4JYAL

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 14
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jyaL00
1PV4A 1PH1A 4R4CA 3CQZH 1RL2A 5GAHC 1VQ9A 5JEAJ 3UDIA 1YJWA 2CCZA 4L5QA 3FKIH 3NEMA 4JI5L 3CPFA 4IFDJ 4DNIA 4KHZA 4NXMQ 1QUQA 2JK8A 2KHJA 4HIKA 4AQYL 4IFDI 4A3FH 2MQHA 3H3VH 3D0FA 4KLKA 4P72A 1VQNA 4JI2L 2JEBI 4LFAQ 4DR3L 1YHAA 2NVYH 4EX5A 2WAQE 3PUWA 4BA1I 2NVXH 3GTGH 3S15H 2F3IA 3CMAA 1Q12A 2B63G 3HOZG 4DR1Q 1VQ6A 2JQOA 4DV3L 2R7DA 2ZTDA 4BBRG 5BR8L 4OO1G 1EFWA 2UUBQ 2AHOB 4DV6Q 4DR2Q 3KJPA 2F52A 4XTCS 2JA5H 4JOIC 4LF7Q 5IE8A 5GAEC 3RLOA 1VQLA 3S17H 4A3FG 4X65Q 1VS0A 4Y52H 4C2MH 3Q8DA 2K5NA 4UP9A 1SFOH 1VQ7A 3M7NA 2KBNA 2AMCB 4DV5Q 3DM3A 5M5YH 3GTQH 3GTMH 1Q86C 1VQ5A 4OX9L 1A0IA 2ZTCA 4R4TA 4JYAL 2WB1E 1Q1EA 5C4XH 4DR2L 1VQPA 1EQQA 4K0KL 4GOPA 1YI2A 4NB3A 4EQ5A 5C4XG 1OXSC 1TWFH 1G51A 3I55A 4YCUA 2KHIA 3M4OH 4UP7A 1L0WA 2Q2HA 5FLMH 1EQRA 1UE5A 1NE3A 4DK6C 2EQSA 1VQDA 2RHQB 3RNUA 2HHHQ 1W3SA 2OTJA 3GTLH 2OCEA 5IYCG 1D8LA 1UEBA 3J80c 4A3GH 1LUZA 4IOCA 1XMOQ 2YTYA 4UY8C 3JC66 2UXCL 1MJEA 4JI8L 1CKNB 1X55A 3TEHB 2OWOA 1EOVA 2UUAL 1YVCA 3JAMi 2VS1A 3HOXH 4JBWA 4MZ9A 5M5WH 1Y1VH 2ALYB 5M3MH 1C7YA 1YBYA 1J5EQ 4GN4B 2ZM6L 4OWWB 2E5LQ 1VQEA 2IY5B 3T1YQ 1IBKL 3AQQA 3S1RH 3EIVA 2WFWA 4DV3Q 3GTPH 2GN5A 1JJCB 4PMWA 4BXXH 3HOWG 4BBSH 1E1TA 5ELOA 4DKAC 4MTNA 4TQUS 4X64Q 1B8AA 3CC2A 1FJGQ 1NBWA 3OYYA 2NVTH 1MKHA 3PO2H 1X65A 2ZJQA 2LXKA 1WFQA 4DV0L 1X3FA 1YJ9A 3TS2A 1TWAH 4LF8L 2BH8A 4X62Q 3H3VI 3HOUG 5K36G 3CAMA 4O0AA 1PH2A 3UE1A 2HIXA 3PSIA 1YHQA 4YHHL 4LF6L 2YV5A 2Y0SE 4DPGA 2R6GA 3J80i 3GO5A 3AEVA 2Y0SG 2R93G 1D7QA 3S1MH 1VQOA 1NJIC 3PUYA 3B6YA 2A1AA 2R7FA 5IP7H 2V1CC 4DV4Q 4HJAA 4LF8Q 2YTXA 3GD7A 4DV7Q 3TQYA 4GLAC 4RMFA 1XJVA 4NXNQ 1JMCA 3W5OA 3I7FA 2K52A 3KF6A 1KHIA 4LWCA 1R9TH 1PH7A 3HOYG 2AWNA 3PF5A 4A3CG 2CFMA 2PI2A 4A3EH 3NENA 4OONA 1PA6A 1IBLQ 2N3SA 1PH6A 1KRTA 4RG1A 2VQEL 1L1OA 1OXXK 4JYAQ 5E7NA 4POGA 1NMFA 4DUZL 2AKWB 3I4OA 2VL6A 3TREA 4OWXB 1PH4A 1K3RA 1NMGA 2MO0A 4OO1I 4PZ7A 1M90C 3KFUA 1CKOA 3STBC 2K75A 4A3IG 2R7ZG 3PIPA 3FP9A 5C3EG 5IP9H 1XNQQ 3ULJA 5C4JH 4JI3L 3H0GH 2KENA 4DUYQ 4AYBG 2F4VL 3KDFA 3ZJYC 1SN8A 1HH2P 3ER0A 3CMEA 2Q2IA 3F2DA 4LFAL 3FKIG 1X3EA 3MEFA 4X64L 3S16H 3AFPA 1I6HH 4Y7NH 4H02A 1UE1A 5C44H 4DR5L 4A3MH 4JI7L 1PVOA 1L1OB 1GKHA 4DR6L 3F8TA 4GNXB 2RF4A 5J3BA 4YCWA 5IYBG 4LF9Q 4GKKL 1YEZA 1YIJA 3RLNA 1VQAA 1HR0W 3PIOA 2VUMG 2NN6G 2BH2A 4PZ6A 1QZHA 3H0GG 4A3EG 5H1SE 1S40A 1BBWA 3HKZE 4GLVB 1SRUA 3PGZA 4BY7G 1RIPA 4HJ7A 1PFSA 1K8AC 5C0XJ 4GKJL 4JBMA 1VQBA 4DV7L 1HNWQ 4GNXA 1YITA 2JA8G 4DV2L 3F2BA 4HIOA 4XIGS 3T1HQ 1SROA 2E2JH 4A4IA 2K50A 3G4SA 4LF4L 3HOWH 4BBSG 4MNOA 5IYCH 4LFBL 2QEXA 3RR5A 3L2PA 1VQHA 1N33Q 4JV5L 2JA6H 4A3BH 4K0KQ 4PG3A 4LFCL 3ULPA 3S2DH 1W2BA 1XNRL 1KXLA 3S1QH 3L0OA 1VCIA 4P71A 4GNXC 3CXCA 4B3RL 2WAQG 3IRBA 4DR4L 5HGQA 3PO3G 4DR7Q 4IFDG 4A3KG 4WJ3M 3EBEA 3HFZB 1WJJA 5HY6A 1JJGA 1SLJA 1GD7A 4AIMA 1S3OA 2VQFQ 1E7ZA 2ID0A 2D0OA 4TVAB 5IWAL 1HJPA 5AJ3L 2VW9A 4LF5L 1U0LA 1BBUA 3PUZA 4JI5Q 2CKZB 2QA4A 1HR0Q 3I4NG 2R93H 2WP8J 4AH6A 2Z0SA 1X54A 2JA6G 4A3BG 4C3IH 3EN2A 2ZTEA 1G6PA 3K80C 5LMUL 3J81c 5IY0A 2HIVA 1B70B 4DR3Q 4R4IA 1B7YB 2OQ0A 1EIYB 5IWAQ 5AJ3Q 1EUJA 4LF5Q 3CCSA 1KD1C 4A3KH 3J81j 1N32L 3BJUA 2RCNA 4B3MQ 1Q7YC 1E3PA 1E24A 2I5MX 3RN5A 1K0RA 2DGYA 4LUZA 2CWPA 3F2CA 4JI8Q 3HOVH 4LNQA 3U4VA 3J81i 1VQIA 2GVBA 4JI0L 2LXJA 2C35B 2F4VQ 4JOIA 4LUVA 1K83H 2NZOA 5BR8Q 2UXDL 1OXUA 2Z6KA 3A0JA 2A8VA 3HOXG 1HNWL 4HJ9A 1KC8C 5IT9c 5IP9G 5JJIA 4B3TQ 3KOJA 1QVGA 4JG2A 5GQOA 3CCUA 4O2DA 1WOCA 2I5LX 1LYLA 3A5UA 4A3LG 2N8NA 1LM0A 3CCEA 4BA2I 3PUXA 4IPHA 1K8GA 3OTOL 2KCMA 3ERSX 4GN3B 4L5TA 1UE7A 4FDBA 2ZJRA 1HNXQ 4GN5A 2ASBA 4DR7L 4QIWE 1OXVA 3GDEA 4L5SA 1E1OA 2UUCL 4L5RC 1FVIA 4OXPA 3I56A 3CP0A 1OTCA 2LSSA 1E22A 1VQ4A 4JI1L 1X9NA 1CSPA 4DK3C 1VQFA 4DR1L 3CCLA 1HNXL 1GM5A 2D0PA 1NTGA 2I5HA 3HKZG 1AE2A 1QVCA 1QZGA 4WJ4A 1GO3E 1Y14B 2MFIA 1IXRA 3U58A 1O7IA 1VQJA 5EAYA 3E9IA 5GAGC 1IBMQ 1N33L 5JJLA 1PH9A 2AWOA 1HZ9A 4UP8A 1BVSA 4IJLA 1HNZQ 1N32Q 3U50C 3KF6B 4DV1Q 4GLXA 4NXML 4HIMA 1XPUA 1KAWA 2EXDA 1MIUA 1IZ6A 4AQYQ 1J5EL 3S14H 3W1GA 4LW1A 1N34L 3SGIA 2CQOA 4JI7Q 2I0QA 1N9WA 2HT1A 2E8GA 3CC7A 2IX1A 2VQFL 1YHBA 2JE6I 5IYDH 1I94L 1FJGL 2PNHA 3E9HA 3PO3H 5FJ8G 3LGJA 1SMXA 1NY4A 1HR0L 5LMNL 2MO1A 4A3DH 4YY3L 2UU9Q 1PYBA 1TWCH 5FJ8H 1XTDA 4KI0A 1Y1WG 4A3DG 2ATWA 1VQCA 1UWVA 4JI6L 3STBD 1LTLA 4DV6L 1XNQL 3I4NH 2N49A 3M4PA 3HOVG 2UXCQ 3G71A 1XPOA 3S1NH 3WWVA 1IL2A 4DV5L 4POFA 4A75A 3K0XA 4X65L 3CW2C 2GVAA 1P8LA 3KLWA 3PCOB 4LF4Q 4X6AH 4QY7A 1Y1WH 4KHPQ 3VDYA 3GTJH 4GKKQ 1Z9FA 1HZCA 2EIFA 4LUOA 4A76A 4A3JH 1VQ8A 4NXNL 3ICEA 3CCMA 3H15A 1XMQL 2VUMH 1V1QA 3A5ZB 1VQGA 3JAMc 2PQAB 4B3SL 5LMNW 3PF4A 1QUQB 4IPCA 2K5VA 1N36L 2ES2A 3UDFA 1YNXA 4X62L 5C0XG 1T9HA 2JEAI 4KHPL 4QQBX 4X66L 2K5HA 3F1ZA 3M85A 5JJKA 1JE5A 4GOPC 4YHHQ 4DUZQ 1EWIA 3KYHC 1TWHH 2E2HH 1KIXA 1CUKA 1X3GA 1X56A 2D62A 4JBJA 4JBKA 3J7A5 2BA1A 2JA7G 3E0EA 2R92H 1EYGA 2N78A 3ULLA 2JA5G 4YWMA 4C3HH 4YWKA 1I94Q 1XNRQ 2ZM6Q 4QJFA 1A8VA 3G48A 1GVPA 4R4OA 4QL5A 4YY3Q 2IHEA 1VQMA 2UU9L 3GTOH 1IYJB 4DR6Q 4DR4Q 1U5KA 4BY7H 1KRSA 4A3CH 1DGSA 1UE6A 2XGTA 2JA9A 5M3FH 2E5LL 3RZDH 1XPRA 1H95A 3CD6A 1IBKQ 2VNUD 3HKSA 1ASZA 1QVFA 4P73A 1C0AA 4DV1L 3G6EA 1SE8A 2A19A 2L15A 4BY1G 1M1KC 2KCTA 2NZHA 3UDGA 2OTLA 1I50H 2UUBL 1PH5A 5IP7G 4BXXG 4LF6Q 3HOZH 3CCRA 1PHJA 4LF7L 1Q1BA 4DAYB 2YU9H 1N8RC 1CKNA 1XMOL 3K7UC 3OTOQ 2MNAA 1S72A 1X6OA 4ME3A 3BZKA 1XMQQ 1HZAA 5C3EH 1JJ2A 3HOYH 5M3MG 3D31A 1K73C 4JI3Q 2UXBQ 1KQSA 3K8AA 5M5XH 1ASYA 3HOUH 2BA0A 3OW2A 4BBRH 4GOPB 3NBHB 1Z47A 1Q8KA 1WCMH 3FHWA 4R4QA 5FLXc 1AH9A 1YZ6A 1Q46A 1WCMG 4DAMA 4QGUA 1V43A 3CCVA 1Q81C 2R92G 2IT1A 3W1BA 1IBLL 4DR5Q 3GTKH 4R1JA 2IHFA 3T1YL 1A63A 1JT8A 1YJNA 2QGQA 2Q2UA 4B3TL 2ZJPA 2VQEQ 2RHSB 4LF9L 3MXNB 4HIDA 2K4KA 2WB1G 4HJ8A 4GS3A 4YCVA 4P74A 3TS0A 1BKBA 5FLMG 4JCVE 1AE3A 5M3FG 4ALPA 3K81C 4DV2Q 3L7ZC 1TWGH 2K14A 3PV0A 3T1HL 1FL0A 4J15A 3PUVA 2E2IH 4B3SQ 2PMZE 3U4ZA 4DUYL 2PQAA 5C44G 3M3YH 4A3LH 1L2FA 4PZ8A 4A93G 1G291 4YWLA 2UUCQ 2PI2E 1JB7A 3RLFA 4C3JH 4LFCQ 2JA7H 3CCQA 2VZAA 1OXTA 5DLQE 5LMNQ 3RN2A 3I4MG 4B3ML 1PH3A 5JEAG 2UUAQ 4B3RQ 3CPWA 3TRZA 4JC0A 1Y1VG 4JV5Q 1L1OC 4OX9Q 1CKMA 2YYZA 1KL9A 2Z6KC 3CCJA 1IBML 3M9BA 4A3MG 5GROA 3J7ZC 5GADC 3UDXA 4HJ5A 2JJQA 3BU2A 4JI4L 2JA8H 1V9PA 4AYBE 1EIFA 1HNZL 4BY1H 4A93H 1WI5A 3UE0A 1K9MC 4DV0Q 3CF5A 4IO9A 2YTVA 1N34Q 2HHHL 5LMUQ 3I2ZA 4IJHA 1TXYA 3KJOA 2R7ZH 1PH8A 3I4MH 3BZCA 3NELA 4GKJQ 4NPSA 5IYDG 3S2HH 2B29A 4JI4Q 4OWTB 1A62A 4APVA 4LFBQ 3KDFB 1VQKA 4DV4L 2B63H 1CSQA 1I3QH 3KF8B 2OQKA 4UPAA 1MJCA 4JI6Q 1N36Q 4IOAA 3DLLA 1WYDA 3RZOH 4JI0Q 4A3GG 1Q82C 3S24A 4A3JG 4JI1Q 3CC4A 2IX0A 2HQLA 4X66Q 2DUDA 2XTIA 3AFQA 4IPDA 2UXDQ 3K7AH 4IPGA 1FGUA 2NVQH 2H5XA 1J6QA 2Q2TA 1C9OA 2VY3A 3A74A 2FXQA 5C0XI 3M4QA 1SR3A 2UXBL 1HZBA 5IYBH 4A3IH 1P16A 3AYHB 2CWAA 4P75A 1I5FA 2B3GA 2NN6I 5ELNA 3PO2G 4JI2Q 1PYSB
chains in the Genus database with same CATH superfamily
2K28A 1PH1A 3K6OA 3BYYB 4JVZA 4L5QA 4JI5L 3NEMA 3CPFA 5FLXE 3QO2A 1QUQA 3A8IE 4IFDI 2MQHA 3GV6A 2WINB 3LNNA 1SYDA 5D65A 4DK0A 1YHAA 1TVXA 2F3VA 4EX5A 2WAQE 3PUWA 3UI2A 2QF7A 2L0CA 1VMPA 3M7GA 3CMAA 2XRQD 1U4MA 4DR1Q 1CA6A 2B63G 1VQ6A 4IUPA 2B2TA 5JVG3 2ZTDA 1CTMA 2AHOB 2XRSD 3NXWA 3KJPA 2F52A 4LF7Q 1II3A 5GAEC 1JCKB 1VS0A 5IOCA 2K5NA 4UP9A 2AMCB 4DV5Q 3GTQH 4A3MB 1HXYD 1A0IA 2B39A 2ZTCA 1AH9A 4NB3A 4EQ5A 2JA5B 1OXSC 1H9KA 1TWFH 2KOLA 1KDBA 2IX3A 4XT3B 4L6TB 4HAEA 1MGSA 1SYFA 2XWBB 5CBEE 1UEBA 2ICIA 4DXGA 1XMOQ 1MJEA 4JI8L 5COYA 2AQ2B 2EVBA 1S5DD 3NSWA 3GV3A 1YVCA 4KTAA 2VS1A 4XYOA 5M5WH 3I3CA 1C7YA 4A3BB 3DXJC 1YBYA 1H9RA 3J7YW 5FLXL 1VQEA 3T1YQ 1IBKL 3AQQA 1QE6A 1PTOH 5D3IB 4ZKCB 2EJGC 3D4RA 1S5CD 3V2TA 2G9HD 4QUFA 1HFGA 2NVTH 1MKHA 2ZJQA 1L0XB 2OF1A 4XYQA 5I6WA 1X3FA 1EQVA 3I70A 1TWAH 3H3VI 1PH2A 5C6AA 1CQFA 3AEVA 3J80i 4IUUA 3TZDA 4X3TA 5J39A 5I2XA 3B6YA 5IGCA 4LF8Q 3KF8A 5IT9E 4DV7Q 3TQYA 4GLAC 4RMFA 4A93B 1JWSD 3W5OA 2KCNA 3KF6A 4LWCA 3SVMA 2AWNA 2CFMA 2FMMA 4A3EH 1PA6A 2VUMB 2N3SA 2EYJA 2P5ZX 2VQEL 1L1OA 5E7NA 4TSSA 1BCPC 1NMFA 4U673 2NTTA 4OWXB 1K3RA 1CKOA 4A3IG 3PIPA 3ULJA 3H0GH 3ZJYC 3ER0A 2Q2IA 3F2DA 1X3EA 3S16H 1UE1A 2SNMA 1GKHA 4GNXB 1CI3M 4GKKL 3DEOA 4C3IG 4ZKBB 3K5MA 4C1NK 4A3EG 1BBWA 2A6HC 2NYZD 4FP5D 1S4ZA 4G4KA 2K1BA 3GTGB 4TKOB 1BR9A 2NVXB 2FJ2A 1YITA 3A8KE 1JORA 3F2BA 1STEA 4XIGS 1B9MA 1SNPA 2D5DA 4A4IA 3HRZC 3HOWH 4MNOA 5IYCH 3C2PA 2F0MA 1RF2D 3FKIB 4X3UA 5JPNC 4JV5L 4K0KQ 4K8IA 3WOFA 1VCIA 4KN4C 1I4QA 4GNXC 1GXDC 3HG9A 2K7VA 4A3KG 2A73B 4R8IA 3EBEA 1WJJA 4CJ0B 3EROA 4HJAA 1S3OA 1E7ZA 3GTOB 2D0OA 4TVAB 5AJ3L 5F2DA 1U0LA 2F0NA 2CKZB 4OEMB 3TMEA 2WP8J 1YNND 2Z0SA 2JA6G 3VA7A 3CKIB 1WTPA 1I3QB 5IGBA 1CA5A 1S5FD 5LL6S 1EUJA 4A3KH 1G8ZD 1E3PA 2F0GA 3BYTB 3MVVA 3NUCA 3RN5A 3N52A 3J81i 1SNOA 2XIWA 4LUVA 1GJXA 2A6EC 2NZOA 1QILA 2B2TC 1TQOA 1T5EA 5IT9c 5JJIA 3KOJA 4JG2A 1SBBB 1WOCA 3QIAA 1LYLA 4EQPA 1KAAA 1TU2B 1YNJD 1JICA 4ZYSA 4A3LG 2N8NA 3CCEA 4ID6A 4N8FA 1JE4A 3PUXA 1BBXC 3ERSX 4L5TA 3S1NB 4GN5A 2A68D 4L5SA 4L5RC 1UUPA 3I56A 4ZCKA 2PZWA 2LSSA 1C8CA 1VQ4A 1H9SA 4DK3C 1WTQA 1GM5A 2D0PA 3I73A 1IXRA 4BWGB 5GAGC 5HGTA 1IBMQ 1NNXA 1N32Q 3SHLA 3U50C 3RZOB 4DV1Q 5FO8B 4PV1C 4AQYQ 2NZ1D 2CQOA 3E5SA 2ZXPA 5CV8A 1E2VA 3GTPB 2E8GA 1YHBA 5IYDH 5D3DA 4ODGA 2PNHA 3H6MA 4A3DH 3J7AF 2UU9Q 2AUKA 1TWCH 1XTDA 2ATWA 1UWVA 5ELFA 1NSNS 3STBD 3I4NH 1XNQL 2N49A 3NBIA 1ML0D 1FGBD 1XPOA 1HA5A 5I9OA 4POFA 2F0OA 4X65L 1P8LA 2F0FA 1Y1WH 4IZ8A 1Z9FA 1PTOF 4DF7A 4ILWA 1SJHD 3TSSA 3H15A 2HD3A 5IIFA 4WJWA 2L5TA 1TWHB 5IT9L 1PLFA 1ZYRC 2JEAI 1H9JA 4QQBX 4C2MB 2NTSA 4K5VA 1EWIA 3KLRA 1X3GA 1VMCA 3Q22A 3J7A5 5DEHA 3E0EA 4YWMA 5ISRA 1I94Q 3DHQA 3D3RA 4L8JA 1TS3A 1W6JA 1A8VA 3G48A 4H44C 1KRSA 2JA9A 5M3FH 1EIHA 1XPRA 3CD6A 1IKMA 2HQEA 4RGMA 3C1FA 1GOZA 4P73A 3FPPA 4DV1L 2HUGA 3V96A 2H4OA 2M2LA 2OTLA 2KCTA 5IP7G 3HOZH 4LF7L 1Q1BA 4K2LA 2YU9H 1N8RC 3K7UC 3OTOQ 2MNAA 1PDQA 4F87A 4ME3A 1RCVD 3HOYH 1K73C 1KQSA 2A69D 1ASYA 3HOUH 5TSSA 4BBRH 3OW2A 1DONA 3LX0A 1Z47A 3CRKC 4EQNA 1Q46A 1EZ6A 2EY5A 4DAMA 3W1BA 5JOBA 1JT8A 3OWFA 2E2HB 5CR3A 3MA2B 4PMBA 2K4KA 3TP7A 3FEWX 1LO5D 4YIJA 4OGQC 5C44B 1V1OA 3K81C 2PO4A 4XQQA 1TWGH 2K14A 1A3VA 2WKCA 3PUVA 2E2IH 3M3YH 4DUYL 3L3OC 3OPOA 4YWLA 3S9WA 2UUCQ 5A2QL 5A2QE 2CHBD 4LFCQ 3GTJB 2JA7H 2NUCA 2RQXA 5LMNQ 4CGYB 3RN2A 1KLUD 1Y1WB 5G3LD 4JC0A 1K0SA 1Y1VG 1L1OC 4OX9Q 1CKMA 1F2YA 3M9BA 5E4XA 4A3MG 5GROA 1SNCA 4HJ5A 4MIUA 2V4DA 4JI4L 3A55A 2F0QA 1R9TB 5EPKA 4S3SA 3CF5A 2YTVA 3ITPA 4X3KA 2HHHL 5E4WC 5LMUQ 3I2ZA 1TXYA 3KJOA 1PH8A 3A7LA 2B2YC 2J0TD 3BDCA 1L0YB 2ICEC 4CKEA 1CHQD 5I9PA 3KDFB 1VQKA 2L9HA 5EPLA 2B63H 3KF8B 3FMCA 2J4XA 2LKVA 1N36Q 1TS4A 4JI0Q 1B3QA 4G57A 2HQLA 1PFNA 4X66Q 5IGGA 2F0DA 2XTIA 2KUMA 1CZWA 4K5WA 4MN3A 2Q2TA 1QNKA 3A74A 3M4QA 1AFPA 1CHPD 2OXPA 1P16A 5IGFA 1ILQA 5ELNA 1I5FA 2B3GA 2NN6I 4IUVA 3PO2G 1B1ZA 5G3LF 1PYSB 1PV4A 1D1KA 1PFMA 3CQZH 5JEAJ 3UDIA 3A7AB 4KHZA 3K5OA 2JK8A 3I8ZA 4AQYL 4A3FH 3FRPB 4KLKA 2CVRA 1VQNA 2JEBI 4DR3L 3E6ZX 2ZXRA 1XX8A 4WRDA 4BA1I 1MSHA 4QIWB 2F3IA 3C3LA 2K6AA 1DD2A 2KEDA 3NHHA 3TDQA 5FKAC 4KY6A 4DV3L 5BR8L 4OO1G 3Q24A 2QEJC 5IE8A 1OO9B 5EBCA 1VQLA 2KA7A 4A3FG 4Y52H 2F0TA 3M7NA 3GTMH 4OX9L 1S5ED 4R4TA 3MAQA 3H94A 1VQPA 5DM73 3S17B 4GOPA 1MI2A 2EJMA 1HRJA 3M4OH 5CBAE 3VR2A 1BCPF 5FLMH 1UE5A 1M8AA 1VQDA 3RNUA 2HHHQ 3WDNA 3GTLH 1D8LA 2EYPA 3J80c 2BE5D 4I7AA 4C56C 4IOCA 1AZQA 4UY8C 3JC66 2UXCL 1D5MC 2IW3A 1EOVA 2WIIB 3HOZB 4A3FB 4JBWA 4MZ9A 5M3MH 4H0LC 2ZXOA 4OWWB 2QDBA 4JPBW 4IURA 3CQZB 2WFWA 4PMWA 2K32A 4BXXH 1E1TA 1HUNA 2A74C 4MTNA 4X64Q 1B8AA 5J1ZA 1XYIA 3CC2A 1LTTD 3EQLC 4EVOA 4KMUC 1Z6HA 4LF8L 2BH8A 3CAMA 4HSPA 3UE1A 2SOBA 2HIXA 3BZDB 3PSIA 1YHQA 4YHHL 2YV5A 2B63B 1GHKA 3GO5A 1XTCD 4ZUIA 2Y0SG 2R93G 4DN4M 3KBGA 3S1RB 1VQOA 3PUYA 2R7FA 5IP7H 2V1CC 1EYCA 2I46A 2YTXA 4WFN3 1ICWA 5KNCA 4BY1B 4NXNQ 1JMCA 4RFBA 1PRTF 1G6ZA 4IFDH 3I7FA 3QOJA 1R9TH 4A3CG 3SR1A 2PI2A 3NENA 4QB4A 1PXUA 4RGTA 4RG1A 1OXXK 1T5XD 2BDOA 4OO1I 2Q8RE 1PRTB 1U9RA 2XN9C 1JOKA 3STBC 2K75A 5A35A 2QW7A 3FP9A 1ESFA 2F4VL 1LTAD 2KENA 4DUYQ 5CORA 1SN8A 1HA6A 1DJRD 2DN8A 1EL0A 2DNCA 2HCIA 2L1BA 5EQ0A 1HHVA 4H02A 4DR5L 5C44H 2KVMA 1PVOA 1LT3D 1KDCA 3F8TA 3SK8A 3VYRA 4YCWA 3JAML 4V0BA 1VQAA 3I91A 2LY7A 3PIOA 2NN6G 1GHJA 3EJIA 4IUNA 4OL7A 3H0GG 1S40A 3NWSA 4HJ7A 2F0KA 2RSNA 4V190 3S15B 1IYVA 1HNWQ 4GNXA 1HPCA 2NVYB 1KLGD 3M4YA 1STYA 1RKNA 2K01A 5LHY1 1GUTA 4PG3A 3S2DH 1XNRL 3MXGA 1BUVT 4HCEA 4P71A 2EYMA 2WAQG 4DR4L 4DR7Q 1CK1A 4IFDG 4TRDA 5HY6A 1Y8NB 2UUAQ 5DNFA 1B3AA 4NKLA 1LABA 3KLSA 1DXMA 4C3IH 1STGA 2I07B 5JEAH 3PMFA 1B70B 4M1UB 5CYUA 2NBFA 4R4IA 4LF5Q 4KKUA 2SDFA 1LT5D 5ELCA 2FMCA 2RCNA 1PZKD 1Q7YC 3GTMB 1E24A 2I5MX 2DGYA 2CWPA 3T53B 4JI8Q 3U4VA 1AZPA 2RCFA 2F4VQ 1C48A 1BF4A 5BR8Q 1OXUA 2Z6KA 3QWNA 3MHBA 5C0XH 4OIJA 5IP9G 4B3TQ 1QVGA 3CCUA 3IAYA 5BN5A 1IW7D 1BNZA 1ENAA 1K8GA 2EXZA 3OTOL 2KCMA 2B2UA 2R61A 4GN3B 1G91A 4N9TA 3OIQA 2ZJRA 3ND9A 4O1NA 1B2TA 3GDEA 4FVMA 4DNTB 1FVIA 1HUMA 1OTCA 1NR2A 5CGKA 4KKSA 3S1MB 2B2WA 1SYEA 4JI1L 4DR1L 1TWCB 1HNXL 1NTGA 2I5HA 1SE4A 1QVCA 4WJ4A 1STAA 3E9IA 1K3BC 3HKZB 4CKCA 3SK6A 4UP8A 1BVSA 4DAPA 3KF6B 4G7HC 4NXML 1V1PB 2PYKA 2EXDA 2ZT9C 1IZ6A 2QKIC 1N34L 2LMCB 4B9XA 1N9WA 2IX1A 2KECA 4B9WA 1FJGL 2G9DA 3LGJA 3AMUA 5LMNL 2MO1A 2MGSA 4RWSC 4R9WA 4YY3L 1SXTA 3S2HB 1Y1VB 1U4PA 3J7AV 3URYA 1VQCA 3S16B 4O42A 4JI6L 1GUSA 3NTKA 3MEHA 2GA4B 3WWVA 3S1NH 3BS1A 1IL2A 3OIPA 1F9PA 1DOKA 1STNA 5EKLA 4LMQD 2Q8IB 2F0HA 1S5BD 3CW2C 2GVAA 3PCOB 3TP8A 4QY7A 3GTJH 5C3WA 4GKKQ 3RMHA 4NXNL 4KKTA 3NQTA 2VUMH 1V1QA 3A5ZB 5LMNW 2E2IB 2SNSA 2K5VA 5D14A 1N36L 3Q6SA 1Q3LA 1YNXA 3T56B 2JYOA 4X62L 4X66L 1BCPB 2K5HA 5JJKA 3KYHC 3PIO3 2E2HH 1A6XA 4JBJA 2BA1A 5CV4A 2JA7G 2R92H 2F0VA 2N78A 3ULLA 1EY7A 4FXDA 1EY8A 2ZM6Q 1JOQA 1GVPA 4R4OA 2IJ0A 4MTKA 3HOUB 4DR6Q 1B44D 5EKKA 3R8BA 4A3CH 1FR3A 2XGTA 1H95A 1IBKQ 1LTGD 4ZRZA 3RD4A 1C0AA 3G6EA 2M9VA 2RBMA 2RDGA 1SMYD 2NZHA 3J80E 3UDGA 1M1KC 1TT2A 1PH5A 3K58A 3JAME 4LF6Q 1PMRA 4QCLA 1DZ1A 4ZQ3A 1R4PB 1CKNA 1S72A 2VB2X 1X6OA 2OT2A 1XMQQ 1JJ2A 2KQ3A 4RAUC 2A68C 2E74C 1MBYA 1LTBD 2BA0A 1YNNC 4GOPB 4IN3A 1WCMH 3R2IA 4BY7B 5FLXc 1YZ6A 2QDLA 1V43A 4RA8A 1IBLL 4R1JA 2RSOA 2OEOA 1TWFB 2BDNA 3HEJA 2QGQA 3MWYW 2Q8TA 3OOCA 1F77A 4DAYA 4GS3A 3QOLA 2NN6H 4J6HA 1PFBA 5M3FG 4ALPA 3GTQB 3GP7A 4DV2Q 3T1HL 1FL0A 5LL6X 1LTRD 2PMZE 2PQAA 4A93G 4P2CB 3NE5B 4RCNA 3TP6A 1CM9A 3H0GB 3X3NA 1RTNA 2F0LA 5E1FA 5DLQE 3SXHA 4B3RQ 3CPWA 1ICFB 4JV5Q 4IQZA 3CCJA 1EY5A 1IBML 3J7ZC 1QJOA 3UDXA 2CH4W 3VYTA 1AEXA 1V9PA 4BY1H 3H3VC 1WI5A 3UE0A 2WB1B 2EYLA 1F9QA 1LLRD 4IJHA 2KHSA 2XNAC 2KEEA 3BZCA 1K28A 3OWEB 4NPSA 2B29A 3U9SA 1IL8A 4OWTB 1A62A 3NTHA 4LFBQ 2OQKA 2X6GA 4UPAA 4C3IB 4IOAA 2CW0C 3RZOH 5CV9A 2DUDA 2UXDQ 3EA6A 5JAVA 1GUNA 2Z4IA 4G7ZC 3VR3A 1J6QA 3DEPA 2VY3A 2FXQA 1PH6A 3AYHB 4P75A 1H9SB 3I4MB 1C4QA 4R4CA 1RD9D 5GAHC 3MFYA 3O13A 3S2DB 2Z8LA 4IFDJ 4NXMQ 3NK9A 3TZUA 5AFWA 3H3VH 1BO0A 4JI2L 1FD7D 4J8QA 3NPPA 2NVYH 2JXMB 1WTWA 3GTLB 3S15H 1IYUA 3C46A 4K8JA 5ELBA 3FVQA 4BBRG 4DGZA 1EFWA 4KD3A 2UUBQ 1O7ZA 4XTCS 4H13C 4JOIC 2DNEA 1KNAA 3S17H 3DMUA 3Q8DA 4HMIA 2KBNA 3DM3A 2CQAA 4DR2L 1Q1EA 3G6JB 1YI2A 5C4XG 4E6IA 2MUYA 5CMDA 4Q0FA 2KHIA 4YCUA 4UP7A 3C1EA 1L0WA 2F0PA 2EQSA 2DY8A 2TMPA 2PCFB 2OTJA 1H9MA 2Z4HA 2YTYA 5KNDA 2Z9HA 1CKNB 1X55A 3TEHB 2UUAL 4F88A 1NCVA 1CT1D 4X3SA 5T1GA 1Y8PB 1Y1VH 3PQIA 1J5EQ 2ZM6L 2E5LQ 2CH4A 1WVLA 3HOWB 3S1RH 1X3QA 1Z7TA 2GN5A 4KHVA 4A3DB 5ELEA 4BBSH 4A3IB 1E0BA 4DKAC 3H91A 2A69C 3ERQA 1NBWA 3FPUB 1B53A 3PO2H 5KEEA 3TS2A 3DWQA 1WTRA 1E2ZA 4K2KA 2QILA 1SYGA 4LF6L 4UHVA 1SYBA 2Y0SE 5EBDA 4CDCC 1JB3A 2WKDA 1D7QA 3S1MH 2PW5A 1NJIC 4DV4Q 4FF3A 3GD7A 1XJVA 5M3MB 1EQTA 2K52A 3HOYG 1G2TA 3PF5A 1IBLQ 3Q0AA 3NP8A 4POGA 1EU3A 4C3HG 3OHXC 4FF4A 2XVSA 4DUZL 3I4OA 2VL6A 4HCSA 2MO0A 4PZ7A 1M90C 5KYLA 3KFUA 4ZLTF 1HFNA 2R7ZG 4JI3L 3M4OB 3M3YB 3E3XA 1HH2P 1TWGB 2L4NA 5FO9B 3CMEA 4LFAL 5FOBB 3X3MA 1EU4A 3FKIG 3IL8A 3MEFA 1I4HA 3VYSA 5EGTA 3HS0C 1L1OB 2RF4A 2F3WA 5J3BA 5IYBG 4A3KB 4LF9Q 1YIJA 1R4QB 2JP1A 2VUMG 1TY2A 4PZ6A 1QZHA 1FNWA 1U4LA 1EY4A 5H1SE 3HKZE 4GLVB 4BY7G 1RIPA 1PFSA 1AN8A 4GKJL 2NVTB 4JBMA 2K05A 3HOYB 4DV7L 4HIOA 1B4OA 4I7ZC 4KY7A 2YU9B 2EE1A 2EY6A 1EWHA 1AW7A 3G4SA 2E75C 4LFBL 2QEXA 3RR5A 3BVZA 4HN7A 1N33Q 4A3BH 1MD2D 4LFCL 3KBXA 4N8X1 1WTHA 1SSOA 3S1QH 2EOTA 3L0OA 3CHBD 3J80L 3CXCA 3LWUA 5HGQA 3PO3G 2EPBA 1VF5C 3AB9A 4DXFA 1QCBD 5M3FB 4RKBA 3E0JA 3ZYYX 1SLJA 2WAQB 1GD7A 4AIMA 2VW9A 4LF5L 3DM1A 1BBUA 2F0EA 4UAIA 2QA4A 4JI5Q 3I4NG 4GZYC 4K6LA 4KY5A 4AH6A 4C1NI 1X54A 1BCPD 3K80C 5LMUL 3J81c 5IY0A 5L37A 1EEID 1B7YB 2OQ0A 1EIYB 5IWAQ 1NUCA 1N32L 3J81j 3BJUA 4B3MQ 3HOVB 3CU7A 3AU7A 4RCOA 2G5DA 3QJYA 1K0RA 4LUZA 5C4XB 4IALA 2O5IC 1ILPA 2LXJA 2FFKB 3T51B 3A0JA 3HOXG 2O4XA 3D8GA 4HJ9A 4ULLA 2K5QA 1KC8C 4UDUC 1W6KA 3KLSX 3T4AC 1B9NA 1UAPA 4A3JB 3D6CA 4OO1H 2Z6BA 4BA2I 1LM0A 1D6EC 4IUQA 4FXGC 1UE7A 4FDBA 3LWEA 1HNXQ 4G7OC 4QIWE 2MPMA 1OXVA 1E1OA 4OXPA 4KK7A 3T16A 1V1PA 1LT6D 4LAAA 4QUCA 5HURA 3R93A 1CSPA 3CCLA 2E2JB 2F0UA 1HQRD 3HKZG 1AE2A 1QZGA 1GO3E 5I6YA 2BOSA 2MFIA 1O7IA 5EAYA 1JWUD 1N33L 1HTPA 1PH9A 2F0WA 1YNJC 5T1IA 4IJLA 1HNZQ 1K8OA 2DJFC 1PTOD 4BBRB 1XPUA 5IGEA 1J5EL 3G7LA 3S14H 3W1GA 4H7BA 4JI7Q 3ND8A 2HT1A 3CC7A 2A6ED 1I94L 3E9HA 1STBA 2EY2A 1NY4A 1PTOB 1QNUA 2B2WC 1PYBA 3P1HA 5FJ8H 1SNDA 4KI0A 4QMGA 4ZK9B 5C3XA 5KNBA 2K04A 5KYIA 1LTLA 4DV6L 3IFTA 5M5WB 5C4HA 3A56A 2UXCQ 3NQIA 3G71A 2JA8B 2QCPX 2LFNA 4A75A 2F1MA 3EFXD 3K0XA 4DFAA 4LF4Q 3KLWA 4X6AH 2EDGA 4ZUJA 1QWYA 3VDYA 4HR7B 2EIFA 3TN2A 4A76A 4LUOA 1VQ8A 4I65A 3K59A 1DYQA 1VQGA 3JAMc 3PF4A 1QUQB 1J8IA 5EJWA 2ES2A 3UDFA 3P75A 3OMGA 4KHPL 1T9HA 3M85A 4HEDA 4DUZQ 2DJGC 1TWHH 1CUKA 2K5WA 1X56A 2D62A 3BDOA 3OMCA 4DA2A 4N9PA 1EYGA 4C3HH 4YWKA 1XNRQ 1SEBD 1WD1A 2MP1A 1VQMA 2UU9L 4QL5A 3Q23A 4KJNA 1IYJB 3GTOH 2K5DA 4DR4Q 1U5KA 2VB3X 3V05A 4HSVA 4JK1C 2VNUD 1ASZA 2XWJB 1WD0A 1SMYC 2ENBA 2L15A 1I50H 2UUBL 1JC7A 3DWPA 1GUOA 1BOSA 4BXXG 3CCRA 1HQMC 3P7JA 1F2MA 1XMOL 3BZKA 1JQYD 1HZAA 4CDDC 5C3EH 1FNVA 5M3MG 3D31A 4KD4A 2PZUA 1ZXTA 2AQ3B 3NBHB 1Q8KA 2X69A 3FHWA 1HCZA 3EVQA 3MXUA 5NUCA 3H09A 3CCVA 2R92G 2IT1A 4DR5Q 2IHFA 3T1YL 4OHJA 1A63A 1TIID 4B3TL 3HP3A 2K33A 2RHSB 4HIDA 4K6DA 4HJ8A 1STHA 2F0SA 4P74A 1BKBA 5FLMG 4JCVE 2R7ZB 1AE3A 1WTOA 1E2WA 4OELB 1G2SA 2LS01 1SFOB 1EZ8A 1EWCA 4J15A 4A3LH 1L2FA 1G291 2MJ8A 3I4LA 2PI2E 4C3JH 3CCQA 1EIGA 1OXTA 1TY0A 4B3ML 1PH3A 1EY6A 5JEAG 2JA7B 1AP0A 4RKLA 1IHZA 2YYZA 1I6VC 3OSOA 2Z6KC 5GADC 1EY0A 2JJQA 2JA8H 4AYBE 4BS9A 1EIFA 1DM0B 2L12A 4A93H 1K9MC 4KV6A 4AYBB 5IGDA 4CJ2C 1N34Q 5M9OA 2JN4A 3NELA 1KNEA 3PO3B 3MXPA 1NAPA 2O2LD 1M4VA 2PQEA 2F0JA 4K14A 4JW0A 4DV4L 1I3QH 2NVQB 3GTKB 1MJCA 4JI6Q 5KGUA 3DLLA 1WYDA 2Z1CA 2RA4A 3A8JE 4A3GG 3S24A 3T13A 5IODA 3AFQA 3K7AH 5M5XB 4IPGA 1FGUA 2NVQH 1Q8IA 1C9OA 1LACA 1VDZA 5C0XI 1SR3A 1KXLA 1HZBA 5IYBH 2CWAA 4JI2Q 3K5LA 1SNMA 4CHTB 1RL2A 1VQ9A 1YJWA 4DNRB 2CCZA 3FKIH 3NWTA 4DNIA 2KHJA 2MHVA 4HIKA 3IFDA 4CDEC 3HOXB 1PZJD 5C4ZA 3D0FA 4P72A 4F7XA 1F2LA 2AUJD 4LFAQ 1SDFA 3RZDB 2NVXH 3GTGH 2M00A 2BE5C 3WOEA 1TR5A 1Q12A 3HOZG 4A3GB 2JQOA 2R7DA 1EY9A 4DV6Q 4DR2Q 5JVH3 2RVLA 2JA5H 1K83B 1BQQT 1ET9A 3RLOA 1ZEQX 4NDXA 4X65Q 3BDLA 4C2MH 5JJZA 1SFOH 1VQ7A 3GQBA 1DCZA 1PRTC 5M5YH 1Q86C 1VQ5A 4Q5VA 4JYAL 2WB1E 4CDFC 5C4XH 1EQQA 5ELDA 2F4IA 1SNQA 5J22A 1G51A 3I55A 4J1MA 2Q2HA 1EOTA 3IKJA 1EQRA 4DK6C 1NE3A 3TBIB 2RHQB 3R3OA 2E2DC 1W3SA 2R93B 3SDZA 1Q90A 2B8GA 2OCEA 5IYCG 4A3GH 1LUZA 2SEBD 3VR6A 1DOLA 1RTOA 2EYHA 3D6WA 1IW7C 1NR4A 2OWOA 1CQVA 1D2BA 1X32A 3I4NB 3JAMi 3HOXH 3MC0B 4K5XA 1I50B 1O7YA 2ALYB 4CBVA 5EKIA 2JA6B 5FO7B 4GN4B 1O78A 2IY5B 4PMCA 3PIP3 3EIVA 4DV3Q 3GTPH 2FHTA 1JJCB 3HOWG 3K0YA 3NTIA 1SE2A 2FINB 5ELOA 5KRUA 2PZTA 4TQUS 1LV9A 2EY1A 1FJGQ 1O7LA 1HTLD 3OYYA 5CC4A 3FDTA 1X65A 2B8FA 3VA5A 1ESRA 2LXKA 1WFQA 4DV0L 5K5PA 1YJ9A 4EGVA 4X62Q 3HOUG 5K36G 3QB3A 4O0AA 1V8QA 4L63B 3R2TA 1UEAB 4DPGA 2R6GA 3A54A 2RDHA 2BCOA 4XQNA 2A1AA 1I6HB 2HDLA 5CV6A 1KHIA 1PH7A 4HMJA 1Y69U 4OONA 3ONAB 1PZID 1MHWC 3D4WA 4ME5A 1KRTA 4OIKA 4JYAQ 2RKSA 2AKWB 3TREA 1PH4A 1NMGA 5I4DA 4ABNA 3VR4A 5C3EG 1XNQQ 5IP9H 5C4JH 1LTSD 4AYBG 3KDFA 4RGNA 5I2YA 3SEBA 2EZVA 1F9SA 4X64L 1XWEA 3AFPA 1I6HH 4Y7NH 4JI7L 4A3MH 4DR6L 1CZGA 1EEFD 2NB0A 2NWGA 1YEZA 3RLNA 1HR0W 3MTSA 2BH2A 3J81E 5CV7A 1TKWB 1SRUA 3PGZA 3I72A 2RDFA 1I4GA 3L9AX 3RUZA 1K8AC 3VYUA 5C0XJ 1VQBA 1SJED 1J9OA 1ENCA 1A15A 2JA8G 4DV2L 4CKBA 4RHSA 4Z9CB 4LJZC 3T1HQ 5C3EB 1SROA 3NBHA 2E2JH 2IL8A 2K50A 1SYCA 4LF4L 4BBSG 1I4XA 2WACA 2J7ZA 3L2PA 1VQHA 2JA6H 3ULPA 3QR8A 4EQOA 1W2BA 1A3UA 1SAPA 2A5HA 4B3RL 3IRBA 1B50A 4WJ3M 3HFZB 4M8AA 3SK4A 1ZKOA 1JJGA 2VQFQ 2ID0A 4K0KL 5IWAL 1HJPA 5C5LA 3PUZA 1HR0Q 2R93H 2IWHA 2F03A 2B2VA 1KDAA 4A3BG 3EN2A 2A6HD 2ZTEA 1G6PA 4QF4A 1LTID 4DAVA 2HIVA 4DR3Q 4C3HB 3U9OA 3I90A 2B2YA 5AJ3Q 4FO2A 3CCSA 1KD1C 1GUGA 1RJTA 1F2ZA 4RH6A 3F2CA 2EJFC 3HOVH 1JOOA 4LNQA 4FYDA 4PQXA 1VQIA 2GVBA 4WORA 2C35B 4HTHA 4JOIA 2L11A 1K83H 1LT4D 2UXDL 1HNWL 2A8VA 5BN3A 4FXKC 1X3PA 5GQOA 2PNRC 4NMZA 4O2DA 1D1IA 2I5LX 3VR5A 3A5UA 2KCCA 5C5MA 1EFID 4IPHA 3W2DA 4A3EB 4FNFA 4DR7L 2ASBA 1ZYRD 4DK1A 5CV5A 2UUCL 3MZ5A 4DU9A 3CP0A 2PMZB 1UNSA 1E22A 1X9NA 3MFGA 1VQFA 2L55A 1RHPA 3J81L 1O80A 1Y14B 3U58A 3D4DA 1VQJA 1TWAB 5JJLA 1BDOA 2AWOA 1HZ9A 4FF1A 1QB5D 4GLXA 4HIMA 1KAWA 3BG3A 1JWMD 1MIUA 4LW1A 3SGIA 2I0QA 1SE3A 1TS2A 2VQFL 1I4RA 2JE6I 1PYWD 3PO3H 5FJ8G 1SMXA 1HR0L 1VF7A 4RHRA 4XQJA 1Y1WG 4IUTA 4A3DG 2D2CC 3DWAA 3HGBA 3M4PA 3HOVG 2IPKD 4DV5L 1D5ZC 1PTOC 5E3FA 1DOMA 4R8NA 4KHPQ 3N6RA 1HZCA 3ICEA 1RODA 4A3JH 1A3TA 4RGOS 3CCMA 1XMQL 4KN7C 2PQAB 2X6LA 4B3SL 4IPCA 4PNYA 2JSOA 5C0XG 3F1ZA 1FNUA 1JE5A 2N55A 4GOPC 2K03A 4YHHQ 5M5YB 1I4PA 2F0IA 1KIXA 1A2TA 4JBKA 3W3AA 5K36H 3K5NA 5FK9C 3HZXA 2JA5G 2B2VC 4U68A 4QJFA 2C9OA 4YY3Q 3BVGA 2IHEA 1WCMB 4BY7H 1DGSA 1A2UA 1UE6A 3SE0A 2E5LL 3RZDH 3KK7A 5DAUA 4BBSB 3HKSA 1ET6A 1QVFA 4FF2A 4F8MA 2R3ZA 1SE8A 4B08A 1K8MA 2A19A 1MSGA 4BY1G 3S1QB 2HCCA 2XSCA 2WV6D 1U4RA 5JPMC 2VXWA 3KUPA 4XXEA 1PHJA 4DAYB 1RDPD 3CRLC 2E76C 4XT1B 2B2UC 1TS5A 1WTVA 4JI3Q 2UXBQ 3K8AA 3K7AB 5M5XH 4R4QA 2EYOA 1WCMG 4QGUA 1Q81C 3GTKH 2AQ1B 1FYCA 2O5JC 2PW7A 2KJXA 1YJNA 3P20A 3TP5A 2Q2UA 2ZJPA 2VQEQ 2R92B 4LF9L 3MXNB 2WB1G 4Y7NB 1BXTA 4YCVA 3TS0A 4NW2A 1XXGA 1CFMA 3L7ZC 3PV0A 1ENFA 1JR0D 2DY7A 4B3SQ 3U4ZA 5C4JB 5C44G 5KIXA 4PZ8A 1KABA 4KJOA 2C5CA 1JB7A 3RLFA 1WTXA 2EYFA 1IKLA 2D9UA 2VZAA 1Y8OB 3I4MG 4NP5A 3MXNA 3TRZA 2CW0D 4MHEA 1KL9A 2PPBC 4LK1C 4C3JB 4XDXA 3F2UA 3BU2A 3SK5A 1PRTD 1HNZL 4DV0Q 4IO9A 1D5XC 1EYAA 1GUWA 2R7ZH 3I4MH 4GKJQ 1EYDA 5IYDG 3S2HH 4JI4Q 1KTKA 2Y0SB 3OW7A 5EPJA 3DUZA 4APVA 3K57A 1CSQA 2H1EA 3S14B 4CJ1B 1QOHA 5BN4A 3QG1A 1Q82C 4ZAIA 4A3JG 4JI1Q 3CC4A 2IX0A 1QG7A 1F9RA 4IPDA 2TSSA 3PO2B 2H5XA 1ONLA 3BVMA 4C3JG 2UXBL 5DM63 4A3IH 2HDMA 2N88A 4JI0L
chains in the Genus database with same CATH topology
1PV4A 1PH1A 4R4CA 3CQZH 1RL2A 5GAHC 1VQ9A 5JEAJ 3UDIA 1YJWA 2CCZA 4L5QA 3FKIH 3NEMA 4JI5L 3CPFA 4IFDJ 4DNIA 4KHZA 4NXMQ 1QUQA 2JK8A 2KHJA 4HIKA 4AQYL 4IFDI 4A3FH 2MQHA 3H3VH 3D0FA 4KLKA 4P72A 1VQNA 4JI2L 2JEBI 4LFAQ 4DR3L 1YHAA 2NVYH 4EX5A 2WAQE 3PUWA 4BA1I 2NVXH 3GTGH 3S15H 2F3IA 3CMAA 1Q12A 2B63G 3HOZG 4DR1Q 1VQ6A 2JQOA 4DV3L 2R7DA 2ZTDA 4BBRG 5BR8L 4OO1G 1EFWA 2UUBQ 2AHOB 4DV6Q 4DR2Q 3KJPA 2F52A 4XTCS 2JA5H 4JOIC 4LF7Q 5IE8A 5GAEC 3RLOA 1VQLA 3S17H 4A3FG 4X65Q 1VS0A 4Y52H 4C2MH 3Q8DA 2K5NA 4UP9A 1SFOH 1VQ7A 3M7NA 2KBNA 2AMCB 4DV5Q 3DM3A 5M5YH 3GTQH 3GTMH 1Q86C 1VQ5A 4OX9L 1A0IA 2ZTCA 4R4TA 4JYAL 2WB1E 1Q1EA 5C4XH 4DR2L 1VQPA 1EQQA 4K0KL 4GOPA 1YI2A 4NB3A 4EQ5A 5C4XG 1OXSC 1TWFH 1G51A 3I55A 4YCUA 2KHIA 3M4OH 4UP7A 1L0WA 2Q2HA 5FLMH 1EQRA 1UE5A 1NE3A 4DK6C 2EQSA 1VQDA 2RHQB 3RNUA 2HHHQ 1W3SA 2OTJA 3GTLH 2OCEA 5IYCG 1D8LA 1UEBA 3J80c 4A3GH 1LUZA 4IOCA 1XMOQ 2YTYA 4UY8C 3JC66 2UXCL 1MJEA 4JI8L 1CKNB 1X55A 3TEHB 2OWOA 1EOVA 2UUAL 1YVCA 3JAMi 2VS1A 3HOXH 4JBWA 4MZ9A 5M5WH 1Y1VH 2ALYB 5M3MH 1C7YA 1YBYA 1J5EQ 4GN4B 2ZM6L 4OWWB 2E5LQ 1VQEA 2IY5B 3T1YQ 1IBKL 3AQQA 3S1RH 3EIVA 2WFWA 4DV3Q 3GTPH 2GN5A 1JJCB 4PMWA 4BXXH 3HOWG 4BBSH 1E1TA 5ELOA 4DKAC 4MTNA 4TQUS 4X64Q 1B8AA 3CC2A 1FJGQ 1NBWA 3OYYA 2NVTH 1MKHA 3PO2H 1X65A 2ZJQA 2LXKA 1WFQA 4DV0L 1X3FA 1YJ9A 3TS2A 1TWAH 4LF8L 2BH8A 4X62Q 3H3VI 3HOUG 5K36G 3CAMA 4O0AA 1PH2A 3UE1A 2HIXA 3PSIA 1YHQA 4YHHL 4LF6L 2YV5A 2Y0SE 4DPGA 2R6GA 3J80i 3GO5A 3AEVA 2Y0SG 2R93G 1D7QA 3S1MH 1VQOA 1NJIC 3PUYA 3B6YA 2A1AA 2R7FA 5IP7H 2V1CC 4DV4Q 4HJAA 4LF8Q 2YTXA 3GD7A 4DV7Q 3TQYA 4GLAC 4RMFA 1XJVA 4NXNQ 1JMCA 3W5OA 3I7FA 2K52A 3KF6A 1KHIA 4LWCA 1R9TH 1PH7A 3HOYG 2AWNA 3PF5A 4A3CG 2CFMA 2PI2A 4A3EH 3NENA 4OONA 1PA6A 1IBLQ 2N3SA 1PH6A 1KRTA 4RG1A 2VQEL 1L1OA 1OXXK 4JYAQ 5E7NA 4POGA 1NMFA 4DUZL 2AKWB 3I4OA 2VL6A 3TREA 4OWXB 1PH4A 1K3RA 1NMGA 2MO0A 4OO1I 4PZ7A 1M90C 3KFUA 1CKOA 3STBC 2K75A 4A3IG 2R7ZG 3PIPA 3FP9A 5C3EG 5IP9H 1XNQQ 3ULJA 5C4JH 4JI3L 3H0GH 2KENA 4DUYQ 4AYBG 2F4VL 3KDFA 3ZJYC 1SN8A 1HH2P 3ER0A 3CMEA 2Q2IA 3F2DA 4LFAL 3FKIG 1X3EA 3MEFA 4X64L 3S16H 3AFPA 1I6HH 4Y7NH 4H02A 1UE1A 5C44H 4DR5L 4A3MH 4JI7L 1PVOA 1L1OB 1GKHA 4DR6L 3F8TA 4GNXB 2RF4A 5J3BA 4YCWA 5IYBG 4LF9Q 4GKKL 1YEZA 1YIJA 3RLNA 1VQAA 1HR0W 3PIOA 2VUMG 2NN6G 2BH2A 4PZ6A 1QZHA 3H0GG 4A3EG 5H1SE 1S40A 1BBWA 3HKZE 4GLVB 1SRUA 3PGZA 4BY7G 1RIPA 4HJ7A 1PFSA 1K8AC 5C0XJ 4GKJL 4JBMA 1VQBA 4DV7L 1HNWQ 4GNXA 1YITA 2JA8G 4DV2L 3F2BA 4HIOA 4XIGS 3T1HQ 1SROA 2E2JH 4A4IA 2K50A 3G4SA 4LF4L 3HOWH 4BBSG 4MNOA 5IYCH 4LFBL 2QEXA 3RR5A 3L2PA 1VQHA 1N33Q 4JV5L 2JA6H 4A3BH 4K0KQ 4PG3A 4LFCL 3ULPA 3S2DH 1W2BA 1XNRL 1KXLA 3S1QH 3L0OA 1VCIA 4P71A 4GNXC 3CXCA 4B3RL 2WAQG 3IRBA 4DR4L 5HGQA 3PO3G 4DR7Q 4IFDG 4A3KG 4WJ3M 3EBEA 3HFZB 1WJJA 5HY6A 1JJGA 1SLJA 1GD7A 4AIMA 1S3OA 2VQFQ 1E7ZA 2ID0A 2D0OA 4TVAB 5IWAL 1HJPA 5AJ3L 2VW9A 4LF5L 1U0LA 1BBUA 3PUZA 4JI5Q 2CKZB 2QA4A 1HR0Q 3I4NG 2R93H 2WP8J 4AH6A 2Z0SA 1X54A 2JA6G 4A3BG 4C3IH 3EN2A 2ZTEA 1G6PA 3K80C 5LMUL 3J81c 5IY0A 2HIVA 1B70B 4DR3Q 4R4IA 1B7YB 2OQ0A 1EIYB 5IWAQ 5AJ3Q 1EUJA 4LF5Q 3CCSA 1KD1C 4A3KH 3J81j 1N32L 3BJUA 2RCNA 4B3MQ 1Q7YC 1E3PA 1E24A 2I5MX 3RN5A 1K0RA 2DGYA 4LUZA 2CWPA 3F2CA 4JI8Q 3HOVH 4LNQA 3U4VA 3J81i 1VQIA 2GVBA 4JI0L 2LXJA 2C35B 2F4VQ 4JOIA 4LUVA 1K83H 2NZOA 5BR8Q 2UXDL 1OXUA 2Z6KA 3A0JA 2A8VA 3HOXG 1HNWL 4HJ9A 1KC8C 5IT9c 5IP9G 5JJIA 4B3TQ 3KOJA 1QVGA 4JG2A 5GQOA 3CCUA 4O2DA 1WOCA 2I5LX 1LYLA 3A5UA 4A3LG 2N8NA 1LM0A 3CCEA 4BA2I 3PUXA 4IPHA 1K8GA 3OTOL 2KCMA 3ERSX 4GN3B 4L5TA 1UE7A 4FDBA 2ZJRA 1HNXQ 4GN5A 2ASBA 4DR7L 4QIWE 1OXVA 3GDEA 4L5SA 1E1OA 2UUCL 4L5RC 1FVIA 4OXPA 3I56A 3CP0A 1OTCA 2LSSA 1E22A 1VQ4A 4JI1L 1X9NA 1CSPA 4DK3C 1VQFA 4DR1L 3CCLA 1HNXL 1GM5A 2D0PA 1NTGA 2I5HA 3HKZG 1AE2A 1QVCA 1QZGA 4WJ4A 1GO3E 1Y14B 2MFIA 1IXRA 3U58A 1O7IA 1VQJA 5EAYA 3E9IA 5GAGC 1IBMQ 1N33L 5JJLA 1PH9A 2AWOA 1HZ9A 4UP8A 1BVSA 4IJLA 1HNZQ 1N32Q 3U50C 3KF6B 4DV1Q 4GLXA 4NXML 4HIMA 1XPUA 1KAWA 2EXDA 1MIUA 1IZ6A 4AQYQ 1J5EL 3S14H 3W1GA 4LW1A 1N34L 3SGIA 2CQOA 4JI7Q 2I0QA 1N9WA 2HT1A 2E8GA 3CC7A 2IX1A 2VQFL 1YHBA 2JE6I 5IYDH 1I94L 1FJGL 2PNHA 3E9HA 3PO3H 5FJ8G 3LGJA 1SMXA 1NY4A 1HR0L 5LMNL 2MO1A 4A3DH 4YY3L 2UU9Q 1PYBA 1TWCH 5FJ8H 1XTDA 4KI0A 1Y1WG 4A3DG 2ATWA 1VQCA 1UWVA 4JI6L 3STBD 1LTLA 4DV6L 1XNQL 3I4NH 2N49A 3M4PA 3HOVG 2UXCQ 3G71A 1XPOA 3S1NH 3WWVA 1IL2A 4DV5L 4POFA 4A75A 3K0XA 4X65L 3CW2C 2GVAA 1P8LA 3KLWA 3PCOB 4LF4Q 4X6AH 4QY7A 1Y1WH 4KHPQ 3VDYA 3GTJH 4GKKQ 1Z9FA 1HZCA 2EIFA 4LUOA 4A76A 4A3JH 1VQ8A 4NXNL 3ICEA 3CCMA 3H15A 1XMQL 2VUMH 1V1QA 3A5ZB 1VQGA 3JAMc 2PQAB 4B3SL 5LMNW 3PF4A 1QUQB 4IPCA 2K5VA 1N36L 2ES2A 3UDFA 1YNXA 4X62L 5C0XG 1T9HA 2JEAI 4KHPL 4QQBX 4X66L 2K5HA 3F1ZA 3M85A 5JJKA 1JE5A 4GOPC 4YHHQ 4DUZQ 1EWIA 3KYHC 1TWHH 2E2HH 1KIXA 1CUKA 1X3GA 1X56A 2D62A 4JBJA 4JBKA 3J7A5 2BA1A 2JA7G 3E0EA 2R92H 1EYGA 2N78A 3ULLA 2JA5G 4YWMA 4C3HH 4YWKA 1I94Q 1XNRQ 2ZM6Q 4QJFA 1A8VA 3G48A 1GVPA 4R4OA 4QL5A 4YY3Q 2IHEA 1VQMA 2UU9L 3GTOH 1IYJB 4DR6Q 4DR4Q 1U5KA 4BY7H 1KRSA 4A3CH 1DGSA 1UE6A 2XGTA 2JA9A 5M3FH 2E5LL 3RZDH 1XPRA 1H95A 3CD6A 1IBKQ 2VNUD 3HKSA 1ASZA 1QVFA 4P73A 1C0AA 4DV1L 3G6EA 1SE8A 2A19A 2L15A 4BY1G 1M1KC 2KCTA 2NZHA 3UDGA 2OTLA 1I50H 2UUBL 1PH5A 5IP7G 4BXXG 4LF6Q 3HOZH 3CCRA 1PHJA 4LF7L 1Q1BA 4DAYB 2YU9H 1N8RC 1CKNA 1XMOL 3K7UC 3OTOQ 2MNAA 1S72A 1X6OA 4ME3A 3BZKA 1XMQQ 1HZAA 5C3EH 1JJ2A 3HOYH 5M3MG 3D31A 1K73C 4JI3Q 2UXBQ 1KQSA 3K8AA 5M5XH 1ASYA 3HOUH 2BA0A 3OW2A 4BBRH 4GOPB 3NBHB 1Z47A 1Q8KA 1WCMH 3FHWA 4R4QA 5FLXc 1AH9A 1YZ6A 1Q46A 1WCMG 4DAMA 4QGUA 1V43A 3CCVA 1Q81C 2R92G 2IT1A 3W1BA 1IBLL 4DR5Q 3GTKH 4R1JA 2IHFA 3T1YL 1A63A 1JT8A 1YJNA 2QGQA 2Q2UA 4B3TL 2ZJPA 2VQEQ 2RHSB 4LF9L 3MXNB 4HIDA 2K4KA 2WB1G 4HJ8A 4GS3A 4YCVA 4P74A 3TS0A 1BKBA 5FLMG 4JCVE 1AE3A 5M3FG 4ALPA 3K81C 4DV2Q 3L7ZC 1TWGH 2K14A 3PV0A 3T1HL 1FL0A 4J15A 3PUVA 2E2IH 4B3SQ 2PMZE 3U4ZA 4DUYL 2PQAA 5C44G 3M3YH 4A3LH 1L2FA 4PZ8A 4A93G 1G291 4YWLA 2UUCQ 2PI2E 1JB7A 3RLFA 4C3JH 4LFCQ 2JA7H 3CCQA 2VZAA 1OXTA 5DLQE 5LMNQ 3RN2A 3I4MG 4B3ML 1PH3A 5JEAG 2UUAQ 4B3RQ 3CPWA 3TRZA 4JC0A 1Y1VG 4JV5Q 1L1OC 4OX9Q 1CKMA 2YYZA 1KL9A 2Z6KC 3CCJA 1IBML 3M9BA 4A3MG 5GROA 3J7ZC 5GADC 3UDXA 4HJ5A 2JJQA 3BU2A 4JI4L 2JA8H 1V9PA 4AYBE 1EIFA 1HNZL 4BY1H 4A93H 1WI5A 3UE0A 1K9MC 4DV0Q 3CF5A 4IO9A 2YTVA 1N34Q 2HHHL 5LMUQ 3I2ZA 4IJHA 1TXYA 3KJOA 2R7ZH 1PH8A 3I4MH 3BZCA 3NELA 4GKJQ 4NPSA 5IYDG 3S2HH 2B29A 4JI4Q 4OWTB 1A62A 4APVA 4LFBQ 3KDFB 1VQKA 4DV4L 2B63H 1CSQA 1I3QH 3KF8B 2OQKA 4UPAA 1MJCA 4JI6Q 1N36Q 4IOAA 3DLLA 1WYDA 3RZOH 4JI0Q 4A3GG 1Q82C 3S24A 4A3JG 4JI1Q 3CC4A 2IX0A 2HQLA 4X66Q 2DUDA 2XTIA 3AFQA 4IPDA 2UXDQ 3K7AH 4IPGA 1FGUA 2NVQH 2H5XA 1J6QA 2Q2TA 1C9OA 2VY3A 3A74A 2FXQA 5C0XI 3M4QA 1SR3A 2UXBL 1HZBA 5IYBH 4A3IH 1P16A 3AYHB 2CWAA 4P75A 1I5FA 2B3GA 2NN6I 5ELNA 3PO2G 4JI2Q 1PYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PV4 A;  1PH1 A;  4R4C A;  3CQZ H;  1RL2 A;  5GAH C;  1VQ9 A;  5JEA J;  3UDI A;  1YJW A;  2CCZ A;  4L5Q A;  3FKI H;  3NEM A;  4JI5 L;  3CPF A;  4IFD J;  4DNI A;  4KHZ A;  4NXM Q;  1QUQ A;  2JK8 A;  2KHJ A;  4HIK A;  4AQY L;  4IFD I;  4A3F H;  2MQH A;  3H3V H;  3D0F A;  4KLK A;  4P72 A;  1VQN A;  4JI2 L;  2JEB I;  4LFA Q;  4DR3 L;  1YHA A;  2NVY H;  4EX5 A;  2WAQ E;  3PUW A;  4BA1 I;  2NVX H;  3GTG H;  3S15 H;  2F3I A;  3CMA A;  1Q12 A;  2B63 G;  3HOZ G;  4DR1 Q;  1VQ6 A;  2JQO A;  4DV3 L;  2R7D A;  2ZTD A;  4BBR G;  5BR8 L;  4OO1 G;  1EFW A;  2UUB Q;  2AHO B;  4DV6 Q;  4DR2 Q;  3KJP A;  2F52 A;  4XTC S;  2JA5 H;  4JOI C;  4LF7 Q;  5IE8 A;  5GAE C;  3RLO A;  1VQL A;  3S17 H;  4A3F G;  4X65 Q;  1VS0 A;  4Y52 H;  4C2M H;  3Q8D A;  2K5N A;  4UP9 A;  1SFO H;  1VQ7 A;  3M7N A;  2KBN A;  2AMC B;  4DV5 Q;  3DM3 A;  5M5Y H;  3GTQ H;  3GTM H;  1Q86 C;  1VQ5 A;  4OX9 L;  1A0I A;  2ZTC A;  4R4T A;  4JYA L;  2WB1 E;  1Q1E A;  5C4X H;  4DR2 L;  1VQP A;  1EQQ A;  4K0K L;  4GOP A;  1YI2 A;  4NB3 A;  4EQ5 A;  5C4X G;  1OXS C;  1TWF H;  1G51 A;  3I55 A;  4YCU A;  2KHI A;  3M4O H;  4UP7 A;  1L0W A;  2Q2H A;  5FLM H;  1EQR A;  1UE5 A;  1NE3 A;  4DK6 C;  2EQS A;  1VQD A;  2RHQ B;  3RNU A;  2HHH Q;  1W3S A;  2OTJ A;  3GTL H;  2OCE A;  5IYC G;  1D8L A;  1UEB A;  3J80 c;  4A3G H;  1LUZ A;  4IOC A;  1XMO Q;  2YTY A;  4UY8 C;  3JC6 6;  2UXC L;  1MJE A;  4JI8 L;  1CKN B;  1X55 A;  3TEH B;  2OWO A;  1EOV A;  2UUA L;  1YVC A;  3JAM i;  2VS1 A;  3HOX H;  4JBW A;  4MZ9 A;  5M5W H;  1Y1V H;  2ALY B;  5M3M H;  1C7Y A;  1YBY A;  1J5E Q;  4GN4 B;  2ZM6 L;  4OWW B;  2E5L Q;  1VQE A;  2IY5 B;  3T1Y Q;  1IBK L;  3AQQ A;  3S1R H;  3EIV A;  2WFW A;  4DV3 Q;  3GTP H;  2GN5 A;  1JJC B;  4PMW A;  4BXX H;  3HOW G;  4BBS H;  1E1T A;  5ELO A;  4DKA C;  4MTN A;  4TQU S;  4X64 Q;  1B8A A;  3CC2 A;  1FJG Q;  1NBW A;  3OYY A;  2NVT H;  1MKH A;  3PO2 H;  1X65 A;  2ZJQ A;  2LXK A;  1WFQ A;  4DV0 L;  1X3F A;  1YJ9 A;  3TS2 A;  1TWA H;  4LF8 L;  2BH8 A;  4X62 Q;  3H3V I;  3HOU G;  5K36 G;  3CAM A;  4O0A A;  1PH2 A;  3UE1 A;  2HIX A;  3PSI A;  1YHQ A;  4YHH L;  4LF6 L;  2YV5 A;  2Y0S E;  4DPG A;  2R6G A;  3J80 i;  3GO5 A;  3AEV A;  2Y0S G;  2R93 G;  1D7Q A;  3S1M H;  1VQO A;  1NJI C;  3PUY A;  3B6Y A;  2A1A A;  2R7F A;  5IP7 H;  2V1C C;  4DV4 Q;  4HJA A;  4LF8 Q;  2YTX A;  3GD7 A;  4DV7 Q;  3TQY A;  4GLA C;  4RMF A;  1XJV A;  4NXN Q;  1JMC A;  3W5O A;  3I7F A;  2K52 A;  3KF6 A;  1KHI A;  4LWC A;  1R9T H;  1PH7 A;  3HOY G;  2AWN A;  3PF5 A;  4A3C G;  2CFM A;  2PI2 A;  4A3E H;  3NEN A;  4OON A;  1PA6 A;  1IBL Q;  2N3S A;  1PH6 A;  1KRT A;  4RG1 A;  2VQE L;  1L1O A;  1OXX K;  4JYA Q;  5E7N A;  4POG A;  1NMF A;  4DUZ L;  2AKW B;  3I4O A;  2VL6 A;  3TRE A;  4OWX B;  1PH4 A;  1K3R A;  1NMG A;  2MO0 A;  4OO1 I;  4PZ7 A;  1M90 C;  3KFU A;  1CKO A;  3STB C;  2K75 A;  4A3I G;  2R7Z G;  3PIP A;  3FP9 A;  5C3E G;  5IP9 H;  1XNQ Q;  3ULJ A;  5C4J H;  4JI3 L;  3H0G H;  2KEN A;  4DUY Q;  4AYB G;  2F4V L;  3KDF A;  3ZJY C;  1SN8 A;  1HH2 P;  3ER0 A;  3CME A;  2Q2I A;  3F2D A;  4LFA L;  3FKI G;  1X3E A;  3MEF A;  4X64 L;  3S16 H;  3AFP A;  1I6H H;  4Y7N H;  4H02 A;  1UE1 A;  5C44 H;  4DR5 L;  4A3M H;  4JI7 L;  1PVO A;  1L1O B;  1GKH A;  4DR6 L;  3F8T A;  4GNX B;  2RF4 A;  5J3B A;  4YCW A;  5IYB G;  4LF9 Q;  4GKK L;  1YEZ A;  1YIJ A;  3RLN A;  1VQA A;  1HR0 W;  3PIO A;  2VUM G;  2NN6 G;  2BH2 A;  4PZ6 A;  1QZH A;  3H0G G;  4A3E G;  5H1S E;  1S40 A;  1BBW A;  3HKZ E;  4GLV B;  1SRU A;  3PGZ A;  4BY7 G;  1RIP A;  4HJ7 A;  1PFS A;  1K8A C;  5C0X J;  4GKJ L;  4JBM A;  1VQB A;  4DV7 L;  1HNW Q;  4GNX A;  1YIT A;  2JA8 G;  4DV2 L;  3F2B A;  4HIO A;  4XIG S;  3T1H Q;  1SRO A;  2E2J H;  4A4I A;  2K50 A;  3G4S A;  4LF4 L;  3HOW H;  4BBS G;  4MNO A;  5IYC H;  4LFB L;  2QEX A;  3RR5 A;  3L2P A;  1VQH A;  1N33 Q;  4JV5 L;  2JA6 H;  4A3B H;  4K0K Q;  4PG3 A;  4LFC L;  3ULP A;  3S2D H;  1W2B A;  1XNR L;  1KXL A;  3S1Q H;  3L0O A;  1VCI A;  4P71 A;  4GNX C;  3CXC A;  4B3R L;  2WAQ G;  3IRB A;  4DR4 L;  5HGQ A;  3PO3 G;  4DR7 Q;  4IFD G;  4A3K G;  4WJ3 M;  3EBE A;  3HFZ B;  1WJJ A;  5HY6 A;  1JJG A;  1SLJ A;  1GD7 A;  4AIM A;  1S3O A;  2VQF Q;  1E7Z A;  2ID0 A;  2D0O A;  4TVA B;  5IWA L;  1HJP A;  5AJ3 L;  2VW9 A;  4LF5 L;  1U0L A;  1BBU A;  3PUZ A;  4JI5 Q;  2CKZ B;  2QA4 A;  1HR0 Q;  3I4N G;  2R93 H;  2WP8 J;  4AH6 A;  2Z0S A;  1X54 A;  2JA6 G;  4A3B G;  4C3I H;  3EN2 A;  2ZTE A;  1G6P A;  3K80 C;  5LMU L;  3J81 c;  5IY0 A;  2HIV A;  1B70 B;  4DR3 Q;  4R4I A;  1B7Y B;  2OQ0 A;  1EIY B;  5IWA Q;  5AJ3 Q;  1EUJ A;  4LF5 Q;  3CCS A;  1KD1 C;  4A3K H;  3J81 j;  1N32 L;  3BJU A;  2RCN A;  4B3M Q;  1Q7Y C;  1E3P A;  1E24 A;  2I5M X;  3RN5 A;  1K0R A;  2DGY A;  4LUZ A;  2CWP A;  3F2C A;  4JI8 Q;  3HOV H;  4LNQ A;  3U4V A;  3J81 i;  1VQI A;  2GVB A;  4JI0 L;  2LXJ A;  2C35 B;  2F4V Q;  4JOI A;  4LUV A;  1K83 H;  2NZO A;  5BR8 Q;  2UXD L;  1OXU A;  2Z6K A;  3A0J A;  2A8V A;  3HOX G;  1HNW L;  4HJ9 A;  1KC8 C;  5IT9 c;  5IP9 G;  5JJI A;  4B3T Q;  3KOJ A;  1QVG A;  4JG2 A;  5GQO A;  3CCU A;  4O2D A;  1WOC A;  2I5L X;  1LYL A;  3A5U A;  4A3L G;  2N8N A;  1LM0 A;  3CCE A;  4BA2 I;  3PUX A;  4IPH A;  1K8G A;  3OTO L;  2KCM A;  3ERS X;  4GN3 B;  4L5T A;  1UE7 A;  4FDB A;  2ZJR A;  1HNX Q;  4GN5 A;  2ASB A;  4DR7 L;  4QIW E;  1OXV A;  3GDE A;  4L5S A;  1E1O A;  2UUC L;  4L5R C;  1FVI A;  4OXP A;  3I56 A;  3CP0 A;  1OTC A;  2LSS A;  1E22 A;  1VQ4 A;  4JI1 L;  1X9N A;  1CSP A;  4DK3 C;  1VQF A;  4DR1 L;  3CCL A;  1HNX L;  1GM5 A;  2D0P A;  1NTG A;  2I5H A;  3HKZ G;  1AE2 A;  1QVC A;  1QZG A;  4WJ4 A;  1GO3 E;  1Y14 B;  2MFI A;  1IXR A;  3U58 A;  1O7I A;  1VQJ A;  5EAY A;  3E9I A;  5GAG C;  1IBM Q;  1N33 L;  5JJL A;  1PH9 A;  2AWO A;  1HZ9 A;  4UP8 A;  1BVS A;  4IJL A;  1HNZ Q;  1N32 Q;  3U50 C;  3KF6 B;  4DV1 Q;  4GLX A;  4NXM L;  4HIM A;  1XPU A;  1KAW A;  2EXD A;  1MIU A;  1IZ6 A;  4AQY Q;  1J5E L;  3S14 H;  3W1G A;  4LW1 A;  1N34 L;  3SGI A;  2CQO A;  4JI7 Q;  2I0Q A;  1N9W A;  2HT1 A;  2E8G A;  3CC7 A;  2IX1 A;  2VQF L;  1YHB A;  2JE6 I;  5IYD H;  1I94 L;  1FJG L;  2PNH A;  3E9H A;  3PO3 H;  5FJ8 G;  3LGJ A;  1SMX A;  1NY4 A;  1HR0 L;  5LMN L;  2MO1 A;  4A3D H;  4YY3 L;  2UU9 Q;  1PYB A;  1TWC H;  5FJ8 H;  1XTD A;  4KI0 A;  1Y1W G;  4A3D G;  2ATW A;  1VQC A;  1UWV A;  4JI6 L;  3STB D;  1LTL A;  4DV6 L;  1XNQ L;  3I4N H;  2N49 A;  3M4P A;  3HOV G;  2UXC Q;  3G71 A;  1XPO A;  3S1N H;  3WWV A;  1IL2 A;  4DV5 L;  4POF A;  4A75 A;  3K0X A;  4X65 L;  3CW2 C;  2GVA A;  1P8L A;  3KLW A;  3PCO B;  4LF4 Q;  4X6A H;  4QY7 A;  1Y1W H;  4KHP Q;  3VDY A;  3GTJ H;  4GKK Q;  1Z9F A;  1HZC A;  2EIF A;  4LUO A;  4A76 A;  4A3J H;  1VQ8 A;  4NXN L;  3ICE A;  3CCM A;  3H15 A;  1XMQ L;  2VUM H;  1V1Q A;  3A5Z B;  1VQG A;  3JAM c;  2PQA B;  4B3S L;  5LMN W;  3PF4 A;  1QUQ B;  4IPC A;  2K5V A;  1N36 L;  2ES2 A;  3UDF A;  1YNX A;  4X62 L;  5C0X G;  1T9H A;  2JEA I;  4KHP L;  4QQB X;  4X66 L;  2K5H A;  3F1Z A;  3M85 A;  5JJK A;  1JE5 A;  4GOP C;  4YHH Q;  4DUZ Q;  1EWI A;  3KYH C;  1TWH H;  2E2H H;  1KIX A;  1CUK A;  1X3G A;  1X56 A;  2D62 A;  4JBJ A;  4JBK A;  3J7A 5;  2BA1 A;  2JA7 G;  3E0E A;  2R92 H;  1EYG A;  2N78 A;  3ULL A;  2JA5 G;  4YWM A;  4C3H H;  4YWK A;  1I94 Q;  1XNR Q;  2ZM6 Q;  4QJF A;  1A8V A;  3G48 A;  1GVP A;  4R4O A;  4QL5 A;  4YY3 Q;  2IHE A;  1VQM A;  2UU9 L;  3GTO H;  1IYJ B;  4DR6 Q;  4DR4 Q;  1U5K A;  4BY7 H;  1KRS A;  4A3C H;  1DGS A;  1UE6 A;  2XGT A;  2JA9 A;  5M3F H;  2E5L L;  3RZD H;  1XPR A;  1H95 A;  3CD6 A;  1IBK Q;  2VNU D;  3HKS A;  1ASZ A;  1QVF A;  4P73 A;  1C0A A;  4DV1 L;  3G6E A;  1SE8 A;  2A19 A;  2L15 A;  4BY1 G;  1M1K C;  2KCT A;  2NZH A;  3UDG A;  2OTL A;  1I50 H;  2UUB L;  1PH5 A;  5IP7 G;  4BXX G;  4LF6 Q;  3HOZ H;  3CCR A;  1PHJ A;  4LF7 L;  1Q1B A;  4DAY B;  2YU9 H;  1N8R C;  1CKN A;  1XMO L;  3K7U C;  3OTO Q;  2MNA A;  1S72 A;  1X6O A;  4ME3 A;  3BZK A;  1XMQ Q;  1HZA A;  5C3E H;  1JJ2 A;  3HOY H;  5M3M G;  3D31 A;  1K73 C;  4JI3 Q;  2UXB Q;  1KQS A;  3K8A A;  5M5X H;  1ASY A;  3HOU H;  2BA0 A;  3OW2 A;  4BBR H;  4GOP B;  3NBH B;  1Z47 A;  1Q8K A;  1WCM H;  3FHW A;  4R4Q A;  5FLX c;  1AH9 A;  1YZ6 A;  1Q46 A;  1WCM G;  4DAM A;  4QGU A;  1V43 A;  3CCV A;  1Q81 C;  2R92 G;  2IT1 A;  3W1B A;  1IBL L;  4DR5 Q;  3GTK H;  4R1J A;  2IHF A;  3T1Y L;  1A63 A;  1JT8 A;  1YJN A;  2QGQ A;  2Q2U A;  4B3T L;  2ZJP A;  2VQE Q;  2RHS B;  4LF9 L;  3MXN B;  4HID A;  2K4K A;  2WB1 G;  4HJ8 A;  4GS3 A;  4YCV A;  4P74 A;  3TS0 A;  1BKB A;  5FLM G;  4JCV E;  1AE3 A;  5M3F G;  4ALP A;  3K81 C;  4DV2 Q;  3L7Z C;  1TWG H;  2K14 A;  3PV0 A;  3T1H L;  1FL0 A;  4J15 A;  3PUV A;  2E2I H;  4B3S Q;  2PMZ E;  3U4Z A;  4DUY L;  2PQA A;  5C44 G;  3M3Y H;  4A3L H;  1L2F A;  4PZ8 A;  4A93 G;  1G29 1;  4YWL A;  2UUC Q;  2PI2 E;  1JB7 A;  3RLF A;  4C3J H;  4LFC Q;  2JA7 H;  3CCQ A;  2VZA A;  1OXT A;  5DLQ E;  5LMN Q;  3RN2 A;  3I4M G;  4B3M L;  1PH3 A;  5JEA G;  2UUA Q;  4B3R Q;  3CPW A;  3TRZ A;  4JC0 A;  1Y1V G;  4JV5 Q;  1L1O C;  4OX9 Q;  1CKM A;  2YYZ A;  1KL9 A;  2Z6K C;  3CCJ A;  1IBM L;  3M9B A;  4A3M G;  5GRO A;  3J7Z C;  5GAD C;  3UDX A;  4HJ5 A;  2JJQ A;  3BU2 A;  4JI4 L;  2JA8 H;  1V9P A;  4AYB E;  1EIF A;  1HNZ L;  4BY1 H;  4A93 H;  1WI5 A;  3UE0 A;  1K9M C;  4DV0 Q;  3CF5 A;  4IO9 A;  2YTV A;  1N34 Q;  2HHH L;  5LMU Q;  3I2Z A;  4IJH A;  1TXY A;  3KJO A;  2R7Z H;  1PH8 A;  3I4M H;  3BZC A;  3NEL A;  4GKJ Q;  4NPS A;  5IYD G;  3S2H H;  2B29 A;  4JI4 Q;  4OWT B;  1A62 A;  4APV A;  4LFB Q;  3KDF B;  1VQK A;  4DV4 L;  2B63 H;  1CSQ A;  1I3Q H;  3KF8 B;  2OQK A;  4UPA A;  1MJC A;  4JI6 Q;  1N36 Q;  4IOA A;  3DLL A;  1WYD A;  3RZO H;  4JI0 Q;  4A3G G;  1Q82 C;  3S24 A;  4A3J G;  4JI1 Q;  3CC4 A;  2IX0 A;  2HQL A;  4X66 Q;  2DUD A;  2XTI A;  3AFQ A;  4IPD A;  2UXD Q;  3K7A H;  4IPG A;  1FGU A;  2NVQ H;  2H5X A;  1J6Q A;  2Q2T A;  1C9O A;  2VY3 A;  3A74 A;  2FXQ A;  5C0X I;  3M4Q A;  1SR3 A;  2UXB L;  1HZB A;  5IYB H;  4A3I H;  1P16 A;  3AYH B;  2CWA A;  4P75 A;  1I5F A;  2B3G A;  2NN6 I;  5ELN A;  3PO2 G;  4JI2 Q;  1PYS B; 
#chains in the Genus database with same CATH topology
 2K28 A;  1PH1 A;  3K6O A;  3BYY B;  4JVZ A;  4L5Q A;  4JI5 L;  3NEM A;  3CPF A;  5FLX E;  3QO2 A;  1QUQ A;  3A8I E;  4IFD I;  2MQH A;  3GV6 A;  2WIN B;  3LNN A;  1SYD A;  5D65 A;  4DK0 A;  1YHA A;  1TVX A;  2F3V A;  4EX5 A;  2WAQ E;  3PUW A;  3UI2 A;  2QF7 A;  2L0C A;  1VMP A;  3M7G A;  3CMA A;  2XRQ D;  1U4M A;  4DR1 Q;  1CA6 A;  2B63 G;  1VQ6 A;  4IUP A;  2B2T A;  5JVG 3;  2ZTD A;  1CTM A;  2AHO B;  2XRS D;  3NXW A;  3KJP A;  2F52 A;  4LF7 Q;  1II3 A;  5GAE C;  1JCK B;  1VS0 A;  5IOC A;  2K5N A;  4UP9 A;  2AMC B;  4DV5 Q;  3GTQ H;  4A3M B;  1HXY D;  1A0I A;  2B39 A;  2ZTC A;  1AH9 A;  4NB3 A;  4EQ5 A;  2JA5 B;  1OXS C;  1H9K A;  1TWF H;  2KOL A;  1KDB A;  2IX3 A;  4XT3 B;  4L6T B;  4HAE A;  1MGS A;  1SYF A;  2XWB B;  5CBE E;  1UEB A;  2ICI A;  4DXG A;  1XMO Q;  1MJE A;  4JI8 L;  5COY A;  2AQ2 B;  2EVB A;  1S5D D;  3NSW A;  3GV3 A;  1YVC A;  4KTA A;  2VS1 A;  4XYO A;  5M5W H;  3I3C A;  1C7Y A;  4A3B B;  3DXJ C;  1YBY A;  1H9R A;  3J7Y W;  5FLX L;  1VQE A;  3T1Y Q;  1IBK L;  3AQQ A;  1QE6 A;  1PTO H;  5D3I B;  4ZKC B;  2EJG C;  3D4R A;  1S5C D;  3V2T A;  2G9H D;  4QUF A;  1HFG A;  2NVT H;  1MKH A;  2ZJQ A;  1L0X B;  2OF1 A;  4XYQ A;  5I6W A;  1X3F A;  1EQV A;  3I70 A;  1TWA H;  3H3V I;  1PH2 A;  5C6A A;  1CQF A;  3AEV A;  3J80 i;  4IUU A;  3TZD A;  4X3T A;  5J39 A;  5I2X A;  3B6Y A;  5IGC A;  4LF8 Q;  3KF8 A;  5IT9 E;  4DV7 Q;  3TQY A;  4GLA C;  4RMF A;  4A93 B;  1JWS D;  3W5O A;  2KCN A;  3KF6 A;  4LWC A;  3SVM A;  2AWN A;  2CFM A;  2FMM A;  4A3E H;  1PA6 A;  2VUM B;  2N3S A;  2EYJ A;  2P5Z X;  2VQE L;  1L1O A;  5E7N A;  4TSS A;  1BCP C;  1NMF A;  4U67 3;  2NTT A;  4OWX B;  1K3R A;  1CKO A;  4A3I G;  3PIP A;  3ULJ A;  3H0G H;  3ZJY C;  3ER0 A;  2Q2I A;  3F2D A;  1X3E A;  3S16 H;  1UE1 A;  2SNM A;  1GKH A;  4GNX B;  1CI3 M;  4GKK L;  3DEO A;  4C3I G;  4ZKB B;  3K5M A;  4C1N K;  4A3E G;  1BBW A;  2A6H C;  2NYZ D;  4FP5 D;  1S4Z A;  4G4K A;  2K1B A;  3GTG B;  4TKO B;  1BR9 A;  2NVX B;  2FJ2 A;  1YIT A;  3A8K E;  1JOR A;  3F2B A;  1STE A;  4XIG S;  1B9M A;  1SNP A;  2D5D A;  4A4I A;  3HRZ C;  3HOW H;  4MNO A;  5IYC H;  3C2P A;  2F0M A;  1RF2 D;  3FKI B;  4X3U A;  5JPN C;  4JV5 L;  4K0K Q;  4K8I A;  3WOF A;  1VCI A;  4KN4 C;  1I4Q A;  4GNX C;  1GXD C;  3HG9 A;  2K7V A;  4A3K G;  2A73 B;  4R8I A;  3EBE A;  1WJJ A;  4CJ0 B;  3ERO A;  4HJA A;  1S3O A;  1E7Z A;  3GTO B;  2D0O A;  4TVA B;  5AJ3 L;  5F2D A;  1U0L A;  2F0N A;  2CKZ B;  4OEM B;  3TME A;  2WP8 J;  1YNN D;  2Z0S A;  2JA6 G;  3VA7 A;  3CKI B;  1WTP A;  1I3Q B;  5IGB A;  1CA5 A;  1S5F D;  5LL6 S;  1EUJ A;  4A3K H;  1G8Z D;  1E3P A;  2F0G A;  3BYT B;  3MVV A;  3NUC A;  3RN5 A;  3N52 A;  3J81 i;  1SNO A;  2XIW A;  4LUV A;  1GJX A;  2A6E C;  2NZO A;  1QIL A;  2B2T C;  1TQO A;  1T5E A;  5IT9 c;  5JJI A;  3KOJ A;  4JG2 A;  1SBB B;  1WOC A;  3QIA A;  1LYL A;  4EQP A;  1KAA A;  1TU2 B;  1YNJ D;  1JIC A;  4ZYS A;  4A3L G;  2N8N A;  3CCE A;  4ID6 A;  4N8F A;  1JE4 A;  3PUX A;  1BBX C;  3ERS X;  4L5T A;  3S1N B;  4GN5 A;  2A68 D;  4L5S A;  4L5R C;  1UUP A;  3I56 A;  4ZCK A;  2PZW A;  2LSS A;  1C8C A;  1VQ4 A;  1H9S A;  4DK3 C;  1WTQ A;  1GM5 A;  2D0P A;  3I73 A;  1IXR A;  4BWG B;  5GAG C;  5HGT A;  1IBM Q;  1NNX A;  1N32 Q;  3SHL A;  3U50 C;  3RZO B;  4DV1 Q;  5FO8 B;  4PV1 C;  4AQY Q;  2NZ1 D;  2CQO A;  3E5S A;  2ZXP A;  5CV8 A;  1E2V A;  3GTP B;  2E8G A;  1YHB A;  5IYD H;  5D3D A;  4ODG A;  2PNH A;  3H6M A;  4A3D H;  3J7A F;  2UU9 Q;  2AUK A;  1TWC H;  1XTD A;  2ATW A;  1UWV A;  5ELF A;  1NSN S;  3STB D;  3I4N H;  1XNQ L;  2N49 A;  3NBI A;  1ML0 D;  1FGB D;  1XPO A;  1HA5 A;  5I9O A;  4POF A;  2F0O A;  4X65 L;  1P8L A;  2F0F A;  1Y1W H;  4IZ8 A;  1Z9F A;  1PTO F;  4DF7 A;  4ILW A;  1SJH D;  3TSS A;  3H15 A;  2HD3 A;  5IIF A;  4WJW A;  2L5T A;  1TWH B;  5IT9 L;  1PLF A;  1ZYR C;  2JEA I;  1H9J A;  4QQB X;  4C2M B;  2NTS A;  4K5V A;  1EWI A;  3KLR A;  1X3G A;  1VMC A;  3Q22 A;  3J7A 5;  5DEH A;  3E0E A;  4YWM A;  5ISR A;  1I94 Q;  3DHQ A;  3D3R A;  4L8J A;  1TS3 A;  1W6J A;  1A8V A;  3G48 A;  4H44 C;  1KRS A;  2JA9 A;  5M3F H;  1EIH A;  1XPR A;  3CD6 A;  1IKM A;  2HQE A;  4RGM A;  3C1F A;  1GOZ A;  4P73 A;  3FPP A;  4DV1 L;  2HUG A;  3V96 A;  2H4O A;  2M2L A;  2OTL A;  2KCT A;  5IP7 G;  3HOZ H;  4LF7 L;  1Q1B A;  4K2L A;  2YU9 H;  1N8R C;  3K7U C;  3OTO Q;  2MNA A;  1PDQ A;  4F87 A;  4ME3 A;  1RCV D;  3HOY H;  1K73 C;  1KQS A;  2A69 D;  1ASY A;  3HOU H;  5TSS A;  4BBR H;  3OW2 A;  1DON A;  3LX0 A;  1Z47 A;  3CRK C;  4EQN A;  1Q46 A;  1EZ6 A;  2EY5 A;  4DAM A;  3W1B A;  5JOB A;  1JT8 A;  3OWF A;  2E2H B;  5CR3 A;  3MA2 B;  4PMB A;  2K4K A;  3TP7 A;  3FEW X;  1LO5 D;  4YIJ A;  4OGQ C;  5C44 B;  1V1O A;  3K81 C;  2PO4 A;  4XQQ A;  1TWG H;  2K14 A;  1A3V A;  2WKC A;  3PUV A;  2E2I H;  3M3Y H;  4DUY L;  3L3O C;  3OPO A;  4YWL A;  3S9W A;  2UUC Q;  5A2Q L;  5A2Q E;  2CHB D;  4LFC Q;  3GTJ B;  2JA7 H;  2NUC A;  2RQX A;  5LMN Q;  4CGY B;  3RN2 A;  1KLU D;  1Y1W B;  5G3L D;  4JC0 A;  1K0S A;  1Y1V G;  1L1O C;  4OX9 Q;  1CKM A;  1F2Y A;  3M9B A;  5E4X A;  4A3M G;  5GRO A;  1SNC A;  4HJ5 A;  4MIU A;  2V4D A;  4JI4 L;  3A55 A;  2F0Q A;  1R9T B;  5EPK A;  4S3S A;  3CF5 A;  2YTV A;  3ITP A;  4X3K A;  2HHH L;  5E4W C;  5LMU Q;  3I2Z A;  1TXY A;  3KJO A;  1PH8 A;  3A7L A;  2B2Y C;  2J0T D;  3BDC A;  1L0Y B;  2ICE C;  4CKE A;  1CHQ D;  5I9P A;  3KDF B;  1VQK A;  2L9H A;  5EPL A;  2B63 H;  3KF8 B;  3FMC A;  2J4X A;  2LKV A;  1N36 Q;  1TS4 A;  4JI0 Q;  1B3Q A;  4G57 A;  2HQL A;  1PFN A;  4X66 Q;  5IGG A;  2F0D A;  2XTI A;  2KUM A;  1CZW A;  4K5W A;  4MN3 A;  2Q2T A;  1QNK A;  3A74 A;  3M4Q A;  1AFP A;  1CHP D;  2OXP A;  1P16 A;  5IGF A;  1ILQ A;  5ELN A;  1I5F A;  2B3G A;  2NN6 I;  4IUV A;  3PO2 G;  1B1Z A;  5G3L F;  1PYS B;  1PV4 A;  1D1K A;  1PFM A;  3CQZ H;  5JEA J;  3UDI A;  3A7A B;  4KHZ A;  3K5O A;  2JK8 A;  3I8Z A;  4AQY L;  4A3F H;  3FRP B;  4KLK A;  2CVR A;  1VQN A;  2JEB I;  4DR3 L;  3E6Z X;  2ZXR A;  1XX8 A;  4WRD A;  4BA1 I;  1MSH A;  4QIW B;  2F3I A;  3C3L A;  2K6A A;  1DD2 A;  2KED A;  3NHH A;  3TDQ A;  5FKA C;  4KY6 A;  4DV3 L;  5BR8 L;  4OO1 G;  3Q24 A;  2QEJ C;  5IE8 A;  1OO9 B;  5EBC A;  1VQL A;  2KA7 A;  4A3F G;  4Y52 H;  2F0T A;  3M7N A;  3GTM H;  4OX9 L;  1S5E D;  4R4T A;  3MAQ A;  3H94 A;  1VQP A;  5DM7 3;  3S17 B;  4GOP A;  1MI2 A;  2EJM A;  1HRJ A;  3M4O H;  5CBA E;  3VR2 A;  1BCP F;  5FLM H;  1UE5 A;  1M8A A;  1VQD A;  3RNU A;  2HHH Q;  3WDN A;  3GTL H;  1D8L A;  2EYP A;  3J80 c;  2BE5 D;  4I7A A;  4C56 C;  4IOC A;  1AZQ A;  4UY8 C;  3JC6 6;  2UXC L;  1D5M C;  2IW3 A;  1EOV A;  2WII B;  3HOZ B;  4A3F B;  4JBW A;  4MZ9 A;  5M3M H;  4H0L C;  2ZXO A;  4OWW B;  2QDB A;  4JPB W;  4IUR A;  3CQZ B;  2WFW A;  4PMW A;  2K32 A;  4BXX H;  1E1T A;  1HUN A;  2A74 C;  4MTN A;  4X64 Q;  1B8A A;  5J1Z A;  1XYI A;  3CC2 A;  1LTT D;  3EQL C;  4EVO A;  4KMU C;  1Z6H A;  4LF8 L;  2BH8 A;  3CAM A;  4HSP A;  3UE1 A;  2SOB A;  2HIX A;  3BZD B;  3PSI A;  1YHQ A;  4YHH L;  2YV5 A;  2B63 B;  1GHK A;  3GO5 A;  1XTC D;  4ZUI A;  2Y0S G;  2R93 G;  4DN4 M;  3KBG A;  3S1R B;  1VQO A;  3PUY A;  2R7F A;  5IP7 H;  2V1C C;  1EYC A;  2I46 A;  2YTX A;  4WFN 3;  1ICW A;  5KNC A;  4BY1 B;  4NXN Q;  1JMC A;  4RFB A;  1PRT F;  1G6Z A;  4IFD H;  3I7F A;  3QOJ A;  1R9T H;  4A3C G;  3SR1 A;  2PI2 A;  3NEN A;  4QB4 A;  1PXU A;  4RGT A;  4RG1 A;  1OXX K;  1T5X D;  2BDO A;  4OO1 I;  2Q8R E;  1PRT B;  1U9R A;  2XN9 C;  1JOK A;  3STB C;  2K75 A;  5A35 A;  2QW7 A;  3FP9 A;  1ESF A;  2F4V L;  1LTA D;  2KEN A;  4DUY Q;  5COR A;  1SN8 A;  1HA6 A;  1DJR D;  2DN8 A;  1EL0 A;  2DNC A;  2HCI A;  2L1B A;  5EQ0 A;  1HHV A;  4H02 A;  4DR5 L;  5C44 H;  2KVM A;  1PVO A;  1LT3 D;  1KDC A;  3F8T A;  3SK8 A;  3VYR A;  4YCW A;  3JAM L;  4V0B A;  1VQA A;  3I91 A;  2LY7 A;  3PIO A;  2NN6 G;  1GHJ A;  3EJI A;  4IUN A;  4OL7 A;  3H0G G;  1S40 A;  3NWS A;  4HJ7 A;  2F0K A;  2RSN A;  4V19 0;  3S15 B;  1IYV A;  1HNW Q;  4GNX A;  1HPC A;  2NVY B;  1KLG D;  3M4Y A;  1STY A;  1RKN A;  2K01 A;  5LHY 1;  1GUT A;  4PG3 A;  3S2D H;  1XNR L;  3MXG A;  1BUV T;  4HCE A;  4P71 A;  2EYM A;  2WAQ G;  4DR4 L;  4DR7 Q;  1CK1 A;  4IFD G;  4TRD A;  5HY6 A;  1Y8N B;  2UUA Q;  5DNF A;  1B3A A;  4NKL A;  1LAB A;  3KLS A;  1DXM A;  4C3I H;  1STG A;  2I07 B;  5JEA H;  3PMF A;  1B70 B;  4M1U B;  5CYU A;  2NBF A;  4R4I A;  4LF5 Q;  4KKU A;  2SDF A;  1LT5 D;  5ELC A;  2FMC A;  2RCN A;  1PZK D;  1Q7Y C;  3GTM B;  1E24 A;  2I5M X;  2DGY A;  2CWP A;  3T53 B;  4JI8 Q;  3U4V A;  1AZP A;  2RCF A;  2F4V Q;  1C48 A;  1BF4 A;  5BR8 Q;  1OXU A;  2Z6K A;  3QWN A;  3MHB A;  5C0X H;  4OIJ A;  5IP9 G;  4B3T Q;  1QVG A;  3CCU A;  3IAY A;  5BN5 A;  1IW7 D;  1BNZ A;  1ENA A;  1K8G A;  2EXZ A;  3OTO L;  2KCM A;  2B2U A;  2R61 A;  4GN3 B;  1G91 A;  4N9T A;  3OIQ A;  2ZJR A;  3ND9 A;  4O1N A;  1B2T A;  3GDE A;  4FVM A;  4DNT B;  1FVI A;  1HUM A;  1OTC A;  1NR2 A;  5CGK A;  4KKS A;  3S1M B;  2B2W A;  1SYE A;  4JI1 L;  4DR1 L;  1TWC B;  1HNX L;  1NTG A;  2I5H A;  1SE4 A;  1QVC A;  4WJ4 A;  1STA A;  3E9I A;  1K3B C;  3HKZ B;  4CKC A;  3SK6 A;  4UP8 A;  1BVS A;  4DAP A;  3KF6 B;  4G7H C;  4NXM L;  1V1P B;  2PYK A;  2EXD A;  2ZT9 C;  1IZ6 A;  2QKI C;  1N34 L;  2LMC B;  4B9X A;  1N9W A;  2IX1 A;  2KEC A;  4B9W A;  1FJG L;  2G9D A;  3LGJ A;  3AMU A;  5LMN L;  2MO1 A;  2MGS A;  4RWS C;  4R9W A;  4YY3 L;  1SXT A;  3S2H B;  1Y1V B;  1U4P A;  3J7A V;  3URY A;  1VQC A;  3S16 B;  4O42 A;  4JI6 L;  1GUS A;  3NTK A;  3MEH A;  2GA4 B;  3WWV A;  3S1N H;  3BS1 A;  1IL2 A;  3OIP A;  1F9P A;  1DOK A;  1STN A;  5EKL A;  4LMQ D;  2Q8I B;  2F0H A;  1S5B D;  3CW2 C;  2GVA A;  3PCO B;  3TP8 A;  4QY7 A;  3GTJ H;  5C3W A;  4GKK Q;  3RMH A;  4NXN L;  4KKT A;  3NQT A;  2VUM H;  1V1Q A;  3A5Z B;  5LMN W;  2E2I B;  2SNS A;  2K5V A;  5D14 A;  1N36 L;  3Q6S A;  1Q3L A;  1YNX A;  3T56 B;  2JYO A;  4X62 L;  4X66 L;  1BCP B;  2K5H A;  5JJK A;  3KYH C;  3PIO 3;  2E2H H;  1A6X A;  4JBJ A;  2BA1 A;  5CV4 A;  2JA7 G;  2R92 H;  2F0V A;  2N78 A;  3ULL A;  1EY7 A;  4FXD A;  1EY8 A;  2ZM6 Q;  1JOQ A;  1GVP A;  4R4O A;  2IJ0 A;  4MTK A;  3HOU B;  4DR6 Q;  1B44 D;  5EKK A;  3R8B A;  4A3C H;  1FR3 A;  2XGT A;  1H95 A;  1IBK Q;  1LTG D;  4ZRZ A;  3RD4 A;  1C0A A;  3G6E A;  2M9V A;  2RBM A;  2RDG A;  1SMY D;  2NZH A;  3J80 E;  3UDG A;  1M1K C;  1TT2 A;  1PH5 A;  3K58 A;  3JAM E;  4LF6 Q;  1PMR A;  4QCL A;  1DZ1 A;  4ZQ3 A;  1R4P B;  1CKN A;  1S72 A;  2VB2 X;  1X6O A;  2OT2 A;  1XMQ Q;  1JJ2 A;  2KQ3 A;  4RAU C;  2A68 C;  2E74 C;  1MBY A;  1LTB D;  2BA0 A;  1YNN C;  4GOP B;  4IN3 A;  1WCM H;  3R2I A;  4BY7 B;  5FLX c;  1YZ6 A;  2QDL A;  1V43 A;  4RA8 A;  1IBL L;  4R1J A;  2RSO A;  2OEO A;  1TWF B;  2BDN A;  3HEJ A;  2QGQ A;  3MWY W;  2Q8T A;  3OOC A;  1F77 A;  4DAY A;  4GS3 A;  3QOL A;  2NN6 H;  4J6H A;  1PFB A;  5M3F G;  4ALP A;  3GTQ B;  3GP7 A;  4DV2 Q;  3T1H L;  1FL0 A;  5LL6 X;  1LTR D;  2PMZ E;  2PQA A;  4A93 G;  4P2C B;  3NE5 B;  4RCN A;  3TP6 A;  1CM9 A;  3H0G B;  3X3N A;  1RTN A;  2F0L A;  5E1F A;  5DLQ E;  3SXH A;  4B3R Q;  3CPW A;  1ICF B;  4JV5 Q;  4IQZ A;  3CCJ A;  1EY5 A;  1IBM L;  3J7Z C;  1QJO A;  3UDX A;  2CH4 W;  3VYT A;  1AEX A;  1V9P A;  4BY1 H;  3H3V C;  1WI5 A;  3UE0 A;  2WB1 B;  2EYL A;  1F9Q A;  1LLR D;  4IJH A;  2KHS A;  2XNA C;  2KEE A;  3BZC A;  1K28 A;  3OWE B;  4NPS A;  2B29 A;  3U9S A;  1IL8 A;  4OWT B;  1A62 A;  3NTH A;  4LFB Q;  2OQK A;  2X6G A;  4UPA A;  4C3I B;  4IOA A;  2CW0 C;  3RZO H;  5CV9 A;  2DUD A;  2UXD Q;  3EA6 A;  5JAV A;  1GUN A;  2Z4I A;  4G7Z C;  3VR3 A;  1J6Q A;  3DEP A;  2VY3 A;  2FXQ A;  1PH6 A;  3AYH B;  4P75 A;  1H9S B;  3I4M B;  1C4Q A;  4R4C A;  1RD9 D;  5GAH C;  3MFY A;  3O13 A;  3S2D B;  2Z8L A;  4IFD J;  4NXM Q;  3NK9 A;  3TZU A;  5AFW A;  3H3V H;  1BO0 A;  4JI2 L;  1FD7 D;  4J8Q A;  3NPP A;  2NVY H;  2JXM B;  1WTW A;  3GTL B;  3S15 H;  1IYU A;  3C46 A;  4K8J A;  5ELB A;  3FVQ A;  4BBR G;  4DGZ A;  1EFW A;  4KD3 A;  2UUB Q;  1O7Z A;  4XTC S;  4H13 C;  4JOI C;  2DNE A;  1KNA A;  3S17 H;  3DMU A;  3Q8D A;  4HMI A;  2KBN A;  3DM3 A;  2CQA A;  4DR2 L;  1Q1E A;  3G6J B;  1YI2 A;  5C4X G;  4E6I A;  2MUY A;  5CMD A;  4Q0F A;  2KHI A;  4YCU A;  4UP7 A;  3C1E A;  1L0W A;  2F0P A;  2EQS A;  2DY8 A;  2TMP A;  2PCF B;  2OTJ A;  1H9M A;  2Z4H A;  2YTY A;  5KND A;  2Z9H A;  1CKN B;  1X55 A;  3TEH B;  2UUA L;  4F88 A;  1NCV A;  1CT1 D;  4X3S A;  5T1G A;  1Y8P B;  1Y1V H;  3PQI A;  1J5E Q;  2ZM6 L;  2E5L Q;  2CH4 A;  1WVL A;  3HOW B;  3S1R H;  1X3Q A;  1Z7T A;  2GN5 A;  4KHV A;  4A3D B;  5ELE A;  4BBS H;  4A3I B;  1E0B A;  4DKA C;  3H91 A;  2A69 C;  3ERQ A;  1NBW A;  3FPU B;  1B53 A;  3PO2 H;  5KEE A;  3TS2 A;  3DWQ A;  1WTR A;  1E2Z A;  4K2K A;  2QIL A;  1SYG A;  4LF6 L;  4UHV A;  1SYB A;  2Y0S E;  5EBD A;  4CDC C;  1JB3 A;  2WKD A;  1D7Q A;  3S1M H;  2PW5 A;  1NJI C;  4DV4 Q;  4FF3 A;  3GD7 A;  1XJV A;  5M3M B;  1EQT A;  2K52 A;  3HOY G;  1G2T A;  3PF5 A;  1IBL Q;  3Q0A A;  3NP8 A;  4POG A;  1EU3 A;  4C3H G;  3OHX C;  4FF4 A;  2XVS A;  4DUZ L;  3I4O A;  2VL6 A;  4HCS A;  2MO0 A;  4PZ7 A;  1M90 C;  5KYL A;  3KFU A;  4ZLT F;  1HFN A;  2R7Z G;  4JI3 L;  3M4O B;  3M3Y B;  3E3X A;  1HH2 P;  1TWG B;  2L4N A;  5FO9 B;  3CME A;  4LFA L;  5FOB B;  3X3M A;  1EU4 A;  3FKI G;  3IL8 A;  3MEF A;  1I4H A;  3VYS A;  5EGT A;  3HS0 C;  1L1O B;  2RF4 A;  2F3W A;  5J3B A;  5IYB G;  4A3K B;  4LF9 Q;  1YIJ A;  1R4Q B;  2JP1 A;  2VUM G;  1TY2 A;  4PZ6 A;  1QZH A;  1FNW A;  1U4L A;  1EY4 A;  5H1S E;  3HKZ E;  4GLV B;  4BY7 G;  1RIP A;  1PFS A;  1AN8 A;  4GKJ L;  2NVT B;  4JBM A;  2K05 A;  3HOY B;  4DV7 L;  4HIO A;  1B4O A;  4I7Z C;  4KY7 A;  2YU9 B;  2EE1 A;  2EY6 A;  1EWH A;  1AW7 A;  3G4S A;  2E75 C;  4LFB L;  2QEX A;  3RR5 A;  3BVZ A;  4HN7 A;  1N33 Q;  4A3B H;  1MD2 D;  4LFC L;  3KBX A;  4N8X 1;  1WTH A;  1SSO A;  3S1Q H;  2EOT A;  3L0O A;  3CHB D;  3J80 L;  3CXC A;  3LWU A;  5HGQ A;  3PO3 G;  2EPB A;  1VF5 C;  3AB9 A;  4DXF A;  1QCB D;  5M3F B;  4RKB A;  3E0J A;  3ZYY X;  1SLJ A;  2WAQ B;  1GD7 A;  4AIM A;  2VW9 A;  4LF5 L;  3DM1 A;  1BBU A;  2F0E A;  4UAI A;  2QA4 A;  4JI5 Q;  3I4N G;  4GZY C;  4K6L A;  4KY5 A;  4AH6 A;  4C1N I;  1X54 A;  1BCP D;  3K80 C;  5LMU L;  3J81 c;  5IY0 A;  5L37 A;  1EEI D;  1B7Y B;  2OQ0 A;  1EIY B;  5IWA Q;  1NUC A;  1N32 L;  3J81 j;  3BJU A;  4B3M Q;  3HOV B;  3CU7 A;  3AU7 A;  4RCO A;  2G5D A;  3QJY A;  1K0R A;  4LUZ A;  5C4X B;  4IAL A;  2O5I C;  1ILP A;  2LXJ A;  2FFK B;  3T51 B;  3A0J A;  3HOX G;  2O4X A;  3D8G A;  4HJ9 A;  4ULL A;  2K5Q A;  1KC8 C;  4UDU C;  1W6K A;  3KLS X;  3T4A C;  1B9N A;  1UAP A;  4A3J B;  3D6C A;  4OO1 H;  2Z6B A;  4BA2 I;  1LM0 A;  1D6E C;  4IUQ A;  4FXG C;  1UE7 A;  4FDB A;  3LWE A;  1HNX Q;  4G7O C;  4QIW E;  2MPM A;  1OXV A;  1E1O A;  4OXP A;  4KK7 A;  3T16 A;  1V1P A;  1LT6 D;  4LAA A;  4QUC A;  5HUR A;  3R93 A;  1CSP A;  3CCL A;  2E2J B;  2F0U A;  1HQR D;  3HKZ G;  1AE2 A;  1QZG A;  1GO3 E;  5I6Y A;  2BOS A;  2MFI A;  1O7I A;  5EAY A;  1JWU D;  1N33 L;  1HTP A;  1PH9 A;  2F0W A;  1YNJ C;  5T1I A;  4IJL A;  1HNZ Q;  1K8O A;  2DJF C;  1PTO D;  4BBR B;  1XPU A;  5IGE A;  1J5E L;  3G7L A;  3S14 H;  3W1G A;  4H7B A;  4JI7 Q;  3ND8 A;  2HT1 A;  3CC7 A;  2A6E D;  1I94 L;  3E9H A;  1STB A;  2EY2 A;  1NY4 A;  1PTO B;  1QNU A;  2B2W C;  1PYB A;  3P1H A;  5FJ8 H;  1SND A;  4KI0 A;  4QMG A;  4ZK9 B;  5C3X A;  5KNB A;  2K04 A;  5KYI A;  1LTL A;  4DV6 L;  3IFT A;  5M5W B;  5C4H A;  3A56 A;  2UXC Q;  3NQI A;  3G71 A;  2JA8 B;  2QCP X;  2LFN A;  4A75 A;  2F1M A;  3EFX D;  3K0X A;  4DFA A;  4LF4 Q;  3KLW A;  4X6A H;  2EDG A;  4ZUJ A;  1QWY A;  3VDY A;  4HR7 B;  2EIF A;  3TN2 A;  4A76 A;  4LUO A;  1VQ8 A;  4I65 A;  3K59 A;  1DYQ A;  1VQG A;  3JAM c;  3PF4 A;  1QUQ B;  1J8I A;  5EJW A;  2ES2 A;  3UDF A;  3P75 A;  3OMG A;  4KHP L;  1T9H A;  3M85 A;  4HED A;  4DUZ Q;  2DJG C;  1TWH H;  1CUK A;  2K5W A;  1X56 A;  2D62 A;  3BDO A;  3OMC A;  4DA2 A;  4N9P A;  1EYG A;  4C3H H;  4YWK A;  1XNR Q;  1SEB D;  1WD1 A;  2MP1 A;  1VQM A;  2UU9 L;  4QL5 A;  3Q23 A;  4KJN A;  1IYJ B;  3GTO H;  2K5D A;  4DR4 Q;  1U5K A;  2VB3 X;  3V05 A;  4HSV A;  4JK1 C;  2VNU D;  1ASZ A;  2XWJ B;  1WD0 A;  1SMY C;  2ENB A;  2L15 A;  1I50 H;  2UUB L;  1JC7 A;  3DWP A;  1GUO A;  1BOS A;  4BXX G;  3CCR A;  1HQM C;  3P7J A;  1F2M A;  1XMO L;  3BZK A;  1JQY D;  1HZA A;  4CDD C;  5C3E H;  1FNV A;  5M3M G;  3D31 A;  4KD4 A;  2PZU A;  1ZXT A;  2AQ3 B;  3NBH B;  1Q8K A;  2X69 A;  3FHW A;  1HCZ A;  3EVQ A;  3MXU A;  5NUC A;  3H09 A;  3CCV A;  2R92 G;  2IT1 A;  4DR5 Q;  2IHF A;  3T1Y L;  4OHJ A;  1A63 A;  1TII D;  4B3T L;  3HP3 A;  2K33 A;  2RHS B;  4HID A;  4K6D A;  4HJ8 A;  1STH A;  2F0S A;  4P74 A;  1BKB A;  5FLM G;  4JCV E;  2R7Z B;  1AE3 A;  1WTO A;  1E2W A;  4OEL B;  1G2S A;  2LS0 1;  1SFO B;  1EZ8 A;  1EWC A;  4J15 A;  4A3L H;  1L2F A;  1G29 1;  2MJ8 A;  3I4L A;  2PI2 E;  4C3J H;  3CCQ A;  1EIG A;  1OXT A;  1TY0 A;  4B3M L;  1PH3 A;  1EY6 A;  5JEA G;  2JA7 B;  1AP0 A;  4RKL A;  1IHZ A;  2YYZ A;  1I6V C;  3OSO A;  2Z6K C;  5GAD C;  1EY0 A;  2JJQ A;  2JA8 H;  4AYB E;  4BS9 A;  1EIF A;  1DM0 B;  2L12 A;  4A93 H;  1K9M C;  4KV6 A;  4AYB B;  5IGD A;  4CJ2 C;  1N34 Q;  5M9O A;  2JN4 A;  3NEL A;  1KNE A;  3PO3 B;  3MXP A;  1NAP A;  2O2L D;  1M4V A;  2PQE A;  2F0J A;  4K14 A;  4JW0 A;  4DV4 L;  1I3Q H;  2NVQ B;  3GTK B;  1MJC A;  4JI6 Q;  5KGU A;  3DLL A;  1WYD A;  2Z1C A;  2RA4 A;  3A8J E;  4A3G G;  3S24 A;  3T13 A;  5IOD A;  3AFQ A;  3K7A H;  5M5X B;  4IPG A;  1FGU A;  2NVQ H;  1Q8I A;  1C9O A;  1LAC A;  1VDZ A;  5C0X I;  1SR3 A;  1KXL A;  1HZB A;  5IYB H;  2CWA A;  4JI2 Q;  3K5L A;  1SNM A;  4CHT B;  1RL2 A;  1VQ9 A;  1YJW A;  4DNR B;  2CCZ A;  3FKI H;  3NWT A;  4DNI A;  2KHJ A;  2MHV A;  4HIK A;  3IFD A;  4CDE C;  3HOX B;  1PZJ D;  5C4Z A;  3D0F A;  4P72 A;  4F7X A;  1F2L A;  2AUJ D;  4LFA Q;  1SDF A;  3RZD B;  2NVX H;  3GTG H;  2M00 A;  2BE5 C;  3WOE A;  1TR5 A;  1Q12 A;  3HOZ G;  4A3G B;  2JQO A;  2R7D A;  1EY9 A;  4DV6 Q;  4DR2 Q;  5JVH 3;  2RVL A;  2JA5 H;  1K83 B;  1BQQ T;  1ET9 A;  3RLO A;  1ZEQ X;  4NDX A;  4X65 Q;  3BDL A;  4C2M H;  5JJZ A;  1SFO H;  1VQ7 A;  3GQB A;  1DCZ A;  1PRT C;  5M5Y H;  1Q86 C;  1VQ5 A;  4Q5V A;  4JYA L;  2WB1 E;  4CDF C;  5C4X H;  1EQQ A;  5ELD A;  2F4I A;  1SNQ A;  5J22 A;  1G51 A;  3I55 A;  4J1M A;  2Q2H A;  1EOT A;  3IKJ A;  1EQR A;  4DK6 C;  1NE3 A;  3TBI B;  2RHQ B;  3R3O A;  2E2D C;  1W3S A;  2R93 B;  3SDZ A;  1Q90 A;  2B8G A;  2OCE A;  5IYC G;  4A3G H;  1LUZ A;  2SEB D;  3VR6 A;  1DOL A;  1RTO A;  2EYH A;  3D6W A;  1IW7 C;  1NR4 A;  2OWO A;  1CQV A;  1D2B A;  1X32 A;  3I4N B;  3JAM i;  3HOX H;  3MC0 B;  4K5X A;  1I50 B;  1O7Y A;  2ALY B;  4CBV A;  5EKI A;  2JA6 B;  5FO7 B;  4GN4 B;  1O78 A;  2IY5 B;  4PMC A;  3PIP 3;  3EIV A;  4DV3 Q;  3GTP H;  2FHT A;  1JJC B;  3HOW G;  3K0Y A;  3NTI A;  1SE2 A;  2FIN B;  5ELO A;  5KRU A;  2PZT A;  4TQU S;  1LV9 A;  2EY1 A;  1FJG Q;  1O7L A;  1HTL D;  3OYY A;  5CC4 A;  3FDT A;  1X65 A;  2B8F A;  3VA5 A;  1ESR A;  2LXK A;  1WFQ A;  4DV0 L;  5K5P A;  1YJ9 A;  4EGV A;  4X62 Q;  3HOU G;  5K36 G;  3QB3 A;  4O0A A;  1V8Q A;  4L63 B;  3R2T A;  1UEA B;  4DPG A;  2R6G A;  3A54 A;  2RDH A;  2BCO A;  4XQN A;  2A1A A;  1I6H B;  2HDL A;  5CV6 A;  1KHI A;  1PH7 A;  4HMJ A;  1Y69 U;  4OON A;  3ONA B;  1PZI D;  1MHW C;  3D4W A;  4ME5 A;  1KRT A;  4OIK A;  4JYA Q;  2RKS A;  2AKW B;  3TRE A;  1PH4 A;  1NMG A;  5I4D A;  4ABN A;  3VR4 A;  5C3E G;  1XNQ Q;  5IP9 H;  5C4J H;  1LTS D;  4AYB G;  3KDF A;  4RGN A;  5I2Y A;  3SEB A;  2EZV A;  1F9S A;  4X64 L;  1XWE A;  3AFP A;  1I6H H;  4Y7N H;  4JI7 L;  4A3M H;  4DR6 L;  1CZG A;  1EEF D;  2NB0 A;  2NWG A;  1YEZ A;  3RLN A;  1HR0 W;  3MTS A;  2BH2 A;  3J81 E;  5CV7 A;  1TKW B;  1SRU A;  3PGZ A;  3I72 A;  2RDF A;  1I4G A;  3L9A X;  3RUZ A;  1K8A C;  3VYU A;  5C0X J;  1VQB A;  1SJE D;  1J9O A;  1ENC A;  1A15 A;  2JA8 G;  4DV2 L;  4CKB A;  4RHS A;  4Z9C B;  4LJZ C;  3T1H Q;  5C3E B;  1SRO A;  3NBH A;  2E2J H;  2IL8 A;  2K50 A;  1SYC A;  4LF4 L;  4BBS G;  1I4X A;  2WAC A;  2J7Z A;  3L2P A;  1VQH A;  2JA6 H;  3ULP A;  3QR8 A;  4EQO A;  1W2B A;  1A3U A;  1SAP A;  2A5H A;  4B3R L;  3IRB A;  1B50 A;  4WJ3 M;  3HFZ B;  4M8A A;  3SK4 A;  1ZKO A;  1JJG A;  2VQF Q;  2ID0 A;  4K0K L;  5IWA L;  1HJP A;  5C5L A;  3PUZ A;  1HR0 Q;  2R93 H;  2IWH A;  2F03 A;  2B2V A;  1KDA A;  4A3B G;  3EN2 A;  2A6H D;  2ZTE A;  1G6P A;  4QF4 A;  1LTI D;  4DAV A;  2HIV A;  4DR3 Q;  4C3H B;  3U9O A;  3I90 A;  2B2Y A;  5AJ3 Q;  4FO2 A;  3CCS A;  1KD1 C;  1GUG A;  1RJT A;  1F2Z A;  4RH6 A;  3F2C A;  2EJF C;  3HOV H;  1JOO A;  4LNQ A;  4FYD A;  4PQX A;  1VQI A;  2GVB A;  4WOR A;  2C35 B;  4HTH A;  4JOI A;  2L11 A;  1K83 H;  1LT4 D;  2UXD L;  1HNW L;  2A8V A;  5BN3 A;  4FXK C;  1X3P A;  5GQO A;  2PNR C;  4NMZ A;  4O2D A;  1D1I A;  2I5L X;  3VR5 A;  3A5U A;  2KCC A;  5C5M A;  1EFI D;  4IPH A;  3W2D A;  4A3E B;  4FNF A;  4DR7 L;  2ASB A;  1ZYR D;  4DK1 A;  5CV5 A;  2UUC L;  3MZ5 A;  4DU9 A;  3CP0 A;  2PMZ B;  1UNS A;  1E22 A;  1X9N A;  3MFG A;  1VQF A;  2L55 A;  1RHP A;  3J81 L;  1O80 A;  1Y14 B;  3U58 A;  3D4D A;  1VQJ A;  1TWA B;  5JJL A;  1BDO A;  2AWO A;  1HZ9 A;  4FF1 A;  1QB5 D;  4GLX A;  4HIM A;  1KAW A;  3BG3 A;  1JWM D;  1MIU A;  4LW1 A;  3SGI A;  2I0Q A;  1SE3 A;  1TS2 A;  2VQF L;  1I4R A;  2JE6 I;  1PYW D;  3PO3 H;  5FJ8 G;  1SMX A;  1HR0 L;  1VF7 A;  4RHR A;  4XQJ A;  1Y1W G;  4IUT A;  4A3D G;  2D2C C;  3DWA A;  3HGB A;  3M4P A;  3HOV G;  2IPK D;  4DV5 L;  1D5Z C;  1PTO C;  5E3F A;  1DOM A;  4R8N A;  4KHP Q;  3N6R A;  1HZC A;  3ICE A;  1ROD A;  4A3J H;  1A3T A;  4RGO S;  3CCM A;  1XMQ L;  4KN7 C;  2PQA B;  2X6L A;  4B3S L;  4IPC A;  4PNY A;  2JSO A;  5C0X G;  3F1Z A;  1FNU A;  1JE5 A;  2N55 A;  4GOP C;  2K03 A;  4YHH Q;  5M5Y B;  1I4P A;  2F0I A;  1KIX A;  1A2T A;  4JBK A;  3W3A A;  5K36 H;  3K5N A;  5FK9 C;  3HZX A;  2JA5 G;  2B2V C;  4U68 A;  4QJF A;  2C9O A;  4YY3 Q;  3BVG A;  2IHE A;  1WCM B;  4BY7 H;  1DGS A;  1A2U A;  1UE6 A;  3SE0 A;  2E5L L;  3RZD H;  3KK7 A;  5DAU A;  4BBS B;  3HKS A;  1ET6 A;  1QVF A;  4FF2 A;  4F8M A;  2R3Z A;  1SE8 A;  4B08 A;  1K8M A;  2A19 A;  1MSG A;  4BY1 G;  3S1Q B;  2HCC A;  2XSC A;  2WV6 D;  1U4R A;  5JPM C;  2VXW A;  3KUP A;  4XXE A;  1PHJ A;  4DAY B;  1RDP D;  3CRL C;  2E76 C;  4XT1 B;  2B2U C;  1TS5 A;  1WTV A;  4JI3 Q;  2UXB Q;  3K8A A;  3K7A B;  5M5X H;  4R4Q A;  2EYO A;  1WCM G;  4QGU A;  1Q81 C;  3GTK H;  2AQ1 B;  1FYC A;  2O5J C;  2PW7 A;  2KJX A;  1YJN A;  3P20 A;  3TP5 A;  2Q2U A;  2ZJP A;  2VQE Q;  2R92 B;  4LF9 L;  3MXN B;  2WB1 G;  4Y7N B;  1BXT A;  4YCV A;  3TS0 A;  4NW2 A;  1XXG A;  1CFM A;  3L7Z C;  3PV0 A;  1ENF A;  1JR0 D;  2DY7 A;  4B3S Q;  3U4Z A;  5C4J B;  5C44 G;  5KIX A;  4PZ8 A;  1KAB A;  4KJO A;  2C5C A;  1JB7 A;  3RLF A;  1WTX A;  2EYF A;  1IKL A;  2D9U A;  2VZA A;  1Y8O B;  3I4M G;  4NP5 A;  3MXN A;  3TRZ A;  2CW0 D;  4MHE A;  1KL9 A;  2PPB C;  4LK1 C;  4C3J B;  4XDX A;  3F2U A;  3BU2 A;  3SK5 A;  1PRT D;  1HNZ L;  4DV0 Q;  4IO9 A;  1D5X C;  1EYA A;  1GUW A;  2R7Z H;  3I4M H;  4GKJ Q;  1EYD A;  5IYD G;  3S2H H;  4JI4 Q;  1KTK A;  2Y0S B;  3OW7 A;  5EPJ A;  3DUZ A;  4APV A;  3K57 A;  1CSQ A;  2H1E A;  3S14 B;  4CJ1 B;  1QOH A;  5BN4 A;  3QG1 A;  1Q82 C;  4ZAI A;  4A3J G;  4JI1 Q;  3CC4 A;  2IX0 A;  1QG7 A;  1F9R A;  4IPD A;  2TSS A;  3PO2 B;  2H5X A;  1ONL A;  3BVM A;  4C3J G;  2UXB L;  5DM6 3;  4A3I H;  2HDM A;  2N88 A;  4JI0 L; 
#chains in the Genus database with same CATH homology
 1PV4 A;  1PH1 A;  4R4C A;  3CQZ H;  1RL2 A;  5GAH C;  1VQ9 A;  5JEA J;  3UDI A;  1YJW A;  2CCZ A;  4L5Q A;  3FKI H;  3NEM A;  4JI5 L;  3CPF A;  4IFD J;  4DNI A;  4KHZ A;  4NXM Q;  1QUQ A;  2JK8 A;  2KHJ A;  4HIK A;  4AQY L;  4IFD I;  4A3F H;  2MQH A;  3H3V H;  3D0F A;  4KLK A;  4P72 A;  1VQN A;  4JI2 L;  2JEB I;  4LFA Q;  4DR3 L;  1YHA A;  2NVY H;  4EX5 A;  2WAQ E;  3PUW A;  4BA1 I;  2NVX H;  3GTG H;  3S15 H;  2F3I A;  3CMA A;  1Q12 A;  2B63 G;  3HOZ G;  4DR1 Q;  1VQ6 A;  2JQO A;  4DV3 L;  2R7D A;  2ZTD A;  4BBR G;  5BR8 L;  4OO1 G;  1EFW A;  2UUB Q;  2AHO B;  4DV6 Q;  4DR2 Q;  3KJP A;  2F52 A;  4XTC S;  2JA5 H;  4JOI C;  4LF7 Q;  5IE8 A;  5GAE C;  3RLO A;  1VQL A;  3S17 H;  4A3F G;  4X65 Q;  1VS0 A;  4Y52 H;  4C2M H;  3Q8D A;  2K5N A;  4UP9 A;  1SFO H;  1VQ7 A;  3M7N A;  2KBN A;  2AMC B;  4DV5 Q;  3DM3 A;  5M5Y H;  3GTQ H;  3GTM H;  1Q86 C;  1VQ5 A;  4OX9 L;  1A0I A;  2ZTC A;  4R4T A;  4JYA L;  2WB1 E;  1Q1E A;  5C4X H;  4DR2 L;  1VQP A;  1EQQ A;  4K0K L;  4GOP A;  1YI2 A;  4NB3 A;  4EQ5 A;  5C4X G;  1OXS C;  1TWF H;  1G51 A;  3I55 A;  4YCU A;  2KHI A;  3M4O H;  4UP7 A;  1L0W A;  2Q2H A;  5FLM H;  1EQR A;  1UE5 A;  1NE3 A;  4DK6 C;  2EQS A;  1VQD A;  2RHQ B;  3RNU A;  2HHH Q;  1W3S A;  2OTJ A;  3GTL H;  2OCE A;  5IYC G;  1D8L A;  1UEB A;  3J80 c;  4A3G H;  1LUZ A;  4IOC A;  1XMO Q;  2YTY A;  4UY8 C;  3JC6 6;  2UXC L;  1MJE A;  4JI8 L;  1CKN B;  1X55 A;  3TEH B;  2OWO A;  1EOV A;  2UUA L;  1YVC A;  3JAM i;  2VS1 A;  3HOX H;  4JBW A;  4MZ9 A;  5M5W H;  1Y1V H;  2ALY B;  5M3M H;  1C7Y A;  1YBY A;  1J5E Q;  4GN4 B;  2ZM6 L;  4OWW B;  2E5L Q;  1VQE A;  2IY5 B;  3T1Y Q;  1IBK L;  3AQQ A;  3S1R H;  3EIV A;  2WFW A;  4DV3 Q;  3GTP H;  2GN5 A;  1JJC B;  4PMW A;  4BXX H;  3HOW G;  4BBS H;  1E1T A;  5ELO A;  4DKA C;  4MTN A;  4TQU S;  4X64 Q;  1B8A A;  3CC2 A;  1FJG Q;  1NBW A;  3OYY A;  2NVT H;  1MKH A;  3PO2 H;  1X65 A;  2ZJQ A;  2LXK A;  1WFQ A;  4DV0 L;  1X3F A;  1YJ9 A;  3TS2 A;  1TWA H;  4LF8 L;  2BH8 A;  4X62 Q;  3H3V I;  3HOU G;  5K36 G;  3CAM A;  4O0A A;  1PH2 A;  3UE1 A;  2HIX A;  3PSI A;  1YHQ A;  4YHH L;  4LF6 L;  2YV5 A;  2Y0S E;  4DPG A;  2R6G A;  3J80 i;  3GO5 A;  3AEV A;  2Y0S G;  2R93 G;  1D7Q A;  3S1M H;  1VQO A;  1NJI C;  3PUY A;  3B6Y A;  2A1A A;  2R7F A;  5IP7 H;  2V1C C;  4DV4 Q;  4HJA A;  4LF8 Q;  2YTX A;  3GD7 A;  4DV7 Q;  3TQY A;  4GLA C;  4RMF A;  1XJV A;  4NXN Q;  1JMC A;  3W5O A;  3I7F A;  2K52 A;  3KF6 A;  1KHI A;  4LWC A;  1R9T H;  1PH7 A;  3HOY G;  2AWN A;  3PF5 A;  4A3C G;  2CFM A;  2PI2 A;  4A3E H;  3NEN A;  4OON A;  1PA6 A;  1IBL Q;  2N3S A;  1PH6 A;  1KRT A;  4RG1 A;  2VQE L;  1L1O A;  1OXX K;  4JYA Q;  5E7N A;  4POG A;  1NMF A;  4DUZ L;  2AKW B;  3I4O A;  2VL6 A;  3TRE A;  4OWX B;  1PH4 A;  1K3R A;  1NMG A;  2MO0 A;  4OO1 I;  4PZ7 A;  1M90 C;  3KFU A;  1CKO A;  3STB C;  2K75 A;  4A3I G;  2R7Z G;  3PIP A;  3FP9 A;  5C3E G;  5IP9 H;  1XNQ Q;  3ULJ A;  5C4J H;  4JI3 L;  3H0G H;  2KEN A;  4DUY Q;  4AYB G;  2F4V L;  3KDF A;  3ZJY C;  1SN8 A;  1HH2 P;  3ER0 A;  3CME A;  2Q2I A;  3F2D A;  4LFA L;  3FKI G;  1X3E A;  3MEF A;  4X64 L;  3S16 H;  3AFP A;  1I6H H;  4Y7N H;  4H02 A;  1UE1 A;  5C44 H;  4DR5 L;  4A3M H;  4JI7 L;  1PVO A;  1L1O B;  1GKH A;  4DR6 L;  3F8T A;  4GNX B;  2RF4 A;  5J3B A;  4YCW A;  5IYB G;  4LF9 Q;  4GKK L;  1YEZ A;  1YIJ A;  3RLN A;  1VQA A;  1HR0 W;  3PIO A;  2VUM G;  2NN6 G;  2BH2 A;  4PZ6 A;  1QZH A;  3H0G G;  4A3E G;  5H1S E;  1S40 A;  1BBW A;  3HKZ E;  4GLV B;  1SRU A;  3PGZ A;  4BY7 G;  1RIP A;  4HJ7 A;  1PFS A;  1K8A C;  5C0X J;  4GKJ L;  4JBM A;  1VQB A;  4DV7 L;  1HNW Q;  4GNX A;  1YIT A;  2JA8 G;  4DV2 L;  3F2B A;  4HIO A;  4XIG S;  3T1H Q;  1SRO A;  2E2J H;  4A4I A;  2K50 A;  3G4S A;  4LF4 L;  3HOW H;  4BBS G;  4MNO A;  5IYC H;  4LFB L;  2QEX A;  3RR5 A;  3L2P A;  1VQH A;  1N33 Q;  4JV5 L;  2JA6 H;  4A3B H;  4K0K Q;  4PG3 A;  4LFC L;  3ULP A;  3S2D H;  1W2B A;  1XNR L;  1KXL A;  3S1Q H;  3L0O A;  1VCI A;  4P71 A;  4GNX C;  3CXC A;  4B3R L;  2WAQ G;  3IRB A;  4DR4 L;  5HGQ A;  3PO3 G;  4DR7 Q;  4IFD G;  4A3K G;  4WJ3 M;  3EBE A;  3HFZ B;  1WJJ A;  5HY6 A;  1JJG A;  1SLJ A;  1GD7 A;  4AIM A;  1S3O A;  2VQF Q;  1E7Z A;  2ID0 A;  2D0O A;  4TVA B;  5IWA L;  1HJP A;  5AJ3 L;  2VW9 A;  4LF5 L;  1U0L A;  1BBU A;  3PUZ A;  4JI5 Q;  2CKZ B;  2QA4 A;  1HR0 Q;  3I4N G;  2R93 H;  2WP8 J;  4AH6 A;  2Z0S A;  1X54 A;  2JA6 G;  4A3B G;  4C3I H;  3EN2 A;  2ZTE A;  1G6P A;  3K80 C;  5LMU L;  3J81 c;  5IY0 A;  2HIV A;  1B70 B;  4DR3 Q;  4R4I A;  1B7Y B;  2OQ0 A;  1EIY B;  5IWA Q;  5AJ3 Q;  1EUJ A;  4LF5 Q;  3CCS A;  1KD1 C;  4A3K H;  3J81 j;  1N32 L;  3BJU A;  2RCN A;  4B3M Q;  1Q7Y C;  1E3P A;  1E24 A;  2I5M X;  3RN5 A;  1K0R A;  2DGY A;  4LUZ A;  2CWP A;  3F2C A;  4JI8 Q;  3HOV H;  4LNQ A;  3U4V A;  3J81 i;  1VQI A;  2GVB A;  4JI0 L;  2LXJ A;  2C35 B;  2F4V Q;  4JOI A;  4LUV A;  1K83 H;  2NZO A;  5BR8 Q;  2UXD L;  1OXU A;  2Z6K A;  3A0J A;  2A8V A;  3HOX G;  1HNW L;  4HJ9 A;  1KC8 C;  5IT9 c;  5IP9 G;  5JJI A;  4B3T Q;  3KOJ A;  1QVG A;  4JG2 A;  5GQO A;  3CCU A;  4O2D A;  1WOC A;  2I5L X;  1LYL A;  3A5U A;  4A3L G;  2N8N A;  1LM0 A;  3CCE A;  4BA2 I;  3PUX A;  4IPH A;  1K8G A;  3OTO L;  2KCM A;  3ERS X;  4GN3 B;  4L5T A;  1UE7 A;  4FDB A;  2ZJR A;  1HNX Q;  4GN5 A;  2ASB A;  4DR7 L;  4QIW E;  1OXV A;  3GDE A;  4L5S A;  1E1O A;  2UUC L;  4L5R C;  1FVI A;  4OXP A;  3I56 A;  3CP0 A;  1OTC A;  2LSS A;  1E22 A;  1VQ4 A;  4JI1 L;  1X9N A;  1CSP A;  4DK3 C;  1VQF A;  4DR1 L;  3CCL A;  1HNX L;  1GM5 A;  2D0P A;  1NTG A;  2I5H A;  3HKZ G;  1AE2 A;  1QVC A;  1QZG A;  4WJ4 A;  1GO3 E;  1Y14 B;  2MFI A;  1IXR A;  3U58 A;  1O7I A;  1VQJ A;  5EAY A;  3E9I A;  5GAG C;  1IBM Q;  1N33 L;  5JJL A;  1PH9 A;  2AWO A;  1HZ9 A;  4UP8 A;  1BVS A;  4IJL A;  1HNZ Q;  1N32 Q;  3U50 C;  3KF6 B;  4DV1 Q;  4GLX A;  4NXM L;  4HIM A;  1XPU A;  1KAW A;  2EXD A;  1MIU A;  1IZ6 A;  4AQY Q;  1J5E L;  3S14 H;  3W1G A;  4LW1 A;  1N34 L;  3SGI A;  2CQO A;  4JI7 Q;  2I0Q A;  1N9W A;  2HT1 A;  2E8G A;  3CC7 A;  2IX1 A;  2VQF L;  1YHB A;  2JE6 I;  5IYD H;  1I94 L;  1FJG L;  2PNH A;  3E9H A;  3PO3 H;  5FJ8 G;  3LGJ A;  1SMX A;  1NY4 A;  1HR0 L;  5LMN L;  2MO1 A;  4A3D H;  4YY3 L;  2UU9 Q;  1PYB A;  1TWC H;  5FJ8 H;  1XTD A;  4KI0 A;  1Y1W G;  4A3D G;  2ATW A;  1VQC A;  1UWV A;  4JI6 L;  3STB D;  1LTL A;  4DV6 L;  1XNQ L;  3I4N H;  2N49 A;  3M4P A;  3HOV G;  2UXC Q;  3G71 A;  1XPO A;  3S1N H;  3WWV A;  1IL2 A;  4DV5 L;  4POF A;  4A75 A;  3K0X A;  4X65 L;  3CW2 C;  2GVA A;  1P8L A;  3KLW A;  3PCO B;  4LF4 Q;  4X6A H;  4QY7 A;  1Y1W H;  4KHP Q;  3VDY A;  3GTJ H;  4GKK Q;  1Z9F A;  1HZC A;  2EIF A;  4LUO A;  4A76 A;  4A3J H;  1VQ8 A;  4NXN L;  3ICE A;  3CCM A;  3H15 A;  1XMQ L;  2VUM H;  1V1Q A;  3A5Z B;  1VQG A;  3JAM c;  2PQA B;  4B3S L;  5LMN W;  3PF4 A;  1QUQ B;  4IPC A;  2K5V A;  1N36 L;  2ES2 A;  3UDF A;  1YNX A;  4X62 L;  5C0X G;  1T9H A;  2JEA I;  4KHP L;  4QQB X;  4X66 L;  2K5H A;  3F1Z A;  3M85 A;  5JJK A;  1JE5 A;  4GOP C;  4YHH Q;  4DUZ Q;  1EWI A;  3KYH C;  1TWH H;  2E2H H;  1KIX A;  1CUK A;  1X3G A;  1X56 A;  2D62 A;  4JBJ A;  4JBK A;  3J7A 5;  2BA1 A;  2JA7 G;  3E0E A;  2R92 H;  1EYG A;  2N78 A;  3ULL A;  2JA5 G;  4YWM A;  4C3H H;  4YWK A;  1I94 Q;  1XNR Q;  2ZM6 Q;  4QJF A;  1A8V A;  3G48 A;  1GVP A;  4R4O A;  4QL5 A;  4YY3 Q;  2IHE A;  1VQM A;  2UU9 L;  3GTO H;  1IYJ B;  4DR6 Q;  4DR4 Q;  1U5K A;  4BY7 H;  1KRS A;  4A3C H;  1DGS A;  1UE6 A;  2XGT A;  2JA9 A;  5M3F H;  2E5L L;  3RZD H;  1XPR A;  1H95 A;  3CD6 A;  1IBK Q;  2VNU D;  3HKS A;  1ASZ A;  1QVF A;  4P73 A;  1C0A A;  4DV1 L;  3G6E A;  1SE8 A;  2A19 A;  2L15 A;  4BY1 G;  1M1K C;  2KCT A;  2NZH A;  3UDG A;  2OTL A;  1I50 H;  2UUB L;  1PH5 A;  5IP7 G;  4BXX G;  4LF6 Q;  3HOZ H;  3CCR A;  1PHJ A;  4LF7 L;  1Q1B A;  4DAY B;  2YU9 H;  1N8R C;  1CKN A;  1XMO L;  3K7U C;  3OTO Q;  2MNA A;  1S72 A;  1X6O A;  4ME3 A;  3BZK A;  1XMQ Q;  1HZA A;  5C3E H;  1JJ2 A;  3HOY H;  5M3M G;  3D31 A;  1K73 C;  4JI3 Q;  2UXB Q;  1KQS A;  3K8A A;  5M5X H;  1ASY A;  3HOU H;  2BA0 A;  3OW2 A;  4BBR H;  4GOP B;  3NBH B;  1Z47 A;  1Q8K A;  1WCM H;  3FHW A;  4R4Q A;  5FLX c;  1AH9 A;  1YZ6 A;  1Q46 A;  1WCM G;  4DAM A;  4QGU A;  1V43 A;  3CCV A;  1Q81 C;  2R92 G;  2IT1 A;  3W1B A;  1IBL L;  4DR5 Q;  3GTK H;  4R1J A;  2IHF A;  3T1Y L;  1A63 A;  1JT8 A;  1YJN A;  2QGQ A;  2Q2U A;  4B3T L;  2ZJP A;  2VQE Q;  2RHS B;  4LF9 L;  3MXN B;  4HID A;  2K4K A;  2WB1 G;  4HJ8 A;  4GS3 A;  4YCV A;  4P74 A;  3TS0 A;  1BKB A;  5FLM G;  4JCV E;  1AE3 A;  5M3F G;  4ALP A;  3K81 C;  4DV2 Q;  3L7Z C;  1TWG H;  2K14 A;  3PV0 A;  3T1H L;  1FL0 A;  4J15 A;  3PUV A;  2E2I H;  4B3S Q;  2PMZ E;  3U4Z A;  4DUY L;  2PQA A;  5C44 G;  3M3Y H;  4A3L H;  1L2F A;  4PZ8 A;  4A93 G;  1G29 1;  4YWL A;  2UUC Q;  2PI2 E;  1JB7 A;  3RLF A;  4C3J H;  4LFC Q;  2JA7 H;  3CCQ A;  2VZA A;  1OXT A;  5DLQ E;  5LMN Q;  3RN2 A;  3I4M G;  4B3M L;  1PH3 A;  5JEA G;  2UUA Q;  4B3R Q;  3CPW A;  3TRZ A;  4JC0 A;  1Y1V G;  4JV5 Q;  1L1O C;  4OX9 Q;  1CKM A;  2YYZ A;  1KL9 A;  2Z6K C;  3CCJ A;  1IBM L;  3M9B A;  4A3M G;  5GRO A;  3J7Z C;  5GAD C;  3UDX A;  4HJ5 A;  2JJQ A;  3BU2 A;  4JI4 L;  2JA8 H;  1V9P A;  4AYB E;  1EIF A;  1HNZ L;  4BY1 H;  4A93 H;  1WI5 A;  3UE0 A;  1K9M C;  4DV0 Q;  3CF5 A;  4IO9 A;  2YTV A;  1N34 Q;  2HHH L;  5LMU Q;  3I2Z A;  4IJH A;  1TXY A;  3KJO A;  2R7Z H;  1PH8 A;  3I4M H;  3BZC A;  3NEL A;  4GKJ Q;  4NPS A;  5IYD G;  3S2H H;  2B29 A;  4JI4 Q;  4OWT B;  1A62 A;  4APV A;  4LFB Q;  3KDF B;  1VQK A;  4DV4 L;  2B63 H;  1CSQ A;  1I3Q H;  3KF8 B;  2OQK A;  4UPA A;  1MJC A;  4JI6 Q;  1N36 Q;  4IOA A;  3DLL A;  1WYD A;  3RZO H;  4JI0 Q;  4A3G G;  1Q82 C;  3S24 A;  4A3J G;  4JI1 Q;  3CC4 A;  2IX0 A;  2HQL A;  4X66 Q;  2DUD A;  2XTI A;  3AFQ A;  4IPD A;  2UXD Q;  3K7A H;  4IPG A;  1FGU A;  2NVQ H;  2H5X A;  1J6Q A;  2Q2T A;  1C9O A;  2VY3 A;  3A74 A;  2FXQ A;  5C0X I;  3M4Q A;  1SR3 A;  2UXB L;  1HZB A;  5IYB H;  4A3I H;  1P16 A;  3AYH B;  2CWA A;  4P75 A;  1I5F A;  2B3G A;  2NN6 I;  5ELN A;  3PO2 G;  4JI2 Q;  1PYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...