1SNQA

Protein stability in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 130
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snqA00
4ZUIA 4ODGA 5IIFA 1JOOA 1SYBA 3BDLA 4ME5A 4NKLA 4K5WA 3MVVA 4DF7A 4N9TA 2EYOA 3PMFA 4K2KA 4KY6A 5HGTA 4K2LA 3OWFA 4KD3A 3T13A 2RDFA 2OEOA 3TP8A 1EZ6A 1EY0A 1EY7A 5F2DA 1TT2A 1KDBA 1RKNA 2KQ3A 4KHVA 4B9XA 5IGFA 3EJIA 4R8NA 2EXZA 5C5MA 1SYCA 3LX0A 4KV6A 3TP6A 4NP5A 1KDAA 2F0SA 4NMZA 1IHZA 4MIUA 4DU9A 5JAVA 5HURA 3NXWA 3DHQA 4E6IA 5IGCA 4EQOA 5KEEA 2EYLA 4KJOA 4B9WA 2WACA 4I65A 2EYPA 2F0EA 1F2ZA 4RKLA 1JORA 1SYGA 3ITPA 1EY6A 3SXHA 4IUNA 5C3XA 5IODA 1STHA 5DAUA 2F0QA 2PW5A 1STNA 3D4WA 3R3OA 4HTHA 3HZXA 5KIXA 1STYA 3MEHA 2OF1A 1A2UA 2F0GA 5IGGA 2F0OA 5J1ZA 4EQNA 3TP5A 2KHSA 4ID6A 2F0WA 4QMGA 5EKKA 4H7BA 2F0TA 2SOBA 3T16A 3TP7A 3S9WA 2EYHA 1F2YA 3EVQA 5C4ZA 5J39A 3NK9A 4ZQ3A 1A3UA 1TQOA 1JOQA 1SYDA 1EQVA 4PMBA 1SNDA 5CGKA 5KYIA 4ZUJA 5I9OA 5IGEA 5KRUA 5CV6A 3D8GA 2ENBA 4F8MA 5NUCA 4YIJA 1KDCA 3DMUA 5EGTA 3C1EA 1KABA 5E1FA 1TR5A 4RKBA 5C3WA 5JOBA 4KY5A 3NUCA 2SNSA 1NSNS 1A2TA 2M00A 5CV8A 4TRDA 4K5XA 3SK4A 2F0JA 1STAA 4IALA 1ENCA 4NDXA 2EY2A 3SK8A 5I6WA 3OMGA 5ISRA 2EYMA 4PMCA 2F0DA 3QOJA 5DEHA 5C5LA 2EY5A 2PQEA 1EY9A 2PW7A 4KJNA 4QF4A 3SK6A 5CC4A 5I6YA 1EY5A 2F0HA 3E5SA 3D4DA 5C6AA 2F0IA 2NUCA 4J6HA 5EKLA 1A3VA 1F2MA 4K14A 1STBA 3TMEA 4EQPA 5CV7A 4IZ8A 4G57A 1STGA 4KY7A 3HEJA 2F0UA 2F3WA 2HQEA 2RKSA 3MHBA 4K6DA 5M9OA 1SNPA 4WRDA 1II3A 2EYJA 3H6MA 1EY4A 3MZ5A 1SYEA 2OXPA 3NHHA 4F7XA 1SYFA 3P1HA 5IGBA 2F0LA 1EYDA 2EY6A 1AEXA 4KTAA 3MXPA 4J1MA 3V2TA 4EVOA 3NP8A 2F0NA 3VA5A 5KGUA 2PZTA 2F3VA 4DGZA 2O4XA 3OSOA 3SR1A 2QDBA 5IGDA 4K8IA 2F0MA 1JOKA 5J22A 1SNMA 1SNCA 2EY1A 5CR3A 1EZ8A 1KAAA 2RBMA 4LAAA 3EROA 2PZWA 3OMCA 2SNMA 3BDCA 5I9PA 5KYLA 1SNQA 2PZUA 4DFAA 3D6CA 5C4HA 4OL7A 4K5VA 2F0VA 1EYCA 4KD4A 5CV4A 1ENAA 2LKVA 5E3FA 1NUCA 4QB4A 3QB3A 3C1FA 1U9RA 3NQTA 3QOLA 4HMJA 4HMIA 2F0KA 4K8JA 5CV5A 3SHLA 4WORA 3SK5A 2F0PA 2PYKA 3U9OA 1A3TA 1SNOA 4PNYA 4S3SA 2EYFA 2F0FA 3ERQA 3P75A 1EYAA 1EY8A 4N9PA 5CV9A 5IOCA 5K5PA 3RUZA
chains in the Genus database with same CATH superfamily
3I56A 3CC4A 1SJHD 4A3EB 2VUMB 4C3JH 1IKMA 1GM5A 3M3YB 3FRPB 4A3GH 4QIWE 5A2QE 3GTOH 1PYBA 4YWLA 1MJCA 5DM63 4JPBW 1H9SB 3K81C 3J7ZC 2EXZA 1J6QA 3LX0A 3NENA 1KDAA 5JAVA 4DU9A 3RLFA 4DAYA 2IL8A 1SROA 1CA5A 2B39A 3L9AX 3ND8A 4ABNA 2NVQB 2RA4A 2WFWA 2QEJC 4DXFA 3S24A 4DAMA 3GTLH 2EQSA 2F0QA 2DN8A 5FOBB 5EPKA 1LT5D 2VW9A 4N8X1 2L15A 1HNWQ 1CKNA 3J7A5 2KHSA 1BCPD 4ID6A 1VQDA 2CH4W 1EFWA 2B2VC 4JBWA 2EYHA 3I4NG 4HJAA 1OXVA 3NBHB 1JOQA 1Q1BA 4JC0A 3I4MG 3S16H 4DV4L 1N32L 3GTPH 1K8GA 3KLSA 3DMUA 1I6VC 2O5IC 2K05A 3I91A 2R3ZA 4IPHA 3HOZH 1CHPD 4KN4C 1XWEA 3S1RH 4UAIA 2A5HA 3BS1A 2F4IA 4HJ9A 1Y14B 5CC4A 1KNEA 2Q2HA 2HQLA 1VQFA 2NTSA 3PUVA 4K14A 4C1NK 2VL6A 5CV7A 3EIVA 5T1GA 4JI4Q 3NEMA 2B8GA 1LT3D 5K36H 5M9OA 4WRDA 2MNAA 1VQIA 3MWYW 3BJUA 4GNXA 3KF6B 3NTIA 3D31A 1L0YB 3N6RA 2EY6A 1QOHA 3QO2A 1WJJA 1G8ZD 2KUMA 3W1BA 1Y1WG 3NE5B 4LF6Q 2XVSA 3P7JA 4KKTA 3UDFA 1S5FD 1RF2D 1TS2A 2Z8LA 2DGYA 4HJ7A 3NQTA 3PIPA 3I4OA 4RA8A 3SHLA 3A7AB 4CKBA 4DXGA 1IYUA 1GJXA 1F9QA 4C3JG 2CHBD 4A3GG 4KD3A 4TVAB 3HOUG 4LF4Q 2JEBI 1TT2A 5IGFA 4H44C 2IT1A 1K9MC 4JI4L 4MIUA 4DV5L 1BBWA 5IGCA 2L1BA 2YTXA 3LWEA 4DR4Q 4AYBG 2PW5A 4H13C 2N8NA 2G5DA 2OF1A 2IJ0A 5HGQA 3S14H 4A93H 4PQXA 4LF6L 5EKKA 2JP1A 3H94A 3EVQA 1SLJA 1V1QA 1LTRD 2E2IH 3A56A 1SNDA 1VQOA 5IGEA 4HIKA 3I70A 3QJYA 3U58A 2A6HC 3I90A 3GP7A 2N88A 1Y1VB 1DYQA 2A8VA 2NYZD 2PO4A 3HOZG 2R6GA 5IT9c 1VF7A 1H95A 2KVMA 5ISRA 1ENCA 2EY2A 1L1OC 4B3SQ 2D62A 3SK6A 2WAQE 1F9PA 1GHJA 1NE3A 2AWNA 3OIPA 3S15B 2HCIA 3K80C 4GLAC 3PSIA 4JBJA 4LF4L 5K36G 2XN9C 3FKIB 1CZWA 2RKSA 3PQIA 3J7YW 2ID0A 1SMYD 2MGSA 3MHBA 4ZLTF 3T1YQ 2UUAQ 1VQGA 1BXTA 1RCVD 2OXPA 4A3KG 1RTNA 4J15A 4DV6Q 1SN8A 4EVOA 1CA6A 1YI2A 2F0NA 1C7YA 1K0SA 2VUMH 4GOPB 2O4XA 2Z6KC 3HRZC 2F0MA 5CR3A 4G7ZC 1KAAA 5C44B 4WJ3M 1MKHA 1WFQA 1Q46A 2CKZB 4P71A 3OHXC 3RZDH 1LV9A 5GAGC 5I4DA 1VQJA 1I4PA 4UP8A 2R93B 2KA7A 1EWHA 1IBKQ 1LO5D 1QCBD 4A3BB 3C46A 1QZHA 1SYBA 1GUWA 4N9TA 2FFKB 4K2LA 4CDFC 3NQIA 4IUVA 4B3SL 5FK9C 2UUBQ 3HOYG 1EY0A 4JVZA 5IP7H 3AMUA 1XTDA 1KQSA 5LMUQ 1VDZA 1PH4A 4O1NA 2ZJPA 2PMZE 5JJKA 4DNRB 2C9OA 3T1YL 2UUAL 5KEEA 5D3IB 2BCOA 2K5VA 5AFWA 4LFBQ 4DV6L 5DAUA 1STNA 1CHQD 2WB1B 4HSPA 4DV2Q 4HJ8A 4A93G 3KK7A 4IPDA 1IBMQ 1YNJC 2F0TA 3T53B 2E5LQ 1TIID 3A8IE 5C4ZA 4HSVA 1VCIA 1HJPA 1A3UA 2VS1A 1KLGD 3ULPA 5CV6A 5NUCA 1KDCA 4BY7H 5LMNQ 1EEFD 3WOEA 2A6EC 2XWBB 1LT4D 2RDHA 3J81i 3TEHB 1IBKL 1PTOB 2RVLA 1R9TB 2EPBA 1WYDA 4JYAL 4PZ8A 1FL0A 2NWGA 4PZ7A 4FNFA 4GNXC 3C2PA 2K7VA 2L9HA 2CVRA 2XRSD 2F4VQ 1A62A 3S1NB 2D0PA 2RQXA 2UUBL 3CRKC 2A1AA 2JE6I 2NZOA 4QY7A 2WP8J 4O42A 5EJWA 5LMUL 4GLXA 2PPBC 5DLQE 4PMWA 4PG3A 3AEVA 4X66L 4RHSA 2R7ZH 4KHPQ 4IOAA 3OIQA 4A3EG 4BY1H 1PH9A 2VUMG 3PO2B 1IBLQ 1G291 1TWGB 3MTSA 4LFBL 5JJLA 1BDOA 3BZKA 4QIWB 1HFGA 3PO3H 4C3IB 1S5CD 4DV2L 3G4SA 3CPFA 1PDQA 4DFAA 5TSSA 1IBML 3MXNA 4C1NI 2K14A 3KDFA 5EPLA 2E5LL 5E3FA 2BH2A 2MJ8A 2XWJB 1PA6A 1DD2A 1AE2A 1I4HA 4H0LC 3HOVH 2E2HH 3CCSA 5LMNL 4Y7NH 1E3PA 1X3FA 4NXMQ 4DF7A 4K2KA 3JAML 1RL2A 3T13A 1IW7C 4TSSA 4RMFA 4DR6Q 4FF3A 2F4VL 5I2XA 3GDEA 4KKSA 5IP7G 1KDBA 1PH1A 3WWVA 3TP6A 4DKAC 4Q5VA 4ZYSA 5I2YA 1UE5A 1X32A 5COYA 1PZID 2EYLA 1MJEA 4A3FB 4KHPL 4ILWA 1IBLL 3J81c 5BN3A 1TWAH 5IGGA 2PQAA 1K83B 2PNHA 2SOBA 1F2YA 3TDQA 3VR4A 3FKIH 3STBC 2B3GA 3D4RA 5EBCA 3GTKH 4GZYC 5I9OA 4L63B 3TQYA 1JC7A 2I5LX 4IFDJ 5ELFA 4NPSA 3CPWA 1BCPF 3LGJA 4OO1H 4X3TA 1ICFB 3BVMA 2X69A 1TWFH 2WKDA 3VR2A 5I6WA 1DZ1A 4LMQD 5FLXc 2UXBQ 1EY9A 3E0JA 4QF4A 2Q8TA 4CKCA 1QILA 1A6XA 1EY5A 3OW7A 5C44H 4GKKQ 1NMGA 5EKLA 2Q2TA 3OTOQ 1I50H 1XMQQ 4DR6L 4G57A 4KY7A 2FHTA 2HQEA 4MTKA 4DR3Q 3HOXH 3SGIA 4FF1A 1BCPB 4U673 2EYJA 4ALPA 1N36Q 1E7ZA 2HD3A 5IWAQ 3D0FA 2R92B 4BY1G 4DUYQ 4FXGC 2VQFQ 4APVA 1JB7A 3VA5A 1PFNA 2B2VA 2PZTA 2UU9Q 2IX1A 3GTLB 4V190 4RGMA 1JQYD 4B3RQ 2RF4A 5FJ8H 2RBMA 1TS3A 3U4VA 4XYOA 5CBEE 1LACA 1EYCA 1I4XA 1TXYA 5CV4A 2A68D 2CW0D 1H9SA 4HMJA 3RLOA 1KLUD 1PRTD 3GTPB 4IUTA 2FINB 1U0LA 3J7AV 1IKLA 3LNNA 1HNXQ 3HOZB 1VQ8A 1DGSA 1QVCA 1LLRD 1NCVA 1YIJA 1RJTA 2UXBL 1E2WA 4X65Q 3HOWB 1CTMA 1K8AC 1SE3A 3W5OA 4GKKL 4DA2A 4RWSC 1KC8C 2B8FA 5C5MA 1BVSA 3PIP3 3OTOL 3R2TA 1Y1VG 3NBHA 3Q6SA 3NWSA 3Q24A 4DR3L 2K5HA 3FP9A 1N36L 2AQ2B 2A6ED 4I65A 1JORA 2EYPA 2N49A 5IWAL 4L5SA 1SYGA 1L0WA 1R9TH 4DUYL 2RHQB 3VYRA 2VQFL 1N8RC 2NVYH 2RHSB 1DOMA 2UU9L 2WAQB 3K5MA 4B3RL 4EQ5A 4B3MQ 3ONAB 4NW2A 4G4KA 3FKIG 3AQQA 4ZQ3A 1Y69U 4JG2A 3DWAA 2A69D 1UAPA 3D6WA 5BR8Q 5JPMC 3BVZA 1VMPA 2JXMB 4OO1G 1MSHA 2QW7A 1KABA 2YTVA 4CJ2C 1XNQL 4KY5A 2VY3A 4QUCA 3NSWA 1EIGA 4GLVB 1BQQT 4HIDA 1DXMA 4ZKBB 2DNCA 3OMGA 2D0OA 4PMCA 4WJWA 2NVTB 3QOJA 5DEHA 1HNXL 3L2PA 5C44G 1ICWA 5FLMH 1FR3A 5I6YA 1TU2B 1F2MA 5IP9H 3VA7A 4IOCA 4X65L 2EXDA 1II3A 2R93G 3WDNA 2P5ZX 3V96A 5LL6S 4A3BG 1AEXA 1RODA 1X3PA 1A15A 3ERSX 1PXUA 2EJGC 2H4OA 3SR1A 2QGQA 1Y8OB 1JOKA 5C4XB 2PI2A 2KJXA 1BOSA 3GD7A 4A93B 3EN2A 1LABA 4K5VA 4B3ML 1QNKA 3CC2A 4HIOA 5IODA 1NBWA 1L0XB 2SDFA 3EA6A 3IKJA 4DK1A 4A4IA 1BR9A 1ET9A 5BR8L 5CV9A 2J7ZA 2MO1A 4JI1Q 1RDPD 5C0XJ 2ICEC 2H1EA 1VS0A 1B3QA 2ZJRA 5JEAH 2R7DA 4BWGB 3RLNA 3M4PA 1WTPA 1EY7A 1PZKD 1XMOQ 3FPPA 2DJFC 1FD7D 4A3DH 4RGOS 1HTPA 3STBD 4UPAA 3SEBA 3CQZB 1EQTA 3PGZA 4IURA 2Z6KA 2AWOA 1VQPA 5JJIA 4KJOA 2Q2IA 1EOVA 3DUZA 4JBMA 1JT8A 3T51B 4A3LH 4XYQA 4A3IH 4IFDI 1PZJD 1GUSA 1FVIA 5LMNW 4OX9Q 3OOCA 2LSSA 4BXXG 4G7HC 1E24A 3PV0A 1K8MA 1V9PA 3ND9A 1DOLA 4AIMA 2LFNA 4ZAIA 4F8MA 2DY8A 3NTHA 1PH2A 4A3CG 5E1FA 3RZDB 3CCQA 1GVPA 4CDDC 2R92H 4H02A 3PO2G 1A2TA 5IT9L 1RD9D 4JI1L 1IL2A 1AH9A 1D5XC 4C3IG 5FLMG 4V0BA 1I4QA 1G2TA 2R61A 3Q8DA 3JAME 4OWTB 3NELA 3UE1A 1XMOL 3E3XA 1SNPA 3H6MA 1HNZQ 1X6OA 1FNVA 2UUCQ 3A54A 4POFA 1SYFA 5M5YH 2OTLA 4RG1A 3T56B 4EGVA 3C3LA 3NPPA 2C35B 3NP8A 1SE8A 2TSSA 4ZRZA 3CCJA 1SNMA 1YNXA 4IUQA 1SE2A 1KD1C 5KYLA 1EUJA 3HOWH 4OX9L 2AKWB 1S40A 1CSPA 4QB4A 4DV5Q 2EZVA 3SXHA 1N33Q 3HGBA 3F2BA 2ZTEA 3U9OA 4LFCQ 4R1JA 2PNRC 2EYFA 2EJFC 4BY7B 4X64L 1PH7A 1FYCA 2JA5H 3HFZB 4ODGA 4A3FG 2WV6D 4OIJA 5JVH3 2ZJQA 3GO5A 1O7ZA 3I7FA 3KLSX 4WFN3 2VXWA 2Z9HA 1RKNA 2A19A 3KF8B 4BBSH 2X6GA 1E0BA 1PYSB 1OO9B 4NMZA 3DWQA 2ZM6Q 3HS0C 4C2MB 1TVXA 1AZQA 2NN6H 1HNZL 2UUCL 1XX8A 3MA2B 4N8FA 2R7ZB 5C3XA 4BY1B 1F2LA 2K04A 1TWHH 3A0JA 5G3LD 2NVTH 4NB3A 5KIXA 3D3RA 4IUUA 1A2UA 2F0GA 3DXJC 3PO3B 2L0CA 3T16A 3KBXA 3K7AB 1A63A 4GS3A 3AFQA 4BA1I 1B53A 5EGTA 5M3FB 1N33L 2QF7A 4P72A 2JEAI 2R92G 4LFCL 3HOVB 2E2HB 1UE1A 4UDUC 2C5CA 4O0AA 4Y7NB 1U5KA 3J80i 1MD2D 1IZ6A 2F0DA 1KHIA 2EDGA 3PIOA 1STEA 5C4XH 2PW7A 1STBA 3M4QA 4IZ8A 1XTCD 4YCWA 1Q7YC 2SEBD 1CKMA 2F1MA 3UDGA 5LHY1 1WD1A 3VR3A 2ZM6L 3H91A 3BDOA 1KNAA 4OELB 5DM73 2HDMA 5M3MB 1W3SA 2LY7A 1TWAB 4DNTB 4XIGS 1UEBA 3HOWG 1EIYB 5C0XI 1SNQA 5GADC 3W2DA 4KD4A 1NUCA 3CQZH 2BA0A 5GQOA 3GTKB 4HN7A 2GVAA 4CDCC 2JA5G 3OWEB 5IY0A 1WI5A 2KCNA 4KLKA 4DR7Q 2E8GA 3RUZA 4LF5Q 4ME5A 1TWFB 3RZOB 4RCNA 1H9RA 1PRTF 2WAQG 4KY6A 2XNAC 1D1KA 2DJGC 2D5DA 5F2DA 2CH4A 5E4WC 4KHVA 1G6ZA 3V05A 3PUWA 2QEXA 2JA7H 1I50B 1SYCA 1H9MA 2K4KA 3MEFA 2E76C 4YHHQ 3HOXB 4P74A 4B3TQ 2NN6G 1F77A 4JI0Q 1SBBB 5C4JH 3E6ZX 1H9JA 2RDGA 3L3OC 1CKNB 4JYAQ 3TREA 1HZCA 1PRTB 5C3EB 1CFMA 3D4WA 4U68A 3HZXA 4M8AA 1ESFA 3J81L 5CMDA 1NR2A 4CDEC 3J80c 2AMCB 3TP7A 3MXUA 1VQCA 1G6PA 4LUZA 1JB3A 3TSSA 5M5XH 4CHTB 4GOPC 1VQ5A 3URYA 4X66Q 3A7LA 4IJLA 2J4XA 1A8VA 2MQHA 2B2YA 3S1MH 2K75A 1VQAA 4DR7L 4K5XA 3H09A 3CC7A 4QCLA 5FLXL 3TBIB 4LF5L 5C5LA 5C4XG 1HUNA 3M7GA 4CKEA 1WCMH 2K1BA 3FMCA 1LTBD 2KEDA 2WINB 4JI3Q 5D14A 5M5WH 4A76A 2F0UA 1D1IA 1JWUD 1XNRQ 3H3VH 1VQEA 1JE4A 2KOLA 1S72A 4YHHL 4B3TL 4A3MB 4HAEA 4JI0L 4J1MA 2UXDQ 4KI0A 2QDBA 3BYTB 3S2DH 4X6AH 2NVYB 4MN3A 1JE5A 3RR5A 2EOTA 1KRSA 3VYSA 4KK7A 1NTGA 1MBYA 1UUPA 3IRBA 1BO0A 2EE1A 2Z4IA 4FO2A 1NJIC 3QWNA 1DCZA 3QOLA 2F0KA 3QG1A 2F52A 4C2MH 1WTWA 4OWWB 5T1IA 2NVXB 3P75A 2AUJD 1K73C 2Z4HA 4YWMA 3CMEA 4FYDA 1B7YB 3K0XA 1HZBA 5IT9E 1I6HH 2RDFA 3FHWA 4LW1A 1GOZA 4FF2A 3K7AH 2JA7G 3T4AC 4JOIA 3HKSA 2R7FA 4KV6A 1GO3E 4JI3L 1M1KC 5HY6A 1PTOC 1HA6A 1Q90A 4XT1B 2MUYA 4R9WA 1ZYRC 1J8IA 1K0RA 5M3FH 1XNRL 1YNNC 2JK8A 5FO7B 5IYDH 4B9WA 2WACA 1U4MA 4JCVE 4K0KQ 3K6OA 4HTHA 3G48A 1AW7A 2UXDL 2K32A 3G71A 1P8LA 5J1ZA 2F0WA 1C4QA 1PH8A 1M8AA 1V43A 2M9VA 2OCEA 4OHJA 4GKJQ 1K8OA 4TQUS 2H5XA 2XSCA 1SFOH 4YIJA 2A6HD 1TR5A 4LNQA 1ML0D 5AJ3Q 1PMRA 4ZKCB 1S5BD 4TRDA 4I7AA 1VQBA 1ONLA 3X3MA 3BU2A 5M3MH 2L12A 4OONA 2VB3X 2B2UA 1BKBA 5C6AA 3A8KE 2XRQD 5DNFA 1M90C 1YJNA 1HCZA 3HEJA 4A3DB 4KKUA 4K6DA 3PUZA 1V1PA 1EY4A 4BY7G 2RSOA 1Q82C 3GV3A 1YEZA 1HH2P 4HCEA 5J3BA 3V2TA 3LWUA 4CJ0B 4Q0FA 3Q23A 3OSOA 5EKIA 3TN2A 3RZOH 1T9HA 4K0KL 1E22A 1R4PB 2K5NA 4A3IB 2EJMA 2EY1A 2OT2A 2Q8RE 3DEOA 4XTCS 3QB3A 1U9RA 4HMIA 1OXUA 5ELOA 4GKJL 1SNOA 4S3SA 4RFBA 4C56C 3ERQA 3TZDA 3JAMi 3PF5A 4DK6C 2R7ZG 5C3EH 5AJ3L 2PI2E 2ALYB 1PYWD 3PO3G 4FVMA 4UP9A 4GN3B 3S2HH 1GXDC 1N9WA 2KCTA 2KQ3A 1AZPA 1Q12A 4R8NA 2IX3A 4UHVA 1Y8PB 2Y0SE 2Z6BA 1PH6A 3GV6A 5M3FG 1ASZA 1PVOA 1ESRA 1XNQQ 3DLLA 5IYDG 3HOVG 3FPUB 1ASYA 1ILQA 5M5YB 1HXYD 3GTMH 1HR0Q 3R3OA 1OXTA 5ELBA 1VQHA 1GUTA 3MEHA 3W1GA 3W3AA 2F0OA 1BCPC 2M2LA 1YNJD 2B2YC 1OXXK 3ZJYC 5J39A 2K50A 2NTTA 1SYDA 2VB2X 5G3LF 4ZUJA 3VYTA 5KRUA 3CU7A 2WKCA 4PZ6A 2CFMA 4R4OA 2OTJA 1Q8IA 1Z47A 4XXEA 1F9SA 4A3MH 2JA6H 1HRJA 3G6JB 1EQQA 2JA5B 1NSNS 2CCZA 1G91A 3GTGH 1STAA 4Z9CB 4IPCA 4HEDA 3NTKA 5M3MG 4LF9Q 4DV0Q 2CQOA 3UDIA 1GUOA 4BS9A 1BBUA 3TMEA 1A3VA 3G7LA 4LWCA 4BBSB 1S5ED 3CW2C 1X3GA 1Q3LA 3BZCA 3NHHA 2NVXH 3QR8A 2HCCA 2FMMA 1ILPA 4KTAA 3KF6A 3HKZE 3VR6A 2V1CC 3N52A 3PIO3 3JAMc 1BBXC 1B1ZA 1TWHB 1RIPA 4IQZA 5EPJA 1HR0L 4R4TA 1IYJB 1EZ8A 3KDFB 3IFTA 3L0OA 2HHHL 3OMCA 1G2SA 3RN2A 3S1QH 1B3AA 1QVFA 1EIHA 3J81E 1HQRD 5C4HA 1X9NA 2F0VA 3S17B 2JYOA 2N55A 4DAPA 1PFMA 3HOXG 1NAPA 1WTOA 3KF8A 3AB9A 1PTOD 5CV5A 3MC0B 4PNYA 2K5WA 3M4YA 4LFAQ 1B2TA 1EY8A 3KLWA 4L6TB 3MAQA 1K3RA 3KJOA 3CP0A 5C3EG 4JOIC 4F87A 1IL8A 3BDLA 5H1SE 5ELCA 1SXTA 3M85A 5FJ8G 2NB0A 1X3EA 4LF9L 1IW7D 4DV0L 3KJPA 5FLXE 1JWMD 2JQOA 2JA8B 1C0AA 3I4MH 1LTSD 4RHRA 3A74A 1IHZA 2BOSA 1TS5A 3KUPA 1UNSA 2PMZB 3FVQA 3NXWA 3OW2A 2KHIA 3KOJA 2B2TA 3WOFA 4YWKA 1CZGA 1TKWB 2MP1A 1LTID 3ITPA 4IUNA 1KXLA 1U4LA 2MO0A 5A35A 2WB1E 1WTHA 2IY5B 1STYA 4RGTA 4EQNA 5BN4A 4QMGA 1GUNA 2QKIC 3RD4A 5JVG3 1EQVA 1VQLA 2NBFA 1R4QB 4UP7A 3PCOB 2B2UC 4A3MG 3ULLA 3K8AA 4IFDH 2V4DA 1VQNA 4IO9A 2D9UA 4LFAL 1E1TA 4RH6A 5CV8A 4XQQA 3K57A 5JPNC 4NDXA 4AH6A 1YJ9A 2K03A 3J81j 4JI5Q 1AE3A 4KJNA 4ZK9B 2LMCB 1JICA 2N3SA 3CCEA 4AQYQ 3H0GB 4J8QA 1EFID 3K5LA 2RCNA 1SE4A 4K6LA 1SAPA 2E2JB 5FO9B 1N34Q 3PF4A 2JA7B 1CSQA 3DWPA 4X64Q 1X54A 2O5JC 1EYDA 5C4JB 4QL5A 5KNDA 4RGNA 2HDLA 2K52A 4K8IA 2MPMA 3G6EA 2L5TA 2ZT9C 1GD7A 3E9HA 4GOPA 3HOUH 2K6AA 1VQMA 4RCOA 5IP9G 4OGQC 1ENAA 2I07B 1CK1A 1QJOA 2JN4A 3C1FA 4XQJA 5BN5A 5M5XB 2KCCA 1VQ9A 1QUQB 1RTOA 1TS4A 5IYBH 1JOOA 3S1MB 2NZHA 2BE5C 1LM0A 1QB5D 1O7YA 3MVVA 3CXCA 4XT3B 3CCMA 5HGTA 3F1ZA 1O78A 2UXCQ 2OEOA 3EFXD 4JI5L 5CBAE 3JC66 2HUGA 1C9OA 1WCMB 4B9XA 4AQYL 3K5NA 3CCLA 1QVGA 2HIVA 4NXNQ 5M5WB 3B6YA 1N34L 1D7QA 1FNWA 3DEPA 3K58A 4EQOA 2HT1A 4WJ4A 1ZEQX 2IHFA 4CBVA 4JK1C 1U4PA 1GKHA 1FJGQ 1STHA 2AQ1B 3P20A 5JEAG 3UDXA 2VQEQ 2XTIA 2GN5A 3S2DB 3MXGA 2I5MX 3TP5A 3J80L 4BA2I 4HIMA 4A3DG 1KRTA 4ME3A 1O80A 4JI7Q 4A75A 4BBRB 3I73A 1W6JA 4A3KH 2QDLA 3X3NA 4DV1Q 4IFDG 2CWPA 5JOBA 4FDBA 2SNSA 1I3QB 2YYZA 2YV5A 1BUVT 4X3KA 1V1OA 1XXGA 3SK4A 3SK8A 3RMHA 4A3LG 4A3IG 1VQ6A 3L7ZC 1HNWL 3H3VC 1I6HB 3D4DA 2UXCL 1AFPA 4EQPA 3R2IA 2RCFA 3S17H 1PFSA 3BG3A 4YCVA 2OWOA 3SE0A 4NXNL 3MZ5A 4HJ5A 1VQ7A 5EBDA 4UY8C 2B2WC 5IGBA 3NWTA 1CQVA 4C3HB 5ELNA 2NN6I 4DK0A 3VDYA 1FJGL 1EQRA 3HP3A 1XJVA 2AQ3B 4AYBE 2AHOB 2VQEL 2A74C 2QILA 3HOYH 3F2UA 5IYCH 3BDCA 2JA8H 1I4RA 1X55A 1L1OB 4OL7A 2Y0SB 4KN7C 1G51A 2K01A 1O7LA 1EL0A 4WORA 1KTKA 2PYKA 1SFOB 4JI7L 2L55A 5IYBG 3E9IA 5K5PA 1PV4A 4DV1L 4ZUIA 1BNZA 3CCRA 5C0XH 4JI2Q 5E4XA 2IW3A 1PHJA 1JWSD 1QG7A 1TY0A 2B2TC 3OWFA 1I5FA 2NZ1D 3CD6A 3GTQH 1Z6HA 1MIUA 2N78A 1HR0W 2K5DA 1U4RA 1YHBA 1F2ZA 2F0EA 3GQBA 2HIXA 4LF7Q 3CRLC 4KHZA 1NNXA 1PFBA 3MFGA 3I8ZA 2GVBA 1DOKA 4TKOB 4Y52H 3AYHB 3H0GH 2X6LA 3BYYB 5GROA 4BBSG 2E2JH 1D5MC 4DAYB 4A3JH 3ZYYX 1YZ6A 3C1EA 3NUCA 1PH3A 4EX5A 3HKZB 1VQ4A 5FO8B 3I55A 4A3EH 5IIFA 2F0JA 2Q2UA 1CM9A 3M3YH 4DR4L 5IE8A 2EY5A 4JI6Q 4JI2L 4R4IA 4QGUA 4J6HA 3S2HB 1YVCA 2B63B 2LXJA 3K7UC 3DM3A 2NVQH 2I46A 1QE6A 3M4OB 3A55A 4DUZQ 1FNUA 4DR2Q 4R4CA 3MXPA 1W2BA 1UE7A 1GHKA 2BE5D 4X3SA 1RHPA 5L37A 4LF7L 3GTMB 2TMPA 1KAWA 3O13A 3PUXA 4IPGA 2BDNA 4MZ9A 5IYCG 1YJWA 2A73B 2PZWA 1KIXA 1IYVA 1SDFA 2JA8G 2MHVA 3I72A 4LUVA 5GAHC 1XYIA 4GNXB 2Z1CA 1CKOA 2A68C 2CW0C 3ULJA 5D3DA 2BDOA 2F3IA 4K8JA 1PRTC 1YHQA 2ASBA 1HHVA 1A3TA 4YCUA 1S3OA 2F0FA 1EYAA 4F88A 4OWXB 4LK1C 2JA6B 1WTQA 1Q81C 2L11A 5C0XG 1HTLD 1WD0A 3GTGB 1SRUA 4K5WA 3RN5A 1PTOF 2EYOA 4XQNA 1H9KA 3MFYA 3KFUA 3CHBD 4OIKA 4JI6L 3U9SA 4DV7Q 2D2CC 1D5ZC 4NP5A 1Y8NB 2YU9B 4BBRH 1TWCB 1B50A 1LTGD 2O2LD 3E0EA 4QJFA 3K59A 1Z9FA 3H3VI 4B08A 2EIFA 3F8TA 3HG9A 1I3QH 4DR5Q 1OTCA 1ENFA 1EOTA 4HCSA 3IL8A 4DUZL 1JJ2A 4DR2L 4P2CB 1QNUA 2KEEA 1YITA 3H0GG 3UI2A 2Q8IB 3S1QB 1CT1D 1E1OA 1Q8KA 1TQOA 2A69C 4A3JG 4PMBA 4JV5Q 2JJQA 4IJHA 3D8GA 1E2ZA 4RAUC 4G7OC 1JMCA 1HA5A 3AU7A 4C3HH 5A2QL 3TRZA 3CAMA 1HPCA 3BZDB 1A0IA 2EYMA 4X3UA 3CCVA 1SJED 4FP5D 2ZXPA 3F2DA 2FMCA 4LJZC 4X62Q 3IFDA 3SVMA 3CKIB 3I4NB 3KYHC 3GTJB 4JI8Q 4DV7L 1EU4A 1UEAB 3I4MB 1SR3A 1SYEA 4F7XA 2VNUD 3P1HA 3J7AF 2JSOA 2KENA 3TS0A 3FDTA 5KGUA 3FEWX 4GN4B 2XGTA 5EAYA 4DR5L 4DGZA 5IGDA 1XPUA 1MGSA 4L5QA 3T1HQ 5KNBA 1SNCA 4DAVA 3AFPA 4LAAA 4KMUC 1X65A 1YBYA 2SNMA 1WCMG 2XIWA 4OEMB 4R8IA 3I2ZA 2PZUA 2YTYA 1UWVA 1J5EQ 2FJ2A 3EBEA 2KBNA 3J80E 3A5UA 3BVGA 1C8CA 5D65A 1XPRA 4JV5L 1Y1VH 3SK5A 4R4QA 2ATWA 4N9PA 5JEAJ 4FXKC 1EIFA 3RNUA 4MTNA 2ICIA 1EYGA 1Y1WB 3PMFA 3IAYA 1WTRA 2G9DA 3S15H 1B4OA 2QCPX 3K5OA 4X62L 1NMFA 4BBRG 2QA4A 1WTVA 3EQLC 1XPOA 5HURA 2ZXRA 3Q0AA 4JI8L 4E6IA 2KECA 4MNOA 1DONA 4FXDA 4IUPA 3QIAA 1GUGA 4OO1I 4C3JB 2J0TD 2IX0A 2I5HA 2E74C 4NXML 4A3GB 3GTOB 4CJ1B 3T1HL 1CQFA 1SSOA 3HOUB 1Z7TA 1EWCA 3NBIA 3S9WA 2DY7A 2B63H 3K0YA 5CGKA 1MI2A 5KYIA 1J5EL 4FF4A 1PH5A 3U50C 5GAEC 3VYUA 2ENBA 4DV3Q 3KBGA 1AN8A 2R93H 4RKBA 4DN4M 4DPGA 3M4OH 4A3BH 1KL9A 4C3HG 2M00A 2BA1A 4YY3Q 1QWYA 5ELEA 1DJRD 4IALA 2PCFB 1ZKOA 4AYBB 5CORA 2HHHQ 2PQEA 2F0HA 2WIIB 2RSNA 4DR1Q 2Y0SG 4POGA 1STGA 3R93A 2F3WA 3M7NA 2F03A 1T5XD 3S16B 1SMXA 5ELDA 1LYLA 5FKAC 1VQKA 1HQMC 4P75A 3UE0A 4DNIA 2F3VA 3H15A 2I0QA 4MHEA 1JJGA 1QUQA 4LUOA 3S1RB 4QUFA 1D2BA 2ZTDA 4L5RC 1O7IA 1UE6A 1X56A 3EROA 5I9PA 3TS2A 1L2FA 5E7NA 1LUZA 2LS01 2B29A 2K28A 1XMQL 1B8AA 1MSGA 1W6KA 2FXQA 2YU9H 1TWCH 4PV1C 4I7ZC 4OXPA 4LF8Q 1P16A 1FGBD 1JR0D 4QQBX 1J9OA 4DV3L 2EVBA 5IOCA 4A3KB 1B9NA 5KNCA 1PTOH 3A8JE 1HUMA 4NKLA 1D8LA 3DM1A 2DNEA 5JJZA 4YY3L 1QZGA 3VR5A 3S1NH 1I4GA 4DK3C 3MXNB 3TP8A 1MHWC 1EZ6A 2ZTCA 2ZXOA 1DM0B 2B2WA 3Q22A 3CF5A 3I4LA 4BXXH 3EJIA 4P73A 4DR1L 2F0SA 1HFNA 1I94Q 4ULLA 1JCKB 2BH8A 1ZYRD 4A3CH 3DHQA 1HZAA 1YNND 1Q1EA 3HKZG 1Q86C 4RKLA 2IPKD 1S5DD 1B44D 3SDZA 3PO2H 1TWGH 1EY6A 3M9BA 2OQKA 1K3BC 3F2CA 4XDXA 4JW0A 4C3IH 3PUYA 2OQ0A 1EWIA 1JJCB 4H7BA 1PLFA 3HOYB 1WOCA 1ZXTA 2B63G 1WTXA 2E75C 3NK9A 1D6EC 3OPOA 2VZAA 3I4NH 2K33A 5CYUA 3KLRA 3GTJH 1FGUA 1B9MA 2CQAA 3TZUA 1LTTD 2IHEA 2L4NA 1TY2A 5C3WA 4LF8L 1K28A 2K5QA 1LT6D 3CCUA 4CGYB 4O2DA 1SEBD 2CWAA 1IXRA 2PQAB 2LXKA 2G9HD 3OYYA 1HZ9A 1VF5C 2MFIA 3S14B 3E5SA 3U4ZA 2F0IA 2NUCA 5EQ0A 1WVLA 3I3CA 1BF4A 3GTQB 1NY4A 2KCMA 1V1PB 5LL6X 4GN5A 1CI3M 2E2IB 4IN3A 1L1OA 1LTLA 3R8BA 1LTAD 2KHJA 2ES2A 1VMCA 2Z0SA 4M1UB 1F9RA 2F0LA 1I94L 1B70B 1OXSC 2E2DC 3A5ZB 4L8JA 1NR4A 2JA6G 1T5EA 1ET6A 1AP0A 2WB1G 4A3FH 1V8QA 3ICEA 4HR7B 1Y1WH 4JBKA 1EU3A 1M4VA 4ZCKA 5J22A 1K83H 4L5TA 3CMAA 1EEID 1X3QA 2AUKA 2DUDA 3D6CA 4DV4Q 1N32Q 2IWHA 2LKVA 1C48A 1SMYC 4A3JB 2GA4B 2F0PA 1CUKA 2JA9A 1S4ZA 1YHAA 3ER0A 1E2VA
chains in the Genus database with same CATH topology
1SJHD 4A3EB 2VUMB 1IKMA 3M3YB 3FRPB 5A2QE 5DM63 1H9SB 2EXZA 3LX0A 1KDAA 5JAVA 4DU9A 3RLFA 4DAYA 2IL8A 1CA5A 2B39A 3L9AX 3ND8A 4ABNA 2NVQB 2RA4A 2QEJC 4DXFA 2F0QA 2DN8A 5FOBB 5EPKA 1LT5D 2KHSA 1BCPD 4ID6A 2B2VC 4JBWA 2EYHA 1OXVA 1JOQA 1Q1BA 3KLSA 3DMUA 1I6VC 2O5IC 2K05A 3I91A 2R3ZA 1CHPD 4KN4C 1XWEA 4UAIA 2A5HA 3BS1A 2F4IA 5CC4A 1KNEA 2NTSA 3PUVA 4K14A 4C1NK 5CV7A 5T1GA 5K36H 2B8GA 1LT3D 5M9OA 4WRDA 3MWYW 3NTIA 3D31A 1L0YB 3N6RA 2EY6A 1QOHA 3QO2A 1G8ZD 2KUMA 3NE5B 2XVSA 3P7JA 4KKTA 1S5FD 1RF2D 1TS2A 2Z8LA 3NQTA 4RA8A 3SHLA 3A7AB 4CKBA 4DXGA 1IYUA 1GJXA 1F9QA 4C3JG 2CHBD 4KD3A 2JEBI 1TT2A 5IGFA 4H44C 2IT1A 4MIUA 5IGCA 2L1BA 3LWEA 2PW5A 4H13C 2OF1A 2IJ0A 4PQXA 5EKKA 2JP1A 3H94A 3EVQA 1LTRD 3A56A 1SNDA 5IGEA 3I70A 3QJYA 2A6HC 3I90A 3GP7A 2N88A 1Y1VB 1DYQA 2NYZD 2PO4A 2R6GA 1VF7A 2KVMA 5ISRA 1ENCA 2EY2A 2D62A 3SK6A 1F9PA 1GHJA 2AWNA 3OIPA 3S15B 2HCIA 5K36G 2XN9C 3FKIB 1CZWA 2RKSA 3J7YW 2ID0A 1SMYD 2MGSA 3MHBA 4ZLTF 1BXTA 1RCVD 2OXPA 1RTNA 4EVOA 1CA6A 2F0NA 2O4XA 3HRZC 2F0MA 5CR3A 4G7ZC 1KAAA 5C44B 3OHXC 1LV9A 5I4DA 1I4PA 2R93B 2KA7A 1EWHA 1QCBD 1LO5D 4A3BB 3C46A 1SYBA 1GUWA 4N9TA 2FFKB 4K2LA 3NQIA 4IUVA 5FK9C 1EY0A 3AMUA 1VDZA 4O1NA 4DNRB 2C9OA 5KEEA 5D3IB 2BCOA 5AFWA 5DAUA 1STNA 1CHQD 2WB1B 4HSPA 3KK7A 1YNJC 2F0TA 3T53B 1TIID 3A8IE 5C4ZA 4HSVA 1VCIA 1A3UA 1KLGD 5CV6A 5NUCA 1KDCA 1EEFD 3WOEA 2A6EC 2XWBB 1LT4D 2RDHA 1PTOB 2RVLA 1R9TB 2EPBA 2NWGA 4FNFA 3C2PA 2K7VA 2L9HA 2CVRA 2XRSD 3S1NB 2RQXA 3CRKC 2JE6I 2WP8J 4O42A 5EJWA 2PPBC 4PMWA 4RHSA 3OIQA 3PO2B 1G291 1TWGB 3MTSA 1BDOA 4QIWB 1HFGA 4C3IB 1S5CD 1PDQA 4DFAA 5TSSA 3MXNA 4C1NI 5EPLA 5E3FA 2MJ8A 2XWJB 1DD2A 1I4HA 4H0LC 4DF7A 4K2KA 3JAML 3T13A 1IW7C 4TSSA 4FF3A 5I2XA 4KKSA 1KDBA 3TP6A 4Q5VA 4ZYSA 5I2YA 1X32A 5COYA 1PZID 2EYLA 4A3FB 4ILWA 5BN3A 5IGGA 1K83B 2SOBA 1F2YA 3TDQA 3VR4A 3D4RA 5EBCA 4GZYC 5I9OA 4L63B 1JC7A 4IFDJ 5ELFA 1BCPF 4OO1H 4X3TA 3BVMA 2X69A 2WKDA 3VR2A 5I6WA 1DZ1A 4LMQD 4CKCA 1EY9A 3E0JA 4QF4A 2Q8TA 1QILA 1A6XA 1EY5A 3OW7A 5EKLA 4G57A 4KY7A 2FHTA 2HQEA 4FF1A 1BCPB 4U673 2EYJA 2R92B 4FXGC 3VA5A 1PFNA 2B2VA 2PZTA 2IX1A 3GTLB 4V190 4RGMA 1JQYD 2RBMA 1TS3A 4XYOA 5CBEE 1LACA 1EYCA 1I4XA 5CV4A 2A68D 4HMJA 2CW0D 1H9SA 1KLUD 1PRTD 3GTPB 4IUTA 2FINB 3J7AV 1IKLA 3LNNA 3HOZB 1LLRD 1NCVA 1RJTA 1E2WA 3HOWB 1CTMA 1SE3A 4DA2A 4RWSC 2B8FA 5C5MA 3PIP3 3R2TA 3Q6SA 3NBHA 3NWSA 3Q24A 2AQ2B 2A6ED 4I65A 1JORA 2EYPA 1SYGA 3VYRA 1DOMA 2WAQB 3K5MA 3ONAB 4NW2A 4G4KA 4ZQ3A 1Y69U 3DWAA 2A69D 1UAPA 3D6WA 5JPMC 3BVZA 1VMPA 2JXMB 4OO1G 1MSHA 1KABA 4CJ2C 4KY5A 4QUCA 3NSWA 1EIGA 1BQQT 1DXMA 4ZKBB 2DNCA 3OMGA 4PMCA 4WJWA 2NVTB 3QOJA 5DEHA 1ICWA 1FR3A 5I6YA 1TU2B 1F2MA 3VA7A 1II3A 3WDNA 3V96A 5LL6S 1AEXA 1RODA 1X3PA 1A15A 1PXUA 2EJGC 2H4OA 3SR1A 1Y8OB 1JOKA 5C4XB 2KJXA 1BOSA 3GD7A 4A93B 1LABA 4K5VA 1QNKA 5IODA 1L0XB 2SDFA 3EA6A 3IKJA 4DK1A 1BR9A 1ET9A 5CV9A 2J7ZA 1RDPD 5C0XJ 2ICEC 2H1EA 5JEAH 4BWGB 1WTPA 1EY7A 1PZKD 3FPPA 1FD7D 4RGOS 1HTPA 3SEBA 3CQZB 1EQTA 4IURA 2AWOA 4KJOA 3DUZA 3T51B 4XYQA 4IFDI 1PZJD 1GUSA 3OOCA 4G7HC 3PV0A 1K8MA 3ND9A 1DOLA 2LFNA 4ZAIA 4F8MA 2DY8A 3NTHA 5E1FA 3RZDB 1A2TA 5IT9L 1RD9D 1D5XC 4C3IG 4V0BA 1I4QA 1G2TA 2R61A 3JAME 1SNPA 3H6MA 1FNVA 3A54A 1SYFA 3T56B 3C3LA 4EGVA 3NPPA 3NP8A 2TSSA 4ZRZA 1SNMA 4IUQA 1SE2A 5KYLA 4QB4A 2EZVA 3SXHA 3HGBA 3U9OA 2PNRC 2EYFA 2EJFC 4BY7B 1FYCA 4ODGA 2WV6D 4OIJA 5JVH3 3GO5A 1O7ZA 3KLSX 4WFN3 2VXWA 1RKNA 2X6GA 1E0BA 1OO9B 4NMZA 3DWQA 3HS0C 4C2MB 1TVXA 1AZQA 2NN6H 1XX8A 3MA2B 2R7ZB 5C3XA 4BY1B 1F2LA 2K04A 5G3LD 5KIXA 3D3RA 4IUUA 1A2UA 2F0GA 3DXJC 3PO3B 2L0CA 3T16A 3KBXA 3K7AB 4BA1I 1B53A 5EGTA 5M3FB 2QF7A 2JEAI 3HOVB 2E2HB 4UDUC 2C5CA 4Y7NB 1MD2D 2F0DA 2EDGA 1STEA 2PW7A 1STBA 4IZ8A 1XTCD 2SEBD 2F1MA 5LHY1 1WD1A 3VR3A 3H91A 3BDOA 1KNAA 5DM73 2HDMA 5M3MB 2LY7A 1TWAB 4DNTB 4XIGS 5C0XI 1SNQA 3W2DA 4KD4A 1NUCA 2BA0A 3GTKB 4HN7A 3OWEB 2KCNA 3RUZA 4ME5A 1TWFB 3RZOB 4RCNA 1H9RA 1PRTF 4KY6A 2XNAC 1D1KA 2D5DA 5F2DA 5E4WC 4KHVA 1G6ZA 3V05A 3PUWA 1I50B 1SYCA 1H9MA 2E76C 3HOXB 2NN6G 1F77A 1SBBB 3E6ZX 1H9JA 2RDGA 3L3OC 1PRTB 5C3EB 1CFMA 3D4WA 4U68A 3HZXA 4M8AA 1ESFA 3J81L 5CMDA 1NR2A 3TP7A 3MXUA 1JB3A 3TSSA 4CHTB 3URYA 3A7LA 2J4XA 2B2YA 4K5XA 3H09A 4QCLA 5FLXL 3TBIB 5C5LA 1HUNA 3M7GA 4CKEA 2K1BA 3FMCA 1LTBD 2KEDA 2WINB 5D14A 2F0UA 1D1IA 1JWUD 1JE4A 2KOLA 4A3MB 4HAEA 4J1MA 4KI0A 2QDBA 3BYTB 2NVYB 4MN3A 2EOTA 3VYSA 4KK7A 1MBYA 1UUPA 1BO0A 2EE1A 2Z4IA 4FO2A 3QWNA 1DCZA 3QOLA 2F0KA 3QG1A 1WTWA 5T1IA 2NVXB 3P75A 2AUJD 2Z4HA 4FYDA 5IT9E 2RDFA 1GOZA 4FF2A 3T4AC 4KV6A 1PTOC 1HA6A 1Q90A 4XT1B 2MUYA 4R9WA 1ZYRC 1J8IA 1YNNC 5FO7B 4B9WA 2WACA 1U4MA 3K6OA 4HTHA 1AW7A 2K32A 5J1ZA 2F0WA 1C4QA 1M8AA 1V43A 2M9VA 4OHJA 1K8OA 4TQUS 2XSCA 4YIJA 2A6HD 1TR5A 1ML0D 1PMRA 4ZKCB 1S5BD 4TRDA 1ONLA 3X3MA 2L12A 2VB3X 2B2UA 5C6AA 3A8KE 2XRQD 5DNFA 1HCZA 3HEJA 4A3DB 4KKUA 4K6DA 3PUZA 1V1PA 1EY4A 2RSOA 3GV3A 4HCEA 3V2TA 3LWUA 4CJ0B 4Q0FA 3Q23A 3OSOA 5EKIA 3TN2A 1R4PB 4A3IB 2EJMA 2EY1A 2OT2A 2Q8RE 3DEOA 4XTCS 3QB3A 1U9RA 4HMIA 1OXUA 1SNOA 4S3SA 4RFBA 4C56C 3ERQA 3TZDA 1PYWD 4FVMA 1GXDC 2KQ3A 1AZPA 1Q12A 4R8NA 2IX3A 1Y8PB 3GV6A 1ESRA 3FPUB 1ILQA 5M5YB 1HXYD 3R3OA 1OXTA 5ELBA 1GUTA 3MEHA 3W3AA 2F0OA 1BCPC 2M2LA 1YNJD 2B2YC 1OXXK 5J39A 2NTTA 1SYDA 2VB2X 5G3LF 4ZUJA 3VYTA 5KRUA 3CU7A 2WKCA 1Q8IA 1Z47A 4XXEA 1F9SA 1HRJA 3G6JB 2JA5B 1NSNS 1G91A 1STAA 4Z9CB 4HEDA 3NTKA 1GUOA 4BS9A 3TMEA 1A3VA 3G7LA 4BBSB 1S5ED 1Q3LA 3NHHA 2HCCA 2FMMA 1ILPA 4KTAA 3VR6A 3N52A 3PIO3 1BBXC 1B1ZA 1TWHB 4IQZA 5EPJA 1EZ8A 3IFTA 3OMCA 1G2SA 1B3AA 1EIHA 3J81E 1HQRD 5C4HA 3S17B 2F0VA 2JYOA 2N55A 4DAPA 1PFMA 1NAPA 1WTOA 3KF8A 3AB9A 1PTOD 5CV5A 3MC0B 4PNYA 2K5WA 3M4YA 1B2TA 1EY8A 4L6TB 3MAQA 4F87A 1IL8A 3BDLA 5ELCA 1SXTA 3M85A 2NB0A 1IW7D 5FLXE 1JWMD 2JA8B 1LTSD 4RHRA 1IHZA 2BOSA 1TS5A 3KUPA 1UNSA 2PMZB 3FVQA 3NXWA 2B2TA 3WOFA 1CZGA 1TKWB 2MP1A 1LTID 3ITPA 4IUNA 1U4LA 5A35A 1STYA 4RGTA 4EQNA 5BN4A 4QMGA 1GUNA 2QKIC 3RD4A 5JVG3 1EQVA 2NBFA 1R4QB 2B2UC 4IFDH 2V4DA 2D9UA 4RH6A 5CV8A 4XQQA 3K57A 5JPNC 4NDXA 2K03A 4KJNA 4ZK9B 2LMCB 1JICA 3H0GB 4J8QA 1EFID 3K5LA 1SE4A 4K6LA 1SAPA 2E2JB 5FO9B 2JA7B 3DWPA 2O5JC 1EYDA 5C4JB 5KNDA 4RGNA 2HDLA 4K8IA 2MPMA 2L5TA 2ZT9C 2K6AA 4RCOA 4OGQC 1ENAA 2I07B 1CK1A 1QJOA 3C1FA 4XQJA 5BN5A 5M5XB 2KCCA 1RTOA 1TS4A 1JOOA 3S1MB 2BE5C 1QB5D 1O7YA 3MVVA 4XT3B 5HGTA 1O78A 2OEOA 3EFXD 5CBAE 2HUGA 1WCMB 4B9XA 3K5NA 5M5WB 1FNWA 3DEPA 3K58A 4EQOA 1ZEQX 4CBVA 4JK1C 1U4PA 1STHA 2AQ1B 3P20A 5JEAG 3S2DB 3MXGA 3TP5A 3J80L 4BA2I 1O80A 4BBRB 3I73A 1W6JA 3X3NA 4IFDG 5JOBA 2SNSA 1I3QB 2YYZA 1BUVT 4X3KA 1V1OA 1XXGA 3SK4A 3SK8A 3RMHA 3L7ZC 3H3VC 1I6HB 3D4DA 1AFPA 4EQPA 3R2IA 3BG3A 3SE0A 3MZ5A 5EBDA 2B2WC 5IGBA 3NWTA 1CQVA 4C3HB 2NN6I 4DK0A 3HP3A 2AQ3B 2A74C 2QILA 3F2UA 3BDCA 1I4RA 4OL7A 2Y0SB 4KN7C 2K01A 1O7LA 1EL0A 4WORA 1KTKA 2PYKA 1SFOB 2L55A 5K5PA 4ZUIA 1BNZA 5C0XH 5E4XA 2IW3A 1JWSD 1QG7A 1TY0A 2B2TC 3OWFA 2NZ1D 1Z6HA 2K5DA 1U4RA 1F2ZA 2F0EA 3GQBA 3CRLC 4KHZA 1PFBA 3MFGA 3I8ZA 1DOKA 4TKOB 2X6LA 3BYYB 1D5MC 3ZYYX 3C1EA 3NUCA 3HKZB 5FO8B 5IIFA 2F0JA 1CM9A 2EY5A 4J6HA 3S2HB 2B63B 2I46A 1QE6A 3M4OB 3A55A 1FNUA 3MXPA 1GHKA 2BE5D 4X3SA 1RHPA 3GTMB 2TMPA 3O13A 3PUXA 2BDNA 2A73B 2PZWA 1IYVA 1SDFA 2MHVA 3I72A 1XYIA 2Z1CA 2A68C 2CW0C 5D3DA 2BDOA 4K8JA 1PRTC 1HHVA 1A3TA 2F0FA 1EYAA 4F88A 4LK1C 2JA6B 1WTQA 2L11A 5C0XG 1HTLD 1WD0A 3GTGB 4K5WA 1PTOF 2EYOA 4XQNA 1H9KA 3MFYA 3CHBD 4OIKA 3U9SA 2D2CC 1D5ZC 4NP5A 1Y8NB 2YU9B 1TWCB 1B50A 1LTGD 2O2LD 3K59A 4B08A 3HG9A 1ENFA 1EOTA 4HCSA 3IL8A 4P2CB 1QNUA 2KEEA 3UI2A 2Q8IB 3S1QB 1CT1D 1TQOA 2A69C 4PMBA 3D8GA 1E2ZA 4RAUC 4G7OC 1HA5A 3AU7A 5A2QL 1HPCA 3BZDB 2EYMA 4X3UA 1SJED 4FP5D 2ZXPA 2FMCA 4LJZC 3IFDA 3SVMA 3CKIB 3I4NB 3GTJB 1EU4A 1UEAB 3I4MB 1SYEA 4F7XA 2VNUD 3P1HA 3J7AF 2JSOA 3FDTA 5KGUA 3FEWX 4DGZA 5IGDA 1MGSA 5KNBA 1SNCA 4DAVA 4LAAA 4KMUC 2SNMA 2XIWA 4R8IA 2PZUA 2FJ2A 3J80E 1C8CA 3BVGA 5D65A 3SK5A 4N9PA 5JEAJ 4FXKC 2ICIA 1Y1WB 3PMFA 3IAYA 1WTRA 2G9DA 1B4OA 2QCPX 3K5OA 1WTVA 3EQLC 5HURA 2ZXRA 3Q0AA 4E6IA 2KECA 1DONA 4FXDA 4IUPA 3QIAA 1GUGA 4OO1I 4C3JB 2J0TD 2IX0A 2E74C 4A3GB 3GTOB 4CJ1B 1CQFA 1SSOA 3HOUB 1Z7TA 1EWCA 3NBIA 3S9WA 2DY7A 3K0YA 5CGKA 1MI2A 5KYIA 4FF4A 3VYUA 2ENBA 3KBGA 1AN8A 4RKBA 4DN4M 4C3HG 2M00A 2BA1A 1QWYA 5ELEA 1DJRD 4IALA 2PCFB 1ZKOA 4AYBB 5CORA 2PQEA 2F0HA 2WIIB 2RSNA 1STGA 3R93A 2F3WA 3M7NA 2F03A 1T5XD 3S16B 5ELDA 5FKAC 1HQMC 2F3VA 4MHEA 3S1RB 4QUFA 1D2BA 3EROA 5I9PA 2LS01 2K28A 1MSGA 1W6KA 4PV1C 4I7ZC 1FGBD 1JR0D 1J9OA 2EVBA 5IOCA 4A3KB 1B9NA 5KNCA 1PTOH 3A8JE 1HUMA 4NKLA 3DM1A 2DNEA 5JJZA 3VR5A 1I4GA 3TP8A 1EZ6A 2ZXOA 1DM0B 2B2WA 3Q22A 3I4LA 3EJIA 2F0SA 1HFNA 4ULLA 1JCKB 1ZYRD 3DHQA 1YNND 1Q1EA 4RKLA 2IPKD 1S5DD 1B44D 3SDZA 1EY6A 4XDXA 3PUYA 4H7BA 1PLFA 3HOYB 1ZXTA 1WTXA 2E75C 3NK9A 1D6EC 3OPOA 2K33A 5CYUA 3KLRA 1B9MA 2CQAA 3TZUA 1LTTD 2L4NA 1TY2A 5C3WA 2K5QA 1LT6D 4CGYB 1SEBD 2G9HD 1VF5C 3S14B 3E5SA 2F0IA 2NUCA 5EQ0A 1WVLA 3I3CA 1BF4A 3GTQB 1V1PB 5LL6X 1CI3M 2E2IB 4IN3A 3R8BA 1LTAD 1VMCA 4M1UB 1F9RA 2F0LA 1OXSC 2E2DC 4L8JA 1NR4A 1T5EA 1ET6A 1AP0A 1V8QA 4HR7B 1EU3A 1M4VA 5J22A 1EEID 1X3QA 2AUKA 3D6CA 2IWHA 2LKVA 1C48A 1SMYC 4A3JB 2GA4B 2F0PA 1S4ZA 1E2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUI A;  4ODG A;  5IIF A;  1JOO A;  1SYB A;  3BDL A;  4ME5 A;  4NKL A;  4K5W A;  3MVV A;  4DF7 A;  4N9T A;  2EYO A;  3PMF A;  4K2K A;  4KY6 A;  5HGT A;  4K2L A;  3OWF A;  4KD3 A;  3T13 A;  2RDF A;  2OEO A;  3TP8 A;  1EZ6 A;  1EY0 A;  1EY7 A;  5F2D A;  1TT2 A;  1KDB A;  1RKN A;  2KQ3 A;  4KHV A;  4B9X A;  5IGF A;  3EJI A;  4R8N A;  2EXZ A;  5C5M A;  1SYC A;  3LX0 A;  4KV6 A;  3TP6 A;  4NP5 A;  1KDA A;  2F0S A;  4NMZ A;  1IHZ A;  4MIU A;  4DU9 A;  5JAV A;  5HUR A;  3NXW A;  3DHQ A;  4E6I A;  5IGC A;  4EQO A;  5KEE A;  2EYL A;  4KJO A;  4B9W A;  2WAC A;  4I65 A;  2EYP A;  2F0E A;  1F2Z A;  4RKL A;  1JOR A;  1SYG A;  3ITP A;  1EY6 A;  3SXH A;  4IUN A;  5C3X A;  5IOD A;  1STH A;  5DAU A;  2F0Q A;  2PW5 A;  1STN A;  3D4W A;  3R3O A;  4HTH A;  3HZX A;  5KIX A;  1STY A;  3MEH A;  2OF1 A;  1A2U A;  2F0G A;  5IGG A;  2F0O A;  5J1Z A;  4EQN A;  3TP5 A;  2KHS A;  4ID6 A;  2F0W A;  4QMG A;  5EKK A;  4H7B A;  2F0T A;  2SOB A;  3T16 A;  3TP7 A;  3S9W A;  2EYH A;  1F2Y A;  3EVQ A;  5C4Z A;  5J39 A;  3NK9 A;  4ZQ3 A;  1A3U A;  1TQO A;  1JOQ A;  1SYD A;  1EQV A;  4PMB A;  1SND A;  5CGK A;  5KYI A;  4ZUJ A;  5I9O A;  5IGE A;  5KRU A;  5CV6 A;  3D8G A;  2ENB A;  4F8M A;  5NUC A;  4YIJ A;  1KDC A;  3DMU A;  5EGT A;  3C1E A;  1KAB A;  5E1F A;  1TR5 A;  4RKB A;  5C3W A;  5JOB A;  4KY5 A;  3NUC A;  2SNS A;  1NSN S;  1A2T A;  2M00 A;  5CV8 A;  4TRD A;  4K5X A;  3SK4 A;  2F0J A;  1STA A;  4IAL A;  1ENC A;  4NDX A;  2EY2 A;  3SK8 A;  5I6W A;  3OMG A;  5ISR A;  2EYM A;  4PMC A;  2F0D A;  3QOJ A;  5DEH A;  5C5L A;  2EY5 A;  2PQE A;  1EY9 A;  2PW7 A;  4KJN A;  4QF4 A;  3SK6 A;  5CC4 A;  5I6Y A;  1EY5 A;  2F0H A;  3E5S A;  3D4D A;  5C6A A;  2F0I A;  2NUC A;  4J6H A;  5EKL A;  1A3V A;  1F2M A;  4K14 A;  1STB A;  3TME A;  4EQP A;  5CV7 A;  4IZ8 A;  4G57 A;  1STG A;  4KY7 A;  3HEJ A;  2F0U A;  2F3W A;  2HQE A;  2RKS A;  3MHB A;  4K6D A;  5M9O A;  1SNP A;  4WRD A;  1II3 A;  2EYJ A;  3H6M A;  1EY4 A;  3MZ5 A;  1SYE A;  2OXP A;  3NHH A;  4F7X A;  1SYF A;  3P1H A;  5IGB A;  2F0L A;  1EYD A;  2EY6 A;  1AEX A;  4KTA A;  3MXP A;  4J1M A;  3V2T A;  4EVO A;  3NP8 A;  2F0N A;  3VA5 A;  5KGU A;  2PZT A;  2F3V A;  4DGZ A;  2O4X A;  3OSO A;  3SR1 A;  2QDB A;  5IGD A;  4K8I A;  2F0M A;  1JOK A;  5J22 A;  1SNM A;  1SNC A;  2EY1 A;  5CR3 A;  1EZ8 A;  1KAA A;  2RBM A;  4LAA A;  3ERO A;  2PZW A;  3OMC A;  2SNM A;  3BDC A;  5I9P A;  5KYL A;  1SNQ A;  2PZU A;  4DFA A;  3D6C A;  5C4H A;  4OL7 A;  4K5V A;  2F0V A;  1EYC A;  4KD4 A;  5CV4 A;  1ENA A;  2LKV A;  5E3F A;  1NUC A;  4QB4 A;  3QB3 A;  3C1F A;  1U9R A;  3NQT A;  3QOL A;  4HMJ A;  4HMI A;  2F0K A;  4K8J A;  5CV5 A;  3SHL A;  4WOR A;  3SK5 A;  2F0P A;  2PYK A;  3U9O A;  1A3T A;  1SNO A;  4PNY A;  4S3S A;  2EYF A;  2F0F A;  3ERQ A;  3P75 A;  1EYA A;  1EY8 A;  4N9P A;  5CV9 A;  5IOC A;  5K5P A;  3RUZ A; 
#chains in the Genus database with same CATH topology
 3I56 A;  3CC4 A;  1SJH D;  4A3E B;  2VUM B;  4C3J H;  1IKM A;  1GM5 A;  3M3Y B;  3FRP B;  4A3G H;  4QIW E;  5A2Q E;  3GTO H;  1PYB A;  4YWL A;  1MJC A;  5DM6 3;  4JPB W;  1H9S B;  3K81 C;  3J7Z C;  2EXZ A;  1J6Q A;  3LX0 A;  3NEN A;  1KDA A;  5JAV A;  4DU9 A;  3RLF A;  4DAY A;  2IL8 A;  1SRO A;  1CA5 A;  2B39 A;  3L9A X;  3ND8 A;  4ABN A;  2NVQ B;  2RA4 A;  2WFW A;  2QEJ C;  4DXF A;  3S24 A;  4DAM A;  3GTL H;  2EQS A;  2F0Q A;  2DN8 A;  5FOB B;  5EPK A;  1LT5 D;  2VW9 A;  4N8X 1;  2L15 A;  1HNW Q;  1CKN A;  3J7A 5;  2KHS A;  1BCP D;  4ID6 A;  1VQD A;  2CH4 W;  1EFW A;  2B2V C;  4JBW A;  2EYH A;  3I4N G;  4HJA A;  1OXV A;  3NBH B;  1JOQ A;  1Q1B A;  4JC0 A;  3I4M G;  3S16 H;  4DV4 L;  1N32 L;  3GTP H;  1K8G A;  3KLS A;  3DMU A;  1I6V C;  2O5I C;  2K05 A;  3I91 A;  2R3Z A;  4IPH A;  3HOZ H;  1CHP D;  4KN4 C;  1XWE A;  3S1R H;  4UAI A;  2A5H A;  3BS1 A;  2F4I A;  4HJ9 A;  1Y14 B;  5CC4 A;  1KNE A;  2Q2H A;  2HQL A;  1VQF A;  2NTS A;  3PUV A;  4K14 A;  4C1N K;  2VL6 A;  5CV7 A;  3EIV A;  5T1G A;  4JI4 Q;  3NEM A;  2B8G A;  1LT3 D;  5K36 H;  5M9O A;  4WRD A;  2MNA A;  1VQI A;  3MWY W;  3BJU A;  4GNX A;  3KF6 B;  3NTI A;  3D31 A;  1L0Y B;  3N6R A;  2EY6 A;  1QOH A;  3QO2 A;  1WJJ A;  1G8Z D;  2KUM A;  3W1B A;  1Y1W G;  3NE5 B;  4LF6 Q;  2XVS A;  3P7J A;  4KKT A;  3UDF A;  1S5F D;  1RF2 D;  1TS2 A;  2Z8L A;  2DGY A;  4HJ7 A;  3NQT A;  3PIP A;  3I4O A;  4RA8 A;  3SHL A;  3A7A B;  4CKB A;  4DXG A;  1IYU A;  1GJX A;  1F9Q A;  4C3J G;  2CHB D;  4A3G G;  4KD3 A;  4TVA B;  3HOU G;  4LF4 Q;  2JEB I;  1TT2 A;  5IGF A;  4H44 C;  2IT1 A;  1K9M C;  4JI4 L;  4MIU A;  4DV5 L;  1BBW A;  5IGC A;  2L1B A;  2YTX A;  3LWE A;  4DR4 Q;  4AYB G;  2PW5 A;  4H13 C;  2N8N A;  2G5D A;  2OF1 A;  2IJ0 A;  5HGQ A;  3S14 H;  4A93 H;  4PQX A;  4LF6 L;  5EKK A;  2JP1 A;  3H94 A;  3EVQ A;  1SLJ A;  1V1Q A;  1LTR D;  2E2I H;  3A56 A;  1SND A;  1VQO A;  5IGE A;  4HIK A;  3I70 A;  3QJY A;  3U58 A;  2A6H C;  3I90 A;  3GP7 A;  2N88 A;  1Y1V B;  1DYQ A;  2A8V A;  2NYZ D;  2PO4 A;  3HOZ G;  2R6G A;  5IT9 c;  1VF7 A;  1H95 A;  2KVM A;  5ISR A;  1ENC A;  2EY2 A;  1L1O C;  4B3S Q;  2D62 A;  3SK6 A;  2WAQ E;  1F9P A;  1GHJ A;  1NE3 A;  2AWN A;  3OIP A;  3S15 B;  2HCI A;  3K80 C;  4GLA C;  3PSI A;  4JBJ A;  4LF4 L;  5K36 G;  2XN9 C;  3FKI B;  1CZW A;  2RKS A;  3PQI A;  3J7Y W;  2ID0 A;  1SMY D;  2MGS A;  3MHB A;  4ZLT F;  3T1Y Q;  2UUA Q;  1VQG A;  1BXT A;  1RCV D;  2OXP A;  4A3K G;  1RTN A;  4J15 A;  4DV6 Q;  1SN8 A;  4EVO A;  1CA6 A;  1YI2 A;  2F0N A;  1C7Y A;  1K0S A;  2VUM H;  4GOP B;  2O4X A;  2Z6K C;  3HRZ C;  2F0M A;  5CR3 A;  4G7Z C;  1KAA A;  5C44 B;  4WJ3 M;  1MKH A;  1WFQ A;  1Q46 A;  2CKZ B;  4P71 A;  3OHX C;  3RZD H;  1LV9 A;  5GAG C;  5I4D A;  1VQJ A;  1I4P A;  4UP8 A;  2R93 B;  2KA7 A;  1EWH A;  1IBK Q;  1LO5 D;  1QCB D;  4A3B B;  3C46 A;  1QZH A;  1SYB A;  1GUW A;  4N9T A;  2FFK B;  4K2L A;  4CDF C;  3NQI A;  4IUV A;  4B3S L;  5FK9 C;  2UUB Q;  3HOY G;  1EY0 A;  4JVZ A;  5IP7 H;  3AMU A;  1XTD A;  1KQS A;  5LMU Q;  1VDZ A;  1PH4 A;  4O1N A;  2ZJP A;  2PMZ E;  5JJK A;  4DNR B;  2C9O A;  3T1Y L;  2UUA L;  5KEE A;  5D3I B;  2BCO A;  2K5V A;  5AFW A;  4LFB Q;  4DV6 L;  5DAU A;  1STN A;  1CHQ D;  2WB1 B;  4HSP A;  4DV2 Q;  4HJ8 A;  4A93 G;  3KK7 A;  4IPD A;  1IBM Q;  1YNJ C;  2F0T A;  3T53 B;  2E5L Q;  1TII D;  3A8I E;  5C4Z A;  4HSV A;  1VCI A;  1HJP A;  1A3U A;  2VS1 A;  1KLG D;  3ULP A;  5CV6 A;  5NUC A;  1KDC A;  4BY7 H;  5LMN Q;  1EEF D;  3WOE A;  2A6E C;  2XWB B;  1LT4 D;  2RDH A;  3J81 i;  3TEH B;  1IBK L;  1PTO B;  2RVL A;  1R9T B;  2EPB A;  1WYD A;  4JYA L;  4PZ8 A;  1FL0 A;  2NWG A;  4PZ7 A;  4FNF A;  4GNX C;  3C2P A;  2K7V A;  2L9H A;  2CVR A;  2XRS D;  2F4V Q;  1A62 A;  3S1N B;  2D0P A;  2RQX A;  2UUB L;  3CRK C;  2A1A A;  2JE6 I;  2NZO A;  4QY7 A;  2WP8 J;  4O42 A;  5EJW A;  5LMU L;  4GLX A;  2PPB C;  5DLQ E;  4PMW A;  4PG3 A;  3AEV A;  4X66 L;  4RHS A;  2R7Z H;  4KHP Q;  4IOA A;  3OIQ A;  4A3E G;  4BY1 H;  1PH9 A;  2VUM G;  3PO2 B;  1IBL Q;  1G29 1;  1TWG B;  3MTS A;  4LFB L;  5JJL A;  1BDO A;  3BZK A;  4QIW B;  1HFG A;  3PO3 H;  4C3I B;  1S5C D;  4DV2 L;  3G4S A;  3CPF A;  1PDQ A;  4DFA A;  5TSS A;  1IBM L;  3MXN A;  4C1N I;  2K14 A;  3KDF A;  5EPL A;  2E5L L;  5E3F A;  2BH2 A;  2MJ8 A;  2XWJ B;  1PA6 A;  1DD2 A;  1AE2 A;  1I4H A;  4H0L C;  3HOV H;  2E2H H;  3CCS A;  5LMN L;  4Y7N H;  1E3P A;  1X3F A;  4NXM Q;  4DF7 A;  4K2K A;  3JAM L;  1RL2 A;  3T13 A;  1IW7 C;  4TSS A;  4RMF A;  4DR6 Q;  4FF3 A;  2F4V L;  5I2X A;  3GDE A;  4KKS A;  5IP7 G;  1KDB A;  1PH1 A;  3WWV A;  3TP6 A;  4DKA C;  4Q5V A;  4ZYS A;  5I2Y A;  1UE5 A;  1X32 A;  5COY A;  1PZI D;  2EYL A;  1MJE A;  4A3F B;  4KHP L;  4ILW A;  1IBL L;  3J81 c;  5BN3 A;  1TWA H;  5IGG A;  2PQA A;  1K83 B;  2PNH A;  2SOB A;  1F2Y A;  3TDQ A;  3VR4 A;  3FKI H;  3STB C;  2B3G A;  3D4R A;  5EBC A;  3GTK H;  4GZY C;  5I9O A;  4L63 B;  3TQY A;  1JC7 A;  2I5L X;  4IFD J;  5ELF A;  4NPS A;  3CPW A;  1BCP F;  3LGJ A;  4OO1 H;  4X3T A;  1ICF B;  3BVM A;  2X69 A;  1TWF H;  2WKD A;  3VR2 A;  5I6W A;  1DZ1 A;  4LMQ D;  5FLX c;  2UXB Q;  1EY9 A;  3E0J A;  4QF4 A;  2Q8T A;  4CKC A;  1QIL A;  1A6X A;  1EY5 A;  3OW7 A;  5C44 H;  4GKK Q;  1NMG A;  5EKL A;  2Q2T A;  3OTO Q;  1I50 H;  1XMQ Q;  4DR6 L;  4G57 A;  4KY7 A;  2FHT A;  2HQE A;  4MTK A;  4DR3 Q;  3HOX H;  3SGI A;  4FF1 A;  1BCP B;  4U67 3;  2EYJ A;  4ALP A;  1N36 Q;  1E7Z A;  2HD3 A;  5IWA Q;  3D0F A;  2R92 B;  4BY1 G;  4DUY Q;  4FXG C;  2VQF Q;  4APV A;  1JB7 A;  3VA5 A;  1PFN A;  2B2V A;  2PZT A;  2UU9 Q;  2IX1 A;  3GTL B;  4V19 0;  4RGM A;  1JQY D;  4B3R Q;  2RF4 A;  5FJ8 H;  2RBM A;  1TS3 A;  3U4V A;  4XYO A;  5CBE E;  1LAC A;  1EYC A;  1I4X A;  1TXY A;  5CV4 A;  2A68 D;  2CW0 D;  1H9S A;  4HMJ A;  3RLO A;  1KLU D;  1PRT D;  3GTP B;  4IUT A;  2FIN B;  1U0L A;  3J7A V;  1IKL A;  3LNN A;  1HNX Q;  3HOZ B;  1VQ8 A;  1DGS A;  1QVC A;  1LLR D;  1NCV A;  1YIJ A;  1RJT A;  2UXB L;  1E2W A;  4X65 Q;  3HOW B;  1CTM A;  1K8A C;  1SE3 A;  3W5O A;  4GKK L;  4DA2 A;  4RWS C;  1KC8 C;  2B8F A;  5C5M A;  1BVS A;  3PIP 3;  3OTO L;  3R2T A;  1Y1V G;  3NBH A;  3Q6S A;  3NWS A;  3Q24 A;  4DR3 L;  2K5H A;  3FP9 A;  1N36 L;  2AQ2 B;  2A6E D;  4I65 A;  1JOR A;  2EYP A;  2N49 A;  5IWA L;  4L5S A;  1SYG A;  1L0W A;  1R9T H;  4DUY L;  2RHQ B;  3VYR A;  2VQF L;  1N8R C;  2NVY H;  2RHS B;  1DOM A;  2UU9 L;  2WAQ B;  3K5M A;  4B3R L;  4EQ5 A;  4B3M Q;  3ONA B;  4NW2 A;  4G4K A;  3FKI G;  3AQQ A;  4ZQ3 A;  1Y69 U;  4JG2 A;  3DWA A;  2A69 D;  1UAP A;  3D6W A;  5BR8 Q;  5JPM C;  3BVZ A;  1VMP A;  2JXM B;  4OO1 G;  1MSH A;  2QW7 A;  1KAB A;  2YTV A;  4CJ2 C;  1XNQ L;  4KY5 A;  2VY3 A;  4QUC A;  3NSW A;  1EIG A;  4GLV B;  1BQQ T;  4HID A;  1DXM A;  4ZKB B;  2DNC A;  3OMG A;  2D0O A;  4PMC A;  4WJW A;  2NVT B;  3QOJ A;  5DEH A;  1HNX L;  3L2P A;  5C44 G;  1ICW A;  5FLM H;  1FR3 A;  5I6Y A;  1TU2 B;  1F2M A;  5IP9 H;  3VA7 A;  4IOC A;  4X65 L;  2EXD A;  1II3 A;  2R93 G;  3WDN A;  2P5Z X;  3V96 A;  5LL6 S;  4A3B G;  1AEX A;  1ROD A;  1X3P A;  1A15 A;  3ERS X;  1PXU A;  2EJG C;  2H4O A;  3SR1 A;  2QGQ A;  1Y8O B;  1JOK A;  5C4X B;  2PI2 A;  2KJX A;  1BOS A;  3GD7 A;  4A93 B;  3EN2 A;  1LAB A;  4K5V A;  4B3M L;  1QNK A;  3CC2 A;  4HIO A;  5IOD A;  1NBW A;  1L0X B;  2SDF A;  3EA6 A;  3IKJ A;  4DK1 A;  4A4I A;  1BR9 A;  1ET9 A;  5BR8 L;  5CV9 A;  2J7Z A;  2MO1 A;  4JI1 Q;  1RDP D;  5C0X J;  2ICE C;  2H1E A;  1VS0 A;  1B3Q A;  2ZJR A;  5JEA H;  2R7D A;  4BWG B;  3RLN A;  3M4P A;  1WTP A;  1EY7 A;  1PZK D;  1XMO Q;  3FPP A;  2DJF C;  1FD7 D;  4A3D H;  4RGO S;  1HTP A;  3STB D;  4UPA A;  3SEB A;  3CQZ B;  1EQT A;  3PGZ A;  4IUR A;  2Z6K A;  2AWO A;  1VQP A;  5JJI A;  4KJO A;  2Q2I A;  1EOV A;  3DUZ A;  4JBM A;  1JT8 A;  3T51 B;  4A3L H;  4XYQ A;  4A3I H;  4IFD I;  1PZJ D;  1GUS A;  1FVI A;  5LMN W;  4OX9 Q;  3OOC A;  2LSS A;  4BXX G;  4G7H C;  1E24 A;  3PV0 A;  1K8M A;  1V9P A;  3ND9 A;  1DOL A;  4AIM A;  2LFN A;  4ZAI A;  4F8M A;  2DY8 A;  3NTH A;  1PH2 A;  4A3C G;  5E1F A;  3RZD B;  3CCQ A;  1GVP A;  4CDD C;  2R92 H;  4H02 A;  3PO2 G;  1A2T A;  5IT9 L;  1RD9 D;  4JI1 L;  1IL2 A;  1AH9 A;  1D5X C;  4C3I G;  5FLM G;  4V0B A;  1I4Q A;  1G2T A;  2R61 A;  3Q8D A;  3JAM E;  4OWT B;  3NEL A;  3UE1 A;  1XMO L;  3E3X A;  1SNP A;  3H6M A;  1HNZ Q;  1X6O A;  1FNV A;  2UUC Q;  3A54 A;  4POF A;  1SYF A;  5M5Y H;  2OTL A;  4RG1 A;  3T56 B;  4EGV A;  3C3L A;  3NPP A;  2C35 B;  3NP8 A;  1SE8 A;  2TSS A;  4ZRZ A;  3CCJ A;  1SNM A;  1YNX A;  4IUQ A;  1SE2 A;  1KD1 C;  5KYL A;  1EUJ A;  3HOW H;  4OX9 L;  2AKW B;  1S40 A;  1CSP A;  4QB4 A;  4DV5 Q;  2EZV A;  3SXH A;  1N33 Q;  3HGB A;  3F2B A;  2ZTE A;  3U9O A;  4LFC Q;  4R1J A;  2PNR C;  2EYF A;  2EJF C;  4BY7 B;  4X64 L;  1PH7 A;  1FYC A;  2JA5 H;  3HFZ B;  4ODG A;  4A3F G;  2WV6 D;  4OIJ A;  5JVH 3;  2ZJQ A;  3GO5 A;  1O7Z A;  3I7F A;  3KLS X;  4WFN 3;  2VXW A;  2Z9H A;  1RKN A;  2A19 A;  3KF8 B;  4BBS H;  2X6G A;  1E0B A;  1PYS B;  1OO9 B;  4NMZ A;  3DWQ A;  2ZM6 Q;  3HS0 C;  4C2M B;  1TVX A;  1AZQ A;  2NN6 H;  1HNZ L;  2UUC L;  1XX8 A;  3MA2 B;  4N8F A;  2R7Z B;  5C3X A;  4BY1 B;  1F2L A;  2K04 A;  1TWH H;  3A0J A;  5G3L D;  2NVT H;  4NB3 A;  5KIX A;  3D3R A;  4IUU A;  1A2U A;  2F0G A;  3DXJ C;  3PO3 B;  2L0C A;  3T16 A;  3KBX A;  3K7A B;  1A63 A;  4GS3 A;  3AFQ A;  4BA1 I;  1B53 A;  5EGT A;  5M3F B;  1N33 L;  2QF7 A;  4P72 A;  2JEA I;  2R92 G;  4LFC L;  3HOV B;  2E2H B;  1UE1 A;  4UDU C;  2C5C A;  4O0A A;  4Y7N B;  1U5K A;  3J80 i;  1MD2 D;  1IZ6 A;  2F0D A;  1KHI A;  2EDG A;  3PIO A;  1STE A;  5C4X H;  2PW7 A;  1STB A;  3M4Q A;  4IZ8 A;  1XTC D;  4YCW A;  1Q7Y C;  2SEB D;  1CKM A;  2F1M A;  3UDG A;  5LHY 1;  1WD1 A;  3VR3 A;  2ZM6 L;  3H91 A;  3BDO A;  1KNA A;  4OEL B;  5DM7 3;  2HDM A;  5M3M B;  1W3S A;  2LY7 A;  1TWA B;  4DNT B;  4XIG S;  1UEB A;  3HOW G;  1EIY B;  5C0X I;  1SNQ A;  5GAD C;  3W2D A;  4KD4 A;  1NUC A;  3CQZ H;  2BA0 A;  5GQO A;  3GTK B;  4HN7 A;  2GVA A;  4CDC C;  2JA5 G;  3OWE B;  5IY0 A;  1WI5 A;  2KCN A;  4KLK A;  4DR7 Q;  2E8G A;  3RUZ A;  4LF5 Q;  4ME5 A;  1TWF B;  3RZO B;  4RCN A;  1H9R A;  1PRT F;  2WAQ G;  4KY6 A;  2XNA C;  1D1K A;  2DJG C;  2D5D A;  5F2D A;  2CH4 A;  5E4W C;  4KHV A;  1G6Z A;  3V05 A;  3PUW A;  2QEX A;  2JA7 H;  1I50 B;  1SYC A;  1H9M A;  2K4K A;  3MEF A;  2E76 C;  4YHH Q;  3HOX B;  4P74 A;  4B3T Q;  2NN6 G;  1F77 A;  4JI0 Q;  1SBB B;  5C4J H;  3E6Z X;  1H9J A;  2RDG A;  3L3O C;  1CKN B;  4JYA Q;  3TRE A;  1HZC A;  1PRT B;  5C3E B;  1CFM A;  3D4W A;  4U68 A;  3HZX A;  4M8A A;  1ESF A;  3J81 L;  5CMD A;  1NR2 A;  4CDE C;  3J80 c;  2AMC B;  3TP7 A;  3MXU A;  1VQC A;  1G6P A;  4LUZ A;  1JB3 A;  3TSS A;  5M5X H;  4CHT B;  4GOP C;  1VQ5 A;  3URY A;  4X66 Q;  3A7L A;  4IJL A;  2J4X A;  1A8V A;  2MQH A;  2B2Y A;  3S1M H;  2K75 A;  1VQA A;  4DR7 L;  4K5X A;  3H09 A;  3CC7 A;  4QCL A;  5FLX L;  3TBI B;  4LF5 L;  5C5L A;  5C4X G;  1HUN A;  3M7G A;  4CKE A;  1WCM H;  2K1B A;  3FMC A;  1LTB D;  2KED A;  2WIN B;  4JI3 Q;  5D14 A;  5M5W H;  4A76 A;  2F0U A;  1D1I A;  1JWU D;  1XNR Q;  3H3V H;  1VQE A;  1JE4 A;  2KOL A;  1S72 A;  4YHH L;  4B3T L;  4A3M B;  4HAE A;  4JI0 L;  4J1M A;  2UXD Q;  4KI0 A;  2QDB A;  3BYT B;  3S2D H;  4X6A H;  2NVY B;  4MN3 A;  1JE5 A;  3RR5 A;  2EOT A;  1KRS A;  3VYS A;  4KK7 A;  1NTG A;  1MBY A;  1UUP A;  3IRB A;  1BO0 A;  2EE1 A;  2Z4I A;  4FO2 A;  1NJI C;  3QWN A;  1DCZ A;  3QOL A;  2F0K A;  3QG1 A;  2F52 A;  4C2M H;  1WTW A;  4OWW B;  5T1I A;  2NVX B;  3P75 A;  2AUJ D;  1K73 C;  2Z4H A;  4YWM A;  3CME A;  4FYD A;  1B7Y B;  3K0X A;  1HZB A;  5IT9 E;  1I6H H;  2RDF A;  3FHW A;  4LW1 A;  1GOZ A;  4FF2 A;  3K7A H;  2JA7 G;  3T4A C;  4JOI A;  3HKS A;  2R7F A;  4KV6 A;  1GO3 E;  4JI3 L;  1M1K C;  5HY6 A;  1PTO C;  1HA6 A;  1Q90 A;  4XT1 B;  2MUY A;  4R9W A;  1ZYR C;  1J8I A;  1K0R A;  5M3F H;  1XNR L;  1YNN C;  2JK8 A;  5FO7 B;  5IYD H;  4B9W A;  2WAC A;  1U4M A;  4JCV E;  4K0K Q;  3K6O A;  4HTH A;  3G48 A;  1AW7 A;  2UXD L;  2K32 A;  3G71 A;  1P8L A;  5J1Z A;  2F0W A;  1C4Q A;  1PH8 A;  1M8A A;  1V43 A;  2M9V A;  2OCE A;  4OHJ A;  4GKJ Q;  1K8O A;  4TQU S;  2H5X A;  2XSC A;  1SFO H;  4YIJ A;  2A6H D;  1TR5 A;  4LNQ A;  1ML0 D;  5AJ3 Q;  1PMR A;  4ZKC B;  1S5B D;  4TRD A;  4I7A A;  1VQB A;  1ONL A;  3X3M A;  3BU2 A;  5M3M H;  2L12 A;  4OON A;  2VB3 X;  2B2U A;  1BKB A;  5C6A A;  3A8K E;  2XRQ D;  5DNF A;  1M90 C;  1YJN A;  1HCZ A;  3HEJ A;  4A3D B;  4KKU A;  4K6D A;  3PUZ A;  1V1P A;  1EY4 A;  4BY7 G;  2RSO A;  1Q82 C;  3GV3 A;  1YEZ A;  1HH2 P;  4HCE A;  5J3B A;  3V2T A;  3LWU A;  4CJ0 B;  4Q0F A;  3Q23 A;  3OSO A;  5EKI A;  3TN2 A;  3RZO H;  1T9H A;  4K0K L;  1E22 A;  1R4P B;  2K5N A;  4A3I B;  2EJM A;  2EY1 A;  2OT2 A;  2Q8R E;  3DEO A;  4XTC S;  3QB3 A;  1U9R A;  4HMI A;  1OXU A;  5ELO A;  4GKJ L;  1SNO A;  4S3S A;  4RFB A;  4C56 C;  3ERQ A;  3TZD A;  3JAM i;  3PF5 A;  4DK6 C;  2R7Z G;  5C3E H;  5AJ3 L;  2PI2 E;  2ALY B;  1PYW D;  3PO3 G;  4FVM A;  4UP9 A;  4GN3 B;  3S2H H;  1GXD C;  1N9W A;  2KCT A;  2KQ3 A;  1AZP A;  1Q12 A;  4R8N A;  2IX3 A;  4UHV A;  1Y8P B;  2Y0S E;  2Z6B A;  1PH6 A;  3GV6 A;  5M3F G;  1ASZ A;  1PVO A;  1ESR A;  1XNQ Q;  3DLL A;  5IYD G;  3HOV G;  3FPU B;  1ASY A;  1ILQ A;  5M5Y B;  1HXY D;  3GTM H;  1HR0 Q;  3R3O A;  1OXT A;  5ELB A;  1VQH A;  1GUT A;  3MEH A;  3W1G A;  3W3A A;  2F0O A;  1BCP C;  2M2L A;  1YNJ D;  2B2Y C;  1OXX K;  3ZJY C;  5J39 A;  2K50 A;  2NTT A;  1SYD A;  2VB2 X;  5G3L F;  4ZUJ A;  3VYT A;  5KRU A;  3CU7 A;  2WKC A;  4PZ6 A;  2CFM A;  4R4O A;  2OTJ A;  1Q8I A;  1Z47 A;  4XXE A;  1F9S A;  4A3M H;  2JA6 H;  1HRJ A;  3G6J B;  1EQQ A;  2JA5 B;  1NSN S;  2CCZ A;  1G91 A;  3GTG H;  1STA A;  4Z9C B;  4IPC A;  4HED A;  3NTK A;  5M3M G;  4LF9 Q;  4DV0 Q;  2CQO A;  3UDI A;  1GUO A;  4BS9 A;  1BBU A;  3TME A;  1A3V A;  3G7L A;  4LWC A;  4BBS B;  1S5E D;  3CW2 C;  1X3G A;  1Q3L A;  3BZC A;  3NHH A;  2NVX H;  3QR8 A;  2HCC A;  2FMM A;  1ILP A;  4KTA A;  3KF6 A;  3HKZ E;  3VR6 A;  2V1C C;  3N52 A;  3PIO 3;  3JAM c;  1BBX C;  1B1Z A;  1TWH B;  1RIP A;  4IQZ A;  5EPJ A;  1HR0 L;  4R4T A;  1IYJ B;  1EZ8 A;  3KDF B;  3IFT A;  3L0O A;  2HHH L;  3OMC A;  1G2S A;  3RN2 A;  3S1Q H;  1B3A A;  1QVF A;  1EIH A;  3J81 E;  1HQR D;  5C4H A;  1X9N A;  2F0V A;  3S17 B;  2JYO A;  2N55 A;  4DAP A;  1PFM A;  3HOX G;  1NAP A;  1WTO A;  3KF8 A;  3AB9 A;  1PTO D;  5CV5 A;  3MC0 B;  4PNY A;  2K5W A;  3M4Y A;  4LFA Q;  1B2T A;  1EY8 A;  3KLW A;  4L6T B;  3MAQ A;  1K3R A;  3KJO A;  3CP0 A;  5C3E G;  4JOI C;  4F87 A;  1IL8 A;  3BDL A;  5H1S E;  5ELC A;  1SXT A;  3M85 A;  5FJ8 G;  2NB0 A;  1X3E A;  4LF9 L;  1IW7 D;  4DV0 L;  3KJP A;  5FLX E;  1JWM D;  2JQO A;  2JA8 B;  1C0A A;  3I4M H;  1LTS D;  4RHR A;  3A74 A;  1IHZ A;  2BOS A;  1TS5 A;  3KUP A;  1UNS A;  2PMZ B;  3FVQ A;  3NXW A;  3OW2 A;  2KHI A;  3KOJ A;  2B2T A;  3WOF A;  4YWK A;  1CZG A;  1TKW B;  2MP1 A;  1LTI D;  3ITP A;  4IUN A;  1KXL A;  1U4L A;  2MO0 A;  5A35 A;  2WB1 E;  1WTH A;  2IY5 B;  1STY A;  4RGT A;  4EQN A;  5BN4 A;  4QMG A;  1GUN A;  2QKI C;  3RD4 A;  5JVG 3;  1EQV A;  1VQL A;  2NBF A;  1R4Q B;  4UP7 A;  3PCO B;  2B2U C;  4A3M G;  3ULL A;  3K8A A;  4IFD H;  2V4D A;  1VQN A;  4IO9 A;  2D9U A;  4LFA L;  1E1T A;  4RH6 A;  5CV8 A;  4XQQ A;  3K57 A;  5JPN C;  4NDX A;  4AH6 A;  1YJ9 A;  2K03 A;  3J81 j;  4JI5 Q;  1AE3 A;  4KJN A;  4ZK9 B;  2LMC B;  1JIC A;  2N3S A;  3CCE A;  4AQY Q;  3H0G B;  4J8Q A;  1EFI D;  3K5L A;  2RCN A;  1SE4 A;  4K6L A;  1SAP A;  2E2J B;  5FO9 B;  1N34 Q;  3PF4 A;  2JA7 B;  1CSQ A;  3DWP A;  4X64 Q;  1X54 A;  2O5J C;  1EYD A;  5C4J B;  4QL5 A;  5KND A;  4RGN A;  2HDL A;  2K52 A;  4K8I A;  2MPM A;  3G6E A;  2L5T A;  2ZT9 C;  1GD7 A;  3E9H A;  4GOP A;  3HOU H;  2K6A A;  1VQM A;  4RCO A;  5IP9 G;  4OGQ C;  1ENA A;  2I07 B;  1CK1 A;  1QJO A;  2JN4 A;  3C1F A;  4XQJ A;  5BN5 A;  5M5X B;  2KCC A;  1VQ9 A;  1QUQ B;  1RTO A;  1TS4 A;  5IYB H;  1JOO A;  3S1M B;  2NZH A;  2BE5 C;  1LM0 A;  1QB5 D;  1O7Y A;  3MVV A;  3CXC A;  4XT3 B;  3CCM A;  5HGT A;  3F1Z A;  1O78 A;  2UXC Q;  2OEO A;  3EFX D;  4JI5 L;  5CBA E;  3JC6 6;  2HUG A;  1C9O A;  1WCM B;  4B9X A;  4AQY L;  3K5N A;  3CCL A;  1QVG A;  2HIV A;  4NXN Q;  5M5W B;  3B6Y A;  1N34 L;  1D7Q A;  1FNW A;  3DEP A;  3K58 A;  4EQO A;  2HT1 A;  4WJ4 A;  1ZEQ X;  2IHF A;  4CBV A;  4JK1 C;  1U4P A;  1GKH A;  1FJG Q;  1STH A;  2AQ1 B;  3P20 A;  5JEA G;  3UDX A;  2VQE Q;  2XTI A;  2GN5 A;  3S2D B;  3MXG A;  2I5M X;  3TP5 A;  3J80 L;  4BA2 I;  4HIM A;  4A3D G;  1KRT A;  4ME3 A;  1O80 A;  4JI7 Q;  4A75 A;  4BBR B;  3I73 A;  1W6J A;  4A3K H;  2QDL A;  3X3N A;  4DV1 Q;  4IFD G;  2CWP A;  5JOB A;  4FDB A;  2SNS A;  1I3Q B;  2YYZ A;  2YV5 A;  1BUV T;  4X3K A;  1V1O A;  1XXG A;  3SK4 A;  3SK8 A;  3RMH A;  4A3L G;  4A3I G;  1VQ6 A;  3L7Z C;  1HNW L;  3H3V C;  1I6H B;  3D4D A;  2UXC L;  1AFP A;  4EQP A;  3R2I A;  2RCF A;  3S17 H;  1PFS A;  3BG3 A;  4YCV A;  2OWO A;  3SE0 A;  4NXN L;  3MZ5 A;  4HJ5 A;  1VQ7 A;  5EBD A;  4UY8 C;  2B2W C;  5IGB A;  3NWT A;  1CQV A;  4C3H B;  5ELN A;  2NN6 I;  4DK0 A;  3VDY A;  1FJG L;  1EQR A;  3HP3 A;  1XJV A;  2AQ3 B;  4AYB E;  2AHO B;  2VQE L;  2A74 C;  2QIL A;  3HOY H;  3F2U A;  5IYC H;  3BDC A;  2JA8 H;  1I4R A;  1X55 A;  1L1O B;  4OL7 A;  2Y0S B;  4KN7 C;  1G51 A;  2K01 A;  1O7L A;  1EL0 A;  4WOR A;  1KTK A;  2PYK A;  1SFO B;  4JI7 L;  2L55 A;  5IYB G;  3E9I A;  5K5P A;  1PV4 A;  4DV1 L;  4ZUI A;  1BNZ A;  3CCR A;  5C0X H;  4JI2 Q;  5E4X A;  2IW3 A;  1PHJ A;  1JWS D;  1QG7 A;  1TY0 A;  2B2T C;  3OWF A;  1I5F A;  2NZ1 D;  3CD6 A;  3GTQ H;  1Z6H A;  1MIU A;  2N78 A;  1HR0 W;  2K5D A;  1U4R A;  1YHB A;  1F2Z A;  2F0E A;  3GQB A;  2HIX A;  4LF7 Q;  3CRL C;  4KHZ A;  1NNX A;  1PFB A;  3MFG A;  3I8Z A;  2GVB A;  1DOK A;  4TKO B;  4Y52 H;  3AYH B;  3H0G H;  2X6L A;  3BYY B;  5GRO A;  4BBS G;  2E2J H;  1D5M C;  4DAY B;  4A3J H;  3ZYY X;  1YZ6 A;  3C1E A;  3NUC A;  1PH3 A;  4EX5 A;  3HKZ B;  1VQ4 A;  5FO8 B;  3I55 A;  4A3E H;  5IIF A;  2F0J A;  2Q2U A;  1CM9 A;  3M3Y H;  4DR4 L;  5IE8 A;  2EY5 A;  4JI6 Q;  4JI2 L;  4R4I A;  4QGU A;  4J6H A;  3S2H B;  1YVC A;  2B63 B;  2LXJ A;  3K7U C;  3DM3 A;  2NVQ H;  2I46 A;  1QE6 A;  3M4O B;  3A55 A;  4DUZ Q;  1FNU A;  4DR2 Q;  4R4C A;  3MXP A;  1W2B A;  1UE7 A;  1GHK A;  2BE5 D;  4X3S A;  1RHP A;  5L37 A;  4LF7 L;  3GTM B;  2TMP A;  1KAW A;  3O13 A;  3PUX A;  4IPG A;  2BDN A;  4MZ9 A;  5IYC G;  1YJW A;  2A73 B;  2PZW A;  1KIX A;  1IYV A;  1SDF A;  2JA8 G;  2MHV A;  3I72 A;  4LUV A;  5GAH C;  1XYI A;  4GNX B;  2Z1C A;  1CKO A;  2A68 C;  2CW0 C;  3ULJ A;  5D3D A;  2BDO A;  2F3I A;  4K8J A;  1PRT C;  1YHQ A;  2ASB A;  1HHV A;  1A3T A;  4YCU A;  1S3O A;  2F0F A;  1EYA A;  4F88 A;  4OWX B;  4LK1 C;  2JA6 B;  1WTQ A;  1Q81 C;  2L11 A;  5C0X G;  1HTL D;  1WD0 A;  3GTG B;  1SRU A;  4K5W A;  3RN5 A;  1PTO F;  2EYO A;  4XQN A;  1H9K A;  3MFY A;  3KFU A;  3CHB D;  4OIK A;  4JI6 L;  3U9S A;  4DV7 Q;  2D2C C;  1D5Z C;  4NP5 A;  1Y8N B;  2YU9 B;  4BBR H;  1TWC B;  1B50 A;  1LTG D;  2O2L D;  3E0E A;  4QJF A;  3K59 A;  1Z9F A;  3H3V I;  4B08 A;  2EIF A;  3F8T A;  3HG9 A;  1I3Q H;  4DR5 Q;  1OTC A;  1ENF A;  1EOT A;  4HCS A;  3IL8 A;  4DUZ L;  1JJ2 A;  4DR2 L;  4P2C B;  1QNU A;  2KEE A;  1YIT A;  3H0G G;  3UI2 A;  2Q8I B;  3S1Q B;  1CT1 D;  1E1O A;  1Q8K A;  1TQO A;  2A69 C;  4A3J G;  4PMB A;  4JV5 Q;  2JJQ A;  4IJH A;  3D8G A;  1E2Z A;  4RAU C;  4G7O C;  1JMC A;  1HA5 A;  3AU7 A;  4C3H H;  5A2Q L;  3TRZ A;  3CAM A;  1HPC A;  3BZD B;  1A0I A;  2EYM A;  4X3U A;  3CCV A;  1SJE D;  4FP5 D;  2ZXP A;  3F2D A;  2FMC A;  4LJZ C;  4X62 Q;  3IFD A;  3SVM A;  3CKI B;  3I4N B;  3KYH C;  3GTJ B;  4JI8 Q;  4DV7 L;  1EU4 A;  1UEA B;  3I4M B;  1SR3 A;  1SYE A;  4F7X A;  2VNU D;  3P1H A;  3J7A F;  2JSO A;  2KEN A;  3TS0 A;  3FDT A;  5KGU A;  3FEW X;  4GN4 B;  2XGT A;  5EAY A;  4DR5 L;  4DGZ A;  5IGD A;  1XPU A;  1MGS A;  4L5Q A;  3T1H Q;  5KNB A;  1SNC A;  4DAV A;  3AFP A;  4LAA A;  4KMU C;  1X65 A;  1YBY A;  2SNM A;  1WCM G;  2XIW A;  4OEM B;  4R8I A;  3I2Z A;  2PZU A;  2YTY A;  1UWV A;  1J5E Q;  2FJ2 A;  3EBE A;  2KBN A;  3J80 E;  3A5U A;  3BVG A;  1C8C A;  5D65 A;  1XPR A;  4JV5 L;  1Y1V H;  3SK5 A;  4R4Q A;  2ATW A;  4N9P A;  5JEA J;  4FXK C;  1EIF A;  3RNU A;  4MTN A;  2ICI A;  1EYG A;  1Y1W B;  3PMF A;  3IAY A;  1WTR A;  2G9D A;  3S15 H;  1B4O A;  2QCP X;  3K5O A;  4X62 L;  1NMF A;  4BBR G;  2QA4 A;  1WTV A;  3EQL C;  1XPO A;  5HUR A;  2ZXR A;  3Q0A A;  4JI8 L;  4E6I A;  2KEC A;  4MNO A;  1DON A;  4FXD A;  4IUP A;  3QIA A;  1GUG A;  4OO1 I;  4C3J B;  2J0T D;  2IX0 A;  2I5H A;  2E74 C;  4NXM L;  4A3G B;  3GTO B;  4CJ1 B;  3T1H L;  1CQF A;  1SSO A;  3HOU B;  1Z7T A;  1EWC A;  3NBI A;  3S9W A;  2DY7 A;  2B63 H;  3K0Y A;  5CGK A;  1MI2 A;  5KYI A;  1J5E L;  4FF4 A;  1PH5 A;  3U50 C;  5GAE C;  3VYU A;  2ENB A;  4DV3 Q;  3KBG A;  1AN8 A;  2R93 H;  4RKB A;  4DN4 M;  4DPG A;  3M4O H;  4A3B H;  1KL9 A;  4C3H G;  2M00 A;  2BA1 A;  4YY3 Q;  1QWY A;  5ELE A;  1DJR D;  4IAL A;  2PCF B;  1ZKO A;  4AYB B;  5COR A;  2HHH Q;  2PQE A;  2F0H A;  2WII B;  2RSN A;  4DR1 Q;  2Y0S G;  4POG A;  1STG A;  3R93 A;  2F3W A;  3M7N A;  2F03 A;  1T5X D;  3S16 B;  1SMX A;  5ELD A;  1LYL A;  5FKA C;  1VQK A;  1HQM C;  4P75 A;  3UE0 A;  4DNI A;  2F3V A;  3H15 A;  2I0Q A;  4MHE A;  1JJG A;  1QUQ A;  4LUO A;  3S1R B;  4QUF A;  1D2B A;  2ZTD A;  4L5R C;  1O7I A;  1UE6 A;  1X56 A;  3ERO A;  5I9P A;  3TS2 A;  1L2F A;  5E7N A;  1LUZ A;  2LS0 1;  2B29 A;  2K28 A;  1XMQ L;  1B8A A;  1MSG A;  1W6K A;  2FXQ A;  2YU9 H;  1TWC H;  4PV1 C;  4I7Z C;  4OXP A;  4LF8 Q;  1P16 A;  1FGB D;  1JR0 D;  4QQB X;  1J9O A;  4DV3 L;  2EVB A;  5IOC A;  4A3K B;  1B9N A;  5KNC A;  1PTO H;  3A8J E;  1HUM A;  4NKL A;  1D8L A;  3DM1 A;  2DNE A;  5JJZ A;  4YY3 L;  1QZG A;  3VR5 A;  3S1N H;  1I4G A;  4DK3 C;  3MXN B;  3TP8 A;  1MHW C;  1EZ6 A;  2ZTC A;  2ZXO A;  1DM0 B;  2B2W A;  3Q22 A;  3CF5 A;  3I4L A;  4BXX H;  3EJI A;  4P73 A;  4DR1 L;  2F0S A;  1HFN A;  1I94 Q;  4ULL A;  1JCK B;  2BH8 A;  1ZYR D;  4A3C H;  3DHQ A;  1HZA A;  1YNN D;  1Q1E A;  3HKZ G;  1Q86 C;  4RKL A;  2IPK D;  1S5D D;  1B44 D;  3SDZ A;  3PO2 H;  1TWG H;  1EY6 A;  3M9B A;  2OQK A;  1K3B C;  3F2C A;  4XDX A;  4JW0 A;  4C3I H;  3PUY A;  2OQ0 A;  1EWI A;  1JJC B;  4H7B A;  1PLF A;  3HOY B;  1WOC A;  1ZXT A;  2B63 G;  1WTX A;  2E75 C;  3NK9 A;  1D6E C;  3OPO A;  2VZA A;  3I4N H;  2K33 A;  5CYU A;  3KLR A;  3GTJ H;  1FGU A;  1B9M A;  2CQA A;  3TZU A;  1LTT D;  2IHE A;  2L4N A;  1TY2 A;  5C3W A;  4LF8 L;  1K28 A;  2K5Q A;  1LT6 D;  3CCU A;  4CGY B;  4O2D A;  1SEB D;  2CWA A;  1IXR A;  2PQA B;  2LXK A;  2G9H D;  3OYY A;  1HZ9 A;  1VF5 C;  2MFI A;  3S14 B;  3E5S A;  3U4Z A;  2F0I A;  2NUC A;  5EQ0 A;  1WVL A;  3I3C A;  1BF4 A;  3GTQ B;  1NY4 A;  2KCM A;  1V1P B;  5LL6 X;  4GN5 A;  1CI3 M;  2E2I B;  4IN3 A;  1L1O A;  1LTL A;  3R8B A;  1LTA D;  2KHJ A;  2ES2 A;  1VMC A;  2Z0S A;  4M1U B;  1F9R A;  2F0L A;  1I94 L;  1B70 B;  1OXS C;  2E2D C;  3A5Z B;  4L8J A;  1NR4 A;  2JA6 G;  1T5E A;  1ET6 A;  1AP0 A;  2WB1 G;  4A3F H;  1V8Q A;  3ICE A;  4HR7 B;  1Y1W H;  4JBK A;  1EU3 A;  1M4V A;  4ZCK A;  5J22 A;  1K83 H;  4L5T A;  3CMA A;  1EEI D;  1X3Q A;  2AUK A;  2DUD A;  3D6C A;  4DV4 Q;  1N32 Q;  2IWH A;  2LKV A;  1C48 A;  1SMY C;  4A3J B;  2GA4 B;  2F0P A;  1CUK A;  2JA9 A;  1S4Z A;  1YHA A;  3ER0 A;  1E2V A; 
#chains in the Genus database with same CATH homology
 1SJH D;  4A3E B;  2VUM B;  1IKM A;  3M3Y B;  3FRP B;  5A2Q E;  5DM6 3;  1H9S B;  2EXZ A;  3LX0 A;  1KDA A;  5JAV A;  4DU9 A;  3RLF A;  4DAY A;  2IL8 A;  1CA5 A;  2B39 A;  3L9A X;  3ND8 A;  4ABN A;  2NVQ B;  2RA4 A;  2QEJ C;  4DXF A;  2F0Q A;  2DN8 A;  5FOB B;  5EPK A;  1LT5 D;  2KHS A;  1BCP D;  4ID6 A;  2B2V C;  4JBW A;  2EYH A;  1OXV A;  1JOQ A;  1Q1B A;  3KLS A;  3DMU A;  1I6V C;  2O5I C;  2K05 A;  3I91 A;  2R3Z A;  1CHP D;  4KN4 C;  1XWE A;  4UAI A;  2A5H A;  3BS1 A;  2F4I A;  5CC4 A;  1KNE A;  2NTS A;  3PUV A;  4K14 A;  4C1N K;  5CV7 A;  5T1G A;  5K36 H;  2B8G A;  1LT3 D;  5M9O A;  4WRD A;  3MWY W;  3NTI A;  3D31 A;  1L0Y B;  3N6R A;  2EY6 A;  1QOH A;  3QO2 A;  1G8Z D;  2KUM A;  3NE5 B;  2XVS A;  3P7J A;  4KKT A;  1S5F D;  1RF2 D;  1TS2 A;  2Z8L A;  3NQT A;  4RA8 A;  3SHL A;  3A7A B;  4CKB A;  4DXG A;  1IYU A;  1GJX A;  1F9Q A;  4C3J G;  2CHB D;  4KD3 A;  2JEB I;  1TT2 A;  5IGF A;  4H44 C;  2IT1 A;  4MIU A;  5IGC A;  2L1B A;  3LWE A;  2PW5 A;  4H13 C;  2OF1 A;  2IJ0 A;  4PQX A;  5EKK A;  2JP1 A;  3H94 A;  3EVQ A;  1LTR D;  3A56 A;  1SND A;  5IGE A;  3I70 A;  3QJY A;  2A6H C;  3I90 A;  3GP7 A;  2N88 A;  1Y1V B;  1DYQ A;  2NYZ D;  2PO4 A;  2R6G A;  1VF7 A;  2KVM A;  5ISR A;  1ENC A;  2EY2 A;  2D62 A;  3SK6 A;  1F9P A;  1GHJ A;  2AWN A;  3OIP A;  3S15 B;  2HCI A;  5K36 G;  2XN9 C;  3FKI B;  1CZW A;  2RKS A;  3J7Y W;  2ID0 A;  1SMY D;  2MGS A;  3MHB A;  4ZLT F;  1BXT A;  1RCV D;  2OXP A;  1RTN A;  4EVO A;  1CA6 A;  2F0N A;  2O4X A;  3HRZ C;  2F0M A;  5CR3 A;  4G7Z C;  1KAA A;  5C44 B;  3OHX C;  1LV9 A;  5I4D A;  1I4P A;  2R93 B;  2KA7 A;  1EWH A;  1QCB D;  1LO5 D;  4A3B B;  3C46 A;  1SYB A;  1GUW A;  4N9T A;  2FFK B;  4K2L A;  3NQI A;  4IUV A;  5FK9 C;  1EY0 A;  3AMU A;  1VDZ A;  4O1N A;  4DNR B;  2C9O A;  5KEE A;  5D3I B;  2BCO A;  5AFW A;  5DAU A;  1STN A;  1CHQ D;  2WB1 B;  4HSP A;  3KK7 A;  1YNJ C;  2F0T A;  3T53 B;  1TII D;  3A8I E;  5C4Z A;  4HSV A;  1VCI A;  1A3U A;  1KLG D;  5CV6 A;  5NUC A;  1KDC A;  1EEF D;  3WOE A;  2A6E C;  2XWB B;  1LT4 D;  2RDH A;  1PTO B;  2RVL A;  1R9T B;  2EPB A;  2NWG A;  4FNF A;  3C2P A;  2K7V A;  2L9H A;  2CVR A;  2XRS D;  3S1N B;  2RQX A;  3CRK C;  2JE6 I;  2WP8 J;  4O42 A;  5EJW A;  2PPB C;  4PMW A;  4RHS A;  3OIQ A;  3PO2 B;  1G29 1;  1TWG B;  3MTS A;  1BDO A;  4QIW B;  1HFG A;  4C3I B;  1S5C D;  1PDQ A;  4DFA A;  5TSS A;  3MXN A;  4C1N I;  5EPL A;  5E3F A;  2MJ8 A;  2XWJ B;  1DD2 A;  1I4H A;  4H0L C;  4DF7 A;  4K2K A;  3JAM L;  3T13 A;  1IW7 C;  4TSS A;  4FF3 A;  5I2X A;  4KKS A;  1KDB A;  3TP6 A;  4Q5V A;  4ZYS A;  5I2Y A;  1X32 A;  5COY A;  1PZI D;  2EYL A;  4A3F B;  4ILW A;  5BN3 A;  5IGG A;  1K83 B;  2SOB A;  1F2Y A;  3TDQ A;  3VR4 A;  3D4R A;  5EBC A;  4GZY C;  5I9O A;  4L63 B;  1JC7 A;  4IFD J;  5ELF A;  1BCP F;  4OO1 H;  4X3T A;  3BVM A;  2X69 A;  2WKD A;  3VR2 A;  5I6W A;  1DZ1 A;  4LMQ D;  4CKC A;  1EY9 A;  3E0J A;  4QF4 A;  2Q8T A;  1QIL A;  1A6X A;  1EY5 A;  3OW7 A;  5EKL A;  4G57 A;  4KY7 A;  2FHT A;  2HQE A;  4FF1 A;  1BCP B;  4U67 3;  2EYJ A;  2R92 B;  4FXG C;  3VA5 A;  1PFN A;  2B2V A;  2PZT A;  2IX1 A;  3GTL B;  4V19 0;  4RGM A;  1JQY D;  2RBM A;  1TS3 A;  4XYO A;  5CBE E;  1LAC A;  1EYC A;  1I4X A;  5CV4 A;  2A68 D;  4HMJ A;  2CW0 D;  1H9S A;  1KLU D;  1PRT D;  3GTP B;  4IUT A;  2FIN B;  3J7A V;  1IKL A;  3LNN A;  3HOZ B;  1LLR D;  1NCV A;  1RJT A;  1E2W A;  3HOW B;  1CTM A;  1SE3 A;  4DA2 A;  4RWS C;  2B8F A;  5C5M A;  3PIP 3;  3R2T A;  3Q6S A;  3NBH A;  3NWS A;  3Q24 A;  2AQ2 B;  2A6E D;  4I65 A;  1JOR A;  2EYP A;  1SYG A;  3VYR A;  1DOM A;  2WAQ B;  3K5M A;  3ONA B;  4NW2 A;  4G4K A;  4ZQ3 A;  1Y69 U;  3DWA A;  2A69 D;  1UAP A;  3D6W A;  5JPM C;  3BVZ A;  1VMP A;  2JXM B;  4OO1 G;  1MSH A;  1KAB A;  4CJ2 C;  4KY5 A;  4QUC A;  3NSW A;  1EIG A;  1BQQ T;  1DXM A;  4ZKB B;  2DNC A;  3OMG A;  4PMC A;  4WJW A;  2NVT B;  3QOJ A;  5DEH A;  1ICW A;  1FR3 A;  5I6Y A;  1TU2 B;  1F2M A;  3VA7 A;  1II3 A;  3WDN A;  3V96 A;  5LL6 S;  1AEX A;  1ROD A;  1X3P A;  1A15 A;  1PXU A;  2EJG C;  2H4O A;  3SR1 A;  1Y8O B;  1JOK A;  5C4X B;  2KJX A;  1BOS A;  3GD7 A;  4A93 B;  1LAB A;  4K5V A;  1QNK A;  5IOD A;  1L0X B;  2SDF A;  3EA6 A;  3IKJ A;  4DK1 A;  1BR9 A;  1ET9 A;  5CV9 A;  2J7Z A;  1RDP D;  5C0X J;  2ICE C;  2H1E A;  5JEA H;  4BWG B;  1WTP A;  1EY7 A;  1PZK D;  3FPP A;  1FD7 D;  4RGO S;  1HTP A;  3SEB A;  3CQZ B;  1EQT A;  4IUR A;  2AWO A;  4KJO A;  3DUZ A;  3T51 B;  4XYQ A;  4IFD I;  1PZJ D;  1GUS A;  3OOC A;  4G7H C;  3PV0 A;  1K8M A;  3ND9 A;  1DOL A;  2LFN A;  4ZAI A;  4F8M A;  2DY8 A;  3NTH A;  5E1F A;  3RZD B;  1A2T A;  5IT9 L;  1RD9 D;  1D5X C;  4C3I G;  4V0B A;  1I4Q A;  1G2T A;  2R61 A;  3JAM E;  1SNP A;  3H6M A;  1FNV A;  3A54 A;  1SYF A;  3T56 B;  3C3L A;  4EGV A;  3NPP A;  3NP8 A;  2TSS A;  4ZRZ A;  1SNM A;  4IUQ A;  1SE2 A;  5KYL A;  4QB4 A;  2EZV A;  3SXH A;  3HGB A;  3U9O A;  2PNR C;  2EYF A;  2EJF C;  4BY7 B;  1FYC A;  4ODG A;  2WV6 D;  4OIJ A;  5JVH 3;  3GO5 A;  1O7Z A;  3KLS X;  4WFN 3;  2VXW A;  1RKN A;  2X6G A;  1E0B A;  1OO9 B;  4NMZ A;  3DWQ A;  3HS0 C;  4C2M B;  1TVX A;  1AZQ A;  2NN6 H;  1XX8 A;  3MA2 B;  2R7Z B;  5C3X A;  4BY1 B;  1F2L A;  2K04 A;  5G3L D;  5KIX A;  3D3R A;  4IUU A;  1A2U A;  2F0G A;  3DXJ C;  3PO3 B;  2L0C A;  3T16 A;  3KBX A;  3K7A B;  4BA1 I;  1B53 A;  5EGT A;  5M3F B;  2QF7 A;  2JEA I;  3HOV B;  2E2H B;  4UDU C;  2C5C A;  4Y7N B;  1MD2 D;  2F0D A;  2EDG A;  1STE A;  2PW7 A;  1STB A;  4IZ8 A;  1XTC D;  2SEB D;  2F1M A;  5LHY 1;  1WD1 A;  3VR3 A;  3H91 A;  3BDO A;  1KNA A;  5DM7 3;  2HDM A;  5M3M B;  2LY7 A;  1TWA B;  4DNT B;  4XIG S;  5C0X I;  1SNQ A;  3W2D A;  4KD4 A;  1NUC A;  2BA0 A;  3GTK B;  4HN7 A;  3OWE B;  2KCN A;  3RUZ A;  4ME5 A;  1TWF B;  3RZO B;  4RCN A;  1H9R A;  1PRT F;  4KY6 A;  2XNA C;  1D1K A;  2D5D A;  5F2D A;  5E4W C;  4KHV A;  1G6Z A;  3V05 A;  3PUW A;  1I50 B;  1SYC A;  1H9M A;  2E76 C;  3HOX B;  2NN6 G;  1F77 A;  1SBB B;  3E6Z X;  1H9J A;  2RDG A;  3L3O C;  1PRT B;  5C3E B;  1CFM A;  3D4W A;  4U68 A;  3HZX A;  4M8A A;  1ESF A;  3J81 L;  5CMD A;  1NR2 A;  3TP7 A;  3MXU A;  1JB3 A;  3TSS A;  4CHT B;  3URY A;  3A7L A;  2J4X A;  2B2Y A;  4K5X A;  3H09 A;  4QCL A;  5FLX L;  3TBI B;  5C5L A;  1HUN A;  3M7G A;  4CKE A;  2K1B A;  3FMC A;  1LTB D;  2KED A;  2WIN B;  5D14 A;  2F0U A;  1D1I A;  1JWU D;  1JE4 A;  2KOL A;  4A3M B;  4HAE A;  4J1M A;  4KI0 A;  2QDB A;  3BYT B;  2NVY B;  4MN3 A;  2EOT A;  3VYS A;  4KK7 A;  1MBY A;  1UUP A;  1BO0 A;  2EE1 A;  2Z4I A;  4FO2 A;  3QWN A;  1DCZ A;  3QOL A;  2F0K A;  3QG1 A;  1WTW A;  5T1I A;  2NVX B;  3P75 A;  2AUJ D;  2Z4H A;  4FYD A;  5IT9 E;  2RDF A;  1GOZ A;  4FF2 A;  3T4A C;  4KV6 A;  1PTO C;  1HA6 A;  1Q90 A;  4XT1 B;  2MUY A;  4R9W A;  1ZYR C;  1J8I A;  1YNN C;  5FO7 B;  4B9W A;  2WAC A;  1U4M A;  3K6O A;  4HTH A;  1AW7 A;  2K32 A;  5J1Z A;  2F0W A;  1C4Q A;  1M8A A;  1V43 A;  2M9V A;  4OHJ A;  1K8O A;  4TQU S;  2XSC A;  4YIJ A;  2A6H D;  1TR5 A;  1ML0 D;  1PMR A;  4ZKC B;  1S5B D;  4TRD A;  1ONL A;  3X3M A;  2L12 A;  2VB3 X;  2B2U A;  5C6A A;  3A8K E;  2XRQ D;  5DNF A;  1HCZ A;  3HEJ A;  4A3D B;  4KKU A;  4K6D A;  3PUZ A;  1V1P A;  1EY4 A;  2RSO A;  3GV3 A;  4HCE A;  3V2T A;  3LWU A;  4CJ0 B;  4Q0F A;  3Q23 A;  3OSO A;  5EKI A;  3TN2 A;  1R4P B;  4A3I B;  2EJM A;  2EY1 A;  2OT2 A;  2Q8R E;  3DEO A;  4XTC S;  3QB3 A;  1U9R A;  4HMI A;  1OXU A;  1SNO A;  4S3S A;  4RFB A;  4C56 C;  3ERQ A;  3TZD A;  1PYW D;  4FVM A;  1GXD C;  2KQ3 A;  1AZP A;  1Q12 A;  4R8N A;  2IX3 A;  1Y8P B;  3GV6 A;  1ESR A;  3FPU B;  1ILQ A;  5M5Y B;  1HXY D;  3R3O A;  1OXT A;  5ELB A;  1GUT A;  3MEH A;  3W3A A;  2F0O A;  1BCP C;  2M2L A;  1YNJ D;  2B2Y C;  1OXX K;  5J39 A;  2NTT A;  1SYD A;  2VB2 X;  5G3L F;  4ZUJ A;  3VYT A;  5KRU A;  3CU7 A;  2WKC A;  1Q8I A;  1Z47 A;  4XXE A;  1F9S A;  1HRJ A;  3G6J B;  2JA5 B;  1NSN S;  1G91 A;  1STA A;  4Z9C B;  4HED A;  3NTK A;  1GUO A;  4BS9 A;  3TME A;  1A3V A;  3G7L A;  4BBS B;  1S5E D;  1Q3L A;  3NHH A;  2HCC A;  2FMM A;  1ILP A;  4KTA A;  3VR6 A;  3N52 A;  3PIO 3;  1BBX C;  1B1Z A;  1TWH B;  4IQZ A;  5EPJ A;  1EZ8 A;  3IFT A;  3OMC A;  1G2S A;  1B3A A;  1EIH A;  3J81 E;  1HQR D;  5C4H A;  3S17 B;  2F0V A;  2JYO A;  2N55 A;  4DAP A;  1PFM A;  1NAP A;  1WTO A;  3KF8 A;  3AB9 A;  1PTO D;  5CV5 A;  3MC0 B;  4PNY A;  2K5W A;  3M4Y A;  1B2T A;  1EY8 A;  4L6T B;  3MAQ A;  4F87 A;  1IL8 A;  3BDL A;  5ELC A;  1SXT A;  3M85 A;  2NB0 A;  1IW7 D;  5FLX E;  1JWM D;  2JA8 B;  1LTS D;  4RHR A;  1IHZ A;  2BOS A;  1TS5 A;  3KUP A;  1UNS A;  2PMZ B;  3FVQ A;  3NXW A;  2B2T A;  3WOF A;  1CZG A;  1TKW B;  2MP1 A;  1LTI D;  3ITP A;  4IUN A;  1U4L A;  5A35 A;  1STY A;  4RGT A;  4EQN A;  5BN4 A;  4QMG A;  1GUN A;  2QKI C;  3RD4 A;  5JVG 3;  1EQV A;  2NBF A;  1R4Q B;  2B2U C;  4IFD H;  2V4D A;  2D9U A;  4RH6 A;  5CV8 A;  4XQQ A;  3K57 A;  5JPN C;  4NDX A;  2K03 A;  4KJN A;  4ZK9 B;  2LMC B;  1JIC A;  3H0G B;  4J8Q A;  1EFI D;  3K5L A;  1SE4 A;  4K6L A;  1SAP A;  2E2J B;  5FO9 B;  2JA7 B;  3DWP A;  2O5J C;  1EYD A;  5C4J B;  5KND A;  4RGN A;  2HDL A;  4K8I A;  2MPM A;  2L5T A;  2ZT9 C;  2K6A A;  4RCO A;  4OGQ C;  1ENA A;  2I07 B;  1CK1 A;  1QJO A;  3C1F A;  4XQJ A;  5BN5 A;  5M5X B;  2KCC A;  1RTO A;  1TS4 A;  1JOO A;  3S1M B;  2BE5 C;  1QB5 D;  1O7Y A;  3MVV A;  4XT3 B;  5HGT A;  1O78 A;  2OEO A;  3EFX D;  5CBA E;  2HUG A;  1WCM B;  4B9X A;  3K5N A;  5M5W B;  1FNW A;  3DEP A;  3K58 A;  4EQO A;  1ZEQ X;  4CBV A;  4JK1 C;  1U4P A;  1STH A;  2AQ1 B;  3P20 A;  5JEA G;  3S2D B;  3MXG A;  3TP5 A;  3J80 L;  4BA2 I;  1O80 A;  4BBR B;  3I73 A;  1W6J A;  3X3N A;  4IFD G;  5JOB A;  2SNS A;  1I3Q B;  2YYZ A;  1BUV T;  4X3K A;  1V1O A;  1XXG A;  3SK4 A;  3SK8 A;  3RMH A;  3L7Z C;  3H3V C;  1I6H B;  3D4D A;  1AFP A;  4EQP A;  3R2I A;  3BG3 A;  3SE0 A;  3MZ5 A;  5EBD A;  2B2W C;  5IGB A;  3NWT A;  1CQV A;  4C3H B;  2NN6 I;  4DK0 A;  3HP3 A;  2AQ3 B;  2A74 C;  2QIL A;  3F2U A;  3BDC A;  1I4R A;  4OL7 A;  2Y0S B;  4KN7 C;  2K01 A;  1O7L A;  1EL0 A;  4WOR A;  1KTK A;  2PYK A;  1SFO B;  2L55 A;  5K5P A;  4ZUI A;  1BNZ A;  5C0X H;  5E4X A;  2IW3 A;  1JWS D;  1QG7 A;  1TY0 A;  2B2T C;  3OWF A;  2NZ1 D;  1Z6H A;  2K5D A;  1U4R A;  1F2Z A;  2F0E A;  3GQB A;  3CRL C;  4KHZ A;  1PFB A;  3MFG A;  3I8Z A;  1DOK A;  4TKO B;  2X6L A;  3BYY B;  1D5M C;  3ZYY X;  3C1E A;  3NUC A;  3HKZ B;  5FO8 B;  5IIF A;  2F0J A;  1CM9 A;  2EY5 A;  4J6H A;  3S2H B;  2B63 B;  2I46 A;  1QE6 A;  3M4O B;  3A55 A;  1FNU A;  3MXP A;  1GHK A;  2BE5 D;  4X3S A;  1RHP A;  3GTM B;  2TMP A;  3O13 A;  3PUX A;  2BDN A;  2A73 B;  2PZW A;  1IYV A;  1SDF A;  2MHV A;  3I72 A;  1XYI A;  2Z1C A;  2A68 C;  2CW0 C;  5D3D A;  2BDO A;  4K8J A;  1PRT C;  1HHV A;  1A3T A;  2F0F A;  1EYA A;  4F88 A;  4LK1 C;  2JA6 B;  1WTQ A;  2L11 A;  5C0X G;  1HTL D;  1WD0 A;  3GTG B;  4K5W A;  1PTO F;  2EYO A;  4XQN A;  1H9K A;  3MFY A;  3CHB D;  4OIK A;  3U9S A;  2D2C C;  1D5Z C;  4NP5 A;  1Y8N B;  2YU9 B;  1TWC B;  1B50 A;  1LTG D;  2O2L D;  3K59 A;  4B08 A;  3HG9 A;  1ENF A;  1EOT A;  4HCS A;  3IL8 A;  4P2C B;  1QNU A;  2KEE A;  3UI2 A;  2Q8I B;  3S1Q B;  1CT1 D;  1TQO A;  2A69 C;  4PMB A;  3D8G A;  1E2Z A;  4RAU C;  4G7O C;  1HA5 A;  3AU7 A;  5A2Q L;  1HPC A;  3BZD B;  2EYM A;  4X3U A;  1SJE D;  4FP5 D;  2ZXP A;  2FMC A;  4LJZ C;  3IFD A;  3SVM A;  3CKI B;  3I4N B;  3GTJ B;  1EU4 A;  1UEA B;  3I4M B;  1SYE A;  4F7X A;  2VNU D;  3P1H A;  3J7A F;  2JSO A;  3FDT A;  5KGU A;  3FEW X;  4DGZ A;  5IGD A;  1MGS A;  5KNB A;  1SNC A;  4DAV A;  4LAA A;  4KMU C;  2SNM A;  2XIW A;  4R8I A;  2PZU A;  2FJ2 A;  3J80 E;  1C8C A;  3BVG A;  5D65 A;  3SK5 A;  4N9P A;  5JEA J;  4FXK C;  2ICI A;  1Y1W B;  3PMF A;  3IAY A;  1WTR A;  2G9D A;  1B4O A;  2QCP X;  3K5O A;  1WTV A;  3EQL C;  5HUR A;  2ZXR A;  3Q0A A;  4E6I A;  2KEC A;  1DON A;  4FXD A;  4IUP A;  3QIA A;  1GUG A;  4OO1 I;  4C3J B;  2J0T D;  2IX0 A;  2E74 C;  4A3G B;  3GTO B;  4CJ1 B;  1CQF A;  1SSO A;  3HOU B;  1Z7T A;  1EWC A;  3NBI A;  3S9W A;  2DY7 A;  3K0Y A;  5CGK A;  1MI2 A;  5KYI A;  4FF4 A;  3VYU A;  2ENB A;  3KBG A;  1AN8 A;  4RKB A;  4DN4 M;  4C3H G;  2M00 A;  2BA1 A;  1QWY A;  5ELE A;  1DJR D;  4IAL A;  2PCF B;  1ZKO A;  4AYB B;  5COR A;  2PQE A;  2F0H A;  2WII B;  2RSN A;  1STG A;  3R93 A;  2F3W A;  3M7N A;  2F03 A;  1T5X D;  3S16 B;  5ELD A;  5FKA C;  1HQM C;  2F3V A;  4MHE A;  3S1R B;  4QUF A;  1D2B A;  3ERO A;  5I9P A;  2LS0 1;  2K28 A;  1MSG A;  1W6K A;  4PV1 C;  4I7Z C;  1FGB D;  1JR0 D;  1J9O A;  2EVB A;  5IOC A;  4A3K B;  1B9N A;  5KNC A;  1PTO H;  3A8J E;  1HUM A;  4NKL A;  3DM1 A;  2DNE A;  5JJZ A;  3VR5 A;  1I4G A;  3TP8 A;  1EZ6 A;  2ZXO A;  1DM0 B;  2B2W A;  3Q22 A;  3I4L A;  3EJI A;  2F0S A;  1HFN A;  4ULL A;  1JCK B;  1ZYR D;  3DHQ A;  1YNN D;  1Q1E A;  4RKL A;  2IPK D;  1S5D D;  1B44 D;  3SDZ A;  1EY6 A;  4XDX A;  3PUY A;  4H7B A;  1PLF A;  3HOY B;  1ZXT A;  1WTX A;  2E75 C;  3NK9 A;  1D6E C;  3OPO A;  2K33 A;  5CYU A;  3KLR A;  1B9M A;  2CQA A;  3TZU A;  1LTT D;  2L4N A;  1TY2 A;  5C3W A;  2K5Q A;  1LT6 D;  4CGY B;  1SEB D;  2G9H D;  1VF5 C;  3S14 B;  3E5S A;  2F0I A;  2NUC A;  5EQ0 A;  1WVL A;  3I3C A;  1BF4 A;  3GTQ B;  1V1P B;  5LL6 X;  1CI3 M;  2E2I B;  4IN3 A;  3R8B A;  1LTA D;  1VMC A;  4M1U B;  1F9R A;  2F0L A;  1OXS C;  2E2D C;  4L8J A;  1NR4 A;  1T5E A;  1ET6 A;  1AP0 A;  1V8Q A;  4HR7 B;  1EU3 A;  1M4V A;  5J22 A;  1EEI D;  1X3Q A;  2AUK A;  3D6C A;  2IWH A;  2LKV A;  1C48 A;  1SMY C;  4A3J B;  2GA4 B;  2F0P A;  1S4Z A;  1E2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...