4JYAL

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jyaL00
5IT9c 4K0KL 1VQ5A 2IY5B 1EOVA 4L5TA 1HNXL 3RN2A 4A3KH 3A0JA 3PIPA 2HQLA 4B3SL 4KHPQ 2WB1E 3T1YQ 4GN4B 2K4KA 2WAQG 3PV0A 1K73C 3K7AH 2JA7H 3OW2A 4JI5L 4APVA 3HOXG 1V1QA 4P71A 4A3GG 4A93H 4JYAL 1X3FA 1E7ZA 3ZJYC 1EYGA 4P73A 1Q8KA 1VQAA 1MIUA 4C3IH 5AJ3L 3KJPA 1EQQA 4LF5Q 2E2JH 4IFDG 4WJ3M 1NMGA 3MEFA 1Z47A 1XMQQ 4R4QA 5FJ8H 5IE8A 1I94Q 4A3JG 1FJGL 3CC7A 4IPDA 1J5EQ 5IP9H 2K5HA 1VQ8A 4ME3A 1UWVA 5GAHC 3JAMc 3CCEA 3S1NH 2BH8A 4LWCA 2YTYA 2Z6KC 3RZDH 1XPRA 1PH7A 4BA2I 2D0PA 3S1RH 3GDEA 4R4OA 1VQ4A 2AHOB 4LF7L 1NMFA 4DV5Q 1XMOL 1E1OA 1I6HH 4BY1G 1K9MC 2YYZA 3K7UC 1UE7A 5C4XG 2IT1A 3G48A 1Q81C 3LGJA 2VQFL 3KYHC 1PVOA 3PUVA 4LF6Q 1VQMA 4FDBA 5C3EH 1X3EA 2JA9A 4KHPL 1LUZA 1XPOA 2PNHA 4DAMA 3KF8B 2R92H 1KC8C 3J7A5 2VUMH 1UE1A 3BU2A 1V9PA 3PUZA 4IPCA 4PZ6A 4R4TA 4R4IA 1CKMA 3CMEA 1HNZQ 4C2MH 4UP8A 2YU9H 2N49A 4A3BG 4YCWA 1SN8A 1XNQQ 1FGUA 3RZOH 1YEZA 3PO2H 4JOIA 3KLWA 2PQAB 1XJVA 4NXMQ 5C4JH 2RHSB 3E9HA 3PF5A 3PUYA 4OWWB 3HOVH 4GKKL 1B7YB 4IJHA 1I94L 1VQ6A 4LFBQ 4DUYQ 3SGIA 4OONA 2AKWB 4JI6Q 1PH9A 1D8LA 4IFDI 4IO9A 1Q7YC 1JT8A 1IYJB 5JEAG 5C3EG 2HIVA 1WCMH 4JCVE 4OXPA 1X55A 2KHIA 2PI2A 2UUAQ 3GTGH 4JI4Q 3UDFA 3CCLA 2FXQA 2R92G 1UEBA 2JA8H 5IYDH 4GNXA 1HH2P 1YBYA 2DGYA 1VS0A 2F3IA 1SFOH 1NY4A 1LYLA 2OQ0A 1W2BA 5IY0A 1OXSC 2Z0SA 2B3GA 3CCVA 1PYBA 3PO2G 1KHIA 1QUQA 1C9OA 3ULPA 4R4CA 4JBWA 4LF6L 2VL6A 4DR5L 3S17H 4POFA 3E9IA 1KD1C 3HOVG 1HNXQ 3RNUA 2Y0SG 4EX5A 1Q82C 2UXCL 1I50H 1K8AC 2OTLA 1AE2A 1HNZL 4GOPA 4UP9A 3K81C 4QY7A 4X6AH 4KLKA 5EAYA 2LXJA 1SRUA 1YNXA 4IPGA 4JI1L 1VQLA 5M5YH 3A5ZB 2KBNA 2LXKA 1B70B 4NXML 4JYAQ 3M7NA 1OXVA 3UDIA 2E5LL 4PZ7A 3UDXA 5IYDG 5AJ3Q 3KF6A 2CQOA 2XTIA 3W1GA 1EIYB 1BKBA 5M3MH 3D0FA 4HIOA 2JA8G 2R7ZG 3S15H 4LFBL 4DUYL 1Y1VH 1YZ6A 2R7FA 2EXDA 2Z6KA 4BBSH 1KRSA 4LF8Q 2ZTCA 3HOXH 4OWTB 3HKZE 4QIWE 1K3RA 2BH2A 1KIXA 1CKOA 1FVIA 4QJFA 3TS2A 3JAMi 4L5SA 3CPFA 4L5QA 2UUAL 2CWPA 3TRZA 1S3OA 4JBKA 1VQFA 4B3MQ 4GNXC 2IHEA 1XMOQ 2I5MX 4A3FH 4JI7Q 3PUWA 4A3JH 1YJWA 1P8LA 3J81i 3HKZG 3HOWH 1YJ9A 2QGQA 3WWVA 2JJQA 3CCSA 5DLQE 3NEMA 1IL2A 2UXBL 1Z9FA 2ALYB 2XGTA 5M3MG 2QA4A 1M90C 1N32Q 1SMXA 2GN5A 4AYBG 3STBC 1Y1VG 4BY1H 2ATWA 4XTCS 3PO3G 3OTOQ 4LUVA 1JJCB 4GNXB 5C4XH 2E2HH 4BBSG 2K75A 4KHZA 3U4ZA 1QZGA 1ASZA 3TS0A 3BJUA 1QUQB 3H3VI 2WB1G 1K83H 4DV0Q 1QVGA 1N32L 5JJLA 4GKKQ 1CUKA 4OX9L 1T9HA 3CCUA 5LMNQ 4A3FG 1EQRA 1X56A 3RLFA 4A3BH 4GN3B 4A4IA 2VQEQ 4GOPB 2QEXA 1VQJA 4LF8L 3HOWG 2VZAA 3S2HH 3KJOA 3KOJA 3UE1A 1L1OC 1YHBA 2D0OA 3RN5A 4DR4Q 4BA1I 4B3ML 1VQBA 2VY3A 3AFQA 5K36G 2MO0A 1YI2A 4JI7L 3KF6B 3J81c 2H5XA 4LF9L 4YWMA 1XTDA 1EIFA 4P74A 3CXCA 1M1KC 4JBMA 3UDGA 4JV5Q 3HOYH 1PH6A 3M4QA 4DV6L 1VQGA 5M5XH 3H15A 4DR5Q 1WI5A 4POGA 3OYYA 2UXCQ 1LTLA 4DK6C 1IXRA 3G4SA 4NXNQ 1UE5A 3EBEA 2HHHL 1SE8A 4UPAA 4H02A 1PH3A 4QGUA 3GD7A 3I7FA 4LW1A 3OTOL 4JC0A 1I5FA 4A3MH 1CSPA 2KENA 4HJ8A 4LF4Q 4YHHQ 3AYHB 3K8AA 3HOZG 1OXTA 3KDFB 3HKSA 2B63G 2MFIA 3M4PA 1C7YA 4BY7H 2A1AA 4DR7Q 4DV0L 1CKNA 1HR0W 2E5LQ 2IX0A 1GM5A 4R1JA 4HJ9A 3ERSX 3ULLA 5H1SE 2NN6G 5LMNL 2IX1A 1I3QH 3H3VH 3A74A 1JB7A 2NVYH 3I4OA 4LUZA 2ZM6L 3PF4A 4NPSA 2VQEL 2HT1A 2JK8A 5C0XJ 1N8RC 1MJEA 3M85A 3ULJA 4IOCA 2BA1A 3H0GG 4GLAC 1HR0Q 3E0EA 2NZOA 3HOYG 1GVPA 1WOCA 2ZJQA 1HZCA 2K14A 4A3EH 3K0XA 4A3LH 1X65A 4DR4L 1YHQA 3GTKH 4JI8Q 4LNQA 1QVFA 4X65L 1J6QA 3CCQA 2R7ZH 3HOUH 2PMZE 4A3MG 4QQBX 3RLOA 3S1QH 1Q12A 3DM3A 1TWAH 5IYCG 4X64L 3GTQH 3ER0A 4YWKA 5GAEC 4JV5L 1VQOA 4JI3Q 1Q1EA 4JI0L 4BY7G 3FHWA 4MNOA 1KL9A 2L15A 1SLJA 3S2DH 4NXNL 4DUZQ 2UXBQ 1NTGA 1VQDA 2OQKA 4DV2L 1VQNA 3Q8DA 1GO3E 2I0QA 2KCTA 2JQOA 1YJNA 3U4VA 1VQKA 4LF4L 4YHHL 1EWIA 3CQZH 2ZJRA 5C44H 1N33Q 3FP9A 1E1TA 2R93H 2GVAA 2MQHA 1VQPA 1QZHA 1G51A 2GVBA 2CWAA 4DR7L 4JI2Q 3TREA 1KXLA 4A3EG 1PHJA 5GROA 4A3LG 1TWGH 3F2CA 1VQEA 1TXYA 3HOUG 4UY8C 2F4VL 4OX9Q 2UUBL 4JG2A 1G6PA 5E7NA 2V1CC 1IZ6A 3ICEA 1PA6A 3PO3H 3S1MH 1L1OA 5IP7H 5BR8Q 1HR0L 2Q2IA 4GS3A 4DK3C 2YTXA 2Q2HA 3G6EA 3S24A 1VQCA 1PH5A 3PCOB 1RL2A 2K50A 3I56A 2NN6I 2RCNA 4YCUA 2CFMA 3GTJH 2YV5A 3T1HQ 2MO1A 4YY3L 4A75A 5IYBH 1PV4A 1FL0A 1LM0A 4PMWA 4P72A 4GKJL 4JI8L 1CKNB 1Q46A 2JA5H 1XNRQ 3AEVA 3CP0A 4LUOA 3KDFA 1EUJA 2WP8J 5JEAJ 3I4NG 5IWAQ 4LF9Q 1JE5A 2ES2A 2HIXA 5C44G 3NBHB 2N78A 4JI3L 2CCZA 2R93G 4LFAQ 3B6YA 4B3RQ 4DV7Q 4DV6Q 4DUZL 4BXXG 1E24A 3L7ZC 5J3BA 4X62Q 2CKZB 4RMFA 2HHHQ 1VCIA 1ASYA 5M3FG 4ALPA 2UXDQ 4AIMA 2N8NA 1K0RA 4J15A 1A62A 3L0OA 4HIMA 1QVCA 2PI2E 2KHJA 5GQOA 5IP7G 1Y1WH 1PH8A 1UE6A 3M3YH 1L2FA 2RF4A 1VQ9A 4A3IG 1N33L 5LMNW 5JJIA 2UU9Q 1SROA 3BZCA 5GAGC 2WAQE 4JI2L 3I4MH 4YWLA 3RLNA 1YITA 4DR6Q 5IYBG 3CC4A 5HY6A 1S40A 1Y14B 1IBKQ 1XPUA 1A0IA 5FLMG 2RHQB 2JA5G 1P16A 1KAWA 2AWNA 2ZM6Q 5BR8L 3CCJA 5LMUL 3STBD 3HOZH 2I5LX 4TVAB 2I5HA 3W5OA 3BZKA 2B63H 1N9WA 1OXXK 3EN2A 3GTPH 3T1HL 1PFSA 2VS1A 3CF5A 1HZ9A 1OXUA 1KQSA 4Y7NH 1PH2A 2NVQH 1TWHH 5FLXc 4PZ8A 4GOPC 3GO5A 4DV1L 1XNRL 4NB3A 4X65Q 3UE0A 3AQQA 4C3JH 1Y1WG 3CC2A 4AH6A 5IWAL 2ASBA 5C0XG 4DV4Q 1N36L 5JJKA 2AMCB 2A8VA 2ZJPA 3I2ZA 1HZAA 4X64Q 4LFAL 3H0GH 4B3RL 1L1OB 1PYSB 4BBRG 3TEHB 4DV7L 2NVXH 4JI0Q 3I4MG 1GKHA 1TWFH 3U58A 1YIJA 1BVSA 4X62L 1Q86C 1IBML 2E2IH 2D62A 3GTMH 4A76A 1X54A 4DV2Q 3PGZA 1N34L 1HZBA 4C3HH 1K8GA 2JEAI 4O0AA 2UXDL 4A3KG 3NENA 4DNIA 3J81j 2K52A 4OO1G 1G291 4UP7A 1L0WA 5IYCH 2UU9L 1WYDA 1MJCA 4DR6L 2JA7G 1HNWQ 3GTLH 2Q2UA 4TQUS 1PH1A 1IBKL 4A93G 1C0AA 2F4VQ 4PG3A 2EQSA 2UUBQ 1W3SA 1AE3A 4KI0A 3GTOH 3MXNB 4HJ5A 2OWOA 4HJ7A 4IFDJ 3DLLA 3K80C 4DPGA 2MNAA 3T1YL 1BBUA 5FJ8G 3FKIH 4P75A 1KRTA 2OCEA 3F2BA 4DV3Q 3S14H 1U5KA 4QL5A 4HIKA 5M5WH 4YY3Q 5IP9G 4MTNA 5HGQA 1DGSA 1EFWA 4GKJQ 1HJPA 4WJ4A 4DKAC 1AH9A 1VQ7A 1V43A 1JMCA 4IPHA 4OWXB 1SR3A 4DV4L 2Q2TA 4LF5L 2LSSA 2EIFA 2KCMA 3PSIA 1XMQL 1NE3A 1E22A 1CSQA 1U0LA 2NVTH 1RIPA 2BA0A 1MKHA 3U50C 2C35B 2R6GA 4AQYQ 1NJIC 2F52A 2YTVA 4O2DA 4DR2Q 4XIGS 1R9TH 1S72A 2DUDA 3NELA 1J5EL 5C0XI 4GLVB 3KFUA 4IOAA 4Y52H 4A3DH 3CD6A 3S16H 3I4NH 2NZHA 4LFCQ 1TWCH 2Y0SE 3CCRA 4DV5L 2JE6I 2VUMG 3FKIG 3F8TA 3A5UA 4HIDA 4DR3Q 4X66Q 5GADC 3J80i 1HNWL 3CCMA 2UUCQ 4BXXH 1IBLQ 4B3TQ 2A19A 3IRBA 4DR1Q 3I55A 4OO1I 2VNUD 1X3GA 4JI1Q 3CAMA 5M3FH 4K0KQ 2R7DA 3JC66 4RG1A 4HJAA 4L5RC 5ELOA 4A3CH 4B3SQ 1YVCA 1VQIA 1WFQA 5LMUQ 4A3IH 2OTJA 4YCVA 4GN5A 1NBWA 4JBJA 4IJLA 4DV3L 2IHFA 2E8GA 1Q1BA 2AWOA 2ID0A 2VW9A 1XNQL 3J7ZC 2N3SA 3TQYA 4JI5Q 2JA6H 1H95A 1O7IA 3F1ZA 3PUXA 3F2DA 4A3DG 5FLMH 4DV1Q 1D7QA 1WCMG 1B8AA 1N36Q 1E3PA 3CPWA 4JOIC 3VDYA 3CMAA 3RR5A 3G71A 4AQYL 1PH4A 1X6OA 1X9NA 4JI6L 2ZTDA 4DR2L 1FJGQ 4GLXA 1A8VA 3EIVA 2JEBI 3W1BA 3HFZB 1IBMQ 1WJJA 1OTCA 3PIOA 3AFPA 2ZTEA 3D31A 1JJ2A 1JJGA 1N34Q 2K5VA 1VQHA 4A3GH 4A3CG 1BBWA 3M4OH 4LFCL 4EQ5A 3CW2C 4JI4L 4LF7Q 3M9BA 3L2PA 4DR3L 3J80c 4X66L 4DAYB 4BBRH 4AYBE 2K5NA 1YHAA 2B29A 2UUCL 1A63A 1IBLL 4B3TL 2WFWA 2PQAA 4MZ9A 4DR1L 2JA6G 1GD7A 5ELNA 2VQFQ
chains in the Genus database with same CATH superfamily
3GTJB 1EOVA 2SNMA 2QF7A 4GN4B 1SMYC 1I4HA 3ONAB 3JAME 4KD3A 2SDFA 1WTHA 3MXGA 2QILA 1KAAA 3MWYW 2BOSA 2IW3A 2F0WA 1HQMC 4H7BA 4P71A 1HFNA 2A73B 3J81E 5T1GA 1VQAA 1MIUA 3M4YA 5AJ3L 3MEFA 1IW7C 4KY6A 3V96A 1I94Q 1FJGL 3CC7A 5CYUA 4IPDA 4DN4M 1NNXA 3H91A 3I4MB 1VQ8A 2BDOA 1E2ZA 4LWCA 4FF2A 4LF7L 1NMFA 2K7VA 1XMOL 1I6HH 2YYZA 3K7UC 5CORA 4RCOA 2IT1A 5A35A 1R4QB 3FDTA 2VQFL 3OWEB 5HURA 1VQMA 1ET9A 4NKLA 5C3EH 2JA9A 4KHPL 1LUZA 1AFPA 5G3LF 1D5ZC 4FF4A 4IPCA 4R4TA 5C5LA 4R4IA 4IALA 4A3BG 4IUNA 4UP8A 4C2MH 1SN8A 5IOCA 1YEZA 3PO2H 2EYLA 2XWBB 2RHSB 5C4JH 3PF5A 5EBDA 1UEAB 1D5XC 3HZXA 3TDQA 3TMEA 1DONA 4K5WA 4LFBQ 3SGIA 1D8LA 4IFDI 4G4KA 5LHY1 1Q7YC 2XVSA 3GTLB 5C3EG 2DJGC 1WCMH 4OXPA 4DK0A 2PI2A 2FXQA 4GNXA 2PMZB 1HH2P 2NUCA 1IKLA 2DGYA 5EPLA 4FXDA 4OL7A 1SFOH 2OQ0A 1W2BA 1ZKOA 2FFKB 1PYBA 3PO2G 5D14A 1C9OA 4JPBW 2VL6A 3S17H 4C2MB 3QWNA 4EQNA 2EE1A 1E0BA 3VYRA 1CA6A 1MSHA 1HNZL 4BWGB 5C4JB 1RODA 5IGCA 5EAYA 3I90A 4X3UA 4OEMB 1L0YB 1B70B 4JYAQ 1OXVA 2PPBC 4PZ7A 4ZYSA 2CQOA 1EIYB 2K33A 5ELEA 3A8JE 3BZDB 1WCMB 1Y1VH 2OEOA 2XSCA 5CR3A 2NTSA 4BBSH 1H9KA 2ZTCA 3HOXH 3G7LA 1KIXA 2XRSD 1IL8A 3TRZA 4G7OC 3S17B 4JBKA 2IHEA 1LO5D 1HPCA 3PUWA 1DXMA 3K5OA 2WACA 3HKZG 1YNJC 2JJQA 1ICFB 5DLQE 3NEMA 2RA4A 2XGTA 2QA4A 1F2ZA 2GN5A 3R2IA 4RKLA 1Y1VG 2ATWA 2A6HD 3PO3G 1PRTF 3OPOA 5FO8B 2E2HH 1C48A 4BBSG 4KHZA 3U4ZA 2WAQB 4QMGA 3DUZA 3TS0A 3BJUA 3H3VI 1E2VA 4X3KA 1K83H 1N32L 5JJLA 4GKKQ 3C2PA 3HOXB 1AZQA 1F2MA 3RLFA 5FK9C 4GN3B 4K5VA 5CV7A 3TP7A 2Z6BA 1VQJA 3I3CA 2B2UA 1WTQA 4LF8L 2WV6D 4BBRB 3S2HH 3SK4A 3V05A 1GHJA 2HD3A 3LX0A 4BA1I 1VQBA 1EY0A 2MO0A 2JXMB 4JI7L 3SK8A 1GUGA 3J81c 1XTDA 1M1KC 1CZWA 4JBMA 3UI2A 2E76C 4DR5Q 1WI5A 4FXKC 5IT9L 4POGA 4ZQ3A 3G4SA 4L63B 1BCPF 1UUPA 3EBEA 1PH3A 4LK1C 4LW1A 2E2JB 4KV6A 4HJ8A 2VXWA 1WTOA 3K8AA 1OXTA 3HKSA 2M00A 3M4PA 4BY7H 2E75C 1SE2A 2NTTA 3MHBA 2IX0A 1GM5A 2B8FA 3ULLA 3U9SA 5HGTA 3A74A 2ZM6L 4LUZA 4DFAA 3PF4A 3S1RB 1N8RC 3M85A 3ULJA 1PYWD 4GLAC 3IKJA 2ZJQA 1X65A 4DR4L 4RH6A 2R7ZH 4X65L 1J6QA 2K32A 1DYQA 3RLOA 2Z4IA 2R92B 1TWAH 3GTQH 4JV5L 1ENFA 2YU9B 4BY7G 2F0NA 1SLJA 1AZPA 4HMJA 4DUZQ 3NQTA 3RZOB 4Q0FA 1VQDA 2OQKA 2K6AA 3Q8DA 1GO3E 2Q8RE 2JQOA 3U4VA 2K5WA 3NP8A 1EWIA 4EQOA 3C46A 1H9SB 1BO0A 2GVBA 2HQEA 4JI2Q 2EYPA 2VB3X 1PHJA 3F2CA 3R8BA 1G8ZD 1LTRD 5EBCA 2UUBL 1E2WA 1G6PA 5E7NA 3P75A 1Q90A 3ICEA 3S1MH 1PFNA 5BR8Q 1HR0L 2Q2IA 2P5ZX 2R7ZB 2F0OA 2YTXA 3CRLC 1LTTD 3PCOB 2RCNA 4XT3B 1PV4A 1FL0A 1II3A 1LM0A 4P72A 4U68A 4JI8L 3K0YA 1V1PB 1A2UA 2JA5H 1JE5A 5IT9E 4JI3L 2CCZA 1QE6A 3B6YA 3U9OA 3VR2A 4DV7Q 5E3FA 2HDLA 2ENBA 2H4OA 5J3BA 1K8OA 1CQVA 5M5YB 4ALPA 1ESFA 1MD2D 4J15A 3L0OA 1QVCA 2PI2E 1GUNA 1SYDA 2KHJA 5GQOA 3S15B 5M3MB 1VQ9A 2EYFA 2XWJB 4AYBB 2UU9Q 5GAGC 3RLNA 1YITA 3CC4A 1S40A 1A0IA 2JA5G 2E2DC 3Q0AA 4FYDA 2F0MA 5LMUL 3STBD 3HOZH 1EQTA 4TVAB 4A3FB 2B63H 3T16A 1HZ9A 1OXUA 1STNA 1LTID 3GP7A 1TWHH 5FLXc 2D5DA 3AQQA 3IL8A 1UAPA 4LAAA 5IWAL 1T5XD 3P7JA 4DV4Q 3D6CA 1BBXC 5E4XA 3H0GH 1HTPA 1TWFH 4X62L 2E2IH 3C1EA 2D62A 3NTKA 1TIID 4DV2Q 1N34L 2UXDL 4S3SA 1UNSA 3EA6A 2CHBD 2B39A 4IN3A 3J81j 3MXUA 4UP7A 1LTSD 5IYCH 3NK9A 2JA7G 1HNWQ 1M4VA 4TQUS 4OGQC 1IBKL 3QJYA 1MBYA 2B63B 3SHLA 2I46A 2F4VQ 2EQSA 1W3SA 1CK1A 3MXNB 2FHTA 1PTOF 1TWHB 1PLFA 3F2BA 3S14H 1W6JA 1U4MA 1STEA 2L0CA 5M5WH 5HGQA 3HOYB 5M5XB 3VR4A 1EYDA 1VMPA 4CKCA 4DKAC 4WJ4A 1VQ7A 1QOHA 4IPHA 4LF5L 1SR3A 1XMQL 1E22A 5ELDA 1U0LA 2NVTH 5I9PA 3HRZC 4AQYQ 2C35B 2R6GA 1NJIC 2F52A 4O2DA 4CKEA 1S72A 2EYHA 4M1UB 3ZYYX 3KFUA 2EY6A 4Y52H 1CM9A 1FR3A 2Y0SB 1TWCH 4TSSA 2B2UC 2IJ0A 2O2LD 2SNSA 3RD4A 1I3QB 2VUMG 2NVYB 4RA8A 1H9JA 4CJ2C 3CCMA 5C4ZA 3IRBA 4DR1Q 1HTLD 4JI1Q 5M3FH 1TS4A 3KLSX 1K8MA 1LT6D 3GTKB 4A3IH 3BVGA 4JBJA 4IJLA 1D1IA 1JOOA 2ID0A 3KLSA 1JWMD 1A15A 1XNQL 1YNND 3AMUA 2N3SA 5KYIA 3PUXA 5FLMH 3FRPB 2M2LA 4UHVA 1B8AA 1ZYRD 2CQAA 4RAUC 1HQRD 3G71A 4XQQA 4RGMA 1X9NA 4JI6L 5FOBB 1FJGQ 1TWCB 3CQZB 1A8VA 2JEBI 3HFZB 1IBMQ 1R4PB 1OTCA 4QIWB 2ZTEA 4A3GH 2F0LA 3L9AX 4K6DA 3HP3A 5C0XH 4LF7Q 2F0KA 1X32A 3IFDA 3VR3A 2R61A 2B29A 1S5DD 2PQAA 1IYVA 4K8JA 3KJOA 2VQFQ 5IT9c 1JR0D 4OIKA 2IY5B 1HNXL 3RN2A 4A3KH 1EU4A 1A3VA 2D9UA 4B3SL 4KHPQ 3T1YQ 3HS0C 1EY9A 1XYIA 1BXTA 4O1NA 5ELFA 1V1QA 4A3GG 1EYGA 4PQXA 4P73A 1Q8KA 4IFDG 3I72A 2EY1A 1J9OA 1A2TA 1NUCA 4R4QA 3OMGA 2XIWA 3W3AA 5FO9B 3LWUA 3M3YB 5IP9H 3NQIA 2K5HA 4B08A 2PO4A 1XPRA 1PH7A 1I4RA 2D0PA 1F9QA 2B2TA 1E1OA 2DNCA 4DA2A 4A3KB 5C4XG 2CW0D 2KVMA 3QO2A 1Q81C 3KYHC 4ID6A 1LTGD 3TP6A 5JPMC 1TQOA 1X3EA 2NVQB 1CHPD 2PNHA 3KF8B 3J7A5 1UE1A 1HNZQ 2PYKA 4C3JB 3I70A 1XWEA 3DXJC 3E6ZX 2A6ED 4KJNA 4JOIA 3SVMA 4EGVA 3D8GA 4MIUA 3PUYA 4OWWB 3HOVH 5CMDA 1JICA 5KRUA 1B7YB 4C3HB 1H9RA 4RCNA 2R3ZA 3MFYA 1PH9A 4KKUA 4IO9A 2TMPA 1JT8A 2A74C 4XYQA 1IYJB 3VYSA 4JCVE 2OF1A 1HUMA 3GTGH 4JI4Q 3CCLA 1UEBA 2EDGA 3CRKC 2D2CC 3FVQA 2F3IA 5JAVA 4BS9A 4GZYC 1QUQA 4IUPA 3MVVA 3HOVG 4EX5A 1JC7A 3T53B 5KIXA 1D2BA 4GOPA 1U9RA 4KLKA 5LL6S 4IPGA 1HXYD 5IGEA 2LXKA 3M7NA 1R9TB 4R8IA 1N32Q 1BKBA 3L3OC 4A3DB 4DUYL 1HA6A 4G7HC 2R7FA 2Z6KA 5G3LD 4LF8Q 3WOFA 3OWFA 3HKZE 4QJFA 3JAMi 1SJHD 1S3OA 3NXWA 4JI7Q 4CDFC 5JOBA 1FNWA 1P8LA 4KY7A 2PZWA 3J81i 2ICIA 3R2TA 3HOWH 1STYA 2QGQA 5EJWA 2V4DA 1IL2A 1FNVA 2JA6B 1CHQD 4IZ8A 2DJFC 2RQXA 1PXUA 2K75A 1SYFA 2G9HD 2RKSA 3GV3A 3I4LA 3VR5A 4KK7A 3A8KE 2K04A 1XXGA 4KMUC 5T1IA 2QDLA 1CTMA 1CUKA 3CCUA 3IAYA 3M4OB 1K0SA 1X56A 4A3BH 3NWSA 5KNBA 1LT3D 1S5CD 1O7YA 3HOWG 5CV9A 2C5CA 1STBA 1ML0D 1YHBA 1QJOA 2D0OA 3RN5A 4DR4Q 4B3ML 2VY3A 3KF6B 4K8IA 5C5MA 1O7ZA 2H5XA 4ZCKA 3J80L 2AQ2B 2RSOA 4P74A 3K58A 3CXCA 1LABA 2KHSA 3UDGA 4JV5Q 2OTJA 4DV6L 1VQGA 1CA5A 2UXCQ 4DK6C 4ODGA 1JE4A 2HHHL 1SE8A 2KEEA 4QGUA 3GD7A 3Q24A 3SR1A 1GUOA 4NMZA 1SYCA 3AYHB 1FGBD 4HSVA 1QNUA 3ITPA 4F87A 5FLXL 4A3BB 2KUMA 4DV0L 2K03A 1CKNA 2E5LQ 4HJ9A 3ERSX 5LMNL 2IX1A 3PMFA 2JK8A 5C0XJ 1HR0Q 1I6HB 4IOCA 2BA1A 3E0EA 1GVPA 3A54A 4UDUC 4B9XA 1PRTD 4N8X1 1HZCA 2X69A 2K14A 4A3LH 1B1ZA 4DXFA 3TP8A 4CDCC 1YHQA 1F77A 4JI8Q 1EY5A 3HOUH 3CCQA 5C3EB 4HMIA 2M9VA 5CV4A 4IUTA 4JI3Q 1TS5A 3FHWA 3P20A 2L15A 2F0PA 4MNOA 5EPKA 3S2DH 4NXNL 2UXBQ 4U673 3PO2B 1MSGA 1NTGA 2PZTA 4CBVA 2LKVA 1VQNA 4Q5VA 3WDNA 4ZUIA 2I0QA 1STHA 4MHEA 4YHHL 1I6VC 2ZJRA 5IGDA 4ZKBB 2R93H 1G6ZA 2GVAA 2MQHA 4XQJA 1GJXA 2CWAA 1LACA 1KNAA 4A3LG 1TWGH 1D5MC 2BE5D 3HOUG 4UY8C 4OX9Q 4JG2A 5J22A 2OT2A 1MHWC 2MJ8A 2V1CC 3OSOA 5CBAE 3PO3H 1BCPD 1EFID 1L1OA 1EYCA 1NAPA 3G6EA 1RDPD 4DK3C 1VQCA 1SFOB 1LTAD 2NN6I 4YCUA 2WIIB 2YV5A 4YY3L 1ICWA 5IYBH 4UAIA 2F0QA 3J80E 4ZAIA 4DAVA 1TY2A 1Q46A 5C4HA 4LUOA 1EUJA 5IWAQ 4LF9Q 2FJ2A 3NBHB 2R93G 5BN3A 1SYGA 3HEJA 1EYAA 4F8MA 4BXXG 5M9OA 1DZ1A 4X62Q 4P2CB 1SXTA 4RMFA 1PZKD 4FNFA 2UXDQ 4AIMA 3J7AF 4LJZC 1Y1WH 1TWGB 1UE6A 2RF4A 5FLXE 1N33L 5LMNW 3DWPA 3BZCA 1Q8IA 1Y1VB 2HCIA 4BBSB 4HSPA 2QKIC 4G57A 5IYBG 2LY7A 1Y14B 2N88A 1IBKQ 1BUVT 1XPUA 2PCFB 3NUCA 2QW7A 1TR5A 3ND9A 1KAWA 3R3OA 2I5LX 3BZKA 1EU3A 3GTPH 3T1HL 3CF5A 2F0HA 3EROA 4ULLA 3CKIB 4Y7NH 1PH2A 4GOPC 3GO5A 4DV1L 1XNRL 1LTBD 5DNFA 1Y1WG 2K1BA 4AH6A 3OMCA 1LLRD 4IURA 3BYTB 3I2ZA 4X64Q 4B3RL 1PMRA 4BBRG 4K6LA 4JI0Q 2E2HB 3U58A 2QDBA 1OO9B 1EOTA 2PW5A 1PZJD 1K83B 1VF5C 4PNYA 5CV8A 4H44C 4QB4A 1HCZA 2LFNA 3OOCA 2F1MA 1M8AA 2Q2UA 1PH1A 4HN7A 4A93G 2Z9HA 1T5EA 3S2HB 2B2VC 3GTOH 2EJGC 3BS1A 4Y7NB 3QOJA 2A69D 4XT1B 4CDEC 5FJ8G 3FKIH 4P75A 5TSSA 2B2YA 1U5KA 2HDMA 1DOMA 1PRTC 4MTNA 4GKJQ 1IHZA 4JK1C 1V43A 1XX8A 3URYA 4OWXB 3C3LA 1GXDC 4DAYA 2KCMA 3PSIA 3MAQA 1NE3A 2BA0A 1F2YA 2YTVA 2Q8TA 2L12A 4DGZA 2LMCB 3EFXD 4BY7B 1F9SA 1VDZA 5EQ0A 2QEJC 4IOAA 1WVLA 4G7ZC 2Y0SE 3FKIG 4HAEA 3GTOB 5IGBA 5GADC 5NUCA 4OO1I 1X3GA 4QF4A 3KUPA 4HJAA 4L5RC 5ELOA 4B3SQ 1TKWB 1WFQA 5D3IB 4YCVA 4KHVA 4DV3L 2IHFA 5I6YA 1SAPA 2AWOA 1TWAB 3GTQB 3S9WA 5C3XA 4FXGC 1A6XA 1O7IA 3F2DA 1D7QA 3H94A 3LWEA 2NB0A 5C6AA 1N36Q 1E3PA 1J8IA 1SJED 3H6MA 2DY8A 3RR5A 3CMAA 1PH4A 2K5QA 2ZTDA 4DR2L 1PTOD 3W1BA 1SYEA 3AFPA 2X6GA 1VQHA 3ERQA 1KLGD 2A6HC 4EQ5A 3MEHA 3T51B 3D4WA 3L2PA 5CC4A 3J80c 2F0SA 1H9MA 4X66L 3S1MB 5KNDA 5IGFA 1IBLL 2SOBA 4CKBA 1IKMA 1GD7A 4GNXC 5IODA 5ELCA 1VQ5A 1NR2A 3FMCA 4HCSA 3PIPA 2HQLA 2WB1E 1FD7D 1CQFA 3CHBD 2JA5B 3K7AH 4V0BA 3T13A 5KGUA 2RDHA 2ZXPA 2PW7A 2JA7H 3TP5A 1V1OA 4JI5L 1WTPA 1SDFA 4ZKCB 1KTKA 4APVA 1EL0A 4JYAL 1X3FA 4RWSC 3KJPA 4C3IH 4WJ3M 5J1ZA 4I7AA 1Z47A 1WTRA 4ZLTF 5IE8A 4A3JG 2F3WA 4CHTB 2RBMA 1PDQA 3NBIA 1J5EQ 3NTHA 1UWVA 5GAHC 3S1NH 2BH8A 3RZDH 2YTYA 3GDEA 1VQ4A 2AHOB 1SBBB 4DV5Q 4BY1G 4WFN3 4IUQA 1K9MC 1RTOA 1UE7A 2NWGA 3RUZA 4XQNA 3E5SA 3NSWA 3HOZB 3LGJA 3K7AB 2NZ1D 3LNNA 1PVOA 3R93A 2K28A 5JEAH 4C3IG 1RF2D 3X3NA 2AUJD 4DAMA 2PZUA 1JWSD 3W2DA 2VUMH 1W6KA 3PUZA 2RSNA 1SNCA 4R9WA 1WTVA 3SXHA 3VR6A 4RGTA 3H0GB 4KN7C 4HR7B 1XJVA 1U4PA 1TWFB 2E2IB 4GKKL 1QWYA 4KD4A 4X3SA 4IJHA 3S1NB 1EEID 4DUYQ 1JB3A 2AKWB 1ET6A 4TKOB 1KLUD 5ELBA 4FF3A 3KBXA 5JEAG 1Z6HA 2FMMA 3DM1A 2A68D 2HIVA 1X55A 2F0UA 3BVMA 5IYDH 3UDFA 3AB9A 2JA8H 3BVZA 1YBYA 2BDNA 1NY4A 4DU9A 1DD2A 1OXSC 2Z0SA 1KHIA 3ULPA 5E4WC 2VUMB 4FF1A 4JBWA 2Z8LA 4LF6L 4DR5L 3QIAA 3S14B 3H3VC 4PMBA 5M5WB 2Y0SG 2KCNA 3EJIA 2OTLA 1AE2A 1FYCA 3K81C 4QY7A 4X6AH 5I2XA 2LXJA 1SRUA 2NVTB 1HRJA 2ZT9C 3A5ZB 4NXML 1WD0A 3UDXA 5IYDG 5AJ3Q 3W1GA 2JA8G 2CH4W 1Y8NB 1YZ6A 3F2UA 3A56A 1A3TA 2BH2A 1K3RA 4XDXA 1FVIA 3TS2A 3CPFA 2DY7A 4KN4C 2UUAL 4IFDH 2CWPA 5M3FB 1VQFA 4B3MQ 3A55A 1XMOQ 2B2YC 2EYJA 1AW7A 1SEBD 2MHVA 4A3IB 3AU7A 3WWVA 2JYOA 3CCSA 2L9HA 3IFTA 3G6JB 1M90C 2KCCA 1WTXA 3MC0B 4R8NA 3STBC 4GNXB 5C4XH 2F03A 4O42A 1STAA 2RCFA 2DNEA 2J4XA 2HUGA 2WB1G 4DV0Q 1QVGA 4DNTB 4A3GB 1T9HA 1Y8OB 5LMNQ 1ENCA 1EQRA 5FO7B 2QCPX 1SMYD 2QEXA 1F2LA 2VZAA 3K5NA 2O5JC 1KDAA 2ZXRA 3KOJA 4DK1A 1DOKA 1KABA 5DAUA 5K36G 4J1MA 1B53A 3Q23A 1PFBA 1H9SA 1EIFA 1IW7D 3MZ5A 5EKKA 5BN5A 3K6OA 5C4XB 4DNRB 1LTLA 4NXNQ 1IXRA 3TN2A 4UPAA 4H02A 1I4GA 3OTOL 4A3MH 5BN4A 1CSPA 2J0TD 4YHHQ 1EWHA 1C7YA 1V1PA 3N6RA 1GHKA 1WTWA 4R1JA 3MXPA 5H1SE 2NN6G 3H3VH 2L11A 2VQEL 2FMCA 1MJEA 1I4QA 4K2LA 4ABNA 2E74C 5JJZA 1WOCA 3SE0A 4A3EH 3K0XA 1TS3A 4KKSA 4LNQA 1QVFA 2PMZE 4A3MG 3S1QH 3N52A 4OIJA 5GAEC 4ILWA 4XXEA 3PIO3 3QOLA 4DV2L 2EYOA 1S4ZA 2EY5A 3HOVB 3PQIA 2ICEC 4LF4L 1YNNC 5C44H 1N33Q 1E1TA 3VA5A 4TRDA 1QZHA 1I4PA 1G51A 4DR7L 3TREA 4A3EG 5I6WA 1EEFD 5KNCA 1VQEA 2F4VL 1ZYRC 1EZ8A 2XNAC 1L0XB 3GTGB 5IP7H 4CGYB 3D4RA 1MI2A 1HA5A 4ZK9B 3S24A 1PH5A 2K50A 1SNPA 3H09A 3I56A 1QCBD 3GTJH 3T1HQ 4A75A 4PMWA 2IPKD 5CV5A 1XNRQ 3AEVA 5JEAJ 3KDFA 2WP8J 3I4NG 2N55A 4DAPA 4RKBA 2ES2A 2HIXA 5C44G 2N78A 3I91A 1NCVA 4B3RQ 1JWUD 1E24A 3L7ZC 2CKZB 1VCIA 1ASYA 3D6WA 2Z4HA 2N8NA 5IP7G 2MUYA 5JJIA 1SROA 2Z1CA 2WAQE 3I4MH 4OELB 5HY6A 1GOZA 2RVLA 5JVG3 1YNJD 3NPPA 1S5ED 2ZM6Q 4IQZA 3CCJA 1BR9A 4OO1H 3D3RA 3TSSA 3W5OA 2I5HA 3KK7A 3QG1A 4KJOA 3EN2A 1PFSA 2EYMA 1DJRD 1AEXA 1KQSA 3HOWB 1EWCA 2ZXOA 4NB3A 4X65Q 3UE0A 2ASBA 2B8GA 4N9PA 1U4LA 2A8VA 2ZJPA 1ONLA 1RTNA 2CW0C 1Y8PB 3O13A 4LFAL 1PYSB 4I65A 3TEHB 2NVXH 2KEDA 3I4MG 2O5IC 1GKHA 2NBFA 1Q86C 1IBML 4F7XA 2L4NA 3GTMH 4XYOA 3PGZA 3C1FA 2JEAI 4O0AA 5EPJA 3K5MA 4QCLA 4DNIA 1GUTA 5AFWA 4OO1G 2JN4A 3VA7A 2B2WA 2A6EC 1WYDA 1MJCA 4DR6L 3GTLH 3KBGA 4X3TA 1C0AA 2UUBQ 1JQYD 1AE3A 4KI0A 2OWOA 4HJ5A 4N9TA 5D65A 4IFDJ 3DLLA 4DPGA 2MNAA 3T1YL 1HHVA 1BBUA 2AQ1B 4NW2A 2OCEA 4DV3Q 4QL5A 4HIKA 2F0JA 2NVXB 5C3WA 1AH9A 4RGNA 3DWQA 1HUNA 2Q2TA 4WORA 3GTMB 2CVRA 1CSQA 1B9MA 1RIPA 3MA2B 1MKHA 3NE5B 4N8FA 4DR2Q 4XIGS 2DUDA 5C0XI 4ME5A 2WKDA 4GLVB 3A7AB 3DWAA 3CD6A 3S16H 2NZHA 5CV6A 4JVZA 3A5UA 4X66Q 3J80i 1ESRA 4BXXH 1IBLQ 3D4DA 1KDCA 2B2TC 3I55A 2VNUD 3CAMA 2R7DA 1SNOA 4A3CH 4J6HA 2A5HA 1YVCA 3HOUB 5LMUQ 1CFMA 1ZEQX 2E8GA 1C4QA 3EQLC 2F0IA 4JI5Q 4MN3A 3J7AV 3S2DB 1WCMG 1X3PA 3A7LA 1BDOA 4JOIC 1O7LA 1X6OA 3S16B 1QILA 4GLXA 3M7GA 3HKZB 1EY7A 2R93B 3D31A 1N34Q 5F2DA 4A3CG 3KF8A 1BBWA 4LFCL 4JI4L 1SE4A 3M9BA 2JP1A 2F0VA 4DR3L 3PO3B 4BBRH 4AYBE 1YHAA 2UUCL 1A63A 4B3TL 2WFWA 1C8CA 1EY6A 4MZ9A 2KJXA 5ELNA 4K0KL 1JOKA 3TBIB 4L5TA 3A0JA 2J7ZA 1X3QA 2H1EA 2RDFA 2K4KA 2WAQG 3PV0A 1K73C 3OW2A 2EXZA 3HOXG 4A93H 1E7ZA 3ZJYC 2IWHA 1EQQA 1QNKA 4LF5Q 2E2JH 1NMGA 1XMQQ 1RHPA 3ND8A 5FJ8H 1Y1WB 4L8JA 4C1NK 1XTCD 5I4DA 4ME3A 3JAMc 5D3DA 3CCEA 1RJTA 2Z6KC 4BA2I 4JW0A 3S1RH 4R4OA 4HEDA 2C9OA 2TSSA 5I9OA 3SEBA 1K28A 3G48A 4C1NI 1NR4A 3PUVA 3GTPB 4LF6Q 4FDBA 1FNUA 3MTSA 1ILPA 1XPOA 2I07B 4A93B 2R92H 2CH4A 1KC8C 5I2YA 4PZ6A 3BU2A 1V9PA 4FP5D 3RMHA 5L37A 4RGOS 1IYUA 1CKMA 3CMEA 2XN9C 2YU9H 2N49A 4YCWA 3VYUA 1XNQQ 1FGUA 3RZOH 3DMUA 1LT5D 3KLWA 3I73A 2L55A 2PQAB 4NXMQ 3E9HA 4KKTA 3V2TA 4B9WA 2G9DA 1I94L 1VQ6A 3P1HA 4OONA 4JI6Q 2GA4B 4IUVA 4MTKA 5JPNC 2AUKA 2KHIA 2UUAQ 2R92G 3Q6SA 1VS0A 5EKIA 4DXGA 1LYLA 5IY0A 2B3GA 3CCVA 4QUFA 1CI3M 3FKIB 4R4CA 2BE5C 4POFA 5CGKA 2G5DA 3E9IA 1KD1C 2UXCL 1HNXQ 3RNUA 1Q82C 1I50H 1A3UA 1K8AC 1BCPC 4NP5A 4UP9A 1B3QA 1YNXA 3A8IE 2WKCA 5M5YH 1VQLA 2KBNA 3UDIA 2E5LL 2VB2X 3SDZA 3KF6A 2XTIA 3S15H 5M3MH 3D0FA 4HIOA 2R7ZG 2B2WC 4LFBL 1TT2A 3PIP3 3OIQA 1GUWA 1MGSA 2EXDA 2JSOA 2EOTA 4K2KA 1KRSA 4OWTB 4QIWE 2KECA 1CKOA 1BNZA 4L5SA 4L5QA 4RHRA 2K05A 3J7YW 3HG9A 1KNEA 2I5MX 3NHHA 3NWTA 4KTAA 1I50B 4A3JH 1CT1D 2Q8IB 4A3FH 1YJWA 1B4OA 3DEPA 1ENAA 4QUCA 1YJ9A 2UXBL 1Z9FA 2ALYB 1VMCA 2SEBD 1EQVA 5M3MG 2L5TA 4K5XA 1SMXA 4AYBG 1DCZA 4BY1H 4XTCS 3OTOQ 4LUVA 1JJCB 4KY5A 1QB5D 2K01A 1QZGA 1ASZA 1DM0B 3BG3A 2WINB 2EJMA 1QUQB 3CU7A 4OX9L 1AP0A 1TY0A 5DEHA 4A3FG 1RD9D 1S5BD 4A4IA 2VQEQ 4GOPB 3BDLA 4L6TB 1I4XA 3NTIA 4A3JB 3UE1A 4CDDC 5ISRA 1L1OC 2X6LA 3AFQA 4M8AA 2KQ3A 1YI2A 1Q3LA 2EVBA 4LF9L 4YWMA 1WD1A 2PNRC 3EVQA 1Y69U 4BY1B 3HOYH 1PH6A 3M4QA 5M5XH 1HFGA 3H15A 2JA7B 3OYYA 1STGA 1UE5A 1B50A 1O78A 3K5LA 2A69C 4WRDA 4IUUA 5JVH3 1DOLA 3I7FA 1KDBA 4C3IB 3FPPA 4JC0A 1I5FA 4I7ZC 2KENA 4LF4Q 3HOZG 2IL8A 3KDFB 2B63G 2MFIA 4FVMA 2MP1A 4YIJA 2A1AA 4DR7Q 3BDCA 1HR0W 2RDGA 4RFBA 1I3QH 3RZDB 2NVYH 3I4OA 1PRTB 3NBHA 1JB7A 1AN8A 1SNMA 4NPSA 3K59A 2HT1A 2F0FA 3H0GG 3HOYG 2NZOA 5A2QL 4ZRZA 1NSNS 1SSOA 3TZUA 3GTKH 4E6IA 1Z7TA 4QQBX 1Q12A 2OXPA 3DM3A 5IYCG 4X64L 1SYBA 3E3XA 3ER0A 4YWKA 1VQOA 1Q1EA 1RCVD 4JI0L 1KL9A 3T4AC 3KLRA 2F0TA 1BQQT 1BF4A 1BOSA 2HCCA 2O4XA 5DM63 2F0DA 2KCTA 3GV6A 2FINB 5E1FA 4NDXA 1YJNA 4CJ1B 1VQKA 3CQZH 4DF7A 4PV1C 3E0JA 5EGTA 3FP9A 1VQPA 2EY2A 1KXLA 1B2TA 1BCPB 2PQEA 5GROA 3K57A 1TXYA 1O80A 1IZ6A 1PA6A 1G91A 1RKNA 2JA8B 2KA7A 4GS3A 1PTOC 2Q2HA 1RL2A 2CFMA 1PZID 2MO1A 4WJWA 4GKJL 1CKNB 3CP0A 2EPBA 3TZDA 4LFAQ 2MGSA 4DV6Q 4DUZL 2EZVA 2HHHQ 5K5PA 2BCOA 5M3FG 5K36H 4K14A 4PMCA 1K0RA 1JORA 1A62A 4HIMA 1PH8A 3WOEA 3M3YH 1L2FA 3HGBA 2DN8A 2F0EA 4A3IG 3BYYB 1JCKB 3DEOA 4JI2L 4YWLA 4DR6Q 1TU2B 5FLMG 2RHQB 3FPUB 1P16A 2WB1B 2AWNA 4EVOA 5BR8L 5EKLA 3GQBA 2EJFC 5A2QE 1EIHA 4HCEA 1N9WA 1OXXK 2VS1A 1B9NA 4Z9CB 2NVQH 4PZ8A 5LL6X 2NN6H 3SK5A 4C3JH 3CC2A 5C0XG 5COYA 1N36L 5JJKA 2AMCB 5KYLA 4LMQD 1HZAA 4FO2A 3OHXC 1L1OB 4DV7L 1YIJA 1GUSA 1BVSA 5IIFA 4A76A 1X54A 1K8GA 1G2TA 1HZBA 4C3HH 1G2SA 3VYTA 4A3KG 3MFGA 3NENA 3Q22A 2NYZD 4CJ0B 2K52A 1G291 4V190 2K5DA 1L0WA 2UU9L 1SE3A 1EIGA 2MPMA 3DHQA 1JOQA 4PG3A 1EY4A 4C3JG 3QR8A 1B3AA 4HJ7A 5J39A 3K80C 1VF7A 3BDOA 1KRTA 3JAML 1K3BC 4YY3Q 5IP9G 2A68C 1DGSA 1EFWA 4C3HG 1TVXA 1HJPA 2LS01 1S5FD 1JMCA 5CBEE 1U4RA 4ZUJA 4DV4L 2F3VA 1CZGA 1F9PA 2EIFA 2LSSA 3J81L 3U50C 4A3MB 5FKAC 1R9TH 1J5EL 1PTOH 3NELA 3T56B 4A3DH 3I4NH 4H13C 4LFCQ 3CCRA 4DV5L 2JE6I 1B44D 3F8TA 4HIDA 1PFMA 4DR3Q 1HNWL 4C56C 1ILQA 1SNDA 2UUCQ 1TS2A 4B3TQ 2A19A 2IX3A 1QG7A 4K0KQ 3OIPA 3JC66 4RG1A 1D1KA 4A3EB 3OW7A 1VQIA 3FEWX 4GN5A 1NBWA 2XRQD 1Q1BA 1SNQA 2VW9A 3S1QB 3J7ZC 1V8QA 3TQYA 4F88A 2JA6H 4H0LC 3X3MA 1H95A 3F1ZA 4A3DG 2KOLA 4DV1Q 1PTOB 2F0GA 4HTHA 3I8ZA 3CPWA 3VDYA 4EQPA 4AQYL 1D6EC 3I4NB 1ZXTA 5DM73 4OHJA 3QB3A 3EIVA 5C44B 1WJJA 2L1BA 3MXNA 3PIOA 5KEEA 1JJGA 1JJ2A 2K5VA 2F4IA 1LT4D 3M4OH 1LV9A 3CW2C 4RHSA 2AQ3B 3SK6A 5IGGA 1EZ6A 4DAYB 2B2VA 2K5NA 1F9RA 4DR1L 2JA6G 1EY8A 4JI1L 4J8QA
chains in the Genus database with same CATH topology
5IT9c 4K0KL 1VQ5A 2IY5B 1EOVA 4L5TA 1HNXL 3RN2A 4A3KH 3A0JA 3PIPA 2HQLA 4B3SL 4KHPQ 2WB1E 3T1YQ 4GN4B 2K4KA 2WAQG 3PV0A 1K73C 3K7AH 2JA7H 3OW2A 4JI5L 4APVA 3HOXG 1V1QA 4P71A 4A3GG 4A93H 4JYAL 1X3FA 1E7ZA 3ZJYC 1EYGA 4P73A 1Q8KA 1VQAA 1MIUA 4C3IH 5AJ3L 3KJPA 1EQQA 4LF5Q 2E2JH 4IFDG 4WJ3M 1NMGA 3MEFA 1Z47A 1XMQQ 4R4QA 5FJ8H 5IE8A 1I94Q 4A3JG 1FJGL 3CC7A 4IPDA 1J5EQ 5IP9H 2K5HA 1VQ8A 4ME3A 1UWVA 5GAHC 3JAMc 3CCEA 3S1NH 2BH8A 4LWCA 2YTYA 2Z6KC 3RZDH 1XPRA 1PH7A 4BA2I 2D0PA 3S1RH 3GDEA 4R4OA 1VQ4A 2AHOB 4LF7L 1NMFA 4DV5Q 1XMOL 1E1OA 1I6HH 4BY1G 1K9MC 2YYZA 3K7UC 1UE7A 5C4XG 2IT1A 3G48A 1Q81C 3LGJA 2VQFL 3KYHC 1PVOA 3PUVA 4LF6Q 1VQMA 4FDBA 5C3EH 1X3EA 2JA9A 4KHPL 1LUZA 1XPOA 2PNHA 4DAMA 3KF8B 2R92H 1KC8C 3J7A5 2VUMH 1UE1A 3BU2A 1V9PA 3PUZA 4IPCA 4PZ6A 4R4TA 4R4IA 1CKMA 3CMEA 1HNZQ 4C2MH 4UP8A 2YU9H 2N49A 4A3BG 4YCWA 1SN8A 1XNQQ 1FGUA 3RZOH 1YEZA 3PO2H 4JOIA 3KLWA 2PQAB 1XJVA 4NXMQ 5C4JH 2RHSB 3E9HA 3PF5A 3PUYA 4OWWB 3HOVH 4GKKL 1B7YB 4IJHA 1I94L 1VQ6A 4LFBQ 4DUYQ 3SGIA 4OONA 2AKWB 4JI6Q 1PH9A 1D8LA 4IFDI 4IO9A 1Q7YC 1JT8A 1IYJB 5JEAG 5C3EG 2HIVA 1WCMH 4JCVE 4OXPA 1X55A 2KHIA 2PI2A 2UUAQ 3GTGH 4JI4Q 3UDFA 3CCLA 2FXQA 2R92G 1UEBA 2JA8H 5IYDH 4GNXA 1HH2P 1YBYA 2DGYA 1VS0A 2F3IA 1SFOH 1NY4A 1LYLA 2OQ0A 1W2BA 5IY0A 1OXSC 2Z0SA 2B3GA 3CCVA 1PYBA 3PO2G 1KHIA 1QUQA 1C9OA 3ULPA 4R4CA 4JBWA 4LF6L 2VL6A 4DR5L 3S17H 4POFA 3E9IA 1KD1C 3HOVG 1HNXQ 3RNUA 2Y0SG 4EX5A 1Q82C 2UXCL 1I50H 1K8AC 2OTLA 1AE2A 1HNZL 4GOPA 4UP9A 3K81C 4QY7A 4X6AH 4KLKA 5EAYA 2LXJA 1SRUA 1YNXA 4IPGA 4JI1L 1VQLA 5M5YH 3A5ZB 2KBNA 2LXKA 1B70B 4NXML 4JYAQ 3M7NA 1OXVA 3UDIA 2E5LL 4PZ7A 3UDXA 5IYDG 5AJ3Q 3KF6A 2CQOA 2XTIA 3W1GA 1EIYB 1BKBA 5M3MH 3D0FA 4HIOA 2JA8G 2R7ZG 3S15H 4LFBL 4DUYL 1Y1VH 1YZ6A 2R7FA 2EXDA 2Z6KA 4BBSH 1KRSA 4LF8Q 2ZTCA 3HOXH 4OWTB 3HKZE 4QIWE 1K3RA 2BH2A 1KIXA 1CKOA 1FVIA 4QJFA 3TS2A 3JAMi 4L5SA 3CPFA 4L5QA 2UUAL 2CWPA 3TRZA 1S3OA 4JBKA 1VQFA 4B3MQ 4GNXC 2IHEA 1XMOQ 2I5MX 4A3FH 4JI7Q 3PUWA 4A3JH 1YJWA 1P8LA 3J81i 3HKZG 3HOWH 1YJ9A 2QGQA 3WWVA 2JJQA 3CCSA 5DLQE 3NEMA 1IL2A 2UXBL 1Z9FA 2ALYB 2XGTA 5M3MG 2QA4A 1M90C 1N32Q 1SMXA 2GN5A 4AYBG 3STBC 1Y1VG 4BY1H 2ATWA 4XTCS 3PO3G 3OTOQ 4LUVA 1JJCB 4GNXB 5C4XH 2E2HH 4BBSG 2K75A 4KHZA 3U4ZA 1QZGA 1ASZA 3TS0A 3BJUA 1QUQB 3H3VI 2WB1G 1K83H 4DV0Q 1QVGA 1N32L 5JJLA 4GKKQ 1CUKA 4OX9L 1T9HA 3CCUA 5LMNQ 4A3FG 1EQRA 1X56A 3RLFA 4A3BH 4GN3B 4A4IA 2VQEQ 4GOPB 2QEXA 1VQJA 4LF8L 3HOWG 2VZAA 3S2HH 3KJOA 3KOJA 3UE1A 1L1OC 1YHBA 2D0OA 3RN5A 4DR4Q 4BA1I 4B3ML 1VQBA 2VY3A 3AFQA 5K36G 2MO0A 1YI2A 4JI7L 3KF6B 3J81c 2H5XA 4LF9L 4YWMA 1XTDA 1EIFA 4P74A 3CXCA 1M1KC 4JBMA 3UDGA 4JV5Q 3HOYH 1PH6A 3M4QA 4DV6L 1VQGA 5M5XH 3H15A 4DR5Q 1WI5A 4POGA 3OYYA 2UXCQ 1LTLA 4DK6C 1IXRA 3G4SA 4NXNQ 1UE5A 3EBEA 2HHHL 1SE8A 4UPAA 4H02A 1PH3A 4QGUA 3GD7A 3I7FA 4LW1A 3OTOL 4JC0A 1I5FA 4A3MH 1CSPA 2KENA 4HJ8A 4LF4Q 4YHHQ 3AYHB 3K8AA 3HOZG 1OXTA 3KDFB 3HKSA 2B63G 2MFIA 3M4PA 1C7YA 4BY7H 2A1AA 4DR7Q 4DV0L 1CKNA 1HR0W 2E5LQ 2IX0A 1GM5A 4R1JA 4HJ9A 3ERSX 3ULLA 5H1SE 2NN6G 5LMNL 2IX1A 1I3QH 3H3VH 3A74A 1JB7A 2NVYH 3I4OA 4LUZA 2ZM6L 3PF4A 4NPSA 2VQEL 2HT1A 2JK8A 5C0XJ 1N8RC 1MJEA 3M85A 3ULJA 4IOCA 2BA1A 3H0GG 4GLAC 1HR0Q 3E0EA 2NZOA 3HOYG 1GVPA 1WOCA 2ZJQA 1HZCA 2K14A 4A3EH 3K0XA 4A3LH 1X65A 4DR4L 1YHQA 3GTKH 4JI8Q 4LNQA 1QVFA 4X65L 1J6QA 3CCQA 2R7ZH 3HOUH 2PMZE 4A3MG 4QQBX 3RLOA 3S1QH 1Q12A 3DM3A 1TWAH 5IYCG 4X64L 3GTQH 3ER0A 4YWKA 5GAEC 4JV5L 1VQOA 4JI3Q 1Q1EA 4JI0L 4BY7G 3FHWA 4MNOA 1KL9A 2L15A 1SLJA 3S2DH 4NXNL 4DUZQ 2UXBQ 1NTGA 1VQDA 2OQKA 4DV2L 1VQNA 3Q8DA 1GO3E 2I0QA 2KCTA 2JQOA 1YJNA 3U4VA 1VQKA 4LF4L 4YHHL 1EWIA 3CQZH 2ZJRA 5C44H 1N33Q 3FP9A 1E1TA 2R93H 2GVAA 2MQHA 1VQPA 1QZHA 1G51A 2GVBA 2CWAA 4DR7L 4JI2Q 3TREA 1KXLA 4A3EG 1PHJA 5GROA 4A3LG 1TWGH 3F2CA 1VQEA 1TXYA 3HOUG 4UY8C 2F4VL 4OX9Q 2UUBL 4JG2A 1G6PA 5E7NA 2V1CC 1IZ6A 3ICEA 1PA6A 3PO3H 3S1MH 1L1OA 5IP7H 5BR8Q 1HR0L 2Q2IA 4GS3A 4DK3C 2YTXA 2Q2HA 3G6EA 3S24A 1VQCA 1PH5A 3PCOB 1RL2A 2K50A 3I56A 2NN6I 2RCNA 4YCUA 2CFMA 3GTJH 2YV5A 3T1HQ 2MO1A 4YY3L 4A75A 5IYBH 1PV4A 1FL0A 1LM0A 4PMWA 4P72A 4GKJL 4JI8L 1CKNB 1Q46A 2JA5H 1XNRQ 3AEVA 3CP0A 4LUOA 3KDFA 1EUJA 2WP8J 5JEAJ 3I4NG 5IWAQ 4LF9Q 1JE5A 2ES2A 2HIXA 5C44G 3NBHB 2N78A 4JI3L 2CCZA 2R93G 4LFAQ 3B6YA 4B3RQ 4DV7Q 4DV6Q 4DUZL 4BXXG 1E24A 3L7ZC 5J3BA 4X62Q 2CKZB 4RMFA 2HHHQ 1VCIA 1ASYA 5M3FG 4ALPA 2UXDQ 4AIMA 2N8NA 1K0RA 4J15A 1A62A 3L0OA 4HIMA 1QVCA 2PI2E 2KHJA 5GQOA 5IP7G 1Y1WH 1PH8A 1UE6A 3M3YH 1L2FA 2RF4A 1VQ9A 4A3IG 1N33L 5LMNW 5JJIA 2UU9Q 1SROA 3BZCA 5GAGC 2WAQE 4JI2L 3I4MH 4YWLA 3RLNA 1YITA 4DR6Q 5IYBG 3CC4A 5HY6A 1S40A 1Y14B 1IBKQ 1XPUA 1A0IA 5FLMG 2RHQB 2JA5G 1P16A 1KAWA 2AWNA 2ZM6Q 5BR8L 3CCJA 5LMUL 3STBD 3HOZH 2I5LX 4TVAB 2I5HA 3W5OA 3BZKA 2B63H 1N9WA 1OXXK 3EN2A 3GTPH 3T1HL 1PFSA 2VS1A 3CF5A 1HZ9A 1OXUA 1KQSA 4Y7NH 1PH2A 2NVQH 1TWHH 5FLXc 4PZ8A 4GOPC 3GO5A 4DV1L 1XNRL 4NB3A 4X65Q 3UE0A 3AQQA 4C3JH 1Y1WG 3CC2A 4AH6A 5IWAL 2ASBA 5C0XG 4DV4Q 1N36L 5JJKA 2AMCB 2A8VA 2ZJPA 3I2ZA 1HZAA 4X64Q 4LFAL 3H0GH 4B3RL 1L1OB 1PYSB 4BBRG 3TEHB 4DV7L 2NVXH 4JI0Q 3I4MG 1GKHA 1TWFH 3U58A 1YIJA 1BVSA 4X62L 1Q86C 1IBML 2E2IH 2D62A 3GTMH 4A76A 1X54A 4DV2Q 3PGZA 1N34L 1HZBA 4C3HH 1K8GA 2JEAI 4O0AA 2UXDL 4A3KG 3NENA 4DNIA 3J81j 2K52A 4OO1G 1G291 4UP7A 1L0WA 5IYCH 2UU9L 1WYDA 1MJCA 4DR6L 2JA7G 1HNWQ 3GTLH 2Q2UA 4TQUS 1PH1A 1IBKL 4A93G 1C0AA 2F4VQ 4PG3A 2EQSA 2UUBQ 1W3SA 1AE3A 4KI0A 3GTOH 3MXNB 4HJ5A 2OWOA 4HJ7A 4IFDJ 3DLLA 3K80C 4DPGA 2MNAA 3T1YL 1BBUA 5FJ8G 3FKIH 4P75A 1KRTA 2OCEA 3F2BA 4DV3Q 3S14H 1U5KA 4QL5A 4HIKA 5M5WH 4YY3Q 5IP9G 4MTNA 5HGQA 1DGSA 1EFWA 4GKJQ 1HJPA 4WJ4A 4DKAC 1AH9A 1VQ7A 1V43A 1JMCA 4IPHA 4OWXB 1SR3A 4DV4L 2Q2TA 4LF5L 2LSSA 2EIFA 2KCMA 3PSIA 1XMQL 1NE3A 1E22A 1CSQA 1U0LA 2NVTH 1RIPA 2BA0A 1MKHA 3U50C 2C35B 2R6GA 4AQYQ 1NJIC 2F52A 2YTVA 4O2DA 4DR2Q 4XIGS 1R9TH 1S72A 2DUDA 3NELA 1J5EL 5C0XI 4GLVB 3KFUA 4IOAA 4Y52H 4A3DH 3CD6A 3S16H 3I4NH 2NZHA 4LFCQ 1TWCH 2Y0SE 3CCRA 4DV5L 2JE6I 2VUMG 3FKIG 3F8TA 3A5UA 4HIDA 4DR3Q 4X66Q 5GADC 3J80i 1HNWL 3CCMA 2UUCQ 4BXXH 1IBLQ 4B3TQ 2A19A 3IRBA 4DR1Q 3I55A 4OO1I 2VNUD 1X3GA 4JI1Q 3CAMA 5M3FH 4K0KQ 2R7DA 3JC66 4RG1A 4HJAA 4L5RC 5ELOA 4A3CH 4B3SQ 1YVCA 1VQIA 1WFQA 5LMUQ 4A3IH 2OTJA 4YCVA 4GN5A 1NBWA 4JBJA 4IJLA 4DV3L 2IHFA 2E8GA 1Q1BA 2AWOA 2ID0A 2VW9A 1XNQL 3J7ZC 2N3SA 3TQYA 4JI5Q 2JA6H 1H95A 1O7IA 3F1ZA 3PUXA 3F2DA 4A3DG 5FLMH 4DV1Q 1D7QA 1WCMG 1B8AA 1N36Q 1E3PA 3CPWA 4JOIC 3VDYA 3CMAA 3RR5A 3G71A 4AQYL 1PH4A 1X6OA 1X9NA 4JI6L 2ZTDA 4DR2L 1FJGQ 4GLXA 1A8VA 3EIVA 2JEBI 3W1BA 3HFZB 1IBMQ 1WJJA 1OTCA 3PIOA 3AFPA 2ZTEA 3D31A 1JJ2A 1JJGA 1N34Q 2K5VA 1VQHA 4A3GH 4A3CG 1BBWA 3M4OH 4LFCL 4EQ5A 3CW2C 4JI4L 4LF7Q 3M9BA 3L2PA 4DR3L 3J80c 4X66L 4DAYB 4BBRH 4AYBE 2K5NA 1YHAA 2B29A 2UUCL 1A63A 1IBLL 4B3TL 2WFWA 2PQAA 4MZ9A 4DR1L 2JA6G 1GD7A 5ELNA 2VQFQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 c;  4K0K L;  1VQ5 A;  2IY5 B;  1EOV A;  4L5T A;  1HNX L;  3RN2 A;  4A3K H;  3A0J A;  3PIP A;  2HQL A;  4B3S L;  4KHP Q;  2WB1 E;  3T1Y Q;  4GN4 B;  2K4K A;  2WAQ G;  3PV0 A;  1K73 C;  3K7A H;  2JA7 H;  3OW2 A;  4JI5 L;  4APV A;  3HOX G;  1V1Q A;  4P71 A;  4A3G G;  4A93 H;  4JYA L;  1X3F A;  1E7Z A;  3ZJY C;  1EYG A;  4P73 A;  1Q8K A;  1VQA A;  1MIU A;  4C3I H;  5AJ3 L;  3KJP A;  1EQQ A;  4LF5 Q;  2E2J H;  4IFD G;  4WJ3 M;  1NMG A;  3MEF A;  1Z47 A;  1XMQ Q;  4R4Q A;  5FJ8 H;  5IE8 A;  1I94 Q;  4A3J G;  1FJG L;  3CC7 A;  4IPD A;  1J5E Q;  5IP9 H;  2K5H A;  1VQ8 A;  4ME3 A;  1UWV A;  5GAH C;  3JAM c;  3CCE A;  3S1N H;  2BH8 A;  4LWC A;  2YTY A;  2Z6K C;  3RZD H;  1XPR A;  1PH7 A;  4BA2 I;  2D0P A;  3S1R H;  3GDE A;  4R4O A;  1VQ4 A;  2AHO B;  4LF7 L;  1NMF A;  4DV5 Q;  1XMO L;  1E1O A;  1I6H H;  4BY1 G;  1K9M C;  2YYZ A;  3K7U C;  1UE7 A;  5C4X G;  2IT1 A;  3G48 A;  1Q81 C;  3LGJ A;  2VQF L;  3KYH C;  1PVO A;  3PUV A;  4LF6 Q;  1VQM A;  4FDB A;  5C3E H;  1X3E A;  2JA9 A;  4KHP L;  1LUZ A;  1XPO A;  2PNH A;  4DAM A;  3KF8 B;  2R92 H;  1KC8 C;  3J7A 5;  2VUM H;  1UE1 A;  3BU2 A;  1V9P A;  3PUZ A;  4IPC A;  4PZ6 A;  4R4T A;  4R4I A;  1CKM A;  3CME A;  1HNZ Q;  4C2M H;  4UP8 A;  2YU9 H;  2N49 A;  4A3B G;  4YCW A;  1SN8 A;  1XNQ Q;  1FGU A;  3RZO H;  1YEZ A;  3PO2 H;  4JOI A;  3KLW A;  2PQA B;  1XJV A;  4NXM Q;  5C4J H;  2RHS B;  3E9H A;  3PF5 A;  3PUY A;  4OWW B;  3HOV H;  4GKK L;  1B7Y B;  4IJH A;  1I94 L;  1VQ6 A;  4LFB Q;  4DUY Q;  3SGI A;  4OON A;  2AKW B;  4JI6 Q;  1PH9 A;  1D8L A;  4IFD I;  4IO9 A;  1Q7Y C;  1JT8 A;  1IYJ B;  5JEA G;  5C3E G;  2HIV A;  1WCM H;  4JCV E;  4OXP A;  1X55 A;  2KHI A;  2PI2 A;  2UUA Q;  3GTG H;  4JI4 Q;  3UDF A;  3CCL A;  2FXQ A;  2R92 G;  1UEB A;  2JA8 H;  5IYD H;  4GNX A;  1HH2 P;  1YBY A;  2DGY A;  1VS0 A;  2F3I A;  1SFO H;  1NY4 A;  1LYL A;  2OQ0 A;  1W2B A;  5IY0 A;  1OXS C;  2Z0S A;  2B3G A;  3CCV A;  1PYB A;  3PO2 G;  1KHI A;  1QUQ A;  1C9O A;  3ULP A;  4R4C A;  4JBW A;  4LF6 L;  2VL6 A;  4DR5 L;  3S17 H;  4POF A;  3E9I A;  1KD1 C;  3HOV G;  1HNX Q;  3RNU A;  2Y0S G;  4EX5 A;  1Q82 C;  2UXC L;  1I50 H;  1K8A C;  2OTL A;  1AE2 A;  1HNZ L;  4GOP A;  4UP9 A;  3K81 C;  4QY7 A;  4X6A H;  4KLK A;  5EAY A;  2LXJ A;  1SRU A;  1YNX A;  4IPG A;  4JI1 L;  1VQL A;  5M5Y H;  3A5Z B;  2KBN A;  2LXK A;  1B70 B;  4NXM L;  4JYA Q;  3M7N A;  1OXV A;  3UDI A;  2E5L L;  4PZ7 A;  3UDX A;  5IYD G;  5AJ3 Q;  3KF6 A;  2CQO A;  2XTI A;  3W1G A;  1EIY B;  1BKB A;  5M3M H;  3D0F A;  4HIO A;  2JA8 G;  2R7Z G;  3S15 H;  4LFB L;  4DUY L;  1Y1V H;  1YZ6 A;  2R7F A;  2EXD A;  2Z6K A;  4BBS H;  1KRS A;  4LF8 Q;  2ZTC A;  3HOX H;  4OWT B;  3HKZ E;  4QIW E;  1K3R A;  2BH2 A;  1KIX A;  1CKO A;  1FVI A;  4QJF A;  3TS2 A;  3JAM i;  4L5S A;  3CPF A;  4L5Q A;  2UUA L;  2CWP A;  3TRZ A;  1S3O A;  4JBK A;  1VQF A;  4B3M Q;  4GNX C;  2IHE A;  1XMO Q;  2I5M X;  4A3F H;  4JI7 Q;  3PUW A;  4A3J H;  1YJW A;  1P8L A;  3J81 i;  3HKZ G;  3HOW H;  1YJ9 A;  2QGQ A;  3WWV A;  2JJQ A;  3CCS A;  5DLQ E;  3NEM A;  1IL2 A;  2UXB L;  1Z9F A;  2ALY B;  2XGT A;  5M3M G;  2QA4 A;  1M90 C;  1N32 Q;  1SMX A;  2GN5 A;  4AYB G;  3STB C;  1Y1V G;  4BY1 H;  2ATW A;  4XTC S;  3PO3 G;  3OTO Q;  4LUV A;  1JJC B;  4GNX B;  5C4X H;  2E2H H;  4BBS G;  2K75 A;  4KHZ A;  3U4Z A;  1QZG A;  1ASZ A;  3TS0 A;  3BJU A;  1QUQ B;  3H3V I;  2WB1 G;  1K83 H;  4DV0 Q;  1QVG A;  1N32 L;  5JJL A;  4GKK Q;  1CUK A;  4OX9 L;  1T9H A;  3CCU A;  5LMN Q;  4A3F G;  1EQR A;  1X56 A;  3RLF A;  4A3B H;  4GN3 B;  4A4I A;  2VQE Q;  4GOP B;  2QEX A;  1VQJ A;  4LF8 L;  3HOW G;  2VZA A;  3S2H H;  3KJO A;  3KOJ A;  3UE1 A;  1L1O C;  1YHB A;  2D0O A;  3RN5 A;  4DR4 Q;  4BA1 I;  4B3M L;  1VQB A;  2VY3 A;  3AFQ A;  5K36 G;  2MO0 A;  1YI2 A;  4JI7 L;  3KF6 B;  3J81 c;  2H5X A;  4LF9 L;  4YWM A;  1XTD A;  1EIF A;  4P74 A;  3CXC A;  1M1K C;  4JBM A;  3UDG A;  4JV5 Q;  3HOY H;  1PH6 A;  3M4Q A;  4DV6 L;  1VQG A;  5M5X H;  3H15 A;  4DR5 Q;  1WI5 A;  4POG A;  3OYY A;  2UXC Q;  1LTL A;  4DK6 C;  1IXR A;  3G4S A;  4NXN Q;  1UE5 A;  3EBE A;  2HHH L;  1SE8 A;  4UPA A;  4H02 A;  1PH3 A;  4QGU A;  3GD7 A;  3I7F A;  4LW1 A;  3OTO L;  4JC0 A;  1I5F A;  4A3M H;  1CSP A;  2KEN A;  4HJ8 A;  4LF4 Q;  4YHH Q;  3AYH B;  3K8A A;  3HOZ G;  1OXT A;  3KDF B;  3HKS A;  2B63 G;  2MFI A;  3M4P A;  1C7Y A;  4BY7 H;  2A1A A;  4DR7 Q;  4DV0 L;  1CKN A;  1HR0 W;  2E5L Q;  2IX0 A;  1GM5 A;  4R1J A;  4HJ9 A;  3ERS X;  3ULL A;  5H1S E;  2NN6 G;  5LMN L;  2IX1 A;  1I3Q H;  3H3V H;  3A74 A;  1JB7 A;  2NVY H;  3I4O A;  4LUZ A;  2ZM6 L;  3PF4 A;  4NPS A;  2VQE L;  2HT1 A;  2JK8 A;  5C0X J;  1N8R C;  1MJE A;  3M85 A;  3ULJ A;  4IOC A;  2BA1 A;  3H0G G;  4GLA C;  1HR0 Q;  3E0E A;  2NZO A;  3HOY G;  1GVP A;  1WOC A;  2ZJQ A;  1HZC A;  2K14 A;  4A3E H;  3K0X A;  4A3L H;  1X65 A;  4DR4 L;  1YHQ A;  3GTK H;  4JI8 Q;  4LNQ A;  1QVF A;  4X65 L;  1J6Q A;  3CCQ A;  2R7Z H;  3HOU H;  2PMZ E;  4A3M G;  4QQB X;  3RLO A;  3S1Q H;  1Q12 A;  3DM3 A;  1TWA H;  5IYC G;  4X64 L;  3GTQ H;  3ER0 A;  4YWK A;  5GAE C;  4JV5 L;  1VQO A;  4JI3 Q;  1Q1E A;  4JI0 L;  4BY7 G;  3FHW A;  4MNO A;  1KL9 A;  2L15 A;  1SLJ A;  3S2D H;  4NXN L;  4DUZ Q;  2UXB Q;  1NTG A;  1VQD A;  2OQK A;  4DV2 L;  1VQN A;  3Q8D A;  1GO3 E;  2I0Q A;  2KCT A;  2JQO A;  1YJN A;  3U4V A;  1VQK A;  4LF4 L;  4YHH L;  1EWI A;  3CQZ H;  2ZJR A;  5C44 H;  1N33 Q;  3FP9 A;  1E1T A;  2R93 H;  2GVA A;  2MQH A;  1VQP A;  1QZH A;  1G51 A;  2GVB A;  2CWA A;  4DR7 L;  4JI2 Q;  3TRE A;  1KXL A;  4A3E G;  1PHJ A;  5GRO A;  4A3L G;  1TWG H;  3F2C A;  1VQE A;  1TXY A;  3HOU G;  4UY8 C;  2F4V L;  4OX9 Q;  2UUB L;  4JG2 A;  1G6P A;  5E7N A;  2V1C C;  1IZ6 A;  3ICE A;  1PA6 A;  3PO3 H;  3S1M H;  1L1O A;  5IP7 H;  5BR8 Q;  1HR0 L;  2Q2I A;  4GS3 A;  4DK3 C;  2YTX A;  2Q2H A;  3G6E A;  3S24 A;  1VQC A;  1PH5 A;  3PCO B;  1RL2 A;  2K50 A;  3I56 A;  2NN6 I;  2RCN A;  4YCU A;  2CFM A;  3GTJ H;  2YV5 A;  3T1H Q;  2MO1 A;  4YY3 L;  4A75 A;  5IYB H;  1PV4 A;  1FL0 A;  1LM0 A;  4PMW A;  4P72 A;  4GKJ L;  4JI8 L;  1CKN B;  1Q46 A;  2JA5 H;  1XNR Q;  3AEV A;  3CP0 A;  4LUO A;  3KDF A;  1EUJ A;  2WP8 J;  5JEA J;  3I4N G;  5IWA Q;  4LF9 Q;  1JE5 A;  2ES2 A;  2HIX A;  5C44 G;  3NBH B;  2N78 A;  4JI3 L;  2CCZ A;  2R93 G;  4LFA Q;  3B6Y A;  4B3R Q;  4DV7 Q;  4DV6 Q;  4DUZ L;  4BXX G;  1E24 A;  3L7Z C;  5J3B A;  4X62 Q;  2CKZ B;  4RMF A;  2HHH Q;  1VCI A;  1ASY A;  5M3F G;  4ALP A;  2UXD Q;  4AIM A;  2N8N A;  1K0R A;  4J15 A;  1A62 A;  3L0O A;  4HIM A;  1QVC A;  2PI2 E;  2KHJ A;  5GQO A;  5IP7 G;  1Y1W H;  1PH8 A;  1UE6 A;  3M3Y H;  1L2F A;  2RF4 A;  1VQ9 A;  4A3I G;  1N33 L;  5LMN W;  5JJI A;  2UU9 Q;  1SRO A;  3BZC A;  5GAG C;  2WAQ E;  4JI2 L;  3I4M H;  4YWL A;  3RLN A;  1YIT A;  4DR6 Q;  5IYB G;  3CC4 A;  5HY6 A;  1S40 A;  1Y14 B;  1IBK Q;  1XPU A;  1A0I A;  5FLM G;  2RHQ B;  2JA5 G;  1P16 A;  1KAW A;  2AWN A;  2ZM6 Q;  5BR8 L;  3CCJ A;  5LMU L;  3STB D;  3HOZ H;  2I5L X;  4TVA B;  2I5H A;  3W5O A;  3BZK A;  2B63 H;  1N9W A;  1OXX K;  3EN2 A;  3GTP H;  3T1H L;  1PFS A;  2VS1 A;  3CF5 A;  1HZ9 A;  1OXU A;  1KQS A;  4Y7N H;  1PH2 A;  2NVQ H;  1TWH H;  5FLX c;  4PZ8 A;  4GOP C;  3GO5 A;  4DV1 L;  1XNR L;  4NB3 A;  4X65 Q;  3UE0 A;  3AQQ A;  4C3J H;  1Y1W G;  3CC2 A;  4AH6 A;  5IWA L;  2ASB A;  5C0X G;  4DV4 Q;  1N36 L;  5JJK A;  2AMC B;  2A8V A;  2ZJP A;  3I2Z A;  1HZA A;  4X64 Q;  4LFA L;  3H0G H;  4B3R L;  1L1O B;  1PYS B;  4BBR G;  3TEH B;  4DV7 L;  2NVX H;  4JI0 Q;  3I4M G;  1GKH A;  1TWF H;  3U58 A;  1YIJ A;  1BVS A;  4X62 L;  1Q86 C;  1IBM L;  2E2I H;  2D62 A;  3GTM H;  4A76 A;  1X54 A;  4DV2 Q;  3PGZ A;  1N34 L;  1HZB A;  4C3H H;  1K8G A;  2JEA I;  4O0A A;  2UXD L;  4A3K G;  3NEN A;  4DNI A;  3J81 j;  2K52 A;  4OO1 G;  1G29 1;  4UP7 A;  1L0W A;  5IYC H;  2UU9 L;  1WYD A;  1MJC A;  4DR6 L;  2JA7 G;  1HNW Q;  3GTL H;  2Q2U A;  4TQU S;  1PH1 A;  1IBK L;  4A93 G;  1C0A A;  2F4V Q;  4PG3 A;  2EQS A;  2UUB Q;  1W3S A;  1AE3 A;  4KI0 A;  3GTO H;  3MXN B;  4HJ5 A;  2OWO A;  4HJ7 A;  4IFD J;  3DLL A;  3K80 C;  4DPG A;  2MNA A;  3T1Y L;  1BBU A;  5FJ8 G;  3FKI H;  4P75 A;  1KRT A;  2OCE A;  3F2B A;  4DV3 Q;  3S14 H;  1U5K A;  4QL5 A;  4HIK A;  5M5W H;  4YY3 Q;  5IP9 G;  4MTN A;  5HGQ A;  1DGS A;  1EFW A;  4GKJ Q;  1HJP A;  4WJ4 A;  4DKA C;  1AH9 A;  1VQ7 A;  1V43 A;  1JMC A;  4IPH A;  4OWX B;  1SR3 A;  4DV4 L;  2Q2T A;  4LF5 L;  2LSS A;  2EIF A;  2KCM A;  3PSI A;  1XMQ L;  1NE3 A;  1E22 A;  1CSQ A;  1U0L A;  2NVT H;  1RIP A;  2BA0 A;  1MKH A;  3U50 C;  2C35 B;  2R6G A;  4AQY Q;  1NJI C;  2F52 A;  2YTV A;  4O2D A;  4DR2 Q;  4XIG S;  1R9T H;  1S72 A;  2DUD A;  3NEL A;  1J5E L;  5C0X I;  4GLV B;  3KFU A;  4IOA A;  4Y52 H;  4A3D H;  3CD6 A;  3S16 H;  3I4N H;  2NZH A;  4LFC Q;  1TWC H;  2Y0S E;  3CCR A;  4DV5 L;  2JE6 I;  2VUM G;  3FKI G;  3F8T A;  3A5U A;  4HID A;  4DR3 Q;  4X66 Q;  5GAD C;  3J80 i;  1HNW L;  3CCM A;  2UUC Q;  4BXX H;  1IBL Q;  4B3T Q;  2A19 A;  3IRB A;  4DR1 Q;  3I55 A;  4OO1 I;  2VNU D;  1X3G A;  4JI1 Q;  3CAM A;  5M3F H;  4K0K Q;  2R7D A;  3JC6 6;  4RG1 A;  4HJA A;  4L5R C;  5ELO A;  4A3C H;  4B3S Q;  1YVC A;  1VQI A;  1WFQ A;  5LMU Q;  4A3I H;  2OTJ A;  4YCV A;  4GN5 A;  1NBW A;  4JBJ A;  4IJL A;  4DV3 L;  2IHF A;  2E8G A;  1Q1B A;  2AWO A;  2ID0 A;  2VW9 A;  1XNQ L;  3J7Z C;  2N3S A;  3TQY A;  4JI5 Q;  2JA6 H;  1H95 A;  1O7I A;  3F1Z A;  3PUX A;  3F2D A;  4A3D G;  5FLM H;  4DV1 Q;  1D7Q A;  1WCM G;  1B8A A;  1N36 Q;  1E3P A;  3CPW A;  4JOI C;  3VDY A;  3CMA A;  3RR5 A;  3G71 A;  4AQY L;  1PH4 A;  1X6O A;  1X9N A;  4JI6 L;  2ZTD A;  4DR2 L;  1FJG Q;  4GLX A;  1A8V A;  3EIV A;  2JEB I;  3W1B A;  3HFZ B;  1IBM Q;  1WJJ A;  1OTC A;  3PIO A;  3AFP A;  2ZTE A;  3D31 A;  1JJ2 A;  1JJG A;  1N34 Q;  2K5V A;  1VQH A;  4A3G H;  4A3C G;  1BBW A;  3M4O H;  4LFC L;  4EQ5 A;  3CW2 C;  4JI4 L;  4LF7 Q;  3M9B A;  3L2P A;  4DR3 L;  3J80 c;  4X66 L;  4DAY B;  4BBR H;  4AYB E;  2K5N A;  1YHA A;  2B29 A;  2UUC L;  1A63 A;  1IBL L;  4B3T L;  2WFW A;  2PQA A;  4MZ9 A;  4DR1 L;  2JA6 G;  1GD7 A;  5ELN A;  2VQF Q; 
#chains in the Genus database with same CATH topology
 3GTJ B;  1EOV A;  2SNM A;  2QF7 A;  4GN4 B;  1SMY C;  1I4H A;  3ONA B;  3JAM E;  4KD3 A;  2SDF A;  1WTH A;  3MXG A;  2QIL A;  1KAA A;  3MWY W;  2BOS A;  2IW3 A;  2F0W A;  1HQM C;  4H7B A;  4P71 A;  1HFN A;  2A73 B;  3J81 E;  5T1G A;  1VQA A;  1MIU A;  3M4Y A;  5AJ3 L;  3MEF A;  1IW7 C;  4KY6 A;  3V96 A;  1I94 Q;  1FJG L;  3CC7 A;  5CYU A;  4IPD A;  4DN4 M;  1NNX A;  3H91 A;  3I4M B;  1VQ8 A;  2BDO A;  1E2Z A;  4LWC A;  4FF2 A;  4LF7 L;  1NMF A;  2K7V A;  1XMO L;  1I6H H;  2YYZ A;  3K7U C;  5COR A;  4RCO A;  2IT1 A;  5A35 A;  1R4Q B;  3FDT A;  2VQF L;  3OWE B;  5HUR A;  1VQM A;  1ET9 A;  4NKL A;  5C3E H;  2JA9 A;  4KHP L;  1LUZ A;  1AFP A;  5G3L F;  1D5Z C;  4FF4 A;  4IPC A;  4R4T A;  5C5L A;  4R4I A;  4IAL A;  4A3B G;  4IUN A;  4UP8 A;  4C2M H;  1SN8 A;  5IOC A;  1YEZ A;  3PO2 H;  2EYL A;  2XWB B;  2RHS B;  5C4J H;  3PF5 A;  5EBD A;  1UEA B;  1D5X C;  3HZX A;  3TDQ A;  3TME A;  1DON A;  4K5W A;  4LFB Q;  3SGI A;  1D8L A;  4IFD I;  4G4K A;  5LHY 1;  1Q7Y C;  2XVS A;  3GTL B;  5C3E G;  2DJG C;  1WCM H;  4OXP A;  4DK0 A;  2PI2 A;  2FXQ A;  4GNX A;  2PMZ B;  1HH2 P;  2NUC A;  1IKL A;  2DGY A;  5EPL A;  4FXD A;  4OL7 A;  1SFO H;  2OQ0 A;  1W2B A;  1ZKO A;  2FFK B;  1PYB A;  3PO2 G;  5D14 A;  1C9O A;  4JPB W;  2VL6 A;  3S17 H;  4C2M B;  3QWN A;  4EQN A;  2EE1 A;  1E0B A;  3VYR A;  1CA6 A;  1MSH A;  1HNZ L;  4BWG B;  5C4J B;  1ROD A;  5IGC A;  5EAY A;  3I90 A;  4X3U A;  4OEM B;  1L0Y B;  1B70 B;  4JYA Q;  1OXV A;  2PPB C;  4PZ7 A;  4ZYS A;  2CQO A;  1EIY B;  2K33 A;  5ELE A;  3A8J E;  3BZD B;  1WCM B;  1Y1V H;  2OEO A;  2XSC A;  5CR3 A;  2NTS A;  4BBS H;  1H9K A;  2ZTC A;  3HOX H;  3G7L A;  1KIX A;  2XRS D;  1IL8 A;  3TRZ A;  4G7O C;  3S17 B;  4JBK A;  2IHE A;  1LO5 D;  1HPC A;  3PUW A;  1DXM A;  3K5O A;  2WAC A;  3HKZ G;  1YNJ C;  2JJQ A;  1ICF B;  5DLQ E;  3NEM A;  2RA4 A;  2XGT A;  2QA4 A;  1F2Z A;  2GN5 A;  3R2I A;  4RKL A;  1Y1V G;  2ATW A;  2A6H D;  3PO3 G;  1PRT F;  3OPO A;  5FO8 B;  2E2H H;  1C48 A;  4BBS G;  4KHZ A;  3U4Z A;  2WAQ B;  4QMG A;  3DUZ A;  3TS0 A;  3BJU A;  3H3V I;  1E2V A;  4X3K A;  1K83 H;  1N32 L;  5JJL A;  4GKK Q;  3C2P A;  3HOX B;  1AZQ A;  1F2M A;  3RLF A;  5FK9 C;  4GN3 B;  4K5V A;  5CV7 A;  3TP7 A;  2Z6B A;  1VQJ A;  3I3C A;  2B2U A;  1WTQ A;  4LF8 L;  2WV6 D;  4BBR B;  3S2H H;  3SK4 A;  3V05 A;  1GHJ A;  2HD3 A;  3LX0 A;  4BA1 I;  1VQB A;  1EY0 A;  2MO0 A;  2JXM B;  4JI7 L;  3SK8 A;  1GUG A;  3J81 c;  1XTD A;  1M1K C;  1CZW A;  4JBM A;  3UI2 A;  2E76 C;  4DR5 Q;  1WI5 A;  4FXK C;  5IT9 L;  4POG A;  4ZQ3 A;  3G4S A;  4L63 B;  1BCP F;  1UUP A;  3EBE A;  1PH3 A;  4LK1 C;  4LW1 A;  2E2J B;  4KV6 A;  4HJ8 A;  2VXW A;  1WTO A;  3K8A A;  1OXT A;  3HKS A;  2M00 A;  3M4P A;  4BY7 H;  2E75 C;  1SE2 A;  2NTT A;  3MHB A;  2IX0 A;  1GM5 A;  2B8F A;  3ULL A;  3U9S A;  5HGT A;  3A74 A;  2ZM6 L;  4LUZ A;  4DFA A;  3PF4 A;  3S1R B;  1N8R C;  3M85 A;  3ULJ A;  1PYW D;  4GLA C;  3IKJ A;  2ZJQ A;  1X65 A;  4DR4 L;  4RH6 A;  2R7Z H;  4X65 L;  1J6Q A;  2K32 A;  1DYQ A;  3RLO A;  2Z4I A;  2R92 B;  1TWA H;  3GTQ H;  4JV5 L;  1ENF A;  2YU9 B;  4BY7 G;  2F0N A;  1SLJ A;  1AZP A;  4HMJ A;  4DUZ Q;  3NQT A;  3RZO B;  4Q0F A;  1VQD A;  2OQK A;  2K6A A;  3Q8D A;  1GO3 E;  2Q8R E;  2JQO A;  3U4V A;  2K5W A;  3NP8 A;  1EWI A;  4EQO A;  3C46 A;  1H9S B;  1BO0 A;  2GVB A;  2HQE A;  4JI2 Q;  2EYP A;  2VB3 X;  1PHJ A;  3F2C A;  3R8B A;  1G8Z D;  1LTR D;  5EBC A;  2UUB L;  1E2W A;  1G6P A;  5E7N A;  3P75 A;  1Q90 A;  3ICE A;  3S1M H;  1PFN A;  5BR8 Q;  1HR0 L;  2Q2I A;  2P5Z X;  2R7Z B;  2F0O A;  2YTX A;  3CRL C;  1LTT D;  3PCO B;  2RCN A;  4XT3 B;  1PV4 A;  1FL0 A;  1II3 A;  1LM0 A;  4P72 A;  4U68 A;  4JI8 L;  3K0Y A;  1V1P B;  1A2U A;  2JA5 H;  1JE5 A;  5IT9 E;  4JI3 L;  2CCZ A;  1QE6 A;  3B6Y A;  3U9O A;  3VR2 A;  4DV7 Q;  5E3F A;  2HDL A;  2ENB A;  2H4O A;  5J3B A;  1K8O A;  1CQV A;  5M5Y B;  4ALP A;  1ESF A;  1MD2 D;  4J15 A;  3L0O A;  1QVC A;  2PI2 E;  1GUN A;  1SYD A;  2KHJ A;  5GQO A;  3S15 B;  5M3M B;  1VQ9 A;  2EYF A;  2XWJ B;  4AYB B;  2UU9 Q;  5GAG C;  3RLN A;  1YIT A;  3CC4 A;  1S40 A;  1A0I A;  2JA5 G;  2E2D C;  3Q0A A;  4FYD A;  2F0M A;  5LMU L;  3STB D;  3HOZ H;  1EQT A;  4TVA B;  4A3F B;  2B63 H;  3T16 A;  1HZ9 A;  1OXU A;  1STN A;  1LTI D;  3GP7 A;  1TWH H;  5FLX c;  2D5D A;  3AQQ A;  3IL8 A;  1UAP A;  4LAA A;  5IWA L;  1T5X D;  3P7J A;  4DV4 Q;  3D6C A;  1BBX C;  5E4X A;  3H0G H;  1HTP A;  1TWF H;  4X62 L;  2E2I H;  3C1E A;  2D62 A;  3NTK A;  1TII D;  4DV2 Q;  1N34 L;  2UXD L;  4S3S A;  1UNS A;  3EA6 A;  2CHB D;  2B39 A;  4IN3 A;  3J81 j;  3MXU A;  4UP7 A;  1LTS D;  5IYC H;  3NK9 A;  2JA7 G;  1HNW Q;  1M4V A;  4TQU S;  4OGQ C;  1IBK L;  3QJY A;  1MBY A;  2B63 B;  3SHL A;  2I46 A;  2F4V Q;  2EQS A;  1W3S A;  1CK1 A;  3MXN B;  2FHT A;  1PTO F;  1TWH B;  1PLF A;  3F2B A;  3S14 H;  1W6J A;  1U4M A;  1STE A;  2L0C A;  5M5W H;  5HGQ A;  3HOY B;  5M5X B;  3VR4 A;  1EYD A;  1VMP A;  4CKC A;  4DKA C;  4WJ4 A;  1VQ7 A;  1QOH A;  4IPH A;  4LF5 L;  1SR3 A;  1XMQ L;  1E22 A;  5ELD A;  1U0L A;  2NVT H;  5I9P A;  3HRZ C;  4AQY Q;  2C35 B;  2R6G A;  1NJI C;  2F52 A;  4O2D A;  4CKE A;  1S72 A;  2EYH A;  4M1U B;  3ZYY X;  3KFU A;  2EY6 A;  4Y52 H;  1CM9 A;  1FR3 A;  2Y0S B;  1TWC H;  4TSS A;  2B2U C;  2IJ0 A;  2O2L D;  2SNS A;  3RD4 A;  1I3Q B;  2VUM G;  2NVY B;  4RA8 A;  1H9J A;  4CJ2 C;  3CCM A;  5C4Z A;  3IRB A;  4DR1 Q;  1HTL D;  4JI1 Q;  5M3F H;  1TS4 A;  3KLS X;  1K8M A;  1LT6 D;  3GTK B;  4A3I H;  3BVG A;  4JBJ A;  4IJL A;  1D1I A;  1JOO A;  2ID0 A;  3KLS A;  1JWM D;  1A15 A;  1XNQ L;  1YNN D;  3AMU A;  2N3S A;  5KYI A;  3PUX A;  5FLM H;  3FRP B;  2M2L A;  4UHV A;  1B8A A;  1ZYR D;  2CQA A;  4RAU C;  1HQR D;  3G71 A;  4XQQ A;  4RGM A;  1X9N A;  4JI6 L;  5FOB B;  1FJG Q;  1TWC B;  3CQZ B;  1A8V A;  2JEB I;  3HFZ B;  1IBM Q;  1R4P B;  1OTC A;  4QIW B;  2ZTE A;  4A3G H;  2F0L A;  3L9A X;  4K6D A;  3HP3 A;  5C0X H;  4LF7 Q;  2F0K A;  1X32 A;  3IFD A;  3VR3 A;  2R61 A;  2B29 A;  1S5D D;  2PQA A;  1IYV A;  4K8J A;  3KJO A;  2VQF Q;  5IT9 c;  1JR0 D;  4OIK A;  2IY5 B;  1HNX L;  3RN2 A;  4A3K H;  1EU4 A;  1A3V A;  2D9U A;  4B3S L;  4KHP Q;  3T1Y Q;  3HS0 C;  1EY9 A;  1XYI A;  1BXT A;  4O1N A;  5ELF A;  1V1Q A;  4A3G G;  1EYG A;  4PQX A;  4P73 A;  1Q8K A;  4IFD G;  3I72 A;  2EY1 A;  1J9O A;  1A2T A;  1NUC A;  4R4Q A;  3OMG A;  2XIW A;  3W3A A;  5FO9 B;  3LWU A;  3M3Y B;  5IP9 H;  3NQI A;  2K5H A;  4B08 A;  2PO4 A;  1XPR A;  1PH7 A;  1I4R A;  2D0P A;  1F9Q A;  2B2T A;  1E1O A;  2DNC A;  4DA2 A;  4A3K B;  5C4X G;  2CW0 D;  2KVM A;  3QO2 A;  1Q81 C;  3KYH C;  4ID6 A;  1LTG D;  3TP6 A;  5JPM C;  1TQO A;  1X3E A;  2NVQ B;  1CHP D;  2PNH A;  3KF8 B;  3J7A 5;  1UE1 A;  1HNZ Q;  2PYK A;  4C3J B;  3I70 A;  1XWE A;  3DXJ C;  3E6Z X;  2A6E D;  4KJN A;  4JOI A;  3SVM A;  4EGV A;  3D8G A;  4MIU A;  3PUY A;  4OWW B;  3HOV H;  5CMD A;  1JIC A;  5KRU A;  1B7Y B;  4C3H B;  1H9R A;  4RCN A;  2R3Z A;  3MFY A;  1PH9 A;  4KKU A;  4IO9 A;  2TMP A;  1JT8 A;  2A74 C;  4XYQ A;  1IYJ B;  3VYS A;  4JCV E;  2OF1 A;  1HUM A;  3GTG H;  4JI4 Q;  3CCL A;  1UEB A;  2EDG A;  3CRK C;  2D2C C;  3FVQ A;  2F3I A;  5JAV A;  4BS9 A;  4GZY C;  1QUQ A;  4IUP A;  3MVV A;  3HOV G;  4EX5 A;  1JC7 A;  3T53 B;  5KIX A;  1D2B A;  4GOP A;  1U9R A;  4KLK A;  5LL6 S;  4IPG A;  1HXY D;  5IGE A;  2LXK A;  3M7N A;  1R9T B;  4R8I A;  1N32 Q;  1BKB A;  3L3O C;  4A3D B;  4DUY L;  1HA6 A;  4G7H C;  2R7F A;  2Z6K A;  5G3L D;  4LF8 Q;  3WOF A;  3OWF A;  3HKZ E;  4QJF A;  3JAM i;  1SJH D;  1S3O A;  3NXW A;  4JI7 Q;  4CDF C;  5JOB A;  1FNW A;  1P8L A;  4KY7 A;  2PZW A;  3J81 i;  2ICI A;  3R2T A;  3HOW H;  1STY A;  2QGQ A;  5EJW A;  2V4D A;  1IL2 A;  1FNV A;  2JA6 B;  1CHQ D;  4IZ8 A;  2DJF C;  2RQX A;  1PXU A;  2K75 A;  1SYF A;  2G9H D;  2RKS A;  3GV3 A;  3I4L A;  3VR5 A;  4KK7 A;  3A8K E;  2K04 A;  1XXG A;  4KMU C;  5T1I A;  2QDL A;  1CTM A;  1CUK A;  3CCU A;  3IAY A;  3M4O B;  1K0S A;  1X56 A;  4A3B H;  3NWS A;  5KNB A;  1LT3 D;  1S5C D;  1O7Y A;  3HOW G;  5CV9 A;  2C5C A;  1STB A;  1ML0 D;  1YHB A;  1QJO A;  2D0O A;  3RN5 A;  4DR4 Q;  4B3M L;  2VY3 A;  3KF6 B;  4K8I A;  5C5M A;  1O7Z A;  2H5X A;  4ZCK A;  3J80 L;  2AQ2 B;  2RSO A;  4P74 A;  3K58 A;  3CXC A;  1LAB A;  2KHS A;  3UDG A;  4JV5 Q;  2OTJ A;  4DV6 L;  1VQG A;  1CA5 A;  2UXC Q;  4DK6 C;  4ODG A;  1JE4 A;  2HHH L;  1SE8 A;  2KEE A;  4QGU A;  3GD7 A;  3Q24 A;  3SR1 A;  1GUO A;  4NMZ A;  1SYC A;  3AYH B;  1FGB D;  4HSV A;  1QNU A;  3ITP A;  4F87 A;  5FLX L;  4A3B B;  2KUM A;  4DV0 L;  2K03 A;  1CKN A;  2E5L Q;  4HJ9 A;  3ERS X;  5LMN L;  2IX1 A;  3PMF A;  2JK8 A;  5C0X J;  1HR0 Q;  1I6H B;  4IOC A;  2BA1 A;  3E0E A;  1GVP A;  3A54 A;  4UDU C;  4B9X A;  1PRT D;  4N8X 1;  1HZC A;  2X69 A;  2K14 A;  4A3L H;  1B1Z A;  4DXF A;  3TP8 A;  4CDC C;  1YHQ A;  1F77 A;  4JI8 Q;  1EY5 A;  3HOU H;  3CCQ A;  5C3E B;  4HMI A;  2M9V A;  5CV4 A;  4IUT A;  4JI3 Q;  1TS5 A;  3FHW A;  3P20 A;  2L15 A;  2F0P A;  4MNO A;  5EPK A;  3S2D H;  4NXN L;  2UXB Q;  4U67 3;  3PO2 B;  1MSG A;  1NTG A;  2PZT A;  4CBV A;  2LKV A;  1VQN A;  4Q5V A;  3WDN A;  4ZUI A;  2I0Q A;  1STH A;  4MHE A;  4YHH L;  1I6V C;  2ZJR A;  5IGD A;  4ZKB B;  2R93 H;  1G6Z A;  2GVA A;  2MQH A;  4XQJ A;  1GJX A;  2CWA A;  1LAC A;  1KNA A;  4A3L G;  1TWG H;  1D5M C;  2BE5 D;  3HOU G;  4UY8 C;  4OX9 Q;  4JG2 A;  5J22 A;  2OT2 A;  1MHW C;  2MJ8 A;  2V1C C;  3OSO A;  5CBA E;  3PO3 H;  1BCP D;  1EFI D;  1L1O A;  1EYC A;  1NAP A;  3G6E A;  1RDP D;  4DK3 C;  1VQC A;  1SFO B;  1LTA D;  2NN6 I;  4YCU A;  2WII B;  2YV5 A;  4YY3 L;  1ICW A;  5IYB H;  4UAI A;  2F0Q A;  3J80 E;  4ZAI A;  4DAV A;  1TY2 A;  1Q46 A;  5C4H A;  4LUO A;  1EUJ A;  5IWA Q;  4LF9 Q;  2FJ2 A;  3NBH B;  2R93 G;  5BN3 A;  1SYG A;  3HEJ A;  1EYA A;  4F8M A;  4BXX G;  5M9O A;  1DZ1 A;  4X62 Q;  4P2C B;  1SXT A;  4RMF A;  1PZK D;  4FNF A;  2UXD Q;  4AIM A;  3J7A F;  4LJZ C;  1Y1W H;  1TWG B;  1UE6 A;  2RF4 A;  5FLX E;  1N33 L;  5LMN W;  3DWP A;  3BZC A;  1Q8I A;  1Y1V B;  2HCI A;  4BBS B;  4HSP A;  2QKI C;  4G57 A;  5IYB G;  2LY7 A;  1Y14 B;  2N88 A;  1IBK Q;  1BUV T;  1XPU A;  2PCF B;  3NUC A;  2QW7 A;  1TR5 A;  3ND9 A;  1KAW A;  3R3O A;  2I5L X;  3BZK A;  1EU3 A;  3GTP H;  3T1H L;  3CF5 A;  2F0H A;  3ERO A;  4ULL A;  3CKI B;  4Y7N H;  1PH2 A;  4GOP C;  3GO5 A;  4DV1 L;  1XNR L;  1LTB D;  5DNF A;  1Y1W G;  2K1B A;  4AH6 A;  3OMC A;  1LLR D;  4IUR A;  3BYT B;  3I2Z A;  4X64 Q;  4B3R L;  1PMR A;  4BBR G;  4K6L A;  4JI0 Q;  2E2H B;  3U58 A;  2QDB A;  1OO9 B;  1EOT A;  2PW5 A;  1PZJ D;  1K83 B;  1VF5 C;  4PNY A;  5CV8 A;  4H44 C;  4QB4 A;  1HCZ A;  2LFN A;  3OOC A;  2F1M A;  1M8A A;  2Q2U A;  1PH1 A;  4HN7 A;  4A93 G;  2Z9H A;  1T5E A;  3S2H B;  2B2V C;  3GTO H;  2EJG C;  3BS1 A;  4Y7N B;  3QOJ A;  2A69 D;  4XT1 B;  4CDE C;  5FJ8 G;  3FKI H;  4P75 A;  5TSS A;  2B2Y A;  1U5K A;  2HDM A;  1DOM A;  1PRT C;  4MTN A;  4GKJ Q;  1IHZ A;  4JK1 C;  1V43 A;  1XX8 A;  3URY A;  4OWX B;  3C3L A;  1GXD C;  4DAY A;  2KCM A;  3PSI A;  3MAQ A;  1NE3 A;  2BA0 A;  1F2Y A;  2YTV A;  2Q8T A;  2L12 A;  4DGZ A;  2LMC B;  3EFX D;  4BY7 B;  1F9S A;  1VDZ A;  5EQ0 A;  2QEJ C;  4IOA A;  1WVL A;  4G7Z C;  2Y0S E;  3FKI G;  4HAE A;  3GTO B;  5IGB A;  5GAD C;  5NUC A;  4OO1 I;  1X3G A;  4QF4 A;  3KUP A;  4HJA A;  4L5R C;  5ELO A;  4B3S Q;  1TKW B;  1WFQ A;  5D3I B;  4YCV A;  4KHV A;  4DV3 L;  2IHF A;  5I6Y A;  1SAP A;  2AWO A;  1TWA B;  3GTQ B;  3S9W A;  5C3X A;  4FXG C;  1A6X A;  1O7I A;  3F2D A;  1D7Q A;  3H94 A;  3LWE A;  2NB0 A;  5C6A A;  1N36 Q;  1E3P A;  1J8I A;  1SJE D;  3H6M A;  2DY8 A;  3RR5 A;  3CMA A;  1PH4 A;  2K5Q A;  2ZTD A;  4DR2 L;  1PTO D;  3W1B A;  1SYE A;  3AFP A;  2X6G A;  1VQH A;  3ERQ A;  1KLG D;  2A6H C;  4EQ5 A;  3MEH A;  3T51 B;  3D4W A;  3L2P A;  5CC4 A;  3J80 c;  2F0S A;  1H9M A;  4X66 L;  3S1M B;  5KND A;  5IGF A;  1IBL L;  2SOB A;  4CKB A;  1IKM A;  1GD7 A;  4GNX C;  5IOD A;  5ELC A;  1VQ5 A;  1NR2 A;  3FMC A;  4HCS A;  3PIP A;  2HQL A;  2WB1 E;  1FD7 D;  1CQF A;  3CHB D;  2JA5 B;  3K7A H;  4V0B A;  3T13 A;  5KGU A;  2RDH A;  2ZXP A;  2PW7 A;  2JA7 H;  3TP5 A;  1V1O A;  4JI5 L;  1WTP A;  1SDF A;  4ZKC B;  1KTK A;  4APV A;  1EL0 A;  4JYA L;  1X3F A;  4RWS C;  3KJP A;  4C3I H;  4WJ3 M;  5J1Z A;  4I7A A;  1Z47 A;  1WTR A;  4ZLT F;  5IE8 A;  4A3J G;  2F3W A;  4CHT B;  2RBM A;  1PDQ A;  3NBI A;  1J5E Q;  3NTH A;  1UWV A;  5GAH C;  3S1N H;  2BH8 A;  3RZD H;  2YTY A;  3GDE A;  1VQ4 A;  2AHO B;  1SBB B;  4DV5 Q;  4BY1 G;  4WFN 3;  4IUQ A;  1K9M C;  1RTO A;  1UE7 A;  2NWG A;  3RUZ A;  4XQN A;  3E5S A;  3NSW A;  3HOZ B;  3LGJ A;  3K7A B;  2NZ1 D;  3LNN A;  1PVO A;  3R93 A;  2K28 A;  5JEA H;  4C3I G;  1RF2 D;  3X3N A;  2AUJ D;  4DAM A;  2PZU A;  1JWS D;  3W2D A;  2VUM H;  1W6K A;  3PUZ A;  2RSN A;  1SNC A;  4R9W A;  1WTV A;  3SXH A;  3VR6 A;  4RGT A;  3H0G B;  4KN7 C;  4HR7 B;  1XJV A;  1U4P A;  1TWF B;  2E2I B;  4GKK L;  1QWY A;  4KD4 A;  4X3S A;  4IJH A;  3S1N B;  1EEI D;  4DUY Q;  1JB3 A;  2AKW B;  1ET6 A;  4TKO B;  1KLU D;  5ELB A;  4FF3 A;  3KBX A;  5JEA G;  1Z6H A;  2FMM A;  3DM1 A;  2A68 D;  2HIV A;  1X55 A;  2F0U A;  3BVM A;  5IYD H;  3UDF A;  3AB9 A;  2JA8 H;  3BVZ A;  1YBY A;  2BDN A;  1NY4 A;  4DU9 A;  1DD2 A;  1OXS C;  2Z0S A;  1KHI A;  3ULP A;  5E4W C;  2VUM B;  4FF1 A;  4JBW A;  2Z8L A;  4LF6 L;  4DR5 L;  3QIA A;  3S14 B;  3H3V C;  4PMB A;  5M5W B;  2Y0S G;  2KCN A;  3EJI A;  2OTL A;  1AE2 A;  1FYC A;  3K81 C;  4QY7 A;  4X6A H;  5I2X A;  2LXJ A;  1SRU A;  2NVT B;  1HRJ A;  2ZT9 C;  3A5Z B;  4NXM L;  1WD0 A;  3UDX A;  5IYD G;  5AJ3 Q;  3W1G A;  2JA8 G;  2CH4 W;  1Y8N B;  1YZ6 A;  3F2U A;  3A56 A;  1A3T A;  2BH2 A;  1K3R A;  4XDX A;  1FVI A;  3TS2 A;  3CPF A;  2DY7 A;  4KN4 C;  2UUA L;  4IFD H;  2CWP A;  5M3F B;  1VQF A;  4B3M Q;  3A55 A;  1XMO Q;  2B2Y C;  2EYJ A;  1AW7 A;  1SEB D;  2MHV A;  4A3I B;  3AU7 A;  3WWV A;  2JYO A;  3CCS A;  2L9H A;  3IFT A;  3G6J B;  1M90 C;  2KCC A;  1WTX A;  3MC0 B;  4R8N A;  3STB C;  4GNX B;  5C4X H;  2F03 A;  4O42 A;  1STA A;  2RCF A;  2DNE A;  2J4X A;  2HUG A;  2WB1 G;  4DV0 Q;  1QVG A;  4DNT B;  4A3G B;  1T9H A;  1Y8O B;  5LMN Q;  1ENC A;  1EQR A;  5FO7 B;  2QCP X;  1SMY D;  2QEX A;  1F2L A;  2VZA A;  3K5N A;  2O5J C;  1KDA A;  2ZXR A;  3KOJ A;  4DK1 A;  1DOK A;  1KAB A;  5DAU A;  5K36 G;  4J1M A;  1B53 A;  3Q23 A;  1PFB A;  1H9S A;  1EIF A;  1IW7 D;  3MZ5 A;  5EKK A;  5BN5 A;  3K6O A;  5C4X B;  4DNR B;  1LTL A;  4NXN Q;  1IXR A;  3TN2 A;  4UPA A;  4H02 A;  1I4G A;  3OTO L;  4A3M H;  5BN4 A;  1CSP A;  2J0T D;  4YHH Q;  1EWH A;  1C7Y A;  1V1P A;  3N6R A;  1GHK A;  1WTW A;  4R1J A;  3MXP A;  5H1S E;  2NN6 G;  3H3V H;  2L11 A;  2VQE L;  2FMC A;  1MJE A;  1I4Q A;  4K2L A;  4ABN A;  2E74 C;  5JJZ A;  1WOC A;  3SE0 A;  4A3E H;  3K0X A;  1TS3 A;  4KKS A;  4LNQ A;  1QVF A;  2PMZ E;  4A3M G;  3S1Q H;  3N52 A;  4OIJ A;  5GAE C;  4ILW A;  4XXE A;  3PIO 3;  3QOL A;  4DV2 L;  2EYO A;  1S4Z A;  2EY5 A;  3HOV B;  3PQI A;  2ICE C;  4LF4 L;  1YNN C;  5C44 H;  1N33 Q;  1E1T A;  3VA5 A;  4TRD A;  1QZH A;  1I4P A;  1G51 A;  4DR7 L;  3TRE A;  4A3E G;  5I6W A;  1EEF D;  5KNC A;  1VQE A;  2F4V L;  1ZYR C;  1EZ8 A;  2XNA C;  1L0X B;  3GTG B;  5IP7 H;  4CGY B;  3D4R A;  1MI2 A;  1HA5 A;  4ZK9 B;  3S24 A;  1PH5 A;  2K50 A;  1SNP A;  3H09 A;  3I56 A;  1QCB D;  3GTJ H;  3T1H Q;  4A75 A;  4PMW A;  2IPK D;  5CV5 A;  1XNR Q;  3AEV A;  5JEA J;  3KDF A;  2WP8 J;  3I4N G;  2N55 A;  4DAP A;  4RKB A;  2ES2 A;  2HIX A;  5C44 G;  2N78 A;  3I91 A;  1NCV A;  4B3R Q;  1JWU D;  1E24 A;  3L7Z C;  2CKZ B;  1VCI A;  1ASY A;  3D6W A;  2Z4H A;  2N8N A;  5IP7 G;  2MUY A;  5JJI A;  1SRO A;  2Z1C A;  2WAQ E;  3I4M H;  4OEL B;  5HY6 A;  1GOZ A;  2RVL A;  5JVG 3;  1YNJ D;  3NPP A;  1S5E D;  2ZM6 Q;  4IQZ A;  3CCJ A;  1BR9 A;  4OO1 H;  3D3R A;  3TSS A;  3W5O A;  2I5H A;  3KK7 A;  3QG1 A;  4KJO A;  3EN2 A;  1PFS A;  2EYM A;  1DJR D;  1AEX A;  1KQS A;  3HOW B;  1EWC A;  2ZXO A;  4NB3 A;  4X65 Q;  3UE0 A;  2ASB A;  2B8G A;  4N9P A;  1U4L A;  2A8V A;  2ZJP A;  1ONL A;  1RTN A;  2CW0 C;  1Y8P B;  3O13 A;  4LFA L;  1PYS B;  4I65 A;  3TEH B;  2NVX H;  2KED A;  3I4M G;  2O5I C;  1GKH A;  2NBF A;  1Q86 C;  1IBM L;  4F7X A;  2L4N A;  3GTM H;  4XYO A;  3PGZ A;  3C1F A;  2JEA I;  4O0A A;  5EPJ A;  3K5M A;  4QCL A;  4DNI A;  1GUT A;  5AFW A;  4OO1 G;  2JN4 A;  3VA7 A;  2B2W A;  2A6E C;  1WYD A;  1MJC A;  4DR6 L;  3GTL H;  3KBG A;  4X3T A;  1C0A A;  2UUB Q;  1JQY D;  1AE3 A;  4KI0 A;  2OWO A;  4HJ5 A;  4N9T A;  5D65 A;  4IFD J;  3DLL A;  4DPG A;  2MNA A;  3T1Y L;  1HHV A;  1BBU A;  2AQ1 B;  4NW2 A;  2OCE A;  4DV3 Q;  4QL5 A;  4HIK A;  2F0J A;  2NVX B;  5C3W A;  1AH9 A;  4RGN A;  3DWQ A;  1HUN A;  2Q2T A;  4WOR A;  3GTM B;  2CVR A;  1CSQ A;  1B9M A;  1RIP A;  3MA2 B;  1MKH A;  3NE5 B;  4N8F A;  4DR2 Q;  4XIG S;  2DUD A;  5C0X I;  4ME5 A;  2WKD A;  4GLV B;  3A7A B;  3DWA A;  3CD6 A;  3S16 H;  2NZH A;  5CV6 A;  4JVZ A;  3A5U A;  4X66 Q;  3J80 i;  1ESR A;  4BXX H;  1IBL Q;  3D4D A;  1KDC A;  2B2T C;  3I55 A;  2VNU D;  3CAM A;  2R7D A;  1SNO A;  4A3C H;  4J6H A;  2A5H A;  1YVC A;  3HOU B;  5LMU Q;  1CFM A;  1ZEQ X;  2E8G A;  1C4Q A;  3EQL C;  2F0I A;  4JI5 Q;  4MN3 A;  3J7A V;  3S2D B;  1WCM G;  1X3P A;  3A7L A;  1BDO A;  4JOI C;  1O7L A;  1X6O A;  3S16 B;  1QIL A;  4GLX A;  3M7G A;  3HKZ B;  1EY7 A;  2R93 B;  3D31 A;  1N34 Q;  5F2D A;  4A3C G;  3KF8 A;  1BBW A;  4LFC L;  4JI4 L;  1SE4 A;  3M9B A;  2JP1 A;  2F0V A;  4DR3 L;  3PO3 B;  4BBR H;  4AYB E;  1YHA A;  2UUC L;  1A63 A;  4B3T L;  2WFW A;  1C8C A;  1EY6 A;  4MZ9 A;  2KJX A;  5ELN A;  4K0K L;  1JOK A;  3TBI B;  4L5T A;  3A0J A;  2J7Z A;  1X3Q A;  2H1E A;  2RDF A;  2K4K A;  2WAQ G;  3PV0 A;  1K73 C;  3OW2 A;  2EXZ A;  3HOX G;  4A93 H;  1E7Z A;  3ZJY C;  2IWH A;  1EQQ A;  1QNK A;  4LF5 Q;  2E2J H;  1NMG A;  1XMQ Q;  1RHP A;  3ND8 A;  5FJ8 H;  1Y1W B;  4L8J A;  4C1N K;  1XTC D;  5I4D A;  4ME3 A;  3JAM c;  5D3D A;  3CCE A;  1RJT A;  2Z6K C;  4BA2 I;  4JW0 A;  3S1R H;  4R4O A;  4HED A;  2C9O A;  2TSS A;  5I9O A;  3SEB A;  1K28 A;  3G48 A;  4C1N I;  1NR4 A;  3PUV A;  3GTP B;  4LF6 Q;  4FDB A;  1FNU A;  3MTS A;  1ILP A;  1XPO A;  2I07 B;  4A93 B;  2R92 H;  2CH4 A;  1KC8 C;  5I2Y A;  4PZ6 A;  3BU2 A;  1V9P A;  4FP5 D;  3RMH A;  5L37 A;  4RGO S;  1IYU A;  1CKM A;  3CME A;  2XN9 C;  2YU9 H;  2N49 A;  4YCW A;  3VYU A;  1XNQ Q;  1FGU A;  3RZO H;  3DMU A;  1LT5 D;  3KLW A;  3I73 A;  2L55 A;  2PQA B;  4NXM Q;  3E9H A;  4KKT A;  3V2T A;  4B9W A;  2G9D A;  1I94 L;  1VQ6 A;  3P1H A;  4OON A;  4JI6 Q;  2GA4 B;  4IUV A;  4MTK A;  5JPN C;  2AUK A;  2KHI A;  2UUA Q;  2R92 G;  3Q6S A;  1VS0 A;  5EKI A;  4DXG A;  1LYL A;  5IY0 A;  2B3G A;  3CCV A;  4QUF A;  1CI3 M;  3FKI B;  4R4C A;  2BE5 C;  4POF A;  5CGK A;  2G5D A;  3E9I A;  1KD1 C;  2UXC L;  1HNX Q;  3RNU A;  1Q82 C;  1I50 H;  1A3U A;  1K8A C;  1BCP C;  4NP5 A;  4UP9 A;  1B3Q A;  1YNX A;  3A8I E;  2WKC A;  5M5Y H;  1VQL A;  2KBN A;  3UDI A;  2E5L L;  2VB2 X;  3SDZ A;  3KF6 A;  2XTI A;  3S15 H;  5M3M H;  3D0F A;  4HIO A;  2R7Z G;  2B2W C;  4LFB L;  1TT2 A;  3PIP 3;  3OIQ A;  1GUW A;  1MGS A;  2EXD A;  2JSO A;  2EOT A;  4K2K A;  1KRS A;  4OWT B;  4QIW E;  2KEC A;  1CKO A;  1BNZ A;  4L5S A;  4L5Q A;  4RHR A;  2K05 A;  3J7Y W;  3HG9 A;  1KNE A;  2I5M X;  3NHH A;  3NWT A;  4KTA A;  1I50 B;  4A3J H;  1CT1 D;  2Q8I B;  4A3F H;  1YJW A;  1B4O A;  3DEP A;  1ENA A;  4QUC A;  1YJ9 A;  2UXB L;  1Z9F A;  2ALY B;  1VMC A;  2SEB D;  1EQV A;  5M3M G;  2L5T A;  4K5X A;  1SMX A;  4AYB G;  1DCZ A;  4BY1 H;  4XTC S;  3OTO Q;  4LUV A;  1JJC B;  4KY5 A;  1QB5 D;  2K01 A;  1QZG A;  1ASZ A;  1DM0 B;  3BG3 A;  2WIN B;  2EJM A;  1QUQ B;  3CU7 A;  4OX9 L;  1AP0 A;  1TY0 A;  5DEH A;  4A3F G;  1RD9 D;  1S5B D;  4A4I A;  2VQE Q;  4GOP B;  3BDL A;  4L6T B;  1I4X A;  3NTI A;  4A3J B;  3UE1 A;  4CDD C;  5ISR A;  1L1O C;  2X6L A;  3AFQ A;  4M8A A;  2KQ3 A;  1YI2 A;  1Q3L A;  2EVB A;  4LF9 L;  4YWM A;  1WD1 A;  2PNR C;  3EVQ A;  1Y69 U;  4BY1 B;  3HOY H;  1PH6 A;  3M4Q A;  5M5X H;  1HFG A;  3H15 A;  2JA7 B;  3OYY A;  1STG A;  1UE5 A;  1B50 A;  1O78 A;  3K5L A;  2A69 C;  4WRD A;  4IUU A;  5JVH 3;  1DOL A;  3I7F A;  1KDB A;  4C3I B;  3FPP A;  4JC0 A;  1I5F A;  4I7Z C;  2KEN A;  4LF4 Q;  3HOZ G;  2IL8 A;  3KDF B;  2B63 G;  2MFI A;  4FVM A;  2MP1 A;  4YIJ A;  2A1A A;  4DR7 Q;  3BDC A;  1HR0 W;  2RDG A;  4RFB A;  1I3Q H;  3RZD B;  2NVY H;  3I4O A;  1PRT B;  3NBH A;  1JB7 A;  1AN8 A;  1SNM A;  4NPS A;  3K59 A;  2HT1 A;  2F0F A;  3H0G G;  3HOY G;  2NZO A;  5A2Q L;  4ZRZ A;  1NSN S;  1SSO A;  3TZU A;  3GTK H;  4E6I A;  1Z7T A;  4QQB X;  1Q12 A;  2OXP A;  3DM3 A;  5IYC G;  4X64 L;  1SYB A;  3E3X A;  3ER0 A;  4YWK A;  1VQO A;  1Q1E A;  1RCV D;  4JI0 L;  1KL9 A;  3T4A C;  3KLR A;  2F0T A;  1BQQ T;  1BF4 A;  1BOS A;  2HCC A;  2O4X A;  5DM6 3;  2F0D A;  2KCT A;  3GV6 A;  2FIN B;  5E1F A;  4NDX A;  1YJN A;  4CJ1 B;  1VQK A;  3CQZ H;  4DF7 A;  4PV1 C;  3E0J A;  5EGT A;  3FP9 A;  1VQP A;  2EY2 A;  1KXL A;  1B2T A;  1BCP B;  2PQE A;  5GRO A;  3K57 A;  1TXY A;  1O80 A;  1IZ6 A;  1PA6 A;  1G91 A;  1RKN A;  2JA8 B;  2KA7 A;  4GS3 A;  1PTO C;  2Q2H A;  1RL2 A;  2CFM A;  1PZI D;  2MO1 A;  4WJW A;  4GKJ L;  1CKN B;  3CP0 A;  2EPB A;  3TZD A;  4LFA Q;  2MGS A;  4DV6 Q;  4DUZ L;  2EZV A;  2HHH Q;  5K5P A;  2BCO A;  5M3F G;  5K36 H;  4K14 A;  4PMC A;  1K0R A;  1JOR A;  1A62 A;  4HIM A;  1PH8 A;  3WOE A;  3M3Y H;  1L2F A;  3HGB A;  2DN8 A;  2F0E A;  4A3I G;  3BYY B;  1JCK B;  3DEO A;  4JI2 L;  4YWL A;  4DR6 Q;  1TU2 B;  5FLM G;  2RHQ B;  3FPU B;  1P16 A;  2WB1 B;  2AWN A;  4EVO A;  5BR8 L;  5EKL A;  3GQB A;  2EJF C;  5A2Q E;  1EIH A;  4HCE A;  1N9W A;  1OXX K;  2VS1 A;  1B9N A;  4Z9C B;  2NVQ H;  4PZ8 A;  5LL6 X;  2NN6 H;  3SK5 A;  4C3J H;  3CC2 A;  5C0X G;  5COY A;  1N36 L;  5JJK A;  2AMC B;  5KYL A;  4LMQ D;  1HZA A;  4FO2 A;  3OHX C;  1L1O B;  4DV7 L;  1YIJ A;  1GUS A;  1BVS A;  5IIF A;  4A76 A;  1X54 A;  1K8G A;  1G2T A;  1HZB A;  4C3H H;  1G2S A;  3VYT A;  4A3K G;  3MFG A;  3NEN A;  3Q22 A;  2NYZ D;  4CJ0 B;  2K52 A;  1G29 1;  4V19 0;  2K5D A;  1L0W A;  2UU9 L;  1SE3 A;  1EIG A;  2MPM A;  3DHQ A;  1JOQ A;  4PG3 A;  1EY4 A;  4C3J G;  3QR8 A;  1B3A A;  4HJ7 A;  5J39 A;  3K80 C;  1VF7 A;  3BDO A;  1KRT A;  3JAM L;  1K3B C;  4YY3 Q;  5IP9 G;  2A68 C;  1DGS A;  1EFW A;  4C3H G;  1TVX A;  1HJP A;  2LS0 1;  1S5F D;  1JMC A;  5CBE E;  1U4R A;  4ZUJ A;  4DV4 L;  2F3V A;  1CZG A;  1F9P A;  2EIF A;  2LSS A;  3J81 L;  3U50 C;  4A3M B;  5FKA C;  1R9T H;  1J5E L;  1PTO H;  3NEL A;  3T56 B;  4A3D H;  3I4N H;  4H13 C;  4LFC Q;  3CCR A;  4DV5 L;  2JE6 I;  1B44 D;  3F8T A;  4HID A;  1PFM A;  4DR3 Q;  1HNW L;  4C56 C;  1ILQ A;  1SND A;  2UUC Q;  1TS2 A;  4B3T Q;  2A19 A;  2IX3 A;  1QG7 A;  4K0K Q;  3OIP A;  3JC6 6;  4RG1 A;  1D1K A;  4A3E B;  3OW7 A;  1VQI A;  3FEW X;  4GN5 A;  1NBW A;  2XRQ D;  1Q1B A;  1SNQ A;  2VW9 A;  3S1Q B;  3J7Z C;  1V8Q A;  3TQY A;  4F88 A;  2JA6 H;  4H0L C;  3X3M A;  1H95 A;  3F1Z A;  4A3D G;  2KOL A;  4DV1 Q;  1PTO B;  2F0G A;  4HTH A;  3I8Z A;  3CPW A;  3VDY A;  4EQP A;  4AQY L;  1D6E C;  3I4N B;  1ZXT A;  5DM7 3;  4OHJ A;  3QB3 A;  3EIV A;  5C44 B;  1WJJ A;  2L1B A;  3MXN A;  3PIO A;  5KEE A;  1JJG A;  1JJ2 A;  2K5V A;  2F4I A;  1LT4 D;  3M4O H;  1LV9 A;  3CW2 C;  4RHS A;  2AQ3 B;  3SK6 A;  5IGG A;  1EZ6 A;  4DAY B;  2B2V A;  2K5N A;  1F9R A;  4DR1 L;  2JA6 G;  1EY8 A;  4JI1 L;  4J8Q A; 
#chains in the Genus database with same CATH homology
 5IT9 c;  4K0K L;  1VQ5 A;  2IY5 B;  1EOV A;  4L5T A;  1HNX L;  3RN2 A;  4A3K H;  3A0J A;  3PIP A;  2HQL A;  4B3S L;  4KHP Q;  2WB1 E;  3T1Y Q;  4GN4 B;  2K4K A;  2WAQ G;  3PV0 A;  1K73 C;  3K7A H;  2JA7 H;  3OW2 A;  4JI5 L;  4APV A;  3HOX G;  1V1Q A;  4P71 A;  4A3G G;  4A93 H;  4JYA L;  1X3F A;  1E7Z A;  3ZJY C;  1EYG A;  4P73 A;  1Q8K A;  1VQA A;  1MIU A;  4C3I H;  5AJ3 L;  3KJP A;  1EQQ A;  4LF5 Q;  2E2J H;  4IFD G;  4WJ3 M;  1NMG A;  3MEF A;  1Z47 A;  1XMQ Q;  4R4Q A;  5FJ8 H;  5IE8 A;  1I94 Q;  4A3J G;  1FJG L;  3CC7 A;  4IPD A;  1J5E Q;  5IP9 H;  2K5H A;  1VQ8 A;  4ME3 A;  1UWV A;  5GAH C;  3JAM c;  3CCE A;  3S1N H;  2BH8 A;  4LWC A;  2YTY A;  2Z6K C;  3RZD H;  1XPR A;  1PH7 A;  4BA2 I;  2D0P A;  3S1R H;  3GDE A;  4R4O A;  1VQ4 A;  2AHO B;  4LF7 L;  1NMF A;  4DV5 Q;  1XMO L;  1E1O A;  1I6H H;  4BY1 G;  1K9M C;  2YYZ A;  3K7U C;  1UE7 A;  5C4X G;  2IT1 A;  3G48 A;  1Q81 C;  3LGJ A;  2VQF L;  3KYH C;  1PVO A;  3PUV A;  4LF6 Q;  1VQM A;  4FDB A;  5C3E H;  1X3E A;  2JA9 A;  4KHP L;  1LUZ A;  1XPO A;  2PNH A;  4DAM A;  3KF8 B;  2R92 H;  1KC8 C;  3J7A 5;  2VUM H;  1UE1 A;  3BU2 A;  1V9P A;  3PUZ A;  4IPC A;  4PZ6 A;  4R4T A;  4R4I A;  1CKM A;  3CME A;  1HNZ Q;  4C2M H;  4UP8 A;  2YU9 H;  2N49 A;  4A3B G;  4YCW A;  1SN8 A;  1XNQ Q;  1FGU A;  3RZO H;  1YEZ A;  3PO2 H;  4JOI A;  3KLW A;  2PQA B;  1XJV A;  4NXM Q;  5C4J H;  2RHS B;  3E9H A;  3PF5 A;  3PUY A;  4OWW B;  3HOV H;  4GKK L;  1B7Y B;  4IJH A;  1I94 L;  1VQ6 A;  4LFB Q;  4DUY Q;  3SGI A;  4OON A;  2AKW B;  4JI6 Q;  1PH9 A;  1D8L A;  4IFD I;  4IO9 A;  1Q7Y C;  1JT8 A;  1IYJ B;  5JEA G;  5C3E G;  2HIV A;  1WCM H;  4JCV E;  4OXP A;  1X55 A;  2KHI A;  2PI2 A;  2UUA Q;  3GTG H;  4JI4 Q;  3UDF A;  3CCL A;  2FXQ A;  2R92 G;  1UEB A;  2JA8 H;  5IYD H;  4GNX A;  1HH2 P;  1YBY A;  2DGY A;  1VS0 A;  2F3I A;  1SFO H;  1NY4 A;  1LYL A;  2OQ0 A;  1W2B A;  5IY0 A;  1OXS C;  2Z0S A;  2B3G A;  3CCV A;  1PYB A;  3PO2 G;  1KHI A;  1QUQ A;  1C9O A;  3ULP A;  4R4C A;  4JBW A;  4LF6 L;  2VL6 A;  4DR5 L;  3S17 H;  4POF A;  3E9I A;  1KD1 C;  3HOV G;  1HNX Q;  3RNU A;  2Y0S G;  4EX5 A;  1Q82 C;  2UXC L;  1I50 H;  1K8A C;  2OTL A;  1AE2 A;  1HNZ L;  4GOP A;  4UP9 A;  3K81 C;  4QY7 A;  4X6A H;  4KLK A;  5EAY A;  2LXJ A;  1SRU A;  1YNX A;  4IPG A;  4JI1 L;  1VQL A;  5M5Y H;  3A5Z B;  2KBN A;  2LXK A;  1B70 B;  4NXM L;  4JYA Q;  3M7N A;  1OXV A;  3UDI A;  2E5L L;  4PZ7 A;  3UDX A;  5IYD G;  5AJ3 Q;  3KF6 A;  2CQO A;  2XTI A;  3W1G A;  1EIY B;  1BKB A;  5M3M H;  3D0F A;  4HIO A;  2JA8 G;  2R7Z G;  3S15 H;  4LFB L;  4DUY L;  1Y1V H;  1YZ6 A;  2R7F A;  2EXD A;  2Z6K A;  4BBS H;  1KRS A;  4LF8 Q;  2ZTC A;  3HOX H;  4OWT B;  3HKZ E;  4QIW E;  1K3R A;  2BH2 A;  1KIX A;  1CKO A;  1FVI A;  4QJF A;  3TS2 A;  3JAM i;  4L5S A;  3CPF A;  4L5Q A;  2UUA L;  2CWP A;  3TRZ A;  1S3O A;  4JBK A;  1VQF A;  4B3M Q;  4GNX C;  2IHE A;  1XMO Q;  2I5M X;  4A3F H;  4JI7 Q;  3PUW A;  4A3J H;  1YJW A;  1P8L A;  3J81 i;  3HKZ G;  3HOW H;  1YJ9 A;  2QGQ A;  3WWV A;  2JJQ A;  3CCS A;  5DLQ E;  3NEM A;  1IL2 A;  2UXB L;  1Z9F A;  2ALY B;  2XGT A;  5M3M G;  2QA4 A;  1M90 C;  1N32 Q;  1SMX A;  2GN5 A;  4AYB G;  3STB C;  1Y1V G;  4BY1 H;  2ATW A;  4XTC S;  3PO3 G;  3OTO Q;  4LUV A;  1JJC B;  4GNX B;  5C4X H;  2E2H H;  4BBS G;  2K75 A;  4KHZ A;  3U4Z A;  1QZG A;  1ASZ A;  3TS0 A;  3BJU A;  1QUQ B;  3H3V I;  2WB1 G;  1K83 H;  4DV0 Q;  1QVG A;  1N32 L;  5JJL A;  4GKK Q;  1CUK A;  4OX9 L;  1T9H A;  3CCU A;  5LMN Q;  4A3F G;  1EQR A;  1X56 A;  3RLF A;  4A3B H;  4GN3 B;  4A4I A;  2VQE Q;  4GOP B;  2QEX A;  1VQJ A;  4LF8 L;  3HOW G;  2VZA A;  3S2H H;  3KJO A;  3KOJ A;  3UE1 A;  1L1O C;  1YHB A;  2D0O A;  3RN5 A;  4DR4 Q;  4BA1 I;  4B3M L;  1VQB A;  2VY3 A;  3AFQ A;  5K36 G;  2MO0 A;  1YI2 A;  4JI7 L;  3KF6 B;  3J81 c;  2H5X A;  4LF9 L;  4YWM A;  1XTD A;  1EIF A;  4P74 A;  3CXC A;  1M1K C;  4JBM A;  3UDG A;  4JV5 Q;  3HOY H;  1PH6 A;  3M4Q A;  4DV6 L;  1VQG A;  5M5X H;  3H15 A;  4DR5 Q;  1WI5 A;  4POG A;  3OYY A;  2UXC Q;  1LTL A;  4DK6 C;  1IXR A;  3G4S A;  4NXN Q;  1UE5 A;  3EBE A;  2HHH L;  1SE8 A;  4UPA A;  4H02 A;  1PH3 A;  4QGU A;  3GD7 A;  3I7F A;  4LW1 A;  3OTO L;  4JC0 A;  1I5F A;  4A3M H;  1CSP A;  2KEN A;  4HJ8 A;  4LF4 Q;  4YHH Q;  3AYH B;  3K8A A;  3HOZ G;  1OXT A;  3KDF B;  3HKS A;  2B63 G;  2MFI A;  3M4P A;  1C7Y A;  4BY7 H;  2A1A A;  4DR7 Q;  4DV0 L;  1CKN A;  1HR0 W;  2E5L Q;  2IX0 A;  1GM5 A;  4R1J A;  4HJ9 A;  3ERS X;  3ULL A;  5H1S E;  2NN6 G;  5LMN L;  2IX1 A;  1I3Q H;  3H3V H;  3A74 A;  1JB7 A;  2NVY H;  3I4O A;  4LUZ A;  2ZM6 L;  3PF4 A;  4NPS A;  2VQE L;  2HT1 A;  2JK8 A;  5C0X J;  1N8R C;  1MJE A;  3M85 A;  3ULJ A;  4IOC A;  2BA1 A;  3H0G G;  4GLA C;  1HR0 Q;  3E0E A;  2NZO A;  3HOY G;  1GVP A;  1WOC A;  2ZJQ A;  1HZC A;  2K14 A;  4A3E H;  3K0X A;  4A3L H;  1X65 A;  4DR4 L;  1YHQ A;  3GTK H;  4JI8 Q;  4LNQ A;  1QVF A;  4X65 L;  1J6Q A;  3CCQ A;  2R7Z H;  3HOU H;  2PMZ E;  4A3M G;  4QQB X;  3RLO A;  3S1Q H;  1Q12 A;  3DM3 A;  1TWA H;  5IYC G;  4X64 L;  3GTQ H;  3ER0 A;  4YWK A;  5GAE C;  4JV5 L;  1VQO A;  4JI3 Q;  1Q1E A;  4JI0 L;  4BY7 G;  3FHW A;  4MNO A;  1KL9 A;  2L15 A;  1SLJ A;  3S2D H;  4NXN L;  4DUZ Q;  2UXB Q;  1NTG A;  1VQD A;  2OQK A;  4DV2 L;  1VQN A;  3Q8D A;  1GO3 E;  2I0Q A;  2KCT A;  2JQO A;  1YJN A;  3U4V A;  1VQK A;  4LF4 L;  4YHH L;  1EWI A;  3CQZ H;  2ZJR A;  5C44 H;  1N33 Q;  3FP9 A;  1E1T A;  2R93 H;  2GVA A;  2MQH A;  1VQP A;  1QZH A;  1G51 A;  2GVB A;  2CWA A;  4DR7 L;  4JI2 Q;  3TRE A;  1KXL A;  4A3E G;  1PHJ A;  5GRO A;  4A3L G;  1TWG H;  3F2C A;  1VQE A;  1TXY A;  3HOU G;  4UY8 C;  2F4V L;  4OX9 Q;  2UUB L;  4JG2 A;  1G6P A;  5E7N A;  2V1C C;  1IZ6 A;  3ICE A;  1PA6 A;  3PO3 H;  3S1M H;  1L1O A;  5IP7 H;  5BR8 Q;  1HR0 L;  2Q2I A;  4GS3 A;  4DK3 C;  2YTX A;  2Q2H A;  3G6E A;  3S24 A;  1VQC A;  1PH5 A;  3PCO B;  1RL2 A;  2K50 A;  3I56 A;  2NN6 I;  2RCN A;  4YCU A;  2CFM A;  3GTJ H;  2YV5 A;  3T1H Q;  2MO1 A;  4YY3 L;  4A75 A;  5IYB H;  1PV4 A;  1FL0 A;  1LM0 A;  4PMW A;  4P72 A;  4GKJ L;  4JI8 L;  1CKN B;  1Q46 A;  2JA5 H;  1XNR Q;  3AEV A;  3CP0 A;  4LUO A;  3KDF A;  1EUJ A;  2WP8 J;  5JEA J;  3I4N G;  5IWA Q;  4LF9 Q;  1JE5 A;  2ES2 A;  2HIX A;  5C44 G;  3NBH B;  2N78 A;  4JI3 L;  2CCZ A;  2R93 G;  4LFA Q;  3B6Y A;  4B3R Q;  4DV7 Q;  4DV6 Q;  4DUZ L;  4BXX G;  1E24 A;  3L7Z C;  5J3B A;  4X62 Q;  2CKZ B;  4RMF A;  2HHH Q;  1VCI A;  1ASY A;  5M3F G;  4ALP A;  2UXD Q;  4AIM A;  2N8N A;  1K0R A;  4J15 A;  1A62 A;  3L0O A;  4HIM A;  1QVC A;  2PI2 E;  2KHJ A;  5GQO A;  5IP7 G;  1Y1W H;  1PH8 A;  1UE6 A;  3M3Y H;  1L2F A;  2RF4 A;  1VQ9 A;  4A3I G;  1N33 L;  5LMN W;  5JJI A;  2UU9 Q;  1SRO A;  3BZC A;  5GAG C;  2WAQ E;  4JI2 L;  3I4M H;  4YWL A;  3RLN A;  1YIT A;  4DR6 Q;  5IYB G;  3CC4 A;  5HY6 A;  1S40 A;  1Y14 B;  1IBK Q;  1XPU A;  1A0I A;  5FLM G;  2RHQ B;  2JA5 G;  1P16 A;  1KAW A;  2AWN A;  2ZM6 Q;  5BR8 L;  3CCJ A;  5LMU L;  3STB D;  3HOZ H;  2I5L X;  4TVA B;  2I5H A;  3W5O A;  3BZK A;  2B63 H;  1N9W A;  1OXX K;  3EN2 A;  3GTP H;  3T1H L;  1PFS A;  2VS1 A;  3CF5 A;  1HZ9 A;  1OXU A;  1KQS A;  4Y7N H;  1PH2 A;  2NVQ H;  1TWH H;  5FLX c;  4PZ8 A;  4GOP C;  3GO5 A;  4DV1 L;  1XNR L;  4NB3 A;  4X65 Q;  3UE0 A;  3AQQ A;  4C3J H;  1Y1W G;  3CC2 A;  4AH6 A;  5IWA L;  2ASB A;  5C0X G;  4DV4 Q;  1N36 L;  5JJK A;  2AMC B;  2A8V A;  2ZJP A;  3I2Z A;  1HZA A;  4X64 Q;  4LFA L;  3H0G H;  4B3R L;  1L1O B;  1PYS B;  4BBR G;  3TEH B;  4DV7 L;  2NVX H;  4JI0 Q;  3I4M G;  1GKH A;  1TWF H;  3U58 A;  1YIJ A;  1BVS A;  4X62 L;  1Q86 C;  1IBM L;  2E2I H;  2D62 A;  3GTM H;  4A76 A;  1X54 A;  4DV2 Q;  3PGZ A;  1N34 L;  1HZB A;  4C3H H;  1K8G A;  2JEA I;  4O0A A;  2UXD L;  4A3K G;  3NEN A;  4DNI A;  3J81 j;  2K52 A;  4OO1 G;  1G29 1;  4UP7 A;  1L0W A;  5IYC H;  2UU9 L;  1WYD A;  1MJC A;  4DR6 L;  2JA7 G;  1HNW Q;  3GTL H;  2Q2U A;  4TQU S;  1PH1 A;  1IBK L;  4A93 G;  1C0A A;  2F4V Q;  4PG3 A;  2EQS A;  2UUB Q;  1W3S A;  1AE3 A;  4KI0 A;  3GTO H;  3MXN B;  4HJ5 A;  2OWO A;  4HJ7 A;  4IFD J;  3DLL A;  3K80 C;  4DPG A;  2MNA A;  3T1Y L;  1BBU A;  5FJ8 G;  3FKI H;  4P75 A;  1KRT A;  2OCE A;  3F2B A;  4DV3 Q;  3S14 H;  1U5K A;  4QL5 A;  4HIK A;  5M5W H;  4YY3 Q;  5IP9 G;  4MTN A;  5HGQ A;  1DGS A;  1EFW A;  4GKJ Q;  1HJP A;  4WJ4 A;  4DKA C;  1AH9 A;  1VQ7 A;  1V43 A;  1JMC A;  4IPH A;  4OWX B;  1SR3 A;  4DV4 L;  2Q2T A;  4LF5 L;  2LSS A;  2EIF A;  2KCM A;  3PSI A;  1XMQ L;  1NE3 A;  1E22 A;  1CSQ A;  1U0L A;  2NVT H;  1RIP A;  2BA0 A;  1MKH A;  3U50 C;  2C35 B;  2R6G A;  4AQY Q;  1NJI C;  2F52 A;  2YTV A;  4O2D A;  4DR2 Q;  4XIG S;  1R9T H;  1S72 A;  2DUD A;  3NEL A;  1J5E L;  5C0X I;  4GLV B;  3KFU A;  4IOA A;  4Y52 H;  4A3D H;  3CD6 A;  3S16 H;  3I4N H;  2NZH A;  4LFC Q;  1TWC H;  2Y0S E;  3CCR A;  4DV5 L;  2JE6 I;  2VUM G;  3FKI G;  3F8T A;  3A5U A;  4HID A;  4DR3 Q;  4X66 Q;  5GAD C;  3J80 i;  1HNW L;  3CCM A;  2UUC Q;  4BXX H;  1IBL Q;  4B3T Q;  2A19 A;  3IRB A;  4DR1 Q;  3I55 A;  4OO1 I;  2VNU D;  1X3G A;  4JI1 Q;  3CAM A;  5M3F H;  4K0K Q;  2R7D A;  3JC6 6;  4RG1 A;  4HJA A;  4L5R C;  5ELO A;  4A3C H;  4B3S Q;  1YVC A;  1VQI A;  1WFQ A;  5LMU Q;  4A3I H;  2OTJ A;  4YCV A;  4GN5 A;  1NBW A;  4JBJ A;  4IJL A;  4DV3 L;  2IHF A;  2E8G A;  1Q1B A;  2AWO A;  2ID0 A;  2VW9 A;  1XNQ L;  3J7Z C;  2N3S A;  3TQY A;  4JI5 Q;  2JA6 H;  1H95 A;  1O7I A;  3F1Z A;  3PUX A;  3F2D A;  4A3D G;  5FLM H;  4DV1 Q;  1D7Q A;  1WCM G;  1B8A A;  1N36 Q;  1E3P A;  3CPW A;  4JOI C;  3VDY A;  3CMA A;  3RR5 A;  3G71 A;  4AQY L;  1PH4 A;  1X6O A;  1X9N A;  4JI6 L;  2ZTD A;  4DR2 L;  1FJG Q;  4GLX A;  1A8V A;  3EIV A;  2JEB I;  3W1B A;  3HFZ B;  1IBM Q;  1WJJ A;  1OTC A;  3PIO A;  3AFP A;  2ZTE A;  3D31 A;  1JJ2 A;  1JJG A;  1N34 Q;  2K5V A;  1VQH A;  4A3G H;  4A3C G;  1BBW A;  3M4O H;  4LFC L;  4EQ5 A;  3CW2 C;  4JI4 L;  4LF7 Q;  3M9B A;  3L2P A;  4DR3 L;  3J80 c;  4X66 L;  4DAY B;  4BBR H;  4AYB E;  2K5N A;  1YHA A;  2B29 A;  2UUC L;  1A63 A;  1IBL L;  4B3T L;  2WFW A;  2PQA A;  4MZ9 A;  4DR1 L;  2JA6 G;  1GD7 A;  5ELN A;  2VQF Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...