1ILPA

Cxcr-1 n-terminal peptide bound to interleukin-8
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
b'AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTERLEUKIN-8 PRECURSOR)
publication title Structure of a CXC chemokine-receptor fragment in complex with interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ilpA00
4UAIA 5JJZA 3DM1A 4R9WA 2EPBA 2KOLA 1ILPA 2B2VA 1DOLA 4OIKA 4IUUA 1HUNA 4IUPA 3N52A 2FJ2A 4IUQA 1KNEA 1MI2A 4X3KA 1U4LA 4U68A 1AP0A 2KEEA 1ICWA 1F9QA 1U4PA 2KEDA 3IL8A 1J8IA 1G6ZA 3FDTA 2D9UA 4HEDA 1CM9A 2L1BA 3P7JA 5CMDA 3GV3A 3Q6SA 1Q3LA 2EOTA 2FHTA 1S4ZA 1EIGA 4HSVA 5EPJA 4DN4M 1WTOA 1ESRA 1G91A 1PFBA 2B2VC 2X69A 3KUPA 2MGSA 2H1EA 1VMCA 5D14A 1WTQA 1WTVA 1AZPA 2HCIA 5CORA 1CA5A 1HA6A 1C8CA 1U4RA 3F2UA 3I3CA 1BBXC 4ZK9B 2HDLA 2HCCA 1EL0A 1RODA 2RSOA 1EQTA 5T1GA 4X3SA 3D6WA 4XDXA 2BDNA 5EKIA 1O80A 3H91A 1HHVA 2B2YC 2HDMA 1GUWA 4CJ1B 1G2SA 2RSNA 1IKLA 1F9RA 3HP3A 1QE6A 2RA4A 5EJWA 4RAUC 1DZ1A 1HRJA 2B2UA 1WD0A 1RTOA 2B2WA 2MPMA 1WD1A 1MSHA 1PDQA 1BO0A 2HUGA 3QO2A 4XT3B 1F9SA 3DEPA 5D65A 1G2TA 4ZKCB 2L4NA 3LWEA 2L11A 2JYOA 2B2TA 1HUMA 1HFNA 1WTXA 3G7LA 1LV9A 4CJ0B 1PLFA 2Q8TA 3I90A 3MTSA 2B2YA 5E4WC 1SSOA 2B2UC 2J7ZA 2B2WC 2N55A 4IURA 1F2LA 2DY7A 3ONAB 2R3ZA 2K03A 2K1BA 2NWGA 3I8ZA 1M8AA 4HAEA 5EPLA 3R93A 2KVMA 1ML0D 1NR4A 2B2TC 5DNFA 1B4OA 1JE4A 4CJ2C 2FFKB 1PFMA 5AFWA 1DOMA 2KECA 2L12A 2FINB 2JP1A 1SDFA 4IUVA 1DOKA 5E4XA 1WTWA 1ILQA 4MHEA 1O7ZA 4RA8A 2L9HA 3MWYW 2FMMA 2IL8A 4X3TA 1BF4A 1EIHA 1IKMA 1MGSA 1NCVA 1DONA 4NW2A 1VMPA 1B50A 1NR2A 1F9PA 1NAPA 4X3UA 1TVXA 4LMQD 4ZAIA 2VXWA 2SDFA 1X32A 2K28A 4HCSA 3DEOA 5COYA 2XIWA 1X3QA 3SVMA 1B3AA 4QUCA 1BNZA 1MSGA 2DY8A 4IUTA 2K05A 4XT1B 2X6LA 1XYIA 3UI2A 4OIJA 1AZQA 2K01A 2NZ1D 1WVLA 2NYZD 5EQ0A 3I91A 1O7YA 1XX8A 1IL8A 1SAPA 3TZDA 3FPUB 5CBEE 2M2LA 1ZXTA 1E0BA 2X6GA 1PFNA 5CBAE 1EOTA 1QG7A 4RWSC 1WTPA 5EPKA 1RJTA 4ZKBB 1A15A 2EE1A 2K04A 2MJ8A 2N88A 3IFDA 1KNAA 3TN2A 5T1IA 4ZLTF 4R8IA 4MN3A 1CA6A 2RVLA 1J9OA 1X3PA 1RHPA 2Q8RE 3KBXA 1JICA 3GV6A 1WTRA 1RTNA 2MP1A 1B2TA 2CVRA 4QUFA 1HFGA 4O42A 1U4MA 1QNKA 2KUMA 1B53A
chains in the Genus database with same CATH superfamily
3DM3A 4BBRB 4BBSG 2E74C 5BR8L 5JVG3 3H6MA 3VYTA 3CRKC 1Q86C 3STBC 1VQPA 2Y0SG 1JOKA 2Z6KC 1I3QB 4L5TA 2QA4A 1NJIC 2KBNA 4HSVA 1TWCB 1QUQA 1UE6A 2AWOA 3BU2A 2JA6H 1JQYD 3OMCA 4PZ7A 2EY5A 3M3YH 4R4OA 3J7YW 2NVXB 2HDLA 1VQ5A 3RLNA 4ZYSA 4YY3Q 2KCTA 2JA8B 1G51A 2K33A 3HOVG 1BXTA 5EJWA 1V1OA 4I7ZC 1DZ1A 5CV9A 5C0XJ 2GVBA 5DAUA 2EYFA 3K0XA 3R2IA 5EBCA 3DEPA 2EDGA 2SOBA 3OPOA 4GN3B 3BYYB 4KD4A 3A5UA 2Q2IA 1HUMA 2VQFL 4XTCS 4X6AH 1IXRA 2KCNA 3GTGB 4JI0L 1TWHH 3EVQA 4IURA 2DY7A 3S14H 1L2FA 2CH4A 1NE3A 4K2LA 5EPLA 1M8AA 1ZYRC 4DPGA 4L6TB 1B8AA 4CJ2C 1XNRL 1JE4A 4YIJA 3CCEA 3S1NH 3SR1A 3QIAA 3TS0A 4JC0A 4A93B 4LF6L 1Q90A 1O7ZA 1PTOC 4RMFA 5M3MH 1SYFA 3S16H 1LT6D 4RH6A 2IX1A 1NCVA 3RR5A 3CCUA 1HNZL 2OWOA 1TR5A 5C0XI 3HOWH 4CBVA 3PO3B 2RBMA 1JB7A 3NELA 4BS9A 4FF4A 1LTGD 2E2IB 1EIFA 4JG2A 4JI7L 3RZOB 1EQQA 5COYA 1S3OA 4XXEA 5FLXE 4X66Q 1QB5D 3UDIA 4MTKA 2K01A 3F2CA 5EQ0A 4DK6C 2K14A 4A3MG 1HZ9A 2V4DA 2PO4A 1XMOL 2M2LA 2C5CA 4IFDG 3N6RA 1QG7A 4HSPA 4JV5Q 4QB4A 3S2DB 2R93G 3K7AB 2QF7A 1PH3A 2RVLA 1LACA 4JI1L 2NTSA 1RTNA 4FF1A 4DR2L 1STNA 4R4CA 2N8NA 2DUDA 5JJZA 1V1QA 4JI8L 1N36Q 3WWVA 4ILWA 5FO9B 4KK7A 5KNCA 1PRTD 4IUPA 3CD6A 4IUQA 4A3BG 3HGBA 1JC7A 4KV6A 3HFZB 1CTMA 4CKEA 1EWCA 1CI3M 3FKIG 3K5OA 5C5MA 4DFAA 5LMUQ 2D9UA 1HR0W 1G6ZA 5CMDA 1GM5A 2FHTA 1S4ZA 3NPPA 1YHAA 4ULLA 1M4VA 1WTVA 2F3WA 5IODA 1PFSA 4G57A 1X56A 1D1KA 2QGQA 2UUBQ 4QL5A 2HCCA 2YTYA 4LF4Q 3W5OA 4HJAA 1HA5A 1KC8C 4V190 3QOJA 3OW7A 1YJNA 4B3SQ 1JJGA 4GNXC 3CF5A 4FVMA 1BKBA 2AUJD 1Y69U 1BO0A 3SK8A 1XJVA 3DMUA 1A3UA 3IFTA 2KENA 5KGUA 4WJ4A 4N8X1 2NVTH 5ELNA 2BA0A 4ZQ3A 5M5XB 5C44B 1Q1EA 3HOUG 2LKVA 1SFOH 2JEBI 4LWCA 1PTOB 2BCOA 5ELOA 5FLXL 5JJKA 1FNUA 2Z0SA 1NUCA 2B8FA 4FXKC 3HOZH 1D8LA 1PH1A 1AE3A 5I6YA 2XTIA 3VDYA 1H9KA 3SVMA 2VB2X 4IUTA 4EGVA 2NZ1D 1H9RA 2B39A 1SE2A 4DV6Q 4A93G 5LMNQ 5FOBB 2Q8IB 4X65Q 3NXWA 1U9RA 2HT1A 1AN8A 2PCFB 2K5VA 4HMIA 4C3JB 1EFWA 4P71A 1VQNA 2PYKA 2A19A 2JN4A 4A3KH 3C2PA 3TSSA 1U4MA 3S24A 3GTKH 4IFDJ 2WFWA 2B63B 1Q46A 3HOXB 2KOLA 4PMWA 2MFIA 3ERQA 1S40A 4JW0A 3U4VA 2ZJRA 1SYEA 5IP9G 2JA6G 3M4OB 1MI2A 1BQQT 2BE5C 3BVMA 1CKMA 3V2TA 4B9WA 1ESFA 1ESRA 3NK9A 1HTPA 1E7ZA 5IOCA 1LYLA 1MIUA 4A3DH 2UUAL 5IGCA 4DV7L 1TWAH 3TP8A 4DK0A 2CWAA 3QWNA 4GNXB 4DR7L 4R4QA 2B2YC 2K5NA 3QB3A 4U673 2A69C 1LLRD 5IGGA 4H13C 1AE2A 1VDZA 4PMCA 3OTOL 4JI0Q 1X9NA 2FMCA 5D65A 3Q0AA 2RQXA 1JCKB 4K14A 2Q2HA 2JYOA 3GTLH 2NB0A 1PA6A 2JE6I 2B2YA 5E4WC 3CHBD 4A3FG 3GTPB 1Q12A 1Y8OB 3FMCA 1S5FD 2LFNA 3HOWG 2B2TC 3ER0A 3A8JE 1YEZA 5HGQA 1WTXA 2KECA 2Q2TA 4MHEA 1STBA 4YWKA 1V1PA 4R4IA 4CDFC 4RKLA 1IYVA 5IGBA 4PNYA 1GUSA 3S1QB 4X62L 1X32A 3D0FA 4BY1H 1X3QA 1XYIA 5GADC 3TZUA 1G8ZD 4P2CB 2F0WA 5CV6A 1IL8A 2EYHA 3UE1A 5K36H 2RHSB 4BY7B 3MVVA 1EQRA 1I94L 5FK9C 3T1YQ 1WTPA 2R7ZH 5IYDH 5ELBA 3NP8A 4AQYQ 1MJCA 4A3JG 2E2HH 2MJ8A 3I70A 2A1AA 1RHPA 3AMUA 1BR9A 2L15A 1VQBA 2PZWA 1SR3A 4LFAL 2VUMB 1UAPA 3HEJA 3IRBA 4UAIA 2V1CC 1CQVA 5JAVA 4HIMA 4JI6L 2CHBD 5IYBG 1PYSB 2HQLA 1ASZA 3CCVA 4DGZA 1AP0A 2PW7A 1QCBD 4A76A 2C9OA 4DV5L 3BVGA 1VQLA 1D1IA 4RGNA 1A6XA 2A5HA 4C2MB 2HIVA 1D7QA 5AJ3Q 1HA6A 3V05A 2B63G 2HD3A 3R8BA 3HOXG 3PO2H 2F0PA 2I5LX 3PSIA 1BCPC 3J7A5 4JBWA 3SK4A 1PRTF 3W1BA 2JA5B 4NB3A 4CHTB 3PUVA 1EUJA 1NBWA 3A54A 4DR6Q 1RF2D 2RSNA 4IJLA 4DNRB 2B2UA 3VA7A 1QZHA 2B2WA 1WYDA 2WAQB 2GA4B 5CGKA 1EY0A 4IQZA 4WJ3M 1VQEA 1X3GA 1IW7D 2VL6A 2MO1A 3H3VC 2YYZA 4FO2A 5I9OA 3BZCA 1HTLD 2UU9Q 3MC0B 2PZUA 1AW7A 3A7AB 2PNHA 4NXMQ 3SHLA 2IWHA 3T51B 1ML0D 2QDLA 1CT1D 3HOZG 1IBKL 5KNBA 4CDDC 1DOKA 2FMMA 3I56A 1MGSA 1JWSD 5C4JB 3GTMB 1STGA 4YY3L 2BA1A 1B9NA 2QEJC 3PIOA 5HY6A 1GUGA 2VXWA 3PUZA 5D3DA 5IP7H 2EY1A 1GHJA 2WKCA 3RZDH 5ELDA 1BDOA 3BDOA 4JBJA 1M1KC 1KQSA 4WJWA 1O7YA 3GTJH 2QILA 3LX0A 2ZXPA 4JI2Q 1BOSA 4NKLA 4ZKBB 1CFMA 2N88A 2WACA 3IFDA 4R8IA 2R92G 2EY2A 1RL2A 2MP1A 2WB1B 1HFGA 1Y8NB 5CV5A 1HQMC 1VQDA 4YWMA 2SEBD 5EKLA 1R9TB 4BY7G 4DNIA 3A8IE 3T1HQ 2PPBC 4BBSB 1YNJC 1VQFA 4X3KA 5M5WB 4A3DG 3EROA 3STBD 1U4PA 4A3GB 3KJOA 4OEMB 1CM9A 1Q3LA 1KHIA 4DR5Q 1G91A 3VR3A 2XSCA 5C4ZA 2NVYH 2Y0SB 3PIO3 4RHRA 2A68C 4LF7Q 1TKWB 3I72A 5KEEA 1JE5A 4J1MA 1N32Q 1BCPB 2EYMA 1X55A 1EIYB 1I4XA 4JV5L 1RODA 4XIGS 4LF9Q 1YIJA 3H09A 3I4MG 1O7IA 1HHVA 3UDXA 3U9OA 4G7ZC 2AKWB 4QIWE 1XTDA 4S3SA 4RAUC 2YV5A 1G291 1R4PB 5EKKA 1I4HA 2VS1A 3D4WA 1Y8PB 1N36L 4HJ8A 1RCVD 2L4NA 4GZYC 4HR7B 3SEBA 1G6PA 3PGZA 3MTSA 5LMUL 2JA5G 3FPPA 5FLMH 3I4OA 4M8AA 1HR0Q 1S5ED 5M5YB 1ZYRD 5DNFA 1B4OA 3JAMi 4RCOA 4LF5Q 1LTBD 4L5RC 1Z6HA 4O2DA 2NVQH 4BY1G 3PUYA 2L9HA 4UP7A 2IL8A 4L5SA 2UUBL 3J81i 1EIHA 1PTOD 3FHWA 4LF4L 1F9PA 1P16A 2VQEQ 4B3SL 3RN5A 4JK1C 1QILA 2E2JB 3CPWA 2NBFA 2Z1CA 5IGDA 3CCQA 2JXMB 5IT9E 3CU7A 2RDHA 2CQAA 1K8AC 5FLXc 3FPUB 1PH4A 2F03A 4A3MB 3S15B 3G48A 4KY7A 4DV4Q 5JOBA 4POGA 3D31A 2CW0C 1WFQA 1ICFB 3I55A 4RG1A 2EIFA 1BBWA 3DM1A 1T9HA 3TP6A 4FNFA 1OXUA 4CDCC 4K5XA 2B2VA 4H02A 1VCIA 2F0QA 1KABA 2WINB 1SYGA 2EZVA 4BWGB 2JK8A 2AUKA 4GLAC 4B3RL 2R7DA 3KJPA 2E5LQ 2EOTA 1JJCB 3FKIB 3O13A 4A3CH 4KD3A 1VMCA 4XQNA 5BN3A 4DV6L 2HCIA 3KLRA 5LMNL 2F0KA 3J7ZC 1HCZA 5KYLA 1Y14B 4X65L 4UY8C 1LABA 3T4AC 1S5CD 4OWXB 4OL7A 1KLGD 3BZKA 2L55A 3D6WA 4GKJQ 1AEXA 5DLQE 4RFBA 4A3GG 1O80A 3H0GB 1DJRD 2HDMA 2MO0A 4NMZA 5GAEC 2NN6H 5C4XH 1LT3D 1ZKOA 3OIPA 4XYOA 1XPUA 3E0JA 2F0VA 3VR6A 1YZ6A 5K5PA 3UDGA 2BDOA 1IBKQ 4GS3A 3S17B 1GKHA 4IOCA 1F2YA 4OWTB 4TRDA 1EY4A 3QOLA 4DF7A 1PZKD 2KVMA 1F77A 5JEAJ 3PF4A 3I4LA 5FKAC 3F2BA 3CQZB 2EXDA 3HOUB 2UXCQ 4LK1C 5IP7G 2D62A 1D5MC 1WTHA 4RA8A 3I2ZA 3SK6A 5IT9L 1SNOA 4K0KL 4EQPA 1DONA 2JEAI 5I4DA 4A3LH 2KHJA 1NR2A 2R6GA 2OEOA 4X3UA 3HOYG 2K28A 4LUOA 1K28A 2OQKA 4KN4C 5JJIA 1BNZA 2ATWA 1KRSA 1CKOA 1Z9FA 4LFCL 2ZTEA 3J80L 1AFPA 3GTOH 2N3SA 4A4IA 5C3EH 3G4SA 1EOTA 2EVBA 2YU9H 3VR2A 1CA6A 1TT2A 4A75A 2IHFA 3LGJA 4MN3A 3RMHA 3K80C 4Y7NH 3C3LA 3PUXA 3EFXD 2CVRA 4CGYB 4KHZA 2TMPA 1XWEA 4MTNA 4TSSA 4C3IH 2JA7H 1YHBA 2EPBA 1DGSA 4Y52H 1KNEA 3ND8A 1EEFD 1K9MC 3D4DA 1VQ7A 1UUPA 1J8IA 2JA6B 2BE5D 3GTQH 2K5WA 1ASYA 3M3YB 1K83H 2E76C 2E75C 1PFBA 1LO5D 3F8TA 3E6ZX 2B8GA 2GN5A 4EQ5A 5A35A 1U4RA 3F2UA 1SMXA 1QUQB 3T1YL 4IJHA 4G4KA 3K5MA 4FXGC 4KN7C 4AQYL 1YVCA 1SE3A 2F4IA 3CRLC 1SE8A 1E1TA 4DV1Q 1SYBA 4RGTA 3J81E 2PI2A 4DNTB 1VQCA 2F0LA 5FJ8G 2A69D 3NE5B 1MSHA 2EYLA 5FLMG 1PZJD 1TWHB 4K5WA 1EY9A 1GUTA 2M00A 3S14B 2LSSA 4WFN3 3MA2B 3L7ZC 2N78A 2MHVA 4IPGA 3TP7A 3RN2A 4KLKA 1TS3A 3H0GG 3S16B 4A3FB 3UDFA 5G3LD 1QZGA 4ZRZA 5AJ3L 1EOVA 1PZID 4K6LA 3HOWB 2DNCA 2HHHQ 4CDEC 1J5EL 1W2BA 1TS4A 2K5QA 3NTHA 4N9TA 3HZXA 1B50A 2RDGA 1CUKA 4DR6L 4DV2Q 2OQ0A 1FR3A 1PXUA 4L5QA 4C3JH 4GKKQ 1JWUD 1N8RC 2K75A 4ZCKA 3W2DA 3CCSA 2WKDA 5E1FA 2UU9L 1PTOF 1PH5A 3CCLA 2L5TA 4QJFA 3HG9A 1A15A 4NXML 5CC4A 2AQ2B 1OXSC 1FL0A 1NMGA 4OO1G 2Z4HA 2ICIA 2F0IA 4A3JB 1K0RA 1CKNA 4BXXH 1GXDC 4JI3Q 3MEFA 3IKJA 4B3RQ 2OTLA 2K4KA 3ZYYX 2A73B 4J6HA 4R9WA 4AYBE 1DOLA 4OIKA 1HUNA 1JMCA 3AFPA 2O5JC 1D5ZC 4U68A 1F9QA 3DWQA 3CC4A 1Y1VH 2EQSA 2K5HA 1S72A 2X69A 2IY5B 1KIXA 3MFGA 3TEHB 1XPRA 2MUYA 2LXJA 2NN6G 5J39A 3KLSX 2I0QA 4JI2L 1EL0A 2IW3A 1BCPD 2A6HC 1A0IA 1HNWL 1YHQA 1IL2A 3NENA 1GUWA 1I6HH 1YJWA 1H9JA 5C3WA 1LT5D 1SEBD 1WD1A 2NVTB 2I46A 2Z6BA 3KF8A 3T1HL 5HGTA 3B6YA 4AIMA 4HJ5A 3TDQA 1SFOB 4C1NI 3AEVA 1OXXK 2R3ZA 4NP5A 4K0KQ 2NWGA 4MZ9A 4DR5L 3GD7A 4A3LG 2EJFC 3QR8A 2CCZA 1S5BD 4LF7L 4IFDI 4B3TQ 1SDFA 5I6WA 1ILQA 3HOZB 4C56C 1N32L 4R4TA 2RF4A 2RHQB 3OSOA 1FGBD 1E24A 4LF9L 4LFCQ 2A74C 1VQ4A 1CK1A 1JWMD 2JA9A 4YHHQ 4DUZQ 5C3EG 2XIWA 4FDBA 5M3MG 4QY7A 3KF6A 3L2PA 3G6EA 5A2QE 3S2HH 4LFBQ 1IBMQ 1CKNB 3TZDA 1V9PA 5CBEE 4X64Q 4GN5A 1WCMH 4C3IG 4DK3C 2JA7G 2PW5A 3DUZA 1HR0L 4C3HH 2F1MA 4A3EH 3GTKB 3KBXA 4LF5L 4HN7A 2R92B 1JORA 1VF7A 4JI5L 1HH2P 3IAYA 3MXUA 1QVCA 1XMQQ 2XNAC 1ILPA 1EYAA 4B3MQ 4KMUC 2IJ0A 4PG3A 5M3FH 4K8IA 1Y1WH 5C0XH 2VQEL 1YNJD 4OX9Q 2SNSA 1F2MA 1KTKA 4HEDA 4M1UB 4ME5A 4A3DB 4DKAC 2MGSA 4HIDA 1I6VC 4L8JA 2A68D 1TWAB 1DXMA 2B29A 4LNQA 2XN9C 2XGTA 3NEMA 3KF8B 3AB9A 3HRZC 1QVFA 2D5DA 4IPCA 2AHOB 1PH2A 5LL6X 4XDXA 4DV4L 3H91A 2XWBB 1A62A 2RA4A 3KLSA 3GTLB 3I4MB 1HRJA 3I4NH 1I5FA 2DJFC 2HUGA 1J6QA 4DUYQ 1F9SA 1K73C 4ZKCB 2EJMA 5ELCA 3S1MH 4OELB 3K7UC 2VY3A 4CJ0B 1TY0A 5FO7B 2B2UC 2D2CC 2B2WC 2ZTDA 1J5EQ 1L0XB 3K8AA 5E7NA 1VF5C 3DWPA 3R93A 1C4QA 2E5LL 3RUZA 4HJ9A 1SROA 1CQFA 4GLVB 4KKTA 4RKBA 3URYA 1IYUA 5A2QL 3VYRA 1SNDA 1X65A 3DHQA 1VMPA 4EVOA 4BY1B 1JOOA 2TSSA 4GKJL 1A8VA 2IX3A 1V1PB 2ZXRA 4HCSA 5I2YA 2RDFA 4ID6A 2E8GA 2OF1A 3CC2A 5KNDA 1KDBA 5E3FA 2R7ZB 2CWPA 5G3LF 1XX8A 2UXDQ 1WI5A 2E2HB 1ET9A 2AMCB 4QGUA 1EEID 1MD2D 2F52A 4RGMA 4BBSH 4IUNA 2F0DA 1J9OA 4KHVA 5NUCA 1YBYA 1FJGQ 2UXCL 1MHWC 1SNCA 2CW0D 3A0JA 2ZXOA 1E22A 1Y1VG 1K0SA 3J80c 3NSWA 5H1SE 3AYHB 3S1RH 5IWAQ 4UP9A 3H94A 2F0HA 2G9HD 4K8JA 2F0UA 2XRSD 3PUWA 3UE0A 4A3KG 3CCJA 3FDTA 3KOJA 3M9BA 3A8KE 2ES2A 3J7AV 1O78A 3PO2B 1HNWQ 1C7YA 3HOVH 1CA5A 4DXFA 4KJNA 1BBXC 5EGTA 4PMBA 3T13A 5C6AA 4KKSA 4LUVA 3E5SA 4JPBW 1E2ZA 3DWAA 1SJHD 2DJGC 1D6EC 2KCCA 3GP7A 2N49A 3TRZA 4PZ6A 1I50H 2RCFA 4ALPA 4IPHA 4ODGA 2MPMA 4XT3B 3VA5A 3J7AF 5DM63 1N33Q 3JC66 1GHKA 1HFNA 5BN5A 3MEHA 1S5DD 1NY4A 3CW2C 1HPCA 1QJOA 1IBLQ 1ONLA 5EBDA 1VQ9A 3BS1A 1K3RA 1BCPF 1NR4A 1TWFH 2Z4IA 3G71A 1EU4A 3OWEB 1VQOA 2P5ZX 2MNAA 4GOPC 2B3GA 1UE5A 2NZOA 2IHEA 2H5XA 3RZDB 4UHVA 4DV1L 3K6OA 1EY5A 1QNUA 1C9OA 1VQIA 1B1ZA 4IFDH 2F0JA 4GOPA 3GTJB 2EY6A 2VB3X 3HOYB 1B3AA 5I2XA 4DR4Q 1TWGH 2G9DA 2R93H 4WRDA 3K58A 4HTHA 3V96A 4AH6A 4A3EG 4JOIA 3K59A 3I91A 1JR0D 4A3IH 1YNXA 4IPDA 4RGOS 2K5DA 2F0TA 3BDCA 1N9WA 4JI5Q 1UNSA 2KHSA 4N8FA 1PYBA 1DYQA 2K04A 3TN2A 3CKIB 2C35B 3SK5A 3ITPA 3EA6A 1Y1WG 4A3BH 1K8OA 4C1NK 5C0XG 5K36G 5GQOA 2CFMA 2HHHL 3EQLC 1QNKA 3NTKA 2R7ZG 5IYDG 4DAYA 3ND9A 1YITA 4EQNA 4IUUA 2F3IA 3N52A 3E9IA 1RD9D 3HKSA 2NVYB 2KCMA 4BBRH 2L0CA 4DR1Q 1VS0A 2KEDA 5DM73 1X54A 1IHZA 4QF4A 4DV2L 1KXLA 3E9HA 5IY0A 1ENAA 1HZAA 2R61A 4ME3A 5EPJA 4GKKL 1HZCA 2B2VC 1A3VA 3KUPA 5EAYA 1A2TA 1I3QH 4QMGA 4H0LC 3I4NG 1TWCH 1CSQA 2K6AA 1D5XC 1PH8A 1Q8IA 3KYHC 3K0YA 2KJXA 1SMYC 3MAQA 4KHPL 3MXGA 3M85A 1VQ8A 3F1ZA 3KDFA 2NVXH 4Q0FA 5C3XA 1QE6A 4LW1A 1NNXA 4IN3A 1WD0A 4JI3L 2JA8H 2OTJA 1PDQA 3PO2G 4RHSA 3PF5A 3AU7A 2Q8TA 3A56A 4TKOB 5TSSA 3MHBA 1JJ2A 3PCOB 4TQUS 1B7YB 1OTCA 2F0MA 1YNNC 3RLFA 3RD4A 3TQYA 3CCRA 4LUZA 4F8MA 4K6DA 2AQ1B 3GTGH 4GOPB 3D4RA 1QOHA 2ID0A 2MQHA 3NBIA 1KL9A 4Q5VA 4DR3Q 4KTAA 1VQMA 3BJUA 1SYDA 1MBYA 1RDPD 2PMZE 3AFQA 5ELEA 4A93H 3EBEA 1P8LA 1PH6A 1L1OC 2ZM6Q 5KYIA 1MJEA 1CHPD 3PO3H 1MSGA 5CR3A 1CZWA 3BVZA 2E2IH 3FEWX 1XXGA 2PNRC 2NZHA 3RZOH 5JJLA 1SAPA 4KKUA 4NXNQ 5CYUA 1I4PA 2X6GA 5CBAE 1PFNA 4DAYB 3NTIA 3PQIA 1X3FA 1L1OA 5KIXA 4I65A 2WAQE 3CC7A 2CQOA 2K50A 5KRUA 3MFYA 4JVZA 1KNAA 3HKZE 1EYCA 3VYSA 5IP9H 3S2DH 1MKHA 4B3TL 3K7AH 4O42A 1EY8A 2Z6KA 4HIOA 4YCWA 1HNXQ 1Z47A 3ULPA 5CV7A 4GN4B 1E1OA 3Q22A 4YHHL 4DUZL 1ICWA 3P7JA 4L63B 1H9SA 3KDFB 1K8GA 5D14A 2IT1A 3W1GA 2H1EA 1IBML 4LFBL 4B9XA 4G7OC 5CORA 3W3AA 5JPNC 4X64L 3S9WA 3I3CA 2UUCQ 3SDZA 3TMEA 5IIFA 1NSNS 3C46A 1B70B 4JYAQ 5C4XB 5LL6S 2A6HD 2LXKA 1X6OA 1IKLA 3VR4A 4A3FH 3DXJC 3PMFA 3G6JB 3CXCA 3NBHA 2A8VA 2UXBQ 3QO2A 3R2TA 5ISRA 1XMQL 1SNPA 1SN8A 4B3ML 2HQEA 4KJOA 1PLFA 1Z7TA 3I90A 4AYBG 4MIUA 1VQGA 3A74A 2WB1E 1T5EA 4OX9L 1F2LA 3ONAB 1KLUD 1FD7D 2DN8A 3JAME 2RCNA 1SLJA 4F7XA 5M5XH 1GUNA 5AFWA 3U58A 1RIPA 5C44H 1GO3E 1LTID 3OIQA 3U50C 4DAMA 1GUOA 3SGIA 1YI2A 4NW2A 1PTOH 2Y0SE 2NUCA 4A3IG 1TVXA 3ULJA 1L1OB 1LTLA 4DV0Q 3U9SA 4QCLA 3GTOB 1I4RA 1W3SA 2F0OA 4QUCA 1B9MA 3S1NB 4DUYL 4A3JH 5C3EB 3UI2A 4OIJA 2YU9B 5M3MB 3M7GA 4IO9A 1ZXTA 4EQOA 1SYCA 3GDEA 4Y7NB 5EPKA 1HQRD 3TS2A 2O4XA 5BN4A 4ZLTF 4P74A 5IYBH 4C3IB 4P72A 2JA7B 4BBRG 1H9SB 1PH7A 4JI4Q 1EWHA 2F4VQ 2KUMA 1B53A 1H9MA 5FO8B 4DV3Q 4UP8A 1FGUA 1UWVA 2EYOA 2XVSA 3GTQB 1FYCA 2FJ2A 1K83B 1XNQQ 4BA2I 1UEBA 2F0EA 3EJIA 4DA2A 2B63H 1STAA 3HOXH 3OMGA 5GAGC 2E2DC 3ERSX 4DN4M 2F0FA 3M4OH 5GAHC 4KHPQ 3NBHB 1WOCA 2UXDL 5CV4A 4YCVA 1C8CA 4GNXA 5IGEA 4FF2A 3HS0C 2EYJA 1B3QA 2JA8G 4ZK9B 1TS2A 1SJED 1SE4A 1F2ZA 5JVH3 3FRPB 1EQTA 2VW9A 4A3CG 3T56B 1SNMA 1UEAB 3KBGA 1KDCA 2BDNA 3MXPA 4DXGA 4OWWB 1TQOA 1TIID 4CJ1B 3H3VI 1FJGL 4CKBA 4QQBX 3D3RA 1X3EA 3JAML 1SXTA 3CMEA 1G2TA 4DAVA 4DAPA 5IWAL 1KAAA 1VQJA 2I5HA 2JJQA 3L3OC 1K8MA 4ZUIA 1M90C 3G7LA 3J81L 5IGFA 2OT2A 2D0OA 1EYDA 1KRTA 1SSOA 3LWUA 2N55A 4R8NA 2ZT9C 3OW2A 4OXPA 4XQQA 5C4XG 4LF8Q 1N34Q 3I8ZA 1NMFA 4UPAA 1EZ8A 3GTPH 3E3XA 1NTGA 3SE0A 3PO3G 1R4QB 1BF4A 4KY6A 1YJ9A 3FVQA 4NDXA 5BR8Q 1HZBA 5D3IB 5F2DA 1PVOA 3ULLA 1EU3A 4ZAIA 1Q8KA 2SDFA 2LS01 3MXNA 3A7LA 3S1QH 5C4HA 2QDBA 2X6LA 1N33L 1OXTA 2R92H 4P75A 1KD1C 3RLOA 1JB3A 2RKSA 3K81C 4QIWB 4XQJA 3R3OA 4TVAB 1TY2A 3CPFA 4RWSC 4WORA 1B44D 1Q82C 2O5IC 1V43A 1IBLL 2Z9HA 4BY7H 1C48A 3T53B 1X3PA 4B08A 4IZ8A 3M4QA 4ZUJA 2H4OA 1VQHA 4G7HC 2BH2A 3GO5A 2WV6D 1PRTC 3M4YA 4CKCA 2ASBA 1Y1VB 1I4QA 1KAWA 2OXPA 2VQFQ 2Q2UA 2VUMH 1C0AA 1U4LA 2LY7A 2QKIC 1CSPA 4IOAA 2L1BA 3P75A 1BBUA 3Q6SA 4DR4L 3KLWA 1EIGA 4A3KB 4N9PA 1XNRQ 3I4MH 4HMJA 3E0EA 4PV1C 1EZ6A 2PQAA 1STHA 4LF6Q 1LTRD 3A55A 4BA1I 1I6HB 1D2BA 4C2MH 3J81j 2QEXA 2GVAA 5JEAH 1HNZQ 1ZEQX 5T1GA 3K5LA 4X3SA 1JT8A 1GOZA 4KY5A 3GQBA 3A5ZB 1DM0B 1F9RA 4JI7Q 2JA5H 1RKNA 2G5DA 1FNVA 4O0AA 3WDNA 2DGYA 4OGQC 1IZ6A 3LWEA 3NQIA 2B2TA 2CH4W 5C44G 1XMOQ 3WOFA 3PV0A 4MNOA 4F87A 4DR1L 2PZTA 4GLXA 2J7ZA 3D8GA 4H44C 3PIPA 1LTAD 2ALYB 3MXNB 1CZGA 2JQOA 4K2KA 4FYDA 2WP8J 3CMAA 4JBKA 1EWIA 2BOSA 3P1HA 4JI1Q 2ZJPA 4DR2Q 3OHXC 4OONA 1Q1BA 2J0TD 1XTCD 4J15A 4OO1I 1IKMA 4JI8Q 3I7FA 1QWYA 3NQTA 2VNUD 2EXZA 2KA7A 4LMQD 1L0YB 5IYCH 1DCZA 1TS5A 3S2HB 3AQQA 5C4JH 2K52A 2F0NA 4XYQA 3GTMH 3ICEA 1STYA 2AQ3B 2K05A 5GROA 1CHQD 2BH8A 2CKZB 1AZQA 1WCMB 4FF3A 4C3HB 1PMRA 3KF6B 4A3EB 1EYGA 3NUCA 2ICEC 1BVSA 1RJTA 2PMZB 2EE1A 4C3JG 4J8QA 5T1IA 5J22A 1K3BC 1GD7A 2Q8RE 2NN6I 3X3MA 1H95A 1PYWD 4QUFA 5M3FB 3J80i 3PIP3 2JSOA 1PRTB 4DR3L 1Y1WB 5C5LA 2OCEA 4E6IA 3D6CA 2PQAB 1SNQA 2YTVA 4O1NA 5IT9c 2F0SA 1R9TH 4BXXG 2ZM6L 1AH9A 1ENFA 3GV3A 3HKZB 4YCUA 1WTOA 2EYPA 1WTQA 5M5WH 4A3GH 4KI0A 4NXNL 3WOEA 1AZPA 1FVIA 2IX0A 3BDLA 3TP5A 2K32A 2LMCB 4POFA 1JOQA 3EN2A 2XWJB 4FXDA 2RSOA 2A6ED 3SXHA 3I4NB 1SMYD 1T5XD 3KFUA 5EKIA 3EIVA 4YWLA 3NWSA 1G2SA 2M9VA 3S1MB 1SRUA 1STEA 1RTOA 2FXQA 1Q81C 1HNXL 3TREA 2L11A 2AWNA 3LNNA 5LMNW 2I07B 3H3VH 3TBIB 2QCPX 1WJJA 4DK1A 2K03A 2K1BA 4HAEA 1YNND 2R7FA 1TU2B 4I7AA 2Z8LA 4JBMA 3HOYH 2L12A 1WTWA 3H15A 2HIXA 1E2WA 1OO9B 3MWYW 5M5YH 4X3TA 2UUCL 2ZTCA 1II3A 1TXYA 3T16A 4JYAL 1A2UA 1UE1A 2PI2E 1A3TA 1SBBB 3NHHA 3FP9A 3DEOA 5LHY1 2DY8A 2UXBL 1VQAA 4K5VA 4XT1B 3CCMA 4OHJA 1WVLA 2VZAA 2E2JH 5IE8A 4APVA 5JPMC 3RNUA 1EY7A 1E0BA 1E3PA 2ENBA 2UUAQ 4DV7Q 4X66L 3KK7A 1HXYD 1OXVA 4JOIC 4PQXA 5CV8A 2K7VA 1XPOA 2ZJQA 3L0OA 2VUMG 4A3MH 3S15H 4DR7Q 3S1RB 3GV6A 3Q23A 3OTOQ 1I4GA 1WCMG 1L0WA 4C3HG 1IYJB 3K5NA 4DV0L 1BUVT 1KDAA 2KEEA 3IL8A 1U5KA 4DU9A 3Q24A 3ZJYC 3HOVB 3I73A 2PQEA 5JEAG 1HJPA 2SNMA 4RCNA 3X3NA 5M3FG 5DEHA 5HURA 4HIKA 4IALA 3BG3A 5FJ8H 3P20A 3FKIH 4PZ8A 5ELFA 1EY6A 1W6KA 1I50B 3CP0A 1LTTD 4UDUC 2WAQG 2DNEA 4X62Q 3NWTA 1O7LA 3HP3A 2EJGC 1W6JA 3HKZG 4JI4L 2J4XA 2F4VL 2NTTA 1E2VA 2D0PA 1IW7C 3H0GH 4JCVE 4DV3L 2YTXA 3VR5A 3F2DA 1LV9A 1GJXA 2O2LD 1VQ6A 1XNQL 4ABNA 3BZDB 3VYUA 1TWFB 2QW7A 1ET6A 5J1ZA 1LT4D 3MZ5A 4FP5D 5I9PA 1I94Q 3OYYA 1LM0A 1DD2A 4H7BA 3CAMA 3QG1A 4AYBB 2A6EC 2IPKD 3U4ZA 2WIIB 4EX5A 2F3VA 5M9OA 1Q7YC 1PV4A 3S17H 1LUZA 5IYCG 2FFKB 1FNWA 1PFMA 3JAMc 1PH9A 1DOMA 1GVPA 1V8QA 1EQVA 1UE7A 2FINB 2JP1A 4IUVA 4V0BA 5E4XA 4LFAQ 3M7NA 4P73A 4R1JA 3J81c 3CQZH 1U0LA 4JI6Q 3HOUH 3C1EA 2R93B 1TWGB 1NAPA 3J80E 1A63A 4HJ7A 3OOCA 4A3IB 3BYTB 4DV5Q 1ENCA 2NVQB 4OO1H 2NYZD 2F0GA 2I5MX 2KQ3A 4LJZC 4Z9CB 1QVGA 4NPSA 3QJYA 3L9AX 3M4PA 4A3BB 3C1FA 4LF8L 1N34L 4LAAA 1EFID 3OWFA 2WB1G 4F88A 2KHIA 1PHJA 2XRQD 1JICA 1LTSD 1WTRA 1B2TA 3Q8DA 3K57A 5L37A 3DLLA 1VQKA 5J3BA 4HCEA
chains in the Genus database with same CATH topology
4BBRB 2E74C 5JVG3 3H6MA 3VYTA 3CRKC 1JOKA 1I3QB 4HSVA 1TWCB 2AWOA 1JQYD 3OMCA 2EY5A 3J7YW 2NVXB 2HDLA 4ZYSA 2JA8B 2K33A 1BXTA 5EJWA 1V1OA 4I7ZC 1DZ1A 5CV9A 5C0XJ 5DAUA 2EYFA 3R2IA 5EBCA 3DEPA 2EDGA 2SOBA 3OPOA 3BYYB 4KD4A 1HUMA 4XTCS 2KCNA 3GTGB 3EVQA 4IURA 2DY7A 4K2LA 5EPLA 1M8AA 1ZYRC 4L6TB 4CJ2C 1JE4A 4YIJA 3SR1A 3QIAA 4A93B 1Q90A 1O7ZA 1PTOC 1SYFA 1LT6D 4RH6A 2IX1A 1NCVA 1TR5A 5C0XI 4CBVA 3PO3B 2RBMA 4FF4A 4BS9A 1LTGD 2E2IB 3RZOB 5COYA 4XXEA 5FLXE 1QB5D 2K01A 5EQ0A 2V4DA 2PO4A 2M2LA 2C5CA 4IFDG 3N6RA 1QG7A 4HSPA 4QB4A 3S2DB 3K7AB 2QF7A 2RVLA 1LACA 2NTSA 1RTNA 4FF1A 1STNA 5JJZA 4ILWA 5FO9B 4KK7A 5KNCA 1PRTD 4IUPA 4IUQA 3HGBA 1JC7A 4KV6A 1CTMA 4CKEA 1EWCA 1CI3M 3K5OA 5C5MA 4DFAA 1G6ZA 2D9UA 5CMDA 2FHTA 1S4ZA 3NPPA 4ULLA 1M4VA 1WTVA 2F3WA 5IODA 4G57A 1D1KA 2HCCA 1HA5A 4V190 3OW7A 3QOJA 4FVMA 2AUJD 1Y69U 1BO0A 3SK8A 3DMUA 1A3UA 3IFTA 5KGUA 2BA0A 4ZQ3A 5M5XB 5C44B 1Q1EA 2LKVA 2JEBI 1PTOB 2BCOA 5FLXL 1FNUA 1NUCA 2B8FA 4FXKC 5I6YA 1H9KA 3SVMA 2VB2X 4IUTA 4EGVA 2NZ1D 1H9RA 2B39A 1SE2A 5FOBB 2Q8IB 3NXWA 1U9RA 1AN8A 2PCFB 4HMIA 4C3JB 2PYKA 3C2PA 3TSSA 1U4MA 4IFDJ 2B63B 3HOXB 2KOLA 4PMWA 3ERQA 1SYEA 3M4OB 1MI2A 1BQQT 2BE5C 3BVMA 3V2TA 4B9WA 1ESFA 1ESRA 3NK9A 1HTPA 5IOCA 5IGCA 3TP8A 4DK0A 3QWNA 2B2YC 3QB3A 4U673 2A69C 1LLRD 5IGGA 4H13C 4PMCA 1VDZA 2FMCA 5D65A 3Q0AA 2RQXA 1JCKB 4K14A 2JYOA 2NB0A 2JE6I 2B2YA 5E4WC 3CHBD 3GTPB 1Q12A 1Y8OB 3FMCA 1S5FD 2LFNA 2B2TC 3A8JE 1WTXA 2KECA 4MHEA 1STBA 1V1PA 4RKLA 1IYVA 5IGBA 4PNYA 1GUSA 3S1QB 1X32A 1X3QA 1XYIA 3TZUA 1G8ZD 4P2CB 2F0WA 5CV6A 1IL8A 2EYHA 5K36H 4BY7B 3MVVA 5FK9C 1WTPA 5ELBA 3NP8A 2MJ8A 3I70A 1RHPA 3AMUA 1BR9A 2PZWA 2VUMB 1UAPA 3HEJA 4UAIA 1CQVA 5JAVA 2CHBD 4DGZA 1AP0A 2PW7A 1QCBD 2C9OA 3BVGA 1D1IA 4RGNA 1A6XA 2A5HA 4C2MB 1HA6A 3V05A 3R8BA 2F0PA 1BCPC 4JBWA 3SK4A 1PRTF 2JA5B 4CHTB 3PUVA 3A54A 1RF2D 2RSNA 4DNRB 2B2UA 3VA7A 2B2WA 2WAQB 2GA4B 5CGKA 1EY0A 4IQZA 1IW7D 3H3VC 2YYZA 4FO2A 5I9OA 1HTLD 3MC0B 2PZUA 1AW7A 3A7AB 3SHLA 2IWHA 3T51B 1ML0D 1CT1D 5KNBA 1DOKA 2FMMA 1MGSA 1JWSD 5C4JB 3GTMB 1STGA 2BA1A 1B9NA 2QEJC 1GUGA 2VXWA 3PUZA 5D3DA 2EY1A 1GHJA 2WKCA 5ELDA 1BDOA 3BDOA 4WJWA 1O7YA 2QILA 3LX0A 2ZXPA 1BOSA 4NKLA 4ZKBB 1CFMA 2N88A 2WACA 3IFDA 4R8IA 2EY2A 2MP1A 2WB1B 1HFGA 1Y8NB 5CV5A 1HQMC 2SEBD 5EKLA 1R9TB 3A8IE 2PPBC 4BBSB 1YNJC 4X3KA 5M5WB 4A3GB 3EROA 1U4PA 1CM9A 1Q3LA 1G91A 3VR3A 2XSCA 5C4ZA 2Y0SB 3PIO3 4RHRA 2A68C 1TKWB 3I72A 5KEEA 4J1MA 1BCPB 2EYMA 1I4XA 1RODA 4XIGS 3H09A 1HHVA 4G7ZC 3U9OA 4S3SA 4RAUC 1G291 1R4PB 5EKKA 1I4HA 3D4WA 1Y8PB 1RCVD 2L4NA 4GZYC 4HR7B 3SEBA 3MTSA 3FPPA 4M8AA 1S5ED 5M5YB 1ZYRD 5DNFA 1B4OA 4RCOA 1LTBD 1Z6HA 3PUYA 2L9HA 2IL8A 1EIHA 1PTOD 1F9PA 4JK1C 1QILA 2E2JB 2NBFA 2Z1CA 5IGDA 2JXMB 5IT9E 3CU7A 2RDHA 2CQAA 3FPUB 2F03A 4A3MB 3S15B 4KY7A 5JOBA 3D31A 2CW0C 3DM1A 3TP6A 4FNFA 1OXUA 4K5XA 2B2VA 1VCIA 2F0QA 1KABA 2WINB 1SYGA 2EZVA 4BWGB 2AUKA 2EOTA 3FKIB 3O13A 4KD3A 1VMCA 4XQNA 5BN3A 2HCIA 3KLRA 2F0KA 1HCZA 5KYLA 1LABA 3T4AC 1S5CD 4OL7A 1KLGD 2L55A 3D6WA 1AEXA 4RFBA 1O80A 3H0GB 1DJRD 2HDMA 4NMZA 2NN6H 1LT3D 1ZKOA 3OIPA 4XYOA 3E0JA 2F0VA 3VR6A 5K5PA 2BDOA 3S17B 1F2YA 4TRDA 1EY4A 3QOLA 4DF7A 1PZKD 2KVMA 1F77A 5JEAJ 3I4LA 5FKAC 3CQZB 3HOUB 4LK1C 2D62A 1D5MC 4RA8A 3SK6A 5IT9L 1SNOA 4EQPA 1DONA 2JEAI 5I4DA 1NR2A 2R6GA 2OEOA 4X3UA 2K28A 4KN4C 1BNZA 3J80L 1AFPA 1EOTA 2EVBA 3VR2A 1CA6A 1TT2A 4MN3A 3RMHA 3C3LA 3PUXA 3EFXD 2CVRA 4CGYB 4KHZA 2TMPA 1XWEA 4TSSA 2EPBA 1KNEA 3ND8A 1EEFD 3D4DA 1UUPA 1J8IA 2JA6B 2BE5D 2K5WA 3M3YB 2E76C 2E75C 1PFBA 1LO5D 3E6ZX 2B8GA 5A35A 1U4RA 3F2UA 4G4KA 3K5MA 4FXGC 4KN7C 1SE3A 2F4IA 3CRLC 1SYBA 4RGTA 3J81E 4DNTB 2F0LA 2A69D 3NE5B 1MSHA 2EYLA 1PZJD 1TWHB 4K5WA 1EY9A 1GUTA 2M00A 3S14B 4WFN3 3MA2B 3L7ZC 2MHVA 3TP7A 1TS3A 3S16B 4A3FB 5G3LD 4ZRZA 1PZID 3HOWB 4K6LA 2DNCA 1TS4A 2K5QA 3NTHA 4N9TA 3HZXA 1B50A 2RDGA 1FR3A 1PXUA 1JWUD 3W2DA 2WKDA 5E1FA 1PTOF 2L5TA 3HG9A 1A15A 5CC4A 2AQ2B 1OXSC 4OO1G 2Z4HA 2ICIA 2F0IA 4A3JB 1GXDC 3IKJA 3ZYYX 2A73B 4J6HA 4R9WA 1DOLA 4OIKA 1HUNA 2O5JC 1D5ZC 4U68A 1F9QA 3DWQA 2X69A 3MFGA 2MUYA 2NN6G 5J39A 3KLSX 1EL0A 2IW3A 1BCPD 2A6HC 1GUWA 1H9JA 5C3WA 1LT5D 1SEBD 1WD1A 2NVTB 2I46A 3KF8A 5HGTA 3TDQA 1SFOB 4C1NI 1OXXK 2R3ZA 4NP5A 2NWGA 3GD7A 2EJFC 1S5BD 4IFDI 1SDFA 5I6WA 1ILQA 3HOZB 4C56C 3OSOA 1FGBD 2A74C 1CK1A 1JWMD 2XIWA 5A2QE 3TZDA 5CBEE 4C3IG 2PW5A 3DUZA 2F1MA 3GTKB 3KBXA 4HN7A 2R92B 1JORA 1VF7A 3IAYA 3MXUA 2XNAC 1ILPA 1EYAA 4KMUC 2IJ0A 4K8IA 5C0XH 1YNJD 2SNSA 1F2MA 1KTKA 4HEDA 4M1UB 4ME5A 4A3DB 2MGSA 1I6VC 4L8JA 2A68D 1TWAB 1DXMA 2XN9C 3AB9A 3HRZC 2D5DA 5LL6X 4XDXA 3H91A 2XWBB 2RA4A 3KLSA 3GTLB 3I4MB 1HRJA 2HUGA 1F9SA 4ZKCB 2EJMA 5ELCA 4CJ0B 1TY0A 5FO7B 2B2UC 2D2CC 2B2WC 1L0XB 1VF5C 3DWPA 3R93A 1C4QA 3RUZA 1CQFA 4KKTA 4RKBA 3URYA 1IYUA 5A2QL 3VYRA 1SNDA 3DHQA 1VMPA 4EVOA 4BY1B 1JOOA 2TSSA 2IX3A 1V1PB 2ZXRA 4HCSA 5I2YA 2RDFA 4ID6A 2OF1A 5KNDA 1KDBA 5E3FA 2R7ZB 5G3LF 1XX8A 2E2HB 1ET9A 1EEID 1MD2D 4RGMA 4IUNA 2F0DA 1J9OA 4KHVA 5NUCA 1SNCA 2CW0D 2ZXOA 3NSWA 3H94A 2F0HA 2G9HD 4K8JA 2F0UA 2XRSD 3PUWA 3FDTA 3A8KE 3J7AV 1O78A 3PO2B 1CA5A 4DXFA 4KJNA 1BBXC 5EGTA 4PMBA 3T13A 5C6AA 4KKSA 3E5SA 1E2ZA 3DWAA 1SJHD 2KCCA 1D6EC 3GP7A 4ODGA 2MPMA 4XT3B 3VA5A 3J7AF 5DM63 1GHKA 1HFNA 5BN5A 3MEHA 1S5DD 1HPCA 1QJOA 1ONLA 5EBDA 3BS1A 1BCPF 1NR4A 2Z4IA 1EU4A 3OWEB 3RZDB 3K6OA 1EY5A 1QNUA 1B1ZA 4IFDH 2F0JA 3GTJB 2EY6A 2VB3X 3HOYB 1B3AA 5I2XA 2G9DA 4WRDA 3K58A 4HTHA 3V96A 3K59A 3I91A 1JR0D 4RGOS 2K5DA 2F0TA 3BDCA 1UNSA 2KHSA 1DYQA 2K04A 3TN2A 3CKIB 3SK5A 3ITPA 3EA6A 1K8OA 4C1NK 5C0XG 5K36G 3EQLC 1QNKA 3NTKA 4DAYA 3ND9A 4EQNA 4IUUA 3N52A 1RD9D 2NVYB 2L0CA 2KEDA 5DM73 1IHZA 4QF4A 1ENAA 2R61A 5EPJA 2B2VC 1A3VA 3KUPA 1A2TA 4QMGA 4H0LC 2K6AA 1D5XC 1Q8IA 3K0YA 2KJXA 1SMYC 3MAQA 3MXGA 3M85A 4Q0FA 5C3XA 1QE6A 4IN3A 1WD0A 1PDQA 4RHSA 3AU7A 2Q8TA 3A56A 4TKOB 5TSSA 3MHBA 4TQUS 2F0MA 1YNNC 3RLFA 3RD4A 4F8MA 4K6DA 2AQ1B 3D4RA 1QOHA 2ID0A 3NBIA 4Q5VA 4KTAA 1SYDA 1MBYA 1RDPD 5ELEA 5KYIA 1CHPD 1MSGA 5CR3A 1CZWA 3BVZA 3FEWX 1XXGA 2PNRC 1SAPA 4KKUA 5CYUA 1I4PA 2X6GA 5CBAE 1PFNA 3NTIA 5KIXA 4I65A 5KRUA 3MFYA 1KNAA 1EYCA 3VYSA 4O42A 1EY8A 1Z47A 5CV7A 3Q22A 1ICWA 3P7JA 4L63B 1H9SA 5D14A 2IT1A 2H1EA 4B9XA 4G7OC 5CORA 3W3AA 5JPNC 3S9WA 3I3CA 3SDZA 3TMEA 5IIFA 1NSNS 3C46A 5C4XB 5LL6S 2A6HD 1IKLA 3VR4A 3DXJC 3PMFA 3G6JB 3NBHA 3QO2A 3R2TA 5ISRA 1SNPA 2HQEA 4KJOA 1PLFA 1Z7TA 3I90A 4MIUA 1T5EA 1F2LA 3ONAB 1KLUD 1FD7D 2DN8A 3JAME 4F7XA 1GUNA 5AFWA 1LTID 3OIQA 1GUOA 4NW2A 1PTOH 2NUCA 1TVXA 3U9SA 4QCLA 3GTOB 1I4RA 2F0OA 4QUCA 1B9MA 3S1NB 5C3EB 3UI2A 4OIJA 2YU9B 5M3MB 3M7GA 1ZXTA 4EQOA 1SYCA 4Y7NB 5EPKA 1HQRD 2O4XA 5BN4A 4ZLTF 4C3IB 2JA7B 1H9SB 1EWHA 2KUMA 1B53A 1H9MA 5FO8B 2EYOA 2XVSA 3GTQB 1FYCA 2FJ2A 1K83B 4BA2I 2F0EA 3EJIA 4DA2A 1STAA 3OMGA 2E2DC 4DN4M 2F0FA 5CV4A 1C8CA 5IGEA 4FF2A 3HS0C 2EYJA 4ZK9B 1TS2A 1SJED 1SE4A 1F2ZA 5JVH3 3FRPB 1EQTA 3T56B 1SNMA 1UEAB 3KBGA 1KDCA 2BDNA 3MXPA 4DXGA 1TQOA 1TIID 4CJ1B 4CKBA 3D3RA 3JAML 1SXTA 1G2TA 4DAVA 4DAPA 1KAAA 3L3OC 1K8MA 4ZUIA 3G7LA 3J81L 5IGFA 2OT2A 1EYDA 1SSOA 3LWUA 2N55A 4R8NA 2ZT9C 4XQQA 3I8ZA 1EZ8A 3SE0A 1R4QB 1BF4A 4KY6A 3FVQA 4NDXA 5D3IB 5F2DA 1EU3A 4ZAIA 2SDFA 2LS01 3MXNA 3A7LA 5C4HA 2QDBA 2X6LA 1OXTA 1JB3A 2RKSA 4QIWB 4XQJA 3R3OA 1TY2A 4RWSC 4WORA 1B44D 2O5IC 1V43A 1C48A 3T53B 1X3PA 4B08A 4IZ8A 4ZUJA 2H4OA 4G7HC 3GO5A 2WV6D 1PRTC 3M4YA 4CKCA 1Y1VB 1I4QA 2OXPA 1U4LA 2LY7A 2QKIC 2L1BA 3P75A 3Q6SA 1EIGA 4A3KB 4N9PA 4HMJA 4PV1C 1EZ6A 1STHA 1LTRD 3A55A 4BA1I 1I6HB 1D2BA 5JEAH 1ZEQX 5T1GA 3K5LA 4X3SA 1GOZA 4KY5A 3GQBA 1DM0B 1F9RA 1RKNA 1FNVA 3WDNA 4OGQC 3LWEA 3NQIA 2B2TA 3WOFA 3PV0A 4F87A 2PZTA 2J7ZA 3D8GA 4H44C 1LTAD 1CZGA 4K2KA 4FYDA 2WP8J 2BOSA 3P1HA 3OHXC 1Q1BA 2J0TD 1XTCD 4OO1I 1IKMA 1QWYA 3NQTA 2VNUD 2EXZA 2KA7A 4LMQD 1L0YB 1DCZA 1TS5A 3S2HB 2F0NA 4XYQA 1STYA 2AQ3B 2K05A 1CHQD 1AZQA 1WCMB 4FF3A 4C3HB 1PMRA 4A3EB 3NUCA 2ICEC 1RJTA 2PMZB 2EE1A 4C3JG 4J8QA 5T1IA 5J22A 2Q8RE 2NN6I 3X3MA 1PYWD 4QUFA 5M3FB 3PIP3 2JSOA 1PRTB 1Y1WB 5C5LA 4E6IA 3D6CA 1SNQA 4O1NA 2F0SA 1ENFA 3GV3A 3HKZB 1WTOA 2EYPA 1WTQA 4KI0A 3WOEA 1AZPA 2IX0A 3BDLA 3TP5A 2K32A 2LMCB 1JOQA 2XWJB 4FXDA 2RSOA 2A6ED 3SXHA 3I4NB 1SMYD 1T5XD 5EKIA 3NWSA 1G2SA 2M9VA 3S1MB 1STEA 1RTOA 2L11A 2AWNA 3LNNA 2I07B 3TBIB 2QCPX 4DK1A 2K03A 2K1BA 4HAEA 1YNND 1TU2B 2Z8LA 2L12A 1WTWA 1E2WA 1OO9B 3MWYW 4X3TA 1II3A 3T16A 1A2UA 1A3TA 1SBBB 3NHHA 3DEOA 5LHY1 2DY8A 4K5VA 4XT1B 4OHJA 1WVLA 5JPMC 1EY7A 1E0BA 2ENBA 3KK7A 1HXYD 1OXVA 4PQXA 5CV8A 2K7VA 3S1RB 3GV6A 3Q23A 1I4GA 4C3HG 3K5NA 1BUVT 1KDAA 2KEEA 3IL8A 4DU9A 3Q24A 3HOVB 3I73A 2PQEA 5JEAG 2SNMA 4RCNA 3X3NA 5DEHA 5HURA 4IALA 3BG3A 3P20A 5ELFA 1EY6A 1W6KA 1I50B 1LTTD 4UDUC 2DNEA 3NWTA 1O7LA 3HP3A 2EJGC 1W6JA 2J4XA 2NTTA 1E2VA 1IW7C 3VR5A 1LV9A 1GJXA 2O2LD 4ABNA 3BZDB 3VYUA 1TWFB 1ET6A 5J1ZA 1LT4D 3MZ5A 4FP5D 5I9PA 1DD2A 4H7BA 4AYBB 3QG1A 2A6EC 2IPKD 2WIIB 2F3VA 5M9OA 2FFKB 1FNWA 1PFMA 1DOMA 4IUVA 1V8QA 1EQVA 2FINB 2JP1A 4V0BA 5E4XA 3M7NA 3C1EA 2R93B 1TWGB 1NAPA 3J80E 3OOCA 4A3IB 3BYTB 1ENCA 2NVQB 4OO1H 2NYZD 2F0GA 2KQ3A 4LJZC 4Z9CB 3QJYA 3L9AX 4A3BB 3C1FA 4LAAA 1EFID 3OWFA 4F88A 2XRQD 1JICA 1LTSD 1WTRA 1B2TA 3K57A 4HCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UAI A;  5JJZ A;  3DM1 A;  4R9W A;  2EPB A;  2KOL A;  1ILP A;  2B2V A;  1DOL A;  4OIK A;  4IUU A;  1HUN A;  4IUP A;  3N52 A;  2FJ2 A;  4IUQ A;  1KNE A;  1MI2 A;  4X3K A;  1U4L A;  4U68 A;  1AP0 A;  2KEE A;  1ICW A;  1F9Q A;  1U4P A;  2KED A;  3IL8 A;  1J8I A;  1G6Z A;  3FDT A;  2D9U A;  4HED A;  1CM9 A;  2L1B A;  3P7J A;  5CMD A;  3GV3 A;  3Q6S A;  1Q3L A;  2EOT A;  2FHT A;  1S4Z A;  1EIG A;  4HSV A;  5EPJ A;  4DN4 M;  1WTO A;  1ESR A;  1G91 A;  1PFB A;  2B2V C;  2X69 A;  3KUP A;  2MGS A;  2H1E A;  1VMC A;  5D14 A;  1WTQ A;  1WTV A;  1AZP A;  2HCI A;  5COR A;  1CA5 A;  1HA6 A;  1C8C A;  1U4R A;  3F2U A;  3I3C A;  1BBX C;  4ZK9 B;  2HDL A;  2HCC A;  1EL0 A;  1ROD A;  2RSO A;  1EQT A;  5T1G A;  4X3S A;  3D6W A;  4XDX A;  2BDN A;  5EKI A;  1O80 A;  3H91 A;  1HHV A;  2B2Y C;  2HDM A;  1GUW A;  4CJ1 B;  1G2S A;  2RSN A;  1IKL A;  1F9R A;  3HP3 A;  1QE6 A;  2RA4 A;  5EJW A;  4RAU C;  1DZ1 A;  1HRJ A;  2B2U A;  1WD0 A;  1RTO A;  2B2W A;  2MPM A;  1WD1 A;  1MSH A;  1PDQ A;  1BO0 A;  2HUG A;  3QO2 A;  4XT3 B;  1F9S A;  3DEP A;  5D65 A;  1G2T A;  4ZKC B;  2L4N A;  3LWE A;  2L11 A;  2JYO A;  2B2T A;  1HUM A;  1HFN A;  1WTX A;  3G7L A;  1LV9 A;  4CJ0 B;  1PLF A;  2Q8T A;  3I90 A;  3MTS A;  2B2Y A;  5E4W C;  1SSO A;  2B2U C;  2J7Z A;  2B2W C;  2N55 A;  4IUR A;  1F2L A;  2DY7 A;  3ONA B;  2R3Z A;  2K03 A;  2K1B A;  2NWG A;  3I8Z A;  1M8A A;  4HAE A;  5EPL A;  3R93 A;  2KVM A;  1ML0 D;  1NR4 A;  2B2T C;  5DNF A;  1B4O A;  1JE4 A;  4CJ2 C;  2FFK B;  1PFM A;  5AFW A;  1DOM A;  2KEC A;  2L12 A;  2FIN B;  2JP1 A;  1SDF A;  4IUV A;  1DOK A;  5E4X A;  1WTW A;  1ILQ A;  4MHE A;  1O7Z A;  4RA8 A;  2L9H A;  3MWY W;  2FMM A;  2IL8 A;  4X3T A;  1BF4 A;  1EIH A;  1IKM A;  1MGS A;  1NCV A;  1DON A;  4NW2 A;  1VMP A;  1B50 A;  1NR2 A;  1F9P A;  1NAP A;  4X3U A;  1TVX A;  4LMQ D;  4ZAI A;  2VXW A;  2SDF A;  1X32 A;  2K28 A;  4HCS A;  3DEO A;  5COY A;  2XIW A;  1X3Q A;  3SVM A;  1B3A A;  4QUC A;  1BNZ A;  1MSG A;  2DY8 A;  4IUT A;  2K05 A;  4XT1 B;  2X6L A;  1XYI A;  3UI2 A;  4OIJ A;  1AZQ A;  2K01 A;  2NZ1 D;  1WVL A;  2NYZ D;  5EQ0 A;  3I91 A;  1O7Y A;  1XX8 A;  1IL8 A;  1SAP A;  3TZD A;  3FPU B;  5CBE E;  2M2L A;  1ZXT A;  1E0B A;  2X6G A;  1PFN A;  5CBA E;  1EOT A;  1QG7 A;  4RWS C;  1WTP A;  5EPK A;  1RJT A;  4ZKB B;  1A15 A;  2EE1 A;  2K04 A;  2MJ8 A;  2N88 A;  3IFD A;  1KNA A;  3TN2 A;  5T1I A;  4ZLT F;  4R8I A;  4MN3 A;  1CA6 A;  2RVL A;  1J9O A;  1X3P A;  1RHP A;  2Q8R E;  3KBX A;  1JIC A;  3GV6 A;  1WTR A;  1RTN A;  2MP1 A;  1B2T A;  2CVR A;  4QUF A;  1HFG A;  4O42 A;  1U4M A;  1QNK A;  2KUM A;  1B53 A; 
#chains in the Genus database with same CATH topology
 3DM3 A;  4BBR B;  4BBS G;  2E74 C;  5BR8 L;  5JVG 3;  3H6M A;  3VYT A;  3CRK C;  1Q86 C;  3STB C;  1VQP A;  2Y0S G;  1JOK A;  2Z6K C;  1I3Q B;  4L5T A;  2QA4 A;  1NJI C;  2KBN A;  4HSV A;  1TWC B;  1QUQ A;  1UE6 A;  2AWO A;  3BU2 A;  2JA6 H;  1JQY D;  3OMC A;  4PZ7 A;  2EY5 A;  3M3Y H;  4R4O A;  3J7Y W;  2NVX B;  2HDL A;  1VQ5 A;  3RLN A;  4ZYS A;  4YY3 Q;  2KCT A;  2JA8 B;  1G51 A;  2K33 A;  3HOV G;  1BXT A;  5EJW A;  1V1O A;  4I7Z C;  1DZ1 A;  5CV9 A;  5C0X J;  2GVB A;  5DAU A;  2EYF A;  3K0X A;  3R2I A;  5EBC A;  3DEP A;  2EDG A;  2SOB A;  3OPO A;  4GN3 B;  3BYY B;  4KD4 A;  3A5U A;  2Q2I A;  1HUM A;  2VQF L;  4XTC S;  4X6A H;  1IXR A;  2KCN A;  3GTG B;  4JI0 L;  1TWH H;  3EVQ A;  4IUR A;  2DY7 A;  3S14 H;  1L2F A;  2CH4 A;  1NE3 A;  4K2L A;  5EPL A;  1M8A A;  1ZYR C;  4DPG A;  4L6T B;  1B8A A;  4CJ2 C;  1XNR L;  1JE4 A;  4YIJ A;  3CCE A;  3S1N H;  3SR1 A;  3QIA A;  3TS0 A;  4JC0 A;  4A93 B;  4LF6 L;  1Q90 A;  1O7Z A;  1PTO C;  4RMF A;  5M3M H;  1SYF A;  3S16 H;  1LT6 D;  4RH6 A;  2IX1 A;  1NCV A;  3RR5 A;  3CCU A;  1HNZ L;  2OWO A;  1TR5 A;  5C0X I;  3HOW H;  4CBV A;  3PO3 B;  2RBM A;  1JB7 A;  3NEL A;  4BS9 A;  4FF4 A;  1LTG D;  2E2I B;  1EIF A;  4JG2 A;  4JI7 L;  3RZO B;  1EQQ A;  5COY A;  1S3O A;  4XXE A;  5FLX E;  4X66 Q;  1QB5 D;  3UDI A;  4MTK A;  2K01 A;  3F2C A;  5EQ0 A;  4DK6 C;  2K14 A;  4A3M G;  1HZ9 A;  2V4D A;  2PO4 A;  1XMO L;  2M2L A;  2C5C A;  4IFD G;  3N6R A;  1QG7 A;  4HSP A;  4JV5 Q;  4QB4 A;  3S2D B;  2R93 G;  3K7A B;  2QF7 A;  1PH3 A;  2RVL A;  1LAC A;  4JI1 L;  2NTS A;  1RTN A;  4FF1 A;  4DR2 L;  1STN A;  4R4C A;  2N8N A;  2DUD A;  5JJZ A;  1V1Q A;  4JI8 L;  1N36 Q;  3WWV A;  4ILW A;  5FO9 B;  4KK7 A;  5KNC A;  1PRT D;  4IUP A;  3CD6 A;  4IUQ A;  4A3B G;  3HGB A;  1JC7 A;  4KV6 A;  3HFZ B;  1CTM A;  4CKE A;  1EWC A;  1CI3 M;  3FKI G;  3K5O A;  5C5M A;  4DFA A;  5LMU Q;  2D9U A;  1HR0 W;  1G6Z A;  5CMD A;  1GM5 A;  2FHT A;  1S4Z A;  3NPP A;  1YHA A;  4ULL A;  1M4V A;  1WTV A;  2F3W A;  5IOD A;  1PFS A;  4G57 A;  1X56 A;  1D1K A;  2QGQ A;  2UUB Q;  4QL5 A;  2HCC A;  2YTY A;  4LF4 Q;  3W5O A;  4HJA A;  1HA5 A;  1KC8 C;  4V19 0;  3QOJ A;  3OW7 A;  1YJN A;  4B3S Q;  1JJG A;  4GNX C;  3CF5 A;  4FVM A;  1BKB A;  2AUJ D;  1Y69 U;  1BO0 A;  3SK8 A;  1XJV A;  3DMU A;  1A3U A;  3IFT A;  2KEN A;  5KGU A;  4WJ4 A;  4N8X 1;  2NVT H;  5ELN A;  2BA0 A;  4ZQ3 A;  5M5X B;  5C44 B;  1Q1E A;  3HOU G;  2LKV A;  1SFO H;  2JEB I;  4LWC A;  1PTO B;  2BCO A;  5ELO A;  5FLX L;  5JJK A;  1FNU A;  2Z0S A;  1NUC A;  2B8F A;  4FXK C;  3HOZ H;  1D8L A;  1PH1 A;  1AE3 A;  5I6Y A;  2XTI A;  3VDY A;  1H9K A;  3SVM A;  2VB2 X;  4IUT A;  4EGV A;  2NZ1 D;  1H9R A;  2B39 A;  1SE2 A;  4DV6 Q;  4A93 G;  5LMN Q;  5FOB B;  2Q8I B;  4X65 Q;  3NXW A;  1U9R A;  2HT1 A;  1AN8 A;  2PCF B;  2K5V A;  4HMI A;  4C3J B;  1EFW A;  4P71 A;  1VQN A;  2PYK A;  2A19 A;  2JN4 A;  4A3K H;  3C2P A;  3TSS A;  1U4M A;  3S24 A;  3GTK H;  4IFD J;  2WFW A;  2B63 B;  1Q46 A;  3HOX B;  2KOL A;  4PMW A;  2MFI A;  3ERQ A;  1S40 A;  4JW0 A;  3U4V A;  2ZJR A;  1SYE A;  5IP9 G;  2JA6 G;  3M4O B;  1MI2 A;  1BQQ T;  2BE5 C;  3BVM A;  1CKM A;  3V2T A;  4B9W A;  1ESF A;  1ESR A;  3NK9 A;  1HTP A;  1E7Z A;  5IOC A;  1LYL A;  1MIU A;  4A3D H;  2UUA L;  5IGC A;  4DV7 L;  1TWA H;  3TP8 A;  4DK0 A;  2CWA A;  3QWN A;  4GNX B;  4DR7 L;  4R4Q A;  2B2Y C;  2K5N A;  3QB3 A;  4U67 3;  2A69 C;  1LLR D;  5IGG A;  4H13 C;  1AE2 A;  1VDZ A;  4PMC A;  3OTO L;  4JI0 Q;  1X9N A;  2FMC A;  5D65 A;  3Q0A A;  2RQX A;  1JCK B;  4K14 A;  2Q2H A;  2JYO A;  3GTL H;  2NB0 A;  1PA6 A;  2JE6 I;  2B2Y A;  5E4W C;  3CHB D;  4A3F G;  3GTP B;  1Q12 A;  1Y8O B;  3FMC A;  1S5F D;  2LFN A;  3HOW G;  2B2T C;  3ER0 A;  3A8J E;  1YEZ A;  5HGQ A;  1WTX A;  2KEC A;  2Q2T A;  4MHE A;  1STB A;  4YWK A;  1V1P A;  4R4I A;  4CDF C;  4RKL A;  1IYV A;  5IGB A;  4PNY A;  1GUS A;  3S1Q B;  4X62 L;  1X32 A;  3D0F A;  4BY1 H;  1X3Q A;  1XYI A;  5GAD C;  3TZU A;  1G8Z D;  4P2C B;  2F0W A;  5CV6 A;  1IL8 A;  2EYH A;  3UE1 A;  5K36 H;  2RHS B;  4BY7 B;  3MVV A;  1EQR A;  1I94 L;  5FK9 C;  3T1Y Q;  1WTP A;  2R7Z H;  5IYD H;  5ELB A;  3NP8 A;  4AQY Q;  1MJC A;  4A3J G;  2E2H H;  2MJ8 A;  3I70 A;  2A1A A;  1RHP A;  3AMU A;  1BR9 A;  2L15 A;  1VQB A;  2PZW A;  1SR3 A;  4LFA L;  2VUM B;  1UAP A;  3HEJ A;  3IRB A;  4UAI A;  2V1C C;  1CQV A;  5JAV A;  4HIM A;  4JI6 L;  2CHB D;  5IYB G;  1PYS B;  2HQL A;  1ASZ A;  3CCV A;  4DGZ A;  1AP0 A;  2PW7 A;  1QCB D;  4A76 A;  2C9O A;  4DV5 L;  3BVG A;  1VQL A;  1D1I A;  4RGN A;  1A6X A;  2A5H A;  4C2M B;  2HIV A;  1D7Q A;  5AJ3 Q;  1HA6 A;  3V05 A;  2B63 G;  2HD3 A;  3R8B A;  3HOX G;  3PO2 H;  2F0P A;  2I5L X;  3PSI A;  1BCP C;  3J7A 5;  4JBW A;  3SK4 A;  1PRT F;  3W1B A;  2JA5 B;  4NB3 A;  4CHT B;  3PUV A;  1EUJ A;  1NBW A;  3A54 A;  4DR6 Q;  1RF2 D;  2RSN A;  4IJL A;  4DNR B;  2B2U A;  3VA7 A;  1QZH A;  2B2W A;  1WYD A;  2WAQ B;  2GA4 B;  5CGK A;  1EY0 A;  4IQZ A;  4WJ3 M;  1VQE A;  1X3G A;  1IW7 D;  2VL6 A;  2MO1 A;  3H3V C;  2YYZ A;  4FO2 A;  5I9O A;  3BZC A;  1HTL D;  2UU9 Q;  3MC0 B;  2PZU A;  1AW7 A;  3A7A B;  2PNH A;  4NXM Q;  3SHL A;  2IWH A;  3T51 B;  1ML0 D;  2QDL A;  1CT1 D;  3HOZ G;  1IBK L;  5KNB A;  4CDD C;  1DOK A;  2FMM A;  3I56 A;  1MGS A;  1JWS D;  5C4J B;  3GTM B;  1STG A;  4YY3 L;  2BA1 A;  1B9N A;  2QEJ C;  3PIO A;  5HY6 A;  1GUG A;  2VXW A;  3PUZ A;  5D3D A;  5IP7 H;  2EY1 A;  1GHJ A;  2WKC A;  3RZD H;  5ELD A;  1BDO A;  3BDO A;  4JBJ A;  1M1K C;  1KQS A;  4WJW A;  1O7Y A;  3GTJ H;  2QIL A;  3LX0 A;  2ZXP A;  4JI2 Q;  1BOS A;  4NKL A;  4ZKB B;  1CFM A;  2N88 A;  2WAC A;  3IFD A;  4R8I A;  2R92 G;  2EY2 A;  1RL2 A;  2MP1 A;  2WB1 B;  1HFG A;  1Y8N B;  5CV5 A;  1HQM C;  1VQD A;  4YWM A;  2SEB D;  5EKL A;  1R9T B;  4BY7 G;  4DNI A;  3A8I E;  3T1H Q;  2PPB C;  4BBS B;  1YNJ C;  1VQF A;  4X3K A;  5M5W B;  4A3D G;  3ERO A;  3STB D;  1U4P A;  4A3G B;  3KJO A;  4OEM B;  1CM9 A;  1Q3L A;  1KHI A;  4DR5 Q;  1G91 A;  3VR3 A;  2XSC A;  5C4Z A;  2NVY H;  2Y0S B;  3PIO 3;  4RHR A;  2A68 C;  4LF7 Q;  1TKW B;  3I72 A;  5KEE A;  1JE5 A;  4J1M A;  1N32 Q;  1BCP B;  2EYM A;  1X55 A;  1EIY B;  1I4X A;  4JV5 L;  1ROD A;  4XIG S;  4LF9 Q;  1YIJ A;  3H09 A;  3I4M G;  1O7I A;  1HHV A;  3UDX A;  3U9O A;  4G7Z C;  2AKW B;  4QIW E;  1XTD A;  4S3S A;  4RAU C;  2YV5 A;  1G29 1;  1R4P B;  5EKK A;  1I4H A;  2VS1 A;  3D4W A;  1Y8P B;  1N36 L;  4HJ8 A;  1RCV D;  2L4N A;  4GZY C;  4HR7 B;  3SEB A;  1G6P A;  3PGZ A;  3MTS A;  5LMU L;  2JA5 G;  3FPP A;  5FLM H;  3I4O A;  4M8A A;  1HR0 Q;  1S5E D;  5M5Y B;  1ZYR D;  5DNF A;  1B4O A;  3JAM i;  4RCO A;  4LF5 Q;  1LTB D;  4L5R C;  1Z6H A;  4O2D A;  2NVQ H;  4BY1 G;  3PUY A;  2L9H A;  4UP7 A;  2IL8 A;  4L5S A;  2UUB L;  3J81 i;  1EIH A;  1PTO D;  3FHW A;  4LF4 L;  1F9P A;  1P16 A;  2VQE Q;  4B3S L;  3RN5 A;  4JK1 C;  1QIL A;  2E2J B;  3CPW A;  2NBF A;  2Z1C A;  5IGD A;  3CCQ A;  2JXM B;  5IT9 E;  3CU7 A;  2RDH A;  2CQA A;  1K8A C;  5FLX c;  3FPU B;  1PH4 A;  2F03 A;  4A3M B;  3S15 B;  3G48 A;  4KY7 A;  4DV4 Q;  5JOB A;  4POG A;  3D31 A;  2CW0 C;  1WFQ A;  1ICF B;  3I55 A;  4RG1 A;  2EIF A;  1BBW A;  3DM1 A;  1T9H A;  3TP6 A;  4FNF A;  1OXU A;  4CDC C;  4K5X A;  2B2V A;  4H02 A;  1VCI A;  2F0Q A;  1KAB A;  2WIN B;  1SYG A;  2EZV A;  4BWG B;  2JK8 A;  2AUK A;  4GLA C;  4B3R L;  2R7D A;  3KJP A;  2E5L Q;  2EOT A;  1JJC B;  3FKI B;  3O13 A;  4A3C H;  4KD3 A;  1VMC A;  4XQN A;  5BN3 A;  4DV6 L;  2HCI A;  3KLR A;  5LMN L;  2F0K A;  3J7Z C;  1HCZ A;  5KYL A;  1Y14 B;  4X65 L;  4UY8 C;  1LAB A;  3T4A C;  1S5C D;  4OWX B;  4OL7 A;  1KLG D;  3BZK A;  2L55 A;  3D6W A;  4GKJ Q;  1AEX A;  5DLQ E;  4RFB A;  4A3G G;  1O80 A;  3H0G B;  1DJR D;  2HDM A;  2MO0 A;  4NMZ A;  5GAE C;  2NN6 H;  5C4X H;  1LT3 D;  1ZKO A;  3OIP A;  4XYO A;  1XPU A;  3E0J A;  2F0V A;  3VR6 A;  1YZ6 A;  5K5P A;  3UDG A;  2BDO A;  1IBK Q;  4GS3 A;  3S17 B;  1GKH A;  4IOC A;  1F2Y A;  4OWT B;  4TRD A;  1EY4 A;  3QOL A;  4DF7 A;  1PZK D;  2KVM A;  1F77 A;  5JEA J;  3PF4 A;  3I4L A;  5FKA C;  3F2B A;  3CQZ B;  2EXD A;  3HOU B;  2UXC Q;  4LK1 C;  5IP7 G;  2D62 A;  1D5M C;  1WTH A;  4RA8 A;  3I2Z A;  3SK6 A;  5IT9 L;  1SNO A;  4K0K L;  4EQP A;  1DON A;  2JEA I;  5I4D A;  4A3L H;  2KHJ A;  1NR2 A;  2R6G A;  2OEO A;  4X3U A;  3HOY G;  2K28 A;  4LUO A;  1K28 A;  2OQK A;  4KN4 C;  5JJI A;  1BNZ A;  2ATW A;  1KRS A;  1CKO A;  1Z9F A;  4LFC L;  2ZTE A;  3J80 L;  1AFP A;  3GTO H;  2N3S A;  4A4I A;  5C3E H;  3G4S A;  1EOT A;  2EVB A;  2YU9 H;  3VR2 A;  1CA6 A;  1TT2 A;  4A75 A;  2IHF A;  3LGJ A;  4MN3 A;  3RMH A;  3K80 C;  4Y7N H;  3C3L A;  3PUX A;  3EFX D;  2CVR A;  4CGY B;  4KHZ A;  2TMP A;  1XWE A;  4MTN A;  4TSS A;  4C3I H;  2JA7 H;  1YHB A;  2EPB A;  1DGS A;  4Y52 H;  1KNE A;  3ND8 A;  1EEF D;  1K9M C;  3D4D A;  1VQ7 A;  1UUP A;  1J8I A;  2JA6 B;  2BE5 D;  3GTQ H;  2K5W A;  1ASY A;  3M3Y B;  1K83 H;  2E76 C;  2E75 C;  1PFB A;  1LO5 D;  3F8T A;  3E6Z X;  2B8G A;  2GN5 A;  4EQ5 A;  5A35 A;  1U4R A;  3F2U A;  1SMX A;  1QUQ B;  3T1Y L;  4IJH A;  4G4K A;  3K5M A;  4FXG C;  4KN7 C;  4AQY L;  1YVC A;  1SE3 A;  2F4I A;  3CRL C;  1SE8 A;  1E1T A;  4DV1 Q;  1SYB A;  4RGT A;  3J81 E;  2PI2 A;  4DNT B;  1VQC A;  2F0L A;  5FJ8 G;  2A69 D;  3NE5 B;  1MSH A;  2EYL A;  5FLM G;  1PZJ D;  1TWH B;  4K5W A;  1EY9 A;  1GUT A;  2M00 A;  3S14 B;  2LSS A;  4WFN 3;  3MA2 B;  3L7Z C;  2N78 A;  2MHV A;  4IPG A;  3TP7 A;  3RN2 A;  4KLK A;  1TS3 A;  3H0G G;  3S16 B;  4A3F B;  3UDF A;  5G3L D;  1QZG A;  4ZRZ A;  5AJ3 L;  1EOV A;  1PZI D;  4K6L A;  3HOW B;  2DNC A;  2HHH Q;  4CDE C;  1J5E L;  1W2B A;  1TS4 A;  2K5Q A;  3NTH A;  4N9T A;  3HZX A;  1B50 A;  2RDG A;  1CUK A;  4DR6 L;  4DV2 Q;  2OQ0 A;  1FR3 A;  1PXU A;  4L5Q A;  4C3J H;  4GKK Q;  1JWU D;  1N8R C;  2K75 A;  4ZCK A;  3W2D A;  3CCS A;  2WKD A;  5E1F A;  2UU9 L;  1PTO F;  1PH5 A;  3CCL A;  2L5T A;  4QJF A;  3HG9 A;  1A15 A;  4NXM L;  5CC4 A;  2AQ2 B;  1OXS C;  1FL0 A;  1NMG A;  4OO1 G;  2Z4H A;  2ICI A;  2F0I A;  4A3J B;  1K0R A;  1CKN A;  4BXX H;  1GXD C;  4JI3 Q;  3MEF A;  3IKJ A;  4B3R Q;  2OTL A;  2K4K A;  3ZYY X;  2A73 B;  4J6H A;  4R9W A;  4AYB E;  1DOL A;  4OIK A;  1HUN A;  1JMC A;  3AFP A;  2O5J C;  1D5Z C;  4U68 A;  1F9Q A;  3DWQ A;  3CC4 A;  1Y1V H;  2EQS A;  2K5H A;  1S72 A;  2X69 A;  2IY5 B;  1KIX A;  3MFG A;  3TEH B;  1XPR A;  2MUY A;  2LXJ A;  2NN6 G;  5J39 A;  3KLS X;  2I0Q A;  4JI2 L;  1EL0 A;  2IW3 A;  1BCP D;  2A6H C;  1A0I A;  1HNW L;  1YHQ A;  1IL2 A;  3NEN A;  1GUW A;  1I6H H;  1YJW A;  1H9J A;  5C3W A;  1LT5 D;  1SEB D;  1WD1 A;  2NVT B;  2I46 A;  2Z6B A;  3KF8 A;  3T1H L;  5HGT A;  3B6Y A;  4AIM A;  4HJ5 A;  3TDQ A;  1SFO B;  4C1N I;  3AEV A;  1OXX K;  2R3Z A;  4NP5 A;  4K0K Q;  2NWG A;  4MZ9 A;  4DR5 L;  3GD7 A;  4A3L G;  2EJF C;  3QR8 A;  2CCZ A;  1S5B D;  4LF7 L;  4IFD I;  4B3T Q;  1SDF A;  5I6W A;  1ILQ A;  3HOZ B;  4C56 C;  1N32 L;  4R4T A;  2RF4 A;  2RHQ B;  3OSO A;  1FGB D;  1E24 A;  4LF9 L;  4LFC Q;  2A74 C;  1VQ4 A;  1CK1 A;  1JWM D;  2JA9 A;  4YHH Q;  4DUZ Q;  5C3E G;  2XIW A;  4FDB A;  5M3M G;  4QY7 A;  3KF6 A;  3L2P A;  3G6E A;  5A2Q E;  3S2H H;  4LFB Q;  1IBM Q;  1CKN B;  3TZD A;  1V9P A;  5CBE E;  4X64 Q;  4GN5 A;  1WCM H;  4C3I G;  4DK3 C;  2JA7 G;  2PW5 A;  3DUZ A;  1HR0 L;  4C3H H;  2F1M A;  4A3E H;  3GTK B;  3KBX A;  4LF5 L;  4HN7 A;  2R92 B;  1JOR A;  1VF7 A;  4JI5 L;  1HH2 P;  3IAY A;  3MXU A;  1QVC A;  1XMQ Q;  2XNA C;  1ILP A;  1EYA A;  4B3M Q;  4KMU C;  2IJ0 A;  4PG3 A;  5M3F H;  4K8I A;  1Y1W H;  5C0X H;  2VQE L;  1YNJ D;  4OX9 Q;  2SNS A;  1F2M A;  1KTK A;  4HED A;  4M1U B;  4ME5 A;  4A3D B;  4DKA C;  2MGS A;  4HID A;  1I6V C;  4L8J A;  2A68 D;  1TWA B;  1DXM A;  2B29 A;  4LNQ A;  2XN9 C;  2XGT A;  3NEM A;  3KF8 B;  3AB9 A;  3HRZ C;  1QVF A;  2D5D A;  4IPC A;  2AHO B;  1PH2 A;  5LL6 X;  4XDX A;  4DV4 L;  3H91 A;  2XWB B;  1A62 A;  2RA4 A;  3KLS A;  3GTL B;  3I4M B;  1HRJ A;  3I4N H;  1I5F A;  2DJF C;  2HUG A;  1J6Q A;  4DUY Q;  1F9S A;  1K73 C;  4ZKC B;  2EJM A;  5ELC A;  3S1M H;  4OEL B;  3K7U C;  2VY3 A;  4CJ0 B;  1TY0 A;  5FO7 B;  2B2U C;  2D2C C;  2B2W C;  2ZTD A;  1J5E Q;  1L0X B;  3K8A A;  5E7N A;  1VF5 C;  3DWP A;  3R93 A;  1C4Q A;  2E5L L;  3RUZ A;  4HJ9 A;  1SRO A;  1CQF A;  4GLV B;  4KKT A;  4RKB A;  3URY A;  1IYU A;  5A2Q L;  3VYR A;  1SND A;  1X65 A;  3DHQ A;  1VMP A;  4EVO A;  4BY1 B;  1JOO A;  2TSS A;  4GKJ L;  1A8V A;  2IX3 A;  1V1P B;  2ZXR A;  4HCS A;  5I2Y A;  2RDF A;  4ID6 A;  2E8G A;  2OF1 A;  3CC2 A;  5KND A;  1KDB A;  5E3F A;  2R7Z B;  2CWP A;  5G3L F;  1XX8 A;  2UXD Q;  1WI5 A;  2E2H B;  1ET9 A;  2AMC B;  4QGU A;  1EEI D;  1MD2 D;  2F52 A;  4RGM A;  4BBS H;  4IUN A;  2F0D A;  1J9O A;  4KHV A;  5NUC A;  1YBY A;  1FJG Q;  2UXC L;  1MHW C;  1SNC A;  2CW0 D;  3A0J A;  2ZXO A;  1E22 A;  1Y1V G;  1K0S A;  3J80 c;  3NSW A;  5H1S E;  3AYH B;  3S1R H;  5IWA Q;  4UP9 A;  3H94 A;  2F0H A;  2G9H D;  4K8J A;  2F0U A;  2XRS D;  3PUW A;  3UE0 A;  4A3K G;  3CCJ A;  3FDT A;  3KOJ A;  3M9B A;  3A8K E;  2ES2 A;  3J7A V;  1O78 A;  3PO2 B;  1HNW Q;  1C7Y A;  3HOV H;  1CA5 A;  4DXF A;  4KJN A;  1BBX C;  5EGT A;  4PMB A;  3T13 A;  5C6A A;  4KKS A;  4LUV A;  3E5S A;  4JPB W;  1E2Z A;  3DWA A;  1SJH D;  2DJG C;  1D6E C;  2KCC A;  3GP7 A;  2N49 A;  3TRZ A;  4PZ6 A;  1I50 H;  2RCF A;  4ALP A;  4IPH A;  4ODG A;  2MPM A;  4XT3 B;  3VA5 A;  3J7A F;  5DM6 3;  1N33 Q;  3JC6 6;  1GHK A;  1HFN A;  5BN5 A;  3MEH A;  1S5D D;  1NY4 A;  3CW2 C;  1HPC A;  1QJO A;  1IBL Q;  1ONL A;  5EBD A;  1VQ9 A;  3BS1 A;  1K3R A;  1BCP F;  1NR4 A;  1TWF H;  2Z4I A;  3G71 A;  1EU4 A;  3OWE B;  1VQO A;  2P5Z X;  2MNA A;  4GOP C;  2B3G A;  1UE5 A;  2NZO A;  2IHE A;  2H5X A;  3RZD B;  4UHV A;  4DV1 L;  3K6O A;  1EY5 A;  1QNU A;  1C9O A;  1VQI A;  1B1Z A;  4IFD H;  2F0J A;  4GOP A;  3GTJ B;  2EY6 A;  2VB3 X;  3HOY B;  1B3A A;  5I2X A;  4DR4 Q;  1TWG H;  2G9D A;  2R93 H;  4WRD A;  3K58 A;  4HTH A;  3V96 A;  4AH6 A;  4A3E G;  4JOI A;  3K59 A;  3I91 A;  1JR0 D;  4A3I H;  1YNX A;  4IPD A;  4RGO S;  2K5D A;  2F0T A;  3BDC A;  1N9W A;  4JI5 Q;  1UNS A;  2KHS A;  4N8F A;  1PYB A;  1DYQ A;  2K04 A;  3TN2 A;  3CKI B;  2C35 B;  3SK5 A;  3ITP A;  3EA6 A;  1Y1W G;  4A3B H;  1K8O A;  4C1N K;  5C0X G;  5K36 G;  5GQO A;  2CFM A;  2HHH L;  3EQL C;  1QNK A;  3NTK A;  2R7Z G;  5IYD G;  4DAY A;  3ND9 A;  1YIT A;  4EQN A;  4IUU A;  2F3I A;  3N52 A;  3E9I A;  1RD9 D;  3HKS A;  2NVY B;  2KCM A;  4BBR H;  2L0C A;  4DR1 Q;  1VS0 A;  2KED A;  5DM7 3;  1X54 A;  1IHZ A;  4QF4 A;  4DV2 L;  1KXL A;  3E9H A;  5IY0 A;  1ENA A;  1HZA A;  2R61 A;  4ME3 A;  5EPJ A;  4GKK L;  1HZC A;  2B2V C;  1A3V A;  3KUP A;  5EAY A;  1A2T A;  1I3Q H;  4QMG A;  4H0L C;  3I4N G;  1TWC H;  1CSQ A;  2K6A A;  1D5X C;  1PH8 A;  1Q8I A;  3KYH C;  3K0Y A;  2KJX A;  1SMY C;  3MAQ A;  4KHP L;  3MXG A;  3M85 A;  1VQ8 A;  3F1Z A;  3KDF A;  2NVX H;  4Q0F A;  5C3X A;  1QE6 A;  4LW1 A;  1NNX A;  4IN3 A;  1WD0 A;  4JI3 L;  2JA8 H;  2OTJ A;  1PDQ A;  3PO2 G;  4RHS A;  3PF5 A;  3AU7 A;  2Q8T A;  3A56 A;  4TKO B;  5TSS A;  3MHB A;  1JJ2 A;  3PCO B;  4TQU S;  1B7Y B;  1OTC A;  2F0M A;  1YNN C;  3RLF A;  3RD4 A;  3TQY A;  3CCR A;  4LUZ A;  4F8M A;  4K6D A;  2AQ1 B;  3GTG H;  4GOP B;  3D4R A;  1QOH A;  2ID0 A;  2MQH A;  3NBI A;  1KL9 A;  4Q5V A;  4DR3 Q;  4KTA A;  1VQM A;  3BJU A;  1SYD A;  1MBY A;  1RDP D;  2PMZ E;  3AFQ A;  5ELE A;  4A93 H;  3EBE A;  1P8L A;  1PH6 A;  1L1O C;  2ZM6 Q;  5KYI A;  1MJE A;  1CHP D;  3PO3 H;  1MSG A;  5CR3 A;  1CZW A;  3BVZ A;  2E2I H;  3FEW X;  1XXG A;  2PNR C;  2NZH A;  3RZO H;  5JJL A;  1SAP A;  4KKU A;  4NXN Q;  5CYU A;  1I4P A;  2X6G A;  5CBA E;  1PFN A;  4DAY B;  3NTI A;  3PQI A;  1X3F A;  1L1O A;  5KIX A;  4I65 A;  2WAQ E;  3CC7 A;  2CQO A;  2K50 A;  5KRU A;  3MFY A;  4JVZ A;  1KNA A;  3HKZ E;  1EYC A;  3VYS A;  5IP9 H;  3S2D H;  1MKH A;  4B3T L;  3K7A H;  4O42 A;  1EY8 A;  2Z6K A;  4HIO A;  4YCW A;  1HNX Q;  1Z47 A;  3ULP A;  5CV7 A;  4GN4 B;  1E1O A;  3Q22 A;  4YHH L;  4DUZ L;  1ICW A;  3P7J A;  4L63 B;  1H9S A;  3KDF B;  1K8G A;  5D14 A;  2IT1 A;  3W1G A;  2H1E A;  1IBM L;  4LFB L;  4B9X A;  4G7O C;  5COR A;  3W3A A;  5JPN C;  4X64 L;  3S9W A;  3I3C A;  2UUC Q;  3SDZ A;  3TME A;  5IIF A;  1NSN S;  3C46 A;  1B70 B;  4JYA Q;  5C4X B;  5LL6 S;  2A6H D;  2LXK A;  1X6O A;  1IKL A;  3VR4 A;  4A3F H;  3DXJ C;  3PMF A;  3G6J B;  3CXC A;  3NBH A;  2A8V A;  2UXB Q;  3QO2 A;  3R2T A;  5ISR A;  1XMQ L;  1SNP A;  1SN8 A;  4B3M L;  2HQE A;  4KJO A;  1PLF A;  1Z7T A;  3I90 A;  4AYB G;  4MIU A;  1VQG A;  3A74 A;  2WB1 E;  1T5E A;  4OX9 L;  1F2L A;  3ONA B;  1KLU D;  1FD7 D;  2DN8 A;  3JAM E;  2RCN A;  1SLJ A;  4F7X A;  5M5X H;  1GUN A;  5AFW A;  3U58 A;  1RIP A;  5C44 H;  1GO3 E;  1LTI D;  3OIQ A;  3U50 C;  4DAM A;  1GUO A;  3SGI A;  1YI2 A;  4NW2 A;  1PTO H;  2Y0S E;  2NUC A;  4A3I G;  1TVX A;  3ULJ A;  1L1O B;  1LTL A;  4DV0 Q;  3U9S A;  4QCL A;  3GTO B;  1I4R A;  1W3S A;  2F0O A;  4QUC A;  1B9M A;  3S1N B;  4DUY L;  4A3J H;  5C3E B;  3UI2 A;  4OIJ A;  2YU9 B;  5M3M B;  3M7G A;  4IO9 A;  1ZXT A;  4EQO A;  1SYC A;  3GDE A;  4Y7N B;  5EPK A;  1HQR D;  3TS2 A;  2O4X A;  5BN4 A;  4ZLT F;  4P74 A;  5IYB H;  4C3I B;  4P72 A;  2JA7 B;  4BBR G;  1H9S B;  1PH7 A;  4JI4 Q;  1EWH A;  2F4V Q;  2KUM A;  1B53 A;  1H9M A;  5FO8 B;  4DV3 Q;  4UP8 A;  1FGU A;  1UWV A;  2EYO A;  2XVS A;  3GTQ B;  1FYC A;  2FJ2 A;  1K83 B;  1XNQ Q;  4BA2 I;  1UEB A;  2F0E A;  3EJI A;  4DA2 A;  2B63 H;  1STA A;  3HOX H;  3OMG A;  5GAG C;  2E2D C;  3ERS X;  4DN4 M;  2F0F A;  3M4O H;  5GAH C;  4KHP Q;  3NBH B;  1WOC A;  2UXD L;  5CV4 A;  4YCV A;  1C8C A;  4GNX A;  5IGE A;  4FF2 A;  3HS0 C;  2EYJ A;  1B3Q A;  2JA8 G;  4ZK9 B;  1TS2 A;  1SJE D;  1SE4 A;  1F2Z A;  5JVH 3;  3FRP B;  1EQT A;  2VW9 A;  4A3C G;  3T56 B;  1SNM A;  1UEA B;  3KBG A;  1KDC A;  2BDN A;  3MXP A;  4DXG A;  4OWW B;  1TQO A;  1TII D;  4CJ1 B;  3H3V I;  1FJG L;  4CKB A;  4QQB X;  3D3R A;  1X3E A;  3JAM L;  1SXT A;  3CME A;  1G2T A;  4DAV A;  4DAP A;  5IWA L;  1KAA A;  1VQJ A;  2I5H A;  2JJQ A;  3L3O C;  1K8M A;  4ZUI A;  1M90 C;  3G7L A;  3J81 L;  5IGF A;  2OT2 A;  2D0O A;  1EYD A;  1KRT A;  1SSO A;  3LWU A;  2N55 A;  4R8N A;  2ZT9 C;  3OW2 A;  4OXP A;  4XQQ A;  5C4X G;  4LF8 Q;  1N34 Q;  3I8Z A;  1NMF A;  4UPA A;  1EZ8 A;  3GTP H;  3E3X A;  1NTG A;  3SE0 A;  3PO3 G;  1R4Q B;  1BF4 A;  4KY6 A;  1YJ9 A;  3FVQ A;  4NDX A;  5BR8 Q;  1HZB A;  5D3I B;  5F2D A;  1PVO A;  3ULL A;  1EU3 A;  4ZAI A;  1Q8K A;  2SDF A;  2LS0 1;  3MXN A;  3A7L A;  3S1Q H;  5C4H A;  2QDB A;  2X6L A;  1N33 L;  1OXT A;  2R92 H;  4P75 A;  1KD1 C;  3RLO A;  1JB3 A;  2RKS A;  3K81 C;  4QIW B;  4XQJ A;  3R3O A;  4TVA B;  1TY2 A;  3CPF A;  4RWS C;  4WOR A;  1B44 D;  1Q82 C;  2O5I C;  1V43 A;  1IBL L;  2Z9H A;  4BY7 H;  1C48 A;  3T53 B;  1X3P A;  4B08 A;  4IZ8 A;  3M4Q A;  4ZUJ A;  2H4O A;  1VQH A;  4G7H C;  2BH2 A;  3GO5 A;  2WV6 D;  1PRT C;  3M4Y A;  4CKC A;  2ASB A;  1Y1V B;  1I4Q A;  1KAW A;  2OXP A;  2VQF Q;  2Q2U A;  2VUM H;  1C0A A;  1U4L A;  2LY7 A;  2QKI C;  1CSP A;  4IOA A;  2L1B A;  3P75 A;  1BBU A;  3Q6S A;  4DR4 L;  3KLW A;  1EIG A;  4A3K B;  4N9P A;  1XNR Q;  3I4M H;  4HMJ A;  3E0E A;  4PV1 C;  1EZ6 A;  2PQA A;  1STH A;  4LF6 Q;  1LTR D;  3A55 A;  4BA1 I;  1I6H B;  1D2B A;  4C2M H;  3J81 j;  2QEX A;  2GVA A;  5JEA H;  1HNZ Q;  1ZEQ X;  5T1G A;  3K5L A;  4X3S A;  1JT8 A;  1GOZ A;  4KY5 A;  3GQB A;  3A5Z B;  1DM0 B;  1F9R A;  4JI7 Q;  2JA5 H;  1RKN A;  2G5D A;  1FNV A;  4O0A A;  3WDN A;  2DGY A;  4OGQ C;  1IZ6 A;  3LWE A;  3NQI A;  2B2T A;  2CH4 W;  5C44 G;  1XMO Q;  3WOF A;  3PV0 A;  4MNO A;  4F87 A;  4DR1 L;  2PZT A;  4GLX A;  2J7Z A;  3D8G A;  4H44 C;  3PIP A;  1LTA D;  2ALY B;  3MXN B;  1CZG A;  2JQO A;  4K2K A;  4FYD A;  2WP8 J;  3CMA A;  4JBK A;  1EWI A;  2BOS A;  3P1H A;  4JI1 Q;  2ZJP A;  4DR2 Q;  3OHX C;  4OON A;  1Q1B A;  2J0T D;  1XTC D;  4J15 A;  4OO1 I;  1IKM A;  4JI8 Q;  3I7F A;  1QWY A;  3NQT A;  2VNU D;  2EXZ A;  2KA7 A;  4LMQ D;  1L0Y B;  5IYC H;  1DCZ A;  1TS5 A;  3S2H B;  3AQQ A;  5C4J H;  2K52 A;  2F0N A;  4XYQ A;  3GTM H;  3ICE A;  1STY A;  2AQ3 B;  2K05 A;  5GRO A;  1CHQ D;  2BH8 A;  2CKZ B;  1AZQ A;  1WCM B;  4FF3 A;  4C3H B;  1PMR A;  3KF6 B;  4A3E B;  1EYG A;  3NUC A;  2ICE C;  1BVS A;  1RJT A;  2PMZ B;  2EE1 A;  4C3J G;  4J8Q A;  5T1I A;  5J22 A;  1K3B C;  1GD7 A;  2Q8R E;  2NN6 I;  3X3M A;  1H95 A;  1PYW D;  4QUF A;  5M3F B;  3J80 i;  3PIP 3;  2JSO A;  1PRT B;  4DR3 L;  1Y1W B;  5C5L A;  2OCE A;  4E6I A;  3D6C A;  2PQA B;  1SNQ A;  2YTV A;  4O1N A;  5IT9 c;  2F0S A;  1R9T H;  4BXX G;  2ZM6 L;  1AH9 A;  1ENF A;  3GV3 A;  3HKZ B;  4YCU A;  1WTO A;  2EYP A;  1WTQ A;  5M5W H;  4A3G H;  4KI0 A;  4NXN L;  3WOE A;  1AZP A;  1FVI A;  2IX0 A;  3BDL A;  3TP5 A;  2K32 A;  2LMC B;  4POF A;  1JOQ A;  3EN2 A;  2XWJ B;  4FXD A;  2RSO A;  2A6E D;  3SXH A;  3I4N B;  1SMY D;  1T5X D;  3KFU A;  5EKI A;  3EIV A;  4YWL A;  3NWS A;  1G2S A;  2M9V A;  3S1M B;  1SRU A;  1STE A;  1RTO A;  2FXQ A;  1Q81 C;  1HNX L;  3TRE A;  2L11 A;  2AWN A;  3LNN A;  5LMN W;  2I07 B;  3H3V H;  3TBI B;  2QCP X;  1WJJ A;  4DK1 A;  2K03 A;  2K1B A;  4HAE A;  1YNN D;  2R7F A;  1TU2 B;  4I7A A;  2Z8L A;  4JBM A;  3HOY H;  2L12 A;  1WTW A;  3H15 A;  2HIX A;  1E2W A;  1OO9 B;  3MWY W;  5M5Y H;  4X3T A;  2UUC L;  2ZTC A;  1II3 A;  1TXY A;  3T16 A;  4JYA L;  1A2U A;  1UE1 A;  2PI2 E;  1A3T A;  1SBB B;  3NHH A;  3FP9 A;  3DEO A;  5LHY 1;  2DY8 A;  2UXB L;  1VQA A;  4K5V A;  4XT1 B;  3CCM A;  4OHJ A;  1WVL A;  2VZA A;  2E2J H;  5IE8 A;  4APV A;  5JPM C;  3RNU A;  1EY7 A;  1E0B A;  1E3P A;  2ENB A;  2UUA Q;  4DV7 Q;  4X66 L;  3KK7 A;  1HXY D;  1OXV A;  4JOI C;  4PQX A;  5CV8 A;  2K7V A;  1XPO A;  2ZJQ A;  3L0O A;  2VUM G;  4A3M H;  3S15 H;  4DR7 Q;  3S1R B;  3GV6 A;  3Q23 A;  3OTO Q;  1I4G A;  1WCM G;  1L0W A;  4C3H G;  1IYJ B;  3K5N A;  4DV0 L;  1BUV T;  1KDA A;  2KEE A;  3IL8 A;  1U5K A;  4DU9 A;  3Q24 A;  3ZJY C;  3HOV B;  3I73 A;  2PQE A;  5JEA G;  1HJP A;  2SNM A;  4RCN A;  3X3N A;  5M3F G;  5DEH A;  5HUR A;  4HIK A;  4IAL A;  3BG3 A;  5FJ8 H;  3P20 A;  3FKI H;  4PZ8 A;  5ELF A;  1EY6 A;  1W6K A;  1I50 B;  3CP0 A;  1LTT D;  4UDU C;  2WAQ G;  2DNE A;  4X62 Q;  3NWT A;  1O7L A;  3HP3 A;  2EJG C;  1W6J A;  3HKZ G;  4JI4 L;  2J4X A;  2F4V L;  2NTT A;  1E2V A;  2D0P A;  1IW7 C;  3H0G H;  4JCV E;  4DV3 L;  2YTX A;  3VR5 A;  3F2D A;  1LV9 A;  1GJX A;  2O2L D;  1VQ6 A;  1XNQ L;  4ABN A;  3BZD B;  3VYU A;  1TWF B;  2QW7 A;  1ET6 A;  5J1Z A;  1LT4 D;  3MZ5 A;  4FP5 D;  5I9P A;  1I94 Q;  3OYY A;  1LM0 A;  1DD2 A;  4H7B A;  3CAM A;  3QG1 A;  4AYB B;  2A6E C;  2IPK D;  3U4Z A;  2WII B;  4EX5 A;  2F3V A;  5M9O A;  1Q7Y C;  1PV4 A;  3S17 H;  1LUZ A;  5IYC G;  2FFK B;  1FNW A;  1PFM A;  3JAM c;  1PH9 A;  1DOM A;  1GVP A;  1V8Q A;  1EQV A;  1UE7 A;  2FIN B;  2JP1 A;  4IUV A;  4V0B A;  5E4X A;  4LFA Q;  3M7N A;  4P73 A;  4R1J A;  3J81 c;  3CQZ H;  1U0L A;  4JI6 Q;  3HOU H;  3C1E A;  2R93 B;  1TWG B;  1NAP A;  3J80 E;  1A63 A;  4HJ7 A;  3OOC A;  4A3I B;  3BYT B;  4DV5 Q;  1ENC A;  2NVQ B;  4OO1 H;  2NYZ D;  2F0G A;  2I5M X;  2KQ3 A;  4LJZ C;  4Z9C B;  1QVG A;  4NPS A;  3QJY A;  3L9A X;  3M4P A;  4A3B B;  3C1F A;  4LF8 L;  1N34 L;  4LAA A;  1EFI D;  3OWF A;  2WB1 G;  4F88 A;  2KHI A;  1PHJ A;  2XRQ D;  1JIC A;  1LTS D;  1WTR A;  1B2T A;  3Q8D A;  3K57 A;  5L37 A;  3DLL A;  1VQK A;  5J3B A;  4HCE A; 
#chains in the Genus database with same CATH homology
 4BBR B;  2E74 C;  5JVG 3;  3H6M A;  3VYT A;  3CRK C;  1JOK A;  1I3Q B;  4HSV A;  1TWC B;  2AWO A;  1JQY D;  3OMC A;  2EY5 A;  3J7Y W;  2NVX B;  2HDL A;  4ZYS A;  2JA8 B;  2K33 A;  1BXT A;  5EJW A;  1V1O A;  4I7Z C;  1DZ1 A;  5CV9 A;  5C0X J;  5DAU A;  2EYF A;  3R2I A;  5EBC A;  3DEP A;  2EDG A;  2SOB A;  3OPO A;  3BYY B;  4KD4 A;  1HUM A;  4XTC S;  2KCN A;  3GTG B;  3EVQ A;  4IUR A;  2DY7 A;  4K2L A;  5EPL A;  1M8A A;  1ZYR C;  4L6T B;  4CJ2 C;  1JE4 A;  4YIJ A;  3SR1 A;  3QIA A;  4A93 B;  1Q90 A;  1O7Z A;  1PTO C;  1SYF A;  1LT6 D;  4RH6 A;  2IX1 A;  1NCV A;  1TR5 A;  5C0X I;  4CBV A;  3PO3 B;  2RBM A;  4FF4 A;  4BS9 A;  1LTG D;  2E2I B;  3RZO B;  5COY A;  4XXE A;  5FLX E;  1QB5 D;  2K01 A;  5EQ0 A;  2V4D A;  2PO4 A;  2M2L A;  2C5C A;  4IFD G;  3N6R A;  1QG7 A;  4HSP A;  4QB4 A;  3S2D B;  3K7A B;  2QF7 A;  2RVL A;  1LAC A;  2NTS A;  1RTN A;  4FF1 A;  1STN A;  5JJZ A;  4ILW A;  5FO9 B;  4KK7 A;  5KNC A;  1PRT D;  4IUP A;  4IUQ A;  3HGB A;  1JC7 A;  4KV6 A;  1CTM A;  4CKE A;  1EWC A;  1CI3 M;  3K5O A;  5C5M A;  4DFA A;  1G6Z A;  2D9U A;  5CMD A;  2FHT A;  1S4Z A;  3NPP A;  4ULL A;  1M4V A;  1WTV A;  2F3W A;  5IOD A;  4G57 A;  1D1K A;  2HCC A;  1HA5 A;  4V19 0;  3OW7 A;  3QOJ A;  4FVM A;  2AUJ D;  1Y69 U;  1BO0 A;  3SK8 A;  3DMU A;  1A3U A;  3IFT A;  5KGU A;  2BA0 A;  4ZQ3 A;  5M5X B;  5C44 B;  1Q1E A;  2LKV A;  2JEB I;  1PTO B;  2BCO A;  5FLX L;  1FNU A;  1NUC A;  2B8F A;  4FXK C;  5I6Y A;  1H9K A;  3SVM A;  2VB2 X;  4IUT A;  4EGV A;  2NZ1 D;  1H9R A;  2B39 A;  1SE2 A;  5FOB B;  2Q8I B;  3NXW A;  1U9R A;  1AN8 A;  2PCF B;  4HMI A;  4C3J B;  2PYK A;  3C2P A;  3TSS A;  1U4M A;  4IFD J;  2B63 B;  3HOX B;  2KOL A;  4PMW A;  3ERQ A;  1SYE A;  3M4O B;  1MI2 A;  1BQQ T;  2BE5 C;  3BVM A;  3V2T A;  4B9W A;  1ESF A;  1ESR A;  3NK9 A;  1HTP A;  5IOC A;  5IGC A;  3TP8 A;  4DK0 A;  3QWN A;  2B2Y C;  3QB3 A;  4U67 3;  2A69 C;  1LLR D;  5IGG A;  4H13 C;  4PMC A;  1VDZ A;  2FMC A;  5D65 A;  3Q0A A;  2RQX A;  1JCK B;  4K14 A;  2JYO A;  2NB0 A;  2JE6 I;  2B2Y A;  5E4W C;  3CHB D;  3GTP B;  1Q12 A;  1Y8O B;  3FMC A;  1S5F D;  2LFN A;  2B2T C;  3A8J E;  1WTX A;  2KEC A;  4MHE A;  1STB A;  1V1P A;  4RKL A;  1IYV A;  5IGB A;  4PNY A;  1GUS A;  3S1Q B;  1X32 A;  1X3Q A;  1XYI A;  3TZU A;  1G8Z D;  4P2C B;  2F0W A;  5CV6 A;  1IL8 A;  2EYH A;  5K36 H;  4BY7 B;  3MVV A;  5FK9 C;  1WTP A;  5ELB A;  3NP8 A;  2MJ8 A;  3I70 A;  1RHP A;  3AMU A;  1BR9 A;  2PZW A;  2VUM B;  1UAP A;  3HEJ A;  4UAI A;  1CQV A;  5JAV A;  2CHB D;  4DGZ A;  1AP0 A;  2PW7 A;  1QCB D;  2C9O A;  3BVG A;  1D1I A;  4RGN A;  1A6X A;  2A5H A;  4C2M B;  1HA6 A;  3V05 A;  3R8B A;  2F0P A;  1BCP C;  4JBW A;  3SK4 A;  1PRT F;  2JA5 B;  4CHT B;  3PUV A;  3A54 A;  1RF2 D;  2RSN A;  4DNR B;  2B2U A;  3VA7 A;  2B2W A;  2WAQ B;  2GA4 B;  5CGK A;  1EY0 A;  4IQZ A;  1IW7 D;  3H3V C;  2YYZ A;  4FO2 A;  5I9O A;  1HTL D;  3MC0 B;  2PZU A;  1AW7 A;  3A7A B;  3SHL A;  2IWH A;  3T51 B;  1ML0 D;  1CT1 D;  5KNB A;  1DOK A;  2FMM A;  1MGS A;  1JWS D;  5C4J B;  3GTM B;  1STG A;  2BA1 A;  1B9N A;  2QEJ C;  1GUG A;  2VXW A;  3PUZ A;  5D3D A;  2EY1 A;  1GHJ A;  2WKC A;  5ELD A;  1BDO A;  3BDO A;  4WJW A;  1O7Y A;  2QIL A;  3LX0 A;  2ZXP A;  1BOS A;  4NKL A;  4ZKB B;  1CFM A;  2N88 A;  2WAC A;  3IFD A;  4R8I A;  2EY2 A;  2MP1 A;  2WB1 B;  1HFG A;  1Y8N B;  5CV5 A;  1HQM C;  2SEB D;  5EKL A;  1R9T B;  3A8I E;  2PPB C;  4BBS B;  1YNJ C;  4X3K A;  5M5W B;  4A3G B;  3ERO A;  1U4P A;  1CM9 A;  1Q3L A;  1G91 A;  3VR3 A;  2XSC A;  5C4Z A;  2Y0S B;  3PIO 3;  4RHR A;  2A68 C;  1TKW B;  3I72 A;  5KEE A;  4J1M A;  1BCP B;  2EYM A;  1I4X A;  1ROD A;  4XIG S;  3H09 A;  1HHV A;  4G7Z C;  3U9O A;  4S3S A;  4RAU C;  1G29 1;  1R4P B;  5EKK A;  1I4H A;  3D4W A;  1Y8P B;  1RCV D;  2L4N A;  4GZY C;  4HR7 B;  3SEB A;  3MTS A;  3FPP A;  4M8A A;  1S5E D;  5M5Y B;  1ZYR D;  5DNF A;  1B4O A;  4RCO A;  1LTB D;  1Z6H A;  3PUY A;  2L9H A;  2IL8 A;  1EIH A;  1PTO D;  1F9P A;  4JK1 C;  1QIL A;  2E2J B;  2NBF A;  2Z1C A;  5IGD A;  2JXM B;  5IT9 E;  3CU7 A;  2RDH A;  2CQA A;  3FPU B;  2F03 A;  4A3M B;  3S15 B;  4KY7 A;  5JOB A;  3D31 A;  2CW0 C;  3DM1 A;  3TP6 A;  4FNF A;  1OXU A;  4K5X A;  2B2V A;  1VCI A;  2F0Q A;  1KAB A;  2WIN B;  1SYG A;  2EZV A;  4BWG B;  2AUK A;  2EOT A;  3FKI B;  3O13 A;  4KD3 A;  1VMC A;  4XQN A;  5BN3 A;  2HCI A;  3KLR A;  2F0K A;  1HCZ A;  5KYL A;  1LAB A;  3T4A C;  1S5C D;  4OL7 A;  1KLG D;  2L55 A;  3D6W A;  1AEX A;  4RFB A;  1O80 A;  3H0G B;  1DJR D;  2HDM A;  4NMZ A;  2NN6 H;  1LT3 D;  1ZKO A;  3OIP A;  4XYO A;  3E0J A;  2F0V A;  3VR6 A;  5K5P A;  2BDO A;  3S17 B;  1F2Y A;  4TRD A;  1EY4 A;  3QOL A;  4DF7 A;  1PZK D;  2KVM A;  1F77 A;  5JEA J;  3I4L A;  5FKA C;  3CQZ B;  3HOU B;  4LK1 C;  2D62 A;  1D5M C;  4RA8 A;  3SK6 A;  5IT9 L;  1SNO A;  4EQP A;  1DON A;  2JEA I;  5I4D A;  1NR2 A;  2R6G A;  2OEO A;  4X3U A;  2K28 A;  4KN4 C;  1BNZ A;  3J80 L;  1AFP A;  1EOT A;  2EVB A;  3VR2 A;  1CA6 A;  1TT2 A;  4MN3 A;  3RMH A;  3C3L A;  3PUX A;  3EFX D;  2CVR A;  4CGY B;  4KHZ A;  2TMP A;  1XWE A;  4TSS A;  2EPB A;  1KNE A;  3ND8 A;  1EEF D;  3D4D A;  1UUP A;  1J8I A;  2JA6 B;  2BE5 D;  2K5W A;  3M3Y B;  2E76 C;  2E75 C;  1PFB A;  1LO5 D;  3E6Z X;  2B8G A;  5A35 A;  1U4R A;  3F2U A;  4G4K A;  3K5M A;  4FXG C;  4KN7 C;  1SE3 A;  2F4I A;  3CRL C;  1SYB A;  4RGT A;  3J81 E;  4DNT B;  2F0L A;  2A69 D;  3NE5 B;  1MSH A;  2EYL A;  1PZJ D;  1TWH B;  4K5W A;  1EY9 A;  1GUT A;  2M00 A;  3S14 B;  4WFN 3;  3MA2 B;  3L7Z C;  2MHV A;  3TP7 A;  1TS3 A;  3S16 B;  4A3F B;  5G3L D;  4ZRZ A;  1PZI D;  3HOW B;  4K6L A;  2DNC A;  1TS4 A;  2K5Q A;  3NTH A;  4N9T A;  3HZX A;  1B50 A;  2RDG A;  1FR3 A;  1PXU A;  1JWU D;  3W2D A;  2WKD A;  5E1F A;  1PTO F;  2L5T A;  3HG9 A;  1A15 A;  5CC4 A;  2AQ2 B;  1OXS C;  4OO1 G;  2Z4H A;  2ICI A;  2F0I A;  4A3J B;  1GXD C;  3IKJ A;  3ZYY X;  2A73 B;  4J6H A;  4R9W A;  1DOL A;  4OIK A;  1HUN A;  2O5J C;  1D5Z C;  4U68 A;  1F9Q A;  3DWQ A;  2X69 A;  3MFG A;  2MUY A;  2NN6 G;  5J39 A;  3KLS X;  1EL0 A;  2IW3 A;  1BCP D;  2A6H C;  1GUW A;  1H9J A;  5C3W A;  1LT5 D;  1SEB D;  1WD1 A;  2NVT B;  2I46 A;  3KF8 A;  5HGT A;  3TDQ A;  1SFO B;  4C1N I;  1OXX K;  2R3Z A;  4NP5 A;  2NWG A;  3GD7 A;  2EJF C;  1S5B D;  4IFD I;  1SDF A;  5I6W A;  1ILQ A;  3HOZ B;  4C56 C;  3OSO A;  1FGB D;  2A74 C;  1CK1 A;  1JWM D;  2XIW A;  5A2Q E;  3TZD A;  5CBE E;  4C3I G;  2PW5 A;  3DUZ A;  2F1M A;  3GTK B;  3KBX A;  4HN7 A;  2R92 B;  1JOR A;  1VF7 A;  3IAY A;  3MXU A;  2XNA C;  1ILP A;  1EYA A;  4KMU C;  2IJ0 A;  4K8I A;  5C0X H;  1YNJ D;  2SNS A;  1F2M A;  1KTK A;  4HED A;  4M1U B;  4ME5 A;  4A3D B;  2MGS A;  1I6V C;  4L8J A;  2A68 D;  1TWA B;  1DXM A;  2XN9 C;  3AB9 A;  3HRZ C;  2D5D A;  5LL6 X;  4XDX A;  3H91 A;  2XWB B;  2RA4 A;  3KLS A;  3GTL B;  3I4M B;  1HRJ A;  2HUG A;  1F9S A;  4ZKC B;  2EJM A;  5ELC A;  4CJ0 B;  1TY0 A;  5FO7 B;  2B2U C;  2D2C C;  2B2W C;  1L0X B;  1VF5 C;  3DWP A;  3R93 A;  1C4Q A;  3RUZ A;  1CQF A;  4KKT A;  4RKB A;  3URY A;  1IYU A;  5A2Q L;  3VYR A;  1SND A;  3DHQ A;  1VMP A;  4EVO A;  4BY1 B;  1JOO A;  2TSS A;  2IX3 A;  1V1P B;  2ZXR A;  4HCS A;  5I2Y A;  2RDF A;  4ID6 A;  2OF1 A;  5KND A;  1KDB A;  5E3F A;  2R7Z B;  5G3L F;  1XX8 A;  2E2H B;  1ET9 A;  1EEI D;  1MD2 D;  4RGM A;  4IUN A;  2F0D A;  1J9O A;  4KHV A;  5NUC A;  1SNC A;  2CW0 D;  2ZXO A;  3NSW A;  3H94 A;  2F0H A;  2G9H D;  4K8J A;  2F0U A;  2XRS D;  3PUW A;  3FDT A;  3A8K E;  3J7A V;  1O78 A;  3PO2 B;  1CA5 A;  4DXF A;  4KJN A;  1BBX C;  5EGT A;  4PMB A;  3T13 A;  5C6A A;  4KKS A;  3E5S A;  1E2Z A;  3DWA A;  1SJH D;  2KCC A;  1D6E C;  3GP7 A;  4ODG A;  2MPM A;  4XT3 B;  3VA5 A;  3J7A F;  5DM6 3;  1GHK A;  1HFN A;  5BN5 A;  3MEH A;  1S5D D;  1HPC A;  1QJO A;  1ONL A;  5EBD A;  3BS1 A;  1BCP F;  1NR4 A;  2Z4I A;  1EU4 A;  3OWE B;  3RZD B;  3K6O A;  1EY5 A;  1QNU A;  1B1Z A;  4IFD H;  2F0J A;  3GTJ B;  2EY6 A;  2VB3 X;  3HOY B;  1B3A A;  5I2X A;  2G9D A;  4WRD A;  3K58 A;  4HTH A;  3V96 A;  3K59 A;  3I91 A;  1JR0 D;  4RGO S;  2K5D A;  2F0T A;  3BDC A;  1UNS A;  2KHS A;  1DYQ A;  2K04 A;  3TN2 A;  3CKI B;  3SK5 A;  3ITP A;  3EA6 A;  1K8O A;  4C1N K;  5C0X G;  5K36 G;  3EQL C;  1QNK A;  3NTK A;  4DAY A;  3ND9 A;  4EQN A;  4IUU A;  3N52 A;  1RD9 D;  2NVY B;  2L0C A;  2KED A;  5DM7 3;  1IHZ A;  4QF4 A;  1ENA A;  2R61 A;  5EPJ A;  2B2V C;  1A3V A;  3KUP A;  1A2T A;  4QMG A;  4H0L C;  2K6A A;  1D5X C;  1Q8I A;  3K0Y A;  2KJX A;  1SMY C;  3MAQ A;  3MXG A;  3M85 A;  4Q0F A;  5C3X A;  1QE6 A;  4IN3 A;  1WD0 A;  1PDQ A;  4RHS A;  3AU7 A;  2Q8T A;  3A56 A;  4TKO B;  5TSS A;  3MHB A;  4TQU S;  2F0M A;  1YNN C;  3RLF A;  3RD4 A;  4F8M A;  4K6D A;  2AQ1 B;  3D4R A;  1QOH A;  2ID0 A;  3NBI A;  4Q5V A;  4KTA A;  1SYD A;  1MBY A;  1RDP D;  5ELE A;  5KYI A;  1CHP D;  1MSG A;  5CR3 A;  1CZW A;  3BVZ A;  3FEW X;  1XXG A;  2PNR C;  1SAP A;  4KKU A;  5CYU A;  1I4P A;  2X6G A;  5CBA E;  1PFN A;  3NTI A;  5KIX A;  4I65 A;  5KRU A;  3MFY A;  1KNA A;  1EYC A;  3VYS A;  4O42 A;  1EY8 A;  1Z47 A;  5CV7 A;  3Q22 A;  1ICW A;  3P7J A;  4L63 B;  1H9S A;  5D14 A;  2IT1 A;  2H1E A;  4B9X A;  4G7O C;  5COR A;  3W3A A;  5JPN C;  3S9W A;  3I3C A;  3SDZ A;  3TME A;  5IIF A;  1NSN S;  3C46 A;  5C4X B;  5LL6 S;  2A6H D;  1IKL A;  3VR4 A;  3DXJ C;  3PMF A;  3G6J B;  3NBH A;  3QO2 A;  3R2T A;  5ISR A;  1SNP A;  2HQE A;  4KJO A;  1PLF A;  1Z7T A;  3I90 A;  4MIU A;  1T5E A;  1F2L A;  3ONA B;  1KLU D;  1FD7 D;  2DN8 A;  3JAM E;  4F7X A;  1GUN A;  5AFW A;  1LTI D;  3OIQ A;  1GUO A;  4NW2 A;  1PTO H;  2NUC A;  1TVX A;  3U9S A;  4QCL A;  3GTO B;  1I4R A;  2F0O A;  4QUC A;  1B9M A;  3S1N B;  5C3E B;  3UI2 A;  4OIJ A;  2YU9 B;  5M3M B;  3M7G A;  1ZXT A;  4EQO A;  1SYC A;  4Y7N B;  5EPK A;  1HQR D;  2O4X A;  5BN4 A;  4ZLT F;  4C3I B;  2JA7 B;  1H9S B;  1EWH A;  2KUM A;  1B53 A;  1H9M A;  5FO8 B;  2EYO A;  2XVS A;  3GTQ B;  1FYC A;  2FJ2 A;  1K83 B;  4BA2 I;  2F0E A;  3EJI A;  4DA2 A;  1STA A;  3OMG A;  2E2D C;  4DN4 M;  2F0F A;  5CV4 A;  1C8C A;  5IGE A;  4FF2 A;  3HS0 C;  2EYJ A;  4ZK9 B;  1TS2 A;  1SJE D;  1SE4 A;  1F2Z A;  5JVH 3;  3FRP B;  1EQT A;  3T56 B;  1SNM A;  1UEA B;  3KBG A;  1KDC A;  2BDN A;  3MXP A;  4DXG A;  1TQO A;  1TII D;  4CJ1 B;  4CKB A;  3D3R A;  3JAM L;  1SXT A;  1G2T A;  4DAV A;  4DAP A;  1KAA A;  3L3O C;  1K8M A;  4ZUI A;  3G7L A;  3J81 L;  5IGF A;  2OT2 A;  1EYD A;  1SSO A;  3LWU A;  2N55 A;  4R8N A;  2ZT9 C;  4XQQ A;  3I8Z A;  1EZ8 A;  3SE0 A;  1R4Q B;  1BF4 A;  4KY6 A;  3FVQ A;  4NDX A;  5D3I B;  5F2D A;  1EU3 A;  4ZAI A;  2SDF A;  2LS0 1;  3MXN A;  3A7L A;  5C4H A;  2QDB A;  2X6L A;  1OXT A;  1JB3 A;  2RKS A;  4QIW B;  4XQJ A;  3R3O A;  1TY2 A;  4RWS C;  4WOR A;  1B44 D;  2O5I C;  1V43 A;  1C48 A;  3T53 B;  1X3P A;  4B08 A;  4IZ8 A;  4ZUJ A;  2H4O A;  4G7H C;  3GO5 A;  2WV6 D;  1PRT C;  3M4Y A;  4CKC A;  1Y1V B;  1I4Q A;  2OXP A;  1U4L A;  2LY7 A;  2QKI C;  2L1B A;  3P75 A;  3Q6S A;  1EIG A;  4A3K B;  4N9P A;  4HMJ A;  4PV1 C;  1EZ6 A;  1STH A;  1LTR D;  3A55 A;  4BA1 I;  1I6H B;  1D2B A;  5JEA H;  1ZEQ X;  5T1G A;  3K5L A;  4X3S A;  1GOZ A;  4KY5 A;  3GQB A;  1DM0 B;  1F9R A;  1RKN A;  1FNV A;  3WDN A;  4OGQ C;  3LWE A;  3NQI A;  2B2T A;  3WOF A;  3PV0 A;  4F87 A;  2PZT A;  2J7Z A;  3D8G A;  4H44 C;  1LTA D;  1CZG A;  4K2K A;  4FYD A;  2WP8 J;  2BOS A;  3P1H A;  3OHX C;  1Q1B A;  2J0T D;  1XTC D;  4OO1 I;  1IKM A;  1QWY A;  3NQT A;  2VNU D;  2EXZ A;  2KA7 A;  4LMQ D;  1L0Y B;  1DCZ A;  1TS5 A;  3S2H B;  2F0N A;  4XYQ A;  1STY A;  2AQ3 B;  2K05 A;  1CHQ D;  1AZQ A;  1WCM B;  4FF3 A;  4C3H B;  1PMR A;  4A3E B;  3NUC A;  2ICE C;  1RJT A;  2PMZ B;  2EE1 A;  4C3J G;  4J8Q A;  5T1I A;  5J22 A;  2Q8R E;  2NN6 I;  3X3M A;  1PYW D;  4QUF A;  5M3F B;  3PIP 3;  2JSO A;  1PRT B;  1Y1W B;  5C5L A;  4E6I A;  3D6C A;  1SNQ A;  4O1N A;  2F0S A;  1ENF A;  3GV3 A;  3HKZ B;  1WTO A;  2EYP A;  1WTQ A;  4KI0 A;  3WOE A;  1AZP A;  2IX0 A;  3BDL A;  3TP5 A;  2K32 A;  2LMC B;  1JOQ A;  2XWJ B;  4FXD A;  2RSO A;  2A6E D;  3SXH A;  3I4N B;  1SMY D;  1T5X D;  5EKI A;  3NWS A;  1G2S A;  2M9V A;  3S1M B;  1STE A;  1RTO A;  2L11 A;  2AWN A;  3LNN A;  2I07 B;  3TBI B;  2QCP X;  4DK1 A;  2K03 A;  2K1B A;  4HAE A;  1YNN D;  1TU2 B;  2Z8L A;  2L12 A;  1WTW A;  1E2W A;  1OO9 B;  3MWY W;  4X3T A;  1II3 A;  3T16 A;  1A2U A;  1A3T A;  1SBB B;  3NHH A;  3DEO A;  5LHY 1;  2DY8 A;  4K5V A;  4XT1 B;  4OHJ A;  1WVL A;  5JPM C;  1EY7 A;  1E0B A;  2ENB A;  3KK7 A;  1HXY D;  1OXV A;  4PQX A;  5CV8 A;  2K7V A;  3S1R B;  3GV6 A;  3Q23 A;  1I4G A;  4C3H G;  3K5N A;  1BUV T;  1KDA A;  2KEE A;  3IL8 A;  4DU9 A;  3Q24 A;  3HOV B;  3I73 A;  2PQE A;  5JEA G;  2SNM A;  4RCN A;  3X3N A;  5DEH A;  5HUR A;  4IAL A;  3BG3 A;  3P20 A;  5ELF A;  1EY6 A;  1W6K A;  1I50 B;  1LTT D;  4UDU C;  2DNE A;  3NWT A;  1O7L A;  3HP3 A;  2EJG C;  1W6J A;  2J4X A;  2NTT A;  1E2V A;  1IW7 C;  3VR5 A;  1LV9 A;  1GJX A;  2O2L D;  4ABN A;  3BZD B;  3VYU A;  1TWF B;  1ET6 A;  5J1Z A;  1LT4 D;  3MZ5 A;  4FP5 D;  5I9P A;  1DD2 A;  4H7B A;  4AYB B;  3QG1 A;  2A6E C;  2IPK D;  2WII B;  2F3V A;  5M9O A;  2FFK B;  1FNW A;  1PFM A;  1DOM A;  4IUV A;  1V8Q A;  1EQV A;  2FIN B;  2JP1 A;  4V0B A;  5E4X A;  3M7N A;  3C1E A;  2R93 B;  1TWG B;  1NAP A;  3J80 E;  3OOC A;  4A3I B;  3BYT B;  1ENC A;  2NVQ B;  4OO1 H;  2NYZ D;  2F0G A;  2KQ3 A;  4LJZ C;  4Z9C B;  3QJY A;  3L9A X;  4A3B B;  3C1F A;  4LAA A;  1EFI D;  3OWF A;  4F88 A;  2XRQ D;  1JIC A;  1LTS D;  1WTR A;  1B2T A;  3K57 A;  4HCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...