2E2DC

Flexibility and variability of timp binding: x-ray structure of the complex between collagenase-3/mmp-13 and timp-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
180
Chain Sequence
CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEYLIAGKAEGNGNMHITLCDFIVPWDTLSATQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Flexibility and Variability of TIMP Binding: X-ray Structure of the Complex Between Collagenase-3/MMP-13 and TIMP-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Matrix metallopeptidase 13
total genus 43
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2006-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2e2dC02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 2e2dC01
1BQQT 3L3OC 3HRZC 5FO7B 3HS0C 1UEAB 2J0TD 2A73B 5JPMC 3KLSA 3V96A 1GXDC 5FO8B 2I07B 2WINB 4ILWA 1JB3A 1BR9A 1PXUA 2QKIC 3FRPB 3I70A 4FXGC 3G6JB 2B39A 3MA2B 1OO9B 3OHXC 3T4AC 1BUVT 2A74C 3CKIB 2WIIB 2XWBB 3CU7A 2E2DC 4FXKC 2XWJB 1UAPA 2TMPA 1D2BA 2ICEC 1JC7A 1XWEA 5JPNC 5FO9B 5FOBB
chains in the Genus database with same CATH superfamily
1I4GA 2Z8LA 4U68A 2UUCQ 2JP1A 4IUPA 3HOYH 1IYJB 1WVLA 4HMJA 1CSPA 2B29A 2YTXA 2B63H 3S1NB 5LMNW 4HJ7A 3K57A 4A3JB 3OIPA 2J4XA 3DHQA 1I4QA 1YHBA 1NJIC 3NEMA 4X3SA 2E2JB 3BVZA 4BY1B 4DR5Q 1B3AA 4C1NI 2K01A 1SNQA 4NMZA 3G4SA 5KRUA 1GUGA 3VA7A 5TSSA 4DK1A 1Q7YC 1FNVA 1PYBA 2F0NA 2A6HD 3EBEA 2IJ0A 1JWMD 4OO1G 4A3CG 1MI2A 4DR7L 3GTLH 1MIUA 1DCZA 1TWCB 5KEEA 2EDGA 3N6RA 1IKMA 4GKJQ 2Z9HA 3H6MA 2NTTA 2VQEL 4DR4L 4DV6Q 4C3HG 3M3YH 3S24A 2D0OA 4H44C 4A3EB 4DNIA 4QIWE 1DZ1A 2B2UA 3H91A 1X3PA 4LF8Q 2YU9H 3T53B 4BY1H 2E5LL 1DONA 2R61A 1SDFA 3PO2G 2WINB 4DR6L 2NN6H 3GD7A 3OW2A 1EU4A 3A7LA 2XTIA 4LFBL 3A56A 1JOQA 4E6IA 2BA0A 2WV6D 4LF4Q 4H13C 3OTOL 2X69A 4HJ5A 4X64L 2WIIB 4Y52H 3H3VI 3EVQA 1WFQA 1MBYA 5C0XG 3HOWH 2OF1A 1C0AA 3VDYA 1KAAA 5IYDH 2AUJD 1I6VC 4C3HH 2N3SA 4X64Q 3HGBA 3PUVA 4C3JB 5JOBA 4X62L 2B8FA 4HEDA 5EPLA 2F4VQ 1VF5C 2JA6B 2NYZD 4ILWA 5EBCA 4IPHA 1RL2A 4GN4B 3T4AC 2IX1A 1CKNB 4A3CH 5GAEC 2IHFA 4JI5Q 4L6TB 4UP8A 4F87A 3SHLA 4BA1I 4A3BH 1SE4A 1LT3D 4C3IH 4IJLA 2LXJA 3OMGA 3TP8A 5HGTA 1UNSA 1CA6A 1AW7A 3ITPA 4JI8L 1PYWD 3QB3A 5IGBA 4DUYQ 4ID6A 4BA2I 4GKJL 1TWAB 4QL5A 2M00A 1WJJA 1YHQA 3F2CA 3R2IA 3MXNA 4QIWB 1H9SB 5C5MA 3DEPA 2RHQB 2AQ2B 1XPRA 1WTVA 2UXCQ 1R9TH 1R9TB 4B3SL 3S16H 2JA5G 2R93B 2F4IA 4A3GG 1F2YA 4TVAB 2QILA 1BDOA 2K7VA 1KRTA 4AIMA 1B50A 1O7ZA 3E0JA 2HHHL 1YNND 1Y1VG 4DU9A 4KKTA 1XNQL 5ELFA 1VQNA 1IW7D 3G6EA 2HQEA 4A3IG 1O7LA 2PPBC 3A0JA 3SDZA 1SR3A 1KHIA 5CGKA 4A3FG 2EJGC 2CW0C 4N9TA 3FKIB 1E22A 5FLMG 1FGBD 2A74C 1V1PA 4H0LC 1MD2D 2KHJA 2CCZA 4JBKA 2B2WC 4CDCC 1YJWA 1VQEA 1IW7C 1ZYRC 2K28A 2A68C 2UXDL 1J9OA 3H09A 3S15B 2MGSA 4ZKCB 1ZYRD 2JA6H 1Y1VH 4B9WA 2E2HB 3TQYA 3AMUA 3HKZE 3MXGA 5GROA 4B3TL 2F0JA 2UXBQ 2EZVA 1LTTD 2BDOA 2Z6KA 3HG9A 4RG1A 3PO3B 3VR2A 4XQNA 1G2TA 4A3FH 3R2TA 3A55A 4DF7A 1CTMA 3M4OB 1G2SA 3MFYA 1D5XC 4IOAA 2B2VC 1HR0Q 1TVXA 2NB0A 2N8NA 2NBFA 3P20A 5IT9c 1KNAA 2L55A 1SMXA 2PW5A 1DXMA 1JJGA 2RCNA 1IHZA 4K0KL 4DN4M 3MXNB 1WYDA 4A3EG 2LSSA 4H7BA 3TP7A 5FLXL 4IUTA 2F0EA 2JN4A 1XPUA 2CKZB 2BE5D 2F0SA 4K0KQ 1NUCA 4A3DG 1Y1WH 3CCLA 1SJHD 3CCQA 3VR4A 1CHQD 3QWNA 4A3MG 1BNZA 2D9UA 4XYQA 2HCCA 3H94A 1SNOA 3M4QA 3J81L 1VF7A 1JCKB 3K5MA 5I9PA 1CZGA 1E1TA 1PTOF 2E2JH 5ELDA 1O78A 2ES2A 3K6OA 4PMCA 2K75A 3I4NH 4K5VA 4C1NK 2E74C 3A8IE 2O5IC 4DAYB 4HSVA 1CFMA 5IGCA 2F4VL 1C7YA 5DAUA 2ALYB 2WAQE 2NUCA 2VXWA 3HOVH 1E1OA 1H95A 3R93A 1W2BA 1P16A 2MFIA 3IFTA 1STNA 2Q2UA 3T51B 1QJOA 4AYBB 2B2YC 4L5RC 1V43A 1B9MA 1VQBA 1Q1BA 4RH6A 5HURA 3RN5A 4KLKA 4YHHL 2A8VA 5EKKA 3PCOB 1U4LA 5A2QE 3IKJA 5DNFA 1N36Q 3P7JA 1BCPB 4A3LH 1QILA 4FNFA 4A3EH 4MTNA 1D6EC 2ZXPA 3A5ZB 3S2HB 1B1ZA 4JI1L 4BBSH 5D14A 1A2UA 2CVRA 2EJMA 1Y8PB 2CW0D 1WCMH 1YJ9A 2VZAA 1Z6HA 1CKNA 3OSOA 4KY5A 1QVGA 5C0XJ 1Q81C 1KD1C 1D7QA 1FNWA 2R92H 1A6XA 2OTJA 1KL9A 4JI4L 2ZJQA 2PZWA 4R4TA 5CC4A 1I4PA 5I6YA 1S72A 1KDAA 4DR2L 1RKNA 4DUYL 1STHA 2RKSA 1FNUA 1TY2A 2VS1A 4L5QA 4A3FB 1E2ZA 2OQ0A 4LFAQ 4JI2Q 3LWUA 5IYBH 1SNCA 4RMFA 1QUQA 4QUFA 2UXCL 5I4DA 4BBSG 1TXYA 2DJFC 3ER0A 4C3IG 3DEOA 3NXWA 1PRTB 5IIFA 3M7GA 1IBLL 1E0BA 2TSSA 2Z0SA 2N88A 3GTKH 4G7HC 3O13A 4XQQA 5JEAH 2PQAB 5IP7H 4RCOA 4B3ML 2LY7A 2X6GA 4JK1C 1WTWA 3M4YA 4RGNA 3NQTA 5EBDA 1HFGA 3PIP3 1NE3A 1ILQA 4R8IA 2JYOA 1VS0A 1TWFB 4OWXB 2K33A 1YVCA 3RUZA 5COYA 2KEEA 1EWCA 2K32A 4CDDC 4LF6Q 1JICA 2FHTA 4C3HB 3HOZH 1CI3M 2K6AA 3BZDB 3F2DA 4JV5Q 1GHJA 2OEOA 4NP5A 1PFNA 1L1OA 3CCRA 3TMEA 4A3DH 3UE1A 1TS2A 3AU7A 2A1AA 2EY6A 4CDFC 3S17H 1G51A 3HRZC 4DAMA 2Z4HA 3SK5A 3S9WA 1JWSD 2HIXA 4R4QA 5A2QL 5JJIA 4G57A 3FHWA 4ZYSA 4DNRB 1QVFA 1S40A 2R7DA 2JEAI 1PXUA 2QKIC 1EIHA 2E2IH 2D62A 3CCVA 1HNWL 1N33L 1CZWA 2MO1A 5M5WH 2F0UA 1WCMB 5AFWA 4AH6A 1HUMA 2WB1E 1EL0A 3DUZA 2R7ZB 2A73B 1PMRA 3KOJA 2O5JC 4DV3L 1STGA 4JI3Q 2F0IA 2B2YA 2F0HA 2XNAC 3L0OA 3R3OA 3BVMA 3DLLA 3HP3A 1W3SA 4JBJA 3KLRA 1SFOH 2M2LA 4WJWA 5DEHA 2L5TA 5A35A 3QG1A 3OMCA 2DN8A 4YCUA 2WACA 1LABA 4P2CB 2K5NA 2YTYA 3MHBA 2CFMA 5J39A 4EVOA 5ELOA 4NXMQ 3UDIA 1AZPA 2IW3A 1KNEA 5IGGA 4R9WA 2UUBL 4KHVA 3BU2A 4POFA 5FLXc 3GV6A 2Z4IA 4HJ8A 5H1SE 1LTAD 2E8GA 1IBKQ 1F2ZA 3K0YA 2UUAQ 2WAQG 2PW7A 1RF2D 2A69C 2SNMA 4ZAIA 1A3VA 4BXXG 1RCVD 2OWOA 4BS9A 3PV0A 4HIDA 1ESRA 3D8GA 2FFKB 1NMGA 1LTGD 3A7AB 2EJFC 4OXPA 5ISRA 1N34Q 1ET9A 1QB5D 1VQOA 1H9MA 1MSGA 2NVQH 1VQPA 2XN9C 1N36L 1DOLA 3L7ZC 1X55A 1XXGA 2TMPA 4G4KA 1F2LA 4KHZA 1QNUA 1X3EA 3KBXA 3T13A 3CMAA 2EVBA 5FO7B 3OWFA 1PYSB 3M4PA 1VDZA 1CT1D 3IL8A 2Q8IB 4P71A 1C8CA 1B2TA 4O1NA 1PH4A 4A93B 3K5NA 3HOVG 1AH9A 3IRBA 3K5LA 4JI7L 2K04A 5KNBA 3ERQA 3Q24A 3T1YQ 1LTLA 1ENFA 3DWAA 4FXKC 1BCPC 1UAPA 3VA5A 4FDBA 2B63B 4JOIC 2MJ8A 3Q0AA 2E2HH 2MPMA 3I4MB 4DNTB 1IBML 3CQZH 1IBLQ 1BO0A 3GQBA 3OYYA 2RQXA 3I2ZA 3I8ZA 3ND8A 5M3FB 1AE2A 4WJ4A 4R4CA 5C3XA 3S1MH 3DWPA 5G3LF 5E3FA 1LYLA 2B39A 2R7ZH 3CD6A 4C2MH 1UE6A 3NELA 4P75A 1FVIA 4DA2A 1PV4A 4OIJA 4A93H 4A3JG 1X3QA 5EGTA 4LF6L 4DV1L 5ELCA 1C4QA 4F88A 2ZXRA 5IT9L 5JJKA 3V96A 4PZ8A 3GTGB 3GTPB 2QGQA 4PNYA 1LTSD 1TWHH 2J7ZA 1BCPD 1F9PA 4FXDA 3G6JB 1N32L 3PUZA 1IL2A 4DGZA 1MJEA 2R7ZG 3CF5A 1HR0L 2RDFA 3J80L 1HA6A 4K5WA 2JA7B 2PZTA 4K8IA 3SVMA 2JJQA 2EOTA 3GP7A 4OO1I 3HOZG 4FF2A 1CQFA 4KMUC 2JK8A 3CCMA 1SE2A 2ENBA 1NAPA 2OT2A 5JJZA 1KTKA 4DV0Q 4I7AA 1BVSA 4UP7A 1WTOA 2WB1B 1E2WA 2SDFA 1ILPA 2Q2HA 3EN2A 4UP9A 1MSHA 2HIVA 1ENCA 4QJFA 2EYMA 4JI2L 1LT4D 1G6PA 5CV4A 1PLFA 4DAPA 4EQ5A 3EIVA 4TRDA 3MEFA 1S5DD 1VQAA 4DKAC 2WKDA 1WTRA 2B2UC 4A93G 4A3KH 1Y8NB 1MKHA 4ZK9B 2Y0SE 1LO5D 4CJ0B 1LUZA 4LF9Q 2DGYA 2AQ3B 2K03A 4LFCQ 2K5QA 5K36H 3NTHA 4XT3B 1SLJA 3GTMB 1HNXQ 3J80c 1O7YA 1NMFA 1YBYA 4KD4A 1UE1A 3DM1A 5AJ3L 5M3MH 1SN8A 1X32A 1II3A 1RDPD 3E9HA 2WP8J 5C3WA 4A3MB 3F2UA 3VYUA 3KF8B 3M3YB 2DJGC 2HDMA 3EQLC 1KDCA 4J8QA 4FO2A 2UUAL 2NVTB 3TSSA 3BZKA 1TS5A 3CHBD 4DV4L 3GTQH 2N49A 2I0QA 5DLQE 3H15A 1PFMA 3M9BA 1EEID 1ASYA 2CWPA 4HJ9A 3RD4A 1JORA 1HTLD 1U4PA 1ML0D 3OOCA 2C35B 4NB3A 3J7A5 1XNRL 4IFDI 3FDTA 3J7ZC 4MN3A 2D2CC 3SK4A 2F0GA 2XVSA 2FINB 2H4OA 4HIMA 1N8RC 1I3QH 3F8TA 4EQPA 1SYGA 2O4XA 2EY2A 3I4MG 5GAHC 3GTOB 2ZXOA 1I6HB 2JA7G 2PNHA 3S14H 5E4WC 4JI4Q 2H1EA 2L4NA 4YWMA 3M85A 4QGUA 1B4OA 3J81E 5K5PA 4JYAL 5J1ZA 1JR0D 1K28A 1LTRD 1W6JA 4PZ6A 3NHHA 3VYTA 4OX9L 1QZGA 4DV3Q 2Q2IA 3MAQA 4FXGC 1WD0A 1I50H 2E76C 4GNXC 4HCSA 5IGFA 3KUPA 3UDXA 4HJAA 4RGTA 2PI2E 5D65A 4CGYB 1ZEQX 2KECA 1QG7A 3DWQA 4DXGA 1EQQA 1BR9A 1NTGA 1X6OA 3KBGA 2HCIA 2IHEA 3PO3G 1BXTA 3NPPA 3SEBA 2LMCB 4ABNA 1YI2A 2PZUA 1NY4A 5KNDA 2N78A 4JI6L 2QCPX 3GTLB 1PZID 2MQHA 3G7LA 3IAYA 4FYDA 1TT2A 3BDOA 3NWSA 4IJHA 3I70A 1ENAA 5KIXA 2NZOA 1OO9B 5FJ8G 2F0WA 3BDLA 5LMNQ 1EYCA 2SOBA 3V05A 1VQ6A 4CHTB 1GUTA 3S1RB 5J3BA 4DR5L 2C5CA 4YWLA 3CCEA 4DR7Q 3D6WA 3GTQB 4A3IH 2BA1A 4H02A 5C4XH 4DK0A 1G291 1QE6A 2HDLA 3G71A 4WORA 1STEA 4HAEA 3RZDB 5I2YA 4YCVA 3TREA 5LMUQ 5IYDG 3TS0A 4RCNA 3PO2B 1ZKOA 5JEAG 3STBD 4LWCA 2KBNA 5BR8Q 3GTJB 1QWYA 3GTMH 5C4JH 4GN5A 1WOCA 3EJIA 1VQ8A 3BYTB 5GQOA 5CBAE 3HOUH 4XYOA 1ASZA 5T1IA 1EZ6A 1F2MA 3PIPA 3S1NH 5C3EG 1U4RA 4V190 3W1BA 2L15A 4XDXA 3AB9A 3K80C 4NPSA 4JBMA 3EROA 1EWIA 3U9OA 3CC2A 1RTOA 1A0IA 5HY6A 1E2VA 2V4DA 4TKOB 2KOLA 1HHVA 1JT8A 1XWEA 1WTPA 4AYBG 1SE8A 3CC7A 2KVMA 1VQ4A 5FJ8H 4DR3L 1KIXA 3BJUA 4AQYQ 1IL8A 2K14A 1K0SA 5DM63 1CK1A 3ZJYC 2AHOB 2F0OA 2EQSA 4G7OC 2X6LA 2ATWA 1EQRA 2K52A 3FRPB 3K7AB 1G91A 4LF8L 2RDGA 3K7AH 2CHBD 2NVYB 1KQSA 5AJ3Q 1FGUA 4YY3Q 1WCMG 3I3CA 1JE5A 4LJZC 1A8VA 3CRLC 3JAMi 2MP1A 4HIOA 5FKAC 1WTHA 1EY0A 1STBA 4GOPB 1G8ZD 1N34L 4BY1G 2PQEA 3JAME 1PH6A 2PCFB 2ZJPA 1A15A 1BBUA 2FMCA 4K6LA 3S2HH 4JYAQ 2CH4W 2A19A 2OQKA 2R3ZA 4KD3A 1XNRQ 1PTOC 4JPBW 2GVAA 1IKLA 3W2DA 1RD9D 1K9MC 4C2MB 5FK9C 4DAYA 1XMQQ 1GKHA 3OTOQ 3QO2A 1YJNA 1OXVA 1SFOB 4DK6C 4GLVB 4A3LG 2XWJB 1VQCA 4LK1C 2UXDQ 3I56A 3BG3A 4X66Q 4BXXH 1Q8IA 2EPBA 5D3IB 1K8OA 3WOEA 3GV3A 1J5EQ 4ZCKA 4RKBA 4KI0A 4GZYC 1I94Q 1TS4A 1GJXA 1JB3A 2OXPA 3WDNA 3DXJC 1PTOD 2AWNA 1LV9A 1EUJA 4K5XA 2XIWA 1XNQQ 2R93H 2JEBI 2JA9A 4DV7Q 2KUMA 3RN2A 4LF4L 1HZBA 1SJED 1E3PA 5C0XI 1XMOQ 1LTID 1A2TA 4S3SA 1Y14B 2F0KA 2NVYH 5GAGC 4DXFA 4A3DB 4A3BB 4JI5L 4C56C 4C3IB 3UDFA 4RGOS 5BN5A 2Q8TA 1M1KC 3K58A 2EXZA 3K7UC 3C2PA 4DV5Q 1KC8C 2L9HA 1GD7A 3RLOA 5K36G 2KEDA 3PIOA 3S1MB 4XIGS 3CCJA 5M3MB 1DD2A 1F9RA 3RNUA 5M5XB 1TQOA 5CV7A 4OIKA 2R7FA 4NW2A 3HOWB 4DUZQ 1MJCA 1FD7D 3MC0B 4LNQA 3NBHB 3HKZB 2K5WA 3GDEA 1QZHA 2D5DA 1NBWA 4IALA 2KCNA 1HR0W 1HNZQ 1V8QA 1M4VA 2EYPA 1HA5A 4LF9L 4OHJA 1EYDA 4KV6A 4CKBA 4QCLA 1EOVA 3LWEA 4OGQC 3CCSA 4HIKA 5JVH3 1ICFB 2VW9A 4DFAA 2KHIA 5IYCG 5KGUA 2IT1A 5FO8B 4DV6L 3CAMA 4A3GH 1VQ9A 2ZTCA 1B9NA 1HZCA 4GN3B 2GA4B 2VNUD 1PFBA 2XWBB 1LTBD 1T5XD 3KYHC 4CKCA 4JCVE 4YCWA 3NWTA 4X65Q 1YEZA 2EYFA 2HD3A 1EEFD 4JI1Q 1PA6A 3CMEA 1YNJD 2XRSD 3MFGA 5M9OA 2KA7A 2ZTDA 4K2KA 4IUVA 2Z6KC 3I73A 5IYCH 1J5EL 1X65A 4F8MA 3S17B 1WTQA 4Y7NB 1KABA 2A68D 4IO9A 4JI8Q 1JJCB 4FF1A 4M8AA 3TS2A 4DR1L 3I4NG 2K5VA 1HQMC 1HXYD 1SYEA 1Z9FA 3I91A 2HQLA 4XXEA 4A75A 4IUQA 2VQFL 3AQQA 5IGDA 2KHSA 3J80i 5LHY1 2RVLA 3I4NB 1CHPD 3TBIB 4LF7L 1G6ZA 4B3RL 1J6QA 3NSWA 3HOUB 1Y8OB 1VQLA 2KENA 5EAYA 5IE8A 2MO0A 1TKWB 3SXHA 4JI7Q 3H0GH 5E7NA 2K1BA 2N55A 1EFWA 1IYUA 1SSOA 2BH8A 3D31A 2Q8RE 3HS0C 3KLSX 4GLAC 4GOPC 4G7ZC 2K50A 4EGVA 2IPKD 3RZOB 4A3KB 1XYIA 1KAWA 3HOWG 4QY7A 1WI5A 1DGSA 2CQOA 4Q5VA 2QF7A 2GN5A 3S1RH 3T1HL 3HKZG 4PZ7A 4CJ2C 4P72A 1JB7A 3CKIB 4IQZA 1E7ZA 4O42A 4BY7B 1IBKL 1EOTA 1GUWA 1HFNA 2QEXA 1SXTA 4NKLA 1V1PB 3GTGH 3H3VC 4DV4Q 1L0WA 1W6KA 2F0VA 4UHVA 3S1QB 2QW7A 1K8AC 2CH4A 4IOCA 1XMOL 1Y1WB 1TWCH 1PRTF 1H9JA 1CQVA 2FMMA 1A62A 4RKLA 4BBRB 1JQYD 4L63B 1D1KA 5FLMH 3HOYB 1UUPA 4XT1B 2KCMA 4OL7A 4YWKA 4IFDH 1X3FA 1JMCA 4PMBA 1F9QA 5CBEE 1EZ8A 1KLUD 1PFSA 3RLNA 1M8AA 4DV2L 3H0GG 4WFN3 2CQAA 2SNSA 3T16A 2QDBA 4MZ9A 1SYDA 3HOXB 1VQIA 1WTXA 4OX9Q 3S14B 1Y1VB 1L0XB 3G48A 3E0EA 5EKLA 3VYSA 4B9XA 2DNEA 4KY6A 1U4MA 2NVXB 5F2DA 2JA8H 2VY3A 1HJPA 2EE1A 1F77A 3S2DH 4ZUIA 1HZ9A 1PH9A 2IL8A 2HT1A 2ICIA 2L1BA 2D0PA 3FKIH 3A8KE 1T9HA 3NTKA 1TY0A 4GKKL 2I5HA 1BOSA 3TN2A 4A3IB 4BBSB 1Q82C 1TWGH 3FP9A 5JAVA 1HTPA 3NK9A 3U50C 4IN3A 2E2IB 3E5SA 2LXKA 4HSPA 2PMZB 4JV5L 3FPPA 2H5XA 4X65L 1KLGD 3EFXD 2M9VA 3UDGA 1L1OC 4MTKA 1JWUD 2A5HA 3Q23A 1N33Q 1LLRD 4ODGA 3U4ZA 1EY7A 2I46A 3NBIA 3RR5A 4KJOA 4OWTB 5CV9A 1YNNC 4A4IA 5I2XA 4GOPA 2A6EC 1PH7A 4LUZA 3GTPH 4KN4C 3QIAA 2SEBD 4KKUA 4N8X1 5KYLA 1UEAB 2NVTH 4KHPL 1VQFA 1K83H 5IOCA 1FYCA 3FPUB 4J1MA 2IY5B 2F0LA 1B53A 3ZYYX 2VB2X 2NZ1D 3J81c 2G9HD 3J7YW 1RODA 5IP9G 1L2FA 3S15H 3PIO3 1STYA 4EX5A 5IP7G 5DM73 2MUYA 1K3BC 1HRJA 1SYFA 2PO4A 2XSCA 3WWVA 4C3JG 2NZHA 5M3MG 5BR8L 3KF6B 1Q1EA 4B08A 1X3GA 3A54A 2F3WA 2BDNA 1JE4A 3HEJA 1C9OA 4UPAA 4L5SA 4OELB 4R8NA 4QUCA 5C4XG 3HOXG 4B3SQ 1PZKD 3C46A 4R4OA 1BUVT 1UE7A 4NDXA 3F2BA 4K6DA 4IFDG 1HQRD 4XQJA 1C48A 2EY5A 2HHHQ 1I3QB 2KQ3A 4QMGA 3GO5A 3ULLA 1HNZL 2VQEQ 3PMFA 4IFDJ 1XTDA 3ERSX 4ZQ3A 2NVQB 1AN8A 3VR5A 1EY8A 3T1HQ 3X3NA 4X3TA 1F9SA 2A6ED 1O7IA 1TWGB 1VMCA 3HOZB 3IFDA 1CKOA 3NBHA 3KJOA 1YIJA 5T1GA 1N9WA 5C3EH 1XJVA 3U4VA 3E6ZX 4APVA 4PG3A 4HMIA 1CKMA 1DM0B 1QCBD 1NR4A 1BBWA 3QOLA 4UAIA 3H0GB 3OPOA 4YY3L 2VB3X 3E9IA 4HCEA 2R92G 2J0TD 3AFPA 2WB1G 4IUNA 4DV5L 3RZOH 3KLSA 4QF4A 4RHRA 2NWGA 3V2TA 1GXDC 2I07B 3HKSA 4JW0A 5EPKA 3SK8A 4Q0FA 1EIGA 2B8GA 4K2LA 1GUOA 1PRTD 4ULLA 1KXLA 4B3TQ 5IYBG 4JBWA 1GO3E 1K83B 1S5BD 1SNPA 2F0MA 1EU3A 1D2BA 2AKWB 2VUMG 2IX3A 3W5OA 1DOMA 3JAMc 3HOVB 4KK7A 3RMHA 1SYCA 2F0PA 4JC0A 4R1JA 1PVOA 1ET6A 3CRKC 4PV1C 2ZTEA 3D6CA 2ASBA 3I55A 3MA2B 4B3MQ 4Y7NH 4JOIA 4BBRH 2XGTA 2F0TA 4P73A 4K14A 4JI0L 2L0CA 4X66L 1B7YB 2F52A 1U9RA 1VMPA 3BYYB 1I94L 3K81C 1JOOA 2F0FA 2EY1A 3PF4A 4V0BA 3TEHB 2E75C 1WD1A 5CMDA 2UU9L 2AMCB 3J81i 1VQ7A 3CPWA 5M3FG 3NTIA 1Q12A 3U58A 3Q8DA 1T5EA 4N8FA 1JC7A 1TWHB 2GVBA 3L3OC 3D0FA 4RHSA 4LF5Q 4LFCL 5IGEA 2QEJC 1PRTC 4N9PA 2F3IA 2NTSA 3JAML 3L2PA 1X9NA 2FJ2A 4I7ZC 4ALPA 1ESFA 3K59A 3MWYW 1Y1WG 5I6WA 5C44G 1OXUA 3OWEB 3UI2A 1S5FD 3W1GA 3BZCA 2RF4A 3BVGA 3KF8A 5LL6S 1ONLA 4EQNA 4DV2Q 1KRSA 2UXBL 2YYZA 1I4XA 5EKIA 1FL0A 2K05A 2DUDA 3Q22A 5JVG3 3T56B 3X3MA 4LUVA 4POGA 1CUKA 1PH5A 3RZDH 2O2LD 1HUNA 1DJRD 1P8LA 1OXSC 4DV0L 3ULPA 2PQAA 3PQIA 2I5LX 1Q86C 4LW1A 4OEMB 3HOYG 1NSNS 2ZT9C 2RHSB 4OWWB 3NQIA 1SYBA 3C3LA 5C0XH 3A5UA 1CSQA 1BF4A 5C5LA 1A63A 1I5FA 1AP0A 3AFQA 3UE0A 4GS3A 1V9PA 4GKKQ 1B3QA 3DMUA 4YIJA 5BN4A 1UEBA 1CM9A 2UU9Q 3KF6A 3LNNA 2I5MX 1VQJA 4L5TA 4ME3A 1BCPF 3NE5B 3NUCA 5ELNA 1B8AA 2B2WA 1S5CD 2VUMB 1SBBB 3A74A 3B6YA 3HOUG 2R92B 1CA5A 1U5KA 2A6HC 4A3BG 1EFID 2E5LQ 3TP5A 1NCVA 3PF5A 1SEBD 1TWAH 2JSOA 4M1UB 1EY9A 1PH1A 4I65A 1QOHA 5ELBA 2K5HA 1N32Q 1XTCD 4HN7A 4JVZA 1JJ2A 4J15A 1R4PB 5EJWA 2RSNA 4A3MH 5CYUA 4RFBA 2K5DA 1I50B 4ZLTF 5G3LD 3FMCA 1AFPA 5NUCA 5I9OA 1VQGA 1K3RA 5CORA 2NVXH 2B2VA 3MTSA 3CC4A 3MEHA 3SK6A 3U9SA 1VQHA 5JJLA 2QA4A 3D4DA 5IODA 1E24A 4A3JH 4IUUA 1YITA 3A8JE 3C1EA 1YNXA 5M5XH 2FXQA 1PH3A 2G5DA 1SRUA 2JE6I 1XX8A 1PH8A 1YHAA 4DR2Q 1HCZA 2DNCA 1VQKA 5C4JB 2HUGA 1PTOH 2EYOA 3SGIA 4ZKBB 1EY6A 3WOFA 1XPOA 3CP0A 1YNJC 4RWSC 4CDEC 3S16B 3TZDA 1QNKA 2C9OA 3I4OA 1IYVA 1HNWQ 4MIUA 2RBMA 1TIID 3MXUA 2YU9B 5C44B 2F3VA 4IZ8A 4DR6Q 1B70B 5C6AA 1H9KA 2B63G 1LT6D 5CR3A 3CPFA 2JA7H 3MVVA 5LL6X 1NR2A 3MXPA 2QDLA 4RAUC 4DR4Q 3ONAB 1PDQA 2VUMH 4QQBX 2OTLA 1Q90A 1S4ZA 4AQYL 3K8AA 4WJ3M 5CV6A 1EIYB 1S3OA 2MNAA 1I4RA 1L0YB 4A3GB 4RA8A 4X6AH 1D5MC 3Q6SA 1K8MA 3FEWX 1YZ6A 5ELEA 2VL6A 2KCTA 1NNXA 2PYKA 4FP5D 5IT9E 2PI2A 1PHJA 3PO3H 4PQXA 1OXTA 2Z6BA 4DK3C 4HR7B 3K5OA 2ICEC 5J22A 4KHPQ 2ID0A 1SNDA 5FO9B 3F1ZA 3NENA 2WAQB 2EYJA 5JEAJ 3TP6A 3N52A 3URYA 1GOZA 3AYHB 5LMUL 4GNXB 3C1FA 3CQZB 1GVPA 4KKSA 4LF5L 3NP8A 3GTKB 5FLXE 1FJGL 4DR1Q 1LM0A 2L12A 2JXMB 2A69D 1Q8KA 4JI3L 1IBMQ 3H3VH 4KY7A 5IWAL 2K4KA 1PZJD 1DOKA 3I7FA 4JG2A 3S1QH 1TU2B 1JOKA 1OTCA 3ULJA 4KN7C 1H9RA 5IP9H 4QB4A 3BDCA 3QR8A 5GADC 2P5ZX 1D5ZC 5BN3A 3KFUA 4CKEA 3HZXA 1IXRA 4LAAA 2AUKA 4DV1Q 1Q3LA 2DY8A 3J7AF 1HZAA 3KJPA 3HFZB 1Z47A 3I72A 2Y0SB 4BY7H 5EPJA 1H9SA 2LKVA 4NXML 1SAPA 1EY4A 1RHPA 2UUCL 2AWOA 4BWGB 1B44D 2EIFA 4LUOA 4IPGA 5IY0A 2XRQD 3PUYA 4MNOA 1TWFH 2KCCA 3I4LA 1LT5D 1M90C 2B2TC 1AE3A 2RSOA 4LMQD 1GUSA 1KDBA 4CBVA 4KTAA 4YHHQ 1D1IA 2F0DA 1Y69U 3EA6A 3E3XA 2CWAA 2IX0A 3CCUA 3RLFA 3PUWA 1TR5A 4BBRG 2VQFQ 4X3UA 4BY7G 1X54A 1V1QA 2WKCA 5D3DA 4TSSA 1U0LA 4HTHA 4DPGA 1QVCA 1RIPA 3I4MH 3LX0A 4A3KG 4DAVA 4LF7Q 3J80E 4U673 2AQ1B 3L9AX 4O0AA 1VQMA 1Q46A 1V1OA 5C4XB 1L1OB 4NXNQ 1ZXTA 3TDQA 1BBXC 2NN6I 1DYQA 4LFAL 3GTOH 1I6HH 2ZM6Q 3PO2H 2MHVA 2NN6G 3GTJH 4FVMA 4IURA 3J81j 3SE0A 1EQVA 4P74A 5M5YH 2R93G 2JA5B 3VR6A 5JPNC 3FKIG 3M7NA 4B3RQ 4CJ1B 5C4ZA 1MGSA 4ME5A 2ZM6L 5JPMC 2RCFA 2R6GA 3T1YL 2EYLA 5EQ0A 4RGMA 2L11A 2PNRC 3OIQA 3MZ5A 3JC66 3AEVA 1O80A 1OXXK 1STAA 4DV7L 3J7AV 1AEXA 3ND9A 4PMWA 3D3RA 5L37A 1QUQB 5C44H 3CU7A 4J6HA 1UWVA 1SROA 1S5ED 4GNXA 3OW7A 4JI0Q 1MHWC 1AZQA 4Z9CB 1GM5A 4X62Q 5C4HA 1EWHA 3TZUA 5LMNL 2Q2TA 2JA5H 5M5YB 2F0QA 2B3GA 1PTOB 5KNCA 4OO1H 4ZRZA 4IPCA 3W3AA 2UUBQ 4FF3A 4GLXA 3VR3A 3CXCA 2JA8B 1HNXL 3PUXA 3HOXH 4UY8C 2OCEA 1FR3A 1SNMA 3PSIA 2F1MA 3VYRA 4LFBQ 4XTCS 4AYBE 2JA8G 3D4WA 1BQQT 3PGZA 3STBC 4F7XA 2EYHA 3R8BA 2G9DA 3CW2C 4DUZL 2WFWA 5M3FH 2V1CC 3QOJA 2RA4A 2RDHA 3KDFA 2BE5C 1LACA 1D8LA 1SMYD 4ZUJA 1HH2P 4K8JA 2LS01 1RTNA 4WRDA 1VCIA 5M5WB 4TQUS 2E2DC 3KK7A 3KLWA 2F03A 2BH2A 1EYGA 1RJTA 1XMQL 3LGJA 4R4IA 1K0RA 2EXDA 2LFNA 2IWHA 3ICEA 4A76A 1GUNA 1HPCA 5C3EB 5IWAQ 2B2TA 3TRZA 4OONA 5CV5A 1FJGQ 2KJXA 2Y0SG 1PH2A 1EY5A 2PMZE 2DY7A 1Z7TA 1IZ6A 1BKBA 2ZJRA 4L8JA 4NXNL 2Z1CA 2BCOA 1EIFA 4DR3Q 1TS3A 3BS1A 1A3TA 1K73C 1X56A 4FF4A 2JA6G 3M4OH 1EQTA 4JI6Q 3S2DB 3D4RA 1ICWA 4KJNA 1A3UA 5HGQA 2YTVA 1UE5A 4X3KA 1SE3A 4EQOA 3QJYA 2BOSA 1K8GA 1I4HA 4IPDA 4MHEA 4O2DA 1VQDA 3SR1A 1VQ5A 5E4XA 5CV8A 5E1FA 1EYAA 3OHXC 3I90A 4C3JH 4UDUC 5KYIA 3DM3A 3P75A 2YV5A 3K0XA 1J8IA 3KDFB 1GHKA 2JQOA 3FVQA 3P1HA 1R4QB 1SMYC 5FOBB
chains in the Genus database with same CATH topology
1I4GA 2Z8LA 4U68A 2JP1A 4IUPA 1WVLA 4HMJA 3S1NB 3K57A 4A3JB 3OIPA 2J4XA 3DHQA 1I4QA 4X3SA 2E2JB 3BVZA 4BY1B 1B3AA 4C1NI 2K01A 1SNQA 4NMZA 5KRUA 1GUGA 3VA7A 5TSSA 4DK1A 1FNVA 2F0NA 2A6HD 2IJ0A 1JWMD 4OO1G 1MI2A 1DCZA 1TWCB 5KEEA 2EDGA 3N6RA 1IKMA 3H6MA 2NTTA 4C3HG 4A3EB 4H44C 1DZ1A 2B2UA 3H91A 1X3PA 3T53B 1DONA 2R61A 1SDFA 2WINB 2NN6H 3GD7A 1EU4A 3A7LA 1JOQA 3A56A 4E6IA 2BA0A 2WV6D 4H13C 2X69A 2WIIB 3EVQA 1MBYA 5C0XG 2OF1A 1KAAA 2AUJD 1I6VC 3HGBA 3PUVA 4C3JB 5JOBA 2B8FA 4HEDA 5EPLA 1VF5C 2JA6B 2NYZD 4ILWA 5EBCA 3T4AC 2IX1A 4L6TB 4F87A 3SHLA 4BA1I 1SE4A 1LT3D 3OMGA 3TP8A 5HGTA 1UNSA 1CA6A 1AW7A 3ITPA 1PYWD 3QB3A 5IGBA 4BA2I 4ID6A 1TWAB 2M00A 3R2IA 3MXNA 4QIWB 1H9SB 5C5MA 3DEPA 2AQ2B 1WTVA 1R9TB 2R93B 2F4IA 1F2YA 2QILA 1BDOA 2K7VA 1B50A 1O7ZA 3E0JA 1YNND 4DU9A 4KKTA 5ELFA 1IW7D 2HQEA 1O7LA 2PPBC 3SDZA 5CGKA 2EJGC 2CW0C 4N9TA 3FKIB 1FGBD 2A74C 1V1PA 4H0LC 1MD2D 2B2WC 1IW7C 1ZYRC 2K28A 2A68C 1J9OA 3H09A 3S15B 2MGSA 4ZKCB 1ZYRD 4B9WA 2E2HB 3AMUA 3MXGA 2F0JA 2EZVA 1LTTD 2BDOA 3HG9A 3PO3B 3VR2A 4XQNA 1G2TA 3R2TA 3A55A 4DF7A 1CTMA 3M4OB 1G2SA 3MFYA 1D5XC 2B2VC 1TVXA 2NB0A 2NBFA 3P20A 1KNAA 2L55A 2PW5A 1DXMA 1IHZA 4DN4M 4H7BA 3TP7A 5FLXL 4IUTA 2F0EA 2BE5D 2F0SA 1NUCA 1SJHD 3VR4A 1CHQD 3QWNA 1BNZA 2D9UA 4XYQA 2HCCA 3H94A 1SNOA 3J81L 1VF7A 1JCKB 3K5MA 5I9PA 1CZGA 1PTOF 5ELDA 1O78A 3K6OA 4PMCA 4K5VA 4C1NK 2E74C 3A8IE 2O5IC 4HSVA 1CFMA 5IGCA 5DAUA 2NUCA 2VXWA 3R93A 3IFTA 1STNA 3T51B 1QJOA 4AYBB 2B2YC 1V43A 1B9MA 4RH6A 1Q1BA 5HURA 5EKKA 1U4LA 5A2QE 3IKJA 5DNFA 3P7JA 1BCPB 1QILA 4FNFA 1D6EC 2ZXPA 3S2HB 1B1ZA 5D14A 1A2UA 2CVRA 2EJMA 1Y8PB 2CW0D 4KY5A 1Z6HA 3OSOA 5C0XJ 1FNWA 1A6XA 2PZWA 5CC4A 1I4PA 5I6YA 1KDAA 1RKNA 1STHA 2RKSA 1FNUA 1TY2A 4A3FB 1E2ZA 3LWUA 1SNCA 4QUFA 5I4DA 4C3IG 3DEOA 3NXWA 1PRTB 5IIFA 3M7GA 1E0BA 2TSSA 2N88A 4G7HC 3O13A 4XQQA 5JEAH 4RCOA 2LY7A 2X6GA 4JK1C 1WTWA 3M4YA 4RGNA 3NQTA 5EBDA 1HFGA 3PIP3 4R8IA 1ILQA 2JYOA 1TWFB 2K33A 3RUZA 5COYA 2KEEA 1EWCA 2K32A 1JICA 2FHTA 4C3HB 1CI3M 2K6AA 3BZDB 1GHJA 2OEOA 4NP5A 1PFNA 3TMEA 1TS2A 3AU7A 2EY6A 3HRZC 2Z4HA 3SK5A 3S9WA 1JWSD 5A2QL 4G57A 4ZYSA 4DNRB 2JEAI 1PXUA 2QKIC 1EIHA 2D62A 1CZWA 2F0UA 1WCMB 5AFWA 1HUMA 1EL0A 3DUZA 2R7ZB 2A73B 1PMRA 2O5JC 1STGA 2F0IA 2B2YA 2F0HA 2XNAC 3R3OA 3BVMA 3HP3A 3KLRA 2M2LA 4WJWA 5DEHA 2L5TA 5A35A 3QG1A 3OMCA 2DN8A 2WACA 1LABA 4P2CB 3MHBA 5J39A 4EVOA 1AZPA 2IW3A 1KNEA 5IGGA 4R9WA 4KHVA 3GV6A 2Z4IA 1LTAD 1F2ZA 3K0YA 2PW7A 1RF2D 2A69C 2SNMA 4ZAIA 1A3VA 1RCVD 4BS9A 3PV0A 1ESRA 3D8GA 2FFKB 1LTGD 3A7AB 2EJFC 5ISRA 1ET9A 1QB5D 1H9MA 1MSGA 2XN9C 1DOLA 3L7ZC 1XXGA 2TMPA 4G4KA 1F2LA 4KHZA 1QNUA 3KBXA 3T13A 2EVBA 5FO7B 3OWFA 1VDZA 1CT1D 3IL8A 2Q8IB 1C8CA 1B2TA 4O1NA 4A93B 3K5NA 3K5LA 2K04A 5KNBA 3ERQA 3Q24A 4FXKC 1ENFA 3DWAA 1BCPC 1UAPA 3VA5A 2B63B 2MJ8A 3Q0AA 2MPMA 3I4MB 4DNTB 1BO0A 3GQBA 2RQXA 3I8ZA 3ND8A 5M3FB 5C3XA 3DWPA 5G3LF 5E3FA 2B39A 4DA2A 4OIJA 1X3QA 5EGTA 5ELCA 1C4QA 4F88A 2ZXRA 5IT9L 3V96A 3GTGB 3GTPB 4PNYA 1LTSD 2J7ZA 1BCPD 1F9PA 4FXDA 3G6JB 3PUZA 4DGZA 2RDFA 3J80L 1HA6A 4K5WA 2JA7B 2PZTA 4K8IA 3SVMA 2EOTA 3GP7A 4OO1I 4FF2A 1CQFA 4KMUC 1SE2A 2ENBA 1NAPA 2OT2A 5JJZA 1KTKA 1WTOA 2WB1B 1E2WA 2SDFA 1ILPA 1MSHA 1ENCA 2EYMA 1LT4D 5CV4A 1PLFA 4DAPA 4TRDA 1S5DD 2WKDA 1WTRA 2B2UC 1Y8NB 4ZK9B 1LO5D 4CJ0B 2AQ3B 2K03A 2K5QA 5K36H 3NTHA 4XT3B 3GTMB 1O7YA 4KD4A 3DM1A 1X32A 1II3A 1RDPD 5C3WA 2WP8J 4A3MB 3F2UA 3VYUA 3M3YB 2HDMA 3EQLC 1KDCA 4J8QA 4FO2A 2NVTB 3TSSA 1TS5A 3CHBD 1PFMA 1EEID 3RD4A 1JORA 1HTLD 1U4PA 1ML0D 3OOCA 4IFDI 3FDTA 4MN3A 2D2CC 3SK4A 2F0GA 2XVSA 2FINB 2H4OA 4EQPA 1SYGA 2O4XA 2EY2A 3GTOB 1I6HB 2ZXOA 5E4WC 2H1EA 2L4NA 3M85A 1B4OA 3J81E 5K5PA 5J1ZA 1JR0D 1LTRD 1W6JA 3NHHA 3VYTA 3MAQA 4FXGC 1WD0A 2E76C 4HCSA 5IGFA 3KUPA 4RGTA 5D65A 4CGYB 1ZEQX 2KECA 1QG7A 3DWQA 4DXGA 1BR9A 3KBGA 2HCIA 1BXTA 3NPPA 3SEBA 2LMCB 4ABNA 2PZUA 5KNDA 2QCPX 3GTLB 1PZID 3G7LA 3IAYA 4FYDA 1TT2A 3BDOA 3NWSA 3I70A 1ENAA 5KIXA 1OO9B 2F0WA 3BDLA 1EYCA 2SOBA 3V05A 4CHTB 1GUTA 3S1RB 2C5CA 3D6WA 3GTQB 2BA1A 4DK0A 1G291 1QE6A 2HDLA 4WORA 1STEA 4HAEA 3RZDB 5I2YA 3PO2B 4RCNA 1ZKOA 5JEAG 3GTJB 1QWYA 3EJIA 3BYTB 5CBAE 4XYOA 5T1IA 1EZ6A 1F2MA 4V190 1U4RA 4XDXA 3AB9A 3EROA 3U9OA 1RTOA 1E2VA 4TKOB 2V4DA 2KOLA 1HHVA 1XWEA 1WTPA 2KVMA 1IL8A 5DM63 1CK1A 2F0OA 4G7OC 2X6LA 3FRPB 3K7AB 1G91A 2RDGA 2CHBD 2NVYB 3I3CA 4LJZC 3CRLC 2MP1A 5FKAC 1EY0A 1STBA 1G8ZD 2PQEA 3JAME 2PCFB 1A15A 2FMCA 4K6LA 2R3ZA 4KD3A 1PTOC 1IKLA 3W2DA 1RD9D 4C2MB 5FK9C 4DAYA 3QO2A 1OXVA 1SFOB 2XWJB 4LK1C 3BG3A 1Q8IA 2EPBA 5D3IB 1K8OA 3WOEA 3GV3A 4RKBA 4KI0A 4GZYC 1TS4A 1GJXA 1JB3A 2OXPA 3WDNA 3DXJC 1PTOD 2AWNA 1LV9A 4K5XA 2XIWA 2JEBI 2KUMA 1SJED 5C0XI 1LTID 1A2TA 4S3SA 2F0KA 4DXFA 4A3DB 4A3BB 4C56C 4C3IB 4RGOS 5BN5A 2Q8TA 3K58A 2EXZA 3C2PA 2L9HA 5K36G 2KEDA 3S1MB 4XIGS 5M3MB 1DD2A 1F9RA 5M5XB 1TQOA 5CV7A 4OIKA 4NW2A 3HOWB 1FD7D 3MC0B 3HKZB 2K5WA 2D5DA 4IALA 2KCNA 1V8QA 1M4VA 2EYPA 1HA5A 4OHJA 1EYDA 4KV6A 4CKBA 4QCLA 3LWEA 4OGQC 5JVH3 4DFAA 5KGUA 2IT1A 5FO8B 1B9NA 2GA4B 2VNUD 1PFBA 2XWBB 1LTBD 1T5XD 4CKCA 3NWTA 2EYFA 1EEFD 1YNJD 2XRSD 3MFGA 5M9OA 2KA7A 4K2KA 4IUVA 3I73A 3S17B 4F8MA 1WTQA 4Y7NB 1KABA 2A68D 4FF1A 4M8AA 1HQMC 1HXYD 1SYEA 3I91A 4XXEA 4IUQA 5IGDA 2KHSA 5LHY1 2RVLA 3I4NB 1CHPD 3TBIB 1G6ZA 3NSWA 3HOUB 1Y8OB 1TKWB 3SXHA 2K1BA 2N55A 1IYUA 1SSOA 3HS0C 3D31A 2Q8RE 3KLSX 4G7ZC 4EGVA 2IPKD 3RZOB 4A3KB 1XYIA 4Q5VA 2QF7A 4CJ2C 3CKIB 4IQZA 4O42A 4BY7B 1EOTA 1GUWA 1HFNA 1SXTA 4NKLA 1V1PB 3H3VC 1W6KA 2F0VA 3S1QB 1Y1WB 1PRTF 1H9JA 1CQVA 2FMMA 4RKLA 4BBRB 1JQYD 4L63B 1D1KA 3HOYB 1UUPA 4XT1B 4OL7A 4IFDH 4PMBA 1F9QA 5CBEE 1EZ8A 1KLUD 1M8AA 4WFN3 2CQAA 2SNSA 3T16A 2QDBA 1SYDA 3HOXB 1WTXA 3S14B 1Y1VB 1L0XB 5EKLA 3VYSA 4B9XA 2DNEA 4KY6A 1U4MA 2NVXB 5F2DA 2EE1A 1F77A 4ZUIA 2IL8A 2ICIA 2L1BA 3A8KE 3NTKA 1TY0A 3TN2A 1BOSA 4A3IB 4BBSB 5JAVA 1HTPA 3NK9A 4IN3A 2E2IB 3E5SA 4HSPA 2PMZB 3FPPA 1KLGD 3EFXD 2M9VA 1JWUD 2A5HA 3Q23A 1LLRD 4ODGA 1EY7A 2I46A 3NBIA 4KJOA 5CV9A 1YNNC 5I2XA 2A6EC 4KN4C 3QIAA 2SEBD 4KKUA 5KYLA 1UEAB 5IOCA 1FYCA 3FPUB 4J1MA 2F0LA 1B53A 3ZYYX 2VB2X 2NZ1D 2G9HD 3J7YW 1RODA 3PIO3 1STYA 5DM73 2MUYA 1HRJA 1SYFA 2PO4A 2XSCA 4C3JG 1Q1EA 4B08A 3A54A 2F3WA 2BDNA 1JE4A 3HEJA 4R8NA 4QUCA 1PZKD 3C46A 1BUVT 4IFDG 4NDXA 4K6DA 4XQJA 1HQRD 1C48A 2EY5A 1I3QB 2KQ3A 4QMGA 3GO5A 3PMFA 4IFDJ 2NVQB 4ZQ3A 1AN8A 3VR5A 1EY8A 3X3NA 4X3TA 1F9SA 2A6ED 1TWGB 1VMCA 3HOZB 3IFDA 3NBHA 5T1GA 3E6ZX 4HMIA 1DM0B 1QCBD 1NR4A 3QOLA 4UAIA 3H0GB 3OPOA 2VB3X 4HCEA 2J0TD 4IUNA 3KLSA 4QF4A 4RHRA 2NWGA 3V2TA 1GXDC 2I07B 5EPKA 3SK8A 4Q0FA 1EIGA 2B8GA 4K2LA 1GUOA 1PRTD 4ULLA 4JBWA 1K83B 1S5BD 1SNPA 2F0MA 1EU3A 1D2BA 2IX3A 1DOMA 3HOVB 4KK7A 3RMHA 1SYCA 2F0PA 1ET6A 3CRKC 4PV1C 3D6CA 3MA2B 2F0TA 4K14A 2L0CA 1U9RA 1VMPA 3BYYB 1JOOA 2F0FA 2EY1A 4V0BA 2E75C 1WD1A 5CMDA 3NTIA 1Q12A 1T5EA 1JC7A 1TWHB 3L3OC 4RHSA 5IGEA 2QEJC 1PRTC 4N9PA 3JAML 2NTSA 2FJ2A 4I7ZC 1ESFA 3K59A 3MWYW 5I6WA 1OXUA 3OWEB 3UI2A 1S5FD 3BVGA 3KF8A 5LL6S 1ONLA 4EQNA 2YYZA 1I4XA 5EKIA 3Q22A 2K05A 5JVG3 3T56B 3X3MA 2O2LD 1HUNA 1DJRD 1OXSC 1NSNS 2ZT9C 3NQIA 1SYBA 3C3LA 5C0XH 1BF4A 5C5LA 1AP0A 3DMUA 4YIJA 5BN4A 1CM9A 3LNNA 1BCPF 3NE5B 3NUCA 2B2WA 1S5CD 2VUMB 1SBBB 2R92B 1CA5A 2A6HC 1EFID 3TP5A 1NCVA 1SEBD 2JSOA 4M1UB 1EY9A 4I65A 1QOHA 5ELBA 1XTCD 4HN7A 1R4PB 5EJWA 2RSNA 5CYUA 4RFBA 2K5DA 1I50B 4ZLTF 5G3LD 3FMCA 1AFPA 5NUCA 5I9OA 5CORA 2B2VA 3MTSA 3MEHA 3SK6A 3U9SA 3D4DA 5IODA 4IUUA 3A8JE 3C1EA 2JE6I 1XX8A 1HCZA 2DNCA 5C4JB 2HUGA 1PTOH 2EYOA 4ZKBB 1EY6A 3WOFA 1YNJC 4RWSC 3S16B 3TZDA 1QNKA 2C9OA 1IYVA 4MIUA 2RBMA 1TIID 3MXUA 2YU9B 5C44B 2F3VA 4IZ8A 5C6AA 1H9KA 1LT6D 5CR3A 3MVVA 5LL6X 1NR2A 3MXPA 4RAUC 3ONAB 1PDQA 1Q90A 1S4ZA 5CV6A 1I4RA 1L0YB 4A3GB 4RA8A 1D5MC 3Q6SA 1K8MA 3FEWX 5ELEA 2PYKA 4FP5D 5IT9E 4PQXA 1OXTA 4HR7B 3K5OA 2ICEC 5J22A 2ID0A 1SNDA 5FO9B 3TP6A 2WAQB 2EYJA 5JEAJ 3N52A 3URYA 1GOZA 3C1FA 3CQZB 4KKSA 3NP8A 3GTKB 5FLXE 2L12A 2JXMB 2A69D 4KY7A 1PZJD 1DOKA 1TU2B 1JOKA 4KN7C 1H9RA 4QB4A 3BDCA 1D5ZC 5BN3A 4CKEA 3HZXA 4LAAA 2AUKA 1Q3LA 2DY8A 3J7AF 1Z47A 3I72A 2Y0SB 5EPJA 1H9SA 2LKVA 1SAPA 1EY4A 1RHPA 2AWOA 4BWGB 1B44D 2XRQD 3PUYA 2KCCA 3I4LA 1LT5D 2B2TC 2RSOA 1GUSA 4LMQD 1KDBA 4CBVA 4KTAA 1D1IA 2F0DA 1Y69U 3EA6A 2IX0A 3RLFA 3PUWA 1TR5A 4X3UA 2WKCA 5D3DA 4TSSA 4HTHA 3LX0A 4DAVA 3J80E 4U673 2AQ1B 3L9AX 1V1OA 5C4XB 1ZXTA 3TDQA 1BBXC 2NN6I 1DYQA 2MHVA 2NN6G 4FVMA 4IURA 3SE0A 1EQVA 2JA5B 3VR6A 5JPNC 3M7NA 4CJ1B 5C4ZA 1MGSA 4ME5A 5JPMC 2R6GA 2EYLA 5EQ0A 4RGMA 2L11A 2PNRC 3OIQA 3MZ5A 1O80A 3J7AV 1OXXK 1STAA 1AEXA 3ND9A 4PMWA 3D3RA 3CU7A 4J6HA 1S5ED 3OW7A 1AZQA 4Z9CB 5C4HA 1EWHA 3TZUA 5M5YB 2F0QA 1PTOB 5KNCA 4OO1H 4ZRZA 3W3AA 4FF3A 3VR3A 2JA8B 3PUXA 1FR3A 1SNMA 2F1MA 3VYRA 4XTCS 3D4WA 1BQQT 4F7XA 2EYHA 3R8BA 2G9DA 3QOJA 2RA4A 2RDHA 2BE5C 1LACA 1SMYD 4ZUJA 4K8JA 2LS01 1RTNA 4WRDA 1VCIA 5M5WB 4TQUS 2E2DC 3KK7A 2F03A 1RJTA 2LFNA 2IWHA 1GUNA 1HPCA 5C3EB 2B2TA 5CV5A 2KJXA 1EY5A 2DY7A 1Z7TA 4L8JA 2Z1CA 2BCOA 3BS1A 1TS3A 1A3TA 4FF4A 1EQTA 3S2DB 3D4RA 1ICWA 4KJNA 1A3UA 4X3KA 1SE3A 4EQOA 3QJYA 2BOSA 1I4HA 4MHEA 3SR1A 5E4XA 5CV8A 5E1FA 1EYAA 3OHXC 3I90A 4UDUC 5KYIA 3P75A 1J8IA 1GHKA 3FVQA 3P1HA 1R4QB 1SMYC 5FOBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQQ T;  3L3O C;  3HRZ C;  5FO7 B;  3HS0 C;  1UEA B;  2J0T D;  2A73 B;  5JPM C;  3KLS A;  3V96 A;  1GXD C;  5FO8 B;  2I07 B;  2WIN B;  4ILW A;  1JB3 A;  1BR9 A;  1PXU A;  2QKI C;  3FRP B;  3I70 A;  4FXG C;  3G6J B;  2B39 A;  3MA2 B;  1OO9 B;  3OHX C;  3T4A C;  1BUV T;  2A74 C;  3CKI B;  2WII B;  2XWB B;  3CU7 A;  2E2D C;  4FXK C;  2XWJ B;  1UAP A;  2TMP A;  1D2B A;  2ICE C;  1JC7 A;  1XWE A;  5JPN C;  5FO9 B;  5FOB B; 
#chains in the Genus database with same CATH topology
 1I4G A;  2Z8L A;  4U68 A;  2UUC Q;  2JP1 A;  4IUP A;  3HOY H;  1IYJ B;  1WVL A;  4HMJ A;  1CSP A;  2B29 A;  2YTX A;  2B63 H;  3S1N B;  5LMN W;  4HJ7 A;  3K57 A;  4A3J B;  3OIP A;  2J4X A;  3DHQ A;  1I4Q A;  1YHB A;  1NJI C;  3NEM A;  4X3S A;  2E2J B;  3BVZ A;  4BY1 B;  4DR5 Q;  1B3A A;  4C1N I;  2K01 A;  1SNQ A;  4NMZ A;  3G4S A;  5KRU A;  1GUG A;  3VA7 A;  5TSS A;  4DK1 A;  1Q7Y C;  1FNV A;  1PYB A;  2F0N A;  2A6H D;  3EBE A;  2IJ0 A;  1JWM D;  4OO1 G;  4A3C G;  1MI2 A;  4DR7 L;  3GTL H;  1MIU A;  1DCZ A;  1TWC B;  5KEE A;  2EDG A;  3N6R A;  1IKM A;  4GKJ Q;  2Z9H A;  3H6M A;  2NTT A;  2VQE L;  4DR4 L;  4DV6 Q;  4C3H G;  3M3Y H;  3S24 A;  2D0O A;  4H44 C;  4A3E B;  4DNI A;  4QIW E;  1DZ1 A;  2B2U A;  3H91 A;  1X3P A;  4LF8 Q;  2YU9 H;  3T53 B;  4BY1 H;  2E5L L;  1DON A;  2R61 A;  1SDF A;  3PO2 G;  2WIN B;  4DR6 L;  2NN6 H;  3GD7 A;  3OW2 A;  1EU4 A;  3A7L A;  2XTI A;  4LFB L;  3A56 A;  1JOQ A;  4E6I A;  2BA0 A;  2WV6 D;  4LF4 Q;  4H13 C;  3OTO L;  2X69 A;  4HJ5 A;  4X64 L;  2WII B;  4Y52 H;  3H3V I;  3EVQ A;  1WFQ A;  1MBY A;  5C0X G;  3HOW H;  2OF1 A;  1C0A A;  3VDY A;  1KAA A;  5IYD H;  2AUJ D;  1I6V C;  4C3H H;  2N3S A;  4X64 Q;  3HGB A;  3PUV A;  4C3J B;  5JOB A;  4X62 L;  2B8F A;  4HED A;  5EPL A;  2F4V Q;  1VF5 C;  2JA6 B;  2NYZ D;  4ILW A;  5EBC A;  4IPH A;  1RL2 A;  4GN4 B;  3T4A C;  2IX1 A;  1CKN B;  4A3C H;  5GAE C;  2IHF A;  4JI5 Q;  4L6T B;  4UP8 A;  4F87 A;  3SHL A;  4BA1 I;  4A3B H;  1SE4 A;  1LT3 D;  4C3I H;  4IJL A;  2LXJ A;  3OMG A;  3TP8 A;  5HGT A;  1UNS A;  1CA6 A;  1AW7 A;  3ITP A;  4JI8 L;  1PYW D;  3QB3 A;  5IGB A;  4DUY Q;  4ID6 A;  4BA2 I;  4GKJ L;  1TWA B;  4QL5 A;  2M00 A;  1WJJ A;  1YHQ A;  3F2C A;  3R2I A;  3MXN A;  4QIW B;  1H9S B;  5C5M A;  3DEP A;  2RHQ B;  2AQ2 B;  1XPR A;  1WTV A;  2UXC Q;  1R9T H;  1R9T B;  4B3S L;  3S16 H;  2JA5 G;  2R93 B;  2F4I A;  4A3G G;  1F2Y A;  4TVA B;  2QIL A;  1BDO A;  2K7V A;  1KRT A;  4AIM A;  1B50 A;  1O7Z A;  3E0J A;  2HHH L;  1YNN D;  1Y1V G;  4DU9 A;  4KKT A;  1XNQ L;  5ELF A;  1VQN A;  1IW7 D;  3G6E A;  2HQE A;  4A3I G;  1O7L A;  2PPB C;  3A0J A;  3SDZ A;  1SR3 A;  1KHI A;  5CGK A;  4A3F G;  2EJG C;  2CW0 C;  4N9T A;  3FKI B;  1E22 A;  5FLM G;  1FGB D;  2A74 C;  1V1P A;  4H0L C;  1MD2 D;  2KHJ A;  2CCZ A;  4JBK A;  2B2W C;  4CDC C;  1YJW A;  1VQE A;  1IW7 C;  1ZYR C;  2K28 A;  2A68 C;  2UXD L;  1J9O A;  3H09 A;  3S15 B;  2MGS A;  4ZKC B;  1ZYR D;  2JA6 H;  1Y1V H;  4B9W A;  2E2H B;  3TQY A;  3AMU A;  3HKZ E;  3MXG A;  5GRO A;  4B3T L;  2F0J A;  2UXB Q;  2EZV A;  1LTT D;  2BDO A;  2Z6K A;  3HG9 A;  4RG1 A;  3PO3 B;  3VR2 A;  4XQN A;  1G2T A;  4A3F H;  3R2T A;  3A55 A;  4DF7 A;  1CTM A;  3M4O B;  1G2S A;  3MFY A;  1D5X C;  4IOA A;  2B2V C;  1HR0 Q;  1TVX A;  2NB0 A;  2N8N A;  2NBF A;  3P20 A;  5IT9 c;  1KNA A;  2L55 A;  1SMX A;  2PW5 A;  1DXM A;  1JJG A;  2RCN A;  1IHZ A;  4K0K L;  4DN4 M;  3MXN B;  1WYD A;  4A3E G;  2LSS A;  4H7B A;  3TP7 A;  5FLX L;  4IUT A;  2F0E A;  2JN4 A;  1XPU A;  2CKZ B;  2BE5 D;  2F0S A;  4K0K Q;  1NUC A;  4A3D G;  1Y1W H;  3CCL A;  1SJH D;  3CCQ A;  3VR4 A;  1CHQ D;  3QWN A;  4A3M G;  1BNZ A;  2D9U A;  4XYQ A;  2HCC A;  3H94 A;  1SNO A;  3M4Q A;  3J81 L;  1VF7 A;  1JCK B;  3K5M A;  5I9P A;  1CZG A;  1E1T A;  1PTO F;  2E2J H;  5ELD A;  1O78 A;  2ES2 A;  3K6O A;  4PMC A;  2K75 A;  3I4N H;  4K5V A;  4C1N K;  2E74 C;  3A8I E;  2O5I C;  4DAY B;  4HSV A;  1CFM A;  5IGC A;  2F4V L;  1C7Y A;  5DAU A;  2ALY B;  2WAQ E;  2NUC A;  2VXW A;  3HOV H;  1E1O A;  1H95 A;  3R93 A;  1W2B A;  1P16 A;  2MFI A;  3IFT A;  1STN A;  2Q2U A;  3T51 B;  1QJO A;  4AYB B;  2B2Y C;  4L5R C;  1V43 A;  1B9M A;  1VQB A;  1Q1B A;  4RH6 A;  5HUR A;  3RN5 A;  4KLK A;  4YHH L;  2A8V A;  5EKK A;  3PCO B;  1U4L A;  5A2Q E;  3IKJ A;  5DNF A;  1N36 Q;  3P7J A;  1BCP B;  4A3L H;  1QIL A;  4FNF A;  4A3E H;  4MTN A;  1D6E C;  2ZXP A;  3A5Z B;  3S2H B;  1B1Z A;  4JI1 L;  4BBS H;  5D14 A;  1A2U A;  2CVR A;  2EJM A;  1Y8P B;  2CW0 D;  1WCM H;  1YJ9 A;  2VZA A;  1Z6H A;  1CKN A;  3OSO A;  4KY5 A;  1QVG A;  5C0X J;  1Q81 C;  1KD1 C;  1D7Q A;  1FNW A;  2R92 H;  1A6X A;  2OTJ A;  1KL9 A;  4JI4 L;  2ZJQ A;  2PZW A;  4R4T A;  5CC4 A;  1I4P A;  5I6Y A;  1S72 A;  1KDA A;  4DR2 L;  1RKN A;  4DUY L;  1STH A;  2RKS A;  1FNU A;  1TY2 A;  2VS1 A;  4L5Q A;  4A3F B;  1E2Z A;  2OQ0 A;  4LFA Q;  4JI2 Q;  3LWU A;  5IYB H;  1SNC A;  4RMF A;  1QUQ A;  4QUF A;  2UXC L;  5I4D A;  4BBS G;  1TXY A;  2DJF C;  3ER0 A;  4C3I G;  3DEO A;  3NXW A;  1PRT B;  5IIF A;  3M7G A;  1IBL L;  1E0B A;  2TSS A;  2Z0S A;  2N88 A;  3GTK H;  4G7H C;  3O13 A;  4XQQ A;  5JEA H;  2PQA B;  5IP7 H;  4RCO A;  4B3M L;  2LY7 A;  2X6G A;  4JK1 C;  1WTW A;  3M4Y A;  4RGN A;  3NQT A;  5EBD A;  1HFG A;  3PIP 3;  1NE3 A;  1ILQ A;  4R8I A;  2JYO A;  1VS0 A;  1TWF B;  4OWX B;  2K33 A;  1YVC A;  3RUZ A;  5COY A;  2KEE A;  1EWC A;  2K32 A;  4CDD C;  4LF6 Q;  1JIC A;  2FHT A;  4C3H B;  3HOZ H;  1CI3 M;  2K6A A;  3BZD B;  3F2D A;  4JV5 Q;  1GHJ A;  2OEO A;  4NP5 A;  1PFN A;  1L1O A;  3CCR A;  3TME A;  4A3D H;  3UE1 A;  1TS2 A;  3AU7 A;  2A1A A;  2EY6 A;  4CDF C;  3S17 H;  1G51 A;  3HRZ C;  4DAM A;  2Z4H A;  3SK5 A;  3S9W A;  1JWS D;  2HIX A;  4R4Q A;  5A2Q L;  5JJI A;  4G57 A;  3FHW A;  4ZYS A;  4DNR B;  1QVF A;  1S40 A;  2R7D A;  2JEA I;  1PXU A;  2QKI C;  1EIH A;  2E2I H;  2D62 A;  3CCV A;  1HNW L;  1N33 L;  1CZW A;  2MO1 A;  5M5W H;  2F0U A;  1WCM B;  5AFW A;  4AH6 A;  1HUM A;  2WB1 E;  1EL0 A;  3DUZ A;  2R7Z B;  2A73 B;  1PMR A;  3KOJ A;  2O5J C;  4DV3 L;  1STG A;  4JI3 Q;  2F0I A;  2B2Y A;  2F0H A;  2XNA C;  3L0O A;  3R3O A;  3BVM A;  3DLL A;  3HP3 A;  1W3S A;  4JBJ A;  3KLR A;  1SFO H;  2M2L A;  4WJW A;  5DEH A;  2L5T A;  5A35 A;  3QG1 A;  3OMC A;  2DN8 A;  4YCU A;  2WAC A;  1LAB A;  4P2C B;  2K5N A;  2YTY A;  3MHB A;  2CFM A;  5J39 A;  4EVO A;  5ELO A;  4NXM Q;  3UDI A;  1AZP A;  2IW3 A;  1KNE A;  5IGG A;  4R9W A;  2UUB L;  4KHV A;  3BU2 A;  4POF A;  5FLX c;  3GV6 A;  2Z4I A;  4HJ8 A;  5H1S E;  1LTA D;  2E8G A;  1IBK Q;  1F2Z A;  3K0Y A;  2UUA Q;  2WAQ G;  2PW7 A;  1RF2 D;  2A69 C;  2SNM A;  4ZAI A;  1A3V A;  4BXX G;  1RCV D;  2OWO A;  4BS9 A;  3PV0 A;  4HID A;  1ESR A;  3D8G A;  2FFK B;  1NMG A;  1LTG D;  3A7A B;  2EJF C;  4OXP A;  5ISR A;  1N34 Q;  1ET9 A;  1QB5 D;  1VQO A;  1H9M A;  1MSG A;  2NVQ H;  1VQP A;  2XN9 C;  1N36 L;  1DOL A;  3L7Z C;  1X55 A;  1XXG A;  2TMP A;  4G4K A;  1F2L A;  4KHZ A;  1QNU A;  1X3E A;  3KBX A;  3T13 A;  3CMA A;  2EVB A;  5FO7 B;  3OWF A;  1PYS B;  3M4P A;  1VDZ A;  1CT1 D;  3IL8 A;  2Q8I B;  4P71 A;  1C8C A;  1B2T A;  4O1N A;  1PH4 A;  4A93 B;  3K5N A;  3HOV G;  1AH9 A;  3IRB A;  3K5L A;  4JI7 L;  2K04 A;  5KNB A;  3ERQ A;  3Q24 A;  3T1Y Q;  1LTL A;  1ENF A;  3DWA A;  4FXK C;  1BCP C;  1UAP A;  3VA5 A;  4FDB A;  2B63 B;  4JOI C;  2MJ8 A;  3Q0A A;  2E2H H;  2MPM A;  3I4M B;  4DNT B;  1IBM L;  3CQZ H;  1IBL Q;  1BO0 A;  3GQB A;  3OYY A;  2RQX A;  3I2Z A;  3I8Z A;  3ND8 A;  5M3F B;  1AE2 A;  4WJ4 A;  4R4C A;  5C3X A;  3S1M H;  3DWP A;  5G3L F;  5E3F A;  1LYL A;  2B39 A;  2R7Z H;  3CD6 A;  4C2M H;  1UE6 A;  3NEL A;  4P75 A;  1FVI A;  4DA2 A;  1PV4 A;  4OIJ A;  4A93 H;  4A3J G;  1X3Q A;  5EGT A;  4LF6 L;  4DV1 L;  5ELC A;  1C4Q A;  4F88 A;  2ZXR A;  5IT9 L;  5JJK A;  3V96 A;  4PZ8 A;  3GTG B;  3GTP B;  2QGQ A;  4PNY A;  1LTS D;  1TWH H;  2J7Z A;  1BCP D;  1F9P A;  4FXD A;  3G6J B;  1N32 L;  3PUZ A;  1IL2 A;  4DGZ A;  1MJE A;  2R7Z G;  3CF5 A;  1HR0 L;  2RDF A;  3J80 L;  1HA6 A;  4K5W A;  2JA7 B;  2PZT A;  4K8I A;  3SVM A;  2JJQ A;  2EOT A;  3GP7 A;  4OO1 I;  3HOZ G;  4FF2 A;  1CQF A;  4KMU C;  2JK8 A;  3CCM A;  1SE2 A;  2ENB A;  1NAP A;  2OT2 A;  5JJZ A;  1KTK A;  4DV0 Q;  4I7A A;  1BVS A;  4UP7 A;  1WTO A;  2WB1 B;  1E2W A;  2SDF A;  1ILP A;  2Q2H A;  3EN2 A;  4UP9 A;  1MSH A;  2HIV A;  1ENC A;  4QJF A;  2EYM A;  4JI2 L;  1LT4 D;  1G6P A;  5CV4 A;  1PLF A;  4DAP A;  4EQ5 A;  3EIV A;  4TRD A;  3MEF A;  1S5D D;  1VQA A;  4DKA C;  2WKD A;  1WTR A;  2B2U C;  4A93 G;  4A3K H;  1Y8N B;  1MKH A;  4ZK9 B;  2Y0S E;  1LO5 D;  4CJ0 B;  1LUZ A;  4LF9 Q;  2DGY A;  2AQ3 B;  2K03 A;  4LFC Q;  2K5Q A;  5K36 H;  3NTH A;  4XT3 B;  1SLJ A;  3GTM B;  1HNX Q;  3J80 c;  1O7Y A;  1NMF A;  1YBY A;  4KD4 A;  1UE1 A;  3DM1 A;  5AJ3 L;  5M3M H;  1SN8 A;  1X32 A;  1II3 A;  1RDP D;  3E9H A;  2WP8 J;  5C3W A;  4A3M B;  3F2U A;  3VYU A;  3KF8 B;  3M3Y B;  2DJG C;  2HDM A;  3EQL C;  1KDC A;  4J8Q A;  4FO2 A;  2UUA L;  2NVT B;  3TSS A;  3BZK A;  1TS5 A;  3CHB D;  4DV4 L;  3GTQ H;  2N49 A;  2I0Q A;  5DLQ E;  3H15 A;  1PFM A;  3M9B A;  1EEI D;  1ASY A;  2CWP A;  4HJ9 A;  3RD4 A;  1JOR A;  1HTL D;  1U4P A;  1ML0 D;  3OOC A;  2C35 B;  4NB3 A;  3J7A 5;  1XNR L;  4IFD I;  3FDT A;  3J7Z C;  4MN3 A;  2D2C C;  3SK4 A;  2F0G A;  2XVS A;  2FIN B;  2H4O A;  4HIM A;  1N8R C;  1I3Q H;  3F8T A;  4EQP A;  1SYG A;  2O4X A;  2EY2 A;  3I4M G;  5GAH C;  3GTO B;  2ZXO A;  1I6H B;  2JA7 G;  2PNH A;  3S14 H;  5E4W C;  4JI4 Q;  2H1E A;  2L4N A;  4YWM A;  3M85 A;  4QGU A;  1B4O A;  3J81 E;  5K5P A;  4JYA L;  5J1Z A;  1JR0 D;  1K28 A;  1LTR D;  1W6J A;  4PZ6 A;  3NHH A;  3VYT A;  4OX9 L;  1QZG A;  4DV3 Q;  2Q2I A;  3MAQ A;  4FXG C;  1WD0 A;  1I50 H;  2E76 C;  4GNX C;  4HCS A;  5IGF A;  3KUP A;  3UDX A;  4HJA A;  4RGT A;  2PI2 E;  5D65 A;  4CGY B;  1ZEQ X;  2KEC A;  1QG7 A;  3DWQ A;  4DXG A;  1EQQ A;  1BR9 A;  1NTG A;  1X6O A;  3KBG A;  2HCI A;  2IHE A;  3PO3 G;  1BXT A;  3NPP A;  3SEB A;  2LMC B;  4ABN A;  1YI2 A;  2PZU A;  1NY4 A;  5KND A;  2N78 A;  4JI6 L;  2QCP X;  3GTL B;  1PZI D;  2MQH A;  3G7L A;  3IAY A;  4FYD A;  1TT2 A;  3BDO A;  3NWS A;  4IJH A;  3I70 A;  1ENA A;  5KIX A;  2NZO A;  1OO9 B;  5FJ8 G;  2F0W A;  3BDL A;  5LMN Q;  1EYC A;  2SOB A;  3V05 A;  1VQ6 A;  4CHT B;  1GUT A;  3S1R B;  5J3B A;  4DR5 L;  2C5C A;  4YWL A;  3CCE A;  4DR7 Q;  3D6W A;  3GTQ B;  4A3I H;  2BA1 A;  4H02 A;  5C4X H;  4DK0 A;  1G29 1;  1QE6 A;  2HDL A;  3G71 A;  4WOR A;  1STE A;  4HAE A;  3RZD B;  5I2Y A;  4YCV A;  3TRE A;  5LMU Q;  5IYD G;  3TS0 A;  4RCN A;  3PO2 B;  1ZKO A;  5JEA G;  3STB D;  4LWC A;  2KBN A;  5BR8 Q;  3GTJ B;  1QWY A;  3GTM H;  5C4J H;  4GN5 A;  1WOC A;  3EJI A;  1VQ8 A;  3BYT B;  5GQO A;  5CBA E;  3HOU H;  4XYO A;  1ASZ A;  5T1I A;  1EZ6 A;  1F2M A;  3PIP A;  3S1N H;  5C3E G;  1U4R A;  4V19 0;  3W1B A;  2L15 A;  4XDX A;  3AB9 A;  3K80 C;  4NPS A;  4JBM A;  3ERO A;  1EWI A;  3U9O A;  3CC2 A;  1RTO A;  1A0I A;  5HY6 A;  1E2V A;  2V4D A;  4TKO B;  2KOL A;  1HHV A;  1JT8 A;  1XWE A;  1WTP A;  4AYB G;  1SE8 A;  3CC7 A;  2KVM A;  1VQ4 A;  5FJ8 H;  4DR3 L;  1KIX A;  3BJU A;  4AQY Q;  1IL8 A;  2K14 A;  1K0S A;  5DM6 3;  1CK1 A;  3ZJY C;  2AHO B;  2F0O A;  2EQS A;  4G7O C;  2X6L A;  2ATW A;  1EQR A;  2K52 A;  3FRP B;  3K7A B;  1G91 A;  4LF8 L;  2RDG A;  3K7A H;  2CHB D;  2NVY B;  1KQS A;  5AJ3 Q;  1FGU A;  4YY3 Q;  1WCM G;  3I3C A;  1JE5 A;  4LJZ C;  1A8V A;  3CRL C;  3JAM i;  2MP1 A;  4HIO A;  5FKA C;  1WTH A;  1EY0 A;  1STB A;  4GOP B;  1G8Z D;  1N34 L;  4BY1 G;  2PQE A;  3JAM E;  1PH6 A;  2PCF B;  2ZJP A;  1A15 A;  1BBU A;  2FMC A;  4K6L A;  3S2H H;  4JYA Q;  2CH4 W;  2A19 A;  2OQK A;  2R3Z A;  4KD3 A;  1XNR Q;  1PTO C;  4JPB W;  2GVA A;  1IKL A;  3W2D A;  1RD9 D;  1K9M C;  4C2M B;  5FK9 C;  4DAY A;  1XMQ Q;  1GKH A;  3OTO Q;  3QO2 A;  1YJN A;  1OXV A;  1SFO B;  4DK6 C;  4GLV B;  4A3L G;  2XWJ B;  1VQC A;  4LK1 C;  2UXD Q;  3I56 A;  3BG3 A;  4X66 Q;  4BXX H;  1Q8I A;  2EPB A;  5D3I B;  1K8O A;  3WOE A;  3GV3 A;  1J5E Q;  4ZCK A;  4RKB A;  4KI0 A;  4GZY C;  1I94 Q;  1TS4 A;  1GJX A;  1JB3 A;  2OXP A;  3WDN A;  3DXJ C;  1PTO D;  2AWN A;  1LV9 A;  1EUJ A;  4K5X A;  2XIW A;  1XNQ Q;  2R93 H;  2JEB I;  2JA9 A;  4DV7 Q;  2KUM A;  3RN2 A;  4LF4 L;  1HZB A;  1SJE D;  1E3P A;  5C0X I;  1XMO Q;  1LTI D;  1A2T A;  4S3S A;  1Y14 B;  2F0K A;  2NVY H;  5GAG C;  4DXF A;  4A3D B;  4A3B B;  4JI5 L;  4C56 C;  4C3I B;  3UDF A;  4RGO S;  5BN5 A;  2Q8T A;  1M1K C;  3K58 A;  2EXZ A;  3K7U C;  3C2P A;  4DV5 Q;  1KC8 C;  2L9H A;  1GD7 A;  3RLO A;  5K36 G;  2KED A;  3PIO A;  3S1M B;  4XIG S;  3CCJ A;  5M3M B;  1DD2 A;  1F9R A;  3RNU A;  5M5X B;  1TQO A;  5CV7 A;  4OIK A;  2R7F A;  4NW2 A;  3HOW B;  4DUZ Q;  1MJC A;  1FD7 D;  3MC0 B;  4LNQ A;  3NBH B;  3HKZ B;  2K5W A;  3GDE A;  1QZH A;  2D5D A;  1NBW A;  4IAL A;  2KCN A;  1HR0 W;  1HNZ Q;  1V8Q A;  1M4V A;  2EYP A;  1HA5 A;  4LF9 L;  4OHJ A;  1EYD A;  4KV6 A;  4CKB A;  4QCL A;  1EOV A;  3LWE A;  4OGQ C;  3CCS A;  4HIK A;  5JVH 3;  1ICF B;  2VW9 A;  4DFA A;  2KHI A;  5IYC G;  5KGU A;  2IT1 A;  5FO8 B;  4DV6 L;  3CAM A;  4A3G H;  1VQ9 A;  2ZTC A;  1B9N A;  1HZC A;  4GN3 B;  2GA4 B;  2VNU D;  1PFB A;  2XWB B;  1LTB D;  1T5X D;  3KYH C;  4CKC A;  4JCV E;  4YCW A;  3NWT A;  4X65 Q;  1YEZ A;  2EYF A;  2HD3 A;  1EEF D;  4JI1 Q;  1PA6 A;  3CME A;  1YNJ D;  2XRS D;  3MFG A;  5M9O A;  2KA7 A;  2ZTD A;  4K2K A;  4IUV A;  2Z6K C;  3I73 A;  5IYC H;  1J5E L;  1X65 A;  4F8M A;  3S17 B;  1WTQ A;  4Y7N B;  1KAB A;  2A68 D;  4IO9 A;  4JI8 Q;  1JJC B;  4FF1 A;  4M8A A;  3TS2 A;  4DR1 L;  3I4N G;  2K5V A;  1HQM C;  1HXY D;  1SYE A;  1Z9F A;  3I91 A;  2HQL A;  4XXE A;  4A75 A;  4IUQ A;  2VQF L;  3AQQ A;  5IGD A;  2KHS A;  3J80 i;  5LHY 1;  2RVL A;  3I4N B;  1CHP D;  3TBI B;  4LF7 L;  1G6Z A;  4B3R L;  1J6Q A;  3NSW A;  3HOU B;  1Y8O B;  1VQL A;  2KEN A;  5EAY A;  5IE8 A;  2MO0 A;  1TKW B;  3SXH A;  4JI7 Q;  3H0G H;  5E7N A;  2K1B A;  2N55 A;  1EFW A;  1IYU A;  1SSO A;  2BH8 A;  3D31 A;  2Q8R E;  3HS0 C;  3KLS X;  4GLA C;  4GOP C;  4G7Z C;  2K50 A;  4EGV A;  2IPK D;  3RZO B;  4A3K B;  1XYI A;  1KAW A;  3HOW G;  4QY7 A;  1WI5 A;  1DGS A;  2CQO A;  4Q5V A;  2QF7 A;  2GN5 A;  3S1R H;  3T1H L;  3HKZ G;  4PZ7 A;  4CJ2 C;  4P72 A;  1JB7 A;  3CKI B;  4IQZ A;  1E7Z A;  4O42 A;  4BY7 B;  1IBK L;  1EOT A;  1GUW A;  1HFN A;  2QEX A;  1SXT A;  4NKL A;  1V1P B;  3GTG H;  3H3V C;  4DV4 Q;  1L0W A;  1W6K A;  2F0V A;  4UHV A;  3S1Q B;  2QW7 A;  1K8A C;  2CH4 A;  4IOC A;  1XMO L;  1Y1W B;  1TWC H;  1PRT F;  1H9J A;  1CQV A;  2FMM A;  1A62 A;  4RKL A;  4BBR B;  1JQY D;  4L63 B;  1D1K A;  5FLM H;  3HOY B;  1UUP A;  4XT1 B;  2KCM A;  4OL7 A;  4YWK A;  4IFD H;  1X3F A;  1JMC A;  4PMB A;  1F9Q A;  5CBE E;  1EZ8 A;  1KLU D;  1PFS A;  3RLN A;  1M8A A;  4DV2 L;  3H0G G;  4WFN 3;  2CQA A;  2SNS A;  3T16 A;  2QDB A;  4MZ9 A;  1SYD A;  3HOX B;  1VQI A;  1WTX A;  4OX9 Q;  3S14 B;  1Y1V B;  1L0X B;  3G48 A;  3E0E A;  5EKL A;  3VYS A;  4B9X A;  2DNE A;  4KY6 A;  1U4M A;  2NVX B;  5F2D A;  2JA8 H;  2VY3 A;  1HJP A;  2EE1 A;  1F77 A;  3S2D H;  4ZUI A;  1HZ9 A;  1PH9 A;  2IL8 A;  2HT1 A;  2ICI A;  2L1B A;  2D0P A;  3FKI H;  3A8K E;  1T9H A;  3NTK A;  1TY0 A;  4GKK L;  2I5H A;  1BOS A;  3TN2 A;  4A3I B;  4BBS B;  1Q82 C;  1TWG H;  3FP9 A;  5JAV A;  1HTP A;  3NK9 A;  3U50 C;  4IN3 A;  2E2I B;  3E5S A;  2LXK A;  4HSP A;  2PMZ B;  4JV5 L;  3FPP A;  2H5X A;  4X65 L;  1KLG D;  3EFX D;  2M9V A;  3UDG A;  1L1O C;  4MTK A;  1JWU D;  2A5H A;  3Q23 A;  1N33 Q;  1LLR D;  4ODG A;  3U4Z A;  1EY7 A;  2I46 A;  3NBI A;  3RR5 A;  4KJO A;  4OWT B;  5CV9 A;  1YNN C;  4A4I A;  5I2X A;  4GOP A;  2A6E C;  1PH7 A;  4LUZ A;  3GTP H;  4KN4 C;  3QIA A;  2SEB D;  4KKU A;  4N8X 1;  5KYL A;  1UEA B;  2NVT H;  4KHP L;  1VQF A;  1K83 H;  5IOC A;  1FYC A;  3FPU B;  4J1M A;  2IY5 B;  2F0L A;  1B53 A;  3ZYY X;  2VB2 X;  2NZ1 D;  3J81 c;  2G9H D;  3J7Y W;  1ROD A;  5IP9 G;  1L2F A;  3S15 H;  3PIO 3;  1STY A;  4EX5 A;  5IP7 G;  5DM7 3;  2MUY A;  1K3B C;  1HRJ A;  1SYF A;  2PO4 A;  2XSC A;  3WWV A;  4C3J G;  2NZH A;  5M3M G;  5BR8 L;  3KF6 B;  1Q1E A;  4B08 A;  1X3G A;  3A54 A;  2F3W A;  2BDN A;  1JE4 A;  3HEJ A;  1C9O A;  4UPA A;  4L5S A;  4OEL B;  4R8N A;  4QUC A;  5C4X G;  3HOX G;  4B3S Q;  1PZK D;  3C46 A;  4R4O A;  1BUV T;  1UE7 A;  4NDX A;  3F2B A;  4K6D A;  4IFD G;  1HQR D;  4XQJ A;  1C48 A;  2EY5 A;  2HHH Q;  1I3Q B;  2KQ3 A;  4QMG A;  3GO5 A;  3ULL A;  1HNZ L;  2VQE Q;  3PMF A;  4IFD J;  1XTD A;  3ERS X;  4ZQ3 A;  2NVQ B;  1AN8 A;  3VR5 A;  1EY8 A;  3T1H Q;  3X3N A;  4X3T A;  1F9S A;  2A6E D;  1O7I A;  1TWG B;  1VMC A;  3HOZ B;  3IFD A;  1CKO A;  3NBH A;  3KJO A;  1YIJ A;  5T1G A;  1N9W A;  5C3E H;  1XJV A;  3U4V A;  3E6Z X;  4APV A;  4PG3 A;  4HMI A;  1CKM A;  1DM0 B;  1QCB D;  1NR4 A;  1BBW A;  3QOL A;  4UAI A;  3H0G B;  3OPO A;  4YY3 L;  2VB3 X;  3E9I A;  4HCE A;  2R92 G;  2J0T D;  3AFP A;  2WB1 G;  4IUN A;  4DV5 L;  3RZO H;  3KLS A;  4QF4 A;  4RHR A;  2NWG A;  3V2T A;  1GXD C;  2I07 B;  3HKS A;  4JW0 A;  5EPK A;  3SK8 A;  4Q0F A;  1EIG A;  2B8G A;  4K2L A;  1GUO A;  1PRT D;  4ULL A;  1KXL A;  4B3T Q;  5IYB G;  4JBW A;  1GO3 E;  1K83 B;  1S5B D;  1SNP A;  2F0M A;  1EU3 A;  1D2B A;  2AKW B;  2VUM G;  2IX3 A;  3W5O A;  1DOM A;  3JAM c;  3HOV B;  4KK7 A;  3RMH A;  1SYC A;  2F0P A;  4JC0 A;  4R1J A;  1PVO A;  1ET6 A;  3CRK C;  4PV1 C;  2ZTE A;  3D6C A;  2ASB A;  3I55 A;  3MA2 B;  4B3M Q;  4Y7N H;  4JOI A;  4BBR H;  2XGT A;  2F0T A;  4P73 A;  4K14 A;  4JI0 L;  2L0C A;  4X66 L;  1B7Y B;  2F52 A;  1U9R A;  1VMP A;  3BYY B;  1I94 L;  3K81 C;  1JOO A;  2F0F A;  2EY1 A;  3PF4 A;  4V0B A;  3TEH B;  2E75 C;  1WD1 A;  5CMD A;  2UU9 L;  2AMC B;  3J81 i;  1VQ7 A;  3CPW A;  5M3F G;  3NTI A;  1Q12 A;  3U58 A;  3Q8D A;  1T5E A;  4N8F A;  1JC7 A;  1TWH B;  2GVB A;  3L3O C;  3D0F A;  4RHS A;  4LF5 Q;  4LFC L;  5IGE A;  2QEJ C;  1PRT C;  4N9P A;  2F3I A;  2NTS A;  3JAM L;  3L2P A;  1X9N A;  2FJ2 A;  4I7Z C;  4ALP A;  1ESF A;  3K59 A;  3MWY W;  1Y1W G;  5I6W A;  5C44 G;  1OXU A;  3OWE B;  3UI2 A;  1S5F D;  3W1G A;  3BZC A;  2RF4 A;  3BVG A;  3KF8 A;  5LL6 S;  1ONL A;  4EQN A;  4DV2 Q;  1KRS A;  2UXB L;  2YYZ A;  1I4X A;  5EKI A;  1FL0 A;  2K05 A;  2DUD A;  3Q22 A;  5JVG 3;  3T56 B;  3X3M A;  4LUV A;  4POG A;  1CUK A;  1PH5 A;  3RZD H;  2O2L D;  1HUN A;  1DJR D;  1P8L A;  1OXS C;  4DV0 L;  3ULP A;  2PQA A;  3PQI A;  2I5L X;  1Q86 C;  4LW1 A;  4OEM B;  3HOY G;  1NSN S;  2ZT9 C;  2RHS B;  4OWW B;  3NQI A;  1SYB A;  3C3L A;  5C0X H;  3A5U A;  1CSQ A;  1BF4 A;  5C5L A;  1A63 A;  1I5F A;  1AP0 A;  3AFQ A;  3UE0 A;  4GS3 A;  1V9P A;  4GKK Q;  1B3Q A;  3DMU A;  4YIJ A;  5BN4 A;  1UEB A;  1CM9 A;  2UU9 Q;  3KF6 A;  3LNN A;  2I5M X;  1VQJ A;  4L5T A;  4ME3 A;  1BCP F;  3NE5 B;  3NUC A;  5ELN A;  1B8A A;  2B2W A;  1S5C D;  2VUM B;  1SBB B;  3A74 A;  3B6Y A;  3HOU G;  2R92 B;  1CA5 A;  1U5K A;  2A6H C;  4A3B G;  1EFI D;  2E5L Q;  3TP5 A;  1NCV A;  3PF5 A;  1SEB D;  1TWA H;  2JSO A;  4M1U B;  1EY9 A;  1PH1 A;  4I65 A;  1QOH A;  5ELB A;  2K5H A;  1N32 Q;  1XTC D;  4HN7 A;  4JVZ A;  1JJ2 A;  4J15 A;  1R4P B;  5EJW A;  2RSN A;  4A3M H;  5CYU A;  4RFB A;  2K5D A;  1I50 B;  4ZLT F;  5G3L D;  3FMC A;  1AFP A;  5NUC A;  5I9O A;  1VQG A;  1K3R A;  5COR A;  2NVX H;  2B2V A;  3MTS A;  3CC4 A;  3MEH A;  3SK6 A;  3U9S A;  1VQH A;  5JJL A;  2QA4 A;  3D4D A;  5IOD A;  1E24 A;  4A3J H;  4IUU A;  1YIT A;  3A8J E;  3C1E A;  1YNX A;  5M5X H;  2FXQ A;  1PH3 A;  2G5D A;  1SRU A;  2JE6 I;  1XX8 A;  1PH8 A;  1YHA A;  4DR2 Q;  1HCZ A;  2DNC A;  1VQK A;  5C4J B;  2HUG A;  1PTO H;  2EYO A;  3SGI A;  4ZKB B;  1EY6 A;  3WOF A;  1XPO A;  3CP0 A;  1YNJ C;  4RWS C;  4CDE C;  3S16 B;  3TZD A;  1QNK A;  2C9O A;  3I4O A;  1IYV A;  1HNW Q;  4MIU A;  2RBM A;  1TII D;  3MXU A;  2YU9 B;  5C44 B;  2F3V A;  4IZ8 A;  4DR6 Q;  1B70 B;  5C6A A;  1H9K A;  2B63 G;  1LT6 D;  5CR3 A;  3CPF A;  2JA7 H;  3MVV A;  5LL6 X;  1NR2 A;  3MXP A;  2QDL A;  4RAU C;  4DR4 Q;  3ONA B;  1PDQ A;  2VUM H;  4QQB X;  2OTL A;  1Q90 A;  1S4Z A;  4AQY L;  3K8A A;  4WJ3 M;  5CV6 A;  1EIY B;  1S3O A;  2MNA A;  1I4R A;  1L0Y B;  4A3G B;  4RA8 A;  4X6A H;  1D5M C;  3Q6S A;  1K8M A;  3FEW X;  1YZ6 A;  5ELE A;  2VL6 A;  2KCT A;  1NNX A;  2PYK A;  4FP5 D;  5IT9 E;  2PI2 A;  1PHJ A;  3PO3 H;  4PQX A;  1OXT A;  2Z6B A;  4DK3 C;  4HR7 B;  3K5O A;  2ICE C;  5J22 A;  4KHP Q;  2ID0 A;  1SND A;  5FO9 B;  3F1Z A;  3NEN A;  2WAQ B;  2EYJ A;  5JEA J;  3TP6 A;  3N52 A;  3URY A;  1GOZ A;  3AYH B;  5LMU L;  4GNX B;  3C1F A;  3CQZ B;  1GVP A;  4KKS A;  4LF5 L;  3NP8 A;  3GTK B;  5FLX E;  1FJG L;  4DR1 Q;  1LM0 A;  2L12 A;  2JXM B;  2A69 D;  1Q8K A;  4JI3 L;  1IBM Q;  3H3V H;  4KY7 A;  5IWA L;  2K4K A;  1PZJ D;  1DOK A;  3I7F A;  4JG2 A;  3S1Q H;  1TU2 B;  1JOK A;  1OTC A;  3ULJ A;  4KN7 C;  1H9R A;  5IP9 H;  4QB4 A;  3BDC A;  3QR8 A;  5GAD C;  2P5Z X;  1D5Z C;  5BN3 A;  3KFU A;  4CKE A;  3HZX A;  1IXR A;  4LAA A;  2AUK A;  4DV1 Q;  1Q3L A;  2DY8 A;  3J7A F;  1HZA A;  3KJP A;  3HFZ B;  1Z47 A;  3I72 A;  2Y0S B;  4BY7 H;  5EPJ A;  1H9S A;  2LKV A;  4NXM L;  1SAP A;  1EY4 A;  1RHP A;  2UUC L;  2AWO A;  4BWG B;  1B44 D;  2EIF A;  4LUO A;  4IPG A;  5IY0 A;  2XRQ D;  3PUY A;  4MNO A;  1TWF H;  2KCC A;  3I4L A;  1LT5 D;  1M90 C;  2B2T C;  1AE3 A;  2RSO A;  4LMQ D;  1GUS A;  1KDB A;  4CBV A;  4KTA A;  4YHH Q;  1D1I A;  2F0D A;  1Y69 U;  3EA6 A;  3E3X A;  2CWA A;  2IX0 A;  3CCU A;  3RLF A;  3PUW A;  1TR5 A;  4BBR G;  2VQF Q;  4X3U A;  4BY7 G;  1X54 A;  1V1Q A;  2WKC A;  5D3D A;  4TSS A;  1U0L A;  4HTH A;  4DPG A;  1QVC A;  1RIP A;  3I4M H;  3LX0 A;  4A3K G;  4DAV A;  4LF7 Q;  3J80 E;  4U67 3;  2AQ1 B;  3L9A X;  4O0A A;  1VQM A;  1Q46 A;  1V1O A;  5C4X B;  1L1O B;  4NXN Q;  1ZXT A;  3TDQ A;  1BBX C;  2NN6 I;  1DYQ A;  4LFA L;  3GTO H;  1I6H H;  2ZM6 Q;  3PO2 H;  2MHV A;  2NN6 G;  3GTJ H;  4FVM A;  4IUR A;  3J81 j;  3SE0 A;  1EQV A;  4P74 A;  5M5Y H;  2R93 G;  2JA5 B;  3VR6 A;  5JPN C;  3FKI G;  3M7N A;  4B3R Q;  4CJ1 B;  5C4Z A;  1MGS A;  4ME5 A;  2ZM6 L;  5JPM C;  2RCF A;  2R6G A;  3T1Y L;  2EYL A;  5EQ0 A;  4RGM A;  2L11 A;  2PNR C;  3OIQ A;  3MZ5 A;  3JC6 6;  3AEV A;  1O80 A;  1OXX K;  1STA A;  4DV7 L;  3J7A V;  1AEX A;  3ND9 A;  4PMW A;  3D3R A;  5L37 A;  1QUQ B;  5C44 H;  3CU7 A;  4J6H A;  1UWV A;  1SRO A;  1S5E D;  4GNX A;  3OW7 A;  4JI0 Q;  1MHW C;  1AZQ A;  4Z9C B;  1GM5 A;  4X62 Q;  5C4H A;  1EWH A;  3TZU A;  5LMN L;  2Q2T A;  2JA5 H;  5M5Y B;  2F0Q A;  2B3G A;  1PTO B;  5KNC A;  4OO1 H;  4ZRZ A;  4IPC A;  3W3A A;  2UUB Q;  4FF3 A;  4GLX A;  3VR3 A;  3CXC A;  2JA8 B;  1HNX L;  3PUX A;  3HOX H;  4UY8 C;  2OCE A;  1FR3 A;  1SNM A;  3PSI A;  2F1M A;  3VYR A;  4LFB Q;  4XTC S;  4AYB E;  2JA8 G;  3D4W A;  1BQQ T;  3PGZ A;  3STB C;  4F7X A;  2EYH A;  3R8B A;  2G9D A;  3CW2 C;  4DUZ L;  2WFW A;  5M3F H;  2V1C C;  3QOJ A;  2RA4 A;  2RDH A;  3KDF A;  2BE5 C;  1LAC A;  1D8L A;  1SMY D;  4ZUJ A;  1HH2 P;  4K8J A;  2LS0 1;  1RTN A;  4WRD A;  1VCI A;  5M5W B;  4TQU S;  2E2D C;  3KK7 A;  3KLW A;  2F03 A;  2BH2 A;  1EYG A;  1RJT A;  1XMQ L;  3LGJ A;  4R4I A;  1K0R A;  2EXD A;  2LFN A;  2IWH A;  3ICE A;  4A76 A;  1GUN A;  1HPC A;  5C3E B;  5IWA Q;  2B2T A;  3TRZ A;  4OON A;  5CV5 A;  1FJG Q;  2KJX A;  2Y0S G;  1PH2 A;  1EY5 A;  2PMZ E;  2DY7 A;  1Z7T A;  1IZ6 A;  1BKB A;  2ZJR A;  4L8J A;  4NXN L;  2Z1C A;  2BCO A;  1EIF A;  4DR3 Q;  1TS3 A;  3BS1 A;  1A3T A;  1K73 C;  1X56 A;  4FF4 A;  2JA6 G;  3M4O H;  1EQT A;  4JI6 Q;  3S2D B;  3D4R A;  1ICW A;  4KJN A;  1A3U A;  5HGQ A;  2YTV A;  1UE5 A;  4X3K A;  1SE3 A;  4EQO A;  3QJY A;  2BOS A;  1K8G A;  1I4H A;  4IPD A;  4MHE A;  4O2D A;  1VQD A;  3SR1 A;  1VQ5 A;  5E4X A;  5CV8 A;  5E1F A;  1EYA A;  3OHX C;  3I90 A;  4C3J H;  4UDU C;  5KYI A;  3DM3 A;  3P75 A;  2YV5 A;  3K0X A;  1J8I A;  3KDF B;  1GHK A;  2JQO A;  3FVQ A;  3P1H A;  1R4Q B;  1SMY C;  5FOB B; 
#chains in the Genus database with same CATH homology
 1I4G A;  2Z8L A;  4U68 A;  2JP1 A;  4IUP A;  1WVL A;  4HMJ A;  3S1N B;  3K57 A;  4A3J B;  3OIP A;  2J4X A;  3DHQ A;  1I4Q A;  4X3S A;  2E2J B;  3BVZ A;  4BY1 B;  1B3A A;  4C1N I;  2K01 A;  1SNQ A;  4NMZ A;  5KRU A;  1GUG A;  3VA7 A;  5TSS A;  4DK1 A;  1FNV A;  2F0N A;  2A6H D;  2IJ0 A;  1JWM D;  4OO1 G;  1MI2 A;  1DCZ A;  1TWC B;  5KEE A;  2EDG A;  3N6R A;  1IKM A;  3H6M A;  2NTT A;  4C3H G;  4A3E B;  4H44 C;  1DZ1 A;  2B2U A;  3H91 A;  1X3P A;  3T53 B;  1DON A;  2R61 A;  1SDF A;  2WIN B;  2NN6 H;  3GD7 A;  1EU4 A;  3A7L A;  1JOQ A;  3A56 A;  4E6I A;  2BA0 A;  2WV6 D;  4H13 C;  2X69 A;  2WII B;  3EVQ A;  1MBY A;  5C0X G;  2OF1 A;  1KAA A;  2AUJ D;  1I6V C;  3HGB A;  3PUV A;  4C3J B;  5JOB A;  2B8F A;  4HED A;  5EPL A;  1VF5 C;  2JA6 B;  2NYZ D;  4ILW A;  5EBC A;  3T4A C;  2IX1 A;  4L6T B;  4F87 A;  3SHL A;  4BA1 I;  1SE4 A;  1LT3 D;  3OMG A;  3TP8 A;  5HGT A;  1UNS A;  1CA6 A;  1AW7 A;  3ITP A;  1PYW D;  3QB3 A;  5IGB A;  4BA2 I;  4ID6 A;  1TWA B;  2M00 A;  3R2I A;  3MXN A;  4QIW B;  1H9S B;  5C5M A;  3DEP A;  2AQ2 B;  1WTV A;  1R9T B;  2R93 B;  2F4I A;  1F2Y A;  2QIL A;  1BDO A;  2K7V A;  1B50 A;  1O7Z A;  3E0J A;  1YNN D;  4DU9 A;  4KKT A;  5ELF A;  1IW7 D;  2HQE A;  1O7L A;  2PPB C;  3SDZ A;  5CGK A;  2EJG C;  2CW0 C;  4N9T A;  3FKI B;  1FGB D;  2A74 C;  1V1P A;  4H0L C;  1MD2 D;  2B2W C;  1IW7 C;  1ZYR C;  2K28 A;  2A68 C;  1J9O A;  3H09 A;  3S15 B;  2MGS A;  4ZKC B;  1ZYR D;  4B9W A;  2E2H B;  3AMU A;  3MXG A;  2F0J A;  2EZV A;  1LTT D;  2BDO A;  3HG9 A;  3PO3 B;  3VR2 A;  4XQN A;  1G2T A;  3R2T A;  3A55 A;  4DF7 A;  1CTM A;  3M4O B;  1G2S A;  3MFY A;  1D5X C;  2B2V C;  1TVX A;  2NB0 A;  2NBF A;  3P20 A;  1KNA A;  2L55 A;  2PW5 A;  1DXM A;  1IHZ A;  4DN4 M;  4H7B A;  3TP7 A;  5FLX L;  4IUT A;  2F0E A;  2BE5 D;  2F0S A;  1NUC A;  1SJH D;  3VR4 A;  1CHQ D;  3QWN A;  1BNZ A;  2D9U A;  4XYQ A;  2HCC A;  3H94 A;  1SNO A;  3J81 L;  1VF7 A;  1JCK B;  3K5M A;  5I9P A;  1CZG A;  1PTO F;  5ELD A;  1O78 A;  3K6O A;  4PMC A;  4K5V A;  4C1N K;  2E74 C;  3A8I E;  2O5I C;  4HSV A;  1CFM A;  5IGC A;  5DAU A;  2NUC A;  2VXW A;  3R93 A;  3IFT A;  1STN A;  3T51 B;  1QJO A;  4AYB B;  2B2Y C;  1V43 A;  1B9M A;  4RH6 A;  1Q1B A;  5HUR A;  5EKK A;  1U4L A;  5A2Q E;  3IKJ A;  5DNF A;  3P7J A;  1BCP B;  1QIL A;  4FNF A;  1D6E C;  2ZXP A;  3S2H B;  1B1Z A;  5D14 A;  1A2U A;  2CVR A;  2EJM A;  1Y8P B;  2CW0 D;  4KY5 A;  1Z6H A;  3OSO A;  5C0X J;  1FNW A;  1A6X A;  2PZW A;  5CC4 A;  1I4P A;  5I6Y A;  1KDA A;  1RKN A;  1STH A;  2RKS A;  1FNU A;  1TY2 A;  4A3F B;  1E2Z A;  3LWU A;  1SNC A;  4QUF A;  5I4D A;  4C3I G;  3DEO A;  3NXW A;  1PRT B;  5IIF A;  3M7G A;  1E0B A;  2TSS A;  2N88 A;  4G7H C;  3O13 A;  4XQQ A;  5JEA H;  4RCO A;  2LY7 A;  2X6G A;  4JK1 C;  1WTW A;  3M4Y A;  4RGN A;  3NQT A;  5EBD A;  1HFG A;  3PIP 3;  4R8I A;  1ILQ A;  2JYO A;  1TWF B;  2K33 A;  3RUZ A;  5COY A;  2KEE A;  1EWC A;  2K32 A;  1JIC A;  2FHT A;  4C3H B;  1CI3 M;  2K6A A;  3BZD B;  1GHJ A;  2OEO A;  4NP5 A;  1PFN A;  3TME A;  1TS2 A;  3AU7 A;  2EY6 A;  3HRZ C;  2Z4H A;  3SK5 A;  3S9W A;  1JWS D;  5A2Q L;  4G57 A;  4ZYS A;  4DNR B;  2JEA I;  1PXU A;  2QKI C;  1EIH A;  2D62 A;  1CZW A;  2F0U A;  1WCM B;  5AFW A;  1HUM A;  1EL0 A;  3DUZ A;  2R7Z B;  2A73 B;  1PMR A;  2O5J C;  1STG A;  2F0I A;  2B2Y A;  2F0H A;  2XNA C;  3R3O A;  3BVM A;  3HP3 A;  3KLR A;  2M2L A;  4WJW A;  5DEH A;  2L5T A;  5A35 A;  3QG1 A;  3OMC A;  2DN8 A;  2WAC A;  1LAB A;  4P2C B;  3MHB A;  5J39 A;  4EVO A;  1AZP A;  2IW3 A;  1KNE A;  5IGG A;  4R9W A;  4KHV A;  3GV6 A;  2Z4I A;  1LTA D;  1F2Z A;  3K0Y A;  2PW7 A;  1RF2 D;  2A69 C;  2SNM A;  4ZAI A;  1A3V A;  1RCV D;  4BS9 A;  3PV0 A;  1ESR A;  3D8G A;  2FFK B;  1LTG D;  3A7A B;  2EJF C;  5ISR A;  1ET9 A;  1QB5 D;  1H9M A;  1MSG A;  2XN9 C;  1DOL A;  3L7Z C;  1XXG A;  2TMP A;  4G4K A;  1F2L A;  4KHZ A;  1QNU A;  3KBX A;  3T13 A;  2EVB A;  5FO7 B;  3OWF A;  1VDZ A;  1CT1 D;  3IL8 A;  2Q8I B;  1C8C A;  1B2T A;  4O1N A;  4A93 B;  3K5N A;  3K5L A;  2K04 A;  5KNB A;  3ERQ A;  3Q24 A;  4FXK C;  1ENF A;  3DWA A;  1BCP C;  1UAP A;  3VA5 A;  2B63 B;  2MJ8 A;  3Q0A A;  2MPM A;  3I4M B;  4DNT B;  1BO0 A;  3GQB A;  2RQX A;  3I8Z A;  3ND8 A;  5M3F B;  5C3X A;  3DWP A;  5G3L F;  5E3F A;  2B39 A;  4DA2 A;  4OIJ A;  1X3Q A;  5EGT A;  5ELC A;  1C4Q A;  4F88 A;  2ZXR A;  5IT9 L;  3V96 A;  3GTG B;  3GTP B;  4PNY A;  1LTS D;  2J7Z A;  1BCP D;  1F9P A;  4FXD A;  3G6J B;  3PUZ A;  4DGZ A;  2RDF A;  3J80 L;  1HA6 A;  4K5W A;  2JA7 B;  2PZT A;  4K8I A;  3SVM A;  2EOT A;  3GP7 A;  4OO1 I;  4FF2 A;  1CQF A;  4KMU C;  1SE2 A;  2ENB A;  1NAP A;  2OT2 A;  5JJZ A;  1KTK A;  1WTO A;  2WB1 B;  1E2W A;  2SDF A;  1ILP A;  1MSH A;  1ENC A;  2EYM A;  1LT4 D;  5CV4 A;  1PLF A;  4DAP A;  4TRD A;  1S5D D;  2WKD A;  1WTR A;  2B2U C;  1Y8N B;  4ZK9 B;  1LO5 D;  4CJ0 B;  2AQ3 B;  2K03 A;  2K5Q A;  5K36 H;  3NTH A;  4XT3 B;  3GTM B;  1O7Y A;  4KD4 A;  3DM1 A;  1X32 A;  1II3 A;  1RDP D;  5C3W A;  2WP8 J;  4A3M B;  3F2U A;  3VYU A;  3M3Y B;  2HDM A;  3EQL C;  1KDC A;  4J8Q A;  4FO2 A;  2NVT B;  3TSS A;  1TS5 A;  3CHB D;  1PFM A;  1EEI D;  3RD4 A;  1JOR A;  1HTL D;  1U4P A;  1ML0 D;  3OOC A;  4IFD I;  3FDT A;  4MN3 A;  2D2C C;  3SK4 A;  2F0G A;  2XVS A;  2FIN B;  2H4O A;  4EQP A;  1SYG A;  2O4X A;  2EY2 A;  3GTO B;  1I6H B;  2ZXO A;  5E4W C;  2H1E A;  2L4N A;  3M85 A;  1B4O A;  3J81 E;  5K5P A;  5J1Z A;  1JR0 D;  1LTR D;  1W6J A;  3NHH A;  3VYT A;  3MAQ A;  4FXG C;  1WD0 A;  2E76 C;  4HCS A;  5IGF A;  3KUP A;  4RGT A;  5D65 A;  4CGY B;  1ZEQ X;  2KEC A;  1QG7 A;  3DWQ A;  4DXG A;  1BR9 A;  3KBG A;  2HCI A;  1BXT A;  3NPP A;  3SEB A;  2LMC B;  4ABN A;  2PZU A;  5KND A;  2QCP X;  3GTL B;  1PZI D;  3G7L A;  3IAY A;  4FYD A;  1TT2 A;  3BDO A;  3NWS A;  3I70 A;  1ENA A;  5KIX A;  1OO9 B;  2F0W A;  3BDL A;  1EYC A;  2SOB A;  3V05 A;  4CHT B;  1GUT A;  3S1R B;  2C5C A;  3D6W A;  3GTQ B;  2BA1 A;  4DK0 A;  1G29 1;  1QE6 A;  2HDL A;  4WOR A;  1STE A;  4HAE A;  3RZD B;  5I2Y A;  3PO2 B;  4RCN A;  1ZKO A;  5JEA G;  3GTJ B;  1QWY A;  3EJI A;  3BYT B;  5CBA E;  4XYO A;  5T1I A;  1EZ6 A;  1F2M A;  4V19 0;  1U4R A;  4XDX A;  3AB9 A;  3ERO A;  3U9O A;  1RTO A;  1E2V A;  4TKO B;  2V4D A;  2KOL A;  1HHV A;  1XWE A;  1WTP A;  2KVM A;  1IL8 A;  5DM6 3;  1CK1 A;  2F0O A;  4G7O C;  2X6L A;  3FRP B;  3K7A B;  1G91 A;  2RDG A;  2CHB D;  2NVY B;  3I3C A;  4LJZ C;  3CRL C;  2MP1 A;  5FKA C;  1EY0 A;  1STB A;  1G8Z D;  2PQE A;  3JAM E;  2PCF B;  1A15 A;  2FMC A;  4K6L A;  2R3Z A;  4KD3 A;  1PTO C;  1IKL A;  3W2D A;  1RD9 D;  4C2M B;  5FK9 C;  4DAY A;  3QO2 A;  1OXV A;  1SFO B;  2XWJ B;  4LK1 C;  3BG3 A;  1Q8I A;  2EPB A;  5D3I B;  1K8O A;  3WOE A;  3GV3 A;  4RKB A;  4KI0 A;  4GZY C;  1TS4 A;  1GJX A;  1JB3 A;  2OXP A;  3WDN A;  3DXJ C;  1PTO D;  2AWN A;  1LV9 A;  4K5X A;  2XIW A;  2JEB I;  2KUM A;  1SJE D;  5C0X I;  1LTI D;  1A2T A;  4S3S A;  2F0K A;  4DXF A;  4A3D B;  4A3B B;  4C56 C;  4C3I B;  4RGO S;  5BN5 A;  2Q8T A;  3K58 A;  2EXZ A;  3C2P A;  2L9H A;  5K36 G;  2KED A;  3S1M B;  4XIG S;  5M3M B;  1DD2 A;  1F9R A;  5M5X B;  1TQO A;  5CV7 A;  4OIK A;  4NW2 A;  3HOW B;  1FD7 D;  3MC0 B;  3HKZ B;  2K5W A;  2D5D A;  4IAL A;  2KCN A;  1V8Q A;  1M4V A;  2EYP A;  1HA5 A;  4OHJ A;  1EYD A;  4KV6 A;  4CKB A;  4QCL A;  3LWE A;  4OGQ C;  5JVH 3;  4DFA A;  5KGU A;  2IT1 A;  5FO8 B;  1B9N A;  2GA4 B;  2VNU D;  1PFB A;  2XWB B;  1LTB D;  1T5X D;  4CKC A;  3NWT A;  2EYF A;  1EEF D;  1YNJ D;  2XRS D;  3MFG A;  5M9O A;  2KA7 A;  4K2K A;  4IUV A;  3I73 A;  3S17 B;  4F8M A;  1WTQ A;  4Y7N B;  1KAB A;  2A68 D;  4FF1 A;  4M8A A;  1HQM C;  1HXY D;  1SYE A;  3I91 A;  4XXE A;  4IUQ A;  5IGD A;  2KHS A;  5LHY 1;  2RVL A;  3I4N B;  1CHP D;  3TBI B;  1G6Z A;  3NSW A;  3HOU B;  1Y8O B;  1TKW B;  3SXH A;  2K1B A;  2N55 A;  1IYU A;  1SSO A;  3HS0 C;  3D31 A;  2Q8R E;  3KLS X;  4G7Z C;  4EGV A;  2IPK D;  3RZO B;  4A3K B;  1XYI A;  4Q5V A;  2QF7 A;  4CJ2 C;  3CKI B;  4IQZ A;  4O42 A;  4BY7 B;  1EOT A;  1GUW A;  1HFN A;  1SXT A;  4NKL A;  1V1P B;  3H3V C;  1W6K A;  2F0V A;  3S1Q B;  1Y1W B;  1PRT F;  1H9J A;  1CQV A;  2FMM A;  4RKL A;  4BBR B;  1JQY D;  4L63 B;  1D1K A;  3HOY B;  1UUP A;  4XT1 B;  4OL7 A;  4IFD H;  4PMB A;  1F9Q A;  5CBE E;  1EZ8 A;  1KLU D;  1M8A A;  4WFN 3;  2CQA A;  2SNS A;  3T16 A;  2QDB A;  1SYD A;  3HOX B;  1WTX A;  3S14 B;  1Y1V B;  1L0X B;  5EKL A;  3VYS A;  4B9X A;  2DNE A;  4KY6 A;  1U4M A;  2NVX B;  5F2D A;  2EE1 A;  1F77 A;  4ZUI A;  2IL8 A;  2ICI A;  2L1B A;  3A8K E;  3NTK A;  1TY0 A;  3TN2 A;  1BOS A;  4A3I B;  4BBS B;  5JAV A;  1HTP A;  3NK9 A;  4IN3 A;  2E2I B;  3E5S A;  4HSP A;  2PMZ B;  3FPP A;  1KLG D;  3EFX D;  2M9V A;  1JWU D;  2A5H A;  3Q23 A;  1LLR D;  4ODG A;  1EY7 A;  2I46 A;  3NBI A;  4KJO A;  5CV9 A;  1YNN C;  5I2X A;  2A6E C;  4KN4 C;  3QIA A;  2SEB D;  4KKU A;  5KYL A;  1UEA B;  5IOC A;  1FYC A;  3FPU B;  4J1M A;  2F0L A;  1B53 A;  3ZYY X;  2VB2 X;  2NZ1 D;  2G9H D;  3J7Y W;  1ROD A;  3PIO 3;  1STY A;  5DM7 3;  2MUY A;  1HRJ A;  1SYF A;  2PO4 A;  2XSC A;  4C3J G;  1Q1E A;  4B08 A;  3A54 A;  2F3W A;  2BDN A;  1JE4 A;  3HEJ A;  4R8N A;  4QUC A;  1PZK D;  3C46 A;  1BUV T;  4IFD G;  4NDX A;  4K6D A;  4XQJ A;  1HQR D;  1C48 A;  2EY5 A;  1I3Q B;  2KQ3 A;  4QMG A;  3GO5 A;  3PMF A;  4IFD J;  2NVQ B;  4ZQ3 A;  1AN8 A;  3VR5 A;  1EY8 A;  3X3N A;  4X3T A;  1F9S A;  2A6E D;  1TWG B;  1VMC A;  3HOZ B;  3IFD A;  3NBH A;  5T1G A;  3E6Z X;  4HMI A;  1DM0 B;  1QCB D;  1NR4 A;  3QOL A;  4UAI A;  3H0G B;  3OPO A;  2VB3 X;  4HCE A;  2J0T D;  4IUN A;  3KLS A;  4QF4 A;  4RHR A;  2NWG A;  3V2T A;  1GXD C;  2I07 B;  5EPK A;  3SK8 A;  4Q0F A;  1EIG A;  2B8G A;  4K2L A;  1GUO A;  1PRT D;  4ULL A;  4JBW A;  1K83 B;  1S5B D;  1SNP A;  2F0M A;  1EU3 A;  1D2B A;  2IX3 A;  1DOM A;  3HOV B;  4KK7 A;  3RMH A;  1SYC A;  2F0P A;  1ET6 A;  3CRK C;  4PV1 C;  3D6C A;  3MA2 B;  2F0T A;  4K14 A;  2L0C A;  1U9R A;  1VMP A;  3BYY B;  1JOO A;  2F0F A;  2EY1 A;  4V0B A;  2E75 C;  1WD1 A;  5CMD A;  3NTI A;  1Q12 A;  1T5E A;  1JC7 A;  1TWH B;  3L3O C;  4RHS A;  5IGE A;  2QEJ C;  1PRT C;  4N9P A;  3JAM L;  2NTS A;  2FJ2 A;  4I7Z C;  1ESF A;  3K59 A;  3MWY W;  5I6W A;  1OXU A;  3OWE B;  3UI2 A;  1S5F D;  3BVG A;  3KF8 A;  5LL6 S;  1ONL A;  4EQN A;  2YYZ A;  1I4X A;  5EKI A;  3Q22 A;  2K05 A;  5JVG 3;  3T56 B;  3X3M A;  2O2L D;  1HUN A;  1DJR D;  1OXS C;  1NSN S;  2ZT9 C;  3NQI A;  1SYB A;  3C3L A;  5C0X H;  1BF4 A;  5C5L A;  1AP0 A;  3DMU A;  4YIJ A;  5BN4 A;  1CM9 A;  3LNN A;  1BCP F;  3NE5 B;  3NUC A;  2B2W A;  1S5C D;  2VUM B;  1SBB B;  2R92 B;  1CA5 A;  2A6H C;  1EFI D;  3TP5 A;  1NCV A;  1SEB D;  2JSO A;  4M1U B;  1EY9 A;  4I65 A;  1QOH A;  5ELB A;  1XTC D;  4HN7 A;  1R4P B;  5EJW A;  2RSN A;  5CYU A;  4RFB A;  2K5D A;  1I50 B;  4ZLT F;  5G3L D;  3FMC A;  1AFP A;  5NUC A;  5I9O A;  5COR A;  2B2V A;  3MTS A;  3MEH A;  3SK6 A;  3U9S A;  3D4D A;  5IOD A;  4IUU A;  3A8J E;  3C1E A;  2JE6 I;  1XX8 A;  1HCZ A;  2DNC A;  5C4J B;  2HUG A;  1PTO H;  2EYO A;  4ZKB B;  1EY6 A;  3WOF A;  1YNJ C;  4RWS C;  3S16 B;  3TZD A;  1QNK A;  2C9O A;  1IYV A;  4MIU A;  2RBM A;  1TII D;  3MXU A;  2YU9 B;  5C44 B;  2F3V A;  4IZ8 A;  5C6A A;  1H9K A;  1LT6 D;  5CR3 A;  3MVV A;  5LL6 X;  1NR2 A;  3MXP A;  4RAU C;  3ONA B;  1PDQ A;  1Q90 A;  1S4Z A;  5CV6 A;  1I4R A;  1L0Y B;  4A3G B;  4RA8 A;  1D5M C;  3Q6S A;  1K8M A;  3FEW X;  5ELE A;  2PYK A;  4FP5 D;  5IT9 E;  4PQX A;  1OXT A;  4HR7 B;  3K5O A;  2ICE C;  5J22 A;  2ID0 A;  1SND A;  5FO9 B;  3TP6 A;  2WAQ B;  2EYJ A;  5JEA J;  3N52 A;  3URY A;  1GOZ A;  3C1F A;  3CQZ B;  4KKS A;  3NP8 A;  3GTK B;  5FLX E;  2L12 A;  2JXM B;  2A69 D;  4KY7 A;  1PZJ D;  1DOK A;  1TU2 B;  1JOK A;  4KN7 C;  1H9R A;  4QB4 A;  3BDC A;  1D5Z C;  5BN3 A;  4CKE A;  3HZX A;  4LAA A;  2AUK A;  1Q3L A;  2DY8 A;  3J7A F;  1Z47 A;  3I72 A;  2Y0S B;  5EPJ A;  1H9S A;  2LKV A;  1SAP A;  1EY4 A;  1RHP A;  2AWO A;  4BWG B;  1B44 D;  2XRQ D;  3PUY A;  2KCC A;  3I4L A;  1LT5 D;  2B2T C;  2RSO A;  1GUS A;  4LMQ D;  1KDB A;  4CBV A;  4KTA A;  1D1I A;  2F0D A;  1Y69 U;  3EA6 A;  2IX0 A;  3RLF A;  3PUW A;  1TR5 A;  4X3U A;  2WKC A;  5D3D A;  4TSS A;  4HTH A;  3LX0 A;  4DAV A;  3J80 E;  4U67 3;  2AQ1 B;  3L9A X;  1V1O A;  5C4X B;  1ZXT A;  3TDQ A;  1BBX C;  2NN6 I;  1DYQ A;  2MHV A;  2NN6 G;  4FVM A;  4IUR A;  3SE0 A;  1EQV A;  2JA5 B;  3VR6 A;  5JPN C;  3M7N A;  4CJ1 B;  5C4Z A;  1MGS A;  4ME5 A;  5JPM C;  2R6G A;  2EYL A;  5EQ0 A;  4RGM A;  2L11 A;  2PNR C;  3OIQ A;  3MZ5 A;  1O80 A;  3J7A V;  1OXX K;  1STA A;  1AEX A;  3ND9 A;  4PMW A;  3D3R A;  3CU7 A;  4J6H A;  1S5E D;  3OW7 A;  1AZQ A;  4Z9C B;  5C4H A;  1EWH A;  3TZU A;  5M5Y B;  2F0Q A;  1PTO B;  5KNC A;  4OO1 H;  4ZRZ A;  3W3A A;  4FF3 A;  3VR3 A;  2JA8 B;  3PUX A;  1FR3 A;  1SNM A;  2F1M A;  3VYR A;  4XTC S;  3D4W A;  1BQQ T;  4F7X A;  2EYH A;  3R8B A;  2G9D A;  3QOJ A;  2RA4 A;  2RDH A;  2BE5 C;  1LAC A;  1SMY D;  4ZUJ A;  4K8J A;  2LS0 1;  1RTN A;  4WRD A;  1VCI A;  5M5W B;  4TQU S;  2E2D C;  3KK7 A;  2F03 A;  1RJT A;  2LFN A;  2IWH A;  1GUN A;  1HPC A;  5C3E B;  2B2T A;  5CV5 A;  2KJX A;  1EY5 A;  2DY7 A;  1Z7T A;  4L8J A;  2Z1C A;  2BCO A;  3BS1 A;  1TS3 A;  1A3T A;  4FF4 A;  1EQT A;  3S2D B;  3D4R A;  1ICW A;  4KJN A;  1A3U A;  4X3K A;  1SE3 A;  4EQO A;  3QJY A;  2BOS A;  1I4H A;  4MHE A;  3SR1 A;  5E4X A;  5CV8 A;  5E1F A;  1EYA A;  3OHX C;  3I90 A;  4UDU C;  5KYI A;  3P75 A;  1J8I A;  1GHK A;  3FVQ A;  3P1H A;  1R4Q B;  1SMY C;  5FOB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...