5E3FA

Crystal structure of staphylococcal nuclease variant delta+phs i92k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e3fA00
1STGA 5CV7A 5IGFA 4OL7A 4EVOA 3QB3A 1RKNA 5CC4A 5CR3A 1KDCA 2SNSA 3OMGA 4PMBA 4DGZA 4KTAA 5DEHA 5IGDA 4F7XA 3MHBA 3EROA 2F0SA 3NUCA 1KDBA 2F3WA 3OSOA 3PMFA 2F0WA 2F0FA 3R3OA 4ODGA 4RKLA 5CV8A 5EKLA 3SHLA 5CGKA 1NUCA 1F2YA 2F0MA 5IGGA 4IALA 4N9PA 4PMCA 3BDLA 5EGTA 4N9TA 1SYGA 5C5MA 4ME5A 1EY8A 1A3TA 2EYLA 3P75A 4J1MA 4K8JA 4NDXA 1EY9A 5C3WA 2F0KA 4K2LA 3NK9A 2EY2A 5IGCA 4PNYA 1SNOA 5NUCA 4MIUA 5JOBA 4B9XA 1SNPA 1EY0A 1STNA 3EVQA 5IGEA 2F0LA 3ERQA 4KHVA 5CV4A 3MXPA 5J1ZA 5C4ZA 4KJOA 1F2MA 5J39A 5KRUA 1A2TA 2SOBA 4TRDA 2PYKA 1JORA 1STBA 3D4WA 3D8GA 4YIJA 3V2TA 4NKLA 4LAAA 1AEXA 4DF7A 1SYDA 2EY5A 3ITPA 4G57A 3TP7A 2F0GA 4K2KA 4H7BA 4KY6A 5DAUA 2PW7A 3S9WA 1EY7A 1EZ8A 3QOJA 1SYEA 4ZUIA 5C4HA 4ZQ3A 4E6IA 5J22A 4J6HA 4ID6A 2F0QA 5E3FA 5HURA 3NXWA 1ENCA 3NP8A 4KJNA 1SYBA 1STAA 2M00A 3OMCA 2PZTA 2F0NA 3OWFA 1EQVA 3D6CA 5HGTA 5CV5A 2RBMA 2SNMA 3MEHA 3NQTA 5EKKA 3TP8A 4KY7A 1U9RA 2F0HA 3DHQA 3NHHA 3H6MA 4B9WA 4ZUJA 1EYDA 1SNMA 3T16A 3DMUA 2F0IA 5C6AA 4RKBA 2EYPA 5IOCA 5CV9A 2OEOA 4F8MA 5JAVA 1SYFA 3VA5A 2F3VA 2PW5A 3MVVA 4K5VA 2O4XA 1SNCA 2F0UA 3LX0A 1KAAA 3RUZA 3C1EA 2RDFA 4EQOA 1F2ZA 5IODA 1EY6A 2ENBA 4KV6A 1TQOA 4KY5A 3SK8A 2PZUA 2KHSA 2RKSA 3P1HA 4R8NA 5ISRA 5C5LA 3C1FA 3EJIA 4HMJA 1SNQA 4I65A 4K14A 5CV6A 4NP5A 1ENAA 3MZ5A 3T13A 1EY5A 5KYIA 1EYCA 5K5PA 3SR1A 1IHZA 4KD3A 1TR5A 3QOLA 1STHA 4S3SA 5KGUA 4K8IA 3E5SA 5C3XA 4HMIA 2PZWA 2QDBA 2WACA 4K5WA 4WRDA 5KIXA 2EYOA 2EY1A 5E1FA 3TMEA 1JOQA 3SK6A 2OF1A 5I9PA 4QMGA 4K5XA 4NMZA 4QB4A 2EY6A 2F0DA 2F0OA 5F2DA 1EZ6A 4KD4A 1JOOA 4WORA 5IIFA 1A3UA 1A2UA 4DU9A 5I9OA 2PQEA 5I6YA 2F0PA 3HEJA 4QF4A 3SK4A 4EQNA 1SNDA 2EYFA 2OXPA 5M9OA 2F0TA 2EYHA 1STYA 5IGBA 5KYLA 1JOKA 2EYJA 2EYMA 2F0JA 4HTHA 4EQPA 2F0EA 3TP6A 1KABA 4IUNA 4K6DA 4DFAA 3D4DA 2KQ3A 1KDAA 1EYAA 1TT2A 2EXZA 2NUCA 1SYCA 3SK5A 2HQEA 5I6WA 5KEEA 3HZXA 1II3A 1EY4A 3BDCA 2F0VA 3SXHA 2LKVA 3TP5A 4IZ8A 3U9OA 1NSNS 1A3VA
chains in the Genus database with same CATH superfamily
4OL7A 1PFBA 2UUAQ 3DWAA 3CCLA 1UEAB 2K04A 2EOTA 1GHJA 5EGTA 1FGBD 5KNBA 2PI2A 4JV5L 4PG3A 1N34L 3D0FA 2RHSB 4JC0A 3RZDB 1HZAA 4JI5Q 4C2MB 5AFWA 4FXKC 2FXQA 5J39A 5KRUA 2OTLA 3V2TA 1BBXC 4HIOA 1O7YA 2LXKA 4JCVE 4KKSA 1SYDA 4UP7A 4GOPB 3TP7A 1GUTA 1HFGA 5EBDA 1Y1WB 1EY7A 5C0XJ 2KHJA 4JI2L 2SEBD 1K8GA 4DV4L 1ET6A 2AQ3B 3I3CA 2M00A 3BVZA 2WKDA 1V43A 1BOSA 3VR5A 3M3YB 1F77A 2L12A 3M4YA 5JVH3 4LJZC 4HJ9A 3A7LA 3I8ZA 3KLRA 3G71A 4F8MA 3ND8A 4A93H 4FF4A 3QWNA 3ULPA 1C8CA 4HJAA 1Q86C 1CZWA 4OWXB 4NXMQ 2ENBA 2E2HH 2C35B 2KHSA 4JPBW 5FJ8H 2XNAC 4IJLA 2VB3X 4K14A 2LXJA 3MZ5A 1E24A 1C9OA 2WB1G 2K28A 5C44G 1BCPD 5C3EH 4K8IA 5C3XA 1XJVA 1PYBA 2C5CA 2PZWA 2QDBA 1LABA 2A5HA 4H0LC 1EEID 2IX3A 2PPBC 1VQMA 2I07B 1R4PB 4UPAA 2R93G 1I6HB 1CI3M 4YWLA 1BVSA 1CUKA 2EYFA 2H1EA 2EYHA 5IT9L 5KYLA 1BR9A 4CDDC 1JWSD 2B8FA 4DNTB 3HZXA 5IYCH 2E2DC 4YCUA 3CC7A 2R7ZB 2A74C 3T4AC 2VUMH 3J81E 1SMXA 4HJ7A 2ZT9C 2FHTA 1K83B 1H9MA 4PMBA 4WJWA 4X64Q 1BO0A 1IL8A 3FKIB 1A6XA 3CMEA 1YHQA 2N78A 4JBWA 3CCEA 3KK7A 3T1HL 4IALA 5LL6X 1V1QA 4DR7Q 1MGSA 3PUWA 2EYLA 4ME5A 2F0KA 4HIMA 1ICFB 2XTIA 4ZK9B 1SNOA 4I7ZC 3MAQA 2ZJQA 1JWUD 3T51B 1S5ED 2C9OA 2RQXA 1DZ1A 3OW2A 2K32A 1CHPD 2X6LA 4FDBA 1DGSA 4KY6A 2NVYH 1TKWB 5EQ0A 3OOCA 2E5LL 2PQAB 1XYIA 3Q23A 2YTXA 4Y7NB 1Q8IA 4ZLTF 2XSCA 1S5DD 1STAA 1JT8A 1TIID 3X3NA 2B2UA 5HGTA 2LSSA 2HDMA 2KCTA 3MEHA 4A75A 3WDNA 4R4TA 3S24A 1X32A 5LMNQ 1SNMA 2G9HD 2B2YC 4IJHA 1XMOL 2AHOB 1NR2A 1VQFA 2NB0A 1D6EC 2JA8B 1ZXTA 2O4XA 3F2DA 3CD6A 2KECA 3VYSA 3H3VH 1I3QH 5ELOA 2KEEA 4JYAQ 1EY6A 2GVBA 2LY7A 2Y0SB 1HNXL 1NMGA 1Q7YC 1QUQB 1UWVA 1H9RA 3S1NH 1ENAA 1JE4A 4OO1I 4HEDA 3Q8DA 1BCPF 3QO2A 3GTLH 3FRPB 4QUCA 4POFA 3K59A 4HMIA 2TSSA 3NENA 1QZGA 5E1FA 4XQQA 1X3EA 4B3MQ 1EWCA 2K52A 3KDFA 1K0SA 1E2WA 2UUCQ 4LF5Q 4A93G 1N36Q 1E22A 1H9SB 3CPFA 5FK9C 1LT5D 2KOLA 4K0KQ 1N32Q 1KNEA 4O1NA 3V05A 2WINB 3KJPA 5FJ8G 4AYBG 2MQHA 1PH6A 4A3KH 1II3A 4B3SL 3F1ZA 4B3RQ 1AH9A 3KLSX 4DR6Q 2XVSA 3HG9A 1I5FA 4X3UA 4JI1L 1G91A 5C3EG 2CWAA 2K1BA 1C0AA 4F7XA 3NUCA 3CCJA 1LTBD 3SHLA 5EKLA 1QVFA 3S2HH 5D65A 1PYWD 2N88A 3HKSA 3NEMA 5NUCA 4DAYA 5HY6A 4BBSB 3DLLA 1STNA 4X3SA 2KBNA 5M5XH 3ERQA 1VQ8A 1SMYC 1JORA 1CA6A 1Y8OB 3M4OH 1X55A 3BZKA 4A3FH 2YTYA 2F0GA 3CCVA 1HNZQ 5IYCG 1Q12A 2E74C 5IYBH 1J8IA 1X3QA 2WV6D 2Z6BA 1A8VA 3UDXA 3H15A 2A68D 2VUMG 5A2QE 2WKCA 1ZEQX 3S1RH 3KFUA 1QILA 4KN7C 2MO1A 3TP8A 2BE5C 2DUDA 5EKKA 1VQOA 1KC8C 4I7AA 1G6PA 5FLMH 4KKTA 3DMUA 2AUJD 2I46A 4MNOA 4YY3Q 4DR4L 5CV9A 2OEOA 4LUZA 1SROA 4XT3B 1EWHA 1VQDA 1K73C 4G4KA 2Q8TA 1TWCB 1UNSA 1XNQL 1IYUA 4RMFA 1TQOA 1BDOA 4CDEC 3S2DB 4KN4C 4DK6C 3PO3B 1XMQL 3H0GH 2ASBA 2MPMA 1B50A 2VZAA 2UXDL 5KIXA 4DR1Q 2ZXPA 5AJ3L 5I9PA 4A3IH 5EAYA 1K8AC 1E2VA 3SVMA 1Y14B 3JAMc 3CCMA 1XX8A 1A3UA 4PQXA 4IPHA 4LF4Q 2L0CA 3R2IA 3S16B 1CKMA 2DJGC 1VQIA 1VQGA 2BA1A 2V4DA 3CW2C 1JCKB 3CU7A 2BH2A 3O13A 3MWYW 3K80C 5I6WA 2A6ED 3P7JA 3BDCA 3TEHB 3HS0C 3KJOA 3HOZH 3A8KE 4EVOA 1FVIA 3MXNB 5CC4A 1ASZA 4FF3A 4A3EH 1OXTA 3GTJH 1LACA 4LFBL 1KDBA 2F3WA 3CC4A 1YHBA 1VQ6A 4U68A 1HA6A 1D1KA 4PZ8A 2IJ0A 5C3WA 1KIXA 4BWGB 4KHPQ 4K8JA 3JC66 1M8AA 3AB9A 4IUTA 1JJ2A 4RCNA 3HOWH 1F2MA 1WTRA 4JI6Q 4XQNA 4L63B 3AMUA 1PH3A 1TWHH 1KD1C 4DF7A 2YV5A 3HOUH 4KLKA 1BXTA 2R6GA 3DM1A 4C1NK 1BCPC 1LTSD 2HHHQ 2UUAL 1SYEA 3KF6A 2NVXH 2D0PA 2K14A 3K5LA 1EL0A 3U50C 2KVMA 3OMCA 1KTKA 4P75A 3HOYB 1KNAA 2WP8J 4Q0FA 1QE6A 3KUPA 1G51A 3QJYA 1IZ6A 4LF7Q 2ZXOA 1HTPA 3W2DA 2QDLA 1AE2A 1PLFA 1RODA 2EE1A 5C44B 4R8IA 1OXXK 1UAPA 1ICWA 3LNNA 4K5VA 1IKMA 3OIPA 4X6AH 3I4MH 5FOBB 1Q46A 3M7NA 2PMZB 4A3FG 1CKNB 2R93B 1BQQT 2PZUA 3JAMi 2ZJPA 1LTTD 4IPCA 5KYIA 4XQJA 4C3JH 4DV1L 1IHZA 2B29A 2DNEA 5EBCA 1LUZA 5EPKA 1IBKQ 1ENFA 3ER0A 3I2ZA 4DK0A 3JAML 3C3LA 1O7IA 1WCMH 2K4KA 2UXCQ 5FLMG 1H9JA 1SE3A 4K5XA 4GKKQ 5LHY1 2F0OA 4X62L 5I2XA 4DNRB 1K28A 4XTCS 5IIFA 1IKLA 4DU9A 3G4SA 4NXML 2NZ1D 1RHPA 3J7AV 1E7ZA 2PMZE 2DY8A 3UI2A 4QIWB 3A56A 5C4XG 4HTHA 3TP6A 2XIWA 2I5MX 2K5QA 4RA8A 3D4DA 4JBMA 1FNWA 3J80c 2KUMA 1LTLA 2ZTDA 1B44D 4APVA 2LKVA 3ULJA 1Y1VH 1VMPA 1Z9FA 1HZCA 1QG7A 4IPGA 4DV7Q 4LFCQ 1EOVA 2SDFA 3GV3A 2IL8A 4IO9A 5CV8A 3OSOA 3GTOH 2F0WA 3BDOA 4A3BH 4RAUC 1Q82C 4A3IG 4OWTB 4MZ9A 5JPNC 1L1OB 1AFPA 3P20A 4HJ8A 3N52A 5C0XI 2KCNA 4QIWE 1JC7A 1ESFA 2IY5B 1NR4A 3HOXG 1LLRD 3RD4A 4ME3A 4G57A 2PQAA 1NTGA 3M4QA 5FO9B 3S9WA 3Q22A 3CCSA 5IP7H 3K5MA 4X64L 4TSSA 3CMAA 3AFQA 1ENCA 4DR7L 1O80A 2F0NA 5CV5A 5M3MG 1K3RA 2GA4B 4KY7A 2ZTEA 3TDQA 2K03A 3K6OA 3S15B 1CM9A 2AWOA 1Y69U 5IOCA 4XT1B 3QIAA 1YI2A 4UDUC 3HOWG 4OXPA 2K05A 2A6HC 3STBD 2B39A 1RF2D 3SK8A 1EQQA 2RKSA 1IBML 4BY7G 5ISRA 2JA6H 4C3HG 3HOVG 4ZKBB 1WYDA 5CV6A 4V190 3BU2A 4A93B 1TS2A 3ERSX 1PZJD 3J7ZC 1Z6HA 4CKBA 1B3AA 3CRKC 1PTOB 3IFDA 4Q5VA 1UEBA 3PF5A 5C0XG 4GNXA 4PZ6A 3J80i 3AQQA 4UP8A 4P71A 5LMNL 2FMMA 3U4VA 2E75C 2X69A 4OX9Q 1CHQD 1H9SA 1SRUA 4A3MG 3PIO3 4GOPC 1EU4A 3T1YQ 2R7FA 3J80L 2F0TA 4A3LG 4JYAL 1STYA 3VR6A 2QA4A 4GS3A 3KOJA 1KABA 1X6OA 2KQ3A 2RDHA 2NN6H 2Q2HA 4M8AA 1MJCA 4ZKCB 1HR0L 3CAMA 1PRTC 4U673 3DM3A 4L5QA 3BYYB 5CV7A 2XWBB 2RDGA 1GM5A 1S5BD 4B3ML 3GTPB 1EUJA 3TRZA 5LMUQ 4LMQD 4YHHQ 4RKLA 3U9OA 1V1PB 1WCMG 1DM0B 4LF5L 3P75A 1N36L 2VUMB 4DV3Q 3PV0A 4Z9CB 4EX5A 2YU9H 5H1SE 2GN5A 1GOZA 4B9XA 4K0KL 1VQ4A 2HIVA 3OWEB 3BG3A 1X3PA 4BBRH 3E9IA 2F1MA 1F2LA 1MHWC 1PZID 1Q1EA 1WFQA 2M9VA 1VQPA 4IFDH 2XRQD 1SXTA 1V1OA 1L0WA 5IWAQ 2YYZA 2Z4IA 5M5WH 4DR6L 1STEA 3PIPA 1Y1VG 2Q2UA 4QGUA 3MFGA 1SJED 1G2SA 3NXWA 3NP8A 1XTCD 4KJNA 1PH5A 5KNDA 2EQSA 4A3BG 1PA6A 4MN3A 1EYDA 4R4IA 4O42A 2VQEQ 3HKZB 5IP9G 1SFOH 1S5CD 1S4ZA 1FD7D 3MVVA 2L11A 2A6EC 4BA1I 1HNZL 3UE0A 3PO2B 4JK1C 4KV6A 4O0AA 4HIDA 1YHAA 2JA5H 2EVBA 3S17B 3KF6B 1DOMA 2VQFQ 1TWFB 3RZOB 3PQIA 3T56B 2EDGA 3J7YW 1QJOA 1I3QB 4A3JG 4A3CH 2UXBQ 2VY3A 3Q6SA 2EY1A 2EJGC 3SK6A 4YY3L 3HKZE 1BBWA 5IYDH 3S1NB 1R4QB 4DR2L 2IPKD 3I90A 1HFNA 3KYHC 3TREA 2JA7H 1ONLA 3SK4A 4LF6Q 3IRBA 5GAHC 4CKCA 5CBEE 1PFNA 1AZPA 4X66Q 1GUSA 1GD7A 1MBYA 4DK1A 3I4LA 4IUNA 3CQZB 4BY1H 1MJEA 3DXJC 3L9AX 2AMCB 3MXNA 1VF7A 4IZ8A 1A3VA 5CYUA 4DR1L 4RH6A 3GTMB 4ZCKA 5BN5A 1MSHA 2QKIC 3KBXA 3D6WA 3HP3A 2ICIA 3PGZA 1WOCA 5GAEC 4AQYQ 1BUVT 1IXRA 1CQFA 4CGYB 3ND9A 4FXGC 2MJ8A 2O5IC 2MFIA 1E0BA 2D0OA 3S14B 5CMDA 3S1MB 3J81c 5J1ZA 1EIGA 1A2TA 1YNND 2PYKA 3SE0A 1STBA 3I7FA 4DUZL 3KF8A 1LT6D 4ABNA 1B3QA 3NSWA 1QVGA 3GTQH 3CPWA 3QOJA 4ZUIA 4ZQ3A 1X9NA 2EXDA 4DV6Q 2CQOA 3UE1A 2NVQH 1TY2A 2DY7A 4A3DH 2E2IH 2OQ0A 4HSVA 4WJ3M 2L1BA 3GTKB 2E2JH 1IW7D 1ILPA 3TN2A 2B2TA 1AZQA 1AN8A 5I4DA 2JQOA 2KENA 3IKJA 2Z6KC 4BBRG 4KI0A 1CKNA 1GUOA 2N55A 2O2LD 1S72A 3TS2A 3MEFA 1F2ZA 2PO4A 2V1CC 3KBGA 4R4QA 1BKBA 3MFYA 1I50H 4HMJA 4CKEA 5TSSA 2B2WC 1PTOD 2MO0A 2ZJRA 1XTDA 1T9HA 5EJWA 4S3SA 5KGUA 5C4XB 3E5SA 1TU2B 2Q2IA 2B2VA 2EYOA 5ELCA 4LF7L 5JJIA 2B63H 4B3TQ 3FDTA 1I94L 2HD3A 4DR3Q 2HT1A 4HN7A 1NE3A 1RIPA 3WOFA 1FR3A 4QL5A 4QF4A 5GROA 1CKOA 3ULLA 2N8NA 1SJHD 2XWJB 5T1IA 1Y1WH 4X65Q 4GZYC 3ZYYX 1SE4A 2RCFA 4A3IB 4MHEA 1KDAA 2F4VQ 2E76C 1YNJC 3PF4A 4JW0A 2I5HA 2UU9Q 3MXGA 3CKIB 3J81i 4QCLA 5K36H 1IBKL 1TWGB 3HFZB 1VQHA 4GNXB 4DXFA 2UXCL 1XNRQ 3M3YH 4A3CG 3HOXB 2MGSA 1GUNA 3EROA 4GKKL 1LYLA 4CBVA 1J5EL 1L1OA 2IHFA 4DV0Q 3Q0AA 4N9TA 2OCEA 3J81L 4NDXA 5DLQE 1LO5D 2Y0SE 1JICA 3NK9A 4C3IH 5ELNA 2JA7G 2CWPA 4JOIA 2JEBI 2PNRC 3STBC 3J7AF 5M3MB 3C46A 1HNWL 2JE6I 4RHRA 4LNQA 4DN4M 1KLUD 3I55A 1XPOA 2WAQG 4LFCL 3E3XA 2ZM6Q 4CDFC 5C4HA 4E6IA 2RF4A 1N9WA 2F0QA 1HTLD 4TQUS 1TWHB 1FL0A 1WD0A 3D6CA 2QGQA 4IFDJ 4BY7B 4FVMA 4ALPA 1VQ9A 3DEPA 4IPDA 4C3HB 3HOVB 5C6AA 2CW0D 2NTTA 2R92H 3GDEA 1SLJA 2PW5A 4QUFA 1LTID 1LV9A 1U4PA 2DJFC 4FYDA 5C4JB 3X3MA 1IBLQ 3H3VI 1EFID 2R7ZH 3RN2A 4JV5Q 1SEBD 3G6JB 2EJFC 4DR5L 2H5XA 5ELBA 4GLXA 1PTOF 4A3MB 2JK8A 2RA4A 4P72A 2MNAA 3FKIH 1EYCA 4JI3L 4YCVA 5A35A 2DN8A 4DAMA 1CT1D 4GKJQ 3TMEA 4UY8C 4JI7L 1SE8A 1PH1A 4QB4A 1CFMA 4JI2Q 4OIKA 3UDFA 2PNHA 2KEDA 5I6YA 2F0PA 3HEJA 4HAEA 1B70B 1WCMB 1Q8KA 1BBUA 3FPUB 3B6YA 5D14A 1KRSA 2RSOA 2NUCA 1LTGD 2XGTA 2L55A 1Y8PB 2LMCB 4Y7NH 1WTXA 4OGQC 1OXVA 1QVCA 2ID0A 3SEBA 5M5YB 3TP5A 5CV4A 1NSNS 2K5WA 5JJLA 1V1PA 1EWIA 3I91A 4HJ5A 3M7GA 2B63G 3PIP3 4KMUC 2I5LX 1AW7A 2JA8H 3K0YA 1TXYA 3A54A 4LUOA 3BVMA 4PNYA 3BZDB 4A4IA 2GVAA 3IL8A 3U58A 3E6ZX 5DNFA 4IQZA 4KJOA 1L0XB 1Y1WG 3E9HA 4DV2L 4LWCA 1F9PA 2B2UC 1GKHA 1HHVA 4UHVA 1SE2A 4K2KA 2E8GA 1MSGA 4JI8L 5G3LD 3K7UC 5EPJA 5LMUL 1EQRA 1H9KA 3JAME 3CP0A 4G7HC 1SYBA 1HQMC 2CKZB 1SSOA 2RBMA 1XPUA 4DV3L 4HCEA 1Q90A 4B9WA 3H09A 2B3GA 4C3IG 5FO7B 2UUBQ 2QCPX 2VW9A 3NTHA 2RCNA 3DEOA 5JAVA 4A3JB 2F3VA 4A3KG 1KXLA 3KF8B 2AQ2B 2A69D 3UDIA 2I0QA 2AQ1B 2HCIA 3P1HA 4JI0Q 3C1FA 3EJIA 2MP1A 1JB7A 3H94A 4NP5A 1M90C 1DD2A 1CA5A 5K5PA 3SR1A 2HDLA 1L1OC 1TY0A 4DV5Q 1J9OA 5JJKA 4JI5L 3OTOQ 1PZKD 2WB1B 4FNFA 4PMWA 4C56C 2E5LQ 1TWAB 4QMGA 3FHWA 2NZOA 4JOIC 2NVTB 2JEAI 1D5XC 1WTHA 3K0XA 1I4XA 2R92G 1U5KA 1QZHA 1YNNC 3RMHA 3I73A 5GADC 5E4WC 5IGBA 2F0JA 1DOKA 4EQPA 5IYBG 1Q1BA 3DUZA 4A76A 1XMOQ 1A62A 4DK3C 3VYUA 3RLFA 3EQLC 4P74A 3A5UA 1FYCA 2UXBL 1ESRA 1CSQA 3QB3A 1KDCA 2WB1E 4X3TA 1HNXQ 3NTIA 1GO3E 5L37A 3I56A 3S1QB 4OELB 1QB5D 2F0MA 1YVCA 1U4LA 2TMPA 4LF6L 4K2LA 2AUKA 1TWCH 1B9MA 5IGEA 1FGUA 1RTOA 1C7YA 4KKUA 1R9TH 1SAPA 3TS0A 5C4ZA 1ZYRD 3S2DH 3D4WA 4YIJA 3H0GG 1PTOC 1TVXA 3K58A 3ITPA 5DAUA 4H7BA 2YU9B 5G3LF 2BH8A 3TSSA 4RGTA 5FLXc 5J22A 1F9RA 1O78A 5D3DA 1FNVA 4HSPA 2PZTA 1EQVA 5ELEA 3VR4A 2F4IA 3VA7A 3G48A 3NQTA 4B3SQ 4HR7B 2EZVA 1UE7A 1U9RA 3QR8A 1X3GA 3A8JE 1NJIC 4JI1Q 1SR3A 1QCBD 3L3OC 3F2BA 3VA5A 2WIIB 1E3PA 2HQLA 2AWNA 2K75A 1D5ZC 1YEZA 3HOZG 1I6VC 3U4ZA 3DWPA 4A3EG 4DV6L 1VQ7A 4GLVB 4FXDA 3MC0B 4DAVA 2BCOA 2H4OA 5JPMC 4G7ZC 4H44C 3H91A 1DYQA 1HZBA 1O7LA 3BVGA 1JWMD 4HIKA 4OWWB 1MD2D 2D2CC 2F0DA 5GQOA 2JXMB 4DXGA 1WTQA 4B08A 3HOUG 4EGVA 3EBEA 1JOKA 3VYTA 4IUUA 2K5VA 4DFAA 1UE5A 1CSPA 1SYCA 5M3FH 4TKOB 5KEEA 4BA2I 4RGMA 4RWSC 1LT3D 2E2HB 3HOYH 1XNQQ 4JG2A 4AYBB 2CHBD 1PHJA 3RLOA 4B3TL 1WTOA 4DR3L 5C5MA 2FMCA 3LWUA 3MA2B 2CW0C 1CQVA 1BNZA 5C3EB 5C44H 2WAQB 3BDLA 1VQNA 3D31A 3I4MG 1AP0A 1XXGA 4CHTB 4POGA 1E1OA 4X65L 3EVQA 2A68C 2R93H 1YJWA 5AJ3Q 2F4VL 4TRDA 5GAGC 4C3JG 4L6TB 1EEFD 5FLXL 4RFBA 2EY5A 1NMFA 2G5DA 3OIQA 3DWQA 4CDCC 4AYBE 1XNRL 1SMYD 5D3IB 5ELFA 4IN3A 4JI4Q 2UUCL 4UP9A 2WAQE 2K5HA 4DV0L 3TQYA 3RN5A 2F0HA 2QF7A 1N32L 1EIYB 5CGKA 1P16A 3I4OA 1K8OA 1HA5A 5LMNW 1PH4A 4LFBQ 4RHSA 4B3RL 4LF9Q 1PH7A 1SNCA 4AH6A 2LS01 1KAAA 1VMCA 1PFMA 3C1EA 3NPPA 3R2TA 3SGIA 4L5SA 2E2JB 2ZM6L 1QOHA 1EQTA 2B2YA 4H13C 5T1GA 1IL2A 1RTNA 2L4NA 1UE6A 1QNKA 4KD3A 2NVYB 2FINB 3NBIA 1HR0W 1NBWA 3FPPA 5IT9E 2OF1A 1HH2P 1I50B 1D7QA 1J6QA 3BYTB 2EY6A 1W3SA 1MKHA 3CC2A 1OXUA 5M9OA 4CJ0B 1WI5A 1GUWA 4QQBX 1IBLL 3K7AH 3ZJYC 2B63B 2EYJA 1I4QA 5IP7G 3KLSA 1EYAA 1TT2A 1NCVA 2CH4A 3SK5A 3EFXD 4DKAC 3SXHA 2NN6I 1LT4D 1RD9D 1AE3A 4NXNQ 3A0JA 5IGFA 4GKJL 4FP5D 3HRZC 3R3OA 4ODGA 3S15H 2F0FA 3GTLB 1EIHA 1F2YA 1W6JA 1WTWA 1WJJA 4XYOA 4DA2A 1D8LA 1EY8A 4DV1Q 2VB2X 4J1MA 3OYYA 1PRTB 1WVLA 1V9PA 5IGCA 3K5NA 2HUGA 3KLWA 2NTSA 5DM73 2A69C 4KK7A 2F0LA 2K7VA 4LK1C 2YTVA 5JVG3 2JA6G 1NY4A 2SOBA 4JVZA 3RR5A 4X62Q 5M3FG 1Q3LA 4IFDI 1U0LA 2QW7A 1TS5A 4L8JA 4C3IB 2K01A 4GN3B 4OONA 1PTOH 1EZ8A 1QWYA 3LWEA 5IY0A 3HOYG 1IYJB 3EA6A 1S40A 4J6HA 4ID6A 4A3KB 4IUVA 5BR8Q 4LF4L 3OWFA 1EIFA 1SBBB 3UDGA 3DHQA 3A5ZB 4LW1A 2NZHA 4MTNA 1YIJA 4GLAC 2KCMA 3WWVA 1RCVD 5J3BA 5DM63 3CCRA 3VDYA 3RLNA 3J7A5 1PYSB 4DAPA 1VQJA 3AFPA 3S2HB 2NN6G 1L2FA 2KHIA 1B2TA 1KL9A 4A3GH 2F0UA 1X65A 2ALYB 3GP7A 5M5XB 1DONA 4GNXC 3GTGH 3W1GA 4OO1H 2R92B 3VR3A 1N33Q 3M4OB 3T13A 3GTPH 3D4RA 1EY5A 3I4NH 1K3BC 4A3FB 2MHVA 4KHPL 1TR5A 1EU3A 2L9HA 2Z0SA 4ZRZA 2WACA 4WFN3 2O5JC 5CBAE 1RDPD 3J81j 5FKAC 3AEVA 1YNXA 2UUBL 3S1RB 3PUYA 4JI6L 1HXYD 3CCUA 1JOOA 1T5XD 1ZYRC 4IFDG 1A2UA 1B9NA 2PQEA 5JEAH 2HHHL 2EPBA 3NBHA 4C1NI 4R9WA 4JI0L 4XIGS 3L7ZC 1JE5A 1D2BA 3G6EA 2F0VA 2VL6A 1VQLA 1NAPA 3L0OA 4DV5L 1K8MA 2JN4A 5E3FA 4DUYQ 3OTOL 1K0RA 5CR3A 2SNSA 3OMGA 3RZDH 1V8QA 4CJ1B 1HZ9A 4J15A 3H0GB 3PMFA 4C2MH 1IBMQ 1X56A 4XDXA 4ZYSA 1Y8NB 4N9PA 1RJTA 4PMCA 1WTVA 1SYGA 3SDZA 3GD7A 3L2PA 4X3KA 3W5OA 1SNPA 3PO2H 2FJ2A 1HJPA 1KAWA 3AYHB 2BOSA 2HIXA 2JA5G 1FJGQ 2N49A 2Z9HA 3EIVA 3S17H 2Q2TA 4P2CB 1HRJA 1TWFH 3RZOH 1GHKA 3OPOA 4NW2A 2J0TD 2PW7A 3NWSA 2R61A 3FEWX 3EN2A 5IYDG 1E1TA 1YJNA 5HURA 1ZKOA 4F88A 3HOZB 3IAYA 4LF8Q 2SNMA 1HR0Q 4A3EB 4FO2A 2A8VA 1IYVA 3GTJB 3G7LA 3PSIA 3T16A 5BN4A 2F0IA 1RL2A 1M1KC 2R3ZA 3HGBA 3BS1A 3PUZA 4K6LA 1VS0A 3CQZH 3GV6A 1SYFA 1B1ZA 2NYZD 4BY1G 1EFWA 2CVRA 4IUQA 3F8TA 3NELA 2XN9C 4DV7L 3TBIB 4RGOS 1KHIA 3Q24A 3HOWB 1PVOA 3K81C 1JJGA 1S3OA 3GTMH 1F9QA 4LFAQ 3TZUA 1I6HH 1D1IA 3HOUB 3FP9A 4RCOA 3PUXA 2A6HD 1HUNA 2Z1CA 2EIFA 4NB3A 1GXDC 1VQAA 1YBYA 4L5TA 2NVXB 1I4HA 1JOQA 3GO5A 2K50A 4XYQA 3PIOA 1JMCA 3S14H 2VS1A 3S1MH 2N3SA 3CF5A 1K9MC 3NTKA 3BJUA 4EQ5A 2QEJC 1LTRD 4EQNA 1SNDA 2OXPA 1PDQA 1N34Q 4RGNA 4A3GG 4FF1A 1K83H 2BDNA 2F03A 4IUPA 4ZAIA 1U4MA 2EXZA 2JSOA 4OHJA 2HQEA 4OO1G 3I4MB 1EY4A 1KRTA 3I4NG 1G291 4A3DG 1ET9A 1C48A 4TVAB 1LTAD 4Y52H 3MHBA 4C3JB 3GTKH 2JJQA 2F0SA 4DV4Q 1NUCA 1PRTD 2ICEC 2PCFB 5JJZA 3A74A 1A3TA 1XWEA 2L5TA 1EY9A 1G8ZD 4AIMA 2EY2A 1B7YB 3OW7A 5JOBA 1EY0A 5JEAG 1CZGA 1DXMA 4LUVA 4KHVA 2R7DA 1B53A 4DR2Q 1PV4A 3GQBA 4DPGA 1KQSA 4NKLA 4LAAA 2KA7A 1CK1A 3OHXC 4BS9A 5C4XH 1G6ZA 4ULLA 1VQ5A 2ZTCA 1R9TB 4OX9L 2D5DA 2B2TC 1B8AA 1Y1VB 3T1YL 3PCOB 1I4RA 3HKZG 1PMRA 4J8QA 3NHHA 1DOLA 1BF4A 2PI2E 3GTOB 1A0IA 2EYPA 1WD1A 1HPCA 4A3BB 4YWKA 3PO2G 2QILA 5E7NA 4NPSA 4BXXH 2ATWA 3FMCA 2VXWA 3K57A 3LX0A 2ES2A 1UE1A 2A19A 5BN3A 4EQOA 4R4CA 3V96A 2K5NA 5K36G 3E0EA 2B2VC 2IHEA 4YHHL 1TWGH 4IOAA 1SN8A 1PH9A 3E0JA 3HOXH 3R93A 2IX0A 3IFTA 4JI4L 1HUMA 1STHA 2LFNA 4OEMB 4DUZQ 1UUPA 5A2QL 4YWMA 4F87A 4V0BA 4DNIA 2D9UA 2MUYA 5F2DA 4KD4A 5IWAL 3T1HQ 4IURA 2Q8RE 3MTSA 4LF9L 2HCCA 3URYA 1KLGD 5M3MH 3K5OA 1I4GA 1OXSC 2X6GA 3ONAB 2F0EA 2RHQB 2IW3A 2Z4HA 4PZ7A 2D62A 2Q8IB 2OTJA 3FVQA 4GOPA 1S5FD 1GVPA 2RSNA 1DJRD 2DGYA 1D5MC 1VQCA 2J4XA 4QY7A 5EPLA 4IOCA 2OWOA 1STGA 4BY7H 2JA6B 2VQEL 4FF2A 5JEAJ 5IGDA 2IX1A 4KTAA 4C3HH 1VF5C 1WTPA 3HOVH 3ICEA 4BBSH 2B8GA 1A63A 4N8X1 5M3FB 1PRTF 4MTKA 3R8BA 5COYA 5IGGA 5IE8A 1HCZA 2CQAA 3A7AB 3M9BA 5C0XH 1PH2A 1CTMA 3CHBD 1PH8A 5C4JH 2R7ZG 1VQEA 1X54A 2VQFL 1X3FA 1EOTA 3NBHB 1I94Q 3F2UA 4A3MH 2XRSD 3FKIG 2EJMA 3W3AA 1AEXA 2DNCA 3C2PA 1VQKA 4A3LH 4NXNL 2A1AA 3U9SA 2QEXA 1OTCA 2K5DA 1SDFA 4L5RC 1ILQA 1IW7C 2WFWA 1PFSA 1LM0A 2BA0A 3K8AA 1T5EA 3F2CA 1O7ZA 1VQBA 4X66L 3MXUA 1YJ9A 2K6AA 3H6MA 4G7OC 2AKWB 4GN4B 4RKBA 4XXEA 4YCWA 2A73B 1GJXA 3PO3H 3AU7A 1J5EQ 1TS4A 3VYRA 2Z8LA 5FO8B 2RDFA 3T53B 5M5YH 4R1JA 1DCZA 2FFKB 4R8NA 5CORA 4BBRB 3CXCA 1JQYD 4I65A 1SNQA 1N8RC 5BR8L 3NE5B 4GN5A 2CH4W 5M5WB 4AQYL 3QOLA 4UAIA 1TS3A 3S16H 1HNWQ 5E4XA 2JA8G 4WRDA 1L0YB 1W6KA 3QG1A 3J80E 1BCPB 3TZDA 3RNUA 4NMZA 4CJ2C 2Y0SG 1C4QA 4JBJA 3KDFB 1EZ6A 3I72A 4WORA 1H95A 2CCZA 1PXUA 1U4RA 2K33A 4BXXG 5FLXE 3M85A 3WOEA 2EYMA 3BZCA 2F52A 5IP9H 1SFOB 1ASYA 1N33L 2NWGA 1JR0D 5HGQA 3D3RA 2OT2A 2OQKA 3K7AB 2JA5B 1RKNA 3NWTA 1HQRD 4DGZA 5DEHA 3VR2A 4O2DA 4DR5Q 5LL6S 1YNJD 2IWHA 1Z47A 5KNCA 4A3JH 4QJFA 4JI3Q 3CCQA 1VCIA 1W2BA 4MIUA 2JA9A 4ILWA 4DR4Q 1QNUA 3MXPA 4JI7Q 4DAYB 2VNUD 2ZXRA 2JA7B 3D8GA 2M2LA 4KHZA 2CFMA 1EYGA 5I2YA 3N6RA 4DUYL 1OO9B 2NBFA 1QUQA 3NQIA 4BY1B 1XMQQ 4BBSG 1TWAH 2IT1A 2P5ZX 3M4PA 3A8IE 2NVTH 1JB3A 3PUVA 5IODA 2UXDQ 4N8FA 1YZ6A 3A55A 1FNUA 4ZUJA 1ML0D 2JYOA 2KCCA 1E2ZA 2L15A 1FJGL 4WJ4A 1A15A 2UU9L 3H3VC 1JJCB 1MI2A 1NNXA 3RUZA 2KJXA 4P73A 4H02A 4KY5A 1Z7TA 5C5LA 2Z6KA 3S1QH 3LGJA 3GTQB 4A3GB 4DV2Q 4LF8L 4K5WA 3GTGB 2RVLA 1XPRA 4JI8Q 2NVQB 5ELDA 2B2WA 3I4NB 1Q81C 1VDZA 2JP1A 1G2TA 4A3DB 2BE5D 4PV1C 5EKIA 3PO3G 5I9OA 2E2IB 1MIUA 4HCSA 2BDOA 4M1UB 4R4OA 4JBKA 1M4VA 4K6DA 1F9SA 3W1BA 4RG1A 2G9DA 4LFAL 1B4OA 5IT9c 3I70A 2F3IA 2J7ZA 1GUGA 1I4PA 1YITA 1P8LA 4OIJA 3CRLC
chains in the Genus database with same CATH topology
4OL7A 1PFBA 3DWAA 1UEAB 2K04A 2EOTA 1GHJA 5EGTA 1FGBD 5KNBA 3RZDB 4C2MB 5AFWA 4FXKC 5J39A 5KRUA 3V2TA 1BBXC 1O7YA 4KKSA 1SYDA 3TP7A 1GUTA 1HFGA 5EBDA 1Y1WB 1EY7A 5C0XJ 2SEBD 1ET6A 2AQ3B 3I3CA 2M00A 3BVZA 2WKDA 1V43A 1BOSA 3VR5A 3M3YB 1F77A 2L12A 3M4YA 5JVH3 4LJZC 3A7LA 3I8ZA 3KLRA 4F8MA 3ND8A 4FF4A 3QWNA 1C8CA 1CZWA 2ENBA 2KHSA 2XNAC 2VB3X 4K14A 3MZ5A 2K28A 1BCPD 4K8IA 5C3XA 2PZWA 2C5CA 2QDBA 1LABA 2A5HA 4H0LC 1EEID 2IX3A 2PPBC 2I07B 1R4PB 1I6HB 1CI3M 2EYFA 2H1EA 2EYHA 5IT9L 5KYLA 1BR9A 1JWSD 2B8FA 4DNTB 3HZXA 2E2DC 2R7ZB 2A74C 3T4AC 3J81E 2ZT9C 2FHTA 1K83B 1H9MA 4PMBA 4WJWA 1BO0A 1IL8A 3FKIB 1A6XA 4JBWA 3KK7A 4IALA 5LL6X 1MGSA 3PUWA 2EYLA 4ME5A 2F0KA 4ZK9B 1SNOA 4I7ZC 3MAQA 1JWUD 3T51B 1S5ED 2C9OA 2RQXA 1DZ1A 2K32A 1CHPD 2X6LA 4KY6A 1TKWB 5EQ0A 3OOCA 1XYIA 3Q23A 4Y7NB 1Q8IA 4ZLTF 2XSCA 1S5DD 1STAA 1TIID 3X3NA 2B2UA 5HGTA 2HDMA 3MEHA 3WDNA 1X32A 1SNMA 2G9HD 2B2YC 1NR2A 2NB0A 1D6EC 2JA8B 1ZXTA 2O4XA 2KECA 3VYSA 2KEEA 1EY6A 2LY7A 2Y0SB 1H9RA 1ENAA 1JE4A 4OO1I 4HEDA 1BCPF 3QO2A 3FRPB 4QUCA 3K59A 4HMIA 2TSSA 5E1FA 4XQQA 1EWCA 1E2WA 1H9SB 5FK9C 1LT5D 2KOLA 1KNEA 4O1NA 3V05A 2WINB 1II3A 3KLSX 2XVSA 3HG9A 4X3UA 1G91A 2K1BA 4F7XA 3NUCA 1LTBD 3SHLA 5EKLA 5D65A 1PYWD 2N88A 4DAYA 5NUCA 4BBSB 1STNA 4X3SA 3ERQA 1SMYC 1JORA 1CA6A 1Y8OB 2F0GA 1Q12A 2E74C 1J8IA 1X3QA 2WV6D 2A68D 5A2QE 2WKCA 1ZEQX 1QILA 4KN7C 3TP8A 2BE5C 5EKKA 4KKTA 3DMUA 2AUJD 2I46A 5CV9A 2OEOA 4XT3B 1EWHA 4G4KA 2Q8TA 1TWCB 1UNSA 1IYUA 1TQOA 1BDOA 3S2DB 4KN4C 3PO3B 2MPMA 1B50A 5KIXA 2ZXPA 5I9PA 1E2VA 3SVMA 1XX8A 1A3UA 4PQXA 2L0CA 3R2IA 3S16B 2BA1A 2V4DA 1JCKB 3CU7A 3O13A 3MWYW 5I6WA 2A6ED 3P7JA 3BDCA 3HS0C 3A8KE 4EVOA 5CC4A 4FF3A 1OXTA 1LACA 1KDBA 2F3WA 4U68A 1HA6A 1D1KA 2IJ0A 5C3WA 4BWGB 4K8JA 1M8AA 3AB9A 4IUTA 4RCNA 1F2MA 1WTRA 4XQNA 4L63B 3AMUA 4DF7A 1BXTA 2R6GA 3DM1A 4C1NK 1BCPC 1LTSD 1SYEA 3K5LA 1EL0A 2KVMA 3OMCA 1KTKA 3HOYB 1KNAA 2WP8J 4Q0FA 1QE6A 3KUPA 3QJYA 2ZXOA 1HTPA 3W2DA 1PLFA 1RODA 2EE1A 5C44B 4R8IA 1OXXK 1UAPA 1ICWA 3LNNA 4K5VA 1IKMA 3OIPA 5FOBB 3M7NA 2PMZB 2R93B 1BQQT 2PZUA 1LTTD 5KYIA 4XQJA 1IHZA 2DNEA 5EBCA 5EPKA 1ENFA 3JAML 4DK0A 3C3LA 1H9JA 1SE3A 4K5XA 5LHY1 2F0OA 5I2XA 4DNRB 5IIFA 4XTCS 1IKLA 4DU9A 2NZ1D 1RHPA 3J7AV 2DY8A 3UI2A 4QIWB 3A56A 4HTHA 3TP6A 2XIWA 2K5QA 4RA8A 3D4DA 1FNWA 2KUMA 1B44D 2LKVA 1VMPA 1QG7A 2SDFA 3GV3A 2IL8A 5CV8A 3OSOA 2F0WA 3BDOA 4RAUC 5JPNC 1AFPA 3P20A 3N52A 5C0XI 2KCNA 1JC7A 1ESFA 1NR4A 1LLRD 3RD4A 4G57A 5FO9B 3S9WA 3Q22A 3K5MA 4TSSA 1ENCA 1O80A 2F0NA 5CV5A 2GA4B 4KY7A 3TDQA 2K03A 3K6OA 3S15B 1CM9A 2AWOA 1Y69U 5IOCA 4XT1B 3QIAA 4UDUC 2K05A 2A6HC 2B39A 1RF2D 3SK8A 2RKSA 5ISRA 4C3HG 4ZKBB 5CV6A 4V190 4A93B 1TS2A 1PZJD 1Z6HA 4CKBA 1B3AA 3CRKC 1PTOB 3IFDA 4Q5VA 5C0XG 2FMMA 2E75C 2X69A 1CHQD 1H9SA 3PIO3 1EU4A 3J80L 2F0TA 1STYA 3VR6A 1KABA 2KQ3A 2RDHA 2NN6H 4M8AA 4ZKCB 1PRTC 4U673 3BYYB 5CV7A 2XWBB 2RDGA 1S5BD 3GTPB 4LMQD 4RKLA 3U9OA 1V1PB 1DM0B 3P75A 2VUMB 3PV0A 4Z9CB 1GOZA 4B9XA 3OWEB 3BG3A 1X3PA 2F1MA 1F2LA 1PZID 1Q1EA 2M9VA 4IFDH 2XRQD 1SXTA 1V1OA 2YYZA 2Z4IA 1STEA 3MFGA 1SJED 1G2SA 3NXWA 3NP8A 1XTCD 4KJNA 5KNDA 4MN3A 1EYDA 4O42A 3HKZB 1S5CD 1S4ZA 1FD7D 3MVVA 2L11A 2A6EC 4BA1I 3PO2B 4JK1C 4KV6A 2EVBA 3S17B 1DOMA 1TWFB 3RZOB 3T56B 2EDGA 3J7YW 1QJOA 1I3QB 3Q6SA 2EY1A 2EJGC 3SK6A 3S1NB 1R4QB 2IPKD 3I90A 1HFNA 1ONLA 3SK4A 4CKCA 5CBEE 1PFNA 1AZPA 1GUSA 1MBYA 4DK1A 3I4LA 4IUNA 3CQZB 3DXJC 3L9AX 3MXNA 1VF7A 4IZ8A 1A3VA 5CYUA 4RH6A 3GTMB 5BN5A 1MSHA 2QKIC 3KBXA 3D6WA 3HP3A 2ICIA 1BUVT 1CQFA 4CGYB 3ND9A 4FXGC 2MJ8A 2O5IC 1E0BA 3S14B 5CMDA 3S1MB 5J1ZA 1EIGA 1A2TA 1YNND 2PYKA 3SE0A 1STBA 3KF8A 1LT6D 4ABNA 3NSWA 3QOJA 4ZUIA 4ZQ3A 1TY2A 2DY7A 4HSVA 2L1BA 3GTKB 1IW7D 1ILPA 3TN2A 2B2TA 1AZQA 1AN8A 5I4DA 3IKJA 4KI0A 1GUOA 2N55A 2O2LD 1F2ZA 2PO4A 3KBGA 3MFYA 4HMJA 4CKEA 5TSSA 2B2WC 1PTOD 5EJWA 4S3SA 5KGUA 5C4XB 3E5SA 1TU2B 2B2VA 2EYOA 5ELCA 3FDTA 4HN7A 3WOFA 1FR3A 4QF4A 1SJHD 2XWJB 5T1IA 4GZYC 3ZYYX 1SE4A 4A3IB 4MHEA 1KDAA 2E76C 1YNJC 3MXGA 3CKIB 4QCLA 5K36H 1TWGB 4DXFA 3HOXB 2MGSA 1GUNA 3EROA 4CBVA 3Q0AA 4N9TA 3J81L 4NDXA 1LO5D 1JICA 3NK9A 2JEBI 2PNRC 3J7AF 5M3MB 3C46A 2JE6I 4RHRA 4DN4M 1KLUD 5C4HA 4E6IA 2F0QA 1HTLD 4TQUS 1TWHB 1WD0A 3D6CA 4IFDJ 4BY7B 4FVMA 3DEPA 4C3HB 3HOVB 5C6AA 2CW0D 2NTTA 2PW5A 4QUFA 1LTID 1LV9A 1U4PA 4FYDA 5C4JB 3X3MA 1EFID 1SEBD 3G6JB 2EJFC 5ELBA 1PTOF 4A3MB 2RA4A 1EYCA 5A35A 2DN8A 1CT1D 3TMEA 4QB4A 1CFMA 4OIKA 2KEDA 5I6YA 2F0PA 3HEJA 4HAEA 1WCMB 3FPUB 5D14A 2RSOA 2NUCA 1LTGD 2L55A 1Y8PB 2LMCB 1WTXA 4OGQC 1OXVA 3SEBA 2ID0A 5M5YB 3TP5A 5CV4A 1NSNS 2K5WA 1V1PA 3I91A 3M7GA 3PIP3 4KMUC 1AW7A 3K0YA 3A54A 3BVMA 4PNYA 3BZDB 3IL8A 3E6ZX 5DNFA 4IQZA 4KJOA 1L0XB 1F9PA 2B2UC 1HHVA 1SE2A 4K2KA 1MSGA 5G3LD 5EPJA 1H9KA 3JAME 4G7HC 1SYBA 1HQMC 1SSOA 2RBMA 4HCEA 1Q90A 4B9WA 3H09A 4C3IG 5FO7B 2QCPX 3NTHA 3DEOA 5JAVA 4A3JB 2F3VA 2AQ2B 2A69D 2AQ1B 2HCIA 3P1HA 3C1FA 3EJIA 2MP1A 3H94A 4NP5A 1DD2A 1CA5A 5K5PA 3SR1A 2HDLA 1TY0A 1J9OA 1PZKD 2WB1B 4FNFA 4PMWA 4C56C 1TWAB 4QMGA 2NVTB 2JEAI 1D5XC 1I4XA 1YNNC 3RMHA 3I73A 5E4WC 5IGBA 2F0JA 1DOKA 4EQPA 1Q1BA 3DUZA 3VYUA 3RLFA 3EQLC 1FYCA 1ESRA 3QB3A 1KDCA 4X3TA 3NTIA 3S1QB 1QB5D 2F0MA 1U4LA 2TMPA 4K2LA 2AUKA 1B9MA 5IGEA 1RTOA 4KKUA 1SAPA 5C4ZA 1ZYRD 3D4WA 4YIJA 1PTOC 1TVXA 3K58A 3ITPA 5DAUA 4H7BA 2YU9B 5G3LF 3TSSA 4RGTA 5J22A 1F9RA 1O78A 5D3DA 1FNVA 4HSPA 2PZTA 1EQVA 5ELEA 3VR4A 2F4IA 3VA7A 3NQTA 4HR7B 2EZVA 1U9RA 3A8JE 1QCBD 3L3OC 3VA5A 2WIIB 2AWNA 1D5ZC 1I6VC 3DWPA 4FXDA 3MC0B 4DAVA 2BCOA 2H4OA 5JPMC 4G7ZC 4H44C 3H91A 1DYQA 1O7LA 3BVGA 1JWMD 1MD2D 2D2CC 2F0DA 2JXMB 4DXGA 1WTQA 4B08A 4EGVA 1JOKA 3VYTA 4IUUA 4DFAA 1SYCA 4TKOB 5KEEA 4BA2I 4RGMA 4RWSC 1LT3D 2E2HB 4AYBB 2CHBD 1WTOA 5C5MA 2FMCA 3LWUA 3MA2B 2CW0C 1CQVA 1BNZA 5C3EB 2WAQB 3BDLA 3D31A 1AP0A 1XXGA 4CHTB 3EVQA 2A68C 4TRDA 4C3JG 4L6TB 1EEFD 5FLXL 4RFBA 2EY5A 3OIQA 3DWQA 1SMYD 5D3IB 5ELFA 4IN3A 2F0HA 2QF7A 5CGKA 1K8OA 1HA5A 4RHSA 1SNCA 2LS01 1KAAA 1VMCA 1PFMA 3C1EA 3NPPA 3R2TA 2E2JB 1QOHA 1EQTA 2B2YA 4H13C 5T1GA 1RTNA 2L4NA 1QNKA 4KD3A 2NVYB 2FINB 3NBIA 5IT9E 3FPPA 2OF1A 1I50B 3BYTB 2EY6A 1OXUA 5M9OA 4CJ0B 1GUWA 2B63B 2EYJA 1I4QA 3KLSA 1EYAA 1TT2A 1NCVA 3SK5A 3EFXD 3SXHA 2NN6I 1LT4D 1RD9D 5IGFA 4FP5D 3HRZC 3R3OA 4ODGA 2F0FA 3GTLB 1EIHA 1F2YA 1W6JA 1WTWA 4XYOA 4DA2A 1EY8A 2VB2X 4J1MA 1PRTB 1WVLA 5IGCA 3K5NA 2HUGA 5DM73 2NTSA 2A69C 4KK7A 2F0LA 2K7VA 4LK1C 5JVG3 2SOBA 4IFDI 1Q3LA 4L8JA 1TS5A 4C3IB 2K01A 1PTOH 1EZ8A 1QWYA 3LWEA 3EA6A 4J6HA 4ID6A 4A3KB 4IUVA 3OWFA 1SBBB 3DHQA 1RCVD 5DM63 4DAPA 3S2HB 2NN6G 1B2TA 2F0UA 3GP7A 5M5XB 1DONA 4OO1H 2R92B 3VR3A 3M4OB 3T13A 3D4RA 1EY5A 4A3FB 2MHVA 1TR5A 1EU3A 2L9HA 4ZRZA 2WACA 4WFN3 2O5JC 5CBAE 1RDPD 5FKAC 3S1RB 3PUYA 1HXYD 1JOOA 1T5XD 1ZYRC 4IFDG 1A2UA 1B9NA 2PQEA 5JEAH 2EPBA 4C1NI 3NBHA 4R9WA 4XIGS 3L7ZC 1D2BA 2F0VA 1NAPA 1K8MA 5E3FA 5CR3A 2SNSA 3OMGA 1V8QA 4CJ1B 3H0GB 3PMFA 4XDXA 4ZYSA 1Y8NB 4N9PA 1RJTA 4PMCA 1WTVA 1SYGA 3SDZA 3GD7A 4X3KA 1SNPA 2FJ2A 2BOSA 4P2CB 1HRJA 1GHKA 3OPOA 4NW2A 2J0TD 2PW7A 3NWSA 2R61A 3FEWX 5HURA 1ZKOA 4F88A 3HOZB 3IAYA 2SNMA 4A3EB 4FO2A 1IYVA 3GTJB 3G7LA 3T16A 5BN4A 2F0IA 2R3ZA 3HGBA 3BS1A 3PUZA 4K6LA 3GV6A 1SYFA 1B1ZA 2NYZD 2CVRA 4IUQA 2XN9C 3TBIB 4RGOS 3Q24A 3HOWB 1F9QA 3TZUA 1D1IA 3HOUB 4RCOA 3PUXA 2A6HD 1HUNA 2Z1CA 1GXDC 2NVXB 1I4HA 1JOQA 3GO5A 4XYQA 3NTKA 2QEJC 1LTRD 4EQNA 1SNDA 2OXPA 1PDQA 4RGNA 4FF1A 2BDNA 2F03A 4IUPA 4ZAIA 1U4MA 2EXZA 2JSOA 4OHJA 2HQEA 4OO1G 3I4MB 1EY4A 1G291 1ET9A 1C48A 1LTAD 3MHBA 4C3JB 2F0SA 1NUCA 1PRTD 2ICEC 2PCFB 5JJZA 1A3TA 1XWEA 2L5TA 1EY9A 1G8ZD 2EY2A 3OW7A 5JOBA 1EY0A 5JEAG 1CZGA 1DXMA 4KHVA 1B53A 3GQBA 4NKLA 4LAAA 2KA7A 1CK1A 3OHXC 4BS9A 1G6ZA 4ULLA 1R9TB 2D5DA 2B2TC 1Y1VB 1I4RA 1PMRA 4J8QA 3NHHA 1DOLA 1BF4A 3GTOB 2EYPA 1WD1A 1HPCA 4A3BB 2QILA 3FMCA 2VXWA 3K57A 3LX0A 5BN3A 4EQOA 3V96A 5K36G 2B2VC 3E0JA 3R93A 2IX0A 3IFTA 1HUMA 1STHA 2LFNA 1UUPA 5A2QL 4F87A 4V0BA 2D9UA 2MUYA 5F2DA 4KD4A 4IURA 2Q8RE 3MTSA 2HCCA 3URYA 1KLGD 3K5OA 1I4GA 1OXSC 2X6GA 3ONAB 2F0EA 2IW3A 2Z4HA 2D62A 2Q8IB 3FVQA 1S5FD 2RSNA 1DJRD 1D5MC 2J4XA 5EPLA 1STGA 2JA6B 4FF2A 5JEAJ 5IGDA 2IX1A 4KTAA 1VF5C 1WTPA 2B8GA 5M3FB 1PRTF 3R8BA 5COYA 5IGGA 1HCZA 2CQAA 3A7AB 5C0XH 1CTMA 3CHBD 1EOTA 3F2UA 2XRSD 2EJMA 3W3AA 1AEXA 2DNCA 3C2PA 3U9SA 2K5DA 1SDFA 1ILQA 1IW7C 2BA0A 1T5EA 1O7ZA 3MXUA 2K6AA 3H6MA 4G7OC 4RKBA 4XXEA 2A73B 1GJXA 3AU7A 1TS4A 3VYRA 2Z8LA 5FO8B 2RDFA 3T53B 1DCZA 2FFKB 4R8NA 5CORA 4BBRB 1JQYD 4I65A 1SNQA 3NE5B 5M5WB 3QOLA 4UAIA 1TS3A 5E4XA 4WRDA 1L0YB 1W6KA 3QG1A 3J80E 1BCPB 3TZDA 4NMZA 4CJ2C 1C4QA 1EZ6A 3I72A 4WORA 1PXUA 1U4RA 2K33A 5FLXE 3M85A 3WOEA 2EYMA 1SFOB 2NWGA 1JR0D 3D3RA 2OT2A 3K7AB 2JA5B 1RKNA 3NWTA 1HQRD 4DGZA 5DEHA 3VR2A 5LL6S 1YNJD 2IWHA 1Z47A 5KNCA 1VCIA 4MIUA 4ILWA 1QNUA 3MXPA 2VNUD 2ZXRA 2JA7B 3D8GA 2M2LA 4KHZA 5I2YA 3N6RA 1OO9B 2NBFA 3NQIA 4BY1B 2IT1A 3A8IE 1JB3A 3PUVA 5IODA 3A55A 1FNUA 4ZUJA 1ML0D 2JYOA 2KCCA 1E2ZA 1A15A 3H3VC 1MI2A 3RUZA 2KJXA 4KY5A 1Z7TA 5C5LA 3GTQB 4A3GB 4K5WA 3GTGB 2RVLA 2NVQB 5ELDA 2B2WA 3I4NB 1VDZA 2JP1A 1G2TA 4A3DB 2BE5D 4PV1C 5EKIA 5I9OA 2E2IB 4HCSA 2BDOA 4M1UB 1M4VA 4K6DA 1F9SA 2G9DA 1B4OA 3I70A 1GUGA 1I4PA 2J7ZA 4OIJA 3CRLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STG A;  5CV7 A;  5IGF A;  4OL7 A;  4EVO A;  3QB3 A;  1RKN A;  5CC4 A;  5CR3 A;  1KDC A;  2SNS A;  3OMG A;  4PMB A;  4DGZ A;  4KTA A;  5DEH A;  5IGD A;  4F7X A;  3MHB A;  3ERO A;  2F0S A;  3NUC A;  1KDB A;  2F3W A;  3OSO A;  3PMF A;  2F0W A;  2F0F A;  3R3O A;  4ODG A;  4RKL A;  5CV8 A;  5EKL A;  3SHL A;  5CGK A;  1NUC A;  1F2Y A;  2F0M A;  5IGG A;  4IAL A;  4N9P A;  4PMC A;  3BDL A;  5EGT A;  4N9T A;  1SYG A;  5C5M A;  4ME5 A;  1EY8 A;  1A3T A;  2EYL A;  3P75 A;  4J1M A;  4K8J A;  4NDX A;  1EY9 A;  5C3W A;  2F0K A;  4K2L A;  3NK9 A;  2EY2 A;  5IGC A;  4PNY A;  1SNO A;  5NUC A;  4MIU A;  5JOB A;  4B9X A;  1SNP A;  1EY0 A;  1STN A;  3EVQ A;  5IGE A;  2F0L A;  3ERQ A;  4KHV A;  5CV4 A;  3MXP A;  5J1Z A;  5C4Z A;  4KJO A;  1F2M A;  5J39 A;  5KRU A;  1A2T A;  2SOB A;  4TRD A;  2PYK A;  1JOR A;  1STB A;  3D4W A;  3D8G A;  4YIJ A;  3V2T A;  4NKL A;  4LAA A;  1AEX A;  4DF7 A;  1SYD A;  2EY5 A;  3ITP A;  4G57 A;  3TP7 A;  2F0G A;  4K2K A;  4H7B A;  4KY6 A;  5DAU A;  2PW7 A;  3S9W A;  1EY7 A;  1EZ8 A;  3QOJ A;  1SYE A;  4ZUI A;  5C4H A;  4ZQ3 A;  4E6I A;  5J22 A;  4J6H A;  4ID6 A;  2F0Q A;  5E3F A;  5HUR A;  3NXW A;  1ENC A;  3NP8 A;  4KJN A;  1SYB A;  1STA A;  2M00 A;  3OMC A;  2PZT A;  2F0N A;  3OWF A;  1EQV A;  3D6C A;  5HGT A;  5CV5 A;  2RBM A;  2SNM A;  3MEH A;  3NQT A;  5EKK A;  3TP8 A;  4KY7 A;  1U9R A;  2F0H A;  3DHQ A;  3NHH A;  3H6M A;  4B9W A;  4ZUJ A;  1EYD A;  1SNM A;  3T16 A;  3DMU A;  2F0I A;  5C6A A;  4RKB A;  2EYP A;  5IOC A;  5CV9 A;  2OEO A;  4F8M A;  5JAV A;  1SYF A;  3VA5 A;  2F3V A;  2PW5 A;  3MVV A;  4K5V A;  2O4X A;  1SNC A;  2F0U A;  3LX0 A;  1KAA A;  3RUZ A;  3C1E A;  2RDF A;  4EQO A;  1F2Z A;  5IOD A;  1EY6 A;  2ENB A;  4KV6 A;  1TQO A;  4KY5 A;  3SK8 A;  2PZU A;  2KHS A;  2RKS A;  3P1H A;  4R8N A;  5ISR A;  5C5L A;  3C1F A;  3EJI A;  4HMJ A;  1SNQ A;  4I65 A;  4K14 A;  5CV6 A;  4NP5 A;  1ENA A;  3MZ5 A;  3T13 A;  1EY5 A;  5KYI A;  1EYC A;  5K5P A;  3SR1 A;  1IHZ A;  4KD3 A;  1TR5 A;  3QOL A;  1STH A;  4S3S A;  5KGU A;  4K8I A;  3E5S A;  5C3X A;  4HMI A;  2PZW A;  2QDB A;  2WAC A;  4K5W A;  4WRD A;  5KIX A;  2EYO A;  2EY1 A;  5E1F A;  3TME A;  1JOQ A;  3SK6 A;  2OF1 A;  5I9P A;  4QMG A;  4K5X A;  4NMZ A;  4QB4 A;  2EY6 A;  2F0D A;  2F0O A;  5F2D A;  1EZ6 A;  4KD4 A;  1JOO A;  4WOR A;  5IIF A;  1A3U A;  1A2U A;  4DU9 A;  5I9O A;  2PQE A;  5I6Y A;  2F0P A;  3HEJ A;  4QF4 A;  3SK4 A;  4EQN A;  1SND A;  2EYF A;  2OXP A;  5M9O A;  2F0T A;  2EYH A;  1STY A;  5IGB A;  5KYL A;  1JOK A;  2EYJ A;  2EYM A;  2F0J A;  4HTH A;  4EQP A;  2F0E A;  3TP6 A;  1KAB A;  4IUN A;  4K6D A;  4DFA A;  3D4D A;  2KQ3 A;  1KDA A;  1EYA A;  1TT2 A;  2EXZ A;  2NUC A;  1SYC A;  3SK5 A;  2HQE A;  5I6W A;  5KEE A;  3HZX A;  1II3 A;  1EY4 A;  3BDC A;  2F0V A;  3SXH A;  2LKV A;  3TP5 A;  4IZ8 A;  3U9O A;  1NSN S;  1A3V A; 
#chains in the Genus database with same CATH topology
 4OL7 A;  1PFB A;  2UUA Q;  3DWA A;  3CCL A;  1UEA B;  2K04 A;  2EOT A;  1GHJ A;  5EGT A;  1FGB D;  5KNB A;  2PI2 A;  4JV5 L;  4PG3 A;  1N34 L;  3D0F A;  2RHS B;  4JC0 A;  3RZD B;  1HZA A;  4JI5 Q;  4C2M B;  5AFW A;  4FXK C;  2FXQ A;  5J39 A;  5KRU A;  2OTL A;  3V2T A;  1BBX C;  4HIO A;  1O7Y A;  2LXK A;  4JCV E;  4KKS A;  1SYD A;  4UP7 A;  4GOP B;  3TP7 A;  1GUT A;  1HFG A;  5EBD A;  1Y1W B;  1EY7 A;  5C0X J;  2KHJ A;  4JI2 L;  2SEB D;  1K8G A;  4DV4 L;  1ET6 A;  2AQ3 B;  3I3C A;  2M00 A;  3BVZ A;  2WKD A;  1V43 A;  1BOS A;  3VR5 A;  3M3Y B;  1F77 A;  2L12 A;  3M4Y A;  5JVH 3;  4LJZ C;  4HJ9 A;  3A7L A;  3I8Z A;  3KLR A;  3G71 A;  4F8M A;  3ND8 A;  4A93 H;  4FF4 A;  3QWN A;  3ULP A;  1C8C A;  4HJA A;  1Q86 C;  1CZW A;  4OWX B;  4NXM Q;  2ENB A;  2E2H H;  2C35 B;  2KHS A;  4JPB W;  5FJ8 H;  2XNA C;  4IJL A;  2VB3 X;  4K14 A;  2LXJ A;  3MZ5 A;  1E24 A;  1C9O A;  2WB1 G;  2K28 A;  5C44 G;  1BCP D;  5C3E H;  4K8I A;  5C3X A;  1XJV A;  1PYB A;  2C5C A;  2PZW A;  2QDB A;  1LAB A;  2A5H A;  4H0L C;  1EEI D;  2IX3 A;  2PPB C;  1VQM A;  2I07 B;  1R4P B;  4UPA A;  2R93 G;  1I6H B;  1CI3 M;  4YWL A;  1BVS A;  1CUK A;  2EYF A;  2H1E A;  2EYH A;  5IT9 L;  5KYL A;  1BR9 A;  4CDD C;  1JWS D;  2B8F A;  4DNT B;  3HZX A;  5IYC H;  2E2D C;  4YCU A;  3CC7 A;  2R7Z B;  2A74 C;  3T4A C;  2VUM H;  3J81 E;  1SMX A;  4HJ7 A;  2ZT9 C;  2FHT A;  1K83 B;  1H9M A;  4PMB A;  4WJW A;  4X64 Q;  1BO0 A;  1IL8 A;  3FKI B;  1A6X A;  3CME A;  1YHQ A;  2N78 A;  4JBW A;  3CCE A;  3KK7 A;  3T1H L;  4IAL A;  5LL6 X;  1V1Q A;  4DR7 Q;  1MGS A;  3PUW A;  2EYL A;  4ME5 A;  2F0K A;  4HIM A;  1ICF B;  2XTI A;  4ZK9 B;  1SNO A;  4I7Z C;  3MAQ A;  2ZJQ A;  1JWU D;  3T51 B;  1S5E D;  2C9O A;  2RQX A;  1DZ1 A;  3OW2 A;  2K32 A;  1CHP D;  2X6L A;  4FDB A;  1DGS A;  4KY6 A;  2NVY H;  1TKW B;  5EQ0 A;  3OOC A;  2E5L L;  2PQA B;  1XYI A;  3Q23 A;  2YTX A;  4Y7N B;  1Q8I A;  4ZLT F;  2XSC A;  1S5D D;  1STA A;  1JT8 A;  1TII D;  3X3N A;  2B2U A;  5HGT A;  2LSS A;  2HDM A;  2KCT A;  3MEH A;  4A75 A;  3WDN A;  4R4T A;  3S24 A;  1X32 A;  5LMN Q;  1SNM A;  2G9H D;  2B2Y C;  4IJH A;  1XMO L;  2AHO B;  1NR2 A;  1VQF A;  2NB0 A;  1D6E C;  2JA8 B;  1ZXT A;  2O4X A;  3F2D A;  3CD6 A;  2KEC A;  3VYS A;  3H3V H;  1I3Q H;  5ELO A;  2KEE A;  4JYA Q;  1EY6 A;  2GVB A;  2LY7 A;  2Y0S B;  1HNX L;  1NMG A;  1Q7Y C;  1QUQ B;  1UWV A;  1H9R A;  3S1N H;  1ENA A;  1JE4 A;  4OO1 I;  4HED A;  3Q8D A;  1BCP F;  3QO2 A;  3GTL H;  3FRP B;  4QUC A;  4POF A;  3K59 A;  4HMI A;  2TSS A;  3NEN A;  1QZG A;  5E1F A;  4XQQ A;  1X3E A;  4B3M Q;  1EWC A;  2K52 A;  3KDF A;  1K0S A;  1E2W A;  2UUC Q;  4LF5 Q;  4A93 G;  1N36 Q;  1E22 A;  1H9S B;  3CPF A;  5FK9 C;  1LT5 D;  2KOL A;  4K0K Q;  1N32 Q;  1KNE A;  4O1N A;  3V05 A;  2WIN B;  3KJP A;  5FJ8 G;  4AYB G;  2MQH A;  1PH6 A;  4A3K H;  1II3 A;  4B3S L;  3F1Z A;  4B3R Q;  1AH9 A;  3KLS X;  4DR6 Q;  2XVS A;  3HG9 A;  1I5F A;  4X3U A;  4JI1 L;  1G91 A;  5C3E G;  2CWA A;  2K1B A;  1C0A A;  4F7X A;  3NUC A;  3CCJ A;  1LTB D;  3SHL A;  5EKL A;  1QVF A;  3S2H H;  5D65 A;  1PYW D;  2N88 A;  3HKS A;  3NEM A;  5NUC A;  4DAY A;  5HY6 A;  4BBS B;  3DLL A;  1STN A;  4X3S A;  2KBN A;  5M5X H;  3ERQ A;  1VQ8 A;  1SMY C;  1JOR A;  1CA6 A;  1Y8O B;  3M4O H;  1X55 A;  3BZK A;  4A3F H;  2YTY A;  2F0G A;  3CCV A;  1HNZ Q;  5IYC G;  1Q12 A;  2E74 C;  5IYB H;  1J8I A;  1X3Q A;  2WV6 D;  2Z6B A;  1A8V A;  3UDX A;  3H15 A;  2A68 D;  2VUM G;  5A2Q E;  2WKC A;  1ZEQ X;  3S1R H;  3KFU A;  1QIL A;  4KN7 C;  2MO1 A;  3TP8 A;  2BE5 C;  2DUD A;  5EKK A;  1VQO A;  1KC8 C;  4I7A A;  1G6P A;  5FLM H;  4KKT A;  3DMU A;  2AUJ D;  2I46 A;  4MNO A;  4YY3 Q;  4DR4 L;  5CV9 A;  2OEO A;  4LUZ A;  1SRO A;  4XT3 B;  1EWH A;  1VQD A;  1K73 C;  4G4K A;  2Q8T A;  1TWC B;  1UNS A;  1XNQ L;  1IYU A;  4RMF A;  1TQO A;  1BDO A;  4CDE C;  3S2D B;  4KN4 C;  4DK6 C;  3PO3 B;  1XMQ L;  3H0G H;  2ASB A;  2MPM A;  1B50 A;  2VZA A;  2UXD L;  5KIX A;  4DR1 Q;  2ZXP A;  5AJ3 L;  5I9P A;  4A3I H;  5EAY A;  1K8A C;  1E2V A;  3SVM A;  1Y14 B;  3JAM c;  3CCM A;  1XX8 A;  1A3U A;  4PQX A;  4IPH A;  4LF4 Q;  2L0C A;  3R2I A;  3S16 B;  1CKM A;  2DJG C;  1VQI A;  1VQG A;  2BA1 A;  2V4D A;  3CW2 C;  1JCK B;  3CU7 A;  2BH2 A;  3O13 A;  3MWY W;  3K80 C;  5I6W A;  2A6E D;  3P7J A;  3BDC A;  3TEH B;  3HS0 C;  3KJO A;  3HOZ H;  3A8K E;  4EVO A;  1FVI A;  3MXN B;  5CC4 A;  1ASZ A;  4FF3 A;  4A3E H;  1OXT A;  3GTJ H;  1LAC A;  4LFB L;  1KDB A;  2F3W A;  3CC4 A;  1YHB A;  1VQ6 A;  4U68 A;  1HA6 A;  1D1K A;  4PZ8 A;  2IJ0 A;  5C3W A;  1KIX A;  4BWG B;  4KHP Q;  4K8J A;  3JC6 6;  1M8A A;  3AB9 A;  4IUT A;  1JJ2 A;  4RCN A;  3HOW H;  1F2M A;  1WTR A;  4JI6 Q;  4XQN A;  4L63 B;  3AMU A;  1PH3 A;  1TWH H;  1KD1 C;  4DF7 A;  2YV5 A;  3HOU H;  4KLK A;  1BXT A;  2R6G A;  3DM1 A;  4C1N K;  1BCP C;  1LTS D;  2HHH Q;  2UUA L;  1SYE A;  3KF6 A;  2NVX H;  2D0P A;  2K14 A;  3K5L A;  1EL0 A;  3U50 C;  2KVM A;  3OMC A;  1KTK A;  4P75 A;  3HOY B;  1KNA A;  2WP8 J;  4Q0F A;  1QE6 A;  3KUP A;  1G51 A;  3QJY A;  1IZ6 A;  4LF7 Q;  2ZXO A;  1HTP A;  3W2D A;  2QDL A;  1AE2 A;  1PLF A;  1ROD A;  2EE1 A;  5C44 B;  4R8I A;  1OXX K;  1UAP A;  1ICW A;  3LNN A;  4K5V A;  1IKM A;  3OIP A;  4X6A H;  3I4M H;  5FOB B;  1Q46 A;  3M7N A;  2PMZ B;  4A3F G;  1CKN B;  2R93 B;  1BQQ T;  2PZU A;  3JAM i;  2ZJP A;  1LTT D;  4IPC A;  5KYI A;  4XQJ A;  4C3J H;  4DV1 L;  1IHZ A;  2B29 A;  2DNE A;  5EBC A;  1LUZ A;  5EPK A;  1IBK Q;  1ENF A;  3ER0 A;  3I2Z A;  4DK0 A;  3JAM L;  3C3L A;  1O7I A;  1WCM H;  2K4K A;  2UXC Q;  5FLM G;  1H9J A;  1SE3 A;  4K5X A;  4GKK Q;  5LHY 1;  2F0O A;  4X62 L;  5I2X A;  4DNR B;  1K28 A;  4XTC S;  5IIF A;  1IKL A;  4DU9 A;  3G4S A;  4NXM L;  2NZ1 D;  1RHP A;  3J7A V;  1E7Z A;  2PMZ E;  2DY8 A;  3UI2 A;  4QIW B;  3A56 A;  5C4X G;  4HTH A;  3TP6 A;  2XIW A;  2I5M X;  2K5Q A;  4RA8 A;  3D4D A;  4JBM A;  1FNW A;  3J80 c;  2KUM A;  1LTL A;  2ZTD A;  1B44 D;  4APV A;  2LKV A;  3ULJ A;  1Y1V H;  1VMP A;  1Z9F A;  1HZC A;  1QG7 A;  4IPG A;  4DV7 Q;  4LFC Q;  1EOV A;  2SDF A;  3GV3 A;  2IL8 A;  4IO9 A;  5CV8 A;  3OSO A;  3GTO H;  2F0W A;  3BDO A;  4A3B H;  4RAU C;  1Q82 C;  4A3I G;  4OWT B;  4MZ9 A;  5JPN C;  1L1O B;  1AFP A;  3P20 A;  4HJ8 A;  3N52 A;  5C0X I;  2KCN A;  4QIW E;  1JC7 A;  1ESF A;  2IY5 B;  1NR4 A;  3HOX G;  1LLR D;  3RD4 A;  4ME3 A;  4G57 A;  2PQA A;  1NTG A;  3M4Q A;  5FO9 B;  3S9W A;  3Q22 A;  3CCS A;  5IP7 H;  3K5M A;  4X64 L;  4TSS A;  3CMA A;  3AFQ A;  1ENC A;  4DR7 L;  1O80 A;  2F0N A;  5CV5 A;  5M3M G;  1K3R A;  2GA4 B;  4KY7 A;  2ZTE A;  3TDQ A;  2K03 A;  3K6O A;  3S15 B;  1CM9 A;  2AWO A;  1Y69 U;  5IOC A;  4XT1 B;  3QIA A;  1YI2 A;  4UDU C;  3HOW G;  4OXP A;  2K05 A;  2A6H C;  3STB D;  2B39 A;  1RF2 D;  3SK8 A;  1EQQ A;  2RKS A;  1IBM L;  4BY7 G;  5ISR A;  2JA6 H;  4C3H G;  3HOV G;  4ZKB B;  1WYD A;  5CV6 A;  4V19 0;  3BU2 A;  4A93 B;  1TS2 A;  3ERS X;  1PZJ D;  3J7Z C;  1Z6H A;  4CKB A;  1B3A A;  3CRK C;  1PTO B;  3IFD A;  4Q5V A;  1UEB A;  3PF5 A;  5C0X G;  4GNX A;  4PZ6 A;  3J80 i;  3AQQ A;  4UP8 A;  4P71 A;  5LMN L;  2FMM A;  3U4V A;  2E75 C;  2X69 A;  4OX9 Q;  1CHQ D;  1H9S A;  1SRU A;  4A3M G;  3PIO 3;  4GOP C;  1EU4 A;  3T1Y Q;  2R7F A;  3J80 L;  2F0T A;  4A3L G;  4JYA L;  1STY A;  3VR6 A;  2QA4 A;  4GS3 A;  3KOJ A;  1KAB A;  1X6O A;  2KQ3 A;  2RDH A;  2NN6 H;  2Q2H A;  4M8A A;  1MJC A;  4ZKC B;  1HR0 L;  3CAM A;  1PRT C;  4U67 3;  3DM3 A;  4L5Q A;  3BYY B;  5CV7 A;  2XWB B;  2RDG A;  1GM5 A;  1S5B D;  4B3M L;  3GTP B;  1EUJ A;  3TRZ A;  5LMU Q;  4LMQ D;  4YHH Q;  4RKL A;  3U9O A;  1V1P B;  1WCM G;  1DM0 B;  4LF5 L;  3P75 A;  1N36 L;  2VUM B;  4DV3 Q;  3PV0 A;  4Z9C B;  4EX5 A;  2YU9 H;  5H1S E;  2GN5 A;  1GOZ A;  4B9X A;  4K0K L;  1VQ4 A;  2HIV A;  3OWE B;  3BG3 A;  1X3P A;  4BBR H;  3E9I A;  2F1M A;  1F2L A;  1MHW C;  1PZI D;  1Q1E A;  1WFQ A;  2M9V A;  1VQP A;  4IFD H;  2XRQ D;  1SXT A;  1V1O A;  1L0W A;  5IWA Q;  2YYZ A;  2Z4I A;  5M5W H;  4DR6 L;  1STE A;  3PIP A;  1Y1V G;  2Q2U A;  4QGU A;  3MFG A;  1SJE D;  1G2S A;  3NXW A;  3NP8 A;  1XTC D;  4KJN A;  1PH5 A;  5KND A;  2EQS A;  4A3B G;  1PA6 A;  4MN3 A;  1EYD A;  4R4I A;  4O42 A;  2VQE Q;  3HKZ B;  5IP9 G;  1SFO H;  1S5C D;  1S4Z A;  1FD7 D;  3MVV A;  2L11 A;  2A6E C;  4BA1 I;  1HNZ L;  3UE0 A;  3PO2 B;  4JK1 C;  4KV6 A;  4O0A A;  4HID A;  1YHA A;  2JA5 H;  2EVB A;  3S17 B;  3KF6 B;  1DOM A;  2VQF Q;  1TWF B;  3RZO B;  3PQI A;  3T56 B;  2EDG A;  3J7Y W;  1QJO A;  1I3Q B;  4A3J G;  4A3C H;  2UXB Q;  2VY3 A;  3Q6S A;  2EY1 A;  2EJG C;  3SK6 A;  4YY3 L;  3HKZ E;  1BBW A;  5IYD H;  3S1N B;  1R4Q B;  4DR2 L;  2IPK D;  3I90 A;  1HFN A;  3KYH C;  3TRE A;  2JA7 H;  1ONL A;  3SK4 A;  4LF6 Q;  3IRB A;  5GAH C;  4CKC A;  5CBE E;  1PFN A;  1AZP A;  4X66 Q;  1GUS A;  1GD7 A;  1MBY A;  4DK1 A;  3I4L A;  4IUN A;  3CQZ B;  4BY1 H;  1MJE A;  3DXJ C;  3L9A X;  2AMC B;  3MXN A;  1VF7 A;  4IZ8 A;  1A3V A;  5CYU A;  4DR1 L;  4RH6 A;  3GTM B;  4ZCK A;  5BN5 A;  1MSH A;  2QKI C;  3KBX A;  3D6W A;  3HP3 A;  2ICI A;  3PGZ A;  1WOC A;  5GAE C;  4AQY Q;  1BUV T;  1IXR A;  1CQF A;  4CGY B;  3ND9 A;  4FXG C;  2MJ8 A;  2O5I C;  2MFI A;  1E0B A;  2D0O A;  3S14 B;  5CMD A;  3S1M B;  3J81 c;  5J1Z A;  1EIG A;  1A2T A;  1YNN D;  2PYK A;  3SE0 A;  1STB A;  3I7F A;  4DUZ L;  3KF8 A;  1LT6 D;  4ABN A;  1B3Q A;  3NSW A;  1QVG A;  3GTQ H;  3CPW A;  3QOJ A;  4ZUI A;  4ZQ3 A;  1X9N A;  2EXD A;  4DV6 Q;  2CQO A;  3UE1 A;  2NVQ H;  1TY2 A;  2DY7 A;  4A3D H;  2E2I H;  2OQ0 A;  4HSV A;  4WJ3 M;  2L1B A;  3GTK B;  2E2J H;  1IW7 D;  1ILP A;  3TN2 A;  2B2T A;  1AZQ A;  1AN8 A;  5I4D A;  2JQO A;  2KEN A;  3IKJ A;  2Z6K C;  4BBR G;  4KI0 A;  1CKN A;  1GUO A;  2N55 A;  2O2L D;  1S72 A;  3TS2 A;  3MEF A;  1F2Z A;  2PO4 A;  2V1C C;  3KBG A;  4R4Q A;  1BKB A;  3MFY A;  1I50 H;  4HMJ A;  4CKE A;  5TSS A;  2B2W C;  1PTO D;  2MO0 A;  2ZJR A;  1XTD A;  1T9H A;  5EJW A;  4S3S A;  5KGU A;  5C4X B;  3E5S A;  1TU2 B;  2Q2I A;  2B2V A;  2EYO A;  5ELC A;  4LF7 L;  5JJI A;  2B63 H;  4B3T Q;  3FDT A;  1I94 L;  2HD3 A;  4DR3 Q;  2HT1 A;  4HN7 A;  1NE3 A;  1RIP A;  3WOF A;  1FR3 A;  4QL5 A;  4QF4 A;  5GRO A;  1CKO A;  3ULL A;  2N8N A;  1SJH D;  2XWJ B;  5T1I A;  1Y1W H;  4X65 Q;  4GZY C;  3ZYY X;  1SE4 A;  2RCF A;  4A3I B;  4MHE A;  1KDA A;  2F4V Q;  2E76 C;  1YNJ C;  3PF4 A;  4JW0 A;  2I5H A;  2UU9 Q;  3MXG A;  3CKI B;  3J81 i;  4QCL A;  5K36 H;  1IBK L;  1TWG B;  3HFZ B;  1VQH A;  4GNX B;  4DXF A;  2UXC L;  1XNR Q;  3M3Y H;  4A3C G;  3HOX B;  2MGS A;  1GUN A;  3ERO A;  4GKK L;  1LYL A;  4CBV A;  1J5E L;  1L1O A;  2IHF A;  4DV0 Q;  3Q0A A;  4N9T A;  2OCE A;  3J81 L;  4NDX A;  5DLQ E;  1LO5 D;  2Y0S E;  1JIC A;  3NK9 A;  4C3I H;  5ELN A;  2JA7 G;  2CWP A;  4JOI A;  2JEB I;  2PNR C;  3STB C;  3J7A F;  5M3M B;  3C46 A;  1HNW L;  2JE6 I;  4RHR A;  4LNQ A;  4DN4 M;  1KLU D;  3I55 A;  1XPO A;  2WAQ G;  4LFC L;  3E3X A;  2ZM6 Q;  4CDF C;  5C4H A;  4E6I A;  2RF4 A;  1N9W A;  2F0Q A;  1HTL D;  4TQU S;  1TWH B;  1FL0 A;  1WD0 A;  3D6C A;  2QGQ A;  4IFD J;  4BY7 B;  4FVM A;  4ALP A;  1VQ9 A;  3DEP A;  4IPD A;  4C3H B;  3HOV B;  5C6A A;  2CW0 D;  2NTT A;  2R92 H;  3GDE A;  1SLJ A;  2PW5 A;  4QUF A;  1LTI D;  1LV9 A;  1U4P A;  2DJF C;  4FYD A;  5C4J B;  3X3M A;  1IBL Q;  3H3V I;  1EFI D;  2R7Z H;  3RN2 A;  4JV5 Q;  1SEB D;  3G6J B;  2EJF C;  4DR5 L;  2H5X A;  5ELB A;  4GLX A;  1PTO F;  4A3M B;  2JK8 A;  2RA4 A;  4P72 A;  2MNA A;  3FKI H;  1EYC A;  4JI3 L;  4YCV A;  5A35 A;  2DN8 A;  4DAM A;  1CT1 D;  4GKJ Q;  3TME A;  4UY8 C;  4JI7 L;  1SE8 A;  1PH1 A;  4QB4 A;  1CFM A;  4JI2 Q;  4OIK A;  3UDF A;  2PNH A;  2KED A;  5I6Y A;  2F0P A;  3HEJ A;  4HAE A;  1B70 B;  1WCM B;  1Q8K A;  1BBU A;  3FPU B;  3B6Y A;  5D14 A;  1KRS A;  2RSO A;  2NUC A;  1LTG D;  2XGT A;  2L55 A;  1Y8P B;  2LMC B;  4Y7N H;  1WTX A;  4OGQ C;  1OXV A;  1QVC A;  2ID0 A;  3SEB A;  5M5Y B;  3TP5 A;  5CV4 A;  1NSN S;  2K5W A;  5JJL A;  1V1P A;  1EWI A;  3I91 A;  4HJ5 A;  3M7G A;  2B63 G;  3PIP 3;  4KMU C;  2I5L X;  1AW7 A;  2JA8 H;  3K0Y A;  1TXY A;  3A54 A;  4LUO A;  3BVM A;  4PNY A;  3BZD B;  4A4I A;  2GVA A;  3IL8 A;  3U58 A;  3E6Z X;  5DNF A;  4IQZ A;  4KJO A;  1L0X B;  1Y1W G;  3E9H A;  4DV2 L;  4LWC A;  1F9P A;  2B2U C;  1GKH A;  1HHV A;  4UHV A;  1SE2 A;  4K2K A;  2E8G A;  1MSG A;  4JI8 L;  5G3L D;  3K7U C;  5EPJ A;  5LMU L;  1EQR A;  1H9K A;  3JAM E;  3CP0 A;  4G7H C;  1SYB A;  1HQM C;  2CKZ B;  1SSO A;  2RBM A;  1XPU A;  4DV3 L;  4HCE A;  1Q90 A;  4B9W A;  3H09 A;  2B3G A;  4C3I G;  5FO7 B;  2UUB Q;  2QCP X;  2VW9 A;  3NTH A;  2RCN A;  3DEO A;  5JAV A;  4A3J B;  2F3V A;  4A3K G;  1KXL A;  3KF8 B;  2AQ2 B;  2A69 D;  3UDI A;  2I0Q A;  2AQ1 B;  2HCI A;  3P1H A;  4JI0 Q;  3C1F A;  3EJI A;  2MP1 A;  1JB7 A;  3H94 A;  4NP5 A;  1M90 C;  1DD2 A;  1CA5 A;  5K5P A;  3SR1 A;  2HDL A;  1L1O C;  1TY0 A;  4DV5 Q;  1J9O A;  5JJK A;  4JI5 L;  3OTO Q;  1PZK D;  2WB1 B;  4FNF A;  4PMW A;  4C56 C;  2E5L Q;  1TWA B;  4QMG A;  3FHW A;  2NZO A;  4JOI C;  2NVT B;  2JEA I;  1D5X C;  1WTH A;  3K0X A;  1I4X A;  2R92 G;  1U5K A;  1QZH A;  1YNN C;  3RMH A;  3I73 A;  5GAD C;  5E4W C;  5IGB A;  2F0J A;  1DOK A;  4EQP A;  5IYB G;  1Q1B A;  3DUZ A;  4A76 A;  1XMO Q;  1A62 A;  4DK3 C;  3VYU A;  3RLF A;  3EQL C;  4P74 A;  3A5U A;  1FYC A;  2UXB L;  1ESR A;  1CSQ A;  3QB3 A;  1KDC A;  2WB1 E;  4X3T A;  1HNX Q;  3NTI A;  1GO3 E;  5L37 A;  3I56 A;  3S1Q B;  4OEL B;  1QB5 D;  2F0M A;  1YVC A;  1U4L A;  2TMP A;  4LF6 L;  4K2L A;  2AUK A;  1TWC H;  1B9M A;  5IGE A;  1FGU A;  1RTO A;  1C7Y A;  4KKU A;  1R9T H;  1SAP A;  3TS0 A;  5C4Z A;  1ZYR D;  3S2D H;  3D4W A;  4YIJ A;  3H0G G;  1PTO C;  1TVX A;  3K58 A;  3ITP A;  5DAU A;  4H7B A;  2YU9 B;  5G3L F;  2BH8 A;  3TSS A;  4RGT A;  5FLX c;  5J22 A;  1F9R A;  1O78 A;  5D3D A;  1FNV A;  4HSP A;  2PZT A;  1EQV A;  5ELE A;  3VR4 A;  2F4I A;  3VA7 A;  3G48 A;  3NQT A;  4B3S Q;  4HR7 B;  2EZV A;  1UE7 A;  1U9R A;  3QR8 A;  1X3G A;  3A8J E;  1NJI C;  4JI1 Q;  1SR3 A;  1QCB D;  3L3O C;  3F2B A;  3VA5 A;  2WII B;  1E3P A;  2HQL A;  2AWN A;  2K75 A;  1D5Z C;  1YEZ A;  3HOZ G;  1I6V C;  3U4Z A;  3DWP A;  4A3E G;  4DV6 L;  1VQ7 A;  4GLV B;  4FXD A;  3MC0 B;  4DAV A;  2BCO A;  2H4O A;  5JPM C;  4G7Z C;  4H44 C;  3H91 A;  1DYQ A;  1HZB A;  1O7L A;  3BVG A;  1JWM D;  4HIK A;  4OWW B;  1MD2 D;  2D2C C;  2F0D A;  5GQO A;  2JXM B;  4DXG A;  1WTQ A;  4B08 A;  3HOU G;  4EGV A;  3EBE A;  1JOK A;  3VYT A;  4IUU A;  2K5V A;  4DFA A;  1UE5 A;  1CSP A;  1SYC A;  5M3F H;  4TKO B;  5KEE A;  4BA2 I;  4RGM A;  4RWS C;  1LT3 D;  2E2H B;  3HOY H;  1XNQ Q;  4JG2 A;  4AYB B;  2CHB D;  1PHJ A;  3RLO A;  4B3T L;  1WTO A;  4DR3 L;  5C5M A;  2FMC A;  3LWU A;  3MA2 B;  2CW0 C;  1CQV A;  1BNZ A;  5C3E B;  5C44 H;  2WAQ B;  3BDL A;  1VQN A;  3D31 A;  3I4M G;  1AP0 A;  1XXG A;  4CHT B;  4POG A;  1E1O A;  4X65 L;  3EVQ A;  2A68 C;  2R93 H;  1YJW A;  5AJ3 Q;  2F4V L;  4TRD A;  5GAG C;  4C3J G;  4L6T B;  1EEF D;  5FLX L;  4RFB A;  2EY5 A;  1NMF A;  2G5D A;  3OIQ A;  3DWQ A;  4CDC C;  4AYB E;  1XNR L;  1SMY D;  5D3I B;  5ELF A;  4IN3 A;  4JI4 Q;  2UUC L;  4UP9 A;  2WAQ E;  2K5H A;  4DV0 L;  3TQY A;  3RN5 A;  2F0H A;  2QF7 A;  1N32 L;  1EIY B;  5CGK A;  1P16 A;  3I4O A;  1K8O A;  1HA5 A;  5LMN W;  1PH4 A;  4LFB Q;  4RHS A;  4B3R L;  4LF9 Q;  1PH7 A;  1SNC A;  4AH6 A;  2LS0 1;  1KAA A;  1VMC A;  1PFM A;  3C1E A;  3NPP A;  3R2T A;  3SGI A;  4L5S A;  2E2J B;  2ZM6 L;  1QOH A;  1EQT A;  2B2Y A;  4H13 C;  5T1G A;  1IL2 A;  1RTN A;  2L4N A;  1UE6 A;  1QNK A;  4KD3 A;  2NVY B;  2FIN B;  3NBI A;  1HR0 W;  1NBW A;  3FPP A;  5IT9 E;  2OF1 A;  1HH2 P;  1I50 B;  1D7Q A;  1J6Q A;  3BYT B;  2EY6 A;  1W3S A;  1MKH A;  3CC2 A;  1OXU A;  5M9O A;  4CJ0 B;  1WI5 A;  1GUW A;  4QQB X;  1IBL L;  3K7A H;  3ZJY C;  2B63 B;  2EYJ A;  1I4Q A;  5IP7 G;  3KLS A;  1EYA A;  1TT2 A;  1NCV A;  2CH4 A;  3SK5 A;  3EFX D;  4DKA C;  3SXH A;  2NN6 I;  1LT4 D;  1RD9 D;  1AE3 A;  4NXN Q;  3A0J A;  5IGF A;  4GKJ L;  4FP5 D;  3HRZ C;  3R3O A;  4ODG A;  3S15 H;  2F0F A;  3GTL B;  1EIH A;  1F2Y A;  1W6J A;  1WTW A;  1WJJ A;  4XYO A;  4DA2 A;  1D8L A;  1EY8 A;  4DV1 Q;  2VB2 X;  4J1M A;  3OYY A;  1PRT B;  1WVL A;  1V9P A;  5IGC A;  3K5N A;  2HUG A;  3KLW A;  2NTS A;  5DM7 3;  2A69 C;  4KK7 A;  2F0L A;  2K7V A;  4LK1 C;  2YTV A;  5JVG 3;  2JA6 G;  1NY4 A;  2SOB A;  4JVZ A;  3RR5 A;  4X62 Q;  5M3F G;  1Q3L A;  4IFD I;  1U0L A;  2QW7 A;  1TS5 A;  4L8J A;  4C3I B;  2K01 A;  4GN3 B;  4OON A;  1PTO H;  1EZ8 A;  1QWY A;  3LWE A;  5IY0 A;  3HOY G;  1IYJ B;  3EA6 A;  1S40 A;  4J6H A;  4ID6 A;  4A3K B;  4IUV A;  5BR8 Q;  4LF4 L;  3OWF A;  1EIF A;  1SBB B;  3UDG A;  3DHQ A;  3A5Z B;  4LW1 A;  2NZH A;  4MTN A;  1YIJ A;  4GLA C;  2KCM A;  3WWV A;  1RCV D;  5J3B A;  5DM6 3;  3CCR A;  3VDY A;  3RLN A;  3J7A 5;  1PYS B;  4DAP A;  1VQJ A;  3AFP A;  3S2H B;  2NN6 G;  1L2F A;  2KHI A;  1B2T A;  1KL9 A;  4A3G H;  2F0U A;  1X65 A;  2ALY B;  3GP7 A;  5M5X B;  1DON A;  4GNX C;  3GTG H;  3W1G A;  4OO1 H;  2R92 B;  3VR3 A;  1N33 Q;  3M4O B;  3T13 A;  3GTP H;  3D4R A;  1EY5 A;  3I4N H;  1K3B C;  4A3F B;  2MHV A;  4KHP L;  1TR5 A;  1EU3 A;  2L9H A;  2Z0S A;  4ZRZ A;  2WAC A;  4WFN 3;  2O5J C;  5CBA E;  1RDP D;  3J81 j;  5FKA C;  3AEV A;  1YNX A;  2UUB L;  3S1R B;  3PUY A;  4JI6 L;  1HXY D;  3CCU A;  1JOO A;  1T5X D;  1ZYR C;  4IFD G;  1A2U A;  1B9N A;  2PQE A;  5JEA H;  2HHH L;  2EPB A;  3NBH A;  4C1N I;  4R9W A;  4JI0 L;  4XIG S;  3L7Z C;  1JE5 A;  1D2B A;  3G6E A;  2F0V A;  2VL6 A;  1VQL A;  1NAP A;  3L0O A;  4DV5 L;  1K8M A;  2JN4 A;  5E3F A;  4DUY Q;  3OTO L;  1K0R A;  5CR3 A;  2SNS A;  3OMG A;  3RZD H;  1V8Q A;  4CJ1 B;  1HZ9 A;  4J15 A;  3H0G B;  3PMF A;  4C2M H;  1IBM Q;  1X56 A;  4XDX A;  4ZYS A;  1Y8N B;  4N9P A;  1RJT A;  4PMC A;  1WTV A;  1SYG A;  3SDZ A;  3GD7 A;  3L2P A;  4X3K A;  3W5O A;  1SNP A;  3PO2 H;  2FJ2 A;  1HJP A;  1KAW A;  3AYH B;  2BOS A;  2HIX A;  2JA5 G;  1FJG Q;  2N49 A;  2Z9H A;  3EIV A;  3S17 H;  2Q2T A;  4P2C B;  1HRJ A;  1TWF H;  3RZO H;  1GHK A;  3OPO A;  4NW2 A;  2J0T D;  2PW7 A;  3NWS A;  2R61 A;  3FEW X;  3EN2 A;  5IYD G;  1E1T A;  1YJN A;  5HUR A;  1ZKO A;  4F88 A;  3HOZ B;  3IAY A;  4LF8 Q;  2SNM A;  1HR0 Q;  4A3E B;  4FO2 A;  2A8V A;  1IYV A;  3GTJ B;  3G7L A;  3PSI A;  3T16 A;  5BN4 A;  2F0I A;  1RL2 A;  1M1K C;  2R3Z A;  3HGB A;  3BS1 A;  3PUZ A;  4K6L A;  1VS0 A;  3CQZ H;  3GV6 A;  1SYF A;  1B1Z A;  2NYZ D;  4BY1 G;  1EFW A;  2CVR A;  4IUQ A;  3F8T A;  3NEL A;  2XN9 C;  4DV7 L;  3TBI B;  4RGO S;  1KHI A;  3Q24 A;  3HOW B;  1PVO A;  3K81 C;  1JJG A;  1S3O A;  3GTM H;  1F9Q A;  4LFA Q;  3TZU A;  1I6H H;  1D1I A;  3HOU B;  3FP9 A;  4RCO A;  3PUX A;  2A6H D;  1HUN A;  2Z1C A;  2EIF A;  4NB3 A;  1GXD C;  1VQA A;  1YBY A;  4L5T A;  2NVX B;  1I4H A;  1JOQ A;  3GO5 A;  2K50 A;  4XYQ A;  3PIO A;  1JMC A;  3S14 H;  2VS1 A;  3S1M H;  2N3S A;  3CF5 A;  1K9M C;  3NTK A;  3BJU A;  4EQ5 A;  2QEJ C;  1LTR D;  4EQN A;  1SND A;  2OXP A;  1PDQ A;  1N34 Q;  4RGN A;  4A3G G;  4FF1 A;  1K83 H;  2BDN A;  2F03 A;  4IUP A;  4ZAI A;  1U4M A;  2EXZ A;  2JSO A;  4OHJ A;  2HQE A;  4OO1 G;  3I4M B;  1EY4 A;  1KRT A;  3I4N G;  1G29 1;  4A3D G;  1ET9 A;  1C48 A;  4TVA B;  1LTA D;  4Y52 H;  3MHB A;  4C3J B;  3GTK H;  2JJQ A;  2F0S A;  4DV4 Q;  1NUC A;  1PRT D;  2ICE C;  2PCF B;  5JJZ A;  3A74 A;  1A3T A;  1XWE A;  2L5T A;  1EY9 A;  1G8Z D;  4AIM A;  2EY2 A;  1B7Y B;  3OW7 A;  5JOB A;  1EY0 A;  5JEA G;  1CZG A;  1DXM A;  4LUV A;  4KHV A;  2R7D A;  1B53 A;  4DR2 Q;  1PV4 A;  3GQB A;  4DPG A;  1KQS A;  4NKL A;  4LAA A;  2KA7 A;  1CK1 A;  3OHX C;  4BS9 A;  5C4X H;  1G6Z A;  4ULL A;  1VQ5 A;  2ZTC A;  1R9T B;  4OX9 L;  2D5D A;  2B2T C;  1B8A A;  1Y1V B;  3T1Y L;  3PCO B;  1I4R A;  3HKZ G;  1PMR A;  4J8Q A;  3NHH A;  1DOL A;  1BF4 A;  2PI2 E;  3GTO B;  1A0I A;  2EYP A;  1WD1 A;  1HPC A;  4A3B B;  4YWK A;  3PO2 G;  2QIL A;  5E7N A;  4NPS A;  4BXX H;  2ATW A;  3FMC A;  2VXW A;  3K57 A;  3LX0 A;  2ES2 A;  1UE1 A;  2A19 A;  5BN3 A;  4EQO A;  4R4C A;  3V96 A;  2K5N A;  5K36 G;  3E0E A;  2B2V C;  2IHE A;  4YHH L;  1TWG H;  4IOA A;  1SN8 A;  1PH9 A;  3E0J A;  3HOX H;  3R93 A;  2IX0 A;  3IFT A;  4JI4 L;  1HUM A;  1STH A;  2LFN A;  4OEM B;  4DUZ Q;  1UUP A;  5A2Q L;  4YWM A;  4F87 A;  4V0B A;  4DNI A;  2D9U A;  2MUY A;  5F2D A;  4KD4 A;  5IWA L;  3T1H Q;  4IUR A;  2Q8R E;  3MTS A;  4LF9 L;  2HCC A;  3URY A;  1KLG D;  5M3M H;  3K5O A;  1I4G A;  1OXS C;  2X6G A;  3ONA B;  2F0E A;  2RHQ B;  2IW3 A;  2Z4H A;  4PZ7 A;  2D62 A;  2Q8I B;  2OTJ A;  3FVQ A;  4GOP A;  1S5F D;  1GVP A;  2RSN A;  1DJR D;  2DGY A;  1D5M C;  1VQC A;  2J4X A;  4QY7 A;  5EPL A;  4IOC A;  2OWO A;  1STG A;  4BY7 H;  2JA6 B;  2VQE L;  4FF2 A;  5JEA J;  5IGD A;  2IX1 A;  4KTA A;  4C3H H;  1VF5 C;  1WTP A;  3HOV H;  3ICE A;  4BBS H;  2B8G A;  1A63 A;  4N8X 1;  5M3F B;  1PRT F;  4MTK A;  3R8B A;  5COY A;  5IGG A;  5IE8 A;  1HCZ A;  2CQA A;  3A7A B;  3M9B A;  5C0X H;  1PH2 A;  1CTM A;  3CHB D;  1PH8 A;  5C4J H;  2R7Z G;  1VQE A;  1X54 A;  2VQF L;  1X3F A;  1EOT A;  3NBH B;  1I94 Q;  3F2U A;  4A3M H;  2XRS D;  3FKI G;  2EJM A;  3W3A A;  1AEX A;  2DNC A;  3C2P A;  1VQK A;  4A3L H;  4NXN L;  2A1A A;  3U9S A;  2QEX A;  1OTC A;  2K5D A;  1SDF A;  4L5R C;  1ILQ A;  1IW7 C;  2WFW A;  1PFS A;  1LM0 A;  2BA0 A;  3K8A A;  1T5E A;  3F2C A;  1O7Z A;  1VQB A;  4X66 L;  3MXU A;  1YJ9 A;  2K6A A;  3H6M A;  4G7O C;  2AKW B;  4GN4 B;  4RKB A;  4XXE A;  4YCW A;  2A73 B;  1GJX A;  3PO3 H;  3AU7 A;  1J5E Q;  1TS4 A;  3VYR A;  2Z8L A;  5FO8 B;  2RDF A;  3T53 B;  5M5Y H;  4R1J A;  1DCZ A;  2FFK B;  4R8N A;  5COR A;  4BBR B;  3CXC A;  1JQY D;  4I65 A;  1SNQ A;  1N8R C;  5BR8 L;  3NE5 B;  4GN5 A;  2CH4 W;  5M5W B;  4AQY L;  3QOL A;  4UAI A;  1TS3 A;  3S16 H;  1HNW Q;  5E4X A;  2JA8 G;  4WRD A;  1L0Y B;  1W6K A;  3QG1 A;  3J80 E;  1BCP B;  3TZD A;  3RNU A;  4NMZ A;  4CJ2 C;  2Y0S G;  1C4Q A;  4JBJ A;  3KDF B;  1EZ6 A;  3I72 A;  4WOR A;  1H95 A;  2CCZ A;  1PXU A;  1U4R A;  2K33 A;  4BXX G;  5FLX E;  3M85 A;  3WOE A;  2EYM A;  3BZC A;  2F52 A;  5IP9 H;  1SFO B;  1ASY A;  1N33 L;  2NWG A;  1JR0 D;  5HGQ A;  3D3R A;  2OT2 A;  2OQK A;  3K7A B;  2JA5 B;  1RKN A;  3NWT A;  1HQR D;  4DGZ A;  5DEH A;  3VR2 A;  4O2D A;  4DR5 Q;  5LL6 S;  1YNJ D;  2IWH A;  1Z47 A;  5KNC A;  4A3J H;  4QJF A;  4JI3 Q;  3CCQ A;  1VCI A;  1W2B A;  4MIU A;  2JA9 A;  4ILW A;  4DR4 Q;  1QNU A;  3MXP A;  4JI7 Q;  4DAY B;  2VNU D;  2ZXR A;  2JA7 B;  3D8G A;  2M2L A;  4KHZ A;  2CFM A;  1EYG A;  5I2Y A;  3N6R A;  4DUY L;  1OO9 B;  2NBF A;  1QUQ A;  3NQI A;  4BY1 B;  1XMQ Q;  4BBS G;  1TWA H;  2IT1 A;  2P5Z X;  3M4P A;  3A8I E;  2NVT H;  1JB3 A;  3PUV A;  5IOD A;  2UXD Q;  4N8F A;  1YZ6 A;  3A55 A;  1FNU A;  4ZUJ A;  1ML0 D;  2JYO A;  2KCC A;  1E2Z A;  2L15 A;  1FJG L;  4WJ4 A;  1A15 A;  2UU9 L;  3H3V C;  1JJC B;  1MI2 A;  1NNX A;  3RUZ A;  2KJX A;  4P73 A;  4H02 A;  4KY5 A;  1Z7T A;  5C5L A;  2Z6K A;  3S1Q H;  3LGJ A;  3GTQ B;  4A3G B;  4DV2 Q;  4LF8 L;  4K5W A;  3GTG B;  2RVL A;  1XPR A;  4JI8 Q;  2NVQ B;  5ELD A;  2B2W A;  3I4N B;  1Q81 C;  1VDZ A;  2JP1 A;  1G2T A;  4A3D B;  2BE5 D;  4PV1 C;  5EKI A;  3PO3 G;  5I9O A;  2E2I B;  1MIU A;  4HCS A;  2BDO A;  4M1U B;  4R4O A;  4JBK A;  1M4V A;  4K6D A;  1F9S A;  3W1B A;  4RG1 A;  2G9D A;  4LFA L;  1B4O A;  5IT9 c;  3I70 A;  2F3I A;  2J7Z A;  1GUG A;  1I4P A;  1YIT A;  1P8L A;  4OIJ A;  3CRL C; 
#chains in the Genus database with same CATH homology
 4OL7 A;  1PFB A;  3DWA A;  1UEA B;  2K04 A;  2EOT A;  1GHJ A;  5EGT A;  1FGB D;  5KNB A;  3RZD B;  4C2M B;  5AFW A;  4FXK C;  5J39 A;  5KRU A;  3V2T A;  1BBX C;  1O7Y A;  4KKS A;  1SYD A;  3TP7 A;  1GUT A;  1HFG A;  5EBD A;  1Y1W B;  1EY7 A;  5C0X J;  2SEB D;  1ET6 A;  2AQ3 B;  3I3C A;  2M00 A;  3BVZ A;  2WKD A;  1V43 A;  1BOS A;  3VR5 A;  3M3Y B;  1F77 A;  2L12 A;  3M4Y A;  5JVH 3;  4LJZ C;  3A7L A;  3I8Z A;  3KLR A;  4F8M A;  3ND8 A;  4FF4 A;  3QWN A;  1C8C A;  1CZW A;  2ENB A;  2KHS A;  2XNA C;  2VB3 X;  4K14 A;  3MZ5 A;  2K28 A;  1BCP D;  4K8I A;  5C3X A;  2PZW A;  2C5C A;  2QDB A;  1LAB A;  2A5H A;  4H0L C;  1EEI D;  2IX3 A;  2PPB C;  2I07 B;  1R4P B;  1I6H B;  1CI3 M;  2EYF A;  2H1E A;  2EYH A;  5IT9 L;  5KYL A;  1BR9 A;  1JWS D;  2B8F A;  4DNT B;  3HZX A;  2E2D C;  2R7Z B;  2A74 C;  3T4A C;  3J81 E;  2ZT9 C;  2FHT A;  1K83 B;  1H9M A;  4PMB A;  4WJW A;  1BO0 A;  1IL8 A;  3FKI B;  1A6X A;  4JBW A;  3KK7 A;  4IAL A;  5LL6 X;  1MGS A;  3PUW A;  2EYL A;  4ME5 A;  2F0K A;  4ZK9 B;  1SNO A;  4I7Z C;  3MAQ A;  1JWU D;  3T51 B;  1S5E D;  2C9O A;  2RQX A;  1DZ1 A;  2K32 A;  1CHP D;  2X6L A;  4KY6 A;  1TKW B;  5EQ0 A;  3OOC A;  1XYI A;  3Q23 A;  4Y7N B;  1Q8I A;  4ZLT F;  2XSC A;  1S5D D;  1STA A;  1TII D;  3X3N A;  2B2U A;  5HGT A;  2HDM A;  3MEH A;  3WDN A;  1X32 A;  1SNM A;  2G9H D;  2B2Y C;  1NR2 A;  2NB0 A;  1D6E C;  2JA8 B;  1ZXT A;  2O4X A;  2KEC A;  3VYS A;  2KEE A;  1EY6 A;  2LY7 A;  2Y0S B;  1H9R A;  1ENA A;  1JE4 A;  4OO1 I;  4HED A;  1BCP F;  3QO2 A;  3FRP B;  4QUC A;  3K59 A;  4HMI A;  2TSS A;  5E1F A;  4XQQ A;  1EWC A;  1E2W A;  1H9S B;  5FK9 C;  1LT5 D;  2KOL A;  1KNE A;  4O1N A;  3V05 A;  2WIN B;  1II3 A;  3KLS X;  2XVS A;  3HG9 A;  4X3U A;  1G91 A;  2K1B A;  4F7X A;  3NUC A;  1LTB D;  3SHL A;  5EKL A;  5D65 A;  1PYW D;  2N88 A;  4DAY A;  5NUC A;  4BBS B;  1STN A;  4X3S A;  3ERQ A;  1SMY C;  1JOR A;  1CA6 A;  1Y8O B;  2F0G A;  1Q12 A;  2E74 C;  1J8I A;  1X3Q A;  2WV6 D;  2A68 D;  5A2Q E;  2WKC A;  1ZEQ X;  1QIL A;  4KN7 C;  3TP8 A;  2BE5 C;  5EKK A;  4KKT A;  3DMU A;  2AUJ D;  2I46 A;  5CV9 A;  2OEO A;  4XT3 B;  1EWH A;  4G4K A;  2Q8T A;  1TWC B;  1UNS A;  1IYU A;  1TQO A;  1BDO A;  3S2D B;  4KN4 C;  3PO3 B;  2MPM A;  1B50 A;  5KIX A;  2ZXP A;  5I9P A;  1E2V A;  3SVM A;  1XX8 A;  1A3U A;  4PQX A;  2L0C A;  3R2I A;  3S16 B;  2BA1 A;  2V4D A;  1JCK B;  3CU7 A;  3O13 A;  3MWY W;  5I6W A;  2A6E D;  3P7J A;  3BDC A;  3HS0 C;  3A8K E;  4EVO A;  5CC4 A;  4FF3 A;  1OXT A;  1LAC A;  1KDB A;  2F3W A;  4U68 A;  1HA6 A;  1D1K A;  2IJ0 A;  5C3W A;  4BWG B;  4K8J A;  1M8A A;  3AB9 A;  4IUT A;  4RCN A;  1F2M A;  1WTR A;  4XQN A;  4L63 B;  3AMU A;  4DF7 A;  1BXT A;  2R6G A;  3DM1 A;  4C1N K;  1BCP C;  1LTS D;  1SYE A;  3K5L A;  1EL0 A;  2KVM A;  3OMC A;  1KTK A;  3HOY B;  1KNA A;  2WP8 J;  4Q0F A;  1QE6 A;  3KUP A;  3QJY A;  2ZXO A;  1HTP A;  3W2D A;  1PLF A;  1ROD A;  2EE1 A;  5C44 B;  4R8I A;  1OXX K;  1UAP A;  1ICW A;  3LNN A;  4K5V A;  1IKM A;  3OIP A;  5FOB B;  3M7N A;  2PMZ B;  2R93 B;  1BQQ T;  2PZU A;  1LTT D;  5KYI A;  4XQJ A;  1IHZ A;  2DNE A;  5EBC A;  5EPK A;  1ENF A;  3JAM L;  4DK0 A;  3C3L A;  1H9J A;  1SE3 A;  4K5X A;  5LHY 1;  2F0O A;  5I2X A;  4DNR B;  5IIF A;  4XTC S;  1IKL A;  4DU9 A;  2NZ1 D;  1RHP A;  3J7A V;  2DY8 A;  3UI2 A;  4QIW B;  3A56 A;  4HTH A;  3TP6 A;  2XIW A;  2K5Q A;  4RA8 A;  3D4D A;  1FNW A;  2KUM A;  1B44 D;  2LKV A;  1VMP A;  1QG7 A;  2SDF A;  3GV3 A;  2IL8 A;  5CV8 A;  3OSO A;  2F0W A;  3BDO A;  4RAU C;  5JPN C;  1AFP A;  3P20 A;  3N52 A;  5C0X I;  2KCN A;  1JC7 A;  1ESF A;  1NR4 A;  1LLR D;  3RD4 A;  4G57 A;  5FO9 B;  3S9W A;  3Q22 A;  3K5M A;  4TSS A;  1ENC A;  1O80 A;  2F0N A;  5CV5 A;  2GA4 B;  4KY7 A;  3TDQ A;  2K03 A;  3K6O A;  3S15 B;  1CM9 A;  2AWO A;  1Y69 U;  5IOC A;  4XT1 B;  3QIA A;  4UDU C;  2K05 A;  2A6H C;  2B39 A;  1RF2 D;  3SK8 A;  2RKS A;  5ISR A;  4C3H G;  4ZKB B;  5CV6 A;  4V19 0;  4A93 B;  1TS2 A;  1PZJ D;  1Z6H A;  4CKB A;  1B3A A;  3CRK C;  1PTO B;  3IFD A;  4Q5V A;  5C0X G;  2FMM A;  2E75 C;  2X69 A;  1CHQ D;  1H9S A;  3PIO 3;  1EU4 A;  3J80 L;  2F0T A;  1STY A;  3VR6 A;  1KAB A;  2KQ3 A;  2RDH A;  2NN6 H;  4M8A A;  4ZKC B;  1PRT C;  4U67 3;  3BYY B;  5CV7 A;  2XWB B;  2RDG A;  1S5B D;  3GTP B;  4LMQ D;  4RKL A;  3U9O A;  1V1P B;  1DM0 B;  3P75 A;  2VUM B;  3PV0 A;  4Z9C B;  1GOZ A;  4B9X A;  3OWE B;  3BG3 A;  1X3P A;  2F1M A;  1F2L A;  1PZI D;  1Q1E A;  2M9V A;  4IFD H;  2XRQ D;  1SXT A;  1V1O A;  2YYZ A;  2Z4I A;  1STE A;  3MFG A;  1SJE D;  1G2S A;  3NXW A;  3NP8 A;  1XTC D;  4KJN A;  5KND A;  4MN3 A;  1EYD A;  4O42 A;  3HKZ B;  1S5C D;  1S4Z A;  1FD7 D;  3MVV A;  2L11 A;  2A6E C;  4BA1 I;  3PO2 B;  4JK1 C;  4KV6 A;  2EVB A;  3S17 B;  1DOM A;  1TWF B;  3RZO B;  3T56 B;  2EDG A;  3J7Y W;  1QJO A;  1I3Q B;  3Q6S A;  2EY1 A;  2EJG C;  3SK6 A;  3S1N B;  1R4Q B;  2IPK D;  3I90 A;  1HFN A;  1ONL A;  3SK4 A;  4CKC A;  5CBE E;  1PFN A;  1AZP A;  1GUS A;  1MBY A;  4DK1 A;  3I4L A;  4IUN A;  3CQZ B;  3DXJ C;  3L9A X;  3MXN A;  1VF7 A;  4IZ8 A;  1A3V A;  5CYU A;  4RH6 A;  3GTM B;  5BN5 A;  1MSH A;  2QKI C;  3KBX A;  3D6W A;  3HP3 A;  2ICI A;  1BUV T;  1CQF A;  4CGY B;  3ND9 A;  4FXG C;  2MJ8 A;  2O5I C;  1E0B A;  3S14 B;  5CMD A;  3S1M B;  5J1Z A;  1EIG A;  1A2T A;  1YNN D;  2PYK A;  3SE0 A;  1STB A;  3KF8 A;  1LT6 D;  4ABN A;  3NSW A;  3QOJ A;  4ZUI A;  4ZQ3 A;  1TY2 A;  2DY7 A;  4HSV A;  2L1B A;  3GTK B;  1IW7 D;  1ILP A;  3TN2 A;  2B2T A;  1AZQ A;  1AN8 A;  5I4D A;  3IKJ A;  4KI0 A;  1GUO A;  2N55 A;  2O2L D;  1F2Z A;  2PO4 A;  3KBG A;  3MFY A;  4HMJ A;  4CKE A;  5TSS A;  2B2W C;  1PTO D;  5EJW A;  4S3S A;  5KGU A;  5C4X B;  3E5S A;  1TU2 B;  2B2V A;  2EYO A;  5ELC A;  3FDT A;  4HN7 A;  3WOF A;  1FR3 A;  4QF4 A;  1SJH D;  2XWJ B;  5T1I A;  4GZY C;  3ZYY X;  1SE4 A;  4A3I B;  4MHE A;  1KDA A;  2E76 C;  1YNJ C;  3MXG A;  3CKI B;  4QCL A;  5K36 H;  1TWG B;  4DXF A;  3HOX B;  2MGS A;  1GUN A;  3ERO A;  4CBV A;  3Q0A A;  4N9T A;  3J81 L;  4NDX A;  1LO5 D;  1JIC A;  3NK9 A;  2JEB I;  2PNR C;  3J7A F;  5M3M B;  3C46 A;  2JE6 I;  4RHR A;  4DN4 M;  1KLU D;  5C4H A;  4E6I A;  2F0Q A;  1HTL D;  4TQU S;  1TWH B;  1WD0 A;  3D6C A;  4IFD J;  4BY7 B;  4FVM A;  3DEP A;  4C3H B;  3HOV B;  5C6A A;  2CW0 D;  2NTT A;  2PW5 A;  4QUF A;  1LTI D;  1LV9 A;  1U4P A;  4FYD A;  5C4J B;  3X3M A;  1EFI D;  1SEB D;  3G6J B;  2EJF C;  5ELB A;  1PTO F;  4A3M B;  2RA4 A;  1EYC A;  5A35 A;  2DN8 A;  1CT1 D;  3TME A;  4QB4 A;  1CFM A;  4OIK A;  2KED A;  5I6Y A;  2F0P A;  3HEJ A;  4HAE A;  1WCM B;  3FPU B;  5D14 A;  2RSO A;  2NUC A;  1LTG D;  2L55 A;  1Y8P B;  2LMC B;  1WTX A;  4OGQ C;  1OXV A;  3SEB A;  2ID0 A;  5M5Y B;  3TP5 A;  5CV4 A;  1NSN S;  2K5W A;  1V1P A;  3I91 A;  3M7G A;  3PIP 3;  4KMU C;  1AW7 A;  3K0Y A;  3A54 A;  3BVM A;  4PNY A;  3BZD B;  3IL8 A;  3E6Z X;  5DNF A;  4IQZ A;  4KJO A;  1L0X B;  1F9P A;  2B2U C;  1HHV A;  1SE2 A;  4K2K A;  1MSG A;  5G3L D;  5EPJ A;  1H9K A;  3JAM E;  4G7H C;  1SYB A;  1HQM C;  1SSO A;  2RBM A;  4HCE A;  1Q90 A;  4B9W A;  3H09 A;  4C3I G;  5FO7 B;  2QCP X;  3NTH A;  3DEO A;  5JAV A;  4A3J B;  2F3V A;  2AQ2 B;  2A69 D;  2AQ1 B;  2HCI A;  3P1H A;  3C1F A;  3EJI A;  2MP1 A;  3H94 A;  4NP5 A;  1DD2 A;  1CA5 A;  5K5P A;  3SR1 A;  2HDL A;  1TY0 A;  1J9O A;  1PZK D;  2WB1 B;  4FNF A;  4PMW A;  4C56 C;  1TWA B;  4QMG A;  2NVT B;  2JEA I;  1D5X C;  1I4X A;  1YNN C;  3RMH A;  3I73 A;  5E4W C;  5IGB A;  2F0J A;  1DOK A;  4EQP A;  1Q1B A;  3DUZ A;  3VYU A;  3RLF A;  3EQL C;  1FYC A;  1ESR A;  3QB3 A;  1KDC A;  4X3T A;  3NTI A;  3S1Q B;  1QB5 D;  2F0M A;  1U4L A;  2TMP A;  4K2L A;  2AUK A;  1B9M A;  5IGE A;  1RTO A;  4KKU A;  1SAP A;  5C4Z A;  1ZYR D;  3D4W A;  4YIJ A;  1PTO C;  1TVX A;  3K58 A;  3ITP A;  5DAU A;  4H7B A;  2YU9 B;  5G3L F;  3TSS A;  4RGT A;  5J22 A;  1F9R A;  1O78 A;  5D3D A;  1FNV A;  4HSP A;  2PZT A;  1EQV A;  5ELE A;  3VR4 A;  2F4I A;  3VA7 A;  3NQT A;  4HR7 B;  2EZV A;  1U9R A;  3A8J E;  1QCB D;  3L3O C;  3VA5 A;  2WII B;  2AWN A;  1D5Z C;  1I6V C;  3DWP A;  4FXD A;  3MC0 B;  4DAV A;  2BCO A;  2H4O A;  5JPM C;  4G7Z C;  4H44 C;  3H91 A;  1DYQ A;  1O7L A;  3BVG A;  1JWM D;  1MD2 D;  2D2C C;  2F0D A;  2JXM B;  4DXG A;  1WTQ A;  4B08 A;  4EGV A;  1JOK A;  3VYT A;  4IUU A;  4DFA A;  1SYC A;  4TKO B;  5KEE A;  4BA2 I;  4RGM A;  4RWS C;  1LT3 D;  2E2H B;  4AYB B;  2CHB D;  1WTO A;  5C5M A;  2FMC A;  3LWU A;  3MA2 B;  2CW0 C;  1CQV A;  1BNZ A;  5C3E B;  2WAQ B;  3BDL A;  3D31 A;  1AP0 A;  1XXG A;  4CHT B;  3EVQ A;  2A68 C;  4TRD A;  4C3J G;  4L6T B;  1EEF D;  5FLX L;  4RFB A;  2EY5 A;  3OIQ A;  3DWQ A;  1SMY D;  5D3I B;  5ELF A;  4IN3 A;  2F0H A;  2QF7 A;  5CGK A;  1K8O A;  1HA5 A;  4RHS A;  1SNC A;  2LS0 1;  1KAA A;  1VMC A;  1PFM A;  3C1E A;  3NPP A;  3R2T A;  2E2J B;  1QOH A;  1EQT A;  2B2Y A;  4H13 C;  5T1G A;  1RTN A;  2L4N A;  1QNK A;  4KD3 A;  2NVY B;  2FIN B;  3NBI A;  5IT9 E;  3FPP A;  2OF1 A;  1I50 B;  3BYT B;  2EY6 A;  1OXU A;  5M9O A;  4CJ0 B;  1GUW A;  2B63 B;  2EYJ A;  1I4Q A;  3KLS A;  1EYA A;  1TT2 A;  1NCV A;  3SK5 A;  3EFX D;  3SXH A;  2NN6 I;  1LT4 D;  1RD9 D;  5IGF A;  4FP5 D;  3HRZ C;  3R3O A;  4ODG A;  2F0F A;  3GTL B;  1EIH A;  1F2Y A;  1W6J A;  1WTW A;  4XYO A;  4DA2 A;  1EY8 A;  2VB2 X;  4J1M A;  1PRT B;  1WVL A;  5IGC A;  3K5N A;  2HUG A;  5DM7 3;  2NTS A;  2A69 C;  4KK7 A;  2F0L A;  2K7V A;  4LK1 C;  5JVG 3;  2SOB A;  4IFD I;  1Q3L A;  4L8J A;  1TS5 A;  4C3I B;  2K01 A;  1PTO H;  1EZ8 A;  1QWY A;  3LWE A;  3EA6 A;  4J6H A;  4ID6 A;  4A3K B;  4IUV A;  3OWF A;  1SBB B;  3DHQ A;  1RCV D;  5DM6 3;  4DAP A;  3S2H B;  2NN6 G;  1B2T A;  2F0U A;  3GP7 A;  5M5X B;  1DON A;  4OO1 H;  2R92 B;  3VR3 A;  3M4O B;  3T13 A;  3D4R A;  1EY5 A;  4A3F B;  2MHV A;  1TR5 A;  1EU3 A;  2L9H A;  4ZRZ A;  2WAC A;  4WFN 3;  2O5J C;  5CBA E;  1RDP D;  5FKA C;  3S1R B;  3PUY A;  1HXY D;  1JOO A;  1T5X D;  1ZYR C;  4IFD G;  1A2U A;  1B9N A;  2PQE A;  5JEA H;  2EPB A;  4C1N I;  3NBH A;  4R9W A;  4XIG S;  3L7Z C;  1D2B A;  2F0V A;  1NAP A;  1K8M A;  5E3F A;  5CR3 A;  2SNS A;  3OMG A;  1V8Q A;  4CJ1 B;  3H0G B;  3PMF A;  4XDX A;  4ZYS A;  1Y8N B;  4N9P A;  1RJT A;  4PMC A;  1WTV A;  1SYG A;  3SDZ A;  3GD7 A;  4X3K A;  1SNP A;  2FJ2 A;  2BOS A;  4P2C B;  1HRJ A;  1GHK A;  3OPO A;  4NW2 A;  2J0T D;  2PW7 A;  3NWS A;  2R61 A;  3FEW X;  5HUR A;  1ZKO A;  4F88 A;  3HOZ B;  3IAY A;  2SNM A;  4A3E B;  4FO2 A;  1IYV A;  3GTJ B;  3G7L A;  3T16 A;  5BN4 A;  2F0I A;  2R3Z A;  3HGB A;  3BS1 A;  3PUZ A;  4K6L A;  3GV6 A;  1SYF A;  1B1Z A;  2NYZ D;  2CVR A;  4IUQ A;  2XN9 C;  3TBI B;  4RGO S;  3Q24 A;  3HOW B;  1F9Q A;  3TZU A;  1D1I A;  3HOU B;  4RCO A;  3PUX A;  2A6H D;  1HUN A;  2Z1C A;  1GXD C;  2NVX B;  1I4H A;  1JOQ A;  3GO5 A;  4XYQ A;  3NTK A;  2QEJ C;  1LTR D;  4EQN A;  1SND A;  2OXP A;  1PDQ A;  4RGN A;  4FF1 A;  2BDN A;  2F03 A;  4IUP A;  4ZAI A;  1U4M A;  2EXZ A;  2JSO A;  4OHJ A;  2HQE A;  4OO1 G;  3I4M B;  1EY4 A;  1G29 1;  1ET9 A;  1C48 A;  1LTA D;  3MHB A;  4C3J B;  2F0S A;  1NUC A;  1PRT D;  2ICE C;  2PCF B;  5JJZ A;  1A3T A;  1XWE A;  2L5T A;  1EY9 A;  1G8Z D;  2EY2 A;  3OW7 A;  5JOB A;  1EY0 A;  5JEA G;  1CZG A;  1DXM A;  4KHV A;  1B53 A;  3GQB A;  4NKL A;  4LAA A;  2KA7 A;  1CK1 A;  3OHX C;  4BS9 A;  1G6Z A;  4ULL A;  1R9T B;  2D5D A;  2B2T C;  1Y1V B;  1I4R A;  1PMR A;  4J8Q A;  3NHH A;  1DOL A;  1BF4 A;  3GTO B;  2EYP A;  1WD1 A;  1HPC A;  4A3B B;  2QIL A;  3FMC A;  2VXW A;  3K57 A;  3LX0 A;  5BN3 A;  4EQO A;  3V96 A;  5K36 G;  2B2V C;  3E0J A;  3R93 A;  2IX0 A;  3IFT A;  1HUM A;  1STH A;  2LFN A;  1UUP A;  5A2Q L;  4F87 A;  4V0B A;  2D9U A;  2MUY A;  5F2D A;  4KD4 A;  4IUR A;  2Q8R E;  3MTS A;  2HCC A;  3URY A;  1KLG D;  3K5O A;  1I4G A;  1OXS C;  2X6G A;  3ONA B;  2F0E A;  2IW3 A;  2Z4H A;  2D62 A;  2Q8I B;  3FVQ A;  1S5F D;  2RSN A;  1DJR D;  1D5M C;  2J4X A;  5EPL A;  1STG A;  2JA6 B;  4FF2 A;  5JEA J;  5IGD A;  2IX1 A;  4KTA A;  1VF5 C;  1WTP A;  2B8G A;  5M3F B;  1PRT F;  3R8B A;  5COY A;  5IGG A;  1HCZ A;  2CQA A;  3A7A B;  5C0X H;  1CTM A;  3CHB D;  1EOT A;  3F2U A;  2XRS D;  2EJM A;  3W3A A;  1AEX A;  2DNC A;  3C2P A;  3U9S A;  2K5D A;  1SDF A;  1ILQ A;  1IW7 C;  2BA0 A;  1T5E A;  1O7Z A;  3MXU A;  2K6A A;  3H6M A;  4G7O C;  4RKB A;  4XXE A;  2A73 B;  1GJX A;  3AU7 A;  1TS4 A;  3VYR A;  2Z8L A;  5FO8 B;  2RDF A;  3T53 B;  1DCZ A;  2FFK B;  4R8N A;  5COR A;  4BBR B;  1JQY D;  4I65 A;  1SNQ A;  3NE5 B;  5M5W B;  3QOL A;  4UAI A;  1TS3 A;  5E4X A;  4WRD A;  1L0Y B;  1W6K A;  3QG1 A;  3J80 E;  1BCP B;  3TZD A;  4NMZ A;  4CJ2 C;  1C4Q A;  1EZ6 A;  3I72 A;  4WOR A;  1PXU A;  1U4R A;  2K33 A;  5FLX E;  3M85 A;  3WOE A;  2EYM A;  1SFO B;  2NWG A;  1JR0 D;  3D3R A;  2OT2 A;  3K7A B;  2JA5 B;  1RKN A;  3NWT A;  1HQR D;  4DGZ A;  5DEH A;  3VR2 A;  5LL6 S;  1YNJ D;  2IWH A;  1Z47 A;  5KNC A;  1VCI A;  4MIU A;  4ILW A;  1QNU A;  3MXP A;  2VNU D;  2ZXR A;  2JA7 B;  3D8G A;  2M2L A;  4KHZ A;  5I2Y A;  3N6R A;  1OO9 B;  2NBF A;  3NQI A;  4BY1 B;  2IT1 A;  3A8I E;  1JB3 A;  3PUV A;  5IOD A;  3A55 A;  1FNU A;  4ZUJ A;  1ML0 D;  2JYO A;  2KCC A;  1E2Z A;  1A15 A;  3H3V C;  1MI2 A;  3RUZ A;  2KJX A;  4KY5 A;  1Z7T A;  5C5L A;  3GTQ B;  4A3G B;  4K5W A;  3GTG B;  2RVL A;  2NVQ B;  5ELD A;  2B2W A;  3I4N B;  1VDZ A;  2JP1 A;  1G2T A;  4A3D B;  2BE5 D;  4PV1 C;  5EKI A;  5I9O A;  2E2I B;  4HCS A;  2BDO A;  4M1U B;  1M4V A;  4K6D A;  1F9S A;  2G9D A;  1B4O A;  3I70 A;  1GUG A;  1I4P A;  2J7Z A;  4OIJ A;  3CRL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...