3KDFA

X-ray crystal structure of the human replication protein a complex from wheat germ cell free expression
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression
rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords Replication protein A 14 kDa subunit
total genus 23
structure length 115
sequence length 115
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kdfA00
5IWAQ 1X3EA 2UXBL 1R9TH 1HR0Q 3H15A 1CKOA 3AFPA 4XIGS 3S1MH 4DAMA 2R6GA 1GKHA 4TVAB 1TXYA 4JBJA 4JI5L 1KRTA 4C3HH 4AQYL 2JEBI 1ASZA 1FL0A 2Z6KC 4DUYL 1C7YA 4A3KH 1XJVA 4A3BH 5IP7H 1AH9A 2HQLA 5ELOA 1CSQA 1QZGA 4L5QA 2PQAA 2JA5G 4A3EH 1IBMQ 5M5XH 3F2BA 3I4NG 5GQOA 2PMZE 2ZJRA 1KHIA 1QVCA 1FGUA 3CF5A 4HJ8A 4YCWA 2B63H 4DUYQ 5IY0A 1UEBA 4PG3A 2ZJQA 3J81j 4A93H 3FP9A 4QJFA 3J80i 4AQYQ 1GM5A 2A8VA 1I6HH 1PYBA 3CCEA 4P71A 1M1KC 1C0AA 3HOXG 2NZOA 3DLLA 2PI2A 1HR0L 2UXBQ 1IZ6A 5IE8A 3HOVG 2WB1E 3U4VA 4GOPA 2WFWA 2K50A 4NXMQ 5GAHC 5LMUQ 4JI6Q 2ZTEA 3KF8B 4X66Q 2R92G 3M4OH 5GADC 3CC2A 3TS2A 2R7ZH 3HKSA 1L1OC 3J81i 1CKNA 3HOYH 4WJ4A 4DV0L 1Y1VH 3JC66 4GLAC 5C0XI 4LF4Q 3GTKH 1V9PA 4LUZA 1MJEA 4YWLA 2IHFA 2UU9L 3ULJA 4IPCA 4A75A 2UUAQ 4A3KG 2ZM6Q 2MFIA 4JI4L 2KCTA 1L0WA 1WI5A 4BBSG 4C2MH 3UDGA 4WJ3M 4LF6L 5IP7G 3KJPA 5M3MH 5C3EH 3S16H 3F8TA 1UE7A 4JI2Q 2YTXA 1YJNA 2ID0A 4IFDG 5EAYA 1GVPA 3S17H 3K8AA 3TQYA 4OWWB 1PH8A 3M4QA 5FJ8H 2C35B 3HOZG 4GN4B 4KI0A 4RMFA 4DR5Q 2RHSB 4HJ9A 5C44G 3L7ZC 1I5FA 4LF4L 4PMWA 3KDFB 5JJIA 4R4CA 3I2ZA 1YBYA 1XNRQ 2IX0A 4LNQA 2JJQA 2DUDA 4JI6L 1N33Q 1JE5A 2K5HA 1O7IA 1WCMG 2ZJPA 3CCQA 3HOVH 3AQQA 2JEAI 4JI3Q 2JE6I 3KOJA 3STBD 3CC4A 4DV1Q 2IT1A 4OONA 1Q7YC 3AYHB 1OXVA 4MTNA 3S14H 1N8RC 3PSIA 3CMAA 4B3MQ 2B63G 3S2HH 4BY7H 5H1SE 2K4KA 4JI1Q 2OQKA 4APVA 3KJOA 4A3MH 1C9OA 1MKHA 4IFDI 1PFSA 4TQUS 3STBC 1YJWA 5M3MG 5C3EG 1IBML 4IPDA 1X56A 1G291 5IYCG 2LXKA 4JBMA 4P75A 1HJPA 4KHZA 2UXCL 2BA0A 1I3QH 2D0PA 2NVQH 4AIMA 1Y1WG 1K83H 4DK6C 2WAQE 2VL6A 3A74A 3J7ZC 2HIVA 1Q8KA 1X65A 4OO1I 2NVXH 4JI5Q 4A3CG 1HNZQ 4JV5Q 4OXPA 4C3IH 4OX9L 2NN6G 4L5RC 1X3FA 2ATWA 1HH2P 3TS0A 1IL2A 1KL9A 2I5HA 3L0OA 5IWAL 1D7QA 1EFWA 4QGUA 1WOCA 1XNQQ 1VQFA 3CCSA 1J5EL 2HHHL 4BBSH 2N8NA 1PH6A 4NXNQ 1UWVA 1JJ2A 4X6AH 4B3RL 2A19A 4DV5L 5JJKA 4AYBE 1J6QA 4KHPL 2VQFQ 2UUBL 2Q2HA 2H5XA 1Q81C 1GD7A 2KBNA 4EX5A 1X3GA 2Y0SE 4YY3L 2UXDQ 1N34Q 4P74A 1YVCA 1YEZA 1WYDA 2VUMG 1D8LA 5M3FG 1X9NA 4OWTB 4BY1G 1SN8A 4X64L 3I4MG 4BXXH 3CMEA 3K81C 2OQ0A 1N9WA 4JBWA 4YCVA 1U5KA 2E2HH 1KXLA 3PUWA 1VQ7A 4LF7L 3DM3A 3U4ZA 2Q2TA 5FLMH 1HNWL 4QIWE 2ASBA 5BR8L 1XMQL 1SROA 1IBLL 4DR1Q 4DV3Q 1VQKA 1PA6A 2AHOB 2YTYA 3I7FA 4A3IH 1S40A 1I94Q 4R4QA 3BZCA 3OTOL 1JMCA 2KENA 2L15A 4DK3C 2E5LL 4JI7Q 4B3SL 4LF9L 2BH2A 1VQEA 2IY5B 2JA9A 4AYBG 1ASYA 3CCJA 4IOAA 1SLJA 3CC7A 2CWPA 3HOUG 1OXTA 1BBUA 2DGYA 4LF5Q 2JA8G 3FHWA 4LFBL 4UP9A 3HOWG 4IO9A 5LMNW 4JC0A 3GTQH 4DR4L 3GTJH 3RLOA 1VQ9A 1EIYB 1A62A 4A3BG 1HNXL 4GKJL 3CPFA 4DV2Q 3HOXH 3JAMc 4QL5A 4BA1I 4DV6L 1Z47A 1E22A 1N36Q 3H3VH 3F1ZA 2UUCQ 3I56A 4DPGA 3UDFA 2ZTDA 2WAQG 1UE1A 4PZ6A 1SR3A 4O0AA 5M3FH 5HY6A 4DV7L 3EIVA 2R92H 1JT8A 3S1NH 1VQ4A 1KQSA 4DR7L 4IPHA 1QUQA 1YHBA 2XTIA 4LFCL 2VQEQ 1L1OA 3G4SA 2QA4A 3PUZA 2QEXA 3AFQA 2RCNA 1BBWA 1PH3A 3I4OA 1HZBA 3MEFA 4P73A 3D0FA 1M90C 4UPAA 1TWCH 1PH7A 3S1QH 1PH4A 4DUZL 2I5MX 3M9BA 3PUYA 5FJ8G 1JB7A 1YI2A 3H0GH 4J15A 3G6EA 5DLQE 3KLWA 3TRZA 5C44H 4LWCA 4NPSA 2VY3A 3FKIH 1JJCB 5C4XH 4LF8Q 2OCEA 4BY7G 1A0IA 3KYHC 3NENA 3VDYA 3CCLA 5AJ3L 4DR2L 4GN5A 2MO1A 3A0JA 5LMNL 3PIPA 1G6PA 4GNXB 1LYLA 2F3IA 1KC8C 4BBRG 1NTGA 1Y14B 4JI0L 2CWAA 1K8AC 1YITA 2OWOA 1PH5A 4DR6L 2F4VQ 1Z9FA 4ALPA 4A3JH 4OO1G 4IFDJ 3KFUA 3E9HA 2VNUD 5IT9c 4HIMA 4JI8L 3G48A 3PV0A 2PQAB 4O2DA 4A3MG 2YTVA 4X62Q 1SE8A 3U50C 1GO3E 4H02A 2IX1A 3UDIA 3ULPA 4X65L 2K52A 3T1YL 1K73C 1EWIA 4JYAQ 3ER0A 3GTGH 5IYCH 3I4NH 3RLNA 5IYBH 4HJ5A 3RR5A 4DR3Q 4UY8C 4MNOA 1E24A 3K0XA 4Y52H 3CCVA 4LFAL 3OW2A 3SGIA 1IBKQ 1N32L 3KDFA 4L5SA 1WFQA 2LXJA 1VQOA 1PV4A 4A93G 1PH9A 1Q46A 1KRSA 2PNHA 1K3RA 1E1OA 2VS1A 1XPOA 1JJGA 3T1HL 2YV5A 1A63A 1VQ5A 1VQDA 2WB1G 3FKIG 3BJUA 4AH6A 3S15H 1AE3A 2R7FA 3MXNB 4YCUA 3AEVA 3PGZA 4A3CH 1K0RA 1NJIC 4YHHQ 2AWOA 3BZKA 1VQHA 4ME3A 3J81c 3F2CA 1QZHA 1FJGL 4NB3A 3W1BA 3BU2A 1FVIA 2AWNA 4JYAL 5IYBG 2V1CC 3CW2C 4X65Q 1VQGA 2E8GA 1QVGA 4K0KQ 4QQBX 1IYJB 4GOPC 1NMGA 3A5ZB 3TREA 4X62L 4B3TQ 5C0XJ 4BY1H 4DV4Q 1YJ9A 1YNXA 2CQOA 5J3BA 1OXXK 2K75A 1E7ZA 3GO5A 2F4VL 2CFMA 2R7ZG 4DR6Q 1WCMH 3M85A 1B7YB 1XMOQ 1AE2A 4A3IG 4GKKQ 1Q86C 4BBRH 5AJ3Q 5JEAJ 1PH2A 3PUVA 1A8VA 5FLMG 4LF8L 1VQCA 1KD1C 4IJLA 1Y1VG 3TEHB 3GTMH 2BH8A 3HOYG 5K36G 2HT1A 1IXRA 4A3GH 1YHQA 2Z6KA 2VW9A 3K80C 2AMCB 1KIXA 2JA7H 3GDEA 4GKKL 3PCOB 1VQPA 1S72A 1HZCA 2GN5A 3ERSX 3PO3G 4LUOA 3G71A 1XMOL 1K8GA 1VQBA 4P72A 3S2DH 4JOIC 4DKAC 5M5YH 1Q12A 2XGTA 1EQQA 1EYGA 3RNUA 4DR7Q 2KCMA 4DV4L 3ICEA 4DV7Q 1KAWA 4B3TL 1VCIA 3W5OA 1VQ8A 2YU9H 3CXCA 1E1TA 2Z0SA 1LTLA 4BXXG 2JK8A 3L2PA 2UUCL 4K0KL 1H95A 3HOUH 1N36L 3I55A 4DV6Q 1DGSA 2B3GA 2LSSA 2F52A 3CQZH 3HFZB 3NELA 1FJGQ 3PO2H 1Q82C 4GKJQ 1TWGH 4YHHL 4A3DH 1EOVA 2JQOA 1B8AA 2GVAA 3S1RH 1L1OB 2E2JH 4DR4Q 4GLVB 1BVSA 2HIXA 4A3FH 4R4TA 5ELNA 5C4JH 3HKZE 4LFBQ 1OXUA 3HKZG 1VQAA 3B6YA 3T1HQ 3U58A 3J7A5 2ES2A 2NVYH 2Q2IA 3PIOA 3GTOH 1LM0A 3UE0A 3S24A 3D31A 2JA8H 1QVFA 3CD6A 1QUQB 1N32Q 1IBKL 4LFAQ 3OTOQ 1W2BA 1HZ9A 5GAGC 2RF4A 4EQ5A 4R1JA 3WWVA 3H0GG 4FDBA 4DR3L 3PF4A 2I5LX 4XTCS 2B29A 2K5VA 4C3JH 5BR8Q 1XMQQ 1RIPA 2GVBA 2RHQB 1HNWQ 1E3PA 5FLXc 4A3JG 3PUXA 1V1QA 1SFOH 2PI2E 1LUZA 1B70B 1VQIA 3KF6B 4YWMA 2EXDA 4UP7A 3T1YQ 4JBKA 1TWFH 1Q1BA 3RZDH 1Q1EA 2QGQA 1V43A 4IPGA 1X6OA 2N49A 1UE6A 3CCUA 3EBEA 2A1AA 1N34L 4JI8Q 1VS0A 4HIKA 1PHJA 1CUKA 3Q8DA 4GOPB 5IP9H 1TWAH 1NE3A 4A76A 1XPUA 3PO2G 4JI0Q 1P16A 1P8LA 4NXNL 2IHEA 1OXSC 2KHJA 5IYDG 2JA7G 3RLFA 5LMNQ 1J5EQ 4DAYB 3A5UA 4QY7A 2OTLA 1XNQL 2VUMH 3ULLA 1T9HA 1W3SA 1TWHH 4DR2Q 1YIJA 2I0QA 3LGJA 1L2FA 4GS3A 3RN2A 2JA6G 3CPWA 4HIDA 2N78A 1SRUA 3J80c 4OX9Q 4HIOA 1MIUA 1U0LA 2NN6I 1HNZL 5GAEC 4JV5L 1EQRA 1RL2A 2VZAA 4DUZQ 1NMFA 4GN3B 3CCRA 1K9MC 5C0XG 3GTPH 3I4MH 2WP8J 3GD7A 2OTJA 3JAMi 4GLXA 2R93G 4A3FG 2MO0A 2AKWB 4JOIA 5IP9G 1NBWA 2VQEL 2UXCQ 1X55A 4LFCQ 1G51A 5IYDH 2YYZA 3M4PA 3K7UC 2MNAA 3UE1A 4Y7NH 3IRBA 4A3LH 4IJHA 2MQHA 3ZJYC 5JEAG 4JI1L 1MJCA 2EQSA 4RG1A 3CAMA 2FXQA 2CCZA 2Q2UA 4B3ML 3OYYA 1CSPA 1YHAA 1PVOA 2NVTH 2KHIA 2D62A 4UP8A 2K14A 3GTLH 1VQMA 2D0OA 2EIFA 3UDXA 1EIFA 4DV2L 3M3YH 2K5NA 1XTDA 4DV1L 1I50H 1HNXQ 4A3DG 4LUVA 4JI3L 3HOWH 2CKZB 4R4IA 4POGA 1UE5A 3F2DA 4PZ8A 3E9IA 1CKMA 1SMXA 4A4IA 1N33L 1VQNA 4GNXC 3EN2A 1XNRL 4LW1A 1VQLA 4LF5L 4GNXA 1YZ6A 1EUJA 4IOCA 2JA6H 4POFA 4DR5L 4A3LG 4A3GG 2Y0SG 2ZTCA 4DNIA 2ALYB 5M5WH 4PZ7A 4B3SQ 4JI7L 4LF9Q 1PYSB 4JG2A 2E5LQ 3W1GA 2NZHA 1XPRA 1I94L 4HJAA 1X54A 3KF6A 4DV3L 2E2IH 4DR1L 4L5TA 1IBLQ 2R93H 4BA2I 4HJ7A 4JI2L 4OWXB 1HR0W 1VQ6A 5C4XG 4R4OA 1WJJA 4A3EG 4LF7Q 2BA1A 2JA5H 4LF6Q 3PF5A 3M7NA 1Y1WH 1CKNB 4JCVE 3NBHB 4X64Q 2ZM6L 4JI4Q 3E0EA 2UUAL 3NEMA 2UU9Q 1VQJA 5JJLA 2UXDL 4YY3Q 3RZOH 3CP0A 4YWKA 4DV0Q 1S3OA 4MZ9A 2N3SA 2VQFL 2UUBQ 4KHPQ 1BKBA 3CCMA 4DV5Q 4X66L 3RN5A 4B3RQ 1NY4A 5LMUL 5HGQA 4NXML 1OTCA 3H3VI 2HHHQ 1PH1A 3PO3H 5GROA 1HZAA 3K7AH 2R7DA 4KLKA 3HOZH 5E7NA
chains in the Genus database with same CATH superfamily
1R9TH 5C4XB 1CKOA 2EYHA 3S1MH 4DAMA 3C3LA 4FF3A 1GKHA 4HAEA 1F9QA 1TXYA 4JBJA 4JI5L 1ASZA 2JEBI 1FL0A 2OT2A 4A3KH 3SE0A 2NVXB 1BCPD 1AH9A 3DMUA 5BN4A 5ELOA 2G5DA 3WOFA 4DK0A 1HA6A 5M5XH 3F2BA 1I6VC 3I4NG 1XTCD 4HJ8A 2FJ2A 3GTPB 4DUYQ 2ZJQA 2BCOA 2ICIA 5EPJA 1STYA 2A8VA 1I6HH 1SMYC 3HOXG 2NZOA 1C0AA 1IZ6A 3IFDA 2F0SA 3DHQA 4PMCA 1LT5D 4GOPA 5CV6A 1CHPD 1RODA 2KEEA 4PQXA 3TS2A 2R7ZH 2EYMA 3J81i 1Y1VH 2E76C 4YWLA 4A3DB 2JP1A 4CHTB 1TY2A 4JI4L 1L0WA 4BBSG 3HG9A 4C2MH 3UDGA 3KJPA 3S16H 3F8TA 2JA6B 4JI2Q 3BDOA 1JWSD 3KLSX 4IFDG 1VDZA 1ENFA 4KMUC 1PH8A 1STNA 1HXYD 3HOZG 4IUNA 4KI0A 4IUUA 4RMFA 3KK7A 3L7ZC 1I5FA 5C44G 3VR6A 4R4CA 3H91A 3I2ZA 1XNRQ 3IFTA 4LNQA 3GQBA 1NAPA 1O7IA 4FO2A 3AQQA 4JK1C 4JI3Q 3STBD 3CC4A 4DV1Q 1ESRA 3NTHA 2EJFC 4U673 2D5DA 4ULLA 1Q7YC 3AYHB 1WTRA 1NR2A 3MXUA 5LL6S 3CMAA 1CZWA 2B63G 4BY7H 2R61A 1C9OA 3VA5A 3STBC 1EQTA 2A6ED 1X56A 4OELB 5IYCG 1NR4A 4P75A 4KHZA 5EPKA 2UXCL 4TRDA 1A3UA 4Y7NB 2IX3A 2WB1B 4J8QA 1SEBD 2YU9B 3J7ZC 1Q8KA 2ZXRA 4OO1I 5I2XA 3G6JB 5F2DA 1SE4A 1JOKA 4OXPA 2EY1A 3MHBA 4L5RC 4FXDA 1HH2P 3S2DB 4RA8A 1H9KA 4A3EB 3L0OA 2D9UA 3LX0A 1TS5A 1EFWA 4DNTB 4IUQA 1XNQQ 1VQFA 4BBSH 4H44C 2HHHL 3QWNA 1PH6A 1J9OA 2K33A 4X6AH 4AYBB 2RCFA 4OIJA 4KHPL 5EKKA 1ILQA 2DNCA 1CZGA 2Y0SE 5D65A 4DAVA 1YVCA 1LLRD 1LO5D 5M3FG 1SNPA 1X9NA 4BXXH 3CMEA 5IGBA 3PUWA 2RDHA 2JN4A 1EIHA 2NUCA 1BO0A 5KGUA 4EQNA 4EQOA 4WFN3 4DR1Q 2YTYA 2CVRA 3TMEA 4R4QA 2L15A 1B9MA 4LF9L 1RJTA 3KLSA 4H0LC 1O7ZA 1ASYA 4IOAA 1SLJA 4HEDA 2L5TA 2PMZB 2JA8G 3NP8A 5FO7B 1JC7A 2JA5B 1BCPB 1A3TA 2M00A 3RZDB 1EL0A 1Q8IA 4DR4L 3Q22A 1EIYB 4GKJL 3CPFA 2EJMA 2A6HD 4BA1I 2E2IB 1JWMD 3DWPA 5FO9B 2UUCQ 3I56A 3UDFA 2MUYA 2WAQG 1PZKD 1SR3A 5ELEA 3EIVA 2R92H 1ZYRC 3A56A 1VQ4A 1KQSA 1SXTA 5A35A 1QUQA 4FNFA 3HKZB 1XYIA 3S1MB 1QNUA 3PUZA 3AFQA 2RCNA 3DWQA 4QF4A 4UPAA 1PH4A 4HN7A 1EY7A 3PUYA 3FVQA 3DWAA 5ELDA 1BCPC 1YI2A 4HTHA 4J15A 3TRZA 2O4XA 1JJCB 4BY7G 2OCEA 3I8ZA 3KYHC 4DR2L 1IL8A 4GN5A 2MO1A 5LMNL 5CV7A 1G6PA 1EIGA 1KC8C 1DOMA 1K8AC 1BXTA 1FR3A 3BVMA 1Z9FA 4O42A 4OO1G 1SDFA 5C5LA 5I6WA 1SE8A 5EGTA 4H02A 3D6WA 2EVBA 3UDIA 1EWIA 1K28A 2L4NA 2SNMA 4IUPA 1DM0B 1WTQA 1B3AA 1C48A 2J7ZA 4S3SA 1CHQD 3KLRA 1IBKQ 1ILPA 4L5SA 1IYVA 3T16A 5M3MB 1PLFA 1Q46A 2PNHA 4H13C 2R7ZB 1TQOA 2DNEA 3FKIG 2K28A 3SK5A 3D4DA 3AEVA 3PGZA 4RHSA 1K0RA 1MSHA 4K8JA 1G91A 2A73B 4NB3A 3I72A 1FVIA 5IYBG 4X65Q 4KY7A 4K6DA 2E8GA 2XWBB 5G3LD 1QVGA 1HA5A 3A5ZB 3TREA 3URYA 1I4RA 4DV4Q 1YJ9A 1KAAA 2ZXOA 1E7ZA 2F4VL 2CFMA 1EY5A 2KEDA 2A68D 1AFPA 4K2LA 4XT1B 2KCNA 4A3IG 1LTTD 1Q86C 1EWHA 3BDLA 2NZ1D 1PH2A 3M7GA 3PUVA 1VQCA 1KD1C 3OMGA 4FP5D 1Y1VG 3GTMH 1R9TB 5IGDA 5JVG3 1IXRA 3UI2A 1B3QA 1KIXA 3KF8A 2XWJB 1SYFA 3K80C 1VQPA 1K0SA 1Z7TA 3G71A 5I4DA 2G9HD 4HCSA 3ONAB 3S2DH 1HQRD 1Q12A 1EYGA 1RDPD 5KEEA 1VQ8A 2YU9H 2Z0SA 5ELCA 4EVOA 3L2PA 2F0MA 3HOYB 2F52A 3HFZB 4KJNA 4YHHL 1UAPA 3S1RH 1HFNA 1B8AA 2GVAA 1TT2A 1BVSA 2HIXA 3DEOA 1BDOA 5HGTA 2F0KA 3HKZE 1PTOB 3J7A5 4OO1H 3U58A 4G4KA 3GTOH 3VR5A 5C5MA 1RCVD 3S24A 3D31A 3CD6A 1N32Q 1QUQB 3SDZA 4DN4M 4EQ5A 4R1JA 2P5ZX 3WWVA 3RD4A 1TU2B 4FDBA 1B4OA 4C56C 1H9SA 1K8OA 2B29A 5I6YA 2GVBA 2RHQB 4G57A 1E3PA 2XSCA 4A3JG 3PUXA 1F77A 1MBYA 1LUZA 3KF6B 4CBVA 4UP7A 2F0VA 3RZDH 2QGQA 4LJZC 1X6OA 2N49A 4X3KA 2F1MA 2A1AA 3GV6A 1YNJD 1F9RA 4GOPB 2F3VA 1K83B 1NE3A 4A76A 2XRQD 4ME5A 3PO2G 4JI0Q 4NXNL 5IYDG 1PFMA 1ZKOA 5LMNQ 1J5EQ 4QY7A 1YIJA 3H0GB 4FF4A 3LGJA 2CHBD 2IW3A 3CPWA 2WKCA 4OX9Q 3SK8A 4HIOA 2VZAA 4DUZQ 5EKIA 1LT4D 3CCRA 1CFMA 1I4QA 2WP8J 2ENBA 2AKWB 4L63B 3P75A 1G51A 4ZUIA 1G2SA 4A3GB 2EPBA 1Q3LA 1I3QB 3TP7A 3IRBA 4A3LH 1LV9A 1KABA 1SE2A 4LK1C 2Q2UA 1ENAA 2D0OA 3UDXA 2K5NA 1I50H 4LUVA 4JI3L 2CKZB 2KCCA 1HRJA 1O78A 5CV4A 4PZ8A 1SMXA 1N33L 2GA4B 3EN2A 4LF5L 1EUJA 4IOCA 4PMBA 3EROA 2ZTCA 4DNIA 4B3SQ 4JI7L 4CGYB 1RD9D 1I94L 2R93H 2E2IH 2QCPX 1EYDA 4JI2L 4OWXB 1HR0W 5C4XG 1LABA 4LF7Q 4GZYC 2BA1A 2JA5H 2B2YA 4B08A 1EY0A 2IJ0A 3NBHB 2J0TD 4I65A 4IUTA 2Q8IB 4CKEA 5JAVA 4K8IA 3K5LA 1JOOA 2HCCA 4YWKA 4DV0Q 2UUBQ 3R3OA 1TWCB 3A7LA 2HUGA 3H3VI 3TSSA 2EY2A 5GROA 1HZAA 3NWSA 5ELFA 3AMUA 5FLXE 2ZT9C 2Z1CA 2K01A 1HR0Q 3A7AB 3H15A 4XIGS 3AFPA 1PTOC 1SJED 3C2PA 3OW7A 3QOJA 3HZXA 4C3HH 1KRTA 1GUSA 1ET6A 5FKAC 1EZ6A 2WACA 4RGNA 1GUWA 1CSQA 2B39A 2E2DC 3NSWA 1QZGA 2PQAA 5FLXL 1IYUA 4A3EH 3FEWX 4A3DG 5GQOA 1QVCA 1UNSA 1FGUA 4PG3A 5CR3A 2LFNA 1CQVA 1EZ8A 3S1QB 1PYBA 3DLLA 1HR0L 1DYQA 5IE8A 3FRPB 3HOVG 1H9SB 4UHVA 5JJZA 3NK9A 1U4RA 3CRKC 2O5JC 5LMUQ 4JI6Q 3KF8B 2R92G 3M4OH 4KN7C 2H4OA 3MXNA 4WJ4A 3JC66 3GTKH 2L11A 3QG1A 4DXGA 3TZUA 2IHFA 2UU9L 4A75A 4KHVA 4ID6A 1GHKA 2KCTA 2B8FA 4WJ3M 3J80E 1TS2A 3T56B 4HCEA 3SK4A 4ZK9B 1ESFA 2YTXA 4XYQA 1H9JA 3S17H 4RAUC 3KBXA 3TQYA 2ICEC 4GN4B 3CHBD 4V190 2RHSB 3KBGA 4X3TA 4CKBA 1JICA 1JOQA 1YBYA 5E4WC 4JI6L 1EYCA 1F9PA 3NWTA 2L0CA 2O2LD 1RTOA 3O13A 4OONA 1OXVA 3F2UA 3S14H 3QOLA 3D6CA 4Z9CB 2OXPA 1TS4A 3S2HH 3RMHA 2OQKA 4APVA 3KJOA 1RF2D 1MKHA 4F88A 1PYWD 1IBML 5IIFA 4IPDA 1G291 2LXKA 2K32A 2D0PA 2NVQH 4C3HB 1Y1WG 4WRDA 2WAQE 1WCMB 3K6OA 3P7JA 2HIVA 1X65A 1KNAA 4A3CG 4K6LA 4JV5Q 1HPCA 2ATWA 1IW7D 1IL2A 2I5HA 5IWAL 2EYJA 2RBMA 1J5EL 4HR7B 4NXNQ 2A19A 1D5ZC 4HMJA 4DV5L 5JJKA 1J6QA 2UUBL 2H5XA 4BWGB 1GD7A 2KBNA 3M3YB 3H09A 4YY3L 5M5WB 4KV6A 4P74A 1BNZA 1YEZA 1D8LA 1TR5A 3I4MG 4MIUA 1N9WA 1KXLA 4KKTA 1U5KA 1VQ7A 4FXKC 5FLMH 4DAYA 1HNWL 4KKSA 4DV3Q 2OEOA 1VQKA 1LTRD 2AHOB 1OO9B 5BN5A 3BZCA 2KENA 3D4WA 4DK3C 2BH2A 4B3SL 4ZLTF 2XRSD 3CCJA 1ICFB 2CWPA 3HOUG 1B50A 4RHRA 1BBUA 1QOHA 3FHWA 4UP9A 3HOWG 3MXPA 2K5QA 5LMNW 4JC0A 5JEAH 2VUMB 3GTQH 4G7HC 3GTJH 3HOXH 1AZQA 3QB3A 2EJGC 1YNND 4DV6L 1B44D 5IGEA 1SYGA 2PNRC 4DPGA 1FD7D 1UE1A 4PZ6A 4RCNA 3PIP3 1JE4A 1JT8A 4EQPA 4IPHA 3J7YW 2QA4A 3RZOB 1JWUD 4UDUC 2QEXA 3DM1A 1M90C 2F0PA 1TWAB 3D0FA 3MEFA 1PH7A 4A3KB 3S1QH 4A3BB 3CU7A 1QJOA 4DUZL 5CBEE 3HP3A 1PRTC 3A55A 3H0GH 1A15A 1L0YB 4LWCA 4IN3A 3VDYA 3CCLA 2RA4A 4BBRG 1STGA 1Y14B 4JI0L 2CWAA 5L37A 2KVMA 2F4VQ 4A3JH 3KFUA 3E9HA 4HIMA 2XVSA 4FF2A 1PTOF 5T1GA 2PQAB 4A3MG 1GO3E 2V4DA 2NN6H 3DXJC 3ULPA 3T1YL 4X65L 4JYAQ 1UUPA 5IYCH 4RGTA 3I4NH 3SXHA 2C9OA 4UY8C 3RR5A 4Y52H 3TP8A 4MNOA 3A54A 4K5XA 3CCVA 3SGIA 5AFWA 4C1NI 1WFQA 4J1MA 5C3EB 2R93B 1TIID 1A2TA 2VS1A 4MHEA 1XPOA 1JJGA 3T1HL 1A63A 1VQ5A 2A69C 2R7FA 3MXNB 3MZ5A 3EQLC 2Z8LA 4YHHQ 4NDXA 2AWOA 1CTMA 4ME3A 3J81c 3T51B 3F2CA 1SSOA 1FJGL 2AWNA 2PYKA 3CW2C 4QQBX 1PZID 3D8GA 4GOPC 3MXGA 1NMGA 4JW0A 4X62L 4B3TQ 3PO3B 5C0XJ 2M9VA 3CKIB 3TZDA 4BY1H 2CW0D 1DCZA 2F0TA 4C3JG 3BVGA 2EE1A 2R3ZA 1WCMH 1XMOQ 3J81L 1STBA 2A74C 5M3FB 4GKKQ 1ML0D 4BBRH 5AJ3Q 5JEAJ 1A8VA 2RDGA 3TEHB 4RGMA 3HOYG 4A3GH 2Z6KA 3GDEA 1CT1D 3PCOB 4GKKL 3K5OA 4LUOA 2F0DA 1DZ1A 4CDFC 1EQVA 5DEHA 2XGTA 4DR7Q 3AU7A 4DV4L 2OF1A 1F2LA 2NB0A 5E1FA 3DUZA 1VCIA 3NQIA 3W5OA 4B3TL 3CXCA 1LTLA 1QG7A 4KTAA 4HMIA 4K0KL 3HOUH 2K5WA 4OGQC 1EU3A 3I55A 4QCLA 2B3GA 3J80L 3CQZH 3QO2A 1FJGQ 3PO2H 4HSPA 2E2JH 1LT6D 5IT9L 4R4TA 3TBIB 3Q23A 1CK1A 4LFBQ 3T1HQ 2BOSA 5DM63 1DOKA 2Q2IA 1F9SA 2N88A 3UE0A 1F2ZA 2JA8H 1Y8PB 1IBKL 1MGSA 2CQAA 1Y8NB 1W2BA 5GAGC 3AB9A 1XWEA 5E3FA 3PF4A 2I5LX 5BR8Q 1XMQQ 1RIPA 1HNWQ 1EYAA 1RTNA 1EU4A 5FLXc 1V1QA 2XNAC 2AUJD 2ZXPA 1VQIA 2AQ1B 4BY7B 1PDQA 2XIWA 5JPNC 2C5CA 3X3MA 2K03A 1V43A 4WORA 3CCUA 2HCIA 3EBEA 2K1BA 2F0EA 2PO4A 1GJXA 3HS0C 4HIKA 1GUNA 3Q8DA 1XPUA 1GUOA 1HHVA 1CI3M 1OXSC 2IHEA 1GUTA 3A5UA 2KOLA 3ULLA 4DR2Q 5KRUA 2JA6G 5CGKA 2N78A 1MSGA 5IOCA 1MIUA 1HNZL 1LTBD 5GAEC 1EQRA 1RL2A 1WVLA 1K9MC 3I4MH 5C0XG 3FPPA 5C6AA 4A3FG 2MO0A 4JOIA 5IP9G 4FVMA 2UXCQ 3N6RA 2VB2X 2JA7B 4IJHA 2Z6BA 3ZJYC 5M9OA 1Q90A 5JEAG 4JI1L 2EQSA 1HTPA 2FXQA 3CAMA 4B3ML 3OYYA 5TSSA 1CSPA 1YHAA 1PVOA 4K2KA 2NVTH 2KHIA 3GTLH 2EIFA 3CRLC 3HOWH 2CH4W 2Q8TA 3U9SA 4POGA 3HRZC 5KYLA 3MTSA 1X3PA 3E9IA 3S9WA 1CKMA 4A4IA 1JR0D 2G9DA 4QUFA 3GTGB 3OMCA 1X32A 1VMCA 2EOTA 2RQXA 2Y0SG 3BZDB 4JG2A 1EY8A 4C3IG 4E6IA 4DV3L 4L5TA 1IBLQ 1II3A 2DJFC 3GTOB 1WJJA 4A3EG 1O7YA 4CDCC 4ABNA 1Y1WH 4R9WA 2KHSA 3NEMA 4KKUA 1CM9A 5JPMC 4MZ9A 2N3SA 2VQFL 4DV5Q 4B3RQ 5LMUL 4NXML 1OTCA 5EQ0A 3PO3H 3U9OA 5EJWA 3S1NB 3HOZH 5IWAQ 1X3EA 2K6AA 3A8KE 3HOXB 3VR4A 2R6GA 4TVAB 2NVQB 4CDEC 2F0UA 4XQQA 4RWSC 3NXWA 2Z6KC 2RSNA 1XJVA 4A3BH 2RDFA 2F0OA 5M5YB 2HQLA 3GTMB 2JA5G 2EZVA 1PZJD 2B2WA 2ZJRA 2PMZE 1KHIA 2B63H 4YCWA 3H3VC 1UEBA 3J81j 4BBSB 2I46A 1EY4A 5J1ZA 3W3AA 4KY5A 4P71A 1M1KC 3P1HA 1LTGD 3R2TA 3PMFA 2UXBQ 2X6LA 1A6XA 2WAQB 5CV9A 3U4VA 2WFWA 2K50A 4NXMQ 4DXFA 2ZTEA 4X66Q 3HEJA 1CKNA 4GLAC 2F0FA 1V9PA 4LUZA 1MJEA 1FNUA 1WTHA 3I4NB 3EFXD 3ULJA 2DY8A 5DM73 4IPCA 1RHPA 2ZM6Q 2MFIA 1WI5A 3I70A 4LF6L 5IP7G 2Z4HA 5C3EH 3NTIA 5J22A 1YJNA 2ID0A 3A8IE 5EAYA 4OWWB 5FJ8H 2PQEA 1AW7A 5CBAE 3WDNA 4HJ9A 1Y8OB 4PMWA 3KDFB 5JJIA 2F0QA 2DUDA 3MEHA 2BDNA 1N33Q 2K5HA 2B2YC 3HOVH 4N9PA 3QIAA 5A2QE 2IT1A 4G7OC 5J39A 4MTNA 1N8RC 1QILA 4B3MQ 3W2DA 1QCBD 2K4KA 4JI1Q 4IURA 3BYTB 1H9MA 4A3MH 4IFDI 1M8AA 1PFSA 3HOZB 5M3MG 3IL8A 2EYPA 1HJPA 4NP5A 2WKDA 2BA0A 1I3QH 3ZYYX 1VMPA 3FKIB 4AIMA 1SYCA 2AQ2B 3MVVA 1Z6HA 4M8AA 4JI5Q 1F2YA 4C3IH 4Q0FA 3CQZB 1X3FA 1L0XB 1E0BA 2PZUA 1WOCA 2EY5A 1V8QA 1PTOH 1UWVA 4B3RL 4AYBE 2VQFQ 2Q2HA 3I4LA 3GTLB 4EX5A 2JA8B 1CA6A 1X3GA 4JPBW 2TMPA 3HOWB 1U4LA 4ZUJA 1I4XA 4BY1G 4X64L 3K81C 2OQ0A 2ASBA 1SROA 1PA6A 3I7FA 1S40A 3OTOL 3ND8A 2RVLA 1STHA 1Y69U 4JI7Q 1VQEA 3Q6SA 5EPLA 1WTPA 1EEFD 3CC7A 4LF5Q 4LFBL 1H9RA 4IALA 1TWFB 1STAA 4TKOB 3RLOA 1A62A 1VQ9A 4A3BG 1E2VA 3OPOA 5I2YA 3HGBA 1Z47A 3ITPA 1SYEA 5A2QL 2PCFB 1KNEA 4CJ2C 3F1ZA 1N36Q 2ZTDA 3HOVB 1X3QA 3K7AB 4O0AA 3T4AC 1O7LA 4DV7L 3S1NH 1KDAA 4BBRB 3QR8A 3L9AX 1AN8A 1O80A 1YHBA 2XTIA 4LFCL 3G4SA 1SJHD 1BBWA 1PH3A 1HZBA 4P73A 4J6HA 1FNWA 1WTWA 3BS1A 1I6HB 2I5MX 3E0JA 1JB7A 2MJ8A 1BQQT 2KQ3A 3KLWA 2B2UC 3K5MA 5M5XB 1A0IA 1PRTF 3A0JA 1BCPF 3EVQA 4GNXB 1LYLA 2SEBD 2OWOA 1YITA 4DR6L 1HTLD 3PO2B 3G48A 3PV0A 4O2DA 2YTVA 4X62Q 4F87A 5CORA 2KJXA 3TDQA 3L3OC 3GTGH 1BF4A 4R8NA 1T5XD 5IYBH 4DR3Q 1D1KA 4NMZA 1JCKB 1FYCA 5ISRA 1ONLA 1N32L 2LXJA 3PQIA 4OEMB 2CW0C 1VQOA 2EYFA 1PV4A 1PH9A 4A93G 1KRSA 1K3RA 1E1OA 2B2VA 1M4VA 2MHVA 2Q8RE 1VQDA 2WB1G 4AH6A 3BJUA 3S15H 3GTKB 1AE3A 1PRTB 2MPMA 1D5XC 4ZAIA 4A3CH 5D3DA 5E4XA 1NJIC 1LTID 2KUMA 3BZKA 3V05A 1VQHA 4R8IA 1TKWB 3QJYA 1SNCA 3BU2A 1E2WA 4K0KQ 2B8GA 3C46A 3M4YA 3H6MA 3NQTA 4RGOS 2K04A 4RKBA 3K59A 1DONA 1HFGA 2VXWA 1UEAB 3K57A 2K75A 4DFAA 2R7ZG 3VYTA 1IKMA 3M85A 4KN4C 1A2UA 4ILWA 1AE2A 2L12A 2F03A 4HSVA 3Q0AA 5FLMG 4F8MA 3OWEB 4IJLA 1XX8A 4DNRB 2BH8A 1CQFA 1SAPA 2VW9A 2WINB 2JA7H 1XXGA 1S72A 4L6TB 1HZCA 2LY7A 1DD2A 1XMOL 1VQBA 4V0BA 4DU9A 2A6EC 4P72A 3JAML 5M5YH 3MA2B 3E3XA 2KCMA 3ICEA 3VYRA 1KAWA 1VF7A 1G6ZA 1V1OA 5KIXA 2JK8A 2QDBA 2UUCL 1MD2D 1N36L 1YNNC 4A3JB 4DV6Q 2LSSA 3PIO3 2BE5D 4A3DH 2K5DA 1ZXTA 1L1OB 5C4JH 1EY6A 1OXUA 3HKZG 5KNCA 1AP0A 2IPKD 2NVYH 4PNYA 1KDBA 2F0NA 1BR9A 4IQZA 1V1PA 1QVFA 1PMRA 1HZ9A 2RF4A 3H0GG 4DR3L 1MI2A 2K5VA 2J4XA 3BYYB 5COYA 3S14B 1JB3A 2TSSA 1SFOH 4IFDH 3V96A 2PI2E 4YWMA 2NWGA 2EXDA 3T1YQ 1TWFH 1Q1BA 2B2UA 2L9HA 4XQJA 1Q1EA 5JVH3 3T13A 3GTQB 4IPGA 2QKIC 1N34L 4JI8Q 3I90A 4XT3B 2QILA 2H1EA 1CUKA 4ZKCB 1TWAH 2M2LA 1P16A 2JA7G 4EGVA 3RLFA 1XNQL 4DAYB 4A3MB 2OTLA 1W3SA 3A8JE 1L2FA 3RN2A 4RCOA 5EKLA 4HIDA 3NE5B 3I73A 3J80c 1S5FD 1U0LA 2NN6I 2L1BA 1NMFA 4GN3B 4B9XA 1ZYRD 1MHWC 2OTJA 4GLXA 1I4HA 2JXMB 4DK1A 5C44B 1NBWA 2VQEL 5IYDH 3ERQA 2YYZA 3M4PA 2MNAA 4Y7NH 2EY6A 2MQHA 1FGBD 2CCZA 3IAYA 4L8JA 4UP8A 1T5EA 1SMYD 3J81E 4DV2L 1EIFA 3M3YH 1XTDA 2DJGC 2DN8A 4K5VA 1W6KA 4R4IA 2IWHA 1HUMA 5JOBA 1SBBB 4F7XA 1VQNA 4GNXC 1XNRL 2FHTA 4I7AA 4GNXA 1YZ6A 2JA6H 4DR5L 1QNKA 4A3GG 4A3LG 1TWGB 1WTXA 4KJOA 2ALYB 2E74C 5M5WH 4LF9Q 4FYDA 1PYSB 4A3IB 3W1GA 1XPRA 3K0YA 2QW7A 4HJAA 3OWFA 1S5BD 2EXZA 2LKVA 1KDCA 4HJ7A 1VQ6A 4R4OA 4N8X1 5C3WA 4LF6Q 3M7NA 1ENCA 1J8IA 1NSNS 4X64Q 4JI4Q 1U4PA 1GHJA 2UU9Q 5IODA 3RUZA 1PRTD 2UXDL 5D14A 1SFOB 2F0WA 5KNBA 4RKLA 1S3OA 1I4GA 4LMQD 4KHPQ 3J7AV 1NY4A 3S2HB 2HHHQ 3P20A 5IT9E 3K7AH 5I9PA 3EJIA 3GTJB 4KLKA 1K8MA 2LMCB 5E7NA 2UXBL 3R8BA 3VR3A 2DY7A 5D3IB 5BN3A 2EDGA 4AQYL 2AQ3B 4DUYL 2MP1A 4RH6A 1C7YA 5C3XA 3K58A 5IP7H 2R92B 4MN3A 2HDMA 2X6GA 4L5QA 3WOEA 1IBMQ 1GOZA 1WTOA 3SHLA 3CF5A 1AZPA 1B2TA 5IY0A 2HD3A 4A93H 3FP9A 4QJFA 3J80i 4AQYQ 1GM5A 2A6HC 2QEJC 3CCEA 1G2TA 3SR1A 1TVXA 2PI2A 3R2IA 4K14A 1WD0A 2WB1E 1LTAD 1QE6A 5GAHC 2Z9HA 5GADC 3CC2A 3HKSA 1L1OC 4RFBA 3HOYH 1STEA 2N55A 3BDCA 3OOCA 5C0XI 1DJRD 4DV0L 4LF4Q 3E5SA 2SNSA 2UUAQ 4A3KG 3OIQA 4IUVA 3LWEA 4IZ8A 5M3MH 1UE7A 1AEXA 3H94A 2AUKA 1NUCA 1EFID 1GVPA 3TN2A 3K8AA 5LHY1 3M4QA 2C35B 5HURA 1LT3D 4A3FB 5C4JB 4DR5Q 5G3LF 3T53B 2X69A 4LF4L 1DXMA 2B2WC 2IX0A 2JJQA 4C3HG 1Y1WB 1JE5A 5C4HA 3NHHA 1WCMG 2ZJPA 2RSOA 3CCQA 4CJ1B 3BG3A 5KYIA 2JEAI 3LNNA 1ICWA 2JYOA 1NNXA 2JE6I 1V1PB 1ZEQX 3KOJA 5NUCA 4B9WA 4XQNA 2FFKB 3NPPA 3PSIA 1EOTA 4DF7A 5H1SE 1IKLA 2O5IC 1C8CA 2WV6D 4C1NK 4TQUS 1YJWA 5C3EG 1TY0A 3G7LA 4JBMA 1EEID 1K83H 4DK6C 3A74A 2VL6A 2NVXH 3Q24A 1HNZQ 2SDFA 4OX9L 2NN6G 4JVZA 3OSOA 3TS0A 3C1EA 1KL9A 1SE3A 2IL8A 1D7QA 5KNDA 2B63B 2PZTA 2E2JB 5IGGA 4QGUA 4KD4A 4Q5VA 2NYZD 3CCSA 2VB3X 1GXDC 2N8NA 2F0GA 1JJ2A 1G8ZD 2F0IA 2B2VC 2K7VA 4FXGC 3HOUB 3TP5A 1Q81C 2A68C 1HQMC 5IGFA 2F0HA 1A3VA 1N34Q 1HCZA 2UXDQ 3FPUB 4YIJA 1WYDA 2VUMG 4G7ZC 4OWTB 3VR2A 1SN8A 3OIPA 4JBWA 4YCVA 2E2HH 4LF7L 3DM3A 3U4ZA 1Y1VB 2Q2TA 1S5ED 3LWUA 3V2TA 4QIWE 4LAAA 4XXEA 1EY9A 5BR8L 3MAQA 1XMQL 1IBLL 2NVTB 4A3IH 1I94Q 1JMCA 1I4PA 4OHJA 3D3RA 3S1RB 1PFNA 2E5LL 2IY5B 1EWCA 2JA9A 3C1FA 4AYBG 1RKNA 1IW7C 1OXTA 3OHXC 2DGYA 4M1UB 3IKJA 4IO9A 1C4QA 1HNXL 2WIIB 4DV2Q 3JAMc 4QL5A 4TSSA 3VYSA 1E22A 3H3VH 4XDXA 5EBDA 3ND9A 5M3FH 2PW5A 4U68A 5HY6A 3JAME 4KD3A 4I7ZC 4DR7L 4KK7A 4ODGA 1K3BC 2VQEQ 1L1OA 5CC4A 3I4OA 1F2MA 1TWCH 1D1IA 2FMMA 3M9BA 5FJ8G 3MFYA 1TWHB 3G6EA 5DLQE 1IHZA 1DOLA 5C44H 4NPSA 2VY3A 1PTOD 2B2TA 4NW2A 3FKIH 5C4XH 4LF8Q 2QDLA 3NENA 3J7AF 1ET9A 5AJ3L 3DEPA 2HQEA 2RKSA 3PIPA 2F3IA 1NTGA 1PH5A 4ALPA 4CKCA 1BUVT 4IFDJ 2VNUD 5IT9c 4JI8L 2K05A 5CV5A 1QWYA 2BDOA 3TP6A 3U50C 5CYUA 4XYOA 2IX1A 5FO8B 2K52A 1K73C 5K36H 3ER0A 4CDDC 1R4QB 3RLNA 4HJ5A 1E24A 3FMCA 3K0XA 1S5DD 3VYUA 4N8FA 4LFAL 3OW2A 3KDFA 2E2HB 4O1NA 1KLUD 2KA7A 4C3JB 4ZKBB 1S5CD 2YV5A 2I07B 4OL7A 3NBIA 4YCUA 1SNQA 4H7BA 4K5WA 2NTSA 1BOSA 4ZYSA 1QZHA 3W1BA 5FOBB 4JYAL 2V1CC 1B9NA 1VQGA 1IYJB 1TS3A 1S4ZA 1YNXA 3NBHA 2CQOA 5J3BA 1OXXK 3GO5A 2F0JA 1LTSD 4DR6Q 4DA2A 3VA7A 1B7YB 2KECA 3SVMA 1R4PB 1E2ZA 4QIWB 3I4MB 2LS01 4C3IB 3BVZA 1SYBA 5CMDA 4LF8L 4X3SA 2FMCA 5K36G 2HT1A 2E75C 4OIKA 2A69D 1YHQA 2BE5C 3EA6A 2AMCB 5DAUA 1GUGA 3PO3G 2GN5A 3ERSX 1K8GA 4FF1A 1D5MC 4QUCA 5K5PA 3NTKA 4JOIC 4KY6A 4DKAC 1EQQA 3RNUA 1BBXC 2Z4IA 1I50B 3FDTA 4WJWA 4DV7Q 2SOBA 1E1TA 4BXXG 3MFGA 3GV3A 1H95A 3M4OB 4ZCKA 1WD1A 1B1ZA 1DGSA 3NELA 3KUPA 2QF7A 5FK9C 1Q82C 4GKJQ 1TWGH 5C0XH 1EOVA 2JQOA 2HDLA 4GLVB 4DR4Q 1JORA 2D2CC 4A3FH 3K5NA 5ELNA 3N52A 1VQAA 3B6YA 1D2BA 3D4RA 2F3WA 4BS9A 2ES2A 3PIOA 1LM0A 2EYOA 4LFAQ 3OTOQ 2L55A 1QB5D 2EYLA 4XTCS 4C3JH 1SYDA 4JBKA 1B70B 2B2TC 2F4IA 1U9RA 1KTKA 1UE6A 2FINB 1VS0A 4DAPA 2CH4A 1PHJA 2NTTA 1LACA 1SNDA 5CV8A 5IP9H 4ZQ3A 1P8LA 2KHJA 2VUMH 1T9HA 1TWHH 3E6ZX 3I91A 2F0LA 5LL6X 2I0QA 3SK6A 4N9TA 3SEBA 2A5HA 1KLGD 4GS3A 3NUCA 1SRUA 2XN9C 4JV5L 1W6JA 3GP7A 1PXUA 3R93A 4CJ0B 3GTPH 5C4ZA 3GD7A 3JAMi 4A93B 4NKLA 4PV1C 2R93G 1YNJC 3I3CA 1X55A 4LFCQ 3K7UC 3UE1A 5I9OA 1NCVA 1U4MA 1FNVA 4DGZA 5T1IA 1MJCA 4RG1A 2MGSA 2D62A 2K14A 2PW7A 1VQMA 4P2CB 5EBCA 4DV1L 1HNXQ 1D6EC 1UE5A 1CA5A 1PFBA 3F2DA 4QB4A 4ZRZA 4C2MB 1SNMA 4LW1A 1VQLA 1HUNA 3S16B 4POFA 1JQYD 3MWYW 4MTKA 4PZ7A 2E5LQ 2NZHA 3S17B 1X54A 3KF6A 4DR1L 1B53A 2PZWA 4BA2I 2NVYB 3S15B 5DNFA 5IGCA 3PF5A 1CKNB 4JCVE 4X3UA 2ZM6L 2PPBC 3E0EA 2UUAL 2JSOA 1VQJA 5JJLA 1SNOA 4YY3Q 1WTVA 4UAIA 3RZOH 3CP0A 2NBFA 1BKBA 3CCMA 2Y0SB 5ELBA 4X66L 3X3NA 3RN5A 5HGQA 1PH1A 3MC0B 4BY1B 1VF5C 2R7DA 4QMGA
chains in the Genus database with same CATH topology
5IWAQ 1X3EA 2UXBL 1R9TH 1HR0Q 3H15A 1CKOA 3AFPA 4XIGS 3S1MH 4DAMA 2R6GA 1GKHA 4TVAB 1TXYA 4JBJA 4JI5L 1KRTA 4C3HH 4AQYL 2JEBI 1ASZA 1FL0A 2Z6KC 4DUYL 1C7YA 4A3KH 1XJVA 4A3BH 5IP7H 1AH9A 2HQLA 5ELOA 1CSQA 1QZGA 4L5QA 2PQAA 2JA5G 4A3EH 1IBMQ 5M5XH 3F2BA 3I4NG 5GQOA 2PMZE 2ZJRA 1KHIA 1QVCA 1FGUA 3CF5A 4HJ8A 4YCWA 2B63H 4DUYQ 5IY0A 1UEBA 4PG3A 2ZJQA 3J81j 4A93H 3FP9A 4QJFA 3J80i 4AQYQ 1GM5A 2A8VA 1I6HH 1PYBA 3CCEA 4P71A 1M1KC 1C0AA 3HOXG 2NZOA 3DLLA 2PI2A 1HR0L 2UXBQ 1IZ6A 5IE8A 3HOVG 2WB1E 3U4VA 4GOPA 2WFWA 2K50A 4NXMQ 5GAHC 5LMUQ 4JI6Q 2ZTEA 3KF8B 4X66Q 2R92G 3M4OH 5GADC 3CC2A 3TS2A 2R7ZH 3HKSA 1L1OC 3J81i 1CKNA 3HOYH 4WJ4A 4DV0L 1Y1VH 3JC66 4GLAC 5C0XI 4LF4Q 3GTKH 1V9PA 4LUZA 1MJEA 4YWLA 2IHFA 2UU9L 3ULJA 4IPCA 4A75A 2UUAQ 4A3KG 2ZM6Q 2MFIA 4JI4L 2KCTA 1L0WA 1WI5A 4BBSG 4C2MH 3UDGA 4WJ3M 4LF6L 5IP7G 3KJPA 5M3MH 5C3EH 3S16H 3F8TA 1UE7A 4JI2Q 2YTXA 1YJNA 2ID0A 4IFDG 5EAYA 1GVPA 3S17H 3K8AA 3TQYA 4OWWB 1PH8A 3M4QA 5FJ8H 2C35B 3HOZG 4GN4B 4KI0A 4RMFA 4DR5Q 2RHSB 4HJ9A 5C44G 3L7ZC 1I5FA 4LF4L 4PMWA 3KDFB 5JJIA 4R4CA 3I2ZA 1YBYA 1XNRQ 2IX0A 4LNQA 2JJQA 2DUDA 4JI6L 1N33Q 1JE5A 2K5HA 1O7IA 1WCMG 2ZJPA 3CCQA 3HOVH 3AQQA 2JEAI 4JI3Q 2JE6I 3KOJA 3STBD 3CC4A 4DV1Q 2IT1A 4OONA 1Q7YC 3AYHB 1OXVA 4MTNA 3S14H 1N8RC 3PSIA 3CMAA 4B3MQ 2B63G 3S2HH 4BY7H 5H1SE 2K4KA 4JI1Q 2OQKA 4APVA 3KJOA 4A3MH 1C9OA 1MKHA 4IFDI 1PFSA 4TQUS 3STBC 1YJWA 5M3MG 5C3EG 1IBML 4IPDA 1X56A 1G291 5IYCG 2LXKA 4JBMA 4P75A 1HJPA 4KHZA 2UXCL 2BA0A 1I3QH 2D0PA 2NVQH 4AIMA 1Y1WG 1K83H 4DK6C 2WAQE 2VL6A 3A74A 3J7ZC 2HIVA 1Q8KA 1X65A 4OO1I 2NVXH 4JI5Q 4A3CG 1HNZQ 4JV5Q 4OXPA 4C3IH 4OX9L 2NN6G 4L5RC 1X3FA 2ATWA 1HH2P 3TS0A 1IL2A 1KL9A 2I5HA 3L0OA 5IWAL 1D7QA 1EFWA 4QGUA 1WOCA 1XNQQ 1VQFA 3CCSA 1J5EL 2HHHL 4BBSH 2N8NA 1PH6A 4NXNQ 1UWVA 1JJ2A 4X6AH 4B3RL 2A19A 4DV5L 5JJKA 4AYBE 1J6QA 4KHPL 2VQFQ 2UUBL 2Q2HA 2H5XA 1Q81C 1GD7A 2KBNA 4EX5A 1X3GA 2Y0SE 4YY3L 2UXDQ 1N34Q 4P74A 1YVCA 1YEZA 1WYDA 2VUMG 1D8LA 5M3FG 1X9NA 4OWTB 4BY1G 1SN8A 4X64L 3I4MG 4BXXH 3CMEA 3K81C 2OQ0A 1N9WA 4JBWA 4YCVA 1U5KA 2E2HH 1KXLA 3PUWA 1VQ7A 4LF7L 3DM3A 3U4ZA 2Q2TA 5FLMH 1HNWL 4QIWE 2ASBA 5BR8L 1XMQL 1SROA 1IBLL 4DR1Q 4DV3Q 1VQKA 1PA6A 2AHOB 2YTYA 3I7FA 4A3IH 1S40A 1I94Q 4R4QA 3BZCA 3OTOL 1JMCA 2KENA 2L15A 4DK3C 2E5LL 4JI7Q 4B3SL 4LF9L 2BH2A 1VQEA 2IY5B 2JA9A 4AYBG 1ASYA 3CCJA 4IOAA 1SLJA 3CC7A 2CWPA 3HOUG 1OXTA 1BBUA 2DGYA 4LF5Q 2JA8G 3FHWA 4LFBL 4UP9A 3HOWG 4IO9A 5LMNW 4JC0A 3GTQH 4DR4L 3GTJH 3RLOA 1VQ9A 1EIYB 1A62A 4A3BG 1HNXL 4GKJL 3CPFA 4DV2Q 3HOXH 3JAMc 4QL5A 4BA1I 4DV6L 1Z47A 1E22A 1N36Q 3H3VH 3F1ZA 2UUCQ 3I56A 4DPGA 3UDFA 2ZTDA 2WAQG 1UE1A 4PZ6A 1SR3A 4O0AA 5M3FH 5HY6A 4DV7L 3EIVA 2R92H 1JT8A 3S1NH 1VQ4A 1KQSA 4DR7L 4IPHA 1QUQA 1YHBA 2XTIA 4LFCL 2VQEQ 1L1OA 3G4SA 2QA4A 3PUZA 2QEXA 3AFQA 2RCNA 1BBWA 1PH3A 3I4OA 1HZBA 3MEFA 4P73A 3D0FA 1M90C 4UPAA 1TWCH 1PH7A 3S1QH 1PH4A 4DUZL 2I5MX 3M9BA 3PUYA 5FJ8G 1JB7A 1YI2A 3H0GH 4J15A 3G6EA 5DLQE 3KLWA 3TRZA 5C44H 4LWCA 4NPSA 2VY3A 3FKIH 1JJCB 5C4XH 4LF8Q 2OCEA 4BY7G 1A0IA 3KYHC 3NENA 3VDYA 3CCLA 5AJ3L 4DR2L 4GN5A 2MO1A 3A0JA 5LMNL 3PIPA 1G6PA 4GNXB 1LYLA 2F3IA 1KC8C 4BBRG 1NTGA 1Y14B 4JI0L 2CWAA 1K8AC 1YITA 2OWOA 1PH5A 4DR6L 2F4VQ 1Z9FA 4ALPA 4A3JH 4OO1G 4IFDJ 3KFUA 3E9HA 2VNUD 5IT9c 4HIMA 4JI8L 3G48A 3PV0A 2PQAB 4O2DA 4A3MG 2YTVA 4X62Q 1SE8A 3U50C 1GO3E 4H02A 2IX1A 3UDIA 3ULPA 4X65L 2K52A 3T1YL 1K73C 1EWIA 4JYAQ 3ER0A 3GTGH 5IYCH 3I4NH 3RLNA 5IYBH 4HJ5A 3RR5A 4DR3Q 4UY8C 4MNOA 1E24A 3K0XA 4Y52H 3CCVA 4LFAL 3OW2A 3SGIA 1IBKQ 1N32L 3KDFA 4L5SA 1WFQA 2LXJA 1VQOA 1PV4A 4A93G 1PH9A 1Q46A 1KRSA 2PNHA 1K3RA 1E1OA 2VS1A 1XPOA 1JJGA 3T1HL 2YV5A 1A63A 1VQ5A 1VQDA 2WB1G 3FKIG 3BJUA 4AH6A 3S15H 1AE3A 2R7FA 3MXNB 4YCUA 3AEVA 3PGZA 4A3CH 1K0RA 1NJIC 4YHHQ 2AWOA 3BZKA 1VQHA 4ME3A 3J81c 3F2CA 1QZHA 1FJGL 4NB3A 3W1BA 3BU2A 1FVIA 2AWNA 4JYAL 5IYBG 2V1CC 3CW2C 4X65Q 1VQGA 2E8GA 1QVGA 4K0KQ 4QQBX 1IYJB 4GOPC 1NMGA 3A5ZB 3TREA 4X62L 4B3TQ 5C0XJ 4BY1H 4DV4Q 1YJ9A 1YNXA 2CQOA 5J3BA 1OXXK 2K75A 1E7ZA 3GO5A 2F4VL 2CFMA 2R7ZG 4DR6Q 1WCMH 3M85A 1B7YB 1XMOQ 1AE2A 4A3IG 4GKKQ 1Q86C 4BBRH 5AJ3Q 5JEAJ 1PH2A 3PUVA 1A8VA 5FLMG 4LF8L 1VQCA 1KD1C 4IJLA 1Y1VG 3TEHB 3GTMH 2BH8A 3HOYG 5K36G 2HT1A 1IXRA 4A3GH 1YHQA 2Z6KA 2VW9A 3K80C 2AMCB 1KIXA 2JA7H 3GDEA 4GKKL 3PCOB 1VQPA 1S72A 1HZCA 2GN5A 3ERSX 3PO3G 4LUOA 3G71A 1XMOL 1K8GA 1VQBA 4P72A 3S2DH 4JOIC 4DKAC 5M5YH 1Q12A 2XGTA 1EQQA 1EYGA 3RNUA 4DR7Q 2KCMA 4DV4L 3ICEA 4DV7Q 1KAWA 4B3TL 1VCIA 3W5OA 1VQ8A 2YU9H 3CXCA 1E1TA 2Z0SA 1LTLA 4BXXG 2JK8A 3L2PA 2UUCL 4K0KL 1H95A 3HOUH 1N36L 3I55A 4DV6Q 1DGSA 2B3GA 2LSSA 2F52A 3CQZH 3HFZB 3NELA 1FJGQ 3PO2H 1Q82C 4GKJQ 1TWGH 4YHHL 4A3DH 1EOVA 2JQOA 1B8AA 2GVAA 3S1RH 1L1OB 2E2JH 4DR4Q 4GLVB 1BVSA 2HIXA 4A3FH 4R4TA 5ELNA 5C4JH 3HKZE 4LFBQ 1OXUA 3HKZG 1VQAA 3B6YA 3T1HQ 3U58A 3J7A5 2ES2A 2NVYH 2Q2IA 3PIOA 3GTOH 1LM0A 3UE0A 3S24A 3D31A 2JA8H 1QVFA 3CD6A 1QUQB 1N32Q 1IBKL 4LFAQ 3OTOQ 1W2BA 1HZ9A 5GAGC 2RF4A 4EQ5A 4R1JA 3WWVA 3H0GG 4FDBA 4DR3L 3PF4A 2I5LX 4XTCS 2B29A 2K5VA 4C3JH 5BR8Q 1XMQQ 1RIPA 2GVBA 2RHQB 1HNWQ 1E3PA 5FLXc 4A3JG 3PUXA 1V1QA 1SFOH 2PI2E 1LUZA 1B70B 1VQIA 3KF6B 4YWMA 2EXDA 4UP7A 3T1YQ 4JBKA 1TWFH 1Q1BA 3RZDH 1Q1EA 2QGQA 1V43A 4IPGA 1X6OA 2N49A 1UE6A 3CCUA 3EBEA 2A1AA 1N34L 4JI8Q 1VS0A 4HIKA 1PHJA 1CUKA 3Q8DA 4GOPB 5IP9H 1TWAH 1NE3A 4A76A 1XPUA 3PO2G 4JI0Q 1P16A 1P8LA 4NXNL 2IHEA 1OXSC 2KHJA 5IYDG 2JA7G 3RLFA 5LMNQ 1J5EQ 4DAYB 3A5UA 4QY7A 2OTLA 1XNQL 2VUMH 3ULLA 1T9HA 1W3SA 1TWHH 4DR2Q 1YIJA 2I0QA 3LGJA 1L2FA 4GS3A 3RN2A 2JA6G 3CPWA 4HIDA 2N78A 1SRUA 3J80c 4OX9Q 4HIOA 1MIUA 1U0LA 2NN6I 1HNZL 5GAEC 4JV5L 1EQRA 1RL2A 2VZAA 4DUZQ 1NMFA 4GN3B 3CCRA 1K9MC 5C0XG 3GTPH 3I4MH 2WP8J 3GD7A 2OTJA 3JAMi 4GLXA 2R93G 4A3FG 2MO0A 2AKWB 4JOIA 5IP9G 1NBWA 2VQEL 2UXCQ 1X55A 4LFCQ 1G51A 5IYDH 2YYZA 3M4PA 3K7UC 2MNAA 3UE1A 4Y7NH 3IRBA 4A3LH 4IJHA 2MQHA 3ZJYC 5JEAG 4JI1L 1MJCA 2EQSA 4RG1A 3CAMA 2FXQA 2CCZA 2Q2UA 4B3ML 3OYYA 1CSPA 1YHAA 1PVOA 2NVTH 2KHIA 2D62A 4UP8A 2K14A 3GTLH 1VQMA 2D0OA 2EIFA 3UDXA 1EIFA 4DV2L 3M3YH 2K5NA 1XTDA 4DV1L 1I50H 1HNXQ 4A3DG 4LUVA 4JI3L 3HOWH 2CKZB 4R4IA 4POGA 1UE5A 3F2DA 4PZ8A 3E9IA 1CKMA 1SMXA 4A4IA 1N33L 1VQNA 4GNXC 3EN2A 1XNRL 4LW1A 1VQLA 4LF5L 4GNXA 1YZ6A 1EUJA 4IOCA 2JA6H 4POFA 4DR5L 4A3LG 4A3GG 2Y0SG 2ZTCA 4DNIA 2ALYB 5M5WH 4PZ7A 4B3SQ 4JI7L 4LF9Q 1PYSB 4JG2A 2E5LQ 3W1GA 2NZHA 1XPRA 1I94L 4HJAA 1X54A 3KF6A 4DV3L 2E2IH 4DR1L 4L5TA 1IBLQ 2R93H 4BA2I 4HJ7A 4JI2L 4OWXB 1HR0W 1VQ6A 5C4XG 4R4OA 1WJJA 4A3EG 4LF7Q 2BA1A 2JA5H 4LF6Q 3PF5A 3M7NA 1Y1WH 1CKNB 4JCVE 3NBHB 4X64Q 2ZM6L 4JI4Q 3E0EA 2UUAL 3NEMA 2UU9Q 1VQJA 5JJLA 2UXDL 4YY3Q 3RZOH 3CP0A 4YWKA 4DV0Q 1S3OA 4MZ9A 2N3SA 2VQFL 2UUBQ 4KHPQ 1BKBA 3CCMA 4DV5Q 4X66L 3RN5A 4B3RQ 1NY4A 5LMUL 5HGQA 4NXML 1OTCA 3H3VI 2HHHQ 1PH1A 3PO3H 5GROA 1HZAA 3K7AH 2R7DA 4KLKA 3HOZH 5E7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA Q;  1X3E A;  2UXB L;  1R9T H;  1HR0 Q;  3H15 A;  1CKO A;  3AFP A;  4XIG S;  3S1M H;  4DAM A;  2R6G A;  1GKH A;  4TVA B;  1TXY A;  4JBJ A;  4JI5 L;  1KRT A;  4C3H H;  4AQY L;  2JEB I;  1ASZ A;  1FL0 A;  2Z6K C;  4DUY L;  1C7Y A;  4A3K H;  1XJV A;  4A3B H;  5IP7 H;  1AH9 A;  2HQL A;  5ELO A;  1CSQ A;  1QZG A;  4L5Q A;  2PQA A;  2JA5 G;  4A3E H;  1IBM Q;  5M5X H;  3F2B A;  3I4N G;  5GQO A;  2PMZ E;  2ZJR A;  1KHI A;  1QVC A;  1FGU A;  3CF5 A;  4HJ8 A;  4YCW A;  2B63 H;  4DUY Q;  5IY0 A;  1UEB A;  4PG3 A;  2ZJQ A;  3J81 j;  4A93 H;  3FP9 A;  4QJF A;  3J80 i;  4AQY Q;  1GM5 A;  2A8V A;  1I6H H;  1PYB A;  3CCE A;  4P71 A;  1M1K C;  1C0A A;  3HOX G;  2NZO A;  3DLL A;  2PI2 A;  1HR0 L;  2UXB Q;  1IZ6 A;  5IE8 A;  3HOV G;  2WB1 E;  3U4V A;  4GOP A;  2WFW A;  2K50 A;  4NXM Q;  5GAH C;  5LMU Q;  4JI6 Q;  2ZTE A;  3KF8 B;  4X66 Q;  2R92 G;  3M4O H;  5GAD C;  3CC2 A;  3TS2 A;  2R7Z H;  3HKS A;  1L1O C;  3J81 i;  1CKN A;  3HOY H;  4WJ4 A;  4DV0 L;  1Y1V H;  3JC6 6;  4GLA C;  5C0X I;  4LF4 Q;  3GTK H;  1V9P A;  4LUZ A;  1MJE A;  4YWL A;  2IHF A;  2UU9 L;  3ULJ A;  4IPC A;  4A75 A;  2UUA Q;  4A3K G;  2ZM6 Q;  2MFI A;  4JI4 L;  2KCT A;  1L0W A;  1WI5 A;  4BBS G;  4C2M H;  3UDG A;  4WJ3 M;  4LF6 L;  5IP7 G;  3KJP A;  5M3M H;  5C3E H;  3S16 H;  3F8T A;  1UE7 A;  4JI2 Q;  2YTX A;  1YJN A;  2ID0 A;  4IFD G;  5EAY A;  1GVP A;  3S17 H;  3K8A A;  3TQY A;  4OWW B;  1PH8 A;  3M4Q A;  5FJ8 H;  2C35 B;  3HOZ G;  4GN4 B;  4KI0 A;  4RMF A;  4DR5 Q;  2RHS B;  4HJ9 A;  5C44 G;  3L7Z C;  1I5F A;  4LF4 L;  4PMW A;  3KDF B;  5JJI A;  4R4C A;  3I2Z A;  1YBY A;  1XNR Q;  2IX0 A;  4LNQ A;  2JJQ A;  2DUD A;  4JI6 L;  1N33 Q;  1JE5 A;  2K5H A;  1O7I A;  1WCM G;  2ZJP A;  3CCQ A;  3HOV H;  3AQQ A;  2JEA I;  4JI3 Q;  2JE6 I;  3KOJ A;  3STB D;  3CC4 A;  4DV1 Q;  2IT1 A;  4OON A;  1Q7Y C;  3AYH B;  1OXV A;  4MTN A;  3S14 H;  1N8R C;  3PSI A;  3CMA A;  4B3M Q;  2B63 G;  3S2H H;  4BY7 H;  5H1S E;  2K4K A;  4JI1 Q;  2OQK A;  4APV A;  3KJO A;  4A3M H;  1C9O A;  1MKH A;  4IFD I;  1PFS A;  4TQU S;  3STB C;  1YJW A;  5M3M G;  5C3E G;  1IBM L;  4IPD A;  1X56 A;  1G29 1;  5IYC G;  2LXK A;  4JBM A;  4P75 A;  1HJP A;  4KHZ A;  2UXC L;  2BA0 A;  1I3Q H;  2D0P A;  2NVQ H;  4AIM A;  1Y1W G;  1K83 H;  4DK6 C;  2WAQ E;  2VL6 A;  3A74 A;  3J7Z C;  2HIV A;  1Q8K A;  1X65 A;  4OO1 I;  2NVX H;  4JI5 Q;  4A3C G;  1HNZ Q;  4JV5 Q;  4OXP A;  4C3I H;  4OX9 L;  2NN6 G;  4L5R C;  1X3F A;  2ATW A;  1HH2 P;  3TS0 A;  1IL2 A;  1KL9 A;  2I5H A;  3L0O A;  5IWA L;  1D7Q A;  1EFW A;  4QGU A;  1WOC A;  1XNQ Q;  1VQF A;  3CCS A;  1J5E L;  2HHH L;  4BBS H;  2N8N A;  1PH6 A;  4NXN Q;  1UWV A;  1JJ2 A;  4X6A H;  4B3R L;  2A19 A;  4DV5 L;  5JJK A;  4AYB E;  1J6Q A;  4KHP L;  2VQF Q;  2UUB L;  2Q2H A;  2H5X A;  1Q81 C;  1GD7 A;  2KBN A;  4EX5 A;  1X3G A;  2Y0S E;  4YY3 L;  2UXD Q;  1N34 Q;  4P74 A;  1YVC A;  1YEZ A;  1WYD A;  2VUM G;  1D8L A;  5M3F G;  1X9N A;  4OWT B;  4BY1 G;  1SN8 A;  4X64 L;  3I4M G;  4BXX H;  3CME A;  3K81 C;  2OQ0 A;  1N9W A;  4JBW A;  4YCV A;  1U5K A;  2E2H H;  1KXL A;  3PUW A;  1VQ7 A;  4LF7 L;  3DM3 A;  3U4Z A;  2Q2T A;  5FLM H;  1HNW L;  4QIW E;  2ASB A;  5BR8 L;  1XMQ L;  1SRO A;  1IBL L;  4DR1 Q;  4DV3 Q;  1VQK A;  1PA6 A;  2AHO B;  2YTY A;  3I7F A;  4A3I H;  1S40 A;  1I94 Q;  4R4Q A;  3BZC A;  3OTO L;  1JMC A;  2KEN A;  2L15 A;  4DK3 C;  2E5L L;  4JI7 Q;  4B3S L;  4LF9 L;  2BH2 A;  1VQE A;  2IY5 B;  2JA9 A;  4AYB G;  1ASY A;  3CCJ A;  4IOA A;  1SLJ A;  3CC7 A;  2CWP A;  3HOU G;  1OXT A;  1BBU A;  2DGY A;  4LF5 Q;  2JA8 G;  3FHW A;  4LFB L;  4UP9 A;  3HOW G;  4IO9 A;  5LMN W;  4JC0 A;  3GTQ H;  4DR4 L;  3GTJ H;  3RLO A;  1VQ9 A;  1EIY B;  1A62 A;  4A3B G;  1HNX L;  4GKJ L;  3CPF A;  4DV2 Q;  3HOX H;  3JAM c;  4QL5 A;  4BA1 I;  4DV6 L;  1Z47 A;  1E22 A;  1N36 Q;  3H3V H;  3F1Z A;  2UUC Q;  3I56 A;  4DPG A;  3UDF A;  2ZTD A;  2WAQ G;  1UE1 A;  4PZ6 A;  1SR3 A;  4O0A A;  5M3F H;  5HY6 A;  4DV7 L;  3EIV A;  2R92 H;  1JT8 A;  3S1N H;  1VQ4 A;  1KQS A;  4DR7 L;  4IPH A;  1QUQ A;  1YHB A;  2XTI A;  4LFC L;  2VQE Q;  1L1O A;  3G4S A;  2QA4 A;  3PUZ A;  2QEX A;  3AFQ A;  2RCN A;  1BBW A;  1PH3 A;  3I4O A;  1HZB A;  3MEF A;  4P73 A;  3D0F A;  1M90 C;  4UPA A;  1TWC H;  1PH7 A;  3S1Q H;  1PH4 A;  4DUZ L;  2I5M X;  3M9B A;  3PUY A;  5FJ8 G;  1JB7 A;  1YI2 A;  3H0G H;  4J15 A;  3G6E A;  5DLQ E;  3KLW A;  3TRZ A;  5C44 H;  4LWC A;  4NPS A;  2VY3 A;  3FKI H;  1JJC B;  5C4X H;  4LF8 Q;  2OCE A;  4BY7 G;  1A0I A;  3KYH C;  3NEN A;  3VDY A;  3CCL A;  5AJ3 L;  4DR2 L;  4GN5 A;  2MO1 A;  3A0J A;  5LMN L;  3PIP A;  1G6P A;  4GNX B;  1LYL A;  2F3I A;  1KC8 C;  4BBR G;  1NTG A;  1Y14 B;  4JI0 L;  2CWA A;  1K8A C;  1YIT A;  2OWO A;  1PH5 A;  4DR6 L;  2F4V Q;  1Z9F A;  4ALP A;  4A3J H;  4OO1 G;  4IFD J;  3KFU A;  3E9H A;  2VNU D;  5IT9 c;  4HIM A;  4JI8 L;  3G48 A;  3PV0 A;  2PQA B;  4O2D A;  4A3M G;  2YTV A;  4X62 Q;  1SE8 A;  3U50 C;  1GO3 E;  4H02 A;  2IX1 A;  3UDI A;  3ULP A;  4X65 L;  2K52 A;  3T1Y L;  1K73 C;  1EWI A;  4JYA Q;  3ER0 A;  3GTG H;  5IYC H;  3I4N H;  3RLN A;  5IYB H;  4HJ5 A;  3RR5 A;  4DR3 Q;  4UY8 C;  4MNO A;  1E24 A;  3K0X A;  4Y52 H;  3CCV A;  4LFA L;  3OW2 A;  3SGI A;  1IBK Q;  1N32 L;  3KDF A;  4L5S A;  1WFQ A;  2LXJ A;  1VQO A;  1PV4 A;  4A93 G;  1PH9 A;  1Q46 A;  1KRS A;  2PNH A;  1K3R A;  1E1O A;  2VS1 A;  1XPO A;  1JJG A;  3T1H L;  2YV5 A;  1A63 A;  1VQ5 A;  1VQD A;  2WB1 G;  3FKI G;  3BJU A;  4AH6 A;  3S15 H;  1AE3 A;  2R7F A;  3MXN B;  4YCU A;  3AEV A;  3PGZ A;  4A3C H;  1K0R A;  1NJI C;  4YHH Q;  2AWO A;  3BZK A;  1VQH A;  4ME3 A;  3J81 c;  3F2C A;  1QZH A;  1FJG L;  4NB3 A;  3W1B A;  3BU2 A;  1FVI A;  2AWN A;  4JYA L;  5IYB G;  2V1C C;  3CW2 C;  4X65 Q;  1VQG A;  2E8G A;  1QVG A;  4K0K Q;  4QQB X;  1IYJ B;  4GOP C;  1NMG A;  3A5Z B;  3TRE A;  4X62 L;  4B3T Q;  5C0X J;  4BY1 H;  4DV4 Q;  1YJ9 A;  1YNX A;  2CQO A;  5J3B A;  1OXX K;  2K75 A;  1E7Z A;  3GO5 A;  2F4V L;  2CFM A;  2R7Z G;  4DR6 Q;  1WCM H;  3M85 A;  1B7Y B;  1XMO Q;  1AE2 A;  4A3I G;  4GKK Q;  1Q86 C;  4BBR H;  5AJ3 Q;  5JEA J;  1PH2 A;  3PUV A;  1A8V A;  5FLM G;  4LF8 L;  1VQC A;  1KD1 C;  4IJL A;  1Y1V G;  3TEH B;  3GTM H;  2BH8 A;  3HOY G;  5K36 G;  2HT1 A;  1IXR A;  4A3G H;  1YHQ A;  2Z6K A;  2VW9 A;  3K80 C;  2AMC B;  1KIX A;  2JA7 H;  3GDE A;  4GKK L;  3PCO B;  1VQP A;  1S72 A;  1HZC A;  2GN5 A;  3ERS X;  3PO3 G;  4LUO A;  3G71 A;  1XMO L;  1K8G A;  1VQB A;  4P72 A;  3S2D H;  4JOI C;  4DKA C;  5M5Y H;  1Q12 A;  2XGT A;  1EQQ A;  1EYG A;  3RNU A;  4DR7 Q;  2KCM A;  4DV4 L;  3ICE A;  4DV7 Q;  1KAW A;  4B3T L;  1VCI A;  3W5O A;  1VQ8 A;  2YU9 H;  3CXC A;  1E1T A;  2Z0S A;  1LTL A;  4BXX G;  2JK8 A;  3L2P A;  2UUC L;  4K0K L;  1H95 A;  3HOU H;  1N36 L;  3I55 A;  4DV6 Q;  1DGS A;  2B3G A;  2LSS A;  2F52 A;  3CQZ H;  3HFZ B;  3NEL A;  1FJG Q;  3PO2 H;  1Q82 C;  4GKJ Q;  1TWG H;  4YHH L;  4A3D H;  1EOV A;  2JQO A;  1B8A A;  2GVA A;  3S1R H;  1L1O B;  2E2J H;  4DR4 Q;  4GLV B;  1BVS A;  2HIX A;  4A3F H;  4R4T A;  5ELN A;  5C4J H;  3HKZ E;  4LFB Q;  1OXU A;  3HKZ G;  1VQA A;  3B6Y A;  3T1H Q;  3U58 A;  3J7A 5;  2ES2 A;  2NVY H;  2Q2I A;  3PIO A;  3GTO H;  1LM0 A;  3UE0 A;  3S24 A;  3D31 A;  2JA8 H;  1QVF A;  3CD6 A;  1QUQ B;  1N32 Q;  1IBK L;  4LFA Q;  3OTO Q;  1W2B A;  1HZ9 A;  5GAG C;  2RF4 A;  4EQ5 A;  4R1J A;  3WWV A;  3H0G G;  4FDB A;  4DR3 L;  3PF4 A;  2I5L X;  4XTC S;  2B29 A;  2K5V A;  4C3J H;  5BR8 Q;  1XMQ Q;  1RIP A;  2GVB A;  2RHQ B;  1HNW Q;  1E3P A;  5FLX c;  4A3J G;  3PUX A;  1V1Q A;  1SFO H;  2PI2 E;  1LUZ A;  1B70 B;  1VQI A;  3KF6 B;  4YWM A;  2EXD A;  4UP7 A;  3T1Y Q;  4JBK A;  1TWF H;  1Q1B A;  3RZD H;  1Q1E A;  2QGQ A;  1V43 A;  4IPG A;  1X6O A;  2N49 A;  1UE6 A;  3CCU A;  3EBE A;  2A1A A;  1N34 L;  4JI8 Q;  1VS0 A;  4HIK A;  1PHJ A;  1CUK A;  3Q8D A;  4GOP B;  5IP9 H;  1TWA H;  1NE3 A;  4A76 A;  1XPU A;  3PO2 G;  4JI0 Q;  1P16 A;  1P8L A;  4NXN L;  2IHE A;  1OXS C;  2KHJ A;  5IYD G;  2JA7 G;  3RLF A;  5LMN Q;  1J5E Q;  4DAY B;  3A5U A;  4QY7 A;  2OTL A;  1XNQ L;  2VUM H;  3ULL A;  1T9H A;  1W3S A;  1TWH H;  4DR2 Q;  1YIJ A;  2I0Q A;  3LGJ A;  1L2F A;  4GS3 A;  3RN2 A;  2JA6 G;  3CPW A;  4HID A;  2N78 A;  1SRU A;  3J80 c;  4OX9 Q;  4HIO A;  1MIU A;  1U0L A;  2NN6 I;  1HNZ L;  5GAE C;  4JV5 L;  1EQR A;  1RL2 A;  2VZA A;  4DUZ Q;  1NMF A;  4GN3 B;  3CCR A;  1K9M C;  5C0X G;  3GTP H;  3I4M H;  2WP8 J;  3GD7 A;  2OTJ A;  3JAM i;  4GLX A;  2R93 G;  4A3F G;  2MO0 A;  2AKW B;  4JOI A;  5IP9 G;  1NBW A;  2VQE L;  2UXC Q;  1X55 A;  4LFC Q;  1G51 A;  5IYD H;  2YYZ A;  3M4P A;  3K7U C;  2MNA A;  3UE1 A;  4Y7N H;  3IRB A;  4A3L H;  4IJH A;  2MQH A;  3ZJY C;  5JEA G;  4JI1 L;  1MJC A;  2EQS A;  4RG1 A;  3CAM A;  2FXQ A;  2CCZ A;  2Q2U A;  4B3M L;  3OYY A;  1CSP A;  1YHA A;  1PVO A;  2NVT H;  2KHI A;  2D62 A;  4UP8 A;  2K14 A;  3GTL H;  1VQM A;  2D0O A;  2EIF A;  3UDX A;  1EIF A;  4DV2 L;  3M3Y H;  2K5N A;  1XTD A;  4DV1 L;  1I50 H;  1HNX Q;  4A3D G;  4LUV A;  4JI3 L;  3HOW H;  2CKZ B;  4R4I A;  4POG A;  1UE5 A;  3F2D A;  4PZ8 A;  3E9I A;  1CKM A;  1SMX A;  4A4I A;  1N33 L;  1VQN A;  4GNX C;  3EN2 A;  1XNR L;  4LW1 A;  1VQL A;  4LF5 L;  4GNX A;  1YZ6 A;  1EUJ A;  4IOC A;  2JA6 H;  4POF A;  4DR5 L;  4A3L G;  4A3G G;  2Y0S G;  2ZTC A;  4DNI A;  2ALY B;  5M5W H;  4PZ7 A;  4B3S Q;  4JI7 L;  4LF9 Q;  1PYS B;  4JG2 A;  2E5L Q;  3W1G A;  2NZH A;  1XPR A;  1I94 L;  4HJA A;  1X54 A;  3KF6 A;  4DV3 L;  2E2I H;  4DR1 L;  4L5T A;  1IBL Q;  2R93 H;  4BA2 I;  4HJ7 A;  4JI2 L;  4OWX B;  1HR0 W;  1VQ6 A;  5C4X G;  4R4O A;  1WJJ A;  4A3E G;  4LF7 Q;  2BA1 A;  2JA5 H;  4LF6 Q;  3PF5 A;  3M7N A;  1Y1W H;  1CKN B;  4JCV E;  3NBH B;  4X64 Q;  2ZM6 L;  4JI4 Q;  3E0E A;  2UUA L;  3NEM A;  2UU9 Q;  1VQJ A;  5JJL A;  2UXD L;  4YY3 Q;  3RZO H;  3CP0 A;  4YWK A;  4DV0 Q;  1S3O A;  4MZ9 A;  2N3S A;  2VQF L;  2UUB Q;  4KHP Q;  1BKB A;  3CCM A;  4DV5 Q;  4X66 L;  3RN5 A;  4B3R Q;  1NY4 A;  5LMU L;  5HGQ A;  4NXM L;  1OTC A;  3H3V I;  2HHH Q;  1PH1 A;  3PO3 H;  5GRO A;  1HZA A;  3K7A H;  2R7D A;  4KLK A;  3HOZ H;  5E7N A; 
#chains in the Genus database with same CATH topology
 1R9T H;  5C4X B;  1CKO A;  2EYH A;  3S1M H;  4DAM A;  3C3L A;  4FF3 A;  1GKH A;  4HAE A;  1F9Q A;  1TXY A;  4JBJ A;  4JI5 L;  1ASZ A;  2JEB I;  1FL0 A;  2OT2 A;  4A3K H;  3SE0 A;  2NVX B;  1BCP D;  1AH9 A;  3DMU A;  5BN4 A;  5ELO A;  2G5D A;  3WOF A;  4DK0 A;  1HA6 A;  5M5X H;  3F2B A;  1I6V C;  3I4N G;  1XTC D;  4HJ8 A;  2FJ2 A;  3GTP B;  4DUY Q;  2ZJQ A;  2BCO A;  2ICI A;  5EPJ A;  1STY A;  2A8V A;  1I6H H;  1SMY C;  3HOX G;  2NZO A;  1C0A A;  1IZ6 A;  3IFD A;  2F0S A;  3DHQ A;  4PMC A;  1LT5 D;  4GOP A;  5CV6 A;  1CHP D;  1ROD A;  2KEE A;  4PQX A;  3TS2 A;  2R7Z H;  2EYM A;  3J81 i;  1Y1V H;  2E76 C;  4YWL A;  4A3D B;  2JP1 A;  4CHT B;  1TY2 A;  4JI4 L;  1L0W A;  4BBS G;  3HG9 A;  4C2M H;  3UDG A;  3KJP A;  3S16 H;  3F8T A;  2JA6 B;  4JI2 Q;  3BDO A;  1JWS D;  3KLS X;  4IFD G;  1VDZ A;  1ENF A;  4KMU C;  1PH8 A;  1STN A;  1HXY D;  3HOZ G;  4IUN A;  4KI0 A;  4IUU A;  4RMF A;  3KK7 A;  3L7Z C;  1I5F A;  5C44 G;  3VR6 A;  4R4C A;  3H91 A;  3I2Z A;  1XNR Q;  3IFT A;  4LNQ A;  3GQB A;  1NAP A;  1O7I A;  4FO2 A;  3AQQ A;  4JK1 C;  4JI3 Q;  3STB D;  3CC4 A;  4DV1 Q;  1ESR A;  3NTH A;  2EJF C;  4U67 3;  2D5D A;  4ULL A;  1Q7Y C;  3AYH B;  1WTR A;  1NR2 A;  3MXU A;  5LL6 S;  3CMA A;  1CZW A;  2B63 G;  4BY7 H;  2R61 A;  1C9O A;  3VA5 A;  3STB C;  1EQT A;  2A6E D;  1X56 A;  4OEL B;  5IYC G;  1NR4 A;  4P75 A;  4KHZ A;  5EPK A;  2UXC L;  4TRD A;  1A3U A;  4Y7N B;  2IX3 A;  2WB1 B;  4J8Q A;  1SEB D;  2YU9 B;  3J7Z C;  1Q8K A;  2ZXR A;  4OO1 I;  5I2X A;  3G6J B;  5F2D A;  1SE4 A;  1JOK A;  4OXP A;  2EY1 A;  3MHB A;  4L5R C;  4FXD A;  1HH2 P;  3S2D B;  4RA8 A;  1H9K A;  4A3E B;  3L0O A;  2D9U A;  3LX0 A;  1TS5 A;  1EFW A;  4DNT B;  4IUQ A;  1XNQ Q;  1VQF A;  4BBS H;  4H44 C;  2HHH L;  3QWN A;  1PH6 A;  1J9O A;  2K33 A;  4X6A H;  4AYB B;  2RCF A;  4OIJ A;  4KHP L;  5EKK A;  1ILQ A;  2DNC A;  1CZG A;  2Y0S E;  5D65 A;  4DAV A;  1YVC A;  1LLR D;  1LO5 D;  5M3F G;  1SNP A;  1X9N A;  4BXX H;  3CME A;  5IGB A;  3PUW A;  2RDH A;  2JN4 A;  1EIH A;  2NUC A;  1BO0 A;  5KGU A;  4EQN A;  4EQO A;  4WFN 3;  4DR1 Q;  2YTY A;  2CVR A;  3TME A;  4R4Q A;  2L15 A;  1B9M A;  4LF9 L;  1RJT A;  3KLS A;  4H0L C;  1O7Z A;  1ASY A;  4IOA A;  1SLJ A;  4HED A;  2L5T A;  2PMZ B;  2JA8 G;  3NP8 A;  5FO7 B;  1JC7 A;  2JA5 B;  1BCP B;  1A3T A;  2M00 A;  3RZD B;  1EL0 A;  1Q8I A;  4DR4 L;  3Q22 A;  1EIY B;  4GKJ L;  3CPF A;  2EJM A;  2A6H D;  4BA1 I;  2E2I B;  1JWM D;  3DWP A;  5FO9 B;  2UUC Q;  3I56 A;  3UDF A;  2MUY A;  2WAQ G;  1PZK D;  1SR3 A;  5ELE A;  3EIV A;  2R92 H;  1ZYR C;  3A56 A;  1VQ4 A;  1KQS A;  1SXT A;  5A35 A;  1QUQ A;  4FNF A;  3HKZ B;  1XYI A;  3S1M B;  1QNU A;  3PUZ A;  3AFQ A;  2RCN A;  3DWQ A;  4QF4 A;  4UPA A;  1PH4 A;  4HN7 A;  1EY7 A;  3PUY A;  3FVQ A;  3DWA A;  5ELD A;  1BCP C;  1YI2 A;  4HTH A;  4J15 A;  3TRZ A;  2O4X A;  1JJC B;  4BY7 G;  2OCE A;  3I8Z A;  3KYH C;  4DR2 L;  1IL8 A;  4GN5 A;  2MO1 A;  5LMN L;  5CV7 A;  1G6P A;  1EIG A;  1KC8 C;  1DOM A;  1K8A C;  1BXT A;  1FR3 A;  3BVM A;  1Z9F A;  4O42 A;  4OO1 G;  1SDF A;  5C5L A;  5I6W A;  1SE8 A;  5EGT A;  4H02 A;  3D6W A;  2EVB A;  3UDI A;  1EWI A;  1K28 A;  2L4N A;  2SNM A;  4IUP A;  1DM0 B;  1WTQ A;  1B3A A;  1C48 A;  2J7Z A;  4S3S A;  1CHQ D;  3KLR A;  1IBK Q;  1ILP A;  4L5S A;  1IYV A;  3T16 A;  5M3M B;  1PLF A;  1Q46 A;  2PNH A;  4H13 C;  2R7Z B;  1TQO A;  2DNE A;  3FKI G;  2K28 A;  3SK5 A;  3D4D A;  3AEV A;  3PGZ A;  4RHS A;  1K0R A;  1MSH A;  4K8J A;  1G91 A;  2A73 B;  4NB3 A;  3I72 A;  1FVI A;  5IYB G;  4X65 Q;  4KY7 A;  4K6D A;  2E8G A;  2XWB B;  5G3L D;  1QVG A;  1HA5 A;  3A5Z B;  3TRE A;  3URY A;  1I4R A;  4DV4 Q;  1YJ9 A;  1KAA A;  2ZXO A;  1E7Z A;  2F4V L;  2CFM A;  1EY5 A;  2KED A;  2A68 D;  1AFP A;  4K2L A;  4XT1 B;  2KCN A;  4A3I G;  1LTT D;  1Q86 C;  1EWH A;  3BDL A;  2NZ1 D;  1PH2 A;  3M7G A;  3PUV A;  1VQC A;  1KD1 C;  3OMG A;  4FP5 D;  1Y1V G;  3GTM H;  1R9T B;  5IGD A;  5JVG 3;  1IXR A;  3UI2 A;  1B3Q A;  1KIX A;  3KF8 A;  2XWJ B;  1SYF A;  3K80 C;  1VQP A;  1K0S A;  1Z7T A;  3G71 A;  5I4D A;  2G9H D;  4HCS A;  3ONA B;  3S2D H;  1HQR D;  1Q12 A;  1EYG A;  1RDP D;  5KEE A;  1VQ8 A;  2YU9 H;  2Z0S A;  5ELC A;  4EVO A;  3L2P A;  2F0M A;  3HOY B;  2F52 A;  3HFZ B;  4KJN A;  4YHH L;  1UAP A;  3S1R H;  1HFN A;  1B8A A;  2GVA A;  1TT2 A;  1BVS A;  2HIX A;  3DEO A;  1BDO A;  5HGT A;  2F0K A;  3HKZ E;  1PTO B;  3J7A 5;  4OO1 H;  3U58 A;  4G4K A;  3GTO H;  3VR5 A;  5C5M A;  1RCV D;  3S24 A;  3D31 A;  3CD6 A;  1N32 Q;  1QUQ B;  3SDZ A;  4DN4 M;  4EQ5 A;  4R1J A;  2P5Z X;  3WWV A;  3RD4 A;  1TU2 B;  4FDB A;  1B4O A;  4C56 C;  1H9S A;  1K8O A;  2B29 A;  5I6Y A;  2GVB A;  2RHQ B;  4G57 A;  1E3P A;  2XSC A;  4A3J G;  3PUX A;  1F77 A;  1MBY A;  1LUZ A;  3KF6 B;  4CBV A;  4UP7 A;  2F0V A;  3RZD H;  2QGQ A;  4LJZ C;  1X6O A;  2N49 A;  4X3K A;  2F1M A;  2A1A A;  3GV6 A;  1YNJ D;  1F9R A;  4GOP B;  2F3V A;  1K83 B;  1NE3 A;  4A76 A;  2XRQ D;  4ME5 A;  3PO2 G;  4JI0 Q;  4NXN L;  5IYD G;  1PFM A;  1ZKO A;  5LMN Q;  1J5E Q;  4QY7 A;  1YIJ A;  3H0G B;  4FF4 A;  3LGJ A;  2CHB D;  2IW3 A;  3CPW A;  2WKC A;  4OX9 Q;  3SK8 A;  4HIO A;  2VZA A;  4DUZ Q;  5EKI A;  1LT4 D;  3CCR A;  1CFM A;  1I4Q A;  2WP8 J;  2ENB A;  2AKW B;  4L63 B;  3P75 A;  1G51 A;  4ZUI A;  1G2S A;  4A3G B;  2EPB A;  1Q3L A;  1I3Q B;  3TP7 A;  3IRB A;  4A3L H;  1LV9 A;  1KAB A;  1SE2 A;  4LK1 C;  2Q2U A;  1ENA A;  2D0O A;  3UDX A;  2K5N A;  1I50 H;  4LUV A;  4JI3 L;  2CKZ B;  2KCC A;  1HRJ A;  1O78 A;  5CV4 A;  4PZ8 A;  1SMX A;  1N33 L;  2GA4 B;  3EN2 A;  4LF5 L;  1EUJ A;  4IOC A;  4PMB A;  3ERO A;  2ZTC A;  4DNI A;  4B3S Q;  4JI7 L;  4CGY B;  1RD9 D;  1I94 L;  2R93 H;  2E2I H;  2QCP X;  1EYD A;  4JI2 L;  4OWX B;  1HR0 W;  5C4X G;  1LAB A;  4LF7 Q;  4GZY C;  2BA1 A;  2JA5 H;  2B2Y A;  4B08 A;  1EY0 A;  2IJ0 A;  3NBH B;  2J0T D;  4I65 A;  4IUT A;  2Q8I B;  4CKE A;  5JAV A;  4K8I A;  3K5L A;  1JOO A;  2HCC A;  4YWK A;  4DV0 Q;  2UUB Q;  3R3O A;  1TWC B;  3A7L A;  2HUG A;  3H3V I;  3TSS A;  2EY2 A;  5GRO A;  1HZA A;  3NWS A;  5ELF A;  3AMU A;  5FLX E;  2ZT9 C;  2Z1C A;  2K01 A;  1HR0 Q;  3A7A B;  3H15 A;  4XIG S;  3AFP A;  1PTO C;  1SJE D;  3C2P A;  3OW7 A;  3QOJ A;  3HZX A;  4C3H H;  1KRT A;  1GUS A;  1ET6 A;  5FKA C;  1EZ6 A;  2WAC A;  4RGN A;  1GUW A;  1CSQ A;  2B39 A;  2E2D C;  3NSW A;  1QZG A;  2PQA A;  5FLX L;  1IYU A;  4A3E H;  3FEW X;  4A3D G;  5GQO A;  1QVC A;  1UNS A;  1FGU A;  4PG3 A;  5CR3 A;  2LFN A;  1CQV A;  1EZ8 A;  3S1Q B;  1PYB A;  3DLL A;  1HR0 L;  1DYQ A;  5IE8 A;  3FRP B;  3HOV G;  1H9S B;  4UHV A;  5JJZ A;  3NK9 A;  1U4R A;  3CRK C;  2O5J C;  5LMU Q;  4JI6 Q;  3KF8 B;  2R92 G;  3M4O H;  4KN7 C;  2H4O A;  3MXN A;  4WJ4 A;  3JC6 6;  3GTK H;  2L11 A;  3QG1 A;  4DXG A;  3TZU A;  2IHF A;  2UU9 L;  4A75 A;  4KHV A;  4ID6 A;  1GHK A;  2KCT A;  2B8F A;  4WJ3 M;  3J80 E;  1TS2 A;  3T56 B;  4HCE A;  3SK4 A;  4ZK9 B;  1ESF A;  2YTX A;  4XYQ A;  1H9J A;  3S17 H;  4RAU C;  3KBX A;  3TQY A;  2ICE C;  4GN4 B;  3CHB D;  4V19 0;  2RHS B;  3KBG A;  4X3T A;  4CKB A;  1JIC A;  1JOQ A;  1YBY A;  5E4W C;  4JI6 L;  1EYC A;  1F9P A;  3NWT A;  2L0C A;  2O2L D;  1RTO A;  3O13 A;  4OON A;  1OXV A;  3F2U A;  3S14 H;  3QOL A;  3D6C A;  4Z9C B;  2OXP A;  1TS4 A;  3S2H H;  3RMH A;  2OQK A;  4APV A;  3KJO A;  1RF2 D;  1MKH A;  4F88 A;  1PYW D;  1IBM L;  5IIF A;  4IPD A;  1G29 1;  2LXK A;  2K32 A;  2D0P A;  2NVQ H;  4C3H B;  1Y1W G;  4WRD A;  2WAQ E;  1WCM B;  3K6O A;  3P7J A;  2HIV A;  1X65 A;  1KNA A;  4A3C G;  4K6L A;  4JV5 Q;  1HPC A;  2ATW A;  1IW7 D;  1IL2 A;  2I5H A;  5IWA L;  2EYJ A;  2RBM A;  1J5E L;  4HR7 B;  4NXN Q;  2A19 A;  1D5Z C;  4HMJ A;  4DV5 L;  5JJK A;  1J6Q A;  2UUB L;  2H5X A;  4BWG B;  1GD7 A;  2KBN A;  3M3Y B;  3H09 A;  4YY3 L;  5M5W B;  4KV6 A;  4P74 A;  1BNZ A;  1YEZ A;  1D8L A;  1TR5 A;  3I4M G;  4MIU A;  1N9W A;  1KXL A;  4KKT A;  1U5K A;  1VQ7 A;  4FXK C;  5FLM H;  4DAY A;  1HNW L;  4KKS A;  4DV3 Q;  2OEO A;  1VQK A;  1LTR D;  2AHO B;  1OO9 B;  5BN5 A;  3BZC A;  2KEN A;  3D4W A;  4DK3 C;  2BH2 A;  4B3S L;  4ZLT F;  2XRS D;  3CCJ A;  1ICF B;  2CWP A;  3HOU G;  1B50 A;  4RHR A;  1BBU A;  1QOH A;  3FHW A;  4UP9 A;  3HOW G;  3MXP A;  2K5Q A;  5LMN W;  4JC0 A;  5JEA H;  2VUM B;  3GTQ H;  4G7H C;  3GTJ H;  3HOX H;  1AZQ A;  3QB3 A;  2EJG C;  1YNN D;  4DV6 L;  1B44 D;  5IGE A;  1SYG A;  2PNR C;  4DPG A;  1FD7 D;  1UE1 A;  4PZ6 A;  4RCN A;  3PIP 3;  1JE4 A;  1JT8 A;  4EQP A;  4IPH A;  3J7Y W;  2QA4 A;  3RZO B;  1JWU D;  4UDU C;  2QEX A;  3DM1 A;  1M90 C;  2F0P A;  1TWA B;  3D0F A;  3MEF A;  1PH7 A;  4A3K B;  3S1Q H;  4A3B B;  3CU7 A;  1QJO A;  4DUZ L;  5CBE E;  3HP3 A;  1PRT C;  3A55 A;  3H0G H;  1A15 A;  1L0Y B;  4LWC A;  4IN3 A;  3VDY A;  3CCL A;  2RA4 A;  4BBR G;  1STG A;  1Y14 B;  4JI0 L;  2CWA A;  5L37 A;  2KVM A;  2F4V Q;  4A3J H;  3KFU A;  3E9H A;  4HIM A;  2XVS A;  4FF2 A;  1PTO F;  5T1G A;  2PQA B;  4A3M G;  1GO3 E;  2V4D A;  2NN6 H;  3DXJ C;  3ULP A;  3T1Y L;  4X65 L;  4JYA Q;  1UUP A;  5IYC H;  4RGT A;  3I4N H;  3SXH A;  2C9O A;  4UY8 C;  3RR5 A;  4Y52 H;  3TP8 A;  4MNO A;  3A54 A;  4K5X A;  3CCV A;  3SGI A;  5AFW A;  4C1N I;  1WFQ A;  4J1M A;  5C3E B;  2R93 B;  1TII D;  1A2T A;  2VS1 A;  4MHE A;  1XPO A;  1JJG A;  3T1H L;  1A63 A;  1VQ5 A;  2A69 C;  2R7F A;  3MXN B;  3MZ5 A;  3EQL C;  2Z8L A;  4YHH Q;  4NDX A;  2AWO A;  1CTM A;  4ME3 A;  3J81 c;  3T51 B;  3F2C A;  1SSO A;  1FJG L;  2AWN A;  2PYK A;  3CW2 C;  4QQB X;  1PZI D;  3D8G A;  4GOP C;  3MXG A;  1NMG A;  4JW0 A;  4X62 L;  4B3T Q;  3PO3 B;  5C0X J;  2M9V A;  3CKI B;  3TZD A;  4BY1 H;  2CW0 D;  1DCZ A;  2F0T A;  4C3J G;  3BVG A;  2EE1 A;  2R3Z A;  1WCM H;  1XMO Q;  3J81 L;  1STB A;  2A74 C;  5M3F B;  4GKK Q;  1ML0 D;  4BBR H;  5AJ3 Q;  5JEA J;  1A8V A;  2RDG A;  3TEH B;  4RGM A;  3HOY G;  4A3G H;  2Z6K A;  3GDE A;  1CT1 D;  3PCO B;  4GKK L;  3K5O A;  4LUO A;  2F0D A;  1DZ1 A;  4CDF C;  1EQV A;  5DEH A;  2XGT A;  4DR7 Q;  3AU7 A;  4DV4 L;  2OF1 A;  1F2L A;  2NB0 A;  5E1F A;  3DUZ A;  1VCI A;  3NQI A;  3W5O A;  4B3T L;  3CXC A;  1LTL A;  1QG7 A;  4KTA A;  4HMI A;  4K0K L;  3HOU H;  2K5W A;  4OGQ C;  1EU3 A;  3I55 A;  4QCL A;  2B3G A;  3J80 L;  3CQZ H;  3QO2 A;  1FJG Q;  3PO2 H;  4HSP A;  2E2J H;  1LT6 D;  5IT9 L;  4R4T A;  3TBI B;  3Q23 A;  1CK1 A;  4LFB Q;  3T1H Q;  2BOS A;  5DM6 3;  1DOK A;  2Q2I A;  1F9S A;  2N88 A;  3UE0 A;  1F2Z A;  2JA8 H;  1Y8P B;  1IBK L;  1MGS A;  2CQA A;  1Y8N B;  1W2B A;  5GAG C;  3AB9 A;  1XWE A;  5E3F A;  3PF4 A;  2I5L X;  5BR8 Q;  1XMQ Q;  1RIP A;  1HNW Q;  1EYA A;  1RTN A;  1EU4 A;  5FLX c;  1V1Q A;  2XNA C;  2AUJ D;  2ZXP A;  1VQI A;  2AQ1 B;  4BY7 B;  1PDQ A;  2XIW A;  5JPN C;  2C5C A;  3X3M A;  2K03 A;  1V43 A;  4WOR A;  3CCU A;  2HCI A;  3EBE A;  2K1B A;  2F0E A;  2PO4 A;  1GJX A;  3HS0 C;  4HIK A;  1GUN A;  3Q8D A;  1XPU A;  1GUO A;  1HHV A;  1CI3 M;  1OXS C;  2IHE A;  1GUT A;  3A5U A;  2KOL A;  3ULL A;  4DR2 Q;  5KRU A;  2JA6 G;  5CGK A;  2N78 A;  1MSG A;  5IOC A;  1MIU A;  1HNZ L;  1LTB D;  5GAE C;  1EQR A;  1RL2 A;  1WVL A;  1K9M C;  3I4M H;  5C0X G;  3FPP A;  5C6A A;  4A3F G;  2MO0 A;  4JOI A;  5IP9 G;  4FVM A;  2UXC Q;  3N6R A;  2VB2 X;  2JA7 B;  4IJH A;  2Z6B A;  3ZJY C;  5M9O A;  1Q90 A;  5JEA G;  4JI1 L;  2EQS A;  1HTP A;  2FXQ A;  3CAM A;  4B3M L;  3OYY A;  5TSS A;  1CSP A;  1YHA A;  1PVO A;  4K2K A;  2NVT H;  2KHI A;  3GTL H;  2EIF A;  3CRL C;  3HOW H;  2CH4 W;  2Q8T A;  3U9S A;  4POG A;  3HRZ C;  5KYL A;  3MTS A;  1X3P A;  3E9I A;  3S9W A;  1CKM A;  4A4I A;  1JR0 D;  2G9D A;  4QUF A;  3GTG B;  3OMC A;  1X32 A;  1VMC A;  2EOT A;  2RQX A;  2Y0S G;  3BZD B;  4JG2 A;  1EY8 A;  4C3I G;  4E6I A;  4DV3 L;  4L5T A;  1IBL Q;  1II3 A;  2DJF C;  3GTO B;  1WJJ A;  4A3E G;  1O7Y A;  4CDC C;  4ABN A;  1Y1W H;  4R9W A;  2KHS A;  3NEM A;  4KKU A;  1CM9 A;  5JPM C;  4MZ9 A;  2N3S A;  2VQF L;  4DV5 Q;  4B3R Q;  5LMU L;  4NXM L;  1OTC A;  5EQ0 A;  3PO3 H;  3U9O A;  5EJW A;  3S1N B;  3HOZ H;  5IWA Q;  1X3E A;  2K6A A;  3A8K E;  3HOX B;  3VR4 A;  2R6G A;  4TVA B;  2NVQ B;  4CDE C;  2F0U A;  4XQQ A;  4RWS C;  3NXW A;  2Z6K C;  2RSN A;  1XJV A;  4A3B H;  2RDF A;  2F0O A;  5M5Y B;  2HQL A;  3GTM B;  2JA5 G;  2EZV A;  1PZJ D;  2B2W A;  2ZJR A;  2PMZ E;  1KHI A;  2B63 H;  4YCW A;  3H3V C;  1UEB A;  3J81 j;  4BBS B;  2I46 A;  1EY4 A;  5J1Z A;  3W3A A;  4KY5 A;  4P71 A;  1M1K C;  3P1H A;  1LTG D;  3R2T A;  3PMF A;  2UXB Q;  2X6L A;  1A6X A;  2WAQ B;  5CV9 A;  3U4V A;  2WFW A;  2K50 A;  4NXM Q;  4DXF A;  2ZTE A;  4X66 Q;  3HEJ A;  1CKN A;  4GLA C;  2F0F A;  1V9P A;  4LUZ A;  1MJE A;  1FNU A;  1WTH A;  3I4N B;  3EFX D;  3ULJ A;  2DY8 A;  5DM7 3;  4IPC A;  1RHP A;  2ZM6 Q;  2MFI A;  1WI5 A;  3I70 A;  4LF6 L;  5IP7 G;  2Z4H A;  5C3E H;  3NTI A;  5J22 A;  1YJN A;  2ID0 A;  3A8I E;  5EAY A;  4OWW B;  5FJ8 H;  2PQE A;  1AW7 A;  5CBA E;  3WDN A;  4HJ9 A;  1Y8O B;  4PMW A;  3KDF B;  5JJI A;  2F0Q A;  2DUD A;  3MEH A;  2BDN A;  1N33 Q;  2K5H A;  2B2Y C;  3HOV H;  4N9P A;  3QIA A;  5A2Q E;  2IT1 A;  4G7O C;  5J39 A;  4MTN A;  1N8R C;  1QIL A;  4B3M Q;  3W2D A;  1QCB D;  2K4K A;  4JI1 Q;  4IUR A;  3BYT B;  1H9M A;  4A3M H;  4IFD I;  1M8A A;  1PFS A;  3HOZ B;  5M3M G;  3IL8 A;  2EYP A;  1HJP A;  4NP5 A;  2WKD A;  2BA0 A;  1I3Q H;  3ZYY X;  1VMP A;  3FKI B;  4AIM A;  1SYC A;  2AQ2 B;  3MVV A;  1Z6H A;  4M8A A;  4JI5 Q;  1F2Y A;  4C3I H;  4Q0F A;  3CQZ B;  1X3F A;  1L0X B;  1E0B A;  2PZU A;  1WOC A;  2EY5 A;  1V8Q A;  1PTO H;  1UWV A;  4B3R L;  4AYB E;  2VQF Q;  2Q2H A;  3I4L A;  3GTL B;  4EX5 A;  2JA8 B;  1CA6 A;  1X3G A;  4JPB W;  2TMP A;  3HOW B;  1U4L A;  4ZUJ A;  1I4X A;  4BY1 G;  4X64 L;  3K81 C;  2OQ0 A;  2ASB A;  1SRO A;  1PA6 A;  3I7F A;  1S40 A;  3OTO L;  3ND8 A;  2RVL A;  1STH A;  1Y69 U;  4JI7 Q;  1VQE A;  3Q6S A;  5EPL A;  1WTP A;  1EEF D;  3CC7 A;  4LF5 Q;  4LFB L;  1H9R A;  4IAL A;  1TWF B;  1STA A;  4TKO B;  3RLO A;  1A62 A;  1VQ9 A;  4A3B G;  1E2V A;  3OPO A;  5I2Y A;  3HGB A;  1Z47 A;  3ITP A;  1SYE A;  5A2Q L;  2PCF B;  1KNE A;  4CJ2 C;  3F1Z A;  1N36 Q;  2ZTD A;  3HOV B;  1X3Q A;  3K7A B;  4O0A A;  3T4A C;  1O7L A;  4DV7 L;  3S1N H;  1KDA A;  4BBR B;  3QR8 A;  3L9A X;  1AN8 A;  1O80 A;  1YHB A;  2XTI A;  4LFC L;  3G4S A;  1SJH D;  1BBW A;  1PH3 A;  1HZB A;  4P73 A;  4J6H A;  1FNW A;  1WTW A;  3BS1 A;  1I6H B;  2I5M X;  3E0J A;  1JB7 A;  2MJ8 A;  1BQQ T;  2KQ3 A;  3KLW A;  2B2U C;  3K5M A;  5M5X B;  1A0I A;  1PRT F;  3A0J A;  1BCP F;  3EVQ A;  4GNX B;  1LYL A;  2SEB D;  2OWO A;  1YIT A;  4DR6 L;  1HTL D;  3PO2 B;  3G48 A;  3PV0 A;  4O2D A;  2YTV A;  4X62 Q;  4F87 A;  5COR A;  2KJX A;  3TDQ A;  3L3O C;  3GTG H;  1BF4 A;  4R8N A;  1T5X D;  5IYB H;  4DR3 Q;  1D1K A;  4NMZ A;  1JCK B;  1FYC A;  5ISR A;  1ONL A;  1N32 L;  2LXJ A;  3PQI A;  4OEM B;  2CW0 C;  1VQO A;  2EYF A;  1PV4 A;  1PH9 A;  4A93 G;  1KRS A;  1K3R A;  1E1O A;  2B2V A;  1M4V A;  2MHV A;  2Q8R E;  1VQD A;  2WB1 G;  4AH6 A;  3BJU A;  3S15 H;  3GTK B;  1AE3 A;  1PRT B;  2MPM A;  1D5X C;  4ZAI A;  4A3C H;  5D3D A;  5E4X A;  1NJI C;  1LTI D;  2KUM A;  3BZK A;  3V05 A;  1VQH A;  4R8I A;  1TKW B;  3QJY A;  1SNC A;  3BU2 A;  1E2W A;  4K0K Q;  2B8G A;  3C46 A;  3M4Y A;  3H6M A;  3NQT A;  4RGO S;  2K04 A;  4RKB A;  3K59 A;  1DON A;  1HFG A;  2VXW A;  1UEA B;  3K57 A;  2K75 A;  4DFA A;  2R7Z G;  3VYT A;  1IKM A;  3M85 A;  4KN4 C;  1A2U A;  4ILW A;  1AE2 A;  2L12 A;  2F03 A;  4HSV A;  3Q0A A;  5FLM G;  4F8M A;  3OWE B;  4IJL A;  1XX8 A;  4DNR B;  2BH8 A;  1CQF A;  1SAP A;  2VW9 A;  2WIN B;  2JA7 H;  1XXG A;  1S72 A;  4L6T B;  1HZC A;  2LY7 A;  1DD2 A;  1XMO L;  1VQB A;  4V0B A;  4DU9 A;  2A6E C;  4P72 A;  3JAM L;  5M5Y H;  3MA2 B;  3E3X A;  2KCM A;  3ICE A;  3VYR A;  1KAW A;  1VF7 A;  1G6Z A;  1V1O A;  5KIX A;  2JK8 A;  2QDB A;  2UUC L;  1MD2 D;  1N36 L;  1YNN C;  4A3J B;  4DV6 Q;  2LSS A;  3PIO 3;  2BE5 D;  4A3D H;  2K5D A;  1ZXT A;  1L1O B;  5C4J H;  1EY6 A;  1OXU A;  3HKZ G;  5KNC A;  1AP0 A;  2IPK D;  2NVY H;  4PNY A;  1KDB A;  2F0N A;  1BR9 A;  4IQZ A;  1V1P A;  1QVF A;  1PMR A;  1HZ9 A;  2RF4 A;  3H0G G;  4DR3 L;  1MI2 A;  2K5V A;  2J4X A;  3BYY B;  5COY A;  3S14 B;  1JB3 A;  2TSS A;  1SFO H;  4IFD H;  3V96 A;  2PI2 E;  4YWM A;  2NWG A;  2EXD A;  3T1Y Q;  1TWF H;  1Q1B A;  2B2U A;  2L9H A;  4XQJ A;  1Q1E A;  5JVH 3;  3T13 A;  3GTQ B;  4IPG A;  2QKI C;  1N34 L;  4JI8 Q;  3I90 A;  4XT3 B;  2QIL A;  2H1E A;  1CUK A;  4ZKC B;  1TWA H;  2M2L A;  1P16 A;  2JA7 G;  4EGV A;  3RLF A;  1XNQ L;  4DAY B;  4A3M B;  2OTL A;  1W3S A;  3A8J E;  1L2F A;  3RN2 A;  4RCO A;  5EKL A;  4HID A;  3NE5 B;  3I73 A;  3J80 c;  1S5F D;  1U0L A;  2NN6 I;  2L1B A;  1NMF A;  4GN3 B;  4B9X A;  1ZYR D;  1MHW C;  2OTJ A;  4GLX A;  1I4H A;  2JXM B;  4DK1 A;  5C44 B;  1NBW A;  2VQE L;  5IYD H;  3ERQ A;  2YYZ A;  3M4P A;  2MNA A;  4Y7N H;  2EY6 A;  2MQH A;  1FGB D;  2CCZ A;  3IAY A;  4L8J A;  4UP8 A;  1T5E A;  1SMY D;  3J81 E;  4DV2 L;  1EIF A;  3M3Y H;  1XTD A;  2DJG C;  2DN8 A;  4K5V A;  1W6K A;  4R4I A;  2IWH A;  1HUM A;  5JOB A;  1SBB B;  4F7X A;  1VQN A;  4GNX C;  1XNR L;  2FHT A;  4I7A A;  4GNX A;  1YZ6 A;  2JA6 H;  4DR5 L;  1QNK A;  4A3G G;  4A3L G;  1TWG B;  1WTX A;  4KJO A;  2ALY B;  2E74 C;  5M5W H;  4LF9 Q;  4FYD A;  1PYS B;  4A3I B;  3W1G A;  1XPR A;  3K0Y A;  2QW7 A;  4HJA A;  3OWF A;  1S5B D;  2EXZ A;  2LKV A;  1KDC A;  4HJ7 A;  1VQ6 A;  4R4O A;  4N8X 1;  5C3W A;  4LF6 Q;  3M7N A;  1ENC A;  1J8I A;  1NSN S;  4X64 Q;  4JI4 Q;  1U4P A;  1GHJ A;  2UU9 Q;  5IOD A;  3RUZ A;  1PRT D;  2UXD L;  5D14 A;  1SFO B;  2F0W A;  5KNB A;  4RKL A;  1S3O A;  1I4G A;  4LMQ D;  4KHP Q;  3J7A V;  1NY4 A;  3S2H B;  2HHH Q;  3P20 A;  5IT9 E;  3K7A H;  5I9P A;  3EJI A;  3GTJ B;  4KLK A;  1K8M A;  2LMC B;  5E7N A;  2UXB L;  3R8B A;  3VR3 A;  2DY7 A;  5D3I B;  5BN3 A;  2EDG A;  4AQY L;  2AQ3 B;  4DUY L;  2MP1 A;  4RH6 A;  1C7Y A;  5C3X A;  3K58 A;  5IP7 H;  2R92 B;  4MN3 A;  2HDM A;  2X6G A;  4L5Q A;  3WOE A;  1IBM Q;  1GOZ A;  1WTO A;  3SHL A;  3CF5 A;  1AZP A;  1B2T A;  5IY0 A;  2HD3 A;  4A93 H;  3FP9 A;  4QJF A;  3J80 i;  4AQY Q;  1GM5 A;  2A6H C;  2QEJ C;  3CCE A;  1G2T A;  3SR1 A;  1TVX A;  2PI2 A;  3R2I A;  4K14 A;  1WD0 A;  2WB1 E;  1LTA D;  1QE6 A;  5GAH C;  2Z9H A;  5GAD C;  3CC2 A;  3HKS A;  1L1O C;  4RFB A;  3HOY H;  1STE A;  2N55 A;  3BDC A;  3OOC A;  5C0X I;  1DJR D;  4DV0 L;  4LF4 Q;  3E5S A;  2SNS A;  2UUA Q;  4A3K G;  3OIQ A;  4IUV A;  3LWE A;  4IZ8 A;  5M3M H;  1UE7 A;  1AEX A;  3H94 A;  2AUK A;  1NUC A;  1EFI D;  1GVP A;  3TN2 A;  3K8A A;  5LHY 1;  3M4Q A;  2C35 B;  5HUR A;  1LT3 D;  4A3F B;  5C4J B;  4DR5 Q;  5G3L F;  3T53 B;  2X69 A;  4LF4 L;  1DXM A;  2B2W C;  2IX0 A;  2JJQ A;  4C3H G;  1Y1W B;  1JE5 A;  5C4H A;  3NHH A;  1WCM G;  2ZJP A;  2RSO A;  3CCQ A;  4CJ1 B;  3BG3 A;  5KYI A;  2JEA I;  3LNN A;  1ICW A;  2JYO A;  1NNX A;  2JE6 I;  1V1P B;  1ZEQ X;  3KOJ A;  5NUC A;  4B9W A;  4XQN A;  2FFK B;  3NPP A;  3PSI A;  1EOT A;  4DF7 A;  5H1S E;  1IKL A;  2O5I C;  1C8C A;  2WV6 D;  4C1N K;  4TQU S;  1YJW A;  5C3E G;  1TY0 A;  3G7L A;  4JBM A;  1EEI D;  1K83 H;  4DK6 C;  3A74 A;  2VL6 A;  2NVX H;  3Q24 A;  1HNZ Q;  2SDF A;  4OX9 L;  2NN6 G;  4JVZ A;  3OSO A;  3TS0 A;  3C1E A;  1KL9 A;  1SE3 A;  2IL8 A;  1D7Q A;  5KND A;  2B63 B;  2PZT A;  2E2J B;  5IGG A;  4QGU A;  4KD4 A;  4Q5V A;  2NYZ D;  3CCS A;  2VB3 X;  1GXD C;  2N8N A;  2F0G A;  1JJ2 A;  1G8Z D;  2F0I A;  2B2V C;  2K7V A;  4FXG C;  3HOU B;  3TP5 A;  1Q81 C;  2A68 C;  1HQM C;  5IGF A;  2F0H A;  1A3V A;  1N34 Q;  1HCZ A;  2UXD Q;  3FPU B;  4YIJ A;  1WYD A;  2VUM G;  4G7Z C;  4OWT B;  3VR2 A;  1SN8 A;  3OIP A;  4JBW A;  4YCV A;  2E2H H;  4LF7 L;  3DM3 A;  3U4Z A;  1Y1V B;  2Q2T A;  1S5E D;  3LWU A;  3V2T A;  4QIW E;  4LAA A;  4XXE A;  1EY9 A;  5BR8 L;  3MAQ A;  1XMQ L;  1IBL L;  2NVT B;  4A3I H;  1I94 Q;  1JMC A;  1I4P A;  4OHJ A;  3D3R A;  3S1R B;  1PFN A;  2E5L L;  2IY5 B;  1EWC A;  2JA9 A;  3C1F A;  4AYB G;  1RKN A;  1IW7 C;  1OXT A;  3OHX C;  2DGY A;  4M1U B;  3IKJ A;  4IO9 A;  1C4Q A;  1HNX L;  2WII B;  4DV2 Q;  3JAM c;  4QL5 A;  4TSS A;  3VYS A;  1E22 A;  3H3V H;  4XDX A;  5EBD A;  3ND9 A;  5M3F H;  2PW5 A;  4U68 A;  5HY6 A;  3JAM E;  4KD3 A;  4I7Z C;  4DR7 L;  4KK7 A;  4ODG A;  1K3B C;  2VQE Q;  1L1O A;  5CC4 A;  3I4O A;  1F2M A;  1TWC H;  1D1I A;  2FMM A;  3M9B A;  5FJ8 G;  3MFY A;  1TWH B;  3G6E A;  5DLQ E;  1IHZ A;  1DOL A;  5C44 H;  4NPS A;  2VY3 A;  1PTO D;  2B2T A;  4NW2 A;  3FKI H;  5C4X H;  4LF8 Q;  2QDL A;  3NEN A;  3J7A F;  1ET9 A;  5AJ3 L;  3DEP A;  2HQE A;  2RKS A;  3PIP A;  2F3I A;  1NTG A;  1PH5 A;  4ALP A;  4CKC A;  1BUV T;  4IFD J;  2VNU D;  5IT9 c;  4JI8 L;  2K05 A;  5CV5 A;  1QWY A;  2BDO A;  3TP6 A;  3U50 C;  5CYU A;  4XYO A;  2IX1 A;  5FO8 B;  2K52 A;  1K73 C;  5K36 H;  3ER0 A;  4CDD C;  1R4Q B;  3RLN A;  4HJ5 A;  1E24 A;  3FMC A;  3K0X A;  1S5D D;  3VYU A;  4N8F A;  4LFA L;  3OW2 A;  3KDF A;  2E2H B;  4O1N A;  1KLU D;  2KA7 A;  4C3J B;  4ZKB B;  1S5C D;  2YV5 A;  2I07 B;  4OL7 A;  3NBI A;  4YCU A;  1SNQ A;  4H7B A;  4K5W A;  2NTS A;  1BOS A;  4ZYS A;  1QZH A;  3W1B A;  5FOB B;  4JYA L;  2V1C C;  1B9N A;  1VQG A;  1IYJ B;  1TS3 A;  1S4Z A;  1YNX A;  3NBH A;  2CQO A;  5J3B A;  1OXX K;  3GO5 A;  2F0J A;  1LTS D;  4DR6 Q;  4DA2 A;  3VA7 A;  1B7Y B;  2KEC A;  3SVM A;  1R4P B;  1E2Z A;  4QIW B;  3I4M B;  2LS0 1;  4C3I B;  3BVZ A;  1SYB A;  5CMD A;  4LF8 L;  4X3S A;  2FMC A;  5K36 G;  2HT1 A;  2E75 C;  4OIK A;  2A69 D;  1YHQ A;  2BE5 C;  3EA6 A;  2AMC B;  5DAU A;  1GUG A;  3PO3 G;  2GN5 A;  3ERS X;  1K8G A;  4FF1 A;  1D5M C;  4QUC A;  5K5P A;  3NTK A;  4JOI C;  4KY6 A;  4DKA C;  1EQQ A;  3RNU A;  1BBX C;  2Z4I A;  1I50 B;  3FDT A;  4WJW A;  4DV7 Q;  2SOB A;  1E1T A;  4BXX G;  3MFG A;  3GV3 A;  1H95 A;  3M4O B;  4ZCK A;  1WD1 A;  1B1Z A;  1DGS A;  3NEL A;  3KUP A;  2QF7 A;  5FK9 C;  1Q82 C;  4GKJ Q;  1TWG H;  5C0X H;  1EOV A;  2JQO A;  2HDL A;  4GLV B;  4DR4 Q;  1JOR A;  2D2C C;  4A3F H;  3K5N A;  5ELN A;  3N52 A;  1VQA A;  3B6Y A;  1D2B A;  3D4R A;  2F3W A;  4BS9 A;  2ES2 A;  3PIO A;  1LM0 A;  2EYO A;  4LFA Q;  3OTO Q;  2L55 A;  1QB5 D;  2EYL A;  4XTC S;  4C3J H;  1SYD A;  4JBK A;  1B70 B;  2B2T C;  2F4I A;  1U9R A;  1KTK A;  1UE6 A;  2FIN B;  1VS0 A;  4DAP A;  2CH4 A;  1PHJ A;  2NTT A;  1LAC A;  1SND A;  5CV8 A;  5IP9 H;  4ZQ3 A;  1P8L A;  2KHJ A;  2VUM H;  1T9H A;  1TWH H;  3E6Z X;  3I91 A;  2F0L A;  5LL6 X;  2I0Q A;  3SK6 A;  4N9T A;  3SEB A;  2A5H A;  1KLG D;  4GS3 A;  3NUC A;  1SRU A;  2XN9 C;  4JV5 L;  1W6J A;  3GP7 A;  1PXU A;  3R93 A;  4CJ0 B;  3GTP H;  5C4Z A;  3GD7 A;  3JAM i;  4A93 B;  4NKL A;  4PV1 C;  2R93 G;  1YNJ C;  3I3C A;  1X55 A;  4LFC Q;  3K7U C;  3UE1 A;  5I9O A;  1NCV A;  1U4M A;  1FNV A;  4DGZ A;  5T1I A;  1MJC A;  4RG1 A;  2MGS A;  2D62 A;  2K14 A;  2PW7 A;  1VQM A;  4P2C B;  5EBC A;  4DV1 L;  1HNX Q;  1D6E C;  1UE5 A;  1CA5 A;  1PFB A;  3F2D A;  4QB4 A;  4ZRZ A;  4C2M B;  1SNM A;  4LW1 A;  1VQL A;  1HUN A;  3S16 B;  4POF A;  1JQY D;  3MWY W;  4MTK A;  4PZ7 A;  2E5L Q;  2NZH A;  3S17 B;  1X54 A;  3KF6 A;  4DR1 L;  1B53 A;  2PZW A;  4BA2 I;  2NVY B;  3S15 B;  5DNF A;  5IGC A;  3PF5 A;  1CKN B;  4JCV E;  4X3U A;  2ZM6 L;  2PPB C;  3E0E A;  2UUA L;  2JSO A;  1VQJ A;  5JJL A;  1SNO A;  4YY3 Q;  1WTV A;  4UAI A;  3RZO H;  3CP0 A;  2NBF A;  1BKB A;  3CCM A;  2Y0S B;  5ELB A;  4X66 L;  3X3N A;  3RN5 A;  5HGQ A;  1PH1 A;  3MC0 B;  4BY1 B;  1VF5 C;  2R7D A;  4QMG A; 
#chains in the Genus database with same CATH homology
 5IWA Q;  1X3E A;  2UXB L;  1R9T H;  1HR0 Q;  3H15 A;  1CKO A;  3AFP A;  4XIG S;  3S1M H;  4DAM A;  2R6G A;  1GKH A;  4TVA B;  1TXY A;  4JBJ A;  4JI5 L;  1KRT A;  4C3H H;  4AQY L;  2JEB I;  1ASZ A;  1FL0 A;  2Z6K C;  4DUY L;  1C7Y A;  4A3K H;  1XJV A;  4A3B H;  5IP7 H;  1AH9 A;  2HQL A;  5ELO A;  1CSQ A;  1QZG A;  4L5Q A;  2PQA A;  2JA5 G;  4A3E H;  1IBM Q;  5M5X H;  3F2B A;  3I4N G;  5GQO A;  2PMZ E;  2ZJR A;  1KHI A;  1QVC A;  1FGU A;  3CF5 A;  4HJ8 A;  4YCW A;  2B63 H;  4DUY Q;  5IY0 A;  1UEB A;  4PG3 A;  2ZJQ A;  3J81 j;  4A93 H;  3FP9 A;  4QJF A;  3J80 i;  4AQY Q;  1GM5 A;  2A8V A;  1I6H H;  1PYB A;  3CCE A;  4P71 A;  1M1K C;  1C0A A;  3HOX G;  2NZO A;  3DLL A;  2PI2 A;  1HR0 L;  2UXB Q;  1IZ6 A;  5IE8 A;  3HOV G;  2WB1 E;  3U4V A;  4GOP A;  2WFW A;  2K50 A;  4NXM Q;  5GAH C;  5LMU Q;  4JI6 Q;  2ZTE A;  3KF8 B;  4X66 Q;  2R92 G;  3M4O H;  5GAD C;  3CC2 A;  3TS2 A;  2R7Z H;  3HKS A;  1L1O C;  3J81 i;  1CKN A;  3HOY H;  4WJ4 A;  4DV0 L;  1Y1V H;  3JC6 6;  4GLA C;  5C0X I;  4LF4 Q;  3GTK H;  1V9P A;  4LUZ A;  1MJE A;  4YWL A;  2IHF A;  2UU9 L;  3ULJ A;  4IPC A;  4A75 A;  2UUA Q;  4A3K G;  2ZM6 Q;  2MFI A;  4JI4 L;  2KCT A;  1L0W A;  1WI5 A;  4BBS G;  4C2M H;  3UDG A;  4WJ3 M;  4LF6 L;  5IP7 G;  3KJP A;  5M3M H;  5C3E H;  3S16 H;  3F8T A;  1UE7 A;  4JI2 Q;  2YTX A;  1YJN A;  2ID0 A;  4IFD G;  5EAY A;  1GVP A;  3S17 H;  3K8A A;  3TQY A;  4OWW B;  1PH8 A;  3M4Q A;  5FJ8 H;  2C35 B;  3HOZ G;  4GN4 B;  4KI0 A;  4RMF A;  4DR5 Q;  2RHS B;  4HJ9 A;  5C44 G;  3L7Z C;  1I5F A;  4LF4 L;  4PMW A;  3KDF B;  5JJI A;  4R4C A;  3I2Z A;  1YBY A;  1XNR Q;  2IX0 A;  4LNQ A;  2JJQ A;  2DUD A;  4JI6 L;  1N33 Q;  1JE5 A;  2K5H A;  1O7I A;  1WCM G;  2ZJP A;  3CCQ A;  3HOV H;  3AQQ A;  2JEA I;  4JI3 Q;  2JE6 I;  3KOJ A;  3STB D;  3CC4 A;  4DV1 Q;  2IT1 A;  4OON A;  1Q7Y C;  3AYH B;  1OXV A;  4MTN A;  3S14 H;  1N8R C;  3PSI A;  3CMA A;  4B3M Q;  2B63 G;  3S2H H;  4BY7 H;  5H1S E;  2K4K A;  4JI1 Q;  2OQK A;  4APV A;  3KJO A;  4A3M H;  1C9O A;  1MKH A;  4IFD I;  1PFS A;  4TQU S;  3STB C;  1YJW A;  5M3M G;  5C3E G;  1IBM L;  4IPD A;  1X56 A;  1G29 1;  5IYC G;  2LXK A;  4JBM A;  4P75 A;  1HJP A;  4KHZ A;  2UXC L;  2BA0 A;  1I3Q H;  2D0P A;  2NVQ H;  4AIM A;  1Y1W G;  1K83 H;  4DK6 C;  2WAQ E;  2VL6 A;  3A74 A;  3J7Z C;  2HIV A;  1Q8K A;  1X65 A;  4OO1 I;  2NVX H;  4JI5 Q;  4A3C G;  1HNZ Q;  4JV5 Q;  4OXP A;  4C3I H;  4OX9 L;  2NN6 G;  4L5R C;  1X3F A;  2ATW A;  1HH2 P;  3TS0 A;  1IL2 A;  1KL9 A;  2I5H A;  3L0O A;  5IWA L;  1D7Q A;  1EFW A;  4QGU A;  1WOC A;  1XNQ Q;  1VQF A;  3CCS A;  1J5E L;  2HHH L;  4BBS H;  2N8N A;  1PH6 A;  4NXN Q;  1UWV A;  1JJ2 A;  4X6A H;  4B3R L;  2A19 A;  4DV5 L;  5JJK A;  4AYB E;  1J6Q A;  4KHP L;  2VQF Q;  2UUB L;  2Q2H A;  2H5X A;  1Q81 C;  1GD7 A;  2KBN A;  4EX5 A;  1X3G A;  2Y0S E;  4YY3 L;  2UXD Q;  1N34 Q;  4P74 A;  1YVC A;  1YEZ A;  1WYD A;  2VUM G;  1D8L A;  5M3F G;  1X9N A;  4OWT B;  4BY1 G;  1SN8 A;  4X64 L;  3I4M G;  4BXX H;  3CME A;  3K81 C;  2OQ0 A;  1N9W A;  4JBW A;  4YCV A;  1U5K A;  2E2H H;  1KXL A;  3PUW A;  1VQ7 A;  4LF7 L;  3DM3 A;  3U4Z A;  2Q2T A;  5FLM H;  1HNW L;  4QIW E;  2ASB A;  5BR8 L;  1XMQ L;  1SRO A;  1IBL L;  4DR1 Q;  4DV3 Q;  1VQK A;  1PA6 A;  2AHO B;  2YTY A;  3I7F A;  4A3I H;  1S40 A;  1I94 Q;  4R4Q A;  3BZC A;  3OTO L;  1JMC A;  2KEN A;  2L15 A;  4DK3 C;  2E5L L;  4JI7 Q;  4B3S L;  4LF9 L;  2BH2 A;  1VQE A;  2IY5 B;  2JA9 A;  4AYB G;  1ASY A;  3CCJ A;  4IOA A;  1SLJ A;  3CC7 A;  2CWP A;  3HOU G;  1OXT A;  1BBU A;  2DGY A;  4LF5 Q;  2JA8 G;  3FHW A;  4LFB L;  4UP9 A;  3HOW G;  4IO9 A;  5LMN W;  4JC0 A;  3GTQ H;  4DR4 L;  3GTJ H;  3RLO A;  1VQ9 A;  1EIY B;  1A62 A;  4A3B G;  1HNX L;  4GKJ L;  3CPF A;  4DV2 Q;  3HOX H;  3JAM c;  4QL5 A;  4BA1 I;  4DV6 L;  1Z47 A;  1E22 A;  1N36 Q;  3H3V H;  3F1Z A;  2UUC Q;  3I56 A;  4DPG A;  3UDF A;  2ZTD A;  2WAQ G;  1UE1 A;  4PZ6 A;  1SR3 A;  4O0A A;  5M3F H;  5HY6 A;  4DV7 L;  3EIV A;  2R92 H;  1JT8 A;  3S1N H;  1VQ4 A;  1KQS A;  4DR7 L;  4IPH A;  1QUQ A;  1YHB A;  2XTI A;  4LFC L;  2VQE Q;  1L1O A;  3G4S A;  2QA4 A;  3PUZ A;  2QEX A;  3AFQ A;  2RCN A;  1BBW A;  1PH3 A;  3I4O A;  1HZB A;  3MEF A;  4P73 A;  3D0F A;  1M90 C;  4UPA A;  1TWC H;  1PH7 A;  3S1Q H;  1PH4 A;  4DUZ L;  2I5M X;  3M9B A;  3PUY A;  5FJ8 G;  1JB7 A;  1YI2 A;  3H0G H;  4J15 A;  3G6E A;  5DLQ E;  3KLW A;  3TRZ A;  5C44 H;  4LWC A;  4NPS A;  2VY3 A;  3FKI H;  1JJC B;  5C4X H;  4LF8 Q;  2OCE A;  4BY7 G;  1A0I A;  3KYH C;  3NEN A;  3VDY A;  3CCL A;  5AJ3 L;  4DR2 L;  4GN5 A;  2MO1 A;  3A0J A;  5LMN L;  3PIP A;  1G6P A;  4GNX B;  1LYL A;  2F3I A;  1KC8 C;  4BBR G;  1NTG A;  1Y14 B;  4JI0 L;  2CWA A;  1K8A C;  1YIT A;  2OWO A;  1PH5 A;  4DR6 L;  2F4V Q;  1Z9F A;  4ALP A;  4A3J H;  4OO1 G;  4IFD J;  3KFU A;  3E9H A;  2VNU D;  5IT9 c;  4HIM A;  4JI8 L;  3G48 A;  3PV0 A;  2PQA B;  4O2D A;  4A3M G;  2YTV A;  4X62 Q;  1SE8 A;  3U50 C;  1GO3 E;  4H02 A;  2IX1 A;  3UDI A;  3ULP A;  4X65 L;  2K52 A;  3T1Y L;  1K73 C;  1EWI A;  4JYA Q;  3ER0 A;  3GTG H;  5IYC H;  3I4N H;  3RLN A;  5IYB H;  4HJ5 A;  3RR5 A;  4DR3 Q;  4UY8 C;  4MNO A;  1E24 A;  3K0X A;  4Y52 H;  3CCV A;  4LFA L;  3OW2 A;  3SGI A;  1IBK Q;  1N32 L;  3KDF A;  4L5S A;  1WFQ A;  2LXJ A;  1VQO A;  1PV4 A;  4A93 G;  1PH9 A;  1Q46 A;  1KRS A;  2PNH A;  1K3R A;  1E1O A;  2VS1 A;  1XPO A;  1JJG A;  3T1H L;  2YV5 A;  1A63 A;  1VQ5 A;  1VQD A;  2WB1 G;  3FKI G;  3BJU A;  4AH6 A;  3S15 H;  1AE3 A;  2R7F A;  3MXN B;  4YCU A;  3AEV A;  3PGZ A;  4A3C H;  1K0R A;  1NJI C;  4YHH Q;  2AWO A;  3BZK A;  1VQH A;  4ME3 A;  3J81 c;  3F2C A;  1QZH A;  1FJG L;  4NB3 A;  3W1B A;  3BU2 A;  1FVI A;  2AWN A;  4JYA L;  5IYB G;  2V1C C;  3CW2 C;  4X65 Q;  1VQG A;  2E8G A;  1QVG A;  4K0K Q;  4QQB X;  1IYJ B;  4GOP C;  1NMG A;  3A5Z B;  3TRE A;  4X62 L;  4B3T Q;  5C0X J;  4BY1 H;  4DV4 Q;  1YJ9 A;  1YNX A;  2CQO A;  5J3B A;  1OXX K;  2K75 A;  1E7Z A;  3GO5 A;  2F4V L;  2CFM A;  2R7Z G;  4DR6 Q;  1WCM H;  3M85 A;  1B7Y B;  1XMO Q;  1AE2 A;  4A3I G;  4GKK Q;  1Q86 C;  4BBR H;  5AJ3 Q;  5JEA J;  1PH2 A;  3PUV A;  1A8V A;  5FLM G;  4LF8 L;  1VQC A;  1KD1 C;  4IJL A;  1Y1V G;  3TEH B;  3GTM H;  2BH8 A;  3HOY G;  5K36 G;  2HT1 A;  1IXR A;  4A3G H;  1YHQ A;  2Z6K A;  2VW9 A;  3K80 C;  2AMC B;  1KIX A;  2JA7 H;  3GDE A;  4GKK L;  3PCO B;  1VQP A;  1S72 A;  1HZC A;  2GN5 A;  3ERS X;  3PO3 G;  4LUO A;  3G71 A;  1XMO L;  1K8G A;  1VQB A;  4P72 A;  3S2D H;  4JOI C;  4DKA C;  5M5Y H;  1Q12 A;  2XGT A;  1EQQ A;  1EYG A;  3RNU A;  4DR7 Q;  2KCM A;  4DV4 L;  3ICE A;  4DV7 Q;  1KAW A;  4B3T L;  1VCI A;  3W5O A;  1VQ8 A;  2YU9 H;  3CXC A;  1E1T A;  2Z0S A;  1LTL A;  4BXX G;  2JK8 A;  3L2P A;  2UUC L;  4K0K L;  1H95 A;  3HOU H;  1N36 L;  3I55 A;  4DV6 Q;  1DGS A;  2B3G A;  2LSS A;  2F52 A;  3CQZ H;  3HFZ B;  3NEL A;  1FJG Q;  3PO2 H;  1Q82 C;  4GKJ Q;  1TWG H;  4YHH L;  4A3D H;  1EOV A;  2JQO A;  1B8A A;  2GVA A;  3S1R H;  1L1O B;  2E2J H;  4DR4 Q;  4GLV B;  1BVS A;  2HIX A;  4A3F H;  4R4T A;  5ELN A;  5C4J H;  3HKZ E;  4LFB Q;  1OXU A;  3HKZ G;  1VQA A;  3B6Y A;  3T1H Q;  3U58 A;  3J7A 5;  2ES2 A;  2NVY H;  2Q2I A;  3PIO A;  3GTO H;  1LM0 A;  3UE0 A;  3S24 A;  3D31 A;  2JA8 H;  1QVF A;  3CD6 A;  1QUQ B;  1N32 Q;  1IBK L;  4LFA Q;  3OTO Q;  1W2B A;  1HZ9 A;  5GAG C;  2RF4 A;  4EQ5 A;  4R1J A;  3WWV A;  3H0G G;  4FDB A;  4DR3 L;  3PF4 A;  2I5L X;  4XTC S;  2B29 A;  2K5V A;  4C3J H;  5BR8 Q;  1XMQ Q;  1RIP A;  2GVB A;  2RHQ B;  1HNW Q;  1E3P A;  5FLX c;  4A3J G;  3PUX A;  1V1Q A;  1SFO H;  2PI2 E;  1LUZ A;  1B70 B;  1VQI A;  3KF6 B;  4YWM A;  2EXD A;  4UP7 A;  3T1Y Q;  4JBK A;  1TWF H;  1Q1B A;  3RZD H;  1Q1E A;  2QGQ A;  1V43 A;  4IPG A;  1X6O A;  2N49 A;  1UE6 A;  3CCU A;  3EBE A;  2A1A A;  1N34 L;  4JI8 Q;  1VS0 A;  4HIK A;  1PHJ A;  1CUK A;  3Q8D A;  4GOP B;  5IP9 H;  1TWA H;  1NE3 A;  4A76 A;  1XPU A;  3PO2 G;  4JI0 Q;  1P16 A;  1P8L A;  4NXN L;  2IHE A;  1OXS C;  2KHJ A;  5IYD G;  2JA7 G;  3RLF A;  5LMN Q;  1J5E Q;  4DAY B;  3A5U A;  4QY7 A;  2OTL A;  1XNQ L;  2VUM H;  3ULL A;  1T9H A;  1W3S A;  1TWH H;  4DR2 Q;  1YIJ A;  2I0Q A;  3LGJ A;  1L2F A;  4GS3 A;  3RN2 A;  2JA6 G;  3CPW A;  4HID A;  2N78 A;  1SRU A;  3J80 c;  4OX9 Q;  4HIO A;  1MIU A;  1U0L A;  2NN6 I;  1HNZ L;  5GAE C;  4JV5 L;  1EQR A;  1RL2 A;  2VZA A;  4DUZ Q;  1NMF A;  4GN3 B;  3CCR A;  1K9M C;  5C0X G;  3GTP H;  3I4M H;  2WP8 J;  3GD7 A;  2OTJ A;  3JAM i;  4GLX A;  2R93 G;  4A3F G;  2MO0 A;  2AKW B;  4JOI A;  5IP9 G;  1NBW A;  2VQE L;  2UXC Q;  1X55 A;  4LFC Q;  1G51 A;  5IYD H;  2YYZ A;  3M4P A;  3K7U C;  2MNA A;  3UE1 A;  4Y7N H;  3IRB A;  4A3L H;  4IJH A;  2MQH A;  3ZJY C;  5JEA G;  4JI1 L;  1MJC A;  2EQS A;  4RG1 A;  3CAM A;  2FXQ A;  2CCZ A;  2Q2U A;  4B3M L;  3OYY A;  1CSP A;  1YHA A;  1PVO A;  2NVT H;  2KHI A;  2D62 A;  4UP8 A;  2K14 A;  3GTL H;  1VQM A;  2D0O A;  2EIF A;  3UDX A;  1EIF A;  4DV2 L;  3M3Y H;  2K5N A;  1XTD A;  4DV1 L;  1I50 H;  1HNX Q;  4A3D G;  4LUV A;  4JI3 L;  3HOW H;  2CKZ B;  4R4I A;  4POG A;  1UE5 A;  3F2D A;  4PZ8 A;  3E9I A;  1CKM A;  1SMX A;  4A4I A;  1N33 L;  1VQN A;  4GNX C;  3EN2 A;  1XNR L;  4LW1 A;  1VQL A;  4LF5 L;  4GNX A;  1YZ6 A;  1EUJ A;  4IOC A;  2JA6 H;  4POF A;  4DR5 L;  4A3L G;  4A3G G;  2Y0S G;  2ZTC A;  4DNI A;  2ALY B;  5M5W H;  4PZ7 A;  4B3S Q;  4JI7 L;  4LF9 Q;  1PYS B;  4JG2 A;  2E5L Q;  3W1G A;  2NZH A;  1XPR A;  1I94 L;  4HJA A;  1X54 A;  3KF6 A;  4DV3 L;  2E2I H;  4DR1 L;  4L5T A;  1IBL Q;  2R93 H;  4BA2 I;  4HJ7 A;  4JI2 L;  4OWX B;  1HR0 W;  1VQ6 A;  5C4X G;  4R4O A;  1WJJ A;  4A3E G;  4LF7 Q;  2BA1 A;  2JA5 H;  4LF6 Q;  3PF5 A;  3M7N A;  1Y1W H;  1CKN B;  4JCV E;  3NBH B;  4X64 Q;  2ZM6 L;  4JI4 Q;  3E0E A;  2UUA L;  3NEM A;  2UU9 Q;  1VQJ A;  5JJL A;  2UXD L;  4YY3 Q;  3RZO H;  3CP0 A;  4YWK A;  4DV0 Q;  1S3O A;  4MZ9 A;  2N3S A;  2VQF L;  2UUB Q;  4KHP Q;  1BKB A;  3CCM A;  4DV5 Q;  4X66 L;  3RN5 A;  4B3R Q;  1NY4 A;  5LMU L;  5HGQ A;  4NXM L;  1OTC A;  3H3V I;  2HHH Q;  1PH1 A;  3PO3 H;  5GRO A;  1HZA A;  3K7A H;  2R7D A;  4KLK A;  3HOZ H;  5E7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...