1HNXQ 3M85A 1LV9A 1Y8NB 2B2VA 2K5DA 1YNXA 3RD4A 1ICFB 1ESFA 5KNBA 4HMJA 1TU2B 4JI1Q 5DM73 2K52A 3GTMB 4TRDA 2B63B 2SEBD 4X3UA 3H3VI 4JG2A 4IOCA 1JJ2A 1BO0A 1C48A 2B2TC 2F0VA 1LTLA 1SYEA 3C1EA 1CSPA 4A3CG 5D3DA 4Z9CB 3NK9A 4JCVE 1NR4A 5HGQA 3HZXA 5IP7H 3ND8A 2KEDA 4RCOA 2VXWA 1VQEA 5JPMC 2F4VQ 4JI5L 2MO1A 3BG3A 1F2MA 1LTBD 1KHIA 4KK7A 1I3QB 2PNHA 3UE1A 1UWVA 4YHHL 4ABNA 4HIOA 4A3MH 1NBWA 3S15H 1SMYC 4KV6A 3A8IE 2YTXA 4K14A 2EVBA 2IHEA 1PHJA 3I4NB 1K3RA 1SJED 4L5SA 1EIFA 4LF6L 4I7ZC 3CCEA 3V05A 1HZCA 1LTGD 3CHBD 2O4XA 3NWTA 1D5XC 3BDLA 1PH5A 2JP1A 1HTLD 2CWAA 4HIDA 5NUCA 2ZJQA 3NBHB 4FF3A 5I9OA 3MXPA 1IW7D 3FKIB 2M00A 3VR4A 2F03A 1CFMA 2WAQG 1QJOA 2Z6KA 1HNXL 3PUZA 1HA6A 1L0XB 2XGTA 4A3JG 2JA6B 4EGVA 1CI3M 1YHQA 2J7ZA 1B3QA 3EVQA 3GTPB 3PO3H 2MO0A 2B39A 4JI1L 4BBRB 3HGBA 1HR0W 2NVQH 2X6GA 3CPWA 1VQDA 1H9MA 1S5CD 5C0XG 1U9RA 3RZDH 3CCQA 2F0TA 2VUMH 1KAWA 3I72A 4KN7C 1M90C 3A54A 2RSNA 2PZTA 5K36G 3ZYYX 3FDTA 5C3EH 3LNNA 3F2BA 2QEJC 1DXMA 4APVA 5IYCH 3C3LA 1QVGA 2N3SA 4AH6A 2WINB 5D3IB 4ZK9B 1U4RA 2RCNA 2N88A 1NR2A 3F1ZA 1S5DD 2EYLA 3J80i 2HDMA 3J81E 1I50H 4OIJA 3CP0A 4FF1A 2JA8G 4DAYB 3I55A 2A68D 3HKZB 4ZRZA 3K6OA 2QA4A 5GAHC 4ALPA 1STEA 4DR4L 3GTQH 3VR5A 4PNYA 1NCVA 2DGYA 3S24A 5BR8L 1VF7A 1QUQB 1C0AA 5CGKA 1ENAA 3QR8A 1AZQA 1S72A 1E2WA 3RZOB 5IWAQ 4Q0FA 4KY5A 2R92H 4DXFA 4DV3Q 3KLWA 3UDFA 2BE5D 2AWOA 4JI3L 3WWVA 4S3SA 3K0YA 4ODGA 3L3OC 5FLXL 1KQSA 1SYFA 5H1SE 4RCNA 4A3GB 4JOIA 3SXHA 4IZ8A 4PV1C 4G7HC 2JXMB 3C1FA 1PH9A 3U9OA 4B3SL 4IPHA 1K8GA 4XQJA 3KOJA 4QCLA 4E6IA 1XMOL 3URYA 2FFKB 2H1EA 3CXCA 1EZ6A 3AMUA 3I90A 3I4MH 2F0KA 2K75A 1ILQA 2QCPX 3PO2H 3PF5A 1I6HH 1A63A 3M4PA 2MP1A 5C0XH 1AE2A 3GV6A 4X64Q 1TWFH 5FLMH 4LK1C 4B3RL 2NZ1D 1O7LA 3HOZB 2UUAQ 3WDNA 4CDDC 4FNFA 5J39A 5EGTA 2B2UC 5KNDA 1LM0A 1SSOA 1TWGH 4DK0A 1WTVA 1VQ5A 4IOAA 4BBSH 2EOTA 3CC7A 2R7ZB 3E0EA 1CUKA 4GNXB 3SHLA 2A6EC 3MFGA 1B9MA 2JA8H 4XQNA 4LF8Q 4AYBE 4BS9A 1MSHA 4CKCA 5M3FH 3EFXD 1OTCA 4DAYA 4DV3L 1EOVA 2B63G 3FP9A 4K6LA 1S3OA 3S2HB 1XNRL 2BH2A 2L15A 5C4XH 1QUQA 1AEXA 1Q1EA 2EXDA 1SEBD 3VR6A 4PZ7A 1C8CA 1Y1WH 3HRZC 2EIFA 3K7AB 2N8NA 2QGQA 4QUFA 3M7NA 1GVPA 3GTJH 1X54A 2PZUA 4X3KA 4C3JB 4P72A 1SNQA 4L8JA 4OONA 2MQHA 4JBJA 2QILA 1KC8C 1PH3A 1PDQA 1SE3A 4L5RC 3ULJA 2JEBI 2HIXA 5DLQE 1SNMA 2NN6H 3M4QA 5M5WH 2JJQA 3I4NG 5JPNC 2NZOA 4O42A 1O7ZA 1EY9A 2PPBC 4BY7B 1CQFA 3OMCA 2E5LQ 4K8JA 4X64L 1OXUA 5C4ZA 5C6AA 2PYKA 5FKAC 4B3MQ 5C4JB 5JVG3 4RH6A 1Q82C 2R6GA 3D6CA 5ELEA 3GDEA 3CCVA 1N32Q 1TS3A 4JI2Q 1GUWA 5M5YH 1U0LA 4NXNL 3WOEA 4B3TQ 1ZEQX 4L5QA 4OX9Q 1GHKA 3NPPA 3HOVH 1I5FA 4GOPC 1L1OC 2RF4A 5M5XH 4R4OA 3BDOA 3S1RH 3NQTA 1Q8KA 4HSPA 4J1MA 1G6PA 4N9TA 2PO4A 1CT1D 1B8AA 2XVSA 1CSQA 1PXUA 3FPPA 3GTGB 2VY3A 5LMUL 4KD3A 2V1CC 4A3EG 4C56C 5FOBB 1II3A 1AE3A 2IL8A 5C44B 2KCMA 3NP8A 1EYCA 4OIKA 1BBXC 3KK7A 2CWPA 3M9BA 1VQPA 3QOJA 4LFCQ 1GUNA 3RLFA 1EEID 3CMAA 1HNWQ 1U4MA 4UAIA 3SR1A 2DY7A 4J6HA 1KDBA 2MHVA 1Y1VG 5IYDG 3U9SA 2RDHA 2ZT9C 3LGJA 3OIPA 4CJ2C 3HKZG 3J7A5 3FVQA 2OF1A 1L2FA 4LF9Q 1LYLA 3SE0A 1GUTA 5JJKA 1JOKA 2OQ0A 2K28A 5C0XI 2KOLA 3CW2C 4B3ML 2E2IH 3S1MH 4IALA 3HOXB 1DOLA 2A69C 3B6YA 3KLRA 3I4NH 2GN5A 1EY6A 4A3KB 2SOBA 2XN9C 1HJPA 4DV0L 3J81c 2D5DA 2TSSA 4HIKA 1YZ6A 4GKJQ 1KABA 2D62A 3EA6A 3CQZB 2XRQD 4IJHA 4OX9L 3S1QB 1HR0L 1CKOA 3OSOA 4P2CB 4A3GG 3GTKH 1B4OA 5ELDA 3BYTB 3S16B 2CQAA 1OXSC 1SAPA 2JK8A 1WCMB 2WAQE 5CV8A 3ER0A 3FKIH 1Y69U 3NWSA 3CMEA 3W1BA 1VQMA 1RODA 2Z8LA 3HS0C 5IT9E 3F2UA 4IUPA 3K59A 1UE7A 3DWQA 2JA6H 2PI2E 1B44D 2ZJPA 4CJ0B 1PH8A 3GTPH 1D5ZC 1E0BA 4XTCS 2JYOA 3S1NB 4BBRH 5IODA 4LF7Q 3T1HL 4MN3A 2A19A 3FHWA 3JC66 2ZXPA 4TQUS 3TN2A 2I5MX 4LFCL 1XMQQ 1EOTA 1STYA 4UP9A 1HNWL 2SNSA 4IJLA 4EQOA 4K8IA 4PMWA 2ASBA 3K5LA 3OOCA 1DYQA 3J80E 1Z9FA 4KY6A 4YY3L 2E2HB 3TRZA 1KD1C 4LF9L 2PCFB 2F0JA 2E76C 5IP9H 3CCSA 3KYHC 1PFBA 1Z7TA 3K80C 3NE5B 4F8MA 3EQLC 3MXUA 2B2VC 2B8FA 5HGTA 1X3EA 4H44C 2R7DA 3H0GH 3E3XA 4C2MB 2PQEA 3PIO3 3H3VH 1VCIA 4N8FA 1RD9D 3PUVA 4DUYL 4DR3L 2RDFA 1Q8IA 1SBBB 2IHFA 1Z6HA 5C3XA 4A3JB 3RLNA 3OW7A 1K83H 3P20A 3STBC 3RZOH 4DF7A 4QB4A 4DR2Q 2PZWA 3MZ5A 1K28A 4DV6Q 1JCKB 1H9KA 3HEJA 3LX0A 3U4ZA 3PIPA 1B50A 3L7ZC 1XTDA 2FXQA 3VYUA 5GAEC 4DUZL 1JJGA 5IGDA 1MI2A 4FVMA 3ZJYC 1KNAA 2WV6D 3ERSX 3BVZA 5A35A 2KBNA 4FXGC 3OHXC 1BKBA 1CA5A 1GM5A 4QJFA 4EQ5A 4KLKA 3QG1A 2UXDQ 3RNUA 4A76A 1LTTD 1UE5A 3HOWH 4LF7L 3KF8A 2IX3A 1YEZA 2A8VA 2XWBB 4BY7G 2KEEA 1NY4A 1V9PA 4XYOA 1YHBA 1D2BA 2WIIB 3KBXA 1PMRA 3BYYB 2AWNA 4IPGA 3OPOA 5CMDA 2G9HD 4A3BB 1ENFA 2L12A 1IKLA 1LT5D 2ENBA 2OT2A 4HJ9A 1VQ9A 2CVRA 1A6XA 2TMPA 1UE1A 3IFDA 4JI4Q 1NMFA 3CKIB 4DV1Q 4PZ6A 3VDYA 3N52A 3HOZH 2EZVA 4DGZA 4LF5L 3I7FA 2Z6KC 3NSWA 2JQOA 4UY8C 2IT1A 1K73C 1R4QB 2EQSA 4KD4A 5L37A 4DNTB 1X3QA 3TQYA 1FVIA 1D1KA 4HEDA 2JEAI 1ENCA 2R7ZH 4KHPL 5DNFA 1O78A 3K5NA 2OWOA 3VA5A 4G4KA 1SE8A 2R93B 1YITA 5IGGA 3J7AV 3PIOA 2PQAB 3GV3A 4R4IA 2B29A 4DV6L 4BA2I 3S2HH 2EJGC 2ZXRA 2K14A 2AQ3B 3A74A 1U4LA 4YHHQ 3W1GA 1FNUA 1YVCA 4P75A 3SK8A 2O5IC 1UEBA 3AEVA 1LT4D 2UXDL 2KCTA 1FGBD 1CHQD 4LF6Q 1DJRD 1HPCA 2ZTCA 1B3AA 2F0MA 4UPAA 4C3JH 1WI5A 2B2YA 3P1HA 4NXML 2A6HD 3DEPA 2UUCQ 3VYRA 2IPKD 5IIFA 1SYDA 1N36Q 1XX8A 2I0QA 1K0RA 2Z6BA 3M4YA 3ULPA 3K58A 1JB7A 2DNCA 1EYAA 1PH4A 1CHPD 5C4HA 4JI4L 1SYGA 4QL5A 1JOOA 3HOYG 3PUYA 1XYIA 2R7FA 2J0TD 3W3AA 5G3LF 5C4JH 5BN4A 1PRTB 1LTRD 1D8LA 1QCBD 2YYZA 1GXDC 1WCMG 1DOKA 3A8JE 1E1TA 3G7LA 3IFTA 1SN8A 1U4PA 2M9VA 2K6AA 2MUYA 3ERQA 1N8RC 1PV4A 2VL6A 3H91A 2F0GA 4KJOA 3T1YQ 3KFUA 1F9QA 4ME3A 3O13A 1LT3D 3GTGH 1IBKL 2YV5A 1B2TA 1JWMD 4CKEA 4RGTA 3EN2A 2RQXA 1E1OA 4A3IG 1GHJA 4PMCA 2NTSA 3HG9A 4JV5Q 2IWHA 2OQKA 2VB3X 1RKNA 1PRTF 3DMUA 4ZQ3A 5IGBA 5IT9c 4LUOA 5C44H 1A0IA 4HSVA 1VQAA 4RGMA 1UE6A 2Y0SE 4DR4Q 1PA6A 1I4XA 2K1BA 2PQAA 4K5XA 5EPKA 5BR8Q 1JJCB 1RDPD 4KKTA 3HKZE 2H5XA 1N9WA 2UUCL 4BXXG 4DAMA 1N36L 4CGYB 3JAMi 2CCZA 4JI3Q 4FF4A 1HXYD 1H9RA 5A2QE 4JI6Q 4A3DH 3D0FA 3VYSA 5CBAE 3MFYA 3J80c 3TS0A 2WB1B 2MPMA 4F88A 3HOXH 3H3VC 4B3SQ 4A3KH 4LWCA 5DEHA 3RLOA 4F87A 3I4LA 5ISRA 3DUZA 3CAMA 1XMOQ 1ESRA 4G7ZC 1S4ZA 1Q86C 1IL2A 3S16H 4A3EB 2KQ3A 1RHPA 3T1YL 1GUSA 2K04A 3M3YB 1L0YB 2Z4HA 2N49A 1BUVT 1PTOC 4OL7A 3K7UC 5J3BA 5KYIA 2K33A 2L11A 2OEOA 4XT1B 4B3RQ 4NPSA 2C35B 5M3MG 4A3CH 4JV5L 4DV5L 4GLXA 4X62Q 1Y1VB 4A3BG 3S1NH 1RCVD 5LL6S 2F52A 2CKZB 5IY0A 3OWFA 4OELB 1T5EA 2QKIC 1E7ZA 5IGEA 4LAAA 5KYLA 1VQLA 1J5EL 1PH6A 3TEHB 2D9UA 1B53A 4ZKBB 3SVMA 4HCSA 1KL9A 4BY1B 1SNCA 2ZJRA 3DEOA 1LTID 4GZYC 4LFBL 2E2HH 1L0WA 4DNRB 1SJHD 2KHSA 2P5ZX 1PFMA 4JI6L 4C3IB 2A5HA 1XNRQ 5GROA 4GLVB 2CH4W 2NUCA 2K5QA 1CZGA 3NEMA 3NQIA 3TSSA 3KBGA 4GLAC 4JK1C 3G71A 2R93G 1TWCB 4BXXH 1I4RA 1IXRA 4IPDA 2ZTDA 2MFIA 3MC0B 4ZUJA 1QWYA 4C2MH 1EUJA 1DGSA 4J15A 1E2ZA 5EPJA 2X6LA 3K5MA 2BA1A 1EWHA 3NBHA 4X66L 5FJ8G 1CTMA 2B3GA 1PRTD 2LXJA 4A3JH 3D4WA 5CV6A 3G4SA 1V1OA 3BS1A 3UDIA 4DFAA 1SROA 4RHRA 4IFDJ 4YCUA 2F3WA 2K5VA 1YNND 1JE5A 1VQCA 2PMZB 2RSOA 2F0LA 1WTOA 3D4RA 1HFNA 3TMEA 4IUVA 3UDXA 3SGIA 5CC4A 5EKKA 5GAGC 5FO7B 3GO5A 5D14A 2VNUD 5K36H 4X62L 2Q2IA 4JBWA 3QJYA 2XNAC 4EX5A 4NXNQ 3NTIA 1D5MC 1W6JA 3PSIA 3PGZA 4UHVA 1BOSA 4MZ9A 3BU2A 4ZCKA 1HUMA 4HN7A 3MEHA 5JEAJ 5I9PA 3EIVA 3CD6A 4NW2A 1TQOA 4IUTA 4ZKCB 1UEAB 1BVSA 1YHAA 3H6MA 2JE6I 1Q1BA 4L63B 4DPGA 2EYOA 1H9SB 5CV5A 5LMUQ 1JR0D 5DAUA 1BDOA 5IYBG 5CV4A 1AZPA 2A74C 4RMFA 1VMPA 4YIJA 2D0PA 1VQ6A 4RA8A 2A1AA 4C1NK 1HFGA 1N34L 2KVMA 1ILPA 1QB5D 1H95A 3LWEA 5LHY1 1OXTA 2K5NA 3PV0A 4FYDA 3A5ZB 2ZTEA 3NBIA 1NMGA 2LFNA 1R9TB 4ULLA 2F0OA 5CR3A 4LUZA 1F9RA 4C3HG 4LF4Q 4FP5D 1I4QA 3S2DB 3PQIA 1KIXA 1EEFD 1EY4A 3CC4A 2K03A 4OWXB 2X69A 3HOUB 1I6VC 2E75C 5FJ8H 5M9OA 4G57A 4LJZC 1HCZA 2AKWB 2QDBA 2ES2A 3PUWA 1MD2D 1D6EC 3ULLA 5J22A 1KXLA 1BBUA 2K01A 5AFWA 4DV0Q 3GQBA 3IL8A 1EY8A 4J8QA 4JI0Q 4A3FB 1PH1A 3T16A 1YJWA 1VQ7A 4OEMB 3MHBA 1HR0Q 4CDFC 2WB1G 1EL0A 4NMZA 2DY8A 2HQEA 2JA7G 4EVOA 5KIXA 2VQFL 4WJ4A 5HY6A 4NP5A 1QNKA 2IJ0A 3L0OA 2I5HA 2IW3A 2NZHA 1K8AC 3BJUA 4GNXA 4AYBB 4DN4M 1PZJD 1BR9A 1DZ1A 4LUVA 2GVBA 1VQJA 1G6ZA 4R1JA 1MJEA 1G291 1CKNB 1FD7D 3T1HQ 3C46A 3P75A 4OGQC 3GTMH 2B63H 3VA7A 2L9HA 1H9SA 2ICIA 4CJ1B 4N8X1 1EQRA 4A3LG 3I3CA 1HHVA 1EU3A 1C7YA 3FPUB 3J81L 4TKOB 3UDGA 5BN5A 2B2WA 1OO9B 4RG1A 1Q12A 4LF4L 4K2LA 4YY3Q 3S15B 4V0BA 4OO1G 3J7ZC 3X3NA 2A6HC 2FINB 1I3QH 3GTOB 5EBDA 5EPLA 4RFBA 5F2DA 5K5PA 4BY1G 3R8BA 3RN5A 4P71A 1PYSB 3NXWA 1TWAB 4R9WA 3W5OA 1RTOA 4Y52H 2I5LX 2Q8IB 1F9SA 2EYMA 5IE8A 1EQTA 3TREA 4DUYQ 1F2LA 4C3IG 5I6YA 4DR3Q 4GOPB 4AQYL 4KHVA 4JI0L 1L1OB 1JC7A 3HOYB 3PIP3 3JAME 1IYJB 2QEXA 1G51A 1CM9A 3L9AX 1X3GA 4U673 3IKJA 2UU9L 2UXCL 1T5XD 1JICA 4DUZQ 1S5ED 3HP3A 1JMCA 4DR6Q 4DV4L 2K7VA 1AFPA 1G2SA 4KI0A 1TS5A 3KJPA 2VUMB 1PYBA 5I2YA 1TWHB 2AQ1B 3E0JA 5HURA 4HR7B 4MNOA 3W2DA 2C5CA 4A3IB 3H09A 2D2CC 3CCUA 1KLUD 3OW2A 1QVFA 2EDGA 4H7BA 4A3EH 2CH4A 2WKDA 3M3YH 1AP0A 3ND9A 2NWGA 2JSOA 3DWAA 2EY5A 2VQEQ 2KCCA 1K0SA 1CZWA 4JC0A 1A3VA 4O2DA 3TZDA 4DU9A 1ET6A 2RBMA 1BXTA 3F2CA 4CBVA 4ZUIA 4LF5Q 1Y1VH 1QE6A 3C2PA 5IYDH 1VDZA 2QDLA 4R4QA 2PW7A 3GTLB 1IW7C 1BCPB 3CC2A 5JJLA 3DM1A 1F2ZA 3IAYA 2NB0A 1GJXA 1QNUA 1KLGD 1YIJA 1MGSA 4KHPQ 2BCOA 1IBML 2F4IA 2R92B 2WFWA 4IUQA 1G8ZD 1NE3A 3D8GA 2M2LA 1JE4A 5TSSA 4BY1H 3KF6B 3OYYA 5JVH3 4HAEA 1NNXA 1WTHA 1BBWA 5KEEA 3D4DA 5KRUA 3DWPA 4JYAQ 1XTCD 1VQBA 1UNSA 3SK4A 3Q8DA 1MIUA 2G5DA 4F7XA 1KDAA 2AMCB 2F0EA 4GOPA 2KECA 1TWCH 3BZDB 4A3GH 4DR6L 3NUCA 3TP6A 1HA5A 2GVAA 4QIWB 1BCPF 1EIYB 3A7AB 1XPUA 2BOSA 1LABA 1S40A 3I4MB 3HOUG 1LT6D 4L5TA 1VQHA 1X3PA 4IFDG 2Q8TA 1PVOA 4NXMQ 3MA2B 4ME5A 5M3MB 1QZHA 4LFAQ 4IPCA 2A68C 1J6QA 1ONLA 2D0OA 1TXYA 3EBEA 1I94L 2EYHA 3TP7A 2RKSA 2AQ2B 3UI2A 2VQEL 4A3FG 3NELA 4R8IA 3K0XA 1YJ9A 4QGUA 4G7OC 4XT3B 1VMCA 3TS2A 3AFQA 4RGOS 2HHHQ 2BE5C 3A0JA 2E8GA 3CRKC 4FF2A 1W6KA 1GD7A 1JB3A 5J1ZA 2YTVA 5JEAG 1S5BD 1D1IA 2RVLA 3CCMA 4B08A 1HQMC 1W3SA 2K4KA 4AYBG 3QB3A 1A3UA 1Y8PB 3SK6A 2EY2A 4DR1L 1MBYA 4YCWA 3S14B 4V190 1OXVA 1IBKQ 4DNIA 2Z0SA 4JYAL 4GN5A 1EY5A 3CRLC 4TSSA 3A8KE 1VQ4A 1KRTA 1GKHA 2Q8RE 5IP7G 4RKBA 5C5MA 1YNNC 5FLXE 1CKMA 1Y14B 1IBLL 1F2YA 3NTHA 4H13C 3KF6A 1VQNA 3T53B 2RA4A 3K7AH 5CV9A 3E5SA 2J4XA 1PZKD 3U58A 1FJGQ 1X65A 4YWLA 1TIID 4QUCA 4ZAIA 4GN4B 4B9WA 4LFAL 3J7AF 1SDFA 5E4WC 1H9JA 2RCFA 1P8LA 5IGFA 2HT1A 1NJIC 4BY7H 2Z4IA 1ZYRD 5CYUA 3QIAA 5JOBA 3BZCA 4DK1A 1HTPA 2NVXB 1HZAA 1B70B 2XWJB 1YNJD 2OCEA 3I73A 3HOVB 2EXZA 2FMMA 1WTQA 2HHHL 1K3BC 2GA4B 2JA9A 4JOIC 1XXGA 5M5XB 4NDXA 4O1NA 4POGA 2BH8A 5D65A 4JPBW 4A3FH 1CA6A 4GN3B 1RTNA 1O7IA 3PO3G 4RWSC 4OO1I 5IT9L 2F0PA 4M8AA 3M4OB 5CORA 2EE1A 2AUJD 2OXPA 2A69D 1B9NA 5IGCA 1BCPD 4X65L 4GKKQ 1NUCA 2VUMG 4WJWA 3JAMc 3RMHA 1VQIA 2RHQB 3R2TA 2MJ8A 5C3EG 5JEAH 1GO3E 2PNRC 3A5UA 4KKSA 5IYCG 3SDZA 4MTNA 1GUOA 4DV5Q 5T1GA 2E74C 3SK5A 1PH2A 2ZXOA 4C3HB 4HJ5A 1Q7YC 1YBYA 3J80L
chains in the Genus database with same CATH topology
1A3TA 1UUPA 2F0SA 5EKIA 1LTSD 4K2KA 3K5OA 1K8OA 1X32A 1KDCA 1LACA 4HMIA 2E2IB 1C4QA 3S1MB 1J8IA 3T13A 3I70A 3S17B 1STAA 3NTKA 4XIGS 1HRJA 1B1ZA 2NVTB 3BDCA 3EJIA 1WD1A 2FHTA 2F0QA 2LY7A 1JQYD 1J9OA 2JA7B 1O7YA 2O5JC 5I2XA 2ICEC 3GTKB 3TDQA 4EQNA 1ICWA 5EQ0A 1A2UA 2F0WA 4IN3A 5BN3A 3FRPB 2O2LD 5I6WA 3EROA 1SXTA 1TY0A 5T1IA 2EYJA 5EBCA 2R3ZA 2XSCA 3DXJC 4KHZA 1DOMA 1CK1A 2FJ2A 1V1PB 1LTAD 4C1NI 5JAVA 1SNDA 2L4NA 1SFOB 3A55A 4KTAA 5DM63 1NAPA 1A15A 4XYQA 3SEBA 2CW0D 1I4HA 1RF2D 2EY6A 2EY1A 3QO2A 2L1BA 4N9PA 4X3SA 3QOLA 5G3LD 4M1UB 3ONAB 4MHEA 2XIWA 2NBFA 2K5WA 2WP8J 2Y0SB 1EQVA 4FXKC 3E6ZX 2HCIA 3TBIB 4RKLA 3NHHA 4MIUA 1V8QA 3H0GB 1VF5C 4NKLA 2JA5B 3P7JA 5I4DA 1ET9A 3MTSA 4IFDI 1STBA 5ELCA 1SNOA 4XXEA 4RAUC 1QOHA 1SE4A 2N55A 1LLRD 3A56A 1IKMA 1EY0A 3D3RA 1Z47A 1K83B 4Y7NB 2NYZD 4IUNA 3S9WA 2RDGA 5JJZA 3X3MA 4K6DA 5IOCA 1WTXA 1PTOB 1JOQA 2G9DA 1R4PB 4HTHA 2B2WC 4BA1I 2C9OA 3T4AC 2NN6G 1EYDA 3I8ZA 3HOWB 3VYTA 2HCCA 2ID0A 3MXGA 2B2TA 2PW5A 2HUGA 2KJXA 1TT2A 1Q3LA 3MAQA 3G6JB 2F0IA 1WTRA 4WRDA 2V4DA 1ZKOA 2NTTA 1V1PA 3Q6SA 1EIGA 1PTOF 3DHQA 1PFNA 1DONA 4U68A 1GOZA 1TS4A 1O80A 4HCEA 2CHBD 2HDLA 1WVLA 1PYWD 1PZID 4WORA 1K8MA 1FYCA 1EZ8A 1RJTA 2EPBA 4A93B 2YU9B 2E2DC 2EYPA 5LL6X 2R61A 2EJFC 1G91A 1OXXK 2LS01 5CV7A 4UDUC 4R8NA 1BNZA 1WTPA 4PMBA 1S5FD 3J7YW 1GUGA 3MXNA 3KUPA 3ITPA 2B8GA 2E2JB 4WFN3 1UAPA 3N6RA 1A2TA 1DCZA 3H94A 2DN8A 3TP5A 5A2QL 1CQVA 1SMYD 3BVMA 2NVYB 3M7GA 3PUXA 3OIQA 4PQXA 2F0NA 2F0UA 4QF4A 3KLSA 2LMCB 1V43A 5C3WA 1EIHA 1I4GA 3I91A 2SNMA 1EFID 4K5VA 2Z1CA 3BVGA 4RHSA 5FK9C 3AU7A 1ZXTA 2KA7A 4A3MB 1LO5D 4ZLTF 2F1MA 2BDOA 1SYBA 3Q22A 1PTOD 1TVXA 1EWCA 4KY7A 4IURA 1I4PA 1ZYRC 4CHTB 1TY2A 4QMGA 1M8AA 1E2VA 1YNJC 4EQPA 4A3DB 2L0CA 4ZYSA 1KAAA 2KUMA 1HUNA 5KGUA 2B2UA 1DM0B 3VR2A 3PO3B 1FR3A 1BCPC 2WACA 2NVQB 1KNEA 3WOFA 4K5WA 3RZDB 1SYCA 2XRSD 2FMCA 1WTWA 5C0XJ 3OMGA 5C3EB 5E4XA 1WD0A 4FXDA 4XQQA 3GD7A 4KJNA 2EJMA 3Q23A 1STNA 2B2YC 4B9XA 3OWEB 4DXGA 4X3TA 3T51B 1IYVA 1STHA 2L5TA 1IL8A 1I50B 1MSGA 3VR3A 2BDNA 1IYUA 3GTQB 2KCNA 1SNPA 3GP7A 5COYA 3QWNA 3TZUA 1Q90A 1IHZA 2AUKA 4OO1H 1SE2A 1ML0D 1F9PA 2NN6I 2BA0A 2F3VA 4H0LC 2IX0A 2A6ED 4L6TB 1DD2A 1JWUD 4DAPA 5C5LA 4CKBA 5KNCA 1TKWB 2WAQB 3FMCA 4I65A 2H4OA 3K57A 5ELFA 4RGNA 3PMFA 3PO2B 1XWEA 2WKCA 1F77A 4FO2A 1I6HB 1PLFA 3R3OA 4C3JG 1PTOH 1TWFB 2CW0C 3MVVA 3CU7A 1NSNS 3KLSX 4DAVA 3Q0AA 2SDFA 5CBEE 4KN4C 3TP8A 2DNEA 1TWGB 4Q5VA 1EU4A 4BBSB 2MGSA 3MWYW 1TR5A 2K32A 1JWSD 2JA8B 4KKUA 2L55A 2QF7A 5M3FB 3FEWX 1QILA 1TS2A 5E3FA 3V2TA 3RUZA 4OHJA 5C4XB 4LMQD 3Q24A 1PRTC 1STGA 4ILWA 1Y1WB 4BWGB 1BQQT 2VB2X 3A7LA 2I46A 5ELBA 3D6WA 3GTJB 5EJWA 1AW7A 3AB9A 2F0FA 2LKVA 5FO8B 1FNWA 2K05A 5E1FA 2I07B 4KMUC 5M5WB 1KTKA 1AN8A 5EKLA 3V96A 5FO9B 2F0DA 1JORA 3R93A 4IUUA 4IQZA 2A73B 1M4VA 1BF4A 4DA2A 1EY7A 4IFDH 5M5YB 3JAML 4XDXA 1G2TA 1HQRD 3S1RB 2IX1A 3D31A 1FNVA 3T56B 3R2IA 3LWUA 1Y8OB 4ID6A 2EYFA 2F0HA 1QG7A 3M85A 1LV9A 1Y8NB 2B2VA 2K5DA 3RD4A 1ESFA 5KNBA 4HMJA 1TU2B 5DM73 3GTMB 4TRDA 2B63B 2SEBD 4X3UA 1BO0A 1C48A 2B2TC 2F0VA 1SYEA 3C1EA 5D3DA 4Z9CB 3NK9A 1NR4A 3HZXA 3ND8A 2KEDA 4RCOA 2VXWA 5JPMC 3BG3A 1F2MA 1LTBD 4KK7A 1I3QB 4ABNA 1SMYC 4KV6A 3A8IE 4K14A 2EVBA 3I4NB 1SJED 4I7ZC 3V05A 1LTGD 3CHBD 2O4XA 3NWTA 1D5XC 3BDLA 2JP1A 1HTLD 5NUCA 4FF3A 5I9OA 3MXPA 1IW7D 3FKIB 2M00A 3VR4A 2F03A 1CFMA 1QJOA 1HA6A 3PUZA 1L0XB 2JA6B 4EGVA 1CI3M 2J7ZA 3EVQA 3GTPB 2B39A 4BBRB 3HGBA 2X6GA 1H9MA 1S5CD 5C0XG 1U9RA 2F0TA 3I72A 4KN7C 3A54A 2RSNA 2PZTA 5K36G 3ZYYX 3FDTA 3LNNA 2QEJC 1DXMA 3C3LA 2WINB 5D3IB 4ZK9B 1U4RA 2N88A 1NR2A 1S5DD 2EYLA 2HDMA 3J81E 4OIJA 4FF1A 2A68D 3HKZB 4ZRZA 3K6OA 1STEA 3VR5A 4PNYA 1NCVA 1VF7A 5CGKA 1ENAA 1AZQA 1E2WA 3RZOB 4Q0FA 4KY5A 4DXFA 2BE5D 2AWOA 4S3SA 3K0YA 4ODGA 3L3OC 5FLXL 1SYFA 4RCNA 4A3GB 3SXHA 4IZ8A 4PV1C 4G7HC 2JXMB 3C1FA 3U9OA 4XQJA 4QCLA 4E6IA 3URYA 2FFKB 2H1EA 1EZ6A 3AMUA 3I90A 2F0KA 1ILQA 2QCPX 5C0XH 2MP1A 3GV6A 4LK1C 2NZ1D 1O7LA 3HOZB 3WDNA 4FNFA 5J39A 5EGTA 2B2UC 5KNDA 1SSOA 4DK0A 1WTVA 2EOTA 2R7ZB 3SHLA 2A6EC 3MFGA 1B9MA 4XQNA 4BS9A 1MSHA 4CKCA 3EFXD 4DAYA 4K6LA 3S2HB 1AEXA 1Q1EA 3VR6A 1SEBD 1C8CA 3HRZC 3K7AB 4QUFA 3M7NA 2PZUA 4X3KA 4C3JB 1SNQA 4L8JA 2QILA 1PDQA 1SE3A 2JEBI 1SNMA 2NN6H 5JPNC 4O42A 1O7ZA 1EY9A 2PPBC 4BY7B 1CQFA 3OMCA 4K8JA 1OXUA 5C4ZA 5C6AA 2PYKA 5FKAC 5C4JB 5JVG3 4RH6A 2R6GA 3D6CA 5ELEA 1TS3A 1GUWA 3WOEA 1ZEQX 1GHKA 3NPPA 3BDOA 3NQTA 4HSPA 4J1MA 4N9TA 2PO4A 1CT1D 2XVSA 1PXUA 3FPPA 3GTGB 4KD3A 4C56C 5FOBB 1II3A 2IL8A 5C44B 3NP8A 1EYCA 4OIKA 1BBXC 3KK7A 3QOJA 1GUNA 3RLFA 1EEID 4UAIA 1U4MA 3SR1A 2DY7A 4J6HA 1KDBA 2MHVA 3U9SA 2RDHA 2ZT9C 3OIPA 4CJ2C 3FVQA 2OF1A 3SE0A 1GUTA 1JOKA 2K28A 5C0XI 2KOLA 4IALA 3HOXB 1DOLA 2A69C 3KLRA 1EY6A 4A3KB 2SOBA 2XN9C 2D5DA 2TSSA 1KABA 2D62A 3EA6A 3CQZB 2XRQD 3S1QB 3OSOA 4P2CB 1B4OA 5ELDA 3BYTB 3S16B 2CQAA 1OXSC 1SAPA 1WCMB 5CV8A 1Y69U 3NWSA 1RODA 2Z8LA 3HS0C 5IT9E 3F2UA 4IUPA 3K59A 3DWQA 1B44D 4CJ0B 1D5ZC 1E0BA 4XTCS 2JYOA 3S1NB 5IODA 4MN3A 2ZXPA 4TQUS 3TN2A 1EOTA 1STYA 2SNSA 4EQOA 4K8IA 4PMWA 3K5LA 3OOCA 1DYQA 3J80E 4KY6A 2E2HB 2PCFB 2F0JA 2E76C 1PFBA 1Z7TA 3NE5B 4F8MA 3EQLC 3MXUA 2B2VC 2B8FA 5HGTA 4H44C 4C2MB 2PQEA 3PIO3 1VCIA 1RD9D 3PUVA 2RDFA 1Q8IA 1SBBB 1Z6HA 5C3XA 4A3JB 3OW7A 3P20A 4DF7A 4QB4A 2PZWA 3MZ5A 1JCKB 1H9KA 3HEJA 3LX0A 1B50A 3L7ZC 3VYUA 5IGDA 1MI2A 4FVMA 1KNAA 2WV6D 3BVZA 5A35A 4FXGC 3OHXC 1CA5A 3QG1A 1LTTD 3KF8A 2IX3A 2XWBB 2KEEA 4XYOA 1D2BA 2WIIB 3KBXA 1PMRA 3BYYB 2AWNA 3OPOA 5CMDA 2G9HD 4A3BB 1ENFA 2L12A 1IKLA 1LT5D 2ENBA 2OT2A 2CVRA 1A6XA 2TMPA 3IFDA 3CKIB 3N52A 2EZVA 4DGZA 3NSWA 2IT1A 1R4QB 4KD4A 4DNTB 1X3QA 1D1KA 4HEDA 2JEAI 1ENCA 5DNFA 1O78A 3K5NA 3VA5A 4G4KA 2R93B 5IGGA 3J7AV 3GV3A 4BA2I 2EJGC 2ZXRA 2AQ3B 1U4LA 1FNUA 3SK8A 2O5IC 1LT4D 1FGBD 1CHQD 1DJRD 1HPCA 1B3AA 2F0MA 2B2YA 3P1HA 2A6HD 3DEPA 3VYRA 2IPKD 5IIFA 1SYDA 1XX8A 3M4YA 3K58A 2DNCA 1EYAA 1CHPD 5C4HA 1SYGA 1JOOA 3PUYA 1XYIA 2J0TD 3W3AA 5G3LF 5BN4A 1PRTB 1LTRD 1QCBD 2YYZA 1GXDC 1DOKA 3A8JE 3G7LA 3IFTA 1U4PA 2M9VA 2K6AA 2MUYA 3ERQA 3H91A 2F0GA 4KJOA 1F9QA 3O13A 1LT3D 1B2TA 1JWMD 4CKEA 4RGTA 2RQXA 1GHJA 4PMCA 2NTSA 3HG9A 2IWHA 2VB3X 1RKNA 1PRTF 3DMUA 4ZQ3A 5IGBA 4HSVA 4RGMA 1I4XA 2K1BA 4K5XA 5EPKA 1RDPD 4KKTA 4CGYB 4FF4A 1HXYD 1H9RA 5A2QE 3VYSA 5CBAE 3MFYA 2WB1B 2MPMA 4F88A 3H3VC 5DEHA 4F87A 3I4LA 5ISRA 3DUZA 1ESRA 4G7ZC 1S4ZA 4A3EB 2KQ3A 1RHPA 1GUSA 2K04A 3M3YB 1L0YB 2Z4HA 1BUVT 1PTOC 4OL7A 5KYIA 2K33A 2L11A 2OEOA 4XT1B 1Y1VB 1RCVD 5LL6S 3OWFA 1T5EA 2QKIC 5IGEA 4LAAA 5KYLA 2D9UA 1B53A 4ZKBB 3SVMA 4HCSA 4BY1B 1SNCA 3DEOA 1LTID 4GZYC 4DNRB 1SJHD 2KHSA 1PFMA 4C3IB 2A5HA 2NUCA 2K5QA 1CZGA 3NQIA 3TSSA 3KBGA 4JK1C 1TWCB 1I4RA 3MC0B 4ZUJA 1QWYA 1E2ZA 5EPJA 2X6LA 3K5MA 2BA1A 1EWHA 3NBHA 1CTMA 1PRTD 3D4WA 5CV6A 1V1OA 3BS1A 4DFAA 4IFDJ 4RHRA 2F3WA 1YNND 2PMZB 2RSOA 2F0LA 1WTOA 3D4RA 1HFNA 3TMEA 4IUVA 5CC4A 5EKKA 5FO7B 3GO5A 5D14A 2VNUD 5K36H 4JBWA 3QJYA 2XNAC 3NTIA 1D5MC 1W6JA 1BOSA 1HUMA 4HN7A 3MEHA 5JEAJ 5I9PA 4NW2A 1TQOA 4IUTA 4ZKCB 1UEAB 3H6MA 2JE6I 1Q1BA 4L63B 2EYOA 1H9SB 5CV5A 1JR0D 5DAUA 1BDOA 5CV4A 1AZPA 2A74C 1VMPA 4YIJA 4RA8A 4C1NK 1HFGA 2KVMA 1ILPA 1QB5D 3LWEA 5LHY1 1OXTA 3PV0A 4FYDA 3NBIA 2LFNA 1R9TB 4ULLA 2F0OA 5CR3A 1F9RA 4C3HG 4FP5D 1I4QA 3S2DB 1EEFD 1EY4A 2K03A 2X69A 3HOUB 1I6VC 2E75C 5M9OA 4G57A 4LJZC 1HCZA 2QDBA 3PUWA 1MD2D 1D6EC 5J22A 2K01A 5AFWA 3GQBA 3IL8A 1EY8A 4J8QA 4A3FB 3T16A 3MHBA 1EL0A 4NMZA 2DY8A 2HQEA 4EVOA 5KIXA 4NP5A 1QNKA 2IJ0A 2IW3A 4AYBB 4DN4M 1PZJD 1BR9A 1DZ1A 1G6ZA 1G291 1FD7D 3C46A 3P75A 4OGQC 3VA7A 2L9HA 1H9SA 2ICIA 4CJ1B 3I3CA 1HHVA 1EU3A 3FPUB 3J81L 4TKOB 5BN5A 2B2WA 1OO9B 1Q12A 4K2LA 3S15B 4V0BA 4OO1G 3X3NA 2A6HC 2FINB 3GTOB 5EBDA 5EPLA 4RFBA 5F2DA 5K5PA 3R8BA 4R9WA 3NXWA 1TWAB 1RTOA 2Q8IB 1F9SA 2EYMA 1EQTA 1F2LA 4C3IG 5I6YA 4KHVA 1JC7A 3HOYB 3PIP3 3JAME 1CM9A 3L9AX 4U673 3IKJA 1T5XD 1JICA 1S5ED 3HP3A 2K7VA 1AFPA 1G2SA 4KI0A 1TS5A 2VUMB 5I2YA 1TWHB 2AQ1B 3E0JA 5HURA 4HR7B 3W2DA 2C5CA 4A3IB 3H09A 2D2CC 1KLUD 2EDGA 4H7BA 2WKDA 1AP0A 3ND9A 2NWGA 2JSOA 3DWAA 2EY5A 2KCCA 1CZWA 1A3VA 3TZDA 4DU9A 1ET6A 2RBMA 1BXTA 4CBVA 4ZUIA 1QE6A 3C2PA 1VDZA 2PW7A 3GTLB 1IW7C 1BCPB 3DM1A 1F2ZA 3IAYA 2NB0A 1GJXA 1QNUA 1KLGD 1MGSA 2BCOA 2F4IA 2R92B 4IUQA 1G8ZD 3D8GA 2M2LA 1JE4A 5TSSA 5JVH3 4HAEA 5KEEA 3D4DA 5KRUA 3DWPA 1XTCD 1UNSA 3SK4A 4F7XA 1KDAA 2F0EA 2KECA 3BZDB 3NUCA 3TP6A 1HA5A 4QIWB 1BCPF 3A7AB 2BOSA 1LABA 3I4MB 1LT6D 1X3PA 4IFDG 2Q8TA 3MA2B 4ME5A 5M3MB 2A68C 1ONLA 2EYHA 3TP7A 2RKSA 2AQ2B 3UI2A 4R8IA 4G7OC 4XT3B 1VMCA 4RGOS 2BE5C 3CRKC 4FF2A 1W6KA 1JB3A 5J1ZA 5JEAG 1S5BD 1D1IA 2RVLA 4B08A 1HQMC 3QB3A 1A3UA 1Y8PB 3SK6A 2EY2A 1MBYA 3S14B 4V190 1OXVA 1EY5A 3CRLC 4TSSA 3A8KE 2Q8RE 4RKBA 5C5MA 1YNNC 5FLXE 1F2YA 3NTHA 4H13C 3T53B 2RA4A 5CV9A 3E5SA 2J4XA 1PZKD 1TIID 4QUCA 4ZAIA 4B9WA 3J7AF 1SDFA 5E4WC 1H9JA 5IGFA 2Z4IA 1ZYRD 5CYUA 3QIAA 5JOBA 4DK1A 1HTPA 2NVXB 2XWJB 1YNJD 3I73A 3HOVB 2EXZA 2FMMA 1WTQA 2GA4B 1XXGA 5M5XB 4NDXA 4O1NA 5D65A 1CA6A 1RTNA 4RWSC 4OO1I 5IT9L 2F0PA 4M8AA 3M4OB 5CORA 2EE1A 2AUJD 2OXPA 2A69D 1B9NA 5IGCA 1BCPD 1NUCA 4WJWA 3RMHA 3R2TA 2MJ8A 5JEAH 2PNRC 4KKSA 3SDZA 1GUOA 5T1GA 2E74C 3SK5A 2ZXOA 4C3HB 3J80L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUV A;  1HQM C;  1FR3 A;  3M85 A;  2B8G A;  1Y8N B;  3ND9 A;  3U9S A;  4KN4 C;  3N6R A;  1HPC A;  1Y8P B;  2ZT9 C;  2DNE A;  1Z6H A;  5K36 H;  5KNB A;  1DCZ A;  1K8O A;  2KCC A;  3OW7 A;  3P20 A;  4JBW A;  3H94 A;  2DN8 A;  1TU2 B;  1OXV A;  3QJY A;  3I4L A;  2A6H D;  1LAC A;  3CRL C;  1H9K A;  4G7Z C;  3SE0 A;  1GUT A;  2A68 D;  3A8K E;  3L7Z C;  1G29 1;  1VDZ A;  1Q1E A;  3VR6 A;  3M4Y A;  3PUX A;  3VR5 A;  1IW7 C;  2K32 A;  4OGQ C;  1GUS A;  2DNC A;  1YNN C;  3VA7 A;  4KKU A;  4XIG S;  3GD7 A;  2QF7 A;  1VF7 A;  4BA1 I;  2EJM A;  1H9S A;  5A35 A;  1GJX A;  2A69 C;  4H13 C;  3M7N A;  2NN6 G;  3KLR A;  2LMC B;  3PUY A;  3T53 B;  3W3A A;  1E2W A;  2D5D A;  4L8J A;  3QG1 A;  3ND8 A;  2K33 A;  2JE6 I;  1Q1B A;  4TKO B;  3T51 B;  5BN4 A;  1V43 A;  2O5J C;  2L5T A;  2D62 A;  5BN5 A;  1IYV A;  1H9S B;  3VR3 A;  3BG3 A;  2YYZ A;  1Q12 A;  1IYU A;  2BE5 D;  2AWO A;  2JEB I;  1BDO A;  3A8J E;  4OO1 G;  2NN6 H;  2A6H C;  1OXS C;  3IFT A;  5BN3 A;  1PMR A;  3TZU A;  1SMY C;  4RCN A;  1H9J A;  3OPO A;  2PPB C;  1Q90 A;  2V4D A;  3A7L A;  1Y69 U;  1ZKO A;  1T5E A;  3A8I E;  4PV1 C;  2EVB A;  4G7H C;  1OXU A;  1A6X A;  2JXM B;  3AB9 A;  2AUK A;  4I7Z C;  4OO1 H;  3QIA A;  3DXJ C;  2R6G A;  4DK1 A;  1OXT A;  3PV0 A;  1HTP A;  4KHZ A;  2Q8I B;  3A7A B;  2NN6 I;  4KMU C;  2BA0 A;  3I73 A;  4GZY C;  1LAB A;  2KA7 A;  4XTC S;  1GHJ A;  4DNR B;  1GHK A;  2IT1 A;  4H0L C;  4IFD G;  2F1M A;  2BDO A;  1IW7 D;  2A6E D;  4TQU S;  3BDO A;  4DNT B;  3VR4 A;  1DD2 A;  4JK1 C;  2JEA I;  2A68 C;  1I6V C;  2AUJ D;  2E75 C;  1K8M A;  1FYC A;  1O78 A;  1ONL A;  2A69 D;  3IKJ A;  4IQZ A;  1CFM A;  4LJZ C;  1QJO A;  1HCZ A;  3PUZ A;  1B9N A;  5C0X H;  3PUW A;  5KNC A;  1TKW B;  3FPP A;  1CI3 M;  4IFD H;  4LK1 C;  3OOC A;  1ZYR C;  1O7L A;  1E2Z A;  4KKT A;  3FMC A;  2K7V A;  3WDN A;  2BA1 A;  1EWH A;  1E2V A;  4G7O C;  4KI0 A;  3GQB A;  1YNJ C;  3HGB A;  5JEA H;  1CTM A;  2EJF C;  2PNR C;  5KND A;  2PCF B;  4BA2 I;  4KKS A;  1OXX K;  2E76 C;  1H9M A;  4DK0 A;  5C0X G;  3SDZ A;  1Z7T A;  2EJG C;  3D31 A;  3NE5 B;  4HR7 B;  2BE5 C;  3CRK C;  1GUO A;  1V8Q A;  3I72 A;  4KN7 C;  1VF5 C;  3EQL C;  3MXU A;  3T56 B;  1H9R A;  2E74 C;  2B8F A;  2A6E C;  3LWU A;  5K36 G;  2D2C C;  4H44 C;  3D4R A;  1GUN A;  2CW0 C;  2EDG A;  3LNN A;  3MFY A;  3RLF A;  1GUG A;  1Y8O B;  5JEA G;  1DXM A;  2O5I C;  1B9M A;  3VR2 A;  1VCI A; 
#chains in the Genus database with same CATH topology
 1A3T A;  3HFZ B;  1UUP A;  2F0S A;  5EKI A;  1J5E Q;  1A62 A;  4JBM A;  2N78 A;  1FJG L;  4P73 A;  3CCJ A;  1LTS D;  4K2K A;  2KEN A;  3K5O A;  1K8O A;  1X32 A;  1NTG A;  1KDC A;  1LAC A;  4HMI A;  4LFB Q;  3I2Z A;  2E2I B;  1C4Q A;  3S1M B;  1J8I A;  3T13 A;  3I70 A;  3S17 B;  1STA A;  3NTK A;  1U5K A;  4XIG S;  2R92 G;  1HRJ A;  1B1Z A;  2NVT B;  3BDC A;  3EJI A;  1WD1 A;  3GTO H;  2FHT A;  2F0Q A;  3IRB A;  2LY7 A;  4H02 A;  1JQY D;  1J9O A;  2JA7 B;  2DUD A;  1TWA H;  1O7Y A;  4DK3 C;  2O5J C;  5I2X A;  2ICE C;  3GTK B;  3UE0 A;  3TDQ A;  1VQ8 A;  4EQN A;  1ICW A;  5EQ0 A;  3HOY H;  3CQZ H;  4X66 Q;  3S1Q H;  1A2U A;  2F0W A;  4IN3 A;  5BN3 A;  3FRP B;  1MHW C;  2O2L D;  4GKK L;  5I6W A;  3ERO A;  1SXT A;  1TY0 A;  1WCM H;  5T1I A;  2EYJ A;  5EBC A;  2R3Z A;  2XSC A;  4K0K Q;  3DXJ C;  4I7A A;  3AYH B;  1WFQ A;  2UXB Q;  4KHZ A;  1DOM A;  1CK1 A;  2FJ2 A;  3STB D;  3I4M G;  1V1P B;  1LTA D;  4C1N I;  3PO2 G;  5JAV A;  2PMZ E;  1SND A;  1P16 A;  2L4N A;  1TWH H;  5FLM G;  1SFO B;  3A55 A;  4KTA A;  5DM6 3;  1NAP A;  1A15 A;  4XYQ A;  3SEB A;  2CW0 D;  1I4H A;  1RF2 D;  2EY6 A;  2EY1 A;  3QO2 A;  2L1B A;  4N9P A;  4X3S A;  3QOL A;  4A3I H;  1XJV A;  5G3L D;  4M1U B;  3ONA B;  5LMN W;  4MHE A;  2XIW A;  2F4V L;  2NBF A;  4BBS G;  2K5W A;  2WP8 J;  2Y0S B;  2IY5 B;  1EQV A;  4FXK C;  3E6Z X;  3PF4 A;  2HCI A;  3TBI B;  3RN2 A;  3KDF B;  4RKL A;  3NHH A;  4MIU A;  1V8Q A;  3H0G B;  1VF5 C;  5M3F G;  4NKL A;  2JA5 B;  3P7J A;  5I4D A;  1ET9 A;  1IZ6 A;  3MTS A;  4R4C A;  4IFD I;  1VQK A;  2HQL A;  1HZB A;  1STB A;  5ELC A;  3GTL H;  1SNO A;  4XXE A;  1QOH A;  4RAU C;  1SE4 A;  2N55 A;  4GNX C;  1LLR D;  3A56 A;  1IKM A;  1EY0 A;  3D3R A;  1Z47 A;  5C4X G;  1K83 B;  1N34 Q;  4Y7N B;  3MXN B;  1SR3 A;  4PG3 A;  2HD3 A;  2NYZ D;  3KJO A;  1Y1W G;  4IUN A;  3S9W A;  2RDG A;  5JJZ A;  4R4T A;  1VQG A;  3X3M A;  4K6D A;  5IOC A;  1WTX A;  1PTO B;  1JOQ A;  1VS0 A;  2Q2U A;  1A8V A;  2G9D A;  3E9I A;  1LUZ A;  1R4P B;  4K0K L;  4HTH A;  2B2W C;  4BA1 I;  2UXB L;  2C9O A;  3T4A C;  2NN6 G;  3F2D A;  3I56 A;  1EYD A;  3I8Z A;  3HOW B;  1V1Q A;  3VYT A;  2HCC A;  2ID0 A;  3MXG A;  3F8T A;  2B2T A;  2PW5 A;  2HUG A;  1C9O A;  1X55 A;  2HIV A;  2KJX A;  1TT2 A;  1Q3L A;  3MAQ A;  3G6J B;  5FLX c;  2F0I A;  1WTR A;  3CPF A;  1JT8 A;  1B7Y B;  4WRD A;  2V4D A;  3PCO B;  1T9H A;  2CQO A;  1ZKO A;  2NTT A;  5M3M H;  1V1P A;  3Q6S A;  1EIG A;  3G48 A;  4A3B H;  3HOV G;  1MJC A;  1PTO F;  3DHQ A;  1PFN A;  1DON A;  1KRS A;  2YTY A;  4U68 A;  1GOZ A;  1TS4 A;  1O80 A;  1YI2 A;  2VQF Q;  1EWI A;  1PFS A;  1XPR A;  4HCE A;  2CHB D;  2HDL A;  2VZA A;  1WVL A;  1PYW D;  3DLL A;  1PZI D;  4WOR A;  5JJI A;  1K8M A;  1FYC A;  1EZ8 A;  1RJT A;  4JI8 Q;  5IWA L;  2EPB A;  4A93 B;  2YU9 B;  4NB3 A;  2E2D C;  3KDF A;  2EYP A;  5LL6 X;  4HJA A;  2R93 H;  2R61 A;  5ELN A;  2EJF C;  1WOC A;  1G91 A;  2RHS B;  1OXX K;  2Q2T A;  3S14 H;  2LS0 1;  2JN4 A;  5CV7 A;  4UDU C;  1EFW A;  4R8N A;  1BNZ A;  1WTP A;  4PMB A;  1S5F D;  3J7Y W;  1GUG A;  3MXN A;  4DV7 Q;  3KUP A;  2UUB Q;  3ITP A;  3K8A A;  2KHI A;  2B8G A;  2E2J B;  2K50 A;  4WFN 3;  1UAP A;  3N6R A;  1A2T A;  3AFP A;  1DCZ A;  3H94 A;  2DN8 A;  3TP5 A;  5A2Q L;  4AQY Q;  2K5H A;  1CQV A;  1SMY D;  4YWM A;  3BVM A;  2NVY B;  2Z9H A;  3M7G A;  3PUX A;  1N33 Q;  4JVZ A;  3OIQ A;  4OWT B;  2OTL A;  4PQX A;  2F0N A;  2F0U A;  4QF4 A;  2UUA L;  3KLS A;  1E22 A;  2LMC B;  2UU9 Q;  2UXC Q;  1V43 A;  3FKI G;  2NVX H;  4DV4 Q;  5C3W A;  1EIH A;  4HJ7 A;  3H15 A;  1I4G A;  4OXP A;  2JA6 G;  4IO9 A;  3I91 A;  4JI8 L;  4LF8 L;  2SNM A;  3M4O H;  4BBR G;  1X3F A;  1EFI D;  4AIM A;  4K5V A;  2Z1C A;  5IYB H;  3BVG A;  4RHS A;  5FK9 C;  3AU7 A;  5LMN Q;  1XNQ Q;  3U4V A;  1X9N A;  1ZXT A;  2KA7 A;  4A3M B;  1LO5 D;  4ZLT F;  4DR7 Q;  2F1M A;  2BDO A;  4DKA C;  1SYB A;  2LSS A;  1PH7 A;  4HIM A;  3Q22 A;  4LW1 A;  4DR5 Q;  1QZG A;  1PTO D;  4DV7 L;  1TVX A;  1EWC A;  2UUB L;  1FL0 A;  2VW9 A;  2Y0S G;  4KY7 A;  5IP9 G;  4IUR A;  4C3H H;  1I4P A;  1ZYR C;  2KHJ A;  4CHT B;  1TY2 A;  4QMG A;  1M8A A;  3MEF A;  1E2V A;  1IBM Q;  1M1K C;  1YNJ C;  3H0G G;  4CDE C;  5E7N A;  4EQP A;  4TVA B;  2JA5 G;  4A3D B;  2L0C A;  1SLJ A;  4ZYS A;  2E5L L;  4A75 A;  1N33 L;  1W2B A;  1KAA A;  2KUM A;  1HUN A;  5KGU A;  2B2U A;  3S17 H;  1HNZ Q;  1DM0 B;  1EQQ A;  1N32 L;  3VR2 A;  3E9H A;  1EYG A;  2NVT H;  4JI2 L;  1FR3 A;  1BCP C;  3PO3 B;  1VQO A;  2WAC A;  4B3T L;  2NVQ B;  4HJ8 A;  1KNE A;  2JA7 H;  3WOF A;  4K5W A;  4MTK A;  3RZD B;  2ATW A;  1SYC A;  2XRS D;  2FMC A;  1WYD A;  2DJG C;  1WTW A;  5C0X J;  3OMG A;  1FGU A;  3KF8 B;  2CFM A;  5C3E B;  5E4X A;  1WD0 A;  4QIW E;  1SRU A;  4FXD A;  3HOW G;  4XQQ A;  3GD7 A;  4KJN A;  2EJM A;  1K9M C;  3Q23 A;  1AH9 A;  1STN A;  2B2Y C;  1RIP A;  3OWE B;  4B9X A;  5EAY A;  4DXG A;  5LMN L;  1I94 Q;  4X3T A;  1XNQ L;  3T51 B;  1IYV A;  1STH A;  2L5T A;  1IL8 A;  1I50 B;  1MSG A;  3VR3 A;  2BDN A;  3AQQ A;  4DR7 L;  1CKN A;  1IYU A;  1Q46 A;  4DR5 L;  4JI7 Q;  3GTQ B;  2KCN A;  1SNP A;  3OTO Q;  3GP7 A;  4A3L H;  5COY A;  3J81 i;  3QWN A;  3TZU A;  3ICE A;  1SMX A;  1SFO H;  1Q90 A;  1IHZ A;  3HOZ G;  2QW7 A;  2AUK A;  4OO1 H;  1SE2 A;  3CF5 A;  4QQB X;  4YWK A;  1ML0 D;  1F9P A;  2ALY B;  2NN6 I;  2BA0 A;  2R7Z G;  4PZ8 A;  1WJJ A;  4DR1 Q;  2F3V A;  4H0L C;  2IX0 A;  2A6E D;  4POF A;  4L6T B;  2XTI A;  1HNZ L;  1DD2 A;  1JWU D;  4C3I H;  1ASZ A;  4A93 G;  2JA5 H;  4DAP A;  3DM3 A;  5C5L A;  4CKB A;  5KNC A;  4GKJ L;  1L1O A;  1TKW B;  1D7Q A;  4LNQ A;  2WAQ B;  1IBL Q;  3FMC A;  2VS1 A;  4I65 A;  3U50 C;  2H4O A;  3K57 A;  3RR5 A;  5ELF A;  1Q81 C;  4RGN A;  3PMF A;  4Y7N H;  3HKS A;  4A4I A;  3PO2 B;  4JW0 A;  1XWE A;  2WKC A;  1F77 A;  4FO2 A;  5ELO A;  1I6H B;  1PLF A;  4UP7 A;  3R3O A;  4C3J G;  1PTO H;  1TWF B;  2CW0 C;  3MVV A;  4UP8 A;  3CU7 A;  1NSN S;  3KLS X;  4DAV A;  1HZ9 A;  2Q2H A;  2SDF A;  5CBE E;  3Q0A A;  4DV2 Q;  1XPO A;  4QY7 A;  4KN4 C;  3TP8 A;  1X56 A;  2DNE A;  4JBK A;  1TWG B;  4Q5V A;  1EU4 A;  4JI7 L;  4BBS B;  3OTO L;  3J81 j;  1XMQ L;  2MGS A;  3MWY W;  1TR5 A;  1VQF A;  2K32 A;  1JWS D;  3K81 C;  3CCR A;  2JA8 B;  4KKU A;  3L2P A;  5AJ3 Q;  2L55 A;  2QF7 A;  2ZM6 Q;  5M3F B;  3FEW X;  4OWW B;  1QIL A;  4X65 Q;  1TS2 A;  4O0A A;  5E3F A;  3V2T A;  1MKH A;  3RUZ A;  2MNA A;  4OHJ A;  5C4X B;  4LMQ D;  3BZK A;  3Q24 A;  1PRT C;  1STG A;  4ILW A;  1Y1W B;  4BWG B;  2AHO B;  1BQQ T;  2VB2 X;  3A7L A;  2I46 A;  5ELB A;  3D6W A;  3GTJ B;  5EJW A;  1AW7 A;  3AB9 A;  2F0F A;  5GAD C;  4WJ3 M;  2LKV A;  5FO8 B;  1FNW A;  4YCV A;  2K05 A;  4A3M G;  5E1F A;  5C44 G;  2I07 B;  4GS3 A;  4A93 H;  4DR2 L;  4KMU C;  2YU9 H;  3I4O A;  1RL2 A;  3CCL A;  1QVC A;  4FDB A;  5M5W B;  3G6E A;  4DK6 C;  1KTK A;  1AN8 A;  5EKL A;  1R9T H;  3V96 A;  5FO9 B;  2F0D A;  4JI5 Q;  1JOR A;  4P74 A;  1X6O A;  3R93 A;  4IUU A;  4IQZ A;  2A73 B;  2LXK A;  3S2D H;  1M4V A;  3NEN A;  1E24 A;  4DV2 L;  1BF4 A;  3HOU H;  4DA2 A;  1EY7 A;  4IFD H;  5M5Y B;  1ASY A;  3JAM L;  4CDC C;  4XDX A;  4A3D G;  2PI2 A;  2E2J H;  1G2T A;  1YJN A;  1HQR D;  1E3P A;  5GQO A;  3S1R B;  3HOX G;  4X6A H;  2IX1 A;  2OTJ A;  3D31 A;  2WB1 E;  1FNV A;  3T56 B;  5AJ3 L;  3R2I A;  4A3K G;  1HH2 P;  3LWU A;  2ZM6 L;  2NVY H;  1Y8O B;  4ID6 A;  4DV1 L;  2EYF A;  2F0H A;  2DJF C;  1QG7 A;  2F3I A;  1HNX Q;  3M85 A;  1LV9 A;  1Y8N B;  2B2V A;  2K5D A;  1YNX A;  3RD4 A;  1ICF B;  1ESF A;  5KNB A;  4HMJ A;  1TU2 B;  4JI1 Q;  5DM7 3;  2K52 A;  3GTM B;  4TRD A;  2B63 B;  2SEB D;  4X3U A;  3H3V I;  4JG2 A;  4IOC A;  1JJ2 A;  1BO0 A;  1C48 A;  2B2T C;  2F0V A;  1LTL A;  1SYE A;  3C1E A;  1CSP A;  4A3C G;  5D3D A;  4Z9C B;  3NK9 A;  4JCV E;  1NR4 A;  5HGQ A;  3HZX A;  5IP7 H;  3ND8 A;  2KED A;  4RCO A;  2VXW A;  1VQE A;  5JPM C;  2F4V Q;  4JI5 L;  2MO1 A;  3BG3 A;  1F2M A;  1LTB D;  1KHI A;  4KK7 A;  1I3Q B;  2PNH A;  3UE1 A;  1UWV A;  4YHH L;  4ABN A;  4HIO A;  4A3M H;  1NBW A;  3S15 H;  1SMY C;  4KV6 A;  3A8I E;  2YTX A;  4K14 A;  2EVB A;  2IHE A;  1PHJ A;  3I4N B;  1K3R A;  1SJE D;  4L5S A;  1EIF A;  4LF6 L;  4I7Z C;  3CCE A;  3V05 A;  1HZC A;  1LTG D;  3CHB D;  2O4X A;  3NWT A;  1D5X C;  3BDL A;  1PH5 A;  2JP1 A;  1HTL D;  2CWA A;  4HID A;  5NUC A;  2ZJQ A;  3NBH B;  4FF3 A;  5I9O A;  3MXP A;  1IW7 D;  3FKI B;  2M00 A;  3VR4 A;  2F03 A;  1CFM A;  2WAQ G;  1QJO A;  2Z6K A;  1HNX L;  3PUZ A;  1HA6 A;  1L0X B;  2XGT A;  4A3J G;  2JA6 B;  4EGV A;  1CI3 M;  1YHQ A;  2J7Z A;  1B3Q A;  3EVQ A;  3GTP B;  3PO3 H;  2MO0 A;  2B39 A;  4JI1 L;  4BBR B;  3HGB A;  1HR0 W;  2NVQ H;  2X6G A;  3CPW A;  1VQD A;  1H9M A;  1S5C D;  5C0X G;  1U9R A;  3RZD H;  3CCQ A;  2F0T A;  2VUM H;  1KAW A;  3I72 A;  4KN7 C;  1M90 C;  3A54 A;  2RSN A;  2PZT A;  5K36 G;  3ZYY X;  3FDT A;  5C3E H;  3LNN A;  3F2B A;  2QEJ C;  1DXM A;  4APV A;  5IYC H;  3C3L A;  1QVG A;  2N3S A;  4AH6 A;  2WIN B;  5D3I B;  4ZK9 B;  1U4R A;  2RCN A;  2N88 A;  1NR2 A;  3F1Z A;  1S5D D;  2EYL A;  3J80 i;  2HDM A;  3J81 E;  1I50 H;  4OIJ A;  3CP0 A;  4FF1 A;  2JA8 G;  4DAY B;  3I55 A;  2A68 D;  3HKZ B;  4ZRZ A;  3K6O A;  2QA4 A;  5GAH C;  4ALP A;  1STE A;  4DR4 L;  3GTQ H;  3VR5 A;  4PNY A;  1NCV A;  2DGY A;  3S24 A;  5BR8 L;  1VF7 A;  1QUQ B;  1C0A A;  5CGK A;  1ENA A;  3QR8 A;  1AZQ A;  1S72 A;  1E2W A;  3RZO B;  5IWA Q;  4Q0F A;  4KY5 A;  2R92 H;  4DXF A;  4DV3 Q;  3KLW A;  3UDF A;  2BE5 D;  2AWO A;  4JI3 L;  3WWV A;  4S3S A;  3K0Y A;  4ODG A;  3L3O C;  5FLX L;  1KQS A;  1SYF A;  5H1S E;  4RCN A;  4A3G B;  4JOI A;  3SXH A;  4IZ8 A;  4PV1 C;  4G7H C;  2JXM B;  3C1F A;  1PH9 A;  3U9O A;  4B3S L;  4IPH A;  1K8G A;  4XQJ A;  3KOJ A;  4QCL A;  4E6I A;  1XMO L;  3URY A;  2FFK B;  2H1E A;  3CXC A;  1EZ6 A;  3AMU A;  3I90 A;  3I4M H;  2F0K A;  2K75 A;  1ILQ A;  2QCP X;  3PO2 H;  3PF5 A;  1I6H H;  1A63 A;  3M4P A;  2MP1 A;  5C0X H;  1AE2 A;  3GV6 A;  4X64 Q;  1TWF H;  5FLM H;  4LK1 C;  4B3R L;  2NZ1 D;  1O7L A;  3HOZ B;  2UUA Q;  3WDN A;  4CDD C;  4FNF A;  5J39 A;  5EGT A;  2B2U C;  5KND A;  1LM0 A;  1SSO A;  1TWG H;  4DK0 A;  1WTV A;  1VQ5 A;  4IOA A;  4BBS H;  2EOT A;  3CC7 A;  2R7Z B;  3E0E A;  1CUK A;  4GNX B;  3SHL A;  2A6E C;  3MFG A;  1B9M A;  2JA8 H;  4XQN A;  4LF8 Q;  4AYB E;  4BS9 A;  1MSH A;  4CKC A;  5M3F H;  3EFX D;  1OTC A;  4DAY A;  4DV3 L;  1EOV A;  2B63 G;  3FP9 A;  4K6L A;  1S3O A;  3S2H B;  1XNR L;  2BH2 A;  2L15 A;  5C4X H;  1QUQ A;  1AEX A;  1Q1E A;  2EXD A;  1SEB D;  3VR6 A;  4PZ7 A;  1C8C A;  1Y1W H;  3HRZ C;  2EIF A;  3K7A B;  2N8N A;  2QGQ A;  4QUF A;  3M7N A;  1GVP A;  3GTJ H;  1X54 A;  2PZU A;  4X3K A;  4C3J B;  4P72 A;  1SNQ A;  4L8J A;  4OON A;  2MQH A;  4JBJ A;  2QIL A;  1KC8 C;  1PH3 A;  1PDQ A;  1SE3 A;  4L5R C;  3ULJ A;  2JEB I;  2HIX A;  5DLQ E;  1SNM A;  2NN6 H;  3M4Q A;  5M5W H;  2JJQ A;  3I4N G;  5JPN C;  2NZO A;  4O42 A;  1O7Z A;  1EY9 A;  2PPB C;  4BY7 B;  1CQF A;  3OMC A;  2E5L Q;  4K8J A;  4X64 L;  1OXU A;  5C4Z A;  5C6A A;  2PYK A;  5FKA C;  4B3M Q;  5C4J B;  5JVG 3;  4RH6 A;  1Q82 C;  2R6G A;  3D6C A;  5ELE A;  3GDE A;  3CCV A;  1N32 Q;  1TS3 A;  4JI2 Q;  1GUW A;  5M5Y H;  1U0L A;  4NXN L;  3WOE A;  4B3T Q;  1ZEQ X;  4L5Q A;  4OX9 Q;  1GHK A;  3NPP A;  3HOV H;  1I5F A;  4GOP C;  1L1O C;  2RF4 A;  5M5X H;  4R4O A;  3BDO A;  3S1R H;  3NQT A;  1Q8K A;  4HSP A;  4J1M A;  1G6P A;  4N9T A;  2PO4 A;  1CT1 D;  1B8A A;  2XVS A;  1CSQ A;  1PXU A;  3FPP A;  3GTG B;  2VY3 A;  5LMU L;  4KD3 A;  2V1C C;  4A3E G;  4C56 C;  5FOB B;  1II3 A;  1AE3 A;  2IL8 A;  5C44 B;  2KCM A;  3NP8 A;  1EYC A;  4OIK A;  1BBX C;  3KK7 A;  2CWP A;  3M9B A;  1VQP A;  3QOJ A;  4LFC Q;  1GUN A;  3RLF A;  1EEI D;  3CMA A;  1HNW Q;  1U4M A;  4UAI A;  3SR1 A;  2DY7 A;  4J6H A;  1KDB A;  2MHV A;  1Y1V G;  5IYD G;  3U9S A;  2RDH A;  2ZT9 C;  3LGJ A;  3OIP A;  4CJ2 C;  3HKZ G;  3J7A 5;  3FVQ A;  2OF1 A;  1L2F A;  4LF9 Q;  1LYL A;  3SE0 A;  1GUT A;  5JJK A;  1JOK A;  2OQ0 A;  2K28 A;  5C0X I;  2KOL A;  3CW2 C;  4B3M L;  2E2I H;  3S1M H;  4IAL A;  3HOX B;  1DOL A;  2A69 C;  3B6Y A;  3KLR A;  3I4N H;  2GN5 A;  1EY6 A;  4A3K B;  2SOB A;  2XN9 C;  1HJP A;  4DV0 L;  3J81 c;  2D5D A;  2TSS A;  4HIK A;  1YZ6 A;  4GKJ Q;  1KAB A;  2D62 A;  3EA6 A;  3CQZ B;  2XRQ D;  4IJH A;  4OX9 L;  3S1Q B;  1HR0 L;  1CKO A;  3OSO A;  4P2C B;  4A3G G;  3GTK H;  1B4O A;  5ELD A;  3BYT B;  3S16 B;  2CQA A;  1OXS C;  1SAP A;  2JK8 A;  1WCM B;  2WAQ E;  5CV8 A;  3ER0 A;  3FKI H;  1Y69 U;  3NWS A;  3CME A;  3W1B A;  1VQM A;  1ROD A;  2Z8L A;  3HS0 C;  5IT9 E;  3F2U A;  4IUP A;  3K59 A;  1UE7 A;  3DWQ A;  2JA6 H;  2PI2 E;  1B44 D;  2ZJP A;  4CJ0 B;  1PH8 A;  3GTP H;  1D5Z C;  1E0B A;  4XTC S;  2JYO A;  3S1N B;  4BBR H;  5IOD A;  4LF7 Q;  3T1H L;  4MN3 A;  2A19 A;  3FHW A;  3JC6 6;  2ZXP A;  4TQU S;  3TN2 A;  2I5M X;  4LFC L;  1XMQ Q;  1EOT A;  1STY A;  4UP9 A;  1HNW L;  2SNS A;  4IJL A;  4EQO A;  4K8I A;  4PMW A;  2ASB A;  3K5L A;  3OOC A;  1DYQ A;  3J80 E;  1Z9F A;  4KY6 A;  4YY3 L;  2E2H B;  3TRZ A;  1KD1 C;  4LF9 L;  2PCF B;  2F0J A;  2E76 C;  5IP9 H;  3CCS A;  3KYH C;  1PFB A;  1Z7T A;  3K80 C;  3NE5 B;  4F8M A;  3EQL C;  3MXU A;  2B2V C;  2B8F A;  5HGT A;  1X3E A;  4H44 C;  2R7D A;  3H0G H;  3E3X A;  4C2M B;  2PQE A;  3PIO 3;  3H3V H;  1VCI A;  4N8F A;  1RD9 D;  3PUV A;  4DUY L;  4DR3 L;  2RDF A;  1Q8I A;  1SBB B;  2IHF A;  1Z6H A;  5C3X A;  4A3J B;  3RLN A;  3OW7 A;  1K83 H;  3P20 A;  3STB C;  3RZO H;  4DF7 A;  4QB4 A;  4DR2 Q;  2PZW A;  3MZ5 A;  1K28 A;  4DV6 Q;  1JCK B;  1H9K A;  3HEJ A;  3LX0 A;  3U4Z A;  3PIP A;  1B50 A;  3L7Z C;  1XTD A;  2FXQ A;  3VYU A;  5GAE C;  4DUZ L;  1JJG A;  5IGD A;  1MI2 A;  4FVM A;  3ZJY C;  1KNA A;  2WV6 D;  3ERS X;  3BVZ A;  5A35 A;  2KBN A;  4FXG C;  3OHX C;  1BKB A;  1CA5 A;  1GM5 A;  4QJF A;  4EQ5 A;  4KLK A;  3QG1 A;  2UXD Q;  3RNU A;  4A76 A;  1LTT D;  1UE5 A;  3HOW H;  4LF7 L;  3KF8 A;  2IX3 A;  1YEZ A;  2A8V A;  2XWB B;  4BY7 G;  2KEE A;  1NY4 A;  1V9P A;  4XYO A;  1YHB A;  1D2B A;  2WII B;  3KBX A;  1PMR A;  3BYY B;  2AWN A;  4IPG A;  3OPO A;  5CMD A;  2G9H D;  4A3B B;  1ENF A;  2L12 A;  1IKL A;  1LT5 D;  2ENB A;  2OT2 A;  4HJ9 A;  1VQ9 A;  2CVR A;  1A6X A;  2TMP A;  1UE1 A;  3IFD A;  4JI4 Q;  1NMF A;  3CKI B;  4DV1 Q;  4PZ6 A;  3VDY A;  3N52 A;  3HOZ H;  2EZV A;  4DGZ A;  4LF5 L;  3I7F A;  2Z6K C;  3NSW A;  2JQO A;  4UY8 C;  2IT1 A;  1K73 C;  1R4Q B;  2EQS A;  4KD4 A;  5L37 A;  4DNT B;  1X3Q A;  3TQY A;  1FVI A;  1D1K A;  4HED A;  2JEA I;  1ENC A;  2R7Z H;  4KHP L;  5DNF A;  1O78 A;  3K5N A;  2OWO A;  3VA5 A;  4G4K A;  1SE8 A;  2R93 B;  1YIT A;  5IGG A;  3J7A V;  3PIO A;  2PQA B;  3GV3 A;  4R4I A;  2B29 A;  4DV6 L;  4BA2 I;  3S2H H;  2EJG C;  2ZXR A;  2K14 A;  2AQ3 B;  3A74 A;  1U4L A;  4YHH Q;  3W1G A;  1FNU A;  1YVC A;  4P75 A;  3SK8 A;  2O5I C;  1UEB A;  3AEV A;  1LT4 D;  2UXD L;  2KCT A;  1FGB D;  1CHQ D;  4LF6 Q;  1DJR D;  1HPC A;  2ZTC A;  1B3A A;  2F0M A;  4UPA A;  4C3J H;  1WI5 A;  2B2Y A;  3P1H A;  4NXM L;  2A6H D;  3DEP A;  2UUC Q;  3VYR A;  2IPK D;  5IIF A;  1SYD A;  1N36 Q;  1XX8 A;  2I0Q A;  1K0R A;  2Z6B A;  3M4Y A;  3ULP A;  3K58 A;  1JB7 A;  2DNC A;  1EYA A;  1PH4 A;  1CHP D;  5C4H A;  4JI4 L;  1SYG A;  4QL5 A;  1JOO A;  3HOY G;  3PUY A;  1XYI A;  2R7F A;  2J0T D;  3W3A A;  5G3L F;  5C4J H;  5BN4 A;  1PRT B;  1LTR D;  1D8L A;  1QCB D;  2YYZ A;  1GXD C;  1WCM G;  1DOK A;  3A8J E;  1E1T A;  3G7L A;  3IFT A;  1SN8 A;  1U4P A;  2M9V A;  2K6A A;  2MUY A;  3ERQ A;  1N8R C;  1PV4 A;  2VL6 A;  3H91 A;  2F0G A;  4KJO A;  3T1Y Q;  3KFU A;  1F9Q A;  4ME3 A;  3O13 A;  1LT3 D;  3GTG H;  1IBK L;  2YV5 A;  1B2T A;  1JWM D;  4CKE A;  4RGT A;  3EN2 A;  2RQX A;  1E1O A;  4A3I G;  1GHJ A;  4PMC A;  2NTS A;  3HG9 A;  4JV5 Q;  2IWH A;  2OQK A;  2VB3 X;  1RKN A;  1PRT F;  3DMU A;  4ZQ3 A;  5IGB A;  5IT9 c;  4LUO A;  5C44 H;  1A0I A;  4HSV A;  1VQA A;  4RGM A;  1UE6 A;  2Y0S E;  4DR4 Q;  1PA6 A;  1I4X A;  2K1B A;  2PQA A;  4K5X A;  5EPK A;  5BR8 Q;  1JJC B;  1RDP D;  4KKT A;  3HKZ E;  2H5X A;  1N9W A;  2UUC L;  4BXX G;  4DAM A;  1N36 L;  4CGY B;  3JAM i;  2CCZ A;  4JI3 Q;  4FF4 A;  1HXY D;  1H9R A;  5A2Q E;  4JI6 Q;  4A3D H;  3D0F A;  3VYS A;  5CBA E;  3MFY A;  3J80 c;  3TS0 A;  2WB1 B;  2MPM A;  4F88 A;  3HOX H;  3H3V C;  4B3S Q;  4A3K H;  4LWC A;  5DEH A;  3RLO A;  4F87 A;  3I4L A;  5ISR A;  3DUZ A;  3CAM A;  1XMO Q;  1ESR A;  4G7Z C;  1S4Z A;  1Q86 C;  1IL2 A;  3S16 H;  4A3E B;  2KQ3 A;  1RHP A;  3T1Y L;  1GUS A;  2K04 A;  3M3Y B;  1L0Y B;  2Z4H A;  2N49 A;  1BUV T;  1PTO C;  4OL7 A;  3K7U C;  5J3B A;  5KYI A;  2K33 A;  2L11 A;  2OEO A;  4XT1 B;  4B3R Q;  4NPS A;  2C35 B;  5M3M G;  4A3C H;  4JV5 L;  4DV5 L;  4GLX A;  4X62 Q;  1Y1V B;  4A3B G;  3S1N H;  1RCV D;  5LL6 S;  2F52 A;  2CKZ B;  5IY0 A;  3OWF A;  4OEL B;  1T5E A;  2QKI C;  1E7Z A;  5IGE A;  4LAA A;  5KYL A;  1VQL A;  1J5E L;  1PH6 A;  3TEH B;  2D9U A;  1B53 A;  4ZKB B;  3SVM A;  4HCS A;  1KL9 A;  4BY1 B;  1SNC A;  2ZJR A;  3DEO A;  1LTI D;  4GZY C;  4LFB L;  2E2H H;  1L0W A;  4DNR B;  1SJH D;  2KHS A;  2P5Z X;  1PFM A;  4JI6 L;  4C3I B;  2A5H A;  1XNR Q;  5GRO A;  4GLV B;  2CH4 W;  2NUC A;  2K5Q A;  1CZG A;  3NEM A;  3NQI A;  3TSS A;  3KBG A;  4GLA C;  4JK1 C;  3G71 A;  2R93 G;  1TWC B;  4BXX H;  1I4R A;  1IXR A;  4IPD A;  2ZTD A;  2MFI A;  3MC0 B;  4ZUJ A;  1QWY A;  4C2M H;  1EUJ A;  1DGS A;  4J15 A;  1E2Z A;  5EPJ A;  2X6L A;  3K5M A;  2BA1 A;  1EWH A;  3NBH A;  4X66 L;  5FJ8 G;  1CTM A;  2B3G A;  1PRT D;  2LXJ A;  4A3J H;  3D4W A;  5CV6 A;  3G4S A;  1V1O A;  3BS1 A;  3UDI A;  4DFA A;  1SRO A;  4RHR A;  4IFD J;  4YCU A;  2F3W A;  2K5V A;  1YNN D;  1JE5 A;  1VQC A;  2PMZ B;  2RSO A;  2F0L A;  1WTO A;  3D4R A;  1HFN A;  3TME A;  4IUV A;  3UDX A;  3SGI A;  5CC4 A;  5EKK A;  5GAG C;  5FO7 B;  3GO5 A;  5D14 A;  2VNU D;  5K36 H;  4X62 L;  2Q2I A;  4JBW A;  3QJY A;  2XNA C;  4EX5 A;  4NXN Q;  3NTI A;  1D5M C;  1W6J A;  3PSI A;  3PGZ A;  4UHV A;  1BOS A;  4MZ9 A;  3BU2 A;  4ZCK A;  1HUM A;  4HN7 A;  3MEH A;  5JEA J;  5I9P A;  3EIV A;  3CD6 A;  4NW2 A;  1TQO A;  4IUT A;  4ZKC B;  1UEA B;  1BVS A;  1YHA A;  3H6M A;  2JE6 I;  1Q1B A;  4L63 B;  4DPG A;  2EYO A;  1H9S B;  5CV5 A;  5LMU Q;  1JR0 D;  5DAU A;  1BDO A;  5IYB G;  5CV4 A;  1AZP A;  2A74 C;  4RMF A;  1VMP A;  4YIJ A;  2D0P A;  1VQ6 A;  4RA8 A;  2A1A A;  4C1N K;  1HFG A;  1N34 L;  2KVM A;  1ILP A;  1QB5 D;  1H95 A;  3LWE A;  5LHY 1;  1OXT A;  2K5N A;  3PV0 A;  4FYD A;  3A5Z B;  2ZTE A;  3NBI A;  1NMG A;  2LFN A;  1R9T B;  4ULL A;  2F0O A;  5CR3 A;  4LUZ A;  1F9R A;  4C3H G;  4LF4 Q;  4FP5 D;  1I4Q A;  3S2D B;  3PQI A;  1KIX A;  1EEF D;  1EY4 A;  3CC4 A;  2K03 A;  4OWX B;  2X69 A;  3HOU B;  1I6V C;  2E75 C;  5FJ8 H;  5M9O A;  4G57 A;  4LJZ C;  1HCZ A;  2AKW B;  2QDB A;  2ES2 A;  3PUW A;  1MD2 D;  1D6E C;  3ULL A;  5J22 A;  1KXL A;  1BBU A;  2K01 A;  5AFW A;  4DV0 Q;  3GQB A;  3IL8 A;  1EY8 A;  4J8Q A;  4JI0 Q;  4A3F B;  1PH1 A;  3T16 A;  1YJW A;  1VQ7 A;  4OEM B;  3MHB A;  1HR0 Q;  4CDF C;  2WB1 G;  1EL0 A;  4NMZ A;  2DY8 A;  2HQE A;  2JA7 G;  4EVO A;  5KIX A;  2VQF L;  4WJ4 A;  5HY6 A;  4NP5 A;  1QNK A;  2IJ0 A;  3L0O A;  2I5H A;  2IW3 A;  2NZH A;  1K8A C;  3BJU A;  4GNX A;  4AYB B;  4DN4 M;  1PZJ D;  1BR9 A;  1DZ1 A;  4LUV A;  2GVB A;  1VQJ A;  1G6Z A;  4R1J A;  1MJE A;  1G29 1;  1CKN B;  1FD7 D;  3T1H Q;  3C46 A;  3P75 A;  4OGQ C;  3GTM H;  2B63 H;  3VA7 A;  2L9H A;  1H9S A;  2ICI A;  4CJ1 B;  4N8X 1;  1EQR A;  4A3L G;  3I3C A;  1HHV A;  1EU3 A;  1C7Y A;  3FPU B;  3J81 L;  4TKO B;  3UDG A;  5BN5 A;  2B2W A;  1OO9 B;  4RG1 A;  1Q12 A;  4LF4 L;  4K2L A;  4YY3 Q;  3S15 B;  4V0B A;  4OO1 G;  3J7Z C;  3X3N A;  2A6H C;  2FIN B;  1I3Q H;  3GTO B;  5EBD A;  5EPL A;  4RFB A;  5F2D A;  5K5P A;  4BY1 G;  3R8B A;  3RN5 A;  4P71 A;  1PYS B;  3NXW A;  1TWA B;  4R9W A;  3W5O A;  1RTO A;  4Y52 H;  2I5L X;  2Q8I B;  1F9S A;  2EYM A;  5IE8 A;  1EQT A;  3TRE A;  4DUY Q;  1F2L A;  4C3I G;  5I6Y A;  4DR3 Q;  4GOP B;  4AQY L;  4KHV A;  4JI0 L;  1L1O B;  1JC7 A;  3HOY B;  3PIP 3;  3JAM E;  1IYJ B;  2QEX A;  1G51 A;  1CM9 A;  3L9A X;  1X3G A;  4U67 3;  3IKJ A;  2UU9 L;  2UXC L;  1T5X D;  1JIC A;  4DUZ Q;  1S5E D;  3HP3 A;  1JMC A;  4DR6 Q;  4DV4 L;  2K7V A;  1AFP A;  1G2S A;  4KI0 A;  1TS5 A;  3KJP A;  2VUM B;  1PYB A;  5I2Y A;  1TWH B;  2AQ1 B;  3E0J A;  5HUR A;  4HR7 B;  4MNO A;  3W2D A;  2C5C A;  4A3I B;  3H09 A;  2D2C C;  3CCU A;  1KLU D;  3OW2 A;  1QVF A;  2EDG A;  4H7B A;  4A3E H;  2CH4 A;  2WKD A;  3M3Y H;  1AP0 A;  3ND9 A;  2NWG A;  2JSO A;  3DWA A;  2EY5 A;  2VQE Q;  2KCC A;  1K0S A;  1CZW A;  4JC0 A;  1A3V A;  4O2D A;  3TZD A;  4DU9 A;  1ET6 A;  2RBM A;  1BXT A;  3F2C A;  4CBV A;  4ZUI A;  4LF5 Q;  1Y1V H;  1QE6 A;  3C2P A;  5IYD H;  1VDZ A;  2QDL A;  4R4Q A;  2PW7 A;  3GTL B;  1IW7 C;  1BCP B;  3CC2 A;  5JJL A;  3DM1 A;  1F2Z A;  3IAY A;  2NB0 A;  1GJX A;  1QNU A;  1KLG D;  1YIJ A;  1MGS A;  4KHP Q;  2BCO A;  1IBM L;  2F4I A;  2R92 B;  2WFW A;  4IUQ A;  1G8Z D;  1NE3 A;  3D8G A;  2M2L A;  1JE4 A;  5TSS A;  4BY1 H;  3KF6 B;  3OYY A;  5JVH 3;  4HAE A;  1NNX A;  1WTH A;  1BBW A;  5KEE A;  3D4D A;  5KRU A;  3DWP A;  4JYA Q;  1XTC D;  1VQB A;  1UNS A;  3SK4 A;  3Q8D A;  1MIU A;  2G5D A;  4F7X A;  1KDA A;  2AMC B;  2F0E A;  4GOP A;  2KEC A;  1TWC H;  3BZD B;  4A3G H;  4DR6 L;  3NUC A;  3TP6 A;  1HA5 A;  2GVA A;  4QIW B;  1BCP F;  1EIY B;  3A7A B;  1XPU A;  2BOS A;  1LAB A;  1S40 A;  3I4M B;  3HOU G;  1LT6 D;  4L5T A;  1VQH A;  1X3P A;  4IFD G;  2Q8T A;  1PVO A;  4NXM Q;  3MA2 B;  4ME5 A;  5M3M B;  1QZH A;  4LFA Q;  4IPC A;  2A68 C;  1J6Q A;  1ONL A;  2D0O A;  1TXY A;  3EBE A;  1I94 L;  2EYH A;  3TP7 A;  2RKS A;  2AQ2 B;  3UI2 A;  2VQE L;  4A3F G;  3NEL A;  4R8I A;  3K0X A;  1YJ9 A;  4QGU A;  4G7O C;  4XT3 B;  1VMC A;  3TS2 A;  3AFQ A;  4RGO S;  2HHH Q;  2BE5 C;  3A0J A;  2E8G A;  3CRK C;  4FF2 A;  1W6K A;  1GD7 A;  1JB3 A;  5J1Z A;  2YTV A;  5JEA G;  1S5B D;  1D1I A;  2RVL A;  3CCM A;  4B08 A;  1HQM C;  1W3S A;  2K4K A;  4AYB G;  3QB3 A;  1A3U A;  1Y8P B;  3SK6 A;  2EY2 A;  4DR1 L;  1MBY A;  4YCW A;  3S14 B;  4V19 0;  1OXV A;  1IBK Q;  4DNI A;  2Z0S A;  4JYA L;  4GN5 A;  1EY5 A;  3CRL C;  4TSS A;  3A8K E;  1VQ4 A;  1KRT A;  1GKH A;  2Q8R E;  5IP7 G;  4RKB A;  5C5M A;  1YNN C;  5FLX E;  1CKM A;  1Y14 B;  1IBL L;  1F2Y A;  3NTH A;  4H13 C;  3KF6 A;  1VQN A;  3T53 B;  2RA4 A;  3K7A H;  5CV9 A;  3E5S A;  2J4X A;  1PZK D;  3U58 A;  1FJG Q;  1X65 A;  4YWL A;  1TII D;  4QUC A;  4ZAI A;  4GN4 B;  4B9W A;  4LFA L;  3J7A F;  1SDF A;  5E4W C;  1H9J A;  2RCF A;  1P8L A;  5IGF A;  2HT1 A;  1NJI C;  4BY7 H;  2Z4I A;  1ZYR D;  5CYU A;  3QIA A;  5JOB A;  3BZC A;  4DK1 A;  1HTP A;  2NVX B;  1HZA A;  1B70 B;  2XWJ B;  1YNJ D;  2OCE A;  3I73 A;  3HOV B;  2EXZ A;  2FMM A;  1WTQ A;  2HHH L;  1K3B C;  2GA4 B;  2JA9 A;  4JOI C;  1XXG A;  5M5X B;  4NDX A;  4O1N A;  4POG A;  2BH8 A;  5D65 A;  4JPB W;  4A3F H;  1CA6 A;  4GN3 B;  1RTN A;  1O7I A;  3PO3 G;  4RWS C;  4OO1 I;  5IT9 L;  2F0P A;  4M8A A;  3M4O B;  5COR A;  2EE1 A;  2AUJ D;  2OXP A;  2A69 D;  1B9N A;  5IGC A;  1BCP D;  4X65 L;  4GKK Q;  1NUC A;  2VUM G;  4WJW A;  3JAM c;  3RMH A;  1VQI A;  2RHQ B;  3R2T A;  2MJ8 A;  5C3E G;  5JEA H;  1GO3 E;  2PNR C;  3A5U A;  4KKS A;  5IYC G;  3SDZ A;  4MTN A;  1GUO A;  4DV5 Q;  5T1G A;  2E74 C;  3SK5 A;  1PH2 A;  2ZXO A;  4C3H B;  4HJ5 A;  1Q7Y C;  1YBY A;  3J80 L; 
#chains in the Genus database with same CATH homology
 1A3T A;  1UUP A;  2F0S A;  5EKI A;  1LTS D;  4K2K A;  3K5O A;  1K8O A;  1X32 A;  1KDC A;  1LAC A;  4HMI A;  2E2I B;  1C4Q A;  3S1M B;  1J8I A;  3T13 A;  3I70 A;  3S17 B;  1STA A;  3NTK A;  4XIG S;  1HRJ A;  1B1Z A;  2NVT B;  3BDC A;  3EJI A;  1WD1 A;  2FHT A;  2F0Q A;  2LY7 A;  1JQY D;  1J9O A;  2JA7 B;  1O7Y A;  2O5J C;  5I2X A;  2ICE C;  3GTK B;  3TDQ A;  4EQN A;  1ICW A;  5EQ0 A;  1A2U A;  2F0W A;  4IN3 A;  5BN3 A;  3FRP B;  2O2L D;  5I6W A;  3ERO A;  1SXT A;  1TY0 A;  5T1I A;  2EYJ A;  5EBC A;  2R3Z A;  2XSC A;  3DXJ C;  4KHZ A;  1DOM A;  1CK1 A;  2FJ2 A;  1V1P B;  1LTA D;  4C1N I;  5JAV A;  1SND A;  2L4N A;  1SFO B;  3A55 A;  4KTA A;  5DM6 3;  1NAP A;  1A15 A;  4XYQ A;  3SEB A;  2CW0 D;  1I4H A;  1RF2 D;  2EY6 A;  2EY1 A;  3QO2 A;  2L1B A;  4N9P A;  4X3S A;  3QOL A;  5G3L D;  4M1U B;  3ONA B;  4MHE A;  2XIW A;  2NBF A;  2K5W A;  2WP8 J;  2Y0S B;  1EQV A;  4FXK C;  3E6Z X;  2HCI A;  3TBI B;  4RKL A;  3NHH A;  4MIU A;  1V8Q A;  3H0G B;  1VF5 C;  4NKL A;  2JA5 B;  3P7J A;  5I4D A;  1ET9 A;  3MTS A;  4IFD I;  1STB A;  5ELC A;  1SNO A;  4XXE A;  4RAU C;  1QOH A;  1SE4 A;  2N55 A;  1LLR D;  3A56 A;  1IKM A;  1EY0 A;  3D3R A;  1Z47 A;  1K83 B;  4Y7N B;  2NYZ D;  4IUN A;  3S9W A;  2RDG A;  5JJZ A;  3X3M A;  4K6D A;  5IOC A;  1WTX A;  1PTO B;  1JOQ A;  2G9D A;  1R4P B;  4HTH A;  2B2W C;  4BA1 I;  2C9O A;  3T4A C;  2NN6 G;  1EYD A;  3I8Z A;  3HOW B;  3VYT A;  2HCC A;  2ID0 A;  3MXG A;  2B2T A;  2PW5 A;  2HUG A;  2KJX A;  1TT2 A;  1Q3L A;  3MAQ A;  3G6J B;  2F0I A;  1WTR A;  4WRD A;  2V4D A;  1ZKO A;  2NTT A;  1V1P A;  3Q6S A;  1EIG A;  1PTO F;  3DHQ A;  1PFN A;  1DON A;  4U68 A;  1GOZ A;  1TS4 A;  1O80 A;  4HCE A;  2CHB D;  2HDL A;  1WVL A;  1PYW D;  1PZI D;  4WOR A;  1K8M A;  1FYC A;  1EZ8 A;  1RJT A;  2EPB A;  4A93 B;  2YU9 B;  2E2D C;  2EYP A;  5LL6 X;  2R61 A;  2EJF C;  1G91 A;  1OXX K;  2LS0 1;  5CV7 A;  4UDU C;  4R8N A;  1BNZ A;  1WTP A;  4PMB A;  1S5F D;  3J7Y W;  1GUG A;  3MXN A;  3KUP A;  3ITP A;  2B8G A;  2E2J B;  4WFN 3;  1UAP A;  3N6R A;  1A2T A;  1DCZ A;  3H94 A;  2DN8 A;  3TP5 A;  5A2Q L;  1CQV A;  1SMY D;  3BVM A;  2NVY B;  3M7G A;  3PUX A;  3OIQ A;  4PQX A;  2F0N A;  2F0U A;  4QF4 A;  3KLS A;  2LMC B;  1V43 A;  5C3W A;  1EIH A;  1I4G A;  3I91 A;  2SNM A;  1EFI D;  4K5V A;  2Z1C A;  3BVG A;  4RHS A;  5FK9 C;  3AU7 A;  1ZXT A;  2KA7 A;  4A3M B;  1LO5 D;  4ZLT F;  2F1M A;  2BDO A;  1SYB A;  3Q22 A;  1PTO D;  1TVX A;  1EWC A;  4KY7 A;  4IUR A;  1I4P A;  1ZYR C;  4CHT B;  1TY2 A;  4QMG A;  1M8A A;  1E2V A;  1YNJ C;  4EQP A;  4A3D B;  2L0C A;  4ZYS A;  1KAA A;  2KUM A;  1HUN A;  5KGU A;  2B2U A;  1DM0 B;  3VR2 A;  3PO3 B;  1FR3 A;  1BCP C;  2WAC A;  2NVQ B;  1KNE A;  3WOF A;  4K5W A;  3RZD B;  1SYC A;  2XRS D;  2FMC A;  1WTW A;  5C0X J;  3OMG A;  5C3E B;  5E4X A;  1WD0 A;  4FXD A;  4XQQ A;  3GD7 A;  4KJN A;  2EJM A;  3Q23 A;  1STN A;  2B2Y C;  4B9X A;  3OWE B;  4DXG A;  4X3T A;  3T51 B;  1IYV A;  1STH A;  2L5T A;  1IL8 A;  1I50 B;  1MSG A;  3VR3 A;  2BDN A;  1IYU A;  3GTQ B;  2KCN A;  1SNP A;  3GP7 A;  5COY A;  3QWN A;  3TZU A;  1Q90 A;  1IHZ A;  2AUK A;  4OO1 H;  1SE2 A;  1ML0 D;  1F9P A;  2NN6 I;  2BA0 A;  2F3V A;  4H0L C;  2IX0 A;  2A6E D;  4L6T B;  1DD2 A;  1JWU D;  4DAP A;  5C5L A;  4CKB A;  5KNC A;  1TKW B;  2WAQ B;  3FMC A;  4I65 A;  2H4O A;  3K57 A;  5ELF A;  4RGN A;  3PMF A;  3PO2 B;  1XWE A;  2WKC A;  1F77 A;  4FO2 A;  1I6H B;  1PLF A;  3R3O A;  4C3J G;  1PTO H;  1TWF B;  2CW0 C;  3MVV A;  3CU7 A;  1NSN S;  3KLS X;  4DAV A;  3Q0A A;  2SDF A;  5CBE E;  4KN4 C;  3TP8 A;  2DNE A;  1TWG B;  4Q5V A;  1EU4 A;  4BBS B;  2MGS A;  3MWY W;  1TR5 A;  2K32 A;  1JWS D;  2JA8 B;  4KKU A;  2L55 A;  2QF7 A;  5M3F B;  3FEW X;  1QIL A;  1TS2 A;  5E3F A;  3V2T A;  3RUZ A;  4OHJ A;  5C4X B;  4LMQ D;  3Q24 A;  1PRT C;  1STG A;  4ILW A;  1Y1W B;  4BWG B;  1BQQ T;  2VB2 X;  3A7L A;  2I46 A;  5ELB A;  3D6W A;  3GTJ B;  5EJW A;  1AW7 A;  3AB9 A;  2F0F A;  2LKV A;  5FO8 B;  1FNW A;  2K05 A;  5E1F A;  2I07 B;  4KMU C;  5M5W B;  1KTK A;  1AN8 A;  5EKL A;  3V96 A;  5FO9 B;  2F0D A;  1JOR A;  3R93 A;  4IUU A;  4IQZ A;  2A73 B;  1M4V A;  1BF4 A;  4DA2 A;  1EY7 A;  4IFD H;  5M5Y B;  3JAM L;  4XDX A;  1G2T A;  1HQR D;  3S1R B;  2IX1 A;  3D31 A;  1FNV A;  3T56 B;  3R2I A;  3LWU A;  1Y8O B;  4ID6 A;  2EYF A;  2F0H A;  1QG7 A;  3M85 A;  1LV9 A;  1Y8N B;  2B2V A;  2K5D A;  3RD4 A;  1ESF A;  5KNB A;  4HMJ A;  1TU2 B;  5DM7 3;  3GTM B;  4TRD A;  2B63 B;  2SEB D;  4X3U A;  1BO0 A;  1C48 A;  2B2T C;  2F0V A;  1SYE A;  3C1E A;  5D3D A;  4Z9C B;  3NK9 A;  1NR4 A;  3HZX A;  3ND8 A;  2KED A;  4RCO A;  2VXW A;  5JPM C;  3BG3 A;  1F2M A;  1LTB D;  4KK7 A;  1I3Q B;  4ABN A;  1SMY C;  4KV6 A;  3A8I E;  4K14 A;  2EVB A;  3I4N B;  1SJE D;  4I7Z C;  3V05 A;  1LTG D;  3CHB D;  2O4X A;  3NWT A;  1D5X C;  3BDL A;  2JP1 A;  1HTL D;  5NUC A;  4FF3 A;  5I9O A;  3MXP A;  1IW7 D;  3FKI B;  2M00 A;  3VR4 A;  2F03 A;  1CFM A;  1QJO A;  1HA6 A;  3PUZ A;  1L0X B;  2JA6 B;  4EGV A;  1CI3 M;  2J7Z A;  3EVQ A;  3GTP B;  2B39 A;  4BBR B;  3HGB A;  2X6G A;  1H9M A;  1S5C D;  5C0X G;  1U9R A;  2F0T A;  3I72 A;  4KN7 C;  3A54 A;  2RSN A;  2PZT A;  5K36 G;  3ZYY X;  3FDT A;  3LNN A;  2QEJ C;  1DXM A;  3C3L A;  2WIN B;  5D3I B;  4ZK9 B;  1U4R A;  2N88 A;  1NR2 A;  1S5D D;  2EYL A;  2HDM A;  3J81 E;  4OIJ A;  4FF1 A;  2A68 D;  3HKZ B;  4ZRZ A;  3K6O A;  1STE A;  3VR5 A;  4PNY A;  1NCV A;  1VF7 A;  5CGK A;  1ENA A;  1AZQ A;  1E2W A;  3RZO B;  4Q0F A;  4KY5 A;  4DXF A;  2BE5 D;  2AWO A;  4S3S A;  3K0Y A;  4ODG A;  3L3O C;  5FLX L;  1SYF A;  4RCN A;  4A3G B;  3SXH A;  4IZ8 A;  4PV1 C;  4G7H C;  2JXM B;  3C1F A;  3U9O A;  4XQJ A;  4QCL A;  4E6I A;  3URY A;  2FFK B;  2H1E A;  1EZ6 A;  3AMU A;  3I90 A;  2F0K A;  1ILQ A;  2QCP X;  5C0X H;  2MP1 A;  3GV6 A;  4LK1 C;  2NZ1 D;  1O7L A;  3HOZ B;  3WDN A;  4FNF A;  5J39 A;  5EGT A;  2B2U C;  5KND A;  1SSO A;  4DK0 A;  1WTV A;  2EOT A;  2R7Z B;  3SHL A;  2A6E C;  3MFG A;  1B9M A;  4XQN A;  4BS9 A;  1MSH A;  4CKC A;  3EFX D;  4DAY A;  4K6L A;  3S2H B;  1AEX A;  1Q1E A;  3VR6 A;  1SEB D;  1C8C A;  3HRZ C;  3K7A B;  4QUF A;  3M7N A;  2PZU A;  4X3K A;  4C3J B;  1SNQ A;  4L8J A;  2QIL A;  1PDQ A;  1SE3 A;  2JEB I;  1SNM A;  2NN6 H;  5JPN C;  4O42 A;  1O7Z A;  1EY9 A;  2PPB C;  4BY7 B;  1CQF A;  3OMC A;  4K8J A;  1OXU A;  5C4Z A;  5C6A A;  2PYK A;  5FKA C;  5C4J B;  5JVG 3;  4RH6 A;  2R6G A;  3D6C A;  5ELE A;  1TS3 A;  1GUW A;  3WOE A;  1ZEQ X;  1GHK A;  3NPP A;  3BDO A;  3NQT A;  4HSP A;  4J1M A;  4N9T A;  2PO4 A;  1CT1 D;  2XVS A;  1PXU A;  3FPP A;  3GTG B;  4KD3 A;  4C56 C;  5FOB B;  1II3 A;  2IL8 A;  5C44 B;  3NP8 A;  1EYC A;  4OIK A;  1BBX C;  3KK7 A;  3QOJ A;  1GUN A;  3RLF A;  1EEI D;  4UAI A;  1U4M A;  3SR1 A;  2DY7 A;  4J6H A;  1KDB A;  2MHV A;  3U9S A;  2RDH A;  2ZT9 C;  3OIP A;  4CJ2 C;  3FVQ A;  2OF1 A;  3SE0 A;  1GUT A;  1JOK A;  2K28 A;  5C0X I;  2KOL A;  4IAL A;  3HOX B;  1DOL A;  2A69 C;  3KLR A;  1EY6 A;  4A3K B;  2SOB A;  2XN9 C;  2D5D A;  2TSS A;  1KAB A;  2D62 A;  3EA6 A;  3CQZ B;  2XRQ D;  3S1Q B;  3OSO A;  4P2C B;  1B4O A;  5ELD A;  3BYT B;  3S16 B;  2CQA A;  1OXS C;  1SAP A;  1WCM B;  5CV8 A;  1Y69 U;  3NWS A;  1ROD A;  2Z8L A;  3HS0 C;  5IT9 E;  3F2U A;  4IUP A;  3K59 A;  3DWQ A;  1B44 D;  4CJ0 B;  1D5Z C;  1E0B A;  4XTC S;  2JYO A;  3S1N B;  5IOD A;  4MN3 A;  2ZXP A;  4TQU S;  3TN2 A;  1EOT A;  1STY A;  2SNS A;  4EQO A;  4K8I A;  4PMW A;  3K5L A;  3OOC A;  1DYQ A;  3J80 E;  4KY6 A;  2E2H B;  2PCF B;  2F0J A;  2E76 C;  1PFB A;  1Z7T A;  3NE5 B;  4F8M A;  3EQL C;  3MXU A;  2B2V C;  2B8F A;  5HGT A;  4H44 C;  4C2M B;  2PQE A;  3PIO 3;  1VCI A;  1RD9 D;  3PUV A;  2RDF A;  1Q8I A;  1SBB B;  1Z6H A;  5C3X A;  4A3J B;  3OW7 A;  3P20 A;  4DF7 A;  4QB4 A;  2PZW A;  3MZ5 A;  1JCK B;  1H9K A;  3HEJ A;  3LX0 A;  1B50 A;  3L7Z C;  3VYU A;  5IGD A;  1MI2 A;  4FVM A;  1KNA A;  2WV6 D;  3BVZ A;  5A35 A;  4FXG C;  3OHX C;  1CA5 A;  3QG1 A;  1LTT D;  3KF8 A;  2IX3 A;  2XWB B;  2KEE A;  4XYO A;  1D2B A;  2WII B;  3KBX A;  1PMR A;  3BYY B;  2AWN A;  3OPO A;  5CMD A;  2G9H D;  4A3B B;  1ENF A;  2L12 A;  1IKL A;  1LT5 D;  2ENB A;  2OT2 A;  2CVR A;  1A6X A;  2TMP A;  3IFD A;  3CKI B;  3N52 A;  2EZV A;  4DGZ A;  3NSW A;  2IT1 A;  1R4Q B;  4KD4 A;  4DNT B;  1X3Q A;  1D1K A;  4HED A;  2JEA I;  1ENC A;  5DNF A;  1O78 A;  3K5N A;  3VA5 A;  4G4K A;  2R93 B;  5IGG A;  3J7A V;  3GV3 A;  4BA2 I;  2EJG C;  2ZXR A;  2AQ3 B;  1U4L A;  1FNU A;  3SK8 A;  2O5I C;  1LT4 D;  1FGB D;  1CHQ D;  1DJR D;  1HPC A;  1B3A A;  2F0M A;  2B2Y A;  3P1H A;  2A6H D;  3DEP A;  3VYR A;  2IPK D;  5IIF A;  1SYD A;  1XX8 A;  3M4Y A;  3K58 A;  2DNC A;  1EYA A;  1CHP D;  5C4H A;  1SYG A;  1JOO A;  3PUY A;  1XYI A;  2J0T D;  3W3A A;  5G3L F;  5BN4 A;  1PRT B;  1LTR D;  1QCB D;  2YYZ A;  1GXD C;  1DOK A;  3A8J E;  3G7L A;  3IFT A;  1U4P A;  2M9V A;  2K6A A;  2MUY A;  3ERQ A;  3H91 A;  2F0G A;  4KJO A;  1F9Q A;  3O13 A;  1LT3 D;  1B2T A;  1JWM D;  4CKE A;  4RGT A;  2RQX A;  1GHJ A;  4PMC A;  2NTS A;  3HG9 A;  2IWH A;  2VB3 X;  1RKN A;  1PRT F;  3DMU A;  4ZQ3 A;  5IGB A;  4HSV A;  4RGM A;  1I4X A;  2K1B A;  4K5X A;  5EPK A;  1RDP D;  4KKT A;  4CGY B;  4FF4 A;  1HXY D;  1H9R A;  5A2Q E;  3VYS A;  5CBA E;  3MFY A;  2WB1 B;  2MPM A;  4F88 A;  3H3V C;  5DEH A;  4F87 A;  3I4L A;  5ISR A;  3DUZ A;  1ESR A;  4G7Z C;  1S4Z A;  4A3E B;  2KQ3 A;  1RHP A;  1GUS A;  2K04 A;  3M3Y B;  1L0Y B;  2Z4H A;  1BUV T;  1PTO C;  4OL7 A;  5KYI A;  2K33 A;  2L11 A;  2OEO A;  4XT1 B;  1Y1V B;  1RCV D;  5LL6 S;  3OWF A;  1T5E A;  2QKI C;  5IGE A;  4LAA A;  5KYL A;  2D9U A;  1B53 A;  4ZKB B;  3SVM A;  4HCS A;  4BY1 B;  1SNC A;  3DEO A;  1LTI D;  4GZY C;  4DNR B;  1SJH D;  2KHS A;  1PFM A;  4C3I B;  2A5H A;  2NUC A;  2K5Q A;  1CZG A;  3NQI A;  3TSS A;  3KBG A;  4JK1 C;  1TWC B;  1I4R A;  3MC0 B;  4ZUJ A;  1QWY A;  1E2Z A;  5EPJ A;  2X6L A;  3K5M A;  2BA1 A;  1EWH A;  3NBH A;  1CTM A;  1PRT D;  3D4W A;  5CV6 A;  1V1O A;  3BS1 A;  4DFA A;  4IFD J;  4RHR A;  2F3W A;  1YNN D;  2PMZ B;  2RSO A;  2F0L A;  1WTO A;  3D4R A;  1HFN A;  3TME A;  4IUV A;  5CC4 A;  5EKK A;  5FO7 B;  3GO5 A;  5D14 A;  2VNU D;  5K36 H;  4JBW A;  3QJY A;  2XNA C;  3NTI A;  1D5M C;  1W6J A;  1BOS A;  1HUM A;  4HN7 A;  3MEH A;  5JEA J;  5I9P A;  4NW2 A;  1TQO A;  4IUT A;  4ZKC B;  1UEA B;  3H6M A;  2JE6 I;  1Q1B A;  4L63 B;  2EYO A;  1H9S B;  5CV5 A;  1JR0 D;  5DAU A;  1BDO A;  5CV4 A;  1AZP A;  2A74 C;  1VMP A;  4YIJ A;  4RA8 A;  4C1N K;  1HFG A;  2KVM A;  1ILP A;  1QB5 D;  3LWE A;  5LHY 1;  1OXT A;  3PV0 A;  4FYD A;  3NBI A;  2LFN A;  1R9T B;  4ULL A;  2F0O A;  5CR3 A;  1F9R A;  4C3H G;  4FP5 D;  1I4Q A;  3S2D B;  1EEF D;  1EY4 A;  2K03 A;  2X69 A;  3HOU B;  1I6V C;  2E75 C;  5M9O A;  4G57 A;  4LJZ C;  1HCZ A;  2QDB A;  3PUW A;  1MD2 D;  1D6E C;  5J22 A;  2K01 A;  5AFW A;  3GQB A;  3IL8 A;  1EY8 A;  4J8Q A;  4A3F B;  3T16 A;  3MHB A;  1EL0 A;  4NMZ A;  2DY8 A;  2HQE A;  4EVO A;  5KIX A;  4NP5 A;  1QNK A;  2IJ0 A;  2IW3 A;  4AYB B;  4DN4 M;  1PZJ D;  1BR9 A;  1DZ1 A;  1G6Z A;  1G29 1;  1FD7 D;  3C46 A;  3P75 A;  4OGQ C;  3VA7 A;  2L9H A;  1H9S A;  2ICI A;  4CJ1 B;  3I3C A;  1HHV A;  1EU3 A;  3FPU B;  3J81 L;  4TKO B;  5BN5 A;  2B2W A;  1OO9 B;  1Q12 A;  4K2L A;  3S15 B;  4V0B A;  4OO1 G;  3X3N A;  2A6H C;  2FIN B;  3GTO B;  5EBD A;  5EPL A;  4RFB A;  5F2D A;  5K5P A;  3R8B A;  4R9W A;  3NXW A;  1TWA B;  1RTO A;  2Q8I B;  1F9S A;  2EYM A;  1EQT A;  1F2L A;  4C3I G;  5I6Y A;  4KHV A;  1JC7 A;  3HOY B;  3PIP 3;  3JAM E;  1CM9 A;  3L9A X;  4U67 3;  3IKJ A;  1T5X D;  1JIC A;  1S5E D;  3HP3 A;  2K7V A;  1AFP A;  1G2S A;  4KI0 A;  1TS5 A;  2VUM B;  5I2Y A;  1TWH B;  2AQ1 B;  3E0J A;  5HUR A;  4HR7 B;  3W2D A;  2C5C A;  4A3I B;  3H09 A;  2D2C C;  1KLU D;  2EDG A;  4H7B A;  2WKD A;  1AP0 A;  3ND9 A;  2NWG A;  2JSO A;  3DWA A;  2EY5 A;  2KCC A;  1CZW A;  1A3V A;  3TZD A;  4DU9 A;  1ET6 A;  2RBM A;  1BXT A;  4CBV A;  4ZUI A;  1QE6 A;  3C2P A;  1VDZ A;  2PW7 A;  3GTL B;  1IW7 C;  1BCP B;  3DM1 A;  1F2Z A;  3IAY A;  2NB0 A;  1GJX A;  1QNU A;  1KLG D;  1MGS A;  2BCO A;  2F4I A;  2R92 B;  4IUQ A;  1G8Z D;  3D8G A;  2M2L A;  1JE4 A;  5TSS A;  5JVH 3;  4HAE A;  5KEE A;  3D4D A;  5KRU A;  3DWP A;  1XTC D;  1UNS A;  3SK4 A;  4F7X A;  1KDA A;  2F0E A;  2KEC A;  3BZD B;  3NUC A;  3TP6 A;  1HA5 A;  4QIW B;  1BCP F;  3A7A B;  2BOS A;  1LAB A;  3I4M B;  1LT6 D;  1X3P A;  4IFD G;  2Q8T A;  3MA2 B;  4ME5 A;  5M3M B;  2A68 C;  1ONL A;  2EYH A;  3TP7 A;  2RKS A;  2AQ2 B;  3UI2 A;  4R8I A;  4G7O C;  4XT3 B;  1VMC A;  4RGO S;  2BE5 C;  3CRK C;  4FF2 A;  1W6K A;  1JB3 A;  5J1Z A;  5JEA G;  1S5B D;  1D1I A;  2RVL A;  4B08 A;  1HQM C;  3QB3 A;  1A3U A;  1Y8P B;  3SK6 A;  2EY2 A;  1MBY A;  3S14 B;  4V19 0;  1OXV A;  1EY5 A;  3CRL C;  4TSS A;  3A8K E;  2Q8R E;  4RKB A;  5C5M A;  1YNN C;  5FLX E;  1F2Y A;  3NTH A;  4H13 C;  3T53 B;  2RA4 A;  5CV9 A;  3E5S A;  2J4X A;  1PZK D;  1TII D;  4QUC A;  4ZAI A;  4B9W A;  3J7A F;  1SDF A;  5E4W C;  1H9J A;  5IGF A;  2Z4I A;  1ZYR D;  5CYU A;  3QIA A;  5JOB A;  4DK1 A;  1HTP A;  2NVX B;  2XWJ B;  1YNJ D;  3I73 A;  3HOV B;  2EXZ A;  2FMM A;  1WTQ A;  2GA4 B;  1XXG A;  5M5X B;  4NDX A;  4O1N A;  5D65 A;  1CA6 A;  1RTN A;  4RWS C;  4OO1 I;  5IT9 L;  2F0P A;  4M8A A;  3M4O B;  5COR A;  2EE1 A;  2AUJ D;  2OXP A;  2A69 D;  1B9N A;  5IGC A;  1BCP D;  1NUC A;  4WJW A;  3RMH A;  3R2T A;  2MJ8 A;  5JEA H;  2PNR C;  4KKS A;  3SDZ A;  1GUO A;  5T1G A;  2E74 C;  3SK5 A;  2ZXO A;  4C3H B;  3J80 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...