2E2DC

Flexibility and variability of timp binding: x-ray structure of the complex between collagenase-3/mmp-13 and timp-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
180
Chain Sequence
b'CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEYLIAGKAEGNGNMHITLCDFIVPWDTLSATQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Matrix metallopeptidase 13
publication title Flexibility and Variability of TIMP Binding: X-ray Structure of the Complex Between Collagenase-3/MMP-13 and TIMP-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 43
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2006-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2e2dC02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 2e2dC01
5JPMC 1UEAB 2ICEC 2QKIC 5FO9B 3I70A 1OO9B 3V96A 5FO7B 2WIIB 3T4AC 1BR9A 1D2BA 3OHXC 1XWEA 1JB3A 2A74C 2J0TD 5JPNC 3G6JB 2XWBB 1JC7A 4FXKC 1UAPA 3KLSA 5FO8B 3CU7A 2TMPA 1GXDC 1PXUA 2I07B 3HRZC 4FXGC 1BUVT 3FRPB 1BQQT 2B39A 2E2DC 2XWJB 5FOBB 2WINB 3MA2B 2A73B 3HS0C 3CKIB 3L3OC 4ILWA
chains in the Genus database with same CATH superfamily
4MZ9A 1KLUD 3Q6SA 3BU2A 4TRDA 1QILA 3AYHB 1IYJB 1F9RA 2F03A 1O7ZA 4YY3L 1CSQA 3MXUA 5EKLA 1PH4A 3PO2H 4I65A 1JICA 4KY5A 3GTOH 2Z4HA 1H9MA 1SAPA 2A68C 1NR2A 1SNQA 1JE4A 1V1PA 4A76A 1QUQB 4DV1Q 2F4VQ 4LF6Q 3H0GH 2EQSA 3GTKB 4WJ3M 4A3FG 1BOSA 1WTVA 1VQGA 1HZBA 2EY2A 1W6JA 1B50A 5M5YH 1OXTA 1CZWA 2KENA 1U5KA 5IT9E 4A3DB 4GKKQ 2F0EA 4K14A 2F0GA 1LT5D 1LACA 5ELFA 3EIVA 1JWMD 1A3TA 2B63H 2RF4A 1RDPD 1S5CD 4A3EG 1X3EA 3V05A 4M1UB 3J7AV 3HOUB 2R93B 1VQCA 1X3QA 4O42A 2JA5G 1JQYD 4RGNA 1VQHA 1CKNA 4JYAQ 3S1MB 2F52A 3KBGA 4IUUA 3WWVA 2MFIA 1Q3LA 1TWGH 1W3SA 5JOBA 3I56A 5M3FH 1KTKA 4DU9A 1EQTA 1KD1C 1I94Q 1CA5A 4ZKCB 1K0SA 2BCOA 1N9WA 2PZUA 3HRZC 4HCEA 4JI2L 1E2ZA 4X62Q 3I4MH 1O78A 1Y1WH 4EQ5A 2A6EC 3PSIA 1G51A 2PQAB 5D3DA 4JC0A 1S5BD 3URYA 4FVMA 2EJFC 4LF5Q 4P75A 5CGKA 1AE2A 4A3BB 1J9OA 1ENCA 2JA9A 2JYOA 1PRTB 4YWMA 1NY4A 3HOVG 1NJIC 4NXNQ 2I07B 2SOBA 2WAQB 1XTCD 5IYBG 3FRPB 5LMUQ 2EYJA 1F2LA 1IL2A 1V9PA 3GQBA 4QY7A 4DR5Q 4KLKA 3CCRA 5KEEA 2OTJA 3CAMA 1SE4A 2F0SA 4PZ6A 2Z4IA 5J39A 1EQRA 5I9OA 5A35A 5IP7H 1FVIA 3D4WA 1T9HA 5JJIA 1BR9A 1D2BA 1XWEA 5K36G 4DUZL 4LF4L 2HHHQ 1QNKA 1EFWA 2XNAC 1S40A 5C0XJ 1M90C 3DEPA 5FLMH 4X64L 2LY7A 3BZDB 4L8JA 4RWSC 3SK5A 3PUWA 1XPUA 1SSOA 2L5TA 3HOXH 4GLXA 2CCZA 2I5MX 2QKIC 3BDOA 1XMQQ 1KC8C 4DAPA 4HCSA 1FJGQ 2LS01 4KD4A 1EYCA 1LTSD 4U68A 1W2BA 1UNSA 1H9SB 3L7ZC 4EVOA 3DWAA 3HOYH 1TY0A 1I6HB 3E9IA 1RIPA 1S72A 1PZKD 3LGJA 4XYOA 4YHHL 5FKAC 2A73B 1BF4A 1TKWB 3MEFA 1BCPC 2ID0A 4PMBA 2G9DA 2PI2A 5C4HA 4A3IH 2C5CA 4XYQA 1F2YA 1LTLA 2K03A 2IT1A 1VQNA 1I4GA 1X65A 5C0XG 4IUPA 2LSSA 2ZTEA 1TWFB 1PTOH 2CWPA 2QF7A 3NBHB 5FOBB 2OTLA 1X32A 3GP7A 2K4KA 4OEMB 3NELA 4B3RQ 4C2MB 2XGTA 2CWAA 1EOVA 2NVYB 1WCMG 5CR3A 2IHEA 4UP7A 2HDMA 2F0HA 1KXLA 2IX0A 4A3DG 1VDZA 5C4JB 4P74A 2D9UA 3B6YA 4ZRZA 1S4ZA 3TS2A 2NVQB 4DV2L 4UAIA 2ZJPA 3HOUG 2R93G 4FNFA 4JI8L 4DK3C 3W1GA 1G291 2VNUD 3MZ5A 1FD7D 1TS5A 2DNEA 3E9HA 3VYUA 1KLGD 5JEAH 3HOWH 1U4MA 4HTHA 2PMZB 5D65A 4WJWA 4DR1Q 3H3VI 4JBJA 2CW0C 5EKIA 3OMGA 4IFDG 1PFMA 4QF4A 1SMYC 2NVTH 2F3WA 4XDXA 2A69D 1WFQA 4PZ8A 1EY9A 4A3BG 4DXFA 4GOPA 1A15A 3PO3H 4LWCA 3K7AH 2M2LA 1T5XD 2BH2A 3UI2A 1EEFD 4DK6C 3NE5B 2F0LA 1LM0A 5FLXc 2WAQG 4GOPC 1ZEQX 5IYCH 1VQMA 2HUGA 4JI3Q 3CCUA 2VB2X 2E2DC 1WTPA 3S14H 4BY1B 3EVQA 1O7LA 4A3CH 1MHWC 5IYDH 3QJYA 4IUQA 1PFBA 3QWNA 5ELNA 5J1ZA 2QEJC 3ND9A 2K1BA 1F77A 2K33A 4C1NI 5CV5A 3KLRA 2O2LD 3BJUA 5C44G 1U4PA 4IUVA 3RNUA 1BBUA 5JJKA 2ZTCA 3FKIH 4IJHA 5E3FA 2UUAQ 5KIXA 4L63B 4YCWA 1FR3A 2HIXA 5I4DA 3PUVA 1XX8A 2JA6H 1EUJA 4ID6A 3OWEB 3M85A 1IKMA 5HGQA 4K6DA 1PLFA 1HR0L 2N3SA 3MC0B 4GKJL 4P73A 1QUQA 1TS2A 5JVH3 3HKZE 3PO2B 1PH9A 3GTOB 1V1PB 4DV3L 5EJWA 3GTLH 4TQUS 5IOCA 1CQVA 2VB3X 4IPGA 4A3JH 5BN5A 3HKSA 3U4VA 3K80C 5DM73 4R1JA 4TVAB 1EQVA 1MD2D 1OXUA 2JA7H 3H0GB 3P7JA 1SE2A 2HDLA 3W5OA 2Y0SB 4KY7A 1B53A 1KHIA 3SK6A 5M5YB 4MTNA 4RGMA 2OXPA 4CBVA 5FO9B 2X6LA 2LXKA 1EYDA 1EIHA 3R2TA 5BR8Q 1SNDA 3ULPA 2J0TD 2KCCA 2EY1A 1Z47A 4UHVA 2FMCA 2J4XA 1GD7A 2B63B 2RCNA 2MO0A 4C3JH 4DR2L 3KDFA 3J80L 4QUFA 3RZOB 3ER0A 4DV5L 3A7LA 4MN3A 1LTBD 3PF4A 1SE3A 4OO1G 4A4IA 1H9RA 1LTAD 1GJXA 1WOCA 1HR0W 4B3TQ 2L55A 3CCEA 4DA2A 2ZM6Q 4CKBA 1Q46A 4HJ8A 5M3FB 1TWGB 5H1SE 2PQAA 5F2DA 2K5DA 3I7FA 2B29A 3I4MB 4HMIA 1K28A 4CDCC 3NUCA 3J7A5 1Y8PB 4HMJA 3TZUA 4K6LA 3WOEA 4JI4L 2XSCA 1IHZA 1FGUA 1T5EA 3HS0C 2YYZA 3GDEA 1GUWA 2UUCQ 5I6WA 2HCCA 5KNBA 4L5SA 1PRTC 4TKOB 5IGDA 4YY3Q 2KCTA 1LTRD 2AHOB 4DV4L 3VR5A 1CTMA 1PXUA 5KNDA 4KHVA 3TBIB 2LXJA 2CKZB 3D4RA 1PH6A 2ZTDA 2EYHA 3WOFA 4C1NK 3H6MA 2N8NA 2MQHA 2NN6I 1E2VA 5CV9A 4JI7L 4DV0Q 2OQKA 4KHPL 4RGOS 1B44D 1EL0A 3D31A 3K5LA 3FHWA 1NUCA 3OMCA 2EXDA 3CCJA 4CKCA 3HOZH 3C2PA 3AFPA 4LW1A 4C3IG 4JK1C 1LT3D 1BKBA 4JPBW 3E3XA 4RKLA 2EYLA 1WTQA 1E3PA 2XRSD 4R4QA 1P16A 4BA2I 3H3VH 4AH6A 4A3KG 3RN5A 1ET6A 2XRQD 3GTMH 4BY1G 3HOXB 4LFBL 4GN3B 4ZKBB 2KECA 1AH9A 1U4LA 1HUNA 1VQ6A 2H4OA 4CJ0B 2OWOA 3EA6A 4F88A 3VA7A 4BXXG 1CQFA 3DXJC 3RZDH 2KCNA 1BCPB 4BBSH 2AQ2B 3HOYB 1N32Q 2F0IA 3HGBA 2RA4A 3U50C 4C3HB 3G71A 4BWGB 2EYFA 1YJWA 1XNQL 4JI2Q 1ZYRD 1EWHA 2MUYA 4O2DA 3E0JA 2F4IA 5IGCA 2D5DA 2D0PA 4CJ1B 1G8ZD 3SHLA 1FGBD 5JVG3 2R7ZH 1OXVA 2Z8LA 3AB9A 1L1OB 2PZTA 4R4TA 3PO2G 4YCVA 3A74A 3PCOB 1PYBA 2V1CC 4KKSA 2J7ZA 1IW7D 1PTOB 2F0JA 1VQKA 3H0GG 4NW2A 2BOSA 3AFQA 4Y52H 1LTGD 3OYYA 3OIPA 3S1QB 2K5NA 3MTSA 1II3A 5C4XH 1WTRA 3R3OA 3ERSX 4JI1L 1HFNA 4S3SA 1GUGA 5KGUA 1X3FA 1WTXA 1UUPA 4DUZQ 1HZAA 3K8AA 1CHQD 2EYPA 3KF6A 4LFCL 1Y69U 1IBLL 4LF4Q 2B63G 2K75A 3U9SA 1I50H 5HY6A 4CJ2C 1EY6A 1C4QA 1CUKA 3PMFA 3GD7A 1Q1BA 3P1HA 2KBNA 4MTKA 3X3NA 3R8BA 4CHTB 4X64Q 3ZYYX 1YHQA 1TWCH 3FMCA 1TQOA 3KF8B 3TEHB 3I3CA 4OGQC 1TWAH 2HIVA 5M3FG 1HJPA 1NNXA 4OIKA 2ZT9C 3S9WA 2IL8A 2KUMA 1CZGA 3HOWB 1E2WA 3GV3A 1NCVA 1B7YB 4X3KA 5M5XH 3I4NH 5KYLA 2QA4A 2M9VA 3NSWA 4FXGC 1I4QA 4KJNA 4YHHQ 2NVTB 4IALA 2E76C 3O13A 1JB7A 4GOPB 1PMRA 2UU9L 2F0UA 2LFNA 1EY5A 1VQ8A 2F0DA 5HURA 3K7AB 4PMWA 1F2MA 4MHEA 2WKDA 1SRUA 2K14A 4Z9CB 3SEBA 1N33L 2B2YA 1ZKOA 1KQSA 3A56A 3S14B 4DNTB 3EBEA 3FPUB 1ASYA 2B2YC 4X3UA 3S15H 3VA5A 2K50A 5DAUA 4JI5L 1DONA 3STBD 4G4KA 1SJHD 1TS4A 4ZQ3A 2K6AA 5CMDA 1PH1A 3J81i 5KNCA 4GZYC 4H44C 5IP7G 1YNJD 1H9JA 2EY5A 2JP1A 3PQIA 2SNMA 4ME3A 1KIXA 1IYVA 3ERQA 1JR0D 1SDFA 1BCPF 3S2HB 3RUZA 3FKIB 1SNOA 2JE6I 5C5LA 4RCOA 1SYDA 3T16A 1A3VA 5FLMG 2JA6B 4DV7L 4DV2Q 3IL8A 2C35B 2NN6H 1L2FA 2R92H 4HJ7A 1HFGA 3JAMc 4XT1B 4K8JA 3GTLB 1CKOA 1PV4A 3FP9A 1I3QH 4A3JB 4FF2A 4N8X1 1ILQA 5K5PA 1JB3A 1PA6A 4XIGS 3T53B 1YVCA 5A2QE 2E5LQ 3HOYG 2JA7B 1JC7A 1EOTA 3D0FA 4C3HG 2OQ0A 4C56C 3FVQA 1SYGA 4DAYA 4IOCA 3CC4A 2ZXOA 1NSNS 4IPCA 4E6IA 4H7BA 3CRLC 3J81E 2XWJB 5J22A 1VCIA 2X69A 2Z1CA 2PO4A 3VYSA 4QUCA 1WD0A 2EJMA 3F1ZA 3CXCA 1F9QA 3KBXA 1QOHA 1A6XA 3BZCA 3KDFB 3IRBA 4UPAA 4C3JB 3M3YH 4A3GH 2F0WA 2FINB 5E1FA 4GLVB 4FDBA 1Z9FA 3M9BA 4LFAL 3GTGB 3VR2A 1I4HA 4KK7A 4LK1C 4LUZA 2A6HD 4HJAA 1F2ZA 5BN4A 1QNUA 2EXZA 3BYTB 5M5WH 1HA5A 1STYA 3DM1A 2B8GA 1AEXA 4IPDA 5IT9c 3I90A 2IJ0A 5FJ8G 3Q8DA 2VS1A 4R8IA 4KTAA 2KEDA 1VF5C 1XPOA 5IWAL 1B70B 1WVLA 2KHIA 1AFPA 3U4ZA 1RODA 1HR0Q 2Q8TA 1HNWL 4GKJQ 1JJGA 1CHPD 3SVMA 1DXMA 3BZKA 3CCVA 1G2SA 1STBA 3M7GA 3IFDA 5JEAG 2AWNA 2SDFA 3KK7A 3HOWG 4MNOA 1UE6A 4A3LH 5IODA 4DV3Q 4V0BA 5D3IB 2N49A 1DOKA 5FLXL 5LMNL 4IUTA 2VZAA 5C3XA 2BE5C 3DM3A 1SMXA 2EIFA 2ES2A 2P5ZX 5IGBA 5C0XI 2KCMA 1A2TA 1KRSA 2Q8RE 3NWSA 3I73A 1JT8A 1PVOA 4A3MH 3ND8A 3HFZB 3L0OA 3W3AA 3RLOA 3T51B 5C3EH 3HOZB 1Q90A 1GUNA 1KNEA 1IBKQ 4UP9A 4ZCKA 4FXDA 4HJ9A 1S5FD 3HKZB 4LF8L 3C1FA 1N36L 3BDCA 5NUCA 2I0QA 5IYCG 1UE5A 3TN2A 3FDTA 2ATWA 2QEXA 4DR2Q 3GTMB 4DV5Q 1VQIA 1AW7A 4JI0L 2DN8A 4K2KA 1L0XB 4M8AA 1A62A 5E7NA 1I4PA 1PYSB 4Y7NH 1VQ5A 2Q2TA 3S17H 3RZDB 4I7ZC 3T1HL 1HUMA 3F2DA 4BBSB 2ASBA 1G6PA 1GKHA 1YHBA 4IQZA 5EPLA 3M4OH 2V4DA 5LMNW 1TXYA 5CBEE 4K8IA 4L5RC 3FKIG 1WJJA 4FXKC 1STNA 1UAPA 2EPBA 1TIID 4NP5A 3PIP3 2JA6G 3ITPA 1L1OA 5KRUA 2A19A 4JI4Q 2HQEA 2PNRC 4ODGA 1MIUA 1GHKA 2R7ZB 3M4QA 1HZ9A 1U0LA 4UP8A 1L1OC 3MVVA 3EFXD 3J81j 4IFDJ 3KLSX 2UXBL 2JA5H 4IFDI 1UE7A 1I4XA 1PTOC 4A3JG 2NZHA 4DV4Q 2JA7G 4OX9Q 1NR4A 4GN4B 1X3GA 5LL6S 4AQYQ 1ESFA 1VQ7A 3A5ZB 3T1YL 3MHBA 5EPKA 4DPGA 2LMCB 1AZQA 5AJ3L 2OF1A 3AU7A 5ELCA 1Q1EA 4N9PA 2KEEA 4BBRH 4JI7Q 2JEAI 5C4XB 1VS0A 3BS1A 4KHPQ 1LTID 3KF6B 1R4PB 4OXPA 3TP5A 1YIJA 1D6EC 3I72A 1IXRA 1Y8NB 2F0PA 4J8QA 1G6ZA 3K7UC 1XMOL 3G6EA 1I50B 2EDGA 3G6JB 3KF8A 3CPFA 3UE0A 4C3JG 4DR6L 1NAPA 1PRTF 3QIAA 1PHJA 1TWCB 3M4PA 1Z6HA 5IYBH 3DEOA 4K5WA 3PUZA 1HPCA 4LFBQ 5EBCA 1GHJA 4JI6L 2EJGC 2WFWA 2B3GA 1Q86C 1X6OA 1NE3A 5JJZA 3I4NB 1W6KA 4XTCS 3A8IE 4H13C 4R4OA 4JOIA 2PZWA 5K36H 3S2DH 1XNQQ 5CBAE 1PZJD 4JOIC 2BDNA 3KOJA 4N8FA 3MAQA 3OTOL 1EYAA 1YNND 2Q2HA 2L9HA 1PH7A 1RJTA 5EAYA 1MI2A 1GM5A 1SE8A 2Z9HA 2OT2A 2F0QA 2Z6KA 2XWBB 1IBML 4TSSA 2B2TA 2MJ8A 1MJEA 2Z6KC 3S15B 1EYGA 1SNPA 1KAWA 2GVBA 3TQYA 3NTKA 4EQOA 2R61A 5KYIA 2B2TC 2ZXPA 4GNXA 1JOKA 4B3ML 1I5FA 4OO1I 4P72A 2OCEA 2CQOA 3HOZG 2A68D 2XVSA 4IN3A 3V96A 1PYWD 2JK8A 2DJGC 3CPWA 3HKZG 4EQNA 2XN9C 1V8QA 4LFCQ 1KAAA 1IBLQ 3CU7A 1VQPA 1QE6A 1C8CA 1BUVT 1L0WA 3PV0A 5C0XH 4J6HA 2R92B 3S16H 3UDFA 1XJVA 3GTKH 4RFBA 3F2UA 1I3QB 4R8NA 1TS3A 4DAYB 2AUKA 3U58A 1WCMH 4UDUC 1HNZL 3Q24A 1LYLA 2QW7A 3J7AF 1SYFA 5M3MH 1HQMC 2TMPA 4RCNA 4ALPA 4A3DH 1CI3M 3CF5A 2VQFL 4DR4L 5CYUA 1CFMA 1MBYA 4G7OC 2F0KA 2VUMH 2MHVA 1HNXL 4A93H 1NMFA 2A5HA 1YEZA 3CKIB 4L6TB 1HQRD 2E74C 1R9TH 2R93H 2UU9Q 4DFAA 4ULLA 4B08A 4A3GB 3M3YB 3S1MH 3D3RA 3IAYA 4HN7A 2KVMA 3ICEA 2A6ED 1VQFA 1N33Q 5CC4A 3LWEA 1BVSA 3D8GA 3CD6A 1P8LA 3K5NA 1SJED 2F0TA 2F3IA 2JQOA 1Y1WB 1E24A 4BA1I 3JC66 4IUNA 2L1BA 3A8JE 4IURA 4JI5Q 1GUSA 2CH4W 4NKLA 4ME5A 4KJOA 5C4XG 5M5WB 2F3VA 5JPMC 1VQJA 4DAVA 1WTWA 1H95A 2JJQA 4NXML 2RBMA 3QO2A 3NP8A 4OWXB 5FO8B 1A0IA 1B2TA 1Y8OB 2L12A 2E2IH 5CV7A 4DV7Q 3OW2A 5GROA 5J3BA 4QIWE 3CMAA 3WDNA 2UXCL 1STAA 1QVCA 1PH3A 2NZ1D 5G3LF 4B3SL 2SNSA 4K0KL 3NEMA 3DLLA 4JV5L 3I4NG 3ONAB 3GTJH 3J80i 5IIFA 5DEHA 1FNVA 1G91A 2ZJRA 3PIO3 4GLAC 1BBWA 4QB4A 4FF3A 4H0LC 1VQDA 3NHHA 5C44H 2XIWA 4BS9A 1EIYB 4RMFA 2DY8A 1V1OA 2WB1E 4RG1A 1MSHA 2FXQA 1XYIA 5C3EB 1JE5A 3CCMA 3S1NH 2RHSB 4I7AA 3Q22A 1K9MC 5C3WA 4QL5A 1ET9A 2CQAA 3SK8A 3H3VC 3T4AC 5ELEA 3EQLC 1B1ZA 4DK0A 3AEVA 1LLRD 1DYQA 1L0YB 2K04A 5IP9H 1BCPD 4IPHA 1QB5D 4LFAQ 4Y7NB 3H15A 4X66L 3S17B 3JAML 4LUOA 2NYZD 3J80E 4MIUA 1LO5D 1Y1VH 3M4OB 4HSVA 3D6WA 4A3IB 4CDFC 1X56A 1OXSC 2K5QA 1A2UA 5EKKA 2B2VA 2MP1A 2A74C 2YU9H 4FF4A 4K5VA 1SNCA 5IWAQ 1IZ6A 4HSPA 4UY8C 1LT6D 3NENA 3E6ZX 1SYCA 1K0RA 2WV6D 3NTIA 4PZ7A 2D62A 3F2BA 4HIOA 2R92G 2TSSA 2Y0SG 1MJCA 5TSSA 2JSOA 2JA8H 4OO1H 1HNWQ 2F0FA 2NTTA 1Y14B 4AYBE 1ICWA 1SFOH 4C2MH 2NBFA 4LAAA 1VQ4A 2GN5A 4HAEA 1A8VA 5IE8A 3RMHA 5LMNQ 3I2ZA 4RA8A 5IGFA 1GO3E 2PW7A 1D5XC 2NB0A 2QILA 1K83H 4BBRB 1K8OA 2KJXA 4LUVA 2RDHA 4QQBX 4O0AA 3E0EA 3TP8A 1WI5A 3I55A 4G57A 3NPPA 1IYUA 5IT9L 2D0OA 4DR7L 4IOAA 2VXWA 3CHBD 5GAEC 3PIPA 5I9PA 3TDQA 3HP3A 4LF9L 2CW0D 3KLSA 4KHZA 3M4YA 4Q0FA 3I4MG 2VY3A 1SMYD 3J7YW 4R4IA 1Y1WG 1M1KC 1EFID 2UXDL 1STHA 1VF7A 1QZHA 1CA6A 2VQEL 4NB3A 4JI0Q 1X55A 3K57A 3M7NA 3Q23A 3BG3A 4FO2A 3CCQA 3A7AB 4OL7A 1EY8A 2ENBA 3QR8A 3CMEA 3T1HQ 1C48A 1FL0A 2OEOA 3PO3B 3K0YA 4P2CB 1IKLA 3S2DB 4J15A 2A69C 4C3IH 3CC7A 1WYDA 1SLJA 2E2JH 5AFWA 5M9OA 2GA4B 1I6VC 4A3KH 2E2HH 3GTQH 4PNYA 4BY1H 4B9WA 3JAME 2UXBQ 1CT1D 3F2CA 5GAHC 1A3UA 4DR3L 1DJRD 5DLQE 1HTLD 3UE1A 2CHBD 2DGYA 1M4VA 1SR3A 2WACA 3LWUA 4A75A 2YTXA 3QOLA 1CK1A 4GNXB 3T1YQ 2DJFC 3NBIA 2B2UA 5AJ3Q 5JAVA 1EY4A 4JCVE 5EQ0A 4LF7L 1CKMA 3MXGA 2O5IC 5C3EG 2UUCL 3HOXG 4HEDA 2N88A 3J7ZC 4JI8Q 3A54A 1VMPA 2B2UC 1V1QA 3ZJYC 2F0MA 1SYEA 4HIKA 5ELBA 3CQZH 4X3TA 3GTPH 2NVXH 5CV6A 3KFUA 4F87A 1UE1A 2FMMA 4IJLA 1XMOQ 2QCPX 4DR6Q 2PPBC 5JJLA 3H94A 1AE3A 2HQLA 5CV4A 1PTOF 3S16B 2K32A 2UUBL 3F8TA 3OOCA 3T13A 1JJ2A 4JI6Q 4U673 2JN4A 4DV0L 1U4RA 1WCMB 1NBWA 1U9RA 1ILPA 1LABA 2ICEC 2KQ3A 1N34L 4A3IG 4DF7A 1HHVA 2MNAA 4NDXA 5M3MB 5JEAJ 4QMGA 3SR1A 2BA1A 1SN8A 1Q8KA 1YBYA 3OPOA 4RKBA 4FF1A 2PI2E 1S5ED 2K28A 2X6GA 4KKTA 3VR6A 4HIDA 2VUMB 4A93B 5ISRA 1O80A 3S1RH 1R9TB 2Z6BA 3RZOH 3OTOQ 4WFN3 1K3RA 1EY7A 1YJ9A 4ZK9B 1TT2A 4JBMA 1EY0A 4EGVA 5DNFA 4B9XA 3T56B 3X3MA 1Q7YC 2I46A 2HCIA 1N32L 1O7IA 4H02A 1IBMQ 4YWKA 1DGSA 3SGIA 2O5JC 3MXNA 2A1AA 1YITA 3I8ZA 5C6AA 1PH8A 3J81c 1RF2D 5FK9C 4HJ5A 4BBRG 3MEHA 3CCSA 4WJ4A 4KN4C 1EEID 1PRTD 2KHJA 1E1OA 3FEWX 2I5LX 1ONLA 4B3MQ 1K3BC 2M00A 4POFA 3H91A 1SBBB 1J8IA 3H09A 3GO5A 3EJIA 5JPNC 3K5OA 2R7FA 2E2IB 3S24A 4CDDC 4YCUA 5T1GA 3EROA 3DWQA 3DWPA 5C4ZA 4BY7H 2EE1A 2PCFB 3DMUA 2RCFA 2L11A 1AP0A 3GTJB 4L5QA 3PGZA 3OIQA 1I4RA 2Q8IB 2L4NA 1RCVD 4QGUA 3PO3G 4LJZC 1HNZQ 1PFSA 1DOLA 3TMEA 1GVPA 2QGQA 4DUYL 1CSPA 2WIIB 1WTHA 5C44B 1Q8IA 5ELOA 2IHFA 4XQJA 1UWVA 2L0CA 3A5UA 3IFTA 2VQFQ 4DR4Q 2I5HA 2R6GA 4R9WA 4O1NA 5DM63 1ESRA 2ICIA 3S1NB 1B9NA 4A3CG 4J1MA 2R3ZA 5IYDG 5BN3A 1HNXQ 4RHRA 4NMZA 1PH5A 1EQQA 4A3FH 1TVXA 1EWIA 1D8LA 1KABA 3N52A 4OWWB 2R7DA 1XNRL 1IL8A 1AZPA 5GADC 1YJNA 1KDBA 2KHSA 1J5EL 4C3HH 1QVGA 1Z7TA 3K5MA 1SEBD 5T1IA 4AIMA 1K8AC 1Y1VB 2F0VA 2HD3A 4A3EH 3DUZA 1ZYRC 1JCKB 3DHQA 1RKNA 2C9OA 1K8MA 3PIOA 2YU9B 1QCBD 1GUTA 4X3SA 2G9HD 4NXMQ 3TZDA 4X65L 4FP5D 3G48A 4DV6L 3BVZA 3K0XA 3UDXA 1J6QA 2JA8B 1D7QA 3ULJA 4ZYSA 1B4OA 1IW7C 2AUJD 5EBDA 2EYOA 2UXCQ 1VQEA 3SXHA 1VMCA 1SFOB 4B3SQ 4K0KQ 4PV1C 1V43A 4HIMA 3I4LA 4JV5Q 1TWHH 3TREA 3UDIA 3QB3A 3S1QH 5IGGA 4GN5A 5M3MG 1HCZA 3C3LA 1K83B 3LNNA 5FJ8H 5FLXE 1XPRA 5LL6X 3KJPA 4DNRB 3HOVH 4KKUA 2VUMG 1ENAA 3P20A 4A93G 1BQQT 4DV1L 2F4VL 4LF6L 1JOOA 1JMCA 4R4CA 5I2XA 4OWTB 1FYCA 1TWAB 3MXPA 4QIWB 1NMGA 1QWYA 4ZAIA 5M5XB 3I70A 3N6RA 3BVMA 1BXTA 2E5LL 4RHSA 4V190 1F9SA 3P75A 1BO0A 1XTDA 1OTCA 1VQLA 3L9AX 1Q82C 4ZLTF 5IY0A 4KD3A 4GKKL 4DXGA 3LX0A 2O4XA 5E4WC 2RDGA 2ZXRA 2ZJQA 4X66Q 1E7ZA 4DGZA 5IGEA 5I6YA 2WB1B 1S3OA 4LNQA 4RAUC 1ML0D 5GQOA 1BBXC 4GS3A 4JYAL 1D1KA 2PW5A 3QOJA 1MKHA 5G3LD 4EX5A 4C3IB 2WAQE 2IWHA 1I94L 3D6CA 3CCLA 2E2JB 2NWGA 3RLFA 3PUYA 1R4QB 4X62L 2ALYB 1B9MA 4A3KB 3UDGA 1F9PA 2E2HB 2L15A 3GTQB 5LHY1 2CFMA 4PMCA 3NWTA 3KJOA 2FJ2A 4RGTA 4JG2A 2YTYA 4DKAC 1ASZA 1EZ8A 4LF5L 1JWSD 2B8FA 3STBC 4JI1Q 4HR7B 1A63A 4GNXC 3FPPA 1YNJC 2MPMA 1EU4A 1RTOA 5HGTA 3S2HH 2JA5B 4NXNL 1AN8A 1C0AA 3K59A 5LMUL 1RL2A 3ULLA 3L2PA 2RVLA 4DR5L 4DNIA 1KL9A 1ICFB 3KLWA 2RSOA 4G7HC 3CQZB 3GTPB 1UEAB 2K7VA 2NVXB 2WKCA 2IX3A 2BA0A 2PNHA 4JVZA 4KV6A 4APVA 4BBSG 1HRJA 1YNXA 4Q5VA 4AYBB 4DR7Q 1ENFA 1SROA 3KYHC 1Q81C 4LF9Q 5IP9G 2HHHL 3RR5A 1VQBA 3K81C 2K01A 2Q2IA 2JXMB 3CC2A 2UXDQ 3BYYB 5EGTA 2H1EA 3V2TA 3RN2A 2VQEQ 1BNZA 1Y1VG 3KUPA 1QJOA 4ILWA 2R7ZG 2EVBA 1DOMA 1TU2B 1VQAA 3HOUH 3OSOA 1JORA 3SE0A 2MGSA 2N78A 1IBKL 1OO9B 1XMQL 2IY5B 2Z0SA 1MSGA 3G4SA 1FJGL 1QZGA 1DD2A 1S5DD 3NXWA 2RQXA 4F7XA 1GXDC 3S1RB 3TS0A 1CKNB 3TRZA 2JA8G 5L37A 1STGA 1KRTA 1WTOA 2WINB 3GTGH 1HTPA 2NUCA 4YIJA 1E22A 3TSSA 1K8GA 4X6AH 1RHPA 4IFDH 4DR3Q 1FNWA 3MXNB 3CRKC 2DNCA 2KOLA 3PF5A 2K05A 2JEBI 2A6HC 4A3BH 3PUXA 1O7YA 2SEBD 5CORA 3E5SA 2KA7A 3U9OA 3TP7A 3A8KE 4LF7Q 4N9TA 1N8RC 4CDEC 3MA2B 2YTVA 4B3RL 3C46A 2NZOA 1EZ6A 1JWUD 2BE5D 2QDBA 2IW3A 1DZ1A 3VR4A 4XT3B 1GOZA 5E4XA 3R2IA 2PMZE 3C1EA 5COYA 4OX9L 1PZID 1RTNA 4BY7B 4G7ZC 2VL6A 4AQYL 2A8VA 3OWFA 2UUBQ 4IZ8A 1E0BA 3VR3A 4OIJA 2DY7A 1LTTD 1BDOA 2XTIA 1FNUA 4A3MB 4DN4M 2PYKA 4QCLA 1YHAA 3I91A 2WB1G 3L3OC 4JBKA 3HG9A 1QVFA 1STEA 4JBWA 1N34Q 2AQ3B 5FO7B 3EN2A 1JJCB 4WRDA 3W2DA 3MFYA 1DM0B 2LKVA 4KN7C 3D4DA 2EOTA 2RHQB 1RD9D 2EY6A 2IX1A 1XXGA 1VQ9A 2YV5A 5GAGC 1JOQA 1X9NA 1EIFA 2RSNA 4DR1L 1I6HH 4KMUC 4A3FB 1H9SA 1VQOA 3K58A 5D14A 1OXXK 2BDOA 4JW0A 4ZUJA 5C5MA 4IO9A 4PQXA 4WORA 1YI2A 4K5XA 1E1TA 1SYBA 4XQNA 1D5ZC 1YZ6A 1KNAA 5CV8A 1G2TA 4LMQD 1K73C 4A3EB 2NN6G 2B2VC 4DK1A 4JI3L 4OELB 2RKSA 2CVRA 2MO1A 1HXYD 1TWFH 4OONA 1PTOD 1CM9A 3NQIA 1KDCA 1H9KA 1PDQA 1PFNA 1X3PA 4K2LA 4QJFA 3RD4A 3W1BA 3VYTA 2VW9A 3SDZA 4FYDA 1SXTA 2AWOA 3CP0A 3TP6A 1KDAA 3NBHA 2AMCB 2IPKD 4OHJA 2NVYH 1HH2P 2RDFA 4AYBG 2WP8J 1C9OA 3MFGA 4EQPA 2Y0SE 2UUAL 3HEJA 1M8AA 2QDLA 5C4JH 1EU3A 1GUOA 2B2WA 5I2YA 2NVQH 1HA6A 2F1MA 2Q2UA 2EZVA 1TWHB 3J80c 4RH6A 3Q0AA 3IKJA 4YWLA 3GV6A 2B2WC 4P71A 5A2QL 1LV9A 1TR5A 1LT4D 3G7LA 4DUYQ 2HT1A 1B3QA 4A3GG 3JAMi 1WD1A 2BH8A 4LF8Q 3J81L 1N36Q 3HOVB 3HZXA 3VDYA 1TY2A 5EPJA 3AMUA 2PQEA 2F0OA 1X54A 4XXEA 2N55A 3BVGA 4XQQA 2F0NA 3RLNA 1C7YA 3VYRA 2FFKB 1XNRQ 2FHTA 3NQTA 3AQQA 5BR8L 1B3AA 2E8GA 4DAMA 1SNMA 3MWYW 4L5TA 4POGA 3I4OA 3R93A 2K5VA 1J5EQ 1MGSA 2NTSA 1ZXTA 1PH2A 2CH4A 2E75C 2K5WA 4ABNA 2B39A 1D1IA 3NTHA 1UEBA 2K52A 2EYMA 3BDLA 2K5HA 4CGYB 4ZUIA 4B3TL 4PG3A 2GVAA 4KY6A 1QG7A 2ZM6L 3OW7A 3A55A 4A3LG 3QG1A 1YNNC 2AKWB 2D2CC 4BXXH 2G5DA 3OHXC 4X65Q 1EIGA 3CW2C 4DV6Q 1DCZA 1B8AA 1D5MC 4BY7G 4F8MA 1LUZA 2DUDA 5ELDA 2AQ1B 3SK4A 4CKEA 1EWCA 2H5XA 4NPSA 3K6OA 4A3MG 3NK9A 3A0JA 4KI0A 1HZCA 1NTGA 1Q12A
chains in the Genus database with same CATH topology
1KLUD 3Q6SA 4TRDA 1QILA 1F9RA 2F03A 1O7ZA 3MXUA 5EKLA 4I65A 1JICA 4KY5A 2Z4HA 1H9MA 1SAPA 2A68C 1NR2A 1SNQA 1JE4A 1V1PA 3GTKB 1BOSA 1WTVA 2EY2A 1W6JA 1B50A 1OXTA 1CZWA 5IT9E 4A3DB 2F0EA 4K14A 2F0GA 1LT5D 1LACA 5ELFA 1JWMD 1A3TA 1RDPD 1S5CD 3V05A 4M1UB 3J7AV 3HOUB 2R93B 1X3QA 4O42A 1JQYD 4RGNA 3S1MB 3KBGA 4IUUA 5JOBA 1Q3LA 1KTKA 4DU9A 1EQTA 1CA5A 4ZKCB 2BCOA 2PZUA 3HRZC 4HCEA 1E2ZA 1O78A 2A6EC 5D3DA 1S5BD 3URYA 4FVMA 2EJFC 5CGKA 4A3BB 1J9OA 1ENCA 2JYOA 1PRTB 2I07B 2SOBA 2WAQB 1XTCD 3FRPB 2EYJA 1F2LA 3GQBA 5KEEA 1SE4A 2F0SA 2Z4IA 5J39A 5I9OA 5A35A 3D4WA 1BR9A 1D2BA 1XWEA 5K36G 1QNKA 2XNAC 5C0XJ 3DEPA 2LY7A 3BZDB 4L8JA 4RWSC 3SK5A 3PUWA 1SSOA 2L5TA 2QKIC 3BDOA 4DAPA 4HCSA 2LS01 4KD4A 1EYCA 1LTSD 4U68A 1UNSA 1H9SB 3L7ZC 4EVOA 3DWAA 1TY0A 1I6HB 1PZKD 4XYOA 5FKAC 2A73B 1BF4A 1TKWB 1BCPC 2ID0A 4PMBA 2G9DA 5C4HA 2C5CA 4XYQA 1F2YA 2K03A 2IT1A 1I4GA 5C0XG 4IUPA 1TWFB 1PTOH 2QF7A 5FOBB 1X32A 3GP7A 4C2MB 2NVYB 5CR3A 2HDMA 2F0HA 2IX0A 1VDZA 5C4JB 2D9UA 4ZRZA 1S4ZA 2NVQB 4UAIA 4FNFA 1G291 2VNUD 3MZ5A 1FD7D 1TS5A 2DNEA 3VYUA 1KLGD 5JEAH 1U4MA 4HTHA 2PMZB 5D65A 4WJWA 2CW0C 5EKIA 3OMGA 4IFDG 1PFMA 4QF4A 1SMYC 2F3WA 4XDXA 2A69D 1EY9A 4DXFA 1A15A 2M2LA 1T5XD 3UI2A 1EEFD 3NE5B 2F0LA 1ZEQX 2HUGA 2VB2X 2E2DC 1WTPA 4BY1B 3EVQA 1O7LA 3QJYA 4IUQA 1PFBA 3QWNA 5J1ZA 2QEJC 3ND9A 2K1BA 1F77A 2K33A 4C1NI 5CV5A 3KLRA 2O2LD 1U4PA 4IUVA 5E3FA 5KIXA 4L63B 1FR3A 5I4DA 3PUVA 1XX8A 4ID6A 3OWEB 3M85A 1IKMA 4K6DA 1PLFA 3MC0B 1TS2A 5JVH3 3PO2B 3GTOB 1V1PB 5EJWA 4TQUS 5IOCA 1CQVA 2VB3X 5BN5A 5DM73 1EQVA 1MD2D 1OXUA 3H0GB 3P7JA 1SE2A 2HDLA 2Y0SB 4KY7A 1B53A 3SK6A 5M5YB 4RGMA 2OXPA 4CBVA 5FO9B 2X6LA 1EYDA 1EIHA 3R2TA 1SNDA 2J0TD 2KCCA 2EY1A 1Z47A 2FMCA 2J4XA 2B63B 3J80L 4QUFA 3RZOB 3A7LA 4MN3A 1LTBD 1SE3A 4OO1G 1H9RA 1LTAD 1GJXA 2L55A 4DA2A 4CKBA 5M3FB 1TWGB 5F2DA 2K5DA 3I4MB 4HMIA 3NUCA 1Y8PB 4HMJA 3TZUA 4K6LA 3WOEA 2XSCA 1IHZA 1T5EA 3HS0C 2YYZA 1GUWA 5I6WA 2HCCA 5KNBA 1PRTC 4TKOB 5IGDA 1LTRD 3VR5A 1CTMA 1PXUA 5KNDA 4KHVA 3TBIB 3D4RA 2EYHA 3WOFA 4C1NK 3H6MA 2NN6I 1E2VA 5CV9A 4RGOS 1B44D 1EL0A 3D31A 3K5LA 1NUCA 3OMCA 4CKCA 3C2PA 4C3IG 4JK1C 1LT3D 4RKLA 2EYLA 1WTQA 2XRSD 4BA2I 1ET6A 2XRQD 3HOXB 4ZKBB 2KECA 1U4LA 1HUNA 2H4OA 4CJ0B 3EA6A 4F88A 3VA7A 1CQFA 3DXJC 2KCNA 1BCPB 2AQ2B 3HOYB 2F0IA 3HGBA 2RA4A 4C3HB 4BWGB 2EYFA 1ZYRD 1EWHA 2MUYA 3E0JA 2F4IA 5IGCA 2D5DA 4CJ1B 1G8ZD 3SHLA 1FGBD 5JVG3 1OXVA 2Z8LA 3AB9A 2PZTA 4KKSA 2J7ZA 1IW7D 1PTOB 2F0JA 4NW2A 2BOSA 1LTGD 3OIPA 3S1QB 3MTSA 1II3A 1WTRA 3R3OA 1HFNA 4S3SA 1GUGA 5KGUA 1WTXA 1UUPA 1Y69U 1CHQD 2EYPA 3U9SA 4CJ2C 1EY6A 1C4QA 3PMFA 3X3NA 3GD7A 1Q1BA 3P1HA 4CHTB 3R8BA 3ZYYX 3FMCA 1TQOA 3I3CA 4OGQC 4OIKA 3S9WA 2ZT9C 3HOWB 2IL8A 2KUMA 1CZGA 1E2WA 3GV3A 1NCVA 4X3KA 5KYLA 2M9VA 3NSWA 4FXGC 1I4QA 4KJNA 2NVTB 4IALA 2E76C 3O13A 1PMRA 2F0UA 2LFNA 1EY5A 2F0DA 5HURA 3K7AB 4PMWA 1F2MA 4MHEA 2WKDA 4Z9CB 3SEBA 2B2YA 1ZKOA 3A56A 3S14B 4DNTB 3FPUB 2B2YC 4X3UA 1DONA 3VA5A 5DAUA 4G4KA 1SJHD 1TS4A 4ZQ3A 2K6AA 5CMDA 5KNCA 4GZYC 4H44C 1YNJD 1H9JA 2EY5A 2JP1A 2SNMA 1IYVA 3ERQA 1JR0D 1SDFA 1BCPF 3S2HB 3RUZA 3FKIB 1SNOA 2JE6I 5C5LA 4RCOA 1SYDA 3T16A 1A3VA 2JA6B 3IL8A 2NN6H 1HFGA 4XT1B 4K8JA 3GTLB 4A3JB 4FF2A 1ILQA 5K5PA 1JB3A 4XIGS 3T53B 5A2QE 2JA7B 1JC7A 1EOTA 4C3HG 4C56C 3FVQA 1SYGA 4DAYA 2ZXOA 1NSNS 4E6IA 4H7BA 3CRLC 3J81E 2XWJB 5J22A 1VCIA 2X69A 2Z1CA 2PO4A 3VYSA 4QUCA 1WD0A 2EJMA 1F9QA 3KBXA 1QOHA 1A6XA 4C3JB 2F0WA 2FINB 5E1FA 3GTGB 3VR2A 1I4HA 4KK7A 4LK1C 2A6HD 1F2ZA 5BN4A 1QNUA 2EXZA 3BYTB 1HA5A 1STYA 3DM1A 2B8GA 1AEXA 3I90A 2IJ0A 4R8IA 4KTAA 2KEDA 1VF5C 1WVLA 1AFPA 1RODA 2Q8TA 1CHPD 3SVMA 1DXMA 1G2SA 1STBA 3M7GA 3IFDA 5JEAG 2AWNA 2SDFA 3KK7A 5IODA 4V0BA 5D3IB 5FLXL 1DOKA 4IUTA 5C3XA 2BE5C 5IGBA 5C0XI 1A2TA 2Q8RE 3NWSA 3I73A 3ND8A 3W3AA 3T51B 3HOZB 1Q90A 1GUNA 1KNEA 4FXDA 1S5FD 3HKZB 3C1FA 3BDCA 5NUCA 3TN2A 3FDTA 3GTMB 1AW7A 2DN8A 4K2KA 1L0XB 4M8AA 1I4PA 3RZDB 4I7ZC 1HUMA 4BBSB 5EPLA 4IQZA 2V4DA 5CBEE 4K8IA 4FXKC 1STNA 1UAPA 2EPBA 1TIID 4NP5A 3PIP3 3ITPA 5KRUA 2HQEA 2PNRC 4ODGA 1GHKA 2R7ZB 3MVVA 3EFXD 4IFDJ 3KLSX 4IFDI 1I4XA 1PTOC 1NR4A 5LL6S 1ESFA 3MHBA 5EPKA 2LMCB 1AZQA 2OF1A 3AU7A 5ELCA 1Q1EA 4N9PA 2KEEA 2JEAI 5C4XB 3BS1A 1LTID 1R4PB 3TP5A 1D6EC 3I72A 1Y8NB 2F0PA 4J8QA 1G6ZA 1I50B 2EDGA 3G6JB 3KF8A 4C3JG 1NAPA 1PRTF 3QIAA 1TWCB 1Z6HA 3DEOA 4K5WA 3PUZA 1HPCA 5EBCA 1GHJA 2EJGC 5JJZA 3I4NB 1W6KA 4XTCS 3A8IE 4H13C 2PZWA 5K36H 5CBAE 1PZJD 3MAQA 2BDNA 1EYAA 1YNND 2L9HA 1RJTA 1MI2A 2OT2A 2F0QA 2XWBB 4TSSA 2B2TA 2MJ8A 3S15B 1SNPA 3NTKA 4EQOA 2R61A 5KYIA 2B2TC 2ZXPA 1JOKA 4OO1I 2A68D 2XVSA 4IN3A 3V96A 1PYWD 4EQNA 2XN9C 1V8QA 1KAAA 3CU7A 1QE6A 1C8CA 1BUVT 3PV0A 5C0XH 4J6HA 2R92B 4RFBA 3F2UA 1I3QB 4R8NA 1TS3A 2AUKA 4UDUC 3Q24A 3J7AF 1SYFA 1HQMC 2TMPA 4RCNA 1CI3M 5CYUA 1CFMA 1MBYA 4G7OC 2F0KA 2MHVA 2A5HA 3CKIB 4L6TB 1HQRD 2E74C 4DFAA 4ULLA 4B08A 4A3GB 3M3YB 3D3RA 3IAYA 4HN7A 2KVMA 2A6ED 5CC4A 3LWEA 3D8GA 3K5NA 1SJED 2F0TA 1Y1WB 4BA1I 4IUNA 2L1BA 3A8JE 4IURA 1GUSA 4NKLA 4ME5A 4KJOA 5M5WB 2F3VA 5JPMC 4DAVA 1WTWA 2RBMA 3QO2A 3NP8A 5FO8B 1B2TA 1Y8OB 2L12A 5CV7A 3WDNA 1STAA 2NZ1D 5G3LF 2SNSA 3ONAB 5IIFA 5DEHA 1FNVA 1G91A 3PIO3 4QB4A 4FF3A 4H0LC 3NHHA 2XIWA 4BS9A 2DY8A 1V1OA 1MSHA 1XYIA 5C3EB 3Q22A 5C3WA 1ET9A 2CQAA 3SK8A 3H3VC 3T4AC 5ELEA 3EQLC 1B1ZA 4DK0A 1LLRD 1DYQA 1L0YB 2K04A 1BCPD 1QB5D 4Y7NB 3S17B 3JAML 2NYZD 3J80E 4MIUA 1LO5D 3M4OB 4HSVA 3D6WA 4A3IB 1OXSC 2K5QA 1A2UA 5EKKA 2B2VA 2MP1A 2A74C 4FF4A 4K5VA 1SNCA 4HSPA 1LT6D 3E6ZX 1SYCA 2WV6D 3NTIA 2D62A 2TSSA 5TSSA 2JSOA 4OO1H 2F0FA 2NTTA 1ICWA 2NBFA 4LAAA 4HAEA 3RMHA 4RA8A 5IGFA 2PW7A 1D5XC 2NB0A 2QILA 4BBRB 1K8OA 2KJXA 2RDHA 3TP8A 4G57A 3NPPA 1IYUA 5IT9L 2VXWA 3CHBD 5I9PA 3TDQA 3HP3A 2CW0D 3KLSA 4KHZA 3M4YA 4Q0FA 1SMYD 3J7YW 1EFID 1STHA 1VF7A 1CA6A 3K57A 3M7NA 3Q23A 3BG3A 4FO2A 3A7AB 4OL7A 1EY8A 2ENBA 1C48A 2OEOA 3PO3B 3K0YA 4P2CB 1IKLA 3S2DB 2A69C 5AFWA 5M9OA 2GA4B 1I6VC 4PNYA 4B9WA 3JAME 1CT1D 1A3UA 1DJRD 1HTLD 2CHBD 1M4VA 2WACA 3LWUA 3QOLA 1CK1A 3NBIA 2B2UA 5JAVA 1EY4A 5EQ0A 3MXGA 2O5IC 4HEDA 2N88A 3A54A 1VMPA 2B2UC 2F0MA 1SYEA 5ELBA 4X3TA 5CV6A 4F87A 2FMMA 2QCPX 2PPBC 3H94A 5CV4A 1PTOF 3S16B 2K32A 3OOCA 3T13A 4U673 1U4RA 1WCMB 1U9RA 1ILPA 1LABA 2ICEC 2KQ3A 4DF7A 1HHVA 4NDXA 5M3MB 5JEAJ 4QMGA 3SR1A 2BA1A 4RKBA 3OPOA 4FF1A 1S5ED 2K28A 2X6GA 4KKTA 3VR6A 2VUMB 4A93B 5ISRA 1O80A 1R9TB 4WFN3 1EY7A 4ZK9B 1TT2A 1EY0A 4EGVA 5DNFA 4B9XA 3T56B 3X3MA 2I46A 2HCIA 2O5JC 3MXNA 3I8ZA 5C6AA 1RF2D 5FK9C 3MEHA 4KN4C 1EEID 1PRTD 3FEWX 1ONLA 2M00A 3H91A 1SBBB 1J8IA 3H09A 3GO5A 3EJIA 5JPNC 3K5OA 2E2IB 5T1GA 3EROA 3DWQA 3DWPA 5C4ZA 2EE1A 2PCFB 3DMUA 2L11A 1AP0A 3GTJB 3OIQA 1I4RA 2Q8IB 2L4NA 1RCVD 4LJZC 1DOLA 3TMEA 2WIIB 5C44B 1Q8IA 4XQJA 2L0CA 3IFTA 2R6GA 4R9WA 4O1NA 5DM63 1ESRA 2ICIA 3S1NB 1B9NA 4J1MA 2R3ZA 5BN3A 4RHRA 4NMZA 1TVXA 1KABA 3N52A 1IL8A 1AZPA 1KDBA 2KHSA 1Z7TA 3K5MA 1SEBD 5T1IA 1Y1VB 2F0VA 3DUZA 1ZYRC 1JCKB 3DHQA 1RKNA 2C9OA 1K8MA 2YU9B 1QCBD 1GUTA 4X3SA 2G9HD 3TZDA 4FP5D 3BVZA 2JA8B 4ZYSA 1B4OA 1IW7C 2AUJD 5EBDA 2EYOA 3SXHA 1VMCA 1SFOB 4PV1C 1V43A 3I4LA 3QB3A 5IGGA 1HCZA 3C3LA 1K83B 3LNNA 5FLXE 5LL6X 4DNRB 4KKUA 1ENAA 3P20A 1BQQT 1JOOA 5I2XA 1FYCA 1TWAB 3MXPA 4QIWB 1QWYA 4ZAIA 5M5XB 3I70A 3N6RA 3BVMA 1BXTA 4RHSA 4V190 1F9SA 3P75A 1BO0A 3L9AX 4ZLTF 4KD3A 4DXGA 3LX0A 2O4XA 5E4WC 2RDGA 2ZXRA 4DGZA 5IGEA 5I6YA 2WB1B 4RAUC 1ML0D 1BBXC 1D1KA 2PW5A 3QOJA 5G3LD 4C3IB 2IWHA 3D6CA 2E2JB 2NWGA 3RLFA 3PUYA 1R4QB 1B9MA 4A3KB 1F9PA 2E2HB 3GTQB 5LHY1 4PMCA 3NWTA 2FJ2A 4RGTA 1EZ8A 1JWSD 2B8FA 4HR7B 3FPPA 1YNJC 2MPMA 1EU4A 1RTOA 5HGTA 1AN8A 3K59A 2RVLA 2RSOA 4G7HC 3CQZB 3GTPB 1UEAB 2K7VA 2NVXB 2WKCA 2IX3A 2BA0A 4KV6A 1HRJA 4Q5VA 4AYBB 1ENFA 2K01A 2JXMB 3BYYB 5EGTA 2H1EA 3V2TA 1BNZA 3KUPA 1QJOA 4ILWA 2EVBA 1DOMA 1TU2B 3OSOA 1JORA 3SE0A 2MGSA 1OO9B 1MSGA 1DD2A 1S5DD 3NXWA 2RQXA 4F7XA 1GXDC 3S1RB 1STGA 1WTOA 2WINB 1HTPA 2NUCA 4YIJA 3TSSA 1RHPA 4IFDH 1FNWA 3CRKC 2DNCA 2KOLA 2K05A 2JEBI 2A6HC 3PUXA 1O7YA 2SEBD 5CORA 3E5SA 2KA7A 3U9OA 3TP7A 3A8KE 4N9TA 3MA2B 3C46A 1EZ6A 1JWUD 2BE5D 2QDBA 2IW3A 1DZ1A 3VR4A 4XT3B 1GOZA 5E4XA 3R2IA 3C1EA 5COYA 1PZID 1RTNA 4BY7B 4G7ZC 3OWFA 4IZ8A 1E0BA 3VR3A 4OIJA 2DY7A 1LTTD 1BDOA 1FNUA 4A3MB 4DN4M 2PYKA 4QCLA 3I91A 3L3OC 3HG9A 1STEA 4JBWA 2AQ3B 5FO7B 4WRDA 3W2DA 3MFYA 1DM0B 2LKVA 4KN7C 3D4DA 2EOTA 1RD9D 2EY6A 2IX1A 1XXGA 1JOQA 2RSNA 4KMUC 4A3FB 1H9SA 3K58A 5D14A 1OXXK 2BDOA 4ZUJA 5C5MA 4PQXA 4WORA 4K5XA 1SYBA 4XQNA 1D5ZC 1KNAA 5CV8A 1G2TA 4LMQD 4A3EB 2NN6G 2B2VC 4DK1A 2RKSA 2CVRA 1HXYD 1PTOD 1CM9A 1PFNA 1KDCA 1H9KA 1PDQA 1X3PA 3NQIA 4K2LA 3RD4A 4FYDA 2JA5B 3VYTA 3SDZA 1SXTA 2AWOA 3TP6A 1KDAA 3NBHA 2IPKD 4OHJA 2RDFA 2WP8J 3MFGA 4EQPA 3HEJA 1M8AA 1EU3A 1GUOA 2B2WA 5I2YA 1HA6A 2F1MA 2EZVA 1TWHB 4RH6A 3Q0AA 3IKJA 3GV6A 2B2WC 5A2QL 1LV9A 1TR5A 1LT4D 3G7LA 1WD1A 3J81L 3HOVB 3HZXA 1TY2A 5EPJA 3AMUA 2PQEA 2F0OA 4XXEA 2N55A 3BVGA 4XQQA 2F0NA 3VYRA 2FFKB 2FHTA 3NQTA 1B3AA 1SNMA 3MWYW 3R93A 1MGSA 2NTSA 1ZXTA 2E75C 2K5WA 4ABNA 2B39A 1D1IA 3NTHA 2EYMA 3BDLA 4CGYB 4ZUIA 4KY6A 1QG7A 3OW7A 3A55A 3QG1A 1YNNC 2D2CC 3OHXC 1EIGA 1DCZA 1D5MC 4F8MA 5ELDA 2AQ1B 3SK4A 4CKEA 1EWCA 3K6OA 3NK9A 4KI0A 1Q12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPM C;  1UEA B;  2ICE C;  2QKI C;  5FO9 B;  3I70 A;  1OO9 B;  3V96 A;  5FO7 B;  2WII B;  3T4A C;  1BR9 A;  1D2B A;  3OHX C;  1XWE A;  1JB3 A;  2A74 C;  2J0T D;  5JPN C;  3G6J B;  2XWB B;  1JC7 A;  4FXK C;  1UAP A;  3KLS A;  5FO8 B;  3CU7 A;  2TMP A;  1GXD C;  1PXU A;  2I07 B;  3HRZ C;  4FXG C;  1BUV T;  3FRP B;  1BQQ T;  2B39 A;  2E2D C;  2XWJ B;  5FOB B;  2WIN B;  3MA2 B;  2A73 B;  3HS0 C;  3CKI B;  3L3O C;  4ILW A; 
#chains in the Genus database with same CATH topology
 4MZ9 A;  1KLU D;  3Q6S A;  3BU2 A;  4TRD A;  1QIL A;  3AYH B;  1IYJ B;  1F9R A;  2F03 A;  1O7Z A;  4YY3 L;  1CSQ A;  3MXU A;  5EKL A;  1PH4 A;  3PO2 H;  4I65 A;  1JIC A;  4KY5 A;  3GTO H;  2Z4H A;  1H9M A;  1SAP A;  2A68 C;  1NR2 A;  1SNQ A;  1JE4 A;  1V1P A;  4A76 A;  1QUQ B;  4DV1 Q;  2F4V Q;  4LF6 Q;  3H0G H;  2EQS A;  3GTK B;  4WJ3 M;  4A3F G;  1BOS A;  1WTV A;  1VQG A;  1HZB A;  2EY2 A;  1W6J A;  1B50 A;  5M5Y H;  1OXT A;  1CZW A;  2KEN A;  1U5K A;  5IT9 E;  4A3D B;  4GKK Q;  2F0E A;  4K14 A;  2F0G A;  1LT5 D;  1LAC A;  5ELF A;  3EIV A;  1JWM D;  1A3T A;  2B63 H;  2RF4 A;  1RDP D;  1S5C D;  4A3E G;  1X3E A;  3V05 A;  4M1U B;  3J7A V;  3HOU B;  2R93 B;  1VQC A;  1X3Q A;  4O42 A;  2JA5 G;  1JQY D;  4RGN A;  1VQH A;  1CKN A;  4JYA Q;  3S1M B;  2F52 A;  3KBG A;  4IUU A;  3WWV A;  2MFI A;  1Q3L A;  1TWG H;  1W3S A;  5JOB A;  3I56 A;  5M3F H;  1KTK A;  4DU9 A;  1EQT A;  1KD1 C;  1I94 Q;  1CA5 A;  4ZKC B;  1K0S A;  2BCO A;  1N9W A;  2PZU A;  3HRZ C;  4HCE A;  4JI2 L;  1E2Z A;  4X62 Q;  3I4M H;  1O78 A;  1Y1W H;  4EQ5 A;  2A6E C;  3PSI A;  1G51 A;  2PQA B;  5D3D A;  4JC0 A;  1S5B D;  3URY A;  4FVM A;  2EJF C;  4LF5 Q;  4P75 A;  5CGK A;  1AE2 A;  4A3B B;  1J9O A;  1ENC A;  2JA9 A;  2JYO A;  1PRT B;  4YWM A;  1NY4 A;  3HOV G;  1NJI C;  4NXN Q;  2I07 B;  2SOB A;  2WAQ B;  1XTC D;  5IYB G;  3FRP B;  5LMU Q;  2EYJ A;  1F2L A;  1IL2 A;  1V9P A;  3GQB A;  4QY7 A;  4DR5 Q;  4KLK A;  3CCR A;  5KEE A;  2OTJ A;  3CAM A;  1SE4 A;  2F0S A;  4PZ6 A;  2Z4I A;  5J39 A;  1EQR A;  5I9O A;  5A35 A;  5IP7 H;  1FVI A;  3D4W A;  1T9H A;  5JJI A;  1BR9 A;  1D2B A;  1XWE A;  5K36 G;  4DUZ L;  4LF4 L;  2HHH Q;  1QNK A;  1EFW A;  2XNA C;  1S40 A;  5C0X J;  1M90 C;  3DEP A;  5FLM H;  4X64 L;  2LY7 A;  3BZD B;  4L8J A;  4RWS C;  3SK5 A;  3PUW A;  1XPU A;  1SSO A;  2L5T A;  3HOX H;  4GLX A;  2CCZ A;  2I5M X;  2QKI C;  3BDO A;  1XMQ Q;  1KC8 C;  4DAP A;  4HCS A;  1FJG Q;  2LS0 1;  4KD4 A;  1EYC A;  1LTS D;  4U68 A;  1W2B A;  1UNS A;  1H9S B;  3L7Z C;  4EVO A;  3DWA A;  3HOY H;  1TY0 A;  1I6H B;  3E9I A;  1RIP A;  1S72 A;  1PZK D;  3LGJ A;  4XYO A;  4YHH L;  5FKA C;  2A73 B;  1BF4 A;  1TKW B;  3MEF A;  1BCP C;  2ID0 A;  4PMB A;  2G9D A;  2PI2 A;  5C4H A;  4A3I H;  2C5C A;  4XYQ A;  1F2Y A;  1LTL A;  2K03 A;  2IT1 A;  1VQN A;  1I4G A;  1X65 A;  5C0X G;  4IUP A;  2LSS A;  2ZTE A;  1TWF B;  1PTO H;  2CWP A;  2QF7 A;  3NBH B;  5FOB B;  2OTL A;  1X32 A;  3GP7 A;  2K4K A;  4OEM B;  3NEL A;  4B3R Q;  4C2M B;  2XGT A;  2CWA A;  1EOV A;  2NVY B;  1WCM G;  5CR3 A;  2IHE A;  4UP7 A;  2HDM A;  2F0H A;  1KXL A;  2IX0 A;  4A3D G;  1VDZ A;  5C4J B;  4P74 A;  2D9U A;  3B6Y A;  4ZRZ A;  1S4Z A;  3TS2 A;  2NVQ B;  4DV2 L;  4UAI A;  2ZJP A;  3HOU G;  2R93 G;  4FNF A;  4JI8 L;  4DK3 C;  3W1G A;  1G29 1;  2VNU D;  3MZ5 A;  1FD7 D;  1TS5 A;  2DNE A;  3E9H A;  3VYU A;  1KLG D;  5JEA H;  3HOW H;  1U4M A;  4HTH A;  2PMZ B;  5D65 A;  4WJW A;  4DR1 Q;  3H3V I;  4JBJ A;  2CW0 C;  5EKI A;  3OMG A;  4IFD G;  1PFM A;  4QF4 A;  1SMY C;  2NVT H;  2F3W A;  4XDX A;  2A69 D;  1WFQ A;  4PZ8 A;  1EY9 A;  4A3B G;  4DXF A;  4GOP A;  1A15 A;  3PO3 H;  4LWC A;  3K7A H;  2M2L A;  1T5X D;  2BH2 A;  3UI2 A;  1EEF D;  4DK6 C;  3NE5 B;  2F0L A;  1LM0 A;  5FLX c;  2WAQ G;  4GOP C;  1ZEQ X;  5IYC H;  1VQM A;  2HUG A;  4JI3 Q;  3CCU A;  2VB2 X;  2E2D C;  1WTP A;  3S14 H;  4BY1 B;  3EVQ A;  1O7L A;  4A3C H;  1MHW C;  5IYD H;  3QJY A;  4IUQ A;  1PFB A;  3QWN A;  5ELN A;  5J1Z A;  2QEJ C;  3ND9 A;  2K1B A;  1F77 A;  2K33 A;  4C1N I;  5CV5 A;  3KLR A;  2O2L D;  3BJU A;  5C44 G;  1U4P A;  4IUV A;  3RNU A;  1BBU A;  5JJK A;  2ZTC A;  3FKI H;  4IJH A;  5E3F A;  2UUA Q;  5KIX A;  4L63 B;  4YCW A;  1FR3 A;  2HIX A;  5I4D A;  3PUV A;  1XX8 A;  2JA6 H;  1EUJ A;  4ID6 A;  3OWE B;  3M85 A;  1IKM A;  5HGQ A;  4K6D A;  1PLF A;  1HR0 L;  2N3S A;  3MC0 B;  4GKJ L;  4P73 A;  1QUQ A;  1TS2 A;  5JVH 3;  3HKZ E;  3PO2 B;  1PH9 A;  3GTO B;  1V1P B;  4DV3 L;  5EJW A;  3GTL H;  4TQU S;  5IOC A;  1CQV A;  2VB3 X;  4IPG A;  4A3J H;  5BN5 A;  3HKS A;  3U4V A;  3K80 C;  5DM7 3;  4R1J A;  4TVA B;  1EQV A;  1MD2 D;  1OXU A;  2JA7 H;  3H0G B;  3P7J A;  1SE2 A;  2HDL A;  3W5O A;  2Y0S B;  4KY7 A;  1B53 A;  1KHI A;  3SK6 A;  5M5Y B;  4MTN A;  4RGM A;  2OXP A;  4CBV A;  5FO9 B;  2X6L A;  2LXK A;  1EYD A;  1EIH A;  3R2T A;  5BR8 Q;  1SND A;  3ULP A;  2J0T D;  2KCC A;  2EY1 A;  1Z47 A;  4UHV A;  2FMC A;  2J4X A;  1GD7 A;  2B63 B;  2RCN A;  2MO0 A;  4C3J H;  4DR2 L;  3KDF A;  3J80 L;  4QUF A;  3RZO B;  3ER0 A;  4DV5 L;  3A7L A;  4MN3 A;  1LTB D;  3PF4 A;  1SE3 A;  4OO1 G;  4A4I A;  1H9R A;  1LTA D;  1GJX A;  1WOC A;  1HR0 W;  4B3T Q;  2L55 A;  3CCE A;  4DA2 A;  2ZM6 Q;  4CKB A;  1Q46 A;  4HJ8 A;  5M3F B;  1TWG B;  5H1S E;  2PQA A;  5F2D A;  2K5D A;  3I7F A;  2B29 A;  3I4M B;  4HMI A;  1K28 A;  4CDC C;  3NUC A;  3J7A 5;  1Y8P B;  4HMJ A;  3TZU A;  4K6L A;  3WOE A;  4JI4 L;  2XSC A;  1IHZ A;  1FGU A;  1T5E A;  3HS0 C;  2YYZ A;  3GDE A;  1GUW A;  2UUC Q;  5I6W A;  2HCC A;  5KNB A;  4L5S A;  1PRT C;  4TKO B;  5IGD A;  4YY3 Q;  2KCT A;  1LTR D;  2AHO B;  4DV4 L;  3VR5 A;  1CTM A;  1PXU A;  5KND A;  4KHV A;  3TBI B;  2LXJ A;  2CKZ B;  3D4R A;  1PH6 A;  2ZTD A;  2EYH A;  3WOF A;  4C1N K;  3H6M A;  2N8N A;  2MQH A;  2NN6 I;  1E2V A;  5CV9 A;  4JI7 L;  4DV0 Q;  2OQK A;  4KHP L;  4RGO S;  1B44 D;  1EL0 A;  3D31 A;  3K5L A;  3FHW A;  1NUC A;  3OMC A;  2EXD A;  3CCJ A;  4CKC A;  3HOZ H;  3C2P A;  3AFP A;  4LW1 A;  4C3I G;  4JK1 C;  1LT3 D;  1BKB A;  4JPB W;  3E3X A;  4RKL A;  2EYL A;  1WTQ A;  1E3P A;  2XRS D;  4R4Q A;  1P16 A;  4BA2 I;  3H3V H;  4AH6 A;  4A3K G;  3RN5 A;  1ET6 A;  2XRQ D;  3GTM H;  4BY1 G;  3HOX B;  4LFB L;  4GN3 B;  4ZKB B;  2KEC A;  1AH9 A;  1U4L A;  1HUN A;  1VQ6 A;  2H4O A;  4CJ0 B;  2OWO A;  3EA6 A;  4F88 A;  3VA7 A;  4BXX G;  1CQF A;  3DXJ C;  3RZD H;  2KCN A;  1BCP B;  4BBS H;  2AQ2 B;  3HOY B;  1N32 Q;  2F0I A;  3HGB A;  2RA4 A;  3U50 C;  4C3H B;  3G71 A;  4BWG B;  2EYF A;  1YJW A;  1XNQ L;  4JI2 Q;  1ZYR D;  1EWH A;  2MUY A;  4O2D A;  3E0J A;  2F4I A;  5IGC A;  2D5D A;  2D0P A;  4CJ1 B;  1G8Z D;  3SHL A;  1FGB D;  5JVG 3;  2R7Z H;  1OXV A;  2Z8L A;  3AB9 A;  1L1O B;  2PZT A;  4R4T A;  3PO2 G;  4YCV A;  3A74 A;  3PCO B;  1PYB A;  2V1C C;  4KKS A;  2J7Z A;  1IW7 D;  1PTO B;  2F0J A;  1VQK A;  3H0G G;  4NW2 A;  2BOS A;  3AFQ A;  4Y52 H;  1LTG D;  3OYY A;  3OIP A;  3S1Q B;  2K5N A;  3MTS A;  1II3 A;  5C4X H;  1WTR A;  3R3O A;  3ERS X;  4JI1 L;  1HFN A;  4S3S A;  1GUG A;  5KGU A;  1X3F A;  1WTX A;  1UUP A;  4DUZ Q;  1HZA A;  3K8A A;  1CHQ D;  2EYP A;  3KF6 A;  4LFC L;  1Y69 U;  1IBL L;  4LF4 Q;  2B63 G;  2K75 A;  3U9S A;  1I50 H;  5HY6 A;  4CJ2 C;  1EY6 A;  1C4Q A;  1CUK A;  3PMF A;  3GD7 A;  1Q1B A;  3P1H A;  2KBN A;  4MTK A;  3X3N A;  3R8B A;  4CHT B;  4X64 Q;  3ZYY X;  1YHQ A;  1TWC H;  3FMC A;  1TQO A;  3KF8 B;  3TEH B;  3I3C A;  4OGQ C;  1TWA H;  2HIV A;  5M3F G;  1HJP A;  1NNX A;  4OIK A;  2ZT9 C;  3S9W A;  2IL8 A;  2KUM A;  1CZG A;  3HOW B;  1E2W A;  3GV3 A;  1NCV A;  1B7Y B;  4X3K A;  5M5X H;  3I4N H;  5KYL A;  2QA4 A;  2M9V A;  3NSW A;  4FXG C;  1I4Q A;  4KJN A;  4YHH Q;  2NVT B;  4IAL A;  2E76 C;  3O13 A;  1JB7 A;  4GOP B;  1PMR A;  2UU9 L;  2F0U A;  2LFN A;  1EY5 A;  1VQ8 A;  2F0D A;  5HUR A;  3K7A B;  4PMW A;  1F2M A;  4MHE A;  2WKD A;  1SRU A;  2K14 A;  4Z9C B;  3SEB A;  1N33 L;  2B2Y A;  1ZKO A;  1KQS A;  3A56 A;  3S14 B;  4DNT B;  3EBE A;  3FPU B;  1ASY A;  2B2Y C;  4X3U A;  3S15 H;  3VA5 A;  2K50 A;  5DAU A;  4JI5 L;  1DON A;  3STB D;  4G4K A;  1SJH D;  1TS4 A;  4ZQ3 A;  2K6A A;  5CMD A;  1PH1 A;  3J81 i;  5KNC A;  4GZY C;  4H44 C;  5IP7 G;  1YNJ D;  1H9J A;  2EY5 A;  2JP1 A;  3PQI A;  2SNM A;  4ME3 A;  1KIX A;  1IYV A;  3ERQ A;  1JR0 D;  1SDF A;  1BCP F;  3S2H B;  3RUZ A;  3FKI B;  1SNO A;  2JE6 I;  5C5L A;  4RCO A;  1SYD A;  3T16 A;  1A3V A;  5FLM G;  2JA6 B;  4DV7 L;  4DV2 Q;  3IL8 A;  2C35 B;  2NN6 H;  1L2F A;  2R92 H;  4HJ7 A;  1HFG A;  3JAM c;  4XT1 B;  4K8J A;  3GTL B;  1CKO A;  1PV4 A;  3FP9 A;  1I3Q H;  4A3J B;  4FF2 A;  4N8X 1;  1ILQ A;  5K5P A;  1JB3 A;  1PA6 A;  4XIG S;  3T53 B;  1YVC A;  5A2Q E;  2E5L Q;  3HOY G;  2JA7 B;  1JC7 A;  1EOT A;  3D0F A;  4C3H G;  2OQ0 A;  4C56 C;  3FVQ A;  1SYG A;  4DAY A;  4IOC A;  3CC4 A;  2ZXO A;  1NSN S;  4IPC A;  4E6I A;  4H7B A;  3CRL C;  3J81 E;  2XWJ B;  5J22 A;  1VCI A;  2X69 A;  2Z1C A;  2PO4 A;  3VYS A;  4QUC A;  1WD0 A;  2EJM A;  3F1Z A;  3CXC A;  1F9Q A;  3KBX A;  1QOH A;  1A6X A;  3BZC A;  3KDF B;  3IRB A;  4UPA A;  4C3J B;  3M3Y H;  4A3G H;  2F0W A;  2FIN B;  5E1F A;  4GLV B;  4FDB A;  1Z9F A;  3M9B A;  4LFA L;  3GTG B;  3VR2 A;  1I4H A;  4KK7 A;  4LK1 C;  4LUZ A;  2A6H D;  4HJA A;  1F2Z A;  5BN4 A;  1QNU A;  2EXZ A;  3BYT B;  5M5W H;  1HA5 A;  1STY A;  3DM1 A;  2B8G A;  1AEX A;  4IPD A;  5IT9 c;  3I90 A;  2IJ0 A;  5FJ8 G;  3Q8D A;  2VS1 A;  4R8I A;  4KTA A;  2KED A;  1VF5 C;  1XPO A;  5IWA L;  1B70 B;  1WVL A;  2KHI A;  1AFP A;  3U4Z A;  1ROD A;  1HR0 Q;  2Q8T A;  1HNW L;  4GKJ Q;  1JJG A;  1CHP D;  3SVM A;  1DXM A;  3BZK A;  3CCV A;  1G2S A;  1STB A;  3M7G A;  3IFD A;  5JEA G;  2AWN A;  2SDF A;  3KK7 A;  3HOW G;  4MNO A;  1UE6 A;  4A3L H;  5IOD A;  4DV3 Q;  4V0B A;  5D3I B;  2N49 A;  1DOK A;  5FLX L;  5LMN L;  4IUT A;  2VZA A;  5C3X A;  2BE5 C;  3DM3 A;  1SMX A;  2EIF A;  2ES2 A;  2P5Z X;  5IGB A;  5C0X I;  2KCM A;  1A2T A;  1KRS A;  2Q8R E;  3NWS A;  3I73 A;  1JT8 A;  1PVO A;  4A3M H;  3ND8 A;  3HFZ B;  3L0O A;  3W3A A;  3RLO A;  3T51 B;  5C3E H;  3HOZ B;  1Q90 A;  1GUN A;  1KNE A;  1IBK Q;  4UP9 A;  4ZCK A;  4FXD A;  4HJ9 A;  1S5F D;  3HKZ B;  4LF8 L;  3C1F A;  1N36 L;  3BDC A;  5NUC A;  2I0Q A;  5IYC G;  1UE5 A;  3TN2 A;  3FDT A;  2ATW A;  2QEX A;  4DR2 Q;  3GTM B;  4DV5 Q;  1VQI A;  1AW7 A;  4JI0 L;  2DN8 A;  4K2K A;  1L0X B;  4M8A A;  1A62 A;  5E7N A;  1I4P A;  1PYS B;  4Y7N H;  1VQ5 A;  2Q2T A;  3S17 H;  3RZD B;  4I7Z C;  3T1H L;  1HUM A;  3F2D A;  4BBS B;  2ASB A;  1G6P A;  1GKH A;  1YHB A;  4IQZ A;  5EPL A;  3M4O H;  2V4D A;  5LMN W;  1TXY A;  5CBE E;  4K8I A;  4L5R C;  3FKI G;  1WJJ A;  4FXK C;  1STN A;  1UAP A;  2EPB A;  1TII D;  4NP5 A;  3PIP 3;  2JA6 G;  3ITP A;  1L1O A;  5KRU A;  2A19 A;  4JI4 Q;  2HQE A;  2PNR C;  4ODG A;  1MIU A;  1GHK A;  2R7Z B;  3M4Q A;  1HZ9 A;  1U0L A;  4UP8 A;  1L1O C;  3MVV A;  3EFX D;  3J81 j;  4IFD J;  3KLS X;  2UXB L;  2JA5 H;  4IFD I;  1UE7 A;  1I4X A;  1PTO C;  4A3J G;  2NZH A;  4DV4 Q;  2JA7 G;  4OX9 Q;  1NR4 A;  4GN4 B;  1X3G A;  5LL6 S;  4AQY Q;  1ESF A;  1VQ7 A;  3A5Z B;  3T1Y L;  3MHB A;  5EPK A;  4DPG A;  2LMC B;  1AZQ A;  5AJ3 L;  2OF1 A;  3AU7 A;  5ELC A;  1Q1E A;  4N9P A;  2KEE A;  4BBR H;  4JI7 Q;  2JEA I;  5C4X B;  1VS0 A;  3BS1 A;  4KHP Q;  1LTI D;  3KF6 B;  1R4P B;  4OXP A;  3TP5 A;  1YIJ A;  1D6E C;  3I72 A;  1IXR A;  1Y8N B;  2F0P A;  4J8Q A;  1G6Z A;  3K7U C;  1XMO L;  3G6E A;  1I50 B;  2EDG A;  3G6J B;  3KF8 A;  3CPF A;  3UE0 A;  4C3J G;  4DR6 L;  1NAP A;  1PRT F;  3QIA A;  1PHJ A;  1TWC B;  3M4P A;  1Z6H A;  5IYB H;  3DEO A;  4K5W A;  3PUZ A;  1HPC A;  4LFB Q;  5EBC A;  1GHJ A;  4JI6 L;  2EJG C;  2WFW A;  2B3G A;  1Q86 C;  1X6O A;  1NE3 A;  5JJZ A;  3I4N B;  1W6K A;  4XTC S;  3A8I E;  4H13 C;  4R4O A;  4JOI A;  2PZW A;  5K36 H;  3S2D H;  1XNQ Q;  5CBA E;  1PZJ D;  4JOI C;  2BDN A;  3KOJ A;  4N8F A;  3MAQ A;  3OTO L;  1EYA A;  1YNN D;  2Q2H A;  2L9H A;  1PH7 A;  1RJT A;  5EAY A;  1MI2 A;  1GM5 A;  1SE8 A;  2Z9H A;  2OT2 A;  2F0Q A;  2Z6K A;  2XWB B;  1IBM L;  4TSS A;  2B2T A;  2MJ8 A;  1MJE A;  2Z6K C;  3S15 B;  1EYG A;  1SNP A;  1KAW A;  2GVB A;  3TQY A;  3NTK A;  4EQO A;  2R61 A;  5KYI A;  2B2T C;  2ZXP A;  4GNX A;  1JOK A;  4B3M L;  1I5F A;  4OO1 I;  4P72 A;  2OCE A;  2CQO A;  3HOZ G;  2A68 D;  2XVS A;  4IN3 A;  3V96 A;  1PYW D;  2JK8 A;  2DJG C;  3CPW A;  3HKZ G;  4EQN A;  2XN9 C;  1V8Q A;  4LFC Q;  1KAA A;  1IBL Q;  3CU7 A;  1VQP A;  1QE6 A;  1C8C A;  1BUV T;  1L0W A;  3PV0 A;  5C0X H;  4J6H A;  2R92 B;  3S16 H;  3UDF A;  1XJV A;  3GTK H;  4RFB A;  3F2U A;  1I3Q B;  4R8N A;  1TS3 A;  4DAY B;  2AUK A;  3U58 A;  1WCM H;  4UDU C;  1HNZ L;  3Q24 A;  1LYL A;  2QW7 A;  3J7A F;  1SYF A;  5M3M H;  1HQM C;  2TMP A;  4RCN A;  4ALP A;  4A3D H;  1CI3 M;  3CF5 A;  2VQF L;  4DR4 L;  5CYU A;  1CFM A;  1MBY A;  4G7O C;  2F0K A;  2VUM H;  2MHV A;  1HNX L;  4A93 H;  1NMF A;  2A5H A;  1YEZ A;  3CKI B;  4L6T B;  1HQR D;  2E74 C;  1R9T H;  2R93 H;  2UU9 Q;  4DFA A;  4ULL A;  4B08 A;  4A3G B;  3M3Y B;  3S1M H;  3D3R A;  3IAY A;  4HN7 A;  2KVM A;  3ICE A;  2A6E D;  1VQF A;  1N33 Q;  5CC4 A;  3LWE A;  1BVS A;  3D8G A;  3CD6 A;  1P8L A;  3K5N A;  1SJE D;  2F0T A;  2F3I A;  2JQO A;  1Y1W B;  1E24 A;  4BA1 I;  3JC6 6;  4IUN A;  2L1B A;  3A8J E;  4IUR A;  4JI5 Q;  1GUS A;  2CH4 W;  4NKL A;  4ME5 A;  4KJO A;  5C4X G;  5M5W B;  2F3V A;  5JPM C;  1VQJ A;  4DAV A;  1WTW A;  1H95 A;  2JJQ A;  4NXM L;  2RBM A;  3QO2 A;  3NP8 A;  4OWX B;  5FO8 B;  1A0I A;  1B2T A;  1Y8O B;  2L12 A;  2E2I H;  5CV7 A;  4DV7 Q;  3OW2 A;  5GRO A;  5J3B A;  4QIW E;  3CMA A;  3WDN A;  2UXC L;  1STA A;  1QVC A;  1PH3 A;  2NZ1 D;  5G3L F;  4B3S L;  2SNS A;  4K0K L;  3NEM A;  3DLL A;  4JV5 L;  3I4N G;  3ONA B;  3GTJ H;  3J80 i;  5IIF A;  5DEH A;  1FNV A;  1G91 A;  2ZJR A;  3PIO 3;  4GLA C;  1BBW A;  4QB4 A;  4FF3 A;  4H0L C;  1VQD A;  3NHH A;  5C44 H;  2XIW A;  4BS9 A;  1EIY B;  4RMF A;  2DY8 A;  1V1O A;  2WB1 E;  4RG1 A;  1MSH A;  2FXQ A;  1XYI A;  5C3E B;  1JE5 A;  3CCM A;  3S1N H;  2RHS B;  4I7A A;  3Q22 A;  1K9M C;  5C3W A;  4QL5 A;  1ET9 A;  2CQA A;  3SK8 A;  3H3V C;  3T4A C;  5ELE A;  3EQL C;  1B1Z A;  4DK0 A;  3AEV A;  1LLR D;  1DYQ A;  1L0Y B;  2K04 A;  5IP9 H;  1BCP D;  4IPH A;  1QB5 D;  4LFA Q;  4Y7N B;  3H15 A;  4X66 L;  3S17 B;  3JAM L;  4LUO A;  2NYZ D;  3J80 E;  4MIU A;  1LO5 D;  1Y1V H;  3M4O B;  4HSV A;  3D6W A;  4A3I B;  4CDF C;  1X56 A;  1OXS C;  2K5Q A;  1A2U A;  5EKK A;  2B2V A;  2MP1 A;  2A74 C;  2YU9 H;  4FF4 A;  4K5V A;  1SNC A;  5IWA Q;  1IZ6 A;  4HSP A;  4UY8 C;  1LT6 D;  3NEN A;  3E6Z X;  1SYC A;  1K0R A;  2WV6 D;  3NTI A;  4PZ7 A;  2D62 A;  3F2B A;  4HIO A;  2R92 G;  2TSS A;  2Y0S G;  1MJC A;  5TSS A;  2JSO A;  2JA8 H;  4OO1 H;  1HNW Q;  2F0F A;  2NTT A;  1Y14 B;  4AYB E;  1ICW A;  1SFO H;  4C2M H;  2NBF A;  4LAA A;  1VQ4 A;  2GN5 A;  4HAE A;  1A8V A;  5IE8 A;  3RMH A;  5LMN Q;  3I2Z A;  4RA8 A;  5IGF A;  1GO3 E;  2PW7 A;  1D5X C;  2NB0 A;  2QIL A;  1K83 H;  4BBR B;  1K8O A;  2KJX A;  4LUV A;  2RDH A;  4QQB X;  4O0A A;  3E0E A;  3TP8 A;  1WI5 A;  3I55 A;  4G57 A;  3NPP A;  1IYU A;  5IT9 L;  2D0O A;  4DR7 L;  4IOA A;  2VXW A;  3CHB D;  5GAE C;  3PIP A;  5I9P A;  3TDQ A;  3HP3 A;  4LF9 L;  2CW0 D;  3KLS A;  4KHZ A;  3M4Y A;  4Q0F A;  3I4M G;  2VY3 A;  1SMY D;  3J7Y W;  4R4I A;  1Y1W G;  1M1K C;  1EFI D;  2UXD L;  1STH A;  1VF7 A;  1QZH A;  1CA6 A;  2VQE L;  4NB3 A;  4JI0 Q;  1X55 A;  3K57 A;  3M7N A;  3Q23 A;  3BG3 A;  4FO2 A;  3CCQ A;  3A7A B;  4OL7 A;  1EY8 A;  2ENB A;  3QR8 A;  3CME A;  3T1H Q;  1C48 A;  1FL0 A;  2OEO A;  3PO3 B;  3K0Y A;  4P2C B;  1IKL A;  3S2D B;  4J15 A;  2A69 C;  4C3I H;  3CC7 A;  1WYD A;  1SLJ A;  2E2J H;  5AFW A;  5M9O A;  2GA4 B;  1I6V C;  4A3K H;  2E2H H;  3GTQ H;  4PNY A;  4BY1 H;  4B9W A;  3JAM E;  2UXB Q;  1CT1 D;  3F2C A;  5GAH C;  1A3U A;  4DR3 L;  1DJR D;  5DLQ E;  1HTL D;  3UE1 A;  2CHB D;  2DGY A;  1M4V A;  1SR3 A;  2WAC A;  3LWU A;  4A75 A;  2YTX A;  3QOL A;  1CK1 A;  4GNX B;  3T1Y Q;  2DJF C;  3NBI A;  2B2U A;  5AJ3 Q;  5JAV A;  1EY4 A;  4JCV E;  5EQ0 A;  4LF7 L;  1CKM A;  3MXG A;  2O5I C;  5C3E G;  2UUC L;  3HOX G;  4HED A;  2N88 A;  3J7Z C;  4JI8 Q;  3A54 A;  1VMP A;  2B2U C;  1V1Q A;  3ZJY C;  2F0M A;  1SYE A;  4HIK A;  5ELB A;  3CQZ H;  4X3T A;  3GTP H;  2NVX H;  5CV6 A;  3KFU A;  4F87 A;  1UE1 A;  2FMM A;  4IJL A;  1XMO Q;  2QCP X;  4DR6 Q;  2PPB C;  5JJL A;  3H94 A;  1AE3 A;  2HQL A;  5CV4 A;  1PTO F;  3S16 B;  2K32 A;  2UUB L;  3F8T A;  3OOC A;  3T13 A;  1JJ2 A;  4JI6 Q;  4U67 3;  2JN4 A;  4DV0 L;  1U4R A;  1WCM B;  1NBW A;  1U9R A;  1ILP A;  1LAB A;  2ICE C;  2KQ3 A;  1N34 L;  4A3I G;  4DF7 A;  1HHV A;  2MNA A;  4NDX A;  5M3M B;  5JEA J;  4QMG A;  3SR1 A;  2BA1 A;  1SN8 A;  1Q8K A;  1YBY A;  3OPO A;  4RKB A;  4FF1 A;  2PI2 E;  1S5E D;  2K28 A;  2X6G A;  4KKT A;  3VR6 A;  4HID A;  2VUM B;  4A93 B;  5ISR A;  1O80 A;  3S1R H;  1R9T B;  2Z6B A;  3RZO H;  3OTO Q;  4WFN 3;  1K3R A;  1EY7 A;  1YJ9 A;  4ZK9 B;  1TT2 A;  4JBM A;  1EY0 A;  4EGV A;  5DNF A;  4B9X A;  3T56 B;  3X3M A;  1Q7Y C;  2I46 A;  2HCI A;  1N32 L;  1O7I A;  4H02 A;  1IBM Q;  4YWK A;  1DGS A;  3SGI A;  2O5J C;  3MXN A;  2A1A A;  1YIT A;  3I8Z A;  5C6A A;  1PH8 A;  3J81 c;  1RF2 D;  5FK9 C;  4HJ5 A;  4BBR G;  3MEH A;  3CCS A;  4WJ4 A;  4KN4 C;  1EEI D;  1PRT D;  2KHJ A;  1E1O A;  3FEW X;  2I5L X;  1ONL A;  4B3M Q;  1K3B C;  2M00 A;  4POF A;  3H91 A;  1SBB B;  1J8I A;  3H09 A;  3GO5 A;  3EJI A;  5JPN C;  3K5O A;  2R7F A;  2E2I B;  3S24 A;  4CDD C;  4YCU A;  5T1G A;  3ERO A;  3DWQ A;  3DWP A;  5C4Z A;  4BY7 H;  2EE1 A;  2PCF B;  3DMU A;  2RCF A;  2L11 A;  1AP0 A;  3GTJ B;  4L5Q A;  3PGZ A;  3OIQ A;  1I4R A;  2Q8I B;  2L4N A;  1RCV D;  4QGU A;  3PO3 G;  4LJZ C;  1HNZ Q;  1PFS A;  1DOL A;  3TME A;  1GVP A;  2QGQ A;  4DUY L;  1CSP A;  2WII B;  1WTH A;  5C44 B;  1Q8I A;  5ELO A;  2IHF A;  4XQJ A;  1UWV A;  2L0C A;  3A5U A;  3IFT A;  2VQF Q;  4DR4 Q;  2I5H A;  2R6G A;  4R9W A;  4O1N A;  5DM6 3;  1ESR A;  2ICI A;  3S1N B;  1B9N A;  4A3C G;  4J1M A;  2R3Z A;  5IYD G;  5BN3 A;  1HNX Q;  4RHR A;  4NMZ A;  1PH5 A;  1EQQ A;  4A3F H;  1TVX A;  1EWI A;  1D8L A;  1KAB A;  3N52 A;  4OWW B;  2R7D A;  1XNR L;  1IL8 A;  1AZP A;  5GAD C;  1YJN A;  1KDB A;  2KHS A;  1J5E L;  4C3H H;  1QVG A;  1Z7T A;  3K5M A;  1SEB D;  5T1I A;  4AIM A;  1K8A C;  1Y1V B;  2F0V A;  2HD3 A;  4A3E H;  3DUZ A;  1ZYR C;  1JCK B;  3DHQ A;  1RKN A;  2C9O A;  1K8M A;  3PIO A;  2YU9 B;  1QCB D;  1GUT A;  4X3S A;  2G9H D;  4NXM Q;  3TZD A;  4X65 L;  4FP5 D;  3G48 A;  4DV6 L;  3BVZ A;  3K0X A;  3UDX A;  1J6Q A;  2JA8 B;  1D7Q A;  3ULJ A;  4ZYS A;  1B4O A;  1IW7 C;  2AUJ D;  5EBD A;  2EYO A;  2UXC Q;  1VQE A;  3SXH A;  1VMC A;  1SFO B;  4B3S Q;  4K0K Q;  4PV1 C;  1V43 A;  4HIM A;  3I4L A;  4JV5 Q;  1TWH H;  3TRE A;  3UDI A;  3QB3 A;  3S1Q H;  5IGG A;  4GN5 A;  5M3M G;  1HCZ A;  3C3L A;  1K83 B;  3LNN A;  5FJ8 H;  5FLX E;  1XPR A;  5LL6 X;  3KJP A;  4DNR B;  3HOV H;  4KKU A;  2VUM G;  1ENA A;  3P20 A;  4A93 G;  1BQQ T;  4DV1 L;  2F4V L;  4LF6 L;  1JOO A;  1JMC A;  4R4C A;  5I2X A;  4OWT B;  1FYC A;  1TWA B;  3MXP A;  4QIW B;  1NMG A;  1QWY A;  4ZAI A;  5M5X B;  3I70 A;  3N6R A;  3BVM A;  1BXT A;  2E5L L;  4RHS A;  4V19 0;  1F9S A;  3P75 A;  1BO0 A;  1XTD A;  1OTC A;  1VQL A;  3L9A X;  1Q82 C;  4ZLT F;  5IY0 A;  4KD3 A;  4GKK L;  4DXG A;  3LX0 A;  2O4X A;  5E4W C;  2RDG A;  2ZXR A;  2ZJQ A;  4X66 Q;  1E7Z A;  4DGZ A;  5IGE A;  5I6Y A;  2WB1 B;  1S3O A;  4LNQ A;  4RAU C;  1ML0 D;  5GQO A;  1BBX C;  4GS3 A;  4JYA L;  1D1K A;  2PW5 A;  3QOJ A;  1MKH A;  5G3L D;  4EX5 A;  4C3I B;  2WAQ E;  2IWH A;  1I94 L;  3D6C A;  3CCL A;  2E2J B;  2NWG A;  3RLF A;  3PUY A;  1R4Q B;  4X62 L;  2ALY B;  1B9M A;  4A3K B;  3UDG A;  1F9P A;  2E2H B;  2L15 A;  3GTQ B;  5LHY 1;  2CFM A;  4PMC A;  3NWT A;  3KJO A;  2FJ2 A;  4RGT A;  4JG2 A;  2YTY A;  4DKA C;  1ASZ A;  1EZ8 A;  4LF5 L;  1JWS D;  2B8F A;  3STB C;  4JI1 Q;  4HR7 B;  1A63 A;  4GNX C;  3FPP A;  1YNJ C;  2MPM A;  1EU4 A;  1RTO A;  5HGT A;  3S2H H;  2JA5 B;  4NXN L;  1AN8 A;  1C0A A;  3K59 A;  5LMU L;  1RL2 A;  3ULL A;  3L2P A;  2RVL A;  4DR5 L;  4DNI A;  1KL9 A;  1ICF B;  3KLW A;  2RSO A;  4G7H C;  3CQZ B;  3GTP B;  1UEA B;  2K7V A;  2NVX B;  2WKC A;  2IX3 A;  2BA0 A;  2PNH A;  4JVZ A;  4KV6 A;  4APV A;  4BBS G;  1HRJ A;  1YNX A;  4Q5V A;  4AYB B;  4DR7 Q;  1ENF A;  1SRO A;  3KYH C;  1Q81 C;  4LF9 Q;  5IP9 G;  2HHH L;  3RR5 A;  1VQB A;  3K81 C;  2K01 A;  2Q2I A;  2JXM B;  3CC2 A;  2UXD Q;  3BYY B;  5EGT A;  2H1E A;  3V2T A;  3RN2 A;  2VQE Q;  1BNZ A;  1Y1V G;  3KUP A;  1QJO A;  4ILW A;  2R7Z G;  2EVB A;  1DOM A;  1TU2 B;  1VQA A;  3HOU H;  3OSO A;  1JOR A;  3SE0 A;  2MGS A;  2N78 A;  1IBK L;  1OO9 B;  1XMQ L;  2IY5 B;  2Z0S A;  1MSG A;  3G4S A;  1FJG L;  1QZG A;  1DD2 A;  1S5D D;  3NXW A;  2RQX A;  4F7X A;  1GXD C;  3S1R B;  3TS0 A;  1CKN B;  3TRZ A;  2JA8 G;  5L37 A;  1STG A;  1KRT A;  1WTO A;  2WIN B;  3GTG H;  1HTP A;  2NUC A;  4YIJ A;  1E22 A;  3TSS A;  1K8G A;  4X6A H;  1RHP A;  4IFD H;  4DR3 Q;  1FNW A;  3MXN B;  3CRK C;  2DNC A;  2KOL A;  3PF5 A;  2K05 A;  2JEB I;  2A6H C;  4A3B H;  3PUX A;  1O7Y A;  2SEB D;  5COR A;  3E5S A;  2KA7 A;  3U9O A;  3TP7 A;  3A8K E;  4LF7 Q;  4N9T A;  1N8R C;  4CDE C;  3MA2 B;  2YTV A;  4B3R L;  3C46 A;  2NZO A;  1EZ6 A;  1JWU D;  2BE5 D;  2QDB A;  2IW3 A;  1DZ1 A;  3VR4 A;  4XT3 B;  1GOZ A;  5E4X A;  3R2I A;  2PMZ E;  3C1E A;  5COY A;  4OX9 L;  1PZI D;  1RTN A;  4BY7 B;  4G7Z C;  2VL6 A;  4AQY L;  2A8V A;  3OWF A;  2UUB Q;  4IZ8 A;  1E0B A;  3VR3 A;  4OIJ A;  2DY7 A;  1LTT D;  1BDO A;  2XTI A;  1FNU A;  4A3M B;  4DN4 M;  2PYK A;  4QCL A;  1YHA A;  3I91 A;  2WB1 G;  3L3O C;  4JBK A;  3HG9 A;  1QVF A;  1STE A;  4JBW A;  1N34 Q;  2AQ3 B;  5FO7 B;  3EN2 A;  1JJC B;  4WRD A;  3W2D A;  3MFY A;  1DM0 B;  2LKV A;  4KN7 C;  3D4D A;  2EOT A;  2RHQ B;  1RD9 D;  2EY6 A;  2IX1 A;  1XXG A;  1VQ9 A;  2YV5 A;  5GAG C;  1JOQ A;  1X9N A;  1EIF A;  2RSN A;  4DR1 L;  1I6H H;  4KMU C;  4A3F B;  1H9S A;  1VQO A;  3K58 A;  5D14 A;  1OXX K;  2BDO A;  4JW0 A;  4ZUJ A;  5C5M A;  4IO9 A;  4PQX A;  4WOR A;  1YI2 A;  4K5X A;  1E1T A;  1SYB A;  4XQN A;  1D5Z C;  1YZ6 A;  1KNA A;  5CV8 A;  1G2T A;  4LMQ D;  1K73 C;  4A3E B;  2NN6 G;  2B2V C;  4DK1 A;  4JI3 L;  4OEL B;  2RKS A;  2CVR A;  2MO1 A;  1HXY D;  1TWF H;  4OON A;  1PTO D;  1CM9 A;  3NQI A;  1KDC A;  1H9K A;  1PDQ A;  1PFN A;  1X3P A;  4K2L A;  4QJF A;  3RD4 A;  3W1B A;  3VYT A;  2VW9 A;  3SDZ A;  4FYD A;  1SXT A;  2AWO A;  3CP0 A;  3TP6 A;  1KDA A;  3NBH A;  2AMC B;  2IPK D;  4OHJ A;  2NVY H;  1HH2 P;  2RDF A;  4AYB G;  2WP8 J;  1C9O A;  3MFG A;  4EQP A;  2Y0S E;  2UUA L;  3HEJ A;  1M8A A;  2QDL A;  5C4J H;  1EU3 A;  1GUO A;  2B2W A;  5I2Y A;  2NVQ H;  1HA6 A;  2F1M A;  2Q2U A;  2EZV A;  1TWH B;  3J80 c;  4RH6 A;  3Q0A A;  3IKJ A;  4YWL A;  3GV6 A;  2B2W C;  4P71 A;  5A2Q L;  1LV9 A;  1TR5 A;  1LT4 D;  3G7L A;  4DUY Q;  2HT1 A;  1B3Q A;  4A3G G;  3JAM i;  1WD1 A;  2BH8 A;  4LF8 Q;  3J81 L;  1N36 Q;  3HOV B;  3HZX A;  3VDY A;  1TY2 A;  5EPJ A;  3AMU A;  2PQE A;  2F0O A;  1X54 A;  4XXE A;  2N55 A;  3BVG A;  4XQQ A;  2F0N A;  3RLN A;  1C7Y A;  3VYR A;  2FFK B;  1XNR Q;  2FHT A;  3NQT A;  3AQQ A;  5BR8 L;  1B3A A;  2E8G A;  4DAM A;  1SNM A;  3MWY W;  4L5T A;  4POG A;  3I4O A;  3R93 A;  2K5V A;  1J5E Q;  1MGS A;  2NTS A;  1ZXT A;  1PH2 A;  2CH4 A;  2E75 C;  2K5W A;  4ABN A;  2B39 A;  1D1I A;  3NTH A;  1UEB A;  2K52 A;  2EYM A;  3BDL A;  2K5H A;  4CGY B;  4ZUI A;  4B3T L;  4PG3 A;  2GVA A;  4KY6 A;  1QG7 A;  2ZM6 L;  3OW7 A;  3A55 A;  4A3L G;  3QG1 A;  1YNN C;  2AKW B;  2D2C C;  4BXX H;  2G5D A;  3OHX C;  4X65 Q;  1EIG A;  3CW2 C;  4DV6 Q;  1DCZ A;  1B8A A;  1D5M C;  4BY7 G;  4F8M A;  1LUZ A;  2DUD A;  5ELD A;  2AQ1 B;  3SK4 A;  4CKE A;  1EWC A;  2H5X A;  4NPS A;  3K6O A;  4A3M G;  3NK9 A;  3A0J A;  4KI0 A;  1HZC A;  1NTG A;  1Q12 A; 
#chains in the Genus database with same CATH homology
 1KLU D;  3Q6S A;  4TRD A;  1QIL A;  1F9R A;  2F03 A;  1O7Z A;  3MXU A;  5EKL A;  4I65 A;  1JIC A;  4KY5 A;  2Z4H A;  1H9M A;  1SAP A;  2A68 C;  1NR2 A;  1SNQ A;  1JE4 A;  1V1P A;  3GTK B;  1BOS A;  1WTV A;  2EY2 A;  1W6J A;  1B50 A;  1OXT A;  1CZW A;  5IT9 E;  4A3D B;  2F0E A;  4K14 A;  2F0G A;  1LT5 D;  1LAC A;  5ELF A;  1JWM D;  1A3T A;  1RDP D;  1S5C D;  3V05 A;  4M1U B;  3J7A V;  3HOU B;  2R93 B;  1X3Q A;  4O42 A;  1JQY D;  4RGN A;  3S1M B;  3KBG A;  4IUU A;  5JOB A;  1Q3L A;  1KTK A;  4DU9 A;  1EQT A;  1CA5 A;  4ZKC B;  2BCO A;  2PZU A;  3HRZ C;  4HCE A;  1E2Z A;  1O78 A;  2A6E C;  5D3D A;  1S5B D;  3URY A;  4FVM A;  2EJF C;  5CGK A;  4A3B B;  1J9O A;  1ENC A;  2JYO A;  1PRT B;  2I07 B;  2SOB A;  2WAQ B;  1XTC D;  3FRP B;  2EYJ A;  1F2L A;  3GQB A;  5KEE A;  1SE4 A;  2F0S A;  2Z4I A;  5J39 A;  5I9O A;  5A35 A;  3D4W A;  1BR9 A;  1D2B A;  1XWE A;  5K36 G;  1QNK A;  2XNA C;  5C0X J;  3DEP A;  2LY7 A;  3BZD B;  4L8J A;  4RWS C;  3SK5 A;  3PUW A;  1SSO A;  2L5T A;  2QKI C;  3BDO A;  4DAP A;  4HCS A;  2LS0 1;  4KD4 A;  1EYC A;  1LTS D;  4U68 A;  1UNS A;  1H9S B;  3L7Z C;  4EVO A;  3DWA A;  1TY0 A;  1I6H B;  1PZK D;  4XYO A;  5FKA C;  2A73 B;  1BF4 A;  1TKW B;  1BCP C;  2ID0 A;  4PMB A;  2G9D A;  5C4H A;  2C5C A;  4XYQ A;  1F2Y A;  2K03 A;  2IT1 A;  1I4G A;  5C0X G;  4IUP A;  1TWF B;  1PTO H;  2QF7 A;  5FOB B;  1X32 A;  3GP7 A;  4C2M B;  2NVY B;  5CR3 A;  2HDM A;  2F0H A;  2IX0 A;  1VDZ A;  5C4J B;  2D9U A;  4ZRZ A;  1S4Z A;  2NVQ B;  4UAI A;  4FNF A;  1G29 1;  2VNU D;  3MZ5 A;  1FD7 D;  1TS5 A;  2DNE A;  3VYU A;  1KLG D;  5JEA H;  1U4M A;  4HTH A;  2PMZ B;  5D65 A;  4WJW A;  2CW0 C;  5EKI A;  3OMG A;  4IFD G;  1PFM A;  4QF4 A;  1SMY C;  2F3W A;  4XDX A;  2A69 D;  1EY9 A;  4DXF A;  1A15 A;  2M2L A;  1T5X D;  3UI2 A;  1EEF D;  3NE5 B;  2F0L A;  1ZEQ X;  2HUG A;  2VB2 X;  2E2D C;  1WTP A;  4BY1 B;  3EVQ A;  1O7L A;  3QJY A;  4IUQ A;  1PFB A;  3QWN A;  5J1Z A;  2QEJ C;  3ND9 A;  2K1B A;  1F77 A;  2K33 A;  4C1N I;  5CV5 A;  3KLR A;  2O2L D;  1U4P A;  4IUV A;  5E3F A;  5KIX A;  4L63 B;  1FR3 A;  5I4D A;  3PUV A;  1XX8 A;  4ID6 A;  3OWE B;  3M85 A;  1IKM A;  4K6D A;  1PLF A;  3MC0 B;  1TS2 A;  5JVH 3;  3PO2 B;  3GTO B;  1V1P B;  5EJW A;  4TQU S;  5IOC A;  1CQV A;  2VB3 X;  5BN5 A;  5DM7 3;  1EQV A;  1MD2 D;  1OXU A;  3H0G B;  3P7J A;  1SE2 A;  2HDL A;  2Y0S B;  4KY7 A;  1B53 A;  3SK6 A;  5M5Y B;  4RGM A;  2OXP A;  4CBV A;  5FO9 B;  2X6L A;  1EYD A;  1EIH A;  3R2T A;  1SND A;  2J0T D;  2KCC A;  2EY1 A;  1Z47 A;  2FMC A;  2J4X A;  2B63 B;  3J80 L;  4QUF A;  3RZO B;  3A7L A;  4MN3 A;  1LTB D;  1SE3 A;  4OO1 G;  1H9R A;  1LTA D;  1GJX A;  2L55 A;  4DA2 A;  4CKB A;  5M3F B;  1TWG B;  5F2D A;  2K5D A;  3I4M B;  4HMI A;  3NUC A;  1Y8P B;  4HMJ A;  3TZU A;  4K6L A;  3WOE A;  2XSC A;  1IHZ A;  1T5E A;  3HS0 C;  2YYZ A;  1GUW A;  5I6W A;  2HCC A;  5KNB A;  1PRT C;  4TKO B;  5IGD A;  1LTR D;  3VR5 A;  1CTM A;  1PXU A;  5KND A;  4KHV A;  3TBI B;  3D4R A;  2EYH A;  3WOF A;  4C1N K;  3H6M A;  2NN6 I;  1E2V A;  5CV9 A;  4RGO S;  1B44 D;  1EL0 A;  3D31 A;  3K5L A;  1NUC A;  3OMC A;  4CKC A;  3C2P A;  4C3I G;  4JK1 C;  1LT3 D;  4RKL A;  2EYL A;  1WTQ A;  2XRS D;  4BA2 I;  1ET6 A;  2XRQ D;  3HOX B;  4ZKB B;  2KEC A;  1U4L A;  1HUN A;  2H4O A;  4CJ0 B;  3EA6 A;  4F88 A;  3VA7 A;  1CQF A;  3DXJ C;  2KCN A;  1BCP B;  2AQ2 B;  3HOY B;  2F0I A;  3HGB A;  2RA4 A;  4C3H B;  4BWG B;  2EYF A;  1ZYR D;  1EWH A;  2MUY A;  3E0J A;  2F4I A;  5IGC A;  2D5D A;  4CJ1 B;  1G8Z D;  3SHL A;  1FGB D;  5JVG 3;  1OXV A;  2Z8L A;  3AB9 A;  2PZT A;  4KKS A;  2J7Z A;  1IW7 D;  1PTO B;  2F0J A;  4NW2 A;  2BOS A;  1LTG D;  3OIP A;  3S1Q B;  3MTS A;  1II3 A;  1WTR A;  3R3O A;  1HFN A;  4S3S A;  1GUG A;  5KGU A;  1WTX A;  1UUP A;  1Y69 U;  1CHQ D;  2EYP A;  3U9S A;  4CJ2 C;  1EY6 A;  1C4Q A;  3PMF A;  3X3N A;  3GD7 A;  1Q1B A;  3P1H A;  4CHT B;  3R8B A;  3ZYY X;  3FMC A;  1TQO A;  3I3C A;  4OGQ C;  4OIK A;  3S9W A;  2ZT9 C;  3HOW B;  2IL8 A;  2KUM A;  1CZG A;  1E2W A;  3GV3 A;  1NCV A;  4X3K A;  5KYL A;  2M9V A;  3NSW A;  4FXG C;  1I4Q A;  4KJN A;  2NVT B;  4IAL A;  2E76 C;  3O13 A;  1PMR A;  2F0U A;  2LFN A;  1EY5 A;  2F0D A;  5HUR A;  3K7A B;  4PMW A;  1F2M A;  4MHE A;  2WKD A;  4Z9C B;  3SEB A;  2B2Y A;  1ZKO A;  3A56 A;  3S14 B;  4DNT B;  3FPU B;  2B2Y C;  4X3U A;  1DON A;  3VA5 A;  5DAU A;  4G4K A;  1SJH D;  1TS4 A;  4ZQ3 A;  2K6A A;  5CMD A;  5KNC A;  4GZY C;  4H44 C;  1YNJ D;  1H9J A;  2EY5 A;  2JP1 A;  2SNM A;  1IYV A;  3ERQ A;  1JR0 D;  1SDF A;  1BCP F;  3S2H B;  3RUZ A;  3FKI B;  1SNO A;  2JE6 I;  5C5L A;  4RCO A;  1SYD A;  3T16 A;  1A3V A;  2JA6 B;  3IL8 A;  2NN6 H;  1HFG A;  4XT1 B;  4K8J A;  3GTL B;  4A3J B;  4FF2 A;  1ILQ A;  5K5P A;  1JB3 A;  4XIG S;  3T53 B;  5A2Q E;  2JA7 B;  1JC7 A;  1EOT A;  4C3H G;  4C56 C;  3FVQ A;  1SYG A;  4DAY A;  2ZXO A;  1NSN S;  4E6I A;  4H7B A;  3CRL C;  3J81 E;  2XWJ B;  5J22 A;  1VCI A;  2X69 A;  2Z1C A;  2PO4 A;  3VYS A;  4QUC A;  1WD0 A;  2EJM A;  1F9Q A;  3KBX A;  1QOH A;  1A6X A;  4C3J B;  2F0W A;  2FIN B;  5E1F A;  3GTG B;  3VR2 A;  1I4H A;  4KK7 A;  4LK1 C;  2A6H D;  1F2Z A;  5BN4 A;  1QNU A;  2EXZ A;  3BYT B;  1HA5 A;  1STY A;  3DM1 A;  2B8G A;  1AEX A;  3I90 A;  2IJ0 A;  4R8I A;  4KTA A;  2KED A;  1VF5 C;  1WVL A;  1AFP A;  1ROD A;  2Q8T A;  1CHP D;  3SVM A;  1DXM A;  1G2S A;  1STB A;  3M7G A;  3IFD A;  5JEA G;  2AWN A;  2SDF A;  3KK7 A;  5IOD A;  4V0B A;  5D3I B;  5FLX L;  1DOK A;  4IUT A;  5C3X A;  2BE5 C;  5IGB A;  5C0X I;  1A2T A;  2Q8R E;  3NWS A;  3I73 A;  3ND8 A;  3W3A A;  3T51 B;  3HOZ B;  1Q90 A;  1GUN A;  1KNE A;  4FXD A;  1S5F D;  3HKZ B;  3C1F A;  3BDC A;  5NUC A;  3TN2 A;  3FDT A;  3GTM B;  1AW7 A;  2DN8 A;  4K2K A;  1L0X B;  4M8A A;  1I4P A;  3RZD B;  4I7Z C;  1HUM A;  4BBS B;  5EPL A;  4IQZ A;  2V4D A;  5CBE E;  4K8I A;  4FXK C;  1STN A;  1UAP A;  2EPB A;  1TII D;  4NP5 A;  3PIP 3;  3ITP A;  5KRU A;  2HQE A;  2PNR C;  4ODG A;  1GHK A;  2R7Z B;  3MVV A;  3EFX D;  4IFD J;  3KLS X;  4IFD I;  1I4X A;  1PTO C;  1NR4 A;  5LL6 S;  1ESF A;  3MHB A;  5EPK A;  2LMC B;  1AZQ A;  2OF1 A;  3AU7 A;  5ELC A;  1Q1E A;  4N9P A;  2KEE A;  2JEA I;  5C4X B;  3BS1 A;  1LTI D;  1R4P B;  3TP5 A;  1D6E C;  3I72 A;  1Y8N B;  2F0P A;  4J8Q A;  1G6Z A;  1I50 B;  2EDG A;  3G6J B;  3KF8 A;  4C3J G;  1NAP A;  1PRT F;  3QIA A;  1TWC B;  1Z6H A;  3DEO A;  4K5W A;  3PUZ A;  1HPC A;  5EBC A;  1GHJ A;  2EJG C;  5JJZ A;  3I4N B;  1W6K A;  4XTC S;  3A8I E;  4H13 C;  2PZW A;  5K36 H;  5CBA E;  1PZJ D;  3MAQ A;  2BDN A;  1EYA A;  1YNN D;  2L9H A;  1RJT A;  1MI2 A;  2OT2 A;  2F0Q A;  2XWB B;  4TSS A;  2B2T A;  2MJ8 A;  3S15 B;  1SNP A;  3NTK A;  4EQO A;  2R61 A;  5KYI A;  2B2T C;  2ZXP A;  1JOK A;  4OO1 I;  2A68 D;  2XVS A;  4IN3 A;  3V96 A;  1PYW D;  4EQN A;  2XN9 C;  1V8Q A;  1KAA A;  3CU7 A;  1QE6 A;  1C8C A;  1BUV T;  3PV0 A;  5C0X H;  4J6H A;  2R92 B;  4RFB A;  3F2U A;  1I3Q B;  4R8N A;  1TS3 A;  2AUK A;  4UDU C;  3Q24 A;  3J7A F;  1SYF A;  1HQM C;  2TMP A;  4RCN A;  1CI3 M;  5CYU A;  1CFM A;  1MBY A;  4G7O C;  2F0K A;  2MHV A;  2A5H A;  3CKI B;  4L6T B;  1HQR D;  2E74 C;  4DFA A;  4ULL A;  4B08 A;  4A3G B;  3M3Y B;  3D3R A;  3IAY A;  4HN7 A;  2KVM A;  2A6E D;  5CC4 A;  3LWE A;  3D8G A;  3K5N A;  1SJE D;  2F0T A;  1Y1W B;  4BA1 I;  4IUN A;  2L1B A;  3A8J E;  4IUR A;  1GUS A;  4NKL A;  4ME5 A;  4KJO A;  5M5W B;  2F3V A;  5JPM C;  4DAV A;  1WTW A;  2RBM A;  3QO2 A;  3NP8 A;  5FO8 B;  1B2T A;  1Y8O B;  2L12 A;  5CV7 A;  3WDN A;  1STA A;  2NZ1 D;  5G3L F;  2SNS A;  3ONA B;  5IIF A;  5DEH A;  1FNV A;  1G91 A;  3PIO 3;  4QB4 A;  4FF3 A;  4H0L C;  3NHH A;  2XIW A;  4BS9 A;  2DY8 A;  1V1O A;  1MSH A;  1XYI A;  5C3E B;  3Q22 A;  5C3W A;  1ET9 A;  2CQA A;  3SK8 A;  3H3V C;  3T4A C;  5ELE A;  3EQL C;  1B1Z A;  4DK0 A;  1LLR D;  1DYQ A;  1L0Y B;  2K04 A;  1BCP D;  1QB5 D;  4Y7N B;  3S17 B;  3JAM L;  2NYZ D;  3J80 E;  4MIU A;  1LO5 D;  3M4O B;  4HSV A;  3D6W A;  4A3I B;  1OXS C;  2K5Q A;  1A2U A;  5EKK A;  2B2V A;  2MP1 A;  2A74 C;  4FF4 A;  4K5V A;  1SNC A;  4HSP A;  1LT6 D;  3E6Z X;  1SYC A;  2WV6 D;  3NTI A;  2D62 A;  2TSS A;  5TSS A;  2JSO A;  4OO1 H;  2F0F A;  2NTT A;  1ICW A;  2NBF A;  4LAA A;  4HAE A;  3RMH A;  4RA8 A;  5IGF A;  2PW7 A;  1D5X C;  2NB0 A;  2QIL A;  4BBR B;  1K8O A;  2KJX A;  2RDH A;  3TP8 A;  4G57 A;  3NPP A;  1IYU A;  5IT9 L;  2VXW A;  3CHB D;  5I9P A;  3TDQ A;  3HP3 A;  2CW0 D;  3KLS A;  4KHZ A;  3M4Y A;  4Q0F A;  1SMY D;  3J7Y W;  1EFI D;  1STH A;  1VF7 A;  1CA6 A;  3K57 A;  3M7N A;  3Q23 A;  3BG3 A;  4FO2 A;  3A7A B;  4OL7 A;  1EY8 A;  2ENB A;  1C48 A;  2OEO A;  3PO3 B;  3K0Y A;  4P2C B;  1IKL A;  3S2D B;  2A69 C;  5AFW A;  5M9O A;  2GA4 B;  1I6V C;  4PNY A;  4B9W A;  3JAM E;  1CT1 D;  1A3U A;  1DJR D;  1HTL D;  2CHB D;  1M4V A;  2WAC A;  3LWU A;  3QOL A;  1CK1 A;  3NBI A;  2B2U A;  5JAV A;  1EY4 A;  5EQ0 A;  3MXG A;  2O5I C;  4HED A;  2N88 A;  3A54 A;  1VMP A;  2B2U C;  2F0M A;  1SYE A;  5ELB A;  4X3T A;  5CV6 A;  4F87 A;  2FMM A;  2QCP X;  2PPB C;  3H94 A;  5CV4 A;  1PTO F;  3S16 B;  2K32 A;  3OOC A;  3T13 A;  4U67 3;  1U4R A;  1WCM B;  1U9R A;  1ILP A;  1LAB A;  2ICE C;  2KQ3 A;  4DF7 A;  1HHV A;  4NDX A;  5M3M B;  5JEA J;  4QMG A;  3SR1 A;  2BA1 A;  4RKB A;  3OPO A;  4FF1 A;  1S5E D;  2K28 A;  2X6G A;  4KKT A;  3VR6 A;  2VUM B;  4A93 B;  5ISR A;  1O80 A;  1R9T B;  4WFN 3;  1EY7 A;  4ZK9 B;  1TT2 A;  1EY0 A;  4EGV A;  5DNF A;  4B9X A;  3T56 B;  3X3M A;  2I46 A;  2HCI A;  2O5J C;  3MXN A;  3I8Z A;  5C6A A;  1RF2 D;  5FK9 C;  3MEH A;  4KN4 C;  1EEI D;  1PRT D;  3FEW X;  1ONL A;  2M00 A;  3H91 A;  1SBB B;  1J8I A;  3H09 A;  3GO5 A;  3EJI A;  5JPN C;  3K5O A;  2E2I B;  5T1G A;  3ERO A;  3DWQ A;  3DWP A;  5C4Z A;  2EE1 A;  2PCF B;  3DMU A;  2L11 A;  1AP0 A;  3GTJ B;  3OIQ A;  1I4R A;  2Q8I B;  2L4N A;  1RCV D;  4LJZ C;  1DOL A;  3TME A;  2WII B;  5C44 B;  1Q8I A;  4XQJ A;  2L0C A;  3IFT A;  2R6G A;  4R9W A;  4O1N A;  5DM6 3;  1ESR A;  2ICI A;  3S1N B;  1B9N A;  4J1M A;  2R3Z A;  5BN3 A;  4RHR A;  4NMZ A;  1TVX A;  1KAB A;  3N52 A;  1IL8 A;  1AZP A;  1KDB A;  2KHS A;  1Z7T A;  3K5M A;  1SEB D;  5T1I A;  1Y1V B;  2F0V A;  3DUZ A;  1ZYR C;  1JCK B;  3DHQ A;  1RKN A;  2C9O A;  1K8M A;  2YU9 B;  1QCB D;  1GUT A;  4X3S A;  2G9H D;  3TZD A;  4FP5 D;  3BVZ A;  2JA8 B;  4ZYS A;  1B4O A;  1IW7 C;  2AUJ D;  5EBD A;  2EYO A;  3SXH A;  1VMC A;  1SFO B;  4PV1 C;  1V43 A;  3I4L A;  3QB3 A;  5IGG A;  1HCZ A;  3C3L A;  1K83 B;  3LNN A;  5FLX E;  5LL6 X;  4DNR B;  4KKU A;  1ENA A;  3P20 A;  1BQQ T;  1JOO A;  5I2X A;  1FYC A;  1TWA B;  3MXP A;  4QIW B;  1QWY A;  4ZAI A;  5M5X B;  3I70 A;  3N6R A;  3BVM A;  1BXT A;  4RHS A;  4V19 0;  1F9S A;  3P75 A;  1BO0 A;  3L9A X;  4ZLT F;  4KD3 A;  4DXG A;  3LX0 A;  2O4X A;  5E4W C;  2RDG A;  2ZXR A;  4DGZ A;  5IGE A;  5I6Y A;  2WB1 B;  4RAU C;  1ML0 D;  1BBX C;  1D1K A;  2PW5 A;  3QOJ A;  5G3L D;  4C3I B;  2IWH A;  3D6C A;  2E2J B;  2NWG A;  3RLF A;  3PUY A;  1R4Q B;  1B9M A;  4A3K B;  1F9P A;  2E2H B;  3GTQ B;  5LHY 1;  4PMC A;  3NWT A;  2FJ2 A;  4RGT A;  1EZ8 A;  1JWS D;  2B8F A;  4HR7 B;  3FPP A;  1YNJ C;  2MPM A;  1EU4 A;  1RTO A;  5HGT A;  1AN8 A;  3K59 A;  2RVL A;  2RSO A;  4G7H C;  3CQZ B;  3GTP B;  1UEA B;  2K7V A;  2NVX B;  2WKC A;  2IX3 A;  2BA0 A;  4KV6 A;  1HRJ A;  4Q5V A;  4AYB B;  1ENF A;  2K01 A;  2JXM B;  3BYY B;  5EGT A;  2H1E A;  3V2T A;  1BNZ A;  3KUP A;  1QJO A;  4ILW A;  2EVB A;  1DOM A;  1TU2 B;  3OSO A;  1JOR A;  3SE0 A;  2MGS A;  1OO9 B;  1MSG A;  1DD2 A;  1S5D D;  3NXW A;  2RQX A;  4F7X A;  1GXD C;  3S1R B;  1STG A;  1WTO A;  2WIN B;  1HTP A;  2NUC A;  4YIJ A;  3TSS A;  1RHP A;  4IFD H;  1FNW A;  3CRK C;  2DNC A;  2KOL A;  2K05 A;  2JEB I;  2A6H C;  3PUX A;  1O7Y A;  2SEB D;  5COR A;  3E5S A;  2KA7 A;  3U9O A;  3TP7 A;  3A8K E;  4N9T A;  3MA2 B;  3C46 A;  1EZ6 A;  1JWU D;  2BE5 D;  2QDB A;  2IW3 A;  1DZ1 A;  3VR4 A;  4XT3 B;  1GOZ A;  5E4X A;  3R2I A;  3C1E A;  5COY A;  1PZI D;  1RTN A;  4BY7 B;  4G7Z C;  3OWF A;  4IZ8 A;  1E0B A;  3VR3 A;  4OIJ A;  2DY7 A;  1LTT D;  1BDO A;  1FNU A;  4A3M B;  4DN4 M;  2PYK A;  4QCL A;  3I91 A;  3L3O C;  3HG9 A;  1STE A;  4JBW A;  2AQ3 B;  5FO7 B;  4WRD A;  3W2D A;  3MFY A;  1DM0 B;  2LKV A;  4KN7 C;  3D4D A;  2EOT A;  1RD9 D;  2EY6 A;  2IX1 A;  1XXG A;  1JOQ A;  2RSN A;  4KMU C;  4A3F B;  1H9S A;  3K58 A;  5D14 A;  1OXX K;  2BDO A;  4ZUJ A;  5C5M A;  4PQX A;  4WOR A;  4K5X A;  1SYB A;  4XQN A;  1D5Z C;  1KNA A;  5CV8 A;  1G2T A;  4LMQ D;  4A3E B;  2NN6 G;  2B2V C;  4DK1 A;  2RKS A;  2CVR A;  1HXY D;  1PTO D;  1CM9 A;  1PFN A;  1KDC A;  1H9K A;  1PDQ A;  1X3P A;  3NQI A;  4K2L A;  3RD4 A;  4FYD A;  2JA5 B;  3VYT A;  3SDZ A;  1SXT A;  2AWO A;  3TP6 A;  1KDA A;  3NBH A;  2IPK D;  4OHJ A;  2RDF A;  2WP8 J;  3MFG A;  4EQP A;  3HEJ A;  1M8A A;  1EU3 A;  1GUO A;  2B2W A;  5I2Y A;  1HA6 A;  2F1M A;  2EZV A;  1TWH B;  4RH6 A;  3Q0A A;  3IKJ A;  3GV6 A;  2B2W C;  5A2Q L;  1LV9 A;  1TR5 A;  1LT4 D;  3G7L A;  1WD1 A;  3J81 L;  3HOV B;  3HZX A;  1TY2 A;  5EPJ A;  3AMU A;  2PQE A;  2F0O A;  4XXE A;  2N55 A;  3BVG A;  4XQQ A;  2F0N A;  3VYR A;  2FFK B;  2FHT A;  3NQT A;  1B3A A;  1SNM A;  3MWY W;  3R93 A;  1MGS A;  2NTS A;  1ZXT A;  2E75 C;  2K5W A;  4ABN A;  2B39 A;  1D1I A;  3NTH A;  2EYM A;  3BDL A;  4CGY B;  4ZUI A;  4KY6 A;  1QG7 A;  3OW7 A;  3A55 A;  3QG1 A;  1YNN C;  2D2C C;  3OHX C;  1EIG A;  1DCZ A;  1D5M C;  4F8M A;  5ELD A;  2AQ1 B;  3SK4 A;  4CKE A;  1EWC A;  3K6O A;  3NK9 A;  4KI0 A;  1Q12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...