5E3FA

Crystal structure of staphylococcal nuclease variant delta+phs i92k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e3fA00
1U9RA 1SYEA 2F0SA 1TQOA 1A2TA 1EY7A 1TT2A 2F3VA 2PW7A 4PMBA 5JOBA 1STGA 3SXHA 1SYCA 4J6HA 4K14A 4S3SA 3PMFA 5KIXA 4R8NA 5F2DA 5I9PA 2F0JA 3SHLA 4KV6A 3SK6A 1AEXA 4ODGA 2EY6A 2M00A 1SYFA 4KY5A 4N9PA 3RUZA 2PZWA 2F0PA 3R3OA 1TR5A 3TP6A 3V2TA 4B9XA 2F0HA 3C1FA 4HMIA 5IGCA 5C4ZA 3SK8A 3S9WA 4K6DA 5IODA 2F0DA 4ZUJA 4EQOA 1EYDA 5ISRA 5EKKA 2F0UA 4N9TA 1A2UA 1RKNA 4HMJA 4EVOA 5J39A 3SR1A 1IHZA 2PZUA 3MHBA 3NUCA 1EYAA 4KD3A 3D8GA 4OL7A 4IZ8A 2OF1A 3NXWA 4KTAA 4RKBA 5IGFA 1EZ6A 3HEJA 3U9OA 5K5PA 1A3TA 2HQEA 1SYDA 3LX0A 4DU9A 5IGEA 3MVVA 2F0KA 3MXPA 4KD4A 4RKLA 1STNA 1II3A 2EY1A 1EQVA 1EY5A 3H6MA 4YIJA 3HZXA 4ZUIA 3TP5A 2O4XA 4DF7A 4E6IA 5DEHA 4PMCA 3NHHA 1A3VA 5CV9A 5E3FA 5IIFA 1EY6A 2EY2A 4EQPA 4KJOA 1JOQA 2PYKA 5C4HA 1EY9A 2F0WA 1SNOA 5I6YA 5KEEA 4G57A 5HURA 2EYJA 5NUCA 5C3XA 5KRUA 3QB3A 1EY0A 2F0LA 2SNSA 1JORA 2F0FA 1KABA 1NSNS 1KDCA 4K8JA 1F2ZA 5CV6A 2F0GA 4F8MA 5IOCA 5KYLA 2F3WA 4PNYA 1A3UA 5HGTA 3BDCA 3MZ5A 2EY5A 4NP5A 3SK5A 4QMGA 4DFAA 5EGTA 4KJNA 4IALA 4K5XA 5C5LA 2ENBA 1ENCA 5E1FA 1STHA 3OMGA 1F2MA 2F0VA 2KQ3A 3NQTA 2EXZA 4MIUA 5IGBA 2EYMA 2SNMA 1SNQA 3E5SA 5CV4A 5IGDA 2EYFA 2F0OA 4ID6A 4K5WA 4K2LA 5JAVA 2PZTA 3ITPA 3OWFA 2OEOA 2F0MA 3D6CA 2QDBA 5I9OA 4HTHA 4KY6A 3QOJA 1SYBA 1EY4A 4ZQ3A 5CV8A 4DGZA 1EYCA 3EROA 2EYLA 2EYHA 1KAAA 5CGKA 5J22A 2F0QA 2RKSA 4EQNA 4ME5A 5EKLA 2EYPA 2OXPA 2F0IA 2F0EA 4WORA 3TP8A 1KDAA 5C5MA 3T13A 4K2KA 5CV5A 1EY8A 1NUCA 1STAA 2EYOA 2PQEA 3OMCA 5DAUA 5KYIA 2RBMA 3C1EA 4KY7A 3OSOA 4WRDA 1KDBA 4J1MA 4F7XA 5CC4A 3DMUA 5M9OA 2F0TA 1SNPA 2WACA 1STBA 4KHVA 1SNDA 2NUCA 1ENAA 3MEHA 2F0NA 3BDLA 4I65A 4LAAA 5IGGA 4QB4A 2SOBA 3EVQA 1F2YA 3NK9A 4QF4A 4TRDA 4NMZA 3ERQA 1EZ8A 3TP7A 4NKLA 3P75A 5CV7A 5C6AA 1JOOA 3D4DA 3TMEA 2RDFA 3DHQA 3P1HA 5KGUA 1SNCA 2PW5A 3SK4A 2LKVA 3D4WA 2KHSA 5J1ZA 4B9WA 5I6WA 4IUNA 1SNMA 3EJIA 4NDXA 4K5VA 1STYA 4K8IA 1JOKA 4H7BA 3T16A 5C3WA 3QOLA 5CR3A 3VA5A 3NP8A 1SYGA
chains in the Genus database with same CATH superfamily
1GD7A 4WJWA 1E1TA 4G7HC 2OWOA 2RCFA 3GTKB 3D3RA 3A5ZB 5JOBA 1JT8A 1C7YA 1SJHD 4KV6A 5IYBH 1TU2B 1NMFA 1C0AA 2WIIB 1X56A 2F0HA 1VQDA 1I3QB 3Q24A 5IP9G 4A3LH 4O0AA 4RHRA 4WJ4A 1TS4A 3ER0A 2B8GA 5EKIA 2PPBC 3M4PA 3MXUA 4RKBA 4GKKQ 3HEJA 4IUQA 2WB1G 3MXNB 2PQAA 4IUTA 5FK9C 3WWVA 4TSSA 1EYGA 3EQLC 4ZUIA 1AFPA 1HHVA 3KF8B 1HZ9A 1R4PB 1G51A 1EIFA 1JB7A 1YVCA 3FKIB 4F88A 2K5NA 2AUJD 3ND9A 2EYJA 5NUCA 1IZ6A 1H9SA 1VQBA 3A8KE 4N8FA 3CCUA 3T1YQ 4C3IB 4OIKA 2F0LA 4C3HB 3GTLH 2JA5G 1A3UA 1MKHA 2EY5A 1Y1VH 3FPPA 2KECA 4IPDA 1K73C 2ZT9C 5IYDG 4YY3Q 3JAMi 2R7ZH 2R93H 2ZXPA 1FYCA 5L37A 4X64Q 3NQTA 2B63H 3KUPA 3CCEA 4MTNA 4CJ2C 4A76A 2ICEC 1N34L 3ITPA 5M3FB 2NB0A 2OEOA 1HZCA 3DEOA 4ABNA 1K3BC 1I4QA 4ULLA 1KAAA 2F0QA 2M9VA 1O7YA 1WI5A 3M85A 4GOPA 2NVYB 4DV7Q 1PH7A 3F2DA 5C5MA 3PUZA 1S5ED 3OMCA 3J80i 1X3QA 3K6OA 4DAVA 3OSOA 1XNQL 1L1OB 3RN2A 4XDXA 1AP0A 1SMYD 3NEMA 3DMUA 1A8VA 3VYRA 5FOBB 1MD2D 4DV5L 1AE3A 5ELCA 1D6EC 3G6JB 1U5KA 4RFBA 3K0YA 4DR6Q 2ZM6L 1LTRD 1RHPA 2MHVA 5M5WB 1PYWD 1BXTA 1Y1WH 1JOKA 2HCCA 1CA6A 1K0RA 3W1GA 2L1BA 1O78A 4PMBA 4DR5Q 4LF4Q 4A3DB 3ULLA 3PO2B 1C9OA 4DV1Q 3CAMA 1XMOL 1AH9A 3I3CA 1SYFA 1EWIA 4KN7C 1U4MA 3SK8A 2ES2A 3S1RH 1IBLQ 3IRBA 4EVOA 1BQQT 3A74A 5C44G 2F4VQ 3I7FA 4NW2A 1JQYD 2VW9A 1WCMG 1ILPA 4DR4L 2NBFA 2WB1B 4E6IA 4DV6Q 3BVGA 3T1HL 2HIVA 2QDLA 2JA6G 4KJOA 1XMQL 1TWHB 4RHSA 2Q2HA 2YU9B 3CD6A 4GN5A 1PFMA 5C3XA 4K0KQ 3W2DA 1PZKD 2SNSA 4HIDA 1KABA 2KCMA 3J7ZC 2ATWA 1Y8NB 4BY7B 2R3ZA 2E74C 1Q3LA 3S15H 1I94L 3QWNA 4JI5L 1S40A 4IALA 4R1JA 2VQEL 2JA5B 5E1FA 2AMCB 1GXDC 2F4IA 3GTQH 1M4VA 2EXZA 1BKBA 1L2FA 4YWKA 2PZTA 3KLSA 4OX9Q 2WFWA 2XVSA 3H0GG 4BY1H 3W5OA 1XJVA 4Q0FA 2OTJA 2DNCA 5EKLA 2UXBQ 2PCFB 4WORA 3CMEA 3MA2B 1Q7YC 2R61A 1NUCA 4TVAB 1LLRD 1M1KC 2PMZE 3U9SA 4LNQA 3FPUB 2YYZA 2RBMA 4A3FG 4J1MA 1SXTA 1FGBD 4OHJA 3NBHA 3J7AF 1STBA 4JI3L 3MEHA 1ENAA 4B3RQ 2CW0D 1DOLA 3AYHB 3SVMA 5AFWA 5JJLA 1V1PB 1GUSA 2PQAB 2JN4A 4LF6L 2RVLA 3MWYW 1OTCA 1VQHA 4K5VA 2MFIA 1HTLD 5CR3A 4K5XA 4GLAC 5EPKA 4QUFA 2Q8IB 1K8OA 5HGQA 4IOAA 1A2TA 1EY7A 2VUMG 1QILA 2AWNA 1XXGA 2CCZA 4N9PA 1ZYRD 4B3ML 1HTPA 1B2TA 4R9WA 1B3QA 5C4JH 4RCOA 3C1FA 4R4QA 1E1OA 4X66L 1PVOA 5C4ZA 4DA2A 1WFQA 4DV2L 1LT6D 4CHTB 3S16B 4QGUA 4LK1C 4CBVA 5C4XH 1A2UA 1IW7D 1KC8C 1EQTA 3TDQA 2HQLA 2UUCL 2EQSA 3D8GA 1ILQA 4POGA 3D0FA 4XT1B 5ELEA 5CORA 3V96A 3K7AB 3HP3A 3M4OB 5IGEA 5KNBA 1KNAA 5C44B 5M3MG 3RR5A 1EWCA 2L0CA 4OWTB 2HIXA 3IL8A 4YCVA 1YEZA 1YNND 3U4VA 3CQZB 3OTOL 4FF2A 4Y52H 1SNOA 2BOSA 4RH6A 1J8IA 3HOXH 4P2CB 4H02A 1E3PA 3K5MA 2JP1A 1S72A 1NSNS 1RL2A 2F3WA 2Z4IA 4LF5L 4FVMA 3DWAA 4A3BH 4CDCC 5LL6S 1WTHA 2KBNA 3DM3A 3K5OA 4MIUA 1AN8A 3E5SA 2BDNA 2F0OA 1IBKQ 5K36G 1LT5D 1VMPA 4HIOA 3MEFA 3H15A 3KK7A 1SYBA 3UDFA 2B2TA 1GHKA 1MBYA 4EQNA 4XT3B 2R6GA 4A3MH 4B3TL 3H0GB 4A3IG 2K01A 3TP8A 1Q90A 2K50A 4G7OC 2E76C 2UXDQ 1GUOA 5T1GA 2KENA 1PZJD 1B9MA 3D31A 5JEAJ 3PSIA 4QJFA 5EPLA 4A3FB 4LAAA 1F2YA 3L9AX 3OOCA 4NMZA 5JEAH 1W6JA 3TP7A 2QEXA 4NKLA 4G4KA 3ULPA 1EEFD 3P1HA 2K7VA 3FRPB 3X3NA 1ESFA 1X9NA 2EJFC 1D1KA 4FO2A 1J5EQ 3CC7A 4K8IA 4H7BA 3VA5A 3HOWH 3VR3A 1G91A 1G291 4JBJA 1TWFB 5E7NA 5DNFA 2CVRA 2PW7A 1TS5A 1SYCA 4K14A 4A3KH 4R8NA 1S3OA 2F0JA 3NSWA 2IX1A 1H95A 2EXDA 4ZKCB 1NTGA 5EAYA 2KHJA 3BDOA 5D3IB 4Y7NB 2UUBQ 2R92B 4KKSA 2DJFC 2VUMB 1J6QA 4ZRZA 5I2YA 3S9WA 3GP7A 1K83H 1VQEA 4OIJA 4EQOA 2VQFL 1WOCA 4FXDA 2P5ZX 1WTPA 2DJGC 1HXYD 3EN2A 2PO4A 3S1QH 5IGFA 4L6TB 2I0QA 3K80C 3KDFA 5IYCG 3BVZA 3J7YW 2GN5A 5CBEE 3I72A 1LABA 1NCVA 5DEHA 4A3JB 5M3MB 3NHHA 3H3VH 1A3VA 5E3FA 1VQMA 3KF6A 2MO1A 2B2TC 4H44C 4FP5D 3I4LA 2K5HA 4HIKA 2K33A 4QUCA 1HUNA 2E5LL 3GTKH 2K04A 3PUYA 3IFTA 2B2YC 2D0PA 4HJAA 3L7ZC 2K05A 2G9HD 4YWLA 5M5YH 4Q5VA 1UWVA 5GAGC 4YHHL 5AJ3L 4OO1H 1I3QH 3CRLC 1ENCA 3OMGA 4JBMA 1F9RA 4A3CG 3NE5B 2PI2E 1JCKB 2H5XA 4JI6L 3VYTA 3CCQA 1HCZA 4GNXC 1G6PA 4HEDA 4DKAC 3KLSX 3E9HA 3VR6A 2BE5D 2PQEA 3FKIH 2UUAQ 4DR7Q 2VY3A 4A3IB 3I8ZA 2ZJRA 1KDBA 2JA9A 4IQZA 4C3IH 4A93B 2YV5A 3M7GA 4KHVA 2F0NA 4JG2A 3MXNA 1LYLA 1JJ2A 1I4XA 4LMQD 1EZ8A 1B53A 2A74C 5KNDA 5FLXL 3DHQA 1HNZQ 4KHPQ 3KF8A 3SK4A 5J3BA 1G2TA 5J1ZA 4IUNA 1RD9D 1IYVA 2LXJA 5M3FH 2NZOA 4X65L 5BR8L 2E2HB 3T4AC 1SSOA 1WTVA 1SFOB 3KFUA 2GA4B 2NVYH 3MFYA 3VR4A 3SK6A 4ODGA 5LMNQ 4QL5A 5C3EG 3GTMB 4O2DA 2ZXRA 4JVZA 2E2IH 4A3EG 4APVA 2EJMA 4C2MB 1YIJA 1A3TA 1LUZA 3FDTA 4ZK9B 1Q12A 5M5WH 4KKUA 2FMCA 3PCOB 3H6MA 3HZXA 1LM0A 1H9RA 3CHBD 3HOUG 2IWHA 3J81E 1C48A 1L1OA 3ULJA 1ET6A 4LF8Q 1PH6A 1PYBA 4A3DH 3GTGB 1G8ZD 5IWAQ 1IXRA 3PO2H 5KNCA 1I4GA 4DR1Q 5HGTA 4OELB 1YHBA 5EGTA 1FJGL 3OHXC 4ZCKA 4A4IA 3RNUA 2IY5B 1EQQA 3DXJC 2QGQA 3ZJYC 4L5TA 3CW2C 2K5DA 1VQ6A 1IBMQ 5CV4A 5IP9H 3JAMc 4GNXB 1B50A 5FJ8G 1KRSA 4GKJL 5I9OA 3TZUA 4ZQ3A 2ZJQA 1SEBD 1UNSA 3J80L 4C3HG 1Q1BA 1I4PA 3I4NG 3QR8A 4BA2I 1OXSC 4ZAIA 5I4DA 1TWHH 1CT1D 2QCPX 3G6EA 1L0XB 4DUZQ 1VQKA 4F7XA 5CC4A 1RTOA 3J80c 1R4QB 1HQRD 4IN3A 4BY7H 1EOVA 4TRDA 2V4DA 3TN2A 3BS1A 1LTLA 4JYAL 3G4SA 2JA5H 4KKTA 3D4DA 3W1BA 3KDFB 1HZBA 5IYDH 1XWEA 4QQBX 2JA7G 1QJOA 3ERSX 3BZCA 1X55A 4X6AH 2NWGA 4DV0L 3KF6B 3HFZB 4NXNL 2PI2A 2RDGA 2KVMA 1B70B 2N8NA 4JI1Q 5LMUL 3M9BA 1L0YB 5C0XI 3R3OA 4BS9A 2CHBD 1PH9A 1LTID 2AUKA 1V1OA 5IODA 2NVXB 3ND8A 4JI8L 3RZDB 1LTSD 5C3EB 1TWGH 3TS0A 1DONA 4IZ8A 5LHY1 4DNTB 3OPOA 4LW1A 1T5EA 3TQYA 4A3EB 4RKLA 1VQAA 2ZTDA 4PZ8A 4DV4L 1N33L 2K5VA 1HUMA 4X62L 4X3KA 4AQYL 2IHEA 3SGIA 2VNUD 5IT9c 5GAHC 3NQIA 4K6LA 1I4RA 3HOUB 4DV5Q 4XQQA 4GN3B 2LSSA 1FL0A 1H9JA 3I4MB 2DY8A 1Q86C 2QKIC 1V1PA 3TBIB 2WAQB 3S16H 3R2IA 1FR3A 5FO7B 4DR3L 1KRTA 2X69A 3CPFA 4LFAQ 1OXXK 1CSQA 3K7AH 1DZ1A 3DWPA 3H91A 1A15A 2VZAA 3G71A 5C44H 3S2DB 4R4IA 1XMOQ 4BY7G 3NPPA 4X3SA 3L3OC 2F0IA 4R8IA 4BBSB 2F0EA 4DUYL 4LF9Q 3CQZH 3UDGA 4K2KA 1WCMH 3I4NB 1EL0A 1TWAB 1TY2A 1EUJA 1V1QA 5DAUA 5FLMG 2FINB 2JA6H 1PXUA 3J7AV 2A6ED 1W6KA 1OXVA 1Q8KA 1XTCD 5ELDA 1YZ6A 3ERQA 4IFDH 2IPKD 1FD7D 4JI2Q 3F8TA 3BZKA 4DR4Q 4LF7L 2KOLA 3I4OA 1N32L 4OWXB 1VQGA 3T1HQ 3LNNA 1WVLA 1STYA 3K59A 5C3WA 1VQLA 3GV6A 2I5HA 2XWJB 3FHWA 3I90A 3CCSA 2FMMA 3CMAA 2JA7B 3P20A 4U673 3T56B 2VXWA 1B8AA 1YNJD 1W2BA 3H0GH 2HDLA 1I94Q 2EY6A 2VQEQ 1B7YB 2HHHL 2Q2TA 3VYSA 3PUXA 1VF7A 3GTOB 5ISRA 3W3AA 3C46A 5D3DA 4A3FH 3A7LA 3JC66 4TKOB 3GD7A 1WTRA 2N55A 3E6ZX 1GUNA 1MJCA 3M4YA 1WJJA 1OXTA 1CK1A 3GTPB 5G3LF 3LGJA 1UUPA 1X54A 4GKKL 1MGSA 1YJNA 2RSNA 2FXQA 1TWFH 5KEEA 5IY0A 5KRUA 3QB3A 3ICEA 1JORA 5CV6A 2A68D 2A6HC 4Y7NH 1FVIA 2VUMH 3CCJA 3QIAA 3STBD 5H1SE 3GV3A 3VR5A 3PV0A 4JI0Q 3U58A 1NE3A 4O42A 5GADC 3TZDA 1ZEQX 4UY8C 1UE7A 1BBXC 3KBGA 3D6CA 3QOJA 5LL6X 2MGSA 2RKSA 2RQXA 2L15A 3RLOA 4X64L 4CKBA 4B3MQ 4ME3A 2WKCA 5M3MH 2N78A 1YNXA 3N52A 4IFDG 3CP0A 4NPSA 3WOEA 1SRUA 2OCEA 1HR0Q 4IJLA 4MTKA 1PTOC 3MTSA 2SEBD 3CU7A 3FMCA 4RGNA 4DV7L 3NTIA 1IKLA 1AE2A 3J7A5 1B3AA 4JV5Q 4IURA 2F1MA 1QVCA 2RDFA 1XPOA 2E75C 1SNCA 2PW5A 2LKVA 2VL6A 1CA5A 4GZYC 1QZHA 2NVTB 4YCUA 3J81i 3RD4A 4DPGA 2I46A 1U9RA 1SYEA 4DR6L 5K36H 2RF4A 3D6WA 5KIXA 1HNXQ 4HAEA 1QNKA 3ONAB 4KI0A 5TSSA 3TP6A 4UP9A 4A3IH 5DM73 5IGCA 2RHSB 4CDFC 2LY7A 4DR5L 4RG1A 1HNWQ 1RKNA 2LMCB 4POFA 4DV1L 1I50B 5G3LD 1E22A 1EZ6A 2CFMA 2K1BA 3LX0A 3G48A 4C1NK 1ML0D 1EQVA 2R92G 4RGMA 1VQJA 1KLUD 3R8BA 1HA6A 3F2BA 2PYKA 5EBCA 2F4VL 2Z1CA 1SMXA 4RAUC 2AWOA 1CHQD 2C35B 2E2HH 1EWHA 2F3IA 1SFOH 4JI7Q 4CKEA 1BO0A 1BCPC 4DV6L 4KN4C 1AZPA 5KYLA 4PNYA 2DGYA 3MZ5A 1SE4A 4QMGA 1HR0W 1M8AA 3GTMH 2JK8A 4A3JG 2IL8A 2MUYA 4K0KL 1KTKA 4PZ7A 1VQNA 4ID6A 4HTHA 4DN4M 2A69C 4LWCA 2N3SA 3TS2A 2XGTA 1B9NA 4DAPA 1M90C 1XX8A 2OXPA 2WAQE 3EBEA 2K32A 2JEBI 5IYCH 1Q1EA 4RGTA 1PTOB 2V1CC 1VS0A 4OX9L 3BJUA 3GTGH 3K57A 1TVXA 1HPCA 2UXBL 4I65A 2N88A 2KCTA 2R7FA 2SOBA 3RZOH 1I6HH 1JJCB 4DR2L 2PNRC 1RIPA 1RDPD 3P75A 2R7ZB 2R93B 1HQMC 5IE8A 2JE6I 3A5UA 2JSOA 4DV3L 2IHFA 2B63B 3SEBA 1SE3A 2KHSA 1N36Q 2R7DA 4NDXA 2QA4A 2UXCQ 2B2YA 3NTHA 3QOLA 5M5XB 4A3CH 2E2DC 4A93G 3VR2A 1TQOA 1PRTC 3BYYB 3UI2A 3M3YB 4S3SA 4JI4L 1JJGA 2NN6G 2B2WA 1PLFA 1EU4A 5DM63 1NJIC 2JYOA 2KEDA 3MXGA 2CH4W 2UU9Q 2F0DA 1EIYB 1ONLA 3S14B 4GNXA 2BCOA 2PZUA 1Y8PB 4JI6Q 4R4OA 1EFID 1LO5D 2K5WA 4RCNA 4DU9A 1SE8A 3MXPA 3F2CA 5JVH3 3HOZB 1EEID 2BDOA 5CV9A 1EY6A 2L9HA 2WINB 3HKSA 4B3SL 4P75A 3PIOA 1BCPB 4CJ1B 1MSHA 1TIID 2F03A 2B2VA 4EQ5A 1KQSA 1DCZA 2F0GA 4GLVB 2CH4A 4BA1I 4AIMA 4KJNA 1S5FD 3S1RB 2BH2A 2MPMA 5JVG3 4JBWA 2NVXH 1EQRA 1O7LA 1R9TB 3RZDH 2CQOA 2I07B 5C3EH 5IGDA 4LFCQ 2H1EA 4K2LA 1F9QA 2TMPA 5BR8Q 1A6XA 1B44D 4KY6A 3JAME 4A3EH 2YTYA 4RMFA 1WYDA 1CQFA 1QE6A 4FNFA 3L0OA 2RCNA 1V8QA 5J22A 1CQVA 4F87A 1JICA 3AFPA 5JPMC 3N6RA 3T13A 4QIWB 1IBKL 1VQ8A 1IYJB 1CKMA 4CDEC 2H4OA 2JJQA 1YJWA 1CZGA 3HOUH 1RODA 2B2WC 3S1MB 1FNVA 5FO8B 2CWPA 2IT1A 4HIMA 1YI2A 4QB4A 4QF4A 1XPUA 1G2SA 2UXDL 4TQUS 3PIP3 2NVQB 4PG3A 3EIVA 1SR3A 3HS0C 1VQ4A 3S1NB 4H0LC 1UEAB 1EFWA 1BR9A 3OYYA 3SDZA 3T16A 4G7ZC 1PRTB 4ILWA 1NNXA 5FJ8H 4JK1C 3PMFA 4BBSH 5F2DA 3TSSA 1AEXA 4C3HH 4BWGB 3HOVG 1YHAA 3T51B 3I4NH 1J5EL 1TWAH 1QUQB 1A0IA 4P74A 1G6ZA 1ASZA 5EJWA 4K6DA 2B2VC 2K14A 4A3GG 4N9TA 2F52A 1VQ5A 1S5DD 1A63A 2A69D 3NXWA 3BG3A 1PH3A 2UUBL 2DY7A 4L63B 1JMCA 4DK3C 4UPAA 1QG7A 1E7ZA 1EY5A 2I5MX 3VA7A 5FLXc 1Z7TA 4EQPA 3E9IA 5IP7G 2B3GA 5CYUA 2XSCA 5HURA 2ZXOA 2JA7H 2CQAA 1CUKA 4XIGS 1J9OA 2C5CA 2FHTA 4O1NA 4K8JA 3Q22A 3PO3B 1F2ZA 4I7AA 4X3TA 4JYAQ 3Q6SA 3HOYG 4DNIA 2JEAI 1N9WA 4JW0A 3GTOH 1K8AC 3VDYA 2KCCA 5IGBA 2SNMA 2WV6D 2B8FA 1GJXA 4ALPA 3OWFA 4DV0Q 2Z8LA 1ENFA 2B29A 3I4MG 1X3PA 1XYIA 2JA8G 1NBWA 2EYPA 3GTPH 4MNOA 3MAQA 2GVBA 3HKZB 2XWBB 1KDAA 5JPNC 1BDOA 4C56C 4GS3A 4DAYB 2WAQG 1JWMD 4IPCA 4IUUA 3HOXB 4HSVA 3PIPA 3J81j 5EBDA 2LS01 3H3VI 1D5ZC 4IJHA 2XRQD 4J15A 1Z47A 3Q8DA 4BBSG 4DV4Q 5ELFA 1JE4A 3D4WA 3E3XA 2HCIA 4X62Q 1SMYC 3AQQA 5I6WA 3U4ZA 1S5CD 1KAWA 1QB5D 2ALYB 2MNAA 4AQYQ 4OO1I 3NP8A 4LJZC 1NY4A 2YU9H 5C6AA 3A55A 1K8GA 1EIHA 4A3MB 3HGBA 1HNZL 1U4LA 5I9PA 4FF3A 1STEA 2Y0SG 3GO5A 5LMNW 5ELBA 1WTQA 2E2JB 4HN7A 3IAYA 4BBRG 1Q81C 3HOVB 4FXKC 2J0TD 3NTKA 3URYA 1VQ9A 4I7ZC 5FLMH 4NXML 1VDZA 1IHZA 2AQ1B 2XN9C 3I70A 4JCVE 5C0XG 4CDDC 4A3GB 1PYSB 3IFDA 1Y8OB 3U9OA 1SYDA 5JJZA 1Y14B 4KD4A 1L0WA 4JOIC 1II3A 2EY1A 2I5LX 4DUYQ 2BA0A 1O80A 3Q23A 2O5IC 4PMCA 3M4QA 1XNRL 1BBUA 5IIFA 1SDFA 2EE1A 3HOWB 2TSSA 1E0BA 3A54A 4G57A 3Q0AA 1K9MC 1IYUA 1EY0A 3R2TA 4V190 1LTTD 1N34Q 1BNZA 4FXGC 4NP5A 2ZJPA 1GKHA 3PGZA 4LF7Q 1K83B 1CSPA 3KBXA 1N32Q 4LF8L 2D5DA 1P16A 3HOYB 5IWAL 3S1QB 2RA4A 4FF4A 2FJ2A 4LUOA 5EPJA 4QCLA 4HJ8A 2QW7A 1XNQQ 4LFBL 2NTSA 3G7LA 3EROA 2EYLA 2EYHA 4UP7A 1Z6HA 1DOKA 1HFNA 1D8LA 4ME5A 1U0LA 2G5DA 2KUMA 2HHHQ 2OTLA 2JA8B 2ZM6Q 4KMUC 2A19A 1AW7A 5JJIA 1WTXA 1BVSA 1MI2A 1HFGA 1DM0B 2AHOB 1X3FA 3L2PA 4U68A 1VF5C 3CKIB 5M5YB 1IL2A 1X65A 1SBBB 4QIWE 3J81L 3M4OH 1JR0D 1KNEA 4YWMA 1SJED 3TMEA 4DUZL 4M8AA 2D9UA 2A5HA 4H13C 5ELNA 2CKZB 1SYGA 2CW0C 4IO9A 1GUGA 1LTGD 1GO3E 1P8LA 3J81c 2HUGA 3SHLA 4IFDJ 1BUVT 1CM9A 1DYQA 2EOTA 5T1IA 1PTOH 3V2TA 4B9XA 2O5JC 2Y0SB 5ELOA 3K5NA 4JBKA 4ZUJA 1HZAA 2EPBA 4BBRB 2F0UA 4PMWA 4JI1L 1VQ7A 1XMQQ 1PMRA 4BXXH 1ZYRC 3UE0A 4C3JG 3TRZA 4EX5A 2ASBA 3UDIA 2VB2X 2L5TA 2Z6KC 4XYQA 1O7IA 2KJXA 3K81C 1IW7C 4JI5Q 1X6OA 3S17B 1JOQA 5M5XH 4OWWB 3KJPA 2NTTA 3I91A 4DK6C 1VQPA 2AQ2B 3M3YH 1QOHA 1I4HA 2L4NA 1KDCA 2X6GA 4UAIA 2BH8A 3A0JA 3PF4A 4OEMB 5IOCA 3H09A 1YNNC 4L5SA 3SK5A 3U50C 1PV4A 4UDUC 2A8VA 1CZWA 3QO2A 2E2IB 3IKJA 3S14H 1F9SA 2EYMA 2M2LA 4M1UB 1TY0A 2PNHA 2EVBA 1RJTA 1EY4A 5CV8A 5IYBG 3CCLA 3CC2A 1MSGA 1NMGA 1C8CA 4HCEA 4IUPA 1JWUD 3HOZH 2OQKA 4JI3Q 3SE0A 4C1NI 1STAA 2K28A 4LFAL 2EYOA 3R93A 4A3LG 1CKNA 2R92H 1D7QA 3S2HB 1JB3A 2HD3A 4AYBB 1QWYA 3M7NA 2BA1A 4XTCS 4LF6Q 2CWAA 4P73A 2F0TA 3T1YL 4P71A 3BDLA 3HKZE 4LF9L 1HA5A 1KL9A 1GVPA 3AMUA 2VB3X 5CBAE 3QJYA 3RMHA 2XIWA 3MFGA 1R9TH 1VQFA 3H94A 3DUZA 4DAMA 4YY3L 4L5RC 1LV9A 5I2XA 4XQJA 4A3JH 1LTAD 1TWCB 3QG1A 4X66Q 4FYDA 2XTIA 4DV2Q 4HR7B 4JI2L 1ICWA 1Y1VG 2UUCQ 4BXXG 1DJRD 4PZ6A 1DOMA 3E0JA 2R7ZG 2R93G 2F0PA 3CCRA 3EFXD 1TR5A 2B63G 4P72A 4GOPC 4HMIA 4CKCA 2G9DA 3EA6A 3S1MH 4JPBW 3OTOQ 1E2VA 4B08A 2XRSD 3LWUA 2HQEA 1KLGD 1RTNA 2NVQH 2VS1A 1D5MC 3MVVA 2RHQB 1STNA 3V05A 1BF4A 3AU7A 3S1NH 4C3JB 1XPRA 2QF7A 3X3MA 4XXEA 4LF5Q 4IFDI 1BOSA 1PFSA 1EY9A 2D62A 2KHIA 2F0WA 5I6YA 1KXLA 2EDGA 1PZID 1SLJA 1F9PA 3CCVA 1CKOA 4LF4L 3LWEA 4A93H 4DR2Q 3C2PA 4PQXA 1X3EA 3OIQA 1PH5A 4LUVA 2NN6H 4DV3Q 3NWTA 3FVQA 3HOZG 3C3LA 1Y1WG 4B3TQ 3K0XA 3GTJB 1TWGB 1UEBA 4WFN3 1IBLL 4KLKA 4DK0A 2X6LA 1PH4A 1T9HA 5JAVA 4HJ9A 1NAPA 4DGZA 2J7ZA 4JI4Q 3UE1A 1Y69U 3OW2A 3I73A 2GVAA 2IJ0A 3CXCA 4PV1C 4JI0L 1YJ9A 1QUQA 1PDQA 2O2LD 3PUVA 5CV5A 4AH6A 1EY8A 1PTOF 1X32A 2L55A 2AKWB 3C1EA 1CI3M 1FNWA 4KY7A 3PIO3 4GLXA 1KIXA 3D4RA 5GROA 3GQBA 2A73B 1TS3A 1H9SB 3P7JA 2WACA 1KD1C 1U4PA 3PO3H 1Q46A 2RDHA 3EVQA 3NK9A 4C2MH 3DLLA 3RLNA 2BE5C 1K28A 3I56A 1SN8A 1JOOA 1HR0L 2IW3A 2J4XA 2L11A 1RCVD 3CCMA 4B9WA 3NWSA 1ASYA 4RGOS 4RWSC 4B3SQ 5GQOA 2ZTCA 4MHEA 4FDBA 1HRJA 1EU3A 2F3VA 2VQFQ 4JV5L 1C4QA 1PH2A 1D1IA 1TS2A 3GTLB 1KHIA 3RUZA 1WCMB 4GOPB 1LT4D 4WJ3M 1QCBD 1Y1VB 3DWQA 4MZ9A 2JA6B 1YITA 1EOTA 1N8RC 1EYDA 4HMJA 1HNXL 3MHBA 4BY1G 1CHPD 3CPWA 4CJ0B 1K8MA 4IPGA 4B3RL 1O7ZA 4N8X1 1I6VC 3BU2A 2E5LQ 1IKMA 2Y0SE 2WP8J 1HNWL 2OT2A 2A6HD 4DAYA 3VYUA 5JJKA 3K8AA 2B39A 5C4HA 4YHHQ 5AJ3Q 5FLXE 5GAEC 3BYTB 2KA7A 5A2QE 2LFNA 1BCPF 1Z9FA 1CKNB 1A62A 4IUVA 4L8JA 4EGVA 3MC0B 2QEJC 2F0FA 4DXGA 3AFQA 1PH8A 5DLQE 1FGUA 2E2JH 1VCIA 4DFAA 4ZYSA 4GN4B 3HOVH 1WD1A 2ENBA 4XQNA 1MHWC 2SDFA 2F0VA 2KQ3A 4XYOA 4JI7L 1E24A 2JQOA 3DEPA 1SNQA 1Y1WB 3CC4A 1TKWB 4A3GH 1SE2A 2F0MA 3A56A 1T5XD 1GOZA 1D2BA 1UE6A 3PQIA 1PTOD 3PF5A 4DK1A 2NZHA 3PO3G 3CF5A 1CTMA 1U4RA 2Z0SA 1CFMA 1GHJA 2NN6I 5C4XG 4YCWA 1SROA 4WRDA 2C9OA 1E2ZA 1JWSD 5IP7H 2D0OA 5E4XA 1SNPA 2NUCA 3A8IE 4X65Q 1B4OA 3HKZG 5KGUA 4AYBE 4QY7A 2ID0A 3KLWA 3HOYH 2K5QA 2E8GA 2Q2UA 1WTOA 3HOXG 1SNMA 3RN5A 4MN3A 3I2ZA 1PRTF 3AB9A 2NZ1D 3NENA 2D2CC 2YTVA 4ZKBB 2Z6BA 4J6HA 3ZYYX 2IX3A 3FEWX 3FP9A 5BN4A 4KY5A 2M00A 3I4MH 2PZWA 1N36L 3A8JE 1PFBA 1QVGA 2JA8H 4A3BG 3S15B 2MQHA 3J80E 3K5LA 2UXCL 2B2UA 2Z9HA 1HJPA 3PUWA 3GTQB 2Z4HA 3SR1A 2K75A 2WB1E 4OXPA 3NUCA 3KYHC 4KD3A 4OL7A 1PHJA 2KCNA 3NBHB 4KTAA 4NB3A 4A3MG 1ET9A 2OQ0A 3K7UC 4BY1B 1DXMA 4V0BA 2F0KA 3AEVA 2HT1A 3S2DH 2AQ3B 2UU9L 3TP5A 1BCPD 4KK7A 2O4XA 5A35A 3O13A 1ESRA 2EY2A 1LTBD 2N49A 3CRKC 1FJGQ 3KOJA 1NR2A 5BN3A 4UP8A 1HH2P 1MIUA 4HJ5A 2WKDA 2XNAC 1I5FA 2ICIA 4DNRB 1PFNA 2YTXA 5JEAG 5FO9B 3E0EA 4GKJQ 4FF1A 5C5LA 3NELA 1MJEA 1F2MA 4BBRH 5C0XJ 1GUWA 1S4ZA 4UHVA 1X3GA 3HOWG 1IL8A 4OGQC 1UE1A 1BBWA 2Q8TA 2FFKB 4KHZA 5C0XH 4A3KG 3T53B 1UE5A 5A2QL 3K58A 2DUDA 5CGKA 2DN8A 2K4KA 4HCSA 1B1ZA 5IT9E 1S5BD 4LFCL 2ZTEA 3S17H 5C4JB 4R4TA 2EIFA 3OW7A 1ZKOA 1V43A 4NXMQ 5C4XB 3F1ZA 5M9OA 4R4CA 3GDEA 3TREA 4Z9CB 4JOIA 2B2UC 2KEEA 1LT3D 3HG9A 1GM5A 2EJGC 1F2LA 1D5XC 1QVFA 1PRTD 4NXNQ 1WTWA 5CV7A 1OO9B 1K0SA 1JC7A 4IOCA 3HRZC 2NYZD 3F2UA 1XNRQ 4RA8A 5LMUQ 3UDXA 1EIGA 3WDNA 5D14A 3EJIA 2A6EC 2MP1A 1SAPA 3H3VC 3S24A 1PA6A 2F0SA 2HDMA 1TT2A 5EQ0A 4JI8Q 3RLFA 1STGA 3SXHA 2RSOA 2K03A 4OO1G 3NBIA 1FNUA 2MO0A 2QILA 3S2HH 2UUAL 1VQIA 3I55A 1XTDA 5D65A 3JAML 4DR7L 4A3BB 4IPHA 1LACA 5EKKA 1N33Q 5J39A 1YNJC 1PH1A 1ICFB 1NR4A 1AZQA 1EYAA 3RZOB 1I6HB 2A1AA 2OF1A 5HY6A 4LFBQ 1UAPA 5K5PA 4CGYB 4OONA 2EZVA 4LUZA 1W3SA 1YBYA 5COYA 3FKIG 4YIJA 4HSPA 5CMDA 4KHPL 4A75A 4DF7A 1TWCH 2JXMB 3BZDB 4ZLTF 4C3IG 1ZXTA 1Q8IA 4X3UA 1VQOA 2K6AA 4DR3Q 3OWEB 1TXYA 4F8MA 1V9PA 3BDCA 5LMNL 4HJ7A 2L12A 5E4WC 1STHA 5FKAC 1K3RA 2IX0A 5M3FG 4J8QA 2EYFA 2PMZB 3DM1A 4K5WA 2NVTH 2MJ8A 2A68C 2QDBA 1QZGA 1DD2A 1Q82C 1EYCA 2Q2IA 1E2WA 3STBC 1H9MA 4C3JH 4A3KB 1WD0A 1OXUA 5BN5A 5KYIA 1GUTA 2DNEA 3WOFA 3TEHB 1VMCA 4L5QA 3A7AB 1JE5A 1RF2D 4JC0A 1L1OC 1SNDA 5IGGA 1I50H 2Z6KA 3KLRA 4DR1L 1YHQA 2K52A 1VQCA 3OIPA 3BVMA 1DGSA 3GTJH 2LXKA 3B6YA 5IT9L 3KJOA 1H9KA 4AYBG 4A3DG 1F77A 1IBML 1QNUA 3PO2G 4DXFA 2Q8RE
chains in the Genus database with same CATH topology
4WJWA 4G7HC 3GTKB 3D3RA 5JOBA 1SJHD 4KV6A 1TU2B 2WIIB 2F0HA 1I3QB 3Q24A 4RHRA 1TS4A 2B8GA 5EKIA 2PPBC 3MXUA 4RKBA 3HEJA 4IUQA 4IUTA 5FK9C 4TSSA 3EQLC 4ZUIA 1AFPA 1HHVA 1R4PB 3FKIB 4F88A 2AUJD 3ND9A 2EYJA 5NUCA 1H9SA 3A8KE 4C3IB 4OIKA 2F0LA 4C3HB 1A3UA 2EY5A 3FPPA 2KECA 2ZT9C 2ZXPA 1FYCA 3NQTA 3KUPA 4CJ2C 2ICEC 3ITPA 5M3FB 2NB0A 2OEOA 3DEOA 4ABNA 1I4QA 4ULLA 1KAAA 2F0QA 2M9VA 1O7YA 3M85A 2NVYB 5C5MA 3PUZA 1S5ED 3OMCA 1X3QA 3K6OA 4DAVA 3OSOA 4XDXA 1AP0A 1SMYD 3DMUA 3VYRA 5FOBB 1MD2D 5ELCA 1D6EC 3G6JB 4RFBA 3K0YA 1LTRD 1RHPA 2MHVA 5M5WB 1PYWD 1BXTA 1JOKA 2HCCA 1CA6A 2L1BA 1O78A 4PMBA 4A3DB 3PO2B 3I3CA 1SYFA 4KN7C 1U4MA 3SK8A 4EVOA 1BQQT 4NW2A 1JQYD 1ILPA 2NBFA 2WB1B 4E6IA 3BVGA 4KJOA 1TWHB 4RHSA 2YU9B 1PFMA 5C3XA 3W2DA 1PZKD 2SNSA 1KABA 1Y8NB 4BY7B 2R3ZA 2E74C 1Q3LA 3QWNA 2JA5B 4IALA 5E1FA 1GXDC 2F4IA 1M4VA 2EXZA 2PZTA 3KLSA 2XVSA 4Q0FA 2DNCA 5EKLA 2PCFB 4WORA 3MA2B 2R61A 1NUCA 1LLRD 3U9SA 3FPUB 2YYZA 2RBMA 4J1MA 1SXTA 1FGBD 4OHJA 3NBHA 3J7AF 1STBA 3MEHA 1ENAA 2CW0D 1DOLA 3SVMA 5AFWA 1V1PB 1GUSA 2RVLA 3MWYW 4K5VA 1HTLD 5CR3A 4K5XA 5EPKA 4QUFA 2Q8IB 1K8OA 1A2TA 1EY7A 1QILA 2AWNA 1XXGA 4N9PA 1ZYRD 1HTPA 1B2TA 4R9WA 4RCOA 3C1FA 5C4ZA 4DA2A 1LT6D 4CHTB 3S16B 4LK1C 4CBVA 1A2UA 1IW7D 1EQTA 3TDQA 3D8GA 1ILQA 5ELEA 4XT1B 5CORA 3V96A 3K7AB 3HP3A 3M4OB 5IGEA 5KNBA 1KNAA 5C44B 1EWCA 2L0CA 3IL8A 1YNND 3CQZB 4FF2A 1SNOA 2BOSA 4RH6A 1J8IA 4P2CB 3K5MA 2JP1A 1NSNS 2F3WA 2Z4IA 4FVMA 3DWAA 5LL6S 3K5OA 4MIUA 1AN8A 3E5SA 2BDNA 2F0OA 5K36G 1LT5D 1VMPA 3KK7A 1SYBA 2B2TA 1GHKA 1MBYA 4EQNA 4XT3B 2R6GA 3H0GB 2K01A 3TP8A 1Q90A 4G7OC 2E76C 1GUOA 5T1GA 1PZJD 1B9MA 3D31A 5JEAJ 5EPLA 4A3FB 4LAAA 1F2YA 3L9AX 3OOCA 4NMZA 5JEAH 1W6JA 3TP7A 4NKLA 4G4KA 1EEFD 2K7VA 3FRPB 3P1HA 3X3NA 1ESFA 2EJFC 1D1KA 4FO2A 4K8IA 4H7BA 3VA5A 1G91A 3VR3A 1G291 1TWFB 5DNFA 2CVRA 2PW7A 1TS5A 1SYCA 4K14A 4R8NA 2F0JA 3NSWA 2IX1A 4ZKCB 4Y7NB 3BDOA 5D3IB 2R92B 4KKSA 2VUMB 4ZRZA 5I2YA 3S9WA 3GP7A 4OIJA 4EQOA 4FXDA 1WTPA 1HXYD 2PO4A 5IGFA 4L6TB 3BVZA 3J7YW 5CBEE 3I72A 1LABA 1NCVA 5DEHA 4A3JB 5M3MB 3NHHA 1A3VA 5E3FA 2B2TC 4H44C 4FP5D 3I4LA 2K33A 4QUCA 1HUNA 2K04A 3PUYA 3IFTA 2B2YC 3L7ZC 2K05A 2G9HD 4Q5VA 4OO1H 3CRLC 1ENCA 3OMGA 1F9RA 3NE5B 1JCKB 3VYTA 1HCZA 4HEDA 3KLSX 3VR6A 2BE5D 2PQEA 4A3IB 3I8ZA 1KDBA 4IQZA 4A93B 3M7GA 4KHVA 2F0NA 3MXNA 1I4XA 4LMQD 1EZ8A 1B53A 2A74C 5KNDA 5FLXL 3DHQA 3KF8A 3SK4A 1G2TA 5J1ZA 4IUNA 1RD9D 1IYVA 2E2HB 3T4AC 1SSOA 1WTVA 1SFOB 2GA4B 3MFYA 3VR4A 3SK6A 4ODGA 3GTMB 2ZXRA 2EJMA 4C2MB 1A3TA 3FDTA 4ZK9B 1Q12A 4KKUA 2FMCA 3H6MA 3HZXA 1H9RA 3CHBD 2IWHA 3J81E 1C48A 1ET6A 3GTGB 1G8ZD 5KNCA 1I4GA 5HGTA 5EGTA 3OHXC 3DXJC 2K5DA 5CV4A 1B50A 5I9OA 3TZUA 4ZQ3A 1SEBD 1UNSA 3J80L 4C3HG 1Q1BA 1I4PA 4BA2I 1OXSC 4ZAIA 5I4DA 1CT1D 2QCPX 1L0XB 4F7XA 5CC4A 1RTOA 1R4QB 1HQRD 4IN3A 4TRDA 2V4DA 3TN2A 3BS1A 4KKTA 3D4DA 1XWEA 1QJOA 2NWGA 2RDGA 2KVMA 1L0YB 5C0XI 3R3OA 4BS9A 2CHBD 1LTID 2AUKA 1V1OA 5IODA 2NVXB 3ND8A 3RZDB 1LTSD 5C3EB 1DONA 4IZ8A 5LHY1 4DNTB 3OPOA 1T5EA 4A3EB 4RKLA 1HUMA 4X3KA 2VNUD 3NQIA 4K6LA 1I4RA 3HOUB 4XQQA 1H9JA 3I4MB 2DY8A 2QKIC 1V1PA 3TBIB 2WAQB 3R2IA 1FR3A 5FO7B 2X69A 1OXXK 1DZ1A 3DWPA 3H91A 1A15A 3S2DB 3NPPA 4X3SA 3L3OC 2F0IA 4R8IA 4BBSB 2F0EA 4K2KA 3I4NB 1EL0A 1TWAB 1TY2A 5DAUA 2FINB 1PXUA 3J7AV 2A6ED 1W6KA 1OXVA 1XTCD 5ELDA 3ERQA 4IFDH 2IPKD 1FD7D 2KOLA 3LNNA 1WVLA 1STYA 3K59A 5C3WA 3GV6A 2XWJB 3I90A 2FMMA 2JA7B 3P20A 4U673 3T56B 2VXWA 1YNJD 2HDLA 2EY6A 3VYSA 3PUXA 1VF7A 3GTOB 5ISRA 3W3AA 3C46A 5D3DA 3A7LA 4TKOB 3GD7A 1WTRA 2N55A 3E6ZX 1GUNA 3M4YA 1OXTA 1CK1A 3GTPB 5G3LF 1UUPA 1MGSA 2RSNA 5KEEA 5KRUA 3QB3A 1JORA 5CV6A 2A68D 2A6HC 3QIAA 3GV3A 3VR5A 3PV0A 4O42A 3TZDA 1ZEQX 1BBXC 3KBGA 3D6CA 3QOJA 5LL6X 2MGSA 2RKSA 2RQXA 4CKBA 2WKCA 3N52A 4IFDG 3WOEA 1PTOC 3MTSA 2SEBD 3CU7A 3FMCA 4RGNA 3NTIA 1IKLA 1B3AA 4IURA 2F1MA 2RDFA 2E75C 1SNCA 2PW5A 2LKVA 4GZYC 1CA5A 2NVTB 3RD4A 2I46A 1U9RA 1SYEA 5K36H 3D6WA 5KIXA 4HAEA 1QNKA 3ONAB 4KI0A 5TSSA 3TP6A 5DM73 5IGCA 2LY7A 1RKNA 2LMCB 1I50B 5G3LD 1EZ6A 2K1BA 3LX0A 4C1NK 1ML0D 1EQVA 4RGMA 1KLUD 3R8BA 1HA6A 2PYKA 5EBCA 2Z1CA 4RAUC 2AWOA 1CHQD 1EWHA 4CKEA 1BO0A 1BCPC 4KN4C 1AZPA 5KYLA 4PNYA 3MZ5A 1SE4A 4QMGA 1M8AA 2IL8A 2MUYA 1KTKA 4ID6A 4HTHA 4DN4M 2A69C 1B9NA 4DAPA 1XX8A 2OXPA 2K32A 2JEBI 1Q1EA 4RGTA 1PTOB 3K57A 1TVXA 1HPCA 4I65A 2N88A 2SOBA 2PNRC 1RDPD 3P75A 2R7ZB 2R93B 1HQMC 2JE6I 2JSOA 2B63B 3SEBA 1SE3A 2KHSA 4NDXA 2B2YA 3NTHA 3QOLA 5M5XB 2E2DC 3VR2A 1TQOA 1PRTC 3BYYB 3UI2A 3M3YB 4S3SA 2NN6G 2B2WA 1PLFA 1EU4A 5DM63 2JYOA 2KEDA 3MXGA 2F0DA 1ONLA 3S14B 2BCOA 2PZUA 1Y8PB 1EFID 1LO5D 2K5WA 4RCNA 4DU9A 3MXPA 5JVH3 3HOZB 1EEID 2BDOA 5CV9A 1EY6A 2L9HA 2WINB 1BCPB 4CJ1B 1MSHA 1TIID 2F03A 2B2VA 1DCZA 2F0GA 4BA1I 4KJNA 1S5FD 3S1RB 2MPMA 5JVG3 4JBWA 1O7LA 1R9TB 2I07B 5IGDA 2H1EA 4K2LA 1F9QA 2TMPA 1A6XA 1B44D 4KY6A 3JAME 1CQFA 1QE6A 4FNFA 5J22A 1V8QA 1CQVA 4F87A 1JICA 5JPMC 3N6RA 3T13A 4QIWB 2H4OA 1CZGA 1RODA 2B2WC 3S1MB 1FNVA 5FO8B 2IT1A 4QB4A 4QF4A 1G2SA 4TQUS 3PIP3 2NVQB 3HS0C 3S1NB 4H0LC 1UEAB 1BR9A 3SDZA 3T16A 4G7ZC 1PRTB 4ILWA 4JK1C 3PMFA 5F2DA 3TSSA 1AEXA 4BWGB 3T51B 1G6ZA 5EJWA 4K6DA 2B2VC 4N9TA 1S5DD 2A69D 3NXWA 3BG3A 2DY7A 4L63B 1QG7A 1EY5A 3VA7A 1Z7TA 4EQPA 5CYUA 2XSCA 5HURA 2ZXOA 2CQAA 4XIGS 1J9OA 2C5CA 2FHTA 4O1NA 4K8JA 3Q22A 3PO3B 1F2ZA 4X3TA 3Q6SA 2JEAI 2KCCA 5IGBA 2SNMA 2WV6D 2B8FA 1GJXA 3OWFA 2Z8LA 1ENFA 1X3PA 1XYIA 2EYPA 3MAQA 3HKZB 2XWBB 1KDAA 5JPNC 1BDOA 4C56C 1JWMD 4IUUA 3HOXB 4HSVA 5EBDA 2LS01 1D5ZC 2XRQD 1Z47A 5ELFA 1JE4A 3D4WA 2HCIA 1SMYC 5I6WA 1S5CD 1QB5D 4OO1I 3NP8A 4LJZC 5C6AA 3A55A 1EIHA 4A3MB 3HGBA 1U4LA 5I9PA 4FF3A 1STEA 3GO5A 5ELBA 1WTQA 2E2JB 4HN7A 3IAYA 3HOVB 4FXKC 2J0TD 3NTKA 3URYA 4I7ZC 1VDZA 1IHZA 2AQ1B 2XN9C 3I70A 5C0XG 4A3GB 3IFDA 1Y8OB 3U9OA 1SYDA 5JJZA 4KD4A 1II3A 2EY1A 2BA0A 1O80A 3Q23A 2O5IC 4PMCA 5IIFA 1SDFA 2EE1A 3HOWB 2TSSA 1E0BA 3A54A 4G57A 3Q0AA 1IYUA 1EY0A 3R2TA 4V190 1LTTD 1BNZA 4FXGC 4NP5A 1K83B 3KBXA 2D5DA 3HOYB 3S1QB 2RA4A 4FF4A 2FJ2A 5EPJA 4QCLA 2NTSA 3G7LA 3EROA 2EYLA 2EYHA 1Z6HA 1DOKA 1HFNA 4ME5A 2KUMA 2JA8B 4KMUC 1AW7A 1WTXA 1MI2A 1HFGA 1DM0B 4U68A 1VF5C 3CKIB 5M5YB 1SBBB 3J81L 1JR0D 1KNEA 3TMEA 1SJED 4M8AA 2D9UA 2A5HA 4H13C 1SYGA 2CW0C 1GUGA 1LTGD 2HUGA 3SHLA 4IFDJ 1BUVT 1CM9A 1DYQA 2EOTA 5T1IA 1PTOH 3V2TA 4B9XA 2O5JC 2Y0SB 3K5NA 4ZUJA 2EPBA 4BBRB 2F0UA 4PMWA 1PMRA 1ZYRC 4C3JG 2VB2X 2L5TA 4XYQA 2KJXA 1IW7C 1JOQA 3S17B 2NTTA 3I91A 2AQ2B 1QOHA 1I4HA 2L4NA 1KDCA 2X6GA 4UAIA 5IOCA 3H09A 1YNNC 3SK5A 4UDUC 1CZWA 3QO2A 2E2IB 3IKJA 1F9SA 2EYMA 2M2LA 4M1UB 1TY0A 2EVBA 1RJTA 1EY4A 5CV8A 1MSGA 1C8CA 4HCEA 4IUPA 1JWUD 3SE0A 4C1NI 1STAA 2K28A 2EYOA 3R93A 3S2HB 1JB3A 4AYBB 1QWYA 3M7NA 2BA1A 4XTCS 2F0TA 3BDLA 1HA5A 3AMUA 2VB3X 5CBAE 3QJYA 3RMHA 2XIWA 3MFGA 3H94A 3DUZA 1LV9A 5I2XA 4XQJA 1LTAD 1TWCB 3QG1A 4FYDA 4HR7B 1ICWA 1DJRD 1DOMA 3E0JA 2F0PA 3EFXD 1TR5A 4HMIA 4CKCA 2G9DA 3EA6A 1E2VA 4B08A 2XRSD 3LWUA 2HQEA 1KLGD 1RTNA 1D5MC 3MVVA 1STNA 3V05A 1BF4A 3AU7A 4C3JB 2QF7A 3X3MA 4XXEA 4IFDI 1BOSA 1EY9A 2D62A 2F0WA 5I6YA 2EDGA 1PZID 1F9PA 3LWEA 3C2PA 4PQXA 3OIQA 2NN6H 3NWTA 3FVQA 3C3LA 3GTJB 1TWGB 4WFN3 4DK0A 2X6LA 5JAVA 1NAPA 4DGZA 2J7ZA 1Y69U 3I73A 2IJ0A 4PV1C 1PDQA 2O2LD 3PUVA 5CV5A 1EY8A 1PTOF 1X32A 2L55A 3C1EA 4KY7A 1CI3M 1FNWA 3PIO3 3D4RA 3GQBA 2A73B 1TS3A 1H9SB 3P7JA 2WACA 1U4PA 2RDHA 3EVQA 3NK9A 2BE5C 1JOOA 2IW3A 2J4XA 2L11A 1RCVD 4B9WA 3NWSA 4RGOS 4RWSC 4MHEA 1HRJA 1EU3A 2F3VA 1C4QA 1D1IA 1TS2A 3GTLB 3RUZA 1WCMB 1LT4D 1QCBD 1Y1VB 3DWQA 2JA6B 1EOTA 1EYDA 4HMJA 3MHBA 1CHPD 4CJ0B 1K8MA 1O7ZA 1I6VC 1IKMA 2WP8J 2OT2A 2A6HD 4DAYA 3VYUA 2B39A 5C4HA 5FLXE 3BYTB 2KA7A 5A2QE 2LFNA 1BCPF 4IUVA 4L8JA 4EGVA 3MC0B 2QEJC 2F0FA 4DXGA 1VCIA 4DFAA 4ZYSA 1WD1A 2ENBA 4XQNA 2SDFA 2F0VA 2KQ3A 4XYOA 3DEPA 1SNQA 1Y1WB 1TKWB 1SE2A 2F0MA 3A56A 1T5XD 1GOZA 1D2BA 1PTOD 4DK1A 1CTMA 1U4RA 1CFMA 1GHJA 2NN6I 4WRDA 2C9OA 1E2ZA 1JWSD 5E4XA 1SNPA 2NUCA 3A8IE 1B4OA 5KGUA 2ID0A 2K5QA 1WTOA 1SNMA 4MN3A 1PRTF 3AB9A 2NZ1D 2D2CC 4ZKBB 4J6HA 3ZYYX 2IX3A 3FEWX 5BN4A 4KY5A 2M00A 2PZWA 3A8JE 1PFBA 3S15B 3J80E 3K5LA 2B2UA 3PUWA 3GTQB 3SR1A 2Z4HA 3NUCA 4KD3A 4OL7A 2KCNA 4KTAA 1ET9A 4BY1B 1DXMA 4V0BA 2F0KA 2AQ3B 3TP5A 1BCPD 4KK7A 2O4XA 5A35A 3O13A 1ESRA 2EY2A 1LTBD 3CRKC 1NR2A 5BN3A 2WKDA 2XNAC 4DNRB 2ICIA 1PFNA 5JEAG 5FO9B 4FF1A 5C5LA 1F2MA 5C0XJ 1GUWA 1S4ZA 1IL8A 4OGQC 2Q8TA 2FFKB 4KHZA 5C0XH 3T53B 5A2QL 3K58A 5CGKA 2DN8A 4HCSA 1B1ZA 5IT9E 1S5BD 5C4JB 3OW7A 1ZKOA 1V43A 5C4XB 5M9OA 4Z9CB 2B2UC 2KEEA 1LT3D 3HG9A 2EJGC 1F2LA 1D5XC 1PRTD 1WTWA 5CV7A 1OO9B 1JC7A 3HRZC 2NYZD 3F2UA 4RA8A 1EIGA 3WDNA 5D14A 3EJIA 2A6EC 2MP1A 1SAPA 3H3VC 2F0SA 2HDMA 1TT2A 5EQ0A 3RLFA 1STGA 3SXHA 2RSOA 2K03A 4OO1G 1FNUA 3NBIA 2QILA 5D65A 3JAML 4A3BB 1LACA 5EKKA 5J39A 1YNJC 1NR4A 1AZQA 1EYAA 3RZOB 1I6HB 2OF1A 1UAPA 5K5PA 4CGYB 2EZVA 5COYA 4YIJA 4HSPA 5CMDA 4DF7A 2JXMB 3BZDB 4ZLTF 4C3IG 1ZXTA 1Q8IA 4X3UA 2K6AA 3OWEB 4F8MA 3BDCA 2L12A 5E4WC 1STHA 5FKAC 2IX0A 4J8QA 2EYFA 2PMZB 3DM1A 4K5WA 2MJ8A 2A68C 2QDBA 1DD2A 1EYCA 1E2WA 1H9MA 4A3KB 1WD0A 1OXUA 5BN5A 5KYIA 1GUTA 2DNEA 3WOFA 1VMCA 3A7AB 1RF2D 5IGGA 1SNDA 3KLRA 3OIPA 3BVMA 5IT9L 1H9KA 1F77A 1QNUA 4DXFA 2Q8RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9R A;  1SYE A;  2F0S A;  1TQO A;  1A2T A;  1EY7 A;  1TT2 A;  2F3V A;  2PW7 A;  4PMB A;  5JOB A;  1STG A;  3SXH A;  1SYC A;  4J6H A;  4K14 A;  4S3S A;  3PMF A;  5KIX A;  4R8N A;  5F2D A;  5I9P A;  2F0J A;  3SHL A;  4KV6 A;  3SK6 A;  1AEX A;  4ODG A;  2EY6 A;  2M00 A;  1SYF A;  4KY5 A;  4N9P A;  3RUZ A;  2PZW A;  2F0P A;  3R3O A;  1TR5 A;  3TP6 A;  3V2T A;  4B9X A;  2F0H A;  3C1F A;  4HMI A;  5IGC A;  5C4Z A;  3SK8 A;  3S9W A;  4K6D A;  5IOD A;  2F0D A;  4ZUJ A;  4EQO A;  1EYD A;  5ISR A;  5EKK A;  2F0U A;  4N9T A;  1A2U A;  1RKN A;  4HMJ A;  4EVO A;  5J39 A;  3SR1 A;  1IHZ A;  2PZU A;  3MHB A;  3NUC A;  1EYA A;  4KD3 A;  3D8G A;  4OL7 A;  4IZ8 A;  2OF1 A;  3NXW A;  4KTA A;  4RKB A;  5IGF A;  1EZ6 A;  3HEJ A;  3U9O A;  5K5P A;  1A3T A;  2HQE A;  1SYD A;  3LX0 A;  4DU9 A;  5IGE A;  3MVV A;  2F0K A;  3MXP A;  4KD4 A;  4RKL A;  1STN A;  1II3 A;  2EY1 A;  1EQV A;  1EY5 A;  3H6M A;  4YIJ A;  3HZX A;  4ZUI A;  3TP5 A;  2O4X A;  4DF7 A;  4E6I A;  5DEH A;  4PMC A;  3NHH A;  1A3V A;  5CV9 A;  5E3F A;  5IIF A;  1EY6 A;  2EY2 A;  4EQP A;  4KJO A;  1JOQ A;  2PYK A;  5C4H A;  1EY9 A;  2F0W A;  1SNO A;  5I6Y A;  5KEE A;  4G57 A;  5HUR A;  2EYJ A;  5NUC A;  5C3X A;  5KRU A;  3QB3 A;  1EY0 A;  2F0L A;  2SNS A;  1JOR A;  2F0F A;  1KAB A;  1NSN S;  1KDC A;  4K8J A;  1F2Z A;  5CV6 A;  2F0G A;  4F8M A;  5IOC A;  5KYL A;  2F3W A;  4PNY A;  1A3U A;  5HGT A;  3BDC A;  3MZ5 A;  2EY5 A;  4NP5 A;  3SK5 A;  4QMG A;  4DFA A;  5EGT A;  4KJN A;  4IAL A;  4K5X A;  5C5L A;  2ENB A;  1ENC A;  5E1F A;  1STH A;  3OMG A;  1F2M A;  2F0V A;  2KQ3 A;  3NQT A;  2EXZ A;  4MIU A;  5IGB A;  2EYM A;  2SNM A;  1SNQ A;  3E5S A;  5CV4 A;  5IGD A;  2EYF A;  2F0O A;  4ID6 A;  4K5W A;  4K2L A;  5JAV A;  2PZT A;  3ITP A;  3OWF A;  2OEO A;  2F0M A;  3D6C A;  2QDB A;  5I9O A;  4HTH A;  4KY6 A;  3QOJ A;  1SYB A;  1EY4 A;  4ZQ3 A;  5CV8 A;  4DGZ A;  1EYC A;  3ERO A;  2EYL A;  2EYH A;  1KAA A;  5CGK A;  5J22 A;  2F0Q A;  2RKS A;  4EQN A;  4ME5 A;  5EKL A;  2EYP A;  2OXP A;  2F0I A;  2F0E A;  4WOR A;  3TP8 A;  1KDA A;  5C5M A;  3T13 A;  4K2K A;  5CV5 A;  1EY8 A;  1NUC A;  1STA A;  2EYO A;  2PQE A;  3OMC A;  5DAU A;  5KYI A;  2RBM A;  3C1E A;  4KY7 A;  3OSO A;  4WRD A;  1KDB A;  4J1M A;  4F7X A;  5CC4 A;  3DMU A;  5M9O A;  2F0T A;  1SNP A;  2WAC A;  1STB A;  4KHV A;  1SND A;  2NUC A;  1ENA A;  3MEH A;  2F0N A;  3BDL A;  4I65 A;  4LAA A;  5IGG A;  4QB4 A;  2SOB A;  3EVQ A;  1F2Y A;  3NK9 A;  4QF4 A;  4TRD A;  4NMZ A;  3ERQ A;  1EZ8 A;  3TP7 A;  4NKL A;  3P75 A;  5CV7 A;  5C6A A;  1JOO A;  3D4D A;  3TME A;  2RDF A;  3DHQ A;  3P1H A;  5KGU A;  1SNC A;  2PW5 A;  3SK4 A;  2LKV A;  3D4W A;  2KHS A;  5J1Z A;  4B9W A;  5I6W A;  4IUN A;  1SNM A;  3EJI A;  4NDX A;  4K5V A;  1STY A;  4K8I A;  1JOK A;  4H7B A;  3T16 A;  5C3W A;  3QOL A;  5CR3 A;  3VA5 A;  3NP8 A;  1SYG A; 
#chains in the Genus database with same CATH topology
 1GD7 A;  4WJW A;  1E1T A;  4G7H C;  2OWO A;  2RCF A;  3GTK B;  3D3R A;  3A5Z B;  5JOB A;  1JT8 A;  1C7Y A;  1SJH D;  4KV6 A;  5IYB H;  1TU2 B;  1NMF A;  1C0A A;  2WII B;  1X56 A;  2F0H A;  1VQD A;  1I3Q B;  3Q24 A;  5IP9 G;  4A3L H;  4O0A A;  4RHR A;  4WJ4 A;  1TS4 A;  3ER0 A;  2B8G A;  5EKI A;  2PPB C;  3M4P A;  3MXU A;  4RKB A;  4GKK Q;  3HEJ A;  4IUQ A;  2WB1 G;  3MXN B;  2PQA A;  4IUT A;  5FK9 C;  3WWV A;  4TSS A;  1EYG A;  3EQL C;  4ZUI A;  1AFP A;  1HHV A;  3KF8 B;  1HZ9 A;  1R4P B;  1G51 A;  1EIF A;  1JB7 A;  1YVC A;  3FKI B;  4F88 A;  2K5N A;  2AUJ D;  3ND9 A;  2EYJ A;  5NUC A;  1IZ6 A;  1H9S A;  1VQB A;  3A8K E;  4N8F A;  3CCU A;  3T1Y Q;  4C3I B;  4OIK A;  2F0L A;  4C3H B;  3GTL H;  2JA5 G;  1A3U A;  1MKH A;  2EY5 A;  1Y1V H;  3FPP A;  2KEC A;  4IPD A;  1K73 C;  2ZT9 C;  5IYD G;  4YY3 Q;  3JAM i;  2R7Z H;  2R93 H;  2ZXP A;  1FYC A;  5L37 A;  4X64 Q;  3NQT A;  2B63 H;  3KUP A;  3CCE A;  4MTN A;  4CJ2 C;  4A76 A;  2ICE C;  1N34 L;  3ITP A;  5M3F B;  2NB0 A;  2OEO A;  1HZC A;  3DEO A;  4ABN A;  1K3B C;  1I4Q A;  4ULL A;  1KAA A;  2F0Q A;  2M9V A;  1O7Y A;  1WI5 A;  3M85 A;  4GOP A;  2NVY B;  4DV7 Q;  1PH7 A;  3F2D A;  5C5M A;  3PUZ A;  1S5E D;  3OMC A;  3J80 i;  1X3Q A;  3K6O A;  4DAV A;  3OSO A;  1XNQ L;  1L1O B;  3RN2 A;  4XDX A;  1AP0 A;  1SMY D;  3NEM A;  3DMU A;  1A8V A;  3VYR A;  5FOB B;  1MD2 D;  4DV5 L;  1AE3 A;  5ELC A;  1D6E C;  3G6J B;  1U5K A;  4RFB A;  3K0Y A;  4DR6 Q;  2ZM6 L;  1LTR D;  1RHP A;  2MHV A;  5M5W B;  1PYW D;  1BXT A;  1Y1W H;  1JOK A;  2HCC A;  1CA6 A;  1K0R A;  3W1G A;  2L1B A;  1O78 A;  4PMB A;  4DR5 Q;  4LF4 Q;  4A3D B;  3ULL A;  3PO2 B;  1C9O A;  4DV1 Q;  3CAM A;  1XMO L;  1AH9 A;  3I3C A;  1SYF A;  1EWI A;  4KN7 C;  1U4M A;  3SK8 A;  2ES2 A;  3S1R H;  1IBL Q;  3IRB A;  4EVO A;  1BQQ T;  3A74 A;  5C44 G;  2F4V Q;  3I7F A;  4NW2 A;  1JQY D;  2VW9 A;  1WCM G;  1ILP A;  4DR4 L;  2NBF A;  2WB1 B;  4E6I A;  4DV6 Q;  3BVG A;  3T1H L;  2HIV A;  2QDL A;  2JA6 G;  4KJO A;  1XMQ L;  1TWH B;  4RHS A;  2Q2H A;  2YU9 B;  3CD6 A;  4GN5 A;  1PFM A;  5C3X A;  4K0K Q;  3W2D A;  1PZK D;  2SNS A;  4HID A;  1KAB A;  2KCM A;  3J7Z C;  2ATW A;  1Y8N B;  4BY7 B;  2R3Z A;  2E74 C;  1Q3L A;  3S15 H;  1I94 L;  3QWN A;  4JI5 L;  1S40 A;  4IAL A;  4R1J A;  2VQE L;  2JA5 B;  5E1F A;  2AMC B;  1GXD C;  2F4I A;  3GTQ H;  1M4V A;  2EXZ A;  1BKB A;  1L2F A;  4YWK A;  2PZT A;  3KLS A;  4OX9 Q;  2WFW A;  2XVS A;  3H0G G;  4BY1 H;  3W5O A;  1XJV A;  4Q0F A;  2OTJ A;  2DNC A;  5EKL A;  2UXB Q;  2PCF B;  4WOR A;  3CME A;  3MA2 B;  1Q7Y C;  2R61 A;  1NUC A;  4TVA B;  1LLR D;  1M1K C;  2PMZ E;  3U9S A;  4LNQ A;  3FPU B;  2YYZ A;  2RBM A;  4A3F G;  4J1M A;  1SXT A;  1FGB D;  4OHJ A;  3NBH A;  3J7A F;  1STB A;  4JI3 L;  3MEH A;  1ENA A;  4B3R Q;  2CW0 D;  1DOL A;  3AYH B;  3SVM A;  5AFW A;  5JJL A;  1V1P B;  1GUS A;  2PQA B;  2JN4 A;  4LF6 L;  2RVL A;  3MWY W;  1OTC A;  1VQH A;  4K5V A;  2MFI A;  1HTL D;  5CR3 A;  4K5X A;  4GLA C;  5EPK A;  4QUF A;  2Q8I B;  1K8O A;  5HGQ A;  4IOA A;  1A2T A;  1EY7 A;  2VUM G;  1QIL A;  2AWN A;  1XXG A;  2CCZ A;  4N9P A;  1ZYR D;  4B3M L;  1HTP A;  1B2T A;  4R9W A;  1B3Q A;  5C4J H;  4RCO A;  3C1F A;  4R4Q A;  1E1O A;  4X66 L;  1PVO A;  5C4Z A;  4DA2 A;  1WFQ A;  4DV2 L;  1LT6 D;  4CHT B;  3S16 B;  4QGU A;  4LK1 C;  4CBV A;  5C4X H;  1A2U A;  1IW7 D;  1KC8 C;  1EQT A;  3TDQ A;  2HQL A;  2UUC L;  2EQS A;  3D8G A;  1ILQ A;  4POG A;  3D0F A;  4XT1 B;  5ELE A;  5COR A;  3V96 A;  3K7A B;  3HP3 A;  3M4O B;  5IGE A;  5KNB A;  1KNA A;  5C44 B;  5M3M G;  3RR5 A;  1EWC A;  2L0C A;  4OWT B;  2HIX A;  3IL8 A;  4YCV A;  1YEZ A;  1YNN D;  3U4V A;  3CQZ B;  3OTO L;  4FF2 A;  4Y52 H;  1SNO A;  2BOS A;  4RH6 A;  1J8I A;  3HOX H;  4P2C B;  4H02 A;  1E3P A;  3K5M A;  2JP1 A;  1S72 A;  1NSN S;  1RL2 A;  2F3W A;  2Z4I A;  4LF5 L;  4FVM A;  3DWA A;  4A3B H;  4CDC C;  5LL6 S;  1WTH A;  2KBN A;  3DM3 A;  3K5O A;  4MIU A;  1AN8 A;  3E5S A;  2BDN A;  2F0O A;  1IBK Q;  5K36 G;  1LT5 D;  1VMP A;  4HIO A;  3MEF A;  3H15 A;  3KK7 A;  1SYB A;  3UDF A;  2B2T A;  1GHK A;  1MBY A;  4EQN A;  4XT3 B;  2R6G A;  4A3M H;  4B3T L;  3H0G B;  4A3I G;  2K01 A;  3TP8 A;  1Q90 A;  2K50 A;  4G7O C;  2E76 C;  2UXD Q;  1GUO A;  5T1G A;  2KEN A;  1PZJ D;  1B9M A;  3D31 A;  5JEA J;  3PSI A;  4QJF A;  5EPL A;  4A3F B;  4LAA A;  1F2Y A;  3L9A X;  3OOC A;  4NMZ A;  5JEA H;  1W6J A;  3TP7 A;  2QEX A;  4NKL A;  4G4K A;  3ULP A;  1EEF D;  3P1H A;  2K7V A;  3FRP B;  3X3N A;  1ESF A;  1X9N A;  2EJF C;  1D1K A;  4FO2 A;  1J5E Q;  3CC7 A;  4K8I A;  4H7B A;  3VA5 A;  3HOW H;  3VR3 A;  1G91 A;  1G29 1;  4JBJ A;  1TWF B;  5E7N A;  5DNF A;  2CVR A;  2PW7 A;  1TS5 A;  1SYC A;  4K14 A;  4A3K H;  4R8N A;  1S3O A;  2F0J A;  3NSW A;  2IX1 A;  1H95 A;  2EXD A;  4ZKC B;  1NTG A;  5EAY A;  2KHJ A;  3BDO A;  5D3I B;  4Y7N B;  2UUB Q;  2R92 B;  4KKS A;  2DJF C;  2VUM B;  1J6Q A;  4ZRZ A;  5I2Y A;  3S9W A;  3GP7 A;  1K83 H;  1VQE A;  4OIJ A;  4EQO A;  2VQF L;  1WOC A;  4FXD A;  2P5Z X;  1WTP A;  2DJG C;  1HXY D;  3EN2 A;  2PO4 A;  3S1Q H;  5IGF A;  4L6T B;  2I0Q A;  3K80 C;  3KDF A;  5IYC G;  3BVZ A;  3J7Y W;  2GN5 A;  5CBE E;  3I72 A;  1LAB A;  1NCV A;  5DEH A;  4A3J B;  5M3M B;  3NHH A;  3H3V H;  1A3V A;  5E3F A;  1VQM A;  3KF6 A;  2MO1 A;  2B2T C;  4H44 C;  4FP5 D;  3I4L A;  2K5H A;  4HIK A;  2K33 A;  4QUC A;  1HUN A;  2E5L L;  3GTK H;  2K04 A;  3PUY A;  3IFT A;  2B2Y C;  2D0P A;  4HJA A;  3L7Z C;  2K05 A;  2G9H D;  4YWL A;  5M5Y H;  4Q5V A;  1UWV A;  5GAG C;  4YHH L;  5AJ3 L;  4OO1 H;  1I3Q H;  3CRL C;  1ENC A;  3OMG A;  4JBM A;  1F9R A;  4A3C G;  3NE5 B;  2PI2 E;  1JCK B;  2H5X A;  4JI6 L;  3VYT A;  3CCQ A;  1HCZ A;  4GNX C;  1G6P A;  4HED A;  4DKA C;  3KLS X;  3E9H A;  3VR6 A;  2BE5 D;  2PQE A;  3FKI H;  2UUA Q;  4DR7 Q;  2VY3 A;  4A3I B;  3I8Z A;  2ZJR A;  1KDB A;  2JA9 A;  4IQZ A;  4C3I H;  4A93 B;  2YV5 A;  3M7G A;  4KHV A;  2F0N A;  4JG2 A;  3MXN A;  1LYL A;  1JJ2 A;  1I4X A;  4LMQ D;  1EZ8 A;  1B53 A;  2A74 C;  5KND A;  5FLX L;  3DHQ A;  1HNZ Q;  4KHP Q;  3KF8 A;  3SK4 A;  5J3B A;  1G2T A;  5J1Z A;  4IUN A;  1RD9 D;  1IYV A;  2LXJ A;  5M3F H;  2NZO A;  4X65 L;  5BR8 L;  2E2H B;  3T4A C;  1SSO A;  1WTV A;  1SFO B;  3KFU A;  2GA4 B;  2NVY H;  3MFY A;  3VR4 A;  3SK6 A;  4ODG A;  5LMN Q;  4QL5 A;  5C3E G;  3GTM B;  4O2D A;  2ZXR A;  4JVZ A;  2E2I H;  4A3E G;  4APV A;  2EJM A;  4C2M B;  1YIJ A;  1A3T A;  1LUZ A;  3FDT A;  4ZK9 B;  1Q12 A;  5M5W H;  4KKU A;  2FMC A;  3PCO B;  3H6M A;  3HZX A;  1LM0 A;  1H9R A;  3CHB D;  3HOU G;  2IWH A;  3J81 E;  1C48 A;  1L1O A;  3ULJ A;  1ET6 A;  4LF8 Q;  1PH6 A;  1PYB A;  4A3D H;  3GTG B;  1G8Z D;  5IWA Q;  1IXR A;  3PO2 H;  5KNC A;  1I4G A;  4DR1 Q;  5HGT A;  4OEL B;  1YHB A;  5EGT A;  1FJG L;  3OHX C;  4ZCK A;  4A4I A;  3RNU A;  2IY5 B;  1EQQ A;  3DXJ C;  2QGQ A;  3ZJY C;  4L5T A;  3CW2 C;  2K5D A;  1VQ6 A;  1IBM Q;  5CV4 A;  5IP9 H;  3JAM c;  4GNX B;  1B50 A;  5FJ8 G;  1KRS A;  4GKJ L;  5I9O A;  3TZU A;  4ZQ3 A;  2ZJQ A;  1SEB D;  1UNS A;  3J80 L;  4C3H G;  1Q1B A;  1I4P A;  3I4N G;  3QR8 A;  4BA2 I;  1OXS C;  4ZAI A;  5I4D A;  1TWH H;  1CT1 D;  2QCP X;  3G6E A;  1L0X B;  4DUZ Q;  1VQK A;  4F7X A;  5CC4 A;  1RTO A;  3J80 c;  1R4Q B;  1HQR D;  4IN3 A;  4BY7 H;  1EOV A;  4TRD A;  2V4D A;  3TN2 A;  3BS1 A;  1LTL A;  4JYA L;  3G4S A;  2JA5 H;  4KKT A;  3D4D A;  3W1B A;  3KDF B;  1HZB A;  5IYD H;  1XWE A;  4QQB X;  2JA7 G;  1QJO A;  3ERS X;  3BZC A;  1X55 A;  4X6A H;  2NWG A;  4DV0 L;  3KF6 B;  3HFZ B;  4NXN L;  2PI2 A;  2RDG A;  2KVM A;  1B70 B;  2N8N A;  4JI1 Q;  5LMU L;  3M9B A;  1L0Y B;  5C0X I;  3R3O A;  4BS9 A;  2CHB D;  1PH9 A;  1LTI D;  2AUK A;  1V1O A;  5IOD A;  2NVX B;  3ND8 A;  4JI8 L;  3RZD B;  1LTS D;  5C3E B;  1TWG H;  3TS0 A;  1DON A;  4IZ8 A;  5LHY 1;  4DNT B;  3OPO A;  4LW1 A;  1T5E A;  3TQY A;  4A3E B;  4RKL A;  1VQA A;  2ZTD A;  4PZ8 A;  4DV4 L;  1N33 L;  2K5V A;  1HUM A;  4X62 L;  4X3K A;  4AQY L;  2IHE A;  3SGI A;  2VNU D;  5IT9 c;  5GAH C;  3NQI A;  4K6L A;  1I4R A;  3HOU B;  4DV5 Q;  4XQQ A;  4GN3 B;  2LSS A;  1FL0 A;  1H9J A;  3I4M B;  2DY8 A;  1Q86 C;  2QKI C;  1V1P A;  3TBI B;  2WAQ B;  3S16 H;  3R2I A;  1FR3 A;  5FO7 B;  4DR3 L;  1KRT A;  2X69 A;  3CPF A;  4LFA Q;  1OXX K;  1CSQ A;  3K7A H;  1DZ1 A;  3DWP A;  3H91 A;  1A15 A;  2VZA A;  3G71 A;  5C44 H;  3S2D B;  4R4I A;  1XMO Q;  4BY7 G;  3NPP A;  4X3S A;  3L3O C;  2F0I A;  4R8I A;  4BBS B;  2F0E A;  4DUY L;  4LF9 Q;  3CQZ H;  3UDG A;  4K2K A;  1WCM H;  3I4N B;  1EL0 A;  1TWA B;  1TY2 A;  1EUJ A;  1V1Q A;  5DAU A;  5FLM G;  2FIN B;  2JA6 H;  1PXU A;  3J7A V;  2A6E D;  1W6K A;  1OXV A;  1Q8K A;  1XTC D;  5ELD A;  1YZ6 A;  3ERQ A;  4IFD H;  2IPK D;  1FD7 D;  4JI2 Q;  3F8T A;  3BZK A;  4DR4 Q;  4LF7 L;  2KOL A;  3I4O A;  1N32 L;  4OWX B;  1VQG A;  3T1H Q;  3LNN A;  1WVL A;  1STY A;  3K59 A;  5C3W A;  1VQL A;  3GV6 A;  2I5H A;  2XWJ B;  3FHW A;  3I90 A;  3CCS A;  2FMM A;  3CMA A;  2JA7 B;  3P20 A;  4U67 3;  3T56 B;  2VXW A;  1B8A A;  1YNJ D;  1W2B A;  3H0G H;  2HDL A;  1I94 Q;  2EY6 A;  2VQE Q;  1B7Y B;  2HHH L;  2Q2T A;  3VYS A;  3PUX A;  1VF7 A;  3GTO B;  5ISR A;  3W3A A;  3C46 A;  5D3D A;  4A3F H;  3A7L A;  3JC6 6;  4TKO B;  3GD7 A;  1WTR A;  2N55 A;  3E6Z X;  1GUN A;  1MJC A;  3M4Y A;  1WJJ A;  1OXT A;  1CK1 A;  3GTP B;  5G3L F;  3LGJ A;  1UUP A;  1X54 A;  4GKK L;  1MGS A;  1YJN A;  2RSN A;  2FXQ A;  1TWF H;  5KEE A;  5IY0 A;  5KRU A;  3QB3 A;  3ICE A;  1JOR A;  5CV6 A;  2A68 D;  2A6H C;  4Y7N H;  1FVI A;  2VUM H;  3CCJ A;  3QIA A;  3STB D;  5H1S E;  3GV3 A;  3VR5 A;  3PV0 A;  4JI0 Q;  3U58 A;  1NE3 A;  4O42 A;  5GAD C;  3TZD A;  1ZEQ X;  4UY8 C;  1UE7 A;  1BBX C;  3KBG A;  3D6C A;  3QOJ A;  5LL6 X;  2MGS A;  2RKS A;  2RQX A;  2L15 A;  3RLO A;  4X64 L;  4CKB A;  4B3M Q;  4ME3 A;  2WKC A;  5M3M H;  2N78 A;  1YNX A;  3N52 A;  4IFD G;  3CP0 A;  4NPS A;  3WOE A;  1SRU A;  2OCE A;  1HR0 Q;  4IJL A;  4MTK A;  1PTO C;  3MTS A;  2SEB D;  3CU7 A;  3FMC A;  4RGN A;  4DV7 L;  3NTI A;  1IKL A;  1AE2 A;  3J7A 5;  1B3A A;  4JV5 Q;  4IUR A;  2F1M A;  1QVC A;  2RDF A;  1XPO A;  2E75 C;  1SNC A;  2PW5 A;  2LKV A;  2VL6 A;  1CA5 A;  4GZY C;  1QZH A;  2NVT B;  4YCU A;  3J81 i;  3RD4 A;  4DPG A;  2I46 A;  1U9R A;  1SYE A;  4DR6 L;  5K36 H;  2RF4 A;  3D6W A;  5KIX A;  1HNX Q;  4HAE A;  1QNK A;  3ONA B;  4KI0 A;  5TSS A;  3TP6 A;  4UP9 A;  4A3I H;  5DM7 3;  5IGC A;  2RHS B;  4CDF C;  2LY7 A;  4DR5 L;  4RG1 A;  1HNW Q;  1RKN A;  2LMC B;  4POF A;  4DV1 L;  1I50 B;  5G3L D;  1E22 A;  1EZ6 A;  2CFM A;  2K1B A;  3LX0 A;  3G48 A;  4C1N K;  1ML0 D;  1EQV A;  2R92 G;  4RGM A;  1VQJ A;  1KLU D;  3R8B A;  1HA6 A;  3F2B A;  2PYK A;  5EBC A;  2F4V L;  2Z1C A;  1SMX A;  4RAU C;  2AWO A;  1CHQ D;  2C35 B;  2E2H H;  1EWH A;  2F3I A;  1SFO H;  4JI7 Q;  4CKE A;  1BO0 A;  1BCP C;  4DV6 L;  4KN4 C;  1AZP A;  5KYL A;  4PNY A;  2DGY A;  3MZ5 A;  1SE4 A;  4QMG A;  1HR0 W;  1M8A A;  3GTM H;  2JK8 A;  4A3J G;  2IL8 A;  2MUY A;  4K0K L;  1KTK A;  4PZ7 A;  1VQN A;  4ID6 A;  4HTH A;  4DN4 M;  2A69 C;  4LWC A;  2N3S A;  3TS2 A;  2XGT A;  1B9N A;  4DAP A;  1M90 C;  1XX8 A;  2OXP A;  2WAQ E;  3EBE A;  2K32 A;  2JEB I;  5IYC H;  1Q1E A;  4RGT A;  1PTO B;  2V1C C;  1VS0 A;  4OX9 L;  3BJU A;  3GTG H;  3K57 A;  1TVX A;  1HPC A;  2UXB L;  4I65 A;  2N88 A;  2KCT A;  2R7F A;  2SOB A;  3RZO H;  1I6H H;  1JJC B;  4DR2 L;  2PNR C;  1RIP A;  1RDP D;  3P75 A;  2R7Z B;  2R93 B;  1HQM C;  5IE8 A;  2JE6 I;  3A5U A;  2JSO A;  4DV3 L;  2IHF A;  2B63 B;  3SEB A;  1SE3 A;  2KHS A;  1N36 Q;  2R7D A;  4NDX A;  2QA4 A;  2UXC Q;  2B2Y A;  3NTH A;  3QOL A;  5M5X B;  4A3C H;  2E2D C;  4A93 G;  3VR2 A;  1TQO A;  1PRT C;  3BYY B;  3UI2 A;  3M3Y B;  4S3S A;  4JI4 L;  1JJG A;  2NN6 G;  2B2W A;  1PLF A;  1EU4 A;  5DM6 3;  1NJI C;  2JYO A;  2KED A;  3MXG A;  2CH4 W;  2UU9 Q;  2F0D A;  1EIY B;  1ONL A;  3S14 B;  4GNX A;  2BCO A;  2PZU A;  1Y8P B;  4JI6 Q;  4R4O A;  1EFI D;  1LO5 D;  2K5W A;  4RCN A;  4DU9 A;  1SE8 A;  3MXP A;  3F2C A;  5JVH 3;  3HOZ B;  1EEI D;  2BDO A;  5CV9 A;  1EY6 A;  2L9H A;  2WIN B;  3HKS A;  4B3S L;  4P75 A;  3PIO A;  1BCP B;  4CJ1 B;  1MSH A;  1TII D;  2F03 A;  2B2V A;  4EQ5 A;  1KQS A;  1DCZ A;  2F0G A;  4GLV B;  2CH4 A;  4BA1 I;  4AIM A;  4KJN A;  1S5F D;  3S1R B;  2BH2 A;  2MPM A;  5JVG 3;  4JBW A;  2NVX H;  1EQR A;  1O7L A;  1R9T B;  3RZD H;  2CQO A;  2I07 B;  5C3E H;  5IGD A;  4LFC Q;  2H1E A;  4K2L A;  1F9Q A;  2TMP A;  5BR8 Q;  1A6X A;  1B44 D;  4KY6 A;  3JAM E;  4A3E H;  2YTY A;  4RMF A;  1WYD A;  1CQF A;  1QE6 A;  4FNF A;  3L0O A;  2RCN A;  1V8Q A;  5J22 A;  1CQV A;  4F87 A;  1JIC A;  3AFP A;  5JPM C;  3N6R A;  3T13 A;  4QIW B;  1IBK L;  1VQ8 A;  1IYJ B;  1CKM A;  4CDE C;  2H4O A;  2JJQ A;  1YJW A;  1CZG A;  3HOU H;  1ROD A;  2B2W C;  3S1M B;  1FNV A;  5FO8 B;  2CWP A;  2IT1 A;  4HIM A;  1YI2 A;  4QB4 A;  4QF4 A;  1XPU A;  1G2S A;  2UXD L;  4TQU S;  3PIP 3;  2NVQ B;  4PG3 A;  3EIV A;  1SR3 A;  3HS0 C;  1VQ4 A;  3S1N B;  4H0L C;  1UEA B;  1EFW A;  1BR9 A;  3OYY A;  3SDZ A;  3T16 A;  4G7Z C;  1PRT B;  4ILW A;  1NNX A;  5FJ8 H;  4JK1 C;  3PMF A;  4BBS H;  5F2D A;  3TSS A;  1AEX A;  4C3H H;  4BWG B;  3HOV G;  1YHA A;  3T51 B;  3I4N H;  1J5E L;  1TWA H;  1QUQ B;  1A0I A;  4P74 A;  1G6Z A;  1ASZ A;  5EJW A;  4K6D A;  2B2V C;  2K14 A;  4A3G G;  4N9T A;  2F52 A;  1VQ5 A;  1S5D D;  1A63 A;  2A69 D;  3NXW A;  3BG3 A;  1PH3 A;  2UUB L;  2DY7 A;  4L63 B;  1JMC A;  4DK3 C;  4UPA A;  1QG7 A;  1E7Z A;  1EY5 A;  2I5M X;  3VA7 A;  5FLX c;  1Z7T A;  4EQP A;  3E9I A;  5IP7 G;  2B3G A;  5CYU A;  2XSC A;  5HUR A;  2ZXO A;  2JA7 H;  2CQA A;  1CUK A;  4XIG S;  1J9O A;  2C5C A;  2FHT A;  4O1N A;  4K8J A;  3Q22 A;  3PO3 B;  1F2Z A;  4I7A A;  4X3T A;  4JYA Q;  3Q6S A;  3HOY G;  4DNI A;  2JEA I;  1N9W A;  4JW0 A;  3GTO H;  1K8A C;  3VDY A;  2KCC A;  5IGB A;  2SNM A;  2WV6 D;  2B8F A;  1GJX A;  4ALP A;  3OWF A;  4DV0 Q;  2Z8L A;  1ENF A;  2B29 A;  3I4M G;  1X3P A;  1XYI A;  2JA8 G;  1NBW A;  2EYP A;  3GTP H;  4MNO A;  3MAQ A;  2GVB A;  3HKZ B;  2XWB B;  1KDA A;  5JPN C;  1BDO A;  4C56 C;  4GS3 A;  4DAY B;  2WAQ G;  1JWM D;  4IPC A;  4IUU A;  3HOX B;  4HSV A;  3PIP A;  3J81 j;  5EBD A;  2LS0 1;  3H3V I;  1D5Z C;  4IJH A;  2XRQ D;  4J15 A;  1Z47 A;  3Q8D A;  4BBS G;  4DV4 Q;  5ELF A;  1JE4 A;  3D4W A;  3E3X A;  2HCI A;  4X62 Q;  1SMY C;  3AQQ A;  5I6W A;  3U4Z A;  1S5C D;  1KAW A;  1QB5 D;  2ALY B;  2MNA A;  4AQY Q;  4OO1 I;  3NP8 A;  4LJZ C;  1NY4 A;  2YU9 H;  5C6A A;  3A55 A;  1K8G A;  1EIH A;  4A3M B;  3HGB A;  1HNZ L;  1U4L A;  5I9P A;  4FF3 A;  1STE A;  2Y0S G;  3GO5 A;  5LMN W;  5ELB A;  1WTQ A;  2E2J B;  4HN7 A;  3IAY A;  4BBR G;  1Q81 C;  3HOV B;  4FXK C;  2J0T D;  3NTK A;  3URY A;  1VQ9 A;  4I7Z C;  5FLM H;  4NXM L;  1VDZ A;  1IHZ A;  2AQ1 B;  2XN9 C;  3I70 A;  4JCV E;  5C0X G;  4CDD C;  4A3G B;  1PYS B;  3IFD A;  1Y8O B;  3U9O A;  1SYD A;  5JJZ A;  1Y14 B;  4KD4 A;  1L0W A;  4JOI C;  1II3 A;  2EY1 A;  2I5L X;  4DUY Q;  2BA0 A;  1O80 A;  3Q23 A;  2O5I C;  4PMC A;  3M4Q A;  1XNR L;  1BBU A;  5IIF A;  1SDF A;  2EE1 A;  3HOW B;  2TSS A;  1E0B A;  3A54 A;  4G57 A;  3Q0A A;  1K9M C;  1IYU A;  1EY0 A;  3R2T A;  4V19 0;  1LTT D;  1N34 Q;  1BNZ A;  4FXG C;  4NP5 A;  2ZJP A;  1GKH A;  3PGZ A;  4LF7 Q;  1K83 B;  1CSP A;  3KBX A;  1N32 Q;  4LF8 L;  2D5D A;  1P16 A;  3HOY B;  5IWA L;  3S1Q B;  2RA4 A;  4FF4 A;  2FJ2 A;  4LUO A;  5EPJ A;  4QCL A;  4HJ8 A;  2QW7 A;  1XNQ Q;  4LFB L;  2NTS A;  3G7L A;  3ERO A;  2EYL A;  2EYH A;  4UP7 A;  1Z6H A;  1DOK A;  1HFN A;  1D8L A;  4ME5 A;  1U0L A;  2G5D A;  2KUM A;  2HHH Q;  2OTL A;  2JA8 B;  2ZM6 Q;  4KMU C;  2A19 A;  1AW7 A;  5JJI A;  1WTX A;  1BVS A;  1MI2 A;  1HFG A;  1DM0 B;  2AHO B;  1X3F A;  3L2P A;  4U68 A;  1VF5 C;  3CKI B;  5M5Y B;  1IL2 A;  1X65 A;  1SBB B;  4QIW E;  3J81 L;  3M4O H;  1JR0 D;  1KNE A;  4YWM A;  1SJE D;  3TME A;  4DUZ L;  4M8A A;  2D9U A;  2A5H A;  4H13 C;  5ELN A;  2CKZ B;  1SYG A;  2CW0 C;  4IO9 A;  1GUG A;  1LTG D;  1GO3 E;  1P8L A;  3J81 c;  2HUG A;  3SHL A;  4IFD J;  1BUV T;  1CM9 A;  1DYQ A;  2EOT A;  5T1I A;  1PTO H;  3V2T A;  4B9X A;  2O5J C;  2Y0S B;  5ELO A;  3K5N A;  4JBK A;  4ZUJ A;  1HZA A;  2EPB A;  4BBR B;  2F0U A;  4PMW A;  4JI1 L;  1VQ7 A;  1XMQ Q;  1PMR A;  4BXX H;  1ZYR C;  3UE0 A;  4C3J G;  3TRZ A;  4EX5 A;  2ASB A;  3UDI A;  2VB2 X;  2L5T A;  2Z6K C;  4XYQ A;  1O7I A;  2KJX A;  3K81 C;  1IW7 C;  4JI5 Q;  1X6O A;  3S17 B;  1JOQ A;  5M5X H;  4OWW B;  3KJP A;  2NTT A;  3I91 A;  4DK6 C;  1VQP A;  2AQ2 B;  3M3Y H;  1QOH A;  1I4H A;  2L4N A;  1KDC A;  2X6G A;  4UAI A;  2BH8 A;  3A0J A;  3PF4 A;  4OEM B;  5IOC A;  3H09 A;  1YNN C;  4L5S A;  3SK5 A;  3U50 C;  1PV4 A;  4UDU C;  2A8V A;  1CZW A;  3QO2 A;  2E2I B;  3IKJ A;  3S14 H;  1F9S A;  2EYM A;  2M2L A;  4M1U B;  1TY0 A;  2PNH A;  2EVB A;  1RJT A;  1EY4 A;  5CV8 A;  5IYB G;  3CCL A;  3CC2 A;  1MSG A;  1NMG A;  1C8C A;  4HCE A;  4IUP A;  1JWU D;  3HOZ H;  2OQK A;  4JI3 Q;  3SE0 A;  4C1N I;  1STA A;  2K28 A;  4LFA L;  2EYO A;  3R93 A;  4A3L G;  1CKN A;  2R92 H;  1D7Q A;  3S2H B;  1JB3 A;  2HD3 A;  4AYB B;  1QWY A;  3M7N A;  2BA1 A;  4XTC S;  4LF6 Q;  2CWA A;  4P73 A;  2F0T A;  3T1Y L;  4P71 A;  3BDL A;  3HKZ E;  4LF9 L;  1HA5 A;  1KL9 A;  1GVP A;  3AMU A;  2VB3 X;  5CBA E;  3QJY A;  3RMH A;  2XIW A;  3MFG A;  1R9T H;  1VQF A;  3H94 A;  3DUZ A;  4DAM A;  4YY3 L;  4L5R C;  1LV9 A;  5I2X A;  4XQJ A;  4A3J H;  1LTA D;  1TWC B;  3QG1 A;  4X66 Q;  4FYD A;  2XTI A;  4DV2 Q;  4HR7 B;  4JI2 L;  1ICW A;  1Y1V G;  2UUC Q;  4BXX G;  1DJR D;  4PZ6 A;  1DOM A;  3E0J A;  2R7Z G;  2R93 G;  2F0P A;  3CCR A;  3EFX D;  1TR5 A;  2B63 G;  4P72 A;  4GOP C;  4HMI A;  4CKC A;  2G9D A;  3EA6 A;  3S1M H;  4JPB W;  3OTO Q;  1E2V A;  4B08 A;  2XRS D;  3LWU A;  2HQE A;  1KLG D;  1RTN A;  2NVQ H;  2VS1 A;  1D5M C;  3MVV A;  2RHQ B;  1STN A;  3V05 A;  1BF4 A;  3AU7 A;  3S1N H;  4C3J B;  1XPR A;  2QF7 A;  3X3M A;  4XXE A;  4LF5 Q;  4IFD I;  1BOS A;  1PFS A;  1EY9 A;  2D62 A;  2KHI A;  2F0W A;  5I6Y A;  1KXL A;  2EDG A;  1PZI D;  1SLJ A;  1F9P A;  3CCV A;  1CKO A;  4LF4 L;  3LWE A;  4A93 H;  4DR2 Q;  3C2P A;  4PQX A;  1X3E A;  3OIQ A;  1PH5 A;  4LUV A;  2NN6 H;  4DV3 Q;  3NWT A;  3FVQ A;  3HOZ G;  3C3L A;  1Y1W G;  4B3T Q;  3K0X A;  3GTJ B;  1TWG B;  1UEB A;  4WFN 3;  1IBL L;  4KLK A;  4DK0 A;  2X6L A;  1PH4 A;  1T9H A;  5JAV A;  4HJ9 A;  1NAP A;  4DGZ A;  2J7Z A;  4JI4 Q;  3UE1 A;  1Y69 U;  3OW2 A;  3I73 A;  2GVA A;  2IJ0 A;  3CXC A;  4PV1 C;  4JI0 L;  1YJ9 A;  1QUQ A;  1PDQ A;  2O2L D;  3PUV A;  5CV5 A;  4AH6 A;  1EY8 A;  1PTO F;  1X32 A;  2L55 A;  2AKW B;  3C1E A;  1CI3 M;  1FNW A;  4KY7 A;  3PIO 3;  4GLX A;  1KIX A;  3D4R A;  5GRO A;  3GQB A;  2A73 B;  1TS3 A;  1H9S B;  3P7J A;  2WAC A;  1KD1 C;  1U4P A;  3PO3 H;  1Q46 A;  2RDH A;  3EVQ A;  3NK9 A;  4C2M H;  3DLL A;  3RLN A;  2BE5 C;  1K28 A;  3I56 A;  1SN8 A;  1JOO A;  1HR0 L;  2IW3 A;  2J4X A;  2L11 A;  1RCV D;  3CCM A;  4B9W A;  3NWS A;  1ASY A;  4RGO S;  4RWS C;  4B3S Q;  5GQO A;  2ZTC A;  4MHE A;  4FDB A;  1HRJ A;  1EU3 A;  2F3V A;  2VQF Q;  4JV5 L;  1C4Q A;  1PH2 A;  1D1I A;  1TS2 A;  3GTL B;  1KHI A;  3RUZ A;  1WCM B;  4GOP B;  1LT4 D;  4WJ3 M;  1QCB D;  1Y1V B;  3DWQ A;  4MZ9 A;  2JA6 B;  1YIT A;  1EOT A;  1N8R C;  1EYD A;  4HMJ A;  1HNX L;  3MHB A;  4BY1 G;  1CHP D;  3CPW A;  4CJ0 B;  1K8M A;  4IPG A;  4B3R L;  1O7Z A;  4N8X 1;  1I6V C;  3BU2 A;  2E5L Q;  1IKM A;  2Y0S E;  2WP8 J;  1HNW L;  2OT2 A;  2A6H D;  4DAY A;  3VYU A;  5JJK A;  3K8A A;  2B39 A;  5C4H A;  4YHH Q;  5AJ3 Q;  5FLX E;  5GAE C;  3BYT B;  2KA7 A;  5A2Q E;  2LFN A;  1BCP F;  1Z9F A;  1CKN B;  1A62 A;  4IUV A;  4L8J A;  4EGV A;  3MC0 B;  2QEJ C;  2F0F A;  4DXG A;  3AFQ A;  1PH8 A;  5DLQ E;  1FGU A;  2E2J H;  1VCI A;  4DFA A;  4ZYS A;  4GN4 B;  3HOV H;  1WD1 A;  2ENB A;  4XQN A;  1MHW C;  2SDF A;  2F0V A;  2KQ3 A;  4XYO A;  4JI7 L;  1E24 A;  2JQO A;  3DEP A;  1SNQ A;  1Y1W B;  3CC4 A;  1TKW B;  4A3G H;  1SE2 A;  2F0M A;  3A56 A;  1T5X D;  1GOZ A;  1D2B A;  1UE6 A;  3PQI A;  1PTO D;  3PF5 A;  4DK1 A;  2NZH A;  3PO3 G;  3CF5 A;  1CTM A;  1U4R A;  2Z0S A;  1CFM A;  1GHJ A;  2NN6 I;  5C4X G;  4YCW A;  1SRO A;  4WRD A;  2C9O A;  1E2Z A;  1JWS D;  5IP7 H;  2D0O A;  5E4X A;  1SNP A;  2NUC A;  3A8I E;  4X65 Q;  1B4O A;  3HKZ G;  5KGU A;  4AYB E;  4QY7 A;  2ID0 A;  3KLW A;  3HOY H;  2K5Q A;  2E8G A;  2Q2U A;  1WTO A;  3HOX G;  1SNM A;  3RN5 A;  4MN3 A;  3I2Z A;  1PRT F;  3AB9 A;  2NZ1 D;  3NEN A;  2D2C C;  2YTV A;  4ZKB B;  2Z6B A;  4J6H A;  3ZYY X;  2IX3 A;  3FEW X;  3FP9 A;  5BN4 A;  4KY5 A;  2M00 A;  3I4M H;  2PZW A;  1N36 L;  3A8J E;  1PFB A;  1QVG A;  2JA8 H;  4A3B G;  3S15 B;  2MQH A;  3J80 E;  3K5L A;  2UXC L;  2B2U A;  2Z9H A;  1HJP A;  3PUW A;  3GTQ B;  2Z4H A;  3SR1 A;  2K75 A;  2WB1 E;  4OXP A;  3NUC A;  3KYH C;  4KD3 A;  4OL7 A;  1PHJ A;  2KCN A;  3NBH B;  4KTA A;  4NB3 A;  4A3M G;  1ET9 A;  2OQ0 A;  3K7U C;  4BY1 B;  1DXM A;  4V0B A;  2F0K A;  3AEV A;  2HT1 A;  3S2D H;  2AQ3 B;  2UU9 L;  3TP5 A;  1BCP D;  4KK7 A;  2O4X A;  5A35 A;  3O13 A;  1ESR A;  2EY2 A;  1LTB D;  2N49 A;  3CRK C;  1FJG Q;  3KOJ A;  1NR2 A;  5BN3 A;  4UP8 A;  1HH2 P;  1MIU A;  4HJ5 A;  2WKD A;  2XNA C;  1I5F A;  2ICI A;  4DNR B;  1PFN A;  2YTX A;  5JEA G;  5FO9 B;  3E0E A;  4GKJ Q;  4FF1 A;  5C5L A;  3NEL A;  1MJE A;  1F2M A;  4BBR H;  5C0X J;  1GUW A;  1S4Z A;  4UHV A;  1X3G A;  3HOW G;  1IL8 A;  4OGQ C;  1UE1 A;  1BBW A;  2Q8T A;  2FFK B;  4KHZ A;  5C0X H;  4A3K G;  3T53 B;  1UE5 A;  5A2Q L;  3K58 A;  2DUD A;  5CGK A;  2DN8 A;  2K4K A;  4HCS A;  1B1Z A;  5IT9 E;  1S5B D;  4LFC L;  2ZTE A;  3S17 H;  5C4J B;  4R4T A;  2EIF A;  3OW7 A;  1ZKO A;  1V43 A;  4NXM Q;  5C4X B;  3F1Z A;  5M9O A;  4R4C A;  3GDE A;  3TRE A;  4Z9C B;  4JOI A;  2B2U C;  2KEE A;  1LT3 D;  3HG9 A;  1GM5 A;  2EJG C;  1F2L A;  1D5X C;  1QVF A;  1PRT D;  4NXN Q;  1WTW A;  5CV7 A;  1OO9 B;  1K0S A;  1JC7 A;  4IOC A;  3HRZ C;  2NYZ D;  3F2U A;  1XNR Q;  4RA8 A;  5LMU Q;  3UDX A;  1EIG A;  3WDN A;  5D14 A;  3EJI A;  2A6E C;  2MP1 A;  1SAP A;  3H3V C;  3S24 A;  1PA6 A;  2F0S A;  2HDM A;  1TT2 A;  5EQ0 A;  4JI8 Q;  3RLF A;  1STG A;  3SXH A;  2RSO A;  2K03 A;  4OO1 G;  3NBI A;  1FNU A;  2MO0 A;  2QIL A;  3S2H H;  2UUA L;  1VQI A;  3I55 A;  1XTD A;  5D65 A;  3JAM L;  4DR7 L;  4A3B B;  4IPH A;  1LAC A;  5EKK A;  1N33 Q;  5J39 A;  1YNJ C;  1PH1 A;  1ICF B;  1NR4 A;  1AZQ A;  1EYA A;  3RZO B;  1I6H B;  2A1A A;  2OF1 A;  5HY6 A;  4LFB Q;  1UAP A;  5K5P A;  4CGY B;  4OON A;  2EZV A;  4LUZ A;  1W3S A;  1YBY A;  5COY A;  3FKI G;  4YIJ A;  4HSP A;  5CMD A;  4KHP L;  4A75 A;  4DF7 A;  1TWC H;  2JXM B;  3BZD B;  4ZLT F;  4C3I G;  1ZXT A;  1Q8I A;  4X3U A;  1VQO A;  2K6A A;  4DR3 Q;  3OWE B;  1TXY A;  4F8M A;  1V9P A;  3BDC A;  5LMN L;  4HJ7 A;  2L12 A;  5E4W C;  1STH A;  5FKA C;  1K3R A;  2IX0 A;  5M3F G;  4J8Q A;  2EYF A;  2PMZ B;  3DM1 A;  4K5W A;  2NVT H;  2MJ8 A;  2A68 C;  2QDB A;  1QZG A;  1DD2 A;  1Q82 C;  1EYC A;  2Q2I A;  1E2W A;  3STB C;  1H9M A;  4C3J H;  4A3K B;  1WD0 A;  1OXU A;  5BN5 A;  5KYI A;  1GUT A;  2DNE A;  3WOF A;  3TEH B;  1VMC A;  4L5Q A;  3A7A B;  1JE5 A;  1RF2 D;  4JC0 A;  1L1O C;  1SND A;  5IGG A;  1I50 H;  2Z6K A;  3KLR A;  4DR1 L;  1YHQ A;  2K52 A;  1VQC A;  3OIP A;  3BVM A;  1DGS A;  3GTJ H;  2LXK A;  3B6Y A;  5IT9 L;  3KJO A;  1H9K A;  4AYB G;  4A3D G;  1F77 A;  1IBM L;  1QNU A;  3PO2 G;  4DXF A;  2Q8R E; 
#chains in the Genus database with same CATH homology
 4WJW A;  4G7H C;  3GTK B;  3D3R A;  5JOB A;  1SJH D;  4KV6 A;  1TU2 B;  2WII B;  2F0H A;  1I3Q B;  3Q24 A;  4RHR A;  1TS4 A;  2B8G A;  5EKI A;  2PPB C;  3MXU A;  4RKB A;  3HEJ A;  4IUQ A;  4IUT A;  5FK9 C;  4TSS A;  3EQL C;  4ZUI A;  1AFP A;  1HHV A;  1R4P B;  3FKI B;  4F88 A;  2AUJ D;  3ND9 A;  2EYJ A;  5NUC A;  1H9S A;  3A8K E;  4C3I B;  4OIK A;  2F0L A;  4C3H B;  1A3U A;  2EY5 A;  3FPP A;  2KEC A;  2ZT9 C;  2ZXP A;  1FYC A;  3NQT A;  3KUP A;  4CJ2 C;  2ICE C;  3ITP A;  5M3F B;  2NB0 A;  2OEO A;  3DEO A;  4ABN A;  1I4Q A;  4ULL A;  1KAA A;  2F0Q A;  2M9V A;  1O7Y A;  3M85 A;  2NVY B;  5C5M A;  3PUZ A;  1S5E D;  3OMC A;  1X3Q A;  3K6O A;  4DAV A;  3OSO A;  4XDX A;  1AP0 A;  1SMY D;  3DMU A;  3VYR A;  5FOB B;  1MD2 D;  5ELC A;  1D6E C;  3G6J B;  4RFB A;  3K0Y A;  1LTR D;  1RHP A;  2MHV A;  5M5W B;  1PYW D;  1BXT A;  1JOK A;  2HCC A;  1CA6 A;  2L1B A;  1O78 A;  4PMB A;  4A3D B;  3PO2 B;  3I3C A;  1SYF A;  4KN7 C;  1U4M A;  3SK8 A;  4EVO A;  1BQQ T;  4NW2 A;  1JQY D;  1ILP A;  2NBF A;  2WB1 B;  4E6I A;  3BVG A;  4KJO A;  1TWH B;  4RHS A;  2YU9 B;  1PFM A;  5C3X A;  3W2D A;  1PZK D;  2SNS A;  1KAB A;  1Y8N B;  4BY7 B;  2R3Z A;  2E74 C;  1Q3L A;  3QWN A;  2JA5 B;  4IAL A;  5E1F A;  1GXD C;  2F4I A;  1M4V A;  2EXZ A;  2PZT A;  3KLS A;  2XVS A;  4Q0F A;  2DNC A;  5EKL A;  2PCF B;  4WOR A;  3MA2 B;  2R61 A;  1NUC A;  1LLR D;  3U9S A;  3FPU B;  2YYZ A;  2RBM A;  4J1M A;  1SXT A;  1FGB D;  4OHJ A;  3NBH A;  3J7A F;  1STB A;  3MEH A;  1ENA A;  2CW0 D;  1DOL A;  3SVM A;  5AFW A;  1V1P B;  1GUS A;  2RVL A;  3MWY W;  4K5V A;  1HTL D;  5CR3 A;  4K5X A;  5EPK A;  4QUF A;  2Q8I B;  1K8O A;  1A2T A;  1EY7 A;  1QIL A;  2AWN A;  1XXG A;  4N9P A;  1ZYR D;  1HTP A;  1B2T A;  4R9W A;  4RCO A;  3C1F A;  5C4Z A;  4DA2 A;  1LT6 D;  4CHT B;  3S16 B;  4LK1 C;  4CBV A;  1A2U A;  1IW7 D;  1EQT A;  3TDQ A;  3D8G A;  1ILQ A;  5ELE A;  4XT1 B;  5COR A;  3V96 A;  3K7A B;  3HP3 A;  3M4O B;  5IGE A;  5KNB A;  1KNA A;  5C44 B;  1EWC A;  2L0C A;  3IL8 A;  1YNN D;  3CQZ B;  4FF2 A;  1SNO A;  2BOS A;  4RH6 A;  1J8I A;  4P2C B;  3K5M A;  2JP1 A;  1NSN S;  2F3W A;  2Z4I A;  4FVM A;  3DWA A;  5LL6 S;  3K5O A;  4MIU A;  1AN8 A;  3E5S A;  2BDN A;  2F0O A;  5K36 G;  1LT5 D;  1VMP A;  3KK7 A;  1SYB A;  2B2T A;  1GHK A;  1MBY A;  4EQN A;  4XT3 B;  2R6G A;  3H0G B;  2K01 A;  3TP8 A;  1Q90 A;  4G7O C;  2E76 C;  1GUO A;  5T1G A;  1PZJ D;  1B9M A;  3D31 A;  5JEA J;  5EPL A;  4A3F B;  4LAA A;  1F2Y A;  3L9A X;  3OOC A;  4NMZ A;  5JEA H;  1W6J A;  3TP7 A;  4NKL A;  4G4K A;  1EEF D;  2K7V A;  3FRP B;  3P1H A;  3X3N A;  1ESF A;  2EJF C;  1D1K A;  4FO2 A;  4K8I A;  4H7B A;  3VA5 A;  1G91 A;  3VR3 A;  1G29 1;  1TWF B;  5DNF A;  2CVR A;  2PW7 A;  1TS5 A;  1SYC A;  4K14 A;  4R8N A;  2F0J A;  3NSW A;  2IX1 A;  4ZKC B;  4Y7N B;  3BDO A;  5D3I B;  2R92 B;  4KKS A;  2VUM B;  4ZRZ A;  5I2Y A;  3S9W A;  3GP7 A;  4OIJ A;  4EQO A;  4FXD A;  1WTP A;  1HXY D;  2PO4 A;  5IGF A;  4L6T B;  3BVZ A;  3J7Y W;  5CBE E;  3I72 A;  1LAB A;  1NCV A;  5DEH A;  4A3J B;  5M3M B;  3NHH A;  1A3V A;  5E3F A;  2B2T C;  4H44 C;  4FP5 D;  3I4L A;  2K33 A;  4QUC A;  1HUN A;  2K04 A;  3PUY A;  3IFT A;  2B2Y C;  3L7Z C;  2K05 A;  2G9H D;  4Q5V A;  4OO1 H;  3CRL C;  1ENC A;  3OMG A;  1F9R A;  3NE5 B;  1JCK B;  3VYT A;  1HCZ A;  4HED A;  3KLS X;  3VR6 A;  2BE5 D;  2PQE A;  4A3I B;  3I8Z A;  1KDB A;  4IQZ A;  4A93 B;  3M7G A;  4KHV A;  2F0N A;  3MXN A;  1I4X A;  4LMQ D;  1EZ8 A;  1B53 A;  2A74 C;  5KND A;  5FLX L;  3DHQ A;  3KF8 A;  3SK4 A;  1G2T A;  5J1Z A;  4IUN A;  1RD9 D;  1IYV A;  2E2H B;  3T4A C;  1SSO A;  1WTV A;  1SFO B;  2GA4 B;  3MFY A;  3VR4 A;  3SK6 A;  4ODG A;  3GTM B;  2ZXR A;  2EJM A;  4C2M B;  1A3T A;  3FDT A;  4ZK9 B;  1Q12 A;  4KKU A;  2FMC A;  3H6M A;  3HZX A;  1H9R A;  3CHB D;  2IWH A;  3J81 E;  1C48 A;  1ET6 A;  3GTG B;  1G8Z D;  5KNC A;  1I4G A;  5HGT A;  5EGT A;  3OHX C;  3DXJ C;  2K5D A;  5CV4 A;  1B50 A;  5I9O A;  3TZU A;  4ZQ3 A;  1SEB D;  1UNS A;  3J80 L;  4C3H G;  1Q1B A;  1I4P A;  4BA2 I;  1OXS C;  4ZAI A;  5I4D A;  1CT1 D;  2QCP X;  1L0X B;  4F7X A;  5CC4 A;  1RTO A;  1R4Q B;  1HQR D;  4IN3 A;  4TRD A;  2V4D A;  3TN2 A;  3BS1 A;  4KKT A;  3D4D A;  1XWE A;  1QJO A;  2NWG A;  2RDG A;  2KVM A;  1L0Y B;  5C0X I;  3R3O A;  4BS9 A;  2CHB D;  1LTI D;  2AUK A;  1V1O A;  5IOD A;  2NVX B;  3ND8 A;  3RZD B;  1LTS D;  5C3E B;  1DON A;  4IZ8 A;  5LHY 1;  4DNT B;  3OPO A;  1T5E A;  4A3E B;  4RKL A;  1HUM A;  4X3K A;  2VNU D;  3NQI A;  4K6L A;  1I4R A;  3HOU B;  4XQQ A;  1H9J A;  3I4M B;  2DY8 A;  2QKI C;  1V1P A;  3TBI B;  2WAQ B;  3R2I A;  1FR3 A;  5FO7 B;  2X69 A;  1OXX K;  1DZ1 A;  3DWP A;  3H91 A;  1A15 A;  3S2D B;  3NPP A;  4X3S A;  3L3O C;  2F0I A;  4R8I A;  4BBS B;  2F0E A;  4K2K A;  3I4N B;  1EL0 A;  1TWA B;  1TY2 A;  5DAU A;  2FIN B;  1PXU A;  3J7A V;  2A6E D;  1W6K A;  1OXV A;  1XTC D;  5ELD A;  3ERQ A;  4IFD H;  2IPK D;  1FD7 D;  2KOL A;  3LNN A;  1WVL A;  1STY A;  3K59 A;  5C3W A;  3GV6 A;  2XWJ B;  3I90 A;  2FMM A;  2JA7 B;  3P20 A;  4U67 3;  3T56 B;  2VXW A;  1YNJ D;  2HDL A;  2EY6 A;  3VYS A;  3PUX A;  1VF7 A;  3GTO B;  5ISR A;  3W3A A;  3C46 A;  5D3D A;  3A7L A;  4TKO B;  3GD7 A;  1WTR A;  2N55 A;  3E6Z X;  1GUN A;  3M4Y A;  1OXT A;  1CK1 A;  3GTP B;  5G3L F;  1UUP A;  1MGS A;  2RSN A;  5KEE A;  5KRU A;  3QB3 A;  1JOR A;  5CV6 A;  2A68 D;  2A6H C;  3QIA A;  3GV3 A;  3VR5 A;  3PV0 A;  4O42 A;  3TZD A;  1ZEQ X;  1BBX C;  3KBG A;  3D6C A;  3QOJ A;  5LL6 X;  2MGS A;  2RKS A;  2RQX A;  4CKB A;  2WKC A;  3N52 A;  4IFD G;  3WOE A;  1PTO C;  3MTS A;  2SEB D;  3CU7 A;  3FMC A;  4RGN A;  3NTI A;  1IKL A;  1B3A A;  4IUR A;  2F1M A;  2RDF A;  2E75 C;  1SNC A;  2PW5 A;  2LKV A;  4GZY C;  1CA5 A;  2NVT B;  3RD4 A;  2I46 A;  1U9R A;  1SYE A;  5K36 H;  3D6W A;  5KIX A;  4HAE A;  1QNK A;  3ONA B;  4KI0 A;  5TSS A;  3TP6 A;  5DM7 3;  5IGC A;  2LY7 A;  1RKN A;  2LMC B;  1I50 B;  5G3L D;  1EZ6 A;  2K1B A;  3LX0 A;  4C1N K;  1ML0 D;  1EQV A;  4RGM A;  1KLU D;  3R8B A;  1HA6 A;  2PYK A;  5EBC A;  2Z1C A;  4RAU C;  2AWO A;  1CHQ D;  1EWH A;  4CKE A;  1BO0 A;  1BCP C;  4KN4 C;  1AZP A;  5KYL A;  4PNY A;  3MZ5 A;  1SE4 A;  4QMG A;  1M8A A;  2IL8 A;  2MUY A;  1KTK A;  4ID6 A;  4HTH A;  4DN4 M;  2A69 C;  1B9N A;  4DAP A;  1XX8 A;  2OXP A;  2K32 A;  2JEB I;  1Q1E A;  4RGT A;  1PTO B;  3K57 A;  1TVX A;  1HPC A;  4I65 A;  2N88 A;  2SOB A;  2PNR C;  1RDP D;  3P75 A;  2R7Z B;  2R93 B;  1HQM C;  2JE6 I;  2JSO A;  2B63 B;  3SEB A;  1SE3 A;  2KHS A;  4NDX A;  2B2Y A;  3NTH A;  3QOL A;  5M5X B;  2E2D C;  3VR2 A;  1TQO A;  1PRT C;  3BYY B;  3UI2 A;  3M3Y B;  4S3S A;  2NN6 G;  2B2W A;  1PLF A;  1EU4 A;  5DM6 3;  2JYO A;  2KED A;  3MXG A;  2F0D A;  1ONL A;  3S14 B;  2BCO A;  2PZU A;  1Y8P B;  1EFI D;  1LO5 D;  2K5W A;  4RCN A;  4DU9 A;  3MXP A;  5JVH 3;  3HOZ B;  1EEI D;  2BDO A;  5CV9 A;  1EY6 A;  2L9H A;  2WIN B;  1BCP B;  4CJ1 B;  1MSH A;  1TII D;  2F03 A;  2B2V A;  1DCZ A;  2F0G A;  4BA1 I;  4KJN A;  1S5F D;  3S1R B;  2MPM A;  5JVG 3;  4JBW A;  1O7L A;  1R9T B;  2I07 B;  5IGD A;  2H1E A;  4K2L A;  1F9Q A;  2TMP A;  1A6X A;  1B44 D;  4KY6 A;  3JAM E;  1CQF A;  1QE6 A;  4FNF A;  5J22 A;  1V8Q A;  1CQV A;  4F87 A;  1JIC A;  5JPM C;  3N6R A;  3T13 A;  4QIW B;  2H4O A;  1CZG A;  1ROD A;  2B2W C;  3S1M B;  1FNV A;  5FO8 B;  2IT1 A;  4QB4 A;  4QF4 A;  1G2S A;  4TQU S;  3PIP 3;  2NVQ B;  3HS0 C;  3S1N B;  4H0L C;  1UEA B;  1BR9 A;  3SDZ A;  3T16 A;  4G7Z C;  1PRT B;  4ILW A;  4JK1 C;  3PMF A;  5F2D A;  3TSS A;  1AEX A;  4BWG B;  3T51 B;  1G6Z A;  5EJW A;  4K6D A;  2B2V C;  4N9T A;  1S5D D;  2A69 D;  3NXW A;  3BG3 A;  2DY7 A;  4L63 B;  1QG7 A;  1EY5 A;  3VA7 A;  1Z7T A;  4EQP A;  5CYU A;  2XSC A;  5HUR A;  2ZXO A;  2CQA A;  4XIG S;  1J9O A;  2C5C A;  2FHT A;  4O1N A;  4K8J A;  3Q22 A;  3PO3 B;  1F2Z A;  4X3T A;  3Q6S A;  2JEA I;  2KCC A;  5IGB A;  2SNM A;  2WV6 D;  2B8F A;  1GJX A;  3OWF A;  2Z8L A;  1ENF A;  1X3P A;  1XYI A;  2EYP A;  3MAQ A;  3HKZ B;  2XWB B;  1KDA A;  5JPN C;  1BDO A;  4C56 C;  1JWM D;  4IUU A;  3HOX B;  4HSV A;  5EBD A;  2LS0 1;  1D5Z C;  2XRQ D;  1Z47 A;  5ELF A;  1JE4 A;  3D4W A;  2HCI A;  1SMY C;  5I6W A;  1S5C D;  1QB5 D;  4OO1 I;  3NP8 A;  4LJZ C;  5C6A A;  3A55 A;  1EIH A;  4A3M B;  3HGB A;  1U4L A;  5I9P A;  4FF3 A;  1STE A;  3GO5 A;  5ELB A;  1WTQ A;  2E2J B;  4HN7 A;  3IAY A;  3HOV B;  4FXK C;  2J0T D;  3NTK A;  3URY A;  4I7Z C;  1VDZ A;  1IHZ A;  2AQ1 B;  2XN9 C;  3I70 A;  5C0X G;  4A3G B;  3IFD A;  1Y8O B;  3U9O A;  1SYD A;  5JJZ A;  4KD4 A;  1II3 A;  2EY1 A;  2BA0 A;  1O80 A;  3Q23 A;  2O5I C;  4PMC A;  5IIF A;  1SDF A;  2EE1 A;  3HOW B;  2TSS A;  1E0B A;  3A54 A;  4G57 A;  3Q0A A;  1IYU A;  1EY0 A;  3R2T A;  4V19 0;  1LTT D;  1BNZ A;  4FXG C;  4NP5 A;  1K83 B;  3KBX A;  2D5D A;  3HOY B;  3S1Q B;  2RA4 A;  4FF4 A;  2FJ2 A;  5EPJ A;  4QCL A;  2NTS A;  3G7L A;  3ERO A;  2EYL A;  2EYH A;  1Z6H A;  1DOK A;  1HFN A;  4ME5 A;  2KUM A;  2JA8 B;  4KMU C;  1AW7 A;  1WTX A;  1MI2 A;  1HFG A;  1DM0 B;  4U68 A;  1VF5 C;  3CKI B;  5M5Y B;  1SBB B;  3J81 L;  1JR0 D;  1KNE A;  3TME A;  1SJE D;  4M8A A;  2D9U A;  2A5H A;  4H13 C;  1SYG A;  2CW0 C;  1GUG A;  1LTG D;  2HUG A;  3SHL A;  4IFD J;  1BUV T;  1CM9 A;  1DYQ A;  2EOT A;  5T1I A;  1PTO H;  3V2T A;  4B9X A;  2O5J C;  2Y0S B;  3K5N A;  4ZUJ A;  2EPB A;  4BBR B;  2F0U A;  4PMW A;  1PMR A;  1ZYR C;  4C3J G;  2VB2 X;  2L5T A;  4XYQ A;  2KJX A;  1IW7 C;  1JOQ A;  3S17 B;  2NTT A;  3I91 A;  2AQ2 B;  1QOH A;  1I4H A;  2L4N A;  1KDC A;  2X6G A;  4UAI A;  5IOC A;  3H09 A;  1YNN C;  3SK5 A;  4UDU C;  1CZW A;  3QO2 A;  2E2I B;  3IKJ A;  1F9S A;  2EYM A;  2M2L A;  4M1U B;  1TY0 A;  2EVB A;  1RJT A;  1EY4 A;  5CV8 A;  1MSG A;  1C8C A;  4HCE A;  4IUP A;  1JWU D;  3SE0 A;  4C1N I;  1STA A;  2K28 A;  2EYO A;  3R93 A;  3S2H B;  1JB3 A;  4AYB B;  1QWY A;  3M7N A;  2BA1 A;  4XTC S;  2F0T A;  3BDL A;  1HA5 A;  3AMU A;  2VB3 X;  5CBA E;  3QJY A;  3RMH A;  2XIW A;  3MFG A;  3H94 A;  3DUZ A;  1LV9 A;  5I2X A;  4XQJ A;  1LTA D;  1TWC B;  3QG1 A;  4FYD A;  4HR7 B;  1ICW A;  1DJR D;  1DOM A;  3E0J A;  2F0P A;  3EFX D;  1TR5 A;  4HMI A;  4CKC A;  2G9D A;  3EA6 A;  1E2V A;  4B08 A;  2XRS D;  3LWU A;  2HQE A;  1KLG D;  1RTN A;  1D5M C;  3MVV A;  1STN A;  3V05 A;  1BF4 A;  3AU7 A;  4C3J B;  2QF7 A;  3X3M A;  4XXE A;  4IFD I;  1BOS A;  1EY9 A;  2D62 A;  2F0W A;  5I6Y A;  2EDG A;  1PZI D;  1F9P A;  3LWE A;  3C2P A;  4PQX A;  3OIQ A;  2NN6 H;  3NWT A;  3FVQ A;  3C3L A;  3GTJ B;  1TWG B;  4WFN 3;  4DK0 A;  2X6L A;  5JAV A;  1NAP A;  4DGZ A;  2J7Z A;  1Y69 U;  3I73 A;  2IJ0 A;  4PV1 C;  1PDQ A;  2O2L D;  3PUV A;  5CV5 A;  1EY8 A;  1PTO F;  1X32 A;  2L55 A;  3C1E A;  4KY7 A;  1CI3 M;  1FNW A;  3PIO 3;  3D4R A;  3GQB A;  2A73 B;  1TS3 A;  1H9S B;  3P7J A;  2WAC A;  1U4P A;  2RDH A;  3EVQ A;  3NK9 A;  2BE5 C;  1JOO A;  2IW3 A;  2J4X A;  2L11 A;  1RCV D;  4B9W A;  3NWS A;  4RGO S;  4RWS C;  4MHE A;  1HRJ A;  1EU3 A;  2F3V A;  1C4Q A;  1D1I A;  1TS2 A;  3GTL B;  3RUZ A;  1WCM B;  1LT4 D;  1QCB D;  1Y1V B;  3DWQ A;  2JA6 B;  1EOT A;  1EYD A;  4HMJ A;  3MHB A;  1CHP D;  4CJ0 B;  1K8M A;  1O7Z A;  1I6V C;  1IKM A;  2WP8 J;  2OT2 A;  2A6H D;  4DAY A;  3VYU A;  2B39 A;  5C4H A;  5FLX E;  3BYT B;  2KA7 A;  5A2Q E;  2LFN A;  1BCP F;  4IUV A;  4L8J A;  4EGV A;  3MC0 B;  2QEJ C;  2F0F A;  4DXG A;  1VCI A;  4DFA A;  4ZYS A;  1WD1 A;  2ENB A;  4XQN A;  2SDF A;  2F0V A;  2KQ3 A;  4XYO A;  3DEP A;  1SNQ A;  1Y1W B;  1TKW B;  1SE2 A;  2F0M A;  3A56 A;  1T5X D;  1GOZ A;  1D2B A;  1PTO D;  4DK1 A;  1CTM A;  1U4R A;  1CFM A;  1GHJ A;  2NN6 I;  4WRD A;  2C9O A;  1E2Z A;  1JWS D;  5E4X A;  1SNP A;  2NUC A;  3A8I E;  1B4O A;  5KGU A;  2ID0 A;  2K5Q A;  1WTO A;  1SNM A;  4MN3 A;  1PRT F;  3AB9 A;  2NZ1 D;  2D2C C;  4ZKB B;  4J6H A;  3ZYY X;  2IX3 A;  3FEW X;  5BN4 A;  4KY5 A;  2M00 A;  2PZW A;  3A8J E;  1PFB A;  3S15 B;  3J80 E;  3K5L A;  2B2U A;  3PUW A;  3GTQ B;  3SR1 A;  2Z4H A;  3NUC A;  4KD3 A;  4OL7 A;  2KCN A;  4KTA A;  1ET9 A;  4BY1 B;  1DXM A;  4V0B A;  2F0K A;  2AQ3 B;  3TP5 A;  1BCP D;  4KK7 A;  2O4X A;  5A35 A;  3O13 A;  1ESR A;  2EY2 A;  1LTB D;  3CRK C;  1NR2 A;  5BN3 A;  2WKD A;  2XNA C;  4DNR B;  2ICI A;  1PFN A;  5JEA G;  5FO9 B;  4FF1 A;  5C5L A;  1F2M A;  5C0X J;  1GUW A;  1S4Z A;  1IL8 A;  4OGQ C;  2Q8T A;  2FFK B;  4KHZ A;  5C0X H;  3T53 B;  5A2Q L;  3K58 A;  5CGK A;  2DN8 A;  4HCS A;  1B1Z A;  5IT9 E;  1S5B D;  5C4J B;  3OW7 A;  1ZKO A;  1V43 A;  5C4X B;  5M9O A;  4Z9C B;  2B2U C;  2KEE A;  1LT3 D;  3HG9 A;  2EJG C;  1F2L A;  1D5X C;  1PRT D;  1WTW A;  5CV7 A;  1OO9 B;  1JC7 A;  3HRZ C;  2NYZ D;  3F2U A;  4RA8 A;  1EIG A;  3WDN A;  5D14 A;  3EJI A;  2A6E C;  2MP1 A;  1SAP A;  3H3V C;  2F0S A;  2HDM A;  1TT2 A;  5EQ0 A;  3RLF A;  1STG A;  3SXH A;  2RSO A;  2K03 A;  4OO1 G;  1FNU A;  3NBI A;  2QIL A;  5D65 A;  3JAM L;  4A3B B;  1LAC A;  5EKK A;  5J39 A;  1YNJ C;  1NR4 A;  1AZQ A;  1EYA A;  3RZO B;  1I6H B;  2OF1 A;  1UAP A;  5K5P A;  4CGY B;  2EZV A;  5COY A;  4YIJ A;  4HSP A;  5CMD A;  4DF7 A;  2JXM B;  3BZD B;  4ZLT F;  4C3I G;  1ZXT A;  1Q8I A;  4X3U A;  2K6A A;  3OWE B;  4F8M A;  3BDC A;  2L12 A;  5E4W C;  1STH A;  5FKA C;  2IX0 A;  4J8Q A;  2EYF A;  2PMZ B;  3DM1 A;  4K5W A;  2MJ8 A;  2A68 C;  2QDB A;  1DD2 A;  1EYC A;  1E2W A;  1H9M A;  4A3K B;  1WD0 A;  1OXU A;  5BN5 A;  5KYI A;  1GUT A;  2DNE A;  3WOF A;  1VMC A;  3A7A B;  1RF2 D;  5IGG A;  1SND A;  3KLR A;  3OIP A;  3BVM A;  5IT9 L;  1H9K A;  1F77 A;  1QNU A;  4DXF A;  2Q8R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...