2B2UA

Tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4 and dimethylarginine 2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
175
structure length
173
Chain Sequence
FETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
total genus 52
structure length 173
sequence length 175
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2uA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2uA01
2NYZD 1A15A 1SDFA 1G91A 1LV9A 1SAPA 1AZPA 1B2TA 2JYOA 1HUMA 1F9SA 2DY8A 4ZLTF 3MTSA 1IKLA 4IUTA 3DEOA 1F9PA 1NCVA 2R3ZA 1IL8A 5CMDA 2D9UA 5EQ0A 3QO2A 4LMQD 2CVRA 2FJ2A 1NAPA 3P7JA 2B2UC 2K03A 4X3KA 2K01A 4XT1B 1MI2A 3F2UA 4MN3A 1KNEA 1CA6A 1BF4A 1SSOA 1B3AA 2L9HA 1CM9A 2B2TC 2NZ1D 3I91A 3I3CA 4ZK9B 2L11A 1F9QA 4RAUC 1WTPA 3FDTA 3DM1A 1MSHA 1GUWA 5DNFA 4IUPA 3TZDA 2VXWA 2HDLA 1MGSA 4RA8A 1WTQA 3SVMA 5D65A 1MSGA 4X3SA 2N88A 2RSNA 2X69A 1BNZA 1B50A 2DY7A 2KOLA 2RSOA 1NR4A 3R93A 1X3PA 2X6LA 1HUNA 1WTOA 1JE4A 1PDQA 2HDMA 1QE6A 2RA4A 5COYA 1ICWA 2B2YC 4NW2A 4U68A 1U4MA 2N55A 2X6GA 4XDXA 2NWGA 1S4ZA 1DOLA 1EIGA 1RODA 2EOTA 5CBEE 2KEEA 2Q8RE 1RTOA 2BDNA 3D6WA 2HCIA 4OIJA 4X3UA 2H1EA 1WD1A 1X3QA 3TN2A 1WD0A 1WTXA 4X3TA 3GV3A 1G2SA 1O80A 2FMMA 2MPMA 4OIKA 1WTRA 1PFNA 3I90A 1RHPA 3KBXA 3ONAB 3KUPA 5T1IA 4DN4M 5CBAE 4MHEA 1F9RA 1C8CA 4HCSA 1VMPA 1RJTA 3I8ZA 1RTNA 4ZAIA 5T1GA 3IFDA 4HAEA 4IUVA 2EPBA 2FINB 5AFWA 1M8AA 1NR2A 2XIWA 5E4XA 2KECA 1DOMA 2MJ8A 2B2WA 2K1BA 5EPKA 1B53A 1WTVA 1DOKA 3G7LA 1HHVA 2IL8A 1HFGA 1ESRA 2L1BA 2B2TA 4CJ2C 1XX8A 1G2TA 2MGSA 2B2VC 1O7ZA 5E4WC 4R8IA 3LWEA 1PLFA 4IUUA 5EJWA 1EL0A 2B2UA 1ILQA 3DEPA 2Q8TA 1QNKA 4IUQA 1HRJA 1EIHA 2JP1A 4QUFA 1XYIA 3MWYW 1DONA 2MP1A 1BBXC 1G6ZA 1HFNA 1B4OA 2L4NA 3H91A 2SDFA 5EPLA 1KNAA 1E0BA 1PFMA 2L12A 4XT3B 3HP3A 4ZKCB 1EQTA 1U4LA 1F2LA 4CJ1B 1HA6A 1JICA 4R9WA 2B2WC 3UI2A 1ML0D 5CORA 2RVLA 1U4RA 2K28A 1ILPA 1O7YA 1Q3LA 2KEDA 3IL8A 1CA5A 4HEDA 5EKIA 2KUMA 3N52A 1AP0A 1ZXTA 2HCCA 5JJZA 1DZ1A 1X32A 2B2YA 3FPUB 2HUGA 2M2LA 4RWSC 1QG7A 1WVLA 1U4PA 4QUCA 2FHTA 2KVMA 1PFBA 4HSVA 1IKMA 4ZKBB 2K04A 2B2VA 2FFKB 1VMCA 1J9OA 4UAIA 1TVXA 1WTWA 1AZQA 2K05A 5D14A 3GV6A 3Q6SA 4IURA 1BO0A 1EOTA 4CJ0B 5EPJA 2EE1A 2J7ZA 4O42A 1J8IA
chains in the Genus database with same CATH superfamily
4GN4B 2SNSA 5IE8A 1SJHD 4GS3A 1E3PA 2A6EC 3HRZC 5GAGC 4PNYA 2I5MX 1TWCH 1NAPA 3SHLA 2IX3A 2E76C 3ER0A 4UP9A 4FF2A 1YHBA 3ULPA 4C3JH 1K9MC 4IFDI 1F2ZA 4TKOB 5HY6A 3TS0A 3J81c 1KDAA 2D62A 1PH6A 1E24A 4KK7A 2Q2TA 4JBJA 4B9WA 5EBDA 4YIJA 3NHHA 2FXQA 1UE7A 4O1NA 2KJXA 2HQEA 2Z1CA 1HPCA 1D5ZC 2NVQH 4U68A 4A3BG 4IJHA 1QOHA 3UDIA 1Y1WB 1PV4A 3QWNA 1QVCA 2EOTA 4C3IH 3Q8DA 4KHPL 1LTGD 2ICIA 1X3QA 3GTKB 3K0XA 2F4VQ 2AUJD 1YNJD 1WJJA 3ONAB 1F9RA 1CKOA 3GTPB 4ZAIA 3G6JB 2EPBA 4LF8Q 1M8AA 5E4XA 1WFQA 2R92G 4OONA 1HTLD 4JI8L 3FMCA 4NKLA 1W6JA 4DR1L 1HFGA 1I4PA 2MGSA 2QGQA 1PXUA 4R8IA 2NVTH 4DUZL 3CC2A 2B63G 4P71A 4A3JB 1HNWL 1F2YA 1QNKA 1FNWA 3AFPA 2JP1A 1DONA 1XYIA 4YY3Q 4MTNA 1LT4D 3BYTB 3HOZB 1RL2A 2E2JH 3HOXG 4X64Q 4H44C 1JICA 4KY7A 5JVH3 2JA8B 1VF7A 4C2MB 2F4VL 1AP0A 1ZXTA 4JI7L 4C3HG 1FYCA 1X3FA 2PNHA 2AHOB 1VQDA 5DM63 1UEBA 1FJGL 1LTRD 5C5LA 4H13C 2NZOA 1IBKL 2JN4A 2OQ0A 2JEBI 2JSOA 3HKZB 3RLFA 4DR1Q 5IY0A 3E5SA 3GTLH 1VQJA 2R61A 4LF4L 3CCMA 1LUZA 3OSOA 3AYHB 2JA6G 3D8GA 3AQQA 4DAYA 2WAQG 2ENBA 2I46A 4Z9CB 1EY4A 3NUCA 5C44H 3F2UA 1YBYA 2G5DA 2JEAI 4NXNQ 2PI2A 5J39A 3JAMi 5KYLA 3OMCA 4K5WA 2WINB 4DNIA 1YI2A 3TMEA 1NSNS 3FKIG 3BVGA 5A2QL 1SEBD 3OPOA 4LJZC 5IYDH 3M3YB 1EIYB 1V43A 1BNZA 4JI3Q 2BH2A 1I4RA 1X3PA 2RA4A 1H9RA 1PDQA 4FF4A 4G7ZC 1W6KA 2VUMG 5F2DA 5M3MG 4B3RQ 1U4MA 4X66Q 1H9SA 4V190 4O0AA 1KTKA 2IHEA 4DR4L 1L1OB 2BH8A 1Y1VH 1K3BC 1JE5A 3OHXC 3HOUG 1WTRA 1Z7TA 1EY6A 3FEWX 4LF6L 2WAQE 1H9SB 5T1GA 3OW7A 4OO1G 4L5RC 3F2CA 2NN6I 1WTVA 1B53A 3KOJA 4NXNL 4JV5L 1VQ6A 2JXMB 1STYA 2B2TA 3HOVB 1V8QA 5ELCA 1O7LA 4YCWA 3F2BA 2G9HD 4BWGB 3STBC 1WTHA 4YCVA 1EZ6A 1S40A 4HJ9A 3J7A5 4ZKCB 4EQOA 1LTLA 4DUYL 2QDLA 1UUPA 3C3LA 1JORA 2H4OA 3S16H 2K28A 3A74A 2OWOA 4JPBW 2VQEL 4J15A 4V0BA 1L2FA 1NMFA 1SYFA 2O5JC 4JC0A 2M2LA 1PH7A 4CDCC 1BCPF 2UXCL 4LF6Q 2ZXRA 2VNUD 1K0SA 2AUKA 2UXDQ 4R1JA 2OXPA 4N8FA 2OTLA 4J6HA 4BA2I 4IURA 2E2HH 3JAME 1GUNA 4JV5Q 5KNCA 4QMGA 3K59A 2NYZD 1LV9A 3K80C 1S5CD 1YNNC 1HTPA 2JYOA 4S3SA 1F9SA 1ONLA 1RCVD 2SNMA 1I4GA 2EDGA 3AU7A 4J1MA 2ZXOA 3DEOA 4HJ7A 1CSQA 2R3ZA 4C56C 2ZXPA 1HR0W 1BBWA 4GNXA 4GN3B 4XT1B 5C0XG 2Z4HA 1MI2A 1LT3D 4QY7A 1PRTD 4K0KQ 4GKJQ 4RAUC 3DM1A 3UE0A 1LTTD 4JI0Q 2KCMA 4RA8A 4A3FH 4EX5A 3NTHA 3V2TA 4X3SA 2N88A 3SR1A 2HQLA 1CKNB 4Y7NH 3PO3B 1JT8A 3T51B 4NPSA 1S5BD 5BN3A 4GKKQ 3VR5A 1TIID 1DOLA 2KCCA 4FDBA 1RKNA 2R7FA 1K8MA 3GDEA 5ELFA 1I4XA 4KN7C 4PV1C 3PIPA 2DNEA 1WD0A 2DJGC 3QIAA 1N33Q 4XQQA 3J80c 5FO8B 4A3EB 2R93H 3MVVA 1JR0D 1YJNA 2EXZA 4C3IG 3SE0A 4YHHL 5BN4A 2JA8H 1S72A 2F0WA 1PRTC 2B8FA 4LFAQ 3PV0A 3T1HL 1EY5A 4JYAL 1DOMA 5IYCG 3H0GH 1R4QB 1ZEQX 1SNCA 2VW9A 4L5SA 2D5DA 3CD6A 1Q12A 5CC4A 2F3WA 5C4JB 2B2UA 3M7GA 1YHQA 1LTBD 1XPRA 2N8NA 3GTGB 1HR0L 1B4OA 1GUTA 3OWFA 3K5MA 1OTCA 4NDXA 4DV0Q 1RD9D 3O13A 1STBA 4CJ1B 4BBRG 3UI2A 2OEOA 5GAEC 1ILPA 2PW7A 4LWCA 5EKIA 2KUMA 4K2LA 1SNQA 2QA4A 3TDQA 1EY0A 1U0LA 4RCOA 2EYFA 1RIPA 1IKMA 4ZKBB 4XYQA 5I2YA 4IPCA 2JA5H 1J9OA 3CF5A 4QL5A 4RFBA 2A73B 3A7LA 1QJOA 3GV6A 4JI1Q 3L9AX 2NVQB 3T56B 3VYSA 2TSSA 1PH8A 2LY7A 1SDFA 1UNSA 2K7VA 1F77A 2PW5A 1WCMG 2UXBQ 2DY8A 5G3LF 5IT9E 1IL8A 2CVRA 2B2UC 1V1PA 1ENAA 1G51A 3RZDH 4A93G 3RR5A 4C3IB 4HMIA 3TQYA 2Z6BA 4A4IA 1B3AA 3I91A 3HOVH 1GUWA 2CH4W 2WIIB 1MSHA 1TWCB 5LMNQ 2ICEC 3KF8B 4JOIC 5ELOA 4C1NI 5IT9c 2F0TA 2ZM6Q 4N8X1 3I72A 3A5ZB 1VQ5A 4BBSB 5LMUQ 1N32L 1C0AA 2PQEA 2D0OA 2JQOA 4A3MH 1HNWQ 2NBFA 3HS0C 1PZJD 2I07B 5J3BA 3NPPA 1SYGA 1PFSA 1FNUA 4LUZA 5IGFA 1VQOA 3OTOL 4OIJA 1LLRD 4ZUIA 1NNXA 1WD1A 2VUMH 3R3OA 2D2CC 4DR2L 3E6ZX 4ODGA 3LWUA 2MQHA 3ULLA 1TS3A 2DJFC 3T13A 1VS0A 2R7DA 4K6LA 4OX9Q 1Y8NB 1VQNA 1H95A 2R6GA 1Y1WH 1IYUA 3G7LA 1IBML 1HHVA 1TWFH 2L1BA 3S16B 3U58A 3MXPA 1HZBA 2F1MA 2ZM6L 5LMUL 2PZTA 2C35B 4FXGC 4JI2Q 4QUFA 1PH9A 3ICEA 1G6ZA 2MP1A 3S2HH 5EPLA 1KNAA 2MO0A 2YV5A 2RDFA 1EQTA 1YHAA 4KD3A 3TREA 4WJ4A 5JPMC 2Z4IA 4IFDJ 2EYHA 2IHFA 4WORA 4EGVA 1Q7YC 1E22A 2KEDA 1HNZL 1CA5A 3H0GB 2HIXA 1AE3A 1TS2A 2I5HA 3Q24A 1QUQA 3NQTA 5JJZA 3PO2G 1D5XC 1IBLQ 1PH1A 1CQFA 1U4PA 4LNQA 4YHHQ 1R9TH 1I50B 3J80L 3CXCA 2CW0D 1AZQA 2ZJQA 1SE4A 1SMYC 4DR6L 4EQ5A 1BQQT 3M9BA 3OWEB 4QF4A 5EPJA 3HOYH 3A55A 1TWGH 1EEID 2J7ZA 4A3JG 2CWAA 5FKAC 2A6ED 3S17H 1B2TA 3EIVA 1YEZA 5IODA 1DGSA 2LXKA 4BXXH 3QJYA 3P75A 1JWMD 3D0FA 4LF7L 3PO3G 1FGBD 1EOVA 4JBKA 3PF5A 2CWPA 2YU9B 5KNDA 1CA6A 2F0VA 1A3VA 1MIUA 4JI8Q 2KCTA 2L11A 4WJWA 1W2BA 2NUCA 4C2MH 5FLMH 3PIP3 5GQOA 3JAMc 3CCVA 3J7YW 1NR4A 5EKKA 3J7AV 4KI0A 2N55A 5BR8Q 4X64L 2MNAA 1KLUD 4KJOA 3TZUA 2ES2A 1GD7A 1EIFA 4A3BH 2IY5B 4OWWB 4DR3Q 4OIKA 5IYBH 5CBAE 4IPHA 1JCKB 4A3IH 3PUWA 3I8ZA 1VQHA 3MXUA 1Q1BA 5CV5A 2EYLA 4BBRB 1D5MC 2F0UA 4HTHA 2R93G 2L5TA 4LF9Q 3BDLA 4HIDA 4DK6C 2IL8A 1V1PB 2TMPA 2KQ3A 2LFNA 3S15H 2R92H 2BOSA 3MXNB 2CH4A 5M5YB 1L1OC 5CGKA 1TS4A 1N34L 4B3MQ 1EFID 1I3QH 5JEAG 3M4YA 1ZKOA 4RH6A 1PTOC 3AEVA 1IW7D 1H9MA 4G4KA 5BR8L 3T1YL 3SEBA 3S15B 3OTOQ 2NVTB 4H7BA 2A19A 4KHPQ 1TKWB 1WCMB 3IL8A 3NSWA 2XWBB 4DV4L 1PTOH 2B2YA 4A3GB 1L0XB 4K5XA 4BBRH 4DR5L 3K7AH 1QVFA 3S1QB 3RN5A 3MC0B 1KQSA 4UAIA 4C3HH 3PF4A 1KAAA 3UE1A 2RHSB 1BO0A 2RCNA 3VYUA 3NWTA 3S14B 3GTKH 3LNNA 2WB1E 1JOKA 1SAPA 3D4RA 1J5EQ 3A7AB 1HUMA 3OMGA 1P8LA 4DUZQ 1C9OA 1Y14B 2NTTA 4G7OC 2SEBD 2M00A 4C3HB 1PTOD 5ELNA 1UE6A 2V1CC 4RHSA 3CCJA 1VQAA 1STAA 3J81j 1JB3A 1HJPA 3L0OA 4L6TB 1A6XA 1SMXA 3Q23A 1XJVA 4LFBQ 4CKCA 4AH6A 4GLVB 1EYCA 3EVQA 3MFGA 3I73A 3J81i 3M85A 1WTQA 1D8LA 2VZAA 2YU9H 3RZDB 2RSNA 2X69A 4XQNA 1XPOA 1D6EC 1EZ8A 3R93A 1JE4A 1FJGQ 5M5WH 4F88A 4DK0A 4NW2A 5ELBA 3H94A 2K32A 5E3FA 3SK5A 1KLGD 2UU9L 1B3QA 4DR6Q 2BDNA 5JPNC 3RZOB 2H1EA 3A0JA 5CYUA 2EY5A 5I2XA 3KLWA 1MD2D 4K14A 3JC66 4X62Q 3GTOH 3I56A 2AWNA 1GUSA 5C5MA 1LO5D 3K5OA 1A3TA 5LHY1 4ILWA 2P5ZX 2JA5B 1SFOH 1TXYA 4RMFA 3CPFA 2K6AA 1IHZA 1HZ9A 4DV5L 2GA4B 2JE6I 4OO1H 2PMZB 5DAUA 5DM73 5EJWA 2Q8TA 1Y1WG 1U9RA 4U673 4EVOA 2ZT9C 3CW2C 2ASBA 1TU2B 2F0FA 1MKHA 4X66L 4TQUS 1F2LA 3DXJC 3NTKA 1FL0A 2OTJA 4BY1G 1N36Q 1XNQQ 4L63B 2LKVA 2K5WA 3EJIA 1ENFA 1BOSA 1X32A 2SOBA 1CSPA 4XQJA 5C4JH 3HOXH 1PFBA 1S3OA 4LK1C 5IGDA 5FO9B 5IYDG 1R9TB 1X3GA 1PTOF 1UE1A 2UUAQ 1STEA 4LF8L 1GOZA 4CKBA 1Q46A 4FO2A 3B6YA 2QCPX 4KLKA 3G4SA 4R8NA 1XMQL 2VQFL 3S17B 2PO4A 3K0YA 4KMUC 4P72A 1HQRD 5IGEA 3K6OA 2JA7H 2C9OA 1H9KA 3VYRA 1JOQA 1ICFB 2XWJB 2WKDA 1F9PA 3ERSX 5CMDA 4I65A 3W5OA 3CQZB 2AMCB 2EY2A 1PRTF 3S1MH 3MA2B 2PZUA 4JI4Q 3FDTA 1Q82C 2M9VA 2JA6H 3TZDA 5C0XH 1KRTA 1HNXL 1M1KC 1I94L 3KLSX 3J80E 3HOWG 5C3WA 5I9OA 5C3XA 1Q1EA 2B8GA 3EBEA 2HT1A 1YNJC 4CKEA 3I70A 3DMUA 3BJUA 4O2DA 3KJPA 3AMUA 1K28A 4WFN3 1PZID 4POFA 2PPBC 2A8VA 1VCIA 5ELDA 1X55A 2PQAA 3UDXA 4BY1B 4IZ8A 1C8CA 2OQKA 2DNCA 4FF1A 4UDUC 1TS5A 4GN5A 4RKBA 4K8IA 1AW7A 3K58A 1XTDA 5IYBG 2JA8G 4JI4L 4DR7L 1EWIA 2VUMB 4JI0L 5E4WC 3LX0A 3LWEA 1WYDA 3K81C 3DEPA 2FMCA 4JI3L 3E9HA 1HFNA 3MWYW 1SE3A 4A76A 5D3IB 1UE5A 2F0HA 3DWPA 3KLRA 4GKKL 4B3RL 3MEFA 2YTVA 3A8JE 1U5KA 3S9WA 2WACA 1DXMA 3OW2A 4PMBA 1LABA 4A3CH 2JA6B 4X62L 3N52A 1N32Q 1DZ1A 1PA6A 3BVZA 5IWAL 1WVLA 1JWSD 4QIWE 3GTLB 5FOBB 2E2IH 5LL6S 5CV6A 3M4QA 1HH2P 4PZ7A 3NELA 4RGTA 3D3RA 4X65L 4CDEC 4GZYC 1A62A 1J8IA 2RBMA 2IWHA 2GVBA 1VQPA 1G6PA 4CBVA 4DR3L 1EQVA 3M3YH 2WP8J 2G9DA 1CHQD 1LYLA 4K8JA 2IW3A 5DLQE 1HR0Q 4TRDA 1WCMH 2RDHA 2N49A 1KHIA 5E7NA 1BCPD 3W3AA 1A2UA 4KKUA 5NUCA 2F0KA 1QZGA 2NZ1D 1SSOA 2B2TC 5FLXE 2PNRC 1N36L 1XNQL 1AN8A 4QB4A 5DNFA 5J22A 1ESFA 2A1AA 2O2LD 1MGSA 1JC7A 4P2CB 2EQSA 1KABA 3BG3A 5M5YH 1AEXA 3CKIB 2LSSA 1SRUA 4PMWA 2IX0A 5C44B 2KOLA 1X9NA 1JWUD 1ICWA 2LS01 3KJOA 5K36G 4WJ3M 1ZYRC 2QKIC 5CBEE 1RTOA 3FRPB 1GO3E 4X65Q 3ERQA 3X3NA 3HOZG 2ZTEA 3VDYA 1CFMA 1HNZQ 4LUVA 2QW7A 1X54A 5CV8A 4K2KA 4XYOA 1YIJA 4XTCS 2XNAC 4GOPC 1NBWA 1GUOA 4DN4M 2KHJA 1D1IA 2PI2E 2HD3A 1GHJA 4HAEA 3IFDA 1B1ZA 2OCEA 1NMGA 2WB1G 3I55A 3S1RB 2QDBA 3CRKC 1STNA 3Q22A 2B2VC 1SNDA 3KDFB 3AB9A 4MZ9A 3NE5B 4B08A 5IYCH 1Z6HA 1VQKA 5M3FB 4AQYL 1VDZA 4Y7NB 4RGOS 1E0BA 5IT9L 1PFMA 4QCLA 5L37A 4A3FB 4KTAA 5J1ZA 1OXUA 2RQXA 5JVG3 3M7NA 5I6YA 2WKCA 1L1OA 4LFCQ 3RUZA 1TY0A 3RD4A 3CCUA 4EQNA 3MFYA 3TBIB 3WWVA 3F2DA 2UUBL 2B2VA 2Q8IB 1LTSD 3NWSA 1PYSB 4A3GH 4ZYSA 4DR4Q 2B39A 1A15A 1IBMQ 2E2IB 4I7ZC 4DF7A 4CHTB 1EYAA 1PTOB 2D0PA 3MTSA 3H3VI 1I6HH 2O4XA 2D9UA 5EQ0A 1S5DD 1A63A 3KLSA 4OGQC 2F4IA 2Q2HA 3TP6A 1II3A 2JA7G 1A3UA 4DA2A 1WTPA 2F0LA 5C4XH 3C1EA 5LMNW 3HEJA 5C4HA 4QJFA 3I7FA 1I4HA 3I4NB 3SVMA 3K7UC 3E3XA 4LFCL 2RCFA 4FNFA 5FLMG 3HOVG 4LF5Q 1AE2A 1PMRA 2L15A 3HOWH 1RODA 2F0MA 4PZ8A 1E1TA 1F2MA 1SLJA 3D4DA 3HZXA 4A3MG 4PMCA 2VQEQ 3T53B 3HFZB 2FMMA 3I90A 3PCOB 4MHEA 3HGBA 3S2DH 3ULJA 3QB3A 4IUVA 3HOXB 4YWKA 1NR2A 4OL7A 4DV1L 3BVMA 3L3OC 1SBBB 3KK7A 2XN9C 1EWCA 2XVSA 2AQ2B 2I5LX 4CJ2C 2VQFQ 1XX8A 3A8KE 5JJLA 1O7ZA 1CT1D 2EYOA 2Z6KA 1UEAB 1LT6D 5H1SE 1M4VA 3MZ5A 4BXXG 5TSSA 4N9PA 1E2ZA 5C0XI 3H91A 2CQAA 1MHWC 2NN6G 4M8AA 3TS2A 1L0WA 3S1MB 2B2WC 2R92B 2E8GA 4HIKA 1EQRA 1U4RA 1EQQA 1MBYA 1CKNA 3OIQA 3OYYA 2VS1A 1IXRA 3PQIA 1GUGA 4JI6L 3EQLC 2JA7B 1DD2A 2A6HD 2VB3X 1EUJA 2LXJA 3MXNA 4A3CG 5JEAJ 3EA6A 4DV1Q 3CAMA 3UDFA 3EFXD 4AYBB 4X6AH 1G91A 4BBSG 1R4PB 1CKMA 4P73A 1L0YB 1H9JA 1XPUA 4JVZA 1KL9A 4IUTA 1KXLA 2N3SA 4LMQD 2FJ2A 3BU2A 3PGZA 5KIXA 3HOYG 1TT2A 4A3JH 1XMOQ 4MN3A 1VQBA 3MAQA 3ZYYX 2NVYH 4IOCA 5C3EG 2L9HA 4ABNA 3T1YQ 5KRUA 4YWMA 1F9QA 2NVXB 1E7ZA 3CHBD 3PO3H 4RKLA 3HG9A 3G6EA 1EU4A 1JJGA 1UWVA 1CZGA 3NK9A 1EYDA 4QGUA 4DR5Q 3GQBA 4A3LG 2K50A 4DXGA 4KY6A 2X6GA 4IUNA 3V05A 3MHBA 5HGQA 3KDFA 2MO1A 4R4QA 4TVAB 3DHQA 2EXDA 2WFWA 4I7AA 1TWFB 1GXDC 3A56A 5IWAQ 4JI5L 5FLXc 3KUPA 4OELB 4KHZA 1J6QA 1GKHA 4HCSA 5EBCA 3PIOA 5FLXL 4NP5A 4UPAA 3K7AB 3PIO3 1VQ4A 1PH3A 1MJEA 1XWEA 4UP8A 5A2QE 4DAMA 2K14A 2PQAB 4IFDG 2VL6A 2VB2X 1W3SA 2ZJPA 3SK8A 3ND8A 4K5VA 3CMAA 1XMQQ 5IGGA 4IOAA 1G2TA 5EGTA 3W1GA 4A3IG 1K83B 1PLFA 4ME5A 5EKLA 3CC7A 3C46A 3WDNA 1RF2D 3ND9A 5LL6X 3HP3A 3GD7A 4APVA 4L8JA 2UU9Q 2Z9HA 4R9WA 2RVLA 2ZTCA 5IP9H 1BVSA 4IJLA 3BS1A 2B29A 2K75A 1HQMC 1VQ8A 3S1RH 2HUGA 2IPKD 4RWSC 5CV4A 1EY7A 2R7ZB 2K5VA 2F0JA 2E2HB 2B3GA 1D7QA 2JK8A 1JOOA 5CV9A 1T5XD 2WV6D 4DV5Q 3M4OH 1CHPD 3BDCA 1N8RC 3CP0A 1N33L 3NBHB 3H09A 3H3VC 1I4QA 4GLXA 3I2ZA 4DKAC 4A3KG 1EFWA 4BA1I 1KAWA 1BCPB 5ISRA 2ID0A 3LGJA 4F87A 2PCFB 3QO2A 4YY3L 1N34Q 2K03A 2BA1A 4A3DB 3WOEA 1FR3A 3J81L 1A0IA 5KNBA 5M9OA 4ALPA 4JG2A 3D31A 3I4MH 1ENCA 4FVMA 3KBGA 2RSOA 1C4QA 1PRTB 3CQZH 5C0XJ 1WTOA 3F8TA 4TSSA 1TWHB 5M3FH 2RKSA 3HKZG 4AQYQ 2UXDL 4YCUA 2R93B 1D1KA 3CCQA 2QEXA 1S5FD 3F1ZA 2NVYB 3D6WA 1SR3A 1YJWA 2F0SA 1Q8IA 1V9PA 2NZHA 3U50C 4GNXC 3R2TA 1TWGB 4BY7B 2N78A 4KHVA 1Q81C 2IX1A 4R4TA 1O80A 3J80i 3GTQH 1K3RA 4B9XA 4A3EH 2RF4A 5T1IA 4E6IA 3I4OA 4PG3A 4ID6A 4UY8C 1TWHH 3NP8A 1Y1VB 4KY5A 4Y52H 1SE8A 4JBMA 1FGUA 2XIWA 1JJCB 1GVPA 3CCSA 1YZ6A 2F3IA 3IRBA 3H3VH 1DOKA 1VQMA 3X3MA 1X56A 4BY7H 4LFBL 3H15A 1ASZA 1CK1A 1I94Q 1O7IA 4ME3A 1K73C 1TR5A 3I4MB 1EIHA 2CFMA 4ZCKA 2A68C 4NXML 2L4NA 2UUCL 3J7ZC 4XT3B 4A3KB 3NXWA 1B9MA 4PZ6A 2F03A 1E1OA 2MFIA 4ULLA 1O7YA 4HIOA 2A74C 1CZWA 1VQ9A 4DV7L 2WB1B 4F7XA 3A5UA 1D2BA 4F8MA 4LF5L 2F0EA 3BYYB 3K5NA 3T1HQ 4BY1H 3TRZA 5D14A 4KKTA 1EOTA 1B44D 2QEJC 4CJ0B 4HJAA 3EROA 2EE1A 1Y8PB 2EJMA 5M5WB 3OOCA 4DR7Q 1OXTA 1I50H 1K0RA 4DV2Q 2F0QA 2OF1A 3CCLA 5C4XB 3GTOB 2R7ZH 3E0JA 4OX9L 4POGA 3G71A 1KNEA 5K5PA 1VQGA 2DUDA 1CM9A 2F0PA 2K5QA 3I3CA 3TP8A 3RNUA 1Z9FA 2E5LL 2VXWA 1DJRD 2HDLA 2IT1A 3AFQA 3VR3A 3CPWA 4DV6Q 2KHSA 3V96A 4DV7Q 5IP7G 4DU9A 4HIMA 4IN3A 1Y8OB 3I4LA 2BE5D 2Z8LA 2UXCQ 1V1QA 2HDMA 3R2IA 4DXFA 2B63B 1ZYRD 1EIGA 4NB3A 3UDGA 3TP5A 4C3JB 1T5EA 1WTXA 1YJ9A 5GROA 4XXEA 1PFNA 3HKZE 3KBXA 1RDPD 1NTGA 3QR8A 1YNND 1RJTA 4DV3L 2K5NA 3H6MA 3L7ZC 1WI5A 1K8AC 1QVGA 1IBKQ 3PUZA 1EYGA 1FD7D 2KECA 2GN5A 3NEMA 1AH9A 1LM0A 2PYKA 3WOFA 1Z47A 2PZWA 1J5EL 4J8QA 5LMNL 3S1NH 2F0GA 4LF4Q 4FXKC 1FNVA 1GM5A 1XXGA 3W2DA 4ZQ3A 1S5ED 2ZTDA 4Q5VA 1SE2A 4H0LC 3GTJH 2AWOA 4P74A 3GTMH 1KIXA 1KC8C 4G7HC 1EU3A 3KYHC 3FKIB 4GOPA 3FPPA 2XSCA 1WTWA 2EIFA 3M4PA 4MTKA 1SNOA 4DNTB 1YNXA 1SYBA 1AZPA 4YWLA 4UHVA 3RZOH 5K36H 3RLNA 2KCNA 4C3JG 3DLLA 3BZDB 3U9SA 1JMCA 3HOZH 2XGTA 1NUCA 1SYDA 1C48A 5HURA 1ET6A 1KDBA 4A3BB 4ZUJA 3GTJB 3HOUB 2K01A 1SROA 4FF3A 2E2DC 4KJNA 1STHA 1B70B 3E0EA 2E2JB 4A3KH 4CDFC 2DGYA 2J4XA 2YTXA 3VR4A 4IUPA 2XRSD 3RLOA 1PZKD 5FJ8G 1CI3M 1T9HA 3K57A 4A3DH 1MSGA 1Y1VG 3RN2A 3W1BA 1HUNA 2X6LA 3HOUH 4OEMB 1BUVT 2C5CA 1IL2A 5JAVA 3U9OA 1PYWD 3PUXA 2Q8RE 4XIGS 1M90C 1TY2A 2EZVA 4GNXB 2JA9A 3TN2A 1XNRL 3S14H 5IGBA 4IPGA 3QG1A 3HOYB 4P75A 3GTQB 1TWAH 4A93B 1NE3A 3MEHA 1DCZA 1PH5A 3FKIH 3OIPA 2H5XA 3ITPA 2K1BA 2B63H 5I9PA 4ZRZA 1IYJB 5A35A 1BBUA 5M5XH 5CV7A 3VYTA 3K5LA 1QILA 4A3MB 3URYA 3CU7A 4IUUA 3L2PA 3E9IA 4DAVA 1EL0A 2Z6KC 4DGZA 4B3SQ 1IW7C 2YYZA 4PQXA 5KEEA 2SDFA 4OO1I 1B8AA 3PSIA 1K83H 5BN5A 4GKJL 1JB7A 2F0OA 2Q2IA 2VY3A 1HNXQ 2OT2A 2NN6H 2A6HC 3K8AA 1A2TA 4B3TL 5C4XG 1QG7A 5I4DA 2KVMA 2GVAA 1MJCA 2Y0SB 4JOIA 2LMCB 2K05A 2KBNA 1DYQA 4L5TA 4O42A 2KENA 1CTMA 1VQLA 5C44G 3ZJYC 1WOCA 5FK9C 4A3GG 4KD4A 1VQCA 1KD1C 4JI2L 1I5FA 4R4OA 2F3VA 4A3FG 4B3SL 4LFAL 1BXTA 4HJ5A 3NENA 1QUQB 3KFUA 3C1FA 3GO5A 1BF4A 3IKJA 4R4CA 1N9WA 2CKZB 2HHHL 1SJED 2EYMA 4IPDA 2Y0SE 4OHJA 1EWHA 4HJ8A 4IO9A 2R7ZG 5M3MH 2F0IA 4JI6Q 3IFTA 4JCVE 2E75C 5D65A 4G57A 1X3EA 2E74C 5COYA 2UUBQ 2UUCQ 1I6HB 4DV0L 2NWGA 1PHJA 1S4ZA 1NY4A 4GOPB 4C1NK 4A3LH 2EY1A 2F52A 4X3UA 4FXDA 2NB0A 1LACA 4X3TA 1SMYD 1SNPA 2EJGC 1RHPA 4L5QA 4M1UB 3PUVA 3JAML 3VA7A 4DAPA 4HN7A 1RTNA 1HZAA 5JOBA 2UUAL 4MNOA 4WRDA 2V4DA 4Q0FA 3I4NG 1BKBA 2B2WA 2Y0SG 5D3DA 3SK6A 1ESRA 4RGNA 1YVCA 2AQ3B 2QF7A 4IFDH 3TP7A 1SYCA 2Q2UA 3MXGA 2XTIA 4IUQA 3NBHA 3STBD 1HA5A 4RG1A 2L12A 1U4LA 3KF8A 1GJXA 3BZCA 2K5DA 2WAQB 1E2WA 1QNUA 1B9NA 4HEDA 1XNRQ 1CUKA 1PVOA 5IOCA 3FPUB 2AKWB 3SGIA 2YTYA 3M4OB 1IZ6A 1VQFA 2K04A 4IALA 2FFKB 1VMCA 1ASYA 5FO7B 1LTAD 1SYEA 2CQOA 1K8GA 3GTMB 3IAYA 3CCRA 1VQIA 2IJ0A 4LF9L 1PH4A 5JJIA 2EJFC 1SXTA 3S2HB 1IKLA 4CGYB 3PO2B 2CW0C 1NCVA 4HCEA 4LAAA 2BDOA 1CQVA 5JJKA 1LTID 3CRLC 5HGTA 4QQBX 1X65A 4X3KA 1C7YA 1Y69U 1IYVA 3DWQA 4DUYQ 4BBSH 1LT5D 4KN4C 4ZK9B 2QILA 4OWXB 5ELEA 5CR3A 3A54A 2F0DA 5DEHA 5AJ3L 2JJQA 4JI7Q 4B3TQ 2DY7A 1BDOA 4AYBG 5C3EH 4EQPA 3CCEA 1DM0B 5FJ8H 4IQZA 4OWTB 3CC4A 4A3DG 2KEEA 4AIMA 2HCIA 5M3FG 2ATWA 1SFOB 3S1NB 3NQIA 2EY6A 2MPMA 2BA0A 1ET9A 1QZHA 1Q86C 3R8BA 5C3EB 3H0GG 4CDDC 3D4WA 1XTCD 5AFWA 3Q0AA 4MIUA 4JI1L 1XMOL 2MJ8A 1JJ2A 5EPKA 3T16A 1G8ZD 1I3QB 3QOJA 3U4ZA 2HHHQ 4DK1A 1SNMA 2A69C 2HIVA 2EVBA 3G48A 1ILQA 2KHIA 2L55A 2A68D 1HRJA 3GP7A 3PMFA 1EY9A 4GLAC 5GADC 3GTGH 3PO2H 3VA5A 5I6WA 2NTSA 1VF5C 1HA6A 4A75A 2L0CA 4OXPA 1ML0D 1FVIA 3PUYA 1O78A 3RMHA 4JK1C 2KA7A 2E5LQ 4HSPA 2JA5G 4JBWA 3P1HA 5GAHC 3FHWA 3J81E 4DV6L 4HMJA 4HR7B 2ZJRA 4JI5Q 4QUCA 2FHTA 1VQEA 4UP7A 1QWYA 4HSVA 3FP9A 3I4MG 4H02A 5M5XB 3VR2A 2K5HA 2EYJA 4DAYB 4JYAQ 4FYDA 5IP9G 3Q6SA 1JQYD 1OXSC 1NJIC 2XRQD 4KKSA 2A69D 4LUOA 3KF6B 3SDZA 2O5IC 5IIFA 3S1QH 3QOLA 5EAYA 4ZLTF 1TWAB 4A93H 5IGCA 5G3LD 5E1FA 4DV3Q 1OXVA 4NXMQ 3P7JA 4A3EG 2A5HA 1HZCA 1V1OA 2PMZE 5KYIA 5KGUA 2ALYB 1BCPC 1KDCA 1UAPA 4K6DA 4QIWB 2EYPA 2NVXH 2J0TD 2RHQB 2Z0SA 4JW0A 1B50A 1OO9B 1B7YB 3SXHA 3VR6A 3BZKA 3N6RA 3DM3A 4B3ML 1QE6A 1TQOA 1Q8KA 4RGMA 2B2YC 3NBIA 3SK4A 4XDXA 3DWAA 4FP5D 1PH2A 5C6AA 3D6CA 2RDGA 3TEHB 3GTPH 4DV4Q 4A3IB 3S24A 1PYBA 2BCOA 2MHVA 3GV3A 4AYBE 3TSSA 1VQ7A 1G2SA 2UXBL 1HXYD 1QCBD 4DV2L 1IBLL 4R4IA 1X6OA 4DFAA 4N9TA 2CHBD 1VMPA 3KF6A 2FINB 3FVQA 1P16A 1OXXK 4DPGA 5M3MB 4DNRB 1KRSA 3HOWB 4K0KL 5JEAH 3DUZA 1EEFD 3EN2A 3T4AC 3BDOA 2MUYA 2BE5C 4LW1A 5AJ3Q 1I6VC 2F0NA 1YITA 3J7AF 2DN8A 5C4ZA 4LF7Q 1A8VA 2I0QA 3I4NH 3A8IE 1BBXC 1QB5D 4RHRA 1STGA 3C2PA 2AQ1B 4BY7G 1G291 2K4KA 3HKSA 4KV6A 1BR9A 4BS9A 2K33A 3P20A 5CORA 1E2VA 1Q3LA 1K8OA 1GHKA 2CCZA 4DR2Q 1AFPA 2HCCA 3U4VA 1EY8A 2K52A 3NTIA 3S2DB 4RCNA 1HCZA 5IP7H 1SN8A 1TVXA 4NMZA 4DK3C 1Q90A 3CMEA
chains in the Genus database with same CATH topology
2SNSA 1SJHD 2A6EC 3HRZC 4PNYA 1NAPA 3SHLA 2IX3A 2E76C 4FF2A 4IFDI 1F2ZA 4TKOB 1KDAA 2D62A 4KK7A 4B9WA 5EBDA 4YIJA 3NHHA 4O1NA 2KJXA 2HQEA 2Z1CA 1HPCA 1D5ZC 4U68A 1QOHA 1Y1WB 3QWNA 2EOTA 1LTGD 2ICIA 1X3QA 3GTKB 2AUJD 1YNJD 3ONAB 1F9RA 3GTPB 4ZAIA 3G6JB 2EPBA 1M8AA 5E4XA 1HTLD 3FMCA 4NKLA 1W6JA 1HFGA 1I4PA 2MGSA 1PXUA 4R8IA 4A3JB 1F2YA 1QNKA 1FNWA 2JP1A 1DONA 1XYIA 1LT4D 3BYTB 3HOZB 4H44C 1JICA 4KY7A 5JVH3 2JA8B 1VF7A 4C2MB 1AP0A 1ZXTA 4C3HG 1FYCA 5DM63 1LTRD 5C5LA 4H13C 2JEBI 2JSOA 3HKZB 3RLFA 3E5SA 2R61A 3OSOA 3D8GA 4DAYA 2ENBA 2I46A 4Z9CB 1EY4A 3NUCA 3F2UA 2JEAI 5J39A 5KYLA 3OMCA 4K5WA 2WINB 3TMEA 1NSNS 3BVGA 5A2QL 1SEBD 3OPOA 4LJZC 3M3YB 1V43A 1BNZA 1I4RA 1X3PA 2RA4A 1H9RA 1PDQA 4FF4A 4G7ZC 1W6KA 5F2DA 1U4MA 1H9SA 4V190 1KTKA 3OHXC 1WTRA 1Z7TA 1EY6A 3FEWX 1H9SB 5T1GA 3OW7A 4OO1G 2NN6I 1WTVA 1B53A 2JXMB 1STYA 2B2TA 3HOVB 1V8QA 5ELCA 1O7LA 2G9HD 4BWGB 1EZ6A 4ZKCB 4EQOA 1UUPA 3C3LA 1JORA 2H4OA 2K28A 4V0BA 1SYFA 2O5JC 2M2LA 1BCPF 2ZXRA 2VNUD 2AUKA 2OXPA 4J6HA 4BA2I 4IURA 3JAME 1GUNA 5KNCA 4QMGA 3K59A 2NYZD 1LV9A 1S5CD 1YNNC 1HTPA 2JYOA 4S3SA 1F9SA 1ONLA 1RCVD 2SNMA 1I4GA 2EDGA 3AU7A 4J1MA 2ZXOA 3DEOA 2R3ZA 4C56C 2ZXPA 4XT1B 5C0XG 2Z4HA 1MI2A 1LT3D 1PRTD 4RAUC 3DM1A 1LTTD 4RA8A 3NTHA 3V2TA 4X3SA 2N88A 3SR1A 3PO3B 3T51B 1S5BD 5BN3A 3VR5A 1TIID 1DOLA 2KCCA 1RKNA 1K8MA 5ELFA 1I4XA 4KN7C 4PV1C 1WD0A 2DNEA 3QIAA 4XQQA 4A3EB 5FO8B 3MVVA 1JR0D 2EXZA 4C3IG 3SE0A 5BN4A 2F0WA 1PRTC 2B8FA 3PV0A 1EY5A 1DOMA 1R4QB 1ZEQX 1SNCA 2D5DA 1Q12A 5CC4A 2F3WA 5C4JB 2B2UA 3M7GA 1LTBD 3GTGB 1B4OA 1GUTA 3OWFA 3K5MA 4NDXA 1RD9D 3O13A 1STBA 4CJ1B 3UI2A 2OEOA 1ILPA 2PW7A 5EKIA 2KUMA 4K2LA 1SNQA 3TDQA 1EY0A 4RCOA 2EYFA 1IKMA 4ZKBB 4XYQA 5I2YA 1J9OA 4RFBA 2A73B 3A7LA 1QJOA 3GV6A 3L9AX 2NVQB 3T56B 3VYSA 2TSSA 2LY7A 1SDFA 1UNSA 2K7VA 1F77A 2PW5A 2DY8A 5G3LF 5IT9E 1IL8A 2CVRA 2B2UC 1V1PA 1ENAA 4C3IB 4HMIA 1B3AA 3I91A 1GUWA 2WIIB 1MSHA 1TWCB 2ICEC 4C1NI 2F0TA 3I72A 4BBSB 2PQEA 2NBFA 3HS0C 1PZJD 2I07B 3NPPA 1SYGA 1FNUA 5IGFA 4OIJA 1LLRD 4ZUIA 1WD1A 3R3OA 2D2CC 3E6ZX 4ODGA 3LWUA 1TS3A 3T13A 4K6LA 1Y8NB 2R6GA 1IYUA 3G7LA 1HHVA 2L1BA 3S16B 3MXPA 2F1MA 2PZTA 4FXGC 4QUFA 1G6ZA 2MP1A 5EPLA 1KNAA 2RDFA 1EQTA 4KD3A 5JPMC 2Z4IA 4IFDJ 2EYHA 4WORA 4EGVA 2KEDA 1CA5A 3H0GB 1TS2A 3Q24A 3NQTA 5JJZA 1D5XC 1CQFA 1U4PA 1I50B 3J80L 2CW0D 1AZQA 1SE4A 1SMYC 1BQQT 4QF4A 3OWEB 5EPJA 3A55A 1EEID 2J7ZA 5FKAC 2A6ED 1B2TA 5IODA 3QJYA 3P75A 1JWMD 1FGBD 2YU9B 5KNDA 1CA6A 2F0VA 1A3VA 2L11A 4WJWA 2NUCA 3PIP3 3J7YW 1NR4A 5EKKA 3J7AV 4KI0A 2N55A 1KLUD 4KJOA 3TZUA 4OIKA 5CBAE 1JCKB 3PUWA 3I8ZA 3MXUA 1Q1BA 5CV5A 2EYLA 4BBRB 1D5MC 2F0UA 4HTHA 2L5TA 3BDLA 2IL8A 1V1PB 2TMPA 2KQ3A 2LFNA 2BOSA 5M5YB 5CGKA 1TS4A 1EFID 5JEAG 3M4YA 1ZKOA 4RH6A 1PTOC 1IW7D 1H9MA 4G4KA 3SEBA 3S15B 2NVTB 4H7BA 1TKWB 1WCMB 3IL8A 3NSWA 2XWBB 1PTOH 2B2YA 4A3GB 1L0XB 4K5XA 3S1QB 3MC0B 4UAIA 1KAAA 1BO0A 3VYUA 3NWTA 3S14B 3LNNA 1JOKA 1SAPA 3D4RA 3A7AB 1HUMA 3OMGA 2NTTA 4G7OC 2SEBD 2M00A 4C3HB 1PTOD 4RHSA 1STAA 1JB3A 4L6TB 1A6XA 3Q23A 4CKCA 1EYCA 3EVQA 3MFGA 3I73A 3M85A 1WTQA 3RZDB 2RSNA 2X69A 4XQNA 1D6EC 1EZ8A 3R93A 1JE4A 4F88A 4DK0A 4NW2A 5ELBA 3H94A 2K32A 5E3FA 3SK5A 1KLGD 2BDNA 5JPNC 3RZOB 2H1EA 5CYUA 2EY5A 5I2XA 1MD2D 4K14A 2AWNA 1GUSA 5C5MA 1LO5D 3K5OA 1A3TA 5LHY1 4ILWA 2JA5B 2K6AA 1IHZA 2GA4B 2JE6I 4OO1H 2PMZB 5DAUA 5DM73 5EJWA 2Q8TA 1U9RA 4U673 4EVOA 2ZT9C 1TU2B 2F0FA 4TQUS 1F2LA 3DXJC 3NTKA 4L63B 2LKVA 2K5WA 3EJIA 1ENFA 1BOSA 1X32A 2SOBA 4XQJA 1PFBA 4LK1C 5IGDA 5FO9B 1R9TB 1PTOF 1STEA 1GOZA 4CKBA 4FO2A 2QCPX 4R8NA 3S17B 2PO4A 3K0YA 4KMUC 1HQRD 5IGEA 3K6OA 2C9OA 1H9KA 3VYRA 1JOQA 2XWJB 2WKDA 1F9PA 5CMDA 4I65A 3CQZB 2EY2A 1PRTF 3MA2B 2PZUA 3FDTA 2M9VA 3TZDA 5C0XH 3KLSX 3J80E 5C3WA 5I9OA 5C3XA 1Q1EA 2B8GA 1YNJC 4CKEA 3I70A 3DMUA 3AMUA 4WFN3 1PZID 2PPBC 1VCIA 5ELDA 4BY1B 4IZ8A 1C8CA 2DNCA 4FF1A 4UDUC 1TS5A 4RKBA 4K8IA 1AW7A 3K58A 2VUMB 5E4WC 3LX0A 3LWEA 3DEPA 2FMCA 1HFNA 3MWYW 1SE3A 5D3IB 2F0HA 3DWPA 3KLRA 3A8JE 3S9WA 2WACA 1DXMA 4PMBA 1LABA 2JA6B 3N52A 1DZ1A 3BVZA 1WVLA 1JWSD 3GTLB 5FOBB 5LL6S 5CV6A 4RGTA 3D3RA 4GZYC 1J8IA 2RBMA 2IWHA 4CBVA 1EQVA 2WP8J 2G9DA 1CHQD 4K8JA 2IW3A 4TRDA 2RDHA 1BCPD 3W3AA 1A2UA 4KKUA 5NUCA 2F0KA 1SSOA 2NZ1D 2B2TC 5FLXE 2PNRC 1AN8A 4QB4A 5DNFA 5J22A 1ESFA 2O2LD 1MGSA 1JC7A 4P2CB 1KABA 3BG3A 1AEXA 3CKIB 4PMWA 2IX0A 5C44B 2KOLA 1JWUD 1ICWA 2LS01 5K36G 1ZYRC 2QKIC 5CBEE 1RTOA 3FRPB 3ERQA 3X3NA 1CFMA 5CV8A 4K2KA 4XYOA 4XTCS 2XNAC 1GUOA 4DN4M 1D1IA 1GHJA 3IFDA 4HAEA 1B1ZA 3S1RB 2QDBA 3CRKC 1STNA 3Q22A 2B2VC 1SNDA 3AB9A 3NE5B 4B08A 1Z6HA 5M3FB 1VDZA 4Y7NB 4RGOS 1E0BA 5IT9L 1PFMA 4QCLA 4A3FB 4KTAA 5J1ZA 1OXUA 2RQXA 5JVG3 3M7NA 5I6YA 2WKCA 3RUZA 1TY0A 3RD4A 4EQNA 3MFYA 3TBIB 2B2VA 2Q8IB 1LTSD 3NWSA 4ZYSA 2B39A 1A15A 2E2IB 4I7ZC 4DF7A 4CHTB 1EYAA 1PTOB 3MTSA 2O4XA 2D9UA 5EQ0A 1S5DD 3KLSA 4OGQC 2F4IA 3TP6A 1II3A 1A3UA 4DA2A 1WTPA 2F0LA 3C1EA 3HEJA 5C4HA 1I4HA 3I4NB 3SVMA 4FNFA 1PMRA 1RODA 2F0MA 1F2MA 3D4DA 3HZXA 4PMCA 3T53B 2FMMA 3I90A 4MHEA 3HGBA 3QB3A 4IUVA 3HOXB 1NR2A 4OL7A 3BVMA 3L3OC 1SBBB 3KK7A 2XN9C 1EWCA 2XVSA 2AQ2B 4CJ2C 1XX8A 3A8KE 1O7ZA 1CT1D 2EYOA 1UEAB 1LT6D 1M4VA 3MZ5A 5TSSA 4N9PA 1E2ZA 5C0XI 3H91A 2CQAA 2NN6G 4M8AA 3S1MB 2B2WC 2R92B 1U4RA 1MBYA 3OIQA 1GUGA 3EQLC 2JA7B 1DD2A 2A6HD 2VB3X 3MXNA 5JEAJ 3EA6A 3EFXD 4AYBB 1G91A 1R4PB 1L0YB 1H9JA 4IUTA 4LMQD 2FJ2A 5KIXA 1TT2A 4MN3A 3MAQA 3ZYYX 2L9HA 4ABNA 5KRUA 1F9QA 2NVXB 3CHBD 4RKLA 3HG9A 1EU4A 1CZGA 3NK9A 1EYDA 3GQBA 4DXGA 4KY6A 2X6GA 4IUNA 3V05A 3MHBA 3DHQA 1TWFB 1GXDC 3A56A 3KUPA 4KHZA 4HCSA 5EBCA 5FLXL 4NP5A 3K7AB 3PIO3 1XWEA 5A2QE 4IFDG 2VB2X 3SK8A 3ND8A 4K5VA 5IGGA 1G2TA 5EGTA 1K83B 1PLFA 4ME5A 5EKLA 3C46A 3WDNA 1RF2D 3ND9A 5LL6X 3HP3A 3GD7A 4L8JA 4R9WA 2RVLA 3BS1A 1HQMC 2HUGA 2IPKD 4RWSC 5CV4A 1EY7A 2R7ZB 2F0JA 2E2HB 1JOOA 5CV9A 1T5XD 2WV6D 1CHPD 3BDCA 3H09A 3H3VC 1I4QA 4BA1I 1BCPB 5ISRA 2ID0A 4F87A 2PCFB 3QO2A 2K03A 2BA1A 4A3DB 3WOEA 1FR3A 3J81L 5KNBA 5M9OA 3D31A 1ENCA 4FVMA 3KBGA 2RSOA 1C4QA 1PRTB 5C0XJ 1WTOA 4TSSA 1TWHB 2RKSA 2R93B 1D1KA 1S5FD 2NVYB 3D6WA 2F0SA 1Q8IA 3R2TA 1TWGB 4BY7B 4KHVA 2IX1A 1O80A 4B9XA 4E6IA 5T1IA 4ID6A 3NP8A 1Y1VB 4KY5A 2XIWA 1DOKA 3X3MA 1CK1A 1TR5A 3I4MB 1EIHA 2A68C 2L4NA 4XT3B 4A3KB 3NXWA 1B9MA 2F03A 4ULLA 1O7YA 2A74C 1CZWA 2WB1B 4F7XA 1D2BA 4F8MA 2F0EA 3BYYB 3K5NA 5D14A 4KKTA 1EOTA 1B44D 2QEJC 4CJ0B 3EROA 2EE1A 1Y8PB 2EJMA 5M5WB 3OOCA 1OXTA 2F0QA 2OF1A 5C4XB 3GTOB 3E0JA 1KNEA 5K5PA 2F0PA 1CM9A 2K5QA 3I3CA 3TP8A 2VXWA 1DJRD 2HDLA 2IT1A 3VR3A 2KHSA 3V96A 4DU9A 1Y8OB 4IN3A 3I4LA 2BE5D 2Z8LA 2HDMA 3R2IA 4DXFA 2B63B 1ZYRD 1EIGA 3TP5A 4C3JB 1T5EA 1WTXA 4XXEA 1PFNA 3KBXA 1RDPD 1YNND 1RJTA 3H6MA 3L7ZC 3PUZA 1FD7D 2KECA 2PYKA 3WOFA 1Z47A 2PZWA 4J8QA 2F0GA 4FXKC 1FNVA 1XXGA 3W2DA 4ZQ3A 1S5ED 4Q5VA 1SE2A 4H0LC 2AWOA 4G7HC 1EU3A 3FKIB 3FPPA 2XSCA 1WTWA 1SNOA 4DNTB 5K36H 1SYBA 1AZPA 2KCNA 4C3JG 3BZDB 3U9SA 1NUCA 1SYDA 1C48A 5HURA 1ET6A 1KDBA 4A3BB 4ZUJA 3GTJB 3HOUB 2K01A 4FF3A 2E2DC 4KJNA 1STHA 2E2JB 2J4XA 3VR4A 4IUPA 2XRSD 1PZKD 1CI3M 3K57A 1MSGA 1HUNA 2X6LA 1BUVT 2C5CA 5JAVA 3U9OA 1PYWD 3PUXA 2Q8RE 4XIGS 1TY2A 2EZVA 3TN2A 5IGBA 3QG1A 3HOYB 3GTQB 4A93B 3MEHA 1DCZA 3OIPA 3ITPA 2K1BA 5I9PA 4ZRZA 5A35A 5CV7A 3VYTA 3K5LA 1QILA 4A3MB 3URYA 3CU7A 4IUUA 4DAVA 1EL0A 4DGZA 1IW7C 2YYZA 4PQXA 5KEEA 2SDFA 4OO1I 5BN5A 2F0OA 2OT2A 2NN6H 2A6HC 1A2TA 1QG7A 5I4DA 2KVMA 2Y0SB 2LMCB 2K05A 1DYQA 4O42A 1CTMA 5FK9C 4KD4A 2F3VA 1BXTA 3C1FA 3GO5A 1BF4A 3IKJA 1SJED 2EYMA 4OHJA 1EWHA 2F0IA 3IFTA 2E75C 5D65A 4G57A 2E74C 5COYA 1I6HB 2NWGA 1S4ZA 4C1NK 2EY1A 4X3UA 4FXDA 2NB0A 1LACA 4X3TA 1SMYD 1SNPA 2EJGC 1RHPA 4M1UB 3PUVA 3JAML 3VA7A 4DAPA 4HN7A 1RTNA 5JOBA 4WRDA 2V4DA 4Q0FA 2B2WA 5D3DA 3SK6A 1ESRA 4RGNA 2AQ3B 2QF7A 4IFDH 3TP7A 1SYCA 3MXGA 4IUQA 3NBHA 1HA5A 2L12A 1U4LA 3KF8A 1GJXA 2K5DA 2WAQB 1E2WA 1QNUA 1B9NA 4HEDA 5IOCA 3FPUB 3M4OB 2K04A 4IALA 2FFKB 1VMCA 5FO7B 1LTAD 1SYEA 3GTMB 3IAYA 2IJ0A 2EJFC 1SXTA 3S2HB 1IKLA 4CGYB 3PO2B 2CW0C 1NCVA 4HCEA 4LAAA 2BDOA 1CQVA 1LTID 3CRLC 5HGTA 4X3KA 1Y69U 1IYVA 3DWQA 1LT5D 4KN4C 4ZK9B 2QILA 5ELEA 5CR3A 3A54A 2F0DA 5DEHA 2DY7A 1BDOA 4EQPA 1DM0B 4IQZA 2KEEA 2HCIA 1SFOB 3S1NB 3NQIA 2EY6A 2MPMA 2BA0A 1ET9A 3R8BA 5C3EB 3D4WA 1XTCD 5AFWA 3Q0AA 4MIUA 2MJ8A 5EPKA 3T16A 1G8ZD 1I3QB 3QOJA 4DK1A 1SNMA 2A69C 2EVBA 1ILQA 2L55A 2A68D 1HRJA 3GP7A 3PMFA 1EY9A 3VA5A 5I6WA 2NTSA 1VF5C 1HA6A 2L0CA 1ML0D 3PUYA 1O78A 3RMHA 4JK1C 2KA7A 4HSPA 4JBWA 3P1HA 3J81E 4HMJA 4HR7B 4QUCA 2FHTA 1QWYA 4HSVA 5M5XB 3VR2A 2EYJA 4FYDA 3Q6SA 1JQYD 1OXSC 2XRQD 4KKSA 2A69D 3SDZA 2O5IC 5IIFA 3QOLA 4ZLTF 1TWAB 5IGCA 5G3LD 5E1FA 1OXVA 3P7JA 2A5HA 1V1OA 5KYIA 5KGUA 1BCPC 1KDCA 1UAPA 4K6DA 4QIWB 2EYPA 2J0TD 1B50A 1OO9B 3SXHA 3VR6A 3N6RA 1QE6A 1TQOA 4RGMA 2B2YC 3NBIA 3SK4A 4XDXA 3DWAA 4FP5D 5C6AA 3D6CA 2RDGA 4A3IB 3GV3A 2BCOA 2MHVA 3TSSA 1G2SA 1HXYD 1QCBD 4DFAA 4N9TA 2CHBD 1VMPA 2FINB 3FVQA 1OXXK 5M3MB 4DNRB 3HOWB 5JEAH 3DUZA 1EEFD 3T4AC 3BDOA 2MUYA 2BE5C 1I6VC 2F0NA 3J7AF 2DN8A 5C4ZA 3A8IE 1BBXC 1QB5D 4RHRA 1STGA 3C2PA 2AQ1B 1G291 4KV6A 1BR9A 4BS9A 2K33A 3P20A 5CORA 1E2VA 1Q3LA 1K8OA 1GHKA 1AFPA 2HCCA 1EY8A 3NTIA 3S2DB 4RCNA 1HCZA 1TVXA 4NMZA 1Q90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYZ D;  1A15 A;  1SDF A;  1G91 A;  1LV9 A;  1SAP A;  1AZP A;  1B2T A;  2JYO A;  1HUM A;  1F9S A;  2DY8 A;  4ZLT F;  3MTS A;  1IKL A;  4IUT A;  3DEO A;  1F9P A;  1NCV A;  2R3Z A;  1IL8 A;  5CMD A;  2D9U A;  5EQ0 A;  3QO2 A;  4LMQ D;  2CVR A;  2FJ2 A;  1NAP A;  3P7J A;  2B2U C;  2K03 A;  4X3K A;  2K01 A;  4XT1 B;  1MI2 A;  3F2U A;  4MN3 A;  1KNE A;  1CA6 A;  1BF4 A;  1SSO A;  1B3A A;  2L9H A;  1CM9 A;  2B2T C;  2NZ1 D;  3I91 A;  3I3C A;  4ZK9 B;  2L11 A;  1F9Q A;  4RAU C;  1WTP A;  3FDT A;  3DM1 A;  1MSH A;  1GUW A;  5DNF A;  4IUP A;  3TZD A;  2VXW A;  2HDL A;  1MGS A;  4RA8 A;  1WTQ A;  3SVM A;  5D65 A;  1MSG A;  4X3S A;  2N88 A;  2RSN A;  2X69 A;  1BNZ A;  1B50 A;  2DY7 A;  2KOL A;  2RSO A;  1NR4 A;  3R93 A;  1X3P A;  2X6L A;  1HUN A;  1WTO A;  1JE4 A;  1PDQ A;  2HDM A;  1QE6 A;  2RA4 A;  5COY A;  1ICW A;  2B2Y C;  4NW2 A;  4U68 A;  1U4M A;  2N55 A;  2X6G A;  4XDX A;  2NWG A;  1S4Z A;  1DOL A;  1EIG A;  1ROD A;  2EOT A;  5CBE E;  2KEE A;  2Q8R E;  1RTO A;  2BDN A;  3D6W A;  2HCI A;  4OIJ A;  4X3U A;  2H1E A;  1WD1 A;  1X3Q A;  3TN2 A;  1WD0 A;  1WTX A;  4X3T A;  3GV3 A;  1G2S A;  1O80 A;  2FMM A;  2MPM A;  4OIK A;  1WTR A;  1PFN A;  3I90 A;  1RHP A;  3KBX A;  3ONA B;  3KUP A;  5T1I A;  4DN4 M;  5CBA E;  4MHE A;  1F9R A;  1C8C A;  4HCS A;  1VMP A;  1RJT A;  3I8Z A;  1RTN A;  4ZAI A;  5T1G A;  3IFD A;  4HAE A;  4IUV A;  2EPB A;  2FIN B;  5AFW A;  1M8A A;  1NR2 A;  2XIW A;  5E4X A;  2KEC A;  1DOM A;  2MJ8 A;  2B2W A;  2K1B A;  5EPK A;  1B53 A;  1WTV A;  1DOK A;  3G7L A;  1HHV A;  2IL8 A;  1HFG A;  1ESR A;  2L1B A;  2B2T A;  4CJ2 C;  1XX8 A;  1G2T A;  2MGS A;  2B2V C;  1O7Z A;  5E4W C;  4R8I A;  3LWE A;  1PLF A;  4IUU A;  5EJW A;  1EL0 A;  2B2U A;  1ILQ A;  3DEP A;  2Q8T A;  1QNK A;  4IUQ A;  1HRJ A;  1EIH A;  2JP1 A;  4QUF A;  1XYI A;  3MWY W;  1DON A;  2MP1 A;  1BBX C;  1G6Z A;  1HFN A;  1B4O A;  2L4N A;  3H91 A;  2SDF A;  5EPL A;  1KNA A;  1E0B A;  1PFM A;  2L12 A;  4XT3 B;  3HP3 A;  4ZKC B;  1EQT A;  1U4L A;  1F2L A;  4CJ1 B;  1HA6 A;  1JIC A;  4R9W A;  2B2W C;  3UI2 A;  1ML0 D;  5COR A;  2RVL A;  1U4R A;  2K28 A;  1ILP A;  1O7Y A;  1Q3L A;  2KED A;  3IL8 A;  1CA5 A;  4HED A;  5EKI A;  2KUM A;  3N52 A;  1AP0 A;  1ZXT A;  2HCC A;  5JJZ A;  1DZ1 A;  1X32 A;  2B2Y A;  3FPU B;  2HUG A;  2M2L A;  4RWS C;  1QG7 A;  1WVL A;  1U4P A;  4QUC A;  2FHT A;  2KVM A;  1PFB A;  4HSV A;  1IKM A;  4ZKB B;  2K04 A;  2B2V A;  2FFK B;  1VMC A;  1J9O A;  4UAI A;  1TVX A;  1WTW A;  1AZQ A;  2K05 A;  5D14 A;  3GV6 A;  3Q6S A;  4IUR A;  1BO0 A;  1EOT A;  4CJ0 B;  5EPJ A;  2EE1 A;  2J7Z A;  4O42 A;  1J8I A; 
#chains in the Genus database with same CATH topology
 4GN4 B;  2SNS A;  5IE8 A;  1SJH D;  4GS3 A;  1E3P A;  2A6E C;  3HRZ C;  5GAG C;  4PNY A;  2I5M X;  1TWC H;  1NAP A;  3SHL A;  2IX3 A;  2E76 C;  3ER0 A;  4UP9 A;  4FF2 A;  1YHB A;  3ULP A;  4C3J H;  1K9M C;  4IFD I;  1F2Z A;  4TKO B;  5HY6 A;  3TS0 A;  3J81 c;  1KDA A;  2D62 A;  1PH6 A;  1E24 A;  4KK7 A;  2Q2T A;  4JBJ A;  4B9W A;  5EBD A;  4YIJ A;  3NHH A;  2FXQ A;  1UE7 A;  4O1N A;  2KJX A;  2HQE A;  2Z1C A;  1HPC A;  1D5Z C;  2NVQ H;  4U68 A;  4A3B G;  4IJH A;  1QOH A;  3UDI A;  1Y1W B;  1PV4 A;  3QWN A;  1QVC A;  2EOT A;  4C3I H;  3Q8D A;  4KHP L;  1LTG D;  2ICI A;  1X3Q A;  3GTK B;  3K0X A;  2F4V Q;  2AUJ D;  1YNJ D;  1WJJ A;  3ONA B;  1F9R A;  1CKO A;  3GTP B;  4ZAI A;  3G6J B;  2EPB A;  4LF8 Q;  1M8A A;  5E4X A;  1WFQ A;  2R92 G;  4OON A;  1HTL D;  4JI8 L;  3FMC A;  4NKL A;  1W6J A;  4DR1 L;  1HFG A;  1I4P A;  2MGS A;  2QGQ A;  1PXU A;  4R8I A;  2NVT H;  4DUZ L;  3CC2 A;  2B63 G;  4P71 A;  4A3J B;  1HNW L;  1F2Y A;  1QNK A;  1FNW A;  3AFP A;  2JP1 A;  1DON A;  1XYI A;  4YY3 Q;  4MTN A;  1LT4 D;  3BYT B;  3HOZ B;  1RL2 A;  2E2J H;  3HOX G;  4X64 Q;  4H44 C;  1JIC A;  4KY7 A;  5JVH 3;  2JA8 B;  1VF7 A;  4C2M B;  2F4V L;  1AP0 A;  1ZXT A;  4JI7 L;  4C3H G;  1FYC A;  1X3F A;  2PNH A;  2AHO B;  1VQD A;  5DM6 3;  1UEB A;  1FJG L;  1LTR D;  5C5L A;  4H13 C;  2NZO A;  1IBK L;  2JN4 A;  2OQ0 A;  2JEB I;  2JSO A;  3HKZ B;  3RLF A;  4DR1 Q;  5IY0 A;  3E5S A;  3GTL H;  1VQJ A;  2R61 A;  4LF4 L;  3CCM A;  1LUZ A;  3OSO A;  3AYH B;  2JA6 G;  3D8G A;  3AQQ A;  4DAY A;  2WAQ G;  2ENB A;  2I46 A;  4Z9C B;  1EY4 A;  3NUC A;  5C44 H;  3F2U A;  1YBY A;  2G5D A;  2JEA I;  4NXN Q;  2PI2 A;  5J39 A;  3JAM i;  5KYL A;  3OMC A;  4K5W A;  2WIN B;  4DNI A;  1YI2 A;  3TME A;  1NSN S;  3FKI G;  3BVG A;  5A2Q L;  1SEB D;  3OPO A;  4LJZ C;  5IYD H;  3M3Y B;  1EIY B;  1V43 A;  1BNZ A;  4JI3 Q;  2BH2 A;  1I4R A;  1X3P A;  2RA4 A;  1H9R A;  1PDQ A;  4FF4 A;  4G7Z C;  1W6K A;  2VUM G;  5F2D A;  5M3M G;  4B3R Q;  1U4M A;  4X66 Q;  1H9S A;  4V19 0;  4O0A A;  1KTK A;  2IHE A;  4DR4 L;  1L1O B;  2BH8 A;  1Y1V H;  1K3B C;  1JE5 A;  3OHX C;  3HOU G;  1WTR A;  1Z7T A;  1EY6 A;  3FEW X;  4LF6 L;  2WAQ E;  1H9S B;  5T1G A;  3OW7 A;  4OO1 G;  4L5R C;  3F2C A;  2NN6 I;  1WTV A;  1B53 A;  3KOJ A;  4NXN L;  4JV5 L;  1VQ6 A;  2JXM B;  1STY A;  2B2T A;  3HOV B;  1V8Q A;  5ELC A;  1O7L A;  4YCW A;  3F2B A;  2G9H D;  4BWG B;  3STB C;  1WTH A;  4YCV A;  1EZ6 A;  1S40 A;  4HJ9 A;  3J7A 5;  4ZKC B;  4EQO A;  1LTL A;  4DUY L;  2QDL A;  1UUP A;  3C3L A;  1JOR A;  2H4O A;  3S16 H;  2K28 A;  3A74 A;  2OWO A;  4JPB W;  2VQE L;  4J15 A;  4V0B A;  1L2F A;  1NMF A;  1SYF A;  2O5J C;  4JC0 A;  2M2L A;  1PH7 A;  4CDC C;  1BCP F;  2UXC L;  4LF6 Q;  2ZXR A;  2VNU D;  1K0S A;  2AUK A;  2UXD Q;  4R1J A;  2OXP A;  4N8F A;  2OTL A;  4J6H A;  4BA2 I;  4IUR A;  2E2H H;  3JAM E;  1GUN A;  4JV5 Q;  5KNC A;  4QMG A;  3K59 A;  2NYZ D;  1LV9 A;  3K80 C;  1S5C D;  1YNN C;  1HTP A;  2JYO A;  4S3S A;  1F9S A;  1ONL A;  1RCV D;  2SNM A;  1I4G A;  2EDG A;  3AU7 A;  4J1M A;  2ZXO A;  3DEO A;  4HJ7 A;  1CSQ A;  2R3Z A;  4C56 C;  2ZXP A;  1HR0 W;  1BBW A;  4GNX A;  4GN3 B;  4XT1 B;  5C0X G;  2Z4H A;  1MI2 A;  1LT3 D;  4QY7 A;  1PRT D;  4K0K Q;  4GKJ Q;  4RAU C;  3DM1 A;  3UE0 A;  1LTT D;  4JI0 Q;  2KCM A;  4RA8 A;  4A3F H;  4EX5 A;  3NTH A;  3V2T A;  4X3S A;  2N88 A;  3SR1 A;  2HQL A;  1CKN B;  4Y7N H;  3PO3 B;  1JT8 A;  3T51 B;  4NPS A;  1S5B D;  5BN3 A;  4GKK Q;  3VR5 A;  1TII D;  1DOL A;  2KCC A;  4FDB A;  1RKN A;  2R7F A;  1K8M A;  3GDE A;  5ELF A;  1I4X A;  4KN7 C;  4PV1 C;  3PIP A;  2DNE A;  1WD0 A;  2DJG C;  3QIA A;  1N33 Q;  4XQQ A;  3J80 c;  5FO8 B;  4A3E B;  2R93 H;  3MVV A;  1JR0 D;  1YJN A;  2EXZ A;  4C3I G;  3SE0 A;  4YHH L;  5BN4 A;  2JA8 H;  1S72 A;  2F0W A;  1PRT C;  2B8F A;  4LFA Q;  3PV0 A;  3T1H L;  1EY5 A;  4JYA L;  1DOM A;  5IYC G;  3H0G H;  1R4Q B;  1ZEQ X;  1SNC A;  2VW9 A;  4L5S A;  2D5D A;  3CD6 A;  1Q12 A;  5CC4 A;  2F3W A;  5C4J B;  2B2U A;  3M7G A;  1YHQ A;  1LTB D;  1XPR A;  2N8N A;  3GTG B;  1HR0 L;  1B4O A;  1GUT A;  3OWF A;  3K5M A;  1OTC A;  4NDX A;  4DV0 Q;  1RD9 D;  3O13 A;  1STB A;  4CJ1 B;  4BBR G;  3UI2 A;  2OEO A;  5GAE C;  1ILP A;  2PW7 A;  4LWC A;  5EKI A;  2KUM A;  4K2L A;  1SNQ A;  2QA4 A;  3TDQ A;  1EY0 A;  1U0L A;  4RCO A;  2EYF A;  1RIP A;  1IKM A;  4ZKB B;  4XYQ A;  5I2Y A;  4IPC A;  2JA5 H;  1J9O A;  3CF5 A;  4QL5 A;  4RFB A;  2A73 B;  3A7L A;  1QJO A;  3GV6 A;  4JI1 Q;  3L9A X;  2NVQ B;  3T56 B;  3VYS A;  2TSS A;  1PH8 A;  2LY7 A;  1SDF A;  1UNS A;  2K7V A;  1F77 A;  2PW5 A;  1WCM G;  2UXB Q;  2DY8 A;  5G3L F;  5IT9 E;  1IL8 A;  2CVR A;  2B2U C;  1V1P A;  1ENA A;  1G51 A;  3RZD H;  4A93 G;  3RR5 A;  4C3I B;  4HMI A;  3TQY A;  2Z6B A;  4A4I A;  1B3A A;  3I91 A;  3HOV H;  1GUW A;  2CH4 W;  2WII B;  1MSH A;  1TWC B;  5LMN Q;  2ICE C;  3KF8 B;  4JOI C;  5ELO A;  4C1N I;  5IT9 c;  2F0T A;  2ZM6 Q;  4N8X 1;  3I72 A;  3A5Z B;  1VQ5 A;  4BBS B;  5LMU Q;  1N32 L;  1C0A A;  2PQE A;  2D0O A;  2JQO A;  4A3M H;  1HNW Q;  2NBF A;  3HS0 C;  1PZJ D;  2I07 B;  5J3B A;  3NPP A;  1SYG A;  1PFS A;  1FNU A;  4LUZ A;  5IGF A;  1VQO A;  3OTO L;  4OIJ A;  1LLR D;  4ZUI A;  1NNX A;  1WD1 A;  2VUM H;  3R3O A;  2D2C C;  4DR2 L;  3E6Z X;  4ODG A;  3LWU A;  2MQH A;  3ULL A;  1TS3 A;  2DJF C;  3T13 A;  1VS0 A;  2R7D A;  4K6L A;  4OX9 Q;  1Y8N B;  1VQN A;  1H95 A;  2R6G A;  1Y1W H;  1IYU A;  3G7L A;  1IBM L;  1HHV A;  1TWF H;  2L1B A;  3S16 B;  3U58 A;  3MXP A;  1HZB A;  2F1M A;  2ZM6 L;  5LMU L;  2PZT A;  2C35 B;  4FXG C;  4JI2 Q;  4QUF A;  1PH9 A;  3ICE A;  1G6Z A;  2MP1 A;  3S2H H;  5EPL A;  1KNA A;  2MO0 A;  2YV5 A;  2RDF A;  1EQT A;  1YHA A;  4KD3 A;  3TRE A;  4WJ4 A;  5JPM C;  2Z4I A;  4IFD J;  2EYH A;  2IHF A;  4WOR A;  4EGV A;  1Q7Y C;  1E22 A;  2KED A;  1HNZ L;  1CA5 A;  3H0G B;  2HIX A;  1AE3 A;  1TS2 A;  2I5H A;  3Q24 A;  1QUQ A;  3NQT A;  5JJZ A;  3PO2 G;  1D5X C;  1IBL Q;  1PH1 A;  1CQF A;  1U4P A;  4LNQ A;  4YHH Q;  1R9T H;  1I50 B;  3J80 L;  3CXC A;  2CW0 D;  1AZQ A;  2ZJQ A;  1SE4 A;  1SMY C;  4DR6 L;  4EQ5 A;  1BQQ T;  3M9B A;  3OWE B;  4QF4 A;  5EPJ A;  3HOY H;  3A55 A;  1TWG H;  1EEI D;  2J7Z A;  4A3J G;  2CWA A;  5FKA C;  2A6E D;  3S17 H;  1B2T A;  3EIV A;  1YEZ A;  5IOD A;  1DGS A;  2LXK A;  4BXX H;  3QJY A;  3P75 A;  1JWM D;  3D0F A;  4LF7 L;  3PO3 G;  1FGB D;  1EOV A;  4JBK A;  3PF5 A;  2CWP A;  2YU9 B;  5KND A;  1CA6 A;  2F0V A;  1A3V A;  1MIU A;  4JI8 Q;  2KCT A;  2L11 A;  4WJW A;  1W2B A;  2NUC A;  4C2M H;  5FLM H;  3PIP 3;  5GQO A;  3JAM c;  3CCV A;  3J7Y W;  1NR4 A;  5EKK A;  3J7A V;  4KI0 A;  2N55 A;  5BR8 Q;  4X64 L;  2MNA A;  1KLU D;  4KJO A;  3TZU A;  2ES2 A;  1GD7 A;  1EIF A;  4A3B H;  2IY5 B;  4OWW B;  4DR3 Q;  4OIK A;  5IYB H;  5CBA E;  4IPH A;  1JCK B;  4A3I H;  3PUW A;  3I8Z A;  1VQH A;  3MXU A;  1Q1B A;  5CV5 A;  2EYL A;  4BBR B;  1D5M C;  2F0U A;  4HTH A;  2R93 G;  2L5T A;  4LF9 Q;  3BDL A;  4HID A;  4DK6 C;  2IL8 A;  1V1P B;  2TMP A;  2KQ3 A;  2LFN A;  3S15 H;  2R92 H;  2BOS A;  3MXN B;  2CH4 A;  5M5Y B;  1L1O C;  5CGK A;  1TS4 A;  1N34 L;  4B3M Q;  1EFI D;  1I3Q H;  5JEA G;  3M4Y A;  1ZKO A;  4RH6 A;  1PTO C;  3AEV A;  1IW7 D;  1H9M A;  4G4K A;  5BR8 L;  3T1Y L;  3SEB A;  3S15 B;  3OTO Q;  2NVT B;  4H7B A;  2A19 A;  4KHP Q;  1TKW B;  1WCM B;  3IL8 A;  3NSW A;  2XWB B;  4DV4 L;  1PTO H;  2B2Y A;  4A3G B;  1L0X B;  4K5X A;  4BBR H;  4DR5 L;  3K7A H;  1QVF A;  3S1Q B;  3RN5 A;  3MC0 B;  1KQS A;  4UAI A;  4C3H H;  3PF4 A;  1KAA A;  3UE1 A;  2RHS B;  1BO0 A;  2RCN A;  3VYU A;  3NWT A;  3S14 B;  3GTK H;  3LNN A;  2WB1 E;  1JOK A;  1SAP A;  3D4R A;  1J5E Q;  3A7A B;  1HUM A;  3OMG A;  1P8L A;  4DUZ Q;  1C9O A;  1Y14 B;  2NTT A;  4G7O C;  2SEB D;  2M00 A;  4C3H B;  1PTO D;  5ELN A;  1UE6 A;  2V1C C;  4RHS A;  3CCJ A;  1VQA A;  1STA A;  3J81 j;  1JB3 A;  1HJP A;  3L0O A;  4L6T B;  1A6X A;  1SMX A;  3Q23 A;  1XJV A;  4LFB Q;  4CKC A;  4AH6 A;  4GLV B;  1EYC A;  3EVQ A;  3MFG A;  3I73 A;  3J81 i;  3M85 A;  1WTQ A;  1D8L A;  2VZA A;  2YU9 H;  3RZD B;  2RSN A;  2X69 A;  4XQN A;  1XPO A;  1D6E C;  1EZ8 A;  3R93 A;  1JE4 A;  1FJG Q;  5M5W H;  4F88 A;  4DK0 A;  4NW2 A;  5ELB A;  3H94 A;  2K32 A;  5E3F A;  3SK5 A;  1KLG D;  2UU9 L;  1B3Q A;  4DR6 Q;  2BDN A;  5JPN C;  3RZO B;  2H1E A;  3A0J A;  5CYU A;  2EY5 A;  5I2X A;  3KLW A;  1MD2 D;  4K14 A;  3JC6 6;  4X62 Q;  3GTO H;  3I56 A;  2AWN A;  1GUS A;  5C5M A;  1LO5 D;  3K5O A;  1A3T A;  5LHY 1;  4ILW A;  2P5Z X;  2JA5 B;  1SFO H;  1TXY A;  4RMF A;  3CPF A;  2K6A A;  1IHZ A;  1HZ9 A;  4DV5 L;  2GA4 B;  2JE6 I;  4OO1 H;  2PMZ B;  5DAU A;  5DM7 3;  5EJW A;  2Q8T A;  1Y1W G;  1U9R A;  4U67 3;  4EVO A;  2ZT9 C;  3CW2 C;  2ASB A;  1TU2 B;  2F0F A;  1MKH A;  4X66 L;  4TQU S;  1F2L A;  3DXJ C;  3NTK A;  1FL0 A;  2OTJ A;  4BY1 G;  1N36 Q;  1XNQ Q;  4L63 B;  2LKV A;  2K5W A;  3EJI A;  1ENF A;  1BOS A;  1X32 A;  2SOB A;  1CSP A;  4XQJ A;  5C4J H;  3HOX H;  1PFB A;  1S3O A;  4LK1 C;  5IGD A;  5FO9 B;  5IYD G;  1R9T B;  1X3G A;  1PTO F;  1UE1 A;  2UUA Q;  1STE A;  4LF8 L;  1GOZ A;  4CKB A;  1Q46 A;  4FO2 A;  3B6Y A;  2QCP X;  4KLK A;  3G4S A;  4R8N A;  1XMQ L;  2VQF L;  3S17 B;  2PO4 A;  3K0Y A;  4KMU C;  4P72 A;  1HQR D;  5IGE A;  3K6O A;  2JA7 H;  2C9O A;  1H9K A;  3VYR A;  1JOQ A;  1ICF B;  2XWJ B;  2WKD A;  1F9P A;  3ERS X;  5CMD A;  4I65 A;  3W5O A;  3CQZ B;  2AMC B;  2EY2 A;  1PRT F;  3S1M H;  3MA2 B;  2PZU A;  4JI4 Q;  3FDT A;  1Q82 C;  2M9V A;  2JA6 H;  3TZD A;  5C0X H;  1KRT A;  1HNX L;  1M1K C;  1I94 L;  3KLS X;  3J80 E;  3HOW G;  5C3W A;  5I9O A;  5C3X A;  1Q1E A;  2B8G A;  3EBE A;  2HT1 A;  1YNJ C;  4CKE A;  3I70 A;  3DMU A;  3BJU A;  4O2D A;  3KJP A;  3AMU A;  1K28 A;  4WFN 3;  1PZI D;  4POF A;  2PPB C;  2A8V A;  1VCI A;  5ELD A;  1X55 A;  2PQA A;  3UDX A;  4BY1 B;  4IZ8 A;  1C8C A;  2OQK A;  2DNC A;  4FF1 A;  4UDU C;  1TS5 A;  4GN5 A;  4RKB A;  4K8I A;  1AW7 A;  3K58 A;  1XTD A;  5IYB G;  2JA8 G;  4JI4 L;  4DR7 L;  1EWI A;  2VUM B;  4JI0 L;  5E4W C;  3LX0 A;  3LWE A;  1WYD A;  3K81 C;  3DEP A;  2FMC A;  4JI3 L;  3E9H A;  1HFN A;  3MWY W;  1SE3 A;  4A76 A;  5D3I B;  1UE5 A;  2F0H A;  3DWP A;  3KLR A;  4GKK L;  4B3R L;  3MEF A;  2YTV A;  3A8J E;  1U5K A;  3S9W A;  2WAC A;  1DXM A;  3OW2 A;  4PMB A;  1LAB A;  4A3C H;  2JA6 B;  4X62 L;  3N52 A;  1N32 Q;  1DZ1 A;  1PA6 A;  3BVZ A;  5IWA L;  1WVL A;  1JWS D;  4QIW E;  3GTL B;  5FOB B;  2E2I H;  5LL6 S;  5CV6 A;  3M4Q A;  1HH2 P;  4PZ7 A;  3NEL A;  4RGT A;  3D3R A;  4X65 L;  4CDE C;  4GZY C;  1A62 A;  1J8I A;  2RBM A;  2IWH A;  2GVB A;  1VQP A;  1G6P A;  4CBV A;  4DR3 L;  1EQV A;  3M3Y H;  2WP8 J;  2G9D A;  1CHQ D;  1LYL A;  4K8J A;  2IW3 A;  5DLQ E;  1HR0 Q;  4TRD A;  1WCM H;  2RDH A;  2N49 A;  1KHI A;  5E7N A;  1BCP D;  3W3A A;  1A2U A;  4KKU A;  5NUC A;  2F0K A;  1QZG A;  2NZ1 D;  1SSO A;  2B2T C;  5FLX E;  2PNR C;  1N36 L;  1XNQ L;  1AN8 A;  4QB4 A;  5DNF A;  5J22 A;  1ESF A;  2A1A A;  2O2L D;  1MGS A;  1JC7 A;  4P2C B;  2EQS A;  1KAB A;  3BG3 A;  5M5Y H;  1AEX A;  3CKI B;  2LSS A;  1SRU A;  4PMW A;  2IX0 A;  5C44 B;  2KOL A;  1X9N A;  1JWU D;  1ICW A;  2LS0 1;  3KJO A;  5K36 G;  4WJ3 M;  1ZYR C;  2QKI C;  5CBE E;  1RTO A;  3FRP B;  1GO3 E;  4X65 Q;  3ERQ A;  3X3N A;  3HOZ G;  2ZTE A;  3VDY A;  1CFM A;  1HNZ Q;  4LUV A;  2QW7 A;  1X54 A;  5CV8 A;  4K2K A;  4XYO A;  1YIJ A;  4XTC S;  2XNA C;  4GOP C;  1NBW A;  1GUO A;  4DN4 M;  2KHJ A;  1D1I A;  2PI2 E;  2HD3 A;  1GHJ A;  4HAE A;  3IFD A;  1B1Z A;  2OCE A;  1NMG A;  2WB1 G;  3I55 A;  3S1R B;  2QDB A;  3CRK C;  1STN A;  3Q22 A;  2B2V C;  1SND A;  3KDF B;  3AB9 A;  4MZ9 A;  3NE5 B;  4B08 A;  5IYC H;  1Z6H A;  1VQK A;  5M3F B;  4AQY L;  1VDZ A;  4Y7N B;  4RGO S;  1E0B A;  5IT9 L;  1PFM A;  4QCL A;  5L37 A;  4A3F B;  4KTA A;  5J1Z A;  1OXU A;  2RQX A;  5JVG 3;  3M7N A;  5I6Y A;  2WKC A;  1L1O A;  4LFC Q;  3RUZ A;  1TY0 A;  3RD4 A;  3CCU A;  4EQN A;  3MFY A;  3TBI B;  3WWV A;  3F2D A;  2UUB L;  2B2V A;  2Q8I B;  1LTS D;  3NWS A;  1PYS B;  4A3G H;  4ZYS A;  4DR4 Q;  2B39 A;  1A15 A;  1IBM Q;  2E2I B;  4I7Z C;  4DF7 A;  4CHT B;  1EYA A;  1PTO B;  2D0P A;  3MTS A;  3H3V I;  1I6H H;  2O4X A;  2D9U A;  5EQ0 A;  1S5D D;  1A63 A;  3KLS A;  4OGQ C;  2F4I A;  2Q2H A;  3TP6 A;  1II3 A;  2JA7 G;  1A3U A;  4DA2 A;  1WTP A;  2F0L A;  5C4X H;  3C1E A;  5LMN W;  3HEJ A;  5C4H A;  4QJF A;  3I7F A;  1I4H A;  3I4N B;  3SVM A;  3K7U C;  3E3X A;  4LFC L;  2RCF A;  4FNF A;  5FLM G;  3HOV G;  4LF5 Q;  1AE2 A;  1PMR A;  2L15 A;  3HOW H;  1ROD A;  2F0M A;  4PZ8 A;  1E1T A;  1F2M A;  1SLJ A;  3D4D A;  3HZX A;  4A3M G;  4PMC A;  2VQE Q;  3T53 B;  3HFZ B;  2FMM A;  3I90 A;  3PCO B;  4MHE A;  3HGB A;  3S2D H;  3ULJ A;  3QB3 A;  4IUV A;  3HOX B;  4YWK A;  1NR2 A;  4OL7 A;  4DV1 L;  3BVM A;  3L3O C;  1SBB B;  3KK7 A;  2XN9 C;  1EWC A;  2XVS A;  2AQ2 B;  2I5L X;  4CJ2 C;  2VQF Q;  1XX8 A;  3A8K E;  5JJL A;  1O7Z A;  1CT1 D;  2EYO A;  2Z6K A;  1UEA B;  1LT6 D;  5H1S E;  1M4V A;  3MZ5 A;  4BXX G;  5TSS A;  4N9P A;  1E2Z A;  5C0X I;  3H91 A;  2CQA A;  1MHW C;  2NN6 G;  4M8A A;  3TS2 A;  1L0W A;  3S1M B;  2B2W C;  2R92 B;  2E8G A;  4HIK A;  1EQR A;  1U4R A;  1EQQ A;  1MBY A;  1CKN A;  3OIQ A;  3OYY A;  2VS1 A;  1IXR A;  3PQI A;  1GUG A;  4JI6 L;  3EQL C;  2JA7 B;  1DD2 A;  2A6H D;  2VB3 X;  1EUJ A;  2LXJ A;  3MXN A;  4A3C G;  5JEA J;  3EA6 A;  4DV1 Q;  3CAM A;  3UDF A;  3EFX D;  4AYB B;  4X6A H;  1G91 A;  4BBS G;  1R4P B;  1CKM A;  4P73 A;  1L0Y B;  1H9J A;  1XPU A;  4JVZ A;  1KL9 A;  4IUT A;  1KXL A;  2N3S A;  4LMQ D;  2FJ2 A;  3BU2 A;  3PGZ A;  5KIX A;  3HOY G;  1TT2 A;  4A3J H;  1XMO Q;  4MN3 A;  1VQB A;  3MAQ A;  3ZYY X;  2NVY H;  4IOC A;  5C3E G;  2L9H A;  4ABN A;  3T1Y Q;  5KRU A;  4YWM A;  1F9Q A;  2NVX B;  1E7Z A;  3CHB D;  3PO3 H;  4RKL A;  3HG9 A;  3G6E A;  1EU4 A;  1JJG A;  1UWV A;  1CZG A;  3NK9 A;  1EYD A;  4QGU A;  4DR5 Q;  3GQB A;  4A3L G;  2K50 A;  4DXG A;  4KY6 A;  2X6G A;  4IUN A;  3V05 A;  3MHB A;  5HGQ A;  3KDF A;  2MO1 A;  4R4Q A;  4TVA B;  3DHQ A;  2EXD A;  2WFW A;  4I7A A;  1TWF B;  1GXD C;  3A56 A;  5IWA Q;  4JI5 L;  5FLX c;  3KUP A;  4OEL B;  4KHZ A;  1J6Q A;  1GKH A;  4HCS A;  5EBC A;  3PIO A;  5FLX L;  4NP5 A;  4UPA A;  3K7A B;  3PIO 3;  1VQ4 A;  1PH3 A;  1MJE A;  1XWE A;  4UP8 A;  5A2Q E;  4DAM A;  2K14 A;  2PQA B;  4IFD G;  2VL6 A;  2VB2 X;  1W3S A;  2ZJP A;  3SK8 A;  3ND8 A;  4K5V A;  3CMA A;  1XMQ Q;  5IGG A;  4IOA A;  1G2T A;  5EGT A;  3W1G A;  4A3I G;  1K83 B;  1PLF A;  4ME5 A;  5EKL A;  3CC7 A;  3C46 A;  3WDN A;  1RF2 D;  3ND9 A;  5LL6 X;  3HP3 A;  3GD7 A;  4APV A;  4L8J A;  2UU9 Q;  2Z9H A;  4R9W A;  2RVL A;  2ZTC A;  5IP9 H;  1BVS A;  4IJL A;  3BS1 A;  2B29 A;  2K75 A;  1HQM C;  1VQ8 A;  3S1R H;  2HUG A;  2IPK D;  4RWS C;  5CV4 A;  1EY7 A;  2R7Z B;  2K5V A;  2F0J A;  2E2H B;  2B3G A;  1D7Q A;  2JK8 A;  1JOO A;  5CV9 A;  1T5X D;  2WV6 D;  4DV5 Q;  3M4O H;  1CHP D;  3BDC A;  1N8R C;  3CP0 A;  1N33 L;  3NBH B;  3H09 A;  3H3V C;  1I4Q A;  4GLX A;  3I2Z A;  4DKA C;  4A3K G;  1EFW A;  4BA1 I;  1KAW A;  1BCP B;  5ISR A;  2ID0 A;  3LGJ A;  4F87 A;  2PCF B;  3QO2 A;  4YY3 L;  1N34 Q;  2K03 A;  2BA1 A;  4A3D B;  3WOE A;  1FR3 A;  3J81 L;  1A0I A;  5KNB A;  5M9O A;  4ALP A;  4JG2 A;  3D31 A;  3I4M H;  1ENC A;  4FVM A;  3KBG A;  2RSO A;  1C4Q A;  1PRT B;  3CQZ H;  5C0X J;  1WTO A;  3F8T A;  4TSS A;  1TWH B;  5M3F H;  2RKS A;  3HKZ G;  4AQY Q;  2UXD L;  4YCU A;  2R93 B;  1D1K A;  3CCQ A;  2QEX A;  1S5F D;  3F1Z A;  2NVY B;  3D6W A;  1SR3 A;  1YJW A;  2F0S A;  1Q8I A;  1V9P A;  2NZH A;  3U50 C;  4GNX C;  3R2T A;  1TWG B;  4BY7 B;  2N78 A;  4KHV A;  1Q81 C;  2IX1 A;  4R4T A;  1O80 A;  3J80 i;  3GTQ H;  1K3R A;  4B9X A;  4A3E H;  2RF4 A;  5T1I A;  4E6I A;  3I4O A;  4PG3 A;  4ID6 A;  4UY8 C;  1TWH H;  3NP8 A;  1Y1V B;  4KY5 A;  4Y52 H;  1SE8 A;  4JBM A;  1FGU A;  2XIW A;  1JJC B;  1GVP A;  3CCS A;  1YZ6 A;  2F3I A;  3IRB A;  3H3V H;  1DOK A;  1VQM A;  3X3M A;  1X56 A;  4BY7 H;  4LFB L;  3H15 A;  1ASZ A;  1CK1 A;  1I94 Q;  1O7I A;  4ME3 A;  1K73 C;  1TR5 A;  3I4M B;  1EIH A;  2CFM A;  4ZCK A;  2A68 C;  4NXM L;  2L4N A;  2UUC L;  3J7Z C;  4XT3 B;  4A3K B;  3NXW A;  1B9M A;  4PZ6 A;  2F03 A;  1E1O A;  2MFI A;  4ULL A;  1O7Y A;  4HIO A;  2A74 C;  1CZW A;  1VQ9 A;  4DV7 L;  2WB1 B;  4F7X A;  3A5U A;  1D2B A;  4F8M A;  4LF5 L;  2F0E A;  3BYY B;  3K5N A;  3T1H Q;  4BY1 H;  3TRZ A;  5D14 A;  4KKT A;  1EOT A;  1B44 D;  2QEJ C;  4CJ0 B;  4HJA A;  3ERO A;  2EE1 A;  1Y8P B;  2EJM A;  5M5W B;  3OOC A;  4DR7 Q;  1OXT A;  1I50 H;  1K0R A;  4DV2 Q;  2F0Q A;  2OF1 A;  3CCL A;  5C4X B;  3GTO B;  2R7Z H;  3E0J A;  4OX9 L;  4POG A;  3G71 A;  1KNE A;  5K5P A;  1VQG A;  2DUD A;  1CM9 A;  2F0P A;  2K5Q A;  3I3C A;  3TP8 A;  3RNU A;  1Z9F A;  2E5L L;  2VXW A;  1DJR D;  2HDL A;  2IT1 A;  3AFQ A;  3VR3 A;  3CPW A;  4DV6 Q;  2KHS A;  3V96 A;  4DV7 Q;  5IP7 G;  4DU9 A;  4HIM A;  4IN3 A;  1Y8O B;  3I4L A;  2BE5 D;  2Z8L A;  2UXC Q;  1V1Q A;  2HDM A;  3R2I A;  4DXF A;  2B63 B;  1ZYR D;  1EIG A;  4NB3 A;  3UDG A;  3TP5 A;  4C3J B;  1T5E A;  1WTX A;  1YJ9 A;  5GRO A;  4XXE A;  1PFN A;  3HKZ E;  3KBX A;  1RDP D;  1NTG A;  3QR8 A;  1YNN D;  1RJT A;  4DV3 L;  2K5N A;  3H6M A;  3L7Z C;  1WI5 A;  1K8A C;  1QVG A;  1IBK Q;  3PUZ A;  1EYG A;  1FD7 D;  2KEC A;  2GN5 A;  3NEM A;  1AH9 A;  1LM0 A;  2PYK A;  3WOF A;  1Z47 A;  2PZW A;  1J5E L;  4J8Q A;  5LMN L;  3S1N H;  2F0G A;  4LF4 Q;  4FXK C;  1FNV A;  1GM5 A;  1XXG A;  3W2D A;  4ZQ3 A;  1S5E D;  2ZTD A;  4Q5V A;  1SE2 A;  4H0L C;  3GTJ H;  2AWO A;  4P74 A;  3GTM H;  1KIX A;  1KC8 C;  4G7H C;  1EU3 A;  3KYH C;  3FKI B;  4GOP A;  3FPP A;  2XSC A;  1WTW A;  2EIF A;  3M4P A;  4MTK A;  1SNO A;  4DNT B;  1YNX A;  1SYB A;  1AZP A;  4YWL A;  4UHV A;  3RZO H;  5K36 H;  3RLN A;  2KCN A;  4C3J G;  3DLL A;  3BZD B;  3U9S A;  1JMC A;  3HOZ H;  2XGT A;  1NUC A;  1SYD A;  1C48 A;  5HUR A;  1ET6 A;  1KDB A;  4A3B B;  4ZUJ A;  3GTJ B;  3HOU B;  2K01 A;  1SRO A;  4FF3 A;  2E2D C;  4KJN A;  1STH A;  1B70 B;  3E0E A;  2E2J B;  4A3K H;  4CDF C;  2DGY A;  2J4X A;  2YTX A;  3VR4 A;  4IUP A;  2XRS D;  3RLO A;  1PZK D;  5FJ8 G;  1CI3 M;  1T9H A;  3K57 A;  4A3D H;  1MSG A;  1Y1V G;  3RN2 A;  3W1B A;  1HUN A;  2X6L A;  3HOU H;  4OEM B;  1BUV T;  2C5C A;  1IL2 A;  5JAV A;  3U9O A;  1PYW D;  3PUX A;  2Q8R E;  4XIG S;  1M90 C;  1TY2 A;  2EZV A;  4GNX B;  2JA9 A;  3TN2 A;  1XNR L;  3S14 H;  5IGB A;  4IPG A;  3QG1 A;  3HOY B;  4P75 A;  3GTQ B;  1TWA H;  4A93 B;  1NE3 A;  3MEH A;  1DCZ A;  1PH5 A;  3FKI H;  3OIP A;  2H5X A;  3ITP A;  2K1B A;  2B63 H;  5I9P A;  4ZRZ A;  1IYJ B;  5A35 A;  1BBU A;  5M5X H;  5CV7 A;  3VYT A;  3K5L A;  1QIL A;  4A3M B;  3URY A;  3CU7 A;  4IUU A;  3L2P A;  3E9I A;  4DAV A;  1EL0 A;  2Z6K C;  4DGZ A;  4B3S Q;  1IW7 C;  2YYZ A;  4PQX A;  5KEE A;  2SDF A;  4OO1 I;  1B8A A;  3PSI A;  1K83 H;  5BN5 A;  4GKJ L;  1JB7 A;  2F0O A;  2Q2I A;  2VY3 A;  1HNX Q;  2OT2 A;  2NN6 H;  2A6H C;  3K8A A;  1A2T A;  4B3T L;  5C4X G;  1QG7 A;  5I4D A;  2KVM A;  2GVA A;  1MJC A;  2Y0S B;  4JOI A;  2LMC B;  2K05 A;  2KBN A;  1DYQ A;  4L5T A;  4O42 A;  2KEN A;  1CTM A;  1VQL A;  5C44 G;  3ZJY C;  1WOC A;  5FK9 C;  4A3G G;  4KD4 A;  1VQC A;  1KD1 C;  4JI2 L;  1I5F A;  4R4O A;  2F3V A;  4A3F G;  4B3S L;  4LFA L;  1BXT A;  4HJ5 A;  3NEN A;  1QUQ B;  3KFU A;  3C1F A;  3GO5 A;  1BF4 A;  3IKJ A;  4R4C A;  1N9W A;  2CKZ B;  2HHH L;  1SJE D;  2EYM A;  4IPD A;  2Y0S E;  4OHJ A;  1EWH A;  4HJ8 A;  4IO9 A;  2R7Z G;  5M3M H;  2F0I A;  4JI6 Q;  3IFT A;  4JCV E;  2E75 C;  5D65 A;  4G57 A;  1X3E A;  2E74 C;  5COY A;  2UUB Q;  2UUC Q;  1I6H B;  4DV0 L;  2NWG A;  1PHJ A;  1S4Z A;  1NY4 A;  4GOP B;  4C1N K;  4A3L H;  2EY1 A;  2F52 A;  4X3U A;  4FXD A;  2NB0 A;  1LAC A;  4X3T A;  1SMY D;  1SNP A;  2EJG C;  1RHP A;  4L5Q A;  4M1U B;  3PUV A;  3JAM L;  3VA7 A;  4DAP A;  4HN7 A;  1RTN A;  1HZA A;  5JOB A;  2UUA L;  4MNO A;  4WRD A;  2V4D A;  4Q0F A;  3I4N G;  1BKB A;  2B2W A;  2Y0S G;  5D3D A;  3SK6 A;  1ESR A;  4RGN A;  1YVC A;  2AQ3 B;  2QF7 A;  4IFD H;  3TP7 A;  1SYC A;  2Q2U A;  3MXG A;  2XTI A;  4IUQ A;  3NBH A;  3STB D;  1HA5 A;  4RG1 A;  2L12 A;  1U4L A;  3KF8 A;  1GJX A;  3BZC A;  2K5D A;  2WAQ B;  1E2W A;  1QNU A;  1B9N A;  4HED A;  1XNR Q;  1CUK A;  1PVO A;  5IOC A;  3FPU B;  2AKW B;  3SGI A;  2YTY A;  3M4O B;  1IZ6 A;  1VQF A;  2K04 A;  4IAL A;  2FFK B;  1VMC A;  1ASY A;  5FO7 B;  1LTA D;  1SYE A;  2CQO A;  1K8G A;  3GTM B;  3IAY A;  3CCR A;  1VQI A;  2IJ0 A;  4LF9 L;  1PH4 A;  5JJI A;  2EJF C;  1SXT A;  3S2H B;  1IKL A;  4CGY B;  3PO2 B;  2CW0 C;  1NCV A;  4HCE A;  4LAA A;  2BDO A;  1CQV A;  5JJK A;  1LTI D;  3CRL C;  5HGT A;  4QQB X;  1X65 A;  4X3K A;  1C7Y A;  1Y69 U;  1IYV A;  3DWQ A;  4DUY Q;  4BBS H;  1LT5 D;  4KN4 C;  4ZK9 B;  2QIL A;  4OWX B;  5ELE A;  5CR3 A;  3A54 A;  2F0D A;  5DEH A;  5AJ3 L;  2JJQ A;  4JI7 Q;  4B3T Q;  2DY7 A;  1BDO A;  4AYB G;  5C3E H;  4EQP A;  3CCE A;  1DM0 B;  5FJ8 H;  4IQZ A;  4OWT B;  3CC4 A;  4A3D G;  2KEE A;  4AIM A;  2HCI A;  5M3F G;  2ATW A;  1SFO B;  3S1N B;  3NQI A;  2EY6 A;  2MPM A;  2BA0 A;  1ET9 A;  1QZH A;  1Q86 C;  3R8B A;  5C3E B;  3H0G G;  4CDD C;  3D4W A;  1XTC D;  5AFW A;  3Q0A A;  4MIU A;  4JI1 L;  1XMO L;  2MJ8 A;  1JJ2 A;  5EPK A;  3T16 A;  1G8Z D;  1I3Q B;  3QOJ A;  3U4Z A;  2HHH Q;  4DK1 A;  1SNM A;  2A69 C;  2HIV A;  2EVB A;  3G48 A;  1ILQ A;  2KHI A;  2L55 A;  2A68 D;  1HRJ A;  3GP7 A;  3PMF A;  1EY9 A;  4GLA C;  5GAD C;  3GTG H;  3PO2 H;  3VA5 A;  5I6W A;  2NTS A;  1VF5 C;  1HA6 A;  4A75 A;  2L0C A;  4OXP A;  1ML0 D;  1FVI A;  3PUY A;  1O78 A;  3RMH A;  4JK1 C;  2KA7 A;  2E5L Q;  4HSP A;  2JA5 G;  4JBW A;  3P1H A;  5GAH C;  3FHW A;  3J81 E;  4DV6 L;  4HMJ A;  4HR7 B;  2ZJR A;  4JI5 Q;  4QUC A;  2FHT A;  1VQE A;  4UP7 A;  1QWY A;  4HSV A;  3FP9 A;  3I4M G;  4H02 A;  5M5X B;  3VR2 A;  2K5H A;  2EYJ A;  4DAY B;  4JYA Q;  4FYD A;  5IP9 G;  3Q6S A;  1JQY D;  1OXS C;  1NJI C;  2XRQ D;  4KKS A;  2A69 D;  4LUO A;  3KF6 B;  3SDZ A;  2O5I C;  5IIF A;  3S1Q H;  3QOL A;  5EAY A;  4ZLT F;  1TWA B;  4A93 H;  5IGC A;  5G3L D;  5E1F A;  4DV3 Q;  1OXV A;  4NXM Q;  3P7J A;  4A3E G;  2A5H A;  1HZC A;  1V1O A;  2PMZ E;  5KYI A;  5KGU A;  2ALY B;  1BCP C;  1KDC A;  1UAP A;  4K6D A;  4QIW B;  2EYP A;  2NVX H;  2J0T D;  2RHQ B;  2Z0S A;  4JW0 A;  1B50 A;  1OO9 B;  1B7Y B;  3SXH A;  3VR6 A;  3BZK A;  3N6R A;  3DM3 A;  4B3M L;  1QE6 A;  1TQO A;  1Q8K A;  4RGM A;  2B2Y C;  3NBI A;  3SK4 A;  4XDX A;  3DWA A;  4FP5 D;  1PH2 A;  5C6A A;  3D6C A;  2RDG A;  3TEH B;  3GTP H;  4DV4 Q;  4A3I B;  3S24 A;  1PYB A;  2BCO A;  2MHV A;  3GV3 A;  4AYB E;  3TSS A;  1VQ7 A;  1G2S A;  2UXB L;  1HXY D;  1QCB D;  4DV2 L;  1IBL L;  4R4I A;  1X6O A;  4DFA A;  4N9T A;  2CHB D;  1VMP A;  3KF6 A;  2FIN B;  3FVQ A;  1P16 A;  1OXX K;  4DPG A;  5M3M B;  4DNR B;  1KRS A;  3HOW B;  4K0K L;  5JEA H;  3DUZ A;  1EEF D;  3EN2 A;  3T4A C;  3BDO A;  2MUY A;  2BE5 C;  4LW1 A;  5AJ3 Q;  1I6V C;  2F0N A;  1YIT A;  3J7A F;  2DN8 A;  5C4Z A;  4LF7 Q;  1A8V A;  2I0Q A;  3I4N H;  3A8I E;  1BBX C;  1QB5 D;  4RHR A;  1STG A;  3C2P A;  2AQ1 B;  4BY7 G;  1G29 1;  2K4K A;  3HKS A;  4KV6 A;  1BR9 A;  4BS9 A;  2K33 A;  3P20 A;  5COR A;  1E2V A;  1Q3L A;  1K8O A;  1GHK A;  2CCZ A;  4DR2 Q;  1AFP A;  2HCC A;  3U4V A;  1EY8 A;  2K52 A;  3NTI A;  3S2D B;  4RCN A;  1HCZ A;  5IP7 H;  1SN8 A;  1TVX A;  4NMZ A;  4DK3 C;  1Q90 A;  3CME A; 
#chains in the Genus database with same CATH homology
 2SNS A;  1SJH D;  2A6E C;  3HRZ C;  4PNY A;  1NAP A;  3SHL A;  2IX3 A;  2E76 C;  4FF2 A;  4IFD I;  1F2Z A;  4TKO B;  1KDA A;  2D62 A;  4KK7 A;  4B9W A;  5EBD A;  4YIJ A;  3NHH A;  4O1N A;  2KJX A;  2HQE A;  2Z1C A;  1HPC A;  1D5Z C;  4U68 A;  1QOH A;  1Y1W B;  3QWN A;  2EOT A;  1LTG D;  2ICI A;  1X3Q A;  3GTK B;  2AUJ D;  1YNJ D;  3ONA B;  1F9R A;  3GTP B;  4ZAI A;  3G6J B;  2EPB A;  1M8A A;  5E4X A;  1HTL D;  3FMC A;  4NKL A;  1W6J A;  1HFG A;  1I4P A;  2MGS A;  1PXU A;  4R8I A;  4A3J B;  1F2Y A;  1QNK A;  1FNW A;  2JP1 A;  1DON A;  1XYI A;  1LT4 D;  3BYT B;  3HOZ B;  4H44 C;  1JIC A;  4KY7 A;  5JVH 3;  2JA8 B;  1VF7 A;  4C2M B;  1AP0 A;  1ZXT A;  4C3H G;  1FYC A;  5DM6 3;  1LTR D;  5C5L A;  4H13 C;  2JEB I;  2JSO A;  3HKZ B;  3RLF A;  3E5S A;  2R61 A;  3OSO A;  3D8G A;  4DAY A;  2ENB A;  2I46 A;  4Z9C B;  1EY4 A;  3NUC A;  3F2U A;  2JEA I;  5J39 A;  5KYL A;  3OMC A;  4K5W A;  2WIN B;  3TME A;  1NSN S;  3BVG A;  5A2Q L;  1SEB D;  3OPO A;  4LJZ C;  3M3Y B;  1V43 A;  1BNZ A;  1I4R A;  1X3P A;  2RA4 A;  1H9R A;  1PDQ A;  4FF4 A;  4G7Z C;  1W6K A;  5F2D A;  1U4M A;  1H9S A;  4V19 0;  1KTK A;  3OHX C;  1WTR A;  1Z7T A;  1EY6 A;  3FEW X;  1H9S B;  5T1G A;  3OW7 A;  4OO1 G;  2NN6 I;  1WTV A;  1B53 A;  2JXM B;  1STY A;  2B2T A;  3HOV B;  1V8Q A;  5ELC A;  1O7L A;  2G9H D;  4BWG B;  1EZ6 A;  4ZKC B;  4EQO A;  1UUP A;  3C3L A;  1JOR A;  2H4O A;  2K28 A;  4V0B A;  1SYF A;  2O5J C;  2M2L A;  1BCP F;  2ZXR A;  2VNU D;  2AUK A;  2OXP A;  4J6H A;  4BA2 I;  4IUR A;  3JAM E;  1GUN A;  5KNC A;  4QMG A;  3K59 A;  2NYZ D;  1LV9 A;  1S5C D;  1YNN C;  1HTP A;  2JYO A;  4S3S A;  1F9S A;  1ONL A;  1RCV D;  2SNM A;  1I4G A;  2EDG A;  3AU7 A;  4J1M A;  2ZXO A;  3DEO A;  2R3Z A;  4C56 C;  2ZXP A;  4XT1 B;  5C0X G;  2Z4H A;  1MI2 A;  1LT3 D;  1PRT D;  4RAU C;  3DM1 A;  1LTT D;  4RA8 A;  3NTH A;  3V2T A;  4X3S A;  2N88 A;  3SR1 A;  3PO3 B;  3T51 B;  1S5B D;  5BN3 A;  3VR5 A;  1TII D;  1DOL A;  2KCC A;  1RKN A;  1K8M A;  5ELF A;  1I4X A;  4KN7 C;  4PV1 C;  1WD0 A;  2DNE A;  3QIA A;  4XQQ A;  4A3E B;  5FO8 B;  3MVV A;  1JR0 D;  2EXZ A;  4C3I G;  3SE0 A;  5BN4 A;  2F0W A;  1PRT C;  2B8F A;  3PV0 A;  1EY5 A;  1DOM A;  1R4Q B;  1ZEQ X;  1SNC A;  2D5D A;  1Q12 A;  5CC4 A;  2F3W A;  5C4J B;  2B2U A;  3M7G A;  1LTB D;  3GTG B;  1B4O A;  1GUT A;  3OWF A;  3K5M A;  4NDX A;  1RD9 D;  3O13 A;  1STB A;  4CJ1 B;  3UI2 A;  2OEO A;  1ILP A;  2PW7 A;  5EKI A;  2KUM A;  4K2L A;  1SNQ A;  3TDQ A;  1EY0 A;  4RCO A;  2EYF A;  1IKM A;  4ZKB B;  4XYQ A;  5I2Y A;  1J9O A;  4RFB A;  2A73 B;  3A7L A;  1QJO A;  3GV6 A;  3L9A X;  2NVQ B;  3T56 B;  3VYS A;  2TSS A;  2LY7 A;  1SDF A;  1UNS A;  2K7V A;  1F77 A;  2PW5 A;  2DY8 A;  5G3L F;  5IT9 E;  1IL8 A;  2CVR A;  2B2U C;  1V1P A;  1ENA A;  4C3I B;  4HMI A;  1B3A A;  3I91 A;  1GUW A;  2WII B;  1MSH A;  1TWC B;  2ICE C;  4C1N I;  2F0T A;  3I72 A;  4BBS B;  2PQE A;  2NBF A;  3HS0 C;  1PZJ D;  2I07 B;  3NPP A;  1SYG A;  1FNU A;  5IGF A;  4OIJ A;  1LLR D;  4ZUI A;  1WD1 A;  3R3O A;  2D2C C;  3E6Z X;  4ODG A;  3LWU A;  1TS3 A;  3T13 A;  4K6L A;  1Y8N B;  2R6G A;  1IYU A;  3G7L A;  1HHV A;  2L1B A;  3S16 B;  3MXP A;  2F1M A;  2PZT A;  4FXG C;  4QUF A;  1G6Z A;  2MP1 A;  5EPL A;  1KNA A;  2RDF A;  1EQT A;  4KD3 A;  5JPM C;  2Z4I A;  4IFD J;  2EYH A;  4WOR A;  4EGV A;  2KED A;  1CA5 A;  3H0G B;  1TS2 A;  3Q24 A;  3NQT A;  5JJZ A;  1D5X C;  1CQF A;  1U4P A;  1I50 B;  3J80 L;  2CW0 D;  1AZQ A;  1SE4 A;  1SMY C;  1BQQ T;  4QF4 A;  3OWE B;  5EPJ A;  3A55 A;  1EEI D;  2J7Z A;  5FKA C;  2A6E D;  1B2T A;  5IOD A;  3QJY A;  3P75 A;  1JWM D;  1FGB D;  2YU9 B;  5KND A;  1CA6 A;  2F0V A;  1A3V A;  2L11 A;  4WJW A;  2NUC A;  3PIP 3;  3J7Y W;  1NR4 A;  5EKK A;  3J7A V;  4KI0 A;  2N55 A;  1KLU D;  4KJO A;  3TZU A;  4OIK A;  5CBA E;  1JCK B;  3PUW A;  3I8Z A;  3MXU A;  1Q1B A;  5CV5 A;  2EYL A;  4BBR B;  1D5M C;  2F0U A;  4HTH A;  2L5T A;  3BDL A;  2IL8 A;  1V1P B;  2TMP A;  2KQ3 A;  2LFN A;  2BOS A;  5M5Y B;  5CGK A;  1TS4 A;  1EFI D;  5JEA G;  3M4Y A;  1ZKO A;  4RH6 A;  1PTO C;  1IW7 D;  1H9M A;  4G4K A;  3SEB A;  3S15 B;  2NVT B;  4H7B A;  1TKW B;  1WCM B;  3IL8 A;  3NSW A;  2XWB B;  1PTO H;  2B2Y A;  4A3G B;  1L0X B;  4K5X A;  3S1Q B;  3MC0 B;  4UAI A;  1KAA A;  1BO0 A;  3VYU A;  3NWT A;  3S14 B;  3LNN A;  1JOK A;  1SAP A;  3D4R A;  3A7A B;  1HUM A;  3OMG A;  2NTT A;  4G7O C;  2SEB D;  2M00 A;  4C3H B;  1PTO D;  4RHS A;  1STA A;  1JB3 A;  4L6T B;  1A6X A;  3Q23 A;  4CKC A;  1EYC A;  3EVQ A;  3MFG A;  3I73 A;  3M85 A;  1WTQ A;  3RZD B;  2RSN A;  2X69 A;  4XQN A;  1D6E C;  1EZ8 A;  3R93 A;  1JE4 A;  4F88 A;  4DK0 A;  4NW2 A;  5ELB A;  3H94 A;  2K32 A;  5E3F A;  3SK5 A;  1KLG D;  2BDN A;  5JPN C;  3RZO B;  2H1E A;  5CYU A;  2EY5 A;  5I2X A;  1MD2 D;  4K14 A;  2AWN A;  1GUS A;  5C5M A;  1LO5 D;  3K5O A;  1A3T A;  5LHY 1;  4ILW A;  2JA5 B;  2K6A A;  1IHZ A;  2GA4 B;  2JE6 I;  4OO1 H;  2PMZ B;  5DAU A;  5DM7 3;  5EJW A;  2Q8T A;  1U9R A;  4U67 3;  4EVO A;  2ZT9 C;  1TU2 B;  2F0F A;  4TQU S;  1F2L A;  3DXJ C;  3NTK A;  4L63 B;  2LKV A;  2K5W A;  3EJI A;  1ENF A;  1BOS A;  1X32 A;  2SOB A;  4XQJ A;  1PFB A;  4LK1 C;  5IGD A;  5FO9 B;  1R9T B;  1PTO F;  1STE A;  1GOZ A;  4CKB A;  4FO2 A;  2QCP X;  4R8N A;  3S17 B;  2PO4 A;  3K0Y A;  4KMU C;  1HQR D;  5IGE A;  3K6O A;  2C9O A;  1H9K A;  3VYR A;  1JOQ A;  2XWJ B;  2WKD A;  1F9P A;  5CMD A;  4I65 A;  3CQZ B;  2EY2 A;  1PRT F;  3MA2 B;  2PZU A;  3FDT A;  2M9V A;  3TZD A;  5C0X H;  3KLS X;  3J80 E;  5C3W A;  5I9O A;  5C3X A;  1Q1E A;  2B8G A;  1YNJ C;  4CKE A;  3I70 A;  3DMU A;  3AMU A;  4WFN 3;  1PZI D;  2PPB C;  1VCI A;  5ELD A;  4BY1 B;  4IZ8 A;  1C8C A;  2DNC A;  4FF1 A;  4UDU C;  1TS5 A;  4RKB A;  4K8I A;  1AW7 A;  3K58 A;  2VUM B;  5E4W C;  3LX0 A;  3LWE A;  3DEP A;  2FMC A;  1HFN A;  3MWY W;  1SE3 A;  5D3I B;  2F0H A;  3DWP A;  3KLR A;  3A8J E;  3S9W A;  2WAC A;  1DXM A;  4PMB A;  1LAB A;  2JA6 B;  3N52 A;  1DZ1 A;  3BVZ A;  1WVL A;  1JWS D;  3GTL B;  5FOB B;  5LL6 S;  5CV6 A;  4RGT A;  3D3R A;  4GZY C;  1J8I A;  2RBM A;  2IWH A;  4CBV A;  1EQV A;  2WP8 J;  2G9D A;  1CHQ D;  4K8J A;  2IW3 A;  4TRD A;  2RDH A;  1BCP D;  3W3A A;  1A2U A;  4KKU A;  5NUC A;  2F0K A;  1SSO A;  2NZ1 D;  2B2T C;  5FLX E;  2PNR C;  1AN8 A;  4QB4 A;  5DNF A;  5J22 A;  1ESF A;  2O2L D;  1MGS A;  1JC7 A;  4P2C B;  1KAB A;  3BG3 A;  1AEX A;  3CKI B;  4PMW A;  2IX0 A;  5C44 B;  2KOL A;  1JWU D;  1ICW A;  2LS0 1;  5K36 G;  1ZYR C;  2QKI C;  5CBE E;  1RTO A;  3FRP B;  3ERQ A;  3X3N A;  1CFM A;  5CV8 A;  4K2K A;  4XYO A;  4XTC S;  2XNA C;  1GUO A;  4DN4 M;  1D1I A;  1GHJ A;  3IFD A;  4HAE A;  1B1Z A;  3S1R B;  2QDB A;  3CRK C;  1STN A;  3Q22 A;  2B2V C;  1SND A;  3AB9 A;  3NE5 B;  4B08 A;  1Z6H A;  5M3F B;  1VDZ A;  4Y7N B;  4RGO S;  1E0B A;  5IT9 L;  1PFM A;  4QCL A;  4A3F B;  4KTA A;  5J1Z A;  1OXU A;  2RQX A;  5JVG 3;  3M7N A;  5I6Y A;  2WKC A;  3RUZ A;  1TY0 A;  3RD4 A;  4EQN A;  3MFY A;  3TBI B;  2B2V A;  2Q8I B;  1LTS D;  3NWS A;  4ZYS A;  2B39 A;  1A15 A;  2E2I B;  4I7Z C;  4DF7 A;  4CHT B;  1EYA A;  1PTO B;  3MTS A;  2O4X A;  2D9U A;  5EQ0 A;  1S5D D;  3KLS A;  4OGQ C;  2F4I A;  3TP6 A;  1II3 A;  1A3U A;  4DA2 A;  1WTP A;  2F0L A;  3C1E A;  3HEJ A;  5C4H A;  1I4H A;  3I4N B;  3SVM A;  4FNF A;  1PMR A;  1ROD A;  2F0M A;  1F2M A;  3D4D A;  3HZX A;  4PMC A;  3T53 B;  2FMM A;  3I90 A;  4MHE A;  3HGB A;  3QB3 A;  4IUV A;  3HOX B;  1NR2 A;  4OL7 A;  3BVM A;  3L3O C;  1SBB B;  3KK7 A;  2XN9 C;  1EWC A;  2XVS A;  2AQ2 B;  4CJ2 C;  1XX8 A;  3A8K E;  1O7Z A;  1CT1 D;  2EYO A;  1UEA B;  1LT6 D;  1M4V A;  3MZ5 A;  5TSS A;  4N9P A;  1E2Z A;  5C0X I;  3H91 A;  2CQA A;  2NN6 G;  4M8A A;  3S1M B;  2B2W C;  2R92 B;  1U4R A;  1MBY A;  3OIQ A;  1GUG A;  3EQL C;  2JA7 B;  1DD2 A;  2A6H D;  2VB3 X;  3MXN A;  5JEA J;  3EA6 A;  3EFX D;  4AYB B;  1G91 A;  1R4P B;  1L0Y B;  1H9J A;  4IUT A;  4LMQ D;  2FJ2 A;  5KIX A;  1TT2 A;  4MN3 A;  3MAQ A;  3ZYY X;  2L9H A;  4ABN A;  5KRU A;  1F9Q A;  2NVX B;  3CHB D;  4RKL A;  3HG9 A;  1EU4 A;  1CZG A;  3NK9 A;  1EYD A;  3GQB A;  4DXG A;  4KY6 A;  2X6G A;  4IUN A;  3V05 A;  3MHB A;  3DHQ A;  1TWF B;  1GXD C;  3A56 A;  3KUP A;  4KHZ A;  4HCS A;  5EBC A;  5FLX L;  4NP5 A;  3K7A B;  3PIO 3;  1XWE A;  5A2Q E;  4IFD G;  2VB2 X;  3SK8 A;  3ND8 A;  4K5V A;  5IGG A;  1G2T A;  5EGT A;  1K83 B;  1PLF A;  4ME5 A;  5EKL A;  3C46 A;  3WDN A;  1RF2 D;  3ND9 A;  5LL6 X;  3HP3 A;  3GD7 A;  4L8J A;  4R9W A;  2RVL A;  3BS1 A;  1HQM C;  2HUG A;  2IPK D;  4RWS C;  5CV4 A;  1EY7 A;  2R7Z B;  2F0J A;  2E2H B;  1JOO A;  5CV9 A;  1T5X D;  2WV6 D;  1CHP D;  3BDC A;  3H09 A;  3H3V C;  1I4Q A;  4BA1 I;  1BCP B;  5ISR A;  2ID0 A;  4F87 A;  2PCF B;  3QO2 A;  2K03 A;  2BA1 A;  4A3D B;  3WOE A;  1FR3 A;  3J81 L;  5KNB A;  5M9O A;  3D31 A;  1ENC A;  4FVM A;  3KBG A;  2RSO A;  1C4Q A;  1PRT B;  5C0X J;  1WTO A;  4TSS A;  1TWH B;  2RKS A;  2R93 B;  1D1K A;  1S5F D;  2NVY B;  3D6W A;  2F0S A;  1Q8I A;  3R2T A;  1TWG B;  4BY7 B;  4KHV A;  2IX1 A;  1O80 A;  4B9X A;  4E6I A;  5T1I A;  4ID6 A;  3NP8 A;  1Y1V B;  4KY5 A;  2XIW A;  1DOK A;  3X3M A;  1CK1 A;  1TR5 A;  3I4M B;  1EIH A;  2A68 C;  2L4N A;  4XT3 B;  4A3K B;  3NXW A;  1B9M A;  2F03 A;  4ULL A;  1O7Y A;  2A74 C;  1CZW A;  2WB1 B;  4F7X A;  1D2B A;  4F8M A;  2F0E A;  3BYY B;  3K5N A;  5D14 A;  4KKT A;  1EOT A;  1B44 D;  2QEJ C;  4CJ0 B;  3ERO A;  2EE1 A;  1Y8P B;  2EJM A;  5M5W B;  3OOC A;  1OXT A;  2F0Q A;  2OF1 A;  5C4X B;  3GTO B;  3E0J A;  1KNE A;  5K5P A;  2F0P A;  1CM9 A;  2K5Q A;  3I3C A;  3TP8 A;  2VXW A;  1DJR D;  2HDL A;  2IT1 A;  3VR3 A;  2KHS A;  3V96 A;  4DU9 A;  1Y8O B;  4IN3 A;  3I4L A;  2BE5 D;  2Z8L A;  2HDM A;  3R2I A;  4DXF A;  2B63 B;  1ZYR D;  1EIG A;  3TP5 A;  4C3J B;  1T5E A;  1WTX A;  4XXE A;  1PFN A;  3KBX A;  1RDP D;  1YNN D;  1RJT A;  3H6M A;  3L7Z C;  3PUZ A;  1FD7 D;  2KEC A;  2PYK A;  3WOF A;  1Z47 A;  2PZW A;  4J8Q A;  2F0G A;  4FXK C;  1FNV A;  1XXG A;  3W2D A;  4ZQ3 A;  1S5E D;  4Q5V A;  1SE2 A;  4H0L C;  2AWO A;  4G7H C;  1EU3 A;  3FKI B;  3FPP A;  2XSC A;  1WTW A;  1SNO A;  4DNT B;  5K36 H;  1SYB A;  1AZP A;  2KCN A;  4C3J G;  3BZD B;  3U9S A;  1NUC A;  1SYD A;  1C48 A;  5HUR A;  1ET6 A;  1KDB A;  4A3B B;  4ZUJ A;  3GTJ B;  3HOU B;  2K01 A;  4FF3 A;  2E2D C;  4KJN A;  1STH A;  2E2J B;  2J4X A;  3VR4 A;  4IUP A;  2XRS D;  1PZK D;  1CI3 M;  3K57 A;  1MSG A;  1HUN A;  2X6L A;  1BUV T;  2C5C A;  5JAV A;  3U9O A;  1PYW D;  3PUX A;  2Q8R E;  4XIG S;  1TY2 A;  2EZV A;  3TN2 A;  5IGB A;  3QG1 A;  3HOY B;  3GTQ B;  4A93 B;  3MEH A;  1DCZ A;  3OIP A;  3ITP A;  2K1B A;  5I9P A;  4ZRZ A;  5A35 A;  5CV7 A;  3VYT A;  3K5L A;  1QIL A;  4A3M B;  3URY A;  3CU7 A;  4IUU A;  4DAV A;  1EL0 A;  4DGZ A;  1IW7 C;  2YYZ A;  4PQX A;  5KEE A;  2SDF A;  4OO1 I;  5BN5 A;  2F0O A;  2OT2 A;  2NN6 H;  2A6H C;  1A2T A;  1QG7 A;  5I4D A;  2KVM A;  2Y0S B;  2LMC B;  2K05 A;  1DYQ A;  4O42 A;  1CTM A;  5FK9 C;  4KD4 A;  2F3V A;  1BXT A;  3C1F A;  3GO5 A;  1BF4 A;  3IKJ A;  1SJE D;  2EYM A;  4OHJ A;  1EWH A;  2F0I A;  3IFT A;  2E75 C;  5D65 A;  4G57 A;  2E74 C;  5COY A;  1I6H B;  2NWG A;  1S4Z A;  4C1N K;  2EY1 A;  4X3U A;  4FXD A;  2NB0 A;  1LAC A;  4X3T A;  1SMY D;  1SNP A;  2EJG C;  1RHP A;  4M1U B;  3PUV A;  3JAM L;  3VA7 A;  4DAP A;  4HN7 A;  1RTN A;  5JOB A;  4WRD A;  2V4D A;  4Q0F A;  2B2W A;  5D3D A;  3SK6 A;  1ESR A;  4RGN A;  2AQ3 B;  2QF7 A;  4IFD H;  3TP7 A;  1SYC A;  3MXG A;  4IUQ A;  3NBH A;  1HA5 A;  2L12 A;  1U4L A;  3KF8 A;  1GJX A;  2K5D A;  2WAQ B;  1E2W A;  1QNU A;  1B9N A;  4HED A;  5IOC A;  3FPU B;  3M4O B;  2K04 A;  4IAL A;  2FFK B;  1VMC A;  5FO7 B;  1LTA D;  1SYE A;  3GTM B;  3IAY A;  2IJ0 A;  2EJF C;  1SXT A;  3S2H B;  1IKL A;  4CGY B;  3PO2 B;  2CW0 C;  1NCV A;  4HCE A;  4LAA A;  2BDO A;  1CQV A;  1LTI D;  3CRL C;  5HGT A;  4X3K A;  1Y69 U;  1IYV A;  3DWQ A;  1LT5 D;  4KN4 C;  4ZK9 B;  2QIL A;  5ELE A;  5CR3 A;  3A54 A;  2F0D A;  5DEH A;  2DY7 A;  1BDO A;  4EQP A;  1DM0 B;  4IQZ A;  2KEE A;  2HCI A;  1SFO B;  3S1N B;  3NQI A;  2EY6 A;  2MPM A;  2BA0 A;  1ET9 A;  3R8B A;  5C3E B;  3D4W A;  1XTC D;  5AFW A;  3Q0A A;  4MIU A;  2MJ8 A;  5EPK A;  3T16 A;  1G8Z D;  1I3Q B;  3QOJ A;  4DK1 A;  1SNM A;  2A69 C;  2EVB A;  1ILQ A;  2L55 A;  2A68 D;  1HRJ A;  3GP7 A;  3PMF A;  1EY9 A;  3VA5 A;  5I6W A;  2NTS A;  1VF5 C;  1HA6 A;  2L0C A;  1ML0 D;  3PUY A;  1O78 A;  3RMH A;  4JK1 C;  2KA7 A;  4HSP A;  4JBW A;  3P1H A;  3J81 E;  4HMJ A;  4HR7 B;  4QUC A;  2FHT A;  1QWY A;  4HSV A;  5M5X B;  3VR2 A;  2EYJ A;  4FYD A;  3Q6S A;  1JQY D;  1OXS C;  2XRQ D;  4KKS A;  2A69 D;  3SDZ A;  2O5I C;  5IIF A;  3QOL A;  4ZLT F;  1TWA B;  5IGC A;  5G3L D;  5E1F A;  1OXV A;  3P7J A;  2A5H A;  1V1O A;  5KYI A;  5KGU A;  1BCP C;  1KDC A;  1UAP A;  4K6D A;  4QIW B;  2EYP A;  2J0T D;  1B50 A;  1OO9 B;  3SXH A;  3VR6 A;  3N6R A;  1QE6 A;  1TQO A;  4RGM A;  2B2Y C;  3NBI A;  3SK4 A;  4XDX A;  3DWA A;  4FP5 D;  5C6A A;  3D6C A;  2RDG A;  4A3I B;  3GV3 A;  2BCO A;  2MHV A;  3TSS A;  1G2S A;  1HXY D;  1QCB D;  4DFA A;  4N9T A;  2CHB D;  1VMP A;  2FIN B;  3FVQ A;  1OXX K;  5M3M B;  4DNR B;  3HOW B;  5JEA H;  3DUZ A;  1EEF D;  3T4A C;  3BDO A;  2MUY A;  2BE5 C;  1I6V C;  2F0N A;  3J7A F;  2DN8 A;  5C4Z A;  3A8I E;  1BBX C;  1QB5 D;  4RHR A;  1STG A;  3C2P A;  2AQ1 B;  1G29 1;  4KV6 A;  1BR9 A;  4BS9 A;  2K33 A;  3P20 A;  5COR A;  1E2V A;  1Q3L A;  1K8O A;  1GHK A;  1AFP A;  2HCC A;  1EY8 A;  3NTI A;  3S2D B;  4RCN A;  1HCZ A;  1TVX A;  4NMZ A;  1Q90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...