3KDFA

X-ray crystal structure of the human replication protein a complex from wheat germ cell free expression
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 14 kDa subunit
publication title X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression
rcsb
source organism Homo sapiens
molecule tags Replication
total genus 23
structure length 115
sequence length 115
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kdfA00
1CUKA 1KRSA 4LF9L 3PSIA 4DV7Q 2MO1A 5M5XH 4LW1A 4A3DG 2IY5B 2Z6KA 4R4IA 1NE3A 1BKBA 3FKIG 1P16A 1Q81C 3K8AA 4YHHL 3MXNB 2VW9A 4JI7Q 1N32Q 1PVOA 4RMFA 3OYYA 1KIXA 2A8VA 3KFUA 3ZJYC 3J81c 1PH7A 4A3BH 1N33Q 2C35B 2WP8J 1S3OA 4RG1A 4A3KH 1KQSA 1OXUA 3HKSA 4OWWB 2B63G 2A19A 3KLWA 3HOZG 4C2MH 1WCMH 4IJLA 3GTOH 4IPDA 1IBKQ 1SR3A 2H5XA 3K0XA 5HY6A 1N34L 4UPAA 5C3EG 2EQSA 3I7FA 4DR6L 1BBWA 2YTXA 3NENA 3PO3H 4A3FH 4QY7A 1IZ6A 1Q7YC 3VDYA 4K0KQ 2RHSB 4DV2L 4GKJQ 1XNQQ 3JAMc 4JI3Q 4MZ9A 1LTLA 4PZ6A 3PCOB 3S1MH 3T1YL 2OQ0A 3H15A 4DR5L 1EOVA 4JBJA 2UUBQ 1YJ9A 1OXSC 1KL9A 2I5LX 3GO5A 2NVTH 4LF4Q 4JOIC 5GADC 1QZHA 1PH4A 1B70B 4GNXA 2JA7H 3F8TA 2R7DA 4R1JA 2HT1A 3HOYH 4DR2Q 3J80c 3HOWG 3I4MH 2B63H 4ME3A 4PMWA 3HOZH 5IWAQ 2UXBL 4PZ8A 1M1KC 2WAQG 4BA2I 4JBWA 1EWIA 3AEVA 1Q46A 4LF8L 3EIVA 4X64Q 4LFAL 2NZOA 2JA6G 1Q8KA 1A63A 1PFSA 4JG2A 4LFCL 1XMQL 2IX1A 5FLXc 2NVYH 4LUOA 1VQEA 4TQUS 1OXXK 1PH6A 4BXXH 1X9NA 4TVAB 2I5HA 4IJHA 2XGTA 5DLQE 3I56A 1Q86C 1VQ6A 1X65A 2RCNA 1I94Q 3PUYA 3HKZE 5LMNQ 3CAMA 3EN2A 1EYGA 3S16H 4B3RQ 4OO1I 4YCWA 4DR3L 2AKWB 2EXDA 1N36Q 3NEMA 1HR0Q 4WJ3M 3CCQA 5IYCG 4JBMA 3GTLH 3UDIA 1MIUA 2NN6G 1MJEA 3HOWH 2Q2UA 3I4NG 3S17H 1R9TH 4DR4Q 1TWHH 2ID0A 4GOPC 4A3JG 4APVA 1CKNB 2UUAL 1UEBA 4JI2L 4JI0Q 3BZCA 1G51A 1EIYB 1N9WA 1JT8A 2JA6H 3CMAA 2Y0SE 1JB7A 4NXMQ 4JI8Q 2WB1G 2R7ZH 5JJKA 4QIWE 1VQIA 4QGUA 4LFBQ 4JYAQ 1U0LA 2K14A 2PI2A 2RF4A 3ULLA 1MKHA 3PGZA 1M90C 1HZBA 4KLKA 3A5ZB 3OW2A 1YIJA 3CD6A 1GKHA 1E1OA 4DPGA 3UE1A 1YBYA 1WOCA 4PZ7A 3KF6A 2JA8H 4JV5Q 4QL5A 2VQFL 5JEAJ 2ASBA 5IYCH 1HNZL 2E5LQ 1A8VA 1SN8A 2OTJA 4A3GG 1Y1VG 1EQQA 1K83H 3G48A 2ZJQA 1E7ZA 4IFDG 3SGIA 3TS2A 3I55A 4JI5L 2ZM6Q 1YITA 2I0QA 5C0XG 2Q2IA 5C4XG 4MTNA 1RIPA 4JC0A 4LF5Q 4B3TQ 4JCVE 3DM3A 4OX9L 1VQ9A 4LWCA 5C0XI 3CCLA 1HZCA 3OTOL 1UE6A 4DV3L 1D7QA 4DV0Q 4GLXA 4DV5L 3HOUG 3CF5A 4LF9Q 1L0WA 1QVFA 1VQFA 3TS0A 4DK3C 1Q1BA 5FJ8H 1Y1WG 3CP0A 5H1SE 2BA0A 3S24A 1HNWQ 1I3QH 5M3MG 1IL2A 3H0GG 4HJ8A 4IO9A 4AYBG 4GN4B 2YU9H 4X65L 2HQLA 2JEBI 2VZAA 1UE7A 2OCEA 4UP9A 1IBMQ 3LGJA 2UUCL 2R7FA 4DR6Q 2VL6A 3NBHB 3CCJA 1OXTA 2YTYA 2GVAA 1PHJA 3F1ZA 1YJWA 2ZTCA 4NXNQ 1IXRA 3CPWA 4LF6L 4AQYL 4FDBA 4GNXB 4GLAC 4BY7G 2E8GA 5IP7G 1A0IA 2F3IA 4LF7Q 3T1YQ 1KHIA 3E9HA 4GS3A 4KHZA 4A76A 1NBWA 1G6PA 4DR1Q 2BA1A 2D0OA 3M4PA 5FLMG 5GAEC 2VQEQ 2E2IH 2JK8A 5JJIA 1YZ6A 3M3YH 3DLLA 3KJOA 1C7YA 2JE6I 4UY8C 3RLNA 2R93H 2UXCQ 2UXBQ 1AH9A 2YYZA 4GLVB 3FHWA 2DUDA 5IE8A 1YVCA 1IBLL 4LF8Q 1K9MC 1LM0A 4LFAQ 3BZKA 2IX0A 4O0AA 2R6GA 2LXJA 4WJ4A 1X3EA 1YHQA 1JJGA 3MEFA 2CCZA 1VQMA 3S14H 1X6OA 2AWNA 2QGQA 5IP7H 3KF8B 2OTLA 4DUZQ 1FGUA 1TWGH 3CCEA 1VQKA 4DAYB 3F2DA 3UDXA 4B3ML 3TREA 1FVIA 2K4KA 4A3DH 3FKIH 1FJGL 1XMOL 2CQOA 3L7ZC 4YWLA 1YI2A 2OWOA 4YY3Q 3K80C 3CW2C 1UE1A 2K75A 1HZAA 2CFMA 2UUAQ 4JBKA 4DUYL 2UU9Q 2WAQE 1QVGA 1VQGA 2AHOB 3E0EA 4NPSA 3GTGH 1OTCA 1XJVA 1H95A 1K3RA 1O7IA 4R4QA 4X62L 4JI1L 1S72A 5C3EH 3CQZH 1MJCA 3TQYA 1VQJA 5BR8Q 1SRUA 1PH3A 2Q2TA 4DR7Q 4L5RC 1Z47A 1PV4A 1VQNA 2KHJA 3K81C 4J15A 1KD1C 5LMNW 4BBSG 3PF4A 1KC8C 1JMCA 4POFA 4HJAA 2VQFQ 2QEXA 4X66Q 4OXPA 5M3FG 1VQ4A 1HNZQ 4JI6L 4A93G 4A75A 4L5SA 4POGA 3AFPA 1XNRQ 4IOCA 3U4ZA 4EX5A 4GKKL 2CWPA 1N32L 2JA5G 3UDFA 1I50H 2PQAA 3GDEA 5IYBG 4JI5Q 1N33L 5JEAG 3UE0A 1BVSA 4DV1L 2F4VL 4OONA 4IPGA 2K5HA 4LNQA 1L1OA 2NN6I 5LMUQ 2F52A 3GTPH 1CKMA 1YHAA 1CKOA 5IYDG 1GO3E 1IBKL 3UDGA 3OTOQ 4DV3Q 3RNUA 4DV5Q 2YTVA 4YWMA 3G4SA 3T1HL 3PV0A 4HJ9A 1WFQA 4PG3A 4K0KL 4GKJL 1VQBA 3G6EA 2HIVA 5IP9G 1BBUA 3ERSX 1X3GA 3EBEA 5M3FH 3PO2G 2YV5A 4GNXC 1NMGA 3J7ZC 2B29A 2UUBL 2FXQA 4P73A 3U50C 3CPFA 4LF4L 4NB3A 2ZTDA 1Q82C 1KXLA 3I4NH 3CCUA 2BH2A 3ICEA 2UUCQ 4A3JH 3RN2A 2R92G 2HHHL 4DK6C 5IWAL 5C44G 1EQRA 3U4VA 2Y0SG 3JC66 5M5WH 4LF6Q 4X64L 4AQYQ 4IFDI 2L15A 5ELOA 3PIPA 1FL0A 1HJPA 3CCRA 4R4OA 3W1GA 1EFWA 1XPUA 2VUMG 3L0OA 4LUVA 1EIFA 3K7UC 4BBRG 2MQHA 1EUJA 4ALPA 3S1RH 4BY1G 3KJPA 3PO2H 3CCMA 4YHHQ 3J81i 1K73C 4KHPL 5AJ3L 4A3GH 1IBLQ 1Y1VH 4A3EG 4DR4L 4A3LG 3HOXG 5HGQA 3GTMH 1GM5A 1N34Q 5JJLA 3A74A 4IPHA 4C3JH 4JI0L 5C4XH 4DNIA 2N8NA 2ATWA 4JI8L 1UE5A 1QZGA 2IHEA 2OQKA 4DV2Q 4GN5A 3JAMi 4C3HH 1W2BA 4YCVA 3TEHB 3HOUH 3GTJH 1VS0A 3CMEA 3F2BA 4B3MQ 4X6AH 3CC4A 4P74A 4DR5Q 1FJGQ 3CXCA 1IYJB 1Y1WH 3F2CA 1NY4A 4JV5L 3M9BA 2E2HH 1VQHA 1PA6A 5M3MH 5C0XJ 1VQPA 3J80i 4AIMA 3H0GH 1NMFA 4A3BG 3RLFA 4EQ5A 4A3KG 2QA4A 4JOIA 4A3LH 2KBNA 1VQ8A 1E24A 1Q12A 2PI2E 3HOXH 1SE8A 1VQAA 2AMCB 1WCMG 1WYDA 3S1NH 2Z0SA 2VS1A 3AFQA 4JI1Q 2ZM6L 3CC2A 2K52A 1VQ5A 1QUQA 1VQ7A 1UWVA 1XMQQ 4B3TL 4LFCQ 4DV6L 1HH2P 3HFZB 3W1BA 3PO3G 3PUWA 4R4CA 4A3FG 1K0RA 3WWVA 1PH9A 4QJFA 3CCSA 1J5EL 2B3GA 3GD7A 3S15H 4BY7H 4B3SL 3NELA 2PQAB 4DV0L 1SLJA 1TWCH 2IT1A 3RR5A 3S2DH 2UXDL 2N78A 2ZJRA 4JI6Q 5E7NA 3HOVG 3I4OA 1L1OB 1WI5A 3ULJA 5FLMH 1E22A 5ELNA 4DR3Q 2NVXH 1PYBA 4GKKQ 1YJNA 1XTDA 1PH1A 4DV4L 1HNWL 2JA7G 3PUXA 1I5FA 4YWKA 4JI4L 3HOYG 3KDFA 4DV1Q 2F4VQ 1V1QA 2K50A 3I4MG 3AQQA 1HNXL 3RLOA 4JI2Q 2VY3A 1T9HA 2WFWA 1X54A 4GOPA 1OXVA 1IBML 2N49A 3W5OA 2CWAA 1W3SA 1Y14B 1C9OA 3T1HQ 3KF6B 5IY0A 2AWOA 2GVBA 2MO0A 5M5YH 5IT9c 4NXNL 1VQCA 1PYSB 1VQLA 1YNXA 4GN3B 2KCMA 4BXXG 1KAWA 2D0PA 2N3SA 1JJ2A 1YEZA 2RHQB 3FP9A 3HOVH 5K36G 4LF7L 2Z6KC 1AE2A 1E3PA 4DR1L 1QVCA 2VQEL 4DV7L 1HR0W 4IOAA 1P8LA 3BU2A 4IPCA 1NTGA 3IRBA 1SROA 4JI7L 1LYLA 5GAGC 4A3MG 2VNUD 3D0FA 4P71A 2PMZE 1CSPA 2HHHQ 2D62A 2UXCL 1B7YB 3STBD 2NZHA 5EAYA 4A4IA 4XIGS 4OWXB 1G291 1XPRA 3A0JA 4HIDA 4OX9Q 1LUZA 2WB1E 2EIFA 3CC7A 3RZDH 2R7ZG 2ZTEA 3K7AH 1DGSA 3M85A 4A3IG 3GTQH 4DKAC 2JEAI 4UP7A 2DGYA 1C0AA 3ER0A 4A3CG 4OO1G 4C3IH 2BH8A 3J7A5 4BBSH 3AYHB 1XNQL 3RZOH 4DAMA 2KHIA 4JI3L 4DUZL 4HIOA 3S1QH 1SFOH 2JA8G 4H02A 4A93H 3HKZG 1X56A 4KHPQ 3KOJA 5AJ3Q 4HJ5A 1I6HH 2JQOA 4AH6A 1K8GA 4A3MH 4YY3L 1TXYA 2JA5H 4X65Q 5IYBH 4XTCS 2UU9L 1J6QA 4DR2L 3PF5A 3PIOA 1ASZA 4L5TA 4L5QA 5IYDH 2ES2A 4A3IH 1Z9FA 2V1CC 4YCUA 3STBC 2ZJPA 2ALYB 1K8AC 3J81j 1VCIA 5BR8L 4A3CH 4DR7L 3BJUA 4MNOA 3ULPA 5GAHC 5J3BA 3U58A 2JJQA 3B6YA 1PH2A 1JE5A 3M4QA 1PH5A 4BA1I 5IP9H 1YHBA 4HIKA 3H3VI 3PUZA 5FJ8G 1I94L 1QUQB 4X66L 1V43A 5LMNL 2IHFA 4B3RL 1V9PA 1WJJA 4R4TA 1XNRL 1N36L 4AYBE 2Q2HA 1HR0L 1VQOA 1L1OC 3GTKH 4P72A 3G71A 1VQDA 2KCTA 2K5NA 4HIMA 1NJIC 2R92H 4KI0A 1Q1EA 5C44H 4DV6Q 4OWTB 5LMUL 1E1TA 3A5UA 4O2DA 2MFIA 4P75A 1J5EQ 1L2FA 4NXML 4B3SQ 5GROA 3D31A 2UXDQ 4LFBL 1S40A 3KDFB 1AE3A 1B8AA 3Q8DA 2VUMH 3H3VH 1GVPA 1CKNA 4JYAL 1X3FA 2LSSA 1D8LA 4BBRH 3PUVA 4Y7NH 4BY1H 4GOPB 2A1AA 1TWAH 1PH8A 1XMOQ 1GD7A 3CCVA 4DV4Q 2CKZB 2I5MX 2XTIA 1JJCB 4JI4Q 2PNHA 1KRTA 3M4OH 1TWFH 4HJ7A 4IFDJ 3E9IA 1HNXQ 3KYHC 1N8RC 4DUYQ 1SMXA 2R93G 1U5KA 5C4JH 4A3EH 1HZ9A 2E5LL 2GN5A 1X55A 1XPOA 1CSQA 1RL2A 5GQOA 4LUZA 4X62Q 2NVQH 3M7NA 2K5VA 3S2HH 1ASYA 4Y52H 4LF5L 3I2ZA 3RN5A 3L2PA 2MNAA 2KENA 2E2JH 1A62A 4QQBX 2LXKA 2JA9A 3TRZA 4UP8A 2HIXA
chains in the Genus database with same CATH superfamily
3FPUB 1XTCD 1HRJA 1KNAA 4LF9L 4ZAIA 4OIKA 2MO1A 4A3DG 3JAME 1SNMA 2NTSA 2PO4A 3K8AA 1PVOA 2EE1A 3MEHA 3KFUA 1S3OA 1BOSA 4FP5D 4A3KH 5DEHA 1MHWC 3HOZG 4C2MH 1WCMH 3PO3B 5HY6A 2F3VA 3O13A 4UPAA 1LTAD 3P7JA 3P20A 3PO3H 1K0SA 1SYBA 3HOVB 3S1MB 2F0GA 1XNQQ 3K59A 2AQ2B 3I72A 3S1MH 3DMUA 2EJFC 3RUZA 1HXYD 3T1YL 2OQ0A 4DR5L 1CZWA 4KMUC 3MFGA 2UUBQ 3I4MB 4JOIC 2FMCA 3NQTA 1J8IA 2HT1A 4DR2Q 3I4MH 1XX8A 1H9SB 4PMWA 1Q90A 5IWAQ 4NW2A 3A7AB 1Q46A 2LY7A 3EROA 4LFAL 1LT4D 3FRPB 4JG2A 4LFCL 1STNA 2F0DA 2IWHA 4C3IB 5FLXc 1G2TA 1VQEA 4TQUS 1PH6A 4BXXH 3EJIA 5F2DA 1B53A 4IJHA 1VQ6A 2XGTA 2QEJC 3PUYA 3HKZE 3CAMA 3ONAB 4KV6A 5JVG3 4XYOA 4A3MB 1TWHB 3NEMA 2OXPA 3GTLH 4C1NI 3TZDA 1R9TH 1EWHA 1TWHH 3KF8A 4GOPC 5G3LF 1S4ZA 4APVA 1UEBA 4DAYA 1G51A 2JA6H 2Y0SE 4QIWE 1M90C 2K14A 2RF4A 2J4XA 3SK6A 1F9QA 1SNDA 3OW2A 4B9WA 3CD6A 4H44C 1GKHA 4MTKA 3UE1A 3IFTA 4JV5Q 1ONLA 3Q22A 4BS9A 1QJOA 4RGMA 1CA5A 3G48A 4H13C 4IFDG 2QDBA 2ZM6Q 4PV1C 5C0XG 2Q2IA 3D4WA 1VMPA 4MTNA 4JCVE 3CHBD 1VQ9A 1HZCA 1QOHA 1UE6A 1RODA 4DV3L 4GLXA 3HOUG 4BY1B 1QVFA 1VQFA 1PDQA 1E2WA 3FEWX 1STGA 5FJ8H 3LX0A 5M3MG 1IL2A 2K03A 3H0GG 3EFXD 4KY7A 2SEBD 4M8AA 2OCEA 4DN4M 3LGJA 2FJ2A 4DR6Q 2ENBA 2B2VC 1KLGD 2YTYA 3OPOA 2ZTCA 3PIP3 1C4QA 2O4XA 4K5VA 1QE6A 2XRQD 4FDBA 1EIGA 3WDNA 1E2VA 2LMCB 4ZK9B 5M5XB 1G6PA 1NBWA 3HS0C 3ND9A 2VQEQ 1MGSA 2EXZA 3M3YH 4RHSA 3DLLA 2A68D 3KJOA 1ILPA 2NB0A 4M1UB 2Z1CA 3BYTB 1BXTA 5EBDA 5C4HA 5KIXA 1VF5C 1RDPD 2LXJA 2Z6BA 3MEFA 3D3RA 2AWNA 5IP7H 4DXFA 1TWGH 2XSCA 2K28A 4XQJA 3TREA 5CV4A 2OWOA 1K28A 1IKLA 2B63B 4CJ0B 4JBKA 5G3LD 1VMCA 1VQGA 2AHOB 5C3EB 1HFNA 2JN4A 1XJVA 1JWUD 1K3RA 5C3EH 2NVYB 5IODA 3W2DA 1MJCA 5BR8Q 3VYUA 1BDOA 1SRUA 2FHTA 2L12A 5C3WA 3K81C 1EZ8A 4MHEA 4X66Q 3H3VC 5FLXL 4JI6L 2A6HD 1I50B 3HOWB 4EX5A 3NK9A 3UDFA 1I50H 2WAQB 4JI5Q 3GTPB 1BVSA 2K5HA 1LTSD 3DWAA 2F52A 4R9WA 3GTPH 2R7ZB 3UDGA 5EGTA 5EJWA 3D6CA 3J7AF 4DV5Q 3MA2B 1WFQA 1WVLA 3ERSX 1HUNA 4IUUA 1JOQA 1G8ZD 3I4NB 2PMZB 1K83B 2AUJD 1D5MC 2K5DA 4OHJA 3I4NH 2M00A 1WTVA 2UUCQ 4A3JH 1BCPF 3M4YA 5ISRA 1D1IA 2MJ8A 3E0JA 2MP1A 4IUPA 4IUVA 4LF6Q 4X64L 2IX3A 3OOCA 1JICA 1FL0A 2A5HA 2F4IA 5FKAC 1EYCA 4LUVA 1EIFA 1LTRD 1SYFA 4BBRG 1EUJA 4ZKCB 1X32A 2PCFB 5E3FA 4BY1G 2O5JC 3KJPA 4P2CB 1JWMD 4A3GB 3T51B 3QIAA 2I07B 3J81i 2YU9B 4A3GH 1IBLQ 4A3LG 3PIO3 1XWEA 5HGQA 2Q8IB 3K5LA 2N8NA 4ULLA 1BBXC 1UE5A 2IHEA 2OQKA 2CH4W 4GN5A 1W2BA 3TEHB 2L11A 2F0IA 3F2BA 3CC4A 1FJGQ 1UAPA 3F2CA 4AYBB 3M9BA 1TT2A 1VQHA 1PA6A 3J80i 5EPKA 3RLFA 1JR0D 4BWGB 2QA4A 1LTGD 1AEXA 4RGOS 2KBNA 4RGTA 2K05A 2VS1A 4JI1Q 1VQ7A 3NTKA 4ILWA 4NMZA 1L0XB 3I70A 4R4CA 4A3FG 1BR9A 1PRTF 2B3GA 2F3WA 3GD7A 1ICFB 3P75A 4CKCA 2PQAB 4DV0L 1B50A 3RR5A 2B39A 2KHSA 2ZJRA 2WV6D 1FR3A 3KBGA 4DR3Q 3PQIA 4CJ1B 1UEAB 3BZDB 1HNWL 1SNCA 3PUXA 4JI4L 3HOYG 3GV6A 4DV1Q 4JI2Q 4ZYSA 1T9HA 5EKLA 2LKVA 3W5OA 5IY0A 2GVBA 1DM0B 2EY6A 5I6WA 4NXNL 4QB4A 2ICIA 4GN3B 1JJ2A 2D0PA 1YEZA 1CI3M 3BVZA 1AE2A 4DR1L 1I4GA 1DD2A 4JW0A 1P8LA 3ZYYX 1EQVA 1YNJD 1Y8NB 4P71A 1BCPD 2UXCL 1B7YB 5BN3A 2D9UA 3ND8A 2R7ZG 1SXTA 2ZTEA 5FOBB 4FF3A 3GV3A 2HCIA 3Q24A 4UP7A 3TP8A 5EPLA 3S1QB 2PZUA 1EEID 1EU4A 2HDMA 2KHIA 4JI3L 4HIOA 3S1QH 2K5QA 3VYSA 4H02A 4I7AA 4ZQ3A 5AJ3Q 4HJ5A 2F0FA 4YY3L 3A8IE 2PZTA 5KRUA 2F1MA 5LL6S 4L5TA 4IQZA 4A3IH 2A73B 2V1CC 1K8AC 3BJUA 5GAHC 2MGSA 3SK4A 1H9SA 1PH2A 3PO2B 1MSHA 2F0KA 2KCCA 3J7AV 3PUZA 5CV6A 1I94L 1QUQB 3PMFA 3V96A 2CH4A 4DF7A 1V9PA 1XNRL 1N36L 2SNSA 2Q2HA 2R92B 4C3JB 2WKCA 2OEOA 2Y0SB 3V2TA 1NJIC 2R92H 3A56A 1EOTA 4PMBA 1E1TA 1JCKB 3A5UA 3R93A 4P75A 2Q8RE 4C3HB 1J5EQ 4NXML 1PRTD 3D31A 4LFBL 1WTWA 1AE3A 1TWAB 2LSSA 4FO2A 5I2YA 2IJ0A 3FPPA 1TWAH 1PH8A 2I5MX 2RDGA 1ZYRC 2ZXPA 1O7LA 1NAPA 1HNXQ 1QNUA 4DUYQ 3NUCA 1SMXA 1EYDA 3HOXB 3S2HB 1XPOA 5DM73 4X62Q 1VDZA 4I65A 3S2HH 1ASYA 4Y52H 4LF5L 2E2HB 2MNAA 2E2JH 3S2DB 5CV7A 4K2LA 2FMMA 2XVSA 2E2HH 4UP8A 3HRZC 3NP8A 2DY8A 1DZ1A 4WORA 4DV7Q 1PXUA 2Z6KA 4R4IA 1NE3A 1U4LA 2IY5B 2XRSD 1Q81C 4YHHL 3MFYA 1TS4A 3MXNB 1A6XA 3I4LA 5KYLA 3A7LA 3OYYA 2A8VA 2O2LD 3URYA 1PH7A 4KKTA 4A3BH 1N33Q 2C35B 2WP8J 2PW5A 2SNMA 4RG1A 1KQSA 3GTOB 5I4DA 1BO0A 4FYDA 3GTOH 1IBKQ 1SR3A 2H5XA 1N34L 5M5YB 1PTOC 1I4XA 4QY7A 2DY7A 3P1HA 1IZ6A 2K5WA 1CT1D 1I6VC 1PZJD 2RSOA 2RHSB 4DV2L 4GKJQ 1PFNA 4XQQA 2EJGC 4PNYA 5FLXE 4PZ6A 3PCOB 1EIHA 4ME5A 2K1BA 3E3XA 4JBJA 2I5LX 1F77A 1HCZA 3NTHA 1QZHA 4LF4Q 3NWSA 3F8TA 2R7DA 1KDAA 3NWTA 3HOZH 2UXBL 1M1KC 4JBWA 1EWIA 3RZDB 4LF8L 3K7AB 3EIVA 1ET6A 2NZOA 1A63A 1XMQL 3U9SA 5KYIA 1B2TA 2PPBC 3DEOA 4BBSB 4KN7C 5CR3A 3S16B 4TVAB 5DLQE 1SFOB 3NTIA 1EYAA 3S16H 2AKWB 2EXDA 2F0MA 1JORA 2F0UA 2R3ZA 1HR0Q 5CORA 5IYCG 3S17H 1MJEA 1MIUA 2NN6G 4DR4Q 2Q2UA 1DOKA 5E4XA 1RTNA 4JI0Q 4DNRB 1N9WA 5C5MA 2QKIC 1CQVA 2WB1G 4RKLA 4DK1A 2PI2A 3ULLA 4KKUA 1I4HA 4B08A 3E6ZX 1OO9B 3KF6A 4QL5A 4EQNA 2ASBA 1HNZL 3GTKB 2E5LQ 1A8VA 1SN8A 1TS3A 5ELBA 3KK7A 5C44B 1Z7TA 4C3JG 4J6HA 4OX9L 4PQXA 5C0XI 1MSGA 2EYMA 1D7QA 1O7ZA 2WIIB 2KCNA 4LF9Q 1IW7D 1AW7A 2A74C 1HA6A 1I3QB 1Q1BA 1I3QH 5C4JB 1MD2D 1U4MA 2EPBA 4FNFA 2HQLA 1V8QA 2NVQB 4UP9A 1UE7A 2CVRA 2JXMB 5C0XH 1IBMQ 3CCJA 2GVAA 3DWPA 3F1ZA 2F0EA 1PHJA 1Q8IA 1F9SA 3IL8A 4GLAC 5JVH3 1NR4A 4BY7G 4ZUJA 1SJHD 4LF7Q 3T1YQ 1KHIA 3E9HA 2ZT9C 4A76A 3M4PA 5FLMG 2E2IH 1DOLA 2JK8A 5IGFA 2R93B 3D4DA 1TQOA 4A3KB 4N9TA 4UY8C 1SNQA 5CGKA 2R93H 1S5ED 4C2MB 1WCMB 2B2YA 2BE5C 4GLVB 1YVCA 1EU3A 1TS2A 1S5DD 1LM0A 4LFAQ 3W3AA 3BZKA 4O0AA 5IGEA 3BG3A 4ZKBB 1YHQA 2CCZA 1X6OA 1SMYC 2QGQA 3R8BA 2LFNA 3ITPA 1Z6HA 3FKIB 5IGCA 4DUZQ 4DAVA 3UDXA 4ODGA 2IPKD 4B3ML 2CW0D 3MHBA 3FKIH 2QDLA 4J1MA 2RDHA 2X6GA 3CW2C 1I4RA 3GTGB 2PZWA 3LNNA 5CBEE 4KKSA 4X3KA 3GTGH 4XDXA 1OTCA 1H95A 3M7GA 1D5ZC 2WINB 3VYTA 1PH3A 2Q2TA 2H1EA 2K33A 1PV4A 2F0TA 4KK7A 2XNAC 4J15A 1KD1C 4BBSG 1AZPA 1B44D 1JMCA 4POFA 1LABA 1H9RA 4J8QA 5M3FG 4OXPA 3MXUA 1VQ4A 4XT3B 4A75A 3GTLB 2OT2A 1R9TB 4WJWA 4GKKL 2JA5G 5IYBG 2PQAA 3UE0A 4OONA 1HQRD 4LNQA 2JA6B 1GO3E 3Q0AA 5EQ0A 1LLRD 4DV3Q 3RNUA 2A6EC 2EY1A 5KEEA 2C9OA 4YWMA 3T1HL 2G9DA 5NUCA 2C5CA 1VQBA 4CKBA 4S3SA 5A35A 1D6EC 3R3OA 1X3GA 3EBEA 2EJMA 3J7ZC 2UUBL 4ZLTF 4P73A 3CPFA 4MN3A 4TSSA 1KXLA 2XWJB 2EOTA 3CRKC 3H09A 1I4QA 2HHHL 5IWAL 4QUFA 5C44G 1AZQA 1STBA 1SNPA 3QO2A 4L63B 5ELOA 3PIPA 2SDFA 1HJPA 3L0OA 2XIWA 2MQHA 4IUQA 3D4RA 4RKBA 1AP0A 3OW7A 2D2CC 2F0QA 4OEMB 2ICEC 1Y1VH 5C4XB 1O78A 4H0LC 1C8CA 2FINB 5ELEA 3A74A 5C4XH 1IKMA 4HMIA 4KHVA 3JAMi 2J0TD 4YCVA 3GTJH 1X3PA 1RF2D 1Y1WB 4X6AH 4P74A 1JE4A 3M3YB 5T1IA 4ZCKA 1Y1WH 1NY4A 1KTKA 4ABNA 4JV5L 1VQPA 1WTXA 1G2SA 1NMFA 1NR2A 4HMJA 4EQ5A 1BCPB 4A3KG 3SHLA 4A3LH 1Q12A 1SE8A 1WCMG 1WYDA 3S1NH 1E0BA 3AFQA 2ZM6L 2A69C 2K52A 1VQ5A 1QUQA 2N88A 1HHVA 3W1BA 4HR7B 3PO3G 3PUWA 1K0RA 4QJFA 1L0YB 1TWGB 2KUMA 4B3SL 1JWSD 2NVXB 2UXDL 3HOVG 4JI6Q 4LJZC 1WI5A 2NVXH 1UNSA 4RGNA 5K5PA 3L9AX 1YJNA 1PH1A 1I5FA 2EVBA 2K50A 3I4MG 3AQQA 2R61A 3RLOA 5CBAE 1DONA 3J80E 1Y14B 3SXHA 1FNUA 1STYA 3KF6B 4EQOA 2AWOA 3QOLA 1NUCA 1JQYD 1U4RA 4DAPA 4BXXG 1KAWA 1KNEA 4N9PA 4C3IG 5IT9L 4XYQA 2L4NA 4NP5A 2VQEL 1HR0W 4IOAA 3IAYA 2B2YC 1SROA 4JI7L 1LYLA 4A3MG 2NZHA 4A4IA 1RD9D 4CDCC 4OWXB 1G291 3GTQB 2V4DA 5JPMC 3H6MA 2EIFA 3MXNA 1PRTB 4OL7A 3I3CA 3GTQH 2G5DA 3M85A 3NXWA 2DGYA 3RZOB 3ER0A 2L9HA 2Z8LA 4F88A 4A3CG 3CRLC 5KNDA 4A93B 4LK1C 3RZOH 1CQFA 4A93H 3KOJA 4DXGA 1CFMA 4A3JB 1TXYA 3SE0A 4X65Q 4XTCS 5JEAH 1J6QA 1SEBD 3WOEA 3PIOA 2AQ3B 1RJTA 1A3TA 5IYDH 2ES2A 3STBC 2ALYB 3J81j 3I73A 1VCIA 5BR8L 4G57A 4MNOA 5ELCA 4FXKC 3U58A 1JE5A 1ICWA 4BA1I 5IP9H 2K7VA 2RBMA 1YHBA 3H3VI 5FJ8G 4X66L 1V43A 5LMNL 3D6WA 4B3RL 1PLFA 3T13A 5HURA 1VQOA 2HD3A 1CA6A 2K01A 1VQDA 3AB9A 3D8GA 1SYEA 2KCTA 2K5NA 1VF7A 5JAVA 1Q1EA 4OWTB 3TDQA 4O2DA 2MFIA 1Y69U 2VUMB 1L2FA 5GROA 2X69A 4JYAL 2VUMH 3H3VH 4Q5VA 3GQBA 3DUZA 1ESFA 2K04A 4IUNA 1G91A 3M4OB 2L5TA 4Y7NH 1TWFB 2A1AA 1D2BA 1XMOQ 2QF7A 2XTIA 1JJCB 4A3EB 4JI4Q 1KRTA 3M4OH 1TWFH 4HJ7A 1N8RC 3MXGA 2D5DA 4A3EH 3KLRA 1RKNA 2F0VA 4JVZA 1LT3D 1RL2A 2VB3X 5GQOA 3Q6SA 3M7NA 1D5XC 3I90A 1TIID 4KJOA 4EGVA 3RN5A 4RCOA 4HAEA 5I6YA 3QB3A 2NTTA 1YNNC 1SDFA 1KRSA 3PSIA 4LW1A 1BKBA 1P16A 1N32Q 1KIXA 4CKEA 2DJGC 3ZJYC 3J81c 4JPBW 5D3IB 4OWWB 3HKSA 3HG9A 2B63G 3KLWA 1EFID 3N52A 1DXMA 2KJXA 4IPDA 4KD3A 1JB3A 2EQSA 4RA8A 4RWSC 1NCVA 5C3EG 2YTXA 1O80A 3OHXC 3R2IA 2G9HD 4K0KQ 1H9KA 5KGUA 4N8X1 4K2KA 5I2XA 2L55A 1LTID 3C1FA 4JI3Q 4MZ9A 1LTLA 2OF1A 3QJYA 2KEDA 1EOVA 1B3QA 2NBFA 2JA7B 1YJ9A 1OXSC 1KL9A 3GO5A 2NVTH 4CGYB 1PH4A 4HSPA 5EBCA 2JA7H 1KDCA 1F2ZA 2VB2X 3J80c 2M9VA 3HOWG 2WAQG 4BA2I 1B3AA 1CHPD 1ENAA 3AEVA 1Q8KA 2IX1A 1PZKD 2NZ1D 4LUOA 3IKJA 1X9NA 2I5HA 1Q86C 5K36H 3A55A 2RCNA 3R2TA 1I94Q 1CK1A 3VR2A 1HUMA 4OO1I 1FYCA 4DR3L 1N36Q 2IL8A 3I4NG 1DCZA 2E74C 4A3JG 2UUAL 1CKNB 4JI2L 1II3A 3BZCA 4A3IB 1EIYB 1JT8A 3CMAA 1JB7A 4NXMQ 4JI8Q 3I91A 2JSOA 1VQIA 3OIQA 4G4KA 4QGUA 1U0LA 4ZRZA 4LFBQ 1MKHA 3PGZA 1BNZA 2NYZD 1HZBA 4OO1H 2JA8B 4KLKA 2Q8TA 3HKZB 1IHZA 3QG1A 4DPGA 1YBYA 3T56B 2JA8H 2VQFL 2RQXA 5IYCH 4A3GG 2ZJQA 1R4QB 1E7ZA 1EQTA 2WKDA 1AFPA 2I0QA 1XXGA 1RIPA 3C1EA 4JC0A 4B3TQ 4LF5Q 4QIWB 3K0YA 3DM3A 2KVMA 4LWCA 3CCLA 1ENFA 3OTOL 3AU7A 5IGDA 3KBXA 3CF5A 1L0WA 3MAQA 1GUWA 1S5FD 1DJRD 5H1SE 5CV9A 4F8MA 2DN8A 4IO9A 2HQEA 4AYBG 3A54A 4IN3A 1TU2B 1M4VA 4GN4B 2SOBA 2JEBI 2GA4B 4RH6A 2R7FA 3ERQA 2VL6A 2DNEA 3NBHB 1OXTA 1HQMC 2EYFA 4KN4C 1UUPA 5CV5A 1YJWA 2E2JB 1IXRA 2RVLA 5T1GA 4AQYL 4GNXB 4FXDA 4FF2A 1A0IA 3NSWA 3HP3A 2N55A 2BA1A 2D0OA 1EY9A 1Y8PB 2NWGA 1ZXTA 1WTQA 5JJIA 1YZ6A 4KY5A 5DNFA 4A3BB 1C7YA 2JE6I 1HTPA 2UXBQ 4DA2A 2YYZA 1AH9A 4DU9A 3FHWA 5IE8A 1BQQT 1EZ6A 1LT6D 4LF8Q 1K9MC 4K8IA 2XN9C 3S14B 2IX0A 3J81L 3C3LA 3OMCA 5DM63 3K5MA 5DAUA 1QWYA 4TKOB 3S14H 1I4PA 5IT9E 4A3DB 1VQKA 1PMRA 2MHVA 1BF4A 1FVIA 2RKSA 4A3DH 4YWLA 3K80C 1LTBD 3HOZB 4DUYL 2UU9Q 4UHVA 2WAQE 3E0EA 4NPSA 3FVQA 3CQZB 2A68C 5JJZA 4X3UA 1WD1A 3T4AC 4X62L 1O7IA 4R4QA 2IW3A 1S72A 3CQZH 3J80L 1SYGA 3TQYA 1VQJA 4DR7Q 2K6AA 4HSVA 3TMEA 1Z47A 1K8OA 1VQNA 2B8GA 5LMNW 1KC8C 1XYIA 2F0OA 1CM9A 1HNZQ 4POGA 3S17B 1PYWD 1KAAA 3AFPA 2B2TA 3U4ZA 1ML0D 3TZUA 1N33L 4G7ZC 2F4VL 4IPGA 5LMUQ 1CKOA 1FD7D 1IBKL 3C2PA 3BVMA 2F0SA 3G4SA 3PV0A 4HJ9A 4L6TB 5CC4A 3Q23A 2AUKA 4GKJL 3G6EA 2PNRC 3MZ5A 5M3FH 3QOJA 3NQIA 3PO2G 2YV5A 4HTHA 2FXQA 3TP7A 3U50C 4LF4L 2ZTDA 3CCUA 4I7ZC 2BH2A 2A6HC 4HCSA 1PTOH 3RN2A 3VYRA 3QWNA 2R92G 1S5BD 3TP5A 4EVOA 1EQRA 3U4VA 3RMHA 3MTSA 2Y0SG 1STHA 3HEJA 4IFDI 5EKIA 2F03A 3S1RB 2Z4HA 1QILA 2PQEA 4R4OA 2KA7A 4C3HG 1LO5D 2HUGA 4ALPA 3S1RH 3OIPA 2BOSA 3A8JE 3CCMA 3UI2A 4FVMA 2JYOA 2WACA 2F0JA 4KHPL 1FNWA 4DR4L 4C56C 4IFDH 3HOXG 1GM5A 4JI0L 5D65A 3MVVA 4DNIA 3HOUB 1QZGA 5FO7B 1QB5D 5IGBA 3HOUH 1VS0A 2E2IB 4B3MQ 4DR5Q 1Q3LA 2F0LA 3H94A 3H0GB 2QCPX 3K57A 5M3MH 5C0XJ 4AIMA 4A3BG 3H0GH 1VQ8A 1E24A 5IGGA 4LFCQ 4CDEC 4DV6L 3HFZB 1WTRA 3S15B 3WWVA 1PH9A 3CCSA 4IUTA 3S15H 3NELA 2IT1A 4FF4A 2N78A 1IL8A 5E7NA 3I4OA 1L1OB 4LAAA 3ULJA 1JC7A 1T5EA 2F0WA 4NKLA 4GKKQ 4O1NA 5KNCA 4DV4L 4GZYC 2E2DC 1ENCA 1PTOF 4O42A 1KABA 1K8MA 1IBML 2N49A 4XT1B 4C1NK 1W6JA 3T1HQ 1TS5A 5IT9c 1IYUA 1VQCA 4N8FA 4CHTB 4FF1A 1FNVA 2RDFA 1V1PB 4QCLA 2KCMA 2N3SA 3FP9A 4KJNA 3HOVH 3N6RA 4LF7L 2Z6KC 1QVCA 3SEBA 3BU2A 1NTGA 5BN5A 5GAGC 1CSPA 1EY7A 4K8JA 2HHHQ 1F2YA 1XPRA 3A0JA 2WB1E 1EL0A 3CC7A 1DYQA 5C5LA 4HCEA 1C0AA 4IZ8A 4C3IH 2BH8A 1XNQL 4DUZL 1A15A 1I6HB 3GP7A 1NSNS 3HZXA 1X56A 1LV9A 1I6HH 3FDTA 5BN4A 2JQOA 4AH6A 1K8GA 4A3MH 1SYCA 1HTLD 2F0NA 3SK8A 1GUGA 5I9PA 1QG7A 4K5WA 4DR2L 4DFAA 2X6LA 2ZXRA 1YNJC 4L5QA 1BCPC 1Z9FA 3VR6A 2ZJPA 3LWEA 4G7HC 4A3CH 3ULPA 3EQLC 1AN8A 1ZYRD 3M4QA 4U68A 2B2TC 4UDUC 2IHFA 1Y1VB 1WJJA 2BDNA 4R4TA 4UAIA 1SJED 4P72A 1PFMA 3G71A 1F2LA 5J39A 3X3MA 4KI0A 5D14A 4B3SQ 1MBYA 4KD4A 4BBRB 3GTJB 2UXDQ 4CJ2C 3KDFB 1B8AA 3Q8DA 1CKNA 2B2WA 1D8LA 4HN7A 4BBRH 5TSSA 1TR5A 2B8FA 4BY1H 4GOPB 3KLSA 2I46A 3CCVA 2CKZB 2PNHA 2R93G 3H91A 1U5KA 1PTOD 1HZ9A 3OWEB 4RCNA 3S1NB 4OGQC 2GN5A 5IIFA 5EKKA 1X55A 1WD0A 3AMUA 3J81E 1CSQA 3A8KE 4LUZA 5CV8A 4RFBA 3I2ZA 3DWQA 2DJFC 2J7ZA 2KENA 1BUVT 4PMCA 2LXKA 3NPPA 1CUKA 5JPNC 1PRTC 2NUCA 5M5XH 4G7OC 3FKIG 1SE2A 4JI7Q 5D3DA 2VW9A 2TMPA 3LWUA 4RMFA 1GUTA 2BCOA 3BVGA 1OXUA 1MI2A 2A19A 4IJLA 1SYDA 1TY2A 3K0XA 4A3FB 3I7FA 4DR6L 1BBWA 3NENA 1SSOA 4A3FH 1TVXA 1Q7YC 3VDYA 4V190 3OSOA 3JAMc 4QMGA 1T5XD 3X3NA 1WTOA 3NBHA 3H15A 3HOYB 2K32A 5GADC 5AFWA 1B70B 4GNXA 4F87A 4R1JA 3HOYH 3K58A 1C48A 1GUOA 2B63H 4ME3A 4X3TA 4PZ8A 5LHY1 2EYJA 4X64Q 2JA6G 2E76C 5LL6X 1PFSA 3EA6A 3CKIB 2NVYH 4ID6A 1U4PA 1OXXK 3K6OA 3I56A 4EQPA 1X65A 5L37A 2TSSA 5LMNQ 3EN2A 3EVQA 4ZUIA 1EYGA 4B3RQ 4YCWA 3BYYB 1ILQA 4WJ3M 3CCQA 4JBMA 3UDIA 3HOWH 1A2TA 1WTHA 2ID0A 3HGBA 2Z9HA 3S9WA 4R8IA 4K6LA 3CU7A 1RCVD 5FK9C 2HDLA 1EEFD 2R7ZH 5JJKA 4JYAQ 4RAUC 1Y8OB 2KOLA 4JK1C 1JOKA 3A5ZB 1YIJA 1E2ZA 1PFBA 1E1OA 1WOCA 4PZ7A 1D1KA 2L0CA 5C3XA 4TRDA 5JEAJ 4MIUA 4R8NA 2OTJA 3T53B 1TY0A 1Y1VG 1EQQA 1K83H 3SGIA 3TS2A 3I55A 4JI5L 2QILA 1YITA 1R4PB 5C4XG 3F2UA 1A2UA 2E75C 1ESRA 3DM1A 2DNCA 2BDOA 4DV0Q 4DV5L 2KECA 3TSSA 4Y7NB 2XWBB 3MWYW 2MUYA 4YIJA 5C6AA 3TS0A 5ELDA 4DK3C 2KQ3A 1Y1WG 1SBBB 3CP0A 2BE5D 2BA0A 3S24A 1HNWQ 1TKWB 4Z9CB 5E4WC 4HJ8A 2YU9H 4E6IA 4X65L 3NE5B 4KTAA 2VZAA 2UUCL 4X3SA 1SMYD 4K5XA 4WRDA 1LACA 4NXNQ 3WOFA 1GHKA 3CPWA 4LF6L 1EY8A 4KY6A 5EPJA 2E8GA 4CDDC 5IP7G 2F3IA 3SK5A 4GS3A 4KHZA 4DR1Q 5GAEC 3TP6A 1IW7C 2F0HA 3DHQA 5CYUA 3RLNA 5FO9B 2UXCQ 4HEDA 2DUDA 4XQNA 4IALA 1IBLL 2H4OA 2QW7A 4IURA 3TN2A 5A2QL 2EYHA 2R6GA 1GJXA 4WJ4A 1X3EA 1JJGA 2B2WC 1VQMA 1ET9A 2VXWA 1SAPA 3KF8B 2OTLA 1EWCA 1FGUA 3CCEA 3QR8A 4DAYB 3F2DA 2NVTB 1B4OA 2K4KA 1B9NA 4H7BA 1FJGL 1GUNA 1XMOL 1KLUD 2CQOA 3L7ZC 1YI2A 4YY3Q 3JAML 1UE1A 2K75A 1HZAA 2CFMA 2UUAQ 1QVGA 2A6ED 2AQ1B 1B1ZA 2EYPA 5KNBA 5E1FA 4JI1L 2M2LA 3SDZA 1GXDC 1O7YA 4L5RC 2KHJA 3BDOA 3PF4A 1J9OA 4HJAA 2VQFQ 2QEXA 3C46A 4A93G 1NNXA 4L5SA 2EYLA 1XNRQ 3RD4A 4IOCA 5ELFA 1RHPA 2PYKA 2CWPA 1N32L 2RSNA 2CW0C 3GDEA 3U9OA 2EY2A 5JEAG 4DV1L 1L1OA 1RTOA 2NN6I 2RCFA 1CKMA 1YHAA 5IYDG 1LT5D 3OTOQ 3BDLA 3MC0B 2YTVA 4PG3A 3IFDA 4K0KL 3G7LA 2HIVA 5IP9G 1BBUA 4CBVA 3VA5A 4GNXC 1NMGA 2O5IC 1F9PA 2B29A 4NB3A 1Q82C 2NN6H 1V1PA 3VR4A 3ICEA 1SE3A 5M5WB 4DK6C 2WB1B 3JC66 4LMQD 5M5WH 2CHBD 2P5ZX 2L15A 4AQYQ 1H9JA 1CTMA 3CCRA 3W1GA 1EFWA 1XPUA 2VUMG 3K7UC 1GHJA 1S5CD 1U9RA 2KEEA 2B2UA 3L3OC 3PO2H 4YHHQ 5IOCA 4V0BA 1JOOA 1K73C 2EDGA 2MPMA 1HA5A 2A69D 5AJ3L 3VA7A 3GTMB 4A3EG 5FO8B 1CZGA 3BS1A 1N34Q 3GTMH 4IPHA 4C3JH 5JJLA 1B9MA 1EY4A 2ATWA 3BDCA 1DOMA 4JI8L 1WTPA 4OIJA 4DV2Q 3I8ZA 4C3HH 3CMEA 3NHHA 1KDBA 3T16A 3MXPA 2CQAA 4K6DA 3CXCA 1IYJB 1HFGA 4JOIA 2JP1A 2PI2E 5C4ZA 3HOXH 1VQAA 2AMCB 2Z0SA 3CC2A 3OWFA 5I9OA 1UWVA 1XMQQ 4B3TL 4BY7B 1HH2P 1TWCB 4OELB 4B9XA 1J5EL 4BY7H 5COYA 1SLJA 1TWCH 3S2DH 3KLSX 1M8AA 1SNOA 5FLMH 1E22A 5ELNA 4DNTB 5HGTA 1PYBA 1EY0A 1EY5A 1PZID 1X3QA 1XTDA 2JA7G 4YWKA 3KDFA 2F4VQ 1V1QA 1HNXL 3G6JB 2VY3A 2WFWA 1X54A 4NDXA 4GOPA 1OXVA 5M9OA 2CWAA 1W3SA 1C9OA 5M5YH 2MO0A 1ZEQX 1PYSB 1VQLA 1HPCA 1YNXA 4FXGC 2RHQB 5JOBA 5K36G 1E3PA 1CHQD 4DV7L 1W6KA 4IPCA 4RHRA 5J22A 3IRBA 2VNUD 3FMCA 3D0FA 2PMZE 2PW7A 3KUPA 2D62A 3NBIA 3STBD 5EAYA 4XIGS 1QNKA 2EY5A 1H9MA 4HIDA 4OX9Q 2HCCA 1LUZA 3RZDH 4DK0A 3K7AH 1DGSA 3E5SA 4A3IG 4DKAC 2JEAI 4OO1G 4K14A 1LTTD 5M3FB 3J7A5 4BBSH 3AYHB 4DAMA 2LS01 4Q0FA 1SFOH 4QUCA 2JA8G 3HKZG 1F9RA 3VR5A 4KHPQ 1STEA 2FFKB 2JA5B 2F0PA 3K5NA 2L1BA 4CDFC 1STAA 1PTOB 2JA5H 5IYBH 1F2MA 3SVMA 4XXEA 2UU9L 3PF5A 1QCBD 1ASZA 5CMDA 4YCUA 1ZKOA 2B2VA 3DXJC 4DR7L 5J1ZA 5J3BA 1SE4A 2JJQA 4QF4A 2EZVA 3B6YA 1PH5A 3TBIB 4L8JA 4HIKA 1G6ZA 1A3VA 1GUSA 3VR3A 4AYBE 1HR0L 1L1OC 1A3UA 3GTKH 3SR1A 1K3BC 4HIMA 3K5OA 5C44H 4DV6Q 5LMUL 1GOZA 1YNND 4F7XA 1IYVA 3V05A 1S40A 4DGZA 1GVPA 1X3FA 3PUVA 4U673 1GD7A 2RA4A 5M3MB 4DV4Q 4IFDJ 2ZXOA 3DEPA 2EYOA 3E9IA 3KYHC 1EY6A 2E5LL 5C4JH 3OMGA 4WFN3 5A2QE 2NVQH 2Z4IA 2K5VA 3J7YW 1V1OA 3L2PA 1FGBD 1A62A 4QQBX 2B2UC 2JA9A 3TRZA 2HIXA
chains in the Genus database with same CATH topology
1CUKA 1KRSA 4LF9L 3PSIA 4DV7Q 2MO1A 5M5XH 4LW1A 4A3DG 2IY5B 2Z6KA 4R4IA 1NE3A 1BKBA 3FKIG 1P16A 1Q81C 3K8AA 4YHHL 3MXNB 2VW9A 4JI7Q 1N32Q 1PVOA 4RMFA 3OYYA 1KIXA 2A8VA 3KFUA 3ZJYC 3J81c 1PH7A 4A3BH 1N33Q 2C35B 2WP8J 1S3OA 4RG1A 4A3KH 1KQSA 1OXUA 3HKSA 4OWWB 2B63G 2A19A 3KLWA 3HOZG 4C2MH 1WCMH 4IJLA 3GTOH 4IPDA 1IBKQ 1SR3A 2H5XA 3K0XA 5HY6A 1N34L 4UPAA 5C3EG 2EQSA 3I7FA 4DR6L 1BBWA 2YTXA 3NENA 3PO3H 4A3FH 4QY7A 1IZ6A 1Q7YC 3VDYA 4K0KQ 2RHSB 4DV2L 4GKJQ 1XNQQ 3JAMc 4JI3Q 4MZ9A 1LTLA 4PZ6A 3PCOB 3S1MH 3T1YL 2OQ0A 3H15A 4DR5L 1EOVA 4JBJA 2UUBQ 1YJ9A 1OXSC 1KL9A 2I5LX 3GO5A 2NVTH 4LF4Q 4JOIC 5GADC 1QZHA 1PH4A 1B70B 4GNXA 2JA7H 3F8TA 2R7DA 4R1JA 2HT1A 3HOYH 4DR2Q 3J80c 3HOWG 3I4MH 2B63H 4ME3A 4PMWA 3HOZH 5IWAQ 2UXBL 4PZ8A 1M1KC 2WAQG 4BA2I 4JBWA 1EWIA 3AEVA 1Q46A 4LF8L 3EIVA 4X64Q 4LFAL 2NZOA 2JA6G 1Q8KA 1A63A 1PFSA 4JG2A 4LFCL 1XMQL 2IX1A 5FLXc 2NVYH 4LUOA 1VQEA 4TQUS 1OXXK 1PH6A 4BXXH 1X9NA 4TVAB 2I5HA 4IJHA 2XGTA 5DLQE 3I56A 1Q86C 1VQ6A 1X65A 2RCNA 1I94Q 3PUYA 3HKZE 5LMNQ 3CAMA 3EN2A 1EYGA 3S16H 4B3RQ 4OO1I 4YCWA 4DR3L 2AKWB 2EXDA 1N36Q 3NEMA 1HR0Q 4WJ3M 3CCQA 5IYCG 4JBMA 3GTLH 3UDIA 1MIUA 2NN6G 1MJEA 3HOWH 2Q2UA 3I4NG 3S17H 1R9TH 4DR4Q 1TWHH 2ID0A 4GOPC 4A3JG 4APVA 1CKNB 2UUAL 1UEBA 4JI2L 4JI0Q 3BZCA 1G51A 1EIYB 1N9WA 1JT8A 2JA6H 3CMAA 2Y0SE 1JB7A 4NXMQ 4JI8Q 2WB1G 2R7ZH 5JJKA 4QIWE 1VQIA 4QGUA 4LFBQ 4JYAQ 1U0LA 2K14A 2PI2A 2RF4A 3ULLA 1MKHA 3PGZA 1M90C 1HZBA 4KLKA 3A5ZB 3OW2A 1YIJA 3CD6A 1GKHA 1E1OA 4DPGA 3UE1A 1YBYA 1WOCA 4PZ7A 3KF6A 2JA8H 4JV5Q 4QL5A 2VQFL 5JEAJ 2ASBA 5IYCH 1HNZL 2E5LQ 1A8VA 1SN8A 2OTJA 4A3GG 1Y1VG 1EQQA 1K83H 3G48A 2ZJQA 1E7ZA 4IFDG 3SGIA 3TS2A 3I55A 4JI5L 2ZM6Q 1YITA 2I0QA 5C0XG 2Q2IA 5C4XG 4MTNA 1RIPA 4JC0A 4LF5Q 4B3TQ 4JCVE 3DM3A 4OX9L 1VQ9A 4LWCA 5C0XI 3CCLA 1HZCA 3OTOL 1UE6A 4DV3L 1D7QA 4DV0Q 4GLXA 4DV5L 3HOUG 3CF5A 4LF9Q 1L0WA 1QVFA 1VQFA 3TS0A 4DK3C 1Q1BA 5FJ8H 1Y1WG 3CP0A 5H1SE 2BA0A 3S24A 1HNWQ 1I3QH 5M3MG 1IL2A 3H0GG 4HJ8A 4IO9A 4AYBG 4GN4B 2YU9H 4X65L 2HQLA 2JEBI 2VZAA 1UE7A 2OCEA 4UP9A 1IBMQ 3LGJA 2UUCL 2R7FA 4DR6Q 2VL6A 3NBHB 3CCJA 1OXTA 2YTYA 2GVAA 1PHJA 3F1ZA 1YJWA 2ZTCA 4NXNQ 1IXRA 3CPWA 4LF6L 4AQYL 4FDBA 4GNXB 4GLAC 4BY7G 2E8GA 5IP7G 1A0IA 2F3IA 4LF7Q 3T1YQ 1KHIA 3E9HA 4GS3A 4KHZA 4A76A 1NBWA 1G6PA 4DR1Q 2BA1A 2D0OA 3M4PA 5FLMG 5GAEC 2VQEQ 2E2IH 2JK8A 5JJIA 1YZ6A 3M3YH 3DLLA 3KJOA 1C7YA 2JE6I 4UY8C 3RLNA 2R93H 2UXCQ 2UXBQ 1AH9A 2YYZA 4GLVB 3FHWA 2DUDA 5IE8A 1YVCA 1IBLL 4LF8Q 1K9MC 1LM0A 4LFAQ 3BZKA 2IX0A 4O0AA 2R6GA 2LXJA 4WJ4A 1X3EA 1YHQA 1JJGA 3MEFA 2CCZA 1VQMA 3S14H 1X6OA 2AWNA 2QGQA 5IP7H 3KF8B 2OTLA 4DUZQ 1FGUA 1TWGH 3CCEA 1VQKA 4DAYB 3F2DA 3UDXA 4B3ML 3TREA 1FVIA 2K4KA 4A3DH 3FKIH 1FJGL 1XMOL 2CQOA 3L7ZC 4YWLA 1YI2A 2OWOA 4YY3Q 3K80C 3CW2C 1UE1A 2K75A 1HZAA 2CFMA 2UUAQ 4JBKA 4DUYL 2UU9Q 2WAQE 1QVGA 1VQGA 2AHOB 3E0EA 4NPSA 3GTGH 1OTCA 1XJVA 1H95A 1K3RA 1O7IA 4R4QA 4X62L 4JI1L 1S72A 5C3EH 3CQZH 1MJCA 3TQYA 1VQJA 5BR8Q 1SRUA 1PH3A 2Q2TA 4DR7Q 4L5RC 1Z47A 1PV4A 1VQNA 2KHJA 3K81C 4J15A 1KD1C 5LMNW 4BBSG 3PF4A 1KC8C 1JMCA 4POFA 4HJAA 2VQFQ 2QEXA 4X66Q 4OXPA 5M3FG 1VQ4A 1HNZQ 4JI6L 4A93G 4A75A 4L5SA 4POGA 3AFPA 1XNRQ 4IOCA 3U4ZA 4EX5A 4GKKL 2CWPA 1N32L 2JA5G 3UDFA 1I50H 2PQAA 3GDEA 5IYBG 4JI5Q 1N33L 5JEAG 3UE0A 1BVSA 4DV1L 2F4VL 4OONA 4IPGA 2K5HA 4LNQA 1L1OA 2NN6I 5LMUQ 2F52A 3GTPH 1CKMA 1YHAA 1CKOA 5IYDG 1GO3E 1IBKL 3UDGA 3OTOQ 4DV3Q 3RNUA 4DV5Q 2YTVA 4YWMA 3G4SA 3T1HL 3PV0A 4HJ9A 1WFQA 4PG3A 4K0KL 4GKJL 1VQBA 3G6EA 2HIVA 5IP9G 1BBUA 3ERSX 1X3GA 3EBEA 5M3FH 3PO2G 2YV5A 4GNXC 1NMGA 3J7ZC 2B29A 2UUBL 2FXQA 4P73A 3U50C 3CPFA 4LF4L 4NB3A 2ZTDA 1Q82C 1KXLA 3I4NH 3CCUA 2BH2A 3ICEA 2UUCQ 4A3JH 3RN2A 2R92G 2HHHL 4DK6C 5IWAL 5C44G 1EQRA 3U4VA 2Y0SG 3JC66 5M5WH 4LF6Q 4X64L 4AQYQ 4IFDI 2L15A 5ELOA 3PIPA 1FL0A 1HJPA 3CCRA 4R4OA 3W1GA 1EFWA 1XPUA 2VUMG 3L0OA 4LUVA 1EIFA 3K7UC 4BBRG 2MQHA 1EUJA 4ALPA 3S1RH 4BY1G 3KJPA 3PO2H 3CCMA 4YHHQ 3J81i 1K73C 4KHPL 5AJ3L 4A3GH 1IBLQ 1Y1VH 4A3EG 4DR4L 4A3LG 3HOXG 5HGQA 3GTMH 1GM5A 1N34Q 5JJLA 3A74A 4IPHA 4C3JH 4JI0L 5C4XH 4DNIA 2N8NA 2ATWA 4JI8L 1UE5A 1QZGA 2IHEA 2OQKA 4DV2Q 4GN5A 3JAMi 4C3HH 1W2BA 4YCVA 3TEHB 3HOUH 3GTJH 1VS0A 3CMEA 3F2BA 4B3MQ 4X6AH 3CC4A 4P74A 4DR5Q 1FJGQ 3CXCA 1IYJB 1Y1WH 3F2CA 1NY4A 4JV5L 3M9BA 2E2HH 1VQHA 1PA6A 5M3MH 5C0XJ 1VQPA 3J80i 4AIMA 3H0GH 1NMFA 4A3BG 3RLFA 4EQ5A 4A3KG 2QA4A 4JOIA 4A3LH 2KBNA 1VQ8A 1E24A 1Q12A 2PI2E 3HOXH 1SE8A 1VQAA 2AMCB 1WCMG 1WYDA 3S1NH 2Z0SA 2VS1A 3AFQA 4JI1Q 2ZM6L 3CC2A 2K52A 1VQ5A 1QUQA 1VQ7A 1UWVA 1XMQQ 4B3TL 4LFCQ 4DV6L 1HH2P 3HFZB 3W1BA 3PO3G 3PUWA 4R4CA 4A3FG 1K0RA 3WWVA 1PH9A 4QJFA 3CCSA 1J5EL 2B3GA 3GD7A 3S15H 4BY7H 4B3SL 3NELA 2PQAB 4DV0L 1SLJA 1TWCH 2IT1A 3RR5A 3S2DH 2UXDL 2N78A 2ZJRA 4JI6Q 5E7NA 3HOVG 3I4OA 1L1OB 1WI5A 3ULJA 5FLMH 1E22A 5ELNA 4DR3Q 2NVXH 1PYBA 4GKKQ 1YJNA 1XTDA 1PH1A 4DV4L 1HNWL 2JA7G 3PUXA 1I5FA 4YWKA 4JI4L 3HOYG 3KDFA 4DV1Q 2F4VQ 1V1QA 2K50A 3I4MG 3AQQA 1HNXL 3RLOA 4JI2Q 2VY3A 1T9HA 2WFWA 1X54A 4GOPA 1OXVA 1IBML 2N49A 3W5OA 2CWAA 1W3SA 1Y14B 1C9OA 3T1HQ 3KF6B 5IY0A 2AWOA 2GVBA 2MO0A 5M5YH 5IT9c 4NXNL 1VQCA 1PYSB 1VQLA 1YNXA 4GN3B 2KCMA 4BXXG 1KAWA 2D0PA 2N3SA 1JJ2A 1YEZA 2RHQB 3FP9A 3HOVH 5K36G 4LF7L 2Z6KC 1AE2A 1E3PA 4DR1L 1QVCA 2VQEL 4DV7L 1HR0W 4IOAA 1P8LA 3BU2A 4IPCA 1NTGA 3IRBA 1SROA 4JI7L 1LYLA 5GAGC 4A3MG 2VNUD 3D0FA 4P71A 2PMZE 1CSPA 2HHHQ 2D62A 2UXCL 1B7YB 3STBD 2NZHA 5EAYA 4A4IA 4XIGS 4OWXB 1G291 1XPRA 3A0JA 4HIDA 4OX9Q 1LUZA 2WB1E 2EIFA 3CC7A 3RZDH 2R7ZG 2ZTEA 3K7AH 1DGSA 3M85A 4A3IG 3GTQH 4DKAC 2JEAI 4UP7A 2DGYA 1C0AA 3ER0A 4A3CG 4OO1G 4C3IH 2BH8A 3J7A5 4BBSH 3AYHB 1XNQL 3RZOH 4DAMA 2KHIA 4JI3L 4DUZL 4HIOA 3S1QH 1SFOH 2JA8G 4H02A 4A93H 3HKZG 1X56A 4KHPQ 3KOJA 5AJ3Q 4HJ5A 1I6HH 2JQOA 4AH6A 1K8GA 4A3MH 4YY3L 1TXYA 2JA5H 4X65Q 5IYBH 4XTCS 2UU9L 1J6QA 4DR2L 3PF5A 3PIOA 1ASZA 4L5TA 4L5QA 5IYDH 2ES2A 4A3IH 1Z9FA 2V1CC 4YCUA 3STBC 2ZJPA 2ALYB 1K8AC 3J81j 1VCIA 5BR8L 4A3CH 4DR7L 3BJUA 4MNOA 3ULPA 5GAHC 5J3BA 3U58A 2JJQA 3B6YA 1PH2A 1JE5A 3M4QA 1PH5A 4BA1I 5IP9H 1YHBA 4HIKA 3H3VI 3PUZA 5FJ8G 1I94L 1QUQB 4X66L 1V43A 5LMNL 2IHFA 4B3RL 1V9PA 1WJJA 4R4TA 1XNRL 1N36L 4AYBE 2Q2HA 1HR0L 1VQOA 1L1OC 3GTKH 4P72A 3G71A 1VQDA 2KCTA 2K5NA 4HIMA 1NJIC 2R92H 4KI0A 1Q1EA 5C44H 4DV6Q 4OWTB 5LMUL 1E1TA 3A5UA 4O2DA 2MFIA 4P75A 1J5EQ 1L2FA 4NXML 4B3SQ 5GROA 3D31A 2UXDQ 4LFBL 1S40A 3KDFB 1AE3A 1B8AA 3Q8DA 2VUMH 3H3VH 1GVPA 1CKNA 4JYAL 1X3FA 2LSSA 1D8LA 4BBRH 3PUVA 4Y7NH 4BY1H 4GOPB 2A1AA 1TWAH 1PH8A 1XMOQ 1GD7A 3CCVA 4DV4Q 2CKZB 2I5MX 2XTIA 1JJCB 4JI4Q 2PNHA 1KRTA 3M4OH 1TWFH 4HJ7A 4IFDJ 3E9IA 1HNXQ 3KYHC 1N8RC 4DUYQ 1SMXA 2R93G 1U5KA 5C4JH 4A3EH 1HZ9A 2E5LL 2GN5A 1X55A 1XPOA 1CSQA 1RL2A 5GQOA 4LUZA 4X62Q 2NVQH 3M7NA 2K5VA 3S2HH 1ASYA 4Y52H 4LF5L 3I2ZA 3RN5A 3L2PA 2MNAA 2KENA 2E2JH 1A62A 4QQBX 2LXKA 2JA9A 3TRZA 4UP8A 2HIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUK A;  1KRS A;  4LF9 L;  3PSI A;  4DV7 Q;  2MO1 A;  5M5X H;  4LW1 A;  4A3D G;  2IY5 B;  2Z6K A;  4R4I A;  1NE3 A;  1BKB A;  3FKI G;  1P16 A;  1Q81 C;  3K8A A;  4YHH L;  3MXN B;  2VW9 A;  4JI7 Q;  1N32 Q;  1PVO A;  4RMF A;  3OYY A;  1KIX A;  2A8V A;  3KFU A;  3ZJY C;  3J81 c;  1PH7 A;  4A3B H;  1N33 Q;  2C35 B;  2WP8 J;  1S3O A;  4RG1 A;  4A3K H;  1KQS A;  1OXU A;  3HKS A;  4OWW B;  2B63 G;  2A19 A;  3KLW A;  3HOZ G;  4C2M H;  1WCM H;  4IJL A;  3GTO H;  4IPD A;  1IBK Q;  1SR3 A;  2H5X A;  3K0X A;  5HY6 A;  1N34 L;  4UPA A;  5C3E G;  2EQS A;  3I7F A;  4DR6 L;  1BBW A;  2YTX A;  3NEN A;  3PO3 H;  4A3F H;  4QY7 A;  1IZ6 A;  1Q7Y C;  3VDY A;  4K0K Q;  2RHS B;  4DV2 L;  4GKJ Q;  1XNQ Q;  3JAM c;  4JI3 Q;  4MZ9 A;  1LTL A;  4PZ6 A;  3PCO B;  3S1M H;  3T1Y L;  2OQ0 A;  3H15 A;  4DR5 L;  1EOV A;  4JBJ A;  2UUB Q;  1YJ9 A;  1OXS C;  1KL9 A;  2I5L X;  3GO5 A;  2NVT H;  4LF4 Q;  4JOI C;  5GAD C;  1QZH A;  1PH4 A;  1B70 B;  4GNX A;  2JA7 H;  3F8T A;  2R7D A;  4R1J A;  2HT1 A;  3HOY H;  4DR2 Q;  3J80 c;  3HOW G;  3I4M H;  2B63 H;  4ME3 A;  4PMW A;  3HOZ H;  5IWA Q;  2UXB L;  4PZ8 A;  1M1K C;  2WAQ G;  4BA2 I;  4JBW A;  1EWI A;  3AEV A;  1Q46 A;  4LF8 L;  3EIV A;  4X64 Q;  4LFA L;  2NZO A;  2JA6 G;  1Q8K A;  1A63 A;  1PFS A;  4JG2 A;  4LFC L;  1XMQ L;  2IX1 A;  5FLX c;  2NVY H;  4LUO A;  1VQE A;  4TQU S;  1OXX K;  1PH6 A;  4BXX H;  1X9N A;  4TVA B;  2I5H A;  4IJH A;  2XGT A;  5DLQ E;  3I56 A;  1Q86 C;  1VQ6 A;  1X65 A;  2RCN A;  1I94 Q;  3PUY A;  3HKZ E;  5LMN Q;  3CAM A;  3EN2 A;  1EYG A;  3S16 H;  4B3R Q;  4OO1 I;  4YCW A;  4DR3 L;  2AKW B;  2EXD A;  1N36 Q;  3NEM A;  1HR0 Q;  4WJ3 M;  3CCQ A;  5IYC G;  4JBM A;  3GTL H;  3UDI A;  1MIU A;  2NN6 G;  1MJE A;  3HOW H;  2Q2U A;  3I4N G;  3S17 H;  1R9T H;  4DR4 Q;  1TWH H;  2ID0 A;  4GOP C;  4A3J G;  4APV A;  1CKN B;  2UUA L;  1UEB A;  4JI2 L;  4JI0 Q;  3BZC A;  1G51 A;  1EIY B;  1N9W A;  1JT8 A;  2JA6 H;  3CMA A;  2Y0S E;  1JB7 A;  4NXM Q;  4JI8 Q;  2WB1 G;  2R7Z H;  5JJK A;  4QIW E;  1VQI A;  4QGU A;  4LFB Q;  4JYA Q;  1U0L A;  2K14 A;  2PI2 A;  2RF4 A;  3ULL A;  1MKH A;  3PGZ A;  1M90 C;  1HZB A;  4KLK A;  3A5Z B;  3OW2 A;  1YIJ A;  3CD6 A;  1GKH A;  1E1O A;  4DPG A;  3UE1 A;  1YBY A;  1WOC A;  4PZ7 A;  3KF6 A;  2JA8 H;  4JV5 Q;  4QL5 A;  2VQF L;  5JEA J;  2ASB A;  5IYC H;  1HNZ L;  2E5L Q;  1A8V A;  1SN8 A;  2OTJ A;  4A3G G;  1Y1V G;  1EQQ A;  1K83 H;  3G48 A;  2ZJQ A;  1E7Z A;  4IFD G;  3SGI A;  3TS2 A;  3I55 A;  4JI5 L;  2ZM6 Q;  1YIT A;  2I0Q A;  5C0X G;  2Q2I A;  5C4X G;  4MTN A;  1RIP A;  4JC0 A;  4LF5 Q;  4B3T Q;  4JCV E;  3DM3 A;  4OX9 L;  1VQ9 A;  4LWC A;  5C0X I;  3CCL A;  1HZC A;  3OTO L;  1UE6 A;  4DV3 L;  1D7Q A;  4DV0 Q;  4GLX A;  4DV5 L;  3HOU G;  3CF5 A;  4LF9 Q;  1L0W A;  1QVF A;  1VQF A;  3TS0 A;  4DK3 C;  1Q1B A;  5FJ8 H;  1Y1W G;  3CP0 A;  5H1S E;  2BA0 A;  3S24 A;  1HNW Q;  1I3Q H;  5M3M G;  1IL2 A;  3H0G G;  4HJ8 A;  4IO9 A;  4AYB G;  4GN4 B;  2YU9 H;  4X65 L;  2HQL A;  2JEB I;  2VZA A;  1UE7 A;  2OCE A;  4UP9 A;  1IBM Q;  3LGJ A;  2UUC L;  2R7F A;  4DR6 Q;  2VL6 A;  3NBH B;  3CCJ A;  1OXT A;  2YTY A;  2GVA A;  1PHJ A;  3F1Z A;  1YJW A;  2ZTC A;  4NXN Q;  1IXR A;  3CPW A;  4LF6 L;  4AQY L;  4FDB A;  4GNX B;  4GLA C;  4BY7 G;  2E8G A;  5IP7 G;  1A0I A;  2F3I A;  4LF7 Q;  3T1Y Q;  1KHI A;  3E9H A;  4GS3 A;  4KHZ A;  4A76 A;  1NBW A;  1G6P A;  4DR1 Q;  2BA1 A;  2D0O A;  3M4P A;  5FLM G;  5GAE C;  2VQE Q;  2E2I H;  2JK8 A;  5JJI A;  1YZ6 A;  3M3Y H;  3DLL A;  3KJO A;  1C7Y A;  2JE6 I;  4UY8 C;  3RLN A;  2R93 H;  2UXC Q;  2UXB Q;  1AH9 A;  2YYZ A;  4GLV B;  3FHW A;  2DUD A;  5IE8 A;  1YVC A;  1IBL L;  4LF8 Q;  1K9M C;  1LM0 A;  4LFA Q;  3BZK A;  2IX0 A;  4O0A A;  2R6G A;  2LXJ A;  4WJ4 A;  1X3E A;  1YHQ A;  1JJG A;  3MEF A;  2CCZ A;  1VQM A;  3S14 H;  1X6O A;  2AWN A;  2QGQ A;  5IP7 H;  3KF8 B;  2OTL A;  4DUZ Q;  1FGU A;  1TWG H;  3CCE A;  1VQK A;  4DAY B;  3F2D A;  3UDX A;  4B3M L;  3TRE A;  1FVI A;  2K4K A;  4A3D H;  3FKI H;  1FJG L;  1XMO L;  2CQO A;  3L7Z C;  4YWL A;  1YI2 A;  2OWO A;  4YY3 Q;  3K80 C;  3CW2 C;  1UE1 A;  2K75 A;  1HZA A;  2CFM A;  2UUA Q;  4JBK A;  4DUY L;  2UU9 Q;  2WAQ E;  1QVG A;  1VQG A;  2AHO B;  3E0E A;  4NPS A;  3GTG H;  1OTC A;  1XJV A;  1H95 A;  1K3R A;  1O7I A;  4R4Q A;  4X62 L;  4JI1 L;  1S72 A;  5C3E H;  3CQZ H;  1MJC A;  3TQY A;  1VQJ A;  5BR8 Q;  1SRU A;  1PH3 A;  2Q2T A;  4DR7 Q;  4L5R C;  1Z47 A;  1PV4 A;  1VQN A;  2KHJ A;  3K81 C;  4J15 A;  1KD1 C;  5LMN W;  4BBS G;  3PF4 A;  1KC8 C;  1JMC A;  4POF A;  4HJA A;  2VQF Q;  2QEX A;  4X66 Q;  4OXP A;  5M3F G;  1VQ4 A;  1HNZ Q;  4JI6 L;  4A93 G;  4A75 A;  4L5S A;  4POG A;  3AFP A;  1XNR Q;  4IOC A;  3U4Z A;  4EX5 A;  4GKK L;  2CWP A;  1N32 L;  2JA5 G;  3UDF A;  1I50 H;  2PQA A;  3GDE A;  5IYB G;  4JI5 Q;  1N33 L;  5JEA G;  3UE0 A;  1BVS A;  4DV1 L;  2F4V L;  4OON A;  4IPG A;  2K5H A;  4LNQ A;  1L1O A;  2NN6 I;  5LMU Q;  2F52 A;  3GTP H;  1CKM A;  1YHA A;  1CKO A;  5IYD G;  1GO3 E;  1IBK L;  3UDG A;  3OTO Q;  4DV3 Q;  3RNU A;  4DV5 Q;  2YTV A;  4YWM A;  3G4S A;  3T1H L;  3PV0 A;  4HJ9 A;  1WFQ A;  4PG3 A;  4K0K L;  4GKJ L;  1VQB A;  3G6E A;  2HIV A;  5IP9 G;  1BBU A;  3ERS X;  1X3G A;  3EBE A;  5M3F H;  3PO2 G;  2YV5 A;  4GNX C;  1NMG A;  3J7Z C;  2B29 A;  2UUB L;  2FXQ A;  4P73 A;  3U50 C;  3CPF A;  4LF4 L;  4NB3 A;  2ZTD A;  1Q82 C;  1KXL A;  3I4N H;  3CCU A;  2BH2 A;  3ICE A;  2UUC Q;  4A3J H;  3RN2 A;  2R92 G;  2HHH L;  4DK6 C;  5IWA L;  5C44 G;  1EQR A;  3U4V A;  2Y0S G;  3JC6 6;  5M5W H;  4LF6 Q;  4X64 L;  4AQY Q;  4IFD I;  2L15 A;  5ELO A;  3PIP A;  1FL0 A;  1HJP A;  3CCR A;  4R4O A;  3W1G A;  1EFW A;  1XPU A;  2VUM G;  3L0O A;  4LUV A;  1EIF A;  3K7U C;  4BBR G;  2MQH A;  1EUJ A;  4ALP A;  3S1R H;  4BY1 G;  3KJP A;  3PO2 H;  3CCM A;  4YHH Q;  3J81 i;  1K73 C;  4KHP L;  5AJ3 L;  4A3G H;  1IBL Q;  1Y1V H;  4A3E G;  4DR4 L;  4A3L G;  3HOX G;  5HGQ A;  3GTM H;  1GM5 A;  1N34 Q;  5JJL A;  3A74 A;  4IPH A;  4C3J H;  4JI0 L;  5C4X H;  4DNI A;  2N8N A;  2ATW A;  4JI8 L;  1UE5 A;  1QZG A;  2IHE A;  2OQK A;  4DV2 Q;  4GN5 A;  3JAM i;  4C3H H;  1W2B A;  4YCV A;  3TEH B;  3HOU H;  3GTJ H;  1VS0 A;  3CME A;  3F2B A;  4B3M Q;  4X6A H;  3CC4 A;  4P74 A;  4DR5 Q;  1FJG Q;  3CXC A;  1IYJ B;  1Y1W H;  3F2C A;  1NY4 A;  4JV5 L;  3M9B A;  2E2H H;  1VQH A;  1PA6 A;  5M3M H;  5C0X J;  1VQP A;  3J80 i;  4AIM A;  3H0G H;  1NMF A;  4A3B G;  3RLF A;  4EQ5 A;  4A3K G;  2QA4 A;  4JOI A;  4A3L H;  2KBN A;  1VQ8 A;  1E24 A;  1Q12 A;  2PI2 E;  3HOX H;  1SE8 A;  1VQA A;  2AMC B;  1WCM G;  1WYD A;  3S1N H;  2Z0S A;  2VS1 A;  3AFQ A;  4JI1 Q;  2ZM6 L;  3CC2 A;  2K52 A;  1VQ5 A;  1QUQ A;  1VQ7 A;  1UWV A;  1XMQ Q;  4B3T L;  4LFC Q;  4DV6 L;  1HH2 P;  3HFZ B;  3W1B A;  3PO3 G;  3PUW A;  4R4C A;  4A3F G;  1K0R A;  3WWV A;  1PH9 A;  4QJF A;  3CCS A;  1J5E L;  2B3G A;  3GD7 A;  3S15 H;  4BY7 H;  4B3S L;  3NEL A;  2PQA B;  4DV0 L;  1SLJ A;  1TWC H;  2IT1 A;  3RR5 A;  3S2D H;  2UXD L;  2N78 A;  2ZJR A;  4JI6 Q;  5E7N A;  3HOV G;  3I4O A;  1L1O B;  1WI5 A;  3ULJ A;  5FLM H;  1E22 A;  5ELN A;  4DR3 Q;  2NVX H;  1PYB A;  4GKK Q;  1YJN A;  1XTD A;  1PH1 A;  4DV4 L;  1HNW L;  2JA7 G;  3PUX A;  1I5F A;  4YWK A;  4JI4 L;  3HOY G;  3KDF A;  4DV1 Q;  2F4V Q;  1V1Q A;  2K50 A;  3I4M G;  3AQQ A;  1HNX L;  3RLO A;  4JI2 Q;  2VY3 A;  1T9H A;  2WFW A;  1X54 A;  4GOP A;  1OXV A;  1IBM L;  2N49 A;  3W5O A;  2CWA A;  1W3S A;  1Y14 B;  1C9O A;  3T1H Q;  3KF6 B;  5IY0 A;  2AWO A;  2GVB A;  2MO0 A;  5M5Y H;  5IT9 c;  4NXN L;  1VQC A;  1PYS B;  1VQL A;  1YNX A;  4GN3 B;  2KCM A;  4BXX G;  1KAW A;  2D0P A;  2N3S A;  1JJ2 A;  1YEZ A;  2RHQ B;  3FP9 A;  3HOV H;  5K36 G;  4LF7 L;  2Z6K C;  1AE2 A;  1E3P A;  4DR1 L;  1QVC A;  2VQE L;  4DV7 L;  1HR0 W;  4IOA A;  1P8L A;  3BU2 A;  4IPC A;  1NTG A;  3IRB A;  1SRO A;  4JI7 L;  1LYL A;  5GAG C;  4A3M G;  2VNU D;  3D0F A;  4P71 A;  2PMZ E;  1CSP A;  2HHH Q;  2D62 A;  2UXC L;  1B7Y B;  3STB D;  2NZH A;  5EAY A;  4A4I A;  4XIG S;  4OWX B;  1G29 1;  1XPR A;  3A0J A;  4HID A;  4OX9 Q;  1LUZ A;  2WB1 E;  2EIF A;  3CC7 A;  3RZD H;  2R7Z G;  2ZTE A;  3K7A H;  1DGS A;  3M85 A;  4A3I G;  3GTQ H;  4DKA C;  2JEA I;  4UP7 A;  2DGY A;  1C0A A;  3ER0 A;  4A3C G;  4OO1 G;  4C3I H;  2BH8 A;  3J7A 5;  4BBS H;  3AYH B;  1XNQ L;  3RZO H;  4DAM A;  2KHI A;  4JI3 L;  4DUZ L;  4HIO A;  3S1Q H;  1SFO H;  2JA8 G;  4H02 A;  4A93 H;  3HKZ G;  1X56 A;  4KHP Q;  3KOJ A;  5AJ3 Q;  4HJ5 A;  1I6H H;  2JQO A;  4AH6 A;  1K8G A;  4A3M H;  4YY3 L;  1TXY A;  2JA5 H;  4X65 Q;  5IYB H;  4XTC S;  2UU9 L;  1J6Q A;  4DR2 L;  3PF5 A;  3PIO A;  1ASZ A;  4L5T A;  4L5Q A;  5IYD H;  2ES2 A;  4A3I H;  1Z9F A;  2V1C C;  4YCU A;  3STB C;  2ZJP A;  2ALY B;  1K8A C;  3J81 j;  1VCI A;  5BR8 L;  4A3C H;  4DR7 L;  3BJU A;  4MNO A;  3ULP A;  5GAH C;  5J3B A;  3U58 A;  2JJQ A;  3B6Y A;  1PH2 A;  1JE5 A;  3M4Q A;  1PH5 A;  4BA1 I;  5IP9 H;  1YHB A;  4HIK A;  3H3V I;  3PUZ A;  5FJ8 G;  1I94 L;  1QUQ B;  4X66 L;  1V43 A;  5LMN L;  2IHF A;  4B3R L;  1V9P A;  1WJJ A;  4R4T A;  1XNR L;  1N36 L;  4AYB E;  2Q2H A;  1HR0 L;  1VQO A;  1L1O C;  3GTK H;  4P72 A;  3G71 A;  1VQD A;  2KCT A;  2K5N A;  4HIM A;  1NJI C;  2R92 H;  4KI0 A;  1Q1E A;  5C44 H;  4DV6 Q;  4OWT B;  5LMU L;  1E1T A;  3A5U A;  4O2D A;  2MFI A;  4P75 A;  1J5E Q;  1L2F A;  4NXM L;  4B3S Q;  5GRO A;  3D31 A;  2UXD Q;  4LFB L;  1S40 A;  3KDF B;  1AE3 A;  1B8A A;  3Q8D A;  2VUM H;  3H3V H;  1GVP A;  1CKN A;  4JYA L;  1X3F A;  2LSS A;  1D8L A;  4BBR H;  3PUV A;  4Y7N H;  4BY1 H;  4GOP B;  2A1A A;  1TWA H;  1PH8 A;  1XMO Q;  1GD7 A;  3CCV A;  4DV4 Q;  2CKZ B;  2I5M X;  2XTI A;  1JJC B;  4JI4 Q;  2PNH A;  1KRT A;  3M4O H;  1TWF H;  4HJ7 A;  4IFD J;  3E9I A;  1HNX Q;  3KYH C;  1N8R C;  4DUY Q;  1SMX A;  2R93 G;  1U5K A;  5C4J H;  4A3E H;  1HZ9 A;  2E5L L;  2GN5 A;  1X55 A;  1XPO A;  1CSQ A;  1RL2 A;  5GQO A;  4LUZ A;  4X62 Q;  2NVQ H;  3M7N A;  2K5V A;  3S2H H;  1ASY A;  4Y52 H;  4LF5 L;  3I2Z A;  3RN5 A;  3L2P A;  2MNA A;  2KEN A;  2E2J H;  1A62 A;  4QQB X;  2LXK A;  2JA9 A;  3TRZ A;  4UP8 A;  2HIX A; 
#chains in the Genus database with same CATH topology
 3FPU B;  1XTC D;  1HRJ A;  1KNA A;  4LF9 L;  4ZAI A;  4OIK A;  2MO1 A;  4A3D G;  3JAM E;  1SNM A;  2NTS A;  2PO4 A;  3K8A A;  1PVO A;  2EE1 A;  3MEH A;  3KFU A;  1S3O A;  1BOS A;  4FP5 D;  4A3K H;  5DEH A;  1MHW C;  3HOZ G;  4C2M H;  1WCM H;  3PO3 B;  5HY6 A;  2F3V A;  3O13 A;  4UPA A;  1LTA D;  3P7J A;  3P20 A;  3PO3 H;  1K0S A;  1SYB A;  3HOV B;  3S1M B;  2F0G A;  1XNQ Q;  3K59 A;  2AQ2 B;  3I72 A;  3S1M H;  3DMU A;  2EJF C;  3RUZ A;  1HXY D;  3T1Y L;  2OQ0 A;  4DR5 L;  1CZW A;  4KMU C;  3MFG A;  2UUB Q;  3I4M B;  4JOI C;  2FMC A;  3NQT A;  1J8I A;  2HT1 A;  4DR2 Q;  3I4M H;  1XX8 A;  1H9S B;  4PMW A;  1Q90 A;  5IWA Q;  4NW2 A;  3A7A B;  1Q46 A;  2LY7 A;  3ERO A;  4LFA L;  1LT4 D;  3FRP B;  4JG2 A;  4LFC L;  1STN A;  2F0D A;  2IWH A;  4C3I B;  5FLX c;  1G2T A;  1VQE A;  4TQU S;  1PH6 A;  4BXX H;  3EJI A;  5F2D A;  1B53 A;  4IJH A;  1VQ6 A;  2XGT A;  2QEJ C;  3PUY A;  3HKZ E;  3CAM A;  3ONA B;  4KV6 A;  5JVG 3;  4XYO A;  4A3M B;  1TWH B;  3NEM A;  2OXP A;  3GTL H;  4C1N I;  3TZD A;  1R9T H;  1EWH A;  1TWH H;  3KF8 A;  4GOP C;  5G3L F;  1S4Z A;  4APV A;  1UEB A;  4DAY A;  1G51 A;  2JA6 H;  2Y0S E;  4QIW E;  1M90 C;  2K14 A;  2RF4 A;  2J4X A;  3SK6 A;  1F9Q A;  1SND A;  3OW2 A;  4B9W A;  3CD6 A;  4H44 C;  1GKH A;  4MTK A;  3UE1 A;  3IFT A;  4JV5 Q;  1ONL A;  3Q22 A;  4BS9 A;  1QJO A;  4RGM A;  1CA5 A;  3G48 A;  4H13 C;  4IFD G;  2QDB A;  2ZM6 Q;  4PV1 C;  5C0X G;  2Q2I A;  3D4W A;  1VMP A;  4MTN A;  4JCV E;  3CHB D;  1VQ9 A;  1HZC A;  1QOH A;  1UE6 A;  1ROD A;  4DV3 L;  4GLX A;  3HOU G;  4BY1 B;  1QVF A;  1VQF A;  1PDQ A;  1E2W A;  3FEW X;  1STG A;  5FJ8 H;  3LX0 A;  5M3M G;  1IL2 A;  2K03 A;  3H0G G;  3EFX D;  4KY7 A;  2SEB D;  4M8A A;  2OCE A;  4DN4 M;  3LGJ A;  2FJ2 A;  4DR6 Q;  2ENB A;  2B2V C;  1KLG D;  2YTY A;  3OPO A;  2ZTC A;  3PIP 3;  1C4Q A;  2O4X A;  4K5V A;  1QE6 A;  2XRQ D;  4FDB A;  1EIG A;  3WDN A;  1E2V A;  2LMC B;  4ZK9 B;  5M5X B;  1G6P A;  1NBW A;  3HS0 C;  3ND9 A;  2VQE Q;  1MGS A;  2EXZ A;  3M3Y H;  4RHS A;  3DLL A;  2A68 D;  3KJO A;  1ILP A;  2NB0 A;  4M1U B;  2Z1C A;  3BYT B;  1BXT A;  5EBD A;  5C4H A;  5KIX A;  1VF5 C;  1RDP D;  2LXJ A;  2Z6B A;  3MEF A;  3D3R A;  2AWN A;  5IP7 H;  4DXF A;  1TWG H;  2XSC A;  2K28 A;  4XQJ A;  3TRE A;  5CV4 A;  2OWO A;  1K28 A;  1IKL A;  2B63 B;  4CJ0 B;  4JBK A;  5G3L D;  1VMC A;  1VQG A;  2AHO B;  5C3E B;  1HFN A;  2JN4 A;  1XJV A;  1JWU D;  1K3R A;  5C3E H;  2NVY B;  5IOD A;  3W2D A;  1MJC A;  5BR8 Q;  3VYU A;  1BDO A;  1SRU A;  2FHT A;  2L12 A;  5C3W A;  3K81 C;  1EZ8 A;  4MHE A;  4X66 Q;  3H3V C;  5FLX L;  4JI6 L;  2A6H D;  1I50 B;  3HOW B;  4EX5 A;  3NK9 A;  3UDF A;  1I50 H;  2WAQ B;  4JI5 Q;  3GTP B;  1BVS A;  2K5H A;  1LTS D;  3DWA A;  2F52 A;  4R9W A;  3GTP H;  2R7Z B;  3UDG A;  5EGT A;  5EJW A;  3D6C A;  3J7A F;  4DV5 Q;  3MA2 B;  1WFQ A;  1WVL A;  3ERS X;  1HUN A;  4IUU A;  1JOQ A;  1G8Z D;  3I4N B;  2PMZ B;  1K83 B;  2AUJ D;  1D5M C;  2K5D A;  4OHJ A;  3I4N H;  2M00 A;  1WTV A;  2UUC Q;  4A3J H;  1BCP F;  3M4Y A;  5ISR A;  1D1I A;  2MJ8 A;  3E0J A;  2MP1 A;  4IUP A;  4IUV A;  4LF6 Q;  4X64 L;  2IX3 A;  3OOC A;  1JIC A;  1FL0 A;  2A5H A;  2F4I A;  5FKA C;  1EYC A;  4LUV A;  1EIF A;  1LTR D;  1SYF A;  4BBR G;  1EUJ A;  4ZKC B;  1X32 A;  2PCF B;  5E3F A;  4BY1 G;  2O5J C;  3KJP A;  4P2C B;  1JWM D;  4A3G B;  3T51 B;  3QIA A;  2I07 B;  3J81 i;  2YU9 B;  4A3G H;  1IBL Q;  4A3L G;  3PIO 3;  1XWE A;  5HGQ A;  2Q8I B;  3K5L A;  2N8N A;  4ULL A;  1BBX C;  1UE5 A;  2IHE A;  2OQK A;  2CH4 W;  4GN5 A;  1W2B A;  3TEH B;  2L11 A;  2F0I A;  3F2B A;  3CC4 A;  1FJG Q;  1UAP A;  3F2C A;  4AYB B;  3M9B A;  1TT2 A;  1VQH A;  1PA6 A;  3J80 i;  5EPK A;  3RLF A;  1JR0 D;  4BWG B;  2QA4 A;  1LTG D;  1AEX A;  4RGO S;  2KBN A;  4RGT A;  2K05 A;  2VS1 A;  4JI1 Q;  1VQ7 A;  3NTK A;  4ILW A;  4NMZ A;  1L0X B;  3I70 A;  4R4C A;  4A3F G;  1BR9 A;  1PRT F;  2B3G A;  2F3W A;  3GD7 A;  1ICF B;  3P75 A;  4CKC A;  2PQA B;  4DV0 L;  1B50 A;  3RR5 A;  2B39 A;  2KHS A;  2ZJR A;  2WV6 D;  1FR3 A;  3KBG A;  4DR3 Q;  3PQI A;  4CJ1 B;  1UEA B;  3BZD B;  1HNW L;  1SNC A;  3PUX A;  4JI4 L;  3HOY G;  3GV6 A;  4DV1 Q;  4JI2 Q;  4ZYS A;  1T9H A;  5EKL A;  2LKV A;  3W5O A;  5IY0 A;  2GVB A;  1DM0 B;  2EY6 A;  5I6W A;  4NXN L;  4QB4 A;  2ICI A;  4GN3 B;  1JJ2 A;  2D0P A;  1YEZ A;  1CI3 M;  3BVZ A;  1AE2 A;  4DR1 L;  1I4G A;  1DD2 A;  4JW0 A;  1P8L A;  3ZYY X;  1EQV A;  1YNJ D;  1Y8N B;  4P71 A;  1BCP D;  2UXC L;  1B7Y B;  5BN3 A;  2D9U A;  3ND8 A;  2R7Z G;  1SXT A;  2ZTE A;  5FOB B;  4FF3 A;  3GV3 A;  2HCI A;  3Q24 A;  4UP7 A;  3TP8 A;  5EPL A;  3S1Q B;  2PZU A;  1EEI D;  1EU4 A;  2HDM A;  2KHI A;  4JI3 L;  4HIO A;  3S1Q H;  2K5Q A;  3VYS A;  4H02 A;  4I7A A;  4ZQ3 A;  5AJ3 Q;  4HJ5 A;  2F0F A;  4YY3 L;  3A8I E;  2PZT A;  5KRU A;  2F1M A;  5LL6 S;  4L5T A;  4IQZ A;  4A3I H;  2A73 B;  2V1C C;  1K8A C;  3BJU A;  5GAH C;  2MGS A;  3SK4 A;  1H9S A;  1PH2 A;  3PO2 B;  1MSH A;  2F0K A;  2KCC A;  3J7A V;  3PUZ A;  5CV6 A;  1I94 L;  1QUQ B;  3PMF A;  3V96 A;  2CH4 A;  4DF7 A;  1V9P A;  1XNR L;  1N36 L;  2SNS A;  2Q2H A;  2R92 B;  4C3J B;  2WKC A;  2OEO A;  2Y0S B;  3V2T A;  1NJI C;  2R92 H;  3A56 A;  1EOT A;  4PMB A;  1E1T A;  1JCK B;  3A5U A;  3R93 A;  4P75 A;  2Q8R E;  4C3H B;  1J5E Q;  4NXM L;  1PRT D;  3D31 A;  4LFB L;  1WTW A;  1AE3 A;  1TWA B;  2LSS A;  4FO2 A;  5I2Y A;  2IJ0 A;  3FPP A;  1TWA H;  1PH8 A;  2I5M X;  2RDG A;  1ZYR C;  2ZXP A;  1O7L A;  1NAP A;  1HNX Q;  1QNU A;  4DUY Q;  3NUC A;  1SMX A;  1EYD A;  3HOX B;  3S2H B;  1XPO A;  5DM7 3;  4X62 Q;  1VDZ A;  4I65 A;  3S2H H;  1ASY A;  4Y52 H;  4LF5 L;  2E2H B;  2MNA A;  2E2J H;  3S2D B;  5CV7 A;  4K2L A;  2FMM A;  2XVS A;  2E2H H;  4UP8 A;  3HRZ C;  3NP8 A;  2DY8 A;  1DZ1 A;  4WOR A;  4DV7 Q;  1PXU A;  2Z6K A;  4R4I A;  1NE3 A;  1U4L A;  2IY5 B;  2XRS D;  1Q81 C;  4YHH L;  3MFY A;  1TS4 A;  3MXN B;  1A6X A;  3I4L A;  5KYL A;  3A7L A;  3OYY A;  2A8V A;  2O2L D;  3URY A;  1PH7 A;  4KKT A;  4A3B H;  1N33 Q;  2C35 B;  2WP8 J;  2PW5 A;  2SNM A;  4RG1 A;  1KQS A;  3GTO B;  5I4D A;  1BO0 A;  4FYD A;  3GTO H;  1IBK Q;  1SR3 A;  2H5X A;  1N34 L;  5M5Y B;  1PTO C;  1I4X A;  4QY7 A;  2DY7 A;  3P1H A;  1IZ6 A;  2K5W A;  1CT1 D;  1I6V C;  1PZJ D;  2RSO A;  2RHS B;  4DV2 L;  4GKJ Q;  1PFN A;  4XQQ A;  2EJG C;  4PNY A;  5FLX E;  4PZ6 A;  3PCO B;  1EIH A;  4ME5 A;  2K1B A;  3E3X A;  4JBJ A;  2I5L X;  1F77 A;  1HCZ A;  3NTH A;  1QZH A;  4LF4 Q;  3NWS A;  3F8T A;  2R7D A;  1KDA A;  3NWT A;  3HOZ H;  2UXB L;  1M1K C;  4JBW A;  1EWI A;  3RZD B;  4LF8 L;  3K7A B;  3EIV A;  1ET6 A;  2NZO A;  1A63 A;  1XMQ L;  3U9S A;  5KYI A;  1B2T A;  2PPB C;  3DEO A;  4BBS B;  4KN7 C;  5CR3 A;  3S16 B;  4TVA B;  5DLQ E;  1SFO B;  3NTI A;  1EYA A;  3S16 H;  2AKW B;  2EXD A;  2F0M A;  1JOR A;  2F0U A;  2R3Z A;  1HR0 Q;  5COR A;  5IYC G;  3S17 H;  1MJE A;  1MIU A;  2NN6 G;  4DR4 Q;  2Q2U A;  1DOK A;  5E4X A;  1RTN A;  4JI0 Q;  4DNR B;  1N9W A;  5C5M A;  2QKI C;  1CQV A;  2WB1 G;  4RKL A;  4DK1 A;  2PI2 A;  3ULL A;  4KKU A;  1I4H A;  4B08 A;  3E6Z X;  1OO9 B;  3KF6 A;  4QL5 A;  4EQN A;  2ASB A;  1HNZ L;  3GTK B;  2E5L Q;  1A8V A;  1SN8 A;  1TS3 A;  5ELB A;  3KK7 A;  5C44 B;  1Z7T A;  4C3J G;  4J6H A;  4OX9 L;  4PQX A;  5C0X I;  1MSG A;  2EYM A;  1D7Q A;  1O7Z A;  2WII B;  2KCN A;  4LF9 Q;  1IW7 D;  1AW7 A;  2A74 C;  1HA6 A;  1I3Q B;  1Q1B A;  1I3Q H;  5C4J B;  1MD2 D;  1U4M A;  2EPB A;  4FNF A;  2HQL A;  1V8Q A;  2NVQ B;  4UP9 A;  1UE7 A;  2CVR A;  2JXM B;  5C0X H;  1IBM Q;  3CCJ A;  2GVA A;  3DWP A;  3F1Z A;  2F0E A;  1PHJ A;  1Q8I A;  1F9S A;  3IL8 A;  4GLA C;  5JVH 3;  1NR4 A;  4BY7 G;  4ZUJ A;  1SJH D;  4LF7 Q;  3T1Y Q;  1KHI A;  3E9H A;  2ZT9 C;  4A76 A;  3M4P A;  5FLM G;  2E2I H;  1DOL A;  2JK8 A;  5IGF A;  2R93 B;  3D4D A;  1TQO A;  4A3K B;  4N9T A;  4UY8 C;  1SNQ A;  5CGK A;  2R93 H;  1S5E D;  4C2M B;  1WCM B;  2B2Y A;  2BE5 C;  4GLV B;  1YVC A;  1EU3 A;  1TS2 A;  1S5D D;  1LM0 A;  4LFA Q;  3W3A A;  3BZK A;  4O0A A;  5IGE A;  3BG3 A;  4ZKB B;  1YHQ A;  2CCZ A;  1X6O A;  1SMY C;  2QGQ A;  3R8B A;  2LFN A;  3ITP A;  1Z6H A;  3FKI B;  5IGC A;  4DUZ Q;  4DAV A;  3UDX A;  4ODG A;  2IPK D;  4B3M L;  2CW0 D;  3MHB A;  3FKI H;  2QDL A;  4J1M A;  2RDH A;  2X6G A;  3CW2 C;  1I4R A;  3GTG B;  2PZW A;  3LNN A;  5CBE E;  4KKS A;  4X3K A;  3GTG H;  4XDX A;  1OTC A;  1H95 A;  3M7G A;  1D5Z C;  2WIN B;  3VYT A;  1PH3 A;  2Q2T A;  2H1E A;  2K33 A;  1PV4 A;  2F0T A;  4KK7 A;  2XNA C;  4J15 A;  1KD1 C;  4BBS G;  1AZP A;  1B44 D;  1JMC A;  4POF A;  1LAB A;  1H9R A;  4J8Q A;  5M3F G;  4OXP A;  3MXU A;  1VQ4 A;  4XT3 B;  4A75 A;  3GTL B;  2OT2 A;  1R9T B;  4WJW A;  4GKK L;  2JA5 G;  5IYB G;  2PQA A;  3UE0 A;  4OON A;  1HQR D;  4LNQ A;  2JA6 B;  1GO3 E;  3Q0A A;  5EQ0 A;  1LLR D;  4DV3 Q;  3RNU A;  2A6E C;  2EY1 A;  5KEE A;  2C9O A;  4YWM A;  3T1H L;  2G9D A;  5NUC A;  2C5C A;  1VQB A;  4CKB A;  4S3S A;  5A35 A;  1D6E C;  3R3O A;  1X3G A;  3EBE A;  2EJM A;  3J7Z C;  2UUB L;  4ZLT F;  4P73 A;  3CPF A;  4MN3 A;  4TSS A;  1KXL A;  2XWJ B;  2EOT A;  3CRK C;  3H09 A;  1I4Q A;  2HHH L;  5IWA L;  4QUF A;  5C44 G;  1AZQ A;  1STB A;  1SNP A;  3QO2 A;  4L63 B;  5ELO A;  3PIP A;  2SDF A;  1HJP A;  3L0O A;  2XIW A;  2MQH A;  4IUQ A;  3D4R A;  4RKB A;  1AP0 A;  3OW7 A;  2D2C C;  2F0Q A;  4OEM B;  2ICE C;  1Y1V H;  5C4X B;  1O78 A;  4H0L C;  1C8C A;  2FIN B;  5ELE A;  3A74 A;  5C4X H;  1IKM A;  4HMI A;  4KHV A;  3JAM i;  2J0T D;  4YCV A;  3GTJ H;  1X3P A;  1RF2 D;  1Y1W B;  4X6A H;  4P74 A;  1JE4 A;  3M3Y B;  5T1I A;  4ZCK A;  1Y1W H;  1NY4 A;  1KTK A;  4ABN A;  4JV5 L;  1VQP A;  1WTX A;  1G2S A;  1NMF A;  1NR2 A;  4HMJ A;  4EQ5 A;  1BCP B;  4A3K G;  3SHL A;  4A3L H;  1Q12 A;  1SE8 A;  1WCM G;  1WYD A;  3S1N H;  1E0B A;  3AFQ A;  2ZM6 L;  2A69 C;  2K52 A;  1VQ5 A;  1QUQ A;  2N88 A;  1HHV A;  3W1B A;  4HR7 B;  3PO3 G;  3PUW A;  1K0R A;  4QJF A;  1L0Y B;  1TWG B;  2KUM A;  4B3S L;  1JWS D;  2NVX B;  2UXD L;  3HOV G;  4JI6 Q;  4LJZ C;  1WI5 A;  2NVX H;  1UNS A;  4RGN A;  5K5P A;  3L9A X;  1YJN A;  1PH1 A;  1I5F A;  2EVB A;  2K50 A;  3I4M G;  3AQQ A;  2R61 A;  3RLO A;  5CBA E;  1DON A;  3J80 E;  1Y14 B;  3SXH A;  1FNU A;  1STY A;  3KF6 B;  4EQO A;  2AWO A;  3QOL A;  1NUC A;  1JQY D;  1U4R A;  4DAP A;  4BXX G;  1KAW A;  1KNE A;  4N9P A;  4C3I G;  5IT9 L;  4XYQ A;  2L4N A;  4NP5 A;  2VQE L;  1HR0 W;  4IOA A;  3IAY A;  2B2Y C;  1SRO A;  4JI7 L;  1LYL A;  4A3M G;  2NZH A;  4A4I A;  1RD9 D;  4CDC C;  4OWX B;  1G29 1;  3GTQ B;  2V4D A;  5JPM C;  3H6M A;  2EIF A;  3MXN A;  1PRT B;  4OL7 A;  3I3C A;  3GTQ H;  2G5D A;  3M85 A;  3NXW A;  2DGY A;  3RZO B;  3ER0 A;  2L9H A;  2Z8L A;  4F88 A;  4A3C G;  3CRL C;  5KND A;  4A93 B;  4LK1 C;  3RZO H;  1CQF A;  4A93 H;  3KOJ A;  4DXG A;  1CFM A;  4A3J B;  1TXY A;  3SE0 A;  4X65 Q;  4XTC S;  5JEA H;  1J6Q A;  1SEB D;  3WOE A;  3PIO A;  2AQ3 B;  1RJT A;  1A3T A;  5IYD H;  2ES2 A;  3STB C;  2ALY B;  3J81 j;  3I73 A;  1VCI A;  5BR8 L;  4G57 A;  4MNO A;  5ELC A;  4FXK C;  3U58 A;  1JE5 A;  1ICW A;  4BA1 I;  5IP9 H;  2K7V A;  2RBM A;  1YHB A;  3H3V I;  5FJ8 G;  4X66 L;  1V43 A;  5LMN L;  3D6W A;  4B3R L;  1PLF A;  3T13 A;  5HUR A;  1VQO A;  2HD3 A;  1CA6 A;  2K01 A;  1VQD A;  3AB9 A;  3D8G A;  1SYE A;  2KCT A;  2K5N A;  1VF7 A;  5JAV A;  1Q1E A;  4OWT B;  3TDQ A;  4O2D A;  2MFI A;  1Y69 U;  2VUM B;  1L2F A;  5GRO A;  2X69 A;  4JYA L;  2VUM H;  3H3V H;  4Q5V A;  3GQB A;  3DUZ A;  1ESF A;  2K04 A;  4IUN A;  1G91 A;  3M4O B;  2L5T A;  4Y7N H;  1TWF B;  2A1A A;  1D2B A;  1XMO Q;  2QF7 A;  2XTI A;  1JJC B;  4A3E B;  4JI4 Q;  1KRT A;  3M4O H;  1TWF H;  4HJ7 A;  1N8R C;  3MXG A;  2D5D A;  4A3E H;  3KLR A;  1RKN A;  2F0V A;  4JVZ A;  1LT3 D;  1RL2 A;  2VB3 X;  5GQO A;  3Q6S A;  3M7N A;  1D5X C;  3I90 A;  1TII D;  4KJO A;  4EGV A;  3RN5 A;  4RCO A;  4HAE A;  5I6Y A;  3QB3 A;  2NTT A;  1YNN C;  1SDF A;  1KRS A;  3PSI A;  4LW1 A;  1BKB A;  1P16 A;  1N32 Q;  1KIX A;  4CKE A;  2DJG C;  3ZJY C;  3J81 c;  4JPB W;  5D3I B;  4OWW B;  3HKS A;  3HG9 A;  2B63 G;  3KLW A;  1EFI D;  3N52 A;  1DXM A;  2KJX A;  4IPD A;  4KD3 A;  1JB3 A;  2EQS A;  4RA8 A;  4RWS C;  1NCV A;  5C3E G;  2YTX A;  1O80 A;  3OHX C;  3R2I A;  2G9H D;  4K0K Q;  1H9K A;  5KGU A;  4N8X 1;  4K2K A;  5I2X A;  2L55 A;  1LTI D;  3C1F A;  4JI3 Q;  4MZ9 A;  1LTL A;  2OF1 A;  3QJY A;  2KED A;  1EOV A;  1B3Q A;  2NBF A;  2JA7 B;  1YJ9 A;  1OXS C;  1KL9 A;  3GO5 A;  2NVT H;  4CGY B;  1PH4 A;  4HSP A;  5EBC A;  2JA7 H;  1KDC A;  1F2Z A;  2VB2 X;  3J80 c;  2M9V A;  3HOW G;  2WAQ G;  4BA2 I;  1B3A A;  1CHP D;  1ENA A;  3AEV A;  1Q8K A;  2IX1 A;  1PZK D;  2NZ1 D;  4LUO A;  3IKJ A;  1X9N A;  2I5H A;  1Q86 C;  5K36 H;  3A55 A;  2RCN A;  3R2T A;  1I94 Q;  1CK1 A;  3VR2 A;  1HUM A;  4OO1 I;  1FYC A;  4DR3 L;  1N36 Q;  2IL8 A;  3I4N G;  1DCZ A;  2E74 C;  4A3J G;  2UUA L;  1CKN B;  4JI2 L;  1II3 A;  3BZC A;  4A3I B;  1EIY B;  1JT8 A;  3CMA A;  1JB7 A;  4NXM Q;  4JI8 Q;  3I91 A;  2JSO A;  1VQI A;  3OIQ A;  4G4K A;  4QGU A;  1U0L A;  4ZRZ A;  4LFB Q;  1MKH A;  3PGZ A;  1BNZ A;  2NYZ D;  1HZB A;  4OO1 H;  2JA8 B;  4KLK A;  2Q8T A;  3HKZ B;  1IHZ A;  3QG1 A;  4DPG A;  1YBY A;  3T56 B;  2JA8 H;  2VQF L;  2RQX A;  5IYC H;  4A3G G;  2ZJQ A;  1R4Q B;  1E7Z A;  1EQT A;  2WKD A;  1AFP A;  2I0Q A;  1XXG A;  1RIP A;  3C1E A;  4JC0 A;  4B3T Q;  4LF5 Q;  4QIW B;  3K0Y A;  3DM3 A;  2KVM A;  4LWC A;  3CCL A;  1ENF A;  3OTO L;  3AU7 A;  5IGD A;  3KBX A;  3CF5 A;  1L0W A;  3MAQ A;  1GUW A;  1S5F D;  1DJR D;  5H1S E;  5CV9 A;  4F8M A;  2DN8 A;  4IO9 A;  2HQE A;  4AYB G;  3A54 A;  4IN3 A;  1TU2 B;  1M4V A;  4GN4 B;  2SOB A;  2JEB I;  2GA4 B;  4RH6 A;  2R7F A;  3ERQ A;  2VL6 A;  2DNE A;  3NBH B;  1OXT A;  1HQM C;  2EYF A;  4KN4 C;  1UUP A;  5CV5 A;  1YJW A;  2E2J B;  1IXR A;  2RVL A;  5T1G A;  4AQY L;  4GNX B;  4FXD A;  4FF2 A;  1A0I A;  3NSW A;  3HP3 A;  2N55 A;  2BA1 A;  2D0O A;  1EY9 A;  1Y8P B;  2NWG A;  1ZXT A;  1WTQ A;  5JJI A;  1YZ6 A;  4KY5 A;  5DNF A;  4A3B B;  1C7Y A;  2JE6 I;  1HTP A;  2UXB Q;  4DA2 A;  2YYZ A;  1AH9 A;  4DU9 A;  3FHW A;  5IE8 A;  1BQQ T;  1EZ6 A;  1LT6 D;  4LF8 Q;  1K9M C;  4K8I A;  2XN9 C;  3S14 B;  2IX0 A;  3J81 L;  3C3L A;  3OMC A;  5DM6 3;  3K5M A;  5DAU A;  1QWY A;  4TKO B;  3S14 H;  1I4P A;  5IT9 E;  4A3D B;  1VQK A;  1PMR A;  2MHV A;  1BF4 A;  1FVI A;  2RKS A;  4A3D H;  4YWL A;  3K80 C;  1LTB D;  3HOZ B;  4DUY L;  2UU9 Q;  4UHV A;  2WAQ E;  3E0E A;  4NPS A;  3FVQ A;  3CQZ B;  2A68 C;  5JJZ A;  4X3U A;  1WD1 A;  3T4A C;  4X62 L;  1O7I A;  4R4Q A;  2IW3 A;  1S72 A;  3CQZ H;  3J80 L;  1SYG A;  3TQY A;  1VQJ A;  4DR7 Q;  2K6A A;  4HSV A;  3TME A;  1Z47 A;  1K8O A;  1VQN A;  2B8G A;  5LMN W;  1KC8 C;  1XYI A;  2F0O A;  1CM9 A;  1HNZ Q;  4POG A;  3S17 B;  1PYW D;  1KAA A;  3AFP A;  2B2T A;  3U4Z A;  1ML0 D;  3TZU A;  1N33 L;  4G7Z C;  2F4V L;  4IPG A;  5LMU Q;  1CKO A;  1FD7 D;  1IBK L;  3C2P A;  3BVM A;  2F0S A;  3G4S A;  3PV0 A;  4HJ9 A;  4L6T B;  5CC4 A;  3Q23 A;  2AUK A;  4GKJ L;  3G6E A;  2PNR C;  3MZ5 A;  5M3F H;  3QOJ A;  3NQI A;  3PO2 G;  2YV5 A;  4HTH A;  2FXQ A;  3TP7 A;  3U50 C;  4LF4 L;  2ZTD A;  3CCU A;  4I7Z C;  2BH2 A;  2A6H C;  4HCS A;  1PTO H;  3RN2 A;  3VYR A;  3QWN A;  2R92 G;  1S5B D;  3TP5 A;  4EVO A;  1EQR A;  3U4V A;  3RMH A;  3MTS A;  2Y0S G;  1STH A;  3HEJ A;  4IFD I;  5EKI A;  2F03 A;  3S1R B;  2Z4H A;  1QIL A;  2PQE A;  4R4O A;  2KA7 A;  4C3H G;  1LO5 D;  2HUG A;  4ALP A;  3S1R H;  3OIP A;  2BOS A;  3A8J E;  3CCM A;  3UI2 A;  4FVM A;  2JYO A;  2WAC A;  2F0J A;  4KHP L;  1FNW A;  4DR4 L;  4C56 C;  4IFD H;  3HOX G;  1GM5 A;  4JI0 L;  5D65 A;  3MVV A;  4DNI A;  3HOU B;  1QZG A;  5FO7 B;  1QB5 D;  5IGB A;  3HOU H;  1VS0 A;  2E2I B;  4B3M Q;  4DR5 Q;  1Q3L A;  2F0L A;  3H94 A;  3H0G B;  2QCP X;  3K57 A;  5M3M H;  5C0X J;  4AIM A;  4A3B G;  3H0G H;  1VQ8 A;  1E24 A;  5IGG A;  4LFC Q;  4CDE C;  4DV6 L;  3HFZ B;  1WTR A;  3S15 B;  3WWV A;  1PH9 A;  3CCS A;  4IUT A;  3S15 H;  3NEL A;  2IT1 A;  4FF4 A;  2N78 A;  1IL8 A;  5E7N A;  3I4O A;  1L1O B;  4LAA A;  3ULJ A;  1JC7 A;  1T5E A;  2F0W A;  4NKL A;  4GKK Q;  4O1N A;  5KNC A;  4DV4 L;  4GZY C;  2E2D C;  1ENC A;  1PTO F;  4O42 A;  1KAB A;  1K8M A;  1IBM L;  2N49 A;  4XT1 B;  4C1N K;  1W6J A;  3T1H Q;  1TS5 A;  5IT9 c;  1IYU A;  1VQC A;  4N8F A;  4CHT B;  4FF1 A;  1FNV A;  2RDF A;  1V1P B;  4QCL A;  2KCM A;  2N3S A;  3FP9 A;  4KJN A;  3HOV H;  3N6R A;  4LF7 L;  2Z6K C;  1QVC A;  3SEB A;  3BU2 A;  1NTG A;  5BN5 A;  5GAG C;  1CSP A;  1EY7 A;  4K8J A;  2HHH Q;  1F2Y A;  1XPR A;  3A0J A;  2WB1 E;  1EL0 A;  3CC7 A;  1DYQ A;  5C5L A;  4HCE A;  1C0A A;  4IZ8 A;  4C3I H;  2BH8 A;  1XNQ L;  4DUZ L;  1A15 A;  1I6H B;  3GP7 A;  1NSN S;  3HZX A;  1X56 A;  1LV9 A;  1I6H H;  3FDT A;  5BN4 A;  2JQO A;  4AH6 A;  1K8G A;  4A3M H;  1SYC A;  1HTL D;  2F0N A;  3SK8 A;  1GUG A;  5I9P A;  1QG7 A;  4K5W A;  4DR2 L;  4DFA A;  2X6L A;  2ZXR A;  1YNJ C;  4L5Q A;  1BCP C;  1Z9F A;  3VR6 A;  2ZJP A;  3LWE A;  4G7H C;  4A3C H;  3ULP A;  3EQL C;  1AN8 A;  1ZYR D;  3M4Q A;  4U68 A;  2B2T C;  4UDU C;  2IHF A;  1Y1V B;  1WJJ A;  2BDN A;  4R4T A;  4UAI A;  1SJE D;  4P72 A;  1PFM A;  3G71 A;  1F2L A;  5J39 A;  3X3M A;  4KI0 A;  5D14 A;  4B3S Q;  1MBY A;  4KD4 A;  4BBR B;  3GTJ B;  2UXD Q;  4CJ2 C;  3KDF B;  1B8A A;  3Q8D A;  1CKN A;  2B2W A;  1D8L A;  4HN7 A;  4BBR H;  5TSS A;  1TR5 A;  2B8F A;  4BY1 H;  4GOP B;  3KLS A;  2I46 A;  3CCV A;  2CKZ B;  2PNH A;  2R93 G;  3H91 A;  1U5K A;  1PTO D;  1HZ9 A;  3OWE B;  4RCN A;  3S1N B;  4OGQ C;  2GN5 A;  5IIF A;  5EKK A;  1X55 A;  1WD0 A;  3AMU A;  3J81 E;  1CSQ A;  3A8K E;  4LUZ A;  5CV8 A;  4RFB A;  3I2Z A;  3DWQ A;  2DJF C;  2J7Z A;  2KEN A;  1BUV T;  4PMC A;  2LXK A;  3NPP A;  1CUK A;  5JPN C;  1PRT C;  2NUC A;  5M5X H;  4G7O C;  3FKI G;  1SE2 A;  4JI7 Q;  5D3D A;  2VW9 A;  2TMP A;  3LWU A;  4RMF A;  1GUT A;  2BCO A;  3BVG A;  1OXU A;  1MI2 A;  2A19 A;  4IJL A;  1SYD A;  1TY2 A;  3K0X A;  4A3F B;  3I7F A;  4DR6 L;  1BBW A;  3NEN A;  1SSO A;  4A3F H;  1TVX A;  1Q7Y C;  3VDY A;  4V19 0;  3OSO A;  3JAM c;  4QMG A;  1T5X D;  3X3N A;  1WTO A;  3NBH A;  3H15 A;  3HOY B;  2K32 A;  5GAD C;  5AFW A;  1B70 B;  4GNX A;  4F87 A;  4R1J A;  3HOY H;  3K58 A;  1C48 A;  1GUO A;  2B63 H;  4ME3 A;  4X3T A;  4PZ8 A;  5LHY 1;  2EYJ A;  4X64 Q;  2JA6 G;  2E76 C;  5LL6 X;  1PFS A;  3EA6 A;  3CKI B;  2NVY H;  4ID6 A;  1U4P A;  1OXX K;  3K6O A;  3I56 A;  4EQP A;  1X65 A;  5L37 A;  2TSS A;  5LMN Q;  3EN2 A;  3EVQ A;  4ZUI A;  1EYG A;  4B3R Q;  4YCW A;  3BYY B;  1ILQ A;  4WJ3 M;  3CCQ A;  4JBM A;  3UDI A;  3HOW H;  1A2T A;  1WTH A;  2ID0 A;  3HGB A;  2Z9H A;  3S9W A;  4R8I A;  4K6L A;  3CU7 A;  1RCV D;  5FK9 C;  2HDL A;  1EEF D;  2R7Z H;  5JJK A;  4JYA Q;  4RAU C;  1Y8O B;  2KOL A;  4JK1 C;  1JOK A;  3A5Z B;  1YIJ A;  1E2Z A;  1PFB A;  1E1O A;  1WOC A;  4PZ7 A;  1D1K A;  2L0C A;  5C3X A;  4TRD A;  5JEA J;  4MIU A;  4R8N A;  2OTJ A;  3T53 B;  1TY0 A;  1Y1V G;  1EQQ A;  1K83 H;  3SGI A;  3TS2 A;  3I55 A;  4JI5 L;  2QIL A;  1YIT A;  1R4P B;  5C4X G;  3F2U A;  1A2U A;  2E75 C;  1ESR A;  3DM1 A;  2DNC A;  2BDO A;  4DV0 Q;  4DV5 L;  2KEC A;  3TSS A;  4Y7N B;  2XWB B;  3MWY W;  2MUY A;  4YIJ A;  5C6A A;  3TS0 A;  5ELD A;  4DK3 C;  2KQ3 A;  1Y1W G;  1SBB B;  3CP0 A;  2BE5 D;  2BA0 A;  3S24 A;  1HNW Q;  1TKW B;  4Z9C B;  5E4W C;  4HJ8 A;  2YU9 H;  4E6I A;  4X65 L;  3NE5 B;  4KTA A;  2VZA A;  2UUC L;  4X3S A;  1SMY D;  4K5X A;  4WRD A;  1LAC A;  4NXN Q;  3WOF A;  1GHK A;  3CPW A;  4LF6 L;  1EY8 A;  4KY6 A;  5EPJ A;  2E8G A;  4CDD C;  5IP7 G;  2F3I A;  3SK5 A;  4GS3 A;  4KHZ A;  4DR1 Q;  5GAE C;  3TP6 A;  1IW7 C;  2F0H A;  3DHQ A;  5CYU A;  3RLN A;  5FO9 B;  2UXC Q;  4HED A;  2DUD A;  4XQN A;  4IAL A;  1IBL L;  2H4O A;  2QW7 A;  4IUR A;  3TN2 A;  5A2Q L;  2EYH A;  2R6G A;  1GJX A;  4WJ4 A;  1X3E A;  1JJG A;  2B2W C;  1VQM A;  1ET9 A;  2VXW A;  1SAP A;  3KF8 B;  2OTL A;  1EWC A;  1FGU A;  3CCE A;  3QR8 A;  4DAY B;  3F2D A;  2NVT B;  1B4O A;  2K4K A;  1B9N A;  4H7B A;  1FJG L;  1GUN A;  1XMO L;  1KLU D;  2CQO A;  3L7Z C;  1YI2 A;  4YY3 Q;  3JAM L;  1UE1 A;  2K75 A;  1HZA A;  2CFM A;  2UUA Q;  1QVG A;  2A6E D;  2AQ1 B;  1B1Z A;  2EYP A;  5KNB A;  5E1F A;  4JI1 L;  2M2L A;  3SDZ A;  1GXD C;  1O7Y A;  4L5R C;  2KHJ A;  3BDO A;  3PF4 A;  1J9O A;  4HJA A;  2VQF Q;  2QEX A;  3C46 A;  4A93 G;  1NNX A;  4L5S A;  2EYL A;  1XNR Q;  3RD4 A;  4IOC A;  5ELF A;  1RHP A;  2PYK A;  2CWP A;  1N32 L;  2RSN A;  2CW0 C;  3GDE A;  3U9O A;  2EY2 A;  5JEA G;  4DV1 L;  1L1O A;  1RTO A;  2NN6 I;  2RCF A;  1CKM A;  1YHA A;  5IYD G;  1LT5 D;  3OTO Q;  3BDL A;  3MC0 B;  2YTV A;  4PG3 A;  3IFD A;  4K0K L;  3G7L A;  2HIV A;  5IP9 G;  1BBU A;  4CBV A;  3VA5 A;  4GNX C;  1NMG A;  2O5I C;  1F9P A;  2B29 A;  4NB3 A;  1Q82 C;  2NN6 H;  1V1P A;  3VR4 A;  3ICE A;  1SE3 A;  5M5W B;  4DK6 C;  2WB1 B;  3JC6 6;  4LMQ D;  5M5W H;  2CHB D;  2P5Z X;  2L15 A;  4AQY Q;  1H9J A;  1CTM A;  3CCR A;  3W1G A;  1EFW A;  1XPU A;  2VUM G;  3K7U C;  1GHJ A;  1S5C D;  1U9R A;  2KEE A;  2B2U A;  3L3O C;  3PO2 H;  4YHH Q;  5IOC A;  4V0B A;  1JOO A;  1K73 C;  2EDG A;  2MPM A;  1HA5 A;  2A69 D;  5AJ3 L;  3VA7 A;  3GTM B;  4A3E G;  5FO8 B;  1CZG A;  3BS1 A;  1N34 Q;  3GTM H;  4IPH A;  4C3J H;  5JJL A;  1B9M A;  1EY4 A;  2ATW A;  3BDC A;  1DOM A;  4JI8 L;  1WTP A;  4OIJ A;  4DV2 Q;  3I8Z A;  4C3H H;  3CME A;  3NHH A;  1KDB A;  3T16 A;  3MXP A;  2CQA A;  4K6D A;  3CXC A;  1IYJ B;  1HFG A;  4JOI A;  2JP1 A;  2PI2 E;  5C4Z A;  3HOX H;  1VQA A;  2AMC B;  2Z0S A;  3CC2 A;  3OWF A;  5I9O A;  1UWV A;  1XMQ Q;  4B3T L;  4BY7 B;  1HH2 P;  1TWC B;  4OEL B;  4B9X A;  1J5E L;  4BY7 H;  5COY A;  1SLJ A;  1TWC H;  3S2D H;  3KLS X;  1M8A A;  1SNO A;  5FLM H;  1E22 A;  5ELN A;  4DNT B;  5HGT A;  1PYB A;  1EY0 A;  1EY5 A;  1PZI D;  1X3Q A;  1XTD A;  2JA7 G;  4YWK A;  3KDF A;  2F4V Q;  1V1Q A;  1HNX L;  3G6J B;  2VY3 A;  2WFW A;  1X54 A;  4NDX A;  4GOP A;  1OXV A;  5M9O A;  2CWA A;  1W3S A;  1C9O A;  5M5Y H;  2MO0 A;  1ZEQ X;  1PYS B;  1VQL A;  1HPC A;  1YNX A;  4FXG C;  2RHQ B;  5JOB A;  5K36 G;  1E3P A;  1CHQ D;  4DV7 L;  1W6K A;  4IPC A;  4RHR A;  5J22 A;  3IRB A;  2VNU D;  3FMC A;  3D0F A;  2PMZ E;  2PW7 A;  3KUP A;  2D62 A;  3NBI A;  3STB D;  5EAY A;  4XIG S;  1QNK A;  2EY5 A;  1H9M A;  4HID A;  4OX9 Q;  2HCC A;  1LUZ A;  3RZD H;  4DK0 A;  3K7A H;  1DGS A;  3E5S A;  4A3I G;  4DKA C;  2JEA I;  4OO1 G;  4K14 A;  1LTT D;  5M3F B;  3J7A 5;  4BBS H;  3AYH B;  4DAM A;  2LS0 1;  4Q0F A;  1SFO H;  4QUC A;  2JA8 G;  3HKZ G;  1F9R A;  3VR5 A;  4KHP Q;  1STE A;  2FFK B;  2JA5 B;  2F0P A;  3K5N A;  2L1B A;  4CDF C;  1STA A;  1PTO B;  2JA5 H;  5IYB H;  1F2M A;  3SVM A;  4XXE A;  2UU9 L;  3PF5 A;  1QCB D;  1ASZ A;  5CMD A;  4YCU A;  1ZKO A;  2B2V A;  3DXJ C;  4DR7 L;  5J1Z A;  5J3B A;  1SE4 A;  2JJQ A;  4QF4 A;  2EZV A;  3B6Y A;  1PH5 A;  3TBI B;  4L8J A;  4HIK A;  1G6Z A;  1A3V A;  1GUS A;  3VR3 A;  4AYB E;  1HR0 L;  1L1O C;  1A3U A;  3GTK H;  3SR1 A;  1K3B C;  4HIM A;  3K5O A;  5C44 H;  4DV6 Q;  5LMU L;  1GOZ A;  1YNN D;  4F7X A;  1IYV A;  3V05 A;  1S40 A;  4DGZ A;  1GVP A;  1X3F A;  3PUV A;  4U67 3;  1GD7 A;  2RA4 A;  5M3M B;  4DV4 Q;  4IFD J;  2ZXO A;  3DEP A;  2EYO A;  3E9I A;  3KYH C;  1EY6 A;  2E5L L;  5C4J H;  3OMG A;  4WFN 3;  5A2Q E;  2NVQ H;  2Z4I A;  2K5V A;  3J7Y W;  1V1O A;  3L2P A;  1FGB D;  1A62 A;  4QQB X;  2B2U C;  2JA9 A;  3TRZ A;  2HIX A; 
#chains in the Genus database with same CATH homology
 1CUK A;  1KRS A;  4LF9 L;  3PSI A;  4DV7 Q;  2MO1 A;  5M5X H;  4LW1 A;  4A3D G;  2IY5 B;  2Z6K A;  4R4I A;  1NE3 A;  1BKB A;  3FKI G;  1P16 A;  1Q81 C;  3K8A A;  4YHH L;  3MXN B;  2VW9 A;  4JI7 Q;  1N32 Q;  1PVO A;  4RMF A;  3OYY A;  1KIX A;  2A8V A;  3KFU A;  3ZJY C;  3J81 c;  1PH7 A;  4A3B H;  1N33 Q;  2C35 B;  2WP8 J;  1S3O A;  4RG1 A;  4A3K H;  1KQS A;  1OXU A;  3HKS A;  4OWW B;  2B63 G;  2A19 A;  3KLW A;  3HOZ G;  4C2M H;  1WCM H;  4IJL A;  3GTO H;  4IPD A;  1IBK Q;  1SR3 A;  2H5X A;  3K0X A;  5HY6 A;  1N34 L;  4UPA A;  5C3E G;  2EQS A;  3I7F A;  4DR6 L;  1BBW A;  2YTX A;  3NEN A;  3PO3 H;  4A3F H;  4QY7 A;  1IZ6 A;  1Q7Y C;  3VDY A;  4K0K Q;  2RHS B;  4DV2 L;  4GKJ Q;  1XNQ Q;  3JAM c;  4JI3 Q;  4MZ9 A;  1LTL A;  4PZ6 A;  3PCO B;  3S1M H;  3T1Y L;  2OQ0 A;  3H15 A;  4DR5 L;  1EOV A;  4JBJ A;  2UUB Q;  1YJ9 A;  1OXS C;  1KL9 A;  2I5L X;  3GO5 A;  2NVT H;  4LF4 Q;  4JOI C;  5GAD C;  1QZH A;  1PH4 A;  1B70 B;  4GNX A;  2JA7 H;  3F8T A;  2R7D A;  4R1J A;  2HT1 A;  3HOY H;  4DR2 Q;  3J80 c;  3HOW G;  3I4M H;  2B63 H;  4ME3 A;  4PMW A;  3HOZ H;  5IWA Q;  2UXB L;  4PZ8 A;  1M1K C;  2WAQ G;  4BA2 I;  4JBW A;  1EWI A;  3AEV A;  1Q46 A;  4LF8 L;  3EIV A;  4X64 Q;  4LFA L;  2NZO A;  2JA6 G;  1Q8K A;  1A63 A;  1PFS A;  4JG2 A;  4LFC L;  1XMQ L;  2IX1 A;  5FLX c;  2NVY H;  4LUO A;  1VQE A;  4TQU S;  1OXX K;  1PH6 A;  4BXX H;  1X9N A;  4TVA B;  2I5H A;  4IJH A;  2XGT A;  5DLQ E;  3I56 A;  1Q86 C;  1VQ6 A;  1X65 A;  2RCN A;  1I94 Q;  3PUY A;  3HKZ E;  5LMN Q;  3CAM A;  3EN2 A;  1EYG A;  3S16 H;  4B3R Q;  4OO1 I;  4YCW A;  4DR3 L;  2AKW B;  2EXD A;  1N36 Q;  3NEM A;  1HR0 Q;  4WJ3 M;  3CCQ A;  5IYC G;  4JBM A;  3GTL H;  3UDI A;  1MIU A;  2NN6 G;  1MJE A;  3HOW H;  2Q2U A;  3I4N G;  3S17 H;  1R9T H;  4DR4 Q;  1TWH H;  2ID0 A;  4GOP C;  4A3J G;  4APV A;  1CKN B;  2UUA L;  1UEB A;  4JI2 L;  4JI0 Q;  3BZC A;  1G51 A;  1EIY B;  1N9W A;  1JT8 A;  2JA6 H;  3CMA A;  2Y0S E;  1JB7 A;  4NXM Q;  4JI8 Q;  2WB1 G;  2R7Z H;  5JJK A;  4QIW E;  1VQI A;  4QGU A;  4LFB Q;  4JYA Q;  1U0L A;  2K14 A;  2PI2 A;  2RF4 A;  3ULL A;  1MKH A;  3PGZ A;  1M90 C;  1HZB A;  4KLK A;  3A5Z B;  3OW2 A;  1YIJ A;  3CD6 A;  1GKH A;  1E1O A;  4DPG A;  3UE1 A;  1YBY A;  1WOC A;  4PZ7 A;  3KF6 A;  2JA8 H;  4JV5 Q;  4QL5 A;  2VQF L;  5JEA J;  2ASB A;  5IYC H;  1HNZ L;  2E5L Q;  1A8V A;  1SN8 A;  2OTJ A;  4A3G G;  1Y1V G;  1EQQ A;  1K83 H;  3G48 A;  2ZJQ A;  1E7Z A;  4IFD G;  3SGI A;  3TS2 A;  3I55 A;  4JI5 L;  2ZM6 Q;  1YIT A;  2I0Q A;  5C0X G;  2Q2I A;  5C4X G;  4MTN A;  1RIP A;  4JC0 A;  4LF5 Q;  4B3T Q;  4JCV E;  3DM3 A;  4OX9 L;  1VQ9 A;  4LWC A;  5C0X I;  3CCL A;  1HZC A;  3OTO L;  1UE6 A;  4DV3 L;  1D7Q A;  4DV0 Q;  4GLX A;  4DV5 L;  3HOU G;  3CF5 A;  4LF9 Q;  1L0W A;  1QVF A;  1VQF A;  3TS0 A;  4DK3 C;  1Q1B A;  5FJ8 H;  1Y1W G;  3CP0 A;  5H1S E;  2BA0 A;  3S24 A;  1HNW Q;  1I3Q H;  5M3M G;  1IL2 A;  3H0G G;  4HJ8 A;  4IO9 A;  4AYB G;  4GN4 B;  2YU9 H;  4X65 L;  2HQL A;  2JEB I;  2VZA A;  1UE7 A;  2OCE A;  4UP9 A;  1IBM Q;  3LGJ A;  2UUC L;  2R7F A;  4DR6 Q;  2VL6 A;  3NBH B;  3CCJ A;  1OXT A;  2YTY A;  2GVA A;  1PHJ A;  3F1Z A;  1YJW A;  2ZTC A;  4NXN Q;  1IXR A;  3CPW A;  4LF6 L;  4AQY L;  4FDB A;  4GNX B;  4GLA C;  4BY7 G;  2E8G A;  5IP7 G;  1A0I A;  2F3I A;  4LF7 Q;  3T1Y Q;  1KHI A;  3E9H A;  4GS3 A;  4KHZ A;  4A76 A;  1NBW A;  1G6P A;  4DR1 Q;  2BA1 A;  2D0O A;  3M4P A;  5FLM G;  5GAE C;  2VQE Q;  2E2I H;  2JK8 A;  5JJI A;  1YZ6 A;  3M3Y H;  3DLL A;  3KJO A;  1C7Y A;  2JE6 I;  4UY8 C;  3RLN A;  2R93 H;  2UXC Q;  2UXB Q;  1AH9 A;  2YYZ A;  4GLV B;  3FHW A;  2DUD A;  5IE8 A;  1YVC A;  1IBL L;  4LF8 Q;  1K9M C;  1LM0 A;  4LFA Q;  3BZK A;  2IX0 A;  4O0A A;  2R6G A;  2LXJ A;  4WJ4 A;  1X3E A;  1YHQ A;  1JJG A;  3MEF A;  2CCZ A;  1VQM A;  3S14 H;  1X6O A;  2AWN A;  2QGQ A;  5IP7 H;  3KF8 B;  2OTL A;  4DUZ Q;  1FGU A;  1TWG H;  3CCE A;  1VQK A;  4DAY B;  3F2D A;  3UDX A;  4B3M L;  3TRE A;  1FVI A;  2K4K A;  4A3D H;  3FKI H;  1FJG L;  1XMO L;  2CQO A;  3L7Z C;  4YWL A;  1YI2 A;  2OWO A;  4YY3 Q;  3K80 C;  3CW2 C;  1UE1 A;  2K75 A;  1HZA A;  2CFM A;  2UUA Q;  4JBK A;  4DUY L;  2UU9 Q;  2WAQ E;  1QVG A;  1VQG A;  2AHO B;  3E0E A;  4NPS A;  3GTG H;  1OTC A;  1XJV A;  1H95 A;  1K3R A;  1O7I A;  4R4Q A;  4X62 L;  4JI1 L;  1S72 A;  5C3E H;  3CQZ H;  1MJC A;  3TQY A;  1VQJ A;  5BR8 Q;  1SRU A;  1PH3 A;  2Q2T A;  4DR7 Q;  4L5R C;  1Z47 A;  1PV4 A;  1VQN A;  2KHJ A;  3K81 C;  4J15 A;  1KD1 C;  5LMN W;  4BBS G;  3PF4 A;  1KC8 C;  1JMC A;  4POF A;  4HJA A;  2VQF Q;  2QEX A;  4X66 Q;  4OXP A;  5M3F G;  1VQ4 A;  1HNZ Q;  4JI6 L;  4A93 G;  4A75 A;  4L5S A;  4POG A;  3AFP A;  1XNR Q;  4IOC A;  3U4Z A;  4EX5 A;  4GKK L;  2CWP A;  1N32 L;  2JA5 G;  3UDF A;  1I50 H;  2PQA A;  3GDE A;  5IYB G;  4JI5 Q;  1N33 L;  5JEA G;  3UE0 A;  1BVS A;  4DV1 L;  2F4V L;  4OON A;  4IPG A;  2K5H A;  4LNQ A;  1L1O A;  2NN6 I;  5LMU Q;  2F52 A;  3GTP H;  1CKM A;  1YHA A;  1CKO A;  5IYD G;  1GO3 E;  1IBK L;  3UDG A;  3OTO Q;  4DV3 Q;  3RNU A;  4DV5 Q;  2YTV A;  4YWM A;  3G4S A;  3T1H L;  3PV0 A;  4HJ9 A;  1WFQ A;  4PG3 A;  4K0K L;  4GKJ L;  1VQB A;  3G6E A;  2HIV A;  5IP9 G;  1BBU A;  3ERS X;  1X3G A;  3EBE A;  5M3F H;  3PO2 G;  2YV5 A;  4GNX C;  1NMG A;  3J7Z C;  2B29 A;  2UUB L;  2FXQ A;  4P73 A;  3U50 C;  3CPF A;  4LF4 L;  4NB3 A;  2ZTD A;  1Q82 C;  1KXL A;  3I4N H;  3CCU A;  2BH2 A;  3ICE A;  2UUC Q;  4A3J H;  3RN2 A;  2R92 G;  2HHH L;  4DK6 C;  5IWA L;  5C44 G;  1EQR A;  3U4V A;  2Y0S G;  3JC6 6;  5M5W H;  4LF6 Q;  4X64 L;  4AQY Q;  4IFD I;  2L15 A;  5ELO A;  3PIP A;  1FL0 A;  1HJP A;  3CCR A;  4R4O A;  3W1G A;  1EFW A;  1XPU A;  2VUM G;  3L0O A;  4LUV A;  1EIF A;  3K7U C;  4BBR G;  2MQH A;  1EUJ A;  4ALP A;  3S1R H;  4BY1 G;  3KJP A;  3PO2 H;  3CCM A;  4YHH Q;  3J81 i;  1K73 C;  4KHP L;  5AJ3 L;  4A3G H;  1IBL Q;  1Y1V H;  4A3E G;  4DR4 L;  4A3L G;  3HOX G;  5HGQ A;  3GTM H;  1GM5 A;  1N34 Q;  5JJL A;  3A74 A;  4IPH A;  4C3J H;  4JI0 L;  5C4X H;  4DNI A;  2N8N A;  2ATW A;  4JI8 L;  1UE5 A;  1QZG A;  2IHE A;  2OQK A;  4DV2 Q;  4GN5 A;  3JAM i;  4C3H H;  1W2B A;  4YCV A;  3TEH B;  3HOU H;  3GTJ H;  1VS0 A;  3CME A;  3F2B A;  4B3M Q;  4X6A H;  3CC4 A;  4P74 A;  4DR5 Q;  1FJG Q;  3CXC A;  1IYJ B;  1Y1W H;  3F2C A;  1NY4 A;  4JV5 L;  3M9B A;  2E2H H;  1VQH A;  1PA6 A;  5M3M H;  5C0X J;  1VQP A;  3J80 i;  4AIM A;  3H0G H;  1NMF A;  4A3B G;  3RLF A;  4EQ5 A;  4A3K G;  2QA4 A;  4JOI A;  4A3L H;  2KBN A;  1VQ8 A;  1E24 A;  1Q12 A;  2PI2 E;  3HOX H;  1SE8 A;  1VQA A;  2AMC B;  1WCM G;  1WYD A;  3S1N H;  2Z0S A;  2VS1 A;  3AFQ A;  4JI1 Q;  2ZM6 L;  3CC2 A;  2K52 A;  1VQ5 A;  1QUQ A;  1VQ7 A;  1UWV A;  1XMQ Q;  4B3T L;  4LFC Q;  4DV6 L;  1HH2 P;  3HFZ B;  3W1B A;  3PO3 G;  3PUW A;  4R4C A;  4A3F G;  1K0R A;  3WWV A;  1PH9 A;  4QJF A;  3CCS A;  1J5E L;  2B3G A;  3GD7 A;  3S15 H;  4BY7 H;  4B3S L;  3NEL A;  2PQA B;  4DV0 L;  1SLJ A;  1TWC H;  2IT1 A;  3RR5 A;  3S2D H;  2UXD L;  2N78 A;  2ZJR A;  4JI6 Q;  5E7N A;  3HOV G;  3I4O A;  1L1O B;  1WI5 A;  3ULJ A;  5FLM H;  1E22 A;  5ELN A;  4DR3 Q;  2NVX H;  1PYB A;  4GKK Q;  1YJN A;  1XTD A;  1PH1 A;  4DV4 L;  1HNW L;  2JA7 G;  3PUX A;  1I5F A;  4YWK A;  4JI4 L;  3HOY G;  3KDF A;  4DV1 Q;  2F4V Q;  1V1Q A;  2K50 A;  3I4M G;  3AQQ A;  1HNX L;  3RLO A;  4JI2 Q;  2VY3 A;  1T9H A;  2WFW A;  1X54 A;  4GOP A;  1OXV A;  1IBM L;  2N49 A;  3W5O A;  2CWA A;  1W3S A;  1Y14 B;  1C9O A;  3T1H Q;  3KF6 B;  5IY0 A;  2AWO A;  2GVB A;  2MO0 A;  5M5Y H;  5IT9 c;  4NXN L;  1VQC A;  1PYS B;  1VQL A;  1YNX A;  4GN3 B;  2KCM A;  4BXX G;  1KAW A;  2D0P A;  2N3S A;  1JJ2 A;  1YEZ A;  2RHQ B;  3FP9 A;  3HOV H;  5K36 G;  4LF7 L;  2Z6K C;  1AE2 A;  1E3P A;  4DR1 L;  1QVC A;  2VQE L;  4DV7 L;  1HR0 W;  4IOA A;  1P8L A;  3BU2 A;  4IPC A;  1NTG A;  3IRB A;  1SRO A;  4JI7 L;  1LYL A;  5GAG C;  4A3M G;  2VNU D;  3D0F A;  4P71 A;  2PMZ E;  1CSP A;  2HHH Q;  2D62 A;  2UXC L;  1B7Y B;  3STB D;  2NZH A;  5EAY A;  4A4I A;  4XIG S;  4OWX B;  1G29 1;  1XPR A;  3A0J A;  4HID A;  4OX9 Q;  1LUZ A;  2WB1 E;  2EIF A;  3CC7 A;  3RZD H;  2R7Z G;  2ZTE A;  3K7A H;  1DGS A;  3M85 A;  4A3I G;  3GTQ H;  4DKA C;  2JEA I;  4UP7 A;  2DGY A;  1C0A A;  3ER0 A;  4A3C G;  4OO1 G;  4C3I H;  2BH8 A;  3J7A 5;  4BBS H;  3AYH B;  1XNQ L;  3RZO H;  4DAM A;  2KHI A;  4JI3 L;  4DUZ L;  4HIO A;  3S1Q H;  1SFO H;  2JA8 G;  4H02 A;  4A93 H;  3HKZ G;  1X56 A;  4KHP Q;  3KOJ A;  5AJ3 Q;  4HJ5 A;  1I6H H;  2JQO A;  4AH6 A;  1K8G A;  4A3M H;  4YY3 L;  1TXY A;  2JA5 H;  4X65 Q;  5IYB H;  4XTC S;  2UU9 L;  1J6Q A;  4DR2 L;  3PF5 A;  3PIO A;  1ASZ A;  4L5T A;  4L5Q A;  5IYD H;  2ES2 A;  4A3I H;  1Z9F A;  2V1C C;  4YCU A;  3STB C;  2ZJP A;  2ALY B;  1K8A C;  3J81 j;  1VCI A;  5BR8 L;  4A3C H;  4DR7 L;  3BJU A;  4MNO A;  3ULP A;  5GAH C;  5J3B A;  3U58 A;  2JJQ A;  3B6Y A;  1PH2 A;  1JE5 A;  3M4Q A;  1PH5 A;  4BA1 I;  5IP9 H;  1YHB A;  4HIK A;  3H3V I;  3PUZ A;  5FJ8 G;  1I94 L;  1QUQ B;  4X66 L;  1V43 A;  5LMN L;  2IHF A;  4B3R L;  1V9P A;  1WJJ A;  4R4T A;  1XNR L;  1N36 L;  4AYB E;  2Q2H A;  1HR0 L;  1VQO A;  1L1O C;  3GTK H;  4P72 A;  3G71 A;  1VQD A;  2KCT A;  2K5N A;  4HIM A;  1NJI C;  2R92 H;  4KI0 A;  1Q1E A;  5C44 H;  4DV6 Q;  4OWT B;  5LMU L;  1E1T A;  3A5U A;  4O2D A;  2MFI A;  4P75 A;  1J5E Q;  1L2F A;  4NXM L;  4B3S Q;  5GRO A;  3D31 A;  2UXD Q;  4LFB L;  1S40 A;  3KDF B;  1AE3 A;  1B8A A;  3Q8D A;  2VUM H;  3H3V H;  1GVP A;  1CKN A;  4JYA L;  1X3F A;  2LSS A;  1D8L A;  4BBR H;  3PUV A;  4Y7N H;  4BY1 H;  4GOP B;  2A1A A;  1TWA H;  1PH8 A;  1XMO Q;  1GD7 A;  3CCV A;  4DV4 Q;  2CKZ B;  2I5M X;  2XTI A;  1JJC B;  4JI4 Q;  2PNH A;  1KRT A;  3M4O H;  1TWF H;  4HJ7 A;  4IFD J;  3E9I A;  1HNX Q;  3KYH C;  1N8R C;  4DUY Q;  1SMX A;  2R93 G;  1U5K A;  5C4J H;  4A3E H;  1HZ9 A;  2E5L L;  2GN5 A;  1X55 A;  1XPO A;  1CSQ A;  1RL2 A;  5GQO A;  4LUZ A;  4X62 Q;  2NVQ H;  3M7N A;  2K5V A;  3S2H H;  1ASY A;  4Y52 H;  4LF5 L;  3I2Z A;  3RN5 A;  3L2P A;  2MNA A;  2KEN A;  2E2J H;  1A62 A;  4QQB X;  2LXK A;  2JA9 A;  3TRZ A;  4UP8 A;  2HIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...