1SNQA

Protein stability in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 38
structure length 130
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snqA00
2EY2A 1EY7A 2RDFA 2F0UA 2F0QA 1A2UA 1TR5A 4N9PA 3TP7A 1JOOA 1TQOA 1RKNA 2F0TA 1II3A 5IGCA 1EY4A 3ITPA 3SK4A 5JAVA 2ENBA 3OMGA 4DGZA 5CR3A 4HMJA 4EQNA 1JOKA 2F0MA 1EY5A 4K5WA 5NUCA 2PQEA 1SYBA 4J6HA 3SHLA 2EYFA 2OF1A 4NDXA 1SNPA 5C3XA 2PZUA 2F0DA 5C3WA 4TRDA 4K2KA 2SNMA 3EROA 3SXHA 5C4ZA 4KHVA 4KTAA 5JOBA 2LKVA 4PNYA 3TMEA 4HMIA 4IUNA 4OL7A 2F0HA 3QOLA 5CGKA 4N9TA 2EY1A 4MIUA 4ZUJA 5IIFA 5ISRA 2EYJA 4ODGA 3U9OA 3NQTA 5K5PA 5KGUA 2NUCA 2EY6A 1STNA 4HTHA 5IGEA 1SYCA 2EXZA 4ID6A 3C1FA 2EYOA 5C5MA 4B9WA 3EJIA 1KDCA 4S3SA 1F2MA 4NMZA 4J1MA 3HEJA 2F0NA 3SK5A 1EY0A 1ENCA 1NUCA 5CV5A 4F8MA 4RKBA 5HGTA 5CV7A 2SOBA 2EYLA 3D8GA 4K5VA 1JOQA 2M00A 2PZTA 5HURA 1AEXA 4KY7A 1EZ8A 3ERQA 5KYIA 4PMBA 2PZWA 1STBA 1U9RA 3P75A 4K2LA 4QF4A 1STGA 5IOCA 2PW7A 2F0PA 3LX0A 5I6YA 3TP8A 2SNSA 3C1EA 2OEOA 5KYLA 4K8JA 1KABA 3TP6A 1EYDA 1NSNS 1F2YA 1SNMA 5J1ZA 4KV6A 5CC4A 1EYAA 2EYHA 3BDLA 4G57A 3T16A 4DF7A 2F0WA 3NXWA 1KDBA 3MVVA 3QOJA 5M9OA 3OWFA 3BDCA 2PYKA 4K6DA 5EKKA 3D6CA 4ZQ3A 4EQPA 5IGGA 1A3UA 4KY5A 5F2DA 3TP5A 5KIXA 4K14A 5E3FA 4PMCA 1F2ZA 3VA5A 2F0VA 4KD4A 4NKLA 3SR1A 1JORA 2EYMA 4WRDA 3S9WA 4K5XA 4WORA 1KDAA 3MHBA 1A2TA 3PMFA 4KY6A 4ZUIA 4KJOA 4EQOA 5IGFA 3NUCA 4ME5A 3MZ5A 5CV6A 2F0LA 2KQ3A 2O4XA 3R3OA 4H7BA 1EZ6A 1STHA 4EVOA 3EVQA 5DEHA 1SYFA 3V2TA 3MXPA 1EY9A 3HZXA 2PW5A 5C4HA 1SNQA 5CV4A 5C6AA 4KD3A 3D4DA 1STYA 4KJNA 3SK6A 3P1HA 2RKSA 5C5LA 1SNCA 2KHSA 3NHHA 4K8IA 5IGDA 3H6MA 5J22A 1EY6A 3NK9A 3OSOA 2HQEA 4IZ8A 3RUZA 3SK8A 5KEEA 1EQVA 5IODA 1EYCA 1SNOA 1A3VA 1SYEA 4QMGA 5DAUA 3NP8A 4DU9A 1A3TA 1SNDA 1EY8A 1SYGA 2EYPA 4NP5A 4QB4A 2OXPA 2F0SA 2WACA 2QDBA 3MEHA 4R8NA 1STAA 3E5SA 4F7XA 5KRUA 2F0EA 5CV9A 2F0GA 1ENAA 3QB3A 4I65A 5CV8A 3D4WA 5J39A 1TT2A 2RBMA 3DHQA 4LAAA 2EY5A 4RKLA 5EKLA 5EGTA 5I6WA 4IALA 1IHZA 3OMCA 5IGBA 3T13A 2F0FA 2F0IA 4B9XA 5I9PA 4DFAA 1KAAA 2F0OA 4E6IA 2F0KA 5I9OA 1SYDA 2F3WA 2F3VA 2F0JA 3DMUA 5E1FA 4YIJA
chains in the Genus database with same CATH superfamily
2XN9C 4NXNQ 1LTAD 3S17B 1KXLA 1H9MA 1G51A 1VQPA 4M1UB 2PQAB 4NW2A 3H3VH 3J81E 1D6EC 2Q2TA 5C4ZA 3J80E 3I55A 5GAGC 2NN6G 4DNIA 5KNCA 5CGKA 2F4VQ 4OIJA 1BOSA 3VR2A 2CWAA 1IKMA 2EYJA 4ODGA 5HGQA 5C4JB 1J9OA 1ICFB 2RQXA 3I4OA 2Q2HA 2IX3A 1V9PA 1ENCA 1EY0A 3K58A 4HJAA 5CV5A 4F8MA 4RKBA 1IL2A 1KRTA 1LUZA 5IE8A 2QGQA 5IYBH 1HUNA 4DR5L 1LLRD 4A3MG 3PO3H 4FDBA 1IKLA 3UI2A 1BF4A 2VW9A 3GTGB 3GTLH 5ELCA 2WB1B 4P2CB 2NZOA 3GV6A 4XDXA 5I2XA 2RA4A 3S1RB 4A3LG 2JA7G 1E0BA 1DOLA 3I2ZA 3NUCA 1EUJA 2FHTA 1OO9B 4G7OC 3FHWA 1JJ2A 2AWNA 5GAEC 4LFAQ 5LMUL 4R4CA 4JI5Q 4A3GB 1QG7A 3NK9A 2JEAI 4JI7L 1WCMB 1Z47A 1SYGA 1VQ4A 2E2JB 1HTLD 4RHRA 1NBWA 2WB1G 2ZTCA 4LF5Q 3DHQA 3H09A 3BVMA 3DWPA 4GN5A 5EKLA 1S5FD 2K01A 3FKIH 4L6TB 2CVRA 3NEMA 2B2TA 2BDNA 3TS0A 4X64L 1RIPA 2AHOB 3J80c 4RA8A 4OX9L 1EWHA 1N34L 4EQNA 1JOKA 2ATWA 1LABA 3SHLA 2ZT9C 5IP9H 1VQLA 2UXDQ 2K14A 1PYSB 4GNXC 3CC4A 4JBMA 4FO2A 1TVXA 1HRJA 4RH6A 1SAPA 1Y14B 2NYZD 2A73B 2B2WA 4B3SL 2VNUD 1S5BD 4IFDG 3CRKC 3EJIA 2Z0SA 1AZPA 1ZYRC 3X3MA 3S1MH 1B4OA 4A3IB 2KENA 4B08A 3K5OA 4JG2A 3HKZB 2WAQE 1PRTC 4UHVA 3H15A 2AWOA 4X3KA 3F2BA 1K83B 3RLOA 4A93G 1EWIA 1CA5A 5IOCA 1IBML 3LX0A 3D6WA 1PTOB 4BBRH 5KYLA 5COYA 3STBD 1VDZA 1VQOA 4G7ZC 2EYHA 4RGMA 1VQJA 3K7AH 3M4QA 1PTOF 1HR0L 3GTMB 1WTXA 2R61A 4JI4L 4KY5A 4DV2L 3QIAA 4HJ9A 1FL0A 2Z8LA 3A8JE 1EU4A 2CH4A 3FPPA 3HOXH 1PFNA 2VB2X 3A54A 1AFPA 3PUVA 4OWWB 4H7BA 2L4NA 1STHA 1G91A 2RCNA 1W2BA 5DEHA 3KF8B 3MXPA 2K75A 5BR8L 1RCVD 2PW5A 3HZXA 5C4HA 3C46A 3S24A 3PV0A 3M85A 1YNXA 2HHHL 1STYA 1LACA 5I2YA 2OTJA 4RGOS 3KLSX 4HN7A 2JA7B 2MJ8A 3DEPA 4JI2Q 2J7ZA 2OXPA 3FMCA 1LT4D 1JCKB 1O78A 4G4KA 1TY2A 4RKLA 2JP1A 3PUYA 2K04A 2J0TD 5IT9E 3IFDA 2UXBL 3FP9A 3NENA 2MHVA 2Y0SE 1EL0A 2I0QA 4ZK9B 3N52A 1Y1VH 4JI3Q 3OMGA 2YV5A 1HNWQ 4H0LC 4LF8Q 4IFDJ 5CR3A 1PH1A 5IWAQ 2UXCL 2HCIA 1PV4A 5M3MG 1EWCA 4A3BG 3JAMc 2BA0A 4LJZC 1GUWA 5C3XA 3KDFB 3HG9A 1SMXA 3H0GG 4K2KA 1SE4A 1OXUA 4GOPC 4DV5Q 4OL7A 5IT9c 1XMOQ 2FMCA 2JA7H 4FP5D 2NUCA 4F88A 2N3SA 1HNXQ 1V1QA 5EPLA 4C3HH 3VYSA 3HRZC 1L1OA 1VS0A 3U9SA 2F0NA 5C4XB 1RTNA 3SGIA 5CBEE 2JA9A 3EBEA 2PZTA 2Y0SG 1AEXA 2XWJB 3BS1A 1TS2A 3KOJA 1SFOH 3T1YL 1U9RA 1XMOL 4XYQA 2A68D 2DN8A 1KLUD 1ML0D 3T1YQ 3K5NA 5C3EB 2VZAA 4RGNA 2KA7A 1NSNS 1TU2B 4GLVB 2Z6BA 5C0XI 4LFBL 4DPGA 4LF9L 4DF7A 4EGVA 2CCZA 1QJOA 1KDBA 3D4RA 1BCPB 1EYGA 2FXQA 5F2DA 1HQRD 2L11A 2WV6D 1JORA 3BZDB 3G6EA 2MO1A 4DV5L 2PMZB 4IJLA 1FD7D 3PMFA 3KUPA 5BN4A 3FEWX 2KQ3A 2Q2UA 4XYOA 5ELNA 2A5HA 1O7YA 3RZOH 1TY0A 1VQAA 1JJCB 1CM9A 1JB3A 1HQMC 3ND8A 1DJRD 2SEBD 4YY3Q 1Y8NB 1UNSA 4QGUA 2I5MX 2IT1A 1MGSA 4P72A 4KLKA 4RHSA 3PUXA 4TSSA 4DV1L 4C56C 4A76A 2QDBA 5JVH3 2FFKB 4DR1Q 2YTYA 4CDCC 3BVZA 2D2CC 1FR3A 3J81i 2TMPA 3MTSA 3NBIA 3Q22A 4ZRZA 2FINB 5DM73 4PQXA 5CORA 5FLMG 3G7LA 1TWCB 1GUTA 4IUVA 2JE6I 4G7HC 2F0TA 2WIIB 2O5JC 2HHHQ 2EJFC 2K5HA 4ZYSA 4LFCQ 1JE5A 1D5ZC 1D1IA 3SEBA 4DV0Q 1Q8IA 5FLXc 3RN2A 1WTVA 4B3ML 1J5EQ 2PZUA 5C3WA 5M5XH 1X3EA 1NR4A 2IW3A 3TMEA 4H44C 2VXWA 4DV4Q 5K36H 1LTSD 5DLQE 2KOLA 2NB0A 4ID6A 4IN3A 5C5MA 3Q0AA 1F2MA 5M3MB 4J1MA 2A8VA 1CHQD 3HEJA 3Q6SA 1N36Q 2VUMG 3OW7A 1R9TH 1TWGB 1YNNC 3CCRA 5FOBB 4GNXB 5GQOA 2V4DA 3I56A 4YHHQ 2EDGA 5D65A 3BZCA 4Y52H 4X3UA 3J81j 1YZ6A 5IYDG 2Z4IA 2KUMA 3STBC 3L9AX 2AQ2B 1YNJD 2F0WA 3A0JA 3QOJA 3NELA 4HIKA 4A3DH 3A7AB 4OX9Q 3M3YB 1RHPA 5DNFA 4PMCA 4KD4A 5C3EG 1MD2D 3R2IA 3S1NB 4WORA 1H9JA 3CAMA 3PO2H 5A2QE 4R9WA 4I7ZC 1U4PA 2EJMA 2UXDL 4XTCS 1HR0W 1V1PB 4IJHA 1Q81C 4QIWB 4LF5L 4A3FH 1YITA 5EJWA 1CKOA 2RKSA 3SDZA 1X55A 4X64Q 3DWAA 5J22A 3NE5B 3OSOA 1WOCA 4V0BA 1ZKOA 1EQVA 2UUCL 4JOIC 5DAUA 4BY1G 5C0XG 1FGUA 2KHIA 4RGTA 3MEHA 4C3IG 1X65A 2KJXA 2HQLA 2A74C 5J39A 1EIYB 1JQYD 2VQEL 5ELBA 3GO5A 3BYTB 2F0IA 5I9PA 4U68A 3M3YH 4JI7Q 3GTOH 3OIQA 2EY2A 1TR5A 5ELDA 2Q8TA 1TQOA 4LFAL 1HHVA 1II3A 3HKZG 2R93H 4JYAL 4DGZA 1ASZA 4FXDA 2EXDA 4XQJA 4A3IH 2ZM6Q 4BS9A 1E22A 4HCSA 1PZID 2ZXOA 1QCBD 1LV9A 3EROA 1QILA 2B2YC 4U673 3K5LA 3T51B 3CC2A 2RF4A 2EY1A 3CCVA 1S5ED 3HOUH 2DJFC 3DWQA 2WFWA 4FF3A 2JA8B 2B63H 1O7LA 4IURA 2JSOA 4FF4A 3FDTA 4LF9Q 3U58A 4LFBQ 2A6HC 1XNRQ 4OEMB 1UE7A 3D8GA 2R7ZH 4JV5Q 1S40A 1I4QA 1MI2A 4DAPA 1HTPA 3EIVA 3CCSA 4A3GG 1BKBA 2CKZB 4EX5A 4BBSH 2A69D 4DAMA 5CC4A 1HZAA 1X3GA 1V1OA 3H0GH 4EQPA 1E1TA 4GKKL 1W3SA 4K14A 4OHJA 1K9MC 2BA1A 1UEBA 3L3OC 4QIWE 1E1OA 5FKAC 3J7ZC 1IZ6A 1WTPA 4CJ1B 3HOYH 1YIJA 4HAEA 1WTWA 2LFNA 4B3TL 1F2LA 4BY1H 1HNWL 2NN6I 1VQMA 3A56A 3JAMi 4DR7Q 1E2WA 1RTOA 3HOYG 3NHHA 2RSOA 1VF7A 2HQEA 1AP0A 1LTID 1EQQA 2UXBQ 3JAME 3P20A 2EIFA 1Y8PB 1I94L 4X66Q 4F87A 1M90C 1TWFB 5KRUA 2HIXA 5CV9A 1AE2A 3PO3B 3WDNA 1JB7A 5M3FH 1IYUA 3M7GA 2E2IH 1K3BC 1QNUA 1PHJA 3A8KE 2WB1E 1SR3A 3I4NH 1CFMA 3MFGA 2N49A 1S3OA 4LMQD 2KVMA 2Y0SB 4P74A 2MNAA 3I8ZA 2EYFA 1Y1VG 5LL6S 1K73C 2B63B 4BY1B 1JJGA 5EKIA 4YWKA 3LNNA 1Q86C 3MXGA 4MHEA 4IUNA 3S14B 1G2TA 1XNQQ 3U4VA 3O13A 1YNND 4MIUA 1L1OC 4CKCA 4L5RC 3H3VC 2EY6A 5AFWA 4B9WA 1Y1WG 3UE1A 3WWVA 1BDOA 1Q90A 3I3CA 3M9BA 1YJNA 1EZ8A 1M4VA 1IBMQ 4QF4A 1ASYA 1X3QA 3A5ZB 1G6PA 1ET9A 1C48A 3S2DB 4GZYC 1S5CD 4NB3A 4RWSC 5G3LF 3PF5A 3TEHB 1ONLA 1Y1VB 1PTOD 3BDLA 4FXKC 4OIKA 3T16A 2ASBA 1IYVA 4KHZA 3E0JA 4JW0A 5M9OA 1XPUA 2K5DA 4JI6Q 1JT8A 3KF6B 3H3VI 4A3MB 2EYMA 5T1IA 4K5XA 4P73A 2A6EC 3MHBA 2CW0D 1AZQA 3GDEA 4HCEA 4XT1B 3TDQA 4DR2Q 2I46A 3CXCA 5IY0A 4KKTA 3CCJA 3V05A 3F1ZA 3DEOA 3TRZA 1C8CA 1J8IA 4A3KG 2JA8H 2I5HA 3IFTA 1QOHA 5T1GA 2L0CA 1EOTA 4R8NA 1L0YB 2RSNA 2ALYB 3I4NB 3K80C 1VQ7A 4HJ7A 2IPKD 2UUAQ 2EY5A 1LTGD 4BBRB 2K52A 4AYBE 1I94Q 1TKWB 1A0IA 3RR5A 5E1FA 4AYBB 1GKHA 4MNOA 5M5YB 1J6QA 2K7VA 1BCPF 4DR7L 1B53A 3S14H 4DV6Q 4CKBA 4DUYQ 1TWGH 1HZCA 4IFDI 3UDFA 1PH2A 3LGJA 3T4AC 4V190 5FJ8G 2E74C 2Z1CA 3ONAB 2CHBD 4HMIA 4Q5VA 1PXUA 1Z7TA 4N9TA 1U4MA 5C0XH 2XSCA 2K32A 4HR7B 3MA2B 1T5EA 4CJ0B 1QUQA 1XNRL 1KDCA 3BZKA 4NXMQ 3PUZA 2JJQA 3ULPA 1EIGA 4C3HB 1JMCA 1YNJC 1ET6A 1PYBA 1X54A 4HIMA 2F4IA 2NVTB 1XX8A 3LWEA 1SE8A 1Q12A 2B39A 3S1NH 4PMBA 1KLGD 1C9OA 3ND9A 2K4KA 3P7JA 1HJPA 4PG3A 5M3FB 5LMNL 4L5TA 4JPBW 1QUQB 2ZTEA 4BY7B 1H9KA 1TS3A 1SNMA 2M2LA 3GP7A 4DR3L 4A3IG 4L5SA 2BE5C 5EPJA 1Y1WB 3NTHA 2C5CA 3WOEA 5GAHC 5FO7B 3A55A 3FKIG 1CKMA 3BDCA 4XQQA 3GTPB 2WP8J 1XXGA 2EJGC 4JYAQ 4DV3Q 3RNUA 2J4XA 2N88A 3VA5A 2F0VA 1H9SB 1RDPD 4DA2A 1TWHH 2AUJD 1D7QA 1NTGA 1BBXC 4IOAA 2LSSA 4MZ9A 3MZ5A 1G8ZD 4EVOA 1CZWA 1SLJA 4H13C 1GXDC 4DV7Q 2VQEQ 4Y7NB 1IXRA 3RLFA 1SNQA 3H91A 3DM3A 4BWGB 1B8AA 3RZOB 1GUGA 4LF7L 2K1BA 1BVSA 1N32L 2NWGA 1L2FA 3P1HA 2ZJPA 1WVLA 4OO1G 3AMUA 4GOPA 2R93G 1KTKA 3K7AB 1A3VA 1HPCA 3NP8A 4ABNA 3I7FA 1F9QA 4LWCA 1HZBA 1B3AA 1T5XD 1TIID 1ILPA 1WD0A 3CKIB 1PH5A 4JBWA 1VMCA 3HOZH 3VR5A 2ZXRA 5IGBA 4JI0Q 1VQEA 4B9XA 4DNTB 2Z4HA 3GD7A 1LM0A 2F0JA 2K6AA 4KHVA 2Q8IB 4GKJL 4YIJA 2OQ0A 2N78A 1X56A 1A2UA 2B2UC 1C4QA 2Q8RE 3ITPA 1EIHA 2I5LX 3MC0B 2PI2A 2A69C 4K5WA 3D3RA 1GHJA 1G291 1SNPA 1VQGA 3K0XA 1N33L 2E5LL 3G6JB 2VB3X 4KTAA 2VQFL 2LKVA 2YTXA 2O5IC 4R4OA 5IYCH 3T53B 1ESFA 2RVLA 3MFYA 4FVMA 2OTLA 4ZKCB 1WFQA 5EQ0A 1QVGA 3T1HQ 4HTHA 2B29A 1Q46A 1HNZL 1N36L 1CKNA 5LHY1 3K59A 3J81c 4HSVA 5FLXE 3CD6A 1ILQA 2G5DA 5M3MH 4K5VA 3W3AA 1AH9A 4IOCA 1EEID 5KYIA 3RN5A 1STBA 3AFQA 1XWEA 2K5NA 2MGSA 1BQQT 2R7ZG 3PSIA 3HOYB 1EYDA 1PZJD 1EYAA 1B9NA 3ZYYX 1UEAB 2K5WA 4C3HG 4LFCL 4DKAC 5JPNC 5EKKA 4ZQ3A 4UAIA 3UDXA 1JWSD 3HGBA 3A7LA 5LMNW 1CTMA 1WYDA 5A2QL 4GKJQ 2H5XA 4ZUIA 1BXTA 4ILWA 3URYA 5CV6A 1Q1BA 1SE2A 4B3MQ 1SYFA 4X62L 2M9VA 1YJWA 5G3LD 1I50B 5C44B 2AQ1B 2R7ZB 4DXFA 2NTTA 3BDOA 1GOZA 4GNXA 1P16A 2AKWB 4OWXB 1PTOH 2WKCA 4DAYA 1YVCA 3Q8DA 4QB4A 1YJ9A 2XGTA 1D8LA 4DR1L 2FMMA 3G71A 2DNCA 2F0EA 3HFZB 1MSHA 1GUNA 3D4WA 4DV7L 2JA6B 4C3JB 4LUOA 1KAAA 4ZCKA 4LW1A 1PA6A 3DMUA 2MO0A 3ULJA 4PMWA 1IBLQ 4UY8C 1OXTA 1I6HB 2K50A 1SJED 3KLWA 2KBNA 2G9HD 3M4OH 2UUBL 5JAVA 2ZJQA 2QF7A 4YWLA 1E7ZA 2EZVA 3KBGA 2B2UA 3VDYA 4LNQA 3HOVG 2A19A 4TRDA 2HIVA 2BH8A 3I91A 1F9SA 5C3EH 3QO2A 2CQOA 3VYRA 2QA4A 3BYYB 1MSGA 5IGEA 1U4LA 2R92H 1GVPA 2MPMA 1OXSC 2FJ2A 3PIPA 1I6VC 2IHEA 2Z6KC 3HOUG 1DYQA 1LTTD 1XJVA 2K03A 4R4IA 2N8NA 1PRTF 2PZWA 2NVQB 2D62A 4HJ8A 4IUTA 3L2PA 4K0KQ 4FNFA 1KABA 3NWTA 3JC66 1GM5A 1PRTD 4XXEA 1CI3M 3V96A 1PFBA 3CCUA 2QCPX 4A3JB 4ME3A 2A6HD 2UXCQ 4DUYL 1JICA 1X6OA 4PV1C 4QUCA 2XNAC 5J3BA 4C2MH 3CCMA 2WAQG 4ALPA 4DR4Q 1I4HA 4R4TA 1NR2A 5FLMH 1IBLL 2MQHA 3RMHA 4KY6A 1A2TA 5IGFA 5KNBA 3KLRA 4WJWA 2E76C 4OWTB 4DK6C 2F52A 2HDLA 1NMGA 3HP3A 2RDGA 1JWMD 5KNDA 2IJ0A 4LF8L 2UUBQ 2RCFA 1QZHA 4HIOA 1DOKA 1IW7D 1EOVA 1SNCA 2KHSA 4K8IA 5IGDA 1NJIC 4HJ5A 5E4XA 1EIFA 3K7UC 2D0PA 4C3JH 3GTJH 2MP1A 2QDLA 3AYHB 2JN4A 3GTLB 3OHXC 2X6GA 2DY7A 1UE6A 2G9DA 3QB3A 2NTSA 3U50C 4BBSB 1SEBD 4DR2L 1YHAA 4NPSA 4A4IA 1QE6A 2F0FA 3M7NA 5CMDA 4TKOB 1X9NA 2F3WA 3S1MB 1SFOB 4DN4M 3J7A5 4A3MH 1NNXA 2HDMA 4QUFA 1MIUA 4UP9A 1HR0Q 1A6XA 2KEEA 1AE3A 2IWHA 5BR8Q 4ZKBB 3VYUA 3HOWG 2EE1A 1SYBA 3PIOA 1NAPA 1O80A 1PLFA 3CCQA 1A63A 3EN2A 2SNMA 1BBUA 4DK1A 1YHBA 4PNYA 5D3IB 5M5WB 3J7YW 1WTHA 1Z6HA 5ISRA 2XRQD 5KGUA 3NQTA 2JA6G 3OWEB 4JI4Q 1Q3LA 1T9HA 4JI8Q 2DUDA 3E9HA 3CHBD 1KL9A 3C1FA 3ICEA 1VQKA 1KC8C 3Q24A 1RJTA 5ELEA 4GLAC 5K36G 3K8AA 2ICIA 3T1HL 3UE0A 1JOQA 2R3ZA 5HURA 3S2HH 4A3JH 3P75A 4IPCA 4K2LA 2RDHA 1TWAB 1XPOA 3MAQA 3FRPB 3TP8A 4X6AH 2R7FA 1RODA 1SROA 4Y7NH 1PH3A 3RLNA 4KV6A 4OGQC 2A1AA 3OTOL 1JR0D 5A35A 4RG1A 3M4YA 2B3GA 4XIGS 3NXWA 2R92G 1CZGA 3TZUA 1FGBD 1U4RA 2LS01 4Z9CB 2QEJC 1I4PA 1BCPD 3SR1A 1L0XB 4WRDA 1K28A 3UDIA 1E2ZA 4KJOA 1XPRA 1N33Q 4LF6L 1V43A 1CHPD 2F0LA 4JI0L 1A8VA 4JBJA 3GTJB 1DGSA 1X3FA 2B2YA 4AQYQ 2AUKA 4IPGA 1S5DD 5EBCA 4O2DA 4QQBX 1VQCA 4IZ8A 1TS5A 4UP7A 1STEA 2JA5H 4JI5L 2YYZA 3F2UA 2WACA 1N32Q 1QZGA 1FNWA 1STAA 4JC0A 1IBKL 3R8BA 2F0GA 4B3TQ 1ENAA 3I90A 3CMAA 5CV8A 1TT2A 2RBMA 4LAAA 5EGTA 1R9TB 4IALA 1SMYC 2R6GA 1VMPA 1JC7A 4C3IB 2F3VA 4HSPA 5IT9L 3GTQB 3MXUA 2HUGA 4CDEC 2F0UA 2F0QA 1TWHB 4N9PA 4C3JG 1WJJA 4DV3L 4GKKQ 3A5UA 1AN8A 3KDFA 4GN3B 3TBIB 1ESRA 2PMZE 1UUPA 2F0DA 1SRUA 1L0WA 1GO3E 4CGYB 5LMNQ 5EPKA 1VQIA 3RZDH 2B2VC 3QOLA 1KNAA 4JV5L 3GTKB 3L7ZC 2O2LD 4BA1I 5IYCG 1B3QA 2EXZA 3PQIA 1QVFA 2PNHA 1OTCA 5D3DA 3HOWB 2TSSA 3SK5A 4NXML 3PO2G 3A8IE 3H94A 5CV7A 4XT3B 4DUZQ 4KY7A 2X69A 4DR5Q 1JE4A 1SSOA 3VYTA 1WTQA 3SE0A 3FPUB 2R93B 2OEOA 1D1KA 4RCNA 4CKEA 4G57A 1G2SA 3HKSA 4A3BB 1VF5C 2CQAA 3NSWA 2PYKA 1I4XA 3NTIA 1XYIA 2BOSA 1G6ZA 2E2DC 2B8FA 2P5ZX 3RD4A 3GTOB 4L5QA 3RZDB 3KF6A 3CPWA 1BBWA 3DUZA 3T56B 3PO2B 2UUAL 1R4QB 3I4MB 4A93H 5CYUA 3HOZG 3PIP3 2JYOA 1MBYA 2XTIA 4KD3A 4KJNA 3SK6A 1GD7A 4NXNL 3W2DA 1F77A 3ZJYC 4O42A 4IO9A 4R1JA 2HCCA 3VR3A 5KEEA 5JEAG 1CA6A 1BUVT 1SYEA 3QR8A 4P75A 3VA7A 5M5XB 1SNDA 1B7YB 1SXTA 1V8QA 1R4PB 2GA4B 4DAYB 1CT1D 2F0SA 1X3PA 2E2HH 1B50A 3PO3G 4F7XA 3K6OA 1K0RA 1DZ1A 4AQYL 1IBKQ 3TREA 4I65A 4CJ2C 5LL6X 2RHQB 4BY7H 1IL8A 4O1NA 3T13A 4LF6Q 1EQTA 4AH6A 5I9OA 1I5FA 1HH2P 3IKJA 3F2CA 4YWMA 3C2PA 1YEZA 3KF8A 3KJOA 1WCMH 1NMFA 1QB5D 4HMJA 1DM0B 4CBVA 4IUUA 1M8AA 2DGYA 4JI1Q 3J81L 2PQEA 3ERSX 4Q0FA 1NCVA 4XQNA 1CUKA 3HS0C 2NZHA 2NVQH 1WTRA 2B2TC 3SXHA 4POFA 4JVZA 4C1NK 4ZUJA 2UU9Q 1VQ8A 5IYDH 4J15A 1RL2A 4N8X1 1SYCA 4IPHA 3CQZH 2E2HB 4S3SA 3S16H 1V1PA 3OTOQ 1H9SA 1ENFA 2ZJRA 3S17H 5HGTA 2SOBA 5M5YH 2PQAA 4RCOA 4A3BH 1DD2A 1Q1EA 3AFPA 1STGA 5I6YA 5JEAH 2Q2IA 1HZ9A 2KECA 1YBYA 4KN7C 2WINB 1F2YA 1VQ9A 2N55A 4DV0L 1I4GA 2D9UA 4CDDC 2LXKA 1NY4A 3EA6A 4JI8L 1FNVA 3BVGA 3TN2A 4RAUC 2NN6H 1XNQL 1FYCA 1OXVA 1Q82C 1K3RA 4EQOA 2NVXB 1PMRA 1L1OB 3R3OA 4GN4B 2PCFB 1CSPA 2XWBB 4QY7A 3J80i 2D0OA 2NVTH 5EBDA 1JWUD 4KHPL 3AEVA 3L0OA 3D4DA 4K6LA 4GLXA 5C4JH 2Z6KA 2DY8A 3QJYA 1EU3A 4C1NI 1XTCD 2F1MA 2LY7A 3UDGA 4YY3L 3AB9A 4A3KB 4A3EG 4LUZA 2VUMB 3SVMA 2D5DA 1DONA 1IYJB 4YCVA 1KIXA 1UE1A 2H1EA 4O0AA 4POGA 2IX1A 3HOUB 5I6WA 4L63B 1IHZA 4X66L 2KCTA 3HOVH 2HT1A 5DM63 2KCCA 2ES2A 3D31A 1AW7A 4JBKA 1I3QH 2CFMA 2RDFA 5CBAE 1CK1A 5AJ3Q 1JOOA 5IGCA 5IP7G 4B3RL 5JJKA 2L9HA 2B2VA 3ER0A 1EY4A 3NQIA 2ENBA 2EQSA 1EFID 3S1RH 1DOMA 1HCZA 3CP0A 4A3JG 1WTOA 4J6HA 1X32A 1B1ZA 4NDXA 1GUOA 2IHFA 3M4PA 1F9PA 5JEAJ 2NBFA 1IW7C 4K0KL 4KMUC 2C9OA 3H0GB 5IIFA 1ZXTA 5C44H 1MJEA 3MWYW 4DR4L 1K0SA 1KAWA 1Y69U 4X3TA 1PFMA 1KNEA 4NMZA 2ZTDA 5IYBG 2R92B 2YU9B 2EVBA 2OQKA 5GADC 1HNXL 4M8AA 3TSSA 2F3IA 3ERQA 5M3FG 4BA2I 1HFNA 3GTKH 3I4LA 3CCEA 1XMQL 2PW7A 4DUZL 3C1EA 2VY3A 4K8JA 1D5MC 1K8GA 3FKIB 4DK0A 1FJGL 4A3DB 2OWOA 2ZM6L 4FF2A 3MVVA 1W6JA 1SBBB 3OWFA 5IWAL 1VQ5A 4BY7G 1MKHA 1S4ZA 5KIXA 4DK3C 5E3FA 1F2ZA 4C2MB 3S9WA 1U0LA 4DXGA 1RF2D 2EPBA 4IUPA 4UPAA 3PGZA 5IP7H 1EZ6A 4DAVA 1CKNB 1PZKD 2RHSB 3V2TA 2KHJA 3LWUA 2JEBI 2XIWA 2MUYA 5CV4A 3K57A 5JJLA 5C5LA 2YU9H 3R2TA 4UDUC 4R8IA 4EQ5A 2UUCQ 3S2HB 4FYDA 1KHIA 1B44D 5JJZA 3SK8A 2ID0A 2MFIA 5JJIA 5IODA 1OXXK 1EYCA 4QMGA 4BXXG 4DU9A 4A93B 2DNEA 2EOTA 3BG3A 1CSQA 1M1KC 1C7YA 2IL8A 2V1CC 1EFWA 2X6LA 4LF4L 4X65L 2E8GA 2L12A 1N9WA 3W1BA 1NE3A 1SN8A 1Q8KA 3TP7A 1UWVA 1SE3A 2L55A 3SK4A 3BJUA 1PDQA 1SJHD 1DXMA 1D5XC 4A3FB 4ULLA 2KEDA 1LO5D 5FO8B 2NVXH 1PH6A 3NBHB 3E6ZX 3HOXB 4YCWA 4A3EB 1WCMG 3IL8A 5JOBA 3E9IA 3TZDA 4LUVA 2JXMB 3U9OA 1LYLA 4KI0A 1HUMA 2GN5A 4MN3A 3U4ZA 1LTRD 2K5QA 3CPFA 2PPBC 3NBHA 5EAYA 3J7AV 2H4OA 1HXYD 5TSSA 2B8GA 2M00A 2QKIC 3BU2A 4A3GH 5FO9B 4IQZA 1BNZA 4YHHL 3PIO3 3GTQH 5I4DA 2SNSA 1YI2A 4OONA 2JK8A 2E2JH 4APVA 2E5LQ 3I4MH 3AU7A 1J5EL 2K33A 3G4SA 2NVYB 3FVQA 4JOIA 1FNUA 3ULLA 1N34Q 3NPPA 1Y1WH 1A3UA 3Q23A 3TP5A 4A3KH 1WD1A 4JCVE 4QL5A 4NKLA 1QNKA 4DV4L 3PF4A 4KK7A 1K8OA 3NTKA 1TXYA 1LTBD 4DNRB 2I07B 2O4XA 3C3LA 2WAQB 4GS3A 2L5TA 4LF4Q 4P71A 3K5MA 4BXXH 1Z9FA 5C6AA 4QCLA 1XTDA 1ICWA 1E2VA 3IRBA 5H1SE 1VCIA 2PO4A 1PFSA 3QWNA 4IUQA 1VQDA 1GHKA 1SNOA 5C4XH 2IX0A 3MEFA 1CQVA 5C44G 4NP5A 4WJ4A 3S15B 3S1QH 4LF7Q 3E5SA 4X65Q 3DXJC 1ZEQX 3K81C 3NWSA 2PNRC 3IAYA 2BCOA 2E2IB 3EQLC 4DV1Q 3KK7A 1VQHA 4DFAA 4E6IA 2F0OA 1BO0A 1SMYD 5BN3A 2VUMH 3VR6A 4CHTB 1RKNA 1UAPA 5IP9G 4MTKA 3S16B 2A68C 1F9RA 3HOVB 1QVCA 1TWAH 2OF1A 4N8FA 1I3QB 1MHWC 5BN5A 3CRLC 3TS2A 1H9RA 1XMQQ 4IFDH 2F0HA 2B2WC 3G48A 5D14A 1A62A 3HKZE 1WI5A 2F03A 2AQ3B 5K5PA 4AIMA 1KQSA 1Q7YC 1STNA 3CC7A 3OIPA 2CH4W 3OPOA 1LT5D 2EYOA 2R7DA 3F2DA 3I4NG 3S1QB 3E3XA 2L15A 2Z9HA 1FJGQ 1DCZA 3D0FA 4DR3Q 2JA8G 3I4MG 3N6RA 3HOWH 1O7IA 3GV3A 3E0EA 1BCPC 2L1BA 3K0YA 2KCMA 3J7AF 5FJ8H 2F4VL 2JA5G 4AYBG 2LXJA 1N8RC 2YTVA 3M4OB 2BE5D 1PH9A 4PZ7A 1D2BA 2BH2A 1TWFH 4MTNA 3CU7A 4RFBA 3W1GA 1K8MA 1FVIA 4KKUA 4K6DA 4X3SA 3D6CA 4PZ8A 4KN4C 3KLSA 4CDFC 4B3RQ 4QJFA 5AJ3L 1SDFA 3X3NA 4ZLTF 1PH7A 1KDAA 1I6HH 4KKSA 1H95A 3I73A 4IPDA 4DR6L 1QWYA 1B9MA 3EVQA 1S72A 4C3IH 4TVAB 1K8AC 1A15A 5HY6A 4GOPB 1KD1C 5C4XG 4DV6L 1VQ6A 3CW2C 4JI3L 4WFN3 4H02A 4A75A 3OW2A 3R93A 1I50H 3GTMH 4JI2L 1W6KA 3H6MA 1EY6A 3RUZA 4JK1C 3I72A 2GVAA 4RMFA 4UP8A 2WKDA 2EYPA 5JVG3 5E7NA 4BBSG 3MXNB 1VQFA 1YHQA 2NZ1D 4A3CG 3OOCA 3WOFA 2ICEC 1HFGA 3OMCA 5M5WH 2QW7A 2DJGC 3CCLA 2F0KA 4YCUA 1SYDA 2JA6H 2NVYH 1GJXA 3GQBA 1GUSA 2LMCB 2JQOA 4HIDA 1EY7A 1PVOA 2E75C 2B63G 3MXNA 4DV2Q 3S2DH 2VS1A 3KFUA 2SDFA 2F0MA 1EY5A 1HA5A 4KHPQ 4X62Q 5NUCA 1LT6D 3TQYA 1ZYRD 2XRSD 5GROA 1MJCA 2K05A 4J8QA 3I70A 3QG1A 1E24A 1UE5A 3HOXG 3AQQA 3EFXD 1K83H 4JI6L 1VQNA 4HEDA 5FLXL 4A3DG 2KCNA 4ZAIA 3B6YA 2CW0C 1LTLA 1NUCA 2A6ED 1EEFD 2OCEA 2K28A 3CF5A 2EYLA 1O7ZA 3W5OA 1E3PA 1Y8OB 4FXGC 1BR9A 3J80L 4L8JA 3OYYA 1I4RA 1TS4A 2AMCB 2F0PA 2QEXA 1PTOC 3KYHC 4I7AA 5J1ZA 5C0XJ 3GTPH 4WJ3M 5JPMC 3PCOB 2PI2E 1HNZQ 4JI1L 4FF1A 1KRSA 1PRTB 4R4QA 2C35B 4B3SQ 4TQUS 5IGGA 3S15H 2BDOA 1PH4A 2UU9L 1EQRA 2HD3A 3CMEA 1PYWD 2JA5B 3F8TA 1TWCH 1RD9D 1P8LA 2VQFQ 4LK1C 5E4WC 2K5VA 3GTGH 4ME5A 1LT3D 5ELOA 1B2TA 3VR4A 1EY9A 2ZXPA 4OO1I 3KJPA 1C0AA 1CQFA 1U5KA 3JAML 4A3CH 2QILA 3DM1A 1A3TA 2GVBA 1EY8A 2VL6A 2XVSA 3DLLA 4OXPA 5LMUQ 1PH8A 3HOZB 4BBRG 1B70B 4A3FG 5L37A 5FK9C 2CWPA 4A3EH 4OELB 4PZ6A 4OO1H 3KBXA 5ELFA 4DR6Q 4A3LH 3CQZB 2IY5B 1VQBA 3A74A 3PUWA 2OT2A 3TP6A 1HA6A
chains in the Genus database with same CATH topology
2XN9C 3S17B 1LTAD 1H9MA 4M1UB 4NW2A 3J81E 1D6EC 5C4ZA 3J80E 2NN6G 5KNCA 5CGKA 4OIJA 1BOSA 3VR2A 1IKMA 2EYJA 4ODGA 5C4JB 1J9OA 2RQXA 2IX3A 1ENCA 1EY0A 3K58A 5CV5A 4F8MA 4RKBA 1HUNA 1LLRD 1IKLA 3UI2A 1BF4A 3GTGB 5ELCA 2WB1B 4P2CB 4XDXA 3GV6A 5I2XA 2RA4A 3S1RB 1E0BA 1DOLA 3NUCA 2FHTA 1OO9B 4G7OC 2AWNA 4A3GB 1QG7A 3NK9A 2JEAI 1WCMB 1Z47A 1SYGA 2E2JB 1HTLD 4RHRA 3DHQA 3H09A 3BVMA 3DWPA 5EKLA 1S5FD 2K01A 4L6TB 2CVRA 2B2TA 2BDNA 4RA8A 1EWHA 4EQNA 1JOKA 1LABA 3SHLA 2ZT9C 4FO2A 1TVXA 1HRJA 4RH6A 1SAPA 2NYZD 2A73B 2B2WA 2VNUD 1S5BD 4IFDG 3CRKC 3EJIA 1AZPA 1ZYRC 3X3MA 1B4OA 4A3IB 4B08A 3K5OA 3HKZB 1PRTC 2AWOA 4X3KA 1K83B 1CA5A 5IOCA 3LX0A 3D6WA 1PTOB 5KYLA 5COYA 1VDZA 4G7ZC 2EYHA 4RGMA 1PTOF 3GTMB 1WTXA 2R61A 4KY5A 3QIAA 2Z8LA 3A8JE 1EU4A 3FPPA 1PFNA 2VB2X 3A54A 1AFPA 3PUVA 4H7BA 2L4NA 1STHA 1G91A 5DEHA 3MXPA 1RCVD 2PW5A 3HZXA 5C4HA 3C46A 3PV0A 3M85A 1STYA 1LACA 5I2YA 4RGOS 3KLSX 4HN7A 2JA7B 2MJ8A 3DEPA 2J7ZA 2OXPA 3FMCA 1LT4D 1JCKB 1O78A 4G4KA 1TY2A 4RKLA 2JP1A 3PUYA 2K04A 2J0TD 5IT9E 3IFDA 2MHVA 4ZK9B 3N52A 3OMGA 4H0LC 4IFDJ 5CR3A 2HCIA 1EWCA 2BA0A 4LJZC 1GUWA 5C3XA 3HG9A 4K2KA 1SE4A 1OXUA 4OL7A 2FMCA 4FP5D 2NUCA 4F88A 5EPLA 3VYSA 3HRZC 3U9SA 2F0NA 5C4XB 1RTNA 5CBEE 2PZTA 3BS1A 1AEXA 2XWJB 1TS2A 1U9RA 4XYQA 2A68D 2DN8A 1KLUD 1ML0D 3K5NA 5C3EB 4RGNA 2KA7A 1NSNS 1TU2B 5C0XI 4EGVA 4DF7A 1QJOA 1KDBA 3D4RA 1BCPB 5F2DA 1HQRD 2L11A 2WV6D 1JORA 3BZDB 2PMZB 1FD7D 3PMFA 3KUPA 5BN4A 3FEWX 2KQ3A 4XYOA 2A5HA 1O7YA 1TY0A 1CM9A 1JB3A 1HQMC 3ND8A 1DJRD 2SEBD 1Y8NB 1UNSA 2IT1A 1MGSA 4RHSA 3PUXA 4TSSA 4C56C 2QDBA 5JVH3 2FFKB 3BVZA 2D2CC 1FR3A 2TMPA 3MTSA 3NBIA 3Q22A 4ZRZA 5DM73 2FINB 4PQXA 5CORA 3G7LA 1TWCB 1GUTA 2JE6I 4IUVA 4G7HC 2F0TA 2WIIB 2O5JC 2EJFC 4ZYSA 1D5ZC 1D1IA 3SEBA 1Q8IA 1WTVA 2PZUA 5C3WA 1NR4A 2IW3A 3TMEA 4H44C 2VXWA 5K36H 1LTSD 2KOLA 2NB0A 4ID6A 4IN3A 5C5MA 3Q0AA 1F2MA 5M3MB 4J1MA 1CHQD 3HEJA 3Q6SA 3OW7A 1TWGB 1YNNC 5FOBB 2V4DA 2EDGA 5D65A 4X3UA 2Z4IA 2KUMA 3L9AX 2AQ2B 1YNJD 2F0WA 3QOJA 3A7AB 3M3YB 1RHPA 5DNFA 4PMCA 4KD4A 1MD2D 3R2IA 3S1NB 4WORA 1H9JA 5A2QE 4R9WA 4I7ZC 1U4PA 2EJMA 4XTCS 1V1PB 4QIWB 5EJWA 3SDZA 2RKSA 5J22A 3DWAA 3NE5B 3OSOA 4V0BA 1ZKOA 1EQVA 5DAUA 5C0XG 4RGTA 3MEHA 4C3IG 2KJXA 2A74C 5J39A 1JQYD 5ELBA 3GO5A 3BYTB 2F0IA 5I9PA 4U68A 3OIQA 2EY2A 1TR5A 5ELDA 2Q8TA 1TQOA 1HHVA 1II3A 4DGZA 4FXDA 4XQJA 4BS9A 4HCSA 1PZID 2ZXOA 1QCBD 1LV9A 3EROA 1QILA 2B2YC 4U673 3K5LA 3T51B 2EY1A 1S5ED 3DWQA 4FF3A 2JA8B 1O7LA 4IURA 2JSOA 4FF4A 3FDTA 2A6HC 3D8GA 1I4QA 1MI2A 4DAPA 1HTPA 2A69D 5CC4A 1V1OA 4EQPA 4K14A 4OHJA 2BA1A 3L3OC 5FKAC 1WTPA 4CJ1B 4HAEA 1WTWA 2LFNA 1F2LA 2NN6I 3A56A 1E2WA 1RTOA 3NHHA 2RSOA 1VF7A 2HQEA 1AP0A 1LTID 3JAME 3P20A 1Y8PB 4F87A 1TWFB 5KRUA 5CV9A 3PO3B 3WDNA 1IYUA 3M7GA 1QNUA 3A8KE 1CFMA 3MFGA 4LMQD 2KVMA 2Y0SB 3I8ZA 2EYFA 5LL6S 2B63B 4BY1B 5EKIA 3LNNA 3MXGA 4MHEA 4IUNA 3S14B 1G2TA 3O13A 1YNND 4MIUA 4CKCA 3H3VC 2EY6A 5AFWA 4B9WA 1BDOA 1Q90A 3I3CA 1EZ8A 1M4VA 4QF4A 1X3QA 1ET9A 1C48A 3S2DB 4GZYC 1S5CD 4RWSC 5G3LF 1ONLA 1Y1VB 1PTOD 3BDLA 4FXKC 4OIKA 3T16A 1IYVA 4KHZA 3E0JA 5M9OA 2K5DA 4A3MB 2EYMA 5T1IA 4K5XA 2A6EC 3MHBA 2CW0D 1AZQA 4HCEA 4XT1B 3TDQA 2I46A 4KKTA 3V05A 3DEOA 1C8CA 1J8IA 3IFTA 1QOHA 5T1GA 2L0CA 1EOTA 4R8NA 1L0YB 2RSNA 3I4NB 2IPKD 2EY5A 1LTGD 4BBRB 1TKWB 5E1FA 4AYBB 5M5YB 2K7VA 1BCPF 1B53A 4CKBA 4IFDI 3T4AC 4V190 2E74C 2Z1CA 3ONAB 2CHBD 4HMIA 4Q5VA 1PXUA 1Z7TA 4N9TA 1U4MA 5C0XH 2XSCA 2K32A 4HR7B 3MA2B 1T5EA 4CJ0B 1KDCA 3PUZA 1EIGA 4C3HB 1YNJC 1ET6A 2F4IA 2NVTB 1XX8A 3LWEA 1Q12A 2B39A 4PMBA 1KLGD 3ND9A 3P7JA 5M3FB 4BY7B 1H9KA 1TS3A 1SNMA 2M2LA 3GP7A 2BE5C 5EPJA 1Y1WB 3NTHA 2C5CA 3WOEA 5FO7B 3A55A 3BDCA 4XQQA 3GTPB 2WP8J 1XXGA 2EJGC 2J4XA 2N88A 3VA5A 2F0VA 1H9SB 1RDPD 4DA2A 2AUJD 1BBXC 3MZ5A 1G8ZD 4EVOA 1CZWA 4H13C 1GXDC 4Y7NB 3RLFA 1SNQA 3H91A 4BWGB 3RZOB 1GUGA 2K1BA 2NWGA 3P1HA 1WVLA 4OO1G 3AMUA 1KTKA 3K7AB 1A3VA 1HPCA 3NP8A 4ABNA 1F9QA 1T5XD 1TIID 1B3AA 1ILPA 1WD0A 3CKIB 4JBWA 1VMCA 3VR5A 2ZXRA 5IGBA 4B9XA 4DNTB 2Z4HA 3GD7A 2F0JA 2K6AA 4KHVA 2Q8IB 4YIJA 1A2UA 2B2UC 1C4QA 2Q8RE 3ITPA 1EIHA 3MC0B 2A69C 4K5WA 3D3RA 1GHJA 1G291 1SNPA 3G6JB 2VB3X 4KTAA 2LKVA 2O5IC 3T53B 1ESFA 2RVLA 3MFYA 4FVMA 4ZKCB 5EQ0A 4HTHA 5LHY1 3K59A 4HSVA 5FLXE 1ILQA 4K5VA 3W3AA 1EEID 5KYIA 1STBA 1XWEA 2MGSA 1BQQT 3HOYB 1EYDA 1PZJD 1EYAA 1B9NA 3ZYYX 1UEAB 2K5WA 4C3HG 5JPNC 5EKKA 4ZQ3A 4UAIA 1JWSD 3HGBA 3A7LA 1CTMA 5A2QL 4ZUIA 1BXTA 4ILWA 3URYA 5CV6A 1Q1BA 1SE2A 1SYFA 2M9VA 5G3LD 1I50B 5C44B 2AQ1B 2R7ZB 4DXFA 2NTTA 3BDOA 1GOZA 1PTOH 2WKCA 4DAYA 4QB4A 2FMMA 2DNCA 2F0EA 1MSHA 1GUNA 3D4WA 2JA6B 4C3JB 1KAAA 3DMUA 4PMWA 1I6HB 1OXTA 1SJED 2G9HD 5JAVA 2QF7A 2EZVA 3KBGA 2B2UA 4TRDA 3I91A 1F9SA 3QO2A 3VYRA 3BYYB 1MSGA 5IGEA 1U4LA 2MPMA 1OXSC 2FJ2A 1I6VC 1DYQA 1LTTD 2K03A 1PRTF 2PZWA 2NVQB 2D62A 4IUTA 4FNFA 1KABA 3NWTA 1PRTD 4XXEA 1CI3M 3V96A 1PFBA 2QCPX 4A3JB 2A6HD 1JICA 4PV1C 4QUCA 2XNAC 1I4HA 1NR2A 3RMHA 4KY6A 1A2TA 5IGFA 5KNBA 3KLRA 4WJWA 2E76C 2HDLA 3HP3A 2RDGA 1JWMD 5KNDA 2IJ0A 1IW7D 1DOKA 1SNCA 2KHSA 4K8IA 5IGDA 5E4XA 2MP1A 3GTLB 3OHXC 2X6GA 2DY7A 2G9DA 3QB3A 2NTSA 4BBSB 1SEBD 1QE6A 2F0FA 3M7NA 5CMDA 4TKOB 2F3WA 3S1MB 1SFOB 4DN4M 2HDMA 4QUFA 1A6XA 2KEEA 2IWHA 4ZKBB 3VYUA 2EE1A 1SYBA 1NAPA 1O80A 1PLFA 2SNMA 4DK1A 4PNYA 5D3IB 5M5WB 3J7YW 1Z6HA 5ISRA 2XRQD 5KGUA 3NQTA 3OWEB 1Q3LA 3CHBD 3C1FA 3Q24A 1RJTA 5ELEA 5K36G 2ICIA 1JOQA 2R3ZA 5HURA 3P75A 4K2LA 2RDHA 1TWAB 3MAQA 3FRPB 3TP8A 1RODA 4KV6A 4OGQC 1JR0D 5A35A 3M4YA 4XIGS 3NXWA 1CZGA 3TZUA 1FGBD 1U4RA 2LS01 4Z9CB 2QEJC 1I4PA 1BCPD 3SR1A 1L0XB 4WRDA 1E2ZA 4KJOA 1V43A 1CHPD 2F0LA 3GTJB 2B2YA 2AUKA 1S5DD 5EBCA 4IZ8A 1TS5A 1STEA 2YYZA 3F2UA 2WACA 1FNWA 1STAA 3R8BA 2F0GA 1ENAA 3I90A 5CV8A 1TT2A 2RBMA 4LAAA 5EGTA 1R9TB 4IALA 1SMYC 2R6GA 1VMPA 1JC7A 4C3IB 2F3VA 4HSPA 5IT9L 3GTQB 3MXUA 2HUGA 2F0UA 2F0QA 1TWHB 4N9PA 4C3JG 1AN8A 3TBIB 1ESRA 1UUPA 2F0DA 4CGYB 5EPKA 2B2VC 3QOLA 1KNAA 3GTKB 3L7ZC 2O2LD 4BA1I 2EXZA 5D3DA 3HOWB 2TSSA 3SK5A 3A8IE 3H94A 5CV7A 4XT3B 4KY7A 2X69A 1JE4A 1SSOA 3VYTA 1WTQA 3SE0A 3FPUB 2R93B 2OEOA 1D1KA 4RCNA 4CKEA 4G57A 1G2SA 4A3BB 1VF5C 2CQAA 3NSWA 2PYKA 1I4XA 3NTIA 1XYIA 2BOSA 1G6ZA 2E2DC 2B8FA 3RD4A 3GTOB 3RZDB 3DUZA 3T56B 3PO2B 1R4QB 3I4MB 5CYUA 3PIP3 2JYOA 1MBYA 4KD3A 4KJNA 3SK6A 3W2DA 1F77A 4O42A 5KEEA 2HCCA 3VR3A 5JEAG 1CA6A 1BUVT 1SYEA 3VA7A 5M5XB 1SNDA 1SXTA 1V8QA 1R4PB 2GA4B 1B50A 1CT1D 2F0SA 1X3PA 4F7XA 3K6OA 1DZ1A 4I65A 4CJ2C 5LL6X 1IL8A 4O1NA 3T13A 1EQTA 5I9OA 3IKJA 3C2PA 3KF8A 1QB5D 4HMJA 1DM0B 4CBVA 4IUUA 1M8AA 3J81L 2PQEA 4Q0FA 1NCVA 4XQNA 3HS0C 1WTRA 2B2TC 3SXHA 4C1NK 4ZUJA 1SYCA 2E2HB 4S3SA 1V1PA 1H9SA 1ENFA 5HGTA 2SOBA 4RCOA 1DD2A 1Q1EA 1STGA 5I6YA 5JEAH 2KECA 4KN7C 2WINB 1F2YA 2N55A 1I4GA 2D9UA 3EA6A 1FNVA 3BVGA 3TN2A 4RAUC 2NN6H 1FYCA 1OXVA 4EQOA 2NVXB 1PMRA 3R3OA 2PCFB 2XWBB 5EBDA 1JWUD 3D4DA 4K6LA 2DY8A 3QJYA 1EU3A 4C1NI 1XTCD 2F1MA 2LY7A 3AB9A 4A3KB 2VUMB 3SVMA 2D5DA 1DONA 2H1EA 3HOUB 2IX1A 5I6WA 4L63B 1IHZA 5DM63 2KCCA 3D31A 1AW7A 2RDFA 5CBAE 1CK1A 1EL0A 1JOOA 5IGCA 2L9HA 2B2VA 1EY4A 3NQIA 2ENBA 1EFID 1DOMA 1HCZA 1WTOA 4J6HA 1X32A 1B1ZA 4NDXA 1GUOA 1F9PA 5JEAJ 2NBFA 1IW7C 4KMUC 2C9OA 3H0GB 5IIFA 1ZXTA 3MWYW 1Y69U 4X3TA 1PFMA 1KNEA 4NMZA 2R92B 2YU9B 2EVBA 4M8AA 3TSSA 3ERQA 4BA2I 1HFNA 3I4LA 2PW7A 3C1EA 4K8JA 1D5MC 3FKIB 4DK0A 4A3DB 4FF2A 3MVVA 1W6JA 1SBBB 3OWFA 1S4ZA 5KIXA 5E3FA 1F2ZA 4C2MB 3S9WA 4DXGA 1RF2D 2EPBA 4IUPA 1EZ6A 4DAVA 1PZKD 3V2TA 3LWUA 2JEBI 2XIWA 2MUYA 5CV4A 3K57A 5C5LA 3R2TA 4UDUC 4R8IA 3S2HB 4FYDA 1B44D 5JJZA 3SK8A 2ID0A 5IODA 1OXXK 1EYCA 4QMGA 4DU9A 4A93B 2DNEA 2EOTA 3BG3A 2IL8A 2X6LA 2L12A 3TP7A 1SE3A 2L55A 3SK4A 1PDQA 1SJHD 1DXMA 1D5XC 4A3FB 4ULLA 2KEDA 1LO5D 5FO8B 3E6ZX 3HOXB 4A3EB 3IL8A 5JOBA 3TZDA 2JXMB 3U9OA 4KI0A 1HUMA 4MN3A 1LTRD 2K5QA 2PPBC 3NBHA 3J7AV 2H4OA 1HXYD 5TSSA 2B8GA 2M00A 2QKIC 5FO9B 4IQZA 1BNZA 3PIO3 5I4DA 2SNSA 3AU7A 2K33A 2NVYB 3FVQA 1FNUA 3NPPA 1A3UA 3Q23A 3TP5A 1WD1A 4NKLA 1QNKA 4KK7A 1K8OA 3NTKA 1LTBD 4DNRB 2I07B 2O4XA 3C3LA 2WAQB 2L5TA 3K5MA 5C6AA 4QCLA 1ICWA 1E2VA 1VCIA 2PO4A 3QWNA 4IUQA 1GHKA 1SNOA 2IX0A 1CQVA 4NP5A 3S15B 3E5SA 3DXJC 1ZEQX 3NWSA 2PNRC 3IAYA 2BCOA 2E2IB 3EQLC 3KK7A 4DFAA 4E6IA 2F0OA 1BO0A 1SMYD 5BN3A 3VR6A 4CHTB 1RKNA 1UAPA 3S16B 2A68C 1F9RA 3HOVB 2OF1A 1I3QB 5BN5A 3CRLC 1H9RA 4IFDH 2F0HA 2B2WC 5D14A 2F03A 2AQ3B 5K5PA 1STNA 3OIPA 3OPOA 1LT5D 2EYOA 3S1QB 1DCZA 3N6RA 3GV3A 1BCPC 2L1BA 3K0YA 3J7AF 3M4OB 2BE5D 1D2BA 3CU7A 4RFBA 1K8MA 4KKUA 4K6DA 4X3SA 3D6CA 4KN4C 3KLSA 1SDFA 3X3NA 4ZLTF 1KDAA 4KKSA 3I73A 1QWYA 1B9MA 3EVQA 1A15A 4WFN3 3R93A 1W6KA 3H6MA 1EY6A 3RUZA 4JK1C 3I72A 2WKDA 2EYPA 5JVG3 2NZ1D 3OOCA 3WOFA 2ICEC 1HFGA 3OMCA 2F0KA 1GJXA 1SYDA 3GQBA 1GUSA 2LMCB 1EY7A 2E75C 3MXNA 2SDFA 2F0MA 1EY5A 1HA5A 5NUCA 1LT6D 1ZYRD 2XRSD 2K05A 4J8QA 3I70A 3QG1A 3EFXD 4HEDA 5FLXL 2KCNA 4ZAIA 2CW0C 1NUCA 2A6ED 1EEFD 2K28A 2EYLA 1O7ZA 1Y8OB 4FXGC 1BR9A 3J80L 4L8JA 1I4RA 1TS4A 2F0PA 1PTOC 5J1ZA 5C0XJ 5JPMC 4FF1A 1PRTB 4TQUS 5IGGA 2BDOA 1PYWD 2JA5B 1RD9D 4LK1C 5E4WC 4ME5A 1LT3D 1B2TA 3VR4A 1EY9A 2ZXPA 4OO1I 1CQFA 3JAML 2QILA 3DM1A 1A3TA 1EY8A 2XVSA 3HOZB 5FK9C 4OO1H 3KBXA 5ELFA 3CQZB 3PUWA 2OT2A 3TP6A 1HA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY2 A;  1EY7 A;  2RDF A;  2F0U A;  2F0Q A;  1A2U A;  1TR5 A;  4N9P A;  3TP7 A;  1JOO A;  1TQO A;  1RKN A;  2F0T A;  1II3 A;  5IGC A;  1EY4 A;  3ITP A;  3SK4 A;  5JAV A;  2ENB A;  3OMG A;  4DGZ A;  5CR3 A;  4HMJ A;  4EQN A;  1JOK A;  2F0M A;  1EY5 A;  4K5W A;  5NUC A;  2PQE A;  1SYB A;  4J6H A;  3SHL A;  2EYF A;  2OF1 A;  4NDX A;  1SNP A;  5C3X A;  2PZU A;  2F0D A;  5C3W A;  4TRD A;  4K2K A;  2SNM A;  3ERO A;  3SXH A;  5C4Z A;  4KHV A;  4KTA A;  5JOB A;  2LKV A;  4PNY A;  3TME A;  4HMI A;  4IUN A;  4OL7 A;  2F0H A;  3QOL A;  5CGK A;  4N9T A;  2EY1 A;  4MIU A;  4ZUJ A;  5IIF A;  5ISR A;  2EYJ A;  4ODG A;  3U9O A;  3NQT A;  5K5P A;  5KGU A;  2NUC A;  2EY6 A;  1STN A;  4HTH A;  5IGE A;  1SYC A;  2EXZ A;  4ID6 A;  3C1F A;  2EYO A;  5C5M A;  4B9W A;  3EJI A;  1KDC A;  4S3S A;  1F2M A;  4NMZ A;  4J1M A;  3HEJ A;  2F0N A;  3SK5 A;  1EY0 A;  1ENC A;  1NUC A;  5CV5 A;  4F8M A;  4RKB A;  5HGT A;  5CV7 A;  2SOB A;  2EYL A;  3D8G A;  4K5V A;  1JOQ A;  2M00 A;  2PZT A;  5HUR A;  1AEX A;  4KY7 A;  1EZ8 A;  3ERQ A;  5KYI A;  4PMB A;  2PZW A;  1STB A;  1U9R A;  3P75 A;  4K2L A;  4QF4 A;  1STG A;  5IOC A;  2PW7 A;  2F0P A;  3LX0 A;  5I6Y A;  3TP8 A;  2SNS A;  3C1E A;  2OEO A;  5KYL A;  4K8J A;  1KAB A;  3TP6 A;  1EYD A;  1NSN S;  1F2Y A;  1SNM A;  5J1Z A;  4KV6 A;  5CC4 A;  1EYA A;  2EYH A;  3BDL A;  4G57 A;  3T16 A;  4DF7 A;  2F0W A;  3NXW A;  1KDB A;  3MVV A;  3QOJ A;  5M9O A;  3OWF A;  3BDC A;  2PYK A;  4K6D A;  5EKK A;  3D6C A;  4ZQ3 A;  4EQP A;  5IGG A;  1A3U A;  4KY5 A;  5F2D A;  3TP5 A;  5KIX A;  4K14 A;  5E3F A;  4PMC A;  1F2Z A;  3VA5 A;  2F0V A;  4KD4 A;  4NKL A;  3SR1 A;  1JOR A;  2EYM A;  4WRD A;  3S9W A;  4K5X A;  4WOR A;  1KDA A;  3MHB A;  1A2T A;  3PMF A;  4KY6 A;  4ZUI A;  4KJO A;  4EQO A;  5IGF A;  3NUC A;  4ME5 A;  3MZ5 A;  5CV6 A;  2F0L A;  2KQ3 A;  2O4X A;  3R3O A;  4H7B A;  1EZ6 A;  1STH A;  4EVO A;  3EVQ A;  5DEH A;  1SYF A;  3V2T A;  3MXP A;  1EY9 A;  3HZX A;  2PW5 A;  5C4H A;  1SNQ A;  5CV4 A;  5C6A A;  4KD3 A;  3D4D A;  1STY A;  4KJN A;  3SK6 A;  3P1H A;  2RKS A;  5C5L A;  1SNC A;  2KHS A;  3NHH A;  4K8I A;  5IGD A;  3H6M A;  5J22 A;  1EY6 A;  3NK9 A;  3OSO A;  2HQE A;  4IZ8 A;  3RUZ A;  3SK8 A;  5KEE A;  1EQV A;  5IOD A;  1EYC A;  1SNO A;  1A3V A;  1SYE A;  4QMG A;  5DAU A;  3NP8 A;  4DU9 A;  1A3T A;  1SND A;  1EY8 A;  1SYG A;  2EYP A;  4NP5 A;  4QB4 A;  2OXP A;  2F0S A;  2WAC A;  2QDB A;  3MEH A;  4R8N A;  1STA A;  3E5S A;  4F7X A;  5KRU A;  2F0E A;  5CV9 A;  2F0G A;  1ENA A;  3QB3 A;  4I65 A;  5CV8 A;  3D4W A;  5J39 A;  1TT2 A;  2RBM A;  3DHQ A;  4LAA A;  2EY5 A;  4RKL A;  5EKL A;  5EGT A;  5I6W A;  4IAL A;  1IHZ A;  3OMC A;  5IGB A;  3T13 A;  2F0F A;  2F0I A;  4B9X A;  5I9P A;  4DFA A;  1KAA A;  2F0O A;  4E6I A;  2F0K A;  5I9O A;  1SYD A;  2F3W A;  2F3V A;  2F0J A;  3DMU A;  5E1F A;  4YIJ A; 
#chains in the Genus database with same CATH topology
 2XN9 C;  4NXN Q;  1LTA D;  3S17 B;  1KXL A;  1H9M A;  1G51 A;  1VQP A;  4M1U B;  2PQA B;  4NW2 A;  3H3V H;  3J81 E;  1D6E C;  2Q2T A;  5C4Z A;  3J80 E;  3I55 A;  5GAG C;  2NN6 G;  4DNI A;  5KNC A;  5CGK A;  2F4V Q;  4OIJ A;  1BOS A;  3VR2 A;  2CWA A;  1IKM A;  2EYJ A;  4ODG A;  5HGQ A;  5C4J B;  1J9O A;  1ICF B;  2RQX A;  3I4O A;  2Q2H A;  2IX3 A;  1V9P A;  1ENC A;  1EY0 A;  3K58 A;  4HJA A;  5CV5 A;  4F8M A;  4RKB A;  1IL2 A;  1KRT A;  1LUZ A;  5IE8 A;  2QGQ A;  5IYB H;  1HUN A;  4DR5 L;  1LLR D;  4A3M G;  3PO3 H;  4FDB A;  1IKL A;  3UI2 A;  1BF4 A;  2VW9 A;  3GTG B;  3GTL H;  5ELC A;  2WB1 B;  4P2C B;  2NZO A;  3GV6 A;  4XDX A;  5I2X A;  2RA4 A;  3S1R B;  4A3L G;  2JA7 G;  1E0B A;  1DOL A;  3I2Z A;  3NUC A;  1EUJ A;  2FHT A;  1OO9 B;  4G7O C;  3FHW A;  1JJ2 A;  2AWN A;  5GAE C;  4LFA Q;  5LMU L;  4R4C A;  4JI5 Q;  4A3G B;  1QG7 A;  3NK9 A;  2JEA I;  4JI7 L;  1WCM B;  1Z47 A;  1SYG A;  1VQ4 A;  2E2J B;  1HTL D;  4RHR A;  1NBW A;  2WB1 G;  2ZTC A;  4LF5 Q;  3DHQ A;  3H09 A;  3BVM A;  3DWP A;  4GN5 A;  5EKL A;  1S5F D;  2K01 A;  3FKI H;  4L6T B;  2CVR A;  3NEM A;  2B2T A;  2BDN A;  3TS0 A;  4X64 L;  1RIP A;  2AHO B;  3J80 c;  4RA8 A;  4OX9 L;  1EWH A;  1N34 L;  4EQN A;  1JOK A;  2ATW A;  1LAB A;  3SHL A;  2ZT9 C;  5IP9 H;  1VQL A;  2UXD Q;  2K14 A;  1PYS B;  4GNX C;  3CC4 A;  4JBM A;  4FO2 A;  1TVX A;  1HRJ A;  4RH6 A;  1SAP A;  1Y14 B;  2NYZ D;  2A73 B;  2B2W A;  4B3S L;  2VNU D;  1S5B D;  4IFD G;  3CRK C;  3EJI A;  2Z0S A;  1AZP A;  1ZYR C;  3X3M A;  3S1M H;  1B4O A;  4A3I B;  2KEN A;  4B08 A;  3K5O A;  4JG2 A;  3HKZ B;  2WAQ E;  1PRT C;  4UHV A;  3H15 A;  2AWO A;  4X3K A;  3F2B A;  1K83 B;  3RLO A;  4A93 G;  1EWI A;  1CA5 A;  5IOC A;  1IBM L;  3LX0 A;  3D6W A;  1PTO B;  4BBR H;  5KYL A;  5COY A;  3STB D;  1VDZ A;  1VQO A;  4G7Z C;  2EYH A;  4RGM A;  1VQJ A;  3K7A H;  3M4Q A;  1PTO F;  1HR0 L;  3GTM B;  1WTX A;  2R61 A;  4JI4 L;  4KY5 A;  4DV2 L;  3QIA A;  4HJ9 A;  1FL0 A;  2Z8L A;  3A8J E;  1EU4 A;  2CH4 A;  3FPP A;  3HOX H;  1PFN A;  2VB2 X;  3A54 A;  1AFP A;  3PUV A;  4OWW B;  4H7B A;  2L4N A;  1STH A;  1G91 A;  2RCN A;  1W2B A;  5DEH A;  3KF8 B;  3MXP A;  2K75 A;  5BR8 L;  1RCV D;  2PW5 A;  3HZX A;  5C4H A;  3C46 A;  3S24 A;  3PV0 A;  3M85 A;  1YNX A;  2HHH L;  1STY A;  1LAC A;  5I2Y A;  2OTJ A;  4RGO S;  3KLS X;  4HN7 A;  2JA7 B;  2MJ8 A;  3DEP A;  4JI2 Q;  2J7Z A;  2OXP A;  3FMC A;  1LT4 D;  1JCK B;  1O78 A;  4G4K A;  1TY2 A;  4RKL A;  2JP1 A;  3PUY A;  2K04 A;  2J0T D;  5IT9 E;  3IFD A;  2UXB L;  3FP9 A;  3NEN A;  2MHV A;  2Y0S E;  1EL0 A;  2I0Q A;  4ZK9 B;  3N52 A;  1Y1V H;  4JI3 Q;  3OMG A;  2YV5 A;  1HNW Q;  4H0L C;  4LF8 Q;  4IFD J;  5CR3 A;  1PH1 A;  5IWA Q;  2UXC L;  2HCI A;  1PV4 A;  5M3M G;  1EWC A;  4A3B G;  3JAM c;  2BA0 A;  4LJZ C;  1GUW A;  5C3X A;  3KDF B;  3HG9 A;  1SMX A;  3H0G G;  4K2K A;  1SE4 A;  1OXU A;  4GOP C;  4DV5 Q;  4OL7 A;  5IT9 c;  1XMO Q;  2FMC A;  2JA7 H;  4FP5 D;  2NUC A;  4F88 A;  2N3S A;  1HNX Q;  1V1Q A;  5EPL A;  4C3H H;  3VYS A;  3HRZ C;  1L1O A;  1VS0 A;  3U9S A;  2F0N A;  5C4X B;  1RTN A;  3SGI A;  5CBE E;  2JA9 A;  3EBE A;  2PZT A;  2Y0S G;  1AEX A;  2XWJ B;  3BS1 A;  1TS2 A;  3KOJ A;  1SFO H;  3T1Y L;  1U9R A;  1XMO L;  4XYQ A;  2A68 D;  2DN8 A;  1KLU D;  1ML0 D;  3T1Y Q;  3K5N A;  5C3E B;  2VZA A;  4RGN A;  2KA7 A;  1NSN S;  1TU2 B;  4GLV B;  2Z6B A;  5C0X I;  4LFB L;  4DPG A;  4LF9 L;  4DF7 A;  4EGV A;  2CCZ A;  1QJO A;  1KDB A;  3D4R A;  1BCP B;  1EYG A;  2FXQ A;  5F2D A;  1HQR D;  2L11 A;  2WV6 D;  1JOR A;  3BZD B;  3G6E A;  2MO1 A;  4DV5 L;  2PMZ B;  4IJL A;  1FD7 D;  3PMF A;  3KUP A;  5BN4 A;  3FEW X;  2KQ3 A;  2Q2U A;  4XYO A;  5ELN A;  2A5H A;  1O7Y A;  3RZO H;  1TY0 A;  1VQA A;  1JJC B;  1CM9 A;  1JB3 A;  1HQM C;  3ND8 A;  1DJR D;  2SEB D;  4YY3 Q;  1Y8N B;  1UNS A;  4QGU A;  2I5M X;  2IT1 A;  1MGS A;  4P72 A;  4KLK A;  4RHS A;  3PUX A;  4TSS A;  4DV1 L;  4C56 C;  4A76 A;  2QDB A;  5JVH 3;  2FFK B;  4DR1 Q;  2YTY A;  4CDC C;  3BVZ A;  2D2C C;  1FR3 A;  3J81 i;  2TMP A;  3MTS A;  3NBI A;  3Q22 A;  4ZRZ A;  2FIN B;  5DM7 3;  4PQX A;  5COR A;  5FLM G;  3G7L A;  1TWC B;  1GUT A;  4IUV A;  2JE6 I;  4G7H C;  2F0T A;  2WII B;  2O5J C;  2HHH Q;  2EJF C;  2K5H A;  4ZYS A;  4LFC Q;  1JE5 A;  1D5Z C;  1D1I A;  3SEB A;  4DV0 Q;  1Q8I A;  5FLX c;  3RN2 A;  1WTV A;  4B3M L;  1J5E Q;  2PZU A;  5C3W A;  5M5X H;  1X3E A;  1NR4 A;  2IW3 A;  3TME A;  4H44 C;  2VXW A;  4DV4 Q;  5K36 H;  1LTS D;  5DLQ E;  2KOL A;  2NB0 A;  4ID6 A;  4IN3 A;  5C5M A;  3Q0A A;  1F2M A;  5M3M B;  4J1M A;  2A8V A;  1CHQ D;  3HEJ A;  3Q6S A;  1N36 Q;  2VUM G;  3OW7 A;  1R9T H;  1TWG B;  1YNN C;  3CCR A;  5FOB B;  4GNX B;  5GQO A;  2V4D A;  3I56 A;  4YHH Q;  2EDG A;  5D65 A;  3BZC A;  4Y52 H;  4X3U A;  3J81 j;  1YZ6 A;  5IYD G;  2Z4I A;  2KUM A;  3STB C;  3L9A X;  2AQ2 B;  1YNJ D;  2F0W A;  3A0J A;  3QOJ A;  3NEL A;  4HIK A;  4A3D H;  3A7A B;  4OX9 Q;  3M3Y B;  1RHP A;  5DNF A;  4PMC A;  4KD4 A;  5C3E G;  1MD2 D;  3R2I A;  3S1N B;  4WOR A;  1H9J A;  3CAM A;  3PO2 H;  5A2Q E;  4R9W A;  4I7Z C;  1U4P A;  2EJM A;  2UXD L;  4XTC S;  1HR0 W;  1V1P B;  4IJH A;  1Q81 C;  4QIW B;  4LF5 L;  4A3F H;  1YIT A;  5EJW A;  1CKO A;  2RKS A;  3SDZ A;  1X55 A;  4X64 Q;  3DWA A;  5J22 A;  3NE5 B;  3OSO A;  1WOC A;  4V0B A;  1ZKO A;  1EQV A;  2UUC L;  4JOI C;  5DAU A;  4BY1 G;  5C0X G;  1FGU A;  2KHI A;  4RGT A;  3MEH A;  4C3I G;  1X65 A;  2KJX A;  2HQL A;  2A74 C;  5J39 A;  1EIY B;  1JQY D;  2VQE L;  5ELB A;  3GO5 A;  3BYT B;  2F0I A;  5I9P A;  4U68 A;  3M3Y H;  4JI7 Q;  3GTO H;  3OIQ A;  2EY2 A;  1TR5 A;  5ELD A;  2Q8T A;  1TQO A;  4LFA L;  1HHV A;  1II3 A;  3HKZ G;  2R93 H;  4JYA L;  4DGZ A;  1ASZ A;  4FXD A;  2EXD A;  4XQJ A;  4A3I H;  2ZM6 Q;  4BS9 A;  1E22 A;  4HCS A;  1PZI D;  2ZXO A;  1QCB D;  1LV9 A;  3ERO A;  1QIL A;  2B2Y C;  4U67 3;  3K5L A;  3T51 B;  3CC2 A;  2RF4 A;  2EY1 A;  3CCV A;  1S5E D;  3HOU H;  2DJF C;  3DWQ A;  2WFW A;  4FF3 A;  2JA8 B;  2B63 H;  1O7L A;  4IUR A;  2JSO A;  4FF4 A;  3FDT A;  4LF9 Q;  3U58 A;  4LFB Q;  2A6H C;  1XNR Q;  4OEM B;  1UE7 A;  3D8G A;  2R7Z H;  4JV5 Q;  1S40 A;  1I4Q A;  1MI2 A;  4DAP A;  1HTP A;  3EIV A;  3CCS A;  4A3G G;  1BKB A;  2CKZ B;  4EX5 A;  4BBS H;  2A69 D;  4DAM A;  5CC4 A;  1HZA A;  1X3G A;  1V1O A;  3H0G H;  4EQP A;  1E1T A;  4GKK L;  1W3S A;  4K14 A;  4OHJ A;  1K9M C;  2BA1 A;  1UEB A;  3L3O C;  4QIW E;  1E1O A;  5FKA C;  3J7Z C;  1IZ6 A;  1WTP A;  4CJ1 B;  3HOY H;  1YIJ A;  4HAE A;  1WTW A;  2LFN A;  4B3T L;  1F2L A;  4BY1 H;  1HNW L;  2NN6 I;  1VQM A;  3A56 A;  3JAM i;  4DR7 Q;  1E2W A;  1RTO A;  3HOY G;  3NHH A;  2RSO A;  1VF7 A;  2HQE A;  1AP0 A;  1LTI D;  1EQQ A;  2UXB Q;  3JAM E;  3P20 A;  2EIF A;  1Y8P B;  1I94 L;  4X66 Q;  4F87 A;  1M90 C;  1TWF B;  5KRU A;  2HIX A;  5CV9 A;  1AE2 A;  3PO3 B;  3WDN A;  1JB7 A;  5M3F H;  1IYU A;  3M7G A;  2E2I H;  1K3B C;  1QNU A;  1PHJ A;  3A8K E;  2WB1 E;  1SR3 A;  3I4N H;  1CFM A;  3MFG A;  2N49 A;  1S3O A;  4LMQ D;  2KVM A;  2Y0S B;  4P74 A;  2MNA A;  3I8Z A;  2EYF A;  1Y1V G;  5LL6 S;  1K73 C;  2B63 B;  4BY1 B;  1JJG A;  5EKI A;  4YWK A;  3LNN A;  1Q86 C;  3MXG A;  4MHE A;  4IUN A;  3S14 B;  1G2T A;  1XNQ Q;  3U4V A;  3O13 A;  1YNN D;  4MIU A;  1L1O C;  4CKC A;  4L5R C;  3H3V C;  2EY6 A;  5AFW A;  4B9W A;  1Y1W G;  3UE1 A;  3WWV A;  1BDO A;  1Q90 A;  3I3C A;  3M9B A;  1YJN A;  1EZ8 A;  1M4V A;  1IBM Q;  4QF4 A;  1ASY A;  1X3Q A;  3A5Z B;  1G6P A;  1ET9 A;  1C48 A;  3S2D B;  4GZY C;  1S5C D;  4NB3 A;  4RWS C;  5G3L F;  3PF5 A;  3TEH B;  1ONL A;  1Y1V B;  1PTO D;  3BDL A;  4FXK C;  4OIK A;  3T16 A;  2ASB A;  1IYV A;  4KHZ A;  3E0J A;  4JW0 A;  5M9O A;  1XPU A;  2K5D A;  4JI6 Q;  1JT8 A;  3KF6 B;  3H3V I;  4A3M B;  2EYM A;  5T1I A;  4K5X A;  4P73 A;  2A6E C;  3MHB A;  2CW0 D;  1AZQ A;  3GDE A;  4HCE A;  4XT1 B;  3TDQ A;  4DR2 Q;  2I46 A;  3CXC A;  5IY0 A;  4KKT A;  3CCJ A;  3V05 A;  3F1Z A;  3DEO A;  3TRZ A;  1C8C A;  1J8I A;  4A3K G;  2JA8 H;  2I5H A;  3IFT A;  1QOH A;  5T1G A;  2L0C A;  1EOT A;  4R8N A;  1L0Y B;  2RSN A;  2ALY B;  3I4N B;  3K80 C;  1VQ7 A;  4HJ7 A;  2IPK D;  2UUA Q;  2EY5 A;  1LTG D;  4BBR B;  2K52 A;  4AYB E;  1I94 Q;  1TKW B;  1A0I A;  3RR5 A;  5E1F A;  4AYB B;  1GKH A;  4MNO A;  5M5Y B;  1J6Q A;  2K7V A;  1BCP F;  4DR7 L;  1B53 A;  3S14 H;  4DV6 Q;  4CKB A;  4DUY Q;  1TWG H;  1HZC A;  4IFD I;  3UDF A;  1PH2 A;  3LGJ A;  3T4A C;  4V19 0;  5FJ8 G;  2E74 C;  2Z1C A;  3ONA B;  2CHB D;  4HMI A;  4Q5V A;  1PXU A;  1Z7T A;  4N9T A;  1U4M A;  5C0X H;  2XSC A;  2K32 A;  4HR7 B;  3MA2 B;  1T5E A;  4CJ0 B;  1QUQ A;  1XNR L;  1KDC A;  3BZK A;  4NXM Q;  3PUZ A;  2JJQ A;  3ULP A;  1EIG A;  4C3H B;  1JMC A;  1YNJ C;  1ET6 A;  1PYB A;  1X54 A;  4HIM A;  2F4I A;  2NVT B;  1XX8 A;  3LWE A;  1SE8 A;  1Q12 A;  2B39 A;  3S1N H;  4PMB A;  1KLG D;  1C9O A;  3ND9 A;  2K4K A;  3P7J A;  1HJP A;  4PG3 A;  5M3F B;  5LMN L;  4L5T A;  4JPB W;  1QUQ B;  2ZTE A;  4BY7 B;  1H9K A;  1TS3 A;  1SNM A;  2M2L A;  3GP7 A;  4DR3 L;  4A3I G;  4L5S A;  2BE5 C;  5EPJ A;  1Y1W B;  3NTH A;  2C5C A;  3WOE A;  5GAH C;  5FO7 B;  3A55 A;  3FKI G;  1CKM A;  3BDC A;  4XQQ A;  3GTP B;  2WP8 J;  1XXG A;  2EJG C;  4JYA Q;  4DV3 Q;  3RNU A;  2J4X A;  2N88 A;  3VA5 A;  2F0V A;  1H9S B;  1RDP D;  4DA2 A;  1TWH H;  2AUJ D;  1D7Q A;  1NTG A;  1BBX C;  4IOA A;  2LSS A;  4MZ9 A;  3MZ5 A;  1G8Z D;  4EVO A;  1CZW A;  1SLJ A;  4H13 C;  1GXD C;  4DV7 Q;  2VQE Q;  4Y7N B;  1IXR A;  3RLF A;  1SNQ A;  3H91 A;  3DM3 A;  4BWG B;  1B8A A;  3RZO B;  1GUG A;  4LF7 L;  2K1B A;  1BVS A;  1N32 L;  2NWG A;  1L2F A;  3P1H A;  2ZJP A;  1WVL A;  4OO1 G;  3AMU A;  4GOP A;  2R93 G;  1KTK A;  3K7A B;  1A3V A;  1HPC A;  3NP8 A;  4ABN A;  3I7F A;  1F9Q A;  4LWC A;  1HZB A;  1B3A A;  1T5X D;  1TII D;  1ILP A;  1WD0 A;  3CKI B;  1PH5 A;  4JBW A;  1VMC A;  3HOZ H;  3VR5 A;  2ZXR A;  5IGB A;  4JI0 Q;  1VQE A;  4B9X A;  4DNT B;  2Z4H A;  3GD7 A;  1LM0 A;  2F0J A;  2K6A A;  4KHV A;  2Q8I B;  4GKJ L;  4YIJ A;  2OQ0 A;  2N78 A;  1X56 A;  1A2U A;  2B2U C;  1C4Q A;  2Q8R E;  3ITP A;  1EIH A;  2I5L X;  3MC0 B;  2PI2 A;  2A69 C;  4K5W A;  3D3R A;  1GHJ A;  1G29 1;  1SNP A;  1VQG A;  3K0X A;  1N33 L;  2E5L L;  3G6J B;  2VB3 X;  4KTA A;  2VQF L;  2LKV A;  2YTX A;  2O5I C;  4R4O A;  5IYC H;  3T53 B;  1ESF A;  2RVL A;  3MFY A;  4FVM A;  2OTL A;  4ZKC B;  1WFQ A;  5EQ0 A;  1QVG A;  3T1H Q;  4HTH A;  2B29 A;  1Q46 A;  1HNZ L;  1N36 L;  1CKN A;  5LHY 1;  3K59 A;  3J81 c;  4HSV A;  5FLX E;  3CD6 A;  1ILQ A;  2G5D A;  5M3M H;  4K5V A;  3W3A A;  1AH9 A;  4IOC A;  1EEI D;  5KYI A;  3RN5 A;  1STB A;  3AFQ A;  1XWE A;  2K5N A;  2MGS A;  1BQQ T;  2R7Z G;  3PSI A;  3HOY B;  1EYD A;  1PZJ D;  1EYA A;  1B9N A;  3ZYY X;  1UEA B;  2K5W A;  4C3H G;  4LFC L;  4DKA C;  5JPN C;  5EKK A;  4ZQ3 A;  4UAI A;  3UDX A;  1JWS D;  3HGB A;  3A7L A;  5LMN W;  1CTM A;  1WYD A;  5A2Q L;  4GKJ Q;  2H5X A;  4ZUI A;  1BXT A;  4ILW A;  3URY A;  5CV6 A;  1Q1B A;  1SE2 A;  4B3M Q;  1SYF A;  4X62 L;  2M9V A;  1YJW A;  5G3L D;  1I50 B;  5C44 B;  2AQ1 B;  2R7Z B;  4DXF A;  2NTT A;  3BDO A;  1GOZ A;  4GNX A;  1P16 A;  2AKW B;  4OWX B;  1PTO H;  2WKC A;  4DAY A;  1YVC A;  3Q8D A;  4QB4 A;  1YJ9 A;  2XGT A;  1D8L A;  4DR1 L;  2FMM A;  3G71 A;  2DNC A;  2F0E A;  3HFZ B;  1MSH A;  1GUN A;  3D4W A;  4DV7 L;  2JA6 B;  4C3J B;  4LUO A;  1KAA A;  4ZCK A;  4LW1 A;  1PA6 A;  3DMU A;  2MO0 A;  3ULJ A;  4PMW A;  1IBL Q;  4UY8 C;  1OXT A;  1I6H B;  2K50 A;  1SJE D;  3KLW A;  2KBN A;  2G9H D;  3M4O H;  2UUB L;  5JAV A;  2ZJQ A;  2QF7 A;  4YWL A;  1E7Z A;  2EZV A;  3KBG A;  2B2U A;  3VDY A;  4LNQ A;  3HOV G;  2A19 A;  4TRD A;  2HIV A;  2BH8 A;  3I91 A;  1F9S A;  5C3E H;  3QO2 A;  2CQO A;  3VYR A;  2QA4 A;  3BYY B;  1MSG A;  5IGE A;  1U4L A;  2R92 H;  1GVP A;  2MPM A;  1OXS C;  2FJ2 A;  3PIP A;  1I6V C;  2IHE A;  2Z6K C;  3HOU G;  1DYQ A;  1LTT D;  1XJV A;  2K03 A;  4R4I A;  2N8N A;  1PRT F;  2PZW A;  2NVQ B;  2D62 A;  4HJ8 A;  4IUT A;  3L2P A;  4K0K Q;  4FNF A;  1KAB A;  3NWT A;  3JC6 6;  1GM5 A;  1PRT D;  4XXE A;  1CI3 M;  3V96 A;  1PFB A;  3CCU A;  2QCP X;  4A3J B;  4ME3 A;  2A6H D;  2UXC Q;  4DUY L;  1JIC A;  1X6O A;  4PV1 C;  4QUC A;  2XNA C;  5J3B A;  4C2M H;  3CCM A;  2WAQ G;  4ALP A;  4DR4 Q;  1I4H A;  4R4T A;  1NR2 A;  5FLM H;  1IBL L;  2MQH A;  3RMH A;  4KY6 A;  1A2T A;  5IGF A;  5KNB A;  3KLR A;  4WJW A;  2E76 C;  4OWT B;  4DK6 C;  2F52 A;  2HDL A;  1NMG A;  3HP3 A;  2RDG A;  1JWM D;  5KND A;  2IJ0 A;  4LF8 L;  2UUB Q;  2RCF A;  1QZH A;  4HIO A;  1DOK A;  1IW7 D;  1EOV A;  1SNC A;  2KHS A;  4K8I A;  5IGD A;  1NJI C;  4HJ5 A;  5E4X A;  1EIF A;  3K7U C;  2D0P A;  4C3J H;  3GTJ H;  2MP1 A;  2QDL A;  3AYH B;  2JN4 A;  3GTL B;  3OHX C;  2X6G A;  2DY7 A;  1UE6 A;  2G9D A;  3QB3 A;  2NTS A;  3U50 C;  4BBS B;  1SEB D;  4DR2 L;  1YHA A;  4NPS A;  4A4I A;  1QE6 A;  2F0F A;  3M7N A;  5CMD A;  4TKO B;  1X9N A;  2F3W A;  3S1M B;  1SFO B;  4DN4 M;  3J7A 5;  4A3M H;  1NNX A;  2HDM A;  4QUF A;  1MIU A;  4UP9 A;  1HR0 Q;  1A6X A;  2KEE A;  1AE3 A;  2IWH A;  5BR8 Q;  4ZKB B;  3VYU A;  3HOW G;  2EE1 A;  1SYB A;  3PIO A;  1NAP A;  1O80 A;  1PLF A;  3CCQ A;  1A63 A;  3EN2 A;  2SNM A;  1BBU A;  4DK1 A;  1YHB A;  4PNY A;  5D3I B;  5M5W B;  3J7Y W;  1WTH A;  1Z6H A;  5ISR A;  2XRQ D;  5KGU A;  3NQT A;  2JA6 G;  3OWE B;  4JI4 Q;  1Q3L A;  1T9H A;  4JI8 Q;  2DUD A;  3E9H A;  3CHB D;  1KL9 A;  3C1F A;  3ICE A;  1VQK A;  1KC8 C;  3Q24 A;  1RJT A;  5ELE A;  4GLA C;  5K36 G;  3K8A A;  2ICI A;  3T1H L;  3UE0 A;  1JOQ A;  2R3Z A;  5HUR A;  3S2H H;  4A3J H;  3P75 A;  4IPC A;  4K2L A;  2RDH A;  1TWA B;  1XPO A;  3MAQ A;  3FRP B;  3TP8 A;  4X6A H;  2R7F A;  1ROD A;  1SRO A;  4Y7N H;  1PH3 A;  3RLN A;  4KV6 A;  4OGQ C;  2A1A A;  3OTO L;  1JR0 D;  5A35 A;  4RG1 A;  3M4Y A;  2B3G A;  4XIG S;  3NXW A;  2R92 G;  1CZG A;  3TZU A;  1FGB D;  1U4R A;  2LS0 1;  4Z9C B;  2QEJ C;  1I4P A;  1BCP D;  3SR1 A;  1L0X B;  4WRD A;  1K28 A;  3UDI A;  1E2Z A;  4KJO A;  1XPR A;  1N33 Q;  4LF6 L;  1V43 A;  1CHP D;  2F0L A;  4JI0 L;  1A8V A;  4JBJ A;  3GTJ B;  1DGS A;  1X3F A;  2B2Y A;  4AQY Q;  2AUK A;  4IPG A;  1S5D D;  5EBC A;  4O2D A;  4QQB X;  1VQC A;  4IZ8 A;  1TS5 A;  4UP7 A;  1STE A;  2JA5 H;  4JI5 L;  2YYZ A;  3F2U A;  2WAC A;  1N32 Q;  1QZG A;  1FNW A;  1STA A;  4JC0 A;  1IBK L;  3R8B A;  2F0G A;  4B3T Q;  1ENA A;  3I90 A;  3CMA A;  5CV8 A;  1TT2 A;  2RBM A;  4LAA A;  5EGT A;  1R9T B;  4IAL A;  1SMY C;  2R6G A;  1VMP A;  1JC7 A;  4C3I B;  2F3V A;  4HSP A;  5IT9 L;  3GTQ B;  3MXU A;  2HUG A;  4CDE C;  2F0U A;  2F0Q A;  1TWH B;  4N9P A;  4C3J G;  1WJJ A;  4DV3 L;  4GKK Q;  3A5U A;  1AN8 A;  3KDF A;  4GN3 B;  3TBI B;  1ESR A;  2PMZ E;  1UUP A;  2F0D A;  1SRU A;  1L0W A;  1GO3 E;  4CGY B;  5LMN Q;  5EPK A;  1VQI A;  3RZD H;  2B2V C;  3QOL A;  1KNA A;  4JV5 L;  3GTK B;  3L7Z C;  2O2L D;  4BA1 I;  5IYC G;  1B3Q A;  2EXZ A;  3PQI A;  1QVF A;  2PNH A;  1OTC A;  5D3D A;  3HOW B;  2TSS A;  3SK5 A;  4NXM L;  3PO2 G;  3A8I E;  3H94 A;  5CV7 A;  4XT3 B;  4DUZ Q;  4KY7 A;  2X69 A;  4DR5 Q;  1JE4 A;  1SSO A;  3VYT A;  1WTQ A;  3SE0 A;  3FPU B;  2R93 B;  2OEO A;  1D1K A;  4RCN A;  4CKE A;  4G57 A;  1G2S A;  3HKS A;  4A3B B;  1VF5 C;  2CQA A;  3NSW A;  2PYK A;  1I4X A;  3NTI A;  1XYI A;  2BOS A;  1G6Z A;  2E2D C;  2B8F A;  2P5Z X;  3RD4 A;  3GTO B;  4L5Q A;  3RZD B;  3KF6 A;  3CPW A;  1BBW A;  3DUZ A;  3T56 B;  3PO2 B;  2UUA L;  1R4Q B;  3I4M B;  4A93 H;  5CYU A;  3HOZ G;  3PIP 3;  2JYO A;  1MBY A;  2XTI A;  4KD3 A;  4KJN A;  3SK6 A;  1GD7 A;  4NXN L;  3W2D A;  1F77 A;  3ZJY C;  4O42 A;  4IO9 A;  4R1J A;  2HCC A;  3VR3 A;  5KEE A;  5JEA G;  1CA6 A;  1BUV T;  1SYE A;  3QR8 A;  4P75 A;  3VA7 A;  5M5X B;  1SND A;  1B7Y B;  1SXT A;  1V8Q A;  1R4P B;  2GA4 B;  4DAY B;  1CT1 D;  2F0S A;  1X3P A;  2E2H H;  1B50 A;  3PO3 G;  4F7X A;  3K6O A;  1K0R A;  1DZ1 A;  4AQY L;  1IBK Q;  3TRE A;  4I65 A;  4CJ2 C;  5LL6 X;  2RHQ B;  4BY7 H;  1IL8 A;  4O1N A;  3T13 A;  4LF6 Q;  1EQT A;  4AH6 A;  5I9O A;  1I5F A;  1HH2 P;  3IKJ A;  3F2C A;  4YWM A;  3C2P A;  1YEZ A;  3KF8 A;  3KJO A;  1WCM H;  1NMF A;  1QB5 D;  4HMJ A;  1DM0 B;  4CBV A;  4IUU A;  1M8A A;  2DGY A;  4JI1 Q;  3J81 L;  2PQE A;  3ERS X;  4Q0F A;  1NCV A;  4XQN A;  1CUK A;  3HS0 C;  2NZH A;  2NVQ H;  1WTR A;  2B2T C;  3SXH A;  4POF A;  4JVZ A;  4C1N K;  4ZUJ A;  2UU9 Q;  1VQ8 A;  5IYD H;  4J15 A;  1RL2 A;  4N8X 1;  1SYC A;  4IPH A;  3CQZ H;  2E2H B;  4S3S A;  3S16 H;  1V1P A;  3OTO Q;  1H9S A;  1ENF A;  2ZJR A;  3S17 H;  5HGT A;  2SOB A;  5M5Y H;  2PQA A;  4RCO A;  4A3B H;  1DD2 A;  1Q1E A;  3AFP A;  1STG A;  5I6Y A;  5JEA H;  2Q2I A;  1HZ9 A;  2KEC A;  1YBY A;  4KN7 C;  2WIN B;  1F2Y A;  1VQ9 A;  2N55 A;  4DV0 L;  1I4G A;  2D9U A;  4CDD C;  2LXK A;  1NY4 A;  3EA6 A;  4JI8 L;  1FNV A;  3BVG A;  3TN2 A;  4RAU C;  2NN6 H;  1XNQ L;  1FYC A;  1OXV A;  1Q82 C;  1K3R A;  4EQO A;  2NVX B;  1PMR A;  1L1O B;  3R3O A;  4GN4 B;  2PCF B;  1CSP A;  2XWB B;  4QY7 A;  3J80 i;  2D0O A;  2NVT H;  5EBD A;  1JWU D;  4KHP L;  3AEV A;  3L0O A;  3D4D A;  4K6L A;  4GLX A;  5C4J H;  2Z6K A;  2DY8 A;  3QJY A;  1EU3 A;  4C1N I;  1XTC D;  2F1M A;  2LY7 A;  3UDG A;  4YY3 L;  3AB9 A;  4A3K B;  4A3E G;  4LUZ A;  2VUM B;  3SVM A;  2D5D A;  1DON A;  1IYJ B;  4YCV A;  1KIX A;  1UE1 A;  2H1E A;  4O0A A;  4POG A;  2IX1 A;  3HOU B;  5I6W A;  4L63 B;  1IHZ A;  4X66 L;  2KCT A;  3HOV H;  2HT1 A;  5DM6 3;  2KCC A;  2ES2 A;  3D31 A;  1AW7 A;  4JBK A;  1I3Q H;  2CFM A;  2RDF A;  5CBA E;  1CK1 A;  5AJ3 Q;  1JOO A;  5IGC A;  5IP7 G;  4B3R L;  5JJK A;  2L9H A;  2B2V A;  3ER0 A;  1EY4 A;  3NQI A;  2ENB A;  2EQS A;  1EFI D;  3S1R H;  1DOM A;  1HCZ A;  3CP0 A;  4A3J G;  1WTO A;  4J6H A;  1X32 A;  1B1Z A;  4NDX A;  1GUO A;  2IHF A;  3M4P A;  1F9P A;  5JEA J;  2NBF A;  1IW7 C;  4K0K L;  4KMU C;  2C9O A;  3H0G B;  5IIF A;  1ZXT A;  5C44 H;  1MJE A;  3MWY W;  4DR4 L;  1K0S A;  1KAW A;  1Y69 U;  4X3T A;  1PFM A;  1KNE A;  4NMZ A;  2ZTD A;  5IYB G;  2R92 B;  2YU9 B;  2EVB A;  2OQK A;  5GAD C;  1HNX L;  4M8A A;  3TSS A;  2F3I A;  3ERQ A;  5M3F G;  4BA2 I;  1HFN A;  3GTK H;  3I4L A;  3CCE A;  1XMQ L;  2PW7 A;  4DUZ L;  3C1E A;  2VY3 A;  4K8J A;  1D5M C;  1K8G A;  3FKI B;  4DK0 A;  1FJG L;  4A3D B;  2OWO A;  2ZM6 L;  4FF2 A;  3MVV A;  1W6J A;  1SBB B;  3OWF A;  5IWA L;  1VQ5 A;  4BY7 G;  1MKH A;  1S4Z A;  5KIX A;  4DK3 C;  5E3F A;  1F2Z A;  4C2M B;  3S9W A;  1U0L A;  4DXG A;  1RF2 D;  2EPB A;  4IUP A;  4UPA A;  3PGZ A;  5IP7 H;  1EZ6 A;  4DAV A;  1CKN B;  1PZK D;  2RHS B;  3V2T A;  2KHJ A;  3LWU A;  2JEB I;  2XIW A;  2MUY A;  5CV4 A;  3K57 A;  5JJL A;  5C5L A;  2YU9 H;  3R2T A;  4UDU C;  4R8I A;  4EQ5 A;  2UUC Q;  3S2H B;  4FYD A;  1KHI A;  1B44 D;  5JJZ A;  3SK8 A;  2ID0 A;  2MFI A;  5JJI A;  5IOD A;  1OXX K;  1EYC A;  4QMG A;  4BXX G;  4DU9 A;  4A93 B;  2DNE A;  2EOT A;  3BG3 A;  1CSQ A;  1M1K C;  1C7Y A;  2IL8 A;  2V1C C;  1EFW A;  2X6L A;  4LF4 L;  4X65 L;  2E8G A;  2L12 A;  1N9W A;  3W1B A;  1NE3 A;  1SN8 A;  1Q8K A;  3TP7 A;  1UWV A;  1SE3 A;  2L55 A;  3SK4 A;  3BJU A;  1PDQ A;  1SJH D;  1DXM A;  1D5X C;  4A3F B;  4ULL A;  2KED A;  1LO5 D;  5FO8 B;  2NVX H;  1PH6 A;  3NBH B;  3E6Z X;  3HOX B;  4YCW A;  4A3E B;  1WCM G;  3IL8 A;  5JOB A;  3E9I A;  3TZD A;  4LUV A;  2JXM B;  3U9O A;  1LYL A;  4KI0 A;  1HUM A;  2GN5 A;  4MN3 A;  3U4Z A;  1LTR D;  2K5Q A;  3CPF A;  2PPB C;  3NBH A;  5EAY A;  3J7A V;  2H4O A;  1HXY D;  5TSS A;  2B8G A;  2M00 A;  2QKI C;  3BU2 A;  4A3G H;  5FO9 B;  4IQZ A;  1BNZ A;  4YHH L;  3PIO 3;  3GTQ H;  5I4D A;  2SNS A;  1YI2 A;  4OON A;  2JK8 A;  2E2J H;  4APV A;  2E5L Q;  3I4M H;  3AU7 A;  1J5E L;  2K33 A;  3G4S A;  2NVY B;  3FVQ A;  4JOI A;  1FNU A;  3ULL A;  1N34 Q;  3NPP A;  1Y1W H;  1A3U A;  3Q23 A;  3TP5 A;  4A3K H;  1WD1 A;  4JCV E;  4QL5 A;  4NKL A;  1QNK A;  4DV4 L;  3PF4 A;  4KK7 A;  1K8O A;  3NTK A;  1TXY A;  1LTB D;  4DNR B;  2I07 B;  2O4X A;  3C3L A;  2WAQ B;  4GS3 A;  2L5T A;  4LF4 Q;  4P71 A;  3K5M A;  4BXX H;  1Z9F A;  5C6A A;  4QCL A;  1XTD A;  1ICW A;  1E2V A;  3IRB A;  5H1S E;  1VCI A;  2PO4 A;  1PFS A;  3QWN A;  4IUQ A;  1VQD A;  1GHK A;  1SNO A;  5C4X H;  2IX0 A;  3MEF A;  1CQV A;  5C44 G;  4NP5 A;  4WJ4 A;  3S15 B;  3S1Q H;  4LF7 Q;  3E5S A;  4X65 Q;  3DXJ C;  1ZEQ X;  3K81 C;  3NWS A;  2PNR C;  3IAY A;  2BCO A;  2E2I B;  3EQL C;  4DV1 Q;  3KK7 A;  1VQH A;  4DFA A;  4E6I A;  2F0O A;  1BO0 A;  1SMY D;  5BN3 A;  2VUM H;  3VR6 A;  4CHT B;  1RKN A;  1UAP A;  5IP9 G;  4MTK A;  3S16 B;  2A68 C;  1F9R A;  3HOV B;  1QVC A;  1TWA H;  2OF1 A;  4N8F A;  1I3Q B;  1MHW C;  5BN5 A;  3CRL C;  3TS2 A;  1H9R A;  1XMQ Q;  4IFD H;  2F0H A;  2B2W C;  3G48 A;  5D14 A;  1A62 A;  3HKZ E;  1WI5 A;  2F03 A;  2AQ3 B;  5K5P A;  4AIM A;  1KQS A;  1Q7Y C;  1STN A;  3CC7 A;  3OIP A;  2CH4 W;  3OPO A;  1LT5 D;  2EYO A;  2R7D A;  3F2D A;  3I4N G;  3S1Q B;  3E3X A;  2L15 A;  2Z9H A;  1FJG Q;  1DCZ A;  3D0F A;  4DR3 Q;  2JA8 G;  3I4M G;  3N6R A;  3HOW H;  1O7I A;  3GV3 A;  3E0E A;  1BCP C;  2L1B A;  3K0Y A;  2KCM A;  3J7A F;  5FJ8 H;  2F4V L;  2JA5 G;  4AYB G;  2LXJ A;  1N8R C;  2YTV A;  3M4O B;  2BE5 D;  1PH9 A;  4PZ7 A;  1D2B A;  2BH2 A;  1TWF H;  4MTN A;  3CU7 A;  4RFB A;  3W1G A;  1K8M A;  1FVI A;  4KKU A;  4K6D A;  4X3S A;  3D6C A;  4PZ8 A;  4KN4 C;  3KLS A;  4CDF C;  4B3R Q;  4QJF A;  5AJ3 L;  1SDF A;  3X3N A;  4ZLT F;  1PH7 A;  1KDA A;  1I6H H;  4KKS A;  1H95 A;  3I73 A;  4IPD A;  4DR6 L;  1QWY A;  1B9M A;  3EVQ A;  1S72 A;  4C3I H;  4TVA B;  1K8A C;  1A15 A;  5HY6 A;  4GOP B;  1KD1 C;  5C4X G;  4DV6 L;  1VQ6 A;  3CW2 C;  4JI3 L;  4WFN 3;  4H02 A;  4A75 A;  3OW2 A;  3R93 A;  1I50 H;  3GTM H;  4JI2 L;  1W6K A;  3H6M A;  1EY6 A;  3RUZ A;  4JK1 C;  3I72 A;  2GVA A;  4RMF A;  4UP8 A;  2WKD A;  2EYP A;  5JVG 3;  5E7N A;  4BBS G;  3MXN B;  1VQF A;  1YHQ A;  2NZ1 D;  4A3C G;  3OOC A;  3WOF A;  2ICE C;  1HFG A;  3OMC A;  5M5W H;  2QW7 A;  2DJG C;  3CCL A;  2F0K A;  4YCU A;  1SYD A;  2JA6 H;  2NVY H;  1GJX A;  3GQB A;  1GUS A;  2LMC B;  2JQO A;  4HID A;  1EY7 A;  1PVO A;  2E75 C;  2B63 G;  3MXN A;  4DV2 Q;  3S2D H;  2VS1 A;  3KFU A;  2SDF A;  2F0M A;  1EY5 A;  1HA5 A;  4KHP Q;  4X62 Q;  5NUC A;  1LT6 D;  3TQY A;  1ZYR D;  2XRS D;  5GRO A;  1MJC A;  2K05 A;  4J8Q A;  3I70 A;  3QG1 A;  1E24 A;  1UE5 A;  3HOX G;  3AQQ A;  3EFX D;  1K83 H;  4JI6 L;  1VQN A;  4HED A;  5FLX L;  4A3D G;  2KCN A;  4ZAI A;  3B6Y A;  2CW0 C;  1LTL A;  1NUC A;  2A6E D;  1EEF D;  2OCE A;  2K28 A;  3CF5 A;  2EYL A;  1O7Z A;  3W5O A;  1E3P A;  1Y8O B;  4FXG C;  1BR9 A;  3J80 L;  4L8J A;  3OYY A;  1I4R A;  1TS4 A;  2AMC B;  2F0P A;  2QEX A;  1PTO C;  3KYH C;  4I7A A;  5J1Z A;  5C0X J;  3GTP H;  4WJ3 M;  5JPM C;  3PCO B;  2PI2 E;  1HNZ Q;  4JI1 L;  4FF1 A;  1KRS A;  1PRT B;  4R4Q A;  2C35 B;  4B3S Q;  4TQU S;  5IGG A;  3S15 H;  2BDO A;  1PH4 A;  2UU9 L;  1EQR A;  2HD3 A;  3CME A;  1PYW D;  2JA5 B;  3F8T A;  1TWC H;  1RD9 D;  1P8L A;  2VQF Q;  4LK1 C;  5E4W C;  2K5V A;  3GTG H;  4ME5 A;  1LT3 D;  5ELO A;  1B2T A;  3VR4 A;  1EY9 A;  2ZXP A;  4OO1 I;  3KJP A;  1C0A A;  1CQF A;  1U5K A;  3JAM L;  4A3C H;  2QIL A;  3DM1 A;  1A3T A;  2GVB A;  1EY8 A;  2VL6 A;  2XVS A;  3DLL A;  4OXP A;  5LMU Q;  1PH8 A;  3HOZ B;  4BBR G;  1B70 B;  4A3F G;  5L37 A;  5FK9 C;  2CWP A;  4A3E H;  4OEL B;  4PZ6 A;  4OO1 H;  3KBX A;  5ELF A;  4DR6 Q;  4A3L H;  3CQZ B;  2IY5 B;  1VQB A;  3A74 A;  3PUW A;  2OT2 A;  3TP6 A;  1HA6 A; 
#chains in the Genus database with same CATH homology
 2XN9 C;  3S17 B;  1LTA D;  1H9M A;  4M1U B;  4NW2 A;  3J81 E;  1D6E C;  5C4Z A;  3J80 E;  2NN6 G;  5KNC A;  5CGK A;  4OIJ A;  1BOS A;  3VR2 A;  1IKM A;  2EYJ A;  4ODG A;  5C4J B;  1J9O A;  2RQX A;  2IX3 A;  1ENC A;  1EY0 A;  3K58 A;  5CV5 A;  4F8M A;  4RKB A;  1HUN A;  1LLR D;  1IKL A;  3UI2 A;  1BF4 A;  3GTG B;  5ELC A;  2WB1 B;  4P2C B;  4XDX A;  3GV6 A;  5I2X A;  2RA4 A;  3S1R B;  1E0B A;  1DOL A;  3NUC A;  2FHT A;  1OO9 B;  4G7O C;  2AWN A;  4A3G B;  1QG7 A;  3NK9 A;  2JEA I;  1WCM B;  1Z47 A;  1SYG A;  2E2J B;  1HTL D;  4RHR A;  3DHQ A;  3H09 A;  3BVM A;  3DWP A;  5EKL A;  1S5F D;  2K01 A;  4L6T B;  2CVR A;  2B2T A;  2BDN A;  4RA8 A;  1EWH A;  4EQN A;  1JOK A;  1LAB A;  3SHL A;  2ZT9 C;  4FO2 A;  1TVX A;  1HRJ A;  4RH6 A;  1SAP A;  2NYZ D;  2A73 B;  2B2W A;  2VNU D;  1S5B D;  4IFD G;  3CRK C;  3EJI A;  1AZP A;  1ZYR C;  3X3M A;  1B4O A;  4A3I B;  4B08 A;  3K5O A;  3HKZ B;  1PRT C;  2AWO A;  4X3K A;  1K83 B;  1CA5 A;  5IOC A;  3LX0 A;  3D6W A;  1PTO B;  5KYL A;  5COY A;  1VDZ A;  4G7Z C;  2EYH A;  4RGM A;  1PTO F;  3GTM B;  1WTX A;  2R61 A;  4KY5 A;  3QIA A;  2Z8L A;  3A8J E;  1EU4 A;  3FPP A;  1PFN A;  2VB2 X;  3A54 A;  1AFP A;  3PUV A;  4H7B A;  2L4N A;  1STH A;  1G91 A;  5DEH A;  3MXP A;  1RCV D;  2PW5 A;  3HZX A;  5C4H A;  3C46 A;  3PV0 A;  3M85 A;  1STY A;  1LAC A;  5I2Y A;  4RGO S;  3KLS X;  4HN7 A;  2JA7 B;  2MJ8 A;  3DEP A;  2J7Z A;  2OXP A;  3FMC A;  1LT4 D;  1JCK B;  1O78 A;  4G4K A;  1TY2 A;  4RKL A;  2JP1 A;  3PUY A;  2K04 A;  2J0T D;  5IT9 E;  3IFD A;  2MHV A;  4ZK9 B;  3N52 A;  3OMG A;  4H0L C;  4IFD J;  5CR3 A;  2HCI A;  1EWC A;  2BA0 A;  4LJZ C;  1GUW A;  5C3X A;  3HG9 A;  4K2K A;  1SE4 A;  1OXU A;  4OL7 A;  2FMC A;  4FP5 D;  2NUC A;  4F88 A;  5EPL A;  3VYS A;  3HRZ C;  3U9S A;  2F0N A;  5C4X B;  1RTN A;  5CBE E;  2PZT A;  3BS1 A;  1AEX A;  2XWJ B;  1TS2 A;  1U9R A;  4XYQ A;  2A68 D;  2DN8 A;  1KLU D;  1ML0 D;  3K5N A;  5C3E B;  4RGN A;  2KA7 A;  1NSN S;  1TU2 B;  5C0X I;  4EGV A;  4DF7 A;  1QJO A;  1KDB A;  3D4R A;  1BCP B;  5F2D A;  1HQR D;  2L11 A;  2WV6 D;  1JOR A;  3BZD B;  2PMZ B;  1FD7 D;  3PMF A;  3KUP A;  5BN4 A;  3FEW X;  2KQ3 A;  4XYO A;  2A5H A;  1O7Y A;  1TY0 A;  1CM9 A;  1JB3 A;  1HQM C;  3ND8 A;  1DJR D;  2SEB D;  1Y8N B;  1UNS A;  2IT1 A;  1MGS A;  4RHS A;  3PUX A;  4TSS A;  4C56 C;  2QDB A;  5JVH 3;  2FFK B;  3BVZ A;  2D2C C;  1FR3 A;  2TMP A;  3MTS A;  3NBI A;  3Q22 A;  4ZRZ A;  5DM7 3;  2FIN B;  4PQX A;  5COR A;  3G7L A;  1TWC B;  1GUT A;  2JE6 I;  4IUV A;  4G7H C;  2F0T A;  2WII B;  2O5J C;  2EJF C;  4ZYS A;  1D5Z C;  1D1I A;  3SEB A;  1Q8I A;  1WTV A;  2PZU A;  5C3W A;  1NR4 A;  2IW3 A;  3TME A;  4H44 C;  2VXW A;  5K36 H;  1LTS D;  2KOL A;  2NB0 A;  4ID6 A;  4IN3 A;  5C5M A;  3Q0A A;  1F2M A;  5M3M B;  4J1M A;  1CHQ D;  3HEJ A;  3Q6S A;  3OW7 A;  1TWG B;  1YNN C;  5FOB B;  2V4D A;  2EDG A;  5D65 A;  4X3U A;  2Z4I A;  2KUM A;  3L9A X;  2AQ2 B;  1YNJ D;  2F0W A;  3QOJ A;  3A7A B;  3M3Y B;  1RHP A;  5DNF A;  4PMC A;  4KD4 A;  1MD2 D;  3R2I A;  3S1N B;  4WOR A;  1H9J A;  5A2Q E;  4R9W A;  4I7Z C;  1U4P A;  2EJM A;  4XTC S;  1V1P B;  4QIW B;  5EJW A;  3SDZ A;  2RKS A;  5J22 A;  3DWA A;  3NE5 B;  3OSO A;  4V0B A;  1ZKO A;  1EQV A;  5DAU A;  5C0X G;  4RGT A;  3MEH A;  4C3I G;  2KJX A;  2A74 C;  5J39 A;  1JQY D;  5ELB A;  3GO5 A;  3BYT B;  2F0I A;  5I9P A;  4U68 A;  3OIQ A;  2EY2 A;  1TR5 A;  5ELD A;  2Q8T A;  1TQO A;  1HHV A;  1II3 A;  4DGZ A;  4FXD A;  4XQJ A;  4BS9 A;  4HCS A;  1PZI D;  2ZXO A;  1QCB D;  1LV9 A;  3ERO A;  1QIL A;  2B2Y C;  4U67 3;  3K5L A;  3T51 B;  2EY1 A;  1S5E D;  3DWQ A;  4FF3 A;  2JA8 B;  1O7L A;  4IUR A;  2JSO A;  4FF4 A;  3FDT A;  2A6H C;  3D8G A;  1I4Q A;  1MI2 A;  4DAP A;  1HTP A;  2A69 D;  5CC4 A;  1V1O A;  4EQP A;  4K14 A;  4OHJ A;  2BA1 A;  3L3O C;  5FKA C;  1WTP A;  4CJ1 B;  4HAE A;  1WTW A;  2LFN A;  1F2L A;  2NN6 I;  3A56 A;  1E2W A;  1RTO A;  3NHH A;  2RSO A;  1VF7 A;  2HQE A;  1AP0 A;  1LTI D;  3JAM E;  3P20 A;  1Y8P B;  4F87 A;  1TWF B;  5KRU A;  5CV9 A;  3PO3 B;  3WDN A;  1IYU A;  3M7G A;  1QNU A;  3A8K E;  1CFM A;  3MFG A;  4LMQ D;  2KVM A;  2Y0S B;  3I8Z A;  2EYF A;  5LL6 S;  2B63 B;  4BY1 B;  5EKI A;  3LNN A;  3MXG A;  4MHE A;  4IUN A;  3S14 B;  1G2T A;  3O13 A;  1YNN D;  4MIU A;  4CKC A;  3H3V C;  2EY6 A;  5AFW A;  4B9W A;  1BDO A;  1Q90 A;  3I3C A;  1EZ8 A;  1M4V A;  4QF4 A;  1X3Q A;  1ET9 A;  1C48 A;  3S2D B;  4GZY C;  1S5C D;  4RWS C;  5G3L F;  1ONL A;  1Y1V B;  1PTO D;  3BDL A;  4FXK C;  4OIK A;  3T16 A;  1IYV A;  4KHZ A;  3E0J A;  5M9O A;  2K5D A;  4A3M B;  2EYM A;  5T1I A;  4K5X A;  2A6E C;  3MHB A;  2CW0 D;  1AZQ A;  4HCE A;  4XT1 B;  3TDQ A;  2I46 A;  4KKT A;  3V05 A;  3DEO A;  1C8C A;  1J8I A;  3IFT A;  1QOH A;  5T1G A;  2L0C A;  1EOT A;  4R8N A;  1L0Y B;  2RSN A;  3I4N B;  2IPK D;  2EY5 A;  1LTG D;  4BBR B;  1TKW B;  5E1F A;  4AYB B;  5M5Y B;  2K7V A;  1BCP F;  1B53 A;  4CKB A;  4IFD I;  3T4A C;  4V19 0;  2E74 C;  2Z1C A;  3ONA B;  2CHB D;  4HMI A;  4Q5V A;  1PXU A;  1Z7T A;  4N9T A;  1U4M A;  5C0X H;  2XSC A;  2K32 A;  4HR7 B;  3MA2 B;  1T5E A;  4CJ0 B;  1KDC A;  3PUZ A;  1EIG A;  4C3H B;  1YNJ C;  1ET6 A;  2F4I A;  2NVT B;  1XX8 A;  3LWE A;  1Q12 A;  2B39 A;  4PMB A;  1KLG D;  3ND9 A;  3P7J A;  5M3F B;  4BY7 B;  1H9K A;  1TS3 A;  1SNM A;  2M2L A;  3GP7 A;  2BE5 C;  5EPJ A;  1Y1W B;  3NTH A;  2C5C A;  3WOE A;  5FO7 B;  3A55 A;  3BDC A;  4XQQ A;  3GTP B;  2WP8 J;  1XXG A;  2EJG C;  2J4X A;  2N88 A;  3VA5 A;  2F0V A;  1H9S B;  1RDP D;  4DA2 A;  2AUJ D;  1BBX C;  3MZ5 A;  1G8Z D;  4EVO A;  1CZW A;  4H13 C;  1GXD C;  4Y7N B;  3RLF A;  1SNQ A;  3H91 A;  4BWG B;  3RZO B;  1GUG A;  2K1B A;  2NWG A;  3P1H A;  1WVL A;  4OO1 G;  3AMU A;  1KTK A;  3K7A B;  1A3V A;  1HPC A;  3NP8 A;  4ABN A;  1F9Q A;  1T5X D;  1TII D;  1B3A A;  1ILP A;  1WD0 A;  3CKI B;  4JBW A;  1VMC A;  3VR5 A;  2ZXR A;  5IGB A;  4B9X A;  4DNT B;  2Z4H A;  3GD7 A;  2F0J A;  2K6A A;  4KHV A;  2Q8I B;  4YIJ A;  1A2U A;  2B2U C;  1C4Q A;  2Q8R E;  3ITP A;  1EIH A;  3MC0 B;  2A69 C;  4K5W A;  3D3R A;  1GHJ A;  1G29 1;  1SNP A;  3G6J B;  2VB3 X;  4KTA A;  2LKV A;  2O5I C;  3T53 B;  1ESF A;  2RVL A;  3MFY A;  4FVM A;  4ZKC B;  5EQ0 A;  4HTH A;  5LHY 1;  3K59 A;  4HSV A;  5FLX E;  1ILQ A;  4K5V A;  3W3A A;  1EEI D;  5KYI A;  1STB A;  1XWE A;  2MGS A;  1BQQ T;  3HOY B;  1EYD A;  1PZJ D;  1EYA A;  1B9N A;  3ZYY X;  1UEA B;  2K5W A;  4C3H G;  5JPN C;  5EKK A;  4ZQ3 A;  4UAI A;  1JWS D;  3HGB A;  3A7L A;  1CTM A;  5A2Q L;  4ZUI A;  1BXT A;  4ILW A;  3URY A;  5CV6 A;  1Q1B A;  1SE2 A;  1SYF A;  2M9V A;  5G3L D;  1I50 B;  5C44 B;  2AQ1 B;  2R7Z B;  4DXF A;  2NTT A;  3BDO A;  1GOZ A;  1PTO H;  2WKC A;  4DAY A;  4QB4 A;  2FMM A;  2DNC A;  2F0E A;  1MSH A;  1GUN A;  3D4W A;  2JA6 B;  4C3J B;  1KAA A;  3DMU A;  4PMW A;  1I6H B;  1OXT A;  1SJE D;  2G9H D;  5JAV A;  2QF7 A;  2EZV A;  3KBG A;  2B2U A;  4TRD A;  3I91 A;  1F9S A;  3QO2 A;  3VYR A;  3BYY B;  1MSG A;  5IGE A;  1U4L A;  2MPM A;  1OXS C;  2FJ2 A;  1I6V C;  1DYQ A;  1LTT D;  2K03 A;  1PRT F;  2PZW A;  2NVQ B;  2D62 A;  4IUT A;  4FNF A;  1KAB A;  3NWT A;  1PRT D;  4XXE A;  1CI3 M;  3V96 A;  1PFB A;  2QCP X;  4A3J B;  2A6H D;  1JIC A;  4PV1 C;  4QUC A;  2XNA C;  1I4H A;  1NR2 A;  3RMH A;  4KY6 A;  1A2T A;  5IGF A;  5KNB A;  3KLR A;  4WJW A;  2E76 C;  2HDL A;  3HP3 A;  2RDG A;  1JWM D;  5KND A;  2IJ0 A;  1IW7 D;  1DOK A;  1SNC A;  2KHS A;  4K8I A;  5IGD A;  5E4X A;  2MP1 A;  3GTL B;  3OHX C;  2X6G A;  2DY7 A;  2G9D A;  3QB3 A;  2NTS A;  4BBS B;  1SEB D;  1QE6 A;  2F0F A;  3M7N A;  5CMD A;  4TKO B;  2F3W A;  3S1M B;  1SFO B;  4DN4 M;  2HDM A;  4QUF A;  1A6X A;  2KEE A;  2IWH A;  4ZKB B;  3VYU A;  2EE1 A;  1SYB A;  1NAP A;  1O80 A;  1PLF A;  2SNM A;  4DK1 A;  4PNY A;  5D3I B;  5M5W B;  3J7Y W;  1Z6H A;  5ISR A;  2XRQ D;  5KGU A;  3NQT A;  3OWE B;  1Q3L A;  3CHB D;  3C1F A;  3Q24 A;  1RJT A;  5ELE A;  5K36 G;  2ICI A;  1JOQ A;  2R3Z A;  5HUR A;  3P75 A;  4K2L A;  2RDH A;  1TWA B;  3MAQ A;  3FRP B;  3TP8 A;  1ROD A;  4KV6 A;  4OGQ C;  1JR0 D;  5A35 A;  3M4Y A;  4XIG S;  3NXW A;  1CZG A;  3TZU A;  1FGB D;  1U4R A;  2LS0 1;  4Z9C B;  2QEJ C;  1I4P A;  1BCP D;  3SR1 A;  1L0X B;  4WRD A;  1E2Z A;  4KJO A;  1V43 A;  1CHP D;  2F0L A;  3GTJ B;  2B2Y A;  2AUK A;  1S5D D;  5EBC A;  4IZ8 A;  1TS5 A;  1STE A;  2YYZ A;  3F2U A;  2WAC A;  1FNW A;  1STA A;  3R8B A;  2F0G A;  1ENA A;  3I90 A;  5CV8 A;  1TT2 A;  2RBM A;  4LAA A;  5EGT A;  1R9T B;  4IAL A;  1SMY C;  2R6G A;  1VMP A;  1JC7 A;  4C3I B;  2F3V A;  4HSP A;  5IT9 L;  3GTQ B;  3MXU A;  2HUG A;  2F0U A;  2F0Q A;  1TWH B;  4N9P A;  4C3J G;  1AN8 A;  3TBI B;  1ESR A;  1UUP A;  2F0D A;  4CGY B;  5EPK A;  2B2V C;  3QOL A;  1KNA A;  3GTK B;  3L7Z C;  2O2L D;  4BA1 I;  2EXZ A;  5D3D A;  3HOW B;  2TSS A;  3SK5 A;  3A8I E;  3H94 A;  5CV7 A;  4XT3 B;  4KY7 A;  2X69 A;  1JE4 A;  1SSO A;  3VYT A;  1WTQ A;  3SE0 A;  3FPU B;  2R93 B;  2OEO A;  1D1K A;  4RCN A;  4CKE A;  4G57 A;  1G2S A;  4A3B B;  1VF5 C;  2CQA A;  3NSW A;  2PYK A;  1I4X A;  3NTI A;  1XYI A;  2BOS A;  1G6Z A;  2E2D C;  2B8F A;  3RD4 A;  3GTO B;  3RZD B;  3DUZ A;  3T56 B;  3PO2 B;  1R4Q B;  3I4M B;  5CYU A;  3PIP 3;  2JYO A;  1MBY A;  4KD3 A;  4KJN A;  3SK6 A;  3W2D A;  1F77 A;  4O42 A;  5KEE A;  2HCC A;  3VR3 A;  5JEA G;  1CA6 A;  1BUV T;  1SYE A;  3VA7 A;  5M5X B;  1SND A;  1SXT A;  1V8Q A;  1R4P B;  2GA4 B;  1B50 A;  1CT1 D;  2F0S A;  1X3P A;  4F7X A;  3K6O A;  1DZ1 A;  4I65 A;  4CJ2 C;  5LL6 X;  1IL8 A;  4O1N A;  3T13 A;  1EQT A;  5I9O A;  3IKJ A;  3C2P A;  3KF8 A;  1QB5 D;  4HMJ A;  1DM0 B;  4CBV A;  4IUU A;  1M8A A;  3J81 L;  2PQE A;  4Q0F A;  1NCV A;  4XQN A;  3HS0 C;  1WTR A;  2B2T C;  3SXH A;  4C1N K;  4ZUJ A;  1SYC A;  2E2H B;  4S3S A;  1V1P A;  1H9S A;  1ENF A;  5HGT A;  2SOB A;  4RCO A;  1DD2 A;  1Q1E A;  1STG A;  5I6Y A;  5JEA H;  2KEC A;  4KN7 C;  2WIN B;  1F2Y A;  2N55 A;  1I4G A;  2D9U A;  3EA6 A;  1FNV A;  3BVG A;  3TN2 A;  4RAU C;  2NN6 H;  1FYC A;  1OXV A;  4EQO A;  2NVX B;  1PMR A;  3R3O A;  2PCF B;  2XWB B;  5EBD A;  1JWU D;  3D4D A;  4K6L A;  2DY8 A;  3QJY A;  1EU3 A;  4C1N I;  1XTC D;  2F1M A;  2LY7 A;  3AB9 A;  4A3K B;  2VUM B;  3SVM A;  2D5D A;  1DON A;  2H1E A;  3HOU B;  2IX1 A;  5I6W A;  4L63 B;  1IHZ A;  5DM6 3;  2KCC A;  3D31 A;  1AW7 A;  2RDF A;  5CBA E;  1CK1 A;  1EL0 A;  1JOO A;  5IGC A;  2L9H A;  2B2V A;  1EY4 A;  3NQI A;  2ENB A;  1EFI D;  1DOM A;  1HCZ A;  1WTO A;  4J6H A;  1X32 A;  1B1Z A;  4NDX A;  1GUO A;  1F9P A;  5JEA J;  2NBF A;  1IW7 C;  4KMU C;  2C9O A;  3H0G B;  5IIF A;  1ZXT A;  3MWY W;  1Y69 U;  4X3T A;  1PFM A;  1KNE A;  4NMZ A;  2R92 B;  2YU9 B;  2EVB A;  4M8A A;  3TSS A;  3ERQ A;  4BA2 I;  1HFN A;  3I4L A;  2PW7 A;  3C1E A;  4K8J A;  1D5M C;  3FKI B;  4DK0 A;  4A3D B;  4FF2 A;  3MVV A;  1W6J A;  1SBB B;  3OWF A;  1S4Z A;  5KIX A;  5E3F A;  1F2Z A;  4C2M B;  3S9W A;  4DXG A;  1RF2 D;  2EPB A;  4IUP A;  1EZ6 A;  4DAV A;  1PZK D;  3V2T A;  3LWU A;  2JEB I;  2XIW A;  2MUY A;  5CV4 A;  3K57 A;  5C5L A;  3R2T A;  4UDU C;  4R8I A;  3S2H B;  4FYD A;  1B44 D;  5JJZ A;  3SK8 A;  2ID0 A;  5IOD A;  1OXX K;  1EYC A;  4QMG A;  4DU9 A;  4A93 B;  2DNE A;  2EOT A;  3BG3 A;  2IL8 A;  2X6L A;  2L12 A;  3TP7 A;  1SE3 A;  2L55 A;  3SK4 A;  1PDQ A;  1SJH D;  1DXM A;  1D5X C;  4A3F B;  4ULL A;  2KED A;  1LO5 D;  5FO8 B;  3E6Z X;  3HOX B;  4A3E B;  3IL8 A;  5JOB A;  3TZD A;  2JXM B;  3U9O A;  4KI0 A;  1HUM A;  4MN3 A;  1LTR D;  2K5Q A;  2PPB C;  3NBH A;  3J7A V;  2H4O A;  1HXY D;  5TSS A;  2B8G A;  2M00 A;  2QKI C;  5FO9 B;  4IQZ A;  1BNZ A;  3PIO 3;  5I4D A;  2SNS A;  3AU7 A;  2K33 A;  2NVY B;  3FVQ A;  1FNU A;  3NPP A;  1A3U A;  3Q23 A;  3TP5 A;  1WD1 A;  4NKL A;  1QNK A;  4KK7 A;  1K8O A;  3NTK A;  1LTB D;  4DNR B;  2I07 B;  2O4X A;  3C3L A;  2WAQ B;  2L5T A;  3K5M A;  5C6A A;  4QCL A;  1ICW A;  1E2V A;  1VCI A;  2PO4 A;  3QWN A;  4IUQ A;  1GHK A;  1SNO A;  2IX0 A;  1CQV A;  4NP5 A;  3S15 B;  3E5S A;  3DXJ C;  1ZEQ X;  3NWS A;  2PNR C;  3IAY A;  2BCO A;  2E2I B;  3EQL C;  3KK7 A;  4DFA A;  4E6I A;  2F0O A;  1BO0 A;  1SMY D;  5BN3 A;  3VR6 A;  4CHT B;  1RKN A;  1UAP A;  3S16 B;  2A68 C;  1F9R A;  3HOV B;  2OF1 A;  1I3Q B;  5BN5 A;  3CRL C;  1H9R A;  4IFD H;  2F0H A;  2B2W C;  5D14 A;  2F03 A;  2AQ3 B;  5K5P A;  1STN A;  3OIP A;  3OPO A;  1LT5 D;  2EYO A;  3S1Q B;  1DCZ A;  3N6R A;  3GV3 A;  1BCP C;  2L1B A;  3K0Y A;  3J7A F;  3M4O B;  2BE5 D;  1D2B A;  3CU7 A;  4RFB A;  1K8M A;  4KKU A;  4K6D A;  4X3S A;  3D6C A;  4KN4 C;  3KLS A;  1SDF A;  3X3N A;  4ZLT F;  1KDA A;  4KKS A;  3I73 A;  1QWY A;  1B9M A;  3EVQ A;  1A15 A;  4WFN 3;  3R93 A;  1W6K A;  3H6M A;  1EY6 A;  3RUZ A;  4JK1 C;  3I72 A;  2WKD A;  2EYP A;  5JVG 3;  2NZ1 D;  3OOC A;  3WOF A;  2ICE C;  1HFG A;  3OMC A;  2F0K A;  1GJX A;  1SYD A;  3GQB A;  1GUS A;  2LMC B;  1EY7 A;  2E75 C;  3MXN A;  2SDF A;  2F0M A;  1EY5 A;  1HA5 A;  5NUC A;  1LT6 D;  1ZYR D;  2XRS D;  2K05 A;  4J8Q A;  3I70 A;  3QG1 A;  3EFX D;  4HED A;  5FLX L;  2KCN A;  4ZAI A;  2CW0 C;  1NUC A;  2A6E D;  1EEF D;  2K28 A;  2EYL A;  1O7Z A;  1Y8O B;  4FXG C;  1BR9 A;  3J80 L;  4L8J A;  1I4R A;  1TS4 A;  2F0P A;  1PTO C;  5J1Z A;  5C0X J;  5JPM C;  4FF1 A;  1PRT B;  4TQU S;  5IGG A;  2BDO A;  1PYW D;  2JA5 B;  1RD9 D;  4LK1 C;  5E4W C;  4ME5 A;  1LT3 D;  1B2T A;  3VR4 A;  1EY9 A;  2ZXP A;  4OO1 I;  1CQF A;  3JAM L;  2QIL A;  3DM1 A;  1A3T A;  1EY8 A;  2XVS A;  3HOZ B;  5FK9 C;  4OO1 H;  3KBX A;  5ELF A;  3CQZ B;  3PUW A;  2OT2 A;  3TP6 A;  1HA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...