3KBXA

Human macrophage inflammatory protein-1 alpha l3m_v63m
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
AADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYMSDLELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCL3
publication title Structural basis for the oligomerization of macrophage inflammatory protein-1 alpha
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 11
structure length 66
sequence length 66
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3kbxA00
5T1GA 3DM1A 2RSNA 2L1BA 4OIKA 2B2VC 1S4ZA 2HCIA 3FPUB 1IKLA 1X3QA 3IFDA 1BF4A 1HFNA 1WTRA 1JE4A 2K03A 1CM9A 3D6WA 3TZDA 1WD0A 1PFNA 1HRJA 1PFMA 1LV9A 4X3SA 4CJ0B 1WTQA 1HA6A 4ZKBB 2RA4A 1XYIA 1ESRA 1F9SA 4MHEA 2XIWA 1EQTA 1O7ZA 2K01A 2VXWA 1PFBA 3MWYW 4IURA 1KNAA 4R9WA 2L12A 1F9RA 1JICA 2FMMA 1HHVA 2CVRA 3MTSA 1BNZA 1MSHA 4RWSC 1PDQA 2B2WA 1A15A 2KVMA 5E4WC 4CJ2C 1J8IA 5D14A 2JP1A 2L11A 3FDTA 3HP3A 1ILPA 1SAPA 1SSOA 2KEEA 5COYA 5EKIA 1MGSA 1DZ1A 2MGSA 2DY7A 3DEPA 1ML0D 2RSOA 3H91A 1HUNA 1DOLA 1EIGA 1O80A 4OIJA 4CJ1B 1KNEA 1NCVA 2DY8A 2EPBA 4RA8A 1RTOA 1U4LA 1NR4A 1X3PA 2FJ2A 2J7ZA 3Q6SA 4XDXA 5DNFA 4R8IA 1WTOA 2B2VA 1AZQA 2HUGA 1RJTA 4HAEA 1NAPA 3KBXA 2B2UA 2HCCA 2N88A 2B2TA 4ZLTF 2MPMA 2FFKB 2L9HA 3I8ZA 1WTXA 2SDFA 5CORA 1WD1A 1CA6A 3SVMA 1CA5A 2HDMA 4HSVA 5T1IA 5JJZA 3KUPA 3F2UA 2KEDA 4XT3B 1WTWA 1WTPA 5EPJA 2L4NA 2B2YC 1DOKA 5D65A 2Q8TA 1RHPA 2EE1A 1M8AA 2MJ8A 2RVLA 3P7JA 1G91A 2IL8A 1BO0A 4QUFA 1QE6A 1U4PA 2MP1A 2NZ1D 4IUVA 1IL8A 4QUCA 1F9PA 2KUMA 2FHTA 2R3ZA 2NWGA 1J9OA 3G7LA 2B2WC 3LWEA 1B4OA 4X3TA 1IKMA 4X3KA 1B53A 5CBEE 1F2LA 1U4MA 2Q8RE 4XT1B 4DN4M 5EQ0A 1RTNA 2BDNA 4IUPA 4IUUA 4LMQD 5CBAE 2K28A 2D9UA 5EPKA 1XX8A 1B2TA 3DEOA 4HEDA 4IUTA 1HUMA 1C8CA 5EJWA 2X6GA 1ZXTA 1DONA 2KOLA 2X69A 1GUWA 3I3CA 1VMPA 1TVXA 1BBXC 1EL0A 1DOMA 1EOTA 4UAIA 1WVLA 1O7YA 1F9QA 3QO2A 5AFWA 1G2TA 1Q3LA 1VMCA 1QNKA 2NYZD 1X32A 3UI2A 2K05A 2N55A 2EOTA 2B2UC 2K04A 5CMDA 2B2TC 1RODA 1AP0A 1ILQA 2H1EA 3GV3A 2B2YA 2KECA 3R93A 2X6LA 1U4RA 4HCSA 4X3UA 1SDFA 3GV6A 4O42A 1G2SA 4NW2A 5EPLA 1WTVA 4ZKCB 2K1BA 2JYOA 5E4XA 4U68A 1B3AA 1QG7A 4ZAIA 1PLFA 3ONAB 4MN3A 3TN2A 1G6ZA 3I91A 3I90A 1MI2A 1HFGA 1AZPA 1EIHA 2M2LA 1E0BA 2HDLA 4IUQA 1ICWA 1B50A 3IL8A 2FINB 3N52A 1NR2A 4RAUC 4ZK9B 1MSGA
chains in the Genus database with same CATH superfamily
4MIUA 3T51B 5I6WA 2B2VC 2Q2TA 1TWHH 1X3QA 4A3CH 1SMXA 2QEXA 3U58A 1F2MA 3TS0A 2EJMA 3BZKA 1GUTA 1PH9A 4O2DA 1UEAB 2K32A 4APVA 4EQOA 2VQEL 4A3DH 3I56A 4HIOA 2WB1G 3PIO3 1WCMB 1ET6A 3BDCA 3OYYA 3SK6A 5IYDH 2F0WA 1BNZA 4J15A 3L3OC 1UEBA 4JI5L 3TDQA 3K5NA 4Q5VA 4UDUC 3QOLA 2CW0D 5EJWA 4JG2A 1B8AA 4XYOA 3Q6SA 5E3FA 1Q8IA 4BY7G 2BA1A 4DV0L 5FK9C 4DK1A 4LJZC 3T1YQ 1E2ZA 4ZLTF 5M5YB 3S1NB 3T53B 2F0HA 1EYAA 2VB3X 2MNAA 3KLSA 1SRUA 4AYBE 1RIPA 5A2QL 1CKMA 1VQ9A 5EPJA 2B2YC 1DOKA 1RHPA 2MJ8A 3AQQA 2NN6G 3E0EA 3NTHA 4R4OA 3E5SA 1L0YB 2JQOA 3K81C 2PI2A 5DLQE 3IFTA 3I4OA 4QMGA 2EXZA 4WRDA 3MXPA 3F2BA 4LMQD 3OTOQ 5C0XI 1NNXA 5I2XA 4QIWE 3MZ5A 5LMNQ 5I2YA 3KYHC 1QZGA 3I3CA 1TVXA 1EL0A 1ASYA 3HOYH 1KRSA 5ELBA 4F88A 3S1MH 1X3GA 1GVPA 2N55A 4QY7A 5IIFA 2AWNA 4ULLA 2H1EA 4BY1B 2KECA 4X66Q 3PSIA 1KAWA 3T1HQ 4K2LA 3IAYA 2JJQA 5AJ3Q 2KCCA 2EYJA 3MEFA 4JW0A 2GN5A 1ZKOA 3I4MB 1PFSA 1JC7A 1SNPA 5EKKA 3E0JA 1SFOH 1EUJA 1K8OA 4EVOA 1ICWA 2AMCB 4JPBW 1YHAA 2BCOA 1JE4A 5BR8Q 2E2IH 1K3BC 4PNYA 4H7BA 1EIFA 1L0XB 4C2MH 5IP7G 4NXMQ 4P72A 2QA4A 4A3GH 4F7XA 4U673 3BYYB 4RFBA 4C3IG 1YIJA 2PZUA 1K73C 3PO3H 4CDEC 3NP8A 2SEBD 1HHVA 3BDLA 1M4VA 1SEBD 4JI3Q 1PA6A 2A69D 1PMRA 2KENA 1NTGA 4HIDA 4A3KB 2HIXA 5GAEC 3F2DA 4DAVA 3CP0A 5I9OA 2K52A 1A3UA 4JV5L 1M90C 2H4OA 2EJGC 3J81c 3HOVB 5DNFA 3CMAA 1D8LA 1VDZA 2PO4A 4DV7Q 4B3TL 3KBXA 1HTPA 4C3HH 4DV1L 3TSSA 2HHHL 1WFQA 1FNUA 2PNRC 1WTXA 4OONA 2IT1A 2E2JB 3M4YA 3UE1A 4DR6Q 4LW1A 3CAMA 5NUCA 5CV5A 1TKWB 2EY6A 5K36H 2OXPA 2KHJA 2PI2E 2EYOA 5JEAG 3EJIA 4LF9Q 1SYGA 4X3TA 1WCMG 4ME3A 4G57A 3TS2A 1DM0B 3A7LA 3GD7A 3C46A 4BXXH 3LX0A 3KLSX 3UDGA 1SJED 1Y1VH 1DOMA 1EOTA 4JI8L 2UXBQ 1O7YA 4FXDA 5AFWA 3L2PA 2B63H 3LWUA 2ATWA 2YTYA 4GN3B 1SMYD 4YCUA 2K4KA 3E6ZX 2VUMH 1D7QA 1HXYD 1CKOA 4BBRB 4QB4A 1IYUA 3FPPA 5M9OA 5J1ZA 5E4XA 4DR3Q 1HQRD 4DV3Q 3S9WA 4ZRZA 1CKNA 2Z8LA 5C0XG 1STHA 2JA5H 3K80C 3VDYA 4AQYQ 2Q2HA 1IHZA 5GAHC 3ICEA 2CW0C 4IUQA 1YNJD 2OTLA 4POFA 5C3XA 2V1CC 2NVXH 1S4ZA 3DXJC 1CKNB 4XYQA 1S40A 2CWPA 4ME5A 1N34Q 4NMZA 1TS3A 1PYBA 3BG3A 3DUZA 4X3SA 1PV4A 3QB3A 3HKSA 1YITA 3A54A 1KDBA 4DUYL 3ULJA 2UXCQ 5FLXc 3TP8A 1RCVD 2CH4A 2CVRA 3PCOB 2K5DA 4YHHQ 1SXTA 5D14A 2QF7A 1JR0D 1SNCA 3NBHA 4YWMA 1DZ1A 5C44H 3RZOH 3OOCA 4PZ8A 3H0GB 3CQZB 2HT1A 1HNZL 4ALPA 3W1GA 3KDFB 3RMHA 3PIPA 4R8NA 5ELEA 1DCZA 3NBHB 2HUGA 2Y0SB 1N36L 2NVTB 1EWIA 4B9XA 4LF7L 1YHQA 2DUDA 3D3RA 3I4MG 1NE3A 3TZUA 4KY6A 2LS01 5JVG3 2IPKD 3J7AV 2O4XA 5ELDA 2L55A 2CWAA 3OWFA 1PRTF 3JAMi 4YWKA 1BBWA 2F0IA 4C56C 1BO0A 2MP1A 1XTCD 3RUZA 1ASZA 2F4VQ 3CCSA 2SOBA 3SHLA 1KHIA 2UU9Q 4LF8Q 1J9OA 1EYDA 1I4RA 2XGTA 3R2IA 2F0VA 4ZQ3A 3ULLA 3S17B 4MZ9A 1XJVA 1TWGH 1OXVA 3A55A 4A3KG 4R1JA 1GM5A 1RDPD 3M4OB 1GD7A 4IO9A 1TT2A 2WV6D 4RCOA 1IBLL 4A3FG 4IFDJ 1C0AA 4IQZA 3CKIB 4KV6A 1PZID 5FLMH 2JA6B 1SDFA 3K7UC 2A69C 1BVSA 1HNWL 4IZ8A 1S72A 3I70A 4B3ML 4A93B 4A3EB 2EDGA 1R9TH 2Z6KA 1PTOF 1LT4D 1SLJA 3H94A 3FPUB 3URYA 3S1RH 1L1OC 4GLAC 1MKHA 4C3JB 1WD0A 2A19A 4XXEA 1BCPD 3NHHA 1HA6A 5C4HA 1EY8A 3C1EA 3KOJA 1TS2A 3MXGA 4A4IA 1BR9A 4PZ7A 5FLXL 4FYDA 1QJOA 4YWLA 2MUYA 1MSHA 5HY6A 3GTPB 2VY3A 3NTKA 4OGQC 3VR4A 4EQNA 1NMGA 4NKLA 3NE5B 1TWHB 1L0WA 1I3QH 2XNAC 5M3FG 2KEEA 3AFQA 1VQNA 1I6VC 4A3JH 4DAYB 1JWUD 1O80A 4A3DB 1R4PB 1CK1A 1NCVA 3S2HH 4JK1C 1W2BA 4JI6Q 4RA8A 4BBRG 2O5JC 1KD1C 4R8IA 3IRBA 5KNBA 4GNXC 2N88A 4B3SL 2L9HA 2NTTA 1X6OA 5ELNA 1VQFA 4DR4L 3F2UA 2F0MA 3DLLA 3ND9A 1OO9B 1BQQT 3SGIA 1XXGA 1SYBA 3DWQA 4FF3A 3W3AA 1E3PA 5GQOA 4CKCA 4QUFA 4IUVA 3JAME 4DUZL 1Y69U 1F9PA 3NWSA 3PO2H 1VF5C 4B9WA 3MEHA 1LTID 4X65Q 3JC66 1Y1WH 1U4MA 4CKEA 5CBAE 4WJ3M 1QCBD 1YNJC 2BA0A 4HJ8A 2XVSA 3U4VA 4PQXA 1D2BA 1QVFA 2XN9C 1UNSA 4TVAB 3LGJA 1DONA 1TS4A 4L6TB 2VL6A 4OELB 1BBXC 2XRSD 3M7NA 4KKUA 1H9KA 5DM73 1WVLA 3BJUA 3S15H 2NZOA 1EQQA 4DK6C 3GTKH 2O2LD 2PMZB 1QNKA 3J80E 2C5CA 1VQBA 1LTSD 1V9PA 2R92G 1PYSB 4DR7Q 4IFDH 1SE2A 3A74A 2BH8A 2ZT9C 2Y0SG 4LFAQ 3CPFA 4KTAA 3D6CA 4L5TA 3TP6A 3DWPA 3T1YL 4DAMA 3HOYB 4MN3A 4K6LA 3TN2A 4LF5L 1TQOA 2QEJC 3M85A 4H0LC 4FXKC 1VQPA 1HZBA 2Q8RE 2A73B 4OIKA 5G3LD 1HR0W 3SEBA 2K03A 4JI0Q 3HOWH 1C9OA 4EQ5A 2WKDA 1F9SA 1S5FD 1SROA 1EQTA 1KNAA 1K0SA 2F3WA 1YZ6A 2QCPX 2LXKA 1TWAH 5FJ8H 1XWEA 3PUXA 5LMNL 3Q24A 5H1SE 4OO1H 3HP3A 1UE5A 1SSOA 3AB9A 2N49A 2L15A 3P1HA 1EYGA 4A3GB 2JA6G 3OPOA 1LT6D 4X66L 4OEMB 4IALA 2DNEA 4A93G 2MPMA 5AJ3L 3I8ZA 1HR0Q 2UUBQ 4HJ5A 4HSVA 1E2VA 3R2TA 2Z1CA 3M9BA 1K83H 1FJGQ 5JJKA 3HKZG 3K7AB 3PUVA 1PVOA 1LLRD 1QVCA 4TQUS 3S14H 3KFUA 1FD7D 3L9AX 1QE6A 4C3JG 1HQMC 4DR2Q 1P8LA 1YJNA 5ISRA 4JI7L 3ND8A 2K50A 5CV8A 5BR8L 4C3HB 2HD3A 1Z7TA 1VQAA 2FMCA 2PMZE 1D5XC 2WINB 1HNXQ 1L1OA 4NXML 3L0OA 4DV2Q 1LTRD 4HJ9A 3F8TA 4DKAC 1BCPC 3OW7A 4KI0A 3GTJH 3O13A 4L5SA 4A3CG 3QO2A 1E24A 1WTHA 1L1OB 1NY4A 3T16A 1D1KA 1VQKA 4A3DG 3A5UA 2XTIA 3S2DH 1JOOA 3PIOA 2A68D 2OT2A 4HSPA 4R4CA 2L0CA 5IYDG 2R7ZG 1G2SA 4HMJA 2VQFQ 4DV7L 3SE0A 4JC0A 2LMCB 4C1NI 2E5LQ 1LTBD 2N3SA 5IGEA 2E2HH 2WKCA 3PUWA 2ZTEA 2LKVA 3FEWX 2B63B 1NR2A 3N6RA 1MSGA 3EFXD 4AH6A 1VQ8A 2VUMB 1B44D 1IW7C 4I7ZC 4QIWB 4ILWA 5FO8B 5FOBB 2JA7H 3CXCA 4KHVA 4GNXB 5IGDA 3PUZA 3VR3A 4H02A 3M7GA 2R93H 1XNQQ 3A56A 4XQNA 4LF9L 1PFBA 1PZJD 3I4NH 1JWSD 1Q1BA 2JA5B 3CC2A 1EY0A 3CCVA 4RHRA 5E4WC 2NVXB 5HGTA 4DXGA 2WP8J 1MGSA 3NELA 2NVYH 1ML0D 1EFWA 3BDOA 4HCEA 4LF6Q 2OQ0A 2AQ3B 2D0OA 1RTOA 1TY2A 2ENBA 1EQRA 2J7ZA 5CYUA 1RJTA 2OQKA 2PW7A 1H9RA 1VQJA 3HOUH 5F2DA 1T5XD 2R61A 2TSSA 3G6JB 4DR3L 1VQEA 1V1QA 3BS1A 4XT3B 4DV3L 2M9VA 5D65A 5C44B 1VQ7A 3RZOB 4AQYL 3RLOA 2WAQE 2CKZB 1JCKB 1FGBD 3HOXH 2DGYA 3ER0A 5KIXA 3RLNA 5BN5A 4A3LH 2B8GA 1N34L 2B29A 2E2DC 4IOAA 2NBFA 1D6EC 1JWMD 2F0DA 2AHOB 1ZXTA 3GP7A 1SYEA 2UXCL 1A2TA 1Y8OB 1M1KC 3H3VH 1A3TA 3K8AA 5C3EH 4RMFA 2B2UC 1PRTD 3NEMA 3GV3A 3CU7A 1EY9A 3R93A 4A3GG 2XRQD 3VR2A 1D1IA 1B3QA 3HOZG 3NPPA 1SNOA 2JXMB 2PW5A 1ZYRD 2DN8A 4NW2A 5EPLA 3H09A 1MJEA 1DYQA 4A3BH 1LM0A 3CF5A 1QG7A 4S3SA 5JAVA 3I91A 3QR8A 4J1MA 5G3LF 1JJ2A 3EROA 2ASBA 3J7YW 1O7LA 2L1BA 1XMOQ 3IFDA 5JJIA 1XPRA 2F0OA 5DAUA 4DGZA 1HRJA 4LUOA 4DAPA 1WOCA 4C3HG 2AWOA 2F4VL 1OXUA 1VF7A 4GN4B 4JI1Q 2F0EA 5HGQA 1R9TB 2NB0A 4BBSB 1Y14B 5IY0A 2VW9A 2L12A 2F1MA 3EN2A 2FMMA 3TP7A 4F87A 3CCJA 3U9OA 1EOVA 4G7HC 4JI4Q 5K36G 2L11A 3S1RB 1A62A 1RL2A 4PG3A 5IP9G 5EKIA 2RF4A 2MGSA 2DY7A 1PTOD 1ET9A 3EIVA 2F0TA 1LT3D 4AYBG 4KJNA 4A76A 1U4LA 1NR4A 1WTOA 1STYA 4KHZA 1I4GA 2TMPA 4BA2I 3W1BA 3CW2C 3VYRA 4R4QA 1Q81C 4BY7H 1BCPB 1W3SA 1PTOH 1U9RA 2E8GA 3KUPA 3K0YA 1I3QB 2KEDA 2A68C 2B63G 4G7OC 2BH2A 1IYVA 4A3JB 3J81j 3HRZC 2IL8A 2DNCA 2EIFA 3S2HB 1B1ZA 2CQOA 1LTLA 1WI5A 2Z6KC 5CGKA 4GKKQ 3CD6A 1H9JA 2AQ2B 2JA5G 3HEJA 4HEDA 2IWHA 4ZUJA 3KJOA 5CV7A 5IWAQ 1VMPA 1P16A 3ZJYC 3ITPA 4OHJA 2KJXA 3NSWA 3QWNA 3C2PA 2AUKA 2IY5B 4NXNQ 5IT9E 2F0GA 3ERSX 3GQBA 1V1PA 1EY6A 4LAAA 1RODA 1Y1WB 4LFCQ 1EY4A 5M3MB 2MFIA 1EY7A 4IJHA 1AN8A 4HJ7A 2RBMA 4JI6L 2PZWA 1V1PB 3GTGH 3FP9A 1I6HH 5JJLA 4UY8C 2YU9H 3S15B 3BZCA 3GTKB 1EIHA 2HQEA 1VQIA 1T9HA 1I5FA 3U9SA 4ZK9B 4WJ4A 4IOCA 1CSQA 2JA8H 1L2FA 2SNSA 2ZJQA 1CQVA 2RCFA 1PFNA 1N32Q 1JQYD 4A3IB 1JT8A 1PFMA 1UAPA 1K28A 1EZ8A 1HZAA 1K0RA 3MWYW 2BE5D 5IP7H 4X65L 5J22A 1JICA 4C3IH 1CZGA 2KCNA 3KK7A 5HURA 1LTAD 4IFDI 1II3A 4N9TA 5COYA 2PNHA 3MFGA 3ULPA 3HOWB 2NTSA 3V05A 4OIJA 2QKIC 4JCVE 4ODGA 1C48A 1AZQA 1C4QA 3A7AB 2D0PA 4JI2L 4DR7L 4IN3A 2B39A 2B2UA 4K0KL 5K5PA 5C6AA 1TWAB 1PRTC 1KDAA 1JJGA 2E75C 4I65A 1FL0A 1UE6A 1EU4A 4QCLA 2YTXA 2Q2UA 1ZYRC 2P5ZX 3CC4A 4BY1G 4HIMA 4B08A 1ENFA 3T4AC 3JAML 2ZJRA 4ZYSA 4DV5Q 2Z0SA 3G7LA 3TQYA 1JE5A 4JI0L 3K0XA 2VZAA 3AYHB 4IUUA 4HIKA 1XMQQ 4BBSG 3BZDB 1O78A 3QIAA 3E9IA 5EPKA 4OO1I 1WCMH 3DEOA 1WYDA 2UUCQ 2ZXOA 5JPNC 1PH4A 1GHJA 1K83B 2Z4IA 3F1ZA 3GTMB 4HTHA 3S14B 3K5OA 4K5VA 4JBWA 1ONLA 4OWTB 4X62L 3TREA 2F0LA 2K05A 2QDLA 1EWHA 2R6GA 1G291 1NBWA 2K33A 3J80L 4G7ZC 1TWFH 3EVQA 5IYBH 3VR6A 1C7YA 1VQ6A 2F3IA 3BVGA 2XWBB 1S5ED 4KHPQ 3CHBD 4MTKA 1CHPD 3S1QB 2ES2A 3GTJB 5IOCA 1PTOC 5EKLA 4DR5Q 1MI2A 1JB3A 4GS3A 3R3OA 1RF2D 5C0XH 2ZM6L 2UUBL 4A3JG 3J81i 3S2DB 1FJGL 1SE8A 3DM1A 3FRPB 2ICEC 5IE8A 5KEEA 1BBUA 1ZEQX 1XPOA 3CRKC 1LV9A 4DR2L 5KGUA 5E7NA 3HOVG 2N78A 2DJGC 4QGUA 1XNRL 1GHKA 3BU2A 1W6JA 1J6QA 1F2YA 1I4XA 1E2WA 1HPCA 3MTSA 1STAA 1HNXL 1HJPA 2KVMA 4ZCKA 4GKJQ 1STBA 4K5WA 3U4ZA 2K5VA 4CDDC 1FNVA 3X3MA 3DEPA 1ESFA 2JA7B 1Q7YC 3S16H 1Y8NB 1Y1WG 1FNWA 1GUGA 5I9PA 1N9WA 2R93B 5M3MG 2DY8A 2EY1A 2FJ2A 2RKSA 2QDBA 1EEFD 3I4NB 4CGYB 1A8VA 1NSNS 4CHTB 1NAPA 4GLVB 5KNDA 5M5WH 1F77A 1MBYA 1VQDA 1CA6A 2ZTDA 1DD2A 4XQJA 2UUAL 1J5EQ 3PUYA 4ABNA 2NVYB 1Z9FA 3P7JA 1GUNA 4IFDG 4DNIA 2IX1A 1YVCA 1U4PA 3GTLH 4WJWA 4M8AA 4NB3A 4L8JA 4A3IG 3RNUA 2A8VA 4LK1C 5DEHA 1N8RC 5J39A 5JVH3 3LWEA 2HHHQ 1Z47A 2Q8IB 2I0QA 1B53A 1HA5A 3TBIB 3HOUB 2G5DA 3D4WA 4X64Q 1QZHA 2RHSB 4NP5A 3HG9A 2PCFB 1SMYC 4MNOA 1JB7A 3HOXB 1B7YB 5I6YA 4LFBQ 3AFPA 4RCNA 1I4HA 3UI2A 2QGQA 2EOTA 3J7ZC 2BE5C 1LT5D 4A3KH 2K5QA 4YY3Q 2D62A 4X3UA 2JN4A 1TS5A 3GV6A 4A3FH 5BN4A 1IBKQ 3HS0C 1E22A 5FJ8G 1VQCA 2EYMA 5KRUA 3FKIH 5D3IB 3ONAB 3A8IE 4OO1G 1JOKA 3NK9A 1HZCA 4JOIA 5C3EB 1Q12A 3K5MA 1LTTD 1I94Q 3G71A 5GROA 3H0GG 2F0QA 1VS0A 1O7IA 4LUZA 1WTQA 4NDXA 2G9HD 2XSCA 4A3BB 2AQ1B 3MXUA 1PRTB 1G6PA 3H15A 3TP5A 4RWSC 1OXSC 2J4XA 5ELOA 2JE6I 3CCMA 1SN8A 3S1MB 1YJWA 3FDTA 4K2KA 3VYTA 1HTLD 2CHBD 3NUCA 5M5XH 1LUZA 5IYCG 2ZXRA 1NMFA 3M4QA 5M3FH 1EFID 3TEHB 2GVAA 4L5RC 3G6EA 1X3EA 4N8X1 1GOZA 5GAGC 2HIVA 1VQMA 4NPSA 4BBRH 3OMGA 2UXDQ 4C1NK 1BOSA 3K57A 4DV4Q 2SDFA 1SFOB 4E6IA 4EX5A 3OTOL 1STNA 3A8KE 1JMCA 2E2IB 2NZ1D 3G48A 2DJFC 1XMOL 4C2MB 1N36Q 2R3ZA 3SK4A 2RCNA 2I5LX 4RH6A 5C4ZA 3PO3B 4YCWA 1PTOB 4JI1L 2D9UA 2HQLA 1TIID 3T1HL 4IPDA 4V190 4A3EG 1H95A 3MFYA 1YEZA 4IJLA 4CDFC 2K14A 3F2CA 1A6XA 5C4JH 4HN7A 1Q3LA 2JA7G 4PMBA 2K04A 4MTNA 5CV9A 5IT9c 1Q90A 1KRTA 4J6HA 4CDCC 3VA7A 5C4XH 2R92H 2K5HA 3TRZA 2F0SA 2K1BA 2WAQB 5JPMC 2PPBC 2Z9HA 1OXXK 4JVZA 4IPCA 1E0BA 2HDLA 5IGFA 1STEA 1VQLA 4POGA 3OWEB 3N52A 3GTQH 4JI3L 1ILQA 5EBCA 2VB2X 1IBLQ 1ENCA 1G8ZD 1YBYA 1DJRD 1MJCA 1HNWQ 5C5LA 4DXFA 2WFWA 1ESRA 1I6HB 3HOUG 4B3RQ 4GKKL 2YV5A 3A5ZB 1Y1VB 4WORA 1A15A 4BA1I 4A3MH 2SNMA 2E74C 2JA8B 3OSOA 1EQVA 2WB1E 1ILPA 2EY2A 1QWYA 4DR6L 1TU2B 1K9MC 4NXNL 1KNEA 3H6MA 4LFCL 1SYFA 4EQPA 3BYTB 2MO1A 3MXNA 3OW2A 1KQSA 3K59A 3IKJA 3SVMA 2EYPA 4A93H 5T1IA 1JORA 4UHVA 3I55A 5C3EG 2NZHA 3UE0A 1KIXA 4IPGA 4RGNA 1GXDC 1M8AA 3MXNB 1BXTA 1OXTA 2LXJA 1E1OA 2UXBL 4QUCA 2KCTA 2NWGA 1SR3A 3SR1A 1N32L 4X3KA 4JBMA 1KABA 2BDOA 2BDNA 2K28A 2QW7A 4DR4Q 1XX8A 3GTOH 1A2UA 3WOEA 3Q23A 3HOYG 1PXUA 1BKBA 5LMUQ 3W5OA 4EGVA 4ID6A 1QNUA 4H13C 4OX9Q 2K5WA 2NYZD 1KL9A 2F0FA 1LYLA 2E76C 1EU3A 5IT9L 1RKNA 2MQHA 3CRLC 4CBVA 4DR1Q 1NJIC 1N33Q 2OTJA 2F3VA 4HCSA 1SNDA 4KLKA 2R7ZH 3KJPA 4LUVA 2LSSA 4UP8A 1JOQA 5IODA 1VQGA 1G6ZA 3STBD 3PQIA 1B50A 2F03A 1FGUA 1PH3A 5LMNW 1TWFB 1BF4A 4YHHL 5TSSA 3CCEA 3C1FA 3OMCA 5C5MA 2RA4A 1SE3A 3PO3G 2XIWA 4DV5L 2EJFC 4IURA 2OEOA 2VNUD 1AH9A 3A0JA 4LF5Q 2KQ3A 1QVGA 2ID0A 1XMQL 1V43A 1HCZA 1TWGB 4TRDA 2KHIA 2UUCL 1J8IA 3AEVA 3WWVA 4XIGS 4JYAQ 3ERQA 4FF1A 1HUNA 2I07B 1G51A 3Q8DA 4J8QA 4F8MA 2I46A 3D4RA 4X6AH 2A74C 4K8IA 1CHQD 5E1FA 3ZYYX 2C35B 1YNND 3P75A 2UU9L 4LF8L 2WAQG 1U5KA 4A75A 4O0AA 4KHPL 4FNFA 4TKOB 3M3YH 1CA5A 2HDMA 5IGGA 5LHY1 1LABA 4DK0A 4FXGC 4RGTA 2MHVA 4DR5L 3S16B 1K8AC 1B70B 3NENA 1I4QA 2RHQB 2EXDA 1YI2A 5M5WB 3RZDH 5CBEE 1KLGD 4BXXG 1RTNA 3E3XA 5EGTA 2RDGA 1Y1VG 2A1AA 1BUVT 1PH6A 2M00A 2X69A 5A35A 1V8QA 2JA8G 4UAIA 1K8MA 3J7A5 1F9QA 2F0PA 3GTLB 4GKJL 3CCLA 1CFMA 4JI7Q 1SJHD 4PMWA 3RD4A 2B2TC 2OCEA 4DNTB 1PH5A 2VUMG 1AP0A 1XTDA 2Z6BA 2JA9A 1GUSA 4Y7NH 3V2TA 2JEAI 2NN6H 3I73A 2X6LA 3JAMc 3B6YA 4RGMA 4KKSA 4FF4A 1DXMA 1SYCA 5JEAJ 3KLWA 1VQOA 1VQ4A 3HOZH 4KKTA 4U68A 1ENAA 1E7ZA 1V1OA 2EZVA 1I4PA 4ZUIA 1AZPA 3MC0B 2NVQH 5CC4A 3NXWA 4QQBX 4KD4A 2ZXPA 3UDIA 1PH2A 2AUJD 3K7AH 1X3FA 1J5EL 2RSNA 2HCIA 3K5LA 2G9DA 3PO2B 5BN3A 2D2CC 1CM9A 2A6HD 3J80c 1AE3A 1LO5D 1SYDA 2R7FA 3L7ZC 4A3FB 4CJ0B 1IBMQ 4ZKBB 2EY5A 3V96A 3FKIB 3U50C 2B3GA 4LF4Q 1RD9D 1I50H 1KTKA 1JJCB 4X64L 5C44G 1SAPA 3GDEA 5C0XJ 1EYCA 4HMIA 4L5QA 1EIYB 2A6ED 2RSOA 3I2ZA 1DOLA 1CSPA 4LFBL 5IP9H 4CJ1B 1TWCH 1FVIA 4FVMA 4K14A 4XDXA 5FKAC 3KLRA 3E9HA 4YY3L 5FO9B 2B2VA 3SK8A 1GJXA 1IZ6A 5L37A 3DHQA 1KXLA 1WJJA 4YCVA 5A2QE 4DV6Q 1Z6HA 3K6OA 1IBKL 1STGA 4RKLA 3T13A 4DFAA 3J7AF 4KN7C 1AW7A 3C3LA 1CUKA 1WTWA 5M5XB 1MD2D 1G91A 5M3FB 5IYBG 2EYFA 3H3VC 1PYWD 5D3DA 2VQEQ 1TXYA 2VS1A 4KN4C 1GO3E 1VQHA 4Z9CB 1I94L 2H5XA 2B2WC 1B4OA 2B8FA 4DK3C 1A0IA 1F2LA 3STBC 4IUPA 4JOIC 1GKHA 1B2TA 4IUTA 1EWCA 1HUMA 1DGSA 4LFAL 2KOLA 3NTIA 4JI5Q 3RLFA 2EYHA 1X54A 1Q86C 4BWGB 1X32A 4OWXB 5CMDA 4FO2A 1Q8KA 2EVBA 2CQAA 4HJAA 2B2YA 5FLMG 2PQAA 3VYUA 1LACA 4DV0Q 1ICFB 4RHSA 5JEAH 1T5EA 1WTVA 3CPWA 3DWAA 3EQLC 4ZAIA 2PQAB 2UXDL 4R4IA 5C4JB 1GUOA 4DV4L 3OIPA 3I72A 3KDFA 3PMFA 4DF7A 2FINB 3AU7A 5T1GA 1YNNC 1HFNA 5KNCA 3TZDA 3D6WA 2R92B 5C4XB 3J81L 2WACA 2LFNA 5I4DA 2L5TA 1YNXA 4P2CB 4RG1A 2I5MX 2ZTCA 5M5YH 4WFN3 3S1NH 1PDQA 1EZ6A 4CJ2C 1A3VA 3GTQB 4KJOA 3WOFA 1HR0L 1QB5D 2JP1A 1KAAA 1QUQA 2A5HA 4RGOS 3KF8A 2K6AA 4H44C 2R7DA 1X3PA 1QUQB 4YIJA 3G4SA 3VA5A 4P73A 4O1NA 1F2ZA 3KF8B 1Y8PB 2B2TA 3NBIA 3WDNA 5IGBA 2OWOA 3BVMA 3KF6A 3D0FA 2E2HB 4A3MB 2J0TD 4FF2A 3J80i 5EBDA 2RDFA 5JJZA 4DV2L 3SDZA 2L4NA 2Q8TA 3MAQA 3P20A 5EAYA 4DNRB 3KF6B 4HR7B 3PO2G 1PZKD 3I4LA 1QOHA 1KC8C 2KUMA 4GLXA 2LY7A 1D5MC 4BY1H 2I5HA 1PH8A 4FP5D 1KLUD 2D5DA 2IHEA 3DMUA 3FKIG 5LL6S 4DN4M 2XWJB 2CCZA 1S5CD 3PIP3 4BBSH 4KK7A 4B3RL 4IPHA 1KDCA 2BOSA 2VQFL 3FVQA 2A6HC 3NWTA 3I4MH 3HKZB 2E5LL 5KYIA 1X9NA 4P71A 1X65A 3BVZA 3D31A 5JOBA 4JV5Q 4DU9A 1CZWA 2GA4B 2YTVA 3FHWA 4P74A 5IGCA 4JBKA 1PH1A 4B3TQ 1U4RA 4DV1Q 3GTOB 4GOPC 1NUCA 1YHBA 2QILA 3NQIA 4DAYA 1XNQL 1XPUA 2A6EC 4I7AA 3HFZB 2Y0SE 3CCRA 2CH4W 1AE2A 4XTCS 1S3OA 4PZ6A 5CR3A 2F0UA 5C3WA 3HOWG 4KY7A 1WTRA 2EQSA 1S5BD 4QJFA 1UE1A 1OTCA 4M1UB 1XYIA 2JSOA 1SE4A 4MHEA 2R7ZB 1O7ZA 2VXWA 2IX0A 3HOVH 4LF6L 1IW7D 3PV0A 1LTGD 4KY5A 4R9WA 4XQQA 3M4PA 4JI8Q 1YJ9A 2RDHA 2F52A 2B2WA 1K3RA 2IHFA 4CKBA 2E2JH 4UP7A 5ELCA 4Q0FA 2JEBI 2KHSA 3R8BA 5LMUL 4DPGA 3Q22A 4OX9L 1EIGA 3A8JE 3J81E 3NQTA 4G4KA 1SNMA 4IUNA 3X3NA 2EPBA 3UDXA 5M3MH 4HAEA 3D4DA 4DR1L 1N33L 2GVBA 1U0LA 3TMEA 2FFKB 5J3BA 4JBJA 5CV4A 2PYKA 2C9OA 5CORA 2IW3A 1WD1A 4LNQA 5ELFA 3H3VI 3SK5A 1B9MA 1X55A 3OIQA 2F0KA 2K75A 2ALYB 3GO5A 4V0BA 1E1TA 2RVLA 1HH2P 3CCUA 1UE7A 2F0JA 2FXQA 3VYSA 5C4XG 1IL8A 1MHWC 1Q46A 4JI2Q 1D5ZC 2FHTA 2KA7A 4RKBA 2F4IA 4DUYQ 4A3IH 4K0KQ 3HKZE 3MA2B 1IKMA 2ICIA 3SXHA 1WTPA 1UUPA 4XT1B 2K5NA 5EQ0A 3M3YB 2WB1B 1IXRA 4GZYC 1FYCA 1H9SA 2F0NA 1GUWA 3HGBA 4UPAA 4OWWB 3AMUA 5FO7B 4AIMA 1W6KA 3OHXC 1G2TA 1VMCA 1H9SB 1HNZQ 4JYAL 3RZDB 2YYZA 1EY5A 5DM63 4LF7Q 2K7VA 4O42A 4BY7B 2JYOA 4A3MG 1B3AA 1PH7A 4KMUC 1PLFA 2KBNA 2OF1A 3PGZA 1CI3M 1HFGA 4X62Q 5GADC 2ZJPA 3PF4A 3IL8A 4RAUC 1S5DD 5CV6A 2PQEA 2V4DA 4Y7NB 1K8GA 1IKLA 1IL2A 1FR3A 3MVVA 4JI4L 4R4TA 3UDFA 2R93G 3H0GH 3CQZH 2RQXA 3HZXA 3I4NG 3HOZB 1CT1D 5FLXE 2K01A 4P75A 4K8JA 3EA6A 2Q2IA 5KYLA 2KCMA 1F9RA 2ZM6Q 2NVTH 2NVQB 1A63A 2AKWB 4Y52H 4KD3A 2NN6I 2NUCA 3GTMH 3CCQA 1Q82C 3LNNA 3PF5A 4QL5A 3H91A 3W2DA 1XNRQ 5LL6X 5IYCH 2EYLA 4K5XA 4N8FA 3MHBA 2IX3A 2MO0A 3GTGB 3QJYA 4B3MQ 2O5IC 4K6DA 2HCCA 4PV1C 1I50B 1QILA 2YU9B 2IJ0A 3RN5A 3S1QH 2CFMA 4OXPA 1EEID 1VCIA 3S17H 4GOPA 3D8GA 3HOXG 5IWAL 1PHJA 3QOJA 1TWCB 3K58A 1H9MA 1TY0A 2PZTA 3EBEA 1VQ5A 4A3LG 3M4OH 4AYBB 4PMCA 4GOPB 3Q0AA 1UWVA 1MIUA 4QF4A 3DM3A 3KBGA 3S24A 4BS9A 1B9NA 1IBML 2JA6H 4GN5A 2UUAQ 4C3IB 1C8CA 2X6GA 2JK8A 3VR5A 1AEXA 4LF4L 1HZ9A 4GNXA 1AFPA 3QG1A 4A3EH 3CC7A 3I7FA 4LWCA 1BCPF 2Z4HA 4TSSA 1CQFA 2N8NA 4FDBA 4N9PA 2WIIB 1CTMA 3RR5A 4UP9A 1TR5A 4C3JH 1SBBB 4B3SQ 4A3BG 1Q1EA 1IYJB 4ZKCB 4DA2A 3RN2A 3CMEA 1R4QB 1SNQA 3I90A 4DV6L 3T56B 1X56A 2M2LA 1BDOA 4L63B 4OL7A 4DUZQ 3GTPH 3FMCA 2EE1A
chains in the Genus database with same CATH topology
4MIUA 3T51B 5I6WA 2B2VC 1X3QA 1F2MA 2EJMA 1GUTA 1UEAB 2K32A 4EQOA 3PIO3 1WCMB 1ET6A 3BDCA 3SK6A 2F0WA 1BNZA 3L3OC 3TDQA 3K5NA 4Q5VA 4UDUC 3QOLA 2CW0D 5EJWA 4XYOA 3Q6SA 5E3FA 1Q8IA 2BA1A 5FK9C 4DK1A 4LJZC 1E2ZA 4ZLTF 5M5YB 3S1NB 3T53B 2F0HA 1EYAA 2VB3X 3KLSA 5A2QL 5EPJA 2B2YC 1DOKA 1RHPA 2MJ8A 3NTHA 2NN6G 3E5SA 1L0YB 3IFTA 4QMGA 2EXZA 4WRDA 3MXPA 4LMQD 5C0XI 5I2XA 3MZ5A 5I2YA 3I3CA 1TVXA 1EL0A 5ELBA 4F88A 2N55A 5IIFA 2AWNA 4ULLA 2H1EA 4BY1B 2KECA 4K2LA 3IAYA 2KCCA 2EYJA 1ZKOA 3I4MB 1JC7A 1SNPA 5EKKA 3E0JA 1K8OA 4EVOA 1ICWA 2BCOA 1JE4A 4PNYA 4H7BA 1L0XB 4F7XA 4U673 3BYYB 4RFBA 4C3IG 2PZUA 3NP8A 2SEBD 1HHVA 3BDLA 1M4VA 1SEBD 2A69D 1PMRA 4A3KB 4DAVA 5I9OA 1A3UA 2H4OA 2EJGC 3HOVB 5DNFA 1VDZA 2PO4A 3KBXA 1HTPA 3TSSA 1FNUA 2PNRC 1WTXA 2IT1A 2E2JB 3M4YA 5NUCA 5CV5A 1TKWB 2EY6A 5K36H 2OXPA 2EYOA 5JEAG 3EJIA 1SYGA 4X3TA 4G57A 1DM0B 3A7LA 3GD7A 3C46A 3LX0A 3KLSX 1SJED 1DOMA 1EOTA 1O7YA 4FXDA 5AFWA 3LWUA 1SMYD 3E6ZX 1HXYD 4BBRB 4QB4A 1IYUA 3FPPA 5M9OA 5J1ZA 5E4XA 1HQRD 3S9WA 4ZRZA 5C0XG 2Z8LA 1STHA 1IHZA 2CW0C 4IUQA 1YNJD 5C3XA 1S4ZA 3DXJC 4XYQA 4ME5A 4NMZA 1TS3A 3BG3A 3DUZA 4X3SA 3QB3A 3A54A 1KDBA 3TP8A 1RCVD 2CVRA 2K5DA 1SXTA 5D14A 2QF7A 1JR0D 1SNCA 3NBHA 1DZ1A 3OOCA 3H0GB 3CQZB 3RMHA 4R8NA 5ELEA 1DCZA 2HUGA 2Y0SB 2NVTB 4B9XA 3D3RA 3TZUA 4KY6A 2LS01 5JVG3 2IPKD 3J7AV 2O4XA 5ELDA 2L55A 3OWFA 1PRTF 2F0IA 4C56C 1BO0A 2MP1A 1XTCD 3RUZA 2SOBA 3SHLA 1J9OA 1EYDA 1I4RA 3R2IA 2F0VA 4ZQ3A 3S17B 1OXVA 3A55A 1RDPD 3M4OB 1TT2A 2WV6D 4RCOA 4IFDJ 4IQZA 3CKIB 4KV6A 1PZID 2JA6B 1SDFA 2A69C 4IZ8A 3I70A 4A93B 4A3EB 2EDGA 1PTOF 1LT4D 3H94A 3FPUB 3URYA 4C3JB 1WD0A 4XXEA 1BCPD 3NHHA 1HA6A 5C4HA 1EY8A 3C1EA 1TS2A 3MXGA 1BR9A 5FLXL 4FYDA 1QJOA 2MUYA 1MSHA 3GTPB 3NTKA 4OGQC 3VR4A 4EQNA 4NKLA 3NE5B 1TWHB 2XNAC 2KEEA 1I6VC 1JWUD 1O80A 4A3DB 1R4PB 1CK1A 1NCVA 4JK1C 4RA8A 2O5JC 4R8IA 5KNBA 2N88A 2L9HA 2NTTA 3F2UA 2F0MA 3ND9A 1OO9B 1BQQT 1XXGA 1SYBA 3DWQA 4FF3A 3W3AA 4CKCA 4QUFA 1Y69U 3JAME 4IUVA 1F9PA 3NWSA 1VF5C 4B9WA 3MEHA 1LTID 1U4MA 4CKEA 5CBAE 1QCBD 1YNJC 2BA0A 2XVSA 4PQXA 1D2BA 2XN9C 1UNSA 1DONA 1TS4A 4L6TB 1BBXC 2XRSD 3M7NA 4KKUA 1H9KA 5DM73 1WVLA 2O2LD 2PMZB 1QNKA 3J80E 2C5CA 1LTSD 4IFDH 1SE2A 2ZT9C 4KTAA 3D6CA 3TP6A 3DWPA 3HOYB 4MN3A 3TN2A 4K6LA 1TQOA 2QEJC 3M85A 4H0LC 4FXKC 2Q8RE 2A73B 4OIKA 5G3LD 3SEBA 2K03A 2WKDA 1F9SA 1S5FD 1EQTA 1KNAA 2F3WA 2QCPX 1XWEA 3PUXA 3Q24A 4OO1H 3HP3A 1SSOA 3AB9A 3P1HA 4A3GB 3OPOA 1LT6D 4IALA 2DNEA 2MPMA 3I8ZA 4HSVA 1E2VA 3R2TA 2Z1CA 3K7AB 3PUVA 1LLRD 4TQUS 1FD7D 3L9AX 1QE6A 4C3JG 1HQMC 5ISRA 3ND8A 5CV8A 4C3HB 1Z7TA 2FMCA 1D5XC 2WINB 1LTRD 1BCPC 3OW7A 4KI0A 3O13A 3QO2A 3T16A 1D1KA 1JOOA 2A68D 2OT2A 4HSPA 2L0CA 1G2SA 4HMJA 3SE0A 2LMCB 4C1NI 1LTBD 5IGEA 2WKCA 3PUWA 2LKVA 3FEWX 2B63B 1NR2A 3N6RA 1MSGA 3EFXD 2VUMB 1B44D 1IW7C 4I7ZC 4QIWB 4ILWA 5FO8B 5FOBB 4KHVA 5IGDA 3PUZA 3VR3A 3M7GA 3A56A 4XQNA 1PFBA 1PZJD 1JWSD 1Q1BA 2JA5B 1EY0A 4RHRA 5E4WC 2NVXB 5HGTA 4DXGA 2WP8J 1MGSA 1ML0D 3BDOA 4HCEA 2AQ3B 1RTOA 1TY2A 2ENBA 2J7ZA 5CYUA 1RJTA 2PW7A 1H9RA 5F2DA 1T5XD 2R61A 2TSSA 3G6JB 3BS1A 4XT3B 2M9VA 5D65A 5C44B 3RZOB 1JCKB 1FGBD 5KIXA 5BN5A 2B8GA 2E2DC 2NBFA 1D6EC 1JWMD 2F0DA 1ZXTA 3GP7A 1SYEA 1A2TA 1Y8OB 1A3TA 2B2UC 1PRTD 3GV3A 3CU7A 1EY9A 3R93A 2XRQD 3VR2A 1D1IA 3NPPA 1SNOA 2JXMB 2PW5A 1ZYRD 2DN8A 4NW2A 5EPLA 3H09A 1DYQA 1QG7A 4S3SA 5JAVA 3I91A 4J1MA 5G3LF 3EROA 3J7YW 1O7LA 2L1BA 3IFDA 2F0OA 5DAUA 4DGZA 1HRJA 4DAPA 4C3HG 2AWOA 1OXUA 1VF7A 2F0EA 1R9TB 2NB0A 4BBSB 2L12A 2F1MA 2FMMA 3TP7A 4F87A 3U9OA 4G7HC 5K36G 2L11A 3S1RB 5EKIA 2MGSA 2DY7A 1PTOD 1ET9A 2F0TA 1LT3D 4KJNA 1U4LA 1NR4A 1WTOA 1STYA 4KHZA 1I4GA 2TMPA 4BA2I 3VYRA 1BCPB 1PTOH 1U9RA 3KUPA 3K0YA 1I3QB 2KEDA 2A68C 4G7OC 1IYVA 4A3JB 3HRZC 2IL8A 2DNCA 3S2HB 1B1ZA 5CGKA 1H9JA 2AQ2B 3HEJA 4HEDA 2IWHA 4ZUJA 5CV7A 1VMPA 4OHJA 3ITPA 2KJXA 3NSWA 3QWNA 3C2PA 2AUKA 5IT9E 2F0GA 3GQBA 1V1PA 1EY6A 4LAAA 1RODA 1Y1WB 1EY4A 5M3MB 1EY7A 1AN8A 2RBMA 2PZWA 1V1PB 3S15B 3GTKB 1EIHA 2HQEA 3U9SA 4ZK9B 2SNSA 1CQVA 1PFNA 1JQYD 4A3IB 1PFMA 1UAPA 1EZ8A 3MWYW 2BE5D 5J22A 1JICA 1CZGA 2KCNA 3KK7A 5HURA 1LTAD 4IFDI 1II3A 4N9TA 5COYA 3MFGA 3HOWB 2NTSA 3V05A 4OIJA 2QKIC 4ODGA 1C48A 1AZQA 1C4QA 3A7AB 4IN3A 2B39A 2B2UA 5K5PA 5C6AA 1TWAB 1PRTC 1KDAA 2E75C 4I65A 1EU4A 4QCLA 1ZYRC 4B08A 1ENFA 3T4AC 3JAML 4ZYSA 3G7LA 4IUUA 3BZDB 1O78A 3QIAA 4OO1I 5EPKA 3DEOA 2ZXOA 5JPNC 1GHJA 1K83B 2Z4IA 3GTMB 4HTHA 3S14B 3K5OA 4K5VA 4JBWA 1ONLA 2F0LA 2K05A 1EWHA 1G291 2K33A 2R6GA 3J80L 4G7ZC 3EVQA 3VR6A 3BVGA 2XWBB 1S5ED 3CHBD 1CHPD 3S1QB 3GTJB 5IOCA 1PTOC 5EKLA 1MI2A 1JB3A 3R3OA 1RF2D 5C0XH 3S2DB 3DM1A 3FRPB 2ICEC 5KEEA 1ZEQX 3CRKC 1LV9A 5KGUA 1GHKA 1W6JA 1F2YA 1I4XA 1E2WA 1HPCA 3MTSA 1STAA 2KVMA 1STBA 4K5WA 1FNVA 3X3MA 3DEPA 1ESFA 2JA7B 1Y8NB 1FNWA 1GUGA 5I9PA 2R93B 2DY8A 2EY1A 2FJ2A 2RKSA 2QDBA 1EEFD 3I4NB 4CGYB 1NSNS 4CHTB 1NAPA 5KNDA 1F77A 1MBYA 1CA6A 1DD2A 4XQJA 3PUYA 4ABNA 2NVYB 3P7JA 1GUNA 4IFDG 2IX1A 1U4PA 4WJWA 4M8AA 4L8JA 4LK1C 5DEHA 5J39A 5JVH3 3LWEA 1Z47A 2Q8IB 1B53A 1HA5A 3TBIB 3HOUB 3D4WA 4NP5A 3HG9A 2PCFB 1SMYC 3HOXB 5I6YA 4RCNA 1I4HA 3UI2A 2EOTA 2BE5C 1LT5D 2K5QA 2D62A 4X3UA 1TS5A 3GV6A 5BN4A 3HS0C 2EYMA 5KRUA 5D3IB 3ONAB 3A8IE 4OO1G 1JOKA 3NK9A 5C3EB 1Q12A 3K5MA 1LTTD 2F0QA 1WTQA 4NDXA 2G9HD 2XSCA 4A3BB 2AQ1B 3MXUA 1PRTB 3TP5A 4RWSC 1OXSC 2J4XA 2JE6I 3S1MB 3FDTA 4K2KA 3VYTA 1HTLD 2CHBD 3NUCA 2ZXRA 1EFID 1GOZA 3OMGA 4C1NK 1BOSA 3K57A 2SDFA 1SFOB 4E6IA 1STNA 3A8KE 2E2IB 2NZ1D 4C2MB 2R3ZA 3SK4A 4RH6A 5C4ZA 3PO3B 1PTOB 2D9UA 1TIID 4V190 3MFYA 1A6XA 4HN7A 1Q3LA 4PMBA 2K04A 5CV9A 1Q90A 4J6HA 3VA7A 2F0SA 2K1BA 2WAQB 5JPMC 2PPBC 1OXXK 1E0BA 2HDLA 5IGFA 1STEA 3OWEB 3N52A 1ILQA 5EBCA 2VB2X 1ENCA 1G8ZD 1DJRD 5C5LA 4DXFA 1ESRA 1I6HB 1Y1VB 4WORA 1A15A 4BA1I 2SNMA 2E74C 2JA8B 3OSOA 1EQVA 1ILPA 2EY2A 1QWYA 1TU2B 1KNEA 3H6MA 1SYFA 4EQPA 3BYTB 3MXNA 3K59A 3IKJA 3SVMA 2EYPA 1JORA 5T1IA 4RGNA 1GXDC 1M8AA 1BXTA 1OXTA 4QUCA 2NWGA 3SR1A 4X3KA 1KABA 2BDOA 2BDNA 2K28A 1XX8A 1A2UA 3WOEA 3Q23A 1PXUA 4EGVA 4ID6A 1QNUA 4H13C 2K5WA 2NYZD 2F0FA 2E76C 1EU3A 5IT9L 1RKNA 3CRLC 4CBVA 2F3VA 4HCSA 1SNDA 1JOQA 5IODA 1G6ZA 1B50A 2F03A 1TWFB 1BF4A 5TSSA 3C1FA 3OMCA 5C5MA 2RA4A 1SE3A 2XIWA 2EJFC 4IURA 2OEOA 2VNUD 2KQ3A 2ID0A 1V43A 1HCZA 1TWGB 4TRDA 1J8IA 4XIGS 3ERQA 4FF1A 1HUNA 2I07B 4J8QA 4F8MA 2I46A 3D4RA 2A74C 4K8IA 1CHQD 5E1FA 3ZYYX 1YNND 3P75A 4FNFA 4TKOB 1CA5A 2HDMA 5IGGA 5LHY1 1LABA 4DK0A 4FXGC 4RGTA 2MHVA 3S16B 1I4QA 5M5WB 5CBEE 1KLGD 1RTNA 5EGTA 2RDGA 1BUVT 2M00A 2X69A 5A35A 1V8QA 4UAIA 1K8MA 1F9QA 2F0PA 3GTLB 1CFMA 1SJHD 4PMWA 3RD4A 2B2TC 4DNTB 1AP0A 1GUSA 2JEAI 3V2TA 2NN6H 3I73A 2X6LA 4RGMA 4KKSA 4FF4A 1DXMA 1SYCA 5JEAJ 4KKTA 4U68A 1ENAA 1V1OA 2EZVA 1I4PA 4ZUIA 1AZPA 3MC0B 5CC4A 3NXWA 4KD4A 2ZXPA 2AUJD 2RSNA 2HCIA 3K5LA 2G9DA 3PO2B 5BN3A 2D2CC 1CM9A 2A6HD 1LO5D 1SYDA 3L7ZC 4A3FB 4CJ0B 4ZKBB 2EY5A 3V96A 3FKIB 1RD9D 1KTKA 1SAPA 5C0XJ 1EYCA 4HMIA 2A6ED 2RSOA 1DOLA 4CJ1B 4FVMA 4K14A 4XDXA 5FKAC 3KLRA 5FO9B 2B2VA 3SK8A 1GJXA 3DHQA 5A2QE 1Z6HA 3K6OA 1STGA 4RKLA 3T13A 4DFAA 3J7AF 4KN7C 1AW7A 3C3LA 1WTWA 5M5XB 1MD2D 1G91A 5M3FB 2EYFA 3H3VC 1PYWD 5D3DA 4KN4C 4Z9CB 2B2WC 1B4OA 2B8FA 1F2LA 4IUPA 1B2TA 4IUTA 1EWCA 1HUMA 2KOLA 3NTIA 3RLFA 2EYHA 4BWGB 1X32A 5CMDA 4FO2A 2EVBA 2CQAA 2B2YA 3VYUA 1LACA 4RHSA 5JEAH 1T5EA 1WTVA 3DWAA 3EQLC 4ZAIA 5C4JB 1GUOA 3OIPA 3I72A 3PMFA 4DF7A 2FINB 3AU7A 5T1GA 1YNNC 1HFNA 5KNCA 3TZDA 3D6WA 2R92B 5C4XB 3J81L 2WACA 2LFNA 5I4DA 2L5TA 4P2CB 4WFN3 1PDQA 1EZ6A 4CJ2C 1A3VA 3GTQB 4KJOA 3WOFA 1QB5D 2JP1A 1KAAA 2A5HA 4RGOS 3KF8A 2K6AA 4H44C 1X3PA 4YIJA 3VA5A 4O1NA 1F2ZA 3WDNA 1Y8PB 2B2TA 3NBIA 5IGBA 3BVMA 2E2HB 4A3MB 2J0TD 4FF2A 5EBDA 2RDFA 5JJZA 3SDZA 2L4NA 2Q8TA 3MAQA 3P20A 4DNRB 4HR7B 1PZKD 3I4LA 1QOHA 2KUMA 2LY7A 1D5MC 4FP5D 1KLUD 2D5DA 3DMUA 4DN4M 5LL6S 2XWJB 1S5CD 3PIP3 4KK7A 1KDCA 2BOSA 3FVQA 2A6HC 3NWTA 3HKZB 5KYIA 3BVZA 3D31A 5JOBA 4DU9A 1CZWA 2GA4B 5IGCA 1U4RA 3GTOB 1NUCA 2QILA 3NQIA 4DAYA 2A6EC 4XTCS 5CR3A 2F0UA 5C3WA 4KY7A 1WTRA 1S5BD 4M1UB 1XYIA 2JSOA 1SE4A 4MHEA 2R7ZB 1O7ZA 2VXWA 2IX0A 1IW7D 3PV0A 1LTGD 4KY5A 4R9WA 4XQQA 2RDHA 2B2WA 4CKBA 5ELCA 4Q0FA 2JEBI 2KHSA 3R8BA 3Q22A 1EIGA 3A8JE 3J81E 3NQTA 4G4KA 1SNMA 4IUNA 3X3NA 2EPBA 4HAEA 3D4DA 3TMEA 2FFKB 5CV4A 2PYKA 2C9OA 5CORA 2IW3A 1WD1A 5ELFA 3SK5A 1B9MA 3OIQA 2F0KA 4V0BA 3GO5A 2RVLA 2F0JA 3VYSA 1IL8A 1D5ZC 2FHTA 2KA7A 4RKBA 2F4IA 3MA2B 1IKMA 2ICIA 3SXHA 1WTPA 1UUPA 4XT1B 5EQ0A 3M3YB 2WB1B 4GZYC 1FYCA 1H9SA 2F0NA 1GUWA 3HGBA 3AMUA 5FO7B 1W6KA 3OHXC 1G2TA 1VMCA 1H9SB 3RZDB 2YYZA 1EY5A 5DM63 2K7VA 4O42A 4BY7B 2JYOA 1B3AA 4KMUC 1PLFA 2OF1A 1CI3M 1HFGA 3IL8A 4RAUC 1S5DD 5CV6A 2PQEA 2V4DA 4Y7NB 1IKLA 1FR3A 3MVVA 2RQXA 3HZXA 3HOZB 1CT1D 5FLXE 2K01A 4K8JA 3EA6A 5KYLA 1F9RA 2NVQB 4KD3A 2NN6I 2NUCA 3LNNA 3H91A 3W2DA 5LL6X 2EYLA 4K5XA 2IX3A 3MHBA 3GTGB 3QJYA 2O5IC 4K6DA 2HCCA 4PV1C 1I50B 1QILA 2YU9B 2IJ0A 1EEID 1VCIA 3D8GA 3QOJA 1TWCB 3K58A 1H9MA 1TY0A 2PZTA 4AYBB 4PMCA 3Q0AA 4QF4A 3KBGA 4BS9A 1B9NA 4C3IB 1C8CA 2X6GA 3VR5A 1AEXA 1AFPA 3QG1A 1BCPF 2Z4HA 4TSSA 1CQFA 4N9PA 2WIIB 1CTMA 1TR5A 1SBBB 1Q1EA 4ZKCB 4DA2A 1R4QB 1SNQA 3I90A 3T56B 2M2LA 1BDOA 4L63B 4OL7A 3FMCA 2EE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T1G A;  3DM1 A;  2RSN A;  2L1B A;  4OIK A;  2B2V C;  1S4Z A;  2HCI A;  3FPU B;  1IKL A;  1X3Q A;  3IFD A;  1BF4 A;  1HFN A;  1WTR A;  1JE4 A;  2K03 A;  1CM9 A;  3D6W A;  3TZD A;  1WD0 A;  1PFN A;  1HRJ A;  1PFM A;  1LV9 A;  4X3S A;  4CJ0 B;  1WTQ A;  1HA6 A;  4ZKB B;  2RA4 A;  1XYI A;  1ESR A;  1F9S A;  4MHE A;  2XIW A;  1EQT A;  1O7Z A;  2K01 A;  2VXW A;  1PFB A;  3MWY W;  4IUR A;  1KNA A;  4R9W A;  2L12 A;  1F9R A;  1JIC A;  2FMM A;  1HHV A;  2CVR A;  3MTS A;  1BNZ A;  1MSH A;  4RWS C;  1PDQ A;  2B2W A;  1A15 A;  2KVM A;  5E4W C;  4CJ2 C;  1J8I A;  5D14 A;  2JP1 A;  2L11 A;  3FDT A;  3HP3 A;  1ILP A;  1SAP A;  1SSO A;  2KEE A;  5COY A;  5EKI A;  1MGS A;  1DZ1 A;  2MGS A;  2DY7 A;  3DEP A;  1ML0 D;  2RSO A;  3H91 A;  1HUN A;  1DOL A;  1EIG A;  1O80 A;  4OIJ A;  4CJ1 B;  1KNE A;  1NCV A;  2DY8 A;  2EPB A;  4RA8 A;  1RTO A;  1U4L A;  1NR4 A;  1X3P A;  2FJ2 A;  2J7Z A;  3Q6S A;  4XDX A;  5DNF A;  4R8I A;  1WTO A;  2B2V A;  1AZQ A;  2HUG A;  1RJT A;  4HAE A;  1NAP A;  3KBX A;  2B2U A;  2HCC A;  2N88 A;  2B2T A;  4ZLT F;  2MPM A;  2FFK B;  2L9H A;  3I8Z A;  1WTX A;  2SDF A;  5COR A;  1WD1 A;  1CA6 A;  3SVM A;  1CA5 A;  2HDM A;  4HSV A;  5T1I A;  5JJZ A;  3KUP A;  3F2U A;  2KED A;  4XT3 B;  1WTW A;  1WTP A;  5EPJ A;  2L4N A;  2B2Y C;  1DOK A;  5D65 A;  2Q8T A;  1RHP A;  2EE1 A;  1M8A A;  2MJ8 A;  2RVL A;  3P7J A;  1G91 A;  2IL8 A;  1BO0 A;  4QUF A;  1QE6 A;  1U4P A;  2MP1 A;  2NZ1 D;  4IUV A;  1IL8 A;  4QUC A;  1F9P A;  2KUM A;  2FHT A;  2R3Z A;  2NWG A;  1J9O A;  3G7L A;  2B2W C;  3LWE A;  1B4O A;  4X3T A;  1IKM A;  4X3K A;  1B53 A;  5CBE E;  1F2L A;  1U4M A;  2Q8R E;  4XT1 B;  4DN4 M;  5EQ0 A;  1RTN A;  2BDN A;  4IUP A;  4IUU A;  4LMQ D;  5CBA E;  2K28 A;  2D9U A;  5EPK A;  1XX8 A;  1B2T A;  3DEO A;  4HED A;  4IUT A;  1HUM A;  1C8C A;  5EJW A;  2X6G A;  1ZXT A;  1DON A;  2KOL A;  2X69 A;  1GUW A;  3I3C A;  1VMP A;  1TVX A;  1BBX C;  1EL0 A;  1DOM A;  1EOT A;  4UAI A;  1WVL A;  1O7Y A;  1F9Q A;  3QO2 A;  5AFW A;  1G2T A;  1Q3L A;  1VMC A;  1QNK A;  2NYZ D;  1X32 A;  3UI2 A;  2K05 A;  2N55 A;  2EOT A;  2B2U C;  2K04 A;  5CMD A;  2B2T C;  1ROD A;  1AP0 A;  1ILQ A;  2H1E A;  3GV3 A;  2B2Y A;  2KEC A;  3R93 A;  2X6L A;  1U4R A;  4HCS A;  4X3U A;  1SDF A;  3GV6 A;  4O42 A;  1G2S A;  4NW2 A;  5EPL A;  1WTV A;  4ZKC B;  2K1B A;  2JYO A;  5E4X A;  4U68 A;  1B3A A;  1QG7 A;  4ZAI A;  1PLF A;  3ONA B;  4MN3 A;  3TN2 A;  1G6Z A;  3I91 A;  3I90 A;  1MI2 A;  1HFG A;  1AZP A;  1EIH A;  2M2L A;  1E0B A;  2HDL A;  4IUQ A;  1ICW A;  1B50 A;  3IL8 A;  2FIN B;  3N52 A;  1NR2 A;  4RAU C;  4ZK9 B;  1MSG A; 
#chains in the Genus database with same CATH topology
 4MIU A;  3T51 B;  5I6W A;  2B2V C;  2Q2T A;  1TWH H;  1X3Q A;  4A3C H;  1SMX A;  2QEX A;  3U58 A;  1F2M A;  3TS0 A;  2EJM A;  3BZK A;  1GUT A;  1PH9 A;  4O2D A;  1UEA B;  2K32 A;  4APV A;  4EQO A;  2VQE L;  4A3D H;  3I56 A;  4HIO A;  2WB1 G;  3PIO 3;  1WCM B;  1ET6 A;  3BDC A;  3OYY A;  3SK6 A;  5IYD H;  2F0W A;  1BNZ A;  4J15 A;  3L3O C;  1UEB A;  4JI5 L;  3TDQ A;  3K5N A;  4Q5V A;  4UDU C;  3QOL A;  2CW0 D;  5EJW A;  4JG2 A;  1B8A A;  4XYO A;  3Q6S A;  5E3F A;  1Q8I A;  4BY7 G;  2BA1 A;  4DV0 L;  5FK9 C;  4DK1 A;  4LJZ C;  3T1Y Q;  1E2Z A;  4ZLT F;  5M5Y B;  3S1N B;  3T53 B;  2F0H A;  1EYA A;  2VB3 X;  2MNA A;  3KLS A;  1SRU A;  4AYB E;  1RIP A;  5A2Q L;  1CKM A;  1VQ9 A;  5EPJ A;  2B2Y C;  1DOK A;  1RHP A;  2MJ8 A;  3AQQ A;  2NN6 G;  3E0E A;  3NTH A;  4R4O A;  3E5S A;  1L0Y B;  2JQO A;  3K81 C;  2PI2 A;  5DLQ E;  3IFT A;  3I4O A;  4QMG A;  2EXZ A;  4WRD A;  3MXP A;  3F2B A;  4LMQ D;  3OTO Q;  5C0X I;  1NNX A;  5I2X A;  4QIW E;  3MZ5 A;  5LMN Q;  5I2Y A;  3KYH C;  1QZG A;  3I3C A;  1TVX A;  1EL0 A;  1ASY A;  3HOY H;  1KRS A;  5ELB A;  4F88 A;  3S1M H;  1X3G A;  1GVP A;  2N55 A;  4QY7 A;  5IIF A;  2AWN A;  4ULL A;  2H1E A;  4BY1 B;  2KEC A;  4X66 Q;  3PSI A;  1KAW A;  3T1H Q;  4K2L A;  3IAY A;  2JJQ A;  5AJ3 Q;  2KCC A;  2EYJ A;  3MEF A;  4JW0 A;  2GN5 A;  1ZKO A;  3I4M B;  1PFS A;  1JC7 A;  1SNP A;  5EKK A;  3E0J A;  1SFO H;  1EUJ A;  1K8O A;  4EVO A;  1ICW A;  2AMC B;  4JPB W;  1YHA A;  2BCO A;  1JE4 A;  5BR8 Q;  2E2I H;  1K3B C;  4PNY A;  4H7B A;  1EIF A;  1L0X B;  4C2M H;  5IP7 G;  4NXM Q;  4P72 A;  2QA4 A;  4A3G H;  4F7X A;  4U67 3;  3BYY B;  4RFB A;  4C3I G;  1YIJ A;  2PZU A;  1K73 C;  3PO3 H;  4CDE C;  3NP8 A;  2SEB D;  1HHV A;  3BDL A;  1M4V A;  1SEB D;  4JI3 Q;  1PA6 A;  2A69 D;  1PMR A;  2KEN A;  1NTG A;  4HID A;  4A3K B;  2HIX A;  5GAE C;  3F2D A;  4DAV A;  3CP0 A;  5I9O A;  2K52 A;  1A3U A;  4JV5 L;  1M90 C;  2H4O A;  2EJG C;  3J81 c;  3HOV B;  5DNF A;  3CMA A;  1D8L A;  1VDZ A;  2PO4 A;  4DV7 Q;  4B3T L;  3KBX A;  1HTP A;  4C3H H;  4DV1 L;  3TSS A;  2HHH L;  1WFQ A;  1FNU A;  2PNR C;  1WTX A;  4OON A;  2IT1 A;  2E2J B;  3M4Y A;  3UE1 A;  4DR6 Q;  4LW1 A;  3CAM A;  5NUC A;  5CV5 A;  1TKW B;  2EY6 A;  5K36 H;  2OXP A;  2KHJ A;  2PI2 E;  2EYO A;  5JEA G;  3EJI A;  4LF9 Q;  1SYG A;  4X3T A;  1WCM G;  4ME3 A;  4G57 A;  3TS2 A;  1DM0 B;  3A7L A;  3GD7 A;  3C46 A;  4BXX H;  3LX0 A;  3KLS X;  3UDG A;  1SJE D;  1Y1V H;  1DOM A;  1EOT A;  4JI8 L;  2UXB Q;  1O7Y A;  4FXD A;  5AFW A;  3L2P A;  2B63 H;  3LWU A;  2ATW A;  2YTY A;  4GN3 B;  1SMY D;  4YCU A;  2K4K A;  3E6Z X;  2VUM H;  1D7Q A;  1HXY D;  1CKO A;  4BBR B;  4QB4 A;  1IYU A;  3FPP A;  5M9O A;  5J1Z A;  5E4X A;  4DR3 Q;  1HQR D;  4DV3 Q;  3S9W A;  4ZRZ A;  1CKN A;  2Z8L A;  5C0X G;  1STH A;  2JA5 H;  3K80 C;  3VDY A;  4AQY Q;  2Q2H A;  1IHZ A;  5GAH C;  3ICE A;  2CW0 C;  4IUQ A;  1YNJ D;  2OTL A;  4POF A;  5C3X A;  2V1C C;  2NVX H;  1S4Z A;  3DXJ C;  1CKN B;  4XYQ A;  1S40 A;  2CWP A;  4ME5 A;  1N34 Q;  4NMZ A;  1TS3 A;  1PYB A;  3BG3 A;  3DUZ A;  4X3S A;  1PV4 A;  3QB3 A;  3HKS A;  1YIT A;  3A54 A;  1KDB A;  4DUY L;  3ULJ A;  2UXC Q;  5FLX c;  3TP8 A;  1RCV D;  2CH4 A;  2CVR A;  3PCO B;  2K5D A;  4YHH Q;  1SXT A;  5D14 A;  2QF7 A;  1JR0 D;  1SNC A;  3NBH A;  4YWM A;  1DZ1 A;  5C44 H;  3RZO H;  3OOC A;  4PZ8 A;  3H0G B;  3CQZ B;  2HT1 A;  1HNZ L;  4ALP A;  3W1G A;  3KDF B;  3RMH A;  3PIP A;  4R8N A;  5ELE A;  1DCZ A;  3NBH B;  2HUG A;  2Y0S B;  1N36 L;  2NVT B;  1EWI A;  4B9X A;  4LF7 L;  1YHQ A;  2DUD A;  3D3R A;  3I4M G;  1NE3 A;  3TZU A;  4KY6 A;  2LS0 1;  5JVG 3;  2IPK D;  3J7A V;  2O4X A;  5ELD A;  2L55 A;  2CWA A;  3OWF A;  1PRT F;  3JAM i;  4YWK A;  1BBW A;  2F0I A;  4C56 C;  1BO0 A;  2MP1 A;  1XTC D;  3RUZ A;  1ASZ A;  2F4V Q;  3CCS A;  2SOB A;  3SHL A;  1KHI A;  2UU9 Q;  4LF8 Q;  1J9O A;  1EYD A;  1I4R A;  2XGT A;  3R2I A;  2F0V A;  4ZQ3 A;  3ULL A;  3S17 B;  4MZ9 A;  1XJV A;  1TWG H;  1OXV A;  3A55 A;  4A3K G;  4R1J A;  1GM5 A;  1RDP D;  3M4O B;  1GD7 A;  4IO9 A;  1TT2 A;  2WV6 D;  4RCO A;  1IBL L;  4A3F G;  4IFD J;  1C0A A;  4IQZ A;  3CKI B;  4KV6 A;  1PZI D;  5FLM H;  2JA6 B;  1SDF A;  3K7U C;  2A69 C;  1BVS A;  1HNW L;  4IZ8 A;  1S72 A;  3I70 A;  4B3M L;  4A93 B;  4A3E B;  2EDG A;  1R9T H;  2Z6K A;  1PTO F;  1LT4 D;  1SLJ A;  3H94 A;  3FPU B;  3URY A;  3S1R H;  1L1O C;  4GLA C;  1MKH A;  4C3J B;  1WD0 A;  2A19 A;  4XXE A;  1BCP D;  3NHH A;  1HA6 A;  5C4H A;  1EY8 A;  3C1E A;  3KOJ A;  1TS2 A;  3MXG A;  4A4I A;  1BR9 A;  4PZ7 A;  5FLX L;  4FYD A;  1QJO A;  4YWL A;  2MUY A;  1MSH A;  5HY6 A;  3GTP B;  2VY3 A;  3NTK A;  4OGQ C;  3VR4 A;  4EQN A;  1NMG A;  4NKL A;  3NE5 B;  1TWH B;  1L0W A;  1I3Q H;  2XNA C;  5M3F G;  2KEE A;  3AFQ A;  1VQN A;  1I6V C;  4A3J H;  4DAY B;  1JWU D;  1O80 A;  4A3D B;  1R4P B;  1CK1 A;  1NCV A;  3S2H H;  4JK1 C;  1W2B A;  4JI6 Q;  4RA8 A;  4BBR G;  2O5J C;  1KD1 C;  4R8I A;  3IRB A;  5KNB A;  4GNX C;  2N88 A;  4B3S L;  2L9H A;  2NTT A;  1X6O A;  5ELN A;  1VQF A;  4DR4 L;  3F2U A;  2F0M A;  3DLL A;  3ND9 A;  1OO9 B;  1BQQ T;  3SGI A;  1XXG A;  1SYB A;  3DWQ A;  4FF3 A;  3W3A A;  1E3P A;  5GQO A;  4CKC A;  4QUF A;  4IUV A;  3JAM E;  4DUZ L;  1Y69 U;  1F9P A;  3NWS A;  3PO2 H;  1VF5 C;  4B9W A;  3MEH A;  1LTI D;  4X65 Q;  3JC6 6;  1Y1W H;  1U4M A;  4CKE A;  5CBA E;  4WJ3 M;  1QCB D;  1YNJ C;  2BA0 A;  4HJ8 A;  2XVS A;  3U4V A;  4PQX A;  1D2B A;  1QVF A;  2XN9 C;  1UNS A;  4TVA B;  3LGJ A;  1DON A;  1TS4 A;  4L6T B;  2VL6 A;  4OEL B;  1BBX C;  2XRS D;  3M7N A;  4KKU A;  1H9K A;  5DM7 3;  1WVL A;  3BJU A;  3S15 H;  2NZO A;  1EQQ A;  4DK6 C;  3GTK H;  2O2L D;  2PMZ B;  1QNK A;  3J80 E;  2C5C A;  1VQB A;  1LTS D;  1V9P A;  2R92 G;  1PYS B;  4DR7 Q;  4IFD H;  1SE2 A;  3A74 A;  2BH8 A;  2ZT9 C;  2Y0S G;  4LFA Q;  3CPF A;  4KTA A;  3D6C A;  4L5T A;  3TP6 A;  3DWP A;  3T1Y L;  4DAM A;  3HOY B;  4MN3 A;  4K6L A;  3TN2 A;  4LF5 L;  1TQO A;  2QEJ C;  3M85 A;  4H0L C;  4FXK C;  1VQP A;  1HZB A;  2Q8R E;  2A73 B;  4OIK A;  5G3L D;  1HR0 W;  3SEB A;  2K03 A;  4JI0 Q;  3HOW H;  1C9O A;  4EQ5 A;  2WKD A;  1F9S A;  1S5F D;  1SRO A;  1EQT A;  1KNA A;  1K0S A;  2F3W A;  1YZ6 A;  2QCP X;  2LXK A;  1TWA H;  5FJ8 H;  1XWE A;  3PUX A;  5LMN L;  3Q24 A;  5H1S E;  4OO1 H;  3HP3 A;  1UE5 A;  1SSO A;  3AB9 A;  2N49 A;  2L15 A;  3P1H A;  1EYG A;  4A3G B;  2JA6 G;  3OPO A;  1LT6 D;  4X66 L;  4OEM B;  4IAL A;  2DNE A;  4A93 G;  2MPM A;  5AJ3 L;  3I8Z A;  1HR0 Q;  2UUB Q;  4HJ5 A;  4HSV A;  1E2V A;  3R2T A;  2Z1C A;  3M9B A;  1K83 H;  1FJG Q;  5JJK A;  3HKZ G;  3K7A B;  3PUV A;  1PVO A;  1LLR D;  1QVC A;  4TQU S;  3S14 H;  3KFU A;  1FD7 D;  3L9A X;  1QE6 A;  4C3J G;  1HQM C;  4DR2 Q;  1P8L A;  1YJN A;  5ISR A;  4JI7 L;  3ND8 A;  2K50 A;  5CV8 A;  5BR8 L;  4C3H B;  2HD3 A;  1Z7T A;  1VQA A;  2FMC A;  2PMZ E;  1D5X C;  2WIN B;  1HNX Q;  1L1O A;  4NXM L;  3L0O A;  4DV2 Q;  1LTR D;  4HJ9 A;  3F8T A;  4DKA C;  1BCP C;  3OW7 A;  4KI0 A;  3GTJ H;  3O13 A;  4L5S A;  4A3C G;  3QO2 A;  1E24 A;  1WTH A;  1L1O B;  1NY4 A;  3T16 A;  1D1K A;  1VQK A;  4A3D G;  3A5U A;  2XTI A;  3S2D H;  1JOO A;  3PIO A;  2A68 D;  2OT2 A;  4HSP A;  4R4C A;  2L0C A;  5IYD G;  2R7Z G;  1G2S A;  4HMJ A;  2VQF Q;  4DV7 L;  3SE0 A;  4JC0 A;  2LMC B;  4C1N I;  2E5L Q;  1LTB D;  2N3S A;  5IGE A;  2E2H H;  2WKC A;  3PUW A;  2ZTE A;  2LKV A;  3FEW X;  2B63 B;  1NR2 A;  3N6R A;  1MSG A;  3EFX D;  4AH6 A;  1VQ8 A;  2VUM B;  1B44 D;  1IW7 C;  4I7Z C;  4QIW B;  4ILW A;  5FO8 B;  5FOB B;  2JA7 H;  3CXC A;  4KHV A;  4GNX B;  5IGD A;  3PUZ A;  3VR3 A;  4H02 A;  3M7G A;  2R93 H;  1XNQ Q;  3A56 A;  4XQN A;  4LF9 L;  1PFB A;  1PZJ D;  3I4N H;  1JWS D;  1Q1B A;  2JA5 B;  3CC2 A;  1EY0 A;  3CCV A;  4RHR A;  5E4W C;  2NVX B;  5HGT A;  4DXG A;  2WP8 J;  1MGS A;  3NEL A;  2NVY H;  1ML0 D;  1EFW A;  3BDO A;  4HCE A;  4LF6 Q;  2OQ0 A;  2AQ3 B;  2D0O A;  1RTO A;  1TY2 A;  2ENB A;  1EQR A;  2J7Z A;  5CYU A;  1RJT A;  2OQK A;  2PW7 A;  1H9R A;  1VQJ A;  3HOU H;  5F2D A;  1T5X D;  2R61 A;  2TSS A;  3G6J B;  4DR3 L;  1VQE A;  1V1Q A;  3BS1 A;  4XT3 B;  4DV3 L;  2M9V A;  5D65 A;  5C44 B;  1VQ7 A;  3RZO B;  4AQY L;  3RLO A;  2WAQ E;  2CKZ B;  1JCK B;  1FGB D;  3HOX H;  2DGY A;  3ER0 A;  5KIX A;  3RLN A;  5BN5 A;  4A3L H;  2B8G A;  1N34 L;  2B29 A;  2E2D C;  4IOA A;  2NBF A;  1D6E C;  1JWM D;  2F0D A;  2AHO B;  1ZXT A;  3GP7 A;  1SYE A;  2UXC L;  1A2T A;  1Y8O B;  1M1K C;  3H3V H;  1A3T A;  3K8A A;  5C3E H;  4RMF A;  2B2U C;  1PRT D;  3NEM A;  3GV3 A;  3CU7 A;  1EY9 A;  3R93 A;  4A3G G;  2XRQ D;  3VR2 A;  1D1I A;  1B3Q A;  3HOZ G;  3NPP A;  1SNO A;  2JXM B;  2PW5 A;  1ZYR D;  2DN8 A;  4NW2 A;  5EPL A;  3H09 A;  1MJE A;  1DYQ A;  4A3B H;  1LM0 A;  3CF5 A;  1QG7 A;  4S3S A;  5JAV A;  3I91 A;  3QR8 A;  4J1M A;  5G3L F;  1JJ2 A;  3ERO A;  2ASB A;  3J7Y W;  1O7L A;  2L1B A;  1XMO Q;  3IFD A;  5JJI A;  1XPR A;  2F0O A;  5DAU A;  4DGZ A;  1HRJ A;  4LUO A;  4DAP A;  1WOC A;  4C3H G;  2AWO A;  2F4V L;  1OXU A;  1VF7 A;  4GN4 B;  4JI1 Q;  2F0E A;  5HGQ A;  1R9T B;  2NB0 A;  4BBS B;  1Y14 B;  5IY0 A;  2VW9 A;  2L12 A;  2F1M A;  3EN2 A;  2FMM A;  3TP7 A;  4F87 A;  3CCJ A;  3U9O A;  1EOV A;  4G7H C;  4JI4 Q;  5K36 G;  2L11 A;  3S1R B;  1A62 A;  1RL2 A;  4PG3 A;  5IP9 G;  5EKI A;  2RF4 A;  2MGS A;  2DY7 A;  1PTO D;  1ET9 A;  3EIV A;  2F0T A;  1LT3 D;  4AYB G;  4KJN A;  4A76 A;  1U4L A;  1NR4 A;  1WTO A;  1STY A;  4KHZ A;  1I4G A;  2TMP A;  4BA2 I;  3W1B A;  3CW2 C;  3VYR A;  4R4Q A;  1Q81 C;  4BY7 H;  1BCP B;  1W3S A;  1PTO H;  1U9R A;  2E8G A;  3KUP A;  3K0Y A;  1I3Q B;  2KED A;  2A68 C;  2B63 G;  4G7O C;  2BH2 A;  1IYV A;  4A3J B;  3J81 j;  3HRZ C;  2IL8 A;  2DNC A;  2EIF A;  3S2H B;  1B1Z A;  2CQO A;  1LTL A;  1WI5 A;  2Z6K C;  5CGK A;  4GKK Q;  3CD6 A;  1H9J A;  2AQ2 B;  2JA5 G;  3HEJ A;  4HED A;  2IWH A;  4ZUJ A;  3KJO A;  5CV7 A;  5IWA Q;  1VMP A;  1P16 A;  3ZJY C;  3ITP A;  4OHJ A;  2KJX A;  3NSW A;  3QWN A;  3C2P A;  2AUK A;  2IY5 B;  4NXN Q;  5IT9 E;  2F0G A;  3ERS X;  3GQB A;  1V1P A;  1EY6 A;  4LAA A;  1ROD A;  1Y1W B;  4LFC Q;  1EY4 A;  5M3M B;  2MFI A;  1EY7 A;  4IJH A;  1AN8 A;  4HJ7 A;  2RBM A;  4JI6 L;  2PZW A;  1V1P B;  3GTG H;  3FP9 A;  1I6H H;  5JJL A;  4UY8 C;  2YU9 H;  3S15 B;  3BZC A;  3GTK B;  1EIH A;  2HQE A;  1VQI A;  1T9H A;  1I5F A;  3U9S A;  4ZK9 B;  4WJ4 A;  4IOC A;  1CSQ A;  2JA8 H;  1L2F A;  2SNS A;  2ZJQ A;  1CQV A;  2RCF A;  1PFN A;  1N32 Q;  1JQY D;  4A3I B;  1JT8 A;  1PFM A;  1UAP A;  1K28 A;  1EZ8 A;  1HZA A;  1K0R A;  3MWY W;  2BE5 D;  5IP7 H;  4X65 L;  5J22 A;  1JIC A;  4C3I H;  1CZG A;  2KCN A;  3KK7 A;  5HUR A;  1LTA D;  4IFD I;  1II3 A;  4N9T A;  5COY A;  2PNH A;  3MFG A;  3ULP A;  3HOW B;  2NTS A;  3V05 A;  4OIJ A;  2QKI C;  4JCV E;  4ODG A;  1C48 A;  1AZQ A;  1C4Q A;  3A7A B;  2D0P A;  4JI2 L;  4DR7 L;  4IN3 A;  2B39 A;  2B2U A;  4K0K L;  5K5P A;  5C6A A;  1TWA B;  1PRT C;  1KDA A;  1JJG A;  2E75 C;  4I65 A;  1FL0 A;  1UE6 A;  1EU4 A;  4QCL A;  2YTX A;  2Q2U A;  1ZYR C;  2P5Z X;  3CC4 A;  4BY1 G;  4HIM A;  4B08 A;  1ENF A;  3T4A C;  3JAM L;  2ZJR A;  4ZYS A;  4DV5 Q;  2Z0S A;  3G7L A;  3TQY A;  1JE5 A;  4JI0 L;  3K0X A;  2VZA A;  3AYH B;  4IUU A;  4HIK A;  1XMQ Q;  4BBS G;  3BZD B;  1O78 A;  3QIA A;  3E9I A;  5EPK A;  4OO1 I;  1WCM H;  3DEO A;  1WYD A;  2UUC Q;  2ZXO A;  5JPN C;  1PH4 A;  1GHJ A;  1K83 B;  2Z4I A;  3F1Z A;  3GTM B;  4HTH A;  3S14 B;  3K5O A;  4K5V A;  4JBW A;  1ONL A;  4OWT B;  4X62 L;  3TRE A;  2F0L A;  2K05 A;  2QDL A;  1EWH A;  2R6G A;  1G29 1;  1NBW A;  2K33 A;  3J80 L;  4G7Z C;  1TWF H;  3EVQ A;  5IYB H;  3VR6 A;  1C7Y A;  1VQ6 A;  2F3I A;  3BVG A;  2XWB B;  1S5E D;  4KHP Q;  3CHB D;  4MTK A;  1CHP D;  3S1Q B;  2ES2 A;  3GTJ B;  5IOC A;  1PTO C;  5EKL A;  4DR5 Q;  1MI2 A;  1JB3 A;  4GS3 A;  3R3O A;  1RF2 D;  5C0X H;  2ZM6 L;  2UUB L;  4A3J G;  3J81 i;  3S2D B;  1FJG L;  1SE8 A;  3DM1 A;  3FRP B;  2ICE C;  5IE8 A;  5KEE A;  1BBU A;  1ZEQ X;  1XPO A;  3CRK C;  1LV9 A;  4DR2 L;  5KGU A;  5E7N A;  3HOV G;  2N78 A;  2DJG C;  4QGU A;  1XNR L;  1GHK A;  3BU2 A;  1W6J A;  1J6Q A;  1F2Y A;  1I4X A;  1E2W A;  1HPC A;  3MTS A;  1STA A;  1HNX L;  1HJP A;  2KVM A;  4ZCK A;  4GKJ Q;  1STB A;  4K5W A;  3U4Z A;  2K5V A;  4CDD C;  1FNV A;  3X3M A;  3DEP A;  1ESF A;  2JA7 B;  1Q7Y C;  3S16 H;  1Y8N B;  1Y1W G;  1FNW A;  1GUG A;  5I9P A;  1N9W A;  2R93 B;  5M3M G;  2DY8 A;  2EY1 A;  2FJ2 A;  2RKS A;  2QDB A;  1EEF D;  3I4N B;  4CGY B;  1A8V A;  1NSN S;  4CHT B;  1NAP A;  4GLV B;  5KND A;  5M5W H;  1F77 A;  1MBY A;  1VQD A;  1CA6 A;  2ZTD A;  1DD2 A;  4XQJ A;  2UUA L;  1J5E Q;  3PUY A;  4ABN A;  2NVY B;  1Z9F A;  3P7J A;  1GUN A;  4IFD G;  4DNI A;  2IX1 A;  1YVC A;  1U4P A;  3GTL H;  4WJW A;  4M8A A;  4NB3 A;  4L8J A;  4A3I G;  3RNU A;  2A8V A;  4LK1 C;  5DEH A;  1N8R C;  5J39 A;  5JVH 3;  3LWE A;  2HHH Q;  1Z47 A;  2Q8I B;  2I0Q A;  1B53 A;  1HA5 A;  3TBI B;  3HOU B;  2G5D A;  3D4W A;  4X64 Q;  1QZH A;  2RHS B;  4NP5 A;  3HG9 A;  2PCF B;  1SMY C;  4MNO A;  1JB7 A;  3HOX B;  1B7Y B;  5I6Y A;  4LFB Q;  3AFP A;  4RCN A;  1I4H A;  3UI2 A;  2QGQ A;  2EOT A;  3J7Z C;  2BE5 C;  1LT5 D;  4A3K H;  2K5Q A;  4YY3 Q;  2D62 A;  4X3U A;  2JN4 A;  1TS5 A;  3GV6 A;  4A3F H;  5BN4 A;  1IBK Q;  3HS0 C;  1E22 A;  5FJ8 G;  1VQC A;  2EYM A;  5KRU A;  3FKI H;  5D3I B;  3ONA B;  3A8I E;  4OO1 G;  1JOK A;  3NK9 A;  1HZC A;  4JOI A;  5C3E B;  1Q12 A;  3K5M A;  1LTT D;  1I94 Q;  3G71 A;  5GRO A;  3H0G G;  2F0Q A;  1VS0 A;  1O7I A;  4LUZ A;  1WTQ A;  4NDX A;  2G9H D;  2XSC A;  4A3B B;  2AQ1 B;  3MXU A;  1PRT B;  1G6P A;  3H15 A;  3TP5 A;  4RWS C;  1OXS C;  2J4X A;  5ELO A;  2JE6 I;  3CCM A;  1SN8 A;  3S1M B;  1YJW A;  3FDT A;  4K2K A;  3VYT A;  1HTL D;  2CHB D;  3NUC A;  5M5X H;  1LUZ A;  5IYC G;  2ZXR A;  1NMF A;  3M4Q A;  5M3F H;  1EFI D;  3TEH B;  2GVA A;  4L5R C;  3G6E A;  1X3E A;  4N8X 1;  1GOZ A;  5GAG C;  2HIV A;  1VQM A;  4NPS A;  4BBR H;  3OMG A;  2UXD Q;  4C1N K;  1BOS A;  3K57 A;  4DV4 Q;  2SDF A;  1SFO B;  4E6I A;  4EX5 A;  3OTO L;  1STN A;  3A8K E;  1JMC A;  2E2I B;  2NZ1 D;  3G48 A;  2DJF C;  1XMO L;  4C2M B;  1N36 Q;  2R3Z A;  3SK4 A;  2RCN A;  2I5L X;  4RH6 A;  5C4Z A;  3PO3 B;  4YCW A;  1PTO B;  4JI1 L;  2D9U A;  2HQL A;  1TII D;  3T1H L;  4IPD A;  4V19 0;  4A3E G;  1H95 A;  3MFY A;  1YEZ A;  4IJL A;  4CDF C;  2K14 A;  3F2C A;  1A6X A;  5C4J H;  4HN7 A;  1Q3L A;  2JA7 G;  4PMB A;  2K04 A;  4MTN A;  5CV9 A;  5IT9 c;  1Q90 A;  1KRT A;  4J6H A;  4CDC C;  3VA7 A;  5C4X H;  2R92 H;  2K5H A;  3TRZ A;  2F0S A;  2K1B A;  2WAQ B;  5JPM C;  2PPB C;  2Z9H A;  1OXX K;  4JVZ A;  4IPC A;  1E0B A;  2HDL A;  5IGF A;  1STE A;  1VQL A;  4POG A;  3OWE B;  3N52 A;  3GTQ H;  4JI3 L;  1ILQ A;  5EBC A;  2VB2 X;  1IBL Q;  1ENC A;  1G8Z D;  1YBY A;  1DJR D;  1MJC A;  1HNW Q;  5C5L A;  4DXF A;  2WFW A;  1ESR A;  1I6H B;  3HOU G;  4B3R Q;  4GKK L;  2YV5 A;  3A5Z B;  1Y1V B;  4WOR A;  1A15 A;  4BA1 I;  4A3M H;  2SNM A;  2E74 C;  2JA8 B;  3OSO A;  1EQV A;  2WB1 E;  1ILP A;  2EY2 A;  1QWY A;  4DR6 L;  1TU2 B;  1K9M C;  4NXN L;  1KNE A;  3H6M A;  4LFC L;  1SYF A;  4EQP A;  3BYT B;  2MO1 A;  3MXN A;  3OW2 A;  1KQS A;  3K59 A;  3IKJ A;  3SVM A;  2EYP A;  4A93 H;  5T1I A;  1JOR A;  4UHV A;  3I55 A;  5C3E G;  2NZH A;  3UE0 A;  1KIX A;  4IPG A;  4RGN A;  1GXD C;  1M8A A;  3MXN B;  1BXT A;  1OXT A;  2LXJ A;  1E1O A;  2UXB L;  4QUC A;  2KCT A;  2NWG A;  1SR3 A;  3SR1 A;  1N32 L;  4X3K A;  4JBM A;  1KAB A;  2BDO A;  2BDN A;  2K28 A;  2QW7 A;  4DR4 Q;  1XX8 A;  3GTO H;  1A2U A;  3WOE A;  3Q23 A;  3HOY G;  1PXU A;  1BKB A;  5LMU Q;  3W5O A;  4EGV A;  4ID6 A;  1QNU A;  4H13 C;  4OX9 Q;  2K5W A;  2NYZ D;  1KL9 A;  2F0F A;  1LYL A;  2E76 C;  1EU3 A;  5IT9 L;  1RKN A;  2MQH A;  3CRL C;  4CBV A;  4DR1 Q;  1NJI C;  1N33 Q;  2OTJ A;  2F3V A;  4HCS A;  1SND A;  4KLK A;  2R7Z H;  3KJP A;  4LUV A;  2LSS A;  4UP8 A;  1JOQ A;  5IOD A;  1VQG A;  1G6Z A;  3STB D;  3PQI A;  1B50 A;  2F03 A;  1FGU A;  1PH3 A;  5LMN W;  1TWF B;  1BF4 A;  4YHH L;  5TSS A;  3CCE A;  3C1F A;  3OMC A;  5C5M A;  2RA4 A;  1SE3 A;  3PO3 G;  2XIW A;  4DV5 L;  2EJF C;  4IUR A;  2OEO A;  2VNU D;  1AH9 A;  3A0J A;  4LF5 Q;  2KQ3 A;  1QVG A;  2ID0 A;  1XMQ L;  1V43 A;  1HCZ A;  1TWG B;  4TRD A;  2KHI A;  2UUC L;  1J8I A;  3AEV A;  3WWV A;  4XIG S;  4JYA Q;  3ERQ A;  4FF1 A;  1HUN A;  2I07 B;  1G51 A;  3Q8D A;  4J8Q A;  4F8M A;  2I46 A;  3D4R A;  4X6A H;  2A74 C;  4K8I A;  1CHQ D;  5E1F A;  3ZYY X;  2C35 B;  1YNN D;  3P75 A;  2UU9 L;  4LF8 L;  2WAQ G;  1U5K A;  4A75 A;  4O0A A;  4KHP L;  4FNF A;  4TKO B;  3M3Y H;  1CA5 A;  2HDM A;  5IGG A;  5LHY 1;  1LAB A;  4DK0 A;  4FXG C;  4RGT A;  2MHV A;  4DR5 L;  3S16 B;  1K8A C;  1B70 B;  3NEN A;  1I4Q A;  2RHQ B;  2EXD A;  1YI2 A;  5M5W B;  3RZD H;  5CBE E;  1KLG D;  4BXX G;  1RTN A;  3E3X A;  5EGT A;  2RDG A;  1Y1V G;  2A1A A;  1BUV T;  1PH6 A;  2M00 A;  2X69 A;  5A35 A;  1V8Q A;  2JA8 G;  4UAI A;  1K8M A;  3J7A 5;  1F9Q A;  2F0P A;  3GTL B;  4GKJ L;  3CCL A;  1CFM A;  4JI7 Q;  1SJH D;  4PMW A;  3RD4 A;  2B2T C;  2OCE A;  4DNT B;  1PH5 A;  2VUM G;  1AP0 A;  1XTD A;  2Z6B A;  2JA9 A;  1GUS A;  4Y7N H;  3V2T A;  2JEA I;  2NN6 H;  3I73 A;  2X6L A;  3JAM c;  3B6Y A;  4RGM A;  4KKS A;  4FF4 A;  1DXM A;  1SYC A;  5JEA J;  3KLW A;  1VQO A;  1VQ4 A;  3HOZ H;  4KKT A;  4U68 A;  1ENA A;  1E7Z A;  1V1O A;  2EZV A;  1I4P A;  4ZUI A;  1AZP A;  3MC0 B;  2NVQ H;  5CC4 A;  3NXW A;  4QQB X;  4KD4 A;  2ZXP A;  3UDI A;  1PH2 A;  2AUJ D;  3K7A H;  1X3F A;  1J5E L;  2RSN A;  2HCI A;  3K5L A;  2G9D A;  3PO2 B;  5BN3 A;  2D2C C;  1CM9 A;  2A6H D;  3J80 c;  1AE3 A;  1LO5 D;  1SYD A;  2R7F A;  3L7Z C;  4A3F B;  4CJ0 B;  1IBM Q;  4ZKB B;  2EY5 A;  3V96 A;  3FKI B;  3U50 C;  2B3G A;  4LF4 Q;  1RD9 D;  1I50 H;  1KTK A;  1JJC B;  4X64 L;  5C44 G;  1SAP A;  3GDE A;  5C0X J;  1EYC A;  4HMI A;  4L5Q A;  1EIY B;  2A6E D;  2RSO A;  3I2Z A;  1DOL A;  1CSP A;  4LFB L;  5IP9 H;  4CJ1 B;  1TWC H;  1FVI A;  4FVM A;  4K14 A;  4XDX A;  5FKA C;  3KLR A;  3E9H A;  4YY3 L;  5FO9 B;  2B2V A;  3SK8 A;  1GJX A;  1IZ6 A;  5L37 A;  3DHQ A;  1KXL A;  1WJJ A;  4YCV A;  5A2Q E;  4DV6 Q;  1Z6H A;  3K6O A;  1IBK L;  1STG A;  4RKL A;  3T13 A;  4DFA A;  3J7A F;  4KN7 C;  1AW7 A;  3C3L A;  1CUK A;  1WTW A;  5M5X B;  1MD2 D;  1G91 A;  5M3F B;  5IYB G;  2EYF A;  3H3V C;  1PYW D;  5D3D A;  2VQE Q;  1TXY A;  2VS1 A;  4KN4 C;  1GO3 E;  1VQH A;  4Z9C B;  1I94 L;  2H5X A;  2B2W C;  1B4O A;  2B8F A;  4DK3 C;  1A0I A;  1F2L A;  3STB C;  4IUP A;  4JOI C;  1GKH A;  1B2T A;  4IUT A;  1EWC A;  1HUM A;  1DGS A;  4LFA L;  2KOL A;  3NTI A;  4JI5 Q;  3RLF A;  2EYH A;  1X54 A;  1Q86 C;  4BWG B;  1X32 A;  4OWX B;  5CMD A;  4FO2 A;  1Q8K A;  2EVB A;  2CQA A;  4HJA A;  2B2Y A;  5FLM G;  2PQA A;  3VYU A;  1LAC A;  4DV0 Q;  1ICF B;  4RHS A;  5JEA H;  1T5E A;  1WTV A;  3CPW A;  3DWA A;  3EQL C;  4ZAI A;  2PQA B;  2UXD L;  4R4I A;  5C4J B;  1GUO A;  4DV4 L;  3OIP A;  3I72 A;  3KDF A;  3PMF A;  4DF7 A;  2FIN B;  3AU7 A;  5T1G A;  1YNN C;  1HFN A;  5KNC A;  3TZD A;  3D6W A;  2R92 B;  5C4X B;  3J81 L;  2WAC A;  2LFN A;  5I4D A;  2L5T A;  1YNX A;  4P2C B;  4RG1 A;  2I5M X;  2ZTC A;  5M5Y H;  4WFN 3;  3S1N H;  1PDQ A;  1EZ6 A;  4CJ2 C;  1A3V A;  3GTQ B;  4KJO A;  3WOF A;  1HR0 L;  1QB5 D;  2JP1 A;  1KAA A;  1QUQ A;  2A5H A;  4RGO S;  3KF8 A;  2K6A A;  4H44 C;  2R7D A;  1X3P A;  1QUQ B;  4YIJ A;  3G4S A;  3VA5 A;  4P73 A;  4O1N A;  1F2Z A;  3KF8 B;  1Y8P B;  2B2T A;  3NBI A;  3WDN A;  5IGB A;  2OWO A;  3BVM A;  3KF6 A;  3D0F A;  2E2H B;  4A3M B;  2J0T D;  4FF2 A;  3J80 i;  5EBD A;  2RDF A;  5JJZ A;  4DV2 L;  3SDZ A;  2L4N A;  2Q8T A;  3MAQ A;  3P20 A;  5EAY A;  4DNR B;  3KF6 B;  4HR7 B;  3PO2 G;  1PZK D;  3I4L A;  1QOH A;  1KC8 C;  2KUM A;  4GLX A;  2LY7 A;  1D5M C;  4BY1 H;  2I5H A;  1PH8 A;  4FP5 D;  1KLU D;  2D5D A;  2IHE A;  3DMU A;  3FKI G;  5LL6 S;  4DN4 M;  2XWJ B;  2CCZ A;  1S5C D;  3PIP 3;  4BBS H;  4KK7 A;  4B3R L;  4IPH A;  1KDC A;  2BOS A;  2VQF L;  3FVQ A;  2A6H C;  3NWT A;  3I4M H;  3HKZ B;  2E5L L;  5KYI A;  1X9N A;  4P71 A;  1X65 A;  3BVZ A;  3D31 A;  5JOB A;  4JV5 Q;  4DU9 A;  1CZW A;  2GA4 B;  2YTV A;  3FHW A;  4P74 A;  5IGC A;  4JBK A;  1PH1 A;  4B3T Q;  1U4R A;  4DV1 Q;  3GTO B;  4GOP C;  1NUC A;  1YHB A;  2QIL A;  3NQI A;  4DAY A;  1XNQ L;  1XPU A;  2A6E C;  4I7A A;  3HFZ B;  2Y0S E;  3CCR A;  2CH4 W;  1AE2 A;  4XTC S;  1S3O A;  4PZ6 A;  5CR3 A;  2F0U A;  5C3W A;  3HOW G;  4KY7 A;  1WTR A;  2EQS A;  1S5B D;  4QJF A;  1UE1 A;  1OTC A;  4M1U B;  1XYI A;  2JSO A;  1SE4 A;  4MHE A;  2R7Z B;  1O7Z A;  2VXW A;  2IX0 A;  3HOV H;  4LF6 L;  1IW7 D;  3PV0 A;  1LTG D;  4KY5 A;  4R9W A;  4XQQ A;  3M4P A;  4JI8 Q;  1YJ9 A;  2RDH A;  2F52 A;  2B2W A;  1K3R A;  2IHF A;  4CKB A;  2E2J H;  4UP7 A;  5ELC A;  4Q0F A;  2JEB I;  2KHS A;  3R8B A;  5LMU L;  4DPG A;  3Q22 A;  4OX9 L;  1EIG A;  3A8J E;  3J81 E;  3NQT A;  4G4K A;  1SNM A;  4IUN A;  3X3N A;  2EPB A;  3UDX A;  5M3M H;  4HAE A;  3D4D A;  4DR1 L;  1N33 L;  2GVB A;  1U0L A;  3TME A;  2FFK B;  5J3B A;  4JBJ A;  5CV4 A;  2PYK A;  2C9O A;  5COR A;  2IW3 A;  1WD1 A;  4LNQ A;  5ELF A;  3H3V I;  3SK5 A;  1B9M A;  1X55 A;  3OIQ A;  2F0K A;  2K75 A;  2ALY B;  3GO5 A;  4V0B A;  1E1T A;  2RVL A;  1HH2 P;  3CCU A;  1UE7 A;  2F0J A;  2FXQ A;  3VYS A;  5C4X G;  1IL8 A;  1MHW C;  1Q46 A;  4JI2 Q;  1D5Z C;  2FHT A;  2KA7 A;  4RKB A;  2F4I A;  4DUY Q;  4A3I H;  4K0K Q;  3HKZ E;  3MA2 B;  1IKM A;  2ICI A;  3SXH A;  1WTP A;  1UUP A;  4XT1 B;  2K5N A;  5EQ0 A;  3M3Y B;  2WB1 B;  1IXR A;  4GZY C;  1FYC A;  1H9S A;  2F0N A;  1GUW A;  3HGB A;  4UPA A;  4OWW B;  3AMU A;  5FO7 B;  4AIM A;  1W6K A;  3OHX C;  1G2T A;  1VMC A;  1H9S B;  1HNZ Q;  4JYA L;  3RZD B;  2YYZ A;  1EY5 A;  5DM6 3;  4LF7 Q;  2K7V A;  4O42 A;  4BY7 B;  2JYO A;  4A3M G;  1B3A A;  1PH7 A;  4KMU C;  1PLF A;  2KBN A;  2OF1 A;  3PGZ A;  1CI3 M;  1HFG A;  4X62 Q;  5GAD C;  2ZJP A;  3PF4 A;  3IL8 A;  4RAU C;  1S5D D;  5CV6 A;  2PQE A;  2V4D A;  4Y7N B;  1K8G A;  1IKL A;  1IL2 A;  1FR3 A;  3MVV A;  4JI4 L;  4R4T A;  3UDF A;  2R93 G;  3H0G H;  3CQZ H;  2RQX A;  3HZX A;  3I4N G;  3HOZ B;  1CT1 D;  5FLX E;  2K01 A;  4P75 A;  4K8J A;  3EA6 A;  2Q2I A;  5KYL A;  2KCM A;  1F9R A;  2ZM6 Q;  2NVT H;  2NVQ B;  1A63 A;  2AKW B;  4Y52 H;  4KD3 A;  2NN6 I;  2NUC A;  3GTM H;  3CCQ A;  1Q82 C;  3LNN A;  3PF5 A;  4QL5 A;  3H91 A;  3W2D A;  1XNR Q;  5LL6 X;  5IYC H;  2EYL A;  4K5X A;  4N8F A;  3MHB A;  2IX3 A;  2MO0 A;  3GTG B;  3QJY A;  4B3M Q;  2O5I C;  4K6D A;  2HCC A;  4PV1 C;  1I50 B;  1QIL A;  2YU9 B;  2IJ0 A;  3RN5 A;  3S1Q H;  2CFM A;  4OXP A;  1EEI D;  1VCI A;  3S17 H;  4GOP A;  3D8G A;  3HOX G;  5IWA L;  1PHJ A;  3QOJ A;  1TWC B;  3K58 A;  1H9M A;  1TY0 A;  2PZT A;  3EBE A;  1VQ5 A;  4A3L G;  3M4O H;  4AYB B;  4PMC A;  4GOP B;  3Q0A A;  1UWV A;  1MIU A;  4QF4 A;  3DM3 A;  3KBG A;  3S24 A;  4BS9 A;  1B9N A;  1IBM L;  2JA6 H;  4GN5 A;  2UUA Q;  4C3I B;  1C8C A;  2X6G A;  2JK8 A;  3VR5 A;  1AEX A;  4LF4 L;  1HZ9 A;  4GNX A;  1AFP A;  3QG1 A;  4A3E H;  3CC7 A;  3I7F A;  4LWC A;  1BCP F;  2Z4H A;  4TSS A;  1CQF A;  2N8N A;  4FDB A;  4N9P A;  2WII B;  1CTM A;  3RR5 A;  4UP9 A;  1TR5 A;  4C3J H;  1SBB B;  4B3S Q;  4A3B G;  1Q1E A;  1IYJ B;  4ZKC B;  4DA2 A;  3RN2 A;  3CME A;  1R4Q B;  1SNQ A;  3I90 A;  4DV6 L;  3T56 B;  1X56 A;  2M2L A;  1BDO A;  4L63 B;  4OL7 A;  4DUZ Q;  3GTP H;  3FMC A;  2EE1 A; 
#chains in the Genus database with same CATH homology
 4MIU A;  3T51 B;  5I6W A;  2B2V C;  1X3Q A;  1F2M A;  2EJM A;  1GUT A;  1UEA B;  2K32 A;  4EQO A;  3PIO 3;  1WCM B;  1ET6 A;  3BDC A;  3SK6 A;  2F0W A;  1BNZ A;  3L3O C;  3TDQ A;  3K5N A;  4Q5V A;  4UDU C;  3QOL A;  2CW0 D;  5EJW A;  4XYO A;  3Q6S A;  5E3F A;  1Q8I A;  2BA1 A;  5FK9 C;  4DK1 A;  4LJZ C;  1E2Z A;  4ZLT F;  5M5Y B;  3S1N B;  3T53 B;  2F0H A;  1EYA A;  2VB3 X;  3KLS A;  5A2Q L;  5EPJ A;  2B2Y C;  1DOK A;  1RHP A;  2MJ8 A;  3NTH A;  2NN6 G;  3E5S A;  1L0Y B;  3IFT A;  4QMG A;  2EXZ A;  4WRD A;  3MXP A;  4LMQ D;  5C0X I;  5I2X A;  3MZ5 A;  5I2Y A;  3I3C A;  1TVX A;  1EL0 A;  5ELB A;  4F88 A;  2N55 A;  5IIF A;  2AWN A;  4ULL A;  2H1E A;  4BY1 B;  2KEC A;  4K2L A;  3IAY A;  2KCC A;  2EYJ A;  1ZKO A;  3I4M B;  1JC7 A;  1SNP A;  5EKK A;  3E0J A;  1K8O A;  4EVO A;  1ICW A;  2BCO A;  1JE4 A;  4PNY A;  4H7B A;  1L0X B;  4F7X A;  4U67 3;  3BYY B;  4RFB A;  4C3I G;  2PZU A;  3NP8 A;  2SEB D;  1HHV A;  3BDL A;  1M4V A;  1SEB D;  2A69 D;  1PMR A;  4A3K B;  4DAV A;  5I9O A;  1A3U A;  2H4O A;  2EJG C;  3HOV B;  5DNF A;  1VDZ A;  2PO4 A;  3KBX A;  1HTP A;  3TSS A;  1FNU A;  2PNR C;  1WTX A;  2IT1 A;  2E2J B;  3M4Y A;  5NUC A;  5CV5 A;  1TKW B;  2EY6 A;  5K36 H;  2OXP A;  2EYO A;  5JEA G;  3EJI A;  1SYG A;  4X3T A;  4G57 A;  1DM0 B;  3A7L A;  3GD7 A;  3C46 A;  3LX0 A;  3KLS X;  1SJE D;  1DOM A;  1EOT A;  1O7Y A;  4FXD A;  5AFW A;  3LWU A;  1SMY D;  3E6Z X;  1HXY D;  4BBR B;  4QB4 A;  1IYU A;  3FPP A;  5M9O A;  5J1Z A;  5E4X A;  1HQR D;  3S9W A;  4ZRZ A;  5C0X G;  2Z8L A;  1STH A;  1IHZ A;  2CW0 C;  4IUQ A;  1YNJ D;  5C3X A;  1S4Z A;  3DXJ C;  4XYQ A;  4ME5 A;  4NMZ A;  1TS3 A;  3BG3 A;  3DUZ A;  4X3S A;  3QB3 A;  3A54 A;  1KDB A;  3TP8 A;  1RCV D;  2CVR A;  2K5D A;  1SXT A;  5D14 A;  2QF7 A;  1JR0 D;  1SNC A;  3NBH A;  1DZ1 A;  3OOC A;  3H0G B;  3CQZ B;  3RMH A;  4R8N A;  5ELE A;  1DCZ A;  2HUG A;  2Y0S B;  2NVT B;  4B9X A;  3D3R A;  3TZU A;  4KY6 A;  2LS0 1;  5JVG 3;  2IPK D;  3J7A V;  2O4X A;  5ELD A;  2L55 A;  3OWF A;  1PRT F;  2F0I A;  4C56 C;  1BO0 A;  2MP1 A;  1XTC D;  3RUZ A;  2SOB A;  3SHL A;  1J9O A;  1EYD A;  1I4R A;  3R2I A;  2F0V A;  4ZQ3 A;  3S17 B;  1OXV A;  3A55 A;  1RDP D;  3M4O B;  1TT2 A;  2WV6 D;  4RCO A;  4IFD J;  4IQZ A;  3CKI B;  4KV6 A;  1PZI D;  2JA6 B;  1SDF A;  2A69 C;  4IZ8 A;  3I70 A;  4A93 B;  4A3E B;  2EDG A;  1PTO F;  1LT4 D;  3H94 A;  3FPU B;  3URY A;  4C3J B;  1WD0 A;  4XXE A;  1BCP D;  3NHH A;  1HA6 A;  5C4H A;  1EY8 A;  3C1E A;  1TS2 A;  3MXG A;  1BR9 A;  5FLX L;  4FYD A;  1QJO A;  2MUY A;  1MSH A;  3GTP B;  3NTK A;  4OGQ C;  3VR4 A;  4EQN A;  4NKL A;  3NE5 B;  1TWH B;  2XNA C;  2KEE A;  1I6V C;  1JWU D;  1O80 A;  4A3D B;  1R4P B;  1CK1 A;  1NCV A;  4JK1 C;  4RA8 A;  2O5J C;  4R8I A;  5KNB A;  2N88 A;  2L9H A;  2NTT A;  3F2U A;  2F0M A;  3ND9 A;  1OO9 B;  1BQQ T;  1XXG A;  1SYB A;  3DWQ A;  4FF3 A;  3W3A A;  4CKC A;  4QUF A;  1Y69 U;  3JAM E;  4IUV A;  1F9P A;  3NWS A;  1VF5 C;  4B9W A;  3MEH A;  1LTI D;  1U4M A;  4CKE A;  5CBA E;  1QCB D;  1YNJ C;  2BA0 A;  2XVS A;  4PQX A;  1D2B A;  2XN9 C;  1UNS A;  1DON A;  1TS4 A;  4L6T B;  1BBX C;  2XRS D;  3M7N A;  4KKU A;  1H9K A;  5DM7 3;  1WVL A;  2O2L D;  2PMZ B;  1QNK A;  3J80 E;  2C5C A;  1LTS D;  4IFD H;  1SE2 A;  2ZT9 C;  4KTA A;  3D6C A;  3TP6 A;  3DWP A;  3HOY B;  4MN3 A;  3TN2 A;  4K6L A;  1TQO A;  2QEJ C;  3M85 A;  4H0L C;  4FXK C;  2Q8R E;  2A73 B;  4OIK A;  5G3L D;  3SEB A;  2K03 A;  2WKD A;  1F9S A;  1S5F D;  1EQT A;  1KNA A;  2F3W A;  2QCP X;  1XWE A;  3PUX A;  3Q24 A;  4OO1 H;  3HP3 A;  1SSO A;  3AB9 A;  3P1H A;  4A3G B;  3OPO A;  1LT6 D;  4IAL A;  2DNE A;  2MPM A;  3I8Z A;  4HSV A;  1E2V A;  3R2T A;  2Z1C A;  3K7A B;  3PUV A;  1LLR D;  4TQU S;  1FD7 D;  3L9A X;  1QE6 A;  4C3J G;  1HQM C;  5ISR A;  3ND8 A;  5CV8 A;  4C3H B;  1Z7T A;  2FMC A;  1D5X C;  2WIN B;  1LTR D;  1BCP C;  3OW7 A;  4KI0 A;  3O13 A;  3QO2 A;  3T16 A;  1D1K A;  1JOO A;  2A68 D;  2OT2 A;  4HSP A;  2L0C A;  1G2S A;  4HMJ A;  3SE0 A;  2LMC B;  4C1N I;  1LTB D;  5IGE A;  2WKC A;  3PUW A;  2LKV A;  3FEW X;  2B63 B;  1NR2 A;  3N6R A;  1MSG A;  3EFX D;  2VUM B;  1B44 D;  1IW7 C;  4I7Z C;  4QIW B;  4ILW A;  5FO8 B;  5FOB B;  4KHV A;  5IGD A;  3PUZ A;  3VR3 A;  3M7G A;  3A56 A;  4XQN A;  1PFB A;  1PZJ D;  1JWS D;  1Q1B A;  2JA5 B;  1EY0 A;  4RHR A;  5E4W C;  2NVX B;  5HGT A;  4DXG A;  2WP8 J;  1MGS A;  1ML0 D;  3BDO A;  4HCE A;  2AQ3 B;  1RTO A;  1TY2 A;  2ENB A;  2J7Z A;  5CYU A;  1RJT A;  2PW7 A;  1H9R A;  5F2D A;  1T5X D;  2R61 A;  2TSS A;  3G6J B;  3BS1 A;  4XT3 B;  2M9V A;  5D65 A;  5C44 B;  3RZO B;  1JCK B;  1FGB D;  5KIX A;  5BN5 A;  2B8G A;  2E2D C;  2NBF A;  1D6E C;  1JWM D;  2F0D A;  1ZXT A;  3GP7 A;  1SYE A;  1A2T A;  1Y8O B;  1A3T A;  2B2U C;  1PRT D;  3GV3 A;  3CU7 A;  1EY9 A;  3R93 A;  2XRQ D;  3VR2 A;  1D1I A;  3NPP A;  1SNO A;  2JXM B;  2PW5 A;  1ZYR D;  2DN8 A;  4NW2 A;  5EPL A;  3H09 A;  1DYQ A;  1QG7 A;  4S3S A;  5JAV A;  3I91 A;  4J1M A;  5G3L F;  3ERO A;  3J7Y W;  1O7L A;  2L1B A;  3IFD A;  2F0O A;  5DAU A;  4DGZ A;  1HRJ A;  4DAP A;  4C3H G;  2AWO A;  1OXU A;  1VF7 A;  2F0E A;  1R9T B;  2NB0 A;  4BBS B;  2L12 A;  2F1M A;  2FMM A;  3TP7 A;  4F87 A;  3U9O A;  4G7H C;  5K36 G;  2L11 A;  3S1R B;  5EKI A;  2MGS A;  2DY7 A;  1PTO D;  1ET9 A;  2F0T A;  1LT3 D;  4KJN A;  1U4L A;  1NR4 A;  1WTO A;  1STY A;  4KHZ A;  1I4G A;  2TMP A;  4BA2 I;  3VYR A;  1BCP B;  1PTO H;  1U9R A;  3KUP A;  3K0Y A;  1I3Q B;  2KED A;  2A68 C;  4G7O C;  1IYV A;  4A3J B;  3HRZ C;  2IL8 A;  2DNC A;  3S2H B;  1B1Z A;  5CGK A;  1H9J A;  2AQ2 B;  3HEJ A;  4HED A;  2IWH A;  4ZUJ A;  5CV7 A;  1VMP A;  4OHJ A;  3ITP A;  2KJX A;  3NSW A;  3QWN A;  3C2P A;  2AUK A;  5IT9 E;  2F0G A;  3GQB A;  1V1P A;  1EY6 A;  4LAA A;  1ROD A;  1Y1W B;  1EY4 A;  5M3M B;  1EY7 A;  1AN8 A;  2RBM A;  2PZW A;  1V1P B;  3S15 B;  3GTK B;  1EIH A;  2HQE A;  3U9S A;  4ZK9 B;  2SNS A;  1CQV A;  1PFN A;  1JQY D;  4A3I B;  1PFM A;  1UAP A;  1EZ8 A;  3MWY W;  2BE5 D;  5J22 A;  1JIC A;  1CZG A;  2KCN A;  3KK7 A;  5HUR A;  1LTA D;  4IFD I;  1II3 A;  4N9T A;  5COY A;  3MFG A;  3HOW B;  2NTS A;  3V05 A;  4OIJ A;  2QKI C;  4ODG A;  1C48 A;  1AZQ A;  1C4Q A;  3A7A B;  4IN3 A;  2B39 A;  2B2U A;  5K5P A;  5C6A A;  1TWA B;  1PRT C;  1KDA A;  2E75 C;  4I65 A;  1EU4 A;  4QCL A;  1ZYR C;  4B08 A;  1ENF A;  3T4A C;  3JAM L;  4ZYS A;  3G7L A;  4IUU A;  3BZD B;  1O78 A;  3QIA A;  4OO1 I;  5EPK A;  3DEO A;  2ZXO A;  5JPN C;  1GHJ A;  1K83 B;  2Z4I A;  3GTM B;  4HTH A;  3S14 B;  3K5O A;  4K5V A;  4JBW A;  1ONL A;  2F0L A;  2K05 A;  1EWH A;  1G29 1;  2K33 A;  2R6G A;  3J80 L;  4G7Z C;  3EVQ A;  3VR6 A;  3BVG A;  2XWB B;  1S5E D;  3CHB D;  1CHP D;  3S1Q B;  3GTJ B;  5IOC A;  1PTO C;  5EKL A;  1MI2 A;  1JB3 A;  3R3O A;  1RF2 D;  5C0X H;  3S2D B;  3DM1 A;  3FRP B;  2ICE C;  5KEE A;  1ZEQ X;  3CRK C;  1LV9 A;  5KGU A;  1GHK A;  1W6J A;  1F2Y A;  1I4X A;  1E2W A;  1HPC A;  3MTS A;  1STA A;  2KVM A;  1STB A;  4K5W A;  1FNV A;  3X3M A;  3DEP A;  1ESF A;  2JA7 B;  1Y8N B;  1FNW A;  1GUG A;  5I9P A;  2R93 B;  2DY8 A;  2EY1 A;  2FJ2 A;  2RKS A;  2QDB A;  1EEF D;  3I4N B;  4CGY B;  1NSN S;  4CHT B;  1NAP A;  5KND A;  1F77 A;  1MBY A;  1CA6 A;  1DD2 A;  4XQJ A;  3PUY A;  4ABN A;  2NVY B;  3P7J A;  1GUN A;  4IFD G;  2IX1 A;  1U4P A;  4WJW A;  4M8A A;  4L8J A;  4LK1 C;  5DEH A;  5J39 A;  5JVH 3;  3LWE A;  1Z47 A;  2Q8I B;  1B53 A;  1HA5 A;  3TBI B;  3HOU B;  3D4W A;  4NP5 A;  3HG9 A;  2PCF B;  1SMY C;  3HOX B;  5I6Y A;  4RCN A;  1I4H A;  3UI2 A;  2EOT A;  2BE5 C;  1LT5 D;  2K5Q A;  2D62 A;  4X3U A;  1TS5 A;  3GV6 A;  5BN4 A;  3HS0 C;  2EYM A;  5KRU A;  5D3I B;  3ONA B;  3A8I E;  4OO1 G;  1JOK A;  3NK9 A;  5C3E B;  1Q12 A;  3K5M A;  1LTT D;  2F0Q A;  1WTQ A;  4NDX A;  2G9H D;  2XSC A;  4A3B B;  2AQ1 B;  3MXU A;  1PRT B;  3TP5 A;  4RWS C;  1OXS C;  2J4X A;  2JE6 I;  3S1M B;  3FDT A;  4K2K A;  3VYT A;  1HTL D;  2CHB D;  3NUC A;  2ZXR A;  1EFI D;  1GOZ A;  3OMG A;  4C1N K;  1BOS A;  3K57 A;  2SDF A;  1SFO B;  4E6I A;  1STN A;  3A8K E;  2E2I B;  2NZ1 D;  4C2M B;  2R3Z A;  3SK4 A;  4RH6 A;  5C4Z A;  3PO3 B;  1PTO B;  2D9U A;  1TII D;  4V19 0;  3MFY A;  1A6X A;  4HN7 A;  1Q3L A;  4PMB A;  2K04 A;  5CV9 A;  1Q90 A;  4J6H A;  3VA7 A;  2F0S A;  2K1B A;  2WAQ B;  5JPM C;  2PPB C;  1OXX K;  1E0B A;  2HDL A;  5IGF A;  1STE A;  3OWE B;  3N52 A;  1ILQ A;  5EBC A;  2VB2 X;  1ENC A;  1G8Z D;  1DJR D;  5C5L A;  4DXF A;  1ESR A;  1I6H B;  1Y1V B;  4WOR A;  1A15 A;  4BA1 I;  2SNM A;  2E74 C;  2JA8 B;  3OSO A;  1EQV A;  1ILP A;  2EY2 A;  1QWY A;  1TU2 B;  1KNE A;  3H6M A;  1SYF A;  4EQP A;  3BYT B;  3MXN A;  3K59 A;  3IKJ A;  3SVM A;  2EYP A;  1JOR A;  5T1I A;  4RGN A;  1GXD C;  1M8A A;  1BXT A;  1OXT A;  4QUC A;  2NWG A;  3SR1 A;  4X3K A;  1KAB A;  2BDO A;  2BDN A;  2K28 A;  1XX8 A;  1A2U A;  3WOE A;  3Q23 A;  1PXU A;  4EGV A;  4ID6 A;  1QNU A;  4H13 C;  2K5W A;  2NYZ D;  2F0F A;  2E76 C;  1EU3 A;  5IT9 L;  1RKN A;  3CRL C;  4CBV A;  2F3V A;  4HCS A;  1SND A;  1JOQ A;  5IOD A;  1G6Z A;  1B50 A;  2F03 A;  1TWF B;  1BF4 A;  5TSS A;  3C1F A;  3OMC A;  5C5M A;  2RA4 A;  1SE3 A;  2XIW A;  2EJF C;  4IUR A;  2OEO A;  2VNU D;  2KQ3 A;  2ID0 A;  1V43 A;  1HCZ A;  1TWG B;  4TRD A;  1J8I A;  4XIG S;  3ERQ A;  4FF1 A;  1HUN A;  2I07 B;  4J8Q A;  4F8M A;  2I46 A;  3D4R A;  2A74 C;  4K8I A;  1CHQ D;  5E1F A;  3ZYY X;  1YNN D;  3P75 A;  4FNF A;  4TKO B;  1CA5 A;  2HDM A;  5IGG A;  5LHY 1;  1LAB A;  4DK0 A;  4FXG C;  4RGT A;  2MHV A;  3S16 B;  1I4Q A;  5M5W B;  5CBE E;  1KLG D;  1RTN A;  5EGT A;  2RDG A;  1BUV T;  2M00 A;  2X69 A;  5A35 A;  1V8Q A;  4UAI A;  1K8M A;  1F9Q A;  2F0P A;  3GTL B;  1CFM A;  1SJH D;  4PMW A;  3RD4 A;  2B2T C;  4DNT B;  1AP0 A;  1GUS A;  2JEA I;  3V2T A;  2NN6 H;  3I73 A;  2X6L A;  4RGM A;  4KKS A;  4FF4 A;  1DXM A;  1SYC A;  5JEA J;  4KKT A;  4U68 A;  1ENA A;  1V1O A;  2EZV A;  1I4P A;  4ZUI A;  1AZP A;  3MC0 B;  5CC4 A;  3NXW A;  4KD4 A;  2ZXP A;  2AUJ D;  2RSN A;  2HCI A;  3K5L A;  2G9D A;  3PO2 B;  5BN3 A;  2D2C C;  1CM9 A;  2A6H D;  1LO5 D;  1SYD A;  3L7Z C;  4A3F B;  4CJ0 B;  4ZKB B;  2EY5 A;  3V96 A;  3FKI B;  1RD9 D;  1KTK A;  1SAP A;  5C0X J;  1EYC A;  4HMI A;  2A6E D;  2RSO A;  1DOL A;  4CJ1 B;  4FVM A;  4K14 A;  4XDX A;  5FKA C;  3KLR A;  5FO9 B;  2B2V A;  3SK8 A;  1GJX A;  3DHQ A;  5A2Q E;  1Z6H A;  3K6O A;  1STG A;  4RKL A;  3T13 A;  4DFA A;  3J7A F;  4KN7 C;  1AW7 A;  3C3L A;  1WTW A;  5M5X B;  1MD2 D;  1G91 A;  5M3F B;  2EYF A;  3H3V C;  1PYW D;  5D3D A;  4KN4 C;  4Z9C B;  2B2W C;  1B4O A;  2B8F A;  1F2L A;  4IUP A;  1B2T A;  4IUT A;  1EWC A;  1HUM A;  2KOL A;  3NTI A;  3RLF A;  2EYH A;  4BWG B;  1X32 A;  5CMD A;  4FO2 A;  2EVB A;  2CQA A;  2B2Y A;  3VYU A;  1LAC A;  4RHS A;  5JEA H;  1T5E A;  1WTV A;  3DWA A;  3EQL C;  4ZAI A;  5C4J B;  1GUO A;  3OIP A;  3I72 A;  3PMF A;  4DF7 A;  2FIN B;  3AU7 A;  5T1G A;  1YNN C;  1HFN A;  5KNC A;  3TZD A;  3D6W A;  2R92 B;  5C4X B;  3J81 L;  2WAC A;  2LFN A;  5I4D A;  2L5T A;  4P2C B;  4WFN 3;  1PDQ A;  1EZ6 A;  4CJ2 C;  1A3V A;  3GTQ B;  4KJO A;  3WOF A;  1QB5 D;  2JP1 A;  1KAA A;  2A5H A;  4RGO S;  3KF8 A;  2K6A A;  4H44 C;  1X3P A;  4YIJ A;  3VA5 A;  4O1N A;  1F2Z A;  3WDN A;  1Y8P B;  2B2T A;  3NBI A;  5IGB A;  3BVM A;  2E2H B;  4A3M B;  2J0T D;  4FF2 A;  5EBD A;  2RDF A;  5JJZ A;  3SDZ A;  2L4N A;  2Q8T A;  3MAQ A;  3P20 A;  4DNR B;  4HR7 B;  1PZK D;  3I4L A;  1QOH A;  2KUM A;  2LY7 A;  1D5M C;  4FP5 D;  1KLU D;  2D5D A;  3DMU A;  4DN4 M;  5LL6 S;  2XWJ B;  1S5C D;  3PIP 3;  4KK7 A;  1KDC A;  2BOS A;  3FVQ A;  2A6H C;  3NWT A;  3HKZ B;  5KYI A;  3BVZ A;  3D31 A;  5JOB A;  4DU9 A;  1CZW A;  2GA4 B;  5IGC A;  1U4R A;  3GTO B;  1NUC A;  2QIL A;  3NQI A;  4DAY A;  2A6E C;  4XTC S;  5CR3 A;  2F0U A;  5C3W A;  4KY7 A;  1WTR A;  1S5B D;  4M1U B;  1XYI A;  2JSO A;  1SE4 A;  4MHE A;  2R7Z B;  1O7Z A;  2VXW A;  2IX0 A;  1IW7 D;  3PV0 A;  1LTG D;  4KY5 A;  4R9W A;  4XQQ A;  2RDH A;  2B2W A;  4CKB A;  5ELC A;  4Q0F A;  2JEB I;  2KHS A;  3R8B A;  3Q22 A;  1EIG A;  3A8J E;  3J81 E;  3NQT A;  4G4K A;  1SNM A;  4IUN A;  3X3N A;  2EPB A;  4HAE A;  3D4D A;  3TME A;  2FFK B;  5CV4 A;  2PYK A;  2C9O A;  5COR A;  2IW3 A;  1WD1 A;  5ELF A;  3SK5 A;  1B9M A;  3OIQ A;  2F0K A;  4V0B A;  3GO5 A;  2RVL A;  2F0J A;  3VYS A;  1IL8 A;  1D5Z C;  2FHT A;  2KA7 A;  4RKB A;  2F4I A;  3MA2 B;  1IKM A;  2ICI A;  3SXH A;  1WTP A;  1UUP A;  4XT1 B;  5EQ0 A;  3M3Y B;  2WB1 B;  4GZY C;  1FYC A;  1H9S A;  2F0N A;  1GUW A;  3HGB A;  3AMU A;  5FO7 B;  1W6K A;  3OHX C;  1G2T A;  1VMC A;  1H9S B;  3RZD B;  2YYZ A;  1EY5 A;  5DM6 3;  2K7V A;  4O42 A;  4BY7 B;  2JYO A;  1B3A A;  4KMU C;  1PLF A;  2OF1 A;  1CI3 M;  1HFG A;  3IL8 A;  4RAU C;  1S5D D;  5CV6 A;  2PQE A;  2V4D A;  4Y7N B;  1IKL A;  1FR3 A;  3MVV A;  2RQX A;  3HZX A;  3HOZ B;  1CT1 D;  5FLX E;  2K01 A;  4K8J A;  3EA6 A;  5KYL A;  1F9R A;  2NVQ B;  4KD3 A;  2NN6 I;  2NUC A;  3LNN A;  3H91 A;  3W2D A;  5LL6 X;  2EYL A;  4K5X A;  2IX3 A;  3MHB A;  3GTG B;  3QJY A;  2O5I C;  4K6D A;  2HCC A;  4PV1 C;  1I50 B;  1QIL A;  2YU9 B;  2IJ0 A;  1EEI D;  1VCI A;  3D8G A;  3QOJ A;  1TWC B;  3K58 A;  1H9M A;  1TY0 A;  2PZT A;  4AYB B;  4PMC A;  3Q0A A;  4QF4 A;  3KBG A;  4BS9 A;  1B9N A;  4C3I B;  1C8C A;  2X6G A;  3VR5 A;  1AEX A;  1AFP A;  3QG1 A;  1BCP F;  2Z4H A;  4TSS A;  1CQF A;  4N9P A;  2WII B;  1CTM A;  1TR5 A;  1SBB B;  1Q1E A;  4ZKC B;  4DA2 A;  1R4Q B;  1SNQ A;  3I90 A;  3T56 B;  2M2L A;  1BDO A;  4L63 B;  4OL7 A;  3FMC A;  2EE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...