1ILPA

Cxcr-1 n-terminal peptide bound to interleukin-8
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords PROTEIN (INTERLEUKIN-8 PRECURSOR)
publication title Structure of a CXC chemokine-receptor fragment in complex with interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ilpA00
1HA6A 1SDFA 1B50A 1MSHA 1S4ZA 2NZ1D 4OIJA 5EPLA 3FPUB 3KUPA 4XT3B 1EIHA 1TVXA 1CM9A 2RA4A 2RSNA 3IL8A 1RTOA 2NYZD 5COYA 1EIGA 1RJTA 2FMMA 1XX8A 4CJ0B 1DONA 2K1BA 2X6LA 1F2LA 2X6GA 4HCSA 1F9QA 3P7JA 4U68A 4DN4M 2EPBA 1AZQA 1CA5A 2HCIA 2VXWA 1A15A 1ML0D 3DM1A 4CJ1B 1WVLA 4IUPA 1IL8A 5EKIA 3SVMA 5CORA 1G2TA 1B2TA 4XDXA 1ZXTA 4QUCA 1X32A 1U4MA 4IUTA 4IUUA 4R9WA 2DY7A 1MSGA 1ICWA 4O42A 4X3UA 2L12A 3LWEA 4RWSC 1HRJA 1NCVA 2HCCA 1PFMA 2K04A 1PLFA 1U4PA 2KOLA 4XT1B 1XYIA 1B53A 3HP3A 1JE4A 2B2VA 2IL8A 2RVLA 3G7LA 1M8AA 4X3TA 5AFWA 5DNFA 4LMQD 4HSVA 1IKMA 1B3AA 2FJ2A 3Q6SA 4HEDA 1F9PA 1PDQA 5JJZA 2EE1A 1B4OA 2B2YA 4UAIA 2B2VC 2K05A 4ZLTF 2NWGA 2KUMA 1G91A 2MP1A 1WD0A 2K01A 4IUVA 2B2YC 1WTOA 3I90A 1QNKA 3TN2A 1WTRA 1AP0A 1J9OA 1EOTA 4X3KA 5EPJA 1O80A 3I8ZA 2X69A 2CVRA 2B2UA 1BNZA 1X3PA 4X3SA 1SAPA 1WTVA 5EJWA 3QO2A 3I3CA 5T1IA 5EPKA 4IUQA 1MI2A 1EL0A 5CBAE 1ILPA 1NAPA 1RHPA 3FDTA 2FINB 1WD1A 4IURA 5T1GA 2MPMA 1BO0A 2DY8A 2XIWA 2N55A 3GV6A 1WTQA 2K03A 2K28A 2Q8RE 1ESRA 2MJ8A 5D14A 4MHEA 3TZDA 1Q3LA 1X3QA 4NW2A 1G2SA 1C8CA 2JYOA 3D6WA 5CBEE 1SSOA 2KEDA 1WTXA 2L1BA 3DEPA 3R93A 4CJ2C 1GUWA 2KECA 2L9HA 1F9RA 1HFGA 2D9UA 1HUMA 1QG7A 2SDFA 3N52A 1DOKA 5D65A 1PFNA 2FFKB 2HDMA 2KVMA 4ZAIA 5E4WC 1VMPA 1U4LA 1ILQA 1WTWA 1NR2A 2B2TA 1HFNA 1IKLA 2B2UC 2FHTA 3IFDA 1MGSA 1NR4A 2L4NA 2B2WA 3ONAB 4MN3A 4OIKA 1CA6A 2BDNA 4RA8A 2MGSA 1J8IA 1AZPA 1WTPA 1DZ1A 3I91A 4ZK9B 2J7ZA 1F9SA 3H91A 2B2TC 2HDLA 2M2LA 2EOTA 1DOLA 1LV9A 1U4RA 2B2WC 3DEOA 2KEEA 3UI2A 5CMDA 2HUGA 2L11A 4ZKBB 1QE6A 4QUFA 3KBXA 1VMCA 2H1EA 4HAEA 1O7ZA 1HHVA 3MTSA 1DOMA 1KNEA 2RSOA 4ZKCB 1G6ZA 1PFBA 1JICA 1O7YA 4RAUC 1EQTA 5E4XA 1E0BA 1BBXC 3F2UA 2Q8TA 1HUNA 4R8IA 1RTNA 3GV3A 2N88A 1RODA 2R3ZA 5EQ0A 2JP1A 1BF4A 3MWYW 1KNAA
chains in the Genus database with same CATH superfamily
3FRPB 5KGUA 3VYUA 4KN4C 3JAME 3OYYA 4DR2Q 3T1HQ 1EYCA 2F03A 5IP7H 1DONA 2P5ZX 1VCIA 4DK3C 2EPBA 4B3MQ 1PVOA 2JA8H 1CKNA 4I7AA 4K6DA 1HNZL 1JJGA 1L1OB 3M7GA 1PTOD 1ZXTA 2CHBD 2XWJB 4QUCA 3NXWA 1ZYRD 2HD3A 3N6RA 3LWEA 4RWSC 1JJCB 1NCVA 3HOUB 3J81L 2IT1A 5LMUL 1Y1VH 1GUGA 2B2VA 3NPPA 5DNFA 1IKMA 4EQNA 4DR5L 4LF4L 4ULLA 1LTSD 4C3HG 4EX5A 2JA7H 1K83B 1Y8NB 4H44C 1X9NA 3TN2A 4LFBL 3CAMA 1T5EA 1OO9B 2DNCA 2B63B 2EXDA 1O80A 2OT2A 3O13A 5D3IB 1RKNA 2E2HB 3HOVH 3I7FA 1V1PB 3MEHA 1SN8A 5M3FG 4POGA 1EY0A 2UU9L 3HKSA 1OTCA 4X62L 2QDLA 1X3GA 3D4RA 1IBLQ 3NELA 1SYGA 4DV5L 4DV6L 2K28A 1JB3A 2Q8RE 4RGMA 4IN3A 2QKIC 2NVTB 2XTIA 4A3MG 4BBRH 3T4AC 2E5LQ 2V4DA 2JA5H 2O5JC 2VUMH 2WFWA 3EBEA 5GAHC 3J7AV 1LTBD 2RCFA 5IYCG 4GZYC 3N52A 3AB9A 1L1OC 2QGQA 1E22A 1SFOH 1EFID 1L0YB 5FJ8H 1MGSA 5I2YA 3RNUA 1JWMD 1EEID 3GTJB 1U4RA 2B2WC 3F2DA 1VQNA 1JOOA 1WCMB 2GVBA 4UP8A 4A3LG 1XTCD 1O7ZA 1CHQD 3TS0A 1G6ZA 1JICA 2Z6KC 4RAUC 1I4QA 3Q0AA 1IYVA 4A3DG 4J8QA 4A3IH 2N88A 3S17H 1NMFA 1UAPA 2UXDQ 1PFSA 1TWFH 4A3KH 1QWYA 3SEBA 2RSNA 1HZAA 1G6PA 1EIGA 2K14A 4K2KA 5C3EG 4HJ8A 1S3OA 2K1BA 4QIWE 2VXWA 1XNQL 1I5FA 2EJFC 4IUPA 3SVMA 1EIYB 4FVMA 2K33A 3A56A 3CMAA 1G291 3GTGH 2CH4W 5C0XG 4C3JG 2R7FA 1GKHA 4A3BB 5BR8L 2EYFA 3SHLA 5M5XB 1IL2A 1XYIA 3I4NB 5JPMC 3HP3A 4TRDA 5HGTA 2FJ2A 3K7AH 2PNRC 4CBVA 2F0PA 2F4IA 2VQFQ 1ESFA 5KRUA 1QVGA 2NTTA 3ER0A 1VQFA 3F2CA 3ICEA 1HNWL 2CVRA 4QCLA 2AQ2B 3M85A 1SYCA 3BYTB 1QVCA 3BDCA 3QOLA 3PIP3 1FJGL 5CR3A 3RLOA 4KV6A 5GROA 2ZTDA 3MXUA 1VQKA 2N55A 2HHHQ 3J7AF 4DV3Q 4FNFA 4K2LA 3TSSA 2Q2UA 4A3GB 2KEDA 1K8MA 2MFIA 3K58A 3TDQA 4CJ2C 5A2QL 4B3TQ 1UUPA 2B8GA 1MJEA 3HOXH 1DOKA 2VQEQ 1F2MA 1VQ9A 2B63G 4FO2A 3GQBA 3SGIA 4LF9Q 3S2DH 1IKLA 1QILA 2ALYB 1TIID 3PMFA 1PH7A 4ZK9B 3S9WA 3CQZH 4IOCA 1RDPD 1FR3A 1EU4A 1EYGA 1CSQA 1VQ8A 2KQ3A 1IXRA 4MTNA 4BY1B 1HHVA 2DGYA 1KNEA 1LTID 4XYQA 1GUWA 1PFBA 1O7YA 2F0DA 5CV7A 1BBXC 3OMCA 4KHPL 1HQMC 2ATWA 3M3YH 3K57A 1JT8A 1HXYD 5EPLA 1C7YA 4NXML 4OONA 1CM9A 3RN2A 1Y14B 1EY5A 2ZJQA 2FMMA 3MFGA 1F2LA 1BBWA 5BN5A 3GTQB 2ZTCA 1G8ZD 4FYDA 1K0SA 4F7XA 4XDXA 1TT2A 3GDEA 3E3XA 2FMCA 2JXMB 5JPNC 3KDFB 5C44B 1KIXA 3TMEA 2L15A 2L12A 1I50H 2I46A 1FNWA 1T9HA 3QR8A 1U5KA 2TSSA 4JBWA 1CSPA 3I72A 2A8VA 2PZTA 2A68C 3GTOH 1M4VA 2CQOA 2D0PA 4ZLTF 5DLQE 4KK7A 5LL6S 3IRBA 3U9OA 1TS4A 2I5HA 2R92G 4GLVB 1E2WA 3I8ZA 2X69A 3KLSX 1TY2A 4A3JH 3EJIA 2ES2A 4NDXA 4LF5Q 2RQXA 2ZXOA 5EJWA 4C3IH 1EQVA 4GN3B 3F2BA 3PQIA 2KCCA 4QIWB 1Y1WH 4A3FB 2RHSB 4G7OC 4ZRZA 5GQOA 3GTLH 1KC8C 4OHJA 1H9RA 2E75C 1SROA 3MZ5A 1TY0A 1G2SA 1YNJC 1EQRA 4HN7A 4UHVA 4DV0Q 4B3RL 1XJVA 3H0GB 3VDYA 2D9UA 1BDOA 4JI7L 2XRSD 3V05A 4JI2L 4ZAIA 1PTOF 2L0CA 1WTWA 5J22A 3CCMA 1OXXK 2MO0A 1ENFA 4LUOA 2A1AA 4BA2I 4NPSA 4J6HA 3JAMi 1DM0B 3PO3B 3RMHA 3VR5A 4JI1Q 4HMIA 4C1NI 1DOLA 5IP9G 3P75A 2KEEA 3UI2A 3SDZA 1PV4A 3A5UA 1E1TA 2E5LL 2K5NA 3T13A 2R7ZH 3BDOA 3Q22A 4Y7NB 3DXJC 5F2DA 1NSNS 4IPHA 4PNYA 2UXCQ 1CI3M 1LACA 4G57A 1JJ2A 1J6QA 2NZ1D 1JC7A 1CQVA 3IL8A 3VA5A 1W6JA 2N78A 1XX8A 2WB1E 4DAPA 4DFAA 1SMYC 4DV1L 2XRQD 2HCIA 3QB3A 1ML0D 2Q8IB 2CCZA 3AEVA 4B9WA 2AWNA 1HNZQ 5M5YB 1Y69U 3SR1A 4F88A 1PYSB 1S5FD 1Q12A 4J15A 2R93G 1LM0A 4OO1H 4BY1G 2BE5D 2N3SA 1QUQA 2IHFA 1KDBA 3NBHB 5LMUQ 1XPOA 2Z6BA 4ZYSA 5M3MB 1EUJA 1KDCA 2EDGA 2PO4A 2F0TA 3A7LA 2LFNA 4B9XA 5JJZA 4DR5Q 4LF4Q 5C4JB 2UXBL 2K32A 1EY7A 3RZDB 1O7IA 1VDZA 3HGBA 4EQOA 4IFDH 2K01A 2PMZE 4O0AA 4LFBQ 1JCKB 4A3EB 5L37A 2B3GA 5IT9c 3CCQA 5C5LA 1DJRD 1B3QA 1FNVA 4PMWA 3TBIB 1LO5D 1EEFD 4K14A 4DR7L 5C44G 2UU9Q 3FHWA 4X62Q 4GKKL 1WD1A 4IURA 1F2YA 4DV5Q 3WWVA 4DV6Q 1SJED 4H13C 2V1CC 1STAA 1D7QA 3TP7A 2JYOA 5A35A 3PUZA 4YIJA 1ICFB 2KHIA 1C0AA 2E2IH 4G7ZC 1WI5A 1R4QB 1RCVD 4MNOA 4CDDC 2NVXB 1K3RA 4WJ4A 1TWAH 1PMRA 1DXMA 5I2XA 3U4VA 4AQYL 1J8IA 2MQHA 2RHQB 1F9SA 4A3FG 3GTKH 1PTOB 1WTHA 2PW7A 4TKOB 4RH6A 4FXDA 1IW7C 3NHHA 3KLSA 5K36G 1I4XA 1LLRD 2A69D 4NP5A 3I4LA 2E2IB 3L7ZC 3H0GG 1QZGA 4CKEA 1FVIA 3CCUA 2XGTA 4C2MB 2KHJA 2ASBA 3HOYH 3S15B 2SNMA 1LABA 1EOVA 3K7UC 2OXPA 2KCMA 4KKUA 1TR5A 2IX3A 5IGBA 1X65A 1BKBA 4CJ0B 1JWSD 1SEBD 2K5QA 4LUZA 4U68A 5KEEA 3PO3G 1XMOL 3DHQA 4FDBA 4L5QA 1XNQQ 2OQ0A 4RKBA 4RCNA 4YY3L 1I6HH 1BOSA 1B9MA 2Z8LA 3BZKA 2JA6G 1X32A 3RN5A 1U4MA 1WJJA 5M3FH 3NENA 4O42A 1YJNA 1D6EC 1MBYA 5BR8Q 3I4MG 3JAMc 2O4XA 2OTJA 2NVYH 3NQIA 2SOBA 4KY5A 2F0EA 3RUZA 2LXKA 3D4WA 2VNUD 5H1SE 2BH2A 1AW7A 4A3MH 3VA7A 4UAIA 3EFXD 4C3HB 1VF5C 1J5EL 1NY4A 1W6KA 4K0KL 1G91A 3PUXA 5IYCH 1HNWQ 2EY2A 2DNEA 2EIFA 1J9OA 1B8AA 1PTOC 2F0OA 4TSSA 4X3SA 1I94L 1ZYRC 2WKDA 3K5OA 1A6XA 3GTMB 5T1IA 5LMNW 2WB1B 3OPOA 1FJGQ 1TWGH 2NVYB 4RGOS 2EY1A 2M00A 1RHPA 3MC0B 4QF4A 1EWIA 1XPRA 3K59A 1AFPA 5M3MG 2K03A 1AE2A 2MJ8A 4A3LH 1CHPD 3NTHA 1Y8OB 2DUDA 3C3LA 4O2DA 3URYA 5IWAL 1W3SA 3JC66 4A3DH 5C5MA 1L1OA 3UE0A 1HUMA 2K4KA 1YVCA 4CKBA 1PFNA 4A3EG 3HFZB 3KYHC 2L55A 1SNPA 3A0JA 3G48A 3DM3A 4ZUJA 1HFNA 1CKMA 1X56A 4KJOA 5C3EH 2B2WA 1E1OA 5FLXE 2BDNA 1S40A 1HA5A 4JI5L 4DUZL 1NE3A 2PMZB 3PUWA 1VQ6A 2CQAA 3HOWG 1GUSA 2I0QA 1QE6A 2D2CC 1X3EA 3S1MB 4C3JH 2KCNA 3VYRA 3A74A 3PGZA 3H3VI 4HIDA 3R2IA 3IKJA 4KHPQ 3GV3A 1ONLA 1GUOA 1RODA 2OWOA 2MPMA 1N34L 3NE5B 1R9TB 1PH2A 4NXMQ 1S5CD 2F0VA 2VB2X 3KBGA 2ZT9C 1Z7TA 1K28A 4YCUA 4CJ1B 1VQEA 1K3BC 4XIGS 1JR0D 3GP7A 1Z47A 4QMGA 3TQYA 4UDUC 1G51A 5E7NA 1HRJA 1LT3D 5KYLA 3HOUH 2HQLA 2A6HD 1PH8A 4UP9A 4IZ8A 4JC0A 3Q6SA 1B3AA 4HEDA 2PZUA 2Q2HA 2EE1A 3GO5A 3MFYA 4QB4A 1UE1A 3VYTA 3RR5A 5I4DA 1K83H 2EYPA 4NXNL 2EZVA 2B63H 3P1HA 3VYSA 4DAVA 3FP9A 2E2HH 3E9HA 3E9IA 3ND8A 4DR6L 1TQOA 2Z4IA 1LTAD 3F8TA 1ASZA 4BY7B 4QL5A 1WYDA 1VQMA 1BO0A 2DY8A 1N36L 4OO1I 4H02A 2HIVA 2NVTH 4K5VA 1HR0L 3NQTA 1ZEQX 3RLNA 1UEBA 4B3RQ 4KD4A 3AU7A 1R4PB 4C56C 1F9RA 1XMQL 1SYDA 4J1MA 4JI7Q 3DWPA 4JI2Q 3QG1A 2YTVA 4DK6C 1Q1EA 4JOIC 4GLAC 4MN3A 5JAVA 4IFDI 1NR4A 1GO3E 4JW0A 1KTKA 1QCBD 1QJOA 2WB1G 2J7ZA 2CWAA 3GTJH 2DJFC 4KJNA 1VQBA 1ZKOA 1YJ9A 1WCMH 4V0BA 1LYLA 2JJQA 2XSCA 1JQYD 1STYA 3F2UA 1VQPA 3D8GA 1RTNA 2F0SA 2OTLA 2AUJD 5CV6A 2PNHA 1BF4A 2EYOA 4XQJA 3FPUB 4EQ5A 3M4QA 4ABNA 5C4XB 1KRTA 1RTOA 5COYA 1ET6A 4F87A 1CA5A 3R3OA 2Y0SE 2DJGC 4DV1Q 1AZQA 5BN3A 1GJXA 1B2TA 2N49A 4IUUA 4LNQA 4DNTB 4X65L 1STEA 4ALPA 3CF5A 3OW2A 4A3BH 1L0WA 1CT1D 2QF7A 3SE0A 4YWKA 3RLFA 5M5XH 4BBSB 1U4PA 4GLXA 1XPUA 3I4NH 2NVQB 2RVLA 4X3TA 1E7ZA 4IFDJ 1F9PA 3S1NB 5IGDA 2UXBQ 1YBYA 4ZQ3A 1D5XC 5IY0A 3H94A 4R8NA 3WOEA 3HKZE 1QVFA 2R92B 1TXYA 2KHSA 1V43A 1A3VA 2PZWA 3I90A 1QNKA 2Z9HA 5EBCA 4CKCA 4A76A 1FGUA 1VQGA 5M5WB 1EOTA 1A0IA 2NUCA 1I4HA 5JEAH 3CP0A 4DR7Q 3BU2A 1GM5A 4KMUC 2G5DA 4WJ3M 2VW9A 1OXUA 1STBA 2B29A 2WAQE 4GKKQ 1NAPA 2FINB 2IHEA 1TS5A 3E6ZX 4YWLA 5T1GA 4CDFC 5IP9H 1QB5D 2F0UA 4HJ5A 5ELNA 1I4RA 4GNXB 1ESRA 5D14A 2QILA 3T51B 1XWEA 3U4ZA 1JB7A 4OL7A 1PZID 4A3GH 4HJ7A 1DGSA 1Q8KA 3BVGA 1H9MA 4FF3A 3EA6A 1SXTA 1Q8IA 3TZUA 3FKIB 3KDFA 3CU7A 5FO7B 2FFKB 5IT9L 4IOAA 1I4PA 4Q5VA 1NR2A 3SK6A 1CZWA 4AQYQ 3DUZA 3I91A 4F8MA 4BY7G 2B2TC 3RZOB 4GS3A 1XXGA 4BY1H 2XWBB 3OWFA 1VQ7A 1K73C 1A63A 1K8OA 4LFCL 3V2TA 1HUNA 3I56A 1RIPA 4JPBW 4A75A 4R1JA 1EIHA 1MJCA 3F1ZA 4L8JA 1FGBD 4N8FA 3TRZA 4HCSA 2EJGC 3EQLC 3GTQH 1KRSA 3SK5A 1XMOQ 1TWHB 2NN6I 3S1QB 4YY3Q 2RDGA 2R93B 4R4CA 2F0JA 2VS1A 4GNXC 3MA2B 3NK9A 5C44H 4JI6L 4RMFA 4LF8L 1TWCB 4X3UA 2BA1A 1Q81C 2IWHA 3ULJA 3OSOA 3BZDB 3UDXA 3PO2B 3K5NA 4UY8C 3CCEA 5J1ZA 4P74A 5GADC 5C4XG 4N9TA 4AIMA 5G3LD 4L5TA 5K5PA 4DA2A 2D0OA 1J5EQ 4TVAB 1EWCA 2KUMA 1CFMA 4K0KQ 4RKLA 2BH8A 1PH6A 1CKOA 2B2UA 4KY6A 1STHA 2JQOA 1M90C 1I94Q 2B39A 4KKTA 1JE5A 2JSOA 4HIMA 5LL6X 2BE5C 2RDFA 3S2HB 3JAML 4DR1L 4A3FH 2OEOA 3CMEA 5LHY1 3J7YW 4BBSG 2A6ED 3D3RA 2J0TD 4JI4L 4I7ZC 2LY7A 5J3BA 4XTCS 4DV4L 5K36H 1UEAB 3A8KE 3L9AX 3K5MA 1ASYA 2NZHA 1PH9A 4IALA 5IWAQ 2K7VA 1I4GA 3H0GH 2L9HA 1KHIA 3S16B 2VUMG 1QG7A 1VMPA 1ILQA 1TKWB 2FHTA 2Z0SA 1QZHA 3HKZB 4P2CB 3NBHA 4JBJA 3PO3H 3IFTA 5FJ8G 4JI5Q 5FK9C 2EVBA 4DUZQ 5FLMG 3DLLA 2CW0D 3M4OB 1EWHA 2F4VL 4PMBA 1Q86C 3Q24A 4RCOA 3QJYA 1I3QB 1D1KA 3HOZB 2NTSA 2AUKA 1H9SA 2YTXA 4Y7NH 5ELBA 4LF6L 2WAQB 3OWEB 5IODA 4QQBX 3R2TA 5EQ0A 3R93A 1N34Q 3MWYW 4A3IG 1X3FA 4ME3A 2BOSA 1IBML 4OIJA 1B50A 4PQXA 3FKIG 3L3OC 4NMZA 3KLRA 1PH5A 4FP5D 1YNXA 1YHQA 2X6LA 3BVMA 4UPAA 5IYDH 5KNDA 2JA6B 5EKIA 5M5YH 3T1YL 1STNA 4JI3L 4P72A 2XNAC 1YNNC 3I4MB 4DR4L 2A69C 4JI8L 1S5DD 2J4XA 4XT1B 3BZCA 1BR9A 1S72A 5M3MH 3C1FA 4JV5L 3CXCA 5CV8A 1SE8A 2R61A 4GOPB 2EYMA 2PQAA 5C4JH 3HRZC 3S1RB 3RZDH 5IE8A 4NXNQ 1X55A 4A3EH 4X66L 2TMPA 1BNZA 1X3PA 1U0LA 1SAPA 4DUYL 2AWOA 4X64L 3I3CA 1PH4A 4DR6Q 2VL6A 1GOZA 1VQJA 1EL0A 5HY6A 1PH1A 2NB0A 1LT6D 3PO2G 2LSSA 3GV6A 1N36Q 2AMCB 4BWGB 1EY8A 1X3QA 4ID6A 1HR0Q 1SMXA 1SE4A 2SNSA 1WTXA 1H9SB 4HJ9A 2BA0A 2R6GA 1XMQQ 4U673 5DM63 2SDFA 3HS0C 3KF6A 4MZ9A 5M9OA 5JVH3 3OOCA 2NVXH 4BXXG 1N33Q 3Q23A 4S3SA 3M4PA 1KAWA 2B2UC 3J81E 4DKAC 2MGSA 2Y0SG 2HDLA 3CRLC 3ND9A 3HOWB 3CCLA 1MD2D 1VQ4A 3NEMA 4KD3A 3D6CA 1YITA 1PTOH 1S5BD 1LT4D 5ELCA 4B3SL 3H3VC 4HAEA 4X6AH 2MUYA 3MTSA 3PIOA 4GOPC 3K8AA 1H9JA 1HZCA 1STGA 3ULPA 1D2BA 4IPDA 3PUVA 5IGGA 4DV2L 3CC4A 4DU9A 4RFBA 5FLXc 4C2MH 3S15H 2NZOA 1S4ZA 1V8QA 5I9PA 4XT3B 5AJ3L 4GKJL 4GN4B 4DK1A 2PQAB 5IYBG 3HKZG 3UDIA 1F9QA 2UUAL 5FO9B 4HTHA 1A62A 1SNCA 4ME5A 2K6AA 1IL8A 4ZCKA 4H7BA 1YNND 3HOZG 4X65Q 1S5ED 1GVPA 2F0NA 1V9PA 2QA4A 2VB3X 2WAQG 2KOLA 4YCVA 2D5DA 4OGQC 2ZJPA 2EQSA 5ELEA 1NBWA 4OEMB 4RGNA 1JMCA 1CTMA 1RF2D 3CC7A 4P75A 4C3HH 1N32L 1LTLA 2D62A 5JEAJ 1OXTA 4DAMA 4IJHA 4JBMA 4WORA 3AMUA 3FEWX 2EY6A 2BDOA 3KF6B 3CPWA 3GTMH 3OW7A 2JE6I 1PZKD 1MI2A 3KJOA 1N8RC 2A6HC 2A19A 1PHJA 4A3CG 2G9HD 4PG3A 4FF4A 3NWSA 1F2ZA 1Q3LA 1YIJA 1NTGA 1HZ9A 3OTOL 5ELDA 2E2JB 2L1BA 1CUKA 2KECA 2HT1A 2PI2E 3CKIB 3A8JE 1LTGD 3HZXA 4JOIA 1VQDA 4WJWA 1CK1A 3AYHB 5E4WC 1EQQA 3LNNA 3P20A 2K52A 3EN2A 3PV0A 3BVZA 4H0LC 1KXLA 3TP6A 1B9NA 3NUCA 3STBD 1AZPA 5GAGC 3BG3A 2OCEA 4N8X1 1VF7A 3DEOA 1MHWC 3CCSA 3VR4A 3M9BA 1LTRD 2HUGA 3X3MA 2IPKD 3KBXA 3S1MH 1VMCA 4PV1C 1Z6HA 4LFCQ 2XVSA 5G3LF 4BS9A 4K8JA 3PF4A 2E2DC 1SRUA 1VQAA 1R9TH 3NWTA 4KI0A 4JYAL 3KUPA 5CGKA 4YCWA 2O5IC 2JEBI 1RJTA 4FF1A 3BS1A 2UUCL 2E8GA 1BXTA 1P8LA 3CC2A 1D8LA 1UNSA 5CORA 5C0XH 4LW1A 2E76C 2EYJA 4XYOA 4JI0L 2DY7A 5EAYA 4JI6Q 4MIUA 3LWUA 4L63B 4LF8Q 1NUCA 1DCZA 4OO1G 4DF7A 2L5TA 2IL8A 4HCEA 1YHAA 2F0WA 3CPFA 5ISRA 1O78A 2PYKA 3J80E 1PRTD 4LJZC 2EY5A 5KNCA 4HMJA 3PF5A 1K0RA 1WD0A 4V190 2B2YC 2YV5A 4IFDG 1ENAA 3GTPB 1VQ5A 4P73A 3TP5A 4DXGA 1HH2P 4BY7H 3ZYYX 4DR1Q 1LUZA 1OXVA 2XN9C 1IYUA 4JI4Q 3T53B 2XIWA 3PUYA 3MAQA 2E74C 4MHEA 1OXSC 5E1FA 4DV4Q 1B7YB 2PPBC 1C8CA 3D6WA 1SSOA 2O2LD 3DEPA 2YU9H 4DR3L 2PQEA 4WFN3 4A93B 5I6WA 3A8IE 4HR7B 2RKSA 4RHSA 4CDCC 1FL0A 2B2TA 4TQUS 4NB3A 1CA6A 4FF2A 2QCPX 3VR3A 5FKAC 3S14B 2M2LA 2F4VQ 1BCPD 3CRKC 1TS3A 2KENA 3QOJA 4QUFA 3WDNA 1GHJA 3PCOB 1MIUA 2LXJA 3WOFA 2YU9B 1PXUA 2WACA 2Q8TA 3C2PA 4LF6Q 4DAYB 2HQEA 1Q7YC 3W5OA 4KY7A 4QY7A 1IBMQ 1Q46A 2KCTA 5JVG3 1N33L 3HOYG 5C4XH 1KQSA 1D5ZC 4LK1C 1CZGA 1VQLA 1DD2A 3P7JA 4OX9L 3VR2A 2JA8B 3K6OA 1A15A 4LAAA 4GNXA 2ZM6L 3T1YQ 2LKVA 4DV7L 4Y52H 1SR3A 4JI3Q 3HG9A 5CV5A 4DR4Q 4PZ7A 1AE3A 4JI8Q 2K04A 1SE3A 1IZ6A 4BBSH 3B6YA 1PLFA 5C4HA 5IIFA 1Y1VB 3T56B 5FO8B 2NVQH 3A55A 2WP8J 1KLUD 4JV5Q 2UUBL 3S1NH 1B4OA 1GUNA 3S24A 2K05A 1LTTD 1LT5D 3LGJA 4Q0FA 5IGEA 2JA7B 1EU3A 2R92H 1HCZA 2A74C 2K50A 5ELOA 5M5WH 4QGUA 4IPCA 4X66Q 3E5SA 4ILWA 4L5RC 1AH9A 3HOVB 1KD1C 4DUYQ 3QO2A 4X64Q 1JWUD 1IBKL 4KTAA 4M8AA 2RBMA 2WV6D 2CWPA 5FLMH 2A73B 1ENCA 3J81i 5JOBA 4IQZA 5LMNL 3E0EA 1ET9A 1PH3A 4ZUIA 1WTQA 1CKNB 1K8GA 4DXFA 3PIPA 4HIOA 4BBRB 4JBKA 4NW2A 5BN4A 5CBEE 2JA5B 2LMCB 4AYBE 2VUMB 3H09A 2ICEC 2H5XA 3MXNA 2HIXA 3FKIH 1JOQA 2GN5A 3ERSX 1SFOB 1EYAA 3IFDA 2NN6G 3ONAB 3FPPA 1DZ1A 1HNXL 2R7DA 2A6EC 4CHTB 3RZOH 4Z9CB 3G6EA 4LFAL 3DWAA 1EZ6A 4B3SQ 1PZJD 1DOMA 4FXGC 1Q90A 3UDFA 2IW3A 1SNMA 1L0XB 2AHOB 4YWMA 2CH4A 4A3IB 3S17B 4DV2Q 4A93G 2C5CA 1KNAA 4K5WA 4DNRB 1TWFB 1YI2A 1VQOA 4A3KB 1D1IA 2EYLA 5AJ3Q 4IPGA 3G71A 4GKJQ 1Z9FA 4NKLA 1PYBA 4C1NK 1TU2B 1UWVA 2X6GA 2EXZA 2UUAQ 4LUVA 2CW0C 3C1EA 1TWHH 1QOHA 3S1QH 3HEJA 5IGFA 2R93H 5NUCA 3R8BA 3GTGB 3W3AA 5KIXA 4IUTA 4R9WA 4MTKA 2SEBD 2AQ3B 5EKKA 2ZTEA 1TWCH 2H4OA 2MNAA 2K5WA 2I5LX 4E6IA 1P16A 5FLXL 3HOUG 3PO2H 4PZ8A 5CV4A 1I6VC 2F0KA 2G9DA 4HSVA 3ERQA 3VR6A 3K7AB 3D4DA 3MXPA 4ODGA 1N32Q 2B2VC 4JG2A 1NJIC 5IP7G 4K5XA 2DN8A 4HJAA 4PZ6A 3NP8A 3J7ZC 3DMUA 2JA8G 2IX1A 1N9WA 4X3KA 1XNRL 1MKHA 2I5MX 3MXNB 3BJUA 5I6YA 4BXXH 3CCRA 1TS2A 5KNBA 4LF7L 5EPKA 3E0JA 3S2HH 3EVQA 4OWTB 4CDEC 1KLGD 1ILPA 2WKCA 2I07B 5C0XI 1EY9A 3FDTA 3I73A 3J80L 5DEHA 1O7LA 1Y1VG 5JJIA 3OMGA 2N8NA 5IGCA 3D31A 5JJLA 3OTOQ 4IJLA 1EFWA 3MHBA 1BUVT 2OQKA 3S16H 4YHHL 2JA7G 3ITPA 3NSWA 3HOXB 5D65A 2F0QA 1SNDA 5EBDA 3A7AB 2IY5B 1GUTA 2A5HA 3S2DB 3TP8A 3HOVG 1E24A 2L4NA 4L6TB 1E3PA 2QW7A 2Y0SB 4KHVA 5IYBH 3MEFA 3OIPA 5ELFA 1HPCA 3CQZB 4R4TA 1V1QA 2F3VA 2EOTA 3LX0A 1V1OA 1YEZA 3U50C 4GOPA 3M4OH 3BDLA 4HIKA 2ENBA 1I3QH 3TEHB 3HOZH 3KF8A 1WCMG 1YHBA 1A2UA 4BBRG 1PRTF 4ZKCB 3KOJA 2JA9A 1E0BA 1HZBA 2JA5G 3J81c 4A4IA 1RL2A 2R3ZA 5CV9A 4BA1I 2JP1A 3M3YB 3K0XA 4IUVA 1HA6A 5D3DA 4JYAQ 4XQQA 4DR2L 3KFUA 2EYHA 3RD4A 3T1HL 1UE7A 4AYBB 5C0XJ 1W2BA 1GHKA 2UUCQ 4KLKA 4DN4M 4B3ML 4R4OA 3J80i 3CCVA 4XXEA 3W1GA 4AH6A 3C46A 2JA6H 3I70A 3SXHA 3W2DA 3J81j 4JI0Q 1L2FA 3I4MH 5EGTA 3AFQA 2FXQA 1PYWD 1I50B 1RD9D 1VQHA 4A3BG 1PFMA 4HSPA 4EQPA 2F0HA 3EIVA 3NBIA 5J39A 3MXGA 4A3CH 1M8AA 1BVSA 1SNQA 3H3VH 3I4NG 4A3KG 3GTOB 2K5VA 2YYZA 3S1RH 1IYJB 2VZAA 3NTIA 1NMGA 2B8FA 4FXKC 4P71A 1A8VA 3T16A 1BCPF 4A3JB 3TREA 1DYQA 4C3IB 5JEAG 2MO1A 4RG1A 2K5DA 1Y1WB 5CBAE 3J7A5 2KA7A 3GTLB 1VS0A 1IBLL 1U9RA 3K0YA 4XQNA 3TZDA 2Z1CA 5HURA 1SYEA 3KF8B 1SBBB 2LS01 4UP7A 1YZ6A 4DR3Q 3H15A 4A3GG 1HFGA 1WOCA 2GA4B 2HDMA 1B44D 5E3FA 4R4QA 3U9SA 5C3XA 4RA8A 3I4OA 1SYBA 1D5MC 3K80C 5TSSA 2ICIA 3HOWH 1Y8PB 2L11A 2K75A 2H1EA 5DAUA 5I9OA 4L5SA 1WFQA 2R7ZB 4O1NA 1E2VA 3CW2C 2F52A 1Q1BA 4GN5A 5FOBB 3QWNA 1SDFA 2BCOA 3HOXG 2UXDL 5KYIA 1PRTB 2Q2IA 4IO9A 2A68D 2JK8A 4DGZA 4EVOA 3M4YA 2F3WA 3A5ZB 3U58A 3STBC 1H9KA 1H95A 3FVQA 4OX9Q 3DM1A 3CCJA 1KABA 2ZM6Q 1WVLA 2F0MA 3H6MA 1G2TA 4DV7Q 1C4QA 4N9PA 1YJWA 1MSGA 1ICWA 3I2ZA 2JN4A 3G6JB 2HCCA 4JVZA 1HTLD 2AKWB 3W1BA 1B53A 5AFWA 3A54A 1AP0A 5GAEC 4LMQD 2UUBQ 1SE2A 1JOKA 1PDQA 2OF1A 2VQFL 2PW5A 1II3A 2B2YA 3GD7A 4OELB 1YNJD 2AQ1B 1A3TA 1C9OA 4AYBG 2NWGA 3KJPA 1F77A 1VQIA 2MP1A 4APVA 1WTRA 5EKLA 1X54A 1EIFA 1UE5A 3MVVA 2K5HA 1BBUA 1XTDA 3G4SA 1IBKQ 1M1KC 2RCNA 1UE6A 5CYUA 4DK0A 3J80c 1BCPB 1X6OA 2ID0A 5LMNQ 1HR0W 2HHHL 1K9MC 5C3WA 2F3IA 1AN8A 4POFA 4DV3L 4PMCA 2ZJRA 1PRTC 5C6AA 2EJMA 2E2JH 4B3TL 2F0FA 3NTKA 4OWXB 1NNXA 1E2ZA 2VQEL 1GD7A 3KK7A 3UE1A 1QUQB 3AQQA 2KVMA 4LF9L 1QNUA 4A3JG 1TWAB 2IJ0A 3D0FA 4G4KA 4C3IG 4WRDA 1SLJA 2Z4HA 2RF4A 3PIO3 1SMYD 4LWCA 1Y1WG 1HNXQ 3GTKB 1LV9A 1FNUA 3CHBD 1SNOA 4LFAQ 4ZKBB 3OHXC 1HTPA 1HJPA 2IX0A 1B1ZA 1EQTA 2F0GA 2VY3A 3V96A 4QJFA 4R8IA 4JCVE 3TS2A 3ZJYC 3HOYB 1MSHA 2KBNA 4EGVA 1TVXA 1AEXA 2RA4A 2F0LA 2NYZD 2C9OA 1T5XD 5DM73 3I55A 4G7HC 4KHZA 3Q8DA 5CC4A 3ULLA 2KJXA 3OIQA 1BCPC 2NBFA 2QDBA 1I6HB 5IYDG 1GXDC 1CQFA 2ZXPA 3X3NA 1KL9A 5M3FB 1A3UA 1EY4A 4KN7C 2YTYA 2R7ZG 1FD7D 2QEXA 5IT9E 1VQCA 2F1MA 4B08A 3EROA 1JE4A 1PA6A 3G7LA 2M9VA 4RGTA 2C35B 3FMCA 3L2PA 4A3MB 4DPGA 4OWWB 1SJHD 4K8IA 4DNIA 3QIAA 1WTOA 3DWQA 3SK8A 5EPJA 5C4ZA 1XNRQ 5A2QE 1K8AC 1EZ8A 3GTPH 4LF5L 1WTVA 1B70B 4RHRA 2NN6H 3SK4A 4LF7Q 1KDAA 2PCFB 4IUQA 1TWGB 4DAYA 3K5LA 3CD6A 1Q82C 2JEAI 1EYDA 4IUNA 4CGYB 3M7NA 2Z6KA 1IW7D 4JK1C 1A2TA 1HQRD 2MHVA 2F0IA 2PI2A 4DV0L 3BYYB 3AFPA 2QEJC 4A3DB 4YHHQ 3IAYA 2GVAA 4KKSA 4A93H 2WIIB 4M1UB 4OXPA 4K6LA 1BQQT 1V1PA 1U4LA 1C48A 1JORA 2CKZB 1IHZA 3K81C 4OIKA 3PSIA 2CFMA 5C3EB 3L0OA 1WTPA 1EY6A 3H91A 5IOCA 4JI1L 3S14H 3UDGA 5CMDA 4R4IA 4I65A 2Q2TA 2RDHA 2ZXRA 4C3JB 1FYCA 5JJKA 1SYFA 5HGQA 2RSOA 5E4XA 3KLWA 1KAAA 2UXCL 2WINB
chains in the Genus database with same CATH topology
3FRPB 5KGUA 3VYUA 4KN4C 3JAME 1EYCA 2F03A 1DONA 1VCIA 2EPBA 4K6DA 3M7GA 1PTOD 1ZXTA 2CHBD 2XWJB 4QUCA 3NXWA 1ZYRD 3N6RA 3LWEA 4RWSC 1NCVA 3HOUB 3J81L 2IT1A 1GUGA 2B2VA 3NPPA 5DNFA 1IKMA 4EQNA 4ULLA 1LTSD 4C3HG 1K83B 1Y8NB 4H44C 3TN2A 1T5EA 1OO9B 2DNCA 2B63B 1O80A 2OT2A 3O13A 5D3IB 1RKNA 2E2HB 1V1PB 3MEHA 1EY0A 3D4RA 1SYGA 2K28A 1JB3A 2Q8RE 4RGMA 4IN3A 2QKIC 2NVTB 3T4AC 2V4DA 2O5JC 3J7AV 1LTBD 4GZYC 3N52A 3AB9A 1EFID 1L0YB 1MGSA 5I2YA 1JWMD 1EEID 3GTJB 1U4RA 2B2WC 1JOOA 1WCMB 1XTCD 1O7ZA 1CHQD 1G6ZA 1JICA 4RAUC 1I4QA 3Q0AA 1IYVA 4J8QA 2N88A 1UAPA 1QWYA 3SEBA 2RSNA 1EIGA 4K2KA 2K1BA 2VXWA 2EJFC 4IUPA 3SVMA 4FVMA 2K33A 3A56A 1G291 5C0XG 4C3JG 4A3BB 2EYFA 3SHLA 5M5XB 1XYIA 3I4NB 5JPMC 3HP3A 4TRDA 5HGTA 2FJ2A 2PNRC 4CBVA 2F0PA 2F4IA 1ESFA 5KRUA 2NTTA 2CVRA 4QCLA 2AQ2B 3M85A 1SYCA 3BYTB 3BDCA 3QOLA 3PIP3 5CR3A 4KV6A 3MXUA 2N55A 3J7AF 4FNFA 4K2LA 3TSSA 4A3GB 2KEDA 1K8MA 3K58A 3TDQA 4CJ2C 5A2QL 1UUPA 2B8GA 1DOKA 1F2MA 4FO2A 3GQBA 1IKLA 1QILA 1TIID 3PMFA 4ZK9B 3S9WA 1RDPD 1FR3A 1EU4A 2KQ3A 4BY1B 1HHVA 4XYQA 1KNEA 1LTID 1GUWA 1PFBA 1O7YA 2F0DA 5CV7A 1BBXC 3OMCA 1HQMC 3K57A 1HXYD 5EPLA 1CM9A 1EY5A 2FMMA 3MFGA 1F2LA 5BN5A 3GTQB 1G8ZD 4FYDA 4F7XA 4XDXA 1TT2A 2FMCA 2JXMB 5JPNC 5C44B 3TMEA 2L12A 2I46A 1FNWA 2TSSA 4JBWA 3I72A 2PZTA 2A68C 1M4VA 4ZLTF 4KK7A 5LL6S 3U9OA 1TS4A 1E2WA 3I8ZA 2X69A 3KLSX 1TY2A 3EJIA 4NDXA 2RQXA 2ZXOA 5EJWA 1EQVA 2KCCA 4QIWB 4A3FB 4G7OC 4ZRZA 4OHJA 1H9RA 2E75C 3MZ5A 1TY0A 1G2SA 1YNJC 4HN7A 3H0GB 2D9UA 1BDOA 2XRSD 3V05A 4ZAIA 1PTOF 2L0CA 1WTWA 5J22A 1OXXK 1ENFA 4BA2I 4J6HA 1DM0B 3PO3B 3RMHA 3VR5A 4HMIA 4C1NI 1DOLA 3P75A 2KEEA 3UI2A 3SDZA 3T13A 3BDOA 3Q22A 4Y7NB 3DXJC 5F2DA 1NSNS 4PNYA 1CI3M 1LACA 4G57A 2NZ1D 1JC7A 1CQVA 3IL8A 3VA5A 1W6JA 1XX8A 4DAPA 4DFAA 1SMYC 2XRQD 2HCIA 3QB3A 1ML0D 2Q8IB 4B9WA 2AWNA 5M5YB 1Y69U 3SR1A 4F88A 1S5FD 1Q12A 4OO1H 2BE5D 1KDBA 4ZYSA 5M3MB 1KDCA 2EDGA 2PO4A 2F0TA 3A7LA 2LFNA 4B9XA 5JJZA 5C4JB 2K32A 1EY7A 3RZDB 1VDZA 3HGBA 4EQOA 4IFDH 2K01A 1JCKB 4A3EB 5C5LA 1DJRD 4PMWA 1FNVA 3TBIB 1LO5D 1EEFD 4K14A 1WD1A 4IURA 1F2YA 1SJED 4H13C 1STAA 3TP7A 2JYOA 5A35A 3PUZA 4YIJA 4G7ZC 1R4QB 1RCVD 2NVXB 1PMRA 1DXMA 5I2XA 1J8IA 1F9SA 1PTOB 2PW7A 4TKOB 4RH6A 4FXDA 1IW7C 3NHHA 3KLSA 5K36G 1I4XA 1LLRD 2A69D 4NP5A 3I4LA 2E2IB 3L7ZC 4CKEA 4C2MB 3S15B 2SNMA 1LABA 2OXPA 4KKUA 1TR5A 2IX3A 5IGBA 4CJ0B 1JWSD 1SEBD 2K5QA 4U68A 5KEEA 3DHQA 4RKBA 4RCNA 1BOSA 1B9MA 2Z8LA 1X32A 1U4MA 4O42A 1D6EC 1MBYA 2O4XA 3NQIA 2SOBA 4KY5A 2F0EA 3RUZA 3D4WA 2VNUD 1AW7A 3VA7A 4UAIA 3EFXD 4C3HB 1VF5C 1W6KA 1G91A 3PUXA 2EY2A 2DNEA 1J9OA 1PTOC 2F0OA 4TSSA 4X3SA 1ZYRC 2WKDA 3K5OA 1A6XA 3GTMB 5T1IA 2WB1B 3OPOA 2NVYB 4RGOS 2EY1A 2M00A 1RHPA 3MC0B 4QF4A 3K59A 1AFPA 2K03A 2MJ8A 1CHPD 3NTHA 1Y8OB 3C3LA 3URYA 5C5MA 1HUMA 4CKBA 1PFNA 2L55A 1SNPA 4ZUJA 1HFNA 4KJOA 2B2WA 5FLXE 2BDNA 1HA5A 2PMZB 3PUWA 2CQAA 1GUSA 1QE6A 2D2CC 3S1MB 2KCNA 3VYRA 3R2IA 3IKJA 3GV3A 1ONLA 1GUOA 1RODA 2MPMA 3NE5B 1R9TB 1S5CD 2F0VA 2VB2X 3KBGA 2ZT9C 1Z7TA 4CJ1B 4XIGS 1JR0D 3GP7A 1Z47A 4QMGA 4UDUC 1HRJA 1LT3D 5KYLA 2A6HD 4IZ8A 1B3AA 3Q6SA 4HEDA 2PZUA 2EE1A 3GO5A 3MFYA 4QB4A 3VYTA 5I4DA 2EYPA 2EZVA 3P1HA 3VYSA 4DAVA 3ND8A 1TQOA 2Z4IA 1LTAD 4BY7B 1BO0A 2DY8A 4OO1I 4K5VA 3NQTA 1ZEQX 4KD4A 3AU7A 1R4PB 4C56C 1F9RA 1SYDA 4J1MA 3DWPA 3QG1A 1Q1EA 4IFDI 4MN3A 5JAVA 1NR4A 1KTKA 1QCBD 1QJOA 2J7ZA 4KJNA 1ZKOA 4V0BA 2XSCA 1JQYD 1STYA 3F2UA 3D8GA 1RTNA 2F0SA 2AUJD 5CV6A 1BF4A 2EYOA 4XQJA 3FPUB 4ABNA 5C4XB 1RTOA 5COYA 1ET6A 4F87A 1CA5A 3R3OA 1AZQA 5BN3A 1GJXA 1B2TA 4IUUA 4DNTB 1STEA 1CT1D 2QF7A 3SE0A 3RLFA 4BBSB 1U4PA 2NVQB 2RVLA 4X3TA 4IFDJ 1F9PA 3S1NB 5IGDA 4ZQ3A 1D5XC 3H94A 4R8NA 3WOEA 2R92B 2KHSA 1V43A 1A3VA 2PZWA 3I90A 1QNKA 5EBCA 4CKCA 5M5WB 1EOTA 2NUCA 1I4HA 5JEAH 4KMUC 1OXUA 1STBA 1NAPA 2FINB 3E6ZX 1TS5A 5T1GA 1QB5D 2F0UA 1I4RA 1ESRA 5D14A 2QILA 3T51B 1XWEA 4OL7A 1PZID 3BVGA 1H9MA 4FF3A 3EA6A 1SXTA 1Q8IA 3TZUA 3FKIB 5FO7B 3CU7A 2FFKB 5IT9L 1I4PA 4Q5VA 1NR2A 3SK6A 1CZWA 3DUZA 3I91A 4F8MA 2B2TC 3RZOB 1XXGA 2XWBB 3OWFA 1K8OA 3V2TA 1HUNA 1EIHA 4L8JA 1FGBD 4HCSA 2EJGC 3EQLC 3SK5A 1TWHB 2NN6I 3S1QB 2RDGA 2R93B 2F0JA 3MA2B 3NK9A 1TWCB 4X3UA 2BA1A 2IWHA 3OSOA 3BZDB 3PO2B 3K5NA 5J1ZA 4N9TA 5G3LD 5K5PA 4DA2A 1EWCA 2KUMA 1CFMA 4RKLA 2B2UA 4KY6A 1STHA 2B39A 4KKTA 2JSOA 5LL6X 2BE5C 2RDFA 3S2HB 3JAML 2OEOA 5LHY1 3J7YW 2A6ED 3D3RA 2J0TD 4I7ZC 2LY7A 4XTCS 5K36H 1UEAB 3A8KE 3L9AX 3K5MA 4IALA 2K7VA 1I4GA 3S16B 2L9HA 1QG7A 1VMPA 1ILQA 1TKWB 2FHTA 3HKZB 4P2CB 3NBHA 3IFTA 5FK9C 2EVBA 2CW0D 3M4OB 1EWHA 4PMBA 3Q24A 4RCOA 3QJYA 1I3QB 1D1KA 3HOZB 2NTSA 2AUKA 1H9SA 5ELBA 2WAQB 3OWEB 5IODA 3R2TA 5EQ0A 3R93A 3MWYW 2BOSA 1B50A 4OIJA 4PQXA 3L3OC 4NMZA 3KLRA 4FP5D 2X6LA 3BVMA 5KNDA 2JA6B 5EKIA 1STNA 2XNAC 1YNNC 3I4MB 2A69C 1S5DD 2J4XA 4XT1B 1BR9A 3C1FA 5CV8A 2R61A 2EYMA 3HRZC 3S1RB 2TMPA 1BNZA 1X3PA 1SAPA 2AWOA 3I3CA 1GOZA 1EL0A 2NB0A 1LT6D 3GV6A 4BWGB 1EY8A 1X3QA 4ID6A 1SE4A 2SNSA 1WTXA 1H9SB 2BA0A 2R6GA 4U673 5DM63 2SDFA 3HS0C 5M9OA 5JVH3 3OOCA 3Q23A 4S3SA 3J81E 2B2UC 2MGSA 2HDLA 3CRLC 3ND9A 3HOWB 1MD2D 4KD3A 3D6CA 1PTOH 1S5BD 1LT4D 5ELCA 3H3VC 4HAEA 2MUYA 3MTSA 1H9JA 1STGA 1D2BA 3PUVA 5IGGA 4DU9A 4RFBA 1S4ZA 1V8QA 5I9PA 4XT3B 4DK1A 1F9QA 5FO9B 4HTHA 1SNCA 4ME5A 2K6AA 1IL8A 4H7BA 1YNND 1S5ED 2F0NA 2VB3X 2KOLA 2D5DA 4OGQC 5ELEA 4RGNA 1CTMA 1RF2D 5JEAJ 2D62A 1OXTA 3AMUA 4WORA 3FEWX 2EY6A 2BDOA 3OW7A 2JE6I 1PZKD 1MI2A 2A6HC 2G9HD 4FF4A 3NWSA 1F2ZA 1Q3LA 5ELDA 2E2JB 2L1BA 2KECA 3CKIB 3A8JE 1LTGD 3HZXA 4WJWA 1CK1A 5E4WC 3LNNA 3P20A 3PV0A 3BVZA 4H0LC 3TP6A 1B9NA 3NUCA 1AZPA 3BG3A 1VF7A 3DEOA 3VR4A 1LTRD 2HUGA 3X3MA 2IPKD 3KBXA 1VMCA 4PV1C 1Z6HA 2XVSA 5G3LF 4BS9A 4K8JA 2E2DC 3NWTA 4KI0A 3KUPA 5CGKA 2O5IC 2JEBI 1RJTA 4FF1A 3BS1A 1BXTA 1UNSA 5CORA 5C0XH 2E76C 2EYJA 4XYOA 2DY7A 4MIUA 3LWUA 4L63B 1NUCA 1DCZA 4OO1G 4DF7A 2L5TA 2IL8A 4HCEA 2F0WA 5ISRA 1O78A 2PYKA 3J80E 1PRTD 4LJZC 2EY5A 5KNCA 4HMJA 1WD0A 4V190 2B2YC 4IFDG 1ENAA 3GTPB 3TP5A 4DXGA 3ZYYX 1OXVA 2XN9C 1IYUA 3T53B 2XIWA 3PUYA 3MAQA 2E74C 4MHEA 1OXSC 5E1FA 2PPBC 1C8CA 3D6WA 1SSOA 2O2LD 3DEPA 2PQEA 4WFN3 4A93B 5I6WA 3A8IE 4HR7B 2RKSA 4RHSA 2B2TA 4TQUS 1CA6A 4FF2A 2QCPX 3VR3A 5FKAC 3S14B 2M2LA 1BCPD 3CRKC 1TS3A 3QOJA 4QUFA 3WDNA 1GHJA 3WOFA 2YU9B 1PXUA 2WACA 2Q8TA 3C2PA 2HQEA 4KY7A 5JVG3 1D5ZC 4LK1C 1CZGA 1DD2A 3P7JA 3VR2A 2JA8B 3K6OA 1A15A 4LAAA 2LKVA 3HG9A 5CV5A 2K04A 1SE3A 1PLFA 5C4HA 5IIFA 1Y1VB 3T56B 5FO8B 3A55A 2WP8J 1KLUD 1B4OA 1GUNA 2K05A 1LTTD 1LT5D 4Q0FA 5IGEA 2JA7B 1EU3A 1HCZA 2A74C 3E5SA 4ILWA 3HOVB 3QO2A 1JWUD 4KTAA 4M8AA 2RBMA 2WV6D 2A73B 1ENCA 5JOBA 4IQZA 1ET9A 4ZUIA 1WTQA 4DXFA 4BBRB 4NW2A 5BN4A 5CBEE 2JA5B 2LMCB 2VUMB 3H09A 2ICEC 3MXNA 1JOQA 1SFOB 1EYAA 3IFDA 2NN6G 3ONAB 3FPPA 1DZ1A 2A6EC 4CHTB 4Z9CB 3DWAA 1EZ6A 1PZJD 1DOMA 4FXGC 1Q90A 2IW3A 1SNMA 1L0XB 4A3IB 3S17B 2C5CA 4DNRB 4K5WA 1KNAA 1TWFB 4A3KB 1D1IA 2EYLA 4NKLA 4C1NK 1TU2B 2X6GA 2EXZA 2CW0C 3C1EA 1QOHA 3HEJA 5IGFA 5NUCA 3R8BA 3GTGB 3W3AA 5KIXA 4IUTA 4R9WA 2SEBD 2AQ3B 5EKKA 2H4OA 2K5WA 4E6IA 5FLXL 5CV4A 1I6VC 2F0KA 2G9DA 4HSVA 3ERQA 3VR6A 3K7AB 3D4DA 3MXPA 4ODGA 2B2VC 4K5XA 2DN8A 3NP8A 3DMUA 2IX1A 4X3KA 5I6YA 1TS2A 5KNBA 5EPKA 3E0JA 3EVQA 1KLGD 1ILPA 2WKCA 2I07B 5C0XI 1EY9A 3FDTA 3I73A 3J80L 5DEHA 1O7LA 3OMGA 5IGCA 3D31A 3MHBA 1BUVT 3ITPA 3NSWA 3HOXB 5D65A 2F0QA 1SNDA 5EBDA 3A7AB 1GUTA 2A5HA 3S2DB 3TP8A 2L4NA 4L6TB 2Y0SB 4KHVA 3OIPA 5ELFA 1HPCA 3CQZB 2F3VA 2EOTA 3LX0A 1V1OA 3BDLA 2ENBA 3KF8A 1A2UA 4ZKCB 1PRTF 1E0BA 2R3ZA 5CV9A 4BA1I 3M3YB 2JP1A 4IUVA 1HA6A 5D3DA 4XQQA 2EYHA 3RD4A 1GHKA 4AYBB 5C0XJ 4DN4M 4XXEA 3C46A 3I70A 3SXHA 3W2DA 5EGTA 1PYWD 1I50B 1RD9D 1PFMA 4HSPA 4EQPA 2F0HA 3NBIA 5J39A 3MXGA 1M8AA 1SNQA 3GTOB 2YYZA 3NTIA 2B8FA 4FXKC 3T16A 1BCPF 4A3JB 1DYQA 4C3IB 5JEAG 2K5DA 1Y1WB 5CBAE 2KA7A 3GTLB 1U9RA 3K0YA 4XQNA 3TZDA 2Z1CA 5HURA 1SYEA 1SBBB 2LS01 1HFGA 2GA4B 2HDMA 1B44D 5E3FA 3U9SA 5C3XA 4RA8A 1SYBA 1D5MC 5TSSA 2ICIA 1Y8PB 2L11A 2H1EA 5DAUA 5I9OA 2R7ZB 4O1NA 1E2VA 1Q1BA 5FOBB 3QWNA 1SDFA 2BCOA 5KYIA 1PRTB 2A68D 4DGZA 4EVOA 3M4YA 2F3WA 1H9KA 3FVQA 3DM1A 1KABA 1WVLA 2F0MA 3H6MA 1G2TA 1C4QA 4N9PA 1MSGA 1ICWA 3G6JB 2HCCA 1HTLD 1B53A 5AFWA 3A54A 1AP0A 4LMQD 1SE2A 1JOKA 1PDQA 2OF1A 2PW5A 1II3A 2B2YA 3GD7A 1YNJD 2AQ1B 1A3TA 2NWGA 1F77A 2MP1A 1WTRA 5EKLA 3MVVA 5CYUA 4DK0A 1BCPB 2ID0A 5C3WA 1AN8A 4PMCA 1PRTC 5C6AA 2EJMA 2F0FA 3NTKA 1E2ZA 3KK7A 2KVMA 1QNUA 1TWAB 2IJ0A 4G4KA 4C3IG 4WRDA 2Z4HA 3PIO3 1SMYD 3GTKB 1LV9A 1FNUA 3CHBD 1SNOA 4ZKBB 3OHXC 1HTPA 2IX0A 1B1ZA 1EQTA 2F0GA 3V96A 4R8IA 3HOYB 1MSHA 4EGVA 1TVXA 1AEXA 2RA4A 2F0LA 2NYZD 2C9OA 1T5XD 5DM73 4G7HC 4KHZA 5CC4A 2KJXA 3OIQA 1BCPC 2NBFA 2QDBA 1I6HB 1GXDC 1CQFA 2ZXPA 3X3NA 5M3FB 1A3UA 1EY4A 4KN7C 1FD7D 5IT9E 2F1MA 4B08A 3EROA 1JE4A 3G7LA 2M9VA 4RGTA 3FMCA 4A3MB 1SJHD 4K8IA 3QIAA 1WTOA 3DWQA 3SK8A 5EPJA 5C4ZA 5A2QE 1EZ8A 1WTVA 4RHRA 2NN6H 3SK4A 1KDAA 2PCFB 4IUQA 1TWGB 4DAYA 3K5LA 2JEAI 1EYDA 4IUNA 4CGYB 3M7NA 1IW7D 4JK1C 1A2TA 1HQRD 2MHVA 2F0IA 3BYYB 2QEJC 4A3DB 3IAYA 4KKSA 2WIIB 4M1UB 4K6LA 1BQQT 1V1PA 1U4LA 1C48A 1JORA 1IHZA 4OIKA 5C3EB 1WTPA 1EY6A 3H91A 5IOCA 5CMDA 4I65A 2RDHA 2ZXRA 4C3JB 1FYCA 1SYFA 2RSOA 5E4XA 1KAAA 2WINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HA6 A;  1SDF A;  1B50 A;  1MSH A;  1S4Z A;  2NZ1 D;  4OIJ A;  5EPL A;  3FPU B;  3KUP A;  4XT3 B;  1EIH A;  1TVX A;  1CM9 A;  2RA4 A;  2RSN A;  3IL8 A;  1RTO A;  2NYZ D;  5COY A;  1EIG A;  1RJT A;  2FMM A;  1XX8 A;  4CJ0 B;  1DON A;  2K1B A;  2X6L A;  1F2L A;  2X6G A;  4HCS A;  1F9Q A;  3P7J A;  4U68 A;  4DN4 M;  2EPB A;  1AZQ A;  1CA5 A;  2HCI A;  2VXW A;  1A15 A;  1ML0 D;  3DM1 A;  4CJ1 B;  1WVL A;  4IUP A;  1IL8 A;  5EKI A;  3SVM A;  5COR A;  1G2T A;  1B2T A;  4XDX A;  1ZXT A;  4QUC A;  1X32 A;  1U4M A;  4IUT A;  4IUU A;  4R9W A;  2DY7 A;  1MSG A;  1ICW A;  4O42 A;  4X3U A;  2L12 A;  3LWE A;  4RWS C;  1HRJ A;  1NCV A;  2HCC A;  1PFM A;  2K04 A;  1PLF A;  1U4P A;  2KOL A;  4XT1 B;  1XYI A;  1B53 A;  3HP3 A;  1JE4 A;  2B2V A;  2IL8 A;  2RVL A;  3G7L A;  1M8A A;  4X3T A;  5AFW A;  5DNF A;  4LMQ D;  4HSV A;  1IKM A;  1B3A A;  2FJ2 A;  3Q6S A;  4HED A;  1F9P A;  1PDQ A;  5JJZ A;  2EE1 A;  1B4O A;  2B2Y A;  4UAI A;  2B2V C;  2K05 A;  4ZLT F;  2NWG A;  2KUM A;  1G91 A;  2MP1 A;  1WD0 A;  2K01 A;  4IUV A;  2B2Y C;  1WTO A;  3I90 A;  1QNK A;  3TN2 A;  1WTR A;  1AP0 A;  1J9O A;  1EOT A;  4X3K A;  5EPJ A;  1O80 A;  3I8Z A;  2X69 A;  2CVR A;  2B2U A;  1BNZ A;  1X3P A;  4X3S A;  1SAP A;  1WTV A;  5EJW A;  3QO2 A;  3I3C A;  5T1I A;  5EPK A;  4IUQ A;  1MI2 A;  1EL0 A;  5CBA E;  1ILP A;  1NAP A;  1RHP A;  3FDT A;  2FIN B;  1WD1 A;  4IUR A;  5T1G A;  2MPM A;  1BO0 A;  2DY8 A;  2XIW A;  2N55 A;  3GV6 A;  1WTQ A;  2K03 A;  2K28 A;  2Q8R E;  1ESR A;  2MJ8 A;  5D14 A;  4MHE A;  3TZD A;  1Q3L A;  1X3Q A;  4NW2 A;  1G2S A;  1C8C A;  2JYO A;  3D6W A;  5CBE E;  1SSO A;  2KED A;  1WTX A;  2L1B A;  3DEP A;  3R93 A;  4CJ2 C;  1GUW A;  2KEC A;  2L9H A;  1F9R A;  1HFG A;  2D9U A;  1HUM A;  1QG7 A;  2SDF A;  3N52 A;  1DOK A;  5D65 A;  1PFN A;  2FFK B;  2HDM A;  2KVM A;  4ZAI A;  5E4W C;  1VMP A;  1U4L A;  1ILQ A;  1WTW A;  1NR2 A;  2B2T A;  1HFN A;  1IKL A;  2B2U C;  2FHT A;  3IFD A;  1MGS A;  1NR4 A;  2L4N A;  2B2W A;  3ONA B;  4MN3 A;  4OIK A;  1CA6 A;  2BDN A;  4RA8 A;  2MGS A;  1J8I A;  1AZP A;  1WTP A;  1DZ1 A;  3I91 A;  4ZK9 B;  2J7Z A;  1F9S A;  3H91 A;  2B2T C;  2HDL A;  2M2L A;  2EOT A;  1DOL A;  1LV9 A;  1U4R A;  2B2W C;  3DEO A;  2KEE A;  3UI2 A;  5CMD A;  2HUG A;  2L11 A;  4ZKB B;  1QE6 A;  4QUF A;  3KBX A;  1VMC A;  2H1E A;  4HAE A;  1O7Z A;  1HHV A;  3MTS A;  1DOM A;  1KNE A;  2RSO A;  4ZKC B;  1G6Z A;  1PFB A;  1JIC A;  1O7Y A;  4RAU C;  1EQT A;  5E4X A;  1E0B A;  1BBX C;  3F2U A;  2Q8T A;  1HUN A;  4R8I A;  1RTN A;  3GV3 A;  2N88 A;  1ROD A;  2R3Z A;  5EQ0 A;  2JP1 A;  1BF4 A;  3MWY W;  1KNA A; 
#chains in the Genus database with same CATH topology
 3FRP B;  5KGU A;  3VYU A;  4KN4 C;  3JAM E;  3OYY A;  4DR2 Q;  3T1H Q;  1EYC A;  2F03 A;  5IP7 H;  1DON A;  2P5Z X;  1VCI A;  4DK3 C;  2EPB A;  4B3M Q;  1PVO A;  2JA8 H;  1CKN A;  4I7A A;  4K6D A;  1HNZ L;  1JJG A;  1L1O B;  3M7G A;  1PTO D;  1ZXT A;  2CHB D;  2XWJ B;  4QUC A;  3NXW A;  1ZYR D;  2HD3 A;  3N6R A;  3LWE A;  4RWS C;  1JJC B;  1NCV A;  3HOU B;  3J81 L;  2IT1 A;  5LMU L;  1Y1V H;  1GUG A;  2B2V A;  3NPP A;  5DNF A;  1IKM A;  4EQN A;  4DR5 L;  4LF4 L;  4ULL A;  1LTS D;  4C3H G;  4EX5 A;  2JA7 H;  1K83 B;  1Y8N B;  4H44 C;  1X9N A;  3TN2 A;  4LFB L;  3CAM A;  1T5E A;  1OO9 B;  2DNC A;  2B63 B;  2EXD A;  1O80 A;  2OT2 A;  3O13 A;  5D3I B;  1RKN A;  2E2H B;  3HOV H;  3I7F A;  1V1P B;  3MEH A;  1SN8 A;  5M3F G;  4POG A;  1EY0 A;  2UU9 L;  3HKS A;  1OTC A;  4X62 L;  2QDL A;  1X3G A;  3D4R A;  1IBL Q;  3NEL A;  1SYG A;  4DV5 L;  4DV6 L;  2K28 A;  1JB3 A;  2Q8R E;  4RGM A;  4IN3 A;  2QKI C;  2NVT B;  2XTI A;  4A3M G;  4BBR H;  3T4A C;  2E5L Q;  2V4D A;  2JA5 H;  2O5J C;  2VUM H;  2WFW A;  3EBE A;  5GAH C;  3J7A V;  1LTB D;  2RCF A;  5IYC G;  4GZY C;  3N52 A;  3AB9 A;  1L1O C;  2QGQ A;  1E22 A;  1SFO H;  1EFI D;  1L0Y B;  5FJ8 H;  1MGS A;  5I2Y A;  3RNU A;  1JWM D;  1EEI D;  3GTJ B;  1U4R A;  2B2W C;  3F2D A;  1VQN A;  1JOO A;  1WCM B;  2GVB A;  4UP8 A;  4A3L G;  1XTC D;  1O7Z A;  1CHQ D;  3TS0 A;  1G6Z A;  1JIC A;  2Z6K C;  4RAU C;  1I4Q A;  3Q0A A;  1IYV A;  4A3D G;  4J8Q A;  4A3I H;  2N88 A;  3S17 H;  1NMF A;  1UAP A;  2UXD Q;  1PFS A;  1TWF H;  4A3K H;  1QWY A;  3SEB A;  2RSN A;  1HZA A;  1G6P A;  1EIG A;  2K14 A;  4K2K A;  5C3E G;  4HJ8 A;  1S3O A;  2K1B A;  4QIW E;  2VXW A;  1XNQ L;  1I5F A;  2EJF C;  4IUP A;  3SVM A;  1EIY B;  4FVM A;  2K33 A;  3A56 A;  3CMA A;  1G29 1;  3GTG H;  2CH4 W;  5C0X G;  4C3J G;  2R7F A;  1GKH A;  4A3B B;  5BR8 L;  2EYF A;  3SHL A;  5M5X B;  1IL2 A;  1XYI A;  3I4N B;  5JPM C;  3HP3 A;  4TRD A;  5HGT A;  2FJ2 A;  3K7A H;  2PNR C;  4CBV A;  2F0P A;  2F4I A;  2VQF Q;  1ESF A;  5KRU A;  1QVG A;  2NTT A;  3ER0 A;  1VQF A;  3F2C A;  3ICE A;  1HNW L;  2CVR A;  4QCL A;  2AQ2 B;  3M85 A;  1SYC A;  3BYT B;  1QVC A;  3BDC A;  3QOL A;  3PIP 3;  1FJG L;  5CR3 A;  3RLO A;  4KV6 A;  5GRO A;  2ZTD A;  3MXU A;  1VQK A;  2N55 A;  2HHH Q;  3J7A F;  4DV3 Q;  4FNF A;  4K2L A;  3TSS A;  2Q2U A;  4A3G B;  2KED A;  1K8M A;  2MFI A;  3K58 A;  3TDQ A;  4CJ2 C;  5A2Q L;  4B3T Q;  1UUP A;  2B8G A;  1MJE A;  3HOX H;  1DOK A;  2VQE Q;  1F2M A;  1VQ9 A;  2B63 G;  4FO2 A;  3GQB A;  3SGI A;  4LF9 Q;  3S2D H;  1IKL A;  1QIL A;  2ALY B;  1TII D;  3PMF A;  1PH7 A;  4ZK9 B;  3S9W A;  3CQZ H;  4IOC A;  1RDP D;  1FR3 A;  1EU4 A;  1EYG A;  1CSQ A;  1VQ8 A;  2KQ3 A;  1IXR A;  4MTN A;  4BY1 B;  1HHV A;  2DGY A;  1KNE A;  1LTI D;  4XYQ A;  1GUW A;  1PFB A;  1O7Y A;  2F0D A;  5CV7 A;  1BBX C;  3OMC A;  4KHP L;  1HQM C;  2ATW A;  3M3Y H;  3K57 A;  1JT8 A;  1HXY D;  5EPL A;  1C7Y A;  4NXM L;  4OON A;  1CM9 A;  3RN2 A;  1Y14 B;  1EY5 A;  2ZJQ A;  2FMM A;  3MFG A;  1F2L A;  1BBW A;  5BN5 A;  3GTQ B;  2ZTC A;  1G8Z D;  4FYD A;  1K0S A;  4F7X A;  4XDX A;  1TT2 A;  3GDE A;  3E3X A;  2FMC A;  2JXM B;  5JPN C;  3KDF B;  5C44 B;  1KIX A;  3TME A;  2L15 A;  2L12 A;  1I50 H;  2I46 A;  1FNW A;  1T9H A;  3QR8 A;  1U5K A;  2TSS A;  4JBW A;  1CSP A;  3I72 A;  2A8V A;  2PZT A;  2A68 C;  3GTO H;  1M4V A;  2CQO A;  2D0P A;  4ZLT F;  5DLQ E;  4KK7 A;  5LL6 S;  3IRB A;  3U9O A;  1TS4 A;  2I5H A;  2R92 G;  4GLV B;  1E2W A;  3I8Z A;  2X69 A;  3KLS X;  1TY2 A;  4A3J H;  3EJI A;  2ES2 A;  4NDX A;  4LF5 Q;  2RQX A;  2ZXO A;  5EJW A;  4C3I H;  1EQV A;  4GN3 B;  3F2B A;  3PQI A;  2KCC A;  4QIW B;  1Y1W H;  4A3F B;  2RHS B;  4G7O C;  4ZRZ A;  5GQO A;  3GTL H;  1KC8 C;  4OHJ A;  1H9R A;  2E75 C;  1SRO A;  3MZ5 A;  1TY0 A;  1G2S A;  1YNJ C;  1EQR A;  4HN7 A;  4UHV A;  4DV0 Q;  4B3R L;  1XJV A;  3H0G B;  3VDY A;  2D9U A;  1BDO A;  4JI7 L;  2XRS D;  3V05 A;  4JI2 L;  4ZAI A;  1PTO F;  2L0C A;  1WTW A;  5J22 A;  3CCM A;  1OXX K;  2MO0 A;  1ENF A;  4LUO A;  2A1A A;  4BA2 I;  4NPS A;  4J6H A;  3JAM i;  1DM0 B;  3PO3 B;  3RMH A;  3VR5 A;  4JI1 Q;  4HMI A;  4C1N I;  1DOL A;  5IP9 G;  3P75 A;  2KEE A;  3UI2 A;  3SDZ A;  1PV4 A;  3A5U A;  1E1T A;  2E5L L;  2K5N A;  3T13 A;  2R7Z H;  3BDO A;  3Q22 A;  4Y7N B;  3DXJ C;  5F2D A;  1NSN S;  4IPH A;  4PNY A;  2UXC Q;  1CI3 M;  1LAC A;  4G57 A;  1JJ2 A;  1J6Q A;  2NZ1 D;  1JC7 A;  1CQV A;  3IL8 A;  3VA5 A;  1W6J A;  2N78 A;  1XX8 A;  2WB1 E;  4DAP A;  4DFA A;  1SMY C;  4DV1 L;  2XRQ D;  2HCI A;  3QB3 A;  1ML0 D;  2Q8I B;  2CCZ A;  3AEV A;  4B9W A;  2AWN A;  1HNZ Q;  5M5Y B;  1Y69 U;  3SR1 A;  4F88 A;  1PYS B;  1S5F D;  1Q12 A;  4J15 A;  2R93 G;  1LM0 A;  4OO1 H;  4BY1 G;  2BE5 D;  2N3S A;  1QUQ A;  2IHF A;  1KDB A;  3NBH B;  5LMU Q;  1XPO A;  2Z6B A;  4ZYS A;  5M3M B;  1EUJ A;  1KDC A;  2EDG A;  2PO4 A;  2F0T A;  3A7L A;  2LFN A;  4B9X A;  5JJZ A;  4DR5 Q;  4LF4 Q;  5C4J B;  2UXB L;  2K32 A;  1EY7 A;  3RZD B;  1O7I A;  1VDZ A;  3HGB A;  4EQO A;  4IFD H;  2K01 A;  2PMZ E;  4O0A A;  4LFB Q;  1JCK B;  4A3E B;  5L37 A;  2B3G A;  5IT9 c;  3CCQ A;  5C5L A;  1DJR D;  1B3Q A;  1FNV A;  4PMW A;  3TBI B;  1LO5 D;  1EEF D;  4K14 A;  4DR7 L;  5C44 G;  2UU9 Q;  3FHW A;  4X62 Q;  4GKK L;  1WD1 A;  4IUR A;  1F2Y A;  4DV5 Q;  3WWV A;  4DV6 Q;  1SJE D;  4H13 C;  2V1C C;  1STA A;  1D7Q A;  3TP7 A;  2JYO A;  5A35 A;  3PUZ A;  4YIJ A;  1ICF B;  2KHI A;  1C0A A;  2E2I H;  4G7Z C;  1WI5 A;  1R4Q B;  1RCV D;  4MNO A;  4CDD C;  2NVX B;  1K3R A;  4WJ4 A;  1TWA H;  1PMR A;  1DXM A;  5I2X A;  3U4V A;  4AQY L;  1J8I A;  2MQH A;  2RHQ B;  1F9S A;  4A3F G;  3GTK H;  1PTO B;  1WTH A;  2PW7 A;  4TKO B;  4RH6 A;  4FXD A;  1IW7 C;  3NHH A;  3KLS A;  5K36 G;  1I4X A;  1LLR D;  2A69 D;  4NP5 A;  3I4L A;  2E2I B;  3L7Z C;  3H0G G;  1QZG A;  4CKE A;  1FVI A;  3CCU A;  2XGT A;  4C2M B;  2KHJ A;  2ASB A;  3HOY H;  3S15 B;  2SNM A;  1LAB A;  1EOV A;  3K7U C;  2OXP A;  2KCM A;  4KKU A;  1TR5 A;  2IX3 A;  5IGB A;  1X65 A;  1BKB A;  4CJ0 B;  1JWS D;  1SEB D;  2K5Q A;  4LUZ A;  4U68 A;  5KEE A;  3PO3 G;  1XMO L;  3DHQ A;  4FDB A;  4L5Q A;  1XNQ Q;  2OQ0 A;  4RKB A;  4RCN A;  4YY3 L;  1I6H H;  1BOS A;  1B9M A;  2Z8L A;  3BZK A;  2JA6 G;  1X32 A;  3RN5 A;  1U4M A;  1WJJ A;  5M3F H;  3NEN A;  4O42 A;  1YJN A;  1D6E C;  1MBY A;  5BR8 Q;  3I4M G;  3JAM c;  2O4X A;  2OTJ A;  2NVY H;  3NQI A;  2SOB A;  4KY5 A;  2F0E A;  3RUZ A;  2LXK A;  3D4W A;  2VNU D;  5H1S E;  2BH2 A;  1AW7 A;  4A3M H;  3VA7 A;  4UAI A;  3EFX D;  4C3H B;  1VF5 C;  1J5E L;  1NY4 A;  1W6K A;  4K0K L;  1G91 A;  3PUX A;  5IYC H;  1HNW Q;  2EY2 A;  2DNE A;  2EIF A;  1J9O A;  1B8A A;  1PTO C;  2F0O A;  4TSS A;  4X3S A;  1I94 L;  1ZYR C;  2WKD A;  3K5O A;  1A6X A;  3GTM B;  5T1I A;  5LMN W;  2WB1 B;  3OPO A;  1FJG Q;  1TWG H;  2NVY B;  4RGO S;  2EY1 A;  2M00 A;  1RHP A;  3MC0 B;  4QF4 A;  1EWI A;  1XPR A;  3K59 A;  1AFP A;  5M3M G;  2K03 A;  1AE2 A;  2MJ8 A;  4A3L H;  1CHP D;  3NTH A;  1Y8O B;  2DUD A;  3C3L A;  4O2D A;  3URY A;  5IWA L;  1W3S A;  3JC6 6;  4A3D H;  5C5M A;  1L1O A;  3UE0 A;  1HUM A;  2K4K A;  1YVC A;  4CKB A;  1PFN A;  4A3E G;  3HFZ B;  3KYH C;  2L55 A;  1SNP A;  3A0J A;  3G48 A;  3DM3 A;  4ZUJ A;  1HFN A;  1CKM A;  1X56 A;  4KJO A;  5C3E H;  2B2W A;  1E1O A;  5FLX E;  2BDN A;  1S40 A;  1HA5 A;  4JI5 L;  4DUZ L;  1NE3 A;  2PMZ B;  3PUW A;  1VQ6 A;  2CQA A;  3HOW G;  1GUS A;  2I0Q A;  1QE6 A;  2D2C C;  1X3E A;  3S1M B;  4C3J H;  2KCN A;  3VYR A;  3A74 A;  3PGZ A;  3H3V I;  4HID A;  3R2I A;  3IKJ A;  4KHP Q;  3GV3 A;  1ONL A;  1GUO A;  1ROD A;  2OWO A;  2MPM A;  1N34 L;  3NE5 B;  1R9T B;  1PH2 A;  4NXM Q;  1S5C D;  2F0V A;  2VB2 X;  3KBG A;  2ZT9 C;  1Z7T A;  1K28 A;  4YCU A;  4CJ1 B;  1VQE A;  1K3B C;  4XIG S;  1JR0 D;  3GP7 A;  1Z47 A;  4QMG A;  3TQY A;  4UDU C;  1G51 A;  5E7N A;  1HRJ A;  1LT3 D;  5KYL A;  3HOU H;  2HQL A;  2A6H D;  1PH8 A;  4UP9 A;  4IZ8 A;  4JC0 A;  3Q6S A;  1B3A A;  4HED A;  2PZU A;  2Q2H A;  2EE1 A;  3GO5 A;  3MFY A;  4QB4 A;  1UE1 A;  3VYT A;  3RR5 A;  5I4D A;  1K83 H;  2EYP A;  4NXN L;  2EZV A;  2B63 H;  3P1H A;  3VYS A;  4DAV A;  3FP9 A;  2E2H H;  3E9H A;  3E9I A;  3ND8 A;  4DR6 L;  1TQO A;  2Z4I A;  1LTA D;  3F8T A;  1ASZ A;  4BY7 B;  4QL5 A;  1WYD A;  1VQM A;  1BO0 A;  2DY8 A;  1N36 L;  4OO1 I;  4H02 A;  2HIV A;  2NVT H;  4K5V A;  1HR0 L;  3NQT A;  1ZEQ X;  3RLN A;  1UEB A;  4B3R Q;  4KD4 A;  3AU7 A;  1R4P B;  4C56 C;  1F9R A;  1XMQ L;  1SYD A;  4J1M A;  4JI7 Q;  3DWP A;  4JI2 Q;  3QG1 A;  2YTV A;  4DK6 C;  1Q1E A;  4JOI C;  4GLA C;  4MN3 A;  5JAV A;  4IFD I;  1NR4 A;  1GO3 E;  4JW0 A;  1KTK A;  1QCB D;  1QJO A;  2WB1 G;  2J7Z A;  2CWA A;  3GTJ H;  2DJF C;  4KJN A;  1VQB A;  1ZKO A;  1YJ9 A;  1WCM H;  4V0B A;  1LYL A;  2JJQ A;  2XSC A;  1JQY D;  1STY A;  3F2U A;  1VQP A;  3D8G A;  1RTN A;  2F0S A;  2OTL A;  2AUJ D;  5CV6 A;  2PNH A;  1BF4 A;  2EYO A;  4XQJ A;  3FPU B;  4EQ5 A;  3M4Q A;  4ABN A;  5C4X B;  1KRT A;  1RTO A;  5COY A;  1ET6 A;  4F87 A;  1CA5 A;  3R3O A;  2Y0S E;  2DJG C;  4DV1 Q;  1AZQ A;  5BN3 A;  1GJX A;  1B2T A;  2N49 A;  4IUU A;  4LNQ A;  4DNT B;  4X65 L;  1STE A;  4ALP A;  3CF5 A;  3OW2 A;  4A3B H;  1L0W A;  1CT1 D;  2QF7 A;  3SE0 A;  4YWK A;  3RLF A;  5M5X H;  4BBS B;  1U4P A;  4GLX A;  1XPU A;  3I4N H;  2NVQ B;  2RVL A;  4X3T A;  1E7Z A;  4IFD J;  1F9P A;  3S1N B;  5IGD A;  2UXB Q;  1YBY A;  4ZQ3 A;  1D5X C;  5IY0 A;  3H94 A;  4R8N A;  3WOE A;  3HKZ E;  1QVF A;  2R92 B;  1TXY A;  2KHS A;  1V43 A;  1A3V A;  2PZW A;  3I90 A;  1QNK A;  2Z9H A;  5EBC A;  4CKC A;  4A76 A;  1FGU A;  1VQG A;  5M5W B;  1EOT A;  1A0I A;  2NUC A;  1I4H A;  5JEA H;  3CP0 A;  4DR7 Q;  3BU2 A;  1GM5 A;  4KMU C;  2G5D A;  4WJ3 M;  2VW9 A;  1OXU A;  1STB A;  2B29 A;  2WAQ E;  4GKK Q;  1NAP A;  2FIN B;  2IHE A;  1TS5 A;  3E6Z X;  4YWL A;  5T1G A;  4CDF C;  5IP9 H;  1QB5 D;  2F0U A;  4HJ5 A;  5ELN A;  1I4R A;  4GNX B;  1ESR A;  5D14 A;  2QIL A;  3T51 B;  1XWE A;  3U4Z A;  1JB7 A;  4OL7 A;  1PZI D;  4A3G H;  4HJ7 A;  1DGS A;  1Q8K A;  3BVG A;  1H9M A;  4FF3 A;  3EA6 A;  1SXT A;  1Q8I A;  3TZU A;  3FKI B;  3KDF A;  3CU7 A;  5FO7 B;  2FFK B;  5IT9 L;  4IOA A;  1I4P A;  4Q5V A;  1NR2 A;  3SK6 A;  1CZW A;  4AQY Q;  3DUZ A;  3I91 A;  4F8M A;  4BY7 G;  2B2T C;  3RZO B;  4GS3 A;  1XXG A;  4BY1 H;  2XWB B;  3OWF A;  1VQ7 A;  1K73 C;  1A63 A;  1K8O A;  4LFC L;  3V2T A;  1HUN A;  3I56 A;  1RIP A;  4JPB W;  4A75 A;  4R1J A;  1EIH A;  1MJC A;  3F1Z A;  4L8J A;  1FGB D;  4N8F A;  3TRZ A;  4HCS A;  2EJG C;  3EQL C;  3GTQ H;  1KRS A;  3SK5 A;  1XMO Q;  1TWH B;  2NN6 I;  3S1Q B;  4YY3 Q;  2RDG A;  2R93 B;  4R4C A;  2F0J A;  2VS1 A;  4GNX C;  3MA2 B;  3NK9 A;  5C44 H;  4JI6 L;  4RMF A;  4LF8 L;  1TWC B;  4X3U A;  2BA1 A;  1Q81 C;  2IWH A;  3ULJ A;  3OSO A;  3BZD B;  3UDX A;  3PO2 B;  3K5N A;  4UY8 C;  3CCE A;  5J1Z A;  4P74 A;  5GAD C;  5C4X G;  4N9T A;  4AIM A;  5G3L D;  4L5T A;  5K5P A;  4DA2 A;  2D0O A;  1J5E Q;  4TVA B;  1EWC A;  2KUM A;  1CFM A;  4K0K Q;  4RKL A;  2BH8 A;  1PH6 A;  1CKO A;  2B2U A;  4KY6 A;  1STH A;  2JQO A;  1M90 C;  1I94 Q;  2B39 A;  4KKT A;  1JE5 A;  2JSO A;  4HIM A;  5LL6 X;  2BE5 C;  2RDF A;  3S2H B;  3JAM L;  4DR1 L;  4A3F H;  2OEO A;  3CME A;  5LHY 1;  3J7Y W;  4BBS G;  2A6E D;  3D3R A;  2J0T D;  4JI4 L;  4I7Z C;  2LY7 A;  5J3B A;  4XTC S;  4DV4 L;  5K36 H;  1UEA B;  3A8K E;  3L9A X;  3K5M A;  1ASY A;  2NZH A;  1PH9 A;  4IAL A;  5IWA Q;  2K7V A;  1I4G A;  3H0G H;  2L9H A;  1KHI A;  3S16 B;  2VUM G;  1QG7 A;  1VMP A;  1ILQ A;  1TKW B;  2FHT A;  2Z0S A;  1QZH A;  3HKZ B;  4P2C B;  3NBH A;  4JBJ A;  3PO3 H;  3IFT A;  5FJ8 G;  4JI5 Q;  5FK9 C;  2EVB A;  4DUZ Q;  5FLM G;  3DLL A;  2CW0 D;  3M4O B;  1EWH A;  2F4V L;  4PMB A;  1Q86 C;  3Q24 A;  4RCO A;  3QJY A;  1I3Q B;  1D1K A;  3HOZ B;  2NTS A;  2AUK A;  1H9S A;  2YTX A;  4Y7N H;  5ELB A;  4LF6 L;  2WAQ B;  3OWE B;  5IOD A;  4QQB X;  3R2T A;  5EQ0 A;  3R93 A;  1N34 Q;  3MWY W;  4A3I G;  1X3F A;  4ME3 A;  2BOS A;  1IBM L;  4OIJ A;  1B50 A;  4PQX A;  3FKI G;  3L3O C;  4NMZ A;  3KLR A;  1PH5 A;  4FP5 D;  1YNX A;  1YHQ A;  2X6L A;  3BVM A;  4UPA A;  5IYD H;  5KND A;  2JA6 B;  5EKI A;  5M5Y H;  3T1Y L;  1STN A;  4JI3 L;  4P72 A;  2XNA C;  1YNN C;  3I4M B;  4DR4 L;  2A69 C;  4JI8 L;  1S5D D;  2J4X A;  4XT1 B;  3BZC A;  1BR9 A;  1S72 A;  5M3M H;  3C1F A;  4JV5 L;  3CXC A;  5CV8 A;  1SE8 A;  2R61 A;  4GOP B;  2EYM A;  2PQA A;  5C4J H;  3HRZ C;  3S1R B;  3RZD H;  5IE8 A;  4NXN Q;  1X55 A;  4A3E H;  4X66 L;  2TMP A;  1BNZ A;  1X3P A;  1U0L A;  1SAP A;  4DUY L;  2AWO A;  4X64 L;  3I3C A;  1PH4 A;  4DR6 Q;  2VL6 A;  1GOZ A;  1VQJ A;  1EL0 A;  5HY6 A;  1PH1 A;  2NB0 A;  1LT6 D;  3PO2 G;  2LSS A;  3GV6 A;  1N36 Q;  2AMC B;  4BWG B;  1EY8 A;  1X3Q A;  4ID6 A;  1HR0 Q;  1SMX A;  1SE4 A;  2SNS A;  1WTX A;  1H9S B;  4HJ9 A;  2BA0 A;  2R6G A;  1XMQ Q;  4U67 3;  5DM6 3;  2SDF A;  3HS0 C;  3KF6 A;  4MZ9 A;  5M9O A;  5JVH 3;  3OOC A;  2NVX H;  4BXX G;  1N33 Q;  3Q23 A;  4S3S A;  3M4P A;  1KAW A;  2B2U C;  3J81 E;  4DKA C;  2MGS A;  2Y0S G;  2HDL A;  3CRL C;  3ND9 A;  3HOW B;  3CCL A;  1MD2 D;  1VQ4 A;  3NEM A;  4KD3 A;  3D6C A;  1YIT A;  1PTO H;  1S5B D;  1LT4 D;  5ELC A;  4B3S L;  3H3V C;  4HAE A;  4X6A H;  2MUY A;  3MTS A;  3PIO A;  4GOP C;  3K8A A;  1H9J A;  1HZC A;  1STG A;  3ULP A;  1D2B A;  4IPD A;  3PUV A;  5IGG A;  4DV2 L;  3CC4 A;  4DU9 A;  4RFB A;  5FLX c;  4C2M H;  3S15 H;  2NZO A;  1S4Z A;  1V8Q A;  5I9P A;  4XT3 B;  5AJ3 L;  4GKJ L;  4GN4 B;  4DK1 A;  2PQA B;  5IYB G;  3HKZ G;  3UDI A;  1F9Q A;  2UUA L;  5FO9 B;  4HTH A;  1A62 A;  1SNC A;  4ME5 A;  2K6A A;  1IL8 A;  4ZCK A;  4H7B A;  1YNN D;  3HOZ G;  4X65 Q;  1S5E D;  1GVP A;  2F0N A;  1V9P A;  2QA4 A;  2VB3 X;  2WAQ G;  2KOL A;  4YCV A;  2D5D A;  4OGQ C;  2ZJP A;  2EQS A;  5ELE A;  1NBW A;  4OEM B;  4RGN A;  1JMC A;  1CTM A;  1RF2 D;  3CC7 A;  4P75 A;  4C3H H;  1N32 L;  1LTL A;  2D62 A;  5JEA J;  1OXT A;  4DAM A;  4IJH A;  4JBM A;  4WOR A;  3AMU A;  3FEW X;  2EY6 A;  2BDO A;  3KF6 B;  3CPW A;  3GTM H;  3OW7 A;  2JE6 I;  1PZK D;  1MI2 A;  3KJO A;  1N8R C;  2A6H C;  2A19 A;  1PHJ A;  4A3C G;  2G9H D;  4PG3 A;  4FF4 A;  3NWS A;  1F2Z A;  1Q3L A;  1YIJ A;  1NTG A;  1HZ9 A;  3OTO L;  5ELD A;  2E2J B;  2L1B A;  1CUK A;  2KEC A;  2HT1 A;  2PI2 E;  3CKI B;  3A8J E;  1LTG D;  3HZX A;  4JOI A;  1VQD A;  4WJW A;  1CK1 A;  3AYH B;  5E4W C;  1EQQ A;  3LNN A;  3P20 A;  2K52 A;  3EN2 A;  3PV0 A;  3BVZ A;  4H0L C;  1KXL A;  3TP6 A;  1B9N A;  3NUC A;  3STB D;  1AZP A;  5GAG C;  3BG3 A;  2OCE A;  4N8X 1;  1VF7 A;  3DEO A;  1MHW C;  3CCS A;  3VR4 A;  3M9B A;  1LTR D;  2HUG A;  3X3M A;  2IPK D;  3KBX A;  3S1M H;  1VMC A;  4PV1 C;  1Z6H A;  4LFC Q;  2XVS A;  5G3L F;  4BS9 A;  4K8J A;  3PF4 A;  2E2D C;  1SRU A;  1VQA A;  1R9T H;  3NWT A;  4KI0 A;  4JYA L;  3KUP A;  5CGK A;  4YCW A;  2O5I C;  2JEB I;  1RJT A;  4FF1 A;  3BS1 A;  2UUC L;  2E8G A;  1BXT A;  1P8L A;  3CC2 A;  1D8L A;  1UNS A;  5COR A;  5C0X H;  4LW1 A;  2E76 C;  2EYJ A;  4XYO A;  4JI0 L;  2DY7 A;  5EAY A;  4JI6 Q;  4MIU A;  3LWU A;  4L63 B;  4LF8 Q;  1NUC A;  1DCZ A;  4OO1 G;  4DF7 A;  2L5T A;  2IL8 A;  4HCE A;  1YHA A;  2F0W A;  3CPF A;  5ISR A;  1O78 A;  2PYK A;  3J80 E;  1PRT D;  4LJZ C;  2EY5 A;  5KNC A;  4HMJ A;  3PF5 A;  1K0R A;  1WD0 A;  4V19 0;  2B2Y C;  2YV5 A;  4IFD G;  1ENA A;  3GTP B;  1VQ5 A;  4P73 A;  3TP5 A;  4DXG A;  1HH2 P;  4BY7 H;  3ZYY X;  4DR1 Q;  1LUZ A;  1OXV A;  2XN9 C;  1IYU A;  4JI4 Q;  3T53 B;  2XIW A;  3PUY A;  3MAQ A;  2E74 C;  4MHE A;  1OXS C;  5E1F A;  4DV4 Q;  1B7Y B;  2PPB C;  1C8C A;  3D6W A;  1SSO A;  2O2L D;  3DEP A;  2YU9 H;  4DR3 L;  2PQE A;  4WFN 3;  4A93 B;  5I6W A;  3A8I E;  4HR7 B;  2RKS A;  4RHS A;  4CDC C;  1FL0 A;  2B2T A;  4TQU S;  4NB3 A;  1CA6 A;  4FF2 A;  2QCP X;  3VR3 A;  5FKA C;  3S14 B;  2M2L A;  2F4V Q;  1BCP D;  3CRK C;  1TS3 A;  2KEN A;  3QOJ A;  4QUF A;  3WDN A;  1GHJ A;  3PCO B;  1MIU A;  2LXJ A;  3WOF A;  2YU9 B;  1PXU A;  2WAC A;  2Q8T A;  3C2P A;  4LF6 Q;  4DAY B;  2HQE A;  1Q7Y C;  3W5O A;  4KY7 A;  4QY7 A;  1IBM Q;  1Q46 A;  2KCT A;  5JVG 3;  1N33 L;  3HOY G;  5C4X H;  1KQS A;  1D5Z C;  4LK1 C;  1CZG A;  1VQL A;  1DD2 A;  3P7J A;  4OX9 L;  3VR2 A;  2JA8 B;  3K6O A;  1A15 A;  4LAA A;  4GNX A;  2ZM6 L;  3T1Y Q;  2LKV A;  4DV7 L;  4Y52 H;  1SR3 A;  4JI3 Q;  3HG9 A;  5CV5 A;  4DR4 Q;  4PZ7 A;  1AE3 A;  4JI8 Q;  2K04 A;  1SE3 A;  1IZ6 A;  4BBS H;  3B6Y A;  1PLF A;  5C4H A;  5IIF A;  1Y1V B;  3T56 B;  5FO8 B;  2NVQ H;  3A55 A;  2WP8 J;  1KLU D;  4JV5 Q;  2UUB L;  3S1N H;  1B4O A;  1GUN A;  3S24 A;  2K05 A;  1LTT D;  1LT5 D;  3LGJ A;  4Q0F A;  5IGE A;  2JA7 B;  1EU3 A;  2R92 H;  1HCZ A;  2A74 C;  2K50 A;  5ELO A;  5M5W H;  4QGU A;  4IPC A;  4X66 Q;  3E5S A;  4ILW A;  4L5R C;  1AH9 A;  3HOV B;  1KD1 C;  4DUY Q;  3QO2 A;  4X64 Q;  1JWU D;  1IBK L;  4KTA A;  4M8A A;  2RBM A;  2WV6 D;  2CWP A;  5FLM H;  2A73 B;  1ENC A;  3J81 i;  5JOB A;  4IQZ A;  5LMN L;  3E0E A;  1ET9 A;  1PH3 A;  4ZUI A;  1WTQ A;  1CKN B;  1K8G A;  4DXF A;  3PIP A;  4HIO A;  4BBR B;  4JBK A;  4NW2 A;  5BN4 A;  5CBE E;  2JA5 B;  2LMC B;  4AYB E;  2VUM B;  3H09 A;  2ICE C;  2H5X A;  3MXN A;  2HIX A;  3FKI H;  1JOQ A;  2GN5 A;  3ERS X;  1SFO B;  1EYA A;  3IFD A;  2NN6 G;  3ONA B;  3FPP A;  1DZ1 A;  1HNX L;  2R7D A;  2A6E C;  4CHT B;  3RZO H;  4Z9C B;  3G6E A;  4LFA L;  3DWA A;  1EZ6 A;  4B3S Q;  1PZJ D;  1DOM A;  4FXG C;  1Q90 A;  3UDF A;  2IW3 A;  1SNM A;  1L0X B;  2AHO B;  4YWM A;  2CH4 A;  4A3I B;  3S17 B;  4DV2 Q;  4A93 G;  2C5C A;  1KNA A;  4K5W A;  4DNR B;  1TWF B;  1YI2 A;  1VQO A;  4A3K B;  1D1I A;  2EYL A;  5AJ3 Q;  4IPG A;  3G71 A;  4GKJ Q;  1Z9F A;  4NKL A;  1PYB A;  4C1N K;  1TU2 B;  1UWV A;  2X6G A;  2EXZ A;  2UUA Q;  4LUV A;  2CW0 C;  3C1E A;  1TWH H;  1QOH A;  3S1Q H;  3HEJ A;  5IGF A;  2R93 H;  5NUC A;  3R8B A;  3GTG B;  3W3A A;  5KIX A;  4IUT A;  4R9W A;  4MTK A;  2SEB D;  2AQ3 B;  5EKK A;  2ZTE A;  1TWC H;  2H4O A;  2MNA A;  2K5W A;  2I5L X;  4E6I A;  1P16 A;  5FLX L;  3HOU G;  3PO2 H;  4PZ8 A;  5CV4 A;  1I6V C;  2F0K A;  2G9D A;  4HSV A;  3ERQ A;  3VR6 A;  3K7A B;  3D4D A;  3MXP A;  4ODG A;  1N32 Q;  2B2V C;  4JG2 A;  1NJI C;  5IP7 G;  4K5X A;  2DN8 A;  4HJA A;  4PZ6 A;  3NP8 A;  3J7Z C;  3DMU A;  2JA8 G;  2IX1 A;  1N9W A;  4X3K A;  1XNR L;  1MKH A;  2I5M X;  3MXN B;  3BJU A;  5I6Y A;  4BXX H;  3CCR A;  1TS2 A;  5KNB A;  4LF7 L;  5EPK A;  3E0J A;  3S2H H;  3EVQ A;  4OWT B;  4CDE C;  1KLG D;  1ILP A;  2WKC A;  2I07 B;  5C0X I;  1EY9 A;  3FDT A;  3I73 A;  3J80 L;  5DEH A;  1O7L A;  1Y1V G;  5JJI A;  3OMG A;  2N8N A;  5IGC A;  3D31 A;  5JJL A;  3OTO Q;  4IJL A;  1EFW A;  3MHB A;  1BUV T;  2OQK A;  3S16 H;  4YHH L;  2JA7 G;  3ITP A;  3NSW A;  3HOX B;  5D65 A;  2F0Q A;  1SND A;  5EBD A;  3A7A B;  2IY5 B;  1GUT A;  2A5H A;  3S2D B;  3TP8 A;  3HOV G;  1E24 A;  2L4N A;  4L6T B;  1E3P A;  2QW7 A;  2Y0S B;  4KHV A;  5IYB H;  3MEF A;  3OIP A;  5ELF A;  1HPC A;  3CQZ B;  4R4T A;  1V1Q A;  2F3V A;  2EOT A;  3LX0 A;  1V1O A;  1YEZ A;  3U50 C;  4GOP A;  3M4O H;  3BDL A;  4HIK A;  2ENB A;  1I3Q H;  3TEH B;  3HOZ H;  3KF8 A;  1WCM G;  1YHB A;  1A2U A;  4BBR G;  1PRT F;  4ZKC B;  3KOJ A;  2JA9 A;  1E0B A;  1HZB A;  2JA5 G;  3J81 c;  4A4I A;  1RL2 A;  2R3Z A;  5CV9 A;  4BA1 I;  2JP1 A;  3M3Y B;  3K0X A;  4IUV A;  1HA6 A;  5D3D A;  4JYA Q;  4XQQ A;  4DR2 L;  3KFU A;  2EYH A;  3RD4 A;  3T1H L;  1UE7 A;  4AYB B;  5C0X J;  1W2B A;  1GHK A;  2UUC Q;  4KLK A;  4DN4 M;  4B3M L;  4R4O A;  3J80 i;  3CCV A;  4XXE A;  3W1G A;  4AH6 A;  3C46 A;  2JA6 H;  3I70 A;  3SXH A;  3W2D A;  3J81 j;  4JI0 Q;  1L2F A;  3I4M H;  5EGT A;  3AFQ A;  2FXQ A;  1PYW D;  1I50 B;  1RD9 D;  1VQH A;  4A3B G;  1PFM A;  4HSP A;  4EQP A;  2F0H A;  3EIV A;  3NBI A;  5J39 A;  3MXG A;  4A3C H;  1M8A A;  1BVS A;  1SNQ A;  3H3V H;  3I4N G;  4A3K G;  3GTO B;  2K5V A;  2YYZ A;  3S1R H;  1IYJ B;  2VZA A;  3NTI A;  1NMG A;  2B8F A;  4FXK C;  4P71 A;  1A8V A;  3T16 A;  1BCP F;  4A3J B;  3TRE A;  1DYQ A;  4C3I B;  5JEA G;  2MO1 A;  4RG1 A;  2K5D A;  1Y1W B;  5CBA E;  3J7A 5;  2KA7 A;  3GTL B;  1VS0 A;  1IBL L;  1U9R A;  3K0Y A;  4XQN A;  3TZD A;  2Z1C A;  5HUR A;  1SYE A;  3KF8 B;  1SBB B;  2LS0 1;  4UP7 A;  1YZ6 A;  4DR3 Q;  3H15 A;  4A3G G;  1HFG A;  1WOC A;  2GA4 B;  2HDM A;  1B44 D;  5E3F A;  4R4Q A;  3U9S A;  5C3X A;  4RA8 A;  3I4O A;  1SYB A;  1D5M C;  3K80 C;  5TSS A;  2ICI A;  3HOW H;  1Y8P B;  2L11 A;  2K75 A;  2H1E A;  5DAU A;  5I9O A;  4L5S A;  1WFQ A;  2R7Z B;  4O1N A;  1E2V A;  3CW2 C;  2F52 A;  1Q1B A;  4GN5 A;  5FOB B;  3QWN A;  1SDF A;  2BCO A;  3HOX G;  2UXD L;  5KYI A;  1PRT B;  2Q2I A;  4IO9 A;  2A68 D;  2JK8 A;  4DGZ A;  4EVO A;  3M4Y A;  2F3W A;  3A5Z B;  3U58 A;  3STB C;  1H9K A;  1H95 A;  3FVQ A;  4OX9 Q;  3DM1 A;  3CCJ A;  1KAB A;  2ZM6 Q;  1WVL A;  2F0M A;  3H6M A;  1G2T A;  4DV7 Q;  1C4Q A;  4N9P A;  1YJW A;  1MSG A;  1ICW A;  3I2Z A;  2JN4 A;  3G6J B;  2HCC A;  4JVZ A;  1HTL D;  2AKW B;  3W1B A;  1B53 A;  5AFW A;  3A54 A;  1AP0 A;  5GAE C;  4LMQ D;  2UUB Q;  1SE2 A;  1JOK A;  1PDQ A;  2OF1 A;  2VQF L;  2PW5 A;  1II3 A;  2B2Y A;  3GD7 A;  4OEL B;  1YNJ D;  2AQ1 B;  1A3T A;  1C9O A;  4AYB G;  2NWG A;  3KJP A;  1F77 A;  1VQI A;  2MP1 A;  4APV A;  1WTR A;  5EKL A;  1X54 A;  1EIF A;  1UE5 A;  3MVV A;  2K5H A;  1BBU A;  1XTD A;  3G4S A;  1IBK Q;  1M1K C;  2RCN A;  1UE6 A;  5CYU A;  4DK0 A;  3J80 c;  1BCP B;  1X6O A;  2ID0 A;  5LMN Q;  1HR0 W;  2HHH L;  1K9M C;  5C3W A;  2F3I A;  1AN8 A;  4POF A;  4DV3 L;  4PMC A;  2ZJR A;  1PRT C;  5C6A A;  2EJM A;  2E2J H;  4B3T L;  2F0F A;  3NTK A;  4OWX B;  1NNX A;  1E2Z A;  2VQE L;  1GD7 A;  3KK7 A;  3UE1 A;  1QUQ B;  3AQQ A;  2KVM A;  4LF9 L;  1QNU A;  4A3J G;  1TWA B;  2IJ0 A;  3D0F A;  4G4K A;  4C3I G;  4WRD A;  1SLJ A;  2Z4H A;  2RF4 A;  3PIO 3;  1SMY D;  4LWC A;  1Y1W G;  1HNX Q;  3GTK B;  1LV9 A;  1FNU A;  3CHB D;  1SNO A;  4LFA Q;  4ZKB B;  3OHX C;  1HTP A;  1HJP A;  2IX0 A;  1B1Z A;  1EQT A;  2F0G A;  2VY3 A;  3V96 A;  4QJF A;  4R8I A;  4JCV E;  3TS2 A;  3ZJY C;  3HOY B;  1MSH A;  2KBN A;  4EGV A;  1TVX A;  1AEX A;  2RA4 A;  2F0L A;  2NYZ D;  2C9O A;  1T5X D;  5DM7 3;  3I55 A;  4G7H C;  4KHZ A;  3Q8D A;  5CC4 A;  3ULL A;  2KJX A;  3OIQ A;  1BCP C;  2NBF A;  2QDB A;  1I6H B;  5IYD G;  1GXD C;  1CQF A;  2ZXP A;  3X3N A;  1KL9 A;  5M3F B;  1A3U A;  1EY4 A;  4KN7 C;  2YTY A;  2R7Z G;  1FD7 D;  2QEX A;  5IT9 E;  1VQC A;  2F1M A;  4B08 A;  3ERO A;  1JE4 A;  1PA6 A;  3G7L A;  2M9V A;  4RGT A;  2C35 B;  3FMC A;  3L2P A;  4A3M B;  4DPG A;  4OWW B;  1SJH D;  4K8I A;  4DNI A;  3QIA A;  1WTO A;  3DWQ A;  3SK8 A;  5EPJ A;  5C4Z A;  1XNR Q;  5A2Q E;  1K8A C;  1EZ8 A;  3GTP H;  4LF5 L;  1WTV A;  1B70 B;  4RHR A;  2NN6 H;  3SK4 A;  4LF7 Q;  1KDA A;  2PCF B;  4IUQ A;  1TWG B;  4DAY A;  3K5L A;  3CD6 A;  1Q82 C;  2JEA I;  1EYD A;  4IUN A;  4CGY B;  3M7N A;  2Z6K A;  1IW7 D;  4JK1 C;  1A2T A;  1HQR D;  2MHV A;  2F0I A;  2PI2 A;  4DV0 L;  3BYY B;  3AFP A;  2QEJ C;  4A3D B;  4YHH Q;  3IAY A;  2GVA A;  4KKS A;  4A93 H;  2WII B;  4M1U B;  4OXP A;  4K6L A;  1BQQ T;  1V1P A;  1U4L A;  1C48 A;  1JOR A;  2CKZ B;  1IHZ A;  3K81 C;  4OIK A;  3PSI A;  2CFM A;  5C3E B;  3L0O A;  1WTP A;  1EY6 A;  3H91 A;  5IOC A;  4JI1 L;  3S14 H;  3UDG A;  5CMD A;  4R4I A;  4I65 A;  2Q2T A;  2RDH A;  2ZXR A;  4C3J B;  1FYC A;  5JJK A;  1SYF A;  5HGQ A;  2RSO A;  5E4X A;  3KLW A;  1KAA A;  2UXC L;  2WIN B; 
#chains in the Genus database with same CATH homology
 3FRP B;  5KGU A;  3VYU A;  4KN4 C;  3JAM E;  1EYC A;  2F03 A;  1DON A;  1VCI A;  2EPB A;  4K6D A;  3M7G A;  1PTO D;  1ZXT A;  2CHB D;  2XWJ B;  4QUC A;  3NXW A;  1ZYR D;  3N6R A;  3LWE A;  4RWS C;  1NCV A;  3HOU B;  3J81 L;  2IT1 A;  1GUG A;  2B2V A;  3NPP A;  5DNF A;  1IKM A;  4EQN A;  4ULL A;  1LTS D;  4C3H G;  1K83 B;  1Y8N B;  4H44 C;  3TN2 A;  1T5E A;  1OO9 B;  2DNC A;  2B63 B;  1O80 A;  2OT2 A;  3O13 A;  5D3I B;  1RKN A;  2E2H B;  1V1P B;  3MEH A;  1EY0 A;  3D4R A;  1SYG A;  2K28 A;  1JB3 A;  2Q8R E;  4RGM A;  4IN3 A;  2QKI C;  2NVT B;  3T4A C;  2V4D A;  2O5J C;  3J7A V;  1LTB D;  4GZY C;  3N52 A;  3AB9 A;  1EFI D;  1L0Y B;  1MGS A;  5I2Y A;  1JWM D;  1EEI D;  3GTJ B;  1U4R A;  2B2W C;  1JOO A;  1WCM B;  1XTC D;  1O7Z A;  1CHQ D;  1G6Z A;  1JIC A;  4RAU C;  1I4Q A;  3Q0A A;  1IYV A;  4J8Q A;  2N88 A;  1UAP A;  1QWY A;  3SEB A;  2RSN A;  1EIG A;  4K2K A;  2K1B A;  2VXW A;  2EJF C;  4IUP A;  3SVM A;  4FVM A;  2K33 A;  3A56 A;  1G29 1;  5C0X G;  4C3J G;  4A3B B;  2EYF A;  3SHL A;  5M5X B;  1XYI A;  3I4N B;  5JPM C;  3HP3 A;  4TRD A;  5HGT A;  2FJ2 A;  2PNR C;  4CBV A;  2F0P A;  2F4I A;  1ESF A;  5KRU A;  2NTT A;  2CVR A;  4QCL A;  2AQ2 B;  3M85 A;  1SYC A;  3BYT B;  3BDC A;  3QOL A;  3PIP 3;  5CR3 A;  4KV6 A;  3MXU A;  2N55 A;  3J7A F;  4FNF A;  4K2L A;  3TSS A;  4A3G B;  2KED A;  1K8M A;  3K58 A;  3TDQ A;  4CJ2 C;  5A2Q L;  1UUP A;  2B8G A;  1DOK A;  1F2M A;  4FO2 A;  3GQB A;  1IKL A;  1QIL A;  1TII D;  3PMF A;  4ZK9 B;  3S9W A;  1RDP D;  1FR3 A;  1EU4 A;  2KQ3 A;  4BY1 B;  1HHV A;  4XYQ A;  1KNE A;  1LTI D;  1GUW A;  1PFB A;  1O7Y A;  2F0D A;  5CV7 A;  1BBX C;  3OMC A;  1HQM C;  3K57 A;  1HXY D;  5EPL A;  1CM9 A;  1EY5 A;  2FMM A;  3MFG A;  1F2L A;  5BN5 A;  3GTQ B;  1G8Z D;  4FYD A;  4F7X A;  4XDX A;  1TT2 A;  2FMC A;  2JXM B;  5JPN C;  5C44 B;  3TME A;  2L12 A;  2I46 A;  1FNW A;  2TSS A;  4JBW A;  3I72 A;  2PZT A;  2A68 C;  1M4V A;  4ZLT F;  4KK7 A;  5LL6 S;  3U9O A;  1TS4 A;  1E2W A;  3I8Z A;  2X69 A;  3KLS X;  1TY2 A;  3EJI A;  4NDX A;  2RQX A;  2ZXO A;  5EJW A;  1EQV A;  2KCC A;  4QIW B;  4A3F B;  4G7O C;  4ZRZ A;  4OHJ A;  1H9R A;  2E75 C;  3MZ5 A;  1TY0 A;  1G2S A;  1YNJ C;  4HN7 A;  3H0G B;  2D9U A;  1BDO A;  2XRS D;  3V05 A;  4ZAI A;  1PTO F;  2L0C A;  1WTW A;  5J22 A;  1OXX K;  1ENF A;  4BA2 I;  4J6H A;  1DM0 B;  3PO3 B;  3RMH A;  3VR5 A;  4HMI A;  4C1N I;  1DOL A;  3P75 A;  2KEE A;  3UI2 A;  3SDZ A;  3T13 A;  3BDO A;  3Q22 A;  4Y7N B;  3DXJ C;  5F2D A;  1NSN S;  4PNY A;  1CI3 M;  1LAC A;  4G57 A;  2NZ1 D;  1JC7 A;  1CQV A;  3IL8 A;  3VA5 A;  1W6J A;  1XX8 A;  4DAP A;  4DFA A;  1SMY C;  2XRQ D;  2HCI A;  3QB3 A;  1ML0 D;  2Q8I B;  4B9W A;  2AWN A;  5M5Y B;  1Y69 U;  3SR1 A;  4F88 A;  1S5F D;  1Q12 A;  4OO1 H;  2BE5 D;  1KDB A;  4ZYS A;  5M3M B;  1KDC A;  2EDG A;  2PO4 A;  2F0T A;  3A7L A;  2LFN A;  4B9X A;  5JJZ A;  5C4J B;  2K32 A;  1EY7 A;  3RZD B;  1VDZ A;  3HGB A;  4EQO A;  4IFD H;  2K01 A;  1JCK B;  4A3E B;  5C5L A;  1DJR D;  4PMW A;  1FNV A;  3TBI B;  1LO5 D;  1EEF D;  4K14 A;  1WD1 A;  4IUR A;  1F2Y A;  1SJE D;  4H13 C;  1STA A;  3TP7 A;  2JYO A;  5A35 A;  3PUZ A;  4YIJ A;  4G7Z C;  1R4Q B;  1RCV D;  2NVX B;  1PMR A;  1DXM A;  5I2X A;  1J8I A;  1F9S A;  1PTO B;  2PW7 A;  4TKO B;  4RH6 A;  4FXD A;  1IW7 C;  3NHH A;  3KLS A;  5K36 G;  1I4X A;  1LLR D;  2A69 D;  4NP5 A;  3I4L A;  2E2I B;  3L7Z C;  4CKE A;  4C2M B;  3S15 B;  2SNM A;  1LAB A;  2OXP A;  4KKU A;  1TR5 A;  2IX3 A;  5IGB A;  4CJ0 B;  1JWS D;  1SEB D;  2K5Q A;  4U68 A;  5KEE A;  3DHQ A;  4RKB A;  4RCN A;  1BOS A;  1B9M A;  2Z8L A;  1X32 A;  1U4M A;  4O42 A;  1D6E C;  1MBY A;  2O4X A;  3NQI A;  2SOB A;  4KY5 A;  2F0E A;  3RUZ A;  3D4W A;  2VNU D;  1AW7 A;  3VA7 A;  4UAI A;  3EFX D;  4C3H B;  1VF5 C;  1W6K A;  1G91 A;  3PUX A;  2EY2 A;  2DNE A;  1J9O A;  1PTO C;  2F0O A;  4TSS A;  4X3S A;  1ZYR C;  2WKD A;  3K5O A;  1A6X A;  3GTM B;  5T1I A;  2WB1 B;  3OPO A;  2NVY B;  4RGO S;  2EY1 A;  2M00 A;  1RHP A;  3MC0 B;  4QF4 A;  3K59 A;  1AFP A;  2K03 A;  2MJ8 A;  1CHP D;  3NTH A;  1Y8O B;  3C3L A;  3URY A;  5C5M A;  1HUM A;  4CKB A;  1PFN A;  2L55 A;  1SNP A;  4ZUJ A;  1HFN A;  4KJO A;  2B2W A;  5FLX E;  2BDN A;  1HA5 A;  2PMZ B;  3PUW A;  2CQA A;  1GUS A;  1QE6 A;  2D2C C;  3S1M B;  2KCN A;  3VYR A;  3R2I A;  3IKJ A;  3GV3 A;  1ONL A;  1GUO A;  1ROD A;  2MPM A;  3NE5 B;  1R9T B;  1S5C D;  2F0V A;  2VB2 X;  3KBG A;  2ZT9 C;  1Z7T A;  4CJ1 B;  4XIG S;  1JR0 D;  3GP7 A;  1Z47 A;  4QMG A;  4UDU C;  1HRJ A;  1LT3 D;  5KYL A;  2A6H D;  4IZ8 A;  1B3A A;  3Q6S A;  4HED A;  2PZU A;  2EE1 A;  3GO5 A;  3MFY A;  4QB4 A;  3VYT A;  5I4D A;  2EYP A;  2EZV A;  3P1H A;  3VYS A;  4DAV A;  3ND8 A;  1TQO A;  2Z4I A;  1LTA D;  4BY7 B;  1BO0 A;  2DY8 A;  4OO1 I;  4K5V A;  3NQT A;  1ZEQ X;  4KD4 A;  3AU7 A;  1R4P B;  4C56 C;  1F9R A;  1SYD A;  4J1M A;  3DWP A;  3QG1 A;  1Q1E A;  4IFD I;  4MN3 A;  5JAV A;  1NR4 A;  1KTK A;  1QCB D;  1QJO A;  2J7Z A;  4KJN A;  1ZKO A;  4V0B A;  2XSC A;  1JQY D;  1STY A;  3F2U A;  3D8G A;  1RTN A;  2F0S A;  2AUJ D;  5CV6 A;  1BF4 A;  2EYO A;  4XQJ A;  3FPU B;  4ABN A;  5C4X B;  1RTO A;  5COY A;  1ET6 A;  4F87 A;  1CA5 A;  3R3O A;  1AZQ A;  5BN3 A;  1GJX A;  1B2T A;  4IUU A;  4DNT B;  1STE A;  1CT1 D;  2QF7 A;  3SE0 A;  3RLF A;  4BBS B;  1U4P A;  2NVQ B;  2RVL A;  4X3T A;  4IFD J;  1F9P A;  3S1N B;  5IGD A;  4ZQ3 A;  1D5X C;  3H94 A;  4R8N A;  3WOE A;  2R92 B;  2KHS A;  1V43 A;  1A3V A;  2PZW A;  3I90 A;  1QNK A;  5EBC A;  4CKC A;  5M5W B;  1EOT A;  2NUC A;  1I4H A;  5JEA H;  4KMU C;  1OXU A;  1STB A;  1NAP A;  2FIN B;  3E6Z X;  1TS5 A;  5T1G A;  1QB5 D;  2F0U A;  1I4R A;  1ESR A;  5D14 A;  2QIL A;  3T51 B;  1XWE A;  4OL7 A;  1PZI D;  3BVG A;  1H9M A;  4FF3 A;  3EA6 A;  1SXT A;  1Q8I A;  3TZU A;  3FKI B;  5FO7 B;  3CU7 A;  2FFK B;  5IT9 L;  1I4P A;  4Q5V A;  1NR2 A;  3SK6 A;  1CZW A;  3DUZ A;  3I91 A;  4F8M A;  2B2T C;  3RZO B;  1XXG A;  2XWB B;  3OWF A;  1K8O A;  3V2T A;  1HUN A;  1EIH A;  4L8J A;  1FGB D;  4HCS A;  2EJG C;  3EQL C;  3SK5 A;  1TWH B;  2NN6 I;  3S1Q B;  2RDG A;  2R93 B;  2F0J A;  3MA2 B;  3NK9 A;  1TWC B;  4X3U A;  2BA1 A;  2IWH A;  3OSO A;  3BZD B;  3PO2 B;  3K5N A;  5J1Z A;  4N9T A;  5G3L D;  5K5P A;  4DA2 A;  1EWC A;  2KUM A;  1CFM A;  4RKL A;  2B2U A;  4KY6 A;  1STH A;  2B39 A;  4KKT A;  2JSO A;  5LL6 X;  2BE5 C;  2RDF A;  3S2H B;  3JAM L;  2OEO A;  5LHY 1;  3J7Y W;  2A6E D;  3D3R A;  2J0T D;  4I7Z C;  2LY7 A;  4XTC S;  5K36 H;  1UEA B;  3A8K E;  3L9A X;  3K5M A;  4IAL A;  2K7V A;  1I4G A;  3S16 B;  2L9H A;  1QG7 A;  1VMP A;  1ILQ A;  1TKW B;  2FHT A;  3HKZ B;  4P2C B;  3NBH A;  3IFT A;  5FK9 C;  2EVB A;  2CW0 D;  3M4O B;  1EWH A;  4PMB A;  3Q24 A;  4RCO A;  3QJY A;  1I3Q B;  1D1K A;  3HOZ B;  2NTS A;  2AUK A;  1H9S A;  5ELB A;  2WAQ B;  3OWE B;  5IOD A;  3R2T A;  5EQ0 A;  3R93 A;  3MWY W;  2BOS A;  1B50 A;  4OIJ A;  4PQX A;  3L3O C;  4NMZ A;  3KLR A;  4FP5 D;  2X6L A;  3BVM A;  5KND A;  2JA6 B;  5EKI A;  1STN A;  2XNA C;  1YNN C;  3I4M B;  2A69 C;  1S5D D;  2J4X A;  4XT1 B;  1BR9 A;  3C1F A;  5CV8 A;  2R61 A;  2EYM A;  3HRZ C;  3S1R B;  2TMP A;  1BNZ A;  1X3P A;  1SAP A;  2AWO A;  3I3C A;  1GOZ A;  1EL0 A;  2NB0 A;  1LT6 D;  3GV6 A;  4BWG B;  1EY8 A;  1X3Q A;  4ID6 A;  1SE4 A;  2SNS A;  1WTX A;  1H9S B;  2BA0 A;  2R6G A;  4U67 3;  5DM6 3;  2SDF A;  3HS0 C;  5M9O A;  5JVH 3;  3OOC A;  3Q23 A;  4S3S A;  3J81 E;  2B2U C;  2MGS A;  2HDL A;  3CRL C;  3ND9 A;  3HOW B;  1MD2 D;  4KD3 A;  3D6C A;  1PTO H;  1S5B D;  1LT4 D;  5ELC A;  3H3V C;  4HAE A;  2MUY A;  3MTS A;  1H9J A;  1STG A;  1D2B A;  3PUV A;  5IGG A;  4DU9 A;  4RFB A;  1S4Z A;  1V8Q A;  5I9P A;  4XT3 B;  4DK1 A;  1F9Q A;  5FO9 B;  4HTH A;  1SNC A;  4ME5 A;  2K6A A;  1IL8 A;  4H7B A;  1YNN D;  1S5E D;  2F0N A;  2VB3 X;  2KOL A;  2D5D A;  4OGQ C;  5ELE A;  4RGN A;  1CTM A;  1RF2 D;  5JEA J;  2D62 A;  1OXT A;  3AMU A;  4WOR A;  3FEW X;  2EY6 A;  2BDO A;  3OW7 A;  2JE6 I;  1PZK D;  1MI2 A;  2A6H C;  2G9H D;  4FF4 A;  3NWS A;  1F2Z A;  1Q3L A;  5ELD A;  2E2J B;  2L1B A;  2KEC A;  3CKI B;  3A8J E;  1LTG D;  3HZX A;  4WJW A;  1CK1 A;  5E4W C;  3LNN A;  3P20 A;  3PV0 A;  3BVZ A;  4H0L C;  3TP6 A;  1B9N A;  3NUC A;  1AZP A;  3BG3 A;  1VF7 A;  3DEO A;  3VR4 A;  1LTR D;  2HUG A;  3X3M A;  2IPK D;  3KBX A;  1VMC A;  4PV1 C;  1Z6H A;  2XVS A;  5G3L F;  4BS9 A;  4K8J A;  2E2D C;  3NWT A;  4KI0 A;  3KUP A;  5CGK A;  2O5I C;  2JEB I;  1RJT A;  4FF1 A;  3BS1 A;  1BXT A;  1UNS A;  5COR A;  5C0X H;  2E76 C;  2EYJ A;  4XYO A;  2DY7 A;  4MIU A;  3LWU A;  4L63 B;  1NUC A;  1DCZ A;  4OO1 G;  4DF7 A;  2L5T A;  2IL8 A;  4HCE A;  2F0W A;  5ISR A;  1O78 A;  2PYK A;  3J80 E;  1PRT D;  4LJZ C;  2EY5 A;  5KNC A;  4HMJ A;  1WD0 A;  4V19 0;  2B2Y C;  4IFD G;  1ENA A;  3GTP B;  3TP5 A;  4DXG A;  3ZYY X;  1OXV A;  2XN9 C;  1IYU A;  3T53 B;  2XIW A;  3PUY A;  3MAQ A;  2E74 C;  4MHE A;  1OXS C;  5E1F A;  2PPB C;  1C8C A;  3D6W A;  1SSO A;  2O2L D;  3DEP A;  2PQE A;  4WFN 3;  4A93 B;  5I6W A;  3A8I E;  4HR7 B;  2RKS A;  4RHS A;  2B2T A;  4TQU S;  1CA6 A;  4FF2 A;  2QCP X;  3VR3 A;  5FKA C;  3S14 B;  2M2L A;  1BCP D;  3CRK C;  1TS3 A;  3QOJ A;  4QUF A;  3WDN A;  1GHJ A;  3WOF A;  2YU9 B;  1PXU A;  2WAC A;  2Q8T A;  3C2P A;  2HQE A;  4KY7 A;  5JVG 3;  1D5Z C;  4LK1 C;  1CZG A;  1DD2 A;  3P7J A;  3VR2 A;  2JA8 B;  3K6O A;  1A15 A;  4LAA A;  2LKV A;  3HG9 A;  5CV5 A;  2K04 A;  1SE3 A;  1PLF A;  5C4H A;  5IIF A;  1Y1V B;  3T56 B;  5FO8 B;  3A55 A;  2WP8 J;  1KLU D;  1B4O A;  1GUN A;  2K05 A;  1LTT D;  1LT5 D;  4Q0F A;  5IGE A;  2JA7 B;  1EU3 A;  1HCZ A;  2A74 C;  3E5S A;  4ILW A;  3HOV B;  3QO2 A;  1JWU D;  4KTA A;  4M8A A;  2RBM A;  2WV6 D;  2A73 B;  1ENC A;  5JOB A;  4IQZ A;  1ET9 A;  4ZUI A;  1WTQ A;  4DXF A;  4BBR B;  4NW2 A;  5BN4 A;  5CBE E;  2JA5 B;  2LMC B;  2VUM B;  3H09 A;  2ICE C;  3MXN A;  1JOQ A;  1SFO B;  1EYA A;  3IFD A;  2NN6 G;  3ONA B;  3FPP A;  1DZ1 A;  2A6E C;  4CHT B;  4Z9C B;  3DWA A;  1EZ6 A;  1PZJ D;  1DOM A;  4FXG C;  1Q90 A;  2IW3 A;  1SNM A;  1L0X B;  4A3I B;  3S17 B;  2C5C A;  4DNR B;  4K5W A;  1KNA A;  1TWF B;  4A3K B;  1D1I A;  2EYL A;  4NKL A;  4C1N K;  1TU2 B;  2X6G A;  2EXZ A;  2CW0 C;  3C1E A;  1QOH A;  3HEJ A;  5IGF A;  5NUC A;  3R8B A;  3GTG B;  3W3A A;  5KIX A;  4IUT A;  4R9W A;  2SEB D;  2AQ3 B;  5EKK A;  2H4O A;  2K5W A;  4E6I A;  5FLX L;  5CV4 A;  1I6V C;  2F0K A;  2G9D A;  4HSV A;  3ERQ A;  3VR6 A;  3K7A B;  3D4D A;  3MXP A;  4ODG A;  2B2V C;  4K5X A;  2DN8 A;  3NP8 A;  3DMU A;  2IX1 A;  4X3K A;  5I6Y A;  1TS2 A;  5KNB A;  5EPK A;  3E0J A;  3EVQ A;  1KLG D;  1ILP A;  2WKC A;  2I07 B;  5C0X I;  1EY9 A;  3FDT A;  3I73 A;  3J80 L;  5DEH A;  1O7L A;  3OMG A;  5IGC A;  3D31 A;  3MHB A;  1BUV T;  3ITP A;  3NSW A;  3HOX B;  5D65 A;  2F0Q A;  1SND A;  5EBD A;  3A7A B;  1GUT A;  2A5H A;  3S2D B;  3TP8 A;  2L4N A;  4L6T B;  2Y0S B;  4KHV A;  3OIP A;  5ELF A;  1HPC A;  3CQZ B;  2F3V A;  2EOT A;  3LX0 A;  1V1O A;  3BDL A;  2ENB A;  3KF8 A;  1A2U A;  4ZKC B;  1PRT F;  1E0B A;  2R3Z A;  5CV9 A;  4BA1 I;  3M3Y B;  2JP1 A;  4IUV A;  1HA6 A;  5D3D A;  4XQQ A;  2EYH A;  3RD4 A;  1GHK A;  4AYB B;  5C0X J;  4DN4 M;  4XXE A;  3C46 A;  3I70 A;  3SXH A;  3W2D A;  5EGT A;  1PYW D;  1I50 B;  1RD9 D;  1PFM A;  4HSP A;  4EQP A;  2F0H A;  3NBI A;  5J39 A;  3MXG A;  1M8A A;  1SNQ A;  3GTO B;  2YYZ A;  3NTI A;  2B8F A;  4FXK C;  3T16 A;  1BCP F;  4A3J B;  1DYQ A;  4C3I B;  5JEA G;  2K5D A;  1Y1W B;  5CBA E;  2KA7 A;  3GTL B;  1U9R A;  3K0Y A;  4XQN A;  3TZD A;  2Z1C A;  5HUR A;  1SYE A;  1SBB B;  2LS0 1;  1HFG A;  2GA4 B;  2HDM A;  1B44 D;  5E3F A;  3U9S A;  5C3X A;  4RA8 A;  1SYB A;  1D5M C;  5TSS A;  2ICI A;  1Y8P B;  2L11 A;  2H1E A;  5DAU A;  5I9O A;  2R7Z B;  4O1N A;  1E2V A;  1Q1B A;  5FOB B;  3QWN A;  1SDF A;  2BCO A;  5KYI A;  1PRT B;  2A68 D;  4DGZ A;  4EVO A;  3M4Y A;  2F3W A;  1H9K A;  3FVQ A;  3DM1 A;  1KAB A;  1WVL A;  2F0M A;  3H6M A;  1G2T A;  1C4Q A;  4N9P A;  1MSG A;  1ICW A;  3G6J B;  2HCC A;  1HTL D;  1B53 A;  5AFW A;  3A54 A;  1AP0 A;  4LMQ D;  1SE2 A;  1JOK A;  1PDQ A;  2OF1 A;  2PW5 A;  1II3 A;  2B2Y A;  3GD7 A;  1YNJ D;  2AQ1 B;  1A3T A;  2NWG A;  1F77 A;  2MP1 A;  1WTR A;  5EKL A;  3MVV A;  5CYU A;  4DK0 A;  1BCP B;  2ID0 A;  5C3W A;  1AN8 A;  4PMC A;  1PRT C;  5C6A A;  2EJM A;  2F0F A;  3NTK A;  1E2Z A;  3KK7 A;  2KVM A;  1QNU A;  1TWA B;  2IJ0 A;  4G4K A;  4C3I G;  4WRD A;  2Z4H A;  3PIO 3;  1SMY D;  3GTK B;  1LV9 A;  1FNU A;  3CHB D;  1SNO A;  4ZKB B;  3OHX C;  1HTP A;  2IX0 A;  1B1Z A;  1EQT A;  2F0G A;  3V96 A;  4R8I A;  3HOY B;  1MSH A;  4EGV A;  1TVX A;  1AEX A;  2RA4 A;  2F0L A;  2NYZ D;  2C9O A;  1T5X D;  5DM7 3;  4G7H C;  4KHZ A;  5CC4 A;  2KJX A;  3OIQ A;  1BCP C;  2NBF A;  2QDB A;  1I6H B;  1GXD C;  1CQF A;  2ZXP A;  3X3N A;  5M3F B;  1A3U A;  1EY4 A;  4KN7 C;  1FD7 D;  5IT9 E;  2F1M A;  4B08 A;  3ERO A;  1JE4 A;  3G7L A;  2M9V A;  4RGT A;  3FMC A;  4A3M B;  1SJH D;  4K8I A;  3QIA A;  1WTO A;  3DWQ A;  3SK8 A;  5EPJ A;  5C4Z A;  5A2Q E;  1EZ8 A;  1WTV A;  4RHR A;  2NN6 H;  3SK4 A;  1KDA A;  2PCF B;  4IUQ A;  1TWG B;  4DAY A;  3K5L A;  2JEA I;  1EYD A;  4IUN A;  4CGY B;  3M7N A;  1IW7 D;  4JK1 C;  1A2T A;  1HQR D;  2MHV A;  2F0I A;  3BYY B;  2QEJ C;  4A3D B;  3IAY A;  4KKS A;  2WII B;  4M1U B;  4K6L A;  1BQQ T;  1V1P A;  1U4L A;  1C48 A;  1JOR A;  1IHZ A;  4OIK A;  5C3E B;  1WTP A;  1EY6 A;  3H91 A;  5IOC A;  5CMD A;  4I65 A;  2RDH A;  2ZXR A;  4C3J B;  1FYC A;  1SYF A;  2RSO A;  5E4X A;  1KAA A;  2WIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...