4JYAL

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 14
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jyaL00
4A3FH 4JV5L 2CKZB 1OXUA 4A3EG 2N3SA 3I55A 3DM3A 3PCOB 4YWLA 1D7QA 3K80C 1E22A 3HOVH 1VQ8A 1OXXK 5IYDH 2B29A 2XGTA 3AYHB 5C4JH 3H0GH 3CW2C 1TWAH 4UPAA 5GAGC 4YY3Q 1SE8A 2EXDA 4KLKA 4YHHL 2NVXH 3S16H 4DV2Q 2R92H 1O7IA 4A76A 1IBML 2I5MX 3EBEA 1IZ6A 4DR1Q 4P73A 1JMCA 1MIUA 4A93G 2K14A 3K8AA 4IOAA 4BY1G 3UDIA 3W1BA 4C3JH 2OQ0A 1YBYA 3F2BA 5JJLA 2C35B 4A3MH 4YWMA 1A0IA 3KDFA 2V1CC 3ERSX 1J5EQ 1XMOL 2Y0SE 4JI0L 2JA8H 2RF4A 3M4PA 2IHEA 3CMEA 1N34L 1JJCB 4IJHA 2KBNA 4XTCS 2HIXA 1CKNB 1VQJA 4YCVA 5M5YH 2YU9H 4LF6Q 3L0OA 4O0AA 4LF9Q 4A3DH 4R1JA 2WB1E 4AQYQ 3T1HQ 3KDFB 4JI4L 4LUVA 3FKIG 5FLXc 1X9NA 2JA9A 3GDEA 1YEZA 4B3MQ 3NBHB 4JI8Q 3PIPA 2LXKA 1IBLQ 4A3FG 4IPCA 5LMNL 2PMZE 3PO2G 1HH2P 4IFDJ 1YIJA 3TS0A 2NZHA 2PI2E 1OXSC 2PNHA 5M3FG 4HIOA 4DR3Q 4DV4L 1L1OB 4OWWB 2E8GA 2BH2A 3E9HA 1HZBA 4LFAL 1A8VA 1N33L 3I56A 2R7ZH 1HNZQ 4BXXH 5GAEC 2DGYA 4B3TL 2ZJPA 4L5TA 2UUCQ 5C44G 4IOCA 3VDYA 2AWOA 3M85A 1KL9A 4X6AH 2E5LQ 2ATWA 2VNUD 1GO3E 3CCQA 2R6GA 2RHSB 1YJNA 1PA6A 4DR4Q 1VQIA 3GTPH 4OXPA 5JEAJ 3PUZA 2D0OA 2OTJA 1EIFA 4A3MG 1N32Q 1VQCA 1W2BA 5K36G 3RZDH 2LXJA 2LSSA 1FGUA 5IWAL 1Q81C 3S1MH 1LUZA 1KHIA 4A3DG 1XNRQ 3M7NA 2IHFA 4JI3Q 3PF5A 1VQ4A 1S3OA 1U0LA 1KD1C 5EAYA 2HHHL 4ME3A 4DKAC 3F2DA 5LMUL 2UXCQ 1C0AA 2UUAL 5JJIA 1HNWQ 1E1OA 1TWHH 1H95A 4KHPQ 4JCVE 3JAMc 1S40A 4R4IA 4QGUA 3KF8B 3CCJA 1EOVA 3DLLA 4DR6L 2R7ZG 4BXXG 5C4XG 1WJJA 1YZ6A 1I6HH 2NZOA 3JAMi 4JYAQ 2OTLA 1VQEA 4BBSH 2I0QA 3HOWH 4K0KQ 2VQEL 1N8RC 2KHIA 1X55A 2WB1G 5IP7H 1WOCA 4X62Q 4JC0A 1UEBA 1JJ2A 5C0XJ 1PH3A 4LUOA 4JI1L 4DV6Q 2KENA 4DV3Q 3PV0A 2MQHA 5DLQE 4B3SQ 3GTQH 2HQLA 1TXYA 3FP9A 3TRZA 4JI2Q 2IX0A 4JBMA 4C3IH 3I4NH 1L1OC 3EIVA 3S17H 4IJLA 3AEVA 1PH1A 1HR0Q 2I5LX 1Y1VH 3I4OA 2ZM6Q 3PUYA 3GO5A 2QA4A 2AWNA 1YNXA 1NMFA 3KF6A 1CKOA 3RLOA 4YY3L 1I94Q 3D31A 3HOZH 4DV2L 1SR3A 1FVIA 2H5XA 2HIVA 3A5UA 3S1RH 1XPOA 1PH5A 2GVBA 3D0FA 4X65Q 2JA7G 2K75A 3GTGH 4DR1L 1PH7A 1B70B 1QVGA 3MEFA 1EFWA 4L5SA 4LFBQ 1VQLA 2DUDA 3AFQA 3M4QA 3M9BA 3PGZA 4JI5Q 1HNXQ 1W3SA 4KHZA 4GS3A 4BA1I 2BH8A 1FJGL 1J5EL 1YI2A 3OTOQ 1JJGA 2EQSA 4BY7H 4DR5Q 4DV1Q 3L7ZC 1EQRA 3CCEA 4BA2I 1NTGA 4HJ7A 4HJ9A 2VW9A 3NEMA 3S24A 2RCNA 2OWOA 4LF7Q 1T9HA 2NN6G 2R7FA 4LF9L 1XPRA 4QL5A 3T1HL 1PHJA 1KRSA 1EIYB 2CCZA 4DUZL 1HR0W 4H02A 1Q1EA 4QJFA 4JI8L 2JA5H 4GLAC 2N8NA 2UUBL 3RN2A 1IBLL 3HKZE 3M3YH 1G291 1RIPA 3S1NH 3S15H 1K83H 3CD6A 1IBKQ 2IX1A 3STBC 2A19A 4C2MH 3RR5A 4DR3L 4B3RL 5IP9G 2Q2HA 3CCSA 5HGQA 4DAYB 3CCVA 1CKNA 3KYHC 3LGJA 3F8TA 4JI7Q 1MKHA 1J6QA 3AQQA 4PG3A 2UUCL 2JEAI 3HOZG 3KFUA 2A1AA 2ZTDA 5FLMG 4JBKA 2E5LL 2MNAA 1TWCH 2WAQG 2K5VA 4O2DA 3RN5A 3UDGA 4DR4L 2CWAA 1AE2A 4NB3A 1VS0A 4GNXB 4OONA 1L1OA 4MZ9A 4ALPA 1LTLA 1M90C 3W1GA 1N32L 4A3JH 4JI6Q 4LF5Q 2IT1A 4APVA 4HIKA 4PMWA 5IE8A 5ELNA 1PH2A 4BY7G 4GKJQ 3BU2A 2WP8J 3A5ZB 2UU9Q 2B63H 4OX9L 3PF4A 1XTDA 1JT8A 1LM0A 1V1QA 3K7AH 2E2JH 3HOVG 1HZAA 5IYDG 1E24A 1SN8A 2R7DA 4EQ5A 3CXCA 1I5FA 1WCMH 5M3MH 3U58A 3H0GG 3L2PA 1PV4A 2JA5G 2UXCL 1QUQB 2R92G 3CCLA 1M1KC 1HNWL 1MJCA 3I2ZA 2YTVA 1X3GA 1K73C 2K4KA 3FHWA 3UE0A 1K8AC 4YCUA 4DV7L 3UDFA 1K9MC 1K3RA 2HT1A 1X54A 3CPFA 3AFPA 2N78A 3JC66 4PZ6A 4QIWE 5JJKA 3HOUH 2JQOA 1MJEA 4LF4L 4HIDA 2N49A 4JYAL 2UXDL 1WYDA 1OTCA 1C7YA 4BBRH 2GVAA 3A74A 4IPGA 2YYZA 4MTNA 3ULPA 2JA8G 4X64Q 3J81c 1KIXA 4K0KL 4X66L 4IFDI 4NXMQ 1B7YB 4TQUS 2VY3A 2AKWB 4X62L 5GQOA 4OO1I 3K81C 1Q12A 4UP8A 4NPSA 4GOPB 3HKZG 1NE3A 2D62A 4UP7A 3BJUA 3J81i 3J81j 4DV3L 4DV6L 1IYJB 3G71A 1CSQA 3CAMA 1XMOQ 1C9OA 3NENA 1PH9A 4LUZA 3S2HH 1K0RA 1VQNA 4IFDG 2ZTCA 2B63G 3KOJA 2VL6A 1CUKA 2R93H 5AJ3L 2F52A 1HZCA 1Q82C 4JI4Q 4JOIC 1CKMA 2NVYH 2Z6KC 3SGIA 2ZM6L 5M3MG 4EX5A 1HR0L 4A3BH 1ASZA 5C3EH 3A0JA 4DV5Q 3TS2A 2EIFA 5M5XH 1Q8KA 1YHBA 3U4VA 1B8AA 3CQZH 2ALYB 3HKSA 1KQSA 3F2CA 2B3GA 1HZ9A 3HFZB 4DV4Q 2F4VQ 3NELA 4UY8C 3T1YQ 4GNXC 1GKHA 5GADC 1AH9A 5BR8Q 2KCTA 2WAQE 4LFBL 3BZKA 4DK3C 3HOUG 5JEAG 1HNXL 1U5KA 1E3PA 1PVOA 1VQGA 4LFCL 1VQOA 4BBRG 4LNQA 3OTOL 3I4MH 1BBUA 1SROA 4DV1L 1VQBA 4R4OA 1OXVA 4HJ5A 4TVAB 5IYCH 1Z9FA 4LF7L 4AYBE 2GN5A 1YHQA 4DUYQ 4QY7A 2I5HA 3CCRA 4POFA 1NBWA 2F3IA 3MXNB 1A63A 1YITA 1N36Q 1PYBA 3CC7A 2WFWA 1IBKL 4A3KH 1ASYA 2PQAB 1L0WA 1Y1WH 2KCMA 3EN2A 2OQKA 3CF5A 4DR2Q 4FDBA 2JEBI 3CC2A 2CQOA 2HHHQ 4A3BG 5LMUQ 5HY6A 3G4SA 2Z0SA 1VQPA 3GTOH 4JI7L 5E7NA 5C0XI 2AMCB 1TWGH 4UP9A 3PUVA 1XMQQ 3HOWG 4P72A 4RG1A 4BBSG 4JBWA 2K50A 2YTYA 3RLNA 3J7ZC 4GN3B 4A93H 1EYGA 4PZ7A 4P71A 5IP7G 1IL2A 4LF6L 1VCIA 4GOPC 2NVTH 4L5RC 2AHOB 4DPGA 1Z47A 4GN4B 4AQYL 5C0XG 4LF8Q 4DV0Q 2QGQA 1V9PA 4JI6L 2FXQA 4LF5L 3K0XA 4IPHA 2K52A 4JOIA 2Z6KA 3HOXH 2VQEQ 2VQFQ 4B3ML 4GKJL 1YJ9A 4NXNQ 2KHJA 1YHAA 4L5QA 1TWFH 2CWPA 1D8LA 4XIGS 5GAHC 1SFOH 1DGSA 2UU9L 3I4NG 1BKBA 1AE3A 5IYCG 1UE7A 1QVCA 1KAWA 1Y14B 4YCWA 3S2DH 1Y1VG 3PIOA 1S72A 1Q1BA 1YVCA 2ZJQA 1HNZL 1UWVA 1NY4A 3CMAA 4GNXA 2ID0A 4GKKQ 2YTXA 3U50C 3GTKH 3PO2H 5ELOA 4IO9A 3GTJH 1FL0A 5FJ8H 1E7ZA 4A3KG 5M3FH 1VQ6A 2JA6H 1Y1WG 4YWKA 3RNUA 1JE5A 4C3HH 5GROA 1EUJA 1EWIA 1X3EA 5C44H 1XNQQ 4DK6C 3U4ZA 1GD7A 1G51A 1X65A 1PH6A 2XTIA 1QUQA 4X64L 1NJIC 4PZ8A 1PYSB 4AYBG 1VQ5A 1VQ7A 3WWVA 4GLXA 4NXML 4DR7Q 1VQAA 5IYBH 3H3VH 4WJ3M 2BA1A 2OCEA 4R4TA 2D0PA 2BA0A 1XNRL 2UXBQ 4JI3L 1WI5A 1FJGQ 3CPWA 4JV5Q 3HOXG 3M4OH 2JK8A 4HJ8A 2Q2TA 1V43A 3TEHB 4KHPL 4QQBX 3KLWA 3TQYA 4HJAA 2MO1A 2VUMH 2YV5A 1VQHA 3KJPA 2A8VA 3K7UC 4DUZQ 1XPUA 4AIMA 2QEXA 1HJPA 2MO0A 2UUBQ 1EQQA 4YHHQ 2ASBA 4DV5L 1IBMQ 5H1SE 3ZJYC 4GOPA 1PH4A 4AH6A 4A75A 3W5OA 5FJ8G 4B3RQ 4RMFA 2JA6G 1VQFA 2F4VL 1I50H 3T1YL 2ES2A 1SLJA 2L15A 5C4XH 1X3FA 4R4CA 4HIMA 5BR8L 3OW2A 3H3VI 1JB7A 1WFQA 2JE6I 5IT9c 1QZHA 5IY0A 1VQMA 1BBWA 4A3JG 1G6PA 1SRUA 3STBD 4JI0Q 4B3SL 2ZTEA 1LYLA 1NMGA 2CFMA 1N34Q 4JI2L 4A3IH 2VZAA 5IYBG 4OO1G 3GD7A 4P74A 2K5HA 4DUYL 2E2IH 1WCMG 1R9TH 1PFSA 5LMNQ 1I94L 4A3LH 2MFIA 1N36L 2RHQB 4OX9Q 3BZCA 4X65L 1PH8A 2VUMG 1UE5A 1N9WA 4LFAQ 3G48A 3CCMA 1N33Q 3RZOH 4DR2L 3PO3H 4B3TQ 3S14H 2K5NA 2VS1A 1QVFA 3HOYH 4Y7NH 2Q2IA 4JI5L 4A3CH 4A3GH 4LW1A 4DNIA 2JA7H 1XMQL 3ER0A 4DV7Q 1UE1A 4DR5L 1CSPA 1Q46A 3F1ZA 4JG2A 3ULLA 3GTLH 3J80c 1VQ9A 3OYYA 4R4QA 4LF4Q 1X56A 2PQAA 1Q7YC 2NVQH 4Y52H 2Y0SG 1SMXA 2UXDQ 3IRBA 1QZGA 4LF8L 4DV0L 3PUXA 1K8GA 3CP0A 4KI0A 1X6OA 3J80i 3S1QH 4X66Q 2VQFL 4MNOA 5LMNW 4GLVB 4NXNL 4A3EH 5IWAQ 1UE6A 3B6YA 3E0EA 2Q2UA 3ICEA 4A3IG 1IXRA 5M5WH 4POGA 2R93G 1KXLA 3CC4A 3CCUA 1I3QH 1GM5A 1KRTA 1P16A 3PUWA 2UUAQ 5C3EG 4GKKL 4A3LG 3Q8DA 1L2FA 3UDXA 4OWTB 3I7FA 1BVSA 3J7A5 5AJ3Q 2PI2A 4J15A 5IP9H 1KC8C 4OWXB 3GTMH 4DR6Q 4WJ4A 1VQKA 4BY1H 3PO3G 4P75A 3RLFA 3UE1A 4GN5A 2E2HH 3HOYG 4IPDA 5J3BA 4A3CG 3TREA 3KJOA 3ULJA 4A4IA 1YJWA 3G6EA 1XNQL 5FLMH 1VQDA 1P8LA 4A3GG 3I4MG 4LWCA 1Q86C 2ZJRA 1GVPA 2JJQA 3H15A 1XJVA 2IY5B 3KF6B 2NN6I 4DR7L 4JBJA 3E9IA 1OXTA 1E1TA 1A62A 4JI1Q 2UXBL 3FKIH 4LFCQ 3PSIA 1RL2A 4DAMA
chains in the Genus database with same CATH superfamily
4JV5L 3FDTA 1NCVA 1JCKB 3W3AA 4A3GB 1I4GA 2BCOA 3VR5A 4A3EG 1D5ZC 3PCOB 4FNFA 1E22A 3BDLA 4DF7A 1V8QA 5C4JH 5GAGC 4UPAA 2NVXH 2ZXOA 4DV2Q 3SR1A 2JP1A 5CYUA 4A76A 2I5MX 4DR1Q 4P73A 4ULLA 3S1QB 2DJGC 5BN3A 4QUCA 4C3JH 3J81E 2F0MA 1HUMA 3E0JA 1DOMA 1A0IA 3KDFA 2V1CC 5HGTA 3GTQB 1XMOL 2RF4A 1N34L 4IJHA 4XTCS 1VQJA 3KBXA 3L0OA 3NTKA 4R1JA 2RDFA 3MXGA 1X9NA 1BBXC 2LY7A 3PIPA 2F0LA 4A3FG 5IIFA 4IFDJ 1HH2P 3D6CA 2IPKD 3TS0A 1L1OB 4OWWB 4LFAL 2KCCA 2R7ZH 5KNCA 1MSHA 3TBIB 3ND8A 1GO3E 1EU4A 1LTGD 3CCQA 1F9RA 2RHSB 4ZKCB 1YJNA 3C2PA 4EQOA 1VQIA 3G6JB 4OXPA 3PUZA 4A3MG 1VQCA 1W2BA 2K33A 1K8OA 1QJOA 2R92B 1F2MA 3G7LA 2HQEA 1R4QB 4ODGA 1BCPF 3PF5A 1ZEQX 1C0AA 1MD2D 2HHHL 1SJHD 2NTTA 1TWHH 1A2UA 4JCVE 2PNRC 4NKLA 3D4DA 4QGUA 1H9MA 1EOVA 3DLLA 3FPUB 3DWQA 1I6HH 3C1EA 2NZOA 1STHA 3HKZB 2TMPA 4F87A 1N8RC 5CORA 4RA8A 5IP7H 3EJIA 1JJ2A 4OELB 5BN5A 3PV0A 4B3SQ 5DLQE 4JI2Q 4PNYA 1ZYRC 1RODA 4C3IH 2L4NA 4L63B 1L1OC 4J1MA 4IJLA 1EWCA 5E4XA 1QNKA 1PH1A 2ZM6Q 1Y1VH 3F2UA 3PUYA 2K05A 3GO5A 3LWEA 3OMGA 1YNXA 3C3LA 3RLOA 3D31A 1SR3A 3S1RH 2H5XA 3A5UA 4BBRB 4OHJA 2GVBA 4WFN3 1B9NA 1QVGA 1TQOA 2AQ2B 5ELDA 2JXMB 3SHLA 5M9OA 4EVOA 1WTOA 3S1MB 3M4QA 1L0XB 4GS3A 1PXUA 1SNPA 1JR0D 3OTOQ 4BY7H 3QR8A 3S24A 2OWOA 3QOJA 2CCZA 1HR0W 2F0OA 4E6IA 3OOCA 4EGVA 2EXZA 2UUBL 3M3YH 1W6JA 1IBLL 3URYA 1G291 3S15H 1I4HA 1L0YB 4S3SA 1IBKQ 4BBSB 4C2MH 2EYOA 4KD3A 4B3RL 3K5OA 3MXUA 5HGQA 4DAYB 3E5SA 3LGJA 4FP5D 3H6MA 1YNND 2UUCL 1BCPD 2JEAI 3HOZG 5IT9E 2E5LL 3NBHA 3RUZA 3SVMA 1ZXTA 2B2UA 1J9OA 4DR4L 3I4NB 3S17B 4NB3A 1LTLA 3Q6SA 1KTKA 4WJWA 1M90C 1YNJD 1JOQA 5EPJA 2FMCA 3E6ZX 1PH2A 3DEOA 1WTWA 2B63H 1SYFA 1V1QA 2E2JH 1IW7D 1X32A 5M3MH 2A6HC 5J22A 1MJCA 4KK7A 3UE0A 5KIXA 4YCUA 1K9MC 1FD7D 2HT1A 5JJKA 2N78A 2EPBA 5JEAH 2XRSD 4HIDA 1MJEA 1WYDA 1C7YA 3IKJA 2PZUA 3A7LA 4MTNA 3ULPA 4X64Q 4K0KL 1K83B 1TWFB 3MC0B 1B7YB 2AKWB 4X62L 2MHVA 4OO1I 1STGA 1Q12A 1SMYD 2PQEA 2IY5B 4DV3L 1I6VC 1C9OA 3J7AV 4KKUA 4Z9CB 2CH4W 1K0RA 4RCNA 5IGCA 3KOJA 4EQPA 2VL6A 1TWCB 2RCFA 1HZCA 4JI4Q 4A3BH 4EX5A 4DAPA 3NUCA 1KLGD 3KLSX 1SDFA 3VR6A 1B8AA 2QILA 1MGSA 3HFZB 3K6OA 2H4OA 3NELA 4UY8C 5GADC 1D5XC 1B1ZA 2PW5A 2KCTA 5BR8Q 5DAUA 3U9OA 1H9KA 3HOUG 1PMRA 1WCMB 1BNZA 2AUKA 3NTHA 1VQOA 5T1IA 1BBUA 4MN3A 2Q8TA 2N55A 4TVAB 5IYCH 2VUMB 1YHQA 2GN5A 1JC7A 4QY7A 5G3LF 2I5HA 2XSCA 2F3IA 3MXNB 1YITA 1WTHA 4PMCA 1Z6HA 4ME5A 1ASYA 5JJZA 1Y1WH 3EN2A 1HA5A 4NMZA 1PYWD 1CM9A 1ONLA 1PRTB 5EPLA 4UHVA 1XMQQ 4RG1A 2K50A 3IAYA 5IP7G 4N9PA 4YIJA 3TSSA 1VCIA 2NVTH 4L5RC 4GN4B 1CQFA 5C0XG 2FXQA 4LF5L 3K0XA 2VQEQ 5FLXE 1U9RA 2Z6KA 4GKJL 1TT2A 1YHAA 3CQZB 3FMCA 1D8LA 4C3IG 5GAHC 4F7XA 1BKBA 4CHTB 1Y14B 2P5ZX 4YCWA 3S2DH 5A35A 3PO3B 1Y1VG 1YVCA 1F9QA 3CKIB 1NY4A 5A2QL 2PZWA 4OEMB 4IUUA 3GTJH 4RGOS 4A3KG 1ICFB 2JA6H 1XX8A 4C3HH 1D6EC 1EWIA 4JPBW 5I2XA 5JOBA 2HUGA 1M4VA 1ZKOA 1G51A 1X65A 1NJIC 1EIGA 1VQ5A 4NP5A 5LL6X 4WJ3M 2OCEA 4R4TA 5D14A 2BA0A 2IWHA 4DFAA 3K59A 3CPWA 4JV5Q 4CKBA 3M4OH 3CRKC 4QQBX 1A3TA 1SYEA 4HJAA 4KD4A 1VQHA 2K5WA 3JAME 1CHPD 1XPUA 2QEXA 2BOSA 3VYRA 2DY7A 1PRTC 2ASBA 2I46A 5G3LD 4GOPA 3TMEA 1SEBD 2H1EA 3OW2A 4HIMA 1WTVA 2EY5A 1HA6A 2VXWA 4RKBA 1JB7A 3MAQA 1WFQA 4K5VA 2CQAA 3FKIB 1BBWA 1BDOA 4LMQD 5C4ZA 1SRUA 5DM63 4B3SL 2ZTEA 4KV6A 1H9RA 5FO8B 3GTKB 1N34Q 1B3QA 1EY0A 4JI2L 4IALA 5M3FB 5IYBG 1LABA 3A56A 4OO1G 3MEHA 4KMUC 4DUYL 2IX3A 3S16B 5IGFA 3DUZA 5C44B 1QNUA 1UE5A 1N9WA 4LFAQ 2B2YA 4U68A 1QG7A 1W6KA 1EY5A 4Y7NH 2Q2IA 4A3GH 1SBBB 3EQLC 1UE1A 4QUFA 5C3XA 3QB3A 1D1KA 2PQAA 3H91A 4LF8L 1STYA 1SSOA 5I9OA 4MHEA 1K8GA 3CP0A 3S1QH 3J80i 2F0VA 4X66Q 5LMNW 4A3EH 2QEJC 3A8IE 3E0EA 4ZUIA 1IL8A 4ID6A 3VR4A 1I50B 4OGQC 2M00A 1P16A 1CQVA 4A3LG 3UDXA 5EKIA 1PTOH 3J7YW 5AJ3Q 1KC8C 4OWXB 2WB1B 2K04A 3GTPB 3UE1A 2E2HH 1K0SA 3HOYG 4IPDA 3KJOA 1AZPA 5EJWA 1YJWA 2E2IB 5FLMH 3V2TA 3TDQA 4DK1A 5FO9B 1HPCA 4LWCA 4DN4M 1JE4A 1ESRA 4O42A 1A62A 4LFCQ 1K3BC 3VYSA 2M2LA 4A3FH 2EJGC 3BDCA 3KUPA 3HS0C 2CKZB 5ELFA 3DM3A 4YWLA 3FPPA 3NP8A 3SE0A 1JQYD 2XGTA 3QO2A 3SK5A 2NVQB 1SE8A 2EXDA 4YHHL 2R92H 3AU7A 1IBML 2F1MA 3EBEA 4F88A 1MIUA 1LTSD 1PZKD 3DWAA 4KHVA 1MBYA 2OQ0A 5CV5A 5JJLA 2C35B 4A3MH 2JSOA 1XWEA 3OIPA 2QW7A 3CMEA 2EYPA 1Q3LA 1JJCB 5M5YH 2O5IC 5C3WA 1PFNA 1A6XA 3H94A 4JI4L 2JA9A 3GDEA 1YEZA 3WDNA 4JW0A 2XVSA 1IBLQ 2PMZE 3ERQA 2NZHA 3GTGB 2PNHA 3QG1A 1HZBA 3KBGA 2PCFB 4C3HG 1CZGA 1N33L 1EYAA 5GAEC 4B3TL 2UUCQ 1HFGA 1KL9A 2E5LQ 2ATWA 1A15A 4DR4Q 3BDOA 3K5NA 4RH6A 1ET6A 5JEAJ 4TRDA 4G7HC 3W2DA 3I90A 2JA5B 1FNUA 2LXJA 2LSSA 2A69D 3NSWA 1STEA 1FGUA 5IWAL 3S1MH 1CFMA 1LUZA 5ELEA 4A3DG 1PTOF 1XNRQ 3MVVA 2FMMA 1KD1C 4LK1C 5JJIA 1HQMC 2O5JC 1GJXA 1U4PA 3TP7A 1H95A 2RDHA 4R4IA 3D8GA 3KF8B 2SOBA 4ABNA 4FO2A 3PIP3 1VQEA 4BBSH 4K0KQ 2VQEL 5EPKA 1X55A 1WOCA 3O13A 4X62Q 3K7AB 4JC0A 1UEBA 2B2VA 4DV3Q 3QIAA 3HZXA 1U4LA 3VA5A 4X3KA 1TXYA 3FP9A 1O7ZA 1C8CA 3I4NH 5CV7A 3S17H 1F2YA 3AEVA 2EVBA 1SAPA 2QA4A 2AWNA 3BZDB 1EY8A 4YY3L 3HOZH 1FVIA 1PH5A 1XPOA 2C5CA 2K75A 3RZDB 1PH7A 1B70B 2NTSA 2L1BA 1PZJD 2DUDA 3M9BA 1VQLA 5L37A 4KHZA 4BA1I 3R2TA 1JJGA 1I4RA 3L7ZC 1GUTA 2SNSA 2VW9A 1K8MA 2RCNA 5I4DA 4QIWB 4LF9L 2CVRA 3T1HL 4H02A 3PMFA 3RN2A 3S1NH 1K83H 4G7OC 3I70A 3STBC 2V4DA 5ELCA 3HOWB 3RR5A 4DR3L 1BF4A 1CKNA 3KYHC 3F8TA 3CHBD 4CDDC 3QWNA 1PTOD 5FLMG 4NDXA 4I7AA 2MNAA 1TWCH 2ENBA 3UDGA 4C1NI 2CWAA 4OONA 4LF5Q 2IT1A 1ENAA 4PMWA 5IE8A 2RQXA 4GKJQ 3K5MA 1FNVA 1AW7A 2K5DA 2DNEA 1XTDA 1JT8A 2F0TA 1HZAA 3CXCA 2R7DA 1PV4A 3U58A 1I5FA 1WCMH 2JYOA 5KEEA 4K8IA 1QUQB 1LTRD 4MIUA 2R92G 3I2ZA 3NTIA 2G5DA 2A73B 1K8AC 2B2TA 2PZTA 4AYBB 1MSGA 1DXMA 1X54A 3JC66 3AFPA 4PZ6A 1SXTA 1B44D 4RGMA 3HOUH 3WOFA 2N49A 1STAA 1OTCA 1EIHA 4IPGA 3A74A 3HOXB 2YYZA 3J81c 4X66L 5TSSA 1SFOB 4TQUS 5A2QE 1S5FD 3HKZG 4UP7A 1IYJB 2KOLA 3G71A 3S2HH 2K03A 1VMPA 4HCEA 3GQBA 1D1IA 5AJ3L 5JAVA 4JOIC 1CKMA 5I6WA 1QE6A 3A55A 1Q8KA 3CQZH 3HKSA 2ZXRA 1KQSA 2F0FA 2B3GA 1HZ9A 4DV4Q 4NW2A 4XXEA 2WAQE 3BZKA 1ENCA 3KLRA 4DK3C 1U5KA 5C0XH 4ILWA 4LFCL 4LNQA 4BBRG 3J7AF 1PFBA 4DV1L 1VQBA 1SNDA 1OXVA 4HJ5A 1Y8NB 4DAVA 1Z9FA 4DUYQ 1OO9B 4PV1C 3CCRA 1A63A 3BS1A 3E3XA 3A8JE 1PYBA 2F0KA 4A3KH 1L0WA 2EE1A 2CW0D 2J0TD 4U673 3OW7A 2Z0SA 4JI7L 5C0XI 3FEWX 3MA2B 1TWGH 4BBSG 3J7ZC 1LT4D 2L9HA 4GN3B 3KK7A 1IL2A 2KJXA 2Z6BA 3NPPA 4A3IB 1JOOA 2R93B 1Z47A 4LF8Q 2B2WC 2NVYB 2PMZB 2PPBC 2QGQA 3ITPA 4JI6L 4G7ZC 1DOLA 5C3EB 1LT3D 5M5XB 1YJ9A 1JWSD 3I4NG 3J80L 1DGSA 2NYZD 1AE3A 1UE7A 1KDCA 1QVCA 3RZOB 3DEPA 1DONA 1TS3A 1UWVA 4GNXA 1DOKA 3CRLC 2YTXA 3GTKH 5ELOA 5C5LA 1FL0A 1E7ZA 3M4YA 5M3FH 4YWKA 2NBFA 3H3VC 5GROA 4UDUC 4K5XA 2Z8LA 1AZQA 4L6TB 5C44H 4DK6C 1LACA 1STNA 1GD7A 2LS01 1PH6A 1PRTF 4JK1C 1GUNA 3ONAB 4PZ8A 5I9PA 1VQ7A 1GUSA 3D6WA 1MHWC 3WWVA 4GLXA 1VQAA 5IYBH 4OO1H 1XNRL 1ET9A 1FJGQ 4OIJA 3GTOB 1STBA 5K36H 4TSSA 4LJZC 3LNNA 1BCPB 5E3FA 3QOLA 3UI2A 2YV5A 4A93B 5KGUA 3GTMB 3K7UC 3RMHA 4BY1B 4AIMA 1PZID 1RD9D 2MO0A 2HDLA 4YHHQ 4ZAIA 5ELBA 1IBMQ 1D2BA 4G57A 4AH6A 5FJ8G 2B2VC 4XDXA 2F4VL 1BUVT 1I50H 1RF2D 1UAPA 1LTBD 1X3FA 2F0EA 2MJ8A 4R4CA 1ESFA 2F4IA 5IT9c 4DNTB 3DXJC 1NMGA 1XTCD 3PO2B 5CBAE 4CKCA 3GD7A 2K32A 2Z4IA 2E2IH 1WCMG 2JN4A 4QB4A 4DGZA 3R8BA 1PFSA 4FYDA 5KYIA 4A3LH 3LWUA 1N36L 3VR2A 2VUMG 1JWUD 1N33Q 4XT1B 4C3JB 4DR2L 3A54A 3QJYA 4B3TQ 5COYA 2K5NA 1SJED 2VS1A 4XQQA 3HOYH 3MFGA 3HG9A 1NAPA 3TN2A 4KY6A 2K28A 2A68D 2QF7A 3NBIA 1CSPA 4OIKA 1V1PA 3HP3A 4LF4Q 2NVQH 2HCIA 1SMXA 4M8AA 4DV0L 1T5EA 3PUXA 2F0GA 4KI0A 1X6OA 1YNNC 4RWSC 1BCPC 4NXNL 4K8JA 5IWAQ 1IXRA 5HURA 4POGA 2NN6H 3I4LA 3CC4A 3CCUA 1HXYD 2VB3X 2R7ZB 4B9XA 1GM5A 5C4XB 3PUWA 4GKKL 5KYLA 1DCZA 3Q8DA 1XXGA 1YNJC 1L2FA 2F0IA 3I7FA 4DXGA 3J7A5 1R4PB 2PI2A 5IP9H 3PO3G 3RLFA 2FJ2A 1IW7C 5J3BA 4RFBA 2NUCA 1XNQL 1P8LA 1R9TB 1EY7A 1TS5A 1TS2A 1Q86C 4K6LA 4HMJA 1O7LA 2JJQA 1UEAB 2F0SA 4DR7L 2NN6I 1CZWA 3E9IA 2UXBL 2B2TC 3S14B 5EAYA 3X3MA 2E76C 1TWHB 2D9UA 4HN7A 2KEEA 5JPNC 1IYVA 2N3SA 3NK9A 4X3SA 2JA7B 1D7QA 1VQ8A 3EROA 3GTLB 5J1ZA 3CW2C 1TWAH 4YY3Q 4KLKA 1I6HB 1SMYC 3Q24A 5LHY1 2J4XA 1O7IA 1S5ED 5KNBA 1GUOA 3DMUA 4IOAA 3UDIA 3W1BA 3T56B 2G9DA 5DM73 1CA5A 1YBYA 5I6YA 4HMIA 2E74C 1FR3A 5IGGA 1HHVA 4JI0L 2Y0SE 2EYJA 3OMCA 5IOCA 2YU9H 2KBNA 3HEJA 2HIXA 4LF9Q 4A3DH 1DD2A 3T1HQ 4DK0A 3BVMA 4DNRB 4LUVA 3FKIG 4KY5A 4ZYSA 5FLXc 3NBHB 2LXKA 1I4PA 3S1RB 1H9SA 2BE5D 1Y8OB 1S5BD 5M3FG 4DR3Q 4DV4L 2WAQB 3MXPA 1A8VA 3TP5A 3I56A 1HNZQ 1A2TA 2A6ED 4L5TA 1HTLD 4UAIA 5C44G 3VDYA 2AWOA 3M85A 1RJTA 4X6AH 1HQRD 2ICIA 2VNUD 4BY7B 4C56C 2O4XA 2X6LA 3VYTA 3WOEA 1Y69U 3HOVB 3D4RA 4HTHA 2D0OA 2OTJA 3N52A 3H0GB 1TR5A 3M3YB 5K36G 3RZDH 1LV9A 3S15B 3GV6A 4FVMA 4EQNA 1Q81C 3V05A 2XIWA 1VQ4A 1S3OA 4ME3A 4DKAC 2UUAL 4KHPQ 4DU9A 3SK8A 2M9VA 3JAMc 2JA8B 1TS4A 1BQQT 2DN8A 3AB9A 1IKLA 4DR6L 4CDCC 4WRDA 2KQ3A 4BXXG 5CMDA 2PW7A 2OTLA 4CKEA 1JICA 1VMCA 2WKDA 2I0QA 3HOWH 5CC4A 5IGDA 2B63B 2WB1G 2A5HA 2KUMA 3AMUA 2E2JB 5C5MA 5C0XJ 1WD1A 2F0PA 1PH3A 4LUOA 5BN4A 2B2UC 5M3MB 2MQHA 3GTQH 2HQLA 3TRZA 1CA6A 2SDFA 3EIVA 1HUNA 2LFNA 2EDGA 1B9MA 1DM0B 3ZYYX 2L11A 4FF3A 2I5LX 3H09A 3KF6A 1NMFA 1EFID 1B3AA 1KABA 3D0FA 3MEFA 1EFWA 2L12A 4L5SA 4I65A 3PGZA 1S4ZA 3P75A 4JI5Q 2B8FA 3P7JA 1W3SA 1B50A 2RDGA 2BH8A 1FJGL 1J5EL 1YI2A 4DR5Q 4DV1Q 4KJOA 2DY8A 4BA2I 1IHZA 1NTGA 4HJ9A 2XNAC 4ZQ3A 2NN6G 2R7FA 4RHRA 2CH4A 1EIYB 4A3BB 1Q1EA 4JI8L 3HKZE 3CD6A 2RA4A 3TZUA 1E2WA 5IP9G 2Q2HA 3CCVA 1VDZA 4JI7Q 3AQQA 4KKTA 3KFUA 1EY6A 2HDMA 1RTOA 4O2DA 1AE2A 1VS0A 1L1OA 4MZ9A 4ALPA 2FHTA 1N32L 5ISRA 4JI6Q 4APVA 4HIKA 4O1NA 1EWHA 2WP8J 4WORA 2K6AA 1EYCA 4XT3B 1Y1WB 1II3A 5JVG3 1E24A 1SN8A 1EQVA 3L2PA 2JA5G 2UXCL 3CCLA 1HNWL 2SEBD 2OEOA 3FHWA 3UDFA 2KA7A 5C4HA 1K3RA 1U4RA 2NVTB 2FFKB 1EQTA 3J80E 1GHJA 4LF4L 4JYAL 2E75C 2EY1A 4BBRH 2GVAA 5K5PA 4ZKBB 1KIXA 2EY6A 2VY3A 3S2DB 2F0DA 1ICWA 4NPSA 4UP8A 4Q0FA 4KTAA 4GOPB 2BDNA 1NE3A 3J81i 3BJUA 3J81j 4DV6L 1D5MC 1C4QA 3CAMA 4R9WA 3SDZA 4J6HA 1PH9A 4IFDG 2ZTCA 4N8X1 3T16A 4V190 2R93H 4H7BA 2N88A 1FNWA 2EZVA 1Q82C 3MHBA 1G2SA 2AUJD 2NVYH 2Z6KC 1HR0L 3TZDA 3X3NA 5CV6A 3A0JA 5C3EH 4IUQA 3TS2A 2EIFA 5M5XH 1YHBA 3U4VA 4A3JB 4G4KA 2ALYB 3F2CA 2KVMA 2F4VQ 1EL0A 1AH9A 5T1GA 4LFBL 3T4AC 1HNXL 1PVOA 3I8ZA 2Q8IB 1SROA 3M4OB 4R4OA 4QMGA 3MTSA 2MPMA 4LF7L 4K5WA 1G91A 4IN3A 5LL6S 1LTTD 2RSOA 4LAAA 1NBWA 1ILQA 1N36Q 1ML0D 3CC7A 4L8JA 1O80A 2PQAB 3CF5A 1KDAA 4DR2Q 3TP8A 4FDBA 3CC2A 5LMUQ 1VQPA 3GTOH 2Z1CA 3EA6A 5I2YA 2Y0SB 4FXGC 3Q0AA 4UP9A 3PUVA 3HOWG 4P72A 3RLNA 2YTYA 4A93H 1EYGA 2E2DC 4PZ7A 4GOPC 1F77A 3NHHA 4DV0Q 4DAYA 1J8IA 4NXNQ 4IUVA 4L5QA 1TWFH 2CWPA 4FXDA 1O7YA 4HSVA 2UU9L 1UUPA 1GHKA 2ZJQA 1S72A 5EKKA 5FOBB 1HNZL 4GKKQ 3PO2H 2EYLA 1TY2A 5FJ8H 1VQ6A 3I4MB 1QWYA 1JE5A 2A69C 4OL7A 3NQIA 4FF4A 1XNQQ 1ZYRD 4IZ8A 4N9TA 3L9AX 2B2YC 1F2LA 4A3EB 4AYBG 4NXML 4DR7Q 2D0PA 2R3ZA 1S5CD 2UXBQ 1SYGA 1WI5A 1SYDA 1V1OA 2XN9C 3HOXG 4HJ8A 2Q2TA 1V43A 3TEHB 1PTOB 4CDEC 4KHPL 2HCCA 2K5QA 1AP0A 3TQYA 2MO1A 3NWTA 2VUMH 4DXFA 2A8VA 3KJPA 4DUZQ 1HJPA 4KKSA 3VR3A 2E2HB 1WTPA 1Q90A 4DV5L 3S9WA 4A75A 4R8NA 4RMFA 5J39A 4H44C 1IKMA 3T1YL 2L15A 5C4XH 3K57A 5IY0A 3IFDA 1VQMA 1EY4A 1G6PA 3P1HA 4JI0Q 4P2CB 4A3FB 2IJ0A 2WACA 2CFMA 3OSOA 4P74A 2WIIB 2PO4A 1R9TH 2B8GA 2RHQB 3K0YA 2PYKA 4OX9Q 3OPOA 3BZCA 1EEID 3D3RA 1PH8A 3G48A 5CV8A 3LX0A 3PO3H 2ICEC 1XYIA 3T53B 3S14H 4IUPA 4JI5L 4A3MB 4MTKA 2FINB 2F0WA 4DNIA 2JA7H 1MI2A 2Z4HA 4B9WA 3BG3A 3MXNA 4DV7Q 4DR5L 3F1ZA 3A7AB 3I91A 5M5YB 3GTLH 2A6HD 3EVQA 4R4QA 1VQ9A 4Y52H 1G6ZA 5EBDA 2UXDQ 1QZGA 2EJMA 4PMBA 3FRPB 4RCOA 1PTOC 2VQFL 4MNOA 4GLVB 1X3QA 2Q2UA 4A3IG 2R93G 2OF1A 1KNEA 1UNSA 2UUAQ 5C3EG 1NR4A 2OT2A 1X3PA 5CBEE 2C9OA 4OWTB 5KNDA 3A8KE 1BVSA 4CBVA 1EZ6A 4J15A 4DR6Q 4IURA 4WJ4A 1GXDC 1I4QA 4CDFC 1VQKA 1QILA 3TP6A 2B39A 1CI3M 4A3CG 1QOHA 3TREA 3ULJA 4A4IA 5E1FA 1VQDA 2LMCB 1NUCA 1RDPD 5NUCA 1GVPA 2QDBA 1XJVA 4K2LA 4JBJA 4HAEA 1E1TA 3FKIH 2MP1A 1CTMA 2EY2A 1RL2A 4DAMA 3PQIA 1I4XA 1F9SA 1E0BA 1CK1A 1OXUA 3I55A 2SNMA 2F0JA 3K80C 3HOVH 1OXXK 5IYDH 1VF7A 2B29A 3AYHB 3H0GH 3S16H 1EOTA 2L0CA 4IQZA 2J7ZA 3MZ5A 1IZ6A 1DJRD 4GZYC 1JMCA 5FK9C 4A93G 2K14A 3K8AA 4BY1G 2OXPA 5M5WB 2CHBD 3F2BA 3SEBA 1I3QB 4YWMA 2KEDA 3ERSX 5IGEA 2KECA 1J5EQ 2AQ1B 2JA8H 3M4PA 2IHEA 4YCVA 1CKNB 4LF6Q 3OWEB 1EZ8A 1PLFA 2XWBB 1RKNA 4O0AA 1NR2A 2WB1E 5C6AA 4AQYQ 3KDFB 4B3MQ 4JI8Q 3HOZB 4ZLTF 4IPCA 5LMNL 3PO2G 1YIJA 2EOTA 2EYFA 2PI2E 1OXSC 4HIOA 1SE2A 2E8GA 3P20A 3E9HA 1S5DD 2BH2A 4BXXH 2IL8A 2DGYA 2ZJPA 1AFPA 4IOCA 2RVLA 1LT5D 1WTQA 2Q8RE 2QKIC 2R6GA 1PA6A 3VA7A 4C3JG 5DNFA 4Q5VA 3GTPH 1JWMD 4RGNA 3I3CA 1EIFA 2NWGA 1N32Q 5C4JB 1HTPA 2CW0C 1C48A 2L5TA 2NVXB 4HSPA 2VB2X 2F0HA 3S1NB 1CHQD 1SYCA 1PDQA 1KHIA 3M7NA 2IHFA 4JI3Q 1KLUD 1U0LA 3F2DA 2UXCQ 5LMUL 2KHSA 1HNWQ 1E1OA 1BR9A 1S40A 4BS9A 3N6RA 3CCJA 4ZRZA 2R7ZG 5C4XG 1WJJA 1YZ6A 1TIID 4DA2A 1E2VA 3JAMi 4JYAQ 4K14A 2X69A 1EY9A 1SNOA 3IFTA 3SXHA 2KHIA 3Q23A 1TVXA 3VYUA 1PRTD 4JI1L 4DV6Q 2KENA 5E4WC 2RSNA 1LO5D 3J81L 1EU3A 3HGBA 2IX0A 4RHSA 4JBMA 1E2ZA 3MWYW 1HR0Q 3I4OA 3HOUB 1I94Q 1CKOA 4DV2L 2HIVA 2WV6D 2JA7G 4X65Q 3GTGH 4DR1L 1QCBD 1JORA 2L55A 4IUTA 2D2CC 4LFBQ 3AFQA 3K58A 1HNXQ 5EBCA 2AQ3B 2WKCA 5D65A 4M1UB 2EQSA 3S2HB 1EQRA 3CCEA 4HJ7A 4KN4C 3NEMA 4LF7Q 1T9HA 1XPRA 4QL5A 2MUYA 1KRSA 1PHJA 2DNCA 4DUZL 1SNQA 2JA5H 4QJFA 3D4WA 4GLAC 2N8NA 5CV4A 1RIPA 3GV3A 4K6DA 4F8MA 3BVZA 1G2TA 2IX1A 2A19A 1A3VA 3NE5B 3CCSA 1MKHA 1J6QA 4H0LC 3ND9A 4PG3A 1FYCA 2WINB 2A1AA 2ZTDA 4JBKA 2WAQG 2K5VA 3L3OC 4XQNA 3DM1A 4C3IB 3RN5A 3DWPA 2D5DA 3CU7A 2F3WA 4GNXB 4HCSA 3W1GA 1Y1VB 4V0BA 4A3JH 1ILPA 3U9SA 1LT6D 4B08A 5ELNA 4BY7G 3BU2A 1GUGA 3A5ZB 2UU9Q 4IFDH 3R93A 4OX9L 4A3KB 4ZK9B 3PF4A 1EEFD 1LM0A 3NQTA 3RD4A 3K7AH 3HOVG 1IYUA 2A68C 5IYDG 4IUNA 3T51B 4EQ5A 3H0GG 1M1KC 2QCPX 4H13C 2YTVA 1TWGB 1X3GA 1K73C 2K4KA 2QDLA 1A3UA 4DV7L 1JOKA 3CPFA 4QIWE 5FKAC 2JQOA 2HD3A 5D3DA 2UXDL 2KCNA 2GA4B 2EYHA 2TSSA 2JA8G 4IFDI 5EGTA 4NXMQ 4C2MB 1CT1D 5GQOA 3K81C 3PIO3 1RTNA 3KF8A 5KRUA 2D62A 5JPMC 5IODA 1XMOQ 5EKLA 1CSQA 3NENA 4LUZA 1B4OA 1VQNA 1RHPA 2B63G 4FF1A 1CUKA 4HEDA 2F52A 5D3IB 3SGIA 2ZM6L 5M3MG 1ASZA 4C1NK 5F2DA 4DV5Q 3R2IA 1WD0A 1WTXA 4R8IA 3T1YQ 4GNXC 1GKHA 2ZT9C 1NNXA 1QB5D 5JEAG 3C1FA 1E3PA 1VQGA 3BYYB 3OTOL 3I4MH 1O78A 2BDOA 3K5LA 3T13A 2LKVA 3BVGA 5IT9L 4AYBE 4J8QA 4CJ1B 1K28A 4POFA 1WVLA 1V1PB 2I07B 3GP7A 2WFWA 5JVH3 1IBKL 4TKOB 2K01A 2KCMA 4KN7C 2OQKA 3HRZC 2JEBI 2CQOA 2HHHQ 4A3BG 5HY6A 3G4SA 3IL8A 4QCLA 3DHQA 5E7NA 2AMCB 1F9PA 4PQXA 1AN8A 1NSNS 2X6GA 1HCZA 4JBWA 4RGTA 2F0UA 4P71A 2BE5C 3V96A 1M8AA 4QF4A 4LF6L 1JB3A 2AHOB 5CR3A 4DPGA 4AQYL 1HFNA 1V9PA 2K1BA 4IPHA 4N8FA 2K52A 4JOIA 3HOXH 2A6EC 2VQFQ 4B3ML 3OHXC 2KHJA 4XIGS 1SFOH 3NWSA 5AFWA 5IYCG 1KAWA 3PIOA 1Q1BA 3HOYB 3CMAA 2ID0A 3U50C 4JVZA 4IO9A 1RCVD 1TY0A 2ZXPA 1Y1WG 3RNUA 5EQ0A 3SK4A 1EUJA 2RKSA 1Y8PB 1X3EA 5CV9A 5DEHA 3U4ZA 2IW3A 3MFYA 1SYBA 2XTIA 1QUQA 4X64L 1PYSB 2NB0A 1AEXA 2MGSA 3H3VH 2BA1A 2NZ1D 1LTAD 2F03A 1GUWA 1PFMA 2XWJB 4JI3L 2A74C 2JK8A 1SE3A 1KDBA 3KLWA 2Z9HA 4ZCKA 4HR7B 1GOZA 2R61A 1Z7TA 3OIQA 3KLSA 2K7VA 2UUBQ 1EQQA 2XRQD 2RBMA 5H1SE 3ZJYC 1PH4A 4X3TA 2EJFC 4RKLA 3W5OA 2B2WA 4KY7A 4B3RQ 2JA6G 1VQFA 2ES2A 1SLJA 4I7ZC 5BR8L 3H3VI 3EFXD 2JE6I 5FO7B 1QZHA 1B53A 1H9SB 4XYQA 4A3JG 3STBD 1LYLA 4X3UA 3I72A 1Q8IA 3GTJB 1B2TA 5IGBA 4A3IH 2VZAA 4XQJA 2JA6B 1DYQA 1TU2B 1KNAA 2K5HA 4C3HB 2G9HD 3FVQA 4CGYB 3R3OA 1TWAB 3M7GA 3SK6A 5LMNQ 1I94L 1U4MA 4FXKC 2MFIA 4X65L 3CCMA 1WTRA 5FLXL 3RZOH 1FGBD 1QVFA 4CJ2C 3I73A 1EYDA 4FF2A 4A3CH 1ENFA 1H9JA 4LW1A 1XMQL 3ER0A 5CGKA 1Q46A 4JG2A 2YU9B 3ULLA 3J80c 1DZ1A 3OYYA 4A3DB 1X56A 1Q7YC 2Y0SG 3IRBA 2F3VA 3Q22A 1BXTA 3NXWA 2F0QA 1SE4A 2O2LD 1UE6A 3B6YA 3ICEA 5M5WH 1T5XD 1KXLA 2EYMA 1I3QH 1HRJA 1SNCA 4RAUC 1F2ZA 1KRTA 4CJ0B 1TKWB 4ZUJA 4K2KA 3GTMH 1BO0A 1BOSA 4BY1H 4P75A 4GN5A 4XYOA 4A3GG 3G6EA 3JAML 3BYTB 3I4MG 1G8ZD 4KJNA 2ZJRA 4BWGB 1SNMA 3H15A 3C46A 1VF5C 3KF6B 2DJFC 1LLRD 1OXTA 4JI1Q 3OWFA 3PSIA 1LTID 4Y7NB 2F0NA 1KAAA
chains in the Genus database with same CATH topology
4A3FH 4JV5L 2CKZB 1OXUA 4A3EG 2N3SA 3I55A 3DM3A 3PCOB 4YWLA 1D7QA 3K80C 1E22A 3HOVH 1VQ8A 1OXXK 5IYDH 2B29A 2XGTA 3AYHB 5C4JH 3H0GH 3CW2C 1TWAH 4UPAA 5GAGC 4YY3Q 1SE8A 2EXDA 4KLKA 4YHHL 2NVXH 3S16H 4DV2Q 2R92H 1O7IA 4A76A 1IBML 2I5MX 3EBEA 1IZ6A 4DR1Q 4P73A 1JMCA 1MIUA 4A93G 2K14A 3K8AA 4IOAA 4BY1G 3UDIA 3W1BA 4C3JH 2OQ0A 1YBYA 3F2BA 5JJLA 2C35B 4A3MH 4YWMA 1A0IA 3KDFA 2V1CC 3ERSX 1J5EQ 1XMOL 2Y0SE 4JI0L 2JA8H 2RF4A 3M4PA 2IHEA 3CMEA 1N34L 1JJCB 4IJHA 2KBNA 4XTCS 2HIXA 1CKNB 1VQJA 4YCVA 5M5YH 2YU9H 4LF6Q 3L0OA 4O0AA 4LF9Q 4A3DH 4R1JA 2WB1E 4AQYQ 3T1HQ 3KDFB 4JI4L 4LUVA 3FKIG 5FLXc 1X9NA 2JA9A 3GDEA 1YEZA 4B3MQ 3NBHB 4JI8Q 3PIPA 2LXKA 1IBLQ 4A3FG 4IPCA 5LMNL 2PMZE 3PO2G 1HH2P 4IFDJ 1YIJA 3TS0A 2NZHA 2PI2E 1OXSC 2PNHA 5M3FG 4HIOA 4DR3Q 4DV4L 1L1OB 4OWWB 2E8GA 2BH2A 3E9HA 1HZBA 4LFAL 1A8VA 1N33L 3I56A 2R7ZH 1HNZQ 4BXXH 5GAEC 2DGYA 4B3TL 2ZJPA 4L5TA 2UUCQ 5C44G 4IOCA 3VDYA 2AWOA 3M85A 1KL9A 4X6AH 2E5LQ 2ATWA 2VNUD 1GO3E 3CCQA 2R6GA 2RHSB 1YJNA 1PA6A 4DR4Q 1VQIA 3GTPH 4OXPA 5JEAJ 3PUZA 2D0OA 2OTJA 1EIFA 4A3MG 1N32Q 1VQCA 1W2BA 5K36G 3RZDH 2LXJA 2LSSA 1FGUA 5IWAL 1Q81C 3S1MH 1LUZA 1KHIA 4A3DG 1XNRQ 3M7NA 2IHFA 4JI3Q 3PF5A 1VQ4A 1S3OA 1U0LA 1KD1C 5EAYA 2HHHL 4ME3A 4DKAC 3F2DA 5LMUL 2UXCQ 1C0AA 2UUAL 5JJIA 1HNWQ 1E1OA 1TWHH 1H95A 4KHPQ 4JCVE 3JAMc 1S40A 4R4IA 4QGUA 3KF8B 3CCJA 1EOVA 3DLLA 4DR6L 2R7ZG 4BXXG 5C4XG 1WJJA 1YZ6A 1I6HH 2NZOA 3JAMi 4JYAQ 2OTLA 1VQEA 4BBSH 2I0QA 3HOWH 4K0KQ 2VQEL 1N8RC 2KHIA 1X55A 2WB1G 5IP7H 1WOCA 4X62Q 4JC0A 1UEBA 1JJ2A 5C0XJ 1PH3A 4LUOA 4JI1L 4DV6Q 2KENA 4DV3Q 3PV0A 2MQHA 5DLQE 4B3SQ 3GTQH 2HQLA 1TXYA 3FP9A 3TRZA 4JI2Q 2IX0A 4JBMA 4C3IH 3I4NH 1L1OC 3EIVA 3S17H 4IJLA 3AEVA 1PH1A 1HR0Q 2I5LX 1Y1VH 3I4OA 2ZM6Q 3PUYA 3GO5A 2QA4A 2AWNA 1YNXA 1NMFA 3KF6A 1CKOA 3RLOA 4YY3L 1I94Q 3D31A 3HOZH 4DV2L 1SR3A 1FVIA 2H5XA 2HIVA 3A5UA 3S1RH 1XPOA 1PH5A 2GVBA 3D0FA 4X65Q 2JA7G 2K75A 3GTGH 4DR1L 1PH7A 1B70B 1QVGA 3MEFA 1EFWA 4L5SA 4LFBQ 1VQLA 2DUDA 3AFQA 3M4QA 3M9BA 3PGZA 4JI5Q 1HNXQ 1W3SA 4KHZA 4GS3A 4BA1I 2BH8A 1FJGL 1J5EL 1YI2A 3OTOQ 1JJGA 2EQSA 4BY7H 4DR5Q 4DV1Q 3L7ZC 1EQRA 3CCEA 4BA2I 1NTGA 4HJ7A 4HJ9A 2VW9A 3NEMA 3S24A 2RCNA 2OWOA 4LF7Q 1T9HA 2NN6G 2R7FA 4LF9L 1XPRA 4QL5A 3T1HL 1PHJA 1KRSA 1EIYB 2CCZA 4DUZL 1HR0W 4H02A 1Q1EA 4QJFA 4JI8L 2JA5H 4GLAC 2N8NA 2UUBL 3RN2A 1IBLL 3HKZE 3M3YH 1G291 1RIPA 3S1NH 3S15H 1K83H 3CD6A 1IBKQ 2IX1A 3STBC 2A19A 4C2MH 3RR5A 4DR3L 4B3RL 5IP9G 2Q2HA 3CCSA 5HGQA 4DAYB 3CCVA 1CKNA 3KYHC 3LGJA 3F8TA 4JI7Q 1MKHA 1J6QA 3AQQA 4PG3A 2UUCL 2JEAI 3HOZG 3KFUA 2A1AA 2ZTDA 5FLMG 4JBKA 2E5LL 2MNAA 1TWCH 2WAQG 2K5VA 4O2DA 3RN5A 3UDGA 4DR4L 2CWAA 1AE2A 4NB3A 1VS0A 4GNXB 4OONA 1L1OA 4MZ9A 4ALPA 1LTLA 1M90C 3W1GA 1N32L 4A3JH 4JI6Q 4LF5Q 2IT1A 4APVA 4HIKA 4PMWA 5IE8A 5ELNA 1PH2A 4BY7G 4GKJQ 3BU2A 2WP8J 3A5ZB 2UU9Q 2B63H 4OX9L 3PF4A 1XTDA 1JT8A 1LM0A 1V1QA 3K7AH 2E2JH 3HOVG 1HZAA 5IYDG 1E24A 1SN8A 2R7DA 4EQ5A 3CXCA 1I5FA 1WCMH 5M3MH 3U58A 3H0GG 3L2PA 1PV4A 2JA5G 2UXCL 1QUQB 2R92G 3CCLA 1M1KC 1HNWL 1MJCA 3I2ZA 2YTVA 1X3GA 1K73C 2K4KA 3FHWA 3UE0A 1K8AC 4YCUA 4DV7L 3UDFA 1K9MC 1K3RA 2HT1A 1X54A 3CPFA 3AFPA 2N78A 3JC66 4PZ6A 4QIWE 5JJKA 3HOUH 2JQOA 1MJEA 4LF4L 4HIDA 2N49A 4JYAL 2UXDL 1WYDA 1OTCA 1C7YA 4BBRH 2GVAA 3A74A 4IPGA 2YYZA 4MTNA 3ULPA 2JA8G 4X64Q 3J81c 1KIXA 4K0KL 4X66L 4IFDI 4NXMQ 1B7YB 4TQUS 2VY3A 2AKWB 4X62L 5GQOA 4OO1I 3K81C 1Q12A 4UP8A 4NPSA 4GOPB 3HKZG 1NE3A 2D62A 4UP7A 3BJUA 3J81i 3J81j 4DV3L 4DV6L 1IYJB 3G71A 1CSQA 3CAMA 1XMOQ 1C9OA 3NENA 1PH9A 4LUZA 3S2HH 1K0RA 1VQNA 4IFDG 2ZTCA 2B63G 3KOJA 2VL6A 1CUKA 2R93H 5AJ3L 2F52A 1HZCA 1Q82C 4JI4Q 4JOIC 1CKMA 2NVYH 2Z6KC 3SGIA 2ZM6L 5M3MG 4EX5A 1HR0L 4A3BH 1ASZA 5C3EH 3A0JA 4DV5Q 3TS2A 2EIFA 5M5XH 1Q8KA 1YHBA 3U4VA 1B8AA 3CQZH 2ALYB 3HKSA 1KQSA 3F2CA 2B3GA 1HZ9A 3HFZB 4DV4Q 2F4VQ 3NELA 4UY8C 3T1YQ 4GNXC 1GKHA 5GADC 1AH9A 5BR8Q 2KCTA 2WAQE 4LFBL 3BZKA 4DK3C 3HOUG 5JEAG 1HNXL 1U5KA 1E3PA 1PVOA 1VQGA 4LFCL 1VQOA 4BBRG 4LNQA 3OTOL 3I4MH 1BBUA 1SROA 4DV1L 1VQBA 4R4OA 1OXVA 4HJ5A 4TVAB 5IYCH 1Z9FA 4LF7L 4AYBE 2GN5A 1YHQA 4DUYQ 4QY7A 2I5HA 3CCRA 4POFA 1NBWA 2F3IA 3MXNB 1A63A 1YITA 1N36Q 1PYBA 3CC7A 2WFWA 1IBKL 4A3KH 1ASYA 2PQAB 1L0WA 1Y1WH 2KCMA 3EN2A 2OQKA 3CF5A 4DR2Q 4FDBA 2JEBI 3CC2A 2CQOA 2HHHQ 4A3BG 5LMUQ 5HY6A 3G4SA 2Z0SA 1VQPA 3GTOH 4JI7L 5E7NA 5C0XI 2AMCB 1TWGH 4UP9A 3PUVA 1XMQQ 3HOWG 4P72A 4RG1A 4BBSG 4JBWA 2K50A 2YTYA 3RLNA 3J7ZC 4GN3B 4A93H 1EYGA 4PZ7A 4P71A 5IP7G 1IL2A 4LF6L 1VCIA 4GOPC 2NVTH 4L5RC 2AHOB 4DPGA 1Z47A 4GN4B 4AQYL 5C0XG 4LF8Q 4DV0Q 2QGQA 1V9PA 4JI6L 2FXQA 4LF5L 3K0XA 4IPHA 2K52A 4JOIA 2Z6KA 3HOXH 2VQEQ 2VQFQ 4B3ML 4GKJL 1YJ9A 4NXNQ 2KHJA 1YHAA 4L5QA 1TWFH 2CWPA 1D8LA 4XIGS 5GAHC 1SFOH 1DGSA 2UU9L 3I4NG 1BKBA 1AE3A 5IYCG 1UE7A 1QVCA 1KAWA 1Y14B 4YCWA 3S2DH 1Y1VG 3PIOA 1S72A 1Q1BA 1YVCA 2ZJQA 1HNZL 1UWVA 1NY4A 3CMAA 4GNXA 2ID0A 4GKKQ 2YTXA 3U50C 3GTKH 3PO2H 5ELOA 4IO9A 3GTJH 1FL0A 5FJ8H 1E7ZA 4A3KG 5M3FH 1VQ6A 2JA6H 1Y1WG 4YWKA 3RNUA 1JE5A 4C3HH 5GROA 1EUJA 1EWIA 1X3EA 5C44H 1XNQQ 4DK6C 3U4ZA 1GD7A 1G51A 1X65A 1PH6A 2XTIA 1QUQA 4X64L 1NJIC 4PZ8A 1PYSB 4AYBG 1VQ5A 1VQ7A 3WWVA 4GLXA 4NXML 4DR7Q 1VQAA 5IYBH 3H3VH 4WJ3M 2BA1A 2OCEA 4R4TA 2D0PA 2BA0A 1XNRL 2UXBQ 4JI3L 1WI5A 1FJGQ 3CPWA 4JV5Q 3HOXG 3M4OH 2JK8A 4HJ8A 2Q2TA 1V43A 3TEHB 4KHPL 4QQBX 3KLWA 3TQYA 4HJAA 2MO1A 2VUMH 2YV5A 1VQHA 3KJPA 2A8VA 3K7UC 4DUZQ 1XPUA 4AIMA 2QEXA 1HJPA 2MO0A 2UUBQ 1EQQA 4YHHQ 2ASBA 4DV5L 1IBMQ 5H1SE 3ZJYC 4GOPA 1PH4A 4AH6A 4A75A 3W5OA 5FJ8G 4B3RQ 4RMFA 2JA6G 1VQFA 2F4VL 1I50H 3T1YL 2ES2A 1SLJA 2L15A 5C4XH 1X3FA 4R4CA 4HIMA 5BR8L 3OW2A 3H3VI 1JB7A 1WFQA 2JE6I 5IT9c 1QZHA 5IY0A 1VQMA 1BBWA 4A3JG 1G6PA 1SRUA 3STBD 4JI0Q 4B3SL 2ZTEA 1LYLA 1NMGA 2CFMA 1N34Q 4JI2L 4A3IH 2VZAA 5IYBG 4OO1G 3GD7A 4P74A 2K5HA 4DUYL 2E2IH 1WCMG 1R9TH 1PFSA 5LMNQ 1I94L 4A3LH 2MFIA 1N36L 2RHQB 4OX9Q 3BZCA 4X65L 1PH8A 2VUMG 1UE5A 1N9WA 4LFAQ 3G48A 3CCMA 1N33Q 3RZOH 4DR2L 3PO3H 4B3TQ 3S14H 2K5NA 2VS1A 1QVFA 3HOYH 4Y7NH 2Q2IA 4JI5L 4A3CH 4A3GH 4LW1A 4DNIA 2JA7H 1XMQL 3ER0A 4DV7Q 1UE1A 4DR5L 1CSPA 1Q46A 3F1ZA 4JG2A 3ULLA 3GTLH 3J80c 1VQ9A 3OYYA 4R4QA 4LF4Q 1X56A 2PQAA 1Q7YC 2NVQH 4Y52H 2Y0SG 1SMXA 2UXDQ 3IRBA 1QZGA 4LF8L 4DV0L 3PUXA 1K8GA 3CP0A 4KI0A 1X6OA 3J80i 3S1QH 4X66Q 2VQFL 4MNOA 5LMNW 4GLVB 4NXNL 4A3EH 5IWAQ 1UE6A 3B6YA 3E0EA 2Q2UA 3ICEA 4A3IG 1IXRA 5M5WH 4POGA 2R93G 1KXLA 3CC4A 3CCUA 1I3QH 1GM5A 1KRTA 1P16A 3PUWA 2UUAQ 5C3EG 4GKKL 4A3LG 3Q8DA 1L2FA 3UDXA 4OWTB 3I7FA 1BVSA 3J7A5 5AJ3Q 2PI2A 4J15A 5IP9H 1KC8C 4OWXB 3GTMH 4DR6Q 4WJ4A 1VQKA 4BY1H 3PO3G 4P75A 3RLFA 3UE1A 4GN5A 2E2HH 3HOYG 4IPDA 5J3BA 4A3CG 3TREA 3KJOA 3ULJA 4A4IA 1YJWA 3G6EA 1XNQL 5FLMH 1VQDA 1P8LA 4A3GG 3I4MG 4LWCA 1Q86C 2ZJRA 1GVPA 2JJQA 3H15A 1XJVA 2IY5B 3KF6B 2NN6I 4DR7L 4JBJA 3E9IA 1OXTA 1E1TA 1A62A 4JI1Q 2UXBL 3FKIH 4LFCQ 3PSIA 1RL2A 4DAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F H;  4JV5 L;  2CKZ B;  1OXU A;  4A3E G;  2N3S A;  3I55 A;  3DM3 A;  3PCO B;  4YWL A;  1D7Q A;  3K80 C;  1E22 A;  3HOV H;  1VQ8 A;  1OXX K;  5IYD H;  2B29 A;  2XGT A;  3AYH B;  5C4J H;  3H0G H;  3CW2 C;  1TWA H;  4UPA A;  5GAG C;  4YY3 Q;  1SE8 A;  2EXD A;  4KLK A;  4YHH L;  2NVX H;  3S16 H;  4DV2 Q;  2R92 H;  1O7I A;  4A76 A;  1IBM L;  2I5M X;  3EBE A;  1IZ6 A;  4DR1 Q;  4P73 A;  1JMC A;  1MIU A;  4A93 G;  2K14 A;  3K8A A;  4IOA A;  4BY1 G;  3UDI A;  3W1B A;  4C3J H;  2OQ0 A;  1YBY A;  3F2B A;  5JJL A;  2C35 B;  4A3M H;  4YWM A;  1A0I A;  3KDF A;  2V1C C;  3ERS X;  1J5E Q;  1XMO L;  2Y0S E;  4JI0 L;  2JA8 H;  2RF4 A;  3M4P A;  2IHE A;  3CME A;  1N34 L;  1JJC B;  4IJH A;  2KBN A;  4XTC S;  2HIX A;  1CKN B;  1VQJ A;  4YCV A;  5M5Y H;  2YU9 H;  4LF6 Q;  3L0O A;  4O0A A;  4LF9 Q;  4A3D H;  4R1J A;  2WB1 E;  4AQY Q;  3T1H Q;  3KDF B;  4JI4 L;  4LUV A;  3FKI G;  5FLX c;  1X9N A;  2JA9 A;  3GDE A;  1YEZ A;  4B3M Q;  3NBH B;  4JI8 Q;  3PIP A;  2LXK A;  1IBL Q;  4A3F G;  4IPC A;  5LMN L;  2PMZ E;  3PO2 G;  1HH2 P;  4IFD J;  1YIJ A;  3TS0 A;  2NZH A;  2PI2 E;  1OXS C;  2PNH A;  5M3F G;  4HIO A;  4DR3 Q;  4DV4 L;  1L1O B;  4OWW B;  2E8G A;  2BH2 A;  3E9H A;  1HZB A;  4LFA L;  1A8V A;  1N33 L;  3I56 A;  2R7Z H;  1HNZ Q;  4BXX H;  5GAE C;  2DGY A;  4B3T L;  2ZJP A;  4L5T A;  2UUC Q;  5C44 G;  4IOC A;  3VDY A;  2AWO A;  3M85 A;  1KL9 A;  4X6A H;  2E5L Q;  2ATW A;  2VNU D;  1GO3 E;  3CCQ A;  2R6G A;  2RHS B;  1YJN A;  1PA6 A;  4DR4 Q;  1VQI A;  3GTP H;  4OXP A;  5JEA J;  3PUZ A;  2D0O A;  2OTJ A;  1EIF A;  4A3M G;  1N32 Q;  1VQC A;  1W2B A;  5K36 G;  3RZD H;  2LXJ A;  2LSS A;  1FGU A;  5IWA L;  1Q81 C;  3S1M H;  1LUZ A;  1KHI A;  4A3D G;  1XNR Q;  3M7N A;  2IHF A;  4JI3 Q;  3PF5 A;  1VQ4 A;  1S3O A;  1U0L A;  1KD1 C;  5EAY A;  2HHH L;  4ME3 A;  4DKA C;  3F2D A;  5LMU L;  2UXC Q;  1C0A A;  2UUA L;  5JJI A;  1HNW Q;  1E1O A;  1TWH H;  1H95 A;  4KHP Q;  4JCV E;  3JAM c;  1S40 A;  4R4I A;  4QGU A;  3KF8 B;  3CCJ A;  1EOV A;  3DLL A;  4DR6 L;  2R7Z G;  4BXX G;  5C4X G;  1WJJ A;  1YZ6 A;  1I6H H;  2NZO A;  3JAM i;  4JYA Q;  2OTL A;  1VQE A;  4BBS H;  2I0Q A;  3HOW H;  4K0K Q;  2VQE L;  1N8R C;  2KHI A;  1X55 A;  2WB1 G;  5IP7 H;  1WOC A;  4X62 Q;  4JC0 A;  1UEB A;  1JJ2 A;  5C0X J;  1PH3 A;  4LUO A;  4JI1 L;  4DV6 Q;  2KEN A;  4DV3 Q;  3PV0 A;  2MQH A;  5DLQ E;  4B3S Q;  3GTQ H;  2HQL A;  1TXY A;  3FP9 A;  3TRZ A;  4JI2 Q;  2IX0 A;  4JBM A;  4C3I H;  3I4N H;  1L1O C;  3EIV A;  3S17 H;  4IJL A;  3AEV A;  1PH1 A;  1HR0 Q;  2I5L X;  1Y1V H;  3I4O A;  2ZM6 Q;  3PUY A;  3GO5 A;  2QA4 A;  2AWN A;  1YNX A;  1NMF A;  3KF6 A;  1CKO A;  3RLO A;  4YY3 L;  1I94 Q;  3D31 A;  3HOZ H;  4DV2 L;  1SR3 A;  1FVI A;  2H5X A;  2HIV A;  3A5U A;  3S1R H;  1XPO A;  1PH5 A;  2GVB A;  3D0F A;  4X65 Q;  2JA7 G;  2K75 A;  3GTG H;  4DR1 L;  1PH7 A;  1B70 B;  1QVG A;  3MEF A;  1EFW A;  4L5S A;  4LFB Q;  1VQL A;  2DUD A;  3AFQ A;  3M4Q A;  3M9B A;  3PGZ A;  4JI5 Q;  1HNX Q;  1W3S A;  4KHZ A;  4GS3 A;  4BA1 I;  2BH8 A;  1FJG L;  1J5E L;  1YI2 A;  3OTO Q;  1JJG A;  2EQS A;  4BY7 H;  4DR5 Q;  4DV1 Q;  3L7Z C;  1EQR A;  3CCE A;  4BA2 I;  1NTG A;  4HJ7 A;  4HJ9 A;  2VW9 A;  3NEM A;  3S24 A;  2RCN A;  2OWO A;  4LF7 Q;  1T9H A;  2NN6 G;  2R7F A;  4LF9 L;  1XPR A;  4QL5 A;  3T1H L;  1PHJ A;  1KRS A;  1EIY B;  2CCZ A;  4DUZ L;  1HR0 W;  4H02 A;  1Q1E A;  4QJF A;  4JI8 L;  2JA5 H;  4GLA C;  2N8N A;  2UUB L;  3RN2 A;  1IBL L;  3HKZ E;  3M3Y H;  1G29 1;  1RIP A;  3S1N H;  3S15 H;  1K83 H;  3CD6 A;  1IBK Q;  2IX1 A;  3STB C;  2A19 A;  4C2M H;  3RR5 A;  4DR3 L;  4B3R L;  5IP9 G;  2Q2H A;  3CCS A;  5HGQ A;  4DAY B;  3CCV A;  1CKN A;  3KYH C;  3LGJ A;  3F8T A;  4JI7 Q;  1MKH A;  1J6Q A;  3AQQ A;  4PG3 A;  2UUC L;  2JEA I;  3HOZ G;  3KFU A;  2A1A A;  2ZTD A;  5FLM G;  4JBK A;  2E5L L;  2MNA A;  1TWC H;  2WAQ G;  2K5V A;  4O2D A;  3RN5 A;  3UDG A;  4DR4 L;  2CWA A;  1AE2 A;  4NB3 A;  1VS0 A;  4GNX B;  4OON A;  1L1O A;  4MZ9 A;  4ALP A;  1LTL A;  1M90 C;  3W1G A;  1N32 L;  4A3J H;  4JI6 Q;  4LF5 Q;  2IT1 A;  4APV A;  4HIK A;  4PMW A;  5IE8 A;  5ELN A;  1PH2 A;  4BY7 G;  4GKJ Q;  3BU2 A;  2WP8 J;  3A5Z B;  2UU9 Q;  2B63 H;  4OX9 L;  3PF4 A;  1XTD A;  1JT8 A;  1LM0 A;  1V1Q A;  3K7A H;  2E2J H;  3HOV G;  1HZA A;  5IYD G;  1E24 A;  1SN8 A;  2R7D A;  4EQ5 A;  3CXC A;  1I5F A;  1WCM H;  5M3M H;  3U58 A;  3H0G G;  3L2P A;  1PV4 A;  2JA5 G;  2UXC L;  1QUQ B;  2R92 G;  3CCL A;  1M1K C;  1HNW L;  1MJC A;  3I2Z A;  2YTV A;  1X3G A;  1K73 C;  2K4K A;  3FHW A;  3UE0 A;  1K8A C;  4YCU A;  4DV7 L;  3UDF A;  1K9M C;  1K3R A;  2HT1 A;  1X54 A;  3CPF A;  3AFP A;  2N78 A;  3JC6 6;  4PZ6 A;  4QIW E;  5JJK A;  3HOU H;  2JQO A;  1MJE A;  4LF4 L;  4HID A;  2N49 A;  4JYA L;  2UXD L;  1WYD A;  1OTC A;  1C7Y A;  4BBR H;  2GVA A;  3A74 A;  4IPG A;  2YYZ A;  4MTN A;  3ULP A;  2JA8 G;  4X64 Q;  3J81 c;  1KIX A;  4K0K L;  4X66 L;  4IFD I;  4NXM Q;  1B7Y B;  4TQU S;  2VY3 A;  2AKW B;  4X62 L;  5GQO A;  4OO1 I;  3K81 C;  1Q12 A;  4UP8 A;  4NPS A;  4GOP B;  3HKZ G;  1NE3 A;  2D62 A;  4UP7 A;  3BJU A;  3J81 i;  3J81 j;  4DV3 L;  4DV6 L;  1IYJ B;  3G71 A;  1CSQ A;  3CAM A;  1XMO Q;  1C9O A;  3NEN A;  1PH9 A;  4LUZ A;  3S2H H;  1K0R A;  1VQN A;  4IFD G;  2ZTC A;  2B63 G;  3KOJ A;  2VL6 A;  1CUK A;  2R93 H;  5AJ3 L;  2F52 A;  1HZC A;  1Q82 C;  4JI4 Q;  4JOI C;  1CKM A;  2NVY H;  2Z6K C;  3SGI A;  2ZM6 L;  5M3M G;  4EX5 A;  1HR0 L;  4A3B H;  1ASZ A;  5C3E H;  3A0J A;  4DV5 Q;  3TS2 A;  2EIF A;  5M5X H;  1Q8K A;  1YHB A;  3U4V A;  1B8A A;  3CQZ H;  2ALY B;  3HKS A;  1KQS A;  3F2C A;  2B3G A;  1HZ9 A;  3HFZ B;  4DV4 Q;  2F4V Q;  3NEL A;  4UY8 C;  3T1Y Q;  4GNX C;  1GKH A;  5GAD C;  1AH9 A;  5BR8 Q;  2KCT A;  2WAQ E;  4LFB L;  3BZK A;  4DK3 C;  3HOU G;  5JEA G;  1HNX L;  1U5K A;  1E3P A;  1PVO A;  1VQG A;  4LFC L;  1VQO A;  4BBR G;  4LNQ A;  3OTO L;  3I4M H;  1BBU A;  1SRO A;  4DV1 L;  1VQB A;  4R4O A;  1OXV A;  4HJ5 A;  4TVA B;  5IYC H;  1Z9F A;  4LF7 L;  4AYB E;  2GN5 A;  1YHQ A;  4DUY Q;  4QY7 A;  2I5H A;  3CCR A;  4POF A;  1NBW A;  2F3I A;  3MXN B;  1A63 A;  1YIT A;  1N36 Q;  1PYB A;  3CC7 A;  2WFW A;  1IBK L;  4A3K H;  1ASY A;  2PQA B;  1L0W A;  1Y1W H;  2KCM A;  3EN2 A;  2OQK A;  3CF5 A;  4DR2 Q;  4FDB A;  2JEB I;  3CC2 A;  2CQO A;  2HHH Q;  4A3B G;  5LMU Q;  5HY6 A;  3G4S A;  2Z0S A;  1VQP A;  3GTO H;  4JI7 L;  5E7N A;  5C0X I;  2AMC B;  1TWG H;  4UP9 A;  3PUV A;  1XMQ Q;  3HOW G;  4P72 A;  4RG1 A;  4BBS G;  4JBW A;  2K50 A;  2YTY A;  3RLN A;  3J7Z C;  4GN3 B;  4A93 H;  1EYG A;  4PZ7 A;  4P71 A;  5IP7 G;  1IL2 A;  4LF6 L;  1VCI A;  4GOP C;  2NVT H;  4L5R C;  2AHO B;  4DPG A;  1Z47 A;  4GN4 B;  4AQY L;  5C0X G;  4LF8 Q;  4DV0 Q;  2QGQ A;  1V9P A;  4JI6 L;  2FXQ A;  4LF5 L;  3K0X A;  4IPH A;  2K52 A;  4JOI A;  2Z6K A;  3HOX H;  2VQE Q;  2VQF Q;  4B3M L;  4GKJ L;  1YJ9 A;  4NXN Q;  2KHJ A;  1YHA A;  4L5Q A;  1TWF H;  2CWP A;  1D8L A;  4XIG S;  5GAH C;  1SFO H;  1DGS A;  2UU9 L;  3I4N G;  1BKB A;  1AE3 A;  5IYC G;  1UE7 A;  1QVC A;  1KAW A;  1Y14 B;  4YCW A;  3S2D H;  1Y1V G;  3PIO A;  1S72 A;  1Q1B A;  1YVC A;  2ZJQ A;  1HNZ L;  1UWV A;  1NY4 A;  3CMA A;  4GNX A;  2ID0 A;  4GKK Q;  2YTX A;  3U50 C;  3GTK H;  3PO2 H;  5ELO A;  4IO9 A;  3GTJ H;  1FL0 A;  5FJ8 H;  1E7Z A;  4A3K G;  5M3F H;  1VQ6 A;  2JA6 H;  1Y1W G;  4YWK A;  3RNU A;  1JE5 A;  4C3H H;  5GRO A;  1EUJ A;  1EWI A;  1X3E A;  5C44 H;  1XNQ Q;  4DK6 C;  3U4Z A;  1GD7 A;  1G51 A;  1X65 A;  1PH6 A;  2XTI A;  1QUQ A;  4X64 L;  1NJI C;  4PZ8 A;  1PYS B;  4AYB G;  1VQ5 A;  1VQ7 A;  3WWV A;  4GLX A;  4NXM L;  4DR7 Q;  1VQA A;  5IYB H;  3H3V H;  4WJ3 M;  2BA1 A;  2OCE A;  4R4T A;  2D0P A;  2BA0 A;  1XNR L;  2UXB Q;  4JI3 L;  1WI5 A;  1FJG Q;  3CPW A;  4JV5 Q;  3HOX G;  3M4O H;  2JK8 A;  4HJ8 A;  2Q2T A;  1V43 A;  3TEH B;  4KHP L;  4QQB X;  3KLW A;  3TQY A;  4HJA A;  2MO1 A;  2VUM H;  2YV5 A;  1VQH A;  3KJP A;  2A8V A;  3K7U C;  4DUZ Q;  1XPU A;  4AIM A;  2QEX A;  1HJP A;  2MO0 A;  2UUB Q;  1EQQ A;  4YHH Q;  2ASB A;  4DV5 L;  1IBM Q;  5H1S E;  3ZJY C;  4GOP A;  1PH4 A;  4AH6 A;  4A75 A;  3W5O A;  5FJ8 G;  4B3R Q;  4RMF A;  2JA6 G;  1VQF A;  2F4V L;  1I50 H;  3T1Y L;  2ES2 A;  1SLJ A;  2L15 A;  5C4X H;  1X3F A;  4R4C A;  4HIM A;  5BR8 L;  3OW2 A;  3H3V I;  1JB7 A;  1WFQ A;  2JE6 I;  5IT9 c;  1QZH A;  5IY0 A;  1VQM A;  1BBW A;  4A3J G;  1G6P A;  1SRU A;  3STB D;  4JI0 Q;  4B3S L;  2ZTE A;  1LYL A;  1NMG A;  2CFM A;  1N34 Q;  4JI2 L;  4A3I H;  2VZA A;  5IYB G;  4OO1 G;  3GD7 A;  4P74 A;  2K5H A;  4DUY L;  2E2I H;  1WCM G;  1R9T H;  1PFS A;  5LMN Q;  1I94 L;  4A3L H;  2MFI A;  1N36 L;  2RHQ B;  4OX9 Q;  3BZC A;  4X65 L;  1PH8 A;  2VUM G;  1UE5 A;  1N9W A;  4LFA Q;  3G48 A;  3CCM A;  1N33 Q;  3RZO H;  4DR2 L;  3PO3 H;  4B3T Q;  3S14 H;  2K5N A;  2VS1 A;  1QVF A;  3HOY H;  4Y7N H;  2Q2I A;  4JI5 L;  4A3C H;  4A3G H;  4LW1 A;  4DNI A;  2JA7 H;  1XMQ L;  3ER0 A;  4DV7 Q;  1UE1 A;  4DR5 L;  1CSP A;  1Q46 A;  3F1Z A;  4JG2 A;  3ULL A;  3GTL H;  3J80 c;  1VQ9 A;  3OYY A;  4R4Q A;  4LF4 Q;  1X56 A;  2PQA A;  1Q7Y C;  2NVQ H;  4Y52 H;  2Y0S G;  1SMX A;  2UXD Q;  3IRB A;  1QZG A;  4LF8 L;  4DV0 L;  3PUX A;  1K8G A;  3CP0 A;  4KI0 A;  1X6O A;  3J80 i;  3S1Q H;  4X66 Q;  2VQF L;  4MNO A;  5LMN W;  4GLV B;  4NXN L;  4A3E H;  5IWA Q;  1UE6 A;  3B6Y A;  3E0E A;  2Q2U A;  3ICE A;  4A3I G;  1IXR A;  5M5W H;  4POG A;  2R93 G;  1KXL A;  3CC4 A;  3CCU A;  1I3Q H;  1GM5 A;  1KRT A;  1P16 A;  3PUW A;  2UUA Q;  5C3E G;  4GKK L;  4A3L G;  3Q8D A;  1L2F A;  3UDX A;  4OWT B;  3I7F A;  1BVS A;  3J7A 5;  5AJ3 Q;  2PI2 A;  4J15 A;  5IP9 H;  1KC8 C;  4OWX B;  3GTM H;  4DR6 Q;  4WJ4 A;  1VQK A;  4BY1 H;  3PO3 G;  4P75 A;  3RLF A;  3UE1 A;  4GN5 A;  2E2H H;  3HOY G;  4IPD A;  5J3B A;  4A3C G;  3TRE A;  3KJO A;  3ULJ A;  4A4I A;  1YJW A;  3G6E A;  1XNQ L;  5FLM H;  1VQD A;  1P8L A;  4A3G G;  3I4M G;  4LWC A;  1Q86 C;  2ZJR A;  1GVP A;  2JJQ A;  3H15 A;  1XJV A;  2IY5 B;  3KF6 B;  2NN6 I;  4DR7 L;  4JBJ A;  3E9I A;  1OXT A;  1E1T A;  1A62 A;  4JI1 Q;  2UXB L;  3FKI H;  4LFC Q;  3PSI A;  1RL2 A;  4DAM A; 
#chains in the Genus database with same CATH topology
 4JV5 L;  3FDT A;  1NCV A;  1JCK B;  3W3A A;  4A3G B;  1I4G A;  2BCO A;  3VR5 A;  4A3E G;  1D5Z C;  3PCO B;  4FNF A;  1E22 A;  3BDL A;  4DF7 A;  1V8Q A;  5C4J H;  5GAG C;  4UPA A;  2NVX H;  2ZXO A;  4DV2 Q;  3SR1 A;  2JP1 A;  5CYU A;  4A76 A;  2I5M X;  4DR1 Q;  4P73 A;  4ULL A;  3S1Q B;  2DJG C;  5BN3 A;  4QUC A;  4C3J H;  3J81 E;  2F0M A;  1HUM A;  3E0J A;  1DOM A;  1A0I A;  3KDF A;  2V1C C;  5HGT A;  3GTQ B;  1XMO L;  2RF4 A;  1N34 L;  4IJH A;  4XTC S;  1VQJ A;  3KBX A;  3L0O A;  3NTK A;  4R1J A;  2RDF A;  3MXG A;  1X9N A;  1BBX C;  2LY7 A;  3PIP A;  2F0L A;  4A3F G;  5IIF A;  4IFD J;  1HH2 P;  3D6C A;  2IPK D;  3TS0 A;  1L1O B;  4OWW B;  4LFA L;  2KCC A;  2R7Z H;  5KNC A;  1MSH A;  3TBI B;  3ND8 A;  1GO3 E;  1EU4 A;  1LTG D;  3CCQ A;  1F9R A;  2RHS B;  4ZKC B;  1YJN A;  3C2P A;  4EQO A;  1VQI A;  3G6J B;  4OXP A;  3PUZ A;  4A3M G;  1VQC A;  1W2B A;  2K33 A;  1K8O A;  1QJO A;  2R92 B;  1F2M A;  3G7L A;  2HQE A;  1R4Q B;  4ODG A;  1BCP F;  3PF5 A;  1ZEQ X;  1C0A A;  1MD2 D;  2HHH L;  1SJH D;  2NTT A;  1TWH H;  1A2U A;  4JCV E;  2PNR C;  4NKL A;  3D4D A;  4QGU A;  1H9M A;  1EOV A;  3DLL A;  3FPU B;  3DWQ A;  1I6H H;  3C1E A;  2NZO A;  1STH A;  3HKZ B;  2TMP A;  4F87 A;  1N8R C;  5COR A;  4RA8 A;  5IP7 H;  3EJI A;  1JJ2 A;  4OEL B;  5BN5 A;  3PV0 A;  4B3S Q;  5DLQ E;  4JI2 Q;  4PNY A;  1ZYR C;  1ROD A;  4C3I H;  2L4N A;  4L63 B;  1L1O C;  4J1M A;  4IJL A;  1EWC A;  5E4X A;  1QNK A;  1PH1 A;  2ZM6 Q;  1Y1V H;  3F2U A;  3PUY A;  2K05 A;  3GO5 A;  3LWE A;  3OMG A;  1YNX A;  3C3L A;  3RLO A;  3D31 A;  1SR3 A;  3S1R H;  2H5X A;  3A5U A;  4BBR B;  4OHJ A;  2GVB A;  4WFN 3;  1B9N A;  1QVG A;  1TQO A;  2AQ2 B;  5ELD A;  2JXM B;  3SHL A;  5M9O A;  4EVO A;  1WTO A;  3S1M B;  3M4Q A;  1L0X B;  4GS3 A;  1PXU A;  1SNP A;  1JR0 D;  3OTO Q;  4BY7 H;  3QR8 A;  3S24 A;  2OWO A;  3QOJ A;  2CCZ A;  1HR0 W;  2F0O A;  4E6I A;  3OOC A;  4EGV A;  2EXZ A;  2UUB L;  3M3Y H;  1W6J A;  1IBL L;  3URY A;  1G29 1;  3S15 H;  1I4H A;  1L0Y B;  4S3S A;  1IBK Q;  4BBS B;  4C2M H;  2EYO A;  4KD3 A;  4B3R L;  3K5O A;  3MXU A;  5HGQ A;  4DAY B;  3E5S A;  3LGJ A;  4FP5 D;  3H6M A;  1YNN D;  2UUC L;  1BCP D;  2JEA I;  3HOZ G;  5IT9 E;  2E5L L;  3NBH A;  3RUZ A;  3SVM A;  1ZXT A;  2B2U A;  1J9O A;  4DR4 L;  3I4N B;  3S17 B;  4NB3 A;  1LTL A;  3Q6S A;  1KTK A;  4WJW A;  1M90 C;  1YNJ D;  1JOQ A;  5EPJ A;  2FMC A;  3E6Z X;  1PH2 A;  3DEO A;  1WTW A;  2B63 H;  1SYF A;  1V1Q A;  2E2J H;  1IW7 D;  1X32 A;  5M3M H;  2A6H C;  5J22 A;  1MJC A;  4KK7 A;  3UE0 A;  5KIX A;  4YCU A;  1K9M C;  1FD7 D;  2HT1 A;  5JJK A;  2N78 A;  2EPB A;  5JEA H;  2XRS D;  4HID A;  1MJE A;  1WYD A;  1C7Y A;  3IKJ A;  2PZU A;  3A7L A;  4MTN A;  3ULP A;  4X64 Q;  4K0K L;  1K83 B;  1TWF B;  3MC0 B;  1B7Y B;  2AKW B;  4X62 L;  2MHV A;  4OO1 I;  1STG A;  1Q12 A;  1SMY D;  2PQE A;  2IY5 B;  4DV3 L;  1I6V C;  1C9O A;  3J7A V;  4KKU A;  4Z9C B;  2CH4 W;  1K0R A;  4RCN A;  5IGC A;  3KOJ A;  4EQP A;  2VL6 A;  1TWC B;  2RCF A;  1HZC A;  4JI4 Q;  4A3B H;  4EX5 A;  4DAP A;  3NUC A;  1KLG D;  3KLS X;  1SDF A;  3VR6 A;  1B8A A;  2QIL A;  1MGS A;  3HFZ B;  3K6O A;  2H4O A;  3NEL A;  4UY8 C;  5GAD C;  1D5X C;  1B1Z A;  2PW5 A;  2KCT A;  5BR8 Q;  5DAU A;  3U9O A;  1H9K A;  3HOU G;  1PMR A;  1WCM B;  1BNZ A;  2AUK A;  3NTH A;  1VQO A;  5T1I A;  1BBU A;  4MN3 A;  2Q8T A;  2N55 A;  4TVA B;  5IYC H;  2VUM B;  1YHQ A;  2GN5 A;  1JC7 A;  4QY7 A;  5G3L F;  2I5H A;  2XSC A;  2F3I A;  3MXN B;  1YIT A;  1WTH A;  4PMC A;  1Z6H A;  4ME5 A;  1ASY A;  5JJZ A;  1Y1W H;  3EN2 A;  1HA5 A;  4NMZ A;  1PYW D;  1CM9 A;  1ONL A;  1PRT B;  5EPL A;  4UHV A;  1XMQ Q;  4RG1 A;  2K50 A;  3IAY A;  5IP7 G;  4N9P A;  4YIJ A;  3TSS A;  1VCI A;  2NVT H;  4L5R C;  4GN4 B;  1CQF A;  5C0X G;  2FXQ A;  4LF5 L;  3K0X A;  2VQE Q;  5FLX E;  1U9R A;  2Z6K A;  4GKJ L;  1TT2 A;  1YHA A;  3CQZ B;  3FMC A;  1D8L A;  4C3I G;  5GAH C;  4F7X A;  1BKB A;  4CHT B;  1Y14 B;  2P5Z X;  4YCW A;  3S2D H;  5A35 A;  3PO3 B;  1Y1V G;  1YVC A;  1F9Q A;  3CKI B;  1NY4 A;  5A2Q L;  2PZW A;  4OEM B;  4IUU A;  3GTJ H;  4RGO S;  4A3K G;  1ICF B;  2JA6 H;  1XX8 A;  4C3H H;  1D6E C;  1EWI A;  4JPB W;  5I2X A;  5JOB A;  2HUG A;  1M4V A;  1ZKO A;  1G51 A;  1X65 A;  1NJI C;  1EIG A;  1VQ5 A;  4NP5 A;  5LL6 X;  4WJ3 M;  2OCE A;  4R4T A;  5D14 A;  2BA0 A;  2IWH A;  4DFA A;  3K59 A;  3CPW A;  4JV5 Q;  4CKB A;  3M4O H;  3CRK C;  4QQB X;  1A3T A;  1SYE A;  4HJA A;  4KD4 A;  1VQH A;  2K5W A;  3JAM E;  1CHP D;  1XPU A;  2QEX A;  2BOS A;  3VYR A;  2DY7 A;  1PRT C;  2ASB A;  2I46 A;  5G3L D;  4GOP A;  3TME A;  1SEB D;  2H1E A;  3OW2 A;  4HIM A;  1WTV A;  2EY5 A;  1HA6 A;  2VXW A;  4RKB A;  1JB7 A;  3MAQ A;  1WFQ A;  4K5V A;  2CQA A;  3FKI B;  1BBW A;  1BDO A;  4LMQ D;  5C4Z A;  1SRU A;  5DM6 3;  4B3S L;  2ZTE A;  4KV6 A;  1H9R A;  5FO8 B;  3GTK B;  1N34 Q;  1B3Q A;  1EY0 A;  4JI2 L;  4IAL A;  5M3F B;  5IYB G;  1LAB A;  3A56 A;  4OO1 G;  3MEH A;  4KMU C;  4DUY L;  2IX3 A;  3S16 B;  5IGF A;  3DUZ A;  5C44 B;  1QNU A;  1UE5 A;  1N9W A;  4LFA Q;  2B2Y A;  4U68 A;  1QG7 A;  1W6K A;  1EY5 A;  4Y7N H;  2Q2I A;  4A3G H;  1SBB B;  3EQL C;  1UE1 A;  4QUF A;  5C3X A;  3QB3 A;  1D1K A;  2PQA A;  3H91 A;  4LF8 L;  1STY A;  1SSO A;  5I9O A;  4MHE A;  1K8G A;  3CP0 A;  3S1Q H;  3J80 i;  2F0V A;  4X66 Q;  5LMN W;  4A3E H;  2QEJ C;  3A8I E;  3E0E A;  4ZUI A;  1IL8 A;  4ID6 A;  3VR4 A;  1I50 B;  4OGQ C;  2M00 A;  1P16 A;  1CQV A;  4A3L G;  3UDX A;  5EKI A;  1PTO H;  3J7Y W;  5AJ3 Q;  1KC8 C;  4OWX B;  2WB1 B;  2K04 A;  3GTP B;  3UE1 A;  2E2H H;  1K0S A;  3HOY G;  4IPD A;  3KJO A;  1AZP A;  5EJW A;  1YJW A;  2E2I B;  5FLM H;  3V2T A;  3TDQ A;  4DK1 A;  5FO9 B;  1HPC A;  4LWC A;  4DN4 M;  1JE4 A;  1ESR A;  4O42 A;  1A62 A;  4LFC Q;  1K3B C;  3VYS A;  2M2L A;  4A3F H;  2EJG C;  3BDC A;  3KUP A;  3HS0 C;  2CKZ B;  5ELF A;  3DM3 A;  4YWL A;  3FPP A;  3NP8 A;  3SE0 A;  1JQY D;  2XGT A;  3QO2 A;  3SK5 A;  2NVQ B;  1SE8 A;  2EXD A;  4YHH L;  2R92 H;  3AU7 A;  1IBM L;  2F1M A;  3EBE A;  4F88 A;  1MIU A;  1LTS D;  1PZK D;  3DWA A;  4KHV A;  1MBY A;  2OQ0 A;  5CV5 A;  5JJL A;  2C35 B;  4A3M H;  2JSO A;  1XWE A;  3OIP A;  2QW7 A;  3CME A;  2EYP A;  1Q3L A;  1JJC B;  5M5Y H;  2O5I C;  5C3W A;  1PFN A;  1A6X A;  3H94 A;  4JI4 L;  2JA9 A;  3GDE A;  1YEZ A;  3WDN A;  4JW0 A;  2XVS A;  1IBL Q;  2PMZ E;  3ERQ A;  2NZH A;  3GTG B;  2PNH A;  3QG1 A;  1HZB A;  3KBG A;  2PCF B;  4C3H G;  1CZG A;  1N33 L;  1EYA A;  5GAE C;  4B3T L;  2UUC Q;  1HFG A;  1KL9 A;  2E5L Q;  2ATW A;  1A15 A;  4DR4 Q;  3BDO A;  3K5N A;  4RH6 A;  1ET6 A;  5JEA J;  4TRD A;  4G7H C;  3W2D A;  3I90 A;  2JA5 B;  1FNU A;  2LXJ A;  2LSS A;  2A69 D;  3NSW A;  1STE A;  1FGU A;  5IWA L;  3S1M H;  1CFM A;  1LUZ A;  5ELE A;  4A3D G;  1PTO F;  1XNR Q;  3MVV A;  2FMM A;  1KD1 C;  4LK1 C;  5JJI A;  1HQM C;  2O5J C;  1GJX A;  1U4P A;  3TP7 A;  1H95 A;  2RDH A;  4R4I A;  3D8G A;  3KF8 B;  2SOB A;  4ABN A;  4FO2 A;  3PIP 3;  1VQE A;  4BBS H;  4K0K Q;  2VQE L;  5EPK A;  1X55 A;  1WOC A;  3O13 A;  4X62 Q;  3K7A B;  4JC0 A;  1UEB A;  2B2V A;  4DV3 Q;  3QIA A;  3HZX A;  1U4L A;  3VA5 A;  4X3K A;  1TXY A;  3FP9 A;  1O7Z A;  1C8C A;  3I4N H;  5CV7 A;  3S17 H;  1F2Y A;  3AEV A;  2EVB A;  1SAP A;  2QA4 A;  2AWN A;  3BZD B;  1EY8 A;  4YY3 L;  3HOZ H;  1FVI A;  1PH5 A;  1XPO A;  2C5C A;  2K75 A;  3RZD B;  1PH7 A;  1B70 B;  2NTS A;  2L1B A;  1PZJ D;  2DUD A;  3M9B A;  1VQL A;  5L37 A;  4KHZ A;  4BA1 I;  3R2T A;  1JJG A;  1I4R A;  3L7Z C;  1GUT A;  2SNS A;  2VW9 A;  1K8M A;  2RCN A;  5I4D A;  4QIW B;  4LF9 L;  2CVR A;  3T1H L;  4H02 A;  3PMF A;  3RN2 A;  3S1N H;  1K83 H;  4G7O C;  3I70 A;  3STB C;  2V4D A;  5ELC A;  3HOW B;  3RR5 A;  4DR3 L;  1BF4 A;  1CKN A;  3KYH C;  3F8T A;  3CHB D;  4CDD C;  3QWN A;  1PTO D;  5FLM G;  4NDX A;  4I7A A;  2MNA A;  1TWC H;  2ENB A;  3UDG A;  4C1N I;  2CWA A;  4OON A;  4LF5 Q;  2IT1 A;  1ENA A;  4PMW A;  5IE8 A;  2RQX A;  4GKJ Q;  3K5M A;  1FNV A;  1AW7 A;  2K5D A;  2DNE A;  1XTD A;  1JT8 A;  2F0T A;  1HZA A;  3CXC A;  2R7D A;  1PV4 A;  3U58 A;  1I5F A;  1WCM H;  2JYO A;  5KEE A;  4K8I A;  1QUQ B;  1LTR D;  4MIU A;  2R92 G;  3I2Z A;  3NTI A;  2G5D A;  2A73 B;  1K8A C;  2B2T A;  2PZT A;  4AYB B;  1MSG A;  1DXM A;  1X54 A;  3JC6 6;  3AFP A;  4PZ6 A;  1SXT A;  1B44 D;  4RGM A;  3HOU H;  3WOF A;  2N49 A;  1STA A;  1OTC A;  1EIH A;  4IPG A;  3A74 A;  3HOX B;  2YYZ A;  3J81 c;  4X66 L;  5TSS A;  1SFO B;  4TQU S;  5A2Q E;  1S5F D;  3HKZ G;  4UP7 A;  1IYJ B;  2KOL A;  3G71 A;  3S2H H;  2K03 A;  1VMP A;  4HCE A;  3GQB A;  1D1I A;  5AJ3 L;  5JAV A;  4JOI C;  1CKM A;  5I6W A;  1QE6 A;  3A55 A;  1Q8K A;  3CQZ H;  3HKS A;  2ZXR A;  1KQS A;  2F0F A;  2B3G A;  1HZ9 A;  4DV4 Q;  4NW2 A;  4XXE A;  2WAQ E;  3BZK A;  1ENC A;  3KLR A;  4DK3 C;  1U5K A;  5C0X H;  4ILW A;  4LFC L;  4LNQ A;  4BBR G;  3J7A F;  1PFB A;  4DV1 L;  1VQB A;  1SND A;  1OXV A;  4HJ5 A;  1Y8N B;  4DAV A;  1Z9F A;  4DUY Q;  1OO9 B;  4PV1 C;  3CCR A;  1A63 A;  3BS1 A;  3E3X A;  3A8J E;  1PYB A;  2F0K A;  4A3K H;  1L0W A;  2EE1 A;  2CW0 D;  2J0T D;  4U67 3;  3OW7 A;  2Z0S A;  4JI7 L;  5C0X I;  3FEW X;  3MA2 B;  1TWG H;  4BBS G;  3J7Z C;  1LT4 D;  2L9H A;  4GN3 B;  3KK7 A;  1IL2 A;  2KJX A;  2Z6B A;  3NPP A;  4A3I B;  1JOO A;  2R93 B;  1Z47 A;  4LF8 Q;  2B2W C;  2NVY B;  2PMZ B;  2PPB C;  2QGQ A;  3ITP A;  4JI6 L;  4G7Z C;  1DOL A;  5C3E B;  1LT3 D;  5M5X B;  1YJ9 A;  1JWS D;  3I4N G;  3J80 L;  1DGS A;  2NYZ D;  1AE3 A;  1UE7 A;  1KDC A;  1QVC A;  3RZO B;  3DEP A;  1DON A;  1TS3 A;  1UWV A;  4GNX A;  1DOK A;  3CRL C;  2YTX A;  3GTK H;  5ELO A;  5C5L A;  1FL0 A;  1E7Z A;  3M4Y A;  5M3F H;  4YWK A;  2NBF A;  3H3V C;  5GRO A;  4UDU C;  4K5X A;  2Z8L A;  1AZQ A;  4L6T B;  5C44 H;  4DK6 C;  1LAC A;  1STN A;  1GD7 A;  2LS0 1;  1PH6 A;  1PRT F;  4JK1 C;  1GUN A;  3ONA B;  4PZ8 A;  5I9P A;  1VQ7 A;  1GUS A;  3D6W A;  1MHW C;  3WWV A;  4GLX A;  1VQA A;  5IYB H;  4OO1 H;  1XNR L;  1ET9 A;  1FJG Q;  4OIJ A;  3GTO B;  1STB A;  5K36 H;  4TSS A;  4LJZ C;  3LNN A;  1BCP B;  5E3F A;  3QOL A;  3UI2 A;  2YV5 A;  4A93 B;  5KGU A;  3GTM B;  3K7U C;  3RMH A;  4BY1 B;  4AIM A;  1PZI D;  1RD9 D;  2MO0 A;  2HDL A;  4YHH Q;  4ZAI A;  5ELB A;  1IBM Q;  1D2B A;  4G57 A;  4AH6 A;  5FJ8 G;  2B2V C;  4XDX A;  2F4V L;  1BUV T;  1I50 H;  1RF2 D;  1UAP A;  1LTB D;  1X3F A;  2F0E A;  2MJ8 A;  4R4C A;  1ESF A;  2F4I A;  5IT9 c;  4DNT B;  3DXJ C;  1NMG A;  1XTC D;  3PO2 B;  5CBA E;  4CKC A;  3GD7 A;  2K32 A;  2Z4I A;  2E2I H;  1WCM G;  2JN4 A;  4QB4 A;  4DGZ A;  3R8B A;  1PFS A;  4FYD A;  5KYI A;  4A3L H;  3LWU A;  1N36 L;  3VR2 A;  2VUM G;  1JWU D;  1N33 Q;  4XT1 B;  4C3J B;  4DR2 L;  3A54 A;  3QJY A;  4B3T Q;  5COY A;  2K5N A;  1SJE D;  2VS1 A;  4XQQ A;  3HOY H;  3MFG A;  3HG9 A;  1NAP A;  3TN2 A;  4KY6 A;  2K28 A;  2A68 D;  2QF7 A;  3NBI A;  1CSP A;  4OIK A;  1V1P A;  3HP3 A;  4LF4 Q;  2NVQ H;  2HCI A;  1SMX A;  4M8A A;  4DV0 L;  1T5E A;  3PUX A;  2F0G A;  4KI0 A;  1X6O A;  1YNN C;  4RWS C;  1BCP C;  4NXN L;  4K8J A;  5IWA Q;  1IXR A;  5HUR A;  4POG A;  2NN6 H;  3I4L A;  3CC4 A;  3CCU A;  1HXY D;  2VB3 X;  2R7Z B;  4B9X A;  1GM5 A;  5C4X B;  3PUW A;  4GKK L;  5KYL A;  1DCZ A;  3Q8D A;  1XXG A;  1YNJ C;  1L2F A;  2F0I A;  3I7F A;  4DXG A;  3J7A 5;  1R4P B;  2PI2 A;  5IP9 H;  3PO3 G;  3RLF A;  2FJ2 A;  1IW7 C;  5J3B A;  4RFB A;  2NUC A;  1XNQ L;  1P8L A;  1R9T B;  1EY7 A;  1TS5 A;  1TS2 A;  1Q86 C;  4K6L A;  4HMJ A;  1O7L A;  2JJQ A;  1UEA B;  2F0S A;  4DR7 L;  2NN6 I;  1CZW A;  3E9I A;  2UXB L;  2B2T C;  3S14 B;  5EAY A;  3X3M A;  2E76 C;  1TWH B;  2D9U A;  4HN7 A;  2KEE A;  5JPN C;  1IYV A;  2N3S A;  3NK9 A;  4X3S A;  2JA7 B;  1D7Q A;  1VQ8 A;  3ERO A;  3GTL B;  5J1Z A;  3CW2 C;  1TWA H;  4YY3 Q;  4KLK A;  1I6H B;  1SMY C;  3Q24 A;  5LHY 1;  2J4X A;  1O7I A;  1S5E D;  5KNB A;  1GUO A;  3DMU A;  4IOA A;  3UDI A;  3W1B A;  3T56 B;  2G9D A;  5DM7 3;  1CA5 A;  1YBY A;  5I6Y A;  4HMI A;  2E74 C;  1FR3 A;  5IGG A;  1HHV A;  4JI0 L;  2Y0S E;  2EYJ A;  3OMC A;  5IOC A;  2YU9 H;  2KBN A;  3HEJ A;  2HIX A;  4LF9 Q;  4A3D H;  1DD2 A;  3T1H Q;  4DK0 A;  3BVM A;  4DNR B;  4LUV A;  3FKI G;  4KY5 A;  4ZYS A;  5FLX c;  3NBH B;  2LXK A;  1I4P A;  3S1R B;  1H9S A;  2BE5 D;  1Y8O B;  1S5B D;  5M3F G;  4DR3 Q;  4DV4 L;  2WAQ B;  3MXP A;  1A8V A;  3TP5 A;  3I56 A;  1HNZ Q;  1A2T A;  2A6E D;  4L5T A;  1HTL D;  4UAI A;  5C44 G;  3VDY A;  2AWO A;  3M85 A;  1RJT A;  4X6A H;  1HQR D;  2ICI A;  2VNU D;  4BY7 B;  4C56 C;  2O4X A;  2X6L A;  3VYT A;  3WOE A;  1Y69 U;  3HOV B;  3D4R A;  4HTH A;  2D0O A;  2OTJ A;  3N52 A;  3H0G B;  1TR5 A;  3M3Y B;  5K36 G;  3RZD H;  1LV9 A;  3S15 B;  3GV6 A;  4FVM A;  4EQN A;  1Q81 C;  3V05 A;  2XIW A;  1VQ4 A;  1S3O A;  4ME3 A;  4DKA C;  2UUA L;  4KHP Q;  4DU9 A;  3SK8 A;  2M9V A;  3JAM c;  2JA8 B;  1TS4 A;  1BQQ T;  2DN8 A;  3AB9 A;  1IKL A;  4DR6 L;  4CDC C;  4WRD A;  2KQ3 A;  4BXX G;  5CMD A;  2PW7 A;  2OTL A;  4CKE A;  1JIC A;  1VMC A;  2WKD A;  2I0Q A;  3HOW H;  5CC4 A;  5IGD A;  2B63 B;  2WB1 G;  2A5H A;  2KUM A;  3AMU A;  2E2J B;  5C5M A;  5C0X J;  1WD1 A;  2F0P A;  1PH3 A;  4LUO A;  5BN4 A;  2B2U C;  5M3M B;  2MQH A;  3GTQ H;  2HQL A;  3TRZ A;  1CA6 A;  2SDF A;  3EIV A;  1HUN A;  2LFN A;  2EDG A;  1B9M A;  1DM0 B;  3ZYY X;  2L11 A;  4FF3 A;  2I5L X;  3H09 A;  3KF6 A;  1NMF A;  1EFI D;  1B3A A;  1KAB A;  3D0F A;  3MEF A;  1EFW A;  2L12 A;  4L5S A;  4I65 A;  3PGZ A;  1S4Z A;  3P75 A;  4JI5 Q;  2B8F A;  3P7J A;  1W3S A;  1B50 A;  2RDG A;  2BH8 A;  1FJG L;  1J5E L;  1YI2 A;  4DR5 Q;  4DV1 Q;  4KJO A;  2DY8 A;  4BA2 I;  1IHZ A;  1NTG A;  4HJ9 A;  2XNA C;  4ZQ3 A;  2NN6 G;  2R7F A;  4RHR A;  2CH4 A;  1EIY B;  4A3B B;  1Q1E A;  4JI8 L;  3HKZ E;  3CD6 A;  2RA4 A;  3TZU A;  1E2W A;  5IP9 G;  2Q2H A;  3CCV A;  1VDZ A;  4JI7 Q;  3AQQ A;  4KKT A;  3KFU A;  1EY6 A;  2HDM A;  1RTO A;  4O2D A;  1AE2 A;  1VS0 A;  1L1O A;  4MZ9 A;  4ALP A;  2FHT A;  1N32 L;  5ISR A;  4JI6 Q;  4APV A;  4HIK A;  4O1N A;  1EWH A;  2WP8 J;  4WOR A;  2K6A A;  1EYC A;  4XT3 B;  1Y1W B;  1II3 A;  5JVG 3;  1E24 A;  1SN8 A;  1EQV A;  3L2P A;  2JA5 G;  2UXC L;  3CCL A;  1HNW L;  2SEB D;  2OEO A;  3FHW A;  3UDF A;  2KA7 A;  5C4H A;  1K3R A;  1U4R A;  2NVT B;  2FFK B;  1EQT A;  3J80 E;  1GHJ A;  4LF4 L;  4JYA L;  2E75 C;  2EY1 A;  4BBR H;  2GVA A;  5K5P A;  4ZKB B;  1KIX A;  2EY6 A;  2VY3 A;  3S2D B;  2F0D A;  1ICW A;  4NPS A;  4UP8 A;  4Q0F A;  4KTA A;  4GOP B;  2BDN A;  1NE3 A;  3J81 i;  3BJU A;  3J81 j;  4DV6 L;  1D5M C;  1C4Q A;  3CAM A;  4R9W A;  3SDZ A;  4J6H A;  1PH9 A;  4IFD G;  2ZTC A;  4N8X 1;  3T16 A;  4V19 0;  2R93 H;  4H7B A;  2N88 A;  1FNW A;  2EZV A;  1Q82 C;  3MHB A;  1G2S A;  2AUJ D;  2NVY H;  2Z6K C;  1HR0 L;  3TZD A;  3X3N A;  5CV6 A;  3A0J A;  5C3E H;  4IUQ A;  3TS2 A;  2EIF A;  5M5X H;  1YHB A;  3U4V A;  4A3J B;  4G4K A;  2ALY B;  3F2C A;  2KVM A;  2F4V Q;  1EL0 A;  1AH9 A;  5T1G A;  4LFB L;  3T4A C;  1HNX L;  1PVO A;  3I8Z A;  2Q8I B;  1SRO A;  3M4O B;  4R4O A;  4QMG A;  3MTS A;  2MPM A;  4LF7 L;  4K5W A;  1G91 A;  4IN3 A;  5LL6 S;  1LTT D;  2RSO A;  4LAA A;  1NBW A;  1ILQ A;  1N36 Q;  1ML0 D;  3CC7 A;  4L8J A;  1O80 A;  2PQA B;  3CF5 A;  1KDA A;  4DR2 Q;  3TP8 A;  4FDB A;  3CC2 A;  5LMU Q;  1VQP A;  3GTO H;  2Z1C A;  3EA6 A;  5I2Y A;  2Y0S B;  4FXG C;  3Q0A A;  4UP9 A;  3PUV A;  3HOW G;  4P72 A;  3RLN A;  2YTY A;  4A93 H;  1EYG A;  2E2D C;  4PZ7 A;  4GOP C;  1F77 A;  3NHH A;  4DV0 Q;  4DAY A;  1J8I A;  4NXN Q;  4IUV A;  4L5Q A;  1TWF H;  2CWP A;  4FXD A;  1O7Y A;  4HSV A;  2UU9 L;  1UUP A;  1GHK A;  2ZJQ A;  1S72 A;  5EKK A;  5FOB B;  1HNZ L;  4GKK Q;  3PO2 H;  2EYL A;  1TY2 A;  5FJ8 H;  1VQ6 A;  3I4M B;  1QWY A;  1JE5 A;  2A69 C;  4OL7 A;  3NQI A;  4FF4 A;  1XNQ Q;  1ZYR D;  4IZ8 A;  4N9T A;  3L9A X;  2B2Y C;  1F2L A;  4A3E B;  4AYB G;  4NXM L;  4DR7 Q;  2D0P A;  2R3Z A;  1S5C D;  2UXB Q;  1SYG A;  1WI5 A;  1SYD A;  1V1O A;  2XN9 C;  3HOX G;  4HJ8 A;  2Q2T A;  1V43 A;  3TEH B;  1PTO B;  4CDE C;  4KHP L;  2HCC A;  2K5Q A;  1AP0 A;  3TQY A;  2MO1 A;  3NWT A;  2VUM H;  4DXF A;  2A8V A;  3KJP A;  4DUZ Q;  1HJP A;  4KKS A;  3VR3 A;  2E2H B;  1WTP A;  1Q90 A;  4DV5 L;  3S9W A;  4A75 A;  4R8N A;  4RMF A;  5J39 A;  4H44 C;  1IKM A;  3T1Y L;  2L15 A;  5C4X H;  3K57 A;  5IY0 A;  3IFD A;  1VQM A;  1EY4 A;  1G6P A;  3P1H A;  4JI0 Q;  4P2C B;  4A3F B;  2IJ0 A;  2WAC A;  2CFM A;  3OSO A;  4P74 A;  2WII B;  2PO4 A;  1R9T H;  2B8G A;  2RHQ B;  3K0Y A;  2PYK A;  4OX9 Q;  3OPO A;  3BZC A;  1EEI D;  3D3R A;  1PH8 A;  3G48 A;  5CV8 A;  3LX0 A;  3PO3 H;  2ICE C;  1XYI A;  3T53 B;  3S14 H;  4IUP A;  4JI5 L;  4A3M B;  4MTK A;  2FIN B;  2F0W A;  4DNI A;  2JA7 H;  1MI2 A;  2Z4H A;  4B9W A;  3BG3 A;  3MXN A;  4DV7 Q;  4DR5 L;  3F1Z A;  3A7A B;  3I91 A;  5M5Y B;  3GTL H;  2A6H D;  3EVQ A;  4R4Q A;  1VQ9 A;  4Y52 H;  1G6Z A;  5EBD A;  2UXD Q;  1QZG A;  2EJM A;  4PMB A;  3FRP B;  4RCO A;  1PTO C;  2VQF L;  4MNO A;  4GLV B;  1X3Q A;  2Q2U A;  4A3I G;  2R93 G;  2OF1 A;  1KNE A;  1UNS A;  2UUA Q;  5C3E G;  1NR4 A;  2OT2 A;  1X3P A;  5CBE E;  2C9O A;  4OWT B;  5KND A;  3A8K E;  1BVS A;  4CBV A;  1EZ6 A;  4J15 A;  4DR6 Q;  4IUR A;  4WJ4 A;  1GXD C;  1I4Q A;  4CDF C;  1VQK A;  1QIL A;  3TP6 A;  2B39 A;  1CI3 M;  4A3C G;  1QOH A;  3TRE A;  3ULJ A;  4A4I A;  5E1F A;  1VQD A;  2LMC B;  1NUC A;  1RDP D;  5NUC A;  1GVP A;  2QDB A;  1XJV A;  4K2L A;  4JBJ A;  4HAE A;  1E1T A;  3FKI H;  2MP1 A;  1CTM A;  2EY2 A;  1RL2 A;  4DAM A;  3PQI A;  1I4X A;  1F9S A;  1E0B A;  1CK1 A;  1OXU A;  3I55 A;  2SNM A;  2F0J A;  3K80 C;  3HOV H;  1OXX K;  5IYD H;  1VF7 A;  2B29 A;  3AYH B;  3H0G H;  3S16 H;  1EOT A;  2L0C A;  4IQZ A;  2J7Z A;  3MZ5 A;  1IZ6 A;  1DJR D;  4GZY C;  1JMC A;  5FK9 C;  4A93 G;  2K14 A;  3K8A A;  4BY1 G;  2OXP A;  5M5W B;  2CHB D;  3F2B A;  3SEB A;  1I3Q B;  4YWM A;  2KED A;  3ERS X;  5IGE A;  2KEC A;  1J5E Q;  2AQ1 B;  2JA8 H;  3M4P A;  2IHE A;  4YCV A;  1CKN B;  4LF6 Q;  3OWE B;  1EZ8 A;  1PLF A;  2XWB B;  1RKN A;  4O0A A;  1NR2 A;  2WB1 E;  5C6A A;  4AQY Q;  3KDF B;  4B3M Q;  4JI8 Q;  3HOZ B;  4ZLT F;  4IPC A;  5LMN L;  3PO2 G;  1YIJ A;  2EOT A;  2EYF A;  2PI2 E;  1OXS C;  4HIO A;  1SE2 A;  2E8G A;  3P20 A;  3E9H A;  1S5D D;  2BH2 A;  4BXX H;  2IL8 A;  2DGY A;  2ZJP A;  1AFP A;  4IOC A;  2RVL A;  1LT5 D;  1WTQ A;  2Q8R E;  2QKI C;  2R6G A;  1PA6 A;  3VA7 A;  4C3J G;  5DNF A;  4Q5V A;  3GTP H;  1JWM D;  4RGN A;  3I3C A;  1EIF A;  2NWG A;  1N32 Q;  5C4J B;  1HTP A;  2CW0 C;  1C48 A;  2L5T A;  2NVX B;  4HSP A;  2VB2 X;  2F0H A;  3S1N B;  1CHQ D;  1SYC A;  1PDQ A;  1KHI A;  3M7N A;  2IHF A;  4JI3 Q;  1KLU D;  1U0L A;  3F2D A;  2UXC Q;  5LMU L;  2KHS A;  1HNW Q;  1E1O A;  1BR9 A;  1S40 A;  4BS9 A;  3N6R A;  3CCJ A;  4ZRZ A;  2R7Z G;  5C4X G;  1WJJ A;  1YZ6 A;  1TII D;  4DA2 A;  1E2V A;  3JAM i;  4JYA Q;  4K14 A;  2X69 A;  1EY9 A;  1SNO A;  3IFT A;  3SXH A;  2KHI A;  3Q23 A;  1TVX A;  3VYU A;  1PRT D;  4JI1 L;  4DV6 Q;  2KEN A;  5E4W C;  2RSN A;  1LO5 D;  3J81 L;  1EU3 A;  3HGB A;  2IX0 A;  4RHS A;  4JBM A;  1E2Z A;  3MWY W;  1HR0 Q;  3I4O A;  3HOU B;  1I94 Q;  1CKO A;  4DV2 L;  2HIV A;  2WV6 D;  2JA7 G;  4X65 Q;  3GTG H;  4DR1 L;  1QCB D;  1JOR A;  2L55 A;  4IUT A;  2D2C C;  4LFB Q;  3AFQ A;  3K58 A;  1HNX Q;  5EBC A;  2AQ3 B;  2WKC A;  5D65 A;  4M1U B;  2EQS A;  3S2H B;  1EQR A;  3CCE A;  4HJ7 A;  4KN4 C;  3NEM A;  4LF7 Q;  1T9H A;  1XPR A;  4QL5 A;  2MUY A;  1KRS A;  1PHJ A;  2DNC A;  4DUZ L;  1SNQ A;  2JA5 H;  4QJF A;  3D4W A;  4GLA C;  2N8N A;  5CV4 A;  1RIP A;  3GV3 A;  4K6D A;  4F8M A;  3BVZ A;  1G2T A;  2IX1 A;  2A19 A;  1A3V A;  3NE5 B;  3CCS A;  1MKH A;  1J6Q A;  4H0L C;  3ND9 A;  4PG3 A;  1FYC A;  2WIN B;  2A1A A;  2ZTD A;  4JBK A;  2WAQ G;  2K5V A;  3L3O C;  4XQN A;  3DM1 A;  4C3I B;  3RN5 A;  3DWP A;  2D5D A;  3CU7 A;  2F3W A;  4GNX B;  4HCS A;  3W1G A;  1Y1V B;  4V0B A;  4A3J H;  1ILP A;  3U9S A;  1LT6 D;  4B08 A;  5ELN A;  4BY7 G;  3BU2 A;  1GUG A;  3A5Z B;  2UU9 Q;  4IFD H;  3R93 A;  4OX9 L;  4A3K B;  4ZK9 B;  3PF4 A;  1EEF D;  1LM0 A;  3NQT A;  3RD4 A;  3K7A H;  3HOV G;  1IYU A;  2A68 C;  5IYD G;  4IUN A;  3T51 B;  4EQ5 A;  3H0G G;  1M1K C;  2QCP X;  4H13 C;  2YTV A;  1TWG B;  1X3G A;  1K73 C;  2K4K A;  2QDL A;  1A3U A;  4DV7 L;  1JOK A;  3CPF A;  4QIW E;  5FKA C;  2JQO A;  2HD3 A;  5D3D A;  2UXD L;  2KCN A;  2GA4 B;  2EYH A;  2TSS A;  2JA8 G;  4IFD I;  5EGT A;  4NXM Q;  4C2M B;  1CT1 D;  5GQO A;  3K81 C;  3PIO 3;  1RTN A;  3KF8 A;  5KRU A;  2D62 A;  5JPM C;  5IOD A;  1XMO Q;  5EKL A;  1CSQ A;  3NEN A;  4LUZ A;  1B4O A;  1VQN A;  1RHP A;  2B63 G;  4FF1 A;  1CUK A;  4HED A;  2F52 A;  5D3I B;  3SGI A;  2ZM6 L;  5M3M G;  1ASZ A;  4C1N K;  5F2D A;  4DV5 Q;  3R2I A;  1WD0 A;  1WTX A;  4R8I A;  3T1Y Q;  4GNX C;  1GKH A;  2ZT9 C;  1NNX A;  1QB5 D;  5JEA G;  3C1F A;  1E3P A;  1VQG A;  3BYY B;  3OTO L;  3I4M H;  1O78 A;  2BDO A;  3K5L A;  3T13 A;  2LKV A;  3BVG A;  5IT9 L;  4AYB E;  4J8Q A;  4CJ1 B;  1K28 A;  4POF A;  1WVL A;  1V1P B;  2I07 B;  3GP7 A;  2WFW A;  5JVH 3;  1IBK L;  4TKO B;  2K01 A;  2KCM A;  4KN7 C;  2OQK A;  3HRZ C;  2JEB I;  2CQO A;  2HHH Q;  4A3B G;  5HY6 A;  3G4S A;  3IL8 A;  4QCL A;  3DHQ A;  5E7N A;  2AMC B;  1F9P A;  4PQX A;  1AN8 A;  1NSN S;  2X6G A;  1HCZ A;  4JBW A;  4RGT A;  2F0U A;  4P71 A;  2BE5 C;  3V96 A;  1M8A A;  4QF4 A;  4LF6 L;  1JB3 A;  2AHO B;  5CR3 A;  4DPG A;  4AQY L;  1HFN A;  1V9P A;  2K1B A;  4IPH A;  4N8F A;  2K52 A;  4JOI A;  3HOX H;  2A6E C;  2VQF Q;  4B3M L;  3OHX C;  2KHJ A;  4XIG S;  1SFO H;  3NWS A;  5AFW A;  5IYC G;  1KAW A;  3PIO A;  1Q1B A;  3HOY B;  3CMA A;  2ID0 A;  3U50 C;  4JVZ A;  4IO9 A;  1RCV D;  1TY0 A;  2ZXP A;  1Y1W G;  3RNU A;  5EQ0 A;  3SK4 A;  1EUJ A;  2RKS A;  1Y8P B;  1X3E A;  5CV9 A;  5DEH A;  3U4Z A;  2IW3 A;  3MFY A;  1SYB A;  2XTI A;  1QUQ A;  4X64 L;  1PYS B;  2NB0 A;  1AEX A;  2MGS A;  3H3V H;  2BA1 A;  2NZ1 D;  1LTA D;  2F03 A;  1GUW A;  1PFM A;  2XWJ B;  4JI3 L;  2A74 C;  2JK8 A;  1SE3 A;  1KDB A;  3KLW A;  2Z9H A;  4ZCK A;  4HR7 B;  1GOZ A;  2R61 A;  1Z7T A;  3OIQ A;  3KLS A;  2K7V A;  2UUB Q;  1EQQ A;  2XRQ D;  2RBM A;  5H1S E;  3ZJY C;  1PH4 A;  4X3T A;  2EJF C;  4RKL A;  3W5O A;  2B2W A;  4KY7 A;  4B3R Q;  2JA6 G;  1VQF A;  2ES2 A;  1SLJ A;  4I7Z C;  5BR8 L;  3H3V I;  3EFX D;  2JE6 I;  5FO7 B;  1QZH A;  1B53 A;  1H9S B;  4XYQ A;  4A3J G;  3STB D;  1LYL A;  4X3U A;  3I72 A;  1Q8I A;  3GTJ B;  1B2T A;  5IGB A;  4A3I H;  2VZA A;  4XQJ A;  2JA6 B;  1DYQ A;  1TU2 B;  1KNA A;  2K5H A;  4C3H B;  2G9H D;  3FVQ A;  4CGY B;  3R3O A;  1TWA B;  3M7G A;  3SK6 A;  5LMN Q;  1I94 L;  1U4M A;  4FXK C;  2MFI A;  4X65 L;  3CCM A;  1WTR A;  5FLX L;  3RZO H;  1FGB D;  1QVF A;  4CJ2 C;  3I73 A;  1EYD A;  4FF2 A;  4A3C H;  1ENF A;  1H9J A;  4LW1 A;  1XMQ L;  3ER0 A;  5CGK A;  1Q46 A;  4JG2 A;  2YU9 B;  3ULL A;  3J80 c;  1DZ1 A;  3OYY A;  4A3D B;  1X56 A;  1Q7Y C;  2Y0S G;  3IRB A;  2F3V A;  3Q22 A;  1BXT A;  3NXW A;  2F0Q A;  1SE4 A;  2O2L D;  1UE6 A;  3B6Y A;  3ICE A;  5M5W H;  1T5X D;  1KXL A;  2EYM A;  1I3Q H;  1HRJ A;  1SNC A;  4RAU C;  1F2Z A;  1KRT A;  4CJ0 B;  1TKW B;  4ZUJ A;  4K2K A;  3GTM H;  1BO0 A;  1BOS A;  4BY1 H;  4P75 A;  4GN5 A;  4XYO A;  4A3G G;  3G6E A;  3JAM L;  3BYT B;  3I4M G;  1G8Z D;  4KJN A;  2ZJR A;  4BWG B;  1SNM A;  3H15 A;  3C46 A;  1VF5 C;  3KF6 B;  2DJF C;  1LLR D;  1OXT A;  4JI1 Q;  3OWF A;  3PSI A;  1LTI D;  4Y7N B;  2F0N A;  1KAA A; 
#chains in the Genus database with same CATH homology
 4A3F H;  4JV5 L;  2CKZ B;  1OXU A;  4A3E G;  2N3S A;  3I55 A;  3DM3 A;  3PCO B;  4YWL A;  1D7Q A;  3K80 C;  1E22 A;  3HOV H;  1VQ8 A;  1OXX K;  5IYD H;  2B29 A;  2XGT A;  3AYH B;  5C4J H;  3H0G H;  3CW2 C;  1TWA H;  4UPA A;  5GAG C;  4YY3 Q;  1SE8 A;  2EXD A;  4KLK A;  4YHH L;  2NVX H;  3S16 H;  4DV2 Q;  2R92 H;  1O7I A;  4A76 A;  1IBM L;  2I5M X;  3EBE A;  1IZ6 A;  4DR1 Q;  4P73 A;  1JMC A;  1MIU A;  4A93 G;  2K14 A;  3K8A A;  4IOA A;  4BY1 G;  3UDI A;  3W1B A;  4C3J H;  2OQ0 A;  1YBY A;  3F2B A;  5JJL A;  2C35 B;  4A3M H;  4YWM A;  1A0I A;  3KDF A;  2V1C C;  3ERS X;  1J5E Q;  1XMO L;  2Y0S E;  4JI0 L;  2JA8 H;  2RF4 A;  3M4P A;  2IHE A;  3CME A;  1N34 L;  1JJC B;  4IJH A;  2KBN A;  4XTC S;  2HIX A;  1CKN B;  1VQJ A;  4YCV A;  5M5Y H;  2YU9 H;  4LF6 Q;  3L0O A;  4O0A A;  4LF9 Q;  4A3D H;  4R1J A;  2WB1 E;  4AQY Q;  3T1H Q;  3KDF B;  4JI4 L;  4LUV A;  3FKI G;  5FLX c;  1X9N A;  2JA9 A;  3GDE A;  1YEZ A;  4B3M Q;  3NBH B;  4JI8 Q;  3PIP A;  2LXK A;  1IBL Q;  4A3F G;  4IPC A;  5LMN L;  2PMZ E;  3PO2 G;  1HH2 P;  4IFD J;  1YIJ A;  3TS0 A;  2NZH A;  2PI2 E;  1OXS C;  2PNH A;  5M3F G;  4HIO A;  4DR3 Q;  4DV4 L;  1L1O B;  4OWW B;  2E8G A;  2BH2 A;  3E9H A;  1HZB A;  4LFA L;  1A8V A;  1N33 L;  3I56 A;  2R7Z H;  1HNZ Q;  4BXX H;  5GAE C;  2DGY A;  4B3T L;  2ZJP A;  4L5T A;  2UUC Q;  5C44 G;  4IOC A;  3VDY A;  2AWO A;  3M85 A;  1KL9 A;  4X6A H;  2E5L Q;  2ATW A;  2VNU D;  1GO3 E;  3CCQ A;  2R6G A;  2RHS B;  1YJN A;  1PA6 A;  4DR4 Q;  1VQI A;  3GTP H;  4OXP A;  5JEA J;  3PUZ A;  2D0O A;  2OTJ A;  1EIF A;  4A3M G;  1N32 Q;  1VQC A;  1W2B A;  5K36 G;  3RZD H;  2LXJ A;  2LSS A;  1FGU A;  5IWA L;  1Q81 C;  3S1M H;  1LUZ A;  1KHI A;  4A3D G;  1XNR Q;  3M7N A;  2IHF A;  4JI3 Q;  3PF5 A;  1VQ4 A;  1S3O A;  1U0L A;  1KD1 C;  5EAY A;  2HHH L;  4ME3 A;  4DKA C;  3F2D A;  5LMU L;  2UXC Q;  1C0A A;  2UUA L;  5JJI A;  1HNW Q;  1E1O A;  1TWH H;  1H95 A;  4KHP Q;  4JCV E;  3JAM c;  1S40 A;  4R4I A;  4QGU A;  3KF8 B;  3CCJ A;  1EOV A;  3DLL A;  4DR6 L;  2R7Z G;  4BXX G;  5C4X G;  1WJJ A;  1YZ6 A;  1I6H H;  2NZO A;  3JAM i;  4JYA Q;  2OTL A;  1VQE A;  4BBS H;  2I0Q A;  3HOW H;  4K0K Q;  2VQE L;  1N8R C;  2KHI A;  1X55 A;  2WB1 G;  5IP7 H;  1WOC A;  4X62 Q;  4JC0 A;  1UEB A;  1JJ2 A;  5C0X J;  1PH3 A;  4LUO A;  4JI1 L;  4DV6 Q;  2KEN A;  4DV3 Q;  3PV0 A;  2MQH A;  5DLQ E;  4B3S Q;  3GTQ H;  2HQL A;  1TXY A;  3FP9 A;  3TRZ A;  4JI2 Q;  2IX0 A;  4JBM A;  4C3I H;  3I4N H;  1L1O C;  3EIV A;  3S17 H;  4IJL A;  3AEV A;  1PH1 A;  1HR0 Q;  2I5L X;  1Y1V H;  3I4O A;  2ZM6 Q;  3PUY A;  3GO5 A;  2QA4 A;  2AWN A;  1YNX A;  1NMF A;  3KF6 A;  1CKO A;  3RLO A;  4YY3 L;  1I94 Q;  3D31 A;  3HOZ H;  4DV2 L;  1SR3 A;  1FVI A;  2H5X A;  2HIV A;  3A5U A;  3S1R H;  1XPO A;  1PH5 A;  2GVB A;  3D0F A;  4X65 Q;  2JA7 G;  2K75 A;  3GTG H;  4DR1 L;  1PH7 A;  1B70 B;  1QVG A;  3MEF A;  1EFW A;  4L5S A;  4LFB Q;  1VQL A;  2DUD A;  3AFQ A;  3M4Q A;  3M9B A;  3PGZ A;  4JI5 Q;  1HNX Q;  1W3S A;  4KHZ A;  4GS3 A;  4BA1 I;  2BH8 A;  1FJG L;  1J5E L;  1YI2 A;  3OTO Q;  1JJG A;  2EQS A;  4BY7 H;  4DR5 Q;  4DV1 Q;  3L7Z C;  1EQR A;  3CCE A;  4BA2 I;  1NTG A;  4HJ7 A;  4HJ9 A;  2VW9 A;  3NEM A;  3S24 A;  2RCN A;  2OWO A;  4LF7 Q;  1T9H A;  2NN6 G;  2R7F A;  4LF9 L;  1XPR A;  4QL5 A;  3T1H L;  1PHJ A;  1KRS A;  1EIY B;  2CCZ A;  4DUZ L;  1HR0 W;  4H02 A;  1Q1E A;  4QJF A;  4JI8 L;  2JA5 H;  4GLA C;  2N8N A;  2UUB L;  3RN2 A;  1IBL L;  3HKZ E;  3M3Y H;  1G29 1;  1RIP A;  3S1N H;  3S15 H;  1K83 H;  3CD6 A;  1IBK Q;  2IX1 A;  3STB C;  2A19 A;  4C2M H;  3RR5 A;  4DR3 L;  4B3R L;  5IP9 G;  2Q2H A;  3CCS A;  5HGQ A;  4DAY B;  3CCV A;  1CKN A;  3KYH C;  3LGJ A;  3F8T A;  4JI7 Q;  1MKH A;  1J6Q A;  3AQQ A;  4PG3 A;  2UUC L;  2JEA I;  3HOZ G;  3KFU A;  2A1A A;  2ZTD A;  5FLM G;  4JBK A;  2E5L L;  2MNA A;  1TWC H;  2WAQ G;  2K5V A;  4O2D A;  3RN5 A;  3UDG A;  4DR4 L;  2CWA A;  1AE2 A;  4NB3 A;  1VS0 A;  4GNX B;  4OON A;  1L1O A;  4MZ9 A;  4ALP A;  1LTL A;  1M90 C;  3W1G A;  1N32 L;  4A3J H;  4JI6 Q;  4LF5 Q;  2IT1 A;  4APV A;  4HIK A;  4PMW A;  5IE8 A;  5ELN A;  1PH2 A;  4BY7 G;  4GKJ Q;  3BU2 A;  2WP8 J;  3A5Z B;  2UU9 Q;  2B63 H;  4OX9 L;  3PF4 A;  1XTD A;  1JT8 A;  1LM0 A;  1V1Q A;  3K7A H;  2E2J H;  3HOV G;  1HZA A;  5IYD G;  1E24 A;  1SN8 A;  2R7D A;  4EQ5 A;  3CXC A;  1I5F A;  1WCM H;  5M3M H;  3U58 A;  3H0G G;  3L2P A;  1PV4 A;  2JA5 G;  2UXC L;  1QUQ B;  2R92 G;  3CCL A;  1M1K C;  1HNW L;  1MJC A;  3I2Z A;  2YTV A;  1X3G A;  1K73 C;  2K4K A;  3FHW A;  3UE0 A;  1K8A C;  4YCU A;  4DV7 L;  3UDF A;  1K9M C;  1K3R A;  2HT1 A;  1X54 A;  3CPF A;  3AFP A;  2N78 A;  3JC6 6;  4PZ6 A;  4QIW E;  5JJK A;  3HOU H;  2JQO A;  1MJE A;  4LF4 L;  4HID A;  2N49 A;  4JYA L;  2UXD L;  1WYD A;  1OTC A;  1C7Y A;  4BBR H;  2GVA A;  3A74 A;  4IPG A;  2YYZ A;  4MTN A;  3ULP A;  2JA8 G;  4X64 Q;  3J81 c;  1KIX A;  4K0K L;  4X66 L;  4IFD I;  4NXM Q;  1B7Y B;  4TQU S;  2VY3 A;  2AKW B;  4X62 L;  5GQO A;  4OO1 I;  3K81 C;  1Q12 A;  4UP8 A;  4NPS A;  4GOP B;  3HKZ G;  1NE3 A;  2D62 A;  4UP7 A;  3BJU A;  3J81 i;  3J81 j;  4DV3 L;  4DV6 L;  1IYJ B;  3G71 A;  1CSQ A;  3CAM A;  1XMO Q;  1C9O A;  3NEN A;  1PH9 A;  4LUZ A;  3S2H H;  1K0R A;  1VQN A;  4IFD G;  2ZTC A;  2B63 G;  3KOJ A;  2VL6 A;  1CUK A;  2R93 H;  5AJ3 L;  2F52 A;  1HZC A;  1Q82 C;  4JI4 Q;  4JOI C;  1CKM A;  2NVY H;  2Z6K C;  3SGI A;  2ZM6 L;  5M3M G;  4EX5 A;  1HR0 L;  4A3B H;  1ASZ A;  5C3E H;  3A0J A;  4DV5 Q;  3TS2 A;  2EIF A;  5M5X H;  1Q8K A;  1YHB A;  3U4V A;  1B8A A;  3CQZ H;  2ALY B;  3HKS A;  1KQS A;  3F2C A;  2B3G A;  1HZ9 A;  3HFZ B;  4DV4 Q;  2F4V Q;  3NEL A;  4UY8 C;  3T1Y Q;  4GNX C;  1GKH A;  5GAD C;  1AH9 A;  5BR8 Q;  2KCT A;  2WAQ E;  4LFB L;  3BZK A;  4DK3 C;  3HOU G;  5JEA G;  1HNX L;  1U5K A;  1E3P A;  1PVO A;  1VQG A;  4LFC L;  1VQO A;  4BBR G;  4LNQ A;  3OTO L;  3I4M H;  1BBU A;  1SRO A;  4DV1 L;  1VQB A;  4R4O A;  1OXV A;  4HJ5 A;  4TVA B;  5IYC H;  1Z9F A;  4LF7 L;  4AYB E;  2GN5 A;  1YHQ A;  4DUY Q;  4QY7 A;  2I5H A;  3CCR A;  4POF A;  1NBW A;  2F3I A;  3MXN B;  1A63 A;  1YIT A;  1N36 Q;  1PYB A;  3CC7 A;  2WFW A;  1IBK L;  4A3K H;  1ASY A;  2PQA B;  1L0W A;  1Y1W H;  2KCM A;  3EN2 A;  2OQK A;  3CF5 A;  4DR2 Q;  4FDB A;  2JEB I;  3CC2 A;  2CQO A;  2HHH Q;  4A3B G;  5LMU Q;  5HY6 A;  3G4S A;  2Z0S A;  1VQP A;  3GTO H;  4JI7 L;  5E7N A;  5C0X I;  2AMC B;  1TWG H;  4UP9 A;  3PUV A;  1XMQ Q;  3HOW G;  4P72 A;  4RG1 A;  4BBS G;  4JBW A;  2K50 A;  2YTY A;  3RLN A;  3J7Z C;  4GN3 B;  4A93 H;  1EYG A;  4PZ7 A;  4P71 A;  5IP7 G;  1IL2 A;  4LF6 L;  1VCI A;  4GOP C;  2NVT H;  4L5R C;  2AHO B;  4DPG A;  1Z47 A;  4GN4 B;  4AQY L;  5C0X G;  4LF8 Q;  4DV0 Q;  2QGQ A;  1V9P A;  4JI6 L;  2FXQ A;  4LF5 L;  3K0X A;  4IPH A;  2K52 A;  4JOI A;  2Z6K A;  3HOX H;  2VQE Q;  2VQF Q;  4B3M L;  4GKJ L;  1YJ9 A;  4NXN Q;  2KHJ A;  1YHA A;  4L5Q A;  1TWF H;  2CWP A;  1D8L A;  4XIG S;  5GAH C;  1SFO H;  1DGS A;  2UU9 L;  3I4N G;  1BKB A;  1AE3 A;  5IYC G;  1UE7 A;  1QVC A;  1KAW A;  1Y14 B;  4YCW A;  3S2D H;  1Y1V G;  3PIO A;  1S72 A;  1Q1B A;  1YVC A;  2ZJQ A;  1HNZ L;  1UWV A;  1NY4 A;  3CMA A;  4GNX A;  2ID0 A;  4GKK Q;  2YTX A;  3U50 C;  3GTK H;  3PO2 H;  5ELO A;  4IO9 A;  3GTJ H;  1FL0 A;  5FJ8 H;  1E7Z A;  4A3K G;  5M3F H;  1VQ6 A;  2JA6 H;  1Y1W G;  4YWK A;  3RNU A;  1JE5 A;  4C3H H;  5GRO A;  1EUJ A;  1EWI A;  1X3E A;  5C44 H;  1XNQ Q;  4DK6 C;  3U4Z A;  1GD7 A;  1G51 A;  1X65 A;  1PH6 A;  2XTI A;  1QUQ A;  4X64 L;  1NJI C;  4PZ8 A;  1PYS B;  4AYB G;  1VQ5 A;  1VQ7 A;  3WWV A;  4GLX A;  4NXM L;  4DR7 Q;  1VQA A;  5IYB H;  3H3V H;  4WJ3 M;  2BA1 A;  2OCE A;  4R4T A;  2D0P A;  2BA0 A;  1XNR L;  2UXB Q;  4JI3 L;  1WI5 A;  1FJG Q;  3CPW A;  4JV5 Q;  3HOX G;  3M4O H;  2JK8 A;  4HJ8 A;  2Q2T A;  1V43 A;  3TEH B;  4KHP L;  4QQB X;  3KLW A;  3TQY A;  4HJA A;  2MO1 A;  2VUM H;  2YV5 A;  1VQH A;  3KJP A;  2A8V A;  3K7U C;  4DUZ Q;  1XPU A;  4AIM A;  2QEX A;  1HJP A;  2MO0 A;  2UUB Q;  1EQQ A;  4YHH Q;  2ASB A;  4DV5 L;  1IBM Q;  5H1S E;  3ZJY C;  4GOP A;  1PH4 A;  4AH6 A;  4A75 A;  3W5O A;  5FJ8 G;  4B3R Q;  4RMF A;  2JA6 G;  1VQF A;  2F4V L;  1I50 H;  3T1Y L;  2ES2 A;  1SLJ A;  2L15 A;  5C4X H;  1X3F A;  4R4C A;  4HIM A;  5BR8 L;  3OW2 A;  3H3V I;  1JB7 A;  1WFQ A;  2JE6 I;  5IT9 c;  1QZH A;  5IY0 A;  1VQM A;  1BBW A;  4A3J G;  1G6P A;  1SRU A;  3STB D;  4JI0 Q;  4B3S L;  2ZTE A;  1LYL A;  1NMG A;  2CFM A;  1N34 Q;  4JI2 L;  4A3I H;  2VZA A;  5IYB G;  4OO1 G;  3GD7 A;  4P74 A;  2K5H A;  4DUY L;  2E2I H;  1WCM G;  1R9T H;  1PFS A;  5LMN Q;  1I94 L;  4A3L H;  2MFI A;  1N36 L;  2RHQ B;  4OX9 Q;  3BZC A;  4X65 L;  1PH8 A;  2VUM G;  1UE5 A;  1N9W A;  4LFA Q;  3G48 A;  3CCM A;  1N33 Q;  3RZO H;  4DR2 L;  3PO3 H;  4B3T Q;  3S14 H;  2K5N A;  2VS1 A;  1QVF A;  3HOY H;  4Y7N H;  2Q2I A;  4JI5 L;  4A3C H;  4A3G H;  4LW1 A;  4DNI A;  2JA7 H;  1XMQ L;  3ER0 A;  4DV7 Q;  1UE1 A;  4DR5 L;  1CSP A;  1Q46 A;  3F1Z A;  4JG2 A;  3ULL A;  3GTL H;  3J80 c;  1VQ9 A;  3OYY A;  4R4Q A;  4LF4 Q;  1X56 A;  2PQA A;  1Q7Y C;  2NVQ H;  4Y52 H;  2Y0S G;  1SMX A;  2UXD Q;  3IRB A;  1QZG A;  4LF8 L;  4DV0 L;  3PUX A;  1K8G A;  3CP0 A;  4KI0 A;  1X6O A;  3J80 i;  3S1Q H;  4X66 Q;  2VQF L;  4MNO A;  5LMN W;  4GLV B;  4NXN L;  4A3E H;  5IWA Q;  1UE6 A;  3B6Y A;  3E0E A;  2Q2U A;  3ICE A;  4A3I G;  1IXR A;  5M5W H;  4POG A;  2R93 G;  1KXL A;  3CC4 A;  3CCU A;  1I3Q H;  1GM5 A;  1KRT A;  1P16 A;  3PUW A;  2UUA Q;  5C3E G;  4GKK L;  4A3L G;  3Q8D A;  1L2F A;  3UDX A;  4OWT B;  3I7F A;  1BVS A;  3J7A 5;  5AJ3 Q;  2PI2 A;  4J15 A;  5IP9 H;  1KC8 C;  4OWX B;  3GTM H;  4DR6 Q;  4WJ4 A;  1VQK A;  4BY1 H;  3PO3 G;  4P75 A;  3RLF A;  3UE1 A;  4GN5 A;  2E2H H;  3HOY G;  4IPD A;  5J3B A;  4A3C G;  3TRE A;  3KJO A;  3ULJ A;  4A4I A;  1YJW A;  3G6E A;  1XNQ L;  5FLM H;  1VQD A;  1P8L A;  4A3G G;  3I4M G;  4LWC A;  1Q86 C;  2ZJR A;  1GVP A;  2JJQ A;  3H15 A;  1XJV A;  2IY5 B;  3KF6 B;  2NN6 I;  4DR7 L;  4JBJ A;  3E9I A;  1OXT A;  1E1T A;  1A62 A;  4JI1 Q;  2UXB L;  3FKI H;  4LFC Q;  3PSI A;  1RL2 A;  4DAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...