1MKHA

C-terminal domain of methionyl-trna synthetase from pyrococcus abyssi
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
106
Chain Sequence
MYVKFDDFAKLDLRVGKIIEVKDHPNADKLYVVKVDLGDEVRTLVAGLKKYYKPEELLNRYVVVVANLEPKKLGIGSQGMLLAADDGERVALLMPDKEVKLGAKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords C-terminal domain of Methionyl-tRNA synthetase
publication title Structure and function of the C-terminal domain of methionyl-tRNA synthetase
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 17
structure length 106
sequence length 107
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1mkhA00
1EQRA 4C3HH 3I4NH 4WJ3M 5C0XJ 1YJWA 1JJCB 1ASYA 1HNXL 1JB7A 1KXLA 1XMOL 4GLXA 2HHHQ 4DR7Q 5C4XH 3CC4A 4DUYL 3W1BA 4P74A 1N32Q 3KF6B 5M3FG 4B3TQ 1HZCA 4JBKA 4BY7H 2YV5A 2Q2HA 1E1TA 4LF5L 4QIWE 3HOXG 4OWTB 3CQZH 4PMWA 4C3JH 4DKAC 1FVIA 5M5YH 3U4VA 4GKKL 5ELNA 1J5EL 2OQKA 2JA8G 4DAMA 2VNUD 5C3EG 4K0KQ 4JI1Q 4DV5L 3I7FA 1O7IA 4HIKA 2E2IH 3HOZH 1LYLA 3CPFA 4LUOA 3GTJH 4DNIA 5GAHC 4JYAQ 1PFSA 2AMCB 3NELA 1CUKA 4X62Q 2QA4A 5JEAG 4A3CG 3WWVA 3A5UA 2UUCL 3KOJA 2JA5H 3NBHB 1S72A 1G6PA 5EAYA 1EQQA 5JEAJ 1OXTA 1WCMH 2F52A 2UUBQ 1FJGQ 2Z6KC 3W1GA 4LF6L 1UEBA 2CFMA 2WB1G 2JK8A 2I5HA 4NXMQ 1IL2A 5AJ3L 3BZCA 1KAWA 1VQ5A 1GKHA 2PI2A 1NE3A 3GO5A 1IBMQ 1PH6A 5GAEC 4LF7Q 2VQEL 4HIDA 3GTGH 2XGTA 1JMCA 4A4IA 5IP9G 2L15A 1VQNA 4LFBL 2RHSB 3L2PA 3TREA 3A0JA 2PQAB 2IHEA 3OTOQ 3CCJA 1LUZA 2KBNA 1XMQQ 2I0QA 3CAMA 4DV7Q 1K73C 4A3KG 4JI4L 4GLAC 2JA9A 3CMAA 1Q7YC 4B3RL 3PUVA 2R7ZG 2V1CC 3EBEA 1GM5A 1YEZA 1IBLQ 1SFOH 1BVSA 4JCVE 2ZJPA 1Q1EA 3PV0A 2HHHL 4DR4L 4DR7L 3SGIA 1VQ6A 3B6YA 3ULJA 1PH8A 3TEHB 1HNWQ 1N32L 2HIVA 1W3SA 5GADC 4DR2Q 1Q86C 3UDXA 4B3TL 4LF9Q 2OWOA 3J81c 5HY6A 1PH9A 3CCVA 4DV2Q 2ID0A 1PH4A 3HOWH 2IX1A 3NEMA 4A75A 2A1AA 2Y0SE 1T9HA 4A3JH 3S16H 5JJIA 4L5QA 1VQPA 3I4MH 3RR5A 3KJOA 1N33Q 4AIMA 4DR3Q 1VQOA 1OTCA 3HOVG 3PUZA 1E7ZA 2K50A 2CQOA 4JI1L 2PNHA 2YYZA 1I5FA 1YHQA 4A3FG 4IOCA 1I3QH 3E9HA 2BH2A 1QUQB 2B63H 4PG3A 3STBC 3H0GG 1XNQQ 1TXYA 1LM0A 2KCMA 3CCMA 5ELOA 3HOYH 4DR6Q 4Y52H 3CCLA 2LXKA 3S15H 3ZJYC 2WFWA 2MNAA 3KDFA 4KHZA 3G4SA 4DR1Q 4BA2I 3UDIA 1VQDA 4NXML 3S17H 3PUXA 3TS0A 1XTDA 1Y1WG 1IBML 3RZOH 5J3BA 4TVAB 3J7ZC 3VDYA 1FGUA 1I50H 1X56A 2ES2A 4LF7L 4DK6C 1E24A 2D0PA 4R4CA 1AE3A 2RCNA 1W2BA 4APVA 2JA7H 1BBUA 2D0OA 2ZTDA 1Z9FA 1CKNA 3G71A 1PH5A 4JI5Q 5C0XI 4DPGA 1XMQL 4LW1A 3GTOH 2UXBQ 2D62A 4AQYL 2A8VA 1VQ4A 1SMXA 4KI0A 3HOUH 2RF4A 4L5SA 4QGUA 4X65Q 3FKIH 1GD7A 2JA6H 1VQBA 1EWIA 3I56A 1Y14B 4RMFA 3ULPA 1IBLL 4JV5Q 1Y1VG 4A93G 3E0EA 2E5LL 2Y0SG 4DV0Q 1X65A 2IT1A 1HNWL 4DV1Q 4R4OA 3W5OA 1N34Q 1G51A 2K14A 4JI0L 5BR8Q 2HIXA 4DR2L 2QGQA 4PZ8A 4LF9L 5IYDH 1PHJA 4UPAA 4BY1H 4QY7A 4NB3A 4MTNA 3EN2A 4GNXA 1AE2A 3FP9A 1LTLA 1N9WA 3KDFB 1V43A 1MJEA 2BA0A 2GVAA 4JI3Q 5M3MG 4DR3L 2ASBA 3KFUA 1IXRA 1VQ8A 2R92H 1YI2A 4IJLA 1X3GA 5C44H 3D0FA 4P71A 1Q82C 1KQSA 4JI6Q 2CWAA 1VQ9A 1VCIA 1UE6A 3L7ZC 4A3IG 1D8LA 1K8AC 1CKNB 2HQLA 1TWFH 1FL0A 1XJVA 2PQAA 2OTLA 4IPCA 1XNQL 3GTKH 2KHIA 1VQEA 3HOVH 1B7YB 4A3EG 3UDGA 1VQCA 3I2ZA 1P8LA 4DR1L 3CC2A 4JI8L 5IYBG 1Q12A 4L5TA 4A3FH 2PMZE 3S2DH 1SE8A 1OXVA 2DGYA 4UP7A 4BXXG 2UUAL 1SRUA 1CKOA 2Q2IA 3AFQA 1XNRQ 4AH6A 2MQHA 3K7UC 4GNXC 4TQUS 3CCSA 1JJ2A 4IPGA 4A76A 4A3GG 2YU9H 3PGZA 2KENA 4GNXB 1Y1WH 4OX9Q 2UXBL 3KJPA 1HZAA 4X66L 1VQHA 2K75A 3PUYA 3CCQA 4X65L 4DV4L 1PA6A 2UXDQ 2OQ0A 4GLVB 3S24A 4JV5L 1IBKQ 2R7DA 1VQKA 1EIYB 1A8VA 5JJLA 2F4VQ 4YCVA 2QEXA 1HR0Q 2N49A 2H5XA 4JC0A 1N34L 4YCUA 5BR8L 4DV6L 5FLMH 4DV3Q 1N8RC 1NTGA 3HKZE 1PH3A 5LMNW 1XPUA 1QUQA 4QQBX 1Z47A 1IYJB 3BZKA 2VUMH 4QL5A 2VQFL 5FJ8G 4KHPL 4HJ8A 4YHHQ 2NZHA 1PH1A 4A93H 1RIPA 4JI3L 5GAGC 5IY0A 1WFQA 4EQ5A 3RLOA 3A74A 4WJ4A 1TWGH 4X64Q 3PO3G 2ZTEA 1CSPA 1VQIA 1X3FA 3RZDH 3J7A5 3MXNB 1E22A 2JQOA 4YWLA 3M85A 1EUJA 1YHBA 4A3LH 3LGJA 2HT1A 2NVTH 5GQOA 1VQJA 2IY5B 1EOVA 3S1RH 1R9TH 4GKJQ 1YIJA 2K4KA 2ZJQA 3TRZA 3HKSA 5M3FH 4K0KL 1SLJA 3CCEA 5IYCG 2JEBI 5IP7G 1OXSC 1WI5A 1L2FA 3F2CA 2E2JH 1Q1BA 3HOXH 1QVGA 1XNRL 3CCUA 3PUWA 4X62L 4JYAL 4BBRG 3JAMc 4A3DG 3I4NG 3H15A 4BBSG 1NMGA 2ALYB 5LMUQ 2JA8H 1SN8A 1VS0A 4IPHA 4DUZQ 4JOIA 5C3EH 2UUBL 1FJGL 1KIXA 2KCTA 4YCWA 4BY7G 1PVOA 4AYBE 4O0AA 3DLLA 2A19A 1HZ9A 4A3CH 2K5VA 4JBMA 1RL2A 1IBKL 4A3BG 2OCEA 4HIOA 4UY8C 4A3GH 2F4VL 4OWXB 1HR0L 1XMOQ 1KRTA 2KHJA 5DLQE 5GROA 1NJIC 3J81i 2IHFA 4DUYQ 4DV3L 1PYSB 4JG2A 4R4IA 3OTOL 1VQAA 1WYDA 1DGSA 1TWCH 1QZGA 3HOZG 3ULLA 4DV7L 3S1NH 2OTJA 2N78A 1JT8A 2MO0A 3J80c 3S14H 1YITA 5IP9H 1VQLA 2C35B 4OWWB 1EYGA 4GKKQ 3PIPA 1HNZQ 4C3IH 1WCMG 2JE6I 4IJHA 1KC8C 4QJFA 1PYBA 2CKZB 3TS2A 2FXQA 4X6AH 4YWMA 4JOIC 2GN5A 4R4QA 3RLFA 4A3KH 1M1KC 5M5WH 3PF5A 1WOCA 1J6QA 3GD7A 1SROA 4LUZA 4XIGS 4DV2L 4GN4B 1TWHH 3CMEA 2R7ZH 5K36G 1P16A 3DM3A 1UWVA 4P73A 3GTQH 4OO1G 4XTCS 1GVPA 4GKJL 3RNUA 2NN6G 1C7YA 4LF6Q 3CD6A 1N33L 2EXDA 3T1YQ 3J81j 2EQSA 4A3MG 5AJ3Q 3D31A 3JC66 2VQEQ 2AWNA 3OYYA 2I5MX 3I55A 4IFDG 1M90C 3CW2C 1HH2P 4LWCA 4EX5A 1JE5A 4LF4Q 3M9BA 1KD1C 2WB1E 3PSIA 1YZ6A 3U58A 1Q81C 4DUZL 1EFWA 4B3SQ 4DR6L 4L5RC 4NXNQ 4OONA 3TQYA 4IFDJ 1D7QA 4IPDA 1PH2A 1U5KA 1K3RA 2VS1A 5IT9c 1Q8KA 5IWAQ 2MFIA 2NVQH 4J15A 4JBWA 2VW9A 3F2BA 1CSQA 4B3MQ 1KRSA 1XPRA 1G291 3HOWG 3KYHC 4BBSH 2Z6KA 3H0GH 2CCZA 4JI7Q 4HJ7A 3L0OA 3PF4A 4A3JG 4DR4Q 3I4MG 2JJQA 5H1SE 2UU9Q 2WAQE 2JEAI 1H95A 3IRBA 4JI5L 4R1JA 3STBD 1QVCA 4HJ5A 4FDBA 2MO1A 1YJNA 1WJJA 4A3BH 2R93G 5HGQA 3HFZB 4LF8Q 2XTIA 3PCOB 2B3GA 2B63G 1L1OA 1X54A 1UE1A 1X3EA 2YTYA 5LMNQ 1HNZL 3HOYG 4B3RQ 3H3VI 4DV0L 2Q2UA 3ER0A 1K0RA 2E8GA 2NVYH 2WP8J 4GN3B 4DV1L 1XPOA 3S2HH 4ALPA 4HJAA 4NPSA 3F2DA 2AKWB 1E1OA 4PZ6A 3T1HQ 4POFA 3S1MH 3PO2G 3GTLH 3A5ZB 1NY4A 4DR5Q 2CWPA 1GO3E 1UE7A 1I94Q 2EIFA 3F8TA 4DAYB 1Y1VH 1X9NA 2JA7G 1X55A 1KHIA 2YTVA 3M4PA 4GOPA 3T1YL 2UXCQ 3CC7A 3AFPA 3U50C 1VQMA 4MZ9A 1MKHA 3AQQA 1UE5A 4JI6L 1K83H 2DUDA 2GVBA 1I6HH 3CXCA 3HOUG 4R4TA 1OXUA 4LF4L 2Z0SA 3FKIG 3GTMH 4HJ9A 3K80C 2JA6G 1ASZA 3M7NA 4IOAA 2BH8A 4H02A 4P75A 4JI2Q 2B29A 4GN5A 4LFAQ 5M3MH 4A3MH 1A0IA 3Q8DA 4NXNL 1EIFA 4LNQA 1L1OC 1YBYA 4BA1I 4POGA 4JBJA 4AQYQ 5IWAL 2ZM6Q 1N36Q 1HR0W 1L1OB 3K81C 1K8GA 2WAQG 5IYDG 4YY3Q 4RG1A 4A3IH 4KLKA 4B3ML 2VL6A 4BY1G 5JJKA 1Q46A 1VQGA 1E3PA 5M5XH 1B8AA 3PIOA 4JI7L 4A3EH 3RLNA 3E9IA 1HZBA 2E5LQ 2UU9L 1K9MC 5IYBH 2NZOA 2K52A 4JI0Q 2R92G 5C44G 3KLWA 5C4JH 3CPWA 4OX9L 2BA1A 2LXJA 4GOPC 5C4XG 4BXXH 1QZHA 1MIUA 2ZJRA 1V1QA 4P72A 4OXPA 1YJ9A 3NENA 1IZ6A 4LF8L 4GOPB 3CF5A 4PZ7A 3HKZG 2UXDL 4LFCQ 4C2MH 5LMNL 1HNXQ 2R6GA 3AEVA 3M3YH 2VZAA 2K5HA 3GDEA 2IX0A 3ICEA 2RHQB 5FLXc 4IO9A 2R93H 1TWAH 3T1HL 1V9PA 2NVXH 2AWOA 4DK3C 4DR5L 4LF5Q 4OO1I 3OW2A 3KF8B 2NN6I 1I94L 1NBWA 2YTXA 3RN2A 1S40A 4YHHL 4HIMA 2Q2TA 3U4ZA 1KL9A 1HJPA 3K7AH 1C9OA 4JI8Q 2JA5G 1J5EQ 2UXCL 1NMFA 2ATWA 4LUVA 1BBWA 1OXXK 4UP9A 1MJCA 1C0AA 4DV5Q 4IFDI 4O2DA 3UE0A 4X64L 2UUAQ 2VY3A 3JAMi 3PO2H 3FHWA 1QVFA 1SR3A 3BU2A 3MEFA 5FJ8H 1X6OA 2PI2E 3KF6A 2UUCQ 4YWKA 3ERSX 4JI2L 3K0XA 1VQ7A 2N8NA 4LFAL 2R7FA 1VQFA 2AHOB 2ZTCA 1U0LA 3RN5A 1PV4A 3EIVA 1N36L 4X66Q 1JJGA 5FLMG 2ZM6L 3PO3H 3AYHB 3H3VH 2K5NA 3F1ZA 4YY3L 4Y7NH 4ME3A 3CCRA 4DV4Q 1B70B 1CKMA 2F3IA 2I5LX 2LSSA 3K8AA 5IE8A 3G6EA 2VUMG 2N3SA 3I4OA 3GTPH 2E2HH 3UDFA 1L0WA 4AYBG 4LFBQ 1A63A 4DV6Q 5LMUL 3M4QA 4MNOA 1S3OA 1BKBA 1YVCA 1A62A 3UE1A 4B3SL 3J80i 1AH9A 1YHAA 1YNXA 5IYCH 3S1QH 5E7NA 5IP7H 3BJUA 4UP8A 5C0XG 2VQFQ 3M4OH 3G48A 3CP0A 4KHPQ 4A3LG 1PH7A 4JI4Q 4LFCL 4GS3A 4BBRH 4A3DH
chains in the Genus database with same CATH superfamily
1EQRA 3IKJA 3I4NH 3NK9A 1SE4A 2H1EA 1QNUA 1K28A 1XMOL 2K5QA 4DR7Q 4P74A 2NVQB 1HZCA 5J1ZA 4BY7H 4NDXA 2YV5A 1E1TA 4LF5L 1KNEA 4QIWE 4OWTB 4C3JH 1FVIA 3U4VA 1PFBA 5ELNA 2OQKA 1PTOB 4DV5L 4FF3A 3I7FA 5I6WA 4HIKA 1JWUD 4LUOA 4DNIA 4X62Q 1G2SA 3OWEB 3L9AX 4ZUIA 3KOJA 1S72A 1OXTA 2NVYB 2WB1G 5L37A 1IL2A 4NXMQ 3BZCA 1GKHA 1IBMQ 1NE3A 1B44D 4XT3B 5C5LA 2GA4B 5CGKA 4FF4A 2DJFC 2IPKD 3GTGH 4DAPA 1JMCA 3L2PA 2NN6H 3TREA 2HUGA 2NZ1D 1CZWA 2KBNA 1K73C 5DAUA 4A3KG 3DWAA 3W3AA 4JI4L 5A35A 2R7ZG 1GM5A 1SFOH 4ZAIA 4A3MB 2ENBA 4DNTB 2L11A 3B6YA 4B3TL 3SK6A 2O4XA 1L0YB 2OWOA 1NCVA 2MJ8A 5HY6A 3RMHA 5I9OA 1PYWD 1SNPA 1X3PA 1IHZA 2A1AA 1T9HA 4L5QA 1VQPA 1SYBA 3RR5A 3A8JE 3HOVG 3D6CA 2K50A 2CQOA 4JI1L 2YYZA 5CMDA 2QCPX 1Y8OB 2F4IA 4A3FG 1I3QH 2L55A 4JK1C 4FVMA 1M4VA 2B63H 2TMPA 1LM0A 5COYA 4ZUJA 3CCMA 3HOYH 2LS01 4Y52H 3ZJYC 4EQOA 3G4SA 3UDIA 2R93B 1TWAB 2EY6A 3KBGA 1Y1WG 2ES2A 2FFKB 4R4CA 1W2BA 4APVA 1ICFB 1YNJC 1BBUA 4Q0FA 2D0OA 1CKNA 4ZKCB 3G71A 2EJMA 2R3ZA 3J7YW 2UXBQ 4AQYL 3PO2B 3T4AC 4KI0A 2OXPA 3FKIH 5HGTA 1EWIA 3I56A 1IBLL 3I90A 4RMFA 1GOZA 1G51A 2HIXA 2QILA 1MI2A 4LF9L 3KLRA 1EZ6A 4Y7NB 2CHBD 2L9HA 5IYDH 1PRTC 3FP9A 1TY0A 2C9OA 2BA0A 4ZQ3A 3VA5A 2E2HB 1X32A 2B8GA 4Z9CB 4JI3Q 2XSCA 3D4RA 1DXMA 3D0FA 3KLSX 3RD4A 2CWAA 1VCIA 2A6HC 3L7ZC 2F3VA 2HQLA 1FL0A 1XJVA 4CKEA 3BVMA 4BBRB 1XNQL 4J6HA 2KHIA 5JPMC 4N9TA 4A3EG 1PTOC 2J4XA 1P8LA 4DR1L 3CC2A 4JI8L 2K28A 2DGYA 4EQPA 1I4RA 1QILA 4DGZA 1H9JA 2EYPA 3K7UC 5M5YB 3MXNA 2HDLA 4TQUS 1H9MA 3A8IE 4OX9Q 5CV9A 4X66L 2K75A 3HOZB 2E2IB 1K8MA 1B53A 4X65L 2UXDQ 2OQ0A 1T5XD 3DWQA 4GLVB 2EY2A 3S24A 4JV5L 1S5FD 1HA6A 5KEEA 2F4VQ 1N34L 2BE5C 1LV9A 5FLMH 4DV3Q 3HKZE 4QQBX 2JN4A 2VQFL 1WD0A 4H0LC 4KHPL 4HJ8A 4YHHQ 2EPBA 1RIPA 4H7BA 5CC4A 2WIIB 1U4RA 4JVZA 2XRSD 1ET6A 1CSPA 1VQIA 3J7A5 1CZGA 2QKIC 4YWLA 1NUCA 1JE4A 2AQ1B 1BCPD 2NVTH 2MGSA 5GQOA 4KJOA 2IY5B 1R9TH 4GKJQ 3K5NA 1YIJA 2LMCB 4QUCA 1F9SA 4U68A 5D3DA 1XNRL 4X62L 2K1BA 3I4NG 1D1KA 3H15A 2IX3A 1NMGA 2ALYB 3WOFA 2A68C 4UDUC 4IPHA 1AZPA 4F7XA 5E4WC 4BY7G 1PVOA 5DM73 4O0AA 3DLLA 4RA8A 1DONA 5I2YA 4UY8C 2KHJA 3U9SA 5DLQE 4RKBA 4G7OC 2VB2X 3S17B 4UAIA 4HMIA 1I50B 4HAEA 3J80c 4IUTA 1VQLA 4GKKQ 1F9QA 1HNZQ 4IJHA 1I4GA 1J9OA 2PZWA 3TS2A 4YWMA 2IWHA 2GN5A 4R4QA 4ME5A 3Q24A 2XRQD 3D3RA 4PV1C 4LUZA 4GN4B 1TWHH 3QOJA 1LTSD 3GTQH 4XTCS 1GVPA 2NN6G 3H91A 3CD6A 3J7AF 4A3MG 2EQSA 2K7VA 2B2WA 2WAQB 1HQMC 2F0IA 4LMQD 3S9WA 2VQEQ 3OYYA 1TWHB 2I5MX 5EKKA 1M90C 1LTID 1HH2P 1STYA 4LWCA 4EX5A 1JE5A 1TVXA 3FRPB 4IURA 1YZ6A 4B3SQ 4DUZL 1EFWA 2R92B 1D7QA 4OONA 2BCOA 4IPDA 3BVZA 3NQIA 3AB9A 1SMYD 1K3RA 3HS0C 2VS1A 4RKLA 1Q8KA 5JVH3 4DAYA 1HCZA 1SEBD 3K5OA 1SYFA 1EZ8A 2XWBB 3F2BA 1TWFB 2XWJB 3GTKB 4BBSH 2CCZA 3E3XA 3L0OA 4RCOA 1JCKB 3R3OA 3C2PA 1ESRA 2WAQE 3IRBA 2X6GA 3STBD 2RDFA 3J81E 2A6ED 4DF7A 4MHEA 4IUVA 1YJNA 1WJJA 1VF5C 2EYFA 2F0WA 1F9RA 3HFZB 5D14A 3NXWA 1WTXA 2R93G 4ZLTF 2LFNA 2B63G 1X54A 1UE1A 3HOYG 2YU9B 4XDXA 1K0RA 3S2HH 2K32A 4NKLA 2SNMA 1Y69U 4RHSA 2AKWB 1E1OA 4POFA 3S1MH 3PO2G 3A5ZB 4ZRZA 1GO3E 1HFNA 1UE7A 2EIFA 3F8TA 2CW0C 2EVBA 1G2TA 3T53B 2YTVA 3AFPA 1EEID 5I9PA 3ZYYX 3U50C 1Q3LA 1UE5A 2DUDA 2GVBA 1I6HH 4K2LA 4K8IA 1D6EC 3DEOA 3FKIG 4KKUA 1ASZA 4H02A 5ELFA 4JI2Q 5M3MH 1YNND 1A0IA 4NXNL 1EIFA 4TRDA 1YBYA 4JBJA 1N36Q 1HR0W 3FPUB 3J80E 3RZDB 2F03A 5IYDG 4B3ML 4KLKA 5JJKA 2L4NA 5M3MB 4JI7L 3PIOA 1E3PA 4G7ZC 3A54A 3E9IA 2RKSA 1XWEA 2NZOA 3FVQA 3KLWA 5C4JH 1EQTA 4OX9L 2BA1A 1A2UA 1V1QA 4P72A 3NENA 4LF8L 4PZ7A 3HKZG 4C1NK 2UXDL 5E4XA 4LFCQ 1RODA 1STBA 4K8JA 4KJNA 4B9XA 1PRTF 1KAAA 1TT2A 3A7LA 5EPJA 1S5ED 1S4ZA 2RHQB 1MD2D 1I4XA 1D1IA 4F88A 3T1HL 2AWOA 4LF5Q 4DR5L 3OW2A 2NN6I 2E76C 1I94L 1S40A 2Q2TA 4YHHL 1C8CA 1MSGA 3H6MA 3NTHA 3NQTA 5CV5A 3U4ZA 4FXDA 3K7AH 1C9OA 4CHTB 1O7YA 1J8IA 1KDCA 4WFN3 1MJCA 1CA6A 4DV5Q 3UE0A 2UUAQ 3FHWA 5JPNC 4V190 3P1HA 3OOCA 1EU3A 3KF6A 1DM0B 4YWKA 3K0XA 1ENAA 2N8NA 4PMCA 1VQ7A 4LFAL 1VQFA 3EFXD 3RN5A 1MBYA 5IGGA 5FLMG 3PO3H 3H3VH 4CGYB 2F0FA 2AQ2B 4A3KB 2K5NA 2SNSA 4ME3A 3G6EA 1STEA 3C1EA 5J39A 2R7ZB 2B2VA 3UDFA 1L0WA 3QIAA 1IYUA 2CVRA 3TZDA 3GQBA 1JICA 4UHVA 5M9OA 3PIO3 1WTOA 1YNXA 5IYCH 1B3QA 2HDMA 3M4OH 3G48A 1PH7A 4JI4Q 1HPCA 3SDZA 1IW7C 1GUOA 5D3IB 4WJ3M 1JJCB 2PW7A 1KDBA 2RQXA 3CC4A 3W1BA 4B3TQ 2KOLA 3C46A 3MFYA 4PMWA 1JQYD 1ILPA 4GKKL 2B2VC 2FMCA 3EVQA 4DAMA 4JI1Q 4R8NA 1A3TA 1LYLA 3CPFA 3R2IA 3GTJH 2F0HA 1O80A 1IKMA 4FP5D 5FK9C 3JAME 3A5UA 4XYOA 3NBHB 3N52A 4RGNA 1G6PA 4G7HC 4G57A 1EQQA 3VR4A 1FJGQ 1FYCA 2Z6KC 2JK8A 1VQ5A 3GO5A 3HP3A 1PH6A 5GAEC 1EY0A 2VQEL 4HIDA 3X3NA 4OO1H 2RHSB 4FNFA 1D2BA 3A0JA 2NTTA 2PQAB 2IHEA 1BOSA 5ELDA 5J22A 3N6RA 5IGCA 1A2TA 2G9HD 3Q0AA 4IFDH 4GLAC 3GTMB 3PUVA 4LK1C 3EBEA 1FNVA 2RA4A 1IBLQ 4JCVE 2ZJPA 5FO8B 4KN4C 3OHXC 3ULJA 1PH8A 1N32L 5C5MA 2HIVA 1W3SA 5C0XH 1Q86C 4LF9Q 3L3OC 3BVGA 2ID0A 2K5WA 3FEWX 3TN2A 1S5CD 5M5XB 4A3EB 4A3JH 1AN8A 3NWTA 1EQVA 3KK7A 2KUMA 3PUZA 1G6ZA 1GUWA 1I5FA 1CM9A 2K05A 3SK4A 5E3FA 1XNQQ 1TXYA 1BUVT 2F0MA 3F2UA 5I4DA 3EROA 3RUZA 3S15H 5ELBA 4DR1Q 5IT9E 4BA2I 4OGQC 1U4MA 1XTDA 4CDCC 1TS5A 1RHPA 4TVAB 5I2XA 5JEAH 1X56A 5KRUA 1NR4A 1AE3A 3SVMA 2RCNA 2ICIA 2JA7H 1F77A 1B1ZA 4IUUA 4J1MA 4DPGA 4LW1A 2D62A 2A8VA 2Q8TA 3HOUH 2F0DA 4RH6A 4X65Q 3ULPA 1Y14B 4JV5Q 4OELB 4QIWB 1EYDA 4PQXA 3H3VC 4PMBA 5KYIA 4R4OA 1N34Q 2K14A 1ZKOA 3OIQA 4B08A 5IOCA 2QGQA 4PZ8A 4UPAA 5FO9B 4BY1H 2VB3X 3EN2A 4GNXA 1LTLA 1N9WA 1FNWA 1A6XA 1PRTB 1V43A 3GTPB 3I70A 5M3MG 1CT1D 4DR3L 3I91A 3PQIA 1VQ8A 4IJLA 1Y8PB 1X3GA 4RWSC 3T16A 5C44H 4P71A 1Q82C 2HQEA 2EY1A 1EY5A 1UE6A 2B2TA 1K8AC 1CKNB 2RVLA 2FINB 5IGEA 2PQAA 1CQVA 2OTLA 2ZT9C 3I4NB 1VQEA 3TP5A 1BF4A 1TY2A 3UDGA 5KGUA 3I2ZA 1V1PA 3S2DH 4L5TA 4CKCA 3IAYA 4BY7B 4UP7A 4XQNA 4JPBW 4HCEA 2UUAL 2F3WA 3QOLA 3V05A 1XNRQ 1AP0A 4C3JB 4GNXC 3CCSA 4A76A 2KENA 1TS2A 2AQ3B 3KJPA 4K5VA 2NYZD 1AZQA 1EU4A 1PA6A 1A3UA 3BZDB 4IQZA 2B2TC 1K8OA 1ONLA 2R7DA 4N8FA 1XXGA 5KNBA 4RGOS 5JJLA 2QEXA 2F0TA 5BR8L 1SSOA 3OSOA 5FLXE 1NTGA 4BS9A 1PH3A 1VMPA 1XPUA 3E5SA 1TKWB 2VUMH 3GTGB 5BN5A 4A93H 4CJ2C 5IY0A 4FYDA 3A74A 1TWGH 3PO3G 2LY7A 4K2KA 2ZTEA 3MXNB 4O42A 5IGFA 3D6WA 4A3LH 4AYBB 5EQ0A 2HT1A 1SFOB 1GHKA 1EOVA 2N88A 4DK0A 3HEJA 5IYCG 4X3UA 2E2JH 3HOXH 1FD7D 3CCUA 4KKSA 2OF1A 5FKAC 2JA8H 2B39A 4DUZQ 4FXGC 5C3EH 1FJGL 3TMEA 1KIXA 4ZCKA 1I3QB 4YCWA 4AYBE 3V2TA 1HZ9A 1WTVA 2NBFA 2B63B 4A3GH 3HOYB 1NR2A 3VYTA 3J81i 2WACA 1PYSB 1SNOA 1VQAA 1WYDA 1DGSA 1QZGA 1I4PA 1DCZA 2MO0A 3S14H 3NSWA 1YITA 5IP9H 4OWWB 4QCLA 3PIPA 1ML0D 3BDCA 4C3IH 2EYLA 3R8BA 5JAVA 1XX8A 4XQQA 2FXQA 1RCVD 3RLFA 5EBDA 4DXGA 1A3VA 4CDDC 3FKIB 3GD7A 2SOBA 5K36G 5CBEE 4OIJA 3SXHA 3DM3A 4P73A 4OO1G 1SYDA 5DNFA 1D5XC 1MGSA 1C7YA 1JB3A 2FHTA 4ZYSA 2EXDA 5JJZA 3D31A 1HXYD 1HHVA 1EIGA 1TR5A 3JC66 2AWNA 1CI3M 4IFDG 3CW2C 2E2DC 2TSSA 5BN4A 2Z4HA 3VYRA 4IFDJ 4ILWA 4NXNQ 3TQYA 4M1UB 2KECA 2MFIA 4B3MQ 1CSQA 3HKZB 1KRSA 1XPRA 1G291 1H9KA 2ICEC 1BXTA 3H0GH 4JI7Q 1RTOA 4A3JG 3Q22A 1BNZA 5C3XA 2JEAI 3JAML 1DYQA 1I4HA 4A3BH 4LF8Q 1EEFD 2XTIA 2B3GA 1H9SA 1L1OA 1NNXA 4B3RQ 3H3VI 2Q2UA 3ER0A 4GN3B 1SAPA 4HJAA 1YNJD 3PIP3 1SYCA 3T1HQ 2QDLA 3GTLH 1NY4A 3OPOA 4DR5Q 2CWPA 1I94Q 4DAYB 1Y1VH 2MP1A 2JA7G 1X55A 2ZXPA 3T1YL 3CC7A 3URYA 1CHQD 3I72A 4MZ9A 2Q8IB 1HUNA 1K83H 5EPKA 1LT3D 1FGBD 3HOUG 4R4TA 2Z0SA 3M7NA 1DOLA 1LO5D 1PRTD 4GN5A 4LFAQ 4LNQA 1L1OC 3MVVA 4IN3A 1JWSD 3KF8A 5IWAL 2CQAA 2DNEA 1K8GA 2I07B 4A3IH 1QE6A 2IJ0A 2VL6A 4BY1G 1WTQA 2A69D 4DNRB 2O5JC 2NVTB 4WORA 1B8AA 2ZXRA 1R9TB 1HZBA 2E5LQ 2A6HD 3VR5A 1K9MC 5IYBH 2UU9L 2DNCA 5C44G 3CPWA 4DK1A 4BXXH 2F0UA 2AUKA 1PTOD 1YJ9A 1E2VA 4C2MH 1TS3A 1HQRD 1ILQA 5ELEA 4C3JG 4OL7A 1BDOA 1UNSA 3M3YH 2K5HA 3CRKC 1X3QA 3GDEA 2EYOA 4M8AA 4P2CB 2NVXH 4X3SA 4DK3C 4OO1I 2Z8LA 3RN2A 4HIMA 3M3YB 1B4OA 1KL9A 1HJPA 3AU7A 1E2WA 5C4ZA 4O1NA 1BBWA 1OXXK 2XIWA 3H94A 4UP9A 4IFDI 2PNRC 3JAMi 1RJTA 4LJZC 1LLRD 4V0BA 1SR3A 2BE5D 5FJ8H 1X6OA 3P20A 3SR1A 3ERSX 1U4PA 2KVMA 4CDEC 4ODGA 2ZTCA 1U0LA 1PV4A 3CCRA 1CKMA 2F3IA 2I5LX 1QOHA 4CDFC 5IE8A 2VUMG 1DOKA 4I7AA 3GTQB 2M00A 4AYBG 2SDFA 2BOSA 1V8QA 4MNOA 2EZVA 2DY7A 1S3OA 1S5DD 2EJGC 3UE1A 1YNNC 3S1QH 2Z4IA 1VF7A 1EIHA 1F2YA 5EBCA 4DN4M 4A3LG 3MZ5A 1LTTD 4GS3A 4A3DH 4C3HH 4L63B 3DHQA 1YJWA 1HNXL 3BS1A 4GLXA 1CHPD 2B2UA 2K33A 5C4XH 4KKTA 1N32Q 3KF6B 2Q2HA 2A68D 3HOXG 4BBSB 1I6VC 1G8ZD 2B2WC 3CQZH 3LX0A 3KLSA 2M2LA 1O7LA 4DKAC 4HSPA 1ZYRC 1J5EL 1LTBD 2JA8G 5C3EG 4K6DA 4K0KQ 3IL8A 1O7IA 2L0CA 3PMFA 1LTRD 3IFTA 1PFSA 2AMCB 1M8AA 3NELA 4FF2A 4QF4A 2UUCL 2JA5H 2KJXA 5EAYA 1WCMH 2F52A 3S2HB 3W1GA 1UEBA 1GXDC 1BBXC 2V4DA 1KAWA 2B2UC 3S1MB 3HGBA 4RAUC 5JVG3 4JW0A 2PZTA 4A4IA 2L15A 5IP9G 4C3IG 3CCJA 2D2CC 3QO2A 1SNQA 3CAMA 3MXPA 4K5WA 1I6HB 1A15A 3D4DA 2JA9A 1Q7YC 3NP8A 2F0JA 1II3A 1YEZA 3VR2A 1Q1EA 3PV0A 2HHHL 3MTSA 5EJWA 3TEHB 1JR0D 5GADC 1EL0A 3UDXA 3LNNA 1PH9A 1SJHD 3CCVA 4DV2Q 1PH4A 2EYMA 2F0VA 2IX1A 3HOWH 3NEMA 3S16H 1CK1A 5CYUA 3I4MH 2IW3A 3KJOA 1N33Q 1OTCA 3T13A 1CFMA 4DR3Q 1VQOA 1Y8NB 3HG9A 5C4JB 2PNHA 1SYEA 3TSSA 3Q23A 4EGVA 3E9HA 2Z6BA 2BH2A 3HZXA 2KHSA 4PG3A 3H0GG 1KNAA 5AFWA 2LKVA 5ELOA 3CCLA 2LXKA 1GJXA 1TU2B 3KDFA 3PUXA 1SE2A 5CBAE 1HTLD 3RZOH 4LF7L 3J7ZC 3VDYA 5CORA 1UEAB 4HEDA 1E24A 1Z7TA 2PQEA 1O7ZA 3I73A 3MFGA 1QB5D 3K7AB 1Z9FA 1PH5A 4JI5Q 1XMQL 3GTOH 3LWEA 1W6KA 2DJGC 4H13C 1B50A 1EYCA 3NWSA 1VQ4A 2CW0D 1SMXA 1Q90A 2B2YA 3E6ZX 1GD7A 3KBXA 2Z9HA 1GHJA 2JA6H 4EQNA 3CU7A 1Y1VG 3E0EA 2E5LL 2Y0SG 1X65A 1HNWL 2RDGA 3PO3B 5BR8Q 4DR2L 2F0NA 3G7LA 1Z6HA 5EGTA 1PHJA 3MXGA 1SNMA 4QY7A 4NB3A 4MTNA 1SE3A 1AE2A 5T1IA 2PCFB 2RSNA 4N9PA 1MJEA 1AFPA 3W2DA 2GVAA 3KFUA 1IXRA 4HSVA 1YI2A 1KQSA 1VQ9A 3CHBD 3M4OB 4A3IG 1WTWA 1T5EA 2F0KA 2G5DA 2OT2A 4X3KA 3HOVH 2KEEA 4KMUC 2VXWA 5IYBG 4A3FH 1SE8A 4I7ZC 4KHVA 5IGDA 2G9DA 1ET9A 4BXXG 1SRUA 1ENFA 2NB0A 5JOBA 3AFQA 2Q2IA 1KLGD 5G3LF 1JOOA 2MQHA 2EYHA 4KK7A 4IPGA 3PGZA 4GNXB 1Y1WH 3OMCA 5A2QE 1VQHA 3M7GA 3MA2B 1DOMA 2B8FA 3CCQA 3GTJB 1LTGD 5NUCA 2F0OA 3UI2A 1EIYB 1A8VA 4YCVA 1ESFA 3QWNA 5CV8A 1EY7A 4KY5A 4F87A 5LMNW 1Z47A 3BZKA 1V1PB 2EOTA 4QL5A 5FJ8G 4TSSA 1PH1A 3LWUA 1L0XB 4C56C 5GAGC 4G4KA 1WFQA 4QMGA 1HA5A 3RLOA 3A55A 4X64Q 1EYAA 3OWFA 3VR3A 5DEHA 1E22A 2JQOA 3M85A 1YHBA 2JP1A 3LGJA 3R2TA 1LTAD 4RFBA 3S1RH 1SXTA 2M9VA 2K4KA 2ZJQA 3TRZA 2WKCA 5M3FH 4K0KL 1SLJA 3CCEA 1JORA 4RHRA 1L2FA 3F2CA 1Q1BA 3P7JA 1QVGA 3DMUA 4KD3A 4A3JB 1EY6A 4XQJA 4C3HG 4A3DG 4BBSG 5LMUQ 1SN8A 2A74C 1OO9B 1IKLA 1B9NA 2J7ZA 4QUFA 1RTNA 3IFDA 3WOEA 4A3CH 3BDLA 1C48A 2K5VA 4JBMA 1IBKL 4HIOA 1HR0L 3S15B 1KRTA 1NJIC 4DUYQ 2IHFA 4CBVA 4N8X1 4R4IA 3VA7A 1TWCH 1E0BA 1U4LA 3ULLA 3S1NH 2OTJA 1JT8A 2I46A 2JA7B 1EYGA 1DD2A 3FPPA 2L1BA 1KLUD 4DFAA 1BQQT 1WCMG 4HMJA 5I6YA 2BDOA 3MWYW 5ISRA 1M1KC 3HOUB 1GUGA 1R4QB 5M5WH 1STAA 1WOCA 1CTMA 1J6QA 4DV2L 1TS4A 1R4PB 3CMEA 1NSNS 1P16A 1UWVA 1GUSA 1K3BC 3RNUA 3NE5B 1PDQA 4LF6Q 1N33L 3T1YQ 4WJWA 3J81j 1AEXA 5AJ3Q 1IL8A 4OHJA 3C3LA 1EWCA 4BY1B 2WV6D 3I55A 3Q6SA 1RF2D 1PFMA 3TBIB 4L5RC 3P75A 5E1FA 3J81L 5C44B 1PH2A 5K5PA 5IWAQ 2NVQH 1BCPB 4J15A 2F0QA 2RSOA 4JBWA 5D65A 3HOWG 3KYHC 4HJ7A 4HN7A 1JOKA 3PF4A 4DR4Q 3I4MG 3S2DB 2UU9Q 4H44C 1PTOH 2MHVA 1H9RA 1H95A 4JI5L 1QVCA 5EKIA 5HGQA 1VDZA 3HRZC 1PZID 4IUNA 4DU9A 3SK8A 1DJRD 2NVYH 2O2LD 4ALPA 4IZ8A 2L12A 4NPSA 1UAPA 5IODA 3AMUA 3A7AB 1LT4D 2K6AA 2WINB 2KCNA 1KHIA 2KQ3A 4GOPA 4KTAA 3A56A 3J80L 1MKHA 3AQQA 3KUPA 3QG1A 2F1MA 1XTCD 3CXCA 1WVLA 2VUMB 3TP8A 4LF4L 4HJ9A 2JA6G 4A93B 2F0SA 5F2DA 2ASBA 4P75A 4A3MH 3Q8DA 1C4QA 5LHY1 1TWGB 1SBBB 4POGA 3T51B 1H9SB 1L1OB 1EY8A 1JWMD 4HR7B 1VQGA 3NBIA 4KD4A 3C1FA 3RLNA 2PYKA 1STGA 5IIFA 4JI0Q 1ZEQX 2MUYA 4GOPC 2JYOA 1QZHA 2ZJRA 4KY6A 4OXPA 2E2JB 1IZ6A 3HOXB 3CF5A 3SEBA 4OEMB 1EWHA 2BDNA 5LMNL 2PW5A 3E0JA 2JA8B 1HNXQ 2R6GA 3AEVA 5C3EB 2VZAA 3M4YA 2F0EA 2R93H 2Q8RE 1GUTA 1TWAH 3QR8A 1F2MA 4IALA 1V1OA 2PZUA 3KF8B 4R9WA 2RCFA 4A3GB 4S3SA 4F8MA 1J5EQ 2UXCL 1SYGA 1B9MA 2HCIA 2K01A 1C0AA 5KNCA 4O2DA 4X64L 2VY3A 3PO2H 1QVFA 1ZXTA 3MEFA 3K5LA 2PI2E 3S14B 2UUCQ 2JXMB 3EA6A 2AHOB 4C3IB 2CH4A 3EIVA 5IGBA 2ZXOA 2ZM6L 1HUMA 4YY3L 3OMGA 3VYSA 4Y7NH 4DV4Q 1D5ZC 2LSSA 3K8AA 4I65A 4XYQA 3MC0B 4MN3A 2E2HH 1A63A 3DM1A 4DV6Q 5LMUL 4HCSA 5CR3A 1A62A 1BCPC 3J80i 2Z1CA 1YHAA 5DM63 1RKNA 2F0PA 4ABNA 5IP7H 5C0XG 2CH4W 4FO2A 3CP0A 3SK5A 3GV6A 1BR9A 4BBRH 5C0XJ 2A69C 5CV4A 1PZJD 1ASYA 5EPLA 1JB7A 1KXLA 2HHHQ 1HRJA 4DUYL 1S5BD 5M3FG 1PXUA 1XYIA 4JBKA 3DEPA 2NWGA 1VMCA 2PPBC 3H0GB 5A2QL 3GV3A 5M5YH 2VNUD 2XVSA 3SHLA 3MXUA 2E2IH 3HOZH 4A3BB 5GAHC 4JYAQ 1CUKA 2QA4A 5JEAG 4A3CG 3WWVA 2XNAC 5JEAJ 2UUBQ 5EKLA 4LF6L 2CFMA 3K6OA 2A5HA 2I5HA 2FMMA 5AJ3L 3I8ZA 2PI2A 3FMCA 4LF7Q 3GTLB 1STNA 3OIPA 4GZYC 2XGTA 1Y1VB 1VQNA 4LFBL 2Y0SB 2K5DA 1Q8IA 3OTOQ 1LUZA 5ELCA 1XMQQ 3D4WA 2I0QA 2R61A 1K83B 4DV7Q 4YIJA 5CV7A 3NHHA 3CMAA 4B3RL 2V1CC 2FJ2A 2EE1A 4ID6A 1BVSA 1U9RA 4DR4L 4DR7L 3SGIA 1VQ6A 1HNWQ 3NTKA 4DR2Q 1LABA 4A3IB 2E74C 3ONAB 3J81c 1W6JA 2QW7A 3EQLC 1HTPA 4A75A 1GUNA 3VYUA 1SMYC 2Y0SE 5JJIA 5IT9L 4AIMA 1E7ZA 3BDOA 1YHQA 4IOCA 2EY5A 3QJYA 3A8KE 1QUQB 4C2MB 3STBC 2N55A 2A6EC 2KCMA 4DR6Q 4RGTA 2MNAA 2WFWA 3D8GA 4KHZA 1VQDA 4NXML 3S17H 1K0SA 3TS0A 1TQOA 1IBML 5J3BA 2NVXB 1FGUA 1I50H 4DK6C 2D0PA 1BO0A 3BYYB 5FO7B 2ZTDA 2K04A 5C0XI 2MPMA 5HURA 1O78A 5CV6A 2RF4A 4NMZA 4L5SA 4QGUA 4C1NI 1VQBA 3WDNA 2D5DA 4A93G 2X6LA 4DV0Q 2IT1A 4DV1Q 3MEHA 3W5OA 4JI0L 1CA5A 1QCBD 4X3TA 2PMZB 2H4OA 3O13A 5G3LD 3KDFB 4E6IA 5TSSA 2R92H 3R93A 4JI6Q 1B3AA 3S1QB 4KV6A 2XN9C 1D8LA 1TWFH 2E75C 4ULLA 3TZUA 4A3DB 3GTKH 4IPCA 4C3HB 1B7YB 4OIKA 1VQCA 4MTKA 5C4XB 1Q12A 2PMZE 3TDQA 4FXKC 4Q5VA 2O5IC 1OXVA 3V96A 4LAAA 1KTKA 1CKOA 2EXZA 3CQZB 3NUCA 4AH6A 3ND9A 1JJ2A 4A3GG 5FLXL 2YU9H 2UXBL 1HZAA 3TP7A 4DAVA 1E2ZA 3PUYA 1JOQA 4DV4L 2K03A 2JA5B 1IBKQ 1VQKA 1HR0Q 1WCMB 2N49A 2H5XA 1SJED 4JC0A 4YCUA 4DV6L 1N8RC 1F2ZA 1QUQA 1HFGA 1QJOA 1IYJB 4IUQA 5BN3A 1G91A 2NZHA 4K5XA 4CJ0B 4JI3L 3X3MA 4EQ5A 3I3CA 4IUPA 4WJ4A 4TKOB 4KN7C 1X3FA 2F0GA 3RZDH 1EUJA 4ZKBB 1KABA 1VQJA 2SEBD 1LT6D 1QNKA 3DXJC 1NAPA 2KA7A 3H09A 4L6TB 3HKSA 3VR6A 5LL6X 2JEBI 5IP7G 1LACA 1OXSC 1WI5A 4RCNA 3HOWB 3GP7A 1MSHA 1PFNA 4JYAL 3PUWA 3S16B 4BBRG 3JAMc 3I4MB 1VS0A 3OW7A 4JOIA 2L5TA 3ITPA 2UUBL 2HCCA 2KCTA 1ZYRD 3K58A 4NW2A 2A19A 4A3BG 1RL2A 2QEJC 2OCEA 1BCPF 2F4VL 2IL8A 3BYTB 2JSOA 4OWXB 1XMOQ 1B2TA 5GROA 1PLFA 4DV3L 4JG2A 1ENCA 3OTOL 1WD1A 3RZOB 1FNUA 3HOZG 4DV7L 1EY4A 2N78A 2C35B 1F2LA 1QG7A 1DZ1A 2WB1B 2DY8A 4CJ1B 1IYVA 4XT1B 2JE6I 1KC8C 3GTOB 4QJFA 1PYBA 2CKZB 4X6AH 1PMRA 4JOIC 3BG3A 1PTOF 4A3KH 3PF5A 2JA6B 4XIGS 2R7ZH 1SROA 4B9WA 2EYJA 1RDPD 1SNDA 3FDTA 4GKJL 1QWYA 1WTRA 2KCCA 3K57A 2PO4A 2RDHA 1FR3A 4LF4Q 3T56B 3M9BA 1KD1C 2WB1E 3PSIA 3U58A 2B2YC 1Q81C 4DR6L 3G6JB 1U5KA 5IT9c 2VW9A 3MAQA 2Z6KA 3HOVB 1TIID 2JJQA 4BWGB 4DA2A 1EY9A 5H1SE 3J7AV 4A3FB 4L8JA 4R1JA 4HJ5A 4FDBA 2MO1A 3MHBA 5C4HA 4ZK9B 3PCOB 5KIXA 2YTYA 1HNZL 5LMNQ 1X3EA 4EVOA 3NPPA 2NTSA 4DV0L 1Y1WB 2E8GA 2WP8J 3SE0A 4DV1L 1XPOA 4QB4A 4RGMA 3F2DA 1JC7A 2EDGA 4PZ6A 2C5CA 1WTHA 2DN8A 4U673 1X9NA 1ICWA 3M4PA 2UXCQ 1VQMA 3K0YA 4JI6L 5T1GA 2P5ZX 1STHA 5K36H 3U9OA 3CRLC 1EFID 1OXUA 2J0TD 2X69A 3GTMH 3K80C 3NTIA 4IOAA 2BH8A 4B3SL 2B29A 5C3WA 1F9PA 4BA1I 4AQYQ 3EJIA 2ZM6Q 3K81C 2WAQG 1IW7D 2D9UA 4RG1A 4YY3Q 1CQFA 1Q46A 4WRDA 5M5XH 3DWPA 4A3EH 3S1RB 1RD9D 2R92G 2K52A 5FOBB 5M3FB 2LXJA 5C4XG 4PNYA 1MIUA 4GOPB 4FF1A 5LL6S 2EJFC 5KYLA 2QF7A 2NUCA 1UUPA 2IX0A 4DXFA 3ICEA 4NP5A 4XXEA 2AUJD 5FLXc 4IO9A 4K6LA 1I4QA 2RBMA 2QDBA 1V9PA 3QB3A 4HTHA 4R8IA 1NBWA 2YTXA 2JA5G 4JI8Q 1D5MC 1NMFA 4LUVA 2ATWA 1TWCB 5C6AA 3S1NB 3BU2A 2KEDA 3TP6A 4CKBA 4J8QA 4JI2L 2WKDA 1AW7A 2R7FA 1MHWC 2A73B 1SDFA 1N36L 4X66Q 1JJGA 3AYHB 4K14A 1KDAA 3F1ZA 1B70B 1EOTA 5M5WB 4KY7A 3I4LA 2N3SA 3I4OA 1SNCA 2OEOA 3GTPH 4LFBQ 2F0LA 1WTPA 3M4QA 4MIUA 3K59A 3DUZA 1BKBA 1YVCA 5KNDA 1LT5D 1AH9A 1PZKD 3K5MA 3NBHA 2HD3A 5E7NA 3BJUA 4UP8A 2VQFQ 3ND8A 3CKIB 4KHPQ 4LFCL 3ERQA
chains in the Genus database with same CATH topology
1EQRA 4C3HH 3I4NH 4WJ3M 5C0XJ 1YJWA 1JJCB 1ASYA 1HNXL 1JB7A 1KXLA 1XMOL 4GLXA 2HHHQ 4DR7Q 5C4XH 3CC4A 4DUYL 3W1BA 4P74A 1N32Q 3KF6B 5M3FG 4B3TQ 1HZCA 4JBKA 4BY7H 2YV5A 2Q2HA 1E1TA 4LF5L 4QIWE 3HOXG 4OWTB 3CQZH 4PMWA 4C3JH 4DKAC 1FVIA 5M5YH 3U4VA 4GKKL 5ELNA 1J5EL 2OQKA 2JA8G 4DAMA 2VNUD 5C3EG 4K0KQ 4JI1Q 4DV5L 3I7FA 1O7IA 4HIKA 2E2IH 3HOZH 1LYLA 3CPFA 4LUOA 3GTJH 4DNIA 5GAHC 4JYAQ 1PFSA 2AMCB 3NELA 1CUKA 4X62Q 2QA4A 5JEAG 4A3CG 3WWVA 3A5UA 2UUCL 3KOJA 2JA5H 3NBHB 1S72A 1G6PA 5EAYA 1EQQA 5JEAJ 1OXTA 1WCMH 2F52A 2UUBQ 1FJGQ 2Z6KC 3W1GA 4LF6L 1UEBA 2CFMA 2WB1G 2JK8A 2I5HA 4NXMQ 1IL2A 5AJ3L 3BZCA 1KAWA 1VQ5A 1GKHA 2PI2A 1NE3A 3GO5A 1IBMQ 1PH6A 5GAEC 4LF7Q 2VQEL 4HIDA 3GTGH 2XGTA 1JMCA 4A4IA 5IP9G 2L15A 1VQNA 4LFBL 2RHSB 3L2PA 3TREA 3A0JA 2PQAB 2IHEA 3OTOQ 3CCJA 1LUZA 2KBNA 1XMQQ 2I0QA 3CAMA 4DV7Q 1K73C 4A3KG 4JI4L 4GLAC 2JA9A 3CMAA 1Q7YC 4B3RL 3PUVA 2R7ZG 2V1CC 3EBEA 1GM5A 1YEZA 1IBLQ 1SFOH 1BVSA 4JCVE 2ZJPA 1Q1EA 3PV0A 2HHHL 4DR4L 4DR7L 3SGIA 1VQ6A 3B6YA 3ULJA 1PH8A 3TEHB 1HNWQ 1N32L 2HIVA 1W3SA 5GADC 4DR2Q 1Q86C 3UDXA 4B3TL 4LF9Q 2OWOA 3J81c 5HY6A 1PH9A 3CCVA 4DV2Q 2ID0A 1PH4A 3HOWH 2IX1A 3NEMA 4A75A 2A1AA 2Y0SE 1T9HA 4A3JH 3S16H 5JJIA 4L5QA 1VQPA 3I4MH 3RR5A 3KJOA 1N33Q 4AIMA 4DR3Q 1VQOA 1OTCA 3HOVG 3PUZA 1E7ZA 2K50A 2CQOA 4JI1L 2PNHA 2YYZA 1I5FA 1YHQA 4A3FG 4IOCA 1I3QH 3E9HA 2BH2A 1QUQB 2B63H 4PG3A 3STBC 3H0GG 1XNQQ 1TXYA 1LM0A 2KCMA 3CCMA 5ELOA 3HOYH 4DR6Q 4Y52H 3CCLA 2LXKA 3S15H 3ZJYC 2WFWA 2MNAA 3KDFA 4KHZA 3G4SA 4DR1Q 4BA2I 3UDIA 1VQDA 4NXML 3S17H 3PUXA 3TS0A 1XTDA 1Y1WG 1IBML 3RZOH 5J3BA 4TVAB 3J7ZC 3VDYA 1FGUA 1I50H 1X56A 2ES2A 4LF7L 4DK6C 1E24A 2D0PA 4R4CA 1AE3A 2RCNA 1W2BA 4APVA 2JA7H 1BBUA 2D0OA 2ZTDA 1Z9FA 1CKNA 3G71A 1PH5A 4JI5Q 5C0XI 4DPGA 1XMQL 4LW1A 3GTOH 2UXBQ 2D62A 4AQYL 2A8VA 1VQ4A 1SMXA 4KI0A 3HOUH 2RF4A 4L5SA 4QGUA 4X65Q 3FKIH 1GD7A 2JA6H 1VQBA 1EWIA 3I56A 1Y14B 4RMFA 3ULPA 1IBLL 4JV5Q 1Y1VG 4A93G 3E0EA 2E5LL 2Y0SG 4DV0Q 1X65A 2IT1A 1HNWL 4DV1Q 4R4OA 3W5OA 1N34Q 1G51A 2K14A 4JI0L 5BR8Q 2HIXA 4DR2L 2QGQA 4PZ8A 4LF9L 5IYDH 1PHJA 4UPAA 4BY1H 4QY7A 4NB3A 4MTNA 3EN2A 4GNXA 1AE2A 3FP9A 1LTLA 1N9WA 3KDFB 1V43A 1MJEA 2BA0A 2GVAA 4JI3Q 5M3MG 4DR3L 2ASBA 3KFUA 1IXRA 1VQ8A 2R92H 1YI2A 4IJLA 1X3GA 5C44H 3D0FA 4P71A 1Q82C 1KQSA 4JI6Q 2CWAA 1VQ9A 1VCIA 1UE6A 3L7ZC 4A3IG 1D8LA 1K8AC 1CKNB 2HQLA 1TWFH 1FL0A 1XJVA 2PQAA 2OTLA 4IPCA 1XNQL 3GTKH 2KHIA 1VQEA 3HOVH 1B7YB 4A3EG 3UDGA 1VQCA 3I2ZA 1P8LA 4DR1L 3CC2A 4JI8L 5IYBG 1Q12A 4L5TA 4A3FH 2PMZE 3S2DH 1SE8A 1OXVA 2DGYA 4UP7A 4BXXG 2UUAL 1SRUA 1CKOA 2Q2IA 3AFQA 1XNRQ 4AH6A 2MQHA 3K7UC 4GNXC 4TQUS 3CCSA 1JJ2A 4IPGA 4A76A 4A3GG 2YU9H 3PGZA 2KENA 4GNXB 1Y1WH 4OX9Q 2UXBL 3KJPA 1HZAA 4X66L 1VQHA 2K75A 3PUYA 3CCQA 4X65L 4DV4L 1PA6A 2UXDQ 2OQ0A 4GLVB 3S24A 4JV5L 1IBKQ 2R7DA 1VQKA 1EIYB 1A8VA 5JJLA 2F4VQ 4YCVA 2QEXA 1HR0Q 2N49A 2H5XA 4JC0A 1N34L 4YCUA 5BR8L 4DV6L 5FLMH 4DV3Q 1N8RC 1NTGA 3HKZE 1PH3A 5LMNW 1XPUA 1QUQA 4QQBX 1Z47A 1IYJB 3BZKA 2VUMH 4QL5A 2VQFL 5FJ8G 4KHPL 4HJ8A 4YHHQ 2NZHA 1PH1A 4A93H 1RIPA 4JI3L 5GAGC 5IY0A 1WFQA 4EQ5A 3RLOA 3A74A 4WJ4A 1TWGH 4X64Q 3PO3G 2ZTEA 1CSPA 1VQIA 1X3FA 3RZDH 3J7A5 3MXNB 1E22A 2JQOA 4YWLA 3M85A 1EUJA 1YHBA 4A3LH 3LGJA 2HT1A 2NVTH 5GQOA 1VQJA 2IY5B 1EOVA 3S1RH 1R9TH 4GKJQ 1YIJA 2K4KA 2ZJQA 3TRZA 3HKSA 5M3FH 4K0KL 1SLJA 3CCEA 5IYCG 2JEBI 5IP7G 1OXSC 1WI5A 1L2FA 3F2CA 2E2JH 1Q1BA 3HOXH 1QVGA 1XNRL 3CCUA 3PUWA 4X62L 4JYAL 4BBRG 3JAMc 4A3DG 3I4NG 3H15A 4BBSG 1NMGA 2ALYB 5LMUQ 2JA8H 1SN8A 1VS0A 4IPHA 4DUZQ 4JOIA 5C3EH 2UUBL 1FJGL 1KIXA 2KCTA 4YCWA 4BY7G 1PVOA 4AYBE 4O0AA 3DLLA 2A19A 1HZ9A 4A3CH 2K5VA 4JBMA 1RL2A 1IBKL 4A3BG 2OCEA 4HIOA 4UY8C 4A3GH 2F4VL 4OWXB 1HR0L 1XMOQ 1KRTA 2KHJA 5DLQE 5GROA 1NJIC 3J81i 2IHFA 4DUYQ 4DV3L 1PYSB 4JG2A 4R4IA 3OTOL 1VQAA 1WYDA 1DGSA 1TWCH 1QZGA 3HOZG 3ULLA 4DV7L 3S1NH 2OTJA 2N78A 1JT8A 2MO0A 3J80c 3S14H 1YITA 5IP9H 1VQLA 2C35B 4OWWB 1EYGA 4GKKQ 3PIPA 1HNZQ 4C3IH 1WCMG 2JE6I 4IJHA 1KC8C 4QJFA 1PYBA 2CKZB 3TS2A 2FXQA 4X6AH 4YWMA 4JOIC 2GN5A 4R4QA 3RLFA 4A3KH 1M1KC 5M5WH 3PF5A 1WOCA 1J6QA 3GD7A 1SROA 4LUZA 4XIGS 4DV2L 4GN4B 1TWHH 3CMEA 2R7ZH 5K36G 1P16A 3DM3A 1UWVA 4P73A 3GTQH 4OO1G 4XTCS 1GVPA 4GKJL 3RNUA 2NN6G 1C7YA 4LF6Q 3CD6A 1N33L 2EXDA 3T1YQ 3J81j 2EQSA 4A3MG 5AJ3Q 3D31A 3JC66 2VQEQ 2AWNA 3OYYA 2I5MX 3I55A 4IFDG 1M90C 3CW2C 1HH2P 4LWCA 4EX5A 1JE5A 4LF4Q 3M9BA 1KD1C 2WB1E 3PSIA 1YZ6A 3U58A 1Q81C 4DUZL 1EFWA 4B3SQ 4DR6L 4L5RC 4NXNQ 4OONA 3TQYA 4IFDJ 1D7QA 4IPDA 1PH2A 1U5KA 1K3RA 2VS1A 5IT9c 1Q8KA 5IWAQ 2MFIA 2NVQH 4J15A 4JBWA 2VW9A 3F2BA 1CSQA 4B3MQ 1KRSA 1XPRA 1G291 3HOWG 3KYHC 4BBSH 2Z6KA 3H0GH 2CCZA 4JI7Q 4HJ7A 3L0OA 3PF4A 4A3JG 4DR4Q 3I4MG 2JJQA 5H1SE 2UU9Q 2WAQE 2JEAI 1H95A 3IRBA 4JI5L 4R1JA 3STBD 1QVCA 4HJ5A 4FDBA 2MO1A 1YJNA 1WJJA 4A3BH 2R93G 5HGQA 3HFZB 4LF8Q 2XTIA 3PCOB 2B3GA 2B63G 1L1OA 1X54A 1UE1A 1X3EA 2YTYA 5LMNQ 1HNZL 3HOYG 4B3RQ 3H3VI 4DV0L 2Q2UA 3ER0A 1K0RA 2E8GA 2NVYH 2WP8J 4GN3B 4DV1L 1XPOA 3S2HH 4ALPA 4HJAA 4NPSA 3F2DA 2AKWB 1E1OA 4PZ6A 3T1HQ 4POFA 3S1MH 3PO2G 3GTLH 3A5ZB 1NY4A 4DR5Q 2CWPA 1GO3E 1UE7A 1I94Q 2EIFA 3F8TA 4DAYB 1Y1VH 1X9NA 2JA7G 1X55A 1KHIA 2YTVA 3M4PA 4GOPA 3T1YL 2UXCQ 3CC7A 3AFPA 3U50C 1VQMA 4MZ9A 1MKHA 3AQQA 1UE5A 4JI6L 1K83H 2DUDA 2GVBA 1I6HH 3CXCA 3HOUG 4R4TA 1OXUA 4LF4L 2Z0SA 3FKIG 3GTMH 4HJ9A 3K80C 2JA6G 1ASZA 3M7NA 4IOAA 2BH8A 4H02A 4P75A 4JI2Q 2B29A 4GN5A 4LFAQ 5M3MH 4A3MH 1A0IA 3Q8DA 4NXNL 1EIFA 4LNQA 1L1OC 1YBYA 4BA1I 4POGA 4JBJA 4AQYQ 5IWAL 2ZM6Q 1N36Q 1HR0W 1L1OB 3K81C 1K8GA 2WAQG 5IYDG 4YY3Q 4RG1A 4A3IH 4KLKA 4B3ML 2VL6A 4BY1G 5JJKA 1Q46A 1VQGA 1E3PA 5M5XH 1B8AA 3PIOA 4JI7L 4A3EH 3RLNA 3E9IA 1HZBA 2E5LQ 2UU9L 1K9MC 5IYBH 2NZOA 2K52A 4JI0Q 2R92G 5C44G 3KLWA 5C4JH 3CPWA 4OX9L 2BA1A 2LXJA 4GOPC 5C4XG 4BXXH 1QZHA 1MIUA 2ZJRA 1V1QA 4P72A 4OXPA 1YJ9A 3NENA 1IZ6A 4LF8L 4GOPB 3CF5A 4PZ7A 3HKZG 2UXDL 4LFCQ 4C2MH 5LMNL 1HNXQ 2R6GA 3AEVA 3M3YH 2VZAA 2K5HA 3GDEA 2IX0A 3ICEA 2RHQB 5FLXc 4IO9A 2R93H 1TWAH 3T1HL 1V9PA 2NVXH 2AWOA 4DK3C 4DR5L 4LF5Q 4OO1I 3OW2A 3KF8B 2NN6I 1I94L 1NBWA 2YTXA 3RN2A 1S40A 4YHHL 4HIMA 2Q2TA 3U4ZA 1KL9A 1HJPA 3K7AH 1C9OA 4JI8Q 2JA5G 1J5EQ 2UXCL 1NMFA 2ATWA 4LUVA 1BBWA 1OXXK 4UP9A 1MJCA 1C0AA 4DV5Q 4IFDI 4O2DA 3UE0A 4X64L 2UUAQ 2VY3A 3JAMi 3PO2H 3FHWA 1QVFA 1SR3A 3BU2A 3MEFA 5FJ8H 1X6OA 2PI2E 3KF6A 2UUCQ 4YWKA 3ERSX 4JI2L 3K0XA 1VQ7A 2N8NA 4LFAL 2R7FA 1VQFA 2AHOB 2ZTCA 1U0LA 3RN5A 1PV4A 3EIVA 1N36L 4X66Q 1JJGA 5FLMG 2ZM6L 3PO3H 3AYHB 3H3VH 2K5NA 3F1ZA 4YY3L 4Y7NH 4ME3A 3CCRA 4DV4Q 1B70B 1CKMA 2F3IA 2I5LX 2LSSA 3K8AA 5IE8A 3G6EA 2VUMG 2N3SA 3I4OA 3GTPH 2E2HH 3UDFA 1L0WA 4AYBG 4LFBQ 1A63A 4DV6Q 5LMUL 3M4QA 4MNOA 1S3OA 1BKBA 1YVCA 1A62A 3UE1A 4B3SL 3J80i 1AH9A 1YHAA 1YNXA 5IYCH 3S1QH 5E7NA 5IP7H 3BJUA 4UP8A 5C0XG 2VQFQ 3M4OH 3G48A 3CP0A 4KHPQ 4A3LG 1PH7A 4JI4Q 4LFCL 4GS3A 4BBRH 4A3DH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQR A;  4C3H H;  3I4N H;  4WJ3 M;  5C0X J;  1YJW A;  1JJC B;  1ASY A;  1HNX L;  1JB7 A;  1KXL A;  1XMO L;  4GLX A;  2HHH Q;  4DR7 Q;  5C4X H;  3CC4 A;  4DUY L;  3W1B A;  4P74 A;  1N32 Q;  3KF6 B;  5M3F G;  4B3T Q;  1HZC A;  4JBK A;  4BY7 H;  2YV5 A;  2Q2H A;  1E1T A;  4LF5 L;  4QIW E;  3HOX G;  4OWT B;  3CQZ H;  4PMW A;  4C3J H;  4DKA C;  1FVI A;  5M5Y H;  3U4V A;  4GKK L;  5ELN A;  1J5E L;  2OQK A;  2JA8 G;  4DAM A;  2VNU D;  5C3E G;  4K0K Q;  4JI1 Q;  4DV5 L;  3I7F A;  1O7I A;  4HIK A;  2E2I H;  3HOZ H;  1LYL A;  3CPF A;  4LUO A;  3GTJ H;  4DNI A;  5GAH C;  4JYA Q;  1PFS A;  2AMC B;  3NEL A;  1CUK A;  4X62 Q;  2QA4 A;  5JEA G;  4A3C G;  3WWV A;  3A5U A;  2UUC L;  3KOJ A;  2JA5 H;  3NBH B;  1S72 A;  1G6P A;  5EAY A;  1EQQ A;  5JEA J;  1OXT A;  1WCM H;  2F52 A;  2UUB Q;  1FJG Q;  2Z6K C;  3W1G A;  4LF6 L;  1UEB A;  2CFM A;  2WB1 G;  2JK8 A;  2I5H A;  4NXM Q;  1IL2 A;  5AJ3 L;  3BZC A;  1KAW A;  1VQ5 A;  1GKH A;  2PI2 A;  1NE3 A;  3GO5 A;  1IBM Q;  1PH6 A;  5GAE C;  4LF7 Q;  2VQE L;  4HID A;  3GTG H;  2XGT A;  1JMC A;  4A4I A;  5IP9 G;  2L15 A;  1VQN A;  4LFB L;  2RHS B;  3L2P A;  3TRE A;  3A0J A;  2PQA B;  2IHE A;  3OTO Q;  3CCJ A;  1LUZ A;  2KBN A;  1XMQ Q;  2I0Q A;  3CAM A;  4DV7 Q;  1K73 C;  4A3K G;  4JI4 L;  4GLA C;  2JA9 A;  3CMA A;  1Q7Y C;  4B3R L;  3PUV A;  2R7Z G;  2V1C C;  3EBE A;  1GM5 A;  1YEZ A;  1IBL Q;  1SFO H;  1BVS A;  4JCV E;  2ZJP A;  1Q1E A;  3PV0 A;  2HHH L;  4DR4 L;  4DR7 L;  3SGI A;  1VQ6 A;  3B6Y A;  3ULJ A;  1PH8 A;  3TEH B;  1HNW Q;  1N32 L;  2HIV A;  1W3S A;  5GAD C;  4DR2 Q;  1Q86 C;  3UDX A;  4B3T L;  4LF9 Q;  2OWO A;  3J81 c;  5HY6 A;  1PH9 A;  3CCV A;  4DV2 Q;  2ID0 A;  1PH4 A;  3HOW H;  2IX1 A;  3NEM A;  4A75 A;  2A1A A;  2Y0S E;  1T9H A;  4A3J H;  3S16 H;  5JJI A;  4L5Q A;  1VQP A;  3I4M H;  3RR5 A;  3KJO A;  1N33 Q;  4AIM A;  4DR3 Q;  1VQO A;  1OTC A;  3HOV G;  3PUZ A;  1E7Z A;  2K50 A;  2CQO A;  4JI1 L;  2PNH A;  2YYZ A;  1I5F A;  1YHQ A;  4A3F G;  4IOC A;  1I3Q H;  3E9H A;  2BH2 A;  1QUQ B;  2B63 H;  4PG3 A;  3STB C;  3H0G G;  1XNQ Q;  1TXY A;  1LM0 A;  2KCM A;  3CCM A;  5ELO A;  3HOY H;  4DR6 Q;  4Y52 H;  3CCL A;  2LXK A;  3S15 H;  3ZJY C;  2WFW A;  2MNA A;  3KDF A;  4KHZ A;  3G4S A;  4DR1 Q;  4BA2 I;  3UDI A;  1VQD A;  4NXM L;  3S17 H;  3PUX A;  3TS0 A;  1XTD A;  1Y1W G;  1IBM L;  3RZO H;  5J3B A;  4TVA B;  3J7Z C;  3VDY A;  1FGU A;  1I50 H;  1X56 A;  2ES2 A;  4LF7 L;  4DK6 C;  1E24 A;  2D0P A;  4R4C A;  1AE3 A;  2RCN A;  1W2B A;  4APV A;  2JA7 H;  1BBU A;  2D0O A;  2ZTD A;  1Z9F A;  1CKN A;  3G71 A;  1PH5 A;  4JI5 Q;  5C0X I;  4DPG A;  1XMQ L;  4LW1 A;  3GTO H;  2UXB Q;  2D62 A;  4AQY L;  2A8V A;  1VQ4 A;  1SMX A;  4KI0 A;  3HOU H;  2RF4 A;  4L5S A;  4QGU A;  4X65 Q;  3FKI H;  1GD7 A;  2JA6 H;  1VQB A;  1EWI A;  3I56 A;  1Y14 B;  4RMF A;  3ULP A;  1IBL L;  4JV5 Q;  1Y1V G;  4A93 G;  3E0E A;  2E5L L;  2Y0S G;  4DV0 Q;  1X65 A;  2IT1 A;  1HNW L;  4DV1 Q;  4R4O A;  3W5O A;  1N34 Q;  1G51 A;  2K14 A;  4JI0 L;  5BR8 Q;  2HIX A;  4DR2 L;  2QGQ A;  4PZ8 A;  4LF9 L;  5IYD H;  1PHJ A;  4UPA A;  4BY1 H;  4QY7 A;  4NB3 A;  4MTN A;  3EN2 A;  4GNX A;  1AE2 A;  3FP9 A;  1LTL A;  1N9W A;  3KDF B;  1V43 A;  1MJE A;  2BA0 A;  2GVA A;  4JI3 Q;  5M3M G;  4DR3 L;  2ASB A;  3KFU A;  1IXR A;  1VQ8 A;  2R92 H;  1YI2 A;  4IJL A;  1X3G A;  5C44 H;  3D0F A;  4P71 A;  1Q82 C;  1KQS A;  4JI6 Q;  2CWA A;  1VQ9 A;  1VCI A;  1UE6 A;  3L7Z C;  4A3I G;  1D8L A;  1K8A C;  1CKN B;  2HQL A;  1TWF H;  1FL0 A;  1XJV A;  2PQA A;  2OTL A;  4IPC A;  1XNQ L;  3GTK H;  2KHI A;  1VQE A;  3HOV H;  1B7Y B;  4A3E G;  3UDG A;  1VQC A;  3I2Z A;  1P8L A;  4DR1 L;  3CC2 A;  4JI8 L;  5IYB G;  1Q12 A;  4L5T A;  4A3F H;  2PMZ E;  3S2D H;  1SE8 A;  1OXV A;  2DGY A;  4UP7 A;  4BXX G;  2UUA L;  1SRU A;  1CKO A;  2Q2I A;  3AFQ A;  1XNR Q;  4AH6 A;  2MQH A;  3K7U C;  4GNX C;  4TQU S;  3CCS A;  1JJ2 A;  4IPG A;  4A76 A;  4A3G G;  2YU9 H;  3PGZ A;  2KEN A;  4GNX B;  1Y1W H;  4OX9 Q;  2UXB L;  3KJP A;  1HZA A;  4X66 L;  1VQH A;  2K75 A;  3PUY A;  3CCQ A;  4X65 L;  4DV4 L;  1PA6 A;  2UXD Q;  2OQ0 A;  4GLV B;  3S24 A;  4JV5 L;  1IBK Q;  2R7D A;  1VQK A;  1EIY B;  1A8V A;  5JJL A;  2F4V Q;  4YCV A;  2QEX A;  1HR0 Q;  2N49 A;  2H5X A;  4JC0 A;  1N34 L;  4YCU A;  5BR8 L;  4DV6 L;  5FLM H;  4DV3 Q;  1N8R C;  1NTG A;  3HKZ E;  1PH3 A;  5LMN W;  1XPU A;  1QUQ A;  4QQB X;  1Z47 A;  1IYJ B;  3BZK A;  2VUM H;  4QL5 A;  2VQF L;  5FJ8 G;  4KHP L;  4HJ8 A;  4YHH Q;  2NZH A;  1PH1 A;  4A93 H;  1RIP A;  4JI3 L;  5GAG C;  5IY0 A;  1WFQ A;  4EQ5 A;  3RLO A;  3A74 A;  4WJ4 A;  1TWG H;  4X64 Q;  3PO3 G;  2ZTE A;  1CSP A;  1VQI A;  1X3F A;  3RZD H;  3J7A 5;  3MXN B;  1E22 A;  2JQO A;  4YWL A;  3M85 A;  1EUJ A;  1YHB A;  4A3L H;  3LGJ A;  2HT1 A;  2NVT H;  5GQO A;  1VQJ A;  2IY5 B;  1EOV A;  3S1R H;  1R9T H;  4GKJ Q;  1YIJ A;  2K4K A;  2ZJQ A;  3TRZ A;  3HKS A;  5M3F H;  4K0K L;  1SLJ A;  3CCE A;  5IYC G;  2JEB I;  5IP7 G;  1OXS C;  1WI5 A;  1L2F A;  3F2C A;  2E2J H;  1Q1B A;  3HOX H;  1QVG A;  1XNR L;  3CCU A;  3PUW A;  4X62 L;  4JYA L;  4BBR G;  3JAM c;  4A3D G;  3I4N G;  3H15 A;  4BBS G;  1NMG A;  2ALY B;  5LMU Q;  2JA8 H;  1SN8 A;  1VS0 A;  4IPH A;  4DUZ Q;  4JOI A;  5C3E H;  2UUB L;  1FJG L;  1KIX A;  2KCT A;  4YCW A;  4BY7 G;  1PVO A;  4AYB E;  4O0A A;  3DLL A;  2A19 A;  1HZ9 A;  4A3C H;  2K5V A;  4JBM A;  1RL2 A;  1IBK L;  4A3B G;  2OCE A;  4HIO A;  4UY8 C;  4A3G H;  2F4V L;  4OWX B;  1HR0 L;  1XMO Q;  1KRT A;  2KHJ A;  5DLQ E;  5GRO A;  1NJI C;  3J81 i;  2IHF A;  4DUY Q;  4DV3 L;  1PYS B;  4JG2 A;  4R4I A;  3OTO L;  1VQA A;  1WYD A;  1DGS A;  1TWC H;  1QZG A;  3HOZ G;  3ULL A;  4DV7 L;  3S1N H;  2OTJ A;  2N78 A;  1JT8 A;  2MO0 A;  3J80 c;  3S14 H;  1YIT A;  5IP9 H;  1VQL A;  2C35 B;  4OWW B;  1EYG A;  4GKK Q;  3PIP A;  1HNZ Q;  4C3I H;  1WCM G;  2JE6 I;  4IJH A;  1KC8 C;  4QJF A;  1PYB A;  2CKZ B;  3TS2 A;  2FXQ A;  4X6A H;  4YWM A;  4JOI C;  2GN5 A;  4R4Q A;  3RLF A;  4A3K H;  1M1K C;  5M5W H;  3PF5 A;  1WOC A;  1J6Q A;  3GD7 A;  1SRO A;  4LUZ A;  4XIG S;  4DV2 L;  4GN4 B;  1TWH H;  3CME A;  2R7Z H;  5K36 G;  1P16 A;  3DM3 A;  1UWV A;  4P73 A;  3GTQ H;  4OO1 G;  4XTC S;  1GVP A;  4GKJ L;  3RNU A;  2NN6 G;  1C7Y A;  4LF6 Q;  3CD6 A;  1N33 L;  2EXD A;  3T1Y Q;  3J81 j;  2EQS A;  4A3M G;  5AJ3 Q;  3D31 A;  3JC6 6;  2VQE Q;  2AWN A;  3OYY A;  2I5M X;  3I55 A;  4IFD G;  1M90 C;  3CW2 C;  1HH2 P;  4LWC A;  4EX5 A;  1JE5 A;  4LF4 Q;  3M9B A;  1KD1 C;  2WB1 E;  3PSI A;  1YZ6 A;  3U58 A;  1Q81 C;  4DUZ L;  1EFW A;  4B3S Q;  4DR6 L;  4L5R C;  4NXN Q;  4OON A;  3TQY A;  4IFD J;  1D7Q A;  4IPD A;  1PH2 A;  1U5K A;  1K3R A;  2VS1 A;  5IT9 c;  1Q8K A;  5IWA Q;  2MFI A;  2NVQ H;  4J15 A;  4JBW A;  2VW9 A;  3F2B A;  1CSQ A;  4B3M Q;  1KRS A;  1XPR A;  1G29 1;  3HOW G;  3KYH C;  4BBS H;  2Z6K A;  3H0G H;  2CCZ A;  4JI7 Q;  4HJ7 A;  3L0O A;  3PF4 A;  4A3J G;  4DR4 Q;  3I4M G;  2JJQ A;  5H1S E;  2UU9 Q;  2WAQ E;  2JEA I;  1H95 A;  3IRB A;  4JI5 L;  4R1J A;  3STB D;  1QVC A;  4HJ5 A;  4FDB A;  2MO1 A;  1YJN A;  1WJJ A;  4A3B H;  2R93 G;  5HGQ A;  3HFZ B;  4LF8 Q;  2XTI A;  3PCO B;  2B3G A;  2B63 G;  1L1O A;  1X54 A;  1UE1 A;  1X3E A;  2YTY A;  5LMN Q;  1HNZ L;  3HOY G;  4B3R Q;  3H3V I;  4DV0 L;  2Q2U A;  3ER0 A;  1K0R A;  2E8G A;  2NVY H;  2WP8 J;  4GN3 B;  4DV1 L;  1XPO A;  3S2H H;  4ALP A;  4HJA A;  4NPS A;  3F2D A;  2AKW B;  1E1O A;  4PZ6 A;  3T1H Q;  4POF A;  3S1M H;  3PO2 G;  3GTL H;  3A5Z B;  1NY4 A;  4DR5 Q;  2CWP A;  1GO3 E;  1UE7 A;  1I94 Q;  2EIF A;  3F8T A;  4DAY B;  1Y1V H;  1X9N A;  2JA7 G;  1X55 A;  1KHI A;  2YTV A;  3M4P A;  4GOP A;  3T1Y L;  2UXC Q;  3CC7 A;  3AFP A;  3U50 C;  1VQM A;  4MZ9 A;  1MKH A;  3AQQ A;  1UE5 A;  4JI6 L;  1K83 H;  2DUD A;  2GVB A;  1I6H H;  3CXC A;  3HOU G;  4R4T A;  1OXU A;  4LF4 L;  2Z0S A;  3FKI G;  3GTM H;  4HJ9 A;  3K80 C;  2JA6 G;  1ASZ A;  3M7N A;  4IOA A;  2BH8 A;  4H02 A;  4P75 A;  4JI2 Q;  2B29 A;  4GN5 A;  4LFA Q;  5M3M H;  4A3M H;  1A0I A;  3Q8D A;  4NXN L;  1EIF A;  4LNQ A;  1L1O C;  1YBY A;  4BA1 I;  4POG A;  4JBJ A;  4AQY Q;  5IWA L;  2ZM6 Q;  1N36 Q;  1HR0 W;  1L1O B;  3K81 C;  1K8G A;  2WAQ G;  5IYD G;  4YY3 Q;  4RG1 A;  4A3I H;  4KLK A;  4B3M L;  2VL6 A;  4BY1 G;  5JJK A;  1Q46 A;  1VQG A;  1E3P A;  5M5X H;  1B8A A;  3PIO A;  4JI7 L;  4A3E H;  3RLN A;  3E9I A;  1HZB A;  2E5L Q;  2UU9 L;  1K9M C;  5IYB H;  2NZO A;  2K52 A;  4JI0 Q;  2R92 G;  5C44 G;  3KLW A;  5C4J H;  3CPW A;  4OX9 L;  2BA1 A;  2LXJ A;  4GOP C;  5C4X G;  4BXX H;  1QZH A;  1MIU A;  2ZJR A;  1V1Q A;  4P72 A;  4OXP A;  1YJ9 A;  3NEN A;  1IZ6 A;  4LF8 L;  4GOP B;  3CF5 A;  4PZ7 A;  3HKZ G;  2UXD L;  4LFC Q;  4C2M H;  5LMN L;  1HNX Q;  2R6G A;  3AEV A;  3M3Y H;  2VZA A;  2K5H A;  3GDE A;  2IX0 A;  3ICE A;  2RHQ B;  5FLX c;  4IO9 A;  2R93 H;  1TWA H;  3T1H L;  1V9P A;  2NVX H;  2AWO A;  4DK3 C;  4DR5 L;  4LF5 Q;  4OO1 I;  3OW2 A;  3KF8 B;  2NN6 I;  1I94 L;  1NBW A;  2YTX A;  3RN2 A;  1S40 A;  4YHH L;  4HIM A;  2Q2T A;  3U4Z A;  1KL9 A;  1HJP A;  3K7A H;  1C9O A;  4JI8 Q;  2JA5 G;  1J5E Q;  2UXC L;  1NMF A;  2ATW A;  4LUV A;  1BBW A;  1OXX K;  4UP9 A;  1MJC A;  1C0A A;  4DV5 Q;  4IFD I;  4O2D A;  3UE0 A;  4X64 L;  2UUA Q;  2VY3 A;  3JAM i;  3PO2 H;  3FHW A;  1QVF A;  1SR3 A;  3BU2 A;  3MEF A;  5FJ8 H;  1X6O A;  2PI2 E;  3KF6 A;  2UUC Q;  4YWK A;  3ERS X;  4JI2 L;  3K0X A;  1VQ7 A;  2N8N A;  4LFA L;  2R7F A;  1VQF A;  2AHO B;  2ZTC A;  1U0L A;  3RN5 A;  1PV4 A;  3EIV A;  1N36 L;  4X66 Q;  1JJG A;  5FLM G;  2ZM6 L;  3PO3 H;  3AYH B;  3H3V H;  2K5N A;  3F1Z A;  4YY3 L;  4Y7N H;  4ME3 A;  3CCR A;  4DV4 Q;  1B70 B;  1CKM A;  2F3I A;  2I5L X;  2LSS A;  3K8A A;  5IE8 A;  3G6E A;  2VUM G;  2N3S A;  3I4O A;  3GTP H;  2E2H H;  3UDF A;  1L0W A;  4AYB G;  4LFB Q;  1A63 A;  4DV6 Q;  5LMU L;  3M4Q A;  4MNO A;  1S3O A;  1BKB A;  1YVC A;  1A62 A;  3UE1 A;  4B3S L;  3J80 i;  1AH9 A;  1YHA A;  1YNX A;  5IYC H;  3S1Q H;  5E7N A;  5IP7 H;  3BJU A;  4UP8 A;  5C0X G;  2VQF Q;  3M4O H;  3G48 A;  3CP0 A;  4KHP Q;  4A3L G;  1PH7 A;  4JI4 Q;  4LFC L;  4GS3 A;  4BBR H;  4A3D H; 
#chains in the Genus database with same CATH topology
 1EQR A;  3IKJ A;  3I4N H;  3NK9 A;  1SE4 A;  2H1E A;  1QNU A;  1K28 A;  1XMO L;  2K5Q A;  4DR7 Q;  4P74 A;  2NVQ B;  1HZC A;  5J1Z A;  4BY7 H;  4NDX A;  2YV5 A;  1E1T A;  4LF5 L;  1KNE A;  4QIW E;  4OWT B;  4C3J H;  1FVI A;  3U4V A;  1PFB A;  5ELN A;  2OQK A;  1PTO B;  4DV5 L;  4FF3 A;  3I7F A;  5I6W A;  4HIK A;  1JWU D;  4LUO A;  4DNI A;  4X62 Q;  1G2S A;  3OWE B;  3L9A X;  4ZUI A;  3KOJ A;  1S72 A;  1OXT A;  2NVY B;  2WB1 G;  5L37 A;  1IL2 A;  4NXM Q;  3BZC A;  1GKH A;  1IBM Q;  1NE3 A;  1B44 D;  4XT3 B;  5C5L A;  2GA4 B;  5CGK A;  4FF4 A;  2DJF C;  2IPK D;  3GTG H;  4DAP A;  1JMC A;  3L2P A;  2NN6 H;  3TRE A;  2HUG A;  2NZ1 D;  1CZW A;  2KBN A;  1K73 C;  5DAU A;  4A3K G;  3DWA A;  3W3A A;  4JI4 L;  5A35 A;  2R7Z G;  1GM5 A;  1SFO H;  4ZAI A;  4A3M B;  2ENB A;  4DNT B;  2L11 A;  3B6Y A;  4B3T L;  3SK6 A;  2O4X A;  1L0Y B;  2OWO A;  1NCV A;  2MJ8 A;  5HY6 A;  3RMH A;  5I9O A;  1PYW D;  1SNP A;  1X3P A;  1IHZ A;  2A1A A;  1T9H A;  4L5Q A;  1VQP A;  1SYB A;  3RR5 A;  3A8J E;  3HOV G;  3D6C A;  2K50 A;  2CQO A;  4JI1 L;  2YYZ A;  5CMD A;  2QCP X;  1Y8O B;  2F4I A;  4A3F G;  1I3Q H;  2L55 A;  4JK1 C;  4FVM A;  1M4V A;  2B63 H;  2TMP A;  1LM0 A;  5COY A;  4ZUJ A;  3CCM A;  3HOY H;  2LS0 1;  4Y52 H;  3ZJY C;  4EQO A;  3G4S A;  3UDI A;  2R93 B;  1TWA B;  2EY6 A;  3KBG A;  1Y1W G;  2ES2 A;  2FFK B;  4R4C A;  1W2B A;  4APV A;  1ICF B;  1YNJ C;  1BBU A;  4Q0F A;  2D0O A;  1CKN A;  4ZKC B;  3G71 A;  2EJM A;  2R3Z A;  3J7Y W;  2UXB Q;  4AQY L;  3PO2 B;  3T4A C;  4KI0 A;  2OXP A;  3FKI H;  5HGT A;  1EWI A;  3I56 A;  1IBL L;  3I90 A;  4RMF A;  1GOZ A;  1G51 A;  2HIX A;  2QIL A;  1MI2 A;  4LF9 L;  3KLR A;  1EZ6 A;  4Y7N B;  2CHB D;  2L9H A;  5IYD H;  1PRT C;  3FP9 A;  1TY0 A;  2C9O A;  2BA0 A;  4ZQ3 A;  3VA5 A;  2E2H B;  1X32 A;  2B8G A;  4Z9C B;  4JI3 Q;  2XSC A;  3D4R A;  1DXM A;  3D0F A;  3KLS X;  3RD4 A;  2CWA A;  1VCI A;  2A6H C;  3L7Z C;  2F3V A;  2HQL A;  1FL0 A;  1XJV A;  4CKE A;  3BVM A;  4BBR B;  1XNQ L;  4J6H A;  2KHI A;  5JPM C;  4N9T A;  4A3E G;  1PTO C;  2J4X A;  1P8L A;  4DR1 L;  3CC2 A;  4JI8 L;  2K28 A;  2DGY A;  4EQP A;  1I4R A;  1QIL A;  4DGZ A;  1H9J A;  2EYP A;  3K7U C;  5M5Y B;  3MXN A;  2HDL A;  4TQU S;  1H9M A;  3A8I E;  4OX9 Q;  5CV9 A;  4X66 L;  2K75 A;  3HOZ B;  2E2I B;  1K8M A;  1B53 A;  4X65 L;  2UXD Q;  2OQ0 A;  1T5X D;  3DWQ A;  4GLV B;  2EY2 A;  3S24 A;  4JV5 L;  1S5F D;  1HA6 A;  5KEE A;  2F4V Q;  1N34 L;  2BE5 C;  1LV9 A;  5FLM H;  4DV3 Q;  3HKZ E;  4QQB X;  2JN4 A;  2VQF L;  1WD0 A;  4H0L C;  4KHP L;  4HJ8 A;  4YHH Q;  2EPB A;  1RIP A;  4H7B A;  5CC4 A;  2WII B;  1U4R A;  4JVZ A;  2XRS D;  1ET6 A;  1CSP A;  1VQI A;  3J7A 5;  1CZG A;  2QKI C;  4YWL A;  1NUC A;  1JE4 A;  2AQ1 B;  1BCP D;  2NVT H;  2MGS A;  5GQO A;  4KJO A;  2IY5 B;  1R9T H;  4GKJ Q;  3K5N A;  1YIJ A;  2LMC B;  4QUC A;  1F9S A;  4U68 A;  5D3D A;  1XNR L;  4X62 L;  2K1B A;  3I4N G;  1D1K A;  3H15 A;  2IX3 A;  1NMG A;  2ALY B;  3WOF A;  2A68 C;  4UDU C;  4IPH A;  1AZP A;  4F7X A;  5E4W C;  4BY7 G;  1PVO A;  5DM7 3;  4O0A A;  3DLL A;  4RA8 A;  1DON A;  5I2Y A;  4UY8 C;  2KHJ A;  3U9S A;  5DLQ E;  4RKB A;  4G7O C;  2VB2 X;  3S17 B;  4UAI A;  4HMI A;  1I50 B;  4HAE A;  3J80 c;  4IUT A;  1VQL A;  4GKK Q;  1F9Q A;  1HNZ Q;  4IJH A;  1I4G A;  1J9O A;  2PZW A;  3TS2 A;  4YWM A;  2IWH A;  2GN5 A;  4R4Q A;  4ME5 A;  3Q24 A;  2XRQ D;  3D3R A;  4PV1 C;  4LUZ A;  4GN4 B;  1TWH H;  3QOJ A;  1LTS D;  3GTQ H;  4XTC S;  1GVP A;  2NN6 G;  3H91 A;  3CD6 A;  3J7A F;  4A3M G;  2EQS A;  2K7V A;  2B2W A;  2WAQ B;  1HQM C;  2F0I A;  4LMQ D;  3S9W A;  2VQE Q;  3OYY A;  1TWH B;  2I5M X;  5EKK A;  1M90 C;  1LTI D;  1HH2 P;  1STY A;  4LWC A;  4EX5 A;  1JE5 A;  1TVX A;  3FRP B;  4IUR A;  1YZ6 A;  4B3S Q;  4DUZ L;  1EFW A;  2R92 B;  1D7Q A;  4OON A;  2BCO A;  4IPD A;  3BVZ A;  3NQI A;  3AB9 A;  1SMY D;  1K3R A;  3HS0 C;  2VS1 A;  4RKL A;  1Q8K A;  5JVH 3;  4DAY A;  1HCZ A;  1SEB D;  3K5O A;  1SYF A;  1EZ8 A;  2XWB B;  3F2B A;  1TWF B;  2XWJ B;  3GTK B;  4BBS H;  2CCZ A;  3E3X A;  3L0O A;  4RCO A;  1JCK B;  3R3O A;  3C2P A;  1ESR A;  2WAQ E;  3IRB A;  2X6G A;  3STB D;  2RDF A;  3J81 E;  2A6E D;  4DF7 A;  4MHE A;  4IUV A;  1YJN A;  1WJJ A;  1VF5 C;  2EYF A;  2F0W A;  1F9R A;  3HFZ B;  5D14 A;  3NXW A;  1WTX A;  2R93 G;  4ZLT F;  2LFN A;  2B63 G;  1X54 A;  1UE1 A;  3HOY G;  2YU9 B;  4XDX A;  1K0R A;  3S2H H;  2K32 A;  4NKL A;  2SNM A;  1Y69 U;  4RHS A;  2AKW B;  1E1O A;  4POF A;  3S1M H;  3PO2 G;  3A5Z B;  4ZRZ A;  1GO3 E;  1HFN A;  1UE7 A;  2EIF A;  3F8T A;  2CW0 C;  2EVB A;  1G2T A;  3T53 B;  2YTV A;  3AFP A;  1EEI D;  5I9P A;  3ZYY X;  3U50 C;  1Q3L A;  1UE5 A;  2DUD A;  2GVB A;  1I6H H;  4K2L A;  4K8I A;  1D6E C;  3DEO A;  3FKI G;  4KKU A;  1ASZ A;  4H02 A;  5ELF A;  4JI2 Q;  5M3M H;  1YNN D;  1A0I A;  4NXN L;  1EIF A;  4TRD A;  1YBY A;  4JBJ A;  1N36 Q;  1HR0 W;  3FPU B;  3J80 E;  3RZD B;  2F03 A;  5IYD G;  4B3M L;  4KLK A;  5JJK A;  2L4N A;  5M3M B;  4JI7 L;  3PIO A;  1E3P A;  4G7Z C;  3A54 A;  3E9I A;  2RKS A;  1XWE A;  2NZO A;  3FVQ A;  3KLW A;  5C4J H;  1EQT A;  4OX9 L;  2BA1 A;  1A2U A;  1V1Q A;  4P72 A;  3NEN A;  4LF8 L;  4PZ7 A;  3HKZ G;  4C1N K;  2UXD L;  5E4X A;  4LFC Q;  1ROD A;  1STB A;  4K8J A;  4KJN A;  4B9X A;  1PRT F;  1KAA A;  1TT2 A;  3A7L A;  5EPJ A;  1S5E D;  1S4Z A;  2RHQ B;  1MD2 D;  1I4X A;  1D1I A;  4F88 A;  3T1H L;  2AWO A;  4LF5 Q;  4DR5 L;  3OW2 A;  2NN6 I;  2E76 C;  1I94 L;  1S40 A;  2Q2T A;  4YHH L;  1C8C A;  1MSG A;  3H6M A;  3NTH A;  3NQT A;  5CV5 A;  3U4Z A;  4FXD A;  3K7A H;  1C9O A;  4CHT B;  1O7Y A;  1J8I A;  1KDC A;  4WFN 3;  1MJC A;  1CA6 A;  4DV5 Q;  3UE0 A;  2UUA Q;  3FHW A;  5JPN C;  4V19 0;  3P1H A;  3OOC A;  1EU3 A;  3KF6 A;  1DM0 B;  4YWK A;  3K0X A;  1ENA A;  2N8N A;  4PMC A;  1VQ7 A;  4LFA L;  1VQF A;  3EFX D;  3RN5 A;  1MBY A;  5IGG A;  5FLM G;  3PO3 H;  3H3V H;  4CGY B;  2F0F A;  2AQ2 B;  4A3K B;  2K5N A;  2SNS A;  4ME3 A;  3G6E A;  1STE A;  3C1E A;  5J39 A;  2R7Z B;  2B2V A;  3UDF A;  1L0W A;  3QIA A;  1IYU A;  2CVR A;  3TZD A;  3GQB A;  1JIC A;  4UHV A;  5M9O A;  3PIO 3;  1WTO A;  1YNX A;  5IYC H;  1B3Q A;  2HDM A;  3M4O H;  3G48 A;  1PH7 A;  4JI4 Q;  1HPC A;  3SDZ A;  1IW7 C;  1GUO A;  5D3I B;  4WJ3 M;  1JJC B;  2PW7 A;  1KDB A;  2RQX A;  3CC4 A;  3W1B A;  4B3T Q;  2KOL A;  3C46 A;  3MFY A;  4PMW A;  1JQY D;  1ILP A;  4GKK L;  2B2V C;  2FMC A;  3EVQ A;  4DAM A;  4JI1 Q;  4R8N A;  1A3T A;  1LYL A;  3CPF A;  3R2I A;  3GTJ H;  2F0H A;  1O80 A;  1IKM A;  4FP5 D;  5FK9 C;  3JAM E;  3A5U A;  4XYO A;  3NBH B;  3N52 A;  4RGN A;  1G6P A;  4G7H C;  4G57 A;  1EQQ A;  3VR4 A;  1FJG Q;  1FYC A;  2Z6K C;  2JK8 A;  1VQ5 A;  3GO5 A;  3HP3 A;  1PH6 A;  5GAE C;  1EY0 A;  2VQE L;  4HID A;  3X3N A;  4OO1 H;  2RHS B;  4FNF A;  1D2B A;  3A0J A;  2NTT A;  2PQA B;  2IHE A;  1BOS A;  5ELD A;  5J22 A;  3N6R A;  5IGC A;  1A2T A;  2G9H D;  3Q0A A;  4IFD H;  4GLA C;  3GTM B;  3PUV A;  4LK1 C;  3EBE A;  1FNV A;  2RA4 A;  1IBL Q;  4JCV E;  2ZJP A;  5FO8 B;  4KN4 C;  3OHX C;  3ULJ A;  1PH8 A;  1N32 L;  5C5M A;  2HIV A;  1W3S A;  5C0X H;  1Q86 C;  4LF9 Q;  3L3O C;  3BVG A;  2ID0 A;  2K5W A;  3FEW X;  3TN2 A;  1S5C D;  5M5X B;  4A3E B;  4A3J H;  1AN8 A;  3NWT A;  1EQV A;  3KK7 A;  2KUM A;  3PUZ A;  1G6Z A;  1GUW A;  1I5F A;  1CM9 A;  2K05 A;  3SK4 A;  5E3F A;  1XNQ Q;  1TXY A;  1BUV T;  2F0M A;  3F2U A;  5I4D A;  3ERO A;  3RUZ A;  3S15 H;  5ELB A;  4DR1 Q;  5IT9 E;  4BA2 I;  4OGQ C;  1U4M A;  1XTD A;  4CDC C;  1TS5 A;  1RHP A;  4TVA B;  5I2X A;  5JEA H;  1X56 A;  5KRU A;  1NR4 A;  1AE3 A;  3SVM A;  2RCN A;  2ICI A;  2JA7 H;  1F77 A;  1B1Z A;  4IUU A;  4J1M A;  4DPG A;  4LW1 A;  2D62 A;  2A8V A;  2Q8T A;  3HOU H;  2F0D A;  4RH6 A;  4X65 Q;  3ULP A;  1Y14 B;  4JV5 Q;  4OEL B;  4QIW B;  1EYD A;  4PQX A;  3H3V C;  4PMB A;  5KYI A;  4R4O A;  1N34 Q;  2K14 A;  1ZKO A;  3OIQ A;  4B08 A;  5IOC A;  2QGQ A;  4PZ8 A;  4UPA A;  5FO9 B;  4BY1 H;  2VB3 X;  3EN2 A;  4GNX A;  1LTL A;  1N9W A;  1FNW A;  1A6X A;  1PRT B;  1V43 A;  3GTP B;  3I70 A;  5M3M G;  1CT1 D;  4DR3 L;  3I91 A;  3PQI A;  1VQ8 A;  4IJL A;  1Y8P B;  1X3G A;  4RWS C;  3T16 A;  5C44 H;  4P71 A;  1Q82 C;  2HQE A;  2EY1 A;  1EY5 A;  1UE6 A;  2B2T A;  1K8A C;  1CKN B;  2RVL A;  2FIN B;  5IGE A;  2PQA A;  1CQV A;  2OTL A;  2ZT9 C;  3I4N B;  1VQE A;  3TP5 A;  1BF4 A;  1TY2 A;  3UDG A;  5KGU A;  3I2Z A;  1V1P A;  3S2D H;  4L5T A;  4CKC A;  3IAY A;  4BY7 B;  4UP7 A;  4XQN A;  4JPB W;  4HCE A;  2UUA L;  2F3W A;  3QOL A;  3V05 A;  1XNR Q;  1AP0 A;  4C3J B;  4GNX C;  3CCS A;  4A76 A;  2KEN A;  1TS2 A;  2AQ3 B;  3KJP A;  4K5V A;  2NYZ D;  1AZQ A;  1EU4 A;  1PA6 A;  1A3U A;  3BZD B;  4IQZ A;  2B2T C;  1K8O A;  1ONL A;  2R7D A;  4N8F A;  1XXG A;  5KNB A;  4RGO S;  5JJL A;  2QEX A;  2F0T A;  5BR8 L;  1SSO A;  3OSO A;  5FLX E;  1NTG A;  4BS9 A;  1PH3 A;  1VMP A;  1XPU A;  3E5S A;  1TKW B;  2VUM H;  3GTG B;  5BN5 A;  4A93 H;  4CJ2 C;  5IY0 A;  4FYD A;  3A74 A;  1TWG H;  3PO3 G;  2LY7 A;  4K2K A;  2ZTE A;  3MXN B;  4O42 A;  5IGF A;  3D6W A;  4A3L H;  4AYB B;  5EQ0 A;  2HT1 A;  1SFO B;  1GHK A;  1EOV A;  2N88 A;  4DK0 A;  3HEJ A;  5IYC G;  4X3U A;  2E2J H;  3HOX H;  1FD7 D;  3CCU A;  4KKS A;  2OF1 A;  5FKA C;  2JA8 H;  2B39 A;  4DUZ Q;  4FXG C;  5C3E H;  1FJG L;  3TME A;  1KIX A;  4ZCK A;  1I3Q B;  4YCW A;  4AYB E;  3V2T A;  1HZ9 A;  1WTV A;  2NBF A;  2B63 B;  4A3G H;  3HOY B;  1NR2 A;  3VYT A;  3J81 i;  2WAC A;  1PYS B;  1SNO A;  1VQA A;  1WYD A;  1DGS A;  1QZG A;  1I4P A;  1DCZ A;  2MO0 A;  3S14 H;  3NSW A;  1YIT A;  5IP9 H;  4OWW B;  4QCL A;  3PIP A;  1ML0 D;  3BDC A;  4C3I H;  2EYL A;  3R8B A;  5JAV A;  1XX8 A;  4XQQ A;  2FXQ A;  1RCV D;  3RLF A;  5EBD A;  4DXG A;  1A3V A;  4CDD C;  3FKI B;  3GD7 A;  2SOB A;  5K36 G;  5CBE E;  4OIJ A;  3SXH A;  3DM3 A;  4P73 A;  4OO1 G;  1SYD A;  5DNF A;  1D5X C;  1MGS A;  1C7Y A;  1JB3 A;  2FHT A;  4ZYS A;  2EXD A;  5JJZ A;  3D31 A;  1HXY D;  1HHV A;  1EIG A;  1TR5 A;  3JC6 6;  2AWN A;  1CI3 M;  4IFD G;  3CW2 C;  2E2D C;  2TSS A;  5BN4 A;  2Z4H A;  3VYR A;  4IFD J;  4ILW A;  4NXN Q;  3TQY A;  4M1U B;  2KEC A;  2MFI A;  4B3M Q;  1CSQ A;  3HKZ B;  1KRS A;  1XPR A;  1G29 1;  1H9K A;  2ICE C;  1BXT A;  3H0G H;  4JI7 Q;  1RTO A;  4A3J G;  3Q22 A;  1BNZ A;  5C3X A;  2JEA I;  3JAM L;  1DYQ A;  1I4H A;  4A3B H;  4LF8 Q;  1EEF D;  2XTI A;  2B3G A;  1H9S A;  1L1O A;  1NNX A;  4B3R Q;  3H3V I;  2Q2U A;  3ER0 A;  4GN3 B;  1SAP A;  4HJA A;  1YNJ D;  3PIP 3;  1SYC A;  3T1H Q;  2QDL A;  3GTL H;  1NY4 A;  3OPO A;  4DR5 Q;  2CWP A;  1I94 Q;  4DAY B;  1Y1V H;  2MP1 A;  2JA7 G;  1X55 A;  2ZXP A;  3T1Y L;  3CC7 A;  3URY A;  1CHQ D;  3I72 A;  4MZ9 A;  2Q8I B;  1HUN A;  1K83 H;  5EPK A;  1LT3 D;  1FGB D;  3HOU G;  4R4T A;  2Z0S A;  3M7N A;  1DOL A;  1LO5 D;  1PRT D;  4GN5 A;  4LFA Q;  4LNQ A;  1L1O C;  3MVV A;  4IN3 A;  1JWS D;  3KF8 A;  5IWA L;  2CQA A;  2DNE A;  1K8G A;  2I07 B;  4A3I H;  1QE6 A;  2IJ0 A;  2VL6 A;  4BY1 G;  1WTQ A;  2A69 D;  4DNR B;  2O5J C;  2NVT B;  4WOR A;  1B8A A;  2ZXR A;  1R9T B;  1HZB A;  2E5L Q;  2A6H D;  3VR5 A;  1K9M C;  5IYB H;  2UU9 L;  2DNC A;  5C44 G;  3CPW A;  4DK1 A;  4BXX H;  2F0U A;  2AUK A;  1PTO D;  1YJ9 A;  1E2V A;  4C2M H;  1TS3 A;  1HQR D;  1ILQ A;  5ELE A;  4C3J G;  4OL7 A;  1BDO A;  1UNS A;  3M3Y H;  2K5H A;  3CRK C;  1X3Q A;  3GDE A;  2EYO A;  4M8A A;  4P2C B;  2NVX H;  4X3S A;  4DK3 C;  4OO1 I;  2Z8L A;  3RN2 A;  4HIM A;  3M3Y B;  1B4O A;  1KL9 A;  1HJP A;  3AU7 A;  1E2W A;  5C4Z A;  4O1N A;  1BBW A;  1OXX K;  2XIW A;  3H94 A;  4UP9 A;  4IFD I;  2PNR C;  3JAM i;  1RJT A;  4LJZ C;  1LLR D;  4V0B A;  1SR3 A;  2BE5 D;  5FJ8 H;  1X6O A;  3P20 A;  3SR1 A;  3ERS X;  1U4P A;  2KVM A;  4CDE C;  4ODG A;  2ZTC A;  1U0L A;  1PV4 A;  3CCR A;  1CKM A;  2F3I A;  2I5L X;  1QOH A;  4CDF C;  5IE8 A;  2VUM G;  1DOK A;  4I7A A;  3GTQ B;  2M00 A;  4AYB G;  2SDF A;  2BOS A;  1V8Q A;  4MNO A;  2EZV A;  2DY7 A;  1S3O A;  1S5D D;  2EJG C;  3UE1 A;  1YNN C;  3S1Q H;  2Z4I A;  1VF7 A;  1EIH A;  1F2Y A;  5EBC A;  4DN4 M;  4A3L G;  3MZ5 A;  1LTT D;  4GS3 A;  4A3D H;  4C3H H;  4L63 B;  3DHQ A;  1YJW A;  1HNX L;  3BS1 A;  4GLX A;  1CHP D;  2B2U A;  2K33 A;  5C4X H;  4KKT A;  1N32 Q;  3KF6 B;  2Q2H A;  2A68 D;  3HOX G;  4BBS B;  1I6V C;  1G8Z D;  2B2W C;  3CQZ H;  3LX0 A;  3KLS A;  2M2L A;  1O7L A;  4DKA C;  4HSP A;  1ZYR C;  1J5E L;  1LTB D;  2JA8 G;  5C3E G;  4K6D A;  4K0K Q;  3IL8 A;  1O7I A;  2L0C A;  3PMF A;  1LTR D;  3IFT A;  1PFS A;  2AMC B;  1M8A A;  3NEL A;  4FF2 A;  4QF4 A;  2UUC L;  2JA5 H;  2KJX A;  5EAY A;  1WCM H;  2F52 A;  3S2H B;  3W1G A;  1UEB A;  1GXD C;  1BBX C;  2V4D A;  1KAW A;  2B2U C;  3S1M B;  3HGB A;  4RAU C;  5JVG 3;  4JW0 A;  2PZT A;  4A4I A;  2L15 A;  5IP9 G;  4C3I G;  3CCJ A;  2D2C C;  3QO2 A;  1SNQ A;  3CAM A;  3MXP A;  4K5W A;  1I6H B;  1A15 A;  3D4D A;  2JA9 A;  1Q7Y C;  3NP8 A;  2F0J A;  1II3 A;  1YEZ A;  3VR2 A;  1Q1E A;  3PV0 A;  2HHH L;  3MTS A;  5EJW A;  3TEH B;  1JR0 D;  5GAD C;  1EL0 A;  3UDX A;  3LNN A;  1PH9 A;  1SJH D;  3CCV A;  4DV2 Q;  1PH4 A;  2EYM A;  2F0V A;  2IX1 A;  3HOW H;  3NEM A;  3S16 H;  1CK1 A;  5CYU A;  3I4M H;  2IW3 A;  3KJO A;  1N33 Q;  1OTC A;  3T13 A;  1CFM A;  4DR3 Q;  1VQO A;  1Y8N B;  3HG9 A;  5C4J B;  2PNH A;  1SYE A;  3TSS A;  3Q23 A;  4EGV A;  3E9H A;  2Z6B A;  2BH2 A;  3HZX A;  2KHS A;  4PG3 A;  3H0G G;  1KNA A;  5AFW A;  2LKV A;  5ELO A;  3CCL A;  2LXK A;  1GJX A;  1TU2 B;  3KDF A;  3PUX A;  1SE2 A;  5CBA E;  1HTL D;  3RZO H;  4LF7 L;  3J7Z C;  3VDY A;  5COR A;  1UEA B;  4HED A;  1E24 A;  1Z7T A;  2PQE A;  1O7Z A;  3I73 A;  3MFG A;  1QB5 D;  3K7A B;  1Z9F A;  1PH5 A;  4JI5 Q;  1XMQ L;  3GTO H;  3LWE A;  1W6K A;  2DJG C;  4H13 C;  1B50 A;  1EYC A;  3NWS A;  1VQ4 A;  2CW0 D;  1SMX A;  1Q90 A;  2B2Y A;  3E6Z X;  1GD7 A;  3KBX A;  2Z9H A;  1GHJ A;  2JA6 H;  4EQN A;  3CU7 A;  1Y1V G;  3E0E A;  2E5L L;  2Y0S G;  1X65 A;  1HNW L;  2RDG A;  3PO3 B;  5BR8 Q;  4DR2 L;  2F0N A;  3G7L A;  1Z6H A;  5EGT A;  1PHJ A;  3MXG A;  1SNM A;  4QY7 A;  4NB3 A;  4MTN A;  1SE3 A;  1AE2 A;  5T1I A;  2PCF B;  2RSN A;  4N9P A;  1MJE A;  1AFP A;  3W2D A;  2GVA A;  3KFU A;  1IXR A;  4HSV A;  1YI2 A;  1KQS A;  1VQ9 A;  3CHB D;  3M4O B;  4A3I G;  1WTW A;  1T5E A;  2F0K A;  2G5D A;  2OT2 A;  4X3K A;  3HOV H;  2KEE A;  4KMU C;  2VXW A;  5IYB G;  4A3F H;  1SE8 A;  4I7Z C;  4KHV A;  5IGD A;  2G9D A;  1ET9 A;  4BXX G;  1SRU A;  1ENF A;  2NB0 A;  5JOB A;  3AFQ A;  2Q2I A;  1KLG D;  5G3L F;  1JOO A;  2MQH A;  2EYH A;  4KK7 A;  4IPG A;  3PGZ A;  4GNX B;  1Y1W H;  3OMC A;  5A2Q E;  1VQH A;  3M7G A;  3MA2 B;  1DOM A;  2B8F A;  3CCQ A;  3GTJ B;  1LTG D;  5NUC A;  2F0O A;  3UI2 A;  1EIY B;  1A8V A;  4YCV A;  1ESF A;  3QWN A;  5CV8 A;  1EY7 A;  4KY5 A;  4F87 A;  5LMN W;  1Z47 A;  3BZK A;  1V1P B;  2EOT A;  4QL5 A;  5FJ8 G;  4TSS A;  1PH1 A;  3LWU A;  1L0X B;  4C56 C;  5GAG C;  4G4K A;  1WFQ A;  4QMG A;  1HA5 A;  3RLO A;  3A55 A;  4X64 Q;  1EYA A;  3OWF A;  3VR3 A;  5DEH A;  1E22 A;  2JQO A;  3M85 A;  1YHB A;  2JP1 A;  3LGJ A;  3R2T A;  1LTA D;  4RFB A;  3S1R H;  1SXT A;  2M9V A;  2K4K A;  2ZJQ A;  3TRZ A;  2WKC A;  5M3F H;  4K0K L;  1SLJ A;  3CCE A;  1JOR A;  4RHR A;  1L2F A;  3F2C A;  1Q1B A;  3P7J A;  1QVG A;  3DMU A;  4KD3 A;  4A3J B;  1EY6 A;  4XQJ A;  4C3H G;  4A3D G;  4BBS G;  5LMU Q;  1SN8 A;  2A74 C;  1OO9 B;  1IKL A;  1B9N A;  2J7Z A;  4QUF A;  1RTN A;  3IFD A;  3WOE A;  4A3C H;  3BDL A;  1C48 A;  2K5V A;  4JBM A;  1IBK L;  4HIO A;  1HR0 L;  3S15 B;  1KRT A;  1NJI C;  4DUY Q;  2IHF A;  4CBV A;  4N8X 1;  4R4I A;  3VA7 A;  1TWC H;  1E0B A;  1U4L A;  3ULL A;  3S1N H;  2OTJ A;  1JT8 A;  2I46 A;  2JA7 B;  1EYG A;  1DD2 A;  3FPP A;  2L1B A;  1KLU D;  4DFA A;  1BQQ T;  1WCM G;  4HMJ A;  5I6Y A;  2BDO A;  3MWY W;  5ISR A;  1M1K C;  3HOU B;  1GUG A;  1R4Q B;  5M5W H;  1STA A;  1WOC A;  1CTM A;  1J6Q A;  4DV2 L;  1TS4 A;  1R4P B;  3CME A;  1NSN S;  1P16 A;  1UWV A;  1GUS A;  1K3B C;  3RNU A;  3NE5 B;  1PDQ A;  4LF6 Q;  1N33 L;  3T1Y Q;  4WJW A;  3J81 j;  1AEX A;  5AJ3 Q;  1IL8 A;  4OHJ A;  3C3L A;  1EWC A;  4BY1 B;  2WV6 D;  3I55 A;  3Q6S A;  1RF2 D;  1PFM A;  3TBI B;  4L5R C;  3P75 A;  5E1F A;  3J81 L;  5C44 B;  1PH2 A;  5K5P A;  5IWA Q;  2NVQ H;  1BCP B;  4J15 A;  2F0Q A;  2RSO A;  4JBW A;  5D65 A;  3HOW G;  3KYH C;  4HJ7 A;  4HN7 A;  1JOK A;  3PF4 A;  4DR4 Q;  3I4M G;  3S2D B;  2UU9 Q;  4H44 C;  1PTO H;  2MHV A;  1H9R A;  1H95 A;  4JI5 L;  1QVC A;  5EKI A;  5HGQ A;  1VDZ A;  3HRZ C;  1PZI D;  4IUN A;  4DU9 A;  3SK8 A;  1DJR D;  2NVY H;  2O2L D;  4ALP A;  4IZ8 A;  2L12 A;  4NPS A;  1UAP A;  5IOD A;  3AMU A;  3A7A B;  1LT4 D;  2K6A A;  2WIN B;  2KCN A;  1KHI A;  2KQ3 A;  4GOP A;  4KTA A;  3A56 A;  3J80 L;  1MKH A;  3AQQ A;  3KUP A;  3QG1 A;  2F1M A;  1XTC D;  3CXC A;  1WVL A;  2VUM B;  3TP8 A;  4LF4 L;  4HJ9 A;  2JA6 G;  4A93 B;  2F0S A;  5F2D A;  2ASB A;  4P75 A;  4A3M H;  3Q8D A;  1C4Q A;  5LHY 1;  1TWG B;  1SBB B;  4POG A;  3T51 B;  1H9S B;  1L1O B;  1EY8 A;  1JWM D;  4HR7 B;  1VQG A;  3NBI A;  4KD4 A;  3C1F A;  3RLN A;  2PYK A;  1STG A;  5IIF A;  4JI0 Q;  1ZEQ X;  2MUY A;  4GOP C;  2JYO A;  1QZH A;  2ZJR A;  4KY6 A;  4OXP A;  2E2J B;  1IZ6 A;  3HOX B;  3CF5 A;  3SEB A;  4OEM B;  1EWH A;  2BDN A;  5LMN L;  2PW5 A;  3E0J A;  2JA8 B;  1HNX Q;  2R6G A;  3AEV A;  5C3E B;  2VZA A;  3M4Y A;  2F0E A;  2R93 H;  2Q8R E;  1GUT A;  1TWA H;  3QR8 A;  1F2M A;  4IAL A;  1V1O A;  2PZU A;  3KF8 B;  4R9W A;  2RCF A;  4A3G B;  4S3S A;  4F8M A;  1J5E Q;  2UXC L;  1SYG A;  1B9M A;  2HCI A;  2K01 A;  1C0A A;  5KNC A;  4O2D A;  4X64 L;  2VY3 A;  3PO2 H;  1QVF A;  1ZXT A;  3MEF A;  3K5L A;  2PI2 E;  3S14 B;  2UUC Q;  2JXM B;  3EA6 A;  2AHO B;  4C3I B;  2CH4 A;  3EIV A;  5IGB A;  2ZXO A;  2ZM6 L;  1HUM A;  4YY3 L;  3OMG A;  3VYS A;  4Y7N H;  4DV4 Q;  1D5Z C;  2LSS A;  3K8A A;  4I65 A;  4XYQ A;  3MC0 B;  4MN3 A;  2E2H H;  1A63 A;  3DM1 A;  4DV6 Q;  5LMU L;  4HCS A;  5CR3 A;  1A62 A;  1BCP C;  3J80 i;  2Z1C A;  1YHA A;  5DM6 3;  1RKN A;  2F0P A;  4ABN A;  5IP7 H;  5C0X G;  2CH4 W;  4FO2 A;  3CP0 A;  3SK5 A;  3GV6 A;  1BR9 A;  4BBR H;  5C0X J;  2A69 C;  5CV4 A;  1PZJ D;  1ASY A;  5EPL A;  1JB7 A;  1KXL A;  2HHH Q;  1HRJ A;  4DUY L;  1S5B D;  5M3F G;  1PXU A;  1XYI A;  4JBK A;  3DEP A;  2NWG A;  1VMC A;  2PPB C;  3H0G B;  5A2Q L;  3GV3 A;  5M5Y H;  2VNU D;  2XVS A;  3SHL A;  3MXU A;  2E2I H;  3HOZ H;  4A3B B;  5GAH C;  4JYA Q;  1CUK A;  2QA4 A;  5JEA G;  4A3C G;  3WWV A;  2XNA C;  5JEA J;  2UUB Q;  5EKL A;  4LF6 L;  2CFM A;  3K6O A;  2A5H A;  2I5H A;  2FMM A;  5AJ3 L;  3I8Z A;  2PI2 A;  3FMC A;  4LF7 Q;  3GTL B;  1STN A;  3OIP A;  4GZY C;  2XGT A;  1Y1V B;  1VQN A;  4LFB L;  2Y0S B;  2K5D A;  1Q8I A;  3OTO Q;  1LUZ A;  5ELC A;  1XMQ Q;  3D4W A;  2I0Q A;  2R61 A;  1K83 B;  4DV7 Q;  4YIJ A;  5CV7 A;  3NHH A;  3CMA A;  4B3R L;  2V1C C;  2FJ2 A;  2EE1 A;  4ID6 A;  1BVS A;  1U9R A;  4DR4 L;  4DR7 L;  3SGI A;  1VQ6 A;  1HNW Q;  3NTK A;  4DR2 Q;  1LAB A;  4A3I B;  2E74 C;  3ONA B;  3J81 c;  1W6J A;  2QW7 A;  3EQL C;  1HTP A;  4A75 A;  1GUN A;  3VYU A;  1SMY C;  2Y0S E;  5JJI A;  5IT9 L;  4AIM A;  1E7Z A;  3BDO A;  1YHQ A;  4IOC A;  2EY5 A;  3QJY A;  3A8K E;  1QUQ B;  4C2M B;  3STB C;  2N55 A;  2A6E C;  2KCM A;  4DR6 Q;  4RGT A;  2MNA A;  2WFW A;  3D8G A;  4KHZ A;  1VQD A;  4NXM L;  3S17 H;  1K0S A;  3TS0 A;  1TQO A;  1IBM L;  5J3B A;  2NVX B;  1FGU A;  1I50 H;  4DK6 C;  2D0P A;  1BO0 A;  3BYY B;  5FO7 B;  2ZTD A;  2K04 A;  5C0X I;  2MPM A;  5HUR A;  1O78 A;  5CV6 A;  2RF4 A;  4NMZ A;  4L5S A;  4QGU A;  4C1N I;  1VQB A;  3WDN A;  2D5D A;  4A93 G;  2X6L A;  4DV0 Q;  2IT1 A;  4DV1 Q;  3MEH A;  3W5O A;  4JI0 L;  1CA5 A;  1QCB D;  4X3T A;  2PMZ B;  2H4O A;  3O13 A;  5G3L D;  3KDF B;  4E6I A;  5TSS A;  2R92 H;  3R93 A;  4JI6 Q;  1B3A A;  3S1Q B;  4KV6 A;  2XN9 C;  1D8L A;  1TWF H;  2E75 C;  4ULL A;  3TZU A;  4A3D B;  3GTK H;  4IPC A;  4C3H B;  1B7Y B;  4OIK A;  1VQC A;  4MTK A;  5C4X B;  1Q12 A;  2PMZ E;  3TDQ A;  4FXK C;  4Q5V A;  2O5I C;  1OXV A;  3V96 A;  4LAA A;  1KTK A;  1CKO A;  2EXZ A;  3CQZ B;  3NUC A;  4AH6 A;  3ND9 A;  1JJ2 A;  4A3G G;  5FLX L;  2YU9 H;  2UXB L;  1HZA A;  3TP7 A;  4DAV A;  1E2Z A;  3PUY A;  1JOQ A;  4DV4 L;  2K03 A;  2JA5 B;  1IBK Q;  1VQK A;  1HR0 Q;  1WCM B;  2N49 A;  2H5X A;  1SJE D;  4JC0 A;  4YCU A;  4DV6 L;  1N8R C;  1F2Z A;  1QUQ A;  1HFG A;  1QJO A;  1IYJ B;  4IUQ A;  5BN3 A;  1G91 A;  2NZH A;  4K5X A;  4CJ0 B;  4JI3 L;  3X3M A;  4EQ5 A;  3I3C A;  4IUP A;  4WJ4 A;  4TKO B;  4KN7 C;  1X3F A;  2F0G A;  3RZD H;  1EUJ A;  4ZKB B;  1KAB A;  1VQJ A;  2SEB D;  1LT6 D;  1QNK A;  3DXJ C;  1NAP A;  2KA7 A;  3H09 A;  4L6T B;  3HKS A;  3VR6 A;  5LL6 X;  2JEB I;  5IP7 G;  1LAC A;  1OXS C;  1WI5 A;  4RCN A;  3HOW B;  3GP7 A;  1MSH A;  1PFN A;  4JYA L;  3PUW A;  3S16 B;  4BBR G;  3JAM c;  3I4M B;  1VS0 A;  3OW7 A;  4JOI A;  2L5T A;  3ITP A;  2UUB L;  2HCC A;  2KCT A;  1ZYR D;  3K58 A;  4NW2 A;  2A19 A;  4A3B G;  1RL2 A;  2QEJ C;  2OCE A;  1BCP F;  2F4V L;  2IL8 A;  3BYT B;  2JSO A;  4OWX B;  1XMO Q;  1B2T A;  5GRO A;  1PLF A;  4DV3 L;  4JG2 A;  1ENC A;  3OTO L;  1WD1 A;  3RZO B;  1FNU A;  3HOZ G;  4DV7 L;  1EY4 A;  2N78 A;  2C35 B;  1F2L A;  1QG7 A;  1DZ1 A;  2WB1 B;  2DY8 A;  4CJ1 B;  1IYV A;  4XT1 B;  2JE6 I;  1KC8 C;  3GTO B;  4QJF A;  1PYB A;  2CKZ B;  4X6A H;  1PMR A;  4JOI C;  3BG3 A;  1PTO F;  4A3K H;  3PF5 A;  2JA6 B;  4XIG S;  2R7Z H;  1SRO A;  4B9W A;  2EYJ A;  1RDP D;  1SND A;  3FDT A;  4GKJ L;  1QWY A;  1WTR A;  2KCC A;  3K57 A;  2PO4 A;  2RDH A;  1FR3 A;  4LF4 Q;  3T56 B;  3M9B A;  1KD1 C;  2WB1 E;  3PSI A;  3U58 A;  2B2Y C;  1Q81 C;  4DR6 L;  3G6J B;  1U5K A;  5IT9 c;  2VW9 A;  3MAQ A;  2Z6K A;  3HOV B;  1TII D;  2JJQ A;  4BWG B;  4DA2 A;  1EY9 A;  5H1S E;  3J7A V;  4A3F B;  4L8J A;  4R1J A;  4HJ5 A;  4FDB A;  2MO1 A;  3MHB A;  5C4H A;  4ZK9 B;  3PCO B;  5KIX A;  2YTY A;  1HNZ L;  5LMN Q;  1X3E A;  4EVO A;  3NPP A;  2NTS A;  4DV0 L;  1Y1W B;  2E8G A;  2WP8 J;  3SE0 A;  4DV1 L;  1XPO A;  4QB4 A;  4RGM A;  3F2D A;  1JC7 A;  2EDG A;  4PZ6 A;  2C5C A;  1WTH A;  2DN8 A;  4U67 3;  1X9N A;  1ICW A;  3M4P A;  2UXC Q;  1VQM A;  3K0Y A;  4JI6 L;  5T1G A;  2P5Z X;  1STH A;  5K36 H;  3U9O A;  3CRL C;  1EFI D;  1OXU A;  2J0T D;  2X69 A;  3GTM H;  3K80 C;  3NTI A;  4IOA A;  2BH8 A;  4B3S L;  2B29 A;  5C3W A;  1F9P A;  4BA1 I;  4AQY Q;  3EJI A;  2ZM6 Q;  3K81 C;  2WAQ G;  1IW7 D;  2D9U A;  4RG1 A;  4YY3 Q;  1CQF A;  1Q46 A;  4WRD A;  5M5X H;  3DWP A;  4A3E H;  3S1R B;  1RD9 D;  2R92 G;  2K52 A;  5FOB B;  5M3F B;  2LXJ A;  5C4X G;  4PNY A;  1MIU A;  4GOP B;  4FF1 A;  5LL6 S;  2EJF C;  5KYL A;  2QF7 A;  2NUC A;  1UUP A;  2IX0 A;  4DXF A;  3ICE A;  4NP5 A;  4XXE A;  2AUJ D;  5FLX c;  4IO9 A;  4K6L A;  1I4Q A;  2RBM A;  2QDB A;  1V9P A;  3QB3 A;  4HTH A;  4R8I A;  1NBW A;  2YTX A;  2JA5 G;  4JI8 Q;  1D5M C;  1NMF A;  4LUV A;  2ATW A;  1TWC B;  5C6A A;  3S1N B;  3BU2 A;  2KED A;  3TP6 A;  4CKB A;  4J8Q A;  4JI2 L;  2WKD A;  1AW7 A;  2R7F A;  1MHW C;  2A73 B;  1SDF A;  1N36 L;  4X66 Q;  1JJG A;  3AYH B;  4K14 A;  1KDA A;  3F1Z A;  1B70 B;  1EOT A;  5M5W B;  4KY7 A;  3I4L A;  2N3S A;  3I4O A;  1SNC A;  2OEO A;  3GTP H;  4LFB Q;  2F0L A;  1WTP A;  3M4Q A;  4MIU A;  3K59 A;  3DUZ A;  1BKB A;  1YVC A;  5KND A;  1LT5 D;  1AH9 A;  1PZK D;  3K5M A;  3NBH A;  2HD3 A;  5E7N A;  3BJU A;  4UP8 A;  2VQF Q;  3ND8 A;  3CKI B;  4KHP Q;  4LFC L;  3ERQ A; 
#chains in the Genus database with same CATH homology
 1EQR A;  4C3H H;  3I4N H;  4WJ3 M;  5C0X J;  1YJW A;  1JJC B;  1ASY A;  1HNX L;  1JB7 A;  1KXL A;  1XMO L;  4GLX A;  2HHH Q;  4DR7 Q;  5C4X H;  3CC4 A;  4DUY L;  3W1B A;  4P74 A;  1N32 Q;  3KF6 B;  5M3F G;  4B3T Q;  1HZC A;  4JBK A;  4BY7 H;  2YV5 A;  2Q2H A;  1E1T A;  4LF5 L;  4QIW E;  3HOX G;  4OWT B;  3CQZ H;  4PMW A;  4C3J H;  4DKA C;  1FVI A;  5M5Y H;  3U4V A;  4GKK L;  5ELN A;  1J5E L;  2OQK A;  2JA8 G;  4DAM A;  2VNU D;  5C3E G;  4K0K Q;  4JI1 Q;  4DV5 L;  3I7F A;  1O7I A;  4HIK A;  2E2I H;  3HOZ H;  1LYL A;  3CPF A;  4LUO A;  3GTJ H;  4DNI A;  5GAH C;  4JYA Q;  1PFS A;  2AMC B;  3NEL A;  1CUK A;  4X62 Q;  2QA4 A;  5JEA G;  4A3C G;  3WWV A;  3A5U A;  2UUC L;  3KOJ A;  2JA5 H;  3NBH B;  1S72 A;  1G6P A;  5EAY A;  1EQQ A;  5JEA J;  1OXT A;  1WCM H;  2F52 A;  2UUB Q;  1FJG Q;  2Z6K C;  3W1G A;  4LF6 L;  1UEB A;  2CFM A;  2WB1 G;  2JK8 A;  2I5H A;  4NXM Q;  1IL2 A;  5AJ3 L;  3BZC A;  1KAW A;  1VQ5 A;  1GKH A;  2PI2 A;  1NE3 A;  3GO5 A;  1IBM Q;  1PH6 A;  5GAE C;  4LF7 Q;  2VQE L;  4HID A;  3GTG H;  2XGT A;  1JMC A;  4A4I A;  5IP9 G;  2L15 A;  1VQN A;  4LFB L;  2RHS B;  3L2P A;  3TRE A;  3A0J A;  2PQA B;  2IHE A;  3OTO Q;  3CCJ A;  1LUZ A;  2KBN A;  1XMQ Q;  2I0Q A;  3CAM A;  4DV7 Q;  1K73 C;  4A3K G;  4JI4 L;  4GLA C;  2JA9 A;  3CMA A;  1Q7Y C;  4B3R L;  3PUV A;  2R7Z G;  2V1C C;  3EBE A;  1GM5 A;  1YEZ A;  1IBL Q;  1SFO H;  1BVS A;  4JCV E;  2ZJP A;  1Q1E A;  3PV0 A;  2HHH L;  4DR4 L;  4DR7 L;  3SGI A;  1VQ6 A;  3B6Y A;  3ULJ A;  1PH8 A;  3TEH B;  1HNW Q;  1N32 L;  2HIV A;  1W3S A;  5GAD C;  4DR2 Q;  1Q86 C;  3UDX A;  4B3T L;  4LF9 Q;  2OWO A;  3J81 c;  5HY6 A;  1PH9 A;  3CCV A;  4DV2 Q;  2ID0 A;  1PH4 A;  3HOW H;  2IX1 A;  3NEM A;  4A75 A;  2A1A A;  2Y0S E;  1T9H A;  4A3J H;  3S16 H;  5JJI A;  4L5Q A;  1VQP A;  3I4M H;  3RR5 A;  3KJO A;  1N33 Q;  4AIM A;  4DR3 Q;  1VQO A;  1OTC A;  3HOV G;  3PUZ A;  1E7Z A;  2K50 A;  2CQO A;  4JI1 L;  2PNH A;  2YYZ A;  1I5F A;  1YHQ A;  4A3F G;  4IOC A;  1I3Q H;  3E9H A;  2BH2 A;  1QUQ B;  2B63 H;  4PG3 A;  3STB C;  3H0G G;  1XNQ Q;  1TXY A;  1LM0 A;  2KCM A;  3CCM A;  5ELO A;  3HOY H;  4DR6 Q;  4Y52 H;  3CCL A;  2LXK A;  3S15 H;  3ZJY C;  2WFW A;  2MNA A;  3KDF A;  4KHZ A;  3G4S A;  4DR1 Q;  4BA2 I;  3UDI A;  1VQD A;  4NXM L;  3S17 H;  3PUX A;  3TS0 A;  1XTD A;  1Y1W G;  1IBM L;  3RZO H;  5J3B A;  4TVA B;  3J7Z C;  3VDY A;  1FGU A;  1I50 H;  1X56 A;  2ES2 A;  4LF7 L;  4DK6 C;  1E24 A;  2D0P A;  4R4C A;  1AE3 A;  2RCN A;  1W2B A;  4APV A;  2JA7 H;  1BBU A;  2D0O A;  2ZTD A;  1Z9F A;  1CKN A;  3G71 A;  1PH5 A;  4JI5 Q;  5C0X I;  4DPG A;  1XMQ L;  4LW1 A;  3GTO H;  2UXB Q;  2D62 A;  4AQY L;  2A8V A;  1VQ4 A;  1SMX A;  4KI0 A;  3HOU H;  2RF4 A;  4L5S A;  4QGU A;  4X65 Q;  3FKI H;  1GD7 A;  2JA6 H;  1VQB A;  1EWI A;  3I56 A;  1Y14 B;  4RMF A;  3ULP A;  1IBL L;  4JV5 Q;  1Y1V G;  4A93 G;  3E0E A;  2E5L L;  2Y0S G;  4DV0 Q;  1X65 A;  2IT1 A;  1HNW L;  4DV1 Q;  4R4O A;  3W5O A;  1N34 Q;  1G51 A;  2K14 A;  4JI0 L;  5BR8 Q;  2HIX A;  4DR2 L;  2QGQ A;  4PZ8 A;  4LF9 L;  5IYD H;  1PHJ A;  4UPA A;  4BY1 H;  4QY7 A;  4NB3 A;  4MTN A;  3EN2 A;  4GNX A;  1AE2 A;  3FP9 A;  1LTL A;  1N9W A;  3KDF B;  1V43 A;  1MJE A;  2BA0 A;  2GVA A;  4JI3 Q;  5M3M G;  4DR3 L;  2ASB A;  3KFU A;  1IXR A;  1VQ8 A;  2R92 H;  1YI2 A;  4IJL A;  1X3G A;  5C44 H;  3D0F A;  4P71 A;  1Q82 C;  1KQS A;  4JI6 Q;  2CWA A;  1VQ9 A;  1VCI A;  1UE6 A;  3L7Z C;  4A3I G;  1D8L A;  1K8A C;  1CKN B;  2HQL A;  1TWF H;  1FL0 A;  1XJV A;  2PQA A;  2OTL A;  4IPC A;  1XNQ L;  3GTK H;  2KHI A;  1VQE A;  3HOV H;  1B7Y B;  4A3E G;  3UDG A;  1VQC A;  3I2Z A;  1P8L A;  4DR1 L;  3CC2 A;  4JI8 L;  5IYB G;  1Q12 A;  4L5T A;  4A3F H;  2PMZ E;  3S2D H;  1SE8 A;  1OXV A;  2DGY A;  4UP7 A;  4BXX G;  2UUA L;  1SRU A;  1CKO A;  2Q2I A;  3AFQ A;  1XNR Q;  4AH6 A;  2MQH A;  3K7U C;  4GNX C;  4TQU S;  3CCS A;  1JJ2 A;  4IPG A;  4A76 A;  4A3G G;  2YU9 H;  3PGZ A;  2KEN A;  4GNX B;  1Y1W H;  4OX9 Q;  2UXB L;  3KJP A;  1HZA A;  4X66 L;  1VQH A;  2K75 A;  3PUY A;  3CCQ A;  4X65 L;  4DV4 L;  1PA6 A;  2UXD Q;  2OQ0 A;  4GLV B;  3S24 A;  4JV5 L;  1IBK Q;  2R7D A;  1VQK A;  1EIY B;  1A8V A;  5JJL A;  2F4V Q;  4YCV A;  2QEX A;  1HR0 Q;  2N49 A;  2H5X A;  4JC0 A;  1N34 L;  4YCU A;  5BR8 L;  4DV6 L;  5FLM H;  4DV3 Q;  1N8R C;  1NTG A;  3HKZ E;  1PH3 A;  5LMN W;  1XPU A;  1QUQ A;  4QQB X;  1Z47 A;  1IYJ B;  3BZK A;  2VUM H;  4QL5 A;  2VQF L;  5FJ8 G;  4KHP L;  4HJ8 A;  4YHH Q;  2NZH A;  1PH1 A;  4A93 H;  1RIP A;  4JI3 L;  5GAG C;  5IY0 A;  1WFQ A;  4EQ5 A;  3RLO A;  3A74 A;  4WJ4 A;  1TWG H;  4X64 Q;  3PO3 G;  2ZTE A;  1CSP A;  1VQI A;  1X3F A;  3RZD H;  3J7A 5;  3MXN B;  1E22 A;  2JQO A;  4YWL A;  3M85 A;  1EUJ A;  1YHB A;  4A3L H;  3LGJ A;  2HT1 A;  2NVT H;  5GQO A;  1VQJ A;  2IY5 B;  1EOV A;  3S1R H;  1R9T H;  4GKJ Q;  1YIJ A;  2K4K A;  2ZJQ A;  3TRZ A;  3HKS A;  5M3F H;  4K0K L;  1SLJ A;  3CCE A;  5IYC G;  2JEB I;  5IP7 G;  1OXS C;  1WI5 A;  1L2F A;  3F2C A;  2E2J H;  1Q1B A;  3HOX H;  1QVG A;  1XNR L;  3CCU A;  3PUW A;  4X62 L;  4JYA L;  4BBR G;  3JAM c;  4A3D G;  3I4N G;  3H15 A;  4BBS G;  1NMG A;  2ALY B;  5LMU Q;  2JA8 H;  1SN8 A;  1VS0 A;  4IPH A;  4DUZ Q;  4JOI A;  5C3E H;  2UUB L;  1FJG L;  1KIX A;  2KCT A;  4YCW A;  4BY7 G;  1PVO A;  4AYB E;  4O0A A;  3DLL A;  2A19 A;  1HZ9 A;  4A3C H;  2K5V A;  4JBM A;  1RL2 A;  1IBK L;  4A3B G;  2OCE A;  4HIO A;  4UY8 C;  4A3G H;  2F4V L;  4OWX B;  1HR0 L;  1XMO Q;  1KRT A;  2KHJ A;  5DLQ E;  5GRO A;  1NJI C;  3J81 i;  2IHF A;  4DUY Q;  4DV3 L;  1PYS B;  4JG2 A;  4R4I A;  3OTO L;  1VQA A;  1WYD A;  1DGS A;  1TWC H;  1QZG A;  3HOZ G;  3ULL A;  4DV7 L;  3S1N H;  2OTJ A;  2N78 A;  1JT8 A;  2MO0 A;  3J80 c;  3S14 H;  1YIT A;  5IP9 H;  1VQL A;  2C35 B;  4OWW B;  1EYG A;  4GKK Q;  3PIP A;  1HNZ Q;  4C3I H;  1WCM G;  2JE6 I;  4IJH A;  1KC8 C;  4QJF A;  1PYB A;  2CKZ B;  3TS2 A;  2FXQ A;  4X6A H;  4YWM A;  4JOI C;  2GN5 A;  4R4Q A;  3RLF A;  4A3K H;  1M1K C;  5M5W H;  3PF5 A;  1WOC A;  1J6Q A;  3GD7 A;  1SRO A;  4LUZ A;  4XIG S;  4DV2 L;  4GN4 B;  1TWH H;  3CME A;  2R7Z H;  5K36 G;  1P16 A;  3DM3 A;  1UWV A;  4P73 A;  3GTQ H;  4OO1 G;  4XTC S;  1GVP A;  4GKJ L;  3RNU A;  2NN6 G;  1C7Y A;  4LF6 Q;  3CD6 A;  1N33 L;  2EXD A;  3T1Y Q;  3J81 j;  2EQS A;  4A3M G;  5AJ3 Q;  3D31 A;  3JC6 6;  2VQE Q;  2AWN A;  3OYY A;  2I5M X;  3I55 A;  4IFD G;  1M90 C;  3CW2 C;  1HH2 P;  4LWC A;  4EX5 A;  1JE5 A;  4LF4 Q;  3M9B A;  1KD1 C;  2WB1 E;  3PSI A;  1YZ6 A;  3U58 A;  1Q81 C;  4DUZ L;  1EFW A;  4B3S Q;  4DR6 L;  4L5R C;  4NXN Q;  4OON A;  3TQY A;  4IFD J;  1D7Q A;  4IPD A;  1PH2 A;  1U5K A;  1K3R A;  2VS1 A;  5IT9 c;  1Q8K A;  5IWA Q;  2MFI A;  2NVQ H;  4J15 A;  4JBW A;  2VW9 A;  3F2B A;  1CSQ A;  4B3M Q;  1KRS A;  1XPR A;  1G29 1;  3HOW G;  3KYH C;  4BBS H;  2Z6K A;  3H0G H;  2CCZ A;  4JI7 Q;  4HJ7 A;  3L0O A;  3PF4 A;  4A3J G;  4DR4 Q;  3I4M G;  2JJQ A;  5H1S E;  2UU9 Q;  2WAQ E;  2JEA I;  1H95 A;  3IRB A;  4JI5 L;  4R1J A;  3STB D;  1QVC A;  4HJ5 A;  4FDB A;  2MO1 A;  1YJN A;  1WJJ A;  4A3B H;  2R93 G;  5HGQ A;  3HFZ B;  4LF8 Q;  2XTI A;  3PCO B;  2B3G A;  2B63 G;  1L1O A;  1X54 A;  1UE1 A;  1X3E A;  2YTY A;  5LMN Q;  1HNZ L;  3HOY G;  4B3R Q;  3H3V I;  4DV0 L;  2Q2U A;  3ER0 A;  1K0R A;  2E8G A;  2NVY H;  2WP8 J;  4GN3 B;  4DV1 L;  1XPO A;  3S2H H;  4ALP A;  4HJA A;  4NPS A;  3F2D A;  2AKW B;  1E1O A;  4PZ6 A;  3T1H Q;  4POF A;  3S1M H;  3PO2 G;  3GTL H;  3A5Z B;  1NY4 A;  4DR5 Q;  2CWP A;  1GO3 E;  1UE7 A;  1I94 Q;  2EIF A;  3F8T A;  4DAY B;  1Y1V H;  1X9N A;  2JA7 G;  1X55 A;  1KHI A;  2YTV A;  3M4P A;  4GOP A;  3T1Y L;  2UXC Q;  3CC7 A;  3AFP A;  3U50 C;  1VQM A;  4MZ9 A;  1MKH A;  3AQQ A;  1UE5 A;  4JI6 L;  1K83 H;  2DUD A;  2GVB A;  1I6H H;  3CXC A;  3HOU G;  4R4T A;  1OXU A;  4LF4 L;  2Z0S A;  3FKI G;  3GTM H;  4HJ9 A;  3K80 C;  2JA6 G;  1ASZ A;  3M7N A;  4IOA A;  2BH8 A;  4H02 A;  4P75 A;  4JI2 Q;  2B29 A;  4GN5 A;  4LFA Q;  5M3M H;  4A3M H;  1A0I A;  3Q8D A;  4NXN L;  1EIF A;  4LNQ A;  1L1O C;  1YBY A;  4BA1 I;  4POG A;  4JBJ A;  4AQY Q;  5IWA L;  2ZM6 Q;  1N36 Q;  1HR0 W;  1L1O B;  3K81 C;  1K8G A;  2WAQ G;  5IYD G;  4YY3 Q;  4RG1 A;  4A3I H;  4KLK A;  4B3M L;  2VL6 A;  4BY1 G;  5JJK A;  1Q46 A;  1VQG A;  1E3P A;  5M5X H;  1B8A A;  3PIO A;  4JI7 L;  4A3E H;  3RLN A;  3E9I A;  1HZB A;  2E5L Q;  2UU9 L;  1K9M C;  5IYB H;  2NZO A;  2K52 A;  4JI0 Q;  2R92 G;  5C44 G;  3KLW A;  5C4J H;  3CPW A;  4OX9 L;  2BA1 A;  2LXJ A;  4GOP C;  5C4X G;  4BXX H;  1QZH A;  1MIU A;  2ZJR A;  1V1Q A;  4P72 A;  4OXP A;  1YJ9 A;  3NEN A;  1IZ6 A;  4LF8 L;  4GOP B;  3CF5 A;  4PZ7 A;  3HKZ G;  2UXD L;  4LFC Q;  4C2M H;  5LMN L;  1HNX Q;  2R6G A;  3AEV A;  3M3Y H;  2VZA A;  2K5H A;  3GDE A;  2IX0 A;  3ICE A;  2RHQ B;  5FLX c;  4IO9 A;  2R93 H;  1TWA H;  3T1H L;  1V9P A;  2NVX H;  2AWO A;  4DK3 C;  4DR5 L;  4LF5 Q;  4OO1 I;  3OW2 A;  3KF8 B;  2NN6 I;  1I94 L;  1NBW A;  2YTX A;  3RN2 A;  1S40 A;  4YHH L;  4HIM A;  2Q2T A;  3U4Z A;  1KL9 A;  1HJP A;  3K7A H;  1C9O A;  4JI8 Q;  2JA5 G;  1J5E Q;  2UXC L;  1NMF A;  2ATW A;  4LUV A;  1BBW A;  1OXX K;  4UP9 A;  1MJC A;  1C0A A;  4DV5 Q;  4IFD I;  4O2D A;  3UE0 A;  4X64 L;  2UUA Q;  2VY3 A;  3JAM i;  3PO2 H;  3FHW A;  1QVF A;  1SR3 A;  3BU2 A;  3MEF A;  5FJ8 H;  1X6O A;  2PI2 E;  3KF6 A;  2UUC Q;  4YWK A;  3ERS X;  4JI2 L;  3K0X A;  1VQ7 A;  2N8N A;  4LFA L;  2R7F A;  1VQF A;  2AHO B;  2ZTC A;  1U0L A;  3RN5 A;  1PV4 A;  3EIV A;  1N36 L;  4X66 Q;  1JJG A;  5FLM G;  2ZM6 L;  3PO3 H;  3AYH B;  3H3V H;  2K5N A;  3F1Z A;  4YY3 L;  4Y7N H;  4ME3 A;  3CCR A;  4DV4 Q;  1B70 B;  1CKM A;  2F3I A;  2I5L X;  2LSS A;  3K8A A;  5IE8 A;  3G6E A;  2VUM G;  2N3S A;  3I4O A;  3GTP H;  2E2H H;  3UDF A;  1L0W A;  4AYB G;  4LFB Q;  1A63 A;  4DV6 Q;  5LMU L;  3M4Q A;  4MNO A;  1S3O A;  1BKB A;  1YVC A;  1A62 A;  3UE1 A;  4B3S L;  3J80 i;  1AH9 A;  1YHA A;  1YNX A;  5IYC H;  3S1Q H;  5E7N A;  5IP7 H;  3BJU A;  4UP8 A;  5C0X G;  2VQF Q;  3M4O H;  3G48 A;  3CP0 A;  4KHP Q;  4A3L G;  1PH7 A;  4JI4 Q;  4LFC L;  4GS3 A;  4BBR H;  4A3D H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...