1ILPA

Cxcr-1 n-terminal peptide bound to interleukin-8
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
b'AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTERLEUKIN-8 PRECURSOR)
molecule tags Cytokine
source organism Homo sapiens
publication title Structure of a CXC chemokine-receptor fragment in complex with interleukin-8.
pubmed doi rcsb
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ilpA00
3I91A 1AZQA 1AZPA 1SAPA 2MJ8A 5EPJA 1HFNA 4R8IA 1HFGA 2L9HA 3IFDA 3LWEA 1WTXA 2L12A 4RAUC 1S4ZA 4X3KA 4HAEA 1DONA 4XT3B 3R93A 1EL0A 1HUNA 1XX8A 2IL8A 1PFMA 2M2LA 1JICA 1A15A 1O80A 3F2UA 5D14A 1WTVA 1WD1A 1CA6A 3HP3A 3Q6SA 1ILQA 1G91A 1J8IA 1VMPA 2B2TC 2VXWA 2RSOA 1NR2A 1U4LA 1U4PA 1F9RA 2K03A 3TN2A 1PFNA 2B2WC 2B2YA 2KEEA 3FPUB 1RODA 1IKMA 1HRJA 2KUMA 2B2UC 4XDXA 5EJWA 4ZLTF 3P7JA 2KECA 3DM1A 2K01A 1EIGA 1O7ZA 1O7YA 2X6GA 4O42A 5EPKA 2KOLA 5T1IA 1ILPA 4IUQA 1G2TA 2EPBA 1HHVA 2K1BA 5EPLA 5CBAE 2HUGA 1ESRA 2K28A 1MSHA 1CA5A 1IL8A 1MI2A 5AFWA 3MWYW 1EQTA 2EE1A 4IUTA 1BF4A 1B50A 1RTNA 1B53A 1E0BA 1PFBA 1WTWA 2B2VC 1RHPA 4HCSA 1F9PA 1GUWA 2X69A 2JYOA 2Q8TA 2H1EA 2MP1A 2X6LA 1WTQA 1QE6A 3IL8A 4ZK9B 2B2YC 5JJZA 1U4RA 1DOKA 2KEDA 1WVLA 1BBXC 5CORA 3D6WA 2NYZD 3GV6A 1CM9A 4U68A 5DNFA 2R3ZA 1WTPA 4MHEA 4ZAIA 1RJTA 4IURA 3I90A 3N52A 4IUUA 3FDTA 1MSGA 2D9UA 4NW2A 4CJ2C 4CJ0B 3I3CA 1DZ1A 4X3UA 1TVXA 3KUPA 4QUFA 2HDLA 2N55A 2L4NA 1EOTA 1PDQA 2FMMA 4R9WA 2B2WA 2RVLA 3UI2A 1DOMA 2FFKB 4X3SA 5E4WC 3ONAB 1F2LA 2K05A 1J9OA 4LMQD 2FHTA 1QNKA 4HEDA 1NAPA 2FJ2A 2L1BA 3I8ZA 1LV9A 5COYA 1X3PA 3GV3A 2B2UA 1MGSA 1XYIA 1JE4A 1B2TA 1SDFA 4MN3A 1WD0A 2BDNA 4IUPA 2B2TA 2CVRA 1SSOA 2N88A 4CJ1B 2Q8RE 1F9QA 2K04A 2L11A 2FINB 3G7LA 4OIJA 2DY7A 1AP0A 2RSNA 1HA6A 2HCCA 2DY8A 2SDFA 3H91A 4IUVA 5D65A 1B4OA 5T1GA 1ML0D 1IKLA 4RWSC 4DN4M 2RA4A 1PLFA 2HDMA 5E4XA 2J7ZA 2NWGA 1G2SA 3QO2A 5CBEE 5EKIA 1X3QA 3DEPA 3MTSA 2MGSA 1KNAA 4X3TA 4ZKBB 1Q3LA 1X32A 2MPMA 1QG7A 1VMCA 4UAIA 4XT1B 3TZDA 1NCVA 5EQ0A 1BO0A 1WTRA 1BNZA 3SVMA 2NZ1D 2XIWA 5CMDA 3DEOA 1F9SA 2HCIA 1KNEA 4OIKA 1ZXTA 1B3AA 1C8CA 1U4MA 1EIHA 1ICWA 4ZKCB 4HSVA 1WTOA 1M8AA 1NR4A 4QUCA 2EOTA 4RA8A 1G6ZA 1DOLA 2B2VA 3KBXA 1RTOA 2KVMA 1HUMA 2JP1A
chains in the Genus database with same CATH superfamily
1CSPA 2L9HA 3E5SA 5C44G 3CRKC 5IP9G 4HAEA 4C3JH 2PQAB 3MEHA 4KK7A 5FO7B 1SLJA 1PRTC 2Q2HA 4APVA 1G291 1VF7A 4DR7L 3BS1A 4O1NA 3CCUA 2K03A 2B63B 1IKMA 2YTXA 4FF2A 4GOPA 4LFAQ 1NE3A 2WAQG 4P2CB 3SXHA 2HHHQ 2EPBA 4A3FG 2ZT9C 2N3SA 3JAMi 2Y0SG 4DR5L 1SE2A 4X65L 1WTWA 4A3IG 3DM3A 4IO9A 5LL6S 3UDGA 1GUWA 2I5MX 1OXXK 3STBD 4LF4Q 1GD7A 5IWAL 4JI5L 2K4KA 2VS1A 5CV9A 4DK1A 2Y0SE 1OXUA 1WTHA 3N52A 1EU4A 4CJ0B 2UUCL 4DA2A 4NP5A 1UE5A 5I6WA 2KCTA 2R92B 4KD3A 3WOEA 4IALA 4JPBW 1Q86C 2K5DA 2K75A 5I4DA 3RZDH 4XYQA 2WV6D 4NXML 1Y8OB 1VQ9A 3BZCA 3PF5A 1QUQA 4YY3Q 2FJ2A 4A75A 3GTKB 1Y1VH 2JA5H 2B2UA 3H94A 4IFDI 3H15A 1O7IA 4A3BG 1ENFA 1D1IA 5ELBA 4F7XA 1SSOA 4TKOB 4KHZA 1Z9FA 3H0GB 2A5HA 4HIOA 3A8IE 1MD2D 5H1SE 1K83B 1TWAH 2MGSA 4GKJQ 1Q3LA 4UAIA 1VMCA 4XT1B 1Q90A 1SYFA 3CCMA 1BO0A 5IYDH 1LABA 1N34L 4KY5A 1EY7A 2QW7A 2G9DA 3CF5A 3RN2A 4K8JA 1G8ZD 1Y69U 1I4XA 4OWWB 3HKZG 2K6AA 1ZYRD 4IFDJ 3FVQA 4ZKCB 2Z4IA 1CZWA 5C4JH 4KHPL 2N8NA 2ID0A 1NJIC 5EPJA 1C0AA 2QEJC 2FXQA 1EUJA 4LJZC 2DJGC 4QB4A 5JVG3 1WTXA 1R9TB 4FO2A 4JI6L 2NB0A 1I4RA 2XGTA 4YWLA 2G5DA 1PYWD 2AKWB 4B3MQ 4CDCC 2QGQA 1M1KC 2WFWA 2EY6A 1LTBD 4C2MB 3J80L 4LF8Q 1SBBB 2KECA 3KF6B 1O7ZA 1O7YA 4YIJA 1KTKA 3NE5B 3I4NH 1VS0A 2BH8A 3HOXB 3OMGA 1W2BA 3ULPA 1STYA 3WOFA 5CV4A 1E7ZA 4GOPB 3TZUA 1K0SA 5IODA 3IL8A 5KNCA 4Y7NB 2UXBL 4JCVE 2OTLA 3KLSX 4DF7A 1ICFB 4KLKA 3HOWB 3I56A 2CKZB 2EXDA 3KJOA 4MHEA 4DGZA 1PA6A 4RGMA 5ELOA 2ZXOA 3KUPA 4QUFA 1YITA 1PDQA 3K7UC 4R9WA 3IAYA 1EQVA 3UI2A 2QILA 1LTID 3CCRA 1SYBA 2KCCA 1K9MC 4KD4A 5M3FG 5LL6X 2EYPA 5JVH3 1YEZA 3CRLC 4DAYB 1P16A 2ASBA 1GJXA 2PCFB 3RUZA 2CVRA 3NHHA 1B3QA 2NVTB 1F9QA 2AUJD 4K2KA 1GHJA 1ESFA 1EZ6A 3S15B 4FXDA 1ML0D 5IWAQ 1FD7D 1SROA 1EEID 2K50A 1J5EQ 1VQNA 3S1MH 3E9IA 1HNWQ 2NWGA 2I5HA 5IP9H 2E2HB 1EYDA 1X3QA 2E2HH 1PTOH 2A74C 5IP7H 3SK4A 3HOWH 3S1MB 3MVVA 2RDGA 4OX9Q 3KLRA 2CW0C 4S3SA 4TSSA 1SJED 4ME5A 1H9JA 3PO2H 1EIHA 1Q82C 1UE6A 1FGBD 2ES2A 4BXXG 1YJWA 4FP5D 5FJ8H 1HZ9A 4CBVA 3VA5A 1KL9A 5G3LD 3J7AF 2BE5C 2MJ8A 1HFNA 1EY8A 3T1HL 2PMZE 3A56A 2PZWA 1JWUD 1CA6A 3M4OH 1L0XB 1KAWA 3BVMA 1RD9D 1Z47A 1H95A 3T51B 1PFNA 1NY4A 1BDOA 1EY9A 4OWXB 5ELFA 5KYIA 1VQLA 1PV4A 2XWBB 1RKNA 3GTQB 4YWMA 2C5CA 2A73B 2K1BA 3PQIA 2K28A 2WB1G 5GROA 5JJKA 5AFWA 3SK5A 5ELNA 1STAA 1B53A 4LFBL 2B2VC 2KHIA 1QUQB 2QF7A 3NSWA 1K8MA 3PO3H 3GTMH 3I4NB 2F0MA 1B9MA 4JI3L 4WRDA 4QQBX 2B39A 1HNZQ 2QCPX 1TR5A 3NBHA 4IURA 5ELDA 3R8BA 3MHBA 2BA1A 1CKNB 5DLQE 4B3ML 4XTCS 2VQFL 2F0PA 3HKZB 3H0GH 1CKNA 1SNCA 4LF8L 1F2LA 4UP8A 3I4MG 4X6AH 1VQBA 2ZXPA 4JI7Q 4KHVA 1PTOD 3D3RA 4B9WA 5FKAC 3H09A 5M9OA 1X3FA 4IJHA 2L0CA 1JOOA 5DAUA 1GXDC 4BY1B 5KNBA 2N88A 4X62Q 4NDXA 1AN8A 4DV3L 1Q7YC 2UXBQ 2EJMA 1MJCA 3CCJA 3OWEB 5JOBA 1N8RC 3H0GG 3KOJA 4AYBB 1VQIA 2YV5A 3Q24A 1K83H 2PNHA 4QCLA 4XYOA 4L5RC 4YWKA 1IBLQ 2KENA 3J7YW 1VQOA 3QJYA 1V8QA 3SDZA 1GHKA 4HJ5A 1C9OA 3EFXD 4DV2L 3U4ZA 2BCOA 2R92G 1AZQA 5IGCA 3E0JA 2L12A 3GTOB 1VDZA 1XX8A 2IL8A 3VR6A 4JOIA 2VB2X 4DR4L 2A19A 4XQQA 2WP8J 2IPKD 1NR2A 2AMCB 1K8GA 1I4QA 3H3VI 4JYAQ 2UU9Q 1RODA 4GLAC 2KUMA 4XDXA 5FO9B 4A3JH 1VQHA 4DUYL 1EIGA 1YNND 1A2TA 5E1FA 1LT4D 2WB1B 1I50B 2RDFA 3G48A 5AJ3Q 1AEXA 1Y8PB 1MI2A 1KXLA 2R61A 1AE2A 3J7ZC 4B3RL 4YCWA 1JWMD 3W2DA 3C1FA 2GVAA 2RBMA 1E0BA 2ZTEA 4EQ5A 4GS3A 5IT9L 4KKSA 2MP1A 1X3EA 5K5PA 2NVQH 2LXKA 1SR3A 1O78A 3TBIB 1A8VA 2F0EA 4IQZA 3F8TA 5EGTA 1IBMQ 3GTJH 1CM9A 5LMUQ 2E74C 5FLXc 1VQ8A 4IUUA 5IE8A 3KK7A 1JB7A 2N55A 4I7ZC 2K5HA 3S2HB 2AQ3B 2FFKB 1U0LA 3OSOA 1XNQL 3OTOL 3H3VH 3GTLB 4H02A 3I55A 2EJFC 1U5KA 1JC7A 4JI1L 1CKOA 3HOUG 2KQ3A 4IPDA 1KD1C 1JQYD 1VQKA 3GTLH 5GAEC 2CCZA 2I5LX 4A93G 4WJ4A 3U9SA 3LNNA 2FINB 4OIJA 2RSNA 4DPGA 5FJ8G 3NP8A 4HJ9A 2AQ2B 3M4YA 2RA4A 5HGQA 1PLFA 3C2PA 2J7ZA 3GTPB 3C1EA 5JEAJ 3AMUA 2ZTDA 2SOBA 3HOYG 1D5MC 3DEPA 3SGIA 1PH6A 1NCVA 3GTPH 3SVMA 1EIFA 5JAVA 2XIWA 3DEOA 4CGYB 1FYCA 1ONLA 1B3AA 1U4MA 1BR9A 4DXFA 4JI2L 3WWVA 4BY7H 1BKBA 4Z9CB 1WCMG 1M8AA 1HNXQ 2F0TA 2R7ZB 3HGBA 4OL7A 3KLSA 4RAUC 2ATWA 2E5LL 4XT3B 1ZYRC 1D6EC 4GKJL 2WKCA 2O5JC 3PO3G 2NVXH 2F0FA 5E7NA 3MZ5A 5IT9c 5BN5A 1HQRD 1IZ6A 1HPCA 5GADC 2UUAQ 3S1NB 3CU7A 3PV0A 2B2UC 4DUZL 3HEJA 3GD7A 3J81i 1SNDA 4KHPQ 4A3KB 4DNTB 1VQEA 4O0AA 4OHJA 4CKEA 3HG9A 1EQTA 1YHBA 1X55A 4QF4A 1PFBA 4A3DG 2QKIC 1SJHD 1LACA 1Q8KA 4H44C 1IXRA 4A3MH 1B1ZA 4QL5A 3C46A 3WDNA 4KJOA 3S15H 2ENBA 1DCZA 1TWCB 3W1GA 2O4XA 1HZBA 3CC4A 2NVTH 3EQLC 2M9VA 1VQ5A 1QZGA 4XQJA 4QIWE 3M7GA 2HD3A 3PUWA 2HQLA 3PSIA 1CFMA 3CW2C 4DR1Q 4F87A 1LTAD 2KA7A 4R1JA 4JI0Q 3CCVA 4JBKA 4JI8Q 5I9PA 4BY1H 4N9TA 1IYUA 2PZTA 3B6YA 2K5QA 4A3MG 3HOVH 2JEAI 1SNMA 4X66Q 5COYA 3CQZB 3NQIA 4LUZA 3HZXA 1A63A 1XYIA 1B2TA 2QA4A 4BBRH 2NN6H 4ME3A 1E1OA 4ZRZA 3T56B 3K5NA 1VQPA 2DY7A 3UDFA 4LUVA 4GOPC 3CCEA 1YHAA 5T1GA 1IKLA 4DV6Q 1STEA 3NUCA 3V05A 3I7FA 2HIVA 5I2YA 4NXNL 4M1UB 5CBEE 2UXDQ 3TSSA 1L1OC 1PH1A 1BNZA 1K8OA 1K3RA 2J0TD 3F2DA 3MXUA 5CYUA 3NK9A 4K2LA 3H3VC 4A3JG 1S5CD 1I4GA 2O2LD 1EZ8A 4C3IG 2B8GA 3HS0C 1Y8NB 2B2VA 3KBXA 1YJNA 1HTLD 4J6HA 4C1NK 1FVIA 1HFGA 5JEAH 3IFDA 2DGYA 4H0LC 3A5UA 2Z8LA 1VQ4A 3S2DB 1XMQQ 1TWFB 1PFMA 1EWCA 4N8FA 3NBHB 2IHEA 4IOCA 2SNMA 1G91A 3KYHC 1NMFA 1VQCA 1Y1VB 1TIID 1PH8A 3GTGH 1QILA 3TP7A 3AQQA 5J39A 3HOVB 3BU2A 1LTTD 3MXNA 3ICEA 4A3DB 3BYYB 4PMCA 3RZDB 3J7A5 2K01A 1LM0A 4A3BB 4LF4L 3W3AA 2JA8H 2DNCA 4UHVA 1T5XD 4A3KG 1EOVA 1R4QB 3TS2A 2HUGA 2WB1E 5CV7A 3TP5A 4BA1I 3T1HQ 1A0IA 2F0GA 3L3OC 4GNXA 3M3YB 4JOIC 4K14A 2X6LA 5HY6A 3A7AB 1S5DD 5FK9C 1QVFA 1PXUA 1RF2D 5C44B 3FDTA 4J8QA 3HKSA 1EQRA 2JA6H 2R7ZG 5EBDA 1MKHA 3PF4A 3NTHA 5FO8B 2UUAL 4CDEC 2JA5B 2KHSA 2LKVA 2OF1A 1QCBD 3NXWA 5EKKA 1SXTA 1SYDA 5E4WC 1C7YA 1J9OA 5LHY1 3J81E 1PRTF 2B63H 2MUYA 1HR0Q 3J81c 1LTSD 1EY0A 3K7AH 4HJAA 1SMYC 1JR0D 1BQQT 1WD0A 2NTTA 2RKSA 3QOLA 4ODGA 1HA6A 2E8GA 1N34Q 5D65A 1AE3A 1CHPD 5K36H 3F2BA 1JCKB 2EVBA 1N32Q 2Z6KC 1X56A 5GAHC 3E6ZX 5L37A 4A93B 1WFQA 3DMUA 3CPFA 4JBMA 4BWGB 1V43A 4DUZQ 1QG7A 2R7FA 3OWFA 3JAML 1WTRA 2JA7G 4KV6A 2HCIA 1KNEA 3I4OA 1SE3A 2CH4W 3DWAA 4J1MA 1M90C 3KDFA 3KFUA 4HSVA 4K6LA 4MNOA 1U9RA 4QUCA 1RTOA 3RD4A 2JP1A 1G6PA 1N36Q 4FYDA 1Q46A 5C0XG 2CFMA 4A3EG 1K8AC 3CHBD 1A15A 4H13C 4DV6L 2VXWA 3FEWX 3FRPB 2F03A 1T5EA 2N49A 3UE0A 3S16H 1E2VA 2KEEA 3MEFA 4BY7B 3RMHA 4TQUS 1PRTD 3K5OA 1TKWB 4IN3A 2IWHA 2R93G 1HHVA 4OONA 5EPLA 4X62L 1NBWA 4Y7NH 4TVAB 1IL8A 4LF6Q 4AH6A 5J22A 2Z6KA 4ZUJA 5J1ZA 3K58A 2NN6I 5M3MG 2EY5A 3FPPA 2OQKA 4HIKA 4WJ3M 3PUXA 2NBFA 4CKBA 2MO0A 1ENCA 4ID6A 4AIMA 4BBRG 2K5NA 1PH3A 4RKLA 2UXDL 2D9UA 3PIP3 2VUMG 1MIUA 3I3CA 4X64Q 4JW0A 2EZVA 2HDLA 3AU7A 3FP9A 5FLXE 2EDGA 4DR2Q 3NPPA 4G4KA 2Z9HA 3U50C 4ULLA 4DV4L 4K5WA 4RG1A 4X65Q 1XMOL 1YJ9A 5M3MH 1K73C 2F0LA 4OEMB 1UE1A 1B7YB 1B70B 3J81L 4AQYQ 4C3HG 4R4OA 1XTCD 1PTOC 4KJNA 2B2TA 3P1HA 2IX1A 4DAPA 2YYZA 4C3IH 2VQEL 1B9NA 3TRZA 1W6JA 1E2WA 4YHHQ 4LFAL 5C3EG 3X3NA 3CD6A 3VYRA 1OXSC 3PGZA 2QDBA 3LWUA 2ALYB 2JSOA 1TWAB 2ZJRA 1X32A 3A74A 4JI1Q 3T4AC 4PQXA 1PH9A 2AWOA 4FXGC 1ZKOA 1STBA 4G57A 4JI4L 3BZDB 5GQOA 4XIGS 1S5BD 4R8IA 1E1TA 2F0KA 1JJGA 1EYCA 3K81C 3QG1A 3N6RA 3S1NH 4P71A 3NENA 3D8GA 1KDBA 1GUNA 4LNQA 4DV0Q 3OIPA 3CKIB 5M5WH 2K33A 4NXMQ 3HOZB 1SE4A 1U4LA 1RDPD 4F88A 1U4PA 3TN2A 2P5ZX 4YY3L 4LF5Q 5I6YA 3DUZA 4M8AA 3D0FA 1HRJA 3VA7A 3L0OA 3NTIA 3OIQA 2X6GA 2R7ZH 5EPKA 2KOLA 5T1IA 1TS5A 3Q22A 4IFDH 2Q2IA 1JT8A 2PW7A 1RCVD 3BJUA 3GQBA 4MZ9A 4HTHA 1DGSA 1GO3E 4IUTA 4KY6A 3KJPA 1B50A 1N33Q 4PZ7A 3SE0A 2K5WA 5CV5A 4HCSA 1RHPA 3S17H 1UAPA 2AHOB 4HMIA 5LMNL 4MTNA 5JJZA 1E24A 3GV6A 5DNFA 4JI7L 1TWGH 3I90A 3M4QA 5BR8Q 1MSGA 1QOHA 3T53B 4IFDG 5FLMH 5D3DA 5C4XH 1IBKL 3ITPA 4TRDA 4DV1L 1WYDA 2KCNA 1EQQA 1TY2A 1SRUA 2E2IB 5C3XA 2SNSA 3NEMA 2E5LQ 4JBJA 2G9HD 1Y1WG 1DM0B 1HXYD 2VL6A 1JE4A 3GDEA 3K57A 5ELCA 1FJGL 2K04A 1EWIA 2F0IA 4K5VA 2HCCA 3KF8A 4JBWA 1WVLA 4DN4M 1B4OA 1ASYA 4LF9Q 5C4XG 3GTMB 3PIO3 3D4WA 1X54A 4L5TA 1QVCA 1KHIA 4C3JG 4DV2Q 1IW7C 4JI8L 4A3EH 4ZKBB 4B3TL 5M3FH 3IRBA 3M85A 1A62A 3HFZB 2XRQD 2NZ1D 1Y1WB 3GTQH 3EVQA 1Q1BA 3MAQA 2QEXA 3FMCA 1VF5C 1F2ZA 3AB9A 1PH5A 4DK6C 2UUBL 5IGBA 5IYBH 2KVMA 2R93H 2OCEA 3TREA 4A3FH 2A69D 5IYCH 4JC0A 2F4VQ 3QWNA 1S4ZA 1FR3A 4CDFC 1Z7TA 3OW2A 1UEBA 3KF6A 5AJ3L 1WTVA 3HOWG 4YHHL 5J3BA 3L2PA 1XXGA 1PZID 1UEAB 1SMXA 5CC4A 3AYHB 3MA2B 1CSQA 3K5MA 2AUKA 4A4IA 3PO2G 1PTOF 1VQ7A 1DYQA 2IT1A 2LXJA 4JV5L 4UP9A 1ILPA 3HOXG 1GUOA 3UE1A 1G2TA 4WFN3 5CBAE 5IYCG 5LMUL 1LT5D 2EE1A 3ZJYC 2E75C 1D5ZC 1W6KA 5C3WA 3SK6A 1HNWL 3CMEA 4B3SL 2Q8TA 3J80i 5I9OA 4DV5L 2PMZB 2MO1A 4C3HH 3TMEA 2UXCQ 4P75A 4Y52H 3HOXH 3FKIG 3HOZH 1NSNS 3VYUA 1SFOH 1F2YA 2ZJPA 2K7VA 1TS2A 3EA6A 3MXGA 1K28A 1PHJA 4LF7L 1XTDA 4GNXB 2K05A 4LFBQ 2D2CC 3E0EA 3D6CA 5I2XA 1X9NA 2FHTA 4HEDA 5F2DA 2ICIA 5IYDG 2WIIB 3A5ZB 2TSSA 1WJJA 2A69C 4MN3A 1E3PA 1Z6HA 3I4LA 1R9TH 2D0PA 1AP0A 4G7HC 3DWPA 2C9OA 1F2MA 3FKIH 3HOZG 2MHVA 1D1KA 2VQFQ 4L8JA 3AEVA 1GUTA 2D5DA 1JMCA 1ET9A 1X3GA 1BBUA 4CKCA 1HR0L 2Q8IB 1VQFA 3URYA 3VDYA 4DU9A 5C0XJ 1D5XC 4A3CG 3M7NA 1HCZA 1V9PA 1KC8C 1DOLA 4ABNA 2WACA 2C35B 2V1CC 2VY3A 4RKBA 2I07B 5LMNQ 1OO9B 5M5XH 1YNJC 3RLNA 1DD2A 4X3KA 4HIMA 2BH2A 1SN8A 4NB3A 4AYBG 2M2LA 3NWSA 1XPRA 4EQPA 3C3LA 3CC7A 1J8IA 1A3VA 5IIFA 2LS01 2ICEC 3CC2A 2H4OA 3M4OB 1QWYA 4A3CH 2D62A 3P7JA 2Y0SB 3S9WA 1V1OA 2CQAA 2R92H 4G7ZC 1TY0A 1V1QA 2DUDA 2XRSD 2F52A 1V1PA 4MTKA 4NMZA 1NNXA 4K5XA 2JA9A 2EIFA 4DR4Q 3BDCA 1QE6A 3A8KE 4ZK9B 4DR6L 2F0DA 2OTJA 3D6WA 1VQDA 4U68A 2A68C 2BE5D 5IOCA 1HJPA 1SNQA 2K14A 4NW2A 3T1YL 4EQNA 1LO5D 3KF8B 5HGTA 2MQHA 5IGDA 5KEEA 2FMMA 3CQZH 4KY7A 1I6HH 1IYVA 4A3GB 4DAYA 1KABA 2M00A 3ONAB 3I2ZA 2XWJB 4RGOS 4B9XA 1EY5A 1NAPA 3I8ZA 3SHLA 4QMGA 3BVGA 3RZOB 1MGSA 4HCEA 2UUBQ 3RZOH 3RNUA 5EAYA 4CHTB 4HR7B 1D2BA 1KAAA 4B3SQ 1IL2A 4BXXH 1YNNC 4JYAL 3EN2A 2JA6B 2EYJA 3MC0B 2UXCL 2E2JB 1OXTA 5C44H 4ILWA 3MTSA 4X3TA 4GN3B 3PUVA 1A3TA 4DNRB 1XMOQ 5EKLA 5DM73 5EQ0A 3HKZE 4JV5Q 5ISRA 4DR7Q 1II3A 1TQOA 1SNOA 4PMWA 1XMQL 4RGTA 4FNFA 4LF7Q 1XNRL 3RLOA 2EOTA 2HHHL 1LTGD 1KDAA 1SAPA 1UE7A 2Z4HA 5TSSA 3NBIA 4X64L 4A76A 3HOYH 1EL0A 3R93A 5NUCA 2NVYH 3S1RH 3S1QH 2OWOA 1HUNA 1EFWA 4ZYSA 1B8AA 1JICA 4RCOA 2RDHA 3HP3A 2Z1CA 1GVPA 3Q6SA 4JI5Q 4R4QA 2Q2TA 5JJIA 2CWAA 4AQYL 2XVSA 4RHRA 1OXVA 1AW7A 2VQEQ 5M3FB 3MWYW 1CHQD 2F0NA 1RTNA 4GZYC 3OMCA 2DJFC 2RQXA 1BCPC 1L0YB 3VR5A 3ULLA 1Y1VG 2F3IA 4LFCL 1HTPA 2JA5G 5CGKA 2B2YC 4A3LH 1BBXC 2WINB 4A3BH 2NYZD 1R4PB 4WORA 3CCLA 2JN4A 4U673 2R3ZA 3D31A 4C2MH 5BN4A 2I0QA 2RCNA 4PZ8A 1SYEA 4RH6A 2F0WA 3I73A 4KKTA 2F0JA 2F0OA 4DV3Q 1TWFH 4JI3Q 2A8VA 2E76C 4DR3L 3TP8A 2RF4A 3S2HH 4KI0A 1TU2B 5M5YH 3GTOH 1AFPA 5E3FA 1D8LA 2L11A 2PO4A 4OWTB 1XPUA 4P74A 5HURA 4RWSC 1MBYA 4DAMA 3CXCA 4BA2I 4DXGA 3SR1A 5EKIA 2A6ED 1PZJD 1CTMA 4OXPA 1N36L 2OQ0A 4DKAC 2A6EC 2F3WA 3A0JA 5C5MA 3TQYA 5BN3A 2DN8A 3R2TA 4POGA 1GM5A 1H9SB 1ICWA 2E2DC 1EYAA 1LUZA 3GP7A 1CQFA 3EROA 1BCPD 3KDFB 1IYJB 5BR8L 1QB5D 1QVGA 4RFBA 1DONA 4FF4A 4PNYA 4FVMA 3CP0A 4JVZA 2EQSA 1VQAA 4IZ8A 3BZKA 1BVSA 4DV7L 3G71A 2NVXB 2JJQA 4L5QA 5D3IB 3NQTA 3DM1A 4H7BA 2JEBI 4EX5A 4O42A 1BXTA 1K3BC 4N8X1 1I5FA 5EBCA 1GUSA 1ESRA 2H5XA 3JAME 4QY7A 4N9PA 3U4VA 1XNRQ 5A2QL 2LFNA 2H1EA 4GNXC 1Y14B 2PYKA 4R4CA 4E6IA 1LT3D 1SYCA 3BVZA 3HOUH 1DOKA 4B3TQ 3CCSA 3T13A 1WTPA 4FDBA 1LT6D 3KBGA 2JA8G 3R3OA 1J5EL 1Q12A 4EQOA 1S5ED 4IOAA 3R2IA 4R8NA 4X3SA 2MFIA 4POFA 2CWPA 4HIDA 4A3IB 1IBML 4AYBE 3K8AA 3S16B 5IP7G 2NUCA 1PMRA 1X3PA 4GKKQ 4QGUA 2UUCQ 2NZOA 2IX0A 2WAQB 3BYTB 4BY7G 3S1QB 4C56C 1I4PA 2EYLA 2JA6G 3H91A 4HSPA 5C4XB 3PO3B 1T9HA 4B08A 1NUCA 1G2SA 3QO2A 4IPHA 4IPCA 1WI5A 1GUGA 5FOBB 3ER0A 4L6TB 1IW7D 1HZAA 1PYBA 1KIXA 5CMDA 3JAMc 1ZXTA 3S17B 1G51A 2ZXRA 4DR3Q 4BBSB 3MXPA 3F2CA 4RMFA 4A3GG 1ASZA 1V1PB 2E2JH 5C4ZA 1G6ZA 2R7DA 4FF1A 3I91A 1I50H 3A8JE 2GVBA 1JJ2A 2R6GA 1AZPA 3MXNB 3CMAA 4LFCQ 2AWNA 3ND9A 2RHQB 3VR3A 2PNRC 1TT2A 2RCFA 3OYYA 1O80A 3FHWA 4ZCKA 4LAAA 3A7LA 4XQNA 3S14H 1ET6A 1HNXL 1K0RA 3TP6A 4XXEA 4A3LG 3L7ZC 1PH4A 1C48A 1KDCA 4BS9A 3CAMA 1I94Q 3HRZC 3OPOA 4A3GH 1WCMH 1VQGA 4IUQA 4K0KL 1FNUA 1A6XA 3AFQA 1FGUA 3P75A 1EEFD 1MSHA 5CV8A 2NZHA 2CQOA 1HR0W 5C0XH 1CZGA 4DFAA 3STBC 3I4MH 1N32L 3IKJA 2I46A 1FNVA 3U9OA 5IGEA 4DR1L 1QNUA 3VYTA 1WTQA 3ULJA 1EY6A 3Q23A 4OO1I 2OEOA 3TDQA 4PV1C 4OGQC 4HJ7A 4O2DA 1CK1A 1DXMA 5IGGA 5FLXL 1DZ1A 4DV7Q 3J7AV 2F4IA 3K7AB 5M5WB 2B2WA 1EFID 1DOMA 3PMFA 3D4DA 2F0VA 2F0QA 3W5OA 3ZYYX 2A1AA 4A3DH 5M5YB 2PI2A 2V4DA 4LMQD 2VNUD 1QNKA 2J4XA 3EIVA 4IPGA 2L1BA 4EGVA 4DNIA 3QR8A 1UUPA 1SDFA 4R4TA 4LUOA 2ZM6Q 2BDNA 2EXZA 2PW5A 3S2DH 2VUMH 1STNA 4IUVA 5C3EB 2BOSA 2A6HC 2B3GA 4IJLA 1S40A 1Q81C 4YCVA 1YZ6A 1X65A 4WJWA 4BY1G 4Q5VA 2KBNA 1BCPF 3VYSA 2JK8A 3RLFA 2F4VL 3ERQA 4LWCA 3OW7A 3QB3A 4OIKA 4C3IB 2UU9L 1BOSA 2YU9H 4KN7C 2NN6G 4J15A 3M9BA 3CPWA 3M4PA 1WTOA 4GKKL 2KCMA 4RGNA 1KLGD 5C3EH 3PIOA 2VUMB 4OX9L 2JE6I 2Q2UA 3E9HA 5DEHA 4L63B 4UY8C 4BBRB 4LW1A 2KJXA 2Z0SA 1LYLA 3PIPA 3TEHB 1SE8A 2RSOA 3JC66 1KRTA 2OT2A 1PH2A 2XSCA 3FPUB 4FF3A 3MFYA 3AFPA 1WOCA 5EJWA 3Q0AA 1H9KA 3E3XA 4KMUC 3GO5A 1JB3A 1PYSB 2PQEA 4G7OC 5C4HA 5JEAG 1XJVA 3EBEA 1XNQQ 3BDLA 4HJ8A 3OTOQ 1CKMA 3QOJA 1O7LA 1L1OA 1F9PA 3U58A 2JYOA 5KRUA 1VQMA 1HH2P 1BBWA 3FKIB 2HQEA 4C1NI 5CR3A 1TS4A 4P73A 2CHBD 2PQAA 1PTOB 5JPNC 3KLWA 4ZAIA 4A93H 1ENAA 1RJTA 2F0SA 1EY4A 4X3UA 1GOZA 3CCQA 4A3KH 2L4NA 5K36G 2EYMA 1IHZA 2RVLA 2L15A 2LY7A 2NTSA 1STGA 2K5VA 4KN4C 1EIYB 2TMPA 2OXPA 2NVYB 3S1RB 1YI2A 1NTGA 3DWQA 5C5LA 3DLLA 5KNDA 1P8LA 4YCUA 2WAQE 1SFOB 3A54A 3A55A 3UDXA 1SMYD 2GA4B 1KLUD 4JI2Q 4IUPA 1S5FD 1XPOA 4C3JB 3PO2B 2Q8RE 4I65A 4L5SA 1TWCH 3D4RA 1KQSA 2DY8A 2JQOA 1I6HB 1DJRD 2F1MA 1HQMC 1STHA 2HDMA 4GLVB 2KHJA 3ND8A 4P72A 1PRTB 1JOQA 2MPMA 3TZDA 1N33L 3W1BA 1Y1WH 5CV6A 1S72A 3I72A 1WCMB 1FNWA 1C8CA 3VR4A 1Q8IA 1UWVA 1FJGQ 1NR4A 1JE5A 4I7AA 1L0WA 4RA8A 2XTIA 3OHXC 1YHQA 3EJIA 4JI0L 5KYLA 4F8MA 2JA8B 4UDUC 4V0BA 1VQ6A 2L55A 3K80C 2F3VA 2IHFA 5C0XI 1S3OA 3F2UA 1WD1A 3GTGB 2K52A 2O5IC 4LF6L 1TXYA 1VMPA 3G6EA 2EYFA 4PMBA 3NTKA 1W3SA 1H9SA 1JORA 2B2WC 2B2YA 3SK8A 4BBSH 4ZLTF 3J80c 5M5XB 2K32A 2HIXA 1QJOA 5IYBG 1A2UA 4PZ6A 2PPBC 1XWEA 3DHQA 3L9AX 1YNJD 4NKLA 3X3MA 1KRSA 2B29A 3G4SA 3M3YH 1RL2A 4QJFA 1I3QB 3O13A 3J81j 2YU9B 3HOVG 4DR2L 3K6OA 4DAVA 1U4RA 4DV4Q 5CORA 1ZEQX 1LTRD 3PUYA 3DXJC 3H6MA 4CDDC 1CUKA 4B3RQ 1L1OB 1TVXA 2PI2E 1YVCA 1EOTA 4QIWB 1N9WA 4NXNQ 4A3JB 1SYGA 5G3LF 4A3IH 1PVOA 2SEBD 1FL0A 5IY0A 2D0OA 3GV3A 5C4JB 3GTKH 3F1ZA 3ERSX 4RCNA 1EU3A 1JJCB 1RIPA 3G6JB 3IFTA 3G7LA 3LGJA 2SDFA 2DNEA 1PFSA 1PH7A 3NELA 5E4XA 3VR2A 4V190 1LTLA 2AQ1B 4ZUIA 1MHWC 2ZJQA 4K8IA 1KNAA 2JXMB 3V2TA 4C3HB 1HA5A 1M4VA 4RHSA 2LMCB 5A2QE 2IY5B 1GKHA 4A3MB 2A6HD 1CT1D 2EY1A 3MFGA 4DV5Q 1TWHH 1H9MA 2VW9A 2BA0A 4DR5Q 5LMNW 1BUVT 1BCPB 4KTAA 4DV0L 1SNPA 4MIUA 1HUMA 4KKUA 4ALPA 3PUZA 4JG2A 3K0XA 1YBYA 3LWEA 3BG3A 1A3UA 5D14A 4R4IA 1PZKD 1ILQA 2B2TC 2ZTCA 3K0YA 3PCOB 5GAGC 2GN5A 3S14B 4UPAA 5C6AA 1NMGA 4JI4Q 1F9RA 2CW0D 4OELB 1HNZL 3V96A 2VB3X 1TWHB 1LLRD 3J80E 1JOKA 4HN7A 2FMCA 2IX3A 4A3FB 3S24A 3LX0A 4DK3C 3K59A 3I70A 4LK1C 2IJ0A 1CA5A 4UP7A 1BF4A 1D7QA 3I4MB 2YTYA 5KGUA 1AH9A 4LF5L 2X69A 2B63G 1IBKQ 4DV1Q 4GN4B 4GLXA 2EYOA 3P20A 1J6QA 1HZCA 2KEDA 1UNSA 5IGFA 1I6VC 4A3EB 4PG3A 1I3QH 4JI6Q 2B8FA 1I94L 4CJ2C 4OO1H 2HT1A 2F0UA 2QDLA 4NPSA 4GN5A 2EY2A 1C4QA 4DK0A 3RN5A 3I4NG 2N78A 1VQJA 4IUNA 2YTVA 5M3MB 3K5LA 2PZUA 3T16A 4EVOA 2BDOA 3BDOA 4LF9L 3Q8DA 1CI3M 5JJLA 1LV9A 2JA7H 2R93B 2CH4A 2JA7B 1EWHA 2EJGC 1IBLL 2XNAC 1QZHA 5ELEA 1MJEA 2E2IH 1L2FA 1YNXA 2XN9C 2F0HA 4Q0FA 3RR5A 2RHSB 4CJ1B 1SEBD 3HOYB 4OO1G 2EYHA 3T1YQ 1TS3A 4FXKC 1I4HA 5FLMG 3SEBA 1OTCA 4X66L 1F77A 4ZQ3A 4K0KQ 1TWGB 5IT9E 2WKDA 3TS0A 3OOCA 1B44D 3GTJB 5A35A 1CQVA 2VZAA 5KIXA 5DM63 1EYGA 1E2ZA 2A68D 2MNAA 1Q1EA 5JPMC 1F9SA 3NWTA 4HMJA 3UDIA 3HOUB 2NVQB 2L5TA 1E22A 2ZM6L 4BBSG 2IW3A 2Z6BA 4DR6Q 4DUYQ 1JWSD 1VCIA 3QIAA 2LSSA 1H9RA 1YIJA 4JK1C 4K6DA 1X6OA
chains in the Genus database with same CATH topology
2L9HA 3E5SA 3CRKC 4HAEA 3MEHA 4KK7A 5FO7B 1PRTC 1G291 1VF7A 3BS1A 4O1NA 2K03A 2B63B 1IKMA 4FF2A 4P2CB 3SXHA 2EPBA 2ZT9C 1SE2A 1WTWA 1GUWA 5LL6S 1OXXK 5CV9A 4DK1A 1OXUA 3N52A 1EU4A 4CJ0B 4DA2A 4NP5A 5I6WA 2R92B 4KD3A 3WOEA 4IALA 2K5DA 5I4DA 4XYQA 2WV6D 1Y8OB 3GTKB 2FJ2A 2B2UA 3H94A 4IFDI 1ENFA 1D1IA 5ELBA 4F7XA 1SSOA 4TKOB 4KHZA 3H0GB 2A5HA 3A8IE 1MD2D 1K83B 2MGSA 1Q3LA 4UAIA 1VMCA 4XT1B 1Q90A 1SYFA 1BO0A 1LABA 4KY5A 1EY7A 2G9DA 4K8JA 1G8ZD 1Y69U 1I4XA 2K6AA 1ZYRD 4IFDJ 3FVQA 4ZKCB 2Z4IA 1CZWA 2ID0A 5EPJA 2QEJC 4LJZC 5JVG3 4QB4A 1WTXA 1R9TB 4FO2A 2NB0A 1I4RA 1PYWD 2EY6A 1LTBD 4C2MB 3J80L 1SBBB 2KECA 1O7ZA 1O7YA 4YIJA 1KTKA 3NE5B 3HOXB 3OMGA 1STYA 3WOFA 5CV4A 3TZUA 5IODA 3IL8A 5KNCA 4Y7NB 3KLSX 4DF7A 3HOWB 4MHEA 4DGZA 4RGMA 2ZXOA 3KUPA 4QUFA 1PDQA 3IAYA 4R9WA 1EQVA 3UI2A 2QILA 1LTID 1SYBA 2KCCA 4KD4A 5LL6X 2EYPA 5JVH3 3CRLC 1GJXA 2PCFB 3RUZA 2CVRA 3NHHA 2NVTB 1F9QA 2AUJD 4K2KA 1GHJA 1ESFA 1EZ6A 3S15B 4FXDA 1ML0D 1FD7D 1EEID 2NWGA 2E2HB 1EYDA 1X3QA 1PTOH 2A74C 3SK4A 3S1MB 3MVVA 2RDGA 3KLRA 2CW0C 4S3SA 4TSSA 1SJED 4ME5A 1H9JA 1EIHA 1FGBD 4FP5D 4CBVA 3VA5A 5G3LD 3J7AF 2BE5C 2MJ8A 1HFNA 1EY8A 3A56A 2PZWA 1JWUD 1CA6A 1L0XB 3BVMA 1RD9D 1Z47A 3T51B 1PFNA 1BDOA 1EY9A 5ELFA 5KYIA 2XWBB 1RKNA 3GTQB 2C5CA 2A73B 2K1BA 2K28A 5AFWA 3SK5A 1STAA 1B53A 2B2VC 2QF7A 3NSWA 1K8MA 3I4NB 2F0MA 1B9MA 4WRDA 2B39A 2QCPX 1TR5A 3NBHA 4IURA 5ELDA 3R8BA 3MHBA 2BA1A 4XTCS 2F0PA 3HKZB 1SNCA 1F2LA 2ZXPA 4KHVA 1PTOD 3D3RA 4B9WA 5FKAC 3H09A 5M9OA 2L0CA 1JOOA 5DAUA 1GXDC 4BY1B 5KNBA 2N88A 4NDXA 1AN8A 2EJMA 3OWEB 5JOBA 4AYBB 3Q24A 4QCLA 4XYOA 3J7YW 3QJYA 3SDZA 1V8QA 1GHKA 3EFXD 2BCOA 1AZQA 5IGCA 3E0JA 2L12A 3GTOB 1VDZA 1XX8A 2IL8A 3VR6A 2VB2X 4XQQA 2WP8J 2IPKD 1NR2A 1I4QA 1RODA 2KUMA 4XDXA 5FO9B 1EIGA 1YNND 1A2TA 5E1FA 1LT4D 2WB1B 1I50B 2RDFA 1AEXA 1Y8PB 1MI2A 2R61A 1JWMD 3W2DA 3C1FA 2RBMA 1E0BA 5IT9L 4KKSA 2MP1A 5K5PA 1O78A 3TBIB 2F0EA 4IQZA 5EGTA 1CM9A 2E74C 4IUUA 3KK7A 2N55A 4I7ZC 3S2HB 2AQ3B 2FFKB 3OSOA 3GTLB 2EJFC 1JC7A 2KQ3A 1JQYD 3U9SA 3LNNA 2FINB 4OIJA 2RSNA 3NP8A 2AQ2B 3M4YA 2RA4A 3C2PA 1PLFA 2J7ZA 3GTPB 3C1EA 3AMUA 5JEAJ 2SOBA 1D5MC 3DEPA 1NCVA 3SVMA 5JAVA 2XIWA 3DEOA 4CGYB 1FYCA 1ONLA 1B3AA 1U4MA 1BR9A 4DXFA 4Z9CB 1M8AA 2F0TA 2R7ZB 3HGBA 4OL7A 3KLSA 4RAUC 4XT3B 1ZYRC 1D6EC 2WKCA 2O5JC 2F0FA 3MZ5A 5BN5A 1HQRD 1HPCA 3S1NB 3CU7A 3PV0A 2B2UC 3HEJA 3GD7A 1SNDA 4A3KB 4DNTB 4OHJA 4CKEA 3HG9A 1EQTA 4QF4A 1PFBA 2QKIC 1SJHD 1LACA 4H44C 1B1ZA 3C46A 3WDNA 4KJOA 2ENBA 1DCZA 1TWCB 2O4XA 3EQLC 2M9VA 4XQJA 3M7GA 3PUWA 1CFMA 4F87A 1LTAD 2KA7A 5I9PA 4N9TA 1IYUA 2PZTA 2K5QA 2JEAI 1SNMA 5COYA 3CQZB 3NQIA 3HZXA 1XYIA 1B2TA 2NN6H 4ZRZA 3T56B 3K5NA 2DY7A 5T1GA 1IKLA 1STEA 3NUCA 3V05A 5I2YA 4M1UB 5CBEE 3TSSA 1K8OA 1BNZA 2J0TD 3MXUA 5CYUA 3NK9A 4K2LA 3H3VC 1S5CD 1I4GA 2O2LD 1EZ8A 4C3IG 2B8GA 3HS0C 1Y8NB 2B2VA 3KBXA 1HTLD 4J6HA 4C1NK 1HFGA 5JEAH 3IFDA 4H0LC 2Z8LA 3S2DB 1TWFB 1PFMA 1EWCA 2SNMA 1G91A 1Y1VB 1TIID 1QILA 3TP7A 5J39A 3HOVB 1LTTD 3MXNA 4A3DB 3BYYB 4PMCA 3RZDB 2K01A 4A3BB 3W3AA 2DNCA 1T5XD 1R4QB 2HUGA 5CV7A 3TP5A 4BA1I 2F0GA 3L3OC 3M3YB 4K14A 2X6LA 3A7AB 1S5DD 5FK9C 1PXUA 1RF2D 5C44B 3FDTA 4J8QA 5EBDA 3NTHA 5FO8B 2JA5B 2KHSA 2LKVA 2OF1A 1QCBD 3NXWA 5EKKA 1SXTA 1SYDA 5E4WC 1J9OA 5LHY1 3J81E 1PRTF 2MUYA 1LTSD 1EY0A 1SMYC 1JR0D 1BQQT 1WD0A 2NTTA 2RKSA 3QOLA 4ODGA 1HA6A 5D65A 1CHPD 5K36H 1JCKB 2EVBA 3E6ZX 4A93B 3DMUA 4BWGB 1V43A 1QG7A 3OWFA 3JAML 1WTRA 4KV6A 2HCIA 1KNEA 1SE3A 3DWAA 4J1MA 4HSVA 4K6LA 1U9RA 4QUCA 1RTOA 3RD4A 2JP1A 4FYDA 5C0XG 3CHBD 1A15A 4H13C 2VXWA 3FEWX 3FRPB 2F03A 1T5EA 1E2VA 2KEEA 4BY7B 3RMHA 4TQUS 1PRTD 3K5OA 1TKWB 4IN3A 2IWHA 1HHVA 5EPLA 1IL8A 5J22A 4ZUJA 5J1ZA 3K58A 2NN6I 2EY5A 3FPPA 3PUXA 2NBFA 4CKBA 1ENCA 4ID6A 4RKLA 2D9UA 3PIP3 3I3CA 2EZVA 2HDLA 3AU7A 5FLXE 2EDGA 3NPPA 4G4KA 4ULLA 4K5WA 2F0LA 3J81L 4C3HG 1XTCD 1PTOC 4KJNA 2B2TA 3P1HA 2IX1A 4DAPA 2YYZA 1B9NA 1W6JA 1E2WA 3X3NA 3VYRA 1OXSC 2QDBA 3LWUA 2JSOA 1TWAB 1X32A 3T4AC 4PQXA 2AWOA 4FXGC 1ZKOA 1STBA 4G57A 3BZDB 4XIGS 1S5BD 4R8IA 2F0KA 1EYCA 3QG1A 3N6RA 3D8GA 1KDBA 1GUNA 3HOZB 3OIPA 3CKIB 2K33A 1SE4A 1U4LA 1RDPD 4F88A 1U4PA 3TN2A 5I6YA 3DUZA 4M8AA 1HRJA 3VA7A 3NTIA 2X6GA 3OIQA 5T1IA 2KOLA 5EPKA 1TS5A 3Q22A 4IFDH 2PW7A 1RCVD 3GQBA 4HTHA 4IUTA 4KY6A 1B50A 3SE0A 2K5WA 5CV5A 4HCSA 1RHPA 1UAPA 4HMIA 5JJZA 3GV6A 5DNFA 3I90A 1MSGA 1QOHA 3T53B 4IFDG 5D3DA 3ITPA 4TRDA 2KCNA 1TY2A 2E2IB 5C3XA 2SNSA 2G9HD 1DM0B 1HXYD 1JE4A 3K57A 5ELCA 2K04A 2F0IA 4K5VA 2HCCA 3KF8A 4JBWA 1WVLA 4DN4M 1B4OA 3GTMB 3PIO3 3D4WA 4C3JG 1IW7C 4ZKBB 3M85A 2XRQD 2NZ1D 1Y1WB 3EVQA 1Q1BA 3MAQA 3FMCA 1VF5C 1F2ZA 3AB9A 5IGBA 2KVMA 2A69D 3QWNA 1S4ZA 1FR3A 1Z7TA 1WTVA 1XXGA 1PZID 1UEAB 5CC4A 3K5MA 3MA2B 2AUKA 1PTOF 1DYQA 2IT1A 1ILPA 1G2TA 1GUOA 4WFN3 5CBAE 1LT5D 2EE1A 2E75C 1D5ZC 1W6KA 5C3WA 3SK6A 2Q8TA 5I9OA 2PMZB 3TMEA 1NSNS 3VYUA 1F2YA 2K7VA 1TS2A 3EA6A 3MXGA 2K05A 2D2CC 3D6CA 5I2XA 2FHTA 4HEDA 5F2DA 2ICIA 2WIIB 2TSSA 2A69C 4MN3A 1Z6HA 3I4LA 1AP0A 4G7HC 3DWPA 2C9OA 1F2MA 2MHVA 1D1KA 4L8JA 1GUTA 2D5DA 1ET9A 4CKCA 2Q8IB 3URYA 4DU9A 5C0XJ 1D5XC 3M7NA 1HCZA 1DOLA 4ABNA 2WACA 4RKBA 2I07B 1OO9B 1YNJC 1DD2A 4X3KA 2M2LA 3NWSA 4EQPA 3C3LA 1J8IA 1A3VA 5IIFA 2LS01 2ICEC 2H4OA 3M4OB 1QWYA 2D62A 3P7JA 2Y0SB 3S9WA 1V1OA 2CQAA 4G7ZC 1TY0A 2XRSD 1V1PA 4NMZA 4K5XA 3BDCA 1QE6A 3A8KE 4ZK9B 2F0DA 3D6WA 4U68A 2A68C 2BE5D 5IOCA 1SNQA 4NW2A 4EQNA 1LO5D 5HGTA 5IGDA 5KEEA 2FMMA 4KY7A 1IYVA 4A3GB 4DAYA 1KABA 2M00A 3ONAB 2XWJB 4RGOS 4B9XA 1EY5A 1NAPA 3I8ZA 3SHLA 4QMGA 3BVGA 3RZOB 1MGSA 4HCEA 4CHTB 4HR7B 1D2BA 1KAAA 1YNNC 2JA6B 2EYJA 3MC0B 2E2JB 1OXTA 4ILWA 3MTSA 4X3TA 3PUVA 1A3TA 4DNRB 5EKLA 5DM73 5EQ0A 5ISRA 1II3A 1TQOA 4PMWA 1SNOA 4RGTA 4FNFA 2EOTA 1LTGD 1KDAA 1SAPA 2Z4HA 5TSSA 3NBIA 1EL0A 3R93A 5NUCA 1HUNA 4ZYSA 1JICA 4RCOA 2RDHA 3HP3A 2Z1CA 3Q6SA 2XVSA 4RHRA 1OXVA 1AW7A 5M3FB 3MWYW 1CHQD 2F0NA 1RTNA 4GZYC 3OMCA 2RQXA 1BCPC 1L0YB 3VR5A 1HTPA 5CGKA 2B2YC 1BBXC 2WINB 2NYZD 1R4PB 4WORA 4U673 2R3ZA 3D31A 5BN4A 1SYEA 4RH6A 2F0WA 3I73A 4KKTA 2F0JA 2F0OA 2E76C 3TP8A 4KI0A 1TU2B 1AFPA 5E3FA 2L11A 2PO4A 5HURA 4RWSC 1MBYA 4BA2I 4DXGA 3SR1A 5EKIA 2A6ED 1PZJD 1CTMA 2A6EC 2F3WA 5C5MA 5BN3A 2DN8A 3R2TA 1H9SB 1ICWA 2E2DC 1EYAA 3GP7A 1CQFA 3EROA 1BCPD 1QB5D 4RFBA 1DONA 4FF4A 4PNYA 4FVMA 4IZ8A 2NVXB 5D3IB 3NQTA 3DM1A 4H7BA 2JEBI 4O42A 1BXTA 5EBCA 1GUSA 1ESRA 3JAME 4N9PA 5A2QL 2LFNA 2H1EA 2PYKA 4E6IA 1LT3D 1SYCA 3BVZA 1DOKA 3T13A 1WTPA 1LT6D 3KBGA 3R3OA 1Q12A 4EQOA 1S5ED 3R2IA 4R8NA 4X3SA 4A3IB 3S16B 2NUCA 1PMRA 1X3PA 2IX0A 2WAQB 3BYTB 3S1QB 4C56C 1I4PA 2EYLA 3H91A 4HSPA 5C4XB 3PO3B 4B08A 1NUCA 1G2SA 3QO2A 1GUGA 5FOBB 4L6TB 1IW7D 5CMDA 1ZXTA 3S17B 2ZXRA 4BBSB 3MXPA 1V1PB 5C4ZA 1G6ZA 4FF1A 3I91A 3A8JE 1AZPA 2R6GA 2AWNA 3ND9A 3VR3A 2PNRC 1TT2A 1O80A 4LAAA 3A7LA 4XQNA 1ET6A 3TP6A 4XXEA 3L7ZC 1C48A 1KDCA 4BS9A 3HRZC 3OPOA 4IUQA 1FNUA 1A6XA 3P75A 1EEFD 1MSHA 5CV8A 5C0XH 1CZGA 4DFAA 3IKJA 2I46A 1FNVA 3U9OA 5IGEA 1QNUA 3VYTA 1WTQA 1EY6A 3Q23A 4OO1I 2OEOA 3TDQA 4PV1C 4OGQC 1CK1A 1DXMA 5IGGA 5FLXL 1DZ1A 3J7AV 2F4IA 3K7AB 5M5WB 2B2WA 1EFID 1DOMA 3PMFA 3D4DA 2F0VA 2F0QA 3ZYYX 5M5YB 4LMQD 2V4DA 2VNUD 1QNKA 2J4XA 2L1BA 4EGVA 1UUPA 1SDFA 2BDNA 2EXZA 2PW5A 1STNA 4IUVA 5C3EB 2BOSA 2A6HC 4WJWA 4Q5VA 3VYSA 1BCPF 3RLFA 3ERQA 3OW7A 3QB3A 4OIKA 4C3IB 1BOSA 4KN7C 2NN6G 1WTOA 4RGNA 1KLGD 2VUMB 2JE6I 5DEHA 4L63B 4BBRB 2KJXA 2RSOA 2OT2A 2XSCA 3FPUB 4FF3A 3MFYA 5EJWA 3Q0AA 1H9KA 4KMUC 3GO5A 1JB3A 2PQEA 4G7OC 5C4HA 5JEAG 3BDLA 3QOJA 1O7LA 1F9PA 2JYOA 5KRUA 3FKIB 2HQEA 4C1NI 5CR3A 1TS4A 2CHBD 1PTOB 5JPNC 4ZAIA 1ENAA 1RJTA 2F0SA 1EY4A 4X3UA 1GOZA 2L4NA 5K36G 2EYMA 1IHZA 2RVLA 2LY7A 2NTSA 1STGA 4KN4C 2TMPA 2OXPA 2NVYB 3S1RB 3DWQA 5C5LA 5KNDA 1SFOB 3A54A 3A55A 1SMYD 2GA4B 1KLUD 4IUPA 1S5FD 4C3JB 3PO2B 2Q8RE 4I65A 3D4RA 2DY8A 1I6HB 1DJRD 2F1MA 1HQMC 1STHA 2HDMA 3ND8A 1PRTB 1JOQA 2MPMA 3TZDA 5CV6A 3I72A 1WCMB 1FNWA 1C8CA 3VR4A 1Q8IA 1NR4A 4RA8A 3OHXC 3EJIA 5KYLA 4F8MA 2JA8B 4UDUC 4V0BA 2L55A 2F3VA 5C0XI 3F2UA 1WD1A 3GTGB 2O5IC 1VMPA 2EYFA 4PMBA 3NTKA 1H9SA 1JORA 2B2WC 2B2YA 3SK8A 4ZLTF 5M5XB 2K32A 1QJOA 2PPBC 1A2UA 1XWEA 3DHQA 3L9AX 1YNJD 4NKLA 3X3MA 1I3QB 3O13A 2YU9B 3K6OA 4DAVA 1U4RA 5CORA 1ZEQX 1LTRD 3PUYA 3DXJC 3H6MA 1TVXA 1EOTA 4QIWB 4A3JB 1SYGA 5G3LF 2SEBD 3GV3A 5C4JB 4RCNA 1EU3A 3G6JB 3IFTA 3G7LA 2SDFA 2DNEA 5E4XA 3VR2A 4V190 2AQ1B 4ZUIA 4K8IA 1KNAA 2JXMB 3V2TA 4C3HB 1HA5A 1M4VA 4RHSA 2LMCB 5A2QE 4A3MB 2A6HD 1CT1D 2EY1A 3MFGA 1H9MA 2BA0A 1BUVT 1BCPB 4KTAA 1SNPA 4MIUA 1HUMA 4KKUA 3PUZA 3LWEA 3BG3A 1A3UA 5D14A 1PZKD 1ILQA 2B2TC 3K0YA 3S14B 5C6AA 1F9RA 2CW0D 3V96A 2VB3X 1TWHB 1LLRD 3J80E 1JOKA 4HN7A 2IX3A 2FMCA 4A3FB 3LX0A 3K59A 3I70A 4LK1C 2IJ0A 1CA5A 1BF4A 3I4MB 5KGUA 2X69A 2EYOA 3P20A 2KEDA 1UNSA 5IGFA 1I6VC 4A3EB 2B8FA 4CJ2C 4OO1H 2F0UA 2EY2A 1C4QA 4DK0A 4IUNA 5M3MB 3K5LA 2PZUA 3T16A 4EVOA 2BDOA 3BDOA 1CI3M 1LV9A 2R93B 2JA7B 1EWHA 2EJGC 2XNAC 5ELEA 2XN9C 2F0HA 4Q0FA 4CJ1B 1SEBD 3HOYB 4OO1G 2EYHA 1TS3A 4FXKC 1I4HA 3SEBA 1F77A 4ZQ3A 1TWGB 5IT9E 2WKDA 3OOCA 1B44D 3GTJB 5A35A 1CQVA 5KIXA 5DM63 1E2ZA 2A68D 3HOUB 1Q1EA 1F9SA 3NWTA 4HMJA 5JPMC 2NVQB 2L5TA 2IW3A 1JWSD 1VCIA 3QIAA 1H9RA 4JK1C 4K6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I91 A;  1AZQ A;  1AZP A;  1SAP A;  2MJ8 A;  5EPJ A;  1HFN A;  4R8I A;  1HFG A;  2L9H A;  3IFD A;  3LWE A;  1WTX A;  2L12 A;  4RAU C;  1S4Z A;  4X3K A;  4HAE A;  1DON A;  4XT3 B;  3R93 A;  1EL0 A;  1HUN A;  1XX8 A;  2IL8 A;  1PFM A;  2M2L A;  1JIC A;  1A15 A;  1O80 A;  3F2U A;  5D14 A;  1WTV A;  1WD1 A;  1CA6 A;  3HP3 A;  3Q6S A;  1ILQ A;  1G91 A;  1J8I A;  1VMP A;  2B2T C;  2VXW A;  2RSO A;  1NR2 A;  1U4L A;  1U4P A;  1F9R A;  2K03 A;  3TN2 A;  1PFN A;  2B2W C;  2B2Y A;  2KEE A;  3FPU B;  1ROD A;  1IKM A;  1HRJ A;  2KUM A;  2B2U C;  4XDX A;  5EJW A;  4ZLT F;  3P7J A;  2KEC A;  3DM1 A;  2K01 A;  1EIG A;  1O7Z A;  1O7Y A;  2X6G A;  4O42 A;  5EPK A;  2KOL A;  5T1I A;  1ILP A;  4IUQ A;  1G2T A;  2EPB A;  1HHV A;  2K1B A;  5EPL A;  5CBA E;  2HUG A;  1ESR A;  2K28 A;  1MSH A;  1CA5 A;  1IL8 A;  1MI2 A;  5AFW A;  3MWY W;  1EQT A;  2EE1 A;  4IUT A;  1BF4 A;  1B50 A;  1RTN A;  1B53 A;  1E0B A;  1PFB A;  1WTW A;  2B2V C;  1RHP A;  4HCS A;  1F9P A;  1GUW A;  2X69 A;  2JYO A;  2Q8T A;  2H1E A;  2MP1 A;  2X6L A;  1WTQ A;  1QE6 A;  3IL8 A;  4ZK9 B;  2B2Y C;  5JJZ A;  1U4R A;  1DOK A;  2KED A;  1WVL A;  1BBX C;  5COR A;  3D6W A;  2NYZ D;  3GV6 A;  1CM9 A;  4U68 A;  5DNF A;  2R3Z A;  1WTP A;  4MHE A;  4ZAI A;  1RJT A;  4IUR A;  3I90 A;  3N52 A;  4IUU A;  3FDT A;  1MSG A;  2D9U A;  4NW2 A;  4CJ2 C;  4CJ0 B;  3I3C A;  1DZ1 A;  4X3U A;  1TVX A;  3KUP A;  4QUF A;  2HDL A;  2N55 A;  2L4N A;  1EOT A;  1PDQ A;  2FMM A;  4R9W A;  2B2W A;  2RVL A;  3UI2 A;  1DOM A;  2FFK B;  4X3S A;  5E4W C;  3ONA B;  1F2L A;  2K05 A;  1J9O A;  4LMQ D;  2FHT A;  1QNK A;  4HED A;  1NAP A;  2FJ2 A;  2L1B A;  3I8Z A;  1LV9 A;  5COY A;  1X3P A;  3GV3 A;  2B2U A;  1MGS A;  1XYI A;  1JE4 A;  1B2T A;  1SDF A;  4MN3 A;  1WD0 A;  2BDN A;  4IUP A;  2B2T A;  2CVR A;  1SSO A;  2N88 A;  4CJ1 B;  2Q8R E;  1F9Q A;  2K04 A;  2L11 A;  2FIN B;  3G7L A;  4OIJ A;  2DY7 A;  1AP0 A;  2RSN A;  1HA6 A;  2HCC A;  2DY8 A;  2SDF A;  3H91 A;  4IUV A;  5D65 A;  1B4O A;  5T1G A;  1ML0 D;  1IKL A;  4RWS C;  4DN4 M;  2RA4 A;  1PLF A;  2HDM A;  5E4X A;  2J7Z A;  2NWG A;  1G2S A;  3QO2 A;  5CBE E;  5EKI A;  1X3Q A;  3DEP A;  3MTS A;  2MGS A;  1KNA A;  4X3T A;  4ZKB B;  1Q3L A;  1X32 A;  2MPM A;  1QG7 A;  1VMC A;  4UAI A;  4XT1 B;  3TZD A;  1NCV A;  5EQ0 A;  1BO0 A;  1WTR A;  1BNZ A;  3SVM A;  2NZ1 D;  2XIW A;  5CMD A;  3DEO A;  1F9S A;  2HCI A;  1KNE A;  4OIK A;  1ZXT A;  1B3A A;  1C8C A;  1U4M A;  1EIH A;  1ICW A;  4ZKC B;  4HSV A;  1WTO A;  1M8A A;  1NR4 A;  4QUC A;  2EOT A;  4RA8 A;  1G6Z A;  1DOL A;  2B2V A;  3KBX A;  1RTO A;  2KVM A;  1HUM A;  2JP1 A; 
#chains in the Genus database with same CATH topology
 1CSP A;  2L9H A;  3E5S A;  5C44 G;  3CRK C;  5IP9 G;  4HAE A;  4C3J H;  2PQA B;  3MEH A;  4KK7 A;  5FO7 B;  1SLJ A;  1PRT C;  2Q2H A;  4APV A;  1G29 1;  1VF7 A;  4DR7 L;  3BS1 A;  4O1N A;  3CCU A;  2K03 A;  2B63 B;  1IKM A;  2YTX A;  4FF2 A;  4GOP A;  4LFA Q;  1NE3 A;  2WAQ G;  4P2C B;  3SXH A;  2HHH Q;  2EPB A;  4A3F G;  2ZT9 C;  2N3S A;  3JAM i;  2Y0S G;  4DR5 L;  1SE2 A;  4X65 L;  1WTW A;  4A3I G;  3DM3 A;  4IO9 A;  5LL6 S;  3UDG A;  1GUW A;  2I5M X;  1OXX K;  3STB D;  4LF4 Q;  1GD7 A;  5IWA L;  4JI5 L;  2K4K A;  2VS1 A;  5CV9 A;  4DK1 A;  2Y0S E;  1OXU A;  1WTH A;  3N52 A;  1EU4 A;  4CJ0 B;  2UUC L;  4DA2 A;  4NP5 A;  1UE5 A;  5I6W A;  2KCT A;  2R92 B;  4KD3 A;  3WOE A;  4IAL A;  4JPB W;  1Q86 C;  2K5D A;  2K75 A;  5I4D A;  3RZD H;  4XYQ A;  2WV6 D;  4NXM L;  1Y8O B;  1VQ9 A;  3BZC A;  3PF5 A;  1QUQ A;  4YY3 Q;  2FJ2 A;  4A75 A;  3GTK B;  1Y1V H;  2JA5 H;  2B2U A;  3H94 A;  4IFD I;  3H15 A;  1O7I A;  4A3B G;  1ENF A;  1D1I A;  5ELB A;  4F7X A;  1SSO A;  4TKO B;  4KHZ A;  1Z9F A;  3H0G B;  2A5H A;  4HIO A;  3A8I E;  1MD2 D;  5H1S E;  1K83 B;  1TWA H;  2MGS A;  4GKJ Q;  1Q3L A;  4UAI A;  1VMC A;  4XT1 B;  1Q90 A;  1SYF A;  3CCM A;  1BO0 A;  5IYD H;  1LAB A;  1N34 L;  4KY5 A;  1EY7 A;  2QW7 A;  2G9D A;  3CF5 A;  3RN2 A;  4K8J A;  1G8Z D;  1Y69 U;  1I4X A;  4OWW B;  3HKZ G;  2K6A A;  1ZYR D;  4IFD J;  3FVQ A;  4ZKC B;  2Z4I A;  1CZW A;  5C4J H;  4KHP L;  2N8N A;  2ID0 A;  1NJI C;  5EPJ A;  1C0A A;  2QEJ C;  2FXQ A;  1EUJ A;  4LJZ C;  2DJG C;  4QB4 A;  5JVG 3;  1WTX A;  1R9T B;  4FO2 A;  4JI6 L;  2NB0 A;  1I4R A;  2XGT A;  4YWL A;  2G5D A;  1PYW D;  2AKW B;  4B3M Q;  4CDC C;  2QGQ A;  1M1K C;  2WFW A;  2EY6 A;  1LTB D;  4C2M B;  3J80 L;  4LF8 Q;  1SBB B;  2KEC A;  3KF6 B;  1O7Z A;  1O7Y A;  4YIJ A;  1KTK A;  3NE5 B;  3I4N H;  1VS0 A;  2BH8 A;  3HOX B;  3OMG A;  1W2B A;  3ULP A;  1STY A;  3WOF A;  5CV4 A;  1E7Z A;  4GOP B;  3TZU A;  1K0S A;  5IOD A;  3IL8 A;  5KNC A;  4Y7N B;  2UXB L;  4JCV E;  2OTL A;  3KLS X;  4DF7 A;  1ICF B;  4KLK A;  3HOW B;  3I56 A;  2CKZ B;  2EXD A;  3KJO A;  4MHE A;  4DGZ A;  1PA6 A;  4RGM A;  5ELO A;  2ZXO A;  3KUP A;  4QUF A;  1YIT A;  1PDQ A;  3K7U C;  4R9W A;  3IAY A;  1EQV A;  3UI2 A;  2QIL A;  1LTI D;  3CCR A;  1SYB A;  2KCC A;  1K9M C;  4KD4 A;  5M3F G;  5LL6 X;  2EYP A;  5JVH 3;  1YEZ A;  3CRL C;  4DAY B;  1P16 A;  2ASB A;  1GJX A;  2PCF B;  3RUZ A;  2CVR A;  3NHH A;  1B3Q A;  2NVT B;  1F9Q A;  2AUJ D;  4K2K A;  1GHJ A;  1ESF A;  1EZ6 A;  3S15 B;  4FXD A;  1ML0 D;  5IWA Q;  1FD7 D;  1SRO A;  1EEI D;  2K50 A;  1J5E Q;  1VQN A;  3S1M H;  3E9I A;  1HNW Q;  2NWG A;  2I5H A;  5IP9 H;  2E2H B;  1EYD A;  1X3Q A;  2E2H H;  1PTO H;  2A74 C;  5IP7 H;  3SK4 A;  3HOW H;  3S1M B;  3MVV A;  2RDG A;  4OX9 Q;  3KLR A;  2CW0 C;  4S3S A;  4TSS A;  1SJE D;  4ME5 A;  1H9J A;  3PO2 H;  1EIH A;  1Q82 C;  1UE6 A;  1FGB D;  2ES2 A;  4BXX G;  1YJW A;  4FP5 D;  5FJ8 H;  1HZ9 A;  4CBV A;  3VA5 A;  1KL9 A;  5G3L D;  3J7A F;  2BE5 C;  2MJ8 A;  1HFN A;  1EY8 A;  3T1H L;  2PMZ E;  3A56 A;  2PZW A;  1JWU D;  1CA6 A;  3M4O H;  1L0X B;  1KAW A;  3BVM A;  1RD9 D;  1Z47 A;  1H95 A;  3T51 B;  1PFN A;  1NY4 A;  1BDO A;  1EY9 A;  4OWX B;  5ELF A;  5KYI A;  1VQL A;  1PV4 A;  2XWB B;  1RKN A;  3GTQ B;  4YWM A;  2C5C A;  2A73 B;  2K1B A;  3PQI A;  2K28 A;  2WB1 G;  5GRO A;  5JJK A;  5AFW A;  3SK5 A;  5ELN A;  1STA A;  1B53 A;  4LFB L;  2B2V C;  2KHI A;  1QUQ B;  2QF7 A;  3NSW A;  1K8M A;  3PO3 H;  3GTM H;  3I4N B;  2F0M A;  1B9M A;  4JI3 L;  4WRD A;  4QQB X;  2B39 A;  1HNZ Q;  2QCP X;  1TR5 A;  3NBH A;  4IUR A;  5ELD A;  3R8B A;  3MHB A;  2BA1 A;  1CKN B;  5DLQ E;  4B3M L;  4XTC S;  2VQF L;  2F0P A;  3HKZ B;  3H0G H;  1CKN A;  1SNC A;  4LF8 L;  1F2L A;  4UP8 A;  3I4M G;  4X6A H;  1VQB A;  2ZXP A;  4JI7 Q;  4KHV A;  1PTO D;  3D3R A;  4B9W A;  5FKA C;  3H09 A;  5M9O A;  1X3F A;  4IJH A;  2L0C A;  1JOO A;  5DAU A;  1GXD C;  4BY1 B;  5KNB A;  2N88 A;  4X62 Q;  4NDX A;  1AN8 A;  4DV3 L;  1Q7Y C;  2UXB Q;  2EJM A;  1MJC A;  3CCJ A;  3OWE B;  5JOB A;  1N8R C;  3H0G G;  3KOJ A;  4AYB B;  1VQI A;  2YV5 A;  3Q24 A;  1K83 H;  2PNH A;  4QCL A;  4XYO A;  4L5R C;  4YWK A;  1IBL Q;  2KEN A;  3J7Y W;  1VQO A;  3QJY A;  1V8Q A;  3SDZ A;  1GHK A;  4HJ5 A;  1C9O A;  3EFX D;  4DV2 L;  3U4Z A;  2BCO A;  2R92 G;  1AZQ A;  5IGC A;  3E0J A;  2L12 A;  3GTO B;  1VDZ A;  1XX8 A;  2IL8 A;  3VR6 A;  4JOI A;  2VB2 X;  4DR4 L;  2A19 A;  4XQQ A;  2WP8 J;  2IPK D;  1NR2 A;  2AMC B;  1K8G A;  1I4Q A;  3H3V I;  4JYA Q;  2UU9 Q;  1ROD A;  4GLA C;  2KUM A;  4XDX A;  5FO9 B;  4A3J H;  1VQH A;  4DUY L;  1EIG A;  1YNN D;  1A2T A;  5E1F A;  1LT4 D;  2WB1 B;  1I50 B;  2RDF A;  3G48 A;  5AJ3 Q;  1AEX A;  1Y8P B;  1MI2 A;  1KXL A;  2R61 A;  1AE2 A;  3J7Z C;  4B3R L;  4YCW A;  1JWM D;  3W2D A;  3C1F A;  2GVA A;  2RBM A;  1E0B A;  2ZTE A;  4EQ5 A;  4GS3 A;  5IT9 L;  4KKS A;  2MP1 A;  1X3E A;  5K5P A;  2NVQ H;  2LXK A;  1SR3 A;  1O78 A;  3TBI B;  1A8V A;  2F0E A;  4IQZ A;  3F8T A;  5EGT A;  1IBM Q;  3GTJ H;  1CM9 A;  5LMU Q;  2E74 C;  5FLX c;  1VQ8 A;  4IUU A;  5IE8 A;  3KK7 A;  1JB7 A;  2N55 A;  4I7Z C;  2K5H A;  3S2H B;  2AQ3 B;  2FFK B;  1U0L A;  3OSO A;  1XNQ L;  3OTO L;  3H3V H;  3GTL B;  4H02 A;  3I55 A;  2EJF C;  1U5K A;  1JC7 A;  4JI1 L;  1CKO A;  3HOU G;  2KQ3 A;  4IPD A;  1KD1 C;  1JQY D;  1VQK A;  3GTL H;  5GAE C;  2CCZ A;  2I5L X;  4A93 G;  4WJ4 A;  3U9S A;  3LNN A;  2FIN B;  4OIJ A;  2RSN A;  4DPG A;  5FJ8 G;  3NP8 A;  4HJ9 A;  2AQ2 B;  3M4Y A;  2RA4 A;  5HGQ A;  1PLF A;  3C2P A;  2J7Z A;  3GTP B;  3C1E A;  5JEA J;  3AMU A;  2ZTD A;  2SOB A;  3HOY G;  1D5M C;  3DEP A;  3SGI A;  1PH6 A;  1NCV A;  3GTP H;  3SVM A;  1EIF A;  5JAV A;  2XIW A;  3DEO A;  4CGY B;  1FYC A;  1ONL A;  1B3A A;  1U4M A;  1BR9 A;  4DXF A;  4JI2 L;  3WWV A;  4BY7 H;  1BKB A;  4Z9C B;  1WCM G;  1M8A A;  1HNX Q;  2F0T A;  2R7Z B;  3HGB A;  4OL7 A;  3KLS A;  4RAU C;  2ATW A;  2E5L L;  4XT3 B;  1ZYR C;  1D6E C;  4GKJ L;  2WKC A;  2O5J C;  3PO3 G;  2NVX H;  2F0F A;  5E7N A;  3MZ5 A;  5IT9 c;  5BN5 A;  1HQR D;  1IZ6 A;  1HPC A;  5GAD C;  2UUA Q;  3S1N B;  3CU7 A;  3PV0 A;  2B2U C;  4DUZ L;  3HEJ A;  3GD7 A;  3J81 i;  1SND A;  4KHP Q;  4A3K B;  4DNT B;  1VQE A;  4O0A A;  4OHJ A;  4CKE A;  3HG9 A;  1EQT A;  1YHB A;  1X55 A;  4QF4 A;  1PFB A;  4A3D G;  2QKI C;  1SJH D;  1LAC A;  1Q8K A;  4H44 C;  1IXR A;  4A3M H;  1B1Z A;  4QL5 A;  3C46 A;  3WDN A;  4KJO A;  3S15 H;  2ENB A;  1DCZ A;  1TWC B;  3W1G A;  2O4X A;  1HZB A;  3CC4 A;  2NVT H;  3EQL C;  2M9V A;  1VQ5 A;  1QZG A;  4XQJ A;  4QIW E;  3M7G A;  2HD3 A;  3PUW A;  2HQL A;  3PSI A;  1CFM A;  3CW2 C;  4DR1 Q;  4F87 A;  1LTA D;  2KA7 A;  4R1J A;  4JI0 Q;  3CCV A;  4JBK A;  4JI8 Q;  5I9P A;  4BY1 H;  4N9T A;  1IYU A;  2PZT A;  3B6Y A;  2K5Q A;  4A3M G;  3HOV H;  2JEA I;  1SNM A;  4X66 Q;  5COY A;  3CQZ B;  3NQI A;  4LUZ A;  3HZX A;  1A63 A;  1XYI A;  1B2T A;  2QA4 A;  4BBR H;  2NN6 H;  4ME3 A;  1E1O A;  4ZRZ A;  3T56 B;  3K5N A;  1VQP A;  2DY7 A;  3UDF A;  4LUV A;  4GOP C;  3CCE A;  1YHA A;  5T1G A;  1IKL A;  4DV6 Q;  1STE A;  3NUC A;  3V05 A;  3I7F A;  2HIV A;  5I2Y A;  4NXN L;  4M1U B;  5CBE E;  2UXD Q;  3TSS A;  1L1O C;  1PH1 A;  1BNZ A;  1K8O A;  1K3R A;  2J0T D;  3F2D A;  3MXU A;  5CYU A;  3NK9 A;  4K2L A;  3H3V C;  4A3J G;  1S5C D;  1I4G A;  2O2L D;  1EZ8 A;  4C3I G;  2B8G A;  3HS0 C;  1Y8N B;  2B2V A;  3KBX A;  1YJN A;  1HTL D;  4J6H A;  4C1N K;  1FVI A;  1HFG A;  5JEA H;  3IFD A;  2DGY A;  4H0L C;  3A5U A;  2Z8L A;  1VQ4 A;  3S2D B;  1XMQ Q;  1TWF B;  1PFM A;  1EWC A;  4N8F A;  3NBH B;  2IHE A;  4IOC A;  2SNM A;  1G91 A;  3KYH C;  1NMF A;  1VQC A;  1Y1V B;  1TII D;  1PH8 A;  3GTG H;  1QIL A;  3TP7 A;  3AQQ A;  5J39 A;  3HOV B;  3BU2 A;  1LTT D;  3MXN A;  3ICE A;  4A3D B;  3BYY B;  4PMC A;  3RZD B;  3J7A 5;  2K01 A;  1LM0 A;  4A3B B;  4LF4 L;  3W3A A;  2JA8 H;  2DNC A;  4UHV A;  1T5X D;  4A3K G;  1EOV A;  1R4Q B;  3TS2 A;  2HUG A;  2WB1 E;  5CV7 A;  3TP5 A;  4BA1 I;  3T1H Q;  1A0I A;  2F0G A;  3L3O C;  4GNX A;  3M3Y B;  4JOI C;  4K14 A;  2X6L A;  5HY6 A;  3A7A B;  1S5D D;  5FK9 C;  1QVF A;  1PXU A;  1RF2 D;  5C44 B;  3FDT A;  4J8Q A;  3HKS A;  1EQR A;  2JA6 H;  2R7Z G;  5EBD A;  1MKH A;  3PF4 A;  3NTH A;  5FO8 B;  2UUA L;  4CDE C;  2JA5 B;  2KHS A;  2LKV A;  2OF1 A;  1QCB D;  3NXW A;  5EKK A;  1SXT A;  1SYD A;  5E4W C;  1C7Y A;  1J9O A;  5LHY 1;  3J81 E;  1PRT F;  2B63 H;  2MUY A;  1HR0 Q;  3J81 c;  1LTS D;  1EY0 A;  3K7A H;  4HJA A;  1SMY C;  1JR0 D;  1BQQ T;  1WD0 A;  2NTT A;  2RKS A;  3QOL A;  4ODG A;  1HA6 A;  2E8G A;  1N34 Q;  5D65 A;  1AE3 A;  1CHP D;  5K36 H;  3F2B A;  1JCK B;  2EVB A;  1N32 Q;  2Z6K C;  1X56 A;  5GAH C;  3E6Z X;  5L37 A;  4A93 B;  1WFQ A;  3DMU A;  3CPF A;  4JBM A;  4BWG B;  1V43 A;  4DUZ Q;  1QG7 A;  2R7F A;  3OWF A;  3JAM L;  1WTR A;  2JA7 G;  4KV6 A;  2HCI A;  1KNE A;  3I4O A;  1SE3 A;  2CH4 W;  3DWA A;  4J1M A;  1M90 C;  3KDF A;  3KFU A;  4HSV A;  4K6L A;  4MNO A;  1U9R A;  4QUC A;  1RTO A;  3RD4 A;  2JP1 A;  1G6P A;  1N36 Q;  4FYD A;  1Q46 A;  5C0X G;  2CFM A;  4A3E G;  1K8A C;  3CHB D;  1A15 A;  4H13 C;  4DV6 L;  2VXW A;  3FEW X;  3FRP B;  2F03 A;  1T5E A;  2N49 A;  3UE0 A;  3S16 H;  1E2V A;  2KEE A;  3MEF A;  4BY7 B;  3RMH A;  4TQU S;  1PRT D;  3K5O A;  1TKW B;  4IN3 A;  2IWH A;  2R93 G;  1HHV A;  4OON A;  5EPL A;  4X62 L;  1NBW A;  4Y7N H;  4TVA B;  1IL8 A;  4LF6 Q;  4AH6 A;  5J22 A;  2Z6K A;  4ZUJ A;  5J1Z A;  3K58 A;  2NN6 I;  5M3M G;  2EY5 A;  3FPP A;  2OQK A;  4HIK A;  4WJ3 M;  3PUX A;  2NBF A;  4CKB A;  2MO0 A;  1ENC A;  4ID6 A;  4AIM A;  4BBR G;  2K5N A;  1PH3 A;  4RKL A;  2UXD L;  2D9U A;  3PIP 3;  2VUM G;  1MIU A;  3I3C A;  4X64 Q;  4JW0 A;  2EZV A;  2HDL A;  3AU7 A;  3FP9 A;  5FLX E;  2EDG A;  4DR2 Q;  3NPP A;  4G4K A;  2Z9H A;  3U50 C;  4ULL A;  4DV4 L;  4K5W A;  4RG1 A;  4X65 Q;  1XMO L;  1YJ9 A;  5M3M H;  1K73 C;  2F0L A;  4OEM B;  1UE1 A;  1B7Y B;  1B70 B;  3J81 L;  4AQY Q;  4C3H G;  4R4O A;  1XTC D;  1PTO C;  4KJN A;  2B2T A;  3P1H A;  2IX1 A;  4DAP A;  2YYZ A;  4C3I H;  2VQE L;  1B9N A;  3TRZ A;  1W6J A;  1E2W A;  4YHH Q;  4LFA L;  5C3E G;  3X3N A;  3CD6 A;  3VYR A;  1OXS C;  3PGZ A;  2QDB A;  3LWU A;  2ALY B;  2JSO A;  1TWA B;  2ZJR A;  1X32 A;  3A74 A;  4JI1 Q;  3T4A C;  4PQX A;  1PH9 A;  2AWO A;  4FXG C;  1ZKO A;  1STB A;  4G57 A;  4JI4 L;  3BZD B;  5GQO A;  4XIG S;  1S5B D;  4R8I A;  1E1T A;  2F0K A;  1JJG A;  1EYC A;  3K81 C;  3QG1 A;  3N6R A;  3S1N H;  4P71 A;  3NEN A;  3D8G A;  1KDB A;  1GUN A;  4LNQ A;  4DV0 Q;  3OIP A;  3CKI B;  5M5W H;  2K33 A;  4NXM Q;  3HOZ B;  1SE4 A;  1U4L A;  1RDP D;  4F88 A;  1U4P A;  3TN2 A;  2P5Z X;  4YY3 L;  4LF5 Q;  5I6Y A;  3DUZ A;  4M8A A;  3D0F A;  1HRJ A;  3VA7 A;  3L0O A;  3NTI A;  3OIQ A;  2X6G A;  2R7Z H;  5EPK A;  2KOL A;  5T1I A;  1TS5 A;  3Q22 A;  4IFD H;  2Q2I A;  1JT8 A;  2PW7 A;  1RCV D;  3BJU A;  3GQB A;  4MZ9 A;  4HTH A;  1DGS A;  1GO3 E;  4IUT A;  4KY6 A;  3KJP A;  1B50 A;  1N33 Q;  4PZ7 A;  3SE0 A;  2K5W A;  5CV5 A;  4HCS A;  1RHP A;  3S17 H;  1UAP A;  2AHO B;  4HMI A;  5LMN L;  4MTN A;  5JJZ A;  1E24 A;  3GV6 A;  5DNF A;  4JI7 L;  1TWG H;  3I90 A;  3M4Q A;  5BR8 Q;  1MSG A;  1QOH A;  3T53 B;  4IFD G;  5FLM H;  5D3D A;  5C4X H;  1IBK L;  3ITP A;  4TRD A;  4DV1 L;  1WYD A;  2KCN A;  1EQQ A;  1TY2 A;  1SRU A;  2E2I B;  5C3X A;  2SNS A;  3NEM A;  2E5L Q;  4JBJ A;  2G9H D;  1Y1W G;  1DM0 B;  1HXY D;  2VL6 A;  1JE4 A;  3GDE A;  3K57 A;  5ELC A;  1FJG L;  2K04 A;  1EWI A;  2F0I A;  4K5V A;  2HCC A;  3KF8 A;  4JBW A;  1WVL A;  4DN4 M;  1B4O A;  1ASY A;  4LF9 Q;  5C4X G;  3GTM B;  3PIO 3;  3D4W A;  1X54 A;  4L5T A;  1QVC A;  1KHI A;  4C3J G;  4DV2 Q;  1IW7 C;  4JI8 L;  4A3E H;  4ZKB B;  4B3T L;  5M3F H;  3IRB A;  3M85 A;  1A62 A;  3HFZ B;  2XRQ D;  2NZ1 D;  1Y1W B;  3GTQ H;  3EVQ A;  1Q1B A;  3MAQ A;  2QEX A;  3FMC A;  1VF5 C;  1F2Z A;  3AB9 A;  1PH5 A;  4DK6 C;  2UUB L;  5IGB A;  5IYB H;  2KVM A;  2R93 H;  2OCE A;  3TRE A;  4A3F H;  2A69 D;  5IYC H;  4JC0 A;  2F4V Q;  3QWN A;  1S4Z A;  1FR3 A;  4CDF C;  1Z7T A;  3OW2 A;  1UEB A;  3KF6 A;  5AJ3 L;  1WTV A;  3HOW G;  4YHH L;  5J3B A;  3L2P A;  1XXG A;  1PZI D;  1UEA B;  1SMX A;  5CC4 A;  3AYH B;  3MA2 B;  1CSQ A;  3K5M A;  2AUK A;  4A4I A;  3PO2 G;  1PTO F;  1VQ7 A;  1DYQ A;  2IT1 A;  2LXJ A;  4JV5 L;  4UP9 A;  1ILP A;  3HOX G;  1GUO A;  3UE1 A;  1G2T A;  4WFN 3;  5CBA E;  5IYC G;  5LMU L;  1LT5 D;  2EE1 A;  3ZJY C;  2E75 C;  1D5Z C;  1W6K A;  5C3W A;  3SK6 A;  1HNW L;  3CME A;  4B3S L;  2Q8T A;  3J80 i;  5I9O A;  4DV5 L;  2PMZ B;  2MO1 A;  4C3H H;  3TME A;  2UXC Q;  4P75 A;  4Y52 H;  3HOX H;  3FKI G;  3HOZ H;  1NSN S;  3VYU A;  1SFO H;  1F2Y A;  2ZJP A;  2K7V A;  1TS2 A;  3EA6 A;  3MXG A;  1K28 A;  1PHJ A;  4LF7 L;  1XTD A;  4GNX B;  2K05 A;  4LFB Q;  2D2C C;  3E0E A;  3D6C A;  5I2X A;  1X9N A;  2FHT A;  4HED A;  5F2D A;  2ICI A;  5IYD G;  2WII B;  3A5Z B;  2TSS A;  1WJJ A;  2A69 C;  4MN3 A;  1E3P A;  1Z6H A;  3I4L A;  1R9T H;  2D0P A;  1AP0 A;  4G7H C;  3DWP A;  2C9O A;  1F2M A;  3FKI H;  3HOZ G;  2MHV A;  1D1K A;  2VQF Q;  4L8J A;  3AEV A;  1GUT A;  2D5D A;  1JMC A;  1ET9 A;  1X3G A;  1BBU A;  4CKC A;  1HR0 L;  2Q8I B;  1VQF A;  3URY A;  3VDY A;  4DU9 A;  5C0X J;  1D5X C;  4A3C G;  3M7N A;  1HCZ A;  1V9P A;  1KC8 C;  1DOL A;  4ABN A;  2WAC A;  2C35 B;  2V1C C;  2VY3 A;  4RKB A;  2I07 B;  5LMN Q;  1OO9 B;  5M5X H;  1YNJ C;  3RLN A;  1DD2 A;  4X3K A;  4HIM A;  2BH2 A;  1SN8 A;  4NB3 A;  4AYB G;  2M2L A;  3NWS A;  1XPR A;  4EQP A;  3C3L A;  3CC7 A;  1J8I A;  1A3V A;  5IIF A;  2LS0 1;  2ICE C;  3CC2 A;  2H4O A;  3M4O B;  1QWY A;  4A3C H;  2D62 A;  3P7J A;  2Y0S B;  3S9W A;  1V1O A;  2CQA A;  2R92 H;  4G7Z C;  1TY0 A;  1V1Q A;  2DUD A;  2XRS D;  2F52 A;  1V1P A;  4MTK A;  4NMZ A;  1NNX A;  4K5X A;  2JA9 A;  2EIF A;  4DR4 Q;  3BDC A;  1QE6 A;  3A8K E;  4ZK9 B;  4DR6 L;  2F0D A;  2OTJ A;  3D6W A;  1VQD A;  4U68 A;  2A68 C;  2BE5 D;  5IOC A;  1HJP A;  1SNQ A;  2K14 A;  4NW2 A;  3T1Y L;  4EQN A;  1LO5 D;  3KF8 B;  5HGT A;  2MQH A;  5IGD A;  5KEE A;  2FMM A;  3CQZ H;  4KY7 A;  1I6H H;  1IYV A;  4A3G B;  4DAY A;  1KAB A;  2M00 A;  3ONA B;  3I2Z A;  2XWJ B;  4RGO S;  4B9X A;  1EY5 A;  1NAP A;  3I8Z A;  3SHL A;  4QMG A;  3BVG A;  3RZO B;  1MGS A;  4HCE A;  2UUB Q;  3RZO H;  3RNU A;  5EAY A;  4CHT B;  4HR7 B;  1D2B A;  1KAA A;  4B3S Q;  1IL2 A;  4BXX H;  1YNN C;  4JYA L;  3EN2 A;  2JA6 B;  2EYJ A;  3MC0 B;  2UXC L;  2E2J B;  1OXT A;  5C44 H;  4ILW A;  3MTS A;  4X3T A;  4GN3 B;  3PUV A;  1A3T A;  4DNR B;  1XMO Q;  5EKL A;  5DM7 3;  5EQ0 A;  3HKZ E;  4JV5 Q;  5ISR A;  4DR7 Q;  1II3 A;  1TQO A;  1SNO A;  4PMW A;  1XMQ L;  4RGT A;  4FNF A;  4LF7 Q;  1XNR L;  3RLO A;  2EOT A;  2HHH L;  1LTG D;  1KDA A;  1SAP A;  1UE7 A;  2Z4H A;  5TSS A;  3NBI A;  4X64 L;  4A76 A;  3HOY H;  1EL0 A;  3R93 A;  5NUC A;  2NVY H;  3S1R H;  3S1Q H;  2OWO A;  1HUN A;  1EFW A;  4ZYS A;  1B8A A;  1JIC A;  4RCO A;  2RDH A;  3HP3 A;  2Z1C A;  1GVP A;  3Q6S A;  4JI5 Q;  4R4Q A;  2Q2T A;  5JJI A;  2CWA A;  4AQY L;  2XVS A;  4RHR A;  1OXV A;  1AW7 A;  2VQE Q;  5M3F B;  3MWY W;  1CHQ D;  2F0N A;  1RTN A;  4GZY C;  3OMC A;  2DJF C;  2RQX A;  1BCP C;  1L0Y B;  3VR5 A;  3ULL A;  1Y1V G;  2F3I A;  4LFC L;  1HTP A;  2JA5 G;  5CGK A;  2B2Y C;  4A3L H;  1BBX C;  2WIN B;  4A3B H;  2NYZ D;  1R4P B;  4WOR A;  3CCL A;  2JN4 A;  4U67 3;  2R3Z A;  3D31 A;  4C2M H;  5BN4 A;  2I0Q A;  2RCN A;  4PZ8 A;  1SYE A;  4RH6 A;  2F0W A;  3I73 A;  4KKT A;  2F0J A;  2F0O A;  4DV3 Q;  1TWF H;  4JI3 Q;  2A8V A;  2E76 C;  4DR3 L;  3TP8 A;  2RF4 A;  3S2H H;  4KI0 A;  1TU2 B;  5M5Y H;  3GTO H;  1AFP A;  5E3F A;  1D8L A;  2L11 A;  2PO4 A;  4OWT B;  1XPU A;  4P74 A;  5HUR A;  4RWS C;  1MBY A;  4DAM A;  3CXC A;  4BA2 I;  4DXG A;  3SR1 A;  5EKI A;  2A6E D;  1PZJ D;  1CTM A;  4OXP A;  1N36 L;  2OQ0 A;  4DKA C;  2A6E C;  2F3W A;  3A0J A;  5C5M A;  3TQY A;  5BN3 A;  2DN8 A;  3R2T A;  4POG A;  1GM5 A;  1H9S B;  1ICW A;  2E2D C;  1EYA A;  1LUZ A;  3GP7 A;  1CQF A;  3ERO A;  1BCP D;  3KDF B;  1IYJ B;  5BR8 L;  1QB5 D;  1QVG A;  4RFB A;  1DON A;  4FF4 A;  4PNY A;  4FVM A;  3CP0 A;  4JVZ A;  2EQS A;  1VQA A;  4IZ8 A;  3BZK A;  1BVS A;  4DV7 L;  3G71 A;  2NVX B;  2JJQ A;  4L5Q A;  5D3I B;  3NQT A;  3DM1 A;  4H7B A;  2JEB I;  4EX5 A;  4O42 A;  1BXT A;  1K3B C;  4N8X 1;  1I5F A;  5EBC A;  1GUS A;  1ESR A;  2H5X A;  3JAM E;  4QY7 A;  4N9P A;  3U4V A;  1XNR Q;  5A2Q L;  2LFN A;  2H1E A;  4GNX C;  1Y14 B;  2PYK A;  4R4C A;  4E6I A;  1LT3 D;  1SYC A;  3BVZ A;  3HOU H;  1DOK A;  4B3T Q;  3CCS A;  3T13 A;  1WTP A;  4FDB A;  1LT6 D;  3KBG A;  2JA8 G;  3R3O A;  1J5E L;  1Q12 A;  4EQO A;  1S5E D;  4IOA A;  3R2I A;  4R8N A;  4X3S A;  2MFI A;  4POF A;  2CWP A;  4HID A;  4A3I B;  1IBM L;  4AYB E;  3K8A A;  3S16 B;  5IP7 G;  2NUC A;  1PMR A;  1X3P A;  4GKK Q;  4QGU A;  2UUC Q;  2NZO A;  2IX0 A;  2WAQ B;  3BYT B;  4BY7 G;  3S1Q B;  4C56 C;  1I4P A;  2EYL A;  2JA6 G;  3H91 A;  4HSP A;  5C4X B;  3PO3 B;  1T9H A;  4B08 A;  1NUC A;  1G2S A;  3QO2 A;  4IPH A;  4IPC A;  1WI5 A;  1GUG A;  5FOB B;  3ER0 A;  4L6T B;  1IW7 D;  1HZA A;  1PYB A;  1KIX A;  5CMD A;  3JAM c;  1ZXT A;  3S17 B;  1G51 A;  2ZXR A;  4DR3 Q;  4BBS B;  3MXP A;  3F2C A;  4RMF A;  4A3G G;  1ASZ A;  1V1P B;  2E2J H;  5C4Z A;  1G6Z A;  2R7D A;  4FF1 A;  3I91 A;  1I50 H;  3A8J E;  2GVB A;  1JJ2 A;  2R6G A;  1AZP A;  3MXN B;  3CMA A;  4LFC Q;  2AWN A;  3ND9 A;  2RHQ B;  3VR3 A;  2PNR C;  1TT2 A;  2RCF A;  3OYY A;  1O80 A;  3FHW A;  4ZCK A;  4LAA A;  3A7L A;  4XQN A;  3S14 H;  1ET6 A;  1HNX L;  1K0R A;  3TP6 A;  4XXE A;  4A3L G;  3L7Z C;  1PH4 A;  1C48 A;  1KDC A;  4BS9 A;  3CAM A;  1I94 Q;  3HRZ C;  3OPO A;  4A3G H;  1WCM H;  1VQG A;  4IUQ A;  4K0K L;  1FNU A;  1A6X A;  3AFQ A;  1FGU A;  3P75 A;  1EEF D;  1MSH A;  5CV8 A;  2NZH A;  2CQO A;  1HR0 W;  5C0X H;  1CZG A;  4DFA A;  3STB C;  3I4M H;  1N32 L;  3IKJ A;  2I46 A;  1FNV A;  3U9O A;  5IGE A;  4DR1 L;  1QNU A;  3VYT A;  1WTQ A;  3ULJ A;  1EY6 A;  3Q23 A;  4OO1 I;  2OEO A;  3TDQ A;  4PV1 C;  4OGQ C;  4HJ7 A;  4O2D A;  1CK1 A;  1DXM A;  5IGG A;  5FLX L;  1DZ1 A;  4DV7 Q;  3J7A V;  2F4I A;  3K7A B;  5M5W B;  2B2W A;  1EFI D;  1DOM A;  3PMF A;  3D4D A;  2F0V A;  2F0Q A;  3W5O A;  3ZYY X;  2A1A A;  4A3D H;  5M5Y B;  2PI2 A;  2V4D A;  4LMQ D;  2VNU D;  1QNK A;  2J4X A;  3EIV A;  4IPG A;  2L1B A;  4EGV A;  4DNI A;  3QR8 A;  1UUP A;  1SDF A;  4R4T A;  4LUO A;  2ZM6 Q;  2BDN A;  2EXZ A;  2PW5 A;  3S2D H;  2VUM H;  1STN A;  4IUV A;  5C3E B;  2BOS A;  2A6H C;  2B3G A;  4IJL A;  1S40 A;  1Q81 C;  4YCV A;  1YZ6 A;  1X65 A;  4WJW A;  4BY1 G;  4Q5V A;  2KBN A;  1BCP F;  3VYS A;  2JK8 A;  3RLF A;  2F4V L;  3ERQ A;  4LWC A;  3OW7 A;  3QB3 A;  4OIK A;  4C3I B;  2UU9 L;  1BOS A;  2YU9 H;  4KN7 C;  2NN6 G;  4J15 A;  3M9B A;  3CPW A;  3M4P A;  1WTO A;  4GKK L;  2KCM A;  4RGN A;  1KLG D;  5C3E H;  3PIO A;  2VUM B;  4OX9 L;  2JE6 I;  2Q2U A;  3E9H A;  5DEH A;  4L63 B;  4UY8 C;  4BBR B;  4LW1 A;  2KJX A;  2Z0S A;  1LYL A;  3PIP A;  3TEH B;  1SE8 A;  2RSO A;  3JC6 6;  1KRT A;  2OT2 A;  1PH2 A;  2XSC A;  3FPU B;  4FF3 A;  3MFY A;  3AFP A;  1WOC A;  5EJW A;  3Q0A A;  1H9K A;  3E3X A;  4KMU C;  3GO5 A;  1JB3 A;  1PYS B;  2PQE A;  4G7O C;  5C4H A;  5JEA G;  1XJV A;  3EBE A;  1XNQ Q;  3BDL A;  4HJ8 A;  3OTO Q;  1CKM A;  3QOJ A;  1O7L A;  1L1O A;  1F9P A;  3U58 A;  2JYO A;  5KRU A;  1VQM A;  1HH2 P;  1BBW A;  3FKI B;  2HQE A;  4C1N I;  5CR3 A;  1TS4 A;  4P73 A;  2CHB D;  2PQA A;  1PTO B;  5JPN C;  3KLW A;  4ZAI A;  4A93 H;  1ENA A;  1RJT A;  2F0S A;  1EY4 A;  4X3U A;  1GOZ A;  3CCQ A;  4A3K H;  2L4N A;  5K36 G;  2EYM A;  1IHZ A;  2RVL A;  2L15 A;  2LY7 A;  2NTS A;  1STG A;  2K5V A;  4KN4 C;  1EIY B;  2TMP A;  2OXP A;  2NVY B;  3S1R B;  1YI2 A;  1NTG A;  3DWQ A;  5C5L A;  3DLL A;  5KND A;  1P8L A;  4YCU A;  2WAQ E;  1SFO B;  3A54 A;  3A55 A;  3UDX A;  1SMY D;  2GA4 B;  1KLU D;  4JI2 Q;  4IUP A;  1S5F D;  1XPO A;  4C3J B;  3PO2 B;  2Q8R E;  4I65 A;  4L5S A;  1TWC H;  3D4R A;  1KQS A;  2DY8 A;  2JQO A;  1I6H B;  1DJR D;  2F1M A;  1HQM C;  1STH A;  2HDM A;  4GLV B;  2KHJ A;  3ND8 A;  4P72 A;  1PRT B;  1JOQ A;  2MPM A;  3TZD A;  1N33 L;  3W1B A;  1Y1W H;  5CV6 A;  1S72 A;  3I72 A;  1WCM B;  1FNW A;  1C8C A;  3VR4 A;  1Q8I A;  1UWV A;  1FJG Q;  1NR4 A;  1JE5 A;  4I7A A;  1L0W A;  4RA8 A;  2XTI A;  3OHX C;  1YHQ A;  3EJI A;  4JI0 L;  5KYL A;  4F8M A;  2JA8 B;  4UDU C;  4V0B A;  1VQ6 A;  2L55 A;  3K80 C;  2F3V A;  2IHF A;  5C0X I;  1S3O A;  3F2U A;  1WD1 A;  3GTG B;  2K52 A;  2O5I C;  4LF6 L;  1TXY A;  1VMP A;  3G6E A;  2EYF A;  4PMB A;  3NTK A;  1W3S A;  1H9S A;  1JOR A;  2B2W C;  2B2Y A;  3SK8 A;  4BBS H;  4ZLT F;  3J80 c;  5M5X B;  2K32 A;  2HIX A;  1QJO A;  5IYB G;  1A2U A;  4PZ6 A;  2PPB C;  1XWE A;  3DHQ A;  3L9A X;  1YNJ D;  4NKL A;  3X3M A;  1KRS A;  2B29 A;  3G4S A;  3M3Y H;  1RL2 A;  4QJF A;  1I3Q B;  3O13 A;  3J81 j;  2YU9 B;  3HOV G;  4DR2 L;  3K6O A;  4DAV A;  1U4R A;  4DV4 Q;  5COR A;  1ZEQ X;  1LTR D;  3PUY A;  3DXJ C;  3H6M A;  4CDD C;  1CUK A;  4B3R Q;  1L1O B;  1TVX A;  2PI2 E;  1YVC A;  1EOT A;  4QIW B;  1N9W A;  4NXN Q;  4A3J B;  1SYG A;  5G3L F;  4A3I H;  1PVO A;  2SEB D;  1FL0 A;  5IY0 A;  2D0O A;  3GV3 A;  5C4J B;  3GTK H;  3F1Z A;  3ERS X;  4RCN A;  1EU3 A;  1JJC B;  1RIP A;  3G6J B;  3IFT A;  3G7L A;  3LGJ A;  2SDF A;  2DNE A;  1PFS A;  1PH7 A;  3NEL A;  5E4X A;  3VR2 A;  4V19 0;  1LTL A;  2AQ1 B;  4ZUI A;  1MHW C;  2ZJQ A;  4K8I A;  1KNA A;  2JXM B;  3V2T A;  4C3H B;  1HA5 A;  1M4V A;  4RHS A;  2LMC B;  5A2Q E;  2IY5 B;  1GKH A;  4A3M B;  2A6H D;  1CT1 D;  2EY1 A;  3MFG A;  4DV5 Q;  1TWH H;  1H9M A;  2VW9 A;  2BA0 A;  4DR5 Q;  5LMN W;  1BUV T;  1BCP B;  4KTA A;  4DV0 L;  1SNP A;  4MIU A;  1HUM A;  4KKU A;  4ALP A;  3PUZ A;  4JG2 A;  3K0X A;  1YBY A;  3LWE A;  3BG3 A;  1A3U A;  5D14 A;  4R4I A;  1PZK D;  1ILQ A;  2B2T C;  2ZTC A;  3K0Y A;  3PCO B;  5GAG C;  2GN5 A;  3S14 B;  4UPA A;  5C6A A;  1NMG A;  4JI4 Q;  1F9R A;  2CW0 D;  4OEL B;  1HNZ L;  3V96 A;  2VB3 X;  1TWH B;  1LLR D;  3J80 E;  1JOK A;  4HN7 A;  2FMC A;  2IX3 A;  4A3F B;  3S24 A;  3LX0 A;  4DK3 C;  3K59 A;  3I70 A;  4LK1 C;  2IJ0 A;  1CA5 A;  4UP7 A;  1BF4 A;  1D7Q A;  3I4M B;  2YTY A;  5KGU A;  1AH9 A;  4LF5 L;  2X69 A;  2B63 G;  1IBK Q;  4DV1 Q;  4GN4 B;  4GLX A;  2EYO A;  3P20 A;  1J6Q A;  1HZC A;  2KED A;  1UNS A;  5IGF A;  1I6V C;  4A3E B;  4PG3 A;  1I3Q H;  4JI6 Q;  2B8F A;  1I94 L;  4CJ2 C;  4OO1 H;  2HT1 A;  2F0U A;  2QDL A;  4NPS A;  4GN5 A;  2EY2 A;  1C4Q A;  4DK0 A;  3RN5 A;  3I4N G;  2N78 A;  1VQJ A;  4IUN A;  2YTV A;  5M3M B;  3K5L A;  2PZU A;  3T16 A;  4EVO A;  2BDO A;  3BDO A;  4LF9 L;  3Q8D A;  1CI3 M;  5JJL A;  1LV9 A;  2JA7 H;  2R93 B;  2CH4 A;  2JA7 B;  1EWH A;  2EJG C;  1IBL L;  2XNA C;  1QZH A;  5ELE A;  1MJE A;  2E2I H;  1L2F A;  1YNX A;  2XN9 C;  2F0H A;  4Q0F A;  3RR5 A;  2RHS B;  4CJ1 B;  1SEB D;  3HOY B;  4OO1 G;  2EYH A;  3T1Y Q;  1TS3 A;  4FXK C;  1I4H A;  5FLM G;  3SEB A;  1OTC A;  4X66 L;  1F77 A;  4ZQ3 A;  4K0K Q;  1TWG B;  5IT9 E;  2WKD A;  3TS0 A;  3OOC A;  1B44 D;  3GTJ B;  5A35 A;  1CQV A;  2VZA A;  5KIX A;  5DM6 3;  1EYG A;  1E2Z A;  2A68 D;  2MNA A;  1Q1E A;  5JPM C;  1F9S A;  3NWT A;  4HMJ A;  3UDI A;  3HOU B;  2NVQ B;  2L5T A;  1E22 A;  2ZM6 L;  4BBS G;  2IW3 A;  2Z6B A;  4DR6 Q;  4DUY Q;  1JWS D;  1VCI A;  3QIA A;  2LSS A;  1H9R A;  1YIJ A;  4JK1 C;  4K6D A;  1X6O A; 
#chains in the Genus database with same CATH homology
 2L9H A;  3E5S A;  3CRK C;  4HAE A;  3MEH A;  4KK7 A;  5FO7 B;  1PRT C;  1G29 1;  1VF7 A;  3BS1 A;  4O1N A;  2K03 A;  2B63 B;  1IKM A;  4FF2 A;  4P2C B;  3SXH A;  2EPB A;  2ZT9 C;  1SE2 A;  1WTW A;  1GUW A;  5LL6 S;  1OXX K;  5CV9 A;  4DK1 A;  1OXU A;  3N52 A;  1EU4 A;  4CJ0 B;  4DA2 A;  4NP5 A;  5I6W A;  2R92 B;  4KD3 A;  3WOE A;  4IAL A;  2K5D A;  5I4D A;  4XYQ A;  2WV6 D;  1Y8O B;  3GTK B;  2FJ2 A;  2B2U A;  3H94 A;  4IFD I;  1ENF A;  1D1I A;  5ELB A;  4F7X A;  1SSO A;  4TKO B;  4KHZ A;  3H0G B;  2A5H A;  3A8I E;  1MD2 D;  1K83 B;  2MGS A;  1Q3L A;  4UAI A;  1VMC A;  4XT1 B;  1Q90 A;  1SYF A;  1BO0 A;  1LAB A;  4KY5 A;  1EY7 A;  2G9D A;  4K8J A;  1G8Z D;  1Y69 U;  1I4X A;  2K6A A;  1ZYR D;  4IFD J;  3FVQ A;  4ZKC B;  2Z4I A;  1CZW A;  2ID0 A;  5EPJ A;  2QEJ C;  4LJZ C;  5JVG 3;  4QB4 A;  1WTX A;  1R9T B;  4FO2 A;  2NB0 A;  1I4R A;  1PYW D;  2EY6 A;  1LTB D;  4C2M B;  3J80 L;  1SBB B;  2KEC A;  1O7Z A;  1O7Y A;  4YIJ A;  1KTK A;  3NE5 B;  3HOX B;  3OMG A;  1STY A;  3WOF A;  5CV4 A;  3TZU A;  5IOD A;  3IL8 A;  5KNC A;  4Y7N B;  3KLS X;  4DF7 A;  3HOW B;  4MHE A;  4DGZ A;  4RGM A;  2ZXO A;  3KUP A;  4QUF A;  1PDQ A;  3IAY A;  4R9W A;  1EQV A;  3UI2 A;  2QIL A;  1LTI D;  1SYB A;  2KCC A;  4KD4 A;  5LL6 X;  2EYP A;  5JVH 3;  3CRL C;  1GJX A;  2PCF B;  3RUZ A;  2CVR A;  3NHH A;  2NVT B;  1F9Q A;  2AUJ D;  4K2K A;  1GHJ A;  1ESF A;  1EZ6 A;  3S15 B;  4FXD A;  1ML0 D;  1FD7 D;  1EEI D;  2NWG A;  2E2H B;  1EYD A;  1X3Q A;  1PTO H;  2A74 C;  3SK4 A;  3S1M B;  3MVV A;  2RDG A;  3KLR A;  2CW0 C;  4S3S A;  4TSS A;  1SJE D;  4ME5 A;  1H9J A;  1EIH A;  1FGB D;  4FP5 D;  4CBV A;  3VA5 A;  5G3L D;  3J7A F;  2BE5 C;  2MJ8 A;  1HFN A;  1EY8 A;  3A56 A;  2PZW A;  1JWU D;  1CA6 A;  1L0X B;  3BVM A;  1RD9 D;  1Z47 A;  3T51 B;  1PFN A;  1BDO A;  1EY9 A;  5ELF A;  5KYI A;  2XWB B;  1RKN A;  3GTQ B;  2C5C A;  2A73 B;  2K1B A;  2K28 A;  5AFW A;  3SK5 A;  1STA A;  1B53 A;  2B2V C;  2QF7 A;  3NSW A;  1K8M A;  3I4N B;  2F0M A;  1B9M A;  4WRD A;  2B39 A;  2QCP X;  1TR5 A;  3NBH A;  4IUR A;  5ELD A;  3R8B A;  3MHB A;  2BA1 A;  4XTC S;  2F0P A;  3HKZ B;  1SNC A;  1F2L A;  2ZXP A;  4KHV A;  1PTO D;  3D3R A;  4B9W A;  5FKA C;  3H09 A;  5M9O A;  2L0C A;  1JOO A;  5DAU A;  1GXD C;  4BY1 B;  5KNB A;  2N88 A;  4NDX A;  1AN8 A;  2EJM A;  3OWE B;  5JOB A;  4AYB B;  3Q24 A;  4QCL A;  4XYO A;  3J7Y W;  3QJY A;  3SDZ A;  1V8Q A;  1GHK A;  3EFX D;  2BCO A;  1AZQ A;  5IGC A;  3E0J A;  2L12 A;  3GTO B;  1VDZ A;  1XX8 A;  2IL8 A;  3VR6 A;  2VB2 X;  4XQQ A;  2WP8 J;  2IPK D;  1NR2 A;  1I4Q A;  1ROD A;  2KUM A;  4XDX A;  5FO9 B;  1EIG A;  1YNN D;  1A2T A;  5E1F A;  1LT4 D;  2WB1 B;  1I50 B;  2RDF A;  1AEX A;  1Y8P B;  1MI2 A;  2R61 A;  1JWM D;  3W2D A;  3C1F A;  2RBM A;  1E0B A;  5IT9 L;  4KKS A;  2MP1 A;  5K5P A;  1O78 A;  3TBI B;  2F0E A;  4IQZ A;  5EGT A;  1CM9 A;  2E74 C;  4IUU A;  3KK7 A;  2N55 A;  4I7Z C;  3S2H B;  2AQ3 B;  2FFK B;  3OSO A;  3GTL B;  2EJF C;  1JC7 A;  2KQ3 A;  1JQY D;  3U9S A;  3LNN A;  2FIN B;  4OIJ A;  2RSN A;  3NP8 A;  2AQ2 B;  3M4Y A;  2RA4 A;  3C2P A;  1PLF A;  2J7Z A;  3GTP B;  3C1E A;  3AMU A;  5JEA J;  2SOB A;  1D5M C;  3DEP A;  1NCV A;  3SVM A;  5JAV A;  2XIW A;  3DEO A;  4CGY B;  1FYC A;  1ONL A;  1B3A A;  1U4M A;  1BR9 A;  4DXF A;  4Z9C B;  1M8A A;  2F0T A;  2R7Z B;  3HGB A;  4OL7 A;  3KLS A;  4RAU C;  4XT3 B;  1ZYR C;  1D6E C;  2WKC A;  2O5J C;  2F0F A;  3MZ5 A;  5BN5 A;  1HQR D;  1HPC A;  3S1N B;  3CU7 A;  3PV0 A;  2B2U C;  3HEJ A;  3GD7 A;  1SND A;  4A3K B;  4DNT B;  4OHJ A;  4CKE A;  3HG9 A;  1EQT A;  4QF4 A;  1PFB A;  2QKI C;  1SJH D;  1LAC A;  4H44 C;  1B1Z A;  3C46 A;  3WDN A;  4KJO A;  2ENB A;  1DCZ A;  1TWC B;  2O4X A;  3EQL C;  2M9V A;  4XQJ A;  3M7G A;  3PUW A;  1CFM A;  4F87 A;  1LTA D;  2KA7 A;  5I9P A;  4N9T A;  1IYU A;  2PZT A;  2K5Q A;  2JEA I;  1SNM A;  5COY A;  3CQZ B;  3NQI A;  3HZX A;  1XYI A;  1B2T A;  2NN6 H;  4ZRZ A;  3T56 B;  3K5N A;  2DY7 A;  5T1G A;  1IKL A;  1STE A;  3NUC A;  3V05 A;  5I2Y A;  4M1U B;  5CBE E;  3TSS A;  1K8O A;  1BNZ A;  2J0T D;  3MXU A;  5CYU A;  3NK9 A;  4K2L A;  3H3V C;  1S5C D;  1I4G A;  2O2L D;  1EZ8 A;  4C3I G;  2B8G A;  3HS0 C;  1Y8N B;  2B2V A;  3KBX A;  1HTL D;  4J6H A;  4C1N K;  1HFG A;  5JEA H;  3IFD A;  4H0L C;  2Z8L A;  3S2D B;  1TWF B;  1PFM A;  1EWC A;  2SNM A;  1G91 A;  1Y1V B;  1TII D;  1QIL A;  3TP7 A;  5J39 A;  3HOV B;  1LTT D;  3MXN A;  4A3D B;  3BYY B;  4PMC A;  3RZD B;  2K01 A;  4A3B B;  3W3A A;  2DNC A;  1T5X D;  1R4Q B;  2HUG A;  5CV7 A;  3TP5 A;  4BA1 I;  2F0G A;  3L3O C;  3M3Y B;  4K14 A;  2X6L A;  3A7A B;  1S5D D;  5FK9 C;  1PXU A;  1RF2 D;  5C44 B;  3FDT A;  4J8Q A;  5EBD A;  3NTH A;  5FO8 B;  2JA5 B;  2KHS A;  2LKV A;  2OF1 A;  1QCB D;  3NXW A;  5EKK A;  1SXT A;  1SYD A;  5E4W C;  1J9O A;  5LHY 1;  3J81 E;  1PRT F;  2MUY A;  1LTS D;  1EY0 A;  1SMY C;  1JR0 D;  1BQQ T;  1WD0 A;  2NTT A;  2RKS A;  3QOL A;  4ODG A;  1HA6 A;  5D65 A;  1CHP D;  5K36 H;  1JCK B;  2EVB A;  3E6Z X;  4A93 B;  3DMU A;  4BWG B;  1V43 A;  1QG7 A;  3OWF A;  3JAM L;  1WTR A;  4KV6 A;  2HCI A;  1KNE A;  1SE3 A;  3DWA A;  4J1M A;  4HSV A;  4K6L A;  1U9R A;  4QUC A;  1RTO A;  3RD4 A;  2JP1 A;  4FYD A;  5C0X G;  3CHB D;  1A15 A;  4H13 C;  2VXW A;  3FEW X;  3FRP B;  2F03 A;  1T5E A;  1E2V A;  2KEE A;  4BY7 B;  3RMH A;  4TQU S;  1PRT D;  3K5O A;  1TKW B;  4IN3 A;  2IWH A;  1HHV A;  5EPL A;  1IL8 A;  5J22 A;  4ZUJ A;  5J1Z A;  3K58 A;  2NN6 I;  2EY5 A;  3FPP A;  3PUX A;  2NBF A;  4CKB A;  1ENC A;  4ID6 A;  4RKL A;  2D9U A;  3PIP 3;  3I3C A;  2EZV A;  2HDL A;  3AU7 A;  5FLX E;  2EDG A;  3NPP A;  4G4K A;  4ULL A;  4K5W A;  2F0L A;  3J81 L;  4C3H G;  1XTC D;  1PTO C;  4KJN A;  2B2T A;  3P1H A;  2IX1 A;  4DAP A;  2YYZ A;  1B9N A;  1W6J A;  1E2W A;  3X3N A;  3VYR A;  1OXS C;  2QDB A;  3LWU A;  2JSO A;  1TWA B;  1X32 A;  3T4A C;  4PQX A;  2AWO A;  4FXG C;  1ZKO A;  1STB A;  4G57 A;  3BZD B;  4XIG S;  1S5B D;  4R8I A;  2F0K A;  1EYC A;  3QG1 A;  3N6R A;  3D8G A;  1KDB A;  1GUN A;  3HOZ B;  3OIP A;  3CKI B;  2K33 A;  1SE4 A;  1U4L A;  1RDP D;  4F88 A;  1U4P A;  3TN2 A;  5I6Y A;  3DUZ A;  4M8A A;  1HRJ A;  3VA7 A;  3NTI A;  2X6G A;  3OIQ A;  5T1I A;  2KOL A;  5EPK A;  1TS5 A;  3Q22 A;  4IFD H;  2PW7 A;  1RCV D;  3GQB A;  4HTH A;  4IUT A;  4KY6 A;  1B50 A;  3SE0 A;  2K5W A;  5CV5 A;  4HCS A;  1RHP A;  1UAP A;  4HMI A;  5JJZ A;  3GV6 A;  5DNF A;  3I90 A;  1MSG A;  1QOH A;  3T53 B;  4IFD G;  5D3D A;  3ITP A;  4TRD A;  2KCN A;  1TY2 A;  2E2I B;  5C3X A;  2SNS A;  2G9H D;  1DM0 B;  1HXY D;  1JE4 A;  3K57 A;  5ELC A;  2K04 A;  2F0I A;  4K5V A;  2HCC A;  3KF8 A;  4JBW A;  1WVL A;  4DN4 M;  1B4O A;  3GTM B;  3PIO 3;  3D4W A;  4C3J G;  1IW7 C;  4ZKB B;  3M85 A;  2XRQ D;  2NZ1 D;  1Y1W B;  3EVQ A;  1Q1B A;  3MAQ A;  3FMC A;  1VF5 C;  1F2Z A;  3AB9 A;  5IGB A;  2KVM A;  2A69 D;  3QWN A;  1S4Z A;  1FR3 A;  1Z7T A;  1WTV A;  1XXG A;  1PZI D;  1UEA B;  5CC4 A;  3K5M A;  3MA2 B;  2AUK A;  1PTO F;  1DYQ A;  2IT1 A;  1ILP A;  1G2T A;  1GUO A;  4WFN 3;  5CBA E;  1LT5 D;  2EE1 A;  2E75 C;  1D5Z C;  1W6K A;  5C3W A;  3SK6 A;  2Q8T A;  5I9O A;  2PMZ B;  3TME A;  1NSN S;  3VYU A;  1F2Y A;  2K7V A;  1TS2 A;  3EA6 A;  3MXG A;  2K05 A;  2D2C C;  3D6C A;  5I2X A;  2FHT A;  4HED A;  5F2D A;  2ICI A;  2WII B;  2TSS A;  2A69 C;  4MN3 A;  1Z6H A;  3I4L A;  1AP0 A;  4G7H C;  3DWP A;  2C9O A;  1F2M A;  2MHV A;  1D1K A;  4L8J A;  1GUT A;  2D5D A;  1ET9 A;  4CKC A;  2Q8I B;  3URY A;  4DU9 A;  5C0X J;  1D5X C;  3M7N A;  1HCZ A;  1DOL A;  4ABN A;  2WAC A;  4RKB A;  2I07 B;  1OO9 B;  1YNJ C;  1DD2 A;  4X3K A;  2M2L A;  3NWS A;  4EQP A;  3C3L A;  1J8I A;  1A3V A;  5IIF A;  2LS0 1;  2ICE C;  2H4O A;  3M4O B;  1QWY A;  2D62 A;  3P7J A;  2Y0S B;  3S9W A;  1V1O A;  2CQA A;  4G7Z C;  1TY0 A;  2XRS D;  1V1P A;  4NMZ A;  4K5X A;  3BDC A;  1QE6 A;  3A8K E;  4ZK9 B;  2F0D A;  3D6W A;  4U68 A;  2A68 C;  2BE5 D;  5IOC A;  1SNQ A;  4NW2 A;  4EQN A;  1LO5 D;  5HGT A;  5IGD A;  5KEE A;  2FMM A;  4KY7 A;  1IYV A;  4A3G B;  4DAY A;  1KAB A;  2M00 A;  3ONA B;  2XWJ B;  4RGO S;  4B9X A;  1EY5 A;  1NAP A;  3I8Z A;  3SHL A;  4QMG A;  3BVG A;  3RZO B;  1MGS A;  4HCE A;  4CHT B;  4HR7 B;  1D2B A;  1KAA A;  1YNN C;  2JA6 B;  2EYJ A;  3MC0 B;  2E2J B;  1OXT A;  4ILW A;  3MTS A;  4X3T A;  3PUV A;  1A3T A;  4DNR B;  5EKL A;  5DM7 3;  5EQ0 A;  5ISR A;  1II3 A;  1TQO A;  4PMW A;  1SNO A;  4RGT A;  4FNF A;  2EOT A;  1LTG D;  1KDA A;  1SAP A;  2Z4H A;  5TSS A;  3NBI A;  1EL0 A;  3R93 A;  5NUC A;  1HUN A;  4ZYS A;  1JIC A;  4RCO A;  2RDH A;  3HP3 A;  2Z1C A;  3Q6S A;  2XVS A;  4RHR A;  1OXV A;  1AW7 A;  5M3F B;  3MWY W;  1CHQ D;  2F0N A;  1RTN A;  4GZY C;  3OMC A;  2RQX A;  1BCP C;  1L0Y B;  3VR5 A;  1HTP A;  5CGK A;  2B2Y C;  1BBX C;  2WIN B;  2NYZ D;  1R4P B;  4WOR A;  4U67 3;  2R3Z A;  3D31 A;  5BN4 A;  1SYE A;  4RH6 A;  2F0W A;  3I73 A;  4KKT A;  2F0J A;  2F0O A;  2E76 C;  3TP8 A;  4KI0 A;  1TU2 B;  1AFP A;  5E3F A;  2L11 A;  2PO4 A;  5HUR A;  4RWS C;  1MBY A;  4BA2 I;  4DXG A;  3SR1 A;  5EKI A;  2A6E D;  1PZJ D;  1CTM A;  2A6E C;  2F3W A;  5C5M A;  5BN3 A;  2DN8 A;  3R2T A;  1H9S B;  1ICW A;  2E2D C;  1EYA A;  3GP7 A;  1CQF A;  3ERO A;  1BCP D;  1QB5 D;  4RFB A;  1DON A;  4FF4 A;  4PNY A;  4FVM A;  4IZ8 A;  2NVX B;  5D3I B;  3NQT A;  3DM1 A;  4H7B A;  2JEB I;  4O42 A;  1BXT A;  5EBC A;  1GUS A;  1ESR A;  3JAM E;  4N9P A;  5A2Q L;  2LFN A;  2H1E A;  2PYK A;  4E6I A;  1LT3 D;  1SYC A;  3BVZ A;  1DOK A;  3T13 A;  1WTP A;  1LT6 D;  3KBG A;  3R3O A;  1Q12 A;  4EQO A;  1S5E D;  3R2I A;  4R8N A;  4X3S A;  4A3I B;  3S16 B;  2NUC A;  1PMR A;  1X3P A;  2IX0 A;  2WAQ B;  3BYT B;  3S1Q B;  4C56 C;  1I4P A;  2EYL A;  3H91 A;  4HSP A;  5C4X B;  3PO3 B;  4B08 A;  1NUC A;  1G2S A;  3QO2 A;  1GUG A;  5FOB B;  4L6T B;  1IW7 D;  5CMD A;  1ZXT A;  3S17 B;  2ZXR A;  4BBS B;  3MXP A;  1V1P B;  5C4Z A;  1G6Z A;  4FF1 A;  3I91 A;  3A8J E;  1AZP A;  2R6G A;  2AWN A;  3ND9 A;  3VR3 A;  2PNR C;  1TT2 A;  1O80 A;  4LAA A;  3A7L A;  4XQN A;  1ET6 A;  3TP6 A;  4XXE A;  3L7Z C;  1C48 A;  1KDC A;  4BS9 A;  3HRZ C;  3OPO A;  4IUQ A;  1FNU A;  1A6X A;  3P75 A;  1EEF D;  1MSH A;  5CV8 A;  5C0X H;  1CZG A;  4DFA A;  3IKJ A;  2I46 A;  1FNV A;  3U9O A;  5IGE A;  1QNU A;  3VYT A;  1WTQ A;  1EY6 A;  3Q23 A;  4OO1 I;  2OEO A;  3TDQ A;  4PV1 C;  4OGQ C;  1CK1 A;  1DXM A;  5IGG A;  5FLX L;  1DZ1 A;  3J7A V;  2F4I A;  3K7A B;  5M5W B;  2B2W A;  1EFI D;  1DOM A;  3PMF A;  3D4D A;  2F0V A;  2F0Q A;  3ZYY X;  5M5Y B;  4LMQ D;  2V4D A;  2VNU D;  1QNK A;  2J4X A;  2L1B A;  4EGV A;  1UUP A;  1SDF A;  2BDN A;  2EXZ A;  2PW5 A;  1STN A;  4IUV A;  5C3E B;  2BOS A;  2A6H C;  4WJW A;  4Q5V A;  3VYS A;  1BCP F;  3RLF A;  3ERQ A;  3OW7 A;  3QB3 A;  4OIK A;  4C3I B;  1BOS A;  4KN7 C;  2NN6 G;  1WTO A;  4RGN A;  1KLG D;  2VUM B;  2JE6 I;  5DEH A;  4L63 B;  4BBR B;  2KJX A;  2RSO A;  2OT2 A;  2XSC A;  3FPU B;  4FF3 A;  3MFY A;  5EJW A;  3Q0A A;  1H9K A;  4KMU C;  3GO5 A;  1JB3 A;  2PQE A;  4G7O C;  5C4H A;  5JEA G;  3BDL A;  3QOJ A;  1O7L A;  1F9P A;  2JYO A;  5KRU A;  3FKI B;  2HQE A;  4C1N I;  5CR3 A;  1TS4 A;  2CHB D;  1PTO B;  5JPN C;  4ZAI A;  1ENA A;  1RJT A;  2F0S A;  1EY4 A;  4X3U A;  1GOZ A;  2L4N A;  5K36 G;  2EYM A;  1IHZ A;  2RVL A;  2LY7 A;  2NTS A;  1STG A;  4KN4 C;  2TMP A;  2OXP A;  2NVY B;  3S1R B;  3DWQ A;  5C5L A;  5KND A;  1SFO B;  3A54 A;  3A55 A;  1SMY D;  2GA4 B;  1KLU D;  4IUP A;  1S5F D;  4C3J B;  3PO2 B;  2Q8R E;  4I65 A;  3D4R A;  2DY8 A;  1I6H B;  1DJR D;  2F1M A;  1HQM C;  1STH A;  2HDM A;  3ND8 A;  1PRT B;  1JOQ A;  2MPM A;  3TZD A;  5CV6 A;  3I72 A;  1WCM B;  1FNW A;  1C8C A;  3VR4 A;  1Q8I A;  1NR4 A;  4RA8 A;  3OHX C;  3EJI A;  5KYL A;  4F8M A;  2JA8 B;  4UDU C;  4V0B A;  2L55 A;  2F3V A;  5C0X I;  3F2U A;  1WD1 A;  3GTG B;  2O5I C;  1VMP A;  2EYF A;  4PMB A;  3NTK A;  1H9S A;  1JOR A;  2B2W C;  2B2Y A;  3SK8 A;  4ZLT F;  5M5X B;  2K32 A;  1QJO A;  2PPB C;  1A2U A;  1XWE A;  3DHQ A;  3L9A X;  1YNJ D;  4NKL A;  3X3M A;  1I3Q B;  3O13 A;  2YU9 B;  3K6O A;  4DAV A;  1U4R A;  5COR A;  1ZEQ X;  1LTR D;  3PUY A;  3DXJ C;  3H6M A;  1TVX A;  1EOT A;  4QIW B;  4A3J B;  1SYG A;  5G3L F;  2SEB D;  3GV3 A;  5C4J B;  4RCN A;  1EU3 A;  3G6J B;  3IFT A;  3G7L A;  2SDF A;  2DNE A;  5E4X A;  3VR2 A;  4V19 0;  2AQ1 B;  4ZUI A;  4K8I A;  1KNA A;  2JXM B;  3V2T A;  4C3H B;  1HA5 A;  1M4V A;  4RHS A;  2LMC B;  5A2Q E;  4A3M B;  2A6H D;  1CT1 D;  2EY1 A;  3MFG A;  1H9M A;  2BA0 A;  1BUV T;  1BCP B;  4KTA A;  1SNP A;  4MIU A;  1HUM A;  4KKU A;  3PUZ A;  3LWE A;  3BG3 A;  1A3U A;  5D14 A;  1PZK D;  1ILQ A;  2B2T C;  3K0Y A;  3S14 B;  5C6A A;  1F9R A;  2CW0 D;  3V96 A;  2VB3 X;  1TWH B;  1LLR D;  3J80 E;  1JOK A;  4HN7 A;  2IX3 A;  2FMC A;  4A3F B;  3LX0 A;  3K59 A;  3I70 A;  4LK1 C;  2IJ0 A;  1CA5 A;  1BF4 A;  3I4M B;  5KGU A;  2X69 A;  2EYO A;  3P20 A;  2KED A;  1UNS A;  5IGF A;  1I6V C;  4A3E B;  2B8F A;  4CJ2 C;  4OO1 H;  2F0U A;  2EY2 A;  1C4Q A;  4DK0 A;  4IUN A;  5M3M B;  3K5L A;  2PZU A;  3T16 A;  4EVO A;  2BDO A;  3BDO A;  1CI3 M;  1LV9 A;  2R93 B;  2JA7 B;  1EWH A;  2EJG C;  2XNA C;  5ELE A;  2XN9 C;  2F0H A;  4Q0F A;  4CJ1 B;  1SEB D;  3HOY B;  4OO1 G;  2EYH A;  1TS3 A;  4FXK C;  1I4H A;  3SEB A;  1F77 A;  4ZQ3 A;  1TWG B;  5IT9 E;  2WKD A;  3OOC A;  1B44 D;  3GTJ B;  5A35 A;  1CQV A;  5KIX A;  5DM6 3;  1E2Z A;  2A68 D;  3HOU B;  1Q1E A;  1F9S A;  3NWT A;  4HMJ A;  5JPM C;  2NVQ B;  2L5T A;  2IW3 A;  1JWS D;  1VCI A;  3QIA A;  1H9R A;  4JK1 C;  4K6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...