3KDFA

X-ray crystal structure of the human replication protein a complex from wheat germ cell free expression
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
b'VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 14 kDa subunit
publication title X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression
rcsb
source organism Homo sapiens
molecule tags Replication
total genus 23
structure length 115
sequence length 115
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kdfA00
3SGIA 2K75A 2NN6I 4YHHQ 4HIOA 1WCMG 4BXXH 3M85A 5LMUQ 3ULPA 2GVAA 4C3IH 2ASBA 2OTJA 3MXNB 3HOZH 4A3FG 1XNQQ 1TWHH 1Q7YC 2ZTCA 4EQ5A 2N8NA 3J7A5 1IBMQ 5C44G 1VS0A 4X6AH 3GTPH 2CFMA 1YVCA 1TWAH 4OO1I 1EIFA 4TQUS 1SROA 1EIYB 1XTDA 4BA2I 3MEFA 4JI3L 3K8AA 2LSSA 4JI2Q 4A3KG 2IY5B 1N34Q 4IOAA 1Q82C 3S1RH 4JI0L 4A3LH 5M5WH 3I7FA 4MNOA 4PG3A 3RLOA 2Z6KA 1CKNA 3AQQA 3NEMA 4UP7A 4DAMA 1PFSA 1YHQA 3BU2A 3D31A 1PH4A 1QVFA 1XNRL 3EIVA 1V9PA 2IX1A 4LF7L 3CAMA 1XMOQ 2GVBA 4A3BG 5ELNA 2JE6I 1I94Q 2GN5A 5FLMG 1BBWA 1CSQA 1KRTA 1PHJA 1AE3A 4KHPL 4B3RQ 3Q8DA 1YNXA 2ZJQA 2QEXA 1N9WA 5E7NA 2E2HH 1E22A 2IT1A 4A3JH 1HNXL 2QA4A 2VQFL 1EQRA 1U5KA 1IBML 2N49A 2WB1G 2Q2IA 4YWKA 3HOUH 2IHEA 1X55A 4OWXB 5M3MG 1WI5A 4NB3A 4BY7H 4QY7A 4GS3A 2CQOA 2CCZA 4P72A 5GAHC 1SLJA 1N34L 1E24A 1FL0A 1IBKQ 4RG1A 3JAMc 4IJHA 2ID0A 4DR5Q 1PV4A 2NVXH 3CF5A 3KF6A 4JOIC 4TVAB 2K52A 4GOPB 3K7AH 3ULJA 3S15H 4B3TQ 1XMOL 4K0KQ 1VQAA 1YHAA 1VQKA 2R92G 4DUYL 1SRUA 1I3QH 2VL6A 4B3SQ 2R7ZH 2ZJPA 1M1KC 4DV4Q 5HGQA 3GTLH 2UXDQ 4LF8L 4B3RL 3M7NA 1VQGA 4UP9A 1C7YA 3S16H 1BVSA 4C2MH 1ASZA 3S1QH 4A3LG 3K80C 4JI8L 4IJLA 4HJ8A 4DV2L 3OYYA 3G71A 2Q2UA 1VQPA 3HKSA 3NENA 3TREA 1TWFH 1MJEA 3PUZA 4GKJQ 1YHBA 4ME3A 2VZAA 4A4IA 4DR5L 2V1CC 3H0GG 5IYCG 4YCUA 2ZM6Q 1S40A 1QZHA 2YYZA 2UUBL 3CW2C 4DR7L 4HIKA 1AH9A 2R6GA 3UE0A 1IZ6A 2XTIA 3VDYA 2HIXA 5C0XI 1TXYA 2WAQG 3STBD 1IBLQ 1NMGA 4A3FH 1Q46A 3PIPA 2IX0A 1XMQQ 1KQSA 3HOUG 1VQFA 4POFA 5C44H 4QIWE 4HJAA 4B3SL 4QJFA 3PUYA 5C3EG 3E0EA 4POGA 2WFWA 2UXDL 3UDIA 1S3OA 3L7ZC 3UDXA 2E5LQ 1RIPA 2JEBI 4A3KH 2KCTA 4IFDI 3F1ZA 1PYSB 3TS0A 4JI6Q 1QUQA 2AWNA 4DV5Q 4OO1G 2MNAA 5C4XG 4MTNA 3GTKH 1TWGH 5IWAQ 2YTXA 4A3CG 3RLFA 3F2CA 4JI7Q 5IT9c 4GLXA 2JA7G 1JT8A 2DUDA 3PCOB 4LW1A 1YJNA 2E2JH 2R7DA 1VQ7A 3OTOL 4A3IG 1I50H 2R7ZG 3U50C 1VQNA 3F2BA 1P8LA 1WFQA 4DV3Q 2I5MX 4FDBA 2UXBQ 1Z9FA 4JYAQ 4JI3Q 2HQLA 2EQSA 5IP7G 1HNWL 3HKZG 3D0FA 3FP9A 3KDFB 4IO9A 4LF4Q 4NPSA 4GNXA 4GKKL 1HZCA 1FGUA 4A3EG 4RMFA 4R4OA 1KRSA 3HFZB 5M3MH 1VQMA 2FXQA 4A75A 5JJLA 3RN2A 4DV7L 1Q8KA 4HJ9A 1I6HH 4DV1L 3M3YH 1GM5A 3CPWA 2YTVA 3M4PA 4GLVB 4PZ6A 4DV5L 1JJCB 5IE8A 2I0QA 2UU9Q 1S72A 1JE5A 4LUOA 2L15A 1XPUA 3U4VA 3U4ZA 4YCVA 3HOWG 5IWAL 1J5EL 1VQ6A 4JI7L 3FHWA 4JV5Q 1C0AA 3GD7A 1WYDA 5IYBG 2JEAI 3AEVA 3KJOA 2B29A 1HNXQ 2VQFQ 4YCWA 4C3HH 1YBYA 2R92H 2KBNA 4L5RC 1G51A 2VY3A 4DV3L 4A3DH 2UXBL 4JYAL 2ZTDA 3HOYG 4LF4L 1X3EA 1J6QA 4A3MG 4YY3L 2BH2A 1BKBA 1VQOA 3H15A 1PH3A 2UU9L 1GO3E 3EN2A 5IY0A 4IPDA 3PV0A 3STBC 3H0GH 5IYCH 1LM0A 1X65A 2K4KA 2R93G 2D0OA 4DUYQ 1VQ5A 4JI4L 1MJCA 5GAEC 3GDEA 5JEAG 3PGZA 4LF8Q 4JV5L 3PO2G 2NVTH 1VCIA 4B3ML 1FVIA 2RF4A 3CC4A 1VQ8A 3DM3A 3GTJH 3M9BA 1CSPA 2K5HA 3IRBA 4QGUA 3HOXG 3CD6A 4GOPA 3S1MH 3KLWA 1Y1VG 4JI8Q 1K83H 1Y1WG 1Q1EA 1W2BA 2Y0SG 4JBJA 5C3EH 4DV2Q 4JBWA 5C0XG 1NTGA 1VQLA 2B63G 2BH8A 1K9MC 1YEZA 4JBMA 3UDGA 4P71A 1L1OC 2DGYA 3EBEA 4R4QA 1RL2A 3RNUA 4LUZA 1HZBA 3I4NG 4AYBE 3E9IA 1LUZA 1N8RC 4X65L 4DR4L 3NELA 2OTLA 1WJJA 5C4XH 3A5ZB 3K0XA 2UUBQ 1XPOA 1VQ4A 4DR7Q 1UE7A 2AKWB 4IFDG 1Q1BA 2PQAB 2ZJRA 1OXXK 4A93H 1K0RA 4A3CH 2K5VA 3I4OA 2JA6H 3S2DH 4DR6L 2JA7H 4YWLA 4BY1G 4LNQA 4KLKA 3H3VI 4AH6A 5H1SE 3ERSX 4A3IH 4JI5L 3KYHC 4L5TA 5LMNW 4A76A 2MQHA 1E1TA 4A3DG 2MO0A 4LUVA 1XJVA 5IP7H 3BJUA 2VQEL 2WP8J 2NVYH 3PSIA 2KHIA 2LXKA 4EX5A 1C9OA 3CC7A 2JA5G 3CCRA 3NBHB 4A3EH 1Q86C 2MO1A 1GVPA 1PYBA 2Q2HA 1TWCH 3CQZH 4IOCA 3U58A 4R1JA 2Z6KC 2UUCQ 1PH8A 3BZCA 1OXUA 4BBSG 3T1YL 3S1NH 4LF6Q 4L5SA 1HR0W 3CMEA 4UP8A 1PVOA 5IYDH 3OTOQ 2E8GA 3PUVA 4KHZA 1EUJA 4PZ8A 3HOWH 1A62A 4L5QA 4R4CA 5GADC 3S24A 5GAGC 1HZ9A 4JBKA 1HNWQ 5IYBH 3TQYA 4X66Q 2NN6G 4GKKQ 1JJ2A 4WJ3M 4O2DA 1SE8A 3J80i 4BXXG 4NXNL 5BR8Q 4XTCS 1VQHA 3FKIH 4LWCA 4DV7Q 3TEHB 2OWOA 4X64Q 1X3GA 1FJGQ 5LMNL 4DV1Q 1UE1A 3KJPA 3AYHB 2F3IA 3HOYH 2WB1E 1A0IA 1K3RA 3G4SA 1K73C 2HT1A 3S2HH 4A3MH 4KI0A 2K50A 1OXVA 2UUCL 1J5EQ 1X54A 5M5XH 1X9NA 1PA6A 3KDFA 1KIXA 4A93G 2JA6G 1U0LA 3CPFA 4LF6L 3F8TA 1GKHA 2N3SA 5IP9G 1N36Q 2R93H 1HR0L 1NJIC 4LFBQ 2PNHA 2LXJA 2K5NA 2NZOA 2AHOB 3KFUA 3A5UA 3PF5A 3PO2H 4GLAC 1BBUA 2PI2E 1K8AC 4NXML 4LFCQ 4X66L 3DLLA 1SN8A 1L2FA 3HOXH 1PH7A 2ZTEA 5BR8L 1Y1VH 1Y1WH 5GQOA 4BA1I 4BBRG 1CKMA 4YY3Q 2H5XA 1IYJB 4JCVE 2MFIA 4AQYL 2KHJA 4X64L 4UY8C 1FJGL 1B70B 1VQJA 2AMCB 4DR2Q 2A8VA 2CKZB 2B63H 4Y52H 4LFAQ 1M90C 2E2IH 1V1QA 3I4NH 1OXTA 1QZGA 1IXRA 4IPGA 1NY4A 4O0AA 5IYDG 5EAYA 3ICEA 3I4MG 1KC8C 4PZ7A 1MIUA 2D62A 4GN5A 2JK8A 5C4JH 4JI4Q 5HY6A 3JC66 4UPAA 4DKAC 1G6PA 1OXSC 2F4VL 1E7ZA 1KXLA 4B3MQ 4P74A 4OX9L 4BY1H 1JJGA 2Z0SA 1N36L 4OWWB 1T9HA 1HZAA 2JA8G 1Z47A 3OW2A 3CCMA 4LFBL 3FKIG 4HIMA 5DLQE 5JJIA 1LYLA 5FJ8G 3PO3G 3A74A 5M3FG 2WAQE 2C35B 1VQEA 4XIGS 2PI2A 3RR5A 3J81i 3J81j 3G48A 4LFCL 4Y7NH 4LF5L 1VQIA 4DR4Q 4X65Q 2JA5H 1XNQL 2RCNA 4JOIA 4OXPA 2I5HA 3CMAA 2OCEA 1AE2A 3CCVA 4DR2L 3T1HL 1EYGA 4LFAL 3M4QA 5J3BA 4BBSH 2VUMG 1V43A 4JI1Q 1L1OB 4DR6Q 3PUXA 2YTYA 4DUZL 4DAYB 3I56A 1VQBA 3B6YA 2K14A 1B8AA 3CCUA 1JMCA 4JI5Q 4HJ5A 3J80c 3PF4A 4DR1Q 3KOJA 1XPRA 4R4IA 5M5YH 3ZJYC 3AFPA 2A1AA 3GTMH 4QL5A 2VQEQ 4JG2A 3HOVG 3L2PA 3BZKA 4GNXC 2D0PA 4QQBX 2PQAA 1LTLA 1O7IA 3W1BA 2ALYB 2AWOA 2VW9A 1EWIA 1E1OA 2A19A 1HNZL 2HHHQ 2NZHA 3HKZE 3T1YQ 3UE1A 3S17H 1OTCA 2PMZE 4PMWA 1SR3A 4WJ4A 1JB7A 1H95A 4DK6C 1VQDA 2Q2TA 1P16A 3CP0A 4YHHL 1CKNB 1EOVA 5LMUL 3M4OH 4JI1L 4LF9Q 3UDFA 4AIMA 4IPCA 4X62Q 4GN3B 4DPGA 5IP9H 1X56A 3CCJA 1CKOA 3E9HA 4NXNQ 2IHFA 3CXCA 4DR1L 1ASYA 3TS2A 2NVQH 1B7YB 5LMNQ 1HNZQ 4JI2L 3TRZA 3GTQH 4A3GG 1EQQA 1W3SA 2ATWA 3W5OA 1N33Q 2CWAA 3RLNA 4APVA 4YWMA 4BBRH 2UUAQ 2HIVA 3AFQA 2HHHL 4DR3Q 2JQOA 5FLXc 3HOZG 5JEAJ 1K8GA 2VS1A 2BA0A 1CUKA 3RZDH 1YIJA 1HR0Q 1Q12A 1I94L 3I4MH 1L0WA 4ALPA 1N32Q 2UXCQ 2QGQA 3KF6B 3J7ZC 3GTOH 1UEBA 3K81C 4NXMQ 4LF9L 5C0XJ 1X3FA 4C3JH 1QVCA 4X62L 5AJ3Q 3J81c 1PH5A 1D7QA 3W1GA 1I5FA 2JA8H 1SMXA 4GOPC 3PIOA 4MZ9A 4AQYQ 3PO3H 5FJ8H 5M3FH 1Y14B 4DV0Q 3G6EA 3H3VH 4J15A 1IBKL 4IFDJ 4R4TA 3RZOH 3PUWA 4H02A 5GROA 2EXDA 1N33L 2Y0SE 2JJQA 1NBWA 2B3GA 2OQKA 2UUAL 2RHSB 3S14H 3GO5A 1A63A 5JJKA 1HH2P 1WOCA 1VQ9A 4P73A 1YITA 1KAWA 4DR3L 4HIDA 1WCMH 1EFWA 1QVGA 4A3JG 4B3TL 2BA1A 3CCEA 4DV6Q 4OX9Q 4P75A 2VUMH 3F2DA 3GTGH 4K0KL 3WWVA 1PH6A 1VQCA 4JC0A 3K7UC 4BY7G 1N32L 1NE3A 4GN4B 2UXCL 1YZ6A 4DV4L 3CC2A 4HJ7A 2RHQB 5ELOA 1X6OA 3ULLA 3L0OA 5AJ3L 1UWVA 3ER0A 3HOVH 4DK3C 4LF5Q 4DNIA 1UE6A 2CWPA 1R9TH 1A8VA 1G291 2ES2A 2YU9H 4KHPQ 1GD7A 2XGTA 2R7FA 3CCLA 2VNUD 3JAMi 4DV0L 3T1HQ 4GKJL 2JA9A 1KL9A 4OONA 2ZM6L 1D8LA 1MKHA 4DUZQ 4A3BH 2F52A 3CCSA 1QUQB 1Q81C 5FLMH 1IL2A 2OQ0A 3I55A 2F4VQ 4IPHA 1DGSA 3RN5A 1IBLL 4DV6L 4OWTB 1HJPA 2EIFA 3CCQA 1YJWA 2I5LX 1XMQL 1PH2A 4JI0Q 2YV5A 4AYBG 1UE5A 5K36G 1PH9A 3LGJA 2E5LL 1KHIA 1L1OA 1XNRQ 1YI2A 1KD1C 4LF7Q 1YJ9A 4JI6L 2N78A 2KENA 3KF8B 1PH1A 4A3GH 2KCMA 1E3PA 3A0JA 1SFOH 3I2ZA 4GNXB 1NMFA
chains in the Genus database with same CATH superfamily
3SGIA 3ULPA 2ASBA 1EY4A 4HAEA 1Q7YC 2ZTCA 3TN2A 5EPKA 5C44G 1VS0A 1CZGA 3RD4A 3HRZC 5M3MB 1EIYB 1STGA 1XTDA 5CORA 3SR1A 4JI3L 4JI2Q 1VF7A 1VMCA 1B50A 1ESRA 4JI0L 2JP1A 2NB0A 4MNOA 2NBFA 1NSNS 1SFOB 3AQQA 3NEMA 1PFSA 1YHQA 3BU2A 3LWEA 1BO0A 3TP8A 4A3BG 1I94Q 2GN5A 1BBWA 2E76C 4IN3A 1PHJA 4B3RQ 1YNXA 2ZJQA 2QEXA 1PTOB 1E22A 2QA4A 4PMCA 4K14A 1U5KA 3HOUH 3S1RB 2IHEA 1X55A 4OWXB 5M3MG 1WI5A 2CW0D 4NB3A 5FO7B 1T5EA 2CCZA 1F2YA 1E24A 3LX0A 4RG1A 2ID0A 1GXDC 1LTTD 1PV4A 4ZUIA 4JOIC 2K52A 1QILA 2F0UA 1VQAA 1YHAA 1EL0A 3TDQA 1SXTA 4DUYL 1I3QH 4B3SQ 3S1MB 3VR3A 1K83B 4BY7B 4NP5A 1NR2A 4DV4Q 3GTLH 2UXDQ 4WORA 4LF8L 4B3RL 1C7YA 5BN3A 2IW3A 1BVSA 4C2MH 1ASZA 3SXHA 4A3LG 3K80C 4XT1B 1RCVD 4DV2L 3OYYA 5C4XB 3D4WA 1VQPA 5DNFA 3TREA 1MJEA 1EOTA 2VZAA 3S2DB 5IYCG 2ZM6Q 2JA7B 1S40A 1Y8PB 2YYZA 2C9OA 3VDYA 1TXYA 1X3PA 2B2WA 2FJ2A 4XYOA 1XMQQ 3FVQA 1VQFA 2F0FA 4B3SL 1WTRA 4AYBB 4POGA 5C3EG 3E0EA 2UXDL 3L7ZC 2E5LQ 2JYOA 1LTID 3F1ZA 5EJWA 4DV5Q 1EFID 5C4XG 2YTXA 4V190 4A3CG 1VMPA 5IT9c 2JA7G 1VDZA 2EZVA 2TMPA 2R7DA 2G9HD 2FMCA 1VQ7A 1I50H 5KGUA 3EVQA 1D5XC 3MVVA 3VYTA 3DXJC 2H1EA 2EQSA 3N52A 3FP9A 1SE4A 2Z9HA 4NPSA 1AN8A 4N9PA 1F9PA 5EKIA 2L1BA 1FGUA 1KRSA 4G7HC 1I6HH 5DM73 4DV1L 2NWGA 3M4PA 2UU9Q 1PZID 4DV5L 4UHVA 5IE8A 2E2JB 3U4VA 1UEAB 2R93B 1EY6A 1Q90A 3FHWA 1UUPA 4JV5Q 3GD7A 3H3VC 1WYDA 3AEVA 3KJOA 1HNXQ 2VQFQ 3SVMA 3OIPA 2B2TC 2K01A 2WB1B 4L5RC 1TIID 1STBA 1C8CA 1Y1WB 1G51A 5A2QE 2RBMA 2Y0SB 5C3WA 3NBIA 2ZTDA 4DAVA 2A6EC 2MPMA 2BH2A 1BKBA 2QCPX 1BBXC 5BN5A 2UU9L 3EN2A 3STBC 2MHVA 2R93G 2F0MA 4FXGC 1ENCA 3GDEA 1SNDA 4JV5L 1Y8NB 1IW7D 1FVIA 2RF4A 3DM3A 3IRBA 4QGUA 2O4XA 1O7ZA 1Y1WG 4JI8Q 4L8JA 2Y0SG 4M8AA 4JBWA 1NTGA 1K9MC 3UDGA 5I2XA 1RL2A 4AYBE 3E9IA 1LUZA 1N8RC 4OO1H 2HD3A 3K0YA 2OTLA 1VQ4A 4IFDG 1Q1BA 2XWJB 2K5VA 4RGNA 3IFDA 3GTJB 3H3VI 4AH6A 3ERSX 1SSOA 2MQHA 1EY9A 1LABA 1LT5D 2X69A 4F7XA 1XJVA 1HQMC 4HMJA 1QB5D 2F0DA 2K1BA 3EQLC 1ILPA 1RHPA 3CC7A 4O42A 3BDCA 1WTQA 1TWCH 4ZQ3A 4R1JA 2Z6KC 3BZCA 3Q0AA 1S5ED 3S1NH 4KJNA 3NTKA 4UP8A 4PZ8A 1EUJA 4A3IB 2SDFA 4L5QA 3A8IE 2VXWA 3S24A 4JBKA 2QEJC 1TY2A 3HKZB 1X3QA 4KHVA 4BXXG 1B9MA 4H0LC 4XTCS 2KECA 4DXGA 1FJGQ 4KD4A 1ZKOA 2EXZA 3AYHB 2JSOA 1K8MA 2WB1E 3S2HH 1K3RA 2HT1A 4A3MH 2PZUA 2EDGA 4U673 2EYMA 3I4MB 1X9NA 3GV6A 1Q8IA 1JQYD 4IUVA 3P7JA 1HA6A 1NJIC 4LFBQ 2LXJA 2IJ0A 4GLAC 1LTRD 3OSOA 1K8AC 5M3FB 4LFCQ 1PH7A 5EPLA 4JCVE 2MFIA 1FJGL 1VQJA 1IKMA 5M5XB 2E2IH 2O2LD 1SJED 1IXRA 1NY4A 4KKSA 3KLSX 5EAYA 3I4MG 4LK1C 2JK8A 3J80E 2XIWA 3OW7A 1T9HA 3HGBA 2HUGA 3CU7A 4LFBL 5JJIA 2YU9B 1UAPA 5M3FG 3J81j 1AZPA 1G2TA 1D5ZC 4LFCL 4Y7NH 2IPKD 5NUCA 4DR4Q 2JA5H 4OXPA 2I5HA 5I6YA 4KY6A 1AE2A 2WKCA 3T1HL 2M9VA 4KY5A 3DWPA 3E6ZX 3M4QA 4LAAA 1L1OB 5IIFA 2YTYA 4DAYB 3B6YA 1CK1A 4RCNA 3BDOA 4RGTA 2LY7A 1PRTF 5C4HA 3IFTA 3ZJYC 2B2UC 4QL5A 2FINB 2VQEQ 4JG2A 2K7VA 4JVZA 3L2PA 2D0PA 3FMCA 2J0TD 4YIJA 1O7IA 1DOKA 1WTHA 3HKZE 1MI2A 1W6KA 4XT3B 1OTCA 1ZYRD 4ABNA 3NUCA 4WJ4A 1RJTA 4S3SA 3V05A 1ENAA 4YHHL 4DF7A 1WTOA 1JOKA 5LMUL 5M5YB 3M4OH 3NBHA 3GTMB 4AIMA 4IPCA 5ELDA 4GN3B 1GOZA 3J81E 4KTAA 5ELEA 3CXCA 1ASYA 2BDNA 3KUPA 3MHBA 1EY5A 4UAIA 2KEDA 1EQQA 2ATWA 3W5OA 4APVA 4YWMA 1PXUA 2L12A 3E3XA 1PTOC 4DR3Q 5FLXc 1TT2A 1K8GA 1ET9A 1CHQD 3OPOA 3ITPA 3J7ZC 4KK7A 4NXMQ 1X3FA 3EJIA 3W1GA 2F0SA 2JA8H 1SMXA 1TS5A 2BE5C 4KV6A 4MZ9A 1TY0A 5LL6S 4NW2A 4EQPA 5I6WA 5FJ8H 1KNAA 3PO3H 1IBKL 3BVMA 4IFDJ 3RZOH 3Q24A 4H02A 1JC7A 1S5FD 2B3GA 4RAUC 3S14H 2RHSB 1A63A 1I3QB 1IYVA 1WOCA 4B08A 2F4VQ 3GTLB 3GTOB 4DR3L 3R93A 2BA1A 4K0KL 4C2MB 4JC0A 1NE3A 5KNCA 1DCZA 3MXPA 1EY7A 4CHTB 3HOVH 3DWAA 4LF5Q 5E3FA 1A15A 3WOEA 1IHZA 1STNA 3CCLA 2EYOA 3MFYA 3NE5B 4OONA 1FD7D 1D8LA 2EYFA 5G3LF 4J1MA 1DGSA 4PMBA 2AUKA 1IBLL 1B9NA 1HJPA 3I4LA 2I5LX 1F2MA 1EEFD 3LGJA 1R9TB 1GUTA 1KHIA 2SNSA 1S5CD 1XNRQ 4LF7Q 3NWSA 2QDBA 2O5IC 4FVMA 2B2YC 3TZDA 3A0JA 3I2ZA 1NMFA 2EYLA 2NN6I 4HIOA 4ME5A 3M85A 1LO5D 2A73B 4EQ5A 4CDEC 1IBMQ 1TWAH 5IODA 1SROA 4BA2I 2N55A 1N34Q 2A5HA 1Q82C 2DJGC 1CKNA 1PH4A 2QF7A 1QVFA 1XNRL 4ZK9B 2F0IA 4LF7L 3CAMA 1XMOQ 3S9WA 2JE6I 3I8ZA 5FLMG 4OHJA 4ZCKA 4RFBA 5IGFA 4IUUA 1MD2D 4DN4M 5E7NA 3TP6A 3C1FA 3WOFA 1IBML 1YNND 1MBYA 1A2TA 4DK1A 4GS3A 4P72A 5GAHC 1HUMA 2PPBC 1N34L 3JAMc 4DR5Q 3T16A 2NVXH 1DJRD 1NAPA 3ND9A 4B3TQ 1XMOL 4WJWA 1SRUA 2VL6A 4N8X1 2R7ZH 3J7AF 2ZJPA 2F0WA 5HGQA 3LWUA 1HXYD 1VQGA 4HEDA 1I4RA 3S1QH 3AMUA 3OWEB 4HJ8A 4IJLA 4TSSA 3VR2A 1AP0A 2Q2UA 3NENA 1BOSA 5KYIA 4DR5L 2V1CC 3MTSA 5L37A 2UUBL 4DR7L 2A69D 2F0OA 4L6TB 1AH9A 4KJOA 2HIXA 5CYUA 1B3QA 5IGGA 1QCBD 3S16B 4WFN3 2PMZB 4QIWE 4ULLA 4HJAA 1KNEA 1EEID 1SNPA 1RIPA 5CV7A 1BUVT 1EU4A 4IFDI 2FHTA 3S1NB 4OO1G 3MA2B 2K33A 4MTNA 3ZYYX 5COYA 1A3VA 5ELBA 3F2CA 4JI7Q 3C3LA 2DUDA 3PCOB 1YJNA 3OTOL 3F2BA 1P8LA 4DV3Q 2CW0C 1H9JA 2D5DA 4JI3Q 4TRDA 3D0FA 5HGTA 4IO9A 4N8FA 4GNXA 1HZCA 1C4QA 3S2HB 3HFZB 4A3MB 4HTHA 4DV7L 1MSHA 3MXNA 4PNYA 1GM5A 4PZ6A 1JJCB 1JE5A 2ZXPA 2L15A 4LUOA 4YCVA 4OIKA 1VQ6A 1JORA 4JI7L 2HQEA 5EPJA 2JEAI 4C3HH 2MP1A 4H7BA 1YBYA 2R92H 4DV3L 1EZ6A 2F0HA 1X3EA 1J6QA 5D3IB 5JVG3 1KTKA 4A3MG 2ENBA 3HS0C 1VQOA 4XDXA 1ML0D 2Q8RE 2Z8LA 1ICWA 2EYJA 1GO3E 5IY0A 2QW7A 1DYQA 4DNRB 2K4KA 4DUYQ 1VQ5A 4DU9A 1EQVA 1LT3D 4LF8Q 1AW7A 4A3DB 3D4RA 4HCEA 2NVTH 3CC4A 3OMCA 5ISRA 3M9BA 2F0JA 4GOPA 3MZ5A 2JA5B 1GUSA 1VQLA 4DV2Q 4L63B 4F88A 1PLFA 4P71A 1L1OC 1H9SA 4XXEA 3W2DA 4X65L 1BCPF 3A5ZB 2F4IA 1XPOA 2AKWB 2E75C 2NUCA 3GQBA 1K0RA 2LKVA 1D1IA 3MC0B 4DR6L 4YWLA 4LNQA 3VR6A 4KLKA 1SMYD 4MHEA 4JI5L 1VF5C 4A3DG 4CKEA 1E1TA 5C3EB 2MO0A 3QO2A 3BJUA 5IP7H 2WP8J 4EX5A 3HG9A 2JA5G 1ZEQX 3NBHB 2K5WA 2Q2HA 3U58A 4XYQA 2KEEA 3NTHA 1A3TA 1IKLA 3EFXD 1PH8A 4A93B 1STYA 1W6JA 4L5SA 2JA6B 1HFNA 5IYDH 3C1EA 1SNQA 3HOWH 1A62A 1BR9A 1KABA 2EY2A 5GAGC 2PNRC 4Z9CB 5IYBH 3TQYA 2NN6G 4WJ3M 2QILA 1HFGA 3NP8A 2Z6BA 1VQHA 5LMNL 4ZYSA 4DV1Q 3KJPA 3HOYH 3CKIB 4ODGA 2XRQD 1K73C 1O7LA 1EYDA 1OXVA 4KI0A 2K03A 1ILQA 1PA6A 4A93G 3KDFA 4FNFA 2JA6G 1IW7C 1D5MC 2B8FA 2N3SA 1HR0L 1MSGA 2JA8B 2K5NA 3FKIB 3PO2H 1SYCA 4IZ8A 4HR7B 1KDCA 3HOXH 4BA1I 3D6WA 2SOBA 4AQYL 5JJZA 5C0XH 3R2IA 1PFNA 1B70B 2A8VA 2AMCB 4Y52H 3OOCA 1V1QA 3T53B 1CZWA 1SEBD 3NHHA 1LT6D 1TS3A 4PZ7A 1MIUA 1QG7A 1V8QA 4UPAA 1KXLA 2WACA 4OX9L 4BY1H 5FOBB 2B2WC 2Z0SA 2JA8G 1A2UA 3HOVB 3LNNA 5EBDA 3FKIG 4HIMA 5DLQE 3R2TA 2FFKB 4RA8A 2N88A 5FJ8G 3PO3G 2C35B 2PI2A 5EQ0A 5E4XA 3A54A 1B3AA 2GA4B 1LTBD 2D2CC 3Q23A 5HURA 1JWMD 3CMAA 2OCEA 5C4JB 1C48A 1EYGA 5J3BA 4BBSH 3SK5A 3I3CA 3PUXA 4C1NI 4IUNA 4DUZL 5LL6X 2K14A 1B8AA 3A8JE 3CCUA 3PF4A 1SDFA 1S4ZA 5KYLA 2L9HA 1M8AA 3KOJA 3A8KE 2BOSA 2A1AA 4DA2A 1DOLA 3HOVG 3BZKA 4QQBX 3K59A 3K5OA 4F87A 2NZHA 1JWUD 2PW7A 5FLXL 3S17H 4PMWA 1TS4A 1I4XA 1H95A 3PQIA 2RSNA 4FF2A 3CP0A 4WRDA 4NMZA 1TWAB 4OL7A 2D9UA 1CKNB 1GUNA 1LTSD 4X62Q 5IP9H 3CCJA 1CKOA 2IHFA 3TRZA 4HSPA 4K8IA 3GTQH 2XNAC 1AFPA 1HTPA 2M2LA 1JB3A 2CWAA 4CJ2C 2L0CA 3AFQA 4RKBA 2HDLA 5M9OA 1OO9B 4RWSC 4EGVA 3OIQA 1STAA 2KQ3A 4MTKA 1CUKA 1L0WA 1E0BA 2I46A 2QGQA 3BYYB 4RH6A 2Q8IB 4C1NK 1UEBA 3W3AA 4OIJA 5DEHA 1FNUA 3VYSA 2NVQB 4X62L 5AJ3Q 2K28A 2K6AA 1HUNA 2QKIC 3PIOA 4CDFC 1Y14B 3WDNA 4U68A 4ZRZA 2PW5A 2Y0SE 3RZDB 1QNUA 5JJKA 1E2VA 5KNDA 3FPUB 1WTVA 1VQ9A 1EFWA 1KAWA 4DXFA 3IKJA 2VUMH 4V0BA 4DV6Q 3GTGH 4F8MA 3QWNA 1ZXTA 1VQCA 3SK6A 3K7UC 1PH6A 3S1QB 1UNSA 3HZXA 1H9RA 2F3WA 3L0OA 5AJ3L 3ER0A 3ND8A 4DK3C 1UE6A 1ZYRC 2EOTA 1PRTD 4X3TA 2EY5A 1G291 4B9WA 1E2ZA 1GD7A 2XGTA 2R7FA 2VNUD 3JAMi 3T1HQ 4GKJL 1F77A 2F0KA 1WCMB 1CA6A 3U9OA 1MKHA 4A3BH 1CA5A 1Q81C 1DONA 3EROA 2F0NA 4HSVA 4IPHA 3QJYA 1ENFA 3RN5A 4MN3A 3KLSA 4DV6L 1G91A 5J39A 3E0JA 1KD1C 4JI6L 1PH1A 3DM1A 3T51B 4DNTB 1SFOH 4GNXB 2K75A 4YHHQ 1WCMG 5LMUQ 3MXNB 3HOZH 1SBBB 2F0PA 2N8NA 5A2QL 2C5CA 4X6AH 3GTPH 4G7OC 1YVCA 4OO1I 2CH4A 2ZXOA 4TQUS 1AEXA 4BS9A 3JAML 4ZLTF 3S1RH 5CV8A 4A3LH 1PZJD 5JOBA 3I7FA 3RLOA 4DAMA 4UP7A 1F9QA 2E74C 3D31A 3D8GA 4I7AA 4HCSA 3EIVA 1NUCA 2GVBA 5ELNA 2A68D 1H9KA 3P75A 2R92B 2EY6A 1U4LA 4IUPA 1CHPD 4QB4A 2E2HH 4TKOB 3DMUA 2IT1A 4A3JH 4ZKBB 1EQRA 2N49A 4YWKA 4BY7H 1D1KA 2CQOA 3MXUA 1FL0A 1IBKQ 3R3OA 4IJHA 1V1OA 3CF5A 1DXMA 2B2VC 2F0QA 4GOPB 5I9OA 4DGZA 3ULJA 1YNJD 2NVTB 3OHXC 4K0KQ 2HCCA 3TSSA 2R92G 3HOUB 1H9SB 4IALA 4EQOA 1WTXA 1M1KC 1S5BD 4IURA 3ONAB 2K05A 5G3LD 1EYAA 2L11A 5K36H 3ERQA 4R9WA 1JWSD 4KD3A 2F0VA 2JXMB 3G71A 1SJHD 1FNWA 4XQQA 1TWFH 2F0LA 2F1MA 3PUZA 2A6HC 4ME3A 4A4IA 1EQTA 5IT9E 5KEEA 3UE0A 1IBLQ 2WAQG 4A3FH 2XRSD 4LJZC 2IX0A 3PIPA 3HOUG 4POFA 4ZKCB 3QOJA 3UDIA 1S3OA 3MEHA 2JEBI 4A3KH 3QR8A 1L0YB 4LMQD 2AWNA 1FYCA 2DY7A 1TWGH 2PYKA 2KCNA 5IWAQ 3HOWB 2HCIA 1SYFA 3BVGA 3M4YA 1XXGA 3DUZA 1JT8A 2K5QA 1FGBD 4LW1A 1EIGA 2E2JH 5IGBA 3G6JB 3U50C 1YNNC 1NR4A 1WFQA 1RKNA 1DM0B 2I5MX 4JYAQ 2HQLA 2PZWA 1JR0D 5IP7G 1HNWL 1XTCD 3GV3A 3KDFB 3HOYB 4GKKL 4K5XA 4XQJA 4RMFA 3QOLA 2F03A 1BDOA 2FXQA 4A75A 3RN2A 4CKBA 1Q8KA 2DJFC 1SYEA 4UDUC 3OMGA 3M3YH 1D6EC 3CPWA 3X3NA 1RTOA 1XPUA 1HTLD 3U4ZA 1I50B 3HOWG 5IWAL 3J80L 3DEOA 1J5EL 3T56B 2A6HD 5IGEA 3PO2B 2KJXA 5IYBG 2B29A 5CBEE 1ONLA 4YCWA 4FF3A 2KBNA 3UI2A 3HOXB 3OWFA 4JYAL 4FP5D 1I6HB 3HOYG 3AU7A 1EYCA 2AQ2B 4K5VA 1JICA 3NTIA 5K5PA 4KY7A 4YY3L 2PQEA 2ICEC 4QUCA 1PRTB 3H15A 2A69C 2VB2X 5FK9C 3SDZA 1NNXA 3H0GH 4BY1B 1WD0A 2D0OA 4JI4L 1I6VC 1KLUD 2K04A 1B2TA 2MJ8A 1LTGD 3PO2G 1VCIA 2ICIA 4B3ML 1VQ8A 3GTJH 1CSPA 2K5HA 3HOXG 1U4PA 2B8GA 4BXXH 4C56C 3TP5A 5C0XG 2BH8A 4JBMA 2KOLA 3EBEA 2DGYA 3RNUA 4BBSB 1PTOF 4LUZA 3NELA 1WJJA 2UUBQ 3K0XA 4DR7Q 1DOMA 1O80A 3BYTB 3I4OA 3TZUA 1K28A 4BY1G 3NQIA 2KUMA 3A55A 4A3IH 5FKAC 3KYHC 4L5TA 3T13A 4LUVA 1HCZA 2BDOA 2NVYH 3S17B 2LXKA 3CCRA 4A3EH 1Q86C 3CQZH 4IOCA 2IX3A 1PDQA 1SE2A 4X3SA 1JCKB 4BBSG 3T1YL 2CQAA 3D3RA 2DN8A 2EYHA 3OTOQ 3J7AV 2E8GA 4R4CA 2P5ZX 3O13A 1QOHA 4RHSA 4RKLA 4RGOS 4X66Q 1EU3A 3GTQB 1JJ2A 4O2DA 1SE8A 1TVXA 4NXNL 1U4MA 1TWCB 4LWCA 4DV7Q 3TEHB 4X64Q 1UE1A 1MHWC 5CGKA 1A0IA 3G4SA 2K50A 2NTTA 4FYDA 5M5XH 1CI3M 2KA7A 1KIXA 4ZUJA 1U0LA 3CPFA 1CQFA 1QJOA 5IP9G 1N36Q 1G8ZD 1NCVA 2CHBD 2NZOA 5JEAH 2MGSA 3A5UA 3PF5A 4G7ZC 2PI2E 2EVBA 4NKLA 4X66L 4X3KA 5F2DA 1SYDA 2ZTEA 3P20A 1Y1VH 5GQOA 1IYJB 3K5NA 2K5DA 2KHJA 4X64L 5I2YA 2B63H 4DR2Q 2CKZB 1SYGA 4LFAQ 4ZAIA 3K5MA 3I4NH 1OXTA 4IPGA 2RSOA 5J1ZA 3ICEA 1EIHA 1BXTA 1KC8C 2D62A 2XSCA 4GN5A 1SMYC 5KIXA 3JC66 4DKAC 1G6PA 1E7ZA 1BCPD 3I90A 3NSWA 2L55A 1IL8A 4RCOA 2F3VA 1JJGA 1N36L 4OWWB 4R8NA 1Z47A 1LTAD 3MFGA 3OW2A 1LYLA 2X6GA 1Y69U 1HNZQ 1VQEA 4XIGS 3IAYA 3RR5A 3G48A 1RTNA 2E2IB 3SE0A 1TQOA 2F0GA 4X65Q 4JOIA 3TMEA 4DR2L 3CCVA 1SNOA 2EJFC 4LFAL 1PZKD 3D4DA 2VUMG 4DR6Q 1R4PB 3I56A 1VQBA 1GUGA 3MXGA 4JI5Q 4HJ5A 3J80c 3PIO3 4DR1Q 1XPRA 4R4IA 5M5YH 3AFPA 1G2SA 3GTMH 5T1GA 4Y7NB 3PMFA 4I65A 1EWCA 3VYUA 4GNXC 2PQAA 1LTLA 1SYBA 2ALYB 2AWOA 4H44C 1EWIA 1E1OA 2A19A 1HNZL 1EWHA 2HHHQ 4CJ1B 3UE1A 2PMZE 1JB7A 3HOZB 2EY1A 5FLXE 5FO8B 4M1UB 1P16A 3GTPB 1TKWB 1PMRA 1KLGD 1EOVA 4PQXA 1CT1D 4K2KA 3UDFA 4J8QA 4DPGA 4IUTA 3E9HA 4DR1L 3NXWA 5LMNQ 4QUFA 4JI2L 5JAVA 3I72A 1F2ZA 2JN4A 2KCCA 4BBRH 2UUAQ 1U4RA 5CV4A 1KDBA 2HHHL 3DHQA 3HOZG 3M4OB 2E2HB 2VS1A 2BA0A 4A3JB 1HR0Q 1Q12A 1QNKA 1I94L 2G5DA 2UXCQ 1SNCA 4K6LA 4CDDC 3GTOH 3K81C 3I70A 5C0XJ 1HRJA 2KVMA 4C3JH 5DM63 1D7QA 3J81c 4EQNA 1I5FA 4GOPC 2RA4A 4FXKC 4JW0A 2MUYA 1O78A 4AQYQ 4K8JA 2AQ3B 4DV0Q 3G6EA 3H3VH 4J15A 1T5XD 4R4TA 3PUWA 5GROA 2UUAL 5IOCA 1TU2B 1JE4A 3KBGA 1LV9A 1HH2P 2RDGA 1YITA 4A3JG 4OX9Q 3CCEA 3QG1A 2B2TA 3L9AX 3WWVA 5BN4A 4BY7G 5I4DA 2UXCL 4GN4B 4KMUC 4DV4L 3RUZA 5C3XA 4HJ7A 2RHQB 3PO3B 4K5WA 5ELOA 1II3A 1X6OA 3ULLA 1TWFB 2J4XA 3P1HA 1M4VA 4DNIA 4CGYB 3RZOB 2CWPA 1R9TH 1A8VA 2ES2A 4KHPQ 3S14B 4QF4A 4I7ZC 4DV0L 5CBAE 2JA9A 1KL9A 3C46A 2ZM6L 4A3FB 4DUZQ 2F52A 3CCSA 1HQRD 3K57A 5FLMH 2RDHA 4CJ0B 3I55A 3NK9A 2A74C 4A3KB 3CCQA 2EIFA 1XMQL 1ET6A 5K36G 4AYBG 5JPMC 1PH9A 2DNEA 1RDPD 1TWGB 2E5LL 1KDAA 1YJ9A 2L4NA 2KENA 4A3GH 5EKKA 2KCMA 2F0TA 4KHPL 2EJGC 4IQZA 4K6DA 3IL8A 2OTJA 2GVAA 4C3IH 4QCLA 4A3FG 1TWHH 5CV6A 3J7A5 4JPBW 2CFMA 1Y8OB 1EIFA 3MEFA 4A3KG 3K8AA 2LSSA 2IY5B 3M3YB 4IOAA 5M5WH 3JAME 4PG3A 5C6AA 2Z6KA 5EGTA 2M00A 1I4GA 3Q22A 1ESFA 5JPNC 3A7AB 4OEMB 1V9PA 2IX1A 3SHLA 2EJMA 5TSSA 3PIP3 1CSQA 2RVLA 1KRTA 4DFAA 1AE3A 3Q8DA 1N9WA 1HNXL 2VQFL 1BCPB 2H4OA 2Q2IA 2WB1G 2LS01 2RKSA 3L3OC 2J7ZA 1PRTC 5LHY1 1DZ1A 2ZT9C 1I4QA 4QY7A 1BQQT 2L5TA 2RQXA 1SLJA 3D6CA 2I07B 5FO9B 3K6OA 2X6LA 3KLRA 3H0GB 3KF6A 4TVAB 4FF1A 3F2UA 3K7AH 5ELFA 1XYIA 3S15H 1PYWD 1V1PA 1VQKA 4CDCC 1GJXA 3KK7A 5D65A 1CQVA 4CBVA 3M7NA 3M7GA 4UP9A 4R8IA 4J6HA 3VA5A 3S16H 3Q6SA 4JI8L 2NVXB 4KN4C 2DY8A 3HKSA 5C4ZA 2A6ED 3DWQA 3SK4A 3BS1A 4GKJQ 1YHBA 2XN9C 5KRUA 2OF1A 3H0GG 1QZHA 4YCUA 2BCOA 1EY0A 1SE3A 3CW2C 2R7ZB 4HIKA 1IYUA 2R6GA 1IZ6A 2XTIA 2NYZD 5C0XI 3STBD 1NMGA 1HA5A 1Q46A 2SEBD 1KQSA 2NVYB 5C44H 4QJFA 3PUYA 4A3EB 3TP7A 1D2BA 3CQZB 2WFWA 2LMCB 3NWTA 3UDXA 5JVH3 2KCTA 4Q0FA 1PYSB 3TS0A 4JI6Q 1QUQA 5IGCA 2MNAA 2NZ1D 3GTKH 2A68C 1CFMA 5CC4A 3RLFA 3V96A 2K32A 4G57A 3J7YW 4DK0A 5C5LA 2KHSA 4KKUA 1QE6A 3BG3A 4GLXA 1F9RA 4A3IG 2R7ZG 1VQNA 1STHA 1GHJA 2UXBQ 4FDBA 1Z9FA 2B2UA 3EA6A 3KF8A 2CVRA 3HKZG 4LF4Q 2VB3X 2Q8TA 4A3EG 4R4OA 1TR5A 5M3MH 1VQMA 5JJLA 1AZQA 1U9RA 4HJ9A 4OELB 2QDLA 4FO2A 1YNJC 2YTVA 4GLVB 2I0QA 4N9TA 1S72A 5EKLA 2R61A 1RF2D 1C0AA 1LT4D 3CRKC 1TS2A 1K3BC 1Y1VB 2VY3A 1STEA 4A3DH 2UXBL 2B63B 1PTOH 4ID6A 4LF4L 1K8OA 5CV5A 4FXDA 3I4NB 2B2VA 3T4AC 1I4HA 1B44D 3VYRA 1PH3A 4K2LA 4IPDA 3PV0A 1BNZA 4C3HB 5IYCH 1LM0A 1X65A 2WKDA 4RGMA 5J22A 1MJCA 5GAEC 1LACA 5JEAG 2NTSA 3PGZA 5KNBA 4KN7C 5E1FA 2NN6H 3CD6A 4KKTA 3S1MH 3KLWA 1Y1VG 2Z1CA 1K83H 1W2BA 1Q1EA 1PFMA 4JBJA 5C3EH 3HEJA 2B63G 4P2CB 3X3MA 1YEZA 3AB9A 4R4QA 1HZBA 3I4NG 1KAAA 4X3UA 4DR4L 3FDTA 5C4XH 1H9MA 1SAPA 2Z4HA 1FR3A 1UE7A 2PQAB 3U9SA 2ZJRA 1OXXK 4A93H 4A3CH 2OXPA 5I9PA 2JA6H 3S2DH 4C3HG 3SK8A 2WAQB 1Q3LA 2JA7H 2TSSA 1WD1A 5H1SE 2WINB 5T1IA 5LMNW 4A76A 2EE1A 2ZXRA 4H13C 2AUJD 5C5MA 3URYA 2VQEL 2PCFB 3PSIA 2KHIA 1C9OA 2MO1A 1GVPA 1PYBA 1HPCA 4QMGA 1SNMA 2UUCQ 1OXUA 3BVZA 4LF6Q 1HR0W 3CMEA 1K0SA 1PVOA 4KHZA 1A3UA 3PUVA 3C2PA 2SNMA 5GADC 2F0EA 1HZ9A 1HNWQ 3VR4A 1GUOA 4GKKQ 3J80i 2RCFA 2G9DA 5BR8Q 3A56A 1J8IA 2OWOA 3FKIH 4BBRB 2EYPA 1X3GA 2V4DA 2HDMA 2F3IA 3RMHA 1EZ8A 2B2YA 4B9XA 4BWGB 5CMDA 2UUCL 1J5EQ 1X54A 5D3DA 2R3ZA 3V2TA 3H6MA 3H91A 2E2DC 4LF6L 3F8TA 1GKHA 4C3JB 2R93H 2PNHA 2AHOB 3KFUA 3FPPA 4NXML 1BBUA 3VR5A 3R8BA 1JOOA 3DLLA 1SN8A 1JOQA 2WV6D 1L2FA 1XNQQ 5BR8L 1Y1WH 5EBCA 4BBRG 4YY3Q 1F9SA 1CKMA 2B39A 2H5XA 4UY8C 3G7LA 3NPPA 3I73A 4GZYC 1M90C 1X32A 2PZTA 3E5SA 1QZGA 5IYDG 4O0AA 1RD9D 4JI4Q 1S5DD 5C4JH 2O5JC 1PTOD 4IFDH 5HY6A 1I4PA 1OXSC 2F4VL 4B3MQ 3K58A 4C3JG 1HHVA 4P74A 4E6IA 3H94A 1HZAA 5DAUA 3CCMA 1CM9A 3A74A 3CRLC 2WAQE 4RHRA 3J81i 4O1NA 1B4OA 1WTWA 4LF5L 2BE5D 1VQIA 1XNQL 2RCNA 2IWHA 1FNVA 1QWYA 1WVLA 4QIWB 1O7YA 1V43A 4NDXA 4JI1Q 2XWBB 1F2LA 4DAPA 1JMCA 1B53A 3BZDB 3GP7A 2OEOA 4A3GB 4HMIA 2FMMA 3W1BA 1RODA 1Z6HA 2VW9A 5E4WC 1MGSA 3T1YQ 3MWYW 1SR3A 4C3IB 4ILWA 1TWHB 3H09A 4DK6C 1VQDA 2Q2TA 3SEBA 1DD2A 3NQTA 4JI1L 4LF9Q 3J81L 1XX8A 2RDFA 4G4KA 1X56A 4NXNQ 5M5WB 3TS2A 2NVQH 1B7YB 1EY8A 1E2WA 4A3GG 2LFNA 4XQNA 1W3SA 1N33Q 1A6XA 3RLNA 1PFBA 2HIVA 5A35A 4C3IG 2JQOA 1BCPC 3FRPB 5JEAJ 3RZDH 1YIJA 3I4MH 1GUWA 4ALPA 1N32Q 3N6RA 3KF6B 3TBIB 4LF9L 1ICFB 1QVCA 1J9OA 1PH5A 1V1PB 3KBXA 5CR3A 5M3FH 3K7AB 5IT9L 1CTMA 3S15B 2CH4W 3DEPA 4JK1C 5IGDA 3QIAA 1N33L 2EXDA 2JJQA 1NBWA 2OQKA 4PV1C 4HN7A 3GO5A 4MIUA 1B1ZA 1G6ZA 1LLRD 1Z7TA 2PO4A 2EPBA 4P73A 4OGQC 4B3TL 4HIDA 1WCMH 1QVGA 1L0XB 3HP3A 4P75A 3F2DA 2AQ1B 2XVSA 4IUQA 3K5LA 1N32L 1YZ6A 5AFWA 3CC2A 3FEWX 3BDLA 3CHBD 2DNCA 1UWVA 3QB3A 2YU9H 4EVOA 3A7LA 1WTPA 2VUMB 3GTGB 2OT2A 1QUQB 5C44B 4FF4A 1IL2A 2OQ0A 1XWEA 5ELCA 4OWTB 4Q5VA 3MAQA 1YJWA 5D14A 3VA7A 1PH2A 4JI0Q 2YV5A 1UE5A 2WIIB 1BF4A 3GTKB 5CV9A 1L1OA 4CKCA 1GHKA 1YI2A 1R4QB 4DAYA 2N78A 3KF8B 3I91A 2IL8A 1E3PA 4A3BB 2Z4IA
chains in the Genus database with same CATH topology
3SGIA 2K75A 2NN6I 4YHHQ 4HIOA 1WCMG 4BXXH 3M85A 5LMUQ 3ULPA 2GVAA 4C3IH 2ASBA 2OTJA 3MXNB 3HOZH 4A3FG 1XNQQ 1TWHH 1Q7YC 2ZTCA 4EQ5A 2N8NA 3J7A5 1IBMQ 5C44G 1VS0A 4X6AH 3GTPH 2CFMA 1YVCA 1TWAH 4OO1I 1EIFA 4TQUS 1SROA 1EIYB 1XTDA 4BA2I 3MEFA 4JI3L 3K8AA 2LSSA 4JI2Q 4A3KG 2IY5B 1N34Q 4IOAA 1Q82C 3S1RH 4JI0L 4A3LH 5M5WH 3I7FA 4MNOA 4PG3A 3RLOA 2Z6KA 1CKNA 3AQQA 3NEMA 4UP7A 4DAMA 1PFSA 1YHQA 3BU2A 3D31A 1PH4A 1QVFA 1XNRL 3EIVA 1V9PA 2IX1A 4LF7L 3CAMA 1XMOQ 2GVBA 4A3BG 5ELNA 2JE6I 1I94Q 2GN5A 5FLMG 1BBWA 1CSQA 1KRTA 1PHJA 1AE3A 4KHPL 4B3RQ 3Q8DA 1YNXA 2ZJQA 2QEXA 1N9WA 5E7NA 2E2HH 1E22A 2IT1A 4A3JH 1HNXL 2QA4A 2VQFL 1EQRA 1U5KA 1IBML 2N49A 2WB1G 2Q2IA 4YWKA 3HOUH 2IHEA 1X55A 4OWXB 5M3MG 1WI5A 4NB3A 4BY7H 4QY7A 4GS3A 2CQOA 2CCZA 4P72A 5GAHC 1SLJA 1N34L 1E24A 1FL0A 1IBKQ 4RG1A 3JAMc 4IJHA 2ID0A 4DR5Q 1PV4A 2NVXH 3CF5A 3KF6A 4JOIC 4TVAB 2K52A 4GOPB 3K7AH 3ULJA 3S15H 4B3TQ 1XMOL 4K0KQ 1VQAA 1YHAA 1VQKA 2R92G 4DUYL 1SRUA 1I3QH 2VL6A 4B3SQ 2R7ZH 2ZJPA 1M1KC 4DV4Q 5HGQA 3GTLH 2UXDQ 4LF8L 4B3RL 3M7NA 1VQGA 4UP9A 1C7YA 3S16H 1BVSA 4C2MH 1ASZA 3S1QH 4A3LG 3K80C 4JI8L 4IJLA 4HJ8A 4DV2L 3OYYA 3G71A 2Q2UA 1VQPA 3HKSA 3NENA 3TREA 1TWFH 1MJEA 3PUZA 4GKJQ 1YHBA 4ME3A 2VZAA 4A4IA 4DR5L 2V1CC 3H0GG 5IYCG 4YCUA 2ZM6Q 1S40A 1QZHA 2YYZA 2UUBL 3CW2C 4DR7L 4HIKA 1AH9A 2R6GA 3UE0A 1IZ6A 2XTIA 3VDYA 2HIXA 5C0XI 1TXYA 2WAQG 3STBD 1IBLQ 1NMGA 4A3FH 1Q46A 3PIPA 2IX0A 1XMQQ 1KQSA 3HOUG 1VQFA 4POFA 5C44H 4QIWE 4HJAA 4B3SL 4QJFA 3PUYA 5C3EG 3E0EA 4POGA 2WFWA 2UXDL 3UDIA 1S3OA 3L7ZC 3UDXA 2E5LQ 1RIPA 2JEBI 4A3KH 2KCTA 4IFDI 3F1ZA 1PYSB 3TS0A 4JI6Q 1QUQA 2AWNA 4DV5Q 4OO1G 2MNAA 5C4XG 4MTNA 3GTKH 1TWGH 5IWAQ 2YTXA 4A3CG 3RLFA 3F2CA 4JI7Q 5IT9c 4GLXA 2JA7G 1JT8A 2DUDA 3PCOB 4LW1A 1YJNA 2E2JH 2R7DA 1VQ7A 3OTOL 4A3IG 1I50H 2R7ZG 3U50C 1VQNA 3F2BA 1P8LA 1WFQA 4DV3Q 2I5MX 4FDBA 2UXBQ 1Z9FA 4JYAQ 4JI3Q 2HQLA 2EQSA 5IP7G 1HNWL 3HKZG 3D0FA 3FP9A 3KDFB 4IO9A 4LF4Q 4NPSA 4GNXA 4GKKL 1HZCA 1FGUA 4A3EG 4RMFA 4R4OA 1KRSA 3HFZB 5M3MH 1VQMA 2FXQA 4A75A 5JJLA 3RN2A 4DV7L 1Q8KA 4HJ9A 1I6HH 4DV1L 3M3YH 1GM5A 3CPWA 2YTVA 3M4PA 4GLVB 4PZ6A 4DV5L 1JJCB 5IE8A 2I0QA 2UU9Q 1S72A 1JE5A 4LUOA 2L15A 1XPUA 3U4VA 3U4ZA 4YCVA 3HOWG 5IWAL 1J5EL 1VQ6A 4JI7L 3FHWA 4JV5Q 1C0AA 3GD7A 1WYDA 5IYBG 2JEAI 3AEVA 3KJOA 2B29A 1HNXQ 2VQFQ 4YCWA 4C3HH 1YBYA 2R92H 2KBNA 4L5RC 1G51A 2VY3A 4DV3L 4A3DH 2UXBL 4JYAL 2ZTDA 3HOYG 4LF4L 1X3EA 1J6QA 4A3MG 4YY3L 2BH2A 1BKBA 1VQOA 3H15A 1PH3A 2UU9L 1GO3E 3EN2A 5IY0A 4IPDA 3PV0A 3STBC 3H0GH 5IYCH 1LM0A 1X65A 2K4KA 2R93G 2D0OA 4DUYQ 1VQ5A 4JI4L 1MJCA 5GAEC 3GDEA 5JEAG 3PGZA 4LF8Q 4JV5L 3PO2G 2NVTH 1VCIA 4B3ML 1FVIA 2RF4A 3CC4A 1VQ8A 3DM3A 3GTJH 3M9BA 1CSPA 2K5HA 3IRBA 4QGUA 3HOXG 3CD6A 4GOPA 3S1MH 3KLWA 1Y1VG 4JI8Q 1K83H 1Y1WG 1Q1EA 1W2BA 2Y0SG 4JBJA 5C3EH 4DV2Q 4JBWA 5C0XG 1NTGA 1VQLA 2B63G 2BH8A 1K9MC 1YEZA 4JBMA 3UDGA 4P71A 1L1OC 2DGYA 3EBEA 4R4QA 1RL2A 3RNUA 4LUZA 1HZBA 3I4NG 4AYBE 3E9IA 1LUZA 1N8RC 4X65L 4DR4L 3NELA 2OTLA 1WJJA 5C4XH 3A5ZB 3K0XA 2UUBQ 1XPOA 1VQ4A 4DR7Q 1UE7A 2AKWB 4IFDG 1Q1BA 2PQAB 2ZJRA 1OXXK 4A93H 1K0RA 4A3CH 2K5VA 3I4OA 2JA6H 3S2DH 4DR6L 2JA7H 4YWLA 4BY1G 4LNQA 4KLKA 3H3VI 4AH6A 5H1SE 3ERSX 4A3IH 4JI5L 3KYHC 4L5TA 5LMNW 4A76A 2MQHA 1E1TA 4A3DG 2MO0A 4LUVA 1XJVA 5IP7H 3BJUA 2VQEL 2WP8J 2NVYH 3PSIA 2KHIA 2LXKA 4EX5A 1C9OA 3CC7A 2JA5G 3CCRA 3NBHB 4A3EH 1Q86C 2MO1A 1GVPA 1PYBA 2Q2HA 1TWCH 3CQZH 4IOCA 3U58A 4R1JA 2Z6KC 2UUCQ 1PH8A 3BZCA 1OXUA 4BBSG 3T1YL 3S1NH 4LF6Q 4L5SA 1HR0W 3CMEA 4UP8A 1PVOA 5IYDH 3OTOQ 2E8GA 3PUVA 4KHZA 1EUJA 4PZ8A 3HOWH 1A62A 4L5QA 4R4CA 5GADC 3S24A 5GAGC 1HZ9A 4JBKA 1HNWQ 5IYBH 3TQYA 4X66Q 2NN6G 4GKKQ 1JJ2A 4WJ3M 4O2DA 1SE8A 3J80i 4BXXG 4NXNL 5BR8Q 4XTCS 1VQHA 3FKIH 4LWCA 4DV7Q 3TEHB 2OWOA 4X64Q 1X3GA 1FJGQ 5LMNL 4DV1Q 1UE1A 3KJPA 3AYHB 2F3IA 3HOYH 2WB1E 1A0IA 1K3RA 3G4SA 1K73C 2HT1A 3S2HH 4A3MH 4KI0A 2K50A 1OXVA 2UUCL 1J5EQ 1X54A 5M5XH 1X9NA 1PA6A 3KDFA 1KIXA 4A93G 2JA6G 1U0LA 3CPFA 4LF6L 3F8TA 1GKHA 2N3SA 5IP9G 1N36Q 2R93H 1HR0L 1NJIC 4LFBQ 2PNHA 2LXJA 2K5NA 2NZOA 2AHOB 3KFUA 3A5UA 3PF5A 3PO2H 4GLAC 1BBUA 2PI2E 1K8AC 4NXML 4LFCQ 4X66L 3DLLA 1SN8A 1L2FA 3HOXH 1PH7A 2ZTEA 5BR8L 1Y1VH 1Y1WH 5GQOA 4BA1I 4BBRG 1CKMA 4YY3Q 2H5XA 1IYJB 4JCVE 2MFIA 4AQYL 2KHJA 4X64L 4UY8C 1FJGL 1B70B 1VQJA 2AMCB 4DR2Q 2A8VA 2CKZB 2B63H 4Y52H 4LFAQ 1M90C 2E2IH 1V1QA 3I4NH 1OXTA 1QZGA 1IXRA 4IPGA 1NY4A 4O0AA 5IYDG 5EAYA 3ICEA 3I4MG 1KC8C 4PZ7A 1MIUA 2D62A 4GN5A 2JK8A 5C4JH 4JI4Q 5HY6A 3JC66 4UPAA 4DKAC 1G6PA 1OXSC 2F4VL 1E7ZA 1KXLA 4B3MQ 4P74A 4OX9L 4BY1H 1JJGA 2Z0SA 1N36L 4OWWB 1T9HA 1HZAA 2JA8G 1Z47A 3OW2A 3CCMA 4LFBL 3FKIG 4HIMA 5DLQE 5JJIA 1LYLA 5FJ8G 3PO3G 3A74A 5M3FG 2WAQE 2C35B 1VQEA 4XIGS 2PI2A 3RR5A 3J81i 3J81j 3G48A 4LFCL 4Y7NH 4LF5L 1VQIA 4DR4Q 4X65Q 2JA5H 1XNQL 2RCNA 4JOIA 4OXPA 2I5HA 3CMAA 2OCEA 1AE2A 3CCVA 4DR2L 3T1HL 1EYGA 4LFAL 3M4QA 5J3BA 4BBSH 2VUMG 1V43A 4JI1Q 1L1OB 4DR6Q 3PUXA 2YTYA 4DUZL 4DAYB 3I56A 1VQBA 3B6YA 2K14A 1B8AA 3CCUA 1JMCA 4JI5Q 4HJ5A 3J80c 3PF4A 4DR1Q 3KOJA 1XPRA 4R4IA 5M5YH 3ZJYC 3AFPA 2A1AA 3GTMH 4QL5A 2VQEQ 4JG2A 3HOVG 3L2PA 3BZKA 4GNXC 2D0PA 4QQBX 2PQAA 1LTLA 1O7IA 3W1BA 2ALYB 2AWOA 2VW9A 1EWIA 1E1OA 2A19A 1HNZL 2HHHQ 2NZHA 3HKZE 3T1YQ 3UE1A 3S17H 1OTCA 2PMZE 4PMWA 1SR3A 4WJ4A 1JB7A 1H95A 4DK6C 1VQDA 2Q2TA 1P16A 3CP0A 4YHHL 1CKNB 1EOVA 5LMUL 3M4OH 4JI1L 4LF9Q 3UDFA 4AIMA 4IPCA 4X62Q 4GN3B 4DPGA 5IP9H 1X56A 3CCJA 1CKOA 3E9HA 4NXNQ 2IHFA 3CXCA 4DR1L 1ASYA 3TS2A 2NVQH 1B7YB 5LMNQ 1HNZQ 4JI2L 3TRZA 3GTQH 4A3GG 1EQQA 1W3SA 2ATWA 3W5OA 1N33Q 2CWAA 3RLNA 4APVA 4YWMA 4BBRH 2UUAQ 2HIVA 3AFQA 2HHHL 4DR3Q 2JQOA 5FLXc 3HOZG 5JEAJ 1K8GA 2VS1A 2BA0A 1CUKA 3RZDH 1YIJA 1HR0Q 1Q12A 1I94L 3I4MH 1L0WA 4ALPA 1N32Q 2UXCQ 2QGQA 3KF6B 3J7ZC 3GTOH 1UEBA 3K81C 4NXMQ 4LF9L 5C0XJ 1X3FA 4C3JH 1QVCA 4X62L 5AJ3Q 3J81c 1PH5A 1D7QA 3W1GA 1I5FA 2JA8H 1SMXA 4GOPC 3PIOA 4MZ9A 4AQYQ 3PO3H 5FJ8H 5M3FH 1Y14B 4DV0Q 3G6EA 3H3VH 4J15A 1IBKL 4IFDJ 4R4TA 3RZOH 3PUWA 4H02A 5GROA 2EXDA 1N33L 2Y0SE 2JJQA 1NBWA 2B3GA 2OQKA 2UUAL 2RHSB 3S14H 3GO5A 1A63A 5JJKA 1HH2P 1WOCA 1VQ9A 4P73A 1YITA 1KAWA 4DR3L 4HIDA 1WCMH 1EFWA 1QVGA 4A3JG 4B3TL 2BA1A 3CCEA 4DV6Q 4OX9Q 4P75A 2VUMH 3F2DA 3GTGH 4K0KL 3WWVA 1PH6A 1VQCA 4JC0A 3K7UC 4BY7G 1N32L 1NE3A 4GN4B 2UXCL 1YZ6A 4DV4L 3CC2A 4HJ7A 2RHQB 5ELOA 1X6OA 3ULLA 3L0OA 5AJ3L 1UWVA 3ER0A 3HOVH 4DK3C 4LF5Q 4DNIA 1UE6A 2CWPA 1R9TH 1A8VA 1G291 2ES2A 2YU9H 4KHPQ 1GD7A 2XGTA 2R7FA 3CCLA 2VNUD 3JAMi 4DV0L 3T1HQ 4GKJL 2JA9A 1KL9A 4OONA 2ZM6L 1D8LA 1MKHA 4DUZQ 4A3BH 2F52A 3CCSA 1QUQB 1Q81C 5FLMH 1IL2A 2OQ0A 3I55A 2F4VQ 4IPHA 1DGSA 3RN5A 1IBLL 4DV6L 4OWTB 1HJPA 2EIFA 3CCQA 1YJWA 2I5LX 1XMQL 1PH2A 4JI0Q 2YV5A 4AYBG 1UE5A 5K36G 1PH9A 3LGJA 2E5LL 1KHIA 1L1OA 1XNRQ 1YI2A 1KD1C 4LF7Q 1YJ9A 4JI6L 2N78A 2KENA 3KF8B 1PH1A 4A3GH 2KCMA 1E3PA 3A0JA 1SFOH 3I2ZA 4GNXB 1NMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SGI A;  2K75 A;  2NN6 I;  4YHH Q;  4HIO A;  1WCM G;  4BXX H;  3M85 A;  5LMU Q;  3ULP A;  2GVA A;  4C3I H;  2ASB A;  2OTJ A;  3MXN B;  3HOZ H;  4A3F G;  1XNQ Q;  1TWH H;  1Q7Y C;  2ZTC A;  4EQ5 A;  2N8N A;  3J7A 5;  1IBM Q;  5C44 G;  1VS0 A;  4X6A H;  3GTP H;  2CFM A;  1YVC A;  1TWA H;  4OO1 I;  1EIF A;  4TQU S;  1SRO A;  1EIY B;  1XTD A;  4BA2 I;  3MEF A;  4JI3 L;  3K8A A;  2LSS A;  4JI2 Q;  4A3K G;  2IY5 B;  1N34 Q;  4IOA A;  1Q82 C;  3S1R H;  4JI0 L;  4A3L H;  5M5W H;  3I7F A;  4MNO A;  4PG3 A;  3RLO A;  2Z6K A;  1CKN A;  3AQQ A;  3NEM A;  4UP7 A;  4DAM A;  1PFS A;  1YHQ A;  3BU2 A;  3D31 A;  1PH4 A;  1QVF A;  1XNR L;  3EIV A;  1V9P A;  2IX1 A;  4LF7 L;  3CAM A;  1XMO Q;  2GVB A;  4A3B G;  5ELN A;  2JE6 I;  1I94 Q;  2GN5 A;  5FLM G;  1BBW A;  1CSQ A;  1KRT A;  1PHJ A;  1AE3 A;  4KHP L;  4B3R Q;  3Q8D A;  1YNX A;  2ZJQ A;  2QEX A;  1N9W A;  5E7N A;  2E2H H;  1E22 A;  2IT1 A;  4A3J H;  1HNX L;  2QA4 A;  2VQF L;  1EQR A;  1U5K A;  1IBM L;  2N49 A;  2WB1 G;  2Q2I A;  4YWK A;  3HOU H;  2IHE A;  1X55 A;  4OWX B;  5M3M G;  1WI5 A;  4NB3 A;  4BY7 H;  4QY7 A;  4GS3 A;  2CQO A;  2CCZ A;  4P72 A;  5GAH C;  1SLJ A;  1N34 L;  1E24 A;  1FL0 A;  1IBK Q;  4RG1 A;  3JAM c;  4IJH A;  2ID0 A;  4DR5 Q;  1PV4 A;  2NVX H;  3CF5 A;  3KF6 A;  4JOI C;  4TVA B;  2K52 A;  4GOP B;  3K7A H;  3ULJ A;  3S15 H;  4B3T Q;  1XMO L;  4K0K Q;  1VQA A;  1YHA A;  1VQK A;  2R92 G;  4DUY L;  1SRU A;  1I3Q H;  2VL6 A;  4B3S Q;  2R7Z H;  2ZJP A;  1M1K C;  4DV4 Q;  5HGQ A;  3GTL H;  2UXD Q;  4LF8 L;  4B3R L;  3M7N A;  1VQG A;  4UP9 A;  1C7Y A;  3S16 H;  1BVS A;  4C2M H;  1ASZ A;  3S1Q H;  4A3L G;  3K80 C;  4JI8 L;  4IJL A;  4HJ8 A;  4DV2 L;  3OYY A;  3G71 A;  2Q2U A;  1VQP A;  3HKS A;  3NEN A;  3TRE A;  1TWF H;  1MJE A;  3PUZ A;  4GKJ Q;  1YHB A;  4ME3 A;  2VZA A;  4A4I A;  4DR5 L;  2V1C C;  3H0G G;  5IYC G;  4YCU A;  2ZM6 Q;  1S40 A;  1QZH A;  2YYZ A;  2UUB L;  3CW2 C;  4DR7 L;  4HIK A;  1AH9 A;  2R6G A;  3UE0 A;  1IZ6 A;  2XTI A;  3VDY A;  2HIX A;  5C0X I;  1TXY A;  2WAQ G;  3STB D;  1IBL Q;  1NMG A;  4A3F H;  1Q46 A;  3PIP A;  2IX0 A;  1XMQ Q;  1KQS A;  3HOU G;  1VQF A;  4POF A;  5C44 H;  4QIW E;  4HJA A;  4B3S L;  4QJF A;  3PUY A;  5C3E G;  3E0E A;  4POG A;  2WFW A;  2UXD L;  3UDI A;  1S3O A;  3L7Z C;  3UDX A;  2E5L Q;  1RIP A;  2JEB I;  4A3K H;  2KCT A;  4IFD I;  3F1Z A;  1PYS B;  3TS0 A;  4JI6 Q;  1QUQ A;  2AWN A;  4DV5 Q;  4OO1 G;  2MNA A;  5C4X G;  4MTN A;  3GTK H;  1TWG H;  5IWA Q;  2YTX A;  4A3C G;  3RLF A;  3F2C A;  4JI7 Q;  5IT9 c;  4GLX A;  2JA7 G;  1JT8 A;  2DUD A;  3PCO B;  4LW1 A;  1YJN A;  2E2J H;  2R7D A;  1VQ7 A;  3OTO L;  4A3I G;  1I50 H;  2R7Z G;  3U50 C;  1VQN A;  3F2B A;  1P8L A;  1WFQ A;  4DV3 Q;  2I5M X;  4FDB A;  2UXB Q;  1Z9F A;  4JYA Q;  4JI3 Q;  2HQL A;  2EQS A;  5IP7 G;  1HNW L;  3HKZ G;  3D0F A;  3FP9 A;  3KDF B;  4IO9 A;  4LF4 Q;  4NPS A;  4GNX A;  4GKK L;  1HZC A;  1FGU A;  4A3E G;  4RMF A;  4R4O A;  1KRS A;  3HFZ B;  5M3M H;  1VQM A;  2FXQ A;  4A75 A;  5JJL A;  3RN2 A;  4DV7 L;  1Q8K A;  4HJ9 A;  1I6H H;  4DV1 L;  3M3Y H;  1GM5 A;  3CPW A;  2YTV A;  3M4P A;  4GLV B;  4PZ6 A;  4DV5 L;  1JJC B;  5IE8 A;  2I0Q A;  2UU9 Q;  1S72 A;  1JE5 A;  4LUO A;  2L15 A;  1XPU A;  3U4V A;  3U4Z A;  4YCV A;  3HOW G;  5IWA L;  1J5E L;  1VQ6 A;  4JI7 L;  3FHW A;  4JV5 Q;  1C0A A;  3GD7 A;  1WYD A;  5IYB G;  2JEA I;  3AEV A;  3KJO A;  2B29 A;  1HNX Q;  2VQF Q;  4YCW A;  4C3H H;  1YBY A;  2R92 H;  2KBN A;  4L5R C;  1G51 A;  2VY3 A;  4DV3 L;  4A3D H;  2UXB L;  4JYA L;  2ZTD A;  3HOY G;  4LF4 L;  1X3E A;  1J6Q A;  4A3M G;  4YY3 L;  2BH2 A;  1BKB A;  1VQO A;  3H15 A;  1PH3 A;  2UU9 L;  1GO3 E;  3EN2 A;  5IY0 A;  4IPD A;  3PV0 A;  3STB C;  3H0G H;  5IYC H;  1LM0 A;  1X65 A;  2K4K A;  2R93 G;  2D0O A;  4DUY Q;  1VQ5 A;  4JI4 L;  1MJC A;  5GAE C;  3GDE A;  5JEA G;  3PGZ A;  4LF8 Q;  4JV5 L;  3PO2 G;  2NVT H;  1VCI A;  4B3M L;  1FVI A;  2RF4 A;  3CC4 A;  1VQ8 A;  3DM3 A;  3GTJ H;  3M9B A;  1CSP A;  2K5H A;  3IRB A;  4QGU A;  3HOX G;  3CD6 A;  4GOP A;  3S1M H;  3KLW A;  1Y1V G;  4JI8 Q;  1K83 H;  1Y1W G;  1Q1E A;  1W2B A;  2Y0S G;  4JBJ A;  5C3E H;  4DV2 Q;  4JBW A;  5C0X G;  1NTG A;  1VQL A;  2B63 G;  2BH8 A;  1K9M C;  1YEZ A;  4JBM A;  3UDG A;  4P71 A;  1L1O C;  2DGY A;  3EBE A;  4R4Q A;  1RL2 A;  3RNU A;  4LUZ A;  1HZB A;  3I4N G;  4AYB E;  3E9I A;  1LUZ A;  1N8R C;  4X65 L;  4DR4 L;  3NEL A;  2OTL A;  1WJJ A;  5C4X H;  3A5Z B;  3K0X A;  2UUB Q;  1XPO A;  1VQ4 A;  4DR7 Q;  1UE7 A;  2AKW B;  4IFD G;  1Q1B A;  2PQA B;  2ZJR A;  1OXX K;  4A93 H;  1K0R A;  4A3C H;  2K5V A;  3I4O A;  2JA6 H;  3S2D H;  4DR6 L;  2JA7 H;  4YWL A;  4BY1 G;  4LNQ A;  4KLK A;  3H3V I;  4AH6 A;  5H1S E;  3ERS X;  4A3I H;  4JI5 L;  3KYH C;  4L5T A;  5LMN W;  4A76 A;  2MQH A;  1E1T A;  4A3D G;  2MO0 A;  4LUV A;  1XJV A;  5IP7 H;  3BJU A;  2VQE L;  2WP8 J;  2NVY H;  3PSI A;  2KHI A;  2LXK A;  4EX5 A;  1C9O A;  3CC7 A;  2JA5 G;  3CCR A;  3NBH B;  4A3E H;  1Q86 C;  2MO1 A;  1GVP A;  1PYB A;  2Q2H A;  1TWC H;  3CQZ H;  4IOC A;  3U58 A;  4R1J A;  2Z6K C;  2UUC Q;  1PH8 A;  3BZC A;  1OXU A;  4BBS G;  3T1Y L;  3S1N H;  4LF6 Q;  4L5S A;  1HR0 W;  3CME A;  4UP8 A;  1PVO A;  5IYD H;  3OTO Q;  2E8G A;  3PUV A;  4KHZ A;  1EUJ A;  4PZ8 A;  3HOW H;  1A62 A;  4L5Q A;  4R4C A;  5GAD C;  3S24 A;  5GAG C;  1HZ9 A;  4JBK A;  1HNW Q;  5IYB H;  3TQY A;  4X66 Q;  2NN6 G;  4GKK Q;  1JJ2 A;  4WJ3 M;  4O2D A;  1SE8 A;  3J80 i;  4BXX G;  4NXN L;  5BR8 Q;  4XTC S;  1VQH A;  3FKI H;  4LWC A;  4DV7 Q;  3TEH B;  2OWO A;  4X64 Q;  1X3G A;  1FJG Q;  5LMN L;  4DV1 Q;  1UE1 A;  3KJP A;  3AYH B;  2F3I A;  3HOY H;  2WB1 E;  1A0I A;  1K3R A;  3G4S A;  1K73 C;  2HT1 A;  3S2H H;  4A3M H;  4KI0 A;  2K50 A;  1OXV A;  2UUC L;  1J5E Q;  1X54 A;  5M5X H;  1X9N A;  1PA6 A;  3KDF A;  1KIX A;  4A93 G;  2JA6 G;  1U0L A;  3CPF A;  4LF6 L;  3F8T A;  1GKH A;  2N3S A;  5IP9 G;  1N36 Q;  2R93 H;  1HR0 L;  1NJI C;  4LFB Q;  2PNH A;  2LXJ A;  2K5N A;  2NZO A;  2AHO B;  3KFU A;  3A5U A;  3PF5 A;  3PO2 H;  4GLA C;  1BBU A;  2PI2 E;  1K8A C;  4NXM L;  4LFC Q;  4X66 L;  3DLL A;  1SN8 A;  1L2F A;  3HOX H;  1PH7 A;  2ZTE A;  5BR8 L;  1Y1V H;  1Y1W H;  5GQO A;  4BA1 I;  4BBR G;  1CKM A;  4YY3 Q;  2H5X A;  1IYJ B;  4JCV E;  2MFI A;  4AQY L;  2KHJ A;  4X64 L;  4UY8 C;  1FJG L;  1B70 B;  1VQJ A;  2AMC B;  4DR2 Q;  2A8V A;  2CKZ B;  2B63 H;  4Y52 H;  4LFA Q;  1M90 C;  2E2I H;  1V1Q A;  3I4N H;  1OXT A;  1QZG A;  1IXR A;  4IPG A;  1NY4 A;  4O0A A;  5IYD G;  5EAY A;  3ICE A;  3I4M G;  1KC8 C;  4PZ7 A;  1MIU A;  2D62 A;  4GN5 A;  2JK8 A;  5C4J H;  4JI4 Q;  5HY6 A;  3JC6 6;  4UPA A;  4DKA C;  1G6P A;  1OXS C;  2F4V L;  1E7Z A;  1KXL A;  4B3M Q;  4P74 A;  4OX9 L;  4BY1 H;  1JJG A;  2Z0S A;  1N36 L;  4OWW B;  1T9H A;  1HZA A;  2JA8 G;  1Z47 A;  3OW2 A;  3CCM A;  4LFB L;  3FKI G;  4HIM A;  5DLQ E;  5JJI A;  1LYL A;  5FJ8 G;  3PO3 G;  3A74 A;  5M3F G;  2WAQ E;  2C35 B;  1VQE A;  4XIG S;  2PI2 A;  3RR5 A;  3J81 i;  3J81 j;  3G48 A;  4LFC L;  4Y7N H;  4LF5 L;  1VQI A;  4DR4 Q;  4X65 Q;  2JA5 H;  1XNQ L;  2RCN A;  4JOI A;  4OXP A;  2I5H A;  3CMA A;  2OCE A;  1AE2 A;  3CCV A;  4DR2 L;  3T1H L;  1EYG A;  4LFA L;  3M4Q A;  5J3B A;  4BBS H;  2VUM G;  1V43 A;  4JI1 Q;  1L1O B;  4DR6 Q;  3PUX A;  2YTY A;  4DUZ L;  4DAY B;  3I56 A;  1VQB A;  3B6Y A;  2K14 A;  1B8A A;  3CCU A;  1JMC A;  4JI5 Q;  4HJ5 A;  3J80 c;  3PF4 A;  4DR1 Q;  3KOJ A;  1XPR A;  4R4I A;  5M5Y H;  3ZJY C;  3AFP A;  2A1A A;  3GTM H;  4QL5 A;  2VQE Q;  4JG2 A;  3HOV G;  3L2P A;  3BZK A;  4GNX C;  2D0P A;  4QQB X;  2PQA A;  1LTL A;  1O7I A;  3W1B A;  2ALY B;  2AWO A;  2VW9 A;  1EWI A;  1E1O A;  2A19 A;  1HNZ L;  2HHH Q;  2NZH A;  3HKZ E;  3T1Y Q;  3UE1 A;  3S17 H;  1OTC A;  2PMZ E;  4PMW A;  1SR3 A;  4WJ4 A;  1JB7 A;  1H95 A;  4DK6 C;  1VQD A;  2Q2T A;  1P16 A;  3CP0 A;  4YHH L;  1CKN B;  1EOV A;  5LMU L;  3M4O H;  4JI1 L;  4LF9 Q;  3UDF A;  4AIM A;  4IPC A;  4X62 Q;  4GN3 B;  4DPG A;  5IP9 H;  1X56 A;  3CCJ A;  1CKO A;  3E9H A;  4NXN Q;  2IHF A;  3CXC A;  4DR1 L;  1ASY A;  3TS2 A;  2NVQ H;  1B7Y B;  5LMN Q;  1HNZ Q;  4JI2 L;  3TRZ A;  3GTQ H;  4A3G G;  1EQQ A;  1W3S A;  2ATW A;  3W5O A;  1N33 Q;  2CWA A;  3RLN A;  4APV A;  4YWM A;  4BBR H;  2UUA Q;  2HIV A;  3AFQ A;  2HHH L;  4DR3 Q;  2JQO A;  5FLX c;  3HOZ G;  5JEA J;  1K8G A;  2VS1 A;  2BA0 A;  1CUK A;  3RZD H;  1YIJ A;  1HR0 Q;  1Q12 A;  1I94 L;  3I4M H;  1L0W A;  4ALP A;  1N32 Q;  2UXC Q;  2QGQ A;  3KF6 B;  3J7Z C;  3GTO H;  1UEB A;  3K81 C;  4NXM Q;  4LF9 L;  5C0X J;  1X3F A;  4C3J H;  1QVC A;  4X62 L;  5AJ3 Q;  3J81 c;  1PH5 A;  1D7Q A;  3W1G A;  1I5F A;  2JA8 H;  1SMX A;  4GOP C;  3PIO A;  4MZ9 A;  4AQY Q;  3PO3 H;  5FJ8 H;  5M3F H;  1Y14 B;  4DV0 Q;  3G6E A;  3H3V H;  4J15 A;  1IBK L;  4IFD J;  4R4T A;  3RZO H;  3PUW A;  4H02 A;  5GRO A;  2EXD A;  1N33 L;  2Y0S E;  2JJQ A;  1NBW A;  2B3G A;  2OQK A;  2UUA L;  2RHS B;  3S14 H;  3GO5 A;  1A63 A;  5JJK A;  1HH2 P;  1WOC A;  1VQ9 A;  4P73 A;  1YIT A;  1KAW A;  4DR3 L;  4HID A;  1WCM H;  1EFW A;  1QVG A;  4A3J G;  4B3T L;  2BA1 A;  3CCE A;  4DV6 Q;  4OX9 Q;  4P75 A;  2VUM H;  3F2D A;  3GTG H;  4K0K L;  3WWV A;  1PH6 A;  1VQC A;  4JC0 A;  3K7U C;  4BY7 G;  1N32 L;  1NE3 A;  4GN4 B;  2UXC L;  1YZ6 A;  4DV4 L;  3CC2 A;  4HJ7 A;  2RHQ B;  5ELO A;  1X6O A;  3ULL A;  3L0O A;  5AJ3 L;  1UWV A;  3ER0 A;  3HOV H;  4DK3 C;  4LF5 Q;  4DNI A;  1UE6 A;  2CWP A;  1R9T H;  1A8V A;  1G29 1;  2ES2 A;  2YU9 H;  4KHP Q;  1GD7 A;  2XGT A;  2R7F A;  3CCL A;  2VNU D;  3JAM i;  4DV0 L;  3T1H Q;  4GKJ L;  2JA9 A;  1KL9 A;  4OON A;  2ZM6 L;  1D8L A;  1MKH A;  4DUZ Q;  4A3B H;  2F52 A;  3CCS A;  1QUQ B;  1Q81 C;  5FLM H;  1IL2 A;  2OQ0 A;  3I55 A;  2F4V Q;  4IPH A;  1DGS A;  3RN5 A;  1IBL L;  4DV6 L;  4OWT B;  1HJP A;  2EIF A;  3CCQ A;  1YJW A;  2I5L X;  1XMQ L;  1PH2 A;  4JI0 Q;  2YV5 A;  4AYB G;  1UE5 A;  5K36 G;  1PH9 A;  3LGJ A;  2E5L L;  1KHI A;  1L1O A;  1XNR Q;  1YI2 A;  1KD1 C;  4LF7 Q;  1YJ9 A;  4JI6 L;  2N78 A;  2KEN A;  3KF8 B;  1PH1 A;  4A3G H;  2KCM A;  1E3P A;  3A0J A;  1SFO H;  3I2Z A;  4GNX B;  1NMF A; 
#chains in the Genus database with same CATH topology
 3SGI A;  3ULP A;  2ASB A;  1EY4 A;  4HAE A;  1Q7Y C;  2ZTC A;  3TN2 A;  5EPK A;  5C44 G;  1VS0 A;  1CZG A;  3RD4 A;  3HRZ C;  5M3M B;  1EIY B;  1STG A;  1XTD A;  5COR A;  3SR1 A;  4JI3 L;  4JI2 Q;  1VF7 A;  1VMC A;  1B50 A;  1ESR A;  4JI0 L;  2JP1 A;  2NB0 A;  4MNO A;  2NBF A;  1NSN S;  1SFO B;  3AQQ A;  3NEM A;  1PFS A;  1YHQ A;  3BU2 A;  3LWE A;  1BO0 A;  3TP8 A;  4A3B G;  1I94 Q;  2GN5 A;  1BBW A;  2E76 C;  4IN3 A;  1PHJ A;  4B3R Q;  1YNX A;  2ZJQ A;  2QEX A;  1PTO B;  1E22 A;  2QA4 A;  4PMC A;  4K14 A;  1U5K A;  3HOU H;  3S1R B;  2IHE A;  1X55 A;  4OWX B;  5M3M G;  1WI5 A;  2CW0 D;  4NB3 A;  5FO7 B;  1T5E A;  2CCZ A;  1F2Y A;  1E24 A;  3LX0 A;  4RG1 A;  2ID0 A;  1GXD C;  1LTT D;  1PV4 A;  4ZUI A;  4JOI C;  2K52 A;  1QIL A;  2F0U A;  1VQA A;  1YHA A;  1EL0 A;  3TDQ A;  1SXT A;  4DUY L;  1I3Q H;  4B3S Q;  3S1M B;  3VR3 A;  1K83 B;  4BY7 B;  4NP5 A;  1NR2 A;  4DV4 Q;  3GTL H;  2UXD Q;  4WOR A;  4LF8 L;  4B3R L;  1C7Y A;  5BN3 A;  2IW3 A;  1BVS A;  4C2M H;  1ASZ A;  3SXH A;  4A3L G;  3K80 C;  4XT1 B;  1RCV D;  4DV2 L;  3OYY A;  5C4X B;  3D4W A;  1VQP A;  5DNF A;  3TRE A;  1MJE A;  1EOT A;  2VZA A;  3S2D B;  5IYC G;  2ZM6 Q;  2JA7 B;  1S40 A;  1Y8P B;  2YYZ A;  2C9O A;  3VDY A;  1TXY A;  1X3P A;  2B2W A;  2FJ2 A;  4XYO A;  1XMQ Q;  3FVQ A;  1VQF A;  2F0F A;  4B3S L;  1WTR A;  4AYB B;  4POG A;  5C3E G;  3E0E A;  2UXD L;  3L7Z C;  2E5L Q;  2JYO A;  1LTI D;  3F1Z A;  5EJW A;  4DV5 Q;  1EFI D;  5C4X G;  2YTX A;  4V19 0;  4A3C G;  1VMP A;  5IT9 c;  2JA7 G;  1VDZ A;  2EZV A;  2TMP A;  2R7D A;  2G9H D;  2FMC A;  1VQ7 A;  1I50 H;  5KGU A;  3EVQ A;  1D5X C;  3MVV A;  3VYT A;  3DXJ C;  2H1E A;  2EQS A;  3N52 A;  3FP9 A;  1SE4 A;  2Z9H A;  4NPS A;  1AN8 A;  4N9P A;  1F9P A;  5EKI A;  2L1B A;  1FGU A;  1KRS A;  4G7H C;  1I6H H;  5DM7 3;  4DV1 L;  2NWG A;  3M4P A;  2UU9 Q;  1PZI D;  4DV5 L;  4UHV A;  5IE8 A;  2E2J B;  3U4V A;  1UEA B;  2R93 B;  1EY6 A;  1Q90 A;  3FHW A;  1UUP A;  4JV5 Q;  3GD7 A;  3H3V C;  1WYD A;  3AEV A;  3KJO A;  1HNX Q;  2VQF Q;  3SVM A;  3OIP A;  2B2T C;  2K01 A;  2WB1 B;  4L5R C;  1TII D;  1STB A;  1C8C A;  1Y1W B;  1G51 A;  5A2Q E;  2RBM A;  2Y0S B;  5C3W A;  3NBI A;  2ZTD A;  4DAV A;  2A6E C;  2MPM A;  2BH2 A;  1BKB A;  2QCP X;  1BBX C;  5BN5 A;  2UU9 L;  3EN2 A;  3STB C;  2MHV A;  2R93 G;  2F0M A;  4FXG C;  1ENC A;  3GDE A;  1SND A;  4JV5 L;  1Y8N B;  1IW7 D;  1FVI A;  2RF4 A;  3DM3 A;  3IRB A;  4QGU A;  2O4X A;  1O7Z A;  1Y1W G;  4JI8 Q;  4L8J A;  2Y0S G;  4M8A A;  4JBW A;  1NTG A;  1K9M C;  3UDG A;  5I2X A;  1RL2 A;  4AYB E;  3E9I A;  1LUZ A;  1N8R C;  4OO1 H;  2HD3 A;  3K0Y A;  2OTL A;  1VQ4 A;  4IFD G;  1Q1B A;  2XWJ B;  2K5V A;  4RGN A;  3IFD A;  3GTJ B;  3H3V I;  4AH6 A;  3ERS X;  1SSO A;  2MQH A;  1EY9 A;  1LAB A;  1LT5 D;  2X69 A;  4F7X A;  1XJV A;  1HQM C;  4HMJ A;  1QB5 D;  2F0D A;  2K1B A;  3EQL C;  1ILP A;  1RHP A;  3CC7 A;  4O42 A;  3BDC A;  1WTQ A;  1TWC H;  4ZQ3 A;  4R1J A;  2Z6K C;  3BZC A;  3Q0A A;  1S5E D;  3S1N H;  4KJN A;  3NTK A;  4UP8 A;  4PZ8 A;  1EUJ A;  4A3I B;  2SDF A;  4L5Q A;  3A8I E;  2VXW A;  3S24 A;  4JBK A;  2QEJ C;  1TY2 A;  3HKZ B;  1X3Q A;  4KHV A;  4BXX G;  1B9M A;  4H0L C;  4XTC S;  2KEC A;  4DXG A;  1FJG Q;  4KD4 A;  1ZKO A;  2EXZ A;  3AYH B;  2JSO A;  1K8M A;  2WB1 E;  3S2H H;  1K3R A;  2HT1 A;  4A3M H;  2PZU A;  2EDG A;  4U67 3;  2EYM A;  3I4M B;  1X9N A;  3GV6 A;  1Q8I A;  1JQY D;  4IUV A;  3P7J A;  1HA6 A;  1NJI C;  4LFB Q;  2LXJ A;  2IJ0 A;  4GLA C;  1LTR D;  3OSO A;  1K8A C;  5M3F B;  4LFC Q;  1PH7 A;  5EPL A;  4JCV E;  2MFI A;  1FJG L;  1VQJ A;  1IKM A;  5M5X B;  2E2I H;  2O2L D;  1SJE D;  1IXR A;  1NY4 A;  4KKS A;  3KLS X;  5EAY A;  3I4M G;  4LK1 C;  2JK8 A;  3J80 E;  2XIW A;  3OW7 A;  1T9H A;  3HGB A;  2HUG A;  3CU7 A;  4LFB L;  5JJI A;  2YU9 B;  1UAP A;  5M3F G;  3J81 j;  1AZP A;  1G2T A;  1D5Z C;  4LFC L;  4Y7N H;  2IPK D;  5NUC A;  4DR4 Q;  2JA5 H;  4OXP A;  2I5H A;  5I6Y A;  4KY6 A;  1AE2 A;  2WKC A;  3T1H L;  2M9V A;  4KY5 A;  3DWP A;  3E6Z X;  3M4Q A;  4LAA A;  1L1O B;  5IIF A;  2YTY A;  4DAY B;  3B6Y A;  1CK1 A;  4RCN A;  3BDO A;  4RGT A;  2LY7 A;  1PRT F;  5C4H A;  3IFT A;  3ZJY C;  2B2U C;  4QL5 A;  2FIN B;  2VQE Q;  4JG2 A;  2K7V A;  4JVZ A;  3L2P A;  2D0P A;  3FMC A;  2J0T D;  4YIJ A;  1O7I A;  1DOK A;  1WTH A;  3HKZ E;  1MI2 A;  1W6K A;  4XT3 B;  1OTC A;  1ZYR D;  4ABN A;  3NUC A;  4WJ4 A;  1RJT A;  4S3S A;  3V05 A;  1ENA A;  4YHH L;  4DF7 A;  1WTO A;  1JOK A;  5LMU L;  5M5Y B;  3M4O H;  3NBH A;  3GTM B;  4AIM A;  4IPC A;  5ELD A;  4GN3 B;  1GOZ A;  3J81 E;  4KTA A;  5ELE A;  3CXC A;  1ASY A;  2BDN A;  3KUP A;  3MHB A;  1EY5 A;  4UAI A;  2KED A;  1EQQ A;  2ATW A;  3W5O A;  4APV A;  4YWM A;  1PXU A;  2L12 A;  3E3X A;  1PTO C;  4DR3 Q;  5FLX c;  1TT2 A;  1K8G A;  1ET9 A;  1CHQ D;  3OPO A;  3ITP A;  3J7Z C;  4KK7 A;  4NXM Q;  1X3F A;  3EJI A;  3W1G A;  2F0S A;  2JA8 H;  1SMX A;  1TS5 A;  2BE5 C;  4KV6 A;  4MZ9 A;  1TY0 A;  5LL6 S;  4NW2 A;  4EQP A;  5I6W A;  5FJ8 H;  1KNA A;  3PO3 H;  1IBK L;  3BVM A;  4IFD J;  3RZO H;  3Q24 A;  4H02 A;  1JC7 A;  1S5F D;  2B3G A;  4RAU C;  3S14 H;  2RHS B;  1A63 A;  1I3Q B;  1IYV A;  1WOC A;  4B08 A;  2F4V Q;  3GTL B;  3GTO B;  4DR3 L;  3R93 A;  2BA1 A;  4K0K L;  4C2M B;  4JC0 A;  1NE3 A;  5KNC A;  1DCZ A;  3MXP A;  1EY7 A;  4CHT B;  3HOV H;  3DWA A;  4LF5 Q;  5E3F A;  1A15 A;  3WOE A;  1IHZ A;  1STN A;  3CCL A;  2EYO A;  3MFY A;  3NE5 B;  4OON A;  1FD7 D;  1D8L A;  2EYF A;  5G3L F;  4J1M A;  1DGS A;  4PMB A;  2AUK A;  1IBL L;  1B9N A;  1HJP A;  3I4L A;  2I5L X;  1F2M A;  1EEF D;  3LGJ A;  1R9T B;  1GUT A;  1KHI A;  2SNS A;  1S5C D;  1XNR Q;  4LF7 Q;  3NWS A;  2QDB A;  2O5I C;  4FVM A;  2B2Y C;  3TZD A;  3A0J A;  3I2Z A;  1NMF A;  2EYL A;  2NN6 I;  4HIO A;  4ME5 A;  3M85 A;  1LO5 D;  2A73 B;  4EQ5 A;  4CDE C;  1IBM Q;  1TWA H;  5IOD A;  1SRO A;  4BA2 I;  2N55 A;  1N34 Q;  2A5H A;  1Q82 C;  2DJG C;  1CKN A;  1PH4 A;  2QF7 A;  1QVF A;  1XNR L;  4ZK9 B;  2F0I A;  4LF7 L;  3CAM A;  1XMO Q;  3S9W A;  2JE6 I;  3I8Z A;  5FLM G;  4OHJ A;  4ZCK A;  4RFB A;  5IGF A;  4IUU A;  1MD2 D;  4DN4 M;  5E7N A;  3TP6 A;  3C1F A;  3WOF A;  1IBM L;  1YNN D;  1MBY A;  1A2T A;  4DK1 A;  4GS3 A;  4P72 A;  5GAH C;  1HUM A;  2PPB C;  1N34 L;  3JAM c;  4DR5 Q;  3T16 A;  2NVX H;  1DJR D;  1NAP A;  3ND9 A;  4B3T Q;  1XMO L;  4WJW A;  1SRU A;  2VL6 A;  4N8X 1;  2R7Z H;  3J7A F;  2ZJP A;  2F0W A;  5HGQ A;  3LWU A;  1HXY D;  1VQG A;  4HED A;  1I4R A;  3S1Q H;  3AMU A;  3OWE B;  4HJ8 A;  4IJL A;  4TSS A;  3VR2 A;  1AP0 A;  2Q2U A;  3NEN A;  1BOS A;  5KYI A;  4DR5 L;  2V1C C;  3MTS A;  5L37 A;  2UUB L;  4DR7 L;  2A69 D;  2F0O A;  4L6T B;  1AH9 A;  4KJO A;  2HIX A;  5CYU A;  1B3Q A;  5IGG A;  1QCB D;  3S16 B;  4WFN 3;  2PMZ B;  4QIW E;  4ULL A;  4HJA A;  1KNE A;  1EEI D;  1SNP A;  1RIP A;  5CV7 A;  1BUV T;  1EU4 A;  4IFD I;  2FHT A;  3S1N B;  4OO1 G;  3MA2 B;  2K33 A;  4MTN A;  3ZYY X;  5COY A;  1A3V A;  5ELB A;  3F2C A;  4JI7 Q;  3C3L A;  2DUD A;  3PCO B;  1YJN A;  3OTO L;  3F2B A;  1P8L A;  4DV3 Q;  2CW0 C;  1H9J A;  2D5D A;  4JI3 Q;  4TRD A;  3D0F A;  5HGT A;  4IO9 A;  4N8F A;  4GNX A;  1HZC A;  1C4Q A;  3S2H B;  3HFZ B;  4A3M B;  4HTH A;  4DV7 L;  1MSH A;  3MXN A;  4PNY A;  1GM5 A;  4PZ6 A;  1JJC B;  1JE5 A;  2ZXP A;  2L15 A;  4LUO A;  4YCV A;  4OIK A;  1VQ6 A;  1JOR A;  4JI7 L;  2HQE A;  5EPJ A;  2JEA I;  4C3H H;  2MP1 A;  4H7B A;  1YBY A;  2R92 H;  4DV3 L;  1EZ6 A;  2F0H A;  1X3E A;  1J6Q A;  5D3I B;  5JVG 3;  1KTK A;  4A3M G;  2ENB A;  3HS0 C;  1VQO A;  4XDX A;  1ML0 D;  2Q8R E;  2Z8L A;  1ICW A;  2EYJ A;  1GO3 E;  5IY0 A;  2QW7 A;  1DYQ A;  4DNR B;  2K4K A;  4DUY Q;  1VQ5 A;  4DU9 A;  1EQV A;  1LT3 D;  4LF8 Q;  1AW7 A;  4A3D B;  3D4R A;  4HCE A;  2NVT H;  3CC4 A;  3OMC A;  5ISR A;  3M9B A;  2F0J A;  4GOP A;  3MZ5 A;  2JA5 B;  1GUS A;  1VQL A;  4DV2 Q;  4L63 B;  4F88 A;  1PLF A;  4P71 A;  1L1O C;  1H9S A;  4XXE A;  3W2D A;  4X65 L;  1BCP F;  3A5Z B;  2F4I A;  1XPO A;  2AKW B;  2E75 C;  2NUC A;  3GQB A;  1K0R A;  2LKV A;  1D1I A;  3MC0 B;  4DR6 L;  4YWL A;  4LNQ A;  3VR6 A;  4KLK A;  1SMY D;  4MHE A;  4JI5 L;  1VF5 C;  4A3D G;  4CKE A;  1E1T A;  5C3E B;  2MO0 A;  3QO2 A;  3BJU A;  5IP7 H;  2WP8 J;  4EX5 A;  3HG9 A;  2JA5 G;  1ZEQ X;  3NBH B;  2K5W A;  2Q2H A;  3U58 A;  4XYQ A;  2KEE A;  3NTH A;  1A3T A;  1IKL A;  3EFX D;  1PH8 A;  4A93 B;  1STY A;  1W6J A;  4L5S A;  2JA6 B;  1HFN A;  5IYD H;  3C1E A;  1SNQ A;  3HOW H;  1A62 A;  1BR9 A;  1KAB A;  2EY2 A;  5GAG C;  2PNR C;  4Z9C B;  5IYB H;  3TQY A;  2NN6 G;  4WJ3 M;  2QIL A;  1HFG A;  3NP8 A;  2Z6B A;  1VQH A;  5LMN L;  4ZYS A;  4DV1 Q;  3KJP A;  3HOY H;  3CKI B;  4ODG A;  2XRQ D;  1K73 C;  1O7L A;  1EYD A;  1OXV A;  4KI0 A;  2K03 A;  1ILQ A;  1PA6 A;  4A93 G;  3KDF A;  4FNF A;  2JA6 G;  1IW7 C;  1D5M C;  2B8F A;  2N3S A;  1HR0 L;  1MSG A;  2JA8 B;  2K5N A;  3FKI B;  3PO2 H;  1SYC A;  4IZ8 A;  4HR7 B;  1KDC A;  3HOX H;  4BA1 I;  3D6W A;  2SOB A;  4AQY L;  5JJZ A;  5C0X H;  3R2I A;  1PFN A;  1B70 B;  2A8V A;  2AMC B;  4Y52 H;  3OOC A;  1V1Q A;  3T53 B;  1CZW A;  1SEB D;  3NHH A;  1LT6 D;  1TS3 A;  4PZ7 A;  1MIU A;  1QG7 A;  1V8Q A;  4UPA A;  1KXL A;  2WAC A;  4OX9 L;  4BY1 H;  5FOB B;  2B2W C;  2Z0S A;  2JA8 G;  1A2U A;  3HOV B;  3LNN A;  5EBD A;  3FKI G;  4HIM A;  5DLQ E;  3R2T A;  2FFK B;  4RA8 A;  2N88 A;  5FJ8 G;  3PO3 G;  2C35 B;  2PI2 A;  5EQ0 A;  5E4X A;  3A54 A;  1B3A A;  2GA4 B;  1LTB D;  2D2C C;  3Q23 A;  5HUR A;  1JWM D;  3CMA A;  2OCE A;  5C4J B;  1C48 A;  1EYG A;  5J3B A;  4BBS H;  3SK5 A;  3I3C A;  3PUX A;  4C1N I;  4IUN A;  4DUZ L;  5LL6 X;  2K14 A;  1B8A A;  3A8J E;  3CCU A;  3PF4 A;  1SDF A;  1S4Z A;  5KYL A;  2L9H A;  1M8A A;  3KOJ A;  3A8K E;  2BOS A;  2A1A A;  4DA2 A;  1DOL A;  3HOV G;  3BZK A;  4QQB X;  3K59 A;  3K5O A;  4F87 A;  2NZH A;  1JWU D;  2PW7 A;  5FLX L;  3S17 H;  4PMW A;  1TS4 A;  1I4X A;  1H95 A;  3PQI A;  2RSN A;  4FF2 A;  3CP0 A;  4WRD A;  4NMZ A;  1TWA B;  4OL7 A;  2D9U A;  1CKN B;  1GUN A;  1LTS D;  4X62 Q;  5IP9 H;  3CCJ A;  1CKO A;  2IHF A;  3TRZ A;  4HSP A;  4K8I A;  3GTQ H;  2XNA C;  1AFP A;  1HTP A;  2M2L A;  1JB3 A;  2CWA A;  4CJ2 C;  2L0C A;  3AFQ A;  4RKB A;  2HDL A;  5M9O A;  1OO9 B;  4RWS C;  4EGV A;  3OIQ A;  1STA A;  2KQ3 A;  4MTK A;  1CUK A;  1L0W A;  1E0B A;  2I46 A;  2QGQ A;  3BYY B;  4RH6 A;  2Q8I B;  4C1N K;  1UEB A;  3W3A A;  4OIJ A;  5DEH A;  1FNU A;  3VYS A;  2NVQ B;  4X62 L;  5AJ3 Q;  2K28 A;  2K6A A;  1HUN A;  2QKI C;  3PIO A;  4CDF C;  1Y14 B;  3WDN A;  4U68 A;  4ZRZ A;  2PW5 A;  2Y0S E;  3RZD B;  1QNU A;  5JJK A;  1E2V A;  5KND A;  3FPU B;  1WTV A;  1VQ9 A;  1EFW A;  1KAW A;  4DXF A;  3IKJ A;  2VUM H;  4V0B A;  4DV6 Q;  3GTG H;  4F8M A;  3QWN A;  1ZXT A;  1VQC A;  3SK6 A;  3K7U C;  1PH6 A;  3S1Q B;  1UNS A;  3HZX A;  1H9R A;  2F3W A;  3L0O A;  5AJ3 L;  3ER0 A;  3ND8 A;  4DK3 C;  1UE6 A;  1ZYR C;  2EOT A;  1PRT D;  4X3T A;  2EY5 A;  1G29 1;  4B9W A;  1E2Z A;  1GD7 A;  2XGT A;  2R7F A;  2VNU D;  3JAM i;  3T1H Q;  4GKJ L;  1F77 A;  2F0K A;  1WCM B;  1CA6 A;  3U9O A;  1MKH A;  4A3B H;  1CA5 A;  1Q81 C;  1DON A;  3ERO A;  2F0N A;  4HSV A;  4IPH A;  3QJY A;  1ENF A;  3RN5 A;  4MN3 A;  3KLS A;  4DV6 L;  1G91 A;  5J39 A;  3E0J A;  1KD1 C;  4JI6 L;  1PH1 A;  3DM1 A;  3T51 B;  4DNT B;  1SFO H;  4GNX B;  2K75 A;  4YHH Q;  1WCM G;  5LMU Q;  3MXN B;  3HOZ H;  1SBB B;  2F0P A;  2N8N A;  5A2Q L;  2C5C A;  4X6A H;  3GTP H;  4G7O C;  1YVC A;  4OO1 I;  2CH4 A;  2ZXO A;  4TQU S;  1AEX A;  4BS9 A;  3JAM L;  4ZLT F;  3S1R H;  5CV8 A;  4A3L H;  1PZJ D;  5JOB A;  3I7F A;  3RLO A;  4DAM A;  4UP7 A;  1F9Q A;  2E74 C;  3D31 A;  3D8G A;  4I7A A;  4HCS A;  3EIV A;  1NUC A;  2GVB A;  5ELN A;  2A68 D;  1H9K A;  3P75 A;  2R92 B;  2EY6 A;  1U4L A;  4IUP A;  1CHP D;  4QB4 A;  2E2H H;  4TKO B;  3DMU A;  2IT1 A;  4A3J H;  4ZKB B;  1EQR A;  2N49 A;  4YWK A;  4BY7 H;  1D1K A;  2CQO A;  3MXU A;  1FL0 A;  1IBK Q;  3R3O A;  4IJH A;  1V1O A;  3CF5 A;  1DXM A;  2B2V C;  2F0Q A;  4GOP B;  5I9O A;  4DGZ A;  3ULJ A;  1YNJ D;  2NVT B;  3OHX C;  4K0K Q;  2HCC A;  3TSS A;  2R92 G;  3HOU B;  1H9S B;  4IAL A;  4EQO A;  1WTX A;  1M1K C;  1S5B D;  4IUR A;  3ONA B;  2K05 A;  5G3L D;  1EYA A;  2L11 A;  5K36 H;  3ERQ A;  4R9W A;  1JWS D;  4KD3 A;  2F0V A;  2JXM B;  3G71 A;  1SJH D;  1FNW A;  4XQQ A;  1TWF H;  2F0L A;  2F1M A;  3PUZ A;  2A6H C;  4ME3 A;  4A4I A;  1EQT A;  5IT9 E;  5KEE A;  3UE0 A;  1IBL Q;  2WAQ G;  4A3F H;  2XRS D;  4LJZ C;  2IX0 A;  3PIP A;  3HOU G;  4POF A;  4ZKC B;  3QOJ A;  3UDI A;  1S3O A;  3MEH A;  2JEB I;  4A3K H;  3QR8 A;  1L0Y B;  4LMQ D;  2AWN A;  1FYC A;  2DY7 A;  1TWG H;  2PYK A;  2KCN A;  5IWA Q;  3HOW B;  2HCI A;  1SYF A;  3BVG A;  3M4Y A;  1XXG A;  3DUZ A;  1JT8 A;  2K5Q A;  1FGB D;  4LW1 A;  1EIG A;  2E2J H;  5IGB A;  3G6J B;  3U50 C;  1YNN C;  1NR4 A;  1WFQ A;  1RKN A;  1DM0 B;  2I5M X;  4JYA Q;  2HQL A;  2PZW A;  1JR0 D;  5IP7 G;  1HNW L;  1XTC D;  3GV3 A;  3KDF B;  3HOY B;  4GKK L;  4K5X A;  4XQJ A;  4RMF A;  3QOL A;  2F03 A;  1BDO A;  2FXQ A;  4A75 A;  3RN2 A;  4CKB A;  1Q8K A;  2DJF C;  1SYE A;  4UDU C;  3OMG A;  3M3Y H;  1D6E C;  3CPW A;  3X3N A;  1RTO A;  1XPU A;  1HTL D;  3U4Z A;  1I50 B;  3HOW G;  5IWA L;  3J80 L;  3DEO A;  1J5E L;  3T56 B;  2A6H D;  5IGE A;  3PO2 B;  2KJX A;  5IYB G;  2B29 A;  5CBE E;  1ONL A;  4YCW A;  4FF3 A;  2KBN A;  3UI2 A;  3HOX B;  3OWF A;  4JYA L;  4FP5 D;  1I6H B;  3HOY G;  3AU7 A;  1EYC A;  2AQ2 B;  4K5V A;  1JIC A;  3NTI A;  5K5P A;  4KY7 A;  4YY3 L;  2PQE A;  2ICE C;  4QUC A;  1PRT B;  3H15 A;  2A69 C;  2VB2 X;  5FK9 C;  3SDZ A;  1NNX A;  3H0G H;  4BY1 B;  1WD0 A;  2D0O A;  4JI4 L;  1I6V C;  1KLU D;  2K04 A;  1B2T A;  2MJ8 A;  1LTG D;  3PO2 G;  1VCI A;  2ICI A;  4B3M L;  1VQ8 A;  3GTJ H;  1CSP A;  2K5H A;  3HOX G;  1U4P A;  2B8G A;  4BXX H;  4C56 C;  3TP5 A;  5C0X G;  2BH8 A;  4JBM A;  2KOL A;  3EBE A;  2DGY A;  3RNU A;  4BBS B;  1PTO F;  4LUZ A;  3NEL A;  1WJJ A;  2UUB Q;  3K0X A;  4DR7 Q;  1DOM A;  1O80 A;  3BYT B;  3I4O A;  3TZU A;  1K28 A;  4BY1 G;  3NQI A;  2KUM A;  3A55 A;  4A3I H;  5FKA C;  3KYH C;  4L5T A;  3T13 A;  4LUV A;  1HCZ A;  2BDO A;  2NVY H;  3S17 B;  2LXK A;  3CCR A;  4A3E H;  1Q86 C;  3CQZ H;  4IOC A;  2IX3 A;  1PDQ A;  1SE2 A;  4X3S A;  1JCK B;  4BBS G;  3T1Y L;  2CQA A;  3D3R A;  2DN8 A;  2EYH A;  3OTO Q;  3J7A V;  2E8G A;  4R4C A;  2P5Z X;  3O13 A;  1QOH A;  4RHS A;  4RKL A;  4RGO S;  4X66 Q;  1EU3 A;  3GTQ B;  1JJ2 A;  4O2D A;  1SE8 A;  1TVX A;  4NXN L;  1U4M A;  1TWC B;  4LWC A;  4DV7 Q;  3TEH B;  4X64 Q;  1UE1 A;  1MHW C;  5CGK A;  1A0I A;  3G4S A;  2K50 A;  2NTT A;  4FYD A;  5M5X H;  1CI3 M;  2KA7 A;  1KIX A;  4ZUJ A;  1U0L A;  3CPF A;  1CQF A;  1QJO A;  5IP9 G;  1N36 Q;  1G8Z D;  1NCV A;  2CHB D;  2NZO A;  5JEA H;  2MGS A;  3A5U A;  3PF5 A;  4G7Z C;  2PI2 E;  2EVB A;  4NKL A;  4X66 L;  4X3K A;  5F2D A;  1SYD A;  2ZTE A;  3P20 A;  1Y1V H;  5GQO A;  1IYJ B;  3K5N A;  2K5D A;  2KHJ A;  4X64 L;  5I2Y A;  2B63 H;  4DR2 Q;  2CKZ B;  1SYG A;  4LFA Q;  4ZAI A;  3K5M A;  3I4N H;  1OXT A;  4IPG A;  2RSO A;  5J1Z A;  3ICE A;  1EIH A;  1BXT A;  1KC8 C;  2D62 A;  2XSC A;  4GN5 A;  1SMY C;  5KIX A;  3JC6 6;  4DKA C;  1G6P A;  1E7Z A;  1BCP D;  3I90 A;  3NSW A;  2L55 A;  1IL8 A;  4RCO A;  2F3V A;  1JJG A;  1N36 L;  4OWW B;  4R8N A;  1Z47 A;  1LTA D;  3MFG A;  3OW2 A;  1LYL A;  2X6G A;  1Y69 U;  1HNZ Q;  1VQE A;  4XIG S;  3IAY A;  3RR5 A;  3G48 A;  1RTN A;  2E2I B;  3SE0 A;  1TQO A;  2F0G A;  4X65 Q;  4JOI A;  3TME A;  4DR2 L;  3CCV A;  1SNO A;  2EJF C;  4LFA L;  1PZK D;  3D4D A;  2VUM G;  4DR6 Q;  1R4P B;  3I56 A;  1VQB A;  1GUG A;  3MXG A;  4JI5 Q;  4HJ5 A;  3J80 c;  3PIO 3;  4DR1 Q;  1XPR A;  4R4I A;  5M5Y H;  3AFP A;  1G2S A;  3GTM H;  5T1G A;  4Y7N B;  3PMF A;  4I65 A;  1EWC A;  3VYU A;  4GNX C;  2PQA A;  1LTL A;  1SYB A;  2ALY B;  2AWO A;  4H44 C;  1EWI A;  1E1O A;  2A19 A;  1HNZ L;  1EWH A;  2HHH Q;  4CJ1 B;  3UE1 A;  2PMZ E;  1JB7 A;  3HOZ B;  2EY1 A;  5FLX E;  5FO8 B;  4M1U B;  1P16 A;  3GTP B;  1TKW B;  1PMR A;  1KLG D;  1EOV A;  4PQX A;  1CT1 D;  4K2K A;  3UDF A;  4J8Q A;  4DPG A;  4IUT A;  3E9H A;  4DR1 L;  3NXW A;  5LMN Q;  4QUF A;  4JI2 L;  5JAV A;  3I72 A;  1F2Z A;  2JN4 A;  2KCC A;  4BBR H;  2UUA Q;  1U4R A;  5CV4 A;  1KDB A;  2HHH L;  3DHQ A;  3HOZ G;  3M4O B;  2E2H B;  2VS1 A;  2BA0 A;  4A3J B;  1HR0 Q;  1Q12 A;  1QNK A;  1I94 L;  2G5D A;  2UXC Q;  1SNC A;  4K6L A;  4CDD C;  3GTO H;  3K81 C;  3I70 A;  5C0X J;  1HRJ A;  2KVM A;  4C3J H;  5DM6 3;  1D7Q A;  3J81 c;  4EQN A;  1I5F A;  4GOP C;  2RA4 A;  4FXK C;  4JW0 A;  2MUY A;  1O78 A;  4AQY Q;  4K8J A;  2AQ3 B;  4DV0 Q;  3G6E A;  3H3V H;  4J15 A;  1T5X D;  4R4T A;  3PUW A;  5GRO A;  2UUA L;  5IOC A;  1TU2 B;  1JE4 A;  3KBG A;  1LV9 A;  1HH2 P;  2RDG A;  1YIT A;  4A3J G;  4OX9 Q;  3CCE A;  3QG1 A;  2B2T A;  3L9A X;  3WWV A;  5BN4 A;  4BY7 G;  5I4D A;  2UXC L;  4GN4 B;  4KMU C;  4DV4 L;  3RUZ A;  5C3X A;  4HJ7 A;  2RHQ B;  3PO3 B;  4K5W A;  5ELO A;  1II3 A;  1X6O A;  3ULL A;  1TWF B;  2J4X A;  3P1H A;  1M4V A;  4DNI A;  4CGY B;  3RZO B;  2CWP A;  1R9T H;  1A8V A;  2ES2 A;  4KHP Q;  3S14 B;  4QF4 A;  4I7Z C;  4DV0 L;  5CBA E;  2JA9 A;  1KL9 A;  3C46 A;  2ZM6 L;  4A3F B;  4DUZ Q;  2F52 A;  3CCS A;  1HQR D;  3K57 A;  5FLM H;  2RDH A;  4CJ0 B;  3I55 A;  3NK9 A;  2A74 C;  4A3K B;  3CCQ A;  2EIF A;  1XMQ L;  1ET6 A;  5K36 G;  4AYB G;  5JPM C;  1PH9 A;  2DNE A;  1RDP D;  1TWG B;  2E5L L;  1KDA A;  1YJ9 A;  2L4N A;  2KEN A;  4A3G H;  5EKK A;  2KCM A;  2F0T A;  4KHP L;  2EJG C;  4IQZ A;  4K6D A;  3IL8 A;  2OTJ A;  2GVA A;  4C3I H;  4QCL A;  4A3F G;  1TWH H;  5CV6 A;  3J7A 5;  4JPB W;  2CFM A;  1Y8O B;  1EIF A;  3MEF A;  4A3K G;  3K8A A;  2LSS A;  2IY5 B;  3M3Y B;  4IOA A;  5M5W H;  3JAM E;  4PG3 A;  5C6A A;  2Z6K A;  5EGT A;  2M00 A;  1I4G A;  3Q22 A;  1ESF A;  5JPN C;  3A7A B;  4OEM B;  1V9P A;  2IX1 A;  3SHL A;  2EJM A;  5TSS A;  3PIP 3;  1CSQ A;  2RVL A;  1KRT A;  4DFA A;  1AE3 A;  3Q8D A;  1N9W A;  1HNX L;  2VQF L;  1BCP B;  2H4O A;  2Q2I A;  2WB1 G;  2LS0 1;  2RKS A;  3L3O C;  2J7Z A;  1PRT C;  5LHY 1;  1DZ1 A;  2ZT9 C;  1I4Q A;  4QY7 A;  1BQQ T;  2L5T A;  2RQX A;  1SLJ A;  3D6C A;  2I07 B;  5FO9 B;  3K6O A;  2X6L A;  3KLR A;  3H0G B;  3KF6 A;  4TVA B;  4FF1 A;  3F2U A;  3K7A H;  5ELF A;  1XYI A;  3S15 H;  1PYW D;  1V1P A;  1VQK A;  4CDC C;  1GJX A;  3KK7 A;  5D65 A;  1CQV A;  4CBV A;  3M7N A;  3M7G A;  4UP9 A;  4R8I A;  4J6H A;  3VA5 A;  3S16 H;  3Q6S A;  4JI8 L;  2NVX B;  4KN4 C;  2DY8 A;  3HKS A;  5C4Z A;  2A6E D;  3DWQ A;  3SK4 A;  3BS1 A;  4GKJ Q;  1YHB A;  2XN9 C;  5KRU A;  2OF1 A;  3H0G G;  1QZH A;  4YCU A;  2BCO A;  1EY0 A;  1SE3 A;  3CW2 C;  2R7Z B;  4HIK A;  1IYU A;  2R6G A;  1IZ6 A;  2XTI A;  2NYZ D;  5C0X I;  3STB D;  1NMG A;  1HA5 A;  1Q46 A;  2SEB D;  1KQS A;  2NVY B;  5C44 H;  4QJF A;  3PUY A;  4A3E B;  3TP7 A;  1D2B A;  3CQZ B;  2WFW A;  2LMC B;  3NWT A;  3UDX A;  5JVH 3;  2KCT A;  4Q0F A;  1PYS B;  3TS0 A;  4JI6 Q;  1QUQ A;  5IGC A;  2MNA A;  2NZ1 D;  3GTK H;  2A68 C;  1CFM A;  5CC4 A;  3RLF A;  3V96 A;  2K32 A;  4G57 A;  3J7Y W;  4DK0 A;  5C5L A;  2KHS A;  4KKU A;  1QE6 A;  3BG3 A;  4GLX A;  1F9R A;  4A3I G;  2R7Z G;  1VQN A;  1STH A;  1GHJ A;  2UXB Q;  4FDB A;  1Z9F A;  2B2U A;  3EA6 A;  3KF8 A;  2CVR A;  3HKZ G;  4LF4 Q;  2VB3 X;  2Q8T A;  4A3E G;  4R4O A;  1TR5 A;  5M3M H;  1VQM A;  5JJL A;  1AZQ A;  1U9R A;  4HJ9 A;  4OEL B;  2QDL A;  4FO2 A;  1YNJ C;  2YTV A;  4GLV B;  2I0Q A;  4N9T A;  1S72 A;  5EKL A;  2R61 A;  1RF2 D;  1C0A A;  1LT4 D;  3CRK C;  1TS2 A;  1K3B C;  1Y1V B;  2VY3 A;  1STE A;  4A3D H;  2UXB L;  2B63 B;  1PTO H;  4ID6 A;  4LF4 L;  1K8O A;  5CV5 A;  4FXD A;  3I4N B;  2B2V A;  3T4A C;  1I4H A;  1B44 D;  3VYR A;  1PH3 A;  4K2L A;  4IPD A;  3PV0 A;  1BNZ A;  4C3H B;  5IYC H;  1LM0 A;  1X65 A;  2WKD A;  4RGM A;  5J22 A;  1MJC A;  5GAE C;  1LAC A;  5JEA G;  2NTS A;  3PGZ A;  5KNB A;  4KN7 C;  5E1F A;  2NN6 H;  3CD6 A;  4KKT A;  3S1M H;  3KLW A;  1Y1V G;  2Z1C A;  1K83 H;  1W2B A;  1Q1E A;  1PFM A;  4JBJ A;  5C3E H;  3HEJ A;  2B63 G;  4P2C B;  3X3M A;  1YEZ A;  3AB9 A;  4R4Q A;  1HZB A;  3I4N G;  1KAA A;  4X3U A;  4DR4 L;  3FDT A;  5C4X H;  1H9M A;  1SAP A;  2Z4H A;  1FR3 A;  1UE7 A;  2PQA B;  3U9S A;  2ZJR A;  1OXX K;  4A93 H;  4A3C H;  2OXP A;  5I9P A;  2JA6 H;  3S2D H;  4C3H G;  3SK8 A;  2WAQ B;  1Q3L A;  2JA7 H;  2TSS A;  1WD1 A;  5H1S E;  2WIN B;  5T1I A;  5LMN W;  4A76 A;  2EE1 A;  2ZXR A;  4H13 C;  2AUJ D;  5C5M A;  3URY A;  2VQE L;  2PCF B;  3PSI A;  2KHI A;  1C9O A;  2MO1 A;  1GVP A;  1PYB A;  1HPC A;  4QMG A;  1SNM A;  2UUC Q;  1OXU A;  3BVZ A;  4LF6 Q;  1HR0 W;  3CME A;  1K0S A;  1PVO A;  4KHZ A;  1A3U A;  3PUV A;  3C2P A;  2SNM A;  5GAD C;  2F0E A;  1HZ9 A;  1HNW Q;  3VR4 A;  1GUO A;  4GKK Q;  3J80 i;  2RCF A;  2G9D A;  5BR8 Q;  3A56 A;  1J8I A;  2OWO A;  3FKI H;  4BBR B;  2EYP A;  1X3G A;  2V4D A;  2HDM A;  2F3I A;  3RMH A;  1EZ8 A;  2B2Y A;  4B9X A;  4BWG B;  5CMD A;  2UUC L;  1J5E Q;  1X54 A;  5D3D A;  2R3Z A;  3V2T A;  3H6M A;  3H91 A;  2E2D C;  4LF6 L;  3F8T A;  1GKH A;  4C3J B;  2R93 H;  2PNH A;  2AHO B;  3KFU A;  3FPP A;  4NXM L;  1BBU A;  3VR5 A;  3R8B A;  1JOO A;  3DLL A;  1SN8 A;  1JOQ A;  2WV6 D;  1L2F A;  1XNQ Q;  5BR8 L;  1Y1W H;  5EBC A;  4BBR G;  4YY3 Q;  1F9S A;  1CKM A;  2B39 A;  2H5X A;  4UY8 C;  3G7L A;  3NPP A;  3I73 A;  4GZY C;  1M90 C;  1X32 A;  2PZT A;  3E5S A;  1QZG A;  5IYD G;  4O0A A;  1RD9 D;  4JI4 Q;  1S5D D;  5C4J H;  2O5J C;  1PTO D;  4IFD H;  5HY6 A;  1I4P A;  1OXS C;  2F4V L;  4B3M Q;  3K58 A;  4C3J G;  1HHV A;  4P74 A;  4E6I A;  3H94 A;  1HZA A;  5DAU A;  3CCM A;  1CM9 A;  3A74 A;  3CRL C;  2WAQ E;  4RHR A;  3J81 i;  4O1N A;  1B4O A;  1WTW A;  4LF5 L;  2BE5 D;  1VQI A;  1XNQ L;  2RCN A;  2IWH A;  1FNV A;  1QWY A;  1WVL A;  4QIW B;  1O7Y A;  1V43 A;  4NDX A;  4JI1 Q;  2XWB B;  1F2L A;  4DAP A;  1JMC A;  1B53 A;  3BZD B;  3GP7 A;  2OEO A;  4A3G B;  4HMI A;  2FMM A;  3W1B A;  1ROD A;  1Z6H A;  2VW9 A;  5E4W C;  1MGS A;  3T1Y Q;  3MWY W;  1SR3 A;  4C3I B;  4ILW A;  1TWH B;  3H09 A;  4DK6 C;  1VQD A;  2Q2T A;  3SEB A;  1DD2 A;  3NQT A;  4JI1 L;  4LF9 Q;  3J81 L;  1XX8 A;  2RDF A;  4G4K A;  1X56 A;  4NXN Q;  5M5W B;  3TS2 A;  2NVQ H;  1B7Y B;  1EY8 A;  1E2W A;  4A3G G;  2LFN A;  4XQN A;  1W3S A;  1N33 Q;  1A6X A;  3RLN A;  1PFB A;  2HIV A;  5A35 A;  4C3I G;  2JQO A;  1BCP C;  3FRP B;  5JEA J;  3RZD H;  1YIJ A;  3I4M H;  1GUW A;  4ALP A;  1N32 Q;  3N6R A;  3KF6 B;  3TBI B;  4LF9 L;  1ICF B;  1QVC A;  1J9O A;  1PH5 A;  1V1P B;  3KBX A;  5CR3 A;  5M3F H;  3K7A B;  5IT9 L;  1CTM A;  3S15 B;  2CH4 W;  3DEP A;  4JK1 C;  5IGD A;  3QIA A;  1N33 L;  2EXD A;  2JJQ A;  1NBW A;  2OQK A;  4PV1 C;  4HN7 A;  3GO5 A;  4MIU A;  1B1Z A;  1G6Z A;  1LLR D;  1Z7T A;  2PO4 A;  2EPB A;  4P73 A;  4OGQ C;  4B3T L;  4HID A;  1WCM H;  1QVG A;  1L0X B;  3HP3 A;  4P75 A;  3F2D A;  2AQ1 B;  2XVS A;  4IUQ A;  3K5L A;  1N32 L;  1YZ6 A;  5AFW A;  3CC2 A;  3FEW X;  3BDL A;  3CHB D;  2DNC A;  1UWV A;  3QB3 A;  2YU9 H;  4EVO A;  3A7L A;  1WTP A;  2VUM B;  3GTG B;  2OT2 A;  1QUQ B;  5C44 B;  4FF4 A;  1IL2 A;  2OQ0 A;  1XWE A;  5ELC A;  4OWT B;  4Q5V A;  3MAQ A;  1YJW A;  5D14 A;  3VA7 A;  1PH2 A;  4JI0 Q;  2YV5 A;  1UE5 A;  2WII B;  1BF4 A;  3GTK B;  5CV9 A;  1L1O A;  4CKC A;  1GHK A;  1YI2 A;  1R4Q B;  4DAY A;  2N78 A;  3KF8 B;  3I91 A;  2IL8 A;  1E3P A;  4A3B B;  2Z4I A; 
#chains in the Genus database with same CATH homology
 3SGI A;  2K75 A;  2NN6 I;  4YHH Q;  4HIO A;  1WCM G;  4BXX H;  3M85 A;  5LMU Q;  3ULP A;  2GVA A;  4C3I H;  2ASB A;  2OTJ A;  3MXN B;  3HOZ H;  4A3F G;  1XNQ Q;  1TWH H;  1Q7Y C;  2ZTC A;  4EQ5 A;  2N8N A;  3J7A 5;  1IBM Q;  5C44 G;  1VS0 A;  4X6A H;  3GTP H;  2CFM A;  1YVC A;  1TWA H;  4OO1 I;  1EIF A;  4TQU S;  1SRO A;  1EIY B;  1XTD A;  4BA2 I;  3MEF A;  4JI3 L;  3K8A A;  2LSS A;  4JI2 Q;  4A3K G;  2IY5 B;  1N34 Q;  4IOA A;  1Q82 C;  3S1R H;  4JI0 L;  4A3L H;  5M5W H;  3I7F A;  4MNO A;  4PG3 A;  3RLO A;  2Z6K A;  1CKN A;  3AQQ A;  3NEM A;  4UP7 A;  4DAM A;  1PFS A;  1YHQ A;  3BU2 A;  3D31 A;  1PH4 A;  1QVF A;  1XNR L;  3EIV A;  1V9P A;  2IX1 A;  4LF7 L;  3CAM A;  1XMO Q;  2GVB A;  4A3B G;  5ELN A;  2JE6 I;  1I94 Q;  2GN5 A;  5FLM G;  1BBW A;  1CSQ A;  1KRT A;  1PHJ A;  1AE3 A;  4KHP L;  4B3R Q;  3Q8D A;  1YNX A;  2ZJQ A;  2QEX A;  1N9W A;  5E7N A;  2E2H H;  1E22 A;  2IT1 A;  4A3J H;  1HNX L;  2QA4 A;  2VQF L;  1EQR A;  1U5K A;  1IBM L;  2N49 A;  2WB1 G;  2Q2I A;  4YWK A;  3HOU H;  2IHE A;  1X55 A;  4OWX B;  5M3M G;  1WI5 A;  4NB3 A;  4BY7 H;  4QY7 A;  4GS3 A;  2CQO A;  2CCZ A;  4P72 A;  5GAH C;  1SLJ A;  1N34 L;  1E24 A;  1FL0 A;  1IBK Q;  4RG1 A;  3JAM c;  4IJH A;  2ID0 A;  4DR5 Q;  1PV4 A;  2NVX H;  3CF5 A;  3KF6 A;  4JOI C;  4TVA B;  2K52 A;  4GOP B;  3K7A H;  3ULJ A;  3S15 H;  4B3T Q;  1XMO L;  4K0K Q;  1VQA A;  1YHA A;  1VQK A;  2R92 G;  4DUY L;  1SRU A;  1I3Q H;  2VL6 A;  4B3S Q;  2R7Z H;  2ZJP A;  1M1K C;  4DV4 Q;  5HGQ A;  3GTL H;  2UXD Q;  4LF8 L;  4B3R L;  3M7N A;  1VQG A;  4UP9 A;  1C7Y A;  3S16 H;  1BVS A;  4C2M H;  1ASZ A;  3S1Q H;  4A3L G;  3K80 C;  4JI8 L;  4IJL A;  4HJ8 A;  4DV2 L;  3OYY A;  3G71 A;  2Q2U A;  1VQP A;  3HKS A;  3NEN A;  3TRE A;  1TWF H;  1MJE A;  3PUZ A;  4GKJ Q;  1YHB A;  4ME3 A;  2VZA A;  4A4I A;  4DR5 L;  2V1C C;  3H0G G;  5IYC G;  4YCU A;  2ZM6 Q;  1S40 A;  1QZH A;  2YYZ A;  2UUB L;  3CW2 C;  4DR7 L;  4HIK A;  1AH9 A;  2R6G A;  3UE0 A;  1IZ6 A;  2XTI A;  3VDY A;  2HIX A;  5C0X I;  1TXY A;  2WAQ G;  3STB D;  1IBL Q;  1NMG A;  4A3F H;  1Q46 A;  3PIP A;  2IX0 A;  1XMQ Q;  1KQS A;  3HOU G;  1VQF A;  4POF A;  5C44 H;  4QIW E;  4HJA A;  4B3S L;  4QJF A;  3PUY A;  5C3E G;  3E0E A;  4POG A;  2WFW A;  2UXD L;  3UDI A;  1S3O A;  3L7Z C;  3UDX A;  2E5L Q;  1RIP A;  2JEB I;  4A3K H;  2KCT A;  4IFD I;  3F1Z A;  1PYS B;  3TS0 A;  4JI6 Q;  1QUQ A;  2AWN A;  4DV5 Q;  4OO1 G;  2MNA A;  5C4X G;  4MTN A;  3GTK H;  1TWG H;  5IWA Q;  2YTX A;  4A3C G;  3RLF A;  3F2C A;  4JI7 Q;  5IT9 c;  4GLX A;  2JA7 G;  1JT8 A;  2DUD A;  3PCO B;  4LW1 A;  1YJN A;  2E2J H;  2R7D A;  1VQ7 A;  3OTO L;  4A3I G;  1I50 H;  2R7Z G;  3U50 C;  1VQN A;  3F2B A;  1P8L A;  1WFQ A;  4DV3 Q;  2I5M X;  4FDB A;  2UXB Q;  1Z9F A;  4JYA Q;  4JI3 Q;  2HQL A;  2EQS A;  5IP7 G;  1HNW L;  3HKZ G;  3D0F A;  3FP9 A;  3KDF B;  4IO9 A;  4LF4 Q;  4NPS A;  4GNX A;  4GKK L;  1HZC A;  1FGU A;  4A3E G;  4RMF A;  4R4O A;  1KRS A;  3HFZ B;  5M3M H;  1VQM A;  2FXQ A;  4A75 A;  5JJL A;  3RN2 A;  4DV7 L;  1Q8K A;  4HJ9 A;  1I6H H;  4DV1 L;  3M3Y H;  1GM5 A;  3CPW A;  2YTV A;  3M4P A;  4GLV B;  4PZ6 A;  4DV5 L;  1JJC B;  5IE8 A;  2I0Q A;  2UU9 Q;  1S72 A;  1JE5 A;  4LUO A;  2L15 A;  1XPU A;  3U4V A;  3U4Z A;  4YCV A;  3HOW G;  5IWA L;  1J5E L;  1VQ6 A;  4JI7 L;  3FHW A;  4JV5 Q;  1C0A A;  3GD7 A;  1WYD A;  5IYB G;  2JEA I;  3AEV A;  3KJO A;  2B29 A;  1HNX Q;  2VQF Q;  4YCW A;  4C3H H;  1YBY A;  2R92 H;  2KBN A;  4L5R C;  1G51 A;  2VY3 A;  4DV3 L;  4A3D H;  2UXB L;  4JYA L;  2ZTD A;  3HOY G;  4LF4 L;  1X3E A;  1J6Q A;  4A3M G;  4YY3 L;  2BH2 A;  1BKB A;  1VQO A;  3H15 A;  1PH3 A;  2UU9 L;  1GO3 E;  3EN2 A;  5IY0 A;  4IPD A;  3PV0 A;  3STB C;  3H0G H;  5IYC H;  1LM0 A;  1X65 A;  2K4K A;  2R93 G;  2D0O A;  4DUY Q;  1VQ5 A;  4JI4 L;  1MJC A;  5GAE C;  3GDE A;  5JEA G;  3PGZ A;  4LF8 Q;  4JV5 L;  3PO2 G;  2NVT H;  1VCI A;  4B3M L;  1FVI A;  2RF4 A;  3CC4 A;  1VQ8 A;  3DM3 A;  3GTJ H;  3M9B A;  1CSP A;  2K5H A;  3IRB A;  4QGU A;  3HOX G;  3CD6 A;  4GOP A;  3S1M H;  3KLW A;  1Y1V G;  4JI8 Q;  1K83 H;  1Y1W G;  1Q1E A;  1W2B A;  2Y0S G;  4JBJ A;  5C3E H;  4DV2 Q;  4JBW A;  5C0X G;  1NTG A;  1VQL A;  2B63 G;  2BH8 A;  1K9M C;  1YEZ A;  4JBM A;  3UDG A;  4P71 A;  1L1O C;  2DGY A;  3EBE A;  4R4Q A;  1RL2 A;  3RNU A;  4LUZ A;  1HZB A;  3I4N G;  4AYB E;  3E9I A;  1LUZ A;  1N8R C;  4X65 L;  4DR4 L;  3NEL A;  2OTL A;  1WJJ A;  5C4X H;  3A5Z B;  3K0X A;  2UUB Q;  1XPO A;  1VQ4 A;  4DR7 Q;  1UE7 A;  2AKW B;  4IFD G;  1Q1B A;  2PQA B;  2ZJR A;  1OXX K;  4A93 H;  1K0R A;  4A3C H;  2K5V A;  3I4O A;  2JA6 H;  3S2D H;  4DR6 L;  2JA7 H;  4YWL A;  4BY1 G;  4LNQ A;  4KLK A;  3H3V I;  4AH6 A;  5H1S E;  3ERS X;  4A3I H;  4JI5 L;  3KYH C;  4L5T A;  5LMN W;  4A76 A;  2MQH A;  1E1T A;  4A3D G;  2MO0 A;  4LUV A;  1XJV A;  5IP7 H;  3BJU A;  2VQE L;  2WP8 J;  2NVY H;  3PSI A;  2KHI A;  2LXK A;  4EX5 A;  1C9O A;  3CC7 A;  2JA5 G;  3CCR A;  3NBH B;  4A3E H;  1Q86 C;  2MO1 A;  1GVP A;  1PYB A;  2Q2H A;  1TWC H;  3CQZ H;  4IOC A;  3U58 A;  4R1J A;  2Z6K C;  2UUC Q;  1PH8 A;  3BZC A;  1OXU A;  4BBS G;  3T1Y L;  3S1N H;  4LF6 Q;  4L5S A;  1HR0 W;  3CME A;  4UP8 A;  1PVO A;  5IYD H;  3OTO Q;  2E8G A;  3PUV A;  4KHZ A;  1EUJ A;  4PZ8 A;  3HOW H;  1A62 A;  4L5Q A;  4R4C A;  5GAD C;  3S24 A;  5GAG C;  1HZ9 A;  4JBK A;  1HNW Q;  5IYB H;  3TQY A;  4X66 Q;  2NN6 G;  4GKK Q;  1JJ2 A;  4WJ3 M;  4O2D A;  1SE8 A;  3J80 i;  4BXX G;  4NXN L;  5BR8 Q;  4XTC S;  1VQH A;  3FKI H;  4LWC A;  4DV7 Q;  3TEH B;  2OWO A;  4X64 Q;  1X3G A;  1FJG Q;  5LMN L;  4DV1 Q;  1UE1 A;  3KJP A;  3AYH B;  2F3I A;  3HOY H;  2WB1 E;  1A0I A;  1K3R A;  3G4S A;  1K73 C;  2HT1 A;  3S2H H;  4A3M H;  4KI0 A;  2K50 A;  1OXV A;  2UUC L;  1J5E Q;  1X54 A;  5M5X H;  1X9N A;  1PA6 A;  3KDF A;  1KIX A;  4A93 G;  2JA6 G;  1U0L A;  3CPF A;  4LF6 L;  3F8T A;  1GKH A;  2N3S A;  5IP9 G;  1N36 Q;  2R93 H;  1HR0 L;  1NJI C;  4LFB Q;  2PNH A;  2LXJ A;  2K5N A;  2NZO A;  2AHO B;  3KFU A;  3A5U A;  3PF5 A;  3PO2 H;  4GLA C;  1BBU A;  2PI2 E;  1K8A C;  4NXM L;  4LFC Q;  4X66 L;  3DLL A;  1SN8 A;  1L2F A;  3HOX H;  1PH7 A;  2ZTE A;  5BR8 L;  1Y1V H;  1Y1W H;  5GQO A;  4BA1 I;  4BBR G;  1CKM A;  4YY3 Q;  2H5X A;  1IYJ B;  4JCV E;  2MFI A;  4AQY L;  2KHJ A;  4X64 L;  4UY8 C;  1FJG L;  1B70 B;  1VQJ A;  2AMC B;  4DR2 Q;  2A8V A;  2CKZ B;  2B63 H;  4Y52 H;  4LFA Q;  1M90 C;  2E2I H;  1V1Q A;  3I4N H;  1OXT A;  1QZG A;  1IXR A;  4IPG A;  1NY4 A;  4O0A A;  5IYD G;  5EAY A;  3ICE A;  3I4M G;  1KC8 C;  4PZ7 A;  1MIU A;  2D62 A;  4GN5 A;  2JK8 A;  5C4J H;  4JI4 Q;  5HY6 A;  3JC6 6;  4UPA A;  4DKA C;  1G6P A;  1OXS C;  2F4V L;  1E7Z A;  1KXL A;  4B3M Q;  4P74 A;  4OX9 L;  4BY1 H;  1JJG A;  2Z0S A;  1N36 L;  4OWW B;  1T9H A;  1HZA A;  2JA8 G;  1Z47 A;  3OW2 A;  3CCM A;  4LFB L;  3FKI G;  4HIM A;  5DLQ E;  5JJI A;  1LYL A;  5FJ8 G;  3PO3 G;  3A74 A;  5M3F G;  2WAQ E;  2C35 B;  1VQE A;  4XIG S;  2PI2 A;  3RR5 A;  3J81 i;  3J81 j;  3G48 A;  4LFC L;  4Y7N H;  4LF5 L;  1VQI A;  4DR4 Q;  4X65 Q;  2JA5 H;  1XNQ L;  2RCN A;  4JOI A;  4OXP A;  2I5H A;  3CMA A;  2OCE A;  1AE2 A;  3CCV A;  4DR2 L;  3T1H L;  1EYG A;  4LFA L;  3M4Q A;  5J3B A;  4BBS H;  2VUM G;  1V43 A;  4JI1 Q;  1L1O B;  4DR6 Q;  3PUX A;  2YTY A;  4DUZ L;  4DAY B;  3I56 A;  1VQB A;  3B6Y A;  2K14 A;  1B8A A;  3CCU A;  1JMC A;  4JI5 Q;  4HJ5 A;  3J80 c;  3PF4 A;  4DR1 Q;  3KOJ A;  1XPR A;  4R4I A;  5M5Y H;  3ZJY C;  3AFP A;  2A1A A;  3GTM H;  4QL5 A;  2VQE Q;  4JG2 A;  3HOV G;  3L2P A;  3BZK A;  4GNX C;  2D0P A;  4QQB X;  2PQA A;  1LTL A;  1O7I A;  3W1B A;  2ALY B;  2AWO A;  2VW9 A;  1EWI A;  1E1O A;  2A19 A;  1HNZ L;  2HHH Q;  2NZH A;  3HKZ E;  3T1Y Q;  3UE1 A;  3S17 H;  1OTC A;  2PMZ E;  4PMW A;  1SR3 A;  4WJ4 A;  1JB7 A;  1H95 A;  4DK6 C;  1VQD A;  2Q2T A;  1P16 A;  3CP0 A;  4YHH L;  1CKN B;  1EOV A;  5LMU L;  3M4O H;  4JI1 L;  4LF9 Q;  3UDF A;  4AIM A;  4IPC A;  4X62 Q;  4GN3 B;  4DPG A;  5IP9 H;  1X56 A;  3CCJ A;  1CKO A;  3E9H A;  4NXN Q;  2IHF A;  3CXC A;  4DR1 L;  1ASY A;  3TS2 A;  2NVQ H;  1B7Y B;  5LMN Q;  1HNZ Q;  4JI2 L;  3TRZ A;  3GTQ H;  4A3G G;  1EQQ A;  1W3S A;  2ATW A;  3W5O A;  1N33 Q;  2CWA A;  3RLN A;  4APV A;  4YWM A;  4BBR H;  2UUA Q;  2HIV A;  3AFQ A;  2HHH L;  4DR3 Q;  2JQO A;  5FLX c;  3HOZ G;  5JEA J;  1K8G A;  2VS1 A;  2BA0 A;  1CUK A;  3RZD H;  1YIJ A;  1HR0 Q;  1Q12 A;  1I94 L;  3I4M H;  1L0W A;  4ALP A;  1N32 Q;  2UXC Q;  2QGQ A;  3KF6 B;  3J7Z C;  3GTO H;  1UEB A;  3K81 C;  4NXM Q;  4LF9 L;  5C0X J;  1X3F A;  4C3J H;  1QVC A;  4X62 L;  5AJ3 Q;  3J81 c;  1PH5 A;  1D7Q A;  3W1G A;  1I5F A;  2JA8 H;  1SMX A;  4GOP C;  3PIO A;  4MZ9 A;  4AQY Q;  3PO3 H;  5FJ8 H;  5M3F H;  1Y14 B;  4DV0 Q;  3G6E A;  3H3V H;  4J15 A;  1IBK L;  4IFD J;  4R4T A;  3RZO H;  3PUW A;  4H02 A;  5GRO A;  2EXD A;  1N33 L;  2Y0S E;  2JJQ A;  1NBW A;  2B3G A;  2OQK A;  2UUA L;  2RHS B;  3S14 H;  3GO5 A;  1A63 A;  5JJK A;  1HH2 P;  1WOC A;  1VQ9 A;  4P73 A;  1YIT A;  1KAW A;  4DR3 L;  4HID A;  1WCM H;  1EFW A;  1QVG A;  4A3J G;  4B3T L;  2BA1 A;  3CCE A;  4DV6 Q;  4OX9 Q;  4P75 A;  2VUM H;  3F2D A;  3GTG H;  4K0K L;  3WWV A;  1PH6 A;  1VQC A;  4JC0 A;  3K7U C;  4BY7 G;  1N32 L;  1NE3 A;  4GN4 B;  2UXC L;  1YZ6 A;  4DV4 L;  3CC2 A;  4HJ7 A;  2RHQ B;  5ELO A;  1X6O A;  3ULL A;  3L0O A;  5AJ3 L;  1UWV A;  3ER0 A;  3HOV H;  4DK3 C;  4LF5 Q;  4DNI A;  1UE6 A;  2CWP A;  1R9T H;  1A8V A;  1G29 1;  2ES2 A;  2YU9 H;  4KHP Q;  1GD7 A;  2XGT A;  2R7F A;  3CCL A;  2VNU D;  3JAM i;  4DV0 L;  3T1H Q;  4GKJ L;  2JA9 A;  1KL9 A;  4OON A;  2ZM6 L;  1D8L A;  1MKH A;  4DUZ Q;  4A3B H;  2F52 A;  3CCS A;  1QUQ B;  1Q81 C;  5FLM H;  1IL2 A;  2OQ0 A;  3I55 A;  2F4V Q;  4IPH A;  1DGS A;  3RN5 A;  1IBL L;  4DV6 L;  4OWT B;  1HJP A;  2EIF A;  3CCQ A;  1YJW A;  2I5L X;  1XMQ L;  1PH2 A;  4JI0 Q;  2YV5 A;  4AYB G;  1UE5 A;  5K36 G;  1PH9 A;  3LGJ A;  2E5L L;  1KHI A;  1L1O A;  1XNR Q;  1YI2 A;  1KD1 C;  4LF7 Q;  1YJ9 A;  4JI6 L;  2N78 A;  2KEN A;  3KF8 B;  1PH1 A;  4A3G H;  2KCM A;  1E3P A;  3A0J A;  1SFO H;  3I2Z A;  4GNX B;  1NMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...