2E2DC

Flexibility and variability of timp binding: x-ray structure of the complex between collagenase-3/mmp-13 and timp-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
180
Chain Sequence
CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEYLIAGKAEGNGNMHITLCDFIVPWDTLSATQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Matrix metallopeptidase 13
publication title Flexibility and Variability of TIMP Binding: X-ray Structure of the Complex Between Collagenase-3/MMP-13 and TIMP-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 43
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2006-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2e2dC02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 2e2dC01
2XWBB 5JPMC 5FO7B 1JB3A 3G6JB 2WIIB 4FXKC 3KLSA 2E2DC 4ILWA 4FXGC 1GXDC 1OO9B 2WINB 1BUVT 5JPNC 3CU7A 3L3OC 3MA2B 1XWEA 3I70A 2QKIC 1D2BA 2I07B 3HRZC 3OHXC 2TMPA 3FRPB 3T4AC 2A73B 2ICEC 1BQQT 2XWJB 5FOBB 5FO9B 1PXUA 5FO8B 3V96A 3CKIB 3HS0C 2B39A 1UAPA 1UEAB 2A74C 1JC7A 2J0TD 1BR9A
chains in the Genus database with same CATH superfamily
1SNMA 4PZ6A 3HKZG 4F88A 3HFZB 5FLMG 3IFDA 2UXBL 4X64L 5EBDA 2E8GA 3HRZC 3BVMA 5C3XA 4V190 1V9PA 1CFMA 4IUTA 2AUJD 2NVXH 5C4XG 2MJ8A 1STGA 1O7YA 3I4MB 1ENAA 4OO1H 2EYLA 2L1BA 4BY7H 3BZKA 1TS5A 1O7IA 5IYBH 1KDBA 2FINB 2XRQD 4RGTA 4X66Q 1PZJD 2MFIA 2EDGA 2SEBD 5IGFA 4A3IH 1TXYA 1K83B 1Z6HA 4RG1A 2XWJB 4RGMA 1KXLA 4DR4L 5IGGA 3AFPA 1NY4A 1WYDA 1JORA 3GTOH 1H9JA 4KY7A 3FKIB 4JI3Q 3A56A 2I46A 1JWUD 4WFN3 1QG7A 4B3RQ 1DD2A 3J81j 3VR4A 3AFQA 3HEJA 1Q46A 4CJ2C 4XYOA 2YYZA 1I4GA 1N36L 3L9AX 3GTQH 2L0CA 1PTOB 1L0YB 2PNHA 3ULPA 5IIFA 3OSOA 2CKZB 2D5DA 2EE1A 4EGVA 4UAIA 5G3LF 1K8MA 1GD7A 4BBRG 5IYDG 1X56A 2F0MA 4ILWA 4OEMB 3RMHA 3S1MB 4JK1C 1Y1WH 1DXMA 1YHAA 2EY5A 4KHVA 1FVIA 3GTKB 5IP7G 2LS01 4LFAL 3MFYA 5CBEE 4ULLA 4DK1A 4A3LH 4KY6A 2GVBA 2WKCA 3F2BA 3NQTA 1YNND 1F9PA 3HOYG 2E76C 4LF9Q 2A6HD 1O7LA 2NZOA 4IPGA 2KEEA 1B4OA 2G9HD 3OWFA 2K05A 4LUVA 3H91A 4A75A 1TWFB 5KNCA 4A3MG 1KHIA 3HOVG 3PUZA 2O4XA 4BS9A 5C4XH 1EYDA 1TWCH 4B3MQ 1ZKOA 1EY5A 2FXQA 1STEA 1SAPA 4DV1L 1BCPD 3GTGB 1N34L 5LMNL 4A3GG 2LFNA 3PIO3 4A3FB 4YWMA 1F9SA 1LT5D 1KNAA 2UUAL 3R2TA 4DGZA 3PO3B 2ID0A 3FVQA 4PZ8A 5JPNC 5BR8L 2EYPA 4DV7Q 2K14A 1ZYRC 4JV5Q 4PMCA 2XRSD 1C4QA 4ALPA 4H44C 1Q7YC 4NKLA 2LXJA 2L15A 1A2UA 1TS2A 2HIVA 1G2TA 1HNXL 4JBKA 5C3EG 1BR9A 2N78A 2NVXB 4GZYC 2Z6BA 4IZ8A 1Q1BA 2WB1E 4ME3A 2F0TA 3UDIA 1J6QA 5ELNA 2MO1A 3U4VA 1A63A 4Q0FA 1RTOA 3HOWH 3U50C 2PI2E 1VQ4A 3BG3A 3KF8A 5CV7A 1RDPD 4UPAA 5C6AA 1I3QH 3I4LA 1II3A 5IODA 1AE2A 1VDZA 2IPKD 4A3IB 1AZQA 1QNKA 3VR2A 1BCPF 3PUVA 4JBJA 3GV3A 3TBIB 4XT3B 1JWSD 3CRLC 3KDFB 1F2ZA 3GTOB 3RNUA 1F2LA 1F77A 2JA6H 5IP7H 3TP5A 1E2ZA 3A7AB 2UXDL 3J80E 3PIP3 3TP7A 1WD0A 1PFNA 4BWGB 3K7UC 4JG2A 1UE6A 3A74A 5TSSA 1E22A 3M4PA 4IUNA 2F0WA 1VQ5A 2G9DA 1X3PA 3GTQB 1YJNA 3QO2A 1AZPA 5IGDA 2KCMA 1QVGA 2XNAC 2IX1A 1TWAH 4FXGC 4PZ7A 2ZXRA 2EYHA 3N6RA 2N8NA 3B6YA 5K36G 1L0XB 1OO9B 3NSWA 4DR3Q 1DOLA 2JA7G 1ET6A 2F0LA 1Y1WB 5M3MG 3PCOB 4CDDC 1I50H 4KJOA 1GM5A 3K6OA 3I72A 1XXGA 5E4XA 1LT4D 2Q8RE 1N33Q 3JAME 2WB1G 4DR4Q 3QWNA 1K0SA 3PGZA 1QILA 2R92G 2ALYB 3PUXA 1RKNA 4ZQ3A 1SNPA 4IFDI 4RGOS 4AIMA 1PRTD 5D3IB 2NN6I 2E75C 3PSIA 1IZ6A 2N88A 2E2HH 4X62Q 2QKIC 2RDFA 2JA8H 2YTXA 1R9TB 3TN2A 2IWHA 3BDLA 1B3AA 2XVSA 3U4ZA 4ZCKA 1N36Q 1PFBA 4ME5A 1X54A 3FP9A 1TWCB 5KGUA 3QG1A 4A3KG 4JI4L 3PO2G 5M3FB 4Z9CB 2JA5B 2FHTA 2J4XA 1ONLA 4J8QA 3VYTA 4CDCC 3I3CA 3A54A 1L1OC 3TRZA 1FR3A 4ZK9B 3BZCA 1PA6A 4LMQD 1T5EA 2F0QA 2D0OA 5NUCA 3X3MA 4XYQA 2EIFA 3T53B 2R7ZH 3OOCA 1SROA 1KDCA 1WTOA 2OQ0A 3S16H 4HJ8A 2MGSA 4A3EH 4NDXA 4DNTB 1KTKA 3F2UA 2K28A 4NP5A 5HGTA 4EQOA 5IT9E 3M9BA 4XQJA 2RKSA 2AQ2B 2GVAA 1VMPA 3K81C 4GNXA 1QWYA 1BBXC 1IBLQ 5JJLA 1C7YA 1H9SA 2RDHA 2XGTA 4JI0L 1SLJA 3C3LA 5FO9B 5CBAE 3PV0A 2RDGA 1HXYD 2XN9C 3PF5A 2K04A 5JPMC 2K50A 1KRTA 3CCSA 2HCCA 4LF5Q 2Y0SB 4EQNA 4DV1Q 4O0AA 1EY9A 2MHVA 3W1BA 2Z0SA 5IYCG 1NBWA 3GTJH 2WINB 1XMQL 4HJ7A 3AU7A 3RD4A 3I70A 2RVLA 2B8GA 1MJCA 4K2KA 5CV5A 1SNOA 1KRSA 4F7XA 1Q8KA 2UUAQ 2CFMA 1HZAA 5BR8Q 1TS4A 1I6VC 4A3JH 2R92H 1XPUA 3V2TA 4JCVE 4ZLTF 2HQLA 4A93B 4DU9A 1RD9D 5HGQA 2F0VA 1C8CA 5HY6A 3W3AA 1N9WA 5GAHC 1VQ6A 1ZEQX 3T4AC 1TWAB 5GADC 4NXML 1H9RA 1IBKQ 1EZ6A 1JOOA 4A3DH 3I4MG 2B2YC 4HIDA 2ZM6L 1FNUA 4J6HA 3D0FA 2A8VA 3MVVA 2RA4A 4KK7A 4A3KH 4QGUA 5C0XH 4K14A 1RL2A 1PMRA 3D4RA 3TMEA 2GA4B 1VQAA 2H5XA 4L5QA 3M7NA 1AEXA 1N32Q 2LMCB 1YNNC 5M5WH 1TR5A 1STYA 1Z9FA 2E74C 4K2LA 3NWSA 3K80C 4FF2A 3MXNB 3HOUG 1VQKA 1BDOA 2VB3X 1VQ9A 3SK4A 1S3OA 2UXDQ 1PVOA 2B63B 2E2HB 2JA8B 4NB3A 5I6WA 2R93G 1JE5A 2VL6A 1IL2A 2VUMH 2Z9HA 4PG3A 4X66L 3MZ5A 1JOQA 1LLRD 1EFID 4C3HH 4K5XA 5J1ZA 4CGYB 3H0GG 1FD7D 2RSOA 4C3IG 1BCPC 4AQYL 2K1BA 2F3IA 1SMYC 2PW7A 1HPCA 3M3YH 2R7DA 3RLFA 1SE4A 1QJOA 4XQNA 1CA6A 1EQVA 4KHPL 1ZYRD 2F52A 3G71A 4IUPA 1ENFA 3E0EA 4B3RL 4S3SA 1HR0L 3N52A 3BVGA 4EX5A 5JOBA 1E1OA 3LGJA 4HIKA 2R7ZB 1UE5A 5LMUQ 3S16B 1HTPA 4GOPC 4A3EB 4P71A 1BO0A 2B2WA 3R8BA 3ER0A 4C3JH 1NE3A 3RN2A 1XMOL 3TS2A 2K7VA 2HUGA 1BVSA 2B2VC 3E9IA 4X6AH 3A8JE 1BUVT 4QIWE 1K73C 2WAQE 3NWTA 1VQIA 2IX3A 1B2TA 2CQOA 1AH9A 3J7YW 5JJZA 3Q24A 3CU7A 2D9UA 2FMMA 4RHSA 3QB3A 3OHXC 1GJXA 5J3BA 3GTJB 2K5WA 2SNSA 1VS0A 2IHEA 4K8IA 1UNSA 4PV1C 4ZYSA 2AQ1B 2RCNA 1LYLA 4BXXG 3VR3A 3HGBA 2NYZD 1FGUA 3OMGA 1Q86C 2F0DA 2J7ZA 2MO0A 3BYTB 4A3JB 2IT1A 4B9WA 1PFSA 2F3WA 3S9WA 2EYMA 4XTCS 4JBWA 4DF7A 2HD3A 4B3ML 4JI7L 3RLNA 1SEBD 1VQFA 1HFGA 4LUOA 5IY0A 3HP3A 4DK3C 1QUQB 4DV0Q 3MEFA 5BN5A 1Q3LA 2Z4HA 3FPUB 4A3DB 2BA0A 3HOZG 1U5KA 2HIXA 3IAYA 5ELCA 4X65L 3S15H 2DN8A 4DR2L 4JV5L 2L11A 2PMZB 4Y7NH 4OX9Q 5D65A 1DM0B 3CPFA 2QA4A 1EIYB 4YY3L 2IJ0A 5E1FA 5M5WB 3VA7A 2WAQG 1G6ZA 1WFQA 1WTXA 5KEEA 1RF2D 1Y8NB 5CV4A 4CHTB 3GQBA 1PFMA 1PH8A 3S2HB 4GKKQ 4H13C 3KOJA 4O2DA 3S17H 1IKMA 1BXTA 4R1JA 2VUMB 1PH2A 5DLQE 2F0OA 3S14B 3KLSX 5KRUA 4ZUIA 3KDFA 3T16A 4HJ9A 4UHVA 2ES2A 2NN6G 2VQEL 1X65A 3M3YB 1QB5D 3NE5B 4KD4A 2E2JB 4V0BA 2K52A 1TU2B 5EAYA 3SGIA 4G57A 1EFWA 4DR7L 1ML0D 1CKMA 4TKOB 1J5EL 3H3VI 1EOVA 2ZJRA 2EVBA 1U4RA 1P8LA 1IHZA 4RGNA 3IFTA 4IPCA 2EXZA 4IO9A 2IL8A 3LNNA 2BDNA 1XNQQ 2C35B 4HJAA 4HMIA 5G3LD 1X3FA 2ZJPA 2YTYA 2Y0SE 3D4DA 4IN3A 4DR3L 4RAUC 2I0QA 2NVTH 3VYSA 2DJGC 4IUVA 3CMEA 2KJXA 4HJ5A 4PQXA 4HTHA 4A3CG 4JI6L 1F9RA 2KHIA 5CGKA 1F9QA 1YNJD 1STAA 3R2IA 4JVZA 2B8FA 1N33L 4A3BB 2VS1A 5JEAJ 1HNZL 1RIPA 3ITPA 4OL7A 4AQYQ 1HTLD 4LK1C 3Q23A 1MJEA 3FMCA 3ERSX 4YWKA 4DV3L 1UUPA 4HN7A 1EY8A 4K5WA 4BBSH 3S2DH 1M90C 4KHPQ 4X62L 5EKLA 5EJWA 2L5TA 1MI2A 2DNCA 2I5MX 1HR0Q 2K01A 1NMGA 3UDXA 3NQIA 5EPLA 1WTQA 2PO4A 1RCVD 3SK6A 3ERQA 4J15A 1A62A 3IRBA 4OHJA 2H4OA 2QDBA 2NZ1D 3OYYA 1XMOQ 2CCZA 3CC4A 4KN4C 2F0NA 3S24A 1U0LA 2BH8A 3JAML 1X6OA 2N49A 1BBUA 1EYAA 1W6JA 4O1NA 1DCZA 1AP0A 2MUYA 4R8NA 2JEAI 3HOXB 2OTJA 3TZUA 5C44G 1D5ZC 1X3EA 1WTPA 5CYUA 4LF6Q 2HT1A 3S15B 4IFDH 3E5SA 4R4QA 1GUNA 1D1KA 1Q82C 2AKWB 3V05A 1VQ7A 1SYEA 4CKCA 1TVXA 1WTVA 2XTIA 2VZAA 3P1HA 4DAMA 3CCEA 2UU9L 1X3QA 1VQOA 5C0XJ 1IW7D 1PDQA 1UWVA 2HDMA 4DPGA 1PH6A 1B8AA 1VQMA 5GAGC 3KBXA 3MXUA 1V1PB 1EYGA 1EUJA 3A8KE 3NELA 1IBLL 4R4IA 4HEDA 2A5HA 5FLMH 3TS0A 1AFPA 1JWMD 3L3OC 4I7ZC 1JJ2A 5C4JH 4IQZA 3EFXD 1ILPA 3S17B 3PF4A 5ELFA 4FP5D 4JI7Q 4HSPA 3TSSA 1ICWA 1V1QA 3GTMB 1KABA 4LF5L 4A93G 3Q6SA 2NTTA 3FDTA 1SMYD 3M4OH 4H02A 4KLKA 1B1ZA 1HQMC 3ULLA 1CHQD 1BF4A 2ATWA 4WRDA 4DK0A 2X6LA 1GXDC 1JOKA 1U4LA 3CCLA 4OWXB 1JICA 1VQLA 4KJNA 4DN4M 1JB7A 4X65Q 4JI8Q 5DEHA 4DR2Q 4OXPA 3S1QH 2VB2X 2K5VA 2EZVA 4JBMA 2DJFC 1JR0D 1P16A 5CV8A 1PRTB 2L4NA 4YY3Q 4JI5Q 2EJMA 1I5FA 3E6ZX 1GUTA 4DXGA 2Q2TA 2UUCQ 1MD2D 4WJ3M 4KY5A 1ZXTA 1IBKL 1I4QA 5LMNW 4TSSA 4BY7B 1LTAD 4A4IA 2B63G 2NVTB 5C5LA 4QUCA 2CQAA 4DA2A 3DUZA 2K5HA 1GUOA 4K0KL 5FO8B 2TSSA 3R3OA 3S1NH 2PQAB 4NPSA 3W5OA 3A5ZB 4IUQA 1IYJB 1PTOD 3W2DA 5FLXL 2F0SA 4BBRH 2BOSA 5IYDH 2X6GA 1SNDA 3MXNA 1O78A 1N32L 1SE2A 4UP8A 2VQEQ 1QCBD 4OGQC 4R4TA 4HSVA 2P5ZX 4UP7A 1SR3A 3TP8A 4X3SA 1EWIA 1S5DD 5FJ8G 1PYBA 4HCSA 4QJFA 4BBSB 3S2DB 2RF4A 1CT1D 3K0YA 3KK7A 4TRDA 4IOCA 3J81L 1TWHH 5FOBB 2R7FA 3HOYH 4DR7Q 1LTBD 3I4NG 4KN7C 1J5EQ 2NB0A 5J39A 4ODGA 5H1SE 4DV5L 1QOHA 1ICFB 2F0GA 2CW0D 3W1GA 1CZGA 3UE0A 4A3MH 4OIKA 1A3TA 3NP8A 3HOVH 2Z6KA 1KLGD 2V4DA 1YITA 3CXCA 1EQRA 4MIUA 1D1IA 3NK9A 3NBIA 1PHJA 4UY8C 4LFBQ 3X3NA 2RBMA 1VF5C 3PMFA 3GD7A 4JI6Q 2MP1A 1XNRL 4GKJL 3BDOA 3VDYA 4A3GH 1ET9A 1CZWA 5M9OA 1PTOF 2PZUA 1HNZQ 2IY5B 2Q8IB 1FNWA 5IWAL 2K75A 5LMUL 2K5DA 1E1TA 3A5UA 2KECA 1GOZA 1SNCA 4DV3Q 3MFGA 3G48A 5EBCA 3HG9A 3BZDB 3HKZB 4ID6A 4DAVA 2YTVA 1ASYA 5C3EH 5C4JB 1WCMG 3ND9A 3FPPA 3M4QA 5EGTA 1AW7A 2C9OA 1E3PA 5KNBA 3Q0AA 5C4XB 4CBVA 2I5HA 5I9PA 2YV5A 1TWGH 1Y1VG 4IALA 4Q5VA 4LF7L 5F2DA 4DUYQ 5BN3A 5JVH3 4LW1A 4L63B 3J7ZC 1LT3D 1SDFA 1IYVA 2IX0A 3TEHB 2D2CC 1VCIA 3ND8A 4HAEA 5D14A 1TIID 5ELBA 2BCOA 2PZTA 5A2QL 1NJIC 5JJKA 1XPRA 2F4VL 4BY1G 4FXKC 1X3GA 3E0JA 2JEBI 3QJYA 5FJ8H 2G5DA 3PUWA 2UU9Q 3I55A 3S1RH 2PNRC 4E6IA 4XXEA 1QUQA 2K03A 1SYDA 1HNWQ 1IYUA 2AMCB 4NW2A 2WFWA 4DV0L 2QGQA 5KYLA 5I9OA 3AMUA 5E4WC 3DEPA 2F03A 4YHHL 5JAVA 4B3TQ 3HOWB 1AN8A 3CCMA 3K0XA 4JOIA 1SSOA 3G4SA 2EYOA 1I3QB 1TY0A 3F8TA 3IL8A 4OX9L 2K33A 5K36H 1YNJC 4APVA 4P2CB 4MZ9A 3LWEA 4BBRB 4QCLA 2JA7H 3MXPA 4B08A 5M3MH 3SVMA 4QY7A 2JA6B 4DR1Q 1K8AC 2I5LX 4RKBA 1C48A 3CKIB 4O42A 4MN3A 1JC7A 1NMFA 2D62A 4GNXC 4GKKL 2M00A 1FGBD 3D6WA 1TWHB 1VQPA 4QMGA 3HOYB 4XIGS 3VYUA 1B50A 5FKAC 1KAAA 2RQXA 5M5XH 1W3SA 3CQZH 4ZAIA 4FXDA 2QILA 4OWWB 1T5XD 4DR5L 1WVLA 2AWOA 2A69C 2AUKA 4IUUA 4A3MB 3CCUA 2M9VA 3HOVB 2EXDA 2L9HA 5CORA 2B2UA 1FYCA 5ELOA 4WJWA 3UE1A 1LV9A 2F0HA 2PYKA 5LL6X 2XWBB 3MWYW 1VQNA 1XYIA 4K0KQ 4R4CA 2IHFA 3PO2H 1I50B 3WWVA 3A7LA 3H3VC 2BE5D 3RZDH 3SR1A 3NBHB 4A3GB 1N8RC 2ZXPA 1Q8IA 3CP0A 3I4OA 2JXMB 1B9NA 2FMCA 1EU3A 1JE4A 3PUYA 1IW7C 1XNQL 4FO2A 1EY4A 3FKIG 1HQRD 3CW2C 2Q2IA 4LAAA 1CKNB 2UXCL 5HURA 2L55A 1UEAB 2EY6A 1QVCA 4U673 4RKLA 3A0JA 1NR2A 1C0AA 1E0BA 5C3EB 1EWHA 4X3KA 3P20A 2Z8LA 4DV5Q 4CKEA 2VNUD 3MTSA 4GLXA 1YI2A 1A2TA 1PH1A 2HHHL 4KKUA 1K3BC 4DKAC 2CHBD 2M2LA 1TWGB 2B29A 3L7ZC 1DZ1A 1I4RA 3QOLA 3CCJA 3SEBA 5E7NA 1M4VA 3CRKC 3STBD 2GN5A 3SXHA 2VQFQ 3H3VH 3BU2A 1JJGA 1YHBA 2SOBA 2WIIB 1XNRQ 4GKJQ 5IYCH 1CKOA 1QVFA 3SDZA 4MNOA 2Q2UA 5IWAQ 4FNFA 1QZHA 4KI0A 2Q8TA 4HR7B 4DAPA 1D2BA 1RHPA 1XJVA 1VQJA 3GDEA 3D3RA 5AFWA 4DAYB 2UUBL 1KLUD 3CCRA 1IL8A 3MAQA 4JYAL 3P75A 3CHBD 5ELEA 5I2XA 3KJPA 2QCPX 1YJ9A 3EBEA 3DEOA 1J9OA 3KLSA 3I91A 3K7AH 3G6EA 2F4IA 5DAUA 2RCFA 1LTID 4LF6L 3WOFA 1PH9A 1LABA 1X55A 2YU9H 4I7AA 3ZJYC 1JMCA 1HR0W 1KIXA 1Z7TA 5CR3A 1ENCA 3NTHA 3URYA 1DYQA 4LF7Q 1PTOC 4B3SL 3I4MH 1L1OB 1CSQA 1E2WA 2KENA 3KF6B 4G7ZC 1V1PA 2JA7B 1MKHA 3PIOA 4EQ5A 4LNQA 1GO3E 1Q81C 5M3MB 1Y8OB 4A3FG 5DM73 3NUCA 4ZKCB 5K5PA 2KQ3A 2B2WC 1GUWA 2KVMA 4PMBA 3PO3G 1K83H 1YNXA 2WB1B 3OIQA 2KHJA 2R92B 2F4VQ 3HOUH 1OTCA 5M5XB 2I07B 4DK6C 3FKIH 3AQQA 3CQZB 4OELB 1LTLA 2OWOA 2K5QA 2R93H 2CW0C 3OIPA 1UEBA 4QB4A 1B53A 3D31A 1LUZA 1WTWA 5L37A 3CD6A 2VXWA 3IKJA 4FVMA 4YCUA 4YHHQ 3EN2A 3DWQA 4CKBA 1AE3A 4HCEA 3ONAB 1A3UA 4ZUJA 3BYYB 3DM1A 4XT1B 1A3VA 2DY7A 2OQKA 4JI8L 3H0GH 1F2MA 5IYBG 4A76A 4YCVA 4A3KB 4C3IH 4IOAA 1NSNS 3PO2B 1XWEA 3KBGA 1PH7A 3NEMA 3CCVA 3RZDB 4A3IG 2JN4A 2MPMA 2ASBA 2K5NA 4UP9A 2EYFA 4JI5L 3WOEA 3JAMi 2B2TA 4L6TB 3VR5A 2SNMA 1B7YB 3T1YL 2UUCL 3GTKH 5A35A 4R4OA 3G6JB 1PH5A 1UE7A 2Z4IA 4KKTA 3CMAA 2O2LD 3DWAA 3RR5A 2PQAA 1Q12A 4R8IA 3BJUA 1CSPA 1BNZA 1T9HA 4F8MA 4C3HB 3FRPB 2ICEC 5C0XI 4DV2L 4IJHA 1I94Q 4C2MH 4DR5Q 5KIXA 1V1OA 2XIWA 1Z47A 3C46A 1L0WA 4QQBX 1F2YA 1EU4A 1VQBA 5FLXc 1YIJA 4XQQA 4NMZA 1Y1WG 1RODA 1OXSC 1YEZA 1D6EC 3QIAA 1Y69U 2AWNA 1HHVA 3I90A 1BKBA 3M85A 3F1ZA 4ABNA 3WDNA 3OW7A 1CQFA 3H6MA 4BXXH 4PNYA 4K5VA 1DJRD 3PO3H 3J81c 1VQDA 4C3JB 1JQYD 2DUDA 3RLOA 2UXCQ 1L2FA 3EA6A 2NBFA 2CWPA 3KLRA 1MIUA 3UDGA 3E9HA 4N8X1 2OCEA 3OWEB 4LFBL 3FHWA 4G7OC 2KCTA 3K7AB 2EPBA 2NWGA 1D5XC 1BCPB 1YBYA 2HHHQ 1HRJA 3J80L 3OTOL 1EEFD 4ZRZA 4DUZL 2YU9B 4F87A 1X32A 1HZCA 3RN5A 2KCCA 3HOZH 2KA7A 3TQYA 2A1AA 5M3FG 2JA5G 4LF8Q 2SDFA 4M1UB 4POGA 4IURA 1E24A 1S5BD 1GHKA 4P74A 5GROA 1SMXA 2AHOB 1KC8C 1KD1C 2EJGC 4GOPB 2DGYA 3SK8A 1XPOA 4P75A 4LWCA 1SFOH 1FJGL 1E7ZA 2VY3A 3HOUB 1PH3A 3CAMA 4WJ4A 2VW9A 4X3UA 4AH6A 4GLVB 2A69D 2HQEA 1EWCA 2UUBQ 1EL0A 1QNUA 1SJHD 3D8GA 1HUMA 3T51B 4DUYL 4JYAQ 2R93B 3J81i 4RCNA 5LL6S 5ELDA 2A6ED 3TP6A 2ZT9C 1PH4A 3AB9A 3CC2A 3ZYYX 3P7JA 3C1FA 3K58A 3HOWG 4QF4A 2EJFC 3DMUA 5IE8A 3KYHC 3H0GB 4L5RC 3A8IE 3I7FA 4C3IB 4JC0A 2NN6H 5GQOA 4Y7NB 3K5OA 4AYBB 2BE5C 3NHHA 1LTSD 5C5MA 1DOKA 4B3SQ 4YCWA 1KNEA 2Y0SG 4GS3A 2R6GA 1K8OA 3RZOH 1HNWL 2DY8A 1FL0A 4N8FA 1S40A 1K3RA 3OW2A 2JA6G 2F0EA 1EY6A 4DV4L 1WI5A 4EVOA 3J7AV 4RMFA 4B3TL 2DNEA 5T1IA 4J1MA 4BA1I 5ISRA 1EQTA 2LY7A 5LHY1 1KQSA 2AQ3B 5J22A 1A15A 4C2MB 2ZTDA 2QEXA 1D8LA 3SHLA 1R9TH 4PMWA 4A3CH 3MXGA 1CK1A 3STBC 1O80A 4DR1L 4MTNA 4OONA 2CH4W 3EJIA 1K0RA 1BQQT 3I73A 1X9NA 2N3SA 4KD3A 1WD1A 5IT9L 2R61A 1BBWA 4K6DA 2E5LL 3U9SA 2NTSA 5M3FH 2JA5H 1J8IA 1BOSA 3J7A5 1CUKA 2LXKA 1CQVA 5DNFA 3I56A 1HUNA 2A68C 3OPOA 3Q22A 3T1YQ 2HCIA 2JQOA 5BN4A 1SN8A 1EZ8A 1IBMQ 4JW0A 2O5JC 1OXTA 2O5IC 3J7AF 1VF7A 3PQIA 2JA8G 1EOTA 1XTDA 3EQLC 4JI2Q 3RUZA 1IXRA 2CVRA 1LM0A 3NBHA 3K5MA 1EEID 3I2ZA 3K5LA 5KNDA 1JCKB 2OF1A 1EIHA 4RHRA 1VQEA 3NPPA 4DV2Q 1S72A 4TQUS 1KAWA 3HOZB 1JJCB 2CWAA 1CKNA 2NUCA 5C44H 1XTCD 4DNRB 2KUMA 1U4PA 3GP7A 1YVCA 4OO1I 4LF4Q 3C1EA 1G8ZD 1DOMA 3QOJA 1DONA 4QIWB 1S5FD 2WAQB 1SFOB 1K8GA 2R7ZG 1A0IA 1U4MA 1RTNA 5I4DA 3VA5A 2ZJQA 4CDEC 2PMZE 4YIJA 4A3EG 3F2DA 4RWSC 1HA6A 3CPWA 1A6XA 2C5CA 2QDLA 2VQFL 3NXWA 1V43A 4CJ0B 1STBA 4OIJA 2UXBQ 4X64Q 2LSSA 2WKDA 5JVG3 4A93H 3DXJC 5JEAG 3EROA 3OTOQ 4DUZQ 1JB3A 1H95A 2V1CC 1O7ZA 5M5YH 1LT6D 2JSOA 3K59A 4DAYA 4RFBA 4K8JA 1YHQA 1B70B 3H94A 3RZOB 1MBYA 1MSHA 1SRUA 3D4WA 2JE6I 1SYCA 5I2YA 3AEVA 3GV6A 4POFA 1SYBA 3A55A 3DLLA 5GAEC 1I4PA 2Z6KC 2PQEA 1TQOA 3F2CA 3BS1A 2HDLA 1I6HH 1PZID 2MNAA 4A3JG 1FJGQ 4CJ1B 1S4ZA 4M8AA 3G7LA 1L1OA 1E2VA 2OTLA 1HJPA 3KF6A 3UI2A 5D3DA 1R4QB 3AYHB 4C1NK 2EOTA 2B63H 4FYDA 3MA2B 2WACA 3M4OB 1GKHA 1TT2A 2FJ2A 4RA8A 2WP8J 1FNVA 2TMPA 2ICIA 1B3QA 2EY2A 1LTRD 1LTTD 2NZHA 1KL9A 5CV9A 1PXUA 3VR6A 4DFAA 1ASZA 1SJED 4A3DG 1SYFA 3KUPA 2LKVA 1SYGA 1JT8A 4P72A 3TREA 2QW7A 3S1QB 1STNA 4DNIA 5DM63 2PI2A 1QE6A 5C0XG 4N9PA 2F0JA 4DR6L 1H9MA 4Y52H 3BVZA 4LUZA 1VQ8A 2RHQB 1EY7A 2F0UA 1CTMA 2ZTEA 1XX8A 2Z1CA 4L5SA 5EPKA 2A73B 3UDFA 4KV6A 3SK5A 4C56C 3I4NH 1G6PA 1EY0A 3K57A 4DV4Q 4LFAQ 1LO5D 4GN3B 1U9RA 1M8AA 4KKSA 2MQHA 2VUMG 2F3VA 2KOLA 2D0PA 3S1NB 3D6CA 1MHWC 4C3HG 1PRTF 4FF1A 1QZGA 1K9MC 4JI1L 3DWPA 4IJLA 1EYCA 3LWUA 2NVYH 2JP1A 1LACA 3GTPH 3TDQA 5IGCA 4L5TA 5KYIA 5JEAH 4GN5A 5C44B 4DXFA 4R9WA 1Y14B 2RHSB 1HFNA 5C4ZA 2KBNA 3NTIA 4QL5A 1UE1A 4U68A 4TVAB 5C4HA 4KHZA 2L12A 2E5LQ 1A8VA 1N34Q 2E2DC 5LMNQ 2NVQH 1PYSB 2B2YA 4DV6L 2JK8A 2X69A 3MHBA 1OXVA 4JOIC 1D7QA 1D5MC 1I94L 1NR4A 4MTKA 4N9TA 5AJ3L 4FF3A 3H09A 1STHA 3DHQA 4LFCL 3M7GA 4HIOA 5T1GA 5FLXE 1I4HA 5EKIA 4AYBE 1CA5A 4C3JG 1WCMH 4NXNL 1PZKD 2XSCA 2A74C 2A6EC 3GTLH 3T1HL 1Y1VH 2OT2A 1V8QA 1HNXQ 2ENBA 2N55A 5CMDA 3J81E 1OXUA 2JYOA 2PZWA 1HZBA 1I4XA 5M5YB 4A3BG 2CH4A 4IFDJ 1TY2A 4MHEA 3CCQA 3Q8DA 4BA2I 3E3XA 5EKKA 2K6AA 3R93A 4H0LC 3C2PA 1Q90A 2E2IH 3H15A 3MC0B 4GN4B 1W6KA 4HMJA 4BY1H 3KF8B 5E3FA 1PV4A 3KFUA 3KLWA 2B2UC 1Q1EA 1I6HB 1W2BA 1SE3A 1NNXA 2A6HC 2K4KA 1TKWB 3TZDA 4IPDA 5COYA 3L2PA 1B9MA 1VQGA 3S2HH 1OXXK 4LF8L 2JJQA 1NAPA 4B9XA 1TS3A 2JA9A 3J80c 3S14H 4GOPA 1WOCA 3HOXG 3JC66 3L0OA 2EY1A 4FDBA 2B2VA 2QF7A 3U58A 4AYBG 1VMCA 2A68D 2ZXOA 1SBBB 3S1RB 2KEDA 4JI3L 4QUFA 1G2SA 5EQ0A 1R4PB 2E2JH 3GO5A 1HZ9A 5IP9G 2EYJA 3O13A 3OMCA 3I4NB 4X3TA 4EQPA 5CC4A 1VQCA 4KMUC 4L8JA 2QEJC 1IKLA 2PCFB 4LJZC 1DGSA 1M1KC 2A19A 1S5CD 4WORA 1PLFA 5JJIA 5IOCA 1GHJA 4XDXA 5A2QE 3EIVA 3NENA 1HA5A 1WJJA 3JAMc 3SE0A 2IW3A 2NVYB 2OEOA 1KDAA 3ICEA 1MSGA 2B3GA 3GTPB 3LX0A 3EVQA 3BDCA 4P73A 3T13A 5EPJA 1G51A 2R3ZA 3J80i 4FF4A 1PYWD 3HKSA 2F0KA 4ZKBB 4A3BH 1CI3M 1GUGA 3K5NA 2ZTCA 1RJTA 5IGEA 4JI4Q 2F1MA 2NVQB 4DR6Q 1C9OA 4LF9L 1GVPA 3V96A 2B39A 1UAPA 2J0TD 4K6LA 2BDOA 4C1NI 1WCMB 3VYRA 2RSNA 5FK9C 4UDUC 1G91A 5IGBA 1GUSA 4OO1G 3K8AA 2BA1A 1NCVA 4BY7G 5C3WA 2BH2A 4G7HC 1PTOH 3GTLB 4CDFC 1Y1VB 2H1EA 1ILQA 1K28A 3HKZE 4YWLA 1HCZA 1HH2P 2F0PA 4IPHA 1S5ED 4JI1Q 1H9KA 1Y8PB 3CC7A 1EQQA 2PW5A 3T56B 4KTAA 1EIGA 4JI0Q 4H7BA 3S1MH 4GNXB 3I8ZA 3FEWX 1NUCA 5FO7B 1H9SB 2FFKB 5IT9c 1IBML 3PIPA 3HOXH 4JPBW 4DV7L 2E2IB 1SXTA 2KHSA 1YJWA 4BBSG 5I6YA 4BY1B 1CM9A 1SNQA 4HIMA 2EQSA 4JI2L 4OWTB 5CV6A 2PPBC 1WTRA 4G4KA 4DV6Q 1XMQQ 2WV6D 1SE8A 3ULJA 3HZXA 5IP9H 1B44D 3HS0C 1PRTC 5AJ3Q 2F0FA 3NTKA 1G291 4LFCQ 2F0IA 1VQHA 1LTGD 1TWFH 4NXNQ 1MGSA 4I65A 4RH6A 3M4YA 2B2TC 2OXPA 1ESFA 1EIFA 2Q2HA 3T1HQ 4GLAC 4LF4L 1NTGA 3GTMH 1ESRA 3GTGH 4IFDG 2KCNA 3CF5A 1CHPD 3DM3A 3QR8A 1YZ6A 3KJOA 4A3LG 4RCOA 4NXMQ 3U9OA 4A3FH 3MEHA 1WTHA 2K32A 2ZM6Q
chains in the Genus database with same CATH topology
1SNMA 4F88A 3IFDA 5EBDA 3HRZC 3BVMA 5C3XA 4V190 1CFMA 4IUTA 2AUJD 2MJ8A 1STGA 1O7YA 3I4MB 1ENAA 4OO1H 2EYLA 2L1BA 1TS5A 1KDBA 2FINB 2XRQD 4RGTA 1PZJD 2SEBD 2EDGA 5IGFA 1K83B 1Z6HA 2XWJB 4RGMA 5IGGA 1JORA 1H9JA 4KY7A 3FKIB 3A56A 2I46A 1JWUD 4WFN3 1QG7A 1DD2A 3VR4A 3HEJA 4CJ2C 4XYOA 2YYZA 1I4GA 3L9AX 2L0CA 1PTOB 1L0YB 5IIFA 3OSOA 2D5DA 2EE1A 4EGVA 4UAIA 5G3LF 1K8MA 2F0MA 4ILWA 3RMHA 3S1MB 4JK1C 1DXMA 2EY5A 4KHVA 3GTKB 2LS01 3MFYA 5CBEE 4ULLA 4DK1A 4KY6A 2WKCA 3NQTA 1YNND 1F9PA 2E76C 2A6HD 1O7LA 2KEEA 1B4OA 2G9HD 3OWFA 2K05A 3H91A 1TWFB 5KNCA 3PUZA 2O4XA 4BS9A 1EYDA 1ZKOA 1EY5A 1STEA 1SAPA 1BCPD 3GTGB 2LFNA 3PIO3 4A3FB 1F9SA 1LT5D 1KNAA 3R2TA 4DGZA 3PO3B 2ID0A 3FVQA 5JPNC 2EYPA 1ZYRC 4PMCA 2XRSD 1C4QA 4H44C 4NKLA 1A2UA 1TS2A 1G2TA 1BR9A 2NVXB 4GZYC 4IZ8A 1Q1BA 2F0TA 4Q0FA 1RTOA 3BG3A 3KF8A 5CV7A 1RDPD 5C6AA 3I4LA 5IODA 1II3A 1VDZA 2IPKD 4A3IB 1AZQA 1QNKA 3VR2A 1BCPF 3PUVA 3GV3A 3TBIB 4XT3B 1JWSD 3CRLC 1F2ZA 3GTOB 1F2LA 1F77A 3TP5A 1E2ZA 3A7AB 3J80E 3PIP3 3TP7A 1WD0A 1PFNA 4BWGB 5TSSA 4IUNA 2F0WA 2G9DA 1X3PA 3GTQB 3QO2A 1AZPA 5IGDA 2XNAC 2IX1A 4FXGC 2ZXRA 2EYHA 3N6RA 5K36G 1L0XB 1OO9B 3NSWA 1DOLA 1ET6A 2F0LA 1Y1WB 4KJOA 3K6OA 3I72A 1XXGA 5E4XA 1LT4D 2Q8RE 3JAME 3QWNA 1QILA 1RKNA 3PUXA 4ZQ3A 1SNPA 4IFDI 4RGOS 1PRTD 5D3IB 2NN6I 2E75C 2N88A 2QKIC 2RDFA 1R9TB 3TN2A 2IWHA 3BDLA 1B3AA 2XVSA 1PFBA 4ME5A 1TWCB 5KGUA 3QG1A 5M3FB 4Z9CB 2JA5B 2FHTA 2J4XA 1ONLA 4J8QA 3VYTA 3I3CA 3A54A 1FR3A 4ZK9B 4LMQD 1T5EA 2F0QA 5NUCA 3X3MA 4XYQA 3T53B 3OOCA 1KDCA 1WTOA 2MGSA 4NDXA 4DNTB 1KTKA 3F2UA 2K28A 4NP5A 5HGTA 4EQOA 5IT9E 4XQJA 2RKSA 2AQ2B 1VMPA 1BBXC 1QWYA 1H9SA 2RDHA 3C3LA 5FO9B 5CBAE 3PV0A 2RDGA 1HXYD 2XN9C 2K04A 5JPMC 2HCCA 2Y0SB 4EQNA 1EY9A 2MHVA 2WINB 3AU7A 3RD4A 3I70A 2RVLA 2B8GA 4K2KA 5CV5A 1SNOA 4F7XA 1TS4A 1I6VC 3V2TA 4ZLTF 4A93B 4DU9A 1RD9D 1C8CA 2F0VA 3W3AA 1ZEQX 3T4AC 1TWAB 1H9RA 1EZ6A 1JOOA 2B2YC 1FNUA 4J6HA 3MVVA 2RA4A 4KK7A 5C0XH 4K14A 1PMRA 3D4RA 3TMEA 2GA4B 3M7NA 1AEXA 2LMCB 1YNNC 1TR5A 1STYA 2E74C 4K2LA 3NWSA 4FF2A 1BDOA 2VB3X 3SK4A 2B63B 2E2HB 2JA8B 5I6WA 3MZ5A 1JOQA 1LLRD 1EFID 4K5XA 5J1ZA 4CGYB 1FD7D 2RSOA 4C3IG 1BCPC 2K1BA 1SMYC 2PW7A 1HPCA 3RLFA 1SE4A 1QJOA 4XQNA 1CA6A 1EQVA 1ZYRD 4IUPA 1ENFA 4S3SA 3N52A 3BVGA 5JOBA 2R7ZB 3S16B 1HTPA 4A3EB 1BO0A 2B2WA 3R8BA 2K7VA 2HUGA 2B2VC 3A8JE 1BUVT 3NWTA 2IX3A 1B2TA 3J7YW 5JJZA 3Q24A 3CU7A 2D9UA 2FMMA 4RHSA 3QB3A 3OHXC 1GJXA 3GTJB 2K5WA 2SNSA 4K8IA 1UNSA 4PV1C 4ZYSA 2AQ1B 3VR3A 3HGBA 2NYZD 3OMGA 2F0DA 2J7ZA 3BYTB 4A3JB 2IT1A 4B9WA 2F3WA 3S9WA 2EYMA 4XTCS 4JBWA 4DF7A 1SEBD 1HFGA 3HP3A 5BN5A 1Q3LA 2Z4HA 3FPUB 4A3DB 2BA0A 3IAYA 5ELCA 2DN8A 2L11A 2PMZB 5D65A 1DM0B 2IJ0A 5E1FA 5M5WB 3VA7A 1G6ZA 1WTXA 5KEEA 1RF2D 1Y8NB 5CV4A 4CHTB 3GQBA 1PFMA 3S2HB 4H13C 1IKMA 1BXTA 2VUMB 2F0OA 3S14B 3KLSX 5KRUA 4ZUIA 3T16A 2NN6G 3M3YB 1QB5D 3NE5B 4KD4A 2E2JB 4V0BA 1TU2B 4G57A 1ML0D 4TKOB 2EVBA 1U4RA 1IHZA 4RGNA 3IFTA 2EXZA 2IL8A 3LNNA 2BDNA 4HMIA 5G3LD 3D4DA 4IN3A 4RAUC 3VYSA 4IUVA 2KJXA 4PQXA 4HTHA 1F9RA 5CGKA 1F9QA 1YNJD 1STAA 3R2IA 2B8FA 4A3BB 5JEAJ 3ITPA 4OL7A 1HTLD 4LK1C 3Q23A 3FMCA 1UUPA 4HN7A 1EY8A 4K5WA 5EKLA 5EJWA 2L5TA 1MI2A 2DNCA 2K01A 3NQIA 5EPLA 1WTQA 2PO4A 1RCVD 3SK6A 3ERQA 4OHJA 2H4OA 2QDBA 2NZ1D 4KN4C 2F0NA 3JAML 1EYAA 1W6JA 4O1NA 1DCZA 1AP0A 2MUYA 4R8NA 2JEAI 3HOXB 3TZUA 1WTPA 1D5ZC 3S15B 4IFDH 5CYUA 3E5SA 1GUNA 1D1KA 3V05A 1SYEA 4CKCA 1TVXA 1WTVA 3P1HA 1X3QA 5C0XJ 1IW7D 1PDQA 2HDMA 3KBXA 3MXUA 1V1PB 3A8KE 4HEDA 2A5HA 1AFPA 1JWMD 3L3OC 4I7ZC 4IQZA 3EFXD 1ILPA 3S17B 5ELFA 4FP5D 4HSPA 3TSSA 1ICWA 3GTMB 1KABA 3Q6SA 2NTTA 3FDTA 1SMYD 1B1ZA 1HQMC 1CHQD 1BF4A 4WRDA 4DK0A 2X6LA 1GXDC 1JOKA 1U4LA 1JICA 4KJNA 4DN4M 5DEHA 2VB2X 2EZVA 1JR0D 5CV8A 1PRTB 2L4NA 2EJMA 3E6ZX 1GUTA 4DXGA 1MD2D 4KY5A 1ZXTA 1I4QA 4TSSA 4BY7B 1LTAD 2NVTB 5C5LA 4QUCA 2CQAA 4DA2A 3DUZA 1GUOA 5FO8B 2TSSA 3R3OA 4IUQA 1PTOD 3W2DA 5FLXL 2F0SA 2BOSA 2X6GA 1SNDA 3MXNA 1O78A 1SE2A 1QCBD 4OGQC 4HSVA 3TP8A 4X3SA 1S5DD 4HCSA 4BBSB 3S2DB 1CT1D 3K0YA 3KK7A 4TRDA 3J81L 5FOBB 1LTBD 4KN7C 2NB0A 5J39A 4ODGA 1QOHA 2F0GA 2CW0D 1CZGA 4OIKA 1A3TA 3NP8A 1KLGD 2V4DA 4MIUA 1D1IA 3NK9A 3NBIA 3X3NA 2RBMA 1VF5C 3PMFA 3GD7A 2MP1A 3BDOA 1ET9A 1CZWA 5M9OA 1PTOF 2PZUA 2Q8IB 1FNWA 2K5DA 2KECA 1GOZA 1SNCA 3MFGA 5EBCA 3HG9A 3BZDB 3HKZB 4ID6A 4DAVA 5C4JB 3ND9A 3FPPA 5EGTA 1AW7A 2C9OA 5KNBA 3Q0AA 5C4XB 4CBVA 5I9PA 4IALA 4Q5VA 5F2DA 5BN3A 5JVH3 4L63B 1LT3D 1SDFA 1IYVA 2IX0A 2D2CC 1VCIA 3ND8A 4HAEA 5D14A 1TIID 5ELBA 2BCOA 2PZTA 5A2QL 4FXKC 3E0JA 2JEBI 3QJYA 3PUWA 2PNRC 4E6IA 4XXEA 2K03A 1SYDA 1IYUA 4NW2A 5KYLA 5I9OA 3AMUA 5E4WC 3DEPA 2F03A 5JAVA 3HOWB 1AN8A 1SSOA 2EYOA 1I3QB 1TY0A 3IL8A 2K33A 5K36H 1YNJC 4P2CB 3LWEA 4BBRB 4QCLA 3MXPA 4B08A 3SVMA 2JA6B 4RKBA 1C48A 3CKIB 4O42A 4MN3A 1JC7A 2D62A 2M00A 1FGBD 3D6WA 1TWHB 4QMGA 3HOYB 4XIGS 3VYUA 1B50A 5FKAC 1KAAA 2RQXA 4ZAIA 4FXDA 2QILA 1T5XD 1WVLA 2AWOA 2A69C 2AUKA 4IUUA 4A3MB 2M9VA 3HOVB 2L9HA 5CORA 2B2UA 1FYCA 4WJWA 1LV9A 2F0HA 2PYKA 5LL6X 2XWBB 3MWYW 1XYIA 1I50B 3A7LA 3H3VC 2BE5D 3SR1A 4A3GB 2ZXPA 1Q8IA 2JXMB 1B9NA 2FMCA 1EU3A 1JE4A 3PUYA 1IW7C 4FO2A 1EY4A 1HQRD 4LAAA 5HURA 2L55A 1UEAB 2EY6A 4U673 4RKLA 1NR2A 1E0BA 5C3EB 1EWHA 4X3KA 3P20A 2Z8LA 4CKEA 2VNUD 3MTSA 1A2TA 4KKUA 2CHBD 2M2LA 1TWGB 3L7ZC 1DZ1A 1I4RA 3QOLA 3SEBA 1M4VA 3CRKC 3SXHA 2SOBA 2WIIB 3SDZA 4FNFA 4KI0A 2Q8TA 4HR7B 4DAPA 1D2BA 1RHPA 3D3RA 5AFWA 1KLUD 1IL8A 3MAQA 3P75A 3CHBD 5ELEA 5I2XA 2QCPX 3DEOA 1J9OA 3KLSA 3I91A 2F4IA 5DAUA 1LTID 3WOFA 1LABA 1Z7TA 5CR3A 1ENCA 3URYA 3NTHA 1DYQA 1PTOC 1E2WA 4G7ZC 1V1PA 2JA7B 5M3MB 1Y8OB 5DM73 3NUCA 4ZKCB 5K5PA 2KQ3A 2B2WC 1GUWA 2KVMA 4PMBA 2WB1B 3OIQA 2R92B 5M5XB 2I07B 3CQZB 2K5QA 2CW0C 3OIPA 4QB4A 1B53A 3D31A 1WTWA 2VXWA 3IKJA 4FVMA 3DWQA 4CKBA 4HCEA 3ONAB 1A3UA 4ZUJA 3BYYB 3DM1A 4XT1B 1A3VA 2DY7A 1F2MA 4A3KB 1NSNS 3PO2B 1XWEA 3KBGA 3RZDB 2MPMA 3WOEA 2EYFA 2B2TA 4L6TB 3VR5A 2SNMA 5A35A 3G6JB 2Z4IA 4KKTA 2O2LD 3DWAA 1Q12A 4R8IA 1BNZA 4F8MA 4C3HB 3FRPB 2ICEC 5C0XI 5KIXA 1V1OA 2XIWA 1Z47A 3C46A 1F2YA 1EU4A 4XQQA 4NMZA 1RODA 1OXSC 1D6EC 3QIAA 1Y69U 2AWNA 1HHVA 3I90A 3M85A 4ABNA 3WDNA 3OW7A 1CQFA 3H6MA 4PNYA 4K5VA 1DJRD 4C3JB 1JQYD 3EA6A 2NBFA 3KLRA 3OWEB 4G7OC 3K7AB 2EPBA 2NWGA 1D5XC 1BCPB 1HRJA 3J80L 2YU9B 1EEFD 4ZRZA 4F87A 1X32A 2KCCA 2KA7A 2SDFA 4M1UB 4IURA 1S5BD 1GHKA 2EJGC 3SK8A 3HOUB 4X3UA 2A69D 2HQEA 1EWCA 1EL0A 1QNUA 1SJHD 3D8GA 1HUMA 3T51B 2R93B 4RCNA 5LL6S 5ELDA 2A6ED 3TP6A 2ZT9C 3AB9A 3ZYYX 3P7JA 3C1FA 3K58A 4QF4A 2EJFC 3DMUA 3H0GB 3A8IE 4C3IB 4Y7NB 2NN6H 3K5OA 4AYBB 2BE5C 3NHHA 1LTSD 5C5MA 1DOKA 1KNEA 2R6GA 1K8OA 2DY8A 2F0EA 1EY6A 3J7AV 4EVOA 2DNEA 5T1IA 4J1MA 4BA1I 5ISRA 1EQTA 2LY7A 5LHY1 2AQ3B 5J22A 1A15A 4C2MB 3SHLA 4PMWA 3MXGA 1CK1A 1O80A 3EJIA 1BQQT 3I73A 4KD3A 1WD1A 5IT9L 2R61A 4K6DA 3U9SA 2NTSA 1J8IA 1BOSA 1CQVA 5DNFA 1HUNA 2A68C 3OPOA 3Q22A 2HCIA 5BN4A 1EZ8A 2O5JC 1OXTA 2O5IC 3J7AF 1VF7A 1EOTA 3EQLC 3RUZA 2CVRA 3NBHA 3K5MA 1EEID 3K5LA 5KNDA 1JCKB 2OF1A 1EIHA 4RHRA 3NPPA 4TQUS 3HOZB 2NUCA 1XTCD 4DNRB 2KUMA 1U4PA 3GP7A 4OO1I 3C1EA 1G8ZD 1DOMA 3QOJA 1DONA 4QIWB 1S5FD 2WAQB 1SFOB 1U4MA 1RTNA 5I4DA 3VA5A 4YIJA 1HA6A 4RWSC 1A6XA 2C5CA 3NXWA 1V43A 4CJ0B 1STBA 4OIJA 2WKDA 5JVG3 3DXJC 5JEAG 3EROA 1JB3A 1O7ZA 1LT6D 2JSOA 3K59A 4DAYA 4RFBA 4K8JA 3H94A 3RZOB 1MBYA 1MSHA 3D4WA 2JE6I 1SYCA 5I2YA 3GV6A 1SYBA 3A55A 1I4PA 2PQEA 1TQOA 3BS1A 2HDLA 1PZID 4CJ1B 1S4ZA 4M8AA 3G7LA 1E2VA 3UI2A 5D3DA 1R4QB 4C1NK 2EOTA 4FYDA 3MA2B 2WACA 3M4OB 1TT2A 2FJ2A 4RA8A 2WP8J 1FNVA 2TMPA 2ICIA 2EY2A 1LTRD 1LTTD 3VR6A 5CV9A 1PXUA 4DFAA 1SJED 1SYFA 3KUPA 2LKVA 1SYGA 3S1QB 1STNA 5DM63 1QE6A 5C0XG 4N9PA 2F0JA 1H9MA 3BVZA 1EY7A 2F0UA 1CTMA 1XX8A 2Z1CA 5EPKA 2A73B 4KV6A 3SK5A 4C56C 1EY0A 3K57A 1LO5D 1U9RA 1M8AA 4KKSA 2F3VA 2KOLA 3S1NB 3D6CA 4C3HG 1PRTF 4FF1A 3DWPA 1EYCA 3LWUA 2JP1A 1LACA 3TDQA 5IGCA 5KYIA 5JEAH 5C44B 4DXFA 4R9WA 1HFNA 5C4ZA 3NTIA 4U68A 5C4HA 4KHZA 2L12A 2E2DC 2B2YA 2X69A 3MHBA 1OXVA 1D5MC 1NR4A 4N9TA 4FF3A 3H09A 1STHA 3DHQA 3M7GA 5T1GA 5FLXE 1I4HA 5EKIA 1CA5A 4C3JG 1PZKD 2XSCA 2A74C 2A6EC 2OT2A 1V8QA 2ENBA 2N55A 5CMDA 3J81E 1OXUA 2JYOA 2PZWA 1I4XA 5M5YB 4IFDJ 1TY2A 4MHEA 4BA2I 5EKKA 2K6AA 3R93A 4H0LC 3C2PA 1Q90A 3MC0B 1W6KA 4HMJA 5E3FA 2B2UC 1Q1EA 1I6HB 1SE3A 2A6HC 1TKWB 3TZDA 5COYA 1B9MA 1OXXK 1NAPA 4B9XA 1TS3A 2EY1A 2B2VA 2QF7A 1VMCA 2A68D 2ZXOA 1SBBB 3S1RB 2KEDA 4QUFA 1G2SA 5EQ0A 1R4PB 3GO5A 2EYJA 3O13A 3OMCA 3I4NB 4X3TA 4EQPA 5CC4A 4KMUC 4L8JA 2QEJC 1IKLA 2PCFB 4LJZC 1S5CD 4WORA 1PLFA 5IOCA 1GHJA 4XDXA 5A2QE 1HA5A 3SE0A 2IW3A 2NVYB 2OEOA 1KDAA 1MSGA 3GTPB 3LX0A 3EVQA 3BDCA 3T13A 5EPJA 2R3ZA 4FF4A 1PYWD 2F0KA 4ZKBB 1CI3M 1GUGA 3K5NA 1RJTA 5IGEA 2F1MA 2NVQB 3V96A 2B39A 1UAPA 2J0TD 4K6LA 2BDOA 4C1NI 1WCMB 3VYRA 2RSNA 5FK9C 4UDUC 1G91A 5IGBA 1GUSA 4OO1G 2BA1A 1NCVA 5C3WA 4G7HC 1PTOH 3GTLB 1Y1VB 2H1EA 1ILQA 1HCZA 2F0PA 1S5ED 1H9KA 1Y8PB 2PW5A 3T56B 4KTAA 1EIGA 4H7BA 3I8ZA 3FEWX 1NUCA 5FO7B 1H9SB 2FFKB 2E2IB 1SXTA 2KHSA 5I6YA 4BY1B 1CM9A 1SNQA 5CV6A 2PPBC 1WTRA 4G4KA 2WV6D 3HZXA 1B44D 3HS0C 1PRTC 2F0FA 3NTKA 1G291 2F0IA 1LTGD 1MGSA 4I65A 4RH6A 3M4YA 2B2TC 2OXPA 1ESFA 1ESRA 4IFDG 2KCNA 1CHPD 4RCOA 3U9OA 3MEHA 2K32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWB B;  5JPM C;  5FO7 B;  1JB3 A;  3G6J B;  2WII B;  4FXK C;  3KLS A;  2E2D C;  4ILW A;  4FXG C;  1GXD C;  1OO9 B;  2WIN B;  1BUV T;  5JPN C;  3CU7 A;  3L3O C;  3MA2 B;  1XWE A;  3I70 A;  2QKI C;  1D2B A;  2I07 B;  3HRZ C;  3OHX C;  2TMP A;  3FRP B;  3T4A C;  2A73 B;  2ICE C;  1BQQ T;  2XWJ B;  5FOB B;  5FO9 B;  1PXU A;  5FO8 B;  3V96 A;  3CKI B;  3HS0 C;  2B39 A;  1UAP A;  1UEA B;  2A74 C;  1JC7 A;  2J0T D;  1BR9 A; 
#chains in the Genus database with same CATH topology
 1SNM A;  4PZ6 A;  3HKZ G;  4F88 A;  3HFZ B;  5FLM G;  3IFD A;  2UXB L;  4X64 L;  5EBD A;  2E8G A;  3HRZ C;  3BVM A;  5C3X A;  4V19 0;  1V9P A;  1CFM A;  4IUT A;  2AUJ D;  2NVX H;  5C4X G;  2MJ8 A;  1STG A;  1O7Y A;  3I4M B;  1ENA A;  4OO1 H;  2EYL A;  2L1B A;  4BY7 H;  3BZK A;  1TS5 A;  1O7I A;  5IYB H;  1KDB A;  2FIN B;  2XRQ D;  4RGT A;  4X66 Q;  1PZJ D;  2MFI A;  2EDG A;  2SEB D;  5IGF A;  4A3I H;  1TXY A;  1K83 B;  1Z6H A;  4RG1 A;  2XWJ B;  4RGM A;  1KXL A;  4DR4 L;  5IGG A;  3AFP A;  1NY4 A;  1WYD A;  1JOR A;  3GTO H;  1H9J A;  4KY7 A;  3FKI B;  4JI3 Q;  3A56 A;  2I46 A;  1JWU D;  4WFN 3;  1QG7 A;  4B3R Q;  1DD2 A;  3J81 j;  3VR4 A;  3AFQ A;  3HEJ A;  1Q46 A;  4CJ2 C;  4XYO A;  2YYZ A;  1I4G A;  1N36 L;  3L9A X;  3GTQ H;  2L0C A;  1PTO B;  1L0Y B;  2PNH A;  3ULP A;  5IIF A;  3OSO A;  2CKZ B;  2D5D A;  2EE1 A;  4EGV A;  4UAI A;  5G3L F;  1K8M A;  1GD7 A;  4BBR G;  5IYD G;  1X56 A;  2F0M A;  4ILW A;  4OEM B;  3RMH A;  3S1M B;  4JK1 C;  1Y1W H;  1DXM A;  1YHA A;  2EY5 A;  4KHV A;  1FVI A;  3GTK B;  5IP7 G;  2LS0 1;  4LFA L;  3MFY A;  5CBE E;  4ULL A;  4DK1 A;  4A3L H;  4KY6 A;  2GVB A;  2WKC A;  3F2B A;  3NQT A;  1YNN D;  1F9P A;  3HOY G;  2E76 C;  4LF9 Q;  2A6H D;  1O7L A;  2NZO A;  4IPG A;  2KEE A;  1B4O A;  2G9H D;  3OWF A;  2K05 A;  4LUV A;  3H91 A;  4A75 A;  1TWF B;  5KNC A;  4A3M G;  1KHI A;  3HOV G;  3PUZ A;  2O4X A;  4BS9 A;  5C4X H;  1EYD A;  1TWC H;  4B3M Q;  1ZKO A;  1EY5 A;  2FXQ A;  1STE A;  1SAP A;  4DV1 L;  1BCP D;  3GTG B;  1N34 L;  5LMN L;  4A3G G;  2LFN A;  3PIO 3;  4A3F B;  4YWM A;  1F9S A;  1LT5 D;  1KNA A;  2UUA L;  3R2T A;  4DGZ A;  3PO3 B;  2ID0 A;  3FVQ A;  4PZ8 A;  5JPN C;  5BR8 L;  2EYP A;  4DV7 Q;  2K14 A;  1ZYR C;  4JV5 Q;  4PMC A;  2XRS D;  1C4Q A;  4ALP A;  4H44 C;  1Q7Y C;  4NKL A;  2LXJ A;  2L15 A;  1A2U A;  1TS2 A;  2HIV A;  1G2T A;  1HNX L;  4JBK A;  5C3E G;  1BR9 A;  2N78 A;  2NVX B;  4GZY C;  2Z6B A;  4IZ8 A;  1Q1B A;  2WB1 E;  4ME3 A;  2F0T A;  3UDI A;  1J6Q A;  5ELN A;  2MO1 A;  3U4V A;  1A63 A;  4Q0F A;  1RTO A;  3HOW H;  3U50 C;  2PI2 E;  1VQ4 A;  3BG3 A;  3KF8 A;  5CV7 A;  1RDP D;  4UPA A;  5C6A A;  1I3Q H;  3I4L A;  1II3 A;  5IOD A;  1AE2 A;  1VDZ A;  2IPK D;  4A3I B;  1AZQ A;  1QNK A;  3VR2 A;  1BCP F;  3PUV A;  4JBJ A;  3GV3 A;  3TBI B;  4XT3 B;  1JWS D;  3CRL C;  3KDF B;  1F2Z A;  3GTO B;  3RNU A;  1F2L A;  1F77 A;  2JA6 H;  5IP7 H;  3TP5 A;  1E2Z A;  3A7A B;  2UXD L;  3J80 E;  3PIP 3;  3TP7 A;  1WD0 A;  1PFN A;  4BWG B;  3K7U C;  4JG2 A;  1UE6 A;  3A74 A;  5TSS A;  1E22 A;  3M4P A;  4IUN A;  2F0W A;  1VQ5 A;  2G9D A;  1X3P A;  3GTQ B;  1YJN A;  3QO2 A;  1AZP A;  5IGD A;  2KCM A;  1QVG A;  2XNA C;  2IX1 A;  1TWA H;  4FXG C;  4PZ7 A;  2ZXR A;  2EYH A;  3N6R A;  2N8N A;  3B6Y A;  5K36 G;  1L0X B;  1OO9 B;  3NSW A;  4DR3 Q;  1DOL A;  2JA7 G;  1ET6 A;  2F0L A;  1Y1W B;  5M3M G;  3PCO B;  4CDD C;  1I50 H;  4KJO A;  1GM5 A;  3K6O A;  3I72 A;  1XXG A;  5E4X A;  1LT4 D;  2Q8R E;  1N33 Q;  3JAM E;  2WB1 G;  4DR4 Q;  3QWN A;  1K0S A;  3PGZ A;  1QIL A;  2R92 G;  2ALY B;  3PUX A;  1RKN A;  4ZQ3 A;  1SNP A;  4IFD I;  4RGO S;  4AIM A;  1PRT D;  5D3I B;  2NN6 I;  2E75 C;  3PSI A;  1IZ6 A;  2N88 A;  2E2H H;  4X62 Q;  2QKI C;  2RDF A;  2JA8 H;  2YTX A;  1R9T B;  3TN2 A;  2IWH A;  3BDL A;  1B3A A;  2XVS A;  3U4Z A;  4ZCK A;  1N36 Q;  1PFB A;  4ME5 A;  1X54 A;  3FP9 A;  1TWC B;  5KGU A;  3QG1 A;  4A3K G;  4JI4 L;  3PO2 G;  5M3F B;  4Z9C B;  2JA5 B;  2FHT A;  2J4X A;  1ONL A;  4J8Q A;  3VYT A;  4CDC C;  3I3C A;  3A54 A;  1L1O C;  3TRZ A;  1FR3 A;  4ZK9 B;  3BZC A;  1PA6 A;  4LMQ D;  1T5E A;  2F0Q A;  2D0O A;  5NUC A;  3X3M A;  4XYQ A;  2EIF A;  3T53 B;  2R7Z H;  3OOC A;  1SRO A;  1KDC A;  1WTO A;  2OQ0 A;  3S16 H;  4HJ8 A;  2MGS A;  4A3E H;  4NDX A;  4DNT B;  1KTK A;  3F2U A;  2K28 A;  4NP5 A;  5HGT A;  4EQO A;  5IT9 E;  3M9B A;  4XQJ A;  2RKS A;  2AQ2 B;  2GVA A;  1VMP A;  3K81 C;  4GNX A;  1QWY A;  1BBX C;  1IBL Q;  5JJL A;  1C7Y A;  1H9S A;  2RDH A;  2XGT A;  4JI0 L;  1SLJ A;  3C3L A;  5FO9 B;  5CBA E;  3PV0 A;  2RDG A;  1HXY D;  2XN9 C;  3PF5 A;  2K04 A;  5JPM C;  2K50 A;  1KRT A;  3CCS A;  2HCC A;  4LF5 Q;  2Y0S B;  4EQN A;  4DV1 Q;  4O0A A;  1EY9 A;  2MHV A;  3W1B A;  2Z0S A;  5IYC G;  1NBW A;  3GTJ H;  2WIN B;  1XMQ L;  4HJ7 A;  3AU7 A;  3RD4 A;  3I70 A;  2RVL A;  2B8G A;  1MJC A;  4K2K A;  5CV5 A;  1SNO A;  1KRS A;  4F7X A;  1Q8K A;  2UUA Q;  2CFM A;  1HZA A;  5BR8 Q;  1TS4 A;  1I6V C;  4A3J H;  2R92 H;  1XPU A;  3V2T A;  4JCV E;  4ZLT F;  2HQL A;  4A93 B;  4DU9 A;  1RD9 D;  5HGQ A;  2F0V A;  1C8C A;  5HY6 A;  3W3A A;  1N9W A;  5GAH C;  1VQ6 A;  1ZEQ X;  3T4A C;  1TWA B;  5GAD C;  4NXM L;  1H9R A;  1IBK Q;  1EZ6 A;  1JOO A;  4A3D H;  3I4M G;  2B2Y C;  4HID A;  2ZM6 L;  1FNU A;  4J6H A;  3D0F A;  2A8V A;  3MVV A;  2RA4 A;  4KK7 A;  4A3K H;  4QGU A;  5C0X H;  4K14 A;  1RL2 A;  1PMR A;  3D4R A;  3TME A;  2GA4 B;  1VQA A;  2H5X A;  4L5Q A;  3M7N A;  1AEX A;  1N32 Q;  2LMC B;  1YNN C;  5M5W H;  1TR5 A;  1STY A;  1Z9F A;  2E74 C;  4K2L A;  3NWS A;  3K80 C;  4FF2 A;  3MXN B;  3HOU G;  1VQK A;  1BDO A;  2VB3 X;  1VQ9 A;  3SK4 A;  1S3O A;  2UXD Q;  1PVO A;  2B63 B;  2E2H B;  2JA8 B;  4NB3 A;  5I6W A;  2R93 G;  1JE5 A;  2VL6 A;  1IL2 A;  2VUM H;  2Z9H A;  4PG3 A;  4X66 L;  3MZ5 A;  1JOQ A;  1LLR D;  1EFI D;  4C3H H;  4K5X A;  5J1Z A;  4CGY B;  3H0G G;  1FD7 D;  2RSO A;  4C3I G;  1BCP C;  4AQY L;  2K1B A;  2F3I A;  1SMY C;  2PW7 A;  1HPC A;  3M3Y H;  2R7D A;  3RLF A;  1SE4 A;  1QJO A;  4XQN A;  1CA6 A;  1EQV A;  4KHP L;  1ZYR D;  2F52 A;  3G71 A;  4IUP A;  1ENF A;  3E0E A;  4B3R L;  4S3S A;  1HR0 L;  3N52 A;  3BVG A;  4EX5 A;  5JOB A;  1E1O A;  3LGJ A;  4HIK A;  2R7Z B;  1UE5 A;  5LMU Q;  3S16 B;  1HTP A;  4GOP C;  4A3E B;  4P71 A;  1BO0 A;  2B2W A;  3R8B A;  3ER0 A;  4C3J H;  1NE3 A;  3RN2 A;  1XMO L;  3TS2 A;  2K7V A;  2HUG A;  1BVS A;  2B2V C;  3E9I A;  4X6A H;  3A8J E;  1BUV T;  4QIW E;  1K73 C;  2WAQ E;  3NWT A;  1VQI A;  2IX3 A;  1B2T A;  2CQO A;  1AH9 A;  3J7Y W;  5JJZ A;  3Q24 A;  3CU7 A;  2D9U A;  2FMM A;  4RHS A;  3QB3 A;  3OHX C;  1GJX A;  5J3B A;  3GTJ B;  2K5W A;  2SNS A;  1VS0 A;  2IHE A;  4K8I A;  1UNS A;  4PV1 C;  4ZYS A;  2AQ1 B;  2RCN A;  1LYL A;  4BXX G;  3VR3 A;  3HGB A;  2NYZ D;  1FGU A;  3OMG A;  1Q86 C;  2F0D A;  2J7Z A;  2MO0 A;  3BYT B;  4A3J B;  2IT1 A;  4B9W A;  1PFS A;  2F3W A;  3S9W A;  2EYM A;  4XTC S;  4JBW A;  4DF7 A;  2HD3 A;  4B3M L;  4JI7 L;  3RLN A;  1SEB D;  1VQF A;  1HFG A;  4LUO A;  5IY0 A;  3HP3 A;  4DK3 C;  1QUQ B;  4DV0 Q;  3MEF A;  5BN5 A;  1Q3L A;  2Z4H A;  3FPU B;  4A3D B;  2BA0 A;  3HOZ G;  1U5K A;  2HIX A;  3IAY A;  5ELC A;  4X65 L;  3S15 H;  2DN8 A;  4DR2 L;  4JV5 L;  2L11 A;  2PMZ B;  4Y7N H;  4OX9 Q;  5D65 A;  1DM0 B;  3CPF A;  2QA4 A;  1EIY B;  4YY3 L;  2IJ0 A;  5E1F A;  5M5W B;  3VA7 A;  2WAQ G;  1G6Z A;  1WFQ A;  1WTX A;  5KEE A;  1RF2 D;  1Y8N B;  5CV4 A;  4CHT B;  3GQB A;  1PFM A;  1PH8 A;  3S2H B;  4GKK Q;  4H13 C;  3KOJ A;  4O2D A;  3S17 H;  1IKM A;  1BXT A;  4R1J A;  2VUM B;  1PH2 A;  5DLQ E;  2F0O A;  3S14 B;  3KLS X;  5KRU A;  4ZUI A;  3KDF A;  3T16 A;  4HJ9 A;  4UHV A;  2ES2 A;  2NN6 G;  2VQE L;  1X65 A;  3M3Y B;  1QB5 D;  3NE5 B;  4KD4 A;  2E2J B;  4V0B A;  2K52 A;  1TU2 B;  5EAY A;  3SGI A;  4G57 A;  1EFW A;  4DR7 L;  1ML0 D;  1CKM A;  4TKO B;  1J5E L;  3H3V I;  1EOV A;  2ZJR A;  2EVB A;  1U4R A;  1P8L A;  1IHZ A;  4RGN A;  3IFT A;  4IPC A;  2EXZ A;  4IO9 A;  2IL8 A;  3LNN A;  2BDN A;  1XNQ Q;  2C35 B;  4HJA A;  4HMI A;  5G3L D;  1X3F A;  2ZJP A;  2YTY A;  2Y0S E;  3D4D A;  4IN3 A;  4DR3 L;  4RAU C;  2I0Q A;  2NVT H;  3VYS A;  2DJG C;  4IUV A;  3CME A;  2KJX A;  4HJ5 A;  4PQX A;  4HTH A;  4A3C G;  4JI6 L;  1F9R A;  2KHI A;  5CGK A;  1F9Q A;  1YNJ D;  1STA A;  3R2I A;  4JVZ A;  2B8F A;  1N33 L;  4A3B B;  2VS1 A;  5JEA J;  1HNZ L;  1RIP A;  3ITP A;  4OL7 A;  4AQY Q;  1HTL D;  4LK1 C;  3Q23 A;  1MJE A;  3FMC A;  3ERS X;  4YWK A;  4DV3 L;  1UUP A;  4HN7 A;  1EY8 A;  4K5W A;  4BBS H;  3S2D H;  1M90 C;  4KHP Q;  4X62 L;  5EKL A;  5EJW A;  2L5T A;  1MI2 A;  2DNC A;  2I5M X;  1HR0 Q;  2K01 A;  1NMG A;  3UDX A;  3NQI A;  5EPL A;  1WTQ A;  2PO4 A;  1RCV D;  3SK6 A;  3ERQ A;  4J15 A;  1A62 A;  3IRB A;  4OHJ A;  2H4O A;  2QDB A;  2NZ1 D;  3OYY A;  1XMO Q;  2CCZ A;  3CC4 A;  4KN4 C;  2F0N A;  3S24 A;  1U0L A;  2BH8 A;  3JAM L;  1X6O A;  2N49 A;  1BBU A;  1EYA A;  1W6J A;  4O1N A;  1DCZ A;  1AP0 A;  2MUY A;  4R8N A;  2JEA I;  3HOX B;  2OTJ A;  3TZU A;  5C44 G;  1D5Z C;  1X3E A;  1WTP A;  5CYU A;  4LF6 Q;  2HT1 A;  3S15 B;  4IFD H;  3E5S A;  4R4Q A;  1GUN A;  1D1K A;  1Q82 C;  2AKW B;  3V05 A;  1VQ7 A;  1SYE A;  4CKC A;  1TVX A;  1WTV A;  2XTI A;  2VZA A;  3P1H A;  4DAM A;  3CCE A;  2UU9 L;  1X3Q A;  1VQO A;  5C0X J;  1IW7 D;  1PDQ A;  1UWV A;  2HDM A;  4DPG A;  1PH6 A;  1B8A A;  1VQM A;  5GAG C;  3KBX A;  3MXU A;  1V1P B;  1EYG A;  1EUJ A;  3A8K E;  3NEL A;  1IBL L;  4R4I A;  4HED A;  2A5H A;  5FLM H;  3TS0 A;  1AFP A;  1JWM D;  3L3O C;  4I7Z C;  1JJ2 A;  5C4J H;  4IQZ A;  3EFX D;  1ILP A;  3S17 B;  3PF4 A;  5ELF A;  4FP5 D;  4JI7 Q;  4HSP A;  3TSS A;  1ICW A;  1V1Q A;  3GTM B;  1KAB A;  4LF5 L;  4A93 G;  3Q6S A;  2NTT A;  3FDT A;  1SMY D;  3M4O H;  4H02 A;  4KLK A;  1B1Z A;  1HQM C;  3ULL A;  1CHQ D;  1BF4 A;  2ATW A;  4WRD A;  4DK0 A;  2X6L A;  1GXD C;  1JOK A;  1U4L A;  3CCL A;  4OWX B;  1JIC A;  1VQL A;  4KJN A;  4DN4 M;  1JB7 A;  4X65 Q;  4JI8 Q;  5DEH A;  4DR2 Q;  4OXP A;  3S1Q H;  2VB2 X;  2K5V A;  2EZV A;  4JBM A;  2DJF C;  1JR0 D;  1P16 A;  5CV8 A;  1PRT B;  2L4N A;  4YY3 Q;  4JI5 Q;  2EJM A;  1I5F A;  3E6Z X;  1GUT A;  4DXG A;  2Q2T A;  2UUC Q;  1MD2 D;  4WJ3 M;  4KY5 A;  1ZXT A;  1IBK L;  1I4Q A;  5LMN W;  4TSS A;  4BY7 B;  1LTA D;  4A4I A;  2B63 G;  2NVT B;  5C5L A;  4QUC A;  2CQA A;  4DA2 A;  3DUZ A;  2K5H A;  1GUO A;  4K0K L;  5FO8 B;  2TSS A;  3R3O A;  3S1N H;  2PQA B;  4NPS A;  3W5O A;  3A5Z B;  4IUQ A;  1IYJ B;  1PTO D;  3W2D A;  5FLX L;  2F0S A;  4BBR H;  2BOS A;  5IYD H;  2X6G A;  1SND A;  3MXN A;  1O78 A;  1N32 L;  1SE2 A;  4UP8 A;  2VQE Q;  1QCB D;  4OGQ C;  4R4T A;  4HSV A;  2P5Z X;  4UP7 A;  1SR3 A;  3TP8 A;  4X3S A;  1EWI A;  1S5D D;  5FJ8 G;  1PYB A;  4HCS A;  4QJF A;  4BBS B;  3S2D B;  2RF4 A;  1CT1 D;  3K0Y A;  3KK7 A;  4TRD A;  4IOC A;  3J81 L;  1TWH H;  5FOB B;  2R7F A;  3HOY H;  4DR7 Q;  1LTB D;  3I4N G;  4KN7 C;  1J5E Q;  2NB0 A;  5J39 A;  4ODG A;  5H1S E;  4DV5 L;  1QOH A;  1ICF B;  2F0G A;  2CW0 D;  3W1G A;  1CZG A;  3UE0 A;  4A3M H;  4OIK A;  1A3T A;  3NP8 A;  3HOV H;  2Z6K A;  1KLG D;  2V4D A;  1YIT A;  3CXC A;  1EQR A;  4MIU A;  1D1I A;  3NK9 A;  3NBI A;  1PHJ A;  4UY8 C;  4LFB Q;  3X3N A;  2RBM A;  1VF5 C;  3PMF A;  3GD7 A;  4JI6 Q;  2MP1 A;  1XNR L;  4GKJ L;  3BDO A;  3VDY A;  4A3G H;  1ET9 A;  1CZW A;  5M9O A;  1PTO F;  2PZU A;  1HNZ Q;  2IY5 B;  2Q8I B;  1FNW A;  5IWA L;  2K75 A;  5LMU L;  2K5D A;  1E1T A;  3A5U A;  2KEC A;  1GOZ A;  1SNC A;  4DV3 Q;  3MFG A;  3G48 A;  5EBC A;  3HG9 A;  3BZD B;  3HKZ B;  4ID6 A;  4DAV A;  2YTV A;  1ASY A;  5C3E H;  5C4J B;  1WCM G;  3ND9 A;  3FPP A;  3M4Q A;  5EGT A;  1AW7 A;  2C9O A;  1E3P A;  5KNB A;  3Q0A A;  5C4X B;  4CBV A;  2I5H A;  5I9P A;  2YV5 A;  1TWG H;  1Y1V G;  4IAL A;  4Q5V A;  4LF7 L;  5F2D A;  4DUY Q;  5BN3 A;  5JVH 3;  4LW1 A;  4L63 B;  3J7Z C;  1LT3 D;  1SDF A;  1IYV A;  2IX0 A;  3TEH B;  2D2C C;  1VCI A;  3ND8 A;  4HAE A;  5D14 A;  1TII D;  5ELB A;  2BCO A;  2PZT A;  5A2Q L;  1NJI C;  5JJK A;  1XPR A;  2F4V L;  4BY1 G;  4FXK C;  1X3G A;  3E0J A;  2JEB I;  3QJY A;  5FJ8 H;  2G5D A;  3PUW A;  2UU9 Q;  3I55 A;  3S1R H;  2PNR C;  4E6I A;  4XXE A;  1QUQ A;  2K03 A;  1SYD A;  1HNW Q;  1IYU A;  2AMC B;  4NW2 A;  2WFW A;  4DV0 L;  2QGQ A;  5KYL A;  5I9O A;  3AMU A;  5E4W C;  3DEP A;  2F03 A;  4YHH L;  5JAV A;  4B3T Q;  3HOW B;  1AN8 A;  3CCM A;  3K0X A;  4JOI A;  1SSO A;  3G4S A;  2EYO A;  1I3Q B;  1TY0 A;  3F8T A;  3IL8 A;  4OX9 L;  2K33 A;  5K36 H;  1YNJ C;  4APV A;  4P2C B;  4MZ9 A;  3LWE A;  4BBR B;  4QCL A;  2JA7 H;  3MXP A;  4B08 A;  5M3M H;  3SVM A;  4QY7 A;  2JA6 B;  4DR1 Q;  1K8A C;  2I5L X;  4RKB A;  1C48 A;  3CKI B;  4O42 A;  4MN3 A;  1JC7 A;  1NMF A;  2D62 A;  4GNX C;  4GKK L;  2M00 A;  1FGB D;  3D6W A;  1TWH B;  1VQP A;  4QMG A;  3HOY B;  4XIG S;  3VYU A;  1B50 A;  5FKA C;  1KAA A;  2RQX A;  5M5X H;  1W3S A;  3CQZ H;  4ZAI A;  4FXD A;  2QIL A;  4OWW B;  1T5X D;  4DR5 L;  1WVL A;  2AWO A;  2A69 C;  2AUK A;  4IUU A;  4A3M B;  3CCU A;  2M9V A;  3HOV B;  2EXD A;  2L9H A;  5COR A;  2B2U A;  1FYC A;  5ELO A;  4WJW A;  3UE1 A;  1LV9 A;  2F0H A;  2PYK A;  5LL6 X;  2XWB B;  3MWY W;  1VQN A;  1XYI A;  4K0K Q;  4R4C A;  2IHF A;  3PO2 H;  1I50 B;  3WWV A;  3A7L A;  3H3V C;  2BE5 D;  3RZD H;  3SR1 A;  3NBH B;  4A3G B;  1N8R C;  2ZXP A;  1Q8I A;  3CP0 A;  3I4O A;  2JXM B;  1B9N A;  2FMC A;  1EU3 A;  1JE4 A;  3PUY A;  1IW7 C;  1XNQ L;  4FO2 A;  1EY4 A;  3FKI G;  1HQR D;  3CW2 C;  2Q2I A;  4LAA A;  1CKN B;  2UXC L;  5HUR A;  2L55 A;  1UEA B;  2EY6 A;  1QVC A;  4U67 3;  4RKL A;  3A0J A;  1NR2 A;  1C0A A;  1E0B A;  5C3E B;  1EWH A;  4X3K A;  3P20 A;  2Z8L A;  4DV5 Q;  4CKE A;  2VNU D;  3MTS A;  4GLX A;  1YI2 A;  1A2T A;  1PH1 A;  2HHH L;  4KKU A;  1K3B C;  4DKA C;  2CHB D;  2M2L A;  1TWG B;  2B29 A;  3L7Z C;  1DZ1 A;  1I4R A;  3QOL A;  3CCJ A;  3SEB A;  5E7N A;  1M4V A;  3CRK C;  3STB D;  2GN5 A;  3SXH A;  2VQF Q;  3H3V H;  3BU2 A;  1JJG A;  1YHB A;  2SOB A;  2WII B;  1XNR Q;  4GKJ Q;  5IYC H;  1CKO A;  1QVF A;  3SDZ A;  4MNO A;  2Q2U A;  5IWA Q;  4FNF A;  1QZH A;  4KI0 A;  2Q8T A;  4HR7 B;  4DAP A;  1D2B A;  1RHP A;  1XJV A;  1VQJ A;  3GDE A;  3D3R A;  5AFW A;  4DAY B;  2UUB L;  1KLU D;  3CCR A;  1IL8 A;  3MAQ A;  4JYA L;  3P75 A;  3CHB D;  5ELE A;  5I2X A;  3KJP A;  2QCP X;  1YJ9 A;  3EBE A;  3DEO A;  1J9O A;  3KLS A;  3I91 A;  3K7A H;  3G6E A;  2F4I A;  5DAU A;  2RCF A;  1LTI D;  4LF6 L;  3WOF A;  1PH9 A;  1LAB A;  1X55 A;  2YU9 H;  4I7A A;  3ZJY C;  1JMC A;  1HR0 W;  1KIX A;  1Z7T A;  5CR3 A;  1ENC A;  3NTH A;  3URY A;  1DYQ A;  4LF7 Q;  1PTO C;  4B3S L;  3I4M H;  1L1O B;  1CSQ A;  1E2W A;  2KEN A;  3KF6 B;  4G7Z C;  1V1P A;  2JA7 B;  1MKH A;  3PIO A;  4EQ5 A;  4LNQ A;  1GO3 E;  1Q81 C;  5M3M B;  1Y8O B;  4A3F G;  5DM7 3;  3NUC A;  4ZKC B;  5K5P A;  2KQ3 A;  2B2W C;  1GUW A;  2KVM A;  4PMB A;  3PO3 G;  1K83 H;  1YNX A;  2WB1 B;  3OIQ A;  2KHJ A;  2R92 B;  2F4V Q;  3HOU H;  1OTC A;  5M5X B;  2I07 B;  4DK6 C;  3FKI H;  3AQQ A;  3CQZ B;  4OEL B;  1LTL A;  2OWO A;  2K5Q A;  2R93 H;  2CW0 C;  3OIP A;  1UEB A;  4QB4 A;  1B53 A;  3D31 A;  1LUZ A;  1WTW A;  5L37 A;  3CD6 A;  2VXW A;  3IKJ A;  4FVM A;  4YCU A;  4YHH Q;  3EN2 A;  3DWQ A;  4CKB A;  1AE3 A;  4HCE A;  3ONA B;  1A3U A;  4ZUJ A;  3BYY B;  3DM1 A;  4XT1 B;  1A3V A;  2DY7 A;  2OQK A;  4JI8 L;  3H0G H;  1F2M A;  5IYB G;  4A76 A;  4YCV A;  4A3K B;  4C3I H;  4IOA A;  1NSN S;  3PO2 B;  1XWE A;  3KBG A;  1PH7 A;  3NEM A;  3CCV A;  3RZD B;  4A3I G;  2JN4 A;  2MPM A;  2ASB A;  2K5N A;  4UP9 A;  2EYF A;  4JI5 L;  3WOE A;  3JAM i;  2B2T A;  4L6T B;  3VR5 A;  2SNM A;  1B7Y B;  3T1Y L;  2UUC L;  3GTK H;  5A35 A;  4R4O A;  3G6J B;  1PH5 A;  1UE7 A;  2Z4I A;  4KKT A;  3CMA A;  2O2L D;  3DWA A;  3RR5 A;  2PQA A;  1Q12 A;  4R8I A;  3BJU A;  1CSP A;  1BNZ A;  1T9H A;  4F8M A;  4C3H B;  3FRP B;  2ICE C;  5C0X I;  4DV2 L;  4IJH A;  1I94 Q;  4C2M H;  4DR5 Q;  5KIX A;  1V1O A;  2XIW A;  1Z47 A;  3C46 A;  1L0W A;  4QQB X;  1F2Y A;  1EU4 A;  1VQB A;  5FLX c;  1YIJ A;  4XQQ A;  4NMZ A;  1Y1W G;  1ROD A;  1OXS C;  1YEZ A;  1D6E C;  3QIA A;  1Y69 U;  2AWN A;  1HHV A;  3I90 A;  1BKB A;  3M85 A;  3F1Z A;  4ABN A;  3WDN A;  3OW7 A;  1CQF A;  3H6M A;  4BXX H;  4PNY A;  4K5V A;  1DJR D;  3PO3 H;  3J81 c;  1VQD A;  4C3J B;  1JQY D;  2DUD A;  3RLO A;  2UXC Q;  1L2F A;  3EA6 A;  2NBF A;  2CWP A;  3KLR A;  1MIU A;  3UDG A;  3E9H A;  4N8X 1;  2OCE A;  3OWE B;  4LFB L;  3FHW A;  4G7O C;  2KCT A;  3K7A B;  2EPB A;  2NWG A;  1D5X C;  1BCP B;  1YBY A;  2HHH Q;  1HRJ A;  3J80 L;  3OTO L;  1EEF D;  4ZRZ A;  4DUZ L;  2YU9 B;  4F87 A;  1X32 A;  1HZC A;  3RN5 A;  2KCC A;  3HOZ H;  2KA7 A;  3TQY A;  2A1A A;  5M3F G;  2JA5 G;  4LF8 Q;  2SDF A;  4M1U B;  4POG A;  4IUR A;  1E24 A;  1S5B D;  1GHK A;  4P74 A;  5GRO A;  1SMX A;  2AHO B;  1KC8 C;  1KD1 C;  2EJG C;  4GOP B;  2DGY A;  3SK8 A;  1XPO A;  4P75 A;  4LWC A;  1SFO H;  1FJG L;  1E7Z A;  2VY3 A;  3HOU B;  1PH3 A;  3CAM A;  4WJ4 A;  2VW9 A;  4X3U A;  4AH6 A;  4GLV B;  2A69 D;  2HQE A;  1EWC A;  2UUB Q;  1EL0 A;  1QNU A;  1SJH D;  3D8G A;  1HUM A;  3T51 B;  4DUY L;  4JYA Q;  2R93 B;  3J81 i;  4RCN A;  5LL6 S;  5ELD A;  2A6E D;  3TP6 A;  2ZT9 C;  1PH4 A;  3AB9 A;  3CC2 A;  3ZYY X;  3P7J A;  3C1F A;  3K58 A;  3HOW G;  4QF4 A;  2EJF C;  3DMU A;  5IE8 A;  3KYH C;  3H0G B;  4L5R C;  3A8I E;  3I7F A;  4C3I B;  4JC0 A;  2NN6 H;  5GQO A;  4Y7N B;  3K5O A;  4AYB B;  2BE5 C;  3NHH A;  1LTS D;  5C5M A;  1DOK A;  4B3S Q;  4YCW A;  1KNE A;  2Y0S G;  4GS3 A;  2R6G A;  1K8O A;  3RZO H;  1HNW L;  2DY8 A;  1FL0 A;  4N8F A;  1S40 A;  1K3R A;  3OW2 A;  2JA6 G;  2F0E A;  1EY6 A;  4DV4 L;  1WI5 A;  4EVO A;  3J7A V;  4RMF A;  4B3T L;  2DNE A;  5T1I A;  4J1M A;  4BA1 I;  5ISR A;  1EQT A;  2LY7 A;  5LHY 1;  1KQS A;  2AQ3 B;  5J22 A;  1A15 A;  4C2M B;  2ZTD A;  2QEX A;  1D8L A;  3SHL A;  1R9T H;  4PMW A;  4A3C H;  3MXG A;  1CK1 A;  3STB C;  1O80 A;  4DR1 L;  4MTN A;  4OON A;  2CH4 W;  3EJI A;  1K0R A;  1BQQ T;  3I73 A;  1X9N A;  2N3S A;  4KD3 A;  1WD1 A;  5IT9 L;  2R61 A;  1BBW A;  4K6D A;  2E5L L;  3U9S A;  2NTS A;  5M3F H;  2JA5 H;  1J8I A;  1BOS A;  3J7A 5;  1CUK A;  2LXK A;  1CQV A;  5DNF A;  3I56 A;  1HUN A;  2A68 C;  3OPO A;  3Q22 A;  3T1Y Q;  2HCI A;  2JQO A;  5BN4 A;  1SN8 A;  1EZ8 A;  1IBM Q;  4JW0 A;  2O5J C;  1OXT A;  2O5I C;  3J7A F;  1VF7 A;  3PQI A;  2JA8 G;  1EOT A;  1XTD A;  3EQL C;  4JI2 Q;  3RUZ A;  1IXR A;  2CVR A;  1LM0 A;  3NBH A;  3K5M A;  1EEI D;  3I2Z A;  3K5L A;  5KND A;  1JCK B;  2OF1 A;  1EIH A;  4RHR A;  1VQE A;  3NPP A;  4DV2 Q;  1S72 A;  4TQU S;  1KAW A;  3HOZ B;  1JJC B;  2CWA A;  1CKN A;  2NUC A;  5C44 H;  1XTC D;  4DNR B;  2KUM A;  1U4P A;  3GP7 A;  1YVC A;  4OO1 I;  4LF4 Q;  3C1E A;  1G8Z D;  1DOM A;  3QOJ A;  1DON A;  4QIW B;  1S5F D;  2WAQ B;  1SFO B;  1K8G A;  2R7Z G;  1A0I A;  1U4M A;  1RTN A;  5I4D A;  3VA5 A;  2ZJQ A;  4CDE C;  2PMZ E;  4YIJ A;  4A3E G;  3F2D A;  4RWS C;  1HA6 A;  3CPW A;  1A6X A;  2C5C A;  2QDL A;  2VQF L;  3NXW A;  1V43 A;  4CJ0 B;  1STB A;  4OIJ A;  2UXB Q;  4X64 Q;  2LSS A;  2WKD A;  5JVG 3;  4A93 H;  3DXJ C;  5JEA G;  3ERO A;  3OTO Q;  4DUZ Q;  1JB3 A;  1H95 A;  2V1C C;  1O7Z A;  5M5Y H;  1LT6 D;  2JSO A;  3K59 A;  4DAY A;  4RFB A;  4K8J A;  1YHQ A;  1B70 B;  3H94 A;  3RZO B;  1MBY A;  1MSH A;  1SRU A;  3D4W A;  2JE6 I;  1SYC A;  5I2Y A;  3AEV A;  3GV6 A;  4POF A;  1SYB A;  3A55 A;  3DLL A;  5GAE C;  1I4P A;  2Z6K C;  2PQE A;  1TQO A;  3F2C A;  3BS1 A;  2HDL A;  1I6H H;  1PZI D;  2MNA A;  4A3J G;  1FJG Q;  4CJ1 B;  1S4Z A;  4M8A A;  3G7L A;  1L1O A;  1E2V A;  2OTL A;  1HJP A;  3KF6 A;  3UI2 A;  5D3D A;  1R4Q B;  3AYH B;  4C1N K;  2EOT A;  2B63 H;  4FYD A;  3MA2 B;  2WAC A;  3M4O B;  1GKH A;  1TT2 A;  2FJ2 A;  4RA8 A;  2WP8 J;  1FNV A;  2TMP A;  2ICI A;  1B3Q A;  2EY2 A;  1LTR D;  1LTT D;  2NZH A;  1KL9 A;  5CV9 A;  1PXU A;  3VR6 A;  4DFA A;  1ASZ A;  1SJE D;  4A3D G;  1SYF A;  3KUP A;  2LKV A;  1SYG A;  1JT8 A;  4P72 A;  3TRE A;  2QW7 A;  3S1Q B;  1STN A;  4DNI A;  5DM6 3;  2PI2 A;  1QE6 A;  5C0X G;  4N9P A;  2F0J A;  4DR6 L;  1H9M A;  4Y52 H;  3BVZ A;  4LUZ A;  1VQ8 A;  2RHQ B;  1EY7 A;  2F0U A;  1CTM A;  2ZTE A;  1XX8 A;  2Z1C A;  4L5S A;  5EPK A;  2A73 B;  3UDF A;  4KV6 A;  3SK5 A;  4C56 C;  3I4N H;  1G6P A;  1EY0 A;  3K57 A;  4DV4 Q;  4LFA Q;  1LO5 D;  4GN3 B;  1U9R A;  1M8A A;  4KKS A;  2MQH A;  2VUM G;  2F3V A;  2KOL A;  2D0P A;  3S1N B;  3D6C A;  1MHW C;  4C3H G;  1PRT F;  4FF1 A;  1QZG A;  1K9M C;  4JI1 L;  3DWP A;  4IJL A;  1EYC A;  3LWU A;  2NVY H;  2JP1 A;  1LAC A;  3GTP H;  3TDQ A;  5IGC A;  4L5T A;  5KYI A;  5JEA H;  4GN5 A;  5C44 B;  4DXF A;  4R9W A;  1Y14 B;  2RHS B;  1HFN A;  5C4Z A;  2KBN A;  3NTI A;  4QL5 A;  1UE1 A;  4U68 A;  4TVA B;  5C4H A;  4KHZ A;  2L12 A;  2E5L Q;  1A8V A;  1N34 Q;  2E2D C;  5LMN Q;  2NVQ H;  1PYS B;  2B2Y A;  4DV6 L;  2JK8 A;  2X69 A;  3MHB A;  1OXV A;  4JOI C;  1D7Q A;  1D5M C;  1I94 L;  1NR4 A;  4MTK A;  4N9T A;  5AJ3 L;  4FF3 A;  3H09 A;  1STH A;  3DHQ A;  4LFC L;  3M7G A;  4HIO A;  5T1G A;  5FLX E;  1I4H A;  5EKI A;  4AYB E;  1CA5 A;  4C3J G;  1WCM H;  4NXN L;  1PZK D;  2XSC A;  2A74 C;  2A6E C;  3GTL H;  3T1H L;  1Y1V H;  2OT2 A;  1V8Q A;  1HNX Q;  2ENB A;  2N55 A;  5CMD A;  3J81 E;  1OXU A;  2JYO A;  2PZW A;  1HZB A;  1I4X A;  5M5Y B;  4A3B G;  2CH4 A;  4IFD J;  1TY2 A;  4MHE A;  3CCQ A;  3Q8D A;  4BA2 I;  3E3X A;  5EKK A;  2K6A A;  3R93 A;  4H0L C;  3C2P A;  1Q90 A;  2E2I H;  3H15 A;  3MC0 B;  4GN4 B;  1W6K A;  4HMJ A;  4BY1 H;  3KF8 B;  5E3F A;  1PV4 A;  3KFU A;  3KLW A;  2B2U C;  1Q1E A;  1I6H B;  1W2B A;  1SE3 A;  1NNX A;  2A6H C;  2K4K A;  1TKW B;  3TZD A;  4IPD A;  5COY A;  3L2P A;  1B9M A;  1VQG A;  3S2H H;  1OXX K;  4LF8 L;  2JJQ A;  1NAP A;  4B9X A;  1TS3 A;  2JA9 A;  3J80 c;  3S14 H;  4GOP A;  1WOC A;  3HOX G;  3JC6 6;  3L0O A;  2EY1 A;  4FDB A;  2B2V A;  2QF7 A;  3U58 A;  4AYB G;  1VMC A;  2A68 D;  2ZXO A;  1SBB B;  3S1R B;  2KED A;  4JI3 L;  4QUF A;  1G2S A;  5EQ0 A;  1R4P B;  2E2J H;  3GO5 A;  1HZ9 A;  5IP9 G;  2EYJ A;  3O13 A;  3OMC A;  3I4N B;  4X3T A;  4EQP A;  5CC4 A;  1VQC A;  4KMU C;  4L8J A;  2QEJ C;  1IKL A;  2PCF B;  4LJZ C;  1DGS A;  1M1K C;  2A19 A;  1S5C D;  4WOR A;  1PLF A;  5JJI A;  5IOC A;  1GHJ A;  4XDX A;  5A2Q E;  3EIV A;  3NEN A;  1HA5 A;  1WJJ A;  3JAM c;  3SE0 A;  2IW3 A;  2NVY B;  2OEO A;  1KDA A;  3ICE A;  1MSG A;  2B3G A;  3GTP B;  3LX0 A;  3EVQ A;  3BDC A;  4P73 A;  3T13 A;  5EPJ A;  1G51 A;  2R3Z A;  3J80 i;  4FF4 A;  1PYW D;  3HKS A;  2F0K A;  4ZKB B;  4A3B H;  1CI3 M;  1GUG A;  3K5N A;  2ZTC A;  1RJT A;  5IGE A;  4JI4 Q;  2F1M A;  2NVQ B;  4DR6 Q;  1C9O A;  4LF9 L;  1GVP A;  3V96 A;  2B39 A;  1UAP A;  2J0T D;  4K6L A;  2BDO A;  4C1N I;  1WCM B;  3VYR A;  2RSN A;  5FK9 C;  4UDU C;  1G91 A;  5IGB A;  1GUS A;  4OO1 G;  3K8A A;  2BA1 A;  1NCV A;  4BY7 G;  5C3W A;  2BH2 A;  4G7H C;  1PTO H;  3GTL B;  4CDF C;  1Y1V B;  2H1E A;  1ILQ A;  1K28 A;  3HKZ E;  4YWL A;  1HCZ A;  1HH2 P;  2F0P A;  4IPH A;  1S5E D;  4JI1 Q;  1H9K A;  1Y8P B;  3CC7 A;  1EQQ A;  2PW5 A;  3T56 B;  4KTA A;  1EIG A;  4JI0 Q;  4H7B A;  3S1M H;  4GNX B;  3I8Z A;  3FEW X;  1NUC A;  5FO7 B;  1H9S B;  2FFK B;  5IT9 c;  1IBM L;  3PIP A;  3HOX H;  4JPB W;  4DV7 L;  2E2I B;  1SXT A;  2KHS A;  1YJW A;  4BBS G;  5I6Y A;  4BY1 B;  1CM9 A;  1SNQ A;  4HIM A;  2EQS A;  4JI2 L;  4OWT B;  5CV6 A;  2PPB C;  1WTR A;  4G4K A;  4DV6 Q;  1XMQ Q;  2WV6 D;  1SE8 A;  3ULJ A;  3HZX A;  5IP9 H;  1B44 D;  3HS0 C;  1PRT C;  5AJ3 Q;  2F0F A;  3NTK A;  1G29 1;  4LFC Q;  2F0I A;  1VQH A;  1LTG D;  1TWF H;  4NXN Q;  1MGS A;  4I65 A;  4RH6 A;  3M4Y A;  2B2T C;  2OXP A;  1ESF A;  1EIF A;  2Q2H A;  3T1H Q;  4GLA C;  4LF4 L;  1NTG A;  3GTM H;  1ESR A;  3GTG H;  4IFD G;  2KCN A;  3CF5 A;  1CHP D;  3DM3 A;  3QR8 A;  1YZ6 A;  3KJO A;  4A3L G;  4RCO A;  4NXM Q;  3U9O A;  4A3F H;  3MEH A;  1WTH A;  2K32 A;  2ZM6 Q; 
#chains in the Genus database with same CATH homology
 1SNM A;  4F88 A;  3IFD A;  5EBD A;  3HRZ C;  3BVM A;  5C3X A;  4V19 0;  1CFM A;  4IUT A;  2AUJ D;  2MJ8 A;  1STG A;  1O7Y A;  3I4M B;  1ENA A;  4OO1 H;  2EYL A;  2L1B A;  1TS5 A;  1KDB A;  2FIN B;  2XRQ D;  4RGT A;  1PZJ D;  2SEB D;  2EDG A;  5IGF A;  1K83 B;  1Z6H A;  2XWJ B;  4RGM A;  5IGG A;  1JOR A;  1H9J A;  4KY7 A;  3FKI B;  3A56 A;  2I46 A;  1JWU D;  4WFN 3;  1QG7 A;  1DD2 A;  3VR4 A;  3HEJ A;  4CJ2 C;  4XYO A;  2YYZ A;  1I4G A;  3L9A X;  2L0C A;  1PTO B;  1L0Y B;  5IIF A;  3OSO A;  2D5D A;  2EE1 A;  4EGV A;  4UAI A;  5G3L F;  1K8M A;  2F0M A;  4ILW A;  3RMH A;  3S1M B;  4JK1 C;  1DXM A;  2EY5 A;  4KHV A;  3GTK B;  2LS0 1;  3MFY A;  5CBE E;  4ULL A;  4DK1 A;  4KY6 A;  2WKC A;  3NQT A;  1YNN D;  1F9P A;  2E76 C;  2A6H D;  1O7L A;  2KEE A;  1B4O A;  2G9H D;  3OWF A;  2K05 A;  3H91 A;  1TWF B;  5KNC A;  3PUZ A;  2O4X A;  4BS9 A;  1EYD A;  1ZKO A;  1EY5 A;  1STE A;  1SAP A;  1BCP D;  3GTG B;  2LFN A;  3PIO 3;  4A3F B;  1F9S A;  1LT5 D;  1KNA A;  3R2T A;  4DGZ A;  3PO3 B;  2ID0 A;  3FVQ A;  5JPN C;  2EYP A;  1ZYR C;  4PMC A;  2XRS D;  1C4Q A;  4H44 C;  4NKL A;  1A2U A;  1TS2 A;  1G2T A;  1BR9 A;  2NVX B;  4GZY C;  4IZ8 A;  1Q1B A;  2F0T A;  4Q0F A;  1RTO A;  3BG3 A;  3KF8 A;  5CV7 A;  1RDP D;  5C6A A;  3I4L A;  5IOD A;  1II3 A;  1VDZ A;  2IPK D;  4A3I B;  1AZQ A;  1QNK A;  3VR2 A;  1BCP F;  3PUV A;  3GV3 A;  3TBI B;  4XT3 B;  1JWS D;  3CRL C;  1F2Z A;  3GTO B;  1F2L A;  1F77 A;  3TP5 A;  1E2Z A;  3A7A B;  3J80 E;  3PIP 3;  3TP7 A;  1WD0 A;  1PFN A;  4BWG B;  5TSS A;  4IUN A;  2F0W A;  2G9D A;  1X3P A;  3GTQ B;  3QO2 A;  1AZP A;  5IGD A;  2XNA C;  2IX1 A;  4FXG C;  2ZXR A;  2EYH A;  3N6R A;  5K36 G;  1L0X B;  1OO9 B;  3NSW A;  1DOL A;  1ET6 A;  2F0L A;  1Y1W B;  4KJO A;  3K6O A;  3I72 A;  1XXG A;  5E4X A;  1LT4 D;  2Q8R E;  3JAM E;  3QWN A;  1QIL A;  1RKN A;  3PUX A;  4ZQ3 A;  1SNP A;  4IFD I;  4RGO S;  1PRT D;  5D3I B;  2NN6 I;  2E75 C;  2N88 A;  2QKI C;  2RDF A;  1R9T B;  3TN2 A;  2IWH A;  3BDL A;  1B3A A;  2XVS A;  1PFB A;  4ME5 A;  1TWC B;  5KGU A;  3QG1 A;  5M3F B;  4Z9C B;  2JA5 B;  2FHT A;  2J4X A;  1ONL A;  4J8Q A;  3VYT A;  3I3C A;  3A54 A;  1FR3 A;  4ZK9 B;  4LMQ D;  1T5E A;  2F0Q A;  5NUC A;  3X3M A;  4XYQ A;  3T53 B;  3OOC A;  1KDC A;  1WTO A;  2MGS A;  4NDX A;  4DNT B;  1KTK A;  3F2U A;  2K28 A;  4NP5 A;  5HGT A;  4EQO A;  5IT9 E;  4XQJ A;  2RKS A;  2AQ2 B;  1VMP A;  1BBX C;  1QWY A;  1H9S A;  2RDH A;  3C3L A;  5FO9 B;  5CBA E;  3PV0 A;  2RDG A;  1HXY D;  2XN9 C;  2K04 A;  5JPM C;  2HCC A;  2Y0S B;  4EQN A;  1EY9 A;  2MHV A;  2WIN B;  3AU7 A;  3RD4 A;  3I70 A;  2RVL A;  2B8G A;  4K2K A;  5CV5 A;  1SNO A;  4F7X A;  1TS4 A;  1I6V C;  3V2T A;  4ZLT F;  4A93 B;  4DU9 A;  1RD9 D;  1C8C A;  2F0V A;  3W3A A;  1ZEQ X;  3T4A C;  1TWA B;  1H9R A;  1EZ6 A;  1JOO A;  2B2Y C;  1FNU A;  4J6H A;  3MVV A;  2RA4 A;  4KK7 A;  5C0X H;  4K14 A;  1PMR A;  3D4R A;  3TME A;  2GA4 B;  3M7N A;  1AEX A;  2LMC B;  1YNN C;  1TR5 A;  1STY A;  2E74 C;  4K2L A;  3NWS A;  4FF2 A;  1BDO A;  2VB3 X;  3SK4 A;  2B63 B;  2E2H B;  2JA8 B;  5I6W A;  3MZ5 A;  1JOQ A;  1LLR D;  1EFI D;  4K5X A;  5J1Z A;  4CGY B;  1FD7 D;  2RSO A;  4C3I G;  1BCP C;  2K1B A;  1SMY C;  2PW7 A;  1HPC A;  3RLF A;  1SE4 A;  1QJO A;  4XQN A;  1CA6 A;  1EQV A;  1ZYR D;  4IUP A;  1ENF A;  4S3S A;  3N52 A;  3BVG A;  5JOB A;  2R7Z B;  3S16 B;  1HTP A;  4A3E B;  1BO0 A;  2B2W A;  3R8B A;  2K7V A;  2HUG A;  2B2V C;  3A8J E;  1BUV T;  3NWT A;  2IX3 A;  1B2T A;  3J7Y W;  5JJZ A;  3Q24 A;  3CU7 A;  2D9U A;  2FMM A;  4RHS A;  3QB3 A;  3OHX C;  1GJX A;  3GTJ B;  2K5W A;  2SNS A;  4K8I A;  1UNS A;  4PV1 C;  4ZYS A;  2AQ1 B;  3VR3 A;  3HGB A;  2NYZ D;  3OMG A;  2F0D A;  2J7Z A;  3BYT B;  4A3J B;  2IT1 A;  4B9W A;  2F3W A;  3S9W A;  2EYM A;  4XTC S;  4JBW A;  4DF7 A;  1SEB D;  1HFG A;  3HP3 A;  5BN5 A;  1Q3L A;  2Z4H A;  3FPU B;  4A3D B;  2BA0 A;  3IAY A;  5ELC A;  2DN8 A;  2L11 A;  2PMZ B;  5D65 A;  1DM0 B;  2IJ0 A;  5E1F A;  5M5W B;  3VA7 A;  1G6Z A;  1WTX A;  5KEE A;  1RF2 D;  1Y8N B;  5CV4 A;  4CHT B;  3GQB A;  1PFM A;  3S2H B;  4H13 C;  1IKM A;  1BXT A;  2VUM B;  2F0O A;  3S14 B;  3KLS X;  5KRU A;  4ZUI A;  3T16 A;  2NN6 G;  3M3Y B;  1QB5 D;  3NE5 B;  4KD4 A;  2E2J B;  4V0B A;  1TU2 B;  4G57 A;  1ML0 D;  4TKO B;  2EVB A;  1U4R A;  1IHZ A;  4RGN A;  3IFT A;  2EXZ A;  2IL8 A;  3LNN A;  2BDN A;  4HMI A;  5G3L D;  3D4D A;  4IN3 A;  4RAU C;  3VYS A;  4IUV A;  2KJX A;  4PQX A;  4HTH A;  1F9R A;  5CGK A;  1F9Q A;  1YNJ D;  1STA A;  3R2I A;  2B8F A;  4A3B B;  5JEA J;  3ITP A;  4OL7 A;  1HTL D;  4LK1 C;  3Q23 A;  3FMC A;  1UUP A;  4HN7 A;  1EY8 A;  4K5W A;  5EKL A;  5EJW A;  2L5T A;  1MI2 A;  2DNC A;  2K01 A;  3NQI A;  5EPL A;  1WTQ A;  2PO4 A;  1RCV D;  3SK6 A;  3ERQ A;  4OHJ A;  2H4O A;  2QDB A;  2NZ1 D;  4KN4 C;  2F0N A;  3JAM L;  1EYA A;  1W6J A;  4O1N A;  1DCZ A;  1AP0 A;  2MUY A;  4R8N A;  2JEA I;  3HOX B;  3TZU A;  1WTP A;  1D5Z C;  3S15 B;  4IFD H;  5CYU A;  3E5S A;  1GUN A;  1D1K A;  3V05 A;  1SYE A;  4CKC A;  1TVX A;  1WTV A;  3P1H A;  1X3Q A;  5C0X J;  1IW7 D;  1PDQ A;  2HDM A;  3KBX A;  3MXU A;  1V1P B;  3A8K E;  4HED A;  2A5H A;  1AFP A;  1JWM D;  3L3O C;  4I7Z C;  4IQZ A;  3EFX D;  1ILP A;  3S17 B;  5ELF A;  4FP5 D;  4HSP A;  3TSS A;  1ICW A;  3GTM B;  1KAB A;  3Q6S A;  2NTT A;  3FDT A;  1SMY D;  1B1Z A;  1HQM C;  1CHQ D;  1BF4 A;  4WRD A;  4DK0 A;  2X6L A;  1GXD C;  1JOK A;  1U4L A;  1JIC A;  4KJN A;  4DN4 M;  5DEH A;  2VB2 X;  2EZV A;  1JR0 D;  5CV8 A;  1PRT B;  2L4N A;  2EJM A;  3E6Z X;  1GUT A;  4DXG A;  1MD2 D;  4KY5 A;  1ZXT A;  1I4Q A;  4TSS A;  4BY7 B;  1LTA D;  2NVT B;  5C5L A;  4QUC A;  2CQA A;  4DA2 A;  3DUZ A;  1GUO A;  5FO8 B;  2TSS A;  3R3O A;  4IUQ A;  1PTO D;  3W2D A;  5FLX L;  2F0S A;  2BOS A;  2X6G A;  1SND A;  3MXN A;  1O78 A;  1SE2 A;  1QCB D;  4OGQ C;  4HSV A;  3TP8 A;  4X3S A;  1S5D D;  4HCS A;  4BBS B;  3S2D B;  1CT1 D;  3K0Y A;  3KK7 A;  4TRD A;  3J81 L;  5FOB B;  1LTB D;  4KN7 C;  2NB0 A;  5J39 A;  4ODG A;  1QOH A;  2F0G A;  2CW0 D;  1CZG A;  4OIK A;  1A3T A;  3NP8 A;  1KLG D;  2V4D A;  4MIU A;  1D1I A;  3NK9 A;  3NBI A;  3X3N A;  2RBM A;  1VF5 C;  3PMF A;  3GD7 A;  2MP1 A;  3BDO A;  1ET9 A;  1CZW A;  5M9O A;  1PTO F;  2PZU A;  2Q8I B;  1FNW A;  2K5D A;  2KEC A;  1GOZ A;  1SNC A;  3MFG A;  5EBC A;  3HG9 A;  3BZD B;  3HKZ B;  4ID6 A;  4DAV A;  5C4J B;  3ND9 A;  3FPP A;  5EGT A;  1AW7 A;  2C9O A;  5KNB A;  3Q0A A;  5C4X B;  4CBV A;  5I9P A;  4IAL A;  4Q5V A;  5F2D A;  5BN3 A;  5JVH 3;  4L63 B;  1LT3 D;  1SDF A;  1IYV A;  2IX0 A;  2D2C C;  1VCI A;  3ND8 A;  4HAE A;  5D14 A;  1TII D;  5ELB A;  2BCO A;  2PZT A;  5A2Q L;  4FXK C;  3E0J A;  2JEB I;  3QJY A;  3PUW A;  2PNR C;  4E6I A;  4XXE A;  2K03 A;  1SYD A;  1IYU A;  4NW2 A;  5KYL A;  5I9O A;  3AMU A;  5E4W C;  3DEP A;  2F03 A;  5JAV A;  3HOW B;  1AN8 A;  1SSO A;  2EYO A;  1I3Q B;  1TY0 A;  3IL8 A;  2K33 A;  5K36 H;  1YNJ C;  4P2C B;  3LWE A;  4BBR B;  4QCL A;  3MXP A;  4B08 A;  3SVM A;  2JA6 B;  4RKB A;  1C48 A;  3CKI B;  4O42 A;  4MN3 A;  1JC7 A;  2D62 A;  2M00 A;  1FGB D;  3D6W A;  1TWH B;  4QMG A;  3HOY B;  4XIG S;  3VYU A;  1B50 A;  5FKA C;  1KAA A;  2RQX A;  4ZAI A;  4FXD A;  2QIL A;  1T5X D;  1WVL A;  2AWO A;  2A69 C;  2AUK A;  4IUU A;  4A3M B;  2M9V A;  3HOV B;  2L9H A;  5COR A;  2B2U A;  1FYC A;  4WJW A;  1LV9 A;  2F0H A;  2PYK A;  5LL6 X;  2XWB B;  3MWY W;  1XYI A;  1I50 B;  3A7L A;  3H3V C;  2BE5 D;  3SR1 A;  4A3G B;  2ZXP A;  1Q8I A;  2JXM B;  1B9N A;  2FMC A;  1EU3 A;  1JE4 A;  3PUY A;  1IW7 C;  4FO2 A;  1EY4 A;  1HQR D;  4LAA A;  5HUR A;  2L55 A;  1UEA B;  2EY6 A;  4U67 3;  4RKL A;  1NR2 A;  1E0B A;  5C3E B;  1EWH A;  4X3K A;  3P20 A;  2Z8L A;  4CKE A;  2VNU D;  3MTS A;  1A2T A;  4KKU A;  2CHB D;  2M2L A;  1TWG B;  3L7Z C;  1DZ1 A;  1I4R A;  3QOL A;  3SEB A;  1M4V A;  3CRK C;  3SXH A;  2SOB A;  2WII B;  3SDZ A;  4FNF A;  4KI0 A;  2Q8T A;  4HR7 B;  4DAP A;  1D2B A;  1RHP A;  3D3R A;  5AFW A;  1KLU D;  1IL8 A;  3MAQ A;  3P75 A;  3CHB D;  5ELE A;  5I2X A;  2QCP X;  3DEO A;  1J9O A;  3KLS A;  3I91 A;  2F4I A;  5DAU A;  1LTI D;  3WOF A;  1LAB A;  1Z7T A;  5CR3 A;  1ENC A;  3URY A;  3NTH A;  1DYQ A;  1PTO C;  1E2W A;  4G7Z C;  1V1P A;  2JA7 B;  5M3M B;  1Y8O B;  5DM7 3;  3NUC A;  4ZKC B;  5K5P A;  2KQ3 A;  2B2W C;  1GUW A;  2KVM A;  4PMB A;  2WB1 B;  3OIQ A;  2R92 B;  5M5X B;  2I07 B;  3CQZ B;  2K5Q A;  2CW0 C;  3OIP A;  4QB4 A;  1B53 A;  3D31 A;  1WTW A;  2VXW A;  3IKJ A;  4FVM A;  3DWQ A;  4CKB A;  4HCE A;  3ONA B;  1A3U A;  4ZUJ A;  3BYY B;  3DM1 A;  4XT1 B;  1A3V A;  2DY7 A;  1F2M A;  4A3K B;  1NSN S;  3PO2 B;  1XWE A;  3KBG A;  3RZD B;  2MPM A;  3WOE A;  2EYF A;  2B2T A;  4L6T B;  3VR5 A;  2SNM A;  5A35 A;  3G6J B;  2Z4I A;  4KKT A;  2O2L D;  3DWA A;  1Q12 A;  4R8I A;  1BNZ A;  4F8M A;  4C3H B;  3FRP B;  2ICE C;  5C0X I;  5KIX A;  1V1O A;  2XIW A;  1Z47 A;  3C46 A;  1F2Y A;  1EU4 A;  4XQQ A;  4NMZ A;  1ROD A;  1OXS C;  1D6E C;  3QIA A;  1Y69 U;  2AWN A;  1HHV A;  3I90 A;  3M85 A;  4ABN A;  3WDN A;  3OW7 A;  1CQF A;  3H6M A;  4PNY A;  4K5V A;  1DJR D;  4C3J B;  1JQY D;  3EA6 A;  2NBF A;  3KLR A;  3OWE B;  4G7O C;  3K7A B;  2EPB A;  2NWG A;  1D5X C;  1BCP B;  1HRJ A;  3J80 L;  2YU9 B;  1EEF D;  4ZRZ A;  4F87 A;  1X32 A;  2KCC A;  2KA7 A;  2SDF A;  4M1U B;  4IUR A;  1S5B D;  1GHK A;  2EJG C;  3SK8 A;  3HOU B;  4X3U A;  2A69 D;  2HQE A;  1EWC A;  1EL0 A;  1QNU A;  1SJH D;  3D8G A;  1HUM A;  3T51 B;  2R93 B;  4RCN A;  5LL6 S;  5ELD A;  2A6E D;  3TP6 A;  2ZT9 C;  3AB9 A;  3ZYY X;  3P7J A;  3C1F A;  3K58 A;  4QF4 A;  2EJF C;  3DMU A;  3H0G B;  3A8I E;  4C3I B;  4Y7N B;  2NN6 H;  3K5O A;  4AYB B;  2BE5 C;  3NHH A;  1LTS D;  5C5M A;  1DOK A;  1KNE A;  2R6G A;  1K8O A;  2DY8 A;  2F0E A;  1EY6 A;  3J7A V;  4EVO A;  2DNE A;  5T1I A;  4J1M A;  4BA1 I;  5ISR A;  1EQT A;  2LY7 A;  5LHY 1;  2AQ3 B;  5J22 A;  1A15 A;  4C2M B;  3SHL A;  4PMW A;  3MXG A;  1CK1 A;  1O80 A;  3EJI A;  1BQQ T;  3I73 A;  4KD3 A;  1WD1 A;  5IT9 L;  2R61 A;  4K6D A;  3U9S A;  2NTS A;  1J8I A;  1BOS A;  1CQV A;  5DNF A;  1HUN A;  2A68 C;  3OPO A;  3Q22 A;  2HCI A;  5BN4 A;  1EZ8 A;  2O5J C;  1OXT A;  2O5I C;  3J7A F;  1VF7 A;  1EOT A;  3EQL C;  3RUZ A;  2CVR A;  3NBH A;  3K5M A;  1EEI D;  3K5L A;  5KND A;  1JCK B;  2OF1 A;  1EIH A;  4RHR A;  3NPP A;  4TQU S;  3HOZ B;  2NUC A;  1XTC D;  4DNR B;  2KUM A;  1U4P A;  3GP7 A;  4OO1 I;  3C1E A;  1G8Z D;  1DOM A;  3QOJ A;  1DON A;  4QIW B;  1S5F D;  2WAQ B;  1SFO B;  1U4M A;  1RTN A;  5I4D A;  3VA5 A;  4YIJ A;  1HA6 A;  4RWS C;  1A6X A;  2C5C A;  3NXW A;  1V43 A;  4CJ0 B;  1STB A;  4OIJ A;  2WKD A;  5JVG 3;  3DXJ C;  5JEA G;  3ERO A;  1JB3 A;  1O7Z A;  1LT6 D;  2JSO A;  3K59 A;  4DAY A;  4RFB A;  4K8J A;  3H94 A;  3RZO B;  1MBY A;  1MSH A;  3D4W A;  2JE6 I;  1SYC A;  5I2Y A;  3GV6 A;  1SYB A;  3A55 A;  1I4P A;  2PQE A;  1TQO A;  3BS1 A;  2HDL A;  1PZI D;  4CJ1 B;  1S4Z A;  4M8A A;  3G7L A;  1E2V A;  3UI2 A;  5D3D A;  1R4Q B;  4C1N K;  2EOT A;  4FYD A;  3MA2 B;  2WAC A;  3M4O B;  1TT2 A;  2FJ2 A;  4RA8 A;  2WP8 J;  1FNV A;  2TMP A;  2ICI A;  2EY2 A;  1LTR D;  1LTT D;  3VR6 A;  5CV9 A;  1PXU A;  4DFA A;  1SJE D;  1SYF A;  3KUP A;  2LKV A;  1SYG A;  3S1Q B;  1STN A;  5DM6 3;  1QE6 A;  5C0X G;  4N9P A;  2F0J A;  1H9M A;  3BVZ A;  1EY7 A;  2F0U A;  1CTM A;  1XX8 A;  2Z1C A;  5EPK A;  2A73 B;  4KV6 A;  3SK5 A;  4C56 C;  1EY0 A;  3K57 A;  1LO5 D;  1U9R A;  1M8A A;  4KKS A;  2F3V A;  2KOL A;  3S1N B;  3D6C A;  4C3H G;  1PRT F;  4FF1 A;  3DWP A;  1EYC A;  3LWU A;  2JP1 A;  1LAC A;  3TDQ A;  5IGC A;  5KYI A;  5JEA H;  5C44 B;  4DXF A;  4R9W A;  1HFN A;  5C4Z A;  3NTI A;  4U68 A;  5C4H A;  4KHZ A;  2L12 A;  2E2D C;  2B2Y A;  2X69 A;  3MHB A;  1OXV A;  1D5M C;  1NR4 A;  4N9T A;  4FF3 A;  3H09 A;  1STH A;  3DHQ A;  3M7G A;  5T1G A;  5FLX E;  1I4H A;  5EKI A;  1CA5 A;  4C3J G;  1PZK D;  2XSC A;  2A74 C;  2A6E C;  2OT2 A;  1V8Q A;  2ENB A;  2N55 A;  5CMD A;  3J81 E;  1OXU A;  2JYO A;  2PZW A;  1I4X A;  5M5Y B;  4IFD J;  1TY2 A;  4MHE A;  4BA2 I;  5EKK A;  2K6A A;  3R93 A;  4H0L C;  3C2P A;  1Q90 A;  3MC0 B;  1W6K A;  4HMJ A;  5E3F A;  2B2U C;  1Q1E A;  1I6H B;  1SE3 A;  2A6H C;  1TKW B;  3TZD A;  5COY A;  1B9M A;  1OXX K;  1NAP A;  4B9X A;  1TS3 A;  2EY1 A;  2B2V A;  2QF7 A;  1VMC A;  2A68 D;  2ZXO A;  1SBB B;  3S1R B;  2KED A;  4QUF A;  1G2S A;  5EQ0 A;  1R4P B;  3GO5 A;  2EYJ A;  3O13 A;  3OMC A;  3I4N B;  4X3T A;  4EQP A;  5CC4 A;  4KMU C;  4L8J A;  2QEJ C;  1IKL A;  2PCF B;  4LJZ C;  1S5C D;  4WOR A;  1PLF A;  5IOC A;  1GHJ A;  4XDX A;  5A2Q E;  1HA5 A;  3SE0 A;  2IW3 A;  2NVY B;  2OEO A;  1KDA A;  1MSG A;  3GTP B;  3LX0 A;  3EVQ A;  3BDC A;  3T13 A;  5EPJ A;  2R3Z A;  4FF4 A;  1PYW D;  2F0K A;  4ZKB B;  1CI3 M;  1GUG A;  3K5N A;  1RJT A;  5IGE A;  2F1M A;  2NVQ B;  3V96 A;  2B39 A;  1UAP A;  2J0T D;  4K6L A;  2BDO A;  4C1N I;  1WCM B;  3VYR A;  2RSN A;  5FK9 C;  4UDU C;  1G91 A;  5IGB A;  1GUS A;  4OO1 G;  2BA1 A;  1NCV A;  5C3W A;  4G7H C;  1PTO H;  3GTL B;  1Y1V B;  2H1E A;  1ILQ A;  1HCZ A;  2F0P A;  1S5E D;  1H9K A;  1Y8P B;  2PW5 A;  3T56 B;  4KTA A;  1EIG A;  4H7B A;  3I8Z A;  3FEW X;  1NUC A;  5FO7 B;  1H9S B;  2FFK B;  2E2I B;  1SXT A;  2KHS A;  5I6Y A;  4BY1 B;  1CM9 A;  1SNQ A;  5CV6 A;  2PPB C;  1WTR A;  4G4K A;  2WV6 D;  3HZX A;  1B44 D;  3HS0 C;  1PRT C;  2F0F A;  3NTK A;  1G29 1;  2F0I A;  1LTG D;  1MGS A;  4I65 A;  4RH6 A;  3M4Y A;  2B2T C;  2OXP A;  1ESF A;  1ESR A;  4IFD G;  2KCN A;  1CHP D;  4RCO A;  3U9O A;  3MEH A;  2K32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...