1SNQA

Protein stability in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 130
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snqA00
5E3FA 3OMGA 3EROA 4I65A 4QF4A 1EYAA 5EKLA 1NUCA 3OSOA 4LAAA 4F8MA 5HURA 2EYFA 3ITPA 2F0VA 2SNMA 2EY1A 2EYPA 1TR5A 2RBMA 3E5SA 1STBA 4KD4A 5CV4A 4HMJA 5C4ZA 5IGGA 5IOCA 2F0SA 1EQVA 3TMEA 3TP8A 1EY0A 4DFAA 5EKKA 5KEEA 2F0LA 5CV5A 3ERQA 4QB4A 3EVQA 4KHVA 5CR3A 5ISRA 2F0JA 3BDCA 3HEJA 3SK6A 5C3WA 5DEHA 3S9WA 1AEXA 1EY7A 5E1FA 4E6IA 5NUCA 3V2TA 2F0NA 4K8IA 4R8NA 4KD3A 5IGCA 3VA5A 4PMCA 1SNPA 2M00A 4ME5A 4J1MA 3U9OA 4ID6A 3MEHA 4J6HA 5CV8A 1KDAA 2OF1A 5KIXA 3HZXA 5IODA 4EQOA 3D8GA 3NXWA 4EQNA 1ENCA 1ENAA 3OWFA 1F2ZA 2EYLA 3QOLA 2F0KA 4ZUIA 1F2YA 3BDLA 1A2UA 5DAUA 1KDCA 5I9OA 2F0QA 2F3VA 4IALA 3SHLA 3LX0A 4QMGA 3TP7A 1RKNA 4K2KA 5CGKA 4NDXA 4IZ8A 5C6AA 1EY6A 2LKVA 2RDFA 2ENBA 2PW5A 1EY9A 1A3UA 3OMCA 4TRDA 2EYMA 5C5MA 2O4XA 1A3VA 5F2DA 3MHBA 1JOQA 2F0IA 3MXPA 5IGDA 2PZUA 5IGFA 1SNDA 4G57A 2HQEA 5CV9A 2F0EA 4K5XA 1A2TA 3R3OA 4RKBA 3P75A 2EYOA 2F3WA 3SK8A 2PZTA 4PMBA 1STAA 2SNSA 1EY4A 4ODGA 4PNYA 2F0GA 5C5LA 3RUZA 2QDBA 1KAAA 3TP6A 3QB3A 1SNCA 1IHZA 2F0OA 2F0MA 1NSNS 2EY2A 3DMUA 4EQPA 5CV7A 5I6YA 4IUNA 5J22A 1EZ8A 1SNQA 2F0PA 4OL7A 5CC4A 4KY6A 4DU9A 1A3TA 4B9WA 1SYCA 2F0DA 4S3SA 1EY8A 2PYKA 4NP5A 5CV6A 1KABA 2F0HA 5M9OA 2WACA 1EZ6A 1TQOA 3T13A 1EY5A 3T16A 5KGUA 3D4DA 4NMZA 5J1ZA 1SNOA 3SK4A 2KHSA 4MIUA 4K5VA 3SR1A 4N9TA 5C3XA 4DF7A 3DHQA 1SYDA 4DGZA 4K5WA 5KRUA 2F0UA 5IGBA 4KJNA 3D6CA 1F2MA 2PZWA 4HMIA 4N9PA 3PMFA 4WRDA 3C1EA 2F0WA 2RKSA 4K6DA 2SOBA 2F0FA 5IGEA 3H6MA 4K14A 3NP8A 1JOOA 1TT2A 2F0TA 5EGTA 4KTAA 4HTHA 4WORA 3TP5A 5I9PA 4KV6A 1EYDA 1SYEA 3NQTA 4KY5A 5I6WA 5J39A 1STHA 5HGTA 3MZ5A 4B9XA 2EY5A 3NK9A 3NHHA 1SYBA 1STGA 3P1HA 3NUCA 4NKLA 4K2LA 4KJOA 3MVVA 5KYLA 1KDBA 1U9RA 4K8JA 2EYJA 4H7BA 2PQEA 2PW7A 2EY6A 5IIFA 2EYHA 3QOJA 4YIJA 2KQ3A 3SXHA 5JAVA 4KY7A 5C4HA 1SNMA 2NUCA 1EYCA 5KYIA 3D4WA 3SK5A 1STYA 1STNA 1SYFA 1JOKA 2OEOA 5K5PA 4EVOA 3C1FA 2OXPA 1SYGA 5JOBA 1II3A 4ZUJA 1JORA 4ZQ3A 4RKLA 4F7XA 2EXZA 3EJIA
chains in the Genus database with same CATH superfamily
1CZGA 3U58A 3SE0A 3UDXA 4BBSG 1RF2D 5GAGC 4BBRG 4FXDA 2NN6I 1X65A 4JI4Q 4KD4A 1STBA 1SE4A 2LXJA 1LT3D 2WAQB 4X3SA 1IYUA 4GNXC 3GTOB 3GTPB 4IFDJ 2KCCA 4JI1L 4CDDC 2CQOA 1VQJA 5M3FH 5CR3A 1TVXA 3OTOL 5C3WA 5DEHA 3CP0A 2CH4W 5H1SE 2JXMB 4DXGA 4PQXA 3TREA 1Q86C 4DUYQ 4LF9Q 3D4RA 3BZCA 4ZUIA 1D5XC 3DLLA 3VR6A 3CC4A 4IALA 4A3CH 1STEA 2ENBA 4JCVE 1P8LA 3MHBA 4YHHL 1Z47A 1SJED 2PMZE 4ZKCB 5FJ8H 2OCEA 3R3OA 2EIFA 2BH2A 3GTMB 3CCLA 1PRTC 2K03A 1STAA 2XSCA 3IL8A 1Q12A 1F9PA 2QDBA 3CCSA 1HNXQ 1PMRA 3SEBA 4A3LG 2OTLA 3E0JA 2HQLA 1TWFB 3GP7A 1LTTD 3KDFA 1I6HH 1KABA 2XRQD 3L0OA 1M90C 4HCSA 2Z9HA 2J4XA 3T56B 1HNWL 1NY4A 1A15A 4K5VA 1I4PA 3R8BA 3CU7A 1S72A 3T51B 4OX9L 1YVCA 1ZYRC 2IX1A 3GTPH 1NNXA 2A69D 2K52A 3T1YQ 1QVGA 1KXLA 1JOOA 4JI3Q 1HTLD 3EIVA 5I9PA 1VQCA 4A3IG 2J7ZA 5E4WC 1LTRD 3MZ5A 1N32Q 1WTOA 2BA1A 4QJFA 1STGA 1UE7A 2K1BA 1XMOL 5C0XG 3CD6A 3TEHB 3GTKH 2HD3A 3F8TA 1G8ZD 3OOCA 3P20A 4KY7A 2Y0SG 1PYBA 5KYIA 1CA5A 1PXUA 5K5PA 1HA5A 2ZTCA 5BN4A 3DEPA 2G9HD 4Y7NB 1EQQA 3H15A 2JA6B 3EROA 3Q23A 3GTMH 1O7ZA 2PNHA 5HURA 1EQRA 2MJ8A 4BY1H 1BR9A 2I5MX 5C3EB 2YTYA 4DR2L 3T1HQ 1O7YA 2Z6KC 3M4PA 5KEEA 5CV5A 1TWFH 3ERQA 1DCZA 1X3GA 3EVQA 2K5DA 1ASZA 2JEBI 2F0JA 3A7LA 1F9SA 2XNAC 3I7FA 2LS01 3G6EA 2UXCQ 2HIVA 4ME5A 4DR7L 1PV4A 3OWEB 1JC7A 4RGMA 1JB3A 3ZJYC 3JAME 3W2DA 2VUMH 2PPBC 1TS4A 2QGQA 4JYAQ 4Y52H 3LX0A 1NJIC 2G9DA 1BVSA 2R93B 4NXNL 5COYA 4DV7Q 1OXUA 4DXFA 2B2YA 3HOYG 4A3MB 5HY6A 2EYOA 3NENA 4ULLA 4UPAA 1K73C 1YHBA 1EY4A 2SNSA 4UP7A 1CTMA 1I94Q 3BZKA 3VR4A 2XN9C 4K0KQ 4RMFA 5K36H 5CC4A 3RNUA 2Z4IA 2F03A 3NTHA 2K5HA 1SYCA 4A3FH 1DONA 5IYDH 1Y14B 2WACA 2F4VL 4LW1A 2PO4A 4NW2A 4DF7A 5KRUA 1Q1EA 4A3GG 1X9NA 4GS3A 4A3EG 4XT1B 5C3EH 2B3GA 4B3SL 2TSSA 3E9IA 3M4QA 4IUPA 1D1KA 1KAWA 1U4RA 1EWHA 2F52A 5IGEA 3S2DH 3NP8A 3GTLB 1VCIA 2F0TA 1IXRA 5IP9H 3Q8DA 1VQ6A 1B1ZA 4JBMA 1G2SA 5EAYA 5A35A 2HT1A 2NBFA 3TN2A 3GTGB 2KBNA 1Q81C 4M1UB 2VQEL 2AUJD 4HJ8A 2RA4A 1PH5A 4K6LA 1HFNA 5EPKA 4GNXA 4L8JA 1EYCA 3IAYA 2R93H 4R4OA 4LF4Q 2E5LL 3M7NA 2OXPA 2KCMA 1SROA 1A8VA 2F1MA 4F7XA 2EXZA 2Q8TA 4C3HB 1Z7TA 1SE8A 2IY5B 4BXXG 4G7OC 1ICWA 3PO3B 3H3VI 2F0SA 4OELB 1EQVA 5D14A 1VQEA 1A6XA 1SN8A 3A5ZB 3STBD 2JA5G 2QEXA 4JV5Q 1SFOB 3K7UC 3S15B 1XNRL 1CI3M 2B63H 1R9TH 4EQOA 4HIOA 3HOVH 3QOLA 4NXML 1DM0B 1R4QB 1BF4A 3S17H 4DV0Q 1A2UA 2Y0SE 1JWMD 4ZK9B 1SSOA 2EE1A 3UI2A 1GHJA 4AH6A 2RDFA 3CW2C 3S16B 2PW5A 3IKJA 4IURA 2O4XA 1GM5A 5M5XH 3R2TA 4JI2L 2HQEA 1GUGA 1HZ9A 4U68A 3RLOA 1XTCD 3GTGH 4RKBA 4LWCA 1I4XA 3I91A 3BJUA 1HQMC 1TWCB 1TWAH 1Y8NB 3QB3A 1A0IA 1IHZA 2M9VA 4NB3A 4EQPA 5IY0A 1FJGL 4IUNA 3IFTA 1LT6D 1V1OA 1K28A 4O2DA 4QIWB 4XTCS 3J81j 4I7ZC 1JR0D 4AYBB 3NBHA 1L0XB 2Q8IB 4RCOA 2CWAA 4B3TL 2I5HA 1XJVA 4DR5L 2NZ1D 2NN6G 3HKZB 4CHTB 5I2XA 3O13A 2VW9A 4J8QA 3I4NH 5IWAL 3PO3H 2K75A 1Y1WH 4HCEA 3CKIB 2K5WA 3RLNA 2Z1CA 4N8X1 3NPPA 5FLXc 1UE1A 4DV6Q 1SFOH 2C35B 2R7ZG 3S15H 4NKLA 4K2LA 1W3SA 2N3SA 2DN8A 3KDFB 4K8JA 3STBC 4CKCA 1BCPF 1Q1BA 3W1GA 3PO2H 1HA6A 3FPUB 1UE5A 1K8MA 3S1MB 2UUAQ 3PIO3 1N33Q 4IOAA 2Z6KA 4JK1C 4EQ5A 4DR1Q 1C7YA 1HNZQ 4BS9A 1H9SB 4DV4Q 1B9NA 4LF6Q 1ONLA 1V1PA 2Z6BA 1VQ9A 1KQSA 2LSSA 1OXVA 2IX0A 3VYRA 1LUZA 5ELCA 1CQFA 1TWCH 4DV3L 1ML0D 1TR5A 1E24A 1BBUA 2E74C 4L5QA 3TMEA 1WVLA 4LFBL 4RGTA 1Z6HA 1UE6A 4CDCC 4IJLA 2VB3X 4GOPB 3V2TA 3G71A 2GVBA 4GKJQ 2FFKB 4CJ2C 2JA7B 4J1MA 3EFXD 2Q2IA 1CM9A 1Y1VB 2F0KA 2JQOA 4DR4Q 2DJGC 3U4VA 1EU4A 5C6AA 1QVFA 2B8FA 4PZ6A 4APVA 1HZAA 5FLMH 1MJEA 4A3KB 5ELNA 3R93A 1B44D 1X3PA 1CZWA 1TS5A 4BY7H 4F88A 4H0LC 3SK8A 3BZDB 2UU9L 5AJ3L 4DR6L 3NELA 4PNYA 1G51A 2ZJRA 4CBVA 4RGNA 5CV7A 1IZ6A 5JVG3 1EWIA 1FNWA 1D5MC 3SVMA 4A3CG 4ME3A 3CRKC 4B3RL 1WTRA 2FXQA 1TY0A 4C3IH 2JEAI 2JJQA 2E2DC 2E2IB 4DR3Q 1BO0A 1SJHD 4JBKA 5FJ8G 2VNUD 4DNRB 1N36L 2I0QA 1IBML 1H95A 4WRDA 4XYQA 4JW0A 4GKKQ 2SOBA 3OPOA 3P7JA 4FNFA 2K6AA 2GA4B 1LTAD 2VS1A 1PFMA 1HUNA 1UUPA 5FOBB 2MO0A 2ZT9C 4QL5A 1YZ6A 2K5QA 2R3ZA 5CMDA 4Q5VA 1VQBA 3DWQA 5JJIA 5BR8L 3KF6A 3KLRA 1HH2P 2CH4A 4H7BA 4OWWB 1EYGA 2YU9H 5C44B 3S14H 4KI0A 1VQ8A 3K5MA 4IFDH 3SK5A 4MTKA 3UDGA 1STNA 3GTQH 2IHEA 2ZM6Q 1KNEA 4ALPA 4DAPA 1JMCA 2RVLA 1SDFA 4LF5L 4C56C 3GTJH 5C4JH 1MIUA 3KOJA 1BCPD 4X64L 4OO1H 5C4ZA 4HMJA 3TS2A 1VQDA 1BNZA 3TP8A 1EY0A 4JC0A 4IPCA 4V0BA 1Q7YC 1KLUD 3KJOA 1F9QA 1LTBD 3V96A 4LMQD 1PDQA 1PLFA 4GNXB 2VB2X 4K8IA 3UE1A 3H09A 1AP0A 2ID0A 1E1OA 1Q8IA 2L12A 5KIXA 2OF1A 5IT9E 4QY7A 5JEAG 5EJWA 2CW0D 3VDYA 3MXNA 1YNND 1OO9B 4QMGA 1L0WA 4JI1Q 1JJGA 4BY1G 1RTNA 1VQPA 4AQYL 3E6ZX 1EWCA 3OTOQ 4G4KA 4AIMA 3L7ZC 2A74C 2I07B 4G57A 1IL8A 2X6GA 3J7YW 4CDFC 3RUZA 5C44H 4L6TB 1D2BA 3HOXB 1PRTB 2VUMG 3NWTA 2NVXB 3PV0A 1EY8A 2BA0A 5D3IB 3DWAA 4YHHQ 2IHFA 1CK1A 5KGUA 3G7LA 2R92H 4IUTA 4C1NI 3HFZB 1EEID 1K8AC 5IGBA 2IPKD 4KJNA 1JWSD 1NE3A 3D6CA 3BG3A 4POFA 3PMFA 2HCCA 1BCPC 3KF8A 2LMCB 1F2LA 1S5BD 4WORA 3L2PA 1M4VA 4OO1I 3DEOA 1WTXA 2A6ED 2IW3A 1HNWQ 1HJPA 1GXDC 3E3XA 4A3FG 3NBHB 5IYDG 1LM0A 3QG1A 5JAVA 3S2HB 4OX9Q 2KQ3A 5LMNW 1E2ZA 2JA8B 3NEMA 1PZKD 3KBGA 3MXGA 1HR0L 2CW0C 4KLKA 4U673 5C3EG 1YNNC 1S5CD 2D9UA 4BWGB 2VL6A 1VF7A 4NPSA 2KECA 1MI2A 1PYWD 5M3MH 3EJIA 1FGUA 4GLAC 4PMWA 2QKIC 3HP3A 1XMOQ 3FHWA 1SMXA 4YWLA 3HOUH 2EY1A 2KHIA 3CXCA 3HOXH 3ND9A 2Q2HA 3J7ZC 3IRBA 1VQGA 2WV6D 2KVMA 1X6OA 1I50H 2ZXRA 3TBIB 2R93G 4R8IA 4CJ0B 4A3DH 2YV5A 1HCZA 2M00A 3J80E 1PH2A 2AQ1B 2B8GA 5IODA 1DOKA 1V1PB 3RD4A 1QZGA 3CCRA 5CGKA 1NR4A 4NDXA 4DR2Q 2DGYA 2LKVA 1GVPA 3S1QB 3CPWA 3K57A 5LL6S 3Q0AA 3EBEA 4XQNA 1I3QH 1SNDA 4P2CB 4WJWA 3Q24A 1YNXA 2X69A 1V8QA 4DR7Q 1UWVA 2F3WA 3HG9A 2A6EC 3QWNA 3DUZA 3URYA 2A5HA 2ASBA 1FVIA 1YJWA 4YY3L 1PTOF 3CPFA 2B63G 1K8OA 1H9RA 3HOVG 2RSNA 4NXNQ 1JT8A 4S3SA 2HCIA 3X3NA 5FO8B 3T13A 3MXUA 1CA6A 5GROA 1S3OA 3AMUA 1ESRA 3H0GB 2FMMA 4QGUA 4HMIA 1WTHA 2F0WA 4H44C 2D62A 1N8RC 3NTIA 1U5KA 5EBDA 1SE3A 5L37A 3NWSA 3E0EA 5C4XH 4KN4C 3NQTA 3U4ZA 5J39A 3GO5A 5HGTA 3NK9A 4YWMA 3A55A 1F9RA 4CKBA 1SYBA 3BVMA 2F4VQ 4RHRA 1U9RA 5IYCH 3ICEA 4JI0L 3QR8A 2PMZB 1WD0A 1DOLA 4B3SQ 2D5DA 2RQXA 1EOTA 3S1QH 1YEZA 3I4NG 1SYFA 4HEDA 1G91A 3GTOH 3PO3G 3GD7A 3C1FA 4WJ3M 2FMCA 1Y1WG 1LTGD 4YWKA 2L55A 4ZUJA 4UDUC 5ELEA 1IW7C 4IOCA 1WTPA 4QUCA 2NTTA 1PH4A 1E7ZA 3E9HA 2VQEQ 2EYPA 1O78A 3J81L 2EZVA 3W5OA 1TS3A 2UXBL 1AE3A 3KF6B 2VZAA 3PO2G 3M9BA 2E5LQ 1KC8C 2K50A 3J81c 4JI8L 4WFN3 5NUCA 2IX3A 1M1KC 4P74A 2K04A 4JI6L 3HZXA 4IUVA 4LUOA 3D8GA 2UXDL 1AZQA 4OWXB 4LF8L 3SHLA 2WIIB 3L3OC 2IT1A 4X3UA 2KHJA 3PIOA 5A2QL 3I8ZA 3W3AA 5BN5A 4HJ7A 1O7IA 1LO5D 5HGQA 4RHSA 1XNRQ 2PZTA 4QCLA 1LTID 4G7ZC 3ULLA 4NXMQ 1U0LA 2L1BA 3QIAA 3HKZG 1SRUA 4A3JB 4KY6A 2V4DA 4DU9A 2G5DA 3MXNB 1IBKL 3T16A 1EY5A 3MEFA 4JI2Q 4JPBW 1CUKA 4YCWA 4DGZA 5FLMG 3H3VH 5KNBA 4BY7G 4N9PA 4A3BB 2N78A 4K6DA 2RKSA 3F2CA 4MHEA 4GLXA 4X65L 3Q22A 1OTCA 4L5RC 1PTOD 3HOZB 2IWHA 1RD9D 1FJGQ 1CFMA 3AQQA 1XPUA 4I7AA 1EFID 4FDBA 2WP8J 1K83B 1EYDA 2RCNA 3LGJA 1C48A 4LUVA 4B3TQ 4RAUC 2JE6I 3S1RB 1YHAA 2A8VA 4DR5Q 4Y7NH 2ICIA 2DNCA 2PI2A 4C3IG 5LMNL 2JA6H 5IWAQ 3ND8A 4BBSB 2CVRA 1RTOA 2FHTA 2WINB 2D0OA 4FVMA 4BBRB 3BVGA 1IBLL 2K32A 4A93G 1BQQT 1JORA 2NWGA 4ZQ3A 1VQOA 1B8AA 4RKLA 2B2TC 3RN2A 1FNUA 3KF8B 3RZOB 1PH8A 1J5EL 2DNEA 3TSSA 3J80c 1UEAB 1VF5C 1Q90A 4EX5A 2R6GA 1WI5A 1W6KA 1YI2A 3A74A 1KD1C 2QA4A 1JJCB 4IFDG 2O5JC 1EOVA 3R2IA 2K33A 4DAMA 2KCTA 4RA8A 3BU2A 4J6HA 3VR5A 4A3MH 1YITA 3L9AX 1HXYD 4A3BH 3BDLA 2MGSA 4DV3Q 2F0QA 1I6VC 4OEMB 5M5WB 1VMCA 2A6HD 4LFBQ 3OMCA 3H94A 2JK8A 1PTOC 1JB7A 4C2MB 4LFAL 1TKWB 5FO7B 2MP1A 4LJZC 3BS1A 1HZBA 1PHJA 1YNJD 3TS0A 4PZ8A 1ZXTA 4YCVA 2XIWA 1OXXK 2BH8A 1VQIA 1LLRD 3M4OB 4R4CA 2JN4A 4BBRH 1A63A 2MO1A 5JPMC 4XQJA 1JWUD 2K5NA 3RZDB 1T9HA 3GTLH 1TQOA 2ZTEA 2KCNA 3RZOH 3WDNA 2I46A 4A3IB 3TQYA 2ZJPA 4IUQA 2UU9Q 5AJ3Q 3ER0A 4DR6Q 4X3TA 1X3FA 3ONAB 1BDOA 1TWHB 1XNQL 3ERSX 2B2UC 1J9OA 2X6LA 3H6MA 5C44G 1CKNA 2Y0SB 4B3RQ 2KEDA 1D1IA 4LK1C 1NR2A 4KKSA 2YTVA 2KJXA 3K8AA 3FPPA 5CYUA 2EY6A 2R92G 1RCVD 4C3HH 1N36Q 3AEVA 1IBMQ 4L5SA 3W1BA 5M5WH 5JEAJ 1IYJB 5FLXL 1DD2A 5ELOA 5E7NA 2RHQB 2KENA 4C2MH 1DXMA 3PIPA 2IL8A 2A6HC 1XMQL 4JG2A 3VYUA 2ATWA 3TRZA 1XXGA 2H5XA 2XWBB 1ESFA 5BR8Q 3K5NA 4HIDA 4OIJA 1SMYD 1EQTA 1XWEA 1YNJC 2KUMA 4DKAC 3RZDH 2A1AA 1L2FA 4FF1A 3U9SA 1AEXA 2Q8RE 3QJYA 3S16H 2DUDA 4IN3A 1LT5D 2A68D 1HR0W 3CCEA 5CV8A 4GN5A 3HOYB 3MFYA 4LF5Q 2VY3A 5M3MG 4X64Q 3FKIB 5I9OA 1TWHH 1S5FD 3KK7A 4CJ1B 4LF7L 4IZ8A 3HOUG 1EY9A 1VQLA 3JAMc 1E22A 1QCBD 3HOXG 5IGFA 3J81i 4K5XA 4DN4M 3KYHC 1XYIA 1VQFA 5GADC 4O1NA 1XPOA 2A19A 4A3DG 1IL2A 3DMUA 2K14A 2ZTDA 4A3GB 2JP1A 3BVZA 5JJZA 2OTJA 1GOZA 1H9KA 3M4YA 4AQYQ 1FR3A 2ZXOA 1JICA 5G3LF 2HUGA 4R4IA 1RDPD 2BCOA 2IJ0A 1SYDA 3OHXC 4RG1A 4K5WA 2NVTB 2JYOA 2PZWA 2EOTA 5M3FG 3PQIA 3C1EA 1GKHA 1D5ZC 5EGTA 1SMYC 1B4OA 1QNUA 5T1IA 3S1MH 1G2TA 1I4HA 3MWYW 2DJFC 2EY5A 1PZJD 1BBXC 1B7YB 4DNIA 2B2TA 1BCPB 1GUNA 4PV1C 1WTQA 1KIXA 3AYHB 2RDHA 3MTSA 2MFIA 3FKIH 2PW7A 4YIJA 2A68C 1SNMA 1W2BA 2PI2E 2WB1G 4DPGA 2OEOA 3TZDA 1HRJA 1J6QA 4J15A 1EFWA 2NZHA 5CBEE 1PH1A 5C0XI 3FVQA 4IPHA 3PUWA 4I65A 4HSPA 3K59A 5C4XG 1EYAA 5EKLA 4LAAA 2JA5B 4X66L 1AH9A 3ITPA 3AFQA 1DJRD 2JA7H 5DM63 4ZYSA 3E5SA 1MGSA 1PFSA 2N8NA 1HPCA 5IYCG 1U4PA 5EKKA 3F1ZA 1Y1VH 4HJ5A 3OW7A 3I90A 3OYYA 1IYVA 1OXTA 5M5YB 4KD3A 5LMUL 4DV6L 3FRPB 2WAQG 1UNSA 1B2TA 4RGOS 4A3KH 2RHSB 2NVTH 3NE5B 3NXWA 1F2YA 3J80i 4JI7L 2UUCL 3GQBA 3TP7A 1RKNA 2XRSD 4KKUA 1ZKOA 4TRDA 5C5MA 1CKMA 4HIKA 1X56A 3SGIA 1QOHA 1BBWA 2XGTA 1A2TA 3S24A 2MUYA 5KNDA 3OIPA 5ELFA 4ZLTF 4ODGA 2FINB 3CC2A 4RCNA 3I70A 2E2IH 4KHPL 2EY2A 2K4KA 4R9WA 1YJNA 3K6OA 2B2UA 4UP8A 1A3TA 5ELBA 2C9OA 3J7A5 1X3EA 4OHJA 3D6WA 1LACA 4NMZA 2HHHL 1SNOA 2N49A 3TZUA 1U4LA 3K81C 2N88A 2JA5H 1PA6A 4MN3A 2K01A 5AFWA 2R7ZB 1A62A 2O5IC 3MA2B 3IFDA 4YY3Q 3A5UA 1WCMB 4P72A 3ULPA 1EIFA 3TP5A 5C0XJ 5I6WA 3CQZB 5M5YH 1VQMA 4DV5L 2MHVA 3NHHA 4GOPC 1L1OC 3NUCA 5G3LD 4KJOA 5IP7H 3MVVA 1E2WA 2L5TA 3I2ZA 2E2HB 3VA7A 1LT4D 1X55A 4L5TA 4JOIC 2MNAA 1EUJA 3TDQA 5C4HA 1U4MA 1N34L 3D4WA 1VQHA 1PH6A 2NVQB 4EVOA 4GN3B 3A8JE 3CCVA 4HN7A 3S1NB 2VXWA 4DV2L 4TSSA 2F3VA 1XX8A 4OWTB 3ULJA 2B39A 3VYSA 1V43A 1S40A 2ALYB 1CKNB 3M3YB 5K36G 4JI0Q 5EKIA 3I3CA 3SDZA 3K0YA 5A2QE 3GV6A 4TVAB 1MD2D 5LHY1 1QNKA 4CDEC 2JA6G 5ISRA 2RCFA 4LFCL 4GN4B 2LXKA 2LFNA 3K5LA 2F0NA 4R8NA 1Y8PB 4IPDA 4DV1L 1SNPA 1Q82C 1BOSA 1HQRD 1Q3LA 3PF4A 2RF4A 4RFBA 1E0BA 4EQNA 1B50A 1ENAA 3HRZC 4HJ9A 1AZPA 5IP9G 1JCKB 4PG3A 4HIMA 5T1GA 1MBYA 2WB1E 3CHBD 2CHBD 1WCMH 2UXBQ 1ET9A 4DUZL 1JOQA 2PNRC 4B3ML 2H1EA 5EQ0A 4JI8Q 1VQ7A 1RL2A 2NVXH 3MFGA 3P75A 4JI6Q 4FF2A 4PMBA 1JQYD 2UXDQ 4HR7B 2PQAA 4A3MG 2Z8LA 4CGYB 2L0CA 5CBAE 2NVQH 2J0TD 1B9MA 3S1NH 3U50C 5CV6A 1E2VA 1EZ6A 3JAMi 1B3QA 1IW7D 1RHPA 2WAQE 3D4DA 1PYSB 5I2YA 5J1ZA 3HOWB 3K0XA 4MIUA 3SR1A 4N9TA 5D65A 3I55A 3M3YH 4GLVB 3KLSX 2F0UA 1C0AA 2XVSA 4K14A 3S2HH 1G6PA 1TT2A 2VQFL 2JA8H 4RWSC 3KUPA 1CQVA 1STHA 1PZID 1IBKQ 1GUOA 1NBWA 1SAPA 1B53A 3LWEA 1RIPA 2QW7A 1C9OA 3I56A 2EYHA 3B6YA 1QB5D 2H4OA 4BA1I 4X65Q 2C5CA 4HJAA 1GUWA 4DK1A 1HTPA 3GTKB 4UY8C 1HFGA 5E3FA 3F2DA 4CKEA 3OW2A 1EEFD 3OSOA 4X3KA 1SR3A 2EPBA 2EYFA 4KK7A 2AUKA 4MZ9A 5LMNQ 1CSPA 5IYBH 4DFAA 2R61A 1CHPD 1F77A 1X54A 3SK6A 4C3HG 4DNTB 1IBLQ 4E6IA 3HOWH 1WOCA 5IGCA 3EN2A 4JI5L 2Z0SA 2Z4HA 1ET6A 3U9OA 4BY1B 1LYLA 1J5EQ 2OQKA 5IT9L 3PGZA 1ENCA 2UUBL 1F2ZA 1T5EA 3DM1A 1LTLA 4C1NK 1SXTA 1QILA 2EJMA 1WFQA 2QF7A 4DA2A 3K7AB 5IT9c 1EIHA 1QJOA 2AWNA 3OIQA 4DK3C 2EYMA 3CCQA 4DAVA 1CKOA 2F0EA 1KNAA 1H9SA 2VUMB 4POGA 2F0GA 3CC7A 1PTOB 2EQSA 4Q0FA 3H0GH 2F0MA 3QO2A 2F0PA 1QWYA 3I4OA 1EU3A 1Y69U 1CHQD 1KRSA 1CSQA 2Q2UA 2B29A 4LFAQ 3CMAA 4GOPA 1S4ZA 1L1OA 3CCMA 3DHQA 3M7GA 3BYTB 4ZCKA 4QQBX 5FLXE 2E75C 4A4IA 4AYBG 1FD7D 4JOIA 4P75A 1WYDA 1XPRA 2F3IA 2KEEA 2AWOA 4A3FB 1AFPA 2V1CC 3FDTA 3VYTA 4X62L 5JEAH 2L11A 3UDFA 4KV6A 4KY5A 3UDIA 5DNFA 3P1HA 3NQIA 1KRTA 3KFUA 1RJTA 1AN8A 4C3JB 1HHVA 4JI4L 3S2DB 5IIFA 4O0AA 4DAYA 3Q6SA 1I4QA 1SE2A 3K7AH 1XNQQ 1STYA 2WFWA 1JOKA 1M8AA 1SLJA 4GZYC 5JOBA 1II3A 2HDMA 1QE6A 1QVCA 4DUYL 4X6AH 4LF9L 3I4MB 1TIID 2MPMA 1ILPA 1PTOH 2AQ3B 5IGGA 1YBYA 1MSHA 2A69C 2R7DA 4KHZA 1TY2A 2F0LA 4WJ4A 2B2WC 4QB4A 3FKIG 3CRLC 4KHVA 1T5XD 3GV3A 1EY7A 4XDXA 3I72A 3GDEA 2I5LX 1PH7A 1FGBD 4UAIA 2JSOA 3VA5A 5EBCA 1XMQQ 3J80L 3PUYA 3CF5A 2NZOA 1TU2B 3C2PA 1JE5A 4OGQC 3OWFA 1HNXL 1MSGA 2NYZD 4G7HC 3K80C 2JA7G 1OXSC 4UHVA 4B08A 3VR3A 2GVAA 3RN5A 4A3JH 2B63B 2PZUA 1TWGB 1R9TB 1Y1VG 3HOVB 4C3JH 3S17B 1MJCA 3T53B 1CT1D 1XTDA 4YCUA 1LABA 3M85A 1NSNS 2EDGA 4H02A 1N9WA 3T1YL 4A3KG 1EZ8A 5M5XB 1GHKA 4JI3L 4LF7Q 2SDFA 3HOZH 4P71A 3T4AC 1N32L 5M9OA 1UAPA 4FF3A 2RDGA 4OO1G 1K83H 1ILQA 3SK4A 2KHSA 2K5VA 1TWAB 3I4MH 1I4GA 3A7AB 5FKAC 3RMHA 5JVH3 2CFMA 3VR2A 3S1RH 5JPNC 5GQOA 3J7AV 3H3VC 4V190 4FP5D 5GAHC 2NTSA 2NB0A 1H9JA 1I4RA 4HTHA 4BBSH 1H9MA 2PQAB 1NMGA 3I4NB 3PSIA 5KYLA 2K7VA 1Y1WB 1FYCA 2E8GA 4N8FA 1EL0A 3FP9A 3T1HL 3PUXA 4JVZA 1K3BC 1PFNA 5LL6X 1SYGA 1DOMA 2UXCL 1TWGH 3RR5A 2EXDA 3KBXA 1O80A 3I4LA 1LV9A 3OMGA 3PO2B 2AKWB 4QIWE 1YJ9A 3BYYB 4AYBE 2LY7A 3PUZA 2RBMA 5IOCA 4JYAL 5IP7G 2D0PA 2JA9A 1K8GA 4IQZA 4DV7L 3HKZE 4XXEA 3HEJA 1QUQA 4ILWA 1WTWA 4OXPA 3D3RA 4XIGS 4FO2A 3RLFA 1C8CA 4EGVA 1KDAA 3FEWX 4P73A 4A3LH 3C46A 5DM73 3DXJC 1I94L 4X66Q 4FYDA 1J8IA 4K0KL 3MAQA 4IPGA 1DZ1A 2P5ZX 1X32A 3M4OH 1A3VA 3DWPA 2AQ2B 4IO9A 2F0IA 1HUMA 5I4DA 5EPLA 1MHWC 5LMUQ 4DK0A 1MKHA 2K05A 1LTSD 4ZRZA 5C5LA 2ZJQA 1NAPA 1FL0A 1SNCA 4A3IH 2F0OA 4JI7Q 2UUCQ 2GN5A 5J22A 3CCJA 3I73A 3JAML 1O7LA 1GO3E 5C0XH 3V05A 4BY7B 1S5ED 1WCMG 3HGBA 4ABNA 4IUUA 1VDZA 2Q2TA 4HSVA 1KTKA 3C3LA 2BE5D 1K9MC 4KHPQ 2FJ2A 2F0FA 2N55A 1V1QA 4LF4L 1SBBB 1PH3A 3ZYYX 4C3IB 2CCZA 2EJFC 3WOEA 1EIGA 1ZEQX 1GD7A 2QEJC 5E4XA 2ICEC 3A8IE 4A3EB 2QDLA 2HHHQ 4LUZA 1KDBA 3AU7A 4A75A 1NTGA 4A93B 2QILA 4KMUC 4PZ7A 2PQEA 2SEBD 4O42A 1GUSA 3QOJA 2BDNA 1L1OB 3A54A 1G6ZA 2B2VC 1VMPA 5CORA 3N6RA 3KLWA 4TKOB 2B2WA 1ICFB 4JV5L 2CWPA 4RH6A 5D3DA 4DV5Q 5GAEC 2JA8G 2YU9B 1WTVA 1Z9FA 4QF4A 3S14B 4UP9A 4F8MA 2F0VA 2SNMA 4DV0L 3GTQB 1DYQA 4ZAIA 2A73B 3HOYH 2PCFB 3NBIA 1ASYA 1N34Q 1EIYB 3EA6A 3PCOB 1SEBD 3BDCA 2CKZB 4DAYB 5E1FA 3GTJB 1VQ4A 5C4JB 2TMPA 5TSSA 4DV2Q 1X3QA 3A56A 4ID6A 2L15A 3MEHA 5ELDA 1C4QA 3NSWA 3MC0B 2EYLA 1KHIA 5DAUA 3LNNA 1KDCA 4K2KA 2L9HA 3KLSA 1FNVA 5BN3A 3K5OA 3H91A 1K0SA 1Y8OB 5IYBG 2BE5C 4LFCQ 3KJPA 4A3GH 3G6JB 4A3EH 3AB9A 5FO9B 3G48A 1HR0Q 2L4NA 4DV1Q 1NCVA 4A93H 2M2LA 1KL9A 2R7FA 4BA2I 3HOWG 2EVBA 2D2CC 1KAAA 3TP6A 1IKLA 1Q8KA 5I6YA 2QCPX 4ZKBB 4OIKA 2E76C 4HAEA 3F2UA 1NMFA 1E1TA 1VQAA 2F0DA 2KOLA 5IE8A 2PYKA 4NP5A 4DUZQ 3F2BA 1PRTF 4B3MQ 1Q46A 4R1JA 3PF5A 2ES2A 2EJGC 1VQ5A 1VS0A 3J7AF 1QZHA 2UUAL 2YTXA 2DY7A 4TQUS 4FXGC 1N33L 1S5DD 4DR1L 1HNZL 3NTKA 3G4SA 2R92B 2HIXA 4DV4L 1JJ2A 4LF6L 3H0GG 2E2JB 1QG7A 1YHQA 1VQNA 4BXXH 4A76A 3K58A 1KLGD 1UEBA 4IJHA 3UE0A 1GJXA 2K28A 3JC66 4XT3B 4LNQA 2NUCA 3N52A 1E3PA 2VQFQ 1PFBA 4MNOA 4GKJL 2XWJB 1DGSA 1NUCA 5KNCA 1W6JA 3D0FA 2F4IA 5CV4A 4DR4L 3J81E 1P16A 2AMCB 1R4PB 4R4QA 4FF4A 1K3RA 5M3MB 2NVYB 3S9WA 3A8KE 1TS2A 3EQLC 1ENFA 5EPJA 2HDLA 4PMCA 3LWUA 3HOUB 2WKCA 1IKMA 2MQHA 1G291 4XYOA 4FXKC 4MTNA 4R4TA 1RODA 1I5FA 1AW7A 2AHOB 4XQQA 4Z9CB 4JBWA 3PIP3 1I50B 1EY6A 2KA7A 4H13C 1A3UA 4IFDI 4A3DB 2E2JH 5F2DA 2NN6H 4KN7C 3MXPA 1V9PA 5IGDA 1JE4A 4QUFA 3D31A 5CV9A 4L63B 3PUVA 4JI5Q 2DY8A 3BDOA 1B70B 4DR3L 1WD1A 1BKBA 1VQKA 5JJKA 1QUQB 3A0JA 2XTIA 4GKKL 2YYZA 2UUBQ 3HKSA 1SNQA 1YIJA 2R7ZH 4OL7A 1I3QB 5JJLA 2B2YC 2ZXPA 4B9WA 5M3FB 2F0HA 3WWVA 1D6EC 1D7QA 2WKDA 1GUTA 3CQZH 1WJJA 4DK6C 5C3XA 3CAMA 3WOFA 4A3JG 3CCUA 1F2MA 5J3BA 4C3JG 2E2HH 4F87A 5FK9C 2B2VA 4M8AA 1PH9A 2ZM6L 2NVYH 2OQ0A 4KTAA 2BOSA 4LF8Q 1SYEA 3AFPA 1D8LA 1PRTD 4KKTA 4B9XA 3DM3A 2OT2A 2WB1B 4A3BG 5DLQE 3HOZG 2O2LD 2EYJA 1BXTA 2CQAA 3SXHA 1AE2A 3CMEA 1TXYA 3I4MG 5C4XB 2RSOA 2BDOA 1L0YB 3HS0C 4X62Q 2OWOA 1K0RA 1PVOA 3FMCA 1B3AA 4OONA 1I6HB 1BUVT 3X3MA 1HZCA 4JBJA 1ZYRD
chains in the Genus database with same CATH topology
1CZGA 3SE0A 1RF2D 4FXDA 2NN6I 4KD4A 1STBA 1SE4A 4X3SA 1LT3D 2WAQB 3GTPB 1IYUA 3GTOB 4IFDJ 2KCCA 5CR3A 1TVXA 5C3WA 5DEHA 2JXMB 4DXGA 4PQXA 3D4RA 4ZUIA 1D5XC 3VR6A 4IALA 1STEA 2ENBA 3MHBA 1Z47A 1SJED 4ZKCB 3R3OA 3GTMB 1PRTC 2K03A 1STAA 2XSCA 3IL8A 1Q12A 1F9PA 2QDBA 1PMRA 3SEBA 3E0JA 1TWFB 3GP7A 1LTTD 1KABA 2XRQD 4HCSA 2J4XA 3T56B 1A15A 4K5VA 1I4PA 3R8BA 3CU7A 3T51B 1ZYRC 2IX1A 2A69D 1JOOA 1HTLD 5I9PA 2J7ZA 5E4WC 1LTRD 3MZ5A 1WTOA 2BA1A 1STGA 2K1BA 5C0XG 1G8ZD 3OOCA 3P20A 4KY7A 5KYIA 1CA5A 1PXUA 5K5PA 1HA5A 5BN4A 3DEPA 2G9HD 4Y7NB 2JA6B 3EROA 3Q23A 1O7ZA 5HURA 2MJ8A 1BR9A 5C3EB 1O7YA 5KEEA 5CV5A 3ERQA 1DCZA 3EVQA 2K5DA 2JEBI 2F0JA 3A7LA 1F9SA 2XNAC 2LS01 4ME5A 3OWEB 1JC7A 4RGMA 1JB3A 3JAME 3W2DA 2PPBC 1TS4A 3LX0A 2G9DA 2R93B 5COYA 1OXUA 4DXFA 2B2YA 4A3MB 2EYOA 4ULLA 2SNSA 1EY4A 1CTMA 3VR4A 2XN9C 5K36H 5CC4A 2Z4IA 2F03A 3NTHA 1SYCA 1DONA 2WACA 2PO4A 4NW2A 4DF7A 5KRUA 1Q1EA 4XT1B 2TSSA 4IUPA 1D1KA 1U4RA 1EWHA 5IGEA 3NP8A 3GTLB 1VCIA 2F0TA 1B1ZA 1G2SA 5A35A 2NBFA 3TN2A 3GTGB 4M1UB 2AUJD 2RA4A 4K6LA 1HFNA 5EPKA 4L8JA 1EYCA 3IAYA 3M7NA 2OXPA 2F1MA 4F7XA 2EXZA 2Q8TA 4C3HB 1Z7TA 4G7OC 1ICWA 3PO3B 2F0SA 1EQVA 5D14A 1A6XA 1SFOB 3S15B 1CI3M 4EQOA 3QOLA 1DM0B 1R4QB 1BF4A 1A2UA 1JWMD 4ZK9B 1SSOA 2EE1A 3UI2A 1GHJA 2RDFA 3S16B 2PW5A 3IKJA 4IURA 2O4XA 3R2TA 2HQEA 1GUGA 4U68A 1XTCD 4RKBA 1I4XA 3I91A 1HQMC 1TWCB 1Y8NB 3QB3A 1IHZA 2M9VA 4EQPA 4IUNA 3IFTA 1LT6D 1V1OA 4QIWB 4XTCS 4I7ZC 1JR0D 4AYBB 3NBHA 1L0XB 2Q8IB 4RCOA 2NZ1D 2NN6G 3HKZB 4CHTB 5I2XA 3O13A 4J8QA 4HCEA 3CKIB 2K5WA 2Z1CA 3NPPA 4NKLA 4K2LA 2DN8A 4K8JA 4CKCA 1BCPF 1Q1BA 1HA6A 3FPUB 1K8MA 3S1MB 3PIO3 4JK1C 4BS9A 1H9SB 1B9NA 1ONLA 1V1PA 1OXVA 2IX0A 3VYRA 5ELCA 1CQFA 1ML0D 1TR5A 2E74C 3TMEA 1WVLA 4RGTA 1Z6HA 2VB3X 3V2TA 2FFKB 4CJ2C 2JA7B 4J1MA 3EFXD 1CM9A 1Y1VB 2F0KA 1EU4A 5C6AA 2B8FA 4A3KB 3R93A 1B44D 1X3PA 1CZWA 1TS5A 4F88A 4H0LC 3SK8A 3BZDB 4PNYA 4CBVA 4RGNA 5CV7A 5JVG3 1FNWA 1D5MC 3SVMA 3CRKC 1WTRA 1TY0A 2JEAI 2E2DC 2E2IB 1BO0A 1SJHD 2VNUD 4DNRB 4WRDA 4XYQA 2SOBA 3OPOA 3P7JA 2K6AA 4FNFA 2GA4B 1LTAD 1PFMA 1HUNA 1UUPA 5FOBB 2ZT9C 2K5QA 2R3ZA 5CMDA 4Q5VA 3DWQA 4H7BA 3KLRA 5C44B 4KI0A 3K5MA 4IFDH 3SK5A 1STNA 1KNEA 4DAPA 2RVLA 1SDFA 4C56C 1BCPD 4OO1H 5C4ZA 4HMJA 1BNZA 3TP8A 1EY0A 4V0BA 1KLUD 1F9QA 1LTBD 3V96A 4LMQD 1PDQA 1PLFA 2VB2X 4K8IA 3H09A 1AP0A 2ID0A 1Q8IA 2L12A 5KIXA 2OF1A 5IT9E 5JEAG 5EJWA 2CW0D 3MXNA 1YNND 1OO9B 4QMGA 1RTNA 3E6ZX 1EWCA 4G4KA 3L7ZC 2A74C 2I07B 4G57A 1IL8A 2X6GA 3J7YW 3RUZA 4L6TB 1D2BA 3HOXB 1PRTB 3NWTA 2NVXB 3PV0A 1EY8A 2BA0A 5D3IB 3DWAA 1CK1A 5KGUA 3G7LA 4IUTA 4C1NI 1EEID 5IGBA 2IPKD 4KJNA 1JWSD 3D6CA 3BG3A 3PMFA 2HCCA 1BCPC 3KF8A 2LMCB 1F2LA 1S5BD 4WORA 1M4VA 4OO1I 3DEOA 1WTXA 2A6ED 2IW3A 1GXDC 3QG1A 5JAVA 3S2HB 2KQ3A 1E2ZA 2JA8B 1PZKD 3KBGA 3MXGA 2CW0C 4U673 1YNNC 1S5CD 2D9UA 4BWGB 1VF7A 2KECA 1MI2A 1PYWD 3EJIA 4PMWA 2QKIC 3HP3A 2EY1A 3ND9A 2WV6D 2KVMA 2ZXRA 3TBIB 4R8IA 4CJ0B 1HCZA 2M00A 3J80E 2AQ1B 2B8GA 5IODA 1DOKA 1V1PB 3RD4A 5CGKA 1NR4A 4NDXA 2LKVA 3S1QB 3K57A 5LL6S 3Q0AA 4XQNA 1SNDA 4P2CB 4WJWA 3Q24A 2X69A 1V8QA 2F3WA 3HG9A 2A6EC 3QWNA 3DUZA 3URYA 2A5HA 1PTOF 1K8OA 1H9RA 2RSNA 4S3SA 2HCIA 3X3NA 5FO8B 3T13A 3MXUA 1CA6A 3AMUA 1ESRA 3H0GB 2FMMA 4HMIA 2F0WA 4H44C 2D62A 3NTIA 5EBDA 1SE3A 3NWSA 4KN4C 3NQTA 5J39A 3GO5A 5HGTA 4CKBA 3NK9A 3A55A 1F9RA 1SYBA 3BVMA 4RHRA 1U9RA 2PMZB 1WD0A 1DOLA 2D5DA 2RQXA 1EOTA 1G91A 1SYFA 4HEDA 3GD7A 3C1FA 2FMCA 1LTGD 2L55A 4ZUJA 4UDUC 5ELEA 1IW7C 1WTPA 4QUCA 2NTTA 2EYPA 1O78A 3J81L 2EZVA 1TS3A 4WFN3 5NUCA 2IX3A 2K04A 3HZXA 4IUVA 3D8GA 1AZQA 3SHLA 2WIIB 3L3OC 2IT1A 4X3UA 5A2QL 3I8ZA 3W3AA 5BN5A 1LO5D 4RHSA 2PZTA 4QCLA 1LTID 4G7ZC 2L1BA 3QIAA 4A3JB 4KY6A 2V4DA 4DU9A 3T16A 1EY5A 4DGZA 5KNBA 4N9PA 4A3BB 4K6DA 2RKSA 4MHEA 3Q22A 3HOZB 1PTOD 2IWHA 1RD9D 1CFMA 1EFID 2WP8J 1K83B 1EYDA 1C48A 4RAUC 2JE6I 3S1RB 2ICIA 2DNCA 4C3IG 3ND8A 4BBSB 2CVRA 1RTOA 2FHTA 2WINB 4FVMA 4BBRB 3BVGA 2K32A 1BQQT 1JORA 2NWGA 4ZQ3A 4RKLA 2B2TC 1FNUA 3RZOB 2DNEA 3TSSA 1UEAB 1VF5C 1Q90A 2R6GA 1W6KA 4IFDG 2O5JC 3R2IA 2K33A 4RA8A 4J6HA 3VR5A 3L9AX 1HXYD 3BDLA 2MGSA 2F0QA 1I6VC 5M5WB 1VMCA 2A6HD 3OMCA 3H94A 1PTOC 4C2MB 1TKWB 5FO7B 4LJZC 2MP1A 3BS1A 1YNJD 1ZXTA 2XIWA 1OXXK 1LLRD 3M4OB 5JPMC 4XQJA 1JWUD 3RZDB 1TQOA 2KCNA 3WDNA 2I46A 4A3IB 4IUQA 4X3TA 3ONAB 1BDOA 1TWHB 2B2UC 1J9OA 2X6LA 3H6MA 2Y0SB 2KEDA 1D1IA 4LK1C 1NR2A 4KKSA 2KJXA 3FPPA 5CYUA 2EY6A 1RCVD 5JEAJ 5FLXL 1DD2A 1DXMA 2IL8A 2A6HC 3VYUA 1XXGA 2XWBB 1ESFA 3K5NA 4OIJA 1SMYD 1EQTA 1XWEA 1YNJC 2KUMA 4FF1A 3U9SA 1AEXA 2Q8RE 3QJYA 4IN3A 1LT5D 2A68D 5CV8A 3HOYB 3MFYA 3FKIB 5I9OA 1S5FD 3KK7A 4CJ1B 4IZ8A 1EY9A 1QCBD 5IGFA 4K5XA 4DN4M 1XYIA 4O1NA 3DMUA 4A3GB 2JP1A 3BVZA 5JJZA 1GOZA 1H9KA 3M4YA 1FR3A 2ZXOA 1JICA 5G3LF 2HUGA 1RDPD 2BCOA 2IJ0A 1SYDA 3OHXC 4K5WA 2NVTB 2JYOA 2PZWA 2EOTA 3C1EA 1D5ZC 5EGTA 1SMYC 1B4OA 1QNUA 5T1IA 1G2TA 1I4HA 3MWYW 2EY5A 1PZJD 1BBXC 2B2TA 1BCPB 1GUNA 4PV1C 1WTQA 2RDHA 3MTSA 2PW7A 4YIJA 2A68C 1SNMA 2OEOA 3TZDA 1HRJA 5CBEE 5C0XI 3FVQA 3PUWA 4I65A 4HSPA 3K59A 1EYAA 5EKLA 4LAAA 2JA5B 3ITPA 1DJRD 5DM63 4ZYSA 3E5SA 1MGSA 1HPCA 1U4PA 5EKKA 3OW7A 3I90A 1IYVA 1OXTA 5M5YB 4KD3A 3FRPB 1UNSA 1B2TA 4RGOS 3NE5B 3NXWA 1F2YA 3GQBA 3TP7A 1RKNA 2XRSD 4KKUA 1ZKOA 4TRDA 5C5MA 1QOHA 1A2TA 2MUYA 5KNDA 3OIPA 5ELFA 4ZLTF 4ODGA 2FINB 4RCNA 3I70A 2EY2A 4R9WA 3K6OA 2B2UA 1A3TA 5ELBA 2C9OA 4OHJA 3D6WA 1LACA 4NMZA 1SNOA 3TZUA 1U4LA 2N88A 4MN3A 2K01A 5AFWA 2R7ZB 2O5IC 3MA2B 3IFDA 1WCMB 3TP5A 5C0XJ 5I6WA 3CQZB 2MHVA 3NHHA 3NUCA 5G3LD 4KJOA 3MVVA 1E2WA 2L5TA 2E2HB 3VA7A 1LT4D 3TDQA 5C4HA 1U4MA 3D4WA 2NVQB 4EVOA 3A8JE 4HN7A 3S1NB 2VXWA 4TSSA 2F3VA 1XX8A 2B39A 3VYSA 1V43A 3M3YB 5K36G 5EKIA 3I3CA 3SDZA 3K0YA 5A2QE 3GV6A 5LHY1 1MD2D 1QNKA 5ISRA 2LFNA 3K5LA 2F0NA 4R8NA 1Y8PB 1SNPA 1BOSA 1HQRD 1Q3LA 4RFBA 1E0BA 4EQNA 1B50A 1ENAA 3HRZC 1AZPA 1JCKB 5T1GA 1MBYA 3CHBD 2CHBD 1ET9A 1JOQA 2PNRC 2H1EA 5EQ0A 3MFGA 3P75A 4FF2A 4PMBA 1JQYD 4HR7B 2Z8LA 4CGYB 2L0CA 5CBAE 2J0TD 1B9MA 5CV6A 1E2VA 1EZ6A 1IW7D 3HOWB 1RHPA 3D4DA 5I2YA 5J1ZA 4MIUA 3SR1A 4N9TA 5D65A 3KLSX 2F0UA 2XVSA 4K14A 1TT2A 4RWSC 3KUPA 1CQVA 1STHA 1PZID 1GUOA 1SAPA 1B53A 3LWEA 2EYHA 1QB5D 2H4OA 4BA1I 2C5CA 1GUWA 4DK1A 1HTPA 3GTKB 1HFGA 5E3FA 4CKEA 1EEFD 3OSOA 4X3KA 2EPBA 2EYFA 4KK7A 2AUKA 4DFAA 2R61A 1CHPD 1F77A 3SK6A 4C3HG 4DNTB 4E6IA 5IGCA 2Z4HA 1ET6A 3U9OA 4BY1B 5IT9L 1ENCA 1F2ZA 1T5EA 3DM1A 4C1NK 1SXTA 1QILA 2EJMA 2QF7A 4DA2A 3K7AB 1EIHA 1QJOA 2AWNA 3OIQA 2EYMA 4DAVA 2F0EA 1KNAA 1H9SA 2VUMB 2F0GA 1PTOB 4Q0FA 3QO2A 2F0MA 2F0PA 1QWYA 1EU3A 1Y69U 1CHQD 1S4ZA 3DHQA 3M7GA 3BYTB 5FLXE 2E75C 1FD7D 1AFPA 2KEEA 2AWOA 4A3FB 3FDTA 3VYTA 5JEAH 2L11A 4KV6A 4KY5A 5DNFA 3P1HA 3NQIA 1RJTA 1AN8A 4C3JB 1HHVA 3S2DB 5IIFA 4DAYA 3Q6SA 1I4QA 1SE2A 1STYA 1JOKA 1M8AA 4GZYC 5JOBA 1II3A 2HDMA 1QE6A 3I4MB 1TIID 2MPMA 1ILPA 1PTOH 2AQ3B 5IGGA 1MSHA 2A69C 4KHZA 1TY2A 2F0LA 2B2WC 4QB4A 3CRLC 4KHVA 1T5XD 3GV3A 1EY7A 4XDXA 3I72A 1FGBD 4UAIA 2JSOA 3VA5A 5EBCA 3J80L 3PUYA 1TU2B 3C2PA 4OGQC 3OWFA 1MSGA 2NYZD 4G7HC 1OXSC 4B08A 3VR3A 2B63B 2PZUA 1TWGB 1R9TB 3HOVB 3S17B 3T53B 1CT1D 1LABA 3M85A 1NSNS 2EDGA 1GHKA 1EZ8A 5M5XB 2SDFA 3T4AC 5M9OA 1UAPA 4FF3A 2RDGA 4OO1G 1ILQA 3SK4A 2KHSA 1TWAB 1I4GA 3A7AB 5FKAC 3RMHA 5JVH3 3VR2A 5JPNC 3J7AV 3H3VC 4V190 4FP5D 2NTSA 2NB0A 1H9JA 1I4RA 4HTHA 1H9MA 3I4NB 5KYLA 2K7VA 1Y1WB 1FYCA 1EL0A 3PUXA 1PFNA 5LL6X 1SYGA 1DOMA 3KBXA 1O80A 3I4LA 1LV9A 3OMGA 3PO2B 3BYYB 2LY7A 3PUZA 2RBMA 5IOCA 4IQZA 4XXEA 3HEJA 4ILWA 1WTWA 3D3RA 4XIGS 4FO2A 3RLFA 1C8CA 4EGVA 1KDAA 3FEWX 3C46A 5DM73 3DXJC 4FYDA 1J8IA 3MAQA 1DZ1A 1X32A 1A3VA 3DWPA 2AQ2B 2F0IA 1HUMA 5I4DA 5EPLA 4DK0A 2K05A 1LTSD 4ZRZA 5C5LA 1NAPA 1SNCA 2F0OA 5J22A 3I73A 3JAML 1O7LA 5C0XH 3V05A 4BY7B 1S5ED 3HGBA 4ABNA 4IUUA 1VDZA 4HSVA 1KTKA 3C3LA 2BE5D 2FJ2A 2F0FA 2N55A 1SBBB 3ZYYX 4C3IB 2EJFC 3WOEA 1EIGA 1ZEQX 2QEJC 5E4XA 2ICEC 3A8IE 4A3EB 1KDBA 3AU7A 4A93B 2QILA 4KMUC 2PQEA 2SEBD 4O42A 1GUSA 3QOJA 2BDNA 3A54A 1G6ZA 2B2VC 1VMPA 5CORA 3N6RA 4TKOB 2B2WA 4RH6A 5D3DA 2YU9B 1WTVA 4QF4A 3S14B 4F8MA 2F0VA 2SNMA 3GTQB 1DYQA 4ZAIA 2A73B 2PCFB 3NBIA 3EA6A 1SEBD 3BDCA 5E1FA 3GTJB 5C4JB 2TMPA 5TSSA 1X3QA 3A56A 4ID6A 3MEHA 5ELDA 1C4QA 3NSWA 3MC0B 2EYLA 5DAUA 3LNNA 1KDCA 4K2KA 2L9HA 5BN3A 1FNVA 3KLSA 3K5OA 3H91A 1Y8OB 2BE5C 3G6JB 3AB9A 5FO9B 2L4NA 1NCVA 2M2LA 4BA2I 2EVBA 2D2CC 1KAAA 3TP6A 1IKLA 5I6YA 2QCPX 4ZKBB 4OIKA 2E76C 4HAEA 3F2UA 2F0DA 2KOLA 2PYKA 4NP5A 1PRTF 2EJGC 3J7AF 2DY7A 4TQUS 4FXGC 1S5DD 3NTKA 2R92B 2E2JB 1QG7A 3K58A 1KLGD 1GJXA 2K28A 4XT3B 2NUCA 3N52A 1PFBA 2XWJB 1NUCA 5KNCA 1W6JA 2F4IA 5CV4A 3J81E 1R4PB 4FF4A 5M3MB 2NVYB 3S9WA 3A8KE 1TS2A 3EQLC 1ENFA 5EPJA 2HDLA 4PMCA 3LWUA 3HOUB 2WKCA 1IKMA 1G291 4XYOA 4FXKC 1RODA 1AW7A 4XQQA 4Z9CB 4JBWA 3PIP3 1I50B 1EY6A 2KA7A 4H13C 1A3UA 4IFDI 4A3DB 5F2DA 2NN6H 4KN7C 3MXPA 5IGDA 1JE4A 4QUFA 3D31A 5CV9A 4L63B 3PUVA 2DY8A 3BDOA 1WD1A 2YYZA 1SNQA 4OL7A 1I3QB 2B2YC 2ZXPA 4B9WA 5M3FB 2F0HA 1D6EC 2WKDA 1GUTA 5C3XA 3WOFA 1F2MA 4C3JG 4F87A 5FK9C 2B2VA 4M8AA 4KTAA 2BOSA 1SYEA 1PRTD 4KKTA 4B9XA 2OT2A 2WB1B 2O2LD 2EYJA 1BXTA 2CQAA 3SXHA 5C4XB 2RSOA 2BDOA 1L0YB 3HS0C 3FMCA 1B3AA 1I6HB 1BUVT 3X3MA 1ZYRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3F A;  3OMG A;  3ERO A;  4I65 A;  4QF4 A;  1EYA A;  5EKL A;  1NUC A;  3OSO A;  4LAA A;  4F8M A;  5HUR A;  2EYF A;  3ITP A;  2F0V A;  2SNM A;  2EY1 A;  2EYP A;  1TR5 A;  2RBM A;  3E5S A;  1STB A;  4KD4 A;  5CV4 A;  4HMJ A;  5C4Z A;  5IGG A;  5IOC A;  2F0S A;  1EQV A;  3TME A;  3TP8 A;  1EY0 A;  4DFA A;  5EKK A;  5KEE A;  2F0L A;  5CV5 A;  3ERQ A;  4QB4 A;  3EVQ A;  4KHV A;  5CR3 A;  5ISR A;  2F0J A;  3BDC A;  3HEJ A;  3SK6 A;  5C3W A;  5DEH A;  3S9W A;  1AEX A;  1EY7 A;  5E1F A;  4E6I A;  5NUC A;  3V2T A;  2F0N A;  4K8I A;  4R8N A;  4KD3 A;  5IGC A;  3VA5 A;  4PMC A;  1SNP A;  2M00 A;  4ME5 A;  4J1M A;  3U9O A;  4ID6 A;  3MEH A;  4J6H A;  5CV8 A;  1KDA A;  2OF1 A;  5KIX A;  3HZX A;  5IOD A;  4EQO A;  3D8G A;  3NXW A;  4EQN A;  1ENC A;  1ENA A;  3OWF A;  1F2Z A;  2EYL A;  3QOL A;  2F0K A;  4ZUI A;  1F2Y A;  3BDL A;  1A2U A;  5DAU A;  1KDC A;  5I9O A;  2F0Q A;  2F3V A;  4IAL A;  3SHL A;  3LX0 A;  4QMG A;  3TP7 A;  1RKN A;  4K2K A;  5CGK A;  4NDX A;  4IZ8 A;  5C6A A;  1EY6 A;  2LKV A;  2RDF A;  2ENB A;  2PW5 A;  1EY9 A;  1A3U A;  3OMC A;  4TRD A;  2EYM A;  5C5M A;  2O4X A;  1A3V A;  5F2D A;  3MHB A;  1JOQ A;  2F0I A;  3MXP A;  5IGD A;  2PZU A;  5IGF A;  1SND A;  4G57 A;  2HQE A;  5CV9 A;  2F0E A;  4K5X A;  1A2T A;  3R3O A;  4RKB A;  3P75 A;  2EYO A;  2F3W A;  3SK8 A;  2PZT A;  4PMB A;  1STA A;  2SNS A;  1EY4 A;  4ODG A;  4PNY A;  2F0G A;  5C5L A;  3RUZ A;  2QDB A;  1KAA A;  3TP6 A;  3QB3 A;  1SNC A;  1IHZ A;  2F0O A;  2F0M A;  1NSN S;  2EY2 A;  3DMU A;  4EQP A;  5CV7 A;  5I6Y A;  4IUN A;  5J22 A;  1EZ8 A;  1SNQ A;  2F0P A;  4OL7 A;  5CC4 A;  4KY6 A;  4DU9 A;  1A3T A;  4B9W A;  1SYC A;  2F0D A;  4S3S A;  1EY8 A;  2PYK A;  4NP5 A;  5CV6 A;  1KAB A;  2F0H A;  5M9O A;  2WAC A;  1EZ6 A;  1TQO A;  3T13 A;  1EY5 A;  3T16 A;  5KGU A;  3D4D A;  4NMZ A;  5J1Z A;  1SNO A;  3SK4 A;  2KHS A;  4MIU A;  4K5V A;  3SR1 A;  4N9T A;  5C3X A;  4DF7 A;  3DHQ A;  1SYD A;  4DGZ A;  4K5W A;  5KRU A;  2F0U A;  5IGB A;  4KJN A;  3D6C A;  1F2M A;  2PZW A;  4HMI A;  4N9P A;  3PMF A;  4WRD A;  3C1E A;  2F0W A;  2RKS A;  4K6D A;  2SOB A;  2F0F A;  5IGE A;  3H6M A;  4K14 A;  3NP8 A;  1JOO A;  1TT2 A;  2F0T A;  5EGT A;  4KTA A;  4HTH A;  4WOR A;  3TP5 A;  5I9P A;  4KV6 A;  1EYD A;  1SYE A;  3NQT A;  4KY5 A;  5I6W A;  5J39 A;  1STH A;  5HGT A;  3MZ5 A;  4B9X A;  2EY5 A;  3NK9 A;  3NHH A;  1SYB A;  1STG A;  3P1H A;  3NUC A;  4NKL A;  4K2L A;  4KJO A;  3MVV A;  5KYL A;  1KDB A;  1U9R A;  4K8J A;  2EYJ A;  4H7B A;  2PQE A;  2PW7 A;  2EY6 A;  5IIF A;  2EYH A;  3QOJ A;  4YIJ A;  2KQ3 A;  3SXH A;  5JAV A;  4KY7 A;  5C4H A;  1SNM A;  2NUC A;  1EYC A;  5KYI A;  3D4W A;  3SK5 A;  1STY A;  1STN A;  1SYF A;  1JOK A;  2OEO A;  5K5P A;  4EVO A;  3C1F A;  2OXP A;  1SYG A;  5JOB A;  1II3 A;  4ZUJ A;  1JOR A;  4ZQ3 A;  4RKL A;  4F7X A;  2EXZ A;  3EJI A; 
#chains in the Genus database with same CATH topology
 1CZG A;  3U58 A;  3SE0 A;  3UDX A;  4BBS G;  1RF2 D;  5GAG C;  4BBR G;  4FXD A;  2NN6 I;  1X65 A;  4JI4 Q;  4KD4 A;  1STB A;  1SE4 A;  2LXJ A;  1LT3 D;  2WAQ B;  4X3S A;  1IYU A;  4GNX C;  3GTO B;  3GTP B;  4IFD J;  2KCC A;  4JI1 L;  4CDD C;  2CQO A;  1VQJ A;  5M3F H;  5CR3 A;  1TVX A;  3OTO L;  5C3W A;  5DEH A;  3CP0 A;  2CH4 W;  5H1S E;  2JXM B;  4DXG A;  4PQX A;  3TRE A;  1Q86 C;  4DUY Q;  4LF9 Q;  3D4R A;  3BZC A;  4ZUI A;  1D5X C;  3DLL A;  3VR6 A;  3CC4 A;  4IAL A;  4A3C H;  1STE A;  2ENB A;  4JCV E;  1P8L A;  3MHB A;  4YHH L;  1Z47 A;  1SJE D;  2PMZ E;  4ZKC B;  5FJ8 H;  2OCE A;  3R3O A;  2EIF A;  2BH2 A;  3GTM B;  3CCL A;  1PRT C;  2K03 A;  1STA A;  2XSC A;  3IL8 A;  1Q12 A;  1F9P A;  2QDB A;  3CCS A;  1HNX Q;  1PMR A;  3SEB A;  4A3L G;  2OTL A;  3E0J A;  2HQL A;  1TWF B;  3GP7 A;  1LTT D;  3KDF A;  1I6H H;  1KAB A;  2XRQ D;  3L0O A;  1M90 C;  4HCS A;  2Z9H A;  2J4X A;  3T56 B;  1HNW L;  1NY4 A;  1A15 A;  4K5V A;  1I4P A;  3R8B A;  3CU7 A;  1S72 A;  3T51 B;  4OX9 L;  1YVC A;  1ZYR C;  2IX1 A;  3GTP H;  1NNX A;  2A69 D;  2K52 A;  3T1Y Q;  1QVG A;  1KXL A;  1JOO A;  4JI3 Q;  1HTL D;  3EIV A;  5I9P A;  1VQC A;  4A3I G;  2J7Z A;  5E4W C;  1LTR D;  3MZ5 A;  1N32 Q;  1WTO A;  2BA1 A;  4QJF A;  1STG A;  1UE7 A;  2K1B A;  1XMO L;  5C0X G;  3CD6 A;  3TEH B;  3GTK H;  2HD3 A;  3F8T A;  1G8Z D;  3OOC A;  3P20 A;  4KY7 A;  2Y0S G;  1PYB A;  5KYI A;  1CA5 A;  1PXU A;  5K5P A;  1HA5 A;  2ZTC A;  5BN4 A;  3DEP A;  2G9H D;  4Y7N B;  1EQQ A;  3H15 A;  2JA6 B;  3ERO A;  3Q23 A;  3GTM H;  1O7Z A;  2PNH A;  5HUR A;  1EQR A;  2MJ8 A;  4BY1 H;  1BR9 A;  2I5M X;  5C3E B;  2YTY A;  4DR2 L;  3T1H Q;  1O7Y A;  2Z6K C;  3M4P A;  5KEE A;  5CV5 A;  1TWF H;  3ERQ A;  1DCZ A;  1X3G A;  3EVQ A;  2K5D A;  1ASZ A;  2JEB I;  2F0J A;  3A7L A;  1F9S A;  2XNA C;  3I7F A;  2LS0 1;  3G6E A;  2UXC Q;  2HIV A;  4ME5 A;  4DR7 L;  1PV4 A;  3OWE B;  1JC7 A;  4RGM A;  1JB3 A;  3ZJY C;  3JAM E;  3W2D A;  2VUM H;  2PPB C;  1TS4 A;  2QGQ A;  4JYA Q;  4Y52 H;  3LX0 A;  1NJI C;  2G9D A;  1BVS A;  2R93 B;  4NXN L;  5COY A;  4DV7 Q;  1OXU A;  4DXF A;  2B2Y A;  3HOY G;  4A3M B;  5HY6 A;  2EYO A;  3NEN A;  4ULL A;  4UPA A;  1K73 C;  1YHB A;  1EY4 A;  2SNS A;  4UP7 A;  1CTM A;  1I94 Q;  3BZK A;  3VR4 A;  2XN9 C;  4K0K Q;  4RMF A;  5K36 H;  5CC4 A;  3RNU A;  2Z4I A;  2F03 A;  3NTH A;  2K5H A;  1SYC A;  4A3F H;  1DON A;  5IYD H;  1Y14 B;  2WAC A;  2F4V L;  4LW1 A;  2PO4 A;  4NW2 A;  4DF7 A;  5KRU A;  1Q1E A;  4A3G G;  1X9N A;  4GS3 A;  4A3E G;  4XT1 B;  5C3E H;  2B3G A;  4B3S L;  2TSS A;  3E9I A;  3M4Q A;  4IUP A;  1D1K A;  1KAW A;  1U4R A;  1EWH A;  2F52 A;  5IGE A;  3S2D H;  3NP8 A;  3GTL B;  1VCI A;  2F0T A;  1IXR A;  5IP9 H;  3Q8D A;  1VQ6 A;  1B1Z A;  4JBM A;  1G2S A;  5EAY A;  5A35 A;  2HT1 A;  2NBF A;  3TN2 A;  3GTG B;  2KBN A;  1Q81 C;  4M1U B;  2VQE L;  2AUJ D;  4HJ8 A;  2RA4 A;  1PH5 A;  4K6L A;  1HFN A;  5EPK A;  4GNX A;  4L8J A;  1EYC A;  3IAY A;  2R93 H;  4R4O A;  4LF4 Q;  2E5L L;  3M7N A;  2OXP A;  2KCM A;  1SRO A;  1A8V A;  2F1M A;  4F7X A;  2EXZ A;  2Q8T A;  4C3H B;  1Z7T A;  1SE8 A;  2IY5 B;  4BXX G;  4G7O C;  1ICW A;  3PO3 B;  3H3V I;  2F0S A;  4OEL B;  1EQV A;  5D14 A;  1VQE A;  1A6X A;  1SN8 A;  3A5Z B;  3STB D;  2JA5 G;  2QEX A;  4JV5 Q;  1SFO B;  3K7U C;  3S15 B;  1XNR L;  1CI3 M;  2B63 H;  1R9T H;  4EQO A;  4HIO A;  3HOV H;  3QOL A;  4NXM L;  1DM0 B;  1R4Q B;  1BF4 A;  3S17 H;  4DV0 Q;  1A2U A;  2Y0S E;  1JWM D;  4ZK9 B;  1SSO A;  2EE1 A;  3UI2 A;  1GHJ A;  4AH6 A;  2RDF A;  3CW2 C;  3S16 B;  2PW5 A;  3IKJ A;  4IUR A;  2O4X A;  1GM5 A;  5M5X H;  3R2T A;  4JI2 L;  2HQE A;  1GUG A;  1HZ9 A;  4U68 A;  3RLO A;  1XTC D;  3GTG H;  4RKB A;  4LWC A;  1I4X A;  3I91 A;  3BJU A;  1HQM C;  1TWC B;  1TWA H;  1Y8N B;  3QB3 A;  1A0I A;  1IHZ A;  2M9V A;  4NB3 A;  4EQP A;  5IY0 A;  1FJG L;  4IUN A;  3IFT A;  1LT6 D;  1V1O A;  1K28 A;  4O2D A;  4QIW B;  4XTC S;  3J81 j;  4I7Z C;  1JR0 D;  4AYB B;  3NBH A;  1L0X B;  2Q8I B;  4RCO A;  2CWA A;  4B3T L;  2I5H A;  1XJV A;  4DR5 L;  2NZ1 D;  2NN6 G;  3HKZ B;  4CHT B;  5I2X A;  3O13 A;  2VW9 A;  4J8Q A;  3I4N H;  5IWA L;  3PO3 H;  2K75 A;  1Y1W H;  4HCE A;  3CKI B;  2K5W A;  3RLN A;  2Z1C A;  4N8X 1;  3NPP A;  5FLX c;  1UE1 A;  4DV6 Q;  1SFO H;  2C35 B;  2R7Z G;  3S15 H;  4NKL A;  4K2L A;  1W3S A;  2N3S A;  2DN8 A;  3KDF B;  4K8J A;  3STB C;  4CKC A;  1BCP F;  1Q1B A;  3W1G A;  3PO2 H;  1HA6 A;  3FPU B;  1UE5 A;  1K8M A;  3S1M B;  2UUA Q;  3PIO 3;  1N33 Q;  4IOA A;  2Z6K A;  4JK1 C;  4EQ5 A;  4DR1 Q;  1C7Y A;  1HNZ Q;  4BS9 A;  1H9S B;  4DV4 Q;  1B9N A;  4LF6 Q;  1ONL A;  1V1P A;  2Z6B A;  1VQ9 A;  1KQS A;  2LSS A;  1OXV A;  2IX0 A;  3VYR A;  1LUZ A;  5ELC A;  1CQF A;  1TWC H;  4DV3 L;  1ML0 D;  1TR5 A;  1E24 A;  1BBU A;  2E74 C;  4L5Q A;  3TME A;  1WVL A;  4LFB L;  4RGT A;  1Z6H A;  1UE6 A;  4CDC C;  4IJL A;  2VB3 X;  4GOP B;  3V2T A;  3G71 A;  2GVB A;  4GKJ Q;  2FFK B;  4CJ2 C;  2JA7 B;  4J1M A;  3EFX D;  2Q2I A;  1CM9 A;  1Y1V B;  2F0K A;  2JQO A;  4DR4 Q;  2DJG C;  3U4V A;  1EU4 A;  5C6A A;  1QVF A;  2B8F A;  4PZ6 A;  4APV A;  1HZA A;  5FLM H;  1MJE A;  4A3K B;  5ELN A;  3R93 A;  1B44 D;  1X3P A;  1CZW A;  1TS5 A;  4BY7 H;  4F88 A;  4H0L C;  3SK8 A;  3BZD B;  2UU9 L;  5AJ3 L;  4DR6 L;  3NEL A;  4PNY A;  1G51 A;  2ZJR A;  4CBV A;  4RGN A;  5CV7 A;  1IZ6 A;  5JVG 3;  1EWI A;  1FNW A;  1D5M C;  3SVM A;  4A3C G;  4ME3 A;  3CRK C;  4B3R L;  1WTR A;  2FXQ A;  1TY0 A;  4C3I H;  2JEA I;  2JJQ A;  2E2D C;  2E2I B;  4DR3 Q;  1BO0 A;  1SJH D;  4JBK A;  5FJ8 G;  2VNU D;  4DNR B;  1N36 L;  2I0Q A;  1IBM L;  1H95 A;  4WRD A;  4XYQ A;  4JW0 A;  4GKK Q;  2SOB A;  3OPO A;  3P7J A;  4FNF A;  2K6A A;  2GA4 B;  1LTA D;  2VS1 A;  1PFM A;  1HUN A;  1UUP A;  5FOB B;  2MO0 A;  2ZT9 C;  4QL5 A;  1YZ6 A;  2K5Q A;  2R3Z A;  5CMD A;  4Q5V A;  1VQB A;  3DWQ A;  5JJI A;  5BR8 L;  3KF6 A;  3KLR A;  1HH2 P;  2CH4 A;  4H7B A;  4OWW B;  1EYG A;  2YU9 H;  5C44 B;  3S14 H;  4KI0 A;  1VQ8 A;  3K5M A;  4IFD H;  3SK5 A;  4MTK A;  3UDG A;  1STN A;  3GTQ H;  2IHE A;  2ZM6 Q;  1KNE A;  4ALP A;  4DAP A;  1JMC A;  2RVL A;  1SDF A;  4LF5 L;  4C56 C;  3GTJ H;  5C4J H;  1MIU A;  3KOJ A;  1BCP D;  4X64 L;  4OO1 H;  5C4Z A;  4HMJ A;  3TS2 A;  1VQD A;  1BNZ A;  3TP8 A;  1EY0 A;  4JC0 A;  4IPC A;  4V0B A;  1Q7Y C;  1KLU D;  3KJO A;  1F9Q A;  1LTB D;  3V96 A;  4LMQ D;  1PDQ A;  1PLF A;  4GNX B;  2VB2 X;  4K8I A;  3UE1 A;  3H09 A;  1AP0 A;  2ID0 A;  1E1O A;  1Q8I A;  2L12 A;  5KIX A;  2OF1 A;  5IT9 E;  4QY7 A;  5JEA G;  5EJW A;  2CW0 D;  3VDY A;  3MXN A;  1YNN D;  1OO9 B;  4QMG A;  1L0W A;  4JI1 Q;  1JJG A;  4BY1 G;  1RTN A;  1VQP A;  4AQY L;  3E6Z X;  1EWC A;  3OTO Q;  4G4K A;  4AIM A;  3L7Z C;  2A74 C;  2I07 B;  4G57 A;  1IL8 A;  2X6G A;  3J7Y W;  4CDF C;  3RUZ A;  5C44 H;  4L6T B;  1D2B A;  3HOX B;  1PRT B;  2VUM G;  3NWT A;  2NVX B;  3PV0 A;  1EY8 A;  2BA0 A;  5D3I B;  3DWA A;  4YHH Q;  2IHF A;  1CK1 A;  5KGU A;  3G7L A;  2R92 H;  4IUT A;  4C1N I;  3HFZ B;  1EEI D;  1K8A C;  5IGB A;  2IPK D;  4KJN A;  1JWS D;  1NE3 A;  3D6C A;  3BG3 A;  4POF A;  3PMF A;  2HCC A;  1BCP C;  3KF8 A;  2LMC B;  1F2L A;  1S5B D;  4WOR A;  3L2P A;  1M4V A;  4OO1 I;  3DEO A;  1WTX A;  2A6E D;  2IW3 A;  1HNW Q;  1HJP A;  1GXD C;  3E3X A;  4A3F G;  3NBH B;  5IYD G;  1LM0 A;  3QG1 A;  5JAV A;  3S2H B;  4OX9 Q;  2KQ3 A;  5LMN W;  1E2Z A;  2JA8 B;  3NEM A;  1PZK D;  3KBG A;  3MXG A;  1HR0 L;  2CW0 C;  4KLK A;  4U67 3;  5C3E G;  1YNN C;  1S5C D;  2D9U A;  4BWG B;  2VL6 A;  1VF7 A;  4NPS A;  2KEC A;  1MI2 A;  1PYW D;  5M3M H;  3EJI A;  1FGU A;  4GLA C;  4PMW A;  2QKI C;  3HP3 A;  1XMO Q;  3FHW A;  1SMX A;  4YWL A;  3HOU H;  2EY1 A;  2KHI A;  3CXC A;  3HOX H;  3ND9 A;  2Q2H A;  3J7Z C;  3IRB A;  1VQG A;  2WV6 D;  2KVM A;  1X6O A;  1I50 H;  2ZXR A;  3TBI B;  2R93 G;  4R8I A;  4CJ0 B;  4A3D H;  2YV5 A;  1HCZ A;  2M00 A;  3J80 E;  1PH2 A;  2AQ1 B;  2B8G A;  5IOD A;  1DOK A;  1V1P B;  3RD4 A;  1QZG A;  3CCR A;  5CGK A;  1NR4 A;  4NDX A;  4DR2 Q;  2DGY A;  2LKV A;  1GVP A;  3S1Q B;  3CPW A;  3K57 A;  5LL6 S;  3Q0A A;  3EBE A;  4XQN A;  1I3Q H;  1SND A;  4P2C B;  4WJW A;  3Q24 A;  1YNX A;  2X69 A;  1V8Q A;  4DR7 Q;  1UWV A;  2F3W A;  3HG9 A;  2A6E C;  3QWN A;  3DUZ A;  3URY A;  2A5H A;  2ASB A;  1FVI A;  1YJW A;  4YY3 L;  1PTO F;  3CPF A;  2B63 G;  1K8O A;  1H9R A;  3HOV G;  2RSN A;  4NXN Q;  1JT8 A;  4S3S A;  2HCI A;  3X3N A;  5FO8 B;  3T13 A;  3MXU A;  1CA6 A;  5GRO A;  1S3O A;  3AMU A;  1ESR A;  3H0G B;  2FMM A;  4QGU A;  4HMI A;  1WTH A;  2F0W A;  4H44 C;  2D62 A;  1N8R C;  3NTI A;  1U5K A;  5EBD A;  1SE3 A;  5L37 A;  3NWS A;  3E0E A;  5C4X H;  4KN4 C;  3NQT A;  3U4Z A;  5J39 A;  3GO5 A;  5HGT A;  3NK9 A;  4YWM A;  3A55 A;  1F9R A;  4CKB A;  1SYB A;  3BVM A;  2F4V Q;  4RHR A;  1U9R A;  5IYC H;  3ICE A;  4JI0 L;  3QR8 A;  2PMZ B;  1WD0 A;  1DOL A;  4B3S Q;  2D5D A;  2RQX A;  1EOT A;  3S1Q H;  1YEZ A;  3I4N G;  1SYF A;  4HED A;  1G91 A;  3GTO H;  3PO3 G;  3GD7 A;  3C1F A;  4WJ3 M;  2FMC A;  1Y1W G;  1LTG D;  4YWK A;  2L55 A;  4ZUJ A;  4UDU C;  5ELE A;  1IW7 C;  4IOC A;  1WTP A;  4QUC A;  2NTT A;  1PH4 A;  1E7Z A;  3E9H A;  2VQE Q;  2EYP A;  1O78 A;  3J81 L;  2EZV A;  3W5O A;  1TS3 A;  2UXB L;  1AE3 A;  3KF6 B;  2VZA A;  3PO2 G;  3M9B A;  2E5L Q;  1KC8 C;  2K50 A;  3J81 c;  4JI8 L;  4WFN 3;  5NUC A;  2IX3 A;  1M1K C;  4P74 A;  2K04 A;  4JI6 L;  3HZX A;  4IUV A;  4LUO A;  3D8G A;  2UXD L;  1AZQ A;  4OWX B;  4LF8 L;  3SHL A;  2WII B;  3L3O C;  2IT1 A;  4X3U A;  2KHJ A;  3PIO A;  5A2Q L;  3I8Z A;  3W3A A;  5BN5 A;  4HJ7 A;  1O7I A;  1LO5 D;  5HGQ A;  4RHS A;  1XNR Q;  2PZT A;  4QCL A;  1LTI D;  4G7Z C;  3ULL A;  4NXM Q;  1U0L A;  2L1B A;  3QIA A;  3HKZ G;  1SRU A;  4A3J B;  4KY6 A;  2V4D A;  4DU9 A;  2G5D A;  3MXN B;  1IBK L;  3T16 A;  1EY5 A;  3MEF A;  4JI2 Q;  4JPB W;  1CUK A;  4YCW A;  4DGZ A;  5FLM G;  3H3V H;  5KNB A;  4BY7 G;  4N9P A;  4A3B B;  2N78 A;  4K6D A;  2RKS A;  3F2C A;  4MHE A;  4GLX A;  4X65 L;  3Q22 A;  1OTC A;  4L5R C;  1PTO D;  3HOZ B;  2IWH A;  1RD9 D;  1FJG Q;  1CFM A;  3AQQ A;  1XPU A;  4I7A A;  1EFI D;  4FDB A;  2WP8 J;  1K83 B;  1EYD A;  2RCN A;  3LGJ A;  1C48 A;  4LUV A;  4B3T Q;  4RAU C;  2JE6 I;  3S1R B;  1YHA A;  2A8V A;  4DR5 Q;  4Y7N H;  2ICI A;  2DNC A;  2PI2 A;  4C3I G;  5LMN L;  2JA6 H;  5IWA Q;  3ND8 A;  4BBS B;  2CVR A;  1RTO A;  2FHT A;  2WIN B;  2D0O A;  4FVM A;  4BBR B;  3BVG A;  1IBL L;  2K32 A;  4A93 G;  1BQQ T;  1JOR A;  2NWG A;  4ZQ3 A;  1VQO A;  1B8A A;  4RKL A;  2B2T C;  3RN2 A;  1FNU A;  3KF8 B;  3RZO B;  1PH8 A;  1J5E L;  2DNE A;  3TSS A;  3J80 c;  1UEA B;  1VF5 C;  1Q90 A;  4EX5 A;  2R6G A;  1WI5 A;  1W6K A;  1YI2 A;  3A74 A;  1KD1 C;  2QA4 A;  1JJC B;  4IFD G;  2O5J C;  1EOV A;  3R2I A;  2K33 A;  4DAM A;  2KCT A;  4RA8 A;  3BU2 A;  4J6H A;  3VR5 A;  4A3M H;  1YIT A;  3L9A X;  1HXY D;  4A3B H;  3BDL A;  2MGS A;  4DV3 Q;  2F0Q A;  1I6V C;  4OEM B;  5M5W B;  1VMC A;  2A6H D;  4LFB Q;  3OMC A;  3H94 A;  2JK8 A;  1PTO C;  1JB7 A;  4C2M B;  4LFA L;  1TKW B;  5FO7 B;  2MP1 A;  4LJZ C;  3BS1 A;  1HZB A;  1PHJ A;  1YNJ D;  3TS0 A;  4PZ8 A;  1ZXT A;  4YCV A;  2XIW A;  1OXX K;  2BH8 A;  1VQI A;  1LLR D;  3M4O B;  4R4C A;  2JN4 A;  4BBR H;  1A63 A;  2MO1 A;  5JPM C;  4XQJ A;  1JWU D;  2K5N A;  3RZD B;  1T9H A;  3GTL H;  1TQO A;  2ZTE A;  2KCN A;  3RZO H;  3WDN A;  2I46 A;  4A3I B;  3TQY A;  2ZJP A;  4IUQ A;  2UU9 Q;  5AJ3 Q;  3ER0 A;  4DR6 Q;  4X3T A;  1X3F A;  3ONA B;  1BDO A;  1TWH B;  1XNQ L;  3ERS X;  2B2U C;  1J9O A;  2X6L A;  3H6M A;  5C44 G;  1CKN A;  2Y0S B;  4B3R Q;  2KED A;  1D1I A;  4LK1 C;  1NR2 A;  4KKS A;  2YTV A;  2KJX A;  3K8A A;  3FPP A;  5CYU A;  2EY6 A;  2R92 G;  1RCV D;  4C3H H;  1N36 Q;  3AEV A;  1IBM Q;  4L5S A;  3W1B A;  5M5W H;  5JEA J;  1IYJ B;  5FLX L;  1DD2 A;  5ELO A;  5E7N A;  2RHQ B;  2KEN A;  4C2M H;  1DXM A;  3PIP A;  2IL8 A;  2A6H C;  1XMQ L;  4JG2 A;  3VYU A;  2ATW A;  3TRZ A;  1XXG A;  2H5X A;  2XWB B;  1ESF A;  5BR8 Q;  3K5N A;  4HID A;  4OIJ A;  1SMY D;  1EQT A;  1XWE A;  1YNJ C;  2KUM A;  4DKA C;  3RZD H;  2A1A A;  1L2F A;  4FF1 A;  3U9S A;  1AEX A;  2Q8R E;  3QJY A;  3S16 H;  2DUD A;  4IN3 A;  1LT5 D;  2A68 D;  1HR0 W;  3CCE A;  5CV8 A;  4GN5 A;  3HOY B;  3MFY A;  4LF5 Q;  2VY3 A;  5M3M G;  4X64 Q;  3FKI B;  5I9O A;  1TWH H;  1S5F D;  3KK7 A;  4CJ1 B;  4LF7 L;  4IZ8 A;  3HOU G;  1EY9 A;  1VQL A;  3JAM c;  1E22 A;  1QCB D;  3HOX G;  5IGF A;  3J81 i;  4K5X A;  4DN4 M;  3KYH C;  1XYI A;  1VQF A;  5GAD C;  4O1N A;  1XPO A;  2A19 A;  4A3D G;  1IL2 A;  3DMU A;  2K14 A;  2ZTD A;  4A3G B;  2JP1 A;  3BVZ A;  5JJZ A;  2OTJ A;  1GOZ A;  1H9K A;  3M4Y A;  4AQY Q;  1FR3 A;  2ZXO A;  1JIC A;  5G3L F;  2HUG A;  4R4I A;  1RDP D;  2BCO A;  2IJ0 A;  1SYD A;  3OHX C;  4RG1 A;  4K5W A;  2NVT B;  2JYO A;  2PZW A;  2EOT A;  5M3F G;  3PQI A;  3C1E A;  1GKH A;  1D5Z C;  5EGT A;  1SMY C;  1B4O A;  1QNU A;  5T1I A;  3S1M H;  1G2T A;  1I4H A;  3MWY W;  2DJF C;  2EY5 A;  1PZJ D;  1BBX C;  1B7Y B;  4DNI A;  2B2T A;  1BCP B;  1GUN A;  4PV1 C;  1WTQ A;  1KIX A;  3AYH B;  2RDH A;  3MTS A;  2MFI A;  3FKI H;  2PW7 A;  4YIJ A;  2A68 C;  1SNM A;  1W2B A;  2PI2 E;  2WB1 G;  4DPG A;  2OEO A;  3TZD A;  1HRJ A;  1J6Q A;  4J15 A;  1EFW A;  2NZH A;  5CBE E;  1PH1 A;  5C0X I;  3FVQ A;  4IPH A;  3PUW A;  4I65 A;  4HSP A;  3K59 A;  5C4X G;  1EYA A;  5EKL A;  4LAA A;  2JA5 B;  4X66 L;  1AH9 A;  3ITP A;  3AFQ A;  1DJR D;  2JA7 H;  5DM6 3;  4ZYS A;  3E5S A;  1MGS A;  1PFS A;  2N8N A;  1HPC A;  5IYC G;  1U4P A;  5EKK A;  3F1Z A;  1Y1V H;  4HJ5 A;  3OW7 A;  3I90 A;  3OYY A;  1IYV A;  1OXT A;  5M5Y B;  4KD3 A;  5LMU L;  4DV6 L;  3FRP B;  2WAQ G;  1UNS A;  1B2T A;  4RGO S;  4A3K H;  2RHS B;  2NVT H;  3NE5 B;  3NXW A;  1F2Y A;  3J80 i;  4JI7 L;  2UUC L;  3GQB A;  3TP7 A;  1RKN A;  2XRS D;  4KKU A;  1ZKO A;  4TRD A;  5C5M A;  1CKM A;  4HIK A;  1X56 A;  3SGI A;  1QOH A;  1BBW A;  2XGT A;  1A2T A;  3S24 A;  2MUY A;  5KND A;  3OIP A;  5ELF A;  4ZLT F;  4ODG A;  2FIN B;  3CC2 A;  4RCN A;  3I70 A;  2E2I H;  4KHP L;  2EY2 A;  2K4K A;  4R9W A;  1YJN A;  3K6O A;  2B2U A;  4UP8 A;  1A3T A;  5ELB A;  2C9O A;  3J7A 5;  1X3E A;  4OHJ A;  3D6W A;  1LAC A;  4NMZ A;  2HHH L;  1SNO A;  2N49 A;  3TZU A;  1U4L A;  3K81 C;  2N88 A;  2JA5 H;  1PA6 A;  4MN3 A;  2K01 A;  5AFW A;  2R7Z B;  1A62 A;  2O5I C;  3MA2 B;  3IFD A;  4YY3 Q;  3A5U A;  1WCM B;  4P72 A;  3ULP A;  1EIF A;  3TP5 A;  5C0X J;  5I6W A;  3CQZ B;  5M5Y H;  1VQM A;  4DV5 L;  2MHV A;  3NHH A;  4GOP C;  1L1O C;  3NUC A;  5G3L D;  4KJO A;  5IP7 H;  3MVV A;  1E2W A;  2L5T A;  3I2Z A;  2E2H B;  3VA7 A;  1LT4 D;  1X55 A;  4L5T A;  4JOI C;  2MNA A;  1EUJ A;  3TDQ A;  5C4H A;  1U4M A;  1N34 L;  3D4W A;  1VQH A;  1PH6 A;  2NVQ B;  4EVO A;  4GN3 B;  3A8J E;  3CCV A;  4HN7 A;  3S1N B;  2VXW A;  4DV2 L;  4TSS A;  2F3V A;  1XX8 A;  4OWT B;  3ULJ A;  2B39 A;  3VYS A;  1V43 A;  1S40 A;  2ALY B;  1CKN B;  3M3Y B;  5K36 G;  4JI0 Q;  5EKI A;  3I3C A;  3SDZ A;  3K0Y A;  5A2Q E;  3GV6 A;  4TVA B;  1MD2 D;  5LHY 1;  1QNK A;  4CDE C;  2JA6 G;  5ISR A;  2RCF A;  4LFC L;  4GN4 B;  2LXK A;  2LFN A;  3K5L A;  2F0N A;  4R8N A;  1Y8P B;  4IPD A;  4DV1 L;  1SNP A;  1Q82 C;  1BOS A;  1HQR D;  1Q3L A;  3PF4 A;  2RF4 A;  4RFB A;  1E0B A;  4EQN A;  1B50 A;  1ENA A;  3HRZ C;  4HJ9 A;  1AZP A;  5IP9 G;  1JCK B;  4PG3 A;  4HIM A;  5T1G A;  1MBY A;  2WB1 E;  3CHB D;  2CHB D;  1WCM H;  2UXB Q;  1ET9 A;  4DUZ L;  1JOQ A;  2PNR C;  4B3M L;  2H1E A;  5EQ0 A;  4JI8 Q;  1VQ7 A;  1RL2 A;  2NVX H;  3MFG A;  3P75 A;  4JI6 Q;  4FF2 A;  4PMB A;  1JQY D;  2UXD Q;  4HR7 B;  2PQA A;  4A3M G;  2Z8L A;  4CGY B;  2L0C A;  5CBA E;  2NVQ H;  2J0T D;  1B9M A;  3S1N H;  3U50 C;  5CV6 A;  1E2V A;  1EZ6 A;  3JAM i;  1B3Q A;  1IW7 D;  1RHP A;  2WAQ E;  3D4D A;  1PYS B;  5I2Y A;  5J1Z A;  3HOW B;  3K0X A;  4MIU A;  3SR1 A;  4N9T A;  5D65 A;  3I55 A;  3M3Y H;  4GLV B;  3KLS X;  2F0U A;  1C0A A;  2XVS A;  4K14 A;  3S2H H;  1G6P A;  1TT2 A;  2VQF L;  2JA8 H;  4RWS C;  3KUP A;  1CQV A;  1STH A;  1PZI D;  1IBK Q;  1GUO A;  1NBW A;  1SAP A;  1B53 A;  3LWE A;  1RIP A;  2QW7 A;  1C9O A;  3I56 A;  2EYH A;  3B6Y A;  1QB5 D;  2H4O A;  4BA1 I;  4X65 Q;  2C5C A;  4HJA A;  1GUW A;  4DK1 A;  1HTP A;  3GTK B;  4UY8 C;  1HFG A;  5E3F A;  3F2D A;  4CKE A;  3OW2 A;  1EEF D;  3OSO A;  4X3K A;  1SR3 A;  2EPB A;  2EYF A;  4KK7 A;  2AUK A;  4MZ9 A;  5LMN Q;  1CSP A;  5IYB H;  4DFA A;  2R61 A;  1CHP D;  1F77 A;  1X54 A;  3SK6 A;  4C3H G;  4DNT B;  1IBL Q;  4E6I A;  3HOW H;  1WOC A;  5IGC A;  3EN2 A;  4JI5 L;  2Z0S A;  2Z4H A;  1ET6 A;  3U9O A;  4BY1 B;  1LYL A;  1J5E Q;  2OQK A;  5IT9 L;  3PGZ A;  1ENC A;  2UUB L;  1F2Z A;  1T5E A;  3DM1 A;  1LTL A;  4C1N K;  1SXT A;  1QIL A;  2EJM A;  1WFQ A;  2QF7 A;  4DA2 A;  3K7A B;  5IT9 c;  1EIH A;  1QJO A;  2AWN A;  3OIQ A;  4DK3 C;  2EYM A;  3CCQ A;  4DAV A;  1CKO A;  2F0E A;  1KNA A;  1H9S A;  2VUM B;  4POG A;  2F0G A;  3CC7 A;  1PTO B;  2EQS A;  4Q0F A;  3H0G H;  2F0M A;  3QO2 A;  2F0P A;  1QWY A;  3I4O A;  1EU3 A;  1Y69 U;  1CHQ D;  1KRS A;  1CSQ A;  2Q2U A;  2B29 A;  4LFA Q;  3CMA A;  4GOP A;  1S4Z A;  1L1O A;  3CCM A;  3DHQ A;  3M7G A;  3BYT B;  4ZCK A;  4QQB X;  5FLX E;  2E75 C;  4A4I A;  4AYB G;  1FD7 D;  4JOI A;  4P75 A;  1WYD A;  1XPR A;  2F3I A;  2KEE A;  2AWO A;  4A3F B;  1AFP A;  2V1C C;  3FDT A;  3VYT A;  4X62 L;  5JEA H;  2L11 A;  3UDF A;  4KV6 A;  4KY5 A;  3UDI A;  5DNF A;  3P1H A;  3NQI A;  1KRT A;  3KFU A;  1RJT A;  1AN8 A;  4C3J B;  1HHV A;  4JI4 L;  3S2D B;  5IIF A;  4O0A A;  4DAY A;  3Q6S A;  1I4Q A;  1SE2 A;  3K7A H;  1XNQ Q;  1STY A;  2WFW A;  1JOK A;  1M8A A;  1SLJ A;  4GZY C;  5JOB A;  1II3 A;  2HDM A;  1QE6 A;  1QVC A;  4DUY L;  4X6A H;  4LF9 L;  3I4M B;  1TII D;  2MPM A;  1ILP A;  1PTO H;  2AQ3 B;  5IGG A;  1YBY A;  1MSH A;  2A69 C;  2R7D A;  4KHZ A;  1TY2 A;  2F0L A;  4WJ4 A;  2B2W C;  4QB4 A;  3FKI G;  3CRL C;  4KHV A;  1T5X D;  3GV3 A;  1EY7 A;  4XDX A;  3I72 A;  3GDE A;  2I5L X;  1PH7 A;  1FGB D;  4UAI A;  2JSO A;  3VA5 A;  5EBC A;  1XMQ Q;  3J80 L;  3PUY A;  3CF5 A;  2NZO A;  1TU2 B;  3C2P A;  1JE5 A;  4OGQ C;  3OWF A;  1HNX L;  1MSG A;  2NYZ D;  4G7H C;  3K80 C;  2JA7 G;  1OXS C;  4UHV A;  4B08 A;  3VR3 A;  2GVA A;  3RN5 A;  4A3J H;  2B63 B;  2PZU A;  1TWG B;  1R9T B;  1Y1V G;  3HOV B;  4C3J H;  3S17 B;  1MJC A;  3T53 B;  1CT1 D;  1XTD A;  4YCU A;  1LAB A;  3M85 A;  1NSN S;  2EDG A;  4H02 A;  1N9W A;  3T1Y L;  4A3K G;  1EZ8 A;  5M5X B;  1GHK A;  4JI3 L;  4LF7 Q;  2SDF A;  3HOZ H;  4P71 A;  3T4A C;  1N32 L;  5M9O A;  1UAP A;  4FF3 A;  2RDG A;  4OO1 G;  1K83 H;  1ILQ A;  3SK4 A;  2KHS A;  2K5V A;  1TWA B;  3I4M H;  1I4G A;  3A7A B;  5FKA C;  3RMH A;  5JVH 3;  2CFM A;  3VR2 A;  3S1R H;  5JPN C;  5GQO A;  3J7A V;  3H3V C;  4V19 0;  4FP5 D;  5GAH C;  2NTS A;  2NB0 A;  1H9J A;  1I4R A;  4HTH A;  4BBS H;  1H9M A;  2PQA B;  1NMG A;  3I4N B;  3PSI A;  5KYL A;  2K7V A;  1Y1W B;  1FYC A;  2E8G A;  4N8F A;  1EL0 A;  3FP9 A;  3T1H L;  3PUX A;  4JVZ A;  1K3B C;  1PFN A;  5LL6 X;  1SYG A;  1DOM A;  2UXC L;  1TWG H;  3RR5 A;  2EXD A;  3KBX A;  1O80 A;  3I4L A;  1LV9 A;  3OMG A;  3PO2 B;  2AKW B;  4QIW E;  1YJ9 A;  3BYY B;  4AYB E;  2LY7 A;  3PUZ A;  2RBM A;  5IOC A;  4JYA L;  5IP7 G;  2D0P A;  2JA9 A;  1K8G A;  4IQZ A;  4DV7 L;  3HKZ E;  4XXE A;  3HEJ A;  1QUQ A;  4ILW A;  1WTW A;  4OXP A;  3D3R A;  4XIG S;  4FO2 A;  3RLF A;  1C8C A;  4EGV A;  1KDA A;  3FEW X;  4P73 A;  4A3L H;  3C46 A;  5DM7 3;  3DXJ C;  1I94 L;  4X66 Q;  4FYD A;  1J8I A;  4K0K L;  3MAQ A;  4IPG A;  1DZ1 A;  2P5Z X;  1X32 A;  3M4O H;  1A3V A;  3DWP A;  2AQ2 B;  4IO9 A;  2F0I A;  1HUM A;  5I4D A;  5EPL A;  1MHW C;  5LMU Q;  4DK0 A;  1MKH A;  2K05 A;  1LTS D;  4ZRZ A;  5C5L A;  2ZJQ A;  1NAP A;  1FL0 A;  1SNC A;  4A3I H;  2F0O A;  4JI7 Q;  2UUC Q;  2GN5 A;  5J22 A;  3CCJ A;  3I73 A;  3JAM L;  1O7L A;  1GO3 E;  5C0X H;  3V05 A;  4BY7 B;  1S5E D;  1WCM G;  3HGB A;  4ABN A;  4IUU A;  1VDZ A;  2Q2T A;  4HSV A;  1KTK A;  3C3L A;  2BE5 D;  1K9M C;  4KHP Q;  2FJ2 A;  2F0F A;  2N55 A;  1V1Q A;  4LF4 L;  1SBB B;  1PH3 A;  3ZYY X;  4C3I B;  2CCZ A;  2EJF C;  3WOE A;  1EIG A;  1ZEQ X;  1GD7 A;  2QEJ C;  5E4X A;  2ICE C;  3A8I E;  4A3E B;  2QDL A;  2HHH Q;  4LUZ A;  1KDB A;  3AU7 A;  4A75 A;  1NTG A;  4A93 B;  2QIL A;  4KMU C;  4PZ7 A;  2PQE A;  2SEB D;  4O42 A;  1GUS A;  3QOJ A;  2BDN A;  1L1O B;  3A54 A;  1G6Z A;  2B2V C;  1VMP A;  5COR A;  3N6R A;  3KLW A;  4TKO B;  2B2W A;  1ICF B;  4JV5 L;  2CWP A;  4RH6 A;  5D3D A;  4DV5 Q;  5GAE C;  2JA8 G;  2YU9 B;  1WTV A;  1Z9F A;  4QF4 A;  3S14 B;  4UP9 A;  4F8M A;  2F0V A;  2SNM A;  4DV0 L;  3GTQ B;  1DYQ A;  4ZAI A;  2A73 B;  3HOY H;  2PCF B;  3NBI A;  1ASY A;  1N34 Q;  1EIY B;  3EA6 A;  3PCO B;  1SEB D;  3BDC A;  2CKZ B;  4DAY B;  5E1F A;  3GTJ B;  1VQ4 A;  5C4J B;  2TMP A;  5TSS A;  4DV2 Q;  1X3Q A;  3A56 A;  4ID6 A;  2L15 A;  3MEH A;  5ELD A;  1C4Q A;  3NSW A;  3MC0 B;  2EYL A;  1KHI A;  5DAU A;  3LNN A;  1KDC A;  4K2K A;  2L9H A;  3KLS A;  1FNV A;  5BN3 A;  3K5O A;  3H91 A;  1K0S A;  1Y8O B;  5IYB G;  2BE5 C;  4LFC Q;  3KJP A;  4A3G H;  3G6J B;  4A3E H;  3AB9 A;  5FO9 B;  3G48 A;  1HR0 Q;  2L4N A;  4DV1 Q;  1NCV A;  4A93 H;  2M2L A;  1KL9 A;  2R7F A;  4BA2 I;  3HOW G;  2EVB A;  2D2C C;  1KAA A;  3TP6 A;  1IKL A;  1Q8K A;  5I6Y A;  2QCP X;  4ZKB B;  4OIK A;  2E76 C;  4HAE A;  3F2U A;  1NMF A;  1E1T A;  1VQA A;  2F0D A;  2KOL A;  5IE8 A;  2PYK A;  4NP5 A;  4DUZ Q;  3F2B A;  1PRT F;  4B3M Q;  1Q46 A;  4R1J A;  3PF5 A;  2ES2 A;  2EJG C;  1VQ5 A;  1VS0 A;  3J7A F;  1QZH A;  2UUA L;  2YTX A;  2DY7 A;  4TQU S;  4FXG C;  1N33 L;  1S5D D;  4DR1 L;  1HNZ L;  3NTK A;  3G4S A;  2R92 B;  2HIX A;  4DV4 L;  1JJ2 A;  4LF6 L;  3H0G G;  2E2J B;  1QG7 A;  1YHQ A;  1VQN A;  4BXX H;  4A76 A;  3K58 A;  1KLG D;  1UEB A;  4IJH A;  3UE0 A;  1GJX A;  2K28 A;  3JC6 6;  4XT3 B;  4LNQ A;  2NUC A;  3N52 A;  1E3P A;  2VQF Q;  1PFB A;  4MNO A;  4GKJ L;  2XWJ B;  1DGS A;  1NUC A;  5KNC A;  1W6J A;  3D0F A;  2F4I A;  5CV4 A;  4DR4 L;  3J81 E;  1P16 A;  2AMC B;  1R4P B;  4R4Q A;  4FF4 A;  1K3R A;  5M3M B;  2NVY B;  3S9W A;  3A8K E;  1TS2 A;  3EQL C;  1ENF A;  5EPJ A;  2HDL A;  4PMC A;  3LWU A;  3HOU B;  2WKC A;  1IKM A;  2MQH A;  1G29 1;  4XYO A;  4FXK C;  4MTN A;  4R4T A;  1ROD A;  1I5F A;  1AW7 A;  2AHO B;  4XQQ A;  4Z9C B;  4JBW A;  3PIP 3;  1I50 B;  1EY6 A;  2KA7 A;  4H13 C;  1A3U A;  4IFD I;  4A3D B;  2E2J H;  5F2D A;  2NN6 H;  4KN7 C;  3MXP A;  1V9P A;  5IGD A;  1JE4 A;  4QUF A;  3D31 A;  5CV9 A;  4L63 B;  3PUV A;  4JI5 Q;  2DY8 A;  3BDO A;  1B70 B;  4DR3 L;  1WD1 A;  1BKB A;  1VQK A;  5JJK A;  1QUQ B;  3A0J A;  2XTI A;  4GKK L;  2YYZ A;  2UUB Q;  3HKS A;  1SNQ A;  1YIJ A;  2R7Z H;  4OL7 A;  1I3Q B;  5JJL A;  2B2Y C;  2ZXP A;  4B9W A;  5M3F B;  2F0H A;  3WWV A;  1D6E C;  1D7Q A;  2WKD A;  1GUT A;  3CQZ H;  1WJJ A;  4DK6 C;  5C3X A;  3CAM A;  3WOF A;  4A3J G;  3CCU A;  1F2M A;  5J3B A;  4C3J G;  2E2H H;  4F87 A;  5FK9 C;  2B2V A;  4M8A A;  1PH9 A;  2ZM6 L;  2NVY H;  2OQ0 A;  4KTA A;  2BOS A;  4LF8 Q;  1SYE A;  3AFP A;  1D8L A;  1PRT D;  4KKT A;  4B9X A;  3DM3 A;  2OT2 A;  2WB1 B;  4A3B G;  5DLQ E;  3HOZ G;  2O2L D;  2EYJ A;  1BXT A;  2CQA A;  3SXH A;  1AE2 A;  3CME A;  1TXY A;  3I4M G;  5C4X B;  2RSO A;  2BDO A;  1L0Y B;  3HS0 C;  4X62 Q;  2OWO A;  1K0R A;  1PVO A;  3FMC A;  1B3A A;  4OON A;  1I6H B;  1BUV T;  3X3M A;  1HZC A;  4JBJ A;  1ZYR D; 
#chains in the Genus database with same CATH homology
 1CZG A;  3SE0 A;  1RF2 D;  4FXD A;  2NN6 I;  4KD4 A;  1STB A;  1SE4 A;  4X3S A;  1LT3 D;  2WAQ B;  3GTP B;  1IYU A;  3GTO B;  4IFD J;  2KCC A;  5CR3 A;  1TVX A;  5C3W A;  5DEH A;  2JXM B;  4DXG A;  4PQX A;  3D4R A;  4ZUI A;  1D5X C;  3VR6 A;  4IAL A;  1STE A;  2ENB A;  3MHB A;  1Z47 A;  1SJE D;  4ZKC B;  3R3O A;  3GTM B;  1PRT C;  2K03 A;  1STA A;  2XSC A;  3IL8 A;  1Q12 A;  1F9P A;  2QDB A;  1PMR A;  3SEB A;  3E0J A;  1TWF B;  3GP7 A;  1LTT D;  1KAB A;  2XRQ D;  4HCS A;  2J4X A;  3T56 B;  1A15 A;  4K5V A;  1I4P A;  3R8B A;  3CU7 A;  3T51 B;  1ZYR C;  2IX1 A;  2A69 D;  1JOO A;  1HTL D;  5I9P A;  2J7Z A;  5E4W C;  1LTR D;  3MZ5 A;  1WTO A;  2BA1 A;  1STG A;  2K1B A;  5C0X G;  1G8Z D;  3OOC A;  3P20 A;  4KY7 A;  5KYI A;  1CA5 A;  1PXU A;  5K5P A;  1HA5 A;  5BN4 A;  3DEP A;  2G9H D;  4Y7N B;  2JA6 B;  3ERO A;  3Q23 A;  1O7Z A;  5HUR A;  2MJ8 A;  1BR9 A;  5C3E B;  1O7Y A;  5KEE A;  5CV5 A;  3ERQ A;  1DCZ A;  3EVQ A;  2K5D A;  2JEB I;  2F0J A;  3A7L A;  1F9S A;  2XNA C;  2LS0 1;  4ME5 A;  3OWE B;  1JC7 A;  4RGM A;  1JB3 A;  3JAM E;  3W2D A;  2PPB C;  1TS4 A;  3LX0 A;  2G9D A;  2R93 B;  5COY A;  1OXU A;  4DXF A;  2B2Y A;  4A3M B;  2EYO A;  4ULL A;  2SNS A;  1EY4 A;  1CTM A;  3VR4 A;  2XN9 C;  5K36 H;  5CC4 A;  2Z4I A;  2F03 A;  3NTH A;  1SYC A;  1DON A;  2WAC A;  2PO4 A;  4NW2 A;  4DF7 A;  5KRU A;  1Q1E A;  4XT1 B;  2TSS A;  4IUP A;  1D1K A;  1U4R A;  1EWH A;  5IGE A;  3NP8 A;  3GTL B;  1VCI A;  2F0T A;  1B1Z A;  1G2S A;  5A35 A;  2NBF A;  3TN2 A;  3GTG B;  4M1U B;  2AUJ D;  2RA4 A;  4K6L A;  1HFN A;  5EPK A;  4L8J A;  1EYC A;  3IAY A;  3M7N A;  2OXP A;  2F1M A;  4F7X A;  2EXZ A;  2Q8T A;  4C3H B;  1Z7T A;  4G7O C;  1ICW A;  3PO3 B;  2F0S A;  1EQV A;  5D14 A;  1A6X A;  1SFO B;  3S15 B;  1CI3 M;  4EQO A;  3QOL A;  1DM0 B;  1R4Q B;  1BF4 A;  1A2U A;  1JWM D;  4ZK9 B;  1SSO A;  2EE1 A;  3UI2 A;  1GHJ A;  2RDF A;  3S16 B;  2PW5 A;  3IKJ A;  4IUR A;  2O4X A;  3R2T A;  2HQE A;  1GUG A;  4U68 A;  1XTC D;  4RKB A;  1I4X A;  3I91 A;  1HQM C;  1TWC B;  1Y8N B;  3QB3 A;  1IHZ A;  2M9V A;  4EQP A;  4IUN A;  3IFT A;  1LT6 D;  1V1O A;  4QIW B;  4XTC S;  4I7Z C;  1JR0 D;  4AYB B;  3NBH A;  1L0X B;  2Q8I B;  4RCO A;  2NZ1 D;  2NN6 G;  3HKZ B;  4CHT B;  5I2X A;  3O13 A;  4J8Q A;  4HCE A;  3CKI B;  2K5W A;  2Z1C A;  3NPP A;  4NKL A;  4K2L A;  2DN8 A;  4K8J A;  4CKC A;  1BCP F;  1Q1B A;  1HA6 A;  3FPU B;  1K8M A;  3S1M B;  3PIO 3;  4JK1 C;  4BS9 A;  1H9S B;  1B9N A;  1ONL A;  1V1P A;  1OXV A;  2IX0 A;  3VYR A;  5ELC A;  1CQF A;  1ML0 D;  1TR5 A;  2E74 C;  3TME A;  1WVL A;  4RGT A;  1Z6H A;  2VB3 X;  3V2T A;  2FFK B;  4CJ2 C;  2JA7 B;  4J1M A;  3EFX D;  1CM9 A;  1Y1V B;  2F0K A;  1EU4 A;  5C6A A;  2B8F A;  4A3K B;  3R93 A;  1B44 D;  1X3P A;  1CZW A;  1TS5 A;  4F88 A;  4H0L C;  3SK8 A;  3BZD B;  4PNY A;  4CBV A;  4RGN A;  5CV7 A;  5JVG 3;  1FNW A;  1D5M C;  3SVM A;  3CRK C;  1WTR A;  1TY0 A;  2JEA I;  2E2D C;  2E2I B;  1BO0 A;  1SJH D;  2VNU D;  4DNR B;  4WRD A;  4XYQ A;  2SOB A;  3OPO A;  3P7J A;  2K6A A;  4FNF A;  2GA4 B;  1LTA D;  1PFM A;  1HUN A;  1UUP A;  5FOB B;  2ZT9 C;  2K5Q A;  2R3Z A;  5CMD A;  4Q5V A;  3DWQ A;  4H7B A;  3KLR A;  5C44 B;  4KI0 A;  3K5M A;  4IFD H;  3SK5 A;  1STN A;  1KNE A;  4DAP A;  2RVL A;  1SDF A;  4C56 C;  1BCP D;  4OO1 H;  5C4Z A;  4HMJ A;  1BNZ A;  3TP8 A;  1EY0 A;  4V0B A;  1KLU D;  1F9Q A;  1LTB D;  3V96 A;  4LMQ D;  1PDQ A;  1PLF A;  2VB2 X;  4K8I A;  3H09 A;  1AP0 A;  2ID0 A;  1Q8I A;  2L12 A;  5KIX A;  2OF1 A;  5IT9 E;  5JEA G;  5EJW A;  2CW0 D;  3MXN A;  1YNN D;  1OO9 B;  4QMG A;  1RTN A;  3E6Z X;  1EWC A;  4G4K A;  3L7Z C;  2A74 C;  2I07 B;  4G57 A;  1IL8 A;  2X6G A;  3J7Y W;  3RUZ A;  4L6T B;  1D2B A;  3HOX B;  1PRT B;  3NWT A;  2NVX B;  3PV0 A;  1EY8 A;  2BA0 A;  5D3I B;  3DWA A;  1CK1 A;  5KGU A;  3G7L A;  4IUT A;  4C1N I;  1EEI D;  5IGB A;  2IPK D;  4KJN A;  1JWS D;  3D6C A;  3BG3 A;  3PMF A;  2HCC A;  1BCP C;  3KF8 A;  2LMC B;  1F2L A;  1S5B D;  4WOR A;  1M4V A;  4OO1 I;  3DEO A;  1WTX A;  2A6E D;  2IW3 A;  1GXD C;  3QG1 A;  5JAV A;  3S2H B;  2KQ3 A;  1E2Z A;  2JA8 B;  1PZK D;  3KBG A;  3MXG A;  2CW0 C;  4U67 3;  1YNN C;  1S5C D;  2D9U A;  4BWG B;  1VF7 A;  2KEC A;  1MI2 A;  1PYW D;  3EJI A;  4PMW A;  2QKI C;  3HP3 A;  2EY1 A;  3ND9 A;  2WV6 D;  2KVM A;  2ZXR A;  3TBI B;  4R8I A;  4CJ0 B;  1HCZ A;  2M00 A;  3J80 E;  2AQ1 B;  2B8G A;  5IOD A;  1DOK A;  1V1P B;  3RD4 A;  5CGK A;  1NR4 A;  4NDX A;  2LKV A;  3S1Q B;  3K57 A;  5LL6 S;  3Q0A A;  4XQN A;  1SND A;  4P2C B;  4WJW A;  3Q24 A;  2X69 A;  1V8Q A;  2F3W A;  3HG9 A;  2A6E C;  3QWN A;  3DUZ A;  3URY A;  2A5H A;  1PTO F;  1K8O A;  1H9R A;  2RSN A;  4S3S A;  2HCI A;  3X3N A;  5FO8 B;  3T13 A;  3MXU A;  1CA6 A;  3AMU A;  1ESR A;  3H0G B;  2FMM A;  4HMI A;  2F0W A;  4H44 C;  2D62 A;  3NTI A;  5EBD A;  1SE3 A;  3NWS A;  4KN4 C;  3NQT A;  5J39 A;  3GO5 A;  5HGT A;  4CKB A;  3NK9 A;  3A55 A;  1F9R A;  1SYB A;  3BVM A;  4RHR A;  1U9R A;  2PMZ B;  1WD0 A;  1DOL A;  2D5D A;  2RQX A;  1EOT A;  1G91 A;  1SYF A;  4HED A;  3GD7 A;  3C1F A;  2FMC A;  1LTG D;  2L55 A;  4ZUJ A;  4UDU C;  5ELE A;  1IW7 C;  1WTP A;  4QUC A;  2NTT A;  2EYP A;  1O78 A;  3J81 L;  2EZV A;  1TS3 A;  4WFN 3;  5NUC A;  2IX3 A;  2K04 A;  3HZX A;  4IUV A;  3D8G A;  1AZQ A;  3SHL A;  2WII B;  3L3O C;  2IT1 A;  4X3U A;  5A2Q L;  3I8Z A;  3W3A A;  5BN5 A;  1LO5 D;  4RHS A;  2PZT A;  4QCL A;  1LTI D;  4G7Z C;  2L1B A;  3QIA A;  4A3J B;  4KY6 A;  2V4D A;  4DU9 A;  3T16 A;  1EY5 A;  4DGZ A;  5KNB A;  4N9P A;  4A3B B;  4K6D A;  2RKS A;  4MHE A;  3Q22 A;  3HOZ B;  1PTO D;  2IWH A;  1RD9 D;  1CFM A;  1EFI D;  2WP8 J;  1K83 B;  1EYD A;  1C48 A;  4RAU C;  2JE6 I;  3S1R B;  2ICI A;  2DNC A;  4C3I G;  3ND8 A;  4BBS B;  2CVR A;  1RTO A;  2FHT A;  2WIN B;  4FVM A;  4BBR B;  3BVG A;  2K32 A;  1BQQ T;  1JOR A;  2NWG A;  4ZQ3 A;  4RKL A;  2B2T C;  1FNU A;  3RZO B;  2DNE A;  3TSS A;  1UEA B;  1VF5 C;  1Q90 A;  2R6G A;  1W6K A;  4IFD G;  2O5J C;  3R2I A;  2K33 A;  4RA8 A;  4J6H A;  3VR5 A;  3L9A X;  1HXY D;  3BDL A;  2MGS A;  2F0Q A;  1I6V C;  5M5W B;  1VMC A;  2A6H D;  3OMC A;  3H94 A;  1PTO C;  4C2M B;  1TKW B;  5FO7 B;  4LJZ C;  2MP1 A;  3BS1 A;  1YNJ D;  1ZXT A;  2XIW A;  1OXX K;  1LLR D;  3M4O B;  5JPM C;  4XQJ A;  1JWU D;  3RZD B;  1TQO A;  2KCN A;  3WDN A;  2I46 A;  4A3I B;  4IUQ A;  4X3T A;  3ONA B;  1BDO A;  1TWH B;  2B2U C;  1J9O A;  2X6L A;  3H6M A;  2Y0S B;  2KED A;  1D1I A;  4LK1 C;  1NR2 A;  4KKS A;  2KJX A;  3FPP A;  5CYU A;  2EY6 A;  1RCV D;  5JEA J;  5FLX L;  1DD2 A;  1DXM A;  2IL8 A;  2A6H C;  3VYU A;  1XXG A;  2XWB B;  1ESF A;  3K5N A;  4OIJ A;  1SMY D;  1EQT A;  1XWE A;  1YNJ C;  2KUM A;  4FF1 A;  3U9S A;  1AEX A;  2Q8R E;  3QJY A;  4IN3 A;  1LT5 D;  2A68 D;  5CV8 A;  3HOY B;  3MFY A;  3FKI B;  5I9O A;  1S5F D;  3KK7 A;  4CJ1 B;  4IZ8 A;  1EY9 A;  1QCB D;  5IGF A;  4K5X A;  4DN4 M;  1XYI A;  4O1N A;  3DMU A;  4A3G B;  2JP1 A;  3BVZ A;  5JJZ A;  1GOZ A;  1H9K A;  3M4Y A;  1FR3 A;  2ZXO A;  1JIC A;  5G3L F;  2HUG A;  1RDP D;  2BCO A;  2IJ0 A;  1SYD A;  3OHX C;  4K5W A;  2NVT B;  2JYO A;  2PZW A;  2EOT A;  3C1E A;  1D5Z C;  5EGT A;  1SMY C;  1B4O A;  1QNU A;  5T1I A;  1G2T A;  1I4H A;  3MWY W;  2EY5 A;  1PZJ D;  1BBX C;  2B2T A;  1BCP B;  1GUN A;  4PV1 C;  1WTQ A;  2RDH A;  3MTS A;  2PW7 A;  4YIJ A;  2A68 C;  1SNM A;  2OEO A;  3TZD A;  1HRJ A;  5CBE E;  5C0X I;  3FVQ A;  3PUW A;  4I65 A;  4HSP A;  3K59 A;  1EYA A;  5EKL A;  4LAA A;  2JA5 B;  3ITP A;  1DJR D;  5DM6 3;  4ZYS A;  3E5S A;  1MGS A;  1HPC A;  1U4P A;  5EKK A;  3OW7 A;  3I90 A;  1IYV A;  1OXT A;  5M5Y B;  4KD3 A;  3FRP B;  1UNS A;  1B2T A;  4RGO S;  3NE5 B;  3NXW A;  1F2Y A;  3GQB A;  3TP7 A;  1RKN A;  2XRS D;  4KKU A;  1ZKO A;  4TRD A;  5C5M A;  1QOH A;  1A2T A;  2MUY A;  5KND A;  3OIP A;  5ELF A;  4ZLT F;  4ODG A;  2FIN B;  4RCN A;  3I70 A;  2EY2 A;  4R9W A;  3K6O A;  2B2U A;  1A3T A;  5ELB A;  2C9O A;  4OHJ A;  3D6W A;  1LAC A;  4NMZ A;  1SNO A;  3TZU A;  1U4L A;  2N88 A;  4MN3 A;  2K01 A;  5AFW A;  2R7Z B;  2O5I C;  3MA2 B;  3IFD A;  1WCM B;  3TP5 A;  5C0X J;  5I6W A;  3CQZ B;  2MHV A;  3NHH A;  3NUC A;  5G3L D;  4KJO A;  3MVV A;  1E2W A;  2L5T A;  2E2H B;  3VA7 A;  1LT4 D;  3TDQ A;  5C4H A;  1U4M A;  3D4W A;  2NVQ B;  4EVO A;  3A8J E;  4HN7 A;  3S1N B;  2VXW A;  4TSS A;  2F3V A;  1XX8 A;  2B39 A;  3VYS A;  1V43 A;  3M3Y B;  5K36 G;  5EKI A;  3I3C A;  3SDZ A;  3K0Y A;  5A2Q E;  3GV6 A;  5LHY 1;  1MD2 D;  1QNK A;  5ISR A;  2LFN A;  3K5L A;  2F0N A;  4R8N A;  1Y8P B;  1SNP A;  1BOS A;  1HQR D;  1Q3L A;  4RFB A;  1E0B A;  4EQN A;  1B50 A;  1ENA A;  3HRZ C;  1AZP A;  1JCK B;  5T1G A;  1MBY A;  3CHB D;  2CHB D;  1ET9 A;  1JOQ A;  2PNR C;  2H1E A;  5EQ0 A;  3MFG A;  3P75 A;  4FF2 A;  4PMB A;  1JQY D;  4HR7 B;  2Z8L A;  4CGY B;  2L0C A;  5CBA E;  2J0T D;  1B9M A;  5CV6 A;  1E2V A;  1EZ6 A;  1IW7 D;  3HOW B;  1RHP A;  3D4D A;  5I2Y A;  5J1Z A;  4MIU A;  3SR1 A;  4N9T A;  5D65 A;  3KLS X;  2F0U A;  2XVS A;  4K14 A;  1TT2 A;  4RWS C;  3KUP A;  1CQV A;  1STH A;  1PZI D;  1GUO A;  1SAP A;  1B53 A;  3LWE A;  2EYH A;  1QB5 D;  2H4O A;  4BA1 I;  2C5C A;  1GUW A;  4DK1 A;  1HTP A;  3GTK B;  1HFG A;  5E3F A;  4CKE A;  1EEF D;  3OSO A;  4X3K A;  2EPB A;  2EYF A;  4KK7 A;  2AUK A;  4DFA A;  2R61 A;  1CHP D;  1F77 A;  3SK6 A;  4C3H G;  4DNT B;  4E6I A;  5IGC A;  2Z4H A;  1ET6 A;  3U9O A;  4BY1 B;  5IT9 L;  1ENC A;  1F2Z A;  1T5E A;  3DM1 A;  4C1N K;  1SXT A;  1QIL A;  2EJM A;  2QF7 A;  4DA2 A;  3K7A B;  1EIH A;  1QJO A;  2AWN A;  3OIQ A;  2EYM A;  4DAV A;  2F0E A;  1KNA A;  1H9S A;  2VUM B;  2F0G A;  1PTO B;  4Q0F A;  3QO2 A;  2F0M A;  2F0P A;  1QWY A;  1EU3 A;  1Y69 U;  1CHQ D;  1S4Z A;  3DHQ A;  3M7G A;  3BYT B;  5FLX E;  2E75 C;  1FD7 D;  1AFP A;  2KEE A;  2AWO A;  4A3F B;  3FDT A;  3VYT A;  5JEA H;  2L11 A;  4KV6 A;  4KY5 A;  5DNF A;  3P1H A;  3NQI A;  1RJT A;  1AN8 A;  4C3J B;  1HHV A;  3S2D B;  5IIF A;  4DAY A;  3Q6S A;  1I4Q A;  1SE2 A;  1STY A;  1JOK A;  1M8A A;  4GZY C;  5JOB A;  1II3 A;  2HDM A;  1QE6 A;  3I4M B;  1TII D;  2MPM A;  1ILP A;  1PTO H;  2AQ3 B;  5IGG A;  1MSH A;  2A69 C;  4KHZ A;  1TY2 A;  2F0L A;  2B2W C;  4QB4 A;  3CRL C;  4KHV A;  1T5X D;  3GV3 A;  1EY7 A;  4XDX A;  3I72 A;  1FGB D;  4UAI A;  2JSO A;  3VA5 A;  5EBC A;  3J80 L;  3PUY A;  1TU2 B;  3C2P A;  4OGQ C;  3OWF A;  1MSG A;  2NYZ D;  4G7H C;  1OXS C;  4B08 A;  3VR3 A;  2B63 B;  2PZU A;  1TWG B;  1R9T B;  3HOV B;  3S17 B;  3T53 B;  1CT1 D;  1LAB A;  3M85 A;  1NSN S;  2EDG A;  1GHK A;  1EZ8 A;  5M5X B;  2SDF A;  3T4A C;  5M9O A;  1UAP A;  4FF3 A;  2RDG A;  4OO1 G;  1ILQ A;  3SK4 A;  2KHS A;  1TWA B;  1I4G A;  3A7A B;  5FKA C;  3RMH A;  5JVH 3;  3VR2 A;  5JPN C;  3J7A V;  3H3V C;  4V19 0;  4FP5 D;  2NTS A;  2NB0 A;  1H9J A;  1I4R A;  4HTH A;  1H9M A;  3I4N B;  5KYL A;  2K7V A;  1Y1W B;  1FYC A;  1EL0 A;  3PUX A;  1PFN A;  5LL6 X;  1SYG A;  1DOM A;  3KBX A;  1O80 A;  3I4L A;  1LV9 A;  3OMG A;  3PO2 B;  3BYY B;  2LY7 A;  3PUZ A;  2RBM A;  5IOC A;  4IQZ A;  4XXE A;  3HEJ A;  4ILW A;  1WTW A;  3D3R A;  4XIG S;  4FO2 A;  3RLF A;  1C8C A;  4EGV A;  1KDA A;  3FEW X;  3C46 A;  5DM7 3;  3DXJ C;  4FYD A;  1J8I A;  3MAQ A;  1DZ1 A;  1X32 A;  1A3V A;  3DWP A;  2AQ2 B;  2F0I A;  1HUM A;  5I4D A;  5EPL A;  4DK0 A;  2K05 A;  1LTS D;  4ZRZ A;  5C5L A;  1NAP A;  1SNC A;  2F0O A;  5J22 A;  3I73 A;  3JAM L;  1O7L A;  5C0X H;  3V05 A;  4BY7 B;  1S5E D;  3HGB A;  4ABN A;  4IUU A;  1VDZ A;  4HSV A;  1KTK A;  3C3L A;  2BE5 D;  2FJ2 A;  2F0F A;  2N55 A;  1SBB B;  3ZYY X;  4C3I B;  2EJF C;  3WOE A;  1EIG A;  1ZEQ X;  2QEJ C;  5E4X A;  2ICE C;  3A8I E;  4A3E B;  1KDB A;  3AU7 A;  4A93 B;  2QIL A;  4KMU C;  2PQE A;  2SEB D;  4O42 A;  1GUS A;  3QOJ A;  2BDN A;  3A54 A;  1G6Z A;  2B2V C;  1VMP A;  5COR A;  3N6R A;  4TKO B;  2B2W A;  4RH6 A;  5D3D A;  2YU9 B;  1WTV A;  4QF4 A;  3S14 B;  4F8M A;  2F0V A;  2SNM A;  3GTQ B;  1DYQ A;  4ZAI A;  2A73 B;  2PCF B;  3NBI A;  3EA6 A;  1SEB D;  3BDC A;  5E1F A;  3GTJ B;  5C4J B;  2TMP A;  5TSS A;  1X3Q A;  3A56 A;  4ID6 A;  3MEH A;  5ELD A;  1C4Q A;  3NSW A;  3MC0 B;  2EYL A;  5DAU A;  3LNN A;  1KDC A;  4K2K A;  2L9H A;  5BN3 A;  1FNV A;  3KLS A;  3K5O A;  3H91 A;  1Y8O B;  2BE5 C;  3G6J B;  3AB9 A;  5FO9 B;  2L4N A;  1NCV A;  2M2L A;  4BA2 I;  2EVB A;  2D2C C;  1KAA A;  3TP6 A;  1IKL A;  5I6Y A;  2QCP X;  4ZKB B;  4OIK A;  2E76 C;  4HAE A;  3F2U A;  2F0D A;  2KOL A;  2PYK A;  4NP5 A;  1PRT F;  2EJG C;  3J7A F;  2DY7 A;  4TQU S;  4FXG C;  1S5D D;  3NTK A;  2R92 B;  2E2J B;  1QG7 A;  3K58 A;  1KLG D;  1GJX A;  2K28 A;  4XT3 B;  2NUC A;  3N52 A;  1PFB A;  2XWJ B;  1NUC A;  5KNC A;  1W6J A;  2F4I A;  5CV4 A;  3J81 E;  1R4P B;  4FF4 A;  5M3M B;  2NVY B;  3S9W A;  3A8K E;  1TS2 A;  3EQL C;  1ENF A;  5EPJ A;  2HDL A;  4PMC A;  3LWU A;  3HOU B;  2WKC A;  1IKM A;  1G29 1;  4XYO A;  4FXK C;  1ROD A;  1AW7 A;  4XQQ A;  4Z9C B;  4JBW A;  3PIP 3;  1I50 B;  1EY6 A;  2KA7 A;  4H13 C;  1A3U A;  4IFD I;  4A3D B;  5F2D A;  2NN6 H;  4KN7 C;  3MXP A;  5IGD A;  1JE4 A;  4QUF A;  3D31 A;  5CV9 A;  4L63 B;  3PUV A;  2DY8 A;  3BDO A;  1WD1 A;  2YYZ A;  1SNQ A;  4OL7 A;  1I3Q B;  2B2Y C;  2ZXP A;  4B9W A;  5M3F B;  2F0H A;  1D6E C;  2WKD A;  1GUT A;  5C3X A;  3WOF A;  1F2M A;  4C3J G;  4F87 A;  5FK9 C;  2B2V A;  4M8A A;  4KTA A;  2BOS A;  1SYE A;  1PRT D;  4KKT A;  4B9X A;  2OT2 A;  2WB1 B;  2O2L D;  2EYJ A;  1BXT A;  2CQA A;  3SXH A;  5C4X B;  2RSO A;  2BDO A;  1L0Y B;  3HS0 C;  3FMC A;  1B3A A;  1I6H B;  1BUV T;  3X3M A;  1ZYR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...