3KDFA

X-ray crystal structure of the human replication protein a complex from wheat germ cell free expression
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Replication protein A 14 kDa subunit
publication title X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression
rcsb
source organism Homo sapiens
total genus 23
structure length 115
sequence length 115
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kdfA00
4C3IH 4OX9L 3F2DA 1HJPA 4YCUA 4B3TL 3RN2A 1PH4A 1PV4A 3ULJA 1IZ6A 1N34L 1XMQL 1VQ6A 3PO2G 2QGQA 3DM3A 4A3LH 1KQSA 4A3FG 4LFBQ 5M3FH 3K7AH 4LF4L 4A3DG 1WYDA 4B3RQ 4O0AA 4DV7Q 3PF5A 1NJIC 3HOVG 2PI2A 4EX5A 1SROA 3JC66 2PQAB 4WJ3M 4NXNQ 1FJGQ 1YBYA 1W3SA 3ERSX 5IYBG 1Y1WH 3D31A 3J81j 1VQIA 1BKBA 4XIGS 1A8VA 3KF6B 5LMNQ 1YNXA 1X3GA 4DUZQ 3RN5A 2HHHL 2ZJRA 3KDFA 2R93G 1RIPA 4LF5L 1KIXA 2ZM6L 2QA4A 2A1AA 3HOXH 1LUZA 2BH8A 2UU9Q 1CSPA 3CCJA 1VQNA 2D0PA 4OWXB 2OCEA 2N78A 1P8LA 2WFWA 1HR0Q 3CCLA 2VQEQ 1PH3A 4IJLA 4YHHL 2RHSB 4QL5A 3PSIA 4LUZA 3FP9A 2A8VA 4DR1Q 1HNXL 1B70B 1WOCA 3CMAA 2KHIA 5GAEC 3GO5A 4APVA 4DV5Q 4HIDA 3RNUA 1MIUA 2WP8J 1Q82C 3CCRA 3AEVA 2JEBI 1I94Q 1NBWA 1X56A 2CWPA 4JOIC 1VQ4A 4A3BG 4LFAL 4JI7L 4K0KQ 4A3JH 3EN2A 4BBRH 1PH9A 2OTJA 1N32L 4P72A 1EIFA 3CCEA 2MO0A 1YZ6A 3ULLA 2AWNA 4DR4L 1V9PA 1Y1VG 4DV2L 1W2BA 4HIKA 2CWAA 2IT1A 4X6AH 2HIXA 2YTXA 2E8GA 4KLKA 5HGQA 2KHJA 3I2ZA 4JI3Q 5ELNA 3FKIH 4JCVE 2K75A 2D0OA 3RLOA 4C3JH 1PH7A 1EWIA 1OXXK 1QUQB 5FJ8G 2R7FA 1KRSA 2N3SA 3MEFA 5H1SE 2JA8H 4L5RC 1K8GA 4B3ML 2JQOA 4UPAA 3PCOB 3RR5A 1PYBA 2F52A 1NMGA 4HJ5A 1IBKL 1CKNA 1KAWA 3K80C 4JC0A 4BY7H 2NZHA 3HOYH 1VQJA 4A3MH 2ALYB 1VQMA 4BXXG 1EQRA 1Z47A 1U0LA 1VQFA 4YWMA 2E5LL 3J7A5 4LFBL 2UXCL 1J6QA 4A3EH 1SE8A 5DLQE 4B3RL 4DV4Q 3NENA 4BA1I 2CKZB 4JI2Q 4DV0Q 4DV7L 3GTGH 4MTNA 3S14H 1K0RA 2OTLA 4AH6A 3I4MH 1FJGL 5LMUQ 5EAYA 3KLWA 5LMNL 4GKKL 4LF7Q 1VQ8A 3GTQH 3M4QA 2B63G 3HOWH 1JT8A 3HOUG 4BY1H 1WCMH 2K5HA 1Z9FA 3CC7A 3TS2A 4JV5L 4KHPL 4O2DA 1XNQQ 3CAMA 1G291 2UU9L 2YV5A 1E22A 2R6GA 2JA7G 4UY8C 2PI2E 1B7YB 5FLMH 4LF9L 1EQQA 1CSQA 5FLXc 1VQAA 1HR0L 2B3GA 5JEAJ 1DGSA 5M5XH 5E7NA 2UXBL 4A4IA 3UDFA 4YCWA 2Z6KA 1VQDA 1VQ5A 3LGJA 4DR3Q 2UUBQ 4NXMQ 3PO2H 3A5UA 1AH9A 4GN4B 4A3FH 3STBD 3DLLA 3OTOQ 2JEAI 3MXNB 4QIWE 1KD1C 1XTDA 2R92G 3M4PA 5IYCG 3JAMc 1Y14B 2GVAA 4GS3A 5IP9H 3K7UC 2K50A 4X64Q 2NN6G 3S2DH 4B3SL 5HY6A 1OTCA 2ES2A 2R93H 4LF6L 2K5VA 4GOPB 2NVTH 1X55A 4IPGA 3PIOA 1C9OA 2E2HH 1UE5A 2ZTDA 1X3EA 3TEHB 5IWAL 2I5MX 2MQHA 4C3HH 1PH6A 1FL0A 3S17H 1WI5A 1JB7A 4DUYQ 2PQAA 3HKZG 4OONA 5IE8A 1PFSA 4HIMA 2VQFL 2YTYA 4RMFA 1L1OB 3KF6A 1X65A 1I6HH 3M85A 4DR5Q 1IBLQ 4GKJQ 1VQEA 3KYHC 4OXPA 4R4QA 5GAGC 1JMCA 4R4OA 4X66L 1S3OA 1K83H 4DR2L 4LFCL 1YVCA 3GDEA 1VS0A 2R7DA 1SRUA 3OW2A 2F3IA 3S1NH 4A3BH 4JI4Q 1JJCB 3J80c 4DV4L 4JI6L 4JI2L 3UDIA 2DGYA 3CMEA 3T1YL 3D0FA 3L0OA 4DR6Q 4HJ7A 1KL9A 1L2FA 4PZ8A 3S2HH 4X65Q 3TRZA 4PG3A 4DV6Q 2LXJA 1UE7A 5C3EG 1ASYA 1Y1VH 4L5QA 3HOZG 4IPDA 5K36G 5IYDG 1X6OA 2OWOA 3I4NH 3NEMA 1XNQL 4YY3Q 1PA6A 2JK8A 1PH1A 4DV3Q 2F4VQ 1IYJB 2AHOB 1HZBA 4KHZA 4C2MH 3S1MH 1HNWL 1SFOH 1ASZA 2UUAQ 2GVBA 2NN6I 3U4VA 5M5WH 1XJVA 1PH2A 4X62Q 1K9MC 1EOVA 4DV1Q 2Z6KC 2CFMA 3KFUA 5JJIA 2UUBL 2HT1A 3CC2A 1M90C 1VQLA 2JA6G 2WB1E 4GLAC 1BBWA 2RCNA 4DR7Q 2ZTCA 2YU9H 1J5EQ 1QUQA 3L7ZC 2Q2HA 3ZJYC 2UUCQ 5GQOA 2ZTEA 1XNRQ 4A3CH 1FGUA 4HJAA 2VY3A 4PMWA 1VQBA 4P71A 5M3FG 2FXQA 4BBSG 4GLXA 4IOAA 4Y52H 5GADC 2KENA 4L5TA 4JI1Q 4X64L 3CPWA 3UE0A 1JE5A 3EBEA 1BBUA 1N9WA 3HOUH 1TWCH 3T1HL 2XGTA 1EIYB 4LF8L 1XMOL 3M4OH 1R9TH 1HH2P 2CCZA 2OQKA 2VZAA 4A3GH 3NELA 2RHQB 3I56A 2I5LX 3FHWA 4GNXB 4HJ9A 2NVYH 5BR8Q 4OWWB 3PUZA 1YIJA 3BZCA 3HOXG 1VQOA 1NY4A 4JYAQ 4QGUA 3HKZE 4A3IG 4JBMA 4DR5L 1N36Q 4A3KH 2ZJQA 4A93H 1NMFA 1Q81C 1N33Q 4P74A 2BA0A 1I5FA 1C7YA 2VL6A 5M3MH 4NXNL 2YTVA 1LTLA 3E9IA 3K81C 3UDGA 5IT9c 4JI0L 4JI4L 3UDXA 2LSSA 1GD7A 2AKWB 4DUZL 5IYCH 3CF5A 2JJQA 3PUYA 5IP7H 4DKAC 1VCIA 3H0GH 5C0XG 2AWOA 3CQZH 1LM0A 3U58A 1A0IA 4LF4Q 1WJJA 3F2BA 3CD6A 1UE1A 1VQCA 5ELOA 4EQ5A 2UXDQ 3A0JA 4A76A 3J81i 4IPHA 2N49A 3SGIA 1V1QA 2JA5H 4IO9A 1IBMQ 2K5NA 1OXSC 3H3VI 4NB3A 2VQEL 4YY3L 1A63A 4JI8Q 4UP9A 1PH5A 1XPRA 2F4VL 3S16H 1SMXA 2BH2A 4DR1L 2R7ZG 3PGZA 2ZM6Q 2Q2UA 1G6PA 3E0EA 4DV5L 3KJPA 4AQYQ 3CPFA 4JBWA 2C35B 1YHQA 3CW2C 2WB1G 1I94L 2IX1A 4BA2I 3AQQA 4MNOA 3I4OA 2K4KA 4IFDG 4TQUS 4A3DH 3OYYA 4K0KL 4GOPA 1L0WA 2EXDA 1Q8KA 2JA8G 3HOVH 1UE6A 2KCTA 3GTKH 3K0XA 4DAMA 4HJ8A 1M1KC 2KBNA 3WWVA 2LXKA 2V1CC 5IYBH 3H15A 1MJEA 4BY7G 1X3FA 3HOYG 4GN5A 3BZKA 2ATWA 1T9HA 4A3MG 1XNRL 3G71A 1MKHA 4AYBE 1YITA 4OWTB 3CP0A 3KF8B 4JI3L 3ULPA 1K73C 3ER0A 1L1OA 4LFAQ 4JI1L 3U4ZA 3NBHB 5IY0A 1HNZQ 1GM5A 1UWVA 2GN5A 5IYDH 3I4MG 5LMNW 1Q46A 4DR4Q 2L15A 4L5SA 2XTIA 4DV2Q 3M3YH 2WAQE 4LW1A 2EIFA 1TWGH 1WCMG 4BY1G 5C0XI 2NVQH 1QZGA 3PUXA 2A19A 1AE2A 3GTOH 5JJLA 1SLJA 1SN8A 1YHBA 2PMZE 1HR0W 1N36L 1E7ZA 4UP8A 1RL2A 4DNIA 2VW9A 2EQSA 2ID0A 3E9HA 4DV0L 1K3RA 3A74A 1N33L 3RZDH 1TWFH 2NVXH 3G6EA 3F1ZA 2Q2IA 3J7ZC 2JA6H 1NTGA 5C4XG 1E3PA 1U5KA 5LMUL 4ALPA 1X9NA 3H3VH 1VQ7A 4LF7L 1IBKQ 1QVFA 1KHIA 4PZ6A 2I5HA 1OXUA 1YHAA 3KJOA 1YI2A 1S72A 4IPCA 4PZ7A 2E5LQ 4BBSH 2UXCQ 1D7QA 4IFDI 2DUDA 3M7NA 5C44G 1K8AC 1EFWA 3BJUA 1QVGA 4LNQA 3STBC 3S15H 2UXDL 1YJNA 2CQOA 5FJ8H 2ZJPA 2VUMG 3PO3G 5IP9G 1IBML 2B29A 3F2CA 4GKKQ 4OO1G 3W1BA 4JI8L 1E1OA 3EIVA 4R4IA 3RZOH 2QEXA 1O7IA 4DK3C 2MNAA 1JJGA 1VQ9A 2I0QA 4JI0Q 1TWHH 4JV5Q 4DR3L 2KCMA 4NXML 4KHPQ 1SR3A 1MJCA 4AQYL 2Q2TA 2VNUD 4R1JA 2Y0SG 4GLVB 4A3IH 1VQHA 3OTOL 1XPUA 4BXXH 4LF9Q 3W5OA 4JI5Q 1I3QH 1OXVA 3AYHB 1S40A 4YWKA 3B6YA 3KDFB 1HZAA 3GTLH 1KXLA 1E1TA 1VQKA 4GOPC 2UXBQ 4A3LG 5AJ3Q 1A62A 4AYBG 2HIVA 4JBJA 1Q86C 4IJHA 2BA1A 4XTCS 1YEZA 1VQPA 2E2JH 2B63H 2H5XA 4GNXA 1TWAH 3UE1A 4A3GG 4P73A 4A75A 1Y1WG 4QJFA 3S24A 1CKMA 1PVOA 2Z0SA 4R4CA 1L1OC 2WAQG 4J15A 1HNZL 2JA7H 3CCVA 3AFPA 4QY7A 1YJWA 2IHEA 4TVAB 4DUYL 4YCVA 1Q1EA 5C4JH 3CCMA 3GTPH 3G48A 1Q7YC 4B3SQ 4LF6Q 1IBLL 4LUVA 2R7ZH 4GKJL 3I4NG 2N8NA 1WFQA 3F8TA 2RF4A 3PF4A 4LUOA 3K8AA 5IWAQ 5J3BA 5C0XJ 4WJ4A 4OX9Q 4AIMA 2VS1A 2K14A 3GTJH 1QZHA 4DAYB 3CCUA 4B3TQ 1N34Q 3A5ZB 2R92H 1HZ9A 1XMQQ 1IXRA 4OO1I 1P16A 2OQ0A 1PH8A 5GAHC 5JJKA 2VQFQ 4DR6L 3ICEA 3S1QH 1YJ9A 5GROA 4X65L 3CCSA 4DV6L 2IHFA 1I50H 1IL2A 4KI0A 4A3JG 4BBRG 4POFA 4X66Q 1EYGA 4MZ9A 1QVCA 2HQLA 3TQYA 4DR2Q 4LFCQ 3IRBA 4H02A 3TREA 1KRTA 4DPGA 1XPOA 4JI6Q 4DV3L 2HHHQ 2NZOA 3T1YQ 1X54A 1CKNB 3KOJA 4IFDJ 4A3CG 4LF5Q 1GO3E 1D8LA 1H95A 4LWCA 1AE3A 4DK6C 3I7FA 3BU2A 2UUAL 3G4SA 2MO1A 3FKIG 1N8RC 1VQGA 1Q12A 2E2IH 4QQBX 2AMCB 4FDBA 3GD7A 4X62L 1CUKA 2K52A 3JAMi 4DV1L 3L2PA 3S1RH 5M5YH 1OXTA 1PYSB 2ASBA 4YHHQ 3PUVA 3PUWA 4P75A 2PNHA 4HIOA 2Y0SE 2IX0A 3CCQA 4JI5L 3CC4A 4DR7L 2MFIA 4JG2A 1HNXQ 4JBKA 4YWLA 2D62A 1J5EL 3RLFA 1HNWQ 1FVIA 4GN3B 1V43A 4R4TA 3CXCA 2UUCL 2JE6I 5AJ3L 3J81c 5C4XH 1BVSA 4JOIA 1Q1BA 4A3KG 3W1GA 4A93G 3VDYA 1TXYA 4A3EG 5C3EH 4JI7Q 1C0AA 5JEAG 1KC8C 3I55A 3GTMH 3HOZH 3PIPA 4GNXC 4RG1A 3Q8DA 5M3MG 4IOCA 1N32Q 4ME3A 3AFQA 3RLNA 3M9BA 1CKOA 1E24A 1GVPA 5C44H 3HKSA 1EUJA 3HOWG 3PV0A 5IP7G 1LYLA 4NPSA 3H0GG 2VUMH 3PO3H 5BR8L 1HZCA 1UEBA 3J80i 4JYAL 3TS0A 1NE3A 5FLMG 1GKHA 2IY5B 2JA5G 2JA9A 3U50C 3T1HQ 1G51A 4POGA 4LF8Q 1XMOQ 1PHJA 1B8AA 1JJ2A 4UP7A 3HFZB 4B3MQ 4Y7NH 2YYZA
chains in the Genus database with same CATH superfamily
4C3IH 3QB3A 2E2IB 4B3TL 3RN2A 1PH4A 1PV4A 1N34L 1WCMB 4A3LH 3DM3A 4TRDA 4A3FG 2Z1CA 2J7ZA 3BYYB 5NUCA 1SROA 1DXMA 2RDHA 4WJ3M 3NE5B 4IN3A 1YBYA 1W3SA 3ERSX 5IYBG 3D31A 1VQIA 2DY7A 1YNXA 4R9WA 2ZJRA 2RSNA 1RIPA 1NR4A 2F0TA 1KIXA 3GTMB 1RD9D 2QA4A 3NPPA 1LUZA 1CSPA 3SHLA 2OCEA 2WFWA 4ZAIA 1IKLA 2EYFA 2VUMB 4QL5A 1LTID 2VXWA 3OPOA 4DR1Q 1LTGD 1WOCA 4IUPA 2F0JA 1W6JA 4APVA 4HIDA 1Q82C 1G8ZD 1X56A 2CWPA 2E2HB 1LABA 4RCOA 4K0KQ 1C48A 4A3JH 3EN2A 4BBRH 4HTHA 4C1NK 2OTJA 2EY6A 1YZ6A 3ULLA 4WFN3 1I6VC 5I9PA 1B3AA 2MUYA 2HIXA 2L9HA 4KLKA 3SE0A 4KHVA 2RBMA 2QILA 2A6HC 1IL8A 1EWIA 1GUNA 1QUQB 4N8X1 2R7FA 5FJ8G 1EY9A 2WAQB 1DYQA 1SYBA 3MEFA 1K8GA 4UPAA 3RR5A 3HOXB 1JWSD 4HJ5A 1IBKL 1DM0B 1KAWA 2CW0D 3TN2A 2OF1A 1A2TA 1VQFA 4LFBL 5EQ0A 2CQAA 3T16A 2UXCL 3NENA 4DV0Q 4DV7L 2MJ8A 4MTNA 1SJHD 4ZYSA 4AH6A 5CC4A 4K8JA 5LMNL 1TIID 2TSSA 3A8KE 1IHZA 1JT8A 1WCMH 1Z9FA 3CC7A 3TS2A 5FOBB 2B2UC 2ZXRA 3CAMA 1G291 1XX8A 1LTAD 4F88A 2YV5A 4HMJA 1TR5A 4IUQA 4OL7A 1CSQA 4U673 5IGBA 3JAML 5I6WA 5E7NA 2UXBL 2NZ1D 5CV4A 4KMUC 4YCWA 3FKIB 4LJZC 2EJFC 1VQ5A 4MHEA 3LGJA 4DR3Q 3H3VC 2QKIC 3MXGA 4WORA 1KD1C 1ICWA 5EKIA 2NVYB 3JAMc 1RCVD 1PFBA 4GS3A 3P20A 4A3MB 5IP9H 2K50A 4X64Q 3S2DH 3ND9A 1TT2A 2E2DC 2R93H 5HGTA 1HTPA 3PIOA 2WKDA 2A6EC 2E2HH 1HPCA 2I5MX 3R93A 4C3HH 1FL0A 4OIKA 3S17H 1WI5A 5C5LA 4DUYQ 1CT1D 4HIMA 3I73A 2VQFL 1PXUA 2D2CC 2O2LD 3X3MA 4RMFA 1L1OB 1I6HH 3NP8A 4GKJQ 1I4GA 5LHY1 3T56B 1F9PA 2FMMA 3KYHC 4UHVA 3I3CA 2B2WC 2JA5B 4X66L 1GUOA 1K83H 4DN4M 4DK0A 1JJCB 4JI2L 2JN4A 2ICEC 3L0OA 4NW2A 1IYUA 1L2FA 1AZQA 1FR3A 3TRZA 5G3LD 5G3LF 5C3EG 2C5CA 2F4IA 3K6OA 3P7JA 3HOZG 4IPDA 5IYDG 5I2XA 3BS1A 1A3VA 1MHWC 4QF4A 1A15A 2D9UA 1HZBA 1LT5D 3S1MH 1RTNA 2UUAQ 4KN7C 3U4VA 2NVTB 4PMCA 4K5WA 4EQNA 4RGTA 1M4VA 2CFMA 2HT1A 3CC2A 3WOEA 4C3IG 2JA6G 1BBWA 2A68C 2ZXPA 1J5EQ 5IIFA 5GQOA 2K04A 4A3CH 1FGUA 1HFNA 4CJ2C 3H6MA 4BBSG 4RA8A 5KIXA 4A3GB 1RTOA 4QIWB 1JE5A 2F3VA 3HOUH 4FXDA 1TWCH 3T1HL 1HA5A 1GUTA 1EZ6A 2OQKA 2VZAA 3TMEA 1D5XC 3A54A 4GNXB 2NVYH 2B2WA 4FF2A 1S5CD 1VQOA 4A3IG 4JBMA 4U68A 1TQOA 4DR5L 4A3KH 2EYJA 4P74A 1ZYRC 4C2MB 2VL6A 5M3MH 3MEHA 3DWPA 1LTLA 3K81C 2LSSA 4K14A 2AKWB 2EYHA 5IYCH 3CF5A 3DUZA 5CMDA 1E0BA 3QR8A 3CQZH 2GA4B 1A0IA 3F2BA 4KJNA 2UXDQ 2YU9B 1UEAB 3A0JA 4A76A 1ENAA 3NTHA 4DFAA 4ZLTF 2JA5H 4FNFA 2K5NA 1ESRA 4NB3A 2RCFA 4UP9A 2F4VL 2F0MA 5C4ZA 4DR1L 2Q2UA 2L4NA 3CPFA 3CW2C 2PZTA 1SMYD 4BA2I 1SE3A 1R9TB 1GUWA 2B2TC 4K0KL 4GOPA 4IZ8A 3K0XA 4DAMA 4HJ8A 3MC0B 3NQTA 3R8BA 1H9JA 2PQEA 3ONAB 3K58A 4F87A 3BYTB 1MKHA 3V2TA 4AYBE 2EYLA 3PQIA 3ULPA 1K73C 4JI1L 1WTHA 2X6LA 5K36H 1UWVA 2K28A 2M00A 2Z6BA 1Q46A 3I91A 4CDEC 3V96A 1F2MA 4RAUC 1TWGH 1WCMG 3DWQA 1GHKA 2XRQD 4IQZA 5EPKA 5JJLA 1SN8A 1B4OA 1V8QA 2PMZE 1D6EC 2VW9A 2EQSA 4OEMB 3S16B 4DV0L 1IKMA 3K5OA 4E6IA 2NVXH 3F1ZA 3J7ZC 1NTGA 5EBCA 4ALPA 3H3VH 3DM1A 5DAUA 1YHAA 3KJOA 1S72A 1F2ZA 4IPCA 4XXEA 2E5LQ 3DEOA 1TU2B 3BJUA 1QVGA 3STBC 3S15H 1YJNA 1K8OA 1PDQA 2ZJPA 2VUMG 5A35A 5IP9G 2F0PA 5CV7A 3EJIA 1O78A 3EIVA 2B2YC 1LT6D 3SVMA 5CGKA 1VQ9A 2I0QA 4DR3L 2VNUD 1EWCA 1OXVA 3AYHB 4YWKA 1KXLA 1HZAA 2NVQB 3SK6A 1E1TA 1IW7C 2KHSA 1VQPA 1TWAH 1SNPA 4A75A 1TWFB 2Z0SA 2HUGA 1EZ8A 1TKWB 2WAQG 1HNZL 1JR0D 2DN8A 3K57A 3AFPA 4LAAA 4QY7A 1Y8NB 1JWMD 2IHEA 4DUYL 4XDXA 1I4PA 1Q7YC 4B3SQ 1DJRD 1PTOB 5JJZA 4GKJL 2G9DA 3CRLC 2R7ZH 2N8NA 2Q8TA 3F8TA 2F0NA 4LUOA 5C0XJ 1PTOD 4I65A 4OGQC 4IFDH 4B3TQ 1N34Q 1P16A 1TWHB 3NTKA 4B9WA 4K6DA 3ICEA 3HG9A 3S1QH 4ZCKA 3CCSA 3EROA 2IHFA 4H0LC 1QB5D 3Q0AA 4FXKC 4R8NA 1E2VA 2KUMA 3MAQA 3IRBA 2B39A 3TSSA 4DAPA 1JOKA 3T1YQ 1X54A 4A3CG 1RHPA 3IL8A 1HFGA 1D8LA 1H95A 1SYEA 2H4OA 2KECA 2UUAL 3FKIG 1VQGA 2AMCB 3S1RH 3GD7A 2K52A 5FO7B 3JAMi 1CHPD 1WTVA 2K5QA 4NMZA 2ASBA 1B50A 3PUVA 4P75A 1HTLD 4HIOA 1D1IA 3CCQA 3CC4A 4JI5L 3ERQA 3DHQA 4JBKA 1FD7D 2D62A 1J5EL 1HNWQ 1FVIA 4GN3B 5A2QL 1V43A 4R4TA 5AJ3L 1MSGA 1TS5A 1BVSA 2MHVA 2F0HA 4PQXA 4O1NA 1I4RA 4A3KG 3VDYA 1TXYA 3VYRA 3NWTA 1B1ZA 3IFDA 1C0AA 2AUJD 1NUCA 1KC8C 4X6AH 4KTAA 3PIPA 5M3MG 4IOCA 5EPLA 3VR3A 1CKOA 1F9QA 1NCVA 3NSWA 4BY7B 5LL6X 5C6AA 1CQFA 2HQEA 1HZCA 1GUSA 2TMPA 2EDGA 5FLMG 4CHTB 2IY5B 2JA5G 4POGA 1STBA 1XMOQ 3I4MB 4UP7A 5KYIA 3HFZB 4G7HC 4Y7NH 4OX9L 1JE4A 4YCUA 3J7A5 4DXFA 3VYTA 1ILQA 3SDZA 5ISRA 4LFBQ 3K7AH 5E4WC 1PTOH 4DV7Q 2PI2A 1LO5D 2O4XA 2PQAB 5HURA 2KQ3A 4NXNQ 3J81j 5LMNQ 2WV6D 4JI0Q 5C4XB 2LY7A 2HHHL 5C3EB 3FDTA 3LNNA 4LF5L 2K05A 1K0SA 5ELDA 3CCJA 5AFWA 1P8LA 3CCLA 5EJWA 3R3OA 1PH3A 5J39A 4YHHL 2RHSB 3PSIA 3VYSA 3FP9A 2A8VA 1G91A 1D1KA 1HNXL 3CMAA 2IX3A 1A3UA 1XYIA 1QNUA 3GO5A 3CCRA 1I94Q 1FNVA 1NBWA 4XYQA 5C0XH 5FO8B 1J9OA 4JI7L 2P5ZX 2B8GA 4ZUIA 1PH9A 4ZKBB 4P72A 1LT4D 3MFYA 3I72A 4AYBB 2KCNA 1NR2A 1KDAA 1W2BA 4DAYA 4HIKA 2IT1A 4DK1A 5HGQA 3I2ZA 5ELNA 4JCVE 2K75A 2D0OA 5CBAE 2M9VA 3GV3A 4IUNA 4O42A 1KRSA 5H1SE 2JA8H 1H9MA 4B3ML 3VA7A 3PCOB 1L0XB 1EEFD 2F52A 2PMZB 3MZ5A 4BY7H 1CKNA 5E3FA 2NZHA 1VQJA 1STNA 4XT1B 2E5LL 1U0LA 1J6QA 4A3EH 1SE8A 5DLQE 4B3RL 2CKZB 4JI2Q 3S14H 4CBVA 3I4MH 1Y8OB 5M5WB 3CHBD 5LMUQ 5EAYA 2IWHA 4MIUA 1AFPA 5KGUA 2QF7A 4BY1H 2F0FA 4A3JB 4BBRB 3SXHA 1E22A 4UY8C 1B7YB 2G5DA 1EQQA 2QDBA 3OHXC 1HR0L 3MFGA 3JAME 5JEAJ 4UAIA 3UDFA 1WTXA 2Z6KA 5DM63 3E0JA 3GV6A 4NXMQ 3PO2H 3BDLA 2JEAI 3OTOQ 2F0VA 3MXNB 4QIWE 3M4PA 1C8CA 1KDCA 1PLFA 1CA6A 3W3AA 2NN6G 3MHBA 5HY6A 4B3SL 2F3WA 2JXMB 1OTCA 1WTRA 1X55A 1BCPB 1HRJA 1C9OA 1Q90A 1UE5A 1B53A 2AUKA 2DY8A 3HGBA 2RA4A 2MQHA 1EEID 4IUUA 1PH6A 2RQXA 2SNMA 1BCPD 4JVZA 1BCPF 1TY2A 5KYLA 4IALA 5IE8A 4KY7A 2YTYA 5EKLA 1X65A 4DR5Q 1IBLQ 1SNQA 1JMCA 1HCZA 4R4OA 1S3OA 3DWAA 4A3BH 1QWYA 4DV4L 3M4YA 4RFBA 4HSVA 3H91A 3T1YL 5CORA 3S2HH 4KN4C 4PG3A 5C3WA 1UE7A 1Y1VH 3QIAA 1TVXA 4DGZA 3FPUB 1YNJC 1CHQD 3NEMA 1XNQL 1SNMA 2L5TA 2F0QA 1PA6A 1AZPA 3W2DA 2F4VQ 1IYJB 3S2DB 2SOBA 4Z9CB 4ZKCB 1RODA 5LL6S 1HNWL 2R93B 4J6HA 4XQNA 5M5WH 4MN3A 1XJVA 2F0KA 5E1FA 4X62Q 1K9MC 1STYA 2L1BA 4H13C 1EYDA 1H9RA 4C3HB 2NTSA 5FO9B 3S17B 1M90C 3AU7A 4CJ1B 5EGTA 5D14A 3L9AX 1BBXC 1K28A 4DR7Q 1QUQA 4DF7A 1I6HB 1EIGA 4HJAA 2MP1A 4GLXA 1K83B 4L5TA 4JI1Q 4R8IA 2PW7A 1S5BD 2SDFA 1N9WA 2RDGA 1XMOL 4KK7A 5C5MA 1DOKA 1KLUD 2IJ0A 2CCZA 4CDDC 2X6GA 3FHWA 4HJ9A 2A74C 4PMBA 4F8MA 4RH6A 3V05A 3QO2A 1YIJA 4JYAQ 3SK8A 4A93H 1K8MA 5JEAH 3S1MB 3BDOA 4RWSC 2ZT9C 4NXNL 1ZKOA 2YTVA 3E9IA 3RUZA 3UDGA 3CU7A 1QNKA 1VMPA 4JI0L 3UDXA 3P75A 2EVBA 1NAPA 4DKAC 5C0XG 1WJJA 3CD6A 1I3QB 3RMHA 1UE1A 2X69A 4QMGA 4EQ5A 1DZ1A 4IPHA 2N49A 3SGIA 4IO9A 2NTTA 1OXSC 4ME5A 5IGCA 3OOCA 4BS9A 1XPRA 1SMXA 1VF7A 2F0WA 2EYOA 3T4AC 2BH2A 1Z6HA 2ZM6Q 1G6PA 1F9RA 3HOUB 3NQIA 4JBWA 1TWCB 1YHQA 1I94L 2Z9HA 4MNOA 4RGOS 2K4KA 5EBDA 3GP7A 3MVVA 2IL8A 2SEBD 2JSOA 1Q8KA 2JA8G 1O7ZA 2KBNA 2SNSA 3QWNA 2V1CC 3SR1A 3NXWA 3WWVA 3H15A 4BY7G 1JORA 4JK1C 4A3KB 1WTPA 1T9HA 2BOSA 2ATWA 3G71A 3Q6SA 1PYWD 3KF8B 3BVGA 5D65A 5M3MB 3ER0A 1L1OA 3N6RA 4LFAQ 3OMGA 5IY0A 1HNZQ 1GM5A 3I4MG 5COYA 5LMNW 3TBIB 2XTIA 3CQZB 1LTSD 3M3YH 5IGDA 3EFXD 1HXYD 2EIFA 4BY1G 3GTOH 2QEJC 5C4HA 1GOZA 1SNOA 1N36L 4UP8A 1RL2A 2ID0A 1D5ZC 4KY6A 3E9HA 1N33L 1K3RA 3A74A 2IW3A 2Q2IA 5C4XG 1E3PA 3TDQA 5LMUL 1NSNS 1VQ7A 2A6HD 1D7QA 2EYPA 2K5WA 1K8AC 3K5MA 1BXTA 4H7BA 4L8JA 2B29A 3F2CA 4OO1G 3W1BA 4JI8L 1E1OA 4G7OC 1STHA 4R4IA 4F7XA 5CV8A 4X3KA 4NXML 1VF5C 2M2LA 4AQYL 1TS4A 1XPUA 4GLVB 4OELB 1VQHA 3OTOL 4ZRZA 4B08A 4LF9Q 3N52A 4JI5Q 1I3QH 3KDFB 3TZUA 2NWGA 4UDUC 2MPMA 1TWGB 1VQKA 4GOPC 4A3LG 2QW7A 5AJ3Q 4AYBG 2R61A 4JBJA 1Q86C 3I4LA 4IJHA 2BA1A 2E2JH 1YEZA 2PYKA 2F0SA 2H5XA 4GNXA 3KLSA 3UE1A 1IYVA 4KD4A 1D5MC 1U4RA 2E74C 2NVXB 1PVOA 4J15A 5TSSA 3CCVA 5IGFA 4TVAB 5C4JH 3G7LA 1IBLL 3S15B 2AQ2B 3FPPA 5IWAQ 5J3BA 2EY1A 4OX9Q 3C46A 2K14A 3GTJH 2WACA 3A5ZB 2N88A 4OIJA 1PH8A 5JJKA 5GROA 1MSHA 4A3JG 2A6ED 4YIJA 4BBRG 4POFA 4MZ9A 1EOTA 4DR2Q 5F2DA 4H02A 4RKBA 2BE5C 3TREA 2JP1A 2HHHQ 3Q22A 1XWEA 2NZOA 4IFDJ 4LF5Q 1GO3E 1TWAB 1EY8A 1AE3A 3J81L 4DK6C 1PMRA 3BU2A 2MO1A 3IFTA 4X62L 4FDBA 3Q24A 3L2PA 1OXTA 1PYSB 3TP7A 2KJXA 3NWSA 5ELBA 4YHHQ 2PNHA 4DR7L 1HNXQ 4JG2A 5IGGA 4YWLA 1SAPA 2F0GA 2HCIA 5A2QE 2R7ZB 3J81c 1SE2A 2EY5A 4JOIA 1Q1BA 4A93G 4C3JB 2PO4A 3OSOA 1Y69U 4JI7Q 3TP8A 5JEAG 1I4XA 3QG1A 1S5FD 3AFQA 4V0BA 5C44H 1GVPA 3S1QB 1Z7TA 3PO3H 4JYAL 4WJWA 1NE3A 1B9NA 2XWBB 2V4DA 1GKHA 1U4LA 2JA9A 1G51A 4RKLA 1SYDA 4LF8Q 2A68D 2HDMA 4B3MQ 1EY4A 2E75C 3ZYYX 2K6AA 4PV1C 3F2DA 1HJPA 1DONA 1EQTA 2KEDA 3ULJA 3S1RB 2NB0A 5IOCA 2QGQA 3DEPA 1WYDA 4B3RQ 4O0AA 1QE6A 3FEWX 3PF5A 1NJIC 4EX5A 1W6KA 5M5XB 1Y1WH 1BKBA 4XIGS 3KF6B 4DUZQ 1X3GA 3RN5A 4CDFC 2R93G 2ZM6L 2B8FA 2A1AA 5JOBA 2BH8A 1ZYRD 4C3HG 4OWXB 1EY0A 3BDCA 1HR0Q 1SNCA 1A3TA 4IJLA 3T53B 1WTWA 1B70B 1X3PA 4DV5Q 3RNUA 3AEVA 1MIUA 2JEBI 1WTOA 1STGA 2Y0SB 4Y7NB 1VQ4A 4LFAL 1V1PB 3H94A 1EIFA 2Z4IA 2MO0A 4N9TA 2XNAC 3K7AB 3J7YW 2CWAA 3VA5A 2WINB 2K01A 2YTXA 2E8GA 1I4HA 2KHJA 4JI3Q 4EQOA 1PFMA 3RLOA 4C3JH 1PH7A 1PTOF 1OXXK 2N3SA 1CFMA 3A56A 4KKUA 2JQOA 4P2CB 1HQRD 1X3QA 3FRPB 1ICFB 1NMGA 3K0YA 3K80C 4JC0A 3HOYH 2K32A 3I4NB 2ALYB 1Z47A 4H44C 4DV4Q 4BA1I 3C1FA 3GTGH 3T51B 5FLXL 1K0RA 2EYMA 1SSOA 2OTLA 1FJGL 2K33A 4RHSA 3GTQH 1VQ8A 1LTTD 2CHBD 5DEHA 3RD4A 5ELCA 3HOWH 3HOUG 2XIWA 4CDCC 4V190 2PCFB 1XNQQ 1TS2A 2A5HA 2UU9L 1QG7A 1PRTC 4LF9L 1BDOA 1EYCA 1VQAA 5FLXc 3AB9A 1DGSA 5M5XH 2Z4HA 4FF3A 3J7AF 2N55A 4DA2A 4ZQ3A 1AH9A 4GN4B 3E6ZX 4A3FH 3STBD 3DLLA 2JA8B 4NP5A 1XTDA 1F9SA 5IYCG 4HN7A 2GVAA 1SYFA 1JCKB 3K7UC 4A3EB 3S14B 1PZJD 1GXDC 2AQ3B 3TEHB 5IWAL 1IW7D 5JVG3 4FXGC 2FHTA 3MTSA 2PQAA 4BY1B 3HKZG 4OONA 3VR6A 1PFSA 2E76C 3NBIA 4NKLA 1VQEA 5I4DA 2EXZA 4R4QA 5GAGC 1HQMC 4N9PA 3R2TA 4FVMA 4B9XA 4DR2L 1SBBB 2R7DA 3S1NH 1SRUA 2F3IA 3KUPA 2ENBA 3J80c 1DD2A 2DGYA 3CMEA 5D3DA 2F0LA 3PO2B 4HJ7A 2F0UA 2LS01 4X65Q 2XN9C 2L11A 3Q23A 4L5QA 1AN8A 4HEDA 5K36G 1CZGA 1X6OA 3I4NH 1NNXA 1BUVT 1PH1A 2B2VC 1KNEA 3KLSX 4RGMA 2AHOB 2F0EA 1SFOH 4Q5VA 3VR2A 5JPMC 2NN6I 1ASZA 1T5XD 1D2BA 3OIQA 1PH2A 2Z6KC 3KFUA 2UUBL 3HRZC 3K5NA 1VQLA 1ET9A 2WB1E 2RCNA 1JOOA 4EQPA 1WTQA 3L7ZC 2Q2HA 1EU3A 2UUCQ 2ZTEA 1HUNA 4PMWA 4P71A 1V1OA 1C4QA 4DNTB 2OXPA 1LT3D 2KENA 3CPWA 1EIHA 3EBEA 4A3BB 1CZWA 2XGTA 3ITPA 4LF8L 3M4OH 1HH2P 3S2HB 5IT9L 1CQVA 1Y1VB 5T1IA 3NELA 2RHQB 3I56A 1NY4A 1LLRD 1E2WA 1T5EA 2LFNA 3HKZE 3K59A 1N36Q 2LMCB 1Q81C 5EKKA 1N33Q 3HEJA 4EVOA 1MI2A 4CGYB 1WVLA 1KNAA 3KBXA 4L63B 4QB4A 5IT9c 4JI4L 4DUZL 2JJQA 4MTKA 3SEBA 1RF2D 2AWOA 3U58A 4LF4Q 3J7AV 2PNRC 2B2VA 1M8AA 3J81i 4G57A 4XYOA 1H9SB 4YY3L 1A63A 4JI8Q 1PH5A 3MXNA 1DOMA 5KRUA 2B63B 2R7ZG 1KTKA 3PGZA 3E0EA 4DV5L 3NHHA 4AQYQ 2C35B 4KJOA 1WD1A 3M7GA 3AQQA 4C3JG 1RJTA 3S9WA 2KCCA 4FYDA 4IFDG 4TQUS 4A3DH 1L0WA 2EXDA 3HOVH 1UE6A 5KNDA 3GTKH 1M1KC 1HA6A 1O80A 2EE1A 2XSCA 1MJEA 2CVRA 3HOYG 1QJOA 4A93B 1XNRL 2PW5A 2XWJB 4DU9A 1RKNA 3OIPA 1YITA 4QCLA 4Q0FA 2CW0C 4JI3L 3U4ZA 1MD2D 3NBHB 4JW0A 5IYDH 3WDNA 5I2YA 4DR4Q 3H09A 1BF4A 2BCOA 4DV2Q 1DCZA 2A69C 4LW1A 5C0XI 1QZGA 3HZXA 3PUXA 5C3XA 2A19A 1AE2A 1YHBA 3P1HA 1HR0W 1E7ZA 2NUCA 4DNIA 2G9HD 1LV9A 3RZDH 2JA6H 3NTIA 1YNNC 3CKIB 1KHIA 4PZ6A 2I5HA 1YI2A 2Z8LA 4BBSH 1EFWA 2PZUA 3OW7A 1AEXA 4BWGB 3A8JE 1IBML 2DNEA 3FMCA 4GKKQ 1CTMA 3RZOH 2QEXA 1O7IA 4DK3C 1JJGA 4JV5Q 4EGVA 2KCMA 4KHPQ 1SR3A 5FK9C 4R1JA 2Y0SG 4FF1A 4A3IH 4BXXH 3W5OA 3EQLC 1S40A 3M3YB 3B6YA 1B3QA 1TY0A 1ONLA 1A62A 4XT3B 2HIVA 1JB3A 3GTOB 1LTRD 4FO2A 2Q8RE 2B63H 4P73A 3S24A 1KDBA 1G2TA 1U9RA 4J1MA 1L1OC 3IAYA 2J0TD 2BDNA 2JA7H 1SXTA 2HCCA 4YCVA 2RSOA 3CCMA 3G48A 5CBEE 5M3FB 2MGSA 4ID6A 4LF6Q 2EZVA 2FMCA 4LUVA 3I4NG 3PF4A 1U4MA 3K8AA 1EY6A 1BR9A 3NK9A 2VS1A 4AIMA 4HSPA 1QZHA 1QCBD 1Y8PB 1HZ9A 2R92H 4OO1I 4PNYA 2OQ0A 3D3RA 1OO9B 2XVSA 5CV5A 4X65L 1I50H 1IL2A 4KI0A 5CV9A 3TZDA 3SK5A 4LFCQ 1XPOA 4JI6Q 4HR7B 1Q3LA 1ML0D 2E2JB 2A69D 5IGEA 3LWEA 3J81E 2E2IH 1Q12A 4X3SA 2EY2A 4C1NI 5KEEA 3KF8A 5C4JB 1BO0A 2IX0A 2NBFA 2Y0SE 2MFIA 2NYZD 3SK4A 3RLFA 4K5XA 1QILA 5CV6A 3A55A 1I4QA 1YNND 2JE6I 2UUCL 2PZWA 3PIO3 1FNWA 4CKEA 2WB1B 3W1GA 1YNJD 4K2KA 4A3EG 3GTJB 3QOLA 3GTMH 4GNXC 3Q8DA 3MXPA 4ME3A 5KNBA 3RLNA 3M9BA 1EY5A 3EA6A 1E24A 3HKSA 1JC7A 1EUJA 4J8QA 3PV0A 1ILPA 2VUMH 5J1ZA 3KLRA 3J80i 3U50C 4ILWA 3AMUA 4ULLA 3DXJC 3HKZB 3BVZA 4M1UB 1VQ6A 1IZ6A 3PO2G 1XMQL 4FF4A 1KQSA 3VYUA 5M3FH 4XQJA 2JYOA 4LF4L 4A3DG 3ND8A 1SMYC 3HOVG 3JC66 1XTCD 1STEA 1SYCA 1F77A 1FJGQ 1A8VA 3KDFA 4JPBW 4L6TB 2B2UA 1F2LA 3OWFA 3HOXH 2UU9Q 1KABA 1STAA 2L55A 5C44B 1VQNA 2D0PA 3LWUA 2N78A 2VQEQ 3PO3B 4LUZA 4CJ0B 2KHIA 5GAEC 2WP8J 1ZEQX 4JOIC 4C56C 4A3BG 3BVMA 4RGNA 4GZYC 1N32L 3CCEA 1SNDA 2AWNA 4DR4L 1V9PA 1Y1VG 4DV2L 1H9KA 1JICA 5I6YA 3I90A 1CI3M 4N8FA 1EL0A 3FKIH 1Y1WB 1AW7A 3HS0C 4KD3A 1EYAA 1SDFA 4L5RC 2FFKB 2WKCA 1PYBA 1BQQT 5BN3A 1MBYA 5D3IB 4A3MH 1VQMA 4BXXG 1EQRA 3DMUA 4YWMA 3A7LA 4ZK9B 3FVQA 2K5DA 4K6LA 1B9MA 1EQVA 4ABNA 5FLXE 3KBGA 2KOLA 3KLWA 3LX0A 4GKKL 3X3NA 4LF7Q 3M4QA 4HCEA 1VDZA 2B63G 3EVQA 1PZKD 4QUCA 2LKVA 3O13A 2K5HA 4JV5L 2L0CA 4KHPL 4O2DA 4IUVA 2R6GA 2JA7G 2PI2E 3CRKC 5FLMH 5DM73 2HDLA 2B3GA 4DXGA 2DJFC 4K8IA 4A4IA 1VQDA 2UUBQ 2L12A 3A5UA 3VR5A 4G7ZC 3QOJA 4RHRA 2R92G 1PTOC 1BOSA 1FGBD 1Y14B 4S3SA 3HOYB 3PMFA 1ET6A 2HD3A 4KKSA 1B44D 2ES2A 4LF6L 2K5VA 4GOPB 2NVTH 3GTGB 4IPGA 3UI2A 1SJED 2ZTDA 1BNZA 1X3EA 1CM9A 3GTQB 3QJYA 3J80E 3HOWB 1JB7A 5K5PA 3K5LA 3H0GB 1LTBD 1UAPA 3KF6A 3M85A 1CA5A 1TS3A 4KV6A 4OXPA 5KNCA 4A3GH 5I9OA 4LFCL 1DOLA 1YVCA 1VS0A 3GDEA 3OW2A 1U4PA 4JI4Q 4JI6L 3UDIA 3OMCA 5DNFA 3D0FA 4DR6Q 1KL9A 4PZ8A 1S4ZA 4X3TA 4A3FB 1II3A 4DV6Q 3D6WA 2LXJA 1ASYA 1ZXTA 2QDLA 2OWOA 4HCSA 4YY3Q 2JK8A 2F03A 4DV3Q 2EJGC 1V1PA 2K1BA 4KHZA 4C2MH 1AP0A 2GVBA 2AQ1B 1J8IA 3D4WA 1ESFA 1EOVA 4DV1Q 5JJIA 2B2TA 2BE5D 1XXGA 3D6CA 3BZDB 4GLAC 5IODA 1WD0A 2ZTCA 2YU9H 4TKOB 2ICIA 5M9OA 4RCNA 4LMQD 5EPJA 3ZJYC 1XNRQ 2VY3A 4Y52H 1VQBA 5CYUA 1EFID 2FXQA 5M3FG 4IOAA 1CK1A 5GADC 4X64L 3S1NB 3UE0A 4LK1C 1BBUA 2J4XA 2RVLA 3L3OC 1EIYB 2QCPX 1R9TH 5IT9E 4HMIA 4I7AA 1KAAA 3E5SA 2I5LX 4OWWB 5BR8Q 3PUZA 1KLGD 3BZCA 5JPNC 3HOXG 3D4RA 4QGUA 3TP6A 3HP3A 5JVH3 2ZJQA 3U9OA 1NMFA 5E4XA 2BA0A 1I5FA 4WRDA 1C7YA 1ENFA 1SFOB 1FNUA 1R4PB 2DNCA 2O5IC 1GD7A 3NUCA 1QOHA 3PUYA 5IP7H 1VCIA 3H0GH 5JAVA 2VB3X 1LM0A 2NN6H 2EJMA 1VQCA 5ELOA 3GTLB 2K7VA 1V1QA 3VR4A 3MXUA 3WOFA 1IBMQ 3H3VI 2VQEL 3S16H 2B2YA 1A6XA 3PIP3 3KJPA 1RDPD 4IUTA 4CKCA 2I07B 1R4QB 2WB1G 2IX1A 3M4OB 3I4OA 1G6ZA 1VMCA 3U9SA 3TP5A 1JOQA 1JWUD 3OYYA 4M8AA 1X32A 1GJXA 2KCTA 5CR3A 3GTPB 2LXKA 5IYBH 1X3FA 4I7ZC 2R3ZA 3BZKA 4GN5A 4A3MG 4ZUJA 2D5DA 1A2UA 4OWTB 3CP0A 1G2SA 2KA7A 2WIIB 3J80L 2GN5A 2KVMA 2L15A 4L5SA 2WAQE 2NVQH 3GQBA 1SLJA 1L0YB 1O7YA 2O5JC 2EPBA 2IPKD 1TWFH 3G6EA 2K03A 1U5KA 2FINB 1X9NA 4LF7L 1IBKQ 2F1MA 1QVFA 2BDOA 5M5YB 4A3DB 1OXUA 4PZ7A 3F2UA 3HOVB 2UXCQ 3GTKB 4IFDI 2DUDA 3M7NA 5C44G 3E3XA 3C3LA 4LNQA 2UXDL 2CQOA 5FJ8H 1K3BC 3PO3G 4XQQA 3I70A 2RKSA 1E2ZA 2MNAA 1SEBD 1TWHH 2F0DA 3HOZB 1MJCA 4DAVA 1SYGA 2Q2TA 1JQYD 2RDFA 4K5VA 3GTLH 3KK7A 1ENCA 2F0IA 2UXBQ 3IKJA 1Q8IA 1BCPC 2I46A 4TSSA 3A8IE 2DJGC 1PRTB 1EU4A 4XTCS 3I8ZA 1PRTD 4A3GG 1PRTF 3C1EA 3RZDB 1Y1WG 4QJFA 1CKMA 4C3IB 2JA6B 4R4CA 4X3UA 2KEEA 1HHVA 1PZID 1YJWA 1Q1EA 3GTPH 4BBSB 1GHJA 4G4KA 3R2IA 2OEOA 5ELFA 5BN4A 4HAEA 1WFQA 2FJ2A 2RF4A 4FP5D 4WJ4A 2VB2X 2OT2A 1UNSA 4DAYB 3CCUA 3A7AB 3RZOB 3D8GA 1XMQQ 1IXRA 3G6JB 4QUFA 5GAHC 1B2TA 4ODGA 1H9SA 1EY7A 2VQFQ 4DR6L 3URYA 1YJ9A 4A3IB 4DV6L 3D4DA 4NDXA 1PFNA 4X66Q 1EYGA 1QVCA 2HQLA 3TQYA 1F2YA 4DPGA 1KRTA 5L37A 3C2PA 4DV3L 2H1EA 1O7LA 3KOJA 1CKNB 5ELEA 1GUGA 4LWCA 1S5DD 2CH4W 3T13A 3I7FA 3MA2B 3G4SA 1N8RC 1FYCA 4QQBX 1CUKA 4KY5A 1SE4A 4DV1L 5M5YH 2ZXOA 2JA7B 3OWEB 3MWYW 3PUWA 4K2LA 3NBHA 1S5ED 2F0OA 3CXCA 1UUPA 5C4XH 1MGSA 2CH4A 2A73B 5C3EH 1HUMA 3I55A 3HOZH 4RG1A 2R92B 1N32Q 2EOTA 4DNRB 4IURA 3HOWG 5IP7G 1LYLA 1I50B 3BG3A 4NPSA 5FKAC 5T1GA 3H0GG 1EWHA 2XRSD 5BR8L 4KKTA 1UEBA 1LACA 2Q8IB 4OO1H 5BN5A 3TS0A 5J22A 4CKBA 4OHJA 2C9OA 3T1HQ 1PHJA 1B8AA 1JJ2A 2PPBC 2YYZA
chains in the Genus database with same CATH topology
4C3IH 4OX9L 3F2DA 1HJPA 4YCUA 4B3TL 3RN2A 1PH4A 1PV4A 3ULJA 1IZ6A 1N34L 1XMQL 1VQ6A 3PO2G 2QGQA 3DM3A 4A3LH 1KQSA 4A3FG 4LFBQ 5M3FH 3K7AH 4LF4L 4A3DG 1WYDA 4B3RQ 4O0AA 4DV7Q 3PF5A 1NJIC 3HOVG 2PI2A 4EX5A 1SROA 3JC66 2PQAB 4WJ3M 4NXNQ 1FJGQ 1YBYA 1W3SA 3ERSX 5IYBG 1Y1WH 3D31A 3J81j 1VQIA 1BKBA 4XIGS 1A8VA 3KF6B 5LMNQ 1YNXA 1X3GA 4DUZQ 3RN5A 2HHHL 2ZJRA 3KDFA 2R93G 1RIPA 4LF5L 1KIXA 2ZM6L 2QA4A 2A1AA 3HOXH 1LUZA 2BH8A 2UU9Q 1CSPA 3CCJA 1VQNA 2D0PA 4OWXB 2OCEA 2N78A 1P8LA 2WFWA 1HR0Q 3CCLA 2VQEQ 1PH3A 4IJLA 4YHHL 2RHSB 4QL5A 3PSIA 4LUZA 3FP9A 2A8VA 4DR1Q 1HNXL 1B70B 1WOCA 3CMAA 2KHIA 5GAEC 3GO5A 4APVA 4DV5Q 4HIDA 3RNUA 1MIUA 2WP8J 1Q82C 3CCRA 3AEVA 2JEBI 1I94Q 1NBWA 1X56A 2CWPA 4JOIC 1VQ4A 4A3BG 4LFAL 4JI7L 4K0KQ 4A3JH 3EN2A 4BBRH 1PH9A 2OTJA 1N32L 4P72A 1EIFA 3CCEA 2MO0A 1YZ6A 3ULLA 2AWNA 4DR4L 1V9PA 1Y1VG 4DV2L 1W2BA 4HIKA 2CWAA 2IT1A 4X6AH 2HIXA 2YTXA 2E8GA 4KLKA 5HGQA 2KHJA 3I2ZA 4JI3Q 5ELNA 3FKIH 4JCVE 2K75A 2D0OA 3RLOA 4C3JH 1PH7A 1EWIA 1OXXK 1QUQB 5FJ8G 2R7FA 1KRSA 2N3SA 3MEFA 5H1SE 2JA8H 4L5RC 1K8GA 4B3ML 2JQOA 4UPAA 3PCOB 3RR5A 1PYBA 2F52A 1NMGA 4HJ5A 1IBKL 1CKNA 1KAWA 3K80C 4JC0A 4BY7H 2NZHA 3HOYH 1VQJA 4A3MH 2ALYB 1VQMA 4BXXG 1EQRA 1Z47A 1U0LA 1VQFA 4YWMA 2E5LL 3J7A5 4LFBL 2UXCL 1J6QA 4A3EH 1SE8A 5DLQE 4B3RL 4DV4Q 3NENA 4BA1I 2CKZB 4JI2Q 4DV0Q 4DV7L 3GTGH 4MTNA 3S14H 1K0RA 2OTLA 4AH6A 3I4MH 1FJGL 5LMUQ 5EAYA 3KLWA 5LMNL 4GKKL 4LF7Q 1VQ8A 3GTQH 3M4QA 2B63G 3HOWH 1JT8A 3HOUG 4BY1H 1WCMH 2K5HA 1Z9FA 3CC7A 3TS2A 4JV5L 4KHPL 4O2DA 1XNQQ 3CAMA 1G291 2UU9L 2YV5A 1E22A 2R6GA 2JA7G 4UY8C 2PI2E 1B7YB 5FLMH 4LF9L 1EQQA 1CSQA 5FLXc 1VQAA 1HR0L 2B3GA 5JEAJ 1DGSA 5M5XH 5E7NA 2UXBL 4A4IA 3UDFA 4YCWA 2Z6KA 1VQDA 1VQ5A 3LGJA 4DR3Q 2UUBQ 4NXMQ 3PO2H 3A5UA 1AH9A 4GN4B 4A3FH 3STBD 3DLLA 3OTOQ 2JEAI 3MXNB 4QIWE 1KD1C 1XTDA 2R92G 3M4PA 5IYCG 3JAMc 1Y14B 2GVAA 4GS3A 5IP9H 3K7UC 2K50A 4X64Q 2NN6G 3S2DH 4B3SL 5HY6A 1OTCA 2ES2A 2R93H 4LF6L 2K5VA 4GOPB 2NVTH 1X55A 4IPGA 3PIOA 1C9OA 2E2HH 1UE5A 2ZTDA 1X3EA 3TEHB 5IWAL 2I5MX 2MQHA 4C3HH 1PH6A 1FL0A 3S17H 1WI5A 1JB7A 4DUYQ 2PQAA 3HKZG 4OONA 5IE8A 1PFSA 4HIMA 2VQFL 2YTYA 4RMFA 1L1OB 3KF6A 1X65A 1I6HH 3M85A 4DR5Q 1IBLQ 4GKJQ 1VQEA 3KYHC 4OXPA 4R4QA 5GAGC 1JMCA 4R4OA 4X66L 1S3OA 1K83H 4DR2L 4LFCL 1YVCA 3GDEA 1VS0A 2R7DA 1SRUA 3OW2A 2F3IA 3S1NH 4A3BH 4JI4Q 1JJCB 3J80c 4DV4L 4JI6L 4JI2L 3UDIA 2DGYA 3CMEA 3T1YL 3D0FA 3L0OA 4DR6Q 4HJ7A 1KL9A 1L2FA 4PZ8A 3S2HH 4X65Q 3TRZA 4PG3A 4DV6Q 2LXJA 1UE7A 5C3EG 1ASYA 1Y1VH 4L5QA 3HOZG 4IPDA 5K36G 5IYDG 1X6OA 2OWOA 3I4NH 3NEMA 1XNQL 4YY3Q 1PA6A 2JK8A 1PH1A 4DV3Q 2F4VQ 1IYJB 2AHOB 1HZBA 4KHZA 4C2MH 3S1MH 1HNWL 1SFOH 1ASZA 2UUAQ 2GVBA 2NN6I 3U4VA 5M5WH 1XJVA 1PH2A 4X62Q 1K9MC 1EOVA 4DV1Q 2Z6KC 2CFMA 3KFUA 5JJIA 2UUBL 2HT1A 3CC2A 1M90C 1VQLA 2JA6G 2WB1E 4GLAC 1BBWA 2RCNA 4DR7Q 2ZTCA 2YU9H 1J5EQ 1QUQA 3L7ZC 2Q2HA 3ZJYC 2UUCQ 5GQOA 2ZTEA 1XNRQ 4A3CH 1FGUA 4HJAA 2VY3A 4PMWA 1VQBA 4P71A 5M3FG 2FXQA 4BBSG 4GLXA 4IOAA 4Y52H 5GADC 2KENA 4L5TA 4JI1Q 4X64L 3CPWA 3UE0A 1JE5A 3EBEA 1BBUA 1N9WA 3HOUH 1TWCH 3T1HL 2XGTA 1EIYB 4LF8L 1XMOL 3M4OH 1R9TH 1HH2P 2CCZA 2OQKA 2VZAA 4A3GH 3NELA 2RHQB 3I56A 2I5LX 3FHWA 4GNXB 4HJ9A 2NVYH 5BR8Q 4OWWB 3PUZA 1YIJA 3BZCA 3HOXG 1VQOA 1NY4A 4JYAQ 4QGUA 3HKZE 4A3IG 4JBMA 4DR5L 1N36Q 4A3KH 2ZJQA 4A93H 1NMFA 1Q81C 1N33Q 4P74A 2BA0A 1I5FA 1C7YA 2VL6A 5M3MH 4NXNL 2YTVA 1LTLA 3E9IA 3K81C 3UDGA 5IT9c 4JI0L 4JI4L 3UDXA 2LSSA 1GD7A 2AKWB 4DUZL 5IYCH 3CF5A 2JJQA 3PUYA 5IP7H 4DKAC 1VCIA 3H0GH 5C0XG 2AWOA 3CQZH 1LM0A 3U58A 1A0IA 4LF4Q 1WJJA 3F2BA 3CD6A 1UE1A 1VQCA 5ELOA 4EQ5A 2UXDQ 3A0JA 4A76A 3J81i 4IPHA 2N49A 3SGIA 1V1QA 2JA5H 4IO9A 1IBMQ 2K5NA 1OXSC 3H3VI 4NB3A 2VQEL 4YY3L 1A63A 4JI8Q 4UP9A 1PH5A 1XPRA 2F4VL 3S16H 1SMXA 2BH2A 4DR1L 2R7ZG 3PGZA 2ZM6Q 2Q2UA 1G6PA 3E0EA 4DV5L 3KJPA 4AQYQ 3CPFA 4JBWA 2C35B 1YHQA 3CW2C 2WB1G 1I94L 2IX1A 4BA2I 3AQQA 4MNOA 3I4OA 2K4KA 4IFDG 4TQUS 4A3DH 3OYYA 4K0KL 4GOPA 1L0WA 2EXDA 1Q8KA 2JA8G 3HOVH 1UE6A 2KCTA 3GTKH 3K0XA 4DAMA 4HJ8A 1M1KC 2KBNA 3WWVA 2LXKA 2V1CC 5IYBH 3H15A 1MJEA 4BY7G 1X3FA 3HOYG 4GN5A 3BZKA 2ATWA 1T9HA 4A3MG 1XNRL 3G71A 1MKHA 4AYBE 1YITA 4OWTB 3CP0A 3KF8B 4JI3L 3ULPA 1K73C 3ER0A 1L1OA 4LFAQ 4JI1L 3U4ZA 3NBHB 5IY0A 1HNZQ 1GM5A 1UWVA 2GN5A 5IYDH 3I4MG 5LMNW 1Q46A 4DR4Q 2L15A 4L5SA 2XTIA 4DV2Q 3M3YH 2WAQE 4LW1A 2EIFA 1TWGH 1WCMG 4BY1G 5C0XI 2NVQH 1QZGA 3PUXA 2A19A 1AE2A 3GTOH 5JJLA 1SLJA 1SN8A 1YHBA 2PMZE 1HR0W 1N36L 1E7ZA 4UP8A 1RL2A 4DNIA 2VW9A 2EQSA 2ID0A 3E9HA 4DV0L 1K3RA 3A74A 1N33L 3RZDH 1TWFH 2NVXH 3G6EA 3F1ZA 2Q2IA 3J7ZC 2JA6H 1NTGA 5C4XG 1E3PA 1U5KA 5LMUL 4ALPA 1X9NA 3H3VH 1VQ7A 4LF7L 1IBKQ 1QVFA 1KHIA 4PZ6A 2I5HA 1OXUA 1YHAA 3KJOA 1YI2A 1S72A 4IPCA 4PZ7A 2E5LQ 4BBSH 2UXCQ 1D7QA 4IFDI 2DUDA 3M7NA 5C44G 1K8AC 1EFWA 3BJUA 1QVGA 4LNQA 3STBC 3S15H 2UXDL 1YJNA 2CQOA 5FJ8H 2ZJPA 2VUMG 3PO3G 5IP9G 1IBML 2B29A 3F2CA 4GKKQ 4OO1G 3W1BA 4JI8L 1E1OA 3EIVA 4R4IA 3RZOH 2QEXA 1O7IA 4DK3C 2MNAA 1JJGA 1VQ9A 2I0QA 4JI0Q 1TWHH 4JV5Q 4DR3L 2KCMA 4NXML 4KHPQ 1SR3A 1MJCA 4AQYL 2Q2TA 2VNUD 4R1JA 2Y0SG 4GLVB 4A3IH 1VQHA 3OTOL 1XPUA 4BXXH 4LF9Q 3W5OA 4JI5Q 1I3QH 1OXVA 3AYHB 1S40A 4YWKA 3B6YA 3KDFB 1HZAA 3GTLH 1KXLA 1E1TA 1VQKA 4GOPC 2UXBQ 4A3LG 5AJ3Q 1A62A 4AYBG 2HIVA 4JBJA 1Q86C 4IJHA 2BA1A 4XTCS 1YEZA 1VQPA 2E2JH 2B63H 2H5XA 4GNXA 1TWAH 3UE1A 4A3GG 4P73A 4A75A 1Y1WG 4QJFA 3S24A 1CKMA 1PVOA 2Z0SA 4R4CA 1L1OC 2WAQG 4J15A 1HNZL 2JA7H 3CCVA 3AFPA 4QY7A 1YJWA 2IHEA 4TVAB 4DUYL 4YCVA 1Q1EA 5C4JH 3CCMA 3GTPH 3G48A 1Q7YC 4B3SQ 4LF6Q 1IBLL 4LUVA 2R7ZH 4GKJL 3I4NG 2N8NA 1WFQA 3F8TA 2RF4A 3PF4A 4LUOA 3K8AA 5IWAQ 5J3BA 5C0XJ 4WJ4A 4OX9Q 4AIMA 2VS1A 2K14A 3GTJH 1QZHA 4DAYB 3CCUA 4B3TQ 1N34Q 3A5ZB 2R92H 1HZ9A 1XMQQ 1IXRA 4OO1I 1P16A 2OQ0A 1PH8A 5GAHC 5JJKA 2VQFQ 4DR6L 3ICEA 3S1QH 1YJ9A 5GROA 4X65L 3CCSA 4DV6L 2IHFA 1I50H 1IL2A 4KI0A 4A3JG 4BBRG 4POFA 4X66Q 1EYGA 4MZ9A 1QVCA 2HQLA 3TQYA 4DR2Q 4LFCQ 3IRBA 4H02A 3TREA 1KRTA 4DPGA 1XPOA 4JI6Q 4DV3L 2HHHQ 2NZOA 3T1YQ 1X54A 1CKNB 3KOJA 4IFDJ 4A3CG 4LF5Q 1GO3E 1D8LA 1H95A 4LWCA 1AE3A 4DK6C 3I7FA 3BU2A 2UUAL 3G4SA 2MO1A 3FKIG 1N8RC 1VQGA 1Q12A 2E2IH 4QQBX 2AMCB 4FDBA 3GD7A 4X62L 1CUKA 2K52A 3JAMi 4DV1L 3L2PA 3S1RH 5M5YH 1OXTA 1PYSB 2ASBA 4YHHQ 3PUVA 3PUWA 4P75A 2PNHA 4HIOA 2Y0SE 2IX0A 3CCQA 4JI5L 3CC4A 4DR7L 2MFIA 4JG2A 1HNXQ 4JBKA 4YWLA 2D62A 1J5EL 3RLFA 1HNWQ 1FVIA 4GN3B 1V43A 4R4TA 3CXCA 2UUCL 2JE6I 5AJ3L 3J81c 5C4XH 1BVSA 4JOIA 1Q1BA 4A3KG 3W1GA 4A93G 3VDYA 1TXYA 4A3EG 5C3EH 4JI7Q 1C0AA 5JEAG 1KC8C 3I55A 3GTMH 3HOZH 3PIPA 4GNXC 4RG1A 3Q8DA 5M3MG 4IOCA 1N32Q 4ME3A 3AFQA 3RLNA 3M9BA 1CKOA 1E24A 1GVPA 5C44H 3HKSA 1EUJA 3HOWG 3PV0A 5IP7G 1LYLA 4NPSA 3H0GG 2VUMH 3PO3H 5BR8L 1HZCA 1UEBA 3J80i 4JYAL 3TS0A 1NE3A 5FLMG 1GKHA 2IY5B 2JA5G 2JA9A 3U50C 3T1HQ 1G51A 4POGA 4LF8Q 1XMOQ 1PHJA 1B8AA 1JJ2A 4UP7A 3HFZB 4B3MQ 4Y7NH 2YYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I H;  4OX9 L;  3F2D A;  1HJP A;  4YCU A;  4B3T L;  3RN2 A;  1PH4 A;  1PV4 A;  3ULJ A;  1IZ6 A;  1N34 L;  1XMQ L;  1VQ6 A;  3PO2 G;  2QGQ A;  3DM3 A;  4A3L H;  1KQS A;  4A3F G;  4LFB Q;  5M3F H;  3K7A H;  4LF4 L;  4A3D G;  1WYD A;  4B3R Q;  4O0A A;  4DV7 Q;  3PF5 A;  1NJI C;  3HOV G;  2PI2 A;  4EX5 A;  1SRO A;  3JC6 6;  2PQA B;  4WJ3 M;  4NXN Q;  1FJG Q;  1YBY A;  1W3S A;  3ERS X;  5IYB G;  1Y1W H;  3D31 A;  3J81 j;  1VQI A;  1BKB A;  4XIG S;  1A8V A;  3KF6 B;  5LMN Q;  1YNX A;  1X3G A;  4DUZ Q;  3RN5 A;  2HHH L;  2ZJR A;  3KDF A;  2R93 G;  1RIP A;  4LF5 L;  1KIX A;  2ZM6 L;  2QA4 A;  2A1A A;  3HOX H;  1LUZ A;  2BH8 A;  2UU9 Q;  1CSP A;  3CCJ A;  1VQN A;  2D0P A;  4OWX B;  2OCE A;  2N78 A;  1P8L A;  2WFW A;  1HR0 Q;  3CCL A;  2VQE Q;  1PH3 A;  4IJL A;  4YHH L;  2RHS B;  4QL5 A;  3PSI A;  4LUZ A;  3FP9 A;  2A8V A;  4DR1 Q;  1HNX L;  1B70 B;  1WOC A;  3CMA A;  2KHI A;  5GAE C;  3GO5 A;  4APV A;  4DV5 Q;  4HID A;  3RNU A;  1MIU A;  2WP8 J;  1Q82 C;  3CCR A;  3AEV A;  2JEB I;  1I94 Q;  1NBW A;  1X56 A;  2CWP A;  4JOI C;  1VQ4 A;  4A3B G;  4LFA L;  4JI7 L;  4K0K Q;  4A3J H;  3EN2 A;  4BBR H;  1PH9 A;  2OTJ A;  1N32 L;  4P72 A;  1EIF A;  3CCE A;  2MO0 A;  1YZ6 A;  3ULL A;  2AWN A;  4DR4 L;  1V9P A;  1Y1V G;  4DV2 L;  1W2B A;  4HIK A;  2CWA A;  2IT1 A;  4X6A H;  2HIX A;  2YTX A;  2E8G A;  4KLK A;  5HGQ A;  2KHJ A;  3I2Z A;  4JI3 Q;  5ELN A;  3FKI H;  4JCV E;  2K75 A;  2D0O A;  3RLO A;  4C3J H;  1PH7 A;  1EWI A;  1OXX K;  1QUQ B;  5FJ8 G;  2R7F A;  1KRS A;  2N3S A;  3MEF A;  5H1S E;  2JA8 H;  4L5R C;  1K8G A;  4B3M L;  2JQO A;  4UPA A;  3PCO B;  3RR5 A;  1PYB A;  2F52 A;  1NMG A;  4HJ5 A;  1IBK L;  1CKN A;  1KAW A;  3K80 C;  4JC0 A;  4BY7 H;  2NZH A;  3HOY H;  1VQJ A;  4A3M H;  2ALY B;  1VQM A;  4BXX G;  1EQR A;  1Z47 A;  1U0L A;  1VQF A;  4YWM A;  2E5L L;  3J7A 5;  4LFB L;  2UXC L;  1J6Q A;  4A3E H;  1SE8 A;  5DLQ E;  4B3R L;  4DV4 Q;  3NEN A;  4BA1 I;  2CKZ B;  4JI2 Q;  4DV0 Q;  4DV7 L;  3GTG H;  4MTN A;  3S14 H;  1K0R A;  2OTL A;  4AH6 A;  3I4M H;  1FJG L;  5LMU Q;  5EAY A;  3KLW A;  5LMN L;  4GKK L;  4LF7 Q;  1VQ8 A;  3GTQ H;  3M4Q A;  2B63 G;  3HOW H;  1JT8 A;  3HOU G;  4BY1 H;  1WCM H;  2K5H A;  1Z9F A;  3CC7 A;  3TS2 A;  4JV5 L;  4KHP L;  4O2D A;  1XNQ Q;  3CAM A;  1G29 1;  2UU9 L;  2YV5 A;  1E22 A;  2R6G A;  2JA7 G;  4UY8 C;  2PI2 E;  1B7Y B;  5FLM H;  4LF9 L;  1EQQ A;  1CSQ A;  5FLX c;  1VQA A;  1HR0 L;  2B3G A;  5JEA J;  1DGS A;  5M5X H;  5E7N A;  2UXB L;  4A4I A;  3UDF A;  4YCW A;  2Z6K A;  1VQD A;  1VQ5 A;  3LGJ A;  4DR3 Q;  2UUB Q;  4NXM Q;  3PO2 H;  3A5U A;  1AH9 A;  4GN4 B;  4A3F H;  3STB D;  3DLL A;  3OTO Q;  2JEA I;  3MXN B;  4QIW E;  1KD1 C;  1XTD A;  2R92 G;  3M4P A;  5IYC G;  3JAM c;  1Y14 B;  2GVA A;  4GS3 A;  5IP9 H;  3K7U C;  2K50 A;  4X64 Q;  2NN6 G;  3S2D H;  4B3S L;  5HY6 A;  1OTC A;  2ES2 A;  2R93 H;  4LF6 L;  2K5V A;  4GOP B;  2NVT H;  1X55 A;  4IPG A;  3PIO A;  1C9O A;  2E2H H;  1UE5 A;  2ZTD A;  1X3E A;  3TEH B;  5IWA L;  2I5M X;  2MQH A;  4C3H H;  1PH6 A;  1FL0 A;  3S17 H;  1WI5 A;  1JB7 A;  4DUY Q;  2PQA A;  3HKZ G;  4OON A;  5IE8 A;  1PFS A;  4HIM A;  2VQF L;  2YTY A;  4RMF A;  1L1O B;  3KF6 A;  1X65 A;  1I6H H;  3M85 A;  4DR5 Q;  1IBL Q;  4GKJ Q;  1VQE A;  3KYH C;  4OXP A;  4R4Q A;  5GAG C;  1JMC A;  4R4O A;  4X66 L;  1S3O A;  1K83 H;  4DR2 L;  4LFC L;  1YVC A;  3GDE A;  1VS0 A;  2R7D A;  1SRU A;  3OW2 A;  2F3I A;  3S1N H;  4A3B H;  4JI4 Q;  1JJC B;  3J80 c;  4DV4 L;  4JI6 L;  4JI2 L;  3UDI A;  2DGY A;  3CME A;  3T1Y L;  3D0F A;  3L0O A;  4DR6 Q;  4HJ7 A;  1KL9 A;  1L2F A;  4PZ8 A;  3S2H H;  4X65 Q;  3TRZ A;  4PG3 A;  4DV6 Q;  2LXJ A;  1UE7 A;  5C3E G;  1ASY A;  1Y1V H;  4L5Q A;  3HOZ G;  4IPD A;  5K36 G;  5IYD G;  1X6O A;  2OWO A;  3I4N H;  3NEM A;  1XNQ L;  4YY3 Q;  1PA6 A;  2JK8 A;  1PH1 A;  4DV3 Q;  2F4V Q;  1IYJ B;  2AHO B;  1HZB A;  4KHZ A;  4C2M H;  3S1M H;  1HNW L;  1SFO H;  1ASZ A;  2UUA Q;  2GVB A;  2NN6 I;  3U4V A;  5M5W H;  1XJV A;  1PH2 A;  4X62 Q;  1K9M C;  1EOV A;  4DV1 Q;  2Z6K C;  2CFM A;  3KFU A;  5JJI A;  2UUB L;  2HT1 A;  3CC2 A;  1M90 C;  1VQL A;  2JA6 G;  2WB1 E;  4GLA C;  1BBW A;  2RCN A;  4DR7 Q;  2ZTC A;  2YU9 H;  1J5E Q;  1QUQ A;  3L7Z C;  2Q2H A;  3ZJY C;  2UUC Q;  5GQO A;  2ZTE A;  1XNR Q;  4A3C H;  1FGU A;  4HJA A;  2VY3 A;  4PMW A;  1VQB A;  4P71 A;  5M3F G;  2FXQ A;  4BBS G;  4GLX A;  4IOA A;  4Y52 H;  5GAD C;  2KEN A;  4L5T A;  4JI1 Q;  4X64 L;  3CPW A;  3UE0 A;  1JE5 A;  3EBE A;  1BBU A;  1N9W A;  3HOU H;  1TWC H;  3T1H L;  2XGT A;  1EIY B;  4LF8 L;  1XMO L;  3M4O H;  1R9T H;  1HH2 P;  2CCZ A;  2OQK A;  2VZA A;  4A3G H;  3NEL A;  2RHQ B;  3I56 A;  2I5L X;  3FHW A;  4GNX B;  4HJ9 A;  2NVY H;  5BR8 Q;  4OWW B;  3PUZ A;  1YIJ A;  3BZC A;  3HOX G;  1VQO A;  1NY4 A;  4JYA Q;  4QGU A;  3HKZ E;  4A3I G;  4JBM A;  4DR5 L;  1N36 Q;  4A3K H;  2ZJQ A;  4A93 H;  1NMF A;  1Q81 C;  1N33 Q;  4P74 A;  2BA0 A;  1I5F A;  1C7Y A;  2VL6 A;  5M3M H;  4NXN L;  2YTV A;  1LTL A;  3E9I A;  3K81 C;  3UDG A;  5IT9 c;  4JI0 L;  4JI4 L;  3UDX A;  2LSS A;  1GD7 A;  2AKW B;  4DUZ L;  5IYC H;  3CF5 A;  2JJQ A;  3PUY A;  5IP7 H;  4DKA C;  1VCI A;  3H0G H;  5C0X G;  2AWO A;  3CQZ H;  1LM0 A;  3U58 A;  1A0I A;  4LF4 Q;  1WJJ A;  3F2B A;  3CD6 A;  1UE1 A;  1VQC A;  5ELO A;  4EQ5 A;  2UXD Q;  3A0J A;  4A76 A;  3J81 i;  4IPH A;  2N49 A;  3SGI A;  1V1Q A;  2JA5 H;  4IO9 A;  1IBM Q;  2K5N A;  1OXS C;  3H3V I;  4NB3 A;  2VQE L;  4YY3 L;  1A63 A;  4JI8 Q;  4UP9 A;  1PH5 A;  1XPR A;  2F4V L;  3S16 H;  1SMX A;  2BH2 A;  4DR1 L;  2R7Z G;  3PGZ A;  2ZM6 Q;  2Q2U A;  1G6P A;  3E0E A;  4DV5 L;  3KJP A;  4AQY Q;  3CPF A;  4JBW A;  2C35 B;  1YHQ A;  3CW2 C;  2WB1 G;  1I94 L;  2IX1 A;  4BA2 I;  3AQQ A;  4MNO A;  3I4O A;  2K4K A;  4IFD G;  4TQU S;  4A3D H;  3OYY A;  4K0K L;  4GOP A;  1L0W A;  2EXD A;  1Q8K A;  2JA8 G;  3HOV H;  1UE6 A;  2KCT A;  3GTK H;  3K0X A;  4DAM A;  4HJ8 A;  1M1K C;  2KBN A;  3WWV A;  2LXK A;  2V1C C;  5IYB H;  3H15 A;  1MJE A;  4BY7 G;  1X3F A;  3HOY G;  4GN5 A;  3BZK A;  2ATW A;  1T9H A;  4A3M G;  1XNR L;  3G71 A;  1MKH A;  4AYB E;  1YIT A;  4OWT B;  3CP0 A;  3KF8 B;  4JI3 L;  3ULP A;  1K73 C;  3ER0 A;  1L1O A;  4LFA Q;  4JI1 L;  3U4Z A;  3NBH B;  5IY0 A;  1HNZ Q;  1GM5 A;  1UWV A;  2GN5 A;  5IYD H;  3I4M G;  5LMN W;  1Q46 A;  4DR4 Q;  2L15 A;  4L5S A;  2XTI A;  4DV2 Q;  3M3Y H;  2WAQ E;  4LW1 A;  2EIF A;  1TWG H;  1WCM G;  4BY1 G;  5C0X I;  2NVQ H;  1QZG A;  3PUX A;  2A19 A;  1AE2 A;  3GTO H;  5JJL A;  1SLJ A;  1SN8 A;  1YHB A;  2PMZ E;  1HR0 W;  1N36 L;  1E7Z A;  4UP8 A;  1RL2 A;  4DNI A;  2VW9 A;  2EQS A;  2ID0 A;  3E9H A;  4DV0 L;  1K3R A;  3A74 A;  1N33 L;  3RZD H;  1TWF H;  2NVX H;  3G6E A;  3F1Z A;  2Q2I A;  3J7Z C;  2JA6 H;  1NTG A;  5C4X G;  1E3P A;  1U5K A;  5LMU L;  4ALP A;  1X9N A;  3H3V H;  1VQ7 A;  4LF7 L;  1IBK Q;  1QVF A;  1KHI A;  4PZ6 A;  2I5H A;  1OXU A;  1YHA A;  3KJO A;  1YI2 A;  1S72 A;  4IPC A;  4PZ7 A;  2E5L Q;  4BBS H;  2UXC Q;  1D7Q A;  4IFD I;  2DUD A;  3M7N A;  5C44 G;  1K8A C;  1EFW A;  3BJU A;  1QVG A;  4LNQ A;  3STB C;  3S15 H;  2UXD L;  1YJN A;  2CQO A;  5FJ8 H;  2ZJP A;  2VUM G;  3PO3 G;  5IP9 G;  1IBM L;  2B29 A;  3F2C A;  4GKK Q;  4OO1 G;  3W1B A;  4JI8 L;  1E1O A;  3EIV A;  4R4I A;  3RZO H;  2QEX A;  1O7I A;  4DK3 C;  2MNA A;  1JJG A;  1VQ9 A;  2I0Q A;  4JI0 Q;  1TWH H;  4JV5 Q;  4DR3 L;  2KCM A;  4NXM L;  4KHP Q;  1SR3 A;  1MJC A;  4AQY L;  2Q2T A;  2VNU D;  4R1J A;  2Y0S G;  4GLV B;  4A3I H;  1VQH A;  3OTO L;  1XPU A;  4BXX H;  4LF9 Q;  3W5O A;  4JI5 Q;  1I3Q H;  1OXV A;  3AYH B;  1S40 A;  4YWK A;  3B6Y A;  3KDF B;  1HZA A;  3GTL H;  1KXL A;  1E1T A;  1VQK A;  4GOP C;  2UXB Q;  4A3L G;  5AJ3 Q;  1A62 A;  4AYB G;  2HIV A;  4JBJ A;  1Q86 C;  4IJH A;  2BA1 A;  4XTC S;  1YEZ A;  1VQP A;  2E2J H;  2B63 H;  2H5X A;  4GNX A;  1TWA H;  3UE1 A;  4A3G G;  4P73 A;  4A75 A;  1Y1W G;  4QJF A;  3S24 A;  1CKM A;  1PVO A;  2Z0S A;  4R4C A;  1L1O C;  2WAQ G;  4J15 A;  1HNZ L;  2JA7 H;  3CCV A;  3AFP A;  4QY7 A;  1YJW A;  2IHE A;  4TVA B;  4DUY L;  4YCV A;  1Q1E A;  5C4J H;  3CCM A;  3GTP H;  3G48 A;  1Q7Y C;  4B3S Q;  4LF6 Q;  1IBL L;  4LUV A;  2R7Z H;  4GKJ L;  3I4N G;  2N8N A;  1WFQ A;  3F8T A;  2RF4 A;  3PF4 A;  4LUO A;  3K8A A;  5IWA Q;  5J3B A;  5C0X J;  4WJ4 A;  4OX9 Q;  4AIM A;  2VS1 A;  2K14 A;  3GTJ H;  1QZH A;  4DAY B;  3CCU A;  4B3T Q;  1N34 Q;  3A5Z B;  2R92 H;  1HZ9 A;  1XMQ Q;  1IXR A;  4OO1 I;  1P16 A;  2OQ0 A;  1PH8 A;  5GAH C;  5JJK A;  2VQF Q;  4DR6 L;  3ICE A;  3S1Q H;  1YJ9 A;  5GRO A;  4X65 L;  3CCS A;  4DV6 L;  2IHF A;  1I50 H;  1IL2 A;  4KI0 A;  4A3J G;  4BBR G;  4POF A;  4X66 Q;  1EYG A;  4MZ9 A;  1QVC A;  2HQL A;  3TQY A;  4DR2 Q;  4LFC Q;  3IRB A;  4H02 A;  3TRE A;  1KRT A;  4DPG A;  1XPO A;  4JI6 Q;  4DV3 L;  2HHH Q;  2NZO A;  3T1Y Q;  1X54 A;  1CKN B;  3KOJ A;  4IFD J;  4A3C G;  4LF5 Q;  1GO3 E;  1D8L A;  1H95 A;  4LWC A;  1AE3 A;  4DK6 C;  3I7F A;  3BU2 A;  2UUA L;  3G4S A;  2MO1 A;  3FKI G;  1N8R C;  1VQG A;  1Q12 A;  2E2I H;  4QQB X;  2AMC B;  4FDB A;  3GD7 A;  4X62 L;  1CUK A;  2K52 A;  3JAM i;  4DV1 L;  3L2P A;  3S1R H;  5M5Y H;  1OXT A;  1PYS B;  2ASB A;  4YHH Q;  3PUV A;  3PUW A;  4P75 A;  2PNH A;  4HIO A;  2Y0S E;  2IX0 A;  3CCQ A;  4JI5 L;  3CC4 A;  4DR7 L;  2MFI A;  4JG2 A;  1HNX Q;  4JBK A;  4YWL A;  2D62 A;  1J5E L;  3RLF A;  1HNW Q;  1FVI A;  4GN3 B;  1V43 A;  4R4T A;  3CXC A;  2UUC L;  2JE6 I;  5AJ3 L;  3J81 c;  5C4X H;  1BVS A;  4JOI A;  1Q1B A;  4A3K G;  3W1G A;  4A93 G;  3VDY A;  1TXY A;  4A3E G;  5C3E H;  4JI7 Q;  1C0A A;  5JEA G;  1KC8 C;  3I55 A;  3GTM H;  3HOZ H;  3PIP A;  4GNX C;  4RG1 A;  3Q8D A;  5M3M G;  4IOC A;  1N32 Q;  4ME3 A;  3AFQ A;  3RLN A;  3M9B A;  1CKO A;  1E24 A;  1GVP A;  5C44 H;  3HKS A;  1EUJ A;  3HOW G;  3PV0 A;  5IP7 G;  1LYL A;  4NPS A;  3H0G G;  2VUM H;  3PO3 H;  5BR8 L;  1HZC A;  1UEB A;  3J80 i;  4JYA L;  3TS0 A;  1NE3 A;  5FLM G;  1GKH A;  2IY5 B;  2JA5 G;  2JA9 A;  3U50 C;  3T1H Q;  1G51 A;  4POG A;  4LF8 Q;  1XMO Q;  1PHJ A;  1B8A A;  1JJ2 A;  4UP7 A;  3HFZ B;  4B3M Q;  4Y7N H;  2YYZ A; 
#chains in the Genus database with same CATH topology
 4C3I H;  3QB3 A;  2E2I B;  4B3T L;  3RN2 A;  1PH4 A;  1PV4 A;  1N34 L;  1WCM B;  4A3L H;  3DM3 A;  4TRD A;  4A3F G;  2Z1C A;  2J7Z A;  3BYY B;  5NUC A;  1SRO A;  1DXM A;  2RDH A;  4WJ3 M;  3NE5 B;  4IN3 A;  1YBY A;  1W3S A;  3ERS X;  5IYB G;  3D31 A;  1VQI A;  2DY7 A;  1YNX A;  4R9W A;  2ZJR A;  2RSN A;  1RIP A;  1NR4 A;  2F0T A;  1KIX A;  3GTM B;  1RD9 D;  2QA4 A;  3NPP A;  1LUZ A;  1CSP A;  3SHL A;  2OCE A;  2WFW A;  4ZAI A;  1IKL A;  2EYF A;  2VUM B;  4QL5 A;  1LTI D;  2VXW A;  3OPO A;  4DR1 Q;  1LTG D;  1WOC A;  4IUP A;  2F0J A;  1W6J A;  4APV A;  4HID A;  1Q82 C;  1G8Z D;  1X56 A;  2CWP A;  2E2H B;  1LAB A;  4RCO A;  4K0K Q;  1C48 A;  4A3J H;  3EN2 A;  4BBR H;  4HTH A;  4C1N K;  2OTJ A;  2EY6 A;  1YZ6 A;  3ULL A;  4WFN 3;  1I6V C;  5I9P A;  1B3A A;  2MUY A;  2HIX A;  2L9H A;  4KLK A;  3SE0 A;  4KHV A;  2RBM A;  2QIL A;  2A6H C;  1IL8 A;  1EWI A;  1GUN A;  1QUQ B;  4N8X 1;  2R7F A;  5FJ8 G;  1EY9 A;  2WAQ B;  1DYQ A;  1SYB A;  3MEF A;  1K8G A;  4UPA A;  3RR5 A;  3HOX B;  1JWS D;  4HJ5 A;  1IBK L;  1DM0 B;  1KAW A;  2CW0 D;  3TN2 A;  2OF1 A;  1A2T A;  1VQF A;  4LFB L;  5EQ0 A;  2CQA A;  3T16 A;  2UXC L;  3NEN A;  4DV0 Q;  4DV7 L;  2MJ8 A;  4MTN A;  1SJH D;  4ZYS A;  4AH6 A;  5CC4 A;  4K8J A;  5LMN L;  1TII D;  2TSS A;  3A8K E;  1IHZ A;  1JT8 A;  1WCM H;  1Z9F A;  3CC7 A;  3TS2 A;  5FOB B;  2B2U C;  2ZXR A;  3CAM A;  1G29 1;  1XX8 A;  1LTA D;  4F88 A;  2YV5 A;  4HMJ A;  1TR5 A;  4IUQ A;  4OL7 A;  1CSQ A;  4U67 3;  5IGB A;  3JAM L;  5I6W A;  5E7N A;  2UXB L;  2NZ1 D;  5CV4 A;  4KMU C;  4YCW A;  3FKI B;  4LJZ C;  2EJF C;  1VQ5 A;  4MHE A;  3LGJ A;  4DR3 Q;  3H3V C;  2QKI C;  3MXG A;  4WOR A;  1KD1 C;  1ICW A;  5EKI A;  2NVY B;  3JAM c;  1RCV D;  1PFB A;  4GS3 A;  3P20 A;  4A3M B;  5IP9 H;  2K50 A;  4X64 Q;  3S2D H;  3ND9 A;  1TT2 A;  2E2D C;  2R93 H;  5HGT A;  1HTP A;  3PIO A;  2WKD A;  2A6E C;  2E2H H;  1HPC A;  2I5M X;  3R93 A;  4C3H H;  1FL0 A;  4OIK A;  3S17 H;  1WI5 A;  5C5L A;  4DUY Q;  1CT1 D;  4HIM A;  3I73 A;  2VQF L;  1PXU A;  2D2C C;  2O2L D;  3X3M A;  4RMF A;  1L1O B;  1I6H H;  3NP8 A;  4GKJ Q;  1I4G A;  5LHY 1;  3T56 B;  1F9P A;  2FMM A;  3KYH C;  4UHV A;  3I3C A;  2B2W C;  2JA5 B;  4X66 L;  1GUO A;  1K83 H;  4DN4 M;  4DK0 A;  1JJC B;  4JI2 L;  2JN4 A;  2ICE C;  3L0O A;  4NW2 A;  1IYU A;  1L2F A;  1AZQ A;  1FR3 A;  3TRZ A;  5G3L D;  5G3L F;  5C3E G;  2C5C A;  2F4I A;  3K6O A;  3P7J A;  3HOZ G;  4IPD A;  5IYD G;  5I2X A;  3BS1 A;  1A3V A;  1MHW C;  4QF4 A;  1A15 A;  2D9U A;  1HZB A;  1LT5 D;  3S1M H;  1RTN A;  2UUA Q;  4KN7 C;  3U4V A;  2NVT B;  4PMC A;  4K5W A;  4EQN A;  4RGT A;  1M4V A;  2CFM A;  2HT1 A;  3CC2 A;  3WOE A;  4C3I G;  2JA6 G;  1BBW A;  2A68 C;  2ZXP A;  1J5E Q;  5IIF A;  5GQO A;  2K04 A;  4A3C H;  1FGU A;  1HFN A;  4CJ2 C;  3H6M A;  4BBS G;  4RA8 A;  5KIX A;  4A3G B;  1RTO A;  4QIW B;  1JE5 A;  2F3V A;  3HOU H;  4FXD A;  1TWC H;  3T1H L;  1HA5 A;  1GUT A;  1EZ6 A;  2OQK A;  2VZA A;  3TME A;  1D5X C;  3A54 A;  4GNX B;  2NVY H;  2B2W A;  4FF2 A;  1S5C D;  1VQO A;  4A3I G;  4JBM A;  4U68 A;  1TQO A;  4DR5 L;  4A3K H;  2EYJ A;  4P74 A;  1ZYR C;  4C2M B;  2VL6 A;  5M3M H;  3MEH A;  3DWP A;  1LTL A;  3K81 C;  2LSS A;  4K14 A;  2AKW B;  2EYH A;  5IYC H;  3CF5 A;  3DUZ A;  5CMD A;  1E0B A;  3QR8 A;  3CQZ H;  2GA4 B;  1A0I A;  3F2B A;  4KJN A;  2UXD Q;  2YU9 B;  1UEA B;  3A0J A;  4A76 A;  1ENA A;  3NTH A;  4DFA A;  4ZLT F;  2JA5 H;  4FNF A;  2K5N A;  1ESR A;  4NB3 A;  2RCF A;  4UP9 A;  2F4V L;  2F0M A;  5C4Z A;  4DR1 L;  2Q2U A;  2L4N A;  3CPF A;  3CW2 C;  2PZT A;  1SMY D;  4BA2 I;  1SE3 A;  1R9T B;  1GUW A;  2B2T C;  4K0K L;  4GOP A;  4IZ8 A;  3K0X A;  4DAM A;  4HJ8 A;  3MC0 B;  3NQT A;  3R8B A;  1H9J A;  2PQE A;  3ONA B;  3K58 A;  4F87 A;  3BYT B;  1MKH A;  3V2T A;  4AYB E;  2EYL A;  3PQI A;  3ULP A;  1K73 C;  4JI1 L;  1WTH A;  2X6L A;  5K36 H;  1UWV A;  2K28 A;  2M00 A;  2Z6B A;  1Q46 A;  3I91 A;  4CDE C;  3V96 A;  1F2M A;  4RAU C;  1TWG H;  1WCM G;  3DWQ A;  1GHK A;  2XRQ D;  4IQZ A;  5EPK A;  5JJL A;  1SN8 A;  1B4O A;  1V8Q A;  2PMZ E;  1D6E C;  2VW9 A;  2EQS A;  4OEM B;  3S16 B;  4DV0 L;  1IKM A;  3K5O A;  4E6I A;  2NVX H;  3F1Z A;  3J7Z C;  1NTG A;  5EBC A;  4ALP A;  3H3V H;  3DM1 A;  5DAU A;  1YHA A;  3KJO A;  1S72 A;  1F2Z A;  4IPC A;  4XXE A;  2E5L Q;  3DEO A;  1TU2 B;  3BJU A;  1QVG A;  3STB C;  3S15 H;  1YJN A;  1K8O A;  1PDQ A;  2ZJP A;  2VUM G;  5A35 A;  5IP9 G;  2F0P A;  5CV7 A;  3EJI A;  1O78 A;  3EIV A;  2B2Y C;  1LT6 D;  3SVM A;  5CGK A;  1VQ9 A;  2I0Q A;  4DR3 L;  2VNU D;  1EWC A;  1OXV A;  3AYH B;  4YWK A;  1KXL A;  1HZA A;  2NVQ B;  3SK6 A;  1E1T A;  1IW7 C;  2KHS A;  1VQP A;  1TWA H;  1SNP A;  4A75 A;  1TWF B;  2Z0S A;  2HUG A;  1EZ8 A;  1TKW B;  2WAQ G;  1HNZ L;  1JR0 D;  2DN8 A;  3K57 A;  3AFP A;  4LAA A;  4QY7 A;  1Y8N B;  1JWM D;  2IHE A;  4DUY L;  4XDX A;  1I4P A;  1Q7Y C;  4B3S Q;  1DJR D;  1PTO B;  5JJZ A;  4GKJ L;  2G9D A;  3CRL C;  2R7Z H;  2N8N A;  2Q8T A;  3F8T A;  2F0N A;  4LUO A;  5C0X J;  1PTO D;  4I65 A;  4OGQ C;  4IFD H;  4B3T Q;  1N34 Q;  1P16 A;  1TWH B;  3NTK A;  4B9W A;  4K6D A;  3ICE A;  3HG9 A;  3S1Q H;  4ZCK A;  3CCS A;  3ERO A;  2IHF A;  4H0L C;  1QB5 D;  3Q0A A;  4FXK C;  4R8N A;  1E2V A;  2KUM A;  3MAQ A;  3IRB A;  2B39 A;  3TSS A;  4DAP A;  1JOK A;  3T1Y Q;  1X54 A;  4A3C G;  1RHP A;  3IL8 A;  1HFG A;  1D8L A;  1H95 A;  1SYE A;  2H4O A;  2KEC A;  2UUA L;  3FKI G;  1VQG A;  2AMC B;  3S1R H;  3GD7 A;  2K52 A;  5FO7 B;  3JAM i;  1CHP D;  1WTV A;  2K5Q A;  4NMZ A;  2ASB A;  1B50 A;  3PUV A;  4P75 A;  1HTL D;  4HIO A;  1D1I A;  3CCQ A;  3CC4 A;  4JI5 L;  3ERQ A;  3DHQ A;  4JBK A;  1FD7 D;  2D62 A;  1J5E L;  1HNW Q;  1FVI A;  4GN3 B;  5A2Q L;  1V43 A;  4R4T A;  5AJ3 L;  1MSG A;  1TS5 A;  1BVS A;  2MHV A;  2F0H A;  4PQX A;  4O1N A;  1I4R A;  4A3K G;  3VDY A;  1TXY A;  3VYR A;  3NWT A;  1B1Z A;  3IFD A;  1C0A A;  2AUJ D;  1NUC A;  1KC8 C;  4X6A H;  4KTA A;  3PIP A;  5M3M G;  4IOC A;  5EPL A;  3VR3 A;  1CKO A;  1F9Q A;  1NCV A;  3NSW A;  4BY7 B;  5LL6 X;  5C6A A;  1CQF A;  2HQE A;  1HZC A;  1GUS A;  2TMP A;  2EDG A;  5FLM G;  4CHT B;  2IY5 B;  2JA5 G;  4POG A;  1STB A;  1XMO Q;  3I4M B;  4UP7 A;  5KYI A;  3HFZ B;  4G7H C;  4Y7N H;  4OX9 L;  1JE4 A;  4YCU A;  3J7A 5;  4DXF A;  3VYT A;  1ILQ A;  3SDZ A;  5ISR A;  4LFB Q;  3K7A H;  5E4W C;  1PTO H;  4DV7 Q;  2PI2 A;  1LO5 D;  2O4X A;  2PQA B;  5HUR A;  2KQ3 A;  4NXN Q;  3J81 j;  5LMN Q;  2WV6 D;  4JI0 Q;  5C4X B;  2LY7 A;  2HHH L;  5C3E B;  3FDT A;  3LNN A;  4LF5 L;  2K05 A;  1K0S A;  5ELD A;  3CCJ A;  5AFW A;  1P8L A;  3CCL A;  5EJW A;  3R3O A;  1PH3 A;  5J39 A;  4YHH L;  2RHS B;  3PSI A;  3VYS A;  3FP9 A;  2A8V A;  1G91 A;  1D1K A;  1HNX L;  3CMA A;  2IX3 A;  1A3U A;  1XYI A;  1QNU A;  3GO5 A;  3CCR A;  1I94 Q;  1FNV A;  1NBW A;  4XYQ A;  5C0X H;  5FO8 B;  1J9O A;  4JI7 L;  2P5Z X;  2B8G A;  4ZUI A;  1PH9 A;  4ZKB B;  4P72 A;  1LT4 D;  3MFY A;  3I72 A;  4AYB B;  2KCN A;  1NR2 A;  1KDA A;  1W2B A;  4DAY A;  4HIK A;  2IT1 A;  4DK1 A;  5HGQ A;  3I2Z A;  5ELN A;  4JCV E;  2K75 A;  2D0O A;  5CBA E;  2M9V A;  3GV3 A;  4IUN A;  4O42 A;  1KRS A;  5H1S E;  2JA8 H;  1H9M A;  4B3M L;  3VA7 A;  3PCO B;  1L0X B;  1EEF D;  2F52 A;  2PMZ B;  3MZ5 A;  4BY7 H;  1CKN A;  5E3F A;  2NZH A;  1VQJ A;  1STN A;  4XT1 B;  2E5L L;  1U0L A;  1J6Q A;  4A3E H;  1SE8 A;  5DLQ E;  4B3R L;  2CKZ B;  4JI2 Q;  3S14 H;  4CBV A;  3I4M H;  1Y8O B;  5M5W B;  3CHB D;  5LMU Q;  5EAY A;  2IWH A;  4MIU A;  1AFP A;  5KGU A;  2QF7 A;  4BY1 H;  2F0F A;  4A3J B;  4BBR B;  3SXH A;  1E22 A;  4UY8 C;  1B7Y B;  2G5D A;  1EQQ A;  2QDB A;  3OHX C;  1HR0 L;  3MFG A;  3JAM E;  5JEA J;  4UAI A;  3UDF A;  1WTX A;  2Z6K A;  5DM6 3;  3E0J A;  3GV6 A;  4NXM Q;  3PO2 H;  3BDL A;  2JEA I;  3OTO Q;  2F0V A;  3MXN B;  4QIW E;  3M4P A;  1C8C A;  1KDC A;  1PLF A;  1CA6 A;  3W3A A;  2NN6 G;  3MHB A;  5HY6 A;  4B3S L;  2F3W A;  2JXM B;  1OTC A;  1WTR A;  1X55 A;  1BCP B;  1HRJ A;  1C9O A;  1Q90 A;  1UE5 A;  1B53 A;  2AUK A;  2DY8 A;  3HGB A;  2RA4 A;  2MQH A;  1EEI D;  4IUU A;  1PH6 A;  2RQX A;  2SNM A;  1BCP D;  4JVZ A;  1BCP F;  1TY2 A;  5KYL A;  4IAL A;  5IE8 A;  4KY7 A;  2YTY A;  5EKL A;  1X65 A;  4DR5 Q;  1IBL Q;  1SNQ A;  1JMC A;  1HCZ A;  4R4O A;  1S3O A;  3DWA A;  4A3B H;  1QWY A;  4DV4 L;  3M4Y A;  4RFB A;  4HSV A;  3H91 A;  3T1Y L;  5COR A;  3S2H H;  4KN4 C;  4PG3 A;  5C3W A;  1UE7 A;  1Y1V H;  3QIA A;  1TVX A;  4DGZ A;  3FPU B;  1YNJ C;  1CHQ D;  3NEM A;  1XNQ L;  1SNM A;  2L5T A;  2F0Q A;  1PA6 A;  1AZP A;  3W2D A;  2F4V Q;  1IYJ B;  3S2D B;  2SOB A;  4Z9C B;  4ZKC B;  1ROD A;  5LL6 S;  1HNW L;  2R93 B;  4J6H A;  4XQN A;  5M5W H;  4MN3 A;  1XJV A;  2F0K A;  5E1F A;  4X62 Q;  1K9M C;  1STY A;  2L1B A;  4H13 C;  1EYD A;  1H9R A;  4C3H B;  2NTS A;  5FO9 B;  3S17 B;  1M90 C;  3AU7 A;  4CJ1 B;  5EGT A;  5D14 A;  3L9A X;  1BBX C;  1K28 A;  4DR7 Q;  1QUQ A;  4DF7 A;  1I6H B;  1EIG A;  4HJA A;  2MP1 A;  4GLX A;  1K83 B;  4L5T A;  4JI1 Q;  4R8I A;  2PW7 A;  1S5B D;  2SDF A;  1N9W A;  2RDG A;  1XMO L;  4KK7 A;  5C5M A;  1DOK A;  1KLU D;  2IJ0 A;  2CCZ A;  4CDD C;  2X6G A;  3FHW A;  4HJ9 A;  2A74 C;  4PMB A;  4F8M A;  4RH6 A;  3V05 A;  3QO2 A;  1YIJ A;  4JYA Q;  3SK8 A;  4A93 H;  1K8M A;  5JEA H;  3S1M B;  3BDO A;  4RWS C;  2ZT9 C;  4NXN L;  1ZKO A;  2YTV A;  3E9I A;  3RUZ A;  3UDG A;  3CU7 A;  1QNK A;  1VMP A;  4JI0 L;  3UDX A;  3P75 A;  2EVB A;  1NAP A;  4DKA C;  5C0X G;  1WJJ A;  3CD6 A;  1I3Q B;  3RMH A;  1UE1 A;  2X69 A;  4QMG A;  4EQ5 A;  1DZ1 A;  4IPH A;  2N49 A;  3SGI A;  4IO9 A;  2NTT A;  1OXS C;  4ME5 A;  5IGC A;  3OOC A;  4BS9 A;  1XPR A;  1SMX A;  1VF7 A;  2F0W A;  2EYO A;  3T4A C;  2BH2 A;  1Z6H A;  2ZM6 Q;  1G6P A;  1F9R A;  3HOU B;  3NQI A;  4JBW A;  1TWC B;  1YHQ A;  1I94 L;  2Z9H A;  4MNO A;  4RGO S;  2K4K A;  5EBD A;  3GP7 A;  3MVV A;  2IL8 A;  2SEB D;  2JSO A;  1Q8K A;  2JA8 G;  1O7Z A;  2KBN A;  2SNS A;  3QWN A;  2V1C C;  3SR1 A;  3NXW A;  3WWV A;  3H15 A;  4BY7 G;  1JOR A;  4JK1 C;  4A3K B;  1WTP A;  1T9H A;  2BOS A;  2ATW A;  3G71 A;  3Q6S A;  1PYW D;  3KF8 B;  3BVG A;  5D65 A;  5M3M B;  3ER0 A;  1L1O A;  3N6R A;  4LFA Q;  3OMG A;  5IY0 A;  1HNZ Q;  1GM5 A;  3I4M G;  5COY A;  5LMN W;  3TBI B;  2XTI A;  3CQZ B;  1LTS D;  3M3Y H;  5IGD A;  3EFX D;  1HXY D;  2EIF A;  4BY1 G;  3GTO H;  2QEJ C;  5C4H A;  1GOZ A;  1SNO A;  1N36 L;  4UP8 A;  1RL2 A;  2ID0 A;  1D5Z C;  4KY6 A;  3E9H A;  1N33 L;  1K3R A;  3A74 A;  2IW3 A;  2Q2I A;  5C4X G;  1E3P A;  3TDQ A;  5LMU L;  1NSN S;  1VQ7 A;  2A6H D;  1D7Q A;  2EYP A;  2K5W A;  1K8A C;  3K5M A;  1BXT A;  4H7B A;  4L8J A;  2B29 A;  3F2C A;  4OO1 G;  3W1B A;  4JI8 L;  1E1O A;  4G7O C;  1STH A;  4R4I A;  4F7X A;  5CV8 A;  4X3K A;  4NXM L;  1VF5 C;  2M2L A;  4AQY L;  1TS4 A;  1XPU A;  4GLV B;  4OEL B;  1VQH A;  3OTO L;  4ZRZ A;  4B08 A;  4LF9 Q;  3N52 A;  4JI5 Q;  1I3Q H;  3KDF B;  3TZU A;  2NWG A;  4UDU C;  2MPM A;  1TWG B;  1VQK A;  4GOP C;  4A3L G;  2QW7 A;  5AJ3 Q;  4AYB G;  2R61 A;  4JBJ A;  1Q86 C;  3I4L A;  4IJH A;  2BA1 A;  2E2J H;  1YEZ A;  2PYK A;  2F0S A;  2H5X A;  4GNX A;  3KLS A;  3UE1 A;  1IYV A;  4KD4 A;  1D5M C;  1U4R A;  2E74 C;  2NVX B;  1PVO A;  4J15 A;  5TSS A;  3CCV A;  5IGF A;  4TVA B;  5C4J H;  3G7L A;  1IBL L;  3S15 B;  2AQ2 B;  3FPP A;  5IWA Q;  5J3B A;  2EY1 A;  4OX9 Q;  3C46 A;  2K14 A;  3GTJ H;  2WAC A;  3A5Z B;  2N88 A;  4OIJ A;  1PH8 A;  5JJK A;  5GRO A;  1MSH A;  4A3J G;  2A6E D;  4YIJ A;  4BBR G;  4POF A;  4MZ9 A;  1EOT A;  4DR2 Q;  5F2D A;  4H02 A;  4RKB A;  2BE5 C;  3TRE A;  2JP1 A;  2HHH Q;  3Q22 A;  1XWE A;  2NZO A;  4IFD J;  4LF5 Q;  1GO3 E;  1TWA B;  1EY8 A;  1AE3 A;  3J81 L;  4DK6 C;  1PMR A;  3BU2 A;  2MO1 A;  3IFT A;  4X62 L;  4FDB A;  3Q24 A;  3L2P A;  1OXT A;  1PYS B;  3TP7 A;  2KJX A;  3NWS A;  5ELB A;  4YHH Q;  2PNH A;  4DR7 L;  1HNX Q;  4JG2 A;  5IGG A;  4YWL A;  1SAP A;  2F0G A;  2HCI A;  5A2Q E;  2R7Z B;  3J81 c;  1SE2 A;  2EY5 A;  4JOI A;  1Q1B A;  4A93 G;  4C3J B;  2PO4 A;  3OSO A;  1Y69 U;  4JI7 Q;  3TP8 A;  5JEA G;  1I4X A;  3QG1 A;  1S5F D;  3AFQ A;  4V0B A;  5C44 H;  1GVP A;  3S1Q B;  1Z7T A;  3PO3 H;  4JYA L;  4WJW A;  1NE3 A;  1B9N A;  2XWB B;  2V4D A;  1GKH A;  1U4L A;  2JA9 A;  1G51 A;  4RKL A;  1SYD A;  4LF8 Q;  2A68 D;  2HDM A;  4B3M Q;  1EY4 A;  2E75 C;  3ZYY X;  2K6A A;  4PV1 C;  3F2D A;  1HJP A;  1DON A;  1EQT A;  2KED A;  3ULJ A;  3S1R B;  2NB0 A;  5IOC A;  2QGQ A;  3DEP A;  1WYD A;  4B3R Q;  4O0A A;  1QE6 A;  3FEW X;  3PF5 A;  1NJI C;  4EX5 A;  1W6K A;  5M5X B;  1Y1W H;  1BKB A;  4XIG S;  3KF6 B;  4DUZ Q;  1X3G A;  3RN5 A;  4CDF C;  2R93 G;  2ZM6 L;  2B8F A;  2A1A A;  5JOB A;  2BH8 A;  1ZYR D;  4C3H G;  4OWX B;  1EY0 A;  3BDC A;  1HR0 Q;  1SNC A;  1A3T A;  4IJL A;  3T53 B;  1WTW A;  1B70 B;  1X3P A;  4DV5 Q;  3RNU A;  3AEV A;  1MIU A;  2JEB I;  1WTO A;  1STG A;  2Y0S B;  4Y7N B;  1VQ4 A;  4LFA L;  1V1P B;  3H94 A;  1EIF A;  2Z4I A;  2MO0 A;  4N9T A;  2XNA C;  3K7A B;  3J7Y W;  2CWA A;  3VA5 A;  2WIN B;  2K01 A;  2YTX A;  2E8G A;  1I4H A;  2KHJ A;  4JI3 Q;  4EQO A;  1PFM A;  3RLO A;  4C3J H;  1PH7 A;  1PTO F;  1OXX K;  2N3S A;  1CFM A;  3A56 A;  4KKU A;  2JQO A;  4P2C B;  1HQR D;  1X3Q A;  3FRP B;  1ICF B;  1NMG A;  3K0Y A;  3K80 C;  4JC0 A;  3HOY H;  2K32 A;  3I4N B;  2ALY B;  1Z47 A;  4H44 C;  4DV4 Q;  4BA1 I;  3C1F A;  3GTG H;  3T51 B;  5FLX L;  1K0R A;  2EYM A;  1SSO A;  2OTL A;  1FJG L;  2K33 A;  4RHS A;  3GTQ H;  1VQ8 A;  1LTT D;  2CHB D;  5DEH A;  3RD4 A;  5ELC A;  3HOW H;  3HOU G;  2XIW A;  4CDC C;  4V19 0;  2PCF B;  1XNQ Q;  1TS2 A;  2A5H A;  2UU9 L;  1QG7 A;  1PRT C;  4LF9 L;  1BDO A;  1EYC A;  1VQA A;  5FLX c;  3AB9 A;  1DGS A;  5M5X H;  2Z4H A;  4FF3 A;  3J7A F;  2N55 A;  4DA2 A;  4ZQ3 A;  1AH9 A;  4GN4 B;  3E6Z X;  4A3F H;  3STB D;  3DLL A;  2JA8 B;  4NP5 A;  1XTD A;  1F9S A;  5IYC G;  4HN7 A;  2GVA A;  1SYF A;  1JCK B;  3K7U C;  4A3E B;  3S14 B;  1PZJ D;  1GXD C;  2AQ3 B;  3TEH B;  5IWA L;  1IW7 D;  5JVG 3;  4FXG C;  2FHT A;  3MTS A;  2PQA A;  4BY1 B;  3HKZ G;  4OON A;  3VR6 A;  1PFS A;  2E76 C;  3NBI A;  4NKL A;  1VQE A;  5I4D A;  2EXZ A;  4R4Q A;  5GAG C;  1HQM C;  4N9P A;  3R2T A;  4FVM A;  4B9X A;  4DR2 L;  1SBB B;  2R7D A;  3S1N H;  1SRU A;  2F3I A;  3KUP A;  2ENB A;  3J80 c;  1DD2 A;  2DGY A;  3CME A;  5D3D A;  2F0L A;  3PO2 B;  4HJ7 A;  2F0U A;  2LS0 1;  4X65 Q;  2XN9 C;  2L11 A;  3Q23 A;  4L5Q A;  1AN8 A;  4HED A;  5K36 G;  1CZG A;  1X6O A;  3I4N H;  1NNX A;  1BUV T;  1PH1 A;  2B2V C;  1KNE A;  3KLS X;  4RGM A;  2AHO B;  2F0E A;  1SFO H;  4Q5V A;  3VR2 A;  5JPM C;  2NN6 I;  1ASZ A;  1T5X D;  1D2B A;  3OIQ A;  1PH2 A;  2Z6K C;  3KFU A;  2UUB L;  3HRZ C;  3K5N A;  1VQL A;  1ET9 A;  2WB1 E;  2RCN A;  1JOO A;  4EQP A;  1WTQ A;  3L7Z C;  2Q2H A;  1EU3 A;  2UUC Q;  2ZTE A;  1HUN A;  4PMW A;  4P71 A;  1V1O A;  1C4Q A;  4DNT B;  2OXP A;  1LT3 D;  2KEN A;  3CPW A;  1EIH A;  3EBE A;  4A3B B;  1CZW A;  2XGT A;  3ITP A;  4LF8 L;  3M4O H;  1HH2 P;  3S2H B;  5IT9 L;  1CQV A;  1Y1V B;  5T1I A;  3NEL A;  2RHQ B;  3I56 A;  1NY4 A;  1LLR D;  1E2W A;  1T5E A;  2LFN A;  3HKZ E;  3K59 A;  1N36 Q;  2LMC B;  1Q81 C;  5EKK A;  1N33 Q;  3HEJ A;  4EVO A;  1MI2 A;  4CGY B;  1WVL A;  1KNA A;  3KBX A;  4L63 B;  4QB4 A;  5IT9 c;  4JI4 L;  4DUZ L;  2JJQ A;  4MTK A;  3SEB A;  1RF2 D;  2AWO A;  3U58 A;  4LF4 Q;  3J7A V;  2PNR C;  2B2V A;  1M8A A;  3J81 i;  4G57 A;  4XYO A;  1H9S B;  4YY3 L;  1A63 A;  4JI8 Q;  1PH5 A;  3MXN A;  1DOM A;  5KRU A;  2B63 B;  2R7Z G;  1KTK A;  3PGZ A;  3E0E A;  4DV5 L;  3NHH A;  4AQY Q;  2C35 B;  4KJO A;  1WD1 A;  3M7G A;  3AQQ A;  4C3J G;  1RJT A;  3S9W A;  2KCC A;  4FYD A;  4IFD G;  4TQU S;  4A3D H;  1L0W A;  2EXD A;  3HOV H;  1UE6 A;  5KND A;  3GTK H;  1M1K C;  1HA6 A;  1O80 A;  2EE1 A;  2XSC A;  1MJE A;  2CVR A;  3HOY G;  1QJO A;  4A93 B;  1XNR L;  2PW5 A;  2XWJ B;  4DU9 A;  1RKN A;  3OIP A;  1YIT A;  4QCL A;  4Q0F A;  2CW0 C;  4JI3 L;  3U4Z A;  1MD2 D;  3NBH B;  4JW0 A;  5IYD H;  3WDN A;  5I2Y A;  4DR4 Q;  3H09 A;  1BF4 A;  2BCO A;  4DV2 Q;  1DCZ A;  2A69 C;  4LW1 A;  5C0X I;  1QZG A;  3HZX A;  3PUX A;  5C3X A;  2A19 A;  1AE2 A;  1YHB A;  3P1H A;  1HR0 W;  1E7Z A;  2NUC A;  4DNI A;  2G9H D;  1LV9 A;  3RZD H;  2JA6 H;  3NTI A;  1YNN C;  3CKI B;  1KHI A;  4PZ6 A;  2I5H A;  1YI2 A;  2Z8L A;  4BBS H;  1EFW A;  2PZU A;  3OW7 A;  1AEX A;  4BWG B;  3A8J E;  1IBM L;  2DNE A;  3FMC A;  4GKK Q;  1CTM A;  3RZO H;  2QEX A;  1O7I A;  4DK3 C;  1JJG A;  4JV5 Q;  4EGV A;  2KCM A;  4KHP Q;  1SR3 A;  5FK9 C;  4R1J A;  2Y0S G;  4FF1 A;  4A3I H;  4BXX H;  3W5O A;  3EQL C;  1S40 A;  3M3Y B;  3B6Y A;  1B3Q A;  1TY0 A;  1ONL A;  1A62 A;  4XT3 B;  2HIV A;  1JB3 A;  3GTO B;  1LTR D;  4FO2 A;  2Q8R E;  2B63 H;  4P73 A;  3S24 A;  1KDB A;  1G2T A;  1U9R A;  4J1M A;  1L1O C;  3IAY A;  2J0T D;  2BDN A;  2JA7 H;  1SXT A;  2HCC A;  4YCV A;  2RSO A;  3CCM A;  3G48 A;  5CBE E;  5M3F B;  2MGS A;  4ID6 A;  4LF6 Q;  2EZV A;  2FMC A;  4LUV A;  3I4N G;  3PF4 A;  1U4M A;  3K8A A;  1EY6 A;  1BR9 A;  3NK9 A;  2VS1 A;  4AIM A;  4HSP A;  1QZH A;  1QCB D;  1Y8P B;  1HZ9 A;  2R92 H;  4OO1 I;  4PNY A;  2OQ0 A;  3D3R A;  1OO9 B;  2XVS A;  5CV5 A;  4X65 L;  1I50 H;  1IL2 A;  4KI0 A;  5CV9 A;  3TZD A;  3SK5 A;  4LFC Q;  1XPO A;  4JI6 Q;  4HR7 B;  1Q3L A;  1ML0 D;  2E2J B;  2A69 D;  5IGE A;  3LWE A;  3J81 E;  2E2I H;  1Q12 A;  4X3S A;  2EY2 A;  4C1N I;  5KEE A;  3KF8 A;  5C4J B;  1BO0 A;  2IX0 A;  2NBF A;  2Y0S E;  2MFI A;  2NYZ D;  3SK4 A;  3RLF A;  4K5X A;  1QIL A;  5CV6 A;  3A55 A;  1I4Q A;  1YNN D;  2JE6 I;  2UUC L;  2PZW A;  3PIO 3;  1FNW A;  4CKE A;  2WB1 B;  3W1G A;  1YNJ D;  4K2K A;  4A3E G;  3GTJ B;  3QOL A;  3GTM H;  4GNX C;  3Q8D A;  3MXP A;  4ME3 A;  5KNB A;  3RLN A;  3M9B A;  1EY5 A;  3EA6 A;  1E24 A;  3HKS A;  1JC7 A;  1EUJ A;  4J8Q A;  3PV0 A;  1ILP A;  2VUM H;  5J1Z A;  3KLR A;  3J80 i;  3U50 C;  4ILW A;  3AMU A;  4ULL A;  3DXJ C;  3HKZ B;  3BVZ A;  4M1U B;  1VQ6 A;  1IZ6 A;  3PO2 G;  1XMQ L;  4FF4 A;  1KQS A;  3VYU A;  5M3F H;  4XQJ A;  2JYO A;  4LF4 L;  4A3D G;  3ND8 A;  1SMY C;  3HOV G;  3JC6 6;  1XTC D;  1STE A;  1SYC A;  1F77 A;  1FJG Q;  1A8V A;  3KDF A;  4JPB W;  4L6T B;  2B2U A;  1F2L A;  3OWF A;  3HOX H;  2UU9 Q;  1KAB A;  1STA A;  2L55 A;  5C44 B;  1VQN A;  2D0P A;  3LWU A;  2N78 A;  2VQE Q;  3PO3 B;  4LUZ A;  4CJ0 B;  2KHI A;  5GAE C;  2WP8 J;  1ZEQ X;  4JOI C;  4C56 C;  4A3B G;  3BVM A;  4RGN A;  4GZY C;  1N32 L;  3CCE A;  1SND A;  2AWN A;  4DR4 L;  1V9P A;  1Y1V G;  4DV2 L;  1H9K A;  1JIC A;  5I6Y A;  3I90 A;  1CI3 M;  4N8F A;  1EL0 A;  3FKI H;  1Y1W B;  1AW7 A;  3HS0 C;  4KD3 A;  1EYA A;  1SDF A;  4L5R C;  2FFK B;  2WKC A;  1PYB A;  1BQQ T;  5BN3 A;  1MBY A;  5D3I B;  4A3M H;  1VQM A;  4BXX G;  1EQR A;  3DMU A;  4YWM A;  3A7L A;  4ZK9 B;  3FVQ A;  2K5D A;  4K6L A;  1B9M A;  1EQV A;  4ABN A;  5FLX E;  3KBG A;  2KOL A;  3KLW A;  3LX0 A;  4GKK L;  3X3N A;  4LF7 Q;  3M4Q A;  4HCE A;  1VDZ A;  2B63 G;  3EVQ A;  1PZK D;  4QUC A;  2LKV A;  3O13 A;  2K5H A;  4JV5 L;  2L0C A;  4KHP L;  4O2D A;  4IUV A;  2R6G A;  2JA7 G;  2PI2 E;  3CRK C;  5FLM H;  5DM7 3;  2HDL A;  2B3G A;  4DXG A;  2DJF C;  4K8I A;  4A4I A;  1VQD A;  2UUB Q;  2L12 A;  3A5U A;  3VR5 A;  4G7Z C;  3QOJ A;  4RHR A;  2R92 G;  1PTO C;  1BOS A;  1FGB D;  1Y14 B;  4S3S A;  3HOY B;  3PMF A;  1ET6 A;  2HD3 A;  4KKS A;  1B44 D;  2ES2 A;  4LF6 L;  2K5V A;  4GOP B;  2NVT H;  3GTG B;  4IPG A;  3UI2 A;  1SJE D;  2ZTD A;  1BNZ A;  1X3E A;  1CM9 A;  3GTQ B;  3QJY A;  3J80 E;  3HOW B;  1JB7 A;  5K5P A;  3K5L A;  3H0G B;  1LTB D;  1UAP A;  3KF6 A;  3M85 A;  1CA5 A;  1TS3 A;  4KV6 A;  4OXP A;  5KNC A;  4A3G H;  5I9O A;  4LFC L;  1DOL A;  1YVC A;  1VS0 A;  3GDE A;  3OW2 A;  1U4P A;  4JI4 Q;  4JI6 L;  3UDI A;  3OMC A;  5DNF A;  3D0F A;  4DR6 Q;  1KL9 A;  4PZ8 A;  1S4Z A;  4X3T A;  4A3F B;  1II3 A;  4DV6 Q;  3D6W A;  2LXJ A;  1ASY A;  1ZXT A;  2QDL A;  2OWO A;  4HCS A;  4YY3 Q;  2JK8 A;  2F03 A;  4DV3 Q;  2EJG C;  1V1P A;  2K1B A;  4KHZ A;  4C2M H;  1AP0 A;  2GVB A;  2AQ1 B;  1J8I A;  3D4W A;  1ESF A;  1EOV A;  4DV1 Q;  5JJI A;  2B2T A;  2BE5 D;  1XXG A;  3D6C A;  3BZD B;  4GLA C;  5IOD A;  1WD0 A;  2ZTC A;  2YU9 H;  4TKO B;  2ICI A;  5M9O A;  4RCN A;  4LMQ D;  5EPJ A;  3ZJY C;  1XNR Q;  2VY3 A;  4Y52 H;  1VQB A;  5CYU A;  1EFI D;  2FXQ A;  5M3F G;  4IOA A;  1CK1 A;  5GAD C;  4X64 L;  3S1N B;  3UE0 A;  4LK1 C;  1BBU A;  2J4X A;  2RVL A;  3L3O C;  1EIY B;  2QCP X;  1R9T H;  5IT9 E;  4HMI A;  4I7A A;  1KAA A;  3E5S A;  2I5L X;  4OWW B;  5BR8 Q;  3PUZ A;  1KLG D;  3BZC A;  5JPN C;  3HOX G;  3D4R A;  4QGU A;  3TP6 A;  3HP3 A;  5JVH 3;  2ZJQ A;  3U9O A;  1NMF A;  5E4X A;  2BA0 A;  1I5F A;  4WRD A;  1C7Y A;  1ENF A;  1SFO B;  1FNU A;  1R4P B;  2DNC A;  2O5I C;  1GD7 A;  3NUC A;  1QOH A;  3PUY A;  5IP7 H;  1VCI A;  3H0G H;  5JAV A;  2VB3 X;  1LM0 A;  2NN6 H;  2EJM A;  1VQC A;  5ELO A;  3GTL B;  2K7V A;  1V1Q A;  3VR4 A;  3MXU A;  3WOF A;  1IBM Q;  3H3V I;  2VQE L;  3S16 H;  2B2Y A;  1A6X A;  3PIP 3;  3KJP A;  1RDP D;  4IUT A;  4CKC A;  2I07 B;  1R4Q B;  2WB1 G;  2IX1 A;  3M4O B;  3I4O A;  1G6Z A;  1VMC A;  3U9S A;  3TP5 A;  1JOQ A;  1JWU D;  3OYY A;  4M8A A;  1X32 A;  1GJX A;  2KCT A;  5CR3 A;  3GTP B;  2LXK A;  5IYB H;  1X3F A;  4I7Z C;  2R3Z A;  3BZK A;  4GN5 A;  4A3M G;  4ZUJ A;  2D5D A;  1A2U A;  4OWT B;  3CP0 A;  1G2S A;  2KA7 A;  2WII B;  3J80 L;  2GN5 A;  2KVM A;  2L15 A;  4L5S A;  2WAQ E;  2NVQ H;  3GQB A;  1SLJ A;  1L0Y B;  1O7Y A;  2O5J C;  2EPB A;  2IPK D;  1TWF H;  3G6E A;  2K03 A;  1U5K A;  2FIN B;  1X9N A;  4LF7 L;  1IBK Q;  2F1M A;  1QVF A;  2BDO A;  5M5Y B;  4A3D B;  1OXU A;  4PZ7 A;  3F2U A;  3HOV B;  2UXC Q;  3GTK B;  4IFD I;  2DUD A;  3M7N A;  5C44 G;  3E3X A;  3C3L A;  4LNQ A;  2UXD L;  2CQO A;  5FJ8 H;  1K3B C;  3PO3 G;  4XQQ A;  3I70 A;  2RKS A;  1E2Z A;  2MNA A;  1SEB D;  1TWH H;  2F0D A;  3HOZ B;  1MJC A;  4DAV A;  1SYG A;  2Q2T A;  1JQY D;  2RDF A;  4K5V A;  3GTL H;  3KK7 A;  1ENC A;  2F0I A;  2UXB Q;  3IKJ A;  1Q8I A;  1BCP C;  2I46 A;  4TSS A;  3A8I E;  2DJG C;  1PRT B;  1EU4 A;  4XTC S;  3I8Z A;  1PRT D;  4A3G G;  1PRT F;  3C1E A;  3RZD B;  1Y1W G;  4QJF A;  1CKM A;  4C3I B;  2JA6 B;  4R4C A;  4X3U A;  2KEE A;  1HHV A;  1PZI D;  1YJW A;  1Q1E A;  3GTP H;  4BBS B;  1GHJ A;  4G4K A;  3R2I A;  2OEO A;  5ELF A;  5BN4 A;  4HAE A;  1WFQ A;  2FJ2 A;  2RF4 A;  4FP5 D;  4WJ4 A;  2VB2 X;  2OT2 A;  1UNS A;  4DAY B;  3CCU A;  3A7A B;  3RZO B;  3D8G A;  1XMQ Q;  1IXR A;  3G6J B;  4QUF A;  5GAH C;  1B2T A;  4ODG A;  1H9S A;  1EY7 A;  2VQF Q;  4DR6 L;  3URY A;  1YJ9 A;  4A3I B;  4DV6 L;  3D4D A;  4NDX A;  1PFN A;  4X66 Q;  1EYG A;  1QVC A;  2HQL A;  3TQY A;  1F2Y A;  4DPG A;  1KRT A;  5L37 A;  3C2P A;  4DV3 L;  2H1E A;  1O7L A;  3KOJ A;  1CKN B;  5ELE A;  1GUG A;  4LWC A;  1S5D D;  2CH4 W;  3T13 A;  3I7F A;  3MA2 B;  3G4S A;  1N8R C;  1FYC A;  4QQB X;  1CUK A;  4KY5 A;  1SE4 A;  4DV1 L;  5M5Y H;  2ZXO A;  2JA7 B;  3OWE B;  3MWY W;  3PUW A;  4K2L A;  3NBH A;  1S5E D;  2F0O A;  3CXC A;  1UUP A;  5C4X H;  1MGS A;  2CH4 A;  2A73 B;  5C3E H;  1HUM A;  3I55 A;  3HOZ H;  4RG1 A;  2R92 B;  1N32 Q;  2EOT A;  4DNR B;  4IUR A;  3HOW G;  5IP7 G;  1LYL A;  1I50 B;  3BG3 A;  4NPS A;  5FKA C;  5T1G A;  3H0G G;  1EWH A;  2XRS D;  5BR8 L;  4KKT A;  1UEB A;  1LAC A;  2Q8I B;  4OO1 H;  5BN5 A;  3TS0 A;  5J22 A;  4CKB A;  4OHJ A;  2C9O A;  3T1H Q;  1PHJ A;  1B8A A;  1JJ2 A;  2PPB C;  2YYZ A; 
#chains in the Genus database with same CATH homology
 4C3I H;  4OX9 L;  3F2D A;  1HJP A;  4YCU A;  4B3T L;  3RN2 A;  1PH4 A;  1PV4 A;  3ULJ A;  1IZ6 A;  1N34 L;  1XMQ L;  1VQ6 A;  3PO2 G;  2QGQ A;  3DM3 A;  4A3L H;  1KQS A;  4A3F G;  4LFB Q;  5M3F H;  3K7A H;  4LF4 L;  4A3D G;  1WYD A;  4B3R Q;  4O0A A;  4DV7 Q;  3PF5 A;  1NJI C;  3HOV G;  2PI2 A;  4EX5 A;  1SRO A;  3JC6 6;  2PQA B;  4WJ3 M;  4NXN Q;  1FJG Q;  1YBY A;  1W3S A;  3ERS X;  5IYB G;  1Y1W H;  3D31 A;  3J81 j;  1VQI A;  1BKB A;  4XIG S;  1A8V A;  3KF6 B;  5LMN Q;  1YNX A;  1X3G A;  4DUZ Q;  3RN5 A;  2HHH L;  2ZJR A;  3KDF A;  2R93 G;  1RIP A;  4LF5 L;  1KIX A;  2ZM6 L;  2QA4 A;  2A1A A;  3HOX H;  1LUZ A;  2BH8 A;  2UU9 Q;  1CSP A;  3CCJ A;  1VQN A;  2D0P A;  4OWX B;  2OCE A;  2N78 A;  1P8L A;  2WFW A;  1HR0 Q;  3CCL A;  2VQE Q;  1PH3 A;  4IJL A;  4YHH L;  2RHS B;  4QL5 A;  3PSI A;  4LUZ A;  3FP9 A;  2A8V A;  4DR1 Q;  1HNX L;  1B70 B;  1WOC A;  3CMA A;  2KHI A;  5GAE C;  3GO5 A;  4APV A;  4DV5 Q;  4HID A;  3RNU A;  1MIU A;  2WP8 J;  1Q82 C;  3CCR A;  3AEV A;  2JEB I;  1I94 Q;  1NBW A;  1X56 A;  2CWP A;  4JOI C;  1VQ4 A;  4A3B G;  4LFA L;  4JI7 L;  4K0K Q;  4A3J H;  3EN2 A;  4BBR H;  1PH9 A;  2OTJ A;  1N32 L;  4P72 A;  1EIF A;  3CCE A;  2MO0 A;  1YZ6 A;  3ULL A;  2AWN A;  4DR4 L;  1V9P A;  1Y1V G;  4DV2 L;  1W2B A;  4HIK A;  2CWA A;  2IT1 A;  4X6A H;  2HIX A;  2YTX A;  2E8G A;  4KLK A;  5HGQ A;  2KHJ A;  3I2Z A;  4JI3 Q;  5ELN A;  3FKI H;  4JCV E;  2K75 A;  2D0O A;  3RLO A;  4C3J H;  1PH7 A;  1EWI A;  1OXX K;  1QUQ B;  5FJ8 G;  2R7F A;  1KRS A;  2N3S A;  3MEF A;  5H1S E;  2JA8 H;  4L5R C;  1K8G A;  4B3M L;  2JQO A;  4UPA A;  3PCO B;  3RR5 A;  1PYB A;  2F52 A;  1NMG A;  4HJ5 A;  1IBK L;  1CKN A;  1KAW A;  3K80 C;  4JC0 A;  4BY7 H;  2NZH A;  3HOY H;  1VQJ A;  4A3M H;  2ALY B;  1VQM A;  4BXX G;  1EQR A;  1Z47 A;  1U0L A;  1VQF A;  4YWM A;  2E5L L;  3J7A 5;  4LFB L;  2UXC L;  1J6Q A;  4A3E H;  1SE8 A;  5DLQ E;  4B3R L;  4DV4 Q;  3NEN A;  4BA1 I;  2CKZ B;  4JI2 Q;  4DV0 Q;  4DV7 L;  3GTG H;  4MTN A;  3S14 H;  1K0R A;  2OTL A;  4AH6 A;  3I4M H;  1FJG L;  5LMU Q;  5EAY A;  3KLW A;  5LMN L;  4GKK L;  4LF7 Q;  1VQ8 A;  3GTQ H;  3M4Q A;  2B63 G;  3HOW H;  1JT8 A;  3HOU G;  4BY1 H;  1WCM H;  2K5H A;  1Z9F A;  3CC7 A;  3TS2 A;  4JV5 L;  4KHP L;  4O2D A;  1XNQ Q;  3CAM A;  1G29 1;  2UU9 L;  2YV5 A;  1E22 A;  2R6G A;  2JA7 G;  4UY8 C;  2PI2 E;  1B7Y B;  5FLM H;  4LF9 L;  1EQQ A;  1CSQ A;  5FLX c;  1VQA A;  1HR0 L;  2B3G A;  5JEA J;  1DGS A;  5M5X H;  5E7N A;  2UXB L;  4A4I A;  3UDF A;  4YCW A;  2Z6K A;  1VQD A;  1VQ5 A;  3LGJ A;  4DR3 Q;  2UUB Q;  4NXM Q;  3PO2 H;  3A5U A;  1AH9 A;  4GN4 B;  4A3F H;  3STB D;  3DLL A;  3OTO Q;  2JEA I;  3MXN B;  4QIW E;  1KD1 C;  1XTD A;  2R92 G;  3M4P A;  5IYC G;  3JAM c;  1Y14 B;  2GVA A;  4GS3 A;  5IP9 H;  3K7U C;  2K50 A;  4X64 Q;  2NN6 G;  3S2D H;  4B3S L;  5HY6 A;  1OTC A;  2ES2 A;  2R93 H;  4LF6 L;  2K5V A;  4GOP B;  2NVT H;  1X55 A;  4IPG A;  3PIO A;  1C9O A;  2E2H H;  1UE5 A;  2ZTD A;  1X3E A;  3TEH B;  5IWA L;  2I5M X;  2MQH A;  4C3H H;  1PH6 A;  1FL0 A;  3S17 H;  1WI5 A;  1JB7 A;  4DUY Q;  2PQA A;  3HKZ G;  4OON A;  5IE8 A;  1PFS A;  4HIM A;  2VQF L;  2YTY A;  4RMF A;  1L1O B;  3KF6 A;  1X65 A;  1I6H H;  3M85 A;  4DR5 Q;  1IBL Q;  4GKJ Q;  1VQE A;  3KYH C;  4OXP A;  4R4Q A;  5GAG C;  1JMC A;  4R4O A;  4X66 L;  1S3O A;  1K83 H;  4DR2 L;  4LFC L;  1YVC A;  3GDE A;  1VS0 A;  2R7D A;  1SRU A;  3OW2 A;  2F3I A;  3S1N H;  4A3B H;  4JI4 Q;  1JJC B;  3J80 c;  4DV4 L;  4JI6 L;  4JI2 L;  3UDI A;  2DGY A;  3CME A;  3T1Y L;  3D0F A;  3L0O A;  4DR6 Q;  4HJ7 A;  1KL9 A;  1L2F A;  4PZ8 A;  3S2H H;  4X65 Q;  3TRZ A;  4PG3 A;  4DV6 Q;  2LXJ A;  1UE7 A;  5C3E G;  1ASY A;  1Y1V H;  4L5Q A;  3HOZ G;  4IPD A;  5K36 G;  5IYD G;  1X6O A;  2OWO A;  3I4N H;  3NEM A;  1XNQ L;  4YY3 Q;  1PA6 A;  2JK8 A;  1PH1 A;  4DV3 Q;  2F4V Q;  1IYJ B;  2AHO B;  1HZB A;  4KHZ A;  4C2M H;  3S1M H;  1HNW L;  1SFO H;  1ASZ A;  2UUA Q;  2GVB A;  2NN6 I;  3U4V A;  5M5W H;  1XJV A;  1PH2 A;  4X62 Q;  1K9M C;  1EOV A;  4DV1 Q;  2Z6K C;  2CFM A;  3KFU A;  5JJI A;  2UUB L;  2HT1 A;  3CC2 A;  1M90 C;  1VQL A;  2JA6 G;  2WB1 E;  4GLA C;  1BBW A;  2RCN A;  4DR7 Q;  2ZTC A;  2YU9 H;  1J5E Q;  1QUQ A;  3L7Z C;  2Q2H A;  3ZJY C;  2UUC Q;  5GQO A;  2ZTE A;  1XNR Q;  4A3C H;  1FGU A;  4HJA A;  2VY3 A;  4PMW A;  1VQB A;  4P71 A;  5M3F G;  2FXQ A;  4BBS G;  4GLX A;  4IOA A;  4Y52 H;  5GAD C;  2KEN A;  4L5T A;  4JI1 Q;  4X64 L;  3CPW A;  3UE0 A;  1JE5 A;  3EBE A;  1BBU A;  1N9W A;  3HOU H;  1TWC H;  3T1H L;  2XGT A;  1EIY B;  4LF8 L;  1XMO L;  3M4O H;  1R9T H;  1HH2 P;  2CCZ A;  2OQK A;  2VZA A;  4A3G H;  3NEL A;  2RHQ B;  3I56 A;  2I5L X;  3FHW A;  4GNX B;  4HJ9 A;  2NVY H;  5BR8 Q;  4OWW B;  3PUZ A;  1YIJ A;  3BZC A;  3HOX G;  1VQO A;  1NY4 A;  4JYA Q;  4QGU A;  3HKZ E;  4A3I G;  4JBM A;  4DR5 L;  1N36 Q;  4A3K H;  2ZJQ A;  4A93 H;  1NMF A;  1Q81 C;  1N33 Q;  4P74 A;  2BA0 A;  1I5F A;  1C7Y A;  2VL6 A;  5M3M H;  4NXN L;  2YTV A;  1LTL A;  3E9I A;  3K81 C;  3UDG A;  5IT9 c;  4JI0 L;  4JI4 L;  3UDX A;  2LSS A;  1GD7 A;  2AKW B;  4DUZ L;  5IYC H;  3CF5 A;  2JJQ A;  3PUY A;  5IP7 H;  4DKA C;  1VCI A;  3H0G H;  5C0X G;  2AWO A;  3CQZ H;  1LM0 A;  3U58 A;  1A0I A;  4LF4 Q;  1WJJ A;  3F2B A;  3CD6 A;  1UE1 A;  1VQC A;  5ELO A;  4EQ5 A;  2UXD Q;  3A0J A;  4A76 A;  3J81 i;  4IPH A;  2N49 A;  3SGI A;  1V1Q A;  2JA5 H;  4IO9 A;  1IBM Q;  2K5N A;  1OXS C;  3H3V I;  4NB3 A;  2VQE L;  4YY3 L;  1A63 A;  4JI8 Q;  4UP9 A;  1PH5 A;  1XPR A;  2F4V L;  3S16 H;  1SMX A;  2BH2 A;  4DR1 L;  2R7Z G;  3PGZ A;  2ZM6 Q;  2Q2U A;  1G6P A;  3E0E A;  4DV5 L;  3KJP A;  4AQY Q;  3CPF A;  4JBW A;  2C35 B;  1YHQ A;  3CW2 C;  2WB1 G;  1I94 L;  2IX1 A;  4BA2 I;  3AQQ A;  4MNO A;  3I4O A;  2K4K A;  4IFD G;  4TQU S;  4A3D H;  3OYY A;  4K0K L;  4GOP A;  1L0W A;  2EXD A;  1Q8K A;  2JA8 G;  3HOV H;  1UE6 A;  2KCT A;  3GTK H;  3K0X A;  4DAM A;  4HJ8 A;  1M1K C;  2KBN A;  3WWV A;  2LXK A;  2V1C C;  5IYB H;  3H15 A;  1MJE A;  4BY7 G;  1X3F A;  3HOY G;  4GN5 A;  3BZK A;  2ATW A;  1T9H A;  4A3M G;  1XNR L;  3G71 A;  1MKH A;  4AYB E;  1YIT A;  4OWT B;  3CP0 A;  3KF8 B;  4JI3 L;  3ULP A;  1K73 C;  3ER0 A;  1L1O A;  4LFA Q;  4JI1 L;  3U4Z A;  3NBH B;  5IY0 A;  1HNZ Q;  1GM5 A;  1UWV A;  2GN5 A;  5IYD H;  3I4M G;  5LMN W;  1Q46 A;  4DR4 Q;  2L15 A;  4L5S A;  2XTI A;  4DV2 Q;  3M3Y H;  2WAQ E;  4LW1 A;  2EIF A;  1TWG H;  1WCM G;  4BY1 G;  5C0X I;  2NVQ H;  1QZG A;  3PUX A;  2A19 A;  1AE2 A;  3GTO H;  5JJL A;  1SLJ A;  1SN8 A;  1YHB A;  2PMZ E;  1HR0 W;  1N36 L;  1E7Z A;  4UP8 A;  1RL2 A;  4DNI A;  2VW9 A;  2EQS A;  2ID0 A;  3E9H A;  4DV0 L;  1K3R A;  3A74 A;  1N33 L;  3RZD H;  1TWF H;  2NVX H;  3G6E A;  3F1Z A;  2Q2I A;  3J7Z C;  2JA6 H;  1NTG A;  5C4X G;  1E3P A;  1U5K A;  5LMU L;  4ALP A;  1X9N A;  3H3V H;  1VQ7 A;  4LF7 L;  1IBK Q;  1QVF A;  1KHI A;  4PZ6 A;  2I5H A;  1OXU A;  1YHA A;  3KJO A;  1YI2 A;  1S72 A;  4IPC A;  4PZ7 A;  2E5L Q;  4BBS H;  2UXC Q;  1D7Q A;  4IFD I;  2DUD A;  3M7N A;  5C44 G;  1K8A C;  1EFW A;  3BJU A;  1QVG A;  4LNQ A;  3STB C;  3S15 H;  2UXD L;  1YJN A;  2CQO A;  5FJ8 H;  2ZJP A;  2VUM G;  3PO3 G;  5IP9 G;  1IBM L;  2B29 A;  3F2C A;  4GKK Q;  4OO1 G;  3W1B A;  4JI8 L;  1E1O A;  3EIV A;  4R4I A;  3RZO H;  2QEX A;  1O7I A;  4DK3 C;  2MNA A;  1JJG A;  1VQ9 A;  2I0Q A;  4JI0 Q;  1TWH H;  4JV5 Q;  4DR3 L;  2KCM A;  4NXM L;  4KHP Q;  1SR3 A;  1MJC A;  4AQY L;  2Q2T A;  2VNU D;  4R1J A;  2Y0S G;  4GLV B;  4A3I H;  1VQH A;  3OTO L;  1XPU A;  4BXX H;  4LF9 Q;  3W5O A;  4JI5 Q;  1I3Q H;  1OXV A;  3AYH B;  1S40 A;  4YWK A;  3B6Y A;  3KDF B;  1HZA A;  3GTL H;  1KXL A;  1E1T A;  1VQK A;  4GOP C;  2UXB Q;  4A3L G;  5AJ3 Q;  1A62 A;  4AYB G;  2HIV A;  4JBJ A;  1Q86 C;  4IJH A;  2BA1 A;  4XTC S;  1YEZ A;  1VQP A;  2E2J H;  2B63 H;  2H5X A;  4GNX A;  1TWA H;  3UE1 A;  4A3G G;  4P73 A;  4A75 A;  1Y1W G;  4QJF A;  3S24 A;  1CKM A;  1PVO A;  2Z0S A;  4R4C A;  1L1O C;  2WAQ G;  4J15 A;  1HNZ L;  2JA7 H;  3CCV A;  3AFP A;  4QY7 A;  1YJW A;  2IHE A;  4TVA B;  4DUY L;  4YCV A;  1Q1E A;  5C4J H;  3CCM A;  3GTP H;  3G48 A;  1Q7Y C;  4B3S Q;  4LF6 Q;  1IBL L;  4LUV A;  2R7Z H;  4GKJ L;  3I4N G;  2N8N A;  1WFQ A;  3F8T A;  2RF4 A;  3PF4 A;  4LUO A;  3K8A A;  5IWA Q;  5J3B A;  5C0X J;  4WJ4 A;  4OX9 Q;  4AIM A;  2VS1 A;  2K14 A;  3GTJ H;  1QZH A;  4DAY B;  3CCU A;  4B3T Q;  1N34 Q;  3A5Z B;  2R92 H;  1HZ9 A;  1XMQ Q;  1IXR A;  4OO1 I;  1P16 A;  2OQ0 A;  1PH8 A;  5GAH C;  5JJK A;  2VQF Q;  4DR6 L;  3ICE A;  3S1Q H;  1YJ9 A;  5GRO A;  4X65 L;  3CCS A;  4DV6 L;  2IHF A;  1I50 H;  1IL2 A;  4KI0 A;  4A3J G;  4BBR G;  4POF A;  4X66 Q;  1EYG A;  4MZ9 A;  1QVC A;  2HQL A;  3TQY A;  4DR2 Q;  4LFC Q;  3IRB A;  4H02 A;  3TRE A;  1KRT A;  4DPG A;  1XPO A;  4JI6 Q;  4DV3 L;  2HHH Q;  2NZO A;  3T1Y Q;  1X54 A;  1CKN B;  3KOJ A;  4IFD J;  4A3C G;  4LF5 Q;  1GO3 E;  1D8L A;  1H95 A;  4LWC A;  1AE3 A;  4DK6 C;  3I7F A;  3BU2 A;  2UUA L;  3G4S A;  2MO1 A;  3FKI G;  1N8R C;  1VQG A;  1Q12 A;  2E2I H;  4QQB X;  2AMC B;  4FDB A;  3GD7 A;  4X62 L;  1CUK A;  2K52 A;  3JAM i;  4DV1 L;  3L2P A;  3S1R H;  5M5Y H;  1OXT A;  1PYS B;  2ASB A;  4YHH Q;  3PUV A;  3PUW A;  4P75 A;  2PNH A;  4HIO A;  2Y0S E;  2IX0 A;  3CCQ A;  4JI5 L;  3CC4 A;  4DR7 L;  2MFI A;  4JG2 A;  1HNX Q;  4JBK A;  4YWL A;  2D62 A;  1J5E L;  3RLF A;  1HNW Q;  1FVI A;  4GN3 B;  1V43 A;  4R4T A;  3CXC A;  2UUC L;  2JE6 I;  5AJ3 L;  3J81 c;  5C4X H;  1BVS A;  4JOI A;  1Q1B A;  4A3K G;  3W1G A;  4A93 G;  3VDY A;  1TXY A;  4A3E G;  5C3E H;  4JI7 Q;  1C0A A;  5JEA G;  1KC8 C;  3I55 A;  3GTM H;  3HOZ H;  3PIP A;  4GNX C;  4RG1 A;  3Q8D A;  5M3M G;  4IOC A;  1N32 Q;  4ME3 A;  3AFQ A;  3RLN A;  3M9B A;  1CKO A;  1E24 A;  1GVP A;  5C44 H;  3HKS A;  1EUJ A;  3HOW G;  3PV0 A;  5IP7 G;  1LYL A;  4NPS A;  3H0G G;  2VUM H;  3PO3 H;  5BR8 L;  1HZC A;  1UEB A;  3J80 i;  4JYA L;  3TS0 A;  1NE3 A;  5FLM G;  1GKH A;  2IY5 B;  2JA5 G;  2JA9 A;  3U50 C;  3T1H Q;  1G51 A;  4POG A;  4LF8 Q;  1XMO Q;  1PHJ A;  1B8A A;  1JJ2 A;  4UP7 A;  3HFZ B;  4B3M Q;  4Y7N H;  2YYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...