1SNQA

Protein stability in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 38
structure length 130
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snqA00
3P1HA 4NP5A 1SYGA 5HGTA 1JOQA 4K5WA 4NMZA 5KGUA 4RKBA 4H7BA 1A3UA 5IGCA 2EYOA 4J6HA 5CV4A 5JOBA 1EY8A 4WRDA 2EYLA 3NXWA 5E3FA 3EROA 5CV9A 5CV7A 3SK8A 1F2YA 2EYPA 3R3OA 3ITPA 5I9PA 3EJIA 1KAAA 1JOKA 1STNA 1SYDA 1SYFA 2F0EA 2PZTA 3H6MA 4ME5A 4EQPA 4MIUA 1NSNS 3NHHA 4K8IA 4E6IA 2F0SA 4K8JA 3EVQA 5CC4A 4ODGA 3TP8A 1EY0A 1TT2A 2F0WA 2PQEA 2PW5A 4HMJA 4J1MA 2F0KA 1A2UA 3LX0A 5C5LA 5KRUA 3TP5A 5KYIA 3QB3A 1STAA 3T16A 4PMCA 5CV5A 5IGFA 1EY7A 2F0FA 1JORA 5EKLA 3NK9A 4ZUIA 1EY4A 3RUZA 1SYEA 4WORA 5E1FA 4KY7A 4ZUJA 5KYLA 5IGDA 2F0DA 4N9PA 3SHLA 3D6CA 4B9WA 1EYDA 1SNOA 1KDCA 2F0JA 3OMCA 3TP7A 3S9WA 3MEHA 3MHBA 4KV6A 4RKLA 5IGGA 4IALA 1A3TA 1ENAA 2SNSA 5J39A 3T13A 1EZ6A 3NUCA 3OMGA 4KJNA 4EVOA 2F0HA 2F3VA 5C3XA 4IZ8A 1A2TA 4QF4A 5C5MA 4N9TA 5I9OA 2PZUA 3TP6A 1A3VA 1ENCA 1TQOA 3D4DA 5K5PA 4KHVA 4LAAA 1IHZA 1II3A 3D4WA 1TR5A 1F2ZA 3ERQA 3QOJA 4HTHA 4OL7A 2PZWA 4K2KA 4ZQ3A 4DGZA 5IOCA 5JAVA 1SYCA 2EXZA 4I65A 1STGA 5DEHA 2KHSA 2SOBA 3NQTA 4K2LA 4B9XA 4EQOA 2F0IA 1EY6A 2EYJA 2NUCA 3PMFA 4R8NA 1U9RA 1EY5A 4KJOA 5J1ZA 3V2TA 5KEEA 1NUCA 4TRDA 3OSOA 1SNDA 1KDAA 3MVVA 3MZ5A 4ID6A 1EY9A 4NDXA 5C4ZA 5IGBA 4F8MA 2HQEA 2F0LA 3C1EA 1F2MA 5M9OA 1SNCA 3SXHA 1STBA 5EKKA 1SNQA 3SK5A 4K5VA 5F2DA 2F0NA 3E5SA 1KDBA 1KABA 2EYMA 4DFAA 3HEJA 3VA5A 3C1FA 4G57A 5CGKA 3BDLA 3QOLA 5CV6A 2OEOA 1SYBA 2WACA 4K6DA 4S3SA 5I6YA 5I6WA 1SNMA 4QB4A 4PNYA 3SK4A 3HZXA 5C6AA 3DHQA 4KTAA 1STHA 5C3WA 2F0UA 2F0OA 5IIFA 5ISRA 3MXPA 3BDCA 2F3WA 5J22A 1RKNA 2RKSA 4K14A 1EYAA 2QDBA 3SR1A 2PW7A 5CR3A 4KD4A 5KIXA 4QMGA 2SNMA 1JOOA 4KD3A 3NP8A 4DU9A 3SK6A 2EY1A 5HURA 2EY2A 5IGEA 1AEXA 2F0PA 3D8GA 2LKVA 1EQVA 1EZ8A 2EY5A 5EGTA 4F7XA 4IUNA 4KY5A 4KY6A 1SNPA 2KQ3A 2F0MA 2EYHA 2M00A 4PMBA 2F0TA 2F0QA 2PYKA 3OWFA 4NKLA 5DAUA 4EQNA 2OXPA 1EYCA 2RBMA 2RDFA 4HMIA 4YIJA 5NUCA 3P75A 2O4XA 2F0VA 3DMUA 5C4HA 2F0GA 2EY6A 3U9OA 3TMEA 2EYFA 2OF1A 5IODA 4K5XA 4DF7A 1STYA 2ENBA 5CV8A
chains in the Genus database with same CATH superfamily
1KAWA 3HP3A 1SYGA 1CKMA 2Z0SA 3V96A 2EQSA 3CPFA 1WI5A 1EY8A 1I4PA 1EQTA 3HOUB 1IBKQ 2O2LD 3MA2B 3K7UC 1JOKA 4OO1H 3HKZE 3BYTB 3J81j 2KCCA 3P20A 4HMJA 1KIXA 1OXTA 5C0XG 1SBBB 1SDFA 3TP5A 2A74C 2B2WC 2CH4A 2UXCL 1YITA 5JJLA 3NK9A 2L55A 4KHPL 3A54A 3PUXA 5KNBA 2B29A 2FMMA 4LW1A 4C3HG 1HCZA 2NBFA 3OYYA 2B63B 3PO2H 4EX5A 3SHLA 3D6CA 1Y8OB 1AFPA 2CQAA 4GNXB 3G48A 3CCMA 3M7GA 1WTHA 4LF5L 1ASZA 1EWCA 5I6YA 3QOJA 4X66Q 5C44G 1TR5A 5BN4A 4UDUC 1D1IA 2VS1A 1LT6D 2G9HD 2BOSA 4FDBA 2F0IA 3OIPA 1J6QA 3KOJA 4KJOA 5J1ZA 1XXGA 3GDEA 3KF6B 3KLSX 3KDFA 3RLOA 1BBWA 3C1EA 4O1NA 5F2DA 2HDMA 5IP9H 3MWYW 4LF8Q 5IWAQ 4BA1I 3KJOA 3E9HA 3MAQA 4B3TL 3M7NA 2F4IA 2JA8H 4QB4A 1WTPA 4OIKA 2NB0A 5C3WA 3ERSX 4HIKA 2BDOA 1Q46A 1BCPD 2GVBA 4BBSG 4IFDJ 5KNDA 2MP1A 1HRJA 1VQNA 4Y52H 3BZDB 1X9NA 4UAIA 4FF2A 2JA5H 1L1OA 4ZAIA 2NVXB 2Q8TA 4DA2A 4BBRH 1PTOH 3BG3A 1LTRD 1LTTD 2KA7A 2JEBI 2F0VA 4ME3A 3HOZB 1KLGD 1SN8A 3DWPA 1TWGH 5ELOA 4NP5A 1YNJC 2IL8A 2VQFQ 2QF7A 3DEOA 2ZJQA 2HUGA 3OW7A 3K57A 1VQDA 4JI8Q 3UDGA 4FP5D 2NZOA 2EYPA 4DR6Q 2BCOA 3U4ZA 3HOYB 1X3PA 3TSSA 5IYCG 3H15A 1VQFA 4DV4Q 1HA6A 1QVCA 3T56B 4XT3B 3QB3A 2Q2UA 1VQ5A 4EQ5A 1KC8C 4OONA 3M9BA 3S17H 1TWCB 1JMCA 1QUQB 1I6HH 5FLXc 3EFXD 1XMQQ 1EL0A 4OX9Q 1SE3A 4IUTA 1IKMA 2IX0A 5E1FA 3FPPA 4JI7L 2KECA 2L15A 3K0YA 4XQQA 5GAEC 1WJJA 5BN5A 4A3BH 2SEBD 4DR7L 1S3OA 4KV6A 2M2LA 3HFZB 4CKBA 1E24A 1LTLA 5JPNC 4C56C 3CF5A 3T1HQ 5FO8B 4DV7Q 2K32A 5LMNW 4A3IB 2XGTA 5BN3A 3I70A 1O7ZA 3D4DA 3JAMc 1IHZA 1II3A 1TWAH 1KTKA 3I56A 4DGZA 2CWAA 4NB3A 1BDOA 4I65A 3ICEA 4ZK9B 3C46A 4DKAC 4Z9CB 1GKHA 3PMFA 1NMGA 1G51A 3MFYA 4JBWA 2AQ3B 1Q1BA 2ZTCA 2BA1A 1G291 1PTOF 5M5WB 4JCVE 2CFMA 3HOUH 4DAYA 4FNFA 3GTOB 2B8GA 2PQAB 4DV0L 4QIWE 3NWTA 2KBNA 5C6AA 3W3AA 2R93B 5FJ8H 3R2IA 5ELNA 3PF4A 1B8AA 1DCZA 5J22A 1RKNA 3QO2A 5IT9c 3CCUA 4YWKA 1H9JA 4LUOA 2QEJC 5JPMC 1XPRA 1R9TB 2B63H 3A8IE 2WAQB 2MO1A 1MJCA 2L1BA 1Z47A 4AH6A 5C3EG 4FXGC 4C3JB 2GA4B 1UUPA 1FYCA 1GO3E 4A3MG 2FJ2A 1G6ZA 3IFDA 2A69D 3CPWA 3F8TA 1AZQA 4DK6C 4CJ0B 5IYDH 4YY3Q 4L63B 3CC4A 1O80A 1FNWA 1YNXA 1B1ZA 1YZ6A 2N78A 2X69A 2BH2A 4DR4L 4RHRA 4K5WA 3QIAA 1JB7A 3PSIA 2BA0A 2B2VA 4KI0A 2XIWA 2EYLA 1WTVA 1SROA 4X3KA 1IL8A 3R3OA 3RR5A 2IPKD 4JPBW 4UHVA 5K36H 2HT1A 2DY8A 4GNXA 2F0EA 1AP0A 3CC2A 1GHKA 2E2JH 2LS01 4K0KL 2A1AA 2NN6I 5KRUA 4OHJA 1LTID 5L37A 1F9PA 1CKNB 5IGFA 1EWIA 1MHWC 2I07B 1JORA 4OO1G 2K50A 1SFOB 1PMRA 3KF6A 4B9WA 2NVXH 4DN4M 2ICIA 4IPHA 2RDGA 2V4DA 5HGQA 5JEAH 1UE5A 3S2HB 1A2TA 4DR2Q 3GTMB 2EVBA 5I9OA 1XTDA 1Y8PB 2M9VA 3PO2G 4B3RQ 1ENCA 1N36L 4C1NI 1X55A 1XWEA 3JAMi 3PQIA 5FKAC 3HOZH 1CHQD 1J9OA 3STBC 4B9XA 1EY6A 4RA8A 1X3FA 4XDXA 2KCMA 5KEEA 2IX3A 2R7ZG 3T4AC 1GJXA 1PVOA 4K5VA 3KF8A 2KEDA 3HEJA 3VA5A 5FOBB 3HOYH 2FXQA 4XIGS 2GVAA 3IFTA 4KKSA 3NTIA 4KTAA 4JVZA 5IIFA 4A3JB 1I94Q 4R4OA 5DNFA 1TWCH 4K14A 1CTMA 1FGUA 1V1PB 2NZ1D 2L11A 3HOXB 3PUVA 4A3CG 1HNXQ 2JA8G 4RHSA 3H0GB 3TDQA 2JSOA 5LMNL 3F2UA 1K83B 1I50B 4KY6A 1VQ9A 3NEMA 1GD7A 1VQBA 4FF3A 3OWFA 2DNEA 1X6OA 2NZHA 3NPPA 4A3IH 4FYDA 2JA5G 3A8JE 1HTLD 1CQVA 2E2HB 4Y7NH 4JYAQ 3GTQB 2QGQA 3UDFA 1V9PA 1IW7D 1S5ED 3E6ZX 4BBRG 2ZTEA 3AU7A 1OO9B 1C7YA 1QUQA 2WINB 1PH2A 4RKBA 5IGCA 2NN6H 1CZWA 4XYOA 5M5WH 1GHJA 2ALYB 1B2TA 5BR8Q 2N49A 3GTOH 4M1UB 3ITPA 4KK7A 2K75A 4BXXH 3M3YB 4PMWA 1AE3A 3EN2A 4EQPA 1FJGL 4P75A 3S14B 1NSNS 3RNUA 2I5LX 1PH8A 1WFQA 2IHEA 1TVXA 5C5LA 4DAPA 1H9KA 4P72A 2R93H 1CK1A 4AYBE 5CV5A 1LT4D 4OGQC 1MGSA 3I8ZA 3AFPA 4BY7G 4YCWA 1R9TH 2K4KA 2JA6G 3VYSA 1F9QA 1A3TA 1QOHA 3MXUA 1CQFA 1EZ6A 4C3JH 2C9OA 5E4WC 4UP8A 1JWSD 4B3ML 4I7AA 4QF4A 1IZ6A 2KEEA 3AFQA 2Y0SE 1YEZA 1HNWQ 5I4DA 4CJ1B 1TQOA 4QIWB 4OL7A 3ND9A 1L2FA 2TMPA 4N8X1 1SYCA 1HUNA 3VA7A 1ET9A 2J4XA 3HOWB 2HDLA 2SDFA 2XRSD 4O0AA 4X62Q 5TSSA 1SNDA 4DUZL 5M3MB 1IL2A 2Y0SG 5EBCA 3CW2C 2UUAL 2CQOA 4MTKA 4QUFA 1STEA 3CMEA 1VQ7A 4A3GG 2QW7A 5CV6A 3X3MA 2Z6BA 3CHBD 1LT5D 4DV3Q 3HZXA 1HNZQ 1JJGA 2B2YA 3CRKC 3HOUG 1VQCA 4HN7A 3CAMA 5A2QE 4LMQD 1E2ZA 2RKSA 5H1SE 4GKJQ 2AWOA 3W5OA 2PW7A 3H94A 1I5FA 2PPBC 5IGEA 1SFOH 2LSSA 2EY5A 1KL9A 1X56A 5FJ8G 4H44C 1DXMA 4A3KB 4X64L 3S15H 2F0QA 3S2HH 4ILWA 3V05A 3OTOQ 3GTMH 3IL8A 2B63G 5G3LF 2VL6A 4HSPA 5IY0A 2EYFA 4NXNL 1HZBA 1CKNA 4L5TA 1BF4A 1BR9A 3NTKA 1V1QA 5IYDG 5E3FA 2YV5A 2XN9C 1X3QA 2R7FA 5I9PA 3EJIA 4L5QA 1STNA 1SYFA 2XWJB 3C3LA 3J7A5 3VR4A 4MZ9A 2ZM6Q 4IUPA 2RVLA 3A7AB 2AQ1B 4RGNA 4IJLA 4A93G 4A76A 2BDNA 3S16B 4A3JH 1FVIA 3J81E 2F52A 1SMYD 5CMDA 1K9MC 2QKIC 5K36G 2ICEC 1F9SA 4K6LA 1EY4A 2EDGA 3A5UA 3HOXH 1OXUA 3H0GH 1JR0D 4A3LG 5JJZA 3R93A 3MEHA 2PCFB 3MHBA 2XWBB 4IALA 1D7QA 5J39A 5AJ3Q 2AHOB 2BH8A 4EVOA 1W6KA 5C3XA 3CCRA 1FNVA 4A75A 3TP6A 4MTNA 2E2HH 4DR3L 3F2DA 3GTQH 1MD2D 4K2KA 5JEAG 1N33L 2KHSA 4K2LA 1S40A 1RHPA 4DV1L 4TSSA 4DV2L 2UXBL 1C8CA 1V1PA 2ES2A 5C4ZA 2RSOA 4F8MA 3HOZG 1STBA 1GXDC 1PYWD 2NVQB 2HIVA 1KABA 1QG7A 4BS9A 1PTOB 3M3YH 3Q24A 4CJ2C 2O5JC 3S14H 2R61A 4S3SA 5I6WA 1SNMA 4PNYA 1ILPA 4XYQA 3DUZA 5ISRA 4JI1Q 2L9HA 1N8RC 4JI5Q 4PV1C 2A68D 1QWYA 4JV5L 1K8OA 4QMGA 3E0JA 1EU3A 2QCPX 4UPAA 4L6TB 1EIFA 1CKOA 4KLKA 2IT1A 1TS5A 1GUOA 4LF6Q 2EYHA 4BY1B 1BCPC 1C4QA 4LF4L 1IBKL 3GTJH 2EIFA 2KJXA 2WKDA 1PH5A 3MXGA 4G7ZC 4YIJA 3Q22A 1D1KA 1AW7A 3PUWA 3LNNA 4OIJA 1L0WA 1R4QB 4K5XA 4AYBB 3MFGA 2UU9Q 2E2IB 1LO5D 3HOWH 4GS3A 4A3IG 1Q8IA 3HRZC 1CA5A 2DGYA 3GV6A 3AQQA 5M3MH 2KENA 3J80E 4R4QA 5CV7A 2YTVA 4CGYB 4CDFC 5COYA 1BBUA 3K6OA 1L0YB 2Q2TA 1Z9FA 2A5HA 2F0KA 3IRBA 2IWHA 2Z1CA 1STAA 3H91A 4X66L 3CXCA 1Y1WB 1JJCB 3D4RA 3PUZA 2B2TC 4ZLTF 1HR0Q 1QB5D 3E0EA 1J5EQ 1NR4A 1HXYD 5FLXE 1PH9A 5IGGA 4A3KH 2F1MA 5FK9C 4DUYL 1YJ9A 2ZXPA 3ONAB 4GLXA 2PZUA 2WAQG 3J7YW 4KHVA 1X3GA 4P71A 1AE2A 1F2ZA 1EFID 1F77A 4X3SA 1Q3LA 1M8AA 2JJQA 1STGA 4F88A 3NQTA 2HCIA 1HFGA 3FMCA 2A6HD 1DM0B 3HKZG 4ID6A 2HQEA 1RD9D 1SNCA 2K04A 2RHQB 1B9MA 3BVZA 1ET6A 4CHTB 2JA7B 1B7YB 5LMUQ 4LF9Q 2K05A 3S16H 1MKHA 5EPKA 3PIOA 1IBLL 3Q23A 4CDEC 3NQIA 1EOTA 4HCEA 1PZID 4DNRB 2EY1A 3EA6A 3L9AX 1K8MA 1Q12A 4HJ8A 2VQFL 3EQLC 4XXEA 1TU2B 3D31A 2DJGC 1ZKOA 4JI8L 4JI4Q 4PQXA 2JK8A 4DR6L 1O7LA 1EEID 4IUQA 3IKJA 4GLVB 3CCSA 3K5NA 3QR8A 2E2JB 1FD7D 3P75A 2OT2A 2JN4A 1PRTB 4B08A 3U9OA 4DV4L 1B50A 1WVLA 4RH6A 3I7FA 3UE0A 3K7AB 4NMZA 1IBML 4NPSA 4H7BA 1XMQL 4J6HA 4A4IA 4WRDA 2A69C 3WWVA 4C3IG 2JA9A 3BYYB 1YNND 3I2ZA 2NVQH 4XQJA 4JBJA 1EU4A 3T1HL 1PZJD 1X65A 3FEWX 3MXNB 4DV7L 2UXCQ 5KYIA 1K0SA 1JWMD 3KJPA 4KHPQ 4QGUA 1D6EC 1QJOA 1XNQL 2DJFC 1PHJA 2E8GA 1A63A 4JOIA 1S5BD 1SNOA 3CD6A 4DR1L 3OMCA 4A3JG 1N9WA 4JI3Q 1FL0A 4BY1H 3GTGB 1BBXC 1EOVA 5M5YB 3W1BA 1QNUA 2IW3A 3HOXG 1KNAA 3H0GG 4QJFA 3OOCA 3R2TA 1LTSD 1BO0A 2UUBL 1K8GA 3M85A 3WDNA 4RMFA 2E2IH 1EY5A 2XSCA 4FXKC 1KDAA 3HOVB 2EJGC 2K14A 2PMZB 1IXRA 1JWUD 2CWPA 4LWCA 1DOLA 5JEAJ 2D9UA 5M9OA 2E5LQ 4B3TQ 1SNQA 1ASYA 2EYMA 2QILA 1Q7YC 3KLRA 3J7AV 4LFBQ 1E3PA 1DD2A 2OQKA 4Y7NB 2ATWA 1YIJA 3RZOB 2I5HA 1H9RA 3SEBA 1GVPA 4JI6Q 1VQJA 4YY3L 1HFNA 4U68A 4GOPA 1JJ2A 1Y1WH 4FF4A 4PG3A 2K03A 3H09A 2VQEL 1LABA 3CC7A 2E2DC 3SE0A 1KRSA 1VQKA 1WYDA 1GM5A 2EJFC 1STYA 1PDQA 3TBIB 2RQXA 4CKCA 1FR3A 2MO0A 1YVCA 2EYOA 1BCPB 1WTRA 3TREA 2EJMA 1GUGA 3S1MB 4JW0A 4A3EG 1IW7C 2GN5A 2PZTA 3H6MA 2PNRC 5FLMH 1PH6A 2G9DA 2JA7H 2YTYA 1EY0A 2F0WA 5M3MG 2PW5A 4DR2L 1A2UA 4X6AH 1KXLA 3K5MA 2K33A 4X65L 4JI7Q 3G6JB 3RD4A 3FPUB 1YJWA 1XMOQ 1GOZA 4LUVA 5EBDA 1WCMB 1LACA 1VQLA 4WORA 2EOTA 3KFUA 5CYUA 4DV5L 4DNIA 2FINB 2VB3X 4A3FG 4JC0A 1VF5C 1XTCD 5ELCA 5I2YA 1A3VA 1SR3A 1N32L 5C4XB 5D14A 3S1QH 2BE5D 1GUTA 4A3KG 2N88A 1VQEA 1SE2A 1VQ4A 1Q82C 1BNZA 4R8NA 3FVQA 2I46A 3K7AH 1L1OC 4DV6Q 2UUCL 5C44B 3CMAA 4HSVA 3PIP3 1LV9A 5C0XJ 1HNXL 2D5DA 2X6GA 4DV0Q 3SK5A 2LXJA 3E5SA 3S15B 2K52A 3N52A 4JG2A 3DEPA 4PZ6A 2F0UA 5EJWA 1NBWA 1EEFD 4IOAA 1D5MC 1HTPA 3K5LA 1I6VC 4RGTA 4UP9A 1K0RA 1SAPA 4BBSB 2KQ3A 4QL5A 2M00A 2CCZA 3GTGH 1TY0A 2XVSA 5M5YH 5BR8L 2Z4HA 4IN3A 2PYKA 1GUNA 3T53B 1TWFB 2PI2E 4TVAB 2L12A 5NUCA 3RLFA 3BJUA 4YCUA 3A8KE 3DMUA 3J80L 4PZ8A 1D5XC 2WP8J 3CCLA 3J7ZC 5IP9G 2JYOA 4GN4B 3FKIB 2MFIA 3RZDB 1K3BC 3LGJA 3O13A 5KGUA 1RIPA 2IX1A 3HOVH 1LLRD 5IE8A 1XPUA 1VDZA 3EROA 5CV9A 2HCCA 3SK8A 2Z6KA 1BXTA 1VQ8A 2YU9B 5GQOA 1PRTF 1HNWL 5JVG3 3NENA 2H1EA 3RZOH 1KQSA 2NVYB 2LFNA 2F0FA 1H9SB 1PFNA 3CU7A 1LM0A 3PV0A 4HAEA 4L8JA 5IGDA 4X62L 2WB1E 4MHEA 2C5CA 4ZRZA 4IOCA 1SMYC 2OTJA 5IP7H 3GTKB 1P8LA 4N9TA 1B3QA 1G2TA 4LAAA 5GAGC 2K5VA 2PZWA 1Y8NB 4N8FA 4DV3L 3K58A 1HNZL 1PYSB 4BY1G 2A6ED 5ELEA 2MUYA 3K8AA 3S1NB 1CI3M 1U9RA 1ML0D 4IQZA 3V2TA 1X32A 1SLJA 4O42A 5CORA 3S1MH 1Q90A 4AYBG 3C1FA 4ZKCB 3GTJB 4RGOS 3L7ZC 4K6DA 1XPOA 2PQAA 1HR0W 2VNUD 1G8ZD 3OTOL 3UDIA 4A3BG 1EWHA 3VR3A 1B53A 4H0LC 3BVGA 2ID0A 3DM3A 3K59A 1WCMH 2SNMA 3NP8A 2YTXA 1C48A 2B2VC 5EGTA 1M90C 1EYGA 3GTLB 1LUZA 2J7ZA 4GN5A 5DLQE 5GADC 1PH4A 4GNXC 1Y1WG 4NKLA 2A68C 2WIIB 4C1NK 3M4OB 2ZM6L 5C4XH 3GTPB 5C4HA 2Z4IA 4GN3B 2EY6A 5C3EB 2AUJD 1B4OA 1PTOD 2H5XA 2ZXRA 1PXUA 1RL2A 3VR6A 1RODA 5HGTA 4UP7A 4A3MB 1RJTA 1MIUA 1Y69U 4R8IA 1A6XA 4AIMA 1JE4A 2Z8LA 5C44H 2UXDL 1U0LA 5JJIA 3I73A 1HZAA 4PMBA 1TKWB 1V8QA 1CUKA 5CC4A 3EVQA 1SJED 2B2UA 1TT2A 1HJPA 2R92B 4LNQA 5GROA 4JBMA 1ICFB 5I2XA 1K3RA 3T16A 4IPGA 2V1CC 2HHHQ 1G6PA 1N34Q 1XYIA 5EKLA 1ZXTA 1TS2A 3RUZA 4LFAL 1SYEA 2JA7G 1BCPF 2X6LA 1PFMA 4OWXB 2VB2X 1WTXA 1VQOA 4BBSH 4RKLA 4B3MQ 3L3OC 3F2CA 5EQ0A 1B3AA 3URYA 1Q1EA 3K5OA 1TWFH 4HJAA 3OWEB 1WD0A 4DU9A 1O7IA 3ERQA 1BUVT 2OWOA 4ZQ3A 3E9IA 2E75C 2B2WA 5IOCA 2YYZA 3GO5A 3FKIH 4DUZQ 3RZDH 2F4VQ 2HIXA 4V0BA 1QILA 3UDXA 1K8AC 2KCNA 1MI2A 1DYQA 4OEMB 1PZKD 4I7ZC 2YU9H 3CP0A 3H3VC 3NBHB 4LF6L 1B44D 3ZJYC 1HQRD 3BU2A 1DJRD 2FMCA 5D3DA 4TKOB 3SK4A 4NXML 1LYLA 2A6HC 1EFWA 1O7YA 4B3SL 3BDCA 2NVYH 2VY3A 3ER0A 1W6JA 5D3IB 1L1OB 1C9OA 1CSQA 4FO2A 2UU9L 1D8LA 4DXFA 2LKVA 3KK7A 3TS2A 1I3QB 1AZPA 1LT3D 2Q8RE 1NJIC 1HQMC 4LFCL 1NCVA 2F0TA 3MEFA 3I4NB 5E4XA 3X3NA 4G7HC 1NMFA 3GTKH 1GUSA 3LWEA 4NXNQ 1B70B 2F0GA 4IUVA 1KRTA 1CZGA 4GKKQ 3NBIA 3AEVA 3BVMA 3S1NH 4BA2I 3I4MB 3HOYG 3Q6SA 2N3SA 2PMZE 1A3UA 4XQNA 1UEAB 1W2BA 2ZXOA 1Q8KA 1J5EL 1JE5A 1M1KC 2WB1B 1HUMA 3D6WA 4MIUA 1I4HA 2F0SA 1A8VA 3HOVG 5DM63 4EGVA 3GQBA 4A3DB 4JI2Q 1MBYA 4YHHQ 5LL6S 3ULPA 3G7LA 1WTOA 1EY7A 1YNNC 5T1GA 3FP9A 3RN2A 2NYZD 1D5ZC 2K01A 4JI0Q 2IHFA 2IY5B 4RCOA 1S5FD 2L0CA 3GTLH 1PRTD 2Q2HA 2C35B 1JCKB 4BY7B 3SGIA 4LUZA 3ND8A 4IURA 4AQYQ 3DLLA 3ULLA 3M4OH 1GUWA 1EQQA 1ESRA 2NN6G 2B2YC 1B9NA 1N33Q 4DV1Q 5JAVA 3GTPH 5C3EH 4LF9L 5EAYA 1PLFA 5M3FB 2UXBQ 3JC66 1UE1A 4R4IA 3ZYYX 4BXXG 5IP7G 4A3MH 4LF7Q 2N8NA 3MVVA 3MZ5A 4DAYB 2B8FA 1DZ1A 2AUKA 1TXYA 4IJHA 2F0LA 3L2PA 5EKIA 2EXDA 2R93G 2FHTA 1E2VA 1XNRQ 3CCQA 3KBGA 3NWSA 4CKEA 4ZKBB 2OEOA 1SYBA 4LF8L 5IWAL 1CT1D 2R92H 1E0BA 4JV5Q 1DGSA 4ABNA 4OWTB 1UNSA 1EYAA 4A3GB 2VUMB 4C3JG 3JAME 3DM1A 3CQZB 4F7XA 2NTSA 5FO9B 1S72A 4KHZA 3TN2A 4LF4Q 2RSNA 3P7JA 4ULLA 1U4RA 1WCMG 3J81c 1WTQA 4EQNA 1EYCA 4ZYSA 2RDFA 4RG1A 3A56A 3T1YQ 1S4ZA 3D0FA 4HJ7A 2WKCA 3M4QA 4DF7A 1MJEA 3GD7A 3KUPA 2ENBA 1IYUA 4L5RC 3P1HA 4FXDA 1SJHD 2CW0D 4DR5Q 1VF7A 1CSPA 5C4XG 3MC0B 1H95A 1QNKA 5IT9E 4TQUS 4OELB 4JI3L 1UWVA 5CBAE 4K8JA 3G71A 1E22A 2OCEA 2R7ZH 1KLUD 3S1QB 3I90A 2MHVA 1UE7A 1A62A 4RCNA 1U5KA 1YBYA 4RGMA 4H13C 3KLWA 4O2DA 4ZUIA 4JBKA 3A5ZB 3IAYA 2KCTA 4KY7A 4OXPA 5KYLA 5CBEE 4A93B 1I3QH 4OX9L 1EYDA 1ONLA 1KDCA 3S9WA 3TP7A 4DUYQ 1PV4A 1Y1VB 2SNSA 5G3LD 2VZAA 4R9WA 4PZ7A 1BQQT 2E5LL 3OMGA 4KJNA 1HHVA 2F0HA 2EZVA 1YJNA 3I4NH 3NBHA 5C5MA 3S1RB 4A3CH 4G4KA 1VS0A 3WOEA 4POFA 4HTHA 1NR2A 4LFBL 2Q8IB 1LTAD 3U50C 1U4LA 3VYRA 4EQOA 2PI2A 1RTOA 3I4MH 1ZYRD 2NUCA 4JI6L 1W3SA 5EPLA 4U673 4NDXA 2D62A 1IKLA 2OTLA 2R3ZA 3KF8B 2MNAA 2BE5C 3QJYA 2F0NA 1KDBA 4IFDI 3FKIG 4DFAA 1JC7A 4LF5Q 1WOCA 4Q0FA 1BOSA 1TS3A 2E76C 1HPCA 3BDLA 3VR5A 1IBLQ 4DK0A 4A3DH 1HZCA 2JE6I 5HY6A 2ZT9C 3J80c 3AYHB 1VMPA 3AMUA 3UI2A 4J15A 2K7VA 2P5ZX 2ZJRA 5E7NA 1AEXA 5C4JB 3OW2A 1EQVA 1ICWA 1QVGA 4IUUA 4MNOA 2PO4A 1SNPA 3VYUA 5EPJA 3SVMA 5A2QL 4HIDA 4X3UA 2XTIA 4BY7H 2K5HA 3J81i 3ULJA 2JA6H 2VXWA 1VQIA 2Z9HA 3TMEA 1F2LA 5M3FH 5IODA 1IBMQ 1K28A 3A74A 1F9RA 3PGZA 1XMOL 1PH1A 5JOBA 1D2BA 3LWUA 1Q81C 5IYBH 1KAAA 1T9HA 3PO3B 2VW9A 2DNCA 3NHHA 2K28A 3EBEA 4H02A 4KKTA 2RCNA 1YHQA 1RTNA 3VDYA 3TP8A 2FFKB 2B3GA 1TS4A 2KUMA 1QZGA 1XNQQ 5ELDA 4L5SA 4A3GH 2VUMH 3L0OA 3TZUA 4DR1Q 2B39A 4ZUJA 4QY7A 3CQZH 2HD3A 3Q0AA 1CM9A 1PA6A 4GLAC 4DV6L 2LMCB 3J81L 3G6EA 4HCSA 4RAUC 4YWMA 1SMXA 1J8IA 1SRUA 5AFWA 3HOWG 1VQPA 2UUBQ 4R1JA 3D4WA 3S2DB 3I91A 3H3VI 1QE6A 4B3RL 2EXZA 2R6GA 2NVTB 1YI2A 2SOBA 4IFDH 1AH9A 2WFWA 2EYJA 4DK1A 1HA5A 5M5XB 2AQ2B 1NNXA 4TRDA 3OSOA 1T5XD 1O78A 1UEBA 4DR7Q 1EY9A 1OXXK 3AB9A 1F2MA 1MSGA 2K5DA 5EKKA 1OXSC 5JVH3 5T1IA 2HQLA 4RFBA 2A6EC 1I4QA 4G57A 5CGKA 1SEBD 3TS0A 4C3HB 3HKZB 2CKZB 2TSSA 1XX8A 1ENFA 4WFN3 4CDCC 2LXKA 2RDHA 3J80i 3PCOB 1I94L 4M8AA 5CR3A 3VR2A 4POGA 2VQEQ 3SK6A 2R92G 3D8GA 4A93H 1EZ8A 4RWSC 1KNEA 1Y1VH 3QWNA 4Q5VA 4HIMA 2K1BA 2WV6D 1YNJD 1PH7A 5DAUA 3S1RH 2I5MX 4A3LH 1NAPA 3CCVA 3C2PA 2OF1A 2IJ0A 1VQMA 4JYAL 2XRQD 1A15A 4JOIC 4IO9A 3S24A 5CV4A 3QG1A 4HEDA 3HG9A 3KBXA 1E2WA 2EE1A 2I0QA 1SYDA 3DWAA 1PTOC 4ZCKA 3T51B 1DOMA 3B6YA 3J7AF 4X65Q 3MTSA 5C0XI 4QQBX 3DWQA 4C3IB 3I4OA 3MXNA 2EPBA 3A7LA 1JQYD 1QCBD 4DR4Q 2K5QA 4DAMA 3F1ZA 4FF1A 4MN3A 1E1TA 1PFSA 4DV5Q 1JB3A 5KNCA 5C4JH 4P74A 4N9PA 3BS1A 1WD1A 2QEXA 1PH3A 1LTGD 1RDPD 1SE8A 3H3VH 1S5CD 4UY8C 1RCVD 3OPOA 1TY2A 3RMHA 1N32Q 2F3VA 3FRPB 4K0KQ 3NTHA 3PF5A 1M4VA 1VQ6A 5FLXL 3M4YA 2XNAC 4KMUC 2NTTA 4WJ3M 4GOPC 1KHIA 2UUCQ 1C0AA 3I4NG 1X54A 1Y14B 4KN7C 1QZHA 4IPDA 3VYTA 1X3EA 1E7ZA 4YWLA 3N6RA 1Z6HA 3PIPA 1NY4A 3PO3H 3I4MG 3JAML 2JEAI 1SE4A 1N36Q 3GP7A 1NTGA 2WACA 3NELA 2H4OA 1EQRA 2JXMB 3G4SA 2G5DA 4APVA 3DHQA 2F0OA 4WJ4A 3MXPA 5JJKA 3U58A 2F3WA 5J3BA 4QCLA 2WB1G 3NSWA 4QUCA 2MPMA 3W1GA 2F03A 1UAPA 4KD3A 1CFMA 4HIOA 5HURA 2ASBA 2EY2A 3RN5A 2Q2IA 4GKJL 2D0PA 2F0PA 4IUNA 4KY5A 4A3DG 4F87A 1CHPD 2F0MA 4C2MB 1FGBD 5ELFA 1OXVA 3CCJA 4DAVA 2OXPA 1TWHB 3I3CA 4GZYC 5IT9L 3SDZA 3S2DH 3RLNA 5D65A 2L4NA 2NVTH 1EUJA 1TIID 2A73B 5M5XH 2HHHL 2RHSB 1N34L 5LMNQ 4LK1C 2R7DA 3KYHC 5C0XH 3NXWA 2AMCB 2CH4W 2DY7A 1F2YA 4KKUA 5M3FG 1Q86C 2MJ8A 1H9MA 4ME5A 4BWGB 1AN8A 4DPGA 4E6IA 2CVRA 4C3HH 4ODGA 1OTCA 4J1MA 4LJZC 3LX0A 1CA6A 4PMCA 1I4GA 4A3EB 5IYBG 3HKSA 1VMCA 3K81C 4DK3C 2F4VL 1JT8A 1HH2P 2JQOA 2F0JA 3STBD 1A0IA 2NWGA 1XJVA 1ENAA 1PYBA 1FJGQ 3T13A 2QA4A 2VUMG 1UE6A 3D3RA 3WOFA 5AJ3L 5K5PA 5DM73 2LY7A 3OIQA 2AWNA 3KLSA 1WTWA 1PRTC 2KVMA 5DEHA 3FHWA 4A3FB 3U4VA 2O5IC 5FLMG 2ZTDA 1S5DD 4P73A 2PNHA 1VQHA 2B2TA 2K5WA 3NE5B 3I55A 4X3TA 1IYVA 3M4PA 3UE1A 3Q8DA 1R4PB 1Z7TA 3SXHA 3TEHB 4IFDG 1PFBA 3E3XA 4CDDC 1DOKA 1BKBA 5A35A 4HJ5A 3OHXC 5GAHC 2AKWB 4C3IH 1U4PA 2E74C 4YCVA 3TZDA 4GKKL 3KDFB 4KD4A 4JI1L 3FDTA 3W2DA 4IPCA 4JI5L 3PO2B 4R4CA 2UUAQ 2CHBD 2Z6KC 1IYJB 3F2BA 1SSOA 4DNTB 2RA4A 2MGSA 2RCFA 4HMIA 1KD1C 3EIVA 4J8QA 3TQYA 2O4XA 5LHY1 2R7ZB 1SXTA 1YHAA 2DN8A 2QDLA 1Y1VG 1I4XA 4HR7B 4JI2L 4YHHL 1EIHA 5CV8A 1EIYB 1JOQA 5IYCH 2J0TD 2UXDQ 1G2SA 4JI0L 1K83H 1HZ9A 1I50H 4X64Q 1V1OA 1BVSA 4G7OC 2K5NA 1VQGA 1ZEQX 4FVMA 2MQHA 2D0OA 2JP1A 4K8IA 1VQAA 4NW2A 4CBVA 4DXGA 2OQ0A 1I4RA 2JA8B 5ELBA 2CW0C 1E1OA 2PQEA 3A0JA 4R4TA 4AQYL 4V190 2A19A 4LFAQ 1G91A 5FO7B 4OO1I 3BZCA 3CKIB 1H9SA 2JA5B 1YHBA 2F0DA 4LF7L 1P16A 1HR0L 2K6AA 4C2MH 1U4MA 3HGBA 4BBRB 2KHJA 3NUCA 3I4LA 3CRLC 1XNRL 4IZ8A 3R8BA 1ESFA 1TWHH 3CCEA 4P2CB 4KN4C 1V43A 4OWWB 2N55A 2RF4A 1TWGB 2D2CC 4HJ9A 1NUCA 1LTBD 3A55A 1DONA 2A8VA 5IGBA 3HS0C 5LL6X 1QVFA 2KHIA 4NXMQ 3QOLA 1FNUA 1ZYRC 3PIO3 4DR3Q 3U9SA 1K73C 4B3SQ 1EIGA 3GV3A 2JA6B 1RF2D 1STHA 3T1YL 4GOPB 4XTCS 5LMUL 4A3EH 3S17B 2F3IA 3SR1A 2QDBA 4DV2Q 3PO3G 1I6HB 2ZJPA 3PUYA 3TRZA 5KIXA 1JICA 1JOOA 1VCIA 1T5EA 1L0XB 2DUDA 4A3BB 4LFCQ 3BDOA 4DR5L 4WJWA 2L5TA 4XT1B 3K0XA 3I72A 1MSHA 3K80C 2KOLA 2RBMA 2B2UC 4JI4L 3BZKA 1NE3A 4ALPA 1TWAB 3DXJC 2Y0SB 1ILQA 4A3FH 2WAQE 4JK1C
chains in the Genus database with same CATH topology
3HP3A 1SYGA 3V96A 1EY8A 1I4PA 1EQTA 3HOUB 2O2LD 3MA2B 1JOKA 4OO1H 3BYTB 2KCCA 3P20A 4HMJA 1OXTA 5C0XG 1SBBB 1SDFA 3TP5A 2A74C 2B2WC 3NK9A 2L55A 3A54A 3PUXA 5KNBA 2FMMA 4C3HG 1HCZA 2NBFA 2B63B 3SHLA 3D6CA 1Y8OB 1AFPA 2CQAA 3M7GA 1EWCA 5I6YA 3QOJA 1TR5A 5BN4A 4UDUC 1D1IA 1LT6D 2G9HD 2BOSA 2F0IA 3OIPA 4KJOA 5J1ZA 1XXGA 3KLSX 3C1EA 4O1NA 5F2DA 2HDMA 3MWYW 4BA1I 3MAQA 3M7NA 2F4IA 4QB4A 1WTPA 4OIKA 2NB0A 5C3WA 2BDOA 1BCPD 4IFDJ 5KNDA 2MP1A 1HRJA 3BZDB 4UAIA 4FF2A 4ZAIA 2NVXB 2Q8TA 4DA2A 1PTOH 3BG3A 1LTRD 1LTTD 2KA7A 2JEBI 2F0VA 3HOZB 1KLGD 3DWPA 4NP5A 1YNJC 2IL8A 2QF7A 3DEOA 2HUGA 3OW7A 3K57A 4FP5D 2EYPA 2BCOA 3HOYB 1X3PA 3TSSA 1HA6A 3T56B 4XT3B 3QB3A 1TWCB 3EFXD 1EL0A 1SE3A 4IUTA 1IKMA 2IX0A 5E1FA 3FPPA 2KECA 3K0YA 4XQQA 5BN5A 2SEBD 4KV6A 2M2LA 4CKBA 5JPNC 4C56C 5FO8B 2K32A 4A3IB 5BN3A 3I70A 1O7ZA 3D4DA 1IHZA 1II3A 1KTKA 4DGZA 1BDOA 4I65A 4ZK9B 3C46A 4Z9CB 3PMFA 3MFYA 4JBWA 2AQ3B 1Q1BA 2BA1A 1G291 1PTOF 5M5WB 4DAYA 4FNFA 3GTOB 2B8GA 3NWTA 5C6AA 3W3AA 2R93B 3R2IA 1DCZA 5J22A 1RKNA 3QO2A 1H9JA 2QEJC 5JPMC 1R9TB 3A8IE 2WAQB 2L1BA 1Z47A 4FXGC 4C3JB 2GA4B 1UUPA 1FYCA 2FJ2A 1G6ZA 3IFDA 2A69D 1AZQA 4CJ0B 4L63B 1O80A 1FNWA 1B1ZA 2X69A 4RHRA 4K5WA 3QIAA 2BA0A 2B2VA 4KI0A 2XIWA 2EYLA 1WTVA 4X3KA 1IL8A 3R3OA 2IPKD 5K36H 2DY8A 2F0EA 1AP0A 1GHKA 2LS01 2NN6I 5KRUA 4OHJA 1LTID 1F9PA 5IGFA 2I07B 1JORA 4OO1G 1SFOB 1PMRA 4B9WA 4DN4M 2ICIA 2RDGA 2V4DA 5JEAH 3S2HB 1A2TA 3GTMB 2EVBA 5I9OA 1Y8PB 2M9VA 1ENCA 4C1NI 1XWEA 5FKAC 1CHQD 1J9OA 4B9XA 1EY6A 4RA8A 4XDXA 5KEEA 2IX3A 3T4AC 1GJXA 4K5VA 3KF8A 2KEDA 3HEJA 3VA5A 5FOBB 4XIGS 3IFTA 4KKSA 3NTIA 4KTAA 5IIFA 4A3JB 5DNFA 4K14A 1CTMA 1V1PB 2NZ1D 2L11A 3HOXB 3PUVA 4RHSA 3H0GB 3TDQA 2JSOA 3F2UA 1K83B 1I50B 4KY6A 4FF3A 3OWFA 2DNEA 3NPPA 4FYDA 3A8JE 1HTLD 1CQVA 2E2HB 3GTQB 1IW7D 1S5ED 3E6ZX 3AU7A 1OO9B 2WINB 4RKBA 5IGCA 2NN6H 1CZWA 4XYOA 1GHJA 1B2TA 4M1UB 3ITPA 4KK7A 3M3YB 4PMWA 4EQPA 3S14B 1NSNS 1TVXA 5C5LA 4DAPA 1H9KA 1CK1A 5CV5A 1LT4D 4OGQC 1MGSA 3I8ZA 3VYSA 1F9QA 1A3TA 1QOHA 3MXUA 1CQFA 1EZ6A 2C9OA 5E4WC 1JWSD 4QF4A 2KEEA 5I4DA 4CJ1B 1TQOA 4QIWB 4OL7A 3ND9A 2TMPA 1SYCA 1HUNA 3VA7A 1ET9A 2J4XA 3HOWB 2HDLA 2SDFA 2XRSD 5TSSA 1SNDA 5M3MB 5EBCA 4QUFA 1STEA 5CV6A 3X3MA 3CHBD 1LT5D 3HZXA 2B2YA 3CRKC 4HN7A 5A2QE 4LMQD 1E2ZA 2RKSA 2AWOA 2PW7A 3H94A 2PPBC 5IGEA 2EY5A 4H44C 1DXMA 4A3KB 2F0QA 4ILWA 3V05A 3IL8A 5G3LF 4HSPA 2EYFA 1BF4A 1BR9A 3NTKA 5E3FA 2XN9C 1X3QA 5I9PA 3EJIA 1STNA 1SYFA 2XWJB 3C3LA 3VR4A 4IUPA 2RVLA 3A7AB 2AQ1B 4RGNA 2BDNA 3S16B 3J81E 1SMYD 5CMDA 2QKIC 5K36G 2ICEC 1F9SA 4K6LA 1EY4A 2EDGA 1OXUA 1JR0D 5JJZA 3R93A 3MEHA 2PCFB 3MHBA 2XWBB 4IALA 5J39A 4EVOA 1W6KA 5C3XA 1FNVA 3TP6A 1MD2D 4K2KA 5JEAG 2KHSA 4K2LA 1RHPA 4TSSA 1C8CA 1V1PA 5C4ZA 2RSOA 4F8MA 1STBA 1GXDC 1PYWD 2NVQB 4BS9A 1KABA 1QG7A 1PTOB 2O5JC 3Q24A 4CJ2C 2R61A 4S3SA 5I6WA 1SNMA 4PNYA 1ILPA 4XYQA 3DUZA 5ISRA 2L9HA 4PV1C 2A68D 1QWYA 1K8OA 4QMGA 3E0JA 1EU3A 2QCPX 4L6TB 2IT1A 1TS5A 1GUOA 2EYHA 4BY1B 1BCPC 1C4QA 2KJXA 2WKDA 3MXGA 4G7ZC 4YIJA 3Q22A 1D1KA 1AW7A 3PUWA 3LNNA 4OIJA 1R4QB 4K5XA 4AYBB 3MFGA 2E2IB 1LO5D 1Q8IA 3HRZC 1CA5A 3GV6A 3J80E 5CV7A 4CGYB 5COYA 3K6OA 1L0YB 2A5HA 2F0KA 2IWHA 2Z1CA 1STAA 3H91A 1Y1WB 3D4RA 3PUZA 2B2TC 4ZLTF 1QB5D 1NR4A 1HXYD 5FLXE 5IGGA 2F1MA 5FK9C 2ZXPA 3ONAB 2PZUA 3J7YW 4KHVA 1F2ZA 1EFID 1F77A 1Q3LA 1M8AA 1STGA 4F88A 3NQTA 2HCIA 1HFGA 3FMCA 2A6HD 1DM0B 4ID6A 2HQEA 1RD9D 1SNCA 2K04A 1B9MA 3BVZA 1ET6A 4CHTB 2JA7B 2K05A 5EPKA 3Q23A 3NQIA 1EOTA 4HCEA 1PZID 4DNRB 2EY1A 3EA6A 3L9AX 1K8MA 1Q12A 3EQLC 4XXEA 1TU2B 3D31A 1ZKOA 4PQXA 1O7LA 1EEID 4IUQA 3IKJA 3K5NA 2E2JB 1FD7D 3P75A 2OT2A 1PRTB 4B08A 3U9OA 1B50A 1WVLA 4RH6A 3K7AB 4NMZA 4H7BA 4J6HA 4WRDA 2A69C 4C3IG 3BYYB 1YNND 4XQJA 1EU4A 1PZJD 3FEWX 5KYIA 1JWMD 1D6EC 1QJOA 1S5BD 1SNOA 3OMCA 3GTGB 1BBXC 5M5YB 1QNUA 2IW3A 1KNAA 3OOCA 3R2TA 1LTSD 1BO0A 3M85A 3WDNA 1EY5A 2XSCA 4FXKC 1KDAA 3HOVB 2EJGC 2PMZB 1JWUD 5JEAJ 1DOLA 2D9UA 5M9OA 1SNQA 2EYMA 2QILA 3KLRA 3J7AV 1DD2A 4Y7NB 3RZOB 1H9RA 3SEBA 1HFNA 4U68A 4FF4A 2K03A 3H09A 1LABA 2E2DC 3SE0A 2EJFC 1STYA 1PDQA 3TBIB 2RQXA 4CKCA 1FR3A 2EYOA 1BCPB 1WTRA 2EJMA 1GUGA 3S1MB 1IW7C 2PZTA 3H6MA 2PNRC 2G9DA 1EY0A 2F0WA 2PW5A 1A2UA 3K5MA 2K33A 3G6JB 3RD4A 3FPUB 1GOZA 5EBDA 1WCMB 1LACA 4WORA 2EOTA 5CYUA 2FINB 2VB3X 1VF5C 1XTCD 5ELCA 5I2YA 1A3VA 5C4XB 5D14A 2BE5D 1GUTA 2N88A 1SE2A 1BNZA 4R8NA 3FVQA 2I46A 5C44B 4HSVA 3PIP3 1LV9A 5C0XJ 2D5DA 2X6GA 3SK5A 3E5SA 3S15B 3N52A 3DEPA 2F0UA 5EJWA 1EEFD 1D5MC 1HTPA 3K5LA 1I6VC 4RGTA 1SAPA 4BBSB 2KQ3A 2M00A 1TY0A 2XVSA 2Z4HA 4IN3A 2PYKA 1GUNA 3T53B 1TWFB 2L12A 5NUCA 3RLFA 3A8KE 3DMUA 3J80L 1D5XC 2WP8J 2JYOA 3FKIB 3RZDB 3O13A 5KGUA 2IX1A 1LLRD 1VDZA 3EROA 5CV9A 2HCCA 3SK8A 1BXTA 2YU9B 1PRTF 5JVG3 2H1EA 2NVYB 2LFNA 2F0FA 1H9SB 1PFNA 3CU7A 3PV0A 4HAEA 4L8JA 5IGDA 4MHEA 2C5CA 4ZRZA 1SMYC 3GTKB 4N9TA 1G2TA 4LAAA 2PZWA 1Y8NB 3K58A 2A6ED 5ELEA 2MUYA 3S1NB 1CI3M 1U9RA 1ML0D 4IQZA 3V2TA 1X32A 4O42A 5CORA 1Q90A 3C1FA 4ZKCB 3GTJB 4RGOS 3L7ZC 4K6DA 2VNUD 1G8ZD 1EWHA 3VR3A 1B53A 4H0LC 3BVGA 2ID0A 3K59A 2SNMA 3NP8A 1C48A 2B2VC 5EGTA 3GTLB 2J7ZA 4NKLA 2A68C 2WIIB 4C1NK 3M4OB 3GTPB 5C4HA 2Z4IA 2EY6A 5C3EB 2AUJD 1B4OA 1PTOD 2ZXRA 1PXUA 3VR6A 1RODA 5HGTA 4A3MB 1RJTA 1A6XA 1Y69U 4R8IA 1JE4A 2Z8LA 3I73A 4PMBA 1TKWB 1V8QA 5CC4A 3EVQA 1SJED 2B2UA 1TT2A 2R92B 5I2XA 3T16A 1XYIA 5EKLA 1ZXTA 1TS2A 3RUZA 1SYEA 1BCPF 2X6LA 1PFMA 2VB2X 1WTXA 4RKLA 3L3OC 5EQ0A 1B3AA 3URYA 1Q1EA 3K5OA 3OWEB 1WD0A 4DU9A 1BUVT 3ERQA 4ZQ3A 5IOCA 2E75C 2B2WA 2YYZA 3GO5A 4V0BA 1QILA 2KCNA 1MI2A 1DYQA 1PZKD 4I7ZC 3H3VC 1B44D 1HQRD 1DJRD 2FMCA 5D3DA 4TKOB 3SK4A 2A6HC 1O7YA 3BDCA 1W6JA 5D3IB 4FO2A 4DXFA 2LKVA 3KK7A 1I3QB 1AZPA 1LT3D 2Q8RE 1HQMC 1NCVA 2F0TA 3I4NB 5E4XA 3X3NA 4G7HC 1GUSA 3LWEA 2F0GA 4IUVA 1CZGA 3NBIA 3BVMA 4BA2I 3I4MB 3Q6SA 1A3UA 4XQNA 1UEAB 2ZXOA 2WB1B 1HUMA 3D6WA 4MIUA 1I4HA 2F0SA 5DM63 4EGVA 3GQBA 4A3DB 1MBYA 5LL6S 3G7LA 1WTOA 1EY7A 1YNNC 5T1GA 2NYZD 1D5ZC 2K01A 4RCOA 1S5FD 2L0CA 1PRTD 1JCKB 4BY7B 3ND8A 4IURA 1GUWA 1ESRA 2NN6G 2B2YC 1B9NA 5JAVA 1PLFA 5M3FB 3ZYYX 3MVVA 3MZ5A 2B8FA 1DZ1A 2AUKA 2F0LA 5EKIA 2FHTA 1E2VA 3KBGA 3NWSA 4CKEA 4ZKBB 2OEOA 1SYBA 1CT1D 1E0BA 4ABNA 1UNSA 1EYAA 4A3GB 2VUMB 4C3JG 3JAME 3DM1A 3CQZB 4F7XA 2NTSA 5FO9B 4KHZA 3TN2A 2RSNA 3P7JA 4ULLA 1U4RA 1WTQA 4EQNA 1EYCA 4ZYSA 2RDFA 3A56A 1S4ZA 2WKCA 4DF7A 3GD7A 3KUPA 2ENBA 1IYUA 3P1HA 4FXDA 1SJHD 2CW0D 1VF7A 3MC0B 1QNKA 5IT9E 4TQUS 5CBAE 4K8JA 1KLUD 3S1QB 3I90A 2MHVA 4RCNA 4RGMA 4H13C 4ZUIA 3IAYA 4KY7A 5KYLA 5CBEE 4A93B 1EYDA 1ONLA 1KDCA 3S9WA 3TP7A 1Y1VB 2SNSA 5G3LD 4R9WA 1BQQT 3OMGA 4KJNA 1HHVA 2F0HA 2EZVA 3NBHA 5C5MA 3S1RB 4G4KA 3WOEA 4HTHA 1NR2A 2Q8IB 1LTAD 1U4LA 3VYRA 4EQOA 1RTOA 1ZYRD 2NUCA 4U673 5EPLA 4NDXA 2D62A 1IKLA 2R3ZA 2BE5C 3QJYA 2F0NA 1KDBA 4IFDI 4DFAA 1JC7A 4Q0FA 1BOSA 1TS3A 2E76C 1HPCA 3BDLA 3VR5A 4DK0A 2JE6I 2ZT9C 3AMUA 1VMPA 3UI2A 2K7VA 1AEXA 5C4JB 1EQVA 1ICWA 4IUUA 2PO4A 1SNPA 3VYUA 5EPJA 3SVMA 5A2QL 4X3UA 2VXWA 3TMEA 1F2LA 5IODA 1F9RA 5JOBA 1D2BA 3LWUA 1KAAA 3PO3B 2DNCA 3NHHA 2K28A 4KKTA 1RTNA 3TP8A 2FFKB 1TS4A 2KUMA 5ELDA 3TZUA 2B39A 4ZUJA 3Q0AA 1CM9A 2LMCB 3J81L 4HCSA 4RAUC 1J8IA 5AFWA 3D4WA 3S2DB 3I91A 1QE6A 2EXZA 2R6GA 2NVTB 4IFDH 2SOBA 2EYJA 4DK1A 1HA5A 5M5XB 2AQ2B 4TRDA 3OSOA 1T5XD 1O78A 1EY9A 1OXXK 3AB9A 1F2MA 1MSGA 2K5DA 5EKKA 1OXSC 5JVH3 5T1IA 4RFBA 2A6EC 1I4QA 4G57A 5CGKA 1SEBD 4C3HB 3HKZB 2TSSA 1XX8A 1ENFA 4WFN3 2RDHA 4M8AA 5CR3A 3VR2A 3SK6A 3D8GA 1EZ8A 4RWSC 1KNEA 3QWNA 4Q5VA 2K1BA 2WV6D 1YNJD 5DAUA 1NAPA 3C2PA 2OF1A 2IJ0A 2XRQD 1A15A 5CV4A 3QG1A 4HEDA 3HG9A 3KBXA 1E2WA 2EE1A 1SYDA 3DWAA 1PTOC 3T51B 1DOMA 3J7AF 3MTSA 5C0XI 3DWQA 4C3IB 3MXNA 2EPBA 3A7LA 1JQYD 1QCBD 2K5QA 4FF1A 4MN3A 1JB3A 5KNCA 4N9PA 3BS1A 1WD1A 1LTGD 1RDPD 1S5CD 1RCVD 3OPOA 1TY2A 3RMHA 2F3VA 3FRPB 3NTHA 1M4VA 5FLXL 3M4YA 2XNAC 4KMUC 2NTTA 4KN7C 3VYTA 3N6RA 1Z6HA 3JAML 2JEAI 1SE4A 3GP7A 2WACA 2H4OA 2JXMB 3DHQA 2F0OA 3MXPA 2F3WA 4QCLA 3NSWA 4QUCA 2MPMA 2F03A 1UAPA 4KD3A 1CFMA 5HURA 2EY2A 2F0PA 4IUNA 4KY5A 4F87A 1CHPD 2F0MA 4C2MB 1FGBD 5ELFA 1OXVA 4DAVA 2OXPA 1TWHB 3I3CA 4GZYC 5IT9L 3SDZA 5D65A 2L4NA 1TIID 2A73B 4LK1C 5C0XH 3NXWA 2DY7A 1F2YA 4KKUA 2MJ8A 1H9MA 4ME5A 4BWGB 1AN8A 4E6IA 2CVRA 4ODGA 4J1MA 4LJZC 3LX0A 1CA6A 4PMCA 1I4GA 4A3EB 1VMCA 2F0JA 2NWGA 1ENAA 3T13A 3D3RA 3WOFA 5K5PA 5DM73 2LY7A 3OIQA 2AWNA 3KLSA 1WTWA 1PRTC 2KVMA 5DEHA 4A3FB 2O5IC 1S5DD 2B2TA 2K5WA 3NE5B 4X3TA 1IYVA 1R4PB 1Z7TA 3SXHA 4IFDG 1PFBA 1DOKA 5A35A 3OHXC 1U4PA 2E74C 3TZDA 4KD4A 3FDTA 3W2DA 3PO2B 2CHBD 1SSOA 4DNTB 2RA4A 2MGSA 4HMIA 4J8QA 2O4XA 5LHY1 2R7ZB 1SXTA 2DN8A 1I4XA 4HR7B 1EIHA 5CV8A 1JOQA 2J0TD 1G2SA 1V1OA 4G7OC 1ZEQX 4FVMA 4K8IA 2JP1A 4NW2A 4CBVA 4DXGA 1I4RA 2JA8B 5ELBA 2CW0C 2PQEA 4V190 1G91A 5FO7B 4OO1I 3CKIB 1H9SA 2JA5B 2F0DA 2K6AA 1U4MA 3HGBA 4BBRB 3NUCA 3I4LA 3CRLC 4IZ8A 3R8BA 1ESFA 4P2CB 4KN4C 1V43A 2N55A 1TWGB 2D2CC 1NUCA 1LTBD 3A55A 1DONA 5IGBA 3HS0C 5LL6X 3QOLA 1FNUA 1ZYRC 3PIO3 3U9SA 1EIGA 3GV3A 2JA6B 1RF2D 1STHA 4XTCS 3S17B 3SR1A 2QDBA 1I6HB 3PUYA 5KIXA 1JICA 1JOOA 1VCIA 1T5EA 1L0XB 4A3BB 3BDOA 4WJWA 2L5TA 4XT1B 3I72A 1MSHA 2KOLA 2RBMA 2B2UC 1TWAB 3DXJC 2Y0SB 1ILQA 4X3SA 4JK1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1H A;  4NP5 A;  1SYG A;  5HGT A;  1JOQ A;  4K5W A;  4NMZ A;  5KGU A;  4RKB A;  4H7B A;  1A3U A;  5IGC A;  2EYO A;  4J6H A;  5CV4 A;  5JOB A;  1EY8 A;  4WRD A;  2EYL A;  3NXW A;  5E3F A;  3ERO A;  5CV9 A;  5CV7 A;  3SK8 A;  1F2Y A;  2EYP A;  3R3O A;  3ITP A;  5I9P A;  3EJI A;  1KAA A;  1JOK A;  1STN A;  1SYD A;  1SYF A;  2F0E A;  2PZT A;  3H6M A;  4ME5 A;  4EQP A;  4MIU A;  1NSN S;  3NHH A;  4K8I A;  4E6I A;  2F0S A;  4K8J A;  3EVQ A;  5CC4 A;  4ODG A;  3TP8 A;  1EY0 A;  1TT2 A;  2F0W A;  2PQE A;  2PW5 A;  4HMJ A;  4J1M A;  2F0K A;  1A2U A;  3LX0 A;  5C5L A;  5KRU A;  3TP5 A;  5KYI A;  3QB3 A;  1STA A;  3T16 A;  4PMC A;  5CV5 A;  5IGF A;  1EY7 A;  2F0F A;  1JOR A;  5EKL A;  3NK9 A;  4ZUI A;  1EY4 A;  3RUZ A;  1SYE A;  4WOR A;  5E1F A;  4KY7 A;  4ZUJ A;  5KYL A;  5IGD A;  2F0D A;  4N9P A;  3SHL A;  3D6C A;  4B9W A;  1EYD A;  1SNO A;  1KDC A;  2F0J A;  3OMC A;  3TP7 A;  3S9W A;  3MEH A;  3MHB A;  4KV6 A;  4RKL A;  5IGG A;  4IAL A;  1A3T A;  1ENA A;  2SNS A;  5J39 A;  3T13 A;  1EZ6 A;  3NUC A;  3OMG A;  4KJN A;  4EVO A;  2F0H A;  2F3V A;  5C3X A;  4IZ8 A;  1A2T A;  4QF4 A;  5C5M A;  4N9T A;  5I9O A;  2PZU A;  3TP6 A;  1A3V A;  1ENC A;  1TQO A;  3D4D A;  5K5P A;  4KHV A;  4LAA A;  1IHZ A;  1II3 A;  3D4W A;  1TR5 A;  1F2Z A;  3ERQ A;  3QOJ A;  4HTH A;  4OL7 A;  2PZW A;  4K2K A;  4ZQ3 A;  4DGZ A;  5IOC A;  5JAV A;  1SYC A;  2EXZ A;  4I65 A;  1STG A;  5DEH A;  2KHS A;  2SOB A;  3NQT A;  4K2L A;  4B9X A;  4EQO A;  2F0I A;  1EY6 A;  2EYJ A;  2NUC A;  3PMF A;  4R8N A;  1U9R A;  1EY5 A;  4KJO A;  5J1Z A;  3V2T A;  5KEE A;  1NUC A;  4TRD A;  3OSO A;  1SND A;  1KDA A;  3MVV A;  3MZ5 A;  4ID6 A;  1EY9 A;  4NDX A;  5C4Z A;  5IGB A;  4F8M A;  2HQE A;  2F0L A;  3C1E A;  1F2M A;  5M9O A;  1SNC A;  3SXH A;  1STB A;  5EKK A;  1SNQ A;  3SK5 A;  4K5V A;  5F2D A;  2F0N A;  3E5S A;  1KDB A;  1KAB A;  2EYM A;  4DFA A;  3HEJ A;  3VA5 A;  3C1F A;  4G57 A;  5CGK A;  3BDL A;  3QOL A;  5CV6 A;  2OEO A;  1SYB A;  2WAC A;  4K6D A;  4S3S A;  5I6Y A;  5I6W A;  1SNM A;  4QB4 A;  4PNY A;  3SK4 A;  3HZX A;  5C6A A;  3DHQ A;  4KTA A;  1STH A;  5C3W A;  2F0U A;  2F0O A;  5IIF A;  5ISR A;  3MXP A;  3BDC A;  2F3W A;  5J22 A;  1RKN A;  2RKS A;  4K14 A;  1EYA A;  2QDB A;  3SR1 A;  2PW7 A;  5CR3 A;  4KD4 A;  5KIX A;  4QMG A;  2SNM A;  1JOO A;  4KD3 A;  3NP8 A;  4DU9 A;  3SK6 A;  2EY1 A;  5HUR A;  2EY2 A;  5IGE A;  1AEX A;  2F0P A;  3D8G A;  2LKV A;  1EQV A;  1EZ8 A;  2EY5 A;  5EGT A;  4F7X A;  4IUN A;  4KY5 A;  4KY6 A;  1SNP A;  2KQ3 A;  2F0M A;  2EYH A;  2M00 A;  4PMB A;  2F0T A;  2F0Q A;  2PYK A;  3OWF A;  4NKL A;  5DAU A;  4EQN A;  2OXP A;  1EYC A;  2RBM A;  2RDF A;  4HMI A;  4YIJ A;  5NUC A;  3P75 A;  2O4X A;  2F0V A;  3DMU A;  5C4H A;  2F0G A;  2EY6 A;  3U9O A;  3TME A;  2EYF A;  2OF1 A;  5IOD A;  4K5X A;  4DF7 A;  1STY A;  2ENB A;  5CV8 A; 
#chains in the Genus database with same CATH topology
 1KAW A;  3HP3 A;  1SYG A;  1CKM A;  2Z0S A;  3V96 A;  2EQS A;  3CPF A;  1WI5 A;  1EY8 A;  1I4P A;  1EQT A;  3HOU B;  1IBK Q;  2O2L D;  3MA2 B;  3K7U C;  1JOK A;  4OO1 H;  3HKZ E;  3BYT B;  3J81 j;  2KCC A;  3P20 A;  4HMJ A;  1KIX A;  1OXT A;  5C0X G;  1SBB B;  1SDF A;  3TP5 A;  2A74 C;  2B2W C;  2CH4 A;  2UXC L;  1YIT A;  5JJL A;  3NK9 A;  2L55 A;  4KHP L;  3A54 A;  3PUX A;  5KNB A;  2B29 A;  2FMM A;  4LW1 A;  4C3H G;  1HCZ A;  2NBF A;  3OYY A;  2B63 B;  3PO2 H;  4EX5 A;  3SHL A;  3D6C A;  1Y8O B;  1AFP A;  2CQA A;  4GNX B;  3G48 A;  3CCM A;  3M7G A;  1WTH A;  4LF5 L;  1ASZ A;  1EWC A;  5I6Y A;  3QOJ A;  4X66 Q;  5C44 G;  1TR5 A;  5BN4 A;  4UDU C;  1D1I A;  2VS1 A;  1LT6 D;  2G9H D;  2BOS A;  4FDB A;  2F0I A;  3OIP A;  1J6Q A;  3KOJ A;  4KJO A;  5J1Z A;  1XXG A;  3GDE A;  3KF6 B;  3KLS X;  3KDF A;  3RLO A;  1BBW A;  3C1E A;  4O1N A;  5F2D A;  2HDM A;  5IP9 H;  3MWY W;  4LF8 Q;  5IWA Q;  4BA1 I;  3KJO A;  3E9H A;  3MAQ A;  4B3T L;  3M7N A;  2F4I A;  2JA8 H;  4QB4 A;  1WTP A;  4OIK A;  2NB0 A;  5C3W A;  3ERS X;  4HIK A;  2BDO A;  1Q46 A;  1BCP D;  2GVB A;  4BBS G;  4IFD J;  5KND A;  2MP1 A;  1HRJ A;  1VQN A;  4Y52 H;  3BZD B;  1X9N A;  4UAI A;  4FF2 A;  2JA5 H;  1L1O A;  4ZAI A;  2NVX B;  2Q8T A;  4DA2 A;  4BBR H;  1PTO H;  3BG3 A;  1LTR D;  1LTT D;  2KA7 A;  2JEB I;  2F0V A;  4ME3 A;  3HOZ B;  1KLG D;  1SN8 A;  3DWP A;  1TWG H;  5ELO A;  4NP5 A;  1YNJ C;  2IL8 A;  2VQF Q;  2QF7 A;  3DEO A;  2ZJQ A;  2HUG A;  3OW7 A;  3K57 A;  1VQD A;  4JI8 Q;  3UDG A;  4FP5 D;  2NZO A;  2EYP A;  4DR6 Q;  2BCO A;  3U4Z A;  3HOY B;  1X3P A;  3TSS A;  5IYC G;  3H15 A;  1VQF A;  4DV4 Q;  1HA6 A;  1QVC A;  3T56 B;  4XT3 B;  3QB3 A;  2Q2U A;  1VQ5 A;  4EQ5 A;  1KC8 C;  4OON A;  3M9B A;  3S17 H;  1TWC B;  1JMC A;  1QUQ B;  1I6H H;  5FLX c;  3EFX D;  1XMQ Q;  1EL0 A;  4OX9 Q;  1SE3 A;  4IUT A;  1IKM A;  2IX0 A;  5E1F A;  3FPP A;  4JI7 L;  2KEC A;  2L15 A;  3K0Y A;  4XQQ A;  5GAE C;  1WJJ A;  5BN5 A;  4A3B H;  2SEB D;  4DR7 L;  1S3O A;  4KV6 A;  2M2L A;  3HFZ B;  4CKB A;  1E24 A;  1LTL A;  5JPN C;  4C56 C;  3CF5 A;  3T1H Q;  5FO8 B;  4DV7 Q;  2K32 A;  5LMN W;  4A3I B;  2XGT A;  5BN3 A;  3I70 A;  1O7Z A;  3D4D A;  3JAM c;  1IHZ A;  1II3 A;  1TWA H;  1KTK A;  3I56 A;  4DGZ A;  2CWA A;  4NB3 A;  1BDO A;  4I65 A;  3ICE A;  4ZK9 B;  3C46 A;  4DKA C;  4Z9C B;  1GKH A;  3PMF A;  1NMG A;  1G51 A;  3MFY A;  4JBW A;  2AQ3 B;  1Q1B A;  2ZTC A;  2BA1 A;  1G29 1;  1PTO F;  5M5W B;  4JCV E;  2CFM A;  3HOU H;  4DAY A;  4FNF A;  3GTO B;  2B8G A;  2PQA B;  4DV0 L;  4QIW E;  3NWT A;  2KBN A;  5C6A A;  3W3A A;  2R93 B;  5FJ8 H;  3R2I A;  5ELN A;  3PF4 A;  1B8A A;  1DCZ A;  5J22 A;  1RKN A;  3QO2 A;  5IT9 c;  3CCU A;  4YWK A;  1H9J A;  4LUO A;  2QEJ C;  5JPM C;  1XPR A;  1R9T B;  2B63 H;  3A8I E;  2WAQ B;  2MO1 A;  1MJC A;  2L1B A;  1Z47 A;  4AH6 A;  5C3E G;  4FXG C;  4C3J B;  2GA4 B;  1UUP A;  1FYC A;  1GO3 E;  4A3M G;  2FJ2 A;  1G6Z A;  3IFD A;  2A69 D;  3CPW A;  3F8T A;  1AZQ A;  4DK6 C;  4CJ0 B;  5IYD H;  4YY3 Q;  4L63 B;  3CC4 A;  1O80 A;  1FNW A;  1YNX A;  1B1Z A;  1YZ6 A;  2N78 A;  2X69 A;  2BH2 A;  4DR4 L;  4RHR A;  4K5W A;  3QIA A;  1JB7 A;  3PSI A;  2BA0 A;  2B2V A;  4KI0 A;  2XIW A;  2EYL A;  1WTV A;  1SRO A;  4X3K A;  1IL8 A;  3R3O A;  3RR5 A;  2IPK D;  4JPB W;  4UHV A;  5K36 H;  2HT1 A;  2DY8 A;  4GNX A;  2F0E A;  1AP0 A;  3CC2 A;  1GHK A;  2E2J H;  2LS0 1;  4K0K L;  2A1A A;  2NN6 I;  5KRU A;  4OHJ A;  1LTI D;  5L37 A;  1F9P A;  1CKN B;  5IGF A;  1EWI A;  1MHW C;  2I07 B;  1JOR A;  4OO1 G;  2K50 A;  1SFO B;  1PMR A;  3KF6 A;  4B9W A;  2NVX H;  4DN4 M;  2ICI A;  4IPH A;  2RDG A;  2V4D A;  5HGQ A;  5JEA H;  1UE5 A;  3S2H B;  1A2T A;  4DR2 Q;  3GTM B;  2EVB A;  5I9O A;  1XTD A;  1Y8P B;  2M9V A;  3PO2 G;  4B3R Q;  1ENC A;  1N36 L;  4C1N I;  1X55 A;  1XWE A;  3JAM i;  3PQI A;  5FKA C;  3HOZ H;  1CHQ D;  1J9O A;  3STB C;  4B9X A;  1EY6 A;  4RA8 A;  1X3F A;  4XDX A;  2KCM A;  5KEE A;  2IX3 A;  2R7Z G;  3T4A C;  1GJX A;  1PVO A;  4K5V A;  3KF8 A;  2KED A;  3HEJ A;  3VA5 A;  5FOB B;  3HOY H;  2FXQ A;  4XIG S;  2GVA A;  3IFT A;  4KKS A;  3NTI A;  4KTA A;  4JVZ A;  5IIF A;  4A3J B;  1I94 Q;  4R4O A;  5DNF A;  1TWC H;  4K14 A;  1CTM A;  1FGU A;  1V1P B;  2NZ1 D;  2L11 A;  3HOX B;  3PUV A;  4A3C G;  1HNX Q;  2JA8 G;  4RHS A;  3H0G B;  3TDQ A;  2JSO A;  5LMN L;  3F2U A;  1K83 B;  1I50 B;  4KY6 A;  1VQ9 A;  3NEM A;  1GD7 A;  1VQB A;  4FF3 A;  3OWF A;  2DNE A;  1X6O A;  2NZH A;  3NPP A;  4A3I H;  4FYD A;  2JA5 G;  3A8J E;  1HTL D;  1CQV A;  2E2H B;  4Y7N H;  4JYA Q;  3GTQ B;  2QGQ A;  3UDF A;  1V9P A;  1IW7 D;  1S5E D;  3E6Z X;  4BBR G;  2ZTE A;  3AU7 A;  1OO9 B;  1C7Y A;  1QUQ A;  2WIN B;  1PH2 A;  4RKB A;  5IGC A;  2NN6 H;  1CZW A;  4XYO A;  5M5W H;  1GHJ A;  2ALY B;  1B2T A;  5BR8 Q;  2N49 A;  3GTO H;  4M1U B;  3ITP A;  4KK7 A;  2K75 A;  4BXX H;  3M3Y B;  4PMW A;  1AE3 A;  3EN2 A;  4EQP A;  1FJG L;  4P75 A;  3S14 B;  1NSN S;  3RNU A;  2I5L X;  1PH8 A;  1WFQ A;  2IHE A;  1TVX A;  5C5L A;  4DAP A;  1H9K A;  4P72 A;  2R93 H;  1CK1 A;  4AYB E;  5CV5 A;  1LT4 D;  4OGQ C;  1MGS A;  3I8Z A;  3AFP A;  4BY7 G;  4YCW A;  1R9T H;  2K4K A;  2JA6 G;  3VYS A;  1F9Q A;  1A3T A;  1QOH A;  3MXU A;  1CQF A;  1EZ6 A;  4C3J H;  2C9O A;  5E4W C;  4UP8 A;  1JWS D;  4B3M L;  4I7A A;  4QF4 A;  1IZ6 A;  2KEE A;  3AFQ A;  2Y0S E;  1YEZ A;  1HNW Q;  5I4D A;  4CJ1 B;  1TQO A;  4QIW B;  4OL7 A;  3ND9 A;  1L2F A;  2TMP A;  4N8X 1;  1SYC A;  1HUN A;  3VA7 A;  1ET9 A;  2J4X A;  3HOW B;  2HDL A;  2SDF A;  2XRS D;  4O0A A;  4X62 Q;  5TSS A;  1SND A;  4DUZ L;  5M3M B;  1IL2 A;  2Y0S G;  5EBC A;  3CW2 C;  2UUA L;  2CQO A;  4MTK A;  4QUF A;  1STE A;  3CME A;  1VQ7 A;  4A3G G;  2QW7 A;  5CV6 A;  3X3M A;  2Z6B A;  3CHB D;  1LT5 D;  4DV3 Q;  3HZX A;  1HNZ Q;  1JJG A;  2B2Y A;  3CRK C;  3HOU G;  1VQC A;  4HN7 A;  3CAM A;  5A2Q E;  4LMQ D;  1E2Z A;  2RKS A;  5H1S E;  4GKJ Q;  2AWO A;  3W5O A;  2PW7 A;  3H94 A;  1I5F A;  2PPB C;  5IGE A;  1SFO H;  2LSS A;  2EY5 A;  1KL9 A;  1X56 A;  5FJ8 G;  4H44 C;  1DXM A;  4A3K B;  4X64 L;  3S15 H;  2F0Q A;  3S2H H;  4ILW A;  3V05 A;  3OTO Q;  3GTM H;  3IL8 A;  2B63 G;  5G3L F;  2VL6 A;  4HSP A;  5IY0 A;  2EYF A;  4NXN L;  1HZB A;  1CKN A;  4L5T A;  1BF4 A;  1BR9 A;  3NTK A;  1V1Q A;  5IYD G;  5E3F A;  2YV5 A;  2XN9 C;  1X3Q A;  2R7F A;  5I9P A;  3EJI A;  4L5Q A;  1STN A;  1SYF A;  2XWJ B;  3C3L A;  3J7A 5;  3VR4 A;  4MZ9 A;  2ZM6 Q;  4IUP A;  2RVL A;  3A7A B;  2AQ1 B;  4RGN A;  4IJL A;  4A93 G;  4A76 A;  2BDN A;  3S16 B;  4A3J H;  1FVI A;  3J81 E;  2F52 A;  1SMY D;  5CMD A;  1K9M C;  2QKI C;  5K36 G;  2ICE C;  1F9S A;  4K6L A;  1EY4 A;  2EDG A;  3A5U A;  3HOX H;  1OXU A;  3H0G H;  1JR0 D;  4A3L G;  5JJZ A;  3R93 A;  3MEH A;  2PCF B;  3MHB A;  2XWB B;  4IAL A;  1D7Q A;  5J39 A;  5AJ3 Q;  2AHO B;  2BH8 A;  4EVO A;  1W6K A;  5C3X A;  3CCR A;  1FNV A;  4A75 A;  3TP6 A;  4MTN A;  2E2H H;  4DR3 L;  3F2D A;  3GTQ H;  1MD2 D;  4K2K A;  5JEA G;  1N33 L;  2KHS A;  4K2L A;  1S40 A;  1RHP A;  4DV1 L;  4TSS A;  4DV2 L;  2UXB L;  1C8C A;  1V1P A;  2ES2 A;  5C4Z A;  2RSO A;  4F8M A;  3HOZ G;  1STB A;  1GXD C;  1PYW D;  2NVQ B;  2HIV A;  1KAB A;  1QG7 A;  4BS9 A;  1PTO B;  3M3Y H;  3Q24 A;  4CJ2 C;  2O5J C;  3S14 H;  2R61 A;  4S3S A;  5I6W A;  1SNM A;  4PNY A;  1ILP A;  4XYQ A;  3DUZ A;  5ISR A;  4JI1 Q;  2L9H A;  1N8R C;  4JI5 Q;  4PV1 C;  2A68 D;  1QWY A;  4JV5 L;  1K8O A;  4QMG A;  3E0J A;  1EU3 A;  2QCP X;  4UPA A;  4L6T B;  1EIF A;  1CKO A;  4KLK A;  2IT1 A;  1TS5 A;  1GUO A;  4LF6 Q;  2EYH A;  4BY1 B;  1BCP C;  1C4Q A;  4LF4 L;  1IBK L;  3GTJ H;  2EIF A;  2KJX A;  2WKD A;  1PH5 A;  3MXG A;  4G7Z C;  4YIJ A;  3Q22 A;  1D1K A;  1AW7 A;  3PUW A;  3LNN A;  4OIJ A;  1L0W A;  1R4Q B;  4K5X A;  4AYB B;  3MFG A;  2UU9 Q;  2E2I B;  1LO5 D;  3HOW H;  4GS3 A;  4A3I G;  1Q8I A;  3HRZ C;  1CA5 A;  2DGY A;  3GV6 A;  3AQQ A;  5M3M H;  2KEN A;  3J80 E;  4R4Q A;  5CV7 A;  2YTV A;  4CGY B;  4CDF C;  5COY A;  1BBU A;  3K6O A;  1L0Y B;  2Q2T A;  1Z9F A;  2A5H A;  2F0K A;  3IRB A;  2IWH A;  2Z1C A;  1STA A;  3H91 A;  4X66 L;  3CXC A;  1Y1W B;  1JJC B;  3D4R A;  3PUZ A;  2B2T C;  4ZLT F;  1HR0 Q;  1QB5 D;  3E0E A;  1J5E Q;  1NR4 A;  1HXY D;  5FLX E;  1PH9 A;  5IGG A;  4A3K H;  2F1M A;  5FK9 C;  4DUY L;  1YJ9 A;  2ZXP A;  3ONA B;  4GLX A;  2PZU A;  2WAQ G;  3J7Y W;  4KHV A;  1X3G A;  4P71 A;  1AE2 A;  1F2Z A;  1EFI D;  1F77 A;  4X3S A;  1Q3L A;  1M8A A;  2JJQ A;  1STG A;  4F88 A;  3NQT A;  2HCI A;  1HFG A;  3FMC A;  2A6H D;  1DM0 B;  3HKZ G;  4ID6 A;  2HQE A;  1RD9 D;  1SNC A;  2K04 A;  2RHQ B;  1B9M A;  3BVZ A;  1ET6 A;  4CHT B;  2JA7 B;  1B7Y B;  5LMU Q;  4LF9 Q;  2K05 A;  3S16 H;  1MKH A;  5EPK A;  3PIO A;  1IBL L;  3Q23 A;  4CDE C;  3NQI A;  1EOT A;  4HCE A;  1PZI D;  4DNR B;  2EY1 A;  3EA6 A;  3L9A X;  1K8M A;  1Q12 A;  4HJ8 A;  2VQF L;  3EQL C;  4XXE A;  1TU2 B;  3D31 A;  2DJG C;  1ZKO A;  4JI8 L;  4JI4 Q;  4PQX A;  2JK8 A;  4DR6 L;  1O7L A;  1EEI D;  4IUQ A;  3IKJ A;  4GLV B;  3CCS A;  3K5N A;  3QR8 A;  2E2J B;  1FD7 D;  3P75 A;  2OT2 A;  2JN4 A;  1PRT B;  4B08 A;  3U9O A;  4DV4 L;  1B50 A;  1WVL A;  4RH6 A;  3I7F A;  3UE0 A;  3K7A B;  4NMZ A;  1IBM L;  4NPS A;  4H7B A;  1XMQ L;  4J6H A;  4A4I A;  4WRD A;  2A69 C;  3WWV A;  4C3I G;  2JA9 A;  3BYY B;  1YNN D;  3I2Z A;  2NVQ H;  4XQJ A;  4JBJ A;  1EU4 A;  3T1H L;  1PZJ D;  1X65 A;  3FEW X;  3MXN B;  4DV7 L;  2UXC Q;  5KYI A;  1K0S A;  1JWM D;  3KJP A;  4KHP Q;  4QGU A;  1D6E C;  1QJO A;  1XNQ L;  2DJF C;  1PHJ A;  2E8G A;  1A63 A;  4JOI A;  1S5B D;  1SNO A;  3CD6 A;  4DR1 L;  3OMC A;  4A3J G;  1N9W A;  4JI3 Q;  1FL0 A;  4BY1 H;  3GTG B;  1BBX C;  1EOV A;  5M5Y B;  3W1B A;  1QNU A;  2IW3 A;  3HOX G;  1KNA A;  3H0G G;  4QJF A;  3OOC A;  3R2T A;  1LTS D;  1BO0 A;  2UUB L;  1K8G A;  3M85 A;  3WDN A;  4RMF A;  2E2I H;  1EY5 A;  2XSC A;  4FXK C;  1KDA A;  3HOV B;  2EJG C;  2K14 A;  2PMZ B;  1IXR A;  1JWU D;  2CWP A;  4LWC A;  1DOL A;  5JEA J;  2D9U A;  5M9O A;  2E5L Q;  4B3T Q;  1SNQ A;  1ASY A;  2EYM A;  2QIL A;  1Q7Y C;  3KLR A;  3J7A V;  4LFB Q;  1E3P A;  1DD2 A;  2OQK A;  4Y7N B;  2ATW A;  1YIJ A;  3RZO B;  2I5H A;  1H9R A;  3SEB A;  1GVP A;  4JI6 Q;  1VQJ A;  4YY3 L;  1HFN A;  4U68 A;  4GOP A;  1JJ2 A;  1Y1W H;  4FF4 A;  4PG3 A;  2K03 A;  3H09 A;  2VQE L;  1LAB A;  3CC7 A;  2E2D C;  3SE0 A;  1KRS A;  1VQK A;  1WYD A;  1GM5 A;  2EJF C;  1STY A;  1PDQ A;  3TBI B;  2RQX A;  4CKC A;  1FR3 A;  2MO0 A;  1YVC A;  2EYO A;  1BCP B;  1WTR A;  3TRE A;  2EJM A;  1GUG A;  3S1M B;  4JW0 A;  4A3E G;  1IW7 C;  2GN5 A;  2PZT A;  3H6M A;  2PNR C;  5FLM H;  1PH6 A;  2G9D A;  2JA7 H;  2YTY A;  1EY0 A;  2F0W A;  5M3M G;  2PW5 A;  4DR2 L;  1A2U A;  4X6A H;  1KXL A;  3K5M A;  2K33 A;  4X65 L;  4JI7 Q;  3G6J B;  3RD4 A;  3FPU B;  1YJW A;  1XMO Q;  1GOZ A;  4LUV A;  5EBD A;  1WCM B;  1LAC A;  1VQL A;  4WOR A;  2EOT A;  3KFU A;  5CYU A;  4DV5 L;  4DNI A;  2FIN B;  2VB3 X;  4A3F G;  4JC0 A;  1VF5 C;  1XTC D;  5ELC A;  5I2Y A;  1A3V A;  1SR3 A;  1N32 L;  5C4X B;  5D14 A;  3S1Q H;  2BE5 D;  1GUT A;  4A3K G;  2N88 A;  1VQE A;  1SE2 A;  1VQ4 A;  1Q82 C;  1BNZ A;  4R8N A;  3FVQ A;  2I46 A;  3K7A H;  1L1O C;  4DV6 Q;  2UUC L;  5C44 B;  3CMA A;  4HSV A;  3PIP 3;  1LV9 A;  5C0X J;  1HNX L;  2D5D A;  2X6G A;  4DV0 Q;  3SK5 A;  2LXJ A;  3E5S A;  3S15 B;  2K52 A;  3N52 A;  4JG2 A;  3DEP A;  4PZ6 A;  2F0U A;  5EJW A;  1NBW A;  1EEF D;  4IOA A;  1D5M C;  1HTP A;  3K5L A;  1I6V C;  4RGT A;  4UP9 A;  1K0R A;  1SAP A;  4BBS B;  2KQ3 A;  4QL5 A;  2M00 A;  2CCZ A;  3GTG H;  1TY0 A;  2XVS A;  5M5Y H;  5BR8 L;  2Z4H A;  4IN3 A;  2PYK A;  1GUN A;  3T53 B;  1TWF B;  2PI2 E;  4TVA B;  2L12 A;  5NUC A;  3RLF A;  3BJU A;  4YCU A;  3A8K E;  3DMU A;  3J80 L;  4PZ8 A;  1D5X C;  2WP8 J;  3CCL A;  3J7Z C;  5IP9 G;  2JYO A;  4GN4 B;  3FKI B;  2MFI A;  3RZD B;  1K3B C;  3LGJ A;  3O13 A;  5KGU A;  1RIP A;  2IX1 A;  3HOV H;  1LLR D;  5IE8 A;  1XPU A;  1VDZ A;  3ERO A;  5CV9 A;  2HCC A;  3SK8 A;  2Z6K A;  1BXT A;  1VQ8 A;  2YU9 B;  5GQO A;  1PRT F;  1HNW L;  5JVG 3;  3NEN A;  2H1E A;  3RZO H;  1KQS A;  2NVY B;  2LFN A;  2F0F A;  1H9S B;  1PFN A;  3CU7 A;  1LM0 A;  3PV0 A;  4HAE A;  4L8J A;  5IGD A;  4X62 L;  2WB1 E;  4MHE A;  2C5C A;  4ZRZ A;  4IOC A;  1SMY C;  2OTJ A;  5IP7 H;  3GTK B;  1P8L A;  4N9T A;  1B3Q A;  1G2T A;  4LAA A;  5GAG C;  2K5V A;  2PZW A;  1Y8N B;  4N8F A;  4DV3 L;  3K58 A;  1HNZ L;  1PYS B;  4BY1 G;  2A6E D;  5ELE A;  2MUY A;  3K8A A;  3S1N B;  1CI3 M;  1U9R A;  1ML0 D;  4IQZ A;  3V2T A;  1X32 A;  1SLJ A;  4O42 A;  5COR A;  3S1M H;  1Q90 A;  4AYB G;  3C1F A;  4ZKC B;  3GTJ B;  4RGO S;  3L7Z C;  4K6D A;  1XPO A;  2PQA A;  1HR0 W;  2VNU D;  1G8Z D;  3OTO L;  3UDI A;  4A3B G;  1EWH A;  3VR3 A;  1B53 A;  4H0L C;  3BVG A;  2ID0 A;  3DM3 A;  3K59 A;  1WCM H;  2SNM A;  3NP8 A;  2YTX A;  1C48 A;  2B2V C;  5EGT A;  1M90 C;  1EYG A;  3GTL B;  1LUZ A;  2J7Z A;  4GN5 A;  5DLQ E;  5GAD C;  1PH4 A;  4GNX C;  1Y1W G;  4NKL A;  2A68 C;  2WII B;  4C1N K;  3M4O B;  2ZM6 L;  5C4X H;  3GTP B;  5C4H A;  2Z4I A;  4GN3 B;  2EY6 A;  5C3E B;  2AUJ D;  1B4O A;  1PTO D;  2H5X A;  2ZXR A;  1PXU A;  1RL2 A;  3VR6 A;  1ROD A;  5HGT A;  4UP7 A;  4A3M B;  1RJT A;  1MIU A;  1Y69 U;  4R8I A;  1A6X A;  4AIM A;  1JE4 A;  2Z8L A;  5C44 H;  2UXD L;  1U0L A;  5JJI A;  3I73 A;  1HZA A;  4PMB A;  1TKW B;  1V8Q A;  1CUK A;  5CC4 A;  3EVQ A;  1SJE D;  2B2U A;  1TT2 A;  1HJP A;  2R92 B;  4LNQ A;  5GRO A;  4JBM A;  1ICF B;  5I2X A;  1K3R A;  3T16 A;  4IPG A;  2V1C C;  2HHH Q;  1G6P A;  1N34 Q;  1XYI A;  5EKL A;  1ZXT A;  1TS2 A;  3RUZ A;  4LFA L;  1SYE A;  2JA7 G;  1BCP F;  2X6L A;  1PFM A;  4OWX B;  2VB2 X;  1WTX A;  1VQO A;  4BBS H;  4RKL A;  4B3M Q;  3L3O C;  3F2C A;  5EQ0 A;  1B3A A;  3URY A;  1Q1E A;  3K5O A;  1TWF H;  4HJA A;  3OWE B;  1WD0 A;  4DU9 A;  1O7I A;  3ERQ A;  1BUV T;  2OWO A;  4ZQ3 A;  3E9I A;  2E75 C;  2B2W A;  5IOC A;  2YYZ A;  3GO5 A;  3FKI H;  4DUZ Q;  3RZD H;  2F4V Q;  2HIX A;  4V0B A;  1QIL A;  3UDX A;  1K8A C;  2KCN A;  1MI2 A;  1DYQ A;  4OEM B;  1PZK D;  4I7Z C;  2YU9 H;  3CP0 A;  3H3V C;  3NBH B;  4LF6 L;  1B44 D;  3ZJY C;  1HQR D;  3BU2 A;  1DJR D;  2FMC A;  5D3D A;  4TKO B;  3SK4 A;  4NXM L;  1LYL A;  2A6H C;  1EFW A;  1O7Y A;  4B3S L;  3BDC A;  2NVY H;  2VY3 A;  3ER0 A;  1W6J A;  5D3I B;  1L1O B;  1C9O A;  1CSQ A;  4FO2 A;  2UU9 L;  1D8L A;  4DXF A;  2LKV A;  3KK7 A;  3TS2 A;  1I3Q B;  1AZP A;  1LT3 D;  2Q8R E;  1NJI C;  1HQM C;  4LFC L;  1NCV A;  2F0T A;  3MEF A;  3I4N B;  5E4X A;  3X3N A;  4G7H C;  1NMF A;  3GTK H;  1GUS A;  3LWE A;  4NXN Q;  1B70 B;  2F0G A;  4IUV A;  1KRT A;  1CZG A;  4GKK Q;  3NBI A;  3AEV A;  3BVM A;  3S1N H;  4BA2 I;  3I4M B;  3HOY G;  3Q6S A;  2N3S A;  2PMZ E;  1A3U A;  4XQN A;  1UEA B;  1W2B A;  2ZXO A;  1Q8K A;  1J5E L;  1JE5 A;  1M1K C;  2WB1 B;  1HUM A;  3D6W A;  4MIU A;  1I4H A;  2F0S A;  1A8V A;  3HOV G;  5DM6 3;  4EGV A;  3GQB A;  4A3D B;  4JI2 Q;  1MBY A;  4YHH Q;  5LL6 S;  3ULP A;  3G7L A;  1WTO A;  1EY7 A;  1YNN C;  5T1G A;  3FP9 A;  3RN2 A;  2NYZ D;  1D5Z C;  2K01 A;  4JI0 Q;  2IHF A;  2IY5 B;  4RCO A;  1S5F D;  2L0C A;  3GTL H;  1PRT D;  2Q2H A;  2C35 B;  1JCK B;  4BY7 B;  3SGI A;  4LUZ A;  3ND8 A;  4IUR A;  4AQY Q;  3DLL A;  3ULL A;  3M4O H;  1GUW A;  1EQQ A;  1ESR A;  2NN6 G;  2B2Y C;  1B9N A;  1N33 Q;  4DV1 Q;  5JAV A;  3GTP H;  5C3E H;  4LF9 L;  5EAY A;  1PLF A;  5M3F B;  2UXB Q;  3JC6 6;  1UE1 A;  4R4I A;  3ZYY X;  4BXX G;  5IP7 G;  4A3M H;  4LF7 Q;  2N8N A;  3MVV A;  3MZ5 A;  4DAY B;  2B8F A;  1DZ1 A;  2AUK A;  1TXY A;  4IJH A;  2F0L A;  3L2P A;  5EKI A;  2EXD A;  2R93 G;  2FHT A;  1E2V A;  1XNR Q;  3CCQ A;  3KBG A;  3NWS A;  4CKE A;  4ZKB B;  2OEO A;  1SYB A;  4LF8 L;  5IWA L;  1CT1 D;  2R92 H;  1E0B A;  4JV5 Q;  1DGS A;  4ABN A;  4OWT B;  1UNS A;  1EYA A;  4A3G B;  2VUM B;  4C3J G;  3JAM E;  3DM1 A;  3CQZ B;  4F7X A;  2NTS A;  5FO9 B;  1S72 A;  4KHZ A;  3TN2 A;  4LF4 Q;  2RSN A;  3P7J A;  4ULL A;  1U4R A;  1WCM G;  3J81 c;  1WTQ A;  4EQN A;  1EYC A;  4ZYS A;  2RDF A;  4RG1 A;  3A56 A;  3T1Y Q;  1S4Z A;  3D0F A;  4HJ7 A;  2WKC A;  3M4Q A;  4DF7 A;  1MJE A;  3GD7 A;  3KUP A;  2ENB A;  1IYU A;  4L5R C;  3P1H A;  4FXD A;  1SJH D;  2CW0 D;  4DR5 Q;  1VF7 A;  1CSP A;  5C4X G;  3MC0 B;  1H95 A;  1QNK A;  5IT9 E;  4TQU S;  4OEL B;  4JI3 L;  1UWV A;  5CBA E;  4K8J A;  3G71 A;  1E22 A;  2OCE A;  2R7Z H;  1KLU D;  3S1Q B;  3I90 A;  2MHV A;  1UE7 A;  1A62 A;  4RCN A;  1U5K A;  1YBY A;  4RGM A;  4H13 C;  3KLW A;  4O2D A;  4ZUI A;  4JBK A;  3A5Z B;  3IAY A;  2KCT A;  4KY7 A;  4OXP A;  5KYL A;  5CBE E;  4A93 B;  1I3Q H;  4OX9 L;  1EYD A;  1ONL A;  1KDC A;  3S9W A;  3TP7 A;  4DUY Q;  1PV4 A;  1Y1V B;  2SNS A;  5G3L D;  2VZA A;  4R9W A;  4PZ7 A;  1BQQ T;  2E5L L;  3OMG A;  4KJN A;  1HHV A;  2F0H A;  2EZV A;  1YJN A;  3I4N H;  3NBH A;  5C5M A;  3S1R B;  4A3C H;  4G4K A;  1VS0 A;  3WOE A;  4POF A;  4HTH A;  1NR2 A;  4LFB L;  2Q8I B;  1LTA D;  3U50 C;  1U4L A;  3VYR A;  4EQO A;  2PI2 A;  1RTO A;  3I4M H;  1ZYR D;  2NUC A;  4JI6 L;  1W3S A;  5EPL A;  4U67 3;  4NDX A;  2D62 A;  1IKL A;  2OTL A;  2R3Z A;  3KF8 B;  2MNA A;  2BE5 C;  3QJY A;  2F0N A;  1KDB A;  4IFD I;  3FKI G;  4DFA A;  1JC7 A;  4LF5 Q;  1WOC A;  4Q0F A;  1BOS A;  1TS3 A;  2E76 C;  1HPC A;  3BDL A;  3VR5 A;  1IBL Q;  4DK0 A;  4A3D H;  1HZC A;  2JE6 I;  5HY6 A;  2ZT9 C;  3J80 c;  3AYH B;  1VMP A;  3AMU A;  3UI2 A;  4J15 A;  2K7V A;  2P5Z X;  2ZJR A;  5E7N A;  1AEX A;  5C4J B;  3OW2 A;  1EQV A;  1ICW A;  1QVG A;  4IUU A;  4MNO A;  2PO4 A;  1SNP A;  3VYU A;  5EPJ A;  3SVM A;  5A2Q L;  4HID A;  4X3U A;  2XTI A;  4BY7 H;  2K5H A;  3J81 i;  3ULJ A;  2JA6 H;  2VXW A;  1VQI A;  2Z9H A;  3TME A;  1F2L A;  5M3F H;  5IOD A;  1IBM Q;  1K28 A;  3A74 A;  1F9R A;  3PGZ A;  1XMO L;  1PH1 A;  5JOB A;  1D2B A;  3LWU A;  1Q81 C;  5IYB H;  1KAA A;  1T9H A;  3PO3 B;  2VW9 A;  2DNC A;  3NHH A;  2K28 A;  3EBE A;  4H02 A;  4KKT A;  2RCN A;  1YHQ A;  1RTN A;  3VDY A;  3TP8 A;  2FFK B;  2B3G A;  1TS4 A;  2KUM A;  1QZG A;  1XNQ Q;  5ELD A;  4L5S A;  4A3G H;  2VUM H;  3L0O A;  3TZU A;  4DR1 Q;  2B39 A;  4ZUJ A;  4QY7 A;  3CQZ H;  2HD3 A;  3Q0A A;  1CM9 A;  1PA6 A;  4GLA C;  4DV6 L;  2LMC B;  3J81 L;  3G6E A;  4HCS A;  4RAU C;  4YWM A;  1SMX A;  1J8I A;  1SRU A;  5AFW A;  3HOW G;  1VQP A;  2UUB Q;  4R1J A;  3D4W A;  3S2D B;  3I91 A;  3H3V I;  1QE6 A;  4B3R L;  2EXZ A;  2R6G A;  2NVT B;  1YI2 A;  2SOB A;  4IFD H;  1AH9 A;  2WFW A;  2EYJ A;  4DK1 A;  1HA5 A;  5M5X B;  2AQ2 B;  1NNX A;  4TRD A;  3OSO A;  1T5X D;  1O78 A;  1UEB A;  4DR7 Q;  1EY9 A;  1OXX K;  3AB9 A;  1F2M A;  1MSG A;  2K5D A;  5EKK A;  1OXS C;  5JVH 3;  5T1I A;  2HQL A;  4RFB A;  2A6E C;  1I4Q A;  4G57 A;  5CGK A;  1SEB D;  3TS0 A;  4C3H B;  3HKZ B;  2CKZ B;  2TSS A;  1XX8 A;  1ENF A;  4WFN 3;  4CDC C;  2LXK A;  2RDH A;  3J80 i;  3PCO B;  1I94 L;  4M8A A;  5CR3 A;  3VR2 A;  4POG A;  2VQE Q;  3SK6 A;  2R92 G;  3D8G A;  4A93 H;  1EZ8 A;  4RWS C;  1KNE A;  1Y1V H;  3QWN A;  4Q5V A;  4HIM A;  2K1B A;  2WV6 D;  1YNJ D;  1PH7 A;  5DAU A;  3S1R H;  2I5M X;  4A3L H;  1NAP A;  3CCV A;  3C2P A;  2OF1 A;  2IJ0 A;  1VQM A;  4JYA L;  2XRQ D;  1A15 A;  4JOI C;  4IO9 A;  3S24 A;  5CV4 A;  3QG1 A;  4HED A;  3HG9 A;  3KBX A;  1E2W A;  2EE1 A;  2I0Q A;  1SYD A;  3DWA A;  1PTO C;  4ZCK A;  3T51 B;  1DOM A;  3B6Y A;  3J7A F;  4X65 Q;  3MTS A;  5C0X I;  4QQB X;  3DWQ A;  4C3I B;  3I4O A;  3MXN A;  2EPB A;  3A7L A;  1JQY D;  1QCB D;  4DR4 Q;  2K5Q A;  4DAM A;  3F1Z A;  4FF1 A;  4MN3 A;  1E1T A;  1PFS A;  4DV5 Q;  1JB3 A;  5KNC A;  5C4J H;  4P74 A;  4N9P A;  3BS1 A;  1WD1 A;  2QEX A;  1PH3 A;  1LTG D;  1RDP D;  1SE8 A;  3H3V H;  1S5C D;  4UY8 C;  1RCV D;  3OPO A;  1TY2 A;  3RMH A;  1N32 Q;  2F3V A;  3FRP B;  4K0K Q;  3NTH A;  3PF5 A;  1M4V A;  1VQ6 A;  5FLX L;  3M4Y A;  2XNA C;  4KMU C;  2NTT A;  4WJ3 M;  4GOP C;  1KHI A;  2UUC Q;  1C0A A;  3I4N G;  1X54 A;  1Y14 B;  4KN7 C;  1QZH A;  4IPD A;  3VYT A;  1X3E A;  1E7Z A;  4YWL A;  3N6R A;  1Z6H A;  3PIP A;  1NY4 A;  3PO3 H;  3I4M G;  3JAM L;  2JEA I;  1SE4 A;  1N36 Q;  3GP7 A;  1NTG A;  2WAC A;  3NEL A;  2H4O A;  1EQR A;  2JXM B;  3G4S A;  2G5D A;  4APV A;  3DHQ A;  2F0O A;  4WJ4 A;  3MXP A;  5JJK A;  3U58 A;  2F3W A;  5J3B A;  4QCL A;  2WB1 G;  3NSW A;  4QUC A;  2MPM A;  3W1G A;  2F03 A;  1UAP A;  4KD3 A;  1CFM A;  4HIO A;  5HUR A;  2ASB A;  2EY2 A;  3RN5 A;  2Q2I A;  4GKJ L;  2D0P A;  2F0P A;  4IUN A;  4KY5 A;  4A3D G;  4F87 A;  1CHP D;  2F0M A;  4C2M B;  1FGB D;  5ELF A;  1OXV A;  3CCJ A;  4DAV A;  2OXP A;  1TWH B;  3I3C A;  4GZY C;  5IT9 L;  3SDZ A;  3S2D H;  3RLN A;  5D65 A;  2L4N A;  2NVT H;  1EUJ A;  1TII D;  2A73 B;  5M5X H;  2HHH L;  2RHS B;  1N34 L;  5LMN Q;  4LK1 C;  2R7D A;  3KYH C;  5C0X H;  3NXW A;  2AMC B;  2CH4 W;  2DY7 A;  1F2Y A;  4KKU A;  5M3F G;  1Q86 C;  2MJ8 A;  1H9M A;  4ME5 A;  4BWG B;  1AN8 A;  4DPG A;  4E6I A;  2CVR A;  4C3H H;  4ODG A;  1OTC A;  4J1M A;  4LJZ C;  3LX0 A;  1CA6 A;  4PMC A;  1I4G A;  4A3E B;  5IYB G;  3HKS A;  1VMC A;  3K81 C;  4DK3 C;  2F4V L;  1JT8 A;  1HH2 P;  2JQO A;  2F0J A;  3STB D;  1A0I A;  2NWG A;  1XJV A;  1ENA A;  1PYB A;  1FJG Q;  3T13 A;  2QA4 A;  2VUM G;  1UE6 A;  3D3R A;  3WOF A;  5AJ3 L;  5K5P A;  5DM7 3;  2LY7 A;  3OIQ A;  2AWN A;  3KLS A;  1WTW A;  1PRT C;  2KVM A;  5DEH A;  3FHW A;  4A3F B;  3U4V A;  2O5I C;  5FLM G;  2ZTD A;  1S5D D;  4P73 A;  2PNH A;  1VQH A;  2B2T A;  2K5W A;  3NE5 B;  3I55 A;  4X3T A;  1IYV A;  3M4P A;  3UE1 A;  3Q8D A;  1R4P B;  1Z7T A;  3SXH A;  3TEH B;  4IFD G;  1PFB A;  3E3X A;  4CDD C;  1DOK A;  1BKB A;  5A35 A;  4HJ5 A;  3OHX C;  5GAH C;  2AKW B;  4C3I H;  1U4P A;  2E74 C;  4YCV A;  3TZD A;  4GKK L;  3KDF B;  4KD4 A;  4JI1 L;  3FDT A;  3W2D A;  4IPC A;  4JI5 L;  3PO2 B;  4R4C A;  2UUA Q;  2CHB D;  2Z6K C;  1IYJ B;  3F2B A;  1SSO A;  4DNT B;  2RA4 A;  2MGS A;  2RCF A;  4HMI A;  1KD1 C;  3EIV A;  4J8Q A;  3TQY A;  2O4X A;  5LHY 1;  2R7Z B;  1SXT A;  1YHA A;  2DN8 A;  2QDL A;  1Y1V G;  1I4X A;  4HR7 B;  4JI2 L;  4YHH L;  1EIH A;  5CV8 A;  1EIY B;  1JOQ A;  5IYC H;  2J0T D;  2UXD Q;  1G2S A;  4JI0 L;  1K83 H;  1HZ9 A;  1I50 H;  4X64 Q;  1V1O A;  1BVS A;  4G7O C;  2K5N A;  1VQG A;  1ZEQ X;  4FVM A;  2MQH A;  2D0O A;  2JP1 A;  4K8I A;  1VQA A;  4NW2 A;  4CBV A;  4DXG A;  2OQ0 A;  1I4R A;  2JA8 B;  5ELB A;  2CW0 C;  1E1O A;  2PQE A;  3A0J A;  4R4T A;  4AQY L;  4V19 0;  2A19 A;  4LFA Q;  1G91 A;  5FO7 B;  4OO1 I;  3BZC A;  3CKI B;  1H9S A;  2JA5 B;  1YHB A;  2F0D A;  4LF7 L;  1P16 A;  1HR0 L;  2K6A A;  4C2M H;  1U4M A;  3HGB A;  4BBR B;  2KHJ A;  3NUC A;  3I4L A;  3CRL C;  1XNR L;  4IZ8 A;  3R8B A;  1ESF A;  1TWH H;  3CCE A;  4P2C B;  4KN4 C;  1V43 A;  4OWW B;  2N55 A;  2RF4 A;  1TWG B;  2D2C C;  4HJ9 A;  1NUC A;  1LTB D;  3A55 A;  1DON A;  2A8V A;  5IGB A;  3HS0 C;  5LL6 X;  1QVF A;  2KHI A;  4NXM Q;  3QOL A;  1FNU A;  1ZYR C;  3PIO 3;  4DR3 Q;  3U9S A;  1K73 C;  4B3S Q;  1EIG A;  3GV3 A;  2JA6 B;  1RF2 D;  1STH A;  3T1Y L;  4GOP B;  4XTC S;  5LMU L;  4A3E H;  3S17 B;  2F3I A;  3SR1 A;  2QDB A;  4DV2 Q;  3PO3 G;  1I6H B;  2ZJP A;  3PUY A;  3TRZ A;  5KIX A;  1JIC A;  1JOO A;  1VCI A;  1T5E A;  1L0X B;  2DUD A;  4A3B B;  4LFC Q;  3BDO A;  4DR5 L;  4WJW A;  2L5T A;  4XT1 B;  3K0X A;  3I72 A;  1MSH A;  3K80 C;  2KOL A;  2RBM A;  2B2U C;  4JI4 L;  3BZK A;  1NE3 A;  4ALP A;  1TWA B;  3DXJ C;  2Y0S B;  1ILQ A;  4A3F H;  2WAQ E;  4JK1 C; 
#chains in the Genus database with same CATH homology
 3HP3 A;  1SYG A;  3V96 A;  1EY8 A;  1I4P A;  1EQT A;  3HOU B;  2O2L D;  3MA2 B;  1JOK A;  4OO1 H;  3BYT B;  2KCC A;  3P20 A;  4HMJ A;  1OXT A;  5C0X G;  1SBB B;  1SDF A;  3TP5 A;  2A74 C;  2B2W C;  3NK9 A;  2L55 A;  3A54 A;  3PUX A;  5KNB A;  2FMM A;  4C3H G;  1HCZ A;  2NBF A;  2B63 B;  3SHL A;  3D6C A;  1Y8O B;  1AFP A;  2CQA A;  3M7G A;  1EWC A;  5I6Y A;  3QOJ A;  1TR5 A;  5BN4 A;  4UDU C;  1D1I A;  1LT6 D;  2G9H D;  2BOS A;  2F0I A;  3OIP A;  4KJO A;  5J1Z A;  1XXG A;  3KLS X;  3C1E A;  4O1N A;  5F2D A;  2HDM A;  3MWY W;  4BA1 I;  3MAQ A;  3M7N A;  2F4I A;  4QB4 A;  1WTP A;  4OIK A;  2NB0 A;  5C3W A;  2BDO A;  1BCP D;  4IFD J;  5KND A;  2MP1 A;  1HRJ A;  3BZD B;  4UAI A;  4FF2 A;  4ZAI A;  2NVX B;  2Q8T A;  4DA2 A;  1PTO H;  3BG3 A;  1LTR D;  1LTT D;  2KA7 A;  2JEB I;  2F0V A;  3HOZ B;  1KLG D;  3DWP A;  4NP5 A;  1YNJ C;  2IL8 A;  2QF7 A;  3DEO A;  2HUG A;  3OW7 A;  3K57 A;  4FP5 D;  2EYP A;  2BCO A;  3HOY B;  1X3P A;  3TSS A;  1HA6 A;  3T56 B;  4XT3 B;  3QB3 A;  1TWC B;  3EFX D;  1EL0 A;  1SE3 A;  4IUT A;  1IKM A;  2IX0 A;  5E1F A;  3FPP A;  2KEC A;  3K0Y A;  4XQQ A;  5BN5 A;  2SEB D;  4KV6 A;  2M2L A;  4CKB A;  5JPN C;  4C56 C;  5FO8 B;  2K32 A;  4A3I B;  5BN3 A;  3I70 A;  1O7Z A;  3D4D A;  1IHZ A;  1II3 A;  1KTK A;  4DGZ A;  1BDO A;  4I65 A;  4ZK9 B;  3C46 A;  4Z9C B;  3PMF A;  3MFY A;  4JBW A;  2AQ3 B;  1Q1B A;  2BA1 A;  1G29 1;  1PTO F;  5M5W B;  4DAY A;  4FNF A;  3GTO B;  2B8G A;  3NWT A;  5C6A A;  3W3A A;  2R93 B;  3R2I A;  1DCZ A;  5J22 A;  1RKN A;  3QO2 A;  1H9J A;  2QEJ C;  5JPM C;  1R9T B;  3A8I E;  2WAQ B;  2L1B A;  1Z47 A;  4FXG C;  4C3J B;  2GA4 B;  1UUP A;  1FYC A;  2FJ2 A;  1G6Z A;  3IFD A;  2A69 D;  1AZQ A;  4CJ0 B;  4L63 B;  1O80 A;  1FNW A;  1B1Z A;  2X69 A;  4RHR A;  4K5W A;  3QIA A;  2BA0 A;  2B2V A;  4KI0 A;  2XIW A;  2EYL A;  1WTV A;  4X3K A;  1IL8 A;  3R3O A;  2IPK D;  5K36 H;  2DY8 A;  2F0E A;  1AP0 A;  1GHK A;  2LS0 1;  2NN6 I;  5KRU A;  4OHJ A;  1LTI D;  1F9P A;  5IGF A;  2I07 B;  1JOR A;  4OO1 G;  1SFO B;  1PMR A;  4B9W A;  4DN4 M;  2ICI A;  2RDG A;  2V4D A;  5JEA H;  3S2H B;  1A2T A;  3GTM B;  2EVB A;  5I9O A;  1Y8P B;  2M9V A;  1ENC A;  4C1N I;  1XWE A;  5FKA C;  1CHQ D;  1J9O A;  4B9X A;  1EY6 A;  4RA8 A;  4XDX A;  5KEE A;  2IX3 A;  3T4A C;  1GJX A;  4K5V A;  3KF8 A;  2KED A;  3HEJ A;  3VA5 A;  5FOB B;  4XIG S;  3IFT A;  4KKS A;  3NTI A;  4KTA A;  5IIF A;  4A3J B;  5DNF A;  4K14 A;  1CTM A;  1V1P B;  2NZ1 D;  2L11 A;  3HOX B;  3PUV A;  4RHS A;  3H0G B;  3TDQ A;  2JSO A;  3F2U A;  1K83 B;  1I50 B;  4KY6 A;  4FF3 A;  3OWF A;  2DNE A;  3NPP A;  4FYD A;  3A8J E;  1HTL D;  1CQV A;  2E2H B;  3GTQ B;  1IW7 D;  1S5E D;  3E6Z X;  3AU7 A;  1OO9 B;  2WIN B;  4RKB A;  5IGC A;  2NN6 H;  1CZW A;  4XYO A;  1GHJ A;  1B2T A;  4M1U B;  3ITP A;  4KK7 A;  3M3Y B;  4PMW A;  4EQP A;  3S14 B;  1NSN S;  1TVX A;  5C5L A;  4DAP A;  1H9K A;  1CK1 A;  5CV5 A;  1LT4 D;  4OGQ C;  1MGS A;  3I8Z A;  3VYS A;  1F9Q A;  1A3T A;  1QOH A;  3MXU A;  1CQF A;  1EZ6 A;  2C9O A;  5E4W C;  1JWS D;  4QF4 A;  2KEE A;  5I4D A;  4CJ1 B;  1TQO A;  4QIW B;  4OL7 A;  3ND9 A;  2TMP A;  1SYC A;  1HUN A;  3VA7 A;  1ET9 A;  2J4X A;  3HOW B;  2HDL A;  2SDF A;  2XRS D;  5TSS A;  1SND A;  5M3M B;  5EBC A;  4QUF A;  1STE A;  5CV6 A;  3X3M A;  3CHB D;  1LT5 D;  3HZX A;  2B2Y A;  3CRK C;  4HN7 A;  5A2Q E;  4LMQ D;  1E2Z A;  2RKS A;  2AWO A;  2PW7 A;  3H94 A;  2PPB C;  5IGE A;  2EY5 A;  4H44 C;  1DXM A;  4A3K B;  2F0Q A;  4ILW A;  3V05 A;  3IL8 A;  5G3L F;  4HSP A;  2EYF A;  1BF4 A;  1BR9 A;  3NTK A;  5E3F A;  2XN9 C;  1X3Q A;  5I9P A;  3EJI A;  1STN A;  1SYF A;  2XWJ B;  3C3L A;  3VR4 A;  4IUP A;  2RVL A;  3A7A B;  2AQ1 B;  4RGN A;  2BDN A;  3S16 B;  3J81 E;  1SMY D;  5CMD A;  2QKI C;  5K36 G;  2ICE C;  1F9S A;  4K6L A;  1EY4 A;  2EDG A;  1OXU A;  1JR0 D;  5JJZ A;  3R93 A;  3MEH A;  2PCF B;  3MHB A;  2XWB B;  4IAL A;  5J39 A;  4EVO A;  1W6K A;  5C3X A;  1FNV A;  3TP6 A;  1MD2 D;  4K2K A;  5JEA G;  2KHS A;  4K2L A;  1RHP A;  4TSS A;  1C8C A;  1V1P A;  5C4Z A;  2RSO A;  4F8M A;  1STB A;  1GXD C;  1PYW D;  2NVQ B;  4BS9 A;  1KAB A;  1QG7 A;  1PTO B;  2O5J C;  3Q24 A;  4CJ2 C;  2R61 A;  4S3S A;  5I6W A;  1SNM A;  4PNY A;  1ILP A;  4XYQ A;  3DUZ A;  5ISR A;  2L9H A;  4PV1 C;  2A68 D;  1QWY A;  1K8O A;  4QMG A;  3E0J A;  1EU3 A;  2QCP X;  4L6T B;  2IT1 A;  1TS5 A;  1GUO A;  2EYH A;  4BY1 B;  1BCP C;  1C4Q A;  2KJX A;  2WKD A;  3MXG A;  4G7Z C;  4YIJ A;  3Q22 A;  1D1K A;  1AW7 A;  3PUW A;  3LNN A;  4OIJ A;  1R4Q B;  4K5X A;  4AYB B;  3MFG A;  2E2I B;  1LO5 D;  1Q8I A;  3HRZ C;  1CA5 A;  3GV6 A;  3J80 E;  5CV7 A;  4CGY B;  5COY A;  3K6O A;  1L0Y B;  2A5H A;  2F0K A;  2IWH A;  2Z1C A;  1STA A;  3H91 A;  1Y1W B;  3D4R A;  3PUZ A;  2B2T C;  4ZLT F;  1QB5 D;  1NR4 A;  1HXY D;  5FLX E;  5IGG A;  2F1M A;  5FK9 C;  2ZXP A;  3ONA B;  2PZU A;  3J7Y W;  4KHV A;  1F2Z A;  1EFI D;  1F77 A;  1Q3L A;  1M8A A;  1STG A;  4F88 A;  3NQT A;  2HCI A;  1HFG A;  3FMC A;  2A6H D;  1DM0 B;  4ID6 A;  2HQE A;  1RD9 D;  1SNC A;  2K04 A;  1B9M A;  3BVZ A;  1ET6 A;  4CHT B;  2JA7 B;  2K05 A;  5EPK A;  3Q23 A;  3NQI A;  1EOT A;  4HCE A;  1PZI D;  4DNR B;  2EY1 A;  3EA6 A;  3L9A X;  1K8M A;  1Q12 A;  3EQL C;  4XXE A;  1TU2 B;  3D31 A;  1ZKO A;  4PQX A;  1O7L A;  1EEI D;  4IUQ A;  3IKJ A;  3K5N A;  2E2J B;  1FD7 D;  3P75 A;  2OT2 A;  1PRT B;  4B08 A;  3U9O A;  1B50 A;  1WVL A;  4RH6 A;  3K7A B;  4NMZ A;  4H7B A;  4J6H A;  4WRD A;  2A69 C;  4C3I G;  3BYY B;  1YNN D;  4XQJ A;  1EU4 A;  1PZJ D;  3FEW X;  5KYI A;  1JWM D;  1D6E C;  1QJO A;  1S5B D;  1SNO A;  3OMC A;  3GTG B;  1BBX C;  5M5Y B;  1QNU A;  2IW3 A;  1KNA A;  3OOC A;  3R2T A;  1LTS D;  1BO0 A;  3M85 A;  3WDN A;  1EY5 A;  2XSC A;  4FXK C;  1KDA A;  3HOV B;  2EJG C;  2PMZ B;  1JWU D;  5JEA J;  1DOL A;  2D9U A;  5M9O A;  1SNQ A;  2EYM A;  2QIL A;  3KLR A;  3J7A V;  1DD2 A;  4Y7N B;  3RZO B;  1H9R A;  3SEB A;  1HFN A;  4U68 A;  4FF4 A;  2K03 A;  3H09 A;  1LAB A;  2E2D C;  3SE0 A;  2EJF C;  1STY A;  1PDQ A;  3TBI B;  2RQX A;  4CKC A;  1FR3 A;  2EYO A;  1BCP B;  1WTR A;  2EJM A;  1GUG A;  3S1M B;  1IW7 C;  2PZT A;  3H6M A;  2PNR C;  2G9D A;  1EY0 A;  2F0W A;  2PW5 A;  1A2U A;  3K5M A;  2K33 A;  3G6J B;  3RD4 A;  3FPU B;  1GOZ A;  5EBD A;  1WCM B;  1LAC A;  4WOR A;  2EOT A;  5CYU A;  2FIN B;  2VB3 X;  1VF5 C;  1XTC D;  5ELC A;  5I2Y A;  1A3V A;  5C4X B;  5D14 A;  2BE5 D;  1GUT A;  2N88 A;  1SE2 A;  1BNZ A;  4R8N A;  3FVQ A;  2I46 A;  5C44 B;  4HSV A;  3PIP 3;  1LV9 A;  5C0X J;  2D5D A;  2X6G A;  3SK5 A;  3E5S A;  3S15 B;  3N52 A;  3DEP A;  2F0U A;  5EJW A;  1EEF D;  1D5M C;  1HTP A;  3K5L A;  1I6V C;  4RGT A;  1SAP A;  4BBS B;  2KQ3 A;  2M00 A;  1TY0 A;  2XVS A;  2Z4H A;  4IN3 A;  2PYK A;  1GUN A;  3T53 B;  1TWF B;  2L12 A;  5NUC A;  3RLF A;  3A8K E;  3DMU A;  3J80 L;  1D5X C;  2WP8 J;  2JYO A;  3FKI B;  3RZD B;  3O13 A;  5KGU A;  2IX1 A;  1LLR D;  1VDZ A;  3ERO A;  5CV9 A;  2HCC A;  3SK8 A;  1BXT A;  2YU9 B;  1PRT F;  5JVG 3;  2H1E A;  2NVY B;  2LFN A;  2F0F A;  1H9S B;  1PFN A;  3CU7 A;  3PV0 A;  4HAE A;  4L8J A;  5IGD A;  4MHE A;  2C5C A;  4ZRZ A;  1SMY C;  3GTK B;  4N9T A;  1G2T A;  4LAA A;  2PZW A;  1Y8N B;  3K58 A;  2A6E D;  5ELE A;  2MUY A;  3S1N B;  1CI3 M;  1U9R A;  1ML0 D;  4IQZ A;  3V2T A;  1X32 A;  4O42 A;  5COR A;  1Q90 A;  3C1F A;  4ZKC B;  3GTJ B;  4RGO S;  3L7Z C;  4K6D A;  2VNU D;  1G8Z D;  1EWH A;  3VR3 A;  1B53 A;  4H0L C;  3BVG A;  2ID0 A;  3K59 A;  2SNM A;  3NP8 A;  1C48 A;  2B2V C;  5EGT A;  3GTL B;  2J7Z A;  4NKL A;  2A68 C;  2WII B;  4C1N K;  3M4O B;  3GTP B;  5C4H A;  2Z4I A;  2EY6 A;  5C3E B;  2AUJ D;  1B4O A;  1PTO D;  2ZXR A;  1PXU A;  3VR6 A;  1ROD A;  5HGT A;  4A3M B;  1RJT A;  1A6X A;  1Y69 U;  4R8I A;  1JE4 A;  2Z8L A;  3I73 A;  4PMB A;  1TKW B;  1V8Q A;  5CC4 A;  3EVQ A;  1SJE D;  2B2U A;  1TT2 A;  2R92 B;  5I2X A;  3T16 A;  1XYI A;  5EKL A;  1ZXT A;  1TS2 A;  3RUZ A;  1SYE A;  1BCP F;  2X6L A;  1PFM A;  2VB2 X;  1WTX A;  4RKL A;  3L3O C;  5EQ0 A;  1B3A A;  3URY A;  1Q1E A;  3K5O A;  3OWE B;  1WD0 A;  4DU9 A;  1BUV T;  3ERQ A;  4ZQ3 A;  5IOC A;  2E75 C;  2B2W A;  2YYZ A;  3GO5 A;  4V0B A;  1QIL A;  2KCN A;  1MI2 A;  1DYQ A;  1PZK D;  4I7Z C;  3H3V C;  1B44 D;  1HQR D;  1DJR D;  2FMC A;  5D3D A;  4TKO B;  3SK4 A;  2A6H C;  1O7Y A;  3BDC A;  1W6J A;  5D3I B;  4FO2 A;  4DXF A;  2LKV A;  3KK7 A;  1I3Q B;  1AZP A;  1LT3 D;  2Q8R E;  1HQM C;  1NCV A;  2F0T A;  3I4N B;  5E4X A;  3X3N A;  4G7H C;  1GUS A;  3LWE A;  2F0G A;  4IUV A;  1CZG A;  3NBI A;  3BVM A;  4BA2 I;  3I4M B;  3Q6S A;  1A3U A;  4XQN A;  1UEA B;  2ZXO A;  2WB1 B;  1HUM A;  3D6W A;  4MIU A;  1I4H A;  2F0S A;  5DM6 3;  4EGV A;  3GQB A;  4A3D B;  1MBY A;  5LL6 S;  3G7L A;  1WTO A;  1EY7 A;  1YNN C;  5T1G A;  2NYZ D;  1D5Z C;  2K01 A;  4RCO A;  1S5F D;  2L0C A;  1PRT D;  1JCK B;  4BY7 B;  3ND8 A;  4IUR A;  1GUW A;  1ESR A;  2NN6 G;  2B2Y C;  1B9N A;  5JAV A;  1PLF A;  5M3F B;  3ZYY X;  3MVV A;  3MZ5 A;  2B8F A;  1DZ1 A;  2AUK A;  2F0L A;  5EKI A;  2FHT A;  1E2V A;  3KBG A;  3NWS A;  4CKE A;  4ZKB B;  2OEO A;  1SYB A;  1CT1 D;  1E0B A;  4ABN A;  1UNS A;  1EYA A;  4A3G B;  2VUM B;  4C3J G;  3JAM E;  3DM1 A;  3CQZ B;  4F7X A;  2NTS A;  5FO9 B;  4KHZ A;  3TN2 A;  2RSN A;  3P7J A;  4ULL A;  1U4R A;  1WTQ A;  4EQN A;  1EYC A;  4ZYS A;  2RDF A;  3A56 A;  1S4Z A;  2WKC A;  4DF7 A;  3GD7 A;  3KUP A;  2ENB A;  1IYU A;  3P1H A;  4FXD A;  1SJH D;  2CW0 D;  1VF7 A;  3MC0 B;  1QNK A;  5IT9 E;  4TQU S;  5CBA E;  4K8J A;  1KLU D;  3S1Q B;  3I90 A;  2MHV A;  4RCN A;  4RGM A;  4H13 C;  4ZUI A;  3IAY A;  4KY7 A;  5KYL A;  5CBE E;  4A93 B;  1EYD A;  1ONL A;  1KDC A;  3S9W A;  3TP7 A;  1Y1V B;  2SNS A;  5G3L D;  4R9W A;  1BQQ T;  3OMG A;  4KJN A;  1HHV A;  2F0H A;  2EZV A;  3NBH A;  5C5M A;  3S1R B;  4G4K A;  3WOE A;  4HTH A;  1NR2 A;  2Q8I B;  1LTA D;  1U4L A;  3VYR A;  4EQO A;  1RTO A;  1ZYR D;  2NUC A;  4U67 3;  5EPL A;  4NDX A;  2D62 A;  1IKL A;  2R3Z A;  2BE5 C;  3QJY A;  2F0N A;  1KDB A;  4IFD I;  4DFA A;  1JC7 A;  4Q0F A;  1BOS A;  1TS3 A;  2E76 C;  1HPC A;  3BDL A;  3VR5 A;  4DK0 A;  2JE6 I;  2ZT9 C;  3AMU A;  1VMP A;  3UI2 A;  2K7V A;  1AEX A;  5C4J B;  1EQV A;  1ICW A;  4IUU A;  2PO4 A;  1SNP A;  3VYU A;  5EPJ A;  3SVM A;  5A2Q L;  4X3U A;  2VXW A;  3TME A;  1F2L A;  5IOD A;  1F9R A;  5JOB A;  1D2B A;  3LWU A;  1KAA A;  3PO3 B;  2DNC A;  3NHH A;  2K28 A;  4KKT A;  1RTN A;  3TP8 A;  2FFK B;  1TS4 A;  2KUM A;  5ELD A;  3TZU A;  2B39 A;  4ZUJ A;  3Q0A A;  1CM9 A;  2LMC B;  3J81 L;  4HCS A;  4RAU C;  1J8I A;  5AFW A;  3D4W A;  3S2D B;  3I91 A;  1QE6 A;  2EXZ A;  2R6G A;  2NVT B;  4IFD H;  2SOB A;  2EYJ A;  4DK1 A;  1HA5 A;  5M5X B;  2AQ2 B;  4TRD A;  3OSO A;  1T5X D;  1O78 A;  1EY9 A;  1OXX K;  3AB9 A;  1F2M A;  1MSG A;  2K5D A;  5EKK A;  1OXS C;  5JVH 3;  5T1I A;  4RFB A;  2A6E C;  1I4Q A;  4G57 A;  5CGK A;  1SEB D;  4C3H B;  3HKZ B;  2TSS A;  1XX8 A;  1ENF A;  4WFN 3;  2RDH A;  4M8A A;  5CR3 A;  3VR2 A;  3SK6 A;  3D8G A;  1EZ8 A;  4RWS C;  1KNE A;  3QWN A;  4Q5V A;  2K1B A;  2WV6 D;  1YNJ D;  5DAU A;  1NAP A;  3C2P A;  2OF1 A;  2IJ0 A;  2XRQ D;  1A15 A;  5CV4 A;  3QG1 A;  4HED A;  3HG9 A;  3KBX A;  1E2W A;  2EE1 A;  1SYD A;  3DWA A;  1PTO C;  3T51 B;  1DOM A;  3J7A F;  3MTS A;  5C0X I;  3DWQ A;  4C3I B;  3MXN A;  2EPB A;  3A7L A;  1JQY D;  1QCB D;  2K5Q A;  4FF1 A;  4MN3 A;  1JB3 A;  5KNC A;  4N9P A;  3BS1 A;  1WD1 A;  1LTG D;  1RDP D;  1S5C D;  1RCV D;  3OPO A;  1TY2 A;  3RMH A;  2F3V A;  3FRP B;  3NTH A;  1M4V A;  5FLX L;  3M4Y A;  2XNA C;  4KMU C;  2NTT A;  4KN7 C;  3VYT A;  3N6R A;  1Z6H A;  3JAM L;  2JEA I;  1SE4 A;  3GP7 A;  2WAC A;  2H4O A;  2JXM B;  3DHQ A;  2F0O A;  3MXP A;  2F3W A;  4QCL A;  3NSW A;  4QUC A;  2MPM A;  2F03 A;  1UAP A;  4KD3 A;  1CFM A;  5HUR A;  2EY2 A;  2F0P A;  4IUN A;  4KY5 A;  4F87 A;  1CHP D;  2F0M A;  4C2M B;  1FGB D;  5ELF A;  1OXV A;  4DAV A;  2OXP A;  1TWH B;  3I3C A;  4GZY C;  5IT9 L;  3SDZ A;  5D65 A;  2L4N A;  1TII D;  2A73 B;  4LK1 C;  5C0X H;  3NXW A;  2DY7 A;  1F2Y A;  4KKU A;  2MJ8 A;  1H9M A;  4ME5 A;  4BWG B;  1AN8 A;  4E6I A;  2CVR A;  4ODG A;  4J1M A;  4LJZ C;  3LX0 A;  1CA6 A;  4PMC A;  1I4G A;  4A3E B;  1VMC A;  2F0J A;  2NWG A;  1ENA A;  3T13 A;  3D3R A;  3WOF A;  5K5P A;  5DM7 3;  2LY7 A;  3OIQ A;  2AWN A;  3KLS A;  1WTW A;  1PRT C;  2KVM A;  5DEH A;  4A3F B;  2O5I C;  1S5D D;  2B2T A;  2K5W A;  3NE5 B;  4X3T A;  1IYV A;  1R4P B;  1Z7T A;  3SXH A;  4IFD G;  1PFB A;  1DOK A;  5A35 A;  3OHX C;  1U4P A;  2E74 C;  3TZD A;  4KD4 A;  3FDT A;  3W2D A;  3PO2 B;  2CHB D;  1SSO A;  4DNT B;  2RA4 A;  2MGS A;  4HMI A;  4J8Q A;  2O4X A;  5LHY 1;  2R7Z B;  1SXT A;  2DN8 A;  1I4X A;  4HR7 B;  1EIH A;  5CV8 A;  1JOQ A;  2J0T D;  1G2S A;  1V1O A;  4G7O C;  1ZEQ X;  4FVM A;  4K8I A;  2JP1 A;  4NW2 A;  4CBV A;  4DXG A;  1I4R A;  2JA8 B;  5ELB A;  2CW0 C;  2PQE A;  4V19 0;  1G91 A;  5FO7 B;  4OO1 I;  3CKI B;  1H9S A;  2JA5 B;  2F0D A;  2K6A A;  1U4M A;  3HGB A;  4BBR B;  3NUC A;  3I4L A;  3CRL C;  4IZ8 A;  3R8B A;  1ESF A;  4P2C B;  4KN4 C;  1V43 A;  2N55 A;  1TWG B;  2D2C C;  1NUC A;  1LTB D;  3A55 A;  1DON A;  5IGB A;  3HS0 C;  5LL6 X;  3QOL A;  1FNU A;  1ZYR C;  3PIO 3;  3U9S A;  1EIG A;  3GV3 A;  2JA6 B;  1RF2 D;  1STH A;  4XTC S;  3S17 B;  3SR1 A;  2QDB A;  1I6H B;  3PUY A;  5KIX A;  1JIC A;  1JOO A;  1VCI A;  1T5E A;  1L0X B;  4A3B B;  3BDO A;  4WJW A;  2L5T A;  4XT1 B;  3I72 A;  1MSH A;  2KOL A;  2RBM A;  2B2U C;  1TWA B;  3DXJ C;  2Y0S B;  1ILQ A;  4X3S A;  4JK1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...