2E2DC

Flexibility and variability of timp binding: x-ray structure of the complex between collagenase-3/mmp-13 and timp-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
180
Chain Sequence
CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEYLIAGKAEGNGNMHITLCDFIVPWDTLSATQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Matrix metallopeptidase 13
publication title Flexibility and Variability of TIMP Binding: X-ray Structure of the Complex Between Collagenase-3/MMP-13 and TIMP-2
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2006-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2e2dC02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 2e2dC01
1BQQT 1JC7A 1UEAB 2A74C 2QKIC 3MA2B 4ILWA 3CU7A 5JPNC 5FOBB 1BUVT 2J0TD 3CKIB 4FXGC 1XWEA 2A73B 2TMPA 1BR9A 3G6JB 2E2DC 5JPMC 5FO8B 3HS0C 1GXDC 1PXUA 3KLSA 3FRPB 2XWJB 2XWBB 2ICEC 2WINB 3HRZC 3L3OC 3V96A 2B39A 2WIIB 1D2BA 1UAPA 5FO7B 1OO9B 3I70A 3OHXC 5FO9B 2I07B 1JB3A 3T4AC 4FXKC
chains in the Genus database with same CATH superfamily
2B2WA 2CH4W 4K5VA 1J6QA 2EYLA 5JJLA 2RF4A 2C9OA 2WAQB 5H1SE 2QF7A 2B2YC 4A3BB 4DR6Q 3RN2A 3JAML 3PUXA 2B2VC 2K03A 1QJOA 3E6ZX 1K9MC 1KNAA 4XIGS 4RA8A 2B2TC 1PTOC 1KDBA 2MPMA 3MXGA 3FEWX 2A68C 4LF7Q 3SK4A 2I5HA 3I56A 4IPGA 1CZWA 1WI5A 2KHSA 4MTKA 4LF7L 5JOBA 1WTOA 4J6HA 2IX1A 1LV9A 1SE4A 3GTOB 1F9RA 4R8NA 3QOJA 4A75A 2QEJC 1NMGA 4IFDJ 1I50H 1DD2A 4HIKA 1MKHA 1GO3E 4DAYB 3NTIA 5C44H 4AQYQ 3SGIA 2DUDA 1D1IA 1BBUA 1EEFD 4YCWA 2Z6KC 4AQYL 1GUGA 4X3KA 3M4OB 4R1JA 3S16H 3M85A 5C4XB 2KBNA 1X54A 4LF5Q 5C3WA 4XT1B 3TS2A 5C44G 1IYVA 2ZXRA 4LF5L 1STGA 4HMJA 3V96A 3SVMA 4CDFC 4UP8A 4HCSA 3DLLA 3NP8A 1D8LA 1LTLA 3T4AC 2PNRC 2F0LA 2J0TD 5T1IA 1ET6A 5C5MA 1PH2A 2CWPA 3S1RB 3H6MA 1BKBA 1B9NA 1OXSC 1KAAA 2JN4A 4IUNA 4L8JA 3KF8B 3S1QH 5C6AA 3MFGA 1L0YB 3D3RA 4WJWA 1LTID 5G3LD 3UDXA 1Q82C 4R4TA 2Q2HA 3ND8A 4BY1H 4A3CH 5E4XA 4CDCC 1PZKD 4DPGA 1T5XD 1XWEA 1PFSA 2N55A 5CYUA 2NVYB 3HG9A 1K8OA 1EFWA 1EQRA 3FKIH 1GXDC 1SNOA 1SYFA 4DA2A 3GO5A 4BY1G 4A3CG 2VB3X 4LJZC 1G8ZD 4KY6A 1EY7A 1PFBA 4DAYA 2XSCA 1KRSA 4JYAQ 3IL8A 3NSWA 1EQQA 4Y52H 4C3JB 4JYAL 2O4XA 4HEDA 5CV9A 1B2TA 1H9SA 4L5RC 5G3LF 1TXYA 1EL0A 2AQ3B 3MEHA 1QVCA 2VB2X 4XYOA 4HMIA 2ASBA 1TWGB 5IIFA 1KD1C 4HJ7A 3M4PA 3PO2H 1D6EC 4X65Q 1ZEQX 2H1EA 2R7ZH 1DGSA 3HOWH 1SYDA 1UE6A 1BCPD 4X65L 2WP8J 4CJ0B 3LWEA 4LUOA 3OMGA 2I0QA 1HZBA 1Q1EA 1B53A 2HDMA 4GNXB 2HIVA 4FP5D 1SBBB 2K33A 5IYDG 3CCQA 3CCEA 2E2HB 1NSNS 3HOWG 3D8GA 4Z9CB 4HJAA 5K36H 3KLSA 1LACA 3T1YQ 3V2TA 5M5YH 4HTHA 5EKKA 2EYHA 1SNQA 1DM0B 4GOPC 3T1YL 1TS4A 4GS3A 2I5LX 2M9VA 4KHPQ 1EOTA 3NWSA 3BVZA 5K36G 3X3NA 3KLWA 3S14H 4KHPL 4FF4A 4N8FA 2BCOA 1Y1WG 1BCPF 1ENAA 1STNA 3SEBA 1E0BA 3A8JE 1S4ZA 1PXUA 1EEID 1WJJA 2OQKA 2EY5A 4P71A 5LMNQ 1EYGA 1S5DD 1T5EA 5DNFA 4IUQA 5KNCA 5LMNL 2B2UC 5KNBA 3RZOH 3A5ZB 3UI2A 4F88A 2UXCQ 1VQFA 2Z4HA 2EQSA 2EYJA 4J15A 3RMHA 1VQOA 2UXCL 1B70B 5F2DA 1B4OA 1XX8A 2YTVA 4YWLA 4JG2A 2D0PA 1L0WA 1HZ9A 3F2CA 1DZ1A 3L3OC 3M9BA 2Q8IB 1Y8OB 4G7OC 1KHIA 2WIIB 3BZDB 4H13C 4C3IH 4GNXA 4APVA 4WORA 2ZJRA 2B3GA 3MXUA 1W2BA 1HH2P 1UE1A 4FXKC 4QMGA 3BDLA 2R92H 1I4GA 4DAMA 1O7IA 4LUVA 3ICEA 4KD4A 1ET9A 1QOHA 1LM0A 4RFBA 2K1BA 4JPBW 2YTXA 2K5HA 2IW3A 1SR3A 1S3OA 1QB5D 2L1BA 3TBIB 3FPPA 1SLJA 4QCLA 2EXZA 1S5FD 3EN2A 3GTJB 3HOUH 2LKVA 2JK8A 1FYCA 2OTLA 4ZKBB 3OMCA 3RUZA 3AYHB 5IGEA 3IFTA 4JI2Q 4GN4B 4IFDI 3PGZA 2A6EC 4XQQA 4X62Q 2F0QA 3GTPH 3I4OA 2OEOA 4LK1C 4JI2L 3TQYA 4X62L 4DV6Q 2HQLA 4JI0Q 3HOUG 1KAWA 3HOXG 4V0BA 1LO5D 4X3TA 4A3KG 4DV6L 1CA5A 2JYOA 4JI0L 1HQRD 4M1UB 4O1NA 4UP7A 1CQVA 1VQIA 4B3RQ 4ZRZA 4IUPA 4NDXA 4JI3Q 1TY2A 2DJFC 3JC66 5C4HA 1J8IA 3GTKH 1SMYC 1SFOB 3DHQA 1HR0Q 4JI3L 3CQZH 1GUOA 5I2YA 5FO8B 1Q81C 1BDOA 2F52A 2G9DA 4OL7A 4DNTB 1XNRQ 5IY0A 1NJIC 1PFMA 4CKBA 3VA7A 1XNRL 3I72A 4LF8Q 3VR5A 3J81E 1GD7A 2K14A 3CC2A 1WTWA 2R7DA 4LF8L 2E2JB 2MUYA 5D3IB 2D9UA 2LY7A 4A3FH 4NKLA 3L0OA 1PTOB 5FK9C 4IOCA 1V8QA 1KIXA 1RL2A 4GKJQ 4A3FG 4HJ9A 3NEMA 4IOAA 1JT8A 4GKJL 1QCBD 1EUJA 3TRZA 4P2CB 4RGOS 2RQXA 2EPBA 3TZDA 1YI2A 1IXRA 4OIKA 4UPAA 2E74C 2MNAA 1ZYRD 3HS0C 3T56B 3PUWA 3A54A 4KTAA 4GN5A 4R9WA 4JI1Q 1GVPA 2WFWA 3MZ5A 4FDBA 2RDFA 4JI1L 1JWUD 1JQYD 1LYLA 4POFA 1YHBA 2K5VA 3NBHA 3GP7A 5C3EB 3C1EA 1A2TA 1Z9FA 3J81L 1TWFH 1SXTA 3UE0A 5IT9E 1HA6A 4DV1Q 3P75A 2RCNA 5IP9H 4F87A 4OWTB 4DV1L 1SN8A 1DJRD 1S40A 3PQIA 3R93A 1A3VA 2QCPX 1SNMA 4IJHA 3S2DB 1GHKA 5GAEC 1VQ5A 2QGQA 3J80i 5CBAE 2CQOA 4Y7NH 2QKIC 4LF4Q 4B08A 3K0XA 1Y8PB 2IJ0A 4LF4L 3VYUA 2VL6A 3BZCA 1D5XC 2NUCA 3I2ZA 5JPMC 5JEAG 5EPLA 2F3WA 1M8AA 5LL6S 1EWIA 1V1PB 1K3BC 1QUQB 1VMPA 1STYA 4BXXH 3LWUA 3VR6A 5LMUQ 4IALA 1KRTA 5EAYA 4R8IA 1K73C 2RHQB 2HUGA 5LMUL 4XXEA 5JPNC 3OW2A 5M3MH 3TS0A 3X3MA 1JCKB 2QEXA 1WTXA 2HQEA 3M7NA 1X55A 4HAEA 5IT9L 1QVGA 3CAMA 1AE3A 5ELNA 2LFNA 4R4OA 3OW7A 2F4IA 5M3MG 4RAUC 1SYCA 3NQTA 4KY5A 1R9TB 2Q2IA 5FO7B 3H0GG 1N34Q 2JA8H 2CH4A 3CC7A 1VQLA 2NVXB 2RBMA 4K8JA 5K5PA 1N34L 4X6AH 3QOLA 3S15H 1C48A 2P5ZX 5JVH3 1D1KA 3NBIA 4R4CA 4IUTA 1BR9A 2PI2E 4IN3A 4DAVA 1A2UA 1PDQA 4FYDA 4A3EG 1I50B 3DWPA 1IL2A 1I6VC 3I7FA 5EGTA 2ZTEA 2RSNA 3CRLC 5C44B 3I4MH 1SMXA 3SHLA 4ZLTF 1X6OA 2DNEA 2SNMA 5JEAJ 3EA6A 4RGMA 4A93H 2MP1A 4GOPB 2F0TA 1WTPA 5BR8Q 2QDLA 2MFIA 3EIVA 2ICIA 3Q8DA 5EPKA 1LUZA 1RODA 1NCVA 4O0AA 5C3XA 3I4MG 4GLXA 5CV4A 5M5XH 3MHBA 3K5LA 3VDYA 3NWTA 3BDOA 3OOCA 4DGZA 4LWCA 4TVAB 2UXBQ 2N8NA 1LT4D 4DV2Q 4YHHL 4LF6Q 2UXBL 1CKOA 4DV2L 4N8X1 1B1ZA 4LF6L 1B9MA 3S1QB 3I8ZA 3A7LA 1WOCA 4DU9A 2WKCA 3D6CA 3FHWA 4JOIA 3K5OA 4AYBG 4BY7G 1NTGA 1TWCH 2L4NA 4AYBE 3FMCA 3QB3A 4ZK9B 1MI2A 1H9KA 5ELBA 1KQSA 1S5BD 4BY1B 2KHJA 4OONA 5FLXc 1JWSD 5IYCG 3C1FA 5ISRA 3ER0A 4RGTA 4RHSA 1QILA 4LMQD 3ERQA 3KDFB 4KLKA 4K6DA 1U0LA 3G6JB 1RDPD 4ALPA 2PO4A 2WB1E 3Q6SA 5HY6A 3STBC 3VYRA 3CF5A 5HGTA 3NTHA 3K8AA 1JE4A 4EX5A 2JA5G 1VQHA 3R3OA 4ZKCB 3S24A 3OHXC 3TN2A 4BBRG 4BBSG 1TKWB 3TP5A 4MTNA 1DXMA 3P7JA 1X56A 3URYA 4PZ6A 3SR1A 1EYDA 1PH6A 3GV3A 1HPCA 4RG1A 4F8MA 1HNWQ 1WTRA 1S5CD 3E0JA 1YNND 2ZTCA 3AFQA 3HOWB 1HNWL 4TSSA 2FMCA 2WV6D 4KV6A 3MXPA 1K83H 1QE6A 5CV5A 4X64Q 3ITPA 3OPOA 4YWMA 1BCPC 5DEHA 1ZXTA 2ZJQA 1SE2A 4X64L 1H9JA 4OX9Q 1EYCA 4DF7A 4UAIA 5LHY1 3BVGA 2IX0A 3K7AH 2F0IA 4I7AA 4TQUS 1TWHH 2CWAA 3DM1A 1QNKA 4OX9L 3GQBA 3S1MB 2OCEA 1Y1WB 5M5YB 4C2MH 2BE5C 3FPUB 2R6GA 4TKOB 4XT3B 1IW7D 3JAMi 1HZCA 1WYDA 3E9IA 4B9WA 2ENBA 4JBJA 3I4NH 1O7YA 3W1BA 3S14B 4GZYC 3T51B 5KYLA 1BBWA 4QIWE 4Q5VA 3K80C 2A73B 3VA5A 2NZ1D 3ND9A 1L1OC 4DN4M 2LS01 2XTIA 4X66Q 3I4NG 4KHVA 2N49A 4OXPA 4UP9A 3V05A 3UDGA 4X66L 4PQXA 1SYBA 3GDEA 1O7LA 2Z0SA 1YJWA 4OHJA 1X32A 4OWXB 4ZAIA 5CV8A 1Q46A 1HFNA 1EIYB 4FVMA 1KDAA 2Z9HA 3PF4A 1OTCA 3L9AX 2MGSA 1F2MA 2E76C 1Q8IA 3OIQA 1NAPA 3Q0AA 4JBMA 5ELFA 3PMFA 3I73A 3M3YH 1FNVA 2IX3A 2R92B 4C1NK 4QUFA 4DV7L 3G6EA 4CJ1B 2F0DA 1CSQA 3GTQH 1A8VA 3TP8A 4KY7A 1D5MC 1X3FA 2K75A 2RDGA 1N36Q 1EIHA 1EZ8A 2V1CC 1XMQL 5J3BA 1IBKL 1N36L 1WTHA 1K8AC 3CD6A 3S1NH 4FF2A 3TP6A 3TSSA 2GN5A 2OT2A 4A4IA 1M90C 4A76A 3HOUB 1BNZA 3HOXB 4A3KB 2G9HD 2PMZE 3NELA 3FKIG 1PH9A 2X6LA 3GTPB 4XQJA 2EY2A 2NVQH 3CHBD 4A3GH 1OXVA 3QIAA 3L2PA 2YV5A 2K50A 2QA4A 2G5DA 5E7NA 1E1TA 4HR7B 2EJMA 5EQ0A 4OELB 1WD1A 3DWQA 3KYHC 2B63H 3PIPA 4L63B 2KQ3A 1VS0A 3CW2C 5ELDA 2ALYB 2ES2A 4A3GG 4GKKQ 5J22A 2A74C 2K32A 3CCVA 2CKZB 1PH7A 3K5MA 4GKKL 3CQZB 4B3TQ 3KF8A 4RH6A 3A55A 2K5WA 3PO2G 2UU9Q 5C0XH 3W3AA 2B63G 3IRBA 2R7ZG 4B3TL 1LABA 4EGVA 1Y14B 2UU9L 5J1ZA 2CFMA 1LT6D 1PTOD 1TWAB 4Q0FA 5LMNW 4G4KA 1DCZA 1MSGA 5IODA 1TS5A 4U68A 1ILPA 4NMZA 2K05A 2KECA 2SOBA 2WAQE 3I90A 1CQFA 1A62A 1IKLA 1X65A 4EVOA 1NNXA 4FNFA 4DNIA 1V43A 2KA7A 4A3FB 3W5OA 1GUNA 2BDOA 4LF9Q 1PA6A 2J4XA 1YVCA 5EJWA 1A63A 1XMOL 2MJ8A 4LF9L 5M3FH 2DGYA 1VDZA 3BYTB 4DK1A 1I94Q 2MO0A 1CFMA 1Q90A 4C3HH 2KCNA 3CRKC 2F0OA 1QG7A 1I94L 5I9PA 3GTOH 5M5WH 2OWOA 1JOKA 3CP0A 4MNOA 2UUBQ 5CV7A 4P75A 2XN9C 2B2WC 2UUBL 5M3FG 1YJ9A 1I4RA 4LFCQ 3PUZA 1JE5A 4EQ5A 3BYYB 4C3HG 1PTOF 3ERSX 3RZDB 4LFCL 2Z8LA 3M4OH 5KIXA 3SDZA 1EY5A 1CI3M 1XJVA 4G7HC 1PH4A 3F2UA 4FXDA 2F0JA 4CGYB 4L5QA 4BA1I 3UE1A 3PCOB 1ZYRC 4XTCS 2ZTDA 1CM9A 3J7AV 1FVIA 4HN7A 4E6IA 3K6OA 4DR2Q 1LTAD 3Q23A 3RN5A 4DR2L 1IYUA 1TWFB 4IPCA 1STEA 4ZUJA 1JB7A 2YU9B 2L55A 5I6YA 1E2ZA 4YY3Q 3C3LA 3CMAA 3PIP3 1YBYA 2AQ2B 1BOSA 1VF5C 5EBCA 4C3IG 4YY3L 1VQPA 1AZQA 1O78A 1HQMC 3MVVA 3CCMA 1SSOA 2L5TA 2R92G 4R4QA 4DKAC 1IHZA 1D2BA 2F0SA 4K0KQ 4OEMB 4Y7NB 4K0KL 1X9NA 3T53B 4G7ZC 3C2PA 1CSPA 1PRTB 1EWHA 4HJ5A 2PQAB 4G57A 1ZKOA 1HR0W 1WCMH 3NE5B 2F4VQ 1SJED 1ASZA 1LT3D 1C9OA 2E5LQ 1R4PB 1IZ6A 3VR2A 1LT5D 3Q24A 4P72A 2F4VL 2E5LL 1I6HB 3KOJA 1EQVA 2NVTB 2R93H 1I4HA 4DFAA 4DR1Q 1K28A 1JICA 3I70A 4DR1L 1F77A 1WCMG 2KVMA 1Y1VH 3BJUA 5M3MB 4C3JH 3H0GB 3FDTA 1SJHD 2AHOB 3GD7A 3H94A 3RNUA 3K7UC 2R93G 5EKLA 4ULLA 3K58A 1SE8A 4J8QA 3PUVA 2TSSA 3FRPB 3DEOA 1Y1VG 4I65A 5IE8A 4DV0Q 4JI6Q 2K6AA 1B50A 2MHVA 2ZJPA 3H09A 4DV0L 4A3EB 4JI6L 3OWFA 2VUMH 3S15B 4JC0A 4HCEA 3C46A 1VQAA 4K2KA 1JMCA 4RCNA 3SK8A 3HP3A 1HRJA 5I6WA 1E24A 2EE1A 3HOVH 2KCTA 2NYZD 5JJKA 3DWAA 1BCPB 3GTGB 1NR2A 1IKMA 2A5HA 2AMCB 2VUMG 4QL5A 2F0UA 2RCFA 2RSOA 1VQKA 4PMCA 2BOSA 1TS2A 4F7XA 5L37A 3A0JA 3G4SA 3I4MB 1A0IA 2HT1A 1TR5A 2LSSA 1J5EQ 1WTVA 3HOVG 5ELOA 1KLUD 2MQHA 1HNZQ 1CHPD 2IHEA 1LTRD 2K4KA 2C35B 1J5EL 2EYFA 2XIWA 1SDFA 3QWNA 1HNZL 2DNCA 4EQNA 1LTTD 2PPBC 2F0MA 1PZJD 3EVQA 1VQ7A 1I4PA 5M5XB 5A35A 3BVMA 3B6YA 1DYQA 1SEBD 4LW1A 5M9OA 2K28A 1U9RA 1ASYA 4BY7B 4AYBB 3LX0A 1Z47A 4RCOA 1C0AA 3GTLB 1AZPA 3HKZG 1GOZA 3HKZE 4DXFA 2F0HA 4I7ZC 4QQBX 4YWKA 1RIPA 1DOKA 1Y69U 2VQEL 5BN3A 5FLXE 3J81j 2B2YA 4AIMA 3M7GA 1JOOA 2VW9A 1E3PA 2DJGC 3KLRA 1PH3A 4L5SA 3NENA 3IAYA 2KOLA 2L12A 4YCVA 3DMUA 2B2VA 3KBXA 2RDHA 3T16A 1FD7D 1QNUA 1EIGA 1YNJC 2O5IC 2XGTA 1V1OA 2L15A 1FNWA 2JA5B 4ILWA 2FFKB 3AFPA 2B2TA 5IP9G 1B44D 4CKEA 3S9WA 2EZVA 4NW2A 1N33Q 4BBRB 4BBSB 2A69D 3SK5A 3EQLC 1N33L 3J81i 1TY0A 3U50C 1X3EA 3BG3A 1G6PA 3MC0B 1RTNA 1VMCA 3GTMH 1CKNB 2F0PA 1FR3A 2PZUA 5DM73 3PO3H 1AP0A 1VQEA 3MXNB 4O2DA 1YNXA 1LLRD 5E3FA 3HZXA 1MIUA 1VQ8A 2Y0SG 2Y0SE 4FXGC 5I9OA 2F0EA 3ULJA 1HNXQ 1VF7A 1SE3A 2Z6KA 4JK1C 3PO3G 2GVAA 3S2HH 1HNXL 4BXXG 2XWBB 1KLGD 3U58A 1F2YA 3PSIA 5T1GA 2D2CC 4WRDA 4GNXC 2XRQD 5FLXL 4TRDA 3VYSA 3TP7A 4X3SA 4WJ3M 5C5LA 3U4VA 5I4DA 1EFID 1U4MA 2BA1A 3K7AB 1KDCA 5GAHC 1XPOA 3S17H 3BZKA 2CW0D 4YIJA 1SFOH 1S5ED 4K5WA 4C2MB 3F8TA 1VQ4A 5AJ3L 1RKNA 1VQJA 4FF3A 2XWJB 1WVLA 2JA8G 1AH9A 3D4RA 3VR3A 1GJXA 2JEAI 2JA6H 2AKWB 3J80c 3I4NB 1W6JA 3DXJC 4L6TB 4XDXA 2ZXOA 4KJNA 4DK3C 1EY6A 3K5NA 2KHIA 2BH2A 3SE0A 4KKSA 5E4WC 2JE6I 4ODGA 4ID6A 1L2FA 3S16B 1SNDA 3QO2A 4RKLA 4A3DH 2UUCQ 1WFQA 4DR7Q 1V1PA 2JA6G 1QUQA 1PYSB 4IPHA 5JAVA 2A6HD 4ZYSA 5FLMH 2UUCL 2OQ0A 3U4ZA 4DR7L 1O80A 1C7YA 3MXNA 3HRZC 4DUZQ 1ILQA 2GVBA 4DK6C 1MJCA 3D31A 3KLSX 2F0FA 2F0VA 1AE2A 4DUZL 3E0EA 4A93G 1CUKA 2EVBA 2ZT9C 4YHHQ 1JB3A 5EPJA 4A3DG 1ICFB 1JC7A 2QILA 5CR3A 1HTLD 4PMWA 2EY1A 1PZID 5FLMG 3CPFA 1VQGA 3CCLA 3HOZH 1X3GA 3F2BA 1GKHA 5KEEA 4P73A 3IFDA 2L0CA 3WOEA 3A56A 3D6WA 3M3YB 1BVSA 2B39A 3KUPA 2E2IH 3UDIA 4NB3A 1PH8A 1VCIA 1KNEA 3HOZG 3K81C 1I3QH 5DM63 2JA7H 4NXNQ 1YEZA 1BF4A 1JJGA 1ESFA 1G291 1HJPA 4P74A 2ID0A 1PMRA 3NHHA 4NXNL 3TREA 4A3JH 4DV5Q 1K3RA 3ONAB 3FKIB 3D4DA 3K0YA 4HIOA 1U5KA 2WB1G 3S1NB 1MGSA 4DV5L 4IFDH 4KI0A 2DY7A 1I4QA 2H5XA 2JA7G 1C4QA 2B29A 3KJPA 1VQDA 5CC4A 3HFZB 1XNQL 3J7YW 4QY7A 4GOPA 4MIUA 1PYWD 5FOBB 2NVQB 2R3ZA 1IYJB 4A3GB 3TZUA 1MSHA 2CHBD 1Q12A 2FINB 3PO2B 1P8LA 3H3VH 2B63B 2Z1CA 2R7ZB 2KCCA 3ZJYC 4OIJA 3J7AF 3MWYW 3R2TA 4A3MH 1VQNA 4IZ8A 1BQQT 2NN6H 2IT1A 1U4LA 1HTPA 2B2UA 4OWWB 1PYBA 2F03A 4HSVA 5FKAC 4A3IH 1XPRA 2Q2UA 5HGQA 5ELEA 5FJ8H 1B3QA 1P16A 3HKSA 4QUCA 4B3SQ 4A3MG 1FGBD 1G91A 5KGUA 4DR6L 1NR4A 4B3SL 1CK1A 2QDBA 2NN6G 3ULLA 2EY6A 1GM5A 1STAA 4ZUIA 2CQAA 3NQIA 2QW7A 3OYYA 2PZTA 4QGUA 5D3DA 1R9TH 3KDFA 1CA6A 1TU2B 4A3IG 2NVXH 5FJ8G 5TSSA 2R7FA 3R8BA 2I46A 5BN5A 5IYBH 1VQ6A 3H15A 1SROA 5M3FB 1BXTA 4C3HB 5A2QL 3CCUA 2F0GA 4BS9A 5M5WB 1F9QA 1EU4A 1IBLQ 3RLNA 3WDNA 1Q86C 3AQQA 2WINB 2B8GA 1GUWA 1IBLL 1D7QA 4H0LC 4KKTA 5J39A 5IYBG 2PZWA 1GUSA 1UAPA 1KL9A 3RZOB 4K2LA 4O42A 1G2TA 4KHZA 3CU7A 4CDEC 3EROA 1ONLA 2CCZA 1NY4A 2NB0A 3NK9A 1ENCA 1XPUA 3AU7A 2RA4A 4DUYQ 1H9SB 3QJYA 3DUZA 1U4PA 2GA4B 2LXJA 1JJCB 1SRUA 4HIDA 5I2XA 1I4XA 4DUYL 2K5QA 4DXGA 4C3IB 4H7BA 3VYTA 2F0WA 2VY3A 3OTOQ 1Q8KA 3LGJA 4DV7Q 2HHHQ 3CC4A 2PNHA 1G6ZA 2M2LA 5COYA 2VXWA 1UNSA 3OTOL 3HGBA 3HOYH 2HHHL 1TQOA 1XYIA 2PQEA 4JI5Q 2JJQA 1B7YB 4J1MA 1STBA 1BUVT 2KUMA 1YHAA 5IGCA 5IGFA 4HSPA 1XMQQ 4JI5L 5JJIA 4RMFA 1HZAA 3E9HA 3EJIA 1IBKQ 1PRTD 5GAGC 2VNUD 5IGBA 5GROA 4MN3A 4PZ7A 3JAMc 1CTMA 3I4LA 3MAQA 3HOYG 3AMUA 4QF4A 1PH5A 2HDLA 1XXGA 2F3IA 3IKJA 2A8VA 2AUKA 1S72A 2N3SA 3SXHA 3H3VC 3DM3A 3OWEB 4OO1H 2PCFB 3STBD 1WCMB 4CJ2C 2D62A 4KD3A 1VQBA 5C4JH 4BA2I 2K04A 1T9HA 2KJXA 2ICEC 2R93B 1GUTA 4GN3B 5IOCA 4MZ9A 4OO1G 2HCCA 2WKDA 4EQOA 1EZ6A 1PRTF 4PMBA 2Z6BA 1Y1VB 3U9OA 2EXDA 1W6KA 4JI4Q 3A5UA 1G51A 5DLQE 3GTKB 1SNPA 4ZQ3A 4JI4L 4NXMQ 3K57A 2JXMB 3BU2A 2E8GA 2C5CA 4JOIC 3ZYYX 1N8RC 4NXML 4A3BH 1E7ZA 5KNDA 1MJEA 5IYDH 4JCVE 5LL6X 2K5DA 3A8KE 3CCJA 1RD9D 2F0NA 2A68D 1UUPA 2VUMB 1OO9B 3J7ZC 2OF1A 1FNUA 2I07B 2WAQG 1RCVD 4A3BG 5C0XG 3F1ZA 3F2DA 1QWYA 3OIPA 1XMOQ 4B9XA 1D5ZC 1IBMQ 1X3PA 1NE3A 3HOVB 2BE5D 2ZXPA 2BDNA 1IBML 3CXCA 3A74A 4CBVA 4KN7C 3S1MH 1B8AA 1Y1WH 5C4ZA 4H44C 2SEBD 4K8IA 4JVZA 3CCSA 1CHQD 3KF6B 5DAUA 2Z4IA 4B3MQ 2D5DA 1IL8A 1ICWA 4B3ML 2NWGA 3PV0A 4IQZA 3L7ZC 1RF2D 3HKZB 1CKMA 3P20A 4ME3A 1XTCD 1L0XB 1RTOA 3I3CA 3BDCA 5C4XH 1KXLA 4V190 4S3SA 5AFWA 1JORA 2KCMA 4IURA 5CV6A 3DEPA 1E1OA 4PZ8A 3K59A 1RHPA 3AEVA 1G2SA 5CORA 4YCUA 5EKIA 3ULPA 1II3A 1FJGQ 5C4XG 4KKUA 4PV1C 1HA5A 1H95A 3P1HA 1FJGL 1NUCA 1PH1A 2V4DA 1UWVA 2XVSA 4KJOA 1PV4A 4K14A 1QVFA 4RHRA 3S1RH 1KTKA 2D0OA 2AWOA 5C0XJ 1J9OA 4DAPA 3G7LA 3M4QA 1Z6HA 2VS1A 1H9MA 2FJ2A 5GADC 4LFAQ 4FO2A 1E2WA 5IP7H 3EFXD 2KEEA 1RJTA 1AFPA 1E2VA 2H4OA 3OSOA 4LFAL 2AUJD 4JBWA 2SDFA 4N9PA 1YITA 2Y0SB 2NVYH 3GV6A 2A69C 1Z7TA 3RLOA 3KF6A 3GTMB 3M4YA 4KMUC 5NUCA 2I5MX 2UUAQ 3CPWA 3PO3B 5IP7G 4K6LA 1EYAA 1R4QB 2UUAL 2E75C 2HCIA 4PNYA 1HXYD 3HOXH 1K8MA 4A3KH 2WACA 4NPSA 3FP9A 3A7AB 1SYGA 1F2ZA 2NZHA 1N32Q 2HD3A 4N9TA 3S2HB 3KK7A 3WOFA 4XQNA 1TVXA 1XTDA 1N32L 2EJFC 4AH6A 4ABNA 1M1KC 1TWGH 2K52A 2YYZA 3T13A 2L9HA 2F0KA 1YZ6A 4C3JG 1ENFA 2JA8B 1SYEA 1GHJA 5E1FA 1Q3LA 3FVQA 4DNRB 4A3LH 2OXPA 5ELCA 4B3RL 2IHFA 3NBHB 3S17B 1PLFA 2EYPA 3VR4A 2XRSD 3H3VI 2E2DC 1HR0L 4UY8C 3U9SA 3J80E 2RVLA 2E2HH 4C1NI 2CW0C 2JQOA 1EY0A 3QR8A 4IPDA 4A3LG 2JA6B 4KN4C 1A15A 3PIOA 4JBKA 1PHJA 2Q2TA 1TWAH 1OXUA 2NN6I 1VQMA 4DV4Q 1LTSD 1QZGA 2PQAA 3MTSA 4CDDC 2EOTA 3LNNA 4H02A 4C56C 4DV4L 2ZM6Q 4A93B 2J7ZA 4A3DB 2ZM6L 1YIJA 2TMPA 2OTJA 1AW7A 1NBWA 2KENA 5CBEE 3NTKA 2FXQA 1EY4A 2B8FA 1U4RA 1KABA 2PW7A 1MHWC 1DONA 4KK7A 2N88A 1CZGA 2A6HC 5EBDA 4RGNA 3J7A5 1L1OB 1UE7A 2RKSA 1UEAB 4CKCA 2BH8A 1TIID 1M4VA 3N6RA 3W2DA 3HOZB 3RZDH 2VQEQ 1V9PA 2IL8A 2PI2A 2NBFA 2R61A 1KC8C 2KEDA 1HUNA 1A3UA 1TWCB 1N9WA 2WB1B 3R2IA 1X3QA 4XYQA 1K8GA 2E2IB 3J80L 1HFGA 1I3QB 2JA7B 4BWGB 2EJGC 3WWVA 3AB9A 5FO9B 1I5FA 4LUZA 2UXDQ 2O5JC 2RHSB 3HEJA 2BA0A 4DR5Q 3MA2B 3W1GA 4GLVB 4A3JB 2UXDL 2YU9H 4DR5L 4RWSC 4HJ8A 4R4IA 1PFNA 2EDGA 3NUCA 3E3XA 1EY9A 3TEHB 2JP1A 5JEAH 1JWMD 4LFBQ 2X6GA 2MO1A 4DK0A 2X69A 4ZCKA 2A6ED 3GTJH 4LNQA 2JSOA 4LFBL 1CT1D 3SK6A 3G48A 3RD4A 3TMEA 3E5SA 1A6XA 3A8IE 3PIO3 2DN8A 5GQOA 1OXTA 4FF1A 4ME5A 2XNAC 1DOMA 4UHVA 4DV3Q 1EWCA 2K01A 3T1HQ 1MBYA 1VQCA 2O2LD 1LTGD 4IUUA 3CMEA 4DV3L 1VQ9A 1L1OA 2Q8RE 3H91A 1ESRA 1I6HH 5KRUA 4A3MB 3T1HL 1A3TA 3NPPA 2VQFQ 2NVTH 4OO1I 1K83B 1LTBD 2CVRA 1YNNC 1K0RA 2YTYA 1NMFA 2VQFL 1SMYD 1BBXC 2NTSA 3CCRA 3UDFA 1F9SA 3MEFA 4WJ4A 3H0GH 4A3IB 4M8AA 2K7VA 1TWHB 1C8CA 4DR3Q 5AJ3Q 5KYIA 4QB4A 4QIWB 4DR3L 4IO9A 2F1MA 1STHA 1B3AA 4UDUC 4PG3A 4RKBA 4A3EH 1IW7C 4JW0A 4K5XA 1TS3A 2M00A 5C0XI 2E2JH 3CKIB 4JV5Q 3J81c 2NTTA 4IJLA 2FHTA 4GLAC 2IWHA 2NZOA 2EYMA 1H9RA 4HIMA 4JV5L 3BS1A 1PTOH 3QG1A 1CKNA 4QJFA 3GTGH 2F3VA 4X3UA 2SNSA 1O7ZA 3EBEA 3I55A 5IGDA 4WFN3 2JEBI 2DY8A 1EIFA 5D14A 1UEBA 2N78A 4U673 1JR0D 1UE5A 1ML0D 4NP5A 4OGQC 1HHVA 2VZAA 3O13A 5BR8L 1Q1BA 3D4WA 2LMCB 3TDQA 5HURA 1OXXK 3Q22A 1QZHA 2LXKA 5IWAQ 2EIFA 4CHTB 4L5TA 4BY7H 5IWAL 5D65A 1TT2A 3HOYB 3N52A 1EOVA 4EQPA 5JJZA 3GTQB 5CMDA 3G71A 3GTLH 1MD2D 3JAME 5C3EH 2PMZB 1V1QA 5IYCH 1JOQA 2JA9A 2K5NA 1JJ2A 2HIXA 1AN8A 1HCZA 2EYOA 1PVOA 1EU3A 5IGGA 2PYKA 1Y8NB 3PF5A 1SAPA 1YNJD 1PRTC 1WTQA 5IT9c 4IUVA 2Q8TA 3RLFA 1XNQQ 5C3EG 1DOLA 3MFYA 3PUYA 5CGKA 3KJOA 5JVG3 3S2DH 3NXWA 4MHEA 4JI7Q 4A3JG 1YHQA 2IY5B 4LAAA 5A2QE 1E22A 2JA5H 4JI7L 5BN4A 4IFDG 1EQTA 1FGUA 5C4JB 1SNCA 2FMMA 4BBRH 3RR5A 4BBSH 3KFUA 2PW5A 1YJNA 2A19A 3D0FA 1BO0A 2ATWA 4POGA 4DR4Q 2L11A 1K0SA 4JI8Q 3I91A 2A1AA 1W3SA 1F2LA 3KBGA 4DR4L 1HUMA 1F9PA 4JI8L 2AWNA 2AQ1B 1EY8A 1Q7YC 1WD0A 2IPKD 1AEXA 1FL0A
chains in the Genus database with same CATH topology
2B2WA 4K5VA 2EYLA 2C9OA 2WAQB 2QF7A 2B2YC 4A3BB 3JAML 3PUXA 2B2VC 2K03A 1QJOA 3E6ZX 1KNAA 4XIGS 4RA8A 2B2TC 1PTOC 1KDBA 2MPMA 3MXGA 3FEWX 2A68C 3SK4A 1CZWA 2KHSA 5JOBA 1WTOA 4J6HA 2IX1A 1LV9A 1SE4A 3GTOB 1F9RA 4R8NA 3QOJA 2QEJC 4IFDJ 1DD2A 3NTIA 1D1IA 1EEFD 3M4OB 1GUGA 4X3KA 3M85A 5C4XB 5C3WA 4XT1B 1IYVA 2ZXRA 1STGA 4HMJA 3V96A 3SVMA 4HCSA 3NP8A 3T4AC 2PNRC 2F0LA 2J0TD 5T1IA 1ET6A 5C5MA 3S1RB 3H6MA 1B9NA 1OXSC 1KAAA 4IUNA 4L8JA 5C6AA 3MFGA 1L0YB 3D3RA 4WJWA 1LTID 5G3LD 3ND8A 5E4XA 1PZKD 1T5XD 1XWEA 2N55A 5CYUA 2NVYB 3HG9A 1K8OA 1GXDC 1SNOA 1SYFA 4DA2A 3GO5A 2VB3X 4LJZC 1G8ZD 4KY6A 1EY7A 1PFBA 4DAYA 2XSCA 3IL8A 3NSWA 4C3JB 2O4XA 4HEDA 5CV9A 1B2TA 1H9SA 5G3LF 1EL0A 2AQ3B 3MEHA 2VB2X 4XYOA 4HMIA 1TWGB 5IIFA 1D6EC 1ZEQX 2H1EA 1SYDA 1BCPD 2WP8J 4CJ0B 3LWEA 3OMGA 1Q1EA 1B53A 2HDMA 4FP5D 1SBBB 2K33A 2E2HB 1NSNS 3D8GA 4Z9CB 5K36H 3KLSA 1LACA 3V2TA 4HTHA 5EKKA 2EYHA 1SNQA 1DM0B 1TS4A 2M9VA 1EOTA 3NWSA 3BVZA 5K36G 3X3NA 4FF4A 2BCOA 1BCPF 1ENAA 1STNA 3SEBA 1E0BA 3A8JE 1S4ZA 1PXUA 1EEID 2EY5A 1S5DD 1T5EA 5DNFA 4IUQA 5KNCA 2B2UC 5KNBA 3UI2A 4F88A 2Z4HA 2EYJA 3RMHA 5F2DA 1B4OA 1XX8A 1DZ1A 3L3OC 2Q8IB 1Y8OB 4G7OC 2WIIB 3BZDB 4H13C 4WORA 3MXUA 4FXKC 4QMGA 3BDLA 1I4GA 4KD4A 1ET9A 1QOHA 4RFBA 2K1BA 2IW3A 4QCLA 2L1BA 1QB5D 3TBIB 3FPPA 2EXZA 1S5FD 3GTJB 2LKVA 1FYCA 4ZKBB 3OMCA 3RUZA 5IGEA 3IFTA 4IFDI 2A6EC 4XQQA 2F0QA 2OEOA 4LK1C 4V0BA 1LO5D 4X3TA 1CA5A 2JYOA 1HQRD 4M1UB 4O1NA 1CQVA 4ZRZA 4IUPA 4NDXA 1TY2A 5C4HA 1J8IA 1SMYC 1SFOB 3DHQA 1GUOA 5I2YA 5FO8B 1BDOA 2G9DA 4OL7A 4DNTB 1PFMA 4CKBA 3VA7A 3I72A 3VR5A 3J81E 1WTWA 2E2JB 2MUYA 5D3IB 2D9UA 2LY7A 4NKLA 1PTOB 5FK9C 1V8QA 1QCBD 4P2CB 4RGOS 2RQXA 2EPBA 3TZDA 4OIKA 2E74C 1ZYRD 3HS0C 3T56B 3PUWA 3A54A 4KTAA 4R9WA 3MZ5A 2RDFA 1JWUD 1JQYD 3NBHA 3GP7A 5C3EB 3C1EA 1A2TA 3J81L 1SXTA 5IT9E 1HA6A 3P75A 4F87A 1DJRD 3R93A 1A3VA 2QCPX 1SNMA 3S2DB 1GHKA 5CBAE 2QKIC 4B08A 1Y8PB 2IJ0A 3VYUA 1D5XC 2NUCA 5JPMC 5JEAG 5EPLA 2F3WA 1M8AA 5LL6S 1V1PB 1VMPA 1STYA 3LWUA 3VR6A 4IALA 4R8IA 2HUGA 4XXEA 5JPNC 3X3MA 1JCKB 1WTXA 2HQEA 3M7NA 4HAEA 5IT9L 2LFNA 3OW7A 2F4IA 4RAUC 1SYCA 3NQTA 4KY5A 1R9TB 5FO7B 2NVXB 2RBMA 4K8JA 5K5PA 3QOLA 1C48A 5JVH3 1D1KA 3NBIA 4IUTA 1BR9A 4IN3A 4DAVA 1A2UA 1PDQA 4FYDA 1I50B 3DWPA 1I6VC 5EGTA 2RSNA 3CRLC 5C44B 3SHLA 4ZLTF 2DNEA 2SNMA 5JEAJ 3EA6A 4RGMA 2MP1A 2F0TA 1WTPA 2ICIA 5EPKA 1RODA 1NCVA 5C3XA 5CV4A 3MHBA 3K5LA 3NWTA 3BDOA 3OOCA 4DGZA 1LT4D 1B1ZA 1B9MA 3S1QB 3I8ZA 3A7LA 4DU9A 2WKCA 3D6CA 3K5OA 2L4NA 3FMCA 3QB3A 4ZK9B 1MI2A 1H9KA 5ELBA 1S5BD 4BY1B 1JWSD 3C1FA 5ISRA 4RGTA 4RHSA 1QILA 4LMQD 3ERQA 4K6DA 3G6JB 1RDPD 2PO4A 3Q6SA 3VYRA 5HGTA 3NTHA 1JE4A 3R3OA 4ZKCB 3OHXC 3TN2A 1TKWB 3TP5A 1DXMA 3P7JA 3URYA 3SR1A 1EYDA 3GV3A 1HPCA 4F8MA 1WTRA 1S5CD 3E0JA 1YNND 3HOWB 4TSSA 2FMCA 2WV6D 4KV6A 3MXPA 1QE6A 5CV5A 3ITPA 3OPOA 1BCPC 5DEHA 1ZXTA 1SE2A 1H9JA 1EYCA 4DF7A 4UAIA 5LHY1 3BVGA 2IX0A 2F0IA 4TQUS 3S1MB 3DM1A 1QNKA 3GQBA 1Y1WB 5M5YB 2BE5C 3FPUB 2R6GA 4TKOB 4XT3B 1IW7D 4B9WA 2ENBA 1O7YA 3S14B 4GZYC 3T51B 5KYLA 4Q5VA 2A73B 3VA5A 2NZ1D 3ND9A 4DN4M 2LS01 4KHVA 3V05A 4PQXA 1SYBA 1O7LA 4OHJA 1X32A 4ZAIA 5CV8A 1HFNA 4FVMA 1KDAA 3L9AX 2MGSA 1F2MA 2E76C 1Q8IA 3OIQA 1NAPA 3Q0AA 5ELFA 3PMFA 3I73A 1FNVA 2IX3A 2R92B 4C1NK 4QUFA 4CJ1B 2F0DA 3TP8A 4KY7A 1D5MC 2RDGA 1EIHA 1EZ8A 4FF2A 3TP6A 3TSSA 2OT2A 3HOUB 1BNZA 3HOXB 4A3KB 2G9HD 2X6LA 3GTPB 4XQJA 2EY2A 3CHBD 1OXVA 3QIAA 4HR7B 2EJMA 5EQ0A 1WD1A 3DWQA 4L63B 2KQ3A 5ELDA 5J22A 2A74C 2K32A 3K5MA 3CQZB 3KF8A 4RH6A 3A55A 2K5WA 5C0XH 3W3AA 1LABA 4EGVA 5J1ZA 1LT6D 1PTOD 1TWAB 4Q0FA 5IODA 4G4KA 1DCZA 1MSGA 1TS5A 4U68A 1ILPA 4NMZA 2K05A 2KECA 2SOBA 3I90A 1CQFA 4EVOA 1IKLA 4FNFA 4A3FB 1V43A 2KA7A 1GUNA 2BDOA 2J4XA 5EJWA 2MJ8A 1VDZA 3BYTB 4DK1A 1CFMA 1Q90A 2KCNA 3CRKC 2F0OA 1QG7A 5I9PA 1JOKA 5CV7A 2XN9C 2B2WC 1I4RA 3PUZA 3BYYB 4C3HG 1PTOF 3RZDB 2Z8LA 5KIXA 3SDZA 1EY5A 1CI3M 4G7HC 3F2UA 4FXDA 2F0JA 4CGYB 4BA1I 1ZYRC 4XTCS 1CM9A 3J7AV 4HN7A 4E6IA 3K6OA 1LTAD 3Q23A 1IYUA 1TWFB 2YU9B 1STEA 4ZUJA 2L55A 5I6YA 1E2ZA 3C3LA 3PIP3 2AQ2B 1BOSA 1VF5C 5EBCA 4C3IG 1AZQA 1O78A 1HQMC 3MVVA 1SSOA 2L5TA 1IHZA 1D2BA 2F0SA 4Y7NB 3T53B 4G7ZC 3C2PA 1PRTB 1EWHA 4G57A 1ZKOA 3NE5B 1SJED 1LT3D 1R4PB 3VR2A 1LT5D 3Q24A 1I6HB 1EQVA 2NVTB 1I4HA 4DFAA 1JICA 3I70A 1F77A 2KVMA 5M3MB 3H0GB 3FDTA 1SJHD 3GD7A 3H94A 5EKLA 4ULLA 3K58A 4J8QA 3PUVA 2TSSA 3FRPB 3DEOA 4I65A 2K6AA 1B50A 2MHVA 3H09A 4A3EB 3OWFA 3S15B 4HCEA 3C46A 4K2KA 4RCNA 3SK8A 3HP3A 1HRJA 5I6WA 2EE1A 2NYZD 1IKMA 3DWAA 1BCPB 3GTGB 1NR2A 2A5HA 2F0UA 2RSOA 4PMCA 2BOSA 1TS2A 4F7XA 3I4MB 1TR5A 1WTVA 1KLUD 1CHPD 1LTRD 2EYFA 2XIWA 1SDFA 3QWNA 2DNCA 4EQNA 1LTTD 2PPBC 2F0MA 1PZJD 3EVQA 1I4PA 5M5XB 5A35A 3BVMA 1DYQA 1SEBD 5M9OA 2K28A 1U9RA 4BY7B 4AYBB 3LX0A 1Z47A 4RCOA 3GTLB 1AZPA 1GOZA 4DXFA 2F0HA 4I7ZC 1DOKA 1Y69U 5BN3A 5FLXE 2B2YA 3M7GA 1JOOA 3KLRA 3IAYA 2KOLA 2L12A 3DMUA 2B2VA 3KBXA 2RDHA 3T16A 1FD7D 1QNUA 1EIGA 1YNJC 2O5IC 1V1OA 1FNWA 2JA5B 4ILWA 2FFKB 2B2TA 3S9WA 1B44D 4CKEA 2EZVA 4NW2A 4BBRB 4BBSB 2A69D 3SK5A 3EQLC 1TY0A 3BG3A 3MC0B 1RTNA 1VMCA 2F0PA 1FR3A 2PZUA 5DM73 1AP0A 1LLRD 5E3FA 3HZXA 4FXGC 5I9OA 2F0EA 1VF7A 1SE3A 4JK1C 2XWBB 1KLGD 1F2YA 5T1GA 2D2CC 4WRDA 2XRQD 5FLXL 4TRDA 3VYSA 3TP7A 4X3SA 5C5LA 5I4DA 1EFID 1U4MA 2BA1A 3K7AB 1KDCA 2CW0D 4YIJA 1S5ED 4K5WA 4C2MB 1RKNA 4FF3A 2XWJB 1WVLA 3D4RA 3VR3A 1GJXA 2JEAI 3I4NB 1W6JA 3DXJC 4L6TB 4XDXA 2ZXOA 4KJNA 1EY6A 3K5NA 3SE0A 4KKSA 5E4WC 2JE6I 4ODGA 4ID6A 3S16B 1SNDA 3QO2A 4RKLA 1V1PA 5JAVA 2A6HD 4ZYSA 1O80A 3MXNA 3HRZC 1ILQA 3D31A 3KLSX 2F0FA 2F0VA 2EVBA 2ZT9C 1JB3A 5EPJA 1JC7A 2QILA 5CR3A 1HTLD 4PMWA 2EY1A 1PZID 5KEEA 3IFDA 2L0CA 3WOEA 3A56A 3D6WA 3M3YB 2B39A 3KUPA 1VCIA 1KNEA 5DM63 1BF4A 1ESFA 1G291 2ID0A 1PMRA 3NHHA 3ONAB 3FKIB 3D4DA 3K0YA 3S1NB 1MGSA 4IFDH 4KI0A 2DY7A 1I4QA 1C4QA 5CC4A 3J7YW 4MIUA 1PYWD 5FOBB 2NVQB 2R3ZA 4A3GB 3TZUA 1MSHA 2CHBD 1Q12A 2FINB 3PO2B 2B63B 2Z1CA 2R7ZB 2KCCA 4OIJA 3J7AF 3MWYW 3R2TA 4IZ8A 1BQQT 2NN6H 2IT1A 1U4LA 1HTPA 2B2UA 2F03A 4HSVA 5FKAC 5ELEA 4QUCA 1FGBD 1G91A 5KGUA 1NR4A 1CK1A 2QDBA 2NN6G 2EY6A 1STAA 4ZUIA 2CQAA 3NQIA 2PZTA 5D3DA 1CA6A 1TU2B 5TSSA 3R8BA 2I46A 5BN5A 5M3FB 1BXTA 4C3HB 5A2QL 2F0GA 4BS9A 5M5WB 1F9QA 1EU4A 3WDNA 2WINB 2B8GA 1GUWA 4H0LC 4KKTA 5J39A 2PZWA 1GUSA 1UAPA 3RZOB 4K2LA 4O42A 1G2TA 4KHZA 3CU7A 3EROA 1ONLA 2NB0A 3NK9A 1ENCA 3AU7A 2RA4A 1H9SB 3QJYA 3DUZA 1U4PA 2GA4B 5I2XA 1I4XA 2K5QA 4DXGA 4C3IB 4H7BA 3VYTA 2F0WA 1G6ZA 2M2LA 5COYA 2VXWA 1UNSA 3HGBA 1TQOA 1XYIA 2PQEA 4J1MA 1STBA 1BUVT 2KUMA 5IGCA 5IGFA 4HSPA 3EJIA 1PRTD 2VNUD 5IGBA 4MN3A 1CTMA 3I4LA 3MAQA 3AMUA 4QF4A 2HDLA 1XXGA 3IKJA 2AUKA 3SXHA 3H3VC 3OWEB 4OO1H 2PCFB 1WCMB 4CJ2C 2D62A 4KD3A 4BA2I 2K04A 2KJXA 2ICEC 2R93B 1GUTA 5IOCA 4OO1G 2HCCA 2WKDA 4EQOA 1EZ6A 1PRTF 4PMBA 1Y1VB 3U9OA 1W6KA 3GTKB 1SNPA 4ZQ3A 3K57A 2JXMB 2C5CA 3ZYYX 5KNDA 5LL6X 2K5DA 3A8KE 1RD9D 2F0NA 2A68D 1UUPA 2VUMB 1OO9B 2OF1A 1FNUA 2I07B 1RCVD 5C0XG 1QWYA 3OIPA 4B9XA 1D5ZC 1X3PA 3HOVB 2BE5D 2ZXPA 2BDNA 4CBVA 4KN7C 5C4ZA 4H44C 2SEBD 4K8IA 1CHQD 5DAUA 2Z4IA 2D5DA 1IL8A 1ICWA 2NWGA 3PV0A 4IQZA 3L7ZC 1RF2D 3HKZB 3P20A 1XTCD 1L0XB 1RTOA 3I3CA 3BDCA 4V190 4S3SA 5AFWA 1JORA 4IURA 5CV6A 3DEPA 3K59A 1RHPA 1G2SA 5CORA 5EKIA 1II3A 4KKUA 4PV1C 1HA5A 3P1HA 1NUCA 2V4DA 2XVSA 4KJOA 4K14A 4RHRA 1KTKA 2AWOA 5C0XJ 1J9OA 4DAPA 3G7LA 1Z6HA 1H9MA 2FJ2A 4FO2A 1E2WA 3EFXD 2KEEA 1RJTA 1AFPA 1E2VA 2H4OA 3OSOA 2AUJD 4JBWA 2SDFA 4N9PA 2Y0SB 3GV6A 2A69C 1Z7TA 3GTMB 3M4YA 4KMUC 5NUCA 3PO3B 4K6LA 1EYAA 1R4QB 2E75C 2HCIA 4PNYA 1HXYD 1K8MA 2WACA 3A7AB 1SYGA 1F2ZA 4N9TA 3S2HB 3KK7A 3WOFA 4XQNA 1TVXA 2EJFC 4ABNA 2YYZA 3T13A 2L9HA 2F0KA 4C3JG 1ENFA 2JA8B 1SYEA 1GHJA 5E1FA 1Q3LA 3FVQA 4DNRB 2OXPA 5ELCA 3S17B 1PLFA 2EYPA 3VR4A 2XRSD 2E2DC 3U9SA 3J80E 2RVLA 4C1NI 2CW0C 1EY0A 2JA6B 4KN4C 1A15A 1OXUA 2NN6I 1LTSD 3MTSA 2EOTA 3LNNA 4C56C 4A93B 2J7ZA 4A3DB 2TMPA 1AW7A 5CBEE 3NTKA 1EY4A 2B8FA 1U4RA 1KABA 2PW7A 1DONA 4KK7A 2N88A 1CZGA 2A6HC 5EBDA 4RGNA 2RKSA 1UEAB 4CKCA 1TIID 1M4VA 3N6RA 3W2DA 3HOZB 2IL8A 2NBFA 2R61A 2KEDA 1HUNA 1A3UA 1TWCB 2WB1B 3R2IA 1X3QA 4XYQA 2E2IB 3J80L 1HFGA 1I3QB 2JA7B 4BWGB 2EJGC 3AB9A 5FO9B 2O5JC 3HEJA 2BA0A 3MA2B 4A3JB 4RWSC 1PFNA 2EDGA 3NUCA 1EY9A 2JP1A 5JEAH 1JWMD 2X6GA 4DK0A 2X69A 2A6ED 2JSOA 1CT1D 3SK6A 3RD4A 3TMEA 3E5SA 1A6XA 3A8IE 3PIO3 2DN8A 1OXTA 4FF1A 4ME5A 2XNAC 1DOMA 1EWCA 2K01A 1MBYA 2O2LD 4IUUA 1LTGD 2Q8RE 3H91A 1ESRA 5KRUA 4A3MB 1A3TA 3NPPA 4OO1I 1K83B 1LTBD 2CVRA 1YNNC 1SMYD 1BBXC 2NTSA 1F9SA 4A3IB 4M8AA 2K7VA 1TWHB 1C8CA 5KYIA 4QB4A 4QIWB 2F1MA 1STHA 1B3AA 4UDUC 4RKBA 1IW7C 4K5XA 1TS3A 2M00A 5C0XI 3CKIB 2NTTA 2FHTA 2IWHA 2EYMA 1H9RA 3BS1A 1PTOH 3QG1A 2F3VA 4X3UA 2SNSA 1O7ZA 5IGDA 4WFN3 2JEBI 2DY8A 5D14A 4U673 1JR0D 1ML0D 4NP5A 4OGQC 1HHVA 3O13A 1Q1BA 3D4WA 2LMCB 3TDQA 5HURA 1OXXK 3Q22A 4CHTB 3HOYB 5D65A 1TT2A 3N52A 4EQPA 5JJZA 3GTQB 5CMDA 1MD2D 3JAME 2PMZB 1JOQA 1AN8A 1HCZA 2EYOA 1EU3A 5IGGA 2PYKA 1Y8NB 1SAPA 1YNJD 1PRTC 1WTQA 4IUVA 2Q8TA 3RLFA 1DOLA 3MFYA 3PUYA 5CGKA 5JVG3 3NXWA 4MHEA 4LAAA 5A2QE 5BN4A 4IFDG 1EQTA 5C4JB 1SNCA 2FMMA 2PW5A 1BO0A 2L11A 3I91A 3KBGA 1F2LA 1HUMA 1F9PA 2AWNA 2AQ1B 1EY8A 1WD0A 2IPKD 1AEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQQ T;  1JC7 A;  1UEA B;  2A74 C;  2QKI C;  3MA2 B;  4ILW A;  3CU7 A;  5JPN C;  5FOB B;  1BUV T;  2J0T D;  3CKI B;  4FXG C;  1XWE A;  2A73 B;  2TMP A;  1BR9 A;  3G6J B;  2E2D C;  5JPM C;  5FO8 B;  3HS0 C;  1GXD C;  1PXU A;  3KLS A;  3FRP B;  2XWJ B;  2XWB B;  2ICE C;  2WIN B;  3HRZ C;  3L3O C;  3V96 A;  2B39 A;  2WII B;  1D2B A;  1UAP A;  5FO7 B;  1OO9 B;  3I70 A;  3OHX C;  5FO9 B;  2I07 B;  1JB3 A;  3T4A C;  4FXK C; 
#chains in the Genus database with same CATH topology
 2B2W A;  2CH4 W;  4K5V A;  1J6Q A;  2EYL A;  5JJL A;  2RF4 A;  2C9O A;  2WAQ B;  5H1S E;  2QF7 A;  2B2Y C;  4A3B B;  4DR6 Q;  3RN2 A;  3JAM L;  3PUX A;  2B2V C;  2K03 A;  1QJO A;  3E6Z X;  1K9M C;  1KNA A;  4XIG S;  4RA8 A;  2B2T C;  1PTO C;  1KDB A;  2MPM A;  3MXG A;  3FEW X;  2A68 C;  4LF7 Q;  3SK4 A;  2I5H A;  3I56 A;  4IPG A;  1CZW A;  1WI5 A;  2KHS A;  4MTK A;  4LF7 L;  5JOB A;  1WTO A;  4J6H A;  2IX1 A;  1LV9 A;  1SE4 A;  3GTO B;  1F9R A;  4R8N A;  3QOJ A;  4A75 A;  2QEJ C;  1NMG A;  4IFD J;  1I50 H;  1DD2 A;  4HIK A;  1MKH A;  1GO3 E;  4DAY B;  3NTI A;  5C44 H;  4AQY Q;  3SGI A;  2DUD A;  1D1I A;  1BBU A;  1EEF D;  4YCW A;  2Z6K C;  4AQY L;  1GUG A;  4X3K A;  3M4O B;  4R1J A;  3S16 H;  3M85 A;  5C4X B;  2KBN A;  1X54 A;  4LF5 Q;  5C3W A;  4XT1 B;  3TS2 A;  5C44 G;  1IYV A;  2ZXR A;  4LF5 L;  1STG A;  4HMJ A;  3V96 A;  3SVM A;  4CDF C;  4UP8 A;  4HCS A;  3DLL A;  3NP8 A;  1D8L A;  1LTL A;  3T4A C;  2PNR C;  2F0L A;  2J0T D;  5T1I A;  1ET6 A;  5C5M A;  1PH2 A;  2CWP A;  3S1R B;  3H6M A;  1BKB A;  1B9N A;  1OXS C;  1KAA A;  2JN4 A;  4IUN A;  4L8J A;  3KF8 B;  3S1Q H;  5C6A A;  3MFG A;  1L0Y B;  3D3R A;  4WJW A;  1LTI D;  5G3L D;  3UDX A;  1Q82 C;  4R4T A;  2Q2H A;  3ND8 A;  4BY1 H;  4A3C H;  5E4X A;  4CDC C;  1PZK D;  4DPG A;  1T5X D;  1XWE A;  1PFS A;  2N55 A;  5CYU A;  2NVY B;  3HG9 A;  1K8O A;  1EFW A;  1EQR A;  3FKI H;  1GXD C;  1SNO A;  1SYF A;  4DA2 A;  3GO5 A;  4BY1 G;  4A3C G;  2VB3 X;  4LJZ C;  1G8Z D;  4KY6 A;  1EY7 A;  1PFB A;  4DAY A;  2XSC A;  1KRS A;  4JYA Q;  3IL8 A;  3NSW A;  1EQQ A;  4Y52 H;  4C3J B;  4JYA L;  2O4X A;  4HED A;  5CV9 A;  1B2T A;  1H9S A;  4L5R C;  5G3L F;  1TXY A;  1EL0 A;  2AQ3 B;  3MEH A;  1QVC A;  2VB2 X;  4XYO A;  4HMI A;  2ASB A;  1TWG B;  5IIF A;  1KD1 C;  4HJ7 A;  3M4P A;  3PO2 H;  1D6E C;  4X65 Q;  1ZEQ X;  2H1E A;  2R7Z H;  1DGS A;  3HOW H;  1SYD A;  1UE6 A;  1BCP D;  4X65 L;  2WP8 J;  4CJ0 B;  3LWE A;  4LUO A;  3OMG A;  2I0Q A;  1HZB A;  1Q1E A;  1B53 A;  2HDM A;  4GNX B;  2HIV A;  4FP5 D;  1SBB B;  2K33 A;  5IYD G;  3CCQ A;  3CCE A;  2E2H B;  1NSN S;  3HOW G;  3D8G A;  4Z9C B;  4HJA A;  5K36 H;  3KLS A;  1LAC A;  3T1Y Q;  3V2T A;  5M5Y H;  4HTH A;  5EKK A;  2EYH A;  1SNQ A;  1DM0 B;  4GOP C;  3T1Y L;  1TS4 A;  4GS3 A;  2I5L X;  2M9V A;  4KHP Q;  1EOT A;  3NWS A;  3BVZ A;  5K36 G;  3X3N A;  3KLW A;  3S14 H;  4KHP L;  4FF4 A;  4N8F A;  2BCO A;  1Y1W G;  1BCP F;  1ENA A;  1STN A;  3SEB A;  1E0B A;  3A8J E;  1S4Z A;  1PXU A;  1EEI D;  1WJJ A;  2OQK A;  2EY5 A;  4P71 A;  5LMN Q;  1EYG A;  1S5D D;  1T5E A;  5DNF A;  4IUQ A;  5KNC A;  5LMN L;  2B2U C;  5KNB A;  3RZO H;  3A5Z B;  3UI2 A;  4F88 A;  2UXC Q;  1VQF A;  2Z4H A;  2EQS A;  2EYJ A;  4J15 A;  3RMH A;  1VQO A;  2UXC L;  1B70 B;  5F2D A;  1B4O A;  1XX8 A;  2YTV A;  4YWL A;  4JG2 A;  2D0P A;  1L0W A;  1HZ9 A;  3F2C A;  1DZ1 A;  3L3O C;  3M9B A;  2Q8I B;  1Y8O B;  4G7O C;  1KHI A;  2WII B;  3BZD B;  4H13 C;  4C3I H;  4GNX A;  4APV A;  4WOR A;  2ZJR A;  2B3G A;  3MXU A;  1W2B A;  1HH2 P;  1UE1 A;  4FXK C;  4QMG A;  3BDL A;  2R92 H;  1I4G A;  4DAM A;  1O7I A;  4LUV A;  3ICE A;  4KD4 A;  1ET9 A;  1QOH A;  1LM0 A;  4RFB A;  2K1B A;  4JPB W;  2YTX A;  2K5H A;  2IW3 A;  1SR3 A;  1S3O A;  1QB5 D;  2L1B A;  3TBI B;  3FPP A;  1SLJ A;  4QCL A;  2EXZ A;  1S5F D;  3EN2 A;  3GTJ B;  3HOU H;  2LKV A;  2JK8 A;  1FYC A;  2OTL A;  4ZKB B;  3OMC A;  3RUZ A;  3AYH B;  5IGE A;  3IFT A;  4JI2 Q;  4GN4 B;  4IFD I;  3PGZ A;  2A6E C;  4XQQ A;  4X62 Q;  2F0Q A;  3GTP H;  3I4O A;  2OEO A;  4LK1 C;  4JI2 L;  3TQY A;  4X62 L;  4DV6 Q;  2HQL A;  4JI0 Q;  3HOU G;  1KAW A;  3HOX G;  4V0B A;  1LO5 D;  4X3T A;  4A3K G;  4DV6 L;  1CA5 A;  2JYO A;  4JI0 L;  1HQR D;  4M1U B;  4O1N A;  4UP7 A;  1CQV A;  1VQI A;  4B3R Q;  4ZRZ A;  4IUP A;  4NDX A;  4JI3 Q;  1TY2 A;  2DJF C;  3JC6 6;  5C4H A;  1J8I A;  3GTK H;  1SMY C;  1SFO B;  3DHQ A;  1HR0 Q;  4JI3 L;  3CQZ H;  1GUO A;  5I2Y A;  5FO8 B;  1Q81 C;  1BDO A;  2F52 A;  2G9D A;  4OL7 A;  4DNT B;  1XNR Q;  5IY0 A;  1NJI C;  1PFM A;  4CKB A;  3VA7 A;  1XNR L;  3I72 A;  4LF8 Q;  3VR5 A;  3J81 E;  1GD7 A;  2K14 A;  3CC2 A;  1WTW A;  2R7D A;  4LF8 L;  2E2J B;  2MUY A;  5D3I B;  2D9U A;  2LY7 A;  4A3F H;  4NKL A;  3L0O A;  1PTO B;  5FK9 C;  4IOC A;  1V8Q A;  1KIX A;  1RL2 A;  4GKJ Q;  4A3F G;  4HJ9 A;  3NEM A;  4IOA A;  1JT8 A;  4GKJ L;  1QCB D;  1EUJ A;  3TRZ A;  4P2C B;  4RGO S;  2RQX A;  2EPB A;  3TZD A;  1YI2 A;  1IXR A;  4OIK A;  4UPA A;  2E74 C;  2MNA A;  1ZYR D;  3HS0 C;  3T56 B;  3PUW A;  3A54 A;  4KTA A;  4GN5 A;  4R9W A;  4JI1 Q;  1GVP A;  2WFW A;  3MZ5 A;  4FDB A;  2RDF A;  4JI1 L;  1JWU D;  1JQY D;  1LYL A;  4POF A;  1YHB A;  2K5V A;  3NBH A;  3GP7 A;  5C3E B;  3C1E A;  1A2T A;  1Z9F A;  3J81 L;  1TWF H;  1SXT A;  3UE0 A;  5IT9 E;  1HA6 A;  4DV1 Q;  3P75 A;  2RCN A;  5IP9 H;  4F87 A;  4OWT B;  4DV1 L;  1SN8 A;  1DJR D;  1S40 A;  3PQI A;  3R93 A;  1A3V A;  2QCP X;  1SNM A;  4IJH A;  3S2D B;  1GHK A;  5GAE C;  1VQ5 A;  2QGQ A;  3J80 i;  5CBA E;  2CQO A;  4Y7N H;  2QKI C;  4LF4 Q;  4B08 A;  3K0X A;  1Y8P B;  2IJ0 A;  4LF4 L;  3VYU A;  2VL6 A;  3BZC A;  1D5X C;  2NUC A;  3I2Z A;  5JPM C;  5JEA G;  5EPL A;  2F3W A;  1M8A A;  5LL6 S;  1EWI A;  1V1P B;  1K3B C;  1QUQ B;  1VMP A;  1STY A;  4BXX H;  3LWU A;  3VR6 A;  5LMU Q;  4IAL A;  1KRT A;  5EAY A;  4R8I A;  1K73 C;  2RHQ B;  2HUG A;  5LMU L;  4XXE A;  5JPN C;  3OW2 A;  5M3M H;  3TS0 A;  3X3M A;  1JCK B;  2QEX A;  1WTX A;  2HQE A;  3M7N A;  1X55 A;  4HAE A;  5IT9 L;  1QVG A;  3CAM A;  1AE3 A;  5ELN A;  2LFN A;  4R4O A;  3OW7 A;  2F4I A;  5M3M G;  4RAU C;  1SYC A;  3NQT A;  4KY5 A;  1R9T B;  2Q2I A;  5FO7 B;  3H0G G;  1N34 Q;  2JA8 H;  2CH4 A;  3CC7 A;  1VQL A;  2NVX B;  2RBM A;  4K8J A;  5K5P A;  1N34 L;  4X6A H;  3QOL A;  3S15 H;  1C48 A;  2P5Z X;  5JVH 3;  1D1K A;  3NBI A;  4R4C A;  4IUT A;  1BR9 A;  2PI2 E;  4IN3 A;  4DAV A;  1A2U A;  1PDQ A;  4FYD A;  4A3E G;  1I50 B;  3DWP A;  1IL2 A;  1I6V C;  3I7F A;  5EGT A;  2ZTE A;  2RSN A;  3CRL C;  5C44 B;  3I4M H;  1SMX A;  3SHL A;  4ZLT F;  1X6O A;  2DNE A;  2SNM A;  5JEA J;  3EA6 A;  4RGM A;  4A93 H;  2MP1 A;  4GOP B;  2F0T A;  1WTP A;  5BR8 Q;  2QDL A;  2MFI A;  3EIV A;  2ICI A;  3Q8D A;  5EPK A;  1LUZ A;  1ROD A;  1NCV A;  4O0A A;  5C3X A;  3I4M G;  4GLX A;  5CV4 A;  5M5X H;  3MHB A;  3K5L A;  3VDY A;  3NWT A;  3BDO A;  3OOC A;  4DGZ A;  4LWC A;  4TVA B;  2UXB Q;  2N8N A;  1LT4 D;  4DV2 Q;  4YHH L;  4LF6 Q;  2UXB L;  1CKO A;  4DV2 L;  4N8X 1;  1B1Z A;  4LF6 L;  1B9M A;  3S1Q B;  3I8Z A;  3A7L A;  1WOC A;  4DU9 A;  2WKC A;  3D6C A;  3FHW A;  4JOI A;  3K5O A;  4AYB G;  4BY7 G;  1NTG A;  1TWC H;  2L4N A;  4AYB E;  3FMC A;  3QB3 A;  4ZK9 B;  1MI2 A;  1H9K A;  5ELB A;  1KQS A;  1S5B D;  4BY1 B;  2KHJ A;  4OON A;  5FLX c;  1JWS D;  5IYC G;  3C1F A;  5ISR A;  3ER0 A;  4RGT A;  4RHS A;  1QIL A;  4LMQ D;  3ERQ A;  3KDF B;  4KLK A;  4K6D A;  1U0L A;  3G6J B;  1RDP D;  4ALP A;  2PO4 A;  2WB1 E;  3Q6S A;  5HY6 A;  3STB C;  3VYR A;  3CF5 A;  5HGT A;  3NTH A;  3K8A A;  1JE4 A;  4EX5 A;  2JA5 G;  1VQH A;  3R3O A;  4ZKC B;  3S24 A;  3OHX C;  3TN2 A;  4BBR G;  4BBS G;  1TKW B;  3TP5 A;  4MTN A;  1DXM A;  3P7J A;  1X56 A;  3URY A;  4PZ6 A;  3SR1 A;  1EYD A;  1PH6 A;  3GV3 A;  1HPC A;  4RG1 A;  4F8M A;  1HNW Q;  1WTR A;  1S5C D;  3E0J A;  1YNN D;  2ZTC A;  3AFQ A;  3HOW B;  1HNW L;  4TSS A;  2FMC A;  2WV6 D;  4KV6 A;  3MXP A;  1K83 H;  1QE6 A;  5CV5 A;  4X64 Q;  3ITP A;  3OPO A;  4YWM A;  1BCP C;  5DEH A;  1ZXT A;  2ZJQ A;  1SE2 A;  4X64 L;  1H9J A;  4OX9 Q;  1EYC A;  4DF7 A;  4UAI A;  5LHY 1;  3BVG A;  2IX0 A;  3K7A H;  2F0I A;  4I7A A;  4TQU S;  1TWH H;  2CWA A;  3DM1 A;  1QNK A;  4OX9 L;  3GQB A;  3S1M B;  2OCE A;  1Y1W B;  5M5Y B;  4C2M H;  2BE5 C;  3FPU B;  2R6G A;  4TKO B;  4XT3 B;  1IW7 D;  3JAM i;  1HZC A;  1WYD A;  3E9I A;  4B9W A;  2ENB A;  4JBJ A;  3I4N H;  1O7Y A;  3W1B A;  3S14 B;  4GZY C;  3T51 B;  5KYL A;  1BBW A;  4QIW E;  4Q5V A;  3K80 C;  2A73 B;  3VA5 A;  2NZ1 D;  3ND9 A;  1L1O C;  4DN4 M;  2LS0 1;  2XTI A;  4X66 Q;  3I4N G;  4KHV A;  2N49 A;  4OXP A;  4UP9 A;  3V05 A;  3UDG A;  4X66 L;  4PQX A;  1SYB A;  3GDE A;  1O7L A;  2Z0S A;  1YJW A;  4OHJ A;  1X32 A;  4OWX B;  4ZAI A;  5CV8 A;  1Q46 A;  1HFN A;  1EIY B;  4FVM A;  1KDA A;  2Z9H A;  3PF4 A;  1OTC A;  3L9A X;  2MGS A;  1F2M A;  2E76 C;  1Q8I A;  3OIQ A;  1NAP A;  3Q0A A;  4JBM A;  5ELF A;  3PMF A;  3I73 A;  3M3Y H;  1FNV A;  2IX3 A;  2R92 B;  4C1N K;  4QUF A;  4DV7 L;  3G6E A;  4CJ1 B;  2F0D A;  1CSQ A;  3GTQ H;  1A8V A;  3TP8 A;  4KY7 A;  1D5M C;  1X3F A;  2K75 A;  2RDG A;  1N36 Q;  1EIH A;  1EZ8 A;  2V1C C;  1XMQ L;  5J3B A;  1IBK L;  1N36 L;  1WTH A;  1K8A C;  3CD6 A;  3S1N H;  4FF2 A;  3TP6 A;  3TSS A;  2GN5 A;  2OT2 A;  4A4I A;  1M90 C;  4A76 A;  3HOU B;  1BNZ A;  3HOX B;  4A3K B;  2G9H D;  2PMZ E;  3NEL A;  3FKI G;  1PH9 A;  2X6L A;  3GTP B;  4XQJ A;  2EY2 A;  2NVQ H;  3CHB D;  4A3G H;  1OXV A;  3QIA A;  3L2P A;  2YV5 A;  2K50 A;  2QA4 A;  2G5D A;  5E7N A;  1E1T A;  4HR7 B;  2EJM A;  5EQ0 A;  4OEL B;  1WD1 A;  3DWQ A;  3KYH C;  2B63 H;  3PIP A;  4L63 B;  2KQ3 A;  1VS0 A;  3CW2 C;  5ELD A;  2ALY B;  2ES2 A;  4A3G G;  4GKK Q;  5J22 A;  2A74 C;  2K32 A;  3CCV A;  2CKZ B;  1PH7 A;  3K5M A;  4GKK L;  3CQZ B;  4B3T Q;  3KF8 A;  4RH6 A;  3A55 A;  2K5W A;  3PO2 G;  2UU9 Q;  5C0X H;  3W3A A;  2B63 G;  3IRB A;  2R7Z G;  4B3T L;  1LAB A;  4EGV A;  1Y14 B;  2UU9 L;  5J1Z A;  2CFM A;  1LT6 D;  1PTO D;  1TWA B;  4Q0F A;  5LMN W;  4G4K A;  1DCZ A;  1MSG A;  5IOD A;  1TS5 A;  4U68 A;  1ILP A;  4NMZ A;  2K05 A;  2KEC A;  2SOB A;  2WAQ E;  3I90 A;  1CQF A;  1A62 A;  1IKL A;  1X65 A;  4EVO A;  1NNX A;  4FNF A;  4DNI A;  1V43 A;  2KA7 A;  4A3F B;  3W5O A;  1GUN A;  2BDO A;  4LF9 Q;  1PA6 A;  2J4X A;  1YVC A;  5EJW A;  1A63 A;  1XMO L;  2MJ8 A;  4LF9 L;  5M3F H;  2DGY A;  1VDZ A;  3BYT B;  4DK1 A;  1I94 Q;  2MO0 A;  1CFM A;  1Q90 A;  4C3H H;  2KCN A;  3CRK C;  2F0O A;  1QG7 A;  1I94 L;  5I9P A;  3GTO H;  5M5W H;  2OWO A;  1JOK A;  3CP0 A;  4MNO A;  2UUB Q;  5CV7 A;  4P75 A;  2XN9 C;  2B2W C;  2UUB L;  5M3F G;  1YJ9 A;  1I4R A;  4LFC Q;  3PUZ A;  1JE5 A;  4EQ5 A;  3BYY B;  4C3H G;  1PTO F;  3ERS X;  3RZD B;  4LFC L;  2Z8L A;  3M4O H;  5KIX A;  3SDZ A;  1EY5 A;  1CI3 M;  1XJV A;  4G7H C;  1PH4 A;  3F2U A;  4FXD A;  2F0J A;  4CGY B;  4L5Q A;  4BA1 I;  3UE1 A;  3PCO B;  1ZYR C;  4XTC S;  2ZTD A;  1CM9 A;  3J7A V;  1FVI A;  4HN7 A;  4E6I A;  3K6O A;  4DR2 Q;  1LTA D;  3Q23 A;  3RN5 A;  4DR2 L;  1IYU A;  1TWF B;  4IPC A;  1STE A;  4ZUJ A;  1JB7 A;  2YU9 B;  2L55 A;  5I6Y A;  1E2Z A;  4YY3 Q;  3C3L A;  3CMA A;  3PIP 3;  1YBY A;  2AQ2 B;  1BOS A;  1VF5 C;  5EBC A;  4C3I G;  4YY3 L;  1VQP A;  1AZQ A;  1O78 A;  1HQM C;  3MVV A;  3CCM A;  1SSO A;  2L5T A;  2R92 G;  4R4Q A;  4DKA C;  1IHZ A;  1D2B A;  2F0S A;  4K0K Q;  4OEM B;  4Y7N B;  4K0K L;  1X9N A;  3T53 B;  4G7Z C;  3C2P A;  1CSP A;  1PRT B;  1EWH A;  4HJ5 A;  2PQA B;  4G57 A;  1ZKO A;  1HR0 W;  1WCM H;  3NE5 B;  2F4V Q;  1SJE D;  1ASZ A;  1LT3 D;  1C9O A;  2E5L Q;  1R4P B;  1IZ6 A;  3VR2 A;  1LT5 D;  3Q24 A;  4P72 A;  2F4V L;  2E5L L;  1I6H B;  3KOJ A;  1EQV A;  2NVT B;  2R93 H;  1I4H A;  4DFA A;  4DR1 Q;  1K28 A;  1JIC A;  3I70 A;  4DR1 L;  1F77 A;  1WCM G;  2KVM A;  1Y1V H;  3BJU A;  5M3M B;  4C3J H;  3H0G B;  3FDT A;  1SJH D;  2AHO B;  3GD7 A;  3H94 A;  3RNU A;  3K7U C;  2R93 G;  5EKL A;  4ULL A;  3K58 A;  1SE8 A;  4J8Q A;  3PUV A;  2TSS A;  3FRP B;  3DEO A;  1Y1V G;  4I65 A;  5IE8 A;  4DV0 Q;  4JI6 Q;  2K6A A;  1B50 A;  2MHV A;  2ZJP A;  3H09 A;  4DV0 L;  4A3E B;  4JI6 L;  3OWF A;  2VUM H;  3S15 B;  4JC0 A;  4HCE A;  3C46 A;  1VQA A;  4K2K A;  1JMC A;  4RCN A;  3SK8 A;  3HP3 A;  1HRJ A;  5I6W A;  1E24 A;  2EE1 A;  3HOV H;  2KCT A;  2NYZ D;  5JJK A;  3DWA A;  1BCP B;  3GTG B;  1NR2 A;  1IKM A;  2A5H A;  2AMC B;  2VUM G;  4QL5 A;  2F0U A;  2RCF A;  2RSO A;  1VQK A;  4PMC A;  2BOS A;  1TS2 A;  4F7X A;  5L37 A;  3A0J A;  3G4S A;  3I4M B;  1A0I A;  2HT1 A;  1TR5 A;  2LSS A;  1J5E Q;  1WTV A;  3HOV G;  5ELO A;  1KLU D;  2MQH A;  1HNZ Q;  1CHP D;  2IHE A;  1LTR D;  2K4K A;  2C35 B;  1J5E L;  2EYF A;  2XIW A;  1SDF A;  3QWN A;  1HNZ L;  2DNC A;  4EQN A;  1LTT D;  2PPB C;  2F0M A;  1PZJ D;  3EVQ A;  1VQ7 A;  1I4P A;  5M5X B;  5A35 A;  3BVM A;  3B6Y A;  1DYQ A;  1SEB D;  4LW1 A;  5M9O A;  2K28 A;  1U9R A;  1ASY A;  4BY7 B;  4AYB B;  3LX0 A;  1Z47 A;  4RCO A;  1C0A A;  3GTL B;  1AZP A;  3HKZ G;  1GOZ A;  3HKZ E;  4DXF A;  2F0H A;  4I7Z C;  4QQB X;  4YWK A;  1RIP A;  1DOK A;  1Y69 U;  2VQE L;  5BN3 A;  5FLX E;  3J81 j;  2B2Y A;  4AIM A;  3M7G A;  1JOO A;  2VW9 A;  1E3P A;  2DJG C;  3KLR A;  1PH3 A;  4L5S A;  3NEN A;  3IAY A;  2KOL A;  2L12 A;  4YCV A;  3DMU A;  2B2V A;  3KBX A;  2RDH A;  3T16 A;  1FD7 D;  1QNU A;  1EIG A;  1YNJ C;  2O5I C;  2XGT A;  1V1O A;  2L15 A;  1FNW A;  2JA5 B;  4ILW A;  2FFK B;  3AFP A;  2B2T A;  5IP9 G;  1B44 D;  4CKE A;  3S9W A;  2EZV A;  4NW2 A;  1N33 Q;  4BBR B;  4BBS B;  2A69 D;  3SK5 A;  3EQL C;  1N33 L;  3J81 i;  1TY0 A;  3U50 C;  1X3E A;  3BG3 A;  1G6P A;  3MC0 B;  1RTN A;  1VMC A;  3GTM H;  1CKN B;  2F0P A;  1FR3 A;  2PZU A;  5DM7 3;  3PO3 H;  1AP0 A;  1VQE A;  3MXN B;  4O2D A;  1YNX A;  1LLR D;  5E3F A;  3HZX A;  1MIU A;  1VQ8 A;  2Y0S G;  2Y0S E;  4FXG C;  5I9O A;  2F0E A;  3ULJ A;  1HNX Q;  1VF7 A;  1SE3 A;  2Z6K A;  4JK1 C;  3PO3 G;  2GVA A;  3S2H H;  1HNX L;  4BXX G;  2XWB B;  1KLG D;  3U58 A;  1F2Y A;  3PSI A;  5T1G A;  2D2C C;  4WRD A;  4GNX C;  2XRQ D;  5FLX L;  4TRD A;  3VYS A;  3TP7 A;  4X3S A;  4WJ3 M;  5C5L A;  3U4V A;  5I4D A;  1EFI D;  1U4M A;  2BA1 A;  3K7A B;  1KDC A;  5GAH C;  1XPO A;  3S17 H;  3BZK A;  2CW0 D;  4YIJ A;  1SFO H;  1S5E D;  4K5W A;  4C2M B;  3F8T A;  1VQ4 A;  5AJ3 L;  1RKN A;  1VQJ A;  4FF3 A;  2XWJ B;  1WVL A;  2JA8 G;  1AH9 A;  3D4R A;  3VR3 A;  1GJX A;  2JEA I;  2JA6 H;  2AKW B;  3J80 c;  3I4N B;  1W6J A;  3DXJ C;  4L6T B;  4XDX A;  2ZXO A;  4KJN A;  4DK3 C;  1EY6 A;  3K5N A;  2KHI A;  2BH2 A;  3SE0 A;  4KKS A;  5E4W C;  2JE6 I;  4ODG A;  4ID6 A;  1L2F A;  3S16 B;  1SND A;  3QO2 A;  4RKL A;  4A3D H;  2UUC Q;  1WFQ A;  4DR7 Q;  1V1P A;  2JA6 G;  1QUQ A;  1PYS B;  4IPH A;  5JAV A;  2A6H D;  4ZYS A;  5FLM H;  2UUC L;  2OQ0 A;  3U4Z A;  4DR7 L;  1O80 A;  1C7Y A;  3MXN A;  3HRZ C;  4DUZ Q;  1ILQ A;  2GVB A;  4DK6 C;  1MJC A;  3D31 A;  3KLS X;  2F0F A;  2F0V A;  1AE2 A;  4DUZ L;  3E0E A;  4A93 G;  1CUK A;  2EVB A;  2ZT9 C;  4YHH Q;  1JB3 A;  5EPJ A;  4A3D G;  1ICF B;  1JC7 A;  2QIL A;  5CR3 A;  1HTL D;  4PMW A;  2EY1 A;  1PZI D;  5FLM G;  3CPF A;  1VQG A;  3CCL A;  3HOZ H;  1X3G A;  3F2B A;  1GKH A;  5KEE A;  4P73 A;  3IFD A;  2L0C A;  3WOE A;  3A56 A;  3D6W A;  3M3Y B;  1BVS A;  2B39 A;  3KUP A;  2E2I H;  3UDI A;  4NB3 A;  1PH8 A;  1VCI A;  1KNE A;  3HOZ G;  3K81 C;  1I3Q H;  5DM6 3;  2JA7 H;  4NXN Q;  1YEZ A;  1BF4 A;  1JJG A;  1ESF A;  1G29 1;  1HJP A;  4P74 A;  2ID0 A;  1PMR A;  3NHH A;  4NXN L;  3TRE A;  4A3J H;  4DV5 Q;  1K3R A;  3ONA B;  3FKI B;  3D4D A;  3K0Y A;  4HIO A;  1U5K A;  2WB1 G;  3S1N B;  1MGS A;  4DV5 L;  4IFD H;  4KI0 A;  2DY7 A;  1I4Q A;  2H5X A;  2JA7 G;  1C4Q A;  2B29 A;  3KJP A;  1VQD A;  5CC4 A;  3HFZ B;  1XNQ L;  3J7Y W;  4QY7 A;  4GOP A;  4MIU A;  1PYW D;  5FOB B;  2NVQ B;  2R3Z A;  1IYJ B;  4A3G B;  3TZU A;  1MSH A;  2CHB D;  1Q12 A;  2FIN B;  3PO2 B;  1P8L A;  3H3V H;  2B63 B;  2Z1C A;  2R7Z B;  2KCC A;  3ZJY C;  4OIJ A;  3J7A F;  3MWY W;  3R2T A;  4A3M H;  1VQN A;  4IZ8 A;  1BQQ T;  2NN6 H;  2IT1 A;  1U4L A;  1HTP A;  2B2U A;  4OWW B;  1PYB A;  2F03 A;  4HSV A;  5FKA C;  4A3I H;  1XPR A;  2Q2U A;  5HGQ A;  5ELE A;  5FJ8 H;  1B3Q A;  1P16 A;  3HKS A;  4QUC A;  4B3S Q;  4A3M G;  1FGB D;  1G91 A;  5KGU A;  4DR6 L;  1NR4 A;  4B3S L;  1CK1 A;  2QDB A;  2NN6 G;  3ULL A;  2EY6 A;  1GM5 A;  1STA A;  4ZUI A;  2CQA A;  3NQI A;  2QW7 A;  3OYY A;  2PZT A;  4QGU A;  5D3D A;  1R9T H;  3KDF A;  1CA6 A;  1TU2 B;  4A3I G;  2NVX H;  5FJ8 G;  5TSS A;  2R7F A;  3R8B A;  2I46 A;  5BN5 A;  5IYB H;  1VQ6 A;  3H15 A;  1SRO A;  5M3F B;  1BXT A;  4C3H B;  5A2Q L;  3CCU A;  2F0G A;  4BS9 A;  5M5W B;  1F9Q A;  1EU4 A;  1IBL Q;  3RLN A;  3WDN A;  1Q86 C;  3AQQ A;  2WIN B;  2B8G A;  1GUW A;  1IBL L;  1D7Q A;  4H0L C;  4KKT A;  5J39 A;  5IYB G;  2PZW A;  1GUS A;  1UAP A;  1KL9 A;  3RZO B;  4K2L A;  4O42 A;  1G2T A;  4KHZ A;  3CU7 A;  4CDE C;  3ERO A;  1ONL A;  2CCZ A;  1NY4 A;  2NB0 A;  3NK9 A;  1ENC A;  1XPU A;  3AU7 A;  2RA4 A;  4DUY Q;  1H9S B;  3QJY A;  3DUZ A;  1U4P A;  2GA4 B;  2LXJ A;  1JJC B;  1SRU A;  4HID A;  5I2X A;  1I4X A;  4DUY L;  2K5Q A;  4DXG A;  4C3I B;  4H7B A;  3VYT A;  2F0W A;  2VY3 A;  3OTO Q;  1Q8K A;  3LGJ A;  4DV7 Q;  2HHH Q;  3CC4 A;  2PNH A;  1G6Z A;  2M2L A;  5COY A;  2VXW A;  1UNS A;  3OTO L;  3HGB A;  3HOY H;  2HHH L;  1TQO A;  1XYI A;  2PQE A;  4JI5 Q;  2JJQ A;  1B7Y B;  4J1M A;  1STB A;  1BUV T;  2KUM A;  1YHA A;  5IGC A;  5IGF A;  4HSP A;  1XMQ Q;  4JI5 L;  5JJI A;  4RMF A;  1HZA A;  3E9H A;  3EJI A;  1IBK Q;  1PRT D;  5GAG C;  2VNU D;  5IGB A;  5GRO A;  4MN3 A;  4PZ7 A;  3JAM c;  1CTM A;  3I4L A;  3MAQ A;  3HOY G;  3AMU A;  4QF4 A;  1PH5 A;  2HDL A;  1XXG A;  2F3I A;  3IKJ A;  2A8V A;  2AUK A;  1S72 A;  2N3S A;  3SXH A;  3H3V C;  3DM3 A;  3OWE B;  4OO1 H;  2PCF B;  3STB D;  1WCM B;  4CJ2 C;  2D62 A;  4KD3 A;  1VQB A;  5C4J H;  4BA2 I;  2K04 A;  1T9H A;  2KJX A;  2ICE C;  2R93 B;  1GUT A;  4GN3 B;  5IOC A;  4MZ9 A;  4OO1 G;  2HCC A;  2WKD A;  4EQO A;  1EZ6 A;  1PRT F;  4PMB A;  2Z6B A;  1Y1V B;  3U9O A;  2EXD A;  1W6K A;  4JI4 Q;  3A5U A;  1G51 A;  5DLQ E;  3GTK B;  1SNP A;  4ZQ3 A;  4JI4 L;  4NXM Q;  3K57 A;  2JXM B;  3BU2 A;  2E8G A;  2C5C A;  4JOI C;  3ZYY X;  1N8R C;  4NXM L;  4A3B H;  1E7Z A;  5KND A;  1MJE A;  5IYD H;  4JCV E;  5LL6 X;  2K5D A;  3A8K E;  3CCJ A;  1RD9 D;  2F0N A;  2A68 D;  1UUP A;  2VUM B;  1OO9 B;  3J7Z C;  2OF1 A;  1FNU A;  2I07 B;  2WAQ G;  1RCV D;  4A3B G;  5C0X G;  3F1Z A;  3F2D A;  1QWY A;  3OIP A;  1XMO Q;  4B9X A;  1D5Z C;  1IBM Q;  1X3P A;  1NE3 A;  3HOV B;  2BE5 D;  2ZXP A;  2BDN A;  1IBM L;  3CXC A;  3A74 A;  4CBV A;  4KN7 C;  3S1M H;  1B8A A;  1Y1W H;  5C4Z A;  4H44 C;  2SEB D;  4K8I A;  4JVZ A;  3CCS A;  1CHQ D;  3KF6 B;  5DAU A;  2Z4I A;  4B3M Q;  2D5D A;  1IL8 A;  1ICW A;  4B3M L;  2NWG A;  3PV0 A;  4IQZ A;  3L7Z C;  1RF2 D;  3HKZ B;  1CKM A;  3P20 A;  4ME3 A;  1XTC D;  1L0X B;  1RTO A;  3I3C A;  3BDC A;  5C4X H;  1KXL A;  4V19 0;  4S3S A;  5AFW A;  1JOR A;  2KCM A;  4IUR A;  5CV6 A;  3DEP A;  1E1O A;  4PZ8 A;  3K59 A;  1RHP A;  3AEV A;  1G2S A;  5COR A;  4YCU A;  5EKI A;  3ULP A;  1II3 A;  1FJG Q;  5C4X G;  4KKU A;  4PV1 C;  1HA5 A;  1H95 A;  3P1H A;  1FJG L;  1NUC A;  1PH1 A;  2V4D A;  1UWV A;  2XVS A;  4KJO A;  1PV4 A;  4K14 A;  1QVF A;  4RHR A;  3S1R H;  1KTK A;  2D0O A;  2AWO A;  5C0X J;  1J9O A;  4DAP A;  3G7L A;  3M4Q A;  1Z6H A;  2VS1 A;  1H9M A;  2FJ2 A;  5GAD C;  4LFA Q;  4FO2 A;  1E2W A;  5IP7 H;  3EFX D;  2KEE A;  1RJT A;  1AFP A;  1E2V A;  2H4O A;  3OSO A;  4LFA L;  2AUJ D;  4JBW A;  2SDF A;  4N9P A;  1YIT A;  2Y0S B;  2NVY H;  3GV6 A;  2A69 C;  1Z7T A;  3RLO A;  3KF6 A;  3GTM B;  3M4Y A;  4KMU C;  5NUC A;  2I5M X;  2UUA Q;  3CPW A;  3PO3 B;  5IP7 G;  4K6L A;  1EYA A;  1R4Q B;  2UUA L;  2E75 C;  2HCI A;  4PNY A;  1HXY D;  3HOX H;  1K8M A;  4A3K H;  2WAC A;  4NPS A;  3FP9 A;  3A7A B;  1SYG A;  1F2Z A;  2NZH A;  1N32 Q;  2HD3 A;  4N9T A;  3S2H B;  3KK7 A;  3WOF A;  4XQN A;  1TVX A;  1XTD A;  1N32 L;  2EJF C;  4AH6 A;  4ABN A;  1M1K C;  1TWG H;  2K52 A;  2YYZ A;  3T13 A;  2L9H A;  2F0K A;  1YZ6 A;  4C3J G;  1ENF A;  2JA8 B;  1SYE A;  1GHJ A;  5E1F A;  1Q3L A;  3FVQ A;  4DNR B;  4A3L H;  2OXP A;  5ELC A;  4B3R L;  2IHF A;  3NBH B;  3S17 B;  1PLF A;  2EYP A;  3VR4 A;  2XRS D;  3H3V I;  2E2D C;  1HR0 L;  4UY8 C;  3U9S A;  3J80 E;  2RVL A;  2E2H H;  4C1N I;  2CW0 C;  2JQO A;  1EY0 A;  3QR8 A;  4IPD A;  4A3L G;  2JA6 B;  4KN4 C;  1A15 A;  3PIO A;  4JBK A;  1PHJ A;  2Q2T A;  1TWA H;  1OXU A;  2NN6 I;  1VQM A;  4DV4 Q;  1LTS D;  1QZG A;  2PQA A;  3MTS A;  4CDD C;  2EOT A;  3LNN A;  4H02 A;  4C56 C;  4DV4 L;  2ZM6 Q;  4A93 B;  2J7Z A;  4A3D B;  2ZM6 L;  1YIJ A;  2TMP A;  2OTJ A;  1AW7 A;  1NBW A;  2KEN A;  5CBE E;  3NTK A;  2FXQ A;  1EY4 A;  2B8F A;  1U4R A;  1KAB A;  2PW7 A;  1MHW C;  1DON A;  4KK7 A;  2N88 A;  1CZG A;  2A6H C;  5EBD A;  4RGN A;  3J7A 5;  1L1O B;  1UE7 A;  2RKS A;  1UEA B;  4CKC A;  2BH8 A;  1TII D;  1M4V A;  3N6R A;  3W2D A;  3HOZ B;  3RZD H;  2VQE Q;  1V9P A;  2IL8 A;  2PI2 A;  2NBF A;  2R61 A;  1KC8 C;  2KED A;  1HUN A;  1A3U A;  1TWC B;  1N9W A;  2WB1 B;  3R2I A;  1X3Q A;  4XYQ A;  1K8G A;  2E2I B;  3J80 L;  1HFG A;  1I3Q B;  2JA7 B;  4BWG B;  2EJG C;  3WWV A;  3AB9 A;  5FO9 B;  1I5F A;  4LUZ A;  2UXD Q;  2O5J C;  2RHS B;  3HEJ A;  2BA0 A;  4DR5 Q;  3MA2 B;  3W1G A;  4GLV B;  4A3J B;  2UXD L;  2YU9 H;  4DR5 L;  4RWS C;  4HJ8 A;  4R4I A;  1PFN A;  2EDG A;  3NUC A;  3E3X A;  1EY9 A;  3TEH B;  2JP1 A;  5JEA H;  1JWM D;  4LFB Q;  2X6G A;  2MO1 A;  4DK0 A;  2X69 A;  4ZCK A;  2A6E D;  3GTJ H;  4LNQ A;  2JSO A;  4LFB L;  1CT1 D;  3SK6 A;  3G48 A;  3RD4 A;  3TME A;  3E5S A;  1A6X A;  3A8I E;  3PIO 3;  2DN8 A;  5GQO A;  1OXT A;  4FF1 A;  4ME5 A;  2XNA C;  1DOM A;  4UHV A;  4DV3 Q;  1EWC A;  2K01 A;  3T1H Q;  1MBY A;  1VQC A;  2O2L D;  1LTG D;  4IUU A;  3CME A;  4DV3 L;  1VQ9 A;  1L1O A;  2Q8R E;  3H91 A;  1ESR A;  1I6H H;  5KRU A;  4A3M B;  3T1H L;  1A3T A;  3NPP A;  2VQF Q;  2NVT H;  4OO1 I;  1K83 B;  1LTB D;  2CVR A;  1YNN C;  1K0R A;  2YTY A;  1NMF A;  2VQF L;  1SMY D;  1BBX C;  2NTS A;  3CCR A;  3UDF A;  1F9S A;  3MEF A;  4WJ4 A;  3H0G H;  4A3I B;  4M8A A;  2K7V A;  1TWH B;  1C8C A;  4DR3 Q;  5AJ3 Q;  5KYI A;  4QB4 A;  4QIW B;  4DR3 L;  4IO9 A;  2F1M A;  1STH A;  1B3A A;  4UDU C;  4PG3 A;  4RKB A;  4A3E H;  1IW7 C;  4JW0 A;  4K5X A;  1TS3 A;  2M00 A;  5C0X I;  2E2J H;  3CKI B;  4JV5 Q;  3J81 c;  2NTT A;  4IJL A;  2FHT A;  4GLA C;  2IWH A;  2NZO A;  2EYM A;  1H9R A;  4HIM A;  4JV5 L;  3BS1 A;  1PTO H;  3QG1 A;  1CKN A;  4QJF A;  3GTG H;  2F3V A;  4X3U A;  2SNS A;  1O7Z A;  3EBE A;  3I55 A;  5IGD A;  4WFN 3;  2JEB I;  2DY8 A;  1EIF A;  5D14 A;  1UEB A;  2N78 A;  4U67 3;  1JR0 D;  1UE5 A;  1ML0 D;  4NP5 A;  4OGQ C;  1HHV A;  2VZA A;  3O13 A;  5BR8 L;  1Q1B A;  3D4W A;  2LMC B;  3TDQ A;  5HUR A;  1OXX K;  3Q22 A;  1QZH A;  2LXK A;  5IWA Q;  2EIF A;  4CHT B;  4L5T A;  4BY7 H;  5IWA L;  5D65 A;  1TT2 A;  3HOY B;  3N52 A;  1EOV A;  4EQP A;  5JJZ A;  3GTQ B;  5CMD A;  3G71 A;  3GTL H;  1MD2 D;  3JAM E;  5C3E H;  2PMZ B;  1V1Q A;  5IYC H;  1JOQ A;  2JA9 A;  2K5N A;  1JJ2 A;  2HIX A;  1AN8 A;  1HCZ A;  2EYO A;  1PVO A;  1EU3 A;  5IGG A;  2PYK A;  1Y8N B;  3PF5 A;  1SAP A;  1YNJ D;  1PRT C;  1WTQ A;  5IT9 c;  4IUV A;  2Q8T A;  3RLF A;  1XNQ Q;  5C3E G;  1DOL A;  3MFY A;  3PUY A;  5CGK A;  3KJO A;  5JVG 3;  3S2D H;  3NXW A;  4MHE A;  4JI7 Q;  4A3J G;  1YHQ A;  2IY5 B;  4LAA A;  5A2Q E;  1E22 A;  2JA5 H;  4JI7 L;  5BN4 A;  4IFD G;  1EQT A;  1FGU A;  5C4J B;  1SNC A;  2FMM A;  4BBR H;  3RR5 A;  4BBS H;  3KFU A;  2PW5 A;  1YJN A;  2A19 A;  3D0F A;  1BO0 A;  2ATW A;  4POG A;  4DR4 Q;  2L11 A;  1K0S A;  4JI8 Q;  3I91 A;  2A1A A;  1W3S A;  1F2L A;  3KBG A;  4DR4 L;  1HUM A;  1F9P A;  4JI8 L;  2AWN A;  2AQ1 B;  1EY8 A;  1Q7Y C;  1WD0 A;  2IPK D;  1AEX A;  1FL0 A; 
#chains in the Genus database with same CATH homology
 2B2W A;  4K5V A;  2EYL A;  2C9O A;  2WAQ B;  2QF7 A;  2B2Y C;  4A3B B;  3JAM L;  3PUX A;  2B2V C;  2K03 A;  1QJO A;  3E6Z X;  1KNA A;  4XIG S;  4RA8 A;  2B2T C;  1PTO C;  1KDB A;  2MPM A;  3MXG A;  3FEW X;  2A68 C;  3SK4 A;  1CZW A;  2KHS A;  5JOB A;  1WTO A;  4J6H A;  2IX1 A;  1LV9 A;  1SE4 A;  3GTO B;  1F9R A;  4R8N A;  3QOJ A;  2QEJ C;  4IFD J;  1DD2 A;  3NTI A;  1D1I A;  1EEF D;  3M4O B;  1GUG A;  4X3K A;  3M85 A;  5C4X B;  5C3W A;  4XT1 B;  1IYV A;  2ZXR A;  1STG A;  4HMJ A;  3V96 A;  3SVM A;  4HCS A;  3NP8 A;  3T4A C;  2PNR C;  2F0L A;  2J0T D;  5T1I A;  1ET6 A;  5C5M A;  3S1R B;  3H6M A;  1B9N A;  1OXS C;  1KAA A;  4IUN A;  4L8J A;  5C6A A;  3MFG A;  1L0Y B;  3D3R A;  4WJW A;  1LTI D;  5G3L D;  3ND8 A;  5E4X A;  1PZK D;  1T5X D;  1XWE A;  2N55 A;  5CYU A;  2NVY B;  3HG9 A;  1K8O A;  1GXD C;  1SNO A;  1SYF A;  4DA2 A;  3GO5 A;  2VB3 X;  4LJZ C;  1G8Z D;  4KY6 A;  1EY7 A;  1PFB A;  4DAY A;  2XSC A;  3IL8 A;  3NSW A;  4C3J B;  2O4X A;  4HED A;  5CV9 A;  1B2T A;  1H9S A;  5G3L F;  1EL0 A;  2AQ3 B;  3MEH A;  2VB2 X;  4XYO A;  4HMI A;  1TWG B;  5IIF A;  1D6E C;  1ZEQ X;  2H1E A;  1SYD A;  1BCP D;  2WP8 J;  4CJ0 B;  3LWE A;  3OMG A;  1Q1E A;  1B53 A;  2HDM A;  4FP5 D;  1SBB B;  2K33 A;  2E2H B;  1NSN S;  3D8G A;  4Z9C B;  5K36 H;  3KLS A;  1LAC A;  3V2T A;  4HTH A;  5EKK A;  2EYH A;  1SNQ A;  1DM0 B;  1TS4 A;  2M9V A;  1EOT A;  3NWS A;  3BVZ A;  5K36 G;  3X3N A;  4FF4 A;  2BCO A;  1BCP F;  1ENA A;  1STN A;  3SEB A;  1E0B A;  3A8J E;  1S4Z A;  1PXU A;  1EEI D;  2EY5 A;  1S5D D;  1T5E A;  5DNF A;  4IUQ A;  5KNC A;  2B2U C;  5KNB A;  3UI2 A;  4F88 A;  2Z4H A;  2EYJ A;  3RMH A;  5F2D A;  1B4O A;  1XX8 A;  1DZ1 A;  3L3O C;  2Q8I B;  1Y8O B;  4G7O C;  2WII B;  3BZD B;  4H13 C;  4WOR A;  3MXU A;  4FXK C;  4QMG A;  3BDL A;  1I4G A;  4KD4 A;  1ET9 A;  1QOH A;  4RFB A;  2K1B A;  2IW3 A;  4QCL A;  2L1B A;  1QB5 D;  3TBI B;  3FPP A;  2EXZ A;  1S5F D;  3GTJ B;  2LKV A;  1FYC A;  4ZKB B;  3OMC A;  3RUZ A;  5IGE A;  3IFT A;  4IFD I;  2A6E C;  4XQQ A;  2F0Q A;  2OEO A;  4LK1 C;  4V0B A;  1LO5 D;  4X3T A;  1CA5 A;  2JYO A;  1HQR D;  4M1U B;  4O1N A;  1CQV A;  4ZRZ A;  4IUP A;  4NDX A;  1TY2 A;  5C4H A;  1J8I A;  1SMY C;  1SFO B;  3DHQ A;  1GUO A;  5I2Y A;  5FO8 B;  1BDO A;  2G9D A;  4OL7 A;  4DNT B;  1PFM A;  4CKB A;  3VA7 A;  3I72 A;  3VR5 A;  3J81 E;  1WTW A;  2E2J B;  2MUY A;  5D3I B;  2D9U A;  2LY7 A;  4NKL A;  1PTO B;  5FK9 C;  1V8Q A;  1QCB D;  4P2C B;  4RGO S;  2RQX A;  2EPB A;  3TZD A;  4OIK A;  2E74 C;  1ZYR D;  3HS0 C;  3T56 B;  3PUW A;  3A54 A;  4KTA A;  4R9W A;  3MZ5 A;  2RDF A;  1JWU D;  1JQY D;  3NBH A;  3GP7 A;  5C3E B;  3C1E A;  1A2T A;  3J81 L;  1SXT A;  5IT9 E;  1HA6 A;  3P75 A;  4F87 A;  1DJR D;  3R93 A;  1A3V A;  2QCP X;  1SNM A;  3S2D B;  1GHK A;  5CBA E;  2QKI C;  4B08 A;  1Y8P B;  2IJ0 A;  3VYU A;  1D5X C;  2NUC A;  5JPM C;  5JEA G;  5EPL A;  2F3W A;  1M8A A;  5LL6 S;  1V1P B;  1VMP A;  1STY A;  3LWU A;  3VR6 A;  4IAL A;  4R8I A;  2HUG A;  4XXE A;  5JPN C;  3X3M A;  1JCK B;  1WTX A;  2HQE A;  3M7N A;  4HAE A;  5IT9 L;  2LFN A;  3OW7 A;  2F4I A;  4RAU C;  1SYC A;  3NQT A;  4KY5 A;  1R9T B;  5FO7 B;  2NVX B;  2RBM A;  4K8J A;  5K5P A;  3QOL A;  1C48 A;  5JVH 3;  1D1K A;  3NBI A;  4IUT A;  1BR9 A;  4IN3 A;  4DAV A;  1A2U A;  1PDQ A;  4FYD A;  1I50 B;  3DWP A;  1I6V C;  5EGT A;  2RSN A;  3CRL C;  5C44 B;  3SHL A;  4ZLT F;  2DNE A;  2SNM A;  5JEA J;  3EA6 A;  4RGM A;  2MP1 A;  2F0T A;  1WTP A;  2ICI A;  5EPK A;  1ROD A;  1NCV A;  5C3X A;  5CV4 A;  3MHB A;  3K5L A;  3NWT A;  3BDO A;  3OOC A;  4DGZ A;  1LT4 D;  1B1Z A;  1B9M A;  3S1Q B;  3I8Z A;  3A7L A;  4DU9 A;  2WKC A;  3D6C A;  3K5O A;  2L4N A;  3FMC A;  3QB3 A;  4ZK9 B;  1MI2 A;  1H9K A;  5ELB A;  1S5B D;  4BY1 B;  1JWS D;  3C1F A;  5ISR A;  4RGT A;  4RHS A;  1QIL A;  4LMQ D;  3ERQ A;  4K6D A;  3G6J B;  1RDP D;  2PO4 A;  3Q6S A;  3VYR A;  5HGT A;  3NTH A;  1JE4 A;  3R3O A;  4ZKC B;  3OHX C;  3TN2 A;  1TKW B;  3TP5 A;  1DXM A;  3P7J A;  3URY A;  3SR1 A;  1EYD A;  3GV3 A;  1HPC A;  4F8M A;  1WTR A;  1S5C D;  3E0J A;  1YNN D;  3HOW B;  4TSS A;  2FMC A;  2WV6 D;  4KV6 A;  3MXP A;  1QE6 A;  5CV5 A;  3ITP A;  3OPO A;  1BCP C;  5DEH A;  1ZXT A;  1SE2 A;  1H9J A;  1EYC A;  4DF7 A;  4UAI A;  5LHY 1;  3BVG A;  2IX0 A;  2F0I A;  4TQU S;  3S1M B;  3DM1 A;  1QNK A;  3GQB A;  1Y1W B;  5M5Y B;  2BE5 C;  3FPU B;  2R6G A;  4TKO B;  4XT3 B;  1IW7 D;  4B9W A;  2ENB A;  1O7Y A;  3S14 B;  4GZY C;  3T51 B;  5KYL A;  4Q5V A;  2A73 B;  3VA5 A;  2NZ1 D;  3ND9 A;  4DN4 M;  2LS0 1;  4KHV A;  3V05 A;  4PQX A;  1SYB A;  1O7L A;  4OHJ A;  1X32 A;  4ZAI A;  5CV8 A;  1HFN A;  4FVM A;  1KDA A;  3L9A X;  2MGS A;  1F2M A;  2E76 C;  1Q8I A;  3OIQ A;  1NAP A;  3Q0A A;  5ELF A;  3PMF A;  3I73 A;  1FNV A;  2IX3 A;  2R92 B;  4C1N K;  4QUF A;  4CJ1 B;  2F0D A;  3TP8 A;  4KY7 A;  1D5M C;  2RDG A;  1EIH A;  1EZ8 A;  4FF2 A;  3TP6 A;  3TSS A;  2OT2 A;  3HOU B;  1BNZ A;  3HOX B;  4A3K B;  2G9H D;  2X6L A;  3GTP B;  4XQJ A;  2EY2 A;  3CHB D;  1OXV A;  3QIA A;  4HR7 B;  2EJM A;  5EQ0 A;  1WD1 A;  3DWQ A;  4L63 B;  2KQ3 A;  5ELD A;  5J22 A;  2A74 C;  2K32 A;  3K5M A;  3CQZ B;  3KF8 A;  4RH6 A;  3A55 A;  2K5W A;  5C0X H;  3W3A A;  1LAB A;  4EGV A;  5J1Z A;  1LT6 D;  1PTO D;  1TWA B;  4Q0F A;  5IOD A;  4G4K A;  1DCZ A;  1MSG A;  1TS5 A;  4U68 A;  1ILP A;  4NMZ A;  2K05 A;  2KEC A;  2SOB A;  3I90 A;  1CQF A;  4EVO A;  1IKL A;  4FNF A;  4A3F B;  1V43 A;  2KA7 A;  1GUN A;  2BDO A;  2J4X A;  5EJW A;  2MJ8 A;  1VDZ A;  3BYT B;  4DK1 A;  1CFM A;  1Q90 A;  2KCN A;  3CRK C;  2F0O A;  1QG7 A;  5I9P A;  1JOK A;  5CV7 A;  2XN9 C;  2B2W C;  1I4R A;  3PUZ A;  3BYY B;  4C3H G;  1PTO F;  3RZD B;  2Z8L A;  5KIX A;  3SDZ A;  1EY5 A;  1CI3 M;  4G7H C;  3F2U A;  4FXD A;  2F0J A;  4CGY B;  4BA1 I;  1ZYR C;  4XTC S;  1CM9 A;  3J7A V;  4HN7 A;  4E6I A;  3K6O A;  1LTA D;  3Q23 A;  1IYU A;  1TWF B;  2YU9 B;  1STE A;  4ZUJ A;  2L55 A;  5I6Y A;  1E2Z A;  3C3L A;  3PIP 3;  2AQ2 B;  1BOS A;  1VF5 C;  5EBC A;  4C3I G;  1AZQ A;  1O78 A;  1HQM C;  3MVV A;  1SSO A;  2L5T A;  1IHZ A;  1D2B A;  2F0S A;  4Y7N B;  3T53 B;  4G7Z C;  3C2P A;  1PRT B;  1EWH A;  4G57 A;  1ZKO A;  3NE5 B;  1SJE D;  1LT3 D;  1R4P B;  3VR2 A;  1LT5 D;  3Q24 A;  1I6H B;  1EQV A;  2NVT B;  1I4H A;  4DFA A;  1JIC A;  3I70 A;  1F77 A;  2KVM A;  5M3M B;  3H0G B;  3FDT A;  1SJH D;  3GD7 A;  3H94 A;  5EKL A;  4ULL A;  3K58 A;  4J8Q A;  3PUV A;  2TSS A;  3FRP B;  3DEO A;  4I65 A;  2K6A A;  1B50 A;  2MHV A;  3H09 A;  4A3E B;  3OWF A;  3S15 B;  4HCE A;  3C46 A;  4K2K A;  4RCN A;  3SK8 A;  3HP3 A;  1HRJ A;  5I6W A;  2EE1 A;  2NYZ D;  1IKM A;  3DWA A;  1BCP B;  3GTG B;  1NR2 A;  2A5H A;  2F0U A;  2RSO A;  4PMC A;  2BOS A;  1TS2 A;  4F7X A;  3I4M B;  1TR5 A;  1WTV A;  1KLU D;  1CHP D;  1LTR D;  2EYF A;  2XIW A;  1SDF A;  3QWN A;  2DNC A;  4EQN A;  1LTT D;  2PPB C;  2F0M A;  1PZJ D;  3EVQ A;  1I4P A;  5M5X B;  5A35 A;  3BVM A;  1DYQ A;  1SEB D;  5M9O A;  2K28 A;  1U9R A;  4BY7 B;  4AYB B;  3LX0 A;  1Z47 A;  4RCO A;  3GTL B;  1AZP A;  1GOZ A;  4DXF A;  2F0H A;  4I7Z C;  1DOK A;  1Y69 U;  5BN3 A;  5FLX E;  2B2Y A;  3M7G A;  1JOO A;  3KLR A;  3IAY A;  2KOL A;  2L12 A;  3DMU A;  2B2V A;  3KBX A;  2RDH A;  3T16 A;  1FD7 D;  1QNU A;  1EIG A;  1YNJ C;  2O5I C;  1V1O A;  1FNW A;  2JA5 B;  4ILW A;  2FFK B;  2B2T A;  3S9W A;  1B44 D;  4CKE A;  2EZV A;  4NW2 A;  4BBR B;  4BBS B;  2A69 D;  3SK5 A;  3EQL C;  1TY0 A;  3BG3 A;  3MC0 B;  1RTN A;  1VMC A;  2F0P A;  1FR3 A;  2PZU A;  5DM7 3;  1AP0 A;  1LLR D;  5E3F A;  3HZX A;  4FXG C;  5I9O A;  2F0E A;  1VF7 A;  1SE3 A;  4JK1 C;  2XWB B;  1KLG D;  1F2Y A;  5T1G A;  2D2C C;  4WRD A;  2XRQ D;  5FLX L;  4TRD A;  3VYS A;  3TP7 A;  4X3S A;  5C5L A;  5I4D A;  1EFI D;  1U4M A;  2BA1 A;  3K7A B;  1KDC A;  2CW0 D;  4YIJ A;  1S5E D;  4K5W A;  4C2M B;  1RKN A;  4FF3 A;  2XWJ B;  1WVL A;  3D4R A;  3VR3 A;  1GJX A;  2JEA I;  3I4N B;  1W6J A;  3DXJ C;  4L6T B;  4XDX A;  2ZXO A;  4KJN A;  1EY6 A;  3K5N A;  3SE0 A;  4KKS A;  5E4W C;  2JE6 I;  4ODG A;  4ID6 A;  3S16 B;  1SND A;  3QO2 A;  4RKL A;  1V1P A;  5JAV A;  2A6H D;  4ZYS A;  1O80 A;  3MXN A;  3HRZ C;  1ILQ A;  3D31 A;  3KLS X;  2F0F A;  2F0V A;  2EVB A;  2ZT9 C;  1JB3 A;  5EPJ A;  1JC7 A;  2QIL A;  5CR3 A;  1HTL D;  4PMW A;  2EY1 A;  1PZI D;  5KEE A;  3IFD A;  2L0C A;  3WOE A;  3A56 A;  3D6W A;  3M3Y B;  2B39 A;  3KUP A;  1VCI A;  1KNE A;  5DM6 3;  1BF4 A;  1ESF A;  1G29 1;  2ID0 A;  1PMR A;  3NHH A;  3ONA B;  3FKI B;  3D4D A;  3K0Y A;  3S1N B;  1MGS A;  4IFD H;  4KI0 A;  2DY7 A;  1I4Q A;  1C4Q A;  5CC4 A;  3J7Y W;  4MIU A;  1PYW D;  5FOB B;  2NVQ B;  2R3Z A;  4A3G B;  3TZU A;  1MSH A;  2CHB D;  1Q12 A;  2FIN B;  3PO2 B;  2B63 B;  2Z1C A;  2R7Z B;  2KCC A;  4OIJ A;  3J7A F;  3MWY W;  3R2T A;  4IZ8 A;  1BQQ T;  2NN6 H;  2IT1 A;  1U4L A;  1HTP A;  2B2U A;  2F03 A;  4HSV A;  5FKA C;  5ELE A;  4QUC A;  1FGB D;  1G91 A;  5KGU A;  1NR4 A;  1CK1 A;  2QDB A;  2NN6 G;  2EY6 A;  1STA A;  4ZUI A;  2CQA A;  3NQI A;  2PZT A;  5D3D A;  1CA6 A;  1TU2 B;  5TSS A;  3R8B A;  2I46 A;  5BN5 A;  5M3F B;  1BXT A;  4C3H B;  5A2Q L;  2F0G A;  4BS9 A;  5M5W B;  1F9Q A;  1EU4 A;  3WDN A;  2WIN B;  2B8G A;  1GUW A;  4H0L C;  4KKT A;  5J39 A;  2PZW A;  1GUS A;  1UAP A;  3RZO B;  4K2L A;  4O42 A;  1G2T A;  4KHZ A;  3CU7 A;  3ERO A;  1ONL A;  2NB0 A;  3NK9 A;  1ENC A;  3AU7 A;  2RA4 A;  1H9S B;  3QJY A;  3DUZ A;  1U4P A;  2GA4 B;  5I2X A;  1I4X A;  2K5Q A;  4DXG A;  4C3I B;  4H7B A;  3VYT A;  2F0W A;  1G6Z A;  2M2L A;  5COY A;  2VXW A;  1UNS A;  3HGB A;  1TQO A;  1XYI A;  2PQE A;  4J1M A;  1STB A;  1BUV T;  2KUM A;  5IGC A;  5IGF A;  4HSP A;  3EJI A;  1PRT D;  2VNU D;  5IGB A;  4MN3 A;  1CTM A;  3I4L A;  3MAQ A;  3AMU A;  4QF4 A;  2HDL A;  1XXG A;  3IKJ A;  2AUK A;  3SXH A;  3H3V C;  3OWE B;  4OO1 H;  2PCF B;  1WCM B;  4CJ2 C;  2D62 A;  4KD3 A;  4BA2 I;  2K04 A;  2KJX A;  2ICE C;  2R93 B;  1GUT A;  5IOC A;  4OO1 G;  2HCC A;  2WKD A;  4EQO A;  1EZ6 A;  1PRT F;  4PMB A;  1Y1V B;  3U9O A;  1W6K A;  3GTK B;  1SNP A;  4ZQ3 A;  3K57 A;  2JXM B;  2C5C A;  3ZYY X;  5KND A;  5LL6 X;  2K5D A;  3A8K E;  1RD9 D;  2F0N A;  2A68 D;  1UUP A;  2VUM B;  1OO9 B;  2OF1 A;  1FNU A;  2I07 B;  1RCV D;  5C0X G;  1QWY A;  3OIP A;  4B9X A;  1D5Z C;  1X3P A;  3HOV B;  2BE5 D;  2ZXP A;  2BDN A;  4CBV A;  4KN7 C;  5C4Z A;  4H44 C;  2SEB D;  4K8I A;  1CHQ D;  5DAU A;  2Z4I A;  2D5D A;  1IL8 A;  1ICW A;  2NWG A;  3PV0 A;  4IQZ A;  3L7Z C;  1RF2 D;  3HKZ B;  3P20 A;  1XTC D;  1L0X B;  1RTO A;  3I3C A;  3BDC A;  4V19 0;  4S3S A;  5AFW A;  1JOR A;  4IUR A;  5CV6 A;  3DEP A;  3K59 A;  1RHP A;  1G2S A;  5COR A;  5EKI A;  1II3 A;  4KKU A;  4PV1 C;  1HA5 A;  3P1H A;  1NUC A;  2V4D A;  2XVS A;  4KJO A;  4K14 A;  4RHR A;  1KTK A;  2AWO A;  5C0X J;  1J9O A;  4DAP A;  3G7L A;  1Z6H A;  1H9M A;  2FJ2 A;  4FO2 A;  1E2W A;  3EFX D;  2KEE A;  1RJT A;  1AFP A;  1E2V A;  2H4O A;  3OSO A;  2AUJ D;  4JBW A;  2SDF A;  4N9P A;  2Y0S B;  3GV6 A;  2A69 C;  1Z7T A;  3GTM B;  3M4Y A;  4KMU C;  5NUC A;  3PO3 B;  4K6L A;  1EYA A;  1R4Q B;  2E75 C;  2HCI A;  4PNY A;  1HXY D;  1K8M A;  2WAC A;  3A7A B;  1SYG A;  1F2Z A;  4N9T A;  3S2H B;  3KK7 A;  3WOF A;  4XQN A;  1TVX A;  2EJF C;  4ABN A;  2YYZ A;  3T13 A;  2L9H A;  2F0K A;  4C3J G;  1ENF A;  2JA8 B;  1SYE A;  1GHJ A;  5E1F A;  1Q3L A;  3FVQ A;  4DNR B;  2OXP A;  5ELC A;  3S17 B;  1PLF A;  2EYP A;  3VR4 A;  2XRS D;  2E2D C;  3U9S A;  3J80 E;  2RVL A;  4C1N I;  2CW0 C;  1EY0 A;  2JA6 B;  4KN4 C;  1A15 A;  1OXU A;  2NN6 I;  1LTS D;  3MTS A;  2EOT A;  3LNN A;  4C56 C;  4A93 B;  2J7Z A;  4A3D B;  2TMP A;  1AW7 A;  5CBE E;  3NTK A;  1EY4 A;  2B8F A;  1U4R A;  1KAB A;  2PW7 A;  1DON A;  4KK7 A;  2N88 A;  1CZG A;  2A6H C;  5EBD A;  4RGN A;  2RKS A;  1UEA B;  4CKC A;  1TII D;  1M4V A;  3N6R A;  3W2D A;  3HOZ B;  2IL8 A;  2NBF A;  2R61 A;  2KED A;  1HUN A;  1A3U A;  1TWC B;  2WB1 B;  3R2I A;  1X3Q A;  4XYQ A;  2E2I B;  3J80 L;  1HFG A;  1I3Q B;  2JA7 B;  4BWG B;  2EJG C;  3AB9 A;  5FO9 B;  2O5J C;  3HEJ A;  2BA0 A;  3MA2 B;  4A3J B;  4RWS C;  1PFN A;  2EDG A;  3NUC A;  1EY9 A;  2JP1 A;  5JEA H;  1JWM D;  2X6G A;  4DK0 A;  2X69 A;  2A6E D;  2JSO A;  1CT1 D;  3SK6 A;  3RD4 A;  3TME A;  3E5S A;  1A6X A;  3A8I E;  3PIO 3;  2DN8 A;  1OXT A;  4FF1 A;  4ME5 A;  2XNA C;  1DOM A;  1EWC A;  2K01 A;  1MBY A;  2O2L D;  4IUU A;  1LTG D;  2Q8R E;  3H91 A;  1ESR A;  5KRU A;  4A3M B;  1A3T A;  3NPP A;  4OO1 I;  1K83 B;  1LTB D;  2CVR A;  1YNN C;  1SMY D;  1BBX C;  2NTS A;  1F9S A;  4A3I B;  4M8A A;  2K7V A;  1TWH B;  1C8C A;  5KYI A;  4QB4 A;  4QIW B;  2F1M A;  1STH A;  1B3A A;  4UDU C;  4RKB A;  1IW7 C;  4K5X A;  1TS3 A;  2M00 A;  5C0X I;  3CKI B;  2NTT A;  2FHT A;  2IWH A;  2EYM A;  1H9R A;  3BS1 A;  1PTO H;  3QG1 A;  2F3V A;  4X3U A;  2SNS A;  1O7Z A;  5IGD A;  4WFN 3;  2JEB I;  2DY8 A;  5D14 A;  4U67 3;  1JR0 D;  1ML0 D;  4NP5 A;  4OGQ C;  1HHV A;  3O13 A;  1Q1B A;  3D4W A;  2LMC B;  3TDQ A;  5HUR A;  1OXX K;  3Q22 A;  4CHT B;  3HOY B;  5D65 A;  1TT2 A;  3N52 A;  4EQP A;  5JJZ A;  3GTQ B;  5CMD A;  1MD2 D;  3JAM E;  2PMZ B;  1JOQ A;  1AN8 A;  1HCZ A;  2EYO A;  1EU3 A;  5IGG A;  2PYK A;  1Y8N B;  1SAP A;  1YNJ D;  1PRT C;  1WTQ A;  4IUV A;  2Q8T A;  3RLF A;  1DOL A;  3MFY A;  3PUY A;  5CGK A;  5JVG 3;  3NXW A;  4MHE A;  4LAA A;  5A2Q E;  5BN4 A;  4IFD G;  1EQT A;  5C4J B;  1SNC A;  2FMM A;  2PW5 A;  1BO0 A;  2L11 A;  3I91 A;  3KBG A;  1F2L A;  1HUM A;  1F9P A;  2AWN A;  2AQ1 B;  1EY8 A;  1WD0 A;  2IPK D;  1AEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...