3KBXA

Human macrophage inflammatory protein-1 alpha l3m_v63m
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
AADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYMSDLELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCL3
publication title Structural basis for the oligomerization of macrophage inflammatory protein-1 alpha
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 11
structure length 66
sequence length 66
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3kbxA00
2K03A 3DEOA 2KUMA 1QE6A 3R93A 1S4ZA 5EPJA 2R3ZA 3MTSA 3IFDA 1F9RA 4IUVA 2HDMA 1ZXTA 4DN4M 3F2UA 2L12A 1NR2A 5T1GA 1KNEA 1ESRA 1U4LA 1DONA 1PFNA 2IL8A 2B2TA 1F9SA 4HEDA 1SAPA 1U4RA 2BDNA 3KBXA 2RA4A 3P7JA 2KEDA 1CA5A 4ZAIA 1WD0A 4R9WA 1HRJA 2X6GA 2MGSA 2MPMA 2Q8RE 3DEPA 3MWYW 1BNZA 4X3KA 1F2LA 2RSOA 4XDXA 1BF4A 4X3SA 4IUQA 1F9QA 1SDFA 1U4PA 1B3AA 2VXWA 2L1BA 1WD1A 1QNKA 4NW2A 1G91A 2X69A 4RAUC 1A15A 2FINB 2J7ZA 1O80A 3D6WA 1ILQA 3TN2A 2XIWA 1B4OA 5CBAE 3I91A 3Q6SA 4IUTA 2NYZD 1F9PA 1IL8A 2JYOA 4OIKA 3UI2A 1WTRA 1B2TA 1ML0D 1X3QA 4O42A 1WTXA 4ZK9B 2HCCA 1MSGA 2B2VC 4IURA 4X3UA 1J8IA 1DZ1A 1XX8A 2K1BA 1EIHA 1EQTA 2N55A 2HCIA 5CBEE 1HA6A 1Q3LA 4X3TA 1EIGA 1GUWA 2L9HA 1O7YA 1VMPA 2K28A 2N88A 1LV9A 4IUPA 5EKIA 1RJTA 5D65A 2Q8TA 4R8IA 2HUGA 2L11A 4OIJA 2H1EA 5DNFA 1NCVA 2FMMA 5EJWA 1HHVA 1O7ZA 1HUMA 2JP1A 3FPUB 3G7LA 1RHPA 1RTOA 2B2WC 2X6LA 4CJ2C 4CJ1B 1RTNA 4ZKBB 3N52A 1TVXA 1EOTA 2EPBA 1SSOA 4XT1B 3TZDA 4HCSA 1KNAA 4LMQD 4UAIA 4CJ0B 2MP1A 3H91A 1WTPA 1WTQA 2NZ1D 1BO0A 1VMCA 1X32A 1PDQA 5EPKA 1B50A 1HFGA 1DOMA 3I8ZA 5AFWA 5E4XA 4MHEA 2B2YC 1JE4A 4RA8A 1QG7A 1X3PA 4ZLTF 4HSVA 1NR4A 4HAEA 3LWEA 1AZPA 3I3CA 2K04A 3I90A 3DM1A 2FFKB 2D9UA 2K01A 2K05A 5E4WC 2HDLA 2KEEA 5COYA 5CORA 5EPLA 1MSHA 1ICWA 1M8AA 1WTOA 1CA6A 2CVRA 1EL0A 1AP0A 1DOKA 1WTWA 1RODA 1HFNA 1U4MA 5JJZA 4XT3B 2B2WA 2EE1A 2FHTA 3ONAB 1XYIA 2B2UC 2M2LA 2KVMA 2KOLA 2RVLA 1WTVA 1B53A 4QUFA 1PFBA 3GV3A 2RSNA 4U68A 2L4NA 3QO2A 2B2YA 5CMDA 1CM9A 1DOLA 1G2SA 3IL8A 2B2TC 1HUNA 3FDTA 2KECA 1J9OA 1IKLA 2B2VA 1IKMA 2NWGA 3HP3A 1PFMA 2FJ2A 2SDFA 3KUPA 1NAPA 1MGSA 5D14A 1G6ZA 4MN3A 5EQ0A 4IUUA 2EOTA 3SVMA 1E0BA 2DY7A 1BBXC 1ILPA 1PLFA 1G2TA 1C8CA 4RWSC 1JICA 2MJ8A 4QUCA 2B2UA 2DY8A 4ZKCB 1MI2A 1AZQA 3GV6A 1WVLA 5T1IA
chains in the Genus database with same CATH superfamily
1Q81C 3GTOB 2D2CC 4HJ8A 4G57A 3PSIA 4XIGS 2BA1A 1ESRA 3T56B 5AJ3Q 1U5KA 1CFMA 2B2TA 2EJFC 1SAPA 2EIFA 2Q2HA 4LF6Q 3HKSA 4LF5L 1VQ4A 3L3OC 1QB5D 3FKIB 3M3YH 3HOYH 1VQJA 3RLFA 3PGZA 2JA6H 1PFSA 4RCNA 4BY7H 4JI4Q 1SYEA 4JV5Q 3MAQA 3TN2A 4DV3Q 4B3SL 1B44D 4LUVA 1V1PA 1SMYC 1HTPA 5BR8Q 5ELDA 1EWCA 1A3VA 4DU9A 3OW2A 1J8IA 1EY8A 4A75A 2UUCL 4G7ZC 2E5LL 4K6DA 4FF3A 2F0SA 4JCVE 1GJXA 2L9HA 5IGGA 2N88A 1L0WA 5AJ3L 3H09A 4RKBA 1EEID 1IL2A 2L11A 1K28A 3CQZB 3JAML 4LF6L 4TRDA 1PH8A 1JCKB 1I94Q 1NTGA 1B3QA 4XT1B 3GQBA 2A6HC 1PZID 2B3GA 3Q0AA 1EWHA 2JA8B 1SNQA 4FF4A 1B50A 1SR3A 3I8ZA 4JI4L 4DR5Q 2IY5B 1EYGA 4JV5L 1X3PA 1NBWA 2MO1A 2JA7G 4DV3L 1EQQA 3PO3G 3D3RA 1SRUA 2HDLA 5COYA 3H0GH 2QDBA 1EL0A 1HNXQ 3RD4A 1HNWL 2N78A 1FYCA 3L7ZC 1TWGB 3NHHA 2IX0A 5K36G 1SMYD 3K5LA 2PNRC 5ELEA 4KKTA 3HOUB 2NVXB 2LY7A 5HURA 2WB1G 1EFID 5JVH3 1BQQT 1I94L 3LWUA 3W1GA 1KC8C 1CM9A 3ZYYX 1Y1WG 1ESFA 3NENA 4LF9Q 4A3KG 5IGEA 4PZ7A 4DR5L 1G6ZA 2A6HD 5EQ0A 1BOSA 5I6WA 1X9NA 4DV4Q 1VF7A 2UUBL 2OEOA 4BBRG 1G51A 4AH6A 3RLNA 4A93G 2A69C 3GTPH 1KLGD 3GV6A 4RCOA 3S1MB 2QF7A 5CV8A 3SXHA 1VQ7A 2PNHA 1VQGA 5EPJA 1LO5D 5KNBA 5M5XH 2RDHA 1YITA 3AFQA 1A0IA 3KLRA 4GN3B 1DONA 1NNXA 1X3FA 2EYOA 2K6AA 3OTOL 1YNND 4DUYQ 3KJPA 4A76A 3PO2B 4A3JG 3S9WA 1LTLA 1XNQQ 5FO8B 2F0IA 3KLWA 4A3BB 1SJED 4LF9L 1LABA 1ZKOA 3T16A 2X69A 4FP5D 1YZ6A 4KJOA 4DV4L 5GAHC 4ZYSA 1BR9A 3S15B 2V4DA 2E75C 4PZ8A 2JYOA 4ULLA 4NKLA 2R61A 4JI7Q 2JA7B 5TSSA 1RKNA 4O42A 1PZKD 1KAWA 2B2VC 3S2HB 1X54A 2F0EA 1XPRA 1R9TH 1SNMA 2D62A 5CBEE 2A69D 1YHBA 2F0JA 2Y0SE 1KABA 5IIFA 3TS0A 2A74C 2M9VA 3EN2A 3MXUA 5JEAH 1O7ZA 1STEA 5K5PA 4DUYL 3BVZA 2EPBA 4FF1A 1XNQL 4HMIA 3NPPA 1STNA 4F88A 3PIPA 1PDQA 2ICIA 3VYSA 1RIPA 4JBWA 2BDOA 1E1OA 1Y1WB 2VQEQ 3A7AB 5C4ZA 5LMUQ 4L63B 2QEXA 4A3MG 4R4TA 4A3KB 2HIXA 4V190 1H9RA 4R4IA 2D9UA 4JI7L 5J22A 1M8AA 1TS2A 5EGTA 1S5FD 2A5HA 3BZKA 2RQXA 4BY1G 3TP8A 4JI0L 5KEEA 4P71A 4XTCS 1TU2B 1FL0A 3CRKC 1WTVA 4LAAA 3CCQA 1PFBA 3CKIB 4JW0A 2L4NA 5IYBG 2B2YA 1AH9A 4FXGC 1DOLA 3IL8A 4FDBA 2A1AA 3QOLA 2BE5C 5M5YH 2NWGA 2AUKA 3HKZE 1PH4A 2SDFA 4JPBW 4A3JB 2PQAB 1OXXK 2VQEL 5LMUL 4JC0A 3SVMA 4NXNQ 2DY7A 1ILPA 1TWCH 3RNUA 1G2TA 2NN6G 2MNAA 5EBDA 2L0CA 1KTKA 2KUMA 1QE6A 1UE5A 3C1EA 3ULPA 2RBMA 4DPGA 3A5ZB 1K9MC 1O7IA 1KDAA 3L9AX 5C0XJ 5GAEC 4EQ5A 2VUMH 4NP5A 2NVQB 1SE8A 2KCMA 1JE5A 1L1OA 2D5DA 3PIP3 1CKNA 2Q8RE 1BNZA 2AQ1B 4N9TA 4J1MA 2M00A 1F9QA 4EQNA 3QB3A 1UEBA 3ZJYC 3PUXA 4GNXC 1M4VA 3K81C 1EQVA 2WAQG 2F4VQ 1P8LA 3CAMA 1SNDA 3HOXB 2R93B 3KK7A 1Q86C 3QG1A 3B6YA 3HOZG 1UE7A 2NYZD 4Q0FA 4O2DA 4CKCA 5KYIA 1PYBA 1X3QA 3AB9A 4IPGA 1VQ9A 1V8QA 2HCCA 4X3UA 2R7DA 2NVXH 4X3TA 3S2DB 5EKIA 3MXPA 2SEBD 4R8IA 2UU9Q 3T53B 2Z4HA 4C2MH 3SK5A 4NB3A 4BY1B 4PMCA 1YJWA 2CCZA 2XRSD 4ZKBB 1WTPA 2Q2TA 1JORA 2ALYB 3F2BA 3MC0B 4A3FG 3STBD 2F4VL 1ZYRC 1JE4A 1LM0A 1C48A 1W3SA 1I3QH 3S1MH 4RGOS 2PW5A 3TDQA 2QILA 5G3LD 1WCMB 4JI5Q 4GN5A 3AFPA 1D5MC 2AWOA 5I9PA 3FHWA 1PH2A 1R4PB 1GOZA 4QJFA 2JA5H 5KIXA 1TT2A 4Y7NB 2F0QA 2DGYA 3S1NH 4A3GB 1PRTB 5ELBA 1CK1A 3MA2B 4HTHA 4H13C 5CMDA 1GKHA 3KF8B 3NQTA 4DAMA 4JBMA 5C44G 4JYAQ 2YU9H 3AEVA 1TS5A 4CHTB 1PXUA 2WAQB 2MJ8A 1NY4A 4MNOA 4APVA 1AZQA 2F0HA 1E24A 3J80c 2YTVA 3VYTA 2BA0A 3MTSA 4POGA 2F0MA 2I5HA 1DM0B 3HOWH 1VS0A 1RD9D 3QR8A 1GD7A 3R2IA 2QDLA 2YYZA 3BU2A 4K2LA 4CDDC 3PF4A 3MXNB 5ELFA 3W3AA 2JE6I 1E2VA 1TWFH 2PQAA 3HKZG 4DNTB 5IP9G 3HG9A 4IJLA 4AYBE 4YY3L 5FLXE 1YVCA 4A3FB 1S5ED 1SROA 1IL8A 1HA5A 1K8AC 1PMRA 1SEBD 3HGBA 1BVSA 1GUNA 1UE6A 3TQYA 5KNDA 2ASBA 4BY7G 2HCIA 4H02A 2K28A 1BBWA 1RJTA 4HMJA 3JAME 2AKWB 1HZ9A 5G3LF 3FVQA 2JP1A 2Y0SB 2WIIB 3K0YA 4DV5L 2B2WC 5BN4A 1RTNA 4CDFC 1VCIA 2K75A 3TZDA 2CHBD 2WV6D 3MXGA 1VQOA 1YHAA 3I4NB 5JEAJ 3QWNA 3I73A 4KN4C 3F1ZA 4HAEA 4L6TB 4DK6C 5C44B 1ONLA 3EROA 2K01A 4V0BA 5EPLA 5CORA 2MO0A 4KY6A 4GOPB 1F77A 3ICEA 2CVRA 1CQFA 2MHVA 1TR5A 1G6PA 3GTGH 1PTOB 5M3FG 4LUOA 1GUTA 2M2LA 4JOIC 1A6XA 1SYDA 3TBIB 1RDPD 5C4XG 3H0GG 1CQVA 4IFDJ 2F0FA 1FGUA 1YNJC 4A3LH 1I4HA 1G2SA 3FDTA 1EZ8A 1JJCB 3I4LA 3P20A 3PUVA 3KUPA 4OGQC 1NMFA 3E9IA 2YV5A 3HKZB 2TMPA 4RGNA 3F2DA 2HIVA 4LF4L 3VYUA 4DUZL 3J7YW 1A2UA 1EY9A 3UE1A 2GA4B 1V1OA 4NXML 1VDZA 3J80L 3R93A 2PMZE 5LMNW 4QB4A 2IX1A 1AFPA 1EY5A 4OWTB 3F2UA 3K59A 3A54A 3H15A 4ZRZA 4H0LC 3UDFA 1F9SA 3NSWA 1F2MA 1IBLQ 3M4OB 3MVVA 5DAUA 1B1ZA 3KF8A 1DYQA 3GTKB 2LXKA 2UXBL 3VYRA 1LT4D 2DJGC 4IUQA 1S40A 2RF4A 1EFWA 1FD7D 2H5XA 4F7XA 2Z6BA 1YNJD 1UE1A 2IHEA 1I5FA 1LUZA 3OHXC 2I46A 5IY0A 5CV6A 1EIFA 5IGBA 1V1PB 4GLVB 3T4AC 3CC2A 2E2IH 2BH2A 4ZK9B 2K5HA 2K1BA 1K3BC 4Y7NH 1XPOA 4P74A 1HA6A 1DJRD 2N49A 3EIVA 4KY7A 3D6CA 2F3VA 2XN9C 3OWEB 4ZUJA 3MXNA 2Z8LA 5M3FB 1D2BA 2VY3A 3CD6A 1RTOA 1EOTA 1TVXA 2FMCA 3SGIA 4KD4A 4MIUA 1QZHA 4LMQD 1GHJA 2QA4A 2JEAI 4PV1C 4PMBA 3GTJH 3K5NA 5C4XB 2PZUA 5AFWA 5JJKA 5IE8A 1Y1VH 3K6OA 3OW7A 1BBUA 1JB3A 3NTIA 5JEAG 4O0AA 4C1NI 3WDNA 2K04A 3K5OA 5I2XA 1I6HH 3A5UA 3CMEA 1UEAB 3H3VH 1VQAA 3C2PA 2WB1E 3PUYA 1CKMA 1QVCA 1SE2A 3RZOB 3W5OA 1TS4A 1Y14B 4JI8Q 3QO2A 1K0SA 1AEXA 1A8VA 4A3CG 4C56C 4IFDG 2CW0C 2NVYB 4X66Q 1PFMA 3ULLA 2R92B 1SE4A 3TSSA 4DA2A 4MN3A 1UUPA 2EYMA 2R7ZB 2EOTA 4BBSB 3SK8A 1Y8PB 1TKWB 5DM63 2PW7A 2IW3A 3GP7A 4JK1C 5I9OA 1JICA 4QUCA 3CMAA 5FJ8H 4YHHQ 1Q82C 3L2PA 4DK1A 4ME3A 3KF6B 1SYCA 3CW2C 5CR3A 3FMCA 5C4JB 3CCMA 3Q23A 1JR0D 4B08A 2A73B 3WOEA 5IP7H 4J15A 1WD0A 1I50B 3GTQB 2A8VA 4G7HC 1ZEQX 4DV2L 4X66L 3JC66 3RR5A 1QNKA 4DF7A 2VZAA 2Q8IB 1K83B 4KV6A 3K7AB 4AYBB 2K14A 5I6YA 2QGQA 1MSGA 1TWAH 5FKAC 3J81c 3M7GA 3J81j 3HRZC 2K5DA 3ERQA 1PH1A 1Y8OB 1J5EL 4GZYC 1QVFA 1Z7TA 4LWCA 4GKKL 1HUMA 4TQUS 4TVAB 4P72A 4FNFA 4CJ2C 1SYGA 3N52A 4DR2Q 4JI6Q 5JOBA 3H91A 5JPMC 3HOVG 1CUKA 3I4MB 1FNVA 1N34L 5M3MH 2VB2X 3VA5A 1EUJA 3H3VC 3IAYA 3ITPA 2FFKB 2K33A 4B9XA 3RZDH 2F0KA 2PCFB 1STYA 1DOKA 1PRTD 2XNAC 3GTMB 1HR0Q 3M4QA 4A3IH 2OT2A 3PIOA 2EXDA 4C3HH 1TWHH 1Q12A 1VQCA 2KVMA 4C3IG 4OONA 2WKCA 5C3EG 1STGA 5IYCG 4OELB 2WP8J 2RHSB 2RSNA 4U68A 4DR2L 4DV6Q 2ZXPA 4CGYB 3HFZB 4KD3A 2K5NA 1NAPA 2JA5G 3JAMi 5BR8L 4QCLA 3CRLC 4EVOA 1E0BA 1C9OA 1VQFA 4DR7Q 2F0UA 2ZM6Q 2XRQD 1CTMA 4K6LA 4OO1G 3DEOA 1YNNC 5DLQE 4BXXG 1ENAA 2EYHA 1PH6A 1LT3D 2FXQA 1EQRA 5JPNC 4DN4M 5CV9A 3KOJA 1PYWD 2HHHQ 1C4QA 1L1OB 2PMZB 1U4RA 5GROA 1CKNB 2KEDA 4J6HA 4MTNA 4KN7C 5C5MA 4LNQA 2MPMA 3MWYW 3CCVA 4DV6L 2WAQE 2KHSA 1RF2D 3GTLH 4GLAC 2KBNA 1BUVT 2I07B 1W2BA 4DR6Q 2F0OA 3Q22A 1U0LA 1HNXL 4K2KA 3HOVB 2F03A 1F2YA 2F0GA 4P75A 1EZ6A 1CI3M 4PQXA 4RFBA 3PIO3 3KF6A 1D5ZC 1ML0D 4ALPA 5KYLA 4RH6A 3J81L 2OTJA 3MHBA 4YWKA 1EIGA 5IYDH 2PPBC 4HR7B 3V96A 1FJGQ 1FGBD 3OMGA 1LTID 2ATWA 1KIXA 2X6LA 4C3IB 5IGCA 1SSOA 4TSSA 1PRTF 5LL6X 5C3EB 2KCCA 2MP1A 1VMCA 2HD3A 3FPPA 4DR6L 1Q1EA 2XWJB 4I7AA 3J81i 1PH9A 2C35B 1H9SB 4A3EH 3EBEA 2EY1A 3PO3B 3NWSA 4UPAA 5E4WC 1EYCA 3LGJA 1SN8A 1X3EA 1YEZA 1E22A 4PNYA 5A35A 4FYDA 3TP5A 1A63A 2J0TD 2WB1B 1T9HA 4C3JH 5NUCA 4K5XA 4L5TA 1K83H 4K5VA 2E2JH 1ENCA 3HP3A 3GTOH 4XQQA 2FJ2A 3K7AH 3CCEA 4BBRB 3KDFA 2E2JB 3DMUA 2I5MX 4A93B 4RWSC 2ZJRA 1LT5D 4A3LG 1OTCA 4IFDI 3S1RB 4B3TQ 4KHZA 3J80E 5JAVA 3F2CA 3FKIH 4DNRB 2B63G 2EY6A 3OWFA 3UE0A 1F9RA 5L37A 5A2QL 1RCVD 1TXYA 1IXRA 3RUZA 2L12A 1BCPB 5FO7B 1QCBD 3P7JA 1H9JA 2K50A 5IGFA 3CCUA 1HQMC 1P16A 2TSSA 4ZQ3A 3I4MH 3KYHC 3BVMA 2VXWA 2D0PA 3SDZA 4QF4A 2NB0A 3A7LA 1MKHA 4L5SA 3BDOA 1VQEA 1A15A 1QUQB 3OSOA 1B4OA 3W1BA 3GTMH 3CQZH 3D0FA 4I65A 2JA9A 3UI2A 4B3TL 3LX0A 1YBYA 3QJYA 1XX8A 4N9PA 1EQTA 3KBGA 1NJIC 1AW7A 3VDYA 2JA8H 1VQDA 4RHSA 2BOSA 1LTTD 3STBC 4RMFA 1PTOF 4NDXA 1SNPA 4A3DG 3CHBD 2EVBA 1MD2D 4K0KQ 4RHRA 3OIPA 1TY2A 4NXNL 1TWGH 2CKZB 3S14B 3MFGA 3KJOA 5EBCA 3QOJA 4GLXA 5BN5A 3E6ZX 4A3MB 2OQ0A 1D1KA 3HOUH 2RKSA 1LT6D 2PZWA 1WTOA 1H95A 1ICWA 4LW1A 3NTKA 2A19A 1HFNA 5D3DA 4JVZA 2AQ2B 1GVPA 4K8IA 2KJXA 1Y1VG 2B2WA 2K4KA 4ABNA 2B63B 1ENFA 1KDBA 1V9PA 3GV3A 4KKUA 1ASZA 4OL7A 4POFA 1HUNA 3KFUA 4HJ7A 2O4XA 1SE3A 1XWEA 2B39A 1H9KA 1H9SA 4DV0Q 1SBBB 5D14A 1HJPA 1VQKA 4N8X1 3VR3A 1AE3A 4IUUA 4FO2A 4KHPQ 4JI3Q 1X55A 3C46A 4UY8C 4QY7A 1HNZQ 3GDEA 2Z6KA 1QJOA 4JOIA 3E0EA 2UU9L 3PO2H 5CV4A 1J6QA 3UDIA 4YWMA 1ZXTA 4A3BH 5IWAQ 1LACA 4Z9CB 2IL8A 4DAYA 2BDNA 1OO9B 3RN5A 1CA5A 4OO1I 3S15H 3DEPA 2LSSA 2K52A 3NWTA 5FJ8G 1BF4A 1O7LA 4ZCKA 3PF5A 2JA7H 1IHZA 2F4IA 5CC4A 2IWHA 4A3DB 3S2HH 3PO3H 3T1HQ 1E7ZA 3M4YA 5LL6S 2E2HB 4JI5L 1IYUA 2J7ZA 3D6WA 1O80A 3HOZB 3PV0A 5K36H 3I91A 4IUTA 1LLRD 1NMGA 2GVBA 2OF1A 3K57A 4IURA 5HY6A 1DZ1A 4P73A 5C0XG 1W6JA 5J39A 5M9OA 3AMUA 2H1EA 4BWGB 1T5XD 1AN8A 2Z4IA 1Y1WH 1TQOA 2IPKD 2J4XA 3EA6A 1RHPA 2VS1A 4YIJA 2LKVA 4A3KH 2NVTB 4JYAL 4UAIA 2R6GA 5KRUA 1WTQA 2NZ1D 3T1HL 1QUQA 2ICEC 1EY0A 5EPKA 1HFGA 3HOYG 2CWPA 2UUAQ 2RHQB 3I56A 3S1RH 3DM3A 1NR4A 2JA6G 2I0QA 3T1YQ 3S1QB 3X3MA 3I90A 4H7BA 1GO3E 2L5TA 2WACA 2R7FA 3D31A 1KQSA 1WJJA 4KY5A 1S72A 5ISRA 1PHJA 1HZBA 2O2LD 5JJZA 1II3A 1STHA 4A3JH 3PUZA 2KOLA 1NE3A 4IPDA 5C5LA 4CKBA 1L0XB 2LS01 4R4CA 1SNCA 4A3IG 3S16B 3I7FA 4C3HG 3L0OA 4DXGA 1MGSA 1IBKQ 1Q8IA 3VR4A 3T1YL 1XNRQ 1N33Q 2NVQH 1K73C 4N8FA 4EX5A 1ET9A 1B70B 2QEJC 5IOCA 3K0XA 4YCWA 1ICFB 4OWXB 4IUVA 1QOHA 1EOVA 1WFQA 4JG2A 1C7YA 2V1CC 3HOXH 2R93H 1VQBA 4HCEA 2PQEA 2Z1CA 1VQNA 1HRJA 1S3OA 2OQKA 2WKDA 4XDXA 2DN8A 2MUYA 1D7QA 2PO4A 1U4PA 1IBKL 2XTIA 3S2DH 2PZTA 2XIWA 1XNRL 1N33L 3M3YB 3HOYB 1KDCA 4BY1H 4LFCQ 2JA6B 1SFOB 3J81E 1G291 4BY7B 2NN6I 2ZXRA 4O1NA 1YI2A 1O7YA 1VMPA 1V1QA 4KMUC 4XQJA 3OYYA 3NBIA 4OEMB 2GVAA 5GQOA 2KHIA 3J7ZC 3J80i 1WCMH 3RLOA 4QIWB 1KNAA 4CJ0B 1L2FA 5CV5A 2VW9A 1KAAA 5E4XA 2LFNA 1KRTA 3TREA 2JK8A 4X64Q 3LWEA 4CBVA 2B8GA 4A3GH 2DNEA 4NPSA 1V43A 1MSHA 5D3IB 1CA6A 1AP0A 1SYBA 4RG1A 3PCOB 1OXSC 1IBLL 1Z9FA 2EE1A 2FHTA 4X6AH 5DEHA 3NEMA 4PMWA 3H0GB 4IN3A 2EXZA 4ZUIA 3V05A 1X6OA 2CH4A 2LXJA 4WJWA 1UAPA 1NSNS 1A62A 1FNWA 1EY4A 2L15A 4AQYQ 4TKOB 1EY6A 1Q46A 4X64L 4YCUA 4LK1C 3W2DA 3H3VI 1HPCA 3V2TA 4ZKCB 2NZOA 1MI2A 3M9BA 1WVLA 2K03A 3K80C 2IT1A 5A2QE 5FLXc 4DR3Q 1SLJA 3DUZA 3MEFA 3U50C 1CHQD 2F0TA 3OPOA 3UDXA 2X6GA 1MBYA 2MGSA 4A3FH 2KENA 3FKIG 3CPWA 4DGZA 5IT9c 3P1HA 5M5XB 3NELA 2XWBB 3GD7A 3VA7A 1FNUA 3ND9A 4RAUC 2EJMA 1JWUD 2A68C 1EYDA 3R2TA 4K5WA 2PI2A 4JI2Q 3EVQA 4MTKA 4R4QA 2K7VA 2ENBA 1WTHA 5E3FA 3CF5A 5JJLA 2NTTA 1Q7YC 2JEBI 4ME5A 5EKKA 4DR1Q 4DR3L 3BVGA 3C1FA 3I4NH 1LV9A 1D6EC 4JI8L 2EYPA 4GNXB 4YCVA 3AYHB 5EJWA 2FMMA 4ODGA 2CQAA 2KHJA 3CPFA 4XYOA 4QQBX 3MFYA 2ZTCA 4CJ1B 3BZDB 5C44H 2VUMG 2I5LX 1R9TB 5C0XI 2MFIA 1IW7D 2JA8G 2P5ZX 3CC7A 4IZ8A 2NBFA 4HJAA 1PRTC 2WINB 3NE5B 4Q5VA 4OX9Q 1JOQA 1PTOH 2RCNA 4ILWA 1LTAD 1DD2A 4RA8A 4ZLTF 1I4QA 2JSOA 4YHHL 4JI2L 1R4QB 1TY0A 3DWPA 1VQLA 2JN4A 4R8NA 2EQSA 4IOCA 3A0JA 1IYJB 2A68D 2KQ3A 3N6RA 1STAA 1WTWA 4DR1L 3U4VA 2K5QA 3CP0A 3A74A 4DFAA 2F0LA 4NMZA 3SE0A 3IFTA 2B2UC 2CWAA 4WFN3 2UUCQ 2E5LQ 3SHLA 3HOUG 3KLSX 1X65A 1Q90A 1BCPF 5IP9H 3E9HA 2EZVA 3BG3A 4DXFA 3ERSX 4DR4Q 1HXYD 1KHIA 3IRBA 3EJIA 5HGQA 2B2VA 3H94A 1N8RC 4OX9L 1PVOA 1XMOQ 2EY5A 3KDFB 1SFOH 3HEJA 1S5CD 4WORA 4B9WA 5ELOA 1M1KC 1S5BD 3M4OH 5M5YB 3GTKH 1GUGA 1GUSA 5FLXL 3IFDA 2RDGA 1SMXA 4H44C 1PH7A 1JMCA 2XVSA 5T1GA 1W6KA 1HNWQ 4GN4B 1KRSA 1PFNA 1TWCB 4JI6L 1Q1BA 3VR6A 2K5VA 1CKOA 2L55A 4M8AA 2AWNA 4X3SA 3RN2A 3PO2G 4DR4L 1C0AA 1SDFA 5IT9L 1YJNA 2UXCQ 4A3BG 2L1BA 4XXEA 2VUMB 4CDEC 1XMOL 1N36Q 2FINB 2SOBA 1WOCA 3K5MA 2EYLA 1ILQA 1SNOA 1UWVA 3SEBA 2NTSA 1I4XA 1HR0L 5LMNQ 1F9PA 1QWYA 2F3WA 4JBJA 1I4PA 5I2YA 5M3FH 1OXUA 5JVG3 4B3RQ 2UUBQ 5H1SE 2N55A 4DAVA 1JQYD 5C4XH 1MHWC 2E8GA 1D5XC 3BYTB 5I4DA 2VQFQ 4GOPC 3ND8A 3BYYB 1VQMA 3OIQA 3SK4A 3HOWG 1PYSB 1CHPD 4BA2I 1PTOC 4F87A 1B9NA 2CQOA 2H4OA 4L5QA 3AQQA 4LFBQ 1F2ZA 2UXCL 1SYFA 2G9HD 1YIJA 3OMCA 4DR7L 3OTOQ 5CV7A 2ZM6L 3G6JB 3DHQA 3LNNA 1N36L 4MHEA 4IUNA 4C2MB 1QG7A 1JJ2A 1B8AA 4F8MA 1TS3A 1MJEA 3IKJA 3ULJA 5LMNL 1VQHA 4L5RC 3RZOH 3A55A 4B3RL 2HHHL 3O13A 4IPHA 4IJHA 2D0OA 2JJQA 1XMQQ 1N9WA 1U4MA 4LFAQ 4GNXA 2NVYH 3TEHB 5LHY1 4WJ3M 3FRPB 1XYIA 2R92H 1I3QB 1VQ6A 2VQFL 2F0DA 2R7ZH 3Q24A 1EU3A 1ASYA 4BBSH 3G6EA 2Q2UA 3A56A 4AIMA 3R3OA 2B2TC 4HIKA 4LFBL 1YJ9A 4P2CB 4OHJA 2VB3X 1JOKA 3FP9A 5DM73 1PTOD 2JA5B 4JI1Q 2CH4W 3S1NB 5C4JH 2ZTDA 1GHKA 1QNUA 3F8TA 3CU7A 1VQ8A 5HGTA 1PLFA 2EYJA 3DWQA 3A8JE 4DAPA 3NTHA 3J7AV 3I2ZA 3DLLA 1D8LA 1I50H 5FLMH 3GTQH 1XMQL 1FJGL 1S4ZA 2QW7A 4LFAL 1KXLA 4UP8A 2EJGC 2ZJPA 2YU9B 1Z47A 4DAYB 4K8JA 2C5CA 1IZ6A 3KBXA 1YHQA 2AUJD 4JI0Q 3BDCA 1LTGD 2RSOA 2PI2E 2K5WA 1TIID 1M90C 4KJNA 3HOWB 2PYKA 5GAGC 4JI1L 3I72A 3HOXG 2R93G 1IBMQ 5J1ZA 5EKLA 1VF5C 5BN3A 2SNMA 1B2TA 1CZGA 1TWFB 2IJ0A 3TP6A 2B8FA 2G5DA 3R8BA 2NUCA 1JT8A 3NXWA 1HZAA 4KLKA 4A3CH 4IFDH 4I7ZC 1IYVA 3NK9A 2IHFA 1HHVA 1QVGA 3G7LA 3FPUB 1MJCA 3U9SA 2Z9HA 2EDGA 4IOAA 2Z0SA 4OWWB 1BXTA 3HZXA 3D8GA 1MIUA 3C3LA 3PQIA 2RDFA 4HSVA 1IBML 1HTLD 1HZCA 1LTSD 1RL2A 3I3CA 4PG3A 4EQOA 1WCMG 2K05A 3M4PA 4PZ6A 1QZGA 3TZUA 3BZCA 4KTAA 4A4IA 4QIWE 2YTYA 4E6IA 1LTBD 3NBHB 4FXKC 3MEHA 2ES2A 1JJGA 4A3GG 1A3UA 1STBA 2BH8A 2Q2IA 3GTGB 1J9OA 4RGTA 1IKMA 2F3IA 1CT1D 1JC7A 2ZTEA 3TRZA 3S17B 2ID0A 4HN7A 1EYAA 1C8CA 4HSPA 3U58A 2BE5D 2LMCB 5C3XA 5KGUA 3J7A5 1D1IA 2DUDA 3T51B 2YTXA 4IO9A 2O5IC 1ET6A 2HT1A 1EIYB 4C1NK 5C3WA 1S5DD 1U4LA 5C6AA 3CCLA 4K0KL 4DKAC 2RA4A 3HOVH 3S24A 4GKJQ 1F2LA 1VQIA 3OOCA 3M7NA 3BDLA 3I4OA 1JWSD 1B3AA 4FF2A 4FVMA 1SXTA 1WD1A 4HIMA 2IX3A 4L8JA 2E74C 1Z6HA 2A6EC 3SR1A 2GN5A 1WTRA 1WTXA 5E1FA 4RKLA 4C3IH 3EQLC 1BKBA 1FR3A 3AU7A 5ELCA 5C3EH 5IYCH 2UXDQ 4OXPA 4WRDA 2F1MA 2Q8TA 2ZJQA 2E2IB 5C4HA 5CGKA 4UP9A 2Y0SG 1WYDA 2OTLA 4DV0L 4GKJL 4K14A 1U9RA 5M5WB 4DNIA 4KHPL 5IP7G 4HIDA 4JI3L 3I4NG 1X32A 1FVIA 2B2YC 1HNZL 2ZXOA 1AZPA 4OO1H 1Q8KA 1QILA 4XQNA 4X62Q 4BXXH 4R4OA 4GS3A 2VL6A 3J7AF 4YY3Q 5IWAL 3GTJB 2HQLA 2K32A 1JOOA 2F0WA 2A6ED 1HCZA 1ZYRD 1Y1VB 2UXDL 3ONAB 3M85A 2KA7A 4LJZC 4ID6A 3TS2A 1I6HB 4QUFA 4BBRH 1EU4A 1E2WA 4A93H 3A8IE 1O78A 1GUOA 4DV5Q 1L1OC 5J3BA 3DXJC 1B9MA 4LF7Q 5CYUA 4X62L 3HS0C 1PV4A 2E2DC 1E1TA 3CCSA 5M3MG 2KECA 3E5SA 3PUWA 1DXMA 1X3GA 1WI5A 2R3ZA 3NBHA 4R1JA 1PZJD 3P75A 1NR2A 1KNEA 4UHVA 4BA1I 1KD1C 3GO5A 1K3RA 4MZ9A 4HEDA 1VQPA 2QCPX 3I70A 3NUCA 4QMGA 1VQ5A 4KI0A 4R9WA 2SNSA 3KLSA 4X3KA 3T13A 5IT9E 4J8QA 2UUAL 3DWAA 4CKEA 4UDUC 5GADC 1DGSA 4FXDA 4NW2A 4LF7L 1G91A 5FK9C 1OXTA 2MQHA 5CBAE 3VR2A 3Q6SA 4LF8Q 3MZ5A 3FEWX 3U9OA 4OIKA 3I55A 4G7OC 4B3MQ 1LYLA 3G48A 5IGDA 1EIHA 3Q8DA 3TMEA 2NZHA 3G4SA 4LF4Q 1Q3LA 4DUZQ 1GUWA 1EEFD 1CSQA 3SK6A 5D65A 3EFXD 4HJ9A 1I4RA 1K0RA 4NXMQ 3S14H 4OIJA 5DNFA 1HR0W 4A3MH 1TWAB 2Z6KC 2KCTA 4S3SA 1X56A 2BCOA 3S17H 3BS1A 1PH3A 1GM5A 2F0VA 2UXBQ 1UNSA 4M1UB 1SJHD 3NQIA 2B63H 3D4RA 4LF8L 3DM1A 3UDGA 1A2TA 4B3ML 5IYBH 3CCJA 2XSCA 1N32Q 1Y69U 3WOFA 3A8KE 4QL5A 5M3MB 4XT3B 4KHVA 1CZWA 2JXMB 3CC4A 3URYA 1XPUA 2F0NA 3E0JA 3RMHA 1EWIA 5IYDG 3RZDB 2F52A 1E3PA 4EQPA 2NN6H 1K8OA 4RGMA 3QIAA 4CDCC 1BCPC 4A3IB 4C3HB 3CXCA 2R92G 1TWHB 3D4DA 4LFCL 2DJFC 5IODA 2R7ZG 2N3SA 1E2ZA 1T5EA 4BBSG 4KKSA 4WJ4A 2AMCB 2C9OA 2B2UA 3D4WA 1EY7A 4BS9A 1N32L 4A3EG 1K8GA 2JQOA 2WFWA 1AE2A 2HDMA 3CCRA 4HJ5A 4A3DH 3WWVA 5EAYA 2E2HH 1OXVA 5M5WH 3X3NA 4ZAIA 3HOZH 1XXGA 5FLMG 4DV7Q 1PH5A 3K8AA 4EGVA 2G9DA 2N8NA 1I6VC 1I4GA 5ELNA 4C3JG 1HH2P 4U673 1BCPD 1XJVA 1Y8NB 3NP8A 1GXDC 4AYBG 4JBKA 3GTLB 2NVTH 4X65Q 2EY2A 2KCNA 1XTDA 3GTPB 1YNXA 4IUPA 1IW7C 3E3XA 5JJIA 5FO9B 2HUGA 3JAMc 2DNCA 1NCVA 3BJUA 4KK7A 2XGTA 4YWLA 1B7YB 1K8MA 4LUZA 3S1QH 4DV7L 1XTCD 2F0PA 4IQZA 4AQYL 5E7NA 4HCSA 2OWOA 3K7UC 1JB7A 2AQ3B 4UP7A 1BO0A 3PMFA 1DOMA 2O5JC 1KL9A 3I4MG 4XYQA 4DV1Q 2AHOB 1LTRD 2ZT9C 4DV2Q 1H9MA 1L0YB 2HQEA 2KEEA 2E76C 4HIOA 2OCEA 2B29A 4DK0A 1BDOA 3ER0A 4X65L 1RODA 1A3TA 2EYFA 4GOPA 1HQRD 1JWMD 1NUCA 3S16H 4Y52H 1G8ZD 4A3EB 2OXPA 5KNCA 5F2DA 1KLUD 2RVLA 1B53A 4QGUA 3K58A 4LF5Q 1DCZA 2RCFA 5FOBB 2QKIC 1J5EQ 2CFMA 2VNUD 4GKKQ 4IPCA 1IKLA 4G4KA 3H6MA 4DV1L 1BBXC 3TP7A 4DK3C 4B3SQ 3U4ZA 4C3JB 5C0XH 4IALA 1PA6A 3VR5A 1N34Q 2DY8A 2CW0D 3G71A 1CSPA 5T1IA
chains in the Genus database with same CATH topology
3GTOB 2D2CC 4G57A 4XIGS 2BA1A 1ESRA 3T56B 1CFMA 2B2TA 2EJFC 1SAPA 3L3OC 1QB5D 3FKIB 3RLFA 4RCNA 1SYEA 3MAQA 3TN2A 1B44D 1V1PA 1SMYC 1HTPA 5ELDA 1EWCA 1A3VA 4DU9A 1J8IA 1EY8A 4G7ZC 4K6DA 4FF3A 2F0SA 1GJXA 2L9HA 5IGGA 2N88A 3H09A 4RKBA 1EEID 2L11A 3CQZB 3JAML 4TRDA 1JCKB 4XT1B 3GQBA 2A6HC 1PZID 3Q0AA 1EWHA 2JA8B 1SNQA 4FF4A 1B50A 3I8ZA 1X3PA 3D3RA 2HDLA 5COYA 2QDBA 1EL0A 3RD4A 1FYCA 3L7ZC 1TWGB 3NHHA 2IX0A 5K36G 1SMYD 3K5LA 2PNRC 5ELEA 4KKTA 3HOUB 2NVXB 2LY7A 5HURA 1EFID 5JVH3 1BQQT 3LWUA 1CM9A 3ZYYX 1ESFA 5IGEA 1G6ZA 2A6HD 5EQ0A 1BOSA 5I6WA 1VF7A 2OEOA 2A69C 1KLGD 3GV6A 4RCOA 3S1MB 2QF7A 5CV8A 3SXHA 5EPJA 1LO5D 5KNBA 2RDHA 3KLRA 1DONA 2EYOA 2K6AA 1YNND 3PO2B 3S9WA 5FO8B 2F0IA 4A3BB 1SJED 1LABA 1ZKOA 3T16A 2X69A 4FP5D 4KJOA 4ZYSA 1BR9A 3S15B 2V4DA 2E75C 2JYOA 4ULLA 4NKLA 2R61A 2JA7B 5TSSA 1RKNA 4O42A 1PZKD 2B2VC 3S2HB 2F0EA 1SNMA 2D62A 5CBEE 2A69D 2F0JA 1KABA 5IIFA 2A74C 2M9VA 3MXUA 5JEAH 1O7ZA 1STEA 5K5PA 3BVZA 2EPBA 4FF1A 4HMIA 3NPPA 1STNA 4F88A 1PDQA 2ICIA 3VYSA 4JBWA 2BDOA 1Y1WB 3A7AB 5C4ZA 4L63B 4A3KB 4V190 1H9RA 2D9UA 5J22A 1M8AA 1TS2A 5EGTA 1S5FD 2A5HA 2RQXA 3TP8A 5KEEA 4XTCS 1TU2B 3CRKC 1WTVA 4LAAA 1PFBA 3CKIB 2L4NA 2B2YA 4FXGC 1DOLA 3IL8A 3QOLA 2BE5C 2NWGA 2AUKA 2SDFA 4A3JB 1OXXK 3SVMA 2DY7A 1ILPA 1G2TA 2NN6G 5EBDA 2L0CA 1KTKA 2KUMA 1QE6A 3C1EA 2RBMA 1KDAA 3L9AX 5C0XJ 4NP5A 2NVQB 2D5DA 3PIP3 2Q8RE 1BNZA 2AQ1B 4N9TA 4J1MA 2M00A 1F9QA 4EQNA 3QB3A 3PUXA 1M4VA 1EQVA 3HOXB 1SNDA 2R93B 3KK7A 3QG1A 2NYZD 4Q0FA 5KYIA 4CKCA 1X3QA 3AB9A 1V8QA 2HCCA 4X3UA 4X3TA 3S2DB 5EKIA 3MXPA 2SEBD 4R8IA 3T53B 2Z4HA 3SK5A 4BY1B 4PMCA 2XRSD 4ZKBB 1WTPA 1JORA 3MC0B 1ZYRC 1JE4A 1C48A 4RGOS 2PW5A 3TDQA 2QILA 5G3LD 1WCMB 1D5MC 2AWOA 5I9PA 1R4PB 1GOZA 5KIXA 1TT2A 4Y7NB 2F0QA 4A3GB 1PRTB 5ELBA 1CK1A 3MA2B 4HTHA 4H13C 5CMDA 3NQTA 1TS5A 4CHTB 1PXUA 2WAQB 2MJ8A 1AZQA 2F0HA 3VYTA 2BA0A 3MTSA 2F0MA 1DM0B 1RD9D 3R2IA 2YYZA 4K2LA 5ELFA 3W3AA 2JE6I 1E2VA 4DNTB 3HG9A 5FLXE 4A3FB 1S5ED 1IL8A 1HA5A 1PMRA 1SEBD 3HGBA 1GUNA 5KNDA 2HCIA 2K28A 1RJTA 4HMJA 3JAME 5G3LF 3FVQA 2JP1A 2Y0SB 2WIIB 3K0YA 2B2WC 5BN4A 1RTNA 1VCIA 3TZDA 2CHBD 2WV6D 3MXGA 3I4NB 5JEAJ 3QWNA 3I73A 4KN4C 4HAEA 4L6TB 5C44B 1ONLA 3EROA 2K01A 4V0BA 5EPLA 5CORA 4KY6A 1F77A 2CVRA 1CQFA 2MHVA 1TR5A 1PTOB 1GUTA 2M2LA 1A6XA 1SYDA 3TBIB 1RDPD 1CQVA 4IFDJ 2F0FA 1YNJC 1I4HA 1G2SA 3FDTA 1EZ8A 3I4LA 3P20A 3PUVA 3KUPA 4OGQC 3HKZB 2TMPA 4RGNA 3VYUA 3J7YW 1A2UA 1EY9A 2GA4B 1V1OA 1VDZA 3J80L 3R93A 4QB4A 2IX1A 1AFPA 1EY5A 3F2UA 3K59A 3A54A 4ZRZA 4H0LC 1F9SA 3NSWA 1F2MA 3M4OB 3MVVA 5DAUA 1B1ZA 3KF8A 1DYQA 3GTKB 3VYRA 1LT4D 4IUQA 1FD7D 4F7XA 1YNJD 3OHXC 2I46A 5CV6A 5IGBA 1V1PB 3T4AC 4ZK9B 2K1BA 1HA6A 1DJRD 4KY7A 3D6CA 2F3VA 2XN9C 3OWEB 4ZUJA 3MXNA 2Z8LA 5M3FB 1D2BA 1RTOA 1EOTA 1TVXA 2FMCA 4KD4A 4MIUA 4LMQD 1GHJA 2JEAI 4PV1C 4PMBA 3K5NA 5C4XB 2PZUA 5AFWA 3OW7A 3K6OA 1JB3A 3NTIA 5JEAG 4C1NI 3WDNA 2K04A 3K5OA 5I2XA 1UEAB 3C2PA 3PUYA 1SE2A 3RZOB 1TS4A 3QO2A 1AEXA 4C56C 4IFDG 2CW0C 2NVYB 1PFMA 2R92B 1SE4A 3TSSA 4DA2A 4MN3A 1UUPA 2EYMA 2R7ZB 2EOTA 4BBSB 3SK8A 1Y8PB 1TKWB 5DM63 2PW7A 2IW3A 3GP7A 4JK1C 5I9OA 1JICA 4QUCA 4DK1A 1SYCA 5CR3A 3FMCA 5C4JB 3Q23A 1JR0D 4B08A 2A73B 3WOEA 1WD0A 1I50B 3GTQB 4G7HC 1ZEQX 1QNKA 4DF7A 2Q8IB 1K83B 4KV6A 3K7AB 4AYBB 5I6YA 1MSGA 5FKAC 3M7GA 3HRZC 2K5DA 3ERQA 1Y8OB 4GZYC 1Z7TA 1HUMA 4TQUS 4CJ2C 4FNFA 1SYGA 3N52A 5JOBA 3H91A 5JPMC 3I4MB 1FNVA 2VB2X 3VA5A 3H3VC 3IAYA 3ITPA 2FFKB 2K33A 4B9XA 2F0KA 2PCFB 1STYA 1DOKA 1PRTD 2XNAC 3GTMB 2OT2A 1Q12A 2KVMA 4C3IG 2WKCA 1STGA 2WP8J 2RSNA 4U68A 2ZXPA 4CGYB 4KD3A 1NAPA 4QCLA 3CRLC 4EVOA 1E0BA 2F0UA 2XRQD 1CTMA 4K6LA 4OO1G 3DEOA 1YNNC 1ENAA 2EYHA 1LT3D 5JPNC 4DN4M 5CV9A 1PYWD 1C4QA 2PMZB 1U4RA 2KEDA 4J6HA 5C5MA 4KN7C 2MPMA 3MWYW 2KHSA 1RF2D 1BUVT 2I07B 2F0OA 3Q22A 4K2KA 3HOVB 2F03A 1F2YA 2F0GA 4PQXA 1EZ6A 1CI3M 4RFBA 3PIO3 1D5ZC 1ML0D 5KYLA 4RH6A 3J81L 3MHBA 1EIGA 2PPBC 4HR7B 3V96A 1FGBD 3OMGA 1LTID 2X6LA 4C3IB 5IGCA 1SSOA 4TSSA 1PRTF 5LL6X 5C3EB 2KCCA 2MP1A 1VMCA 3FPPA 1Q1EA 2XWJB 1H9SB 2EY1A 3PO3B 3NWSA 5E4WC 1EYCA 5A35A 4PNYA 4FYDA 3TP5A 2J0TD 2WB1B 5NUCA 4K5XA 4K5VA 1ENCA 3HP3A 4XQQA 2FJ2A 4BBRB 3DMUA 4A93B 4RWSC 1LT5D 4IFDI 3S1RB 4KHZA 3J80E 5JAVA 4DNRB 2EY6A 3OWFA 1F9RA 5A2QL 1RCVD 3RUZA 2L12A 1BCPB 5FO7B 1QCBD 3P7JA 1H9JA 5IGFA 1HQMC 2TSSA 4ZQ3A 3BVMA 2VXWA 3SDZA 4QF4A 2NB0A 3A7LA 3BDOA 1A15A 3OSOA 1B4OA 4I65A 3UI2A 3LX0A 3QJYA 1XX8A 4N9PA 1EQTA 3KBGA 1AW7A 4RHSA 2BOSA 1LTTD 1PTOF 4NDXA 1SNPA 3CHBD 2EVBA 1MD2D 4RHRA 3OIPA 1TY2A 3S14B 3MFGA 5EBCA 3QOJA 5BN5A 3E6ZX 4A3MB 1D1KA 2RKSA 1LT6D 2PZWA 1WTOA 1ICWA 3NTKA 1HFNA 5D3DA 2AQ2B 4K8IA 2KJXA 2B2WA 4ABNA 2B63B 1ENFA 1KDBA 3GV3A 4KKUA 4OL7A 1HUNA 2O4XA 1SE3A 1XWEA 2B39A 1H9KA 1H9SA 1SBBB 5D14A 3VR3A 4IUUA 4FO2A 3C46A 1QJOA 5CV4A 1ZXTA 1LACA 4Z9CB 2IL8A 4DAYA 2BDNA 1OO9B 1CA5A 4OO1I 3DEPA 3NWTA 1BF4A 1O7LA 1IHZA 2F4IA 5CC4A 2IWHA 4A3DB 5LL6S 3M4YA 2E2HB 1IYUA 2J7ZA 3D6WA 1O80A 3HOZB 3PV0A 5K36H 3I91A 4IUTA 1LLRD 2OF1A 3K57A 4IURA 1DZ1A 5C0XG 1W6JA 5J39A 5M9OA 3AMUA 2H1EA 4BWGB 1T5XD 1AN8A 2Z4IA 1TQOA 2IPKD 2J4XA 3EA6A 1RHPA 4YIJA 2LKVA 2NVTB 4UAIA 2R6GA 5KRUA 1WTQA 2NZ1D 2ICEC 1EY0A 5EPKA 1HFGA 1NR4A 3S1QB 3X3MA 3I90A 4H7BA 2L5TA 2WACA 3D31A 4KY5A 5ISRA 2O2LD 5JJZA 1II3A 1STHA 3PUZA 2KOLA 5C5LA 4CKBA 1L0XB 2LS01 1SNCA 3S16B 4C3HG 4DXGA 1MGSA 1Q8IA 3VR4A 1ET9A 5IOCA 2QEJC 4IUVA 1QOHA 4HCEA 2PQEA 2Z1CA 1HRJA 2WKDA 4XDXA 2DN8A 2MUYA 2PO4A 1U4PA 2PZTA 2XIWA 3M3YB 3HOYB 1KDCA 2JA6B 1SFOB 3J81E 1G291 4BY7B 2NN6I 2ZXRA 4O1NA 1O7YA 1VMPA 4KMUC 4XQJA 3NBIA 4QIWB 1KNAA 4CJ0B 5CV5A 1KAAA 5E4XA 2LFNA 3LWEA 4CBVA 2B8GA 2DNEA 1V43A 1MSHA 5D3IB 1CA6A 1AP0A 1SYBA 1OXSC 2EE1A 2FHTA 5DEHA 4PMWA 3H0GB 4IN3A 2EXZA 4ZUIA 3V05A 4WJWA 1UAPA 1NSNS 1FNWA 1EY4A 4TKOB 1EY6A 4LK1C 3W2DA 1HPCA 3V2TA 4ZKCB 1MI2A 1WVLA 2K03A 2IT1A 5A2QE 3DUZA 1CHQD 2F0TA 3OPOA 2X6GA 1MBYA 2MGSA 4DGZA 3P1HA 5M5XB 2XWBB 3GD7A 3VA7A 1FNUA 3ND9A 4RAUC 2EJMA 1JWUD 2A68C 1EYDA 3R2TA 4K5WA 3EVQA 2K7VA 2ENBA 5E3FA 2NTTA 2JEBI 4ME5A 5EKKA 3BVGA 3C1FA 1LV9A 1D6EC 2EYPA 5EJWA 2FMMA 4ODGA 2CQAA 4XYOA 3MFYA 4CJ1B 3BZDB 1R9TB 5C0XI 1IW7D 4IZ8A 2NBFA 1PRTC 2WINB 3NE5B 4Q5VA 1JOQA 1PTOH 4ILWA 1LTAD 1DD2A 4RA8A 4ZLTF 1I4QA 2JSOA 1R4QB 1TY0A 3DWPA 4R8NA 2A68D 2KQ3A 3N6RA 1STAA 1WTWA 2K5QA 4DFAA 2F0LA 4NMZA 3SE0A 3IFTA 2B2UC 4WFN3 3SHLA 3KLSX 1Q90A 1BCPF 2EZVA 3BG3A 4DXFA 1HXYD 3EJIA 2B2VA 3H94A 2EY5A 3HEJA 1S5CD 4WORA 4B9WA 1S5BD 5M5YB 1GUGA 1GUSA 5FLXL 3IFDA 2RDGA 4H44C 2XVSA 5T1GA 1W6KA 1PFNA 1TWCB 1Q1BA 3VR6A 2L55A 4M8AA 2AWNA 4X3SA 1SDFA 5IT9L 2L1BA 4XXEA 2VUMB 2FINB 2SOBA 3K5MA 2EYLA 1ILQA 1SNOA 3SEBA 2NTSA 1I4XA 1F9PA 1QWYA 2F3WA 5I2YA 1I4PA 1OXUA 5JVG3 2N55A 4DAVA 1JQYD 1D5XC 3BYTB 5I4DA 3ND8A 3BYYB 3OIQA 3SK4A 1CHPD 4BA2I 1PTOC 4F87A 1B9NA 2H4OA 1F2ZA 1SYFA 2G9HD 3OMCA 5CV7A 3G6JB 3DHQA 3LNNA 4MHEA 4IUNA 4C2MB 1QG7A 4F8MA 1TS3A 3IKJA 3A55A 3O13A 1U4MA 5LHY1 3FRPB 1XYIA 1I3QB 2F0DA 3Q24A 1EU3A 3A56A 3R3OA 2B2TC 4P2CB 4OHJA 2VB3X 1JOKA 5DM73 1PTOD 2JA5B 3S1NB 1GHKA 1QNUA 3CU7A 5HGTA 1PLFA 2EYJA 3DWQA 3A8JE 4DAPA 3NTHA 3J7AV 1S4ZA 2EJGC 2YU9B 1Z47A 4K8JA 2C5CA 3KBXA 2AUJD 3BDCA 1LTGD 2RSOA 2K5WA 1TIID 4KJNA 3HOWB 2PYKA 3I72A 5J1ZA 5EKLA 1VF5C 5BN3A 2SNMA 1B2TA 1CZGA 1TWFB 2IJ0A 3TP6A 2B8FA 3R8BA 2NUCA 3NXWA 4IFDH 4I7ZC 1IYVA 3NK9A 1HHVA 3G7LA 3FPUB 3U9SA 2EDGA 1BXTA 3HZXA 3D8GA 3C3LA 2RDFA 4HSVA 1HTLD 1LTSD 3I3CA 4EQOA 2K05A 3TZUA 4KTAA 4E6IA 1LTBD 4FXKC 3MEHA 1A3UA 1STBA 3GTGB 1J9OA 4RGTA 1IKMA 1CT1D 1JC7A 3S17B 2ID0A 4HN7A 1EYAA 1C8CA 4HSPA 2BE5D 2LMCB 5C3XA 5KGUA 1D1IA 3T51B 2O5IC 1ET6A 4C1NK 5C3WA 1S5DD 1U4LA 5C6AA 2RA4A 1F2LA 3OOCA 3M7NA 3BDLA 1JWSD 1B3AA 4FF2A 4FVMA 1SXTA 1WD1A 2IX3A 4L8JA 2E74C 1Z6HA 2A6EC 3SR1A 1WTRA 1WTXA 5E1FA 4RKLA 3EQLC 1FR3A 3AU7A 5ELCA 4WRDA 2F1MA 2Q8TA 2E2IB 5C4HA 5CGKA 4K14A 1U9RA 5M5WB 1X32A 2B2YC 2ZXOA 1AZPA 4OO1H 1QILA 4XQNA 3J7AF 3GTJB 2K32A 1JOOA 2F0WA 2A6ED 1HCZA 1ZYRD 1Y1VB 3ONAB 3M85A 2KA7A 4LJZC 4ID6A 1I6HB 4QUFA 1EU4A 1E2WA 3A8IE 1O78A 1GUOA 3DXJC 1B9MA 5CYUA 3HS0C 2E2DC 2KECA 3E5SA 3PUWA 1DXMA 2R3ZA 3NBHA 1PZJD 3P75A 1NR2A 1KNEA 4BA1I 3GO5A 4HEDA 2QCPX 3I70A 3NUCA 4QMGA 4KI0A 4R9WA 2SNSA 3KLSA 4X3KA 3T13A 5IT9E 4J8QA 3DWAA 4CKEA 4UDUC 4FXDA 4NW2A 1G91A 5FK9C 1OXTA 5CBAE 3VR2A 3Q6SA 3MZ5A 3FEWX 3U9OA 4OIKA 4G7OC 5IGDA 1EIHA 3TMEA 1Q3LA 1GUWA 1EEFD 3SK6A 5D65A 3EFXD 1I4RA 4OIJA 5DNFA 1TWAB 4S3SA 2BCOA 3BS1A 2F0VA 1UNSA 4M1UB 1SJHD 3NQIA 3D4RA 3DM1A 1A2TA 2XSCA 1Y69U 3WOFA 3A8KE 5M3MB 4XT3B 4KHVA 1CZWA 2JXMB 3URYA 2F0NA 3E0JA 3RMHA 3RZDB 4EQPA 1K8OA 2NN6H 4RGMA 3QIAA 1BCPC 4A3IB 4C3HB 1TWHB 3D4DA 5IODA 1E2ZA 1T5EA 4KKSA 2C9OA 3D4WA 2B2UA 1EY7A 4BS9A 2HDMA 1OXVA 3X3NA 4ZAIA 1XXGA 4EGVA 2G9DA 1I6VC 1I4GA 4C3JG 4U673 1BCPD 1Y8NB 3NP8A 1GXDC 3GTLB 2EY2A 2KCNA 3GTPB 4IUPA 1IW7C 5FO9B 2HUGA 2DNCA 1NCVA 4KK7A 1K8MA 1XTCD 2F0PA 4IQZA 4HCSA 2AQ3B 1BO0A 3PMFA 1DOMA 2O5JC 4XYQA 1LTRD 2ZT9C 1H9MA 1L0YB 2HQEA 2KEEA 2E76C 4DK0A 1BDOA 1RODA 1A3TA 2EYFA 1HQRD 1JWMD 1NUCA 1G8ZD 4A3EB 2OXPA 5KNCA 5F2DA 1KLUD 2RVLA 1B53A 3K58A 1DCZA 5FOBB 2QKIC 2VNUD 1IKLA 4G4KA 3H6MA 1BBXC 3TP7A 4C3JB 5C0XH 4IALA 3VR5A 2DY8A 2CW0D 2E2JB 5T1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K03 A;  3DEO A;  2KUM A;  1QE6 A;  3R93 A;  1S4Z A;  5EPJ A;  2R3Z A;  3MTS A;  3IFD A;  1F9R A;  4IUV A;  2HDM A;  1ZXT A;  4DN4 M;  3F2U A;  2L12 A;  1NR2 A;  5T1G A;  1KNE A;  1ESR A;  1U4L A;  1DON A;  1PFN A;  2IL8 A;  2B2T A;  1F9S A;  4HED A;  1SAP A;  1U4R A;  2BDN A;  3KBX A;  2RA4 A;  3P7J A;  2KED A;  1CA5 A;  4ZAI A;  1WD0 A;  4R9W A;  1HRJ A;  2X6G A;  2MGS A;  2MPM A;  2Q8R E;  3DEP A;  3MWY W;  1BNZ A;  4X3K A;  1F2L A;  2RSO A;  4XDX A;  1BF4 A;  4X3S A;  4IUQ A;  1F9Q A;  1SDF A;  1U4P A;  1B3A A;  2VXW A;  2L1B A;  1WD1 A;  1QNK A;  4NW2 A;  1G91 A;  2X69 A;  4RAU C;  1A15 A;  2FIN B;  2J7Z A;  1O80 A;  3D6W A;  1ILQ A;  3TN2 A;  2XIW A;  1B4O A;  5CBA E;  3I91 A;  3Q6S A;  4IUT A;  2NYZ D;  1F9P A;  1IL8 A;  2JYO A;  4OIK A;  3UI2 A;  1WTR A;  1B2T A;  1ML0 D;  1X3Q A;  4O42 A;  1WTX A;  4ZK9 B;  2HCC A;  1MSG A;  2B2V C;  4IUR A;  4X3U A;  1J8I A;  1DZ1 A;  1XX8 A;  2K1B A;  1EIH A;  1EQT A;  2N55 A;  2HCI A;  5CBE E;  1HA6 A;  1Q3L A;  4X3T A;  1EIG A;  1GUW A;  2L9H A;  1O7Y A;  1VMP A;  2K28 A;  2N88 A;  1LV9 A;  4IUP A;  5EKI A;  1RJT A;  5D65 A;  2Q8T A;  4R8I A;  2HUG A;  2L11 A;  4OIJ A;  2H1E A;  5DNF A;  1NCV A;  2FMM A;  5EJW A;  1HHV A;  1O7Z A;  1HUM A;  2JP1 A;  3FPU B;  3G7L A;  1RHP A;  1RTO A;  2B2W C;  2X6L A;  4CJ2 C;  4CJ1 B;  1RTN A;  4ZKB B;  3N52 A;  1TVX A;  1EOT A;  2EPB A;  1SSO A;  4XT1 B;  3TZD A;  4HCS A;  1KNA A;  4LMQ D;  4UAI A;  4CJ0 B;  2MP1 A;  3H91 A;  1WTP A;  1WTQ A;  2NZ1 D;  1BO0 A;  1VMC A;  1X32 A;  1PDQ A;  5EPK A;  1B50 A;  1HFG A;  1DOM A;  3I8Z A;  5AFW A;  5E4X A;  4MHE A;  2B2Y C;  1JE4 A;  4RA8 A;  1QG7 A;  1X3P A;  4ZLT F;  4HSV A;  1NR4 A;  4HAE A;  3LWE A;  1AZP A;  3I3C A;  2K04 A;  3I90 A;  3DM1 A;  2FFK B;  2D9U A;  2K01 A;  2K05 A;  5E4W C;  2HDL A;  2KEE A;  5COY A;  5COR A;  5EPL A;  1MSH A;  1ICW A;  1M8A A;  1WTO A;  1CA6 A;  2CVR A;  1EL0 A;  1AP0 A;  1DOK A;  1WTW A;  1ROD A;  1HFN A;  1U4M A;  5JJZ A;  4XT3 B;  2B2W A;  2EE1 A;  2FHT A;  3ONA B;  1XYI A;  2B2U C;  2M2L A;  2KVM A;  2KOL A;  2RVL A;  1WTV A;  1B53 A;  4QUF A;  1PFB A;  3GV3 A;  2RSN A;  4U68 A;  2L4N A;  3QO2 A;  2B2Y A;  5CMD A;  1CM9 A;  1DOL A;  1G2S A;  3IL8 A;  2B2T C;  1HUN A;  3FDT A;  2KEC A;  1J9O A;  1IKL A;  2B2V A;  1IKM A;  2NWG A;  3HP3 A;  1PFM A;  2FJ2 A;  2SDF A;  3KUP A;  1NAP A;  1MGS A;  5D14 A;  1G6Z A;  4MN3 A;  5EQ0 A;  4IUU A;  2EOT A;  3SVM A;  1E0B A;  2DY7 A;  1BBX C;  1ILP A;  1PLF A;  1G2T A;  1C8C A;  4RWS C;  1JIC A;  2MJ8 A;  4QUC A;  2B2U A;  2DY8 A;  4ZKC B;  1MI2 A;  1AZQ A;  3GV6 A;  1WVL A;  5T1I A; 
#chains in the Genus database with same CATH topology
 1Q81 C;  3GTO B;  2D2C C;  4HJ8 A;  4G57 A;  3PSI A;  4XIG S;  2BA1 A;  1ESR A;  3T56 B;  5AJ3 Q;  1U5K A;  1CFM A;  2B2T A;  2EJF C;  1SAP A;  2EIF A;  2Q2H A;  4LF6 Q;  3HKS A;  4LF5 L;  1VQ4 A;  3L3O C;  1QB5 D;  3FKI B;  3M3Y H;  3HOY H;  1VQJ A;  3RLF A;  3PGZ A;  2JA6 H;  1PFS A;  4RCN A;  4BY7 H;  4JI4 Q;  1SYE A;  4JV5 Q;  3MAQ A;  3TN2 A;  4DV3 Q;  4B3S L;  1B44 D;  4LUV A;  1V1P A;  1SMY C;  1HTP A;  5BR8 Q;  5ELD A;  1EWC A;  1A3V A;  4DU9 A;  3OW2 A;  1J8I A;  1EY8 A;  4A75 A;  2UUC L;  4G7Z C;  2E5L L;  4K6D A;  4FF3 A;  2F0S A;  4JCV E;  1GJX A;  2L9H A;  5IGG A;  2N88 A;  1L0W A;  5AJ3 L;  3H09 A;  4RKB A;  1EEI D;  1IL2 A;  2L11 A;  1K28 A;  3CQZ B;  3JAM L;  4LF6 L;  4TRD A;  1PH8 A;  1JCK B;  1I94 Q;  1NTG A;  1B3Q A;  4XT1 B;  3GQB A;  2A6H C;  1PZI D;  2B3G A;  3Q0A A;  1EWH A;  2JA8 B;  1SNQ A;  4FF4 A;  1B50 A;  1SR3 A;  3I8Z A;  4JI4 L;  4DR5 Q;  2IY5 B;  1EYG A;  4JV5 L;  1X3P A;  1NBW A;  2MO1 A;  2JA7 G;  4DV3 L;  1EQQ A;  3PO3 G;  3D3R A;  1SRU A;  2HDL A;  5COY A;  3H0G H;  2QDB A;  1EL0 A;  1HNX Q;  3RD4 A;  1HNW L;  2N78 A;  1FYC A;  3L7Z C;  1TWG B;  3NHH A;  2IX0 A;  5K36 G;  1SMY D;  3K5L A;  2PNR C;  5ELE A;  4KKT A;  3HOU B;  2NVX B;  2LY7 A;  5HUR A;  2WB1 G;  1EFI D;  5JVH 3;  1BQQ T;  1I94 L;  3LWU A;  3W1G A;  1KC8 C;  1CM9 A;  3ZYY X;  1Y1W G;  1ESF A;  3NEN A;  4LF9 Q;  4A3K G;  5IGE A;  4PZ7 A;  4DR5 L;  1G6Z A;  2A6H D;  5EQ0 A;  1BOS A;  5I6W A;  1X9N A;  4DV4 Q;  1VF7 A;  2UUB L;  2OEO A;  4BBR G;  1G51 A;  4AH6 A;  3RLN A;  4A93 G;  2A69 C;  3GTP H;  1KLG D;  3GV6 A;  4RCO A;  3S1M B;  2QF7 A;  5CV8 A;  3SXH A;  1VQ7 A;  2PNH A;  1VQG A;  5EPJ A;  1LO5 D;  5KNB A;  5M5X H;  2RDH A;  1YIT A;  3AFQ A;  1A0I A;  3KLR A;  4GN3 B;  1DON A;  1NNX A;  1X3F A;  2EYO A;  2K6A A;  3OTO L;  1YNN D;  4DUY Q;  3KJP A;  4A76 A;  3PO2 B;  4A3J G;  3S9W A;  1LTL A;  1XNQ Q;  5FO8 B;  2F0I A;  3KLW A;  4A3B B;  1SJE D;  4LF9 L;  1LAB A;  1ZKO A;  3T16 A;  2X69 A;  4FP5 D;  1YZ6 A;  4KJO A;  4DV4 L;  5GAH C;  4ZYS A;  1BR9 A;  3S15 B;  2V4D A;  2E75 C;  4PZ8 A;  2JYO A;  4ULL A;  4NKL A;  2R61 A;  4JI7 Q;  2JA7 B;  5TSS A;  1RKN A;  4O42 A;  1PZK D;  1KAW A;  2B2V C;  3S2H B;  1X54 A;  2F0E A;  1XPR A;  1R9T H;  1SNM A;  2D62 A;  5CBE E;  2A69 D;  1YHB A;  2F0J A;  2Y0S E;  1KAB A;  5IIF A;  3TS0 A;  2A74 C;  2M9V A;  3EN2 A;  3MXU A;  5JEA H;  1O7Z A;  1STE A;  5K5P A;  4DUY L;  3BVZ A;  2EPB A;  4FF1 A;  1XNQ L;  4HMI A;  3NPP A;  1STN A;  4F88 A;  3PIP A;  1PDQ A;  2ICI A;  3VYS A;  1RIP A;  4JBW A;  2BDO A;  1E1O A;  1Y1W B;  2VQE Q;  3A7A B;  5C4Z A;  5LMU Q;  4L63 B;  2QEX A;  4A3M G;  4R4T A;  4A3K B;  2HIX A;  4V19 0;  1H9R A;  4R4I A;  2D9U A;  4JI7 L;  5J22 A;  1M8A A;  1TS2 A;  5EGT A;  1S5F D;  2A5H A;  3BZK A;  2RQX A;  4BY1 G;  3TP8 A;  4JI0 L;  5KEE A;  4P71 A;  4XTC S;  1TU2 B;  1FL0 A;  3CRK C;  1WTV A;  4LAA A;  3CCQ A;  1PFB A;  3CKI B;  4JW0 A;  2L4N A;  5IYB G;  2B2Y A;  1AH9 A;  4FXG C;  1DOL A;  3IL8 A;  4FDB A;  2A1A A;  3QOL A;  2BE5 C;  5M5Y H;  2NWG A;  2AUK A;  3HKZ E;  1PH4 A;  2SDF A;  4JPB W;  4A3J B;  2PQA B;  1OXX K;  2VQE L;  5LMU L;  4JC0 A;  3SVM A;  4NXN Q;  2DY7 A;  1ILP A;  1TWC H;  3RNU A;  1G2T A;  2NN6 G;  2MNA A;  5EBD A;  2L0C A;  1KTK A;  2KUM A;  1QE6 A;  1UE5 A;  3C1E A;  3ULP A;  2RBM A;  4DPG A;  3A5Z B;  1K9M C;  1O7I A;  1KDA A;  3L9A X;  5C0X J;  5GAE C;  4EQ5 A;  2VUM H;  4NP5 A;  2NVQ B;  1SE8 A;  2KCM A;  1JE5 A;  1L1O A;  2D5D A;  3PIP 3;  1CKN A;  2Q8R E;  1BNZ A;  2AQ1 B;  4N9T A;  4J1M A;  2M00 A;  1F9Q A;  4EQN A;  3QB3 A;  1UEB A;  3ZJY C;  3PUX A;  4GNX C;  1M4V A;  3K81 C;  1EQV A;  2WAQ G;  2F4V Q;  1P8L A;  3CAM A;  1SND A;  3HOX B;  2R93 B;  3KK7 A;  1Q86 C;  3QG1 A;  3B6Y A;  3HOZ G;  1UE7 A;  2NYZ D;  4Q0F A;  4O2D A;  4CKC A;  5KYI A;  1PYB A;  1X3Q A;  3AB9 A;  4IPG A;  1VQ9 A;  1V8Q A;  2HCC A;  4X3U A;  2R7D A;  2NVX H;  4X3T A;  3S2D B;  5EKI A;  3MXP A;  2SEB D;  4R8I A;  2UU9 Q;  3T53 B;  2Z4H A;  4C2M H;  3SK5 A;  4NB3 A;  4BY1 B;  4PMC A;  1YJW A;  2CCZ A;  2XRS D;  4ZKB B;  1WTP A;  2Q2T A;  1JOR A;  2ALY B;  3F2B A;  3MC0 B;  4A3F G;  3STB D;  2F4V L;  1ZYR C;  1JE4 A;  1LM0 A;  1C48 A;  1W3S A;  1I3Q H;  3S1M H;  4RGO S;  2PW5 A;  3TDQ A;  2QIL A;  5G3L D;  1WCM B;  4JI5 Q;  4GN5 A;  3AFP A;  1D5M C;  2AWO A;  5I9P A;  3FHW A;  1PH2 A;  1R4P B;  1GOZ A;  4QJF A;  2JA5 H;  5KIX A;  1TT2 A;  4Y7N B;  2F0Q A;  2DGY A;  3S1N H;  4A3G B;  1PRT B;  5ELB A;  1CK1 A;  3MA2 B;  4HTH A;  4H13 C;  5CMD A;  1GKH A;  3KF8 B;  3NQT A;  4DAM A;  4JBM A;  5C44 G;  4JYA Q;  2YU9 H;  3AEV A;  1TS5 A;  4CHT B;  1PXU A;  2WAQ B;  2MJ8 A;  1NY4 A;  4MNO A;  4APV A;  1AZQ A;  2F0H A;  1E24 A;  3J80 c;  2YTV A;  3VYT A;  2BA0 A;  3MTS A;  4POG A;  2F0M A;  2I5H A;  1DM0 B;  3HOW H;  1VS0 A;  1RD9 D;  3QR8 A;  1GD7 A;  3R2I A;  2QDL A;  2YYZ A;  3BU2 A;  4K2L A;  4CDD C;  3PF4 A;  3MXN B;  5ELF A;  3W3A A;  2JE6 I;  1E2V A;  1TWF H;  2PQA A;  3HKZ G;  4DNT B;  5IP9 G;  3HG9 A;  4IJL A;  4AYB E;  4YY3 L;  5FLX E;  1YVC A;  4A3F B;  1S5E D;  1SRO A;  1IL8 A;  1HA5 A;  1K8A C;  1PMR A;  1SEB D;  3HGB A;  1BVS A;  1GUN A;  1UE6 A;  3TQY A;  5KND A;  2ASB A;  4BY7 G;  2HCI A;  4H02 A;  2K28 A;  1BBW A;  1RJT A;  4HMJ A;  3JAM E;  2AKW B;  1HZ9 A;  5G3L F;  3FVQ A;  2JP1 A;  2Y0S B;  2WII B;  3K0Y A;  4DV5 L;  2B2W C;  5BN4 A;  1RTN A;  4CDF C;  1VCI A;  2K75 A;  3TZD A;  2CHB D;  2WV6 D;  3MXG A;  1VQO A;  1YHA A;  3I4N B;  5JEA J;  3QWN A;  3I73 A;  4KN4 C;  3F1Z A;  4HAE A;  4L6T B;  4DK6 C;  5C44 B;  1ONL A;  3ERO A;  2K01 A;  4V0B A;  5EPL A;  5COR A;  2MO0 A;  4KY6 A;  4GOP B;  1F77 A;  3ICE A;  2CVR A;  1CQF A;  2MHV A;  1TR5 A;  1G6P A;  3GTG H;  1PTO B;  5M3F G;  4LUO A;  1GUT A;  2M2L A;  4JOI C;  1A6X A;  1SYD A;  3TBI B;  1RDP D;  5C4X G;  3H0G G;  1CQV A;  4IFD J;  2F0F A;  1FGU A;  1YNJ C;  4A3L H;  1I4H A;  1G2S A;  3FDT A;  1EZ8 A;  1JJC B;  3I4L A;  3P20 A;  3PUV A;  3KUP A;  4OGQ C;  1NMF A;  3E9I A;  2YV5 A;  3HKZ B;  2TMP A;  4RGN A;  3F2D A;  2HIV A;  4LF4 L;  3VYU A;  4DUZ L;  3J7Y W;  1A2U A;  1EY9 A;  3UE1 A;  2GA4 B;  1V1O A;  4NXM L;  1VDZ A;  3J80 L;  3R93 A;  2PMZ E;  5LMN W;  4QB4 A;  2IX1 A;  1AFP A;  1EY5 A;  4OWT B;  3F2U A;  3K59 A;  3A54 A;  3H15 A;  4ZRZ A;  4H0L C;  3UDF A;  1F9S A;  3NSW A;  1F2M A;  1IBL Q;  3M4O B;  3MVV A;  5DAU A;  1B1Z A;  3KF8 A;  1DYQ A;  3GTK B;  2LXK A;  2UXB L;  3VYR A;  1LT4 D;  2DJG C;  4IUQ A;  1S40 A;  2RF4 A;  1EFW A;  1FD7 D;  2H5X A;  4F7X A;  2Z6B A;  1YNJ D;  1UE1 A;  2IHE A;  1I5F A;  1LUZ A;  3OHX C;  2I46 A;  5IY0 A;  5CV6 A;  1EIF A;  5IGB A;  1V1P B;  4GLV B;  3T4A C;  3CC2 A;  2E2I H;  2BH2 A;  4ZK9 B;  2K5H A;  2K1B A;  1K3B C;  4Y7N H;  1XPO A;  4P74 A;  1HA6 A;  1DJR D;  2N49 A;  3EIV A;  4KY7 A;  3D6C A;  2F3V A;  2XN9 C;  3OWE B;  4ZUJ A;  3MXN A;  2Z8L A;  5M3F B;  1D2B A;  2VY3 A;  3CD6 A;  1RTO A;  1EOT A;  1TVX A;  2FMC A;  3SGI A;  4KD4 A;  4MIU A;  1QZH A;  4LMQ D;  1GHJ A;  2QA4 A;  2JEA I;  4PV1 C;  4PMB A;  3GTJ H;  3K5N A;  5C4X B;  2PZU A;  5AFW A;  5JJK A;  5IE8 A;  1Y1V H;  3K6O A;  3OW7 A;  1BBU A;  1JB3 A;  3NTI A;  5JEA G;  4O0A A;  4C1N I;  3WDN A;  2K04 A;  3K5O A;  5I2X A;  1I6H H;  3A5U A;  3CME A;  1UEA B;  3H3V H;  1VQA A;  3C2P A;  2WB1 E;  3PUY A;  1CKM A;  1QVC A;  1SE2 A;  3RZO B;  3W5O A;  1TS4 A;  1Y14 B;  4JI8 Q;  3QO2 A;  1K0S A;  1AEX A;  1A8V A;  4A3C G;  4C56 C;  4IFD G;  2CW0 C;  2NVY B;  4X66 Q;  1PFM A;  3ULL A;  2R92 B;  1SE4 A;  3TSS A;  4DA2 A;  4MN3 A;  1UUP A;  2EYM A;  2R7Z B;  2EOT A;  4BBS B;  3SK8 A;  1Y8P B;  1TKW B;  5DM6 3;  2PW7 A;  2IW3 A;  3GP7 A;  4JK1 C;  5I9O A;  1JIC A;  4QUC A;  3CMA A;  5FJ8 H;  4YHH Q;  1Q82 C;  3L2P A;  4DK1 A;  4ME3 A;  3KF6 B;  1SYC A;  3CW2 C;  5CR3 A;  3FMC A;  5C4J B;  3CCM A;  3Q23 A;  1JR0 D;  4B08 A;  2A73 B;  3WOE A;  5IP7 H;  4J15 A;  1WD0 A;  1I50 B;  3GTQ B;  2A8V A;  4G7H C;  1ZEQ X;  4DV2 L;  4X66 L;  3JC6 6;  3RR5 A;  1QNK A;  4DF7 A;  2VZA A;  2Q8I B;  1K83 B;  4KV6 A;  3K7A B;  4AYB B;  2K14 A;  5I6Y A;  2QGQ A;  1MSG A;  1TWA H;  5FKA C;  3J81 c;  3M7G A;  3J81 j;  3HRZ C;  2K5D A;  3ERQ A;  1PH1 A;  1Y8O B;  1J5E L;  4GZY C;  1QVF A;  1Z7T A;  4LWC A;  4GKK L;  1HUM A;  4TQU S;  4TVA B;  4P72 A;  4FNF A;  4CJ2 C;  1SYG A;  3N52 A;  4DR2 Q;  4JI6 Q;  5JOB A;  3H91 A;  5JPM C;  3HOV G;  1CUK A;  3I4M B;  1FNV A;  1N34 L;  5M3M H;  2VB2 X;  3VA5 A;  1EUJ A;  3H3V C;  3IAY A;  3ITP A;  2FFK B;  2K33 A;  4B9X A;  3RZD H;  2F0K A;  2PCF B;  1STY A;  1DOK A;  1PRT D;  2XNA C;  3GTM B;  1HR0 Q;  3M4Q A;  4A3I H;  2OT2 A;  3PIO A;  2EXD A;  4C3H H;  1TWH H;  1Q12 A;  1VQC A;  2KVM A;  4C3I G;  4OON A;  2WKC A;  5C3E G;  1STG A;  5IYC G;  4OEL B;  2WP8 J;  2RHS B;  2RSN A;  4U68 A;  4DR2 L;  4DV6 Q;  2ZXP A;  4CGY B;  3HFZ B;  4KD3 A;  2K5N A;  1NAP A;  2JA5 G;  3JAM i;  5BR8 L;  4QCL A;  3CRL C;  4EVO A;  1E0B A;  1C9O A;  1VQF A;  4DR7 Q;  2F0U A;  2ZM6 Q;  2XRQ D;  1CTM A;  4K6L A;  4OO1 G;  3DEO A;  1YNN C;  5DLQ E;  4BXX G;  1ENA A;  2EYH A;  1PH6 A;  1LT3 D;  2FXQ A;  1EQR A;  5JPN C;  4DN4 M;  5CV9 A;  3KOJ A;  1PYW D;  2HHH Q;  1C4Q A;  1L1O B;  2PMZ B;  1U4R A;  5GRO A;  1CKN B;  2KED A;  4J6H A;  4MTN A;  4KN7 C;  5C5M A;  4LNQ A;  2MPM A;  3MWY W;  3CCV A;  4DV6 L;  2WAQ E;  2KHS A;  1RF2 D;  3GTL H;  4GLA C;  2KBN A;  1BUV T;  2I07 B;  1W2B A;  4DR6 Q;  2F0O A;  3Q22 A;  1U0L A;  1HNX L;  4K2K A;  3HOV B;  2F03 A;  1F2Y A;  2F0G A;  4P75 A;  1EZ6 A;  1CI3 M;  4PQX A;  4RFB A;  3PIO 3;  3KF6 A;  1D5Z C;  1ML0 D;  4ALP A;  5KYL A;  4RH6 A;  3J81 L;  2OTJ A;  3MHB A;  4YWK A;  1EIG A;  5IYD H;  2PPB C;  4HR7 B;  3V96 A;  1FJG Q;  1FGB D;  3OMG A;  1LTI D;  2ATW A;  1KIX A;  2X6L A;  4C3I B;  5IGC A;  1SSO A;  4TSS A;  1PRT F;  5LL6 X;  5C3E B;  2KCC A;  2MP1 A;  1VMC A;  2HD3 A;  3FPP A;  4DR6 L;  1Q1E A;  2XWJ B;  4I7A A;  3J81 i;  1PH9 A;  2C35 B;  1H9S B;  4A3E H;  3EBE A;  2EY1 A;  3PO3 B;  3NWS A;  4UPA A;  5E4W C;  1EYC A;  3LGJ A;  1SN8 A;  1X3E A;  1YEZ A;  1E22 A;  4PNY A;  5A35 A;  4FYD A;  3TP5 A;  1A63 A;  2J0T D;  2WB1 B;  1T9H A;  4C3J H;  5NUC A;  4K5X A;  4L5T A;  1K83 H;  4K5V A;  2E2J H;  1ENC A;  3HP3 A;  3GTO H;  4XQQ A;  2FJ2 A;  3K7A H;  3CCE A;  4BBR B;  3KDF A;  2E2J B;  3DMU A;  2I5M X;  4A93 B;  4RWS C;  2ZJR A;  1LT5 D;  4A3L G;  1OTC A;  4IFD I;  3S1R B;  4B3T Q;  4KHZ A;  3J80 E;  5JAV A;  3F2C A;  3FKI H;  4DNR B;  2B63 G;  2EY6 A;  3OWF A;  3UE0 A;  1F9R A;  5L37 A;  5A2Q L;  1RCV D;  1TXY A;  1IXR A;  3RUZ A;  2L12 A;  1BCP B;  5FO7 B;  1QCB D;  3P7J A;  1H9J A;  2K50 A;  5IGF A;  3CCU A;  1HQM C;  1P16 A;  2TSS A;  4ZQ3 A;  3I4M H;  3KYH C;  3BVM A;  2VXW A;  2D0P A;  3SDZ A;  4QF4 A;  2NB0 A;  3A7L A;  1MKH A;  4L5S A;  3BDO A;  1VQE A;  1A15 A;  1QUQ B;  3OSO A;  1B4O A;  3W1B A;  3GTM H;  3CQZ H;  3D0F A;  4I65 A;  2JA9 A;  3UI2 A;  4B3T L;  3LX0 A;  1YBY A;  3QJY A;  1XX8 A;  4N9P A;  1EQT A;  3KBG A;  1NJI C;  1AW7 A;  3VDY A;  2JA8 H;  1VQD A;  4RHS A;  2BOS A;  1LTT D;  3STB C;  4RMF A;  1PTO F;  4NDX A;  1SNP A;  4A3D G;  3CHB D;  2EVB A;  1MD2 D;  4K0K Q;  4RHR A;  3OIP A;  1TY2 A;  4NXN L;  1TWG H;  2CKZ B;  3S14 B;  3MFG A;  3KJO A;  5EBC A;  3QOJ A;  4GLX A;  5BN5 A;  3E6Z X;  4A3M B;  2OQ0 A;  1D1K A;  3HOU H;  2RKS A;  1LT6 D;  2PZW A;  1WTO A;  1H95 A;  1ICW A;  4LW1 A;  3NTK A;  2A19 A;  1HFN A;  5D3D A;  4JVZ A;  2AQ2 B;  1GVP A;  4K8I A;  2KJX A;  1Y1V G;  2B2W A;  2K4K A;  4ABN A;  2B63 B;  1ENF A;  1KDB A;  1V9P A;  3GV3 A;  4KKU A;  1ASZ A;  4OL7 A;  4POF A;  1HUN A;  3KFU A;  4HJ7 A;  2O4X A;  1SE3 A;  1XWE A;  2B39 A;  1H9K A;  1H9S A;  4DV0 Q;  1SBB B;  5D14 A;  1HJP A;  1VQK A;  4N8X 1;  3VR3 A;  1AE3 A;  4IUU A;  4FO2 A;  4KHP Q;  4JI3 Q;  1X55 A;  3C46 A;  4UY8 C;  4QY7 A;  1HNZ Q;  3GDE A;  2Z6K A;  1QJO A;  4JOI A;  3E0E A;  2UU9 L;  3PO2 H;  5CV4 A;  1J6Q A;  3UDI A;  4YWM A;  1ZXT A;  4A3B H;  5IWA Q;  1LAC A;  4Z9C B;  2IL8 A;  4DAY A;  2BDN A;  1OO9 B;  3RN5 A;  1CA5 A;  4OO1 I;  3S15 H;  3DEP A;  2LSS A;  2K52 A;  3NWT A;  5FJ8 G;  1BF4 A;  1O7L A;  4ZCK A;  3PF5 A;  2JA7 H;  1IHZ A;  2F4I A;  5CC4 A;  2IWH A;  4A3D B;  3S2H H;  3PO3 H;  3T1H Q;  1E7Z A;  3M4Y A;  5LL6 S;  2E2H B;  4JI5 L;  1IYU A;  2J7Z A;  3D6W A;  1O80 A;  3HOZ B;  3PV0 A;  5K36 H;  3I91 A;  4IUT A;  1LLR D;  1NMG A;  2GVB A;  2OF1 A;  3K57 A;  4IUR A;  5HY6 A;  1DZ1 A;  4P73 A;  5C0X G;  1W6J A;  5J39 A;  5M9O A;  3AMU A;  2H1E A;  4BWG B;  1T5X D;  1AN8 A;  2Z4I A;  1Y1W H;  1TQO A;  2IPK D;  2J4X A;  3EA6 A;  1RHP A;  2VS1 A;  4YIJ A;  2LKV A;  4A3K H;  2NVT B;  4JYA L;  4UAI A;  2R6G A;  5KRU A;  1WTQ A;  2NZ1 D;  3T1H L;  1QUQ A;  2ICE C;  1EY0 A;  5EPK A;  1HFG A;  3HOY G;  2CWP A;  2UUA Q;  2RHQ B;  3I56 A;  3S1R H;  3DM3 A;  1NR4 A;  2JA6 G;  2I0Q A;  3T1Y Q;  3S1Q B;  3X3M A;  3I90 A;  4H7B A;  1GO3 E;  2L5T A;  2WAC A;  2R7F A;  3D31 A;  1KQS A;  1WJJ A;  4KY5 A;  1S72 A;  5ISR A;  1PHJ A;  1HZB A;  2O2L D;  5JJZ A;  1II3 A;  1STH A;  4A3J H;  3PUZ A;  2KOL A;  1NE3 A;  4IPD A;  5C5L A;  4CKB A;  1L0X B;  2LS0 1;  4R4C A;  1SNC A;  4A3I G;  3S16 B;  3I7F A;  4C3H G;  3L0O A;  4DXG A;  1MGS A;  1IBK Q;  1Q8I A;  3VR4 A;  3T1Y L;  1XNR Q;  1N33 Q;  2NVQ H;  1K73 C;  4N8F A;  4EX5 A;  1ET9 A;  1B70 B;  2QEJ C;  5IOC A;  3K0X A;  4YCW A;  1ICF B;  4OWX B;  4IUV A;  1QOH A;  1EOV A;  1WFQ A;  4JG2 A;  1C7Y A;  2V1C C;  3HOX H;  2R93 H;  1VQB A;  4HCE A;  2PQE A;  2Z1C A;  1VQN A;  1HRJ A;  1S3O A;  2OQK A;  2WKD A;  4XDX A;  2DN8 A;  2MUY A;  1D7Q A;  2PO4 A;  1U4P A;  1IBK L;  2XTI A;  3S2D H;  2PZT A;  2XIW A;  1XNR L;  1N33 L;  3M3Y B;  3HOY B;  1KDC A;  4BY1 H;  4LFC Q;  2JA6 B;  1SFO B;  3J81 E;  1G29 1;  4BY7 B;  2NN6 I;  2ZXR A;  4O1N A;  1YI2 A;  1O7Y A;  1VMP A;  1V1Q A;  4KMU C;  4XQJ A;  3OYY A;  3NBI A;  4OEM B;  2GVA A;  5GQO A;  2KHI A;  3J7Z C;  3J80 i;  1WCM H;  3RLO A;  4QIW B;  1KNA A;  4CJ0 B;  1L2F A;  5CV5 A;  2VW9 A;  1KAA A;  5E4X A;  2LFN A;  1KRT A;  3TRE A;  2JK8 A;  4X64 Q;  3LWE A;  4CBV A;  2B8G A;  4A3G H;  2DNE A;  4NPS A;  1V43 A;  1MSH A;  5D3I B;  1CA6 A;  1AP0 A;  1SYB A;  4RG1 A;  3PCO B;  1OXS C;  1IBL L;  1Z9F A;  2EE1 A;  2FHT A;  4X6A H;  5DEH A;  3NEM A;  4PMW A;  3H0G B;  4IN3 A;  2EXZ A;  4ZUI A;  3V05 A;  1X6O A;  2CH4 A;  2LXJ A;  4WJW A;  1UAP A;  1NSN S;  1A62 A;  1FNW A;  1EY4 A;  2L15 A;  4AQY Q;  4TKO B;  1EY6 A;  1Q46 A;  4X64 L;  4YCU A;  4LK1 C;  3W2D A;  3H3V I;  1HPC A;  3V2T A;  4ZKC B;  2NZO A;  1MI2 A;  3M9B A;  1WVL A;  2K03 A;  3K80 C;  2IT1 A;  5A2Q E;  5FLX c;  4DR3 Q;  1SLJ A;  3DUZ A;  3MEF A;  3U50 C;  1CHQ D;  2F0T A;  3OPO A;  3UDX A;  2X6G A;  1MBY A;  2MGS A;  4A3F H;  2KEN A;  3FKI G;  3CPW A;  4DGZ A;  5IT9 c;  3P1H A;  5M5X B;  3NEL A;  2XWB B;  3GD7 A;  3VA7 A;  1FNU A;  3ND9 A;  4RAU C;  2EJM A;  1JWU D;  2A68 C;  1EYD A;  3R2T A;  4K5W A;  2PI2 A;  4JI2 Q;  3EVQ A;  4MTK A;  4R4Q A;  2K7V A;  2ENB A;  1WTH A;  5E3F A;  3CF5 A;  5JJL A;  2NTT A;  1Q7Y C;  2JEB I;  4ME5 A;  5EKK A;  4DR1 Q;  4DR3 L;  3BVG A;  3C1F A;  3I4N H;  1LV9 A;  1D6E C;  4JI8 L;  2EYP A;  4GNX B;  4YCV A;  3AYH B;  5EJW A;  2FMM A;  4ODG A;  2CQA A;  2KHJ A;  3CPF A;  4XYO A;  4QQB X;  3MFY A;  2ZTC A;  4CJ1 B;  3BZD B;  5C44 H;  2VUM G;  2I5L X;  1R9T B;  5C0X I;  2MFI A;  1IW7 D;  2JA8 G;  2P5Z X;  3CC7 A;  4IZ8 A;  2NBF A;  4HJA A;  1PRT C;  2WIN B;  3NE5 B;  4Q5V A;  4OX9 Q;  1JOQ A;  1PTO H;  2RCN A;  4ILW A;  1LTA D;  1DD2 A;  4RA8 A;  4ZLT F;  1I4Q A;  2JSO A;  4YHH L;  4JI2 L;  1R4Q B;  1TY0 A;  3DWP A;  1VQL A;  2JN4 A;  4R8N A;  2EQS A;  4IOC A;  3A0J A;  1IYJ B;  2A68 D;  2KQ3 A;  3N6R A;  1STA A;  1WTW A;  4DR1 L;  3U4V A;  2K5Q A;  3CP0 A;  3A74 A;  4DFA A;  2F0L A;  4NMZ A;  3SE0 A;  3IFT A;  2B2U C;  2CWA A;  4WFN 3;  2UUC Q;  2E5L Q;  3SHL A;  3HOU G;  3KLS X;  1X65 A;  1Q90 A;  1BCP F;  5IP9 H;  3E9H A;  2EZV A;  3BG3 A;  4DXF A;  3ERS X;  4DR4 Q;  1HXY D;  1KHI A;  3IRB A;  3EJI A;  5HGQ A;  2B2V A;  3H94 A;  1N8R C;  4OX9 L;  1PVO A;  1XMO Q;  2EY5 A;  3KDF B;  1SFO H;  3HEJ A;  1S5C D;  4WOR A;  4B9W A;  5ELO A;  1M1K C;  1S5B D;  3M4O H;  5M5Y B;  3GTK H;  1GUG A;  1GUS A;  5FLX L;  3IFD A;  2RDG A;  1SMX A;  4H44 C;  1PH7 A;  1JMC A;  2XVS A;  5T1G A;  1W6K A;  1HNW Q;  4GN4 B;  1KRS A;  1PFN A;  1TWC B;  4JI6 L;  1Q1B A;  3VR6 A;  2K5V A;  1CKO A;  2L55 A;  4M8A A;  2AWN A;  4X3S A;  3RN2 A;  3PO2 G;  4DR4 L;  1C0A A;  1SDF A;  5IT9 L;  1YJN A;  2UXC Q;  4A3B G;  2L1B A;  4XXE A;  2VUM B;  4CDE C;  1XMO L;  1N36 Q;  2FIN B;  2SOB A;  1WOC A;  3K5M A;  2EYL A;  1ILQ A;  1SNO A;  1UWV A;  3SEB A;  2NTS A;  1I4X A;  1HR0 L;  5LMN Q;  1F9P A;  1QWY A;  2F3W A;  4JBJ A;  1I4P A;  5I2Y A;  5M3F H;  1OXU A;  5JVG 3;  4B3R Q;  2UUB Q;  5H1S E;  2N55 A;  4DAV A;  1JQY D;  5C4X H;  1MHW C;  2E8G A;  1D5X C;  3BYT B;  5I4D A;  2VQF Q;  4GOP C;  3ND8 A;  3BYY B;  1VQM A;  3OIQ A;  3SK4 A;  3HOW G;  1PYS B;  1CHP D;  4BA2 I;  1PTO C;  4F87 A;  1B9N A;  2CQO A;  2H4O A;  4L5Q A;  3AQQ A;  4LFB Q;  1F2Z A;  2UXC L;  1SYF A;  2G9H D;  1YIJ A;  3OMC A;  4DR7 L;  3OTO Q;  5CV7 A;  2ZM6 L;  3G6J B;  3DHQ A;  3LNN A;  1N36 L;  4MHE A;  4IUN A;  4C2M B;  1QG7 A;  1JJ2 A;  1B8A A;  4F8M A;  1TS3 A;  1MJE A;  3IKJ A;  3ULJ A;  5LMN L;  1VQH A;  4L5R C;  3RZO H;  3A55 A;  4B3R L;  2HHH L;  3O13 A;  4IPH A;  4IJH A;  2D0O A;  2JJQ A;  1XMQ Q;  1N9W A;  1U4M A;  4LFA Q;  4GNX A;  2NVY H;  3TEH B;  5LHY 1;  4WJ3 M;  3FRP B;  1XYI A;  2R92 H;  1I3Q B;  1VQ6 A;  2VQF L;  2F0D A;  2R7Z H;  3Q24 A;  1EU3 A;  1ASY A;  4BBS H;  3G6E A;  2Q2U A;  3A56 A;  4AIM A;  3R3O A;  2B2T C;  4HIK A;  4LFB L;  1YJ9 A;  4P2C B;  4OHJ A;  2VB3 X;  1JOK A;  3FP9 A;  5DM7 3;  1PTO D;  2JA5 B;  4JI1 Q;  2CH4 W;  3S1N B;  5C4J H;  2ZTD A;  1GHK A;  1QNU A;  3F8T A;  3CU7 A;  1VQ8 A;  5HGT A;  1PLF A;  2EYJ A;  3DWQ A;  3A8J E;  4DAP A;  3NTH A;  3J7A V;  3I2Z A;  3DLL A;  1D8L A;  1I50 H;  5FLM H;  3GTQ H;  1XMQ L;  1FJG L;  1S4Z A;  2QW7 A;  4LFA L;  1KXL A;  4UP8 A;  2EJG C;  2ZJP A;  2YU9 B;  1Z47 A;  4DAY B;  4K8J A;  2C5C A;  1IZ6 A;  3KBX A;  1YHQ A;  2AUJ D;  4JI0 Q;  3BDC A;  1LTG D;  2RSO A;  2PI2 E;  2K5W A;  1TII D;  1M90 C;  4KJN A;  3HOW B;  2PYK A;  5GAG C;  4JI1 L;  3I72 A;  3HOX G;  2R93 G;  1IBM Q;  5J1Z A;  5EKL A;  1VF5 C;  5BN3 A;  2SNM A;  1B2T A;  1CZG A;  1TWF B;  2IJ0 A;  3TP6 A;  2B8F A;  2G5D A;  3R8B A;  2NUC A;  1JT8 A;  3NXW A;  1HZA A;  4KLK A;  4A3C H;  4IFD H;  4I7Z C;  1IYV A;  3NK9 A;  2IHF A;  1HHV A;  1QVG A;  3G7L A;  3FPU B;  1MJC A;  3U9S A;  2Z9H A;  2EDG A;  4IOA A;  2Z0S A;  4OWW B;  1BXT A;  3HZX A;  3D8G A;  1MIU A;  3C3L A;  3PQI A;  2RDF A;  4HSV A;  1IBM L;  1HTL D;  1HZC A;  1LTS D;  1RL2 A;  3I3C A;  4PG3 A;  4EQO A;  1WCM G;  2K05 A;  3M4P A;  4PZ6 A;  1QZG A;  3TZU A;  3BZC A;  4KTA A;  4A4I A;  4QIW E;  2YTY A;  4E6I A;  1LTB D;  3NBH B;  4FXK C;  3MEH A;  2ES2 A;  1JJG A;  4A3G G;  1A3U A;  1STB A;  2BH8 A;  2Q2I A;  3GTG B;  1J9O A;  4RGT A;  1IKM A;  2F3I A;  1CT1 D;  1JC7 A;  2ZTE A;  3TRZ A;  3S17 B;  2ID0 A;  4HN7 A;  1EYA A;  1C8C A;  4HSP A;  3U58 A;  2BE5 D;  2LMC B;  5C3X A;  5KGU A;  3J7A 5;  1D1I A;  2DUD A;  3T51 B;  2YTX A;  4IO9 A;  2O5I C;  1ET6 A;  2HT1 A;  1EIY B;  4C1N K;  5C3W A;  1S5D D;  1U4L A;  5C6A A;  3CCL A;  4K0K L;  4DKA C;  2RA4 A;  3HOV H;  3S24 A;  4GKJ Q;  1F2L A;  1VQI A;  3OOC A;  3M7N A;  3BDL A;  3I4O A;  1JWS D;  1B3A A;  4FF2 A;  4FVM A;  1SXT A;  1WD1 A;  4HIM A;  2IX3 A;  4L8J A;  2E74 C;  1Z6H A;  2A6E C;  3SR1 A;  2GN5 A;  1WTR A;  1WTX A;  5E1F A;  4RKL A;  4C3I H;  3EQL C;  1BKB A;  1FR3 A;  3AU7 A;  5ELC A;  5C3E H;  5IYC H;  2UXD Q;  4OXP A;  4WRD A;  2F1M A;  2Q8T A;  2ZJQ A;  2E2I B;  5C4H A;  5CGK A;  4UP9 A;  2Y0S G;  1WYD A;  2OTL A;  4DV0 L;  4GKJ L;  4K14 A;  1U9R A;  5M5W B;  4DNI A;  4KHP L;  5IP7 G;  4HID A;  4JI3 L;  3I4N G;  1X32 A;  1FVI A;  2B2Y C;  1HNZ L;  2ZXO A;  1AZP A;  4OO1 H;  1Q8K A;  1QIL A;  4XQN A;  4X62 Q;  4BXX H;  4R4O A;  4GS3 A;  2VL6 A;  3J7A F;  4YY3 Q;  5IWA L;  3GTJ B;  2HQL A;  2K32 A;  1JOO A;  2F0W A;  2A6E D;  1HCZ A;  1ZYR D;  1Y1V B;  2UXD L;  3ONA B;  3M85 A;  2KA7 A;  4LJZ C;  4ID6 A;  3TS2 A;  1I6H B;  4QUF A;  4BBR H;  1EU4 A;  1E2W A;  4A93 H;  3A8I E;  1O78 A;  1GUO A;  4DV5 Q;  1L1O C;  5J3B A;  3DXJ C;  1B9M A;  4LF7 Q;  5CYU A;  4X62 L;  3HS0 C;  1PV4 A;  2E2D C;  1E1T A;  3CCS A;  5M3M G;  2KEC A;  3E5S A;  3PUW A;  1DXM A;  1X3G A;  1WI5 A;  2R3Z A;  3NBH A;  4R1J A;  1PZJ D;  3P75 A;  1NR2 A;  1KNE A;  4UHV A;  4BA1 I;  1KD1 C;  3GO5 A;  1K3R A;  4MZ9 A;  4HED A;  1VQP A;  2QCP X;  3I70 A;  3NUC A;  4QMG A;  1VQ5 A;  4KI0 A;  4R9W A;  2SNS A;  3KLS A;  4X3K A;  3T13 A;  5IT9 E;  4J8Q A;  2UUA L;  3DWA A;  4CKE A;  4UDU C;  5GAD C;  1DGS A;  4FXD A;  4NW2 A;  4LF7 L;  1G91 A;  5FK9 C;  1OXT A;  2MQH A;  5CBA E;  3VR2 A;  3Q6S A;  4LF8 Q;  3MZ5 A;  3FEW X;  3U9O A;  4OIK A;  3I55 A;  4G7O C;  4B3M Q;  1LYL A;  3G48 A;  5IGD A;  1EIH A;  3Q8D A;  3TME A;  2NZH A;  3G4S A;  4LF4 Q;  1Q3L A;  4DUZ Q;  1GUW A;  1EEF D;  1CSQ A;  3SK6 A;  5D65 A;  3EFX D;  4HJ9 A;  1I4R A;  1K0R A;  4NXM Q;  3S14 H;  4OIJ A;  5DNF A;  1HR0 W;  4A3M H;  1TWA B;  2Z6K C;  2KCT A;  4S3S A;  1X56 A;  2BCO A;  3S17 H;  3BS1 A;  1PH3 A;  1GM5 A;  2F0V A;  2UXB Q;  1UNS A;  4M1U B;  1SJH D;  3NQI A;  2B63 H;  3D4R A;  4LF8 L;  3DM1 A;  3UDG A;  1A2T A;  4B3M L;  5IYB H;  3CCJ A;  2XSC A;  1N32 Q;  1Y69 U;  3WOF A;  3A8K E;  4QL5 A;  5M3M B;  4XT3 B;  4KHV A;  1CZW A;  2JXM B;  3CC4 A;  3URY A;  1XPU A;  2F0N A;  3E0J A;  3RMH A;  1EWI A;  5IYD G;  3RZD B;  2F52 A;  1E3P A;  4EQP A;  2NN6 H;  1K8O A;  4RGM A;  3QIA A;  4CDC C;  1BCP C;  4A3I B;  4C3H B;  3CXC A;  2R92 G;  1TWH B;  3D4D A;  4LFC L;  2DJF C;  5IOD A;  2R7Z G;  2N3S A;  1E2Z A;  1T5E A;  4BBS G;  4KKS A;  4WJ4 A;  2AMC B;  2C9O A;  2B2U A;  3D4W A;  1EY7 A;  4BS9 A;  1N32 L;  4A3E G;  1K8G A;  2JQO A;  2WFW A;  1AE2 A;  2HDM A;  3CCR A;  4HJ5 A;  4A3D H;  3WWV A;  5EAY A;  2E2H H;  1OXV A;  5M5W H;  3X3N A;  4ZAI A;  3HOZ H;  1XXG A;  5FLM G;  4DV7 Q;  1PH5 A;  3K8A A;  4EGV A;  2G9D A;  2N8N A;  1I6V C;  1I4G A;  5ELN A;  4C3J G;  1HH2 P;  4U67 3;  1BCP D;  1XJV A;  1Y8N B;  3NP8 A;  1GXD C;  4AYB G;  4JBK A;  3GTL B;  2NVT H;  4X65 Q;  2EY2 A;  2KCN A;  1XTD A;  3GTP B;  1YNX A;  4IUP A;  1IW7 C;  3E3X A;  5JJI A;  5FO9 B;  2HUG A;  3JAM c;  2DNC A;  1NCV A;  3BJU A;  4KK7 A;  2XGT A;  4YWL A;  1B7Y B;  1K8M A;  4LUZ A;  3S1Q H;  4DV7 L;  1XTC D;  2F0P A;  4IQZ A;  4AQY L;  5E7N A;  4HCS A;  2OWO A;  3K7U C;  1JB7 A;  2AQ3 B;  4UP7 A;  1BO0 A;  3PMF A;  1DOM A;  2O5J C;  1KL9 A;  3I4M G;  4XYQ A;  4DV1 Q;  2AHO B;  1LTR D;  2ZT9 C;  4DV2 Q;  1H9M A;  1L0Y B;  2HQE A;  2KEE A;  2E76 C;  4HIO A;  2OCE A;  2B29 A;  4DK0 A;  1BDO A;  3ER0 A;  4X65 L;  1ROD A;  1A3T A;  2EYF A;  4GOP A;  1HQR D;  1JWM D;  1NUC A;  3S16 H;  4Y52 H;  1G8Z D;  4A3E B;  2OXP A;  5KNC A;  5F2D A;  1KLU D;  2RVL A;  1B53 A;  4QGU A;  3K58 A;  4LF5 Q;  1DCZ A;  2RCF A;  5FOB B;  2QKI C;  1J5E Q;  2CFM A;  2VNU D;  4GKK Q;  4IPC A;  1IKL A;  4G4K A;  3H6M A;  4DV1 L;  1BBX C;  3TP7 A;  4DK3 C;  4B3S Q;  3U4Z A;  4C3J B;  5C0X H;  4IAL A;  1PA6 A;  3VR5 A;  1N34 Q;  2DY8 A;  2CW0 D;  3G71 A;  1CSP A;  5T1I A; 
#chains in the Genus database with same CATH homology
 3GTO B;  2D2C C;  4G57 A;  4XIG S;  2BA1 A;  1ESR A;  3T56 B;  1CFM A;  2B2T A;  2EJF C;  1SAP A;  3L3O C;  1QB5 D;  3FKI B;  3RLF A;  4RCN A;  1SYE A;  3MAQ A;  3TN2 A;  1B44 D;  1V1P A;  1SMY C;  1HTP A;  5ELD A;  1EWC A;  1A3V A;  4DU9 A;  1J8I A;  1EY8 A;  4G7Z C;  4K6D A;  4FF3 A;  2F0S A;  1GJX A;  2L9H A;  5IGG A;  2N88 A;  3H09 A;  4RKB A;  1EEI D;  2L11 A;  3CQZ B;  3JAM L;  4TRD A;  1JCK B;  4XT1 B;  3GQB A;  2A6H C;  1PZI D;  3Q0A A;  1EWH A;  2JA8 B;  1SNQ A;  4FF4 A;  1B50 A;  3I8Z A;  1X3P A;  3D3R A;  2HDL A;  5COY A;  2QDB A;  1EL0 A;  3RD4 A;  1FYC A;  3L7Z C;  1TWG B;  3NHH A;  2IX0 A;  5K36 G;  1SMY D;  3K5L A;  2PNR C;  5ELE A;  4KKT A;  3HOU B;  2NVX B;  2LY7 A;  5HUR A;  1EFI D;  5JVH 3;  1BQQ T;  3LWU A;  1CM9 A;  3ZYY X;  1ESF A;  5IGE A;  1G6Z A;  2A6H D;  5EQ0 A;  1BOS A;  5I6W A;  1VF7 A;  2OEO A;  2A69 C;  1KLG D;  3GV6 A;  4RCO A;  3S1M B;  2QF7 A;  5CV8 A;  3SXH A;  5EPJ A;  1LO5 D;  5KNB A;  2RDH A;  3KLR A;  1DON A;  2EYO A;  2K6A A;  1YNN D;  3PO2 B;  3S9W A;  5FO8 B;  2F0I A;  4A3B B;  1SJE D;  1LAB A;  1ZKO A;  3T16 A;  2X69 A;  4FP5 D;  4KJO A;  4ZYS A;  1BR9 A;  3S15 B;  2V4D A;  2E75 C;  2JYO A;  4ULL A;  4NKL A;  2R61 A;  2JA7 B;  5TSS A;  1RKN A;  4O42 A;  1PZK D;  2B2V C;  3S2H B;  2F0E A;  1SNM A;  2D62 A;  5CBE E;  2A69 D;  2F0J A;  1KAB A;  5IIF A;  2A74 C;  2M9V A;  3MXU A;  5JEA H;  1O7Z A;  1STE A;  5K5P A;  3BVZ A;  2EPB A;  4FF1 A;  4HMI A;  3NPP A;  1STN A;  4F88 A;  1PDQ A;  2ICI A;  3VYS A;  4JBW A;  2BDO A;  1Y1W B;  3A7A B;  5C4Z A;  4L63 B;  4A3K B;  4V19 0;  1H9R A;  2D9U A;  5J22 A;  1M8A A;  1TS2 A;  5EGT A;  1S5F D;  2A5H A;  2RQX A;  3TP8 A;  5KEE A;  4XTC S;  1TU2 B;  3CRK C;  1WTV A;  4LAA A;  1PFB A;  3CKI B;  2L4N A;  2B2Y A;  4FXG C;  1DOL A;  3IL8 A;  3QOL A;  2BE5 C;  2NWG A;  2AUK A;  2SDF A;  4A3J B;  1OXX K;  3SVM A;  2DY7 A;  1ILP A;  1G2T A;  2NN6 G;  5EBD A;  2L0C A;  1KTK A;  2KUM A;  1QE6 A;  3C1E A;  2RBM A;  1KDA A;  3L9A X;  5C0X J;  4NP5 A;  2NVQ B;  2D5D A;  3PIP 3;  2Q8R E;  1BNZ A;  2AQ1 B;  4N9T A;  4J1M A;  2M00 A;  1F9Q A;  4EQN A;  3QB3 A;  3PUX A;  1M4V A;  1EQV A;  3HOX B;  1SND A;  2R93 B;  3KK7 A;  3QG1 A;  2NYZ D;  4Q0F A;  5KYI A;  4CKC A;  1X3Q A;  3AB9 A;  1V8Q A;  2HCC A;  4X3U A;  4X3T A;  3S2D B;  5EKI A;  3MXP A;  2SEB D;  4R8I A;  3T53 B;  2Z4H A;  3SK5 A;  4BY1 B;  4PMC A;  2XRS D;  4ZKB B;  1WTP A;  1JOR A;  3MC0 B;  1ZYR C;  1JE4 A;  1C48 A;  4RGO S;  2PW5 A;  3TDQ A;  2QIL A;  5G3L D;  1WCM B;  1D5M C;  2AWO A;  5I9P A;  1R4P B;  1GOZ A;  5KIX A;  1TT2 A;  4Y7N B;  2F0Q A;  4A3G B;  1PRT B;  5ELB A;  1CK1 A;  3MA2 B;  4HTH A;  4H13 C;  5CMD A;  3NQT A;  1TS5 A;  4CHT B;  1PXU A;  2WAQ B;  2MJ8 A;  1AZQ A;  2F0H A;  3VYT A;  2BA0 A;  3MTS A;  2F0M A;  1DM0 B;  1RD9 D;  3R2I A;  2YYZ A;  4K2L A;  5ELF A;  3W3A A;  2JE6 I;  1E2V A;  4DNT B;  3HG9 A;  5FLX E;  4A3F B;  1S5E D;  1IL8 A;  1HA5 A;  1PMR A;  1SEB D;  3HGB A;  1GUN A;  5KND A;  2HCI A;  2K28 A;  1RJT A;  4HMJ A;  3JAM E;  5G3L F;  3FVQ A;  2JP1 A;  2Y0S B;  2WII B;  3K0Y A;  2B2W C;  5BN4 A;  1RTN A;  1VCI A;  3TZD A;  2CHB D;  2WV6 D;  3MXG A;  3I4N B;  5JEA J;  3QWN A;  3I73 A;  4KN4 C;  4HAE A;  4L6T B;  5C44 B;  1ONL A;  3ERO A;  2K01 A;  4V0B A;  5EPL A;  5COR A;  4KY6 A;  1F77 A;  2CVR A;  1CQF A;  2MHV A;  1TR5 A;  1PTO B;  1GUT A;  2M2L A;  1A6X A;  1SYD A;  3TBI B;  1RDP D;  1CQV A;  4IFD J;  2F0F A;  1YNJ C;  1I4H A;  1G2S A;  3FDT A;  1EZ8 A;  3I4L A;  3P20 A;  3PUV A;  3KUP A;  4OGQ C;  3HKZ B;  2TMP A;  4RGN A;  3VYU A;  3J7Y W;  1A2U A;  1EY9 A;  2GA4 B;  1V1O A;  1VDZ A;  3J80 L;  3R93 A;  4QB4 A;  2IX1 A;  1AFP A;  1EY5 A;  3F2U A;  3K59 A;  3A54 A;  4ZRZ A;  4H0L C;  1F9S A;  3NSW A;  1F2M A;  3M4O B;  3MVV A;  5DAU A;  1B1Z A;  3KF8 A;  1DYQ A;  3GTK B;  3VYR A;  1LT4 D;  4IUQ A;  1FD7 D;  4F7X A;  1YNJ D;  3OHX C;  2I46 A;  5CV6 A;  5IGB A;  1V1P B;  3T4A C;  4ZK9 B;  2K1B A;  1HA6 A;  1DJR D;  4KY7 A;  3D6C A;  2F3V A;  2XN9 C;  3OWE B;  4ZUJ A;  3MXN A;  2Z8L A;  5M3F B;  1D2B A;  1RTO A;  1EOT A;  1TVX A;  2FMC A;  4KD4 A;  4MIU A;  4LMQ D;  1GHJ A;  2JEA I;  4PV1 C;  4PMB A;  3K5N A;  5C4X B;  2PZU A;  5AFW A;  3OW7 A;  3K6O A;  1JB3 A;  3NTI A;  5JEA G;  4C1N I;  3WDN A;  2K04 A;  3K5O A;  5I2X A;  1UEA B;  3C2P A;  3PUY A;  1SE2 A;  3RZO B;  1TS4 A;  3QO2 A;  1AEX A;  4C56 C;  4IFD G;  2CW0 C;  2NVY B;  1PFM A;  2R92 B;  1SE4 A;  3TSS A;  4DA2 A;  4MN3 A;  1UUP A;  2EYM A;  2R7Z B;  2EOT A;  4BBS B;  3SK8 A;  1Y8P B;  1TKW B;  5DM6 3;  2PW7 A;  2IW3 A;  3GP7 A;  4JK1 C;  5I9O A;  1JIC A;  4QUC A;  4DK1 A;  1SYC A;  5CR3 A;  3FMC A;  5C4J B;  3Q23 A;  1JR0 D;  4B08 A;  2A73 B;  3WOE A;  1WD0 A;  1I50 B;  3GTQ B;  4G7H C;  1ZEQ X;  1QNK A;  4DF7 A;  2Q8I B;  1K83 B;  4KV6 A;  3K7A B;  4AYB B;  5I6Y A;  1MSG A;  5FKA C;  3M7G A;  3HRZ C;  2K5D A;  3ERQ A;  1Y8O B;  4GZY C;  1Z7T A;  1HUM A;  4TQU S;  4CJ2 C;  4FNF A;  1SYG A;  3N52 A;  5JOB A;  3H91 A;  5JPM C;  3I4M B;  1FNV A;  2VB2 X;  3VA5 A;  3H3V C;  3IAY A;  3ITP A;  2FFK B;  2K33 A;  4B9X A;  2F0K A;  2PCF B;  1STY A;  1DOK A;  1PRT D;  2XNA C;  3GTM B;  2OT2 A;  1Q12 A;  2KVM A;  4C3I G;  2WKC A;  1STG A;  2WP8 J;  2RSN A;  4U68 A;  2ZXP A;  4CGY B;  4KD3 A;  1NAP A;  4QCL A;  3CRL C;  4EVO A;  1E0B A;  2F0U A;  2XRQ D;  1CTM A;  4K6L A;  4OO1 G;  3DEO A;  1YNN C;  1ENA A;  2EYH A;  1LT3 D;  5JPN C;  4DN4 M;  5CV9 A;  1PYW D;  1C4Q A;  2PMZ B;  1U4R A;  2KED A;  4J6H A;  5C5M A;  4KN7 C;  2MPM A;  3MWY W;  2KHS A;  1RF2 D;  1BUV T;  2I07 B;  2F0O A;  3Q22 A;  4K2K A;  3HOV B;  2F03 A;  1F2Y A;  2F0G A;  4PQX A;  1EZ6 A;  1CI3 M;  4RFB A;  3PIO 3;  1D5Z C;  1ML0 D;  5KYL A;  4RH6 A;  3J81 L;  3MHB A;  1EIG A;  2PPB C;  4HR7 B;  3V96 A;  1FGB D;  3OMG A;  1LTI D;  2X6L A;  4C3I B;  5IGC A;  1SSO A;  4TSS A;  1PRT F;  5LL6 X;  5C3E B;  2KCC A;  2MP1 A;  1VMC A;  3FPP A;  1Q1E A;  2XWJ B;  1H9S B;  2EY1 A;  3PO3 B;  3NWS A;  5E4W C;  1EYC A;  5A35 A;  4PNY A;  4FYD A;  3TP5 A;  2J0T D;  2WB1 B;  5NUC A;  4K5X A;  4K5V A;  1ENC A;  3HP3 A;  4XQQ A;  2FJ2 A;  4BBR B;  3DMU A;  4A93 B;  4RWS C;  1LT5 D;  4IFD I;  3S1R B;  4KHZ A;  3J80 E;  5JAV A;  4DNR B;  2EY6 A;  3OWF A;  1F9R A;  5A2Q L;  1RCV D;  3RUZ A;  2L12 A;  1BCP B;  5FO7 B;  1QCB D;  3P7J A;  1H9J A;  5IGF A;  1HQM C;  2TSS A;  4ZQ3 A;  3BVM A;  2VXW A;  3SDZ A;  4QF4 A;  2NB0 A;  3A7L A;  3BDO A;  1A15 A;  3OSO A;  1B4O A;  4I65 A;  3UI2 A;  3LX0 A;  3QJY A;  1XX8 A;  4N9P A;  1EQT A;  3KBG A;  1AW7 A;  4RHS A;  2BOS A;  1LTT D;  1PTO F;  4NDX A;  1SNP A;  3CHB D;  2EVB A;  1MD2 D;  4RHR A;  3OIP A;  1TY2 A;  3S14 B;  3MFG A;  5EBC A;  3QOJ A;  5BN5 A;  3E6Z X;  4A3M B;  1D1K A;  2RKS A;  1LT6 D;  2PZW A;  1WTO A;  1ICW A;  3NTK A;  1HFN A;  5D3D A;  2AQ2 B;  4K8I A;  2KJX A;  2B2W A;  4ABN A;  2B63 B;  1ENF A;  1KDB A;  3GV3 A;  4KKU A;  4OL7 A;  1HUN A;  2O4X A;  1SE3 A;  1XWE A;  2B39 A;  1H9K A;  1H9S A;  1SBB B;  5D14 A;  3VR3 A;  4IUU A;  4FO2 A;  3C46 A;  1QJO A;  5CV4 A;  1ZXT A;  1LAC A;  4Z9C B;  2IL8 A;  4DAY A;  2BDN A;  1OO9 B;  1CA5 A;  4OO1 I;  3DEP A;  3NWT A;  1BF4 A;  1O7L A;  1IHZ A;  2F4I A;  5CC4 A;  2IWH A;  4A3D B;  5LL6 S;  3M4Y A;  2E2H B;  1IYU A;  2J7Z A;  3D6W A;  1O80 A;  3HOZ B;  3PV0 A;  5K36 H;  3I91 A;  4IUT A;  1LLR D;  2OF1 A;  3K57 A;  4IUR A;  1DZ1 A;  5C0X G;  1W6J A;  5J39 A;  5M9O A;  3AMU A;  2H1E A;  4BWG B;  1T5X D;  1AN8 A;  2Z4I A;  1TQO A;  2IPK D;  2J4X A;  3EA6 A;  1RHP A;  4YIJ A;  2LKV A;  2NVT B;  4UAI A;  2R6G A;  5KRU A;  1WTQ A;  2NZ1 D;  2ICE C;  1EY0 A;  5EPK A;  1HFG A;  1NR4 A;  3S1Q B;  3X3M A;  3I90 A;  4H7B A;  2L5T A;  2WAC A;  3D31 A;  4KY5 A;  5ISR A;  2O2L D;  5JJZ A;  1II3 A;  1STH A;  3PUZ A;  2KOL A;  5C5L A;  4CKB A;  1L0X B;  2LS0 1;  1SNC A;  3S16 B;  4C3H G;  4DXG A;  1MGS A;  1Q8I A;  3VR4 A;  1ET9 A;  5IOC A;  2QEJ C;  4IUV A;  1QOH A;  4HCE A;  2PQE A;  2Z1C A;  1HRJ A;  2WKD A;  4XDX A;  2DN8 A;  2MUY A;  2PO4 A;  1U4P A;  2PZT A;  2XIW A;  3M3Y B;  3HOY B;  1KDC A;  2JA6 B;  1SFO B;  3J81 E;  1G29 1;  4BY7 B;  2NN6 I;  2ZXR A;  4O1N A;  1O7Y A;  1VMP A;  4KMU C;  4XQJ A;  3NBI A;  4QIW B;  1KNA A;  4CJ0 B;  5CV5 A;  1KAA A;  5E4X A;  2LFN A;  3LWE A;  4CBV A;  2B8G A;  2DNE A;  1V43 A;  1MSH A;  5D3I B;  1CA6 A;  1AP0 A;  1SYB A;  1OXS C;  2EE1 A;  2FHT A;  5DEH A;  4PMW A;  3H0G B;  4IN3 A;  2EXZ A;  4ZUI A;  3V05 A;  4WJW A;  1UAP A;  1NSN S;  1FNW A;  1EY4 A;  4TKO B;  1EY6 A;  4LK1 C;  3W2D A;  1HPC A;  3V2T A;  4ZKC B;  1MI2 A;  1WVL A;  2K03 A;  2IT1 A;  5A2Q E;  3DUZ A;  1CHQ D;  2F0T A;  3OPO A;  2X6G A;  1MBY A;  2MGS A;  4DGZ A;  3P1H A;  5M5X B;  2XWB B;  3GD7 A;  3VA7 A;  1FNU A;  3ND9 A;  4RAU C;  2EJM A;  1JWU D;  2A68 C;  1EYD A;  3R2T A;  4K5W A;  3EVQ A;  2K7V A;  2ENB A;  5E3F A;  2NTT A;  2JEB I;  4ME5 A;  5EKK A;  3BVG A;  3C1F A;  1LV9 A;  1D6E C;  2EYP A;  5EJW A;  2FMM A;  4ODG A;  2CQA A;  4XYO A;  3MFY A;  4CJ1 B;  3BZD B;  1R9T B;  5C0X I;  1IW7 D;  4IZ8 A;  2NBF A;  1PRT C;  2WIN B;  3NE5 B;  4Q5V A;  1JOQ A;  1PTO H;  4ILW A;  1LTA D;  1DD2 A;  4RA8 A;  4ZLT F;  1I4Q A;  2JSO A;  1R4Q B;  1TY0 A;  3DWP A;  4R8N A;  2A68 D;  2KQ3 A;  3N6R A;  1STA A;  1WTW A;  2K5Q A;  4DFA A;  2F0L A;  4NMZ A;  3SE0 A;  3IFT A;  2B2U C;  4WFN 3;  3SHL A;  3KLS X;  1Q90 A;  1BCP F;  2EZV A;  3BG3 A;  4DXF A;  1HXY D;  3EJI A;  2B2V A;  3H94 A;  2EY5 A;  3HEJ A;  1S5C D;  4WOR A;  4B9W A;  1S5B D;  5M5Y B;  1GUG A;  1GUS A;  5FLX L;  3IFD A;  2RDG A;  4H44 C;  2XVS A;  5T1G A;  1W6K A;  1PFN A;  1TWC B;  1Q1B A;  3VR6 A;  2L55 A;  4M8A A;  2AWN A;  4X3S A;  1SDF A;  5IT9 L;  2L1B A;  4XXE A;  2VUM B;  2FIN B;  2SOB A;  3K5M A;  2EYL A;  1ILQ A;  1SNO A;  3SEB A;  2NTS A;  1I4X A;  1F9P A;  1QWY A;  2F3W A;  5I2Y A;  1I4P A;  1OXU A;  5JVG 3;  2N55 A;  4DAV A;  1JQY D;  1D5X C;  3BYT B;  5I4D A;  3ND8 A;  3BYY B;  3OIQ A;  3SK4 A;  1CHP D;  4BA2 I;  1PTO C;  4F87 A;  1B9N A;  2H4O A;  1F2Z A;  1SYF A;  2G9H D;  3OMC A;  5CV7 A;  3G6J B;  3DHQ A;  3LNN A;  4MHE A;  4IUN A;  4C2M B;  1QG7 A;  4F8M A;  1TS3 A;  3IKJ A;  3A55 A;  3O13 A;  1U4M A;  5LHY 1;  3FRP B;  1XYI A;  1I3Q B;  2F0D A;  3Q24 A;  1EU3 A;  3A56 A;  3R3O A;  2B2T C;  4P2C B;  4OHJ A;  2VB3 X;  1JOK A;  5DM7 3;  1PTO D;  2JA5 B;  3S1N B;  1GHK A;  1QNU A;  3CU7 A;  5HGT A;  1PLF A;  2EYJ A;  3DWQ A;  3A8J E;  4DAP A;  3NTH A;  3J7A V;  1S4Z A;  2EJG C;  2YU9 B;  1Z47 A;  4K8J A;  2C5C A;  3KBX A;  2AUJ D;  3BDC A;  1LTG D;  2RSO A;  2K5W A;  1TII D;  4KJN A;  3HOW B;  2PYK A;  3I72 A;  5J1Z A;  5EKL A;  1VF5 C;  5BN3 A;  2SNM A;  1B2T A;  1CZG A;  1TWF B;  2IJ0 A;  3TP6 A;  2B8F A;  3R8B A;  2NUC A;  3NXW A;  4IFD H;  4I7Z C;  1IYV A;  3NK9 A;  1HHV A;  3G7L A;  3FPU B;  3U9S A;  2EDG A;  1BXT A;  3HZX A;  3D8G A;  3C3L A;  2RDF A;  4HSV A;  1HTL D;  1LTS D;  3I3C A;  4EQO A;  2K05 A;  3TZU A;  4KTA A;  4E6I A;  1LTB D;  4FXK C;  3MEH A;  1A3U A;  1STB A;  3GTG B;  1J9O A;  4RGT A;  1IKM A;  1CT1 D;  1JC7 A;  3S17 B;  2ID0 A;  4HN7 A;  1EYA A;  1C8C A;  4HSP A;  2BE5 D;  2LMC B;  5C3X A;  5KGU A;  1D1I A;  3T51 B;  2O5I C;  1ET6 A;  4C1N K;  5C3W A;  1S5D D;  1U4L A;  5C6A A;  2RA4 A;  1F2L A;  3OOC A;  3M7N A;  3BDL A;  1JWS D;  1B3A A;  4FF2 A;  4FVM A;  1SXT A;  1WD1 A;  2IX3 A;  4L8J A;  2E74 C;  1Z6H A;  2A6E C;  3SR1 A;  1WTR A;  1WTX A;  5E1F A;  4RKL A;  3EQL C;  1FR3 A;  3AU7 A;  5ELC A;  4WRD A;  2F1M A;  2Q8T A;  2E2I B;  5C4H A;  5CGK A;  4K14 A;  1U9R A;  5M5W B;  1X32 A;  2B2Y C;  2ZXO A;  1AZP A;  4OO1 H;  1QIL A;  4XQN A;  3J7A F;  3GTJ B;  2K32 A;  1JOO A;  2F0W A;  2A6E D;  1HCZ A;  1ZYR D;  1Y1V B;  3ONA B;  3M85 A;  2KA7 A;  4LJZ C;  4ID6 A;  1I6H B;  4QUF A;  1EU4 A;  1E2W A;  3A8I E;  1O78 A;  1GUO A;  3DXJ C;  1B9M A;  5CYU A;  3HS0 C;  2E2D C;  2KEC A;  3E5S A;  3PUW A;  1DXM A;  2R3Z A;  3NBH A;  1PZJ D;  3P75 A;  1NR2 A;  1KNE A;  4BA1 I;  3GO5 A;  4HED A;  2QCP X;  3I70 A;  3NUC A;  4QMG A;  4KI0 A;  4R9W A;  2SNS A;  3KLS A;  4X3K A;  3T13 A;  5IT9 E;  4J8Q A;  3DWA A;  4CKE A;  4UDU C;  4FXD A;  4NW2 A;  1G91 A;  5FK9 C;  1OXT A;  5CBA E;  3VR2 A;  3Q6S A;  3MZ5 A;  3FEW X;  3U9O A;  4OIK A;  4G7O C;  5IGD A;  1EIH A;  3TME A;  1Q3L A;  1GUW A;  1EEF D;  3SK6 A;  5D65 A;  3EFX D;  1I4R A;  4OIJ A;  5DNF A;  1TWA B;  4S3S A;  2BCO A;  3BS1 A;  2F0V A;  1UNS A;  4M1U B;  1SJH D;  3NQI A;  3D4R A;  3DM1 A;  1A2T A;  2XSC A;  1Y69 U;  3WOF A;  3A8K E;  5M3M B;  4XT3 B;  4KHV A;  1CZW A;  2JXM B;  3URY A;  2F0N A;  3E0J A;  3RMH A;  3RZD B;  4EQP A;  1K8O A;  2NN6 H;  4RGM A;  3QIA A;  1BCP C;  4A3I B;  4C3H B;  1TWH B;  3D4D A;  5IOD A;  1E2Z A;  1T5E A;  4KKS A;  2C9O A;  3D4W A;  2B2U A;  1EY7 A;  4BS9 A;  2HDM A;  1OXV A;  3X3N A;  4ZAI A;  1XXG A;  4EGV A;  2G9D A;  1I6V C;  1I4G A;  4C3J G;  4U67 3;  1BCP D;  1Y8N B;  3NP8 A;  1GXD C;  3GTL B;  2EY2 A;  2KCN A;  3GTP B;  4IUP A;  1IW7 C;  5FO9 B;  2HUG A;  2DNC A;  1NCV A;  4KK7 A;  1K8M A;  1XTC D;  2F0P A;  4IQZ A;  4HCS A;  2AQ3 B;  1BO0 A;  3PMF A;  1DOM A;  2O5J C;  4XYQ A;  1LTR D;  2ZT9 C;  1H9M A;  1L0Y B;  2HQE A;  2KEE A;  2E76 C;  4DK0 A;  1BDO A;  1ROD A;  1A3T A;  2EYF A;  1HQR D;  1JWM D;  1NUC A;  1G8Z D;  4A3E B;  2OXP A;  5KNC A;  5F2D A;  1KLU D;  2RVL A;  1B53 A;  3K58 A;  1DCZ A;  5FOB B;  2QKI C;  2VNU D;  1IKL A;  4G4K A;  3H6M A;  1BBX C;  3TP7 A;  4C3J B;  5C0X H;  4IAL A;  3VR5 A;  2DY8 A;  2CW0 D;  2E2J B;  5T1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...