1SNQA

Protein stability in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 38
structure length 130
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snqA00
2F0QA 5C6AA 4QMGA 5CR3A 3SXHA 1KDBA 1SYFA 4K8JA 5E3FA 5EKKA 3D4WA 5I6YA 3QB3A 5IOCA 2F0IA 1NUCA 2PZWA 5CV9A 1EY4A 4KJNA 1JOQA 1JOOA 3EJIA 4ZUIA 2EYJA 1TR5A 4KV6A 1U9RA 3MHBA 4PNYA 2F0UA 4TRDA 2F0MA 4KD4A 1EY8A 3VA5A 4K8IA 2EY5A 1A3TA 3P1HA 4PMCA 3TP8A 4YIJA 2F0VA 3BDLA 3SK4A 4B9WA 2F0FA 5CC4A 1STNA 1SNQA 4KD3A 4KTAA 3E5SA 4NP5A 5F2DA 2PW5A 3NUCA 2PW7A 4KJOA 5EGTA 5JAVA 4KY7A 3C1EA 1EQVA 3NQTA 4R8NA 4K5WA 3T13A 1EZ8A 5IIFA 4N9TA 4F7XA 1EYAA 1F2ZA 1JOKA 1JORA 2F0LA 1SNCA 4ID6A 1SNOA 2KHSA 3MZ5A 1SYDA 3SHLA 3ITPA 5IGGA 2PYKA 3R3OA 2F0GA 5IGEA 5CV8A 3HEJA 5KRUA 1KDAA 5KYLA 2F0DA 1IHZA 3U9OA 5IGCA 2F0NA 2OEOA 2RKSA 2EYFA 3OMCA 1EYCA 1SYGA 5KEEA 1EY7A 4E6IA 4N9PA 1KDCA 3OSOA 2M00A 2F0HA 3H6MA 2OF1A 2RDFA 4ODGA 5EKLA 4KY5A 5C5MA 4QB4A 2WACA 4J6HA 5CGKA 2PZTA 4OL7A 4LAAA 4NDXA 2HQEA 4EQNA 1SYCA 5I9OA 5K5PA 4IZ8A 3SK6A 3OWFA 2F0OA 1A2TA 1SYEA 1ENAA 1SNDA 3ERQA 4G57A 4HMIA 3BDCA 4J1MA 5CV7A 5J1ZA 1SNMA 2OXPA 1EY9A 3NXWA 3TMEA 5C4ZA 4I65A 2SNSA 2F3WA 1TT2A 2PQEA 4B9XA 5IGBA 3D8GA 4DU9A 1F2MA 4PMBA 1ENCA 3RUZA 1AEXA 3NP8A 4IUNA 2EYMA 1STBA 3C1FA 4EVOA 5J39A 3HZXA 5E1FA 4HMJA 5ISRA 5J22A 5C5LA 4MIUA 2F3VA 3PMFA 5CV6A 3SK5A 1EYDA 5HURA 2SNMA 5I6WA 4ZUJA 5IGFA 4NKLA 3S9WA 2F0TA 3V2TA 1A2UA 5C4HA 2EY6A 1EZ6A 2ENBA 2PZUA 1A3UA 4DFAA 3TP7A 2F0WA 1EY6A 3TP6A 2SOBA 3EVQA 1KABA 3P75A 4EQOA 5DAUA 5I9PA 4F8MA 4ME5A 3LX0A 2EYOA 3D6CA 5M9OA 4NMZA 5IODA 5KYIA 2LKVA 2KQ3A 4RKLA 2F0JA 5DEHA 4WRDA 5NUCA 2EYHA 4EQPA 2O4XA 4KHVA 4K5VA 2F0PA 3D4DA 2EYLA 4K2LA 2EYPA 4DF7A 1NSNS 5C3WA 5HGTA 2NUCA 2F0SA 4KY6A 3EROA 5CV4A 1A3VA 3SR1A 2F0EA 3T16A 5IGDA 4ZQ3A 4K14A 4H7BA 4IALA 1EY0A 1RKNA 3OMGA 4WORA 1II3A 5KIXA 3DHQA 1F2YA 4HTHA 3MEHA 1STAA 4K5XA 2QDBA 5C3XA 3NK9A 2F0KA 3NHHA 4RKBA 3TP5A 3QOJA 5JOBA 4K6DA 4S3SA 2EXZA 1STYA 1SYBA 4K2KA 5CV5A 1STGA 2EY2A 5KGUA 3DMUA 2EY1A 3MVVA 4DGZA 2RBMA 3QOLA 4QF4A 1EY5A 1SNPA 1TQOA 3MXPA 1KAAA 3SK8A 1STHA
chains in the Genus database with same CATH superfamily
5FOBB 1DOKA 2LXJA 3TS0A 4DV5Q 3H15A 1JE5A 1ENFA 1L0YB 1V1PA 2JJQA 1QUQA 5CC4A 5IIFA 4KJOA 4A3LH 4LK1C 5LMUQ 4JBJA 2JA7H 1EZ8A 4B3RQ 3QG1A 1SMYD 2OTLA 1TIID 2A69D 1VQ4A 1J8IA 5IWAQ 3I4OA 3KLSX 2JN4A 4BY7H 3SHLA 3SVMA 3RLNA 3HOVG 4AYBG 1T5XD 1H95A 1IHZA 1SJHD 4YCWA 1LABA 1VQ7A 4B3ML 3K7AB 1QVFA 4ODGA 4DV1L 1BO0A 4LUVA 1E2ZA 4OL7A 3F2DA 1QZHA 3MFYA 1B53A 3OWFA 1IZ6A 1EIFA 1Q86C 1IW7D 1AE3A 1TT2A 1G291 1ENCA 5IYCG 3FEWX 4AYBB 1JR0D 1CZWA 2Q2IA 1EL0A 2G5DA 3M7NA 1EQRA 4XTCS 1PDQA 4C3JH 3M85A 4NKLA 4BBRB 4JYAL 4BY7G 1A2UA 5FJ8H 1N34L 1EZ6A 4APVA 4EQOA 5DAUA 1D5XC 3S1NH 5DLQE 3J81j 2MO1A 5IYBG 4A3MG 2TMPA 1KC8C 1KLGD 1HNZQ 1LV9A 4K5VA 1B9NA 1E7ZA 1RODA 5E7NA 3FRPB 2Z6KC 1A3VA 2UXDQ 1G6ZA 4A3DH 4IALA 1RCVD 4DV2Q 2NN6I 5IYDH 2AKWB 1QVGA 3IRBA 2QGQA 5CBEE 2ZJQA 3GTKH 1NY4A 1CHPD 2H5XA 4HEDA 2MHVA 4G7ZC 4DR6L 2QDLA 2WKDA 3ERSX 3WWVA 3N6RA 3PIO3 1GUSA 1RJTA 4FXKC 1SNPA 4DV1Q 1R9TB 3W1GA 2F0QA 5C6AA 1I50H 1UUPA 5EKKA 1DYQA 2OQ0A 4XIGS 5FJ8G 1CKNA 1JJ2A 2I46A 1ET6A 1GO3E 3GV3A 2C35B 3HP3A 4KD4A 1LT4D 3VA5A 4ZRZA 3SK4A 1GJXA 1CK1A 4H02A 3EA6A 4JI8L 2B8GA 2I07B 3QWNA 2HUGA 3BVZA 1TWAH 3T13A 4OO1G 2KENA 4DR3L 4FO2A 4KHPQ 1ILQA 3S24A 5IGGA 1Y69U 3VR6A 2VNUD 3R3OA 4BY1G 1SBBB 5K36H 4L5QA 3X3NA 3WOEA 4HIDA 4A3GB 3OMCA 2DUDA 4A3EG 1PH3A 3PUVA 1V1OA 1I4PA 2F0HA 4MZ9A 3H6MA 1Q1BA 3KJOA 1B1ZA 5JVH3 1A15A 1TWFB 4EQNA 1VF5C 3NTIA 2JSOA 2F0OA 5J1ZA 4LUOA 3PO2G 1SNMA 3K8AA 3FKIB 3CC2A 1K3RA 1SE8A 3IFDA 2LS01 4JI2Q 3HZXA 4TVAB 1UEAB 4ALPA 4MIUA 3I70A 3M7GA 2B39A 2F0TA 1U4PA 3V2TA 5E4XA 4QGUA 1WD0A 4LFBQ 1KABA 2CH4W 3HG9A 3HOYB 2QF7A 2R92B 4NMZA 4L63B 1EEID 5IODA 1JJCB 1FJGL 4DV3Q 2C5CA 2F0JA 2IX0A 1BBUA 4EQPA 1K8OA 4CJ1B 4I7ZC 2A6HC 2F0PA 4R4CA 4A3BB 1AH9A 2IHEA 2F0SA 1HR0W 4BWGB 4WJ4A 3GTOB 1SFOH 1UE1A 2R61A 1FR3A 3UDIA 4A3MH 2I0QA 1T9HA 3NPPA 4O42A 3VYRA 1OXUA 2RVLA 4Y7NB 2JA6H 4GKJL 1H9RA 2N78A 5IY0A 1VQ5A 4PZ7A 2RBMA 3NQIA 2QCPX 1O78A 1K28A 1STHA 5C4XH 4QMGA 4LJZC 4LFCL 4X62Q 3D4WA 5IOCA 2ASBA 2B63B 5EJWA 3RZOB 1PFSA 1PRTF 4A3BG 1HJPA 2WAQG 1Y1WH 2L0CA 3Q0AA 2HHHL 4TRDA 1PMRA 5CYUA 2DY7A 2L5TA 1QOHA 3S15B 1KL9A 4OWTB 2XGTA 4DUZL 1I4GA 2PMZB 4WJ3M 4KY7A 4JG2A 3AFQA 5M5WH 4IUQA 3GP7A 4DR1Q 2WKCA 1XPRA 1V1PB 1E2WA 3K6OA 4C3HH 2PI2E 1RDPD 4UP9A 4GLVB 3D0FA 4DK1A 5IE8A 1PH7A 1NAPA 5I2XA 2EOTA 5IT9L 2HD3A 2E74C 1VQGA 1EWIA 2CHBD 2CW0D 2E2JB 1XMQL 5GQOA 1C0AA 5I9OA 1NMGA 3BVMA 4G57A 1SYEA 1HQRD 4A3FG 2PNHA 5C4ZA 1S5BD 3OPOA 3M4OH 2F3WA 3MTSA 2VXWA 5JJKA 4F88A 2EVBA 4HIMA 2EQSA 4EVOA 4HMJA 1PTOC 3AMUA 1IYJB 5IGFA 3NTKA 3A74A 3W2DA 4JI4L 1QJOA 3NWSA 1VQJA 2D2CC 1CM9A 4LF7L 3PIOA 3LWUA 2N49A 2K14A 4HIOA 3I72A 4A75A 4RKLA 3D6WA 1KXLA 4IJLA 1PRTD 1TY2A 3I8ZA 4JI0Q 2Q8TA 1V9PA 1JE4A 5HGTA 4X3SA 3S17H 4HR7B 2DGYA 4DN4M 1GM5A 5C3EH 4LF6Q 3K80C 4ZQ3A 5KIXA 3KOJA 4WORA 3T1YL 2WFWA 4FYDA 3MEHA 2I5HA 1T5EA 3NHHA 4RKBA 1Y8PB 1PFBA 3WOFA 3DWAA 2F4VQ 4O1NA 4K2KA 2A74C 3S14H 2ZXPA 4OIJA 4KHZA 4MNOA 4DR3Q 3J80E 1JOQA 1LO5D 1TKWB 2JXMB 1CT1D 3SXHA 4DR6Q 1HZBA 1D1IA 3V96A 3H3VI 3PO2B 4WJWA 2PZWA 4XQQA 1HXYD 1EY4A 3H0GH 3CQZH 2CWPA 3HOZB 5AJ3Q 4JOIA 2XNAC 1EIHA 3PCOB 3L3OC 3PQIA 4YIJA 4B9WA 3DWQA 1OXVA 2R7ZG 3STBC 2A69C 2JA9A 2AQ1B 4U673 4A3BH 3ICEA 4R9WA 3DWPA 4HIKA 5M3FG 5C0XH 1I4HA 4L5RC 1S3OA 3I55A 1KIXA 3I7FA 5BR8Q 3CRLC 3HEJA 2F0NA 1DOLA 4MN3A 3WDNA 3CCEA 3DLLA 4CKBA 2CQAA 4P72A 3J81i 3PUZA 2HQEA 5K5PA 3CPWA 3H0GG 1PRTB 4P75A 5CV7A 4PMWA 1EY9A 4Q0FA 1K0RA 4DXGA 1WYDA 3PO3G 4IUVA 3FMCA 1OXSC 3C1FA 1I4QA 1IL2A 3M3YH 5C4JB 1I50B 2K4KA 3M4QA 4DUYL 3A7AB 4DV3L 4B3TL 3S9WA 4B3MQ 4FF2A 2FMCA 2KEEA 4RHSA 2LFNA 4XXEA 2Q2TA 1P16A 1YJWA 1KLUD 3PSIA 3FPUB 4ZKCB 1PZID 3NEMA 3CAMA 1PH6A 4X66L 3F8TA 3S1RB 1BKBA 1EFID 3MC0B 2O4XA 1BBWA 3D31A 2O2LD 3D4DA 4XQJA 1VQ8A 1WI5A 1Q8KA 4KY6A 3K59A 4DR7L 2E2JH 5G3LD 1D5MC 2F0KA 3K7AH 3LGJA 3S1RH 1SSOA 1O7LA 1RF2D 3QOJA 4QUFA 4RFBA 1Z47A 2LY7A 1WJJA 4LWCA 3EIVA 4JVZA 5IP9G 4A3GH 3DEOA 2B2YA 1HNXL 2EJFC 4FNFA 2M9VA 2EY1A 3UDGA 1CUKA 2FHTA 3S1MB 1OXXK 2PMZE 5CR3A 2M2LA 3RZDB 3HOYH 2IWHA 1ONLA 1NR2A 1Y14B 2F0MA 1B2TA 4BY1B 2K04A 4A3KH 1G8ZD 1V8QA 2Q2HA 3NE5B 3RN2A 1DONA 1CQFA 3H3VC 1M90C 2HCIA 4F7XA 2H1EA 3DM1A 4DUZQ 3RD4A 1SNOA 2AHOB 1SYDA 2N88A 5M3FB 3E9HA 2MPMA 2EZVA 5CV8A 5ELCA 3S1NB 1BCPC 1CSPA 3U9OA 1SE3A 4L5SA 4XQNA 4E6IA 3U58A 2VUMG 4DKAC 4CGYB 4YY3Q 4GOPC 1UE5A 1QUQB 1R4PB 2Z6BA 4DA2A 1JWMD 4O2DA 2HT1A 4J6HA 4R4TA 1D5ZC 2RQXA 4JI6L 4DV7Q 5ELFA 1E3PA 4C1NK 4ME3A 3K0YA 3TMEA 4IO9A 1MHWC 4DAVA 1MIUA 4G7HC 2IX3A 1I4XA 4JI5L 3MAQA 3CCLA 2RDHA 3A5UA 2F3VA 1RL2A 4NPSA 3P20A 3SK5A 4ZUJA 1JJGA 3IFTA 4C3IH 2A68D 1SE2A 2PZUA 2F4VL 1HR0Q 2IW3A 1GUWA 4DV0L 1GKHA 5HY6A 4LFBL 2HIXA 3X3MA 3JAML 3J7YW 1G6PA 1STEA 3MXUA 3BYYB 4HN7A 5IGDA 2V4DA 3LNNA 4Y52H 3F2CA 3EN2A 4M8AA 1GHJA 3BJUA 5EKIA 2NVQH 2A1AA 1C9OA 5C3XA 3K5MA 5I4DA 1VMCA 4KN7C 2WAQB 3M9BA 2GA4B 1B70B 4A4IA 5KNCA 1AN8A 1IKMA 1HA6A 5IYCH 5JPMC 4BA2I 2PQAB 2OWOA 3MXPA 4RG1A 4BXXH 1GUTA 3CCRA 2ICEC 1DOMA 4IFDG 1PH8A 4K8JA 3GTLB 1I94Q 5IP9H 1P8LA 1V1QA 2B8FA 2MQHA 3MHBA 2F0UA 1I4RA 2LXKA 5DNFA 1JB7A 2KHIA 4KD3A 3S1QH 2I5LX 3NQTA 3J81L 4RGNA 1HUMA 2IHFA 1EUJA 1GD7A 3OWEB 4YWLA 2DNCA 3BDOA 2ZJPA 1YNJC 1CFMA 1TS2A 4JPBW 2E2IB 5KRUA 4H13C 1Y1VB 5ELBA 3T56B 3T53B 4N9PA 2UXDL 4A3MB 2PPBC 1J5EQ 1K8MA 4B3TQ 3MXNA 3ULLA 3CD6A 2VB3X 3CXCA 4QY7A 2PZTA 2E2IH 2X6LA 3SK6A 1CZGA 5LL6S 2DN8A 3J81c 2JEAI 1LTID 1S5FD 4B9XA 4KI0A 3BU2A 3D8GA 1VQBA 3KF6A 3KK7A 2KCMA 3TRZA 3S14B 1EWCA 4BBSB 1RTNA 2E8GA 2EJGC 4LFAQ 1N36L 4B3SQ 4OO1H 4HSPA 1LLRD 4DK3C 2KHJA 3CCVA 1S5ED 1WD1A 2GVBA 2EXDA 4GNXA 4IUPA 4JCVE 1AFPA 5K36G 1BF4A 3GQBA 3R8BA 1YVCA 1HZ9A 4QL5A 2EYHA 1Q46A 4KHVA 2Q8IB 2EYLA 2NUCA 4C3IG 5CV4A 2F0EA 2UUBQ 4H7BA 1NTGA 1IYVA 1M8AA 3QR8A 3S2HB 3R2TA 1I6HB 1XPUA 2K28A 1YHQA 1IBMQ 2E2HH 1MKHA 5KNBA 1YEZA 2B3GA 1L1OB 1LTSD 1ML0D 3KJPA 1HCZA 4JI0L 1GHKA 2G9HD 2VS1A 1KDBA 1KNEA 2BA1A 4R4OA 3CCUA 3UE0A 1NUCA 2QA4A 3RN5A 4UP8A 1FNWA 1J9OA 1WOCA 2VY3A 4DAYB 3DXJC 5C0XG 2R6GA 1MI2A 3HOXH 2FMMA 2G9DA 1RIPA 4ABNA 4LFAL 4MTNA 4GS3A 1VQCA 4P74A 2F0LA 1SNCA 4OEMB 1K0SA 2K6AA 4IOAA 3MZ5A 1FJGQ 4JI7Q 3DM3A 1TWHH 5C3EB 1KDAA 5KYLA 2F0DA 1OTCA 2RKSA 1WTXA 1BVSA 3RNUA 3PIPA 4JYAQ 4C1NI 2B2VA 3UDFA 2B29A 1BCPF 1HHVA 2RDFA 2Z4HA 3OTOL 3HOUG 4DAMA 4JI5Q 4ZK9B 1IBKL 3VR2A 4ZLTF 1TS4A 2BDOA 1A6XA 5ELOA 1MJCA 1PXUA 1VQAA 1X54A 4RWSC 4A3EB 5GROA 2B2WA 1W6JA 1BQQT 4GKKL 2L55A 4LUZA 1WCMB 3Q8DA 3IL8A 4BS9A 1PZKD 2JA5H 3K5NA 4HSVA 1A63A 4DNTB 4DFAA 4JBWA 3JAMi 2NBFA 1W2BA 5FLXL 3R93A 2LKVA 2JA5B 1DXMA 2R7ZH 2R92H 2YU9H 2MGSA 2B2WC 4K2LA 3E0EA 1SEBD 3V05A 3EROA 1AP0A 1SJED 1CA5A 1EY0A 4K6LA 2KJXA 4I7AA 2CVRA 5M3FH 1HFGA 1K8GA 3HOYG 4ZAIA 4J8QA 3VYUA 1UEBA 4LF7Q 2XRSD 5JOBA 2QEJC 1MSHA 4TQUS 3N52A 4GN4B 4KHPL 3DMUA 4RCNA 3QOLA 2R7DA 1TQOA 3FP9A 5JVG3 3SK8A 2RF4A 4N8FA 4O0AA 1TVXA 4A93H 1XNQQ 3U9SA 4JI2L 3QB3A 4DR5L 3A8JE 2EYJA 4AQYQ 2B63H 5E4WC 1BCPD 1Q8IA 1LTBD 4FP5D 1GUGA 1EY8A 2X69A 4GN5A 1A3TA 4K8IA 1YNXA 3HRZC 1CTMA 4A93B 4KTAA 5JAVA 1BNZA 1F77A 3W3AA 4IJHA 4N9TA 1KQSA 5JEAG 4CJ2C 1GUOA 2VQFQ 5IT9c 2JP1A 4JI1L 1H9SB 2HDMA 5GADC 1U4MA 1VDZA 1J6QA 1XYIA 4JV5L 2K01A 3A0JA 2N55A 1TWHB 3T1YQ 1ZXTA 3L0OA 1PTOD 3I4LA 2ID0A 3LWEA 3TQYA 1E1OA 3GTPH 3OIPA 1JB3A 3KFUA 1MSGA 4POGA 3L7ZC 5FLMG 1SNDA 3S1QB 3MA2B 1W3SA 3NBHB 2WIIB 4JW0A 2A6ED 1XX8A 1HNWQ 2NTTA 1R4QB 4MHEA 1N34Q 5J39A 3HOUH 3S17B 3OW2A 2UUBL 2B2UA 5CV6A 1WTVA 5HURA 4QIWE 4FXGC 4IPCA 4JI3L 1Y8OB 5G3LF 2VQEQ 3UI2A 5D3DA 1VQ9A 2RA4A 2K7VA 2B2TC 2NZHA 1UNSA 1PTOB 2UUCQ 1HTLD 2JA5G 5C44G 4LF4Q 3KDFB 1YBYA 1KNAA 3RLFA 1FGUA 1LTGD 4KK7A 1D7QA 2KUMA 3GTMH 4BBRG 4BXXG 2JQOA 4BY7B 2JK8A 1PTOH 5CBAE 4QUCA 2NTSA 4HCSA 4DV5L 1PYSB 3VYTA 1EIYB 2CFMA 5FK9C 1K8AC 1G91A 1G2TA 2K33A 2AQ3B 4DGZA 4R4IA 4L6TB 1KAAA 2UU9Q 4IN3A 1ESRA 5LMUL 5FO9B 3JC66 3GTQH 4HJ5A 1O7IA 1NJIC 1U4LA 4JI8Q 1F9QA 3AEVA 1JOOA 2AQ2B 5JPNC 1TR5A 3A7LA 1HNWL 1I3QB 4DV4Q 1PTOF 2D5DA 3CCMA 1CSQA 4IQZA 4P71A 2AMCB 5F2DA 4ZKBB 4A93G 3S15H 4KKSA 2O5IC 4R1JA 3OTOQ 5M5XB 1QNUA 1SMYC 4K5WA 4RGOS 4A3IB 3GTJB 2QILA 4LW1A 2NN6H 1F2ZA 3HKZB 1WTRA 3I4NB 4L8JA 1R9TH 4BBRH 3BZCA 2K5NA 3Q22A 3T4AC 1IXRA 2RCFA 3HGBA 5M5XH 4GOPA 4A3DB 3GDEA 2OEOA 5EPJA 4DR7Q 2YTYA 5EAYA 2UU9L 2M00A 3KF8B 2WV6D 2X6GA 3T1HQ 4A3FB 4BBSG 4GKKQ 4LAAA 3ER0A 1SR3A 1LT5D 3K5OA 1A2TA 2NVYB 3OHXC 2QEXA 4XDXA 5IGBA 4J15A 2RSOA 1ASYA 3AYHB 4FVMA 4IUUA 4EX5A 2ZTCA 4A3JG 1Q1EA 5A2QL 1VQEA 1XMOQ 1XNRL 2MFIA 1X9NA 4NB3A 3VDYA 1EOVA 3FHWA 2J0TD 2ZTEA 2Z4IA 2JA7G 1VQOA 4CDEC 5BN4A 2SNMA 1PRTC 1BOSA 1IBLL 5C4HA 1YHAA 1L1OC 2KCCA 4HJ7A 1PVOA 3ONAB 5JJIA 1VS0A 1IKLA 2V1CC 2N3SA 1H9KA 4DR4Q 1ZYRC 3H94A 1XNQL 1LT3D 3VR4A 1TWAB 1Q3LA 2I5MX 5IP7H 1RKNA 5ELNA 2K5DA 2K5WA 4HTHA 1FNVA 3KF6B 2A6EC 3EFXD 4BY1H 2F4IA 4S3SA 1ILPA 1E1TA 1QCBD 1Y1VH 3HKSA 1A62A 1BXTA 1JICA 4YHHQ 3T1HL 2YV5A 3SDZA 1XXGA 2D62A 2BH2A 4CHTB 4C3JB 3KF8A 3CW2C 3A8KE 1WVLA 1XTDA 4U68A 2OCEA 1SE4A 4A3GG 1FGBD 2ZJRA 2IY5B 4GN3B 1K3BC 1CA6A 1QG7A 5GAGC 3TP8A 4PMCA 3BDLA 5TSSA 4XYOA 2BDNA 1Q81C 2IL8A 4KLKA 4JK1C 3R2IA 2JA6B 3C1EA 4R8NA 3PF5A 4PG3A 1B8AA 5EPKA 4V190 1EEFD 1FNUA 3L9AX 1JOKA 2ALYB 3HS0C 4X66Q 2CWAA 3FKIG 2QW7A 2JEBI 3CP0A 4A3KG 4OONA 3OYYA 1CQVA 4NW2A 2Z9HA 1PV4A 2KA7A 5C44B 5IGCA 1CKMA 1HUNA 2YTXA 2DY8A 2EPBA 2YU9B 2NYZD 2NN6G 2VL6A 2MJ8A 5EPLA 1I6HH 2B2YC 3C2PA 1L1OA 1EU4A 3KBGA 5C5MA 1PYWD 2JA8B 2WACA 1DJRD 2N8NA 4P73A 4NDXA 3IAYA 4IFDI 1DD2A 2RHSB 1VQMA 2K5QA 3BDCA 4J1MA 2UXBL 1XTCD 2F52A 2VUMH 4DU9A 1F2MA 2WB1G 3G48A 4JBKA 4KN4C 1AEXA 1MGSA 1U0LA 1G51A 1TXYA 3A8IE 5A35A 3D3RA 5E1FA 5GAHC 1J5EL 2HCCA 4TKOB 3PMFA 3CC7A 4ZYSA 2A6HD 1HFNA 2NVQB 3SGIA 1AW7A 1HNXQ 2UUAQ 5C4JH 4UP7A 5C3EG 4RMFA 4FDBA 4YCVA 4LF9Q 2JA8G 3MFGA 1VMPA 4EGVA 4RH6A 3GD7A 4IUTA 3I56A 4JI3Q 3RMHA 1LM0A 1LTTD 1EOTA 1AZQA 4UAIA 5DEHA 2Y0SB 4PV1C 1QZGA 1GUNA 1YJ9A 3SR1A 5M3MG 1X3PA 5HGQA 5L37A 3OMGA 1II3A 4HCEA 2PNRC 3NELA 2SEBD 1VCIA 4UPAA 2BOSA 4OWXB 5GAEC 1STYA 2VW9A 5C0XJ 5COYA 5EQ0A 4ILWA 3TBIB 4DV7L 2HIVA 3K57A 1EY5A 3BZKA 1D2BA 3K58A 2AWNA 2Z1CA 4IFDJ 2WAQE 4X3KA 1D8LA 2XVSA 5DM63 2LSSA 1L0WA 1NBWA 2XSCA 3D4RA 1O7YA 1H9SA 1JWSD 3RLOA 3EQLC 1SNQA 1UWVA 1QB5D 2XTIA 2NB0A 2NVTB 1EYAA 2L15A 1KAWA 2MO0A 1Q7YC 1S5DD 4A3IG 5IGEA 4CKEA 3J80c 4LF5Q 4DR5Q 2WB1B 4Y7NH 4AQYL 2NWGA 1S4ZA 1SYGA 2R7ZB 3OSOA 4POFA 4C2MB 3TREA 4KY5A 1I6VC 2JYOA 1WTWA 1XMOL 2K75A 1XNRQ 3GTMB 3K81C 3F2BA 4IZ8A 3RZOH 3S16B 2GN5A 2HQLA 2B2UC 3TP6A 3KLSA 1HRJA 2AUKA 4A3CG 3VR3A 4JI1Q 3JAME 1I94L 2E76C 4PQXA 5FLXc 4IPDA 2TSSA 5ISRA 5J22A 1CHQD 4NXNL 3GTQB 4DR4L 2F03A 1O80A 1N32Q 2ENBA 2SOBA 3FVQA 1WTQA 1X3QA 3LX0A 2E2HB 2XN9C 3A55A 1ZYRD 5KYIA 4HJ8A 1IBLQ 2KQ3A 5NUCA 4Q5VA 1PFMA 4F87A 2BE5C 4CDDC 3E6ZX 4B3RL 4DR2Q 2AWOA 2JA8H 2Z0SA 4OXPA 1YITA 3CRKC 1PZJD 2Z6KA 2AUJD 2D0PA 1TWGH 2EXZA 2RCNA 4IURA 1Z7TA 3GTPB 1FVIA 4OELB 4LF6L 4QF4A 4C3IB 1N36Q 1W6KA 3NWTA 2KCTA 4YY3L 3E9IA 1NMFA 3HOUB 4KJNA 4XT3B 2A73B 2J7ZA 5J3BA 1YNJD 2OTJA 4HJAA 1B44D 4X65Q 2BH8A 5C4XG 2YTVA 5EBCA 4GNXB 2Y0SE 4JC0A 4FF3A 2MUYA 1Y1WG 3S1MH 1AZPA 4ID6A 4RA8A 1L0XB 2EDGA 3ND9A 4RAUC 2Z8LA 1MD2D 3STBD 5JJZA 1HR0L 1VQ6A 1N33L 4A3JH 4QJFA 3E3XA 4QB4A 1B4OA 2YYZA 1I5FA 4DK0A 2CH4A 1K83H 1KTKA 4GZYC 4IPHA 4V0BA 1YJNA 3G4SA 1NE3A 2EJMA 1HA5A 3CKIB 3M4PA 4OWWB 3HKZG 5IYBH 3CPFA 1NCVA 1S5CD 1Q12A 2E5LQ 3QIAA 3SEBA 1EYDA 3RZDH 4IOCA 1FYCA 2MP1A 5DM73 4GOPB 2EY6A 3TP7A 4DV0Q 1EY6A 5I2YA 3F1ZA 2A68C 3ZYYX 1GOZA 3TZUA 5LMNQ 2E75C 5H1SE 1SMXA 2OT2A 4A76A 3GTGB 1Y1VG 4B08A 4X3TA 4DF7A 2ATWA 1SFOB 4MTKA 5C3WA 1LTAD 3TZDA 4R8IA 1M1KC 2WP8J 3RR5A 3IKJA 3CQZB 4JBMA 1CKNB 2LMCB 3B6YA 1TWCH 2H4OA 3BYTB 1XPOA 1LTLA 3GTOH 3HOVH 3Q23A 1HTPA 2RDGA 4YCUA 3O13A 1TWGB 1LYLA 4X64Q 4QQBX 1DGSA 1B3QA 1CKOA 2F3IA 5E3FA 4KKTA 3NSWA 4OX9L 1HPCA 2R93G 1QE6A 3J7AV 1RHPA 4LF8Q 1WTOA 5AJ3L 2WB1E 3URYA 1BUVT 3E5SA 3ULJA 3NUCA 2PW7A 3OW7A 3BS1A 3ZJYC 2XWBB 1C4QA 1HNZL 4XYQA 4DK6C 1X6OA 4YHHL 3VYSA 3TEHB 2C9OA 2PYKA 5BR8L 3T51B 3A56A 4X62L 4LFCQ 4FXDA 4RCOA 1VQHA 2KVMA 5JEAH 4NXNQ 3I4MH 4GNXC 5EKLA 4P2CB 3CMEA 2ZTDA 5JJLA 4A3DG 1SYCA 1LT6D 3BZDB 3S2DB 4GKJQ 4OIKA 1D6EC 1NR4A 4HMIA 1XJVA 1IW7C 4CDCC 2Q8RE 3NXWA 3I4MB 1WCMG 3W5OA 2UXBQ 4X3UA 5T1GA 4IUNA 2EYMA 2PQAA 5IT9E 5ELEA 2KEDA 2Y0SG 4B3SL 1U4RA 1X3FA 3AQQA 2XWJB 4FF1A 3PV0A 4A3KB 1YNND 3CCSA 3MEFA 5M3MH 1A3UA 2OQKA 4JV5Q 1ICFB 4F8MA 2HHHQ 2JA7B 3KLWA 4Z9CB 2ZM6L 4QCLA 4LF9L 3A54A 1N32L 3KDFA 1Z9FA 4DXFA 3S16H 3MWYW 1B50A 1TS5A 4BBSH 3G71A 1PH4A 2K5HA 4H0LC 3W1BA 1STAA 2RSNA 2XRQD 2K32A 2Q2UA 1LTRD 1B7YB 3TSSA 2NZOA 1WCMH 3PGZA 5FO8B 5T1IA 5C44H 2B2VC 1XMQQ 1GVPA 1WFQA 3G7LA 3SE0A 2VQFL 3H09A 2VZAA 1HZAA 3P7JA 4OGQC 5KNDA 2RHQB 1PLFA 5CV9A 3EJIA 4ZUIA 1H9JA 4KV6A 1U9RA 2ZM6Q 1PHJA 2R93B 4M1UB 3PO2H 2MNAA 3BVGA 2EY5A 4XT1B 1UE7A 2F0VA 1VQLA 4UHVA 4JI4Q 1BBXC 4RGMA 5FO7B 3F2UA 1WTHA 1ZKOA 3J80L 1JORA 3PUWA 5C4XB 4X65L 4RHRA 4TSSA 4DV6L 2NVYH 4AIMA 1KHIA 2ZXOA 3C3LA 1DZ1A 1TWCB 3U4ZA 3H91A 1Y1WB 4ZCKA 1X65A 1H9MA 1Z6HA 3J80i 5CORA 3ULPA 1PH1A 1EYCA 1KRTA 1YIJA 1KDCA 2B2TA 2VQEL 4RGTA 3PIP3 4A3CH 2VUMB 2K03A 4R4QA 2OF1A 3A5ZB 5FKAC 3C46A 1D1KA 1CI3M 1C48A 5M5WB 1E2VA 2R7FA 4PZ6A 1VQIA 1EU3A 5BN5A 2K52A 3ERQA 2UXCQ 1VQNA 1IYUA 2PQEA 3I4MG 3RUZA 3M3YB 1STBA 4PZ8A 2ES2A 4ULLA 2BE5D 3PO3B 2R3ZA 3CMAA 5LMNL 3J7AF 3FKIH 1X3EA 2DJGC 3QJYA 1VQDA 2A5HA 4K0KQ 4GLAC 2J4XA 4CDFC 5I9PA 3P75A 2L4NA 4AH6A 4DNIA 5M3MB 2IPKD 1JQYD 1F2LA 3D6CA 3HOXB 1VF7A 4KKUA 2HDLA 4A3EH 4NXMQ 4BA1I 3VA7A 4JI6Q 2EYPA 3E0JA 1NSNS 1MJEA 2NVTH 2KBNA 3KLRA 5LHY1 5JEAJ 4X64L 4HJ9A 1VQFA 5AFWA 3JAMc 4GLXA 3AB9A 4AYBE 3CC4A 1M4VA 1QVCA 2A8VA 1FL0A 1SYBA 2B63G 1QNKA 1TWFH 3AU7A 3FPPA 1K73C 1YHBA 5CMDA 3FDTA 4X6AH 1BCPB 3TN2A 2CW0C 3NBHA 1DM0B 4OO1I 2P5ZX 5IYDG 1ASZA 3MXGA 4CBVA 1SYFA 2VB2X 2F0IA 3I90A 2FFKB 1OO9B 5EBDA 1PYBA 3ND8A 4PNYA 4IPGA 1EIGA 5D14A 1VQPA 3P1HA 4JI7L 3EBEA 3I73A 1PA6A 1STNA 1I3QH 1X32A 1JCKB 2XIWA 2PW5A 3U4VA 5EGTA 4IFDH 4UDUC 4YWMA 2KCNA 1YZ6A 1ET9A 1E24A 5LMNW 2K50A 3NENA 4C2MH 5C0XI 1FD7D 3I4NH 5M5YH 3M4YA 1PH5A 1Y8NB 1ESFA 5FLMH 5A2QE 2PCFB 2JA6G 1EY7A 5IWAL 2R92G 1PFNA 3CF5A 1RTOA 2BCOA 3K7UC 2K1BA 1NNXA 4DAYA 2UUCL 1SAPA 4LF4L 2L9HA 1X56A 2JE6I 1ENAA 3OIQA 4UY8C 5FLXE 2IJ0A 2OXPA 2QKIC 3CHBD 4I65A 2SNSA 1G2SA 4LNQA 4PMBA 1F9SA 3AFPA 1SROA 3DUZA 3HOWH 4N8X1 1HH2P 1E22A 3MXNB 3UDXA 3CCJA 3PUYA 1AE2A 1IBKQ 5C5LA 1SRUA 2NVXH 2CCZA 2DJFC 1JWUD 2E5LL 3M4OB 1LACA 1N33Q 4C3HG 3GO5A 3S2HH 2D9UA 2K05A 1GXDC 2F0WA 3I4NG 1HZCA 3PUXA 3HOWB 1B3AA 4ME5A 2CKZB 1BR9A 1C8CA 3GTLH 3U50C 2GVAA 1A0IA 1QWYA 4DV2L 1SLJA 4DAPA 4WRDA 2IT1A 1SN8A 2D0OA 3KUPA 1N8RC 4EQ5A 2ZT9C 1YNNC 5D3IB 1F2YA 1BDOA 2F1MA 4K5XA 2QDBA 2E2DC 3NK9A 2O5JC 5BN3A 3L2PA 1O7ZA 1WTPA 3CU7A 4L5TA 2EE1A 1ICWA 4OHJA 3BG3A 2WINB 4DR1L 3TS2A 4JOIC 3HKZE 4A3JB 4K6DA 5ELDA 1F9RA 3Q6SA 4WFN3 4H44C 4A3LG 1DCZA 1IL8A 5I6YA 3S2DH 1A8VA 1EWHA 1UE6A 2L1BA 1SXTA 4DPGA 3TDQA 1V43A 4DV4L 2PO4A 1S40A 4FF4A 3VR5A 1JT8A 4LF8L 3OOCA 2F0FA 4NP5A 2ICIA 2L11A 1X3GA 1ZEQX 3HOZG 1EQVA 3KYHC 1EQQA 1QILA 3DEPA 3QO2A 2KHSA 1HQMC 1Q82C 3ITPA 2IX1A 3G6JB 1IBML 3PF4A 2F0GA 4KMUC 3HOXG 3H3VH 5LL6X 4QIWB 4OX9Q 1K83B 4C56C 3I2ZA 4DV6Q 2EYFA 2L12A 5KEEA 3Q24A 4DR2L 3GTGH 2UUAL 2FJ2A 3J81E 1MBYA 4DUYQ 2FXQA 3K5LA 1OXTA 5CGKA 3GTJH 4A3IH 1TU2B 1RD9D 3K0XA 1N9WA 4C3JG 3GTKB 3J7A5 3HOVB 2NZ1D 1K9MC 2KOLA 4K0KL 3NP8A 4HAEA 2UXCL 1E0BA 1UAPA 1KRSA 3H0GB 4CJ0B 1EYGA 3HOZH 1L2FA 1PH2A 1TS3A 4A3FH 4NXML 1B9MA 5I6WA 1U5KA 2NVXB 4G7OC 3NBIA 2BA0A 4G4KA 4C3HB 2ZXRA 2R93H 5IP7G 4YWKA 4LF5L 3EVQA 4CKCA 1VQKA 1LUZA 2SDFA 2CQOA 3HFZB 1SDFA 3KBXA 1X55A 3HOWG 2EYOA 5M5YB 2DNEA 5M9OA 1JMCA 1S72A 1Q90A 1C7YA 1XWEA 1JC7A 2K5VA 3CCQA 2KECA 3T16A 3NTHA 4K14A 1KD1C 4DNRB 1YI2A 3G6EA 3DHQA 3UE1A 2PI2A 1F9PA 1TY0A 3TP5A 3GV6A 1EFWA 3PO3H 2FINB 5CV5A 5D65A 1STGA 2EY2A 5KGUA 2A19A 3I3CA 3MVVA 4LMQD 3J7ZC 1PH9A 3I91A 2EIFA 1EQTA
chains in the Genus database with same CATH topology
5FOBB 1DOKA 1ENFA 1L0YB 1V1PA 5CC4A 5IIFA 4KJOA 4LK1C 1EZ8A 3QG1A 1SMYD 1TIID 2A69D 1J8IA 3KLSX 3SHLA 3SVMA 1T5XD 1IHZA 1SJHD 1LABA 3K7AB 4ODGA 1BO0A 4OL7A 1E2ZA 3MFYA 1B53A 3OWFA 1IW7D 1TT2A 1G291 1ENCA 3FEWX 4AYBB 1JR0D 1CZWA 1EL0A 3M7NA 4XTCS 1PDQA 3M85A 4NKLA 4BBRB 1A2UA 1EZ6A 4EQOA 5DAUA 1D5XC 2TMPA 1KLGD 1LV9A 4K5VA 1B9NA 1RODA 3FRPB 1A3VA 1G6ZA 4IALA 1RCVD 2NN6I 5CBEE 1CHPD 4HEDA 2MHVA 4G7ZC 2WKDA 3PIO3 3N6RA 1GUSA 1RJTA 4FXKC 1SNPA 1R9TB 2F0QA 5C6AA 1UUPA 5EKKA 1DYQA 4XIGS 2I46A 1ET6A 3GV3A 4KD4A 3HP3A 1LT4D 3VA5A 4ZRZA 3SK4A 1GJXA 1CK1A 3EA6A 2B8GA 2I07B 3QWNA 2HUGA 3BVZA 3T13A 4OO1G 4FO2A 1ILQA 5IGGA 1Y69U 3VR6A 2VNUD 3R3OA 1SBBB 5K36H 3X3NA 3WOEA 4A3GB 3OMCA 3PUVA 1V1OA 1I4PA 2F0HA 3H6MA 1Q1BA 1B1ZA 5JVH3 1A15A 1TWFB 4EQNA 1VF5C 3NTIA 2JSOA 2F0OA 5J1ZA 1SNMA 3FKIB 3IFDA 2LS01 3HZXA 1UEAB 4MIUA 3I70A 3M7GA 2B39A 2F0TA 1U4PA 3V2TA 5E4XA 1WD0A 1KABA 3HG9A 3HOYB 2QF7A 2R92B 4NMZA 4L63B 1EEID 5IODA 2C5CA 2F0JA 2IX0A 1K8OA 4EQPA 4CJ1B 4I7ZC 2A6HC 2F0PA 4A3BB 2F0SA 4BWGB 3GTOB 2R61A 1FR3A 3NPPA 4O42A 3VYRA 1OXUA 2RVLA 4Y7NB 1H9RA 2RBMA 3NQIA 2QCPX 1O78A 1STHA 4QMGA 4LJZC 3D4WA 5IOCA 2B63B 5EJWA 3RZOB 1PRTF 2L0CA 3Q0AA 4TRDA 1PMRA 5CYUA 2DY7A 2L5TA 1QOHA 3S15B 1I4GA 2PMZB 4KY7A 4IUQA 3GP7A 2WKCA 1V1PB 1E2WA 3K6OA 1RDPD 4DK1A 1NAPA 5I2XA 2EOTA 5IT9L 2E74C 2CHBD 2CW0D 2E2JB 5I9OA 3BVMA 4G57A 1SYEA 1HQRD 5C4ZA 1S5BD 3OPOA 2F3WA 3MTSA 2VXWA 4F88A 2EVBA 4EVOA 4HMJA 1PTOC 3AMUA 5IGFA 3NTKA 3W2DA 1QJOA 3NWSA 2D2CC 1CM9A 3LWUA 3I72A 4RKLA 3D6WA 1PRTD 1TY2A 3I8ZA 2Q8TA 1JE4A 5HGTA 4X3SA 4HR7B 4DN4M 4ZQ3A 5KIXA 4WORA 4FYDA 3MEHA 1T5EA 3NHHA 4RKBA 1Y8PB 1PFBA 3WOFA 3DWAA 4O1NA 4K2KA 2A74C 2ZXPA 4OIJA 4KHZA 3J80E 1JOQA 1LO5D 1TKWB 2JXMB 1CT1D 3SXHA 3PO2B 1D1IA 3V96A 4XQQA 2PZWA 4WJWA 1HXYD 1EY4A 3HOZB 2XNAC 1EIHA 3L3OC 4YIJA 4B9WA 3DWQA 1OXVA 2A69C 2AQ1B 4U673 4R9WA 3DWPA 5C0XH 1I4HA 3CRLC 3HEJA 2F0NA 1DOLA 4MN3A 3WDNA 4CKBA 2CQAA 3PUZA 2HQEA 5K5PA 1PRTB 5CV7A 4PMWA 1EY9A 4Q0FA 4DXGA 4IUVA 3FMCA 1OXSC 3C1FA 1I4QA 5C4JB 1I50B 3A7AB 3S9WA 4FF2A 2FMCA 2KEEA 4RHSA 2LFNA 4XXEA 1KLUD 3FPUB 4ZKCB 1PZID 3S1RB 1EFID 3MC0B 2O4XA 3D31A 2O2LD 3D4DA 4XQJA 4KY6A 3K59A 5G3LD 1D5MC 2F0KA 1SSOA 1O7LA 1RF2D 4QUFA 3QOJA 4RFBA 1Z47A 2LY7A 3DEOA 2B2YA 2EJFC 4FNFA 2M9VA 2EY1A 2FHTA 3S1MB 1OXXK 3RZDB 5CR3A 2M2LA 2IWHA 1ONLA 1NR2A 2F0MA 1B2TA 4BY1B 2K04A 1G8ZD 1V8QA 3NE5B 1DONA 1CQFA 3H3VC 2HCIA 4F7XA 2H1EA 3DM1A 3RD4A 1SNOA 1SYDA 2N88A 5M3FB 2MPMA 2EZVA 5CV8A 5ELCA 3S1NB 1BCPC 3U9OA 1SE3A 4XQNA 4E6IA 4CGYB 1R4PB 4DA2A 1JWMD 4J6HA 1D5ZC 2RQXA 5ELFA 4C1NK 3K0YA 3TMEA 4DAVA 4G7HC 2IX3A 1I4XA 3MAQA 2RDHA 2F3VA 3P20A 3SK5A 4ZUJA 3IFTA 2A68D 1SE2A 2PZUA 2IW3A 1GUWA 3X3MA 3JAML 3J7YW 1STEA 3MXUA 3BYYB 4HN7A 5IGDA 2V4DA 3LNNA 4M8AA 1GHJA 5EKIA 5C3XA 3K5MA 5I4DA 1VMCA 4KN7C 2WAQB 2GA4B 1IKMA 5KNCA 1AN8A 1HA6A 5JPMC 4BA2I 3MXPA 1GUTA 2ICEC 1DOMA 4IFDG 4K8JA 3GTLB 2B8FA 3MHBA 2F0UA 1I4RA 5DNFA 4KD3A 3NQTA 3J81L 4RGNA 1HUMA 3OWEB 2DNCA 3BDOA 1YNJC 1CFMA 1TS2A 2E2IB 5KRUA 4H13C 1Y1VB 5ELBA 3T56B 3T53B 4N9PA 4A3MB 2PPBC 1K8MA 3MXNA 2VB3X 2PZTA 2X6LA 3SK6A 2JEAI 1CZGA 2DN8A 5LL6S 1LTID 1S5FD 4B9XA 4KI0A 3D8GA 3KK7A 3S14B 1EWCA 4BBSB 1RTNA 2EJGC 4OO1H 4HSPA 1LLRD 1S5ED 1WD1A 4IUPA 1AFPA 5K36G 1BF4A 3GQBA 3R8BA 2EYHA 2Q8IB 4KHVA 2EYLA 2NUCA 4C3IG 5CV4A 2F0EA 4H7BA 1IYVA 1M8AA 3S2HB 3R2TA 1I6HB 2K28A 5KNBA 1LTSD 1ML0D 1HCZA 1GHKA 2G9HD 1KDBA 1KNEA 2BA1A 1NUCA 1FNWA 1J9OA 3DXJC 5C0XG 2R6GA 1MI2A 2FMMA 2G9DA 4ABNA 2F0LA 1SNCA 2K6AA 3MZ5A 5C3EB 1KDAA 5KYLA 2F0DA 2RKSA 1WTXA 4C1NI 2B2VA 1BCPF 1HHVA 2RDFA 2Z4HA 4ZK9B 3VR2A 4ZLTF 1TS4A 2BDOA 1A6XA 1PXUA 4RWSC 4A3EB 2B2WA 1W6JA 1BQQT 2L55A 1WCMB 3IL8A 4BS9A 1PZKD 3K5NA 4HSVA 4DNTB 4DFAA 4JBWA 2NBFA 5FLXL 3R93A 2LKVA 2JA5B 1DXMA 2MGSA 2B2WC 4K2LA 1SEBD 3V05A 3EROA 1AP0A 1SJED 1CA5A 1EY0A 4K6LA 2KJXA 2CVRA 1HFGA 4ZAIA 4J8QA 3VYUA 2XRSD 5JOBA 2QEJC 1MSHA 4TQUS 3N52A 3DMUA 4RCNA 3QOLA 1TQOA 5JVG3 3SK8A 1TVXA 3U9SA 3QB3A 3A8JE 2EYJA 5E4WC 1BCPD 1Q8IA 1LTBD 4FP5D 1GUGA 1EY8A 2X69A 4K8IA 1A3TA 3HRZC 1CTMA 4A93B 4KTAA 5JAVA 1BNZA 1F77A 3W3AA 4N9TA 5JEAG 4CJ2C 1GUOA 2JP1A 1H9SB 2HDMA 1U4MA 1VDZA 1XYIA 2K01A 2N55A 1TWHB 1ZXTA 1PTOD 3I4LA 2ID0A 3LWEA 3OIPA 1JB3A 1MSGA 3L7ZC 1SNDA 3S1QB 3MA2B 2WIIB 2A6ED 1XX8A 2NTTA 1R4QB 4MHEA 5J39A 3S17B 2B2UA 5CV6A 1WTVA 5HURA 4FXGC 1Y8OB 5G3LF 3UI2A 5D3DA 2RA4A 2K7VA 2B2TC 1UNSA 1PTOB 1HTLD 1KNAA 3RLFA 1LTGD 4KK7A 2KUMA 4BY7B 1PTOH 5CBAE 4QUCA 2NTSA 4HCSA 3VYTA 5FK9C 1G91A 1G2TA 2K33A 2AQ3B 4DGZA 4L6TB 1KAAA 4IN3A 1ESRA 5FO9B 1U4LA 1F9QA 1JOOA 2AQ2B 5JPNC 1TR5A 3A7LA 1I3QB 1PTOF 2D5DA 4IQZA 5F2DA 4ZKBB 4KKSA 2O5IC 5M5XB 1QNUA 1SMYC 4K5WA 4RGOS 4A3IB 3GTJB 2QILA 2NN6H 1F2ZA 3HKZB 1WTRA 3I4NB 4L8JA 3Q22A 3T4AC 3HGBA 4A3DB 2OEOA 5EPJA 2M00A 2WV6D 2X6GA 4A3FB 4LAAA 1LT5D 3K5OA 1A2TA 2NVYB 3OHXC 4XDXA 5IGBA 2RSOA 4FVMA 4IUUA 1Q1EA 5A2QL 2J0TD 2Z4IA 5BN4A 2SNMA 1PRTC 1BOSA 5C4HA 2KCCA 3ONAB 1IKLA 1H9KA 1ZYRC 3H94A 1LT3D 3VR4A 1TWAB 1Q3LA 1RKNA 2K5DA 2K5WA 4HTHA 1FNVA 2A6EC 3EFXD 2F4IA 4S3SA 1ILPA 1QCBD 1BXTA 1JICA 3SDZA 1XXGA 2D62A 4CHTB 4C3JB 3KF8A 3A8KE 1WVLA 4U68A 1SE4A 1FGBD 1CA6A 1QG7A 3TP8A 4PMCA 3BDLA 5TSSA 4XYOA 2BDNA 2IL8A 4JK1C 3R2IA 2JA6B 3C1EA 4R8NA 4V190 5EPKA 1EEFD 1FNUA 3L9AX 1JOKA 3HS0C 2JEBI 1CQVA 4NW2A 2KA7A 5C44B 5IGCA 1HUNA 2DY8A 2EPBA 2YU9B 5EPLA 2NN6G 2NYZD 2MJ8A 2B2YC 3C2PA 1EU4A 3KBGA 5C5MA 1PYWD 2JA8B 2WACA 1DJRD 3IAYA 4NDXA 4IFDI 1DD2A 2K5QA 3BDCA 4J1MA 1XTCD 4DU9A 1F2MA 4KN4C 1AEXA 1MGSA 3A8IE 5A35A 3D3RA 5E1FA 2HCCA 4TKOB 3PMFA 4ZYSA 2A6HD 1HFNA 2NVQB 1AW7A 3MFGA 1VMPA 4EGVA 4RH6A 3GD7A 4IUTA 3RMHA 1LTTD 1EOTA 1AZQA 4UAIA 5DEHA 2Y0SB 4PV1C 1GUNA 3SR1A 1X3PA 3OMGA 1II3A 4HCEA 2PNRC 2SEBD 1VCIA 2BOSA 1STYA 5C0XJ 5COYA 5EQ0A 4ILWA 3TBIB 3K57A 1EY5A 1D2BA 3K58A 2AWNA 2Z1CA 4IFDJ 4X3KA 2XVSA 5DM63 2XSCA 3D4RA 1O7YA 1H9SA 1JWSD 3EQLC 1SNQA 1QB5D 2NB0A 2NVTB 1EYAA 1S5DD 5IGEA 4CKEA 2WB1B 2NWGA 1S4ZA 1SYGA 2R7ZB 3OSOA 4C2MB 4KY5A 1I6VC 2JYOA 1WTWA 3GTMB 4IZ8A 3S16B 2B2UC 3TP6A 3KLSA 1HRJA 2AUKA 3VR3A 3JAME 2E76C 4PQXA 2TSSA 5ISRA 5J22A 1CHQD 3GTQB 2F03A 1O80A 2ENBA 2SOBA 3FVQA 1WTQA 1X3QA 3LX0A 2E2HB 2XN9C 3A55A 1ZYRD 5KYIA 2KQ3A 5NUCA 4Q5VA 1PFMA 4F87A 2BE5C 3E6ZX 2AWOA 3CRKC 1PZJD 2AUJD 2EXZA 4IURA 1Z7TA 3GTPB 4QF4A 4C3IB 1W6KA 3NWTA 3HOUB 4KJNA 4XT3B 2A73B 2J7ZA 1YNJD 1B44D 5EBCA 4FF3A 2MUYA 1AZPA 4ID6A 4RA8A 1L0XB 2EDGA 3ND9A 4RAUC 2Z8LA 1MD2D 5JJZA 4QB4A 1B4OA 2YYZA 4DK0A 1KTKA 4GZYC 4V0BA 2EJMA 1HA5A 3CKIB 1NCVA 1S5CD 1Q12A 3QIAA 3SEBA 1EYDA 1FYCA 2MP1A 5DM73 2EY6A 3TP7A 1EY6A 5I2YA 2A68C 3ZYYX 1GOZA 3TZUA 2E75C 3GTGB 2OT2A 4B08A 4X3TA 4DF7A 1SFOB 5C3WA 1LTAD 3TZDA 4R8IA 2WP8J 3IKJA 3CQZB 2LMCB 2H4OA 3BYTB 3Q23A 1HTPA 2RDGA 3O13A 1TWGB 5E3FA 4KKTA 3NSWA 1HPCA 1QE6A 3J7AV 1RHPA 1WTOA 3URYA 1BUVT 3E5SA 3NUCA 2PW7A 3OW7A 3BS1A 2XWBB 1C4QA 4XYQA 3VYSA 2C9OA 2PYKA 3T51B 3A56A 4FXDA 4RCOA 2KVMA 5JEAH 5EKLA 4P2CB 1SYCA 1LT6D 3BZDB 3S2DB 4OIKA 1D6EC 1NR4A 4HMIA 1IW7C 2Q8RE 3NXWA 3I4MB 4X3UA 5T1GA 4IUNA 2EYMA 5IT9E 5ELEA 2KEDA 1U4RA 2XWJB 4FF1A 3PV0A 4A3KB 1YNND 1A3UA 4F8MA 2JA7B 4Z9CB 4QCLA 3A54A 4DXFA 3MWYW 1B50A 1TS5A 4H0LC 1STAA 2RSNA 2XRQD 2K32A 1LTRD 3TSSA 5FO8B 5T1IA 2B2VC 3G7LA 3SE0A 3H09A 3P7JA 4OGQC 5KNDA 1PLFA 5CV9A 3EJIA 4ZUIA 1H9JA 4KV6A 1U9RA 2R93B 4M1UB 3BVGA 2EY5A 4XT1B 2F0VA 1BBXC 4RGMA 5FO7B 3F2UA 1ZKOA 3J80L 1JORA 3PUWA 5C4XB 4RHRA 4TSSA 3C3LA 1DZ1A 2ZXOA 1TWCB 3H91A 1Y1WB 1Z6HA 1H9MA 5CORA 1EYCA 1KDCA 2B2TA 4RGTA 3PIP3 2VUMB 2K03A 2OF1A 5FKAC 3C46A 1D1KA 1CI3M 1C48A 5M5WB 1E2VA 1EU3A 5BN5A 3ERQA 1IYUA 2PQEA 3RUZA 3M3YB 1STBA 4ULLA 2BE5D 3PO3B 2R3ZA 3J7AF 3QJYA 2A5HA 2J4XA 5I9PA 3P75A 2L4NA 5M3MB 2IPKD 1JQYD 1F2LA 3D6CA 3HOXB 1VF7A 4KKUA 2HDLA 3VA7A 4BA1I 2EYPA 3E0JA 1NSNS 3KLRA 5LHY1 5JEAJ 5AFWA 3AB9A 1M4VA 1SYBA 1QNKA 3AU7A 3FPPA 5CMDA 3FDTA 1BCPB 3TN2A 2CW0C 3NBHA 1DM0B 4OO1I 3MXGA 4CBVA 1SYFA 2VB2X 2F0IA 3I90A 2FFKB 1OO9B 5EBDA 4PNYA 3ND8A 1EIGA 5D14A 3P1HA 3I73A 1STNA 1X32A 1JCKB 2XIWA 2PW5A 5EGTA 4IFDH 4UDUC 2KCNA 1ET9A 5C0XI 1FD7D 3M4YA 1Y8NB 1ESFA 5A2QE 2PCFB 1EY7A 1PFNA 1RTOA 2BCOA 2K1BA 4DAYA 1SAPA 2L9HA 2JE6I 1ENAA 3OIQA 5FLXE 2IJ0A 2OXPA 2QKIC 3CHBD 4I65A 2SNSA 1G2SA 4PMBA 1F9SA 3DUZA 3PUYA 5C5LA 1JWUD 3M4OB 1LACA 4C3HG 3GO5A 2D9UA 2K05A 1GXDC 2F0WA 3PUXA 3HOWB 1B3AA 4ME5A 1BR9A 1C8CA 1QWYA 4DAPA 4WRDA 2IT1A 3KUPA 2ZT9C 1YNNC 5D3IB 1F2YA 1BDOA 2F1MA 4K5XA 2QDBA 2E2DC 3NK9A 2O5JC 5BN3A 1O7ZA 1WTPA 3CU7A 2EE1A 1ICWA 4OHJA 3BG3A 2WINB 4A3JB 4K6DA 5ELDA 1F9RA 3Q6SA 4WFN3 4H44C 1DCZA 1IL8A 5I6YA 1EWHA 2L1BA 1SXTA 3TDQA 1V43A 2PO4A 4FF4A 3VR5A 3OOCA 2F0FA 4NP5A 2ICIA 2L11A 1ZEQX 1EQVA 1QILA 3DEPA 3QO2A 2KHSA 1HQMC 3ITPA 2IX1A 3G6JB 2F0GA 4KMUC 5LL6X 4QIWB 1K83B 4C56C 2EYFA 2L12A 5KEEA 3Q24A 2FJ2A 3J81E 1MBYA 3K5LA 1OXTA 5CGKA 1TU2B 1RD9D 4C3JG 3GTKB 3HOVB 2NZ1D 2KOLA 3NP8A 4HAEA 1E0BA 1UAPA 4CJ0B 3H0GB 1TS3A 1B9MA 5I6WA 2NVXB 4G7OC 3NBIA 2BA0A 4G4KA 4C3HB 2ZXRA 3EVQA 4CKCA 2SDFA 3KBXA 1SDFA 5M5YB 2EYOA 2DNEA 5M9OA 1Q90A 1XWEA 1JC7A 2KECA 3T16A 3NTHA 4K14A 4DNRB 3DHQA 1F9PA 1TY0A 3TP5A 3GV6A 2FINB 5CV5A 5D65A 1STGA 2EY2A 5KGUA 3I3CA 3MVVA 4LMQD 3I91A 1EQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0Q A;  5C6A A;  4QMG A;  5CR3 A;  3SXH A;  1KDB A;  1SYF A;  4K8J A;  5E3F A;  5EKK A;  3D4W A;  5I6Y A;  3QB3 A;  5IOC A;  2F0I A;  1NUC A;  2PZW A;  5CV9 A;  1EY4 A;  4KJN A;  1JOQ A;  1JOO A;  3EJI A;  4ZUI A;  2EYJ A;  1TR5 A;  4KV6 A;  1U9R A;  3MHB A;  4PNY A;  2F0U A;  4TRD A;  2F0M A;  4KD4 A;  1EY8 A;  3VA5 A;  4K8I A;  2EY5 A;  1A3T A;  3P1H A;  4PMC A;  3TP8 A;  4YIJ A;  2F0V A;  3BDL A;  3SK4 A;  4B9W A;  2F0F A;  5CC4 A;  1STN A;  1SNQ A;  4KD3 A;  4KTA A;  3E5S A;  4NP5 A;  5F2D A;  2PW5 A;  3NUC A;  2PW7 A;  4KJO A;  5EGT A;  5JAV A;  4KY7 A;  3C1E A;  1EQV A;  3NQT A;  4R8N A;  4K5W A;  3T13 A;  1EZ8 A;  5IIF A;  4N9T A;  4F7X A;  1EYA A;  1F2Z A;  1JOK A;  1JOR A;  2F0L A;  1SNC A;  4ID6 A;  1SNO A;  2KHS A;  3MZ5 A;  1SYD A;  3SHL A;  3ITP A;  5IGG A;  2PYK A;  3R3O A;  2F0G A;  5IGE A;  5CV8 A;  3HEJ A;  5KRU A;  1KDA A;  5KYL A;  2F0D A;  1IHZ A;  3U9O A;  5IGC A;  2F0N A;  2OEO A;  2RKS A;  2EYF A;  3OMC A;  1EYC A;  1SYG A;  5KEE A;  1EY7 A;  4E6I A;  4N9P A;  1KDC A;  3OSO A;  2M00 A;  2F0H A;  3H6M A;  2OF1 A;  2RDF A;  4ODG A;  5EKL A;  4KY5 A;  5C5M A;  4QB4 A;  2WAC A;  4J6H A;  5CGK A;  2PZT A;  4OL7 A;  4LAA A;  4NDX A;  2HQE A;  4EQN A;  1SYC A;  5I9O A;  5K5P A;  4IZ8 A;  3SK6 A;  3OWF A;  2F0O A;  1A2T A;  1SYE A;  1ENA A;  1SND A;  3ERQ A;  4G57 A;  4HMI A;  3BDC A;  4J1M A;  5CV7 A;  5J1Z A;  1SNM A;  2OXP A;  1EY9 A;  3NXW A;  3TME A;  5C4Z A;  4I65 A;  2SNS A;  2F3W A;  1TT2 A;  2PQE A;  4B9X A;  5IGB A;  3D8G A;  4DU9 A;  1F2M A;  4PMB A;  1ENC A;  3RUZ A;  1AEX A;  3NP8 A;  4IUN A;  2EYM A;  1STB A;  3C1F A;  4EVO A;  5J39 A;  3HZX A;  5E1F A;  4HMJ A;  5ISR A;  5J22 A;  5C5L A;  4MIU A;  2F3V A;  3PMF A;  5CV6 A;  3SK5 A;  1EYD A;  5HUR A;  2SNM A;  5I6W A;  4ZUJ A;  5IGF A;  4NKL A;  3S9W A;  2F0T A;  3V2T A;  1A2U A;  5C4H A;  2EY6 A;  1EZ6 A;  2ENB A;  2PZU A;  1A3U A;  4DFA A;  3TP7 A;  2F0W A;  1EY6 A;  3TP6 A;  2SOB A;  3EVQ A;  1KAB A;  3P75 A;  4EQO A;  5DAU A;  5I9P A;  4F8M A;  4ME5 A;  3LX0 A;  2EYO A;  3D6C A;  5M9O A;  4NMZ A;  5IOD A;  5KYI A;  2LKV A;  2KQ3 A;  4RKL A;  2F0J A;  5DEH A;  4WRD A;  5NUC A;  2EYH A;  4EQP A;  2O4X A;  4KHV A;  4K5V A;  2F0P A;  3D4D A;  2EYL A;  4K2L A;  2EYP A;  4DF7 A;  1NSN S;  5C3W A;  5HGT A;  2NUC A;  2F0S A;  4KY6 A;  3ERO A;  5CV4 A;  1A3V A;  3SR1 A;  2F0E A;  3T16 A;  5IGD A;  4ZQ3 A;  4K14 A;  4H7B A;  4IAL A;  1EY0 A;  1RKN A;  3OMG A;  4WOR A;  1II3 A;  5KIX A;  3DHQ A;  1F2Y A;  4HTH A;  3MEH A;  1STA A;  4K5X A;  2QDB A;  5C3X A;  3NK9 A;  2F0K A;  3NHH A;  4RKB A;  3TP5 A;  3QOJ A;  5JOB A;  4K6D A;  4S3S A;  2EXZ A;  1STY A;  1SYB A;  4K2K A;  5CV5 A;  1STG A;  2EY2 A;  5KGU A;  3DMU A;  2EY1 A;  3MVV A;  4DGZ A;  2RBM A;  3QOL A;  4QF4 A;  1EY5 A;  1SNP A;  1TQO A;  3MXP A;  1KAA A;  3SK8 A;  1STH A; 
#chains in the Genus database with same CATH topology
 5FOB B;  1DOK A;  2LXJ A;  3TS0 A;  4DV5 Q;  3H15 A;  1JE5 A;  1ENF A;  1L0Y B;  1V1P A;  2JJQ A;  1QUQ A;  5CC4 A;  5IIF A;  4KJO A;  4A3L H;  4LK1 C;  5LMU Q;  4JBJ A;  2JA7 H;  1EZ8 A;  4B3R Q;  3QG1 A;  1SMY D;  2OTL A;  1TII D;  2A69 D;  1VQ4 A;  1J8I A;  5IWA Q;  3I4O A;  3KLS X;  2JN4 A;  4BY7 H;  3SHL A;  3SVM A;  3RLN A;  3HOV G;  4AYB G;  1T5X D;  1H95 A;  1IHZ A;  1SJH D;  4YCW A;  1LAB A;  1VQ7 A;  4B3M L;  3K7A B;  1QVF A;  4ODG A;  4DV1 L;  1BO0 A;  4LUV A;  1E2Z A;  4OL7 A;  3F2D A;  1QZH A;  3MFY A;  1B53 A;  3OWF A;  1IZ6 A;  1EIF A;  1Q86 C;  1IW7 D;  1AE3 A;  1TT2 A;  1G29 1;  1ENC A;  5IYC G;  3FEW X;  4AYB B;  1JR0 D;  1CZW A;  2Q2I A;  1EL0 A;  2G5D A;  3M7N A;  1EQR A;  4XTC S;  1PDQ A;  4C3J H;  3M85 A;  4NKL A;  4BBR B;  4JYA L;  4BY7 G;  1A2U A;  5FJ8 H;  1N34 L;  1EZ6 A;  4APV A;  4EQO A;  5DAU A;  1D5X C;  3S1N H;  5DLQ E;  3J81 j;  2MO1 A;  5IYB G;  4A3M G;  2TMP A;  1KC8 C;  1KLG D;  1HNZ Q;  1LV9 A;  4K5V A;  1B9N A;  1E7Z A;  1ROD A;  5E7N A;  3FRP B;  2Z6K C;  1A3V A;  2UXD Q;  1G6Z A;  4A3D H;  4IAL A;  1RCV D;  4DV2 Q;  2NN6 I;  5IYD H;  2AKW B;  1QVG A;  3IRB A;  2QGQ A;  5CBE E;  2ZJQ A;  3GTK H;  1NY4 A;  1CHP D;  2H5X A;  4HED A;  2MHV A;  4G7Z C;  4DR6 L;  2QDL A;  2WKD A;  3ERS X;  3WWV A;  3N6R A;  3PIO 3;  1GUS A;  1RJT A;  4FXK C;  1SNP A;  4DV1 Q;  1R9T B;  3W1G A;  2F0Q A;  5C6A A;  1I50 H;  1UUP A;  5EKK A;  1DYQ A;  2OQ0 A;  4XIG S;  5FJ8 G;  1CKN A;  1JJ2 A;  2I46 A;  1ET6 A;  1GO3 E;  3GV3 A;  2C35 B;  3HP3 A;  4KD4 A;  1LT4 D;  3VA5 A;  4ZRZ A;  3SK4 A;  1GJX A;  1CK1 A;  4H02 A;  3EA6 A;  4JI8 L;  2B8G A;  2I07 B;  3QWN A;  2HUG A;  3BVZ A;  1TWA H;  3T13 A;  4OO1 G;  2KEN A;  4DR3 L;  4FO2 A;  4KHP Q;  1ILQ A;  3S24 A;  5IGG A;  1Y69 U;  3VR6 A;  2VNU D;  3R3O A;  4BY1 G;  1SBB B;  5K36 H;  4L5Q A;  3X3N A;  3WOE A;  4HID A;  4A3G B;  3OMC A;  2DUD A;  4A3E G;  1PH3 A;  3PUV A;  1V1O A;  1I4P A;  2F0H A;  4MZ9 A;  3H6M A;  1Q1B A;  3KJO A;  1B1Z A;  5JVH 3;  1A15 A;  1TWF B;  4EQN A;  1VF5 C;  3NTI A;  2JSO A;  2F0O A;  5J1Z A;  4LUO A;  3PO2 G;  1SNM A;  3K8A A;  3FKI B;  3CC2 A;  1K3R A;  1SE8 A;  3IFD A;  2LS0 1;  4JI2 Q;  3HZX A;  4TVA B;  1UEA B;  4ALP A;  4MIU A;  3I70 A;  3M7G A;  2B39 A;  2F0T A;  1U4P A;  3V2T A;  5E4X A;  4QGU A;  1WD0 A;  4LFB Q;  1KAB A;  2CH4 W;  3HG9 A;  3HOY B;  2QF7 A;  2R92 B;  4NMZ A;  4L63 B;  1EEI D;  5IOD A;  1JJC B;  1FJG L;  4DV3 Q;  2C5C A;  2F0J A;  2IX0 A;  1BBU A;  4EQP A;  1K8O A;  4CJ1 B;  4I7Z C;  2A6H C;  2F0P A;  4R4C A;  4A3B B;  1AH9 A;  2IHE A;  2F0S A;  1HR0 W;  4BWG B;  4WJ4 A;  3GTO B;  1SFO H;  1UE1 A;  2R61 A;  1FR3 A;  3UDI A;  4A3M H;  2I0Q A;  1T9H A;  3NPP A;  4O42 A;  3VYR A;  1OXU A;  2RVL A;  4Y7N B;  2JA6 H;  4GKJ L;  1H9R A;  2N78 A;  5IY0 A;  1VQ5 A;  4PZ7 A;  2RBM A;  3NQI A;  2QCP X;  1O78 A;  1K28 A;  1STH A;  5C4X H;  4QMG A;  4LJZ C;  4LFC L;  4X62 Q;  3D4W A;  5IOC A;  2ASB A;  2B63 B;  5EJW A;  3RZO B;  1PFS A;  1PRT F;  4A3B G;  1HJP A;  2WAQ G;  1Y1W H;  2L0C A;  3Q0A A;  2HHH L;  4TRD A;  1PMR A;  5CYU A;  2DY7 A;  2L5T A;  1QOH A;  3S15 B;  1KL9 A;  4OWT B;  2XGT A;  4DUZ L;  1I4G A;  2PMZ B;  4WJ3 M;  4KY7 A;  4JG2 A;  3AFQ A;  5M5W H;  4IUQ A;  3GP7 A;  4DR1 Q;  2WKC A;  1XPR A;  1V1P B;  1E2W A;  3K6O A;  4C3H H;  2PI2 E;  1RDP D;  4UP9 A;  4GLV B;  3D0F A;  4DK1 A;  5IE8 A;  1PH7 A;  1NAP A;  5I2X A;  2EOT A;  5IT9 L;  2HD3 A;  2E74 C;  1VQG A;  1EWI A;  2CHB D;  2CW0 D;  2E2J B;  1XMQ L;  5GQO A;  1C0A A;  5I9O A;  1NMG A;  3BVM A;  4G57 A;  1SYE A;  1HQR D;  4A3F G;  2PNH A;  5C4Z A;  1S5B D;  3OPO A;  3M4O H;  2F3W A;  3MTS A;  2VXW A;  5JJK A;  4F88 A;  2EVB A;  4HIM A;  2EQS A;  4EVO A;  4HMJ A;  1PTO C;  3AMU A;  1IYJ B;  5IGF A;  3NTK A;  3A74 A;  3W2D A;  4JI4 L;  1QJO A;  3NWS A;  1VQJ A;  2D2C C;  1CM9 A;  4LF7 L;  3PIO A;  3LWU A;  2N49 A;  2K14 A;  4HIO A;  3I72 A;  4A75 A;  4RKL A;  3D6W A;  1KXL A;  4IJL A;  1PRT D;  1TY2 A;  3I8Z A;  4JI0 Q;  2Q8T A;  1V9P A;  1JE4 A;  5HGT A;  4X3S A;  3S17 H;  4HR7 B;  2DGY A;  4DN4 M;  1GM5 A;  5C3E H;  4LF6 Q;  3K80 C;  4ZQ3 A;  5KIX A;  3KOJ A;  4WOR A;  3T1Y L;  2WFW A;  4FYD A;  3MEH A;  2I5H A;  1T5E A;  3NHH A;  4RKB A;  1Y8P B;  1PFB A;  3WOF A;  3DWA A;  2F4V Q;  4O1N A;  4K2K A;  2A74 C;  3S14 H;  2ZXP A;  4OIJ A;  4KHZ A;  4MNO A;  4DR3 Q;  3J80 E;  1JOQ A;  1LO5 D;  1TKW B;  2JXM B;  1CT1 D;  3SXH A;  4DR6 Q;  1HZB A;  1D1I A;  3V96 A;  3H3V I;  3PO2 B;  4WJW A;  2PZW A;  4XQQ A;  1HXY D;  1EY4 A;  3H0G H;  3CQZ H;  2CWP A;  3HOZ B;  5AJ3 Q;  4JOI A;  2XNA C;  1EIH A;  3PCO B;  3L3O C;  3PQI A;  4YIJ A;  4B9W A;  3DWQ A;  1OXV A;  2R7Z G;  3STB C;  2A69 C;  2JA9 A;  2AQ1 B;  4U67 3;  4A3B H;  3ICE A;  4R9W A;  3DWP A;  4HIK A;  5M3F G;  5C0X H;  1I4H A;  4L5R C;  1S3O A;  3I55 A;  1KIX A;  3I7F A;  5BR8 Q;  3CRL C;  3HEJ A;  2F0N A;  1DOL A;  4MN3 A;  3WDN A;  3CCE A;  3DLL A;  4CKB A;  2CQA A;  4P72 A;  3J81 i;  3PUZ A;  2HQE A;  5K5P A;  3CPW A;  3H0G G;  1PRT B;  4P75 A;  5CV7 A;  4PMW A;  1EY9 A;  4Q0F A;  1K0R A;  4DXG A;  1WYD A;  3PO3 G;  4IUV A;  3FMC A;  1OXS C;  3C1F A;  1I4Q A;  1IL2 A;  3M3Y H;  5C4J B;  1I50 B;  2K4K A;  3M4Q A;  4DUY L;  3A7A B;  4DV3 L;  4B3T L;  3S9W A;  4B3M Q;  4FF2 A;  2FMC A;  2KEE A;  4RHS A;  2LFN A;  4XXE A;  2Q2T A;  1P16 A;  1YJW A;  1KLU D;  3PSI A;  3FPU B;  4ZKC B;  1PZI D;  3NEM A;  3CAM A;  1PH6 A;  4X66 L;  3F8T A;  3S1R B;  1BKB A;  1EFI D;  3MC0 B;  2O4X A;  1BBW A;  3D31 A;  2O2L D;  3D4D A;  4XQJ A;  1VQ8 A;  1WI5 A;  1Q8K A;  4KY6 A;  3K59 A;  4DR7 L;  2E2J H;  5G3L D;  1D5M C;  2F0K A;  3K7A H;  3LGJ A;  3S1R H;  1SSO A;  1O7L A;  1RF2 D;  3QOJ A;  4QUF A;  4RFB A;  1Z47 A;  2LY7 A;  1WJJ A;  4LWC A;  3EIV A;  4JVZ A;  5IP9 G;  4A3G H;  3DEO A;  2B2Y A;  1HNX L;  2EJF C;  4FNF A;  2M9V A;  2EY1 A;  3UDG A;  1CUK A;  2FHT A;  3S1M B;  1OXX K;  2PMZ E;  5CR3 A;  2M2L A;  3RZD B;  3HOY H;  2IWH A;  1ONL A;  1NR2 A;  1Y14 B;  2F0M A;  1B2T A;  4BY1 B;  2K04 A;  4A3K H;  1G8Z D;  1V8Q A;  2Q2H A;  3NE5 B;  3RN2 A;  1DON A;  1CQF A;  3H3V C;  1M90 C;  2HCI A;  4F7X A;  2H1E A;  3DM1 A;  4DUZ Q;  3RD4 A;  1SNO A;  2AHO B;  1SYD A;  2N88 A;  5M3F B;  3E9H A;  2MPM A;  2EZV A;  5CV8 A;  5ELC A;  3S1N B;  1BCP C;  1CSP A;  3U9O A;  1SE3 A;  4L5S A;  4XQN A;  4E6I A;  3U58 A;  2VUM G;  4DKA C;  4CGY B;  4YY3 Q;  4GOP C;  1UE5 A;  1QUQ B;  1R4P B;  2Z6B A;  4DA2 A;  1JWM D;  4O2D A;  2HT1 A;  4J6H A;  4R4T A;  1D5Z C;  2RQX A;  4JI6 L;  4DV7 Q;  5ELF A;  1E3P A;  4C1N K;  4ME3 A;  3K0Y A;  3TME A;  4IO9 A;  1MHW C;  4DAV A;  1MIU A;  4G7H C;  2IX3 A;  1I4X A;  4JI5 L;  3MAQ A;  3CCL A;  2RDH A;  3A5U A;  2F3V A;  1RL2 A;  4NPS A;  3P20 A;  3SK5 A;  4ZUJ A;  1JJG A;  3IFT A;  4C3I H;  2A68 D;  1SE2 A;  2PZU A;  2F4V L;  1HR0 Q;  2IW3 A;  1GUW A;  4DV0 L;  1GKH A;  5HY6 A;  4LFB L;  2HIX A;  3X3M A;  3JAM L;  3J7Y W;  1G6P A;  1STE A;  3MXU A;  3BYY B;  4HN7 A;  5IGD A;  2V4D A;  3LNN A;  4Y52 H;  3F2C A;  3EN2 A;  4M8A A;  1GHJ A;  3BJU A;  5EKI A;  2NVQ H;  2A1A A;  1C9O A;  5C3X A;  3K5M A;  5I4D A;  1VMC A;  4KN7 C;  2WAQ B;  3M9B A;  2GA4 B;  1B70 B;  4A4I A;  5KNC A;  1AN8 A;  1IKM A;  1HA6 A;  5IYC H;  5JPM C;  4BA2 I;  2PQA B;  2OWO A;  3MXP A;  4RG1 A;  4BXX H;  1GUT A;  3CCR A;  2ICE C;  1DOM A;  4IFD G;  1PH8 A;  4K8J A;  3GTL B;  1I94 Q;  5IP9 H;  1P8L A;  1V1Q A;  2B8F A;  2MQH A;  3MHB A;  2F0U A;  1I4R A;  2LXK A;  5DNF A;  1JB7 A;  2KHI A;  4KD3 A;  3S1Q H;  2I5L X;  3NQT A;  3J81 L;  4RGN A;  1HUM A;  2IHF A;  1EUJ A;  1GD7 A;  3OWE B;  4YWL A;  2DNC A;  3BDO A;  2ZJP A;  1YNJ C;  1CFM A;  1TS2 A;  4JPB W;  2E2I B;  5KRU A;  4H13 C;  1Y1V B;  5ELB A;  3T56 B;  3T53 B;  4N9P A;  2UXD L;  4A3M B;  2PPB C;  1J5E Q;  1K8M A;  4B3T Q;  3MXN A;  3ULL A;  3CD6 A;  2VB3 X;  3CXC A;  4QY7 A;  2PZT A;  2E2I H;  2X6L A;  3SK6 A;  1CZG A;  5LL6 S;  2DN8 A;  3J81 c;  2JEA I;  1LTI D;  1S5F D;  4B9X A;  4KI0 A;  3BU2 A;  3D8G A;  1VQB A;  3KF6 A;  3KK7 A;  2KCM A;  3TRZ A;  3S14 B;  1EWC A;  4BBS B;  1RTN A;  2E8G A;  2EJG C;  4LFA Q;  1N36 L;  4B3S Q;  4OO1 H;  4HSP A;  1LLR D;  4DK3 C;  2KHJ A;  3CCV A;  1S5E D;  1WD1 A;  2GVB A;  2EXD A;  4GNX A;  4IUP A;  4JCV E;  1AFP A;  5K36 G;  1BF4 A;  3GQB A;  3R8B A;  1YVC A;  1HZ9 A;  4QL5 A;  2EYH A;  1Q46 A;  4KHV A;  2Q8I B;  2EYL A;  2NUC A;  4C3I G;  5CV4 A;  2F0E A;  2UUB Q;  4H7B A;  1NTG A;  1IYV A;  1M8A A;  3QR8 A;  3S2H B;  3R2T A;  1I6H B;  1XPU A;  2K28 A;  1YHQ A;  1IBM Q;  2E2H H;  1MKH A;  5KNB A;  1YEZ A;  2B3G A;  1L1O B;  1LTS D;  1ML0 D;  3KJP A;  1HCZ A;  4JI0 L;  1GHK A;  2G9H D;  2VS1 A;  1KDB A;  1KNE A;  2BA1 A;  4R4O A;  3CCU A;  3UE0 A;  1NUC A;  2QA4 A;  3RN5 A;  4UP8 A;  1FNW A;  1J9O A;  1WOC A;  2VY3 A;  4DAY B;  3DXJ C;  5C0X G;  2R6G A;  1MI2 A;  3HOX H;  2FMM A;  2G9D A;  1RIP A;  4ABN A;  4LFA L;  4MTN A;  4GS3 A;  1VQC A;  4P74 A;  2F0L A;  1SNC A;  4OEM B;  1K0S A;  2K6A A;  4IOA A;  3MZ5 A;  1FJG Q;  4JI7 Q;  3DM3 A;  1TWH H;  5C3E B;  1KDA A;  5KYL A;  2F0D A;  1OTC A;  2RKS A;  1WTX A;  1BVS A;  3RNU A;  3PIP A;  4JYA Q;  4C1N I;  2B2V A;  3UDF A;  2B29 A;  1BCP F;  1HHV A;  2RDF A;  2Z4H A;  3OTO L;  3HOU G;  4DAM A;  4JI5 Q;  4ZK9 B;  1IBK L;  3VR2 A;  4ZLT F;  1TS4 A;  2BDO A;  1A6X A;  5ELO A;  1MJC A;  1PXU A;  1VQA A;  1X54 A;  4RWS C;  4A3E B;  5GRO A;  2B2W A;  1W6J A;  1BQQ T;  4GKK L;  2L55 A;  4LUZ A;  1WCM B;  3Q8D A;  3IL8 A;  4BS9 A;  1PZK D;  2JA5 H;  3K5N A;  4HSV A;  1A63 A;  4DNT B;  4DFA A;  4JBW A;  3JAM i;  2NBF A;  1W2B A;  5FLX L;  3R93 A;  2LKV A;  2JA5 B;  1DXM A;  2R7Z H;  2R92 H;  2YU9 H;  2MGS A;  2B2W C;  4K2L A;  3E0E A;  1SEB D;  3V05 A;  3ERO A;  1AP0 A;  1SJE D;  1CA5 A;  1EY0 A;  4K6L A;  2KJX A;  4I7A A;  2CVR A;  5M3F H;  1HFG A;  1K8G A;  3HOY G;  4ZAI A;  4J8Q A;  3VYU A;  1UEB A;  4LF7 Q;  2XRS D;  5JOB A;  2QEJ C;  1MSH A;  4TQU S;  3N52 A;  4GN4 B;  4KHP L;  3DMU A;  4RCN A;  3QOL A;  2R7D A;  1TQO A;  3FP9 A;  5JVG 3;  3SK8 A;  2RF4 A;  4N8F A;  4O0A A;  1TVX A;  4A93 H;  1XNQ Q;  3U9S A;  4JI2 L;  3QB3 A;  4DR5 L;  3A8J E;  2EYJ A;  4AQY Q;  2B63 H;  5E4W C;  1BCP D;  1Q8I A;  1LTB D;  4FP5 D;  1GUG A;  1EY8 A;  2X69 A;  4GN5 A;  1A3T A;  4K8I A;  1YNX A;  3HRZ C;  1CTM A;  4A93 B;  4KTA A;  5JAV A;  1BNZ A;  1F77 A;  3W3A A;  4IJH A;  4N9T A;  1KQS A;  5JEA G;  4CJ2 C;  1GUO A;  2VQF Q;  5IT9 c;  2JP1 A;  4JI1 L;  1H9S B;  2HDM A;  5GAD C;  1U4M A;  1VDZ A;  1J6Q A;  1XYI A;  4JV5 L;  2K01 A;  3A0J A;  2N55 A;  1TWH B;  3T1Y Q;  1ZXT A;  3L0O A;  1PTO D;  3I4L A;  2ID0 A;  3LWE A;  3TQY A;  1E1O A;  3GTP H;  3OIP A;  1JB3 A;  3KFU A;  1MSG A;  4POG A;  3L7Z C;  5FLM G;  1SND A;  3S1Q B;  3MA2 B;  1W3S A;  3NBH B;  2WII B;  4JW0 A;  2A6E D;  1XX8 A;  1HNW Q;  2NTT A;  1R4Q B;  4MHE A;  1N34 Q;  5J39 A;  3HOU H;  3S17 B;  3OW2 A;  2UUB L;  2B2U A;  5CV6 A;  1WTV A;  5HUR A;  4QIW E;  4FXG C;  4IPC A;  4JI3 L;  1Y8O B;  5G3L F;  2VQE Q;  3UI2 A;  5D3D A;  1VQ9 A;  2RA4 A;  2K7V A;  2B2T C;  2NZH A;  1UNS A;  1PTO B;  2UUC Q;  1HTL D;  2JA5 G;  5C44 G;  4LF4 Q;  3KDF B;  1YBY A;  1KNA A;  3RLF A;  1FGU A;  1LTG D;  4KK7 A;  1D7Q A;  2KUM A;  3GTM H;  4BBR G;  4BXX G;  2JQO A;  4BY7 B;  2JK8 A;  1PTO H;  5CBA E;  4QUC A;  2NTS A;  4HCS A;  4DV5 L;  1PYS B;  3VYT A;  1EIY B;  2CFM A;  5FK9 C;  1K8A C;  1G91 A;  1G2T A;  2K33 A;  2AQ3 B;  4DGZ A;  4R4I A;  4L6T B;  1KAA A;  2UU9 Q;  4IN3 A;  1ESR A;  5LMU L;  5FO9 B;  3JC6 6;  3GTQ H;  4HJ5 A;  1O7I A;  1NJI C;  1U4L A;  4JI8 Q;  1F9Q A;  3AEV A;  1JOO A;  2AQ2 B;  5JPN C;  1TR5 A;  3A7L A;  1HNW L;  1I3Q B;  4DV4 Q;  1PTO F;  2D5D A;  3CCM A;  1CSQ A;  4IQZ A;  4P71 A;  2AMC B;  5F2D A;  4ZKB B;  4A93 G;  3S15 H;  4KKS A;  2O5I C;  4R1J A;  3OTO Q;  5M5X B;  1QNU A;  1SMY C;  4K5W A;  4RGO S;  4A3I B;  3GTJ B;  2QIL A;  4LW1 A;  2NN6 H;  1F2Z A;  3HKZ B;  1WTR A;  3I4N B;  4L8J A;  1R9T H;  4BBR H;  3BZC A;  2K5N A;  3Q22 A;  3T4A C;  1IXR A;  2RCF A;  3HGB A;  5M5X H;  4GOP A;  4A3D B;  3GDE A;  2OEO A;  5EPJ A;  4DR7 Q;  2YTY A;  5EAY A;  2UU9 L;  2M00 A;  3KF8 B;  2WV6 D;  2X6G A;  3T1H Q;  4A3F B;  4BBS G;  4GKK Q;  4LAA A;  3ER0 A;  1SR3 A;  1LT5 D;  3K5O A;  1A2T A;  2NVY B;  3OHX C;  2QEX A;  4XDX A;  5IGB A;  4J15 A;  2RSO A;  1ASY A;  3AYH B;  4FVM A;  4IUU A;  4EX5 A;  2ZTC A;  4A3J G;  1Q1E A;  5A2Q L;  1VQE A;  1XMO Q;  1XNR L;  2MFI A;  1X9N A;  4NB3 A;  3VDY A;  1EOV A;  3FHW A;  2J0T D;  2ZTE A;  2Z4I A;  2JA7 G;  1VQO A;  4CDE C;  5BN4 A;  2SNM A;  1PRT C;  1BOS A;  1IBL L;  5C4H A;  1YHA A;  1L1O C;  2KCC A;  4HJ7 A;  1PVO A;  3ONA B;  5JJI A;  1VS0 A;  1IKL A;  2V1C C;  2N3S A;  1H9K A;  4DR4 Q;  1ZYR C;  3H94 A;  1XNQ L;  1LT3 D;  3VR4 A;  1TWA B;  1Q3L A;  2I5M X;  5IP7 H;  1RKN A;  5ELN A;  2K5D A;  2K5W A;  4HTH A;  1FNV A;  3KF6 B;  2A6E C;  3EFX D;  4BY1 H;  2F4I A;  4S3S A;  1ILP A;  1E1T A;  1QCB D;  1Y1V H;  3HKS A;  1A62 A;  1BXT A;  1JIC A;  4YHH Q;  3T1H L;  2YV5 A;  3SDZ A;  1XXG A;  2D62 A;  2BH2 A;  4CHT B;  4C3J B;  3KF8 A;  3CW2 C;  3A8K E;  1WVL A;  1XTD A;  4U68 A;  2OCE A;  1SE4 A;  4A3G G;  1FGB D;  2ZJR A;  2IY5 B;  4GN3 B;  1K3B C;  1CA6 A;  1QG7 A;  5GAG C;  3TP8 A;  4PMC A;  3BDL A;  5TSS A;  4XYO A;  2BDN A;  1Q81 C;  2IL8 A;  4KLK A;  4JK1 C;  3R2I A;  2JA6 B;  3C1E A;  4R8N A;  3PF5 A;  4PG3 A;  1B8A A;  5EPK A;  4V19 0;  1EEF D;  1FNU A;  3L9A X;  1JOK A;  2ALY B;  3HS0 C;  4X66 Q;  2CWA A;  3FKI G;  2QW7 A;  2JEB I;  3CP0 A;  4A3K G;  4OON A;  3OYY A;  1CQV A;  4NW2 A;  2Z9H A;  1PV4 A;  2KA7 A;  5C44 B;  5IGC A;  1CKM A;  1HUN A;  2YTX A;  2DY8 A;  2EPB A;  2YU9 B;  2NYZ D;  2NN6 G;  2VL6 A;  2MJ8 A;  5EPL A;  1I6H H;  2B2Y C;  3C2P A;  1L1O A;  1EU4 A;  3KBG A;  5C5M A;  1PYW D;  2JA8 B;  2WAC A;  1DJR D;  2N8N A;  4P73 A;  4NDX A;  3IAY A;  4IFD I;  1DD2 A;  2RHS B;  1VQM A;  2K5Q A;  3BDC A;  4J1M A;  2UXB L;  1XTC D;  2F52 A;  2VUM H;  4DU9 A;  1F2M A;  2WB1 G;  3G48 A;  4JBK A;  4KN4 C;  1AEX A;  1MGS A;  1U0L A;  1G51 A;  1TXY A;  3A8I E;  5A35 A;  3D3R A;  5E1F A;  5GAH C;  1J5E L;  2HCC A;  4TKO B;  3PMF A;  3CC7 A;  4ZYS A;  2A6H D;  1HFN A;  2NVQ B;  3SGI A;  1AW7 A;  1HNX Q;  2UUA Q;  5C4J H;  4UP7 A;  5C3E G;  4RMF A;  4FDB A;  4YCV A;  4LF9 Q;  2JA8 G;  3MFG A;  1VMP A;  4EGV A;  4RH6 A;  3GD7 A;  4IUT A;  3I56 A;  4JI3 Q;  3RMH A;  1LM0 A;  1LTT D;  1EOT A;  1AZQ A;  4UAI A;  5DEH A;  2Y0S B;  4PV1 C;  1QZG A;  1GUN A;  1YJ9 A;  3SR1 A;  5M3M G;  1X3P A;  5HGQ A;  5L37 A;  3OMG A;  1II3 A;  4HCE A;  2PNR C;  3NEL A;  2SEB D;  1VCI A;  4UPA A;  2BOS A;  4OWX B;  5GAE C;  1STY A;  2VW9 A;  5C0X J;  5COY A;  5EQ0 A;  4ILW A;  3TBI B;  4DV7 L;  2HIV A;  3K57 A;  1EY5 A;  3BZK A;  1D2B A;  3K58 A;  2AWN A;  2Z1C A;  4IFD J;  2WAQ E;  4X3K A;  1D8L A;  2XVS A;  5DM6 3;  2LSS A;  1L0W A;  1NBW A;  2XSC A;  3D4R A;  1O7Y A;  1H9S A;  1JWS D;  3RLO A;  3EQL C;  1SNQ A;  1UWV A;  1QB5 D;  2XTI A;  2NB0 A;  2NVT B;  1EYA A;  2L15 A;  1KAW A;  2MO0 A;  1Q7Y C;  1S5D D;  4A3I G;  5IGE A;  4CKE A;  3J80 c;  4LF5 Q;  4DR5 Q;  2WB1 B;  4Y7N H;  4AQY L;  2NWG A;  1S4Z A;  1SYG A;  2R7Z B;  3OSO A;  4POF A;  4C2M B;  3TRE A;  4KY5 A;  1I6V C;  2JYO A;  1WTW A;  1XMO L;  2K75 A;  1XNR Q;  3GTM B;  3K81 C;  3F2B A;  4IZ8 A;  3RZO H;  3S16 B;  2GN5 A;  2HQL A;  2B2U C;  3TP6 A;  3KLS A;  1HRJ A;  2AUK A;  4A3C G;  3VR3 A;  4JI1 Q;  3JAM E;  1I94 L;  2E76 C;  4PQX A;  5FLX c;  4IPD A;  2TSS A;  5ISR A;  5J22 A;  1CHQ D;  4NXN L;  3GTQ B;  4DR4 L;  2F03 A;  1O80 A;  1N32 Q;  2ENB A;  2SOB A;  3FVQ A;  1WTQ A;  1X3Q A;  3LX0 A;  2E2H B;  2XN9 C;  3A55 A;  1ZYR D;  5KYI A;  4HJ8 A;  1IBL Q;  2KQ3 A;  5NUC A;  4Q5V A;  1PFM A;  4F87 A;  2BE5 C;  4CDD C;  3E6Z X;  4B3R L;  4DR2 Q;  2AWO A;  2JA8 H;  2Z0S A;  4OXP A;  1YIT A;  3CRK C;  1PZJ D;  2Z6K A;  2AUJ D;  2D0P A;  1TWG H;  2EXZ A;  2RCN A;  4IUR A;  1Z7T A;  3GTP B;  1FVI A;  4OEL B;  4LF6 L;  4QF4 A;  4C3I B;  1N36 Q;  1W6K A;  3NWT A;  2KCT A;  4YY3 L;  3E9I A;  1NMF A;  3HOU B;  4KJN A;  4XT3 B;  2A73 B;  2J7Z A;  5J3B A;  1YNJ D;  2OTJ A;  4HJA A;  1B44 D;  4X65 Q;  2BH8 A;  5C4X G;  2YTV A;  5EBC A;  4GNX B;  2Y0S E;  4JC0 A;  4FF3 A;  2MUY A;  1Y1W G;  3S1M H;  1AZP A;  4ID6 A;  4RA8 A;  1L0X B;  2EDG A;  3ND9 A;  4RAU C;  2Z8L A;  1MD2 D;  3STB D;  5JJZ A;  1HR0 L;  1VQ6 A;  1N33 L;  4A3J H;  4QJF A;  3E3X A;  4QB4 A;  1B4O A;  2YYZ A;  1I5F A;  4DK0 A;  2CH4 A;  1K83 H;  1KTK A;  4GZY C;  4IPH A;  4V0B A;  1YJN A;  3G4S A;  1NE3 A;  2EJM A;  1HA5 A;  3CKI B;  3M4P A;  4OWW B;  3HKZ G;  5IYB H;  3CPF A;  1NCV A;  1S5C D;  1Q12 A;  2E5L Q;  3QIA A;  3SEB A;  1EYD A;  3RZD H;  4IOC A;  1FYC A;  2MP1 A;  5DM7 3;  4GOP B;  2EY6 A;  3TP7 A;  4DV0 Q;  1EY6 A;  5I2Y A;  3F1Z A;  2A68 C;  3ZYY X;  1GOZ A;  3TZU A;  5LMN Q;  2E75 C;  5H1S E;  1SMX A;  2OT2 A;  4A76 A;  3GTG B;  1Y1V G;  4B08 A;  4X3T A;  4DF7 A;  2ATW A;  1SFO B;  4MTK A;  5C3W A;  1LTA D;  3TZD A;  4R8I A;  1M1K C;  2WP8 J;  3RR5 A;  3IKJ A;  3CQZ B;  4JBM A;  1CKN B;  2LMC B;  3B6Y A;  1TWC H;  2H4O A;  3BYT B;  1XPO A;  1LTL A;  3GTO H;  3HOV H;  3Q23 A;  1HTP A;  2RDG A;  4YCU A;  3O13 A;  1TWG B;  1LYL A;  4X64 Q;  4QQB X;  1DGS A;  1B3Q A;  1CKO A;  2F3I A;  5E3F A;  4KKT A;  3NSW A;  4OX9 L;  1HPC A;  2R93 G;  1QE6 A;  3J7A V;  1RHP A;  4LF8 Q;  1WTO A;  5AJ3 L;  2WB1 E;  3URY A;  1BUV T;  3E5S A;  3ULJ A;  3NUC A;  2PW7 A;  3OW7 A;  3BS1 A;  3ZJY C;  2XWB B;  1C4Q A;  1HNZ L;  4XYQ A;  4DK6 C;  1X6O A;  4YHH L;  3VYS A;  3TEH B;  2C9O A;  2PYK A;  5BR8 L;  3T51 B;  3A56 A;  4X62 L;  4LFC Q;  4FXD A;  4RCO A;  1VQH A;  2KVM A;  5JEA H;  4NXN Q;  3I4M H;  4GNX C;  5EKL A;  4P2C B;  3CME A;  2ZTD A;  5JJL A;  4A3D G;  1SYC A;  1LT6 D;  3BZD B;  3S2D B;  4GKJ Q;  4OIK A;  1D6E C;  1NR4 A;  4HMI A;  1XJV A;  1IW7 C;  4CDC C;  2Q8R E;  3NXW A;  3I4M B;  1WCM G;  3W5O A;  2UXB Q;  4X3U A;  5T1G A;  4IUN A;  2EYM A;  2PQA A;  5IT9 E;  5ELE A;  2KED A;  2Y0S G;  4B3S L;  1U4R A;  1X3F A;  3AQQ A;  2XWJ B;  4FF1 A;  3PV0 A;  4A3K B;  1YNN D;  3CCS A;  3MEF A;  5M3M H;  1A3U A;  2OQK A;  4JV5 Q;  1ICF B;  4F8M A;  2HHH Q;  2JA7 B;  3KLW A;  4Z9C B;  2ZM6 L;  4QCL A;  4LF9 L;  3A54 A;  1N32 L;  3KDF A;  1Z9F A;  4DXF A;  3S16 H;  3MWY W;  1B50 A;  1TS5 A;  4BBS H;  3G71 A;  1PH4 A;  2K5H A;  4H0L C;  3W1B A;  1STA A;  2RSN A;  2XRQ D;  2K32 A;  2Q2U A;  1LTR D;  1B7Y B;  3TSS A;  2NZO A;  1WCM H;  3PGZ A;  5FO8 B;  5T1I A;  5C44 H;  2B2V C;  1XMQ Q;  1GVP A;  1WFQ A;  3G7L A;  3SE0 A;  2VQF L;  3H09 A;  2VZA A;  1HZA A;  3P7J A;  4OGQ C;  5KND A;  2RHQ B;  1PLF A;  5CV9 A;  3EJI A;  4ZUI A;  1H9J A;  4KV6 A;  1U9R A;  2ZM6 Q;  1PHJ A;  2R93 B;  4M1U B;  3PO2 H;  2MNA A;  3BVG A;  2EY5 A;  4XT1 B;  1UE7 A;  2F0V A;  1VQL A;  4UHV A;  4JI4 Q;  1BBX C;  4RGM A;  5FO7 B;  3F2U A;  1WTH A;  1ZKO A;  3J80 L;  1JOR A;  3PUW A;  5C4X B;  4X65 L;  4RHR A;  4TSS A;  4DV6 L;  2NVY H;  4AIM A;  1KHI A;  2ZXO A;  3C3L A;  1DZ1 A;  1TWC B;  3U4Z A;  3H91 A;  1Y1W B;  4ZCK A;  1X65 A;  1H9M A;  1Z6H A;  3J80 i;  5COR A;  3ULP A;  1PH1 A;  1EYC A;  1KRT A;  1YIJ A;  1KDC A;  2B2T A;  2VQE L;  4RGT A;  3PIP 3;  4A3C H;  2VUM B;  2K03 A;  4R4Q A;  2OF1 A;  3A5Z B;  5FKA C;  3C46 A;  1D1K A;  1CI3 M;  1C48 A;  5M5W B;  1E2V A;  2R7F A;  4PZ6 A;  1VQI A;  1EU3 A;  5BN5 A;  2K52 A;  3ERQ A;  2UXC Q;  1VQN A;  1IYU A;  2PQE A;  3I4M G;  3RUZ A;  3M3Y B;  1STB A;  4PZ8 A;  2ES2 A;  4ULL A;  2BE5 D;  3PO3 B;  2R3Z A;  3CMA A;  5LMN L;  3J7A F;  3FKI H;  1X3E A;  2DJG C;  3QJY A;  1VQD A;  2A5H A;  4K0K Q;  4GLA C;  2J4X A;  4CDF C;  5I9P A;  3P75 A;  2L4N A;  4AH6 A;  4DNI A;  5M3M B;  2IPK D;  1JQY D;  1F2L A;  3D6C A;  3HOX B;  1VF7 A;  4KKU A;  2HDL A;  4A3E H;  4NXM Q;  4BA1 I;  3VA7 A;  4JI6 Q;  2EYP A;  3E0J A;  1NSN S;  1MJE A;  2NVT H;  2KBN A;  3KLR A;  5LHY 1;  5JEA J;  4X64 L;  4HJ9 A;  1VQF A;  5AFW A;  3JAM c;  4GLX A;  3AB9 A;  4AYB E;  3CC4 A;  1M4V A;  1QVC A;  2A8V A;  1FL0 A;  1SYB A;  2B63 G;  1QNK A;  1TWF H;  3AU7 A;  3FPP A;  1K73 C;  1YHB A;  5CMD A;  3FDT A;  4X6A H;  1BCP B;  3TN2 A;  2CW0 C;  3NBH A;  1DM0 B;  4OO1 I;  2P5Z X;  5IYD G;  1ASZ A;  3MXG A;  4CBV A;  1SYF A;  2VB2 X;  2F0I A;  3I90 A;  2FFK B;  1OO9 B;  5EBD A;  1PYB A;  3ND8 A;  4PNY A;  4IPG A;  1EIG A;  5D14 A;  1VQP A;  3P1H A;  4JI7 L;  3EBE A;  3I73 A;  1PA6 A;  1STN A;  1I3Q H;  1X32 A;  1JCK B;  2XIW A;  2PW5 A;  3U4V A;  5EGT A;  4IFD H;  4UDU C;  4YWM A;  2KCN A;  1YZ6 A;  1ET9 A;  1E24 A;  5LMN W;  2K50 A;  3NEN A;  4C2M H;  5C0X I;  1FD7 D;  3I4N H;  5M5Y H;  3M4Y A;  1PH5 A;  1Y8N B;  1ESF A;  5FLM H;  5A2Q E;  2PCF B;  2JA6 G;  1EY7 A;  5IWA L;  2R92 G;  1PFN A;  3CF5 A;  1RTO A;  2BCO A;  3K7U C;  2K1B A;  1NNX A;  4DAY A;  2UUC L;  1SAP A;  4LF4 L;  2L9H A;  1X56 A;  2JE6 I;  1ENA A;  3OIQ A;  4UY8 C;  5FLX E;  2IJ0 A;  2OXP A;  2QKI C;  3CHB D;  4I65 A;  2SNS A;  1G2S A;  4LNQ A;  4PMB A;  1F9S A;  3AFP A;  1SRO A;  3DUZ A;  3HOW H;  4N8X 1;  1HH2 P;  1E22 A;  3MXN B;  3UDX A;  3CCJ A;  3PUY A;  1AE2 A;  1IBK Q;  5C5L A;  1SRU A;  2NVX H;  2CCZ A;  2DJF C;  1JWU D;  2E5L L;  3M4O B;  1LAC A;  1N33 Q;  4C3H G;  3GO5 A;  3S2H H;  2D9U A;  2K05 A;  1GXD C;  2F0W A;  3I4N G;  1HZC A;  3PUX A;  3HOW B;  1B3A A;  4ME5 A;  2CKZ B;  1BR9 A;  1C8C A;  3GTL H;  3U50 C;  2GVA A;  1A0I A;  1QWY A;  4DV2 L;  1SLJ A;  4DAP A;  4WRD A;  2IT1 A;  1SN8 A;  2D0O A;  3KUP A;  1N8R C;  4EQ5 A;  2ZT9 C;  1YNN C;  5D3I B;  1F2Y A;  1BDO A;  2F1M A;  4K5X A;  2QDB A;  2E2D C;  3NK9 A;  2O5J C;  5BN3 A;  3L2P A;  1O7Z A;  1WTP A;  3CU7 A;  4L5T A;  2EE1 A;  1ICW A;  4OHJ A;  3BG3 A;  2WIN B;  4DR1 L;  3TS2 A;  4JOI C;  3HKZ E;  4A3J B;  4K6D A;  5ELD A;  1F9R A;  3Q6S A;  4WFN 3;  4H44 C;  4A3L G;  1DCZ A;  1IL8 A;  5I6Y A;  3S2D H;  1A8V A;  1EWH A;  1UE6 A;  2L1B A;  1SXT A;  4DPG A;  3TDQ A;  1V43 A;  4DV4 L;  2PO4 A;  1S40 A;  4FF4 A;  3VR5 A;  1JT8 A;  4LF8 L;  3OOC A;  2F0F A;  4NP5 A;  2ICI A;  2L11 A;  1X3G A;  1ZEQ X;  3HOZ G;  1EQV A;  3KYH C;  1EQQ A;  1QIL A;  3DEP A;  3QO2 A;  2KHS A;  1HQM C;  1Q82 C;  3ITP A;  2IX1 A;  3G6J B;  1IBM L;  3PF4 A;  2F0G A;  4KMU C;  3HOX G;  3H3V H;  5LL6 X;  4QIW B;  4OX9 Q;  1K83 B;  4C56 C;  3I2Z A;  4DV6 Q;  2EYF A;  2L12 A;  5KEE A;  3Q24 A;  4DR2 L;  3GTG H;  2UUA L;  2FJ2 A;  3J81 E;  1MBY A;  4DUY Q;  2FXQ A;  3K5L A;  1OXT A;  5CGK A;  3GTJ H;  4A3I H;  1TU2 B;  1RD9 D;  3K0X A;  1N9W A;  4C3J G;  3GTK B;  3J7A 5;  3HOV B;  2NZ1 D;  1K9M C;  2KOL A;  4K0K L;  3NP8 A;  4HAE A;  2UXC L;  1E0B A;  1UAP A;  1KRS A;  3H0G B;  4CJ0 B;  1EYG A;  3HOZ H;  1L2F A;  1PH2 A;  1TS3 A;  4A3F H;  4NXM L;  1B9M A;  5I6W A;  1U5K A;  2NVX B;  4G7O C;  3NBI A;  2BA0 A;  4G4K A;  4C3H B;  2ZXR A;  2R93 H;  5IP7 G;  4YWK A;  4LF5 L;  3EVQ A;  4CKC A;  1VQK A;  1LUZ A;  2SDF A;  2CQO A;  3HFZ B;  1SDF A;  3KBX A;  1X55 A;  3HOW G;  2EYO A;  5M5Y B;  2DNE A;  5M9O A;  1JMC A;  1S72 A;  1Q90 A;  1C7Y A;  1XWE A;  1JC7 A;  2K5V A;  3CCQ A;  2KEC A;  3T16 A;  3NTH A;  4K14 A;  1KD1 C;  4DNR B;  1YI2 A;  3G6E A;  3DHQ A;  3UE1 A;  2PI2 A;  1F9P A;  1TY0 A;  3TP5 A;  3GV6 A;  1EFW A;  3PO3 H;  2FIN B;  5CV5 A;  5D65 A;  1STG A;  2EY2 A;  5KGU A;  2A19 A;  3I3C A;  3MVV A;  4LMQ D;  3J7Z C;  1PH9 A;  3I91 A;  2EIF A;  1EQT A; 
#chains in the Genus database with same CATH homology
 5FOB B;  1DOK A;  1ENF A;  1L0Y B;  1V1P A;  5CC4 A;  5IIF A;  4KJO A;  4LK1 C;  1EZ8 A;  3QG1 A;  1SMY D;  1TII D;  2A69 D;  1J8I A;  3KLS X;  3SHL A;  3SVM A;  1T5X D;  1IHZ A;  1SJH D;  1LAB A;  3K7A B;  4ODG A;  1BO0 A;  4OL7 A;  1E2Z A;  3MFY A;  1B53 A;  3OWF A;  1IW7 D;  1TT2 A;  1G29 1;  1ENC A;  3FEW X;  4AYB B;  1JR0 D;  1CZW A;  1EL0 A;  3M7N A;  4XTC S;  1PDQ A;  3M85 A;  4NKL A;  4BBR B;  1A2U A;  1EZ6 A;  4EQO A;  5DAU A;  1D5X C;  2TMP A;  1KLG D;  1LV9 A;  4K5V A;  1B9N A;  1ROD A;  3FRP B;  1A3V A;  1G6Z A;  4IAL A;  1RCV D;  2NN6 I;  5CBE E;  1CHP D;  4HED A;  2MHV A;  4G7Z C;  2WKD A;  3PIO 3;  3N6R A;  1GUS A;  1RJT A;  4FXK C;  1SNP A;  1R9T B;  2F0Q A;  5C6A A;  1UUP A;  5EKK A;  1DYQ A;  4XIG S;  2I46 A;  1ET6 A;  3GV3 A;  4KD4 A;  3HP3 A;  1LT4 D;  3VA5 A;  4ZRZ A;  3SK4 A;  1GJX A;  1CK1 A;  3EA6 A;  2B8G A;  2I07 B;  3QWN A;  2HUG A;  3BVZ A;  3T13 A;  4OO1 G;  4FO2 A;  1ILQ A;  5IGG A;  1Y69 U;  3VR6 A;  2VNU D;  3R3O A;  1SBB B;  5K36 H;  3X3N A;  3WOE A;  4A3G B;  3OMC A;  3PUV A;  1V1O A;  1I4P A;  2F0H A;  3H6M A;  1Q1B A;  1B1Z A;  5JVH 3;  1A15 A;  1TWF B;  4EQN A;  1VF5 C;  3NTI A;  2JSO A;  2F0O A;  5J1Z A;  1SNM A;  3FKI B;  3IFD A;  2LS0 1;  3HZX A;  1UEA B;  4MIU A;  3I70 A;  3M7G A;  2B39 A;  2F0T A;  1U4P A;  3V2T A;  5E4X A;  1WD0 A;  1KAB A;  3HG9 A;  3HOY B;  2QF7 A;  2R92 B;  4NMZ A;  4L63 B;  1EEI D;  5IOD A;  2C5C A;  2F0J A;  2IX0 A;  1K8O A;  4EQP A;  4CJ1 B;  4I7Z C;  2A6H C;  2F0P A;  4A3B B;  2F0S A;  4BWG B;  3GTO B;  2R61 A;  1FR3 A;  3NPP A;  4O42 A;  3VYR A;  1OXU A;  2RVL A;  4Y7N B;  1H9R A;  2RBM A;  3NQI A;  2QCP X;  1O78 A;  1STH A;  4QMG A;  4LJZ C;  3D4W A;  5IOC A;  2B63 B;  5EJW A;  3RZO B;  1PRT F;  2L0C A;  3Q0A A;  4TRD A;  1PMR A;  5CYU A;  2DY7 A;  2L5T A;  1QOH A;  3S15 B;  1I4G A;  2PMZ B;  4KY7 A;  4IUQ A;  3GP7 A;  2WKC A;  1V1P B;  1E2W A;  3K6O A;  1RDP D;  4DK1 A;  1NAP A;  5I2X A;  2EOT A;  5IT9 L;  2E74 C;  2CHB D;  2CW0 D;  2E2J B;  5I9O A;  3BVM A;  4G57 A;  1SYE A;  1HQR D;  5C4Z A;  1S5B D;  3OPO A;  2F3W A;  3MTS A;  2VXW A;  4F88 A;  2EVB A;  4EVO A;  4HMJ A;  1PTO C;  3AMU A;  5IGF A;  3NTK A;  3W2D A;  1QJO A;  3NWS A;  2D2C C;  1CM9 A;  3LWU A;  3I72 A;  4RKL A;  3D6W A;  1PRT D;  1TY2 A;  3I8Z A;  2Q8T A;  1JE4 A;  5HGT A;  4X3S A;  4HR7 B;  4DN4 M;  4ZQ3 A;  5KIX A;  4WOR A;  4FYD A;  3MEH A;  1T5E A;  3NHH A;  4RKB A;  1Y8P B;  1PFB A;  3WOF A;  3DWA A;  4O1N A;  4K2K A;  2A74 C;  2ZXP A;  4OIJ A;  4KHZ A;  3J80 E;  1JOQ A;  1LO5 D;  1TKW B;  2JXM B;  1CT1 D;  3SXH A;  3PO2 B;  1D1I A;  3V96 A;  4XQQ A;  2PZW A;  4WJW A;  1HXY D;  1EY4 A;  3HOZ B;  2XNA C;  1EIH A;  3L3O C;  4YIJ A;  4B9W A;  3DWQ A;  1OXV A;  2A69 C;  2AQ1 B;  4U67 3;  4R9W A;  3DWP A;  5C0X H;  1I4H A;  3CRL C;  3HEJ A;  2F0N A;  1DOL A;  4MN3 A;  3WDN A;  4CKB A;  2CQA A;  3PUZ A;  2HQE A;  5K5P A;  1PRT B;  5CV7 A;  4PMW A;  1EY9 A;  4Q0F A;  4DXG A;  4IUV A;  3FMC A;  1OXS C;  3C1F A;  1I4Q A;  5C4J B;  1I50 B;  3A7A B;  3S9W A;  4FF2 A;  2FMC A;  2KEE A;  4RHS A;  2LFN A;  4XXE A;  1KLU D;  3FPU B;  4ZKC B;  1PZI D;  3S1R B;  1EFI D;  3MC0 B;  2O4X A;  3D31 A;  2O2L D;  3D4D A;  4XQJ A;  4KY6 A;  3K59 A;  5G3L D;  1D5M C;  2F0K A;  1SSO A;  1O7L A;  1RF2 D;  4QUF A;  3QOJ A;  4RFB A;  1Z47 A;  2LY7 A;  3DEO A;  2B2Y A;  2EJF C;  4FNF A;  2M9V A;  2EY1 A;  2FHT A;  3S1M B;  1OXX K;  3RZD B;  5CR3 A;  2M2L A;  2IWH A;  1ONL A;  1NR2 A;  2F0M A;  1B2T A;  4BY1 B;  2K04 A;  1G8Z D;  1V8Q A;  3NE5 B;  1DON A;  1CQF A;  3H3V C;  2HCI A;  4F7X A;  2H1E A;  3DM1 A;  3RD4 A;  1SNO A;  1SYD A;  2N88 A;  5M3F B;  2MPM A;  2EZV A;  5CV8 A;  5ELC A;  3S1N B;  1BCP C;  3U9O A;  1SE3 A;  4XQN A;  4E6I A;  4CGY B;  1R4P B;  4DA2 A;  1JWM D;  4J6H A;  1D5Z C;  2RQX A;  5ELF A;  4C1N K;  3K0Y A;  3TME A;  4DAV A;  4G7H C;  2IX3 A;  1I4X A;  3MAQ A;  2RDH A;  2F3V A;  3P20 A;  3SK5 A;  4ZUJ A;  3IFT A;  2A68 D;  1SE2 A;  2PZU A;  2IW3 A;  1GUW A;  3X3M A;  3JAM L;  3J7Y W;  1STE A;  3MXU A;  3BYY B;  4HN7 A;  5IGD A;  2V4D A;  3LNN A;  4M8A A;  1GHJ A;  5EKI A;  5C3X A;  3K5M A;  5I4D A;  1VMC A;  4KN7 C;  2WAQ B;  2GA4 B;  1IKM A;  5KNC A;  1AN8 A;  1HA6 A;  5JPM C;  4BA2 I;  3MXP A;  1GUT A;  2ICE C;  1DOM A;  4IFD G;  4K8J A;  3GTL B;  2B8F A;  3MHB A;  2F0U A;  1I4R A;  5DNF A;  4KD3 A;  3NQT A;  3J81 L;  4RGN A;  1HUM A;  3OWE B;  2DNC A;  3BDO A;  1YNJ C;  1CFM A;  1TS2 A;  2E2I B;  5KRU A;  4H13 C;  1Y1V B;  5ELB A;  3T56 B;  3T53 B;  4N9P A;  4A3M B;  2PPB C;  1K8M A;  3MXN A;  2VB3 X;  2PZT A;  2X6L A;  3SK6 A;  2JEA I;  1CZG A;  2DN8 A;  5LL6 S;  1LTI D;  1S5F D;  4B9X A;  4KI0 A;  3D8G A;  3KK7 A;  3S14 B;  1EWC A;  4BBS B;  1RTN A;  2EJG C;  4OO1 H;  4HSP A;  1LLR D;  1S5E D;  1WD1 A;  4IUP A;  1AFP A;  5K36 G;  1BF4 A;  3GQB A;  3R8B A;  2EYH A;  2Q8I B;  4KHV A;  2EYL A;  2NUC A;  4C3I G;  5CV4 A;  2F0E A;  4H7B A;  1IYV A;  1M8A A;  3S2H B;  3R2T A;  1I6H B;  2K28 A;  5KNB A;  1LTS D;  1ML0 D;  1HCZ A;  1GHK A;  2G9H D;  1KDB A;  1KNE A;  2BA1 A;  1NUC A;  1FNW A;  1J9O A;  3DXJ C;  5C0X G;  2R6G A;  1MI2 A;  2FMM A;  2G9D A;  4ABN A;  2F0L A;  1SNC A;  2K6A A;  3MZ5 A;  5C3E B;  1KDA A;  5KYL A;  2F0D A;  2RKS A;  1WTX A;  4C1N I;  2B2V A;  1BCP F;  1HHV A;  2RDF A;  2Z4H A;  4ZK9 B;  3VR2 A;  4ZLT F;  1TS4 A;  2BDO A;  1A6X A;  1PXU A;  4RWS C;  4A3E B;  2B2W A;  1W6J A;  1BQQ T;  2L55 A;  1WCM B;  3IL8 A;  4BS9 A;  1PZK D;  3K5N A;  4HSV A;  4DNT B;  4DFA A;  4JBW A;  2NBF A;  5FLX L;  3R93 A;  2LKV A;  2JA5 B;  1DXM A;  2MGS A;  2B2W C;  4K2L A;  1SEB D;  3V05 A;  3ERO A;  1AP0 A;  1SJE D;  1CA5 A;  1EY0 A;  4K6L A;  2KJX A;  2CVR A;  1HFG A;  4ZAI A;  4J8Q A;  3VYU A;  2XRS D;  5JOB A;  2QEJ C;  1MSH A;  4TQU S;  3N52 A;  3DMU A;  4RCN A;  3QOL A;  1TQO A;  5JVG 3;  3SK8 A;  1TVX A;  3U9S A;  3QB3 A;  3A8J E;  2EYJ A;  5E4W C;  1BCP D;  1Q8I A;  1LTB D;  4FP5 D;  1GUG A;  1EY8 A;  2X69 A;  4K8I A;  1A3T A;  3HRZ C;  1CTM A;  4A93 B;  4KTA A;  5JAV A;  1BNZ A;  1F77 A;  3W3A A;  4N9T A;  5JEA G;  4CJ2 C;  1GUO A;  2JP1 A;  1H9S B;  2HDM A;  1U4M A;  1VDZ A;  1XYI A;  2K01 A;  2N55 A;  1TWH B;  1ZXT A;  1PTO D;  3I4L A;  2ID0 A;  3LWE A;  3OIP A;  1JB3 A;  1MSG A;  3L7Z C;  1SND A;  3S1Q B;  3MA2 B;  2WII B;  2A6E D;  1XX8 A;  2NTT A;  1R4Q B;  4MHE A;  5J39 A;  3S17 B;  2B2U A;  5CV6 A;  1WTV A;  5HUR A;  4FXG C;  1Y8O B;  5G3L F;  3UI2 A;  5D3D A;  2RA4 A;  2K7V A;  2B2T C;  1UNS A;  1PTO B;  1HTL D;  1KNA A;  3RLF A;  1LTG D;  4KK7 A;  2KUM A;  4BY7 B;  1PTO H;  5CBA E;  4QUC A;  2NTS A;  4HCS A;  3VYT A;  5FK9 C;  1G91 A;  1G2T A;  2K33 A;  2AQ3 B;  4DGZ A;  4L6T B;  1KAA A;  4IN3 A;  1ESR A;  5FO9 B;  1U4L A;  1F9Q A;  1JOO A;  2AQ2 B;  5JPN C;  1TR5 A;  3A7L A;  1I3Q B;  1PTO F;  2D5D A;  4IQZ A;  5F2D A;  4ZKB B;  4KKS A;  2O5I C;  5M5X B;  1QNU A;  1SMY C;  4K5W A;  4RGO S;  4A3I B;  3GTJ B;  2QIL A;  2NN6 H;  1F2Z A;  3HKZ B;  1WTR A;  3I4N B;  4L8J A;  3Q22 A;  3T4A C;  3HGB A;  4A3D B;  2OEO A;  5EPJ A;  2M00 A;  2WV6 D;  2X6G A;  4A3F B;  4LAA A;  1LT5 D;  3K5O A;  1A2T A;  2NVY B;  3OHX C;  4XDX A;  5IGB A;  2RSO A;  4FVM A;  4IUU A;  1Q1E A;  5A2Q L;  2J0T D;  2Z4I A;  5BN4 A;  2SNM A;  1PRT C;  1BOS A;  5C4H A;  2KCC A;  3ONA B;  1IKL A;  1H9K A;  1ZYR C;  3H94 A;  1LT3 D;  3VR4 A;  1TWA B;  1Q3L A;  1RKN A;  2K5D A;  2K5W A;  4HTH A;  1FNV A;  2A6E C;  3EFX D;  2F4I A;  4S3S A;  1ILP A;  1QCB D;  1BXT A;  1JIC A;  3SDZ A;  1XXG A;  2D62 A;  4CHT B;  4C3J B;  3KF8 A;  3A8K E;  1WVL A;  4U68 A;  1SE4 A;  1FGB D;  1CA6 A;  1QG7 A;  3TP8 A;  4PMC A;  3BDL A;  5TSS A;  4XYO A;  2BDN A;  2IL8 A;  4JK1 C;  3R2I A;  2JA6 B;  3C1E A;  4R8N A;  4V19 0;  5EPK A;  1EEF D;  1FNU A;  3L9A X;  1JOK A;  3HS0 C;  2JEB I;  1CQV A;  4NW2 A;  2KA7 A;  5C44 B;  5IGC A;  1HUN A;  2DY8 A;  2EPB A;  2YU9 B;  5EPL A;  2NN6 G;  2NYZ D;  2MJ8 A;  2B2Y C;  3C2P A;  1EU4 A;  3KBG A;  5C5M A;  1PYW D;  2JA8 B;  2WAC A;  1DJR D;  3IAY A;  4NDX A;  4IFD I;  1DD2 A;  2K5Q A;  3BDC A;  4J1M A;  1XTC D;  4DU9 A;  1F2M A;  4KN4 C;  1AEX A;  1MGS A;  3A8I E;  5A35 A;  3D3R A;  5E1F A;  2HCC A;  4TKO B;  3PMF A;  4ZYS A;  2A6H D;  1HFN A;  2NVQ B;  1AW7 A;  3MFG A;  1VMP A;  4EGV A;  4RH6 A;  3GD7 A;  4IUT A;  3RMH A;  1LTT D;  1EOT A;  1AZQ A;  4UAI A;  5DEH A;  2Y0S B;  4PV1 C;  1GUN A;  3SR1 A;  1X3P A;  3OMG A;  1II3 A;  4HCE A;  2PNR C;  2SEB D;  1VCI A;  2BOS A;  1STY A;  5C0X J;  5COY A;  5EQ0 A;  4ILW A;  3TBI B;  3K57 A;  1EY5 A;  1D2B A;  3K58 A;  2AWN A;  2Z1C A;  4IFD J;  4X3K A;  2XVS A;  5DM6 3;  2XSC A;  3D4R A;  1O7Y A;  1H9S A;  1JWS D;  3EQL C;  1SNQ A;  1QB5 D;  2NB0 A;  2NVT B;  1EYA A;  1S5D D;  5IGE A;  4CKE A;  2WB1 B;  2NWG A;  1S4Z A;  1SYG A;  2R7Z B;  3OSO A;  4C2M B;  4KY5 A;  1I6V C;  2JYO A;  1WTW A;  3GTM B;  4IZ8 A;  3S16 B;  2B2U C;  3TP6 A;  3KLS A;  1HRJ A;  2AUK A;  3VR3 A;  3JAM E;  2E76 C;  4PQX A;  2TSS A;  5ISR A;  5J22 A;  1CHQ D;  3GTQ B;  2F03 A;  1O80 A;  2ENB A;  2SOB A;  3FVQ A;  1WTQ A;  1X3Q A;  3LX0 A;  2E2H B;  2XN9 C;  3A55 A;  1ZYR D;  5KYI A;  2KQ3 A;  5NUC A;  4Q5V A;  1PFM A;  4F87 A;  2BE5 C;  3E6Z X;  2AWO A;  3CRK C;  1PZJ D;  2AUJ D;  2EXZ A;  4IUR A;  1Z7T A;  3GTP B;  4QF4 A;  4C3I B;  1W6K A;  3NWT A;  3HOU B;  4KJN A;  4XT3 B;  2A73 B;  2J7Z A;  1YNJ D;  1B44 D;  5EBC A;  4FF3 A;  2MUY A;  1AZP A;  4ID6 A;  4RA8 A;  1L0X B;  2EDG A;  3ND9 A;  4RAU C;  2Z8L A;  1MD2 D;  5JJZ A;  4QB4 A;  1B4O A;  2YYZ A;  4DK0 A;  1KTK A;  4GZY C;  4V0B A;  2EJM A;  1HA5 A;  3CKI B;  1NCV A;  1S5C D;  1Q12 A;  3QIA A;  3SEB A;  1EYD A;  1FYC A;  2MP1 A;  5DM7 3;  2EY6 A;  3TP7 A;  1EY6 A;  5I2Y A;  2A68 C;  3ZYY X;  1GOZ A;  3TZU A;  2E75 C;  3GTG B;  2OT2 A;  4B08 A;  4X3T A;  4DF7 A;  1SFO B;  5C3W A;  1LTA D;  3TZD A;  4R8I A;  2WP8 J;  3IKJ A;  3CQZ B;  2LMC B;  2H4O A;  3BYT B;  3Q23 A;  1HTP A;  2RDG A;  3O13 A;  1TWG B;  5E3F A;  4KKT A;  3NSW A;  1HPC A;  1QE6 A;  3J7A V;  1RHP A;  1WTO A;  3URY A;  1BUV T;  3E5S A;  3NUC A;  2PW7 A;  3OW7 A;  3BS1 A;  2XWB B;  1C4Q A;  4XYQ A;  3VYS A;  2C9O A;  2PYK A;  3T51 B;  3A56 A;  4FXD A;  4RCO A;  2KVM A;  5JEA H;  5EKL A;  4P2C B;  1SYC A;  1LT6 D;  3BZD B;  3S2D B;  4OIK A;  1D6E C;  1NR4 A;  4HMI A;  1IW7 C;  2Q8R E;  3NXW A;  3I4M B;  4X3U A;  5T1G A;  4IUN A;  2EYM A;  5IT9 E;  5ELE A;  2KED A;  1U4R A;  2XWJ B;  4FF1 A;  3PV0 A;  4A3K B;  1YNN D;  1A3U A;  4F8M A;  2JA7 B;  4Z9C B;  4QCL A;  3A54 A;  4DXF A;  3MWY W;  1B50 A;  1TS5 A;  4H0L C;  1STA A;  2RSN A;  2XRQ D;  2K32 A;  1LTR D;  3TSS A;  5FO8 B;  5T1I A;  2B2V C;  3G7L A;  3SE0 A;  3H09 A;  3P7J A;  4OGQ C;  5KND A;  1PLF A;  5CV9 A;  3EJI A;  4ZUI A;  1H9J A;  4KV6 A;  1U9R A;  2R93 B;  4M1U B;  3BVG A;  2EY5 A;  4XT1 B;  2F0V A;  1BBX C;  4RGM A;  5FO7 B;  3F2U A;  1ZKO A;  3J80 L;  1JOR A;  3PUW A;  5C4X B;  4RHR A;  4TSS A;  3C3L A;  1DZ1 A;  2ZXO A;  1TWC B;  3H91 A;  1Y1W B;  1Z6H A;  1H9M A;  5COR A;  1EYC A;  1KDC A;  2B2T A;  4RGT A;  3PIP 3;  2VUM B;  2K03 A;  2OF1 A;  5FKA C;  3C46 A;  1D1K A;  1CI3 M;  1C48 A;  5M5W B;  1E2V A;  1EU3 A;  5BN5 A;  3ERQ A;  1IYU A;  2PQE A;  3RUZ A;  3M3Y B;  1STB A;  4ULL A;  2BE5 D;  3PO3 B;  2R3Z A;  3J7A F;  3QJY A;  2A5H A;  2J4X A;  5I9P A;  3P75 A;  2L4N A;  5M3M B;  2IPK D;  1JQY D;  1F2L A;  3D6C A;  3HOX B;  1VF7 A;  4KKU A;  2HDL A;  3VA7 A;  4BA1 I;  2EYP A;  3E0J A;  1NSN S;  3KLR A;  5LHY 1;  5JEA J;  5AFW A;  3AB9 A;  1M4V A;  1SYB A;  1QNK A;  3AU7 A;  3FPP A;  5CMD A;  3FDT A;  1BCP B;  3TN2 A;  2CW0 C;  3NBH A;  1DM0 B;  4OO1 I;  3MXG A;  4CBV A;  1SYF A;  2VB2 X;  2F0I A;  3I90 A;  2FFK B;  1OO9 B;  5EBD A;  4PNY A;  3ND8 A;  1EIG A;  5D14 A;  3P1H A;  3I73 A;  1STN A;  1X32 A;  1JCK B;  2XIW A;  2PW5 A;  5EGT A;  4IFD H;  4UDU C;  2KCN A;  1ET9 A;  5C0X I;  1FD7 D;  3M4Y A;  1Y8N B;  1ESF A;  5A2Q E;  2PCF B;  1EY7 A;  1PFN A;  1RTO A;  2BCO A;  2K1B A;  4DAY A;  1SAP A;  2L9H A;  2JE6 I;  1ENA A;  3OIQ A;  5FLX E;  2IJ0 A;  2OXP A;  2QKI C;  3CHB D;  4I65 A;  2SNS A;  1G2S A;  4PMB A;  1F9S A;  3DUZ A;  3PUY A;  5C5L A;  1JWU D;  3M4O B;  1LAC A;  4C3H G;  3GO5 A;  2D9U A;  2K05 A;  1GXD C;  2F0W A;  3PUX A;  3HOW B;  1B3A A;  4ME5 A;  1BR9 A;  1C8C A;  1QWY A;  4DAP A;  4WRD A;  2IT1 A;  3KUP A;  2ZT9 C;  1YNN C;  5D3I B;  1F2Y A;  1BDO A;  2F1M A;  4K5X A;  2QDB A;  2E2D C;  3NK9 A;  2O5J C;  5BN3 A;  1O7Z A;  1WTP A;  3CU7 A;  2EE1 A;  1ICW A;  4OHJ A;  3BG3 A;  2WIN B;  4A3J B;  4K6D A;  5ELD A;  1F9R A;  3Q6S A;  4WFN 3;  4H44 C;  1DCZ A;  1IL8 A;  5I6Y A;  1EWH A;  2L1B A;  1SXT A;  3TDQ A;  1V43 A;  2PO4 A;  4FF4 A;  3VR5 A;  3OOC A;  2F0F A;  4NP5 A;  2ICI A;  2L11 A;  1ZEQ X;  1EQV A;  1QIL A;  3DEP A;  3QO2 A;  2KHS A;  1HQM C;  3ITP A;  2IX1 A;  3G6J B;  2F0G A;  4KMU C;  5LL6 X;  4QIW B;  1K83 B;  4C56 C;  2EYF A;  2L12 A;  5KEE A;  3Q24 A;  2FJ2 A;  3J81 E;  1MBY A;  3K5L A;  1OXT A;  5CGK A;  1TU2 B;  1RD9 D;  4C3J G;  3GTK B;  3HOV B;  2NZ1 D;  2KOL A;  3NP8 A;  4HAE A;  1E0B A;  1UAP A;  4CJ0 B;  3H0G B;  1TS3 A;  1B9M A;  5I6W A;  2NVX B;  4G7O C;  3NBI A;  2BA0 A;  4G4K A;  4C3H B;  2ZXR A;  3EVQ A;  4CKC A;  2SDF A;  3KBX A;  1SDF A;  5M5Y B;  2EYO A;  2DNE A;  5M9O A;  1Q90 A;  1XWE A;  1JC7 A;  2KEC A;  3T16 A;  3NTH A;  4K14 A;  4DNR B;  3DHQ A;  1F9P A;  1TY0 A;  3TP5 A;  3GV6 A;  2FIN B;  5CV5 A;  5D65 A;  1STG A;  2EY2 A;  5KGU A;  3I3C A;  3MVV A;  4LMQ D;  3I91 A;  1EQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...