2B2UA

Tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4 and dimethylarginine 2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
175
structure length
173
Chain Sequence
FETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 173
sequence length 175
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2uA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2uA01
4CJ1B 1XYIA 2B2YA 2FFKB 1KNEA 4IURA 2BDNA 1B53A 1F9RA 1WTRA 1MSGA 2K01A 1GUWA 1HUNA 5D65A 2EOTA 3HP3A 1WD0A 2B2YC 3D6WA 1WTVA 1ML0D 3Q6SA 1IL8A 2K03A 1B2TA 3I3CA 2JYOA 1PFNA 1ICWA 5DNFA 1E0BA 2D9UA 1PFMA 1LV9A 2CVRA 3MWYW 4LMQD 2NWGA 4RAUC 1WVLA 1WTPA 3FPUB 4IUVA 2X6LA 4RA8A 1F9SA 2B2UA 2DY8A 2J7ZA 2RA4A 2DY7A 2X6GA 1WTOA 1BO0A 1NAPA 2L11A 5JJZA 4XT1B 2K04A 1VMCA 1PFBA 3IL8A 2B2UC 3KUPA 4UAIA 2B2VA 4IUUA 1AZQA 1F9QA 1EIGA 2KUMA 5CMDA 1WTWA 1WTQA 1IKMA 1EQTA 4NW2A 4MN3A 2FHTA 2L12A 5EQ0A 5CBEE 2B2TA 1HRJA 1ILQA 3F2UA 2SDFA 2B2VC 2H1EA 1JICA 1A15A 1MSHA 1X32A 4HEDA 4X3SA 1TVXA 1O80A 1PDQA 3QO2A 2KOLA 2B2TC 2FMMA 2IL8A 2VXWA 3DM1A 4HSVA 4ZKBB 2X69A 1SDFA 1WD1A 1HFNA 1MGSA 2FJ2A 2KEEA 4U68A 1NCVA 1HHVA 1S4ZA 1RTOA 1VMPA 2HUGA 2RSNA 5EKIA 3FDTA 1HUMA 1B4OA 4CJ2C 1QG7A 1U4MA 2FINB 3N52A 4O42A 1HFGA 1NR4A 2L9HA 4ZAIA 1HA6A 2EE1A 4RWSC 4ZK9B 5T1IA 1J8IA 3P7JA 1NR2A 1DOMA 2MP1A 2HCCA 3GV6A 4QUCA 4XT3B 3I90A 1O7ZA 2NZ1D 2KVMA 4X3KA 5EPLA 4CJ0B 1DOKA 1G2SA 3KBXA 1EOTA 3MTSA 4DN4M 1DZ1A 2XIWA 5EJWA 5E4XA 2MGSA 2MPMA 1F9PA 4X3TA 1IKLA 4OIKA 4R9WA 2KECA 1EL0A 1EIHA 2K1BA 1KNAA 1O7YA 3TZDA 4R8IA 3IFDA 4QUFA 4XDXA 1M8AA 1U4RA 2M2LA 2RSOA 2Q8RE 1ZXTA 1DOLA 1RTNA 2KEDA 2L1BA 2HDMA 2NYZD 3GV3A 1G91A 2K28A 3R93A 4ZLTF 5EPKA 1C8CA 4IUQA 1RJTA 1G6ZA 1SAPA 2MJ8A 2Q8TA 1SSOA 2RVLA 2JP1A 2B2WA 2K05A 3ONAB 1RODA 2N55A 3DEPA 4HAEA 5AFWA 1WTXA 4HCSA 4MHEA 3LWEA 1QNKA 1RHPA 1BF4A 1ILPA 1G2TA 1CA6A 1AP0A 1U4LA 3I8ZA 3I91A 2HCIA 4OIJA 2EPBA 5E4WC 1B50A 5CBAE 2B2WC 5EPJA 3H91A 4IUPA 4X3UA 3UI2A 1B3AA 3G7LA 1PLFA 5CORA 1X3PA 3SVMA 1ESRA 1BBXC 3DEOA 5COYA 5D14A 1XX8A 3TN2A 1DONA 1Q3LA 1CM9A 2N88A 1CA5A 1JE4A 1U4PA 5T1GA 4ZKCB 1F2LA 1X3QA 2L4NA 1MI2A 2R3ZA 1BNZA 2HDLA 4IUTA 1J9OA 1QE6A 1AZPA
chains in the Genus database with same CATH superfamily
4C1NK 2P5ZX 2UUBQ 4KN7C 1IBKL 1B1ZA 5CV5A 1BOSA 3K8AA 1SRUA 1WTRA 4DR5Q 1QVCA 2JA6G 1T9HA 3HOYG 4A3IH 3QR8A 2K03A 2E75C 4JI0L 2AUJD 3A8KE 4KMUC 1WTPA 2E2HB 4B3SQ 2OXPA 3T1YQ 4A3MG 1Z6HA 1ENFA 2VQEL 2EZVA 1PRTB 5HY6A 1EFID 1FGUA 1V8QA 4BBRB 4H44C 2LS01 1O78A 3KUPA 1E1OA 3FEWX 3HOWG 4DR3L 3G48A 1QVFA 4BXXH 1SYBA 4JI8L 2H1EA 3M4OB 4X6AH 1VQ8A 3SR1A 3FHWA 5FKAC 2IL8A 2VXWA 2UXCQ 1BUVT 2PCFB 1S4ZA 2TSSA 2J0TD 3LNNA 3VYSA 2BE5D 2R61A 4MIUA 3VR5A 3J80E 3N52A 1NR4A 2AUKA 1STHA 4WORA 4ZAIA 2F0UA 2K5WA 4BY1B 4JI1L 2NVYB 4OONA 1XXGA 3GV6A 4GLXA 1SN8A 3ERQA 4B3MQ 4DNTB 2L15A 4C3HB 1L1OA 2K6AA 2XIWA 4HN7A 2GVAA 4HR7B 4AYBB 3EQLC 1XPRA 2B63H 4DR4L 3HOUG 3A56A 4FXKC 4ZUJA 3KYHC 1VF7A 3KF6B 3TZDA 4GOPC 5EGTA 4LK1C 2M00A 4LF6L 3CCJA 3L3OC 2R92G 5JAVA 4A3EB 2WKCA 1SE8A 2UUCL 2JEBI 3FVQA 4P73A 4XYQA 2D0OA 4JVZA 3TEHB 5IE8A 4QF4A 1XWEA 2VW9A 4DR2L 3RLOA 3BZKA 1AP0A 1UAPA 2WP8J 4DK6C 5LMNL 4B9XA 3E0JA 1LTLA 4PMCA 3CC7A 2XSCA 1X3PA 1LT3D 4A3BB 4GNXC 3GD7A 1V1PA 1Q90A 1B3QA 5M3MG 1Y1WG 5ELBA 2JA5H 1GVPA 1Y1VH 5D65A 4X62Q 1WYDA 1R9TH 5M5XH 3L9AX 2LKVA 2XVSA 3T1HQ 1ET9A 3NTHA 5C44H 2UXDL 2J7ZA 4A3MB 3PO2H 4IJLA 1P8LA 3LGJA 4DAMA 2EYHA 2L11A 1E1TA 1I4XA 1EIGA 1IW7D 3K0YA 4K6LA 3A0JA 4CBVA 4KJNA 1QCBD 4HEDA 1Q81C 5AJ3L 2IT1A 1O80A 4QGUA 1KRSA 1TY2A 1FVIA 1PRTC 2JA8G 3CKIB 3PF5A 3MZ5A 2WKDA 4A3GG 1TWHB 1VQMA 1HA6A 2A69D 3SK5A 5LMUL 1PTOD 1C9OA 1KRTA 2B39A 3BDCA 4A93G 1K8OA 1YVCA 2QILA 1S5CD 3V05A 4PZ7A 4A3FH 2RDFA 2E2JB 1ENCA 5C4XH 3BZCA 1QZGA 1U9RA 1EQRA 2OCEA 3BS1A 4KHPL 3OW2A 1IYUA 1H9KA 1AW7A 4DV0Q 4XDXA 4Y7NH 4IPCA 3KOJA 1MIUA 1RTNA 4JPBW 1E3PA 1UE5A 3NELA 5CR3A 1G91A 1CHPD 5IIFA 3UDIA 3DEPA 2RQXA 3QOJA 1IL2A 4BBSH 2YTVA 5J1ZA 4LFBL 1VQGA 3TSSA 4K5XA 2PMZE 5I9PA 1IBMQ 4A76A 3H0GB 3UI2A 5DEHA 3J7AV 4ALPA 3SVMA 2CWPA 1HQMC 5IYCH 5IP9G 1V43A 2HIVA 4L5TA 3RR5A 3VR4A 4X66Q 1EWIA 2E76C 4JV5L 5M9OA 1D5MC 5NUCA 3RLNA 3EBEA 4P74A 3HOZB 3K0XA 3CW2C 5M3MB 1P16A 1Y1WB 1KNEA 2JA7B 3E3XA 3D4WA 4IOAA 4ULLA 1VQPA 4K8JA 1E22A 5IYBG 3RZOB 3HP3A 3M4OH 2EQSA 3LX0A 1IL8A 2R7DA 2I0QA 1PFNA 4EX5A 1LV9A 3HEJA 4IUVA 1PH9A 1XMQQ 3QG1A 3D6CA 4EQ5A 3OIQA 5JJIA 4ABNA 2NTTA 1FL0A 4G7ZC 2RDHA 3HKZB 2PO4A 2F0NA 1LYLA 2NVYH 3D31A 2ZM6L 5JPMC 3S2HH 2F0MA 4GN5A 1JC7A 4RGNA 3J81j 4C3HH 5JEAJ 3F2UA 2BE5C 5C3EH 2E2IB 1STNA 5E7NA 1LTRD 2F0LA 1Q86C 1FD7D 1VMPA 4HJ7A 2KCCA 4A3EH 4G57A 1GM5A 4IJHA 1FYCA 3GTJH 4LUOA 4ZK9B 5JEAH 1J8IA 3SGIA 2OTJA 2ZJPA 3RN2A 4KJOA 1PMRA 2MPMA 2PI2A 1EY7A 2E8GA 2KECA 3VA5A 2K1BA 4DA2A 2ZXRA 4TSSA 4LF8Q 1D1IA 2VZAA 2ZTDA 3I56A 2B29A 2SNSA 4K6DA 4A3BH 1HR0Q 2RSOA 3D4RA 4R4QA 4ME3A 3GTOB 2K28A 3CP0A 2I46A 3OMCA 1UEAB 3HG9A 4EQPA 2D62A 1G6ZA 3J7A5 4A3IG 1A3TA 2WB1E 2BCOA 3NBIA 1ASZA 4MHEA 5BR8L 2EXZA 1G2TA 1EYDA 4OIJA 2Q2IA 4X3UA 2E74C 3CMAA 2LSSA 1CKNB 2K32A 3ND9A 4TVAB 5KNCA 3C1EA 1CA5A 1H9MA 4LW1A 5C0XJ 3CRLC 4DV5L 2DGYA 2HDLA 1JB7A 3F2CA 4KY6A 1XYIA 3PO3B 2F4IA 2FFKB 5FJ8H 4POFA 4LF4L 1CSPA 2ZTCA 4ZRZA 4HTHA 2BOSA 1IBKQ 1ET6A 5C3XA 4JI2L 2L5TA 2NWGA 1Y8PB 1IW7C 2I5LX 3BDOA 4F7XA 3Q8DA 1HPCA 3J80i 4EGVA 1LTGD 1SMYD 4UY8C 4JI0Q 5DLQE 1YHBA 3E9IA 2EYOA 3RUZA 5ISRA 3K80C 5D3IB 4CKEA 1XJVA 5DM63 5K5PA 2VQEQ 4NW2A 4HIDA 2L12A 5EQ0A 4LF5L 3OSOA 4DF7A 5KEEA 1B9NA 1CK1A 3GTQB 2WB1G 1EOVA 4DR3Q 2VUMB 4IOCA 1G291 2A69C 4HJ5A 3CD6A 1LACA 1PTOC 3I7FA 4IFDG 5CV9A 4JI8Q 3I4NG 2PMZB 2V1CC 2NN6I 3H3VI 4LJZC 4J15A 3FDTA 4CJ2C 2BDOA 1S40A 1TS4A 1S3OA 4WJ3M 1L1OB 3MEHA 4RWSC 1K83H 3OIPA 3P7JA 2R7ZH 1SXTA 2F0IA 1VDZA 3VR6A 1KXLA 4JI6Q 2F0DA 1JB3A 2A6HD 4JI1Q 4DV4L 2QDBA 3RD4A 3H0GH 1KLUD 4V0BA 2YU9B 2ZJQA 4DR4Q 3Q24A 4QUFA 2DNEA 4JBJA 4JOIA 1N36L 3J7AF 4YIJA 2K4KA 3Q0AA 3HOZH 1SE2A 4H02A 1O7IA 2IX3A 5KYLA 2JA7H 4UP8A 4LF6Q 2Q8TA 1KIXA 2EY6A 3RZOH 4DAVA 3ITPA 2UUCQ 3H6MA 4CDFC 2EPBA 1V1PB 4LF7Q 5GROA 1PXUA 1B7YB 4HIMA 3QOLA 3TN2A 3PO2G 1F2LA 5LMNQ 1OXUA 1BNZA 5F2DA 1PTOH 1AN8A 4IUTA 1VQNA 2FXQA 4IALA 1M4VA 4H13C 5C5LA 2ZT9C 1A2TA 2F3WA 3R3OA 3TREA 5I6YA 4IURA 1M90C 1F9RA 2KQ3A 3A8IE 2E2IH 2JYOA 4XQQA 2UUAL 2D9UA 5IP7H 1PFMA 2F0HA 3I4MG 1D2BA 4UDUC 2Z6KA 1TU2B 3PIPA 5M3FG 1HNXL 4FVMA 1TY0A 3BVZA 2H4OA 2NZOA 4DUYL 1SYEA 4B3TL 2OT2A 4N8X1 2UXDQ 2NB0A 3GTLB 1SYFA 1LT6D 3NSWA 1N33L 1K8MA 4C2MB 1D1KA 4X64L 1ENAA 1T5XD 2XGTA 2VB3X 1R4QB 4HSVA 3S17B 3U58A 3MHBA 3OPOA 4L63B 2PPBC 4JI5Q 1HHVA 1KDAA 4YCWA 5AJ3Q 1QG7A 1QILA 4DXFA 3GTOH 3BU2A 3QWNA 4NP5A 4NB3A 1TWFH 1EY8A 2Q2UA 2CW0C 2MP1A 4LFCL 1SFOB 4BBSG 4A3CH 4OWXB 1C4QA 2PQEA 3H15A 1D5ZC 3TS2A 5LMUQ 4K5WA 3PQIA 5E4XA 4X3TA 4OX9L 4UP7A 1ZKOA 4IPHA 2Y0SE 3S1MB 3K58A 2E5LQ 1LT4D 1T5EA 1L1OC 1O7YA 2ID0A 2SEBD 2CFMA 3GTGB 3S2DB 5FK9C 5KNDA 2UU9L 4LWCA 3PMFA 5HGQA 2RCNA 3A7LA 1EY5A 2D0PA 3ZJYC 3KJPA 2TMPA 4KHPQ 2K5VA 1B70B 1SSOA 1HTLD 2AKWB 3KLSX 4HCSA 1HCZA 1KHIA 2O4XA 5IYDG 3I8ZA 2HCIA 4XTCS 3NUCA 1TR5A 4GKKL 4K2KA 4R4IA 4YWKA 3K57A 4LFBQ 5C4JB 3DEOA 1GD7A 3NWTA 1I4RA 1YJ9A 3CAMA 2KCNA 2RHQB 1MBYA 3MFGA 5H1SE 1PV4A 2VNUD 4FDBA 4V190 1FNVA 4CJ1B 1EU4A 4A3DH 4XQJA 2EDGA 4LUZA 2CCZA 2D2CC 2K01A 4L5SA 2Z9HA 2EOTA 4C3JG 4JYAL 3GTQH 2VUMH 1VQ5A 1BBXC 4GS3A 1D8LA 1HA5A 2Y0SG 2F0VA 1PH1A 4OWWB 3FRPB 1UEBA 5ELFA 3A7AB 2VY3A 1BDOA 3TZUA 4A3JG 1PFBA 3T4AC 2R93G 4UAIA 1CKNA 1Q82C 1OTCA 1F9QA 3AYHB 4WJWA 1EQTA 1I50B 1NE3A 4P75A 1K3RA 2F0KA 2ZM6Q 2PNHA 3SHLA 1PZKD 3I72A 3Q23A 5EBDA 1HH2P 3DM1A 1SLJA 5LHY1 2ZJRA 3DXJC 2EJFC 4KLKA 1STAA 1CSQA 1GHJA 3BYTB 1TT2A 3W1BA 1EY4A 2A6HC 4FP5D 1IYJB 2XNAC 1AFPA 1M1KC 3CHBD 1SNPA 3K5NA 1K8AC 4M8AA 3GQBA 1G2SA 3W2DA 5BN4A 4DR6L 1CQVA 4CHTB 1F9PA 1MKHA 2HT1A 4R9WA 2LFNA 3GTKB 2WAQE 1KNAA 4QJFA 4RHSA 1Y8NB 2F4VL 4DGZA 4JI3L 1Q46A 1V1OA 2IW3A 1K28A 1IHZA 2I07B 1SNCA 1IBLL 4RKLA 5ELCA 2GN5A 5JOBA 4HJ9A 5FJ8G 1JORA 1WOCA 2B2WA 2OQ0A 3U50C 3FKIG 1Q8IA 5C0XG 3GTMB 3I91A 1I3QB 5IGEA 3WOFA 2N3SA 5D14A 3HOVG 2RCFA 5BR8Q 4R4CA 4YCUA 1JE4A 1I6VC 2L4NA 1N34L 4UHVA 1UNSA 2EYJA 1BVSA 1SYCA 5I6WA 2A73B 3GTLH 4R4OA 4BY7H 3UDFA 4DV5Q 4HJAA 1KD1C 1CZWA 1ICFB 5FLMG 4C2MH 4JI7L 1CI3M 4C3JB 3Q6SA 1SNMA 2A74C 4NMZA 1E0BA 3S17H 3I4LA 4LF4Q 4LMQD 4JI4L 1GUTA 5DM73 4A3KG 2RHSB 2WAQG 2RA4A 1BO0A 1I4PA 1DCZA 2K5NA 2YV5A 2YTXA 4JI2Q 1BKBA 2R7ZG 4XT1B 3C2PA 1SR3A 1S5BD 3DMUA 1PZID 4IUUA 2EYFA 1SFOH 1WTQA 3SK4A 4MN3A 2MO0A 1R4PB 3C1FA 1J5EL 4HIKA 4UP9A 1A6XA 4CDCC 2JA6B 3HOYB 1CT1D 1QNUA 1Q12A 3STBD 3WWVA 3GTGH 4ZUIA 3S2DH 1HR0W 1MJEA 1L0XB 4KHZA 2JE6I 1JOQA 1RTOA 2PZTA 2HUGA 3ND8A 3O13A 3ULJA 3CXCA 2XN9C 1EIFA 4DK3C 2BA1A 1X3GA 3CCLA 1YBYA 3NWSA 4BWGB 3H3VC 4X3KA 3URYA 3HOWB 1DOKA 1Q8KA 2RBMA 2EYMA 1EZ6A 1DGSA 3RNUA 4KY7A 5FO9B 5IWAL 3G71A 5C4JH 1LT5D 4GLAC 3EVQA 1VQ7A 1E2VA 4DV4Q 4KKUA 4G7HC 1DOLA 3D0FA 4Q5VA 4IO9A 1RJTA 1STEA 1GO3E 3UDXA 1G6PA 1Z9FA 1LO5D 1AE3A 1N36Q 1MHWC 1WCMG 2QEJC 1PA6A 3FKIB 2N49A 3HZXA 2EYPA 3K7UC 4KD3A 3M3YB 3HOUB 4A3LH 3OMGA 4APVA 2QF7A 1X6OA 2HD3A 3CCQA 1TKWB 4DV2L 4IN3A 3GTPB 2NVTB 2R7FA 1S72A 2R92B 5IY0A 4K5VA 1K73C 2A19A 5M5WB 2IY5B 4I7AA 2ZXPA 1B53A 4HJ8A 2A8VA 3PV0A 4QMGA 3JAML 3ER0A 2NN6H 1A3UA 1VS0A 2I5HA 1PH7A 2CVRA 2EVBA 3WOEA 1WVLA 1XMOQ 4FNFA 3FPUB 3FMCA 3HOXG 2E2HH 4DR7L 2MQHA 2KHJA 3M4QA 2UUAQ 4FF2A 4OL7A 1ZYRD 4BBRH 2F0EA 1HXYD 5C3WA 4K0KL 5FO7B 1XNQL 3MXUA 3MC0B 5GAHC 1PVOA 3HFZB 2B2TA 3SEBA 1HNXQ 1HRJA 2JSOA 4C3IG 2SDFA 3BVMA 3MXPA 1EY9A 4DR1Q 1TQOA 3A5UA 4B3TQ 3GTKH 5L37A 1N33Q 1I94L 2FMMA 4KN4C 4FF1A 1YNJC 3PUVA 4X64Q 1MGSA 1JE5A 3CPWA 1TS2A 1U4MA 3OYYA 3NPPA 1CKOA 3GO5A 3M4PA 5I4DA 2DJFC 5KNBA 4BY1H 4BS9A 4QUCA 3TP7A 1A2UA 2KENA 3G6JB 2LXJA 2C9OA 1FNWA 1D6EC 1I3QH 3VDYA 4DV6Q 2EY5A 1UUPA 3KFUA 4QB4A 2JA8B 5LMNW 1EY0A 1YNXA 4H0LC 4DV3L 2MFIA 3G6EA 3NP8A 4OX9Q 4A3GB 1HNWL 4KK7A 4A3DG 2BH8A 4IFDI 1E2WA 5E1FA 3E9HA 4FF3A 1LUZA 3TP8A 2WACA 4JOIC 1HZAA 2UU9Q 1VQDA 1C8CA 2IJ0A 5CV7A 4A93B 5K36H 1HZ9A 4OO1G 5HURA 3PF4A 5JJKA 2CW0D 3G7LA 3K81C 3SK6A 2YTYA 3P20A 1A63A 4DUZL 2O5JC 2A1AA 1DONA 2KCTA 3J7YW 1N32L 1H95A 2NVQB 4GKKQ 3ZYYX 1X9NA 1BBWA 1JWMD 1SROA 3AQQA 2B2YA 3P1HA 4R8NA 5EAYA 4P2CB 1PH8A 1B2TA 3QJYA 1LTAD 2JA6H 3HOYH 4YWLA 4N9TA 3UDGA 4UPAA 1ICWA 2B8FA 4H7BA 4IPDA 2VS1A 3JAMi 4J6HA 2QCPX 1KAWA 2KBNA 5ELEA 1F9SA 3S1QB 1WFQA 1H9SB 2H5XA 3S16B 4B3ML 4A3MH 1TIID 2K75A 3VYTA 1A62A 1XNRL 1VMCA 2Z6KC 1C0AA 1VQCA 2B2VA 3S24A 2K5HA 3CQZB 3STBC 2PW5A 4BXXG 3HOWH 4P72A 4JW0A 2GVBA 2PW7A 5M5YB 1KL9A 1DYQA 3P75A 4RFBA 1X32A 4CGYB 4OWTB 1RKNA 3ERSX 4JK1C 5A35A 4KI0A 1WD1A 2GA4B 2FJ2A 2XWJB 1SJHD 5C6AA 1SEBD 1TWHH 1YJWA 4JBMA 2L9HA 2KJXA 2EE1A 2A5HA 3T53B 4RH6A 1U5KA 3RMHA 5GAGC 2JXMB 2NTSA 1L0WA 1CUKA 1WJJA 1AEXA 1QJOA 5C4ZA 3CCUA 3M7NA 5EPLA 1WTHA 2B63G 1DZ1A 4RKBA 2BA0A 5GQOA 1FGBD 1QUQA 2E2JH 2M9VA 3HOUH 1QB5D 2OWOA 4DR6Q 1S5DD 1GJXA 4RGMA 2WIIB 3ULPA 4YWMA 4CKCA 2NVTH 1I4GA 4RCNA 1ZXTA 4JG2A 2R92H 3CCMA 2QEXA 5EPKA 4BY7G 5C5MA 3WDNA 5IGDA 4JI3Q 1EUJA 4PZ8A 5M5WH 1OO9B 1MD2D 1C48A 3ONAB 4HSPA 4JC0A 1RODA 1IBLQ 2QA4A 5LL6S 1NBWA 1VQKA 2G5DA 2PQAB 3Q22A 1RHPA 2AMCB 5CBAE 5TSSA 3KJOA 3H91A 1PYSB 4PQXA 2L55A 4XXEA 5J22A 3BJUA 4L5QA 3SXHA 4MTNA 4ZKCB 2JN4A 4BA1I 1X3QA 4HIOA 5J3BA 4FXDA 5GADC 4OEMB 1B9MA 4DV1L 5J39A 3CCEA 4IQZA 3I70A 1KQSA 1YITA 1NTGA 5M3MH 4OHJA 1Y1WH 2UXBL 2JA5G 1Y1VG 3L7ZC 3PIOA 3W5OA 4A3IB 1ML0D 1K9MC 2A68D 3N6RA 4XYOA 1CHQD 1ZYRC 1Y69U 1A3VA 1RIPA 1NJIC 4JI7Q 2X6LA 5C44G 1K0RA 1HJPA 4DR2Q 4TKOB 2XTIA 5CC4A 4YY3L 1IZ6A 4JI4Q 2OF1A 3PCOB 4RGTA 5BN5A 5FLXL 1XTCD 3PUWA 5IGFA 2RF4A 1JICA 3RZDB 2KOLA 1QVGA 2JA8H 4QIWE 4E6IA 2X69A 4ZKBB 1J5EQ 3J81c 2AWOA 4LF9L 2K50A 4A3GH 1SE3A 5DAUA 3M85A 5IGBA 2KA7A 4ZQ3A 1SNDA 2OTLA 4XT3B 5JJLA 2VB2X 1PZJD 2NZ1D 2KVMA 5IT9L 3MTSA 1EOTA 1JT8A 4A3FG 2K5DA 2B63B 2MGSA 3FPPA 5C4XG 2ZXOA 4LNQA 4O1NA 2N8NA 2AQ2B 1I4HA 5CYUA 1UE6A 3NEMA 4OGQC 2WB1B 4HCEA 1X54A 1E2ZA 1B44D 1AE2A 3I4NB 3CPFA 5IWAQ 2L1BA 4I65A 2HDMA 4DFAA 4PV1C 3LWUA 3HS0C 4IUQA 3TBIB 3OTOL 3IRBA 2MJ8A 3BVGA 1D7QA 1GUNA 1XMQL 5I2YA 3LWEA 1ILPA 3T56B 3ULLA 4B3RL 1XPUA 2K14A 2B2WC 2RDGA 2LXKA 5IYCG 1W6KA 3VYUA 1II3A 1ESRA 2K52A 3A5ZB 3CRKC 4IUNA 3S16H 5IP9H 1U4PA 5T1GA 1V9PA 1MI2A 2EJGC 2MNAA 1EYAA 3J81E 2Q2TA 3NENA 1NY4A 1J9OA 4B08A 3CQZH 4DV2Q 3PO3H 3VR2A 4L8JA 2JA5B 1Y1VB 3PIP3 1U0LA 3MVVA 3D6WA 5IYBH 1R9TB 1JWSD 5M5XB 1TWGB 1QWYA 3EFXD 3NBHA 4PG3A 3JAMc 1GKHA 4NPSA 2ES2A 4WRDA 5C0XI 1IXRA 3PO2B 3M7GA 4QCLA 2C5CA 3R2IA 4P71A 4DR7Q 1IKMA 3NHHA 5CMDA 1WTWA 1PH3A 2IPKD 4C3HG 4AYBG 2FHTA 2DN8A 5C3EG 3RN5A 4JV5Q 3L2PA 4K0KQ 4O2DA 3EROA 1XNQQ 2Z1CA 4JBWA 2OEOA 2EY1A 1X65A 1YIJA 3F8TA 2KEEA 3I4MB 4C1NI 3NE5B 4A3EG 5KRUA 1DD2A 2F0JA 2FINB 3X3MA 1I94Q 5JEAG 5T1IA 4NXNL 3KDFB 5M3FB 2HCCA 2EJMA 3S9WA 3S1NB 5BN3A 1H9SA 1SE4A 3PUYA 4L5RC 4GKJL 4PZ6A 1HZBA 4GN4B 4OIKA 3EIVA 4RGOS 3D4DA 4A3BG 3F2BA 3AFPA 2YU9H 1PFSA 3JAME 3BG3A 3EA6A 1U4RA 3V2TA 3R2TA 1VQAA 1QZHA 3UE1A 1V1QA 1QOHA 4GLVB 4L6TB 4RHRA 5ELOA 4DNRB 3GV3A 1SNOA 2I5MX 1H9JA 4DV3Q 1YNJD 4LFAL 1PHJA 1ASYA 1HNZL 3DHQA 1KDCA 1JMCA 1WTXA 3VR3A 2RVLA 2C35B 1HNWQ 1FJGL 4BBSB 4HMJA 2VQFL 4GZYC 1GOZA 1VQBA 3J7ZC 2K5QA 1PLFA 2F0FA 4J1MA 3F2DA 3OWFA 1BCPD 2A6ED 3NTKA 4TRDA 4F87A 3IFTA 1Q3LA 1ZEQX 4QIWB 1K8GA 1X55A 4DKAC 1JJCB 1AZPA 1SNQA 2A68C 4DUZQ 3IKJA 5CGKA 1N32Q 1JQYD 1X3EA 1YHQA 4XQNA 1HUNA 4B9WA 2F0SA 1WD0A 3RZDH 1CKMA 1UE1A 4R1JA 3SK8A 3KF8A 1YEZA 1OXTA 3MWYW 2F03A 2PQAA 2B2UA 2DY7A 1YZ6A 1UWVA 4JI6L 3S14B 1HTPA 3AEVA 1STYA 3DLLA 2HHHL 4IFDJ 2J4XA 2Z4IA 3S2HB 3KLWA 2JEAI 1CQFA 2AQ3B 5GAEC 3TQYA 1EEID 1XNRQ 3E0EA 3S15B 5C3EB 3DWQA 3KK7A 3BZDB 1ONLA 1BCPF 2EY2A 1NMFA 1PH5A 2B2TC 4N9PA 4AH6A 3HKZE 1TWAB 1EZ8A 4IFDH 1F2ZA 1NCVA 2Z4HA 3I4NH 2CH4A 2F1MA 2Y0SB 1B4OA 2XRQD 2CQAA 3A55A 2E2DC 1HFGA 2IX0A 3K5OA 3GTJB 2HIXA 1Y14B 1QUQB 4OXPA 4A3JB 1PYWD 2CWAA 4LF7L 4DV7L 1PH4A 2R93B 1JJ2A 1EU3A 3I2ZA 4CJ0B 1EYGA 2RKSA 3H0GG 3PUZA 1TXYA 3J81L 1EL0A 3A8JE 3S1MH 4BA2I 3SE0A 2F0PA 3CF5A 1BCPB 2DUDA 3TRZA 4LF5Q 3I73A 2WFWA 3HOZG 1AH9A 3DWPA 2F0WA 3AB9A 3OOCA 2JA7G 3SDZA 1LTSD 3TP5A 1I4QA 1CA6A 1TWGH 5E4WC 1OXVA 5EBCA 4M1UB 3K59A 4IUPA 3IAYA 3BDLA 3K7AB 2JQOA 1LABA 2WV6D 1F2MA 1XX8A 3DM3A 3TP6A 4G7OC 2N88A 3HKZG 1FNUA 3H94A 2ASBA 1RL2A 1GHKA 1VF5C 1Q7YC 4FO2A 3D3RA 2ENBA 2IHFA 3R8BA 1EYCA 1MSGA 3OHXC 4DV1Q 4JI5L 1JWUD 2B2YC 2L0CA 2NVXB 4NXML 1LTID 4K14A 1KTKA 4O0AA 5IP7G 2UXBQ 1VQJA 4WJ4A 4RAUC 4OELB 1KDBA 3I4MH 3CMEA 4RA8A 4OO1I 4ME5A 4KTAA 3HOVB 1GUOA 1WTOA 3A54A 5JJZA 3M9BA 1RDPD 5M3FH 3IL8A 4LUVA 2LY7A 5ELNA 2K33A 2E5LL 3S1NH 3E5SA 5D3DA 4YY3Q 4CKBA 1I50H 1KC8C 4Y52H 2IHEA 5FLXc 1A8VA 2B2VC 5A2QL 4PNYA 2KCMA 5HGTA 3T16A 3H3VH 1HFNA 1BQQT 1YNND 5C4HA 4U68A 4MZ9A 1J6QA 1I6HB 5E3FA 1VQEA 4A3KB 1L2FA 2WAQB 1D5XC 1K83B 4LF9Q 3K6OA 3NQIA 2O5IC 1DOMA 5FOBB 1G8ZD 4A3CG 1S5FD 2R7ZB 1SBBB 3I90A 2NUCA 4PMWA 2AWNA 1IYVA 4AQYL 4ILWA 5CV8A 2K7VA 4DN4M 2XRSD 5EJWA 3KBGA 3U9SA 3T13A 4GOPA 1IKLA 1RCVD 5IT9c 3UE0A 3U4ZA 4DUYQ 4EVOA 3KLSA 2ATWA 2KHIA 1Q1EA 4FYDA 1PTOF 3J81i 5IGGA 1SJED 4X65L 4FF4A 4YHHL 1VQ9A 3PO3G 1Y8OB 2V4DA 1RD9D 1SAPA 3MAQA 2F52A 4F8MA 3CC4A 1KLGD 1BCPC 2A6EC 3TMEA 3TS0A 4DAYA 1BF4A 2F0OA 3GTMH 5I9OA 2WINB 3J80L 3OTOQ 5IYDH 3KDFA 4JBKA 3DUZA 5FLXE 4LFCQ 1DJRD 2JJQA 1B3AA 5CORA 5CV4A 4GNXA 4HMIA 1PH2A 2UUBL 1UE7A 1GUGA 4GN3B 3OWEB 4B3RQ 3S14H 1BR9A 2R3ZA 4F88A 1PTOB 1G51A 5IOCA 4DR5L 1QE6A 4Z9CB 3MXNA 5EKLA 1EQQA 2YYZA 2FMCA 2ICEC 5I2XA 5LL6X 3NBHB 2MHVA 2G9HD 3I4OA 3PSIA 3S15H 3EJIA 1HZCA 3HRZC 4B3SL 1VQ4A 1W3SA 4C3JH 3T1YL 2VUMG 1WCMB 2F0QA 4POGA 5G3LD 2QDLA 5DNFA 2F0TA 4QY7A 1TWAH 5IT9E 3JC66 1F2YA 2OQKA 4IZ8A 2N78A 1BBUA 2PZUA 1LTTD 3NQTA 2B8GA 3MFYA 2CKZB 4S3SA 4EQOA 3VA7A 3I55A 2AHOB 2VL6A 4A3JH 2CQOA 1TWCB 4RMFA 2R93H 3U9OA 3W3AA 2UXCL 1NSNS 3QO2A 1HQRD 4K2LA 1K3BC 4XIGS 1SDFA 5FO8B 1EQVA 3GP7A 5IGCA 2RSNA 3HOXB 4JYAQ 1HUMA 1NMGA 2DJGC 2F0GA 1XPOA 4O42A 3H09A 1TWFB 3C3LA 4AIMA 3CU7A 4R4TA 5G3LF 3A74A 4NXNQ 4C3IB 3MXGA 3K7AH 1Z7TA 3V96A 3MA2B 2ICIA 4R8IA 4GKJQ 1X3FA 2M2LA 4J8QA 4KY5A 1W6JA 2Q8RE 4WFN3 2NYZD 2KEDA 3KF6A 1EIYB 4ZLTF 2Z6BA 2CHBD 1NUCA 1I5FA 4A75A 2JP1A 2K05A 4HAEA 2N55A 1STGA 4FXGC 3G4SA 2NVXH 3FKIH 2JK8A 2ZTEA 1B50A 4LFAQ 1SMXA 5C0XH 3M3YH 5EPJA 1HNZQ 1DXMA 1LTBD 3EN2A 2BH2A 1FJGQ 2VQFQ 1PH6A 2DNCA 2F3IA 3HOVH 3GTPH 3PUXA 1XTDA 3D8GA 4X62L 1LM0A 2F4VQ 2IX1A 4A3DB 2QGQA 1VQOA 1SYDA 3KF8B 2AQ1B 1EWHA 1GUWA 3S1RB 5JVG3 5FLMH 2QW7A 3T1HL 3I3CA 4DPGA 1MJCA 4MTKA 1VQHA 2LMCB 1JOKA 4EQNA 4IPGA 1I6HH 4A3KH 1DM0B 2X6GA 1NAPA 3HGBA 4Q0FA 1X56A 2EIFA 2PNRC 4N8FA 2Z8LA 1H9RA 4NKLA 4QL5A 1EEFD 4KKSA 1A0IA 1N34Q 1YNNC 3L0OA 2HHHQ 4X3SA 1A15A 5KYIA 4ID6A 3BYYB 1W2BA 5JPNC 5EKIA 3K5MA 4RCOA 4CDEC 3CCRA 1S5ED 4PMBA 2QKIC 3PGZA 1EFWA 1NR2A 4KD4A 3E6ZX 1O7ZA 1O7LA 1BXTA 4DK1A 3KBXA 3QB3A 3C46A 1JJGA 2JA9A 1ESFA 4DV0L 3B6YA 1NNXA 4DV7Q 1CZGA 5ELDA 2PI2E 4RG1A 1M8AA 1EY6A 1VCIA 1TS5A 5EKKA 4K8IA 3VYRA 3NTIA 3NK9A 5CV6A 2EYLA 5JVH3 2MO1A 1OXXK 1IBML 4DU9A 1XMOL 4NDXA 3QIAA 5AFWA 4KKTA 1VQLA 4A93H 1LLRD 1QNKA 1N8RC 1KABA 1WCMH 1GXDC 1U4LA 4KV6A 4A3LG 4X66L 3CC2A 1FR3A 3OW7A 1VQIA 2HQEA 1PYBA 2PYKA 1B8AA 3PIO3 2O2LD 1K0SA 2NVQH 2R6GA 2D5DA 3NXWA 4DR1L 1TWCH 4KHVA 4C56C 4AYBE 4MNOA 4BY7B 4A4IA 3ICEA 2BDNA 4CDDC 1L0YB 2NN6G 1F77A 2Q8IB 1WTVA 3TDQA 4ODGA 2HQLA 1WI5A 3HOXH 3S1QH 4NXMQ 1YHAA 2DY8A 3U4VA 2G9DA 4YCVA 3K5LA 3CCVA 2NBFA 4BBRG 1OXSC 2K04A 2XWBB 1E24A 4DV6L 2B2UC 1AZQA 2KUMA 1N9WA 1SYGA 5CBEE 5M5YH 1RF2D 1ILQA 1JR0D 1MSHA 4C3IH 1CTMA 1TVXA 2NZHA 1PDQA 1E7ZA 1JOOA 1CFMA 3HKSA 2IWHA 3KLRA 4ZCKA 5IODA 4U673 4DAPA 4QQBX 1TS3A 5C44B 4JCVE 4TQUS 3DWAA 1PRTD 3F1ZA 4BY1G 3AFQA 4ZYSA 4GOPB 1Z47A 3GDEA 5KIXA 4LF8L 1VQ6A 4I7ZC 3AMUA 2EXDA 2PZWA 1HR0L 3AU7A 5KGUA 1EIHA 1GUSA 4AQYQ 1STBA 2B3GA 2F3VA 3X3NA 3IFDA 1C7YA 2SOBA 1KAAA 3M4YA 3MEFA 4DAYB 4G4KA 3R93A 1JCKB 2KHSA 4GNXB 4X65Q 3S1RH 1Q1BA 5K36G 4LAAA 4YHHQ 1SMYC 1VQFA 4A3FB 1YI2A 3RLFA 4DXGA 1YJNA 4OO1H 5C4XB 2MUYA 2ALYB 3W1GA 3CCSA 3MXNB 2Q2HA 5COYA 1PRTF 2SNMA 3J80c 3T51B 1CM9A 5A2QE 4DK0A 4Y7NB 2CH4W 3FP9A 1EWCA 4DNIA 2Z0SA
chains in the Genus database with same CATH topology
4C1NK 4KN7C 1B1ZA 5CV5A 1BOSA 1WTRA 2K03A 2E75C 2AUJD 3A8KE 4KMUC 1WTPA 2E2HB 2OXPA 1Z6HA 1ENFA 2EZVA 1PRTB 1EFID 1V8QA 4BBRB 4H44C 2LS01 1O78A 3KUPA 3FEWX 1SYBA 2H1EA 3M4OB 3SR1A 5FKAC 2IL8A 2VXWA 1BUVT 2PCFB 1S4ZA 2TSSA 2J0TD 3LNNA 3VYSA 2BE5D 2R61A 4MIUA 3VR5A 3J80E 3N52A 1NR4A 2AUKA 1STHA 4ZAIA 4WORA 2F0UA 2K5WA 4BY1B 2NVYB 1XXGA 3GV6A 3ERQA 4DNTB 4C3HB 2K6AA 2XIWA 4HN7A 4AYBB 4HR7B 3EQLC 3A56A 4FXKC 4ZUJA 1VF7A 3TZDA 5EGTA 4LK1C 2M00A 3L3OC 5JAVA 4A3EB 2WKCA 2JEBI 3FVQA 4XYQA 4QF4A 1XWEA 1AP0A 1UAPA 2WP8J 4B9XA 3E0JA 4PMCA 2XSCA 1X3PA 1LT3D 4A3BB 3GD7A 1V1PA 1Q90A 5ELBA 5D65A 3L9AX 2LKVA 2XVSA 1ET9A 3NTHA 2J7ZA 4A3MB 2EYHA 2L11A 1I4XA 1EIGA 1IW7D 3K0YA 4K6LA 4CBVA 4KJNA 1QCBD 4HEDA 2IT1A 1O80A 1TY2A 1PRTC 3CKIB 3MZ5A 2WKDA 1TWHB 1HA6A 2A69D 3SK5A 1PTOD 2B39A 3BDCA 1K8OA 2QILA 1S5CD 3V05A 2RDFA 2E2JB 1ENCA 1U9RA 3BS1A 1IYUA 1H9KA 1AW7A 4XDXA 1RTNA 5CR3A 1G91A 1CHPD 5IIFA 3DEPA 2RQXA 3QOJA 5J1ZA 3TSSA 4K5XA 5I9PA 3H0GB 3UI2A 5DEHA 3J7AV 3SVMA 1HQMC 1V43A 3VR4A 2E76C 5M9OA 1D5MC 5NUCA 3HOZB 5M3MB 1Y1WB 1KNEA 2JA7B 3D4WA 4ULLA 4K8JA 3RZOB 3HP3A 3LX0A 1IL8A 1PFNA 1LV9A 3HEJA 4IUVA 3QG1A 3D6CA 3OIQA 4ABNA 2NTTA 4G7ZC 2RDHA 3HKZB 2PO4A 2F0NA 3D31A 5JPMC 2F0MA 1JC7A 4RGNA 5JEAJ 3F2UA 2BE5C 2E2IB 1STNA 1LTRD 2F0LA 1FD7D 1VMPA 2KCCA 4G57A 1FYCA 4ZK9B 5JEAH 1J8IA 4KJOA 1PMRA 2MPMA 1EY7A 2KECA 3VA5A 2K1BA 4DA2A 2ZXRA 4TSSA 1D1IA 2SNSA 4K6DA 2RSOA 3D4RA 3GTOB 2K28A 2I46A 3OMCA 1UEAB 3HG9A 4EQPA 2D62A 1G6ZA 1A3TA 2BCOA 3NBIA 4MHEA 2EXZA 1G2TA 1EYDA 4OIJA 4X3UA 2E74C 2K32A 3ND9A 5KNCA 3C1EA 1CA5A 1H9MA 5C0XJ 3CRLC 2HDLA 4KY6A 1XYIA 3PO3B 2F4IA 2FFKB 4ZRZA 4HTHA 2BOSA 1ET6A 5C3XA 2L5TA 2NWGA 1Y8PB 1IW7C 3BDOA 4F7XA 1HPCA 4EGVA 1LTGD 1SMYD 2EYOA 3RUZA 5ISRA 5D3IB 4CKEA 5DM63 5K5PA 4NW2A 2L12A 5EQ0A 3OSOA 4DF7A 5KEEA 1B9NA 1CK1A 3GTQB 2VUMB 1G291 2A69C 1LACA 1PTOC 4IFDG 5CV9A 2PMZB 2NN6I 4LJZC 3FDTA 4CJ2C 2BDOA 1TS4A 3MEHA 4RWSC 3OIPA 3P7JA 1SXTA 2F0IA 1VDZA 3VR6A 2F0DA 1JB3A 2A6HD 2QDBA 3RD4A 1KLUD 4V0BA 2YU9B 3Q24A 4QUFA 2DNEA 3J7AF 4YIJA 3Q0AA 1SE2A 2IX3A 5KYLA 2Q8TA 2EY6A 4DAVA 3ITPA 3H6MA 2EPBA 1V1PB 1PXUA 3QOLA 3TN2A 1F2LA 1OXUA 1BNZA 5F2DA 1PTOH 4IUTA 1AN8A 4IALA 1M4VA 4H13C 5C5LA 2ZT9C 1A2TA 2F3WA 3R3OA 5I6YA 4IURA 1F9RA 2KQ3A 3A8IE 2JYOA 4XQQA 2D9UA 1PFMA 2F0HA 1D2BA 4UDUC 1TU2B 4FVMA 1TY0A 3BVZA 2H4OA 1SYEA 2OT2A 2NB0A 3GTLB 1SYFA 1LT6D 3NSWA 1K8MA 4C2MB 1D1KA 1ENAA 1T5XD 2VB3X 1R4QB 4HSVA 3S17B 3MHBA 3OPOA 4L63B 2PPBC 1HHVA 1KDAA 1QG7A 1QILA 4DXFA 3QWNA 4NP5A 1EY8A 2CW0C 2MP1A 1SFOB 1C4QA 2PQEA 1D5ZC 4K5WA 5E4XA 4X3TA 1ZKOA 3S1MB 3K58A 1LT4D 1T5EA 1O7YA 2ID0A 2SEBD 3S2DB 3GTGB 5FK9C 5KNDA 3PMFA 3A7LA 1EY5A 2TMPA 1SSOA 1HTLD 3KLSX 4HCSA 1HCZA 2O4XA 3I8ZA 2HCIA 4XTCS 3NUCA 1TR5A 4K2KA 3K57A 5C4JB 3DEOA 3NWTA 1I4RA 2KCNA 1MBYA 3MFGA 2VNUD 4V190 1FNVA 4CJ1B 1EU4A 4XQJA 2EDGA 2D2CC 2K01A 2EOTA 4C3JG 1BBXC 1HA5A 2F0VA 3FRPB 5ELFA 3A7AB 1BDOA 3TZUA 1PFBA 3T4AC 4UAIA 1F9QA 4WJWA 1EQTA 1I50B 2F0KA 3SHLA 1PZKD 3I72A 3Q23A 5EBDA 3DM1A 5LHY1 3DXJC 2EJFC 1STAA 1GHJA 3BYTB 1TT2A 1EY4A 2A6HC 4FP5D 2XNAC 1AFPA 3CHBD 1SNPA 3K5NA 4M8AA 3GQBA 1G2SA 3W2DA 5BN4A 1CQVA 4CHTB 1F9PA 4R9WA 2LFNA 3GTKB 1KNAA 4RHSA 1Y8NB 4DGZA 1V1OA 2IW3A 1IHZA 2I07B 1SNCA 4RKLA 5ELCA 5JOBA 1JORA 2B2WA 1Q8IA 5C0XG 3GTMB 3I91A 1I3QB 5IGEA 3WOFA 5D14A 1JE4A 1I6VC 2L4NA 1UNSA 2EYJA 1SYCA 5I6WA 2A73B 1CZWA 1CI3M 4C3JB 3Q6SA 1SNMA 2A74C 4NMZA 1E0BA 3I4LA 4LMQD 1GUTA 5DM73 2RA4A 1BO0A 1I4PA 1DCZA 4XT1B 3C2PA 1S5BD 3DMUA 1PZID 4IUUA 2EYFA 1WTQA 3SK4A 4MN3A 1R4PB 3C1FA 1A6XA 2JA6B 3HOYB 1CT1D 1QNUA 1Q12A 4ZUIA 1L0XB 4KHZA 2JE6I 1JOQA 1RTOA 2PZTA 2HUGA 3ND8A 3O13A 2XN9C 2BA1A 3NWSA 4BWGB 3H3VC 4X3KA 3URYA 3HOWB 1DOKA 2RBMA 2EYMA 1EZ6A 4KY7A 5FO9B 1LT5D 3EVQA 1E2VA 4KKUA 4G7HC 1DOLA 4Q5VA 1RJTA 1STEA 1LO5D 2QEJC 3FKIB 3HZXA 2EYPA 3M3YB 4KD3A 3HOUB 3OMGA 2QF7A 1TKWB 4IN3A 3GTPB 2NVTB 2R92B 4K5VA 5M5WB 2ZXPA 1B53A 3PV0A 4QMGA 3JAML 2NN6H 1A3UA 2CVRA 2EVBA 3WOEA 1WVLA 4FNFA 3FPUB 3FMCA 4FF2A 4OL7A 1ZYRD 2F0EA 1HXYD 5C3WA 5FO7B 3MXUA 3MC0B 3SEBA 2B2TA 1HRJA 2JSOA 4C3IG 2SDFA 3BVMA 3MXPA 1EY9A 1TQOA 2FMMA 4KN4C 4FF1A 1YNJC 3PUVA 1MGSA 1TS2A 1U4MA 3NPPA 3GO5A 5I4DA 5KNBA 4BS9A 4QUCA 3TP7A 1A2UA 3G6JB 2C9OA 1FNWA 1D6EC 2EY5A 1UUPA 4QB4A 2JA8B 1EY0A 4H0LC 3NP8A 4A3GB 4KK7A 4IFDI 1E2WA 5E1FA 4FF3A 3TP8A 2WACA 1C8CA 2IJ0A 5CV7A 4A93B 5K36H 4OO1G 5HURA 2CW0D 3G7LA 3SK6A 3P20A 2O5JC 1DONA 3J7YW 2NVQB 3ZYYX 1JWMD 2B2YA 3P1HA 4R8NA 4P2CB 1B2TA 3QJYA 1LTAD 4N9TA 1ICWA 2B8FA 4H7BA 4J6HA 2QCPX 5ELEA 1F9SA 3S1QB 1H9SB 3S16B 1TIID 3VYTA 1VMCA 2B2VA 3CQZB 2PW5A 2PW7A 5M5YB 1DYQA 3P75A 4RFBA 1X32A 4CGYB 1RKNA 4JK1C 5A35A 4KI0A 1WD1A 2GA4B 2FJ2A 2XWJB 1SJHD 5C6AA 1SEBD 2L9HA 2KJXA 2EE1A 2A5HA 3T53B 4RH6A 3RMHA 2JXMB 2NTSA 5C4ZA 1AEXA 1QJOA 3M7NA 5EPLA 1DZ1A 4RKBA 2BA0A 1FGBD 2M9VA 1QB5D 1S5DD 1GJXA 4RGMA 2WIIB 4CKCA 1I4GA 4RCNA 1ZXTA 5EPKA 5C5MA 3WDNA 5IGDA 1OO9B 1MD2D 1C48A 3ONAB 4HSPA 1RODA 5LL6S 3Q22A 1RHPA 5CBAE 5TSSA 3H91A 4PQXA 2L55A 4XXEA 5J22A 3SXHA 4ZKCB 4BA1I 1X3QA 4FXDA 1B9MA 5J39A 4IQZA 3I70A 4OHJA 3L7ZC 4A3IB 1ML0D 2A68D 3N6RA 4XYOA 1CHQD 1ZYRC 1Y69U 1A3VA 2X6LA 4TKOB 5CC4A 2OF1A 4RGTA 5BN5A 5FLXL 1XTCD 3PUWA 5IGFA 1JICA 3RZDB 2KOLA 4E6IA 2X69A 4ZKBB 2AWOA 1SE3A 5DAUA 3M85A 5IGBA 2KA7A 4ZQ3A 1SNDA 4XT3B 2VB2X 1PZJD 2NZ1D 2KVMA 5IT9L 3MTSA 1EOTA 2K5DA 2B63B 2MGSA 3FPPA 2ZXOA 4O1NA 2AQ2B 1I4HA 5CYUA 4OGQC 2WB1B 4HCEA 1E2ZA 1B44D 3I4NB 2L1BA 4I65A 2HDMA 4DFAA 4PV1C 3LWUA 3HS0C 4IUQA 3TBIB 2MJ8A 3BVGA 1GUNA 5I2YA 3LWEA 1ILPA 3T56B 2B2WC 2RDGA 1W6KA 3VYUA 1II3A 1ESRA 3CRKC 4IUNA 1U4PA 5T1GA 1MI2A 2EJGC 3J81E 1EYAA 1J9OA 4B08A 3VR2A 4L8JA 2JA5B 1Y1VB 3PIP3 3MVVA 3D6WA 1R9TB 1JWSD 5M5XB 1TWGB 1QWYA 3EFXD 3NBHA 4WRDA 5C0XI 3PO2B 3M7GA 4QCLA 2C5CA 3R2IA 1IKMA 3NHHA 5CMDA 1WTWA 2IPKD 4C3HG 2FHTA 2DN8A 3EROA 2Z1CA 4JBWA 2OEOA 2EY1A 2KEEA 3I4MB 4C1NI 3NE5B 5KRUA 1DD2A 2F0JA 2FINB 3X3MA 5JEAG 5T1IA 5M3FB 2HCCA 2EJMA 3S9WA 3S1NB 5BN3A 1H9SA 1SE4A 3PUYA 4OIKA 4RGOS 3D4DA 3JAME 3BG3A 3EA6A 1U4RA 3V2TA 3R2TA 4DNRB 1QOHA 4L6TB 4RHRA 3GV3A 1SNOA 1H9JA 1YNJD 3DHQA 1KDCA 1WTXA 3VR3A 2RVLA 4BBSB 4HMJA 4GZYC 1GOZA 2K5QA 1PLFA 2F0FA 4J1MA 3NTKA 1BCPD 2A6ED 3OWFA 4F87A 4TRDA 3IFTA 1Q3LA 1ZEQX 4QIWB 1AZPA 1SNQA 2A68C 3IKJA 5CGKA 1JQYD 4XQNA 1HUNA 4B9WA 2F0SA 1WD0A 3SK8A 3KF8A 1OXTA 3MWYW 2F03A 2B2UA 2DY7A 3S14B 1HTPA 1STYA 4IFDJ 2J4XA 2Z4IA 3S2HB 2JEAI 1CQFA 2AQ3B 1EEID 3S15B 5C3EB 3DWQA 3KK7A 3BZDB 1ONLA 1BCPF 2EY2A 2B2TC 4N9PA 1TWAB 1EZ8A 4IFDH 1F2ZA 1NCVA 2Z4HA 2F1MA 2Y0SB 1B4OA 2XRQD 2CQAA 3A55A 2E2DC 1HFGA 2IX0A 3K5OA 3GTJB 4A3JB 1PYWD 2R93B 1EU3A 4CJ0B 2RKSA 3PUZA 3J81L 1EL0A 3A8JE 4BA2I 3SE0A 2F0PA 1BCPB 3I73A 3DWPA 2F0WA 3AB9A 3OOCA 3SDZA 1LTSD 3TP5A 1I4QA 1CA6A 5E4WC 1OXVA 5EBCA 4M1UB 3K59A 4IUPA 3IAYA 3BDLA 3K7AB 1LABA 2WV6D 1F2MA 1XX8A 3TP6A 4G7OC 2N88A 1FNUA 3H94A 1GHKA 1VF5C 4FO2A 3D3RA 2ENBA 3R8BA 1EYCA 1MSGA 3OHXC 1JWUD 2B2YC 2L0CA 2NVXB 1LTID 4K14A 1KTKA 4RAUC 1KDBA 4RA8A 4OO1I 4ME5A 4KTAA 3HOVB 1GUOA 1WTOA 3A54A 5JJZA 1RDPD 3IL8A 2LY7A 2K33A 3E5SA 5D3DA 4CKBA 5A2QL 2B2VC 4PNYA 5HGTA 3T16A 1HFNA 1BQQT 1YNND 5C4HA 4U68A 1I6HB 5E3FA 4A3KB 2WAQB 1D5XC 1K83B 3K6OA 3NQIA 2O5IC 1DOMA 5FOBB 1G8ZD 2R7ZB 1S5FD 1SBBB 3I90A 2NUCA 4PMWA 2AWNA 1IYVA 4ILWA 5CV8A 2K7VA 4DN4M 2XRSD 5EJWA 3KBGA 3U9SA 3T13A 1IKLA 1RCVD 4EVOA 3KLSA 1Q1EA 4FYDA 1PTOF 5IGGA 1SJED 4FF4A 1Y8OB 2V4DA 1RD9D 1SAPA 3MAQA 4F8MA 1KLGD 1BCPC 2A6EC 3TMEA 4DAYA 1BF4A 2F0OA 5I9OA 2WINB 3J80L 3DUZA 5FLXE 1DJRD 1B3AA 5CORA 5CV4A 4HMIA 1GUGA 3OWEB 1BR9A 2R3ZA 4F88A 1PTOB 5IOCA 1QE6A 4Z9CB 3MXNA 5EKLA 2YYZA 2FMCA 2ICEC 5I2XA 5LL6X 2MHVA 2G9HD 3EJIA 3HRZC 1WCMB 2F0QA 5G3LD 5DNFA 2F0TA 5IT9E 1F2YA 4IZ8A 2PZUA 1LTTD 3NQTA 2B8GA 3MFYA 4S3SA 4EQOA 3VA7A 1TWCB 3U9OA 3W3AA 1NSNS 3QO2A 1HQRD 4K2LA 4XIGS 1SDFA 5FO8B 1EQVA 3GP7A 5IGCA 2RSNA 3HOXB 1HUMA 2F0GA 4O42A 3H09A 1TWFB 3C3LA 3CU7A 5G3LF 4C3IB 3MXGA 1Z7TA 3V96A 3MA2B 2ICIA 4R8IA 2M2LA 4J8QA 4KY5A 1W6JA 2Q8RE 4WFN3 2NYZD 2KEDA 4ZLTF 2CHBD 1NUCA 2JP1A 2K05A 4HAEA 2N55A 1STGA 4FXGC 1B50A 5C0XH 5EPJA 1DXMA 1LTBD 2DNCA 3PUXA 3D8GA 2IX1A 4A3DB 1SYDA 2AQ1B 1EWHA 1GUWA 3S1RB 5JVG3 3I3CA 2LMCB 1JOKA 4EQNA 1DM0B 2X6GA 1NAPA 3HGBA 4Q0FA 2PNRC 2Z8LA 1H9RA 4NKLA 1EEFD 4KKSA 1YNNC 4X3SA 1A15A 5KYIA 4ID6A 3BYYB 5JPNC 5EKIA 3K5MA 4RCOA 1S5ED 4PMBA 2QKIC 1NR2A 4KD4A 3E6ZX 1O7ZA 1O7LA 1BXTA 4DK1A 3KBXA 3QB3A 3C46A 1ESFA 1CZGA 5ELDA 1M8AA 1EY6A 1VCIA 1TS5A 5EKKA 4K8IA 3VYRA 3NTIA 3NK9A 5CV6A 2EYLA 5JVH3 1OXXK 4DU9A 4NDXA 3QIAA 5AFWA 4KKTA 1LLRD 1QNKA 1KABA 1GXDC 1U4LA 4KV6A 1FR3A 3OW7A 2HQEA 2PYKA 3PIO3 2O2LD 2R6GA 2D5DA 3NXWA 4KHVA 4C56C 4BY7B 2BDNA 1L0YB 2NN6G 1F77A 2Q8IB 1WTVA 3TDQA 4ODGA 2DY8A 2G9DA 3K5LA 2NBFA 1OXSC 2K04A 2XWBB 2B2UC 1AZQA 2KUMA 1SYGA 5CBEE 1RF2D 1ILQA 1JR0D 1MSHA 1CTMA 1TVXA 1PDQA 1JOOA 1CFMA 2IWHA 3KLRA 5IODA 4U673 4DAPA 1TS3A 5C44B 4TQUS 3DWAA 1PRTD 4ZYSA 1Z47A 5KIXA 4I7ZC 3AMUA 2PZWA 3AU7A 5KGUA 1EIHA 1GUSA 1STBA 2F3VA 3X3NA 3IFDA 2SOBA 1KAAA 3M4YA 4G4KA 3R93A 1JCKB 2KHSA 1Q1BA 5K36G 4LAAA 1SMYC 4A3FB 3RLFA 4DXGA 4OO1H 5C4XB 2MUYA 5COYA 1PRTF 2SNMA 3T51B 1CM9A 5A2QE 4DK0A 4Y7NB 1EWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJ1 B;  1XYI A;  2B2Y A;  2FFK B;  1KNE A;  4IUR A;  2BDN A;  1B53 A;  1F9R A;  1WTR A;  1MSG A;  2K01 A;  1GUW A;  1HUN A;  5D65 A;  2EOT A;  3HP3 A;  1WD0 A;  2B2Y C;  3D6W A;  1WTV A;  1ML0 D;  3Q6S A;  1IL8 A;  2K03 A;  1B2T A;  3I3C A;  2JYO A;  1PFN A;  1ICW A;  5DNF A;  1E0B A;  2D9U A;  1PFM A;  1LV9 A;  2CVR A;  3MWY W;  4LMQ D;  2NWG A;  4RAU C;  1WVL A;  1WTP A;  3FPU B;  4IUV A;  2X6L A;  4RA8 A;  1F9S A;  2B2U A;  2DY8 A;  2J7Z A;  2RA4 A;  2DY7 A;  2X6G A;  1WTO A;  1BO0 A;  1NAP A;  2L11 A;  5JJZ A;  4XT1 B;  2K04 A;  1VMC A;  1PFB A;  3IL8 A;  2B2U C;  3KUP A;  4UAI A;  2B2V A;  4IUU A;  1AZQ A;  1F9Q A;  1EIG A;  2KUM A;  5CMD A;  1WTW A;  1WTQ A;  1IKM A;  1EQT A;  4NW2 A;  4MN3 A;  2FHT A;  2L12 A;  5EQ0 A;  5CBE E;  2B2T A;  1HRJ A;  1ILQ A;  3F2U A;  2SDF A;  2B2V C;  2H1E A;  1JIC A;  1A15 A;  1MSH A;  1X32 A;  4HED A;  4X3S A;  1TVX A;  1O80 A;  1PDQ A;  3QO2 A;  2KOL A;  2B2T C;  2FMM A;  2IL8 A;  2VXW A;  3DM1 A;  4HSV A;  4ZKB B;  2X69 A;  1SDF A;  1WD1 A;  1HFN A;  1MGS A;  2FJ2 A;  2KEE A;  4U68 A;  1NCV A;  1HHV A;  1S4Z A;  1RTO A;  1VMP A;  2HUG A;  2RSN A;  5EKI A;  3FDT A;  1HUM A;  1B4O A;  4CJ2 C;  1QG7 A;  1U4M A;  2FIN B;  3N52 A;  4O42 A;  1HFG A;  1NR4 A;  2L9H A;  4ZAI A;  1HA6 A;  2EE1 A;  4RWS C;  4ZK9 B;  5T1I A;  1J8I A;  3P7J A;  1NR2 A;  1DOM A;  2MP1 A;  2HCC A;  3GV6 A;  4QUC A;  4XT3 B;  3I90 A;  1O7Z A;  2NZ1 D;  2KVM A;  4X3K A;  5EPL A;  4CJ0 B;  1DOK A;  1G2S A;  3KBX A;  1EOT A;  3MTS A;  4DN4 M;  1DZ1 A;  2XIW A;  5EJW A;  5E4X A;  2MGS A;  2MPM A;  1F9P A;  4X3T A;  1IKL A;  4OIK A;  4R9W A;  2KEC A;  1EL0 A;  1EIH A;  2K1B A;  1KNA A;  1O7Y A;  3TZD A;  4R8I A;  3IFD A;  4QUF A;  4XDX A;  1M8A A;  1U4R A;  2M2L A;  2RSO A;  2Q8R E;  1ZXT A;  1DOL A;  1RTN A;  2KED A;  2L1B A;  2HDM A;  2NYZ D;  3GV3 A;  1G91 A;  2K28 A;  3R93 A;  4ZLT F;  5EPK A;  1C8C A;  4IUQ A;  1RJT A;  1G6Z A;  1SAP A;  2MJ8 A;  2Q8T A;  1SSO A;  2RVL A;  2JP1 A;  2B2W A;  2K05 A;  3ONA B;  1ROD A;  2N55 A;  3DEP A;  4HAE A;  5AFW A;  1WTX A;  4HCS A;  4MHE A;  3LWE A;  1QNK A;  1RHP A;  1BF4 A;  1ILP A;  1G2T A;  1CA6 A;  1AP0 A;  1U4L A;  3I8Z A;  3I91 A;  2HCI A;  4OIJ A;  2EPB A;  5E4W C;  1B50 A;  5CBA E;  2B2W C;  5EPJ A;  3H91 A;  4IUP A;  4X3U A;  3UI2 A;  1B3A A;  3G7L A;  1PLF A;  5COR A;  1X3P A;  3SVM A;  1ESR A;  1BBX C;  3DEO A;  5COY A;  5D14 A;  1XX8 A;  3TN2 A;  1DON A;  1Q3L A;  1CM9 A;  2N88 A;  1CA5 A;  1JE4 A;  1U4P A;  5T1G A;  4ZKC B;  1F2L A;  1X3Q A;  2L4N A;  1MI2 A;  2R3Z A;  1BNZ A;  2HDL A;  4IUT A;  1J9O A;  1QE6 A;  1AZP A; 
#chains in the Genus database with same CATH topology
 4C1N K;  2P5Z X;  2UUB Q;  4KN7 C;  1IBK L;  1B1Z A;  5CV5 A;  1BOS A;  3K8A A;  1SRU A;  1WTR A;  4DR5 Q;  1QVC A;  2JA6 G;  1T9H A;  3HOY G;  4A3I H;  3QR8 A;  2K03 A;  2E75 C;  4JI0 L;  2AUJ D;  3A8K E;  4KMU C;  1WTP A;  2E2H B;  4B3S Q;  2OXP A;  3T1Y Q;  4A3M G;  1Z6H A;  1ENF A;  2VQE L;  2EZV A;  1PRT B;  5HY6 A;  1EFI D;  1FGU A;  1V8Q A;  4BBR B;  4H44 C;  2LS0 1;  1O78 A;  3KUP A;  1E1O A;  3FEW X;  3HOW G;  4DR3 L;  3G48 A;  1QVF A;  4BXX H;  1SYB A;  4JI8 L;  2H1E A;  3M4O B;  4X6A H;  1VQ8 A;  3SR1 A;  3FHW A;  5FKA C;  2IL8 A;  2VXW A;  2UXC Q;  1BUV T;  2PCF B;  1S4Z A;  2TSS A;  2J0T D;  3LNN A;  3VYS A;  2BE5 D;  2R61 A;  4MIU A;  3VR5 A;  3J80 E;  3N52 A;  1NR4 A;  2AUK A;  1STH A;  4WOR A;  4ZAI A;  2F0U A;  2K5W A;  4BY1 B;  4JI1 L;  2NVY B;  4OON A;  1XXG A;  3GV6 A;  4GLX A;  1SN8 A;  3ERQ A;  4B3M Q;  4DNT B;  2L15 A;  4C3H B;  1L1O A;  2K6A A;  2XIW A;  4HN7 A;  2GVA A;  4HR7 B;  4AYB B;  3EQL C;  1XPR A;  2B63 H;  4DR4 L;  3HOU G;  3A56 A;  4FXK C;  4ZUJ A;  3KYH C;  1VF7 A;  3KF6 B;  3TZD A;  4GOP C;  5EGT A;  4LK1 C;  2M00 A;  4LF6 L;  3CCJ A;  3L3O C;  2R92 G;  5JAV A;  4A3E B;  2WKC A;  1SE8 A;  2UUC L;  2JEB I;  3FVQ A;  4P73 A;  4XYQ A;  2D0O A;  4JVZ A;  3TEH B;  5IE8 A;  4QF4 A;  1XWE A;  2VW9 A;  4DR2 L;  3RLO A;  3BZK A;  1AP0 A;  1UAP A;  2WP8 J;  4DK6 C;  5LMN L;  4B9X A;  3E0J A;  1LTL A;  4PMC A;  3CC7 A;  2XSC A;  1X3P A;  1LT3 D;  4A3B B;  4GNX C;  3GD7 A;  1V1P A;  1Q90 A;  1B3Q A;  5M3M G;  1Y1W G;  5ELB A;  2JA5 H;  1GVP A;  1Y1V H;  5D65 A;  4X62 Q;  1WYD A;  1R9T H;  5M5X H;  3L9A X;  2LKV A;  2XVS A;  3T1H Q;  1ET9 A;  3NTH A;  5C44 H;  2UXD L;  2J7Z A;  4A3M B;  3PO2 H;  4IJL A;  1P8L A;  3LGJ A;  4DAM A;  2EYH A;  2L11 A;  1E1T A;  1I4X A;  1EIG A;  1IW7 D;  3K0Y A;  4K6L A;  3A0J A;  4CBV A;  4KJN A;  1QCB D;  4HED A;  1Q81 C;  5AJ3 L;  2IT1 A;  1O80 A;  4QGU A;  1KRS A;  1TY2 A;  1FVI A;  1PRT C;  2JA8 G;  3CKI B;  3PF5 A;  3MZ5 A;  2WKD A;  4A3G G;  1TWH B;  1VQM A;  1HA6 A;  2A69 D;  3SK5 A;  5LMU L;  1PTO D;  1C9O A;  1KRT A;  2B39 A;  3BDC A;  4A93 G;  1K8O A;  1YVC A;  2QIL A;  1S5C D;  3V05 A;  4PZ7 A;  4A3F H;  2RDF A;  2E2J B;  1ENC A;  5C4X H;  3BZC A;  1QZG A;  1U9R A;  1EQR A;  2OCE A;  3BS1 A;  4KHP L;  3OW2 A;  1IYU A;  1H9K A;  1AW7 A;  4DV0 Q;  4XDX A;  4Y7N H;  4IPC A;  3KOJ A;  1MIU A;  1RTN A;  4JPB W;  1E3P A;  1UE5 A;  3NEL A;  5CR3 A;  1G91 A;  1CHP D;  5IIF A;  3UDI A;  3DEP A;  2RQX A;  3QOJ A;  1IL2 A;  4BBS H;  2YTV A;  5J1Z A;  4LFB L;  1VQG A;  3TSS A;  4K5X A;  2PMZ E;  5I9P A;  1IBM Q;  4A76 A;  3H0G B;  3UI2 A;  5DEH A;  3J7A V;  4ALP A;  3SVM A;  2CWP A;  1HQM C;  5IYC H;  5IP9 G;  1V43 A;  2HIV A;  4L5T A;  3RR5 A;  3VR4 A;  4X66 Q;  1EWI A;  2E76 C;  4JV5 L;  5M9O A;  1D5M C;  5NUC A;  3RLN A;  3EBE A;  4P74 A;  3HOZ B;  3K0X A;  3CW2 C;  5M3M B;  1P16 A;  1Y1W B;  1KNE A;  2JA7 B;  3E3X A;  3D4W A;  4IOA A;  4ULL A;  1VQP A;  4K8J A;  1E22 A;  5IYB G;  3RZO B;  3HP3 A;  3M4O H;  2EQS A;  3LX0 A;  1IL8 A;  2R7D A;  2I0Q A;  1PFN A;  4EX5 A;  1LV9 A;  3HEJ A;  4IUV A;  1PH9 A;  1XMQ Q;  3QG1 A;  3D6C A;  4EQ5 A;  3OIQ A;  5JJI A;  4ABN A;  2NTT A;  1FL0 A;  4G7Z C;  2RDH A;  3HKZ B;  2PO4 A;  2F0N A;  1LYL A;  2NVY H;  3D31 A;  2ZM6 L;  5JPM C;  3S2H H;  2F0M A;  4GN5 A;  1JC7 A;  4RGN A;  3J81 j;  4C3H H;  5JEA J;  3F2U A;  2BE5 C;  5C3E H;  2E2I B;  1STN A;  5E7N A;  1LTR D;  2F0L A;  1Q86 C;  1FD7 D;  1VMP A;  4HJ7 A;  2KCC A;  4A3E H;  4G57 A;  1GM5 A;  4IJH A;  1FYC A;  3GTJ H;  4LUO A;  4ZK9 B;  5JEA H;  1J8I A;  3SGI A;  2OTJ A;  2ZJP A;  3RN2 A;  4KJO A;  1PMR A;  2MPM A;  2PI2 A;  1EY7 A;  2E8G A;  2KEC A;  3VA5 A;  2K1B A;  4DA2 A;  2ZXR A;  4TSS A;  4LF8 Q;  1D1I A;  2VZA A;  2ZTD A;  3I56 A;  2B29 A;  2SNS A;  4K6D A;  4A3B H;  1HR0 Q;  2RSO A;  3D4R A;  4R4Q A;  4ME3 A;  3GTO B;  2K28 A;  3CP0 A;  2I46 A;  3OMC A;  1UEA B;  3HG9 A;  4EQP A;  2D62 A;  1G6Z A;  3J7A 5;  4A3I G;  1A3T A;  2WB1 E;  2BCO A;  3NBI A;  1ASZ A;  4MHE A;  5BR8 L;  2EXZ A;  1G2T A;  1EYD A;  4OIJ A;  2Q2I A;  4X3U A;  2E74 C;  3CMA A;  2LSS A;  1CKN B;  2K32 A;  3ND9 A;  4TVA B;  5KNC A;  3C1E A;  1CA5 A;  1H9M A;  4LW1 A;  5C0X J;  3CRL C;  4DV5 L;  2DGY A;  2HDL A;  1JB7 A;  3F2C A;  4KY6 A;  1XYI A;  3PO3 B;  2F4I A;  2FFK B;  5FJ8 H;  4POF A;  4LF4 L;  1CSP A;  2ZTC A;  4ZRZ A;  4HTH A;  2BOS A;  1IBK Q;  1ET6 A;  5C3X A;  4JI2 L;  2L5T A;  2NWG A;  1Y8P B;  1IW7 C;  2I5L X;  3BDO A;  4F7X A;  3Q8D A;  1HPC A;  3J80 i;  4EGV A;  1LTG D;  1SMY D;  4UY8 C;  4JI0 Q;  5DLQ E;  1YHB A;  3E9I A;  2EYO A;  3RUZ A;  5ISR A;  3K80 C;  5D3I B;  4CKE A;  1XJV A;  5DM6 3;  5K5P A;  2VQE Q;  4NW2 A;  4HID A;  2L12 A;  5EQ0 A;  4LF5 L;  3OSO A;  4DF7 A;  5KEE A;  1B9N A;  1CK1 A;  3GTQ B;  2WB1 G;  1EOV A;  4DR3 Q;  2VUM B;  4IOC A;  1G29 1;  2A69 C;  4HJ5 A;  3CD6 A;  1LAC A;  1PTO C;  3I7F A;  4IFD G;  5CV9 A;  4JI8 Q;  3I4N G;  2PMZ B;  2V1C C;  2NN6 I;  3H3V I;  4LJZ C;  4J15 A;  3FDT A;  4CJ2 C;  2BDO A;  1S40 A;  1TS4 A;  1S3O A;  4WJ3 M;  1L1O B;  3MEH A;  4RWS C;  1K83 H;  3OIP A;  3P7J A;  2R7Z H;  1SXT A;  2F0I A;  1VDZ A;  3VR6 A;  1KXL A;  4JI6 Q;  2F0D A;  1JB3 A;  2A6H D;  4JI1 Q;  4DV4 L;  2QDB A;  3RD4 A;  3H0G H;  1KLU D;  4V0B A;  2YU9 B;  2ZJQ A;  4DR4 Q;  3Q24 A;  4QUF A;  2DNE A;  4JBJ A;  4JOI A;  1N36 L;  3J7A F;  4YIJ A;  2K4K A;  3Q0A A;  3HOZ H;  1SE2 A;  4H02 A;  1O7I A;  2IX3 A;  5KYL A;  2JA7 H;  4UP8 A;  4LF6 Q;  2Q8T A;  1KIX A;  2EY6 A;  3RZO H;  4DAV A;  3ITP A;  2UUC Q;  3H6M A;  4CDF C;  2EPB A;  1V1P B;  4LF7 Q;  5GRO A;  1PXU A;  1B7Y B;  4HIM A;  3QOL A;  3TN2 A;  3PO2 G;  1F2L A;  5LMN Q;  1OXU A;  1BNZ A;  5F2D A;  1PTO H;  1AN8 A;  4IUT A;  1VQN A;  2FXQ A;  4IAL A;  1M4V A;  4H13 C;  5C5L A;  2ZT9 C;  1A2T A;  2F3W A;  3R3O A;  3TRE A;  5I6Y A;  4IUR A;  1M90 C;  1F9R A;  2KQ3 A;  3A8I E;  2E2I H;  2JYO A;  4XQQ A;  2UUA L;  2D9U A;  5IP7 H;  1PFM A;  2F0H A;  3I4M G;  1D2B A;  4UDU C;  2Z6K A;  1TU2 B;  3PIP A;  5M3F G;  1HNX L;  4FVM A;  1TY0 A;  3BVZ A;  2H4O A;  2NZO A;  4DUY L;  1SYE A;  4B3T L;  2OT2 A;  4N8X 1;  2UXD Q;  2NB0 A;  3GTL B;  1SYF A;  1LT6 D;  3NSW A;  1N33 L;  1K8M A;  4C2M B;  1D1K A;  4X64 L;  1ENA A;  1T5X D;  2XGT A;  2VB3 X;  1R4Q B;  4HSV A;  3S17 B;  3U58 A;  3MHB A;  3OPO A;  4L63 B;  2PPB C;  4JI5 Q;  1HHV A;  1KDA A;  4YCW A;  5AJ3 Q;  1QG7 A;  1QIL A;  4DXF A;  3GTO H;  3BU2 A;  3QWN A;  4NP5 A;  4NB3 A;  1TWF H;  1EY8 A;  2Q2U A;  2CW0 C;  2MP1 A;  4LFC L;  1SFO B;  4BBS G;  4A3C H;  4OWX B;  1C4Q A;  2PQE A;  3H15 A;  1D5Z C;  3TS2 A;  5LMU Q;  4K5W A;  3PQI A;  5E4X A;  4X3T A;  4OX9 L;  4UP7 A;  1ZKO A;  4IPH A;  2Y0S E;  3S1M B;  3K58 A;  2E5L Q;  1LT4 D;  1T5E A;  1L1O C;  1O7Y A;  2ID0 A;  2SEB D;  2CFM A;  3GTG B;  3S2D B;  5FK9 C;  5KND A;  2UU9 L;  4LWC A;  3PMF A;  5HGQ A;  2RCN A;  3A7L A;  1EY5 A;  2D0P A;  3ZJY C;  3KJP A;  2TMP A;  4KHP Q;  2K5V A;  1B70 B;  1SSO A;  1HTL D;  2AKW B;  3KLS X;  4HCS A;  1HCZ A;  1KHI A;  2O4X A;  5IYD G;  3I8Z A;  2HCI A;  4XTC S;  3NUC A;  1TR5 A;  4GKK L;  4K2K A;  4R4I A;  4YWK A;  3K57 A;  4LFB Q;  5C4J B;  3DEO A;  1GD7 A;  3NWT A;  1I4R A;  1YJ9 A;  3CAM A;  2KCN A;  2RHQ B;  1MBY A;  3MFG A;  5H1S E;  1PV4 A;  2VNU D;  4FDB A;  4V19 0;  1FNV A;  4CJ1 B;  1EU4 A;  4A3D H;  4XQJ A;  2EDG A;  4LUZ A;  2CCZ A;  2D2C C;  2K01 A;  4L5S A;  2Z9H A;  2EOT A;  4C3J G;  4JYA L;  3GTQ H;  2VUM H;  1VQ5 A;  1BBX C;  4GS3 A;  1D8L A;  1HA5 A;  2Y0S G;  2F0V A;  1PH1 A;  4OWW B;  3FRP B;  1UEB A;  5ELF A;  3A7A B;  2VY3 A;  1BDO A;  3TZU A;  4A3J G;  1PFB A;  3T4A C;  2R93 G;  4UAI A;  1CKN A;  1Q82 C;  1OTC A;  1F9Q A;  3AYH B;  4WJW A;  1EQT A;  1I50 B;  1NE3 A;  4P75 A;  1K3R A;  2F0K A;  2ZM6 Q;  2PNH A;  3SHL A;  1PZK D;  3I72 A;  3Q23 A;  5EBD A;  1HH2 P;  3DM1 A;  1SLJ A;  5LHY 1;  2ZJR A;  3DXJ C;  2EJF C;  4KLK A;  1STA A;  1CSQ A;  1GHJ A;  3BYT B;  1TT2 A;  3W1B A;  1EY4 A;  2A6H C;  4FP5 D;  1IYJ B;  2XNA C;  1AFP A;  1M1K C;  3CHB D;  1SNP A;  3K5N A;  1K8A C;  4M8A A;  3GQB A;  1G2S A;  3W2D A;  5BN4 A;  4DR6 L;  1CQV A;  4CHT B;  1F9P A;  1MKH A;  2HT1 A;  4R9W A;  2LFN A;  3GTK B;  2WAQ E;  1KNA A;  4QJF A;  4RHS A;  1Y8N B;  2F4V L;  4DGZ A;  4JI3 L;  1Q46 A;  1V1O A;  2IW3 A;  1K28 A;  1IHZ A;  2I07 B;  1SNC A;  1IBL L;  4RKL A;  5ELC A;  2GN5 A;  5JOB A;  4HJ9 A;  5FJ8 G;  1JOR A;  1WOC A;  2B2W A;  2OQ0 A;  3U50 C;  3FKI G;  1Q8I A;  5C0X G;  3GTM B;  3I91 A;  1I3Q B;  5IGE A;  3WOF A;  2N3S A;  5D14 A;  3HOV G;  2RCF A;  5BR8 Q;  4R4C A;  4YCU A;  1JE4 A;  1I6V C;  2L4N A;  1N34 L;  4UHV A;  1UNS A;  2EYJ A;  1BVS A;  1SYC A;  5I6W A;  2A73 B;  3GTL H;  4R4O A;  4BY7 H;  3UDF A;  4DV5 Q;  4HJA A;  1KD1 C;  1CZW A;  1ICF B;  5FLM G;  4C2M H;  4JI7 L;  1CI3 M;  4C3J B;  3Q6S A;  1SNM A;  2A74 C;  4NMZ A;  1E0B A;  3S17 H;  3I4L A;  4LF4 Q;  4LMQ D;  4JI4 L;  1GUT A;  5DM7 3;  4A3K G;  2RHS B;  2WAQ G;  2RA4 A;  1BO0 A;  1I4P A;  1DCZ A;  2K5N A;  2YV5 A;  2YTX A;  4JI2 Q;  1BKB A;  2R7Z G;  4XT1 B;  3C2P A;  1SR3 A;  1S5B D;  3DMU A;  1PZI D;  4IUU A;  2EYF A;  1SFO H;  1WTQ A;  3SK4 A;  4MN3 A;  2MO0 A;  1R4P B;  3C1F A;  1J5E L;  4HIK A;  4UP9 A;  1A6X A;  4CDC C;  2JA6 B;  3HOY B;  1CT1 D;  1QNU A;  1Q12 A;  3STB D;  3WWV A;  3GTG H;  4ZUI A;  3S2D H;  1HR0 W;  1MJE A;  1L0X B;  4KHZ A;  2JE6 I;  1JOQ A;  1RTO A;  2PZT A;  2HUG A;  3ND8 A;  3O13 A;  3ULJ A;  3CXC A;  2XN9 C;  1EIF A;  4DK3 C;  2BA1 A;  1X3G A;  3CCL A;  1YBY A;  3NWS A;  4BWG B;  3H3V C;  4X3K A;  3URY A;  3HOW B;  1DOK A;  1Q8K A;  2RBM A;  2EYM A;  1EZ6 A;  1DGS A;  3RNU A;  4KY7 A;  5FO9 B;  5IWA L;  3G71 A;  5C4J H;  1LT5 D;  4GLA C;  3EVQ A;  1VQ7 A;  1E2V A;  4DV4 Q;  4KKU A;  4G7H C;  1DOL A;  3D0F A;  4Q5V A;  4IO9 A;  1RJT A;  1STE A;  1GO3 E;  3UDX A;  1G6P A;  1Z9F A;  1LO5 D;  1AE3 A;  1N36 Q;  1MHW C;  1WCM G;  2QEJ C;  1PA6 A;  3FKI B;  2N49 A;  3HZX A;  2EYP A;  3K7U C;  4KD3 A;  3M3Y B;  3HOU B;  4A3L H;  3OMG A;  4APV A;  2QF7 A;  1X6O A;  2HD3 A;  3CCQ A;  1TKW B;  4DV2 L;  4IN3 A;  3GTP B;  2NVT B;  2R7F A;  1S72 A;  2R92 B;  5IY0 A;  4K5V A;  1K73 C;  2A19 A;  5M5W B;  2IY5 B;  4I7A A;  2ZXP A;  1B53 A;  4HJ8 A;  2A8V A;  3PV0 A;  4QMG A;  3JAM L;  3ER0 A;  2NN6 H;  1A3U A;  1VS0 A;  2I5H A;  1PH7 A;  2CVR A;  2EVB A;  3WOE A;  1WVL A;  1XMO Q;  4FNF A;  3FPU B;  3FMC A;  3HOX G;  2E2H H;  4DR7 L;  2MQH A;  2KHJ A;  3M4Q A;  2UUA Q;  4FF2 A;  4OL7 A;  1ZYR D;  4BBR H;  2F0E A;  1HXY D;  5C3W A;  4K0K L;  5FO7 B;  1XNQ L;  3MXU A;  3MC0 B;  5GAH C;  1PVO A;  3HFZ B;  2B2T A;  3SEB A;  1HNX Q;  1HRJ A;  2JSO A;  4C3I G;  2SDF A;  3BVM A;  3MXP A;  1EY9 A;  4DR1 Q;  1TQO A;  3A5U A;  4B3T Q;  3GTK H;  5L37 A;  1N33 Q;  1I94 L;  2FMM A;  4KN4 C;  4FF1 A;  1YNJ C;  3PUV A;  4X64 Q;  1MGS A;  1JE5 A;  3CPW A;  1TS2 A;  1U4M A;  3OYY A;  3NPP A;  1CKO A;  3GO5 A;  3M4P A;  5I4D A;  2DJF C;  5KNB A;  4BY1 H;  4BS9 A;  4QUC A;  3TP7 A;  1A2U A;  2KEN A;  3G6J B;  2LXJ A;  2C9O A;  1FNW A;  1D6E C;  1I3Q H;  3VDY A;  4DV6 Q;  2EY5 A;  1UUP A;  3KFU A;  4QB4 A;  2JA8 B;  5LMN W;  1EY0 A;  1YNX A;  4H0L C;  4DV3 L;  2MFI A;  3G6E A;  3NP8 A;  4OX9 Q;  4A3G B;  1HNW L;  4KK7 A;  4A3D G;  2BH8 A;  4IFD I;  1E2W A;  5E1F A;  3E9H A;  4FF3 A;  1LUZ A;  3TP8 A;  2WAC A;  4JOI C;  1HZA A;  2UU9 Q;  1VQD A;  1C8C A;  2IJ0 A;  5CV7 A;  4A93 B;  5K36 H;  1HZ9 A;  4OO1 G;  5HUR A;  3PF4 A;  5JJK A;  2CW0 D;  3G7L A;  3K81 C;  3SK6 A;  2YTY A;  3P20 A;  1A63 A;  4DUZ L;  2O5J C;  2A1A A;  1DON A;  2KCT A;  3J7Y W;  1N32 L;  1H95 A;  2NVQ B;  4GKK Q;  3ZYY X;  1X9N A;  1BBW A;  1JWM D;  1SRO A;  3AQQ A;  2B2Y A;  3P1H A;  4R8N A;  5EAY A;  4P2C B;  1PH8 A;  1B2T A;  3QJY A;  1LTA D;  2JA6 H;  3HOY H;  4YWL A;  4N9T A;  3UDG A;  4UPA A;  1ICW A;  2B8F A;  4H7B A;  4IPD A;  2VS1 A;  3JAM i;  4J6H A;  2QCP X;  1KAW A;  2KBN A;  5ELE A;  1F9S A;  3S1Q B;  1WFQ A;  1H9S B;  2H5X A;  3S16 B;  4B3M L;  4A3M H;  1TII D;  2K75 A;  3VYT A;  1A62 A;  1XNR L;  1VMC A;  2Z6K C;  1C0A A;  1VQC A;  2B2V A;  3S24 A;  2K5H A;  3CQZ B;  3STB C;  2PW5 A;  4BXX G;  3HOW H;  4P72 A;  4JW0 A;  2GVB A;  2PW7 A;  5M5Y B;  1KL9 A;  1DYQ A;  3P75 A;  4RFB A;  1X32 A;  4CGY B;  4OWT B;  1RKN A;  3ERS X;  4JK1 C;  5A35 A;  4KI0 A;  1WD1 A;  2GA4 B;  2FJ2 A;  2XWJ B;  1SJH D;  5C6A A;  1SEB D;  1TWH H;  1YJW A;  4JBM A;  2L9H A;  2KJX A;  2EE1 A;  2A5H A;  3T53 B;  4RH6 A;  1U5K A;  3RMH A;  5GAG C;  2JXM B;  2NTS A;  1L0W A;  1CUK A;  1WJJ A;  1AEX A;  1QJO A;  5C4Z A;  3CCU A;  3M7N A;  5EPL A;  1WTH A;  2B63 G;  1DZ1 A;  4RKB A;  2BA0 A;  5GQO A;  1FGB D;  1QUQ A;  2E2J H;  2M9V A;  3HOU H;  1QB5 D;  2OWO A;  4DR6 Q;  1S5D D;  1GJX A;  4RGM A;  2WII B;  3ULP A;  4YWM A;  4CKC A;  2NVT H;  1I4G A;  4RCN A;  1ZXT A;  4JG2 A;  2R92 H;  3CCM A;  2QEX A;  5EPK A;  4BY7 G;  5C5M A;  3WDN A;  5IGD A;  4JI3 Q;  1EUJ A;  4PZ8 A;  5M5W H;  1OO9 B;  1MD2 D;  1C48 A;  3ONA B;  4HSP A;  4JC0 A;  1ROD A;  1IBL Q;  2QA4 A;  5LL6 S;  1NBW A;  1VQK A;  2G5D A;  2PQA B;  3Q22 A;  1RHP A;  2AMC B;  5CBA E;  5TSS A;  3KJO A;  3H91 A;  1PYS B;  4PQX A;  2L55 A;  4XXE A;  5J22 A;  3BJU A;  4L5Q A;  3SXH A;  4MTN A;  4ZKC B;  2JN4 A;  4BA1 I;  1X3Q A;  4HIO A;  5J3B A;  4FXD A;  5GAD C;  4OEM B;  1B9M A;  4DV1 L;  5J39 A;  3CCE A;  4IQZ A;  3I70 A;  1KQS A;  1YIT A;  1NTG A;  5M3M H;  4OHJ A;  1Y1W H;  2UXB L;  2JA5 G;  1Y1V G;  3L7Z C;  3PIO A;  3W5O A;  4A3I B;  1ML0 D;  1K9M C;  2A68 D;  3N6R A;  4XYO A;  1CHQ D;  1ZYR C;  1Y69 U;  1A3V A;  1RIP A;  1NJI C;  4JI7 Q;  2X6L A;  5C44 G;  1K0R A;  1HJP A;  4DR2 Q;  4TKO B;  2XTI A;  5CC4 A;  4YY3 L;  1IZ6 A;  4JI4 Q;  2OF1 A;  3PCO B;  4RGT A;  5BN5 A;  5FLX L;  1XTC D;  3PUW A;  5IGF A;  2RF4 A;  1JIC A;  3RZD B;  2KOL A;  1QVG A;  2JA8 H;  4QIW E;  4E6I A;  2X69 A;  4ZKB B;  1J5E Q;  3J81 c;  2AWO A;  4LF9 L;  2K50 A;  4A3G H;  1SE3 A;  5DAU A;  3M85 A;  5IGB A;  2KA7 A;  4ZQ3 A;  1SND A;  2OTL A;  4XT3 B;  5JJL A;  2VB2 X;  1PZJ D;  2NZ1 D;  2KVM A;  5IT9 L;  3MTS A;  1EOT A;  1JT8 A;  4A3F G;  2K5D A;  2B63 B;  2MGS A;  3FPP A;  5C4X G;  2ZXO A;  4LNQ A;  4O1N A;  2N8N A;  2AQ2 B;  1I4H A;  5CYU A;  1UE6 A;  3NEM A;  4OGQ C;  2WB1 B;  4HCE A;  1X54 A;  1E2Z A;  1B44 D;  1AE2 A;  3I4N B;  3CPF A;  5IWA Q;  2L1B A;  4I65 A;  2HDM A;  4DFA A;  4PV1 C;  3LWU A;  3HS0 C;  4IUQ A;  3TBI B;  3OTO L;  3IRB A;  2MJ8 A;  3BVG A;  1D7Q A;  1GUN A;  1XMQ L;  5I2Y A;  3LWE A;  1ILP A;  3T56 B;  3ULL A;  4B3R L;  1XPU A;  2K14 A;  2B2W C;  2RDG A;  2LXK A;  5IYC G;  1W6K A;  3VYU A;  1II3 A;  1ESR A;  2K52 A;  3A5Z B;  3CRK C;  4IUN A;  3S16 H;  5IP9 H;  1U4P A;  5T1G A;  1V9P A;  1MI2 A;  2EJG C;  2MNA A;  1EYA A;  3J81 E;  2Q2T A;  3NEN A;  1NY4 A;  1J9O A;  4B08 A;  3CQZ H;  4DV2 Q;  3PO3 H;  3VR2 A;  4L8J A;  2JA5 B;  1Y1V B;  3PIP 3;  1U0L A;  3MVV A;  3D6W A;  5IYB H;  1R9T B;  1JWS D;  5M5X B;  1TWG B;  1QWY A;  3EFX D;  3NBH A;  4PG3 A;  3JAM c;  1GKH A;  4NPS A;  2ES2 A;  4WRD A;  5C0X I;  1IXR A;  3PO2 B;  3M7G A;  4QCL A;  2C5C A;  3R2I A;  4P71 A;  4DR7 Q;  1IKM A;  3NHH A;  5CMD A;  1WTW A;  1PH3 A;  2IPK D;  4C3H G;  4AYB G;  2FHT A;  2DN8 A;  5C3E G;  3RN5 A;  4JV5 Q;  3L2P A;  4K0K Q;  4O2D A;  3ERO A;  1XNQ Q;  2Z1C A;  4JBW A;  2OEO A;  2EY1 A;  1X65 A;  1YIJ A;  3F8T A;  2KEE A;  3I4M B;  4C1N I;  3NE5 B;  4A3E G;  5KRU A;  1DD2 A;  2F0J A;  2FIN B;  3X3M A;  1I94 Q;  5JEA G;  5T1I A;  4NXN L;  3KDF B;  5M3F B;  2HCC A;  2EJM A;  3S9W A;  3S1N B;  5BN3 A;  1H9S A;  1SE4 A;  3PUY A;  4L5R C;  4GKJ L;  4PZ6 A;  1HZB A;  4GN4 B;  4OIK A;  3EIV A;  4RGO S;  3D4D A;  4A3B G;  3F2B A;  3AFP A;  2YU9 H;  1PFS A;  3JAM E;  3BG3 A;  3EA6 A;  1U4R A;  3V2T A;  3R2T A;  1VQA A;  1QZH A;  3UE1 A;  1V1Q A;  1QOH A;  4GLV B;  4L6T B;  4RHR A;  5ELO A;  4DNR B;  3GV3 A;  1SNO A;  2I5M X;  1H9J A;  4DV3 Q;  1YNJ D;  4LFA L;  1PHJ A;  1ASY A;  1HNZ L;  3DHQ A;  1KDC A;  1JMC A;  1WTX A;  3VR3 A;  2RVL A;  2C35 B;  1HNW Q;  1FJG L;  4BBS B;  4HMJ A;  2VQF L;  4GZY C;  1GOZ A;  1VQB A;  3J7Z C;  2K5Q A;  1PLF A;  2F0F A;  4J1M A;  3F2D A;  3OWF A;  1BCP D;  2A6E D;  3NTK A;  4TRD A;  4F87 A;  3IFT A;  1Q3L A;  1ZEQ X;  4QIW B;  1K8G A;  1X55 A;  4DKA C;  1JJC B;  1AZP A;  1SNQ A;  2A68 C;  4DUZ Q;  3IKJ A;  5CGK A;  1N32 Q;  1JQY D;  1X3E A;  1YHQ A;  4XQN A;  1HUN A;  4B9W A;  2F0S A;  1WD0 A;  3RZD H;  1CKM A;  1UE1 A;  4R1J A;  3SK8 A;  3KF8 A;  1YEZ A;  1OXT A;  3MWY W;  2F03 A;  2PQA A;  2B2U A;  2DY7 A;  1YZ6 A;  1UWV A;  4JI6 L;  3S14 B;  1HTP A;  3AEV A;  1STY A;  3DLL A;  2HHH L;  4IFD J;  2J4X A;  2Z4I A;  3S2H B;  3KLW A;  2JEA I;  1CQF A;  2AQ3 B;  5GAE C;  3TQY A;  1EEI D;  1XNR Q;  3E0E A;  3S15 B;  5C3E B;  3DWQ A;  3KK7 A;  3BZD B;  1ONL A;  1BCP F;  2EY2 A;  1NMF A;  1PH5 A;  2B2T C;  4N9P A;  4AH6 A;  3HKZ E;  1TWA B;  1EZ8 A;  4IFD H;  1F2Z A;  1NCV A;  2Z4H A;  3I4N H;  2CH4 A;  2F1M A;  2Y0S B;  1B4O A;  2XRQ D;  2CQA A;  3A55 A;  2E2D C;  1HFG A;  2IX0 A;  3K5O A;  3GTJ B;  2HIX A;  1Y14 B;  1QUQ B;  4OXP A;  4A3J B;  1PYW D;  2CWA A;  4LF7 L;  4DV7 L;  1PH4 A;  2R93 B;  1JJ2 A;  1EU3 A;  3I2Z A;  4CJ0 B;  1EYG A;  2RKS A;  3H0G G;  3PUZ A;  1TXY A;  3J81 L;  1EL0 A;  3A8J E;  3S1M H;  4BA2 I;  3SE0 A;  2F0P A;  3CF5 A;  1BCP B;  2DUD A;  3TRZ A;  4LF5 Q;  3I73 A;  2WFW A;  3HOZ G;  1AH9 A;  3DWP A;  2F0W A;  3AB9 A;  3OOC A;  2JA7 G;  3SDZ A;  1LTS D;  3TP5 A;  1I4Q A;  1CA6 A;  1TWG H;  5E4W C;  1OXV A;  5EBC A;  4M1U B;  3K59 A;  4IUP A;  3IAY A;  3BDL A;  3K7A B;  2JQO A;  1LAB A;  2WV6 D;  1F2M A;  1XX8 A;  3DM3 A;  3TP6 A;  4G7O C;  2N88 A;  3HKZ G;  1FNU A;  3H94 A;  2ASB A;  1RL2 A;  1GHK A;  1VF5 C;  1Q7Y C;  4FO2 A;  3D3R A;  2ENB A;  2IHF A;  3R8B A;  1EYC A;  1MSG A;  3OHX C;  4DV1 Q;  4JI5 L;  1JWU D;  2B2Y C;  2L0C A;  2NVX B;  4NXM L;  1LTI D;  4K14 A;  1KTK A;  4O0A A;  5IP7 G;  2UXB Q;  1VQJ A;  4WJ4 A;  4RAU C;  4OEL B;  1KDB A;  3I4M H;  3CME A;  4RA8 A;  4OO1 I;  4ME5 A;  4KTA A;  3HOV B;  1GUO A;  1WTO A;  3A54 A;  5JJZ A;  3M9B A;  1RDP D;  5M3F H;  3IL8 A;  4LUV A;  2LY7 A;  5ELN A;  2K33 A;  2E5L L;  3S1N H;  3E5S A;  5D3D A;  4YY3 Q;  4CKB A;  1I50 H;  1KC8 C;  4Y52 H;  2IHE A;  5FLX c;  1A8V A;  2B2V C;  5A2Q L;  4PNY A;  2KCM A;  5HGT A;  3T16 A;  3H3V H;  1HFN A;  1BQQ T;  1YNN D;  5C4H A;  4U68 A;  4MZ9 A;  1J6Q A;  1I6H B;  5E3F A;  1VQE A;  4A3K B;  1L2F A;  2WAQ B;  1D5X C;  1K83 B;  4LF9 Q;  3K6O A;  3NQI A;  2O5I C;  1DOM A;  5FOB B;  1G8Z D;  4A3C G;  1S5F D;  2R7Z B;  1SBB B;  3I90 A;  2NUC A;  4PMW A;  2AWN A;  1IYV A;  4AQY L;  4ILW A;  5CV8 A;  2K7V A;  4DN4 M;  2XRS D;  5EJW A;  3KBG A;  3U9S A;  3T13 A;  4GOP A;  1IKL A;  1RCV D;  5IT9 c;  3UE0 A;  3U4Z A;  4DUY Q;  4EVO A;  3KLS A;  2ATW A;  2KHI A;  1Q1E A;  4FYD A;  1PTO F;  3J81 i;  5IGG A;  1SJE D;  4X65 L;  4FF4 A;  4YHH L;  1VQ9 A;  3PO3 G;  1Y8O B;  2V4D A;  1RD9 D;  1SAP A;  3MAQ A;  2F52 A;  4F8M A;  3CC4 A;  1KLG D;  1BCP C;  2A6E C;  3TME A;  3TS0 A;  4DAY A;  1BF4 A;  2F0O A;  3GTM H;  5I9O A;  2WIN B;  3J80 L;  3OTO Q;  5IYD H;  3KDF A;  4JBK A;  3DUZ A;  5FLX E;  4LFC Q;  1DJR D;  2JJQ A;  1B3A A;  5COR A;  5CV4 A;  4GNX A;  4HMI A;  1PH2 A;  2UUB L;  1UE7 A;  1GUG A;  4GN3 B;  3OWE B;  4B3R Q;  3S14 H;  1BR9 A;  2R3Z A;  4F88 A;  1PTO B;  1G51 A;  5IOC A;  4DR5 L;  1QE6 A;  4Z9C B;  3MXN A;  5EKL A;  1EQQ A;  2YYZ A;  2FMC A;  2ICE C;  5I2X A;  5LL6 X;  3NBH B;  2MHV A;  2G9H D;  3I4O A;  3PSI A;  3S15 H;  3EJI A;  1HZC A;  3HRZ C;  4B3S L;  1VQ4 A;  1W3S A;  4C3J H;  3T1Y L;  2VUM G;  1WCM B;  2F0Q A;  4POG A;  5G3L D;  2QDL A;  5DNF A;  2F0T A;  4QY7 A;  1TWA H;  5IT9 E;  3JC6 6;  1F2Y A;  2OQK A;  4IZ8 A;  2N78 A;  1BBU A;  2PZU A;  1LTT D;  3NQT A;  2B8G A;  3MFY A;  2CKZ B;  4S3S A;  4EQO A;  3VA7 A;  3I55 A;  2AHO B;  2VL6 A;  4A3J H;  2CQO A;  1TWC B;  4RMF A;  2R93 H;  3U9O A;  3W3A A;  2UXC L;  1NSN S;  3QO2 A;  1HQR D;  4K2L A;  1K3B C;  4XIG S;  1SDF A;  5FO8 B;  1EQV A;  3GP7 A;  5IGC A;  2RSN A;  3HOX B;  4JYA Q;  1HUM A;  1NMG A;  2DJG C;  2F0G A;  1XPO A;  4O42 A;  3H09 A;  1TWF B;  3C3L A;  4AIM A;  3CU7 A;  4R4T A;  5G3L F;  3A74 A;  4NXN Q;  4C3I B;  3MXG A;  3K7A H;  1Z7T A;  3V96 A;  3MA2 B;  2ICI A;  4R8I A;  4GKJ Q;  1X3F A;  2M2L A;  4J8Q A;  4KY5 A;  1W6J A;  2Q8R E;  4WFN 3;  2NYZ D;  2KED A;  3KF6 A;  1EIY B;  4ZLT F;  2Z6B A;  2CHB D;  1NUC A;  1I5F A;  4A75 A;  2JP1 A;  2K05 A;  4HAE A;  2N55 A;  1STG A;  4FXG C;  3G4S A;  2NVX H;  3FKI H;  2JK8 A;  2ZTE A;  1B50 A;  4LFA Q;  1SMX A;  5C0X H;  3M3Y H;  5EPJ A;  1HNZ Q;  1DXM A;  1LTB D;  3EN2 A;  2BH2 A;  1FJG Q;  2VQF Q;  1PH6 A;  2DNC A;  2F3I A;  3HOV H;  3GTP H;  3PUX A;  1XTD A;  3D8G A;  4X62 L;  1LM0 A;  2F4V Q;  2IX1 A;  4A3D B;  2QGQ A;  1VQO A;  1SYD A;  3KF8 B;  2AQ1 B;  1EWH A;  1GUW A;  3S1R B;  5JVG 3;  5FLM H;  2QW7 A;  3T1H L;  3I3C A;  4DPG A;  1MJC A;  4MTK A;  1VQH A;  2LMC B;  1JOK A;  4EQN A;  4IPG A;  1I6H H;  4A3K H;  1DM0 B;  2X6G A;  1NAP A;  3HGB A;  4Q0F A;  1X56 A;  2EIF A;  2PNR C;  4N8F A;  2Z8L A;  1H9R A;  4NKL A;  4QL5 A;  1EEF D;  4KKS A;  1A0I A;  1N34 Q;  1YNN C;  3L0O A;  2HHH Q;  4X3S A;  1A15 A;  5KYI A;  4ID6 A;  3BYY B;  1W2B A;  5JPN C;  5EKI A;  3K5M A;  4RCO A;  4CDE C;  3CCR A;  1S5E D;  4PMB A;  2QKI C;  3PGZ A;  1EFW A;  1NR2 A;  4KD4 A;  3E6Z X;  1O7Z A;  1O7L A;  1BXT A;  4DK1 A;  3KBX A;  3QB3 A;  3C46 A;  1JJG A;  2JA9 A;  1ESF A;  4DV0 L;  3B6Y A;  1NNX A;  4DV7 Q;  1CZG A;  5ELD A;  2PI2 E;  4RG1 A;  1M8A A;  1EY6 A;  1VCI A;  1TS5 A;  5EKK A;  4K8I A;  3VYR A;  3NTI A;  3NK9 A;  5CV6 A;  2EYL A;  5JVH 3;  2MO1 A;  1OXX K;  1IBM L;  4DU9 A;  1XMO L;  4NDX A;  3QIA A;  5AFW A;  4KKT A;  1VQL A;  4A93 H;  1LLR D;  1QNK A;  1N8R C;  1KAB A;  1WCM H;  1GXD C;  1U4L A;  4KV6 A;  4A3L G;  4X66 L;  3CC2 A;  1FR3 A;  3OW7 A;  1VQI A;  2HQE A;  1PYB A;  2PYK A;  1B8A A;  3PIO 3;  2O2L D;  1K0S A;  2NVQ H;  2R6G A;  2D5D A;  3NXW A;  4DR1 L;  1TWC H;  4KHV A;  4C56 C;  4AYB E;  4MNO A;  4BY7 B;  4A4I A;  3ICE A;  2BDN A;  4CDD C;  1L0Y B;  2NN6 G;  1F77 A;  2Q8I B;  1WTV A;  3TDQ A;  4ODG A;  2HQL A;  1WI5 A;  3HOX H;  3S1Q H;  4NXM Q;  1YHA A;  2DY8 A;  3U4V A;  2G9D A;  4YCV A;  3K5L A;  3CCV A;  2NBF A;  4BBR G;  1OXS C;  2K04 A;  2XWB B;  1E24 A;  4DV6 L;  2B2U C;  1AZQ A;  2KUM A;  1N9W A;  1SYG A;  5CBE E;  5M5Y H;  1RF2 D;  1ILQ A;  1JR0 D;  1MSH A;  4C3I H;  1CTM A;  1TVX A;  2NZH A;  1PDQ A;  1E7Z A;  1JOO A;  1CFM A;  3HKS A;  2IWH A;  3KLR A;  4ZCK A;  5IOD A;  4U67 3;  4DAP A;  4QQB X;  1TS3 A;  5C44 B;  4JCV E;  4TQU S;  3DWA A;  1PRT D;  3F1Z A;  4BY1 G;  3AFQ A;  4ZYS A;  4GOP B;  1Z47 A;  3GDE A;  5KIX A;  4LF8 L;  1VQ6 A;  4I7Z C;  3AMU A;  2EXD A;  2PZW A;  1HR0 L;  3AU7 A;  5KGU A;  1EIH A;  1GUS A;  4AQY Q;  1STB A;  2B3G A;  2F3V A;  3X3N A;  3IFD A;  1C7Y A;  2SOB A;  1KAA A;  3M4Y A;  3MEF A;  4DAY B;  4G4K A;  3R93 A;  1JCK B;  2KHS A;  4GNX B;  4X65 Q;  3S1R H;  1Q1B A;  5K36 G;  4LAA A;  4YHH Q;  1SMY C;  1VQF A;  4A3F B;  1YI2 A;  3RLF A;  4DXG A;  1YJN A;  4OO1 H;  5C4X B;  2MUY A;  2ALY B;  3W1G A;  3CCS A;  3MXN B;  2Q2H A;  5COY A;  1PRT F;  2SNM A;  3J80 c;  3T51 B;  1CM9 A;  5A2Q E;  4DK0 A;  4Y7N B;  2CH4 W;  3FP9 A;  1EWC A;  4DNI A;  2Z0S A; 
#chains in the Genus database with same CATH homology
 4C1N K;  4KN7 C;  1B1Z A;  5CV5 A;  1BOS A;  1WTR A;  2K03 A;  2E75 C;  2AUJ D;  3A8K E;  4KMU C;  1WTP A;  2E2H B;  2OXP A;  1Z6H A;  1ENF A;  2EZV A;  1PRT B;  1EFI D;  1V8Q A;  4BBR B;  4H44 C;  2LS0 1;  1O78 A;  3KUP A;  3FEW X;  1SYB A;  2H1E A;  3M4O B;  3SR1 A;  5FKA C;  2IL8 A;  2VXW A;  1BUV T;  2PCF B;  1S4Z A;  2TSS A;  2J0T D;  3LNN A;  3VYS A;  2BE5 D;  2R61 A;  4MIU A;  3VR5 A;  3J80 E;  3N52 A;  1NR4 A;  2AUK A;  1STH A;  4ZAI A;  4WOR A;  2F0U A;  2K5W A;  4BY1 B;  2NVY B;  1XXG A;  3GV6 A;  3ERQ A;  4DNT B;  4C3H B;  2K6A A;  2XIW A;  4HN7 A;  4AYB B;  4HR7 B;  3EQL C;  3A56 A;  4FXK C;  4ZUJ A;  1VF7 A;  3TZD A;  5EGT A;  4LK1 C;  2M00 A;  3L3O C;  5JAV A;  4A3E B;  2WKC A;  2JEB I;  3FVQ A;  4XYQ A;  4QF4 A;  1XWE A;  1AP0 A;  1UAP A;  2WP8 J;  4B9X A;  3E0J A;  4PMC A;  2XSC A;  1X3P A;  1LT3 D;  4A3B B;  3GD7 A;  1V1P A;  1Q90 A;  5ELB A;  5D65 A;  3L9A X;  2LKV A;  2XVS A;  1ET9 A;  3NTH A;  2J7Z A;  4A3M B;  2EYH A;  2L11 A;  1I4X A;  1EIG A;  1IW7 D;  3K0Y A;  4K6L A;  4CBV A;  4KJN A;  1QCB D;  4HED A;  2IT1 A;  1O80 A;  1TY2 A;  1PRT C;  3CKI B;  3MZ5 A;  2WKD A;  1TWH B;  1HA6 A;  2A69 D;  3SK5 A;  1PTO D;  2B39 A;  3BDC A;  1K8O A;  2QIL A;  1S5C D;  3V05 A;  2RDF A;  2E2J B;  1ENC A;  1U9R A;  3BS1 A;  1IYU A;  1H9K A;  1AW7 A;  4XDX A;  1RTN A;  5CR3 A;  1G91 A;  1CHP D;  5IIF A;  3DEP A;  2RQX A;  3QOJ A;  5J1Z A;  3TSS A;  4K5X A;  5I9P A;  3H0G B;  3UI2 A;  5DEH A;  3J7A V;  3SVM A;  1HQM C;  1V43 A;  3VR4 A;  2E76 C;  5M9O A;  1D5M C;  5NUC A;  3HOZ B;  5M3M B;  1Y1W B;  1KNE A;  2JA7 B;  3D4W A;  4ULL A;  4K8J A;  3RZO B;  3HP3 A;  3LX0 A;  1IL8 A;  1PFN A;  1LV9 A;  3HEJ A;  4IUV A;  3QG1 A;  3D6C A;  3OIQ A;  4ABN A;  2NTT A;  4G7Z C;  2RDH A;  3HKZ B;  2PO4 A;  2F0N A;  3D31 A;  5JPM C;  2F0M A;  1JC7 A;  4RGN A;  5JEA J;  3F2U A;  2BE5 C;  2E2I B;  1STN A;  1LTR D;  2F0L A;  1FD7 D;  1VMP A;  2KCC A;  4G57 A;  1FYC A;  4ZK9 B;  5JEA H;  1J8I A;  4KJO A;  1PMR A;  2MPM A;  1EY7 A;  2KEC A;  3VA5 A;  2K1B A;  4DA2 A;  2ZXR A;  4TSS A;  1D1I A;  2SNS A;  4K6D A;  2RSO A;  3D4R A;  3GTO B;  2K28 A;  2I46 A;  3OMC A;  1UEA B;  3HG9 A;  4EQP A;  2D62 A;  1G6Z A;  1A3T A;  2BCO A;  3NBI A;  4MHE A;  2EXZ A;  1G2T A;  1EYD A;  4OIJ A;  4X3U A;  2E74 C;  2K32 A;  3ND9 A;  5KNC A;  3C1E A;  1CA5 A;  1H9M A;  5C0X J;  3CRL C;  2HDL A;  4KY6 A;  1XYI A;  3PO3 B;  2F4I A;  2FFK B;  4ZRZ A;  4HTH A;  2BOS A;  1ET6 A;  5C3X A;  2L5T A;  2NWG A;  1Y8P B;  1IW7 C;  3BDO A;  4F7X A;  1HPC A;  4EGV A;  1LTG D;  1SMY D;  2EYO A;  3RUZ A;  5ISR A;  5D3I B;  4CKE A;  5DM6 3;  5K5P A;  4NW2 A;  2L12 A;  5EQ0 A;  3OSO A;  4DF7 A;  5KEE A;  1B9N A;  1CK1 A;  3GTQ B;  2VUM B;  1G29 1;  2A69 C;  1LAC A;  1PTO C;  4IFD G;  5CV9 A;  2PMZ B;  2NN6 I;  4LJZ C;  3FDT A;  4CJ2 C;  2BDO A;  1TS4 A;  3MEH A;  4RWS C;  3OIP A;  3P7J A;  1SXT A;  2F0I A;  1VDZ A;  3VR6 A;  2F0D A;  1JB3 A;  2A6H D;  2QDB A;  3RD4 A;  1KLU D;  4V0B A;  2YU9 B;  3Q24 A;  4QUF A;  2DNE A;  3J7A F;  4YIJ A;  3Q0A A;  1SE2 A;  2IX3 A;  5KYL A;  2Q8T A;  2EY6 A;  4DAV A;  3ITP A;  3H6M A;  2EPB A;  1V1P B;  1PXU A;  3QOL A;  3TN2 A;  1F2L A;  1OXU A;  1BNZ A;  5F2D A;  1PTO H;  4IUT A;  1AN8 A;  4IAL A;  1M4V A;  4H13 C;  5C5L A;  2ZT9 C;  1A2T A;  2F3W A;  3R3O A;  5I6Y A;  4IUR A;  1F9R A;  2KQ3 A;  3A8I E;  2JYO A;  4XQQ A;  2D9U A;  1PFM A;  2F0H A;  1D2B A;  4UDU C;  1TU2 B;  4FVM A;  1TY0 A;  3BVZ A;  2H4O A;  1SYE A;  2OT2 A;  2NB0 A;  3GTL B;  1SYF A;  1LT6 D;  3NSW A;  1K8M A;  4C2M B;  1D1K A;  1ENA A;  1T5X D;  2VB3 X;  1R4Q B;  4HSV A;  3S17 B;  3MHB A;  3OPO A;  4L63 B;  2PPB C;  1HHV A;  1KDA A;  1QG7 A;  1QIL A;  4DXF A;  3QWN A;  4NP5 A;  1EY8 A;  2CW0 C;  2MP1 A;  1SFO B;  1C4Q A;  2PQE A;  1D5Z C;  4K5W A;  5E4X A;  4X3T A;  1ZKO A;  3S1M B;  3K58 A;  1LT4 D;  1T5E A;  1O7Y A;  2ID0 A;  2SEB D;  3S2D B;  3GTG B;  5FK9 C;  5KND A;  3PMF A;  3A7L A;  1EY5 A;  2TMP A;  1SSO A;  1HTL D;  3KLS X;  4HCS A;  1HCZ A;  2O4X A;  3I8Z A;  2HCI A;  4XTC S;  3NUC A;  1TR5 A;  4K2K A;  3K57 A;  5C4J B;  3DEO A;  3NWT A;  1I4R A;  2KCN A;  1MBY A;  3MFG A;  2VNU D;  4V19 0;  1FNV A;  4CJ1 B;  1EU4 A;  4XQJ A;  2EDG A;  2D2C C;  2K01 A;  2EOT A;  4C3J G;  1BBX C;  1HA5 A;  2F0V A;  3FRP B;  5ELF A;  3A7A B;  1BDO A;  3TZU A;  1PFB A;  3T4A C;  4UAI A;  1F9Q A;  4WJW A;  1EQT A;  1I50 B;  2F0K A;  3SHL A;  1PZK D;  3I72 A;  3Q23 A;  5EBD A;  3DM1 A;  5LHY 1;  3DXJ C;  2EJF C;  1STA A;  1GHJ A;  3BYT B;  1TT2 A;  1EY4 A;  2A6H C;  4FP5 D;  2XNA C;  1AFP A;  3CHB D;  1SNP A;  3K5N A;  4M8A A;  3GQB A;  1G2S A;  3W2D A;  5BN4 A;  1CQV A;  4CHT B;  1F9P A;  4R9W A;  2LFN A;  3GTK B;  1KNA A;  4RHS A;  1Y8N B;  4DGZ A;  1V1O A;  2IW3 A;  1IHZ A;  2I07 B;  1SNC A;  4RKL A;  5ELC A;  5JOB A;  1JOR A;  2B2W A;  1Q8I A;  5C0X G;  3GTM B;  3I91 A;  1I3Q B;  5IGE A;  3WOF A;  5D14 A;  1JE4 A;  1I6V C;  2L4N A;  1UNS A;  2EYJ A;  1SYC A;  5I6W A;  2A73 B;  1CZW A;  1CI3 M;  4C3J B;  3Q6S A;  1SNM A;  2A74 C;  4NMZ A;  1E0B A;  3I4L A;  4LMQ D;  1GUT A;  5DM7 3;  2RA4 A;  1BO0 A;  1I4P A;  1DCZ A;  4XT1 B;  3C2P A;  1S5B D;  3DMU A;  1PZI D;  4IUU A;  2EYF A;  1WTQ A;  3SK4 A;  4MN3 A;  1R4P B;  3C1F A;  1A6X A;  2JA6 B;  3HOY B;  1CT1 D;  1QNU A;  1Q12 A;  4ZUI A;  1L0X B;  4KHZ A;  2JE6 I;  1JOQ A;  1RTO A;  2PZT A;  2HUG A;  3ND8 A;  3O13 A;  2XN9 C;  2BA1 A;  3NWS A;  4BWG B;  3H3V C;  4X3K A;  3URY A;  3HOW B;  1DOK A;  2RBM A;  2EYM A;  1EZ6 A;  4KY7 A;  5FO9 B;  1LT5 D;  3EVQ A;  1E2V A;  4KKU A;  4G7H C;  1DOL A;  4Q5V A;  1RJT A;  1STE A;  1LO5 D;  2QEJ C;  3FKI B;  3HZX A;  2EYP A;  3M3Y B;  4KD3 A;  3HOU B;  3OMG A;  2QF7 A;  1TKW B;  4IN3 A;  3GTP B;  2NVT B;  2R92 B;  4K5V A;  5M5W B;  2ZXP A;  1B53 A;  3PV0 A;  4QMG A;  3JAM L;  2NN6 H;  1A3U A;  2CVR A;  2EVB A;  3WOE A;  1WVL A;  4FNF A;  3FPU B;  3FMC A;  4FF2 A;  4OL7 A;  1ZYR D;  2F0E A;  1HXY D;  5C3W A;  5FO7 B;  3MXU A;  3MC0 B;  3SEB A;  2B2T A;  1HRJ A;  2JSO A;  4C3I G;  2SDF A;  3BVM A;  3MXP A;  1EY9 A;  1TQO A;  2FMM A;  4KN4 C;  4FF1 A;  1YNJ C;  3PUV A;  1MGS A;  1TS2 A;  1U4M A;  3NPP A;  3GO5 A;  5I4D A;  5KNB A;  4BS9 A;  4QUC A;  3TP7 A;  1A2U A;  3G6J B;  2C9O A;  1FNW A;  1D6E C;  2EY5 A;  1UUP A;  4QB4 A;  2JA8 B;  1EY0 A;  4H0L C;  3NP8 A;  4A3G B;  4KK7 A;  4IFD I;  1E2W A;  5E1F A;  4FF3 A;  3TP8 A;  2WAC A;  1C8C A;  2IJ0 A;  5CV7 A;  4A93 B;  5K36 H;  4OO1 G;  5HUR A;  2CW0 D;  3G7L A;  3SK6 A;  3P20 A;  2O5J C;  1DON A;  3J7Y W;  2NVQ B;  3ZYY X;  1JWM D;  2B2Y A;  3P1H A;  4R8N A;  4P2C B;  1B2T A;  3QJY A;  1LTA D;  4N9T A;  1ICW A;  2B8F A;  4H7B A;  4J6H A;  2QCP X;  5ELE A;  1F9S A;  3S1Q B;  1H9S B;  3S16 B;  1TII D;  3VYT A;  1VMC A;  2B2V A;  3CQZ B;  2PW5 A;  2PW7 A;  5M5Y B;  1DYQ A;  3P75 A;  4RFB A;  1X32 A;  4CGY B;  1RKN A;  4JK1 C;  5A35 A;  4KI0 A;  1WD1 A;  2GA4 B;  2FJ2 A;  2XWJ B;  1SJH D;  5C6A A;  1SEB D;  2L9H A;  2KJX A;  2EE1 A;  2A5H A;  3T53 B;  4RH6 A;  3RMH A;  2JXM B;  2NTS A;  5C4Z A;  1AEX A;  1QJO A;  3M7N A;  5EPL A;  1DZ1 A;  4RKB A;  2BA0 A;  1FGB D;  2M9V A;  1QB5 D;  1S5D D;  1GJX A;  4RGM A;  2WII B;  4CKC A;  1I4G A;  4RCN A;  1ZXT A;  5EPK A;  5C5M A;  3WDN A;  5IGD A;  1OO9 B;  1MD2 D;  1C48 A;  3ONA B;  4HSP A;  1ROD A;  5LL6 S;  3Q22 A;  1RHP A;  5CBA E;  5TSS A;  3H91 A;  4PQX A;  2L55 A;  4XXE A;  5J22 A;  3SXH A;  4ZKC B;  4BA1 I;  1X3Q A;  4FXD A;  1B9M A;  5J39 A;  4IQZ A;  3I70 A;  4OHJ A;  3L7Z C;  4A3I B;  1ML0 D;  2A68 D;  3N6R A;  4XYO A;  1CHQ D;  1ZYR C;  1Y69 U;  1A3V A;  2X6L A;  4TKO B;  5CC4 A;  2OF1 A;  4RGT A;  5BN5 A;  5FLX L;  1XTC D;  3PUW A;  5IGF A;  1JIC A;  3RZD B;  2KOL A;  4E6I A;  2X69 A;  4ZKB B;  2AWO A;  1SE3 A;  5DAU A;  3M85 A;  5IGB A;  2KA7 A;  4ZQ3 A;  1SND A;  4XT3 B;  2VB2 X;  1PZJ D;  2NZ1 D;  2KVM A;  5IT9 L;  3MTS A;  1EOT A;  2K5D A;  2B63 B;  2MGS A;  3FPP A;  2ZXO A;  4O1N A;  2AQ2 B;  1I4H A;  5CYU A;  4OGQ C;  2WB1 B;  4HCE A;  1E2Z A;  1B44 D;  3I4N B;  2L1B A;  4I65 A;  2HDM A;  4DFA A;  4PV1 C;  3LWU A;  3HS0 C;  4IUQ A;  3TBI B;  2MJ8 A;  3BVG A;  1GUN A;  5I2Y A;  3LWE A;  1ILP A;  3T56 B;  2B2W C;  2RDG A;  1W6K A;  3VYU A;  1II3 A;  1ESR A;  3CRK C;  4IUN A;  1U4P A;  5T1G A;  1MI2 A;  2EJG C;  3J81 E;  1EYA A;  1J9O A;  4B08 A;  3VR2 A;  4L8J A;  2JA5 B;  1Y1V B;  3PIP 3;  3MVV A;  3D6W A;  1R9T B;  1JWS D;  5M5X B;  1TWG B;  1QWY A;  3EFX D;  3NBH A;  4WRD A;  5C0X I;  3PO2 B;  3M7G A;  4QCL A;  2C5C A;  3R2I A;  1IKM A;  3NHH A;  5CMD A;  1WTW A;  2IPK D;  4C3H G;  2FHT A;  2DN8 A;  3ERO A;  2Z1C A;  4JBW A;  2OEO A;  2EY1 A;  2KEE A;  3I4M B;  4C1N I;  3NE5 B;  5KRU A;  1DD2 A;  2F0J A;  2FIN B;  3X3M A;  5JEA G;  5T1I A;  5M3F B;  2HCC A;  2EJM A;  3S9W A;  3S1N B;  5BN3 A;  1H9S A;  1SE4 A;  3PUY A;  4OIK A;  4RGO S;  3D4D A;  3JAM E;  3BG3 A;  3EA6 A;  1U4R A;  3V2T A;  3R2T A;  4DNR B;  1QOH A;  4L6T B;  4RHR A;  3GV3 A;  1SNO A;  1H9J A;  1YNJ D;  3DHQ A;  1KDC A;  1WTX A;  3VR3 A;  2RVL A;  4BBS B;  4HMJ A;  4GZY C;  1GOZ A;  2K5Q A;  1PLF A;  2F0F A;  4J1M A;  3NTK A;  1BCP D;  2A6E D;  3OWF A;  4F87 A;  4TRD A;  3IFT A;  1Q3L A;  1ZEQ X;  4QIW B;  1AZP A;  1SNQ A;  2A68 C;  3IKJ A;  5CGK A;  1JQY D;  4XQN A;  1HUN A;  4B9W A;  2F0S A;  1WD0 A;  3SK8 A;  3KF8 A;  1OXT A;  3MWY W;  2F03 A;  2B2U A;  2DY7 A;  3S14 B;  1HTP A;  1STY A;  4IFD J;  2J4X A;  2Z4I A;  3S2H B;  2JEA I;  1CQF A;  2AQ3 B;  1EEI D;  3S15 B;  5C3E B;  3DWQ A;  3KK7 A;  3BZD B;  1ONL A;  1BCP F;  2EY2 A;  2B2T C;  4N9P A;  1TWA B;  1EZ8 A;  4IFD H;  1F2Z A;  1NCV A;  2Z4H A;  2F1M A;  2Y0S B;  1B4O A;  2XRQ D;  2CQA A;  3A55 A;  2E2D C;  1HFG A;  2IX0 A;  3K5O A;  3GTJ B;  4A3J B;  1PYW D;  2R93 B;  1EU3 A;  4CJ0 B;  2RKS A;  3PUZ A;  3J81 L;  1EL0 A;  3A8J E;  4BA2 I;  3SE0 A;  2F0P A;  1BCP B;  3I73 A;  3DWP A;  2F0W A;  3AB9 A;  3OOC A;  3SDZ A;  1LTS D;  3TP5 A;  1I4Q A;  1CA6 A;  5E4W C;  1OXV A;  5EBC A;  4M1U B;  3K59 A;  4IUP A;  3IAY A;  3BDL A;  3K7A B;  1LAB A;  2WV6 D;  1F2M A;  1XX8 A;  3TP6 A;  4G7O C;  2N88 A;  1FNU A;  3H94 A;  1GHK A;  1VF5 C;  4FO2 A;  3D3R A;  2ENB A;  3R8B A;  1EYC A;  1MSG A;  3OHX C;  1JWU D;  2B2Y C;  2L0C A;  2NVX B;  1LTI D;  4K14 A;  1KTK A;  4RAU C;  1KDB A;  4RA8 A;  4OO1 I;  4ME5 A;  4KTA A;  3HOV B;  1GUO A;  1WTO A;  3A54 A;  5JJZ A;  1RDP D;  3IL8 A;  2LY7 A;  2K33 A;  3E5S A;  5D3D A;  4CKB A;  5A2Q L;  2B2V C;  4PNY A;  5HGT A;  3T16 A;  1HFN A;  1BQQ T;  1YNN D;  5C4H A;  4U68 A;  1I6H B;  5E3F A;  4A3K B;  2WAQ B;  1D5X C;  1K83 B;  3K6O A;  3NQI A;  2O5I C;  1DOM A;  5FOB B;  1G8Z D;  2R7Z B;  1S5F D;  1SBB B;  3I90 A;  2NUC A;  4PMW A;  2AWN A;  1IYV A;  4ILW A;  5CV8 A;  2K7V A;  4DN4 M;  2XRS D;  5EJW A;  3KBG A;  3U9S A;  3T13 A;  1IKL A;  1RCV D;  4EVO A;  3KLS A;  1Q1E A;  4FYD A;  1PTO F;  5IGG A;  1SJE D;  4FF4 A;  1Y8O B;  2V4D A;  1RD9 D;  1SAP A;  3MAQ A;  4F8M A;  1KLG D;  1BCP C;  2A6E C;  3TME A;  4DAY A;  1BF4 A;  2F0O A;  5I9O A;  2WIN B;  3J80 L;  3DUZ A;  5FLX E;  1DJR D;  1B3A A;  5COR A;  5CV4 A;  4HMI A;  1GUG A;  3OWE B;  1BR9 A;  2R3Z A;  4F88 A;  1PTO B;  5IOC A;  1QE6 A;  4Z9C B;  3MXN A;  5EKL A;  2YYZ A;  2FMC A;  2ICE C;  5I2X A;  5LL6 X;  2MHV A;  2G9H D;  3EJI A;  3HRZ C;  1WCM B;  2F0Q A;  5G3L D;  5DNF A;  2F0T A;  5IT9 E;  1F2Y A;  4IZ8 A;  2PZU A;  1LTT D;  3NQT A;  2B8G A;  3MFY A;  4S3S A;  4EQO A;  3VA7 A;  1TWC B;  3U9O A;  3W3A A;  1NSN S;  3QO2 A;  1HQR D;  4K2L A;  4XIG S;  1SDF A;  5FO8 B;  1EQV A;  3GP7 A;  5IGC A;  2RSN A;  3HOX B;  1HUM A;  2F0G A;  4O42 A;  3H09 A;  1TWF B;  3C3L A;  3CU7 A;  5G3L F;  4C3I B;  3MXG A;  1Z7T A;  3V96 A;  3MA2 B;  2ICI A;  4R8I A;  2M2L A;  4J8Q A;  4KY5 A;  1W6J A;  2Q8R E;  4WFN 3;  2NYZ D;  2KED A;  4ZLT F;  2CHB D;  1NUC A;  2JP1 A;  2K05 A;  4HAE A;  2N55 A;  1STG A;  4FXG C;  1B50 A;  5C0X H;  5EPJ A;  1DXM A;  1LTB D;  2DNC A;  3PUX A;  3D8G A;  2IX1 A;  4A3D B;  1SYD A;  2AQ1 B;  1EWH A;  1GUW A;  3S1R B;  5JVG 3;  3I3C A;  2LMC B;  1JOK A;  4EQN A;  1DM0 B;  2X6G A;  1NAP A;  3HGB A;  4Q0F A;  2PNR C;  2Z8L A;  1H9R A;  4NKL A;  1EEF D;  4KKS A;  1YNN C;  4X3S A;  1A15 A;  5KYI A;  4ID6 A;  3BYY B;  5JPN C;  5EKI A;  3K5M A;  4RCO A;  1S5E D;  4PMB A;  2QKI C;  1NR2 A;  4KD4 A;  3E6Z X;  1O7Z A;  1O7L A;  1BXT A;  4DK1 A;  3KBX A;  3QB3 A;  3C46 A;  1ESF A;  1CZG A;  5ELD A;  1M8A A;  1EY6 A;  1VCI A;  1TS5 A;  5EKK A;  4K8I A;  3VYR A;  3NTI A;  3NK9 A;  5CV6 A;  2EYL A;  5JVH 3;  1OXX K;  4DU9 A;  4NDX A;  3QIA A;  5AFW A;  4KKT A;  1LLR D;  1QNK A;  1KAB A;  1GXD C;  1U4L A;  4KV6 A;  1FR3 A;  3OW7 A;  2HQE A;  2PYK A;  3PIO 3;  2O2L D;  2R6G A;  2D5D A;  3NXW A;  4KHV A;  4C56 C;  4BY7 B;  2BDN A;  1L0Y B;  2NN6 G;  1F77 A;  2Q8I B;  1WTV A;  3TDQ A;  4ODG A;  2DY8 A;  2G9D A;  3K5L A;  2NBF A;  1OXS C;  2K04 A;  2XWB B;  2B2U C;  1AZQ A;  2KUM A;  1SYG A;  5CBE E;  1RF2 D;  1ILQ A;  1JR0 D;  1MSH A;  1CTM A;  1TVX A;  1PDQ A;  1JOO A;  1CFM A;  2IWH A;  3KLR A;  5IOD A;  4U67 3;  4DAP A;  1TS3 A;  5C44 B;  4TQU S;  3DWA A;  1PRT D;  4ZYS A;  1Z47 A;  5KIX A;  4I7Z C;  3AMU A;  2PZW A;  3AU7 A;  5KGU A;  1EIH A;  1GUS A;  1STB A;  2F3V A;  3X3N A;  3IFD A;  2SOB A;  1KAA A;  3M4Y A;  4G4K A;  3R93 A;  1JCK B;  2KHS A;  1Q1B A;  5K36 G;  4LAA A;  1SMY C;  4A3F B;  3RLF A;  4DXG A;  4OO1 H;  5C4X B;  2MUY A;  5COY A;  1PRT F;  2SNM A;  3T51 B;  1CM9 A;  5A2Q E;  4DK0 A;  4Y7N B;  1EWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...