3KDFA

X-ray crystal structure of the human replication protein a complex from wheat germ cell free expression
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 14 kDa subunit
publication title X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression
rcsb
source organism Homo sapiens
molecule tags Replication
total genus 23
structure length 115
sequence length 115
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kdfA00
1L1OA 2VQFQ 2HIXA 4A75A 3HOUH 2B63H 3A0JA 4A3MH 3HKZG 1CKNA 4AH6A 2JA5H 2UUBL 2YTYA 4PG3A 3RNUA 4DV0Q 1G6PA 3AQQA 2AKWB 2I5LX 1KXLA 3SGIA 1VQFA 4LFAL 4Y52H 2HHHL 4DR3L 3KJOA 2K5HA 2RHQB 4JC0A 4X65Q 4GOPC 1PH4A 4LFBQ 3CMAA 4X6AH 4QY7A 4QGUA 3F1ZA 2Q2IA 1KIXA 4DV7Q 1Q86C 2VQEL 2JA7G 1VQDA 2CWPA 3JAMc 1IBKL 1I3QH 2AHOB 2K5VA 2ZJPA 2KHJA 4IOAA 3AFQA 3RLOA 5JJIA 2F3IA 4TVAB 1N32L 3A5UA 4X62L 2ES2A 1K3RA 1JJGA 4AYBE 2N78A 4DPGA 5J3BA 5LMUQ 3ZJYC 5JEAG 3CC7A 3HOVH 3S1MH 3KOJA 2GVBA 4KHPL 4LFCL 3CCQA 4BA2I 3S2HH 3GTOH 4JI1L 3PIOA 2H5XA 1HNZL 4A3GH 4A3FH 1YJWA 1EOVA 1EWIA 4DV5Q 3CCEA 3HOUG 4GLAC 2PMZE 2K14A 4MTNA 1B70B 3HFZB 4P72A 1PH6A 2JA5G 4IFDI 4R4QA 5IT9c 1VQ7A 4OWWB 1SRUA 4MZ9A 1IYJB 4A4IA 1T9HA 1JE5A 2ZTEA 3PUZA 1BKBA 4K0KQ 5M5XH 5M5YH 5EAYA 3PUYA 5M3FH 3I4NG 1HR0Q 5FLXc 1FJGQ 3CCSA 4GKKQ 3OTOL 3E9IA 4L5SA 1BBUA 1LM0A 1RIPA 4HJ8A 4DR5L 4LF6L 4LF6Q 2KCTA 4MNOA 4C3IH 1NBWA 3CQZH 1XPRA 2HIVA 1TWHH 4OONA 1FVIA 2Q2TA 2UXDL 3CD6A 1YITA 1K0RA 1E3PA 4DR6Q 3S1QH 2Y0SG 5ELOA 4BBSH 1E1OA 1XTDA 2UU9L 3HOVG 2R93G 3G48A 5C4XH 3J81c 4A3GG 4LF8Q 4A3FG 4AQYQ 4GNXA 1PH7A 2QGQA 4OWTB 3T1YL 1YIJA 4KLKA 3EIVA 2I5MX 5GROA 3U58A 4A3KH 4IJLA 1EIFA 5C0XI 4HIOA 2E5LL 2R92G 2YTVA 3K81C 2A19A 3A74A 3M4QA 3PUVA 4GS3A 5IYDH 4AIMA 2GN5A 1UE7A 1KC8C 5JJKA 2VZAA 3K0XA 2LSSA 3CPWA 4UPAA 2EXDA 5GAEC 4A3DH 4O0AA 4POFA 3STBD 3T1HL 3E9HA 1I50H 2VUMH 3UE0A 2PQAA 1HNWL 1X56A 1RL2A 4IPCA 4JOIC 4JI7Q 4RG1A 4DR2Q 4AYBG 1NMGA 1HZ9A 1N33L 1YBYA 1PH8A 1AE2A 1WOCA 3ULPA 3GTJH 1N8RC 4IPHA 3CAMA 1M90C 1I6HH 5GAHC 3W5OA 3UE1A 4BBSG 3GO5A 4UY8C 3Q8DA 4JI4Q 3M3YH 2R7ZH 2XTIA 4LUOA 3LGJA 3PF5A 3UDGA 3KF6B 2UUCQ 3HOYH 1LTLA 3RLNA 4JI5L 1CKOA 4HJ7A 3GTQH 2JA6H 2K52A 1UE5A 2OQKA 1Z9FA 3IRBA 4JI3L 4GN4B 3ULJA 1GD7A 4YCWA 3AYHB 2JJQA 2EIFA 2IX1A 4OO1I 3UDIA 4DAYB 2WB1G 4GLVB 1YHBA 1HR0W 4C3HH 4YCUA 4O2DA 5C0XG 4DV2L 3BU2A 1IBMQ 1XNRL 2WAQG 5JEAJ 1EUJA 1NE3A 3FHWA 4HIMA 2F4VQ 2K50A 4LF4L 3S14H 2MQHA 3KYHC 1YJNA 2WP8J 5IWAL 4GKJQ 2JQOA 2K4KA 2WFWA 4DV6L 1A8VA 2NZHA 3M4PA 1X54A 4APVA 4NB3A 2RHSB 2E2JH 1A62A 4UP8A 3RZDH 4DUYL 4LF5L 1OTCA 1HZAA 3MEFA 2R7ZG 2UXCQ 5IYCG 4B3TQ 1K83H 4YHHQ 1YHQA 4JI0L 1QVGA 2ZTDA 5C3EG 1X3FA 4A93H 1JJCB 2VQFL 1PFSA 3GTMH 3B6YA 5HY6A 3ER0A 4ALPA 1QZHA 2IX0A 3S1NH 3RR5A 1X9NA 3PCOB 3U50C 4A3EH 2UUAQ 4DV0L 4DV3Q 1FL0A 1PH1A 2NZOA 4GN3B 4IPDA 1E1TA 2CWAA 4A3LH 4PZ7A 2MFIA 3PO3H 4BXXG 4DV4Q 4X65L 3AEVA 3CCRA 3DLLA 4A76A 4LFBL 4BBRG 1PH5A 1SE8A 4DV7L 3CW2C 4X64Q 4X66Q 1GO3E 3U4ZA 5BR8Q 4IPGA 1Q82C 1N36Q 1XPUA 2UXBQ 4OO1G 2OCEA 4JBWA 3KF8B 3HOXH 3CCUA 4A3BG 3RN5A 3W1GA 3GTPH 4JI2Q 5LMUL 2K75A 2KHIA 3H0GH 5M3MH 3CPFA 3G4SA 4HIKA 1TWFH 4JI8Q 5IY0A 1VQIA 4NXML 1U0LA 4NXMQ 1J6QA 2YYZA 4DV5L 5AJ3Q 4YWLA 4IJHA 2RCNA 2B63G 4IFDJ 4A3MG 1YI2A 4R4OA 3CCMA 4A3LG 4DR4Q 4GOPB 2PNHA 4K0KL 4YY3Q 1QVCA 1NJIC 1MJEA 4LUZA 1VQ8A 4A3JH 4YWKA 1UE6A 2L15A 1HR0L 1FJGL 4GKKL 2IT1A 2JA9A 1PH3A 3FKIH 3PF4A 3CCJA 1C7YA 1K73C 2V1CC 1QZGA 3U4VA 2CFMA 2ATWA 3K80C 1HJPA 1J5EQ 2EQSA 2N8NA 5LMNQ 3HOXG 3TREA 3I4MH 4DR6L 2AMCB 1VQBA 5FJ8H 3KF6A 3PV0A 3CF5A 2Z6KA 4DAMA 3CXCA 3H0GG 5M3MG 5IE8A 1Q12A 3TEHB 1GVPA 1NMFA 2KENA 4P74A 4LF8L 4AQYL 1AE3A 4HJ9A 1Y1VH 1YVCA 1QUQB 4R1JA 4BY7H 5C0XJ 3FP9A 4TQUS 4DUZQ 2YU9H 4JI6Q 1VCIA 2AWNA 1N9WA 4LF7Q 3AFPA 3I4OA 5FLMH 5M3FG 1HZBA 4YWMA 4A3JG 1EFWA 3D31A 1EIYB 2DGYA 1LUZA 2DUDA 1VS0A 1XJVA 5HGQA 3EN2A 4HIDA 2GVAA 3FKIG 3KJPA 5E7NA 4IOCA 1PH2A 4DNIA 4OXPA 1JMCA 2ASBA 4NXNL 1KL9A 2N49A 1YEZA 4P71A 1SR3A 4JI7L 3STBC 4DR2L 4NXNQ 1BVSA 2RF4A 1N34Q 4J15A 2NVTH 4B3MQ 3I4MG 3TQYA 1IBLQ 5FJ8G 2ZM6Q 4Y7NH 5ELNA 3K7AH 4KI0A 4JI4L 4GLXA 5C4XG 3H15A 4JYAQ 3PUXA 5H1SE 1NY4A 3KDFB 1Q1BA 1SLJA 1I94Q 2UUCL 5DLQE 4GNXC 2BH2A 1XNQQ 3L0OA 3HKZE 4LUVA 1PYBA 2ALYB 1Y14B 5GAGC 5IP7H 1VQAA 2JA8H 4KHZA 3CCVA 4A3KG 4DR7Q 1D7QA 1DGSA 3CC2A 1X55A 1VQ9A 3K8AA 4EQ5A 5IYDG 4UP9A 4DKAC 2Q2UA 1VQJA 1A0IA 2OTJA 4LF9Q 4JBKA 2NVQH 4A3DG 4OX9Q 1VQ4A 4B3SQ 1MIUA 4DK3C 5IYBH 1K9MC 4JV5Q 2VUMG 1XMQQ 1VQ6A 1IBML 4QJFA 2JEBI 4A3CH 2VW9A 1S72A 2F4VL 2NN6I 1OXVA 2LXKA 3J7ZC 3PUWA 4DR1Q 5M5WH 1XMOQ 4GKJL 4ME3A 1EQRA 4C3JH 1X3GA 1HNXQ 1TWAH 3HOWH 5LMNW 1K8GA 4WJ4A 1QVFA 2UXCL 3F2BA 3J80i 4B3TL 4YHHL 2A8VA 1CSPA 3BJUA 1V43A 2IY5B 2C35B 1Q46A 3ICEA 1E7ZA 3ULLA 3HOYG 1KD1C 2JE6I 5IP7G 4R4TA 2E2HH 4GOPA 1C9OA 2JA6G 3NEMA 4PMWA 3CC4A 1SROA 3PO2H 1Q7YC 3S17H 2K5NA 2N3SA 1S3OA 2B3GA 1B8AA 4QL5A 4DV1Q 1VQEA 3I2ZA 4DV3L 3I56A 2UUAL 1FGUA 1G51A 1X6OA 2HT1A 4L5QA 3GTLH 3K7UC 3MXNB 2VY3A 4B3RQ 4DV4L 2XGTA 1HH2P 1YZ6A 1VQGA 1KHIA 2IHEA 3WWVA 3JC66 1UEBA 4LNQA 2QEXA 1V1QA 3G71A 2R7FA 2BA1A 4X66L 3A5ZB 4X64L 5BR8L 1N36L 2UXBL 3BZKA 2ZTCA 3F2DA 1W3SA 3M85A 1TWGH 3RLFA 5K36G 5JJLA 1X3EA 1ASYA 4JI2L 2JK8A 3OW2A 3J7A5 2UUBQ 1H95A 2CKZB 2PI2A 1SMXA 2NN6G 1SN8A 1QUQA 5C4JH 3L7ZC 4JI8L 2FXQA 3GDEA 3RZOH 4A93G 2A1AA 4GN5A 1L1OC 2NVXH 4LFAQ 3JAMi 3BZCA 5AJ3L 3TS2A 2HHHQ 4DR3Q 3I4NH 3PO2G 3RN2A 1PVOA 1Q81C 1Y1WH 4EX5A 1P8LA 4A3EG 1P16A 2Z0SA 2VQEQ 1EQQA 1IBKQ 1LYLA 2ID0A 3CCLA 1EYGA 4DR4L 1VQHA 2I0QA 4YY3L 2Q2HA 2E2IH 3PO3G 1E22A 3ERSX 2E8GA 1PYSB 3TS0A 1Q1EA 1VQCA 2YTXA 2VL6A 1E24A 4PZ8A 1N32Q 4X62Q 2D62A 1U5KA 4H02A 3J81j 2MO0A 3S1RH 3HOZH 1KQSA 2R93H 1JB7A 4L5RC 4JCVE 4KHPQ 4LFCQ 5GADC 1OXUA 2OQ0A 1J5EL 4JI1Q 4P73A 4C2MH 1HNZQ 2LXJA 5LMNL 1OXSC 2KCMA 3KDFA 1UWVA 4FDBA 1VQMA 1L1OB 2R92H 2HQLA 5C44H 3NBHB 3GD7A 1WFQA 3W1BA 2B29A 4JG2A 4PZ6A 4XIGS 2ZJRA 4DK6C 4OWXB 1CKNB 3F2CA 2ZJQA 1IXRA 3H3VI 1NTGA 2CQOA 1HZCA 1WCMH 3E0EA 3M4OH 2D0OA 1Y1WG 3OTOQ 1TXYA 4DR5Q 3S15H 1OXTA 4RMFA 4DUZL 2PI2E 4JI6L 2WB1E 1KRSA 1ASZA 2R7DA 4JOIA 4BA1I 1JJ2A 4LF7L 2UXDQ 1WJJA 1L2FA 2WAQE 1X65A 4P75A 3J81i 1VQOA 1C0AA 3HKSA 3F8TA 3HOZG 2D0PA 2UU9Q 3CP0A 1I5FA 2NVYH 1N34L 3OYYA 4B3ML 1BBWA 1UE1A 2KBNA 1GM5A 4A3IH 4QQBX 3T1YQ 1IBLL 1V9PA 2ZM6L 2Z6KC 1TWCH 3S24A 5C44G 2E5LQ 1VQKA 2IHFA 1K8AC 4JBMA 1W2BA 3PIPA 1PV4A 4JYAL 4BY1H 1I94L 3M9BA 2MNAA 4LW1A 1MJCA 1XNQL 1WCMG 1Y1VG 2VS1A 4NPSA 3NENA 3TRZA 1Z47A 4BY7G 2QA4A 4DR7L 1B7YB 4IFDG 2BA0A 1GKHA 3T1HQ 1O7IA 1PA6A 3PGZA 1HNWQ 1M1KC 2MO1A 1G291 1KRTA 1PH9A 3NELA 4LF9L 5FLMG 3S16H 1N33Q 5IP9H 2CCZA 1VQLA 4OX9L 1VQPA 4B3SL 3UDXA 3I55A 1YNXA 3GTGH 4JV5L 1AH9A 1XMQL 4POGA 3H3VH 3I7FA 1MKHA 2AWOA 1L0WA 3L2PA 3M7NA 5IYCH 4DR1L 3CMEA 5GQOA 1YJ9A 1XMOL 1D8LA 4UP7A 1HNXL 4IO9A 5C3EH 4A3IG 3GTKH 3DM3A 1Q8KA 3G6EA 4JI5Q 3KLWA 3S2DH 4GNXB 1XPOA 1VQNA 1KAWA 1A63A 4BY1G 1PHJA 1YHAA 4JI3Q 4HJ5A 1IZ6A 2F52A 4HJAA 1CUKA 1VQ5A 1IL2A 1WYDA 4R4IA 2JA8G 3J80c 3KFUA 4WJ3M 1WI5A 4BXXH 4DV2Q 1CSQA 4JBJA 1CKMA 4XTCS 4BBRH 2R6GA 1XNRQ 4R4CA 4DV1L 2I5HA 4LF4Q 2JA7H 5IP9G 5IWAQ 1OXXK 2PQAB 2JEAI 2BH8A 5IYBG 4DV6Q 1R9TH 1S40A 4B3RL 3PSIA 3D0FA 3EBEA 4DUYQ 4LF5Q 3VDYA 4A3BH 4A3CG 1SFOH 2VNUD 4LWCA 4L5TA 4YCVA 4JI0Q 1JT8A 2YV5A 2Y0SE 2OTLA 2OWOA 4QIWE 3HOWG 3UDFA
chains in the Genus database with same CATH superfamily
1L1OA 2VQFQ 2HIXA 2C9OA 4A75A 1Y1WB 4A3MH 3HKZG 1CKNA 4AH6A 2JA5H 2YTYA 1G91A 1CT1D 1H9MA 2I5LX 3SE0A 4Y52H 4A3JB 4X65Q 3A8JE 5C4ZA 4KY6A 4LFBQ 5IOCA 5IGFA 1B9NA 4QY7A 3CRLC 2TMPA 2K5WA 3F1ZA 3OPOA 3I70A 1NNXA 1QNUA 2CWPA 1IBKL 2K5VA 2ZJPA 1BBXC 4IOAA 5JJIA 4TVAB 3A5UA 4X62L 5ELFA 1FYCA 4FF1A 1W6JA 5LMUQ 5JEAG 1GUSA 2K03A 2GVBA 4RGMA 4KHPL 3DWPA 4JI1L 2EYPA 3PIOA 4GLAC 2PMZE 3I73A 1B70B 4MTNA 4IFDI 3QWNA 4R4QA 4KJNA 4A4IA 3J7YW 2Z1CA 2RDFA 4K0KQ 1EEFD 3TZUA 2WINB 3P75A 5M3FH 3I4NG 1SYBA 1EU3A 4L5SA 1TT2A 1BBUA 1RIPA 4LF6L 2KCTA 4MNOA 4KY5A 1NBWA 2NVYB 2HIVA 2Q2TA 4KN7C 1E3PA 2DN8A 1TWCB 4BBSH 1E1OA 5KRUA 2UU9L 3HOVG 3G48A 4KKUA 1I4HA 2F0WA 2EJGC 3P1HA 3T1YL 5JAVA 1YIJA 3EIVA 4KJOA 4CDCC 3SVMA 1EIFA 4HIOA 4QMGA 2YTVA 3MHBA 1B1ZA 1WTOA 3CPWA 2EXDA 1KAAA 1PRTB 3STBD 3S9WA 3FVQA 2VUMH 1HNWL 4C3IG 1RL2A 4PV1C 4JOIC 3FDTA 5M5WB 4AYBG 4C3JB 5BN4A 1N33L 1AE2A 1WOCA 3NHHA 1N8RC 3NTKA 1H9KA 4FXKC 4ZLTF 1PDQA 3GO5A 2NBFA 2QF7A 2R7ZH 4LUOA 4I65A 1QOHA 3OIPA 3KF6B 1W6KA 3HOYH 1LTLA 2E2HB 1JB3A 1CKOA 4ZKBB 4HJ7A 1A15A 5KYIA 1UUPA 2EXZA 2OQKA 4PMBA 4DAYB 4XDXA 3M7GA 2CQAA 4C3HH 5C0XG 3K58A 2Z9HA 1Z7TA 1TU2B 2K50A 2MQHA 3KYHC 4GKJQ 2K4KA 2WFWA 1A8VA 2NZHA 4L8JA 3NTHA 2EE1A 3D6CA 2UXCQ 5IYCG 1PZKD 1II3A 3WOEA 1KTKA 2ZTDA 3OMCA 1HXYD 2VQFL 1PFSA 4RAUC 2DJGC 3HRZC 4B9WA 1G2SA 1QZHA 1X9NA 1MHWC 4EVOA 2NB0A 2NZOA 4IPDA 4PZ7A 1B3AA 2MFIA 4BXXG 3VR3A 4X65L 2M9VA 1LTGD 4LFBL 4BBRG 3QO2A 3EVQA 2R93B 3CW2C 4X66Q 3U4ZA 4IPGA 1Q82C 4DF7A 4OO1G 2OCEA 5G3LD 4PMCA 3W1GA 4JI2Q 5LMUL 2KHIA 5M3MH 4G4KA 4HIKA 2YYZA 4YWLA 4IJHA 4FO2A 2B63G 4IFDJ 4WFN3 1S5FD 3NQTA 3CCMA 4K0KL 2NTTA 1MJEA 1QVCA 5JPMC 2PNRC 3S1QB 4A3JH 4YWKA 1JWMD 3D4RA 1Y8OB 1ZEQX 2IT1A 2JA9A 2M00A 4G7HC 3CCJA 1EY4A 1D1KA 2EYOA 2V1CC 1SBBB 2EQSA 2EYJA 4CHTB 5LMNQ 3QJYA 3TREA 3HOXG 1VQBA 3KF6A 2OXPA 1KDAA 2A74C 1Q12A 3BG3A 4P74A 1EEID 3SK5A 5JPNC 1AZQA 1JICA 1QUQB 1PRTD 1EZ8A 1F9QA 2WAQB 4DAYA 1VCIA 4IZ8A 3S16B 1N9WA 2KQ3A 2XRQD 5FLMH 3NTIA 1EIYB 2PW7A 1I6HB 1XJVA 3H3VH 5HGQA 4HIDA 4ZUJA 4ZCKA 3ITPA 4IOCA 4OXPA 2EYHA 1JMCA 2N49A 2K5DA 1O7YA 3E3XA 1LTAD 4CDEC 1R4PB 2ZM6Q 2B2WC 4GLXA 5C4XG 3H15A 4JYAQ 1NY4A 2E76C 3KDFB 4L6TB 4GNXC 4H44C 1WTPA 1XNQQ 1QWYA 1PYBA 5GAGC 3PIO3 3IKJA 3FEWX 1VQAA 4KHZA 3CCVA 1H9RA 4IUNA 1X55A 3K8AA 3QB3A 5IYDG 2Q8TA 4DKAC 1EOTA 4FXDA 2NYZD 1VQ4A 1MIUA 4JV5Q 1KABA 1SFOB 2JEBI 1XTCD 4A3CH 1S72A 1OXVA 2LXKA 2ZXOA 3DWAA 3I8ZA 5M5WH 5I2XA 5DNFA 4GKJL 4ME3A 1AFPA 3QR8A 1CM9A 4C3JH 3J7AF 5LMNW 3HOUB 5KNDA 2F0UA 1GJXA 3QOLA 4WJ4A 4CJ1B 1QVFA 2UXCL 3J80i 2A5HA 2RQXA 5CYUA 4K14A 2A8VA 2XWJB 2C35B 3P7JA 3ULLA 2HCCA 4H13C 2E2HH 1CA6A 3A7AB 4RGOS 3ONAB 3AB9A 1Q7YC 1S4ZA 3IFTA 1JQYD 1I3QB 2F0HA 4EGVA 3NSWA 4HN7A 3K7UC 4OHJA 2K01A 1K8OA 2VY3A 1YZ6A 3FPUB 4LNQA 1UEBA 1V1QA 3S1MB 4X66L 2BA1A 3S2HB 2NUCA 5I2YA 5IODA 1K8MA 4A3FB 1TKWB 3K6OA 1TWGH 2AQ3B 3K5OA 5K36G 1X3EA 1ASYA 4JI2L 2UUBQ 1SN8A 1QUQA 3NWSA 2FXQA 3RD4A 5M5XB 4A93G 1JR0D 2RDHA 4LFAQ 2Z4HA 4DR3Q 3PO2G 4XXEA 3RN2A 3F2UA 1Q81C 2A6ED 1F2ZA 1V8QA 4IUQA 3CCLA 2ID0A 1STHA 3ERSX 1PYSB 1N32Q 1Q1EA 2YTXA 1E24A 2K28A 2KHSA 1H9SB 2KA7A 3J81j 3T53B 2MO0A 2R93H 1OO9B 5GADC 2QW7A 2OQ0A 4P73A 1HNZQ 5LMNL 3PQIA 1E2VA 5LL6S 3KDFA 1UWVA 1VQMA 1CTMA 4N9TA 1ESFA 1ENFA 2K7VA 1WFQA 1BF4A 2RKSA 3G6JB 4JG2A 4XIGS 4KV6A 3F2CA 1RTOA 1NTGA 2CQOA 2F0KA 4ODGA 1ET9A 3MFGA 4CKEA 4IFDH 3K0YA 1OXTA 4RMFA 4IUUA 2PI2E 1ASZA 2R7DA 4R9WA 1E2ZA 1L2FA 1T5XD 5T1IA 1NCVA 3K7AB 3C2PA 1G6ZA 2LMCB 1STBA 1LT5D 4DK1A 3OYYA 2KBNA 1JCKB 1GM5A 4QQBX 2HD3A 4Q0FA 2ZM6L 2JA6B 2AUJD 1W2BA 4JYAL 2RBMA 4BY1H 3M9BA 2PCFB 4LW1A 3LWEA 1XNQL 1JC7A 4NPSA 2CW0C 1PA6A 5E3FA 1M1KC 2MO1A 1G291 2E75C 3NELA 3S16H 1VF5C 1VQLA 3UDXA 2E2JB 4JV5L 1AH9A 3D4DA 2AUKA 3M7NA 2QCPX 3NK9A 4CGYB 4IO9A 3DM3A 1EYCA 1Q8KA 2IX3A 3S1NB 4P2CB 2B2YC 3QG1A 1XPOA 1VQNA 4A3EB 1KAWA 1A63A 1F9RA 2A73B 2F52A 3PO3B 1EWCA 4R4IA 1SMYC 2TSSA 4XTCS 5HGTA 1IKLA 1A2TA 5JOBA 5T1GA 2JA7H 1H9SA 3VYUA 2PQAB 2JEAI 5IYBG 3PMFA 4DV6Q 1Y69U 3EBEA 1R4QB 3VDYA 1ZKOA 1SFOH 3H0GB 3RZOB 1HHVA 3URYA 3H94A 3HOWG 3HOUH 2UUBL 4PG3A 3RNUA 5EKKA 2F0FA 2AKWB 1KXLA 1PZID 3SGIA 4LFAL 4DR3L 1FNWA 2K5HA 4GOPC 4OELB 3HOZB 1RDPD 2FJ2A 1Q86C 3FMCA 1LTSD 1CHPD 1ILQA 1I3QH 2M2LA 1DCZA 1N32L 4RFBA 1TIID 2ES2A 1K3RA 4AYBE 2N78A 4DPGA 5ELBA 1LTTD 4KK7A 3CC7A 3S1MH 3S2HH 1NAPA 2XWBB 4EQPA 1HNZL 1GUGA 1Y1VB 4A3FH 1YJWA 1EWIA 4DV5Q 2JA5G 5EGTA 3HEJA 1YNJD 1VQ7A 1SRUA 1JE5A 3BYTB 2EYLA 2LKVA 5M5XH 5TSSA 5FLXc 1MGSA 3E9IA 1LM0A 4HJ8A 1TS5A 4LF6Q 1CFMA 4HAEA 5IGDA 2NVTB 1EIGA 3CD6A 4A3IB 1WTQA 2Y0SG 5C3XA 2HDLA 4HSPA 5CV8A 5F2DA 2F03A 3J81c 1PH7A 2JA8B 3EA6A 4OWTB 5GROA 2R92G 2DY7A 5C0XI 4MN3A 3A74A 2F0VA 1DXMA 4AIMA 3T16A 2GN5A 5KNCA 2VXWA 4J8QA 2VZAA 3K0XA 1X3QA 1WTWA 1GXDC 4UPAA 3GTGB 3X3MA 2KUMA 2PQAA 1RTNA 2N55A 4RG1A 4DR2Q 1YBYA 1TWAB 3GTKB 4F87A 1B3QA 4BBSG 3OIQA 2B2YA 3HKZB 2XTIA 3LGJA 4IURA 2CW0D 4Q5VA 2SNMA 4FNFA 5J39A 2JA6H 2ICIA 1UE5A 1Z9FA 1GD7A 2LY7A 3AYHB 3TSSA 3GTLB 4OO1I 2LFNA 4GLVB 1YHBA 1FD7D 3Q23A 2KCCA 2F0GA 5JEAJ 4HIMA 4CKBA 2ZXRA 5D14A 2WP8J 4RCNA 1GUOA 1U4PA 3C1EA 1F9SA 4ME5A 4DV6L 1MI2A 4HTHA 4NB3A 4LJZC 2E2JH 1JOOA 2BE5D 4XQQA 1OTCA 1HZAA 1EL0A 2B2VC 2R7ZG 2K05A 4O42A 1S5BD 1HQMC 4L63B 1QVGA 1X3FA 1JJCB 4HMJA 4OEMB 3OMGA 3I4NB 4U68A 3B6YA 4ALPA 3S1NH 2A6HC 1C4QA 4A3EH 2NTSA 4DV3Q 4GN3B 1SSOA 4K8JA 3BDOA 2IPKD 3GTQB 3PO3H 4DV4Q 3AEVA 3DLLA 2F0IA 5EBDA 3CU7A 3S1RB 1Q3LA 1SE8A 3BVMA 4K2LA 1U4RA 1SE3A 5IIFA 4X64Q 1EIHA 3GTOB 2UXBQ 4JBWA 3CCUA 4F8MA 3BDCA 4KTAA 2K04A 4RWSC 2K75A 3H0GH 1KLUD 5IY0A 1D5MC 5M5YB 1HA5A 2E2DC 3M4OB 1J6QA 1WCMB 4DV5L 1XX8A 3A56A 4C3IB 3MC0B 4DR4Q 4DAPA 4LUZA 5FLXE 4KD3A 3NWTA 2RDGA 1PH3A 3PF4A 4ZQ3A 1QZGA 3K80C 1QILA 2QDLA 2EY5A 2XSCA 3EFXD 3T13A 5FJ8H 5M3MG 3J81E 1IYVA 1B9MA 2KENA 3V96A 4HJ9A 1Y1VH 1LLRD 1YVCA 4JVZA 1TR5A 5C0XJ 3HP3A 2IWHA 1STAA 1O7LA 1E0BA 4LF7Q 3X3NA 1HZBA 4YWMA 4A3JG 1EFWA 2DGYA 1LUZA 2DUDA 3KK7A 4QB4A 1PH2A 1CZGA 1NR4A 2ASBA 4DR2L 4G7ZC 1N34Q 4J15A 3HS0C 2CHBD 4B3MQ 2NVTH 3TQYA 1IBLQ 2B2TC 4K5VA 2JP1A 3LX0A 2AQ1B 1U9RA 5EKIA 1Q1BA 1SLJA 4X3KA 3IFDA 3V2TA 2KECA 5IP7H 2JA8H 4A3KG 4DR7Q 1K0SA 1V1PB 4BBRB 2OTJA 4OIJA 5ELDA 4LF9Q 4A3DG 3E6ZX 4GZYC 5CR3A 3RUZA 1TVXA 5K5PA 1K9MC 3D8GA 1VQ6A 4QJFA 4X3TA 4ZUIA 3PUWA 1C48A 1XXGA 4DFAA 1IW7C 1ZXTA 4NW2A 1TWAH 3GTMB 2HUGA 2B63B 1K8GA 1X3PA 2NN6H 1BR9A 1KD1C 2JE6I 4R4TA 2B8GA 2A68D 5JVG3 4ID6A 2F3WA 3NEMA 5EKLA 2N3SA 4HEDA 1B8AA 4DV1Q 1VQEA 3I2ZA 4DV3L 1DONA 1SYEA 4L5QA 3GTLH 2DY8A 4DV4L 2XGTA 2EVBA 4UAIA 2KEEA 5CBEE 3Q24A 4X64L 5JEAH 3A5ZB 2CH4W 2UXBL 2A6HD 1SNCA 3K59A 2K6AA 4FF4A 1D5ZC 4A3GB 2ZTCA 3F2DA 3M85A 3RLFA 2OF1A 3Q6SA 5JJLA 2B39A 1SNDA 5E1FA 1H95A 2SEBD 1ONLA 3L7ZC 5J1ZA 2A1AA 2L9HA 3JAMi 3O13A 3H09A 3I4LA 3I4NH 4K6DA 1Y1WH 3NBIA 1NR2A 3LWUA 1I4RA 1SNOA 3CQZB 1EQQA 1LYLA 4DR4L 4NKLA 5FLXL 2I0QA 3OWEB 2BCOA 3GTQH 1VQCA 2VL6A 4PZ8A 2KVMA 4ZAIA 3SR1A 3S1RH 1D5XC 1KQSA 2HCIA 5J22A 1JB7A 4JCVE 2KEDA 2PMZB 5C4XB 4LFCQ 2L0CA 1PTOC 1WTRA 3NE5B 1GUNA 2WACA 3J81L 3NBHB 2B29A 5EPKA 2ZJQA 1V1PA 1IXRA 3M4OH 1KNAA 1WCMH 3CHBD 1D6EC 2D0OA 4KMUC 4X3UA 4DR5Q 5DEHA 4RGTA 2WB1E 1KRSA 2FFKB 4JOIA 4BA1I 4XQJA 4LF7L 1GUWA 3GTJB 1ZYRC 1X65A 4Y7NB 1C0AA 2V4DA 1AZPA 3F8TA 4XYOA 2WV6D 2D0PA 5AFWA 4KN4C 5D3DA 3ZYYX 4H0LC 2NVYH 1TS4A 2H1EA 4DU9A 1N34L 4B3ML 1BBWA 3DMUA 1UE1A 1B4OA 1IBLL 4ZYSA 4HMIA 2Z6KC 1TWCH 3MWYW 1TQOA 1VQKA 4JBMA 3K5MA 3A8IE 4RGNA 1MJCA 2VS1A 3NENA 4RHSA 1Z47A 4BY7G 3WOFA 4DR7L 1B7YB 1F2YA 1JE4A 1M4VA 2BA0A 4EQNA 5BN3A 4IFDG 5C0XH 4XQNA 3S14B 1PH9A 5KEEA 4LF9L 3GV3A 5IP9H 2JXMB 2CCZA 1O78A 3RZDB 1CI3M 5FKAC 4POGA 2HQEA 1MKHA 1EY5A 2AWOA 5FO8B 5CV9A 5IYCH 4X3SA 3UI2A 3CMEA 4A93B 1E2WA 3KLWA 3PO2B 2MJ8A 1HUNA 4GNXB 5E4XA 1SYCA 4BY1G 1PHJA 4JI3Q 4HJ5A 4O1NA 1VQ5A 1IL2A 1WYDA 3J80c 2X69A 1WI5A 4BXXH 4DV2Q 1FR3A 4BBRH 2R6GA 1LTID 1XNRQ 4R4CA 4DV1L 1SNMA 1DOMA 5IWAQ 1OXXK 2Z6BA 4TRDA 4WJWA 2X6GA 2QILA 4LF5Q 1NSNS 3T51B 3GTPB 4LWCA 5EQ0A 4JI0Q 1CHQD 1JT8A 2Y0SE 1BCPC 2PZUA 1CK1A 4QIWE 3UDFA 2RVLA 2Q8RE 3NBHA 2XNAC 4HCEA 2O4XA 5EPLA 4FYDA 2B63H 1QB5D 1LTBD 2MGSA 3SK8A 4DV0Q 4U673 1HFGA 1WVLA 3MAQA 3AQQA 4MIUA 2C5CA 1VQFA 2VB3X 2RHQB 4JC0A 1PH4A 3FKIB 2EY1A 4X6AH 1ENCA 2Q2IA 2F0QA 2JA7G 1FGBD 4HSVA 2IJ0A 4DGZA 1CQVA 3RLOA 3VYTA 3I4MB 5I9PA 2F3IA 3SK4A 1SDFA 3NUCA 3TDQA 2O5JC 1JJGA 5J3BA 3VYSA 2KOLA 1TY0A 3I90A 4CJ2C 4LFCL 3CCQA 4BA2I 2H5XA 4A3GH 3HOUG 3CCEA 4ABNA 1QG7A 1PH6A 3HFZB 1LTRD 5IT9c 4OWWB 2YU9B 1IYJB 1T9HA 1JOKA 3PUZA 1JORA 2ZT9C 2EOTA 4RCOA 5EAYA 1HUMA 2DJFC 4UDUC 4DR5L 3H6MA 3NP8A 1TS2A 3CQZH 5DM63 1FVIA 4FXGC 1YITA 1K0RA 3S1QH 4TKOB 1MD2D 5ELOA 1Q90A 1XTDA 4OGQC 3L3OC 3MA2B 2B2WA 5C4XH 4LF8Q 4A3FG 4GNXA 2I07B 2I46A 1ML0D 3U58A 3BDLA 2D2CC 2H4OA 3K81C 5IYDH 3M4QA 4C1NK 1HRJA 2NVQB 1UE7A 1KC8C 3NPPA 2DNEA 2HDMA 5GAEC 1IL8A 4POFA 1IHZA 1GHJA 2QKIC 4LMQD 3HG9A 1XYIA 1NMGA 1HZ9A 1PH8A 3HOWB 3ULPA 3GTJH 4IPHA 1I6HH 1A3VA 4XYQA 1X32A 3Q8DA 1VMCA 1F2MA 1HPCA 2MP1A 3TZDA 3T56B 4F88A 5ISRA 3PF5A 2JN4A 2E74C 1STGA 2G5DA 3BYYB 4R8IA 1HQRD 3K5NA 2K52A 5HURA 4JI3L 4GN4B 3ULJA 4ILWA 3KBXA 2IX1A 3J80E 4IUPA 1BO0A 2WB1G 4YCUA 4O2DA 4DV2L 3VR5A 3BU2A 4E6IA 1XNRL 1I6VC 4KKTA 1EUJA 1NE3A 2F4VQ 3S14H 1YJNA 2F0MA 5IWAL 5CGKA 4K2KA 2JQOA 2BDOA 3M4PA 1X54A 4APVA 2RHSB 3RZDH 5JVH3 4LF5L 3AMUA 1VDZA 5K36H 2CVRA 1WTVA 1FNUA 4B3TQ 3A55A 1YHQA 4JI0L 3GV6A 1WTHA 5C3EG 1I4PA 3V05A 4A93H 5HY6A 3ER0A 3R8BA 2IX0A 2K1BA 2K32A 2PW5A 3PCOB 3U50C 2UUAQ 4DV0L 4ZRZA 1PH1A 3TP6A 4A3LH 1U4LA 2E2IB 2CWAA 5D65A 1Y8PB 1T5EA 3DEPA 5KIXA 4A76A 1UEAB 2PYKA 1DOKA 1N36Q 5BR8Q 3BZDB 4TSSA 3J7AV 1HFNA 4A3BG 1PXUA 5KNBA 2R92B 1MSGA 3GTPH 5C44B 5EBCA 2RSOA 4N8X1 1AP0A 1BQQT 5IGEA 2JYOA 1U0LA 4NXML 2RCNA 4A3MG 5IT9E 3S15B 1YI2A 1PTOF 1JWUD 4R4OA 5DM73 4GOPB 3SDZA 1NJIC 3E0JA 2L15A 1QJOA 1O80A 2J4XA 2PO4A 3FKIH 3N52A 1AEXA 3R93A 5L37A 1K73C 1C7YA 3U4VA 2F0DA 2CFMA 1J5EQ 2N8NA 2EPBA 3I4MH 2AMCB 4QF4A 4JW0A 5CV6A 1ILPA 4HR7B 2L55A 3H0GG 2D9UA 1PFBA 2IW3A 4LF8L 1DD2A 2WKDA 1PZJD 3FP9A 4TQUS 3SK6A 2YU9H 4JI6Q 2AWNA 5C3WA 3AFPA 5M3FG 4KHVA 2GVAA 1HTPA 3KJPA 1GUTA 2PQEA 3OHXC 2R7ZB 4DXGA 3TN2A 4NXNL 1KL9A 5C6AA 1YEZA 4JPBW 3STBC 3MXGA 4J1MA 5FO7B 5FJ8G 3TBIB 3K7AH 4KI0A 2L11A 3PUXA 5H1SE 1I94Q 2SNSA 4IQZA 2SDFA 4NP5A 4IALA 5DLQE 2BH2A 3L0OA 2KJXA 3I72A 2X6LA 1D7QA 2F0PA 1VMPA 2EDGA 1DGSA 3CC2A 1VQ9A 4UP9A 2Q2UA 2RSNA 1VQJA 1A0IA 5E4WC 3J80L 4JBKA 2NVQH 2F0EA 2ICEC 5IYBH 5COYA 2VUMG 4PQXA 4KKSA 2F4VL 4DR1Q 2R3ZA 3T4AC 3J7ZC 1EQRA 4CDFC 2A69C 1HNXQ 4S3SA 3HOWH 3FRPB 2O2LD 3TMEA 1PLFA 4B3TL 4UHVA 1CSPA 3BJUA 1SMYD 2K5QA 2N88A 3ICEA 1E7ZA 3HOYG 3KBGA 5IP7G 5I6YA 1BCPF 1C9OA 1ICFB 4GOPA 4PMWA 1FNVA 4BWGB 2K5NA 4QL5A 1ESRA 2UUAL 2HT1A 1G51A 1X6OA 1M8AA 4C3HG 3VA7A 4B3RQ 1HH2P 1YNNC 4RA8A 3WWVA 1RJTA 3HOVB 5M3MB 4K8IA 5BR8L 1N36L 1S5DD 3BZKA 2LS01 1W3SA 4K5WA 3BVGA 2OEOA 3MEHA 2JK8A 1EY8A 2PI2A 2NN6G 1IYUA 4NDXA 3RZOH 3GDEA 2SOBA 2F0NA 4GN5A 4PNYA 3SXHA 3VR4A 5IT9L 3BZCA 3TS2A 1PVOA 2HHHQ 1P8LA 3H3VC 1P16A 5CV4A 2VQEQ 2O5IC 5CBAE 1TWHB 2QDBA 1RHPA 2Q2HA 4AYBB 2E2IH 1EU4A 1E22A 3MZ5A 5A35A 1A3UA 3HOZH 2EY6A 1OXUA 3KLSA 1J5EL 1PFNA 1OXSC 4A3KB 4XT1B 1V1OA 2R92H 5C44H 1A3TA 1CZWA 1J9OA 4B9XA 3DXJC 4DK6C 4OWXB 1WD0A 4A3DB 1F77A 1Y1WG 1I50B 3OTOQ 2EJMA 3S15H 4JI6L 1PRTC 4MHEA 2B2UC 2UXDQ 1WJJA 5LHY1 4J6HA 2WAQE 1WTXA 1VQOA 3HKSA 1NUCA 3M3YB 4FP5D 3CP0A 1I5FA 2L5TA 3KLRA 1SYGA 3OOCA 1ET6A 4A3IH 3U9OA 3R2TA 2J7ZA 2E5LQ 2MUYA 3S24A 2IHFA 1K8AC 3PIPA 1PV4A 1I94L 2F0OA 1DJRD 2MNAA 5DAUA 3TP8A 1WCMG 5C5MA 2QA4A 3T1HQ 1GKHA 5FK9C 3M4YA 5JJZA 4RKLA 1MBYA 5FLMG 1PYWD 1BNZA 1VQPA 3I55A 1STNA 3GTGH 1ICWA 1SAPA 1K83B 2B2VA 1L0WA 3L2PA 4DR1L 3MTSA 4N9PA 4KD4A 5GQOA 1D8LA 4UP7A 1HNXL 5IGBA 3GTKH 1SE4A 3G6EA 4JI5Q 1B2TA 5KGUA 2L1BA 2G9HD 1LT4D 1J8IA 1EQTA 1CUKA 2J0TD 3KFUA 4CBVA 1UNSA 3C46A 1CSQA 2A69D 3EQLC 4LF4Q 5IP9G 3I91A 2BH8A 5C5LA 1TWGB 4DAVA 3HOXB 1S40A 4B3RL 3PSIA 3D0FA 2OT2A 4DUYQ 4A3CG 2VNUD 2MHVA 3SEBA 1TWFB 2OTLA 1DZ1A 4C3JG 2OWOA 2Q8IB 1KDBA 3MVVA 5I9OA 3A0JA 2L4NA 4CDDC 3A8KE 3KLSX 1G6PA 1YNND 1LACA 2HHHL 3NXWA 3KJOA 4G7OC 3CMAA 2F1MA 4IN3A 5M9OA 4QGUA 1KIXA 4DV7Q 2VQEL 1VQDA 3JAMc 2AHOB 2A6EC 2KHJA 3AFQA 1F9PA 1LV9A 4MTKA 1MSHA 2F0JA 1L0YB 3ZJYC 4LAAA 3HOVH 3KOJA 3TP5A 4I7AA 3GTOH 3AU7A 3G7LA 5KYLA 1EOVA 3Q22A 4BY7B 3W2DA 2K14A 4P72A 1KDCA 1SJED 4MZ9A 1EYAA 2KCNA 1EFID 2ZTEA 5CV5A 1BKBA 3EJIA 2B2UA 5M5YH 3VA5A 3PUYA 1HR0Q 1FJGQ 3CCSA 4GKKQ 3OTOL 4C3IH 1XPRA 4R8NA 4OONA 1TWHH 2UXDL 2F3VA 4DR6Q 2B2TA 2XRSD 4M1UB 1PTOB 2R93G 1S5CD 3E5SA 5A2QE 4DA2A 1PFMA 4BY1B 4ZKCB 4A3GG 4AQYQ 4QUFA 4RH6A 2QGQA 4KLKA 2I5MX 4A3KH 4IJLA 2E5LL 2ZXPA 4GS3A 2A19A 1TY2A 3PUVA 1KNEA 4HCSA 5JJKA 2LSSA 4A3DH 2D5DA 4O0AA 1STEA 3T1HL 3E9HA 1I50H 1Y8NB 3QOJA 3UE0A 4M8AA 1X56A 4IPCA 1CQFA 4JI7Q 4OIKA 3BVZA 3K5LA 1M90C 3CAMA 5GAHC 1C8CA 3DEOA 3W5OA 3UE1A 4UY8C 1SNQA 4JI4Q 2L12A 3M3YH 1LT6D 3UDGA 2UUCQ 3ND9A 3RLNA 4WRDA 4JI5L 3S17B 3IRBA 2JA7B 4YCWA 3VR2A 2JJQA 2EIFA 4RHRA 3UDIA 4DNRB 5ELEA 1HR0W 1PMRA 1IBMQ 1IW7D 1ENAA 2WAQG 3FHWA 2EYFA 2BDNA 2NWGA 1EYDA 4LF4L 4OO1H 4QUCA 3HGBA 1A62A 2P5ZX 4UP8A 1L0XB 4DUYL 4XT3B 4NMZA 5I4DA 4DXFA 3MEFA 1K83H 2K33A 4YHHQ 5C4JB 1G8ZD 1XWEA 2NVXB 3OWFA 2IL8A 3GTMH 1QE6A 1TS3A 5EJWA 3RR5A 3EROA 3RMHA 1IKMA 1FL0A 3PIP3 3C3LA 1G2TA 1E1TA 3CRKC 1GHKA 3DWQA 2WIIB 5G3LF 3CCRA 1PH5A 4DV7L 3JAME 1O7ZA 1GO3E 1XPUA 4C2MB 3U9SA 3WDNA 1D2BA 4N8FA 3C1FA 3KF8B 3HOXH 5CMDA 1BCPB 3RN5A 5I6WA 3ND8A 3VR6A 1DM0B 3SHLA 3CPFA 3VYRA 3G4SA 1TWFH 4JI8Q 3P20A 1VQIA 4DN4M 4NXMQ 5AJ3Q 4C1NI 2EJFC 1EZ6A 4A3LG 2FINB 1Q8IA 2PNHA 4YY3Q 2CH4A 1I4XA 1YNJC 1VQ8A 1HR0L 1UE6A 1FJGL 4GKKL 2FMCA 1PTOD 5EPJA 1BDOA 2ATWA 2XIWA 1AW7A 1HJPA 3ERQA 4DR6L 4IUTA 1PRTF 3A54A 5A2QL 3PV0A 3CF5A 2Z6KA 4DAMA 3CXCA 2BOSA 3A7LA 2RA4A 5IE8A 3TEHB 1GVPA 1NMFA 1Z6HA 4AQYL 1AE3A 5CC4A 2WB1B 3MFYA 2F4IA 4R1JA 4BY7H 1JOQA 1SXTA 1ZYRD 4DUZQ 3LNNA 3L9AX 3I4OA 3D31A 1VS0A 3EN2A 3FKIG 5FOBB 5E7NA 4CKCA 4BS9A 4DNIA 4NXNQ 4P71A 1SR3A 3TP7A 1F2LA 4JI7L 1BVSA 2RF4A 4JK1C 5C3EB 3I4MG 3DUZA 2JSOA 4Y7NH 3S2DB 5ELNA 4JI4L 5BN5A 4RKBA 4EQOA 1PTOH 2Z4IA 1SE2A 3FPPA 1VF7A 2B8FA 1SYFA 2UUCL 3GP7A 3HKZE 4LUVA 2ALYB 1RCVD 1Y14B 5CV7A 1HTLD 4EQ5A 1SJHD 3MXUA 1B44D 3D6WA 3BS1A 4H7BA 4QCLA 3DHQA 3N6RA 1R9TB 4OX9Q 4B3SQ 4DK3C 4V190 3W3AA 4DK0A 4A3BB 4DNTB 1XMQQ 1IBML 1AN8A 4C56C 2VW9A 1EY7A 3KF8A 2NN6I 1DOLA 1XMOQ 3K57A 4Z9CB 1X3GA 3R3OA 3GQBA 3H91A 1SNPA 4A3MB 2JA5B 3F2BA 2QEJC 4YHHL 1V43A 2DNCA 2ENBA 2BE5C 2IY5B 1Q46A 2PZWA 4FVMA 2EYMA 5ELCA 2XVSA 2NZ1D 3PO2H 2JA6G 3D3RA 3CC4A 1SROA 3S17H 2XN9C 1S3OA 2B3GA 2F0TA 3I56A 1FGUA 5LL6X 5NUCA 3MXNB 1LABA 1DYQA 2Y0SB 1BCPD 1VQGA 1KHIA 2IHEA 4QIWB 1H9JA 3JC66 3JAML 5IGGA 2QEXA 2MPMA 3G71A 2R7FA 4F7XA 3CKIB 2FMMA 1EQVA 1EY0A 4G57A 3J7A5 3OW2A 3R2IA 2CKZB 1SMXA 5C4JH 3MXPA 4JI8L 1QNKA 1L1OC 4FF2A 5M3FB 2NVXH 5AJ3L 4IUVA 2VB2X 4EX5A 4A3EG 1EWHA 2Z0SA 1KLGD 2PPBC 1IBKQ 2FHTA 1EYGA 1VQHA 4YY3L 1RF2D 2PZTA 3PO3G 2E8GA 3TS0A 4X62Q 2D62A 1B50A 1U5KA 4H02A 4BBSB 4L5RC 4KHPQ 1RODA 4OL7A 4JI1Q 4C2MH 2LXJA 2EY2A 2KCMA 1S5ED 1I4GA 4FDBA 1L1OB 2AQ2B 1BUVT 2HQLA 3NQIA 4K5XA 4I7ZC 3GD7A 3W1BA 4PZ6A 1HA6A 1QCBD 3KUPA 2ZJRA 1CKNB 1SEBD 4K6LA 4V0BA 3H3VI 1HZCA 3E0EA 1B53A 3IL8A 2VUMB 1TXYA 3Q0AA 3IAYA 4DUZL 1EY9A 1JJ2A 4CJ0B 1D1IA 1EY6A 2R61A 4P75A 3J81i 2WKCA 3HOZG 2UU9Q 4YIJA 5FO9B 1BOSA 1LT3D 2F0SA 3HOYB 3T1YQ 1V9PA 3I3CA 2G9DA 5C44G 3D4WA 3TRZA 1Y1VG 3DM1A 3OSOA 4C3HB 1STYA 4ULLA 5CORA 1O7IA 1RD9D 3PGZA 1HNWQ 2RCFA 3MXNA 1BXTA 5IGCA 1GOZA 1LO5D 1KRTA 1N33Q 5C4HA 4OX9L 4B3SL 1YNXA 1WD1A 1A2UA 1XMQL 2F0LA 3I7FA 1XMOL 1YJ9A 5C3EH 2Z8LA 4A3IG 2GA4B 1JWSD 3S2DH 1K28A 4KY7A 1YHAA 4ZK9B 1IZ6A 4HJAA 1SYDA 2JA8G 3HZXA 4WJ3M 1U4MA 1K3BC 4FF3A 1I4QA 1RKNA 4JBJA 1A6XA 1CKMA 1HCZA 2A68C 2I5HA 4LK1C 1UAPA 4B08A 5D3IB 1R9TH 1CA5A 4A3BH 3QIAA 4L5TA 4YCVA 2EZVA 2YV5A 3OW7A 4WORA
chains in the Genus database with same CATH topology
1L1OA 2VQFQ 2HIXA 4A75A 3HOUH 2B63H 3A0JA 4A3MH 3HKZG 1CKNA 4AH6A 2JA5H 2UUBL 2YTYA 4PG3A 3RNUA 4DV0Q 1G6PA 3AQQA 2AKWB 2I5LX 1KXLA 3SGIA 1VQFA 4LFAL 4Y52H 2HHHL 4DR3L 3KJOA 2K5HA 2RHQB 4JC0A 4X65Q 4GOPC 1PH4A 4LFBQ 3CMAA 4X6AH 4QY7A 4QGUA 3F1ZA 2Q2IA 1KIXA 4DV7Q 1Q86C 2VQEL 2JA7G 1VQDA 2CWPA 3JAMc 1IBKL 1I3QH 2AHOB 2K5VA 2ZJPA 2KHJA 4IOAA 3AFQA 3RLOA 5JJIA 2F3IA 4TVAB 1N32L 3A5UA 4X62L 2ES2A 1K3RA 1JJGA 4AYBE 2N78A 4DPGA 5J3BA 5LMUQ 3ZJYC 5JEAG 3CC7A 3HOVH 3S1MH 3KOJA 2GVBA 4KHPL 4LFCL 3CCQA 4BA2I 3S2HH 3GTOH 4JI1L 3PIOA 2H5XA 1HNZL 4A3GH 4A3FH 1YJWA 1EOVA 1EWIA 4DV5Q 3CCEA 3HOUG 4GLAC 2PMZE 2K14A 4MTNA 1B70B 3HFZB 4P72A 1PH6A 2JA5G 4IFDI 4R4QA 5IT9c 1VQ7A 4OWWB 1SRUA 4MZ9A 1IYJB 4A4IA 1T9HA 1JE5A 2ZTEA 3PUZA 1BKBA 4K0KQ 5M5XH 5M5YH 5EAYA 3PUYA 5M3FH 3I4NG 1HR0Q 5FLXc 1FJGQ 3CCSA 4GKKQ 3OTOL 3E9IA 4L5SA 1BBUA 1LM0A 1RIPA 4HJ8A 4DR5L 4LF6L 4LF6Q 2KCTA 4MNOA 4C3IH 1NBWA 3CQZH 1XPRA 2HIVA 1TWHH 4OONA 1FVIA 2Q2TA 2UXDL 3CD6A 1YITA 1K0RA 1E3PA 4DR6Q 3S1QH 2Y0SG 5ELOA 4BBSH 1E1OA 1XTDA 2UU9L 3HOVG 2R93G 3G48A 5C4XH 3J81c 4A3GG 4LF8Q 4A3FG 4AQYQ 4GNXA 1PH7A 2QGQA 4OWTB 3T1YL 1YIJA 4KLKA 3EIVA 2I5MX 5GROA 3U58A 4A3KH 4IJLA 1EIFA 5C0XI 4HIOA 2E5LL 2R92G 2YTVA 3K81C 2A19A 3A74A 3M4QA 3PUVA 4GS3A 5IYDH 4AIMA 2GN5A 1UE7A 1KC8C 5JJKA 2VZAA 3K0XA 2LSSA 3CPWA 4UPAA 2EXDA 5GAEC 4A3DH 4O0AA 4POFA 3STBD 3T1HL 3E9HA 1I50H 2VUMH 3UE0A 2PQAA 1HNWL 1X56A 1RL2A 4IPCA 4JOIC 4JI7Q 4RG1A 4DR2Q 4AYBG 1NMGA 1HZ9A 1N33L 1YBYA 1PH8A 1AE2A 1WOCA 3ULPA 3GTJH 1N8RC 4IPHA 3CAMA 1M90C 1I6HH 5GAHC 3W5OA 3UE1A 4BBSG 3GO5A 4UY8C 3Q8DA 4JI4Q 3M3YH 2R7ZH 2XTIA 4LUOA 3LGJA 3PF5A 3UDGA 3KF6B 2UUCQ 3HOYH 1LTLA 3RLNA 4JI5L 1CKOA 4HJ7A 3GTQH 2JA6H 2K52A 1UE5A 2OQKA 1Z9FA 3IRBA 4JI3L 4GN4B 3ULJA 1GD7A 4YCWA 3AYHB 2JJQA 2EIFA 2IX1A 4OO1I 3UDIA 4DAYB 2WB1G 4GLVB 1YHBA 1HR0W 4C3HH 4YCUA 4O2DA 5C0XG 4DV2L 3BU2A 1IBMQ 1XNRL 2WAQG 5JEAJ 1EUJA 1NE3A 3FHWA 4HIMA 2F4VQ 2K50A 4LF4L 3S14H 2MQHA 3KYHC 1YJNA 2WP8J 5IWAL 4GKJQ 2JQOA 2K4KA 2WFWA 4DV6L 1A8VA 2NZHA 3M4PA 1X54A 4APVA 4NB3A 2RHSB 2E2JH 1A62A 4UP8A 3RZDH 4DUYL 4LF5L 1OTCA 1HZAA 3MEFA 2R7ZG 2UXCQ 5IYCG 4B3TQ 1K83H 4YHHQ 1YHQA 4JI0L 1QVGA 2ZTDA 5C3EG 1X3FA 4A93H 1JJCB 2VQFL 1PFSA 3GTMH 3B6YA 5HY6A 3ER0A 4ALPA 1QZHA 2IX0A 3S1NH 3RR5A 1X9NA 3PCOB 3U50C 4A3EH 2UUAQ 4DV0L 4DV3Q 1FL0A 1PH1A 2NZOA 4GN3B 4IPDA 1E1TA 2CWAA 4A3LH 4PZ7A 2MFIA 3PO3H 4BXXG 4DV4Q 4X65L 3AEVA 3CCRA 3DLLA 4A76A 4LFBL 4BBRG 1PH5A 1SE8A 4DV7L 3CW2C 4X64Q 4X66Q 1GO3E 3U4ZA 5BR8Q 4IPGA 1Q82C 1N36Q 1XPUA 2UXBQ 4OO1G 2OCEA 4JBWA 3KF8B 3HOXH 3CCUA 4A3BG 3RN5A 3W1GA 3GTPH 4JI2Q 5LMUL 2K75A 2KHIA 3H0GH 5M3MH 3CPFA 3G4SA 4HIKA 1TWFH 4JI8Q 5IY0A 1VQIA 4NXML 1U0LA 4NXMQ 1J6QA 2YYZA 4DV5L 5AJ3Q 4YWLA 4IJHA 2RCNA 2B63G 4IFDJ 4A3MG 1YI2A 4R4OA 3CCMA 4A3LG 4DR4Q 4GOPB 2PNHA 4K0KL 4YY3Q 1QVCA 1NJIC 1MJEA 4LUZA 1VQ8A 4A3JH 4YWKA 1UE6A 2L15A 1HR0L 1FJGL 4GKKL 2IT1A 2JA9A 1PH3A 3FKIH 3PF4A 3CCJA 1C7YA 1K73C 2V1CC 1QZGA 3U4VA 2CFMA 2ATWA 3K80C 1HJPA 1J5EQ 2EQSA 2N8NA 5LMNQ 3HOXG 3TREA 3I4MH 4DR6L 2AMCB 1VQBA 5FJ8H 3KF6A 3PV0A 3CF5A 2Z6KA 4DAMA 3CXCA 3H0GG 5M3MG 5IE8A 1Q12A 3TEHB 1GVPA 1NMFA 2KENA 4P74A 4LF8L 4AQYL 1AE3A 4HJ9A 1Y1VH 1YVCA 1QUQB 4R1JA 4BY7H 5C0XJ 3FP9A 4TQUS 4DUZQ 2YU9H 4JI6Q 1VCIA 2AWNA 1N9WA 4LF7Q 3AFPA 3I4OA 5FLMH 5M3FG 1HZBA 4YWMA 4A3JG 1EFWA 3D31A 1EIYB 2DGYA 1LUZA 2DUDA 1VS0A 1XJVA 5HGQA 3EN2A 4HIDA 2GVAA 3FKIG 3KJPA 5E7NA 4IOCA 1PH2A 4DNIA 4OXPA 1JMCA 2ASBA 4NXNL 1KL9A 2N49A 1YEZA 4P71A 1SR3A 4JI7L 3STBC 4DR2L 4NXNQ 1BVSA 2RF4A 1N34Q 4J15A 2NVTH 4B3MQ 3I4MG 3TQYA 1IBLQ 5FJ8G 2ZM6Q 4Y7NH 5ELNA 3K7AH 4KI0A 4JI4L 4GLXA 5C4XG 3H15A 4JYAQ 3PUXA 5H1SE 1NY4A 3KDFB 1Q1BA 1SLJA 1I94Q 2UUCL 5DLQE 4GNXC 2BH2A 1XNQQ 3L0OA 3HKZE 4LUVA 1PYBA 2ALYB 1Y14B 5GAGC 5IP7H 1VQAA 2JA8H 4KHZA 3CCVA 4A3KG 4DR7Q 1D7QA 1DGSA 3CC2A 1X55A 1VQ9A 3K8AA 4EQ5A 5IYDG 4UP9A 4DKAC 2Q2UA 1VQJA 1A0IA 2OTJA 4LF9Q 4JBKA 2NVQH 4A3DG 4OX9Q 1VQ4A 4B3SQ 1MIUA 4DK3C 5IYBH 1K9MC 4JV5Q 2VUMG 1XMQQ 1VQ6A 1IBML 4QJFA 2JEBI 4A3CH 2VW9A 1S72A 2F4VL 2NN6I 1OXVA 2LXKA 3J7ZC 3PUWA 4DR1Q 5M5WH 1XMOQ 4GKJL 4ME3A 1EQRA 4C3JH 1X3GA 1HNXQ 1TWAH 3HOWH 5LMNW 1K8GA 4WJ4A 1QVFA 2UXCL 3F2BA 3J80i 4B3TL 4YHHL 2A8VA 1CSPA 3BJUA 1V43A 2IY5B 2C35B 1Q46A 3ICEA 1E7ZA 3ULLA 3HOYG 1KD1C 2JE6I 5IP7G 4R4TA 2E2HH 4GOPA 1C9OA 2JA6G 3NEMA 4PMWA 3CC4A 1SROA 3PO2H 1Q7YC 3S17H 2K5NA 2N3SA 1S3OA 2B3GA 1B8AA 4QL5A 4DV1Q 1VQEA 3I2ZA 4DV3L 3I56A 2UUAL 1FGUA 1G51A 1X6OA 2HT1A 4L5QA 3GTLH 3K7UC 3MXNB 2VY3A 4B3RQ 4DV4L 2XGTA 1HH2P 1YZ6A 1VQGA 1KHIA 2IHEA 3WWVA 3JC66 1UEBA 4LNQA 2QEXA 1V1QA 3G71A 2R7FA 2BA1A 4X66L 3A5ZB 4X64L 5BR8L 1N36L 2UXBL 3BZKA 2ZTCA 3F2DA 1W3SA 3M85A 1TWGH 3RLFA 5K36G 5JJLA 1X3EA 1ASYA 4JI2L 2JK8A 3OW2A 3J7A5 2UUBQ 1H95A 2CKZB 2PI2A 1SMXA 2NN6G 1SN8A 1QUQA 5C4JH 3L7ZC 4JI8L 2FXQA 3GDEA 3RZOH 4A93G 2A1AA 4GN5A 1L1OC 2NVXH 4LFAQ 3JAMi 3BZCA 5AJ3L 3TS2A 2HHHQ 4DR3Q 3I4NH 3PO2G 3RN2A 1PVOA 1Q81C 1Y1WH 4EX5A 1P8LA 4A3EG 1P16A 2Z0SA 2VQEQ 1EQQA 1IBKQ 1LYLA 2ID0A 3CCLA 1EYGA 4DR4L 1VQHA 2I0QA 4YY3L 2Q2HA 2E2IH 3PO3G 1E22A 3ERSX 2E8GA 1PYSB 3TS0A 1Q1EA 1VQCA 2YTXA 2VL6A 1E24A 4PZ8A 1N32Q 4X62Q 2D62A 1U5KA 4H02A 3J81j 2MO0A 3S1RH 3HOZH 1KQSA 2R93H 1JB7A 4L5RC 4JCVE 4KHPQ 4LFCQ 5GADC 1OXUA 2OQ0A 1J5EL 4JI1Q 4P73A 4C2MH 1HNZQ 2LXJA 5LMNL 1OXSC 2KCMA 3KDFA 1UWVA 4FDBA 1VQMA 1L1OB 2R92H 2HQLA 5C44H 3NBHB 3GD7A 1WFQA 3W1BA 2B29A 4JG2A 4PZ6A 4XIGS 2ZJRA 4DK6C 4OWXB 1CKNB 3F2CA 2ZJQA 1IXRA 3H3VI 1NTGA 2CQOA 1HZCA 1WCMH 3E0EA 3M4OH 2D0OA 1Y1WG 3OTOQ 1TXYA 4DR5Q 3S15H 1OXTA 4RMFA 4DUZL 2PI2E 4JI6L 2WB1E 1KRSA 1ASZA 2R7DA 4JOIA 4BA1I 1JJ2A 4LF7L 2UXDQ 1WJJA 1L2FA 2WAQE 1X65A 4P75A 3J81i 1VQOA 1C0AA 3HKSA 3F8TA 3HOZG 2D0PA 2UU9Q 3CP0A 1I5FA 2NVYH 1N34L 3OYYA 4B3ML 1BBWA 1UE1A 2KBNA 1GM5A 4A3IH 4QQBX 3T1YQ 1IBLL 1V9PA 2ZM6L 2Z6KC 1TWCH 3S24A 5C44G 2E5LQ 1VQKA 2IHFA 1K8AC 4JBMA 1W2BA 3PIPA 1PV4A 4JYAL 4BY1H 1I94L 3M9BA 2MNAA 4LW1A 1MJCA 1XNQL 1WCMG 1Y1VG 2VS1A 4NPSA 3NENA 3TRZA 1Z47A 4BY7G 2QA4A 4DR7L 1B7YB 4IFDG 2BA0A 1GKHA 3T1HQ 1O7IA 1PA6A 3PGZA 1HNWQ 1M1KC 2MO1A 1G291 1KRTA 1PH9A 3NELA 4LF9L 5FLMG 3S16H 1N33Q 5IP9H 2CCZA 1VQLA 4OX9L 1VQPA 4B3SL 3UDXA 3I55A 1YNXA 3GTGH 4JV5L 1AH9A 1XMQL 4POGA 3H3VH 3I7FA 1MKHA 2AWOA 1L0WA 3L2PA 3M7NA 5IYCH 4DR1L 3CMEA 5GQOA 1YJ9A 1XMOL 1D8LA 4UP7A 1HNXL 4IO9A 5C3EH 4A3IG 3GTKH 3DM3A 1Q8KA 3G6EA 4JI5Q 3KLWA 3S2DH 4GNXB 1XPOA 1VQNA 1KAWA 1A63A 4BY1G 1PHJA 1YHAA 4JI3Q 4HJ5A 1IZ6A 2F52A 4HJAA 1CUKA 1VQ5A 1IL2A 1WYDA 4R4IA 2JA8G 3J80c 3KFUA 4WJ3M 1WI5A 4BXXH 4DV2Q 1CSQA 4JBJA 1CKMA 4XTCS 4BBRH 2R6GA 1XNRQ 4R4CA 4DV1L 2I5HA 4LF4Q 2JA7H 5IP9G 5IWAQ 1OXXK 2PQAB 2JEAI 2BH8A 5IYBG 4DV6Q 1R9TH 1S40A 4B3RL 3PSIA 3D0FA 3EBEA 4DUYQ 4LF5Q 3VDYA 4A3BH 4A3CG 1SFOH 2VNUD 4LWCA 4L5TA 4YCVA 4JI0Q 1JT8A 2YV5A 2Y0SE 2OTLA 2OWOA 4QIWE 3HOWG 3UDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O A;  2VQF Q;  2HIX A;  4A75 A;  3HOU H;  2B63 H;  3A0J A;  4A3M H;  3HKZ G;  1CKN A;  4AH6 A;  2JA5 H;  2UUB L;  2YTY A;  4PG3 A;  3RNU A;  4DV0 Q;  1G6P A;  3AQQ A;  2AKW B;  2I5L X;  1KXL A;  3SGI A;  1VQF A;  4LFA L;  4Y52 H;  2HHH L;  4DR3 L;  3KJO A;  2K5H A;  2RHQ B;  4JC0 A;  4X65 Q;  4GOP C;  1PH4 A;  4LFB Q;  3CMA A;  4X6A H;  4QY7 A;  4QGU A;  3F1Z A;  2Q2I A;  1KIX A;  4DV7 Q;  1Q86 C;  2VQE L;  2JA7 G;  1VQD A;  2CWP A;  3JAM c;  1IBK L;  1I3Q H;  2AHO B;  2K5V A;  2ZJP A;  2KHJ A;  4IOA A;  3AFQ A;  3RLO A;  5JJI A;  2F3I A;  4TVA B;  1N32 L;  3A5U A;  4X62 L;  2ES2 A;  1K3R A;  1JJG A;  4AYB E;  2N78 A;  4DPG A;  5J3B A;  5LMU Q;  3ZJY C;  5JEA G;  3CC7 A;  3HOV H;  3S1M H;  3KOJ A;  2GVB A;  4KHP L;  4LFC L;  3CCQ A;  4BA2 I;  3S2H H;  3GTO H;  4JI1 L;  3PIO A;  2H5X A;  1HNZ L;  4A3G H;  4A3F H;  1YJW A;  1EOV A;  1EWI A;  4DV5 Q;  3CCE A;  3HOU G;  4GLA C;  2PMZ E;  2K14 A;  4MTN A;  1B70 B;  3HFZ B;  4P72 A;  1PH6 A;  2JA5 G;  4IFD I;  4R4Q A;  5IT9 c;  1VQ7 A;  4OWW B;  1SRU A;  4MZ9 A;  1IYJ B;  4A4I A;  1T9H A;  1JE5 A;  2ZTE A;  3PUZ A;  1BKB A;  4K0K Q;  5M5X H;  5M5Y H;  5EAY A;  3PUY A;  5M3F H;  3I4N G;  1HR0 Q;  5FLX c;  1FJG Q;  3CCS A;  4GKK Q;  3OTO L;  3E9I A;  4L5S A;  1BBU A;  1LM0 A;  1RIP A;  4HJ8 A;  4DR5 L;  4LF6 L;  4LF6 Q;  2KCT A;  4MNO A;  4C3I H;  1NBW A;  3CQZ H;  1XPR A;  2HIV A;  1TWH H;  4OON A;  1FVI A;  2Q2T A;  2UXD L;  3CD6 A;  1YIT A;  1K0R A;  1E3P A;  4DR6 Q;  3S1Q H;  2Y0S G;  5ELO A;  4BBS H;  1E1O A;  1XTD A;  2UU9 L;  3HOV G;  2R93 G;  3G48 A;  5C4X H;  3J81 c;  4A3G G;  4LF8 Q;  4A3F G;  4AQY Q;  4GNX A;  1PH7 A;  2QGQ A;  4OWT B;  3T1Y L;  1YIJ A;  4KLK A;  3EIV A;  2I5M X;  5GRO A;  3U58 A;  4A3K H;  4IJL A;  1EIF A;  5C0X I;  4HIO A;  2E5L L;  2R92 G;  2YTV A;  3K81 C;  2A19 A;  3A74 A;  3M4Q A;  3PUV A;  4GS3 A;  5IYD H;  4AIM A;  2GN5 A;  1UE7 A;  1KC8 C;  5JJK A;  2VZA A;  3K0X A;  2LSS A;  3CPW A;  4UPA A;  2EXD A;  5GAE C;  4A3D H;  4O0A A;  4POF A;  3STB D;  3T1H L;  3E9H A;  1I50 H;  2VUM H;  3UE0 A;  2PQA A;  1HNW L;  1X56 A;  1RL2 A;  4IPC A;  4JOI C;  4JI7 Q;  4RG1 A;  4DR2 Q;  4AYB G;  1NMG A;  1HZ9 A;  1N33 L;  1YBY A;  1PH8 A;  1AE2 A;  1WOC A;  3ULP A;  3GTJ H;  1N8R C;  4IPH A;  3CAM A;  1M90 C;  1I6H H;  5GAH C;  3W5O A;  3UE1 A;  4BBS G;  3GO5 A;  4UY8 C;  3Q8D A;  4JI4 Q;  3M3Y H;  2R7Z H;  2XTI A;  4LUO A;  3LGJ A;  3PF5 A;  3UDG A;  3KF6 B;  2UUC Q;  3HOY H;  1LTL A;  3RLN A;  4JI5 L;  1CKO A;  4HJ7 A;  3GTQ H;  2JA6 H;  2K52 A;  1UE5 A;  2OQK A;  1Z9F A;  3IRB A;  4JI3 L;  4GN4 B;  3ULJ A;  1GD7 A;  4YCW A;  3AYH B;  2JJQ A;  2EIF A;  2IX1 A;  4OO1 I;  3UDI A;  4DAY B;  2WB1 G;  4GLV B;  1YHB A;  1HR0 W;  4C3H H;  4YCU A;  4O2D A;  5C0X G;  4DV2 L;  3BU2 A;  1IBM Q;  1XNR L;  2WAQ G;  5JEA J;  1EUJ A;  1NE3 A;  3FHW A;  4HIM A;  2F4V Q;  2K50 A;  4LF4 L;  3S14 H;  2MQH A;  3KYH C;  1YJN A;  2WP8 J;  5IWA L;  4GKJ Q;  2JQO A;  2K4K A;  2WFW A;  4DV6 L;  1A8V A;  2NZH A;  3M4P A;  1X54 A;  4APV A;  4NB3 A;  2RHS B;  2E2J H;  1A62 A;  4UP8 A;  3RZD H;  4DUY L;  4LF5 L;  1OTC A;  1HZA A;  3MEF A;  2R7Z G;  2UXC Q;  5IYC G;  4B3T Q;  1K83 H;  4YHH Q;  1YHQ A;  4JI0 L;  1QVG A;  2ZTD A;  5C3E G;  1X3F A;  4A93 H;  1JJC B;  2VQF L;  1PFS A;  3GTM H;  3B6Y A;  5HY6 A;  3ER0 A;  4ALP A;  1QZH A;  2IX0 A;  3S1N H;  3RR5 A;  1X9N A;  3PCO B;  3U50 C;  4A3E H;  2UUA Q;  4DV0 L;  4DV3 Q;  1FL0 A;  1PH1 A;  2NZO A;  4GN3 B;  4IPD A;  1E1T A;  2CWA A;  4A3L H;  4PZ7 A;  2MFI A;  3PO3 H;  4BXX G;  4DV4 Q;  4X65 L;  3AEV A;  3CCR A;  3DLL A;  4A76 A;  4LFB L;  4BBR G;  1PH5 A;  1SE8 A;  4DV7 L;  3CW2 C;  4X64 Q;  4X66 Q;  1GO3 E;  3U4Z A;  5BR8 Q;  4IPG A;  1Q82 C;  1N36 Q;  1XPU A;  2UXB Q;  4OO1 G;  2OCE A;  4JBW A;  3KF8 B;  3HOX H;  3CCU A;  4A3B G;  3RN5 A;  3W1G A;  3GTP H;  4JI2 Q;  5LMU L;  2K75 A;  2KHI A;  3H0G H;  5M3M H;  3CPF A;  3G4S A;  4HIK A;  1TWF H;  4JI8 Q;  5IY0 A;  1VQI A;  4NXM L;  1U0L A;  4NXM Q;  1J6Q A;  2YYZ A;  4DV5 L;  5AJ3 Q;  4YWL A;  4IJH A;  2RCN A;  2B63 G;  4IFD J;  4A3M G;  1YI2 A;  4R4O A;  3CCM A;  4A3L G;  4DR4 Q;  4GOP B;  2PNH A;  4K0K L;  4YY3 Q;  1QVC A;  1NJI C;  1MJE A;  4LUZ A;  1VQ8 A;  4A3J H;  4YWK A;  1UE6 A;  2L15 A;  1HR0 L;  1FJG L;  4GKK L;  2IT1 A;  2JA9 A;  1PH3 A;  3FKI H;  3PF4 A;  3CCJ A;  1C7Y A;  1K73 C;  2V1C C;  1QZG A;  3U4V A;  2CFM A;  2ATW A;  3K80 C;  1HJP A;  1J5E Q;  2EQS A;  2N8N A;  5LMN Q;  3HOX G;  3TRE A;  3I4M H;  4DR6 L;  2AMC B;  1VQB A;  5FJ8 H;  3KF6 A;  3PV0 A;  3CF5 A;  2Z6K A;  4DAM A;  3CXC A;  3H0G G;  5M3M G;  5IE8 A;  1Q12 A;  3TEH B;  1GVP A;  1NMF A;  2KEN A;  4P74 A;  4LF8 L;  4AQY L;  1AE3 A;  4HJ9 A;  1Y1V H;  1YVC A;  1QUQ B;  4R1J A;  4BY7 H;  5C0X J;  3FP9 A;  4TQU S;  4DUZ Q;  2YU9 H;  4JI6 Q;  1VCI A;  2AWN A;  1N9W A;  4LF7 Q;  3AFP A;  3I4O A;  5FLM H;  5M3F G;  1HZB A;  4YWM A;  4A3J G;  1EFW A;  3D31 A;  1EIY B;  2DGY A;  1LUZ A;  2DUD A;  1VS0 A;  1XJV A;  5HGQ A;  3EN2 A;  4HID A;  2GVA A;  3FKI G;  3KJP A;  5E7N A;  4IOC A;  1PH2 A;  4DNI A;  4OXP A;  1JMC A;  2ASB A;  4NXN L;  1KL9 A;  2N49 A;  1YEZ A;  4P71 A;  1SR3 A;  4JI7 L;  3STB C;  4DR2 L;  4NXN Q;  1BVS A;  2RF4 A;  1N34 Q;  4J15 A;  2NVT H;  4B3M Q;  3I4M G;  3TQY A;  1IBL Q;  5FJ8 G;  2ZM6 Q;  4Y7N H;  5ELN A;  3K7A H;  4KI0 A;  4JI4 L;  4GLX A;  5C4X G;  3H15 A;  4JYA Q;  3PUX A;  5H1S E;  1NY4 A;  3KDF B;  1Q1B A;  1SLJ A;  1I94 Q;  2UUC L;  5DLQ E;  4GNX C;  2BH2 A;  1XNQ Q;  3L0O A;  3HKZ E;  4LUV A;  1PYB A;  2ALY B;  1Y14 B;  5GAG C;  5IP7 H;  1VQA A;  2JA8 H;  4KHZ A;  3CCV A;  4A3K G;  4DR7 Q;  1D7Q A;  1DGS A;  3CC2 A;  1X55 A;  1VQ9 A;  3K8A A;  4EQ5 A;  5IYD G;  4UP9 A;  4DKA C;  2Q2U A;  1VQJ A;  1A0I A;  2OTJ A;  4LF9 Q;  4JBK A;  2NVQ H;  4A3D G;  4OX9 Q;  1VQ4 A;  4B3S Q;  1MIU A;  4DK3 C;  5IYB H;  1K9M C;  4JV5 Q;  2VUM G;  1XMQ Q;  1VQ6 A;  1IBM L;  4QJF A;  2JEB I;  4A3C H;  2VW9 A;  1S72 A;  2F4V L;  2NN6 I;  1OXV A;  2LXK A;  3J7Z C;  3PUW A;  4DR1 Q;  5M5W H;  1XMO Q;  4GKJ L;  4ME3 A;  1EQR A;  4C3J H;  1X3G A;  1HNX Q;  1TWA H;  3HOW H;  5LMN W;  1K8G A;  4WJ4 A;  1QVF A;  2UXC L;  3F2B A;  3J80 i;  4B3T L;  4YHH L;  2A8V A;  1CSP A;  3BJU A;  1V43 A;  2IY5 B;  2C35 B;  1Q46 A;  3ICE A;  1E7Z A;  3ULL A;  3HOY G;  1KD1 C;  2JE6 I;  5IP7 G;  4R4T A;  2E2H H;  4GOP A;  1C9O A;  2JA6 G;  3NEM A;  4PMW A;  3CC4 A;  1SRO A;  3PO2 H;  1Q7Y C;  3S17 H;  2K5N A;  2N3S A;  1S3O A;  2B3G A;  1B8A A;  4QL5 A;  4DV1 Q;  1VQE A;  3I2Z A;  4DV3 L;  3I56 A;  2UUA L;  1FGU A;  1G51 A;  1X6O A;  2HT1 A;  4L5Q A;  3GTL H;  3K7U C;  3MXN B;  2VY3 A;  4B3R Q;  4DV4 L;  2XGT A;  1HH2 P;  1YZ6 A;  1VQG A;  1KHI A;  2IHE A;  3WWV A;  3JC6 6;  1UEB A;  4LNQ A;  2QEX A;  1V1Q A;  3G71 A;  2R7F A;  2BA1 A;  4X66 L;  3A5Z B;  4X64 L;  5BR8 L;  1N36 L;  2UXB L;  3BZK A;  2ZTC A;  3F2D A;  1W3S A;  3M85 A;  1TWG H;  3RLF A;  5K36 G;  5JJL A;  1X3E A;  1ASY A;  4JI2 L;  2JK8 A;  3OW2 A;  3J7A 5;  2UUB Q;  1H95 A;  2CKZ B;  2PI2 A;  1SMX A;  2NN6 G;  1SN8 A;  1QUQ A;  5C4J H;  3L7Z C;  4JI8 L;  2FXQ A;  3GDE A;  3RZO H;  4A93 G;  2A1A A;  4GN5 A;  1L1O C;  2NVX H;  4LFA Q;  3JAM i;  3BZC A;  5AJ3 L;  3TS2 A;  2HHH Q;  4DR3 Q;  3I4N H;  3PO2 G;  3RN2 A;  1PVO A;  1Q81 C;  1Y1W H;  4EX5 A;  1P8L A;  4A3E G;  1P16 A;  2Z0S A;  2VQE Q;  1EQQ A;  1IBK Q;  1LYL A;  2ID0 A;  3CCL A;  1EYG A;  4DR4 L;  1VQH A;  2I0Q A;  4YY3 L;  2Q2H A;  2E2I H;  3PO3 G;  1E22 A;  3ERS X;  2E8G A;  1PYS B;  3TS0 A;  1Q1E A;  1VQC A;  2YTX A;  2VL6 A;  1E24 A;  4PZ8 A;  1N32 Q;  4X62 Q;  2D62 A;  1U5K A;  4H02 A;  3J81 j;  2MO0 A;  3S1R H;  3HOZ H;  1KQS A;  2R93 H;  1JB7 A;  4L5R C;  4JCV E;  4KHP Q;  4LFC Q;  5GAD C;  1OXU A;  2OQ0 A;  1J5E L;  4JI1 Q;  4P73 A;  4C2M H;  1HNZ Q;  2LXJ A;  5LMN L;  1OXS C;  2KCM A;  3KDF A;  1UWV A;  4FDB A;  1VQM A;  1L1O B;  2R92 H;  2HQL A;  5C44 H;  3NBH B;  3GD7 A;  1WFQ A;  3W1B A;  2B29 A;  4JG2 A;  4PZ6 A;  4XIG S;  2ZJR A;  4DK6 C;  4OWX B;  1CKN B;  3F2C A;  2ZJQ A;  1IXR A;  3H3V I;  1NTG A;  2CQO A;  1HZC A;  1WCM H;  3E0E A;  3M4O H;  2D0O A;  1Y1W G;  3OTO Q;  1TXY A;  4DR5 Q;  3S15 H;  1OXT A;  4RMF A;  4DUZ L;  2PI2 E;  4JI6 L;  2WB1 E;  1KRS A;  1ASZ A;  2R7D A;  4JOI A;  4BA1 I;  1JJ2 A;  4LF7 L;  2UXD Q;  1WJJ A;  1L2F A;  2WAQ E;  1X65 A;  4P75 A;  3J81 i;  1VQO A;  1C0A A;  3HKS A;  3F8T A;  3HOZ G;  2D0P A;  2UU9 Q;  3CP0 A;  1I5F A;  2NVY H;  1N34 L;  3OYY A;  4B3M L;  1BBW A;  1UE1 A;  2KBN A;  1GM5 A;  4A3I H;  4QQB X;  3T1Y Q;  1IBL L;  1V9P A;  2ZM6 L;  2Z6K C;  1TWC H;  3S24 A;  5C44 G;  2E5L Q;  1VQK A;  2IHF A;  1K8A C;  4JBM A;  1W2B A;  3PIP A;  1PV4 A;  4JYA L;  4BY1 H;  1I94 L;  3M9B A;  2MNA A;  4LW1 A;  1MJC A;  1XNQ L;  1WCM G;  1Y1V G;  2VS1 A;  4NPS A;  3NEN A;  3TRZ A;  1Z47 A;  4BY7 G;  2QA4 A;  4DR7 L;  1B7Y B;  4IFD G;  2BA0 A;  1GKH A;  3T1H Q;  1O7I A;  1PA6 A;  3PGZ A;  1HNW Q;  1M1K C;  2MO1 A;  1G29 1;  1KRT A;  1PH9 A;  3NEL A;  4LF9 L;  5FLM G;  3S16 H;  1N33 Q;  5IP9 H;  2CCZ A;  1VQL A;  4OX9 L;  1VQP A;  4B3S L;  3UDX A;  3I55 A;  1YNX A;  3GTG H;  4JV5 L;  1AH9 A;  1XMQ L;  4POG A;  3H3V H;  3I7F A;  1MKH A;  2AWO A;  1L0W A;  3L2P A;  3M7N A;  5IYC H;  4DR1 L;  3CME A;  5GQO A;  1YJ9 A;  1XMO L;  1D8L A;  4UP7 A;  1HNX L;  4IO9 A;  5C3E H;  4A3I G;  3GTK H;  3DM3 A;  1Q8K A;  3G6E A;  4JI5 Q;  3KLW A;  3S2D H;  4GNX B;  1XPO A;  1VQN A;  1KAW A;  1A63 A;  4BY1 G;  1PHJ A;  1YHA A;  4JI3 Q;  4HJ5 A;  1IZ6 A;  2F52 A;  4HJA A;  1CUK A;  1VQ5 A;  1IL2 A;  1WYD A;  4R4I A;  2JA8 G;  3J80 c;  3KFU A;  4WJ3 M;  1WI5 A;  4BXX H;  4DV2 Q;  1CSQ A;  4JBJ A;  1CKM A;  4XTC S;  4BBR H;  2R6G A;  1XNR Q;  4R4C A;  4DV1 L;  2I5H A;  4LF4 Q;  2JA7 H;  5IP9 G;  5IWA Q;  1OXX K;  2PQA B;  2JEA I;  2BH8 A;  5IYB G;  4DV6 Q;  1R9T H;  1S40 A;  4B3R L;  3PSI A;  3D0F A;  3EBE A;  4DUY Q;  4LF5 Q;  3VDY A;  4A3B H;  4A3C G;  1SFO H;  2VNU D;  4LWC A;  4L5T A;  4YCV A;  4JI0 Q;  1JT8 A;  2YV5 A;  2Y0S E;  2OTL A;  2OWO A;  4QIW E;  3HOW G;  3UDF A; 
#chains in the Genus database with same CATH topology
 1L1O A;  2VQF Q;  2HIX A;  2C9O A;  4A75 A;  1Y1W B;  4A3M H;  3HKZ G;  1CKN A;  4AH6 A;  2JA5 H;  2YTY A;  1G91 A;  1CT1 D;  1H9M A;  2I5L X;  3SE0 A;  4Y52 H;  4A3J B;  4X65 Q;  3A8J E;  5C4Z A;  4KY6 A;  4LFB Q;  5IOC A;  5IGF A;  1B9N A;  4QY7 A;  3CRL C;  2TMP A;  2K5W A;  3F1Z A;  3OPO A;  3I70 A;  1NNX A;  1QNU A;  2CWP A;  1IBK L;  2K5V A;  2ZJP A;  1BBX C;  4IOA A;  5JJI A;  4TVA B;  3A5U A;  4X62 L;  5ELF A;  1FYC A;  4FF1 A;  1W6J A;  5LMU Q;  5JEA G;  1GUS A;  2K03 A;  2GVB A;  4RGM A;  4KHP L;  3DWP A;  4JI1 L;  2EYP A;  3PIO A;  4GLA C;  2PMZ E;  3I73 A;  1B70 B;  4MTN A;  4IFD I;  3QWN A;  4R4Q A;  4KJN A;  4A4I A;  3J7Y W;  2Z1C A;  2RDF A;  4K0K Q;  1EEF D;  3TZU A;  2WIN B;  3P75 A;  5M3F H;  3I4N G;  1SYB A;  1EU3 A;  4L5S A;  1TT2 A;  1BBU A;  1RIP A;  4LF6 L;  2KCT A;  4MNO A;  4KY5 A;  1NBW A;  2NVY B;  2HIV A;  2Q2T A;  4KN7 C;  1E3P A;  2DN8 A;  1TWC B;  4BBS H;  1E1O A;  5KRU A;  2UU9 L;  3HOV G;  3G48 A;  4KKU A;  1I4H A;  2F0W A;  2EJG C;  3P1H A;  3T1Y L;  5JAV A;  1YIJ A;  3EIV A;  4KJO A;  4CDC C;  3SVM A;  1EIF A;  4HIO A;  4QMG A;  2YTV A;  3MHB A;  1B1Z A;  1WTO A;  3CPW A;  2EXD A;  1KAA A;  1PRT B;  3STB D;  3S9W A;  3FVQ A;  2VUM H;  1HNW L;  4C3I G;  1RL2 A;  4PV1 C;  4JOI C;  3FDT A;  5M5W B;  4AYB G;  4C3J B;  5BN4 A;  1N33 L;  1AE2 A;  1WOC A;  3NHH A;  1N8R C;  3NTK A;  1H9K A;  4FXK C;  4ZLT F;  1PDQ A;  3GO5 A;  2NBF A;  2QF7 A;  2R7Z H;  4LUO A;  4I65 A;  1QOH A;  3OIP A;  3KF6 B;  1W6K A;  3HOY H;  1LTL A;  2E2H B;  1JB3 A;  1CKO A;  4ZKB B;  4HJ7 A;  1A15 A;  5KYI A;  1UUP A;  2EXZ A;  2OQK A;  4PMB A;  4DAY B;  4XDX A;  3M7G A;  2CQA A;  4C3H H;  5C0X G;  3K58 A;  2Z9H A;  1Z7T A;  1TU2 B;  2K50 A;  2MQH A;  3KYH C;  4GKJ Q;  2K4K A;  2WFW A;  1A8V A;  2NZH A;  4L8J A;  3NTH A;  2EE1 A;  3D6C A;  2UXC Q;  5IYC G;  1PZK D;  1II3 A;  3WOE A;  1KTK A;  2ZTD A;  3OMC A;  1HXY D;  2VQF L;  1PFS A;  4RAU C;  2DJG C;  3HRZ C;  4B9W A;  1G2S A;  1QZH A;  1X9N A;  1MHW C;  4EVO A;  2NB0 A;  2NZO A;  4IPD A;  4PZ7 A;  1B3A A;  2MFI A;  4BXX G;  3VR3 A;  4X65 L;  2M9V A;  1LTG D;  4LFB L;  4BBR G;  3QO2 A;  3EVQ A;  2R93 B;  3CW2 C;  4X66 Q;  3U4Z A;  4IPG A;  1Q82 C;  4DF7 A;  4OO1 G;  2OCE A;  5G3L D;  4PMC A;  3W1G A;  4JI2 Q;  5LMU L;  2KHI A;  5M3M H;  4G4K A;  4HIK A;  2YYZ A;  4YWL A;  4IJH A;  4FO2 A;  2B63 G;  4IFD J;  4WFN 3;  1S5F D;  3NQT A;  3CCM A;  4K0K L;  2NTT A;  1MJE A;  1QVC A;  5JPM C;  2PNR C;  3S1Q B;  4A3J H;  4YWK A;  1JWM D;  3D4R A;  1Y8O B;  1ZEQ X;  2IT1 A;  2JA9 A;  2M00 A;  4G7H C;  3CCJ A;  1EY4 A;  1D1K A;  2EYO A;  2V1C C;  1SBB B;  2EQS A;  2EYJ A;  4CHT B;  5LMN Q;  3QJY A;  3TRE A;  3HOX G;  1VQB A;  3KF6 A;  2OXP A;  1KDA A;  2A74 C;  1Q12 A;  3BG3 A;  4P74 A;  1EEI D;  3SK5 A;  5JPN C;  1AZQ A;  1JIC A;  1QUQ B;  1PRT D;  1EZ8 A;  1F9Q A;  2WAQ B;  4DAY A;  1VCI A;  4IZ8 A;  3S16 B;  1N9W A;  2KQ3 A;  2XRQ D;  5FLM H;  3NTI A;  1EIY B;  2PW7 A;  1I6H B;  1XJV A;  3H3V H;  5HGQ A;  4HID A;  4ZUJ A;  4ZCK A;  3ITP A;  4IOC A;  4OXP A;  2EYH A;  1JMC A;  2N49 A;  2K5D A;  1O7Y A;  3E3X A;  1LTA D;  4CDE C;  1R4P B;  2ZM6 Q;  2B2W C;  4GLX A;  5C4X G;  3H15 A;  4JYA Q;  1NY4 A;  2E76 C;  3KDF B;  4L6T B;  4GNX C;  4H44 C;  1WTP A;  1XNQ Q;  1QWY A;  1PYB A;  5GAG C;  3PIO 3;  3IKJ A;  3FEW X;  1VQA A;  4KHZ A;  3CCV A;  1H9R A;  4IUN A;  1X55 A;  3K8A A;  3QB3 A;  5IYD G;  2Q8T A;  4DKA C;  1EOT A;  4FXD A;  2NYZ D;  1VQ4 A;  1MIU A;  4JV5 Q;  1KAB A;  1SFO B;  2JEB I;  1XTC D;  4A3C H;  1S72 A;  1OXV A;  2LXK A;  2ZXO A;  3DWA A;  3I8Z A;  5M5W H;  5I2X A;  5DNF A;  4GKJ L;  4ME3 A;  1AFP A;  3QR8 A;  1CM9 A;  4C3J H;  3J7A F;  5LMN W;  3HOU B;  5KND A;  2F0U A;  1GJX A;  3QOL A;  4WJ4 A;  4CJ1 B;  1QVF A;  2UXC L;  3J80 i;  2A5H A;  2RQX A;  5CYU A;  4K14 A;  2A8V A;  2XWJ B;  2C35 B;  3P7J A;  3ULL A;  2HCC A;  4H13 C;  2E2H H;  1CA6 A;  3A7A B;  4RGO S;  3ONA B;  3AB9 A;  1Q7Y C;  1S4Z A;  3IFT A;  1JQY D;  1I3Q B;  2F0H A;  4EGV A;  3NSW A;  4HN7 A;  3K7U C;  4OHJ A;  2K01 A;  1K8O A;  2VY3 A;  1YZ6 A;  3FPU B;  4LNQ A;  1UEB A;  1V1Q A;  3S1M B;  4X66 L;  2BA1 A;  3S2H B;  2NUC A;  5I2Y A;  5IOD A;  1K8M A;  4A3F B;  1TKW B;  3K6O A;  1TWG H;  2AQ3 B;  3K5O A;  5K36 G;  1X3E A;  1ASY A;  4JI2 L;  2UUB Q;  1SN8 A;  1QUQ A;  3NWS A;  2FXQ A;  3RD4 A;  5M5X B;  4A93 G;  1JR0 D;  2RDH A;  4LFA Q;  2Z4H A;  4DR3 Q;  3PO2 G;  4XXE A;  3RN2 A;  3F2U A;  1Q81 C;  2A6E D;  1F2Z A;  1V8Q A;  4IUQ A;  3CCL A;  2ID0 A;  1STH A;  3ERS X;  1PYS B;  1N32 Q;  1Q1E A;  2YTX A;  1E24 A;  2K28 A;  2KHS A;  1H9S B;  2KA7 A;  3J81 j;  3T53 B;  2MO0 A;  2R93 H;  1OO9 B;  5GAD C;  2QW7 A;  2OQ0 A;  4P73 A;  1HNZ Q;  5LMN L;  3PQI A;  1E2V A;  5LL6 S;  3KDF A;  1UWV A;  1VQM A;  1CTM A;  4N9T A;  1ESF A;  1ENF A;  2K7V A;  1WFQ A;  1BF4 A;  2RKS A;  3G6J B;  4JG2 A;  4XIG S;  4KV6 A;  3F2C A;  1RTO A;  1NTG A;  2CQO A;  2F0K A;  4ODG A;  1ET9 A;  3MFG A;  4CKE A;  4IFD H;  3K0Y A;  1OXT A;  4RMF A;  4IUU A;  2PI2 E;  1ASZ A;  2R7D A;  4R9W A;  1E2Z A;  1L2F A;  1T5X D;  5T1I A;  1NCV A;  3K7A B;  3C2P A;  1G6Z A;  2LMC B;  1STB A;  1LT5 D;  4DK1 A;  3OYY A;  2KBN A;  1JCK B;  1GM5 A;  4QQB X;  2HD3 A;  4Q0F A;  2ZM6 L;  2JA6 B;  2AUJ D;  1W2B A;  4JYA L;  2RBM A;  4BY1 H;  3M9B A;  2PCF B;  4LW1 A;  3LWE A;  1XNQ L;  1JC7 A;  4NPS A;  2CW0 C;  1PA6 A;  5E3F A;  1M1K C;  2MO1 A;  1G29 1;  2E75 C;  3NEL A;  3S16 H;  1VF5 C;  1VQL A;  3UDX A;  2E2J B;  4JV5 L;  1AH9 A;  3D4D A;  2AUK A;  3M7N A;  2QCP X;  3NK9 A;  4CGY B;  4IO9 A;  3DM3 A;  1EYC A;  1Q8K A;  2IX3 A;  3S1N B;  4P2C B;  2B2Y C;  3QG1 A;  1XPO A;  1VQN A;  4A3E B;  1KAW A;  1A63 A;  1F9R A;  2A73 B;  2F52 A;  3PO3 B;  1EWC A;  4R4I A;  1SMY C;  2TSS A;  4XTC S;  5HGT A;  1IKL A;  1A2T A;  5JOB A;  5T1G A;  2JA7 H;  1H9S A;  3VYU A;  2PQA B;  2JEA I;  5IYB G;  3PMF A;  4DV6 Q;  1Y69 U;  3EBE A;  1R4Q B;  3VDY A;  1ZKO A;  1SFO H;  3H0G B;  3RZO B;  1HHV A;  3URY A;  3H94 A;  3HOW G;  3HOU H;  2UUB L;  4PG3 A;  3RNU A;  5EKK A;  2F0F A;  2AKW B;  1KXL A;  1PZI D;  3SGI A;  4LFA L;  4DR3 L;  1FNW A;  2K5H A;  4GOP C;  4OEL B;  3HOZ B;  1RDP D;  2FJ2 A;  1Q86 C;  3FMC A;  1LTS D;  1CHP D;  1ILQ A;  1I3Q H;  2M2L A;  1DCZ A;  1N32 L;  4RFB A;  1TII D;  2ES2 A;  1K3R A;  4AYB E;  2N78 A;  4DPG A;  5ELB A;  1LTT D;  4KK7 A;  3CC7 A;  3S1M H;  3S2H H;  1NAP A;  2XWB B;  4EQP A;  1HNZ L;  1GUG A;  1Y1V B;  4A3F H;  1YJW A;  1EWI A;  4DV5 Q;  2JA5 G;  5EGT A;  3HEJ A;  1YNJ D;  1VQ7 A;  1SRU A;  1JE5 A;  3BYT B;  2EYL A;  2LKV A;  5M5X H;  5TSS A;  5FLX c;  1MGS A;  3E9I A;  1LM0 A;  4HJ8 A;  1TS5 A;  4LF6 Q;  1CFM A;  4HAE A;  5IGD A;  2NVT B;  1EIG A;  3CD6 A;  4A3I B;  1WTQ A;  2Y0S G;  5C3X A;  2HDL A;  4HSP A;  5CV8 A;  5F2D A;  2F03 A;  3J81 c;  1PH7 A;  2JA8 B;  3EA6 A;  4OWT B;  5GRO A;  2R92 G;  2DY7 A;  5C0X I;  4MN3 A;  3A74 A;  2F0V A;  1DXM A;  4AIM A;  3T16 A;  2GN5 A;  5KNC A;  2VXW A;  4J8Q A;  2VZA A;  3K0X A;  1X3Q A;  1WTW A;  1GXD C;  4UPA A;  3GTG B;  3X3M A;  2KUM A;  2PQA A;  1RTN A;  2N55 A;  4RG1 A;  4DR2 Q;  1YBY A;  1TWA B;  3GTK B;  4F87 A;  1B3Q A;  4BBS G;  3OIQ A;  2B2Y A;  3HKZ B;  2XTI A;  3LGJ A;  4IUR A;  2CW0 D;  4Q5V A;  2SNM A;  4FNF A;  5J39 A;  2JA6 H;  2ICI A;  1UE5 A;  1Z9F A;  1GD7 A;  2LY7 A;  3AYH B;  3TSS A;  3GTL B;  4OO1 I;  2LFN A;  4GLV B;  1YHB A;  1FD7 D;  3Q23 A;  2KCC A;  2F0G A;  5JEA J;  4HIM A;  4CKB A;  2ZXR A;  5D14 A;  2WP8 J;  4RCN A;  1GUO A;  1U4P A;  3C1E A;  1F9S A;  4ME5 A;  4DV6 L;  1MI2 A;  4HTH A;  4NB3 A;  4LJZ C;  2E2J H;  1JOO A;  2BE5 D;  4XQQ A;  1OTC A;  1HZA A;  1EL0 A;  2B2V C;  2R7Z G;  2K05 A;  4O42 A;  1S5B D;  1HQM C;  4L63 B;  1QVG A;  1X3F A;  1JJC B;  4HMJ A;  4OEM B;  3OMG A;  3I4N B;  4U68 A;  3B6Y A;  4ALP A;  3S1N H;  2A6H C;  1C4Q A;  4A3E H;  2NTS A;  4DV3 Q;  4GN3 B;  1SSO A;  4K8J A;  3BDO A;  2IPK D;  3GTQ B;  3PO3 H;  4DV4 Q;  3AEV A;  3DLL A;  2F0I A;  5EBD A;  3CU7 A;  3S1R B;  1Q3L A;  1SE8 A;  3BVM A;  4K2L A;  1U4R A;  1SE3 A;  5IIF A;  4X64 Q;  1EIH A;  3GTO B;  2UXB Q;  4JBW A;  3CCU A;  4F8M A;  3BDC A;  4KTA A;  2K04 A;  4RWS C;  2K75 A;  3H0G H;  1KLU D;  5IY0 A;  1D5M C;  5M5Y B;  1HA5 A;  2E2D C;  3M4O B;  1J6Q A;  1WCM B;  4DV5 L;  1XX8 A;  3A56 A;  4C3I B;  3MC0 B;  4DR4 Q;  4DAP A;  4LUZ A;  5FLX E;  4KD3 A;  3NWT A;  2RDG A;  1PH3 A;  3PF4 A;  4ZQ3 A;  1QZG A;  3K80 C;  1QIL A;  2QDL A;  2EY5 A;  2XSC A;  3EFX D;  3T13 A;  5FJ8 H;  5M3M G;  3J81 E;  1IYV A;  1B9M A;  2KEN A;  3V96 A;  4HJ9 A;  1Y1V H;  1LLR D;  1YVC A;  4JVZ A;  1TR5 A;  5C0X J;  3HP3 A;  2IWH A;  1STA A;  1O7L A;  1E0B A;  4LF7 Q;  3X3N A;  1HZB A;  4YWM A;  4A3J G;  1EFW A;  2DGY A;  1LUZ A;  2DUD A;  3KK7 A;  4QB4 A;  1PH2 A;  1CZG A;  1NR4 A;  2ASB A;  4DR2 L;  4G7Z C;  1N34 Q;  4J15 A;  3HS0 C;  2CHB D;  4B3M Q;  2NVT H;  3TQY A;  1IBL Q;  2B2T C;  4K5V A;  2JP1 A;  3LX0 A;  2AQ1 B;  1U9R A;  5EKI A;  1Q1B A;  1SLJ A;  4X3K A;  3IFD A;  3V2T A;  2KEC A;  5IP7 H;  2JA8 H;  4A3K G;  4DR7 Q;  1K0S A;  1V1P B;  4BBR B;  2OTJ A;  4OIJ A;  5ELD A;  4LF9 Q;  4A3D G;  3E6Z X;  4GZY C;  5CR3 A;  3RUZ A;  1TVX A;  5K5P A;  1K9M C;  3D8G A;  1VQ6 A;  4QJF A;  4X3T A;  4ZUI A;  3PUW A;  1C48 A;  1XXG A;  4DFA A;  1IW7 C;  1ZXT A;  4NW2 A;  1TWA H;  3GTM B;  2HUG A;  2B63 B;  1K8G A;  1X3P A;  2NN6 H;  1BR9 A;  1KD1 C;  2JE6 I;  4R4T A;  2B8G A;  2A68 D;  5JVG 3;  4ID6 A;  2F3W A;  3NEM A;  5EKL A;  2N3S A;  4HED A;  1B8A A;  4DV1 Q;  1VQE A;  3I2Z A;  4DV3 L;  1DON A;  1SYE A;  4L5Q A;  3GTL H;  2DY8 A;  4DV4 L;  2XGT A;  2EVB A;  4UAI A;  2KEE A;  5CBE E;  3Q24 A;  4X64 L;  5JEA H;  3A5Z B;  2CH4 W;  2UXB L;  2A6H D;  1SNC A;  3K59 A;  2K6A A;  4FF4 A;  1D5Z C;  4A3G B;  2ZTC A;  3F2D A;  3M85 A;  3RLF A;  2OF1 A;  3Q6S A;  5JJL A;  2B39 A;  1SND A;  5E1F A;  1H95 A;  2SEB D;  1ONL A;  3L7Z C;  5J1Z A;  2A1A A;  2L9H A;  3JAM i;  3O13 A;  3H09 A;  3I4L A;  3I4N H;  4K6D A;  1Y1W H;  3NBI A;  1NR2 A;  3LWU A;  1I4R A;  1SNO A;  3CQZ B;  1EQQ A;  1LYL A;  4DR4 L;  4NKL A;  5FLX L;  2I0Q A;  3OWE B;  2BCO A;  3GTQ H;  1VQC A;  2VL6 A;  4PZ8 A;  2KVM A;  4ZAI A;  3SR1 A;  3S1R H;  1D5X C;  1KQS A;  2HCI A;  5J22 A;  1JB7 A;  4JCV E;  2KED A;  2PMZ B;  5C4X B;  4LFC Q;  2L0C A;  1PTO C;  1WTR A;  3NE5 B;  1GUN A;  2WAC A;  3J81 L;  3NBH B;  2B29 A;  5EPK A;  2ZJQ A;  1V1P A;  1IXR A;  3M4O H;  1KNA A;  1WCM H;  3CHB D;  1D6E C;  2D0O A;  4KMU C;  4X3U A;  4DR5 Q;  5DEH A;  4RGT A;  2WB1 E;  1KRS A;  2FFK B;  4JOI A;  4BA1 I;  4XQJ A;  4LF7 L;  1GUW A;  3GTJ B;  1ZYR C;  1X65 A;  4Y7N B;  1C0A A;  2V4D A;  1AZP A;  3F8T A;  4XYO A;  2WV6 D;  2D0P A;  5AFW A;  4KN4 C;  5D3D A;  3ZYY X;  4H0L C;  2NVY H;  1TS4 A;  2H1E A;  4DU9 A;  1N34 L;  4B3M L;  1BBW A;  3DMU A;  1UE1 A;  1B4O A;  1IBL L;  4ZYS A;  4HMI A;  2Z6K C;  1TWC H;  3MWY W;  1TQO A;  1VQK A;  4JBM A;  3K5M A;  3A8I E;  4RGN A;  1MJC A;  2VS1 A;  3NEN A;  4RHS A;  1Z47 A;  4BY7 G;  3WOF A;  4DR7 L;  1B7Y B;  1F2Y A;  1JE4 A;  1M4V A;  2BA0 A;  4EQN A;  5BN3 A;  4IFD G;  5C0X H;  4XQN A;  3S14 B;  1PH9 A;  5KEE A;  4LF9 L;  3GV3 A;  5IP9 H;  2JXM B;  2CCZ A;  1O78 A;  3RZD B;  1CI3 M;  5FKA C;  4POG A;  2HQE A;  1MKH A;  1EY5 A;  2AWO A;  5FO8 B;  5CV9 A;  5IYC H;  4X3S A;  3UI2 A;  3CME A;  4A93 B;  1E2W A;  3KLW A;  3PO2 B;  2MJ8 A;  1HUN A;  4GNX B;  5E4X A;  1SYC A;  4BY1 G;  1PHJ A;  4JI3 Q;  4HJ5 A;  4O1N A;  1VQ5 A;  1IL2 A;  1WYD A;  3J80 c;  2X69 A;  1WI5 A;  4BXX H;  4DV2 Q;  1FR3 A;  4BBR H;  2R6G A;  1LTI D;  1XNR Q;  4R4C A;  4DV1 L;  1SNM A;  1DOM A;  5IWA Q;  1OXX K;  2Z6B A;  4TRD A;  4WJW A;  2X6G A;  2QIL A;  4LF5 Q;  1NSN S;  3T51 B;  3GTP B;  4LWC A;  5EQ0 A;  4JI0 Q;  1CHQ D;  1JT8 A;  2Y0S E;  1BCP C;  2PZU A;  1CK1 A;  4QIW E;  3UDF A;  2RVL A;  2Q8R E;  3NBH A;  2XNA C;  4HCE A;  2O4X A;  5EPL A;  4FYD A;  2B63 H;  1QB5 D;  1LTB D;  2MGS A;  3SK8 A;  4DV0 Q;  4U67 3;  1HFG A;  1WVL A;  3MAQ A;  3AQQ A;  4MIU A;  2C5C A;  1VQF A;  2VB3 X;  2RHQ B;  4JC0 A;  1PH4 A;  3FKI B;  2EY1 A;  4X6A H;  1ENC A;  2Q2I A;  2F0Q A;  2JA7 G;  1FGB D;  4HSV A;  2IJ0 A;  4DGZ A;  1CQV A;  3RLO A;  3VYT A;  3I4M B;  5I9P A;  2F3I A;  3SK4 A;  1SDF A;  3NUC A;  3TDQ A;  2O5J C;  1JJG A;  5J3B A;  3VYS A;  2KOL A;  1TY0 A;  3I90 A;  4CJ2 C;  4LFC L;  3CCQ A;  4BA2 I;  2H5X A;  4A3G H;  3HOU G;  3CCE A;  4ABN A;  1QG7 A;  1PH6 A;  3HFZ B;  1LTR D;  5IT9 c;  4OWW B;  2YU9 B;  1IYJ B;  1T9H A;  1JOK A;  3PUZ A;  1JOR A;  2ZT9 C;  2EOT A;  4RCO A;  5EAY A;  1HUM A;  2DJF C;  4UDU C;  4DR5 L;  3H6M A;  3NP8 A;  1TS2 A;  3CQZ H;  5DM6 3;  1FVI A;  4FXG C;  1YIT A;  1K0R A;  3S1Q H;  4TKO B;  1MD2 D;  5ELO A;  1Q90 A;  1XTD A;  4OGQ C;  3L3O C;  3MA2 B;  2B2W A;  5C4X H;  4LF8 Q;  4A3F G;  4GNX A;  2I07 B;  2I46 A;  1ML0 D;  3U58 A;  3BDL A;  2D2C C;  2H4O A;  3K81 C;  5IYD H;  3M4Q A;  4C1N K;  1HRJ A;  2NVQ B;  1UE7 A;  1KC8 C;  3NPP A;  2DNE A;  2HDM A;  5GAE C;  1IL8 A;  4POF A;  1IHZ A;  1GHJ A;  2QKI C;  4LMQ D;  3HG9 A;  1XYI A;  1NMG A;  1HZ9 A;  1PH8 A;  3HOW B;  3ULP A;  3GTJ H;  4IPH A;  1I6H H;  1A3V A;  4XYQ A;  1X32 A;  3Q8D A;  1VMC A;  1F2M A;  1HPC A;  2MP1 A;  3TZD A;  3T56 B;  4F88 A;  5ISR A;  3PF5 A;  2JN4 A;  2E74 C;  1STG A;  2G5D A;  3BYY B;  4R8I A;  1HQR D;  3K5N A;  2K52 A;  5HUR A;  4JI3 L;  4GN4 B;  3ULJ A;  4ILW A;  3KBX A;  2IX1 A;  3J80 E;  4IUP A;  1BO0 A;  2WB1 G;  4YCU A;  4O2D A;  4DV2 L;  3VR5 A;  3BU2 A;  4E6I A;  1XNR L;  1I6V C;  4KKT A;  1EUJ A;  1NE3 A;  2F4V Q;  3S14 H;  1YJN A;  2F0M A;  5IWA L;  5CGK A;  4K2K A;  2JQO A;  2BDO A;  3M4P A;  1X54 A;  4APV A;  2RHS B;  3RZD H;  5JVH 3;  4LF5 L;  3AMU A;  1VDZ A;  5K36 H;  2CVR A;  1WTV A;  1FNU A;  4B3T Q;  3A55 A;  1YHQ A;  4JI0 L;  3GV6 A;  1WTH A;  5C3E G;  1I4P A;  3V05 A;  4A93 H;  5HY6 A;  3ER0 A;  3R8B A;  2IX0 A;  2K1B A;  2K32 A;  2PW5 A;  3PCO B;  3U50 C;  2UUA Q;  4DV0 L;  4ZRZ A;  1PH1 A;  3TP6 A;  4A3L H;  1U4L A;  2E2I B;  2CWA A;  5D65 A;  1Y8P B;  1T5E A;  3DEP A;  5KIX A;  4A76 A;  1UEA B;  2PYK A;  1DOK A;  1N36 Q;  5BR8 Q;  3BZD B;  4TSS A;  3J7A V;  1HFN A;  4A3B G;  1PXU A;  5KNB A;  2R92 B;  1MSG A;  3GTP H;  5C44 B;  5EBC A;  2RSO A;  4N8X 1;  1AP0 A;  1BQQ T;  5IGE A;  2JYO A;  1U0L A;  4NXM L;  2RCN A;  4A3M G;  5IT9 E;  3S15 B;  1YI2 A;  1PTO F;  1JWU D;  4R4O A;  5DM7 3;  4GOP B;  3SDZ A;  1NJI C;  3E0J A;  2L15 A;  1QJO A;  1O80 A;  2J4X A;  2PO4 A;  3FKI H;  3N52 A;  1AEX A;  3R93 A;  5L37 A;  1K73 C;  1C7Y A;  3U4V A;  2F0D A;  2CFM A;  1J5E Q;  2N8N A;  2EPB A;  3I4M H;  2AMC B;  4QF4 A;  4JW0 A;  5CV6 A;  1ILP A;  4HR7 B;  2L55 A;  3H0G G;  2D9U A;  1PFB A;  2IW3 A;  4LF8 L;  1DD2 A;  2WKD A;  1PZJ D;  3FP9 A;  4TQU S;  3SK6 A;  2YU9 H;  4JI6 Q;  2AWN A;  5C3W A;  3AFP A;  5M3F G;  4KHV A;  2GVA A;  1HTP A;  3KJP A;  1GUT A;  2PQE A;  3OHX C;  2R7Z B;  4DXG A;  3TN2 A;  4NXN L;  1KL9 A;  5C6A A;  1YEZ A;  4JPB W;  3STB C;  3MXG A;  4J1M A;  5FO7 B;  5FJ8 G;  3TBI B;  3K7A H;  4KI0 A;  2L11 A;  3PUX A;  5H1S E;  1I94 Q;  2SNS A;  4IQZ A;  2SDF A;  4NP5 A;  4IAL A;  5DLQ E;  2BH2 A;  3L0O A;  2KJX A;  3I72 A;  2X6L A;  1D7Q A;  2F0P A;  1VMP A;  2EDG A;  1DGS A;  3CC2 A;  1VQ9 A;  4UP9 A;  2Q2U A;  2RSN A;  1VQJ A;  1A0I A;  5E4W C;  3J80 L;  4JBK A;  2NVQ H;  2F0E A;  2ICE C;  5IYB H;  5COY A;  2VUM G;  4PQX A;  4KKS A;  2F4V L;  4DR1 Q;  2R3Z A;  3T4A C;  3J7Z C;  1EQR A;  4CDF C;  2A69 C;  1HNX Q;  4S3S A;  3HOW H;  3FRP B;  2O2L D;  3TME A;  1PLF A;  4B3T L;  4UHV A;  1CSP A;  3BJU A;  1SMY D;  2K5Q A;  2N88 A;  3ICE A;  1E7Z A;  3HOY G;  3KBG A;  5IP7 G;  5I6Y A;  1BCP F;  1C9O A;  1ICF B;  4GOP A;  4PMW A;  1FNV A;  4BWG B;  2K5N A;  4QL5 A;  1ESR A;  2UUA L;  2HT1 A;  1G51 A;  1X6O A;  1M8A A;  4C3H G;  3VA7 A;  4B3R Q;  1HH2 P;  1YNN C;  4RA8 A;  3WWV A;  1RJT A;  3HOV B;  5M3M B;  4K8I A;  5BR8 L;  1N36 L;  1S5D D;  3BZK A;  2LS0 1;  1W3S A;  4K5W A;  3BVG A;  2OEO A;  3MEH A;  2JK8 A;  1EY8 A;  2PI2 A;  2NN6 G;  1IYU A;  4NDX A;  3RZO H;  3GDE A;  2SOB A;  2F0N A;  4GN5 A;  4PNY A;  3SXH A;  3VR4 A;  5IT9 L;  3BZC A;  3TS2 A;  1PVO A;  2HHH Q;  1P8L A;  3H3V C;  1P16 A;  5CV4 A;  2VQE Q;  2O5I C;  5CBA E;  1TWH B;  2QDB A;  1RHP A;  2Q2H A;  4AYB B;  2E2I H;  1EU4 A;  1E22 A;  3MZ5 A;  5A35 A;  1A3U A;  3HOZ H;  2EY6 A;  1OXU A;  3KLS A;  1J5E L;  1PFN A;  1OXS C;  4A3K B;  4XT1 B;  1V1O A;  2R92 H;  5C44 H;  1A3T A;  1CZW A;  1J9O A;  4B9X A;  3DXJ C;  4DK6 C;  4OWX B;  1WD0 A;  4A3D B;  1F77 A;  1Y1W G;  1I50 B;  3OTO Q;  2EJM A;  3S15 H;  4JI6 L;  1PRT C;  4MHE A;  2B2U C;  2UXD Q;  1WJJ A;  5LHY 1;  4J6H A;  2WAQ E;  1WTX A;  1VQO A;  3HKS A;  1NUC A;  3M3Y B;  4FP5 D;  3CP0 A;  1I5F A;  2L5T A;  3KLR A;  1SYG A;  3OOC A;  1ET6 A;  4A3I H;  3U9O A;  3R2T A;  2J7Z A;  2E5L Q;  2MUY A;  3S24 A;  2IHF A;  1K8A C;  3PIP A;  1PV4 A;  1I94 L;  2F0O A;  1DJR D;  2MNA A;  5DAU A;  3TP8 A;  1WCM G;  5C5M A;  2QA4 A;  3T1H Q;  1GKH A;  5FK9 C;  3M4Y A;  5JJZ A;  4RKL A;  1MBY A;  5FLM G;  1PYW D;  1BNZ A;  1VQP A;  3I55 A;  1STN A;  3GTG H;  1ICW A;  1SAP A;  1K83 B;  2B2V A;  1L0W A;  3L2P A;  4DR1 L;  3MTS A;  4N9P A;  4KD4 A;  5GQO A;  1D8L A;  4UP7 A;  1HNX L;  5IGB A;  3GTK H;  1SE4 A;  3G6E A;  4JI5 Q;  1B2T A;  5KGU A;  2L1B A;  2G9H D;  1LT4 D;  1J8I A;  1EQT A;  1CUK A;  2J0T D;  3KFU A;  4CBV A;  1UNS A;  3C46 A;  1CSQ A;  2A69 D;  3EQL C;  4LF4 Q;  5IP9 G;  3I91 A;  2BH8 A;  5C5L A;  1TWG B;  4DAV A;  3HOX B;  1S40 A;  4B3R L;  3PSI A;  3D0F A;  2OT2 A;  4DUY Q;  4A3C G;  2VNU D;  2MHV A;  3SEB A;  1TWF B;  2OTL A;  1DZ1 A;  4C3J G;  2OWO A;  2Q8I B;  1KDB A;  3MVV A;  5I9O A;  3A0J A;  2L4N A;  4CDD C;  3A8K E;  3KLS X;  1G6P A;  1YNN D;  1LAC A;  2HHH L;  3NXW A;  3KJO A;  4G7O C;  3CMA A;  2F1M A;  4IN3 A;  5M9O A;  4QGU A;  1KIX A;  4DV7 Q;  2VQE L;  1VQD A;  3JAM c;  2AHO B;  2A6E C;  2KHJ A;  3AFQ A;  1F9P A;  1LV9 A;  4MTK A;  1MSH A;  2F0J A;  1L0Y B;  3ZJY C;  4LAA A;  3HOV H;  3KOJ A;  3TP5 A;  4I7A A;  3GTO H;  3AU7 A;  3G7L A;  5KYL A;  1EOV A;  3Q22 A;  4BY7 B;  3W2D A;  2K14 A;  4P72 A;  1KDC A;  1SJE D;  4MZ9 A;  1EYA A;  2KCN A;  1EFI D;  2ZTE A;  5CV5 A;  1BKB A;  3EJI A;  2B2U A;  5M5Y H;  3VA5 A;  3PUY A;  1HR0 Q;  1FJG Q;  3CCS A;  4GKK Q;  3OTO L;  4C3I H;  1XPR A;  4R8N A;  4OON A;  1TWH H;  2UXD L;  2F3V A;  4DR6 Q;  2B2T A;  2XRS D;  4M1U B;  1PTO B;  2R93 G;  1S5C D;  3E5S A;  5A2Q E;  4DA2 A;  1PFM A;  4BY1 B;  4ZKC B;  4A3G G;  4AQY Q;  4QUF A;  4RH6 A;  2QGQ A;  4KLK A;  2I5M X;  4A3K H;  4IJL A;  2E5L L;  2ZXP A;  4GS3 A;  2A19 A;  1TY2 A;  3PUV A;  1KNE A;  4HCS A;  5JJK A;  2LSS A;  4A3D H;  2D5D A;  4O0A A;  1STE A;  3T1H L;  3E9H A;  1I50 H;  1Y8N B;  3QOJ A;  3UE0 A;  4M8A A;  1X56 A;  4IPC A;  1CQF A;  4JI7 Q;  4OIK A;  3BVZ A;  3K5L A;  1M90 C;  3CAM A;  5GAH C;  1C8C A;  3DEO A;  3W5O A;  3UE1 A;  4UY8 C;  1SNQ A;  4JI4 Q;  2L12 A;  3M3Y H;  1LT6 D;  3UDG A;  2UUC Q;  3ND9 A;  3RLN A;  4WRD A;  4JI5 L;  3S17 B;  3IRB A;  2JA7 B;  4YCW A;  3VR2 A;  2JJQ A;  2EIF A;  4RHR A;  3UDI A;  4DNR B;  5ELE A;  1HR0 W;  1PMR A;  1IBM Q;  1IW7 D;  1ENA A;  2WAQ G;  3FHW A;  2EYF A;  2BDN A;  2NWG A;  1EYD A;  4LF4 L;  4OO1 H;  4QUC A;  3HGB A;  1A62 A;  2P5Z X;  4UP8 A;  1L0X B;  4DUY L;  4XT3 B;  4NMZ A;  5I4D A;  4DXF A;  3MEF A;  1K83 H;  2K33 A;  4YHH Q;  5C4J B;  1G8Z D;  1XWE A;  2NVX B;  3OWF A;  2IL8 A;  3GTM H;  1QE6 A;  1TS3 A;  5EJW A;  3RR5 A;  3ERO A;  3RMH A;  1IKM A;  1FL0 A;  3PIP 3;  3C3L A;  1G2T A;  1E1T A;  3CRK C;  1GHK A;  3DWQ A;  2WII B;  5G3L F;  3CCR A;  1PH5 A;  4DV7 L;  3JAM E;  1O7Z A;  1GO3 E;  1XPU A;  4C2M B;  3U9S A;  3WDN A;  1D2B A;  4N8F A;  3C1F A;  3KF8 B;  3HOX H;  5CMD A;  1BCP B;  3RN5 A;  5I6W A;  3ND8 A;  3VR6 A;  1DM0 B;  3SHL A;  3CPF A;  3VYR A;  3G4S A;  1TWF H;  4JI8 Q;  3P20 A;  1VQI A;  4DN4 M;  4NXM Q;  5AJ3 Q;  4C1N I;  2EJF C;  1EZ6 A;  4A3L G;  2FIN B;  1Q8I A;  2PNH A;  4YY3 Q;  2CH4 A;  1I4X A;  1YNJ C;  1VQ8 A;  1HR0 L;  1UE6 A;  1FJG L;  4GKK L;  2FMC A;  1PTO D;  5EPJ A;  1BDO A;  2ATW A;  2XIW A;  1AW7 A;  1HJP A;  3ERQ A;  4DR6 L;  4IUT A;  1PRT F;  3A54 A;  5A2Q L;  3PV0 A;  3CF5 A;  2Z6K A;  4DAM A;  3CXC A;  2BOS A;  3A7L A;  2RA4 A;  5IE8 A;  3TEH B;  1GVP A;  1NMF A;  1Z6H A;  4AQY L;  1AE3 A;  5CC4 A;  2WB1 B;  3MFY A;  2F4I A;  4R1J A;  4BY7 H;  1JOQ A;  1SXT A;  1ZYR D;  4DUZ Q;  3LNN A;  3L9A X;  3I4O A;  3D31 A;  1VS0 A;  3EN2 A;  3FKI G;  5FOB B;  5E7N A;  4CKC A;  4BS9 A;  4DNI A;  4NXN Q;  4P71 A;  1SR3 A;  3TP7 A;  1F2L A;  4JI7 L;  1BVS A;  2RF4 A;  4JK1 C;  5C3E B;  3I4M G;  3DUZ A;  2JSO A;  4Y7N H;  3S2D B;  5ELN A;  4JI4 L;  5BN5 A;  4RKB A;  4EQO A;  1PTO H;  2Z4I A;  1SE2 A;  3FPP A;  1VF7 A;  2B8F A;  1SYF A;  2UUC L;  3GP7 A;  3HKZ E;  4LUV A;  2ALY B;  1RCV D;  1Y14 B;  5CV7 A;  1HTL D;  4EQ5 A;  1SJH D;  3MXU A;  1B44 D;  3D6W A;  3BS1 A;  4H7B A;  4QCL A;  3DHQ A;  3N6R A;  1R9T B;  4OX9 Q;  4B3S Q;  4DK3 C;  4V19 0;  3W3A A;  4DK0 A;  4A3B B;  4DNT B;  1XMQ Q;  1IBM L;  1AN8 A;  4C56 C;  2VW9 A;  1EY7 A;  3KF8 A;  2NN6 I;  1DOL A;  1XMO Q;  3K57 A;  4Z9C B;  1X3G A;  3R3O A;  3GQB A;  3H91 A;  1SNP A;  4A3M B;  2JA5 B;  3F2B A;  2QEJ C;  4YHH L;  1V43 A;  2DNC A;  2ENB A;  2BE5 C;  2IY5 B;  1Q46 A;  2PZW A;  4FVM A;  2EYM A;  5ELC A;  2XVS A;  2NZ1 D;  3PO2 H;  2JA6 G;  3D3R A;  3CC4 A;  1SRO A;  3S17 H;  2XN9 C;  1S3O A;  2B3G A;  2F0T A;  3I56 A;  1FGU A;  5LL6 X;  5NUC A;  3MXN B;  1LAB A;  1DYQ A;  2Y0S B;  1BCP D;  1VQG A;  1KHI A;  2IHE A;  4QIW B;  1H9J A;  3JC6 6;  3JAM L;  5IGG A;  2QEX A;  2MPM A;  3G71 A;  2R7F A;  4F7X A;  3CKI B;  2FMM A;  1EQV A;  1EY0 A;  4G57 A;  3J7A 5;  3OW2 A;  3R2I A;  2CKZ B;  1SMX A;  5C4J H;  3MXP A;  4JI8 L;  1QNK A;  1L1O C;  4FF2 A;  5M3F B;  2NVX H;  5AJ3 L;  4IUV A;  2VB2 X;  4EX5 A;  4A3E G;  1EWH A;  2Z0S A;  1KLG D;  2PPB C;  1IBK Q;  2FHT A;  1EYG A;  1VQH A;  4YY3 L;  1RF2 D;  2PZT A;  3PO3 G;  2E8G A;  3TS0 A;  4X62 Q;  2D62 A;  1B50 A;  1U5K A;  4H02 A;  4BBS B;  4L5R C;  4KHP Q;  1ROD A;  4OL7 A;  4JI1 Q;  4C2M H;  2LXJ A;  2EY2 A;  2KCM A;  1S5E D;  1I4G A;  4FDB A;  1L1O B;  2AQ2 B;  1BUV T;  2HQL A;  3NQI A;  4K5X A;  4I7Z C;  3GD7 A;  3W1B A;  4PZ6 A;  1HA6 A;  1QCB D;  3KUP A;  2ZJR A;  1CKN B;  1SEB D;  4K6L A;  4V0B A;  3H3V I;  1HZC A;  3E0E A;  1B53 A;  3IL8 A;  2VUM B;  1TXY A;  3Q0A A;  3IAY A;  4DUZ L;  1EY9 A;  1JJ2 A;  4CJ0 B;  1D1I A;  1EY6 A;  2R61 A;  4P75 A;  3J81 i;  2WKC A;  3HOZ G;  2UU9 Q;  4YIJ A;  5FO9 B;  1BOS A;  1LT3 D;  2F0S A;  3HOY B;  3T1Y Q;  1V9P A;  3I3C A;  2G9D A;  5C44 G;  3D4W A;  3TRZ A;  1Y1V G;  3DM1 A;  3OSO A;  4C3H B;  1STY A;  4ULL A;  5COR A;  1O7I A;  1RD9 D;  3PGZ A;  1HNW Q;  2RCF A;  3MXN A;  1BXT A;  5IGC A;  1GOZ A;  1LO5 D;  1KRT A;  1N33 Q;  5C4H A;  4OX9 L;  4B3S L;  1YNX A;  1WD1 A;  1A2U A;  1XMQ L;  2F0L A;  3I7F A;  1XMO L;  1YJ9 A;  5C3E H;  2Z8L A;  4A3I G;  2GA4 B;  1JWS D;  3S2D H;  1K28 A;  4KY7 A;  1YHA A;  4ZK9 B;  1IZ6 A;  4HJA A;  1SYD A;  2JA8 G;  3HZX A;  4WJ3 M;  1U4M A;  1K3B C;  4FF3 A;  1I4Q A;  1RKN A;  4JBJ A;  1A6X A;  1CKM A;  1HCZ A;  2A68 C;  2I5H A;  4LK1 C;  1UAP A;  4B08 A;  5D3I B;  1R9T H;  1CA5 A;  4A3B H;  3QIA A;  4L5T A;  4YCV A;  2EZV A;  2YV5 A;  3OW7 A;  4WOR A; 
#chains in the Genus database with same CATH homology
 1L1O A;  2VQF Q;  2HIX A;  4A75 A;  3HOU H;  2B63 H;  3A0J A;  4A3M H;  3HKZ G;  1CKN A;  4AH6 A;  2JA5 H;  2UUB L;  2YTY A;  4PG3 A;  3RNU A;  4DV0 Q;  1G6P A;  3AQQ A;  2AKW B;  2I5L X;  1KXL A;  3SGI A;  1VQF A;  4LFA L;  4Y52 H;  2HHH L;  4DR3 L;  3KJO A;  2K5H A;  2RHQ B;  4JC0 A;  4X65 Q;  4GOP C;  1PH4 A;  4LFB Q;  3CMA A;  4X6A H;  4QY7 A;  4QGU A;  3F1Z A;  2Q2I A;  1KIX A;  4DV7 Q;  1Q86 C;  2VQE L;  2JA7 G;  1VQD A;  2CWP A;  3JAM c;  1IBK L;  1I3Q H;  2AHO B;  2K5V A;  2ZJP A;  2KHJ A;  4IOA A;  3AFQ A;  3RLO A;  5JJI A;  2F3I A;  4TVA B;  1N32 L;  3A5U A;  4X62 L;  2ES2 A;  1K3R A;  1JJG A;  4AYB E;  2N78 A;  4DPG A;  5J3B A;  5LMU Q;  3ZJY C;  5JEA G;  3CC7 A;  3HOV H;  3S1M H;  3KOJ A;  2GVB A;  4KHP L;  4LFC L;  3CCQ A;  4BA2 I;  3S2H H;  3GTO H;  4JI1 L;  3PIO A;  2H5X A;  1HNZ L;  4A3G H;  4A3F H;  1YJW A;  1EOV A;  1EWI A;  4DV5 Q;  3CCE A;  3HOU G;  4GLA C;  2PMZ E;  2K14 A;  4MTN A;  1B70 B;  3HFZ B;  4P72 A;  1PH6 A;  2JA5 G;  4IFD I;  4R4Q A;  5IT9 c;  1VQ7 A;  4OWW B;  1SRU A;  4MZ9 A;  1IYJ B;  4A4I A;  1T9H A;  1JE5 A;  2ZTE A;  3PUZ A;  1BKB A;  4K0K Q;  5M5X H;  5M5Y H;  5EAY A;  3PUY A;  5M3F H;  3I4N G;  1HR0 Q;  5FLX c;  1FJG Q;  3CCS A;  4GKK Q;  3OTO L;  3E9I A;  4L5S A;  1BBU A;  1LM0 A;  1RIP A;  4HJ8 A;  4DR5 L;  4LF6 L;  4LF6 Q;  2KCT A;  4MNO A;  4C3I H;  1NBW A;  3CQZ H;  1XPR A;  2HIV A;  1TWH H;  4OON A;  1FVI A;  2Q2T A;  2UXD L;  3CD6 A;  1YIT A;  1K0R A;  1E3P A;  4DR6 Q;  3S1Q H;  2Y0S G;  5ELO A;  4BBS H;  1E1O A;  1XTD A;  2UU9 L;  3HOV G;  2R93 G;  3G48 A;  5C4X H;  3J81 c;  4A3G G;  4LF8 Q;  4A3F G;  4AQY Q;  4GNX A;  1PH7 A;  2QGQ A;  4OWT B;  3T1Y L;  1YIJ A;  4KLK A;  3EIV A;  2I5M X;  5GRO A;  3U58 A;  4A3K H;  4IJL A;  1EIF A;  5C0X I;  4HIO A;  2E5L L;  2R92 G;  2YTV A;  3K81 C;  2A19 A;  3A74 A;  3M4Q A;  3PUV A;  4GS3 A;  5IYD H;  4AIM A;  2GN5 A;  1UE7 A;  1KC8 C;  5JJK A;  2VZA A;  3K0X A;  2LSS A;  3CPW A;  4UPA A;  2EXD A;  5GAE C;  4A3D H;  4O0A A;  4POF A;  3STB D;  3T1H L;  3E9H A;  1I50 H;  2VUM H;  3UE0 A;  2PQA A;  1HNW L;  1X56 A;  1RL2 A;  4IPC A;  4JOI C;  4JI7 Q;  4RG1 A;  4DR2 Q;  4AYB G;  1NMG A;  1HZ9 A;  1N33 L;  1YBY A;  1PH8 A;  1AE2 A;  1WOC A;  3ULP A;  3GTJ H;  1N8R C;  4IPH A;  3CAM A;  1M90 C;  1I6H H;  5GAH C;  3W5O A;  3UE1 A;  4BBS G;  3GO5 A;  4UY8 C;  3Q8D A;  4JI4 Q;  3M3Y H;  2R7Z H;  2XTI A;  4LUO A;  3LGJ A;  3PF5 A;  3UDG A;  3KF6 B;  2UUC Q;  3HOY H;  1LTL A;  3RLN A;  4JI5 L;  1CKO A;  4HJ7 A;  3GTQ H;  2JA6 H;  2K52 A;  1UE5 A;  2OQK A;  1Z9F A;  3IRB A;  4JI3 L;  4GN4 B;  3ULJ A;  1GD7 A;  4YCW A;  3AYH B;  2JJQ A;  2EIF A;  2IX1 A;  4OO1 I;  3UDI A;  4DAY B;  2WB1 G;  4GLV B;  1YHB A;  1HR0 W;  4C3H H;  4YCU A;  4O2D A;  5C0X G;  4DV2 L;  3BU2 A;  1IBM Q;  1XNR L;  2WAQ G;  5JEA J;  1EUJ A;  1NE3 A;  3FHW A;  4HIM A;  2F4V Q;  2K50 A;  4LF4 L;  3S14 H;  2MQH A;  3KYH C;  1YJN A;  2WP8 J;  5IWA L;  4GKJ Q;  2JQO A;  2K4K A;  2WFW A;  4DV6 L;  1A8V A;  2NZH A;  3M4P A;  1X54 A;  4APV A;  4NB3 A;  2RHS B;  2E2J H;  1A62 A;  4UP8 A;  3RZD H;  4DUY L;  4LF5 L;  1OTC A;  1HZA A;  3MEF A;  2R7Z G;  2UXC Q;  5IYC G;  4B3T Q;  1K83 H;  4YHH Q;  1YHQ A;  4JI0 L;  1QVG A;  2ZTD A;  5C3E G;  1X3F A;  4A93 H;  1JJC B;  2VQF L;  1PFS A;  3GTM H;  3B6Y A;  5HY6 A;  3ER0 A;  4ALP A;  1QZH A;  2IX0 A;  3S1N H;  3RR5 A;  1X9N A;  3PCO B;  3U50 C;  4A3E H;  2UUA Q;  4DV0 L;  4DV3 Q;  1FL0 A;  1PH1 A;  2NZO A;  4GN3 B;  4IPD A;  1E1T A;  2CWA A;  4A3L H;  4PZ7 A;  2MFI A;  3PO3 H;  4BXX G;  4DV4 Q;  4X65 L;  3AEV A;  3CCR A;  3DLL A;  4A76 A;  4LFB L;  4BBR G;  1PH5 A;  1SE8 A;  4DV7 L;  3CW2 C;  4X64 Q;  4X66 Q;  1GO3 E;  3U4Z A;  5BR8 Q;  4IPG A;  1Q82 C;  1N36 Q;  1XPU A;  2UXB Q;  4OO1 G;  2OCE A;  4JBW A;  3KF8 B;  3HOX H;  3CCU A;  4A3B G;  3RN5 A;  3W1G A;  3GTP H;  4JI2 Q;  5LMU L;  2K75 A;  2KHI A;  3H0G H;  5M3M H;  3CPF A;  3G4S A;  4HIK A;  1TWF H;  4JI8 Q;  5IY0 A;  1VQI A;  4NXM L;  1U0L A;  4NXM Q;  1J6Q A;  2YYZ A;  4DV5 L;  5AJ3 Q;  4YWL A;  4IJH A;  2RCN A;  2B63 G;  4IFD J;  4A3M G;  1YI2 A;  4R4O A;  3CCM A;  4A3L G;  4DR4 Q;  4GOP B;  2PNH A;  4K0K L;  4YY3 Q;  1QVC A;  1NJI C;  1MJE A;  4LUZ A;  1VQ8 A;  4A3J H;  4YWK A;  1UE6 A;  2L15 A;  1HR0 L;  1FJG L;  4GKK L;  2IT1 A;  2JA9 A;  1PH3 A;  3FKI H;  3PF4 A;  3CCJ A;  1C7Y A;  1K73 C;  2V1C C;  1QZG A;  3U4V A;  2CFM A;  2ATW A;  3K80 C;  1HJP A;  1J5E Q;  2EQS A;  2N8N A;  5LMN Q;  3HOX G;  3TRE A;  3I4M H;  4DR6 L;  2AMC B;  1VQB A;  5FJ8 H;  3KF6 A;  3PV0 A;  3CF5 A;  2Z6K A;  4DAM A;  3CXC A;  3H0G G;  5M3M G;  5IE8 A;  1Q12 A;  3TEH B;  1GVP A;  1NMF A;  2KEN A;  4P74 A;  4LF8 L;  4AQY L;  1AE3 A;  4HJ9 A;  1Y1V H;  1YVC A;  1QUQ B;  4R1J A;  4BY7 H;  5C0X J;  3FP9 A;  4TQU S;  4DUZ Q;  2YU9 H;  4JI6 Q;  1VCI A;  2AWN A;  1N9W A;  4LF7 Q;  3AFP A;  3I4O A;  5FLM H;  5M3F G;  1HZB A;  4YWM A;  4A3J G;  1EFW A;  3D31 A;  1EIY B;  2DGY A;  1LUZ A;  2DUD A;  1VS0 A;  1XJV A;  5HGQ A;  3EN2 A;  4HID A;  2GVA A;  3FKI G;  3KJP A;  5E7N A;  4IOC A;  1PH2 A;  4DNI A;  4OXP A;  1JMC A;  2ASB A;  4NXN L;  1KL9 A;  2N49 A;  1YEZ A;  4P71 A;  1SR3 A;  4JI7 L;  3STB C;  4DR2 L;  4NXN Q;  1BVS A;  2RF4 A;  1N34 Q;  4J15 A;  2NVT H;  4B3M Q;  3I4M G;  3TQY A;  1IBL Q;  5FJ8 G;  2ZM6 Q;  4Y7N H;  5ELN A;  3K7A H;  4KI0 A;  4JI4 L;  4GLX A;  5C4X G;  3H15 A;  4JYA Q;  3PUX A;  5H1S E;  1NY4 A;  3KDF B;  1Q1B A;  1SLJ A;  1I94 Q;  2UUC L;  5DLQ E;  4GNX C;  2BH2 A;  1XNQ Q;  3L0O A;  3HKZ E;  4LUV A;  1PYB A;  2ALY B;  1Y14 B;  5GAG C;  5IP7 H;  1VQA A;  2JA8 H;  4KHZ A;  3CCV A;  4A3K G;  4DR7 Q;  1D7Q A;  1DGS A;  3CC2 A;  1X55 A;  1VQ9 A;  3K8A A;  4EQ5 A;  5IYD G;  4UP9 A;  4DKA C;  2Q2U A;  1VQJ A;  1A0I A;  2OTJ A;  4LF9 Q;  4JBK A;  2NVQ H;  4A3D G;  4OX9 Q;  1VQ4 A;  4B3S Q;  1MIU A;  4DK3 C;  5IYB H;  1K9M C;  4JV5 Q;  2VUM G;  1XMQ Q;  1VQ6 A;  1IBM L;  4QJF A;  2JEB I;  4A3C H;  2VW9 A;  1S72 A;  2F4V L;  2NN6 I;  1OXV A;  2LXK A;  3J7Z C;  3PUW A;  4DR1 Q;  5M5W H;  1XMO Q;  4GKJ L;  4ME3 A;  1EQR A;  4C3J H;  1X3G A;  1HNX Q;  1TWA H;  3HOW H;  5LMN W;  1K8G A;  4WJ4 A;  1QVF A;  2UXC L;  3F2B A;  3J80 i;  4B3T L;  4YHH L;  2A8V A;  1CSP A;  3BJU A;  1V43 A;  2IY5 B;  2C35 B;  1Q46 A;  3ICE A;  1E7Z A;  3ULL A;  3HOY G;  1KD1 C;  2JE6 I;  5IP7 G;  4R4T A;  2E2H H;  4GOP A;  1C9O A;  2JA6 G;  3NEM A;  4PMW A;  3CC4 A;  1SRO A;  3PO2 H;  1Q7Y C;  3S17 H;  2K5N A;  2N3S A;  1S3O A;  2B3G A;  1B8A A;  4QL5 A;  4DV1 Q;  1VQE A;  3I2Z A;  4DV3 L;  3I56 A;  2UUA L;  1FGU A;  1G51 A;  1X6O A;  2HT1 A;  4L5Q A;  3GTL H;  3K7U C;  3MXN B;  2VY3 A;  4B3R Q;  4DV4 L;  2XGT A;  1HH2 P;  1YZ6 A;  1VQG A;  1KHI A;  2IHE A;  3WWV A;  3JC6 6;  1UEB A;  4LNQ A;  2QEX A;  1V1Q A;  3G71 A;  2R7F A;  2BA1 A;  4X66 L;  3A5Z B;  4X64 L;  5BR8 L;  1N36 L;  2UXB L;  3BZK A;  2ZTC A;  3F2D A;  1W3S A;  3M85 A;  1TWG H;  3RLF A;  5K36 G;  5JJL A;  1X3E A;  1ASY A;  4JI2 L;  2JK8 A;  3OW2 A;  3J7A 5;  2UUB Q;  1H95 A;  2CKZ B;  2PI2 A;  1SMX A;  2NN6 G;  1SN8 A;  1QUQ A;  5C4J H;  3L7Z C;  4JI8 L;  2FXQ A;  3GDE A;  3RZO H;  4A93 G;  2A1A A;  4GN5 A;  1L1O C;  2NVX H;  4LFA Q;  3JAM i;  3BZC A;  5AJ3 L;  3TS2 A;  2HHH Q;  4DR3 Q;  3I4N H;  3PO2 G;  3RN2 A;  1PVO A;  1Q81 C;  1Y1W H;  4EX5 A;  1P8L A;  4A3E G;  1P16 A;  2Z0S A;  2VQE Q;  1EQQ A;  1IBK Q;  1LYL A;  2ID0 A;  3CCL A;  1EYG A;  4DR4 L;  1VQH A;  2I0Q A;  4YY3 L;  2Q2H A;  2E2I H;  3PO3 G;  1E22 A;  3ERS X;  2E8G A;  1PYS B;  3TS0 A;  1Q1E A;  1VQC A;  2YTX A;  2VL6 A;  1E24 A;  4PZ8 A;  1N32 Q;  4X62 Q;  2D62 A;  1U5K A;  4H02 A;  3J81 j;  2MO0 A;  3S1R H;  3HOZ H;  1KQS A;  2R93 H;  1JB7 A;  4L5R C;  4JCV E;  4KHP Q;  4LFC Q;  5GAD C;  1OXU A;  2OQ0 A;  1J5E L;  4JI1 Q;  4P73 A;  4C2M H;  1HNZ Q;  2LXJ A;  5LMN L;  1OXS C;  2KCM A;  3KDF A;  1UWV A;  4FDB A;  1VQM A;  1L1O B;  2R92 H;  2HQL A;  5C44 H;  3NBH B;  3GD7 A;  1WFQ A;  3W1B A;  2B29 A;  4JG2 A;  4PZ6 A;  4XIG S;  2ZJR A;  4DK6 C;  4OWX B;  1CKN B;  3F2C A;  2ZJQ A;  1IXR A;  3H3V I;  1NTG A;  2CQO A;  1HZC A;  1WCM H;  3E0E A;  3M4O H;  2D0O A;  1Y1W G;  3OTO Q;  1TXY A;  4DR5 Q;  3S15 H;  1OXT A;  4RMF A;  4DUZ L;  2PI2 E;  4JI6 L;  2WB1 E;  1KRS A;  1ASZ A;  2R7D A;  4JOI A;  4BA1 I;  1JJ2 A;  4LF7 L;  2UXD Q;  1WJJ A;  1L2F A;  2WAQ E;  1X65 A;  4P75 A;  3J81 i;  1VQO A;  1C0A A;  3HKS A;  3F8T A;  3HOZ G;  2D0P A;  2UU9 Q;  3CP0 A;  1I5F A;  2NVY H;  1N34 L;  3OYY A;  4B3M L;  1BBW A;  1UE1 A;  2KBN A;  1GM5 A;  4A3I H;  4QQB X;  3T1Y Q;  1IBL L;  1V9P A;  2ZM6 L;  2Z6K C;  1TWC H;  3S24 A;  5C44 G;  2E5L Q;  1VQK A;  2IHF A;  1K8A C;  4JBM A;  1W2B A;  3PIP A;  1PV4 A;  4JYA L;  4BY1 H;  1I94 L;  3M9B A;  2MNA A;  4LW1 A;  1MJC A;  1XNQ L;  1WCM G;  1Y1V G;  2VS1 A;  4NPS A;  3NEN A;  3TRZ A;  1Z47 A;  4BY7 G;  2QA4 A;  4DR7 L;  1B7Y B;  4IFD G;  2BA0 A;  1GKH A;  3T1H Q;  1O7I A;  1PA6 A;  3PGZ A;  1HNW Q;  1M1K C;  2MO1 A;  1G29 1;  1KRT A;  1PH9 A;  3NEL A;  4LF9 L;  5FLM G;  3S16 H;  1N33 Q;  5IP9 H;  2CCZ A;  1VQL A;  4OX9 L;  1VQP A;  4B3S L;  3UDX A;  3I55 A;  1YNX A;  3GTG H;  4JV5 L;  1AH9 A;  1XMQ L;  4POG A;  3H3V H;  3I7F A;  1MKH A;  2AWO A;  1L0W A;  3L2P A;  3M7N A;  5IYC H;  4DR1 L;  3CME A;  5GQO A;  1YJ9 A;  1XMO L;  1D8L A;  4UP7 A;  1HNX L;  4IO9 A;  5C3E H;  4A3I G;  3GTK H;  3DM3 A;  1Q8K A;  3G6E A;  4JI5 Q;  3KLW A;  3S2D H;  4GNX B;  1XPO A;  1VQN A;  1KAW A;  1A63 A;  4BY1 G;  1PHJ A;  1YHA A;  4JI3 Q;  4HJ5 A;  1IZ6 A;  2F52 A;  4HJA A;  1CUK A;  1VQ5 A;  1IL2 A;  1WYD A;  4R4I A;  2JA8 G;  3J80 c;  3KFU A;  4WJ3 M;  1WI5 A;  4BXX H;  4DV2 Q;  1CSQ A;  4JBJ A;  1CKM A;  4XTC S;  4BBR H;  2R6G A;  1XNR Q;  4R4C A;  4DV1 L;  2I5H A;  4LF4 Q;  2JA7 H;  5IP9 G;  5IWA Q;  1OXX K;  2PQA B;  2JEA I;  2BH8 A;  5IYB G;  4DV6 Q;  1R9T H;  1S40 A;  4B3R L;  3PSI A;  3D0F A;  3EBE A;  4DUY Q;  4LF5 Q;  3VDY A;  4A3B H;  4A3C G;  1SFO H;  2VNU D;  4LWC A;  4L5T A;  4YCV A;  4JI0 Q;  1JT8 A;  2YV5 A;  2Y0S E;  2OTL A;  2OWO A;  4QIW E;  3HOW G;  3UDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...