1MKHA

C-terminal domain of methionyl-trna synthetase from pyrococcus abyssi
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
106
Chain Sequence
b'MYVKFDDFAKLDLRVGKIIEVKDHPNADKLYVVKVDLGDEVRTLVAGLKKYYKPEELLNRYVVVVANLEPKKLGIGSQGMLLAADDGERVALLMPDKEVKLGAKVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-terminal domain of Methionyl-tRNA synthetase
publication title Structure and function of the C-terminal domain of methionyl-tRNA synthetase
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ligase
total genus 17
structure length 106
sequence length 107
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1mkhA00
3U4ZA 2VQFQ 4IJLA 4A3GH 1K83H 5JEAJ 3M4QA 2Y0SG 5J3BA 4A3KH 1PH3A 4BY1G 3HOVH 5C4XH 4DUZL 3CCUA 3S1MH 4DV4Q 4AQYL 1IXRA 2JA6H 2RCNA 1YIJA 3S16H 2R93G 2KENA 1K3RA 1UE5A 1IYJB 4JBJA 1YI2A 4HIKA 1VCIA 4XTCS 1U5KA 2RF4A 3EIVA 4DR2Q 2V1CC 4LF8Q 4DR4Q 2ZTDA 1SE8A 5DLQE 4DV3Q 2HIXA 2N49A 1GO3E 1UEBA 3PUYA 2ID0A 2UXDQ 4JI3L 4GOPB 1E1TA 4DUYL 1OTCA 2Q2IA 3T1HQ 4X6AH 2R7ZH 3HOZH 5C3EH 4DAMA 3CC4A 1V43A 4DK6C 3Q8DA 1VQHA 1C9OA 3RLFA 4DV7L 4A3JG 2QGQA 1S40A 1N33L 1T9HA 3ER0A 4LFCL 2F4VQ 2JEAI 4GNXC 1UE6A 3CMAA 1WJJA 1XMOL 4O0AA 2UXBQ 3M4PA 3PV0A 1Y1WH 3I7FA 2K5VA 3KJOA 4LF6L 1IBKQ 1L2FA 3K8AA 2H5XA 3H3VH 4A3FH 3OYYA 3CCLA 4GKKQ 2CWAA 3U4VA 1GD7A 1V9PA 3TQYA 2ZM6L 3D0FA 4X62L 4HJ7A 1VQKA 4LFAL 3GD7A 1JMCA 4C3HH 3M4OH 1KC8C 2OTJA 3L0OA 2F3IA 4BBRG 3BJUA 1QVGA 2UU9Q 2ASBA 2RHSB 1EQRA 1VQAA 2B29A 4JOIA 3TEHB 3KDFB 1X55A 4A3CG 2E2IH 1Q12A 5C44G 1NTGA 2I5LX 2UUCL 1VQDA 4MNOA 1OXXK 1SFOH 2JE6I 3FHWA 3KFUA 1J6QA 4P72A 3M7NA 4BXXG 1IBLL 4WJ3M 1X56A 1CKMA 2HHHL 1TWFH 4K0KL 4AYBG 1N32Q 3LGJA 1HZCA 2L15A 1YHQA 1EYGA 1VQ9A 4JI8Q 4LWCA 4A3DG 1LM0A 4GKJL 2VW9A 2UUBQ 4IFDG 4OO1G 1OXVA 3TS0A 5GAEC 2F52A 2PI2A 3B6YA 3ICEA 1EIFA 1M1KC 2AWNA 3G4SA 4BBSG 3STBC 5FLMG 4DV2L 1I6HH 1HNXQ 3L2PA 4A3IH 1XPUA 1RL2A 4QJFA 4R4TA 1ASZA 5IYDH 1TXYA 5E7NA 2WP8J 1Q8KA 4X66L 4JI1Q 1J5EQ 3JAMi 4JI2Q 2CCZA 3KYHC 4OWXB 5JJIA 3RR5A 1FVIA 4YY3Q 3RNUA 1X6OA 1PH8A 1VQ7A 3H0GH 4GN5A 5HGQA 3CCVA 1OXSC 3CCEA 1JJ2A 3GTPH 2ALYB 1KHIA 3HKZG 3K7AH 4DV6Q 1G6PA 3EBEA 4C3JH 3HOUG 3I4NH 4UP8A 1HNZQ 2A1AA 3RLOA 1PFSA 5GAHC 3CCMA 3KF6B 4GNXB 1PH9A 3M85A 2I5MX 3ULLA 1K73C 2AKWB 3UDXA 2IX1A 4Y52H 1XPRA 4HJ5A 4PMWA 3CC7A 4PZ8A 1AE2A 3JC66 4LF4L 1Q7YC 4YWMA 2NVTH 4DR5Q 4YCWA 4BY7H 4JYAQ 1N9WA 3T1YL 4IO9A 3PO2G 3J80c 1NY4A 1ASYA 2VQEQ 3S14H 1HR0Q 2VUMH 1KIXA 2OCEA 4A75A 4B3TL 4DR3L 2JA7H 3BZCA 3E0EA 3S15H 2CKZB 1VQCA 3NEMA 2BA0A 4DUZQ 3I56A 3PCOB 4A3LG 1W2BA 1Z9FA 4POFA 5JEAG 2UXCL 3F1ZA 3CMEA 1Y1VG 1HR0W 4JI7Q 1Q1EA 4L5TA 1JT8A 2WAQE 3AFQA 1QUQB 2B63H 3A5UA 3SGIA 3CCRA 2IT1A 4JI6L 4J15A 3PUZA 4OX9L 3NENA 4LFBQ 4YCUA 3HOXG 4JI4Q 4A3EG 1QZHA 3J7A5 4KLKA 1I94L 1B7YB 5FLXc 4YHHQ 3CC2A 2OQKA 4R1JA 1DGSA 2IHEA 3S2DH 1AE3A 4DV7Q 1XNQL 2UUAL 4C3IH 1SMXA 3IRBA 5FJ8G 1KRTA 4B3MQ 3J81c 4LFCQ 1YJWA 2YU9H 1UWVA 3HOYG 3AQQA 1NMGA 5LMNQ 1N8RC 2JK8A 4R4OA 2ES2A 1PH7A 4B3RL 4DV1L 1JJCB 2D62A 1MJEA 4GLAC 1YBYA 3PIPA 3GTKH 2HIVA 1EOVA 3DLLA 2QA4A 3I4MH 1E3PA 5LMUQ 1E7ZA 3MEFA 1D8LA 3NBHB 1SN8A 2AMCB 1MKHA 2K5NA 1VQJA 3E9HA 3FKIG 4LFAQ 4X62Q 2ZM6Q 5LMNW 2A8VA 2D0OA 1XJVA 4RG1A 4A76A 2HT1A 4A93G 1A8VA 4LUZA 4NPSA 1E24A 4DV5L 2BA1A 2Q2HA 1PH1A 4A3CH 5C44H 2OQ0A 1B8AA 3I2ZA 4QGUA 3GTQH 3TS2A 4POGA 1L1OA 4GN4B 1GM5A 3M9BA 5C0XJ 2JQOA 4ME3A 1I50H 1XMQL 1FL0A 4BXXH 1IBML 4AIMA 2VL6A 2YTYA 1WFQA 4HJ9A 4NXNL 2R7FA 1N36L 1WCMG 2B3GA 1TWGH 1VQEA 2LXKA 1A0IA 2Z0SA 5EAYA 4LF7Q 2I0QA 1VQGA 5IWAQ 1VQFA 3D31A 4A3KG 3HOVG 4GKJQ 2KBNA 1C7YA 1TWHH 4P75A 4XIGS 5IYBG 5C4XG 4DV4L 4JI0Q 2R92H 4EQ5A 3I55A 3CCJA 1JB7A 4LF5L 1YZ6A 3PUVA 4IPHA 5FLMH 4BBSH 3K80C 4A3MH 4DR7Q 1Y14B 4DKAC 4A3BH 2E2JH 5IP7H 1SRUA 4DR2L 1X54A 4DR4L 4X66Q 5IYCH 1CSPA 1MJCA 4DR6Q 2BH2A 3PSIA 4L5RC 1EFWA 3L7ZC 4DNIA 1BBUA 3UDIA 1EUJA 3T1HL 1HJPA 3BU2A 3HKSA 3HOZG 2XTIA 2Q2UA 5C3EG 5K36G 4QL5A 1OXTA 1VQMA 2ATWA 3TRZA 1N34Q 2C35B 4C2MH 4DV0Q 4NXML 2EXDA 3UE0A 3UDGA 2F4VL 3M3YH 4IPGA 1WYDA 1PH5A 1HNWQ 3AEVA 3S17H 4QY7A 2WFWA 1BBWA 1XPOA 1PYBA 5M5XH 2Z6KA 2OTLA 1Y1WG 2K14A 1IBKL 4L5SA 1CKOA 2K50A 2PQAB 4P73A 1PV4A 2N8NA 4JI5Q 3CQZH 1BKBA 4MZ9A 1PVOA 1D7QA 4A3FG 4P71A 1PHJA 1S72A 1VQ4A 4YWLA 4LF4Q 3GO5A 4KHPQ 4NB3A 4IOAA 1L0WA 4X65Q 1KQSA 3HOWH 4B3SL 1VQ6A 2NVXH 3PO3G 3A5ZB 5IT9c 3PF4A 2VZAA 2NVQH 4LUVA 1PH6A 1LUZA 2JJQA 4JV5L 2GVAA 4PG3A 2DGYA 3F8TA 4OONA 3PIOA 4JC0A 3BZKA 2EIFA 4BA1I 1SLJA 1Y1VH 1EQQA 3GTGH 3KOJA 1YEZA 1N32L 2UXCQ 2JA5H 2WAQG 3K7UC 2MNAA 2PI2E 1IL2A 4JI8L 4JOIC 4JI6Q 4R4QA 1CUKA 2HQLA 2CFMA 2UUBL 3HOXH 4OX9Q 5AJ3Q 4A3EH 1FGUA 4LF9Q 3KJPA 1X3EA 4HIMA 2CWPA 4X64L 3RLNA 3A74A 1Z47A 5IY0A 1HNXL 4BY1H 4A3IG 3CD6A 2FXQA 1FJGL 1VQOA 2WB1E 5IP9G 2VS1A 4AQYQ 4JI1L 3CCSA 1HH2P 3ULPA 1J5EL 2R93H 4JI2L 2JA9A 2NN6I 1YVCA 4PZ6A 3CXCA 4LUOA 1YJNA 3S24A 3H0GG 1K8AC 4B3RQ 1X3FA 1IZ6A 1VQLA 3CW2C 4BA2I 4GNXA 3KF6A 1A63A 2GVBA 1X3GA 3AFPA 4JI3Q 1HZ9A 1K8GA 3I4NG 4DUYQ 1PH2A 3H3VI 1YHBA 3FKIH 5BR8Q 2LSSA 1NBWA 5GAGC 4A3JH 4IPDA 2MO0A 1X65A 1N33Q 2XGTA 4DV5Q 2E5LL 1CSQA 5M3FG 1R9TH 4KI0A 4IPCA 4OWTB 1XMOQ 5GQOA 3RZDH 1TWAH 4DR1L 4PZ7A 4LF6Q 3HFZB 1KRSA 4JYAL 4APVA 4A4IA 1S3OA 1IBMQ 2IX0A 4Y7NH 1P8LA 1L1OB 4DPGA 4H02A 3CP0A 1HR0L 4NXNQ 2AWOA 4R4IA 5C0XG 1N36Q 3J81i 2VUMG 4R4CA 2JA7G 3GTMH 1PYSB 3GTOH 1W3SA 4P74A 1LTLA 3K81C 2MFIA 1E1OA 4BBRH 5IYBH 3KLWA 1RIPA 1QUQA 2JA8G 1GKHA 4GLVB 4LF5Q 1VQIA 1CKNA 3W1GA 4JI7L 1YHAA 4OXPA 4HIDA 3FP9A 2UUCQ 1XNRL 2B63G 1EIYB 1P16A 3VDYA 3OTOL 3CCQA 4UPAA 1IBLQ 4JI4L 4LFBL 2HHHQ 3G6EA 5M3MG 4K0KQ 2VY3A 3F2CA 3RZOH 2ZTCA 2R7DA 3PUWA 2BH8A 3ZJYC 4ALPA 1PH4A 2VQFL 2YYZA 4JBMA 4YHHL 4A3DH 4A3GG 1XTDA 1VQPA 1I3QH 2K52A 2Y0SE 4DK3C 3CPFA 3F2DA 3NELA 1KL9A 1G291 1G51A 4TVAB 1VS0A 4HIOA 2NZHA 3J7ZC 2JA6G 1C0AA 2JEBI 1Q46A 1V1QA 2KCMA 2Q2TA 1NJIC 4B3ML 1SROA 4JG2A 4NXMQ 4QQBX 4DV2Q 1UE7A 5LMNL 2KCTA 2DUDA 4UP7A 4GOPA 4LF8L 2PNHA 5HY6A 4DV3L 2MQHA 3U50C 1M90C 2UXDL 4L5QA 5LMUL 3I4MG 3RN2A 2YV5A 3CAMA 5JJLA 5JJKA 1OXUA 2E8GA 4JBKA 4FDBA 1YITA 4GN3B 2ZJPA 2R7ZG 1AH9A 1K0RA 2NN6G 2NZOA 1Q86C 4B3SQ 2IHFA 3STBD 2A19A 3CF5A 3PO3H 3K0XA 2K4KA 1X9NA 3HOUH 2I5HA 2OWOA 1QVCA 3UE1A 4QIWE 4JV5Q 4LW1A 1MIUA 2UXBL 2EQSA 1VQ5A 5C0XI 2N78A 2YTVA 3DM3A 1U0LA 2PMZE 4DAYB 3A0JA 3MXNB 5M5WH 1K9MC 1B70B 4YWKA 3W1BA 4UP9A 3W5OA 4GKKL 4LF7L 1HZAA 5IWAL 4OWWB 3KDFA 4HJAA 2NVYH 3T1YQ 4TQUS 3PO2H 4RMFA 3JAMc 3GDEA 1L1OC 3S1RH 3CPWA 2UU9L 4JI0L 1KAWA 3PF5A 5M5YH 2R6GA 4B3TQ 2R92G 4X64Q 4DR3Q 1WOCA 3F2BA 5H1SE 4DR7L 2RHQB 1SR3A 3E9IA 4A3MG 2AHOB 2GN5A 1FJGQ 4A3BG 1JJGA 2WB1G 5IP9H 5IP7G 3S1QH 4A3LH 2ZJQA 1QVFA 4IJHA 5IYCG 4DR6L 1EWIA 3KF8B 3H15A 4JCVE 4AYBE 4IFDJ 1BVSA 2IY5B 1GVPA 1UE1A 5BR8L 3AYHB 1TWCH 3ERSX 3S1NH 1KD1C 1H95A 3GTLH 2MO1A 2CQOA 3U58A 5GROA 2N3SA 1WI5A 1N34L 2D0PA 4HJ8A 4DV0L 4GOPC 3OW2A 1I94Q 2PQAA 1HNWL 5GADC 2E2HH 1E22A 4IOCA 1YJ9A 5IYDG 5ELOA 5IE8A 5FJ8H 1XNQQ 3RN5A 2UUAQ 1VQ8A 3PGZA 4JI5L 3J80i 3ULJA 1VQBA 5M3FH 1PA6A 3PUXA 3G71A 2E5LQ 3HOYH 3J81j 4YY3L 1Q82C 2ZJRA 1LYLA 4DR1Q 3I4OA 4DV1Q 4KHPL 2LXJA 3GTJH 4X65L 4LNQA 3WWVA 3HOWG 3HKZE 4DV6L 2YTXA 4AH6A 2Z6KC 2KHJA 5ELNA 4JBWA 1I5FA 1HNZL 4UY8C 3EN2A 2QEXA 3S2HH 3UDFA 1NE3A 1NMFA 2K5HA 1KXLA 4A93H 2K75A 1VQNA 2VNUD 4MTNA 1JE5A 2JA8H 4GS3A 1A62A 5C4JH 1QZGA 4YCVA 4IFDI 2KHIA 4OO1I 4O2DA 2ZTEA 4WJ4A 2JA5G 1HZBA 1YNXA 3G48A 4DR5L 1XNRQ 4KHZA 4EX5A 1CKNB 1Q81C 3OTOQ 1XMQQ 4BY7G 1Q1BA 1O7IA 5AJ3L 5M3MH 2VQEL 4GLXA 4LF9L 3TREA 1WCMH
chains in the Genus database with same CATH superfamily
3A8KE 4KD3A 2VQFQ 4IJLA 1J8IA 4A3GH 5JEAJ 1PH3A 3HOVH 3RZDB 3V2TA 3CCUA 2RCNA 2R93G 1GUOA 4QB4A 1HTPA 4HAEA 1J9OA 4JBJA 4OL7A 4HIKA 1IW7C 1U5KA 3EIVA 3GTOB 4DR4Q 2N49A 1GO3E 4LAAA 3PUYA 3I73A 2UXDQ 1OTCA 3I3CA 4OIJA 3CC4A 4DV7L 1C9OA 2QGQA 1N33L 1LACA 1T9HA 4IQZA 1UE6A 5I9OA 2HDMA 2A5HA 3MEHA 3PV0A 1D5MC 2K5VA 2A6EC 3KLSA 3K8AA 2H5XA 3N52A 2Z4HA 4A3FH 1B9MA 2B8GA 2CWAA 2MJ8A 3OMGA 2ZM6L 4KN4C 4X62L 3GD7A 4GZYC 3H09A 2OTJA 2E2JB 4BBRG 1QVGA 2UU9Q 2M2LA 2RHSB 3TSSA 3TEHB 3NPPA 4A3CG 2E2IH 1Q12A 2I5LX 1D1IA 1VQDA 1LTID 1OXXK 1VF5C 3FHWA 1J6QA 4P72A 3LWEA 3HS0C 1IBLL 3SK6A 3Q0AA 4BXXG 1X56A 3HOUB 2XN9C 4H7BA 5IODA 2QEJC 4GKJL 2FFKB 5KYLA 2UUBQ 5GAEC 1EY4A 1MD2D 2ZXOA 5FLMG 4DV2L 1I6HH 1II3A 2FMCA 4A3IH 1HNXQ 4X3KA 4R4TA 3KLSX 4XT3B 2WP8J 2NVYB 3JAMi 4JI2Q 3KYHC 2A6HD 1WVLA 5JJIA 3S1RB 1VQ7A 2PCFB 2J0TD 1A2UA 4HCEA 5CBAE 2A73B 2K01A 1YNND 5JAVA 5A2QE 3A8JE 1HNZQ 1SXTA 1Y1VB 3GTGB 2I5MX 3BYTB 5DNFA 2IX1A 3EROA 3CC7A 3HOXB 2PO4A 4PZ8A 2E74C 2I07B 1AE2A 3D4WA 3JC66 1LT3D 4DR5Q 4YCWA 4ULLA 1D1KA 1RJTA 3PO2G 5DM63 1ILQA 4B3TL 2JA7H 4DR3L 1M8AA 2BOSA 3KF8A 1TS2A 1VQCA 1TS4A 3NEMA 5FKAC 4POFA 5JEAG 4JK1C 3HRZC 1DD2A 1Q3LA 2EDGA 4L5TA 3VYUA 2WAQE 3AFQA 3RMHA 3CCRA 1CA5A 4LFBQ 4A3EG 5HGTA 4N8X1 1HTLD 1LTSD 5G3LF 1MGSA 5C4JB 1R9TB 2OQKA 4R1JA 2IHEA 1AE3A 2F0TA 3NTHA 4O1NA 4IURA 1F2LA 4DV7Q 5FJ8G 1EIGA 1SMXA 2F0OA 4B3MQ 1UWVA 2EYLA 4C1NK 4RWSC 1C4QA 1PFNA 2D62A 4GLAC 3HOVB 1F2MA 1EOVA 2QA4A 1O7YA 5LMUQ 1F9RA 1EU3A 4KKTA 2EYHA 3MEFA 3E9HA 2B2TC 2K5NA 2ZM6Q 2Z1CA 5DEHA 4X62Q 4IUTA 5KRUA 4PMCA 4NPSA 3GV6A 2K32A 1PH1A 4DK1A 4A3CH 3QIAA 4POGA 5E4WC 4GN4B 4IZ8A 3GP7A 1FL0A 1I3QB 4BXXH 2VL6A 5A35A 5I2XA 2YTYA 2KA7A 2B3GA 1TWGH 1VQEA 1A0IA 5T1GA 3AMUA 4KV6A 4GKJQ 2PZUA 1TWHH 5C4XG 4XIGS 4NKLA 2R92H 4QUCA 2X69A 3I55A 2L0CA 5ELEA 1YZ6A 5FLMH 4A3FB 3QR8A 3K80C 3I91A 1SRUA 3UI2A 3ZYYX 1HCZA 5IYCH 1CSPA 2BH2A 3W2DA 3PO3B 1EFWA 3L7ZC 2K04A 2EYPA 4K5XA 2XNAC 3T1HL 1HJPA 2Q2UA 5C3EG 2ATWA 1BXTA 5FO9B 1GHJA 4C2MH 3UE0A 1A6XA 3S17H 4QY7A 2SEBD 2F0NA 1CT1D 5M5XH 4FXGC 3K5MA 2VXWA 5JVG3 1IBKL 2OTLA 4L5SA 1ILPA 1S72A 5LL6X 2VB3X 5M5YB 4Z9CB 2ZXRA 4KHPQ 4IOAA 1L0WA 5JPMC 4A3IB 3HOWH 2NVXH 5IT9c 3S1QB 3PF4A 2NVQH 4LUVA 1Y69U 3R8BA 1U4MA 4FF1A 3I4LA 4JV5L 1IHZA 1H9SA 2ZT9C 5C3XA 3F8TA 3SK8A 4OONA 5J22A 2F03A 1ZKOA 1SLJA 3VYSA 4FF2A 1VMPA 2JA5H 2WAQG 1B44D 2CFMA 2E2HB 4A3EH 5EKIA 3KJPA 2PZTA 5M3FB 3D6CA 4X3TA 3TP8A 1AP0A 3ULPA 4JI1L 5T1IA 1J5EL 3J81L 1JWUD 2ENBA 1CTMA 4PZ6A 1BF4A 4MHEA 2JA7B 1YJNA 1X3FA 1VQLA 4GNXA 1L0XB 3KF6A 4KHVA 3AFPA 4OHJA 1HZ9A 1K8GA 2JA8B 3H3VI 5E4XA 3R3OA 1KNAA 1BUVT 3VA7A 4DA2A 1PTOC 1U4PA 3TP7A 3HZXA 1ICWA 1WTVA 1WTWA 4LF6Q 4OEMB 1VMCA 4JYAL 2NYZD 3M7GA 3SE0A 1HR0L 3TBIB 4XDXA 4DNRB 1LTLA 3LNNA 1QUQA 1XWEA 3J7YW 4GLVB 4JW0A 4CBVA 2A6ED 1ENAA 2B2VA 4HIDA 3FP9A 1SYGA 3S9WA 1P16A 3OTOL 4UPAA 3EQLC 3G6EA 3NQIA 4X3SA 5JPNC 2EXZA 2Q8IB 4KKUA 3VYRA 4ALPA 4YHHL 2DJGC 2K52A 3NELA 1G291 3MTSA 4HIOA 1C0AA 2JEBI 3MZ5A 1V1QA 2KCMA 4KD4A 1NJIC 2KEEA 1U4LA 4N9PA 2B2YA 5EPKA 5LMNL 1DOLA 2PNHA 1CZGA 3U50C 1CQFA 5KNBA 1TWHB 3I4MG 3RN2A 2YV5A 4JBKA 2R92B 5I6WA 4XYOA 3NBIA 1K0RA 1Q86C 2A19A 2WB1B 2NTTA 4XYQA 1PFMA 2B8FA 2XIWA 4JV5Q 1KAAA 5IIFA 2N78A 3DM3A 2PMZE 2NTSA 2EYOA 1X3PA 2C5CA 3A0JA 3MXNB 1GHKA 4HSVA 1LTGD 3X3MA 4GKKL 3ONAB 2OF1A 2EYFA 4KTAA 1HZAA 1ZYRC 5M5XB 2F3WA 3GDEA 1L1OC 3NWSA 3JAMc 4OELB 1V8QA 2LMCB 4QUFA 1ESFA 5EBCA 1H9MA 4B9WA 5H1SE 4DR7L 3E9IA 1SR3A 2EY2A 1SNCA 1A2TA 1SYBA 2AHOB 3NSWA 2ZJQA 3QG1A 1TT2A 3BDOA 3HOWB 4DR6L 3K7AB 4JCVE 5I6YA 4AYBE 2NVXB 4C3JB 1TWCH 2PZWA 1EEID 1H95A 3GTLH 2D0PA 4HJ8A 2EYJA 4PNYA 2JA5B 4KN7C 4BY7B 2UUAQ 1VQ8A 3PGZA 1MI2A 3G71A 4L6TB 1SJED 4M1UB 2F0PA 1LYLA 4DV1Q 2Y0SB 3WDNA 3WWVA 3HKZE 4DV6L 2Z6KC 1R4QB 1I5FA 3F2UA 1ONLA 1HHVA 1IKMA 3EN2A 2QEXA 3S2HH 1NE3A 3U9SA 4A93H 2KEDA 1JE5A 1A62A 5JJZA 4OO1I 4O2DA 1OO9B 4V190 3H6MA 1JORA 1F9SA 1Q81C 5A2QL 3OTOQ 1WTQA 4LF9L 4R9WA 3MHBA 4QIWB 4CKBA 3HGBA 1CZWA 3S1MH 4CDFC 1KTKA 1IXRA 1HFGA 1YIJA 1PFBA 1I4GA 1VCIA 1G8ZD 2V1CC 5C3WA 5DLQE 4KKSA 2ID0A 2G9DA 1SNQA 4JI3L 4C1NI 4Q0FA 4DUYL 3HP3A 1G2TA 3HOZH 5BN5A 4DAMA 3TDQA 4DK6C 1VQHA 2B39A 3J80E 4LFCL 3OIQA 2F4VQ 3BG3A 3DEPA 2JEAI 1JR0D 4O0AA 4TSSA 1Y1WH 3H3VH 5DAUA 1F9QA 3CCLA 4GKKQ 5D3IB 4BBSB 1VQKA 3M4OH 2PPBC 5E1FA 2BDNA 2RSOA 3OPOA 3BJUA 2FINB 1HXYD 4JOIA 2B29A 1BCPF 3KDFB 5C44G 1NTGA 1TY2A 2AQ3B 1QJOA 1UEAB 2JE6I 1QG7A 3M7NA 4WJ3M 4UDUC 1CKMA 2KQ3A 4K0KL 4AYBG 4UAIA 1LT6D 2L15A 2JP1A 4JI8Q 1DOKA 4A3DG 1RODA 1LTAD 3ND8A 4DN4M 2VW9A 5NUCA 5LHY1 4OO1G 3NUCA 1OXVA 3MWYW 4EGVA 1D2BA 1B50A 1EIFA 3K5LA 3CQZB 1PXUA 3STBC 3KUPA 5C5MA 1E2ZA 5FK9C 3RUZA 2CCZA 4C56C 3BVMA 3RR5A 1MBYA 1SE2A 3RNUA 1X6OA 3H0GH 4GN5A 5HGQA 1NR2A 3CCVA 3GTPH 4OGQC 1ET9A 1KNEA 4H0LC 3HKZG 4DV6Q 4IUPA 4K14A 2A69C 4KY7A 4UP8A 2A1AA 1TS5A 1PFSA 1T5EA 4E6IA 3ULLA 1K73C 4Y52H 1XPRA 1TWCB 4XQQA 4HJ5A 1LO5D 5KYIA 3GTLB 4X3UA 1BR9A 2OEOA 3H91A 5KIXA 3T51B 4IUNA 3T1YL 3SEBA 3A55A 3QO2A 4IO9A 1GXDC 1ASYA 1KIXA 2LKVA 1AZPA 2Z6BA 3E0EA 2CKZB 2OT2A 2BA0A 3I56A 4A3LG 1Z9FA 2QDBA 3BYYB 4JI7Q 1Q1EA 1MSGA 3E0JA 1RF2D 4CKCA 4JI6L 5F2DA 3FKIB 4ODGA 2RA4A 3S2HB 4YCUA 1PRTF 4JI4Q 1IL8A 3OIPA 4CDEC 4A93B 1I94L 5FLXc 3S2DH 4CDDC 4C3IH 1KRTA 5CMDA 4LFCQ 2YU9H 1Y8NB 3HOYG 1HQMC 1N8RC 4R4OA 1AEXA 1PH7A 3SK5A 3GTKH 2QCPX 3MVVA 2L5TA 2BE5C 4ABNA 3DLLA 1GUGA 2NWGA 5BR8L 1MKHA 3VYTA 2D0OA 4A76A 2HT1A 4ZK9B 3QJYA 1A8VA 5G3LD 3EA6A 3BDLA 5C44H 4V0BA 3RZOB 5LL6S 2CH4A 5C0XJ 1I50H 1IBML 4AIMA 3HOZB 3IKJA 4HJ9A 4ZYSA 1Z7TA 1WCMG 3Q23A 1UAPA 1VQGA 3T13A 4OO1H 4A3KG 1RDPD 2DJFC 5J39A 1C7YA 4CJ1B 1Y1WB 4DV4L 4JI0Q 4EQ5A 3CCJA 1JB7A 4LF5L 3PUVA 4IPHA 1Y14B 4DKAC 1EY0A 1BOSA 5EBDA 4DR2L 2R61A 3DWPA 3D8GA 5EGTA 3P1HA 1ZYRD 4L5RC 1BBUA 1EUJA 1AN8A 4RKBA 1ZEQX 2TMPA 3TRZA 1OXTA 3QOLA 1N34Q 2C35B 4NXML 1SNMA 3M3YH 1PH5A 3AEVA 1NR4A 4RCNA 1XPOA 2KOLA 1W6KA 5ELFA 1IYVA 4BWGB 5K36H 4JI5Q 1PVOA 4P71A 1PHJA 4FXKC 4X65Q 4C3HG 1SYEA 4DNTB 2NUCA 4NMZA 2JJQA 4PG3A 2CH4W 3H0GB 3FEWX 1Y8PB 3BZKA 3KOJA 1N32L 1IL2A 1AZQA 4JI6Q 4S3SA 4R4QA 3C1EA 1BNZA 1FGUA 4HIMA 3Q22A 3MFYA 1UNSA 3CD6A 1EWHA 1VQOA 2QF7A 2R93H 4N8FA 3CCSA 4M8AA 2JA9A 2MP1A 3I70A 1I4XA 2CW0C 4I65A 1YVCA 1STNA 2ICEC 4LUOA 1A3TA 3A54A 3FRPB 1A63A 2E76C 2CHBD 1I4PA 1XTCD 5ISRA 4J8QA 3I4NG 1ENFA 1PH2A 2WINB 5BR8Q 5IGGA 1STYA 2O5IC 1LTBD 1NBWA 4RAUC 2MO0A 1B3QA 1N33Q 1F77A 4FYDA 5M3MB 4KI0A 4IPCA 1VF7A 5GQOA 1X3QA 1TWAH 4A3GB 3HFZB 1IBMQ 3CRLC 2IX0A 4Y7NH 3S2DB 1P8LA 4DPGA 4H02A 4PQXA 4Q5VA 1G6ZA 5C0XG 2VUMG 4C3IB 1CA6A 4NW2A 3J81i 3D3RA 1EIHA 3K81C 1NSNS 2MFIA 4BBRH 4IUVA 1RIPA 4LF5Q 3W1GA 3GTKB 2F4IA 3TZDA 1YHAA 4J6HA 4OXPA 3KBGA 2B63G 4ZRZA 1IBLQ 3F2CA 2ZTCA 1HFNA 2O2LD 5CV6A 1XTDA 1VQPA 1VS0A 3J7ZC 2JA6G 1Q46A 2K7VA 2M9VA 5FOBB 2Q2TA 4NXMQ 2F0JA 4DV2Q 4HN7A 1EYDA 2KCTA 4GOPA 4HEDA 4ZCKA 2DY8A 4L5QA 1OXUA 2E8GA 2E2IB 4ZUJA 2R7ZG 2L11A 3STBD 3CF5A 2I5HA 1QE6A 3UE1A 3SHLA 3IFTA 1EY7A 1O7LA 1EL0A 5M5WH 1B70B 1H9SB 1PLFA 5EKKA 4U673 1XYIA 3A7AB 4LF7L 5JOBA 3M3YB 4ZKCB 5IWAL 1DXMA 2A69D 1I6HB 4HJAA 4YIJA 3NTIA 3J80L 2JSOA 3PO2H 4RMFA 2F0MA 3CPWA 5L37A 4B3TQ 1E2VA 4DR3Q 2IW3A 3BS1A 4A3MG 1JJGA 4A3BG 1O7ZA 5IP7G 4EQOA 5JEAH 2EJFC 2IY5B 1K3BC 1SNDA 2J4XA 3ERSX 3S1NH 1KD1C 1TS3A 3U58A 2N3SA 4DV0L 3EVQA 2K05A 1HNWL 1PRTB 4HMIA 1DYQA 3A56A 1YJ9A 5ELOA 5IE8A 5FJ8H 3RN5A 2B2TA 3DUZA 2K1BA 3K5OA 3W3AA 4UHVA 5CV9A 4EQPA 3DWAA 1Q82C 3P75A 1FNVA 1CHPD 3I4OA 2LXJA 3GTJH 4OIKA 4K2KA 4IN3A 3GV3A 1SYDA 5C5LA 1TQOA 3SXHA 2KHJA 4K2LA 5ELNA 2R93B 1KDBA 4UY8C 2V4DA 4B9XA 2XRQD 4U68A 4I7ZC 1VQNA 2WKDA 2KHIA 1EY8A 4WJ4A 2BE5D 2WACA 1YNXA 3G48A 4EX5A 2ICIA 1O7IA 5AJ3L 2VQEL 4GLXA 4KJNA 4F7XA 1B2TA 1A3VA 4JPBW 1PMRA 3VR4A 1K83H 1DCZA 3NP8A 3NQTA 3R2IA 5J3BA 2E2DC 2PW7A 4BY1G 5C4XH 4DUZL 1FD7D 5CORA 4AQYL 2JA6H 2K33A 3S16H 4DK0A 5IT9E 1NNXA 5C6AA 1UE5A 4WORA 2RF4A 4TKOB 2H4OA 1STHA 2HIXA 4BBRB 5ELBA 2Q2IA 3E5SA 3Q6SA 3T1HQ 1CI3M 1KDAA 2R7ZH 1NAPA 1R4PB 5C3EH 1ET6A 4A3JG 3Q8DA 3ER0A 3IAYA 3SVMA 3CMAA 1WJJA 1XMOL 1JB3A 2A68C 1TWGB 4MN3A 2K5WA 2N55A 3KJOA 1IBKQ 2HQEA 3NBHA 1KDCA 3MXGA 3OYYA 5COYA 1WTRA 3U4VA 1GD7A 3D0FA 2P5ZX 1JMCA 5EJWA 2K6AA 3OWEB 2F3IA 2HDLA 2ASBA 1VQAA 1EU4A 2UUCL 3TP5A 4XQNA 2F0IA 1WTOA 3BZDB 3MXPA 2L1BA 4EQNA 1PDQA 4DXGA 3KLRA 2HHHL 1TWFH 3LGJA 1HZCA 1EYGA 1VQ9A 3OSOA 4C2MB 1LM0A 1KLGD 3BVZA 3S17B 1Z6HA 1NUCA 2EY5A 3TS0A 2F52A 2PI2A 3B6YA 1B1ZA 1M1KC 2AWNA 5M5WB 3DXJC 4QJFA 1ASZA 5IOCA 5E7NA 1Q8KA 2HCIA 2XRSD 4X66L 4JI1Q 4XXEA 1J5EQ 3DM1A 3PO2B 4OWXB 1BCPD 1FVIA 2NVQB 1SYCA 2F3VA 3NWTA 1OXSC 3CCEA 4P2CB 1HA5A 2ALYB 1KHIA 3DWQA 2B2WC 3EBEA 4MTKA 2B2UC 3HOUG 1AW7A 2CVRA 5GAHC 1PH9A 3M85A 1A15A 3H94A 2CW0D 2E75C 3S1NB 4PMWA 2K28A 3NHHA 2L55A 4A3EB 1FNWA 1GUTA 4CKEA 1GUWA 3AU7A 4LF4L 1Q7YC 4YWMA 1STGA 4JYAQ 2L12A 1F9PA 1N9WA 1RKNA 3J80c 1NY4A 2VQEQ 1HR0Q 4A75A 2H1EA 3BZCA 5JVH3 4H44C 1JOOA 4DUZQ 3MC0B 3PCOB 3GTJB 3L3OC 3CMEA 1Y1VG 2SOBA 1HR0W 2IT1A 1CFMA 2KCNA 2LY7A 1FYCA 3PUZA 2X6LA 2SDFA 3NENA 4OX9L 3HOXG 1QOHA 5CYUA 1QZHA 2QW7A 3CHBD 3OOCA 4YHHQ 1EYAA 1S5DD 2XWJB 4ZQ3A 1XNQL 1RTNA 3JAME 3J81c 1L0YB 1YJWA 2EJMA 1SJHD 3AQQA 5LMNQ 1JWMD 1I4QA 1T5XD 2ES2A 4LJZC 4B3RL 1YBYA 5C4XB 3I4MH 1E3PA 1CM9A 3K58A 2KECA 3S16B 4CJ2C 2AMCB 2PNRC 4RGTA 5LMNW 1XJVA 4RG1A 3CRKC 2IJ0A 1PRTD 2KUMA 4LUZA 3VR6A 4DV5L 1E24A 2Q2HA 2EOTA 2OQ0A 1B8AA 2NZ1D 3I2ZA 4QGUA 3TS2A 1L1OA 3SK4A 5KEEA 1GM5A 3O13A 1XMQL 2KCCA 5C3EB 5CV4A 2KJXA 2DNEA 4DXFA 2R7FA 3D4DA 1C8CA 2EYMA 2IX3A 1CK1A 4PMBA 5EAYA 4DF7A 3D31A 2F0HA 3HOVG 2KBNA 4P75A 3OHXC 1JOKA 4DR7Q 2O5JC 3KK7A 1HA6A 3GQBA 2E2JH 4DR4L 4X66Q 1MJCA 4DR6Q 2JN4A 1B9NA 1O80A 4KMUC 1ESRA 3UDIA 3R2TA 2EJGC 3BU2A 4KK7A 4QL5A 2EXDA 4ZAIA 4IPGA 3LWUA 2WAQB 2WFWA 3E3XA 1PYBA 2Z6KA 2K14A 1CKOA 2PQAB 4FP5D 2N8NA 1PV4A 4MZ9A 2F0WA 4A3FG 4PV1C 3I72A 5DM73 1AFPA 4LF4Q 5KGUA 1U9RA 4K8JA 1QB5D 3PO3G 1EQVA 2N88A 2VZAA 1W6JA 1PH6A 1TKWB 4DAYA 2F0LA 2RDFA 3MXUA 1F2YA 2PYKA 5I2YA 3PIOA 1QWYA 2EIFA 3NK9A 1Y1VH 3GTGH 2Q8TA 2Z8LA 3K7UC 2MNAA 2PI2E 1GUNA 1CUKA 1SSOA 5I9PA 2UUBL 1PZJD 3HOXH 4OX9Q 4LF9Q 1X3EA 2RCFA 1V1PB 4X64L 1PZKD 3RLNA 1Z47A 5IY0A 3L9AX 1HNXL 5J1ZA 4A3IG 1F2ZA 1FJGL 2WB1E 1SMYC 2C9OA 3H3VC 4JI2L 4WJWA 2NN6I 1JICA 2F0FA 3CXCA 2QDLA 4NP5A 1A3UA 1RTOA 3S24A 4B3RQ 1IZ6A 3SR1A 1X3GA 3IFDA 1E0BA 4JI3Q 2F0QA 1WD0A 3SDZA 4DUYQ 2M00A 2LSSA 3BDCA 5CGKA 2EY6A 4K8IA 4IPDA 2XGTA 4DV5Q 2E5LL 1CSQA 3T4AC 5M3FG 1R9TH 4OWTB 5EKLA 2DNCA 4DR1L 4PZ7A 1KRSA 4HSPA 3S1MB 3TP6A 3CP0A 2AWOA 4R4IA 2I46A 2JA7G 3GTMH 1PYSB 1W3SA 1STEA 4QCLA 3T56B 1DONA 3KLWA 3PIO3 2A68D 2JA8G 1GKHA 1CKNA 1JQYD 4FO2A 3I4MB 1EOTA 1XNRL 1EIYB 3VDYA 2XVSA 3CCQA 5TSSA 1BQQT 2MHVA 4LFBL 3ND9A 4K0KQ 4XT1B 4RCOA 2HD3A 2R7DA 3PUWA 2BH8A 1PH4A 4JBMA 2YYZA 1H9JA 4A3DH 1I3QH 4G4KA 1D5ZC 2Y0SE 3ERQA 1KL9A 1Y8OB 4TVAB 2NZHA 3LX0A 4IUUA 4B3ML 3FDTA 4QQBX 1SROA 1SE3A 5IGCA 3A8IE 1G91A 4UP7A 4LF8L 4DV3L 3M4OB 5E3FA 1M90C 3P20A 5LMUL 3CAMA 5JJLA 1H9KA 5JJKA 4FDBA 1NCVA 1PZID 4O42A 4GN3B 2ZJPA 4ME5A 2NN6G 4RHRA 2NZOA 5IT9L 2IHFA 2KVMA 3PO3H 1X9NA 2K4KA 1QVCA 1M4VA 4QIWE 3R93A 3MA2B 5IGEA 4LW1A 1MIUA 5FLXE 2UXBL 1VQ5A 5C0XI 2MPMA 3OW7A 5CV5A 3BVGA 2J7ZA 1HUMA 3URYA 1JCKB 3W1BA 4UP9A 2DN8A 1ZXTA 5D65A 4OWWB 4JVZA 3T1YQ 3I90A 4TQUS 2O4XA 3T16A 1SE4A 1D5XC 3QWNA 3PF5A 5M5YH 2R6GA 2R92G 1EFID 4X64Q 1WOCA 2RHQB 1FJGQ 3GTPB 2WB1G 4K5VA 4A3LH 3S1QH 2QKIC 3P7JA 1QVFA 5IYCG 1EWIA 2FMMA 2QILA 3KF8B 2F0EA 4IFDJ 1BVSA 1GVPA 3AYHB 1PTOF 1BCPC 2D9UA 5BN3A 2MO1A 1BBXC 5ELCA 3TN2A 2RVLA 4GOPC 4TRDA 3OW2A 1I94Q 3EFXD 5GADC 2E2HH 1E22A 3V96A 2KHSA 5IYDG 1FR3A 3T53B 3J80i 3ULJA 1VQBA 5M3FH 2E5LQ 1EEFD 3HOYH 4YY3L 3D4RA 1EZ8A 2ZJRA 2JYOA 4DR1Q 4KHPL 1KABA 2XWBB 3HOWG 1TVXA 4AH6A 1Q90A 2OXPA 2Z4IA 4C3JG 1B53A 4FVMA 1KXLA 1HPCA 3A7LA 3D6WA 2VNUD 1QCBD 2JA8H 2WV6D 1QZGA 4YCVA 4IFDI 5FO8B 2ZTEA 2JA5G 1HZBA 2HUGA 4J1MA 3NXWA 1XNRQ 1O78A 1WTXA 4BY7G 1GJXA 1Q1BA 1S4ZA 3TREA 1WCMH 2G5DA 4KJOA 3U4ZA 2CQAA 1E2WA 2YU9B 3X3NA 3M4QA 2Y0SG 4A3KH 4CDCC 4DV4Q 2PMZB 2KENA 2Q8RE 4DAPA 1ICFB 1K3RA 4HCSA 1IYJB 1LTTD 4KY5A 1YI2A 1SNPA 4XTCS 1WTHA 1BCPB 4DR2Q 4LF8Q 3GTMB 2ZTDA 1SE8A 4DV3Q 1HQRD 1UEBA 1VDZA 3OMCA 1DM0B 4GOPB 1E1TA 5C44B 4X6AH 2NN6H 1JWSD 1V43A 1STBA 3RLFA 1S40A 1I50B 2F0GA 3FPUB 1ML0D 4GNXC 4AYBB 3OWFA 1PRTC 4WRDA 4RHSA 2UXBQ 3M4PA 1FNUA 4LF6L 3I7FA 4A3DB 2PQEA 3DHQA 1L2FA 1YNJC 3I8ZA 2D5DA 1B4OA 1V9PA 3TQYA 4LK1C 4HJ7A 4LFAL 5EPLA 4C3HH 1KC8C 3JAML 4F8MA 1HUNA 3L0OA 2EY1A 1LABA 2D2CC 1EQRA 1X55A 1TR5A 1H9RA 2LFNA 4QF4A 4MNOA 1SFOH 3KFUA 1PTOH 1K0SA 1SYFA 3HKZB 1N32Q 1YHQA 4L63B 1JE4A 4LWCA 2B2VC 4IFDG 1SAPA 5ELDA 3ICEA 3G4SA 5EPJA 4BBSG 2NB0A 3ITPA 3L2PA 1XPUA 1RL2A 4K5WA 2SNMA 1TXYA 5IYDH 4YY3Q 1PH8A 1IYUA 1STAA 2K03A 1JJ2A 2ZXPA 1EY5A 5AFWA 2B2YC 3K7AH 1G6PA 3IL8A 4RGMA 4C3JH 3I4NH 2RKSA 3RLOA 3CCMA 4GNXB 3KF6B 2X6GA 4HR7B 1SMYD 2FHTA 2AKWB 3UDXA 1RCVD 3MAQA 2IL8A 1QNUA 2NVTH 4BY7H 1QNKA 3VR2A 3EJIA 1DOMA 3S14H 5C0XH 2VUMH 3K5NA 4K6DA 5HURA 2OCEA 4IUQA 2BDOA 3HOYB 3S15H 1PYWD 1W2BA 2A74C 4CGYB 2UXCL 3F1ZA 2BCOA 1JT8A 1QUQB 2B63H 3A5UA 3SGIA 4J15A 1G2SA 1U4RA 3J7A5 4KLKA 1B7YB 3CC2A 4LMQD 2HCCA 4CJ0B 1DGSA 1TWAB 1X32A 2UUAL 3IRBA 1IW7D 2MUYA 4RGOS 4Y7NB 1IKLA 1NMGA 1WCMB 4FNFA 2JK8A 3J7AF 5D3DA 1CQVA 2RQXA 3G6JB 1CHQD 4DV1L 1JJCB 1MJEA 4A3KB 3PIPA 1RD9D 2HIVA 1WD1A 1E7ZA 2XSCA 3NTKA 1D8LA 3NBHB 1SN8A 1K9MC 2K5DA 1C48A 1VQJA 3FKIG 4LFAQ 2A8VA 3RD4A 1BO0A 4A93G 4ZUIA 2BA1A 2RDHA 3GTQH 4FXDA 4WFN3 3M9BA 2RBMA 2JQOA 4ME3A 1S5BD 4R8IA 4MIUA 1WFQA 4NXNL 1N36L 4G7ZC 2LXKA 2Z0SA 4LF7Q 2I0QA 5IWAQ 1VQFA 4IFDH 1ENCA 1DZ1A 5IYBG 4EVOA 1GUSA 1RHPA 5D14A 4IALA 4BBSH 3V05A 4A3MH 2F0VA 3HEJA 1B3AA 4A3BH 3K6OA 1EQTA 5IP7H 1X54A 1GOZA 1QILA 4C3HB 2F0SA 3PSIA 1S5CD 3M4YA 3DMUA 4DNIA 2RDGA 3HKSA 3HOZG 2XTIA 1SFOB 1VQMA 1I4RA 5K5PA 1PTOB 4DV0Q 4L8JA 2F4VL 3UDGA 1WYDA 2MGSA 1HNWQ 1BBWA 4F88A 3K0YA 1Y1WG 2K50A 4P73A 3CQZH 1BKBA 3PIP3 1D7QA 4HTHA 2EVBA 1VQ4A 2TSSA 3G7LA 4YWLA 3GO5A 4ID6A 4NB3A 3FMCA 1KQSA 1LTRD 4B3SL 1VQ6A 3A5ZB 1BDOA 1V1OA 1LUZA 4KY6A 2GVAA 1K8OA 1EWCA 2RSNA 3MXNA 5BN4A 2DGYA 2AUKA 2WKCA 4JC0A 3C2PA 4BA1I 1EQQA 2UXCQ 3WOFA 1YEZA 3TMEA 4RA8A 3I4NB 4JI8L 4JOIC 4XQJA 2A6HC 2HQLA 3QOJA 2F0KA 5EQ0A 1KLUD 5AJ3Q 5KNCA 5CBEE 5FLXL 1LT4D 2CWPA 3WOEA 1YNNC 3A74A 1TY0A 3K59A 2EE1A 4BY1H 2FXQA 1LT5D 1UUPA 5IP9G 2VS1A 4RFBA 2NVTB 4AQYQ 1HH2P 1SEBD 1EYCA 2AQ2B 3S14B 2VUMB 4G7OC 3Q24A 2IWHA 3H0GG 1K8AC 4BA2I 3CW2C 3S15B 2GVBA 1SNOA 5I4DA 2EPBA 1YHBA 3FKIH 2L4NA 1K28A 5GAGC 4NDXA 4A3JH 2B63B 1X65A 2F0UA 1XMOQ 5IGDA 1D6EC 3C3LA 3RZDH 1WTPA 3NE5B 1K83B 5C4ZA 1SDFA 4APVA 4A4IA 1S3OA 1TU2B 5M9OA 1L1OB 4NXNQ 2JA6B 2GA4B 1N36Q 4FF3A 4R4CA 3GTOH 4P74A 4K6LA 1E1OA 5IYBH 3MFGA 5FO7B 4DAVA 2F0DA 1VQIA 4JI7L 2UUCQ 3TZUA 1YNJD 2G9HD 3DEOA 3J7AV 2Z9HA 2R7ZB 3CU7A 4RKLA 3PMFA 5IGBA 4JI4L 2HHHQ 5M3MG 3KBXA 2VY3A 3RZOH 1S5FD 3ZJYC 4ZKBB 2VQFL 1EZ6A 4A3GG 2WIIB 3E6ZX 2R3ZA 4DK3C 3F2DA 2EZVA 3CPFA 3GTQB 1G51A 4C3IG 3HG9A 4JG2A 2JXMB 2DY7A 1UE7A 2AQ1B 2AUJD 2B2WA 3VR3A 1HRJA 2B2UA 2DUDA 5HY6A 2MQHA 1MHWC 1DJRD 5CC4A 2UXDL 1TIID 2F1MA 1YITA 4ZLTF 1FGBD 4A3MB 1AH9A 1I6VC 4B3SQ 4A3BB 4DGZA 3K0XA 3HOUH 2OWOA 2NBFA 5CV8A 1TWFB 3N6RA 3QB3A 2EQSA 4FF4A 1XX8A 2YTVA 1U0LA 4DAYB 4RH6A 2PW5A 3VR5A 2LS01 4YWKA 3W5OA 4ILWA 3J81E 4QMGA 2L9HA 3C46A 3KDFA 2NVYH 5CV7A 3VA5A 3S1RH 2UU9L 3U9OA 4JI0L 1KAWA 4HMJA 4DFAA 3F2BA 5KNDA 2GN5A 5IP9H 4IJHA 2K5QA 4RGNA 3H15A 1UE1A 4F87A 2CQOA 5GROA 3C1FA 1WI5A 1N34L 2FJ2A 5C4HA 3CKIB 2PQAA 1LLRD 3FPPA 4I7AA 4IOCA 1JC7A 2VB2X 1XXGA 5CR3A 1XNQQ 1SBBB 4R8NA 5IGFA 4JI5L 5K36G 2IPKD 1PA6A 3PUXA 4G7HC 1JOQA 3J81j 4B08A 4BS9A 4X65L 4BY1B 4LNQA 4CHTB 2YTXA 3FVQA 1K8MA 1Q8IA 3PQIA 1S5ED 4JBWA 4N9TA 1HNZL 1LV9A 3AB9A 4DU9A 1PTOD 1EY6A 3UDFA 1NMFA 2K5HA 2K75A 4H13C 4MTNA 4GS3A 3K57A 5C4JH 4G57A 1EY9A 1MSHA 4DR5L 4KHZA 1CKNB 1I4HA 1V1PA 1XMQQ 2SNSA 5M3MH 4A3JB
chains in the Genus database with same CATH topology
3U4ZA 2VQFQ 4IJLA 4A3GH 1K83H 5JEAJ 3M4QA 2Y0SG 5J3BA 4A3KH 1PH3A 4BY1G 3HOVH 5C4XH 4DUZL 3CCUA 3S1MH 4DV4Q 4AQYL 1IXRA 2JA6H 2RCNA 1YIJA 3S16H 2R93G 2KENA 1K3RA 1UE5A 1IYJB 4JBJA 1YI2A 4HIKA 1VCIA 4XTCS 1U5KA 2RF4A 3EIVA 4DR2Q 2V1CC 4LF8Q 4DR4Q 2ZTDA 1SE8A 5DLQE 4DV3Q 2HIXA 2N49A 1GO3E 1UEBA 3PUYA 2ID0A 2UXDQ 4JI3L 4GOPB 1E1TA 4DUYL 1OTCA 2Q2IA 3T1HQ 4X6AH 2R7ZH 3HOZH 5C3EH 4DAMA 3CC4A 1V43A 4DK6C 3Q8DA 1VQHA 1C9OA 3RLFA 4DV7L 4A3JG 2QGQA 1S40A 1N33L 1T9HA 3ER0A 4LFCL 2F4VQ 2JEAI 4GNXC 1UE6A 3CMAA 1WJJA 1XMOL 4O0AA 2UXBQ 3M4PA 3PV0A 1Y1WH 3I7FA 2K5VA 3KJOA 4LF6L 1IBKQ 1L2FA 3K8AA 2H5XA 3H3VH 4A3FH 3OYYA 3CCLA 4GKKQ 2CWAA 3U4VA 1GD7A 1V9PA 3TQYA 2ZM6L 3D0FA 4X62L 4HJ7A 1VQKA 4LFAL 3GD7A 1JMCA 4C3HH 3M4OH 1KC8C 2OTJA 3L0OA 2F3IA 4BBRG 3BJUA 1QVGA 2UU9Q 2ASBA 2RHSB 1EQRA 1VQAA 2B29A 4JOIA 3TEHB 3KDFB 1X55A 4A3CG 2E2IH 1Q12A 5C44G 1NTGA 2I5LX 2UUCL 1VQDA 4MNOA 1OXXK 1SFOH 2JE6I 3FHWA 3KFUA 1J6QA 4P72A 3M7NA 4BXXG 1IBLL 4WJ3M 1X56A 1CKMA 2HHHL 1TWFH 4K0KL 4AYBG 1N32Q 3LGJA 1HZCA 2L15A 1YHQA 1EYGA 1VQ9A 4JI8Q 4LWCA 4A3DG 1LM0A 4GKJL 2VW9A 2UUBQ 4IFDG 4OO1G 1OXVA 3TS0A 5GAEC 2F52A 2PI2A 3B6YA 3ICEA 1EIFA 1M1KC 2AWNA 3G4SA 4BBSG 3STBC 5FLMG 4DV2L 1I6HH 1HNXQ 3L2PA 4A3IH 1XPUA 1RL2A 4QJFA 4R4TA 1ASZA 5IYDH 1TXYA 5E7NA 2WP8J 1Q8KA 4X66L 4JI1Q 1J5EQ 3JAMi 4JI2Q 2CCZA 3KYHC 4OWXB 5JJIA 3RR5A 1FVIA 4YY3Q 3RNUA 1X6OA 1PH8A 1VQ7A 3H0GH 4GN5A 5HGQA 3CCVA 1OXSC 3CCEA 1JJ2A 3GTPH 2ALYB 1KHIA 3HKZG 3K7AH 4DV6Q 1G6PA 3EBEA 4C3JH 3HOUG 3I4NH 4UP8A 1HNZQ 2A1AA 3RLOA 1PFSA 5GAHC 3CCMA 3KF6B 4GNXB 1PH9A 3M85A 2I5MX 3ULLA 1K73C 2AKWB 3UDXA 2IX1A 4Y52H 1XPRA 4HJ5A 4PMWA 3CC7A 4PZ8A 1AE2A 3JC66 4LF4L 1Q7YC 4YWMA 2NVTH 4DR5Q 4YCWA 4BY7H 4JYAQ 1N9WA 3T1YL 4IO9A 3PO2G 3J80c 1NY4A 1ASYA 2VQEQ 3S14H 1HR0Q 2VUMH 1KIXA 2OCEA 4A75A 4B3TL 4DR3L 2JA7H 3BZCA 3E0EA 3S15H 2CKZB 1VQCA 3NEMA 2BA0A 4DUZQ 3I56A 3PCOB 4A3LG 1W2BA 1Z9FA 4POFA 5JEAG 2UXCL 3F1ZA 3CMEA 1Y1VG 1HR0W 4JI7Q 1Q1EA 4L5TA 1JT8A 2WAQE 3AFQA 1QUQB 2B63H 3A5UA 3SGIA 3CCRA 2IT1A 4JI6L 4J15A 3PUZA 4OX9L 3NENA 4LFBQ 4YCUA 3HOXG 4JI4Q 4A3EG 1QZHA 3J7A5 4KLKA 1I94L 1B7YB 5FLXc 4YHHQ 3CC2A 2OQKA 4R1JA 1DGSA 2IHEA 3S2DH 1AE3A 4DV7Q 1XNQL 2UUAL 4C3IH 1SMXA 3IRBA 5FJ8G 1KRTA 4B3MQ 3J81c 4LFCQ 1YJWA 2YU9H 1UWVA 3HOYG 3AQQA 1NMGA 5LMNQ 1N8RC 2JK8A 4R4OA 2ES2A 1PH7A 4B3RL 4DV1L 1JJCB 2D62A 1MJEA 4GLAC 1YBYA 3PIPA 3GTKH 2HIVA 1EOVA 3DLLA 2QA4A 3I4MH 1E3PA 5LMUQ 1E7ZA 3MEFA 1D8LA 3NBHB 1SN8A 2AMCB 1MKHA 2K5NA 1VQJA 3E9HA 3FKIG 4LFAQ 4X62Q 2ZM6Q 5LMNW 2A8VA 2D0OA 1XJVA 4RG1A 4A76A 2HT1A 4A93G 1A8VA 4LUZA 4NPSA 1E24A 4DV5L 2BA1A 2Q2HA 1PH1A 4A3CH 5C44H 2OQ0A 1B8AA 3I2ZA 4QGUA 3GTQH 3TS2A 4POGA 1L1OA 4GN4B 1GM5A 3M9BA 5C0XJ 2JQOA 4ME3A 1I50H 1XMQL 1FL0A 4BXXH 1IBML 4AIMA 2VL6A 2YTYA 1WFQA 4HJ9A 4NXNL 2R7FA 1N36L 1WCMG 2B3GA 1TWGH 1VQEA 2LXKA 1A0IA 2Z0SA 5EAYA 4LF7Q 2I0QA 1VQGA 5IWAQ 1VQFA 3D31A 4A3KG 3HOVG 4GKJQ 2KBNA 1C7YA 1TWHH 4P75A 4XIGS 5IYBG 5C4XG 4DV4L 4JI0Q 2R92H 4EQ5A 3I55A 3CCJA 1JB7A 4LF5L 1YZ6A 3PUVA 4IPHA 5FLMH 4BBSH 3K80C 4A3MH 4DR7Q 1Y14B 4DKAC 4A3BH 2E2JH 5IP7H 1SRUA 4DR2L 1X54A 4DR4L 4X66Q 5IYCH 1CSPA 1MJCA 4DR6Q 2BH2A 3PSIA 4L5RC 1EFWA 3L7ZC 4DNIA 1BBUA 3UDIA 1EUJA 3T1HL 1HJPA 3BU2A 3HKSA 3HOZG 2XTIA 2Q2UA 5C3EG 5K36G 4QL5A 1OXTA 1VQMA 2ATWA 3TRZA 1N34Q 2C35B 4C2MH 4DV0Q 4NXML 2EXDA 3UE0A 3UDGA 2F4VL 3M3YH 4IPGA 1WYDA 1PH5A 1HNWQ 3AEVA 3S17H 4QY7A 2WFWA 1BBWA 1XPOA 1PYBA 5M5XH 2Z6KA 2OTLA 1Y1WG 2K14A 1IBKL 4L5SA 1CKOA 2K50A 2PQAB 4P73A 1PV4A 2N8NA 4JI5Q 3CQZH 1BKBA 4MZ9A 1PVOA 1D7QA 4A3FG 4P71A 1PHJA 1S72A 1VQ4A 4YWLA 4LF4Q 3GO5A 4KHPQ 4NB3A 4IOAA 1L0WA 4X65Q 1KQSA 3HOWH 4B3SL 1VQ6A 2NVXH 3PO3G 3A5ZB 5IT9c 3PF4A 2VZAA 2NVQH 4LUVA 1PH6A 1LUZA 2JJQA 4JV5L 2GVAA 4PG3A 2DGYA 3F8TA 4OONA 3PIOA 4JC0A 3BZKA 2EIFA 4BA1I 1SLJA 1Y1VH 1EQQA 3GTGH 3KOJA 1YEZA 1N32L 2UXCQ 2JA5H 2WAQG 3K7UC 2MNAA 2PI2E 1IL2A 4JI8L 4JOIC 4JI6Q 4R4QA 1CUKA 2HQLA 2CFMA 2UUBL 3HOXH 4OX9Q 5AJ3Q 4A3EH 1FGUA 4LF9Q 3KJPA 1X3EA 4HIMA 2CWPA 4X64L 3RLNA 3A74A 1Z47A 5IY0A 1HNXL 4BY1H 4A3IG 3CD6A 2FXQA 1FJGL 1VQOA 2WB1E 5IP9G 2VS1A 4AQYQ 4JI1L 3CCSA 1HH2P 3ULPA 1J5EL 2R93H 4JI2L 2JA9A 2NN6I 1YVCA 4PZ6A 3CXCA 4LUOA 1YJNA 3S24A 3H0GG 1K8AC 4B3RQ 1X3FA 1IZ6A 1VQLA 3CW2C 4BA2I 4GNXA 3KF6A 1A63A 2GVBA 1X3GA 3AFPA 4JI3Q 1HZ9A 1K8GA 3I4NG 4DUYQ 1PH2A 3H3VI 1YHBA 3FKIH 5BR8Q 2LSSA 1NBWA 5GAGC 4A3JH 4IPDA 2MO0A 1X65A 1N33Q 2XGTA 4DV5Q 2E5LL 1CSQA 5M3FG 1R9TH 4KI0A 4IPCA 4OWTB 1XMOQ 5GQOA 3RZDH 1TWAH 4DR1L 4PZ7A 4LF6Q 3HFZB 1KRSA 4JYAL 4APVA 4A4IA 1S3OA 1IBMQ 2IX0A 4Y7NH 1P8LA 1L1OB 4DPGA 4H02A 3CP0A 1HR0L 4NXNQ 2AWOA 4R4IA 5C0XG 1N36Q 3J81i 2VUMG 4R4CA 2JA7G 3GTMH 1PYSB 3GTOH 1W3SA 4P74A 1LTLA 3K81C 2MFIA 1E1OA 4BBRH 5IYBH 3KLWA 1RIPA 1QUQA 2JA8G 1GKHA 4GLVB 4LF5Q 1VQIA 1CKNA 3W1GA 4JI7L 1YHAA 4OXPA 4HIDA 3FP9A 2UUCQ 1XNRL 2B63G 1EIYB 1P16A 3VDYA 3OTOL 3CCQA 4UPAA 1IBLQ 4JI4L 4LFBL 2HHHQ 3G6EA 5M3MG 4K0KQ 2VY3A 3F2CA 3RZOH 2ZTCA 2R7DA 3PUWA 2BH8A 3ZJYC 4ALPA 1PH4A 2VQFL 2YYZA 4JBMA 4YHHL 4A3DH 4A3GG 1XTDA 1VQPA 1I3QH 2K52A 2Y0SE 4DK3C 3CPFA 3F2DA 3NELA 1KL9A 1G291 1G51A 4TVAB 1VS0A 4HIOA 2NZHA 3J7ZC 2JA6G 1C0AA 2JEBI 1Q46A 1V1QA 2KCMA 2Q2TA 1NJIC 4B3ML 1SROA 4JG2A 4NXMQ 4QQBX 4DV2Q 1UE7A 5LMNL 2KCTA 2DUDA 4UP7A 4GOPA 4LF8L 2PNHA 5HY6A 4DV3L 2MQHA 3U50C 1M90C 2UXDL 4L5QA 5LMUL 3I4MG 3RN2A 2YV5A 3CAMA 5JJLA 5JJKA 1OXUA 2E8GA 4JBKA 4FDBA 1YITA 4GN3B 2ZJPA 2R7ZG 1AH9A 1K0RA 2NN6G 2NZOA 1Q86C 4B3SQ 2IHFA 3STBD 2A19A 3CF5A 3PO3H 3K0XA 2K4KA 1X9NA 3HOUH 2I5HA 2OWOA 1QVCA 3UE1A 4QIWE 4JV5Q 4LW1A 1MIUA 2UXBL 2EQSA 1VQ5A 5C0XI 2N78A 2YTVA 3DM3A 1U0LA 2PMZE 4DAYB 3A0JA 3MXNB 5M5WH 1K9MC 1B70B 4YWKA 3W1BA 4UP9A 3W5OA 4GKKL 4LF7L 1HZAA 5IWAL 4OWWB 3KDFA 4HJAA 2NVYH 3T1YQ 4TQUS 3PO2H 4RMFA 3JAMc 3GDEA 1L1OC 3S1RH 3CPWA 2UU9L 4JI0L 1KAWA 3PF5A 5M5YH 2R6GA 4B3TQ 2R92G 4X64Q 4DR3Q 1WOCA 3F2BA 5H1SE 4DR7L 2RHQB 1SR3A 3E9IA 4A3MG 2AHOB 2GN5A 1FJGQ 4A3BG 1JJGA 2WB1G 5IP9H 5IP7G 3S1QH 4A3LH 2ZJQA 1QVFA 4IJHA 5IYCG 4DR6L 1EWIA 3KF8B 3H15A 4JCVE 4AYBE 4IFDJ 1BVSA 2IY5B 1GVPA 1UE1A 5BR8L 3AYHB 1TWCH 3ERSX 3S1NH 1KD1C 1H95A 3GTLH 2MO1A 2CQOA 3U58A 5GROA 2N3SA 1WI5A 1N34L 2D0PA 4HJ8A 4DV0L 4GOPC 3OW2A 1I94Q 2PQAA 1HNWL 5GADC 2E2HH 1E22A 4IOCA 1YJ9A 5IYDG 5ELOA 5IE8A 5FJ8H 1XNQQ 3RN5A 2UUAQ 1VQ8A 3PGZA 4JI5L 3J80i 3ULJA 1VQBA 5M3FH 1PA6A 3PUXA 3G71A 2E5LQ 3HOYH 3J81j 4YY3L 1Q82C 2ZJRA 1LYLA 4DR1Q 3I4OA 4DV1Q 4KHPL 2LXJA 3GTJH 4X65L 4LNQA 3WWVA 3HOWG 3HKZE 4DV6L 2YTXA 4AH6A 2Z6KC 2KHJA 5ELNA 4JBWA 1I5FA 1HNZL 4UY8C 3EN2A 2QEXA 3S2HH 3UDFA 1NE3A 1NMFA 2K5HA 1KXLA 4A93H 2K75A 1VQNA 2VNUD 4MTNA 1JE5A 2JA8H 4GS3A 1A62A 5C4JH 1QZGA 4YCVA 4IFDI 2KHIA 4OO1I 4O2DA 2ZTEA 4WJ4A 2JA5G 1HZBA 1YNXA 3G48A 4DR5L 1XNRQ 4KHZA 4EX5A 1CKNB 1Q81C 3OTOQ 1XMQQ 4BY7G 1Q1BA 1O7IA 5AJ3L 5M3MH 2VQEL 4GLXA 4LF9L 3TREA 1WCMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4Z A;  2VQF Q;  4IJL A;  4A3G H;  1K83 H;  5JEA J;  3M4Q A;  2Y0S G;  5J3B A;  4A3K H;  1PH3 A;  4BY1 G;  3HOV H;  5C4X H;  4DUZ L;  3CCU A;  3S1M H;  4DV4 Q;  4AQY L;  1IXR A;  2JA6 H;  2RCN A;  1YIJ A;  3S16 H;  2R93 G;  2KEN A;  1K3R A;  1UE5 A;  1IYJ B;  4JBJ A;  1YI2 A;  4HIK A;  1VCI A;  4XTC S;  1U5K A;  2RF4 A;  3EIV A;  4DR2 Q;  2V1C C;  4LF8 Q;  4DR4 Q;  2ZTD A;  1SE8 A;  5DLQ E;  4DV3 Q;  2HIX A;  2N49 A;  1GO3 E;  1UEB A;  3PUY A;  2ID0 A;  2UXD Q;  4JI3 L;  4GOP B;  1E1T A;  4DUY L;  1OTC A;  2Q2I A;  3T1H Q;  4X6A H;  2R7Z H;  3HOZ H;  5C3E H;  4DAM A;  3CC4 A;  1V43 A;  4DK6 C;  3Q8D A;  1VQH A;  1C9O A;  3RLF A;  4DV7 L;  4A3J G;  2QGQ A;  1S40 A;  1N33 L;  1T9H A;  3ER0 A;  4LFC L;  2F4V Q;  2JEA I;  4GNX C;  1UE6 A;  3CMA A;  1WJJ A;  1XMO L;  4O0A A;  2UXB Q;  3M4P A;  3PV0 A;  1Y1W H;  3I7F A;  2K5V A;  3KJO A;  4LF6 L;  1IBK Q;  1L2F A;  3K8A A;  2H5X A;  3H3V H;  4A3F H;  3OYY A;  3CCL A;  4GKK Q;  2CWA A;  3U4V A;  1GD7 A;  1V9P A;  3TQY A;  2ZM6 L;  3D0F A;  4X62 L;  4HJ7 A;  1VQK A;  4LFA L;  3GD7 A;  1JMC A;  4C3H H;  3M4O H;  1KC8 C;  2OTJ A;  3L0O A;  2F3I A;  4BBR G;  3BJU A;  1QVG A;  2UU9 Q;  2ASB A;  2RHS B;  1EQR A;  1VQA A;  2B29 A;  4JOI A;  3TEH B;  3KDF B;  1X55 A;  4A3C G;  2E2I H;  1Q12 A;  5C44 G;  1NTG A;  2I5L X;  2UUC L;  1VQD A;  4MNO A;  1OXX K;  1SFO H;  2JE6 I;  3FHW A;  3KFU A;  1J6Q A;  4P72 A;  3M7N A;  4BXX G;  1IBL L;  4WJ3 M;  1X56 A;  1CKM A;  2HHH L;  1TWF H;  4K0K L;  4AYB G;  1N32 Q;  3LGJ A;  1HZC A;  2L15 A;  1YHQ A;  1EYG A;  1VQ9 A;  4JI8 Q;  4LWC A;  4A3D G;  1LM0 A;  4GKJ L;  2VW9 A;  2UUB Q;  4IFD G;  4OO1 G;  1OXV A;  3TS0 A;  5GAE C;  2F52 A;  2PI2 A;  3B6Y A;  3ICE A;  1EIF A;  1M1K C;  2AWN A;  3G4S A;  4BBS G;  3STB C;  5FLM G;  4DV2 L;  1I6H H;  1HNX Q;  3L2P A;  4A3I H;  1XPU A;  1RL2 A;  4QJF A;  4R4T A;  1ASZ A;  5IYD H;  1TXY A;  5E7N A;  2WP8 J;  1Q8K A;  4X66 L;  4JI1 Q;  1J5E Q;  3JAM i;  4JI2 Q;  2CCZ A;  3KYH C;  4OWX B;  5JJI A;  3RR5 A;  1FVI A;  4YY3 Q;  3RNU A;  1X6O A;  1PH8 A;  1VQ7 A;  3H0G H;  4GN5 A;  5HGQ A;  3CCV A;  1OXS C;  3CCE A;  1JJ2 A;  3GTP H;  2ALY B;  1KHI A;  3HKZ G;  3K7A H;  4DV6 Q;  1G6P A;  3EBE A;  4C3J H;  3HOU G;  3I4N H;  4UP8 A;  1HNZ Q;  2A1A A;  3RLO A;  1PFS A;  5GAH C;  3CCM A;  3KF6 B;  4GNX B;  1PH9 A;  3M85 A;  2I5M X;  3ULL A;  1K73 C;  2AKW B;  3UDX A;  2IX1 A;  4Y52 H;  1XPR A;  4HJ5 A;  4PMW A;  3CC7 A;  4PZ8 A;  1AE2 A;  3JC6 6;  4LF4 L;  1Q7Y C;  4YWM A;  2NVT H;  4DR5 Q;  4YCW A;  4BY7 H;  4JYA Q;  1N9W A;  3T1Y L;  4IO9 A;  3PO2 G;  3J80 c;  1NY4 A;  1ASY A;  2VQE Q;  3S14 H;  1HR0 Q;  2VUM H;  1KIX A;  2OCE A;  4A75 A;  4B3T L;  4DR3 L;  2JA7 H;  3BZC A;  3E0E A;  3S15 H;  2CKZ B;  1VQC A;  3NEM A;  2BA0 A;  4DUZ Q;  3I56 A;  3PCO B;  4A3L G;  1W2B A;  1Z9F A;  4POF A;  5JEA G;  2UXC L;  3F1Z A;  3CME A;  1Y1V G;  1HR0 W;  4JI7 Q;  1Q1E A;  4L5T A;  1JT8 A;  2WAQ E;  3AFQ A;  1QUQ B;  2B63 H;  3A5U A;  3SGI A;  3CCR A;  2IT1 A;  4JI6 L;  4J15 A;  3PUZ A;  4OX9 L;  3NEN A;  4LFB Q;  4YCU A;  3HOX G;  4JI4 Q;  4A3E G;  1QZH A;  3J7A 5;  4KLK A;  1I94 L;  1B7Y B;  5FLX c;  4YHH Q;  3CC2 A;  2OQK A;  4R1J A;  1DGS A;  2IHE A;  3S2D H;  1AE3 A;  4DV7 Q;  1XNQ L;  2UUA L;  4C3I H;  1SMX A;  3IRB A;  5FJ8 G;  1KRT A;  4B3M Q;  3J81 c;  4LFC Q;  1YJW A;  2YU9 H;  1UWV A;  3HOY G;  3AQQ A;  1NMG A;  5LMN Q;  1N8R C;  2JK8 A;  4R4O A;  2ES2 A;  1PH7 A;  4B3R L;  4DV1 L;  1JJC B;  2D62 A;  1MJE A;  4GLA C;  1YBY A;  3PIP A;  3GTK H;  2HIV A;  1EOV A;  3DLL A;  2QA4 A;  3I4M H;  1E3P A;  5LMU Q;  1E7Z A;  3MEF A;  1D8L A;  3NBH B;  1SN8 A;  2AMC B;  1MKH A;  2K5N A;  1VQJ A;  3E9H A;  3FKI G;  4LFA Q;  4X62 Q;  2ZM6 Q;  5LMN W;  2A8V A;  2D0O A;  1XJV A;  4RG1 A;  4A76 A;  2HT1 A;  4A93 G;  1A8V A;  4LUZ A;  4NPS A;  1E24 A;  4DV5 L;  2BA1 A;  2Q2H A;  1PH1 A;  4A3C H;  5C44 H;  2OQ0 A;  1B8A A;  3I2Z A;  4QGU A;  3GTQ H;  3TS2 A;  4POG A;  1L1O A;  4GN4 B;  1GM5 A;  3M9B A;  5C0X J;  2JQO A;  4ME3 A;  1I50 H;  1XMQ L;  1FL0 A;  4BXX H;  1IBM L;  4AIM A;  2VL6 A;  2YTY A;  1WFQ A;  4HJ9 A;  4NXN L;  2R7F A;  1N36 L;  1WCM G;  2B3G A;  1TWG H;  1VQE A;  2LXK A;  1A0I A;  2Z0S A;  5EAY A;  4LF7 Q;  2I0Q A;  1VQG A;  5IWA Q;  1VQF A;  3D31 A;  4A3K G;  3HOV G;  4GKJ Q;  2KBN A;  1C7Y A;  1TWH H;  4P75 A;  4XIG S;  5IYB G;  5C4X G;  4DV4 L;  4JI0 Q;  2R92 H;  4EQ5 A;  3I55 A;  3CCJ A;  1JB7 A;  4LF5 L;  1YZ6 A;  3PUV A;  4IPH A;  5FLM H;  4BBS H;  3K80 C;  4A3M H;  4DR7 Q;  1Y14 B;  4DKA C;  4A3B H;  2E2J H;  5IP7 H;  1SRU A;  4DR2 L;  1X54 A;  4DR4 L;  4X66 Q;  5IYC H;  1CSP A;  1MJC A;  4DR6 Q;  2BH2 A;  3PSI A;  4L5R C;  1EFW A;  3L7Z C;  4DNI A;  1BBU A;  3UDI A;  1EUJ A;  3T1H L;  1HJP A;  3BU2 A;  3HKS A;  3HOZ G;  2XTI A;  2Q2U A;  5C3E G;  5K36 G;  4QL5 A;  1OXT A;  1VQM A;  2ATW A;  3TRZ A;  1N34 Q;  2C35 B;  4C2M H;  4DV0 Q;  4NXM L;  2EXD A;  3UE0 A;  3UDG A;  2F4V L;  3M3Y H;  4IPG A;  1WYD A;  1PH5 A;  1HNW Q;  3AEV A;  3S17 H;  4QY7 A;  2WFW A;  1BBW A;  1XPO A;  1PYB A;  5M5X H;  2Z6K A;  2OTL A;  1Y1W G;  2K14 A;  1IBK L;  4L5S A;  1CKO A;  2K50 A;  2PQA B;  4P73 A;  1PV4 A;  2N8N A;  4JI5 Q;  3CQZ H;  1BKB A;  4MZ9 A;  1PVO A;  1D7Q A;  4A3F G;  4P71 A;  1PHJ A;  1S72 A;  1VQ4 A;  4YWL A;  4LF4 Q;  3GO5 A;  4KHP Q;  4NB3 A;  4IOA A;  1L0W A;  4X65 Q;  1KQS A;  3HOW H;  4B3S L;  1VQ6 A;  2NVX H;  3PO3 G;  3A5Z B;  5IT9 c;  3PF4 A;  2VZA A;  2NVQ H;  4LUV A;  1PH6 A;  1LUZ A;  2JJQ A;  4JV5 L;  2GVA A;  4PG3 A;  2DGY A;  3F8T A;  4OON A;  3PIO A;  4JC0 A;  3BZK A;  2EIF A;  4BA1 I;  1SLJ A;  1Y1V H;  1EQQ A;  3GTG H;  3KOJ A;  1YEZ A;  1N32 L;  2UXC Q;  2JA5 H;  2WAQ G;  3K7U C;  2MNA A;  2PI2 E;  1IL2 A;  4JI8 L;  4JOI C;  4JI6 Q;  4R4Q A;  1CUK A;  2HQL A;  2CFM A;  2UUB L;  3HOX H;  4OX9 Q;  5AJ3 Q;  4A3E H;  1FGU A;  4LF9 Q;  3KJP A;  1X3E A;  4HIM A;  2CWP A;  4X64 L;  3RLN A;  3A74 A;  1Z47 A;  5IY0 A;  1HNX L;  4BY1 H;  4A3I G;  3CD6 A;  2FXQ A;  1FJG L;  1VQO A;  2WB1 E;  5IP9 G;  2VS1 A;  4AQY Q;  4JI1 L;  3CCS A;  1HH2 P;  3ULP A;  1J5E L;  2R93 H;  4JI2 L;  2JA9 A;  2NN6 I;  1YVC A;  4PZ6 A;  3CXC A;  4LUO A;  1YJN A;  3S24 A;  3H0G G;  1K8A C;  4B3R Q;  1X3F A;  1IZ6 A;  1VQL A;  3CW2 C;  4BA2 I;  4GNX A;  3KF6 A;  1A63 A;  2GVB A;  1X3G A;  3AFP A;  4JI3 Q;  1HZ9 A;  1K8G A;  3I4N G;  4DUY Q;  1PH2 A;  3H3V I;  1YHB A;  3FKI H;  5BR8 Q;  2LSS A;  1NBW A;  5GAG C;  4A3J H;  4IPD A;  2MO0 A;  1X65 A;  1N33 Q;  2XGT A;  4DV5 Q;  2E5L L;  1CSQ A;  5M3F G;  1R9T H;  4KI0 A;  4IPC A;  4OWT B;  1XMO Q;  5GQO A;  3RZD H;  1TWA H;  4DR1 L;  4PZ7 A;  4LF6 Q;  3HFZ B;  1KRS A;  4JYA L;  4APV A;  4A4I A;  1S3O A;  1IBM Q;  2IX0 A;  4Y7N H;  1P8L A;  1L1O B;  4DPG A;  4H02 A;  3CP0 A;  1HR0 L;  4NXN Q;  2AWO A;  4R4I A;  5C0X G;  1N36 Q;  3J81 i;  2VUM G;  4R4C A;  2JA7 G;  3GTM H;  1PYS B;  3GTO H;  1W3S A;  4P74 A;  1LTL A;  3K81 C;  2MFI A;  1E1O A;  4BBR H;  5IYB H;  3KLW A;  1RIP A;  1QUQ A;  2JA8 G;  1GKH A;  4GLV B;  4LF5 Q;  1VQI A;  1CKN A;  3W1G A;  4JI7 L;  1YHA A;  4OXP A;  4HID A;  3FP9 A;  2UUC Q;  1XNR L;  2B63 G;  1EIY B;  1P16 A;  3VDY A;  3OTO L;  3CCQ A;  4UPA A;  1IBL Q;  4JI4 L;  4LFB L;  2HHH Q;  3G6E A;  5M3M G;  4K0K Q;  2VY3 A;  3F2C A;  3RZO H;  2ZTC A;  2R7D A;  3PUW A;  2BH8 A;  3ZJY C;  4ALP A;  1PH4 A;  2VQF L;  2YYZ A;  4JBM A;  4YHH L;  4A3D H;  4A3G G;  1XTD A;  1VQP A;  1I3Q H;  2K52 A;  2Y0S E;  4DK3 C;  3CPF A;  3F2D A;  3NEL A;  1KL9 A;  1G29 1;  1G51 A;  4TVA B;  1VS0 A;  4HIO A;  2NZH A;  3J7Z C;  2JA6 G;  1C0A A;  2JEB I;  1Q46 A;  1V1Q A;  2KCM A;  2Q2T A;  1NJI C;  4B3M L;  1SRO A;  4JG2 A;  4NXM Q;  4QQB X;  4DV2 Q;  1UE7 A;  5LMN L;  2KCT A;  2DUD A;  4UP7 A;  4GOP A;  4LF8 L;  2PNH A;  5HY6 A;  4DV3 L;  2MQH A;  3U50 C;  1M90 C;  2UXD L;  4L5Q A;  5LMU L;  3I4M G;  3RN2 A;  2YV5 A;  3CAM A;  5JJL A;  5JJK A;  1OXU A;  2E8G A;  4JBK A;  4FDB A;  1YIT A;  4GN3 B;  2ZJP A;  2R7Z G;  1AH9 A;  1K0R A;  2NN6 G;  2NZO A;  1Q86 C;  4B3S Q;  2IHF A;  3STB D;  2A19 A;  3CF5 A;  3PO3 H;  3K0X A;  2K4K A;  1X9N A;  3HOU H;  2I5H A;  2OWO A;  1QVC A;  3UE1 A;  4QIW E;  4JV5 Q;  4LW1 A;  1MIU A;  2UXB L;  2EQS A;  1VQ5 A;  5C0X I;  2N78 A;  2YTV A;  3DM3 A;  1U0L A;  2PMZ E;  4DAY B;  3A0J A;  3MXN B;  5M5W H;  1K9M C;  1B70 B;  4YWK A;  3W1B A;  4UP9 A;  3W5O A;  4GKK L;  4LF7 L;  1HZA A;  5IWA L;  4OWW B;  3KDF A;  4HJA A;  2NVY H;  3T1Y Q;  4TQU S;  3PO2 H;  4RMF A;  3JAM c;  3GDE A;  1L1O C;  3S1R H;  3CPW A;  2UU9 L;  4JI0 L;  1KAW A;  3PF5 A;  5M5Y H;  2R6G A;  4B3T Q;  2R92 G;  4X64 Q;  4DR3 Q;  1WOC A;  3F2B A;  5H1S E;  4DR7 L;  2RHQ B;  1SR3 A;  3E9I A;  4A3M G;  2AHO B;  2GN5 A;  1FJG Q;  4A3B G;  1JJG A;  2WB1 G;  5IP9 H;  5IP7 G;  3S1Q H;  4A3L H;  2ZJQ A;  1QVF A;  4IJH A;  5IYC G;  4DR6 L;  1EWI A;  3KF8 B;  3H15 A;  4JCV E;  4AYB E;  4IFD J;  1BVS A;  2IY5 B;  1GVP A;  1UE1 A;  5BR8 L;  3AYH B;  1TWC H;  3ERS X;  3S1N H;  1KD1 C;  1H95 A;  3GTL H;  2MO1 A;  2CQO A;  3U58 A;  5GRO A;  2N3S A;  1WI5 A;  1N34 L;  2D0P A;  4HJ8 A;  4DV0 L;  4GOP C;  3OW2 A;  1I94 Q;  2PQA A;  1HNW L;  5GAD C;  2E2H H;  1E22 A;  4IOC A;  1YJ9 A;  5IYD G;  5ELO A;  5IE8 A;  5FJ8 H;  1XNQ Q;  3RN5 A;  2UUA Q;  1VQ8 A;  3PGZ A;  4JI5 L;  3J80 i;  3ULJ A;  1VQB A;  5M3F H;  1PA6 A;  3PUX A;  3G71 A;  2E5L Q;  3HOY H;  3J81 j;  4YY3 L;  1Q82 C;  2ZJR A;  1LYL A;  4DR1 Q;  3I4O A;  4DV1 Q;  4KHP L;  2LXJ A;  3GTJ H;  4X65 L;  4LNQ A;  3WWV A;  3HOW G;  3HKZ E;  4DV6 L;  2YTX A;  4AH6 A;  2Z6K C;  2KHJ A;  5ELN A;  4JBW A;  1I5F A;  1HNZ L;  4UY8 C;  3EN2 A;  2QEX A;  3S2H H;  3UDF A;  1NE3 A;  1NMF A;  2K5H A;  1KXL A;  4A93 H;  2K75 A;  1VQN A;  2VNU D;  4MTN A;  1JE5 A;  2JA8 H;  4GS3 A;  1A62 A;  5C4J H;  1QZG A;  4YCV A;  4IFD I;  2KHI A;  4OO1 I;  4O2D A;  2ZTE A;  4WJ4 A;  2JA5 G;  1HZB A;  1YNX A;  3G48 A;  4DR5 L;  1XNR Q;  4KHZ A;  4EX5 A;  1CKN B;  1Q81 C;  3OTO Q;  1XMQ Q;  4BY7 G;  1Q1B A;  1O7I A;  5AJ3 L;  5M3M H;  2VQE L;  4GLX A;  4LF9 L;  3TRE A;  1WCM H; 
#chains in the Genus database with same CATH topology
 3A8K E;  4KD3 A;  2VQF Q;  4IJL A;  1J8I A;  4A3G H;  5JEA J;  1PH3 A;  3HOV H;  3RZD B;  3V2T A;  3CCU A;  2RCN A;  2R93 G;  1GUO A;  4QB4 A;  1HTP A;  4HAE A;  1J9O A;  4JBJ A;  4OL7 A;  4HIK A;  1IW7 C;  1U5K A;  3EIV A;  3GTO B;  4DR4 Q;  2N49 A;  1GO3 E;  4LAA A;  3PUY A;  3I73 A;  2UXD Q;  1OTC A;  3I3C A;  4OIJ A;  3CC4 A;  4DV7 L;  1C9O A;  2QGQ A;  1N33 L;  1LAC A;  1T9H A;  4IQZ A;  1UE6 A;  5I9O A;  2HDM A;  2A5H A;  3MEH A;  3PV0 A;  1D5M C;  2K5V A;  2A6E C;  3KLS A;  3K8A A;  2H5X A;  3N52 A;  2Z4H A;  4A3F H;  1B9M A;  2B8G A;  2CWA A;  2MJ8 A;  3OMG A;  2ZM6 L;  4KN4 C;  4X62 L;  3GD7 A;  4GZY C;  3H09 A;  2OTJ A;  2E2J B;  4BBR G;  1QVG A;  2UU9 Q;  2M2L A;  2RHS B;  3TSS A;  3TEH B;  3NPP A;  4A3C G;  2E2I H;  1Q12 A;  2I5L X;  1D1I A;  1VQD A;  1LTI D;  1OXX K;  1VF5 C;  3FHW A;  1J6Q A;  4P72 A;  3LWE A;  3HS0 C;  1IBL L;  3SK6 A;  3Q0A A;  4BXX G;  1X56 A;  3HOU B;  2XN9 C;  4H7B A;  5IOD A;  2QEJ C;  4GKJ L;  2FFK B;  5KYL A;  2UUB Q;  5GAE C;  1EY4 A;  1MD2 D;  2ZXO A;  5FLM G;  4DV2 L;  1I6H H;  1II3 A;  2FMC A;  4A3I H;  1HNX Q;  4X3K A;  4R4T A;  3KLS X;  4XT3 B;  2WP8 J;  2NVY B;  3JAM i;  4JI2 Q;  3KYH C;  2A6H D;  1WVL A;  5JJI A;  3S1R B;  1VQ7 A;  2PCF B;  2J0T D;  1A2U A;  4HCE A;  5CBA E;  2A73 B;  2K01 A;  1YNN D;  5JAV A;  5A2Q E;  3A8J E;  1HNZ Q;  1SXT A;  1Y1V B;  3GTG B;  2I5M X;  3BYT B;  5DNF A;  2IX1 A;  3ERO A;  3CC7 A;  3HOX B;  2PO4 A;  4PZ8 A;  2E74 C;  2I07 B;  1AE2 A;  3D4W A;  3JC6 6;  1LT3 D;  4DR5 Q;  4YCW A;  4ULL A;  1D1K A;  1RJT A;  3PO2 G;  5DM6 3;  1ILQ A;  4B3T L;  2JA7 H;  4DR3 L;  1M8A A;  2BOS A;  3KF8 A;  1TS2 A;  1VQC A;  1TS4 A;  3NEM A;  5FKA C;  4POF A;  5JEA G;  4JK1 C;  3HRZ C;  1DD2 A;  1Q3L A;  2EDG A;  4L5T A;  3VYU A;  2WAQ E;  3AFQ A;  3RMH A;  3CCR A;  1CA5 A;  4LFB Q;  4A3E G;  5HGT A;  4N8X 1;  1HTL D;  1LTS D;  5G3L F;  1MGS A;  5C4J B;  1R9T B;  2OQK A;  4R1J A;  2IHE A;  1AE3 A;  2F0T A;  3NTH A;  4O1N A;  4IUR A;  1F2L A;  4DV7 Q;  5FJ8 G;  1EIG A;  1SMX A;  2F0O A;  4B3M Q;  1UWV A;  2EYL A;  4C1N K;  4RWS C;  1C4Q A;  1PFN A;  2D62 A;  4GLA C;  3HOV B;  1F2M A;  1EOV A;  2QA4 A;  1O7Y A;  5LMU Q;  1F9R A;  1EU3 A;  4KKT A;  2EYH A;  3MEF A;  3E9H A;  2B2T C;  2K5N A;  2ZM6 Q;  2Z1C A;  5DEH A;  4X62 Q;  4IUT A;  5KRU A;  4PMC A;  4NPS A;  3GV6 A;  2K32 A;  1PH1 A;  4DK1 A;  4A3C H;  3QIA A;  4POG A;  5E4W C;  4GN4 B;  4IZ8 A;  3GP7 A;  1FL0 A;  1I3Q B;  4BXX H;  2VL6 A;  5A35 A;  5I2X A;  2YTY A;  2KA7 A;  2B3G A;  1TWG H;  1VQE A;  1A0I A;  5T1G A;  3AMU A;  4KV6 A;  4GKJ Q;  2PZU A;  1TWH H;  5C4X G;  4XIG S;  4NKL A;  2R92 H;  4QUC A;  2X69 A;  3I55 A;  2L0C A;  5ELE A;  1YZ6 A;  5FLM H;  4A3F B;  3QR8 A;  3K80 C;  3I91 A;  1SRU A;  3UI2 A;  3ZYY X;  1HCZ A;  5IYC H;  1CSP A;  2BH2 A;  3W2D A;  3PO3 B;  1EFW A;  3L7Z C;  2K04 A;  2EYP A;  4K5X A;  2XNA C;  3T1H L;  1HJP A;  2Q2U A;  5C3E G;  2ATW A;  1BXT A;  5FO9 B;  1GHJ A;  4C2M H;  3UE0 A;  1A6X A;  3S17 H;  4QY7 A;  2SEB D;  2F0N A;  1CT1 D;  5M5X H;  4FXG C;  3K5M A;  2VXW A;  5JVG 3;  1IBK L;  2OTL A;  4L5S A;  1ILP A;  1S72 A;  5LL6 X;  2VB3 X;  5M5Y B;  4Z9C B;  2ZXR A;  4KHP Q;  4IOA A;  1L0W A;  5JPM C;  4A3I B;  3HOW H;  2NVX H;  5IT9 c;  3S1Q B;  3PF4 A;  2NVQ H;  4LUV A;  1Y69 U;  3R8B A;  1U4M A;  4FF1 A;  3I4L A;  4JV5 L;  1IHZ A;  1H9S A;  2ZT9 C;  5C3X A;  3F8T A;  3SK8 A;  4OON A;  5J22 A;  2F03 A;  1ZKO A;  1SLJ A;  3VYS A;  4FF2 A;  1VMP A;  2JA5 H;  2WAQ G;  1B44 D;  2CFM A;  2E2H B;  4A3E H;  5EKI A;  3KJP A;  2PZT A;  5M3F B;  3D6C A;  4X3T A;  3TP8 A;  1AP0 A;  3ULP A;  4JI1 L;  5T1I A;  1J5E L;  3J81 L;  1JWU D;  2ENB A;  1CTM A;  4PZ6 A;  1BF4 A;  4MHE A;  2JA7 B;  1YJN A;  1X3F A;  1VQL A;  4GNX A;  1L0X B;  3KF6 A;  4KHV A;  3AFP A;  4OHJ A;  1HZ9 A;  1K8G A;  2JA8 B;  3H3V I;  5E4X A;  3R3O A;  1KNA A;  1BUV T;  3VA7 A;  4DA2 A;  1PTO C;  1U4P A;  3TP7 A;  3HZX A;  1ICW A;  1WTV A;  1WTW A;  4LF6 Q;  4OEM B;  1VMC A;  4JYA L;  2NYZ D;  3M7G A;  3SE0 A;  1HR0 L;  3TBI B;  4XDX A;  4DNR B;  1LTL A;  3LNN A;  1QUQ A;  1XWE A;  3J7Y W;  4GLV B;  4JW0 A;  4CBV A;  2A6E D;  1ENA A;  2B2V A;  4HID A;  3FP9 A;  1SYG A;  3S9W A;  1P16 A;  3OTO L;  4UPA A;  3EQL C;  3G6E A;  3NQI A;  4X3S A;  5JPN C;  2EXZ A;  2Q8I B;  4KKU A;  3VYR A;  4ALP A;  4YHH L;  2DJG C;  2K52 A;  3NEL A;  1G29 1;  3MTS A;  4HIO A;  1C0A A;  2JEB I;  3MZ5 A;  1V1Q A;  2KCM A;  4KD4 A;  1NJI C;  2KEE A;  1U4L A;  4N9P A;  2B2Y A;  5EPK A;  5LMN L;  1DOL A;  2PNH A;  1CZG A;  3U50 C;  1CQF A;  5KNB A;  1TWH B;  3I4M G;  3RN2 A;  2YV5 A;  4JBK A;  2R92 B;  5I6W A;  4XYO A;  3NBI A;  1K0R A;  1Q86 C;  2A19 A;  2WB1 B;  2NTT A;  4XYQ A;  1PFM A;  2B8F A;  2XIW A;  4JV5 Q;  1KAA A;  5IIF A;  2N78 A;  3DM3 A;  2PMZ E;  2NTS A;  2EYO A;  1X3P A;  2C5C A;  3A0J A;  3MXN B;  1GHK A;  4HSV A;  1LTG D;  3X3M A;  4GKK L;  3ONA B;  2OF1 A;  2EYF A;  4KTA A;  1HZA A;  1ZYR C;  5M5X B;  2F3W A;  3GDE A;  1L1O C;  3NWS A;  3JAM c;  4OEL B;  1V8Q A;  2LMC B;  4QUF A;  1ESF A;  5EBC A;  1H9M A;  4B9W A;  5H1S E;  4DR7 L;  3E9I A;  1SR3 A;  2EY2 A;  1SNC A;  1A2T A;  1SYB A;  2AHO B;  3NSW A;  2ZJQ A;  3QG1 A;  1TT2 A;  3BDO A;  3HOW B;  4DR6 L;  3K7A B;  4JCV E;  5I6Y A;  4AYB E;  2NVX B;  4C3J B;  1TWC H;  2PZW A;  1EEI D;  1H95 A;  3GTL H;  2D0P A;  4HJ8 A;  2EYJ A;  4PNY A;  2JA5 B;  4KN7 C;  4BY7 B;  2UUA Q;  1VQ8 A;  3PGZ A;  1MI2 A;  3G71 A;  4L6T B;  1SJE D;  4M1U B;  2F0P A;  1LYL A;  4DV1 Q;  2Y0S B;  3WDN A;  3WWV A;  3HKZ E;  4DV6 L;  2Z6K C;  1R4Q B;  1I5F A;  3F2U A;  1ONL A;  1HHV A;  1IKM A;  3EN2 A;  2QEX A;  3S2H H;  1NE3 A;  3U9S A;  4A93 H;  2KED A;  1JE5 A;  1A62 A;  5JJZ A;  4OO1 I;  4O2D A;  1OO9 B;  4V19 0;  3H6M A;  1JOR A;  1F9S A;  1Q81 C;  5A2Q L;  3OTO Q;  1WTQ A;  4LF9 L;  4R9W A;  3MHB A;  4QIW B;  4CKB A;  3HGB A;  1CZW A;  3S1M H;  4CDF C;  1KTK A;  1IXR A;  1HFG A;  1YIJ A;  1PFB A;  1I4G A;  1VCI A;  1G8Z D;  2V1C C;  5C3W A;  5DLQ E;  4KKS A;  2ID0 A;  2G9D A;  1SNQ A;  4JI3 L;  4C1N I;  4Q0F A;  4DUY L;  3HP3 A;  1G2T A;  3HOZ H;  5BN5 A;  4DAM A;  3TDQ A;  4DK6 C;  1VQH A;  2B39 A;  3J80 E;  4LFC L;  3OIQ A;  2F4V Q;  3BG3 A;  3DEP A;  2JEA I;  1JR0 D;  4O0A A;  4TSS A;  1Y1W H;  3H3V H;  5DAU A;  1F9Q A;  3CCL A;  4GKK Q;  5D3I B;  4BBS B;  1VQK A;  3M4O H;  2PPB C;  5E1F A;  2BDN A;  2RSO A;  3OPO A;  3BJU A;  2FIN B;  1HXY D;  4JOI A;  2B29 A;  1BCP F;  3KDF B;  5C44 G;  1NTG A;  1TY2 A;  2AQ3 B;  1QJO A;  1UEA B;  2JE6 I;  1QG7 A;  3M7N A;  4WJ3 M;  4UDU C;  1CKM A;  2KQ3 A;  4K0K L;  4AYB G;  4UAI A;  1LT6 D;  2L15 A;  2JP1 A;  4JI8 Q;  1DOK A;  4A3D G;  1ROD A;  1LTA D;  3ND8 A;  4DN4 M;  2VW9 A;  5NUC A;  5LHY 1;  4OO1 G;  3NUC A;  1OXV A;  3MWY W;  4EGV A;  1D2B A;  1B50 A;  1EIF A;  3K5L A;  3CQZ B;  1PXU A;  3STB C;  3KUP A;  5C5M A;  1E2Z A;  5FK9 C;  3RUZ A;  2CCZ A;  4C56 C;  3BVM A;  3RR5 A;  1MBY A;  1SE2 A;  3RNU A;  1X6O A;  3H0G H;  4GN5 A;  5HGQ A;  1NR2 A;  3CCV A;  3GTP H;  4OGQ C;  1ET9 A;  1KNE A;  4H0L C;  3HKZ G;  4DV6 Q;  4IUP A;  4K14 A;  2A69 C;  4KY7 A;  4UP8 A;  2A1A A;  1TS5 A;  1PFS A;  1T5E A;  4E6I A;  3ULL A;  1K73 C;  4Y52 H;  1XPR A;  1TWC B;  4XQQ A;  4HJ5 A;  1LO5 D;  5KYI A;  3GTL B;  4X3U A;  1BR9 A;  2OEO A;  3H91 A;  5KIX A;  3T51 B;  4IUN A;  3T1Y L;  3SEB A;  3A55 A;  3QO2 A;  4IO9 A;  1GXD C;  1ASY A;  1KIX A;  2LKV A;  1AZP A;  2Z6B A;  3E0E A;  2CKZ B;  2OT2 A;  2BA0 A;  3I56 A;  4A3L G;  1Z9F A;  2QDB A;  3BYY B;  4JI7 Q;  1Q1E A;  1MSG A;  3E0J A;  1RF2 D;  4CKC A;  4JI6 L;  5F2D A;  3FKI B;  4ODG A;  2RA4 A;  3S2H B;  4YCU A;  1PRT F;  4JI4 Q;  1IL8 A;  3OIP A;  4CDE C;  4A93 B;  1I94 L;  5FLX c;  3S2D H;  4CDD C;  4C3I H;  1KRT A;  5CMD A;  4LFC Q;  2YU9 H;  1Y8N B;  3HOY G;  1HQM C;  1N8R C;  4R4O A;  1AEX A;  1PH7 A;  3SK5 A;  3GTK H;  2QCP X;  3MVV A;  2L5T A;  2BE5 C;  4ABN A;  3DLL A;  1GUG A;  2NWG A;  5BR8 L;  1MKH A;  3VYT A;  2D0O A;  4A76 A;  2HT1 A;  4ZK9 B;  3QJY A;  1A8V A;  5G3L D;  3EA6 A;  3BDL A;  5C44 H;  4V0B A;  3RZO B;  5LL6 S;  2CH4 A;  5C0X J;  1I50 H;  1IBM L;  4AIM A;  3HOZ B;  3IKJ A;  4HJ9 A;  4ZYS A;  1Z7T A;  1WCM G;  3Q23 A;  1UAP A;  1VQG A;  3T13 A;  4OO1 H;  4A3K G;  1RDP D;  2DJF C;  5J39 A;  1C7Y A;  4CJ1 B;  1Y1W B;  4DV4 L;  4JI0 Q;  4EQ5 A;  3CCJ A;  1JB7 A;  4LF5 L;  3PUV A;  4IPH A;  1Y14 B;  4DKA C;  1EY0 A;  1BOS A;  5EBD A;  4DR2 L;  2R61 A;  3DWP A;  3D8G A;  5EGT A;  3P1H A;  1ZYR D;  4L5R C;  1BBU A;  1EUJ A;  1AN8 A;  4RKB A;  1ZEQ X;  2TMP A;  3TRZ A;  1OXT A;  3QOL A;  1N34 Q;  2C35 B;  4NXM L;  1SNM A;  3M3Y H;  1PH5 A;  3AEV A;  1NR4 A;  4RCN A;  1XPO A;  2KOL A;  1W6K A;  5ELF A;  1IYV A;  4BWG B;  5K36 H;  4JI5 Q;  1PVO A;  4P71 A;  1PHJ A;  4FXK C;  4X65 Q;  4C3H G;  1SYE A;  4DNT B;  2NUC A;  4NMZ A;  2JJQ A;  4PG3 A;  2CH4 W;  3H0G B;  3FEW X;  1Y8P B;  3BZK A;  3KOJ A;  1N32 L;  1IL2 A;  1AZQ A;  4JI6 Q;  4S3S A;  4R4Q A;  3C1E A;  1BNZ A;  1FGU A;  4HIM A;  3Q22 A;  3MFY A;  1UNS A;  3CD6 A;  1EWH A;  1VQO A;  2QF7 A;  2R93 H;  4N8F A;  3CCS A;  4M8A A;  2JA9 A;  2MP1 A;  3I70 A;  1I4X A;  2CW0 C;  4I65 A;  1YVC A;  1STN A;  2ICE C;  4LUO A;  1A3T A;  3A54 A;  3FRP B;  1A63 A;  2E76 C;  2CHB D;  1I4P A;  1XTC D;  5ISR A;  4J8Q A;  3I4N G;  1ENF A;  1PH2 A;  2WIN B;  5BR8 Q;  5IGG A;  1STY A;  2O5I C;  1LTB D;  1NBW A;  4RAU C;  2MO0 A;  1B3Q A;  1N33 Q;  1F77 A;  4FYD A;  5M3M B;  4KI0 A;  4IPC A;  1VF7 A;  5GQO A;  1X3Q A;  1TWA H;  4A3G B;  3HFZ B;  1IBM Q;  3CRL C;  2IX0 A;  4Y7N H;  3S2D B;  1P8L A;  4DPG A;  4H02 A;  4PQX A;  4Q5V A;  1G6Z A;  5C0X G;  2VUM G;  4C3I B;  1CA6 A;  4NW2 A;  3J81 i;  3D3R A;  1EIH A;  3K81 C;  1NSN S;  2MFI A;  4BBR H;  4IUV A;  1RIP A;  4LF5 Q;  3W1G A;  3GTK B;  2F4I A;  3TZD A;  1YHA A;  4J6H A;  4OXP A;  3KBG A;  2B63 G;  4ZRZ A;  1IBL Q;  3F2C A;  2ZTC A;  1HFN A;  2O2L D;  5CV6 A;  1XTD A;  1VQP A;  1VS0 A;  3J7Z C;  2JA6 G;  1Q46 A;  2K7V A;  2M9V A;  5FOB B;  2Q2T A;  4NXM Q;  2F0J A;  4DV2 Q;  4HN7 A;  1EYD A;  2KCT A;  4GOP A;  4HED A;  4ZCK A;  2DY8 A;  4L5Q A;  1OXU A;  2E8G A;  2E2I B;  4ZUJ A;  2R7Z G;  2L11 A;  3STB D;  3CF5 A;  2I5H A;  1QE6 A;  3UE1 A;  3SHL A;  3IFT A;  1EY7 A;  1O7L A;  1EL0 A;  5M5W H;  1B70 B;  1H9S B;  1PLF A;  5EKK A;  4U67 3;  1XYI A;  3A7A B;  4LF7 L;  5JOB A;  3M3Y B;  4ZKC B;  5IWA L;  1DXM A;  2A69 D;  1I6H B;  4HJA A;  4YIJ A;  3NTI A;  3J80 L;  2JSO A;  3PO2 H;  4RMF A;  2F0M A;  3CPW A;  5L37 A;  4B3T Q;  1E2V A;  4DR3 Q;  2IW3 A;  3BS1 A;  4A3M G;  1JJG A;  4A3B G;  1O7Z A;  5IP7 G;  4EQO A;  5JEA H;  2EJF C;  2IY5 B;  1K3B C;  1SND A;  2J4X A;  3ERS X;  3S1N H;  1KD1 C;  1TS3 A;  3U58 A;  2N3S A;  4DV0 L;  3EVQ A;  2K05 A;  1HNW L;  1PRT B;  4HMI A;  1DYQ A;  3A56 A;  1YJ9 A;  5ELO A;  5IE8 A;  5FJ8 H;  3RN5 A;  2B2T A;  3DUZ A;  2K1B A;  3K5O A;  3W3A A;  4UHV A;  5CV9 A;  4EQP A;  3DWA A;  1Q82 C;  3P75 A;  1FNV A;  1CHP D;  3I4O A;  2LXJ A;  3GTJ H;  4OIK A;  4K2K A;  4IN3 A;  3GV3 A;  1SYD A;  5C5L A;  1TQO A;  3SXH A;  2KHJ A;  4K2L A;  5ELN A;  2R93 B;  1KDB A;  4UY8 C;  2V4D A;  4B9X A;  2XRQ D;  4U68 A;  4I7Z C;  1VQN A;  2WKD A;  2KHI A;  1EY8 A;  4WJ4 A;  2BE5 D;  2WAC A;  1YNX A;  3G48 A;  4EX5 A;  2ICI A;  1O7I A;  5AJ3 L;  2VQE L;  4GLX A;  4KJN A;  4F7X A;  1B2T A;  1A3V A;  4JPB W;  1PMR A;  3VR4 A;  1K83 H;  1DCZ A;  3NP8 A;  3NQT A;  3R2I A;  5J3B A;  2E2D C;  2PW7 A;  4BY1 G;  5C4X H;  4DUZ L;  1FD7 D;  5COR A;  4AQY L;  2JA6 H;  2K33 A;  3S16 H;  4DK0 A;  5IT9 E;  1NNX A;  5C6A A;  1UE5 A;  4WOR A;  2RF4 A;  4TKO B;  2H4O A;  1STH A;  2HIX A;  4BBR B;  5ELB A;  2Q2I A;  3E5S A;  3Q6S A;  3T1H Q;  1CI3 M;  1KDA A;  2R7Z H;  1NAP A;  1R4P B;  5C3E H;  1ET6 A;  4A3J G;  3Q8D A;  3ER0 A;  3IAY A;  3SVM A;  3CMA A;  1WJJ A;  1XMO L;  1JB3 A;  2A68 C;  1TWG B;  4MN3 A;  2K5W A;  2N55 A;  3KJO A;  1IBK Q;  2HQE A;  3NBH A;  1KDC A;  3MXG A;  3OYY A;  5COY A;  1WTR A;  3U4V A;  1GD7 A;  3D0F A;  2P5Z X;  1JMC A;  5EJW A;  2K6A A;  3OWE B;  2F3I A;  2HDL A;  2ASB A;  1VQA A;  1EU4 A;  2UUC L;  3TP5 A;  4XQN A;  2F0I A;  1WTO A;  3BZD B;  3MXP A;  2L1B A;  4EQN A;  1PDQ A;  4DXG A;  3KLR A;  2HHH L;  1TWF H;  3LGJ A;  1HZC A;  1EYG A;  1VQ9 A;  3OSO A;  4C2M B;  1LM0 A;  1KLG D;  3BVZ A;  3S17 B;  1Z6H A;  1NUC A;  2EY5 A;  3TS0 A;  2F52 A;  2PI2 A;  3B6Y A;  1B1Z A;  1M1K C;  2AWN A;  5M5W B;  3DXJ C;  4QJF A;  1ASZ A;  5IOC A;  5E7N A;  1Q8K A;  2HCI A;  2XRS D;  4X66 L;  4JI1 Q;  4XXE A;  1J5E Q;  3DM1 A;  3PO2 B;  4OWX B;  1BCP D;  1FVI A;  2NVQ B;  1SYC A;  2F3V A;  3NWT A;  1OXS C;  3CCE A;  4P2C B;  1HA5 A;  2ALY B;  1KHI A;  3DWQ A;  2B2W C;  3EBE A;  4MTK A;  2B2U C;  3HOU G;  1AW7 A;  2CVR A;  5GAH C;  1PH9 A;  3M85 A;  1A15 A;  3H94 A;  2CW0 D;  2E75 C;  3S1N B;  4PMW A;  2K28 A;  3NHH A;  2L55 A;  4A3E B;  1FNW A;  1GUT A;  4CKE A;  1GUW A;  3AU7 A;  4LF4 L;  1Q7Y C;  4YWM A;  1STG A;  4JYA Q;  2L12 A;  1F9P A;  1N9W A;  1RKN A;  3J80 c;  1NY4 A;  2VQE Q;  1HR0 Q;  4A75 A;  2H1E A;  3BZC A;  5JVH 3;  4H44 C;  1JOO A;  4DUZ Q;  3MC0 B;  3PCO B;  3GTJ B;  3L3O C;  3CME A;  1Y1V G;  2SOB A;  1HR0 W;  2IT1 A;  1CFM A;  2KCN A;  2LY7 A;  1FYC A;  3PUZ A;  2X6L A;  2SDF A;  3NEN A;  4OX9 L;  3HOX G;  1QOH A;  5CYU A;  1QZH A;  2QW7 A;  3CHB D;  3OOC A;  4YHH Q;  1EYA A;  1S5D D;  2XWJ B;  4ZQ3 A;  1XNQ L;  1RTN A;  3JAM E;  3J81 c;  1L0Y B;  1YJW A;  2EJM A;  1SJH D;  3AQQ A;  5LMN Q;  1JWM D;  1I4Q A;  1T5X D;  2ES2 A;  4LJZ C;  4B3R L;  1YBY A;  5C4X B;  3I4M H;  1E3P A;  1CM9 A;  3K58 A;  2KEC A;  3S16 B;  4CJ2 C;  2AMC B;  2PNR C;  4RGT A;  5LMN W;  1XJV A;  4RG1 A;  3CRK C;  2IJ0 A;  1PRT D;  2KUM A;  4LUZ A;  3VR6 A;  4DV5 L;  1E24 A;  2Q2H A;  2EOT A;  2OQ0 A;  1B8A A;  2NZ1 D;  3I2Z A;  4QGU A;  3TS2 A;  1L1O A;  3SK4 A;  5KEE A;  1GM5 A;  3O13 A;  1XMQ L;  2KCC A;  5C3E B;  5CV4 A;  2KJX A;  2DNE A;  4DXF A;  2R7F A;  3D4D A;  1C8C A;  2EYM A;  2IX3 A;  1CK1 A;  4PMB A;  5EAY A;  4DF7 A;  3D31 A;  2F0H A;  3HOV G;  2KBN A;  4P75 A;  3OHX C;  1JOK A;  4DR7 Q;  2O5J C;  3KK7 A;  1HA6 A;  3GQB A;  2E2J H;  4DR4 L;  4X66 Q;  1MJC A;  4DR6 Q;  2JN4 A;  1B9N A;  1O80 A;  4KMU C;  1ESR A;  3UDI A;  3R2T A;  2EJG C;  3BU2 A;  4KK7 A;  4QL5 A;  2EXD A;  4ZAI A;  4IPG A;  3LWU A;  2WAQ B;  2WFW A;  3E3X A;  1PYB A;  2Z6K A;  2K14 A;  1CKO A;  2PQA B;  4FP5 D;  2N8N A;  1PV4 A;  4MZ9 A;  2F0W A;  4A3F G;  4PV1 C;  3I72 A;  5DM7 3;  1AFP A;  4LF4 Q;  5KGU A;  1U9R A;  4K8J A;  1QB5 D;  3PO3 G;  1EQV A;  2N88 A;  2VZA A;  1W6J A;  1PH6 A;  1TKW B;  4DAY A;  2F0L A;  2RDF A;  3MXU A;  1F2Y A;  2PYK A;  5I2Y A;  3PIO A;  1QWY A;  2EIF A;  3NK9 A;  1Y1V H;  3GTG H;  2Q8T A;  2Z8L A;  3K7U C;  2MNA A;  2PI2 E;  1GUN A;  1CUK A;  1SSO A;  5I9P A;  2UUB L;  1PZJ D;  3HOX H;  4OX9 Q;  4LF9 Q;  1X3E A;  2RCF A;  1V1P B;  4X64 L;  1PZK D;  3RLN A;  1Z47 A;  5IY0 A;  3L9A X;  1HNX L;  5J1Z A;  4A3I G;  1F2Z A;  1FJG L;  2WB1 E;  1SMY C;  2C9O A;  3H3V C;  4JI2 L;  4WJW A;  2NN6 I;  1JIC A;  2F0F A;  3CXC A;  2QDL A;  4NP5 A;  1A3U A;  1RTO A;  3S24 A;  4B3R Q;  1IZ6 A;  3SR1 A;  1X3G A;  3IFD A;  1E0B A;  4JI3 Q;  2F0Q A;  1WD0 A;  3SDZ A;  4DUY Q;  2M00 A;  2LSS A;  3BDC A;  5CGK A;  2EY6 A;  4K8I A;  4IPD A;  2XGT A;  4DV5 Q;  2E5L L;  1CSQ A;  3T4A C;  5M3F G;  1R9T H;  4OWT B;  5EKL A;  2DNC A;  4DR1 L;  4PZ7 A;  1KRS A;  4HSP A;  3S1M B;  3TP6 A;  3CP0 A;  2AWO A;  4R4I A;  2I46 A;  2JA7 G;  3GTM H;  1PYS B;  1W3S A;  1STE A;  4QCL A;  3T56 B;  1DON A;  3KLW A;  3PIO 3;  2A68 D;  2JA8 G;  1GKH A;  1CKN A;  1JQY D;  4FO2 A;  3I4M B;  1EOT A;  1XNR L;  1EIY B;  3VDY A;  2XVS A;  3CCQ A;  5TSS A;  1BQQ T;  2MHV A;  4LFB L;  3ND9 A;  4K0K Q;  4XT1 B;  4RCO A;  2HD3 A;  2R7D A;  3PUW A;  2BH8 A;  1PH4 A;  4JBM A;  2YYZ A;  1H9J A;  4A3D H;  1I3Q H;  4G4K A;  1D5Z C;  2Y0S E;  3ERQ A;  1KL9 A;  1Y8O B;  4TVA B;  2NZH A;  3LX0 A;  4IUU A;  4B3M L;  3FDT A;  4QQB X;  1SRO A;  1SE3 A;  5IGC A;  3A8I E;  1G91 A;  4UP7 A;  4LF8 L;  4DV3 L;  3M4O B;  5E3F A;  1M90 C;  3P20 A;  5LMU L;  3CAM A;  5JJL A;  1H9K A;  5JJK A;  4FDB A;  1NCV A;  1PZI D;  4O42 A;  4GN3 B;  2ZJP A;  4ME5 A;  2NN6 G;  4RHR A;  2NZO A;  5IT9 L;  2IHF A;  2KVM A;  3PO3 H;  1X9N A;  2K4K A;  1QVC A;  1M4V A;  4QIW E;  3R93 A;  3MA2 B;  5IGE A;  4LW1 A;  1MIU A;  5FLX E;  2UXB L;  1VQ5 A;  5C0X I;  2MPM A;  3OW7 A;  5CV5 A;  3BVG A;  2J7Z A;  1HUM A;  3URY A;  1JCK B;  3W1B A;  4UP9 A;  2DN8 A;  1ZXT A;  5D65 A;  4OWW B;  4JVZ A;  3T1Y Q;  3I90 A;  4TQU S;  2O4X A;  3T16 A;  1SE4 A;  1D5X C;  3QWN A;  3PF5 A;  5M5Y H;  2R6G A;  2R92 G;  1EFI D;  4X64 Q;  1WOC A;  2RHQ B;  1FJG Q;  3GTP B;  2WB1 G;  4K5V A;  4A3L H;  3S1Q H;  2QKI C;  3P7J A;  1QVF A;  5IYC G;  1EWI A;  2FMM A;  2QIL A;  3KF8 B;  2F0E A;  4IFD J;  1BVS A;  1GVP A;  3AYH B;  1PTO F;  1BCP C;  2D9U A;  5BN3 A;  2MO1 A;  1BBX C;  5ELC A;  3TN2 A;  2RVL A;  4GOP C;  4TRD A;  3OW2 A;  1I94 Q;  3EFX D;  5GAD C;  2E2H H;  1E22 A;  3V96 A;  2KHS A;  5IYD G;  1FR3 A;  3T53 B;  3J80 i;  3ULJ A;  1VQB A;  5M3F H;  2E5L Q;  1EEF D;  3HOY H;  4YY3 L;  3D4R A;  1EZ8 A;  2ZJR A;  2JYO A;  4DR1 Q;  4KHP L;  1KAB A;  2XWB B;  3HOW G;  1TVX A;  4AH6 A;  1Q90 A;  2OXP A;  2Z4I A;  4C3J G;  1B53 A;  4FVM A;  1KXL A;  1HPC A;  3A7L A;  3D6W A;  2VNU D;  1QCB D;  2JA8 H;  2WV6 D;  1QZG A;  4YCV A;  4IFD I;  5FO8 B;  2ZTE A;  2JA5 G;  1HZB A;  2HUG A;  4J1M A;  3NXW A;  1XNR Q;  1O78 A;  1WTX A;  4BY7 G;  1GJX A;  1Q1B A;  1S4Z A;  3TRE A;  1WCM H;  2G5D A;  4KJO A;  3U4Z A;  2CQA A;  1E2W A;  2YU9 B;  3X3N A;  3M4Q A;  2Y0S G;  4A3K H;  4CDC C;  4DV4 Q;  2PMZ B;  2KEN A;  2Q8R E;  4DAP A;  1ICF B;  1K3R A;  4HCS A;  1IYJ B;  1LTT D;  4KY5 A;  1YI2 A;  1SNP A;  4XTC S;  1WTH A;  1BCP B;  4DR2 Q;  4LF8 Q;  3GTM B;  2ZTD A;  1SE8 A;  4DV3 Q;  1HQR D;  1UEB A;  1VDZ A;  3OMC A;  1DM0 B;  4GOP B;  1E1T A;  5C44 B;  4X6A H;  2NN6 H;  1JWS D;  1V43 A;  1STB A;  3RLF A;  1S40 A;  1I50 B;  2F0G A;  3FPU B;  1ML0 D;  4GNX C;  4AYB B;  3OWF A;  1PRT C;  4WRD A;  4RHS A;  2UXB Q;  3M4P A;  1FNU A;  4LF6 L;  3I7F A;  4A3D B;  2PQE A;  3DHQ A;  1L2F A;  1YNJ C;  3I8Z A;  2D5D A;  1B4O A;  1V9P A;  3TQY A;  4LK1 C;  4HJ7 A;  4LFA L;  5EPL A;  4C3H H;  1KC8 C;  3JAM L;  4F8M A;  1HUN A;  3L0O A;  2EY1 A;  1LAB A;  2D2C C;  1EQR A;  1X55 A;  1TR5 A;  1H9R A;  2LFN A;  4QF4 A;  4MNO A;  1SFO H;  3KFU A;  1PTO H;  1K0S A;  1SYF A;  3HKZ B;  1N32 Q;  1YHQ A;  4L63 B;  1JE4 A;  4LWC A;  2B2V C;  4IFD G;  1SAP A;  5ELD A;  3ICE A;  3G4S A;  5EPJ A;  4BBS G;  2NB0 A;  3ITP A;  3L2P A;  1XPU A;  1RL2 A;  4K5W A;  2SNM A;  1TXY A;  5IYD H;  4YY3 Q;  1PH8 A;  1IYU A;  1STA A;  2K03 A;  1JJ2 A;  2ZXP A;  1EY5 A;  5AFW A;  2B2Y C;  3K7A H;  1G6P A;  3IL8 A;  4RGM A;  4C3J H;  3I4N H;  2RKS A;  3RLO A;  3CCM A;  4GNX B;  3KF6 B;  2X6G A;  4HR7 B;  1SMY D;  2FHT A;  2AKW B;  3UDX A;  1RCV D;  3MAQ A;  2IL8 A;  1QNU A;  2NVT H;  4BY7 H;  1QNK A;  3VR2 A;  3EJI A;  1DOM A;  3S14 H;  5C0X H;  2VUM H;  3K5N A;  4K6D A;  5HUR A;  2OCE A;  4IUQ A;  2BDO A;  3HOY B;  3S15 H;  1PYW D;  1W2B A;  2A74 C;  4CGY B;  2UXC L;  3F1Z A;  2BCO A;  1JT8 A;  1QUQ B;  2B63 H;  3A5U A;  3SGI A;  4J15 A;  1G2S A;  1U4R A;  3J7A 5;  4KLK A;  1B7Y B;  3CC2 A;  4LMQ D;  2HCC A;  4CJ0 B;  1DGS A;  1TWA B;  1X32 A;  2UUA L;  3IRB A;  1IW7 D;  2MUY A;  4RGO S;  4Y7N B;  1IKL A;  1NMG A;  1WCM B;  4FNF A;  2JK8 A;  3J7A F;  5D3D A;  1CQV A;  2RQX A;  3G6J B;  1CHQ D;  4DV1 L;  1JJC B;  1MJE A;  4A3K B;  3PIP A;  1RD9 D;  2HIV A;  1WD1 A;  1E7Z A;  2XSC A;  3NTK A;  1D8L A;  3NBH B;  1SN8 A;  1K9M C;  2K5D A;  1C48 A;  1VQJ A;  3FKI G;  4LFA Q;  2A8V A;  3RD4 A;  1BO0 A;  4A93 G;  4ZUI A;  2BA1 A;  2RDH A;  3GTQ H;  4FXD A;  4WFN 3;  3M9B A;  2RBM A;  2JQO A;  4ME3 A;  1S5B D;  4R8I A;  4MIU A;  1WFQ A;  4NXN L;  1N36 L;  4G7Z C;  2LXK A;  2Z0S A;  4LF7 Q;  2I0Q A;  5IWA Q;  1VQF A;  4IFD H;  1ENC A;  1DZ1 A;  5IYB G;  4EVO A;  1GUS A;  1RHP A;  5D14 A;  4IAL A;  4BBS H;  3V05 A;  4A3M H;  2F0V A;  3HEJ A;  1B3A A;  4A3B H;  3K6O A;  1EQT A;  5IP7 H;  1X54 A;  1GOZ A;  1QIL A;  4C3H B;  2F0S A;  3PSI A;  1S5C D;  3M4Y A;  3DMU A;  4DNI A;  2RDG A;  3HKS A;  3HOZ G;  2XTI A;  1SFO B;  1VQM A;  1I4R A;  5K5P A;  1PTO B;  4DV0 Q;  4L8J A;  2F4V L;  3UDG A;  1WYD A;  2MGS A;  1HNW Q;  1BBW A;  4F88 A;  3K0Y A;  1Y1W G;  2K50 A;  4P73 A;  3CQZ H;  1BKB A;  3PIP 3;  1D7Q A;  4HTH A;  2EVB A;  1VQ4 A;  2TSS A;  3G7L A;  4YWL A;  3GO5 A;  4ID6 A;  4NB3 A;  3FMC A;  1KQS A;  1LTR D;  4B3S L;  1VQ6 A;  3A5Z B;  1BDO A;  1V1O A;  1LUZ A;  4KY6 A;  2GVA A;  1K8O A;  1EWC A;  2RSN A;  3MXN A;  5BN4 A;  2DGY A;  2AUK A;  2WKC A;  4JC0 A;  3C2P A;  4BA1 I;  1EQQ A;  2UXC Q;  3WOF A;  1YEZ A;  3TME A;  4RA8 A;  3I4N B;  4JI8 L;  4JOI C;  4XQJ A;  2A6H C;  2HQL A;  3QOJ A;  2F0K A;  5EQ0 A;  1KLU D;  5AJ3 Q;  5KNC A;  5CBE E;  5FLX L;  1LT4 D;  2CWP A;  3WOE A;  1YNN C;  3A74 A;  1TY0 A;  3K59 A;  2EE1 A;  4BY1 H;  2FXQ A;  1LT5 D;  1UUP A;  5IP9 G;  2VS1 A;  4RFB A;  2NVT B;  4AQY Q;  1HH2 P;  1SEB D;  1EYC A;  2AQ2 B;  3S14 B;  2VUM B;  4G7O C;  3Q24 A;  2IWH A;  3H0G G;  1K8A C;  4BA2 I;  3CW2 C;  3S15 B;  2GVB A;  1SNO A;  5I4D A;  2EPB A;  1YHB A;  3FKI H;  2L4N A;  1K28 A;  5GAG C;  4NDX A;  4A3J H;  2B63 B;  1X65 A;  2F0U A;  1XMO Q;  5IGD A;  1D6E C;  3C3L A;  3RZD H;  1WTP A;  3NE5 B;  1K83 B;  5C4Z A;  1SDF A;  4APV A;  4A4I A;  1S3O A;  1TU2 B;  5M9O A;  1L1O B;  4NXN Q;  2JA6 B;  2GA4 B;  1N36 Q;  4FF3 A;  4R4C A;  3GTO H;  4P74 A;  4K6L A;  1E1O A;  5IYB H;  3MFG A;  5FO7 B;  4DAV A;  2F0D A;  1VQI A;  4JI7 L;  2UUC Q;  3TZU A;  1YNJ D;  2G9H D;  3DEO A;  3J7A V;  2Z9H A;  2R7Z B;  3CU7 A;  4RKL A;  3PMF A;  5IGB A;  4JI4 L;  2HHH Q;  5M3M G;  3KBX A;  2VY3 A;  3RZO H;  1S5F D;  3ZJY C;  4ZKB B;  2VQF L;  1EZ6 A;  4A3G G;  2WII B;  3E6Z X;  2R3Z A;  4DK3 C;  3F2D A;  2EZV A;  3CPF A;  3GTQ B;  1G51 A;  4C3I G;  3HG9 A;  4JG2 A;  2JXM B;  2DY7 A;  1UE7 A;  2AQ1 B;  2AUJ D;  2B2W A;  3VR3 A;  1HRJ A;  2B2U A;  2DUD A;  5HY6 A;  2MQH A;  1MHW C;  1DJR D;  5CC4 A;  2UXD L;  1TII D;  2F1M A;  1YIT A;  4ZLT F;  1FGB D;  4A3M B;  1AH9 A;  1I6V C;  4B3S Q;  4A3B B;  4DGZ A;  3K0X A;  3HOU H;  2OWO A;  2NBF A;  5CV8 A;  1TWF B;  3N6R A;  3QB3 A;  2EQS A;  4FF4 A;  1XX8 A;  2YTV A;  1U0L A;  4DAY B;  4RH6 A;  2PW5 A;  3VR5 A;  2LS0 1;  4YWK A;  3W5O A;  4ILW A;  3J81 E;  4QMG A;  2L9H A;  3C46 A;  3KDF A;  2NVY H;  5CV7 A;  3VA5 A;  3S1R H;  2UU9 L;  3U9O A;  4JI0 L;  1KAW A;  4HMJ A;  4DFA A;  3F2B A;  5KND A;  2GN5 A;  5IP9 H;  4IJH A;  2K5Q A;  4RGN A;  3H15 A;  1UE1 A;  4F87 A;  2CQO A;  5GRO A;  3C1F A;  1WI5 A;  1N34 L;  2FJ2 A;  5C4H A;  3CKI B;  2PQA A;  1LLR D;  3FPP A;  4I7A A;  4IOC A;  1JC7 A;  2VB2 X;  1XXG A;  5CR3 A;  1XNQ Q;  1SBB B;  4R8N A;  5IGF A;  4JI5 L;  5K36 G;  2IPK D;  1PA6 A;  3PUX A;  4G7H C;  1JOQ A;  3J81 j;  4B08 A;  4BS9 A;  4X65 L;  4BY1 B;  4LNQ A;  4CHT B;  2YTX A;  3FVQ A;  1K8M A;  1Q8I A;  3PQI A;  1S5E D;  4JBW A;  4N9T A;  1HNZ L;  1LV9 A;  3AB9 A;  4DU9 A;  1PTO D;  1EY6 A;  3UDF A;  1NMF A;  2K5H A;  2K75 A;  4H13 C;  4MTN A;  4GS3 A;  3K57 A;  5C4J H;  4G57 A;  1EY9 A;  1MSH A;  4DR5 L;  4KHZ A;  1CKN B;  1I4H A;  1V1P A;  1XMQ Q;  2SNS A;  5M3M H;  4A3J B; 
#chains in the Genus database with same CATH homology
 3U4Z A;  2VQF Q;  4IJL A;  4A3G H;  1K83 H;  5JEA J;  3M4Q A;  2Y0S G;  5J3B A;  4A3K H;  1PH3 A;  4BY1 G;  3HOV H;  5C4X H;  4DUZ L;  3CCU A;  3S1M H;  4DV4 Q;  4AQY L;  1IXR A;  2JA6 H;  2RCN A;  1YIJ A;  3S16 H;  2R93 G;  2KEN A;  1K3R A;  1UE5 A;  1IYJ B;  4JBJ A;  1YI2 A;  4HIK A;  1VCI A;  4XTC S;  1U5K A;  2RF4 A;  3EIV A;  4DR2 Q;  2V1C C;  4LF8 Q;  4DR4 Q;  2ZTD A;  1SE8 A;  5DLQ E;  4DV3 Q;  2HIX A;  2N49 A;  1GO3 E;  1UEB A;  3PUY A;  2ID0 A;  2UXD Q;  4JI3 L;  4GOP B;  1E1T A;  4DUY L;  1OTC A;  2Q2I A;  3T1H Q;  4X6A H;  2R7Z H;  3HOZ H;  5C3E H;  4DAM A;  3CC4 A;  1V43 A;  4DK6 C;  3Q8D A;  1VQH A;  1C9O A;  3RLF A;  4DV7 L;  4A3J G;  2QGQ A;  1S40 A;  1N33 L;  1T9H A;  3ER0 A;  4LFC L;  2F4V Q;  2JEA I;  4GNX C;  1UE6 A;  3CMA A;  1WJJ A;  1XMO L;  4O0A A;  2UXB Q;  3M4P A;  3PV0 A;  1Y1W H;  3I7F A;  2K5V A;  3KJO A;  4LF6 L;  1IBK Q;  1L2F A;  3K8A A;  2H5X A;  3H3V H;  4A3F H;  3OYY A;  3CCL A;  4GKK Q;  2CWA A;  3U4V A;  1GD7 A;  1V9P A;  3TQY A;  2ZM6 L;  3D0F A;  4X62 L;  4HJ7 A;  1VQK A;  4LFA L;  3GD7 A;  1JMC A;  4C3H H;  3M4O H;  1KC8 C;  2OTJ A;  3L0O A;  2F3I A;  4BBR G;  3BJU A;  1QVG A;  2UU9 Q;  2ASB A;  2RHS B;  1EQR A;  1VQA A;  2B29 A;  4JOI A;  3TEH B;  3KDF B;  1X55 A;  4A3C G;  2E2I H;  1Q12 A;  5C44 G;  1NTG A;  2I5L X;  2UUC L;  1VQD A;  4MNO A;  1OXX K;  1SFO H;  2JE6 I;  3FHW A;  3KFU A;  1J6Q A;  4P72 A;  3M7N A;  4BXX G;  1IBL L;  4WJ3 M;  1X56 A;  1CKM A;  2HHH L;  1TWF H;  4K0K L;  4AYB G;  1N32 Q;  3LGJ A;  1HZC A;  2L15 A;  1YHQ A;  1EYG A;  1VQ9 A;  4JI8 Q;  4LWC A;  4A3D G;  1LM0 A;  4GKJ L;  2VW9 A;  2UUB Q;  4IFD G;  4OO1 G;  1OXV A;  3TS0 A;  5GAE C;  2F52 A;  2PI2 A;  3B6Y A;  3ICE A;  1EIF A;  1M1K C;  2AWN A;  3G4S A;  4BBS G;  3STB C;  5FLM G;  4DV2 L;  1I6H H;  1HNX Q;  3L2P A;  4A3I H;  1XPU A;  1RL2 A;  4QJF A;  4R4T A;  1ASZ A;  5IYD H;  1TXY A;  5E7N A;  2WP8 J;  1Q8K A;  4X66 L;  4JI1 Q;  1J5E Q;  3JAM i;  4JI2 Q;  2CCZ A;  3KYH C;  4OWX B;  5JJI A;  3RR5 A;  1FVI A;  4YY3 Q;  3RNU A;  1X6O A;  1PH8 A;  1VQ7 A;  3H0G H;  4GN5 A;  5HGQ A;  3CCV A;  1OXS C;  3CCE A;  1JJ2 A;  3GTP H;  2ALY B;  1KHI A;  3HKZ G;  3K7A H;  4DV6 Q;  1G6P A;  3EBE A;  4C3J H;  3HOU G;  3I4N H;  4UP8 A;  1HNZ Q;  2A1A A;  3RLO A;  1PFS A;  5GAH C;  3CCM A;  3KF6 B;  4GNX B;  1PH9 A;  3M85 A;  2I5M X;  3ULL A;  1K73 C;  2AKW B;  3UDX A;  2IX1 A;  4Y52 H;  1XPR A;  4HJ5 A;  4PMW A;  3CC7 A;  4PZ8 A;  1AE2 A;  3JC6 6;  4LF4 L;  1Q7Y C;  4YWM A;  2NVT H;  4DR5 Q;  4YCW A;  4BY7 H;  4JYA Q;  1N9W A;  3T1Y L;  4IO9 A;  3PO2 G;  3J80 c;  1NY4 A;  1ASY A;  2VQE Q;  3S14 H;  1HR0 Q;  2VUM H;  1KIX A;  2OCE A;  4A75 A;  4B3T L;  4DR3 L;  2JA7 H;  3BZC A;  3E0E A;  3S15 H;  2CKZ B;  1VQC A;  3NEM A;  2BA0 A;  4DUZ Q;  3I56 A;  3PCO B;  4A3L G;  1W2B A;  1Z9F A;  4POF A;  5JEA G;  2UXC L;  3F1Z A;  3CME A;  1Y1V G;  1HR0 W;  4JI7 Q;  1Q1E A;  4L5T A;  1JT8 A;  2WAQ E;  3AFQ A;  1QUQ B;  2B63 H;  3A5U A;  3SGI A;  3CCR A;  2IT1 A;  4JI6 L;  4J15 A;  3PUZ A;  4OX9 L;  3NEN A;  4LFB Q;  4YCU A;  3HOX G;  4JI4 Q;  4A3E G;  1QZH A;  3J7A 5;  4KLK A;  1I94 L;  1B7Y B;  5FLX c;  4YHH Q;  3CC2 A;  2OQK A;  4R1J A;  1DGS A;  2IHE A;  3S2D H;  1AE3 A;  4DV7 Q;  1XNQ L;  2UUA L;  4C3I H;  1SMX A;  3IRB A;  5FJ8 G;  1KRT A;  4B3M Q;  3J81 c;  4LFC Q;  1YJW A;  2YU9 H;  1UWV A;  3HOY G;  3AQQ A;  1NMG A;  5LMN Q;  1N8R C;  2JK8 A;  4R4O A;  2ES2 A;  1PH7 A;  4B3R L;  4DV1 L;  1JJC B;  2D62 A;  1MJE A;  4GLA C;  1YBY A;  3PIP A;  3GTK H;  2HIV A;  1EOV A;  3DLL A;  2QA4 A;  3I4M H;  1E3P A;  5LMU Q;  1E7Z A;  3MEF A;  1D8L A;  3NBH B;  1SN8 A;  2AMC B;  1MKH A;  2K5N A;  1VQJ A;  3E9H A;  3FKI G;  4LFA Q;  4X62 Q;  2ZM6 Q;  5LMN W;  2A8V A;  2D0O A;  1XJV A;  4RG1 A;  4A76 A;  2HT1 A;  4A93 G;  1A8V A;  4LUZ A;  4NPS A;  1E24 A;  4DV5 L;  2BA1 A;  2Q2H A;  1PH1 A;  4A3C H;  5C44 H;  2OQ0 A;  1B8A A;  3I2Z A;  4QGU A;  3GTQ H;  3TS2 A;  4POG A;  1L1O A;  4GN4 B;  1GM5 A;  3M9B A;  5C0X J;  2JQO A;  4ME3 A;  1I50 H;  1XMQ L;  1FL0 A;  4BXX H;  1IBM L;  4AIM A;  2VL6 A;  2YTY A;  1WFQ A;  4HJ9 A;  4NXN L;  2R7F A;  1N36 L;  1WCM G;  2B3G A;  1TWG H;  1VQE A;  2LXK A;  1A0I A;  2Z0S A;  5EAY A;  4LF7 Q;  2I0Q A;  1VQG A;  5IWA Q;  1VQF A;  3D31 A;  4A3K G;  3HOV G;  4GKJ Q;  2KBN A;  1C7Y A;  1TWH H;  4P75 A;  4XIG S;  5IYB G;  5C4X G;  4DV4 L;  4JI0 Q;  2R92 H;  4EQ5 A;  3I55 A;  3CCJ A;  1JB7 A;  4LF5 L;  1YZ6 A;  3PUV A;  4IPH A;  5FLM H;  4BBS H;  3K80 C;  4A3M H;  4DR7 Q;  1Y14 B;  4DKA C;  4A3B H;  2E2J H;  5IP7 H;  1SRU A;  4DR2 L;  1X54 A;  4DR4 L;  4X66 Q;  5IYC H;  1CSP A;  1MJC A;  4DR6 Q;  2BH2 A;  3PSI A;  4L5R C;  1EFW A;  3L7Z C;  4DNI A;  1BBU A;  3UDI A;  1EUJ A;  3T1H L;  1HJP A;  3BU2 A;  3HKS A;  3HOZ G;  2XTI A;  2Q2U A;  5C3E G;  5K36 G;  4QL5 A;  1OXT A;  1VQM A;  2ATW A;  3TRZ A;  1N34 Q;  2C35 B;  4C2M H;  4DV0 Q;  4NXM L;  2EXD A;  3UE0 A;  3UDG A;  2F4V L;  3M3Y H;  4IPG A;  1WYD A;  1PH5 A;  1HNW Q;  3AEV A;  3S17 H;  4QY7 A;  2WFW A;  1BBW A;  1XPO A;  1PYB A;  5M5X H;  2Z6K A;  2OTL A;  1Y1W G;  2K14 A;  1IBK L;  4L5S A;  1CKO A;  2K50 A;  2PQA B;  4P73 A;  1PV4 A;  2N8N A;  4JI5 Q;  3CQZ H;  1BKB A;  4MZ9 A;  1PVO A;  1D7Q A;  4A3F G;  4P71 A;  1PHJ A;  1S72 A;  1VQ4 A;  4YWL A;  4LF4 Q;  3GO5 A;  4KHP Q;  4NB3 A;  4IOA A;  1L0W A;  4X65 Q;  1KQS A;  3HOW H;  4B3S L;  1VQ6 A;  2NVX H;  3PO3 G;  3A5Z B;  5IT9 c;  3PF4 A;  2VZA A;  2NVQ H;  4LUV A;  1PH6 A;  1LUZ A;  2JJQ A;  4JV5 L;  2GVA A;  4PG3 A;  2DGY A;  3F8T A;  4OON A;  3PIO A;  4JC0 A;  3BZK A;  2EIF A;  4BA1 I;  1SLJ A;  1Y1V H;  1EQQ A;  3GTG H;  3KOJ A;  1YEZ A;  1N32 L;  2UXC Q;  2JA5 H;  2WAQ G;  3K7U C;  2MNA A;  2PI2 E;  1IL2 A;  4JI8 L;  4JOI C;  4JI6 Q;  4R4Q A;  1CUK A;  2HQL A;  2CFM A;  2UUB L;  3HOX H;  4OX9 Q;  5AJ3 Q;  4A3E H;  1FGU A;  4LF9 Q;  3KJP A;  1X3E A;  4HIM A;  2CWP A;  4X64 L;  3RLN A;  3A74 A;  1Z47 A;  5IY0 A;  1HNX L;  4BY1 H;  4A3I G;  3CD6 A;  2FXQ A;  1FJG L;  1VQO A;  2WB1 E;  5IP9 G;  2VS1 A;  4AQY Q;  4JI1 L;  3CCS A;  1HH2 P;  3ULP A;  1J5E L;  2R93 H;  4JI2 L;  2JA9 A;  2NN6 I;  1YVC A;  4PZ6 A;  3CXC A;  4LUO A;  1YJN A;  3S24 A;  3H0G G;  1K8A C;  4B3R Q;  1X3F A;  1IZ6 A;  1VQL A;  3CW2 C;  4BA2 I;  4GNX A;  3KF6 A;  1A63 A;  2GVB A;  1X3G A;  3AFP A;  4JI3 Q;  1HZ9 A;  1K8G A;  3I4N G;  4DUY Q;  1PH2 A;  3H3V I;  1YHB A;  3FKI H;  5BR8 Q;  2LSS A;  1NBW A;  5GAG C;  4A3J H;  4IPD A;  2MO0 A;  1X65 A;  1N33 Q;  2XGT A;  4DV5 Q;  2E5L L;  1CSQ A;  5M3F G;  1R9T H;  4KI0 A;  4IPC A;  4OWT B;  1XMO Q;  5GQO A;  3RZD H;  1TWA H;  4DR1 L;  4PZ7 A;  4LF6 Q;  3HFZ B;  1KRS A;  4JYA L;  4APV A;  4A4I A;  1S3O A;  1IBM Q;  2IX0 A;  4Y7N H;  1P8L A;  1L1O B;  4DPG A;  4H02 A;  3CP0 A;  1HR0 L;  4NXN Q;  2AWO A;  4R4I A;  5C0X G;  1N36 Q;  3J81 i;  2VUM G;  4R4C A;  2JA7 G;  3GTM H;  1PYS B;  3GTO H;  1W3S A;  4P74 A;  1LTL A;  3K81 C;  2MFI A;  1E1O A;  4BBR H;  5IYB H;  3KLW A;  1RIP A;  1QUQ A;  2JA8 G;  1GKH A;  4GLV B;  4LF5 Q;  1VQI A;  1CKN A;  3W1G A;  4JI7 L;  1YHA A;  4OXP A;  4HID A;  3FP9 A;  2UUC Q;  1XNR L;  2B63 G;  1EIY B;  1P16 A;  3VDY A;  3OTO L;  3CCQ A;  4UPA A;  1IBL Q;  4JI4 L;  4LFB L;  2HHH Q;  3G6E A;  5M3M G;  4K0K Q;  2VY3 A;  3F2C A;  3RZO H;  2ZTC A;  2R7D A;  3PUW A;  2BH8 A;  3ZJY C;  4ALP A;  1PH4 A;  2VQF L;  2YYZ A;  4JBM A;  4YHH L;  4A3D H;  4A3G G;  1XTD A;  1VQP A;  1I3Q H;  2K52 A;  2Y0S E;  4DK3 C;  3CPF A;  3F2D A;  3NEL A;  1KL9 A;  1G29 1;  1G51 A;  4TVA B;  1VS0 A;  4HIO A;  2NZH A;  3J7Z C;  2JA6 G;  1C0A A;  2JEB I;  1Q46 A;  1V1Q A;  2KCM A;  2Q2T A;  1NJI C;  4B3M L;  1SRO A;  4JG2 A;  4NXM Q;  4QQB X;  4DV2 Q;  1UE7 A;  5LMN L;  2KCT A;  2DUD A;  4UP7 A;  4GOP A;  4LF8 L;  2PNH A;  5HY6 A;  4DV3 L;  2MQH A;  3U50 C;  1M90 C;  2UXD L;  4L5Q A;  5LMU L;  3I4M G;  3RN2 A;  2YV5 A;  3CAM A;  5JJL A;  5JJK A;  1OXU A;  2E8G A;  4JBK A;  4FDB A;  1YIT A;  4GN3 B;  2ZJP A;  2R7Z G;  1AH9 A;  1K0R A;  2NN6 G;  2NZO A;  1Q86 C;  4B3S Q;  2IHF A;  3STB D;  2A19 A;  3CF5 A;  3PO3 H;  3K0X A;  2K4K A;  1X9N A;  3HOU H;  2I5H A;  2OWO A;  1QVC A;  3UE1 A;  4QIW E;  4JV5 Q;  4LW1 A;  1MIU A;  2UXB L;  2EQS A;  1VQ5 A;  5C0X I;  2N78 A;  2YTV A;  3DM3 A;  1U0L A;  2PMZ E;  4DAY B;  3A0J A;  3MXN B;  5M5W H;  1K9M C;  1B70 B;  4YWK A;  3W1B A;  4UP9 A;  3W5O A;  4GKK L;  4LF7 L;  1HZA A;  5IWA L;  4OWW B;  3KDF A;  4HJA A;  2NVY H;  3T1Y Q;  4TQU S;  3PO2 H;  4RMF A;  3JAM c;  3GDE A;  1L1O C;  3S1R H;  3CPW A;  2UU9 L;  4JI0 L;  1KAW A;  3PF5 A;  5M5Y H;  2R6G A;  4B3T Q;  2R92 G;  4X64 Q;  4DR3 Q;  1WOC A;  3F2B A;  5H1S E;  4DR7 L;  2RHQ B;  1SR3 A;  3E9I A;  4A3M G;  2AHO B;  2GN5 A;  1FJG Q;  4A3B G;  1JJG A;  2WB1 G;  5IP9 H;  5IP7 G;  3S1Q H;  4A3L H;  2ZJQ A;  1QVF A;  4IJH A;  5IYC G;  4DR6 L;  1EWI A;  3KF8 B;  3H15 A;  4JCV E;  4AYB E;  4IFD J;  1BVS A;  2IY5 B;  1GVP A;  1UE1 A;  5BR8 L;  3AYH B;  1TWC H;  3ERS X;  3S1N H;  1KD1 C;  1H95 A;  3GTL H;  2MO1 A;  2CQO A;  3U58 A;  5GRO A;  2N3S A;  1WI5 A;  1N34 L;  2D0P A;  4HJ8 A;  4DV0 L;  4GOP C;  3OW2 A;  1I94 Q;  2PQA A;  1HNW L;  5GAD C;  2E2H H;  1E22 A;  4IOC A;  1YJ9 A;  5IYD G;  5ELO A;  5IE8 A;  5FJ8 H;  1XNQ Q;  3RN5 A;  2UUA Q;  1VQ8 A;  3PGZ A;  4JI5 L;  3J80 i;  3ULJ A;  1VQB A;  5M3F H;  1PA6 A;  3PUX A;  3G71 A;  2E5L Q;  3HOY H;  3J81 j;  4YY3 L;  1Q82 C;  2ZJR A;  1LYL A;  4DR1 Q;  3I4O A;  4DV1 Q;  4KHP L;  2LXJ A;  3GTJ H;  4X65 L;  4LNQ A;  3WWV A;  3HOW G;  3HKZ E;  4DV6 L;  2YTX A;  4AH6 A;  2Z6K C;  2KHJ A;  5ELN A;  4JBW A;  1I5F A;  1HNZ L;  4UY8 C;  3EN2 A;  2QEX A;  3S2H H;  3UDF A;  1NE3 A;  1NMF A;  2K5H A;  1KXL A;  4A93 H;  2K75 A;  1VQN A;  2VNU D;  4MTN A;  1JE5 A;  2JA8 H;  4GS3 A;  1A62 A;  5C4J H;  1QZG A;  4YCV A;  4IFD I;  2KHI A;  4OO1 I;  4O2D A;  2ZTE A;  4WJ4 A;  2JA5 G;  1HZB A;  1YNX A;  3G48 A;  4DR5 L;  1XNR Q;  4KHZ A;  4EX5 A;  1CKN B;  1Q81 C;  3OTO Q;  1XMQ Q;  4BY7 G;  1Q1B A;  1O7I A;  5AJ3 L;  5M3M H;  2VQE L;  4GLX A;  4LF9 L;  3TRE A;  1WCM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...