4HMIA

Crystal structure of staphylococcal nuclease variant delta+phs v99k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMKNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V99K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hmiA00
1STYA 2KQ3A 3T16A 5C3WA 2F0TA 4WRDA 4F7XA 1EYAA 2OXPA 4PMCA 1A2UA 4PNYA 1KDCA 5IOCA 1STAA 5CV9A 4RKLA 1SYCA 4K2KA 3SK8A 3BDLA 1RKNA 2HQEA 2PZTA 1EY6A 1SNPA 2EYFA 4HTHA 2NUCA 4LAAA 1JOQA 5IGCA 2F0KA 2F0JA 5JOBA 1EZ8A 2PW7A 4KHVA 5K5PA 5KRUA 2F0HA 5I9PA 2F0VA 1NSNS 1AEXA 2EYOA 3MEHA 4K5VA 3DMUA 1NUCA 3TMEA 5IGFA 1A3VA 2F3WA 5CV6A 2PW5A 4ID6A 5EKLA 4EQNA 5IODA 1KDBA 2RKSA 1SNQA 1EY9A 5CV5A 4YIJA 5C5LA 1EY8A 3SHLA 2SOBA 3HEJA 3NK9A 2KHSA 3C1FA 5KGUA 2OF1A 1IHZA 1EY5A 1TQOA 2ENBA 5I6WA 1II3A 2F0FA 4IALA 1ENCA 1KABA 1ENAA 2EY2A 1EYDA 5C5MA 4B9WA 5EGTA 4J1MA 5HGTA 3MHBA 4K5XA 2RDFA 2F0NA 1KDAA 3TP8A 1U9RA 3D8GA 4IZ8A 2RBMA 3OWFA 3P75A 3SR1A 4ZUIA 2EY5A 4DGZA 1EY7A 4EVOA 5CC4A 2F0UA 2PYKA 3NHHA 2PZWA 5E3FA 5F2DA 1F2YA 2EY1A 4K5WA 3OMGA 2F0OA 3RUZA 4G57A 5CV8A 5C4ZA 5I6YA 1EQVA 3EJIA 5KEEA 5KIXA 5C6AA 2QDBA 3TP6A 2EY6A 5NUCA 1SNCA 4RKBA 1A3TA 1STNA 4DU9A 3R3OA 3TP7A 3VA5A 3MZ5A 4KV6A 3SK4A 4DF7A 3V2TA 5I9OA 5DAUA 2LKVA 3SXHA 1SNMA 3DHQA 4E6IA 5CR3A 2EXZA 4QB4A 5DEHA 5EKKA 4EQOA 4F8MA 5IIFA 4ZQ3A 1A2TA 4QF4A 4B9XA 5IGDA 4KY5A 4KJNA 4WORA 4EQPA 5M9OA 1SYBA 5IGBA 1EZ6A 2O4XA 3BDCA 1SYGA 1F2MA 3ERQA 4QMGA 5C3XA 1KAAA 5J39A 2F3VA 4TRDA 4H7BA 1SNDA 1STBA 2F0DA 4HMIA 5CGKA 2F0GA 2OEOA 3ITPA 3QOLA 1EY0A 2F0IA 2M00A 3PMFA 1STHA 3OSOA 4HMJA 3HZXA 4NDXA 3S9WA 4J6HA 5J1ZA 2PQEA 5E1FA 2F0LA 3NUCA 3MVVA 2SNSA 2SNMA 3EVQA 5KYLA 2EYHA 1JORA 3NQTA 4KD3A 4I65A 4K8JA 2F0WA 1EYCA 1SNOA 1TR5A 3LX0A 5CV7A 3SK6A 1JOOA 2WACA 1F2ZA 4MIUA 3TP5A 3NXWA 4DFAA 4IUNA 4K14A 4K8IA 5KYIA 5JAVA 4R8NA 3C1EA 2EYMA 2PZUA 3D4DA 5ISRA 2F0PA 4NP5A 3QOJA 5CV4A 4KJOA 4K2LA 4N9TA 4PMBA 1A3UA 4NKLA 4OL7A 4ODGA 3OMCA 1STGA 2F0MA 3D4WA 4S3SA 3T13A 1EY4A 2EYLA 3MXPA 3P1HA 5IGEA 3H6MA 4KTAA 4ME5A 2F0QA 5HURA 3NP8A 1JOKA 3SK5A 5C4HA 1SYDA 1SYFA 3E5SA 4K6DA 4KD4A 1TT2A 5IGGA 2EYJA 2F0EA 2F0SA 2EYPA 3D6CA 3EROA 3QB3A 4KY6A 4N9PA 4NMZA 4ZUJA 5J22A 3U9OA 1SYEA 4KY7A
chains in the Genus database with same CATH superfamily
1STYA 3T16A 3QG1A 1WTXA 5T1GA 5C4XG 4A3LG 1IW7C 1VQNA 4K2KA 1L2FA 2H4OA 2HQEA 4OIJA 2E2IB 2EOTA 1I4QA 1G2TA 1H95A 3T1YQ 2JA9A 1XNRQ 1L0YB 4JBKA 2PW7A 1ASZA 5I2YA 2F0HA 3BJUA 2JK8A 4DR3Q 5IGFA 3S1QB 1JC7A 1MJCA 2A74C 2AUJD 4OGQC 1BKBA 1SMYD 1P16A 2K7VA 1RTOA 2L5TA 4C2MH 1PH2A 2F0FA 1HFGA 1PH1A 1ENAA 4FF1A 4DR7Q 1MHWC 4B3TQ 2OQ0A 2Q2TA 1TVXA 1E24A 1JOQA 4DXFA 3AFQA 1RD9D 3OYYA 2EY1A 2IHEA 4A3MB 5JPNC 4GNXB 2VY3A 1KIXA 2EY6A 4DU9A 1A3TA 2DJFC 3ONAB 3S14H 1E3PA 4UPAA 5AJ3Q 3V2TA 2B2YC 2K5DA 2UXBQ 5C3EB 5FLXc 3GTLH 4AYBG 3CCRA 1HZ9A 3GTKB 2I5HA 2EXZA 1CKMA 4OX9L 4LNQA 1PTOD 5AFWA 1IKLA 4LK1C 3S1NH 1VQKA 1C48A 4DV6Q 5M3FG 4KMUC 2JP1A 3FKIB 2R92B 1KAAA 1BDOA 5FLMG 1EIHA 1GUTA 1B53A 1EY0A 1H9RA 1AH9A 1TS5A 4A3KB 5BR8L 2O5JC 1KC8C 4A3GG 3OOCA 1PTOF 1JMCA 2QGQA 3K5NA 2EQSA 4Q0FA 3GTQH 4KD3A 3VYRA 2E5LL 2CWAA 3S2DB 1M4VA 5CV7A 3CHBD 4LF7L 1AZQA 1HA5A 4OO1I 4X64Q 1WCMH 2F0PA 3ND8A 4JOIA 1A3UA 1EY4A 3NBHB 3K7UC 3H6MA 5IWAL 2JA5G 4DR6Q 1LYLA 3U4ZA 1OO9B 4JW0A 4O0AA 4KHPL 1MD2D 5HURA 4IPCA 1WVLA 4IFDG 3NBHA 2QA4A 1BCPD 1NAPA 3OHXC 1EL0A 2CW0D 2WB1E 2NUCA 5C0XJ 4NW2A 3HOUG 1IBKQ 5FO7B 3KJPA 1NE3A 3R2TA 4R8IA 4JV5L 4YIJA 4GKJQ 1BCPF 1PRTD 3L3OC 3BVZA 1TQOA 2UUCL 1DYQA 3HOWG 2D0PA 1CT1D 4LF8L 1ZEQX 1Q3LA 3T51B 4GLXA 2WB1B 2Q2IA 4BY7H 4OONA 1LT6D 2PZWA 2VQEL 1JWUD 1KQSA 2OCEA 2RF4A 3KFUA 4DPGA 5C4ZA 1SFOH 1CKOA 1EQVA 1PRTF 4J15A 4A3FH 5NUCA 5LMUQ 3TP7A 4KV6A 4HSPA 2AQ1B 5ELDA 1HTLD 2Q8IB 4P71A 1PH6A 3PO2G 4IJHA 1LLRD 3M7GA 4RMFA 5CR3A 4LUVA 1SAPA 4F8MA 3PF5A 2NVXH 1E1TA 2HIXA 1Z9FA 4LMQD 4DV4Q 1A6XA 3HOXG 4JI7Q 1BNZA 1TWFB 4I7AA 1EEFD 3VYSA 2G9HD 3SE0A 3CCMA 4H7BA 3GDEA 3LWEA 4IOCA 5CGKA 5LMNL 1G6PA 4HMJA 5C4JH 3S9WA 4DK1A 5E4XA 4X3UA 1VQLA 1YNJD 3RMHA 4A3EG 3PSIA 1JORA 3CCLA 2BE5C 1T5EA 1PYBA 4TVAB 5IYDH 4WJ4A 4L5QA 3RLNA 5FO9B 1KHIA 2B2VC 1XNQQ 2K5VA 1HQMC 2WKDA 1YVCA 2F4VQ 3KOJA 1SROA 1PLFA 4MZ9A 4S3SA 5M3MB 1JE4A 4KTAA 3U58A 2WKCA 4BS9A 1Y1VH 1LO5D 2KHIA 3IAYA 2HHHQ 1D2BA 4C3JG 1W3SA 1A8VA 3GV6A 2EZVA 2OXPA 2E2DC 2XSCA 4PMCA 2CH4A 3CC4A 4A3DB 1ILPA 1HQRD 2DNCA 1Q81C 1WJJA 2WP8J 2ZTDA 1DOLA 5DM63 4JK1C 4KHVA 5M3FH 4IN3A 3CCEA 4A3JG 1K9MC 1D1KA 2JA6G 1CA5A 1JCKB 1ML0D 4GOPB 3I4MH 1E2WA 5KGUA 1F9PA 2B63G 4ZK9B 2R93G 1SR3A 2ZXRA 4GN5A 4DR2Q 4GOPA 3AEVA 4DUYL 1LT3D 1R9TH 3GTOH 1I4HA 3ULLA 4FXGC 4ZUIA 3STBD 1EU4A 2F0UA 4JI4L 4IPGA 3AU7A 5KIXA 2Q2HA 2ALYB 2BA1A 4OO1G 1I6HB 1STNA 2NWGA 5EPKA 3VA5A 4P74A 3PO3B 4DF7A 1F2LA 4A3BB 3TRZA 4OEMB 2HDLA 3DM1A 4A3IB 1JB3A 4U673 3S17H 3J81j 2CVRA 2HUGA 2I5MX 3I2ZA 1A0IA 4IFDH 3TZUA 3FRPB 4EQPA 1VQ5A 4KKSA 2UUAL 1F9RA 4DV0L 1STEA 4HMIA 4OWWB 5JPMC 1YNXA 4DR4L 2OEOA 1SBBB 2IX1A 4RGTA 5KNBA 2F0IA 3T4AC 1X32A 1CHQD 4RAUC 4CGYB 4YY3L 4OX9Q 2B2TA 4O1NA 3A74A 2B8GA 1HJPA 3NXWA 4DK0A 1GOZA 1I4XA 2ZXPA 1Z6HA 5JAVA 5C3EG 4PV1C 3GTMH 2PZUA 3H3VI 4WFN3 1B8AA 3Q6SA 2FHTA 4N8X1 5BR8Q 5M5YH 4Q5VA 3D4WA 3MAQA 4QCLA 4B3ML 2KOLA 2E5LQ 5C4XB 1IW7D 4CJ1B 4LF7Q 1S5BD 4RGOS 4A3KG 3A55A 1RODA 3PV0A 4RKLA 3SK8A 4GN4B 1OXTA 3WWVA 1F9SA 2PI2E 3E3XA 4UP9A 2JA8B 3CMAA 2LSSA 2TSSA 5KRUA 1EOVA 5EJWA 5K5PA 1G2SA 1NSNS 3AB9A 1UUPA 4ID6A 1HXYD 3NBIA 2KHSA 3PUWA 1E2VA 3QWNA 2NN6I 2IJ0A 5M5XB 2R7ZB 5I6WA 5JJLA 1DZ1A 3D3RA 2PPBC 4DGZA 5C44B 5HGTA 2IX0A 3M7NA 1IYJB 3VYUA 1SMXA 4RH6A 5F2DA 3LWUA 5CV8A 2PI2A 1RHPA 4JV5Q 2B2UA 2A19A 4JBWA 1OTCA 1K28A 5COYA 2K03A 3C3LA 3M3YB 4KK7A 2B2WA 2UUCQ 2VB3X 4X3SA 3LNNA 4LF8Q 1PV4A 3E9IA 3CKIB 1CZWA 4X3TA 2PMZE 4C3JH 2A8VA 4WORA 2VQEQ 4BBSH 3MXNB 3MWYW 3U9SA 1V1QA 4B3RL 1B3QA 1Q1BA 1HNXL 4ZKBB 3S24A 4XYQA 2WB1G 3MXNA 1K3RA 4A3JH 1VMPA 4NDXA 4JBJA 1Y14B 2OWOA 3S2HH 2P5ZX 1E1OA 5ELOA 2JA6H 3D0FA 3S1MB 1ENFA 4ZKCB 5I2XA 4FXKC 3F2UA 1QNKA 4QIWE 4RA8A 5KYIA 2CQOA 1GM5A 1WTPA 1O78A 3HGBA 5ISRA 4RFBA 4KN4C 1IL8A 5LMNQ 4R4OA 4OL7A 3G6EA 2F0MA 1S5FD 2C35B 3CCJA 3L0OA 5C4HA 1HFNA 3E5SA 2F0SA 3EROA 4OO1H 1LTID 1QVCA 1JB7A 2JE6I 1PH7A 1EYGA 2Z9HA 3CW2C 5IOCA 2XN9C 1KD1C 4L5TA 1HNWL 4X66L 2K75A 3S1QH 3FMCA 2BA0A 1EY6A 4A93B 1YITA 4LAAA 1EZ8A 3J7A5 1ZYRD 2JA7B 1QCBD 2L12A 4X3KA 4GS3A 4LF4L 3W2DA 3HOWB 4DNIA 1G91A 2RKSA 1EY9A 1K8GA 5A2QL 1MJEA 1EY5A 1VQOA 1NMGA 4TQUS 1UE1A 5T1IA 5M3MG 4A3MH 3J7ZC 2B29A 5BN4A 1I4PA 2DNEA 1HR0L 2L1BA 1KDAA 4EVOA 5CC4A 1SLJA 5FJ8G 1QE6A 1YZ6A 2AKWB 1PVOA 5DNFA 1D5XC 4A3DG 3EJIA 5KEEA 1D5ZC 4QL5A 1A63A 5E4WC 3UE0A 5I9OA 3Q22A 4C56C 1YJWA 4YCWA 3HOXB 3VA7A 1EOTA 3FKIH 2VL6A 2R92H 1Y8PB 4DUYQ 3ULJA 1B1ZA 1GO3E 4YCUA 4ZQ3A 1X54A 4JI4Q 1FVIA 2CH4W 4F87A 1DXMA 3BDCA 3H0GB 1MGSA 1NR2A 3H09A 1VF5C 3A8IE 4A3EB 3S2DH 2BE5D 4BA2I 4BBRG 1VQJA 3Q23A 3A7AB 1KTKA 2BOSA 3PCOB 3CMEA 1XTCD 4C3IG 4LFBL 1HZCA 1TS4A 1GHJA 1Y1WB 3PO3G 1I4GA 2UUAQ 1JJGA 3CP0A 5I4DA 1HUMA 1FNUA 4A75A 3C1EA 4A3IG 1X3PA 2DGYA 3D4DA 4X65L 4DV0Q 2UU9L 2DN8A 2JN4A 3I4LA 5HY6A 3RZOH 4DR4Q 4M8AA 3QOJA 3S1RB 4PMBA 1X9NA 4G4KA 4YY3Q 4DR1L 4XYOA 4KHZA 2Z4IA 3A7LA 4R4CA 4HSVA 1H9MA 2VZAA 1KDCA 4GNXC 4BXXH 5ELFA 3DEPA 2Q8TA 3BU2A 2PZTA 4L63B 3HRZC 1V9PA 3HKSA 2F0KA 4DAMA 1Q8KA 1PFSA 3CCSA 3I4NB 5IT9c 4K0KL 4B3MQ 2EYOA 1AEXA 4RGMA 1KDBA 2RA4A 1N8RC 1WI5A 3K7AH 2FINB 3JC66 4FO2A 1FL0A 1E7ZA 4YWLA 3K81C 4DK3C 4DXGA 3FP9A 1ESFA 1KABA 1WTHA 4C3HB 5BN3A 4K5XA 1U9RA 4RCNA 5A35A 1WTQA 1IBLL 2B8FA 5A2QE 1QG7A 1K83B 3J81i 1BBXC 2UUBL 3G4SA 3I72A 4HJAA 2JA8G 3SK4A 3T1HL 2Z4HA 3C2PA 4JOIC 1WTOA 4A3CG 2RQXA 3PUVA 3FPUB 4OWTB 4HCSA 1L0XB 2GVBA 4FDBA 4IPHA 2MP1A 3R2IA 4KKTA 4IQZA 2R7ZG 1PH9A 3MFGA 4JI8L 3I55A 1FJGL 4DAYB 1H9SB 5LMNW 4KI0A 5EBCA 5C44G 3V05A 3P7JA 5C0XH 2HCIA 3VR2A 2F0LA 3GTJB 2IPKD 2NZHA 4DAYA 1H9SA 4DV2L 3A8JE 3BZKA 4HAEA 1PZID 3KYHC 4DFAA 1PFBA 4FF3A 2MPMA 5BN5A 4B3RQ 3CPFA 1HNXQ 3HFZB 1G51A 1EUJA 4RWSC 4KJOA 4K2LA 4DNRB 2K50A 2BCOA 2EYLA 5IGEA 3F2DA 1Y8NB 1V8QA 1FD7D 3CCVA 4A3DH 1G8ZD 1SYDA 2EYJA 1J8IA 2ICEC 4N9PA 1RTNA 3TS0A 3HOYH 1HA6A 1ET6A 4KY7A 3UE1A 1ET9A 5CV9A 1SYCA 3HOVG 4LWCA 1I50H 5JVG3 3BZDB 1JJCB 2NVYB 2IY5B 4BY1B 4ZRZA 2ES2A 3K5OA 3TMEA 3A5UA 2EJMA 2IL8A 1WD1A 1VQDA 1U4RA 1W2BA 1F77A 1LABA 4V0BA 2SOBA 3J81L 2SDFA 3QJYA 1HRJA 1Y8OB 4LUOA 3OW7A 2XWJB 4X66Q 1HNWQ 3TQYA 2EY2A 1EYDA 1XMOL 3MXUA 2F4IA 1I6HH 2ZM6L 2RBMA 2EY5A 3PO3H 1PFMA 1J5EL 4A3BH 4LF4Q 4K5WA 3OMGA 3UDFA 5IYCH 2KCTA 1TWGH 3NEMA 1KRSA 1CTMA 3AMUA 1AW7A 1AFPA 2QKIC 1B44D 1PH4A 4A93G 3NTHA 2YTXA 3PUYA 1A62A 2JA7G 1ZYRC 1SNMA 2F52A 2C9OA 1HR0Q 3I4OA 3PIO3 2NZOA 3M4OB 4JI0L 1VQEA 3SDZA 1WOCA 3CQZB 4YHHL 3UDXA 3F2BA 3N6RA 1YJNA 5C3XA 1HHVA 1F2MA 4BWGB 2HD3A 4RG1A 2QCPX 4PZ6A 4PZ7A 3HOZB 2JJQA 3QOLA 2HQLA 3S15H 2NVQB 2N78A 2VQFL 1B9NA 3ERSX 3KJOA 2SNMA 3EVQA 2EYHA 4XDXA 3NQTA 4MNOA 1D8LA 2DUDA 3H3VC 1RL2A 3M4PA 4P75A 1KRTA 5JEAG 4A3CH 2PQAA 4XT1B 2K04A 5C4XH 4GOPC 1X55A 4A3LH 2F1MA 2PCFB 2WV6D 2K5NA 2WINB 3HG9A 1BQQT 1EQQA 3PIPA 1JOKA 3BYTB 1X3GA 1CK1A 3H0GG 4K6DA 1X6OA 4NXNL 5IY0A 3ND9A 1CQFA 2EYPA 4LFBQ 4CDCC 2JA8H 1R4PB 1OXXK 1D7QA 4IUUA 1B50A 1ASYA 2RDGA 2UU9Q 4X65Q 2ASBA 4ALPA 1XJVA 3BDOA 2ICIA 1Y1WG 2GA4B 4LFAL 4DR1Q 2F0VA 2R7ZH 4FP5D 4XQNA 5D14A 1UE7A 1NNXA 2J0TD 3NSWA 1CUKA 1IHZA 4G7ZC 1V43A 5C44H 2ENBA 1II3A 2Z6KC 1JQYD 3FEWX 1N36L 1PH3A 1E2ZA 1I6VC 2Z1CA 1DGSA 2B2TC 1MSGA 3TP8A 2LFNA 2PYKA 4JI2L 3J81E 4K0KQ 4JC0A 2A6EC 3RUZA 4EGVA 3S1NB 2L0CA 3CRLC 1GVPA 1AE2A 2ZT9C 2N88A 3KF6B 3J80i 2D62A 5FLMH 4JYAQ 3EQLC 3JAMi 3K8AA 3I4NG 1K0RA 3DHQA 3KF6A 5DEHA 4A3GH 2RCFA 1PMRA 2XIWA 5FK9C 3OIPA 3OTOL 1M90C 3E0EA 1IBLQ 2QW7A 1B3AA 1QILA 3GTQB 1YIJA 2KHJA 4BBRB 2AUKA 1HNZL 2C5CA 2UUBQ 4TRDA 2F0DA 4C3HG 4Z9CB 3T1HQ 1QOHA 1WCMB 2GN5A 2O2LD 2B39A 4C3IB 3QO2A 1RJTA 2J4XA 5J1ZA 5KNCA 3NUCA 3MVVA 4RHSA 1BBWA 1BO0A 2EIFA 4UP7A 2JA5H 3TREA 3HKZE 3OPOA 2GVAA 5IYBG 1CKNB 1SNOA 5ELBA 3TP5A 2WACA 4A4IA 5EAYA 5TSSA 1BBUA 3D6WA 4JI8Q 2F3IA 1CKNA 1FJGQ 4NP5A 1GUSA 1CQVA 1STGA 2XVSA 1SJED 4ILWA 2M2LA 1TKWB 3L2PA 1X65A 1SYFA 1Z47A 4DV2Q 3HOUH 3HKZB 1B7YB 2EVBA 2B2UC 2CHBD 4XQQA 3J7AV 2B2WC 1EIGA 4DV5L 2JA7H 1EFID 3PUXA 1Q1EA 4X62L 3HOWH 2XWBB 4XTCS 1V1OA 3G7LA 3KBGA 4AQYL 3GV3A 4LW1A 4R1JA 4BY7B 1FGUA 3DMUA 2I5LX 1NTGA 3NK9A 4IURA 4PQXA 1WD0A 2XTIA 3KDFA 4C1NK 2MNAA 3J80L 3Q8DA 1MKHA 3TEHB 4JBMA 1HR0W 1YI2A 3JAML 3GO5A 3PO2H 3VYTA 1VQ6A 1TS3A 3SR1A 4X6AH 4BA1I 2N3SA 2VNUD 4G57A 3HOXH 4P72A 4XXEA 1U4LA 2NYZD 5IWAQ 1FNVA 1SJHD 1VQPA 1SNCA 1DCZA 2NBFA 3T56B 4OIKA 1SRUA 3M4YA 4APVA 2MUYA 3CC7A 3R93A 4KHPQ 2RVLA 1Q90A 1JE5A 4BY1G 3GTPH 4DUZL 1XMOQ 3H0GH 4DV3L 5C4JB 1VDZA 2ZM6Q 2MHVA 1CFMA 3KUPA 5CBEE 3L9AX 1VQBA 4A3EH 1BUVT 3PUZA 4DR5L 1J5EQ 2EPBA 1I4RA 2LY7A 2O4XA 3BVMA 3H91A 5J39A 3H94A 3W5OA 1G291 4QQBX 1YBYA 4A76A 5IP7G 1TIID 2E2JH 1Y1WH 5K36G 1P8LA 4J6HA 3H15A 2MGSA 4JI6L 2NVTH 2IT1A 1XYIA 4JI0Q 2F0WA 1EYCA 4YHHQ 3E9HA 3S1RH 4K14A 4PMWA 1Y1VB 5GROA 2OT2A 5ELEA 1AE3A 4R8NA 4O42A 1RIPA 3WOFA 1K3BC 1H9KA 1D1IA 3NELA 1GJXA 2KJXA 2YU9H 1TWHH 4POGA 2QDLA 2DY8A 2VQFQ 3I3CA 4ME5A 1D6EC 4OHJA 1PTOB 5EQ0A 3W1GA 2H1EA 3HOZG 1X56A 3RD4A 3KBXA 3HOVB 2KQ3A 2L55A 2K6AA 1EYAA 1AN8A 2PMZB 4CKBA 1OXVA 2H5XA 5M5WH 5CORA 2B63H 3I4MB 5JEAJ 1MSHA 2R93H 2BDOA 4V190 3BDLA 3URYA 4R4TA 4ZLTF 1HH2P 1VS0A 3CCQA 1R9TB 2R6GA 4NXNQ 3I90A 4B3SL 5CV5A 4JCVE 4ZCKA 4MTKA 3C1FA 1S4ZA 3KK7A 2AWNA 4IJLA 2E2IH 3PGZA 4QIWB 2OQKA 4KN7C 5C5MA 3RZDB 4J1MA 1K83H 1XXGA 2I0QA 4LFAQ 3OIQA 2X6GA 3J80E 1SXTA 1GUWA 2QDBA 3TP6A 1S40A 2JEBI 3JAME 1I3QB 3DWQA 1UEAB 4CBVA 3CRKC 1JWMD 3FVQA 1N36Q 2OTLA 3VR4A 4JI3L 4QUCA 3K58A 4DN4M 4KJNA 1KNEA 1WFQA 3A56A 3ZJYC 1S5DD 1EZ6A 2CFMA 1L1OB 3MFYA 4HN7A 1STBA 1PRTB 2VXWA 3A5ZB 5C3EH 3QR8A 1L0WA 3GTKH 4JG2A 1L1OA 4Y7NB 2MQHA 1WTRA 3FPPA 4HIMA 1QZGA 1RCVD 5EBDA 3L7ZC 3OTOQ 5GAGC 3SK6A 3CF5A 1F2ZA 4R4QA 4HJ8A 4FNFA 4DK6C 1VQ4A 1HNZQ 2R7DA 2AMCB 1W6JA 3F1ZA 4A3KH 1KLGD 1ILQA 2N8NA 2CQAA 1EIFA 1K8OA 4N9TA 2KCNA 4DV1L 4B08A 2AQ3B 2M9VA 3NWSA 3KLSA 2FJ2A 1J9OA 5JJKA 2F0EA 4NMZA 1PA6A 3U9OA 3CC2A 1VQFA 1WCMG 3GTGB 2NVYH 4QJFA 3C46A 1YJ9A 2VB2X 4U68A 3O13A 4BY1H 1C8CA 2PNHA 5GAHC 2D9UA 4YWMA 2KBNA 1RKNA 1QUQB 4HTHA 5D65A 1GKHA 2NN6G 4XT3B 4L6TB 5GADC 4HIOA 5JOBA 4LJZC 4CDFC 5FOBB 5FLXL 3F2CA 5IP9G 1QUQA 1C9OA 5CV6A 2PW5A 1K8AC 2D0OA 5ELCA 1TWAB 2NTSA 3MTSA 3HEJA 4DV5Q 2A6ED 4X62Q 1DM0B 4N8FA 1KXLA 3HKZG 1ONLA 4I7ZC 1VQGA 4IZ8A 2E75C 2K01A 4LF5L 2VUMB 3KLSX 2AHOB 4AQYQ 1N32L 1VQCA 2KENA 4PZ8A 4NXML 1VMCA 5CBAE 2F03A 1LTRD 5D3DA 3F8TA 1IBML 2A5HA 2JYOA 1K0SA 1LUZA 1QNUA 5FO8B 2BH2A 1WTVA 3S16B 3K0YA 1T9HA 4BY7G 2QEJC 1EQTA 2JQOA 4FXDA 2EDGA 3M9BA 4B9XA 5DM73 1X3EA 1TWCB 5M9OA 1SYBA 3K59A 2A6HC 2NVQH 4C1NI 4QMGA 4RHRA 4EQ5A 1JJ2A 4LUZA 1SNDA 4IUPA 2IHFA 5GAEC 1XPUA 2M00A 2WIIB 5JJZA 1IZ6A 1I5FA 4MHEA 4DUZQ 1DD2A 4DV3Q 2SEBD 1TWFH 3CAMA 3DEOA 1YNNC 4ME3A 4J8QA 4OELB 2CCZA 3A0JA 1JOOA 5IE8A 4DR5Q 4DR2L 2FFKB 4GLVB 1EIYB 2RHQB 1KLUD 1N33L 3TN2A 3K0XA 4JI6Q 4GN3B 1T5XD 3MC0B 3NP8A 1Z7TA 5IYDG 3NE5B 4DNTB 3BS1A 2EXDA 3Q24A 2F0TA 1YEZA 1A2UA 2DJGC 1ICFB 4PNYA 2MO0A 4G7HC 1JT8A 5M3MH 4L5SA 4CKCA 1U4MA 4FF4A 1ICWA 5IGCA 4H0LC 1Y1VG 1VQ8A 4M1UB 4HR7B 3MEHA 4LF6L 2QILA 1B9MA 5FJ8H 3GP7A 1FNWA 4EQNA 5C5LA 5JJIA 4GNXA 3I73A 2YTVA 5EPJA 4DAPA 2NB0A 1VQMA 3KLRA 3H3VH 5EKIA 4IALA 1ENCA 3K80C 4CKEA 1QWYA 5FLXE 1O80A 4JPBW 2QEXA 4HJ9A 4AIMA 5E3FA 3U4VA 3D4RA 3KLWA 2DY7A 3I4MG 4B3SQ 2I46A 1W6KA 4HIDA 2A69C 4IUTA 5DAUA 5ELNA 1ZXTA 1EQRA 1JR0D 4BBRH 5CMDA 5EKKA 2ZJPA 1Q12A 1A2TA 4QF4A 3J7YW 2FXQA 4C3IH 2G5DA 3ULPA 1IYVA 1EWCA 2BH8A 1HTPA 3VR6A 1UAPA 3X3NA 4A3IH 2NN6H 1XPOA 1XTDA 3RZOB 4WJ3M 3G6JB 1S5ED 1B4OA 1LT5D 4HIKA 2SNSA 5IP9H 4JI3Q 1EEID 1PH8A 3X3MA 2ZXOA 4IPDA 2PO4A 3TZDA 4DV7L 1PDQA 1WYDA 1PYWD 3PQIA 1U4PA 2KEEA 4L8JA 1X3QA 1MIUA 2B2YA 3RLFA 3V96A 3BZCA 4NKLA 4P2CB 2WAQE 1Q82C 3MXPA 3A54A 3DUZA 2Z8LA 4R9WA 2F0QA 4P73A 1E22A 2E2HB 3CU7A 5IGGA 3MXGA 4JI5L 3PIOA 4UAIA 4JVZA 1MBYA 5C3WA 1H9JA 2PQAB 1BF4A 1KAWA 2L9HA 3ICEA 3IRBA 4PG3A 2KVMA 1U5KA 3K7AB 4DA2A 1BR9A 4ABNA 1WTWA 2X6LA 2XGTA 4DV1Q 4NPSA 2WAQB 3FHWA 2ZTCA 5JVH3 1EWIA 2F0JA 2ID0A 5I9PA 2K1BA 1GUNA 1CSQA 3N52A 4CJ0B 4JI1L 5IODA 1LTBD 2D2CC 3SHLA 2A68C 1C7YA 4OWXB 3SEBA 4H13C 2I07B 2OF1A 2V1CC 3AQQA 3PIP3 2Q2UA 4R4IA 1LTLA 1TXYA 3G48A 3W1BA 4KKUA 1A15A 2KEDA 1SDFA 3EFXD 3MHBA 2D5DA 1Y69U 3IFTA 2ZTEA 3P75A 2Y0SE 2Z0SA 1S72A 1SSOA 5LL6S 4C2MB 2Q8RE 3UDGA 5M5XH 1PZJD 4RKBA 3MEFA 3R3OA 5L37A 1PHJA 4LF9L 3R8BA 1I94L 1PZKD 3IFDA 2MFIA 4E6IA 3GQBA 4QB4A 4FF2A 1LTAD 1M8AA 3S14B 4LFCL 1SN8A 3J81c 4LF5Q 2Y0SB 2V4DA 5IGDA 4YCVA 2JXMB 3NQIA 4IOAA 1N32Q 3GTLB 4NXMQ 4TKOB 5FKAC 3M3YH 2E8GA 1EU3A 2F0GA 1QVGA 1LTTD 1IBMQ 1PXUA 3ITPA 2L11A 2VUMG 3AFPA 3G71A 3CXCA 1U0LA 2WFWA 1OXUA 1N34L 4BBSG 5CYUA 4FVMA 4K8JA 1XMQL 3K5LA 4MIUA 1XX8A 1JWSD 3EN2A 1TY0A 3WOEA 3HOYB 1B2TA 1PTOH 5CV4A 3SVMA 1F9QA 1IXRA 3HOVH 3S1MH 4ODGA 1UNSA 3OMCA 1S3OA 2HCCA 1I50B 3IL8A 2A1AA 2ATWA 1UEBA 4Y52H 4XIGS 3SK5A 1HZBA 1LV9A 1B70B 3QB3A 2KCMA 1SE4A 4GLAC 4GKKL 1Q8IA 4EX5A 1D5MC 1SNPA 2EYFA 2KCCA 1DONA 1N33Q 1VF7A 1IYUA 1R4QB 4IO9A 2UXDL 2EE1A 3P20A 3RZDH 1SNQA 3D31A 1EY8A 1TWGB 1SE2A 1VQAA 4A93H 2B2VA 1RF2D 5C0XI 2E74C 2R7FA 2EJGC 2E76C 4FYDA 1SMYC 1PH5A 3EBEA 3D8GA 4F7XA 3OWFA 1I3QH 1FGBD 3NHHA 1F2YA 4UHVA 5I6YA 4LF6Q 4YWKA 1CA6A 3KDFB 2Z6KA 1N9WA 3UI2A 4A3MG 3HS0C 1S5CD 3DWAA 2A73B 2UXCL 3SXHA 2VW9A 1M1KC 1SFOB 2K05A 4A3FB 2A6HD 1BXTA 2RHSB 3S15B 4OXPA 3VDYA 4TSSA 4UY8C 4F88A 1GXDC 3WDNA 5IGBA 2MJ8A 4Y7NH 2LXKA 1PTOC 2NVXB 1KL9A 1HUNA 3UDIA 5JEAH 1YNND 1NMFA 3FKIG 1YHBA 4G7OC 2R92G 3RN2A 1K73C 4IUVA 3HZXA 3NTIA 2PQEA 2KA7A 2J7ZA 5KYLA 3DM3A 4DAVA 2YV5A 1O7YA 3VR5A 2VS1A 1CI3M 4ULLA 1Q46A 3J7AF 4XQJA 2EYMA 5LHY1 2B3GA 4ZAIA 1DOKA 1GUOA 1G6ZA 3TSSA 4RCOA 3T1YL 1XNRL 3T13A 3GTGH 1O7ZA 4QGUA 4AYBE 1QZHA 3HP3A 4AH6A 2X69A 2ZJQA 4DR3L 1TT2A 2XNAC 4IFDJ 4ZUJA 4ZYSA 2R61A 1PFNA 4WRDA 4DV7Q 3TS2A 1STAA 1ZKOA 2CKZB 3K57A 4DR7L 1TWAH 2CWPA 4QY7A 2YYZA 3OWEB 4B3TL 1BCPC 3NENA 1OXSC 1HPCA 4AYBB 1GHKA 5H1SE 2RDHA 1V1PB 3RLOA 4JI5Q 4K5VA 2CW0C 3FDTA 1A3VA 1SE3A 2NTTA 4RGNA 4HJ5A 2VUMH 3EIVA 5M3FB 4BXXG 2QF7A 1V1PA 3DWPA 5AJ3L 1QJOA 1JICA 2JEAI 2UXBL 1L1OC 4B9WA 1PRTC 2R3ZA 5EGTA 3I4NH 4CHTB 2F0NA 1XPRA 2A69D 5G3LD 4HJ7A 1PYSB 3DLLA 4A3GB 1KNAA 1TU2B 4DV6L 1FYCA 2F0OA 3S16H 2PNRC 4JI1Q 5C6AA 2YTYA 2XRQD 3GTOB 2XRSD 3TBIB 1CHPD 3MZ5A 4C3HH 1NCVA 2HIVA 2WAQG 5HGQA 3CPWA 3CD6A 1TWCH 2LKVA 2K52A 3NTKA 5G3LF 1Q86C 4EQOA 4MN3A 3I8ZA 3ZYYX 5IIFA 2HT1A 1LTSD 3QIAA 3A8KE 1LACA 3J80c 3NPPA 2IWHA 1XWEA 2KUMA 4UP8A 5IYBH 2JA5B 3Q0AA 1SYGA 3ERQA 3JAMc 3S17B 1VQHA 1LT4D 4X64L 1SE8A 1NJIC 2O5IC 2K5HA 3M85A 2RSOA 1AZPA 4LF9Q 5EPLA 1STHA 2LS01 1IL2A 3K5MA 4KLKA 1I94Q 1LM0A 3B6YA 5E1FA 1BCPB 1QB5D 4H44C 1O7IA 1FR3A 4LFCQ 4DR6L 2RCNA 4I65A 4O2DA 4NB3A 2TMPA 3SGIA 1UWVA 4K8IA 1NY4A 3HOUB 5LL6X 1YNJC 4JI2Q 2K14A 3AYHB 5IT9L 2ZJRA 3VR3A 4L5RC 1GUGA 5C0XG 2Y0SG 3GTJH 2JSOA 1IBKL 3GTMB 1N34Q 1K8MA 4HEDA 4KD4A 2N49A 3DXJC 3W3AA 3D6CA 4KY6A 1XMQQ 1MI2A 4GKJL 1LTGD 5M5YB 1BVSA 1RDPD 3M4QA 1CM9A 2KECA 2AQ2B 5DLQE 5E7NA 2LXJA 1VQ7A 3OW2A 2A68D 1VQIA 4GZYC 3PO2B 2K5WA 4POFA 3KF8B 5GQOA 3MA2B 3HOYG 1NUCA 2K33A 2F3WA 3I70A 5EKLA 1EWHA 4H02A 5LMUL 1IKMA 4GKKQ 2L15A 1TY2A 3ER0A 3KF8A 1NR4A 2N55A 1HZAA 1C0AA 1GD7A 1YHQA 2RDFA 3GTPB 5J3BA 4DV4L 1UE6A 1EY7A 1J6QA 2NZ1D 4JI7L 2UXDQ 1CSPA 1HCZA 1SEBD 2FMCA 1NBWA 3CCUA 4IFDI 3I91A 4WJWA 3STBC 4IUQA 1DOMA 4QUFA 2IW3A 1QVFA 2K28A 4MTNA 3GD7A 5IP7H 3PF4A 2OTJA 2EJFC 2E2JB 3T53B 1C4QA 5K36H 2MO1A 2NVTB 4A3BG 3NWTA 1E0BA 4KY5A 2HDMA 2L4NA 4CDDC 5KNDA 5IYCG 4HCEA 1DJRD 3RN5A 1X3FA 3IKJA 2K5QA 2F3VA 1TS2A 1CZGA 2FMMA 1XNQL 4C3JB 4BBSB 1EFWA 2F4VL 2UXCQ 1VCIA 3PMFA 3OSOA 3M4OH 2K4KA 4K6LA 4CJ2C 3E6ZX 3CQZH 2YU9B 1TWHB 5D3IB 3BVGA 3K6OA 3LX0A 1TR5A 2LMCB 2Z6BA 2HHHL 3RNUA 4IUNA 3I56A 4A3JB 3HOZH 1AP0A 3S2HB 1UE5A 4UDUC 2JA6B 4A3FG 2E2HH 3EA6A 2RSNA 2BDNA 3LGJA 2IX3A 5M5WB 1O7LA 3I7FA 2B63B 3E0JA 1ESRA 2R93B 1YHAA 2AWOA 3BYYB 3RR5A 3P1HA 3BG3A 3TDQA 2G9DA 3U50C 2K32A 4CDEC 1Q7YC 4DKAC 5IT9E 4JYAL 1VQ9A 1BOSA 1SYEA 5J22A
chains in the Genus database with same CATH topology
1STYA 3T16A 3QG1A 1WTXA 5T1GA 1IW7C 4K2KA 2H4OA 2HQEA 4OIJA 2E2IB 2EOTA 1I4QA 1G2TA 1L0YB 2PW7A 5I2YA 2F0HA 3S1QB 5IGFA 1JC7A 2A74C 2AUJD 4OGQC 1SMYD 2K7VA 1RTOA 2L5TA 2F0FA 1HFGA 1ENAA 4FF1A 1JOQA 1TVXA 4DXFA 1RD9D 2EY1A 4A3MB 5JPNC 2EY6A 4DU9A 1A3TA 3ONAB 3V2TA 2B2YC 2K5DA 5C3EB 3GTKB 2EXZA 1PTOD 5AFWA 1IKLA 4LK1C 1C48A 4KMUC 2JP1A 3FKIB 2R92B 1KAAA 1BDOA 1EIHA 1GUTA 1B53A 1EY0A 1H9RA 1TS5A 4A3KB 2O5JC 3OOCA 1PTOF 3K5NA 4Q0FA 4KD3A 3VYRA 3S2DB 1M4VA 5CV7A 3CHBD 1AZQA 1HA5A 4OO1I 2F0PA 3ND8A 1A3UA 1EY4A 3H6MA 1OO9B 1MD2D 5HURA 1WVLA 4IFDG 3NBHA 1BCPD 1NAPA 3OHXC 1EL0A 2CW0D 5C0XJ 2NUCA 4NW2A 5FO7B 3R2TA 4R8IA 4YIJA 1BCPF 1PRTD 3L3OC 3BVZA 1TQOA 1DYQA 1CT1D 1ZEQX 1Q3LA 3T51B 2WB1B 1LT6D 2PZWA 1JWUD 5C4ZA 1EQVA 1PRTF 5NUCA 3TP7A 4KV6A 4HSPA 2AQ1B 5ELDA 1HTLD 2Q8IB 1LLRD 3M7GA 5CR3A 1SAPA 4F8MA 4LMQD 1A6XA 1BNZA 1TWFB 1EEFD 3VYSA 2G9HD 3SE0A 4H7BA 3LWEA 5CGKA 4HMJA 3S9WA 4DK1A 5E4XA 4X3UA 1YNJD 3RMHA 1JORA 2BE5C 1T5EA 5FO9B 2B2VC 1HQMC 2WKDA 1PLFA 4S3SA 5M3MB 1JE4A 4KTAA 2WKCA 4BS9A 1LO5D 3IAYA 1D2BA 4C3JG 3GV6A 2EZVA 2OXPA 2E2DC 2XSCA 4PMCA 1ILPA 4A3DB 1HQRD 2DNCA 2WP8J 5DM63 1DOLA 4JK1C 4KHVA 4IN3A 1D1KA 1CA5A 1JCKB 1ML0D 1E2WA 5KGUA 1F9PA 4ZK9B 2ZXRA 1LT3D 1I4HA 4FXGC 4ZUIA 1EU4A 2F0UA 3AU7A 5KIXA 2BA1A 4OO1G 1I6HB 1STNA 2NWGA 5EPKA 3VA5A 3PO3B 4DF7A 1F2LA 4A3BB 2HDLA 3DM1A 4A3IB 1JB3A 4U673 2CVRA 2HUGA 4IFDH 3TZUA 3FRPB 4EQPA 4KKSA 1F9RA 1STEA 4HMIA 5JPMC 2OEOA 1SBBB 2IX1A 4RGTA 5KNBA 2F0IA 3T4AC 1X32A 1CHQD 4RAUC 4CGYB 2B2TA 4O1NA 2B8GA 3NXWA 4DK0A 1GOZA 1I4XA 2ZXPA 1Z6HA 5JAVA 4PV1C 2PZUA 4WFN3 3Q6SA 2FHTA 4Q5VA 3D4WA 3MAQA 4QCLA 2KOLA 5C4XB 1IW7D 4CJ1B 1S5BD 4RGOS 3A55A 1RODA 3PV0A 4RKLA 3SK8A 1OXTA 1F9SA 2JA8B 2TSSA 5KRUA 5EJWA 5K5PA 1G2SA 1NSNS 3AB9A 1UUPA 4ID6A 1HXYD 3NBIA 2KHSA 3PUWA 1E2VA 3QWNA 2NN6I 2IJ0A 5M5XB 2R7ZB 5I6WA 1DZ1A 3D3RA 2PPBC 4DGZA 5C44B 5HGTA 2IX0A 3M7NA 3VYUA 4RH6A 5F2DA 3LWUA 5CV8A 1RHPA 2B2UA 4JBWA 5COYA 2K03A 3C3LA 3M3YB 4KK7A 2B2WA 2VB3X 4X3SA 3LNNA 3CKIB 1CZWA 4X3TA 4WORA 3MWYW 3U9SA 1Q1BA 4ZKBB 4XYQA 3MXNA 1VMPA 4NDXA 3S1MB 1ENFA 4ZKCB 5I2XA 4FXKC 3F2UA 1QNKA 4RA8A 5KYIA 1WTPA 1O78A 3HGBA 5ISRA 4RFBA 4KN4C 1IL8A 4OL7A 2F0MA 1S5FD 5C4HA 1HFNA 3E5SA 2F0SA 3EROA 4OO1H 1LTID 2JE6I 5IOCA 2XN9C 3FMCA 2BA0A 1EY6A 4A93B 4LAAA 1EZ8A 1ZYRD 2JA7B 1QCBD 2L12A 4X3KA 3W2DA 3HOWB 1G91A 2RKSA 1EY9A 5A2QL 1EY5A 4TQUS 5T1IA 5BN4A 1I4PA 2DNEA 2L1BA 1KDAA 4EVOA 5CC4A 1QE6A 5DNFA 1D5XC 3EJIA 5KEEA 1D5ZC 5E4WC 5I9OA 3Q22A 4C56C 3HOXB 3VA7A 1EOTA 1Y8PB 1B1ZA 4ZQ3A 4F87A 1DXMA 3BDCA 3H0GB 1MGSA 1NR2A 3H09A 1VF5C 3A8IE 4A3EB 2BE5D 4BA2I 3Q23A 3A7AB 1KTKA 2BOSA 1XTCD 4C3IG 1TS4A 1GHJA 1Y1WB 1I4GA 5I4DA 1HUMA 1FNUA 3C1EA 1X3PA 3D4DA 2DN8A 3I4LA 4M8AA 3QOJA 3S1RB 4PMBA 4G4KA 4XYOA 4KHZA 2Z4IA 3A7LA 4HSVA 1H9MA 1KDCA 5ELFA 3DEPA 2Q8TA 2PZTA 4L63B 3HRZC 2F0KA 3I4NB 2EYOA 1AEXA 4RGMA 1KDBA 2RA4A 2FINB 4FO2A 4DXGA 1ESFA 1KABA 4C3HB 5BN3A 4K5XA 1U9RA 4RCNA 5A35A 1WTQA 2B8FA 5A2QE 1QG7A 1K83B 1BBXC 3I72A 3SK4A 3C2PA 2Z4HA 1WTOA 2RQXA 3PUVA 3FPUB 4HCSA 1L0XB 2MP1A 3R2IA 4KKTA 4IQZA 3MFGA 1H9SB 4KI0A 5EBCA 3V05A 3P7JA 5C0XH 2HCIA 3VR2A 2F0LA 3GTJB 2IPKD 4DAYA 1H9SA 3A8JE 4HAEA 1PZID 4DFAA 1PFBA 4FF3A 2MPMA 5BN5A 4RWSC 4KJOA 4K2LA 4DNRB 2BCOA 2EYLA 5IGEA 1Y8NB 1V8QA 1FD7D 1G8ZD 1SYDA 2EYJA 1J8IA 2ICEC 4N9PA 1RTNA 1HA6A 1ET6A 4KY7A 1ET9A 5CV9A 1SYCA 5JVG3 3BZDB 2NVYB 4BY1B 4ZRZA 3K5OA 3TMEA 2EJMA 2IL8A 1WD1A 1U4RA 1F77A 1LABA 4V0BA 2SOBA 3J81L 2SDFA 3QJYA 1HRJA 1Y8OB 3OW7A 2XWJB 2EY2A 1EYDA 3MXUA 2F4IA 2RBMA 2EY5A 1PFMA 4K5WA 3OMGA 1CTMA 3AMUA 1AW7A 1AFPA 2QKIC 1B44D 3NTHA 3PUYA 1ZYRC 1SNMA 2C9OA 3PIO3 3M4OB 3SDZA 3CQZB 3N6RA 1HHVA 5C3XA 1F2MA 4BWGB 2QCPX 3HOZB 3QOLA 2NVQB 1B9NA 2SNMA 3EVQA 2EYHA 4XDXA 3NQTA 3H3VC 5JEAG 4XT1B 2K04A 2F1MA 2PCFB 2WV6D 2WINB 3HG9A 1BQQT 1JOKA 3BYTB 1CK1A 4K6DA 3ND9A 1CQFA 2EYPA 1R4PB 1OXXK 4IUUA 1B50A 2RDGA 3BDOA 2ICIA 2GA4B 2F0VA 4FP5D 4XQNA 5D14A 2J0TD 3NSWA 1IHZA 4G7ZC 1V43A 2ENBA 1II3A 1JQYD 3FEWX 1E2ZA 1I6VC 2Z1CA 2B2TC 1MSGA 3TP8A 2LFNA 2PYKA 3J81E 2A6EC 3RUZA 4EGVA 3S1NB 2L0CA 3CRLC 2ZT9C 2N88A 2D62A 3EQLC 3DHQA 5DEHA 1PMRA 2XIWA 5FK9C 3OIPA 1B3AA 1QILA 3GTQB 4BBRB 2AUKA 2C5CA 4TRDA 2F0DA 4C3HG 4Z9CB 1QOHA 1WCMB 2O2LD 2B39A 4C3IB 3QO2A 1RJTA 2J4XA 5J1ZA 5KNCA 3NUCA 3MVVA 4RHSA 1BO0A 3OPOA 1SNOA 5ELBA 3TP5A 2WACA 5TSSA 3D6WA 4NP5A 1GUSA 1CQVA 1STGA 2XVSA 1SJED 4ILWA 2M2LA 1TKWB 1SYFA 1Z47A 3HKZB 2EVBA 2B2UC 2CHBD 4XQQA 3J7AV 2B2WC 1EIGA 1EFID 3PUXA 1Q1EA 2XWBB 4XTCS 1V1OA 3G7LA 3KBGA 3GV3A 4BY7B 3DMUA 3NK9A 4IURA 4PQXA 1WD0A 3J80L 4C1NK 3JAML 3GO5A 3VYTA 1TS3A 3SR1A 4BA1I 2VNUD 4G57A 4XXEA 1U4LA 2NYZD 1FNVA 1SJHD 1SNCA 1DCZA 2NBFA 3T56B 4OIKA 3M4YA 2MUYA 3R93A 2RVLA 1Q90A 5C4JB 1VDZA 2MHVA 1CFMA 3KUPA 5CBEE 3L9AX 1BUVT 3PUZA 2EPBA 1I4RA 2LY7A 2O4XA 3BVMA 3H91A 5J39A 3H94A 1G291 1TIID 5K36G 4J6HA 2MGSA 2IT1A 1XYIA 2F0WA 1EYCA 4K14A 4PMWA 1Y1VB 2OT2A 5ELEA 4R8NA 4O42A 3WOFA 1H9KA 1D1IA 1GJXA 2KJXA 2DY8A 3I3CA 4ME5A 1D6EC 4OHJA 1PTOB 5EQ0A 2H1EA 3RD4A 3KBXA 3HOVB 2KQ3A 2L55A 2K6AA 1EYAA 1AN8A 2PMZB 4CKBA 1OXVA 5CORA 3I4MB 5JEAJ 1MSHA 2BDOA 4V190 3BDLA 3URYA 4ZLTF 1R9TB 2R6GA 3I90A 5CV5A 3C1FA 1S4ZA 3KK7A 2AWNA 4QIWB 4KN7C 5C5MA 3RZDB 4J1MA 1XXGA 3OIQA 2X6GA 3J80E 1SXTA 1GUWA 2QDBA 3TP6A 2JEBI 3JAME 1I3QB 3DWQA 1UEAB 4CBVA 3CRKC 1JWMD 3FVQA 3VR4A 3K58A 4QUCA 4DN4M 4KJNA 1KNEA 3A56A 1S5DD 1EZ6A 3MFYA 4HN7A 1STBA 1PRTB 2VXWA 4Y7NB 1WTRA 3FPPA 1RCVD 5EBDA 3L7ZC 3SK6A 1F2ZA 4FNFA 1W6JA 1KLGD 1ILQA 2CQAA 1K8OA 4N9TA 2KCNA 4B08A 2AQ3B 2M9VA 3NWSA 3KLSA 2FJ2A 1J9OA 2F0EA 4NMZA 3U9OA 3GTGB 3C46A 2VB2X 4U68A 3O13A 1C8CA 2D9UA 1RKNA 4HTHA 5D65A 2NN6G 4XT3B 4L6TB 5JOBA 4LJZC 5FOBB 5FLXL 5CV6A 2PW5A 5ELCA 1TWAB 2NTSA 3MTSA 3HEJA 2A6ED 1DM0B 1ONLA 4I7ZC 4IZ8A 2E75C 2K01A 2VUMB 3KLSX 1VMCA 5CBAE 2F03A 1LTRD 5D3DA 2A5HA 2JYOA 1QNUA 5FO8B 1WTVA 3S16B 3K0YA 2QEJC 1EQTA 4FXDA 2EDGA 4B9XA 5DM73 1TWCB 5M9OA 1SYBA 3K59A 2A6HC 4C1NI 4QMGA 4RHRA 1SNDA 4IUPA 2M00A 2WIIB 5JJZA 1DD2A 4MHEA 2SEBD 3DEOA 1YNNC 4J8QA 1JOOA 2FFKB 1KLUD 3TN2A 1T5XD 3MC0B 3NP8A 1Z7TA 3NE5B 4DNTB 3BS1A 3Q24A 2F0TA 1A2UA 4PNYA 4G7HC 4CKCA 1U4MA 4FF4A 1ICWA 5IGCA 4H0LC 4M1UB 4HR7B 3MEHA 2QILA 1B9MA 3GP7A 1FNWA 4EQNA 5C5LA 3I73A 5EPJA 4DAPA 2NB0A 3KLRA 5EKIA 4IALA 1ENCA 4CKEA 1QWYA 5FLXE 1O80A 5E3FA 3D4RA 2DY7A 2I46A 1W6KA 2A69C 4IUTA 5DAUA 1ZXTA 1JR0D 5CMDA 5EKKA 1Q12A 1A2TA 4QF4A 3J7YW 1IYVA 1EWCA 1HTPA 3VR6A 1UAPA 3X3NA 2NN6H 3RZOB 3G6JB 1S5ED 1B4OA 1LT5D 2SNSA 1EEID 3X3MA 2ZXOA 2PO4A 3TZDA 1PDQA 1PYWD 1U4PA 2KEEA 4L8JA 1X3QA 2B2YA 3RLFA 3V96A 4P2CB 4NKLA 3MXPA 3A54A 3DUZA 2Z8LA 4R9WA 2F0QA 2E2HB 3CU7A 5IGGA 3MXGA 4UAIA 1MBYA 5C3WA 1H9JA 1BF4A 2L9HA 2KVMA 3K7AB 4DA2A 1BR9A 4ABNA 1WTWA 2X6LA 2WAQB 5JVH3 2F0JA 2ID0A 5I9PA 2K1BA 1GUNA 3N52A 4CJ0B 5IODA 1LTBD 2D2CC 3SHLA 2A68C 3SEBA 4H13C 2I07B 2OF1A 3PIP3 4KKUA 1A15A 2KEDA 1SDFA 3EFXD 3MHBA 2D5DA 1Y69U 3IFTA 3P75A 1SSOA 5LL6S 4C2MB 2Q8RE 1PZJD 4RKBA 3R3OA 3R8BA 1PZKD 3IFDA 4E6IA 3GQBA 4QB4A 4FF2A 1LTAD 1M8AA 3S14B 2Y0SB 2V4DA 5IGDA 2JXMB 3NQIA 3GTLB 4TKOB 5FKAC 1EU3A 2F0GA 1LTTD 1PXUA 3ITPA 2L11A 1OXUA 5CYUA 4FVMA 4K8JA 3K5LA 4MIUA 1XX8A 1JWSD 1TY0A 3WOEA 3HOYB 1B2TA 1PTOH 5CV4A 3SVMA 1F9QA 4ODGA 1UNSA 3OMCA 2HCCA 1I50B 3IL8A 4XIGS 3SK5A 1LV9A 3QB3A 1SE4A 1Q8IA 1D5MC 1SNPA 2EYFA 2KCCA 1DONA 1VF7A 1IYUA 1R4QB 2EE1A 3P20A 1SNQA 3D31A 1EY8A 1TWGB 1SE2A 2B2VA 1RF2D 5C0XI 2E74C 2EJGC 2E76C 4FYDA 1SMYC 3D8GA 4F7XA 3OWFA 1FGBD 3NHHA 1F2YA 5I6YA 1CA6A 3UI2A 3HS0C 1S5CD 3DWAA 2A73B 3SXHA 1SFOB 2K05A 4A3FB 2A6HD 1BXTA 3S15B 4TSSA 4F88A 1GXDC 3WDNA 5IGBA 2MJ8A 1PTOC 2NVXB 1HUNA 5JEAH 1YNND 4G7OC 4IUVA 3HZXA 3NTIA 2PQEA 2KA7A 2J7ZA 5KYLA 4DAVA 1O7YA 3VR5A 1CI3M 4ULLA 3J7AF 4XQJA 2EYMA 5LHY1 4ZAIA 1DOKA 1GUOA 1G6ZA 3TSSA 4RCOA 3T13A 1O7ZA 3HP3A 2X69A 1TT2A 2XNAC 4IFDJ 4ZUJA 4ZYSA 2R61A 1PFNA 4WRDA 1STAA 1ZKOA 3K57A 2YYZA 3OWEB 1BCPC 1OXSC 1HPCA 4AYBB 1GHKA 2RDHA 1V1PB 4K5VA 2CW0C 3FDTA 1A3VA 1SE3A 2NTTA 4RGNA 5M3FB 2QF7A 1V1PA 3DWPA 1QJOA 1JICA 2JEAI 4B9WA 1PRTC 2R3ZA 5EGTA 4CHTB 2F0NA 2A69D 5G3LD 4A3GB 1KNAA 1TU2B 1FYCA 2F0OA 2PNRC 5C6AA 2XRQD 3GTOB 2XRSD 3TBIB 1CHPD 3MZ5A 1NCVA 2LKVA 3NTKA 5G3LF 4EQOA 4MN3A 3I8ZA 3ZYYX 5IIFA 1LTSD 3A8KE 3QIAA 1LACA 3NPPA 2IWHA 1XWEA 2KUMA 2JA5B 3Q0AA 1SYGA 3ERQA 3S17B 1LT4D 2O5IC 3M85A 2RSOA 1AZPA 5EPLA 1STHA 2LS01 3K5MA 5E1FA 1BCPB 1QB5D 4H44C 1FR3A 4I65A 2TMPA 4K8IA 3HOUB 5LL6X 1YNJC 5IT9L 3VR3A 1GUGA 5C0XG 2JSOA 3GTMB 1K8MA 4HEDA 4KD4A 3DXJC 3W3AA 4KY6A 3D6CA 1MI2A 1LTGD 5M5YB 1RDPD 1CM9A 2KECA 2AQ2B 2A68D 4GZYC 3PO2B 2K5WA 3MA2B 1NUCA 2K33A 2F3WA 3I70A 5EKLA 1EWHA 1IKMA 1TY2A 3KF8A 1NR4A 2N55A 2RDFA 3GTPB 1EY7A 2NZ1D 1HCZA 1SEBD 2FMCA 4IFDI 3I91A 4WJWA 4IUQA 1DOMA 4QUFA 2IW3A 2K28A 3GD7A 2EJFC 2E2JB 3T53B 1C4QA 5K36H 2NVTB 3NWTA 1E0BA 4KY5A 2HDMA 2L4NA 5KNDA 4HCEA 1DJRD 3IKJA 2K5QA 2F3VA 1TS2A 1CZGA 2FMMA 4C3JB 4BBSB 1VCIA 3PMFA 3OSOA 4K6LA 4CJ2C 3E6ZX 2YU9B 1TWHB 5D3IB 3BVGA 3K6OA 3LX0A 1TR5A 2LMCB 4IUNA 4A3JB 1AP0A 3S2HB 4UDUC 2JA6B 3EA6A 2RSNA 2BDNA 2IX3A 5M5WB 1O7LA 2B63B 3E0JA 1ESRA 2R93B 2AWOA 3BYYB 3TDQA 3BG3A 3P1HA 2G9DA 2K32A 5IT9E 1BOSA 1SYEA 5J22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STY A;  2KQ3 A;  3T16 A;  5C3W A;  2F0T A;  4WRD A;  4F7X A;  1EYA A;  2OXP A;  4PMC A;  1A2U A;  4PNY A;  1KDC A;  5IOC A;  1STA A;  5CV9 A;  4RKL A;  1SYC A;  4K2K A;  3SK8 A;  3BDL A;  1RKN A;  2HQE A;  2PZT A;  1EY6 A;  1SNP A;  2EYF A;  4HTH A;  2NUC A;  4LAA A;  1JOQ A;  5IGC A;  2F0K A;  2F0J A;  5JOB A;  1EZ8 A;  2PW7 A;  4KHV A;  5K5P A;  5KRU A;  2F0H A;  5I9P A;  2F0V A;  1NSN S;  1AEX A;  2EYO A;  3MEH A;  4K5V A;  3DMU A;  1NUC A;  3TME A;  5IGF A;  1A3V A;  2F3W A;  5CV6 A;  2PW5 A;  4ID6 A;  5EKL A;  4EQN A;  5IOD A;  1KDB A;  2RKS A;  1SNQ A;  1EY9 A;  5CV5 A;  4YIJ A;  5C5L A;  1EY8 A;  3SHL A;  2SOB A;  3HEJ A;  3NK9 A;  2KHS A;  3C1F A;  5KGU A;  2OF1 A;  1IHZ A;  1EY5 A;  1TQO A;  2ENB A;  5I6W A;  1II3 A;  2F0F A;  4IAL A;  1ENC A;  1KAB A;  1ENA A;  2EY2 A;  1EYD A;  5C5M A;  4B9W A;  5EGT A;  4J1M A;  5HGT A;  3MHB A;  4K5X A;  2RDF A;  2F0N A;  1KDA A;  3TP8 A;  1U9R A;  3D8G A;  4IZ8 A;  2RBM A;  3OWF A;  3P75 A;  3SR1 A;  4ZUI A;  2EY5 A;  4DGZ A;  1EY7 A;  4EVO A;  5CC4 A;  2F0U A;  2PYK A;  3NHH A;  2PZW A;  5E3F A;  5F2D A;  1F2Y A;  2EY1 A;  4K5W A;  3OMG A;  2F0O A;  3RUZ A;  4G57 A;  5CV8 A;  5C4Z A;  5I6Y A;  1EQV A;  3EJI A;  5KEE A;  5KIX A;  5C6A A;  2QDB A;  3TP6 A;  2EY6 A;  5NUC A;  1SNC A;  4RKB A;  1A3T A;  1STN A;  4DU9 A;  3R3O A;  3TP7 A;  3VA5 A;  3MZ5 A;  4KV6 A;  3SK4 A;  4DF7 A;  3V2T A;  5I9O A;  5DAU A;  2LKV A;  3SXH A;  1SNM A;  3DHQ A;  4E6I A;  5CR3 A;  2EXZ A;  4QB4 A;  5DEH A;  5EKK A;  4EQO A;  4F8M A;  5IIF A;  4ZQ3 A;  1A2T A;  4QF4 A;  4B9X A;  5IGD A;  4KY5 A;  4KJN A;  4WOR A;  4EQP A;  5M9O A;  1SYB A;  5IGB A;  1EZ6 A;  2O4X A;  3BDC A;  1SYG A;  1F2M A;  3ERQ A;  4QMG A;  5C3X A;  1KAA A;  5J39 A;  2F3V A;  4TRD A;  4H7B A;  1SND A;  1STB A;  2F0D A;  4HMI A;  5CGK A;  2F0G A;  2OEO A;  3ITP A;  3QOL A;  1EY0 A;  2F0I A;  2M00 A;  3PMF A;  1STH A;  3OSO A;  4HMJ A;  3HZX A;  4NDX A;  3S9W A;  4J6H A;  5J1Z A;  2PQE A;  5E1F A;  2F0L A;  3NUC A;  3MVV A;  2SNS A;  2SNM A;  3EVQ A;  5KYL A;  2EYH A;  1JOR A;  3NQT A;  4KD3 A;  4I65 A;  4K8J A;  2F0W A;  1EYC A;  1SNO A;  1TR5 A;  3LX0 A;  5CV7 A;  3SK6 A;  1JOO A;  2WAC A;  1F2Z A;  4MIU A;  3TP5 A;  3NXW A;  4DFA A;  4IUN A;  4K14 A;  4K8I A;  5KYI A;  5JAV A;  4R8N A;  3C1E A;  2EYM A;  2PZU A;  3D4D A;  5ISR A;  2F0P A;  4NP5 A;  3QOJ A;  5CV4 A;  4KJO A;  4K2L A;  4N9T A;  4PMB A;  1A3U A;  4NKL A;  4OL7 A;  4ODG A;  3OMC A;  1STG A;  2F0M A;  3D4W A;  4S3S A;  3T13 A;  1EY4 A;  2EYL A;  3MXP A;  3P1H A;  5IGE A;  3H6M A;  4KTA A;  4ME5 A;  2F0Q A;  5HUR A;  3NP8 A;  1JOK A;  3SK5 A;  5C4H A;  1SYD A;  1SYF A;  3E5S A;  4K6D A;  4KD4 A;  1TT2 A;  5IGG A;  2EYJ A;  2F0E A;  2F0S A;  2EYP A;  3D6C A;  3ERO A;  3QB3 A;  4KY6 A;  4N9P A;  4NMZ A;  4ZUJ A;  5J22 A;  3U9O A;  1SYE A;  4KY7 A; 
#chains in the Genus database with same CATH topology
 1STY A;  3T16 A;  3QG1 A;  1WTX A;  5T1G A;  5C4X G;  4A3L G;  1IW7 C;  1VQN A;  4K2K A;  1L2F A;  2H4O A;  2HQE A;  4OIJ A;  2E2I B;  2EOT A;  1I4Q A;  1G2T A;  1H95 A;  3T1Y Q;  2JA9 A;  1XNR Q;  1L0Y B;  4JBK A;  2PW7 A;  1ASZ A;  5I2Y A;  2F0H A;  3BJU A;  2JK8 A;  4DR3 Q;  5IGF A;  3S1Q B;  1JC7 A;  1MJC A;  2A74 C;  2AUJ D;  4OGQ C;  1BKB A;  1SMY D;  1P16 A;  2K7V A;  1RTO A;  2L5T A;  4C2M H;  1PH2 A;  2F0F A;  1HFG A;  1PH1 A;  1ENA A;  4FF1 A;  4DR7 Q;  1MHW C;  4B3T Q;  2OQ0 A;  2Q2T A;  1TVX A;  1E24 A;  1JOQ A;  4DXF A;  3AFQ A;  1RD9 D;  3OYY A;  2EY1 A;  2IHE A;  4A3M B;  5JPN C;  4GNX B;  2VY3 A;  1KIX A;  2EY6 A;  4DU9 A;  1A3T A;  2DJF C;  3ONA B;  3S14 H;  1E3P A;  4UPA A;  5AJ3 Q;  3V2T A;  2B2Y C;  2K5D A;  2UXB Q;  5C3E B;  5FLX c;  3GTL H;  4AYB G;  3CCR A;  1HZ9 A;  3GTK B;  2I5H A;  2EXZ A;  1CKM A;  4OX9 L;  4LNQ A;  1PTO D;  5AFW A;  1IKL A;  4LK1 C;  3S1N H;  1VQK A;  1C48 A;  4DV6 Q;  5M3F G;  4KMU C;  2JP1 A;  3FKI B;  2R92 B;  1KAA A;  1BDO A;  5FLM G;  1EIH A;  1GUT A;  1B53 A;  1EY0 A;  1H9R A;  1AH9 A;  1TS5 A;  4A3K B;  5BR8 L;  2O5J C;  1KC8 C;  4A3G G;  3OOC A;  1PTO F;  1JMC A;  2QGQ A;  3K5N A;  2EQS A;  4Q0F A;  3GTQ H;  4KD3 A;  3VYR A;  2E5L L;  2CWA A;  3S2D B;  1M4V A;  5CV7 A;  3CHB D;  4LF7 L;  1AZQ A;  1HA5 A;  4OO1 I;  4X64 Q;  1WCM H;  2F0P A;  3ND8 A;  4JOI A;  1A3U A;  1EY4 A;  3NBH B;  3K7U C;  3H6M A;  5IWA L;  2JA5 G;  4DR6 Q;  1LYL A;  3U4Z A;  1OO9 B;  4JW0 A;  4O0A A;  4KHP L;  1MD2 D;  5HUR A;  4IPC A;  1WVL A;  4IFD G;  3NBH A;  2QA4 A;  1BCP D;  1NAP A;  3OHX C;  1EL0 A;  2CW0 D;  2WB1 E;  2NUC A;  5C0X J;  4NW2 A;  3HOU G;  1IBK Q;  5FO7 B;  3KJP A;  1NE3 A;  3R2T A;  4R8I A;  4JV5 L;  4YIJ A;  4GKJ Q;  1BCP F;  1PRT D;  3L3O C;  3BVZ A;  1TQO A;  2UUC L;  1DYQ A;  3HOW G;  2D0P A;  1CT1 D;  4LF8 L;  1ZEQ X;  1Q3L A;  3T51 B;  4GLX A;  2WB1 B;  2Q2I A;  4BY7 H;  4OON A;  1LT6 D;  2PZW A;  2VQE L;  1JWU D;  1KQS A;  2OCE A;  2RF4 A;  3KFU A;  4DPG A;  5C4Z A;  1SFO H;  1CKO A;  1EQV A;  1PRT F;  4J15 A;  4A3F H;  5NUC A;  5LMU Q;  3TP7 A;  4KV6 A;  4HSP A;  2AQ1 B;  5ELD A;  1HTL D;  2Q8I B;  4P71 A;  1PH6 A;  3PO2 G;  4IJH A;  1LLR D;  3M7G A;  4RMF A;  5CR3 A;  4LUV A;  1SAP A;  4F8M A;  3PF5 A;  2NVX H;  1E1T A;  2HIX A;  1Z9F A;  4LMQ D;  4DV4 Q;  1A6X A;  3HOX G;  4JI7 Q;  1BNZ A;  1TWF B;  4I7A A;  1EEF D;  3VYS A;  2G9H D;  3SE0 A;  3CCM A;  4H7B A;  3GDE A;  3LWE A;  4IOC A;  5CGK A;  5LMN L;  1G6P A;  4HMJ A;  5C4J H;  3S9W A;  4DK1 A;  5E4X A;  4X3U A;  1VQL A;  1YNJ D;  3RMH A;  4A3E G;  3PSI A;  1JOR A;  3CCL A;  2BE5 C;  1T5E A;  1PYB A;  4TVA B;  5IYD H;  4WJ4 A;  4L5Q A;  3RLN A;  5FO9 B;  1KHI A;  2B2V C;  1XNQ Q;  2K5V A;  1HQM C;  2WKD A;  1YVC A;  2F4V Q;  3KOJ A;  1SRO A;  1PLF A;  4MZ9 A;  4S3S A;  5M3M B;  1JE4 A;  4KTA A;  3U58 A;  2WKC A;  4BS9 A;  1Y1V H;  1LO5 D;  2KHI A;  3IAY A;  2HHH Q;  1D2B A;  4C3J G;  1W3S A;  1A8V A;  3GV6 A;  2EZV A;  2OXP A;  2E2D C;  2XSC A;  4PMC A;  2CH4 A;  3CC4 A;  4A3D B;  1ILP A;  1HQR D;  2DNC A;  1Q81 C;  1WJJ A;  2WP8 J;  2ZTD A;  1DOL A;  5DM6 3;  4JK1 C;  4KHV A;  5M3F H;  4IN3 A;  3CCE A;  4A3J G;  1K9M C;  1D1K A;  2JA6 G;  1CA5 A;  1JCK B;  1ML0 D;  4GOP B;  3I4M H;  1E2W A;  5KGU A;  1F9P A;  2B63 G;  4ZK9 B;  2R93 G;  1SR3 A;  2ZXR A;  4GN5 A;  4DR2 Q;  4GOP A;  3AEV A;  4DUY L;  1LT3 D;  1R9T H;  3GTO H;  1I4H A;  3ULL A;  4FXG C;  4ZUI A;  3STB D;  1EU4 A;  2F0U A;  4JI4 L;  4IPG A;  3AU7 A;  5KIX A;  2Q2H A;  2ALY B;  2BA1 A;  4OO1 G;  1I6H B;  1STN A;  2NWG A;  5EPK A;  3VA5 A;  4P74 A;  3PO3 B;  4DF7 A;  1F2L A;  4A3B B;  3TRZ A;  4OEM B;  2HDL A;  3DM1 A;  4A3I B;  1JB3 A;  4U67 3;  3S17 H;  3J81 j;  2CVR A;  2HUG A;  2I5M X;  3I2Z A;  1A0I A;  4IFD H;  3TZU A;  3FRP B;  4EQP A;  1VQ5 A;  4KKS A;  2UUA L;  1F9R A;  4DV0 L;  1STE A;  4HMI A;  4OWW B;  5JPM C;  1YNX A;  4DR4 L;  2OEO A;  1SBB B;  2IX1 A;  4RGT A;  5KNB A;  2F0I A;  3T4A C;  1X32 A;  1CHQ D;  4RAU C;  4CGY B;  4YY3 L;  4OX9 Q;  2B2T A;  4O1N A;  3A74 A;  2B8G A;  1HJP A;  3NXW A;  4DK0 A;  1GOZ A;  1I4X A;  2ZXP A;  1Z6H A;  5JAV A;  5C3E G;  4PV1 C;  3GTM H;  2PZU A;  3H3V I;  4WFN 3;  1B8A A;  3Q6S A;  2FHT A;  4N8X 1;  5BR8 Q;  5M5Y H;  4Q5V A;  3D4W A;  3MAQ A;  4QCL A;  4B3M L;  2KOL A;  2E5L Q;  5C4X B;  1IW7 D;  4CJ1 B;  4LF7 Q;  1S5B D;  4RGO S;  4A3K G;  3A55 A;  1ROD A;  3PV0 A;  4RKL A;  3SK8 A;  4GN4 B;  1OXT A;  3WWV A;  1F9S A;  2PI2 E;  3E3X A;  4UP9 A;  2JA8 B;  3CMA A;  2LSS A;  2TSS A;  5KRU A;  1EOV A;  5EJW A;  5K5P A;  1G2S A;  1NSN S;  3AB9 A;  1UUP A;  4ID6 A;  1HXY D;  3NBI A;  2KHS A;  3PUW A;  1E2V A;  3QWN A;  2NN6 I;  2IJ0 A;  5M5X B;  2R7Z B;  5I6W A;  5JJL A;  1DZ1 A;  3D3R A;  2PPB C;  4DGZ A;  5C44 B;  5HGT A;  2IX0 A;  3M7N A;  1IYJ B;  3VYU A;  1SMX A;  4RH6 A;  5F2D A;  3LWU A;  5CV8 A;  2PI2 A;  1RHP A;  4JV5 Q;  2B2U A;  2A19 A;  4JBW A;  1OTC A;  1K28 A;  5COY A;  2K03 A;  3C3L A;  3M3Y B;  4KK7 A;  2B2W A;  2UUC Q;  2VB3 X;  4X3S A;  3LNN A;  4LF8 Q;  1PV4 A;  3E9I A;  3CKI B;  1CZW A;  4X3T A;  2PMZ E;  4C3J H;  2A8V A;  4WOR A;  2VQE Q;  4BBS H;  3MXN B;  3MWY W;  3U9S A;  1V1Q A;  4B3R L;  1B3Q A;  1Q1B A;  1HNX L;  4ZKB B;  3S24 A;  4XYQ A;  2WB1 G;  3MXN A;  1K3R A;  4A3J H;  1VMP A;  4NDX A;  4JBJ A;  1Y14 B;  2OWO A;  3S2H H;  2P5Z X;  1E1O A;  5ELO A;  2JA6 H;  3D0F A;  3S1M B;  1ENF A;  4ZKC B;  5I2X A;  4FXK C;  3F2U A;  1QNK A;  4QIW E;  4RA8 A;  5KYI A;  2CQO A;  1GM5 A;  1WTP A;  1O78 A;  3HGB A;  5ISR A;  4RFB A;  4KN4 C;  1IL8 A;  5LMN Q;  4R4O A;  4OL7 A;  3G6E A;  2F0M A;  1S5F D;  2C35 B;  3CCJ A;  3L0O A;  5C4H A;  1HFN A;  3E5S A;  2F0S A;  3ERO A;  4OO1 H;  1LTI D;  1QVC A;  1JB7 A;  2JE6 I;  1PH7 A;  1EYG A;  2Z9H A;  3CW2 C;  5IOC A;  2XN9 C;  1KD1 C;  4L5T A;  1HNW L;  4X66 L;  2K75 A;  3S1Q H;  3FMC A;  2BA0 A;  1EY6 A;  4A93 B;  1YIT A;  4LAA A;  1EZ8 A;  3J7A 5;  1ZYR D;  2JA7 B;  1QCB D;  2L12 A;  4X3K A;  4GS3 A;  4LF4 L;  3W2D A;  3HOW B;  4DNI A;  1G91 A;  2RKS A;  1EY9 A;  1K8G A;  5A2Q L;  1MJE A;  1EY5 A;  1VQO A;  1NMG A;  4TQU S;  1UE1 A;  5T1I A;  5M3M G;  4A3M H;  3J7Z C;  2B29 A;  5BN4 A;  1I4P A;  2DNE A;  1HR0 L;  2L1B A;  1KDA A;  4EVO A;  5CC4 A;  1SLJ A;  5FJ8 G;  1QE6 A;  1YZ6 A;  2AKW B;  1PVO A;  5DNF A;  1D5X C;  4A3D G;  3EJI A;  5KEE A;  1D5Z C;  4QL5 A;  1A63 A;  5E4W C;  3UE0 A;  5I9O A;  3Q22 A;  4C56 C;  1YJW A;  4YCW A;  3HOX B;  3VA7 A;  1EOT A;  3FKI H;  2VL6 A;  2R92 H;  1Y8P B;  4DUY Q;  3ULJ A;  1B1Z A;  1GO3 E;  4YCU A;  4ZQ3 A;  1X54 A;  4JI4 Q;  1FVI A;  2CH4 W;  4F87 A;  1DXM A;  3BDC A;  3H0G B;  1MGS A;  1NR2 A;  3H09 A;  1VF5 C;  3A8I E;  4A3E B;  3S2D H;  2BE5 D;  4BA2 I;  4BBR G;  1VQJ A;  3Q23 A;  3A7A B;  1KTK A;  2BOS A;  3PCO B;  3CME A;  1XTC D;  4C3I G;  4LFB L;  1HZC A;  1TS4 A;  1GHJ A;  1Y1W B;  3PO3 G;  1I4G A;  2UUA Q;  1JJG A;  3CP0 A;  5I4D A;  1HUM A;  1FNU A;  4A75 A;  3C1E A;  4A3I G;  1X3P A;  2DGY A;  3D4D A;  4X65 L;  4DV0 Q;  2UU9 L;  2DN8 A;  2JN4 A;  3I4L A;  5HY6 A;  3RZO H;  4DR4 Q;  4M8A A;  3QOJ A;  3S1R B;  4PMB A;  1X9N A;  4G4K A;  4YY3 Q;  4DR1 L;  4XYO A;  4KHZ A;  2Z4I A;  3A7L A;  4R4C A;  4HSV A;  1H9M A;  2VZA A;  1KDC A;  4GNX C;  4BXX H;  5ELF A;  3DEP A;  2Q8T A;  3BU2 A;  2PZT A;  4L63 B;  3HRZ C;  1V9P A;  3HKS A;  2F0K A;  4DAM A;  1Q8K A;  1PFS A;  3CCS A;  3I4N B;  5IT9 c;  4K0K L;  4B3M Q;  2EYO A;  1AEX A;  4RGM A;  1KDB A;  2RA4 A;  1N8R C;  1WI5 A;  3K7A H;  2FIN B;  3JC6 6;  4FO2 A;  1FL0 A;  1E7Z A;  4YWL A;  3K81 C;  4DK3 C;  4DXG A;  3FP9 A;  1ESF A;  1KAB A;  1WTH A;  4C3H B;  5BN3 A;  4K5X A;  1U9R A;  4RCN A;  5A35 A;  1WTQ A;  1IBL L;  2B8F A;  5A2Q E;  1QG7 A;  1K83 B;  3J81 i;  1BBX C;  2UUB L;  3G4S A;  3I72 A;  4HJA A;  2JA8 G;  3SK4 A;  3T1H L;  2Z4H A;  3C2P A;  4JOI C;  1WTO A;  4A3C G;  2RQX A;  3PUV A;  3FPU B;  4OWT B;  4HCS A;  1L0X B;  2GVB A;  4FDB A;  4IPH A;  2MP1 A;  3R2I A;  4KKT A;  4IQZ A;  2R7Z G;  1PH9 A;  3MFG A;  4JI8 L;  3I55 A;  1FJG L;  4DAY B;  1H9S B;  5LMN W;  4KI0 A;  5EBC A;  5C44 G;  3V05 A;  3P7J A;  5C0X H;  2HCI A;  3VR2 A;  2F0L A;  3GTJ B;  2IPK D;  2NZH A;  4DAY A;  1H9S A;  4DV2 L;  3A8J E;  3BZK A;  4HAE A;  1PZI D;  3KYH C;  4DFA A;  1PFB A;  4FF3 A;  2MPM A;  5BN5 A;  4B3R Q;  3CPF A;  1HNX Q;  3HFZ B;  1G51 A;  1EUJ A;  4RWS C;  4KJO A;  4K2L A;  4DNR B;  2K50 A;  2BCO A;  2EYL A;  5IGE A;  3F2D A;  1Y8N B;  1V8Q A;  1FD7 D;  3CCV A;  4A3D H;  1G8Z D;  1SYD A;  2EYJ A;  1J8I A;  2ICE C;  4N9P A;  1RTN A;  3TS0 A;  3HOY H;  1HA6 A;  1ET6 A;  4KY7 A;  3UE1 A;  1ET9 A;  5CV9 A;  1SYC A;  3HOV G;  4LWC A;  1I50 H;  5JVG 3;  3BZD B;  1JJC B;  2NVY B;  2IY5 B;  4BY1 B;  4ZRZ A;  2ES2 A;  3K5O A;  3TME A;  3A5U A;  2EJM A;  2IL8 A;  1WD1 A;  1VQD A;  1U4R A;  1W2B A;  1F77 A;  1LAB A;  4V0B A;  2SOB A;  3J81 L;  2SDF A;  3QJY A;  1HRJ A;  1Y8O B;  4LUO A;  3OW7 A;  2XWJ B;  4X66 Q;  1HNW Q;  3TQY A;  2EY2 A;  1EYD A;  1XMO L;  3MXU A;  2F4I A;  1I6H H;  2ZM6 L;  2RBM A;  2EY5 A;  3PO3 H;  1PFM A;  1J5E L;  4A3B H;  4LF4 Q;  4K5W A;  3OMG A;  3UDF A;  5IYC H;  2KCT A;  1TWG H;  3NEM A;  1KRS A;  1CTM A;  3AMU A;  1AW7 A;  1AFP A;  2QKI C;  1B44 D;  1PH4 A;  4A93 G;  3NTH A;  2YTX A;  3PUY A;  1A62 A;  2JA7 G;  1ZYR C;  1SNM A;  2F52 A;  2C9O A;  1HR0 Q;  3I4O A;  3PIO 3;  2NZO A;  3M4O B;  4JI0 L;  1VQE A;  3SDZ A;  1WOC A;  3CQZ B;  4YHH L;  3UDX A;  3F2B A;  3N6R A;  1YJN A;  5C3X A;  1HHV A;  1F2M A;  4BWG B;  2HD3 A;  4RG1 A;  2QCP X;  4PZ6 A;  4PZ7 A;  3HOZ B;  2JJQ A;  3QOL A;  2HQL A;  3S15 H;  2NVQ B;  2N78 A;  2VQF L;  1B9N A;  3ERS X;  3KJO A;  2SNM A;  3EVQ A;  2EYH A;  4XDX A;  3NQT A;  4MNO A;  1D8L A;  2DUD A;  3H3V C;  1RL2 A;  3M4P A;  4P75 A;  1KRT A;  5JEA G;  4A3C H;  2PQA A;  4XT1 B;  2K04 A;  5C4X H;  4GOP C;  1X55 A;  4A3L H;  2F1M A;  2PCF B;  2WV6 D;  2K5N A;  2WIN B;  3HG9 A;  1BQQ T;  1EQQ A;  3PIP A;  1JOK A;  3BYT B;  1X3G A;  1CK1 A;  3H0G G;  4K6D A;  1X6O A;  4NXN L;  5IY0 A;  3ND9 A;  1CQF A;  2EYP A;  4LFB Q;  4CDC C;  2JA8 H;  1R4P B;  1OXX K;  1D7Q A;  4IUU A;  1B50 A;  1ASY A;  2RDG A;  2UU9 Q;  4X65 Q;  2ASB A;  4ALP A;  1XJV A;  3BDO A;  2ICI A;  1Y1W G;  2GA4 B;  4LFA L;  4DR1 Q;  2F0V A;  2R7Z H;  4FP5 D;  4XQN A;  5D14 A;  1UE7 A;  1NNX A;  2J0T D;  3NSW A;  1CUK A;  1IHZ A;  4G7Z C;  1V43 A;  5C44 H;  2ENB A;  1II3 A;  2Z6K C;  1JQY D;  3FEW X;  1N36 L;  1PH3 A;  1E2Z A;  1I6V C;  2Z1C A;  1DGS A;  2B2T C;  1MSG A;  3TP8 A;  2LFN A;  2PYK A;  4JI2 L;  3J81 E;  4K0K Q;  4JC0 A;  2A6E C;  3RUZ A;  4EGV A;  3S1N B;  2L0C A;  3CRL C;  1GVP A;  1AE2 A;  2ZT9 C;  2N88 A;  3KF6 B;  3J80 i;  2D62 A;  5FLM H;  4JYA Q;  3EQL C;  3JAM i;  3K8A A;  3I4N G;  1K0R A;  3DHQ A;  3KF6 A;  5DEH A;  4A3G H;  2RCF A;  1PMR A;  2XIW A;  5FK9 C;  3OIP A;  3OTO L;  1M90 C;  3E0E A;  1IBL Q;  2QW7 A;  1B3A A;  1QIL A;  3GTQ B;  1YIJ A;  2KHJ A;  4BBR B;  2AUK A;  1HNZ L;  2C5C A;  2UUB Q;  4TRD A;  2F0D A;  4C3H G;  4Z9C B;  3T1H Q;  1QOH A;  1WCM B;  2GN5 A;  2O2L D;  2B39 A;  4C3I B;  3QO2 A;  1RJT A;  2J4X A;  5J1Z A;  5KNC A;  3NUC A;  3MVV A;  4RHS A;  1BBW A;  1BO0 A;  2EIF A;  4UP7 A;  2JA5 H;  3TRE A;  3HKZ E;  3OPO A;  2GVA A;  5IYB G;  1CKN B;  1SNO A;  5ELB A;  3TP5 A;  2WAC A;  4A4I A;  5EAY A;  5TSS A;  1BBU A;  3D6W A;  4JI8 Q;  2F3I A;  1CKN A;  1FJG Q;  4NP5 A;  1GUS A;  1CQV A;  1STG A;  2XVS A;  1SJE D;  4ILW A;  2M2L A;  1TKW B;  3L2P A;  1X65 A;  1SYF A;  1Z47 A;  4DV2 Q;  3HOU H;  3HKZ B;  1B7Y B;  2EVB A;  2B2U C;  2CHB D;  4XQQ A;  3J7A V;  2B2W C;  1EIG A;  4DV5 L;  2JA7 H;  1EFI D;  3PUX A;  1Q1E A;  4X62 L;  3HOW H;  2XWB B;  4XTC S;  1V1O A;  3G7L A;  3KBG A;  4AQY L;  3GV3 A;  4LW1 A;  4R1J A;  4BY7 B;  1FGU A;  3DMU A;  2I5L X;  1NTG A;  3NK9 A;  4IUR A;  4PQX A;  1WD0 A;  2XTI A;  3KDF A;  4C1N K;  2MNA A;  3J80 L;  3Q8D A;  1MKH A;  3TEH B;  4JBM A;  1HR0 W;  1YI2 A;  3JAM L;  3GO5 A;  3PO2 H;  3VYT A;  1VQ6 A;  1TS3 A;  3SR1 A;  4X6A H;  4BA1 I;  2N3S A;  2VNU D;  4G57 A;  3HOX H;  4P72 A;  4XXE A;  1U4L A;  2NYZ D;  5IWA Q;  1FNV A;  1SJH D;  1VQP A;  1SNC A;  1DCZ A;  2NBF A;  3T56 B;  4OIK A;  1SRU A;  3M4Y A;  4APV A;  2MUY A;  3CC7 A;  3R93 A;  4KHP Q;  2RVL A;  1Q90 A;  1JE5 A;  4BY1 G;  3GTP H;  4DUZ L;  1XMO Q;  3H0G H;  4DV3 L;  5C4J B;  1VDZ A;  2ZM6 Q;  2MHV A;  1CFM A;  3KUP A;  5CBE E;  3L9A X;  1VQB A;  4A3E H;  1BUV T;  3PUZ A;  4DR5 L;  1J5E Q;  2EPB A;  1I4R A;  2LY7 A;  2O4X A;  3BVM A;  3H91 A;  5J39 A;  3H94 A;  3W5O A;  1G29 1;  4QQB X;  1YBY A;  4A76 A;  5IP7 G;  1TII D;  2E2J H;  1Y1W H;  5K36 G;  1P8L A;  4J6H A;  3H15 A;  2MGS A;  4JI6 L;  2NVT H;  2IT1 A;  1XYI A;  4JI0 Q;  2F0W A;  1EYC A;  4YHH Q;  3E9H A;  3S1R H;  4K14 A;  4PMW A;  1Y1V B;  5GRO A;  2OT2 A;  5ELE A;  1AE3 A;  4R8N A;  4O42 A;  1RIP A;  3WOF A;  1K3B C;  1H9K A;  1D1I A;  3NEL A;  1GJX A;  2KJX A;  2YU9 H;  1TWH H;  4POG A;  2QDL A;  2DY8 A;  2VQF Q;  3I3C A;  4ME5 A;  1D6E C;  4OHJ A;  1PTO B;  5EQ0 A;  3W1G A;  2H1E A;  3HOZ G;  1X56 A;  3RD4 A;  3KBX A;  3HOV B;  2KQ3 A;  2L55 A;  2K6A A;  1EYA A;  1AN8 A;  2PMZ B;  4CKB A;  1OXV A;  2H5X A;  5M5W H;  5COR A;  2B63 H;  3I4M B;  5JEA J;  1MSH A;  2R93 H;  2BDO A;  4V19 0;  3BDL A;  3URY A;  4R4T A;  4ZLT F;  1HH2 P;  1VS0 A;  3CCQ A;  1R9T B;  2R6G A;  4NXN Q;  3I90 A;  4B3S L;  5CV5 A;  4JCV E;  4ZCK A;  4MTK A;  3C1F A;  1S4Z A;  3KK7 A;  2AWN A;  4IJL A;  2E2I H;  3PGZ A;  4QIW B;  2OQK A;  4KN7 C;  5C5M A;  3RZD B;  4J1M A;  1K83 H;  1XXG A;  2I0Q A;  4LFA Q;  3OIQ A;  2X6G A;  3J80 E;  1SXT A;  1GUW A;  2QDB A;  3TP6 A;  1S40 A;  2JEB I;  3JAM E;  1I3Q B;  3DWQ A;  1UEA B;  4CBV A;  3CRK C;  1JWM D;  3FVQ A;  1N36 Q;  2OTL A;  3VR4 A;  4JI3 L;  4QUC A;  3K58 A;  4DN4 M;  4KJN A;  1KNE A;  1WFQ A;  3A56 A;  3ZJY C;  1S5D D;  1EZ6 A;  2CFM A;  1L1O B;  3MFY A;  4HN7 A;  1STB A;  1PRT B;  2VXW A;  3A5Z B;  5C3E H;  3QR8 A;  1L0W A;  3GTK H;  4JG2 A;  1L1O A;  4Y7N B;  2MQH A;  1WTR A;  3FPP A;  4HIM A;  1QZG A;  1RCV D;  5EBD A;  3L7Z C;  3OTO Q;  5GAG C;  3SK6 A;  3CF5 A;  1F2Z A;  4R4Q A;  4HJ8 A;  4FNF A;  4DK6 C;  1VQ4 A;  1HNZ Q;  2R7D A;  2AMC B;  1W6J A;  3F1Z A;  4A3K H;  1KLG D;  1ILQ A;  2N8N A;  2CQA A;  1EIF A;  1K8O A;  4N9T A;  2KCN A;  4DV1 L;  4B08 A;  2AQ3 B;  2M9V A;  3NWS A;  3KLS A;  2FJ2 A;  1J9O A;  5JJK A;  2F0E A;  4NMZ A;  1PA6 A;  3U9O A;  3CC2 A;  1VQF A;  1WCM G;  3GTG B;  2NVY H;  4QJF A;  3C46 A;  1YJ9 A;  2VB2 X;  4U68 A;  3O13 A;  4BY1 H;  1C8C A;  2PNH A;  5GAH C;  2D9U A;  4YWM A;  2KBN A;  1RKN A;  1QUQ B;  4HTH A;  5D65 A;  1GKH A;  2NN6 G;  4XT3 B;  4L6T B;  5GAD C;  4HIO A;  5JOB A;  4LJZ C;  4CDF C;  5FOB B;  5FLX L;  3F2C A;  5IP9 G;  1QUQ A;  1C9O A;  5CV6 A;  2PW5 A;  1K8A C;  2D0O A;  5ELC A;  1TWA B;  2NTS A;  3MTS A;  3HEJ A;  4DV5 Q;  2A6E D;  4X62 Q;  1DM0 B;  4N8F A;  1KXL A;  3HKZ G;  1ONL A;  4I7Z C;  1VQG A;  4IZ8 A;  2E75 C;  2K01 A;  4LF5 L;  2VUM B;  3KLS X;  2AHO B;  4AQY Q;  1N32 L;  1VQC A;  2KEN A;  4PZ8 A;  4NXM L;  1VMC A;  5CBA E;  2F03 A;  1LTR D;  5D3D A;  3F8T A;  1IBM L;  2A5H A;  2JYO A;  1K0S A;  1LUZ A;  1QNU A;  5FO8 B;  2BH2 A;  1WTV A;  3S16 B;  3K0Y A;  1T9H A;  4BY7 G;  2QEJ C;  1EQT A;  2JQO A;  4FXD A;  2EDG A;  3M9B A;  4B9X A;  5DM7 3;  1X3E A;  1TWC B;  5M9O A;  1SYB A;  3K59 A;  2A6H C;  2NVQ H;  4C1N I;  4QMG A;  4RHR A;  4EQ5 A;  1JJ2 A;  4LUZ A;  1SND A;  4IUP A;  2IHF A;  5GAE C;  1XPU A;  2M00 A;  2WII B;  5JJZ A;  1IZ6 A;  1I5F A;  4MHE A;  4DUZ Q;  1DD2 A;  4DV3 Q;  2SEB D;  1TWF H;  3CAM A;  3DEO A;  1YNN C;  4ME3 A;  4J8Q A;  4OEL B;  2CCZ A;  3A0J A;  1JOO A;  5IE8 A;  4DR5 Q;  4DR2 L;  2FFK B;  4GLV B;  1EIY B;  2RHQ B;  1KLU D;  1N33 L;  3TN2 A;  3K0X A;  4JI6 Q;  4GN3 B;  1T5X D;  3MC0 B;  3NP8 A;  1Z7T A;  5IYD G;  3NE5 B;  4DNT B;  3BS1 A;  2EXD A;  3Q24 A;  2F0T A;  1YEZ A;  1A2U A;  2DJG C;  1ICF B;  4PNY A;  2MO0 A;  4G7H C;  1JT8 A;  5M3M H;  4L5S A;  4CKC A;  1U4M A;  4FF4 A;  1ICW A;  5IGC A;  4H0L C;  1Y1V G;  1VQ8 A;  4M1U B;  4HR7 B;  3MEH A;  4LF6 L;  2QIL A;  1B9M A;  5FJ8 H;  3GP7 A;  1FNW A;  4EQN A;  5C5L A;  5JJI A;  4GNX A;  3I73 A;  2YTV A;  5EPJ A;  4DAP A;  2NB0 A;  1VQM A;  3KLR A;  3H3V H;  5EKI A;  4IAL A;  1ENC A;  3K80 C;  4CKE A;  1QWY A;  5FLX E;  1O80 A;  4JPB W;  2QEX A;  4HJ9 A;  4AIM A;  5E3F A;  3U4V A;  3D4R A;  3KLW A;  2DY7 A;  3I4M G;  4B3S Q;  2I46 A;  1W6K A;  4HID A;  2A69 C;  4IUT A;  5DAU A;  5ELN A;  1ZXT A;  1EQR A;  1JR0 D;  4BBR H;  5CMD A;  5EKK A;  2ZJP A;  1Q12 A;  1A2T A;  4QF4 A;  3J7Y W;  2FXQ A;  4C3I H;  2G5D A;  3ULP A;  1IYV A;  1EWC A;  2BH8 A;  1HTP A;  3VR6 A;  1UAP A;  3X3N A;  4A3I H;  2NN6 H;  1XPO A;  1XTD A;  3RZO B;  4WJ3 M;  3G6J B;  1S5E D;  1B4O A;  1LT5 D;  4HIK A;  2SNS A;  5IP9 H;  4JI3 Q;  1EEI D;  1PH8 A;  3X3M A;  2ZXO A;  4IPD A;  2PO4 A;  3TZD A;  4DV7 L;  1PDQ A;  1WYD A;  1PYW D;  3PQI A;  1U4P A;  2KEE A;  4L8J A;  1X3Q A;  1MIU A;  2B2Y A;  3RLF A;  3V96 A;  3BZC A;  4NKL A;  4P2C B;  2WAQ E;  1Q82 C;  3MXP A;  3A54 A;  3DUZ A;  2Z8L A;  4R9W A;  2F0Q A;  4P73 A;  1E22 A;  2E2H B;  3CU7 A;  5IGG A;  3MXG A;  4JI5 L;  3PIO A;  4UAI A;  4JVZ A;  1MBY A;  5C3W A;  1H9J A;  2PQA B;  1BF4 A;  1KAW A;  2L9H A;  3ICE A;  3IRB A;  4PG3 A;  2KVM A;  1U5K A;  3K7A B;  4DA2 A;  1BR9 A;  4ABN A;  1WTW A;  2X6L A;  2XGT A;  4DV1 Q;  4NPS A;  2WAQ B;  3FHW A;  2ZTC A;  5JVH 3;  1EWI A;  2F0J A;  2ID0 A;  5I9P A;  2K1B A;  1GUN A;  1CSQ A;  3N52 A;  4CJ0 B;  4JI1 L;  5IOD A;  1LTB D;  2D2C C;  3SHL A;  2A68 C;  1C7Y A;  4OWX B;  3SEB A;  4H13 C;  2I07 B;  2OF1 A;  2V1C C;  3AQQ A;  3PIP 3;  2Q2U A;  4R4I A;  1LTL A;  1TXY A;  3G48 A;  3W1B A;  4KKU A;  1A15 A;  2KED A;  1SDF A;  3EFX D;  3MHB A;  2D5D A;  1Y69 U;  3IFT A;  2ZTE A;  3P75 A;  2Y0S E;  2Z0S A;  1S72 A;  1SSO A;  5LL6 S;  4C2M B;  2Q8R E;  3UDG A;  5M5X H;  1PZJ D;  4RKB A;  3MEF A;  3R3O A;  5L37 A;  1PHJ A;  4LF9 L;  3R8B A;  1I94 L;  1PZK D;  3IFD A;  2MFI A;  4E6I A;  3GQB A;  4QB4 A;  4FF2 A;  1LTA D;  1M8A A;  3S14 B;  4LFC L;  1SN8 A;  3J81 c;  4LF5 Q;  2Y0S B;  2V4D A;  5IGD A;  4YCV A;  2JXM B;  3NQI A;  4IOA A;  1N32 Q;  3GTL B;  4NXM Q;  4TKO B;  5FKA C;  3M3Y H;  2E8G A;  1EU3 A;  2F0G A;  1QVG A;  1LTT D;  1IBM Q;  1PXU A;  3ITP A;  2L11 A;  2VUM G;  3AFP A;  3G71 A;  3CXC A;  1U0L A;  2WFW A;  1OXU A;  1N34 L;  4BBS G;  5CYU A;  4FVM A;  4K8J A;  1XMQ L;  3K5L A;  4MIU A;  1XX8 A;  1JWS D;  3EN2 A;  1TY0 A;  3WOE A;  3HOY B;  1B2T A;  1PTO H;  5CV4 A;  3SVM A;  1F9Q A;  1IXR A;  3HOV H;  3S1M H;  4ODG A;  1UNS A;  3OMC A;  1S3O A;  2HCC A;  1I50 B;  3IL8 A;  2A1A A;  2ATW A;  1UEB A;  4Y52 H;  4XIG S;  3SK5 A;  1HZB A;  1LV9 A;  1B70 B;  3QB3 A;  2KCM A;  1SE4 A;  4GLA C;  4GKK L;  1Q8I A;  4EX5 A;  1D5M C;  1SNP A;  2EYF A;  2KCC A;  1DON A;  1N33 Q;  1VF7 A;  1IYU A;  1R4Q B;  4IO9 A;  2UXD L;  2EE1 A;  3P20 A;  3RZD H;  1SNQ A;  3D31 A;  1EY8 A;  1TWG B;  1SE2 A;  1VQA A;  4A93 H;  2B2V A;  1RF2 D;  5C0X I;  2E74 C;  2R7F A;  2EJG C;  2E76 C;  4FYD A;  1SMY C;  1PH5 A;  3EBE A;  3D8G A;  4F7X A;  3OWF A;  1I3Q H;  1FGB D;  3NHH A;  1F2Y A;  4UHV A;  5I6Y A;  4LF6 Q;  4YWK A;  1CA6 A;  3KDF B;  2Z6K A;  1N9W A;  3UI2 A;  4A3M G;  3HS0 C;  1S5C D;  3DWA A;  2A73 B;  2UXC L;  3SXH A;  2VW9 A;  1M1K C;  1SFO B;  2K05 A;  4A3F B;  2A6H D;  1BXT A;  2RHS B;  3S15 B;  4OXP A;  3VDY A;  4TSS A;  4UY8 C;  4F88 A;  1GXD C;  3WDN A;  5IGB A;  2MJ8 A;  4Y7N H;  2LXK A;  1PTO C;  2NVX B;  1KL9 A;  1HUN A;  3UDI A;  5JEA H;  1YNN D;  1NMF A;  3FKI G;  1YHB A;  4G7O C;  2R92 G;  3RN2 A;  1K73 C;  4IUV A;  3HZX A;  3NTI A;  2PQE A;  2KA7 A;  2J7Z A;  5KYL A;  3DM3 A;  4DAV A;  2YV5 A;  1O7Y A;  3VR5 A;  2VS1 A;  1CI3 M;  4ULL A;  1Q46 A;  3J7A F;  4XQJ A;  2EYM A;  5LHY 1;  2B3G A;  4ZAI A;  1DOK A;  1GUO A;  1G6Z A;  3TSS A;  4RCO A;  3T1Y L;  1XNR L;  3T13 A;  3GTG H;  1O7Z A;  4QGU A;  4AYB E;  1QZH A;  3HP3 A;  4AH6 A;  2X69 A;  2ZJQ A;  4DR3 L;  1TT2 A;  2XNA C;  4IFD J;  4ZUJ A;  4ZYS A;  2R61 A;  1PFN A;  4WRD A;  4DV7 Q;  3TS2 A;  1STA A;  1ZKO A;  2CKZ B;  3K57 A;  4DR7 L;  1TWA H;  2CWP A;  4QY7 A;  2YYZ A;  3OWE B;  4B3T L;  1BCP C;  3NEN A;  1OXS C;  1HPC A;  4AYB B;  1GHK A;  5H1S E;  2RDH A;  1V1P B;  3RLO A;  4JI5 Q;  4K5V A;  2CW0 C;  3FDT A;  1A3V A;  1SE3 A;  2NTT A;  4RGN A;  4HJ5 A;  2VUM H;  3EIV A;  5M3F B;  4BXX G;  2QF7 A;  1V1P A;  3DWP A;  5AJ3 L;  1QJO A;  1JIC A;  2JEA I;  2UXB L;  1L1O C;  4B9W A;  1PRT C;  2R3Z A;  5EGT A;  3I4N H;  4CHT B;  2F0N A;  1XPR A;  2A69 D;  5G3L D;  4HJ7 A;  1PYS B;  3DLL A;  4A3G B;  1KNA A;  1TU2 B;  4DV6 L;  1FYC A;  2F0O A;  3S16 H;  2PNR C;  4JI1 Q;  5C6A A;  2YTY A;  2XRQ D;  3GTO B;  2XRS D;  3TBI B;  1CHP D;  3MZ5 A;  4C3H H;  1NCV A;  2HIV A;  2WAQ G;  5HGQ A;  3CPW A;  3CD6 A;  1TWC H;  2LKV A;  2K52 A;  3NTK A;  5G3L F;  1Q86 C;  4EQO A;  4MN3 A;  3I8Z A;  3ZYY X;  5IIF A;  2HT1 A;  1LTS D;  3QIA A;  3A8K E;  1LAC A;  3J80 c;  3NPP A;  2IWH A;  1XWE A;  2KUM A;  4UP8 A;  5IYB H;  2JA5 B;  3Q0A A;  1SYG A;  3ERQ A;  3JAM c;  3S17 B;  1VQH A;  1LT4 D;  4X64 L;  1SE8 A;  1NJI C;  2O5I C;  2K5H A;  3M85 A;  2RSO A;  1AZP A;  4LF9 Q;  5EPL A;  1STH A;  2LS0 1;  1IL2 A;  3K5M A;  4KLK A;  1I94 Q;  1LM0 A;  3B6Y A;  5E1F A;  1BCP B;  1QB5 D;  4H44 C;  1O7I A;  1FR3 A;  4LFC Q;  4DR6 L;  2RCN A;  4I65 A;  4O2D A;  4NB3 A;  2TMP A;  3SGI A;  1UWV A;  4K8I A;  1NY4 A;  3HOU B;  5LL6 X;  1YNJ C;  4JI2 Q;  2K14 A;  3AYH B;  5IT9 L;  2ZJR A;  3VR3 A;  4L5R C;  1GUG A;  5C0X G;  2Y0S G;  3GTJ H;  2JSO A;  1IBK L;  3GTM B;  1N34 Q;  1K8M A;  4HED A;  4KD4 A;  2N49 A;  3DXJ C;  3W3A A;  3D6C A;  4KY6 A;  1XMQ Q;  1MI2 A;  4GKJ L;  1LTG D;  5M5Y B;  1BVS A;  1RDP D;  3M4Q A;  1CM9 A;  2KEC A;  2AQ2 B;  5DLQ E;  5E7N A;  2LXJ A;  1VQ7 A;  3OW2 A;  2A68 D;  1VQI A;  4GZY C;  3PO2 B;  2K5W A;  4POF A;  3KF8 B;  5GQO A;  3MA2 B;  3HOY G;  1NUC A;  2K33 A;  2F3W A;  3I70 A;  5EKL A;  1EWH A;  4H02 A;  5LMU L;  1IKM A;  4GKK Q;  2L15 A;  1TY2 A;  3ER0 A;  3KF8 A;  1NR4 A;  2N55 A;  1HZA A;  1C0A A;  1GD7 A;  1YHQ A;  2RDF A;  3GTP B;  5J3B A;  4DV4 L;  1UE6 A;  1EY7 A;  1J6Q A;  2NZ1 D;  4JI7 L;  2UXD Q;  1CSP A;  1HCZ A;  1SEB D;  2FMC A;  1NBW A;  3CCU A;  4IFD I;  3I91 A;  4WJW A;  3STB C;  4IUQ A;  1DOM A;  4QUF A;  2IW3 A;  1QVF A;  2K28 A;  4MTN A;  3GD7 A;  5IP7 H;  3PF4 A;  2OTJ A;  2EJF C;  2E2J B;  3T53 B;  1C4Q A;  5K36 H;  2MO1 A;  2NVT B;  4A3B G;  3NWT A;  1E0B A;  4KY5 A;  2HDM A;  2L4N A;  4CDD C;  5KND A;  5IYC G;  4HCE A;  1DJR D;  3RN5 A;  1X3F A;  3IKJ A;  2K5Q A;  2F3V A;  1TS2 A;  1CZG A;  2FMM A;  1XNQ L;  4C3J B;  4BBS B;  1EFW A;  2F4V L;  2UXC Q;  1VCI A;  3PMF A;  3OSO A;  3M4O H;  2K4K A;  4K6L A;  4CJ2 C;  3E6Z X;  3CQZ H;  2YU9 B;  1TWH B;  5D3I B;  3BVG A;  3K6O A;  3LX0 A;  1TR5 A;  2LMC B;  2Z6B A;  2HHH L;  3RNU A;  4IUN A;  3I56 A;  4A3J B;  3HOZ H;  1AP0 A;  3S2H B;  1UE5 A;  4UDU C;  2JA6 B;  4A3F G;  2E2H H;  3EA6 A;  2RSN A;  2BDN A;  3LGJ A;  2IX3 A;  5M5W B;  1O7L A;  3I7F A;  2B63 B;  3E0J A;  1ESR A;  2R93 B;  1YHA A;  2AWO A;  3BYY B;  3RR5 A;  3P1H A;  3BG3 A;  3TDQ A;  2G9D A;  3U50 C;  2K32 A;  4CDE C;  1Q7Y C;  4DKA C;  5IT9 E;  4JYA L;  1VQ9 A;  1BOS A;  1SYE A;  5J22 A; 
#chains in the Genus database with same CATH homology
 1STY A;  3T16 A;  3QG1 A;  1WTX A;  5T1G A;  1IW7 C;  4K2K A;  2H4O A;  2HQE A;  4OIJ A;  2E2I B;  2EOT A;  1I4Q A;  1G2T A;  1L0Y B;  2PW7 A;  5I2Y A;  2F0H A;  3S1Q B;  5IGF A;  1JC7 A;  2A74 C;  2AUJ D;  4OGQ C;  1SMY D;  2K7V A;  1RTO A;  2L5T A;  2F0F A;  1HFG A;  1ENA A;  4FF1 A;  1JOQ A;  1TVX A;  4DXF A;  1RD9 D;  2EY1 A;  4A3M B;  5JPN C;  2EY6 A;  4DU9 A;  1A3T A;  3ONA B;  3V2T A;  2B2Y C;  2K5D A;  5C3E B;  3GTK B;  2EXZ A;  1PTO D;  5AFW A;  1IKL A;  4LK1 C;  1C48 A;  4KMU C;  2JP1 A;  3FKI B;  2R92 B;  1KAA A;  1BDO A;  1EIH A;  1GUT A;  1B53 A;  1EY0 A;  1H9R A;  1TS5 A;  4A3K B;  2O5J C;  3OOC A;  1PTO F;  3K5N A;  4Q0F A;  4KD3 A;  3VYR A;  3S2D B;  1M4V A;  5CV7 A;  3CHB D;  1AZQ A;  1HA5 A;  4OO1 I;  2F0P A;  3ND8 A;  1A3U A;  1EY4 A;  3H6M A;  1OO9 B;  1MD2 D;  5HUR A;  1WVL A;  4IFD G;  3NBH A;  1BCP D;  1NAP A;  3OHX C;  1EL0 A;  2CW0 D;  5C0X J;  2NUC A;  4NW2 A;  5FO7 B;  3R2T A;  4R8I A;  4YIJ A;  1BCP F;  1PRT D;  3L3O C;  3BVZ A;  1TQO A;  1DYQ A;  1CT1 D;  1ZEQ X;  1Q3L A;  3T51 B;  2WB1 B;  1LT6 D;  2PZW A;  1JWU D;  5C4Z A;  1EQV A;  1PRT F;  5NUC A;  3TP7 A;  4KV6 A;  4HSP A;  2AQ1 B;  5ELD A;  1HTL D;  2Q8I B;  1LLR D;  3M7G A;  5CR3 A;  1SAP A;  4F8M A;  4LMQ D;  1A6X A;  1BNZ A;  1TWF B;  1EEF D;  3VYS A;  2G9H D;  3SE0 A;  4H7B A;  3LWE A;  5CGK A;  4HMJ A;  3S9W A;  4DK1 A;  5E4X A;  4X3U A;  1YNJ D;  3RMH A;  1JOR A;  2BE5 C;  1T5E A;  5FO9 B;  2B2V C;  1HQM C;  2WKD A;  1PLF A;  4S3S A;  5M3M B;  1JE4 A;  4KTA A;  2WKC A;  4BS9 A;  1LO5 D;  3IAY A;  1D2B A;  4C3J G;  3GV6 A;  2EZV A;  2OXP A;  2E2D C;  2XSC A;  4PMC A;  1ILP A;  4A3D B;  1HQR D;  2DNC A;  2WP8 J;  5DM6 3;  1DOL A;  4JK1 C;  4KHV A;  4IN3 A;  1D1K A;  1CA5 A;  1JCK B;  1ML0 D;  1E2W A;  5KGU A;  1F9P A;  4ZK9 B;  2ZXR A;  1LT3 D;  1I4H A;  4FXG C;  4ZUI A;  1EU4 A;  2F0U A;  3AU7 A;  5KIX A;  2BA1 A;  4OO1 G;  1I6H B;  1STN A;  2NWG A;  5EPK A;  3VA5 A;  3PO3 B;  4DF7 A;  1F2L A;  4A3B B;  2HDL A;  3DM1 A;  4A3I B;  1JB3 A;  4U67 3;  2CVR A;  2HUG A;  4IFD H;  3TZU A;  3FRP B;  4EQP A;  4KKS A;  1F9R A;  1STE A;  4HMI A;  5JPM C;  2OEO A;  1SBB B;  2IX1 A;  4RGT A;  5KNB A;  2F0I A;  3T4A C;  1X32 A;  1CHQ D;  4RAU C;  4CGY B;  2B2T A;  4O1N A;  2B8G A;  3NXW A;  4DK0 A;  1GOZ A;  1I4X A;  2ZXP A;  1Z6H A;  5JAV A;  4PV1 C;  2PZU A;  4WFN 3;  3Q6S A;  2FHT A;  4Q5V A;  3D4W A;  3MAQ A;  4QCL A;  2KOL A;  5C4X B;  1IW7 D;  4CJ1 B;  1S5B D;  4RGO S;  3A55 A;  1ROD A;  3PV0 A;  4RKL A;  3SK8 A;  1OXT A;  1F9S A;  2JA8 B;  2TSS A;  5KRU A;  5EJW A;  5K5P A;  1G2S A;  1NSN S;  3AB9 A;  1UUP A;  4ID6 A;  1HXY D;  3NBI A;  2KHS A;  3PUW A;  1E2V A;  3QWN A;  2NN6 I;  2IJ0 A;  5M5X B;  2R7Z B;  5I6W A;  1DZ1 A;  3D3R A;  2PPB C;  4DGZ A;  5C44 B;  5HGT A;  2IX0 A;  3M7N A;  3VYU A;  4RH6 A;  5F2D A;  3LWU A;  5CV8 A;  1RHP A;  2B2U A;  4JBW A;  5COY A;  2K03 A;  3C3L A;  3M3Y B;  4KK7 A;  2B2W A;  2VB3 X;  4X3S A;  3LNN A;  3CKI B;  1CZW A;  4X3T A;  4WOR A;  3MWY W;  3U9S A;  1Q1B A;  4ZKB B;  4XYQ A;  3MXN A;  1VMP A;  4NDX A;  3S1M B;  1ENF A;  4ZKC B;  5I2X A;  4FXK C;  3F2U A;  1QNK A;  4RA8 A;  5KYI A;  1WTP A;  1O78 A;  3HGB A;  5ISR A;  4RFB A;  4KN4 C;  1IL8 A;  4OL7 A;  2F0M A;  1S5F D;  5C4H A;  1HFN A;  3E5S A;  2F0S A;  3ERO A;  4OO1 H;  1LTI D;  2JE6 I;  5IOC A;  2XN9 C;  3FMC A;  2BA0 A;  1EY6 A;  4A93 B;  4LAA A;  1EZ8 A;  1ZYR D;  2JA7 B;  1QCB D;  2L12 A;  4X3K A;  3W2D A;  3HOW B;  1G91 A;  2RKS A;  1EY9 A;  5A2Q L;  1EY5 A;  4TQU S;  5T1I A;  5BN4 A;  1I4P A;  2DNE A;  2L1B A;  1KDA A;  4EVO A;  5CC4 A;  1QE6 A;  5DNF A;  1D5X C;  3EJI A;  5KEE A;  1D5Z C;  5E4W C;  5I9O A;  3Q22 A;  4C56 C;  3HOX B;  3VA7 A;  1EOT A;  1Y8P B;  1B1Z A;  4ZQ3 A;  4F87 A;  1DXM A;  3BDC A;  3H0G B;  1MGS A;  1NR2 A;  3H09 A;  1VF5 C;  3A8I E;  4A3E B;  2BE5 D;  4BA2 I;  3Q23 A;  3A7A B;  1KTK A;  2BOS A;  1XTC D;  4C3I G;  1TS4 A;  1GHJ A;  1Y1W B;  1I4G A;  5I4D A;  1HUM A;  1FNU A;  3C1E A;  1X3P A;  3D4D A;  2DN8 A;  3I4L A;  4M8A A;  3QOJ A;  3S1R B;  4PMB A;  4G4K A;  4XYO A;  4KHZ A;  2Z4I A;  3A7L A;  4HSV A;  1H9M A;  1KDC A;  5ELF A;  3DEP A;  2Q8T A;  2PZT A;  4L63 B;  3HRZ C;  2F0K A;  3I4N B;  2EYO A;  1AEX A;  4RGM A;  1KDB A;  2RA4 A;  2FIN B;  4FO2 A;  4DXG A;  1ESF A;  1KAB A;  4C3H B;  5BN3 A;  4K5X A;  1U9R A;  4RCN A;  5A35 A;  1WTQ A;  2B8F A;  5A2Q E;  1QG7 A;  1K83 B;  1BBX C;  3I72 A;  3SK4 A;  3C2P A;  2Z4H A;  1WTO A;  2RQX A;  3PUV A;  3FPU B;  4HCS A;  1L0X B;  2MP1 A;  3R2I A;  4KKT A;  4IQZ A;  3MFG A;  1H9S B;  4KI0 A;  5EBC A;  3V05 A;  3P7J A;  5C0X H;  2HCI A;  3VR2 A;  2F0L A;  3GTJ B;  2IPK D;  4DAY A;  1H9S A;  3A8J E;  4HAE A;  1PZI D;  4DFA A;  1PFB A;  4FF3 A;  2MPM A;  5BN5 A;  4RWS C;  4KJO A;  4K2L A;  4DNR B;  2BCO A;  2EYL A;  5IGE A;  1Y8N B;  1V8Q A;  1FD7 D;  1G8Z D;  1SYD A;  2EYJ A;  1J8I A;  2ICE C;  4N9P A;  1RTN A;  1HA6 A;  1ET6 A;  4KY7 A;  1ET9 A;  5CV9 A;  1SYC A;  5JVG 3;  3BZD B;  2NVY B;  4BY1 B;  4ZRZ A;  3K5O A;  3TME A;  2EJM A;  2IL8 A;  1WD1 A;  1U4R A;  1F77 A;  1LAB A;  4V0B A;  2SOB A;  3J81 L;  2SDF A;  3QJY A;  1HRJ A;  1Y8O B;  3OW7 A;  2XWJ B;  2EY2 A;  1EYD A;  3MXU A;  2F4I A;  2RBM A;  2EY5 A;  1PFM A;  4K5W A;  3OMG A;  1CTM A;  3AMU A;  1AW7 A;  1AFP A;  2QKI C;  1B44 D;  3NTH A;  3PUY A;  1ZYR C;  1SNM A;  2C9O A;  3PIO 3;  3M4O B;  3SDZ A;  3CQZ B;  3N6R A;  1HHV A;  5C3X A;  1F2M A;  4BWG B;  2QCP X;  3HOZ B;  3QOL A;  2NVQ B;  1B9N A;  2SNM A;  3EVQ A;  2EYH A;  4XDX A;  3NQT A;  3H3V C;  5JEA G;  4XT1 B;  2K04 A;  2F1M A;  2PCF B;  2WV6 D;  2WIN B;  3HG9 A;  1BQQ T;  1JOK A;  3BYT B;  1CK1 A;  4K6D A;  3ND9 A;  1CQF A;  2EYP A;  1R4P B;  1OXX K;  4IUU A;  1B50 A;  2RDG A;  3BDO A;  2ICI A;  2GA4 B;  2F0V A;  4FP5 D;  4XQN A;  5D14 A;  2J0T D;  3NSW A;  1IHZ A;  4G7Z C;  1V43 A;  2ENB A;  1II3 A;  1JQY D;  3FEW X;  1E2Z A;  1I6V C;  2Z1C A;  2B2T C;  1MSG A;  3TP8 A;  2LFN A;  2PYK A;  3J81 E;  2A6E C;  3RUZ A;  4EGV A;  3S1N B;  2L0C A;  3CRL C;  2ZT9 C;  2N88 A;  2D62 A;  3EQL C;  3DHQ A;  5DEH A;  1PMR A;  2XIW A;  5FK9 C;  3OIP A;  1B3A A;  1QIL A;  3GTQ B;  4BBR B;  2AUK A;  2C5C A;  4TRD A;  2F0D A;  4C3H G;  4Z9C B;  1QOH A;  1WCM B;  2O2L D;  2B39 A;  4C3I B;  3QO2 A;  1RJT A;  2J4X A;  5J1Z A;  5KNC A;  3NUC A;  3MVV A;  4RHS A;  1BO0 A;  3OPO A;  1SNO A;  5ELB A;  3TP5 A;  2WAC A;  5TSS A;  3D6W A;  4NP5 A;  1GUS A;  1CQV A;  1STG A;  2XVS A;  1SJE D;  4ILW A;  2M2L A;  1TKW B;  1SYF A;  1Z47 A;  3HKZ B;  2EVB A;  2B2U C;  2CHB D;  4XQQ A;  3J7A V;  2B2W C;  1EIG A;  1EFI D;  3PUX A;  1Q1E A;  2XWB B;  4XTC S;  1V1O A;  3G7L A;  3KBG A;  3GV3 A;  4BY7 B;  3DMU A;  3NK9 A;  4IUR A;  4PQX A;  1WD0 A;  3J80 L;  4C1N K;  3JAM L;  3GO5 A;  3VYT A;  1TS3 A;  3SR1 A;  4BA1 I;  2VNU D;  4G57 A;  4XXE A;  1U4L A;  2NYZ D;  1FNV A;  1SJH D;  1SNC A;  1DCZ A;  2NBF A;  3T56 B;  4OIK A;  3M4Y A;  2MUY A;  3R93 A;  2RVL A;  1Q90 A;  5C4J B;  1VDZ A;  2MHV A;  1CFM A;  3KUP A;  5CBE E;  3L9A X;  1BUV T;  3PUZ A;  2EPB A;  1I4R A;  2LY7 A;  2O4X A;  3BVM A;  3H91 A;  5J39 A;  3H94 A;  1G29 1;  1TII D;  5K36 G;  4J6H A;  2MGS A;  2IT1 A;  1XYI A;  2F0W A;  1EYC A;  4K14 A;  4PMW A;  1Y1V B;  2OT2 A;  5ELE A;  4R8N A;  4O42 A;  3WOF A;  1H9K A;  1D1I A;  1GJX A;  2KJX A;  2DY8 A;  3I3C A;  4ME5 A;  1D6E C;  4OHJ A;  1PTO B;  5EQ0 A;  2H1E A;  3RD4 A;  3KBX A;  3HOV B;  2KQ3 A;  2L55 A;  2K6A A;  1EYA A;  1AN8 A;  2PMZ B;  4CKB A;  1OXV A;  5COR A;  3I4M B;  5JEA J;  1MSH A;  2BDO A;  4V19 0;  3BDL A;  3URY A;  4ZLT F;  1R9T B;  2R6G A;  3I90 A;  5CV5 A;  3C1F A;  1S4Z A;  3KK7 A;  2AWN A;  4QIW B;  4KN7 C;  5C5M A;  3RZD B;  4J1M A;  1XXG A;  3OIQ A;  2X6G A;  3J80 E;  1SXT A;  1GUW A;  2QDB A;  3TP6 A;  2JEB I;  3JAM E;  1I3Q B;  3DWQ A;  1UEA B;  4CBV A;  3CRK C;  1JWM D;  3FVQ A;  3VR4 A;  3K58 A;  4QUC A;  4DN4 M;  4KJN A;  1KNE A;  3A56 A;  1S5D D;  1EZ6 A;  3MFY A;  4HN7 A;  1STB A;  1PRT B;  2VXW A;  4Y7N B;  1WTR A;  3FPP A;  1RCV D;  5EBD A;  3L7Z C;  3SK6 A;  1F2Z A;  4FNF A;  1W6J A;  1KLG D;  1ILQ A;  2CQA A;  1K8O A;  4N9T A;  2KCN A;  4B08 A;  2AQ3 B;  2M9V A;  3NWS A;  3KLS A;  2FJ2 A;  1J9O A;  2F0E A;  4NMZ A;  3U9O A;  3GTG B;  3C46 A;  2VB2 X;  4U68 A;  3O13 A;  1C8C A;  2D9U A;  1RKN A;  4HTH A;  5D65 A;  2NN6 G;  4XT3 B;  4L6T B;  5JOB A;  4LJZ C;  5FOB B;  5FLX L;  5CV6 A;  2PW5 A;  5ELC A;  1TWA B;  2NTS A;  3MTS A;  3HEJ A;  2A6E D;  1DM0 B;  1ONL A;  4I7Z C;  4IZ8 A;  2E75 C;  2K01 A;  2VUM B;  3KLS X;  1VMC A;  5CBA E;  2F03 A;  1LTR D;  5D3D A;  2A5H A;  2JYO A;  1QNU A;  5FO8 B;  1WTV A;  3S16 B;  3K0Y A;  2QEJ C;  1EQT A;  4FXD A;  2EDG A;  4B9X A;  5DM7 3;  1TWC B;  5M9O A;  1SYB A;  3K59 A;  2A6H C;  4C1N I;  4QMG A;  4RHR A;  1SND A;  4IUP A;  2M00 A;  2WII B;  5JJZ A;  1DD2 A;  4MHE A;  2SEB D;  3DEO A;  1YNN C;  4J8Q A;  1JOO A;  2FFK B;  1KLU D;  3TN2 A;  1T5X D;  3MC0 B;  3NP8 A;  1Z7T A;  3NE5 B;  4DNT B;  3BS1 A;  3Q24 A;  2F0T A;  1A2U A;  4PNY A;  4G7H C;  4CKC A;  1U4M A;  4FF4 A;  1ICW A;  5IGC A;  4H0L C;  4M1U B;  4HR7 B;  3MEH A;  2QIL A;  1B9M A;  3GP7 A;  1FNW A;  4EQN A;  5C5L A;  3I73 A;  5EPJ A;  4DAP A;  2NB0 A;  3KLR A;  5EKI A;  4IAL A;  1ENC A;  4CKE A;  1QWY A;  5FLX E;  1O80 A;  5E3F A;  3D4R A;  2DY7 A;  2I46 A;  1W6K A;  2A69 C;  4IUT A;  5DAU A;  1ZXT A;  1JR0 D;  5CMD A;  5EKK A;  1Q12 A;  1A2T A;  4QF4 A;  3J7Y W;  1IYV A;  1EWC A;  1HTP A;  3VR6 A;  1UAP A;  3X3N A;  2NN6 H;  3RZO B;  3G6J B;  1S5E D;  1B4O A;  1LT5 D;  2SNS A;  1EEI D;  3X3M A;  2ZXO A;  2PO4 A;  3TZD A;  1PDQ A;  1PYW D;  1U4P A;  2KEE A;  4L8J A;  1X3Q A;  2B2Y A;  3RLF A;  3V96 A;  4P2C B;  4NKL A;  3MXP A;  3A54 A;  3DUZ A;  2Z8L A;  4R9W A;  2F0Q A;  2E2H B;  3CU7 A;  5IGG A;  3MXG A;  4UAI A;  1MBY A;  5C3W A;  1H9J A;  1BF4 A;  2L9H A;  2KVM A;  3K7A B;  4DA2 A;  1BR9 A;  4ABN A;  1WTW A;  2X6L A;  2WAQ B;  5JVH 3;  2F0J A;  2ID0 A;  5I9P A;  2K1B A;  1GUN A;  3N52 A;  4CJ0 B;  5IOD A;  1LTB D;  2D2C C;  3SHL A;  2A68 C;  3SEB A;  4H13 C;  2I07 B;  2OF1 A;  3PIP 3;  4KKU A;  1A15 A;  2KED A;  1SDF A;  3EFX D;  3MHB A;  2D5D A;  1Y69 U;  3IFT A;  3P75 A;  1SSO A;  5LL6 S;  4C2M B;  2Q8R E;  1PZJ D;  4RKB A;  3R3O A;  3R8B A;  1PZK D;  3IFD A;  4E6I A;  3GQB A;  4QB4 A;  4FF2 A;  1LTA D;  1M8A A;  3S14 B;  2Y0S B;  2V4D A;  5IGD A;  2JXM B;  3NQI A;  3GTL B;  4TKO B;  5FKA C;  1EU3 A;  2F0G A;  1LTT D;  1PXU A;  3ITP A;  2L11 A;  1OXU A;  5CYU A;  4FVM A;  4K8J A;  3K5L A;  4MIU A;  1XX8 A;  1JWS D;  1TY0 A;  3WOE A;  3HOY B;  1B2T A;  1PTO H;  5CV4 A;  3SVM A;  1F9Q A;  4ODG A;  1UNS A;  3OMC A;  2HCC A;  1I50 B;  3IL8 A;  4XIG S;  3SK5 A;  1LV9 A;  3QB3 A;  1SE4 A;  1Q8I A;  1D5M C;  1SNP A;  2EYF A;  2KCC A;  1DON A;  1VF7 A;  1IYU A;  1R4Q B;  2EE1 A;  3P20 A;  1SNQ A;  3D31 A;  1EY8 A;  1TWG B;  1SE2 A;  2B2V A;  1RF2 D;  5C0X I;  2E74 C;  2EJG C;  2E76 C;  4FYD A;  1SMY C;  3D8G A;  4F7X A;  3OWF A;  1FGB D;  3NHH A;  1F2Y A;  5I6Y A;  1CA6 A;  3UI2 A;  3HS0 C;  1S5C D;  3DWA A;  2A73 B;  3SXH A;  1SFO B;  2K05 A;  4A3F B;  2A6H D;  1BXT A;  3S15 B;  4TSS A;  4F88 A;  1GXD C;  3WDN A;  5IGB A;  2MJ8 A;  1PTO C;  2NVX B;  1HUN A;  5JEA H;  1YNN D;  4G7O C;  4IUV A;  3HZX A;  3NTI A;  2PQE A;  2KA7 A;  2J7Z A;  5KYL A;  4DAV A;  1O7Y A;  3VR5 A;  1CI3 M;  4ULL A;  3J7A F;  4XQJ A;  2EYM A;  5LHY 1;  4ZAI A;  1DOK A;  1GUO A;  1G6Z A;  3TSS A;  4RCO A;  3T13 A;  1O7Z A;  3HP3 A;  2X69 A;  1TT2 A;  2XNA C;  4IFD J;  4ZUJ A;  4ZYS A;  2R61 A;  1PFN A;  4WRD A;  1STA A;  1ZKO A;  3K57 A;  2YYZ A;  3OWE B;  1BCP C;  1OXS C;  1HPC A;  4AYB B;  1GHK A;  2RDH A;  1V1P B;  4K5V A;  2CW0 C;  3FDT A;  1A3V A;  1SE3 A;  2NTT A;  4RGN A;  5M3F B;  2QF7 A;  1V1P A;  3DWP A;  1QJO A;  1JIC A;  2JEA I;  4B9W A;  1PRT C;  2R3Z A;  5EGT A;  4CHT B;  2F0N A;  2A69 D;  5G3L D;  4A3G B;  1KNA A;  1TU2 B;  1FYC A;  2F0O A;  2PNR C;  5C6A A;  2XRQ D;  3GTO B;  2XRS D;  3TBI B;  1CHP D;  3MZ5 A;  1NCV A;  2LKV A;  3NTK A;  5G3L F;  4EQO A;  4MN3 A;  3I8Z A;  3ZYY X;  5IIF A;  1LTS D;  3A8K E;  3QIA A;  1LAC A;  3NPP A;  2IWH A;  1XWE A;  2KUM A;  2JA5 B;  3Q0A A;  1SYG A;  3ERQ A;  3S17 B;  1LT4 D;  2O5I C;  3M85 A;  2RSO A;  1AZP A;  5EPL A;  1STH A;  2LS0 1;  3K5M A;  5E1F A;  1BCP B;  1QB5 D;  4H44 C;  1FR3 A;  4I65 A;  2TMP A;  4K8I A;  3HOU B;  5LL6 X;  1YNJ C;  5IT9 L;  3VR3 A;  1GUG A;  5C0X G;  2JSO A;  3GTM B;  1K8M A;  4HED A;  4KD4 A;  3DXJ C;  3W3A A;  4KY6 A;  3D6C A;  1MI2 A;  1LTG D;  5M5Y B;  1RDP D;  1CM9 A;  2KEC A;  2AQ2 B;  2A68 D;  4GZY C;  3PO2 B;  2K5W A;  3MA2 B;  1NUC A;  2K33 A;  2F3W A;  3I70 A;  5EKL A;  1EWH A;  1IKM A;  1TY2 A;  3KF8 A;  1NR4 A;  2N55 A;  2RDF A;  3GTP B;  1EY7 A;  2NZ1 D;  1HCZ A;  1SEB D;  2FMC A;  4IFD I;  3I91 A;  4WJW A;  4IUQ A;  1DOM A;  4QUF A;  2IW3 A;  2K28 A;  3GD7 A;  2EJF C;  2E2J B;  3T53 B;  1C4Q A;  5K36 H;  2NVT B;  3NWT A;  1E0B A;  4KY5 A;  2HDM A;  2L4N A;  5KND A;  4HCE A;  1DJR D;  3IKJ A;  2K5Q A;  2F3V A;  1TS2 A;  1CZG A;  2FMM A;  4C3J B;  4BBS B;  1VCI A;  3PMF A;  3OSO A;  4K6L A;  4CJ2 C;  3E6Z X;  2YU9 B;  1TWH B;  5D3I B;  3BVG A;  3K6O A;  3LX0 A;  1TR5 A;  2LMC B;  4IUN A;  4A3J B;  1AP0 A;  3S2H B;  4UDU C;  2JA6 B;  3EA6 A;  2RSN A;  2BDN A;  2IX3 A;  5M5W B;  1O7L A;  2B63 B;  3E0J A;  1ESR A;  2R93 B;  2AWO A;  3BYY B;  3TDQ A;  3BG3 A;  3P1H A;  2G9D A;  2K32 A;  5IT9 E;  1BOS A;  1SYE A;  5J22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...