1SNQA

Protein stability in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 130
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snqA00
1SYBA 2SNMA 4KY7A 3QB3A 5I9OA 4N9TA 4PMBA 5C5MA 3DHQA 3BDCA 5J39A 4QMGA 1SNDA 5IGEA 2PW5A 1A3TA 5F2DA 1II3A 2PZWA 3HZXA 4K2LA 4F7XA 3QOLA 4DGZA 3E5SA 4K5VA 1JOKA 1U9RA 4LAAA 3ITPA 2F0VA 1TR5A 1KDCA 4J1MA 5CV5A 3SK8A 5C4HA 3VA5A 1A2TA 4KTAA 1SYEA 2WACA 4G57A 4YIJA 4ME5A 5I9PA 2EY5A 4ZUJA 4OL7A 1TT2A 3D6CA 1JORA 4WRDA 1STNA 1EY6A 3SK4A 1KAAA 4EQOA 4NKLA 4ODGA 5IGCA 5J22A 1EYDA 4K2KA 2PW7A 5CV6A 2EYMA 3V2TA 3HEJA 2F0PA 5JOBA 4B9XA 5IIFA 2KHSA 4IUNA 2F0FA 4QB4A 5IGFA 3C1EA 1EY8A 3BDLA 1EYCA 3D8GA 2RBMA 3PMFA 1EZ6A 1SNPA 4K6DA 3T13A 2F0EA 3TMEA 1JOOA 2EXZA 4H7BA 5EKKA 4J6HA 3SHLA 5J1ZA 1F2ZA 3NHHA 2F0HA 5HGTA 3R3OA 3TP5A 5C3WA 5E1FA 1STBA 1STHA 1NSNS 4WORA 3U9OA 1KABA 3D4WA 3MZ5A 5I6YA 2EY1A 1STYA 1EY5A 2OXPA 4K14A 4PMCA 4HMIA 3SR1A 4B9WA 1SYFA 2F0IA 2EYLA 2EY2A 3TP8A 3P1HA 1SNMA 4S3SA 5KIXA 1STAA 4RKLA 4EQPA 4TRDA 2F3WA 1NUCA 4KHVA 1KDBA 2F0GA 2F0OA 1SNQA 2EY6A 1EY9A 3NP8A 1SYDA 4DU9A 1EY7A 4F8MA 3OMGA 4DF7A 5IOCA 4NDXA 5CV8A 1SYCA 4KJNA 4PNYA 3C1FA 1RKNA 4I65A 3MHBA 3T16A 4KD4A 3DMUA 1A3UA 4IZ8A 5IGDA 5KEEA 5IGBA 4KV6A 1F2MA 2F0DA 5I6WA 2PZTA 3MVVA 4EQNA 3EJIA 5M9OA 2F0LA 5NUCA 3TP6A 2HQEA 1F2YA 3EROA 4K8JA 2EYPA 3TP7A 2RDFA 5C6AA 5K5PA 4ZQ3A 3LX0A 5CV9A 3RUZA 4ID6A 3SK6A 2SOBA 3OWFA 4ZUIA 5EKLA 5IGGA 2PYKA 1IHZA 2O4XA 3MEHA 4EVOA 5CR3A 1A2UA 1EY0A 2F0TA 3NK9A 2PQEA 5ISRA 4NMZA 5KYIA 1EQVA 1EY4A 3MXPA 1A3VA 3SK5A 2F0WA 2NUCA 2OEOA 2F0QA 2PZUA 2F0NA 2RKSA 4HMJA 4KJOA 5E3FA 4DFAA 2EYFA 4KY6A 1ENCA 4K8IA 2QDBA 3H6MA 3NUCA 5DAUA 3ERQA 4N9PA 3P75A 5IODA 1EZ8A 3NQTA 2LKVA 3OMCA 1EYAA 2KQ3A 5CV4A 5DEHA 1SNCA 1SNOA 2F0JA 2F0SA 5C4ZA 4NP5A 5KGUA 5KYLA 3QOJA 1SYGA 4HTHA 5JAVA 3S9WA 2EYOA 5KRUA 4K5XA 1ENAA 4MIUA 1AEXA 2EYHA 2SNSA 3OSOA 2F3VA 3EVQA 4RKBA 5EGTA 2F0MA 4QF4A 4IALA 3D4DA 5CV7A 1STGA 1KDAA 5C5LA 2EYJA 2F0KA 2ENBA 2M00A 3NXWA 1JOQA 4K5WA 4E6IA 5C3XA 4KD3A 1TQOA 4R8NA 4KY5A 5CC4A 2F0UA 2OF1A 5CGKA 5HURA 3SXHA
chains in the Genus database with same CATH superfamily
3TREA 2SNMA 4KY7A 1KD1C 4WFN3 4FYDA 1FNUA 4QMGA 3S2HB 1Q82C 5C4JB 2E2HB 3K59A 1CUKA 4HCSA 4LAAA 4J1MA 1PFMA 5I9PA 2QEJC 3HP3A 4DAPA 4HN7A 1GKHA 1EIGA 1UE7A 4JI6L 2B2WC 2FFKB 1WD0A 1VQ7A 1TY0A 1QUQB 2IY5B 2F0PA 3GQBA 1N33L 1C4QA 1EU3A 1BCPD 3BDLA 5C3EB 4GNXB 1M90C 5K36H 4N8FA 1K0RA 4FF1A 3NWSA 4A93G 4KKTA 3BZKA 3AEVA 1ZYRC 3NHHA 2K75A 5LL6S 5GAEC 3GTMH 1Q1EA 1NY4A 5GAHC 1JT8A 3U4ZA 1LT4D 1I94L 1GHJA 3HKZE 2R7ZB 2MP1A 5HGQA 5JJKA 2MPMA 3HOUG 2KVMA 3CRKC 4DV2Q 4RKLA 4A3BB 2QDLA 4A76A 1V43A 2E76C 5GQOA 4BS9A 2EY6A 2M9VA 3SE0A 4ZCKA 3O13A 2R7DA 4A3KH 2ZTCA 4A3MH 3S15H 1E0BA 1LACA 1HRJA 2WP8J 4IQZA 5D65A 4QCLA 3MXUA 3LX0A 5CV9A 3SK6A 4ZUIA 3QG1A 1ET6A 1IHZA 2HCCA 3KF6A 1ZKOA 4DUYQ 1VF5C 5JVH3 5BN3A 1FVIA 3TRZA 5C44B 1A3VA 3LWUA 2TSSA 4HMJA 2L9HA 3H6MA 4BBSB 3RZOB 1PTOB 1HNXL 3KDFB 4IFDI 5KYLA 1N33Q 2B2TA 4P71A 1CHPD 3W1GA 4XDXA 4K5XA 4O0AA 2XVSA 3S14B 1KNAA 3A0JA 3EVQA 3L3OC 1SMXA 3OIPA 4P2CB 4YCVA 4QGUA 3D4DA 4F88A 3I73A 3H94A 1HA6A 3DWQA 3QJYA 1HR0Q 3HOWG 2H4OA 1HR0W 5CGKA 3CAMA 4JCVE 1ZEQX 4MTKA 5C5MA 4YCWA 4CJ0B 2PQAA 3W1BA 1A3TA 5F2DA 5M5YH 1XMQL 2GVAA 3I7FA 3KUPA 2KEEA 3QOLA 1D2BA 3VA5A 3K5MA 2EPBA 4GOPC 1FR3A 2PNRC 4FXKC 2OCEA 3T1YL 2NVXH 3K6OA 3K0YA 5A2QE 1VMPA 4LWCA 1I6VC 2UXBL 1PTOF 3OW7A 5ELBA 4GLXA 4YWLA 2F3IA 3BYYB 4LFAL 3GTGB 3S24A 4DAVA 3SHLA 1IKLA 5LMNL 2I5HA 2D62A 4R8IA 1HCZA 5FKAC 1YBYA 3G6EA 1S5CD 3ZYYX 3ND8A 2K5WA 4B3TL 3HOUH 4JI5L 2DJGC 1SNQA 4DU9A 3X3NA 1QJOA 5IOCA 4R4IA 2AUKA 4DAYB 5C3EG 4TSSA 2RCNA 4KD4A 1PH7A 2JA8B 4RFBA 3MWYW 5KEEA 4KV6A 3S1MB 1YHBA 3PUXA 1YJWA 2BA1A 1PYSB 1WI5A 5M9OA 4CKBA 1VS0A 1C9OA 2UUAL 3CF5A 3H3VC 1SE3A 4KHZA 1TWGH 2Q2IA 1YVCA 1B3QA 4EVOA 4EGVA 4C3HG 1B9NA 1ESRA 5DNFA 4LF5Q 4IUVA 1UE5A 4DV5L 4B3SQ 2PZUA 1J9OA 4DFAA 4KY6A 3P75A 4G4KA 1TS3A 1Q3LA 1WCMG 2LKVA 3DWPA 2PNHA 1QILA 5CV4A 4GKJL 3BYTB 5KGUA 1NMGA 4FDBA 4HTHA 2FJ2A 4CJ1B 2VQEL 4B3RQ 1SR3A 1B9MA 1LTGD 4UAIA 1R4PB 1SAPA 1S3OA 3R2TA 1AFPA 1G2SA 4BY1B 4OELB 4C3JH 5C44G 4KD3A 1HQMC 4KY5A 5IT9c 2YV5A 3HOWH 1MBYA 1KRSA 3K5LA 1K0SA 1AZQA 1PTOC 4B3TQ 3J80E 3CCMA 2IHEA 3RLOA 1ZYRD 4F7XA 1HXYD 2WINB 4A4IA 1Q8KA 1Z7TA 3DM1A 3SK8A 2D5DA 4G57A 4KHPQ 2NB0A 5FLXE 3D4RA 4BBRH 1CKMA 1F2LA 4Q5VA 4X65L 2Q2UA 2K01A 2UUAQ 5JPNC 4MZ9A 4K2KA 2PW7A 2DY7A 3VYUA 1T9HA 1RDPD 4X64Q 4AQYL 4IFDG 2A5HA 1OXTA 4K6DA 1JWUD 4DV1Q 4H7BA 3CKIB 4A3IG 4RG1A 3R8BA 4DPGA 4JYAQ 5M3FG 4NPSA 4WORA 4FXDA 1O7YA 2N3SA 5IY0A 1X65A 4U68A 1L0WA 2BDOA 2VNUD 2EY2A 1CM9A 4FNFA 4PZ6A 5KIXA 3NELA 2VQEQ 5H1SE 4KLKA 2FINB 2KENA 2AQ2B 4BXXH 3AFQA 1KHIA 3CC7A 2R61A 3MFGA 1NJIC 1LTLA 1C7YA 2NN6G 4R1JA 3T16A 2WB1B 1AP0A 4B08A 1Y1WG 2B8GA 3J7AV 3K7AB 3NENA 3S1RB 3FKIB 2RHSB 5I2YA 3PIO3 2SOBA 4UP8A 1QNKA 1HQRD 2O4XA 3K81C 3IFTA 3AQQA 3TSSA 1SMYD 2F0TA 3PO3B 1JCKB 4C3HH 2NUCA 5E4XA 1F77A 1RL2A 5JAVA 4GLAC 1X56A 2Y0SG 3ERSX 4N9PA 1NR2A 1VQCA 5EQ0A 4X65Q 2JA8G 3TS0A 3HOYB 1WCMH 3MEFA 1Q86C 4TVAB 1DXMA 3DEOA 1FJGL 1K3BC 4XQJA 4DV0L 4FP5D 3GTOH 4HJ5A 3CCJA 4LFBL 1AEXA 1NR4A 2CH4W 1DD2A 1UEBA 4QF4A 4IALA 1D8LA 2ASBA 1OXUA 3MXNB 2M00A 1VQ5A 3KFUA 2Z9HA 4K5WA 5C3XA 2KHIA 2LFNA 1BCPF 2OF1A 1L0YB 3VR6A 4CKEA 5C4XB 4IO9A 2B2UC 3FP9A 1RD9D 1HJPA 1Z6HA 3E5SA 3BVMA 4LUZA 1E3PA 3UE1A 4YIJA 1CI3M 4OO1I 1LYLA 1STNA 4NKLA 1B70B 2FXQA 3V2TA 2EYMA 4B3ML 3CPWA 3D0FA 2A68C 2F0FA 3ONAB 2L0CA 5IGFA 2KCNA 2F4IA 2RDGA 4Y52H 2XWBB 4IFDH 2QCPX 4JI0Q 3GTPH 1B2TA 1S40A 1U4PA 2ZT9C 1F2ZA 4A3IH 3A56A 4BY7H 5CYUA 1HA5A 3DM3A 5EPLA 4K14A 1OXSC 4X66Q 1GUGA 4JW0A 3OPOA 4JPBW 4DV0Q 2A6ED 3NTHA 3Q22A 1TKWB 3F2BA 1PH5A 2XN9C 3A8JE 2K1BA 4IPCA 1X3PA 4I65A 3NBIA 3I56A 1J5EL 4QUFA 1HTPA 4IZ8A 1N34Q 3M9BA 3FDTA 2F0DA 2C5CA 2G9DA 1OXXK 3JC66 4IFDJ 3F2DA 3EIVA 3E3XA 4DUZQ 2WV6D 2CH4A 1HUNA 2YU9B 3OWFA 3U50C 5EKLA 4DV7L 2MHVA 2X6LA 4N8X1 1SE2A 4A3LH 3RLFA 1LM0A 1UUPA 4IJHA 1EQVA 1EY4A 4JOIC 3SK5A 3IRBA 2LS01 2F0QA 1PH1A 1HNWQ 1EIFA 1YHAA 1EQTA 1HTLD 1PTOD 3CPFA 4IOAA 5IT9L 5E7NA 1BR9A 3GV6A 1AN8A 4J8QA 4YHHL 3RZDH 2NVYH 1O80A 1SNOA 2Q8IB 1PRTB 1M8AA 1SYGA 3H0GG 4LFCL 4OX9Q 2VB3X 2CQOA 3OWEB 2K4KA 4YCUA 2UU9L 1CKOA 2ZXPA 1LTTD 2BCOA 3R93A 5IP7G 1IYVA 4JI2Q 3ULPA 2B63B 2B2YC 3GTKB 2E75C 2H1EA 1STEA 3EA6A 2DJFC 3FEWX 1XNQQ 1N32Q 3HRZC 1O7IA 2AKWB 4DGZA 2NZOA 2ICIA 2HQLA 5FLMG 5C4HA 1TWCB 1JQYD 4X62L 1W2BA 1QVGA 4ME5A 3D6CA 3ULLA 2JK8A 4RMFA 1YJNA 1FNWA 3NTKA 3JAME 4IOCA 1IBKL 4FO2A 2C9OA 3I4OA 4RCOA 4LF8Q 2WAQB 4LF4L 1DGSA 4DAMA 3I3CA 1MD2D 2CCZA 4A3EH 3S17H 1RJTA 1KXLA 1D5XC 2CHBD 3D4WA 1DM0B 1EY5A 4GKKQ 1A63A 4A3JG 4XYOA 3HOZG 2I07B 3K58A 3A8IE 3OTOL 1RF2D 3TP8A 4DR2L 3HOXG 3IAYA 4EQPA 1GUWA 4LFCQ 2F0OA 3ZJYC 3NP8A 2ES2A 2N49A 1KC8C 3S2DH 1G291 3T1HL 2EDGA 1T5EA 3GV3A 2B2WA 3PUVA 4TKOB 4OGQC 2F4VQ 4JI1Q 4JI8L 2IWHA 4OO1G 3S1NH 3J7YW 2JYOA 2RDFA 3URYA 3I2ZA 4A3GG 3CW2C 2FMCA 1HZBA 4DNTB 1PLFA 4XT1B 3BVGA 1ASYA 3TS2A 4DKAC 4X62Q 3MAQA 3L0OA 1F9SA 2KUMA 3CD6A 2EYFA 5ELOA 2IPKD 3PCOB 1EFID 4JC0A 3C2PA 4LUOA 3KBXA 3N6RA 4JV5Q 1IXRA 2F0JA 3K0XA 3PIPA 1SFOH 3QR8A 3QOJA 1PFNA 4LF7L 1YI2A 2N88A 4DR7L 2OT2A 3H0GH 3SEBA 3QO2A 1BOSA 2JA5B 3KF8B 1S4ZA 2OTLA 1CHQD 4L5QA 3S1QB 1R4QB 1WTQA 5IP7H 1I3QH 4QIWE 4CDEC 3BG3A 1QOHA 2A68D 4DV4Q 1AE2A 3OTOQ 4G7HC 1F9RA 1B1ZA 4PMBA 4NXMQ 3I4MH 3A5ZB 1GUTA 4JI3Q 4G7OC 2IJ0A 4X6AH 5I2XA 1QNUA 1AW7A 1JOKA 2Y0SE 3F2CA 2F0VA 2PI2E 1XMOL 1S5BD 1EQRA 1JWSD 1TWFH 1XXGA 4IURA 4YWMA 2EY5A 4L5TA 4DR4L 4KK7A 1CA5A 3G6JB 3VR3A 1P8LA 1YITA 4KI0A 1V1OA 2RBMA 1SNPA 4O1NA 4A3DG 3PIP3 3K7UC 1STBA 3GTJH 2EY1A 5JJZA 1G6PA 5LL6X 4A3JH 3HOZH 4WJWA 4J15A 1L1OB 3BVZA 3NBHA 1MJCA 1VDZA 3M4OB 3HOXH 4LF7Q 1VQAA 1PVOA 4NXNL 2GA4B 2QW7A 2RHQB 4GOPA 1Q1BA 5IE8A 3H3VI 2MFIA 4KJNA 1YZ6A 2QEXA 2R92B 2F52A 1PFSA 3HOVH 4X3SA 3FPUB 4OO1H 1LUZA 5BN4A 2O5JC 2TMPA 3RUZA 2F03A 4A3GH 5M3MG 5IYDG 2QGQA 2YTXA 2MJ8A 1IL8A 1EOVA 2G9HD 1Z9FA 1DYQA 1X3EA 4YY3Q 1WTPA 2WFWA 4RGOS 4JI7L 3KK7A 1XPUA 4EQ5A 2N78A 2NVQH 3BJUA 5FK9C 2OTJA 1CFMA 1VQEA 4LMQD 1V1QA 3NEMA 2LY7A 5AJ3Q 4GS3A 4IUTA 2SEBD 1P16A 5LMUQ 1XTCD 1LTBD 5EGTA 3JAMi 1ASZA 1HFGA 1PH2A 3J81i 1QB5D 1MI2A 1LT5D 5CORA 1WTRA 3CQZH 1Q7YC 3Q24A 4JI6Q 5IGEA 4LF6L 3J7AF 4CDFC 4UP9A 1UWVA 3ULJA 3E9IA 3STBC 1XJVA 4PZ8A 1XYIA 3ITPA 3PO2G 1JICA 4HJ9A 1TWAB 3T53B 2E2JH 2XTIA 2B3GA 1KAAA 5EBCA 4X3TA 3BZCA 1I94Q 1SMYC 2VL6A 2PQAB 1TY2A 2UXCL 5ELFA 1XNRL 1VQNA 1I4GA 3FVQA 1EZ6A 1GUOA 1B8AA 1BXTA 1E22A 1QVCA 1I4PA 4P74A 2CKZB 1ICWA 5L37A 3P7JA 3CMAA 3A7AB 2NN6I 3KDFA 3UE0A 1SLJA 1HPCA 3S16B 2F0IA 2IW3A 2HHHL 1SSOA 1VQHA 2KEDA 5FLXc 1QCBD 4ZKCB 1VCIA 4C3IG 1TIID 2UUBL 1JC7A 5EJWA 1S5DD 3RN5A 2OQKA 2ZTEA 4DR5L 2Q8RE 4A93H 1MGSA 4KN4C 3WWVA 3NQIA 1ILQA 3GTQH 1FD7D 1I50H 1L1OC 3SDZA 1QE6A 2KECA 2RVLA 2UUCL 4H02A 2NZHA 5DM73 5M3MH 1HNXQ 3EN2A 1UEAB 2EXDA 2O5IC 3RN2A 4LF9L 1CSQA 1LTID 4JVZA 4GNXC 1OTCA 3K5NA 2A6HC 1PRTD 1E1TA 1EZ8A 3NTIA 3L9AX 5M5WB 5DEHA 4HCEA 1I4HA 4GN5A 5C4ZA 4Y7NB 1FGBD 2QA4A 1NNXA 2UXCQ 1LTRD 4OHJA 2BA0A 2VY3A 2SDFA 2EYOA 1R9TH 4WJ3M 4UDUC 3KBGA 1LT6D 1G6ZA 1K28A 2R7ZG 1XMQQ 2HUGA 4AYBB 4A3BG 3Q8DA 2K03A 4E6IA 2K32A 2ZJPA 2A6EC 2OQ0A 2Q2TA 3T1YQ 4HIOA 1VQ9A 2NVTH 1U4RA 2IX3A 4ALPA 3BDCA 5J39A 4ZKBB 4ME3A 2J4XA 2UXBQ 4CHTB 2PZWA 2QKIC 2PI2A 2ZM6L 2UUBQ 4R4CA 4RA8A 2MUYA 2K5VA 2E2IH 4LFAQ 2Z6KC 3PO2H 4OONA 1XWEA 4ZUJA 1E2WA 1TT2A 4FF3A 1H9MA 5LMNQ 2DGYA 1LV9A 5M5XH 4JI4L 1YJ9A 5CV6A 3Q6SA 1BBWA 2B2TC 2QF7A 3A54A 4LK1C 1YEZA 2UUCQ 4QB4A 2LSSA 2A73B 5A2QL 3D8GA 1VQFA 3W2DA 4JI5Q 4BBSG 3GTLH 4J6HA 1I6HH 3TP5A 3U9OA 4TQUS 4FXGC 1HFNA 3M7NA 2B2UA 4CKCA 1VQOA 4JBWA 3PIOA 4C2MH 1LO5D 1NUCA 1JB3A 1CKNA 1DONA 4RHSA 4ZK9B 2FHTA 3DXJC 1SYDA 1D1KA 1XTDA 3M3YB 4FF4A 4X3KA 2K5QA 2HT1A 2NZ1D 1EWHA 1U4MA 3S2HH 4DV5Q 5NUCA 3TP6A 5C4JH 1E2VA 3M7GA 4PQXA 2E2HH 2MGSA 4F87A 2NTSA 1H9RA 5IGGA 5COYA 4GKJQ 2JA7B 1EY0A 3NK9A 1PV4A 4DNRB 1PH8A 2JA6B 2OEOA 2K14A 5E3FA 2XRSD 1WTVA 5G3LF 3ERQA 4R9WA 5IODA 5C3EH 3STBD 2VS1A 1Y1VB 3RD4A 4JK1C 2UXDL 4A3FB 1YHQA 2BOSA 4RGNA 3TBIB 3W5OA 2F3VA 2X69A 2ATWA 2H5XA 4G7ZC 2R7ZH 1BBXC 4HJAA 3P20A 3H3VH 1JOQA 4A3BH 2R93B 2K28A 1OXVA 1CTMA 3QB3A 1CZGA 4H0LC 3DHQA 1VMCA 1II3A 3K8AA 4JOIA 4DNIA 1HZCA 1TR5A 3FPPA 2C35B 3VR5A 4AQYQ 5EKIA 4O42A 2LMCB 4GZYC 1BKBA 1ILPA 1PMRA 3AB9A 2NYZD 4WRDA 1PDQA 4AYBG 5JEAG 5FO9B 3WOEA 2A69D 1PYWD 2NWGA 5JOBA 1KLGD 5FLXL 3I4MB 1GUNA 1TWHB 5C44H 1DOMA 4NW2A 5KNBA 1I4XA 4DV6L 2A1AA 5J1ZA 4JG2A 4XQNA 4OXPA 3RZOH 4DXFA 1PTOH 2B2YA 2RF4A 5I6YA 4P73A 4PMCA 2OXPA 4ZYSA 3KLRA 5IT9E 3S14H 2F3WA 3CCLA 1JJCB 4KHVA 3I4NB 1CQFA 4KKUA 1CK1A 1L2FA 2VUMB 4F8MA 4BY1G 2A6HD 1GXDC 5ELCA 1VQGA 3MXNA 3JAMc 1RKNA 3CCQA 3DMUA 3PUYA 3J81c 1VQMA 2DNCA 2WKDA 3G71A 3EROA 1FGUA 1IL2A 3I90A 1ESFA 5M3FH 1GOZA 1EYGA 3HFZB 1TS2A 3AFPA 3A8KE 4LW1A 3KOJA 1FJGQ 5ISRA 2K52A 4M8AA 3V05A 2F0WA 4V190 3NWTA 2IX1A 1V1PB 4LFBQ 3L2PA 2MNAA 3M4QA 1G8ZD 3HOVB 1ET9A 2NN6H 2JP1A 3CCVA 2KQ3A 3GTMB 3GTGH 3RR5A 1UNSA 1SNCA 1DJRD 1UE6A 1Y1WH 3T4AC 1RTNA 1ENAA 2A8VA 4K0KL 2E74C 2AMCB 1G2TA 4OIKA 1UAPA 1PFBA 5LHY1 4O2DA 2ENBA 3NXWA 3T51B 1AH9A 2JA6G 3C46A 3J80i 4NMZA 4BWGB 3SXHA 4A3KB 4DR6L 3VDYA 1SXTA 4A3MB 1TS4A 3S15B 2AWNA 2WB1G 2JA8H 4DR3L 4B3MQ 3S1MH 3CC2A 4XXEA 4A3FG 3FKIG 3D3RA 1A2TA 1JE5A 4KTAA 1E1OA 1PH4A 2YTYA 4IPGA 4JBMA 1H9SA 4H44C 2R3ZA 4IUPA 4ODGA 5IGCA 3H15A 3WOFA 3PO3G 3HEJA 1RHPA 3F2UA 1K8MA 1RCVD 1Q8IA 1SN8A 3TMEA 2EXZA 5EKKA 5JJIA 5FO7B 3HOYG 1D5MC 5IP9G 2F0HA 2MQHA 5GAGC 3HS0C 2EJGC 2Z0SA 2HCIA 1WD1A 1V9PA 1J5EQ 3VYTA 1SYFA 4POFA 2RDHA 1WTOA 1FL0A 1BUVT 2IT1A 1Y69U 1GHKA 4DR1L 4TRDA 2A19A 5J3BA 4XT3B 1HNZL 4UHVA 1CQVA 4FF2A 4BY1H 1PRTF 5CV8A 1SYCA 4PNYA 4DV7Q 3I8ZA 3KJPA 5M5YB 1JMCA 5C4XG 1M4VA 2B2VA 1C8CA 4EQNA 2Z8LA 2EYPA 2EJFC 3TP7A 5C6AA 4ABNA 2NVXB 4GN4B 1E2ZA 1KLUD 3ICEA 1BQQT 1X3QA 2GN5A 3MEHA 4DN4M 2PCFB 4YHHQ 1AZPA 3J7A5 1PZKD 3IL8A 2I5MX 1QWYA 4POGA 2RQXA 1IBML 2D9UA 2XRQD 2UU9Q 1ENCA 2Z4IA 3NUCA 1H95A 3NQTA 1JE4A 4RGMA 1EYAA 1W6KA 3PGZA 1PH6A 2F0SA 2RSNA 2Z1CA 1IBLL 1ICFB 2B39A 4OIJA 1K83H 2VQFL 3HOUB 5IWAL 3K5OA 3QIAA 4HSVA 3TZUA 2JA9A 2CW0C 1DOLA 5C5LA 1K8GA 4ILWA 5IYBG 5ELDA 1XPOA 2L4NA 1QZGA 1XPRA 2F1MA 4DR1Q 1SROA 3DWAA 4YWKA 1R9TB 1IBKQ 2MO1A 1YNND 3OOCA 5T1IA 1TWGB 3K7AH 3S1RH 1QVFA 3FKIH 4IPHA 4LF4Q 5TSSA 4PV1C 1W6JA 3SK4A 1EQQA 3TN2A 1DCZA 3L7ZC 3RNUA 2JEBI 2CFMA 2ICEC 3PO3H 1AE3A 1EWCA 1H9KA 2JN4A 3FMCA 3G7LA 4ULLA 4DR2Q 1EU4A 5A35A 2EOTA 3JAML 1PRTC 4BA1I 5G3LD 4HEDA 1B50A 3HOYH 3I91A 5IP9H 3J81L 3AMUA 1HUMA 2DY8A 5E1FA 4IJLA 5DM63 4Q0FA 3DLLA 5FLMH 4UPAA 3T1HQ 3KLWA 4RCNA 3OYYA 2EYLA 1SNMA 2B8FA 4JI8Q 4C3JB 1K8AC 3HOWB 2F0GA 3TQYA 3U4VA 2B63G 3C3LA 5EPKA 3OMGA 4X3UA 4AYBE 1LTAD 5C4XH 5BN5A 1IYJB 3M4YA 2E8GA 1WJJA 1HHVA 1YIJA 3NBHB 1HZAA 5D3IB 4BBRB 4KKSA 2G5DA 4CDDC 1JR0D 4GOPB 4UP7A 3K57A 1A2UA 3KYHC 3BU2A 4DR7Q 4KN7C 3AU7A 3NSWA 3I4LA 1O78A 3VR4A 3OW2A 2ZJRA 5FJ8G 3CCRA 2WAQG 1VQBA 5GROA 3HKSA 4DUYL 1U4LA 1SDFA 2ZJQA 2K50A 4I7AA 2K7VA 1SRUA 2AHOB 4XIGS 2SNSA 2EYHA 1CT1D 4RKBA 2ZXRA 5CV7A 1STGA 1UE1A 3LGJA 2EYJA 4IN3A 1XMOQ 3VYSA 1L1OA 1I5FA 3OIQA 5EBDA 2LXKA 5IYBH 2AQ1B 1L0XB 4DR4Q 2HIVA 2CQAA 2RA4A 1QUQA 2PW5A 2JSOA 4MTNA 3A74A 2L1BA 1E24A 4GNXA 1HR0L 2PMZB 1KDCA 3KF6B 3PQIA 1EEID 1GVPA 2P5ZX 1VF7A 1LTSD 4OL7A 5HY6A 1DZ1A 3PUWA 2YU9H 4C3HB 4R4OA 2IL8A 3PSIA 3KLSX 4B9XA 3PUZA 3CP0A 1WCMB 2BE5C 2YTVA 2KCTA 2PO4A 4NXNQ 4EX5A 1MSGA 2VB2X 1A0IA 2ZXOA 4K6LA 3GTOB 5C3WA 3NPPA 3UI2A 2K33A 2WB1E 2D0OA 5JJLA 4HJ7A 4DA2A 2JA5G 2ID0A 2LXJA 2Z6KA 2DN8A 1OO9B 2B63H 2Z4HA 4AIMA 3C1FA 1A62A 3GTKH 1SE4A 5IGDA 1SEBD 5IGBA 2L15A 1SJHD 5CMDA 2PZTA 4A3DH 3J80c 2HQEA 4JI7Q 4L5RC 2EQSA 1TWCH 1X54A 2EJMA 1WTXA 1X3GA 1PZID 4WJ4A 2PYKA 3D31A 2CW0D 4C3JG 1YNJC 2A69C 3E0EA 3GTPB 3VR2A 1FNVA 4K8IA 4DXGA 4AH6A 4PZ7A 4A3IB 1GJXA 5FJ8H 4BY7B 5M3FB 1MHWC 4NP5A 3BZDB 4LF5L 4B3SL 4KMUC 4BBRG 1VQPA 1PHJA 4U673 4LF6Q 1IW7C 2JXMB 5IYDH 4GLVB 1KDAA 4HIKA 1B3AA 4LNQA 1D1IA 4B3RL 3Q23A 2EE1A 4OWWB 3I70A 3R2IA 2L12A 4L6TB 1VQIA 1Y1WB 2R92G 1LLRD 3ER0A 4K2LA 5D3DA 2WKCA 1BF4A 4RGTA 3E6ZX 1XNRQ 5CV5A 1EIHA 4QIWB 3M85A 4HJ8A 1SYEA 1NCVA 1IZ6A 4RWSC 1Z47A 3J81j 4MN3A 1H9JA 4V0BA 1VQ4A 1WVLA 4BXXG 5ELNA 4EQOA 1IYUA 1EYDA 4CGYB 1KAWA 3CU7A 1NTGA 4IUNA 2ZTDA 2Y0SB 1QG7A 1EYCA 4KHPL 3PMFA 2HHHQ 2K5HA 3IFDA 3T13A 1BBUA 2F0EA 2NVYB 1JOOA 3F1ZA 3RZDB 4I7ZC 1KRTA 3E0JA 1KIXA 1Q81C 1N8RC 1EEFD 4DAYA 1YNXA 1WTHA 4HIDA 4HSPA 3EQLC 4HMIA 1WTWA 5AFWA 4X64L 4DR5Q 1EOTA 2ALYB 4QY7A 4OEMB 2JA5H 2V4DA 1ONLA 4DV1L 1I4QA 4XQQA 2I46A 3K80C 1KDBA 2K5DA 3S1QH 4C1NI 4JYAL 3AYHB 5LMNW 1TS5A 4MNOA 4DF7A 4NDXA 4PMWA 1XX8A 1TU2B 3MHBA 1S5ED 2AWOA 5I4DA 4HAEA 4LF9Q 1B53A 4IPDA 2K5NA 2V1CC 1CKNB 1C0AA 1MJEA 1NE3A 1EL0A 4IUUA 1TXYA 1GUSA 2AUJD 5ELEA 4QJFA 2FMMA 3TZDA 4UY8C 2YYZA 1BO0A 1TVXA 5KYIA 3DUZA 1SE8A 2F0NA 2RKSA 4DK0A 4C3IH 5IYCG 4QL5A 2X6GA 3EBEA 2AQ3B 5DAUA 2KA7A 1VQDA 4L8JA 3HKZB 4A3EB 3QWNA 3S17B 1U5KA 3GD7A 1RIPA 2O2LD 1X6OA 1GO3E 4DK3C 3CCUA 3E9HA 2ZM6Q 1EWIA 3M4OH 3X3MA 4R8NA 1A6XA 3S2DB 3U58A 1ENFA 1SYBA 2BE5D 2XNAC 4N9TA 1W3SA 4C56C 1SNDA 3HGBA 4L63B 1B7YB 4R4TA 5C0XI 4JI4Q 4BY7G 4JBJA 3HZXA 4DK6C 2R92H 3S1NB 2VXWA 1EUJA 1K83B 1PXUA 1NAPA 5EPJA 1U9RA 4QQBX 1FYCA 3I72A 3ND9A 2WAQE 1GD7A 2M2LA 2OWOA 3I55A 1JORA 1EY6A 4GN3B 1PYBA 3UDXA 3GP7A 1RTOA 3A55A 5J22A 1QZHA 4RHRA 2K6AA 3RMHA 2BH2A 4A3CG 4FVMA 1X3FA 2I0QA 1EY8A 3PV0A 1Y8PB 3MFYA 1SFOB 1BCPB 3H0GB 1EFWA 3H91A 4LJZC 3J80L 4B9WA 4A3LG 2KCMA 4JI0L 5FO8B 1STAA 1I3QB 1G91A 2XWJB 3GO5A 1YNJD 2K05A 1D5ZC 1D7QA 5DLQE 4OWXB 3F8TA 3BS1A 2QILA 2HD3A 4X66L 4DV3L 3A7LA 4ZAIA 2GVBA 4BBSH 4R4QA 3EJIA 2F0LA 1CZWA 4K8JA 1TWFB 1JJ2A 1YNNC 1J6QA 2E2DC 5K5PA 1IW7D 2D0PA 4XYQA 4H13C 1TWAH 1N34L 2UXDQ 2PPBC 3FRPB 1IKMA 3CCEA 3MA2B 4DUZL 5IYCH 4APVA 3G4SA 3GTJB 1K73C 3IKJA 1JJGA 3S9WA 4LUVA 4ZLTF 4A3JB 3SVMA 3HOZB 4MIUA 1HNWL 1WYDA 1X32A 4C1NK 3HOXB 2JEAI 3S16H 1G51A 1M1KC 1A8VA 4MHEA 3OHXC 1WFQA 1J8IA 4RH6A 1K9MC 1B4OA 2RCFA 2CWPA 1E7ZA 4OX9L 5T1GA 4HR7B 2BH8A 4DK1A 3EFXD 3HKZG 4A3EG 1WOCA 4XTCS 1LT3D 1F9QA 3LWEA 1Q90A 4A3GB 4JI2L 1JB7A 2E5LL 2WACA 4P75A 4DV3Q 1KQSA 5EAYA 4P72A 4DV6Q 5KNCA 3V96A 1XNQL 1N32L 2JA7G 3UDIA 2HIXA 4HIMA 1CSPA 5IIFA 2NVQB 2KHSA 3Q0AA 4A3CH 3C1EA 3GDEA 3UDFA 4CJ2C 1LABA 3U9SA 2R7FA 1T5XD 1V1PA 2HDMA 5HGTA 1O7LA 4QUCA 2D2CC 3M4PA 5M5WH 1H9SB 1Y1VG 1KABA 4Y7NH 1K3RA 3PF5A 1STYA 3CHBD 2KBNA 1PH9A 1PH3A 2VW9A 3VA7A 2L55A 2N8NA 5KNDA 4LF8L 2WIIB 4IUQA 2Z6BA 5JEAH 1EY9A 2Q8TA 5C0XG 3CQZB 3CXCA 2R93G 4GKKL 1GM5A 1BCPC 1SJED 4L5SA 1A3UA 1HZ9A 4A75A 2JQOA 2K04A 1CA6A 2KCCA 5I6WA 2Q2HA 4NB3A 2DUDA 2IHFA 3MXGA 3B6YA 2J7ZA 1B44D 2JJQA 5BR8L 1DOKA 2E2JB 4ID6A 4OWTB 5CR3A 2PMZE 1D6EC 3W3AA 2B29A 2F4VL 2E5LQ 4JI1L 1ML0D 4K0KQ 1F9PA 3TDQA 3I4MG 2NBFA 3PF4A 5JEAJ 4A3DB 5FOBB 1JWMD 3NE5B 1U0LA 1MKHA 3G48A 3CMEA 1Y14B 4DR6Q 1NBWA 4M1UB 3FHWA 1VQLA 1Y8OB 1NMFA 1EIYB 2EIFA 3T56B 3A5UA 4DR3Q 3DEPA 3CC4A 2F0KA 4JV5L 3I4NG 3J81E 1TQOA 5CC4A 2VUMG 2NTTA 3MC0B 1Q46A 1ZXTA 5HURA 5I9OA 3M3YH 1N9WA 4A93B 2HDLA 1BDOA 1MSHA 1S5FD 5CBAE 4CBVA 2CWAA 1BNZA 3GTQB 4K5VA 1I50B 3BDOA 5M3MB 4DV4L 2DNEA 2J0TD 3TEHB 1KL9A 1Y8NB 4NXML 1S72A 2L5TA 4BA2I 4JI3L 1I4RA 1MIUA 3N52A 2JA7H 5BR8Q 5K36G 2JA6H 4RAUC 3VYRA 1N36L 3HOVG 3D6WA 1HNZQ 3R3OA 4Z9CB 1STHA 3KJOA 1NSNS 1Y1VH 3MZ5A 4A3FH 1VQ6A 3SR1A 1VQKA 4DV2L 3WDNA 2EVBA 3UDGA 3P1HA 3HG9A 1C48A 2IX0A 1K8OA 5E4WC 4JBKA 1EY7A 2NVTB 2XSCA 5C0XH 2JE6I 2R93H 4ZRZA 4A3KG 1X9NA 1V8QA 4A3MG 2L11A 1F2MA 1Q12A 3MVVA 2E2IB 1IBMQ 1KTKA 1F2YA 2KJXA 3PO2B 4CDCC 1HH2P 2XGTA 4ZQ3A 5JPMC 3LNNA 2N55A 5M5XB 2KHJA 1SBBB 1VQJA 2EZVA 2A74C 2PQEA 2I5LX 3RLNA 3MXPA 2BDNA 1IBLQ 3KF8A 2XIWA 4PG3A 1KNEA 1PA6A 2VQFQ 3J7ZC 4KJOA 5IWAQ 1O7ZA 2QDBA 3GTLB 1I6HB 1TWHH 3OMCA 5C0XJ 2CVRA 1PZJD 2RSOA 3H09A 4YY3L 1VQ8A 5KRUA 1RODA 1N36Q 2MO0A 4C2MB 1A15A 3OSOA 5D14A 3CCSA 1BVSA 2F0MA 2KOLA 1X55A 3MTSA 3CRLC 2R6GA 5GADC 2B2VC 5CBEE 5JVG3 5AJ3L 4C3IB 3SGIA 3KLSA 2VZAA 3I4NH 2F0UA 4S3SA 2VUMH 5LMUL
chains in the Genus database with same CATH topology
2SNMA 4KY7A 4WFN3 4FYDA 1FNUA 4QMGA 3S2HB 5C4JB 2E2HB 3K59A 4HCSA 4LAAA 4J1MA 1PFMA 5I9PA 2QEJC 3HP3A 4DAPA 4HN7A 1EIGA 2B2WC 2FFKB 1WD0A 1TY0A 2F0PA 3GQBA 1C4QA 1EU3A 1BCPD 3BDLA 5C3EB 5K36H 4FF1A 3NWSA 4KKTA 1ZYRC 3NHHA 5LL6S 1Q1EA 1LT4D 1GHJA 2R7ZB 2MP1A 2MPMA 2KVMA 3CRKC 4RKLA 4A3BB 1V43A 2E76C 4BS9A 2EY6A 2M9VA 3SE0A 3O13A 1E0BA 1LACA 1HRJA 2WP8J 4IQZA 5D65A 4QCLA 3MXUA 3LX0A 5CV9A 3SK6A 4ZUIA 3QG1A 1ET6A 1IHZA 2HCCA 1ZKOA 1VF5C 5JVH3 5BN3A 5C44B 1A3VA 3LWUA 2TSSA 4HMJA 2L9HA 3H6MA 4BBSB 3RZOB 1PTOB 4IFDI 5KYLA 2B2TA 1CHPD 4XDXA 4K5XA 2XVSA 3S14B 1KNAA 4P2CB 3EVQA 3L3OC 3OIPA 3D4DA 4F88A 3I73A 3H94A 1HA6A 3DWQA 3QJYA 2H4OA 5CGKA 1ZEQX 5C5MA 4CJ0B 1A3TA 5F2DA 3KUPA 2KEEA 3QOLA 1D2BA 3VA5A 3K5MA 2EPBA 1FR3A 2PNRC 4FXKC 3K6OA 3K0YA 5A2QE 1VMPA 1I6VC 1PTOF 3OW7A 5ELBA 3BYYB 3GTGB 4DAVA 3SHLA 1IKLA 2D62A 4R8IA 1HCZA 5FKAC 1S5CD 3ZYYX 3ND8A 2K5WA 1SNQA 4DU9A 3X3NA 1QJOA 5IOCA 2AUKA 4TSSA 4KD4A 2JA8B 4RFBA 3MWYW 5KEEA 4KV6A 3S1MB 3PUXA 2BA1A 5M9OA 4CKBA 3H3VC 1SE3A 4KHZA 4EVOA 4EGVA 4C3HG 1B9NA 1ESRA 5DNFA 4IUVA 2PZUA 1J9OA 4DFAA 4KY6A 3P75A 4G4KA 1TS3A 1Q3LA 2LKVA 3DWPA 5CV4A 1QILA 3BYTB 5KGUA 4HTHA 2FJ2A 4CJ1B 1B9MA 1LTGD 4UAIA 1R4PB 1SAPA 3R2TA 1AFPA 1G2SA 4BY1B 4KD3A 1HQMC 4KY5A 1MBYA 3K5LA 1AZQA 1PTOC 3J80E 1ZYRD 4F7XA 1HXYD 2WINB 1Z7TA 3DM1A 3SK8A 2D5DA 4G57A 2NB0A 5FLXE 3D4RA 1F2LA 4Q5VA 2K01A 5JPNC 4K2KA 2PW7A 2DY7A 3VYUA 1RDPD 4IFDG 2A5HA 1OXTA 4K6DA 1JWUD 4H7BA 3CKIB 3R8BA 4WORA 4FXDA 1O7YA 4U68A 2BDOA 2VNUD 2EY2A 1CM9A 4FNFA 5KIXA 2FINB 2AQ2B 2R61A 3MFGA 2NN6G 3T16A 2WB1B 1AP0A 4B08A 2B8GA 3J7AV 3K7AB 3S1RB 3FKIB 5I2YA 3PIO3 2SOBA 1QNKA 1HQRD 2O4XA 3IFTA 3TSSA 1SMYD 2F0TA 3PO3B 1JCKB 2NUCA 5E4XA 1F77A 5JAVA 4N9PA 1NR2A 5EQ0A 3HOYB 1DXMA 3DEOA 4XQJA 4FP5D 1AEXA 1NR4A 1DD2A 4QF4A 4IALA 1OXUA 2M00A 4K5WA 5C3XA 2LFNA 1BCPF 2OF1A 1L0YB 3VR6A 4CKEA 5C4XB 2B2UC 1RD9D 1Z6HA 3E5SA 3BVMA 4YIJA 1CI3M 4OO1I 1STNA 4NKLA 3V2TA 2EYMA 2A68C 2F0FA 3ONAB 2L0CA 5IGFA 2KCNA 2F4IA 2RDGA 2XWBB 4IFDH 2QCPX 1B2TA 1U4PA 2ZT9C 1F2ZA 3A56A 5CYUA 1HA5A 5EPLA 4K14A 1OXSC 1GUGA 3OPOA 2A6ED 3NTHA 3Q22A 1TKWB 2XN9C 3A8JE 2K1BA 1X3PA 4I65A 3NBIA 4QUFA 1HTPA 4IZ8A 3FDTA 2F0DA 2C5CA 2G9DA 1OXXK 4IFDJ 2WV6D 1HUNA 2YU9B 3OWFA 5EKLA 2MHVA 2X6LA 1SE2A 3RLFA 1UUPA 1EQVA 1EY4A 3SK5A 2LS01 2F0QA 1EQTA 1HTLD 1PTOD 5IT9L 1BR9A 3GV6A 1AN8A 4J8QA 1O80A 1SNOA 2Q8IB 1PRTB 1M8AA 1SYGA 2VB3X 3OWEB 2ZXPA 1LTTD 2BCOA 3R93A 1IYVA 2B63B 2B2YC 3GTKB 2E75C 2H1EA 1STEA 3EA6A 3FEWX 3HRZC 4DGZA 2ICIA 5C4HA 1TWCB 1JQYD 4ME5A 3D6CA 1FNWA 3NTKA 3JAME 4FO2A 2C9OA 4RCOA 2WAQB 3I3CA 1MD2D 1RJTA 1D5XC 2CHBD 3D4WA 1DM0B 1EY5A 4XYOA 2I07B 3K58A 3A8IE 1RF2D 3TP8A 3IAYA 4EQPA 1GUWA 2F0OA 3NP8A 1G291 2EDGA 1T5EA 3GV3A 2B2WA 3PUVA 4TKOB 4OGQC 2IWHA 4OO1G 3J7YW 2JYOA 2RDFA 3URYA 2FMCA 4DNTB 1PLFA 4XT1B 3BVGA 3MAQA 1F9SA 2KUMA 2EYFA 2IPKD 1EFID 3C2PA 3KBXA 3N6RA 2F0JA 3QOJA 1PFNA 2N88A 2OT2A 3SEBA 3QO2A 1BOSA 2JA5B 1S4ZA 1CHQD 3S1QB 1R4QB 1WTQA 3BG3A 1QOHA 2A68D 4G7HC 1F9RA 1B1ZA 4PMBA 1GUTA 4G7OC 2IJ0A 5I2XA 1QNUA 1AW7A 1JOKA 2F0VA 1S5BD 1JWSD 1XXGA 4IURA 2EY5A 4KK7A 1CA5A 3G6JB 3VR3A 4KI0A 1V1OA 2RBMA 1SNPA 4O1NA 3PIP3 1STBA 2EY1A 5JJZA 5LL6X 4WJWA 3BVZA 3NBHA 1VDZA 3M4OB 2GA4B 1Q1BA 4KJNA 2R92B 4X3SA 3FPUB 4OO1H 5BN4A 2O5JC 2TMPA 3RUZA 2F03A 2MJ8A 1IL8A 2G9HD 1DYQA 1WTPA 4RGOS 3KK7A 5FK9C 1CFMA 4LMQD 2LY7A 4IUTA 2SEBD 1XTCD 1LTBD 5EGTA 1HFGA 1QB5D 1MI2A 1LT5D 5CORA 1WTRA 3Q24A 3J7AF 5IGEA 1XYIA 3ITPA 1JICA 1TWAB 3T53B 1KAAA 5EBCA 4X3TA 1SMYC 1TY2A 5ELFA 1I4GA 3FVQA 1EZ6A 1GUOA 1BXTA 1I4PA 1ICWA 3P7JA 3A7AB 2NN6I 1HPCA 3S16B 2F0IA 2IW3A 1SSOA 2KEDA 1QCBD 4ZKCB 1VCIA 4C3IG 1TIID 1JC7A 5EJWA 1S5DD 2Q8RE 1MGSA 4KN4C 3NQIA 1ILQA 1FD7D 3SDZA 1QE6A 2KECA 2RVLA 5DM73 1UEAB 2O5IC 1LTID 3K5NA 2A6HC 1PRTD 1EZ8A 3NTIA 3L9AX 5M5WB 5DEHA 4HCEA 1I4HA 5C4ZA 4Y7NB 1FGBD 1LTRD 4OHJA 2BA0A 2SDFA 2EYOA 4UDUC 3KBGA 1LT6D 1G6ZA 2HUGA 4AYBB 2K03A 4E6IA 2K32A 2A6EC 1U4RA 2IX3A 3BDCA 5J39A 4ZKBB 2J4XA 4CHTB 2PZWA 2QKIC 4RA8A 2MUYA 1XWEA 4ZUJA 1E2WA 1TT2A 4FF3A 1H9MA 1LV9A 5CV6A 3Q6SA 2B2TC 2QF7A 3A54A 4LK1C 4QB4A 2A73B 5A2QL 3D8GA 3W2DA 4J6HA 3TP5A 3U9OA 4TQUS 4FXGC 1HFNA 3M7NA 2B2UA 4CKCA 4JBWA 1LO5D 1NUCA 1JB3A 1DONA 4RHSA 4ZK9B 2FHTA 3DXJC 1SYDA 1D1KA 3M3YB 4FF4A 4X3KA 2K5QA 2NZ1D 1EWHA 1U4MA 5NUCA 3TP6A 1E2VA 3M7GA 4PQXA 2MGSA 4F87A 2NTSA 1H9RA 5IGGA 5COYA 2JA7B 1EY0A 3NK9A 4DNRB 2JA6B 2OEOA 5E3FA 2XRSD 1WTVA 5G3LF 3ERQA 4R9WA 5IODA 1Y1VB 3RD4A 4JK1C 4A3FB 2BOSA 4RGNA 3TBIB 2F3VA 2X69A 4G7ZC 1BBXC 3P20A 1JOQA 2R93B 2K28A 1OXVA 1CTMA 3QB3A 1CZGA 4H0LC 3DHQA 1VMCA 1II3A 1TR5A 3FPPA 3VR5A 5EKIA 4O42A 2LMCB 4GZYC 1ILPA 1PMRA 3AB9A 2NYZD 4WRDA 1PDQA 5JEAG 5FO9B 3WOEA 2A69D 1PYWD 2NWGA 5JOBA 1KLGD 5FLXL 3I4MB 1GUNA 1TWHB 1DOMA 4NW2A 5KNBA 1I4XA 5J1ZA 4XQNA 4DXFA 1PTOH 2B2YA 5I6YA 4PMCA 2OXPA 4ZYSA 3KLRA 5IT9E 2F3WA 4KHVA 3I4NB 1CQFA 4KKUA 1CK1A 2VUMB 4F8MA 2A6HD 1GXDC 5ELCA 3MXNA 1RKNA 3DMUA 3PUYA 2DNCA 2WKDA 3EROA 3I90A 1ESFA 1GOZA 1TS2A 3A8KE 5ISRA 4M8AA 3V05A 2F0WA 4V190 3NWTA 2IX1A 1V1PB 1G8ZD 3HOVB 1ET9A 2NN6H 2JP1A 3GTMB 2KQ3A 1UNSA 1SNCA 1DJRD 3T4AC 1RTNA 1ENAA 2E74C 1G2TA 4OIKA 1UAPA 1PFBA 5LHY1 2ENBA 3NXWA 3T51B 3C46A 4NMZA 4BWGB 3SXHA 4A3KB 1SXTA 4A3MB 1TS4A 3S15B 2AWNA 4XXEA 3D3RA 1A2TA 4KTAA 1H9SA 4H44C 2R3ZA 4IUPA 4ODGA 5IGCA 3WOFA 3HEJA 1RHPA 3F2UA 1K8MA 1RCVD 1Q8IA 3TMEA 2EXZA 5EKKA 5FO7B 1D5MC 2F0HA 3HS0C 2EJGC 2HCIA 1WD1A 3VYTA 1SYFA 2RDHA 1WTOA 2IT1A 1BUVT 1Y69U 1GHKA 4TRDA 4XT3B 1CQVA 4FF2A 1PRTF 5CV8A 1SYCA 4PNYA 3I8ZA 5M5YB 1M4VA 2B2VA 1C8CA 4EQNA 2Z8LA 2EYPA 2EJFC 3TP7A 5C6AA 4ABNA 2NVXB 1E2ZA 1KLUD 1BQQT 1X3QA 1AZPA 3MEHA 4DN4M 2PCFB 1PZKD 3IL8A 1QWYA 2RQXA 2D9UA 2XRQD 1ENCA 2Z4IA 3NUCA 3NQTA 1JE4A 4RGMA 1EYAA 1W6KA 2F0SA 2RSNA 2Z1CA 2B39A 4OIJA 3HOUB 3K5OA 3QIAA 4HSVA 3TZUA 2CW0C 1DOLA 5C5LA 4ILWA 5ELDA 2L4NA 2F1MA 3DWAA 1R9TB 1YNND 3OOCA 5T1IA 1TWGB 5TSSA 4PV1C 1W6JA 3SK4A 3TN2A 1DCZA 3L7ZC 2JEBI 2ICEC 1EWCA 1H9KA 3FMCA 3G7LA 4ULLA 1EU4A 5A35A 2EOTA 3JAML 1PRTC 4BA1I 5G3LD 4HEDA 1B50A 3I91A 3J81L 3AMUA 1HUMA 2DY8A 5E1FA 5DM63 4Q0FA 4RCNA 2EYLA 1SNMA 2B8FA 4C3JB 3HOWB 2F0GA 3C3LA 5EPKA 3OMGA 4X3UA 1LTAD 5BN5A 3M4YA 1HHVA 5D3IB 4BBRB 4KKSA 1JR0D 3K57A 1A2UA 4KN7C 3AU7A 3NSWA 3I4LA 1O78A 3VR4A 1U4LA 1SDFA 2K7VA 4XIGS 2SNSA 2EYHA 1CT1D 4RKBA 2ZXRA 5CV7A 1STGA 2EYJA 4IN3A 3VYSA 3OIQA 5EBDA 2AQ1B 1L0XB 2CQAA 2RA4A 2PW5A 2JSOA 2L1BA 2PMZB 1KDCA 1EEID 1VF7A 1LTSD 4OL7A 1DZ1A 3PUWA 4C3HB 2IL8A 3KLSX 4B9XA 3PUZA 1WCMB 2BE5C 2PO4A 1MSGA 2VB2X 4K6LA 2ZXOA 3GTOB 5C3WA 3NPPA 3UI2A 2K33A 4DA2A 2ID0A 2DN8A 1OO9B 2Z4HA 3C1FA 1SE4A 5IGDA 1SEBD 5IGBA 1SJHD 5CMDA 2PZTA 2HQEA 2EJMA 1WTXA 1PZID 2PYKA 3D31A 2CW0D 4C3JG 1YNJC 2A69C 3GTPB 3VR2A 1FNVA 4K8IA 4DXGA 4A3IB 1GJXA 4BY7B 5M3FB 4NP5A 3BZDB 4KMUC 4U673 1IW7C 2JXMB 1KDAA 1B3AA 1D1IA 3Q23A 2EE1A 3I70A 3R2IA 2L12A 4L6TB 1Y1WB 1LLRD 4K2LA 5D3DA 2WKCA 1BF4A 4RGTA 3E6ZX 5CV5A 1EIHA 4QIWB 3M85A 1SYEA 1NCVA 4RWSC 1Z47A 4MN3A 1H9JA 4V0BA 1WVLA 4EQOA 1IYUA 1EYDA 4CGYB 3CU7A 4IUNA 2Y0SB 1QG7A 1EYCA 3PMFA 3RZDB 3IFDA 3T13A 2NVYB 2F0EA 1JOOA 4I7ZC 3E0JA 1EEFD 4DAYA 1WTWA 4HSPA 3EQLC 4HMIA 5AFWA 1EOTA 2V4DA 1ONLA 1I4QA 4XQQA 2I46A 1KDBA 2K5DA 4C1NI 1TS5A 4DF7A 4NDXA 4PMWA 1XX8A 1TU2B 3MHBA 1S5ED 2AWOA 5I4DA 4HAEA 1B53A 1EL0A 4IUUA 1GUSA 2AUJD 5ELEA 2FMMA 3TZDA 2YYZA 1BO0A 1TVXA 5KYIA 3DUZA 2F0NA 2RKSA 4DK0A 2X6GA 5DAUA 2AQ3B 2KA7A 4L8JA 3HKZB 4A3EB 3QWNA 3S17B 3GD7A 2O2LD 3X3MA 4R8NA 1A6XA 3S2DB 1ENFA 1SYBA 2BE5D 2XNAC 4N9TA 4C56C 1SNDA 3HGBA 4L63B 5C0XI 3HZXA 3S1NB 2VXWA 1K83B 1PXUA 1NAPA 5EPJA 1U9RA 1FYCA 3I72A 3ND9A 2M2LA 1JORA 1EY6A 3GP7A 1RTOA 3A55A 5J22A 4RHRA 2K6AA 3RMHA 4FVMA 1EY8A 3PV0A 1Y8PB 3MFYA 1SFOB 1BCPB 3H0GB 3H91A 4LJZC 3J80L 4B9WA 5FO8B 1STAA 1I3QB 1G91A 2XWJB 3GO5A 1YNJD 2K05A 1D5ZC 3BS1A 2QILA 3A7LA 4ZAIA 3EJIA 2F0LA 1CZWA 4K8JA 1TWFB 1YNNC 5K5PA 2E2DC 1IW7D 4XYQA 4H13C 2PPBC 3FRPB 1IKMA 3MA2B 3GTJB 3IKJA 3S9WA 4ZLTF 4A3JB 3SVMA 3HOZB 4MIUA 1X32A 4C1NK 3HOXB 2JEAI 4MHEA 3OHXC 1J8IA 4RH6A 1B4OA 5T1GA 4HR7B 4DK1A 3EFXD 4XTCS 1LT3D 1F9QA 3LWEA 1Q90A 4A3GB 2WACA 5KNCA 3V96A 5IIFA 2NVQB 2KHSA 3Q0AA 3C1EA 4CJ2C 1LABA 3U9SA 1T5XD 1V1PA 2HDMA 5HGTA 1O7LA 4QUCA 2D2CC 1H9SB 1KABA 1STYA 3CHBD 3VA7A 2L55A 5KNDA 2WIIB 4IUQA 5JEAH 1EY9A 2Q8TA 5C0XG 3CQZB 1BCPC 1SJED 1A3UA 1CA6A 2K04A 2KCCA 5I6WA 3MXGA 2J7ZA 1B44D 1DOKA 2E2JB 4ID6A 5CR3A 1D6EC 3W3AA 1ML0D 1F9PA 3TDQA 2NBFA 5JEAJ 4A3DB 5FOBB 1JWMD 3NE5B 4M1UB 1Y8OB 3T56B 3DEPA 2F0KA 3J81E 1TQOA 5CC4A 2NTTA 3MC0B 1ZXTA 5HURA 5I9OA 4A93B 2HDLA 1BDOA 1MSHA 1S5FD 5CBAE 4CBVA 1BNZA 3GTQB 4K5VA 1I50B 3BDOA 5M3MB 2DNEA 2J0TD 1Y8NB 2L5TA 4BA2I 1I4RA 3N52A 5K36G 4RAUC 3VYRA 3D6WA 3R3OA 4Z9CB 1STHA 1NSNS 3MZ5A 3SR1A 3WDNA 2EVBA 3P1HA 3HG9A 1C48A 2IX0A 1K8OA 5E4WC 1EY7A 2NVTB 2XSCA 5C0XH 2JE6I 4ZRZA 1V8QA 2L11A 1F2MA 1Q12A 3MVVA 2E2IB 1KTKA 1F2YA 2KJXA 3PO2B 4ZQ3A 5JPMC 3LNNA 2N55A 5M5XB 1SBBB 2EZVA 2A74C 2PQEA 3MXPA 2BDNA 3KF8A 2XIWA 1KNEA 4KJOA 1O7ZA 2QDBA 3GTLB 1I6HB 3OMCA 5C0XJ 2CVRA 1PZJD 2RSOA 3H09A 5KRUA 1RODA 4C2MB 1A15A 3OSOA 5D14A 2F0MA 2KOLA 3MTSA 3CRLC 2R6GA 2B2VC 5CBEE 5JVG3 4C3IB 3KLSA 2F0UA 4S3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYB A;  2SNM A;  4KY7 A;  3QB3 A;  5I9O A;  4N9T A;  4PMB A;  5C5M A;  3DHQ A;  3BDC A;  5J39 A;  4QMG A;  1SND A;  5IGE A;  2PW5 A;  1A3T A;  5F2D A;  1II3 A;  2PZW A;  3HZX A;  4K2L A;  4F7X A;  3QOL A;  4DGZ A;  3E5S A;  4K5V A;  1JOK A;  1U9R A;  4LAA A;  3ITP A;  2F0V A;  1TR5 A;  1KDC A;  4J1M A;  5CV5 A;  3SK8 A;  5C4H A;  3VA5 A;  1A2T A;  4KTA A;  1SYE A;  2WAC A;  4G57 A;  4YIJ A;  4ME5 A;  5I9P A;  2EY5 A;  4ZUJ A;  4OL7 A;  1TT2 A;  3D6C A;  1JOR A;  4WRD A;  1STN A;  1EY6 A;  3SK4 A;  1KAA A;  4EQO A;  4NKL A;  4ODG A;  5IGC A;  5J22 A;  1EYD A;  4K2K A;  2PW7 A;  5CV6 A;  2EYM A;  3V2T A;  3HEJ A;  2F0P A;  5JOB A;  4B9X A;  5IIF A;  2KHS A;  4IUN A;  2F0F A;  4QB4 A;  5IGF A;  3C1E A;  1EY8 A;  3BDL A;  1EYC A;  3D8G A;  2RBM A;  3PMF A;  1EZ6 A;  1SNP A;  4K6D A;  3T13 A;  2F0E A;  3TME A;  1JOO A;  2EXZ A;  4H7B A;  5EKK A;  4J6H A;  3SHL A;  5J1Z A;  1F2Z A;  3NHH A;  2F0H A;  5HGT A;  3R3O A;  3TP5 A;  5C3W A;  5E1F A;  1STB A;  1STH A;  1NSN S;  4WOR A;  3U9O A;  1KAB A;  3D4W A;  3MZ5 A;  5I6Y A;  2EY1 A;  1STY A;  1EY5 A;  2OXP A;  4K14 A;  4PMC A;  4HMI A;  3SR1 A;  4B9W A;  1SYF A;  2F0I A;  2EYL A;  2EY2 A;  3TP8 A;  3P1H A;  1SNM A;  4S3S A;  5KIX A;  1STA A;  4RKL A;  4EQP A;  4TRD A;  2F3W A;  1NUC A;  4KHV A;  1KDB A;  2F0G A;  2F0O A;  1SNQ A;  2EY6 A;  1EY9 A;  3NP8 A;  1SYD A;  4DU9 A;  1EY7 A;  4F8M A;  3OMG A;  4DF7 A;  5IOC A;  4NDX A;  5CV8 A;  1SYC A;  4KJN A;  4PNY A;  3C1F A;  1RKN A;  4I65 A;  3MHB A;  3T16 A;  4KD4 A;  3DMU A;  1A3U A;  4IZ8 A;  5IGD A;  5KEE A;  5IGB A;  4KV6 A;  1F2M A;  2F0D A;  5I6W A;  2PZT A;  3MVV A;  4EQN A;  3EJI A;  5M9O A;  2F0L A;  5NUC A;  3TP6 A;  2HQE A;  1F2Y A;  3ERO A;  4K8J A;  2EYP A;  3TP7 A;  2RDF A;  5C6A A;  5K5P A;  4ZQ3 A;  3LX0 A;  5CV9 A;  3RUZ A;  4ID6 A;  3SK6 A;  2SOB A;  3OWF A;  4ZUI A;  5EKL A;  5IGG A;  2PYK A;  1IHZ A;  2O4X A;  3MEH A;  4EVO A;  5CR3 A;  1A2U A;  1EY0 A;  2F0T A;  3NK9 A;  2PQE A;  5ISR A;  4NMZ A;  5KYI A;  1EQV A;  1EY4 A;  3MXP A;  1A3V A;  3SK5 A;  2F0W A;  2NUC A;  2OEO A;  2F0Q A;  2PZU A;  2F0N A;  2RKS A;  4HMJ A;  4KJO A;  5E3F A;  4DFA A;  2EYF A;  4KY6 A;  1ENC A;  4K8I A;  2QDB A;  3H6M A;  3NUC A;  5DAU A;  3ERQ A;  4N9P A;  3P75 A;  5IOD A;  1EZ8 A;  3NQT A;  2LKV A;  3OMC A;  1EYA A;  2KQ3 A;  5CV4 A;  5DEH A;  1SNC A;  1SNO A;  2F0J A;  2F0S A;  5C4Z A;  4NP5 A;  5KGU A;  5KYL A;  3QOJ A;  1SYG A;  4HTH A;  5JAV A;  3S9W A;  2EYO A;  5KRU A;  4K5X A;  1ENA A;  4MIU A;  1AEX A;  2EYH A;  2SNS A;  3OSO A;  2F3V A;  3EVQ A;  4RKB A;  5EGT A;  2F0M A;  4QF4 A;  4IAL A;  3D4D A;  5CV7 A;  1STG A;  1KDA A;  5C5L A;  2EYJ A;  2F0K A;  2ENB A;  2M00 A;  3NXW A;  1JOQ A;  4K5W A;  4E6I A;  5C3X A;  4KD3 A;  1TQO A;  4R8N A;  4KY5 A;  5CC4 A;  2F0U A;  2OF1 A;  5CGK A;  5HUR A;  3SXH A; 
#chains in the Genus database with same CATH topology
 3TRE A;  2SNM A;  4KY7 A;  1KD1 C;  4WFN 3;  4FYD A;  1FNU A;  4QMG A;  3S2H B;  1Q82 C;  5C4J B;  2E2H B;  3K59 A;  1CUK A;  4HCS A;  4LAA A;  4J1M A;  1PFM A;  5I9P A;  2QEJ C;  3HP3 A;  4DAP A;  4HN7 A;  1GKH A;  1EIG A;  1UE7 A;  4JI6 L;  2B2W C;  2FFK B;  1WD0 A;  1VQ7 A;  1TY0 A;  1QUQ B;  2IY5 B;  2F0P A;  3GQB A;  1N33 L;  1C4Q A;  1EU3 A;  1BCP D;  3BDL A;  5C3E B;  4GNX B;  1M90 C;  5K36 H;  4N8F A;  1K0R A;  4FF1 A;  3NWS A;  4A93 G;  4KKT A;  3BZK A;  3AEV A;  1ZYR C;  3NHH A;  2K75 A;  5LL6 S;  5GAE C;  3GTM H;  1Q1E A;  1NY4 A;  5GAH C;  1JT8 A;  3U4Z A;  1LT4 D;  1I94 L;  1GHJ A;  3HKZ E;  2R7Z B;  2MP1 A;  5HGQ A;  5JJK A;  2MPM A;  3HOU G;  2KVM A;  3CRK C;  4DV2 Q;  4RKL A;  4A3B B;  2QDL A;  4A76 A;  1V43 A;  2E76 C;  5GQO A;  4BS9 A;  2EY6 A;  2M9V A;  3SE0 A;  4ZCK A;  3O13 A;  2R7D A;  4A3K H;  2ZTC A;  4A3M H;  3S15 H;  1E0B A;  1LAC A;  1HRJ A;  2WP8 J;  4IQZ A;  5D65 A;  4QCL A;  3MXU A;  3LX0 A;  5CV9 A;  3SK6 A;  4ZUI A;  3QG1 A;  1ET6 A;  1IHZ A;  2HCC A;  3KF6 A;  1ZKO A;  4DUY Q;  1VF5 C;  5JVH 3;  5BN3 A;  1FVI A;  3TRZ A;  5C44 B;  1A3V A;  3LWU A;  2TSS A;  4HMJ A;  2L9H A;  3H6M A;  4BBS B;  3RZO B;  1PTO B;  1HNX L;  3KDF B;  4IFD I;  5KYL A;  1N33 Q;  2B2T A;  4P71 A;  1CHP D;  3W1G A;  4XDX A;  4K5X A;  4O0A A;  2XVS A;  3S14 B;  1KNA A;  3A0J A;  3EVQ A;  3L3O C;  1SMX A;  3OIP A;  4P2C B;  4YCV A;  4QGU A;  3D4D A;  4F88 A;  3I73 A;  3H94 A;  1HA6 A;  3DWQ A;  3QJY A;  1HR0 Q;  3HOW G;  2H4O A;  1HR0 W;  5CGK A;  3CAM A;  4JCV E;  1ZEQ X;  4MTK A;  5C5M A;  4YCW A;  4CJ0 B;  2PQA A;  3W1B A;  1A3T A;  5F2D A;  5M5Y H;  1XMQ L;  2GVA A;  3I7F A;  3KUP A;  2KEE A;  3QOL A;  1D2B A;  3VA5 A;  3K5M A;  2EPB A;  4GOP C;  1FR3 A;  2PNR C;  4FXK C;  2OCE A;  3T1Y L;  2NVX H;  3K6O A;  3K0Y A;  5A2Q E;  1VMP A;  4LWC A;  1I6V C;  2UXB L;  1PTO F;  3OW7 A;  5ELB A;  4GLX A;  4YWL A;  2F3I A;  3BYY B;  4LFA L;  3GTG B;  3S24 A;  4DAV A;  3SHL A;  1IKL A;  5LMN L;  2I5H A;  2D62 A;  4R8I A;  1HCZ A;  5FKA C;  1YBY A;  3G6E A;  1S5C D;  3ZYY X;  3ND8 A;  2K5W A;  4B3T L;  3HOU H;  4JI5 L;  2DJG C;  1SNQ A;  4DU9 A;  3X3N A;  1QJO A;  5IOC A;  4R4I A;  2AUK A;  4DAY B;  5C3E G;  4TSS A;  2RCN A;  4KD4 A;  1PH7 A;  2JA8 B;  4RFB A;  3MWY W;  5KEE A;  4KV6 A;  3S1M B;  1YHB A;  3PUX A;  1YJW A;  2BA1 A;  1PYS B;  1WI5 A;  5M9O A;  4CKB A;  1VS0 A;  1C9O A;  2UUA L;  3CF5 A;  3H3V C;  1SE3 A;  4KHZ A;  1TWG H;  2Q2I A;  1YVC A;  1B3Q A;  4EVO A;  4EGV A;  4C3H G;  1B9N A;  1ESR A;  5DNF A;  4LF5 Q;  4IUV A;  1UE5 A;  4DV5 L;  4B3S Q;  2PZU A;  1J9O A;  4DFA A;  4KY6 A;  3P75 A;  4G4K A;  1TS3 A;  1Q3L A;  1WCM G;  2LKV A;  3DWP A;  2PNH A;  1QIL A;  5CV4 A;  4GKJ L;  3BYT B;  5KGU A;  1NMG A;  4FDB A;  4HTH A;  2FJ2 A;  4CJ1 B;  2VQE L;  4B3R Q;  1SR3 A;  1B9M A;  1LTG D;  4UAI A;  1R4P B;  1SAP A;  1S3O A;  3R2T A;  1AFP A;  1G2S A;  4BY1 B;  4OEL B;  4C3J H;  5C44 G;  4KD3 A;  1HQM C;  4KY5 A;  5IT9 c;  2YV5 A;  3HOW H;  1MBY A;  1KRS A;  3K5L A;  1K0S A;  1AZQ A;  1PTO C;  4B3T Q;  3J80 E;  3CCM A;  2IHE A;  3RLO A;  1ZYR D;  4F7X A;  1HXY D;  2WIN B;  4A4I A;  1Q8K A;  1Z7T A;  3DM1 A;  3SK8 A;  2D5D A;  4G57 A;  4KHP Q;  2NB0 A;  5FLX E;  3D4R A;  4BBR H;  1CKM A;  1F2L A;  4Q5V A;  4X65 L;  2Q2U A;  2K01 A;  2UUA Q;  5JPN C;  4MZ9 A;  4K2K A;  2PW7 A;  2DY7 A;  3VYU A;  1T9H A;  1RDP D;  4X64 Q;  4AQY L;  4IFD G;  2A5H A;  1OXT A;  4K6D A;  1JWU D;  4DV1 Q;  4H7B A;  3CKI B;  4A3I G;  4RG1 A;  3R8B A;  4DPG A;  4JYA Q;  5M3F G;  4NPS A;  4WOR A;  4FXD A;  1O7Y A;  2N3S A;  5IY0 A;  1X65 A;  4U68 A;  1L0W A;  2BDO A;  2VNU D;  2EY2 A;  1CM9 A;  4FNF A;  4PZ6 A;  5KIX A;  3NEL A;  2VQE Q;  5H1S E;  4KLK A;  2FIN B;  2KEN A;  2AQ2 B;  4BXX H;  3AFQ A;  1KHI A;  3CC7 A;  2R61 A;  3MFG A;  1NJI C;  1LTL A;  1C7Y A;  2NN6 G;  4R1J A;  3T16 A;  2WB1 B;  1AP0 A;  4B08 A;  1Y1W G;  2B8G A;  3J7A V;  3K7A B;  3NEN A;  3S1R B;  3FKI B;  2RHS B;  5I2Y A;  3PIO 3;  2SOB A;  4UP8 A;  1QNK A;  1HQR D;  2O4X A;  3K81 C;  3IFT A;  3AQQ A;  3TSS A;  1SMY D;  2F0T A;  3PO3 B;  1JCK B;  4C3H H;  2NUC A;  5E4X A;  1F77 A;  1RL2 A;  5JAV A;  4GLA C;  1X56 A;  2Y0S G;  3ERS X;  4N9P A;  1NR2 A;  1VQC A;  5EQ0 A;  4X65 Q;  2JA8 G;  3TS0 A;  3HOY B;  1WCM H;  3MEF A;  1Q86 C;  4TVA B;  1DXM A;  3DEO A;  1FJG L;  1K3B C;  4XQJ A;  4DV0 L;  4FP5 D;  3GTO H;  4HJ5 A;  3CCJ A;  4LFB L;  1AEX A;  1NR4 A;  2CH4 W;  1DD2 A;  1UEB A;  4QF4 A;  4IAL A;  1D8L A;  2ASB A;  1OXU A;  3MXN B;  2M00 A;  1VQ5 A;  3KFU A;  2Z9H A;  4K5W A;  5C3X A;  2KHI A;  2LFN A;  1BCP F;  2OF1 A;  1L0Y B;  3VR6 A;  4CKE A;  5C4X B;  4IO9 A;  2B2U C;  3FP9 A;  1RD9 D;  1HJP A;  1Z6H A;  3E5S A;  3BVM A;  4LUZ A;  1E3P A;  3UE1 A;  4YIJ A;  1CI3 M;  4OO1 I;  1LYL A;  1STN A;  4NKL A;  1B70 B;  2FXQ A;  3V2T A;  2EYM A;  4B3M L;  3CPW A;  3D0F A;  2A68 C;  2F0F A;  3ONA B;  2L0C A;  5IGF A;  2KCN A;  2F4I A;  2RDG A;  4Y52 H;  2XWB B;  4IFD H;  2QCP X;  4JI0 Q;  3GTP H;  1B2T A;  1S40 A;  1U4P A;  2ZT9 C;  1F2Z A;  4A3I H;  3A56 A;  4BY7 H;  5CYU A;  1HA5 A;  3DM3 A;  5EPL A;  4K14 A;  1OXS C;  4X66 Q;  1GUG A;  4JW0 A;  3OPO A;  4JPB W;  4DV0 Q;  2A6E D;  3NTH A;  3Q22 A;  1TKW B;  3F2B A;  1PH5 A;  2XN9 C;  3A8J E;  2K1B A;  4IPC A;  1X3P A;  4I65 A;  3NBI A;  3I56 A;  1J5E L;  4QUF A;  1HTP A;  4IZ8 A;  1N34 Q;  3M9B A;  3FDT A;  2F0D A;  2C5C A;  2G9D A;  1OXX K;  3JC6 6;  4IFD J;  3F2D A;  3EIV A;  3E3X A;  4DUZ Q;  2WV6 D;  2CH4 A;  1HUN A;  2YU9 B;  3OWF A;  3U50 C;  5EKL A;  4DV7 L;  2MHV A;  2X6L A;  4N8X 1;  1SE2 A;  4A3L H;  3RLF A;  1LM0 A;  1UUP A;  4IJH A;  1EQV A;  1EY4 A;  4JOI C;  3SK5 A;  3IRB A;  2LS0 1;  2F0Q A;  1PH1 A;  1HNW Q;  1EIF A;  1YHA A;  1EQT A;  1HTL D;  1PTO D;  3CPF A;  4IOA A;  5IT9 L;  5E7N A;  1BR9 A;  3GV6 A;  1AN8 A;  4J8Q A;  4YHH L;  3RZD H;  2NVY H;  1O80 A;  1SNO A;  2Q8I B;  1PRT B;  1M8A A;  1SYG A;  3H0G G;  4LFC L;  4OX9 Q;  2VB3 X;  2CQO A;  3OWE B;  2K4K A;  4YCU A;  2UU9 L;  1CKO A;  2ZXP A;  1LTT D;  2BCO A;  3R93 A;  5IP7 G;  1IYV A;  4JI2 Q;  3ULP A;  2B63 B;  2B2Y C;  3GTK B;  2E75 C;  2H1E A;  1STE A;  3EA6 A;  2DJF C;  3FEW X;  1XNQ Q;  1N32 Q;  3HRZ C;  1O7I A;  2AKW B;  4DGZ A;  2NZO A;  2ICI A;  2HQL A;  5FLM G;  5C4H A;  1TWC B;  1JQY D;  4X62 L;  1W2B A;  1QVG A;  4ME5 A;  3D6C A;  3ULL A;  2JK8 A;  4RMF A;  1YJN A;  1FNW A;  3NTK A;  3JAM E;  4IOC A;  1IBK L;  4FO2 A;  2C9O A;  3I4O A;  4RCO A;  4LF8 Q;  2WAQ B;  4LF4 L;  1DGS A;  4DAM A;  3I3C A;  1MD2 D;  2CCZ A;  4A3E H;  3S17 H;  1RJT A;  1KXL A;  1D5X C;  2CHB D;  3D4W A;  1DM0 B;  1EY5 A;  4GKK Q;  1A63 A;  4A3J G;  4XYO A;  3HOZ G;  2I07 B;  3K58 A;  3A8I E;  3OTO L;  1RF2 D;  3TP8 A;  4DR2 L;  3HOX G;  3IAY A;  4EQP A;  1GUW A;  4LFC Q;  2F0O A;  3ZJY C;  3NP8 A;  2ES2 A;  2N49 A;  1KC8 C;  3S2D H;  1G29 1;  3T1H L;  2EDG A;  1T5E A;  3GV3 A;  2B2W A;  3PUV A;  4TKO B;  4OGQ C;  2F4V Q;  4JI1 Q;  4JI8 L;  2IWH A;  4OO1 G;  3S1N H;  3J7Y W;  2JYO A;  2RDF A;  3URY A;  3I2Z A;  4A3G G;  3CW2 C;  2FMC A;  1HZB A;  4DNT B;  1PLF A;  4XT1 B;  3BVG A;  1ASY A;  3TS2 A;  4DKA C;  4X62 Q;  3MAQ A;  3L0O A;  1F9S A;  2KUM A;  3CD6 A;  2EYF A;  5ELO A;  2IPK D;  3PCO B;  1EFI D;  4JC0 A;  3C2P A;  4LUO A;  3KBX A;  3N6R A;  4JV5 Q;  1IXR A;  2F0J A;  3K0X A;  3PIP A;  1SFO H;  3QR8 A;  3QOJ A;  1PFN A;  4LF7 L;  1YI2 A;  2N88 A;  4DR7 L;  2OT2 A;  3H0G H;  3SEB A;  3QO2 A;  1BOS A;  2JA5 B;  3KF8 B;  1S4Z A;  2OTL A;  1CHQ D;  4L5Q A;  3S1Q B;  1R4Q B;  1WTQ A;  5IP7 H;  1I3Q H;  4QIW E;  4CDE C;  3BG3 A;  1QOH A;  2A68 D;  4DV4 Q;  1AE2 A;  3OTO Q;  4G7H C;  1F9R A;  1B1Z A;  4PMB A;  4NXM Q;  3I4M H;  3A5Z B;  1GUT A;  4JI3 Q;  4G7O C;  2IJ0 A;  4X6A H;  5I2X A;  1QNU A;  1AW7 A;  1JOK A;  2Y0S E;  3F2C A;  2F0V A;  2PI2 E;  1XMO L;  1S5B D;  1EQR A;  1JWS D;  1TWF H;  1XXG A;  4IUR A;  4YWM A;  2EY5 A;  4L5T A;  4DR4 L;  4KK7 A;  1CA5 A;  3G6J B;  3VR3 A;  1P8L A;  1YIT A;  4KI0 A;  1V1O A;  2RBM A;  1SNP A;  4O1N A;  4A3D G;  3PIP 3;  3K7U C;  1STB A;  3GTJ H;  2EY1 A;  5JJZ A;  1G6P A;  5LL6 X;  4A3J H;  3HOZ H;  4WJW A;  4J15 A;  1L1O B;  3BVZ A;  3NBH A;  1MJC A;  1VDZ A;  3M4O B;  3HOX H;  4LF7 Q;  1VQA A;  1PVO A;  4NXN L;  2GA4 B;  2QW7 A;  2RHQ B;  4GOP A;  1Q1B A;  5IE8 A;  3H3V I;  2MFI A;  4KJN A;  1YZ6 A;  2QEX A;  2R92 B;  2F52 A;  1PFS A;  3HOV H;  4X3S A;  3FPU B;  4OO1 H;  1LUZ A;  5BN4 A;  2O5J C;  2TMP A;  3RUZ A;  2F03 A;  4A3G H;  5M3M G;  5IYD G;  2QGQ A;  2YTX A;  2MJ8 A;  1IL8 A;  1EOV A;  2G9H D;  1Z9F A;  1DYQ A;  1X3E A;  4YY3 Q;  1WTP A;  2WFW A;  4RGO S;  4JI7 L;  3KK7 A;  1XPU A;  4EQ5 A;  2N78 A;  2NVQ H;  3BJU A;  5FK9 C;  2OTJ A;  1CFM A;  1VQE A;  4LMQ D;  1V1Q A;  3NEM A;  2LY7 A;  5AJ3 Q;  4GS3 A;  4IUT A;  2SEB D;  1P16 A;  5LMU Q;  1XTC D;  1LTB D;  5EGT A;  3JAM i;  1ASZ A;  1HFG A;  1PH2 A;  3J81 i;  1QB5 D;  1MI2 A;  1LT5 D;  5COR A;  1WTR A;  3CQZ H;  1Q7Y C;  3Q24 A;  4JI6 Q;  5IGE A;  4LF6 L;  3J7A F;  4CDF C;  4UP9 A;  1UWV A;  3ULJ A;  3E9I A;  3STB C;  1XJV A;  4PZ8 A;  1XYI A;  3ITP A;  3PO2 G;  1JIC A;  4HJ9 A;  1TWA B;  3T53 B;  2E2J H;  2XTI A;  2B3G A;  1KAA A;  5EBC A;  4X3T A;  3BZC A;  1I94 Q;  1SMY C;  2VL6 A;  2PQA B;  1TY2 A;  2UXC L;  5ELF A;  1XNR L;  1VQN A;  1I4G A;  3FVQ A;  1EZ6 A;  1GUO A;  1B8A A;  1BXT A;  1E22 A;  1QVC A;  1I4P A;  4P74 A;  2CKZ B;  1ICW A;  5L37 A;  3P7J A;  3CMA A;  3A7A B;  2NN6 I;  3KDF A;  3UE0 A;  1SLJ A;  1HPC A;  3S16 B;  2F0I A;  2IW3 A;  2HHH L;  1SSO A;  1VQH A;  2KED A;  5FLX c;  1QCB D;  4ZKC B;  1VCI A;  4C3I G;  1TII D;  2UUB L;  1JC7 A;  5EJW A;  1S5D D;  3RN5 A;  2OQK A;  2ZTE A;  4DR5 L;  2Q8R E;  4A93 H;  1MGS A;  4KN4 C;  3WWV A;  3NQI A;  1ILQ A;  3GTQ H;  1FD7 D;  1I50 H;  1L1O C;  3SDZ A;  1QE6 A;  2KEC A;  2RVL A;  2UUC L;  4H02 A;  2NZH A;  5DM7 3;  5M3M H;  1HNX Q;  3EN2 A;  1UEA B;  2EXD A;  2O5I C;  3RN2 A;  4LF9 L;  1CSQ A;  1LTI D;  4JVZ A;  4GNX C;  1OTC A;  3K5N A;  2A6H C;  1PRT D;  1E1T A;  1EZ8 A;  3NTI A;  3L9A X;  5M5W B;  5DEH A;  4HCE A;  1I4H A;  4GN5 A;  5C4Z A;  4Y7N B;  1FGB D;  2QA4 A;  1NNX A;  2UXC Q;  1LTR D;  4OHJ A;  2BA0 A;  2VY3 A;  2SDF A;  2EYO A;  1R9T H;  4WJ3 M;  4UDU C;  3KBG A;  1LT6 D;  1G6Z A;  1K28 A;  2R7Z G;  1XMQ Q;  2HUG A;  4AYB B;  4A3B G;  3Q8D A;  2K03 A;  4E6I A;  2K32 A;  2ZJP A;  2A6E C;  2OQ0 A;  2Q2T A;  3T1Y Q;  4HIO A;  1VQ9 A;  2NVT H;  1U4R A;  2IX3 A;  4ALP A;  3BDC A;  5J39 A;  4ZKB B;  4ME3 A;  2J4X A;  2UXB Q;  4CHT B;  2PZW A;  2QKI C;  2PI2 A;  2ZM6 L;  2UUB Q;  4R4C A;  4RA8 A;  2MUY A;  2K5V A;  2E2I H;  4LFA Q;  2Z6K C;  3PO2 H;  4OON A;  1XWE A;  4ZUJ A;  1E2W A;  1TT2 A;  4FF3 A;  1H9M A;  5LMN Q;  2DGY A;  1LV9 A;  5M5X H;  4JI4 L;  1YJ9 A;  5CV6 A;  3Q6S A;  1BBW A;  2B2T C;  2QF7 A;  3A54 A;  4LK1 C;  1YEZ A;  2UUC Q;  4QB4 A;  2LSS A;  2A73 B;  5A2Q L;  3D8G A;  1VQF A;  3W2D A;  4JI5 Q;  4BBS G;  3GTL H;  4J6H A;  1I6H H;  3TP5 A;  3U9O A;  4TQU S;  4FXG C;  1HFN A;  3M7N A;  2B2U A;  4CKC A;  1VQO A;  4JBW A;  3PIO A;  4C2M H;  1LO5 D;  1NUC A;  1JB3 A;  1CKN A;  1DON A;  4RHS A;  4ZK9 B;  2FHT A;  3DXJ C;  1SYD A;  1D1K A;  1XTD A;  3M3Y B;  4FF4 A;  4X3K A;  2K5Q A;  2HT1 A;  2NZ1 D;  1EWH A;  1U4M A;  3S2H H;  4DV5 Q;  5NUC A;  3TP6 A;  5C4J H;  1E2V A;  3M7G A;  4PQX A;  2E2H H;  2MGS A;  4F87 A;  2NTS A;  1H9R A;  5IGG A;  5COY A;  4GKJ Q;  2JA7 B;  1EY0 A;  3NK9 A;  1PV4 A;  4DNR B;  1PH8 A;  2JA6 B;  2OEO A;  2K14 A;  5E3F A;  2XRS D;  1WTV A;  5G3L F;  3ERQ A;  4R9W A;  5IOD A;  5C3E H;  3STB D;  2VS1 A;  1Y1V B;  3RD4 A;  4JK1 C;  2UXD L;  4A3F B;  1YHQ A;  2BOS A;  4RGN A;  3TBI B;  3W5O A;  2F3V A;  2X69 A;  2ATW A;  2H5X A;  4G7Z C;  2R7Z H;  1BBX C;  4HJA A;  3P20 A;  3H3V H;  1JOQ A;  4A3B H;  2R93 B;  2K28 A;  1OXV A;  1CTM A;  3QB3 A;  1CZG A;  4H0L C;  3DHQ A;  1VMC A;  1II3 A;  3K8A A;  4JOI A;  4DNI A;  1HZC A;  1TR5 A;  3FPP A;  2C35 B;  3VR5 A;  4AQY Q;  5EKI A;  4O42 A;  2LMC B;  4GZY C;  1BKB A;  1ILP A;  1PMR A;  3AB9 A;  2NYZ D;  4WRD A;  1PDQ A;  4AYB G;  5JEA G;  5FO9 B;  3WOE A;  2A69 D;  1PYW D;  2NWG A;  5JOB A;  1KLG D;  5FLX L;  3I4M B;  1GUN A;  1TWH B;  5C44 H;  1DOM A;  4NW2 A;  5KNB A;  1I4X A;  4DV6 L;  2A1A A;  5J1Z A;  4JG2 A;  4XQN A;  4OXP A;  3RZO H;  4DXF A;  1PTO H;  2B2Y A;  2RF4 A;  5I6Y A;  4P73 A;  4PMC A;  2OXP A;  4ZYS A;  3KLR A;  5IT9 E;  3S14 H;  2F3W A;  3CCL A;  1JJC B;  4KHV A;  3I4N B;  1CQF A;  4KKU A;  1CK1 A;  1L2F A;  2VUM B;  4F8M A;  4BY1 G;  2A6H D;  1GXD C;  5ELC A;  1VQG A;  3MXN A;  3JAM c;  1RKN A;  3CCQ A;  3DMU A;  3PUY A;  3J81 c;  1VQM A;  2DNC A;  2WKD A;  3G71 A;  3ERO A;  1FGU A;  1IL2 A;  3I90 A;  1ESF A;  5M3F H;  1GOZ A;  1EYG A;  3HFZ B;  1TS2 A;  3AFP A;  3A8K E;  4LW1 A;  3KOJ A;  1FJG Q;  5ISR A;  2K52 A;  4M8A A;  3V05 A;  2F0W A;  4V19 0;  3NWT A;  2IX1 A;  1V1P B;  4LFB Q;  3L2P A;  2MNA A;  3M4Q A;  1G8Z D;  3HOV B;  1ET9 A;  2NN6 H;  2JP1 A;  3CCV A;  2KQ3 A;  3GTM B;  3GTG H;  3RR5 A;  1UNS A;  1SNC A;  1DJR D;  1UE6 A;  1Y1W H;  3T4A C;  1RTN A;  1ENA A;  2A8V A;  4K0K L;  2E74 C;  2AMC B;  1G2T A;  4OIK A;  1UAP A;  1PFB A;  5LHY 1;  4O2D A;  2ENB A;  3NXW A;  3T51 B;  1AH9 A;  2JA6 G;  3C46 A;  3J80 i;  4NMZ A;  4BWG B;  3SXH A;  4A3K B;  4DR6 L;  3VDY A;  1SXT A;  4A3M B;  1TS4 A;  3S15 B;  2AWN A;  2WB1 G;  2JA8 H;  4DR3 L;  4B3M Q;  3S1M H;  3CC2 A;  4XXE A;  4A3F G;  3FKI G;  3D3R A;  1A2T A;  1JE5 A;  4KTA A;  1E1O A;  1PH4 A;  2YTY A;  4IPG A;  4JBM A;  1H9S A;  4H44 C;  2R3Z A;  4IUP A;  4ODG A;  5IGC A;  3H15 A;  3WOF A;  3PO3 G;  3HEJ A;  1RHP A;  3F2U A;  1K8M A;  1RCV D;  1Q8I A;  1SN8 A;  3TME A;  2EXZ A;  5EKK A;  5JJI A;  5FO7 B;  3HOY G;  1D5M C;  5IP9 G;  2F0H A;  2MQH A;  5GAG C;  3HS0 C;  2EJG C;  2Z0S A;  2HCI A;  1WD1 A;  1V9P A;  1J5E Q;  3VYT A;  1SYF A;  4POF A;  2RDH A;  1WTO A;  1FL0 A;  1BUV T;  2IT1 A;  1Y69 U;  1GHK A;  4DR1 L;  4TRD A;  2A19 A;  5J3B A;  4XT3 B;  1HNZ L;  4UHV A;  1CQV A;  4FF2 A;  4BY1 H;  1PRT F;  5CV8 A;  1SYC A;  4PNY A;  4DV7 Q;  3I8Z A;  3KJP A;  5M5Y B;  1JMC A;  5C4X G;  1M4V A;  2B2V A;  1C8C A;  4EQN A;  2Z8L A;  2EYP A;  2EJF C;  3TP7 A;  5C6A A;  4ABN A;  2NVX B;  4GN4 B;  1E2Z A;  1KLU D;  3ICE A;  1BQQ T;  1X3Q A;  2GN5 A;  3MEH A;  4DN4 M;  2PCF B;  4YHH Q;  1AZP A;  3J7A 5;  1PZK D;  3IL8 A;  2I5M X;  1QWY A;  4POG A;  2RQX A;  1IBM L;  2D9U A;  2XRQ D;  2UU9 Q;  1ENC A;  2Z4I A;  3NUC A;  1H95 A;  3NQT A;  1JE4 A;  4RGM A;  1EYA A;  1W6K A;  3PGZ A;  1PH6 A;  2F0S A;  2RSN A;  2Z1C A;  1IBL L;  1ICF B;  2B39 A;  4OIJ A;  1K83 H;  2VQF L;  3HOU B;  5IWA L;  3K5O A;  3QIA A;  4HSV A;  3TZU A;  2JA9 A;  2CW0 C;  1DOL A;  5C5L A;  1K8G A;  4ILW A;  5IYB G;  5ELD A;  1XPO A;  2L4N A;  1QZG A;  1XPR A;  2F1M A;  4DR1 Q;  1SRO A;  3DWA A;  4YWK A;  1R9T B;  1IBK Q;  2MO1 A;  1YNN D;  3OOC A;  5T1I A;  1TWG B;  3K7A H;  3S1R H;  1QVF A;  3FKI H;  4IPH A;  4LF4 Q;  5TSS A;  4PV1 C;  1W6J A;  3SK4 A;  1EQQ A;  3TN2 A;  1DCZ A;  3L7Z C;  3RNU A;  2JEB I;  2CFM A;  2ICE C;  3PO3 H;  1AE3 A;  1EWC A;  1H9K A;  2JN4 A;  3FMC A;  3G7L A;  4ULL A;  4DR2 Q;  1EU4 A;  5A35 A;  2EOT A;  3JAM L;  1PRT C;  4BA1 I;  5G3L D;  4HED A;  1B50 A;  3HOY H;  3I91 A;  5IP9 H;  3J81 L;  3AMU A;  1HUM A;  2DY8 A;  5E1F A;  4IJL A;  5DM6 3;  4Q0F A;  3DLL A;  5FLM H;  4UPA A;  3T1H Q;  3KLW A;  4RCN A;  3OYY A;  2EYL A;  1SNM A;  2B8F A;  4JI8 Q;  4C3J B;  1K8A C;  3HOW B;  2F0G A;  3TQY A;  3U4V A;  2B63 G;  3C3L A;  5EPK A;  3OMG A;  4X3U A;  4AYB E;  1LTA D;  5C4X H;  5BN5 A;  1IYJ B;  3M4Y A;  2E8G A;  1WJJ A;  1HHV A;  1YIJ A;  3NBH B;  1HZA A;  5D3I B;  4BBR B;  4KKS A;  2G5D A;  4CDD C;  1JR0 D;  4GOP B;  4UP7 A;  3K57 A;  1A2U A;  3KYH C;  3BU2 A;  4DR7 Q;  4KN7 C;  3AU7 A;  3NSW A;  3I4L A;  1O78 A;  3VR4 A;  3OW2 A;  2ZJR A;  5FJ8 G;  3CCR A;  2WAQ G;  1VQB A;  5GRO A;  3HKS A;  4DUY L;  1U4L A;  1SDF A;  2ZJQ A;  2K50 A;  4I7A A;  2K7V A;  1SRU A;  2AHO B;  4XIG S;  2SNS A;  2EYH A;  1CT1 D;  4RKB A;  2ZXR A;  5CV7 A;  1STG A;  1UE1 A;  3LGJ A;  2EYJ A;  4IN3 A;  1XMO Q;  3VYS A;  1L1O A;  1I5F A;  3OIQ A;  5EBD A;  2LXK A;  5IYB H;  2AQ1 B;  1L0X B;  4DR4 Q;  2HIV A;  2CQA A;  2RA4 A;  1QUQ A;  2PW5 A;  2JSO A;  4MTN A;  3A74 A;  2L1B A;  1E24 A;  4GNX A;  1HR0 L;  2PMZ B;  1KDC A;  3KF6 B;  3PQI A;  1EEI D;  1GVP A;  2P5Z X;  1VF7 A;  1LTS D;  4OL7 A;  5HY6 A;  1DZ1 A;  3PUW A;  2YU9 H;  4C3H B;  4R4O A;  2IL8 A;  3PSI A;  3KLS X;  4B9X A;  3PUZ A;  3CP0 A;  1WCM B;  2BE5 C;  2YTV A;  2KCT A;  2PO4 A;  4NXN Q;  4EX5 A;  1MSG A;  2VB2 X;  1A0I A;  2ZXO A;  4K6L A;  3GTO B;  5C3W A;  3NPP A;  3UI2 A;  2K33 A;  2WB1 E;  2D0O A;  5JJL A;  4HJ7 A;  4DA2 A;  2JA5 G;  2ID0 A;  2LXJ A;  2Z6K A;  2DN8 A;  1OO9 B;  2B63 H;  2Z4H A;  4AIM A;  3C1F A;  1A62 A;  3GTK H;  1SE4 A;  5IGD A;  1SEB D;  5IGB A;  2L15 A;  1SJH D;  5CMD A;  2PZT A;  4A3D H;  3J80 c;  2HQE A;  4JI7 Q;  4L5R C;  2EQS A;  1TWC H;  1X54 A;  2EJM A;  1WTX A;  1X3G A;  1PZI D;  4WJ4 A;  2PYK A;  3D31 A;  2CW0 D;  4C3J G;  1YNJ C;  2A69 C;  3E0E A;  3GTP B;  3VR2 A;  1FNV A;  4K8I A;  4DXG A;  4AH6 A;  4PZ7 A;  4A3I B;  1GJX A;  5FJ8 H;  4BY7 B;  5M3F B;  1MHW C;  4NP5 A;  3BZD B;  4LF5 L;  4B3S L;  4KMU C;  4BBR G;  1VQP A;  1PHJ A;  4U67 3;  4LF6 Q;  1IW7 C;  2JXM B;  5IYD H;  4GLV B;  1KDA A;  4HIK A;  1B3A A;  4LNQ A;  1D1I A;  4B3R L;  3Q23 A;  2EE1 A;  4OWW B;  3I70 A;  3R2I A;  2L12 A;  4L6T B;  1VQI A;  1Y1W B;  2R92 G;  1LLR D;  3ER0 A;  4K2L A;  5D3D A;  2WKC A;  1BF4 A;  4RGT A;  3E6Z X;  1XNR Q;  5CV5 A;  1EIH A;  4QIW B;  3M85 A;  4HJ8 A;  1SYE A;  1NCV A;  1IZ6 A;  4RWS C;  1Z47 A;  3J81 j;  4MN3 A;  1H9J A;  4V0B A;  1VQ4 A;  1WVL A;  4BXX G;  5ELN A;  4EQO A;  1IYU A;  1EYD A;  4CGY B;  1KAW A;  3CU7 A;  1NTG A;  4IUN A;  2ZTD A;  2Y0S B;  1QG7 A;  1EYC A;  4KHP L;  3PMF A;  2HHH Q;  2K5H A;  3IFD A;  3T13 A;  1BBU A;  2F0E A;  2NVY B;  1JOO A;  3F1Z A;  3RZD B;  4I7Z C;  1KRT A;  3E0J A;  1KIX A;  1Q81 C;  1N8R C;  1EEF D;  4DAY A;  1YNX A;  1WTH A;  4HID A;  4HSP A;  3EQL C;  4HMI A;  1WTW A;  5AFW A;  4X64 L;  4DR5 Q;  1EOT A;  2ALY B;  4QY7 A;  4OEM B;  2JA5 H;  2V4D A;  1ONL A;  4DV1 L;  1I4Q A;  4XQQ A;  2I46 A;  3K80 C;  1KDB A;  2K5D A;  3S1Q H;  4C1N I;  4JYA L;  3AYH B;  5LMN W;  1TS5 A;  4MNO A;  4DF7 A;  4NDX A;  4PMW A;  1XX8 A;  1TU2 B;  3MHB A;  1S5E D;  2AWO A;  5I4D A;  4HAE A;  4LF9 Q;  1B53 A;  4IPD A;  2K5N A;  2V1C C;  1CKN B;  1C0A A;  1MJE A;  1NE3 A;  1EL0 A;  4IUU A;  1TXY A;  1GUS A;  2AUJ D;  5ELE A;  4QJF A;  2FMM A;  3TZD A;  4UY8 C;  2YYZ A;  1BO0 A;  1TVX A;  5KYI A;  3DUZ A;  1SE8 A;  2F0N A;  2RKS A;  4DK0 A;  4C3I H;  5IYC G;  4QL5 A;  2X6G A;  3EBE A;  2AQ3 B;  5DAU A;  2KA7 A;  1VQD A;  4L8J A;  3HKZ B;  4A3E B;  3QWN A;  3S17 B;  1U5K A;  3GD7 A;  1RIP A;  2O2L D;  1X6O A;  1GO3 E;  4DK3 C;  3CCU A;  3E9H A;  2ZM6 Q;  1EWI A;  3M4O H;  3X3M A;  4R8N A;  1A6X A;  3S2D B;  3U58 A;  1ENF A;  1SYB A;  2BE5 D;  2XNA C;  4N9T A;  1W3S A;  4C56 C;  1SND A;  3HGB A;  4L63 B;  1B7Y B;  4R4T A;  5C0X I;  4JI4 Q;  4BY7 G;  4JBJ A;  3HZX A;  4DK6 C;  2R92 H;  3S1N B;  2VXW A;  1EUJ A;  1K83 B;  1PXU A;  1NAP A;  5EPJ A;  1U9R A;  4QQB X;  1FYC A;  3I72 A;  3ND9 A;  2WAQ E;  1GD7 A;  2M2L A;  2OWO A;  3I55 A;  1JOR A;  1EY6 A;  4GN3 B;  1PYB A;  3UDX A;  3GP7 A;  1RTO A;  3A55 A;  5J22 A;  1QZH A;  4RHR A;  2K6A A;  3RMH A;  2BH2 A;  4A3C G;  4FVM A;  1X3F A;  2I0Q A;  1EY8 A;  3PV0 A;  1Y8P B;  3MFY A;  1SFO B;  1BCP B;  3H0G B;  1EFW A;  3H91 A;  4LJZ C;  3J80 L;  4B9W A;  4A3L G;  2KCM A;  4JI0 L;  5FO8 B;  1STA A;  1I3Q B;  1G91 A;  2XWJ B;  3GO5 A;  1YNJ D;  2K05 A;  1D5Z C;  1D7Q A;  5DLQ E;  4OWX B;  3F8T A;  3BS1 A;  2QIL A;  2HD3 A;  4X66 L;  4DV3 L;  3A7L A;  4ZAI A;  2GVB A;  4BBS H;  4R4Q A;  3EJI A;  2F0L A;  1CZW A;  4K8J A;  1TWF B;  1JJ2 A;  1YNN C;  1J6Q A;  2E2D C;  5K5P A;  1IW7 D;  2D0P A;  4XYQ A;  4H13 C;  1TWA H;  1N34 L;  2UXD Q;  2PPB C;  3FRP B;  1IKM A;  3CCE A;  3MA2 B;  4DUZ L;  5IYC H;  4APV A;  3G4S A;  3GTJ B;  1K73 C;  3IKJ A;  1JJG A;  3S9W A;  4LUV A;  4ZLT F;  4A3J B;  3SVM A;  3HOZ B;  4MIU A;  1HNW L;  1WYD A;  1X32 A;  4C1N K;  3HOX B;  2JEA I;  3S16 H;  1G51 A;  1M1K C;  1A8V A;  4MHE A;  3OHX C;  1WFQ A;  1J8I A;  4RH6 A;  1K9M C;  1B4O A;  2RCF A;  2CWP A;  1E7Z A;  4OX9 L;  5T1G A;  4HR7 B;  2BH8 A;  4DK1 A;  3EFX D;  3HKZ G;  4A3E G;  1WOC A;  4XTC S;  1LT3 D;  1F9Q A;  3LWE A;  1Q90 A;  4A3G B;  4JI2 L;  1JB7 A;  2E5L L;  2WAC A;  4P75 A;  4DV3 Q;  1KQS A;  5EAY A;  4P72 A;  4DV6 Q;  5KNC A;  3V96 A;  1XNQ L;  1N32 L;  2JA7 G;  3UDI A;  2HIX A;  4HIM A;  1CSP A;  5IIF A;  2NVQ B;  2KHS A;  3Q0A A;  4A3C H;  3C1E A;  3GDE A;  3UDF A;  4CJ2 C;  1LAB A;  3U9S A;  2R7F A;  1T5X D;  1V1P A;  2HDM A;  5HGT A;  1O7L A;  4QUC A;  2D2C C;  3M4P A;  5M5W H;  1H9S B;  1Y1V G;  1KAB A;  4Y7N H;  1K3R A;  3PF5 A;  1STY A;  3CHB D;  2KBN A;  1PH9 A;  1PH3 A;  2VW9 A;  3VA7 A;  2L55 A;  2N8N A;  5KND A;  4LF8 L;  2WII B;  4IUQ A;  2Z6B A;  5JEA H;  1EY9 A;  2Q8T A;  5C0X G;  3CQZ B;  3CXC A;  2R93 G;  4GKK L;  1GM5 A;  1BCP C;  1SJE D;  4L5S A;  1A3U A;  1HZ9 A;  4A75 A;  2JQO A;  2K04 A;  1CA6 A;  2KCC A;  5I6W A;  2Q2H A;  4NB3 A;  2DUD A;  2IHF A;  3MXG A;  3B6Y A;  2J7Z A;  1B44 D;  2JJQ A;  5BR8 L;  1DOK A;  2E2J B;  4ID6 A;  4OWT B;  5CR3 A;  2PMZ E;  1D6E C;  3W3A A;  2B29 A;  2F4V L;  2E5L Q;  4JI1 L;  1ML0 D;  4K0K Q;  1F9P A;  3TDQ A;  3I4M G;  2NBF A;  3PF4 A;  5JEA J;  4A3D B;  5FOB B;  1JWM D;  3NE5 B;  1U0L A;  1MKH A;  3G48 A;  3CME A;  1Y14 B;  4DR6 Q;  1NBW A;  4M1U B;  3FHW A;  1VQL A;  1Y8O B;  1NMF A;  1EIY B;  2EIF A;  3T56 B;  3A5U A;  4DR3 Q;  3DEP A;  3CC4 A;  2F0K A;  4JV5 L;  3I4N G;  3J81 E;  1TQO A;  5CC4 A;  2VUM G;  2NTT A;  3MC0 B;  1Q46 A;  1ZXT A;  5HUR A;  5I9O A;  3M3Y H;  1N9W A;  4A93 B;  2HDL A;  1BDO A;  1MSH A;  1S5F D;  5CBA E;  4CBV A;  2CWA A;  1BNZ A;  3GTQ B;  4K5V A;  1I50 B;  3BDO A;  5M3M B;  4DV4 L;  2DNE A;  2J0T D;  3TEH B;  1KL9 A;  1Y8N B;  4NXM L;  1S72 A;  2L5T A;  4BA2 I;  4JI3 L;  1I4R A;  1MIU A;  3N52 A;  2JA7 H;  5BR8 Q;  5K36 G;  2JA6 H;  4RAU C;  3VYR A;  1N36 L;  3HOV G;  3D6W A;  1HNZ Q;  3R3O A;  4Z9C B;  1STH A;  3KJO A;  1NSN S;  1Y1V H;  3MZ5 A;  4A3F H;  1VQ6 A;  3SR1 A;  1VQK A;  4DV2 L;  3WDN A;  2EVB A;  3UDG A;  3P1H A;  3HG9 A;  1C48 A;  2IX0 A;  1K8O A;  5E4W C;  4JBK A;  1EY7 A;  2NVT B;  2XSC A;  5C0X H;  2JE6 I;  2R93 H;  4ZRZ A;  4A3K G;  1X9N A;  1V8Q A;  4A3M G;  2L11 A;  1F2M A;  1Q12 A;  3MVV A;  2E2I B;  1IBM Q;  1KTK A;  1F2Y A;  2KJX A;  3PO2 B;  4CDC C;  1HH2 P;  2XGT A;  4ZQ3 A;  5JPM C;  3LNN A;  2N55 A;  5M5X B;  2KHJ A;  1SBB B;  1VQJ A;  2EZV A;  2A74 C;  2PQE A;  2I5L X;  3RLN A;  3MXP A;  2BDN A;  1IBL Q;  3KF8 A;  2XIW A;  4PG3 A;  1KNE A;  1PA6 A;  2VQF Q;  3J7Z C;  4KJO A;  5IWA Q;  1O7Z A;  2QDB A;  3GTL B;  1I6H B;  1TWH H;  3OMC A;  5C0X J;  2CVR A;  1PZJ D;  2RSO A;  3H09 A;  4YY3 L;  1VQ8 A;  5KRU A;  1ROD A;  1N36 Q;  2MO0 A;  4C2M B;  1A15 A;  3OSO A;  5D14 A;  3CCS A;  1BVS A;  2F0M A;  2KOL A;  1X55 A;  3MTS A;  3CRL C;  2R6G A;  5GAD C;  2B2V C;  5CBE E;  5JVG 3;  5AJ3 L;  4C3I B;  3SGI A;  3KLS A;  2VZA A;  3I4N H;  2F0U A;  4S3S A;  2VUM H;  5LMU L; 
#chains in the Genus database with same CATH homology
 2SNM A;  4KY7 A;  4WFN 3;  4FYD A;  1FNU A;  4QMG A;  3S2H B;  5C4J B;  2E2H B;  3K59 A;  4HCS A;  4LAA A;  4J1M A;  1PFM A;  5I9P A;  2QEJ C;  3HP3 A;  4DAP A;  4HN7 A;  1EIG A;  2B2W C;  2FFK B;  1WD0 A;  1TY0 A;  2F0P A;  3GQB A;  1C4Q A;  1EU3 A;  1BCP D;  3BDL A;  5C3E B;  5K36 H;  4FF1 A;  3NWS A;  4KKT A;  1ZYR C;  3NHH A;  5LL6 S;  1Q1E A;  1LT4 D;  1GHJ A;  2R7Z B;  2MP1 A;  2MPM A;  2KVM A;  3CRK C;  4RKL A;  4A3B B;  1V43 A;  2E76 C;  4BS9 A;  2EY6 A;  2M9V A;  3SE0 A;  3O13 A;  1E0B A;  1LAC A;  1HRJ A;  2WP8 J;  4IQZ A;  5D65 A;  4QCL A;  3MXU A;  3LX0 A;  5CV9 A;  3SK6 A;  4ZUI A;  3QG1 A;  1ET6 A;  1IHZ A;  2HCC A;  1ZKO A;  1VF5 C;  5JVH 3;  5BN3 A;  5C44 B;  1A3V A;  3LWU A;  2TSS A;  4HMJ A;  2L9H A;  3H6M A;  4BBS B;  3RZO B;  1PTO B;  4IFD I;  5KYL A;  2B2T A;  1CHP D;  4XDX A;  4K5X A;  2XVS A;  3S14 B;  1KNA A;  4P2C B;  3EVQ A;  3L3O C;  3OIP A;  3D4D A;  4F88 A;  3I73 A;  3H94 A;  1HA6 A;  3DWQ A;  3QJY A;  2H4O A;  5CGK A;  1ZEQ X;  5C5M A;  4CJ0 B;  1A3T A;  5F2D A;  3KUP A;  2KEE A;  3QOL A;  1D2B A;  3VA5 A;  3K5M A;  2EPB A;  1FR3 A;  2PNR C;  4FXK C;  3K6O A;  3K0Y A;  5A2Q E;  1VMP A;  1I6V C;  1PTO F;  3OW7 A;  5ELB A;  3BYY B;  3GTG B;  4DAV A;  3SHL A;  1IKL A;  2D62 A;  4R8I A;  1HCZ A;  5FKA C;  1S5C D;  3ZYY X;  3ND8 A;  2K5W A;  1SNQ A;  4DU9 A;  3X3N A;  1QJO A;  5IOC A;  2AUK A;  4TSS A;  4KD4 A;  2JA8 B;  4RFB A;  3MWY W;  5KEE A;  4KV6 A;  3S1M B;  3PUX A;  2BA1 A;  5M9O A;  4CKB A;  3H3V C;  1SE3 A;  4KHZ A;  4EVO A;  4EGV A;  4C3H G;  1B9N A;  1ESR A;  5DNF A;  4IUV A;  2PZU A;  1J9O A;  4DFA A;  4KY6 A;  3P75 A;  4G4K A;  1TS3 A;  1Q3L A;  2LKV A;  3DWP A;  5CV4 A;  1QIL A;  3BYT B;  5KGU A;  4HTH A;  2FJ2 A;  4CJ1 B;  1B9M A;  1LTG D;  4UAI A;  1R4P B;  1SAP A;  3R2T A;  1AFP A;  1G2S A;  4BY1 B;  4KD3 A;  1HQM C;  4KY5 A;  1MBY A;  3K5L A;  1AZQ A;  1PTO C;  3J80 E;  1ZYR D;  4F7X A;  1HXY D;  2WIN B;  1Z7T A;  3DM1 A;  3SK8 A;  2D5D A;  4G57 A;  2NB0 A;  5FLX E;  3D4R A;  1F2L A;  4Q5V A;  2K01 A;  5JPN C;  4K2K A;  2PW7 A;  2DY7 A;  3VYU A;  1RDP D;  4IFD G;  2A5H A;  1OXT A;  4K6D A;  1JWU D;  4H7B A;  3CKI B;  3R8B A;  4WOR A;  4FXD A;  1O7Y A;  4U68 A;  2BDO A;  2VNU D;  2EY2 A;  1CM9 A;  4FNF A;  5KIX A;  2FIN B;  2AQ2 B;  2R61 A;  3MFG A;  2NN6 G;  3T16 A;  2WB1 B;  1AP0 A;  4B08 A;  2B8G A;  3J7A V;  3K7A B;  3S1R B;  3FKI B;  5I2Y A;  3PIO 3;  2SOB A;  1QNK A;  1HQR D;  2O4X A;  3IFT A;  3TSS A;  1SMY D;  2F0T A;  3PO3 B;  1JCK B;  2NUC A;  5E4X A;  1F77 A;  5JAV A;  4N9P A;  1NR2 A;  5EQ0 A;  3HOY B;  1DXM A;  3DEO A;  4XQJ A;  4FP5 D;  1AEX A;  1NR4 A;  1DD2 A;  4QF4 A;  4IAL A;  1OXU A;  2M00 A;  4K5W A;  5C3X A;  2LFN A;  1BCP F;  2OF1 A;  1L0Y B;  3VR6 A;  4CKE A;  5C4X B;  2B2U C;  1RD9 D;  1Z6H A;  3E5S A;  3BVM A;  4YIJ A;  1CI3 M;  4OO1 I;  1STN A;  4NKL A;  3V2T A;  2EYM A;  2A68 C;  2F0F A;  3ONA B;  2L0C A;  5IGF A;  2KCN A;  2F4I A;  2RDG A;  2XWB B;  4IFD H;  2QCP X;  1B2T A;  1U4P A;  2ZT9 C;  1F2Z A;  3A56 A;  5CYU A;  1HA5 A;  5EPL A;  4K14 A;  1OXS C;  1GUG A;  3OPO A;  2A6E D;  3NTH A;  3Q22 A;  1TKW B;  2XN9 C;  3A8J E;  2K1B A;  1X3P A;  4I65 A;  3NBI A;  4QUF A;  1HTP A;  4IZ8 A;  3FDT A;  2F0D A;  2C5C A;  2G9D A;  1OXX K;  4IFD J;  2WV6 D;  1HUN A;  2YU9 B;  3OWF A;  5EKL A;  2MHV A;  2X6L A;  1SE2 A;  3RLF A;  1UUP A;  1EQV A;  1EY4 A;  3SK5 A;  2LS0 1;  2F0Q A;  1EQT A;  1HTL D;  1PTO D;  5IT9 L;  1BR9 A;  3GV6 A;  1AN8 A;  4J8Q A;  1O80 A;  1SNO A;  2Q8I B;  1PRT B;  1M8A A;  1SYG A;  2VB3 X;  3OWE B;  2ZXP A;  1LTT D;  2BCO A;  3R93 A;  1IYV A;  2B63 B;  2B2Y C;  3GTK B;  2E75 C;  2H1E A;  1STE A;  3EA6 A;  3FEW X;  3HRZ C;  4DGZ A;  2ICI A;  5C4H A;  1TWC B;  1JQY D;  4ME5 A;  3D6C A;  1FNW A;  3NTK A;  3JAM E;  4FO2 A;  2C9O A;  4RCO A;  2WAQ B;  3I3C A;  1MD2 D;  1RJT A;  1D5X C;  2CHB D;  3D4W A;  1DM0 B;  1EY5 A;  4XYO A;  2I07 B;  3K58 A;  3A8I E;  1RF2 D;  3TP8 A;  3IAY A;  4EQP A;  1GUW A;  2F0O A;  3NP8 A;  1G29 1;  2EDG A;  1T5E A;  3GV3 A;  2B2W A;  3PUV A;  4TKO B;  4OGQ C;  2IWH A;  4OO1 G;  3J7Y W;  2JYO A;  2RDF A;  3URY A;  2FMC A;  4DNT B;  1PLF A;  4XT1 B;  3BVG A;  3MAQ A;  1F9S A;  2KUM A;  2EYF A;  2IPK D;  1EFI D;  3C2P A;  3KBX A;  3N6R A;  2F0J A;  3QOJ A;  1PFN A;  2N88 A;  2OT2 A;  3SEB A;  3QO2 A;  1BOS A;  2JA5 B;  1S4Z A;  1CHQ D;  3S1Q B;  1R4Q B;  1WTQ A;  3BG3 A;  1QOH A;  2A68 D;  4G7H C;  1F9R A;  1B1Z A;  4PMB A;  1GUT A;  4G7O C;  2IJ0 A;  5I2X A;  1QNU A;  1AW7 A;  1JOK A;  2F0V A;  1S5B D;  1JWS D;  1XXG A;  4IUR A;  2EY5 A;  4KK7 A;  1CA5 A;  3G6J B;  3VR3 A;  4KI0 A;  1V1O A;  2RBM A;  1SNP A;  4O1N A;  3PIP 3;  1STB A;  2EY1 A;  5JJZ A;  5LL6 X;  4WJW A;  3BVZ A;  3NBH A;  1VDZ A;  3M4O B;  2GA4 B;  1Q1B A;  4KJN A;  2R92 B;  4X3S A;  3FPU B;  4OO1 H;  5BN4 A;  2O5J C;  2TMP A;  3RUZ A;  2F03 A;  2MJ8 A;  1IL8 A;  2G9H D;  1DYQ A;  1WTP A;  4RGO S;  3KK7 A;  5FK9 C;  1CFM A;  4LMQ D;  2LY7 A;  4IUT A;  2SEB D;  1XTC D;  1LTB D;  5EGT A;  1HFG A;  1QB5 D;  1MI2 A;  1LT5 D;  5COR A;  1WTR A;  3Q24 A;  3J7A F;  5IGE A;  1XYI A;  3ITP A;  1JIC A;  1TWA B;  3T53 B;  1KAA A;  5EBC A;  4X3T A;  1SMY C;  1TY2 A;  5ELF A;  1I4G A;  3FVQ A;  1EZ6 A;  1GUO A;  1BXT A;  1I4P A;  1ICW A;  3P7J A;  3A7A B;  2NN6 I;  1HPC A;  3S16 B;  2F0I A;  2IW3 A;  1SSO A;  2KED A;  1QCB D;  4ZKC B;  1VCI A;  4C3I G;  1TII D;  1JC7 A;  5EJW A;  1S5D D;  2Q8R E;  1MGS A;  4KN4 C;  3NQI A;  1ILQ A;  1FD7 D;  3SDZ A;  1QE6 A;  2KEC A;  2RVL A;  5DM7 3;  1UEA B;  2O5I C;  1LTI D;  3K5N A;  2A6H C;  1PRT D;  1EZ8 A;  3NTI A;  3L9A X;  5M5W B;  5DEH A;  4HCE A;  1I4H A;  5C4Z A;  4Y7N B;  1FGB D;  1LTR D;  4OHJ A;  2BA0 A;  2SDF A;  2EYO A;  4UDU C;  3KBG A;  1LT6 D;  1G6Z A;  2HUG A;  4AYB B;  2K03 A;  4E6I A;  2K32 A;  2A6E C;  1U4R A;  2IX3 A;  3BDC A;  5J39 A;  4ZKB B;  2J4X A;  4CHT B;  2PZW A;  2QKI C;  4RA8 A;  2MUY A;  1XWE A;  4ZUJ A;  1E2W A;  1TT2 A;  4FF3 A;  1H9M A;  1LV9 A;  5CV6 A;  3Q6S A;  2B2T C;  2QF7 A;  3A54 A;  4LK1 C;  4QB4 A;  2A73 B;  5A2Q L;  3D8G A;  3W2D A;  4J6H A;  3TP5 A;  3U9O A;  4TQU S;  4FXG C;  1HFN A;  3M7N A;  2B2U A;  4CKC A;  4JBW A;  1LO5 D;  1NUC A;  1JB3 A;  1DON A;  4RHS A;  4ZK9 B;  2FHT A;  3DXJ C;  1SYD A;  1D1K A;  3M3Y B;  4FF4 A;  4X3K A;  2K5Q A;  2NZ1 D;  1EWH A;  1U4M A;  5NUC A;  3TP6 A;  1E2V A;  3M7G A;  4PQX A;  2MGS A;  4F87 A;  2NTS A;  1H9R A;  5IGG A;  5COY A;  2JA7 B;  1EY0 A;  3NK9 A;  4DNR B;  2JA6 B;  2OEO A;  5E3F A;  2XRS D;  1WTV A;  5G3L F;  3ERQ A;  4R9W A;  5IOD A;  1Y1V B;  3RD4 A;  4JK1 C;  4A3F B;  2BOS A;  4RGN A;  3TBI B;  2F3V A;  2X69 A;  4G7Z C;  1BBX C;  3P20 A;  1JOQ A;  2R93 B;  2K28 A;  1OXV A;  1CTM A;  3QB3 A;  1CZG A;  4H0L C;  3DHQ A;  1VMC A;  1II3 A;  1TR5 A;  3FPP A;  3VR5 A;  5EKI A;  4O42 A;  2LMC B;  4GZY C;  1ILP A;  1PMR A;  3AB9 A;  2NYZ D;  4WRD A;  1PDQ A;  5JEA G;  5FO9 B;  3WOE A;  2A69 D;  1PYW D;  2NWG A;  5JOB A;  1KLG D;  5FLX L;  3I4M B;  1GUN A;  1TWH B;  1DOM A;  4NW2 A;  5KNB A;  1I4X A;  5J1Z A;  4XQN A;  4DXF A;  1PTO H;  2B2Y A;  5I6Y A;  4PMC A;  2OXP A;  4ZYS A;  3KLR A;  5IT9 E;  2F3W A;  4KHV A;  3I4N B;  1CQF A;  4KKU A;  1CK1 A;  2VUM B;  4F8M A;  2A6H D;  1GXD C;  5ELC A;  3MXN A;  1RKN A;  3DMU A;  3PUY A;  2DNC A;  2WKD A;  3ERO A;  3I90 A;  1ESF A;  1GOZ A;  1TS2 A;  3A8K E;  5ISR A;  4M8A A;  3V05 A;  2F0W A;  4V19 0;  3NWT A;  2IX1 A;  1V1P B;  1G8Z D;  3HOV B;  1ET9 A;  2NN6 H;  2JP1 A;  3GTM B;  2KQ3 A;  1UNS A;  1SNC A;  1DJR D;  3T4A C;  1RTN A;  1ENA A;  2E74 C;  1G2T A;  4OIK A;  1UAP A;  1PFB A;  5LHY 1;  2ENB A;  3NXW A;  3T51 B;  3C46 A;  4NMZ A;  4BWG B;  3SXH A;  4A3K B;  1SXT A;  4A3M B;  1TS4 A;  3S15 B;  2AWN A;  4XXE A;  3D3R A;  1A2T A;  4KTA A;  1H9S A;  4H44 C;  2R3Z A;  4IUP A;  4ODG A;  5IGC A;  3WOF A;  3HEJ A;  1RHP A;  3F2U A;  1K8M A;  1RCV D;  1Q8I A;  3TME A;  2EXZ A;  5EKK A;  5FO7 B;  1D5M C;  2F0H A;  3HS0 C;  2EJG C;  2HCI A;  1WD1 A;  3VYT A;  1SYF A;  2RDH A;  1WTO A;  2IT1 A;  1BUV T;  1Y69 U;  1GHK A;  4TRD A;  4XT3 B;  1CQV A;  4FF2 A;  1PRT F;  5CV8 A;  1SYC A;  4PNY A;  3I8Z A;  5M5Y B;  1M4V A;  2B2V A;  1C8C A;  4EQN A;  2Z8L A;  2EYP A;  2EJF C;  3TP7 A;  5C6A A;  4ABN A;  2NVX B;  1E2Z A;  1KLU D;  1BQQ T;  1X3Q A;  1AZP A;  3MEH A;  4DN4 M;  2PCF B;  1PZK D;  3IL8 A;  1QWY A;  2RQX A;  2D9U A;  2XRQ D;  1ENC A;  2Z4I A;  3NUC A;  3NQT A;  1JE4 A;  4RGM A;  1EYA A;  1W6K A;  2F0S A;  2RSN A;  2Z1C A;  2B39 A;  4OIJ A;  3HOU B;  3K5O A;  3QIA A;  4HSV A;  3TZU A;  2CW0 C;  1DOL A;  5C5L A;  4ILW A;  5ELD A;  2L4N A;  2F1M A;  3DWA A;  1R9T B;  1YNN D;  3OOC A;  5T1I A;  1TWG B;  5TSS A;  4PV1 C;  1W6J A;  3SK4 A;  3TN2 A;  1DCZ A;  3L7Z C;  2JEB I;  2ICE C;  1EWC A;  1H9K A;  3FMC A;  3G7L A;  4ULL A;  1EU4 A;  5A35 A;  2EOT A;  3JAM L;  1PRT C;  4BA1 I;  5G3L D;  4HED A;  1B50 A;  3I91 A;  3J81 L;  3AMU A;  1HUM A;  2DY8 A;  5E1F A;  5DM6 3;  4Q0F A;  4RCN A;  2EYL A;  1SNM A;  2B8F A;  4C3J B;  3HOW B;  2F0G A;  3C3L A;  5EPK A;  3OMG A;  4X3U A;  1LTA D;  5BN5 A;  3M4Y A;  1HHV A;  5D3I B;  4BBR B;  4KKS A;  1JR0 D;  3K57 A;  1A2U A;  4KN7 C;  3AU7 A;  3NSW A;  3I4L A;  1O78 A;  3VR4 A;  1U4L A;  1SDF A;  2K7V A;  4XIG S;  2SNS A;  2EYH A;  1CT1 D;  4RKB A;  2ZXR A;  5CV7 A;  1STG A;  2EYJ A;  4IN3 A;  3VYS A;  3OIQ A;  5EBD A;  2AQ1 B;  1L0X B;  2CQA A;  2RA4 A;  2PW5 A;  2JSO A;  2L1B A;  2PMZ B;  1KDC A;  1EEI D;  1VF7 A;  1LTS D;  4OL7 A;  1DZ1 A;  3PUW A;  4C3H B;  2IL8 A;  3KLS X;  4B9X A;  3PUZ A;  1WCM B;  2BE5 C;  2PO4 A;  1MSG A;  2VB2 X;  4K6L A;  2ZXO A;  3GTO B;  5C3W A;  3NPP A;  3UI2 A;  2K33 A;  4DA2 A;  2ID0 A;  2DN8 A;  1OO9 B;  2Z4H A;  3C1F A;  1SE4 A;  5IGD A;  1SEB D;  5IGB A;  1SJH D;  5CMD A;  2PZT A;  2HQE A;  2EJM A;  1WTX A;  1PZI D;  2PYK A;  3D31 A;  2CW0 D;  4C3J G;  1YNJ C;  2A69 C;  3GTP B;  3VR2 A;  1FNV A;  4K8I A;  4DXG A;  4A3I B;  1GJX A;  4BY7 B;  5M3F B;  4NP5 A;  3BZD B;  4KMU C;  4U67 3;  1IW7 C;  2JXM B;  1KDA A;  1B3A A;  1D1I A;  3Q23 A;  2EE1 A;  3I70 A;  3R2I A;  2L12 A;  4L6T B;  1Y1W B;  1LLR D;  4K2L A;  5D3D A;  2WKC A;  1BF4 A;  4RGT A;  3E6Z X;  5CV5 A;  1EIH A;  4QIW B;  3M85 A;  1SYE A;  1NCV A;  4RWS C;  1Z47 A;  4MN3 A;  1H9J A;  4V0B A;  1WVL A;  4EQO A;  1IYU A;  1EYD A;  4CGY B;  3CU7 A;  4IUN A;  2Y0S B;  1QG7 A;  1EYC A;  3PMF A;  3RZD B;  3IFD A;  3T13 A;  2NVY B;  2F0E A;  1JOO A;  4I7Z C;  3E0J A;  1EEF D;  4DAY A;  1WTW A;  4HSP A;  3EQL C;  4HMI A;  5AFW A;  1EOT A;  2V4D A;  1ONL A;  1I4Q A;  4XQQ A;  2I46 A;  1KDB A;  2K5D A;  4C1N I;  1TS5 A;  4DF7 A;  4NDX A;  4PMW A;  1XX8 A;  1TU2 B;  3MHB A;  1S5E D;  2AWO A;  5I4D A;  4HAE A;  1B53 A;  1EL0 A;  4IUU A;  1GUS A;  2AUJ D;  5ELE A;  2FMM A;  3TZD A;  2YYZ A;  1BO0 A;  1TVX A;  5KYI A;  3DUZ A;  2F0N A;  2RKS A;  4DK0 A;  2X6G A;  5DAU A;  2AQ3 B;  2KA7 A;  4L8J A;  3HKZ B;  4A3E B;  3QWN A;  3S17 B;  3GD7 A;  2O2L D;  3X3M A;  4R8N A;  1A6X A;  3S2D B;  1ENF A;  1SYB A;  2BE5 D;  2XNA C;  4N9T A;  4C56 C;  1SND A;  3HGB A;  4L63 B;  5C0X I;  3HZX A;  3S1N B;  2VXW A;  1K83 B;  1PXU A;  1NAP A;  5EPJ A;  1U9R A;  1FYC A;  3I72 A;  3ND9 A;  2M2L A;  1JOR A;  1EY6 A;  3GP7 A;  1RTO A;  3A55 A;  5J22 A;  4RHR A;  2K6A A;  3RMH A;  4FVM A;  1EY8 A;  3PV0 A;  1Y8P B;  3MFY A;  1SFO B;  1BCP B;  3H0G B;  3H91 A;  4LJZ C;  3J80 L;  4B9W A;  5FO8 B;  1STA A;  1I3Q B;  1G91 A;  2XWJ B;  3GO5 A;  1YNJ D;  2K05 A;  1D5Z C;  3BS1 A;  2QIL A;  3A7L A;  4ZAI A;  3EJI A;  2F0L A;  1CZW A;  4K8J A;  1TWF B;  1YNN C;  5K5P A;  2E2D C;  1IW7 D;  4XYQ A;  4H13 C;  2PPB C;  3FRP B;  1IKM A;  3MA2 B;  3GTJ B;  3IKJ A;  3S9W A;  4ZLT F;  4A3J B;  3SVM A;  3HOZ B;  4MIU A;  1X32 A;  4C1N K;  3HOX B;  2JEA I;  4MHE A;  3OHX C;  1J8I A;  4RH6 A;  1B4O A;  5T1G A;  4HR7 B;  4DK1 A;  3EFX D;  4XTC S;  1LT3 D;  1F9Q A;  3LWE A;  1Q90 A;  4A3G B;  2WAC A;  5KNC A;  3V96 A;  5IIF A;  2NVQ B;  2KHS A;  3Q0A A;  3C1E A;  4CJ2 C;  1LAB A;  3U9S A;  1T5X D;  1V1P A;  2HDM A;  5HGT A;  1O7L A;  4QUC A;  2D2C C;  1H9S B;  1KAB A;  1STY A;  3CHB D;  3VA7 A;  2L55 A;  5KND A;  2WII B;  4IUQ A;  5JEA H;  1EY9 A;  2Q8T A;  5C0X G;  3CQZ B;  1BCP C;  1SJE D;  1A3U A;  1CA6 A;  2K04 A;  2KCC A;  5I6W A;  3MXG A;  2J7Z A;  1B44 D;  1DOK A;  2E2J B;  4ID6 A;  5CR3 A;  1D6E C;  3W3A A;  1ML0 D;  1F9P A;  3TDQ A;  2NBF A;  5JEA J;  4A3D B;  5FOB B;  1JWM D;  3NE5 B;  4M1U B;  1Y8O B;  3T56 B;  3DEP A;  2F0K A;  3J81 E;  1TQO A;  5CC4 A;  2NTT A;  3MC0 B;  1ZXT A;  5HUR A;  5I9O A;  4A93 B;  2HDL A;  1BDO A;  1MSH A;  1S5F D;  5CBA E;  4CBV A;  1BNZ A;  3GTQ B;  4K5V A;  1I50 B;  3BDO A;  5M3M B;  2DNE A;  2J0T D;  1Y8N B;  2L5T A;  4BA2 I;  1I4R A;  3N52 A;  5K36 G;  4RAU C;  3VYR A;  3D6W A;  3R3O A;  4Z9C B;  1STH A;  1NSN S;  3MZ5 A;  3SR1 A;  3WDN A;  2EVB A;  3P1H A;  3HG9 A;  1C48 A;  2IX0 A;  1K8O A;  5E4W C;  1EY7 A;  2NVT B;  2XSC A;  5C0X H;  2JE6 I;  4ZRZ A;  1V8Q A;  2L11 A;  1F2M A;  1Q12 A;  3MVV A;  2E2I B;  1KTK A;  1F2Y A;  2KJX A;  3PO2 B;  4ZQ3 A;  5JPM C;  3LNN A;  2N55 A;  5M5X B;  1SBB B;  2EZV A;  2A74 C;  2PQE A;  3MXP A;  2BDN A;  3KF8 A;  2XIW A;  1KNE A;  4KJO A;  1O7Z A;  2QDB A;  3GTL B;  1I6H B;  3OMC A;  5C0X J;  2CVR A;  1PZJ D;  2RSO A;  3H09 A;  5KRU A;  1ROD A;  4C2M B;  1A15 A;  3OSO A;  5D14 A;  2F0M A;  2KOL A;  3MTS A;  3CRL C;  2R6G A;  2B2V C;  5CBE E;  5JVG 3;  4C3I B;  3KLS A;  2F0U A;  4S3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...