1PRTF

The crystal structure of pertussis toxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title The crystal structure of pertussis toxin.
pubmed doi rcsb
source organism Bordetella pertussis
total genus 19
structure length 98
sequence length 98
chains with identical sequence L
ec nomenclature
pdb deposition date 1993-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09276 Pertus-S5-tox Pertussis toxin S5 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1prtF00
3R2IA 1PTOF 4OHJA 4DXGA 3DWPA 1I4QA 1XXGA 2XN9C 3DWAA 4RFBA 5D3DA 1FNVA 1FNWA 1TY0A 2NTSA 1SE3A 1SEBD 5TSSA 1TS4A 1SE4A 1JWSD 4L63B 2SEBD 1JR0D 2RDHA 4RGOS 3MC0B 5I4DA 1AN8A 1LTRD 3BVMA 1BXTA 1UNSA 1CQVA 2CHBD 3GP7A 2AQ2B 3OWEB 2R61A 1ET6A 2IPKD 1EEID 2NTTA 1PZKD 1ET9A 1S5BD 3BVZA 1LTID 4RHRA 3V05A 2G9HD 4ZYSA 1LT3D 1EWCA 1SJED 1EU4A 1I4XA 1LT6D 1CK1A 1BCPC 4TSSA 1V1PA 2AQ1B 4RGTA 1TS3A 1CT1D 1CHQD 1KTKA 3DWQA 1SBBB 4RGNA 4O1NA 1PTOC 1S5ED 3MFGA 4BWGB 3BYTB 3BYYB 5ELBA 1HTLD 1G8ZD 2Z8LA 3KLSX 2XNAC 1QILA 5D3IB 1LLRD 1SJHD 1STEA 1I4HA 1LTBD 1FD7D 1HQRD 1LT5D 1L0YB 1AW7A 1JCKB 1V1OA 1I4RA 1S5CD 1GOZA 1DYQA 1PYWD 2ICIA 3SEBA 1FGBD 2XRQD 3CHBD 1ENFA 1LTGD 1T5XD 4RH6A 4RHSA 1XTCD 2TSSA 3TSSA 1PRTB 2J4XA 1B44D 1S5DD 1L0XB 1LTTD 1PTOH 3EA6A 1BCPB 1LT4D 3O13A 1S5FD 5ELEA 2IJ0A 4DXFA 3EFXD 2WV6D 1JQYD 4RCOA 1I4PA 1SXTA 1TS5A 1D5ZC 1I4GA 1PRTF 1RF2D 1RCVD 1TS2A 3URYA 1PRTD 1DJRD 1EEFD 1RD9D 1KLUD 1BCPF 2QEJC 1HA5A 1JWUD 2O2LD 1BCPD 3BZDB 1B1ZA 1PZID 3R2TA 1LTSD 2XRSD 1HXYD 1ESFA 1D5MC 4Z9CB 1PTOD 3W2DA 1KLGD 5ELCA 5ELFA 2QILA 4C56C 1TY2A 1UUPA 1EU3A 4UDUC 1V1PB 1F77A 1LO5D 4K6LA 1LTAD 1JWMD 4L6TB 1D6EC 1EFID 1FNUA 1SE2A 1PTOB 2AQ3B 3R8BA 4RGMA 3BVGA 1RDPD 1M4VA 1PRTC 5FKAC 1PZJD 1MD2D 2RDGA 1CHPD 5FK9C 5ELDA 1D5XC
chains in the Genus database with same CATH superfamily
4A93B 5FJ8G 1JICA 3U4VA 1XXGA 3SE0A 1W6KA 5EBCA 4LUOA 2HCCA 1U9RA 2C9OA 2ZJQA 5D3DA 4NDXA 3A8KE 3NQTA 1WTRA 4L5QA 3J81E 3PIO3 3S1QH 2YTXA 4LFAL 3MZ5A 1J9OA 5IY0A 4KN4C 1AE2A 2ZT9C 3I70A 4XT1B 1UNSA 3J81c 4A3DH 2G5DA 1YJWA 3DM3A 1V43A 3P1HA 1EEID 3IFTA 5GAHC 3ICEA 4XDXA 1EYDA 4NXNQ 3TP5A 3VR4A 5CYUA 4NPSA 3PUWA 3SK4A 4DUYQ 1B3AA 5M5WB 2O5JC 2PQAA 3DM1A 4A3MH 5IODA 4RGTA 4X64L 2B8GA 1EYGA 4KI0A 3DWQA 1O7YA 5C0XJ 2BH2A 1S5ED 1JE4A 4BWGB 4ME3A 4N9PA 4A3IB 1VQLA 3GTGB 1WD0A 4P73A 1YITA 2Z8LA 3NBHA 1S4ZA 4EQNA 1QILA 1KXLA 4DR7Q 3RR5A 1VQKA 1C9OA 2NWGA 3HKZB 5A2QE 1IW7C 2WKCA 2Z9HA 4MTKA 1MHWC 2R93B 3J7YW 2YTYA 3ZJYC 4A3BG 5KYIA 1VS0A 4RH6A 1BBXC 2TSSA 4B3TL 5KNBA 3FKIB 4XYQA 1QB5D 5IYCG 2PNHA 1G6ZA 5IGFA 4A3FB 4B3RL 2D0OA 2D0PA 3HG9A 1STHA 3NEMA 1VQ8A 5LMNQ 3MA2B 4IOCA 3GTGH 1PTOD 2PW5A 1Q7YC 4DV1L 1CM9A 2F3VA 4POGA 1UUPA 1EU3A 5ELNA 4U68A 3I56A 5IGGA 1WOCA 1L1OB 5IT9L 1ILPA 2R93H 1JT8A 5CBAE 1F2MA 1D6EC 3PO2G 4QIWE 5C44B 1NMGA 4DK3C 4IN3A 3S1MB 1SE8A 4DN4M 5FKAC 5J1ZA 2CQOA 1VQGA 3ITPA 1CUKA 4L5RC 4DV5L 2MHVA 1N34L 1ICFB 3DWPA 4WRDA 1G91A 2WAQE 4PZ6A 1F2LA 1CSQA 2EYJA 5CV4A 1TY0A 4A3FH 1ZYRC 5BR8L 3KF8B 3PCOB 4DV7Q 1E2ZA 2X69A 1SYGA 2PW7A 2OQ0A 2QA4A 3BVZA 4X3KA 1VF7A 4HTHA 3RN5A 2UXDL 3AQQA 2I5LX 3A55A 3UDXA 4ZYSA 4X62Q 3HOYG 1O7ZA 4IJHA 3FP9A 5IT9c 4P71A 1FL0A 1L1OC 3V96A 4HIOA 4DR6Q 3NP8A 3IAYA 1SROA 3I55A 4GLAC 2VQEQ 4IUQA 2KHJA 5C44H 4KHPL 3T4AC 3BYTB 4B9WA 1PMRA 1G2SA 1LACA 1AZQA 3OIQA 4UHVA 4IPHA 1KD1C 2OTJA 3S1NH 3KLSX 3NUCA 2XNAC 3FPUB 4A3EH 4GN5A 3HRZC 2QW7A 1KAWA 3MXPA 1GOZA 2LY7A 3Q22A 3GV3A 3N52A 4IOAA 5C0XI 2OQKA 4MIUA 3CPFA 3G4SA 2K01A 1DOKA 2F0HA 3I91A 2ZM6Q 1NAPA 2EY6A 1A6XA 4DV0Q 4OGQC 3FMCA 4TKOB 2RHQB 5E4WC 3CD6A 3H3VI 2IJ0A 5EPJA 4JG2A 3W1BA 3Q23A 1I4PA 4C3IG 1DJRD 4JI0L 2J0TD 2K04A 1RTOA 3GTMB 2TMPA 4AYBE 2E76C 4C2MB 1BBWA 5JVH3 3KYHC 1MI2A 4ALPA 3MHBA 5GAEC 2JN4A 4K2KA 1WVLA 4I65A 3HOXB 4JOIC 4ZKCB 5AJ3L 3STBD 2F0FA 2VQFQ 1BUVT 3G48A 1PA6A 5KEEA 4QMGA 2B2TA 1SE2A 2F0WA 1PTOB 1LM0A 4X66Q 3E5SA 4YCUA 4A3GG 4OXPA 3A0JA 3FRPB 1VQHA 3GTKH 3NTIA 2B2WC 1IYUA 4ZAIA 3IL8A 1GKHA 1SFOB 3S15B 1QJOA 1K0RA 1N32Q 5F2DA 1T9HA 1GUGA 4CDEC 2E2JB 1K8GA 1TKWB 5TSSA 3D6CA 2B2YA 1K28A 4L5TA 4JI4L 3GTMH 5JVG3 2JA5G 1DOLA 5JJLA 4V190 3TP7A 2PPBC 3PIP3 4IALA 2N3SA 4G7HC 1FYCA 1S5BD 3HOXH 4CGYB 5CGKA 4H0LC 1DONA 3LWEA 2FHTA 2QF7A 1J5EL 3C3LA 3E9HA 3OYYA 5FLMG 1G6PA 4BBRB 3J7A5 4LF5Q 2PZUA 3TN2A 1MSHA 1YIJA 3BJUA 5M5XB 1PTOC 3CCQA 3NTKA 2F4VL 1KC8C 4OWWB 4IZ8A 3NWTA 3NWSA 1PH8A 1SFOH 3S15H 3F2DA 5IP7G 5C4JB 4DAYA 2LS01 4C1NI 2E5LL 2JA7B 2JA6H 5IWAL 2GN5A 2EJGC 2EYHA 1D1IA 1LTLA 4PQXA 1K83H 1HQMC 4ZKBB 3HKZE 2J4XA 1HR0W 3H0GH 5T1IA 4P2CB 1RCVD 5L37A 4BBRH 4HJAA 4DUZL 2KHIA 2O2LD 3QOJA 5CV6A 3S2HB 1GJXA 1SYBA 1VQEA 3K0XA 5CV5A 3J80i 4R4CA 4Z9CB 1UAPA 1I50H 4C3HG 4B3MQ 2PI2E 1Q8IA 2GVBA 3WOFA 3M4OH 1CFMA 2UUBQ 2PYKA 1CTMA 3CCJA 3I4MG 2K14A 2WKDA 2Q2IA 4U673 1TWHB 3OMCA 4DNIA 1SYFA 1A2UA 1RDPD 2CWAA 4XQQA 2KCNA 2L11A 2RDGA 2IX1A 1HHVA 4BY7G 1STGA 1N33L 3JAMi 4IO9A 4M8AA 3NELA 5LMUL 5DM63 2EZVA 1NR4A 3GQBA 4Y52H 1HNXL 2B63H 3CCLA 5CMDA 1LYLA 2PQEA 1GUSA 1I3QH 3HKSA 4IFDH 4JV5L 2JP1A 3S2HH 1Z6HA 4KKSA 2JEBI 4BY1G 3VR6A 1I6HB 3WDNA 1IBLL 2HQLA 2NTTA 1JJ2A 1ET9A 2RBMA 1CKOA 1LTID 3K6OA 1EQQA 2H1EA 3V05A 3RZOB 2IT1A 4ABNA 3PUYA 3GTOH 2IW3A 3F8TA 4DR1Q 1QE6A 1IBKQ 3SK8A 1UWVA 2KCMA 4DU9A 4DV6Q 4X3SA 2NVYH 2F0GA 2PCFB 4NW2A 4UPAA 1AZPA 1PVOA 2BCOA 4N8X1 2M00A 1AH9A 3VA5A 4K5WA 2Z6KC 1VQBA 2A6HD 4N8FA 3S2DH 2V4DA 3STBC 4H02A 1HRJA 3NE5B 2EOTA 3GTJH 3GO5A 3SK5A 3OTOL 1PFNA 4KN7C 4LFBQ 1NUCA 1B7YB 3K80C 1JB3A 4PZ7A 1I4RA 2D5DA 4NXMQ 4A3CG 3H91A 4UP7A 4UP9A 2JA8G 4FNFA 2A6ED 3QO2A 2DJFC 2UU9Q 2VY3A 1A15A 1SLJA 3EVQA 4DXFA 1GM5A 4DR4L 4L8JA 3QG1A 3C46A 2FMMA 1FR3A 1PRTF 2EYPA 5IYDG 2EY1A 2RQXA 2XWJB 1X9NA 3W3AA 1JWUD 3DEPA 1BCPD 2QDBA 2K50A 2AWNA 3R2TA 4DR5Q 1LTSD 1DOMA 1D5MC 2R7DA 1S72A 2IX3A 3G6EA 1WTVA 5ELCA 1EQRA 3BS1A 3J81i 1E1OA 2ATWA 2BA0A 3VYRA 2JSOA 3MEHA 4MTNA 1LO5D 1F9SA 4OX9Q 4EQOA 1GHKA 3KJOA 4AYBG 2UXCQ 2AQ3B 2EE1A 3QR8A 1ZXTA 1MD2D 1BDOA 5ELDA 1D5XC 5C3XA 1VQPA 1EOVA 4IUNA 2JJQA 3Q8DA 4NXNL 2R92B 3CF5A 1U4RA 3K5LA 4DUYL 2EVBA 5FOBB 4A3DG 4KD3A 3L0OA 3SK6A 3J7AV 2CW0D 1VQOA 1Q90A 5CORA 1XPOA 3GV6A 5KYLA 1ET6A 3SGIA 1HNZL 4A3MG 3CXCA 1U5KA 1EWCA 4RG1A 4GKKL 4KV6A 4DR7L 2FINB 5M3FH 1N9WA 3IKJA 3ND8A 2IHEA 1NY4A 4JYAL 1LV9A 4P75A 3ER0A 1WTWA 3A8JE 3BYYB 4PV1C 3A7AB 5M5YB 1WCMB 1PV4A 4RKLA 2Z0SA 1QCBD 4ID6A 3I73A 1CKNB 3HOZB 1SMYC 4GLXA 1LT5D 1V1OA 3HFZB 1WTHA 4F87A 1DYQA 1XTDA 5CV8A 3SEBA 1EIYB 2E2DC 3HOVB 1M8AA 1ENFA 4IUVA 3AEVA 1R9TH 2E2IH 1S5DD 5LMNL 5ELEA 4QJFA 2F0VA 1FVIA 2EY2A 3K58A 1SYCA 2BH8A 2RSNA 2IHFA 5C4ZA 2YU9B 1JOQA 3KLSA 1Y8PB 1Z9FA 2YTVA 3T56B 3VR2A 3PF5A 4HSVA 3KLRA 3HKZG 1QUQB 1EUJA 2F0MA 4FF2A 2JQOA 4GS3A 3NQIA 2OF1A 1R4QB 1Q81C 2R93G 4UDUC 2Y0SB 3HOZH 3U9OA 4DV4Q 1R4PB 1F77A 4ME5A 2E2HH 2PI2A 1HH2P 2IX0A 5G3LF 3IRBA 1OXUA 2ZJPA 4GKJQ 1XMQL 1EY4A 5EBDA 3HOWB 1HZCA 3R8BA 1Q86C 1PH2A 4DV7L 1QWYA 4EVOA 2PZWA 5FK9C 4A3FG 1HPCA 1GVPA 1L1OA 2RKSA 3NPPA 5EGTA 2R7ZB 2H4OA 4RFBA 1PHJA 4K0KQ 2A6EC 4JPBW 4DNTB 1D2BA 4JBJA 1Q1BA 2SEBD 4IPGA 4X3TA 3NENA 5LL6X 5T1GA 3DHQA 3U9SA 3T1YQ 2UUCQ 4J1MA 2VQEL 4DV2Q 1KL9A 1JJGA 2IPKD 1SRUA 2L9HA 2IY5B 2RF4A 3AFQA 4DF7A 3PUXA 3TP8A 5ELOA 2F0JA 1BCPC 1C4QA 5C44G 1CQFA 2Z4HA 5JJIA 1ICWA 1O80A 1VQDA 1B4OA 1TS3A 4LF4Q 1EWIA 5KIXA 1TT2A 1F9RA 4A3EG 1UEBA 1SDFA 1RKNA 4DV0L 1XNQQ 2GVAA 1STEA 1LTBD 1EQVA 2BDOA 3I4LA 2R7ZH 1F2YA 3VR3A 3GTPB 3VR5A 2ICIA 4WJWA 1FJGQ 2K5WA 2YYZA 2N78A 1LUZA 4RHSA 3TBIB 5K5PA 3NHHA 4JOIA 5A35A 5DAUA 4JI8Q 1ASZA 4JI6Q 2JA9A 3EFXD 4DR3Q 3WOEA 1TS5A 3UDGA 2VQFL 1GUOA 1S3OA 3H3VC 1U0LA 2CW0C 4A93H 1CZWA 4R4OA 2PNRC 1TWAB 1HXYD 5M3MB 2XIWA 1QZGA 2L5TA 2B2WA 1A62A 1A3VA 1E7ZA 1VQ5A 4ILWA 3I7FA 5EPLA 1JORA 2N8NA 4LF6L 5C4XB 3DMUA 2F0QA 1AE3A 3GTPH 4B3SQ 1H9SA 2C5CA 1J6QA 5M5WH 4J8QA 1RIPA 1RODA 4R4QA 3BVGA 4RGMA 1KQSA 2KEEA 2K52A 3I72A 1STAA 1STNA 1KRSA 4A3IH 1NTGA 5LL6S 4ZQ3A 4OEMB 2QCPX 4NKLA 4FXGC 1X54A 3CQZB 4IJLA 4LFCQ 2EJMA 3GTLB 1AP0A 3D4RA 2KUMA 1E3PA 3KOJA 4ZLTF 3PO3B 4RGOS 1TWAH 2F1MA 3MC0B 2K5QA 2EJFC 3V2TA 4JVZA 4C1NK 3A5ZB 5FO9B 5M3MH 3HOXG 1PH9A 2WB1B 4FDBA 1H9JA 1C0AA 1GD7A 1SNDA 3TQYA 1SJED 5C4XH 2UXBQ 2V1CC 1I4XA 1QVGA 3FKIH 4LF8Q 2NBFA 2EYMA 2M2LA 1V1PA 2AQ1B 4EQPA 4WFN3 5JEAH 4JI7L 3UE0A 1VQCA 3JC66 2D62A 1Q3LA 3ULPA 1H9RA 1I94Q 1Y8OB 4ULLA 4DV3L 2JA6G 1DD2A 1XPUA 3EN2A 2ALYB 4ZUJA 4B9XA 4A3LH 3BG3A 1I4HA 3KBGA 4KY6A 2MFIA 5IE8A 5IT9E 5CBEE 1AW7A 5E4XA 3TREA 4LW1A 1EY9A 5E7NA 4FXDA 3AFPA 3H0GG 1Z47A 1VQIA 1HTPA 2Q8RE 3G6JB 2K4KA 2K7VA 5I6YA 1H9MA 1XTCD 5IP9H 1Y14B 3D3RA 1QNUA 1B44D 1A2TA 4MNOA 3EBEA 1V1QA 4BBRG 3S1MH 4B3ML 1Y1VB 3J81j 1OXSC 4LF9L 3ULLA 5BN5A 4HMIA 2GA4B 2K75A 1NR2A 5K36H 1ILQA 2UUBL 4OO1H 1G2TA 2F03A 2K5NA 3VYTA 3LNNA 3RN2A 1WTPA 3S1RB 3BDCA 1IBMQ 1IXRA 2O5IC 1Q82C 1VF5C 2NYZD 3J7AF 3QWNA 1VDZA 3W1GA 1VQ4A 2X6GA 2Y0SE 4A3BB 3OW7A 1AEXA 4EGVA 2F0UA 1B53A 1M4VA 1O78A 4XXEA 1CHPD 2DNCA 2AHOB 2B63G 1XMOL 2D9UA 4IFDG 1E1TA 1Y1VH 1VQAA 1DXMA 5GQOA 1TU2B 4DFAA 3E6ZX 4DV6L 3G71A 3OMGA 2PO4A 2ZTEA 2Z6KA 5C6AA 4OWXB 3RLFA 4JI2Q 4BA2I 4RCNA 2ZXRA 5BN4A 1YVCA 4DAPA 4RHRA 2BE5D 1II3A 2OCEA 3MXUA 3U4ZA 4KY7A 1G291 4PMBA 1J8IA 5FO8B 2JYOA 4XQNA 3ERQA 2RHSB 3KLWA 4CJ2C 2VXWA 1UEAB 4XQJA 5GADC 2MUYA 2CQAA 4RGNA 1EL0A 2I5HA 5CV7A 5D14A 4A3KB 2DUDA 3RLNA 5IYBH 4C2MH 4KJNA 4OL7A 2A68D 3D6WA 1NCVA 1JCKB 4KKTA 5C4HA 1WI5A 2N88A 1IL2A 3CCUA 4HIDA 4CDFC 4HJ7A 2M9VA 4MN3A 3OIPA 1RTNA 4R8IA 1UE1A 5EKIA 1PRTB 4AQYL 4KKUA 4TQUS 5IGCA 1PTOH 4B3RQ 5HGTA 1UE7A 4FF1A 4IURA 4WJ3M 3U50C 1RF2D 4IQZA 3I4NB 2KJXA 1KLUD 1SNPA 2WIIB 4DV1Q 1VCIA 2JXMB 2RDFA 4CHTB 4OX9L 2E2JH 2C35B 2UXCL 1PH7A 2K6AA 4A3KH 5EJWA 3P7JA 4HIKA 1IKMA 2F0IA 3C1EA 3T51B 2ICEC 4DV5Q 1N34Q 1QNKA 3I2ZA 4FP5D 4H13C 1XJVA 2ZXPA 3OHXC 4OWTB 4G7OC 1PRTC 1BF4A 2MGSA 4G57A 5M5XH 3GD7A 5JAVA 2NN6H 2YV5A 5BR8Q 1CA5A 4JBWA 4JK1C 1X65A 4V0BA 1YHBA 2XN9C 4OONA 4KK7A 3I4NH 5C4JH 1YBYA 2F0PA 3UDFA 1SNCA 3MTSA 2UXDQ 2JA7H 5I4DA 1SMYD 4YWKA 5JOBA 2HIXA 3C1FA 2ES2A 1HNWQ 1PYBA 3CU7A 5M3FG 3L3OC 1F2ZA 4YY3Q 2NVXB 4KHPQ 2VUMB 2F0KA 2NZOA 2DJGC 3K7UC 2WB1E 4TSSA 4Y7NB 1SAPA 1E2VA 2RCFA 3HEJA 5KNDA 1JB7A 5DNFA 3PIOA 1CHQD 4O1NA 4BBSB 2OEOA 2NB0A 3LX0A 3Q6SA 2F3WA 5EQ0A 4DAVA 1K9MC 2Z6BA 1HQRD 3TRZA 1Y1WB 1LABA 4LF7L 3RZDB 4FXKC 1JC7A 3T13A 2WAQG 4IFDJ 4IPDA 4UP8A 5C3EB 3K7AB 2XVSA 1TWHH 2E74C 1CKNA 3O13A 1HZBA 3E9IA 2VUMH 1SXTA 4JI1Q 2XGTA 1K3BC 2PZTA 4Y7NH 4DNRB 4DV4L 2EQSA 4A3JB 2A5HA 2QEJC 4CJ0B 4GKJL 4BBSH 5GROA 3SXHA 3HOZG 2BE5C 5ELFA 2L1BA 2MP1A 4LF5L 3OWFA 2QILA 4R8NA 1X6OA 3I4OA 4JW0A 1EYAA 1I6HH 3BZCA 1Z7TA 3CMAA 1Y1WH 3MEFA 3LGJA 3MFYA 4YWLA 4JBKA 3RZOH 1X3FA 1LTAD 4PNYA 4XIGS 1KDAA 3RZDH 3W5OA 4K0KL 4KJOA 1TR5A 1WYDA 4GLVB 3RMHA 1QUQA 2ASBA 3SR1A 3T1YL 2SNMA 2UUCL 4BXXH 2EXZA 5C3EH 1KIXA 2A68C 2HCIA 4IUPA 1TWGB 2BDNA 4DXGA 5KRUA 3MVVA 3GTQB 4C3JB 1KABA 3D31A 4HCSA 4P74A 4R9WA 4A3JH 2UUAQ 1JR0D 2RDHA 2VS1A 2L55A 1J5EQ 4LF4L 1BXTA 1EIFA 1CQVA 3AU7A 2R61A 2LXJA 4Q5VA 4C3HB 2HHHQ 1Q12A 1PZKD 3R3OA 1N36Q 3KF6B 1BBUA 2B3GA 3A56A 4XYOA 2K33A 4WORA 3K57A 1RL2A 5KGUA 2RA4A 4QGUA 5COYA 1KTKA 5HY6A 4DA2A 2QGQA 3M7NA 1SYEA 1FJGL 4HCEA 5IWAQ 2HIVA 3M85A 2R7ZG 3M9BA 1HFGA 4ZRZA 3A7LA 1JOOA 1HR0Q 3OPOA 2R3ZA 2ZTDA 5KNCA 1I6VC 4HMJA 1NJIC 5D3IB 1TWGH 4JI8L 4CJ1B 3J7ZC 4A76A 3GTQH 4C3JH 3J80L 2EYLA 1PYWD 1X3QA 1FGBD 1H95A 2KA7A 5IGBA 3BDLA 3CMEA 1YNXA 4LUZA 5JJZA 3FVQA 3HZXA 4QB4A 4I7AA 5JPMC 3TEHB 3PV0A 1L0XB 4LNQA 1OXTA 1YZ6A 4A93G 1E0BA 3I8ZA 3HOUB 4LMQD 4O42A 2CH4A 3CRKC 4J15A 3HGBA 1HUNA 1CI3M 1PZID 2WP8J 4B3SL 2R92H 4NB3A 1ESFA 2WINB 4F7XA 4IFDI 4DR2Q 3BZKA 2AMCB 5DLQE 1TVXA 1TY2A 1Y8NB 3CAMA 2AKWB 1X3PA 2F0SA 3J80c 1WTXA 3K0YA 1TWCB 4F88A 1XNRQ 4LFCL 3QIAA 1P16A 1CA6A 2JA8B 1EFID 3F2UA 2HD3A 5LMUQ 4A3IG 4L5SA 1WJJA 3EJIA 2RCNA 4JV5Q 1W3SA 1QZHA 4A75A 5M5YH 1WCMH 3HOUH 5M3MG 2UXBL 1FNVA 1ONLA 3MXNB 4KMUC 1B70B 4LF8L 1PFSA 2F52A 1JWSD 4KD4A 2B2UC 3UDIA 4G4KA 1PLFA 5C4XG 3OWEB 1I94L 2A1AA 3FKIG 3HOVH 2G9HD 4GNXB 5JEAG 3Q24A 3DUZA 5NUCA 1KDBA 2R7FA 1TWCH 1QVFA 1TWFB 4HJ9A 2FXQA 4CDDC 2ZJRA 5IOCA 3F2BA 4X65Q 4X62L 4JI3Q 4A3LG 5J39A 1K8OA 1HTLD 3PIPA 5EKLA 1SMXA 4RAUC 2YU9H 4DR6L 3PGZA 1HZAA 4HN7A 3RUZA 3A8IE 3S1QB 1FD7D 4XTCS 3EROA 5D65A 2IL8A 1S5CD 5IP9G 1HA6A 3L2PA 3AB9A 1TQOA 4A3DB 1MGSA 3B6YA 4DR4Q 4S3SA 3T16A 1BKBA 4B08A 2XRQD 4HJ8A 1T5EA 3KF8A 2ZXOA 1MJEA 5I2XA 3T53B 2AUKA 3EA6A 4AH6A 3HOWH 4A3MB 4GNXC 5K36G 3K5OA 1VQMA 2JE6I 1IBML 4OO1G 4H7BA 1D5ZC 1TS2A 3URYA 2ZM6L 1S40A 4LUVA 1EEFD 5J22A 1STYA 4XT3B 4LAAA 4JI5Q 1V8QA 2XRSD 2VNUD 3DEOA 4M1UB 1KLGD 2MO1A 3VA7A 1YNND 4DK0A 2AWOA 5JJKA 3MXGA 5E3FA 3BU2A 2Q2UA 2PMZB 5I9PA 1A8VA 4WJ4A 5HURA 5C0XH 5IGDA 3AMUA 2B8FA 5A2QL 4ZK9B 1FNUA 1JJCB 3KFUA 4HSPA 4QCLA 3H3VH 1Y1VG 2BOSA 1YJNA 3TZUA 1NNXA 2K32A 4KLKA 4JI2L 2QKIC 1VQFA 4OHJA 4OELB 4X66L 5EPKA 2EYOA 2JEAI 1PDQA 1PFMA 4OIJA 5M9OA 2RVLA 1HNZQ 1EY8A 4PMCA 4GOPB 1K3RA 2KQ3A 4DPGA 1WTOA 1VQNA 4RWSC 1N32L 2HQEA 1P8LA 4KTAA 4GKKQ 5CC4A 1NE3A 1PFBA 2F4IA 2VL6A 3A74A 1VMPA 4JYAQ 3X3MA 3OSOA 1MKHA 1MIUA 1HCZA 4HEDA 4TVAB 1CK1A 1F9QA 2ID0A 3K5NA 2I46A 5IYBG 3E0EA 3H6MA 3K81C 2Q8TA 4X6AH 1B9MA 2QEXA 4R1JA 1IL8A 4KY5A 1WD1A 2FFKB 1EIHA 3K59A 2DGYA 2F0NA 3C2PA 1O7IA 3OW2A 1MSGA 2X6LA 3CP0A 1D8LA 2B2VC 2K05A 4GOPC 1GO3E 3I3CA 3D4WA 3N6RA 1SNMA 2E8GA 3P20A 1OO9B 2K5DA 2B39A 2DY8A 3M4PA 4K8IA 2MJ8A 1LTTD 1SNOA 1LT4D 1SR3A 4K2LA 2MNAA 1GXDC 2AUJD 1OXXK 3E0JA 1PRTD 1BCPF 3BZDB 4X3UA 3T1HQ 1B1ZA 4A3KG 2F3IA 4POFA 3CQZH 2A73B 3S1NB 3GTLH 3E3XA 4K5XA 3TP6A 1WFQA 2L4NA 4A3EB 5JEAJ 1VQ9A 3PO3H 3KDFB 2BA1A 1GUNA 1VQJA 2LMCB 1XMQQ 1RHPA 2K03A 3CCMA 4CKEA 4YHHQ 4K6LA 1JWMD 4RMFA 3NSWA 2NN6G 5I9OA 3TS0A 2J7ZA 4BS9A 4JCVE 3I4NG 3R2IA 1HNWL 1RJTA 2JA7G 4YY3L 1ZKOA 5FJ8H 4ZUIA 2PQAB 3QB3A 1PXUA 1U4PA 2EYFA 3BVMA 2FJ2A 1Q8KA 1X55A 4UAIA 1ASYA 2CHBD 5C5MA 3TS2A 1VMCA 1HFNA 5DM73 1UE6A 2A74C 3NBHB 1EU4A 1SSOA 5LHY1 4FF3A 4LFAQ 2LKVA 4PZ8A 1CT1D 1QG7A 3GTKB 1B2TA 1SBBB 3QJYA 4EX5A 4N9TA 1EY6A 3MFGA 1YNNC 4MHEA 4YWMA 3S24A 4DR1L 1IBKL 4TRDA 1PH6A 1BNZA 2KBNA 1EZ6A 2EPBA 3QOLA 1IKLA 1SYDA 2XWBB 1QVCA 1U4LA 3S1RH 4X64Q 1I5FA 1H9SB 4JI1L 3FHWA 4LFBL 2EIFA 1LTGD 1T5XD 1ENCA 1NSNS 1YEZA 3KJPA 2VUMG 4EQ5A 4NXML 3PO2B 3H94A 4A3BH 2LXKA 2UU9L 3CCEA 2CH4W 1ESRA 1A3UA 4HAEA 4BBSG 4P72A 4CBVA 1HA5A 2KVMA 5IYCH 2OXPA 3NBIA 2Q2TA 1IHZA 1FGUA 4GN3B 3KK7A 4LF6Q 4APVA 4B3TQ 5IGEA 2MO0A 3TDQA 3K8AA 4QUFA 2JA6B 1Y1WG 4C56C 3P75A 4PMWA 3U58A 4DR5L 1E2WA 1V1PB 2L0CA 2OT2A 2XSCA 1K83B 4IUUA 4G7ZC 2EXDA 1N8RC 4BXXG 1Q1EA 5FO7B 3HOYB 4L6TB 5G3LD 1B9NA 2PMZE 3PMFA 2DN8A 3H0GB 4LK1C 5C3EG 1VQ6A 4MZ9A 3RD4A 2UUAL 2I07B 5I6WA 3UI2A 4GZYC 5H1SE 3PO2H 4CKBA 2HHHL 4A3JG 1L0WA 1N36L 4UY8C 4LWCA 1B3QA 1SE3A 1JOKA 1L2FA 1I50B 1MBYA 1BR9A 1SE4A 2LFNA 3M4YA 1HJPA 3MAQA 1AN8A 1D1KA 3ULJA 4DK1A 3M4OB 2AQ2B 4QL5A 1CKMA 5ISRA 3MWYW 3D0FA 4JI7Q 3PF4A 3OOCA 1HR0L 1XPRA 2F0DA 4H44C 3CC7A 1E24A 1E22A 1PH3A 4DV3Q 3SVMA 1C48A 3HOYH 1BVSA 1ZEQX 1U4MA 1SNQA 4O0AA 3SDZA 4C3IB 5ELBA 2KECA 1W6JA 4OO1I 2A19A 4C3JG 2B63B 3KF6A 4HJ5A 1LLRD 1SJHD 1I3QB 1L0YB 3SHLA 3M3YB 5AFWA 2XTIA 1M90C 3CPWA 3AYHB 3ONAB 4LF9Q 2HDLA 2KEDA 2RSOA 3GTOB 2LSSA 4DR2L 3L9AX 2NVYB 4A3GB 3VYSA 2KCTA 1I4GA 2R92G 3FDTA 3KBXA 4DKAC 1A3TA 5DEHA 3S2DB 2HUGA 2KENA 1XNRL 2NVQB 1F9PA 1YI2A 3F2CA 5JPNC 4C3IH 3GTJB 3W2DA 2JA5B 1EIGA 1G51A 1ENAA 4CDCC 2I0QA 4JI0Q 3S16B 1KNAA 2F0OA 3M3YH 4FF4A 5C3WA 1Y69U 2G9DA 2NVXH 2B2UA 2F0TA 1XMOQ 5C5LA 2MQHA 3UE1A 5BN3A 1C8CA 5AJ3Q 1WCMG 3HOUG 3R93A 1DCZA 1H9KA 1O7LA 2K28A 1B50A 1PH5A 1PTOF 2B29A 2EY5A 4Q0FA 4A3GH 2CVRA 1MJCA 4IUTA 3DWAA 1K8MA 4DAMA 1B8AA 1YJ9A 2NTSA 3H15A 1SEBD 1KDCA 2ZTCA 1IYJB 4L63B 2NVQH 2FMCA 3HOVG 3K5MA 2N49A 2B2TC 1EYCA 4I7ZC 3Q0AA 4X65L 2F0EA 1EY7A 3VDYA 3I90A 4JI3L 5J3BA 3S17B 4K8JA 1XWEA 2JA5H 1AFPA 1TIID 1EOTA 4R4TA 2ENBA 2SNSA 3WWVA 2SOBA 2L15A 1LT6D 3K7AH 3S16H 4DAYB 3MXNA 4DV2L 1JMCA 3D4DA 4JI4Q 3CKIB 1C7YA 1YNJD 3CC4A 4QQBX 4R4IA 1STBA 5FLMH 3RLOA 3PQIA 2B2YC 2VB3X 4GNXA 2NUCA 1G8ZD 3H09A 4KHZA 4NMZA 1GUTA 2Y0SG 1KNEA 1HUMA 1PH4A 1X32A 2A69D 3EIVA 3BDOA 2NVTB 4HR7B 2R6GA 2JK8A 4AQYQ 1OTCA 1DM0B 1EQTA 1VQ7A 5IP7H 1X56A 1XNQL 1EZ8A 3HOWG 1CSPA 2F4VQ 2HT1A 3I4MB 4JI5L 3M4QA 2NZ1D 1ML0D 3S17H 4HIMA 5GAGC 1NBWA 5E1FA 5M3FB 1W2BA 2E5LQ 1KHIA 3CCSA 2WV6D 1JQYD 2Q2HA 4J6HA 3A5UA 4BY7B 3L7ZC 3S14B 2NN6I 1A0IA 1YHQA 4JI6L 3HS0C 4YIJA 4GN4B 3GDEA 4DR3L 3VYUA 2F0LA 2VB2X 2I5MX 3CCVA 5C0XG 5IIFA 2KOLA 2CKZB 2MPMA 3PUVA 4QIWB 4BY1B 2VZAA 4C3HH 2NVTH 4DUZQ 4JBMA 2OWOA 2OTLA 1R9TB 2HDMA 2CWPA 1IW7D 1Q46A 2E2IB 1TXYA 4DK6C 2WFWA 3I4MH 1X3GA 2WAQB 1A63A 2Z1CA 1PZJD 4F8MA 4ODGA 3JAML 2DNEA 5FLXL 5I2YA 1I4QA 2QDLA 4IPCA 3J80E 4K14A 1KRTA 4BY7H 3S14H 2K1BA 3DXJC 4YCVA 1FNWA 1NMFA 4ZCKA 3CC2A 1TS4A 4QY7A 3EQLC 5HGQA 2H5XA 3NK9A 1LTRD 4RKBA 2K5HA 3GP7A 1N33Q 5EKKA 1DGSA 2KCCA 2E2HB 4FO2A 3X3NA 3CCRA 1EWHA 5LMNW 1M1KC 2Q8IB 3G7LA 3NXWA 5CV9A 1LT3D 3M7GA 4PG3A 1HNXQ 4BY1H 4QUCA 2B2VA 3IFDA 4FYDA 4RA8A 3FEWX 3LWUA 4GOPA 4E6IA 1XX8A 3PSIA 3JAME 3KUPA 4A4IA 1BQQT 2EDGA 5FLXE 1IBLQ 4QF4A 3PUZA 1XYIA 2SDFA 1OXVA 3JAMc 3NTHA 2VW9A 1GUWA 4LF7Q 3TMEA 3FPPA 5FLXc 4DGZA 2E75C 1EY0A 1GHJA 1YHAA 1BO0A 1EFWA 4LJZC 4CKCA 1BOSA 4YCWA 3F1ZA 1ZYRD 4O2DA 4BA1I 3CHBD 3T1HL 3TZDA 1DZ1A 1PH1A 4A3CH 3TSSA 2D2CC 2JA8H 4K5VA 3CRLC 3OTOQ 4AYBB 1BCPB 1S5FD 3ZYYX 2NZHA 4RCOA 2N55A 2KHSA 2P5ZX 4KHVA 2A6HC 4JC0A 4OIKA 3S9WA 1KAAA 1RD9D 3D8GA 1V9PA 4FVMA 2K5VA 1IYVA 4YHHL 3PO3G 1CZGA 1SN8A 5IYDH 2WB1G 1X3EA 3HP3A 2L12A 3ERSX 4NP5A 1K8AC 1D7QA 3J81L 2CFMA 3RNUA 4K6DA 1EY5A 3DLLA 3A54A 5EAYA 1YNJC 1IZ6A 2IWHA 3ND9A 1K73C 2CCZA 2O4XA 1JE5A 5CR3A 1WTQA 1TWFH 1UE5A 2WACA 4AIMA 2Z4IA 3KDFA 2A8VA 2DY7A 1HZ9A 1QOHA 1K0SA 2A69C 1PYSB 3CW2C
chains in the Genus database with same CATH topology
4A93B 1JICA 1XXGA 3SE0A 1W6KA 5EBCA 2HCCA 1U9RA 2C9OA 5D3DA 4NDXA 3A8KE 3NQTA 1WTRA 3J81E 3PIO3 3MZ5A 1J9OA 4KN4C 2ZT9C 3I70A 4XT1B 1UNSA 1V43A 3P1HA 1EEID 3IFTA 4XDXA 1EYDA 3TP5A 3VR4A 5CYUA 3PUWA 3SK4A 1B3AA 5M5WB 2O5JC 3DM1A 5IODA 4RGTA 2B8GA 4KI0A 3DWQA 1O7YA 5C0XJ 1S5ED 1JE4A 4BWGB 4N9PA 4A3IB 3GTGB 1WD0A 2Z8LA 3NBHA 1S4ZA 4EQNA 1QILA 2NWGA 3HKZB 5A2QE 1IW7C 2WKCA 2R93B 3J7YW 5KYIA 4RH6A 1BBXC 2TSSA 5KNBA 3FKIB 4XYQA 1QB5D 1G6ZA 5IGFA 4A3FB 3HG9A 1STHA 3MA2B 1PTOD 2PW5A 1CM9A 2F3VA 1UUPA 1EU3A 4U68A 5IGGA 1ILPA 5IT9L 5CBAE 1F2MA 1D6EC 5C44B 4IN3A 3S1MB 4DN4M 5FKAC 5J1ZA 3ITPA 2MHVA 3DWPA 4WRDA 1G91A 1F2LA 2EYJA 5CV4A 1TY0A 1ZYRC 1E2ZA 2X69A 1SYGA 2PW7A 3BVZA 4X3KA 1VF7A 4HTHA 3A55A 4ZYSA 1O7ZA 3V96A 3NP8A 3IAYA 4IUQA 3T4AC 3BYTB 4B9WA 1PMRA 1G2SA 1LACA 1AZQA 3OIQA 3KLSX 3NUCA 2XNAC 3FPUB 3HRZC 3MXPA 1GOZA 2LY7A 3Q22A 3GV3A 3N52A 5C0XI 4MIUA 2K01A 1DOKA 2F0HA 3I91A 1NAPA 2EY6A 1A6XA 4OGQC 3FMCA 4TKOB 5E4WC 2IJ0A 5EPJA 3Q23A 1I4PA 4C3IG 1DJRD 2J0TD 2K04A 1RTOA 3GTMB 2TMPA 2E76C 4C2MB 5JVH3 1MI2A 3MHBA 4K2KA 1WVLA 4I65A 3HOXB 4ZKCB 2F0FA 1BUVT 5KEEA 4QMGA 2B2TA 1SE2A 2F0WA 1PTOB 3E5SA 3FRPB 3NTIA 2B2WC 1IYUA 4ZAIA 3IL8A 1SFOB 3S15B 1QJOA 5F2DA 1GUGA 2E2JB 1TKWB 5TSSA 3D6CA 2B2YA 5JVG3 1DOLA 4V190 3TP7A 2PPBC 3PIP3 4IALA 4G7HC 1FYCA 1S5BD 4CGYB 5CGKA 4H0LC 1DONA 3LWEA 2FHTA 2QF7A 3C3LA 4BBRB 2PZUA 3TN2A 1MSHA 5M5XB 1PTOC 3NTKA 4IZ8A 3NWTA 3NWSA 5C4JB 4DAYA 2LS01 4C1NI 2JA7B 2EJGC 2EYHA 1D1IA 4PQXA 1HQMC 4ZKBB 2J4XA 5T1IA 4P2CB 1RCVD 3QOJA 2O2LD 5CV6A 3S2HB 1GJXA 1SYBA 5CV5A 4Z9CB 1UAPA 4C3HG 1Q8IA 3WOFA 1CFMA 2PYKA 1CTMA 2WKDA 4U673 1TWHB 3OMCA 1SYFA 1A2UA 1RDPD 4XQQA 2KCNA 2L11A 2RDGA 2IX1A 1HHVA 1STGA 4M8AA 5DM63 2EZVA 1NR4A 3GQBA 5CMDA 2PQEA 1GUSA 4IFDH 2JP1A 1Z6HA 4KKSA 2JEBI 3VR6A 1I6HB 3WDNA 2NTTA 1ET9A 2RBMA 1LTID 3K6OA 3V05A 2H1EA 3RZOB 4ABNA 2IT1A 3PUYA 2IW3A 1QE6A 3SK8A 4DU9A 4X3SA 2F0GA 2PCFB 4NW2A 1AZPA 2BCOA 2M00A 3VA5A 4K5WA 2A6HD 2V4DA 1HRJA 3NE5B 2EOTA 3GO5A 3SK5A 1PFNA 4KN7C 1NUCA 1JB3A 1I4RA 2D5DA 3H91A 4FNFA 2A6ED 3QO2A 1A15A 3EVQA 4DXFA 4L8JA 3QG1A 3C46A 2FMMA 1FR3A 1PRTF 2EYPA 2EY1A 2RQXA 2XWJB 3W3AA 1JWUD 3DEPA 1BCPD 2QDBA 2AWNA 3R2TA 1LTSD 1DOMA 1D5MC 2IX3A 1WTVA 5ELCA 3BS1A 2BA0A 3VYRA 2JSOA 3MEHA 1LO5D 1F9SA 4EQOA 1GHKA 2AQ3B 2EE1A 1ZXTA 1MD2D 1BDOA 5ELDA 1D5XC 5C3XA 4IUNA 2R92B 1U4RA 3K5LA 2EVBA 5FOBB 4KD3A 3SK6A 3J7AV 2CW0D 1Q90A 5CORA 3GV6A 5KYLA 1ET6A 1EWCA 4KV6A 2FINB 3IKJA 3ND8A 1LV9A 1WTWA 3A8JE 3BYYB 4PV1C 3A7AB 5M5YB 1WCMB 4RKLA 1QCBD 4ID6A 3I73A 3HOZB 1SMYC 1LT5D 1V1OA 4F87A 1DYQA 5CV8A 3SEBA 2E2DC 3HOVB 1M8AA 1ENFA 4IUVA 1S5DD 5ELEA 2F0VA 2EY2A 3K58A 1SYCA 2RSNA 5C4ZA 2YU9B 1JOQA 3KLSA 1Y8PB 3T56B 3VR2A 4HSVA 3KLRA 4FF2A 2F0MA 3NQIA 2OF1A 1R4QB 4UDUC 2Y0SB 3U9OA 1R4PB 1F77A 4ME5A 2IX0A 5G3LF 1OXUA 1EY4A 5EBDA 3HOWB 3R8BA 1QWYA 4EVOA 2PZWA 5FK9C 1HPCA 2RKSA 3NPPA 5EGTA 2R7ZB 2H4OA 4RFBA 2A6EC 4DNTB 1D2BA 1Q1BA 2SEBD 4X3TA 5LL6X 5T1GA 3DHQA 3U9SA 4J1MA 2IPKD 2L9HA 4DF7A 3PUXA 3TP8A 2F0JA 1BCPC 1C4QA 1CQFA 2Z4HA 1ICWA 1O80A 1B4OA 1TS3A 5KIXA 1TT2A 1F9RA 1SDFA 1RKNA 1STEA 1LTBD 1EQVA 2BDOA 3I4LA 1F2YA 3VR3A 3GTPB 3VR5A 2ICIA 4WJWA 2K5WA 2YYZA 4RHSA 5K5PA 3TBIB 3NHHA 5A35A 5DAUA 3EFXD 3WOEA 1TS5A 1GUOA 3H3VC 2CW0C 1CZWA 2PNRC 1TWAB 1HXYD 5M3MB 2XIWA 2L5TA 2B2WA 1A3VA 4ILWA 5EPLA 1JORA 5C4XB 3DMUA 2F0QA 1H9SA 2C5CA 4J8QA 1RODA 4RGMA 3BVGA 2KEEA 3I72A 1STAA 1STNA 5LL6S 4ZQ3A 2QCPX 4NKLA 4FXGC 3CQZB 2EJMA 3GTLB 1AP0A 3D4RA 2KUMA 4ZLTF 3PO3B 4RGOS 5FO9B 2F1MA 3MC0B 4C1NK 2K5QA 2EJFC 3V2TA 2WB1B 1H9JA 1SNDA 1SJED 1I4XA 2NBFA 2EYMA 2M2LA 1V1PA 2AQ1B 4EQPA 4WFN3 5JEAH 2D62A 1Q3LA 1H9RA 1Y8OB 4ULLA 1DD2A 4B9XA 4ZUJA 3BG3A 1I4HA 3KBGA 4KY6A 5IT9E 5CBEE 1AW7A 5E4XA 1EY9A 4FXDA 1Z47A 1HTPA 2Q8RE 3G6JB 2K7VA 5I6YA 1H9MA 1XTCD 3D3RA 1QNUA 1B44D 1A2TA 1Y1VB 1OXSC 5BN5A 4HMIA 2GA4B 1NR2A 5K36H 1ILQA 4OO1H 1G2TA 2F03A 3VYTA 3LNNA 1WTPA 3S1RB 3BDCA 2O5IC 1VF5C 2NYZD 3J7AF 3QWNA 1VDZA 2X6GA 4A3BB 3OW7A 4EGVA 1AEXA 2F0UA 1B53A 1M4VA 1O78A 4XXEA 1CHPD 2DNCA 2D9UA 4IFDG 1DXMA 1TU2B 4DFAA 3E6ZX 3OMGA 2PO4A 5C6AA 3RLFA 4BA2I 4RCNA 2ZXRA 5BN4A 4DAPA 4RHRA 2BE5D 1II3A 3MXUA 4KY7A 1G291 4PMBA 1J8IA 5FO8B 2JYOA 4XQNA 3ERQA 4CJ2C 2VXWA 1UEAB 4XQJA 2MUYA 2CQAA 4RGNA 1EL0A 5CV7A 5D14A 4A3KB 4KJNA 4OL7A 2A68D 3D6WA 1NCVA 1JCKB 4KKTA 5C4HA 2N88A 2M9VA 4MN3A 3OIPA 1RTNA 4R8IA 5EKIA 1PRTB 4KKUA 4TQUS 5IGCA 1PTOH 5HGTA 4FF1A 4IURA 1RF2D 4IQZA 3I4NB 2KJXA 1KLUD 1SNPA 2WIIB 1VCIA 2JXMB 2RDFA 4CHTB 2K6AA 5EJWA 3P7JA 1IKMA 2F0IA 3C1EA 3T51B 2ICEC 1QNKA 4FP5D 4H13C 2ZXPA 3OHXC 4G7OC 1PRTC 1BF4A 2MGSA 4G57A 3GD7A 5JAVA 2NN6H 1CA5A 4JBWA 4JK1C 4V0BA 2XN9C 4KK7A 2F0PA 1SNCA 3MTSA 5I4DA 1SMYD 5JOBA 3C1FA 3CU7A 3L3OC 1F2ZA 2NVXB 2VUMB 2F0KA 4Y7NB 4TSSA 1SAPA 1E2VA 3HEJA 5KNDA 5DNFA 1CHQD 4O1NA 4BBSB 2OEOA 2NB0A 3LX0A 3Q6SA 2F3WA 5EQ0A 4DAVA 1HQRD 1Y1WB 1LABA 3RZDB 4FXKC 1JC7A 3T13A 4IFDJ 5C3EB 3K7AB 2XVSA 2E74C 3O13A 1SXTA 2PZTA 4DNRB 4A3JB 2A5HA 2QEJC 4CJ0B 3SXHA 2BE5C 5ELFA 2L1BA 2MP1A 3OWFA 2QILA 4R8NA 1EYAA 1Z7TA 3MFYA 1LTAD 4PNYA 4XIGS 1KDAA 4KJOA 1TR5A 3RMHA 3SR1A 2SNMA 2EXZA 2A68C 2HCIA 4IUPA 1TWGB 2BDNA 4DXGA 5KRUA 3MVVA 3GTQB 4C3JB 1KABA 3D31A 4HCSA 4R9WA 1JR0D 2RDHA 2L55A 1BXTA 1CQVA 3AU7A 2R61A 4Q5VA 4C3HB 1Q12A 1PZKD 3R3OA 3A56A 4XYOA 2K33A 4WORA 3K57A 5KGUA 2RA4A 5COYA 1KTKA 4DA2A 3M7NA 1SYEA 4HCEA 3M85A 1HFGA 4ZRZA 3A7LA 1JOOA 3OPOA 2R3ZA 5KNCA 1I6VC 4HMJA 5D3IB 4CJ1B 3J80L 2EYLA 1PYWD 1X3QA 1FGBD 2KA7A 5IGBA 3BDLA 5JJZA 3FVQA 3HZXA 4QB4A 5JPMC 3PV0A 1L0XB 1OXTA 1E0BA 3I8ZA 3HOUB 4LMQD 4O42A 3CRKC 3HGBA 1HUNA 1CI3M 1PZID 2WP8J 1ESFA 2WINB 4F7XA 4IFDI 1TVXA 1TY2A 1Y8NB 1X3PA 2F0SA 1WTXA 3K0YA 1TWCB 4F88A 3QIAA 1CA6A 2JA8B 1EFID 3F2UA 3EJIA 1FNVA 1ONLA 4KMUC 1JWSD 4KD4A 2B2UC 4G4KA 1PLFA 3OWEB 2G9HD 5JEAG 3Q24A 3DUZA 5NUCA 1KDBA 1TWFB 5IOCA 5J39A 1K8OA 1HTLD 5EKLA 4RAUC 4HN7A 3RUZA 3A8IE 3S1QB 1FD7D 4XTCS 3EROA 5D65A 2IL8A 1S5CD 1HA6A 3AB9A 1TQOA 4A3DB 1MGSA 4S3SA 3T16A 4B08A 2XRQD 1T5EA 3KF8A 2ZXOA 5I2XA 3T53B 2AUKA 3EA6A 4A3MB 5K36G 3K5OA 2JE6I 4OO1G 4H7BA 1D5ZC 1TS2A 3URYA 1EEFD 5J22A 1STYA 4XT3B 4LAAA 1V8QA 2XRSD 2VNUD 3DEOA 4M1UB 1KLGD 3VA7A 1YNND 4DK0A 2AWOA 3MXGA 5E3FA 2PMZB 5I9PA 5HURA 5C0XH 5IGDA 3AMUA 2B8FA 5A2QL 4ZK9B 1FNUA 4HSPA 4QCLA 2BOSA 3TZUA 2K32A 2QKIC 4OHJA 5EPKA 2EYOA 2JEAI 1PDQA 1PFMA 4OIJA 5M9OA 2RVLA 1EY8A 4PMCA 2KQ3A 1WTOA 4RWSC 2HQEA 4KTAA 5CC4A 2F4IA 1PFBA 1VMPA 3X3MA 3OSOA 1HCZA 4HEDA 1CK1A 1F9QA 2ID0A 3K5NA 2I46A 3H6MA 2Q8TA 1B9MA 1IL8A 4KY5A 1WD1A 2FFKB 1EIHA 3K59A 2F0NA 3C2PA 1MSGA 2X6LA 2B2VC 2K05A 3I3CA 3D4WA 3N6RA 1SNMA 3P20A 1OO9B 2K5DA 2B39A 2DY8A 4K8IA 2MJ8A 1LTTD 1SNOA 1LT4D 4K2LA 1GXDC 2AUJD 1OXXK 3E0JA 1PRTD 1BCPF 3BZDB 4X3UA 1B1ZA 2A73B 3S1NB 4K5XA 3TP6A 2L4NA 4A3EB 5JEAJ 2BA1A 1GUNA 2LMCB 1RHPA 2K03A 4CKEA 4K6LA 1JWMD 3NSWA 2NN6G 5I9OA 4BS9A 2J7ZA 3R2IA 1RJTA 1ZKOA 4ZUIA 3QB3A 1PXUA 1U4PA 2EYFA 3BVMA 2FJ2A 4UAIA 2CHBD 5C5MA 1VMCA 1HFNA 5DM73 2A74C 1EU4A 1SSOA 5LHY1 4FF3A 2LKVA 1CT1D 1QG7A 3GTKB 1B2TA 1SBBB 3QJYA 4N9TA 1EY6A 3MFGA 1YNNC 4MHEA 4TRDA 1BNZA 1EZ6A 2EPBA 3QOLA 1IKLA 1SYDA 2XWBB 1U4LA 1H9SB 1LTGD 1T5XD 1ENCA 1NSNS 3PO2B 3H94A 1ESRA 1A3UA 4HAEA 4CBVA 1HA5A 2KVMA 2OXPA 3NBIA 1IHZA 3KK7A 5IGEA 4QUFA 3TDQA 2JA6B 4C56C 3P75A 4PMWA 1E2WA 1V1PB 2L0CA 2OT2A 2XSCA 1K83B 4IUUA 4G7ZC 1Q1EA 5FO7B 3HOYB 4L6TB 5G3LD 1B9NA 3PMFA 2DN8A 3H0GB 4LK1C 3RD4A 2I07B 5I6WA 3UI2A 4GZYC 4CKBA 1SE3A 1JOKA 1I50B 1MBYA 1BR9A 1SE4A 2LFNA 3M4YA 3MAQA 1AN8A 1D1KA 4DK1A 3M4OB 2AQ2B 5ISRA 3MWYW 3OOCA 2F0DA 4H44C 3SVMA 1C48A 1ZEQX 1U4MA 1SNQA 3SDZA 4C3IB 5ELBA 2KECA 1W6JA 4OO1I 4C3JG 2B63B 1LLRD 1SJHD 1I3QB 1L0YB 3SHLA 3M3YB 5AFWA 3ONAB 2HDLA 2KEDA 2RSOA 3GTOB 3L9AX 2NVYB 4A3GB 3VYSA 1I4GA 3FDTA 3KBXA 1A3TA 5DEHA 3S2DB 2HUGA 2NVQB 1F9PA 5JPNC 3GTJB 3W2DA 2JA5B 1EIGA 1ENAA 3S16B 1KNAA 2F0OA 4FF4A 5C3WA 1Y69U 2G9DA 2B2UA 2F0TA 5C5LA 5BN3A 1C8CA 3R93A 1DCZA 1H9KA 1O7LA 2K28A 1B50A 1PTOF 2EY5A 4Q0FA 2CVRA 4IUTA 3DWAA 1K8MA 2NTSA 1SEBD 1KDCA 4L63B 2FMCA 3K5MA 2B2TC 1EYCA 4I7ZC 3Q0AA 2F0EA 1EY7A 3I90A 3S17B 4K8JA 1XWEA 1AFPA 1TIID 1EOTA 2ENBA 2SNSA 2SOBA 1LT6D 3MXNA 3D4DA 3CKIB 1YNJD 1STBA 2B2YC 2VB3X 2NUCA 1G8ZD 3H09A 4KHZA 4NMZA 1GUTA 1KNEA 1HUMA 1X32A 2A69D 3BDOA 2NVTB 4HR7B 2R6GA 1DM0B 1EQTA 1EZ8A 3I4MB 2NZ1D 1ML0D 5E1FA 5M3FB 2WV6D 1JQYD 4J6HA 4BY7B 3L7ZC 3S14B 2NN6I 3HS0C 4YIJA 3VYUA 2F0LA 2VB2X 5C0XG 5IIFA 2KOLA 2MPMA 3PUVA 4QIWB 4BY1B 1R9TB 2HDMA 1IW7D 2E2IB 2WAQB 2Z1CA 1PZJD 4F8MA 4ODGA 3JAML 2DNEA 5FLXL 5I2YA 1I4QA 3J80E 4K14A 2K1BA 3DXJC 1FNWA 1TS4A 3EQLC 3NK9A 1LTRD 4RKBA 3GP7A 5EKKA 2KCCA 2E2HB 4FO2A 3X3NA 1EWHA 2Q8IB 3G7LA 3NXWA 5CV9A 1LT3D 3M7GA 4QUCA 2B2VA 3IFDA 4FYDA 4RA8A 3FEWX 3LWUA 4E6IA 1XX8A 3JAME 3KUPA 1BQQT 2EDGA 5FLXE 4QF4A 3PUZA 1XYIA 2SDFA 1OXVA 3NTHA 1GUWA 3TMEA 3FPPA 4DGZA 2E75C 1EY0A 1GHJA 1BO0A 4LJZC 4CKCA 1BOSA 1ZYRD 4BA1I 3CHBD 3TZDA 1DZ1A 3TSSA 2D2CC 4K5VA 3CRLC 4AYBB 1BCPB 1S5FD 3ZYYX 4RCOA 2N55A 2KHSA 4KHVA 2A6HC 4OIKA 3S9WA 1KAAA 1RD9D 3D8GA 4FVMA 1IYVA 1CZGA 3HP3A 2L12A 4NP5A 3J81L 4K6DA 1EY5A 3A54A 1YNJC 2IWHA 3ND9A 2O4XA 5CR3A 1WTQA 2WACA 2Z4IA 2DY7A 1QOHA 2A69C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2I A;  1PTO F;  4OHJ A;  4DXG A;  3DWP A;  1I4Q A;  1XXG A;  2XN9 C;  3DWA A;  4RFB A;  5D3D A;  1FNV A;  1FNW A;  1TY0 A;  2NTS A;  1SE3 A;  1SEB D;  5TSS A;  1TS4 A;  1SE4 A;  1JWS D;  4L63 B;  2SEB D;  1JR0 D;  2RDH A;  4RGO S;  3MC0 B;  5I4D A;  1AN8 A;  1LTR D;  3BVM A;  1BXT A;  1UNS A;  1CQV A;  2CHB D;  3GP7 A;  2AQ2 B;  3OWE B;  2R61 A;  1ET6 A;  2IPK D;  1EEI D;  2NTT A;  1PZK D;  1ET9 A;  1S5B D;  3BVZ A;  1LTI D;  4RHR A;  3V05 A;  2G9H D;  4ZYS A;  1LT3 D;  1EWC A;  1SJE D;  1EU4 A;  1I4X A;  1LT6 D;  1CK1 A;  1BCP C;  4TSS A;  1V1P A;  2AQ1 B;  4RGT A;  1TS3 A;  1CT1 D;  1CHQ D;  1KTK A;  3DWQ A;  1SBB B;  4RGN A;  4O1N A;  1PTO C;  1S5E D;  3MFG A;  4BWG B;  3BYT B;  3BYY B;  5ELB A;  1HTL D;  1G8Z D;  2Z8L A;  3KLS X;  2XNA C;  1QIL A;  5D3I B;  1LLR D;  1SJH D;  1STE A;  1I4H A;  1LTB D;  1FD7 D;  1HQR D;  1LT5 D;  1L0Y B;  1AW7 A;  1JCK B;  1V1O A;  1I4R A;  1S5C D;  1GOZ A;  1DYQ A;  1PYW D;  2ICI A;  3SEB A;  1FGB D;  2XRQ D;  3CHB D;  1ENF A;  1LTG D;  1T5X D;  4RH6 A;  4RHS A;  1XTC D;  2TSS A;  3TSS A;  1PRT B;  2J4X A;  1B44 D;  1S5D D;  1L0X B;  1LTT D;  1PTO H;  3EA6 A;  1BCP B;  1LT4 D;  3O13 A;  1S5F D;  5ELE A;  2IJ0 A;  4DXF A;  3EFX D;  2WV6 D;  1JQY D;  4RCO A;  1I4P A;  1SXT A;  1TS5 A;  1D5Z C;  1I4G A;  1PRT F;  1RF2 D;  1RCV D;  1TS2 A;  3URY A;  1PRT D;  1DJR D;  1EEF D;  1RD9 D;  1KLU D;  1BCP F;  2QEJ C;  1HA5 A;  1JWU D;  2O2L D;  1BCP D;  3BZD B;  1B1Z A;  1PZI D;  3R2T A;  1LTS D;  2XRS D;  1HXY D;  1ESF A;  1D5M C;  4Z9C B;  1PTO D;  3W2D A;  1KLG D;  5ELC A;  5ELF A;  2QIL A;  4C56 C;  1TY2 A;  1UUP A;  1EU3 A;  4UDU C;  1V1P B;  1F77 A;  1LO5 D;  4K6L A;  1LTA D;  1JWM D;  4L6T B;  1D6E C;  1EFI D;  1FNU A;  1SE2 A;  1PTO B;  2AQ3 B;  3R8B A;  4RGM A;  3BVG A;  1RDP D;  1M4V A;  1PRT C;  5FKA C;  1PZJ D;  1MD2 D;  2RDG A;  1CHP D;  5FK9 C;  5ELD A;  1D5X C; 
#chains in the Genus database with same CATH topology
 4A93 B;  5FJ8 G;  1JIC A;  3U4V A;  1XXG A;  3SE0 A;  1W6K A;  5EBC A;  4LUO A;  2HCC A;  1U9R A;  2C9O A;  2ZJQ A;  5D3D A;  4NDX A;  3A8K E;  3NQT A;  1WTR A;  4L5Q A;  3J81 E;  3PIO 3;  3S1Q H;  2YTX A;  4LFA L;  3MZ5 A;  1J9O A;  5IY0 A;  4KN4 C;  1AE2 A;  2ZT9 C;  3I70 A;  4XT1 B;  1UNS A;  3J81 c;  4A3D H;  2G5D A;  1YJW A;  3DM3 A;  1V43 A;  3P1H A;  1EEI D;  3IFT A;  5GAH C;  3ICE A;  4XDX A;  1EYD A;  4NXN Q;  3TP5 A;  3VR4 A;  5CYU A;  4NPS A;  3PUW A;  3SK4 A;  4DUY Q;  1B3A A;  5M5W B;  2O5J C;  2PQA A;  3DM1 A;  4A3M H;  5IOD A;  4RGT A;  4X64 L;  2B8G A;  1EYG A;  4KI0 A;  3DWQ A;  1O7Y A;  5C0X J;  2BH2 A;  1S5E D;  1JE4 A;  4BWG B;  4ME3 A;  4N9P A;  4A3I B;  1VQL A;  3GTG B;  1WD0 A;  4P73 A;  1YIT A;  2Z8L A;  3NBH A;  1S4Z A;  4EQN A;  1QIL A;  1KXL A;  4DR7 Q;  3RR5 A;  1VQK A;  1C9O A;  2NWG A;  3HKZ B;  5A2Q E;  1IW7 C;  2WKC A;  2Z9H A;  4MTK A;  1MHW C;  2R93 B;  3J7Y W;  2YTY A;  3ZJY C;  4A3B G;  5KYI A;  1VS0 A;  4RH6 A;  1BBX C;  2TSS A;  4B3T L;  5KNB A;  3FKI B;  4XYQ A;  1QB5 D;  5IYC G;  2PNH A;  1G6Z A;  5IGF A;  4A3F B;  4B3R L;  2D0O A;  2D0P A;  3HG9 A;  1STH A;  3NEM A;  1VQ8 A;  5LMN Q;  3MA2 B;  4IOC A;  3GTG H;  1PTO D;  2PW5 A;  1Q7Y C;  4DV1 L;  1CM9 A;  2F3V A;  4POG A;  1UUP A;  1EU3 A;  5ELN A;  4U68 A;  3I56 A;  5IGG A;  1WOC A;  1L1O B;  5IT9 L;  1ILP A;  2R93 H;  1JT8 A;  5CBA E;  1F2M A;  1D6E C;  3PO2 G;  4QIW E;  5C44 B;  1NMG A;  4DK3 C;  4IN3 A;  3S1M B;  1SE8 A;  4DN4 M;  5FKA C;  5J1Z A;  2CQO A;  1VQG A;  3ITP A;  1CUK A;  4L5R C;  4DV5 L;  2MHV A;  1N34 L;  1ICF B;  3DWP A;  4WRD A;  1G91 A;  2WAQ E;  4PZ6 A;  1F2L A;  1CSQ A;  2EYJ A;  5CV4 A;  1TY0 A;  4A3F H;  1ZYR C;  5BR8 L;  3KF8 B;  3PCO B;  4DV7 Q;  1E2Z A;  2X69 A;  1SYG A;  2PW7 A;  2OQ0 A;  2QA4 A;  3BVZ A;  4X3K A;  1VF7 A;  4HTH A;  3RN5 A;  2UXD L;  3AQQ A;  2I5L X;  3A55 A;  3UDX A;  4ZYS A;  4X62 Q;  3HOY G;  1O7Z A;  4IJH A;  3FP9 A;  5IT9 c;  4P71 A;  1FL0 A;  1L1O C;  3V96 A;  4HIO A;  4DR6 Q;  3NP8 A;  3IAY A;  1SRO A;  3I55 A;  4GLA C;  2VQE Q;  4IUQ A;  2KHJ A;  5C44 H;  4KHP L;  3T4A C;  3BYT B;  4B9W A;  1PMR A;  1G2S A;  1LAC A;  1AZQ A;  3OIQ A;  4UHV A;  4IPH A;  1KD1 C;  2OTJ A;  3S1N H;  3KLS X;  3NUC A;  2XNA C;  3FPU B;  4A3E H;  4GN5 A;  3HRZ C;  2QW7 A;  1KAW A;  3MXP A;  1GOZ A;  2LY7 A;  3Q22 A;  3GV3 A;  3N52 A;  4IOA A;  5C0X I;  2OQK A;  4MIU A;  3CPF A;  3G4S A;  2K01 A;  1DOK A;  2F0H A;  3I91 A;  2ZM6 Q;  1NAP A;  2EY6 A;  1A6X A;  4DV0 Q;  4OGQ C;  3FMC A;  4TKO B;  2RHQ B;  5E4W C;  3CD6 A;  3H3V I;  2IJ0 A;  5EPJ A;  4JG2 A;  3W1B A;  3Q23 A;  1I4P A;  4C3I G;  1DJR D;  4JI0 L;  2J0T D;  2K04 A;  1RTO A;  3GTM B;  2TMP A;  4AYB E;  2E76 C;  4C2M B;  1BBW A;  5JVH 3;  3KYH C;  1MI2 A;  4ALP A;  3MHB A;  5GAE C;  2JN4 A;  4K2K A;  1WVL A;  4I65 A;  3HOX B;  4JOI C;  4ZKC B;  5AJ3 L;  3STB D;  2F0F A;  2VQF Q;  1BUV T;  3G48 A;  1PA6 A;  5KEE A;  4QMG A;  2B2T A;  1SE2 A;  2F0W A;  1PTO B;  1LM0 A;  4X66 Q;  3E5S A;  4YCU A;  4A3G G;  4OXP A;  3A0J A;  3FRP B;  1VQH A;  3GTK H;  3NTI A;  2B2W C;  1IYU A;  4ZAI A;  3IL8 A;  1GKH A;  1SFO B;  3S15 B;  1QJO A;  1K0R A;  1N32 Q;  5F2D A;  1T9H A;  1GUG A;  4CDE C;  2E2J B;  1K8G A;  1TKW B;  5TSS A;  3D6C A;  2B2Y A;  1K28 A;  4L5T A;  4JI4 L;  3GTM H;  5JVG 3;  2JA5 G;  1DOL A;  5JJL A;  4V19 0;  3TP7 A;  2PPB C;  3PIP 3;  4IAL A;  2N3S A;  4G7H C;  1FYC A;  1S5B D;  3HOX H;  4CGY B;  5CGK A;  4H0L C;  1DON A;  3LWE A;  2FHT A;  2QF7 A;  1J5E L;  3C3L A;  3E9H A;  3OYY A;  5FLM G;  1G6P A;  4BBR B;  3J7A 5;  4LF5 Q;  2PZU A;  3TN2 A;  1MSH A;  1YIJ A;  3BJU A;  5M5X B;  1PTO C;  3CCQ A;  3NTK A;  2F4V L;  1KC8 C;  4OWW B;  4IZ8 A;  3NWT A;  3NWS A;  1PH8 A;  1SFO H;  3S15 H;  3F2D A;  5IP7 G;  5C4J B;  4DAY A;  2LS0 1;  4C1N I;  2E5L L;  2JA7 B;  2JA6 H;  5IWA L;  2GN5 A;  2EJG C;  2EYH A;  1D1I A;  1LTL A;  4PQX A;  1K83 H;  1HQM C;  4ZKB B;  3HKZ E;  2J4X A;  1HR0 W;  3H0G H;  5T1I A;  4P2C B;  1RCV D;  5L37 A;  4BBR H;  4HJA A;  4DUZ L;  2KHI A;  2O2L D;  3QOJ A;  5CV6 A;  3S2H B;  1GJX A;  1SYB A;  1VQE A;  3K0X A;  5CV5 A;  3J80 i;  4R4C A;  4Z9C B;  1UAP A;  1I50 H;  4C3H G;  4B3M Q;  2PI2 E;  1Q8I A;  2GVB A;  3WOF A;  3M4O H;  1CFM A;  2UUB Q;  2PYK A;  1CTM A;  3CCJ A;  3I4M G;  2K14 A;  2WKD A;  2Q2I A;  4U67 3;  1TWH B;  3OMC A;  4DNI A;  1SYF A;  1A2U A;  1RDP D;  2CWA A;  4XQQ A;  2KCN A;  2L11 A;  2RDG A;  2IX1 A;  1HHV A;  4BY7 G;  1STG A;  1N33 L;  3JAM i;  4IO9 A;  4M8A A;  3NEL A;  5LMU L;  5DM6 3;  2EZV A;  1NR4 A;  3GQB A;  4Y52 H;  1HNX L;  2B63 H;  3CCL A;  5CMD A;  1LYL A;  2PQE A;  1GUS A;  1I3Q H;  3HKS A;  4IFD H;  4JV5 L;  2JP1 A;  3S2H H;  1Z6H A;  4KKS A;  2JEB I;  4BY1 G;  3VR6 A;  1I6H B;  3WDN A;  1IBL L;  2HQL A;  2NTT A;  1JJ2 A;  1ET9 A;  2RBM A;  1CKO A;  1LTI D;  3K6O A;  1EQQ A;  2H1E A;  3V05 A;  3RZO B;  2IT1 A;  4ABN A;  3PUY A;  3GTO H;  2IW3 A;  3F8T A;  4DR1 Q;  1QE6 A;  1IBK Q;  3SK8 A;  1UWV A;  2KCM A;  4DU9 A;  4DV6 Q;  4X3S A;  2NVY H;  2F0G A;  2PCF B;  4NW2 A;  4UPA A;  1AZP A;  1PVO A;  2BCO A;  4N8X 1;  2M00 A;  1AH9 A;  3VA5 A;  4K5W A;  2Z6K C;  1VQB A;  2A6H D;  4N8F A;  3S2D H;  2V4D A;  3STB C;  4H02 A;  1HRJ A;  3NE5 B;  2EOT A;  3GTJ H;  3GO5 A;  3SK5 A;  3OTO L;  1PFN A;  4KN7 C;  4LFB Q;  1NUC A;  1B7Y B;  3K80 C;  1JB3 A;  4PZ7 A;  1I4R A;  2D5D A;  4NXM Q;  4A3C G;  3H91 A;  4UP7 A;  4UP9 A;  2JA8 G;  4FNF A;  2A6E D;  3QO2 A;  2DJF C;  2UU9 Q;  2VY3 A;  1A15 A;  1SLJ A;  3EVQ A;  4DXF A;  1GM5 A;  4DR4 L;  4L8J A;  3QG1 A;  3C46 A;  2FMM A;  1FR3 A;  1PRT F;  2EYP A;  5IYD G;  2EY1 A;  2RQX A;  2XWJ B;  1X9N A;  3W3A A;  1JWU D;  3DEP A;  1BCP D;  2QDB A;  2K50 A;  2AWN A;  3R2T A;  4DR5 Q;  1LTS D;  1DOM A;  1D5M C;  2R7D A;  1S72 A;  2IX3 A;  3G6E A;  1WTV A;  5ELC A;  1EQR A;  3BS1 A;  3J81 i;  1E1O A;  2ATW A;  2BA0 A;  3VYR A;  2JSO A;  3MEH A;  4MTN A;  1LO5 D;  1F9S A;  4OX9 Q;  4EQO A;  1GHK A;  3KJO A;  4AYB G;  2UXC Q;  2AQ3 B;  2EE1 A;  3QR8 A;  1ZXT A;  1MD2 D;  1BDO A;  5ELD A;  1D5X C;  5C3X A;  1VQP A;  1EOV A;  4IUN A;  2JJQ A;  3Q8D A;  4NXN L;  2R92 B;  3CF5 A;  1U4R A;  3K5L A;  4DUY L;  2EVB A;  5FOB B;  4A3D G;  4KD3 A;  3L0O A;  3SK6 A;  3J7A V;  2CW0 D;  1VQO A;  1Q90 A;  5COR A;  1XPO A;  3GV6 A;  5KYL A;  1ET6 A;  3SGI A;  1HNZ L;  4A3M G;  3CXC A;  1U5K A;  1EWC A;  4RG1 A;  4GKK L;  4KV6 A;  4DR7 L;  2FIN B;  5M3F H;  1N9W A;  3IKJ A;  3ND8 A;  2IHE A;  1NY4 A;  4JYA L;  1LV9 A;  4P75 A;  3ER0 A;  1WTW A;  3A8J E;  3BYY B;  4PV1 C;  3A7A B;  5M5Y B;  1WCM B;  1PV4 A;  4RKL A;  2Z0S A;  1QCB D;  4ID6 A;  3I73 A;  1CKN B;  3HOZ B;  1SMY C;  4GLX A;  1LT5 D;  1V1O A;  3HFZ B;  1WTH A;  4F87 A;  1DYQ A;  1XTD A;  5CV8 A;  3SEB A;  1EIY B;  2E2D C;  3HOV B;  1M8A A;  1ENF A;  4IUV A;  3AEV A;  1R9T H;  2E2I H;  1S5D D;  5LMN L;  5ELE A;  4QJF A;  2F0V A;  1FVI A;  2EY2 A;  3K58 A;  1SYC A;  2BH8 A;  2RSN A;  2IHF A;  5C4Z A;  2YU9 B;  1JOQ A;  3KLS A;  1Y8P B;  1Z9F A;  2YTV A;  3T56 B;  3VR2 A;  3PF5 A;  4HSV A;  3KLR A;  3HKZ G;  1QUQ B;  1EUJ A;  2F0M A;  4FF2 A;  2JQO A;  4GS3 A;  3NQI A;  2OF1 A;  1R4Q B;  1Q81 C;  2R93 G;  4UDU C;  2Y0S B;  3HOZ H;  3U9O A;  4DV4 Q;  1R4P B;  1F77 A;  4ME5 A;  2E2H H;  2PI2 A;  1HH2 P;  2IX0 A;  5G3L F;  3IRB A;  1OXU A;  2ZJP A;  4GKJ Q;  1XMQ L;  1EY4 A;  5EBD A;  3HOW B;  1HZC A;  3R8B A;  1Q86 C;  1PH2 A;  4DV7 L;  1QWY A;  4EVO A;  2PZW A;  5FK9 C;  4A3F G;  1HPC A;  1GVP A;  1L1O A;  2RKS A;  3NPP A;  5EGT A;  2R7Z B;  2H4O A;  4RFB A;  1PHJ A;  4K0K Q;  2A6E C;  4JPB W;  4DNT B;  1D2B A;  4JBJ A;  1Q1B A;  2SEB D;  4IPG A;  4X3T A;  3NEN A;  5LL6 X;  5T1G A;  3DHQ A;  3U9S A;  3T1Y Q;  2UUC Q;  4J1M A;  2VQE L;  4DV2 Q;  1KL9 A;  1JJG A;  2IPK D;  1SRU A;  2L9H A;  2IY5 B;  2RF4 A;  3AFQ A;  4DF7 A;  3PUX A;  3TP8 A;  5ELO A;  2F0J A;  1BCP C;  1C4Q A;  5C44 G;  1CQF A;  2Z4H A;  5JJI A;  1ICW A;  1O80 A;  1VQD A;  1B4O A;  1TS3 A;  4LF4 Q;  1EWI A;  5KIX A;  1TT2 A;  1F9R A;  4A3E G;  1UEB A;  1SDF A;  1RKN A;  4DV0 L;  1XNQ Q;  2GVA A;  1STE A;  1LTB D;  1EQV A;  2BDO A;  3I4L A;  2R7Z H;  1F2Y A;  3VR3 A;  3GTP B;  3VR5 A;  2ICI A;  4WJW A;  1FJG Q;  2K5W A;  2YYZ A;  2N78 A;  1LUZ A;  4RHS A;  3TBI B;  5K5P A;  3NHH A;  4JOI A;  5A35 A;  5DAU A;  4JI8 Q;  1ASZ A;  4JI6 Q;  2JA9 A;  3EFX D;  4DR3 Q;  3WOE A;  1TS5 A;  3UDG A;  2VQF L;  1GUO A;  1S3O A;  3H3V C;  1U0L A;  2CW0 C;  4A93 H;  1CZW A;  4R4O A;  2PNR C;  1TWA B;  1HXY D;  5M3M B;  2XIW A;  1QZG A;  2L5T A;  2B2W A;  1A62 A;  1A3V A;  1E7Z A;  1VQ5 A;  4ILW A;  3I7F A;  5EPL A;  1JOR A;  2N8N A;  4LF6 L;  5C4X B;  3DMU A;  2F0Q A;  1AE3 A;  3GTP H;  4B3S Q;  1H9S A;  2C5C A;  1J6Q A;  5M5W H;  4J8Q A;  1RIP A;  1ROD A;  4R4Q A;  3BVG A;  4RGM A;  1KQS A;  2KEE A;  2K52 A;  3I72 A;  1STA A;  1STN A;  1KRS A;  4A3I H;  1NTG A;  5LL6 S;  4ZQ3 A;  4OEM B;  2QCP X;  4NKL A;  4FXG C;  1X54 A;  3CQZ B;  4IJL A;  4LFC Q;  2EJM A;  3GTL B;  1AP0 A;  3D4R A;  2KUM A;  1E3P A;  3KOJ A;  4ZLT F;  3PO3 B;  4RGO S;  1TWA H;  2F1M A;  3MC0 B;  2K5Q A;  2EJF C;  3V2T A;  4JVZ A;  4C1N K;  3A5Z B;  5FO9 B;  5M3M H;  3HOX G;  1PH9 A;  2WB1 B;  4FDB A;  1H9J A;  1C0A A;  1GD7 A;  1SND A;  3TQY A;  1SJE D;  5C4X H;  2UXB Q;  2V1C C;  1I4X A;  1QVG A;  3FKI H;  4LF8 Q;  2NBF A;  2EYM A;  2M2L A;  1V1P A;  2AQ1 B;  4EQP A;  4WFN 3;  5JEA H;  4JI7 L;  3UE0 A;  1VQC A;  3JC6 6;  2D62 A;  1Q3L A;  3ULP A;  1H9R A;  1I94 Q;  1Y8O B;  4ULL A;  4DV3 L;  2JA6 G;  1DD2 A;  1XPU A;  3EN2 A;  2ALY B;  4ZUJ A;  4B9X A;  4A3L H;  3BG3 A;  1I4H A;  3KBG A;  4KY6 A;  2MFI A;  5IE8 A;  5IT9 E;  5CBE E;  1AW7 A;  5E4X A;  3TRE A;  4LW1 A;  1EY9 A;  5E7N A;  4FXD A;  3AFP A;  3H0G G;  1Z47 A;  1VQI A;  1HTP A;  2Q8R E;  3G6J B;  2K4K A;  2K7V A;  5I6Y A;  1H9M A;  1XTC D;  5IP9 H;  1Y14 B;  3D3R A;  1QNU A;  1B44 D;  1A2T A;  4MNO A;  3EBE A;  1V1Q A;  4BBR G;  3S1M H;  4B3M L;  1Y1V B;  3J81 j;  1OXS C;  4LF9 L;  3ULL A;  5BN5 A;  4HMI A;  2GA4 B;  2K75 A;  1NR2 A;  5K36 H;  1ILQ A;  2UUB L;  4OO1 H;  1G2T A;  2F03 A;  2K5N A;  3VYT A;  3LNN A;  3RN2 A;  1WTP A;  3S1R B;  3BDC A;  1IBM Q;  1IXR A;  2O5I C;  1Q82 C;  1VF5 C;  2NYZ D;  3J7A F;  3QWN A;  1VDZ A;  3W1G A;  1VQ4 A;  2X6G A;  2Y0S E;  4A3B B;  3OW7 A;  1AEX A;  4EGV A;  2F0U A;  1B53 A;  1M4V A;  1O78 A;  4XXE A;  1CHP D;  2DNC A;  2AHO B;  2B63 G;  1XMO L;  2D9U A;  4IFD G;  1E1T A;  1Y1V H;  1VQA A;  1DXM A;  5GQO A;  1TU2 B;  4DFA A;  3E6Z X;  4DV6 L;  3G71 A;  3OMG A;  2PO4 A;  2ZTE A;  2Z6K A;  5C6A A;  4OWX B;  3RLF A;  4JI2 Q;  4BA2 I;  4RCN A;  2ZXR A;  5BN4 A;  1YVC A;  4DAP A;  4RHR A;  2BE5 D;  1II3 A;  2OCE A;  3MXU A;  3U4Z A;  4KY7 A;  1G29 1;  4PMB A;  1J8I A;  5FO8 B;  2JYO A;  4XQN A;  3ERQ A;  2RHS B;  3KLW A;  4CJ2 C;  2VXW A;  1UEA B;  4XQJ A;  5GAD C;  2MUY A;  2CQA A;  4RGN A;  1EL0 A;  2I5H A;  5CV7 A;  5D14 A;  4A3K B;  2DUD A;  3RLN A;  5IYB H;  4C2M H;  4KJN A;  4OL7 A;  2A68 D;  3D6W A;  1NCV A;  1JCK B;  4KKT A;  5C4H A;  1WI5 A;  2N88 A;  1IL2 A;  3CCU A;  4HID A;  4CDF C;  4HJ7 A;  2M9V A;  4MN3 A;  3OIP A;  1RTN A;  4R8I A;  1UE1 A;  5EKI A;  1PRT B;  4AQY L;  4KKU A;  4TQU S;  5IGC A;  1PTO H;  4B3R Q;  5HGT A;  1UE7 A;  4FF1 A;  4IUR A;  4WJ3 M;  3U50 C;  1RF2 D;  4IQZ A;  3I4N B;  2KJX A;  1KLU D;  1SNP A;  2WII B;  4DV1 Q;  1VCI A;  2JXM B;  2RDF A;  4CHT B;  4OX9 L;  2E2J H;  2C35 B;  2UXC L;  1PH7 A;  2K6A A;  4A3K H;  5EJW A;  3P7J A;  4HIK A;  1IKM A;  2F0I A;  3C1E A;  3T51 B;  2ICE C;  4DV5 Q;  1N34 Q;  1QNK A;  3I2Z A;  4FP5 D;  4H13 C;  1XJV A;  2ZXP A;  3OHX C;  4OWT B;  4G7O C;  1PRT C;  1BF4 A;  2MGS A;  4G57 A;  5M5X H;  3GD7 A;  5JAV A;  2NN6 H;  2YV5 A;  5BR8 Q;  1CA5 A;  4JBW A;  4JK1 C;  1X65 A;  4V0B A;  1YHB A;  2XN9 C;  4OON A;  4KK7 A;  3I4N H;  5C4J H;  1YBY A;  2F0P A;  3UDF A;  1SNC A;  3MTS A;  2UXD Q;  2JA7 H;  5I4D A;  1SMY D;  4YWK A;  5JOB A;  2HIX A;  3C1F A;  2ES2 A;  1HNW Q;  1PYB A;  3CU7 A;  5M3F G;  3L3O C;  1F2Z A;  4YY3 Q;  2NVX B;  4KHP Q;  2VUM B;  2F0K A;  2NZO A;  2DJG C;  3K7U C;  2WB1 E;  4TSS A;  4Y7N B;  1SAP A;  1E2V A;  2RCF A;  3HEJ A;  5KND A;  1JB7 A;  5DNF A;  3PIO A;  1CHQ D;  4O1N A;  4BBS B;  2OEO A;  2NB0 A;  3LX0 A;  3Q6S A;  2F3W A;  5EQ0 A;  4DAV A;  1K9M C;  2Z6B A;  1HQR D;  3TRZ A;  1Y1W B;  1LAB A;  4LF7 L;  3RZD B;  4FXK C;  1JC7 A;  3T13 A;  2WAQ G;  4IFD J;  4IPD A;  4UP8 A;  5C3E B;  3K7A B;  2XVS A;  1TWH H;  2E74 C;  1CKN A;  3O13 A;  1HZB A;  3E9I A;  2VUM H;  1SXT A;  4JI1 Q;  2XGT A;  1K3B C;  2PZT A;  4Y7N H;  4DNR B;  4DV4 L;  2EQS A;  4A3J B;  2A5H A;  2QEJ C;  4CJ0 B;  4GKJ L;  4BBS H;  5GRO A;  3SXH A;  3HOZ G;  2BE5 C;  5ELF A;  2L1B A;  2MP1 A;  4LF5 L;  3OWF A;  2QIL A;  4R8N A;  1X6O A;  3I4O A;  4JW0 A;  1EYA A;  1I6H H;  3BZC A;  1Z7T A;  3CMA A;  1Y1W H;  3MEF A;  3LGJ A;  3MFY A;  4YWL A;  4JBK A;  3RZO H;  1X3F A;  1LTA D;  4PNY A;  4XIG S;  1KDA A;  3RZD H;  3W5O A;  4K0K L;  4KJO A;  1TR5 A;  1WYD A;  4GLV B;  3RMH A;  1QUQ A;  2ASB A;  3SR1 A;  3T1Y L;  2SNM A;  2UUC L;  4BXX H;  2EXZ A;  5C3E H;  1KIX A;  2A68 C;  2HCI A;  4IUP A;  1TWG B;  2BDN A;  4DXG A;  5KRU A;  3MVV A;  3GTQ B;  4C3J B;  1KAB A;  3D31 A;  4HCS A;  4P74 A;  4R9W A;  4A3J H;  2UUA Q;  1JR0 D;  2RDH A;  2VS1 A;  2L55 A;  1J5E Q;  4LF4 L;  1BXT A;  1EIF A;  1CQV A;  3AU7 A;  2R61 A;  2LXJ A;  4Q5V A;  4C3H B;  2HHH Q;  1Q12 A;  1PZK D;  3R3O A;  1N36 Q;  3KF6 B;  1BBU A;  2B3G A;  3A56 A;  4XYO A;  2K33 A;  4WOR A;  3K57 A;  1RL2 A;  5KGU A;  2RA4 A;  4QGU A;  5COY A;  1KTK A;  5HY6 A;  4DA2 A;  2QGQ A;  3M7N A;  1SYE A;  1FJG L;  4HCE A;  5IWA Q;  2HIV A;  3M85 A;  2R7Z G;  3M9B A;  1HFG A;  4ZRZ A;  3A7L A;  1JOO A;  1HR0 Q;  3OPO A;  2R3Z A;  2ZTD A;  5KNC A;  1I6V C;  4HMJ A;  1NJI C;  5D3I B;  1TWG H;  4JI8 L;  4CJ1 B;  3J7Z C;  4A76 A;  3GTQ H;  4C3J H;  3J80 L;  2EYL A;  1PYW D;  1X3Q A;  1FGB D;  1H95 A;  2KA7 A;  5IGB A;  3BDL A;  3CME A;  1YNX A;  4LUZ A;  5JJZ A;  3FVQ A;  3HZX A;  4QB4 A;  4I7A A;  5JPM C;  3TEH B;  3PV0 A;  1L0X B;  4LNQ A;  1OXT A;  1YZ6 A;  4A93 G;  1E0B A;  3I8Z A;  3HOU B;  4LMQ D;  4O42 A;  2CH4 A;  3CRK C;  4J15 A;  3HGB A;  1HUN A;  1CI3 M;  1PZI D;  2WP8 J;  4B3S L;  2R92 H;  4NB3 A;  1ESF A;  2WIN B;  4F7X A;  4IFD I;  4DR2 Q;  3BZK A;  2AMC B;  5DLQ E;  1TVX A;  1TY2 A;  1Y8N B;  3CAM A;  2AKW B;  1X3P A;  2F0S A;  3J80 c;  1WTX A;  3K0Y A;  1TWC B;  4F88 A;  1XNR Q;  4LFC L;  3QIA A;  1P16 A;  1CA6 A;  2JA8 B;  1EFI D;  3F2U A;  2HD3 A;  5LMU Q;  4A3I G;  4L5S A;  1WJJ A;  3EJI A;  2RCN A;  4JV5 Q;  1W3S A;  1QZH A;  4A75 A;  5M5Y H;  1WCM H;  3HOU H;  5M3M G;  2UXB L;  1FNV A;  1ONL A;  3MXN B;  4KMU C;  1B70 B;  4LF8 L;  1PFS A;  2F52 A;  1JWS D;  4KD4 A;  2B2U C;  3UDI A;  4G4K A;  1PLF A;  5C4X G;  3OWE B;  1I94 L;  2A1A A;  3FKI G;  3HOV H;  2G9H D;  4GNX B;  5JEA G;  3Q24 A;  3DUZ A;  5NUC A;  1KDB A;  2R7F A;  1TWC H;  1QVF A;  1TWF B;  4HJ9 A;  2FXQ A;  4CDD C;  2ZJR A;  5IOC A;  3F2B A;  4X65 Q;  4X62 L;  4JI3 Q;  4A3L G;  5J39 A;  1K8O A;  1HTL D;  3PIP A;  5EKL A;  1SMX A;  4RAU C;  2YU9 H;  4DR6 L;  3PGZ A;  1HZA A;  4HN7 A;  3RUZ A;  3A8I E;  3S1Q B;  1FD7 D;  4XTC S;  3ERO A;  5D65 A;  2IL8 A;  1S5C D;  5IP9 G;  1HA6 A;  3L2P A;  3AB9 A;  1TQO A;  4A3D B;  1MGS A;  3B6Y A;  4DR4 Q;  4S3S A;  3T16 A;  1BKB A;  4B08 A;  2XRQ D;  4HJ8 A;  1T5E A;  3KF8 A;  2ZXO A;  1MJE A;  5I2X A;  3T53 B;  2AUK A;  3EA6 A;  4AH6 A;  3HOW H;  4A3M B;  4GNX C;  5K36 G;  3K5O A;  1VQM A;  2JE6 I;  1IBM L;  4OO1 G;  4H7B A;  1D5Z C;  1TS2 A;  3URY A;  2ZM6 L;  1S40 A;  4LUV A;  1EEF D;  5J22 A;  1STY A;  4XT3 B;  4LAA A;  4JI5 Q;  1V8Q A;  2XRS D;  2VNU D;  3DEO A;  4M1U B;  1KLG D;  2MO1 A;  3VA7 A;  1YNN D;  4DK0 A;  2AWO A;  5JJK A;  3MXG A;  5E3F A;  3BU2 A;  2Q2U A;  2PMZ B;  5I9P A;  1A8V A;  4WJ4 A;  5HUR A;  5C0X H;  5IGD A;  3AMU A;  2B8F A;  5A2Q L;  4ZK9 B;  1FNU A;  1JJC B;  3KFU A;  4HSP A;  4QCL A;  3H3V H;  1Y1V G;  2BOS A;  1YJN A;  3TZU A;  1NNX A;  2K32 A;  4KLK A;  4JI2 L;  2QKI C;  1VQF A;  4OHJ A;  4OEL B;  4X66 L;  5EPK A;  2EYO A;  2JEA I;  1PDQ A;  1PFM A;  4OIJ A;  5M9O A;  2RVL A;  1HNZ Q;  1EY8 A;  4PMC A;  4GOP B;  1K3R A;  2KQ3 A;  4DPG A;  1WTO A;  1VQN A;  4RWS C;  1N32 L;  2HQE A;  1P8L A;  4KTA A;  4GKK Q;  5CC4 A;  1NE3 A;  1PFB A;  2F4I A;  2VL6 A;  3A74 A;  1VMP A;  4JYA Q;  3X3M A;  3OSO A;  1MKH A;  1MIU A;  1HCZ A;  4HED A;  4TVA B;  1CK1 A;  1F9Q A;  2ID0 A;  3K5N A;  2I46 A;  5IYB G;  3E0E A;  3H6M A;  3K81 C;  2Q8T A;  4X6A H;  1B9M A;  2QEX A;  4R1J A;  1IL8 A;  4KY5 A;  1WD1 A;  2FFK B;  1EIH A;  3K59 A;  2DGY A;  2F0N A;  3C2P A;  1O7I A;  3OW2 A;  1MSG A;  2X6L A;  3CP0 A;  1D8L A;  2B2V C;  2K05 A;  4GOP C;  1GO3 E;  3I3C A;  3D4W A;  3N6R A;  1SNM A;  2E8G A;  3P20 A;  1OO9 B;  2K5D A;  2B39 A;  2DY8 A;  3M4P A;  4K8I A;  2MJ8 A;  1LTT D;  1SNO A;  1LT4 D;  1SR3 A;  4K2L A;  2MNA A;  1GXD C;  2AUJ D;  1OXX K;  3E0J A;  1PRT D;  1BCP F;  3BZD B;  4X3U A;  3T1H Q;  1B1Z A;  4A3K G;  2F3I A;  4POF A;  3CQZ H;  2A73 B;  3S1N B;  3GTL H;  3E3X A;  4K5X A;  3TP6 A;  1WFQ A;  2L4N A;  4A3E B;  5JEA J;  1VQ9 A;  3PO3 H;  3KDF B;  2BA1 A;  1GUN A;  1VQJ A;  2LMC B;  1XMQ Q;  1RHP A;  2K03 A;  3CCM A;  4CKE A;  4YHH Q;  4K6L A;  1JWM D;  4RMF A;  3NSW A;  2NN6 G;  5I9O A;  3TS0 A;  2J7Z A;  4BS9 A;  4JCV E;  3I4N G;  3R2I A;  1HNW L;  1RJT A;  2JA7 G;  4YY3 L;  1ZKO A;  5FJ8 H;  4ZUI A;  2PQA B;  3QB3 A;  1PXU A;  1U4P A;  2EYF A;  3BVM A;  2FJ2 A;  1Q8K A;  1X55 A;  4UAI A;  1ASY A;  2CHB D;  5C5M A;  3TS2 A;  1VMC A;  1HFN A;  5DM7 3;  1UE6 A;  2A74 C;  3NBH B;  1EU4 A;  1SSO A;  5LHY 1;  4FF3 A;  4LFA Q;  2LKV A;  4PZ8 A;  1CT1 D;  1QG7 A;  3GTK B;  1B2T A;  1SBB B;  3QJY A;  4EX5 A;  4N9T A;  1EY6 A;  3MFG A;  1YNN C;  4MHE A;  4YWM A;  3S24 A;  4DR1 L;  1IBK L;  4TRD A;  1PH6 A;  1BNZ A;  2KBN A;  1EZ6 A;  2EPB A;  3QOL A;  1IKL A;  1SYD A;  2XWB B;  1QVC A;  1U4L A;  3S1R H;  4X64 Q;  1I5F A;  1H9S B;  4JI1 L;  3FHW A;  4LFB L;  2EIF A;  1LTG D;  1T5X D;  1ENC A;  1NSN S;  1YEZ A;  3KJP A;  2VUM G;  4EQ5 A;  4NXM L;  3PO2 B;  3H94 A;  4A3B H;  2LXK A;  2UU9 L;  3CCE A;  2CH4 W;  1ESR A;  1A3U A;  4HAE A;  4BBS G;  4P72 A;  4CBV A;  1HA5 A;  2KVM A;  5IYC H;  2OXP A;  3NBI A;  2Q2T A;  1IHZ A;  1FGU A;  4GN3 B;  3KK7 A;  4LF6 Q;  4APV A;  4B3T Q;  5IGE A;  2MO0 A;  3TDQ A;  3K8A A;  4QUF A;  2JA6 B;  1Y1W G;  4C56 C;  3P75 A;  4PMW A;  3U58 A;  4DR5 L;  1E2W A;  1V1P B;  2L0C A;  2OT2 A;  2XSC A;  1K83 B;  4IUU A;  4G7Z C;  2EXD A;  1N8R C;  4BXX G;  1Q1E A;  5FO7 B;  3HOY B;  4L6T B;  5G3L D;  1B9N A;  2PMZ E;  3PMF A;  2DN8 A;  3H0G B;  4LK1 C;  5C3E G;  1VQ6 A;  4MZ9 A;  3RD4 A;  2UUA L;  2I07 B;  5I6W A;  3UI2 A;  4GZY C;  5H1S E;  3PO2 H;  4CKB A;  2HHH L;  4A3J G;  1L0W A;  1N36 L;  4UY8 C;  4LWC A;  1B3Q A;  1SE3 A;  1JOK A;  1L2F A;  1I50 B;  1MBY A;  1BR9 A;  1SE4 A;  2LFN A;  3M4Y A;  1HJP A;  3MAQ A;  1AN8 A;  1D1K A;  3ULJ A;  4DK1 A;  3M4O B;  2AQ2 B;  4QL5 A;  1CKM A;  5ISR A;  3MWY W;  3D0F A;  4JI7 Q;  3PF4 A;  3OOC A;  1HR0 L;  1XPR A;  2F0D A;  4H44 C;  3CC7 A;  1E24 A;  1E22 A;  1PH3 A;  4DV3 Q;  3SVM A;  1C48 A;  3HOY H;  1BVS A;  1ZEQ X;  1U4M A;  1SNQ A;  4O0A A;  3SDZ A;  4C3I B;  5ELB A;  2KEC A;  1W6J A;  4OO1 I;  2A19 A;  4C3J G;  2B63 B;  3KF6 A;  4HJ5 A;  1LLR D;  1SJH D;  1I3Q B;  1L0Y B;  3SHL A;  3M3Y B;  5AFW A;  2XTI A;  1M90 C;  3CPW A;  3AYH B;  3ONA B;  4LF9 Q;  2HDL A;  2KED A;  2RSO A;  3GTO B;  2LSS A;  4DR2 L;  3L9A X;  2NVY B;  4A3G B;  3VYS A;  2KCT A;  1I4G A;  2R92 G;  3FDT A;  3KBX A;  4DKA C;  1A3T A;  5DEH A;  3S2D B;  2HUG A;  2KEN A;  1XNR L;  2NVQ B;  1F9P A;  1YI2 A;  3F2C A;  5JPN C;  4C3I H;  3GTJ B;  3W2D A;  2JA5 B;  1EIG A;  1G51 A;  1ENA A;  4CDC C;  2I0Q A;  4JI0 Q;  3S16 B;  1KNA A;  2F0O A;  3M3Y H;  4FF4 A;  5C3W A;  1Y69 U;  2G9D A;  2NVX H;  2B2U A;  2F0T A;  1XMO Q;  5C5L A;  2MQH A;  3UE1 A;  5BN3 A;  1C8C A;  5AJ3 Q;  1WCM G;  3HOU G;  3R93 A;  1DCZ A;  1H9K A;  1O7L A;  2K28 A;  1B50 A;  1PH5 A;  1PTO F;  2B29 A;  2EY5 A;  4Q0F A;  4A3G H;  2CVR A;  1MJC A;  4IUT A;  3DWA A;  1K8M A;  4DAM A;  1B8A A;  1YJ9 A;  2NTS A;  3H15 A;  1SEB D;  1KDC A;  2ZTC A;  1IYJ B;  4L63 B;  2NVQ H;  2FMC A;  3HOV G;  3K5M A;  2N49 A;  2B2T C;  1EYC A;  4I7Z C;  3Q0A A;  4X65 L;  2F0E A;  1EY7 A;  3VDY A;  3I90 A;  4JI3 L;  5J3B A;  3S17 B;  4K8J A;  1XWE A;  2JA5 H;  1AFP A;  1TII D;  1EOT A;  4R4T A;  2ENB A;  2SNS A;  3WWV A;  2SOB A;  2L15 A;  1LT6 D;  3K7A H;  3S16 H;  4DAY B;  3MXN A;  4DV2 L;  1JMC A;  3D4D A;  4JI4 Q;  3CKI B;  1C7Y A;  1YNJ D;  3CC4 A;  4QQB X;  4R4I A;  1STB A;  5FLM H;  3RLO A;  3PQI A;  2B2Y C;  2VB3 X;  4GNX A;  2NUC A;  1G8Z D;  3H09 A;  4KHZ A;  4NMZ A;  1GUT A;  2Y0S G;  1KNE A;  1HUM A;  1PH4 A;  1X32 A;  2A69 D;  3EIV A;  3BDO A;  2NVT B;  4HR7 B;  2R6G A;  2JK8 A;  4AQY Q;  1OTC A;  1DM0 B;  1EQT A;  1VQ7 A;  5IP7 H;  1X56 A;  1XNQ L;  1EZ8 A;  3HOW G;  1CSP A;  2F4V Q;  2HT1 A;  3I4M B;  4JI5 L;  3M4Q A;  2NZ1 D;  1ML0 D;  3S17 H;  4HIM A;  5GAG C;  1NBW A;  5E1F A;  5M3F B;  1W2B A;  2E5L Q;  1KHI A;  3CCS A;  2WV6 D;  1JQY D;  2Q2H A;  4J6H A;  3A5U A;  4BY7 B;  3L7Z C;  3S14 B;  2NN6 I;  1A0I A;  1YHQ A;  4JI6 L;  3HS0 C;  4YIJ A;  4GN4 B;  3GDE A;  4DR3 L;  3VYU A;  2F0L A;  2VB2 X;  2I5M X;  3CCV A;  5C0X G;  5IIF A;  2KOL A;  2CKZ B;  2MPM A;  3PUV A;  4QIW B;  4BY1 B;  2VZA A;  4C3H H;  2NVT H;  4DUZ Q;  4JBM A;  2OWO A;  2OTL A;  1R9T B;  2HDM A;  2CWP A;  1IW7 D;  1Q46 A;  2E2I B;  1TXY A;  4DK6 C;  2WFW A;  3I4M H;  1X3G A;  2WAQ B;  1A63 A;  2Z1C A;  1PZJ D;  4F8M A;  4ODG A;  3JAM L;  2DNE A;  5FLX L;  5I2Y A;  1I4Q A;  2QDL A;  4IPC A;  3J80 E;  4K14 A;  1KRT A;  4BY7 H;  3S14 H;  2K1B A;  3DXJ C;  4YCV A;  1FNW A;  1NMF A;  4ZCK A;  3CC2 A;  1TS4 A;  4QY7 A;  3EQL C;  5HGQ A;  2H5X A;  3NK9 A;  1LTR D;  4RKB A;  2K5H A;  3GP7 A;  1N33 Q;  5EKK A;  1DGS A;  2KCC A;  2E2H B;  4FO2 A;  3X3N A;  3CCR A;  1EWH A;  5LMN W;  1M1K C;  2Q8I B;  3G7L A;  3NXW A;  5CV9 A;  1LT3 D;  3M7G A;  4PG3 A;  1HNX Q;  4BY1 H;  4QUC A;  2B2V A;  3IFD A;  4FYD A;  4RA8 A;  3FEW X;  3LWU A;  4GOP A;  4E6I A;  1XX8 A;  3PSI A;  3JAM E;  3KUP A;  4A4I A;  1BQQ T;  2EDG A;  5FLX E;  1IBL Q;  4QF4 A;  3PUZ A;  1XYI A;  2SDF A;  1OXV A;  3JAM c;  3NTH A;  2VW9 A;  1GUW A;  4LF7 Q;  3TME A;  3FPP A;  5FLX c;  4DGZ A;  2E75 C;  1EY0 A;  1GHJ A;  1YHA A;  1BO0 A;  1EFW A;  4LJZ C;  4CKC A;  1BOS A;  4YCW A;  3F1Z A;  1ZYR D;  4O2D A;  4BA1 I;  3CHB D;  3T1H L;  3TZD A;  1DZ1 A;  1PH1 A;  4A3C H;  3TSS A;  2D2C C;  2JA8 H;  4K5V A;  3CRL C;  3OTO Q;  4AYB B;  1BCP B;  1S5F D;  3ZYY X;  2NZH A;  4RCO A;  2N55 A;  2KHS A;  2P5Z X;  4KHV A;  2A6H C;  4JC0 A;  4OIK A;  3S9W A;  1KAA A;  1RD9 D;  3D8G A;  1V9P A;  4FVM A;  2K5V A;  1IYV A;  4YHH L;  3PO3 G;  1CZG A;  1SN8 A;  5IYD H;  2WB1 G;  1X3E A;  3HP3 A;  2L12 A;  3ERS X;  4NP5 A;  1K8A C;  1D7Q A;  3J81 L;  2CFM A;  3RNU A;  4K6D A;  1EY5 A;  3DLL A;  3A54 A;  5EAY A;  1YNJ C;  1IZ6 A;  2IWH A;  3ND9 A;  1K73 C;  2CCZ A;  2O4X A;  1JE5 A;  5CR3 A;  1WTQ A;  1TWF H;  1UE5 A;  2WAC A;  4AIM A;  2Z4I A;  3KDF A;  2A8V A;  2DY7 A;  1HZ9 A;  1QOH A;  1K0S A;  2A69 C;  1PYS B;  3CW2 C; 
#chains in the Genus database with same CATH homology
 4A93 B;  1JIC A;  1XXG A;  3SE0 A;  1W6K A;  5EBC A;  2HCC A;  1U9R A;  2C9O A;  5D3D A;  4NDX A;  3A8K E;  3NQT A;  1WTR A;  3J81 E;  3PIO 3;  3MZ5 A;  1J9O A;  4KN4 C;  2ZT9 C;  3I70 A;  4XT1 B;  1UNS A;  1V43 A;  3P1H A;  1EEI D;  3IFT A;  4XDX A;  1EYD A;  3TP5 A;  3VR4 A;  5CYU A;  3PUW A;  3SK4 A;  1B3A A;  5M5W B;  2O5J C;  3DM1 A;  5IOD A;  4RGT A;  2B8G A;  4KI0 A;  3DWQ A;  1O7Y A;  5C0X J;  1S5E D;  1JE4 A;  4BWG B;  4N9P A;  4A3I B;  3GTG B;  1WD0 A;  2Z8L A;  3NBH A;  1S4Z A;  4EQN A;  1QIL A;  2NWG A;  3HKZ B;  5A2Q E;  1IW7 C;  2WKC A;  2R93 B;  3J7Y W;  5KYI A;  4RH6 A;  1BBX C;  2TSS A;  5KNB A;  3FKI B;  4XYQ A;  1QB5 D;  1G6Z A;  5IGF A;  4A3F B;  3HG9 A;  1STH A;  3MA2 B;  1PTO D;  2PW5 A;  1CM9 A;  2F3V A;  1UUP A;  1EU3 A;  4U68 A;  5IGG A;  1ILP A;  5IT9 L;  5CBA E;  1F2M A;  1D6E C;  5C44 B;  4IN3 A;  3S1M B;  4DN4 M;  5FKA C;  5J1Z A;  3ITP A;  2MHV A;  3DWP A;  4WRD A;  1G91 A;  1F2L A;  2EYJ A;  5CV4 A;  1TY0 A;  1ZYR C;  1E2Z A;  2X69 A;  1SYG A;  2PW7 A;  3BVZ A;  4X3K A;  1VF7 A;  4HTH A;  3A55 A;  4ZYS A;  1O7Z A;  3V96 A;  3NP8 A;  3IAY A;  4IUQ A;  3T4A C;  3BYT B;  4B9W A;  1PMR A;  1G2S A;  1LAC A;  1AZQ A;  3OIQ A;  3KLS X;  3NUC A;  2XNA C;  3FPU B;  3HRZ C;  3MXP A;  1GOZ A;  2LY7 A;  3Q22 A;  3GV3 A;  3N52 A;  5C0X I;  4MIU A;  2K01 A;  1DOK A;  2F0H A;  3I91 A;  1NAP A;  2EY6 A;  1A6X A;  4OGQ C;  3FMC A;  4TKO B;  5E4W C;  2IJ0 A;  5EPJ A;  3Q23 A;  1I4P A;  4C3I G;  1DJR D;  2J0T D;  2K04 A;  1RTO A;  3GTM B;  2TMP A;  2E76 C;  4C2M B;  5JVH 3;  1MI2 A;  3MHB A;  4K2K A;  1WVL A;  4I65 A;  3HOX B;  4ZKC B;  2F0F A;  1BUV T;  5KEE A;  4QMG A;  2B2T A;  1SE2 A;  2F0W A;  1PTO B;  3E5S A;  3FRP B;  3NTI A;  2B2W C;  1IYU A;  4ZAI A;  3IL8 A;  1SFO B;  3S15 B;  1QJO A;  5F2D A;  1GUG A;  2E2J B;  1TKW B;  5TSS A;  3D6C A;  2B2Y A;  5JVG 3;  1DOL A;  4V19 0;  3TP7 A;  2PPB C;  3PIP 3;  4IAL A;  4G7H C;  1FYC A;  1S5B D;  4CGY B;  5CGK A;  4H0L C;  1DON A;  3LWE A;  2FHT A;  2QF7 A;  3C3L A;  4BBR B;  2PZU A;  3TN2 A;  1MSH A;  5M5X B;  1PTO C;  3NTK A;  4IZ8 A;  3NWT A;  3NWS A;  5C4J B;  4DAY A;  2LS0 1;  4C1N I;  2JA7 B;  2EJG C;  2EYH A;  1D1I A;  4PQX A;  1HQM C;  4ZKB B;  2J4X A;  5T1I A;  4P2C B;  1RCV D;  3QOJ A;  2O2L D;  5CV6 A;  3S2H B;  1GJX A;  1SYB A;  5CV5 A;  4Z9C B;  1UAP A;  4C3H G;  1Q8I A;  3WOF A;  1CFM A;  2PYK A;  1CTM A;  2WKD A;  4U67 3;  1TWH B;  3OMC A;  1SYF A;  1A2U A;  1RDP D;  4XQQ A;  2KCN A;  2L11 A;  2RDG A;  2IX1 A;  1HHV A;  1STG A;  4M8A A;  5DM6 3;  2EZV A;  1NR4 A;  3GQB A;  5CMD A;  2PQE A;  1GUS A;  4IFD H;  2JP1 A;  1Z6H A;  4KKS A;  2JEB I;  3VR6 A;  1I6H B;  3WDN A;  2NTT A;  1ET9 A;  2RBM A;  1LTI D;  3K6O A;  3V05 A;  2H1E A;  3RZO B;  4ABN A;  2IT1 A;  3PUY A;  2IW3 A;  1QE6 A;  3SK8 A;  4DU9 A;  4X3S A;  2F0G A;  2PCF B;  4NW2 A;  1AZP A;  2BCO A;  2M00 A;  3VA5 A;  4K5W A;  2A6H D;  2V4D A;  1HRJ A;  3NE5 B;  2EOT A;  3GO5 A;  3SK5 A;  1PFN A;  4KN7 C;  1NUC A;  1JB3 A;  1I4R A;  2D5D A;  3H91 A;  4FNF A;  2A6E D;  3QO2 A;  1A15 A;  3EVQ A;  4DXF A;  4L8J A;  3QG1 A;  3C46 A;  2FMM A;  1FR3 A;  1PRT F;  2EYP A;  2EY1 A;  2RQX A;  2XWJ B;  3W3A A;  1JWU D;  3DEP A;  1BCP D;  2QDB A;  2AWN A;  3R2T A;  1LTS D;  1DOM A;  1D5M C;  2IX3 A;  1WTV A;  5ELC A;  3BS1 A;  2BA0 A;  3VYR A;  2JSO A;  3MEH A;  1LO5 D;  1F9S A;  4EQO A;  1GHK A;  2AQ3 B;  2EE1 A;  1ZXT A;  1MD2 D;  1BDO A;  5ELD A;  1D5X C;  5C3X A;  4IUN A;  2R92 B;  1U4R A;  3K5L A;  2EVB A;  5FOB B;  4KD3 A;  3SK6 A;  3J7A V;  2CW0 D;  1Q90 A;  5COR A;  3GV6 A;  5KYL A;  1ET6 A;  1EWC A;  4KV6 A;  2FIN B;  3IKJ A;  3ND8 A;  1LV9 A;  1WTW A;  3A8J E;  3BYY B;  4PV1 C;  3A7A B;  5M5Y B;  1WCM B;  4RKL A;  1QCB D;  4ID6 A;  3I73 A;  3HOZ B;  1SMY C;  1LT5 D;  1V1O A;  4F87 A;  1DYQ A;  5CV8 A;  3SEB A;  2E2D C;  3HOV B;  1M8A A;  1ENF A;  4IUV A;  1S5D D;  5ELE A;  2F0V A;  2EY2 A;  3K58 A;  1SYC A;  2RSN A;  5C4Z A;  2YU9 B;  1JOQ A;  3KLS A;  1Y8P B;  3T56 B;  3VR2 A;  4HSV A;  3KLR A;  4FF2 A;  2F0M A;  3NQI A;  2OF1 A;  1R4Q B;  4UDU C;  2Y0S B;  3U9O A;  1R4P B;  1F77 A;  4ME5 A;  2IX0 A;  5G3L F;  1OXU A;  1EY4 A;  5EBD A;  3HOW B;  3R8B A;  1QWY A;  4EVO A;  2PZW A;  5FK9 C;  1HPC A;  2RKS A;  3NPP A;  5EGT A;  2R7Z B;  2H4O A;  4RFB A;  2A6E C;  4DNT B;  1D2B A;  1Q1B A;  2SEB D;  4X3T A;  5LL6 X;  5T1G A;  3DHQ A;  3U9S A;  4J1M A;  2IPK D;  2L9H A;  4DF7 A;  3PUX A;  3TP8 A;  2F0J A;  1BCP C;  1C4Q A;  1CQF A;  2Z4H A;  1ICW A;  1O80 A;  1B4O A;  1TS3 A;  5KIX A;  1TT2 A;  1F9R A;  1SDF A;  1RKN A;  1STE A;  1LTB D;  1EQV A;  2BDO A;  3I4L A;  1F2Y A;  3VR3 A;  3GTP B;  3VR5 A;  2ICI A;  4WJW A;  2K5W A;  2YYZ A;  4RHS A;  5K5P A;  3TBI B;  3NHH A;  5A35 A;  5DAU A;  3EFX D;  3WOE A;  1TS5 A;  1GUO A;  3H3V C;  2CW0 C;  1CZW A;  2PNR C;  1TWA B;  1HXY D;  5M3M B;  2XIW A;  2L5T A;  2B2W A;  1A3V A;  4ILW A;  5EPL A;  1JOR A;  5C4X B;  3DMU A;  2F0Q A;  1H9S A;  2C5C A;  4J8Q A;  1ROD A;  4RGM A;  3BVG A;  2KEE A;  3I72 A;  1STA A;  1STN A;  5LL6 S;  4ZQ3 A;  2QCP X;  4NKL A;  4FXG C;  3CQZ B;  2EJM A;  3GTL B;  1AP0 A;  3D4R A;  2KUM A;  4ZLT F;  3PO3 B;  4RGO S;  5FO9 B;  2F1M A;  3MC0 B;  4C1N K;  2K5Q A;  2EJF C;  3V2T A;  2WB1 B;  1H9J A;  1SND A;  1SJE D;  1I4X A;  2NBF A;  2EYM A;  2M2L A;  1V1P A;  2AQ1 B;  4EQP A;  4WFN 3;  5JEA H;  2D62 A;  1Q3L A;  1H9R A;  1Y8O B;  4ULL A;  1DD2 A;  4B9X A;  4ZUJ A;  3BG3 A;  1I4H A;  3KBG A;  4KY6 A;  5IT9 E;  5CBE E;  1AW7 A;  5E4X A;  1EY9 A;  4FXD A;  1Z47 A;  1HTP A;  2Q8R E;  3G6J B;  2K7V A;  5I6Y A;  1H9M A;  1XTC D;  3D3R A;  1QNU A;  1B44 D;  1A2T A;  1Y1V B;  1OXS C;  5BN5 A;  4HMI A;  2GA4 B;  1NR2 A;  5K36 H;  1ILQ A;  4OO1 H;  1G2T A;  2F03 A;  3VYT A;  3LNN A;  1WTP A;  3S1R B;  3BDC A;  2O5I C;  1VF5 C;  2NYZ D;  3J7A F;  3QWN A;  1VDZ A;  2X6G A;  4A3B B;  3OW7 A;  4EGV A;  1AEX A;  2F0U A;  1B53 A;  1M4V A;  1O78 A;  4XXE A;  1CHP D;  2DNC A;  2D9U A;  4IFD G;  1DXM A;  1TU2 B;  4DFA A;  3E6Z X;  3OMG A;  2PO4 A;  5C6A A;  3RLF A;  4BA2 I;  4RCN A;  2ZXR A;  5BN4 A;  4DAP A;  4RHR A;  2BE5 D;  1II3 A;  3MXU A;  4KY7 A;  1G29 1;  4PMB A;  1J8I A;  5FO8 B;  2JYO A;  4XQN A;  3ERQ A;  4CJ2 C;  2VXW A;  1UEA B;  4XQJ A;  2MUY A;  2CQA A;  4RGN A;  1EL0 A;  5CV7 A;  5D14 A;  4A3K B;  4KJN A;  4OL7 A;  2A68 D;  3D6W A;  1NCV A;  1JCK B;  4KKT A;  5C4H A;  2N88 A;  2M9V A;  4MN3 A;  3OIP A;  1RTN A;  4R8I A;  5EKI A;  1PRT B;  4KKU A;  4TQU S;  5IGC A;  1PTO H;  5HGT A;  4FF1 A;  4IUR A;  1RF2 D;  4IQZ A;  3I4N B;  2KJX A;  1KLU D;  1SNP A;  2WII B;  1VCI A;  2JXM B;  2RDF A;  4CHT B;  2K6A A;  5EJW A;  3P7J A;  1IKM A;  2F0I A;  3C1E A;  3T51 B;  2ICE C;  1QNK A;  4FP5 D;  4H13 C;  2ZXP A;  3OHX C;  4G7O C;  1PRT C;  1BF4 A;  2MGS A;  4G57 A;  3GD7 A;  5JAV A;  2NN6 H;  1CA5 A;  4JBW A;  4JK1 C;  4V0B A;  2XN9 C;  4KK7 A;  2F0P A;  1SNC A;  3MTS A;  5I4D A;  1SMY D;  5JOB A;  3C1F A;  3CU7 A;  3L3O C;  1F2Z A;  2NVX B;  2VUM B;  2F0K A;  4Y7N B;  4TSS A;  1SAP A;  1E2V A;  3HEJ A;  5KND A;  5DNF A;  1CHQ D;  4O1N A;  4BBS B;  2OEO A;  2NB0 A;  3LX0 A;  3Q6S A;  2F3W A;  5EQ0 A;  4DAV A;  1HQR D;  1Y1W B;  1LAB A;  3RZD B;  4FXK C;  1JC7 A;  3T13 A;  4IFD J;  5C3E B;  3K7A B;  2XVS A;  2E74 C;  3O13 A;  1SXT A;  2PZT A;  4DNR B;  4A3J B;  2A5H A;  2QEJ C;  4CJ0 B;  3SXH A;  2BE5 C;  5ELF A;  2L1B A;  2MP1 A;  3OWF A;  2QIL A;  4R8N A;  1EYA A;  1Z7T A;  3MFY A;  1LTA D;  4PNY A;  4XIG S;  1KDA A;  4KJO A;  1TR5 A;  3RMH A;  3SR1 A;  2SNM A;  2EXZ A;  2A68 C;  2HCI A;  4IUP A;  1TWG B;  2BDN A;  4DXG A;  5KRU A;  3MVV A;  3GTQ B;  4C3J B;  1KAB A;  3D31 A;  4HCS A;  4R9W A;  1JR0 D;  2RDH A;  2L55 A;  1BXT A;  1CQV A;  3AU7 A;  2R61 A;  4Q5V A;  4C3H B;  1Q12 A;  1PZK D;  3R3O A;  3A56 A;  4XYO A;  2K33 A;  4WOR A;  3K57 A;  5KGU A;  2RA4 A;  5COY A;  1KTK A;  4DA2 A;  3M7N A;  1SYE A;  4HCE A;  3M85 A;  1HFG A;  4ZRZ A;  3A7L A;  1JOO A;  3OPO A;  2R3Z A;  5KNC A;  1I6V C;  4HMJ A;  5D3I B;  4CJ1 B;  3J80 L;  2EYL A;  1PYW D;  1X3Q A;  1FGB D;  2KA7 A;  5IGB A;  3BDL A;  5JJZ A;  3FVQ A;  3HZX A;  4QB4 A;  5JPM C;  3PV0 A;  1L0X B;  1OXT A;  1E0B A;  3I8Z A;  3HOU B;  4LMQ D;  4O42 A;  3CRK C;  3HGB A;  1HUN A;  1CI3 M;  1PZI D;  2WP8 J;  1ESF A;  2WIN B;  4F7X A;  4IFD I;  1TVX A;  1TY2 A;  1Y8N B;  1X3P A;  2F0S A;  1WTX A;  3K0Y A;  1TWC B;  4F88 A;  3QIA A;  1CA6 A;  2JA8 B;  1EFI D;  3F2U A;  3EJI A;  1FNV A;  1ONL A;  4KMU C;  1JWS D;  4KD4 A;  2B2U C;  4G4K A;  1PLF A;  3OWE B;  2G9H D;  5JEA G;  3Q24 A;  3DUZ A;  5NUC A;  1KDB A;  1TWF B;  5IOC A;  5J39 A;  1K8O A;  1HTL D;  5EKL A;  4RAU C;  4HN7 A;  3RUZ A;  3A8I E;  3S1Q B;  1FD7 D;  4XTC S;  3ERO A;  5D65 A;  2IL8 A;  1S5C D;  1HA6 A;  3AB9 A;  1TQO A;  4A3D B;  1MGS A;  4S3S A;  3T16 A;  4B08 A;  2XRQ D;  1T5E A;  3KF8 A;  2ZXO A;  5I2X A;  3T53 B;  2AUK A;  3EA6 A;  4A3M B;  5K36 G;  3K5O A;  2JE6 I;  4OO1 G;  4H7B A;  1D5Z C;  1TS2 A;  3URY A;  1EEF D;  5J22 A;  1STY A;  4XT3 B;  4LAA A;  1V8Q A;  2XRS D;  2VNU D;  3DEO A;  4M1U B;  1KLG D;  3VA7 A;  1YNN D;  4DK0 A;  2AWO A;  3MXG A;  5E3F A;  2PMZ B;  5I9P A;  5HUR A;  5C0X H;  5IGD A;  3AMU A;  2B8F A;  5A2Q L;  4ZK9 B;  1FNU A;  4HSP A;  4QCL A;  2BOS A;  3TZU A;  2K32 A;  2QKI C;  4OHJ A;  5EPK A;  2EYO A;  2JEA I;  1PDQ A;  1PFM A;  4OIJ A;  5M9O A;  2RVL A;  1EY8 A;  4PMC A;  2KQ3 A;  1WTO A;  4RWS C;  2HQE A;  4KTA A;  5CC4 A;  2F4I A;  1PFB A;  1VMP A;  3X3M A;  3OSO A;  1HCZ A;  4HED A;  1CK1 A;  1F9Q A;  2ID0 A;  3K5N A;  2I46 A;  3H6M A;  2Q8T A;  1B9M A;  1IL8 A;  4KY5 A;  1WD1 A;  2FFK B;  1EIH A;  3K59 A;  2F0N A;  3C2P A;  1MSG A;  2X6L A;  2B2V C;  2K05 A;  3I3C A;  3D4W A;  3N6R A;  1SNM A;  3P20 A;  1OO9 B;  2K5D A;  2B39 A;  2DY8 A;  4K8I A;  2MJ8 A;  1LTT D;  1SNO A;  1LT4 D;  4K2L A;  1GXD C;  2AUJ D;  1OXX K;  3E0J A;  1PRT D;  1BCP F;  3BZD B;  4X3U A;  1B1Z A;  2A73 B;  3S1N B;  4K5X A;  3TP6 A;  2L4N A;  4A3E B;  5JEA J;  2BA1 A;  1GUN A;  2LMC B;  1RHP A;  2K03 A;  4CKE A;  4K6L A;  1JWM D;  3NSW A;  2NN6 G;  5I9O A;  4BS9 A;  2J7Z A;  3R2I A;  1RJT A;  1ZKO A;  4ZUI A;  3QB3 A;  1PXU A;  1U4P A;  2EYF A;  3BVM A;  2FJ2 A;  4UAI A;  2CHB D;  5C5M A;  1VMC A;  1HFN A;  5DM7 3;  2A74 C;  1EU4 A;  1SSO A;  5LHY 1;  4FF3 A;  2LKV A;  1CT1 D;  1QG7 A;  3GTK B;  1B2T A;  1SBB B;  3QJY A;  4N9T A;  1EY6 A;  3MFG A;  1YNN C;  4MHE A;  4TRD A;  1BNZ A;  1EZ6 A;  2EPB A;  3QOL A;  1IKL A;  1SYD A;  2XWB B;  1U4L A;  1H9S B;  1LTG D;  1T5X D;  1ENC A;  1NSN S;  3PO2 B;  3H94 A;  1ESR A;  1A3U A;  4HAE A;  4CBV A;  1HA5 A;  2KVM A;  2OXP A;  3NBI A;  1IHZ A;  3KK7 A;  5IGE A;  4QUF A;  3TDQ A;  2JA6 B;  4C56 C;  3P75 A;  4PMW A;  1E2W A;  1V1P B;  2L0C A;  2OT2 A;  2XSC A;  1K83 B;  4IUU A;  4G7Z C;  1Q1E A;  5FO7 B;  3HOY B;  4L6T B;  5G3L D;  1B9N A;  3PMF A;  2DN8 A;  3H0G B;  4LK1 C;  3RD4 A;  2I07 B;  5I6W A;  3UI2 A;  4GZY C;  4CKB A;  1SE3 A;  1JOK A;  1I50 B;  1MBY A;  1BR9 A;  1SE4 A;  2LFN A;  3M4Y A;  3MAQ A;  1AN8 A;  1D1K A;  4DK1 A;  3M4O B;  2AQ2 B;  5ISR A;  3MWY W;  3OOC A;  2F0D A;  4H44 C;  3SVM A;  1C48 A;  1ZEQ X;  1U4M A;  1SNQ A;  3SDZ A;  4C3I B;  5ELB A;  2KEC A;  1W6J A;  4OO1 I;  4C3J G;  2B63 B;  1LLR D;  1SJH D;  1I3Q B;  1L0Y B;  3SHL A;  3M3Y B;  5AFW A;  3ONA B;  2HDL A;  2KED A;  2RSO A;  3GTO B;  3L9A X;  2NVY B;  4A3G B;  3VYS A;  1I4G A;  3FDT A;  3KBX A;  1A3T A;  5DEH A;  3S2D B;  2HUG A;  2NVQ B;  1F9P A;  5JPN C;  3GTJ B;  3W2D A;  2JA5 B;  1EIG A;  1ENA A;  3S16 B;  1KNA A;  2F0O A;  4FF4 A;  5C3W A;  1Y69 U;  2G9D A;  2B2U A;  2F0T A;  5C5L A;  5BN3 A;  1C8C A;  3R93 A;  1DCZ A;  1H9K A;  1O7L A;  2K28 A;  1B50 A;  1PTO F;  2EY5 A;  4Q0F A;  2CVR A;  4IUT A;  3DWA A;  1K8M A;  2NTS A;  1SEB D;  1KDC A;  4L63 B;  2FMC A;  3K5M A;  2B2T C;  1EYC A;  4I7Z C;  3Q0A A;  2F0E A;  1EY7 A;  3I90 A;  3S17 B;  4K8J A;  1XWE A;  1AFP A;  1TII D;  1EOT A;  2ENB A;  2SNS A;  2SOB A;  1LT6 D;  3MXN A;  3D4D A;  3CKI B;  1YNJ D;  1STB A;  2B2Y C;  2VB3 X;  2NUC A;  1G8Z D;  3H09 A;  4KHZ A;  4NMZ A;  1GUT A;  1KNE A;  1HUM A;  1X32 A;  2A69 D;  3BDO A;  2NVT B;  4HR7 B;  2R6G A;  1DM0 B;  1EQT A;  1EZ8 A;  3I4M B;  2NZ1 D;  1ML0 D;  5E1F A;  5M3F B;  2WV6 D;  1JQY D;  4J6H A;  4BY7 B;  3L7Z C;  3S14 B;  2NN6 I;  3HS0 C;  4YIJ A;  3VYU A;  2F0L A;  2VB2 X;  5C0X G;  5IIF A;  2KOL A;  2MPM A;  3PUV A;  4QIW B;  4BY1 B;  1R9T B;  2HDM A;  1IW7 D;  2E2I B;  2WAQ B;  2Z1C A;  1PZJ D;  4F8M A;  4ODG A;  3JAM L;  2DNE A;  5FLX L;  5I2Y A;  1I4Q A;  3J80 E;  4K14 A;  2K1B A;  3DXJ C;  1FNW A;  1TS4 A;  3EQL C;  3NK9 A;  1LTR D;  4RKB A;  3GP7 A;  5EKK A;  2KCC A;  2E2H B;  4FO2 A;  3X3N A;  1EWH A;  2Q8I B;  3G7L A;  3NXW A;  5CV9 A;  1LT3 D;  3M7G A;  4QUC A;  2B2V A;  3IFD A;  4FYD A;  4RA8 A;  3FEW X;  3LWU A;  4E6I A;  1XX8 A;  3JAM E;  3KUP A;  1BQQ T;  2EDG A;  5FLX E;  4QF4 A;  3PUZ A;  1XYI A;  2SDF A;  1OXV A;  3NTH A;  1GUW A;  3TME A;  3FPP A;  4DGZ A;  2E75 C;  1EY0 A;  1GHJ A;  1BO0 A;  4LJZ C;  4CKC A;  1BOS A;  1ZYR D;  4BA1 I;  3CHB D;  3TZD A;  1DZ1 A;  3TSS A;  2D2C C;  4K5V A;  3CRL C;  4AYB B;  1BCP B;  1S5F D;  3ZYY X;  4RCO A;  2N55 A;  2KHS A;  4KHV A;  2A6H C;  4OIK A;  3S9W A;  1KAA A;  1RD9 D;  3D8G A;  4FVM A;  1IYV A;  1CZG A;  3HP3 A;  2L12 A;  4NP5 A;  3J81 L;  4K6D A;  1EY5 A;  3A54 A;  1YNJ C;  2IWH A;  3ND9 A;  2O4X A;  5CR3 A;  1WTQ A;  2WAC A;  2Z4I A;  2DY7 A;  1QOH A;  2A69 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...