1ILPA

Cxcr-1 n-terminal peptide bound to interleukin-8
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTERLEUKIN-8 PRECURSOR)
publication title Structure of a CXC chemokine-receptor fragment in complex with interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ilpA00
2EOTA 3LWEA 1C8CA 1MI2A 3KBXA 2BDNA 2B2UA 5T1GA 1EIHA 2RSNA 1B2TA 1CM9A 1U4MA 4HSVA 1WTXA 1ZXTA 2DY7A 4RAUC 1RTOA 4CJ2C 5E4XA 4ZAIA 1VMPA 1WTWA 1KNEA 2KOLA 5CBAE 2NYZD 1ILPA 1EOTA 4XT3B 1G91A 5EPLA 4HAEA 1O7YA 1J9OA 1EQTA 4ZK9B 2R3ZA 1B4OA 5EKIA 1AP0A 5T1IA 2MJ8A 2FJ2A 2EE1A 1CA5A 1F9PA 1F2LA 1XX8A 1TVXA 2HCIA 4HEDA 4IURA 4ZKCB 1WD1A 1WTVA 4R9WA 1IKLA 5DNFA 1DOLA 2FFKB 2KUMA 5EQ0A 1HA6A 1ILQA 1MGSA 2RSOA 1CA6A 2Q8RE 3FPUB 1Q3LA 4IUPA 3DEPA 1B50A 4XDXA 5COYA 1RTNA 5D14A 2MP1A 1NAPA 4U68A 5EPKA 1BBXC 2HCCA 2KVMA 2SDFA 1F9QA 1X32A 4R8IA 2MGSA 2B2WC 1DOKA 2L12A 3MTSA 4X3KA 4X3TA 3KUPA 3H91A 4QUCA 1HUMA 3P7JA 4IUTA 1A15A 3IFDA 4NW2A 1U4RA 2DY8A 1JICA 1NCVA 1WTPA 1BO0A 2B2VC 2FINB 1PLFA 2JYOA 1KNAA 2Q8TA 4CJ0B 1HFNA 2FMMA 3I3CA 1U4LA 4OIKA 1BF4A 2J7ZA 4OIJA 1DONA 1G2SA 2D9UA 1DOMA 1QG7A 5D65A 4ZLTF 2KEEA 2KEDA 3D6WA 1QE6A 4RA8A 2K03A 1RHPA 5EPJA 1IKMA 1HHVA 3SVMA 1ESRA 1F9RA 4X3UA 1S4ZA 4IUQA 2RA4A 1RODA 2B2TC 3DM1A 3G7LA 1U4PA 2IL8A 1QNKA 2X6GA 3I8ZA 4HCSA 1O7ZA 1RJTA 2B2YC 2B2WA 3DEOA 1LV9A 2L9HA 2HUGA 2K28A 4LMQD 4XT1B 3TZDA 3UI2A 4QUFA 1WD0A 2EPBA 1GUWA 1SAPA 1SDFA 2MPMA 5CMDA 1PFNA 2L1BA 3F2UA 2B2VA 4IUUA 4UAIA 4IUVA 1PFMA 2N55A 2NWGA 3N52A 3ONAB 2FHTA 2HDLA 1X3PA 4MHEA 3QO2A 2K04A 1E0BA 1MSHA 1B3AA 2K1BA 4X3SA 1NR2A 3R93A 4DN4M 2RVLA 3TN2A 2K01A 2VXWA 1EL0A 2NZ1D 1HUNA 1ML0D 2M2LA 3FDTA 5JJZA 1G6ZA 2B2TA 4O42A 3MWYW 1XYIA 1J8IA 2H1EA 3GV3A 2B2YA 1IL8A 1ICWA 5CORA 3HP3A 2JP1A 1B53A 2CVRA 3I91A 1SSOA 1M8AA 1G2TA 1HRJA 2B2UC 1DZ1A 5AFWA 5E4WC 3GV6A 1WTRA 1VMCA 3I90A 4MN3A 1PFBA 1EIGA 1O80A 3Q6SA 5CBEE 1WTOA 4CJ1B 1JE4A 1HFGA 1F9SA 1X3QA 2K05A 2XIWA 4RWSC 1NR4A 2X6LA 5EJWA 2N88A 2HDMA 1WTQA 2X69A 2L11A 1PDQA 1MSGA 3IL8A 4ZKBB 1WVLA 1AZQA 2KECA 2L4NA 1BNZA 1AZPA
chains in the Genus database with same CATH superfamily
3H3VH 1YEZA 1MI2A 3A8JE 2OCEA 2Z6BA 3CAMA 3GTKH 1CM9A 1U4MA 5FLXc 2DJGC 4RAUC 5LHY1 1R4QB 2E75C 3TP6A 2I46A 1SE3A 1G91A 3OIQA 4RG1A 2RDFA 2C35B 1D5ZC 1XNRQ 1U5KA 5EKIA 1XX8A 4ID6A 5IYBG 3GTKB 1UEAB 1YBYA 4TQUS 3NK9A 2IY5B 4P74A 3NQIA 3A54A 1ZEQX 2AQ2B 1RDPD 1XNRL 1XTCD 1JJCB 1EQQA 2E76C 3J80c 1I6HB 4F88A 3W1BA 1VQIA 1SFOH 4XQJA 4DV4Q 5M3FB 4H44C 1HUMA 3MEHA 4IUTA 1GVPA 3A5UA 5LL6S 3Q24A 3QG1A 4PMCA 4HIKA 4CJ0B 2N3SA 2FMMA 2JK8A 2DNCA 3T1HQ 4CGYB 4C1NI 4DV4L 1M90C 1VQ6A 1QG7A 3M9BA 2Z8LA 3K58A 3UDGA 4K6DA 1FVIA 3QOLA 4X3UA 3FKIB 3RD4A 2QKIC 1JORA 3VR4A 2L9HA 1ICFB 4KN4C 3GP7A 4IPCA 1V43A 3HKSA 3NENA 1DYQA 2BE5D 1K3RA 2B8GA 4BBRH 1SYBA 1TQOA 2EY1A 2LMCB 4JOIA 4QIWE 2PZTA 1Q7YC 4RHSA 1ET6A 5JAVA 1JMCA 1VQNA 3JC66 4ODGA 4DPGA 1KC8C 4OGQC 4OEMB 3LGJA 2IWHA 3FDTA 3VR3A 5HURA 1J8IA 2NVQH 1IL8A 3KK7A 3HOXB 1JB7A 1UE7A 4RHRA 1WYDA 2JA7H 3SDZA 3BZCA 2E2JH 2NTSA 3MXUA 3Q8DA 3RN2A 3RZOB 3HFZB 3EA6A 1OXVA 1EIGA 1WTOA 3QJYA 3J80L 1JOOA 1K3BC 2N88A 1X65A 3W2DA 2OWOA 4GN3B 1VF7A 1O7LA 1IBKQ 4EVOA 1Y1VH 5ELBA 5I4DA 1ASYA 2OEOA 3GQBA 4JI6Q 3J7A5 2ZXPA 4A93G 2DY7A 2WKDA 1IW7D 2Z4HA 4IFDJ 2NYZD 1ET9A 1IBKL 2RCNA 5JEAJ 2QGQA 1TWCH 2R3ZA 4JI7Q 2FJ2A 1D1KA 5FK9C 4R4QA 5HGTA 4B3MQ 3VYTA 1PH5A 4LFBQ 5EQ0A 2Q2UA 5LMUL 1X9NA 4JI7L 1BOSA 5COYA 2MNAA 2G9HD 1TWAH 2IHFA 2Z9HA 4A3KH 2HCCA 1ENCA 3HKZG 1F9QA 1G8ZD 4YCWA 3I4NH 3K7AH 4GZYC 3SK5A 3MAQA 4JI0Q 3AEVA 2TMPA 1EY8A 3OW2A 1KNAA 4TVAB 3W1GA 3S15B 3GTLH 2IHEA 4CDEC 4OIKA 1G2SA 3ZYYX 2PQEA 4JI0L 4OO1H 3I4NB 4ZLTF 2I07B 3HZXA 1I4QA 1RHPA 1WFQA 1GJXA 3AFQA 4IUQA 1UEBA 4DV6L 4DNIA 2HQLA 3DEOA 1FJGQ 4GNXC 3PQIA 2WB1E 3PUWA 3OHXC 2ICIA 3JAMc 4KV6A 2JSOA 5CMDA 2JJQA 5IWAQ 2B2VA 3HOVG 5CR3A 3I2ZA 1Y8OB 3TRZA 4LAAA 5J1ZA 4FXGC 1FJGL 2EJGC 1X3PA 5IP7G 1YHQA 1B3AA 2RVLA 3AU7A 2PNHA 2QW7A 5IWAL 4DV7Q 3CPFA 1C0AA 3MWYW 4N9PA 4IFDI 1YITA 1JWMD 1HR0Q 1D6EC 3H0GG 2KENA 4BY7B 4QGUA 4NP5A 4J15A 4KTAA 1O7IA 4K5WA 3J81L 2LXJA 3UDIA 4DV7L 3AQQA 3AB9A 3W3AA 4XTCS 5IYDH 1FYCA 1HR0L 4A93B 4RKLA 1KDBA 1STYA 1O80A 1YJNA 1VQOA 2AMCB 2A69D 2F0DA 2R6GA 3BDLA 4Q0FA 1FNUA 4H02A 3R2IA 3IL8A 2IX0A 2L5TA 2NVYB 2E74C 3KBXA 5T1GA 1GD7A 3IKJA 4E6IA 4B3RL 3PV0A 3PO2G 4IJLA 1ENAA 3J7AV 3HKZB 3OMCA 4HAEA 3IAYA 3KFUA 3TREA 2B39A 2VUMG 3PF5A 4QY7A 3U9OA 3GTGH 1TVXA 1EY4A 4KHPQ 2O2LD 5AJ3Q 1HNXQ 3HOUB 3WOEA 2EVBA 2P5ZX 4JI4Q 2XRSD 4RMFA 3T53B 4JBMA 3U58A 1ZKOA 2AUJD 4V0BA 3I73A 4UP8A 3TMEA 5M3MH 1CZWA 3QR8A 3TQYA 3NTIA 4KKTA 4KHPL 1X32A 4EQNA 1H9JA 5AJ3L 2O5IC 1PTOC 1HNXL 4JI4L 1E1OA 1K28A 4A3LG 2DY8A 2EYHA 3M3YB 2YTVA 5CV7A 4EQOA 5ELOA 2I5LX 4YIJA 2UUBL 3DXJC 2JA8H 5M5XB 1D5XC 3PO3G 1TKWB 3DUZA 3RN5A 1RKNA 4IO9A 1E2VA 1NNXA 4FF3A 3CD6A 1KTKA 1SDFA 4N8FA 1PFNA 3H0GB 1S5ED 1JR0D 2R7ZG 3Q22A 3A8IE 1SE4A 2N55A 4LJZC 2FXQA 2ZTDA 4A3IH 3HOWG 5M5WH 2A74C 2K1BA 1EQRA 3T13A 3TN2A 3I56A 4RGMA 4JBKA 3HS0C 2ZJQA 1V1PA 1VS0A 1A8VA 5CV6A 5C0XH 1HNWQ 2Z1CA 1L0YB 4FO2A 4YY3Q 1L2FA 3I91A 4BY1G 3RNUA 2BA0A 4L5RC 3OOCA 2NVXB 4LUZA 5AFWA 4DR4Q 3CQZH 3K6OA 2J4XA 1KD1C 1K8MA 2Q2HA 3PO2B 4A3GG 4DFAA 1UUPA 1F9SA 2MQHA 1A63A 4X66Q 4DR4L 2VUMB 1DONA 1Q8KA 3IRBA 1QVCA 1STNA 5DLQE 1FL0A 3BDOA 1GUGA 2B2UA 4JBJA 5I2YA 4X66L 4CJ2C 3BVGA 1A3UA 1BDOA 1KNEA 2K7VA 4P71A 2L0CA 2PO4A 5M5YB 3KJPA 3SEBA 4IURA 1EUJA 4WORA 1IKLA 2F0NA 2O5JC 5IT9c 1YIJA 1CQVA 4WJ3M 3A8KE 1U9RA 2YTYA 1VQ5A 1ZYRC 2SNMA 1PH2A 3GTOB 5C3WA 4DAYB 4O0AA 4B3TQ 1DXMA 2ID0A 3NBHB 2CCZA 1LTLA 4KHZA 1U4LA 1VQJA 2K5NA 1BF4A 2R7ZB 3G6EA 2D0OA 3K81C 1VQAA 4C3JB 4B3TL 1Y1WH 3HOWB 1IKMA 1GUSA 4DAVA 1EY7A 2IL8A 3S2DB 5IGGA 3K59A 2KCTA 3M4PA 3MFGA 4A3EH 1LACA 1AH9A 3F2UA 3CW2C 2ICEC 2WAQE 4BY1B 2MFIA 5FLXE 3KYHC 1Q90A 4R4OA 3NWSA 2G5DA 2F52A 2KBNA 2VXWA 4C2MH 4FXKC 1BCPF 3CU7A 1PTOF 4FNFA 4JCVE 4A3GB 3GV3A 3QOJA 5CORA 3HP3A 3KLSX 2RCFA 4BA1I 4JYAQ 3I4MG 1TWHH 1CUKA 1BQQT 3S1QB 4AIMA 4DGZA 1KRSA 1CKNA 2CW0D 1QVGA 4DAYA 3EN2A 2VY3A 5IE8A 1IXRA 3J80E 1MJEA 2F1MA 1SROA 1Q12A 2A6HC 3NBHA 1TS2A 1TWFH 4JYAL 2WKCA 1JE4A 1LTGD 3Q0AA 2A68D 1M4VA 1V9PA 2J0TD 4DR1Q 1BBWA 2PW5A 3K5MA 2R93G 2JA5G 3GD7A 4OHJA 4F8MA 1I3QH 1C9OA 1CKMA 5C3EH 5E4XA 2OQKA 4DR1L 2QILA 3RZDH 3TBIB 4A3BH 4WJWA 4R8NA 1OO9B 1BKBA 3L9AX 1AP0A 1SLJA 4Y7NH 1F2LA 3VYRA 3GTJH 1HQMC 3HOYG 4C3HG 2KA7A 3K0YA 1MGSA 4KLKA 1IHZA 2HQEA 4DUYL 2EQSA 3NSWA 1NAPA 5EPKA 3PIO3 4R8IA 4FXDA 4Y52H 2B2WC 2L12A 4KKUA 1LTRD 4LFCL 3Q23A 2RDGA 4DR7Q 2F0KA 1ENFA 4EQ5A 2WFWA 3M4QA 3P7JA 1A15A 4FVMA 2BH2A 1EU3A 3W5OA 2B63G 4JBWA 5G3LD 4KD3A 3BZDB 1KAWA 2AWOA 1LT6D 3K5OA 4CDFC 1NUCA 2QF7A 5JJIA 3D6WA 2NVTH 3M4YA 2F0IA 2RDHA 4B08A 3H6MA 4P75A 5ELNA 4HMIA 3F2DA 1EYCA 1PYWD 2TSSA 1LV9A 1WD0A 1GUWA 3E6ZX 5CGKA 2EPBA 2AQ1B 2BA1A 2F0QA 2AHOB 2L15A 2EY6A 2V4DA 2RHQB 3CCQA 1XMOQ 3I4MB 2FHTA 3F1ZA 5KYIA 4MHEA 3QO2A 4OWXB 4X6AH 3DM3A 3I4OA 3D4DA 4DV0Q 4B9WA 4A3DH 4GNXA 4FYDA 2NBFA 4CBVA 2SEBD 1X54A 4DK0A 4NXMQ 4K5XA 5FO9B 1G2TA 2R93B 4DV0L 3WDNA 1EQVA 3S1MB 5EAYA 1EU4A 1YNJD 4X64L 1YNND 1KQSA 4NXML 1VQGA 4ZYSA 2N78A 4BA2I 1R9TB 2LKVA 5C44G 2VB2X 1SNMA 1SMYD 5CV9A 2ES2A 5FJ8H 1K8AC 1AZQA 3NHHA 4IOCA 3HOYB 4C3HB 3VR6A 4A3FH 5IP9G 1IBLQ 1GHKA 4ULLA 3ULLA 1WTXA 1Q46A 1ZXTA 4X65L 4HIDA 4A3MG 1NJIC 1IBML 3S17H 3U9SA 2C9OA 2CWAA 3CXCA 1O7YA 2K5WA 1IBLL 4A3FB 1RIPA 5HY6A 1F9PA 3JAME 4ZKCB 2Q2IA 3MVVA 1WCMH 5IODA 2B63B 1MKHA 1WTHA 5KNCA 2MO1A 3ERQA 1HTPA 4YWKA 1B50A 3F8TA 1ONLA 2JEBI 4IFDH 3OIPA 4JG2A 1BBXC 5JEAH 3MTSA 1WCMB 4X3TA 5C3XA 2UXBQ 1LT3D 3UE1A 3IFDA 1JICA 4CKBA 3GO5A 1QZHA 1I6HH 2F0WA 1H9SB 3D0FA 1NY4A 2D9UA 2UXBL 4OXPA 1QE6A 3G71A 5M3FH 3NEMA 3MXPA 3NBIA 3RR5A 1KIXA 1PH1A 2B2TC 2DNEA 1EY6A 4C3IB 2F0HA 1PRTD 4GN5A 5K36G 4LUOA 1S5DD 3KF8A 2OTLA 1CZGA 2K32A 1X55A 3CCRA 3K5LA 1SRUA 4IUUA 4XIGS 1SNOA 1VQKA 3FKIH 1HNZQ 4DR6L 1STGA 2E2DC 5JVG3 3CF5A 1L0XB 2EDGA 3M85A 1B70B 1OXUA 3RLNA 5EKLA 4O42A 2AKWB 2PQAA 5DAUA 1HNZL 2DGYA 1SR3A 5C44B 1JOQA 2PW7A 1HA5A 5J39A 3MEFA 4HSPA 4U673 1HRJA 2BH8A 3E0EA 4TSSA 4LF4Q 3GV6A 1S3OA 2NZOA 1HPCA 4DV3Q 2A6EC 2NN6G 3HOXH 4MN3A 4A3MB 5GAEC 1VCIA 1J6QA 4HJ9A 1H9SA 1HZCA 2ZTEA 1SJED 5IYCH 4LF4L 5FLXL 4H0LC 5DM73 4DV3L 4OX9Q 2XVSA 3RZOH 4MIUA 4GLXA 2Q2TA 1B9MA 1GKHA 1CKOA 3D31A 1YI2A 4H7BA 1FGUA 1G6PA 4G7HC 5GQOA 2KOLA 4OX9L 4XT3B 3S2HB 3URYA 2CH4W 3KLWA 1OXXK 2JA9A 3P1HA 3A7LA 1NE3A 5T1IA 5IYBH 1TT2A 2UUAQ 1TS4A 3HKZE 1T5EA 4R9WA 2XWJB 4K2LA 3WWVA 4PQXA 5JJLA 1HA6A 3G6JB 5NUCA 4A3JG 2OF1A 4XDXA 2UUAL 2KVMA 2E2IB 4P72A 5J22A 4X3KA 3U50C 3PGZA 3V96A 1L1OC 1BBUA 5GROA 5LMUQ 1X3EA 1F2ZA 5ELCA 3R2TA 2PI2A 3VA7A 3ND9A 1QCBD 4OIJA 2F0TA 4HMJA 2LXKA 4UY8C 1S4ZA 4LFAQ 2X6GA 1OXSC 4YWLA 1JCKB 1MD2D 1O7ZA 3C3LA 3S15H 3UDXA 1EFID 4JK1C 4I7ZC 4L5SA 2K4KA 2F4VQ 2ZJRA 4POFA 2NUCA 4LFAL 5DEHA 5IYDG 4ME3A 4DV6Q 4A4IA 5HGQA 2E8GA 2MHVA 2NZ1D 3R3OA 2F4VL 2M2LA 2Z6KC 4C1NK 1XMQL 1DCZA 4XYQA 1EYAA 4JI8Q 4WRDA 5IT9E 1CK1A 3FVQA 3CKIB 4OONA 3TP5A 4JI8L 4KJNA 3MXNB 1VDZA 3S16B 4BY7H 3I55A 1AN8A 1N34Q 2XIWA 4TRDA 3K7UC 1WTQA 4YCUA 1BNZA 4PZ7A 1I4HA 4A93H 1HR0W 1A62A 1I50H 1CFMA 4RGOS 1PZKD 3BYTB 4UP7A 2YV5A 1N34L 3UDFA 4A3JB 1VMPA 3NUCA 4JW0A 5I6WA 4G57A 4IJHA 3GTQB 4O2DA 1STBA 3T1YQ 1PH6A 1I50B 2NVYH 1XJVA 2IT1A 3E3XA 3G48A 1GUNA 5DNFA 3BU2A 2ZT9C 1E22A 4B3RQ 1MJCA 4JI2Q 3OTOQ 1JWSD 4C56C 4G7ZC 4AQYL 1SNQA 3T1YL 2ZXOA 2MP1A 3ERSX 2VNUD 2KJXA 3CMEA 5LMNQ 1S5FD 3DHQA 1K0SA 4V190 5C4JB 4JI2L 3OTOL 4NW2A 3FPPA 3HOUH 4K0KL 1WTPA 2XSCA 3OWEB 5GAGC 3MXNA 2WB1G 4NDXA 3BVMA 2AUKA 3I3CA 3PUVA 1B9NA 5LMNL 1AE3A 4A3IG 4B3SQ 1PRTB 2ASBA 1HZ9A 5IOCA 3CRLC 3JAML 2YTXA 3H15A 4RA8A 3EQLC 1V1PB 1HUNA 3G7LA 3M3YH 5C0XG 1N33Q 4HCSA 2B2WA 3QB3A 2F0JA 2D0PA 4B3SL 5BN5A 1BCPC 2MPMA 2UUBQ 4FF2A 4AH6A 5BN4A 4JC0A 3S1RB 2KCMA 5M5XH 3C2PA 5IP7H 4WFN3 1N33L 2ENBA 4DV2Q 1GM5A 1IL2A 3IFTA 2XRQD 2K04A 4M8AA 4GKJQ 1NR2A 3HOVB 1TWGB 3J7ZC 1CHPD 1OXTA 4MZ9A 2K50A 1G6ZA 2UUCQ 1KXLA 3H0GH 4IALA 2QA4A 3TSSA 2JP1A 4LW1A 4DV2L 3GTMB 2UXDQ 3AFPA 3CHBD 4GKJL 4N8X1 1SSOA 3J81i 1M8AA 1HTLD 1LT4D 3OWFA 1DJRD 1QUQB 2UUCL 2BDOA 4FF1A 4JPBW 1WTRA 1EY5A 2UU9Q 2GN5A 2UXDL 2SOBA 1Z47A 1CI3M 3T51B 2M9VA 1HJPA 3A5ZB 2DN8A 2NVXH 1VF5C 2UU9L 4X62Q 4GOPC 3SK8A 3L2PA 4Z9CB 3PO2H 1K83B 4QB4A 5FLMG 4HIMA 2PMZB 4ZAIA 5CBAE 1IYJB 1N8RC 2VUMH 4X62L 1F77A 1J9OA 4ZK9B 1B4OA 4JOIC 2SNSA 2F03A 3H3VC 1WD1A 1DOLA 1VQCA 2FFKB 2KUMA 3BVZA 3MHBA 3CCVA 2RSOA 1NSNS 1S5BD 1DM0B 2Z0SA 2VB3X 3FPUB 4RFBA 1Y1WG 2JN4A 2Y0SG 3SR1A 3TEHB 4L6TB 5M5YH 1QB5D 4A3LH 5L37A 1QUQA 2NN6I 3M4OH 3STBC 4A3EG 2K52A 2ZXRA 1KABA 3BDCA 2JE6I 2JYOA 4OWTB 1PTOD 2K33A 2KCCA 5GAHC 3PO3H 2E2HB 5D65A 3M4OB 3HRZC 2KEEA 1LO5D 3GTOH 1KRTA 2I0QA 1W2BA 1L0WA 3F2BA 2N49A 3S1NB 4XT1B 3HOZG 3E5SA 1PH3A 4NXNQ 2R7ZH 3PO3B 2F3WA 1E24A 1CKNB 4C3JH 3K5NA 2HHHQ 4S3SA 4UAIA 3HOWH 2XGTA 3MFYA 3ONAB 2YYZA 3S2DH 2RQXA 4J1MA 1BR9A 2CHBD 3CCMA 4NXNL 3TDQA 3EVQA 3RLOA 4L63B 2HHHL 2B2TA 4L5QA 4DK3C 2CWPA 4BBSG 2EZVA 4BY1H 1FR3A 2QCPX 1Z7TA 4JI5Q 4GKKQ 4CHTB 1VQ8A 4R1JA 1B3QA 4MTNA 4DUZQ 2F0SA 4A3GH 4A3BG 4JI5L 1DGSA 4GKKL 4PZ6A 4QQBX 3S1QH 4BXXH 1FD7D 2F0PA 3OW7A 5EJWA 4APVA 3CCUA 2R92G 1ILPA 2L11A 1PDQA 4CDDC 4DUZL 1WVLA 5I6YA 2K5QA 2L4NA 4IPGA 1JWUD 4G4KA 1C8CA 1LABA 4LF7Q 2KQ3A 1B2TA 4QMGA 4MNOA 5C4XG 4GLAC 3CCSA 3KF6B 1B8AA 3NXWA 3VYUA 1K8OA 1WTWA 2Y0SB 2XTIA 3TP7A 5IT9L 2LS01 4LF7L 1SE8A 1UNSA 5E7NA 2JA6G 3CC7A 1PH9A 1M1KC 1SNCA 1X3GA 4RGTA 4PMBA 1ILQA 1X3FA 1XTDA 2E5LQ 4IUPA 4OWWB 1GUOA 1PZID 2K5HA 4JV5Q 1A2TA 2EYPA 2Z4IA 1LT5D 1AFPA 2PZUA 4ZUIA 1C48A 1ZYRD 4DK6C 2E5LL 5EBCA 3HG9A 1EYDA 3ULPA 4CKEA 2FINB 3K57A 3HOZB 1PLFA 4DUYQ 4JV5L 1HFNA 3PCOB 4PG3A 2B8FA 1I4PA 3RMHA 1RL2A 3S14B 3NELA 4HJ8A 4QJFA 4LFCQ 1HHVA 2VS1A 3N6RA 3DM1A 4QUCA 1EWHA 4GNXB 5IGEA 4K5VA 2B2YC 5TSSA 4KY5A 1A3VA 5I2XA 3J81j 4IPHA 3KF6A 3P75A 4P73A 3I7FA 2QDLA 3B6YA 4OELB 1L1OA 3M7NA 2L1BA 1K8GA 4BBSB 4CDCC 3GDEA 2RHSB 5ISRA 4FP5D 1SEBD 4IZ8A 4HJ5A 2QEJC 2ZTCA 2KHSA 1E0BA 3KBGA 4UDUC 3FMCA 1QJOA 4DNRB 3X3NA 1PH7A 2H1EA 3FHWA 3I4MH 1YJWA 4A3CG 2R92B 2DUDA 2QEXA 1T9HA 1R4PB 5C4XB 3I90A 1D1IA 1MHWC 4AYBG 1E7ZA 2HD3A 3OSOA 3DMUA 4DA2A 3L3OC 4FDBA 4H13C 2R93H 2X6LA 5C0XI 2A6HD 2JA6B 2PI2E 3S1MH 2AQ3B 1RD9D 2B3GA 4X64Q 3ND8A 4YCVA 3GTPH 4EGVA 1UAPA 1R9TH 1S72A 1I4GA 1SYFA 5JEAG 5BR8Q 2F0LA 1UWVA 4PZ8A 1YJ9A 2JA5B 4DXFA 2YU9B 1VQBA 3OPOA 3HOYH 4C3HH 5IGCA 1XPRA 4R4IA 4UP9A 3GTPB 2A1AA 1WTVA 1RF2D 5BR8L 4X65Q 4ABNA 4PV1C 1IBMQ 1PYBA 2UXCQ 4G7OC 4KN7C 1E1TA 3LWUA 4J8QA 3DLLA 1XPOA 1PTOB 1VQEA 2B63H 3KF8B 1FNVA 2UXCL 3ULJA 2RKSA 1NCVA 4ZUJA 4ME5A 3D4RA 5CV8A 1A0IA 1W3SA 5G3LF 1CQFA 4KY7A 2KEDA 2H4OA 3BJUA 4ILWA 3TS0A 5EPJA 1F9RA 2PQAB 1LTID 2GA4B 1VQMA 2BE5C 3UI2A 4I65A 2CFMA 3ER0A 3AMUA 2BCOA 4B9XA 2VW9A 2IJ0A 3D4WA 5DM63 4EX5A 1IZ6A 3MXGA 4BBRG 4RCNA 5KNDA 4C3IH 4ZQ3A 3HOXG 1F2MA 4X3SA 1WJJA 3CCEA 1QILA 4LWCA 1GOZA 1SYEA 3D6CA 1EL0A 4AYBB 1YHAA 2IPKD 5IYCG 3SGIA 1HXYD 5ELEA 4K14A 1HQRD 4DV5L 1SXTA 1B53A 2D62A 4DR6Q 2EXZA 5IGBA 3P20A 1TY2A 1KLUD 1ESFA 4KHVA 5FO7B 5IGDA 3CRKC 2PZWA 2JA7G 1BUVT 1PFBA 2WIIB 2F0GA 5C44H 4DAPA 1H95A 1NR4A 1V1OA 4CKCA 5IP9H 4MTKA 1J5EQ 1IW7C 1LYLA 5FOBB 2OTJA 4A3MH 2CKZB 2BDNA 2EYMA 2RBMA 4LUVA 2RSNA 1Y1VG 5F2DA 1RTOA 1KL9A 4A76A 1AE2A 4HJAA 1J5EL 5J3BA 2CH4A 4KKSA 1PXUA 1JE5A 1QNUA 2R7FA 4HEDA 4JVZA 1SFOB 4GLVB 3J7YW 1LUZA 1NBWA 3H94A 4GOPA 1CA6A 3S2HH 4LF5Q 1ASZA 4U68A 3T1HL 1KLGD 1VQFA 4A3KG 5KGUA 3H91A 5H1SE 2R7DA 3I4NG 1C4QA 4LF5L 3A74A 4O1NA 4YWMA 2Q8TA 4JI3Q 2E2IH 4DR5Q 1EWIA 5FO8B 1DOMA 4F7XA 4BBRB 4F87A 2A73B 4OO1G 1ESRA 3FEWX 3I8ZA 5K36H 1B7YB 3BG3A 1RJTA 4JI3L 1AEXA 2HUGA 2K28A 4DR5L 1Y69U 1PRTF 4GN4B 2NVQB 1JQYD 5C4ZA 2XWBB 1VQPA 1N9WA 1Q1BA 5EKKA 4DR3Q 2D5DA 5EGTA 2ZM6Q 2NWGA 3FP9A 1EY9A 2JA7B 1EWCA 3NPPA 1B44D 5A2QL 4DNTB 1PMRA 2K01A 4BY7G 2E2JB 4KI0A 1ML0D 5KEEA 3NTHA 3C1FA 5LL6X 3KOJA 4DR3L 2ZM6L 3NE5B 3PSIA 2EYLA 2CQOA 1KAAA 1QVFA 1F2YA 1XPUA 2K6AA 3CC4A 1LTTD 4K8JA 4HJ7A 2ZJPA 2NN6H 2A5HA 4DF7A 2A69C 1Y1VB 1JJ2A 1XMQQ 2EJFC 2EY2A 4JI6L 3J81c 2PPBC 2R61A 3DWQA 2A6ED 3EJIA 1YNXA 1MSGA 4ZKBB 1W6KA 1TWCB 4NB3A 1VQHA 3I4LA 4LNQA 5KIXA 4B3ML 3NTKA 1KHIA 3S16H 4LFBL 3OMGA 4KD4A 5JJKA 2OT2A 1V8QA 1YVCA 1CT1D 5K5PA 2F0MA 1TR5A 1TWAB 3HOUG 4A3KB 3T56B 2PMZE 1T5XD 1EY0A 1S5CD 1GUTA 3J80i 3T4AC 3K7AB 1PHJA 1EZ8A 4A3JH 4XXEA 3V05A 2Q8RE 1Q3LA 3MC0B 4DU9A 3O13A 3GTQH 1VQLA 5JOBA 3LNNA 3U4ZA 5A35A 2HIXA 5D14A 3BS1A 3GTLB 1CHQD 5M3MG 2F3VA 2WINB 1TY0A 1II3A 4BS9A 4NPSA 1TIID 1MBYA 1BVSA 5JPNC 4AQYQ 2K5DA 2OQ0A 2J7ZA 1EEID 4HCEA 5I9PA 4IQZA 1HCZA 2XN9C 3TS2A 3ZJYC 5C4JH 3CPWA 2JA8G 2L55A 3H3VI 2C5CA 2PCFB 1UE1A 1Y8NB 4K0KQ 1H9RA 1E2ZA 4LMQD 4PNYA 4QIWB 5LMNW 3DWPA 1H9MA 1A2UA 1CSPA 4IUVA 3QWNA 4IN3A 1MIUA 5JPMC 2K75A 3S1RH 1EIYB 1D7QA 2B2YA 3CMAA 1ICWA 3MA2B 2GVAA 2XNAC 3D3RA 5IIFA 5IY0A 2CVRA 3BYYB 2ATWA 1IYUA 2WV6D 1KDAA 3HOVH 1DZ1A 1TWGH 2BOSA 2WACA 1QOHA 2LY7A 3OYYA 2F4IA 4K2KA 4RCOA 3RLFA 4KMUC 5E4WC 3TP8A 2DJFC 4ZCKA 4HTHA 3PIPA 1LTBD 1A3TA 4UPAA 2KHJA 3GTMH 3CCLA 5EBDA 1G291 2K05A 4M1UB 3ITPA 1A6XA 2HDMA 3I72A 2IW3A 1UE5A 3PIP3 3J7AF 2PYKA 1Q8IA 4IOAA 1AW7A 3UE0A 3D8GA 1SJHD 1WI5A 2KHIA 3VR5A 3GTGB 4DKAC 5BN3A 2EYFA 4KK7A 1SNPA 1EOTA 3LX0A 5M3MB 1PV4A 1EIFA 2Y0SE 5CV5A 1BXTA 4LF6Q 1K83H 1UE6A 2EXDA 2QDBA 1NMGA 4HIOA 3EBEA 3L7ZC 2IX3A 2F3IA 2SDFA 4P2CB 4LF6L 1CTMA 1JOKA 1PZJD 2JA8B 2Q8IB 2ALYB 1O78A 3A0JA 1PFSA 4C3JG 1VQ9A 5CYUA 1I4RA 2D2CC 4BWGB 3KJOA 3E0JA 1PH4A 4R4TA 4HR7B 1K9MC 2EYJA 2F0OA 4J6HA 3JAMi 1NMFA 4HN7A 5E1FA 2EIFA 1K73C 2JQOA 5CC4A 2WB1B 4RH6A 4LF8Q 1XWEA 4L8JA 4DAMA 4A3IB 1S40A 3SVMA 5M5WB 4JI1Q 1GHJA 3TZDA 2NTTA 2JXMB 4A75A 2E2HH 3R8BA 4POGA 4LF8L 1HNWL 2F0FA 1PFMA 4FF4A 1W6JA 1HZBA 2RF4A 4JI1L 4YY3L 3S1NH 1BCPD 1EYGA 1CSQA 3KLRA 1MSHA 2EJMA 1LLRD 1N32Q 3R93A 4DK1A 1PVOA 3CQZB 4BXXG 1PYSB 1XYIA 5CV4A 1X56A 2CW0C 1N32L 3PUYA 1V1QA 1I5FA 4NMZA 4K8IA 5E3FA 5C4HA 1FGBD 4KJOA 1VQ7A 4QF4A 2A68C 4N9TA 3M7GA 3Q6SA 4OO1I 3SE0A 1TXYA 3NP8A 1YZ6A 3G4SA 2KECA 1AZPA 2EOTA 3LWEA 3F2CA 5C5MA 5FLMH 3EIVA 1EIHA 1OTCA 5I9OA 3VDYA 2HIVA 4HSVA 3C1EA 1I4XA 1K0RA 1VQDA 1C7YA 2B29A 3WOFA 5C3EG 3A7AB 5EPLA 1SMXA 1STAA 4UHVA 1U0LA 2MJ8A 1H9KA 1GO3E 2VL6A 1B1ZA 3FRPB 3VA5A 1E2WA 2G9DA 3K8AA 5JVH3 2FMCA 1RTNA 4LF9Q 1D2BA 5D3IB 1G51A 4QL5A 2MGSA 3KUPA 2O4XA 2JEAI 1Y1WB 3HEJA 5KYLA 1L1OB 1N36Q 1U4RA 5C6AA 2B2VC 4TKOB 4LF9L 2LFNA 1Q86C 3STBD 4KY6A 4A3EB 3K80C 2N8NA 2A19A 4RGNA 2VQFQ 1N36L 1JT8A 2F0EA 1WOCA 2K03A 1STEA 5KNBA 1RODA 1SBBB 3HOZH 4DR2Q 1QNKA 2EY5A 1JB3A 1LTSD 1RCVD 4C2MB 5C0XJ 2VQFL 2I5HA 3S14H 1TS5A 3KDFB 4DR2L 5FKAC 5A2QE 1TS3A 2HDLA 1EEFD 1TWHB 2M00A 4DN4M 2GVBA 3EFXD 4BBSH 1SN8A 1Y8PB 2LSSA 3BZKA 3SHLA 1SYCA 2WAQG 3PUZA 3V2TA 1Q82C 5M9OA 2VQEQ 2MUYA 1TWFB 5C5LA 4A3DG 4AYBE 1Z6HA 1YNJC 5GADC 1YNNC 4LK1C 3PUXA 3S24A 4R4CA 3C46A 2VQEL 1P8LA 1I3QB 1SMYC 3PIOA 3I70A 1SYDA 3SK4A 4CJ1B 2R92H 1HFGA 5C3EB 4WJ4A 2VZAA 4RWSC 3A55A 3PMFA 3RZDB 2OXPA 3S9WA 2X69A 4A3BB 4YHHQ 1I94Q 1SE2A 2NB0A 5FJ8G 5C4XH 4Y7NB 3SK6A 1EZ6A 3CCJA 3GTJB 3QIAA 1TU2B 4RKBA 2AWNA 2MO0A 4A3FG 3ICEA 3TZUA 4I7AA 4YHHL 1I94L 2JA6H 1EQTA 3KDFA 5ELFA 1P16A 2EE1A 4DXGA 1CA5A 4XQNA 2HCIA 2HT1A 4DR7L 1GXDC 2Z6KA 4XQQA 4QCLA 1WCMG 1LM0A 2JA5H 3DEPA 3AYHB 2NZHA 1QZGA 4IUNA 2YU9H 3NQTA 3MZ5A 3VYSA 2KCNA 4IFDG 1DOKA 1JJGA 1I6VC 1PH8A 3T16A 2NVTB 2F0VA 1X6OA 1QWYA 3X3MA 1VQ4A 1BO0A 3E9IA 1HH2P 4L5TA 1SNDA 1D8LA 4C3IG 3KLSA 4GS3A 1FNWA 3DWAA 3K0XA 1PTOH 1PRTC 4K6LA 3SXHA 1JC7A 1XMOL 1HZAA 1PA6A 3EROA 2I5MX 3E9HA 2RA4A 3J81E 5M3FG 1U4PA 3PF4A 2V1CC 4ALPA 3CC2A 4QUFA 2WAQB 1BCPB 1D5MC 1SAPA 5ELDA 1Q81C 2WP8J 5D3DA 4A3DB 1KDCA 2IX1A 1EOVA 1EFWA 2CQAA 3VR2A 3N52A 2H5XA 2F0UA 3H09A 1SYGA 1YHBA 4OL7A 1E3PA 3FKIG 1XNQQ 5JJZA 4XYOA 2K14A 4ZRZA 5IGFA 4PMWA 3U4VA 4A3CH 5KRUA 1Q1EA 3CP0A 3A56A 1LTAD 4Q5VA 3HGBA 1Y14B 2B2UC 4IPDA 1XNQL 1STHA 3L0OA 4EQPA 4DV1Q 1VMCA 1IYVA 1NTGA 3NWTA 5CBEE 4DV5Q 4NKLA 3S17B 1X3QA 1DD2A 1XXGA 2EYOA 2A8VA 2PNRC 4DV1L 4GOPB 3RUZA 2K5VA 1Z9FA
chains in the Genus database with same CATH topology
1MI2A 3A8JE 1CM9A 1U4MA 4RAUC 5LHY1 1R4QB 2E75C 3TP6A 2I46A 1SE3A 1G91A 3OIQA 2RDFA 1D5ZC 5EKIA 1XX8A 4ID6A 3GTKB 1UEAB 4TQUS 3NK9A 3NQIA 3A54A 1ZEQX 2AQ2B 1RDPD 1XTCD 2E76C 1I6HB 4F88A 4XQJA 5M3FB 4H44C 1HUMA 3MEHA 4IUTA 5LL6S 3Q24A 3QG1A 4PMCA 4CJ0B 2FMMA 2DNCA 4CGYB 4C1NI 1QG7A 3K58A 2Z8LA 4K6DA 3QOLA 4X3UA 3FKIB 3RD4A 2QKIC 1JORA 3VR4A 2L9HA 4KN4C 3GP7A 1V43A 1DYQA 2BE5D 2B8GA 1SYBA 1TQOA 2EY1A 2LMCB 2PZTA 4RHSA 1ET6A 5JAVA 4ODGA 4OGQC 2IWHA 3FDTA 3VR3A 5HURA 1J8IA 1IL8A 3KK7A 3HOXB 4RHRA 3SDZA 2NTSA 3MXUA 3RZOB 3EA6A 1OXVA 1EIGA 1WTOA 3QJYA 3J80L 1JOOA 2N88A 3W2DA 1VF7A 1O7LA 4EVOA 5ELBA 5I4DA 2OEOA 3GQBA 2ZXPA 2DY7A 2WKDA 1IW7D 2Z4HA 4IFDJ 2NYZD 1ET9A 5JEAJ 2R3ZA 2FJ2A 1D1KA 5FK9C 5HGTA 3VYTA 5EQ0A 1BOSA 5COYA 2G9HD 2HCCA 1ENCA 1F9QA 1G8ZD 4GZYC 3SK5A 3MAQA 2TMPA 1EY8A 1KNAA 3S15B 4OIKA 1G2SA 3ZYYX 2PQEA 4OO1H 3I4NB 4ZLTF 2I07B 3HZXA 1I4QA 1RHPA 1GJXA 4IUQA 3DEOA 3PUWA 3OHXC 2ICIA 4KV6A 2JSOA 5CMDA 2B2VA 5CR3A 1Y8OB 4LAAA 5J1ZA 4FXGC 2EJGC 1X3PA 1B3AA 2RVLA 3AU7A 3MWYW 4N9PA 4IFDI 1JWMD 1D6EC 4BY7B 4NP5A 4KTAA 4K5WA 3J81L 3AB9A 3W3AA 4XTCS 1FYCA 4A93B 4RKLA 1KDBA 1STYA 1O80A 2A69D 2F0DA 2R6GA 3BDLA 4Q0FA 1FNUA 3R2IA 3IL8A 2IX0A 2L5TA 2NVYB 2E74C 3KBXA 5T1GA 3IKJA 4E6IA 3PV0A 1ENAA 3J7AV 3HKZB 3OMCA 4HAEA 3IAYA 2B39A 3U9OA 1TVXA 1EY4A 2O2LD 3HOUB 3WOEA 2EVBA 2XRSD 3T53B 1ZKOA 2AUJD 4V0BA 3I73A 3TMEA 1CZWA 3NTIA 4KKTA 1X32A 4EQNA 1H9JA 2O5IC 1PTOC 2DY8A 2EYHA 3M3YB 5CV7A 4EQOA 4YIJA 3DXJC 5M5XB 1D5XC 1TKWB 3DUZA 1RKNA 1E2VA 4FF3A 1KTKA 1SDFA 1PFNA 3H0GB 1S5ED 1JR0D 3Q22A 3A8IE 1SE4A 2N55A 4LJZC 2A74C 2K1BA 3T13A 3TN2A 4RGMA 3HS0C 1V1PA 5CV6A 5C0XH 2Z1CA 1L0YB 4FO2A 3I91A 2BA0A 3OOCA 2NVXB 5AFWA 3K6OA 2J4XA 1K8MA 3PO2B 4DFAA 1UUPA 1F9SA 2VUMB 1DONA 1STNA 3BDOA 1GUGA 2B2UA 5I2YA 4CJ2C 3BVGA 1A3UA 1BDOA 1KNEA 2K7VA 2L0CA 2PO4A 5M5YB 3SEBA 4IURA 4WORA 1IKLA 2F0NA 2O5JC 1CQVA 3A8KE 1U9RA 1ZYRC 2SNMA 3GTOB 5C3WA 1DXMA 2ID0A 4KHZA 1U4LA 1BF4A 2R7ZB 4C3JB 3HOWB 1IKMA 1GUSA 4DAVA 1EY7A 2IL8A 3S2DB 5IGGA 3K59A 3MFGA 1LACA 3F2UA 2ICEC 4BY1B 5FLXE 1Q90A 3NWSA 2VXWA 4FXKC 1BCPF 3CU7A 1PTOF 4FNFA 4A3GB 3GV3A 3QOJA 5CORA 3HP3A 3KLSX 4BA1I 1BQQT 3S1QB 4DGZA 2CW0D 4DAYA 3J80E 2F1MA 1Q12A 2A6HC 3NBHA 1TS2A 2WKCA 1JE4A 1LTGD 3Q0AA 2A68D 1M4VA 2J0TD 2PW5A 3K5MA 3GD7A 4OHJA 4F8MA 5E4XA 2QILA 3TBIB 4WJWA 4R8NA 1OO9B 3L9AX 1AP0A 1F2LA 3VYRA 1HQMC 4C3HG 2KA7A 3K0YA 1MGSA 1IHZA 2HQEA 3NSWA 1NAPA 5EPKA 3PIO3 4R8IA 4FXDA 2B2WC 2L12A 4KKUA 1LTRD 3Q23A 2RDGA 2F0KA 1ENFA 3P7JA 1A15A 4FVMA 1EU3A 4JBWA 5G3LD 4KD3A 3BZDB 2AWOA 1LT6D 3K5OA 1NUCA 2QF7A 3D6WA 3M4YA 2F0IA 2RDHA 4B08A 3H6MA 4HMIA 1EYCA 1PYWD 2TSSA 1LV9A 1WD0A 1GUWA 3E6ZX 5CGKA 2EPBA 2AQ1B 2BA1A 2F0QA 2EY6A 2V4DA 3I4MB 2FHTA 5KYIA 4MHEA 3QO2A 3D4DA 4B9WA 4FYDA 2NBFA 4CBVA 2SEBD 4DK0A 4K5XA 5FO9B 1G2TA 2R93B 3WDNA 1EQVA 3S1MB 1EU4A 1YNJD 1YNND 4ZYSA 4BA2I 1R9TB 2LKVA 2VB2X 1SNMA 1SMYD 5CV9A 1AZQA 3NHHA 3HOYB 4C3HB 3VR6A 1GHKA 4ULLA 1WTXA 1ZXTA 3U9SA 2C9OA 1O7YA 2K5WA 4A3FB 1F9PA 3JAME 4ZKCB 3MVVA 5IODA 2B63B 5KNCA 3ERQA 1HTPA 1B50A 1ONLA 2JEBI 4IFDH 3OIPA 1BBXC 5JEAH 3MTSA 1WCMB 4X3TA 5C3XA 1LT3D 3IFDA 1JICA 4CKBA 3GO5A 2F0WA 1H9SB 2D9UA 1QE6A 3MXPA 3NBIA 2B2TC 2DNEA 1EY6A 4C3IB 2F0HA 1PRTD 5K36G 1S5DD 3KF8A 1CZGA 2K32A 3K5LA 4IUUA 4XIGS 1SNOA 1STGA 2E2DC 5JVG3 1L0XB 2EDGA 3M85A 1OXUA 5EKLA 4O42A 5DAUA 5C44B 1JOQA 2PW7A 1HA5A 5J39A 4U673 4HSPA 1HRJA 4TSSA 3GV6A 1HPCA 2A6EC 2NN6G 4MN3A 4A3MB 1VCIA 1H9SA 1SJED 5FLXL 4H0LC 5DM73 2XVSA 4MIUA 1B9MA 3D31A 4H7BA 4G7HC 2KOLA 4XT3B 3S2HB 3URYA 1OXXK 3P1HA 3A7LA 5T1IA 1TT2A 1TS4A 1T5EA 4R9WA 2XWJB 4K2LA 4PQXA 1HA6A 3G6JB 5NUCA 2OF1A 4XDXA 2KVMA 2E2IB 5J22A 4X3KA 3V96A 1F2ZA 5ELCA 3R2TA 3VA7A 3ND9A 1QCBD 4OIJA 2F0TA 4HMJA 1S4ZA 2X6GA 1OXSC 1JCKB 1MD2D 1O7ZA 3C3LA 1EFID 4JK1C 4I7ZC 2NUCA 5DEHA 2MHVA 2NZ1D 3R3OA 2M2LA 4C1NK 1DCZA 4XYQA 1EYAA 4WRDA 5IT9E 1CK1A 3FVQA 3CKIB 3TP5A 4KJNA 1VDZA 3S16B 1AN8A 2XIWA 4TRDA 1WTQA 1BNZA 1I4HA 1CFMA 4RGOS 1PZKD 3BYTB 4A3JB 1VMPA 3NUCA 5I6WA 4G57A 3GTQB 1STBA 1I50B 2IT1A 1GUNA 5DNFA 2ZT9C 1JWSD 4C56C 4G7ZC 1SNQA 2ZXOA 2MP1A 2VNUD 2KJXA 1S5FD 3DHQA 4V190 5C4JB 4NW2A 3FPPA 1WTPA 2XSCA 3OWEB 3MXNA 4NDXA 3BVMA 2AUKA 3I3CA 3PUVA 1B9NA 1PRTB 5IOCA 3CRLC 3JAML 4RA8A 3EQLC 1V1PB 1HUNA 3G7LA 5C0XG 4HCSA 2B2WA 3QB3A 2F0JA 5BN5A 1BCPC 2MPMA 4FF2A 5BN4A 3S1RB 3C2PA 4WFN3 2ENBA 3IFTA 2XRQD 2K04A 4M8AA 1NR2A 3HOVB 1TWGB 1CHPD 1OXTA 1G6ZA 4IALA 3TSSA 2JP1A 3GTMB 3CHBD 1SSOA 1M8AA 1HTLD 1LT4D 3OWFA 1DJRD 2BDOA 4FF1A 1WTRA 1EY5A 2SOBA 1Z47A 1CI3M 3T51B 2M9VA 2DN8A 1VF5C 3SK8A 4Z9CB 1K83B 4QB4A 2PMZB 4ZAIA 5CBAE 1F77A 1J9OA 4ZK9B 1B4OA 2SNSA 2F03A 3H3VC 1WD1A 1DOLA 2FFKB 2KUMA 3BVZA 3MHBA 2RSOA 1NSNS 1S5BD 1DM0B 2VB3X 3FPUB 4RFBA 3SR1A 4L6TB 1QB5D 2NN6I 2ZXRA 1KABA 3BDCA 2JE6I 2JYOA 1PTOD 2K33A 2KCCA 2E2HB 5D65A 3M4OB 3HRZC 2KEEA 1LO5D 3S1NB 4XT1B 3E5SA 3PO3B 2F3WA 3K5NA 4S3SA 4UAIA 3MFYA 3ONAB 2YYZA 2RQXA 4J1MA 1BR9A 2CHBD 3TDQA 3EVQA 4L63B 2B2TA 2EZVA 1FR3A 2QCPX 1Z7TA 4CHTB 2F0SA 1FD7D 2F0PA 3OW7A 5EJWA 1ILPA 2L11A 1PDQA 1WVLA 5I6YA 2K5QA 2L4NA 1JWUD 4G4KA 1C8CA 1LABA 2KQ3A 1B2TA 4QMGA 3NXWA 3VYUA 1K8OA 1WTWA 2Y0SB 5IT9L 3TP7A 2LS01 1UNSA 1SNCA 4RGTA 4PMBA 1ILQA 4IUPA 1GUOA 1PZID 1A2TA 2EYPA 2Z4IA 1LT5D 1AFPA 2PZUA 4ZUIA 1C48A 1ZYRD 5EBCA 3HG9A 1EYDA 4CKEA 2FINB 3K57A 3HOZB 1PLFA 1HFNA 2B8FA 1I4PA 3RMHA 3S14B 1HHVA 3N6RA 3DM1A 4QUCA 1EWHA 5IGEA 4K5VA 2B2YC 5TSSA 4KY5A 1A3VA 5I2XA 3P75A 3M7NA 4BBSB 2L1BA 5ISRA 4FP5D 1SEBD 4IZ8A 2QEJC 3KBGA 2KHSA 1E0BA 4UDUC 3FMCA 1QJOA 4DNRB 3X3NA 2H1EA 2R92B 1R4PB 5C4XB 3I90A 1D1IA 3OSOA 3DMUA 4DA2A 3L3OC 4H13C 2X6LA 5C0XI 2A6HD 2JA6B 2AQ3B 1RD9D 3ND8A 4EGVA 1UAPA 1I4GA 1SYFA 5JEAG 2F0LA 2JA5B 4DXFA 2YU9B 3OPOA 5IGCA 3GTPB 1WTVA 1RF2D 4ABNA 4PV1C 4G7OC 4KN7C 3LWUA 4J8QA 1PTOB 1FNVA 2RKSA 1NCVA 4ZUJA 4ME5A 3D4RA 5CV8A 5G3LF 1CQFA 4KY7A 2KEDA 2H4OA 4ILWA 5EPJA 1F9RA 1LTID 2GA4B 2BE5C 3UI2A 4I65A 3AMUA 2BCOA 4B9XA 2IJ0A 3D4WA 5DM63 3MXGA 5KNDA 4RCNA 4ZQ3A 1F2MA 4X3SA 1QILA 1GOZA 1SYEA 3D6CA 1EL0A 4AYBB 2IPKD 1HXYD 5ELEA 4K14A 1HQRD 1SXTA 1B53A 2D62A 2EXZA 5IGBA 3P20A 1TY2A 1KLUD 1ESFA 4KHVA 5FO7B 5IGDA 3CRKC 2PZWA 1BUVT 1PFBA 2WIIB 2F0GA 4DAPA 1NR4A 1V1OA 4CKCA 1IW7C 5FOBB 2RBMA 2BDNA 2EYMA 2RSNA 5F2DA 1RTOA 4KKSA 1PXUA 1QNUA 4HEDA 1SFOB 3J7YW 3H94A 1CA6A 4U68A 1KLGD 5KGUA 3H91A 1C4QA 4O1NA 2Q8TA 5FO8B 1DOMA 4F7XA 4BBRB 4F87A 2A73B 4OO1G 1ESRA 3FEWX 3I8ZA 5K36H 3BG3A 1RJTA 1AEXA 2HUGA 2K28A 1Y69U 1PRTF 2NVQB 1JQYD 5C4ZA 2XWBB 1Q1BA 5EKKA 2D5DA 5EGTA 2NWGA 1EY9A 2JA7B 1EWCA 3NPPA 1B44D 5A2QL 4DNTB 1PMRA 2K01A 2E2JB 4KI0A 1ML0D 5KEEA 3NTHA 3C1FA 5LL6X 3NE5B 2EYLA 1KAAA 1F2YA 2K6AA 1LTTD 4K8JA 2NN6H 2A5HA 4DF7A 2A69C 1Y1VB 2EJFC 2EY2A 2PPBC 2R61A 3DWQA 2A6ED 3EJIA 1MSGA 4ZKBB 1W6KA 1TWCB 3I4LA 5KIXA 3NTKA 3OMGA 4KD4A 2OT2A 1V8QA 1CT1D 5K5PA 2F0MA 1TR5A 1TWAB 4A3KB 3T56B 1T5XD 1EY0A 1S5CD 1GUTA 3T4AC 3K7AB 1EZ8A 4XXEA 3V05A 2Q8RE 1Q3LA 3MC0B 4DU9A 3O13A 5JOBA 3LNNA 5A35A 5D14A 3BS1A 3GTLB 1CHQD 2F3VA 2WINB 1TY0A 1II3A 4BS9A 1TIID 1MBYA 5JPNC 2K5DA 2J7ZA 1EEID 4HCEA 5I9PA 4IQZA 1HCZA 2XN9C 2L55A 2C5CA 2PCFB 1Y8NB 1H9RA 1E2ZA 4LMQD 4PNYA 4QIWB 3DWPA 1H9MA 1A2UA 4IUVA 3QWNA 4IN3A 5JPMC 2B2YA 1ICWA 3MA2B 2XNAC 3D3RA 5IIFA 2CVRA 3BYYB 1IYUA 2WV6D 1KDAA 1DZ1A 2BOSA 2WACA 1QOHA 2LY7A 4K2KA 2F4IA 4RCOA 3RLFA 3TP8A 4KMUC 5E4WC 4HTHA 1LTBD 1A3TA 5EBDA 1G291 2K05A 4M1UB 3ITPA 1A6XA 2HDMA 3I72A 2IW3A 3J7AF 3PIP3 2PYKA 1Q8IA 1AW7A 3D8GA 1SJHD 3VR5A 3GTGB 5BN3A 2EYFA 4KK7A 1SNPA 1EOTA 3LX0A 5M3MB 5CV5A 1BXTA 2QDBA 3L7ZC 2IX3A 2SDFA 4P2CB 1CTMA 1JOKA 1PZJD 2JA8B 2Q8IB 1O78A 4C3JG 5CYUA 1I4RA 2D2CC 4BWGB 3E0JA 4HR7B 2EYJA 2F0OA 4J6HA 4HN7A 5E1FA 5CC4A 2WB1B 4RH6A 1XWEA 4L8JA 4A3IB 3SVMA 5M5WB 1GHJA 3TZDA 2NTTA 2JXMB 3R8BA 2F0FA 1PFMA 4FF4A 1W6JA 1BCPD 3KLRA 1MSHA 2EJMA 1LLRD 3R93A 4DK1A 3CQZB 1XYIA 5CV4A 2CW0C 3PUYA 4NMZA 4K8IA 5E3FA 5C4HA 1FGBD 4KJOA 4QF4A 2A68C 4N9TA 3M7GA 3Q6SA 4OO1I 3SE0A 3NP8A 2KECA 1AZPA 2EOTA 3LWEA 5C5MA 1EIHA 5I9OA 4HSVA 3C1EA 1I4XA 3WOFA 3A7AB 5EPLA 1STAA 2MJ8A 1H9KA 1B1ZA 3FRPB 3VA5A 1E2WA 2G9DA 5JVH3 2FMCA 1RTNA 1D2BA 5D3IB 2MGSA 3KUPA 2O4XA 2JEAI 1Y1WB 3HEJA 5KYLA 1U4RA 5C6AA 2B2VC 4TKOB 2LFNA 4KY6A 4A3EB 4RGNA 2F0EA 2K03A 1STEA 5KNBA 1RODA 1SBBB 1QNKA 2EY5A 1JB3A 1LTSD 1RCVD 4C2MB 5C0XJ 1TS5A 5FKAC 5A2QE 1TS3A 2HDLA 1EEFD 1TWHB 2M00A 4DN4M 3EFXD 1Y8PB 3SHLA 1SYCA 3PUZA 3V2TA 5M9OA 2MUYA 1TWFB 5C5LA 1Z6HA 1YNJC 1YNNC 4LK1C 3PUXA 3C46A 1SMYC 1I3QB 3I70A 1SYDA 3SK4A 4CJ1B 1HFGA 5C3EB 4RWSC 3A55A 3PMFA 3RZDB 2OXPA 3S9WA 2X69A 4A3BB 1SE2A 2NB0A 4Y7NB 3SK6A 1EZ6A 3GTJB 3QIAA 1TU2B 4RKBA 2AWNA 3TZUA 1EQTA 5ELFA 2EE1A 4DXGA 1CA5A 4XQNA 2HCIA 1GXDC 4XQQA 4QCLA 3DEPA 4IUNA 3NQTA 3MZ5A 3VYSA 2KCNA 4IFDG 1DOKA 1I6VC 3T16A 2NVTB 2F0VA 1QWYA 3X3MA 1BO0A 1SNDA 4C3IG 3KLSA 1FNWA 3DWAA 1PTOH 1PRTC 4K6LA 3SXHA 1JC7A 3EROA 2RA4A 3J81E 1U4PA 4QUFA 2WAQB 1BCPB 1D5MC 1SAPA 5ELDA 2WP8J 5D3DA 4A3DB 1KDCA 2IX1A 2CQAA 3VR2A 3N52A 2F0UA 3H09A 1SYGA 4OL7A 5JJZA 4XYOA 4ZRZA 5IGFA 4PMWA 5KRUA 1Q1EA 3A56A 1LTAD 4Q5VA 3HGBA 2B2UC 1STHA 4EQPA 1VMCA 1IYVA 3NWTA 5CBEE 4NKLA 3S17B 1X3QA 1DD2A 1XXGA 2EYOA 2PNRC 3RUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOT A;  3LWE A;  1C8C A;  1MI2 A;  3KBX A;  2BDN A;  2B2U A;  5T1G A;  1EIH A;  2RSN A;  1B2T A;  1CM9 A;  1U4M A;  4HSV A;  1WTX A;  1ZXT A;  2DY7 A;  4RAU C;  1RTO A;  4CJ2 C;  5E4X A;  4ZAI A;  1VMP A;  1WTW A;  1KNE A;  2KOL A;  5CBA E;  2NYZ D;  1ILP A;  1EOT A;  4XT3 B;  1G91 A;  5EPL A;  4HAE A;  1O7Y A;  1J9O A;  1EQT A;  4ZK9 B;  2R3Z A;  1B4O A;  5EKI A;  1AP0 A;  5T1I A;  2MJ8 A;  2FJ2 A;  2EE1 A;  1CA5 A;  1F9P A;  1F2L A;  1XX8 A;  1TVX A;  2HCI A;  4HED A;  4IUR A;  4ZKC B;  1WD1 A;  1WTV A;  4R9W A;  1IKL A;  5DNF A;  1DOL A;  2FFK B;  2KUM A;  5EQ0 A;  1HA6 A;  1ILQ A;  1MGS A;  2RSO A;  1CA6 A;  2Q8R E;  3FPU B;  1Q3L A;  4IUP A;  3DEP A;  1B50 A;  4XDX A;  5COY A;  1RTN A;  5D14 A;  2MP1 A;  1NAP A;  4U68 A;  5EPK A;  1BBX C;  2HCC A;  2KVM A;  2SDF A;  1F9Q A;  1X32 A;  4R8I A;  2MGS A;  2B2W C;  1DOK A;  2L12 A;  3MTS A;  4X3K A;  4X3T A;  3KUP A;  3H91 A;  4QUC A;  1HUM A;  3P7J A;  4IUT A;  1A15 A;  3IFD A;  4NW2 A;  1U4R A;  2DY8 A;  1JIC A;  1NCV A;  1WTP A;  1BO0 A;  2B2V C;  2FIN B;  1PLF A;  2JYO A;  1KNA A;  2Q8T A;  4CJ0 B;  1HFN A;  2FMM A;  3I3C A;  1U4L A;  4OIK A;  1BF4 A;  2J7Z A;  4OIJ A;  1DON A;  1G2S A;  2D9U A;  1DOM A;  1QG7 A;  5D65 A;  4ZLT F;  2KEE A;  2KED A;  3D6W A;  1QE6 A;  4RA8 A;  2K03 A;  1RHP A;  5EPJ A;  1IKM A;  1HHV A;  3SVM A;  1ESR A;  1F9R A;  4X3U A;  1S4Z A;  4IUQ A;  2RA4 A;  1ROD A;  2B2T C;  3DM1 A;  3G7L A;  1U4P A;  2IL8 A;  1QNK A;  2X6G A;  3I8Z A;  4HCS A;  1O7Z A;  1RJT A;  2B2Y C;  2B2W A;  3DEO A;  1LV9 A;  2L9H A;  2HUG A;  2K28 A;  4LMQ D;  4XT1 B;  3TZD A;  3UI2 A;  4QUF A;  1WD0 A;  2EPB A;  1GUW A;  1SAP A;  1SDF A;  2MPM A;  5CMD A;  1PFN A;  2L1B A;  3F2U A;  2B2V A;  4IUU A;  4UAI A;  4IUV A;  1PFM A;  2N55 A;  2NWG A;  3N52 A;  3ONA B;  2FHT A;  2HDL A;  1X3P A;  4MHE A;  3QO2 A;  2K04 A;  1E0B A;  1MSH A;  1B3A A;  2K1B A;  4X3S A;  1NR2 A;  3R93 A;  4DN4 M;  2RVL A;  3TN2 A;  2K01 A;  2VXW A;  1EL0 A;  2NZ1 D;  1HUN A;  1ML0 D;  2M2L A;  3FDT A;  5JJZ A;  1G6Z A;  2B2T A;  4O42 A;  3MWY W;  1XYI A;  1J8I A;  2H1E A;  3GV3 A;  2B2Y A;  1IL8 A;  1ICW A;  5COR A;  3HP3 A;  2JP1 A;  1B53 A;  2CVR A;  3I91 A;  1SSO A;  1M8A A;  1G2T A;  1HRJ A;  2B2U C;  1DZ1 A;  5AFW A;  5E4W C;  3GV6 A;  1WTR A;  1VMC A;  3I90 A;  4MN3 A;  1PFB A;  1EIG A;  1O80 A;  3Q6S A;  5CBE E;  1WTO A;  4CJ1 B;  1JE4 A;  1HFG A;  1F9S A;  1X3Q A;  2K05 A;  2XIW A;  4RWS C;  1NR4 A;  2X6L A;  5EJW A;  2N88 A;  2HDM A;  1WTQ A;  2X69 A;  2L11 A;  1PDQ A;  1MSG A;  3IL8 A;  4ZKB B;  1WVL A;  1AZQ A;  2KEC A;  2L4N A;  1BNZ A;  1AZP A; 
#chains in the Genus database with same CATH topology
 3H3V H;  1YEZ A;  1MI2 A;  3A8J E;  2OCE A;  2Z6B A;  3CAM A;  3GTK H;  1CM9 A;  1U4M A;  5FLX c;  2DJG C;  4RAU C;  5LHY 1;  1R4Q B;  2E75 C;  3TP6 A;  2I46 A;  1SE3 A;  1G91 A;  3OIQ A;  4RG1 A;  2RDF A;  2C35 B;  1D5Z C;  1XNR Q;  1U5K A;  5EKI A;  1XX8 A;  4ID6 A;  5IYB G;  3GTK B;  1UEA B;  1YBY A;  4TQU S;  3NK9 A;  2IY5 B;  4P74 A;  3NQI A;  3A54 A;  1ZEQ X;  2AQ2 B;  1RDP D;  1XNR L;  1XTC D;  1JJC B;  1EQQ A;  2E76 C;  3J80 c;  1I6H B;  4F88 A;  3W1B A;  1VQI A;  1SFO H;  4XQJ A;  4DV4 Q;  5M3F B;  4H44 C;  1HUM A;  3MEH A;  4IUT A;  1GVP A;  3A5U A;  5LL6 S;  3Q24 A;  3QG1 A;  4PMC A;  4HIK A;  4CJ0 B;  2N3S A;  2FMM A;  2JK8 A;  2DNC A;  3T1H Q;  4CGY B;  4C1N I;  4DV4 L;  1M90 C;  1VQ6 A;  1QG7 A;  3M9B A;  2Z8L A;  3K58 A;  3UDG A;  4K6D A;  1FVI A;  3QOL A;  4X3U A;  3FKI B;  3RD4 A;  2QKI C;  1JOR A;  3VR4 A;  2L9H A;  1ICF B;  4KN4 C;  3GP7 A;  4IPC A;  1V43 A;  3HKS A;  3NEN A;  1DYQ A;  2BE5 D;  1K3R A;  2B8G A;  4BBR H;  1SYB A;  1TQO A;  2EY1 A;  2LMC B;  4JOI A;  4QIW E;  2PZT A;  1Q7Y C;  4RHS A;  1ET6 A;  5JAV A;  1JMC A;  1VQN A;  3JC6 6;  4ODG A;  4DPG A;  1KC8 C;  4OGQ C;  4OEM B;  3LGJ A;  2IWH A;  3FDT A;  3VR3 A;  5HUR A;  1J8I A;  2NVQ H;  1IL8 A;  3KK7 A;  3HOX B;  1JB7 A;  1UE7 A;  4RHR A;  1WYD A;  2JA7 H;  3SDZ A;  3BZC A;  2E2J H;  2NTS A;  3MXU A;  3Q8D A;  3RN2 A;  3RZO B;  3HFZ B;  3EA6 A;  1OXV A;  1EIG A;  1WTO A;  3QJY A;  3J80 L;  1JOO A;  1K3B C;  2N88 A;  1X65 A;  3W2D A;  2OWO A;  4GN3 B;  1VF7 A;  1O7L A;  1IBK Q;  4EVO A;  1Y1V H;  5ELB A;  5I4D A;  1ASY A;  2OEO A;  3GQB A;  4JI6 Q;  3J7A 5;  2ZXP A;  4A93 G;  2DY7 A;  2WKD A;  1IW7 D;  2Z4H A;  4IFD J;  2NYZ D;  1ET9 A;  1IBK L;  2RCN A;  5JEA J;  2QGQ A;  1TWC H;  2R3Z A;  4JI7 Q;  2FJ2 A;  1D1K A;  5FK9 C;  4R4Q A;  5HGT A;  4B3M Q;  3VYT A;  1PH5 A;  4LFB Q;  5EQ0 A;  2Q2U A;  5LMU L;  1X9N A;  4JI7 L;  1BOS A;  5COY A;  2MNA A;  2G9H D;  1TWA H;  2IHF A;  2Z9H A;  4A3K H;  2HCC A;  1ENC A;  3HKZ G;  1F9Q A;  1G8Z D;  4YCW A;  3I4N H;  3K7A H;  4GZY C;  3SK5 A;  3MAQ A;  4JI0 Q;  3AEV A;  2TMP A;  1EY8 A;  3OW2 A;  1KNA A;  4TVA B;  3W1G A;  3S15 B;  3GTL H;  2IHE A;  4CDE C;  4OIK A;  1G2S A;  3ZYY X;  2PQE A;  4JI0 L;  4OO1 H;  3I4N B;  4ZLT F;  2I07 B;  3HZX A;  1I4Q A;  1RHP A;  1WFQ A;  1GJX A;  3AFQ A;  4IUQ A;  1UEB A;  4DV6 L;  4DNI A;  2HQL A;  3DEO A;  1FJG Q;  4GNX C;  3PQI A;  2WB1 E;  3PUW A;  3OHX C;  2ICI A;  3JAM c;  4KV6 A;  2JSO A;  5CMD A;  2JJQ A;  5IWA Q;  2B2V A;  3HOV G;  5CR3 A;  3I2Z A;  1Y8O B;  3TRZ A;  4LAA A;  5J1Z A;  4FXG C;  1FJG L;  2EJG C;  1X3P A;  5IP7 G;  1YHQ A;  1B3A A;  2RVL A;  3AU7 A;  2PNH A;  2QW7 A;  5IWA L;  4DV7 Q;  3CPF A;  1C0A A;  3MWY W;  4N9P A;  4IFD I;  1YIT A;  1JWM D;  1HR0 Q;  1D6E C;  3H0G G;  2KEN A;  4BY7 B;  4QGU A;  4NP5 A;  4J15 A;  4KTA A;  1O7I A;  4K5W A;  3J81 L;  2LXJ A;  3UDI A;  4DV7 L;  3AQQ A;  3AB9 A;  3W3A A;  4XTC S;  5IYD H;  1FYC A;  1HR0 L;  4A93 B;  4RKL A;  1KDB A;  1STY A;  1O80 A;  1YJN A;  1VQO A;  2AMC B;  2A69 D;  2F0D A;  2R6G A;  3BDL A;  4Q0F A;  1FNU A;  4H02 A;  3R2I A;  3IL8 A;  2IX0 A;  2L5T A;  2NVY B;  2E74 C;  3KBX A;  5T1G A;  1GD7 A;  3IKJ A;  4E6I A;  4B3R L;  3PV0 A;  3PO2 G;  4IJL A;  1ENA A;  3J7A V;  3HKZ B;  3OMC A;  4HAE A;  3IAY A;  3KFU A;  3TRE A;  2B39 A;  2VUM G;  3PF5 A;  4QY7 A;  3U9O A;  3GTG H;  1TVX A;  1EY4 A;  4KHP Q;  2O2L D;  5AJ3 Q;  1HNX Q;  3HOU B;  3WOE A;  2EVB A;  2P5Z X;  4JI4 Q;  2XRS D;  4RMF A;  3T53 B;  4JBM A;  3U58 A;  1ZKO A;  2AUJ D;  4V0B A;  3I73 A;  4UP8 A;  3TME A;  5M3M H;  1CZW A;  3QR8 A;  3TQY A;  3NTI A;  4KKT A;  4KHP L;  1X32 A;  4EQN A;  1H9J A;  5AJ3 L;  2O5I C;  1PTO C;  1HNX L;  4JI4 L;  1E1O A;  1K28 A;  4A3L G;  2DY8 A;  2EYH A;  3M3Y B;  2YTV A;  5CV7 A;  4EQO A;  5ELO A;  2I5L X;  4YIJ A;  2UUB L;  3DXJ C;  2JA8 H;  5M5X B;  1D5X C;  3PO3 G;  1TKW B;  3DUZ A;  3RN5 A;  1RKN A;  4IO9 A;  1E2V A;  1NNX A;  4FF3 A;  3CD6 A;  1KTK A;  1SDF A;  4N8F A;  1PFN A;  3H0G B;  1S5E D;  1JR0 D;  2R7Z G;  3Q22 A;  3A8I E;  1SE4 A;  2N55 A;  4LJZ C;  2FXQ A;  2ZTD A;  4A3I H;  3HOW G;  5M5W H;  2A74 C;  2K1B A;  1EQR A;  3T13 A;  3TN2 A;  3I56 A;  4RGM A;  4JBK A;  3HS0 C;  2ZJQ A;  1V1P A;  1VS0 A;  1A8V A;  5CV6 A;  5C0X H;  1HNW Q;  2Z1C A;  1L0Y B;  4FO2 A;  4YY3 Q;  1L2F A;  3I91 A;  4BY1 G;  3RNU A;  2BA0 A;  4L5R C;  3OOC A;  2NVX B;  4LUZ A;  5AFW A;  4DR4 Q;  3CQZ H;  3K6O A;  2J4X A;  1KD1 C;  1K8M A;  2Q2H A;  3PO2 B;  4A3G G;  4DFA A;  1UUP A;  1F9S A;  2MQH A;  1A63 A;  4X66 Q;  4DR4 L;  2VUM B;  1DON A;  1Q8K A;  3IRB A;  1QVC A;  1STN A;  5DLQ E;  1FL0 A;  3BDO A;  1GUG A;  2B2U A;  4JBJ A;  5I2Y A;  4X66 L;  4CJ2 C;  3BVG A;  1A3U A;  1BDO A;  1KNE A;  2K7V A;  4P71 A;  2L0C A;  2PO4 A;  5M5Y B;  3KJP A;  3SEB A;  4IUR A;  1EUJ A;  4WOR A;  1IKL A;  2F0N A;  2O5J C;  5IT9 c;  1YIJ A;  1CQV A;  4WJ3 M;  3A8K E;  1U9R A;  2YTY A;  1VQ5 A;  1ZYR C;  2SNM A;  1PH2 A;  3GTO B;  5C3W A;  4DAY B;  4O0A A;  4B3T Q;  1DXM A;  2ID0 A;  3NBH B;  2CCZ A;  1LTL A;  4KHZ A;  1U4L A;  1VQJ A;  2K5N A;  1BF4 A;  2R7Z B;  3G6E A;  2D0O A;  3K81 C;  1VQA A;  4C3J B;  4B3T L;  1Y1W H;  3HOW B;  1IKM A;  1GUS A;  4DAV A;  1EY7 A;  2IL8 A;  3S2D B;  5IGG A;  3K59 A;  2KCT A;  3M4P A;  3MFG A;  4A3E H;  1LAC A;  1AH9 A;  3F2U A;  3CW2 C;  2ICE C;  2WAQ E;  4BY1 B;  2MFI A;  5FLX E;  3KYH C;  1Q90 A;  4R4O A;  3NWS A;  2G5D A;  2F52 A;  2KBN A;  2VXW A;  4C2M H;  4FXK C;  1BCP F;  3CU7 A;  1PTO F;  4FNF A;  4JCV E;  4A3G B;  3GV3 A;  3QOJ A;  5COR A;  3HP3 A;  3KLS X;  2RCF A;  4BA1 I;  4JYA Q;  3I4M G;  1TWH H;  1CUK A;  1BQQ T;  3S1Q B;  4AIM A;  4DGZ A;  1KRS A;  1CKN A;  2CW0 D;  1QVG A;  4DAY A;  3EN2 A;  2VY3 A;  5IE8 A;  1IXR A;  3J80 E;  1MJE A;  2F1M A;  1SRO A;  1Q12 A;  2A6H C;  3NBH A;  1TS2 A;  1TWF H;  4JYA L;  2WKC A;  1JE4 A;  1LTG D;  3Q0A A;  2A68 D;  1M4V A;  1V9P A;  2J0T D;  4DR1 Q;  1BBW A;  2PW5 A;  3K5M A;  2R93 G;  2JA5 G;  3GD7 A;  4OHJ A;  4F8M A;  1I3Q H;  1C9O A;  1CKM A;  5C3E H;  5E4X A;  2OQK A;  4DR1 L;  2QIL A;  3RZD H;  3TBI B;  4A3B H;  4WJW A;  4R8N A;  1OO9 B;  1BKB A;  3L9A X;  1AP0 A;  1SLJ A;  4Y7N H;  1F2L A;  3VYR A;  3GTJ H;  1HQM C;  3HOY G;  4C3H G;  2KA7 A;  3K0Y A;  1MGS A;  4KLK A;  1IHZ A;  2HQE A;  4DUY L;  2EQS A;  3NSW A;  1NAP A;  5EPK A;  3PIO 3;  4R8I A;  4FXD A;  4Y52 H;  2B2W C;  2L12 A;  4KKU A;  1LTR D;  4LFC L;  3Q23 A;  2RDG A;  4DR7 Q;  2F0K A;  1ENF A;  4EQ5 A;  2WFW A;  3M4Q A;  3P7J A;  1A15 A;  4FVM A;  2BH2 A;  1EU3 A;  3W5O A;  2B63 G;  4JBW A;  5G3L D;  4KD3 A;  3BZD B;  1KAW A;  2AWO A;  1LT6 D;  3K5O A;  4CDF C;  1NUC A;  2QF7 A;  5JJI A;  3D6W A;  2NVT H;  3M4Y A;  2F0I A;  2RDH A;  4B08 A;  3H6M A;  4P75 A;  5ELN A;  4HMI A;  3F2D A;  1EYC A;  1PYW D;  2TSS A;  1LV9 A;  1WD0 A;  1GUW A;  3E6Z X;  5CGK A;  2EPB A;  2AQ1 B;  2BA1 A;  2F0Q A;  2AHO B;  2L15 A;  2EY6 A;  2V4D A;  2RHQ B;  3CCQ A;  1XMO Q;  3I4M B;  2FHT A;  3F1Z A;  5KYI A;  4MHE A;  3QO2 A;  4OWX B;  4X6A H;  3DM3 A;  3I4O A;  3D4D A;  4DV0 Q;  4B9W A;  4A3D H;  4GNX A;  4FYD A;  2NBF A;  4CBV A;  2SEB D;  1X54 A;  4DK0 A;  4NXM Q;  4K5X A;  5FO9 B;  1G2T A;  2R93 B;  4DV0 L;  3WDN A;  1EQV A;  3S1M B;  5EAY A;  1EU4 A;  1YNJ D;  4X64 L;  1YNN D;  1KQS A;  4NXM L;  1VQG A;  4ZYS A;  2N78 A;  4BA2 I;  1R9T B;  2LKV A;  5C44 G;  2VB2 X;  1SNM A;  1SMY D;  5CV9 A;  2ES2 A;  5FJ8 H;  1K8A C;  1AZQ A;  3NHH A;  4IOC A;  3HOY B;  4C3H B;  3VR6 A;  4A3F H;  5IP9 G;  1IBL Q;  1GHK A;  4ULL A;  3ULL A;  1WTX A;  1Q46 A;  1ZXT A;  4X65 L;  4HID A;  4A3M G;  1NJI C;  1IBM L;  3S17 H;  3U9S A;  2C9O A;  2CWA A;  3CXC A;  1O7Y A;  2K5W A;  1IBL L;  4A3F B;  1RIP A;  5HY6 A;  1F9P A;  3JAM E;  4ZKC B;  2Q2I A;  3MVV A;  1WCM H;  5IOD A;  2B63 B;  1MKH A;  1WTH A;  5KNC A;  2MO1 A;  3ERQ A;  1HTP A;  4YWK A;  1B50 A;  3F8T A;  1ONL A;  2JEB I;  4IFD H;  3OIP A;  4JG2 A;  1BBX C;  5JEA H;  3MTS A;  1WCM B;  4X3T A;  5C3X A;  2UXB Q;  1LT3 D;  3UE1 A;  3IFD A;  1JIC A;  4CKB A;  3GO5 A;  1QZH A;  1I6H H;  2F0W A;  1H9S B;  3D0F A;  1NY4 A;  2D9U A;  2UXB L;  4OXP A;  1QE6 A;  3G71 A;  5M3F H;  3NEM A;  3MXP A;  3NBI A;  3RR5 A;  1KIX A;  1PH1 A;  2B2T C;  2DNE A;  1EY6 A;  4C3I B;  2F0H A;  1PRT D;  4GN5 A;  5K36 G;  4LUO A;  1S5D D;  3KF8 A;  2OTL A;  1CZG A;  2K32 A;  1X55 A;  3CCR A;  3K5L A;  1SRU A;  4IUU A;  4XIG S;  1SNO A;  1VQK A;  3FKI H;  1HNZ Q;  4DR6 L;  1STG A;  2E2D C;  5JVG 3;  3CF5 A;  1L0X B;  2EDG A;  3M85 A;  1B70 B;  1OXU A;  3RLN A;  5EKL A;  4O42 A;  2AKW B;  2PQA A;  5DAU A;  1HNZ L;  2DGY A;  1SR3 A;  5C44 B;  1JOQ A;  2PW7 A;  1HA5 A;  5J39 A;  3MEF A;  4HSP A;  4U67 3;  1HRJ A;  2BH8 A;  3E0E A;  4TSS A;  4LF4 Q;  3GV6 A;  1S3O A;  2NZO A;  1HPC A;  4DV3 Q;  2A6E C;  2NN6 G;  3HOX H;  4MN3 A;  4A3M B;  5GAE C;  1VCI A;  1J6Q A;  4HJ9 A;  1H9S A;  1HZC A;  2ZTE A;  1SJE D;  5IYC H;  4LF4 L;  5FLX L;  4H0L C;  5DM7 3;  4DV3 L;  4OX9 Q;  2XVS A;  3RZO H;  4MIU A;  4GLX A;  2Q2T A;  1B9M A;  1GKH A;  1CKO A;  3D31 A;  1YI2 A;  4H7B A;  1FGU A;  1G6P A;  4G7H C;  5GQO A;  2KOL A;  4OX9 L;  4XT3 B;  3S2H B;  3URY A;  2CH4 W;  3KLW A;  1OXX K;  2JA9 A;  3P1H A;  3A7L A;  1NE3 A;  5T1I A;  5IYB H;  1TT2 A;  2UUA Q;  1TS4 A;  3HKZ E;  1T5E A;  4R9W A;  2XWJ B;  4K2L A;  3WWV A;  4PQX A;  5JJL A;  1HA6 A;  3G6J B;  5NUC A;  4A3J G;  2OF1 A;  4XDX A;  2UUA L;  2KVM A;  2E2I B;  4P72 A;  5J22 A;  4X3K A;  3U50 C;  3PGZ A;  3V96 A;  1L1O C;  1BBU A;  5GRO A;  5LMU Q;  1X3E A;  1F2Z A;  5ELC A;  3R2T A;  2PI2 A;  3VA7 A;  3ND9 A;  1QCB D;  4OIJ A;  2F0T A;  4HMJ A;  2LXK A;  4UY8 C;  1S4Z A;  4LFA Q;  2X6G A;  1OXS C;  4YWL A;  1JCK B;  1MD2 D;  1O7Z A;  3C3L A;  3S15 H;  3UDX A;  1EFI D;  4JK1 C;  4I7Z C;  4L5S A;  2K4K A;  2F4V Q;  2ZJR A;  4POF A;  2NUC A;  4LFA L;  5DEH A;  5IYD G;  4ME3 A;  4DV6 Q;  4A4I A;  5HGQ A;  2E8G A;  2MHV A;  2NZ1 D;  3R3O A;  2F4V L;  2M2L A;  2Z6K C;  4C1N K;  1XMQ L;  1DCZ A;  4XYQ A;  1EYA A;  4JI8 Q;  4WRD A;  5IT9 E;  1CK1 A;  3FVQ A;  3CKI B;  4OON A;  3TP5 A;  4JI8 L;  4KJN A;  3MXN B;  1VDZ A;  3S16 B;  4BY7 H;  3I55 A;  1AN8 A;  1N34 Q;  2XIW A;  4TRD A;  3K7U C;  1WTQ A;  4YCU A;  1BNZ A;  4PZ7 A;  1I4H A;  4A93 H;  1HR0 W;  1A62 A;  1I50 H;  1CFM A;  4RGO S;  1PZK D;  3BYT B;  4UP7 A;  2YV5 A;  1N34 L;  3UDF A;  4A3J B;  1VMP A;  3NUC A;  4JW0 A;  5I6W A;  4G57 A;  4IJH A;  3GTQ B;  4O2D A;  1STB A;  3T1Y Q;  1PH6 A;  1I50 B;  2NVY H;  1XJV A;  2IT1 A;  3E3X A;  3G48 A;  1GUN A;  5DNF A;  3BU2 A;  2ZT9 C;  1E22 A;  4B3R Q;  1MJC A;  4JI2 Q;  3OTO Q;  1JWS D;  4C56 C;  4G7Z C;  4AQY L;  1SNQ A;  3T1Y L;  2ZXO A;  2MP1 A;  3ERS X;  2VNU D;  2KJX A;  3CME A;  5LMN Q;  1S5F D;  3DHQ A;  1K0S A;  4V19 0;  5C4J B;  4JI2 L;  3OTO L;  4NW2 A;  3FPP A;  3HOU H;  4K0K L;  1WTP A;  2XSC A;  3OWE B;  5GAG C;  3MXN A;  2WB1 G;  4NDX A;  3BVM A;  2AUK A;  3I3C A;  3PUV A;  1B9N A;  5LMN L;  1AE3 A;  4A3I G;  4B3S Q;  1PRT B;  2ASB A;  1HZ9 A;  5IOC A;  3CRL C;  3JAM L;  2YTX A;  3H15 A;  4RA8 A;  3EQL C;  1V1P B;  1HUN A;  3G7L A;  3M3Y H;  5C0X G;  1N33 Q;  4HCS A;  2B2W A;  3QB3 A;  2F0J A;  2D0P A;  4B3S L;  5BN5 A;  1BCP C;  2MPM A;  2UUB Q;  4FF2 A;  4AH6 A;  5BN4 A;  4JC0 A;  3S1R B;  2KCM A;  5M5X H;  3C2P A;  5IP7 H;  4WFN 3;  1N33 L;  2ENB A;  4DV2 Q;  1GM5 A;  1IL2 A;  3IFT A;  2XRQ D;  2K04 A;  4M8A A;  4GKJ Q;  1NR2 A;  3HOV B;  1TWG B;  3J7Z C;  1CHP D;  1OXT A;  4MZ9 A;  2K50 A;  1G6Z A;  2UUC Q;  1KXL A;  3H0G H;  4IAL A;  2QA4 A;  3TSS A;  2JP1 A;  4LW1 A;  4DV2 L;  3GTM B;  2UXD Q;  3AFP A;  3CHB D;  4GKJ L;  4N8X 1;  1SSO A;  3J81 i;  1M8A A;  1HTL D;  1LT4 D;  3OWF A;  1DJR D;  1QUQ B;  2UUC L;  2BDO A;  4FF1 A;  4JPB W;  1WTR A;  1EY5 A;  2UU9 Q;  2GN5 A;  2UXD L;  2SOB A;  1Z47 A;  1CI3 M;  3T51 B;  2M9V A;  1HJP A;  3A5Z B;  2DN8 A;  2NVX H;  1VF5 C;  2UU9 L;  4X62 Q;  4GOP C;  3SK8 A;  3L2P A;  4Z9C B;  3PO2 H;  1K83 B;  4QB4 A;  5FLM G;  4HIM A;  2PMZ B;  4ZAI A;  5CBA E;  1IYJ B;  1N8R C;  2VUM H;  4X62 L;  1F77 A;  1J9O A;  4ZK9 B;  1B4O A;  4JOI C;  2SNS A;  2F03 A;  3H3V C;  1WD1 A;  1DOL A;  1VQC A;  2FFK B;  2KUM A;  3BVZ A;  3MHB A;  3CCV A;  2RSO A;  1NSN S;  1S5B D;  1DM0 B;  2Z0S A;  2VB3 X;  3FPU B;  4RFB A;  1Y1W G;  2JN4 A;  2Y0S G;  3SR1 A;  3TEH B;  4L6T B;  5M5Y H;  1QB5 D;  4A3L H;  5L37 A;  1QUQ A;  2NN6 I;  3M4O H;  3STB C;  4A3E G;  2K52 A;  2ZXR A;  1KAB A;  3BDC A;  2JE6 I;  2JYO A;  4OWT B;  1PTO D;  2K33 A;  2KCC A;  5GAH C;  3PO3 H;  2E2H B;  5D65 A;  3M4O B;  3HRZ C;  2KEE A;  1LO5 D;  3GTO H;  1KRT A;  2I0Q A;  1W2B A;  1L0W A;  3F2B A;  2N49 A;  3S1N B;  4XT1 B;  3HOZ G;  3E5S A;  1PH3 A;  4NXN Q;  2R7Z H;  3PO3 B;  2F3W A;  1E24 A;  1CKN B;  4C3J H;  3K5N A;  2HHH Q;  4S3S A;  4UAI A;  3HOW H;  2XGT A;  3MFY A;  3ONA B;  2YYZ A;  3S2D H;  2RQX A;  4J1M A;  1BR9 A;  2CHB D;  3CCM A;  4NXN L;  3TDQ A;  3EVQ A;  3RLO A;  4L63 B;  2HHH L;  2B2T A;  4L5Q A;  4DK3 C;  2CWP A;  4BBS G;  2EZV A;  4BY1 H;  1FR3 A;  2QCP X;  1Z7T A;  4JI5 Q;  4GKK Q;  4CHT B;  1VQ8 A;  4R1J A;  1B3Q A;  4MTN A;  4DUZ Q;  2F0S A;  4A3G H;  4A3B G;  4JI5 L;  1DGS A;  4GKK L;  4PZ6 A;  4QQB X;  3S1Q H;  4BXX H;  1FD7 D;  2F0P A;  3OW7 A;  5EJW A;  4APV A;  3CCU A;  2R92 G;  1ILP A;  2L11 A;  1PDQ A;  4CDD C;  4DUZ L;  1WVL A;  5I6Y A;  2K5Q A;  2L4N A;  4IPG A;  1JWU D;  4G4K A;  1C8C A;  1LAB A;  4LF7 Q;  2KQ3 A;  1B2T A;  4QMG A;  4MNO A;  5C4X G;  4GLA C;  3CCS A;  3KF6 B;  1B8A A;  3NXW A;  3VYU A;  1K8O A;  1WTW A;  2Y0S B;  2XTI A;  3TP7 A;  5IT9 L;  2LS0 1;  4LF7 L;  1SE8 A;  1UNS A;  5E7N A;  2JA6 G;  3CC7 A;  1PH9 A;  1M1K C;  1SNC A;  1X3G A;  4RGT A;  4PMB A;  1ILQ A;  1X3F A;  1XTD A;  2E5L Q;  4IUP A;  4OWW B;  1GUO A;  1PZI D;  2K5H A;  4JV5 Q;  1A2T A;  2EYP A;  2Z4I A;  1LT5 D;  1AFP A;  2PZU A;  4ZUI A;  1C48 A;  1ZYR D;  4DK6 C;  2E5L L;  5EBC A;  3HG9 A;  1EYD A;  3ULP A;  4CKE A;  2FIN B;  3K57 A;  3HOZ B;  1PLF A;  4DUY Q;  4JV5 L;  1HFN A;  3PCO B;  4PG3 A;  2B8F A;  1I4P A;  3RMH A;  1RL2 A;  3S14 B;  3NEL A;  4HJ8 A;  4QJF A;  4LFC Q;  1HHV A;  2VS1 A;  3N6R A;  3DM1 A;  4QUC A;  1EWH A;  4GNX B;  5IGE A;  4K5V A;  2B2Y C;  5TSS A;  4KY5 A;  1A3V A;  5I2X A;  3J81 j;  4IPH A;  3KF6 A;  3P75 A;  4P73 A;  3I7F A;  2QDL A;  3B6Y A;  4OEL B;  1L1O A;  3M7N A;  2L1B A;  1K8G A;  4BBS B;  4CDC C;  3GDE A;  2RHS B;  5ISR A;  4FP5 D;  1SEB D;  4IZ8 A;  4HJ5 A;  2QEJ C;  2ZTC A;  2KHS A;  1E0B A;  3KBG A;  4UDU C;  3FMC A;  1QJO A;  4DNR B;  3X3N A;  1PH7 A;  2H1E A;  3FHW A;  3I4M H;  1YJW A;  4A3C G;  2R92 B;  2DUD A;  2QEX A;  1T9H A;  1R4P B;  5C4X B;  3I90 A;  1D1I A;  1MHW C;  4AYB G;  1E7Z A;  2HD3 A;  3OSO A;  3DMU A;  4DA2 A;  3L3O C;  4FDB A;  4H13 C;  2R93 H;  2X6L A;  5C0X I;  2A6H D;  2JA6 B;  2PI2 E;  3S1M H;  2AQ3 B;  1RD9 D;  2B3G A;  4X64 Q;  3ND8 A;  4YCV A;  3GTP H;  4EGV A;  1UAP A;  1R9T H;  1S72 A;  1I4G A;  1SYF A;  5JEA G;  5BR8 Q;  2F0L A;  1UWV A;  4PZ8 A;  1YJ9 A;  2JA5 B;  4DXF A;  2YU9 B;  1VQB A;  3OPO A;  3HOY H;  4C3H H;  5IGC A;  1XPR A;  4R4I A;  4UP9 A;  3GTP B;  2A1A A;  1WTV A;  1RF2 D;  5BR8 L;  4X65 Q;  4ABN A;  4PV1 C;  1IBM Q;  1PYB A;  2UXC Q;  4G7O C;  4KN7 C;  1E1T A;  3LWU A;  4J8Q A;  3DLL A;  1XPO A;  1PTO B;  1VQE A;  2B63 H;  3KF8 B;  1FNV A;  2UXC L;  3ULJ A;  2RKS A;  1NCV A;  4ZUJ A;  4ME5 A;  3D4R A;  5CV8 A;  1A0I A;  1W3S A;  5G3L F;  1CQF A;  4KY7 A;  2KED A;  2H4O A;  3BJU A;  4ILW A;  3TS0 A;  5EPJ A;  1F9R A;  2PQA B;  1LTI D;  2GA4 B;  1VQM A;  2BE5 C;  3UI2 A;  4I65 A;  2CFM A;  3ER0 A;  3AMU A;  2BCO A;  4B9X A;  2VW9 A;  2IJ0 A;  3D4W A;  5DM6 3;  4EX5 A;  1IZ6 A;  3MXG A;  4BBR G;  4RCN A;  5KND A;  4C3I H;  4ZQ3 A;  3HOX G;  1F2M A;  4X3S A;  1WJJ A;  3CCE A;  1QIL A;  4LWC A;  1GOZ A;  1SYE A;  3D6C A;  1EL0 A;  4AYB B;  1YHA A;  2IPK D;  5IYC G;  3SGI A;  1HXY D;  5ELE A;  4K14 A;  1HQR D;  4DV5 L;  1SXT A;  1B53 A;  2D62 A;  4DR6 Q;  2EXZ A;  5IGB A;  3P20 A;  1TY2 A;  1KLU D;  1ESF A;  4KHV A;  5FO7 B;  5IGD A;  3CRK C;  2PZW A;  2JA7 G;  1BUV T;  1PFB A;  2WII B;  2F0G A;  5C44 H;  4DAP A;  1H95 A;  1NR4 A;  1V1O A;  4CKC A;  5IP9 H;  4MTK A;  1J5E Q;  1IW7 C;  1LYL A;  5FOB B;  2OTJ A;  4A3M H;  2CKZ B;  2BDN A;  2EYM A;  2RBM A;  4LUV A;  2RSN A;  1Y1V G;  5F2D A;  1RTO A;  1KL9 A;  4A76 A;  1AE2 A;  4HJA A;  1J5E L;  5J3B A;  2CH4 A;  4KKS A;  1PXU A;  1JE5 A;  1QNU A;  2R7F A;  4HED A;  4JVZ A;  1SFO B;  4GLV B;  3J7Y W;  1LUZ A;  1NBW A;  3H94 A;  4GOP A;  1CA6 A;  3S2H H;  4LF5 Q;  1ASZ A;  4U68 A;  3T1H L;  1KLG D;  1VQF A;  4A3K G;  5KGU A;  3H91 A;  5H1S E;  2R7D A;  3I4N G;  1C4Q A;  4LF5 L;  3A74 A;  4O1N A;  4YWM A;  2Q8T A;  4JI3 Q;  2E2I H;  4DR5 Q;  1EWI A;  5FO8 B;  1DOM A;  4F7X A;  4BBR B;  4F87 A;  2A73 B;  4OO1 G;  1ESR A;  3FEW X;  3I8Z A;  5K36 H;  1B7Y B;  3BG3 A;  1RJT A;  4JI3 L;  1AEX A;  2HUG A;  2K28 A;  4DR5 L;  1Y69 U;  1PRT F;  4GN4 B;  2NVQ B;  1JQY D;  5C4Z A;  2XWB B;  1VQP A;  1N9W A;  1Q1B A;  5EKK A;  4DR3 Q;  2D5D A;  5EGT A;  2ZM6 Q;  2NWG A;  3FP9 A;  1EY9 A;  2JA7 B;  1EWC A;  3NPP A;  1B44 D;  5A2Q L;  4DNT B;  1PMR A;  2K01 A;  4BY7 G;  2E2J B;  4KI0 A;  1ML0 D;  5KEE A;  3NTH A;  3C1F A;  5LL6 X;  3KOJ A;  4DR3 L;  2ZM6 L;  3NE5 B;  3PSI A;  2EYL A;  2CQO A;  1KAA A;  1QVF A;  1F2Y A;  1XPU A;  2K6A A;  3CC4 A;  1LTT D;  4K8J A;  4HJ7 A;  2ZJP A;  2NN6 H;  2A5H A;  4DF7 A;  2A69 C;  1Y1V B;  1JJ2 A;  1XMQ Q;  2EJF C;  2EY2 A;  4JI6 L;  3J81 c;  2PPB C;  2R61 A;  3DWQ A;  2A6E D;  3EJI A;  1YNX A;  1MSG A;  4ZKB B;  1W6K A;  1TWC B;  4NB3 A;  1VQH A;  3I4L A;  4LNQ A;  5KIX A;  4B3M L;  3NTK A;  1KHI A;  3S16 H;  4LFB L;  3OMG A;  4KD4 A;  5JJK A;  2OT2 A;  1V8Q A;  1YVC A;  1CT1 D;  5K5P A;  2F0M A;  1TR5 A;  1TWA B;  3HOU G;  4A3K B;  3T56 B;  2PMZ E;  1T5X D;  1EY0 A;  1S5C D;  1GUT A;  3J80 i;  3T4A C;  3K7A B;  1PHJ A;  1EZ8 A;  4A3J H;  4XXE A;  3V05 A;  2Q8R E;  1Q3L A;  3MC0 B;  4DU9 A;  3O13 A;  3GTQ H;  1VQL A;  5JOB A;  3LNN A;  3U4Z A;  5A35 A;  2HIX A;  5D14 A;  3BS1 A;  3GTL B;  1CHQ D;  5M3M G;  2F3V A;  2WIN B;  1TY0 A;  1II3 A;  4BS9 A;  4NPS A;  1TII D;  1MBY A;  1BVS A;  5JPN C;  4AQY Q;  2K5D A;  2OQ0 A;  2J7Z A;  1EEI D;  4HCE A;  5I9P A;  4IQZ A;  1HCZ A;  2XN9 C;  3TS2 A;  3ZJY C;  5C4J H;  3CPW A;  2JA8 G;  2L55 A;  3H3V I;  2C5C A;  2PCF B;  1UE1 A;  1Y8N B;  4K0K Q;  1H9R A;  1E2Z A;  4LMQ D;  4PNY A;  4QIW B;  5LMN W;  3DWP A;  1H9M A;  1A2U A;  1CSP A;  4IUV A;  3QWN A;  4IN3 A;  1MIU A;  5JPM C;  2K75 A;  3S1R H;  1EIY B;  1D7Q A;  2B2Y A;  3CMA A;  1ICW A;  3MA2 B;  2GVA A;  2XNA C;  3D3R A;  5IIF A;  5IY0 A;  2CVR A;  3BYY B;  2ATW A;  1IYU A;  2WV6 D;  1KDA A;  3HOV H;  1DZ1 A;  1TWG H;  2BOS A;  2WAC A;  1QOH A;  2LY7 A;  3OYY A;  2F4I A;  4K2K A;  4RCO A;  3RLF A;  4KMU C;  5E4W C;  3TP8 A;  2DJF C;  4ZCK A;  4HTH A;  3PIP A;  1LTB D;  1A3T A;  4UPA A;  2KHJ A;  3GTM H;  3CCL A;  5EBD A;  1G29 1;  2K05 A;  4M1U B;  3ITP A;  1A6X A;  2HDM A;  3I72 A;  2IW3 A;  1UE5 A;  3PIP 3;  3J7A F;  2PYK A;  1Q8I A;  4IOA A;  1AW7 A;  3UE0 A;  3D8G A;  1SJH D;  1WI5 A;  2KHI A;  3VR5 A;  3GTG B;  4DKA C;  5BN3 A;  2EYF A;  4KK7 A;  1SNP A;  1EOT A;  3LX0 A;  5M3M B;  1PV4 A;  1EIF A;  2Y0S E;  5CV5 A;  1BXT A;  4LF6 Q;  1K83 H;  1UE6 A;  2EXD A;  2QDB A;  1NMG A;  4HIO A;  3EBE A;  3L7Z C;  2IX3 A;  2F3I A;  2SDF A;  4P2C B;  4LF6 L;  1CTM A;  1JOK A;  1PZJ D;  2JA8 B;  2Q8I B;  2ALY B;  1O78 A;  3A0J A;  1PFS A;  4C3J G;  1VQ9 A;  5CYU A;  1I4R A;  2D2C C;  4BWG B;  3KJO A;  3E0J A;  1PH4 A;  4R4T A;  4HR7 B;  1K9M C;  2EYJ A;  2F0O A;  4J6H A;  3JAM i;  1NMF A;  4HN7 A;  5E1F A;  2EIF A;  1K73 C;  2JQO A;  5CC4 A;  2WB1 B;  4RH6 A;  4LF8 Q;  1XWE A;  4L8J A;  4DAM A;  4A3I B;  1S40 A;  3SVM A;  5M5W B;  4JI1 Q;  1GHJ A;  3TZD A;  2NTT A;  2JXM B;  4A75 A;  2E2H H;  3R8B A;  4POG A;  4LF8 L;  1HNW L;  2F0F A;  1PFM A;  4FF4 A;  1W6J A;  1HZB A;  2RF4 A;  4JI1 L;  4YY3 L;  3S1N H;  1BCP D;  1EYG A;  1CSQ A;  3KLR A;  1MSH A;  2EJM A;  1LLR D;  1N32 Q;  3R93 A;  4DK1 A;  1PVO A;  3CQZ B;  4BXX G;  1PYS B;  1XYI A;  5CV4 A;  1X56 A;  2CW0 C;  1N32 L;  3PUY A;  1V1Q A;  1I5F A;  4NMZ A;  4K8I A;  5E3F A;  5C4H A;  1FGB D;  4KJO A;  1VQ7 A;  4QF4 A;  2A68 C;  4N9T A;  3M7G A;  3Q6S A;  4OO1 I;  3SE0 A;  1TXY A;  3NP8 A;  1YZ6 A;  3G4S A;  2KEC A;  1AZP A;  2EOT A;  3LWE A;  3F2C A;  5C5M A;  5FLM H;  3EIV A;  1EIH A;  1OTC A;  5I9O A;  3VDY A;  2HIV A;  4HSV A;  3C1E A;  1I4X A;  1K0R A;  1VQD A;  1C7Y A;  2B29 A;  3WOF A;  5C3E G;  3A7A B;  5EPL A;  1SMX A;  1STA A;  4UHV A;  1U0L A;  2MJ8 A;  1H9K A;  1GO3 E;  2VL6 A;  1B1Z A;  3FRP B;  3VA5 A;  1E2W A;  2G9D A;  3K8A A;  5JVH 3;  2FMC A;  1RTN A;  4LF9 Q;  1D2B A;  5D3I B;  1G51 A;  4QL5 A;  2MGS A;  3KUP A;  2O4X A;  2JEA I;  1Y1W B;  3HEJ A;  5KYL A;  1L1O B;  1N36 Q;  1U4R A;  5C6A A;  2B2V C;  4TKO B;  4LF9 L;  2LFN A;  1Q86 C;  3STB D;  4KY6 A;  4A3E B;  3K80 C;  2N8N A;  2A19 A;  4RGN A;  2VQF Q;  1N36 L;  1JT8 A;  2F0E A;  1WOC A;  2K03 A;  1STE A;  5KNB A;  1ROD A;  1SBB B;  3HOZ H;  4DR2 Q;  1QNK A;  2EY5 A;  1JB3 A;  1LTS D;  1RCV D;  4C2M B;  5C0X J;  2VQF L;  2I5H A;  3S14 H;  1TS5 A;  3KDF B;  4DR2 L;  5FKA C;  5A2Q E;  1TS3 A;  2HDL A;  1EEF D;  1TWH B;  2M00 A;  4DN4 M;  2GVB A;  3EFX D;  4BBS H;  1SN8 A;  1Y8P B;  2LSS A;  3BZK A;  3SHL A;  1SYC A;  2WAQ G;  3PUZ A;  3V2T A;  1Q82 C;  5M9O A;  2VQE Q;  2MUY A;  1TWF B;  5C5L A;  4A3D G;  4AYB E;  1Z6H A;  1YNJ C;  5GAD C;  1YNN C;  4LK1 C;  3PUX A;  3S24 A;  4R4C A;  3C46 A;  2VQE L;  1P8L A;  1I3Q B;  1SMY C;  3PIO A;  3I70 A;  1SYD A;  3SK4 A;  4CJ1 B;  2R92 H;  1HFG A;  5C3E B;  4WJ4 A;  2VZA A;  4RWS C;  3A55 A;  3PMF A;  3RZD B;  2OXP A;  3S9W A;  2X69 A;  4A3B B;  4YHH Q;  1I94 Q;  1SE2 A;  2NB0 A;  5FJ8 G;  5C4X H;  4Y7N B;  3SK6 A;  1EZ6 A;  3CCJ A;  3GTJ B;  3QIA A;  1TU2 B;  4RKB A;  2AWN A;  2MO0 A;  4A3F G;  3ICE A;  3TZU A;  4I7A A;  4YHH L;  1I94 L;  2JA6 H;  1EQT A;  3KDF A;  5ELF A;  1P16 A;  2EE1 A;  4DXG A;  1CA5 A;  4XQN A;  2HCI A;  2HT1 A;  4DR7 L;  1GXD C;  2Z6K A;  4XQQ A;  4QCL A;  1WCM G;  1LM0 A;  2JA5 H;  3DEP A;  3AYH B;  2NZH A;  1QZG A;  4IUN A;  2YU9 H;  3NQT A;  3MZ5 A;  3VYS A;  2KCN A;  4IFD G;  1DOK A;  1JJG A;  1I6V C;  1PH8 A;  3T16 A;  2NVT B;  2F0V A;  1X6O A;  1QWY A;  3X3M A;  1VQ4 A;  1BO0 A;  3E9I A;  1HH2 P;  4L5T A;  1SND A;  1D8L A;  4C3I G;  3KLS A;  4GS3 A;  1FNW A;  3DWA A;  3K0X A;  1PTO H;  1PRT C;  4K6L A;  3SXH A;  1JC7 A;  1XMO L;  1HZA A;  1PA6 A;  3ERO A;  2I5M X;  3E9H A;  2RA4 A;  3J81 E;  5M3F G;  1U4P A;  3PF4 A;  2V1C C;  4ALP A;  3CC2 A;  4QUF A;  2WAQ B;  1BCP B;  1D5M C;  1SAP A;  5ELD A;  1Q81 C;  2WP8 J;  5D3D A;  4A3D B;  1KDC A;  2IX1 A;  1EOV A;  1EFW A;  2CQA A;  3VR2 A;  3N52 A;  2H5X A;  2F0U A;  3H09 A;  1SYG A;  1YHB A;  4OL7 A;  1E3P A;  3FKI G;  1XNQ Q;  5JJZ A;  4XYO A;  2K14 A;  4ZRZ A;  5IGF A;  4PMW A;  3U4V A;  4A3C H;  5KRU A;  1Q1E A;  3CP0 A;  3A56 A;  1LTA D;  4Q5V A;  3HGB A;  1Y14 B;  2B2U C;  4IPD A;  1XNQ L;  1STH A;  3L0O A;  4EQP A;  4DV1 Q;  1VMC A;  1IYV A;  1NTG A;  3NWT A;  5CBE E;  4DV5 Q;  4NKL A;  3S17 B;  1X3Q A;  1DD2 A;  1XXG A;  2EYO A;  2A8V A;  2PNR C;  4DV1 L;  4GOP B;  3RUZ A;  2K5V A;  1Z9F A; 
#chains in the Genus database with same CATH homology
 1MI2 A;  3A8J E;  1CM9 A;  1U4M A;  4RAU C;  5LHY 1;  1R4Q B;  2E75 C;  3TP6 A;  2I46 A;  1SE3 A;  1G91 A;  3OIQ A;  2RDF A;  1D5Z C;  5EKI A;  1XX8 A;  4ID6 A;  3GTK B;  1UEA B;  4TQU S;  3NK9 A;  3NQI A;  3A54 A;  1ZEQ X;  2AQ2 B;  1RDP D;  1XTC D;  2E76 C;  1I6H B;  4F88 A;  4XQJ A;  5M3F B;  4H44 C;  1HUM A;  3MEH A;  4IUT A;  5LL6 S;  3Q24 A;  3QG1 A;  4PMC A;  4CJ0 B;  2FMM A;  2DNC A;  4CGY B;  4C1N I;  1QG7 A;  3K58 A;  2Z8L A;  4K6D A;  3QOL A;  4X3U A;  3FKI B;  3RD4 A;  2QKI C;  1JOR A;  3VR4 A;  2L9H A;  4KN4 C;  3GP7 A;  1V43 A;  1DYQ A;  2BE5 D;  2B8G A;  1SYB A;  1TQO A;  2EY1 A;  2LMC B;  2PZT A;  4RHS A;  1ET6 A;  5JAV A;  4ODG A;  4OGQ C;  2IWH A;  3FDT A;  3VR3 A;  5HUR A;  1J8I A;  1IL8 A;  3KK7 A;  3HOX B;  4RHR A;  3SDZ A;  2NTS A;  3MXU A;  3RZO B;  3EA6 A;  1OXV A;  1EIG A;  1WTO A;  3QJY A;  3J80 L;  1JOO A;  2N88 A;  3W2D A;  1VF7 A;  1O7L A;  4EVO A;  5ELB A;  5I4D A;  2OEO A;  3GQB A;  2ZXP A;  2DY7 A;  2WKD A;  1IW7 D;  2Z4H A;  4IFD J;  2NYZ D;  1ET9 A;  5JEA J;  2R3Z A;  2FJ2 A;  1D1K A;  5FK9 C;  5HGT A;  3VYT A;  5EQ0 A;  1BOS A;  5COY A;  2G9H D;  2HCC A;  1ENC A;  1F9Q A;  1G8Z D;  4GZY C;  3SK5 A;  3MAQ A;  2TMP A;  1EY8 A;  1KNA A;  3S15 B;  4OIK A;  1G2S A;  3ZYY X;  2PQE A;  4OO1 H;  3I4N B;  4ZLT F;  2I07 B;  3HZX A;  1I4Q A;  1RHP A;  1GJX A;  4IUQ A;  3DEO A;  3PUW A;  3OHX C;  2ICI A;  4KV6 A;  2JSO A;  5CMD A;  2B2V A;  5CR3 A;  1Y8O B;  4LAA A;  5J1Z A;  4FXG C;  2EJG C;  1X3P A;  1B3A A;  2RVL A;  3AU7 A;  3MWY W;  4N9P A;  4IFD I;  1JWM D;  1D6E C;  4BY7 B;  4NP5 A;  4KTA A;  4K5W A;  3J81 L;  3AB9 A;  3W3A A;  4XTC S;  1FYC A;  4A93 B;  4RKL A;  1KDB A;  1STY A;  1O80 A;  2A69 D;  2F0D A;  2R6G A;  3BDL A;  4Q0F A;  1FNU A;  3R2I A;  3IL8 A;  2IX0 A;  2L5T A;  2NVY B;  2E74 C;  3KBX A;  5T1G A;  3IKJ A;  4E6I A;  3PV0 A;  1ENA A;  3J7A V;  3HKZ B;  3OMC A;  4HAE A;  3IAY A;  2B39 A;  3U9O A;  1TVX A;  1EY4 A;  2O2L D;  3HOU B;  3WOE A;  2EVB A;  2XRS D;  3T53 B;  1ZKO A;  2AUJ D;  4V0B A;  3I73 A;  3TME A;  1CZW A;  3NTI A;  4KKT A;  1X32 A;  4EQN A;  1H9J A;  2O5I C;  1PTO C;  2DY8 A;  2EYH A;  3M3Y B;  5CV7 A;  4EQO A;  4YIJ A;  3DXJ C;  5M5X B;  1D5X C;  1TKW B;  3DUZ A;  1RKN A;  1E2V A;  4FF3 A;  1KTK A;  1SDF A;  1PFN A;  3H0G B;  1S5E D;  1JR0 D;  3Q22 A;  3A8I E;  1SE4 A;  2N55 A;  4LJZ C;  2A74 C;  2K1B A;  3T13 A;  3TN2 A;  4RGM A;  3HS0 C;  1V1P A;  5CV6 A;  5C0X H;  2Z1C A;  1L0Y B;  4FO2 A;  3I91 A;  2BA0 A;  3OOC A;  2NVX B;  5AFW A;  3K6O A;  2J4X A;  1K8M A;  3PO2 B;  4DFA A;  1UUP A;  1F9S A;  2VUM B;  1DON A;  1STN A;  3BDO A;  1GUG A;  2B2U A;  5I2Y A;  4CJ2 C;  3BVG A;  1A3U A;  1BDO A;  1KNE A;  2K7V A;  2L0C A;  2PO4 A;  5M5Y B;  3SEB A;  4IUR A;  4WOR A;  1IKL A;  2F0N A;  2O5J C;  1CQV A;  3A8K E;  1U9R A;  1ZYR C;  2SNM A;  3GTO B;  5C3W A;  1DXM A;  2ID0 A;  4KHZ A;  1U4L A;  1BF4 A;  2R7Z B;  4C3J B;  3HOW B;  1IKM A;  1GUS A;  4DAV A;  1EY7 A;  2IL8 A;  3S2D B;  5IGG A;  3K59 A;  3MFG A;  1LAC A;  3F2U A;  2ICE C;  4BY1 B;  5FLX E;  1Q90 A;  3NWS A;  2VXW A;  4FXK C;  1BCP F;  3CU7 A;  1PTO F;  4FNF A;  4A3G B;  3GV3 A;  3QOJ A;  5COR A;  3HP3 A;  3KLS X;  4BA1 I;  1BQQ T;  3S1Q B;  4DGZ A;  2CW0 D;  4DAY A;  3J80 E;  2F1M A;  1Q12 A;  2A6H C;  3NBH A;  1TS2 A;  2WKC A;  1JE4 A;  1LTG D;  3Q0A A;  2A68 D;  1M4V A;  2J0T D;  2PW5 A;  3K5M A;  3GD7 A;  4OHJ A;  4F8M A;  5E4X A;  2QIL A;  3TBI B;  4WJW A;  4R8N A;  1OO9 B;  3L9A X;  1AP0 A;  1F2L A;  3VYR A;  1HQM C;  4C3H G;  2KA7 A;  3K0Y A;  1MGS A;  1IHZ A;  2HQE A;  3NSW A;  1NAP A;  5EPK A;  3PIO 3;  4R8I A;  4FXD A;  2B2W C;  2L12 A;  4KKU A;  1LTR D;  3Q23 A;  2RDG A;  2F0K A;  1ENF A;  3P7J A;  1A15 A;  4FVM A;  1EU3 A;  4JBW A;  5G3L D;  4KD3 A;  3BZD B;  2AWO A;  1LT6 D;  3K5O A;  1NUC A;  2QF7 A;  3D6W A;  3M4Y A;  2F0I A;  2RDH A;  4B08 A;  3H6M A;  4HMI A;  1EYC A;  1PYW D;  2TSS A;  1LV9 A;  1WD0 A;  1GUW A;  3E6Z X;  5CGK A;  2EPB A;  2AQ1 B;  2BA1 A;  2F0Q A;  2EY6 A;  2V4D A;  3I4M B;  2FHT A;  5KYI A;  4MHE A;  3QO2 A;  3D4D A;  4B9W A;  4FYD A;  2NBF A;  4CBV A;  2SEB D;  4DK0 A;  4K5X A;  5FO9 B;  1G2T A;  2R93 B;  3WDN A;  1EQV A;  3S1M B;  1EU4 A;  1YNJ D;  1YNN D;  4ZYS A;  4BA2 I;  1R9T B;  2LKV A;  2VB2 X;  1SNM A;  1SMY D;  5CV9 A;  1AZQ A;  3NHH A;  3HOY B;  4C3H B;  3VR6 A;  1GHK A;  4ULL A;  1WTX A;  1ZXT A;  3U9S A;  2C9O A;  1O7Y A;  2K5W A;  4A3F B;  1F9P A;  3JAM E;  4ZKC B;  3MVV A;  5IOD A;  2B63 B;  5KNC A;  3ERQ A;  1HTP A;  1B50 A;  1ONL A;  2JEB I;  4IFD H;  3OIP A;  1BBX C;  5JEA H;  3MTS A;  1WCM B;  4X3T A;  5C3X A;  1LT3 D;  3IFD A;  1JIC A;  4CKB A;  3GO5 A;  2F0W A;  1H9S B;  2D9U A;  1QE6 A;  3MXP A;  3NBI A;  2B2T C;  2DNE A;  1EY6 A;  4C3I B;  2F0H A;  1PRT D;  5K36 G;  1S5D D;  3KF8 A;  1CZG A;  2K32 A;  3K5L A;  4IUU A;  4XIG S;  1SNO A;  1STG A;  2E2D C;  5JVG 3;  1L0X B;  2EDG A;  3M85 A;  1OXU A;  5EKL A;  4O42 A;  5DAU A;  5C44 B;  1JOQ A;  2PW7 A;  1HA5 A;  5J39 A;  4U67 3;  4HSP A;  1HRJ A;  4TSS A;  3GV6 A;  1HPC A;  2A6E C;  2NN6 G;  4MN3 A;  4A3M B;  1VCI A;  1H9S A;  1SJE D;  5FLX L;  4H0L C;  5DM7 3;  2XVS A;  4MIU A;  1B9M A;  3D31 A;  4H7B A;  4G7H C;  2KOL A;  4XT3 B;  3S2H B;  3URY A;  1OXX K;  3P1H A;  3A7L A;  5T1I A;  1TT2 A;  1TS4 A;  1T5E A;  4R9W A;  2XWJ B;  4K2L A;  4PQX A;  1HA6 A;  3G6J B;  5NUC A;  2OF1 A;  4XDX A;  2KVM A;  2E2I B;  5J22 A;  4X3K A;  3V96 A;  1F2Z A;  5ELC A;  3R2T A;  3VA7 A;  3ND9 A;  1QCB D;  4OIJ A;  2F0T A;  4HMJ A;  1S4Z A;  2X6G A;  1OXS C;  1JCK B;  1MD2 D;  1O7Z A;  3C3L A;  1EFI D;  4JK1 C;  4I7Z C;  2NUC A;  5DEH A;  2MHV A;  2NZ1 D;  3R3O A;  2M2L A;  4C1N K;  1DCZ A;  4XYQ A;  1EYA A;  4WRD A;  5IT9 E;  1CK1 A;  3FVQ A;  3CKI B;  3TP5 A;  4KJN A;  1VDZ A;  3S16 B;  1AN8 A;  2XIW A;  4TRD A;  1WTQ A;  1BNZ A;  1I4H A;  1CFM A;  4RGO S;  1PZK D;  3BYT B;  4A3J B;  1VMP A;  3NUC A;  5I6W A;  4G57 A;  3GTQ B;  1STB A;  1I50 B;  2IT1 A;  1GUN A;  5DNF A;  2ZT9 C;  1JWS D;  4C56 C;  4G7Z C;  1SNQ A;  2ZXO A;  2MP1 A;  2VNU D;  2KJX A;  1S5F D;  3DHQ A;  4V19 0;  5C4J B;  4NW2 A;  3FPP A;  1WTP A;  2XSC A;  3OWE B;  3MXN A;  4NDX A;  3BVM A;  2AUK A;  3I3C A;  3PUV A;  1B9N A;  1PRT B;  5IOC A;  3CRL C;  3JAM L;  4RA8 A;  3EQL C;  1V1P B;  1HUN A;  3G7L A;  5C0X G;  4HCS A;  2B2W A;  3QB3 A;  2F0J A;  5BN5 A;  1BCP C;  2MPM A;  4FF2 A;  5BN4 A;  3S1R B;  3C2P A;  4WFN 3;  2ENB A;  3IFT A;  2XRQ D;  2K04 A;  4M8A A;  1NR2 A;  3HOV B;  1TWG B;  1CHP D;  1OXT A;  1G6Z A;  4IAL A;  3TSS A;  2JP1 A;  3GTM B;  3CHB D;  1SSO A;  1M8A A;  1HTL D;  1LT4 D;  3OWF A;  1DJR D;  2BDO A;  4FF1 A;  1WTR A;  1EY5 A;  2SOB A;  1Z47 A;  1CI3 M;  3T51 B;  2M9V A;  2DN8 A;  1VF5 C;  3SK8 A;  4Z9C B;  1K83 B;  4QB4 A;  2PMZ B;  4ZAI A;  5CBA E;  1F77 A;  1J9O A;  4ZK9 B;  1B4O A;  2SNS A;  2F03 A;  3H3V C;  1WD1 A;  1DOL A;  2FFK B;  2KUM A;  3BVZ A;  3MHB A;  2RSO A;  1NSN S;  1S5B D;  1DM0 B;  2VB3 X;  3FPU B;  4RFB A;  3SR1 A;  4L6T B;  1QB5 D;  2NN6 I;  2ZXR A;  1KAB A;  3BDC A;  2JE6 I;  2JYO A;  1PTO D;  2K33 A;  2KCC A;  2E2H B;  5D65 A;  3M4O B;  3HRZ C;  2KEE A;  1LO5 D;  3S1N B;  4XT1 B;  3E5S A;  3PO3 B;  2F3W A;  3K5N A;  4S3S A;  4UAI A;  3MFY A;  3ONA B;  2YYZ A;  2RQX A;  4J1M A;  1BR9 A;  2CHB D;  3TDQ A;  3EVQ A;  4L63 B;  2B2T A;  2EZV A;  1FR3 A;  2QCP X;  1Z7T A;  4CHT B;  2F0S A;  1FD7 D;  2F0P A;  3OW7 A;  5EJW A;  1ILP A;  2L11 A;  1PDQ A;  1WVL A;  5I6Y A;  2K5Q A;  2L4N A;  1JWU D;  4G4K A;  1C8C A;  1LAB A;  2KQ3 A;  1B2T A;  4QMG A;  3NXW A;  3VYU A;  1K8O A;  1WTW A;  2Y0S B;  5IT9 L;  3TP7 A;  2LS0 1;  1UNS A;  1SNC A;  4RGT A;  4PMB A;  1ILQ A;  4IUP A;  1GUO A;  1PZI D;  1A2T A;  2EYP A;  2Z4I A;  1LT5 D;  1AFP A;  2PZU A;  4ZUI A;  1C48 A;  1ZYR D;  5EBC A;  3HG9 A;  1EYD A;  4CKE A;  2FIN B;  3K57 A;  3HOZ B;  1PLF A;  1HFN A;  2B8F A;  1I4P A;  3RMH A;  3S14 B;  1HHV A;  3N6R A;  3DM1 A;  4QUC A;  1EWH A;  5IGE A;  4K5V A;  2B2Y C;  5TSS A;  4KY5 A;  1A3V A;  5I2X A;  3P75 A;  3M7N A;  4BBS B;  2L1B A;  5ISR A;  4FP5 D;  1SEB D;  4IZ8 A;  2QEJ C;  3KBG A;  2KHS A;  1E0B A;  4UDU C;  3FMC A;  1QJO A;  4DNR B;  3X3N A;  2H1E A;  2R92 B;  1R4P B;  5C4X B;  3I90 A;  1D1I A;  3OSO A;  3DMU A;  4DA2 A;  3L3O C;  4H13 C;  2X6L A;  5C0X I;  2A6H D;  2JA6 B;  2AQ3 B;  1RD9 D;  3ND8 A;  4EGV A;  1UAP A;  1I4G A;  1SYF A;  5JEA G;  2F0L A;  2JA5 B;  4DXF A;  2YU9 B;  3OPO A;  5IGC A;  3GTP B;  1WTV A;  1RF2 D;  4ABN A;  4PV1 C;  4G7O C;  4KN7 C;  3LWU A;  4J8Q A;  1PTO B;  1FNV A;  2RKS A;  1NCV A;  4ZUJ A;  4ME5 A;  3D4R A;  5CV8 A;  5G3L F;  1CQF A;  4KY7 A;  2KED A;  2H4O A;  4ILW A;  5EPJ A;  1F9R A;  1LTI D;  2GA4 B;  2BE5 C;  3UI2 A;  4I65 A;  3AMU A;  2BCO A;  4B9X A;  2IJ0 A;  3D4W A;  5DM6 3;  3MXG A;  5KND A;  4RCN A;  4ZQ3 A;  1F2M A;  4X3S A;  1QIL A;  1GOZ A;  1SYE A;  3D6C A;  1EL0 A;  4AYB B;  2IPK D;  1HXY D;  5ELE A;  4K14 A;  1HQR D;  1SXT A;  1B53 A;  2D62 A;  2EXZ A;  5IGB A;  3P20 A;  1TY2 A;  1KLU D;  1ESF A;  4KHV A;  5FO7 B;  5IGD A;  3CRK C;  2PZW A;  1BUV T;  1PFB A;  2WII B;  2F0G A;  4DAP A;  1NR4 A;  1V1O A;  4CKC A;  1IW7 C;  5FOB B;  2RBM A;  2BDN A;  2EYM A;  2RSN A;  5F2D A;  1RTO A;  4KKS A;  1PXU A;  1QNU A;  4HED A;  1SFO B;  3J7Y W;  3H94 A;  1CA6 A;  4U68 A;  1KLG D;  5KGU A;  3H91 A;  1C4Q A;  4O1N A;  2Q8T A;  5FO8 B;  1DOM A;  4F7X A;  4BBR B;  4F87 A;  2A73 B;  4OO1 G;  1ESR A;  3FEW X;  3I8Z A;  5K36 H;  3BG3 A;  1RJT A;  1AEX A;  2HUG A;  2K28 A;  1Y69 U;  1PRT F;  2NVQ B;  1JQY D;  5C4Z A;  2XWB B;  1Q1B A;  5EKK A;  2D5D A;  5EGT A;  2NWG A;  1EY9 A;  2JA7 B;  1EWC A;  3NPP A;  1B44 D;  5A2Q L;  4DNT B;  1PMR A;  2K01 A;  2E2J B;  4KI0 A;  1ML0 D;  5KEE A;  3NTH A;  3C1F A;  5LL6 X;  3NE5 B;  2EYL A;  1KAA A;  1F2Y A;  2K6A A;  1LTT D;  4K8J A;  2NN6 H;  2A5H A;  4DF7 A;  2A69 C;  1Y1V B;  2EJF C;  2EY2 A;  2PPB C;  2R61 A;  3DWQ A;  2A6E D;  3EJI A;  1MSG A;  4ZKB B;  1W6K A;  1TWC B;  3I4L A;  5KIX A;  3NTK A;  3OMG A;  4KD4 A;  2OT2 A;  1V8Q A;  1CT1 D;  5K5P A;  2F0M A;  1TR5 A;  1TWA B;  4A3K B;  3T56 B;  1T5X D;  1EY0 A;  1S5C D;  1GUT A;  3T4A C;  3K7A B;  1EZ8 A;  4XXE A;  3V05 A;  2Q8R E;  1Q3L A;  3MC0 B;  4DU9 A;  3O13 A;  5JOB A;  3LNN A;  5A35 A;  5D14 A;  3BS1 A;  3GTL B;  1CHQ D;  2F3V A;  2WIN B;  1TY0 A;  1II3 A;  4BS9 A;  1TII D;  1MBY A;  5JPN C;  2K5D A;  2J7Z A;  1EEI D;  4HCE A;  5I9P A;  4IQZ A;  1HCZ A;  2XN9 C;  2L55 A;  2C5C A;  2PCF B;  1Y8N B;  1H9R A;  1E2Z A;  4LMQ D;  4PNY A;  4QIW B;  3DWP A;  1H9M A;  1A2U A;  4IUV A;  3QWN A;  4IN3 A;  5JPM C;  2B2Y A;  1ICW A;  3MA2 B;  2XNA C;  3D3R A;  5IIF A;  2CVR A;  3BYY B;  1IYU A;  2WV6 D;  1KDA A;  1DZ1 A;  2BOS A;  2WAC A;  1QOH A;  2LY7 A;  4K2K A;  2F4I A;  4RCO A;  3RLF A;  3TP8 A;  4KMU C;  5E4W C;  4HTH A;  1LTB D;  1A3T A;  5EBD A;  1G29 1;  2K05 A;  4M1U B;  3ITP A;  1A6X A;  2HDM A;  3I72 A;  2IW3 A;  3J7A F;  3PIP 3;  2PYK A;  1Q8I A;  1AW7 A;  3D8G A;  1SJH D;  3VR5 A;  3GTG B;  5BN3 A;  2EYF A;  4KK7 A;  1SNP A;  1EOT A;  3LX0 A;  5M3M B;  5CV5 A;  1BXT A;  2QDB A;  3L7Z C;  2IX3 A;  2SDF A;  4P2C B;  1CTM A;  1JOK A;  1PZJ D;  2JA8 B;  2Q8I B;  1O78 A;  4C3J G;  5CYU A;  1I4R A;  2D2C C;  4BWG B;  3E0J A;  4HR7 B;  2EYJ A;  2F0O A;  4J6H A;  4HN7 A;  5E1F A;  5CC4 A;  2WB1 B;  4RH6 A;  1XWE A;  4L8J A;  4A3I B;  3SVM A;  5M5W B;  1GHJ A;  3TZD A;  2NTT A;  2JXM B;  3R8B A;  2F0F A;  1PFM A;  4FF4 A;  1W6J A;  1BCP D;  3KLR A;  1MSH A;  2EJM A;  1LLR D;  3R93 A;  4DK1 A;  3CQZ B;  1XYI A;  5CV4 A;  2CW0 C;  3PUY A;  4NMZ A;  4K8I A;  5E3F A;  5C4H A;  1FGB D;  4KJO A;  4QF4 A;  2A68 C;  4N9T A;  3M7G A;  3Q6S A;  4OO1 I;  3SE0 A;  3NP8 A;  2KEC A;  1AZP A;  2EOT A;  3LWE A;  5C5M A;  1EIH A;  5I9O A;  4HSV A;  3C1E A;  1I4X A;  3WOF A;  3A7A B;  5EPL A;  1STA A;  2MJ8 A;  1H9K A;  1B1Z A;  3FRP B;  3VA5 A;  1E2W A;  2G9D A;  5JVH 3;  2FMC A;  1RTN A;  1D2B A;  5D3I B;  2MGS A;  3KUP A;  2O4X A;  2JEA I;  1Y1W B;  3HEJ A;  5KYL A;  1U4R A;  5C6A A;  2B2V C;  4TKO B;  2LFN A;  4KY6 A;  4A3E B;  4RGN A;  2F0E A;  2K03 A;  1STE A;  5KNB A;  1ROD A;  1SBB B;  1QNK A;  2EY5 A;  1JB3 A;  1LTS D;  1RCV D;  4C2M B;  5C0X J;  1TS5 A;  5FKA C;  5A2Q E;  1TS3 A;  2HDL A;  1EEF D;  1TWH B;  2M00 A;  4DN4 M;  3EFX D;  1Y8P B;  3SHL A;  1SYC A;  3PUZ A;  3V2T A;  5M9O A;  2MUY A;  1TWF B;  5C5L A;  1Z6H A;  1YNJ C;  1YNN C;  4LK1 C;  3PUX A;  3C46 A;  1SMY C;  1I3Q B;  3I70 A;  1SYD A;  3SK4 A;  4CJ1 B;  1HFG A;  5C3E B;  4RWS C;  3A55 A;  3PMF A;  3RZD B;  2OXP A;  3S9W A;  2X69 A;  4A3B B;  1SE2 A;  2NB0 A;  4Y7N B;  3SK6 A;  1EZ6 A;  3GTJ B;  3QIA A;  1TU2 B;  4RKB A;  2AWN A;  3TZU A;  1EQT A;  5ELF A;  2EE1 A;  4DXG A;  1CA5 A;  4XQN A;  2HCI A;  1GXD C;  4XQQ A;  4QCL A;  3DEP A;  4IUN A;  3NQT A;  3MZ5 A;  3VYS A;  2KCN A;  4IFD G;  1DOK A;  1I6V C;  3T16 A;  2NVT B;  2F0V A;  1QWY A;  3X3M A;  1BO0 A;  1SND A;  4C3I G;  3KLS A;  1FNW A;  3DWA A;  1PTO H;  1PRT C;  4K6L A;  3SXH A;  1JC7 A;  3ERO A;  2RA4 A;  3J81 E;  1U4P A;  4QUF A;  2WAQ B;  1BCP B;  1D5M C;  1SAP A;  5ELD A;  2WP8 J;  5D3D A;  4A3D B;  1KDC A;  2IX1 A;  2CQA A;  3VR2 A;  3N52 A;  2F0U A;  3H09 A;  1SYG A;  4OL7 A;  5JJZ A;  4XYO A;  4ZRZ A;  5IGF A;  4PMW A;  5KRU A;  1Q1E A;  3A56 A;  1LTA D;  4Q5V A;  3HGB A;  2B2U C;  1STH A;  4EQP A;  1VMC A;  1IYV A;  3NWT A;  5CBE E;  4NKL A;  3S17 B;  1X3Q A;  1DD2 A;  1XXG A;  2EYO A;  2PNR C;  3RUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...