1MKHA

C-terminal domain of methionyl-trna synthetase from pyrococcus abyssi
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
106
Chain Sequence
MYVKFDDFAKLDLRVGKIIEVKDHPNADKLYVVKVDLGDEVRTLVAGLKKYYKPEELLNRYVVVVANLEPKKLGIGSQGMLLAADDGERVALLMPDKEVKLGAKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the C-terminal domain of methionyl-tRNA synthetase
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ligase
molecule keywords C-terminal domain of Methionyl-tRNA synthetase
total genus 17
structure length 106
sequence length 107
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1mkhA00
4JI7L 4IPDA 4B3RL 3CCRA 1E22A 2R93G 4DR6Q 1HZAA 1XTDA 1IBKL 4GOPB 1X55A 3UDFA 4FDBA 4GLVB 5IYDH 1K0RA 4PMWA 4O0AA 1UEBA 5AJ3L 1K73C 2VY3A 4DAYB 1CKOA 4B3TL 1X3EA 2E5LQ 2VW9A 2I5HA 3L0OA 5C0XG 1JMCA 3I4NH 1IBML 4JI1L 2VQEL 1PH4A 2E8GA 2E2HH 3GTOH 1L1OB 5M5WH 3KDFA 1OXUA 1Y1VG 4ME3A 4A3DH 3S1MH 3S1NH 1N32L 4GOPC 2PI2A 2ASBA 5C4JH 4JBMA 1J5EL 1VQ8A 2R93H 2GVBA 1OXXK 2LSSA 3MXNB 4QIWE 4PG3A 2NZOA 2ZJRA 5JEAG 1E1TA 2VQFQ 1UE5A 2CWPA 3RZOH 4QJFA 1E24A 1L0WA 4IOCA 3Q8DA 4HIKA 1HNXL 1EWIA 1N9WA 3CC4A 4TQUS 1I3QH 3HOUH 1QUQA 4JI3Q 3HOUG 1UE7A 4ALPA 2RHSB 1VQEA 4BY1G 1KC8C 3CD6A 2UXCQ 4P72A 3J81i 4JI2L 3KJPA 3CQZH 3RNUA 3DLLA 4BBSG 5C0XI 2MQHA 1J5EQ 3HOYH 2JA7H 1HNWQ 1M90C 3ZJYC 4OWWB 4JV5L 2NVQH 2JE6I 2IHEA 4DPGA 1GKHA 1YZ6A 3G6EA 1M1KC 2UU9Q 3CP0A 2WB1G 4LNQA 2OTJA 4YWKA 3S15H 3GTKH 1W2BA 4UPAA 1Y1WG 2Z0SA 2JK8A 1Y1WH 3ULLA 1A62A 2IHFA 4X65L 2JA8G 1Z47A 3GTJH 1PFSA 1U5KA 1Z9FA 4X62L 3CPFA 3ULPA 1PH3A 1X6OA 4A3DG 1VS0A 4IFDI 2VS1A 4B3RQ 4DUZQ 3FKIH 1MIUA 2UXBQ 5JEAJ 4OX9L 3L7ZC 2F52A 2KCMA 1PH8A 3RR5A 1VQ7A 5C44H 4DV6L 1Q81C 2UXDL 1SR3A 2K4KA 3PO2G 5C3EH 4MTNA 1IXRA 3D0FA 4APVA 2PNHA 3S2DH 3CMAA 1CUKA 4LF8Q 3S14H 4UP8A 4A3BG 2ZTCA 1FJGL 1TWFH 1D8LA 3T1YL 4DR5Q 4A76A 1E1OA 4GLAC 1TXYA 2UXCL 2ALYB 2NN6G 2NVXH 4LF5L 4B3TQ 1YNXA 5LMNL 4WJ4A 1VQOA 4LF6L 4JOIA 2OQ0A 4LFBQ 4JI3L 4JBWA 4BBSH 2ZTEA 3W1GA 2ZM6Q 3D31A 4RMFA 1MKHA 3NEMA 4OONA 1YHAA 1HZ9A 4DR7Q 5M5YH 1N36Q 1KHIA 1L1OC 1X56A 3FHWA 1YJ9A 2L15A 3PIOA 3CCQA 1Y14B 4QQBX 3CC7A 4DR3L 4AQYQ 2B63H 2IT1A 1WFQA 1FL0A 3I4OA 2UUCQ 2E2JH 1OXTA 2A1AA 2RF4A 3HKZG 4EQ5A 5GADC 1WJJA 4B3ML 3KF6A 3TRZA 1KAWA 1E3PA 2KENA 1SN8A 4DV4L 4A3KG 3PUWA 4LFCQ 3I4MH 4L5QA 5IYCH 1FVIA 1VCIA 3H0GH 1Q12A 2KHJA 3JC66 4QY7A 3TEHB 4A75A 4POFA 3H3VI 2EXDA 3CCSA 2BH8A 3S24A 1AE3A 1GO3E 4P75A 1KRTA 1GVPA 1V9PA 1PYBA 4KHPL 5K36G 1IBLQ 2R92H 2YYZA 4BA1I 4JI5Q 2OTLA 5C0XJ 3J7A5 2VNUD 1V43A 2FXQA 5LMUL 2B3GA 1XNQQ 1Q7YC 1KL9A 2LXKA 1VQ9A 3CCUA 2MO1A 1VQ5A 4NXMQ 4A3LG 5IYBH 4YCWA 2EQSA 2JA5H 3M7NA 3K7UC 4DR6L 4IOAA 3S2HH 4X6AH 3M3YH 1CSQA 3OYYA 3CCMA 5LMUQ 1XMOQ 3HOXH 2IY5B 4JI0Q 2YTVA 3EBEA 1EFWA 1IBLL 4BXXH 4L5RC 3PUXA 1N33Q 4BBRG 5IT9c 2B29A 4JC0A 5DLQE 1WCMH 3U4ZA 3GTGH 1BBWA 1XJVA 3HOZH 4LF6Q 1JJGA 1G291 3NBHB 1ASYA 4A3FH 4GKJQ 1PHJA 3BJUA 5JJLA 4GS3A 1P16A 3I4NG 4C2MH 1XNRL 1LUZA 1Q46A 1N32Q 1HR0L 4YY3L 3JAMi 4NXNL 5JJKA 1UWVA 4DAMA 1NBWA 3BZKA 1TWCH 2N3SA 4B3MQ 1AE2A 1Q82C 2JA5G 1X3GA 2QGQA 4JI8Q 3M4QA 3CCJA 3S1QH 5IP7H 1XPRA 4PZ7A 1U0LA 3CAMA 3K80C 2E2IH 4EX5A 3I56A 2OWOA 3HOWH 3UE0A 2ZJPA 2N78A 2C35B 1N33L 4DV5Q 2IX1A 4X65Q 5IY0A 3OTOL 1HJPA 4HJAA 2D0PA 2K14A 2H5XA 1XMOL 4A3MG 1EQRA 1RL2A 3E9HA 4DV1L 3GTPH 4BY1H 3K0XA 1S3OA 1X3FA 5GROA 2UUAQ 1C7YA 1J6QA 1VQHA 4A3CH 4JYAL 1CSPA 1YVCA 2N49A 4DR2Q 2JEBI 2DUDA 3HKSA 3NELA 4AIMA 2QEXA 1PYSB 2GN5A 4JI5L 3RN5A 1A63A 2D62A 3E9IA 3BZCA 1UE6A 2EIFA 4X66Q 1QZGA 1QUQB 1X54A 2JA7G 1LM0A 4L5TA 4NB3A 4YY3Q 4HIOA 4A3EG 1PH1A 3AQQA 1N34L 1HZCA 4DR1Q 4DKAC 1VQIA 5C3EG 1PH2A 1GM5A 4DUYQ 3AEVA 4DUZL 2VUMH 4GOPA 4GLXA 2ZTDA 3HOVH 1IZ6A 3AYHB 4P74A 4DK3C 3G48A 4DV7Q 4KLKA 1X65A 4YWLA 2BH2A 4C3HH 5H1SE 3RN2A 1MJCA 2WAQE 3LGJA 1IL2A 2JA6G 4Y52H 4A3IH 1I94L 3SGIA 3J80c 1B7YB 5JJIA 3H3VH 1EOVA 3IRBA 3WWVA 3GO5A 1K8AC 4GN5A 2KHIA 4A4IA 1MJEA 3CMEA 4LUOA 4A3EH 4YCVA 3PO2H 1B8AA 4NPSA 2K50A 3CCVA 3I2ZA 1W3SA 3HOVG 4PZ8A 5M3FH 3HFZB 2F4VQ 4UY8C 3KF8B 4OWXB 1VQ4A 1JJCB 4JI1Q 3A74A 2VQEQ 4KHZA 4UP7A 4LFAQ 4BY7G 4X64Q 4A3BH 1VQCA 2VZAA 2WAQG 3CCEA 2WB1E 3OW2A 3KLWA 3U4VA 4DR2L 1VQGA 1CKNA 1NE3A 2HHHQ 4A3GG 3TREA 2Q2HA 4OXPA 3F2DA 3S16H 3KF6B 3PCOB 1QZHA 1VQ6A 3HOYG 3AFPA 1G6PA 2ZJQA 4JI6Q 4A3CG 1H95A 1I94Q 1BKBA 2Z6KA 3KYHC 2CKZB 4R4TA 1G51A 2K75A 5IWAL 2Q2IA 4DV5L 1SMXA 2YTYA 4TVAB 2HHHL 3KJOA 3M85A 4DV3L 3M9BA 4IPHA 4DNIA 5HGQA 4JI8L 3VDYA 4LW1A 3I4MG 1K9MC 2DGYA 1HNZL 3CXCA 1PH6A 1SE8A 1C0AA 2PQAA 4BBRH 1BVSA 1VQJA 4X64L 4DR1L 3GTLH 3EN2A 1QVCA 2RCNA 1UE1A 1N34Q 3GTMH 1JT8A 4GNXA 2F4VL 5IE8A 3CPWA 4JI4L 5IYDG 2Q2UA 4IFDG 4R4OA 5GAEC 4OX9Q 1B70B 5M3MG 1L1OA 4A3GH 3S17H 3DM3A 2IX0A 4JYAQ 4DV6Q 4MZ9A 5FLXc 3T1HL 2UXDQ 1XMQQ 1YEZA 4A3JG 4YHHL 3RLFA 5C4XG 5IYBG 1KQSA 3ICEA 3J7ZC 3CC2A 3HOWG 2R7ZG 4XTCS 4HIDA 1WI5A 3OTOQ 2OCEA 1XMQL 3HOXG 2B63G 4AYBE 4NXML 2AMCB 3PO3H 2WP8J 4P71A 3ULJA 1YJNA 1SFOH 1TWHH 2R6GA 4O2DA 1YI2A 2I5MX 2K52A 1SRUA 4HJ9A 2VQFL 1QVGA 1PH5A 5E7NA 4LFAL 4JV5Q 4A3MH 1VQLA 3ER0A 2JEAI 5FJ8G 1EYGA 1EIFA 4A3FG 3H0GG 1SLJA 4R1JA 1EIYB 3F2BA 2R92G 1WYDA 3PUZA 1PVOA 2LXJA 1IYJB 3PF5A 5GQOA 1V1QA 2CFMA 4GKJL 1TWAH 1HH2P 4POGA 2N8NA 2CQOA 3RLOA 2ID0A 5EAYA 4C3IH 4QL5A 4PZ6A 3G4SA 4DR4Q 1WOCA 2Y0SE 2ES2A 1A0IA 1NJIC 4YCUA 2XGTA 5IWAQ 2NVTH 4DR3Q 1EQQA 1HZBA 2UUCL 3F1ZA 3FP9A 1N36L 5FLMH 3GD7A 3UDXA 2K5HA 4XIGS 2OQKA 5BR8L 1R9TH 1ASZA 1I6HH 2RHQB 3CCLA 3G71A 3HOZG 3AFQA 4A3IG 5ELOA 1YHBA 2JA6H 1P8LA 4DUYL 1I50H 4HJ7A 4LUVA 4LWCA 1CKMA 1PH9A 3KOJA 1T9HA 1EUJA 1NMFA 4LUZA 4DR5L 3FKIG 4AH6A 4IO9A 3STBC 1PH7A 1FJGQ 2A19A 4YWMA 1VQPA 1K83H 1XNRQ 4GKKL 3NENA 3PIPA 4K0KQ 3RZDH 1C9OA 4P73A 4A3LH 5AJ3Q 4LF9L 1NY4A 1BBUA 4L5SA 4DV3Q 3PUYA 4BY7H 5IP7G 3J80i 1KIXA 1RIPA 3A5ZB 2BA1A 2JQOA 2PQAB 4C3JH 5GAGC 4Y7NH 3J81j 3I55A 3K7AH 4DV1Q 1S40A 2UUBL 1XPUA 1Q1EA 1K3RA 2D0OA 3M4OH 1OXSC 4GNXB 4JOIC 1Q8KA 5FJ8H 4JI6L 3PF4A 1IBKQ 1DGSA 2JJQA 2UUBQ 4WJ3M 5M3MH 4YHHQ 3T1HQ 4OO1I 2BA0A 2ZM6L 3EIVA 3CW2C 4GN3B 2K5NA 1LTLA 1Q1BA 2WFWA 1NMGA 3BU2A 4LF5Q 4QGUA 5IP9G 1I5FA 1VQFA 4H02A 2HIXA 3GTQH 4OO1G 1VQBA 2ATWA 2UU9L 1SROA 3KFUA 2YV5A 3B6YA 2MNAA 2CWAA 1HR0Q 4A93H 4B3SQ 3J81c 1VQMA 4LF8L 4A93G 3PO3G 3E0EA 4RG1A 4BA2I 1JE5A 1KRSA 1E7ZA 1X9NA 2AWOA 3MEFA 5M3FG 4HJ8A 2R7DA 2JA9A 1VQKA 4GN4B 2AKWB 1PV4A 4JI2Q 5J3BA 5LMNW 4LF7Q 5BR8Q 1JJ2A 1Q86C 2UXBL 1WCMG 1JB7A 1AH9A 3KDFB 1NTGA 3K81C 1GD7A 1XPOA 5IP9H 3L2PA 5HY6A 4X62Q 2I0QA 4IFDJ 4LF4L 3TS2A 4DR4L 2KBNA 1YITA 1S72A 4HJ5A 4LFBL 2MO0A 3PV0A 4DV2L 1HNXQ 3RLNA 4HIMA 1FGUA 3CF5A 3JAMc 1CKNB 3F2CA 2XTIA 4GKKQ 3M4PA 5C44G 3T1YQ 3GDEA 3K8AA 3STBD 4DV0L 4NXNQ 1L2FA 2VUMG 3UDGA 1OTCA 4X66L 4A3KH 1YJWA 2PMZE 1KD1C 3UDIA 4OWTB 4AYBG 4BXXG 1KXLA 4LFCL 1VQAA 4DV4Q 2JA8H 3HKZE 4DV2Q 1A8VA 1OXVA 4DV0Q 3PGZA 3W1BA 4R4QA 4GNXC 3UE1A 1IBMQ 2E5LL 4LF4Q 1Y1VH 2A8VA 3PUVA 1K8GA 1YBYA 4AQYL 1HR0W 2AHOB 4MNOA 4R4CA 4JG2A 2AWNA 1PA6A 2K5VA 1VQNA 1TWGH 4DR7L 4DV7L 3F8TA 5C4XH 3TS0A 4A3JH 3U58A 1YIJA 2F3IA 2HQLA 3U50C 4DK6C 2QA4A 1XNQL 2R7ZH 3W5OA 1N8RC 4JI7Q 1D7QA 4IPGA 4IJHA 1LYLA 2Z6KC 5LMNQ 2I5LX 2YTXA 4LF7L 2VL6A 4J15A 2V1CC 1YHQA 2R7FA 5FLMG 3S1RH 4B3SL 4JBJA 4JI4Q 4R4IA 4KHPQ 1VQDA 2GVAA 5IYCG 3H15A 4UP9A 2PI2E 4LF9Q 2HIVA 2CCZA 2YU9H 4JBKA 2Y0SG 4IJLA 4K0KL 2NVYH 1HNWL 2KCTA 3A5UA 3I7FA 4KI0A 3ERSX 2Q2TA 4IPCA 1QVFA 2NN6I 2UUAL 2HT1A 3TQYA 5GAHC 5M5XH 3A0JA 5ELNA 1HNZQ 2NZHA 4JCVE 4JI0L 3PSIA 2MFIA 1O7IA
chains in the Genus database with same CATH superfamily
4C3IG 5I2YA 4UAIA 1HZAA 2IPKD 4G7OC 1IBKL 2RKSA 1EIGA 5AJ3L 2N55A 4B3TL 2E5LQ 1B50A 3BDLA 3I4NH 2VQEL 1L1OB 4ZUIA 1OXUA 1Y1VG 4CKCA 1U4MA 2EJMA 5CV6A 4HCEA 3OIQA 3PO2B 1OXXK 1BF4A 1SDFA 2JSOA 1E1TA 1TS3A 1MGSA 1BCPC 1E24A 4IOCA 2FJ2A 3UI2A 5C4HA 1PDQA 1I3QH 4ZQ3A 1QUQA 3J80L 1KC8C 4KD3A 3V05A 5IT9L 4FXDA 3RNUA 1Y8OB 5C0XI 4CJ1B 1HNWQ 4BWGB 4M1UB 5ISRA 1M90C 1FR3A 4JV5L 2EOTA 4ZKCB 1CA6A 3TSSA 3CP0A 3CU7A 4LNQA 3S15H 1W2BA 3JAME 1DM0B 4K8JA 5J39A 1CQFA 1UAPA 2BE5D 4KJNA 2IHFA 2PW5A 3E0JA 1U5KA 1QNKA 4A3DG 5D14A 5DAUA 2O5JC 4DUZQ 2SOBA 3FKIH 4OX9L 2F52A 3VYSA 1ESFA 1SR3A 3K5LA 3PMFA 4R8NA 1MSGA 1D5XC 3H6MA 5M3FB 1CUKA 3KK7A 3S14H 1U4RA 1EYCA 1CZGA 2CW0C 4HSPA 3OHXC 2ZTCA 4GLAC 4A3EB 1WCMB 1I50B 1PXUA 2QILA 1IKMA 4BBSH 4JBWA 2ZTEA 3BVMA 4LK1C 3KUPA 1MKHA 3BS1A 1YHAA 1A2UA 2SDFA 3FHWA 5A35A 2L15A 3PIOA 1A15A 1Y14B 3S16B 4DR3L 4AQYQ 2B63H 4CJ2C 1WFQA 5EQ0A 2RF4A 3HKZG 1GUSA 4RHSA 4EQ5A 3TRZA 1WJJA 2DY8A 2KENA 3I4MH 2F0FA 5IYCH 1VCIA 2KHJA 1ET6A 1L0YB 3JC66 1FNUA 3TEHB 2EXDA 4KN4C 2BCOA 4A3MB 4KHPL 4Q0FA 3CQZB 2F0SA 4QIWB 5LL6S 5LMUL 5JVH3 3MC0B 1VQ5A 4NXMQ 1K0SA 5IYBH 3P20A 4V190 3K7UC 2JA5B 3QJYA 3I90A 5CV7A 3EBEA 5HGTA 1IBLL 3PUXA 1S5FD 1WCMH 4HMJA 2IX3A 2MP1A 4A3FH 4GKJQ 1PHJA 2L4NA 3BJUA 5JJLA 5C4JB 1N32Q 1HR0L 4U68A 2B2TC 4DAMA 2IJ0A 1JQYD 3BZKA 1TWCH 1SNCA 4B3MQ 2JA5G 2QGQA 1AN8A 1FNVA 5KNDA 4G57A 2JN4A 5CV8A 4B08A 2E2IH 2EVBA 1RF2D 1PFBA 4YIJA 2IX1A 3TP6A 4DV5Q 1K3BC 1J8IA 1XWEA 2D0PA 1EQRA 1D2BA 1RL2A 3IL8A 3MXNA 4KY7A 4BY1H 3R2TA 2UUAQ 3BVZA 1IW7D 3MXUA 4RKLA 3VR5A 1EY8A 2QKIC 4OEMB 2GN5A 4X66Q 2EIFA 1QZGA 1PTOB 1RODA 4A3EG 1PH1A 1N34L 1HZCA 1K28A 4MHEA 4DKAC 4DUYQ 3KBXA 4DUZL 2VUMH 3HOVH 3AYHB 3G48A 1X65A 2EY6A 2KHSA 4TRDA 4C3HH 5H1SE 2XSCA 3LGJA 4R8IA 3NWTA 1I94L 4DXGA 4S3SA 2F0LA 5FLXL 1MJEA 1UEAB 1DCZA 2NVXB 3S17B 2WKCA 5D3IB 5JEAH 2K50A 1ILPA 3T4AC 3HFZB 1B3AA 2VZAA 3CCEA 4DR2L 2F0JA 2K04A 5KNCA 3FMCA 3TREA 3F2DA 3S16H 2WKDA 1VQ6A 5EKIA 2I07B 4GZYC 2ZJQA 1HA6A 2Z8LA 3EFXD 1G51A 4K2LA 1PRTD 5IWAL 2Q2IA 3QG1A 3F2UA 1XXGA 2YTYA 2F3VA 2HHHL 2NBFA 4FNFA 3M85A 4DV3L 3M9BA 2F0QA 3H09A 3WDNA 1HNZL 5JAVA 2HCCA 4DR1L 1S5ED 4RA8A 1N34Q 1UE1A 3C1FA 1PMRA 1JT8A 2I46A 1CT1D 1WTWA 3NTHA 5IYDG 2Q2UA 3QWNA 3HOZB 4A3GH 2NUCA 3AMUA 1RHPA 4JYAQ 5CR3A 4DV6Q 2F03A 2WIIB 2UXDQ 3NQIA 1XMQQ 4EQNA 4YHHL 5M3MB 3HOXB 1TR5A 3C1EA 4DFAA 3ICEA 4HIDA 1ESRA 1LTTD 1WI5A 3NWSA 3OTOQ 1AZPA 2OCEA 3D4DA 1EL0A 1XMQL 3MHBA 4AYBE 1JR0D 2AMCB 1HPCA 4P71A 1BDOA 2KCNA 1YI2A 1SRUA 4HJ9A 2VQFL 4LFAL 5FJ8G 1SLJA 2L0CA 2DN8A 4R1JA 3F2BA 4OL7A 4I7ZC 1GUGA 1STBA 2RDGA 1KNEA 4PZ6A 2HDMA 3MXGA 4DR4Q 1WOCA 2ES2A 1PRTF 2XGTA 5IWAQ 1I4RA 1HZBA 1B3QA 1N36L 3UDXA 2K5HA 4XIGS 1ASZA 3G7LA 3CCLA 3G71A 4A3IG 1CQVA 3R93A 1KDCA 4TSSA 1II3A 1P8LA 4DUYL 1EIHA 1CKMA 3HEJA 2QW7A 3A7AB 3MA2B 1NMFA 5DNFA 4AH6A 1LT4D 1FJGQ 1G6ZA 1H9SB 1VQPA 3K5OA 3S1NB 4ZCKA 1GUWA 1C9OA 4P73A 5AJ3Q 4LF9L 1NY4A 4L5SA 2EE1A 5IP7G 4OIJA 3J80i 2F1MA 2PQAB 3ERQA 4HR7B 4DV1Q 2ZXOA 3TDQA 2R61A 2XRSD 4JOIC 2PZUA 4JI6L 1DOMA 1IBKQ 1R4QB 3VR4A 3GV6A 4KY6A 2D9UA 1Z7TA 3CW2C 1Q1BA 1NMGA 3BU2A 1I4PA 3I73A 4KTAA 1I5FA 1SMYC 1VQFA 2HIXA 4H02A 3GTQH 5I9PA 4OO1G 4KJOA 4A93H 4B3SQ 3WOFA 2OF1A 3DWQA 1X9NA 1FGBD 4HJ8A 2ZT9C 1VQKA 5TSSA 1IHZA 4L63B 1PV4A 1F2YA 1SJED 2F0NA 1JJ2A 1LTSD 3KDFB 4DA2A 1NTGA 3FDTA 3L2PA 1KLGD 2I0QA 4H13C 4DR4L 5IGEA 3TBIB 4HJ5A 3M4YA 2JXMB 1WTRA 3CF5A 1B9NA 1CKNB 4IUTA 2MUYA 3I70A 5C44G 1SYBA 4DV0L 1L2FA 1NNXA 1YJWA 4P2CB 2HCIA 1T5EA 4AYBG 4DV2Q 3PGZA 3GTGB 1TWHB 4GNXC 2E5LL 3C3LA 4PMCA 2A8VA 1CHPD 2EJGC 1HR0W 3M3YB 4MNOA 4R4CA 2F0KA 3WOEA 4DR7L 4FXGC 2D2CC 1XNQL 2R7ZH 4JI7Q 1D7QA 1Y1WB 2Z6KC 3V96A 4LF7L 4J15A 2VUMB 4B3SL 4KHPQ 2GVAA 5IYCG 2XVSA 4RAUC 1RCVD 2HIVA 3LX0A 4JBKA 2Y0SG 4DK0A 2K28A 4BBRB 2NVYH 3GTLB 1WTQA 5L37A 1H9KA 2K6AA 2NN6I 3TQYA 5IT9E 1D1KA 3A0JA 2CH4W 3OIPA 1PFMA 4JI7L 2R93G 2A5HA 4K6LA 4GOPB 2OT2A 3UDFA 4GLVB 1HQMC 4O0AA 2XIWA 2B8GA 1Y1VB 2ENBA 4PMWA 4CBVA 4DAYB 2R3ZA 3L0OA 5C0XG 1JMCA 3GQBA 1L0XB 2E8GA 1BOSA 3SK6A 4Q5VA 2KQ3A 1Q3LA 3D4WA 2DNEA 1TY2A 4WRDA 3GV3A 3MXNB 4PG3A 3OPOA 1GOZA 4IUPA 1W6KA 4C3JG 4N9PA 3RZOH 1LTBD 2NZ1D 2PPBC 4HEDA 1L0WA 4ULLA 1KNAA 3CC4A 4TQUS 4JI3Q 2PNRC 4ALPA 1VQEA 1HXYD 3AU7A 2B2VC 4PQXA 4P72A 2K5QA 3KJPA 1A3TA 3CQZH 2MQHA 2JA7H 4EVOA 3Q22A 3DM1A 4ODGA 4XQQA 3ZJYC 1QJOA 2F0UA 2JE6I 2IHEA 1GKHA 2WB1G 3IAYA 4H0LC 4YWKA 5KIXA 1JICA 4CDDC 4UPAA 5CV5A 1Y1WG 2JK8A 1V1PA 4OGQC 2B2YA 1IYVA 3HOUB 4X62L 1Z9FA 1ZKOA 3CPFA 4KMUC 4IFDI 4B3RQ 4BBSB 2UXBQ 1PZID 3L7ZC 1VQ7A 1PH8A 3HOVB 1GUNA 3PO2G 4FO2A 1IXRA 3D0FA 2PNHA 1Y69U 3S2DH 1SNQA 3CMAA 1ICWA 4C2MB 4LF8Q 5I2XA 3DEOA 2CQAA 2ZXPA 1FJGL 1TWFH 1D8LA 1BCPF 3Q23A 1E1OA 2UXCL 5FLXE 1KTKA 2NN6G 2NVXH 4LF5L 1YNXA 2E76C 1VQOA 4LF6L 2OQ0A 5DM63 4LFBQ 1TY0A 4JI3L 4RMFA 1EFID 1STAA 2HDLA 3N52A 5DEHA 1S5DD 1KHIA 4C3HB 1L1OC 5EPLA 3CC7A 2IT1A 3DHQA 4XT3B 1OXTA 4B3ML 1E3PA 4A3KG 5JPMC 3PUWA 4L5QA 1QOHA 1Q12A 3H3VI 3FEWX 2H1EA 1GO3E 3A7LA 5EJWA 4P75A 1SNPA 1PYBA 1V9PA 1AFPA 5G3LF 1IBLQ 2R92H 2YYZA 4JI5Q 5C0XJ 1VF7A 3J7A5 1V43A 3N6RA 2J0TD 4DR6L 3M7NA 2JA5H 1K8MA 1PLFA 1CSQA 3OYYA 3CCMA 2QDBA 5LMUQ 3HOXH 3M3YH 2EYMA 1EFWA 4L5RC 5IT9c 1WTXA 4JC0A 5DLQE 1SAPA 1O7LA 1JCKB 1SYDA 1DOKA 2B2YC 2NYZD 4LF6Q 1GHKA 1F9RA 1LTGD 1F9QA 4GS3A 4JK1C 4JW0A 4C56C 1LUZA 1Q46A 4YY3L 1NUCA 1NBWA 2RSNA 2N3SA 1X3GA 2FMCA 3NUCA 3M4QA 3CCJA 4K8IA 5IP7H 4PZ7A 2OWOA 1XX8A 2EYJA 4WFN3 2EYOA 2C35B 1TKWB 3OTOL 1GXDC 2K14A 2B2VA 2H5XA 1XMOL 4J8QA 5C0XH 3E9HA 1S3OA 1X3FA 5GROA 1VQHA 4RHRA 4JYAL 2N49A 4DR2Q 1TWAB 2DUDA 2DY7A 2QEXA 1A63A 3E9IA 2H4OA 3BZCA 3EA6A 2F0TA 3U9SA 4A93B 1LT6D 1D6EC 1LM0A 1TS4A 4HIOA 3AQQA 1VQIA 1PH2A 1UNSA 3K58A 4GLXA 1MD2D 1IZ6A 1WTHA 3M7GA 2B63B 4DV7Q 4YWLA 4DXFA 3RN2A 1IL2A 4Y52H 5CGKA 3S2HB 3SGIA 3J80c 5JJIA 3Q0AA 3RZOB 1V1OA 3K6OA 1K8AC 2KHIA 3R2IA 4RH6A 5ELEA 4B9WA 4IQZA 4CKBA 2JA8B 4Z9CB 3KLSX 5E4WC 3CCVA 3I2ZA 2VXWA 4ZKBB 4PZ8A 5M3FH 1CHQD 1HTLD 2CW0D 4K5VA 1VQ4A 4JI1Q 4X64Q 1VQCA 2WV6D 3Q6SA 3VYUA 3MWYW 3OMGA 2XWJB 3KLWA 2PW7A 2Q8RE 1NE3A 3GTPB 1HRJA 2RDFA 2AQ3B 4OXPA 1U4PA 3AFPA 3VYTA 4JI6Q 2Z6KA 4U673 3IFDA 2MGSA 3SDZA 1SMXA 4TVAB 3CKIB 3BVGA 2J4XA 3VDYA 1I4XA 3P1HA 5FO8B 4X64L 1BVSA 2AUKA 4GNXA 2F4VL 3CPWA 4DGZA 4IFDG 4A3FB 5M5WB 4OX9Q 1B70B 5M3MG 1L1OA 1TQOA 4B9XA 3T1HL 1ZEQX 2KJXA 1YEZA 5C4XG 3RLFA 1I3QB 5IYBG 1BUVT 3J7ZC 2ZXRA 3CC2A 3HOWG 4XTCS 2FINB 2RQXA 3S1QB 3PO3H 3CRLC 4F88A 4RGMA 1ILQA 3ULJA 1YJNA 1NAPA 2EY5A 1TWHH 2R6GA 4O2DA 4FF3A 1PH5A 5E7NA 4A3MH 4ILWA 1EYGA 2JYOA 2K5DA 2R92G 1NSNS 1PZJD 1CZWA 1PVOA 2A68D 3PF5A 2CFMA 5KNBA 5EKLA 3MEHA 3DWPA 2N8NA 1KLUD 3RLOA 4RGOS 2ID0A 4C3IH 2RA4A 3G4SA 3PIP3 2Y0SE 2X69A 1PZKD 1PFNA 2UUCL 4A3JB 4IN3A 3KF8A 5FLMH 4QB4A 2L5TA 1R9TH 5ELDA 4XQJA 1TIID 4HAEA 4MIUA 1BXTA 1YHBA 2C9OA 1F77A 3KOJA 4F7XA 4RGTA 5FK9C 4IO9A 3STBC 1EY9A 2A19A 4YWMA 2QDLA 4V0BA 1XNRQ 2F3WA 1SXTA 1C4QA 3PIPA 4K0KQ 2EY1A 4JPBW 3I8ZA 4QUCA 3NHHA 1SE3A 4XDXA 1TS2A 3X3MA 4G7HC 3SEBA 4Y7NH 2JQOA 4C3JH 3I55A 2UUBL 3S1QH 3J81j 1S40A 3M4OH 5J22A 3O13A 2QF7A 1TWGB 4ME5A 5IOCA 5FJ8H 1QILA 3BG3A 2UUBQ 4WJ3M 1NR2A 3T1HQ 1CI3M 3K7AB 3EIVA 4GN3B 4KN7C 5C5MA 3JAML 2OEOA 2EZVA 4QUFA 3KFUA 2YV5A 4J1MA 3SK4A 3NTKA 1VQMA 4A93G 1VMPA 3E0EA 4RG1A 4BA2I 1JE5A 4RFBA 2F0GA 1ET9A 2R7DA 3IFTA 4GN4B 4HMIA 2AKWB 5LMNW 4DNRB 4LF7Q 2KEEA 1Q86C 2UXBL 1AH9A 4MN3A 3K81C 3QB3A 1XPOA 5IP9H 4IFDJ 4LF4L 2KBNA 1YITA 3C46A 1AP0A 4DV2L 4KKTA 1I6HB 3F2CA 2XTIA 4GKKQ 4DU9A 3K8AA 3STBD 1U9RA 4X3UA 3V2TA 4KHVA 4A3KH 2PMZE 3UDIA 2F0WA 1KXLA 2JA8H 1A8VA 4DV0Q 3W1BA 1IBMQ 4LF4Q 4K6DA 4KKUA 1K8GA 4AQYL 2AHOB 2K5VA 4DV7L 3TS0A 4A3JH 1YIJA 2HQLA 4DAVA 2RBMA 2QA4A 1LACA 3W5OA 5LMNQ 1GUTA 1EY5A 1ZYRC 2L12A 1YHQA 5FLMG 3RZDB 1VQDA 1Q8IA 4ZRZA 2DJGC 2CCZA 2VB3X 5FKAC 1STGA 2MPMA 3I72A 5COYA 5D3DA 3A5UA 3I7FA 2A6HC 1H9RA 2WB1B 2G9DA 2K32A 1JWMD 1RD9D 3PSIA 2MFIA 1YNNC 1VQ8A 2CHBD 3CCRA 2Q8TA 1E22A 3J81E 1STYA 1K8OA 3MFYA 5I6WA 1X55A 3NK9A 2SNMA 2LFNA 4FDBA 4PMBA 2RDHA 1CK1A 1H9SA 1UEBA 1LTAD 1CKOA 5C5LA 1XTCD 2VW9A 2I5HA 1FYCA 2A6EC 1IBML 1SNDA 2E2HH 3GTOH 5M5WH 3KDFA 4ME3A 3S1NH 3EROA 1N32L 2PI2A 2ASBA 3H3VC 5BN4A 4A3DB 4DK1A 5C3EB 4JBMA 5F2DA 5KRUA 2GVBA 1B9MA 2LSSA 4QIWE 5JEAG 2BOSA 1UE5A 1F2MA 5ELCA 4CDCC 2KECA 4QJFA 3RMHA 4OHJA 3PIO3 1C8CA 1EWIA 1N9WA 1SNMA 1UE7A 3HG9A 4BY1G 1S5CD 2AQ1B 2UXCQ 3J81i 4OO1H 2SEBD 3DLLA 1FD7D 4IUUA 5FO9B 2NVYB 2VB2X 2NVQH 2BDOA 3R3OA 1M1KC 4RCOA 2UU9Q 5CC4A 2B2TA 5KGUA 5KYIA 2OTJA 5IODA 3S1RB 2TSSA 2Z0SA 1Y1WH 4K5WA 1HA5A 1KABA 4CHTB 1A62A 3L9AX 3NBHA 5CV9A 2JA8G 4ZYSA 1EWHA 1PFSA 4A3IB 5KYLA 1X6OA 2VS1A 2E2IB 1MIUA 4L6TB 3BYTB 5JEAJ 3KLSA 2KCMA 1PTOF 1Q81C 4DV6L 3NPPA 2UXDL 4X3TA 2K4KA 2D5DA 5C3EH 4CGYB 1RKNA 1EEID 3A8KE 2AQ2B 1GHJA 5A2QE 3A54A 3GTOB 2E2HB 4DR5Q 4CDFC 5C3XA 5LMNL 4LJZC 1GJXA 4CJ0B 2ZM6Q 2G5DA 3NEMA 2F0EA 5M5YH 1N36Q 1YJ9A 3HRZC 2PZWA 3CCQA 4QQBX 1SYFA 4OELB 3I4OA 3ONAB 2A1AA 5IGGA 3KF6A 1NCVA 1KAWA 4DV4L 1EQTA 1SN8A 3D8GA 2EYPA 4CKEA 4LFCQ 4RWSC 4A75A 4QY7A 2YU9B 1G2TA 2F0VA 4POFA 2JP1A 2BH8A 3S24A 1A3VA 2AUJD 3VYRA 1VMCA 2K01A 2VNUD 2OTLA 2PCFB 1MBYA 3T13A 3TP8A 4NKLA 1WD0A 3PO3B 1VQ9A 1KL9A 2LXKA 1YNJD 1X3PA 4A3LG 4FF1A 3W2DA 4YCWA 5M5YB 1EEFD 2A73B 1XMOQ 2IY5B 4WJWA 1SYCA 4JI0Q 4BXXH 1N33Q 3QR8A 1I4QA 1EY4A 3VR3A 1SYGA 3H94A 2KVMA 1JJGA 2K5WA 5IGFA 1NR4A 2XWBB 4AYBB 1O80A 1P16A 3SXHA 3I4NG 3S14B 1K83B 1XNRL 2KUMA 3JAMi 1I4GA 3EQLC 5JJKA 1H9JA 3J7AV 1Q82C 1XPRA 1MSHA 1U0LA 1G2SA 2A6HD 4EX5A 4XQNA 3HOWH 1N33L 1ENFA 4X65Q 1CM9A 1HJPA 3HGBA 4BS9A 4A3MG 4FVMA 1ZYRD 3HOWB 4DV1L 3GTPH 1VF5C 4RKBA 3T53B 3K0XA 5IGCA 1C7YA 2O2LD 4A3CH 4KKSA 1YVCA 1B53A 2JEBI 4KY5A 4NMZA 3NELA 4AIMA 1PYWD 1PYSB 1SE2A 2NVQB 2D62A 1M8AA 3H0GB 3NTIA 1X54A 2JA7G 4NB3A 4YY3Q 1EZ6A 5CBAE 4IURA 2M00A 4DR1Q 5C3EG 5KEEA 2ZTDA 2XRQD 4P74A 4DK3C 5K5PA 1RDPD 4IFDH 4KLKA 1O7ZA 2BH2A 1MJCA 1AEXA 1B7YB 4K2KA 3GO5A 3VA5A 4GN5A 4RCNA 3CMEA 2DNCA 3PO2H 1B8AA 1A2TA 3C2PA 2A68C 3NSWA 3HOVG 1RTNA 5C4ZA 2F4VQ 4UY8C 1SJHD 4O42A 1JJCB 2VQEQ 3A74A 4LFAQ 4BY7G 2B2UC 5LL6X 4A3BH 3I4MB 2FMMA 5C44B 3HP3A 2WB1E 3OW2A 3U4VA 1BCPD 1CKNA 1EWCA 3HS0C 1R9TB 3PCOB 1QZHA 3HOYG 1DD2A 4A3CG 1D5MC 5A2QL 3KYHC 5CYUA 2HD3A 2K75A 4M8AA 2NVTB 1WTPA 4DV5L 1ENCA 3KJOA 4IPHA 5HGQA 4JI8L 4LW1A 3I4MG 2DGYA 3CXCA 4EQOA 4KK7A 1VQJA 3T16A 1E2ZA 5IE8A 3S1MB 4R4OA 4EQPA 2IWHA 3GTQB 4N9TA 1B4OA 1EU3A 3SHLA 1DYQA 1SYEA 3S17H 1QE6A 3DM3A 3X3NA 1SFOB 1KQSA 1LT3D 2E75C 1EYDA 2CVRA 4F8MA 2B2WC 2B63G 4NXML 2MHVA 3QOJA 2I5MX 4G4KA 1QVGA 1WD1A 2R92B 2R93B 1VQLA 1EIFA 4FYDA 3H0GG 5CV4A 1EIYB 2MJ8A 3I4LA 1IYJB 5GQOA 1V1QA 4GKJL 1MHWC 1HH2P 2CQOA 3LNNA 4MTKA 5EAYA 4QL5A 1SE4A 2E2JB 1NJIC 4YCUA 4DR3Q 3P75A 3TZDA 3FP9A 1JE4A 1HTPA 2XNAC 5EPJA 3AFQA 3HOZG 2PMZB 1C48A 2B2WA 1BO0A 2L9HA 3OSOA 1WVLA 2JA6H 4HJ7A 3FRPB 4LWCA 5JJZA 1T9HA 1EUJA 4LUZA 3NXWA 4F87A 2F0IA 3FKIG 1PH7A 1K83H 2B8FA 2FHTA 3NENA 3J81L 1AZQA 5LHY1 3MAQA 1IL8A 1QWYA 3PUYA 4BY7H 1O7YA 2F0HA 4RGNA 1B2TA 1XPUA 3K7AH 1Q1EA 4ABNA 1OXSC 4NW2A 1Q8KA 2PO4A 3PF4A 1HCZA 5M3MH 4YHHQ 4OO1I 1D1IA 4XXEA 1HFNA 3D4RA 1BR9A 1CFMA 2EPBA 2K5NA 1LTLA 2WFWA 4H7BA 2K7VA 3T51B 2F0OA 4LMQD 4QGUA 1M4VA 1VQBA 2L55A 4R9WA 3NBIA 3A8JE 3B6YA 2CWAA 1HR0Q 3J81c 1DJRD 3PO3G 5T1IA 3NE5B 1KRSA 2B2UA 5JOBA 2AWOA 3MEFA 4WORA 2JA9A 3ND9A 5EBDA 5M9OA 2ICEC 4HCSA 5J3BA 3SE0A 1STEA 2J7ZA 1JB7A 4HN7A 1DONA 2KCCA 1ML0D 1HFGA 4X62Q 5ELBA 2X6LA 4LFBL 2MO0A 1IW7C 3RLNA 4HIMA 1FGUA 4C3IB 3JAMc 3P7JA 5JPNC 2K1BA 1XYIA 3MXPA 4NXNQ 2VUMG 4X66L 3RUZA 2F0DA 1G8ZD 1SNOA 4BXXG 5JVG3 3A8IE 4JVZA 4XT1B 1OXVA 4R4QA 2NB0A 1Y1VH 3PUVA 2A69D 1YBYA 3OWFA 3BDCA 2AWNA 3DMUA 3U58A 4DK6C 4I7AA 4IPGA 4OIKA 2I5LX 1PTOD 1VDZA 2A6ED 2V1CC 2VL6A 2R7FA 3CHBD 3S1RH 4JI4Q 3H15A 2HQEA 2FFKB 4K0KL 4FF4A 3GTMB 2Z4HA 2KCTA 4KI0A 3ERSX 4IPCA 5IGDA 2UUAL 5GAHC 5M5XH 1W6JA 2Z4IA 5ELNA 2QEJC 1HNZQ 2NZHA 4JI0L 4IPDA 3U9OA 4B3RL 1PRTC 4DR6Q 1XTDA 1KAAA 4DNTB 3OMCA 5J1ZA 4X3KA 1K0RA 2L1BA 3M4OB 5IYDH 1K73C 2VY3A 1EYAA 4Y7NB 1X3EA 5C6AA 4X3SA 1EY0A 4FP5D 4IZ8A 4JI1L 1PH4A 1QCBD 2HUGA 1O78A 4A3DH 3S1MH 2K03A 4GOPC 5C4JH 2Y0SB 1J5EL 2R93H 2KEDA 1F9SA 2BDNA 1F2LA 2NZOA 3VR6A 2ZJRA 3EVQA 2VQFQ 2CWPA 2IL8A 1EZ8A 1HNXL 1BCPB 3Q8DA 2NTTA 4QF4A 4HIKA 3HOUH 1MI2A 5AFWA 3HOUG 2RHSB 3DWAA 4FF2A 3CD6A 1SBBB 4QMGA 4XYOA 4JI2L 4BBSG 2G9HD 2KA7A 4ZUJA 1J5EQ 3HOYH 2LKVA 5EKKA 2K33A 1WTOA 4DAPA 4OWWB 1DXMA 1DZ1A 4DPGA 1YZ6A 3G6EA 1STHA 2WAQB 1EU4A 5EGTA 5DM73 5CBEE 4E6IA 3GTKH 1LTRD 3KBGA 4L8JA 3ULLA 4X65L 1Z47A 3L3OC 3GTJH 1JOKA 3ULPA 2NN6H 3VA7A 1PH3A 5ELFA 1VS0A 1ICFB 1YNND 1EQVA 1EY7A 1LT5D 3RR5A 5BN5A 5C44H 1JORA 2F0MA 3DXJC 4MTNA 4APVA 4A3KB 4HTHA 3MVVA 5E3FA 4UP8A 1HUNA 4A3BG 3T1YL 4A76A 1JWUD 1TXYA 2ALYB 3URYA 4B3TQ 4WJ4A 2JA6B 4JOIA 2NTSA 3W1GA 1G91A 3D31A 4OONA 1RTOA 1HZ9A 4DR7Q 1X56A 2A69C 4ID6A 2UUCQ 1FL0A 3MFGA 2E2JH 5GADC 3BDOA 3E5SA 3GP7A 2X6GA 1TWCB 1FVIA 2NWGA 3H0GH 4QCLA 5HURA 5FOBB 1JB3A 1JC7A 2EDGA 4IUVA 3CCSA 1AE3A 1KRTA 1GVPA 1ENAA 5EBCA 1R4PB 5K36G 1J9OA 4BA1I 3QO2A 1BBXC 2FXQA 2B3GA 1XNQQ 1B1ZA 5T1GA 1Q7YC 3CCUA 2MO1A 1S5BD 2EQSA 4IOAA 1AW7A 4X6AH 4IUNA 3S2HH 2RCFA 2N88A 1QNUA 2YTVA 3FVQA 4C3JB 4BBRG 2B29A 3GTGH 3U4ZA 1BBWA 1XJVA 1ZXTA 3HOZH 4ZAIA 4A3GB 1G291 3NBHB 1ASYA 3SVMA 4XYQA 2WACA 1E2VA 3SR1A 4C2MH 3J80E 2O5IC 1JOQA 3K0YA 4K14A 2LY7A 4NXNL 1UWVA 1AE2A 4JI8Q 3CAMA 3K80C 2PYKA 3I56A 2GA4B 2ICIA 4N8X1 3UE0A 2ZJPA 2N78A 3K5NA 1SSOA 5IY0A 3IKJA 4C1NK 2C5CA 1I6VC 1BQQT 4HJAA 2KOLA 4UHVA 1DOLA 2F4IA 3AB9A 4N8FA 3HZXA 1J6QA 5K36H 1CSPA 4KV6A 3E6ZX 3HKSA 1CA5A 3RN5A 4JI5L 1WTVA 2EYLA 3H91A 1UE6A 1QUQB 3FPUB 4L5TA 3DEPA 2JA7B 3T56B 1A3UA 1SEBD 1GM5A 3AEVA 4GOPA 3BYYB 2Z6BA 2M2LA 1STNA 1FNWA 4DAYA 4HSVA 2IW3A 2JA6G 2WAQE 4NP5A 4A3IH 5IIFA 3H3VH 1EOVA 3IRBA 3WWVA 2M9VA 4A4IA 1GUOA 3DUZA 4LUOA 5IGBA 4A3EH 1B44D 4YCVA 4NPSA 2A74C 1RJTA 1W3SA 3I3CA 1SMYD 1PTOH 3KF8B 4OWXB 4KHZA 4UP7A 3A55A 3K5MA 2WAQG 3D6CA 4LAAA 1VQGA 3I91A 2HHHQ 4A3GG 3LWEA 2Q2HA 3KF6B 3TMEA 1X32A 3J7AF 4PNYA 1G6PA 1H95A 2EXZA 1I94Q 1BKBA 1A6XA 2CKZB 4R4TA 2TMPA 1PRTB 1F2ZA 4PV1C 1TVXA 2Z1CA 5M5XB 5BN3A 4DNIA 3S15B 1K9MC 1PH6A 1SE8A 3FPPA 2EYHA 2RVLA 1TWFB 1Y8NB 2PQAA 4BBRH 3GTLH 3EN2A 1QVCA 2RCNA 3ZYYX 3OOCA 3GTMH 1Y8PB 1V1PB 4JI4L 5GAEC 4C3HG 3TP7A 5FO7B 2XN9C 3RD4A 2IX0A 5G3LD 4MZ9A 5FLXc 1YNJC 1KDAA 4A3JG 3LWUA 2R7ZG 2CH4A 3QIAA 3HOXG 3S9WA 2WP8J 3A56A 1SFOH 1E0BA 2K52A 2EYFA 4K5XA 3GTKB 4JV5Q 1H9MA 3ER0A 2JEAI 2WINB 4A3FG 1UUPA 3KLRA 2P5ZX 1WYDA 3PUZA 2V4DA 2LXJA 3D3RA 3W3AA 3HOYB 1TWAH 1KDBA 2OXPA 3I4NB 1JOOA 4POGA 1Z6HA 1EOTA 1F9PA 3QOLA 1QG7A 3MTSA 5E4XA 1A0IA 2NVTH 2LS01 1EQQA 3ND8A 3OW7A 3F1ZA 4FXKC 5C4XB 4CDEC 1HQRD 3GD7A 5BR8L 2OQKA 3PQIA 1I6HH 1EY6A 2RHQB 1E2WA 2QCPX 1ONLA 5ELOA 1PTOC 1I50H 2EJFC 4O1NA 3MZ5A 4LUVA 2DJFC 1PH9A 4G7ZC 4A3BB 4I65A 4DR5L 4ZK9B 1LO5D 3BZDB 4IUQA 4GKKL 2K05A 3K57A 4IALA 3OWEB 3RZDH 2PZTA 4A3LH 1Q90A 1BBUA 4DV3Q 3TP5A 1KIXA 1D5ZC 1RIPA 3A5ZB 2BA1A 2Z9HA 4UDUC 3FKIB 5GAGC 4J6HA 3Q24A 2D0OA 1K3RA 2BE5C 5I4DA 4GNXB 1S4ZA 1IKLA 3SK5A 3VR2A 1LLRD 1DGSA 2JJQA 2PQEA 2BA0A 3NP8A 2ZM6L 1OO9B 1U4LA 4BY7B 1TU2B 4LF5Q 4NDXA 5IP9G 2RSOA 3G6JB 2L11A 2ATWA 2UU9L 1SROA 1HUMA 2MNAA 1C0AA 5CMDA 4LF8L 3R8BA 1E7ZA 5M3FG 1LABA 3NQTA 3HKZB 4JI2Q 4BY1B 1V8QA 5BR8Q 2R7ZB 1WCMG 1LTID 4DF7A 3ITPA 2Q8IB 1GD7A 5HY6A 4DN4M 1X3QA 3TS2A 2LMCB 1S72A 5NUCA 1HNXQ 3PV0A 2SNSA 4H44C 3M4PA 3T1YQ 3GDEA 5CORA 3UDGA 1OTCA 2B39A 5I9OA 3TZUA 4TKOB 1KD1C 3S2DB 4OWTB 1I4HA 1TS5A 4LFCL 1VQAA 4EGVA 4DV4Q 5D65A 3HKZE 1T5XD 2E74C 3J7YW 3UE1A 3EJIA 1JWSD 4KD4A 4JG2A 1PA6A 3GTJB 1VQNA 1TWGH 3F8TA 3SK8A 5C4XH 2F3IA 1LV9A 3U50C 1TT2A 1CTMA 1N8RC 5E1FA 4IJHA 1LYLA 1BNZA 2YTXA 4JBJA 3TN2A 4R4IA 3CRKC 4UP9A 2PI2E 4LF9Q 2YU9H 3K59A 1IYUA 4ZLTF 4IJLA 1QB5D 1HHVA 1HNWL 1QVFA 2Q2TA 2E2DC 2F0PA 2O4XA 5C3WA 3D6WA 5I6YA 2EY2A 2HT1A 3E3XA 4JCVE 5EPKA 1O7IA 4C1NI
chains in the Genus database with same CATH topology
4JI7L 4IPDA 4B3RL 3CCRA 1E22A 2R93G 4DR6Q 1HZAA 1XTDA 1IBKL 4GOPB 1X55A 3UDFA 4FDBA 4GLVB 5IYDH 1K0RA 4PMWA 4O0AA 1UEBA 5AJ3L 1K73C 2VY3A 4DAYB 1CKOA 4B3TL 1X3EA 2E5LQ 2VW9A 2I5HA 3L0OA 5C0XG 1JMCA 3I4NH 1IBML 4JI1L 2VQEL 1PH4A 2E8GA 2E2HH 3GTOH 1L1OB 5M5WH 3KDFA 1OXUA 1Y1VG 4ME3A 4A3DH 3S1MH 3S1NH 1N32L 4GOPC 2PI2A 2ASBA 5C4JH 4JBMA 1J5EL 1VQ8A 2R93H 2GVBA 1OXXK 2LSSA 3MXNB 4QIWE 4PG3A 2NZOA 2ZJRA 5JEAG 1E1TA 2VQFQ 1UE5A 2CWPA 3RZOH 4QJFA 1E24A 1L0WA 4IOCA 3Q8DA 4HIKA 1HNXL 1EWIA 1N9WA 3CC4A 4TQUS 1I3QH 3HOUH 1QUQA 4JI3Q 3HOUG 1UE7A 4ALPA 2RHSB 1VQEA 4BY1G 1KC8C 3CD6A 2UXCQ 4P72A 3J81i 4JI2L 3KJPA 3CQZH 3RNUA 3DLLA 4BBSG 5C0XI 2MQHA 1J5EQ 3HOYH 2JA7H 1HNWQ 1M90C 3ZJYC 4OWWB 4JV5L 2NVQH 2JE6I 2IHEA 4DPGA 1GKHA 1YZ6A 3G6EA 1M1KC 2UU9Q 3CP0A 2WB1G 4LNQA 2OTJA 4YWKA 3S15H 3GTKH 1W2BA 4UPAA 1Y1WG 2Z0SA 2JK8A 1Y1WH 3ULLA 1A62A 2IHFA 4X65L 2JA8G 1Z47A 3GTJH 1PFSA 1U5KA 1Z9FA 4X62L 3CPFA 3ULPA 1PH3A 1X6OA 4A3DG 1VS0A 4IFDI 2VS1A 4B3RQ 4DUZQ 3FKIH 1MIUA 2UXBQ 5JEAJ 4OX9L 3L7ZC 2F52A 2KCMA 1PH8A 3RR5A 1VQ7A 5C44H 4DV6L 1Q81C 2UXDL 1SR3A 2K4KA 3PO2G 5C3EH 4MTNA 1IXRA 3D0FA 4APVA 2PNHA 3S2DH 3CMAA 1CUKA 4LF8Q 3S14H 4UP8A 4A3BG 2ZTCA 1FJGL 1TWFH 1D8LA 3T1YL 4DR5Q 4A76A 1E1OA 4GLAC 1TXYA 2UXCL 2ALYB 2NN6G 2NVXH 4LF5L 4B3TQ 1YNXA 5LMNL 4WJ4A 1VQOA 4LF6L 4JOIA 2OQ0A 4LFBQ 4JI3L 4JBWA 4BBSH 2ZTEA 3W1GA 2ZM6Q 3D31A 4RMFA 1MKHA 3NEMA 4OONA 1YHAA 1HZ9A 4DR7Q 5M5YH 1N36Q 1KHIA 1L1OC 1X56A 3FHWA 1YJ9A 2L15A 3PIOA 3CCQA 1Y14B 4QQBX 3CC7A 4DR3L 4AQYQ 2B63H 2IT1A 1WFQA 1FL0A 3I4OA 2UUCQ 2E2JH 1OXTA 2A1AA 2RF4A 3HKZG 4EQ5A 5GADC 1WJJA 4B3ML 3KF6A 3TRZA 1KAWA 1E3PA 2KENA 1SN8A 4DV4L 4A3KG 3PUWA 4LFCQ 3I4MH 4L5QA 5IYCH 1FVIA 1VCIA 3H0GH 1Q12A 2KHJA 3JC66 4QY7A 3TEHB 4A75A 4POFA 3H3VI 2EXDA 3CCSA 2BH8A 3S24A 1AE3A 1GO3E 4P75A 1KRTA 1GVPA 1V9PA 1PYBA 4KHPL 5K36G 1IBLQ 2R92H 2YYZA 4BA1I 4JI5Q 2OTLA 5C0XJ 3J7A5 2VNUD 1V43A 2FXQA 5LMUL 2B3GA 1XNQQ 1Q7YC 1KL9A 2LXKA 1VQ9A 3CCUA 2MO1A 1VQ5A 4NXMQ 4A3LG 5IYBH 4YCWA 2EQSA 2JA5H 3M7NA 3K7UC 4DR6L 4IOAA 3S2HH 4X6AH 3M3YH 1CSQA 3OYYA 3CCMA 5LMUQ 1XMOQ 3HOXH 2IY5B 4JI0Q 2YTVA 3EBEA 1EFWA 1IBLL 4BXXH 4L5RC 3PUXA 1N33Q 4BBRG 5IT9c 2B29A 4JC0A 5DLQE 1WCMH 3U4ZA 3GTGH 1BBWA 1XJVA 3HOZH 4LF6Q 1JJGA 1G291 3NBHB 1ASYA 4A3FH 4GKJQ 1PHJA 3BJUA 5JJLA 4GS3A 1P16A 3I4NG 4C2MH 1XNRL 1LUZA 1Q46A 1N32Q 1HR0L 4YY3L 3JAMi 4NXNL 5JJKA 1UWVA 4DAMA 1NBWA 3BZKA 1TWCH 2N3SA 4B3MQ 1AE2A 1Q82C 2JA5G 1X3GA 2QGQA 4JI8Q 3M4QA 3CCJA 3S1QH 5IP7H 1XPRA 4PZ7A 1U0LA 3CAMA 3K80C 2E2IH 4EX5A 3I56A 2OWOA 3HOWH 3UE0A 2ZJPA 2N78A 2C35B 1N33L 4DV5Q 2IX1A 4X65Q 5IY0A 3OTOL 1HJPA 4HJAA 2D0PA 2K14A 2H5XA 1XMOL 4A3MG 1EQRA 1RL2A 3E9HA 4DV1L 3GTPH 4BY1H 3K0XA 1S3OA 1X3FA 5GROA 2UUAQ 1C7YA 1J6QA 1VQHA 4A3CH 4JYAL 1CSPA 1YVCA 2N49A 4DR2Q 2JEBI 2DUDA 3HKSA 3NELA 4AIMA 2QEXA 1PYSB 2GN5A 4JI5L 3RN5A 1A63A 2D62A 3E9IA 3BZCA 1UE6A 2EIFA 4X66Q 1QZGA 1QUQB 1X54A 2JA7G 1LM0A 4L5TA 4NB3A 4YY3Q 4HIOA 4A3EG 1PH1A 3AQQA 1N34L 1HZCA 4DR1Q 4DKAC 1VQIA 5C3EG 1PH2A 1GM5A 4DUYQ 3AEVA 4DUZL 2VUMH 4GOPA 4GLXA 2ZTDA 3HOVH 1IZ6A 3AYHB 4P74A 4DK3C 3G48A 4DV7Q 4KLKA 1X65A 4YWLA 2BH2A 4C3HH 5H1SE 3RN2A 1MJCA 2WAQE 3LGJA 1IL2A 2JA6G 4Y52H 4A3IH 1I94L 3SGIA 3J80c 1B7YB 5JJIA 3H3VH 1EOVA 3IRBA 3WWVA 3GO5A 1K8AC 4GN5A 2KHIA 4A4IA 1MJEA 3CMEA 4LUOA 4A3EH 4YCVA 3PO2H 1B8AA 4NPSA 2K50A 3CCVA 3I2ZA 1W3SA 3HOVG 4PZ8A 5M3FH 3HFZB 2F4VQ 4UY8C 3KF8B 4OWXB 1VQ4A 1JJCB 4JI1Q 3A74A 2VQEQ 4KHZA 4UP7A 4LFAQ 4BY7G 4X64Q 4A3BH 1VQCA 2VZAA 2WAQG 3CCEA 2WB1E 3OW2A 3KLWA 3U4VA 4DR2L 1VQGA 1CKNA 1NE3A 2HHHQ 4A3GG 3TREA 2Q2HA 4OXPA 3F2DA 3S16H 3KF6B 3PCOB 1QZHA 1VQ6A 3HOYG 3AFPA 1G6PA 2ZJQA 4JI6Q 4A3CG 1H95A 1I94Q 1BKBA 2Z6KA 3KYHC 2CKZB 4R4TA 1G51A 2K75A 5IWAL 2Q2IA 4DV5L 1SMXA 2YTYA 4TVAB 2HHHL 3KJOA 3M85A 4DV3L 3M9BA 4IPHA 4DNIA 5HGQA 4JI8L 3VDYA 4LW1A 3I4MG 1K9MC 2DGYA 1HNZL 3CXCA 1PH6A 1SE8A 1C0AA 2PQAA 4BBRH 1BVSA 1VQJA 4X64L 4DR1L 3GTLH 3EN2A 1QVCA 2RCNA 1UE1A 1N34Q 3GTMH 1JT8A 4GNXA 2F4VL 5IE8A 3CPWA 4JI4L 5IYDG 2Q2UA 4IFDG 4R4OA 5GAEC 4OX9Q 1B70B 5M3MG 1L1OA 4A3GH 3S17H 3DM3A 2IX0A 4JYAQ 4DV6Q 4MZ9A 5FLXc 3T1HL 2UXDQ 1XMQQ 1YEZA 4A3JG 4YHHL 3RLFA 5C4XG 5IYBG 1KQSA 3ICEA 3J7ZC 3CC2A 3HOWG 2R7ZG 4XTCS 4HIDA 1WI5A 3OTOQ 2OCEA 1XMQL 3HOXG 2B63G 4AYBE 4NXML 2AMCB 3PO3H 2WP8J 4P71A 3ULJA 1YJNA 1SFOH 1TWHH 2R6GA 4O2DA 1YI2A 2I5MX 2K52A 1SRUA 4HJ9A 2VQFL 1QVGA 1PH5A 5E7NA 4LFAL 4JV5Q 4A3MH 1VQLA 3ER0A 2JEAI 5FJ8G 1EYGA 1EIFA 4A3FG 3H0GG 1SLJA 4R1JA 1EIYB 3F2BA 2R92G 1WYDA 3PUZA 1PVOA 2LXJA 1IYJB 3PF5A 5GQOA 1V1QA 2CFMA 4GKJL 1TWAH 1HH2P 4POGA 2N8NA 2CQOA 3RLOA 2ID0A 5EAYA 4C3IH 4QL5A 4PZ6A 3G4SA 4DR4Q 1WOCA 2Y0SE 2ES2A 1A0IA 1NJIC 4YCUA 2XGTA 5IWAQ 2NVTH 4DR3Q 1EQQA 1HZBA 2UUCL 3F1ZA 3FP9A 1N36L 5FLMH 3GD7A 3UDXA 2K5HA 4XIGS 2OQKA 5BR8L 1R9TH 1ASZA 1I6HH 2RHQB 3CCLA 3G71A 3HOZG 3AFQA 4A3IG 5ELOA 1YHBA 2JA6H 1P8LA 4DUYL 1I50H 4HJ7A 4LUVA 4LWCA 1CKMA 1PH9A 3KOJA 1T9HA 1EUJA 1NMFA 4LUZA 4DR5L 3FKIG 4AH6A 4IO9A 3STBC 1PH7A 1FJGQ 2A19A 4YWMA 1VQPA 1K83H 1XNRQ 4GKKL 3NENA 3PIPA 4K0KQ 3RZDH 1C9OA 4P73A 4A3LH 5AJ3Q 4LF9L 1NY4A 1BBUA 4L5SA 4DV3Q 3PUYA 4BY7H 5IP7G 3J80i 1KIXA 1RIPA 3A5ZB 2BA1A 2JQOA 2PQAB 4C3JH 5GAGC 4Y7NH 3J81j 3I55A 3K7AH 4DV1Q 1S40A 2UUBL 1XPUA 1Q1EA 1K3RA 2D0OA 3M4OH 1OXSC 4GNXB 4JOIC 1Q8KA 5FJ8H 4JI6L 3PF4A 1IBKQ 1DGSA 2JJQA 2UUBQ 4WJ3M 5M3MH 4YHHQ 3T1HQ 4OO1I 2BA0A 2ZM6L 3EIVA 3CW2C 4GN3B 2K5NA 1LTLA 1Q1BA 2WFWA 1NMGA 3BU2A 4LF5Q 4QGUA 5IP9G 1I5FA 1VQFA 4H02A 2HIXA 3GTQH 4OO1G 1VQBA 2ATWA 2UU9L 1SROA 3KFUA 2YV5A 3B6YA 2MNAA 2CWAA 1HR0Q 4A93H 4B3SQ 3J81c 1VQMA 4LF8L 4A93G 3PO3G 3E0EA 4RG1A 4BA2I 1JE5A 1KRSA 1E7ZA 1X9NA 2AWOA 3MEFA 5M3FG 4HJ8A 2R7DA 2JA9A 1VQKA 4GN4B 2AKWB 1PV4A 4JI2Q 5J3BA 5LMNW 4LF7Q 5BR8Q 1JJ2A 1Q86C 2UXBL 1WCMG 1JB7A 1AH9A 3KDFB 1NTGA 3K81C 1GD7A 1XPOA 5IP9H 3L2PA 5HY6A 4X62Q 2I0QA 4IFDJ 4LF4L 3TS2A 4DR4L 2KBNA 1YITA 1S72A 4HJ5A 4LFBL 2MO0A 3PV0A 4DV2L 1HNXQ 3RLNA 4HIMA 1FGUA 3CF5A 3JAMc 1CKNB 3F2CA 2XTIA 4GKKQ 3M4PA 5C44G 3T1YQ 3GDEA 3K8AA 3STBD 4DV0L 4NXNQ 1L2FA 2VUMG 3UDGA 1OTCA 4X66L 4A3KH 1YJWA 2PMZE 1KD1C 3UDIA 4OWTB 4AYBG 4BXXG 1KXLA 4LFCL 1VQAA 4DV4Q 2JA8H 3HKZE 4DV2Q 1A8VA 1OXVA 4DV0Q 3PGZA 3W1BA 4R4QA 4GNXC 3UE1A 1IBMQ 2E5LL 4LF4Q 1Y1VH 2A8VA 3PUVA 1K8GA 1YBYA 4AQYL 1HR0W 2AHOB 4MNOA 4R4CA 4JG2A 2AWNA 1PA6A 2K5VA 1VQNA 1TWGH 4DR7L 4DV7L 3F8TA 5C4XH 3TS0A 4A3JH 3U58A 1YIJA 2F3IA 2HQLA 3U50C 4DK6C 2QA4A 1XNQL 2R7ZH 3W5OA 1N8RC 4JI7Q 1D7QA 4IPGA 4IJHA 1LYLA 2Z6KC 5LMNQ 2I5LX 2YTXA 4LF7L 2VL6A 4J15A 2V1CC 1YHQA 2R7FA 5FLMG 3S1RH 4B3SL 4JBJA 4JI4Q 4R4IA 4KHPQ 1VQDA 2GVAA 5IYCG 3H15A 4UP9A 2PI2E 4LF9Q 2HIVA 2CCZA 2YU9H 4JBKA 2Y0SG 4IJLA 4K0KL 2NVYH 1HNWL 2KCTA 3A5UA 3I7FA 4KI0A 3ERSX 2Q2TA 4IPCA 1QVFA 2NN6I 2UUAL 2HT1A 3TQYA 5GAHC 5M5XH 3A0JA 5ELNA 1HNZQ 2NZHA 4JCVE 4JI0L 3PSIA 2MFIA 1O7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 L;  4IPD A;  4B3R L;  3CCR A;  1E22 A;  2R93 G;  4DR6 Q;  1HZA A;  1XTD A;  1IBK L;  4GOP B;  1X55 A;  3UDF A;  4FDB A;  4GLV B;  5IYD H;  1K0R A;  4PMW A;  4O0A A;  1UEB A;  5AJ3 L;  1K73 C;  2VY3 A;  4DAY B;  1CKO A;  4B3T L;  1X3E A;  2E5L Q;  2VW9 A;  2I5H A;  3L0O A;  5C0X G;  1JMC A;  3I4N H;  1IBM L;  4JI1 L;  2VQE L;  1PH4 A;  2E8G A;  2E2H H;  3GTO H;  1L1O B;  5M5W H;  3KDF A;  1OXU A;  1Y1V G;  4ME3 A;  4A3D H;  3S1M H;  3S1N H;  1N32 L;  4GOP C;  2PI2 A;  2ASB A;  5C4J H;  4JBM A;  1J5E L;  1VQ8 A;  2R93 H;  2GVB A;  1OXX K;  2LSS A;  3MXN B;  4QIW E;  4PG3 A;  2NZO A;  2ZJR A;  5JEA G;  1E1T A;  2VQF Q;  1UE5 A;  2CWP A;  3RZO H;  4QJF A;  1E24 A;  1L0W A;  4IOC A;  3Q8D A;  4HIK A;  1HNX L;  1EWI A;  1N9W A;  3CC4 A;  4TQU S;  1I3Q H;  3HOU H;  1QUQ A;  4JI3 Q;  3HOU G;  1UE7 A;  4ALP A;  2RHS B;  1VQE A;  4BY1 G;  1KC8 C;  3CD6 A;  2UXC Q;  4P72 A;  3J81 i;  4JI2 L;  3KJP A;  3CQZ H;  3RNU A;  3DLL A;  4BBS G;  5C0X I;  2MQH A;  1J5E Q;  3HOY H;  2JA7 H;  1HNW Q;  1M90 C;  3ZJY C;  4OWW B;  4JV5 L;  2NVQ H;  2JE6 I;  2IHE A;  4DPG A;  1GKH A;  1YZ6 A;  3G6E A;  1M1K C;  2UU9 Q;  3CP0 A;  2WB1 G;  4LNQ A;  2OTJ A;  4YWK A;  3S15 H;  3GTK H;  1W2B A;  4UPA A;  1Y1W G;  2Z0S A;  2JK8 A;  1Y1W H;  3ULL A;  1A62 A;  2IHF A;  4X65 L;  2JA8 G;  1Z47 A;  3GTJ H;  1PFS A;  1U5K A;  1Z9F A;  4X62 L;  3CPF A;  3ULP A;  1PH3 A;  1X6O A;  4A3D G;  1VS0 A;  4IFD I;  2VS1 A;  4B3R Q;  4DUZ Q;  3FKI H;  1MIU A;  2UXB Q;  5JEA J;  4OX9 L;  3L7Z C;  2F52 A;  2KCM A;  1PH8 A;  3RR5 A;  1VQ7 A;  5C44 H;  4DV6 L;  1Q81 C;  2UXD L;  1SR3 A;  2K4K A;  3PO2 G;  5C3E H;  4MTN A;  1IXR A;  3D0F A;  4APV A;  2PNH A;  3S2D H;  3CMA A;  1CUK A;  4LF8 Q;  3S14 H;  4UP8 A;  4A3B G;  2ZTC A;  1FJG L;  1TWF H;  1D8L A;  3T1Y L;  4DR5 Q;  4A76 A;  1E1O A;  4GLA C;  1TXY A;  2UXC L;  2ALY B;  2NN6 G;  2NVX H;  4LF5 L;  4B3T Q;  1YNX A;  5LMN L;  4WJ4 A;  1VQO A;  4LF6 L;  4JOI A;  2OQ0 A;  4LFB Q;  4JI3 L;  4JBW A;  4BBS H;  2ZTE A;  3W1G A;  2ZM6 Q;  3D31 A;  4RMF A;  1MKH A;  3NEM A;  4OON A;  1YHA A;  1HZ9 A;  4DR7 Q;  5M5Y H;  1N36 Q;  1KHI A;  1L1O C;  1X56 A;  3FHW A;  1YJ9 A;  2L15 A;  3PIO A;  3CCQ A;  1Y14 B;  4QQB X;  3CC7 A;  4DR3 L;  4AQY Q;  2B63 H;  2IT1 A;  1WFQ A;  1FL0 A;  3I4O A;  2UUC Q;  2E2J H;  1OXT A;  2A1A A;  2RF4 A;  3HKZ G;  4EQ5 A;  5GAD C;  1WJJ A;  4B3M L;  3KF6 A;  3TRZ A;  1KAW A;  1E3P A;  2KEN A;  1SN8 A;  4DV4 L;  4A3K G;  3PUW A;  4LFC Q;  3I4M H;  4L5Q A;  5IYC H;  1FVI A;  1VCI A;  3H0G H;  1Q12 A;  2KHJ A;  3JC6 6;  4QY7 A;  3TEH B;  4A75 A;  4POF A;  3H3V I;  2EXD A;  3CCS A;  2BH8 A;  3S24 A;  1AE3 A;  1GO3 E;  4P75 A;  1KRT A;  1GVP A;  1V9P A;  1PYB A;  4KHP L;  5K36 G;  1IBL Q;  2R92 H;  2YYZ A;  4BA1 I;  4JI5 Q;  2OTL A;  5C0X J;  3J7A 5;  2VNU D;  1V43 A;  2FXQ A;  5LMU L;  2B3G A;  1XNQ Q;  1Q7Y C;  1KL9 A;  2LXK A;  1VQ9 A;  3CCU A;  2MO1 A;  1VQ5 A;  4NXM Q;  4A3L G;  5IYB H;  4YCW A;  2EQS A;  2JA5 H;  3M7N A;  3K7U C;  4DR6 L;  4IOA A;  3S2H H;  4X6A H;  3M3Y H;  1CSQ A;  3OYY A;  3CCM A;  5LMU Q;  1XMO Q;  3HOX H;  2IY5 B;  4JI0 Q;  2YTV A;  3EBE A;  1EFW A;  1IBL L;  4BXX H;  4L5R C;  3PUX A;  1N33 Q;  4BBR G;  5IT9 c;  2B29 A;  4JC0 A;  5DLQ E;  1WCM H;  3U4Z A;  3GTG H;  1BBW A;  1XJV A;  3HOZ H;  4LF6 Q;  1JJG A;  1G29 1;  3NBH B;  1ASY A;  4A3F H;  4GKJ Q;  1PHJ A;  3BJU A;  5JJL A;  4GS3 A;  1P16 A;  3I4N G;  4C2M H;  1XNR L;  1LUZ A;  1Q46 A;  1N32 Q;  1HR0 L;  4YY3 L;  3JAM i;  4NXN L;  5JJK A;  1UWV A;  4DAM A;  1NBW A;  3BZK A;  1TWC H;  2N3S A;  4B3M Q;  1AE2 A;  1Q82 C;  2JA5 G;  1X3G A;  2QGQ A;  4JI8 Q;  3M4Q A;  3CCJ A;  3S1Q H;  5IP7 H;  1XPR A;  4PZ7 A;  1U0L A;  3CAM A;  3K80 C;  2E2I H;  4EX5 A;  3I56 A;  2OWO A;  3HOW H;  3UE0 A;  2ZJP A;  2N78 A;  2C35 B;  1N33 L;  4DV5 Q;  2IX1 A;  4X65 Q;  5IY0 A;  3OTO L;  1HJP A;  4HJA A;  2D0P A;  2K14 A;  2H5X A;  1XMO L;  4A3M G;  1EQR A;  1RL2 A;  3E9H A;  4DV1 L;  3GTP H;  4BY1 H;  3K0X A;  1S3O A;  1X3F A;  5GRO A;  2UUA Q;  1C7Y A;  1J6Q A;  1VQH A;  4A3C H;  4JYA L;  1CSP A;  1YVC A;  2N49 A;  4DR2 Q;  2JEB I;  2DUD A;  3HKS A;  3NEL A;  4AIM A;  2QEX A;  1PYS B;  2GN5 A;  4JI5 L;  3RN5 A;  1A63 A;  2D62 A;  3E9I A;  3BZC A;  1UE6 A;  2EIF A;  4X66 Q;  1QZG A;  1QUQ B;  1X54 A;  2JA7 G;  1LM0 A;  4L5T A;  4NB3 A;  4YY3 Q;  4HIO A;  4A3E G;  1PH1 A;  3AQQ A;  1N34 L;  1HZC A;  4DR1 Q;  4DKA C;  1VQI A;  5C3E G;  1PH2 A;  1GM5 A;  4DUY Q;  3AEV A;  4DUZ L;  2VUM H;  4GOP A;  4GLX A;  2ZTD A;  3HOV H;  1IZ6 A;  3AYH B;  4P74 A;  4DK3 C;  3G48 A;  4DV7 Q;  4KLK A;  1X65 A;  4YWL A;  2BH2 A;  4C3H H;  5H1S E;  3RN2 A;  1MJC A;  2WAQ E;  3LGJ A;  1IL2 A;  2JA6 G;  4Y52 H;  4A3I H;  1I94 L;  3SGI A;  3J80 c;  1B7Y B;  5JJI A;  3H3V H;  1EOV A;  3IRB A;  3WWV A;  3GO5 A;  1K8A C;  4GN5 A;  2KHI A;  4A4I A;  1MJE A;  3CME A;  4LUO A;  4A3E H;  4YCV A;  3PO2 H;  1B8A A;  4NPS A;  2K50 A;  3CCV A;  3I2Z A;  1W3S A;  3HOV G;  4PZ8 A;  5M3F H;  3HFZ B;  2F4V Q;  4UY8 C;  3KF8 B;  4OWX B;  1VQ4 A;  1JJC B;  4JI1 Q;  3A74 A;  2VQE Q;  4KHZ A;  4UP7 A;  4LFA Q;  4BY7 G;  4X64 Q;  4A3B H;  1VQC A;  2VZA A;  2WAQ G;  3CCE A;  2WB1 E;  3OW2 A;  3KLW A;  3U4V A;  4DR2 L;  1VQG A;  1CKN A;  1NE3 A;  2HHH Q;  4A3G G;  3TRE A;  2Q2H A;  4OXP A;  3F2D A;  3S16 H;  3KF6 B;  3PCO B;  1QZH A;  1VQ6 A;  3HOY G;  3AFP A;  1G6P A;  2ZJQ A;  4JI6 Q;  4A3C G;  1H95 A;  1I94 Q;  1BKB A;  2Z6K A;  3KYH C;  2CKZ B;  4R4T A;  1G51 A;  2K75 A;  5IWA L;  2Q2I A;  4DV5 L;  1SMX A;  2YTY A;  4TVA B;  2HHH L;  3KJO A;  3M85 A;  4DV3 L;  3M9B A;  4IPH A;  4DNI A;  5HGQ A;  4JI8 L;  3VDY A;  4LW1 A;  3I4M G;  1K9M C;  2DGY A;  1HNZ L;  3CXC A;  1PH6 A;  1SE8 A;  1C0A A;  2PQA A;  4BBR H;  1BVS A;  1VQJ A;  4X64 L;  4DR1 L;  3GTL H;  3EN2 A;  1QVC A;  2RCN A;  1UE1 A;  1N34 Q;  3GTM H;  1JT8 A;  4GNX A;  2F4V L;  5IE8 A;  3CPW A;  4JI4 L;  5IYD G;  2Q2U A;  4IFD G;  4R4O A;  5GAE C;  4OX9 Q;  1B70 B;  5M3M G;  1L1O A;  4A3G H;  3S17 H;  3DM3 A;  2IX0 A;  4JYA Q;  4DV6 Q;  4MZ9 A;  5FLX c;  3T1H L;  2UXD Q;  1XMQ Q;  1YEZ A;  4A3J G;  4YHH L;  3RLF A;  5C4X G;  5IYB G;  1KQS A;  3ICE A;  3J7Z C;  3CC2 A;  3HOW G;  2R7Z G;  4XTC S;  4HID A;  1WI5 A;  3OTO Q;  2OCE A;  1XMQ L;  3HOX G;  2B63 G;  4AYB E;  4NXM L;  2AMC B;  3PO3 H;  2WP8 J;  4P71 A;  3ULJ A;  1YJN A;  1SFO H;  1TWH H;  2R6G A;  4O2D A;  1YI2 A;  2I5M X;  2K52 A;  1SRU A;  4HJ9 A;  2VQF L;  1QVG A;  1PH5 A;  5E7N A;  4LFA L;  4JV5 Q;  4A3M H;  1VQL A;  3ER0 A;  2JEA I;  5FJ8 G;  1EYG A;  1EIF A;  4A3F G;  3H0G G;  1SLJ A;  4R1J A;  1EIY B;  3F2B A;  2R92 G;  1WYD A;  3PUZ A;  1PVO A;  2LXJ A;  1IYJ B;  3PF5 A;  5GQO A;  1V1Q A;  2CFM A;  4GKJ L;  1TWA H;  1HH2 P;  4POG A;  2N8N A;  2CQO A;  3RLO A;  2ID0 A;  5EAY A;  4C3I H;  4QL5 A;  4PZ6 A;  3G4S A;  4DR4 Q;  1WOC A;  2Y0S E;  2ES2 A;  1A0I A;  1NJI C;  4YCU A;  2XGT A;  5IWA Q;  2NVT H;  4DR3 Q;  1EQQ A;  1HZB A;  2UUC L;  3F1Z A;  3FP9 A;  1N36 L;  5FLM H;  3GD7 A;  3UDX A;  2K5H A;  4XIG S;  2OQK A;  5BR8 L;  1R9T H;  1ASZ A;  1I6H H;  2RHQ B;  3CCL A;  3G71 A;  3HOZ G;  3AFQ A;  4A3I G;  5ELO A;  1YHB A;  2JA6 H;  1P8L A;  4DUY L;  1I50 H;  4HJ7 A;  4LUV A;  4LWC A;  1CKM A;  1PH9 A;  3KOJ A;  1T9H A;  1EUJ A;  1NMF A;  4LUZ A;  4DR5 L;  3FKI G;  4AH6 A;  4IO9 A;  3STB C;  1PH7 A;  1FJG Q;  2A19 A;  4YWM A;  1VQP A;  1K83 H;  1XNR Q;  4GKK L;  3NEN A;  3PIP A;  4K0K Q;  3RZD H;  1C9O A;  4P73 A;  4A3L H;  5AJ3 Q;  4LF9 L;  1NY4 A;  1BBU A;  4L5S A;  4DV3 Q;  3PUY A;  4BY7 H;  5IP7 G;  3J80 i;  1KIX A;  1RIP A;  3A5Z B;  2BA1 A;  2JQO A;  2PQA B;  4C3J H;  5GAG C;  4Y7N H;  3J81 j;  3I55 A;  3K7A H;  4DV1 Q;  1S40 A;  2UUB L;  1XPU A;  1Q1E A;  1K3R A;  2D0O A;  3M4O H;  1OXS C;  4GNX B;  4JOI C;  1Q8K A;  5FJ8 H;  4JI6 L;  3PF4 A;  1IBK Q;  1DGS A;  2JJQ A;  2UUB Q;  4WJ3 M;  5M3M H;  4YHH Q;  3T1H Q;  4OO1 I;  2BA0 A;  2ZM6 L;  3EIV A;  3CW2 C;  4GN3 B;  2K5N A;  1LTL A;  1Q1B A;  2WFW A;  1NMG A;  3BU2 A;  4LF5 Q;  4QGU A;  5IP9 G;  1I5F A;  1VQF A;  4H02 A;  2HIX A;  3GTQ H;  4OO1 G;  1VQB A;  2ATW A;  2UU9 L;  1SRO A;  3KFU A;  2YV5 A;  3B6Y A;  2MNA A;  2CWA A;  1HR0 Q;  4A93 H;  4B3S Q;  3J81 c;  1VQM A;  4LF8 L;  4A93 G;  3PO3 G;  3E0E A;  4RG1 A;  4BA2 I;  1JE5 A;  1KRS A;  1E7Z A;  1X9N A;  2AWO A;  3MEF A;  5M3F G;  4HJ8 A;  2R7D A;  2JA9 A;  1VQK A;  4GN4 B;  2AKW B;  1PV4 A;  4JI2 Q;  5J3B A;  5LMN W;  4LF7 Q;  5BR8 Q;  1JJ2 A;  1Q86 C;  2UXB L;  1WCM G;  1JB7 A;  1AH9 A;  3KDF B;  1NTG A;  3K81 C;  1GD7 A;  1XPO A;  5IP9 H;  3L2P A;  5HY6 A;  4X62 Q;  2I0Q A;  4IFD J;  4LF4 L;  3TS2 A;  4DR4 L;  2KBN A;  1YIT A;  1S72 A;  4HJ5 A;  4LFB L;  2MO0 A;  3PV0 A;  4DV2 L;  1HNX Q;  3RLN A;  4HIM A;  1FGU A;  3CF5 A;  3JAM c;  1CKN B;  3F2C A;  2XTI A;  4GKK Q;  3M4P A;  5C44 G;  3T1Y Q;  3GDE A;  3K8A A;  3STB D;  4DV0 L;  4NXN Q;  1L2F A;  2VUM G;  3UDG A;  1OTC A;  4X66 L;  4A3K H;  1YJW A;  2PMZ E;  1KD1 C;  3UDI A;  4OWT B;  4AYB G;  4BXX G;  1KXL A;  4LFC L;  1VQA A;  4DV4 Q;  2JA8 H;  3HKZ E;  4DV2 Q;  1A8V A;  1OXV A;  4DV0 Q;  3PGZ A;  3W1B A;  4R4Q A;  4GNX C;  3UE1 A;  1IBM Q;  2E5L L;  4LF4 Q;  1Y1V H;  2A8V A;  3PUV A;  1K8G A;  1YBY A;  4AQY L;  1HR0 W;  2AHO B;  4MNO A;  4R4C A;  4JG2 A;  2AWN A;  1PA6 A;  2K5V A;  1VQN A;  1TWG H;  4DR7 L;  4DV7 L;  3F8T A;  5C4X H;  3TS0 A;  4A3J H;  3U58 A;  1YIJ A;  2F3I A;  2HQL A;  3U50 C;  4DK6 C;  2QA4 A;  1XNQ L;  2R7Z H;  3W5O A;  1N8R C;  4JI7 Q;  1D7Q A;  4IPG A;  4IJH A;  1LYL A;  2Z6K C;  5LMN Q;  2I5L X;  2YTX A;  4LF7 L;  2VL6 A;  4J15 A;  2V1C C;  1YHQ A;  2R7F A;  5FLM G;  3S1R H;  4B3S L;  4JBJ A;  4JI4 Q;  4R4I A;  4KHP Q;  1VQD A;  2GVA A;  5IYC G;  3H15 A;  4UP9 A;  2PI2 E;  4LF9 Q;  2HIV A;  2CCZ A;  2YU9 H;  4JBK A;  2Y0S G;  4IJL A;  4K0K L;  2NVY H;  1HNW L;  2KCT A;  3A5U A;  3I7F A;  4KI0 A;  3ERS X;  2Q2T A;  4IPC A;  1QVF A;  2NN6 I;  2UUA L;  2HT1 A;  3TQY A;  5GAH C;  5M5X H;  3A0J A;  5ELN A;  1HNZ Q;  2NZH A;  4JCV E;  4JI0 L;  3PSI A;  2MFI A;  1O7I A; 
#chains in the Genus database with same CATH topology
 4C3I G;  5I2Y A;  4UAI A;  1HZA A;  2IPK D;  4G7O C;  1IBK L;  2RKS A;  1EIG A;  5AJ3 L;  2N55 A;  4B3T L;  2E5L Q;  1B50 A;  3BDL A;  3I4N H;  2VQE L;  1L1O B;  4ZUI A;  1OXU A;  1Y1V G;  4CKC A;  1U4M A;  2EJM A;  5CV6 A;  4HCE A;  3OIQ A;  3PO2 B;  1OXX K;  1BF4 A;  1SDF A;  2JSO A;  1E1T A;  1TS3 A;  1MGS A;  1BCP C;  1E24 A;  4IOC A;  2FJ2 A;  3UI2 A;  5C4H A;  1PDQ A;  1I3Q H;  4ZQ3 A;  1QUQ A;  3J80 L;  1KC8 C;  4KD3 A;  3V05 A;  5IT9 L;  4FXD A;  3RNU A;  1Y8O B;  5C0X I;  4CJ1 B;  1HNW Q;  4BWG B;  4M1U B;  5ISR A;  1M90 C;  1FR3 A;  4JV5 L;  2EOT A;  4ZKC B;  1CA6 A;  3TSS A;  3CP0 A;  3CU7 A;  4LNQ A;  3S15 H;  1W2B A;  3JAM E;  1DM0 B;  4K8J A;  5J39 A;  1CQF A;  1UAP A;  2BE5 D;  4KJN A;  2IHF A;  2PW5 A;  3E0J A;  1U5K A;  1QNK A;  4A3D G;  5D14 A;  5DAU A;  2O5J C;  4DUZ Q;  2SOB A;  3FKI H;  4OX9 L;  2F52 A;  3VYS A;  1ESF A;  1SR3 A;  3K5L A;  3PMF A;  4R8N A;  1MSG A;  1D5X C;  3H6M A;  5M3F B;  1CUK A;  3KK7 A;  3S14 H;  1U4R A;  1EYC A;  1CZG A;  2CW0 C;  4HSP A;  3OHX C;  2ZTC A;  4GLA C;  4A3E B;  1WCM B;  1I50 B;  1PXU A;  2QIL A;  1IKM A;  4BBS H;  4JBW A;  2ZTE A;  3BVM A;  4LK1 C;  3KUP A;  1MKH A;  3BS1 A;  1YHA A;  1A2U A;  2SDF A;  3FHW A;  5A35 A;  2L15 A;  3PIO A;  1A15 A;  1Y14 B;  3S16 B;  4DR3 L;  4AQY Q;  2B63 H;  4CJ2 C;  1WFQ A;  5EQ0 A;  2RF4 A;  3HKZ G;  1GUS A;  4RHS A;  4EQ5 A;  3TRZ A;  1WJJ A;  2DY8 A;  2KEN A;  3I4M H;  2F0F A;  5IYC H;  1VCI A;  2KHJ A;  1ET6 A;  1L0Y B;  3JC6 6;  1FNU A;  3TEH B;  2EXD A;  4KN4 C;  2BCO A;  4A3M B;  4KHP L;  4Q0F A;  3CQZ B;  2F0S A;  4QIW B;  5LL6 S;  5LMU L;  5JVH 3;  3MC0 B;  1VQ5 A;  4NXM Q;  1K0S A;  5IYB H;  3P20 A;  4V19 0;  3K7U C;  2JA5 B;  3QJY A;  3I90 A;  5CV7 A;  3EBE A;  5HGT A;  1IBL L;  3PUX A;  1S5F D;  1WCM H;  4HMJ A;  2IX3 A;  2MP1 A;  4A3F H;  4GKJ Q;  1PHJ A;  2L4N A;  3BJU A;  5JJL A;  5C4J B;  1N32 Q;  1HR0 L;  4U68 A;  2B2T C;  4DAM A;  2IJ0 A;  1JQY D;  3BZK A;  1TWC H;  1SNC A;  4B3M Q;  2JA5 G;  2QGQ A;  1AN8 A;  1FNV A;  5KND A;  4G57 A;  2JN4 A;  5CV8 A;  4B08 A;  2E2I H;  2EVB A;  1RF2 D;  1PFB A;  4YIJ A;  2IX1 A;  3TP6 A;  4DV5 Q;  1K3B C;  1J8I A;  1XWE A;  2D0P A;  1EQR A;  1D2B A;  1RL2 A;  3IL8 A;  3MXN A;  4KY7 A;  4BY1 H;  3R2T A;  2UUA Q;  3BVZ A;  1IW7 D;  3MXU A;  4RKL A;  3VR5 A;  1EY8 A;  2QKI C;  4OEM B;  2GN5 A;  4X66 Q;  2EIF A;  1QZG A;  1PTO B;  1ROD A;  4A3E G;  1PH1 A;  1N34 L;  1HZC A;  1K28 A;  4MHE A;  4DKA C;  4DUY Q;  3KBX A;  4DUZ L;  2VUM H;  3HOV H;  3AYH B;  3G48 A;  1X65 A;  2EY6 A;  2KHS A;  4TRD A;  4C3H H;  5H1S E;  2XSC A;  3LGJ A;  4R8I A;  3NWT A;  1I94 L;  4DXG A;  4S3S A;  2F0L A;  5FLX L;  1MJE A;  1UEA B;  1DCZ A;  2NVX B;  3S17 B;  2WKC A;  5D3I B;  5JEA H;  2K50 A;  1ILP A;  3T4A C;  3HFZ B;  1B3A A;  2VZA A;  3CCE A;  4DR2 L;  2F0J A;  2K04 A;  5KNC A;  3FMC A;  3TRE A;  3F2D A;  3S16 H;  2WKD A;  1VQ6 A;  5EKI A;  2I07 B;  4GZY C;  2ZJQ A;  1HA6 A;  2Z8L A;  3EFX D;  1G51 A;  4K2L A;  1PRT D;  5IWA L;  2Q2I A;  3QG1 A;  3F2U A;  1XXG A;  2YTY A;  2F3V A;  2HHH L;  2NBF A;  4FNF A;  3M85 A;  4DV3 L;  3M9B A;  2F0Q A;  3H09 A;  3WDN A;  1HNZ L;  5JAV A;  2HCC A;  4DR1 L;  1S5E D;  4RA8 A;  1N34 Q;  1UE1 A;  3C1F A;  1PMR A;  1JT8 A;  2I46 A;  1CT1 D;  1WTW A;  3NTH A;  5IYD G;  2Q2U A;  3QWN A;  3HOZ B;  4A3G H;  2NUC A;  3AMU A;  1RHP A;  4JYA Q;  5CR3 A;  4DV6 Q;  2F03 A;  2WII B;  2UXD Q;  3NQI A;  1XMQ Q;  4EQN A;  4YHH L;  5M3M B;  3HOX B;  1TR5 A;  3C1E A;  4DFA A;  3ICE A;  4HID A;  1ESR A;  1LTT D;  1WI5 A;  3NWS A;  3OTO Q;  1AZP A;  2OCE A;  3D4D A;  1EL0 A;  1XMQ L;  3MHB A;  4AYB E;  1JR0 D;  2AMC B;  1HPC A;  4P71 A;  1BDO A;  2KCN A;  1YI2 A;  1SRU A;  4HJ9 A;  2VQF L;  4LFA L;  5FJ8 G;  1SLJ A;  2L0C A;  2DN8 A;  4R1J A;  3F2B A;  4OL7 A;  4I7Z C;  1GUG A;  1STB A;  2RDG A;  1KNE A;  4PZ6 A;  2HDM A;  3MXG A;  4DR4 Q;  1WOC A;  2ES2 A;  1PRT F;  2XGT A;  5IWA Q;  1I4R A;  1HZB A;  1B3Q A;  1N36 L;  3UDX A;  2K5H A;  4XIG S;  1ASZ A;  3G7L A;  3CCL A;  3G71 A;  4A3I G;  1CQV A;  3R93 A;  1KDC A;  4TSS A;  1II3 A;  1P8L A;  4DUY L;  1EIH A;  1CKM A;  3HEJ A;  2QW7 A;  3A7A B;  3MA2 B;  1NMF A;  5DNF A;  4AH6 A;  1LT4 D;  1FJG Q;  1G6Z A;  1H9S B;  1VQP A;  3K5O A;  3S1N B;  4ZCK A;  1GUW A;  1C9O A;  4P73 A;  5AJ3 Q;  4LF9 L;  1NY4 A;  4L5S A;  2EE1 A;  5IP7 G;  4OIJ A;  3J80 i;  2F1M A;  2PQA B;  3ERQ A;  4HR7 B;  4DV1 Q;  2ZXO A;  3TDQ A;  2R61 A;  2XRS D;  4JOI C;  2PZU A;  4JI6 L;  1DOM A;  1IBK Q;  1R4Q B;  3VR4 A;  3GV6 A;  4KY6 A;  2D9U A;  1Z7T A;  3CW2 C;  1Q1B A;  1NMG A;  3BU2 A;  1I4P A;  3I73 A;  4KTA A;  1I5F A;  1SMY C;  1VQF A;  2HIX A;  4H02 A;  3GTQ H;  5I9P A;  4OO1 G;  4KJO A;  4A93 H;  4B3S Q;  3WOF A;  2OF1 A;  3DWQ A;  1X9N A;  1FGB D;  4HJ8 A;  2ZT9 C;  1VQK A;  5TSS A;  1IHZ A;  4L63 B;  1PV4 A;  1F2Y A;  1SJE D;  2F0N A;  1JJ2 A;  1LTS D;  3KDF B;  4DA2 A;  1NTG A;  3FDT A;  3L2P A;  1KLG D;  2I0Q A;  4H13 C;  4DR4 L;  5IGE A;  3TBI B;  4HJ5 A;  3M4Y A;  2JXM B;  1WTR A;  3CF5 A;  1B9N A;  1CKN B;  4IUT A;  2MUY A;  3I70 A;  5C44 G;  1SYB A;  4DV0 L;  1L2F A;  1NNX A;  1YJW A;  4P2C B;  2HCI A;  1T5E A;  4AYB G;  4DV2 Q;  3PGZ A;  3GTG B;  1TWH B;  4GNX C;  2E5L L;  3C3L A;  4PMC A;  2A8V A;  1CHP D;  2EJG C;  1HR0 W;  3M3Y B;  4MNO A;  4R4C A;  2F0K A;  3WOE A;  4DR7 L;  4FXG C;  2D2C C;  1XNQ L;  2R7Z H;  4JI7 Q;  1D7Q A;  1Y1W B;  2Z6K C;  3V96 A;  4LF7 L;  4J15 A;  2VUM B;  4B3S L;  4KHP Q;  2GVA A;  5IYC G;  2XVS A;  4RAU C;  1RCV D;  2HIV A;  3LX0 A;  4JBK A;  2Y0S G;  4DK0 A;  2K28 A;  4BBR B;  2NVY H;  3GTL B;  1WTQ A;  5L37 A;  1H9K A;  2K6A A;  2NN6 I;  3TQY A;  5IT9 E;  1D1K A;  3A0J A;  2CH4 W;  3OIP A;  1PFM A;  4JI7 L;  2R93 G;  2A5H A;  4K6L A;  4GOP B;  2OT2 A;  3UDF A;  4GLV B;  1HQM C;  4O0A A;  2XIW A;  2B8G A;  1Y1V B;  2ENB A;  4PMW A;  4CBV A;  4DAY B;  2R3Z A;  3L0O A;  5C0X G;  1JMC A;  3GQB A;  1L0X B;  2E8G A;  1BOS A;  3SK6 A;  4Q5V A;  2KQ3 A;  1Q3L A;  3D4W A;  2DNE A;  1TY2 A;  4WRD A;  3GV3 A;  3MXN B;  4PG3 A;  3OPO A;  1GOZ A;  4IUP A;  1W6K A;  4C3J G;  4N9P A;  3RZO H;  1LTB D;  2NZ1 D;  2PPB C;  4HED A;  1L0W A;  4ULL A;  1KNA A;  3CC4 A;  4TQU S;  4JI3 Q;  2PNR C;  4ALP A;  1VQE A;  1HXY D;  3AU7 A;  2B2V C;  4PQX A;  4P72 A;  2K5Q A;  3KJP A;  1A3T A;  3CQZ H;  2MQH A;  2JA7 H;  4EVO A;  3Q22 A;  3DM1 A;  4ODG A;  4XQQ A;  3ZJY C;  1QJO A;  2F0U A;  2JE6 I;  2IHE A;  1GKH A;  2WB1 G;  3IAY A;  4H0L C;  4YWK A;  5KIX A;  1JIC A;  4CDD C;  4UPA A;  5CV5 A;  1Y1W G;  2JK8 A;  1V1P A;  4OGQ C;  2B2Y A;  1IYV A;  3HOU B;  4X62 L;  1Z9F A;  1ZKO A;  3CPF A;  4KMU C;  4IFD I;  4B3R Q;  4BBS B;  2UXB Q;  1PZI D;  3L7Z C;  1VQ7 A;  1PH8 A;  3HOV B;  1GUN A;  3PO2 G;  4FO2 A;  1IXR A;  3D0F A;  2PNH A;  1Y69 U;  3S2D H;  1SNQ A;  3CMA A;  1ICW A;  4C2M B;  4LF8 Q;  5I2X A;  3DEO A;  2CQA A;  2ZXP A;  1FJG L;  1TWF H;  1D8L A;  1BCP F;  3Q23 A;  1E1O A;  2UXC L;  5FLX E;  1KTK A;  2NN6 G;  2NVX H;  4LF5 L;  1YNX A;  2E76 C;  1VQO A;  4LF6 L;  2OQ0 A;  5DM6 3;  4LFB Q;  1TY0 A;  4JI3 L;  4RMF A;  1EFI D;  1STA A;  2HDL A;  3N52 A;  5DEH A;  1S5D D;  1KHI A;  4C3H B;  1L1O C;  5EPL A;  3CC7 A;  2IT1 A;  3DHQ A;  4XT3 B;  1OXT A;  4B3M L;  1E3P A;  4A3K G;  5JPM C;  3PUW A;  4L5Q A;  1QOH A;  1Q12 A;  3H3V I;  3FEW X;  2H1E A;  1GO3 E;  3A7L A;  5EJW A;  4P75 A;  1SNP A;  1PYB A;  1V9P A;  1AFP A;  5G3L F;  1IBL Q;  2R92 H;  2YYZ A;  4JI5 Q;  5C0X J;  1VF7 A;  3J7A 5;  1V43 A;  3N6R A;  2J0T D;  4DR6 L;  3M7N A;  2JA5 H;  1K8M A;  1PLF A;  1CSQ A;  3OYY A;  3CCM A;  2QDB A;  5LMU Q;  3HOX H;  3M3Y H;  2EYM A;  1EFW A;  4L5R C;  5IT9 c;  1WTX A;  4JC0 A;  5DLQ E;  1SAP A;  1O7L A;  1JCK B;  1SYD A;  1DOK A;  2B2Y C;  2NYZ D;  4LF6 Q;  1GHK A;  1F9R A;  1LTG D;  1F9Q A;  4GS3 A;  4JK1 C;  4JW0 A;  4C56 C;  1LUZ A;  1Q46 A;  4YY3 L;  1NUC A;  1NBW A;  2RSN A;  2N3S A;  1X3G A;  2FMC A;  3NUC A;  3M4Q A;  3CCJ A;  4K8I A;  5IP7 H;  4PZ7 A;  2OWO A;  1XX8 A;  2EYJ A;  4WFN 3;  2EYO A;  2C35 B;  1TKW B;  3OTO L;  1GXD C;  2K14 A;  2B2V A;  2H5X A;  1XMO L;  4J8Q A;  5C0X H;  3E9H A;  1S3O A;  1X3F A;  5GRO A;  1VQH A;  4RHR A;  4JYA L;  2N49 A;  4DR2 Q;  1TWA B;  2DUD A;  2DY7 A;  2QEX A;  1A63 A;  3E9I A;  2H4O A;  3BZC A;  3EA6 A;  2F0T A;  3U9S A;  4A93 B;  1LT6 D;  1D6E C;  1LM0 A;  1TS4 A;  4HIO A;  3AQQ A;  1VQI A;  1PH2 A;  1UNS A;  3K58 A;  4GLX A;  1MD2 D;  1IZ6 A;  1WTH A;  3M7G A;  2B63 B;  4DV7 Q;  4YWL A;  4DXF A;  3RN2 A;  1IL2 A;  4Y52 H;  5CGK A;  3S2H B;  3SGI A;  3J80 c;  5JJI A;  3Q0A A;  3RZO B;  1V1O A;  3K6O A;  1K8A C;  2KHI A;  3R2I A;  4RH6 A;  5ELE A;  4B9W A;  4IQZ A;  4CKB A;  2JA8 B;  4Z9C B;  3KLS X;  5E4W C;  3CCV A;  3I2Z A;  2VXW A;  4ZKB B;  4PZ8 A;  5M3F H;  1CHQ D;  1HTL D;  2CW0 D;  4K5V A;  1VQ4 A;  4JI1 Q;  4X64 Q;  1VQC A;  2WV6 D;  3Q6S A;  3VYU A;  3MWY W;  3OMG A;  2XWJ B;  3KLW A;  2PW7 A;  2Q8R E;  1NE3 A;  3GTP B;  1HRJ A;  2RDF A;  2AQ3 B;  4OXP A;  1U4P A;  3AFP A;  3VYT A;  4JI6 Q;  2Z6K A;  4U67 3;  3IFD A;  2MGS A;  3SDZ A;  1SMX A;  4TVA B;  3CKI B;  3BVG A;  2J4X A;  3VDY A;  1I4X A;  3P1H A;  5FO8 B;  4X64 L;  1BVS A;  2AUK A;  4GNX A;  2F4V L;  3CPW A;  4DGZ A;  4IFD G;  4A3F B;  5M5W B;  4OX9 Q;  1B70 B;  5M3M G;  1L1O A;  1TQO A;  4B9X A;  3T1H L;  1ZEQ X;  2KJX A;  1YEZ A;  5C4X G;  3RLF A;  1I3Q B;  5IYB G;  1BUV T;  3J7Z C;  2ZXR A;  3CC2 A;  3HOW G;  4XTC S;  2FIN B;  2RQX A;  3S1Q B;  3PO3 H;  3CRL C;  4F88 A;  4RGM A;  1ILQ A;  3ULJ A;  1YJN A;  1NAP A;  2EY5 A;  1TWH H;  2R6G A;  4O2D A;  4FF3 A;  1PH5 A;  5E7N A;  4A3M H;  4ILW A;  1EYG A;  2JYO A;  2K5D A;  2R92 G;  1NSN S;  1PZJ D;  1CZW A;  1PVO A;  2A68 D;  3PF5 A;  2CFM A;  5KNB A;  5EKL A;  3MEH A;  3DWP A;  2N8N A;  1KLU D;  3RLO A;  4RGO S;  2ID0 A;  4C3I H;  2RA4 A;  3G4S A;  3PIP 3;  2Y0S E;  2X69 A;  1PZK D;  1PFN A;  2UUC L;  4A3J B;  4IN3 A;  3KF8 A;  5FLM H;  4QB4 A;  2L5T A;  1R9T H;  5ELD A;  4XQJ A;  1TII D;  4HAE A;  4MIU A;  1BXT A;  1YHB A;  2C9O A;  1F77 A;  3KOJ A;  4F7X A;  4RGT A;  5FK9 C;  4IO9 A;  3STB C;  1EY9 A;  2A19 A;  4YWM A;  2QDL A;  4V0B A;  1XNR Q;  2F3W A;  1SXT A;  1C4Q A;  3PIP A;  4K0K Q;  2EY1 A;  4JPB W;  3I8Z A;  4QUC A;  3NHH A;  1SE3 A;  4XDX A;  1TS2 A;  3X3M A;  4G7H C;  3SEB A;  4Y7N H;  2JQO A;  4C3J H;  3I55 A;  2UUB L;  3S1Q H;  3J81 j;  1S40 A;  3M4O H;  5J22 A;  3O13 A;  2QF7 A;  1TWG B;  4ME5 A;  5IOC A;  5FJ8 H;  1QIL A;  3BG3 A;  2UUB Q;  4WJ3 M;  1NR2 A;  3T1H Q;  1CI3 M;  3K7A B;  3EIV A;  4GN3 B;  4KN7 C;  5C5M A;  3JAM L;  2OEO A;  2EZV A;  4QUF A;  3KFU A;  2YV5 A;  4J1M A;  3SK4 A;  3NTK A;  1VQM A;  4A93 G;  1VMP A;  3E0E A;  4RG1 A;  4BA2 I;  1JE5 A;  4RFB A;  2F0G A;  1ET9 A;  2R7D A;  3IFT A;  4GN4 B;  4HMI A;  2AKW B;  5LMN W;  4DNR B;  4LF7 Q;  2KEE A;  1Q86 C;  2UXB L;  1AH9 A;  4MN3 A;  3K81 C;  3QB3 A;  1XPO A;  5IP9 H;  4IFD J;  4LF4 L;  2KBN A;  1YIT A;  3C46 A;  1AP0 A;  4DV2 L;  4KKT A;  1I6H B;  3F2C A;  2XTI A;  4GKK Q;  4DU9 A;  3K8A A;  3STB D;  1U9R A;  4X3U A;  3V2T A;  4KHV A;  4A3K H;  2PMZ E;  3UDI A;  2F0W A;  1KXL A;  2JA8 H;  1A8V A;  4DV0 Q;  3W1B A;  1IBM Q;  4LF4 Q;  4K6D A;  4KKU A;  1K8G A;  4AQY L;  2AHO B;  2K5V A;  4DV7 L;  3TS0 A;  4A3J H;  1YIJ A;  2HQL A;  4DAV A;  2RBM A;  2QA4 A;  1LAC A;  3W5O A;  5LMN Q;  1GUT A;  1EY5 A;  1ZYR C;  2L12 A;  1YHQ A;  5FLM G;  3RZD B;  1VQD A;  1Q8I A;  4ZRZ A;  2DJG C;  2CCZ A;  2VB3 X;  5FKA C;  1STG A;  2MPM A;  3I72 A;  5COY A;  5D3D A;  3A5U A;  3I7F A;  2A6H C;  1H9R A;  2WB1 B;  2G9D A;  2K32 A;  1JWM D;  1RD9 D;  3PSI A;  2MFI A;  1YNN C;  1VQ8 A;  2CHB D;  3CCR A;  2Q8T A;  1E22 A;  3J81 E;  1STY A;  1K8O A;  3MFY A;  5I6W A;  1X55 A;  3NK9 A;  2SNM A;  2LFN A;  4FDB A;  4PMB A;  2RDH A;  1CK1 A;  1H9S A;  1UEB A;  1LTA D;  1CKO A;  5C5L A;  1XTC D;  2VW9 A;  2I5H A;  1FYC A;  2A6E C;  1IBM L;  1SND A;  2E2H H;  3GTO H;  5M5W H;  3KDF A;  4ME3 A;  3S1N H;  3ERO A;  1N32 L;  2PI2 A;  2ASB A;  3H3V C;  5BN4 A;  4A3D B;  4DK1 A;  5C3E B;  4JBM A;  5F2D A;  5KRU A;  2GVB A;  1B9M A;  2LSS A;  4QIW E;  5JEA G;  2BOS A;  1UE5 A;  1F2M A;  5ELC A;  4CDC C;  2KEC A;  4QJF A;  3RMH A;  4OHJ A;  3PIO 3;  1C8C A;  1EWI A;  1N9W A;  1SNM A;  1UE7 A;  3HG9 A;  4BY1 G;  1S5C D;  2AQ1 B;  2UXC Q;  3J81 i;  4OO1 H;  2SEB D;  3DLL A;  1FD7 D;  4IUU A;  5FO9 B;  2NVY B;  2VB2 X;  2NVQ H;  2BDO A;  3R3O A;  1M1K C;  4RCO A;  2UU9 Q;  5CC4 A;  2B2T A;  5KGU A;  5KYI A;  2OTJ A;  5IOD A;  3S1R B;  2TSS A;  2Z0S A;  1Y1W H;  4K5W A;  1HA5 A;  1KAB A;  4CHT B;  1A62 A;  3L9A X;  3NBH A;  5CV9 A;  2JA8 G;  4ZYS A;  1EWH A;  1PFS A;  4A3I B;  5KYL A;  1X6O A;  2VS1 A;  2E2I B;  1MIU A;  4L6T B;  3BYT B;  5JEA J;  3KLS A;  2KCM A;  1PTO F;  1Q81 C;  4DV6 L;  3NPP A;  2UXD L;  4X3T A;  2K4K A;  2D5D A;  5C3E H;  4CGY B;  1RKN A;  1EEI D;  3A8K E;  2AQ2 B;  1GHJ A;  5A2Q E;  3A54 A;  3GTO B;  2E2H B;  4DR5 Q;  4CDF C;  5C3X A;  5LMN L;  4LJZ C;  1GJX A;  4CJ0 B;  2ZM6 Q;  2G5D A;  3NEM A;  2F0E A;  5M5Y H;  1N36 Q;  1YJ9 A;  3HRZ C;  2PZW A;  3CCQ A;  4QQB X;  1SYF A;  4OEL B;  3I4O A;  3ONA B;  2A1A A;  5IGG A;  3KF6 A;  1NCV A;  1KAW A;  4DV4 L;  1EQT A;  1SN8 A;  3D8G A;  2EYP A;  4CKE A;  4LFC Q;  4RWS C;  4A75 A;  4QY7 A;  2YU9 B;  1G2T A;  2F0V A;  4POF A;  2JP1 A;  2BH8 A;  3S24 A;  1A3V A;  2AUJ D;  3VYR A;  1VMC A;  2K01 A;  2VNU D;  2OTL A;  2PCF B;  1MBY A;  3T13 A;  3TP8 A;  4NKL A;  1WD0 A;  3PO3 B;  1VQ9 A;  1KL9 A;  2LXK A;  1YNJ D;  1X3P A;  4A3L G;  4FF1 A;  3W2D A;  4YCW A;  5M5Y B;  1EEF D;  2A73 B;  1XMO Q;  2IY5 B;  4WJW A;  1SYC A;  4JI0 Q;  4BXX H;  1N33 Q;  3QR8 A;  1I4Q A;  1EY4 A;  3VR3 A;  1SYG A;  3H94 A;  2KVM A;  1JJG A;  2K5W A;  5IGF A;  1NR4 A;  2XWB B;  4AYB B;  1O80 A;  1P16 A;  3SXH A;  3I4N G;  3S14 B;  1K83 B;  1XNR L;  2KUM A;  3JAM i;  1I4G A;  3EQL C;  5JJK A;  1H9J A;  3J7A V;  1Q82 C;  1XPR A;  1MSH A;  1U0L A;  1G2S A;  2A6H D;  4EX5 A;  4XQN A;  3HOW H;  1N33 L;  1ENF A;  4X65 Q;  1CM9 A;  1HJP A;  3HGB A;  4BS9 A;  4A3M G;  4FVM A;  1ZYR D;  3HOW B;  4DV1 L;  3GTP H;  1VF5 C;  4RKB A;  3T53 B;  3K0X A;  5IGC A;  1C7Y A;  2O2L D;  4A3C H;  4KKS A;  1YVC A;  1B53 A;  2JEB I;  4KY5 A;  4NMZ A;  3NEL A;  4AIM A;  1PYW D;  1PYS B;  1SE2 A;  2NVQ B;  2D62 A;  1M8A A;  3H0G B;  3NTI A;  1X54 A;  2JA7 G;  4NB3 A;  4YY3 Q;  1EZ6 A;  5CBA E;  4IUR A;  2M00 A;  4DR1 Q;  5C3E G;  5KEE A;  2ZTD A;  2XRQ D;  4P74 A;  4DK3 C;  5K5P A;  1RDP D;  4IFD H;  4KLK A;  1O7Z A;  2BH2 A;  1MJC A;  1AEX A;  1B7Y B;  4K2K A;  3GO5 A;  3VA5 A;  4GN5 A;  4RCN A;  3CME A;  2DNC A;  3PO2 H;  1B8A A;  1A2T A;  3C2P A;  2A68 C;  3NSW A;  3HOV G;  1RTN A;  5C4Z A;  2F4V Q;  4UY8 C;  1SJH D;  4O42 A;  1JJC B;  2VQE Q;  3A74 A;  4LFA Q;  4BY7 G;  2B2U C;  5LL6 X;  4A3B H;  3I4M B;  2FMM A;  5C44 B;  3HP3 A;  2WB1 E;  3OW2 A;  3U4V A;  1BCP D;  1CKN A;  1EWC A;  3HS0 C;  1R9T B;  3PCO B;  1QZH A;  3HOY G;  1DD2 A;  4A3C G;  1D5M C;  5A2Q L;  3KYH C;  5CYU A;  2HD3 A;  2K75 A;  4M8A A;  2NVT B;  1WTP A;  4DV5 L;  1ENC A;  3KJO A;  4IPH A;  5HGQ A;  4JI8 L;  4LW1 A;  3I4M G;  2DGY A;  3CXC A;  4EQO A;  4KK7 A;  1VQJ A;  3T16 A;  1E2Z A;  5IE8 A;  3S1M B;  4R4O A;  4EQP A;  2IWH A;  3GTQ B;  4N9T A;  1B4O A;  1EU3 A;  3SHL A;  1DYQ A;  1SYE A;  3S17 H;  1QE6 A;  3DM3 A;  3X3N A;  1SFO B;  1KQS A;  1LT3 D;  2E75 C;  1EYD A;  2CVR A;  4F8M A;  2B2W C;  2B63 G;  4NXM L;  2MHV A;  3QOJ A;  2I5M X;  4G4K A;  1QVG A;  1WD1 A;  2R92 B;  2R93 B;  1VQL A;  1EIF A;  4FYD A;  3H0G G;  5CV4 A;  1EIY B;  2MJ8 A;  3I4L A;  1IYJ B;  5GQO A;  1V1Q A;  4GKJ L;  1MHW C;  1HH2 P;  2CQO A;  3LNN A;  4MTK A;  5EAY A;  4QL5 A;  1SE4 A;  2E2J B;  1NJI C;  4YCU A;  4DR3 Q;  3P75 A;  3TZD A;  3FP9 A;  1JE4 A;  1HTP A;  2XNA C;  5EPJ A;  3AFQ A;  3HOZ G;  2PMZ B;  1C48 A;  2B2W A;  1BO0 A;  2L9H A;  3OSO A;  1WVL A;  2JA6 H;  4HJ7 A;  3FRP B;  4LWC A;  5JJZ A;  1T9H A;  1EUJ A;  4LUZ A;  3NXW A;  4F87 A;  2F0I A;  3FKI G;  1PH7 A;  1K83 H;  2B8F A;  2FHT A;  3NEN A;  3J81 L;  1AZQ A;  5LHY 1;  3MAQ A;  1IL8 A;  1QWY A;  3PUY A;  4BY7 H;  1O7Y A;  2F0H A;  4RGN A;  1B2T A;  1XPU A;  3K7A H;  1Q1E A;  4ABN A;  1OXS C;  4NW2 A;  1Q8K A;  2PO4 A;  3PF4 A;  1HCZ A;  5M3M H;  4YHH Q;  4OO1 I;  1D1I A;  4XXE A;  1HFN A;  3D4R A;  1BR9 A;  1CFM A;  2EPB A;  2K5N A;  1LTL A;  2WFW A;  4H7B A;  2K7V A;  3T51 B;  2F0O A;  4LMQ D;  4QGU A;  1M4V A;  1VQB A;  2L55 A;  4R9W A;  3NBI A;  3A8J E;  3B6Y A;  2CWA A;  1HR0 Q;  3J81 c;  1DJR D;  3PO3 G;  5T1I A;  3NE5 B;  1KRS A;  2B2U A;  5JOB A;  2AWO A;  3MEF A;  4WOR A;  2JA9 A;  3ND9 A;  5EBD A;  5M9O A;  2ICE C;  4HCS A;  5J3B A;  3SE0 A;  1STE A;  2J7Z A;  1JB7 A;  4HN7 A;  1DON A;  2KCC A;  1ML0 D;  1HFG A;  4X62 Q;  5ELB A;  2X6L A;  4LFB L;  2MO0 A;  1IW7 C;  3RLN A;  4HIM A;  1FGU A;  4C3I B;  3JAM c;  3P7J A;  5JPN C;  2K1B A;  1XYI A;  3MXP A;  4NXN Q;  2VUM G;  4X66 L;  3RUZ A;  2F0D A;  1G8Z D;  1SNO A;  4BXX G;  5JVG 3;  3A8I E;  4JVZ A;  4XT1 B;  1OXV A;  4R4Q A;  2NB0 A;  1Y1V H;  3PUV A;  2A69 D;  1YBY A;  3OWF A;  3BDC A;  2AWN A;  3DMU A;  3U58 A;  4DK6 C;  4I7A A;  4IPG A;  4OIK A;  2I5L X;  1PTO D;  1VDZ A;  2A6E D;  2V1C C;  2VL6 A;  2R7F A;  3CHB D;  3S1R H;  4JI4 Q;  3H15 A;  2HQE A;  2FFK B;  4K0K L;  4FF4 A;  3GTM B;  2Z4H A;  2KCT A;  4KI0 A;  3ERS X;  4IPC A;  5IGD A;  2UUA L;  5GAH C;  5M5X H;  1W6J A;  2Z4I A;  5ELN A;  2QEJ C;  1HNZ Q;  2NZH A;  4JI0 L;  4IPD A;  3U9O A;  4B3R L;  1PRT C;  4DR6 Q;  1XTD A;  1KAA A;  4DNT B;  3OMC A;  5J1Z A;  4X3K A;  1K0R A;  2L1B A;  3M4O B;  5IYD H;  1K73 C;  2VY3 A;  1EYA A;  4Y7N B;  1X3E A;  5C6A A;  4X3S A;  1EY0 A;  4FP5 D;  4IZ8 A;  4JI1 L;  1PH4 A;  1QCB D;  2HUG A;  1O78 A;  4A3D H;  3S1M H;  2K03 A;  4GOP C;  5C4J H;  2Y0S B;  1J5E L;  2R93 H;  2KED A;  1F9S A;  2BDN A;  1F2L A;  2NZO A;  3VR6 A;  2ZJR A;  3EVQ A;  2VQF Q;  2CWP A;  2IL8 A;  1EZ8 A;  1HNX L;  1BCP B;  3Q8D A;  2NTT A;  4QF4 A;  4HIK A;  3HOU H;  1MI2 A;  5AFW A;  3HOU G;  2RHS B;  3DWA A;  4FF2 A;  3CD6 A;  1SBB B;  4QMG A;  4XYO A;  4JI2 L;  4BBS G;  2G9H D;  2KA7 A;  4ZUJ A;  1J5E Q;  3HOY H;  2LKV A;  5EKK A;  2K33 A;  1WTO A;  4DAP A;  4OWW B;  1DXM A;  1DZ1 A;  4DPG A;  1YZ6 A;  3G6E A;  1STH A;  2WAQ B;  1EU4 A;  5EGT A;  5DM7 3;  5CBE E;  4E6I A;  3GTK H;  1LTR D;  3KBG A;  4L8J A;  3ULL A;  4X65 L;  1Z47 A;  3L3O C;  3GTJ H;  1JOK A;  3ULP A;  2NN6 H;  3VA7 A;  1PH3 A;  5ELF A;  1VS0 A;  1ICF B;  1YNN D;  1EQV A;  1EY7 A;  1LT5 D;  3RR5 A;  5BN5 A;  5C44 H;  1JOR A;  2F0M A;  3DXJ C;  4MTN A;  4APV A;  4A3K B;  4HTH A;  3MVV A;  5E3F A;  4UP8 A;  1HUN A;  4A3B G;  3T1Y L;  4A76 A;  1JWU D;  1TXY A;  2ALY B;  3URY A;  4B3T Q;  4WJ4 A;  2JA6 B;  4JOI A;  2NTS A;  3W1G A;  1G91 A;  3D31 A;  4OON A;  1RTO A;  1HZ9 A;  4DR7 Q;  1X56 A;  2A69 C;  4ID6 A;  2UUC Q;  1FL0 A;  3MFG A;  2E2J H;  5GAD C;  3BDO A;  3E5S A;  3GP7 A;  2X6G A;  1TWC B;  1FVI A;  2NWG A;  3H0G H;  4QCL A;  5HUR A;  5FOB B;  1JB3 A;  1JC7 A;  2EDG A;  4IUV A;  3CCS A;  1AE3 A;  1KRT A;  1GVP A;  1ENA A;  5EBC A;  1R4P B;  5K36 G;  1J9O A;  4BA1 I;  3QO2 A;  1BBX C;  2FXQ A;  2B3G A;  1XNQ Q;  1B1Z A;  5T1G A;  1Q7Y C;  3CCU A;  2MO1 A;  1S5B D;  2EQS A;  4IOA A;  1AW7 A;  4X6A H;  4IUN A;  3S2H H;  2RCF A;  2N88 A;  1QNU A;  2YTV A;  3FVQ A;  4C3J B;  4BBR G;  2B29 A;  3GTG H;  3U4Z A;  1BBW A;  1XJV A;  1ZXT A;  3HOZ H;  4ZAI A;  4A3G B;  1G29 1;  3NBH B;  1ASY A;  3SVM A;  4XYQ A;  2WAC A;  1E2V A;  3SR1 A;  4C2M H;  3J80 E;  2O5I C;  1JOQ A;  3K0Y A;  4K14 A;  2LY7 A;  4NXN L;  1UWV A;  1AE2 A;  4JI8 Q;  3CAM A;  3K80 C;  2PYK A;  3I56 A;  2GA4 B;  2ICI A;  4N8X 1;  3UE0 A;  2ZJP A;  2N78 A;  3K5N A;  1SSO A;  5IY0 A;  3IKJ A;  4C1N K;  2C5C A;  1I6V C;  1BQQ T;  4HJA A;  2KOL A;  4UHV A;  1DOL A;  2F4I A;  3AB9 A;  4N8F A;  3HZX A;  1J6Q A;  5K36 H;  1CSP A;  4KV6 A;  3E6Z X;  3HKS A;  1CA5 A;  3RN5 A;  4JI5 L;  1WTV A;  2EYL A;  3H91 A;  1UE6 A;  1QUQ B;  3FPU B;  4L5T A;  3DEP A;  2JA7 B;  3T56 B;  1A3U A;  1SEB D;  1GM5 A;  3AEV A;  4GOP A;  3BYY B;  2Z6B A;  2M2L A;  1STN A;  1FNW A;  4DAY A;  4HSV A;  2IW3 A;  2JA6 G;  2WAQ E;  4NP5 A;  4A3I H;  5IIF A;  3H3V H;  1EOV A;  3IRB A;  3WWV A;  2M9V A;  4A4I A;  1GUO A;  3DUZ A;  4LUO A;  5IGB A;  4A3E H;  1B44 D;  4YCV A;  4NPS A;  2A74 C;  1RJT A;  1W3S A;  3I3C A;  1SMY D;  1PTO H;  3KF8 B;  4OWX B;  4KHZ A;  4UP7 A;  3A55 A;  3K5M A;  2WAQ G;  3D6C A;  4LAA A;  1VQG A;  3I91 A;  2HHH Q;  4A3G G;  3LWE A;  2Q2H A;  3KF6 B;  3TME A;  1X32 A;  3J7A F;  4PNY A;  1G6P A;  1H95 A;  2EXZ A;  1I94 Q;  1BKB A;  1A6X A;  2CKZ B;  4R4T A;  2TMP A;  1PRT B;  1F2Z A;  4PV1 C;  1TVX A;  2Z1C A;  5M5X B;  5BN3 A;  4DNI A;  3S15 B;  1K9M C;  1PH6 A;  1SE8 A;  3FPP A;  2EYH A;  2RVL A;  1TWF B;  1Y8N B;  2PQA A;  4BBR H;  3GTL H;  3EN2 A;  1QVC A;  2RCN A;  3ZYY X;  3OOC A;  3GTM H;  1Y8P B;  1V1P B;  4JI4 L;  5GAE C;  4C3H G;  3TP7 A;  5FO7 B;  2XN9 C;  3RD4 A;  2IX0 A;  5G3L D;  4MZ9 A;  5FLX c;  1YNJ C;  1KDA A;  4A3J G;  3LWU A;  2R7Z G;  2CH4 A;  3QIA A;  3HOX G;  3S9W A;  2WP8 J;  3A56 A;  1SFO H;  1E0B A;  2K52 A;  2EYF A;  4K5X A;  3GTK B;  4JV5 Q;  1H9M A;  3ER0 A;  2JEA I;  2WIN B;  4A3F G;  1UUP A;  3KLR A;  2P5Z X;  1WYD A;  3PUZ A;  2V4D A;  2LXJ A;  3D3R A;  3W3A A;  3HOY B;  1TWA H;  1KDB A;  2OXP A;  3I4N B;  1JOO A;  4POG A;  1Z6H A;  1EOT A;  1F9P A;  3QOL A;  1QG7 A;  3MTS A;  5E4X A;  1A0I A;  2NVT H;  2LS0 1;  1EQQ A;  3ND8 A;  3OW7 A;  3F1Z A;  4FXK C;  5C4X B;  4CDE C;  1HQR D;  3GD7 A;  5BR8 L;  2OQK A;  3PQI A;  1I6H H;  1EY6 A;  2RHQ B;  1E2W A;  2QCP X;  1ONL A;  5ELO A;  1PTO C;  1I50 H;  2EJF C;  4O1N A;  3MZ5 A;  4LUV A;  2DJF C;  1PH9 A;  4G7Z C;  4A3B B;  4I65 A;  4DR5 L;  4ZK9 B;  1LO5 D;  3BZD B;  4IUQ A;  4GKK L;  2K05 A;  3K57 A;  4IAL A;  3OWE B;  3RZD H;  2PZT A;  4A3L H;  1Q90 A;  1BBU A;  4DV3 Q;  3TP5 A;  1KIX A;  1D5Z C;  1RIP A;  3A5Z B;  2BA1 A;  2Z9H A;  4UDU C;  3FKI B;  5GAG C;  4J6H A;  3Q24 A;  2D0O A;  1K3R A;  2BE5 C;  5I4D A;  4GNX B;  1S4Z A;  1IKL A;  3SK5 A;  3VR2 A;  1LLR D;  1DGS A;  2JJQ A;  2PQE A;  2BA0 A;  3NP8 A;  2ZM6 L;  1OO9 B;  1U4L A;  4BY7 B;  1TU2 B;  4LF5 Q;  4NDX A;  5IP9 G;  2RSO A;  3G6J B;  2L11 A;  2ATW A;  2UU9 L;  1SRO A;  1HUM A;  2MNA A;  1C0A A;  5CMD A;  4LF8 L;  3R8B A;  1E7Z A;  5M3F G;  1LAB A;  3NQT A;  3HKZ B;  4JI2 Q;  4BY1 B;  1V8Q A;  5BR8 Q;  2R7Z B;  1WCM G;  1LTI D;  4DF7 A;  3ITP A;  2Q8I B;  1GD7 A;  5HY6 A;  4DN4 M;  1X3Q A;  3TS2 A;  2LMC B;  1S72 A;  5NUC A;  1HNX Q;  3PV0 A;  2SNS A;  4H44 C;  3M4P A;  3T1Y Q;  3GDE A;  5COR A;  3UDG A;  1OTC A;  2B39 A;  5I9O A;  3TZU A;  4TKO B;  1KD1 C;  3S2D B;  4OWT B;  1I4H A;  1TS5 A;  4LFC L;  1VQA A;  4EGV A;  4DV4 Q;  5D65 A;  3HKZ E;  1T5X D;  2E74 C;  3J7Y W;  3UE1 A;  3EJI A;  1JWS D;  4KD4 A;  4JG2 A;  1PA6 A;  3GTJ B;  1VQN A;  1TWG H;  3F8T A;  3SK8 A;  5C4X H;  2F3I A;  1LV9 A;  3U50 C;  1TT2 A;  1CTM A;  1N8R C;  5E1F A;  4IJH A;  1LYL A;  1BNZ A;  2YTX A;  4JBJ A;  3TN2 A;  4R4I A;  3CRK C;  4UP9 A;  2PI2 E;  4LF9 Q;  2YU9 H;  3K59 A;  1IYU A;  4ZLT F;  4IJL A;  1QB5 D;  1HHV A;  1HNW L;  1QVF A;  2Q2T A;  2E2D C;  2F0P A;  2O4X A;  5C3W A;  3D6W A;  5I6Y A;  2EY2 A;  2HT1 A;  3E3X A;  4JCV E;  5EPK A;  1O7I A;  4C1N I; 
#chains in the Genus database with same CATH homology
 4JI7 L;  4IPD A;  4B3R L;  3CCR A;  1E22 A;  2R93 G;  4DR6 Q;  1HZA A;  1XTD A;  1IBK L;  4GOP B;  1X55 A;  3UDF A;  4FDB A;  4GLV B;  5IYD H;  1K0R A;  4PMW A;  4O0A A;  1UEB A;  5AJ3 L;  1K73 C;  2VY3 A;  4DAY B;  1CKO A;  4B3T L;  1X3E A;  2E5L Q;  2VW9 A;  2I5H A;  3L0O A;  5C0X G;  1JMC A;  3I4N H;  1IBM L;  4JI1 L;  2VQE L;  1PH4 A;  2E8G A;  2E2H H;  3GTO H;  1L1O B;  5M5W H;  3KDF A;  1OXU A;  1Y1V G;  4ME3 A;  4A3D H;  3S1M H;  3S1N H;  1N32 L;  4GOP C;  2PI2 A;  2ASB A;  5C4J H;  4JBM A;  1J5E L;  1VQ8 A;  2R93 H;  2GVB A;  1OXX K;  2LSS A;  3MXN B;  4QIW E;  4PG3 A;  2NZO A;  2ZJR A;  5JEA G;  1E1T A;  2VQF Q;  1UE5 A;  2CWP A;  3RZO H;  4QJF A;  1E24 A;  1L0W A;  4IOC A;  3Q8D A;  4HIK A;  1HNX L;  1EWI A;  1N9W A;  3CC4 A;  4TQU S;  1I3Q H;  3HOU H;  1QUQ A;  4JI3 Q;  3HOU G;  1UE7 A;  4ALP A;  2RHS B;  1VQE A;  4BY1 G;  1KC8 C;  3CD6 A;  2UXC Q;  4P72 A;  3J81 i;  4JI2 L;  3KJP A;  3CQZ H;  3RNU A;  3DLL A;  4BBS G;  5C0X I;  2MQH A;  1J5E Q;  3HOY H;  2JA7 H;  1HNW Q;  1M90 C;  3ZJY C;  4OWW B;  4JV5 L;  2NVQ H;  2JE6 I;  2IHE A;  4DPG A;  1GKH A;  1YZ6 A;  3G6E A;  1M1K C;  2UU9 Q;  3CP0 A;  2WB1 G;  4LNQ A;  2OTJ A;  4YWK A;  3S15 H;  3GTK H;  1W2B A;  4UPA A;  1Y1W G;  2Z0S A;  2JK8 A;  1Y1W H;  3ULL A;  1A62 A;  2IHF A;  4X65 L;  2JA8 G;  1Z47 A;  3GTJ H;  1PFS A;  1U5K A;  1Z9F A;  4X62 L;  3CPF A;  3ULP A;  1PH3 A;  1X6O A;  4A3D G;  1VS0 A;  4IFD I;  2VS1 A;  4B3R Q;  4DUZ Q;  3FKI H;  1MIU A;  2UXB Q;  5JEA J;  4OX9 L;  3L7Z C;  2F52 A;  2KCM A;  1PH8 A;  3RR5 A;  1VQ7 A;  5C44 H;  4DV6 L;  1Q81 C;  2UXD L;  1SR3 A;  2K4K A;  3PO2 G;  5C3E H;  4MTN A;  1IXR A;  3D0F A;  4APV A;  2PNH A;  3S2D H;  3CMA A;  1CUK A;  4LF8 Q;  3S14 H;  4UP8 A;  4A3B G;  2ZTC A;  1FJG L;  1TWF H;  1D8L A;  3T1Y L;  4DR5 Q;  4A76 A;  1E1O A;  4GLA C;  1TXY A;  2UXC L;  2ALY B;  2NN6 G;  2NVX H;  4LF5 L;  4B3T Q;  1YNX A;  5LMN L;  4WJ4 A;  1VQO A;  4LF6 L;  4JOI A;  2OQ0 A;  4LFB Q;  4JI3 L;  4JBW A;  4BBS H;  2ZTE A;  3W1G A;  2ZM6 Q;  3D31 A;  4RMF A;  1MKH A;  3NEM A;  4OON A;  1YHA A;  1HZ9 A;  4DR7 Q;  5M5Y H;  1N36 Q;  1KHI A;  1L1O C;  1X56 A;  3FHW A;  1YJ9 A;  2L15 A;  3PIO A;  3CCQ A;  1Y14 B;  4QQB X;  3CC7 A;  4DR3 L;  4AQY Q;  2B63 H;  2IT1 A;  1WFQ A;  1FL0 A;  3I4O A;  2UUC Q;  2E2J H;  1OXT A;  2A1A A;  2RF4 A;  3HKZ G;  4EQ5 A;  5GAD C;  1WJJ A;  4B3M L;  3KF6 A;  3TRZ A;  1KAW A;  1E3P A;  2KEN A;  1SN8 A;  4DV4 L;  4A3K G;  3PUW A;  4LFC Q;  3I4M H;  4L5Q A;  5IYC H;  1FVI A;  1VCI A;  3H0G H;  1Q12 A;  2KHJ A;  3JC6 6;  4QY7 A;  3TEH B;  4A75 A;  4POF A;  3H3V I;  2EXD A;  3CCS A;  2BH8 A;  3S24 A;  1AE3 A;  1GO3 E;  4P75 A;  1KRT A;  1GVP A;  1V9P A;  1PYB A;  4KHP L;  5K36 G;  1IBL Q;  2R92 H;  2YYZ A;  4BA1 I;  4JI5 Q;  2OTL A;  5C0X J;  3J7A 5;  2VNU D;  1V43 A;  2FXQ A;  5LMU L;  2B3G A;  1XNQ Q;  1Q7Y C;  1KL9 A;  2LXK A;  1VQ9 A;  3CCU A;  2MO1 A;  1VQ5 A;  4NXM Q;  4A3L G;  5IYB H;  4YCW A;  2EQS A;  2JA5 H;  3M7N A;  3K7U C;  4DR6 L;  4IOA A;  3S2H H;  4X6A H;  3M3Y H;  1CSQ A;  3OYY A;  3CCM A;  5LMU Q;  1XMO Q;  3HOX H;  2IY5 B;  4JI0 Q;  2YTV A;  3EBE A;  1EFW A;  1IBL L;  4BXX H;  4L5R C;  3PUX A;  1N33 Q;  4BBR G;  5IT9 c;  2B29 A;  4JC0 A;  5DLQ E;  1WCM H;  3U4Z A;  3GTG H;  1BBW A;  1XJV A;  3HOZ H;  4LF6 Q;  1JJG A;  1G29 1;  3NBH B;  1ASY A;  4A3F H;  4GKJ Q;  1PHJ A;  3BJU A;  5JJL A;  4GS3 A;  1P16 A;  3I4N G;  4C2M H;  1XNR L;  1LUZ A;  1Q46 A;  1N32 Q;  1HR0 L;  4YY3 L;  3JAM i;  4NXN L;  5JJK A;  1UWV A;  4DAM A;  1NBW A;  3BZK A;  1TWC H;  2N3S A;  4B3M Q;  1AE2 A;  1Q82 C;  2JA5 G;  1X3G A;  2QGQ A;  4JI8 Q;  3M4Q A;  3CCJ A;  3S1Q H;  5IP7 H;  1XPR A;  4PZ7 A;  1U0L A;  3CAM A;  3K80 C;  2E2I H;  4EX5 A;  3I56 A;  2OWO A;  3HOW H;  3UE0 A;  2ZJP A;  2N78 A;  2C35 B;  1N33 L;  4DV5 Q;  2IX1 A;  4X65 Q;  5IY0 A;  3OTO L;  1HJP A;  4HJA A;  2D0P A;  2K14 A;  2H5X A;  1XMO L;  4A3M G;  1EQR A;  1RL2 A;  3E9H A;  4DV1 L;  3GTP H;  4BY1 H;  3K0X A;  1S3O A;  1X3F A;  5GRO A;  2UUA Q;  1C7Y A;  1J6Q A;  1VQH A;  4A3C H;  4JYA L;  1CSP A;  1YVC A;  2N49 A;  4DR2 Q;  2JEB I;  2DUD A;  3HKS A;  3NEL A;  4AIM A;  2QEX A;  1PYS B;  2GN5 A;  4JI5 L;  3RN5 A;  1A63 A;  2D62 A;  3E9I A;  3BZC A;  1UE6 A;  2EIF A;  4X66 Q;  1QZG A;  1QUQ B;  1X54 A;  2JA7 G;  1LM0 A;  4L5T A;  4NB3 A;  4YY3 Q;  4HIO A;  4A3E G;  1PH1 A;  3AQQ A;  1N34 L;  1HZC A;  4DR1 Q;  4DKA C;  1VQI A;  5C3E G;  1PH2 A;  1GM5 A;  4DUY Q;  3AEV A;  4DUZ L;  2VUM H;  4GOP A;  4GLX A;  2ZTD A;  3HOV H;  1IZ6 A;  3AYH B;  4P74 A;  4DK3 C;  3G48 A;  4DV7 Q;  4KLK A;  1X65 A;  4YWL A;  2BH2 A;  4C3H H;  5H1S E;  3RN2 A;  1MJC A;  2WAQ E;  3LGJ A;  1IL2 A;  2JA6 G;  4Y52 H;  4A3I H;  1I94 L;  3SGI A;  3J80 c;  1B7Y B;  5JJI A;  3H3V H;  1EOV A;  3IRB A;  3WWV A;  3GO5 A;  1K8A C;  4GN5 A;  2KHI A;  4A4I A;  1MJE A;  3CME A;  4LUO A;  4A3E H;  4YCV A;  3PO2 H;  1B8A A;  4NPS A;  2K50 A;  3CCV A;  3I2Z A;  1W3S A;  3HOV G;  4PZ8 A;  5M3F H;  3HFZ B;  2F4V Q;  4UY8 C;  3KF8 B;  4OWX B;  1VQ4 A;  1JJC B;  4JI1 Q;  3A74 A;  2VQE Q;  4KHZ A;  4UP7 A;  4LFA Q;  4BY7 G;  4X64 Q;  4A3B H;  1VQC A;  2VZA A;  2WAQ G;  3CCE A;  2WB1 E;  3OW2 A;  3KLW A;  3U4V A;  4DR2 L;  1VQG A;  1CKN A;  1NE3 A;  2HHH Q;  4A3G G;  3TRE A;  2Q2H A;  4OXP A;  3F2D A;  3S16 H;  3KF6 B;  3PCO B;  1QZH A;  1VQ6 A;  3HOY G;  3AFP A;  1G6P A;  2ZJQ A;  4JI6 Q;  4A3C G;  1H95 A;  1I94 Q;  1BKB A;  2Z6K A;  3KYH C;  2CKZ B;  4R4T A;  1G51 A;  2K75 A;  5IWA L;  2Q2I A;  4DV5 L;  1SMX A;  2YTY A;  4TVA B;  2HHH L;  3KJO A;  3M85 A;  4DV3 L;  3M9B A;  4IPH A;  4DNI A;  5HGQ A;  4JI8 L;  3VDY A;  4LW1 A;  3I4M G;  1K9M C;  2DGY A;  1HNZ L;  3CXC A;  1PH6 A;  1SE8 A;  1C0A A;  2PQA A;  4BBR H;  1BVS A;  1VQJ A;  4X64 L;  4DR1 L;  3GTL H;  3EN2 A;  1QVC A;  2RCN A;  1UE1 A;  1N34 Q;  3GTM H;  1JT8 A;  4GNX A;  2F4V L;  5IE8 A;  3CPW A;  4JI4 L;  5IYD G;  2Q2U A;  4IFD G;  4R4O A;  5GAE C;  4OX9 Q;  1B70 B;  5M3M G;  1L1O A;  4A3G H;  3S17 H;  3DM3 A;  2IX0 A;  4JYA Q;  4DV6 Q;  4MZ9 A;  5FLX c;  3T1H L;  2UXD Q;  1XMQ Q;  1YEZ A;  4A3J G;  4YHH L;  3RLF A;  5C4X G;  5IYB G;  1KQS A;  3ICE A;  3J7Z C;  3CC2 A;  3HOW G;  2R7Z G;  4XTC S;  4HID A;  1WI5 A;  3OTO Q;  2OCE A;  1XMQ L;  3HOX G;  2B63 G;  4AYB E;  4NXM L;  2AMC B;  3PO3 H;  2WP8 J;  4P71 A;  3ULJ A;  1YJN A;  1SFO H;  1TWH H;  2R6G A;  4O2D A;  1YI2 A;  2I5M X;  2K52 A;  1SRU A;  4HJ9 A;  2VQF L;  1QVG A;  1PH5 A;  5E7N A;  4LFA L;  4JV5 Q;  4A3M H;  1VQL A;  3ER0 A;  2JEA I;  5FJ8 G;  1EYG A;  1EIF A;  4A3F G;  3H0G G;  1SLJ A;  4R1J A;  1EIY B;  3F2B A;  2R92 G;  1WYD A;  3PUZ A;  1PVO A;  2LXJ A;  1IYJ B;  3PF5 A;  5GQO A;  1V1Q A;  2CFM A;  4GKJ L;  1TWA H;  1HH2 P;  4POG A;  2N8N A;  2CQO A;  3RLO A;  2ID0 A;  5EAY A;  4C3I H;  4QL5 A;  4PZ6 A;  3G4S A;  4DR4 Q;  1WOC A;  2Y0S E;  2ES2 A;  1A0I A;  1NJI C;  4YCU A;  2XGT A;  5IWA Q;  2NVT H;  4DR3 Q;  1EQQ A;  1HZB A;  2UUC L;  3F1Z A;  3FP9 A;  1N36 L;  5FLM H;  3GD7 A;  3UDX A;  2K5H A;  4XIG S;  2OQK A;  5BR8 L;  1R9T H;  1ASZ A;  1I6H H;  2RHQ B;  3CCL A;  3G71 A;  3HOZ G;  3AFQ A;  4A3I G;  5ELO A;  1YHB A;  2JA6 H;  1P8L A;  4DUY L;  1I50 H;  4HJ7 A;  4LUV A;  4LWC A;  1CKM A;  1PH9 A;  3KOJ A;  1T9H A;  1EUJ A;  1NMF A;  4LUZ A;  4DR5 L;  3FKI G;  4AH6 A;  4IO9 A;  3STB C;  1PH7 A;  1FJG Q;  2A19 A;  4YWM A;  1VQP A;  1K83 H;  1XNR Q;  4GKK L;  3NEN A;  3PIP A;  4K0K Q;  3RZD H;  1C9O A;  4P73 A;  4A3L H;  5AJ3 Q;  4LF9 L;  1NY4 A;  1BBU A;  4L5S A;  4DV3 Q;  3PUY A;  4BY7 H;  5IP7 G;  3J80 i;  1KIX A;  1RIP A;  3A5Z B;  2BA1 A;  2JQO A;  2PQA B;  4C3J H;  5GAG C;  4Y7N H;  3J81 j;  3I55 A;  3K7A H;  4DV1 Q;  1S40 A;  2UUB L;  1XPU A;  1Q1E A;  1K3R A;  2D0O A;  3M4O H;  1OXS C;  4GNX B;  4JOI C;  1Q8K A;  5FJ8 H;  4JI6 L;  3PF4 A;  1IBK Q;  1DGS A;  2JJQ A;  2UUB Q;  4WJ3 M;  5M3M H;  4YHH Q;  3T1H Q;  4OO1 I;  2BA0 A;  2ZM6 L;  3EIV A;  3CW2 C;  4GN3 B;  2K5N A;  1LTL A;  1Q1B A;  2WFW A;  1NMG A;  3BU2 A;  4LF5 Q;  4QGU A;  5IP9 G;  1I5F A;  1VQF A;  4H02 A;  2HIX A;  3GTQ H;  4OO1 G;  1VQB A;  2ATW A;  2UU9 L;  1SRO A;  3KFU A;  2YV5 A;  3B6Y A;  2MNA A;  2CWA A;  1HR0 Q;  4A93 H;  4B3S Q;  3J81 c;  1VQM A;  4LF8 L;  4A93 G;  3PO3 G;  3E0E A;  4RG1 A;  4BA2 I;  1JE5 A;  1KRS A;  1E7Z A;  1X9N A;  2AWO A;  3MEF A;  5M3F G;  4HJ8 A;  2R7D A;  2JA9 A;  1VQK A;  4GN4 B;  2AKW B;  1PV4 A;  4JI2 Q;  5J3B A;  5LMN W;  4LF7 Q;  5BR8 Q;  1JJ2 A;  1Q86 C;  2UXB L;  1WCM G;  1JB7 A;  1AH9 A;  3KDF B;  1NTG A;  3K81 C;  1GD7 A;  1XPO A;  5IP9 H;  3L2P A;  5HY6 A;  4X62 Q;  2I0Q A;  4IFD J;  4LF4 L;  3TS2 A;  4DR4 L;  2KBN A;  1YIT A;  1S72 A;  4HJ5 A;  4LFB L;  2MO0 A;  3PV0 A;  4DV2 L;  1HNX Q;  3RLN A;  4HIM A;  1FGU A;  3CF5 A;  3JAM c;  1CKN B;  3F2C A;  2XTI A;  4GKK Q;  3M4P A;  5C44 G;  3T1Y Q;  3GDE A;  3K8A A;  3STB D;  4DV0 L;  4NXN Q;  1L2F A;  2VUM G;  3UDG A;  1OTC A;  4X66 L;  4A3K H;  1YJW A;  2PMZ E;  1KD1 C;  3UDI A;  4OWT B;  4AYB G;  4BXX G;  1KXL A;  4LFC L;  1VQA A;  4DV4 Q;  2JA8 H;  3HKZ E;  4DV2 Q;  1A8V A;  1OXV A;  4DV0 Q;  3PGZ A;  3W1B A;  4R4Q A;  4GNX C;  3UE1 A;  1IBM Q;  2E5L L;  4LF4 Q;  1Y1V H;  2A8V A;  3PUV A;  1K8G A;  1YBY A;  4AQY L;  1HR0 W;  2AHO B;  4MNO A;  4R4C A;  4JG2 A;  2AWN A;  1PA6 A;  2K5V A;  1VQN A;  1TWG H;  4DR7 L;  4DV7 L;  3F8T A;  5C4X H;  3TS0 A;  4A3J H;  3U58 A;  1YIJ A;  2F3I A;  2HQL A;  3U50 C;  4DK6 C;  2QA4 A;  1XNQ L;  2R7Z H;  3W5O A;  1N8R C;  4JI7 Q;  1D7Q A;  4IPG A;  4IJH A;  1LYL A;  2Z6K C;  5LMN Q;  2I5L X;  2YTX A;  4LF7 L;  2VL6 A;  4J15 A;  2V1C C;  1YHQ A;  2R7F A;  5FLM G;  3S1R H;  4B3S L;  4JBJ A;  4JI4 Q;  4R4I A;  4KHP Q;  1VQD A;  2GVA A;  5IYC G;  3H15 A;  4UP9 A;  2PI2 E;  4LF9 Q;  2HIV A;  2CCZ A;  2YU9 H;  4JBK A;  2Y0S G;  4IJL A;  4K0K L;  2NVY H;  1HNW L;  2KCT A;  3A5U A;  3I7F A;  4KI0 A;  3ERS X;  2Q2T A;  4IPC A;  1QVF A;  2NN6 I;  2UUA L;  2HT1 A;  3TQY A;  5GAH C;  5M5X H;  3A0J A;  5ELN A;  1HNZ Q;  2NZH A;  4JCV E;  4JI0 L;  3PSI A;  2MFI A;  1O7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...