1PRTF

The crystal structure of pertussis toxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title The crystal structure of pertussis toxin.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Toxin
total genus 19
structure length 98
sequence length 98
chains with identical sequence L
ec nomenclature
pdb deposition date 1993-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09276 Pertus-S5-tox Pertussis toxin S5 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1prtF00
1PTOB 1PZJD 3R8BA 3DWPA 3SEBA 1XTCD 1PRTF 2SEBD 1I4GA 1JQYD 4RHSA 1SE2A 1TS5A 1RF2D 2XNAC 4RGMA 5FKAC 4C56C 1BCPB 1HA5A 3KLSX 1DYQA 1L0XB 1DJRD 1SBBB 2XRSD 3DWQA 2AQ3B 1T5XD 1LTBD 1LLRD 2RDGA 1S5CD 1UUPA 5D3DA 4RGTA 1ET6A 5ELDA 1HQRD 1TY0A 1PTOH 1ET9A 1PRTB 3BVMA 3MC0B 3EA6A 3EFXD 1AN8A 3R2IA 4RGNA 5ELCA 3TSSA 1TS2A 5D3IB 1EFID 1PZKD 1EWCA 4L63B 1JR0D 1ESFA 1SJHD 5ELBA 2R61A 4RGOS 1PTOC 1CK1A 1M4VA 1SJED 3V05A 1HXYD 4L6TB 1LTRD 3BVGA 1FD7D 1PTOD 3DWAA 2NTSA 3OWEB 2IPKD 1TY2A 1JWSD 4UDUC 1PZID 1TS4A 1BCPC 4TSSA 5ELEA 1I4HA 1I4XA 1S5DD 3CHBD 1JWUD 1D5MC 1LT5D 1LTSD 2Z8LA 1BCPD 1KTKA 3O13A 2AQ1B 1TS3A 2NTTA 1FNWA 2G9HD 3BYTB 4RCOA 1KLUD 4ZYSA 1PRTC 1JCKB 1F77A 1V1PB 2QEJC 3BYYB 2O2LD 2AQ2B 1CT1D 4Z9CB 1L0YB 1S5FD 1V1OA 1QILA 1LT6D 2IJ0A 1PRTD 1LT3D 4K6LA 1MD2D 1EU3A 2RDHA 1LO5D 1LTGD 1LTTD 1D5XC 4DXFA 3GP7A 1B44D 5ELFA 1I4RA 1CHQD 1GOZA 1RCVD 3BVZA 5FK9C 1XXGA 4RH6A 1SE3A 4RHRA 1S5BD 1I4PA 5I4DA 1CQVA 2J4XA 1BCPF 1EU4A 2QILA 3URYA 1BXTA 4BWGB 1STEA 2XRQD 3W2DA 1SE4A 2WV6D 1ENFA 1SEBD 4O1NA 1HTLD 1LTAD 1D6EC 1JWMD 3MFGA 1FNUA 1RD9D 1EEFD 2XN9C 4OHJA 1PTOF 2TSSA 1B1ZA 1AW7A 1EEID 1SXTA 4RFBA 1FNVA 1V1PA 2CHBD 1CHPD 5TSSA 1RDPD 1S5ED 1UNSA 3BZDB 1FGBD 1D5ZC 1LT4D 4DXGA 1KLGD 3R2TA 1I4QA 1G8ZD 1PYWD 2ICIA 1LTID
chains in the Genus database with same CATH superfamily
4QIWB 1SYGA 3S15H 2G5DA 3K5MA 2X6LA 3ZYYX 2RHSB 3NQTA 1KNAA 1EOVA 4PZ8A 1VQHA 2LY7A 1KDBA 4KHVA 5JOBA 4IUTA 5C3EB 3KDFB 3FRPB 1ESRA 1UE1A 2A69C 2Q8IB 4DR7Q 1TVXA 4QQBX 3RZOB 5J39A 1WCMH 2KECA 5I9PA 4CDEC 2A69D 4S3SA 1CUKA 2SOBA 3R2IA 4I7ZC 5EAYA 2B2UA 3TS0A 1N36L 5IYDH 3I91A 2K5VA 3KBXA 3KF8B 4MNOA 2EZVA 4IOAA 1F2MA 2F4IA 1X9NA 5IP9H 4BY7H 1AP0A 3G4SA 3SK8A 5M5WB 3PF5A 4OX9L 1SNOA 3GV6A 1BCPC 3D6WA 4DUYL 2EYFA 1VQJA 4AQYL 1DOLA 1BCPD 2EYHA 5FO8B 4RCOA 1KLUD 1V1OA 3PIPA 2JA8G 4BBRH 1XNRL 1K9MC 4IJLA 1HQMC 3S1MH 1IYJB 3A0JA 4DNRB 2QA4A 2EE1A 3X3NA 2FMMA 2JN4A 4DV4Q 1X3QA 4X65L 3PUWA 4B3TQ 3W1BA 1XMOL 2K5QA 2NN6G 2UXDL 1B53A 3CCUA 1I50H 4IFDJ 3TN2A 2R7DA 1PLFA 2NB0A 3UDIA 1MSHA 4NXNQ 5JPNC 1ZEQX 2UUBQ 1XPRA 4CDFC 3H3VC 3MAQA 2R92H 3HFZB 4DAPA 4DR5Q 2EJMA 1A2UA 1Q90A 2JA8B 2QKIC 1EEID 3CCLA 3NSWA 1KLGD 2JSOA 1G8ZD 2IX0A 2HT1A 1H9RA 3KBGA 3DWPA 4QCLA 3SEBA 1HZCA 3FKIH 5IYCG 3I55A 4QF4A 1STAA 3MA2B 5IODA 1STYA 3T1YQ 4PZ7A 1AZQA 3IAYA 2ENBA 2N49A 1DYQA 4YWMA 4J6HA 5ELOA 4LUOA 1LLRD 1A0IA 1DM0B 4LF9Q 4JPBW 1SNQA 4UHVA 4CKBA 1Z9FA 2J0TD 5KYLA 4KD3A 4QGUA 1IKMA 3F2UA 4DGZA 5CORA 4J15A 4IUQA 4TQUS 2G9DA 4F8MA 4K8JA 4P75A 3S24A 4A3BB 1XTDA 3QWNA 1Q3LA 3VR5A 3NBHA 5CC4A 4GKJL 1E2ZA 1H9KA 2AQ1B 2GVBA 3MZ5A 1FNWA 2G9HD 2Q2HA 4IFDI 2CQAA 3DMUA 4X66L 1F2LA 4GZYC 5C3WA 4WJWA 4JI3L 1BQQT 1JOQA 4QL5A 5F2DA 5C4XH 3GTKH 1LTGD 1WVLA 3CPWA 1PFMA 5JJKA 3NK9A 1VQKA 4DV5L 2CH4A 3G71A 1HNWQ 4A3LH 4PNYA 3FPUB 2OT2A 4G7HC 1LTLA 1QVFA 1WCMG 2BCOA 1BOSA 4OONA 1SNMA 5IYDG 3CW2C 1S72A 1CSPA 2JA5B 1B7YB 4LF5L 4X3SA 5A2QE 2DJFC 2RBMA 4JBKA 4ZRZA 1BBWA 1DONA 4C1NI 4Y52H 2VUMH 5IP9G 4BY7G 3GTJH 2LKVA 2FXQA 4F7XA 2VXWA 4JI5L 4JI7L 3S15B 1X3GA 1WTHA 5JJIA 5C44B 1EEFD 1PH1A 1PTOF 4M1UB 2JA7H 3K5OA 3H09A 4JI1Q 1JJ2A 4EQPA 1Q82C 3ITPA 1PYWD 2Z0SA 3H0GH 2VQFQ 4IPDA 2E2DC 5LMNQ 1PZJD 1PH5A 2L5TA 1QVCA 5IP7H 4BBRG 2YV5A 3SGIA 4A3DB 4B3SL 3S2HH 4P71A 2XVSA 2K75A 1N8RC 2PZWA 1L0XB 4P72A 2LMCB 4ZQ3A 1QZGA 1SE8A 4ZUJA 1MIUA 2QGQA 4TVAB 3EA6A 4IOCA 3A7AB 1KQSA 5E1FA 4FXDA 1I94Q 1BVSA 3NE5B 4WJ4A 5FLXL 4OEMB 4C3IH 4B9XA 2F1MA 2MPMA 1HPCA 4IURA 2OWOA 4KJNA 2F0VA 3A54A 4UP7A 1V8QA 2R92G 5LHY1 1Q8KA 2RSNA 5IT9c 4BBRB 1N34Q 1JWSD 1IW7C 3PSIA 3GTOB 4JI2L 1YNXA 2IX1A 4DAYB 1IW7D 2HHHL 3CQZH 2MO0A 1ICWA 3I2ZA 2MUYA 1HJPA 2AKWB 1EIFA 1KABA 3BYTB 1AE3A 4ZYSA 2ZTDA 1EYCA 1A8VA 3S9WA 3FKIG 1AEXA 1KIXA 3K8AA 3S2DH 1QILA 3PGZA 5I6YA 4FDBA 4KV6A 2RQXA 1QJOA 2YU9B 1KDAA 4NMZA 1EIYB 3RLFA 1E1OA 2P5ZX 2R7FA 3AEVA 4MZ9A 1PDQA 2WB1G 1TXYA 2I46A 1BCPF 4JV5L 2R92B 1C8CA 1DCZA 3M7NA 2WV6D 1U4MA 2ZXPA 2UU9Q 4KN4C 1A3VA 1HTLD 4K0KQ 2PCFB 3K6OA 5I9OA 1HUNA 3X3MA 4K6DA 4LFBL 2L11A 3FKIB 1Y1VB 2EYJA 4BS9A 5K5PA 3TREA 3HOVB 3HGBA 1YNJC 1W6KA 4NXMQ 4A3MH 3T1HQ 4XDXA 3GTPB 1KDCA 3S1NH 1X3PA 1YNJD 3M4OH 1TU2B 3E9HA 2C9OA 2K32A 4HIMA 3MXNA 1CA6A 3R8BA 1J5EQ 2KCNA 5C4XG 1SE2A 2LXKA 4X64Q 5EPLA 1X56A 2L9HA 4DN4M 1X3FA 1HUMA 4AYBE 4A3LG 1I3QB 4DA2A 1KRSA 5E3FA 1WTXA 2N88A 1L1OC 2Z4IA 1UUPA 5BR8Q 1ET6A 1SSOA 1X6OA 2VNUD 1VQAA 4FF3A 2D62A 4O42A 3TP8A 1YJ9A 2BA0A 4RKLA 3I4NB 1FVIA 1E7ZA 5JVH3 5T1GA 2VUMG 1R9TH 4CHTB 4PMBA 1VQDA 1VQFA 1M1KC 4LJZC 2E8GA 1CK1A 1IBKL 1LTRD 1HR0L 3KLWA 3K0XA 4Q5VA 2JA7G 2K6AA 1TY2A 2F0PA 3Q8DA 1I4XA 4MIUA 4LK1C 3IRBA 4H44C 3Q6SA 2A6EC 4CDDC 1MSGA 1FYCA 1G2SA 3H0GG 1S4ZA 5CV7A 4XIGS 3SR1A 5IT9L 1B3AA 3T51B 1BNZA 2A6ED 5E4WC 3J7AF 4DK3C 2KA7A 5IP7G 1FGUA 1PH8A 2ICEC 5C3EH 1MD2D 2NUCA 1PXUA 2K03A 2K5WA 4GLAC 3DHQA 4N9PA 5JEAH 2HIVA 3I3CA 3GTJB 1GOZA 1E2WA 3VR2A 3NP8A 4JC0A 2B2TC 2ZM6L 2RSOA 2NWGA 3I72A 4DF7A 3NELA 3PUXA 3CMAA 5C3XA 3WOFA 2PW5A 2PI2E 3NTKA 3T53B 4RA8A 4PG3A 4C3IG 1N33Q 5M5WH 5DM63 3H0GB 1SROA 4C3JH 1LM0A 4IFDH 3OW2A 2TSSA 2EXZA 1VQLA 1KC8C 4KKTA 4LF4Q 5ELNA 1AH9A 1BKBA 3HKSA 2L15A 4ILWA 1V1PA 1VS0A 3S2HB 2Z6KA 5C5MA 3F2CA 3A74A 2QF7A 4DV1Q 2HCCA 3N52A 4LW1A 3CRKC 1SNCA 4DV6L 4KI0A 3NBHB 1SNDA 4HJAA 4RGMA 1RF2D 3NHHA 4C56C 1SBBB 2H5XA 4V190 2AQ3B 1M90C 4JYAL 2Q8RE 1WTOA 1O7LA 3J81c 4DUYQ 4DR2L 1L2FA 1MJCA 3RMHA 1PZKD 1EWCA 3SHLA 1D7QA 3H94A 1IBLQ 1STGA 4ODGA 4OIKA 4RGOS 2MFIA 4KKUA 4DR1Q 4R1JA 1SJED 4J8QA 4A76A 4GS3A 1Q81C 3S2DB 3TP7A 4LUVA 1EUJA 1JICA 3OWEB 2F4VL 4ZAIA 5EKKA 4UDUC 1OXXK 4A3MG 1ZYRC 2QW7A 4YY3L 1XMOQ 1W6JA 3T56B 1ZYRD 1WTQA 5JJZA 3H15A 1VQNA 1WOCA 4L5SA 2FHTA 2O2LD 5C4ZA 1TIID 2FMCA 2RCNA 1NE3A 4B3MQ 2B2YC 4HJ7A 3BS1A 3OTOL 2K4KA 2A68C 3CU7A 1UE5A 5LL6X 3F8TA 4IO9A 2MO1A 2NYZD 2OEOA 2Y0SG 2HDMA 2A68D 3EQLC 4EQOA 4JBWA 3QR8A 1SFOH 1EQRA 3K0YA 2E5LL 3GTGB 2KHSA 4HMJA 5NUCA 1LUZA 1S40A 1F9PA 3S14B 4OIJA 4BXXH 4ME5A 1RTNA 4JI0Q 1RL2A 4LF7Q 1ENCA 2XIWA 2WAQG 2KHJA 4C2MB 2K7VA 1IBMQ 5C4JH 2EPBA 2B39A 4A3IB 3FPPA 2SNSA 2DY7A 2EQSA 4K14A 2CHBD 4LNQA 1B9NA 3IFTA 2F0NA 4QB4A 1OXUA 3VA7A 1I4QA 4EQNA 1MHWC 3Q0AA 1PH9A 4DR6Q 1Q46A 2Z4HA 4EVOA 1BF4A 1D1IA 1XWEA 5C3EG 1VMCA 3OWFA 1PRTF 4RHSA 3VR4A 4FF4A 3HOYH 2XNAC 2B2VA 4ID6A 2H4OA 1HA5A 3I4MH 3RLNA 3RN2A 3J80L 1DJRD 2GN5A 1MGSA 3IFDA 2QDBA 2JA5H 1GUTA 1X55A 2I07B 4UY8C 1TY0A 1PTOH 2WAQB 3F1ZA 5ELCA 2SNMA 4XT1B 5D3IB 3WDNA 4DUZQ 4ZLTF 4DU9A 1EFID 1NY4A 1PVOA 1O78A 3P1HA 1U5KA 3SK4A 2OF1A 4GN4B 4X66Q 1ESFA 3SDZA 1IHZA 1SJHD 2QCPX 2B8FA 2ZTCA 5G3LD 5C44H 3GDEA 3J81L 3HOUB 2KCCA 1GKHA 3L7ZC 4C3JG 1OO9B 2LXJA 2K01A 4IFDG 2YTXA 1VQPA 4FXGC 1Y1WH 1HXYD 5M3MB 3CXCA 3PQIA 1YHQA 3K57A 1KD1C 1VQIA 2UXCQ 4IJHA 1TKWB 3PMFA 4HSVA 2F0GA 2Z8LA 4O2DA 4DNTB 2XWJB 4JI4L 1EIHA 5HGTA 2NTTA 3E3XA 4IUPA 4A3DH 1OTCA 2A5HA 2AQ2B 1IL8A 4GKKQ 1HHVA 2VZAA 3OIQA 4A4IA 5FLMH 4OELB 4GNXA 3MXNB 3SE0A 2DJGC 1WI5A 2ZTEA 1I4RA 4RWSC 1K28A 1RCVD 2OTLA 3D31A 3KK7A 4C3JB 4GOPC 1PH3A 1G91A 2K50A 1SDFA 1IL2A 2PW7A 1B50A 2LSSA 5D65A 2QILA 2JEAI 2MQHA 5LMUL 1SE4A 2KCMA 3RD4A 5JEAJ 1TWCH 4A3KH 1ENAA 3C1FA 1SEBD 4O1NA 4HJ8A 1D6EC 3G6JB 4HTHA 4NB3A 2PNRC 4E6IA 3GTOH 3RN5A 1OXVA 5BN4A 3HKZG 4H02A 2F0LA 1XJVA 3PIO3 3IKJA 4WJ3M 3CC4A 2PMZE 4K2LA 4EGVA 4IALA 1V43A 1O80A 2YTVA 2YU9H 1GM5A 5FKAC 1GHKA 1LV9A 4HIKA 2B2UC 1HFNA 1JB3A 4FF2A 3J81i 1II3A 1LTBD 2A6HC 1HQRD 1BBUA 3L9AX 3BVMA 4HCSA 4JI8L 3EBEA 2A6HD 3HKZB 1EQQA 5AJ3L 2PZUA 5EKLA 1C48A 4DV7Q 2F0KA 2CW0D 1O7ZA 3BU2A 3TDQA 4R4IA 4BXXG 1Y1VH 2EYMA 4YIJA 2L55A 3Q23A 4A3BG 3LX0A 5L37A 3HOVH 3L3OC 1FJGQ 3GTQH 3GTPH 5DLQE 1PYBA 4TSSA 5FLXc 4UAIA 1F2ZA 2JEBI 2ASBA 5IIFA 5JPMC 1TS3A 3H6MA 2VB3X 1N32L 4EQ5A 4JOIA 1V1PB 2DNCA 3ULJA 2IWHA 3HOYG 1S5FD 4B08A 5M3FB 1I3QH 4C3HH 2O4XA 3I4MG 1Q7YC 1SFOB 2K1BA 3E9IA 5IWAL 1JMCA 3A55A 5CV4A 4LFBQ 5FK9C 4DR3L 3K5LA 2JA5G 3ND9A 1KRTA 1V9PA 1I4PA 3DM1A 3I4NH 4FXKC 2A73B 4LWCA 1I5FA 3HS0C 2B29A 5I2XA 3VR3A 5C4JB 4G7OC 4X3TA 4R4QA 4YWLA 3OMCA 4DR4L 1Z7TA 3D6CA 4POFA 2UUAL 4PQXA 5C44G 1OXTA 1MI2A 1B2TA 4DV0L 3NXWA 1G6PA 1Y1WG 4UPAA 1TWHH 3MTSA 4DV2L 5EBDA 3HOYB 4HJ9A 3E5SA 2OQKA 1PMRA 3DLLA 2V4DA 5HGQA 3I4MB 3CCSA 3K7AB 3JAMc 3R2TA 2VQEL 3I73A 2KEDA 4A3DG 2BOSA 2KUMA 2DNEA 1PTOB 4JBMA 4MTNA 2K5DA 2Q2IA 1SNPA 4R4TA 2F03A 5FLMG 5KIXA 1GUOA 2WINB 1O7IA 1D1KA 1Q12A 1F9RA 1CI3M 4IZ8A 4DR7L 2M00A 2R7ZH 3ULLA 2NZHA 2RDGA 4A3JB 5CBAE 1Y1WB 1ZXTA 2XGTA 3NEMA 1IKLA 1CKMA 4OGQC 3TS2A 4APVA 4A3KG 3D8GA 3OPOA 1AZPA 1EY8A 2VL6A 2R61A 1U4LA 2F3IA 1UWVA 3KFUA 2VB2X 3TZDA 1M4VA 2CCZA 1CZWA 1YEZA 3GTLH 3OMGA 1DXMA 2NTSA 2PZTA 2IPKD 3U9OA 1VF7A 3LNNA 1I4HA 2K33A 3E0EA 1E24A 3HEJA 1Z47A 3CCVA 2ZM6Q 2E2JB 2HDLA 1W3SA 3BZKA 4RG1A 1B70B 1X3EA 2KVMA 2MHVA 4M8AA 3DXJC 4KHPQ 1STBA 3M4YA 2F0MA 1PH2A 2V1CC 1TWCB 3GP7A 4A3KB 2F0IA 3I4LA 5ELFA 3AMUA 5HURA 4DV4L 1JORA 5FLXE 2MNAA 4B3TL 3AFQA 1SN8A 5EPJA 3RLOA 2AWOA 1H95A 5GAHC 1AE2A 2XRQD 4NXNL 2Z6BA 4G4KA 4NPSA 2UUBL 4CKCA 4DV6Q 1Y1VG 1J8IA 1LTAD 3RNUA 1CTMA 4HMIA 2K05A 4DR5L 3HOVG 3ERSX 4OXPA 4K5XA 2XN9C 4OHJA 4R4OA 2R93B 3GO5A 4NKLA 1B1ZA 2SDFA 2Q8TA 2XSCA 1K3BC 1SXTA 5LL6S 2IW3A 1XNQQ 1HR0W 2NVXH 3BZDB 2XWBB 1YBYA 4TRDA 2MJ8A 2E74C 1R4QB 1A3UA 3KUPA 1N9WA 1E1TA 1WTVA 4FVMA 2NVQH 5CV9A 3PV0A 4KTAA 2EYPA 2N3SA 3E0JA 1JQYD 4GN3B 4C3HG 3JAML 3T1YL 3PUYA 1HNXL 1Q1BA 4DK1A 2C5CA 4JI6Q 1RODA 2RKSA 3OOCA 4B3RQ 5IYBH 4HAEA 2F4VQ 4X62Q 4GNXB 3I4NG 3HOWB 4KJOA 4LF9L 3GTQB 1CKOA 3QIAA 5J1ZA 5CV8A 3EVQA 3GTGH 3LWUA 3S14H 2Y0SE 4ZCKA 5JAVA 4IUVA 4L63B 3U4ZA 3EROA 4R9WA 1TWGH 4C2MH 1JR0D 4LF6Q 3NBIA 4IPHA 3G6EA 4A3IH 2BH8A 3K5NA 1RTOA 2FINB 1PH4A 4C3HB 3BZCA 4A3FB 3PO2B 3CF5A 2L12A 3V2TA 3S1QH 3CHBD 3E6ZX 4MHEA 1LT5D 1LTSD 4ME3A 4NP5A 4YCWA 5T1IA 4QIWE 1K8AC 3QOJA 3J81j 1XMQQ 1C4QA 2YTYA 1GJXA 1EZ6A 1B8AA 2QEJC 4JG2A 5JVG3 4KMUC 1JOKA 2E5LQ 2A1AA 1YI2A 1Y8NB 3A8JE 3V96A 4K8IA 4CDCC 3NTHA 1SYEA 2IT1A 1GUNA 4XQNA 4G7ZC 1BDOA 1B44D 1XXGA 3HRZC 4K5VA 4RHRA 1D8LA 1TWHB 2NZOA 3CCRA 4N9TA 2KENA 5IGGA 2A19A 3MFYA 4DV3Q 4LF8Q 2PI2A 1NJIC 1G51A 4BWGB 3HOUH 1QNUA 5A35A 1X54A 5M3MH 1XPOA 5DEHA 1EY9A 1DD2A 2NZ1D 1UAPA 1F9QA 3MFGA 5IT9E 1QE6A 2D5DA 3CD6A 1QVGA 3CP0A 4I65A 3PO3B 3JAMi 3KJPA 2OQ0A 1AW7A 3NUCA 4JI1L 3UDXA 4HJ5A 1TWAH 4CGYB 4A93B 1SYFA 4KY5A 3I7FA 2VQFL 1VQMA 3P75A 2R7ZB 1RHPA 3G7LA 5LMNL 1P16A 2A8VA 3AB9A 2K04A 2AMCB 3MWYW 3GTMH 1JJGA 1I4GA 2C35B 1HNZL 4HIDA 4YCVA 4CJ2C 4YHHL 2XRSD 2EY5A 1T5XD 4P73A 2F0FA 5ELDA 3GTLB 4Q0FA 5EJWA 5FJ8H 1ET9A 2JQOA 3NQIA 1I94L 3FP9A 1K73C 2B2WA 5K36H 1N36Q 2WKCA 3MEFA 3HOZB 2EIFA 3J80c 5C0XI 3A8IE 5ELBA 4DFAA 4L5TA 4H13C 3C46A 2F0JA 4A75A 1U0LA 1U9RA 5CV5A 5IGDA 3H3VI 3C2PA 3BVGA 2O5JC 4I7AA 1CSQA 4OX9Q 1JWUD 1DOMA 5KYIA 3F2BA 2PNHA 5CR3A 4BA1I 1KTKA 5EKIA 4AQYQ 1ML0D 5KRUA 2NVTH 1A15A 2JP1A 5EQ0A 3CCMA 1HH2P 3CCQA 3ND8A 3RR5A 4JK1C 1J6QA 5C5LA 5GQOA 4CKEA 2RDHA 2EY6A 1XNRQ 1LTTD 3DEPA 3K59A 3CC7A 1YVCA 3KF6A 1H9SA 5IYBG 1CHQD 4P2CB 3DEOA 4DK0A 4OO1I 1PA6A 3ZJYC 1JE5A 4X65Q 2OTJA 2IL8A 5M9OA 2UXBL 1U4RA 3SXHA 3LGJA 2UXDQ 1HZAA 2UU9L 3W2DA 4NW2A 2NVXB 4KY6A 1HA6A 2E75C 4K0KL 2EYOA 5M5XB 4A3IG 5GROA 1EL0A 2Z6KC 3PCOB 4QUFA 2NVQB 5GADC 2D0PA 4A3GH 3U4VA 4NXML 3S17B 2E2IH 3T1HL 3OW7A 4CJ1B 1GD7A 2JE6I 5M3FH 3HOXH 1J5EL 2GVAA 5AJ3Q 4B9WA 2RDFA 5AFWA 3UE1A 3FMCA 3I56A 3A8KE 4X64L 2J7ZA 1NAPA 4U68A 1XPUA 4LFCL 3AU7A 1I6HH 1TWGB 4QJFA 1EWHA 5BR8L 2Q2TA 3CKIB 2L0CA 1S5CD 1PH6A 1PRTB 3KJOA 3TSSA 4IUNA 1F9SA 1FL0A 2D0OA 1VQEA 4OWXB 3HOUG 4R8NA 2PQEA 3D0FA 3S1QB 3WOEA 5M3MG 4IPGA 4AYBG 5FOBB 4IN3A 4MTKA 3L2PA 2HIXA 2F0HA 2VW9A 1PTOC 1Q1EA 1EY4A 3T4AC 5JEAG 2EXDA 1PTOD 2R3ZA 3K7AH 1G6ZA 3OSOA 4KHZA 4DR3Q 1CZGA 3N6RA 1S5DD 2YYZA 3U9SA 2K5NA 3M4QA 2JA6H 1VQ8A 3KLRA 2E76C 1EY6A 1K83H 2AUJD 3VYTA 1MBYA 3O13A 2KHIA 2CKZB 3J80E 1C0AA 4GKJQ 5H1SE 4PZ6A 4DKAC 2BH2A 1BO0A 3BYYB 4BBSH 3RUZA 1CT1D 1LT3D 4K6LA 3CC2A 4JI3Q 1V1QA 1CQFA 1L1OB 1J9OA 1QUQA 4A3JH 3PIP3 2F52A 1DZ1A 4RKBA 4CBVA 4AYBB 2AHOB 1NBWA 2M9VA 3FEWX 2KOLA 5BN5A 2JA9A 4DV5Q 5FJ8G 2I5MX 3J81E 1PFSA 5I4DA 1VQOA 1K8GA 5K36G 3FHWA 4GLVB 2Q2UA 3BG3A 2VQEQ 1TWAB 4AH6A 1N33L 1SR3A 1YJNA 2HQLA 3GD7A 1Z6HA 4LF5Q 1Y8PB 3M3YH 2EVBA 2OCEA 2DGYA 1KHIA 4IQZA 3QJYA 2MP1A 4RAUC 4DK6C 1RD9D 4JI5Q 4JI7Q 3ICEA 3GTMB 4LF4L 5CGKA 1E3PA 3DM3A 3WWVA 1YJWA 2VY3A 3U50C 2E2JH 1P8LA 3M7GA 4L5QA 1S5ED 1UNSA 4JCVE 4U673 1I6VC 4DV1L 1WFQA 2CWPA 2B2VC 1VQ9A 3TQYA 1UE6A 2SEBD 1QWYA 2KQ3A 2QDLA 1BR9A 3GV3A 2RCFA 3QOLA 4B3SQ 3GQBA 1HZBA 1B9MA 3ER0A 1NUCA 5IOCA 3J80i 2WP8J 3F2DA 1G2TA 4TKOB 5KEEA 1IBLL 2X69A 4ZKBB 2KBNA 1EWIA 4N8X1 4DR1L 1JE4A 1UEAB 2BDNA 2R93H 2O5IC 2NVTB 4L6TB 1Y8OB 1SLJA 4A3GG 1ICFB 1PYSB 4Y7NB 1Y14B 1XYIA 3K80C 1YZ6A 1ZKOA 4JI2Q 5M3FG 1E0BA 3HOXG 3BDLA 4GNXC 3NTIA 2HHHQ 2CW0C 5GAGC 2UUCL 1NSNS 2WB1E 3TMEA 1JCKB 5HY6A 1VF5C 1LT6D 2X6GA 1LYLA 3CRLC 2B63H 4B3ML 4L8JA 2I5LX 2WKDA 1UEBA 1PFBA 1LO5D 2BA1A 1D5XC 4X3UA 3HOWH 4LMQD 3D4RA 1A63A 2AUKA 3T16A 2NVYH 5C0XH 3M85A 3SK6A 4LFAL 4WORA 4RH6A 1SE3A 3S1RH 2CWAA 2EJGC 3HG9A 2EY1A 3VYRA 3H3VH 4A3GB 4FF1A 5M5YH 4JV5Q 5CMDA 3QG1A 3VDYA 2E2IB 4A3CH 1HFGA 3R3OA 4JI0L 4LF7L 5KGUA 4X3KA 3I90A 3KYHC 4DNIA 3HOXB 1JWMD 4ULLA 1JOOA 3CCEA 4QY7A 1IBML 1FNUA 1E2VA 4A3FH 4XQJA 1HNXQ 3PO2H 1NR4A 2NBFA 3PIOA 2CH4W 3I4OA 1TQOA 3IL8A 2JA6G 1CHPD 1I6HB 4HSPA 2F3WA 1SYBA 2ES2A 5IE8A 1HCZA 4DR6L 4BY1H 1EYAA 2IY5B 4BBSG 1GUWA 4XYOA 4OO1H 2K52A 4H0LC 3RZDB 2EDGA 1HTPA 4KLKA 3VR6A 4PV1C 4A3JG 2EOTA 1LACA 2AWNA 4ZUIA 4YWKA 5I6WA 1EYGA 1PH7A 1TWFH 4DUZL 3UI2A 1C7YA 1X65A 4RGNA 3KF6B 4FNFA 1H9SB 3C1EA 3FDTA 1VDZA 4J1MA 4QUCA 1KAAA 2JA6B 1VQBA 1EZ8A 1K83B 1VQGA 4DAVA 1SMYC 4K2KA 3PO3H 2KCTA 3NWSA 4FYDA 1JB7A 1Y69U 2JYOA 1VQ6A 4BBSB 1SMYD 2BDOA 4A93H 2JK8A 1FD7D 1IBKQ 2UXCL 2KJXA 1PV4A 5A2QL 1HR0Q 4OL7A 5COYA 1WTPA 1PZID 1OXSC 2WFWA 4JOIC 3J7YW 1K0RA 2D2CC 1ILPA 3HP3A 2VS1A 3HZXA 1SYCA 1IYUA 3MHBA 1BUVT 1ILQA 1DGSA 1CA5A 1ASZA 4GKKL 5FO9B 2R6GA 1L0YB 1Q8IA 2JXMB 3J7AV 1WTWA 2JJQA 2RA4A 1NMFA 2M2LA 1KL9A 2F0WA 4POGA 2XTIA 1EQTA 3QB3A 3M3YB 1K8MA 4ZKCB 2IX3A 3TEHB 1EU4A 3HOZH 4R8IA 3VA5A 1JT8A 1DOKA 1WCMB 3TRZA 3SVMA 1FR3A 1VQ7A 1RKNA 2R93G 5G3LF 2IHFA 3TBIB 1SMXA 1HNZQ 2E2HH 1JJCB 1VCIA 4BY7B 2NN6I 3BDOA 5FO7B 3SK5A 4YHHQ 2PYKA 4RFBA 3BJUA 1FNVA 1EYDA 1KAWA 1RDPD 4DXGA 3MEHA 1NNXA 1EY7A 2PQAB 1SRUA 1TT2A 1LTID 3Q22A 1YHAA 1KXLA 4OWWB 4XT3B 2CFMA 2DY8A 1R4PB 2B63G 2EJFC 3AFPA 3K7UC 4KN7C 4GOPB 3HOWG 3ERQA 1BCPB 5C4HA 4XYQA 5C0XG 4GN5A 1CKNB 4R4CA 1T9HA 1GXDC 1GUSA 2F3VA 2RVLA 3S1MB 5D3DA 4RGTA 4RMFA 1QUQB 4IPCA 4RCNA 4JYAQ 3J7A5 1K8OA 5M5XH 4DV7L 4DR2Q 4A3CG 2L4NA 1L1OA 1EY0A 1SYDA 1VQCA 2DN8A 1YIJA 1X32A 1I50B 3TZUA 4A3FG 3V05A 3PO2G 3CMEA 3S17H 1FJGL 2ZJRA 3KOJA 4UP9A 1QOHA 1CFMA 1UE7A 3L0OA 2B63B 1TS4A 3UDFA 1KNEA 3JAME 1NTGA 2NVYB 2ATWA 4BY1G 2K14A 4YY3Q 2N78A 4HCEA 2B8GA 3S1RB 2UXBQ 1PRTC 2MGSA 2PMZB 3MXPA 4OO1G 1JC7A 1HRJA 4JW0A 3KDFA 4Z9CB 1PRTD 5LMNW 3CAMA 5M5YB 3J7ZC 4PMCA 4G57A 1O7YA 4HN7A 4L5RC 2F0QA 3CPFA 5J3BA 2F0EA 1QZHA 3OTOQ 3KF8A 2WAQE 1VQ4A 3VYUA 1CQVA 3ULPA 3NWTA 3URYA 5E4XA 3S16H 1BXTA 1EQVA 2HUGA 4X6AH 4A3EH 2WB1B 1ENFA 2N8NA 2B2TA 2CVRA 5C0XJ 2ZJQA 3TP5A 3PO3G 1STHA 1A62A 4DAMA 4BY1B 2F0DA 3LWEA 3UE0A 1EIGA 2BE5C 3M9BA 2I0QA 4LFCQ 4A93G 1HNWL 1EY5A 5DAUA 5BN3A 5EGTA 1S3OA 2BE5D 2R7ZG 2FJ2A 4HIOA 2B3GA 3ONAB 3I70A 3FVQA 5KNBA 3U58A 1NMGA 2PPBC 1QNKA 1B4OA 4JBJA 4XXEA 1K0SA 2ICIA 5GAEC 1TWFB 1AFPA 3W3AA 5C6AA 4FP5D 2CQOA 2A74C 3I8ZA 4CJ0B 3KLSA 3G48A 3KLSX 2RF4A 2HCIA 2L1BA 5C4XB 4LUZA 3GTKB 5I2YA 2H1EA 1K3RA 1GO3E 3HOZG 1M8AA 1QCBD 3PUZA 1TS2A 2IHEA 4KY7A 4C1NK 3A5ZB 3UDGA 1A3TA 4KKSA 1L0WA 1A6XA 1YNNC 2ZXOA 1GVPA 1MJEA 3RZOH 1YHBA 1YNND 1QG7A 3AQQA 3MXGA 5KNDA 2VUMB 3PF4A 3DWAA 1EFWA 5IGEA 4HEDA 4N8FA 3W1GA 2K28A 1VMPA 1D5MC 2LFNA 2JA7B 4V0BA 5EBCA 4JI4Q 1T5EA 2HD3A 4WFN3 4FO2A 1LABA 1WD0A 4KHPL 2IJ0A 4NDXA 1TR5A 1EU3A 3H91A 4HR7B 3TP6A 1QB5D 3PUVA 1RIPA 1N34L 3BVZA 5IGCA 1ASYA 1E22A 3EJIA 5IGBA 3EIVA 1WYDA 1S5BD 2EYLA 2E2HB 2RHQB 1WTRA 4LAAA 2N55A 1D2BA 2J4XA 4ABNA 2B2YA 3HKZE 1IXRA 2ZJPA 3MVVA 1VQ5A 5LMUQ 1ONLA 1W2BA 1H9MA 4GLXA 4P74A 5D14A 2F0TA 4Y7NH 4C3IB 1RJTA 2TMPA 4ALPA 1C9OA 4KD4A 3MXUA 4UP8A 1XNQL 4PMWA 5CBEE 2ALYB 3BDCA 1FGBD 4OWTB 5EPKA 3W5OA 3T13A 2QEXA 5E7NA 1XX8A 2F0SA 5IGFA 3CQZB 1H9JA 3A56A 1XTCD 2K5HA 3CCJA 1TS5A 3VYSA 2JA8H 4JI6L 3P7JA 1IZ6A 4B3RL 1HZ9A 2WIIB 3NPPA 1WJJA 2B2WC 2EY2A 3DWQA 4X62L 3K58A 1STNA 5DM73 4KK7A 1MKHA 4WRDA 3MC0B 2ZT9C 3EFXD 1AN8A 1NR2A 3D4WA 2NN6H 4JI8Q 4A3EG 1Q86C 1SAPA 1YITA 2UUCQ 4LF6L 3K81C 4F87A 3A5UA 3EN2A 3C3LA 1G291 3OHXC 2F0OA 3JC66 2I5HA 5ISRA 3P20A 3STBC 1NCVA 2F0UA 2DUDA 1U4PA 2GA4B 5DNFA 3STBD 4LFAQ 5ELEA 3NENA 2KEEA 2D9UA 1XMQL 3DUZA 3RZDH 1A2TA 4A3MB 2FFKB 2LS01 1F77A 4K5WA 4BA2I 1CM9A 3S1NB 4XQQA 4F88A 1N32Q 3S16B 3M4OB 5IYCH 4A3EB 4MN3A 4A3BH 3A7LA 4QMGA 3OYYA 4DXFA 3D4DA 3D3RA 5IWAQ 2Z9HA 2ID0A 2PQAA 3M4PA 4LF8L 4EX5A 4DV3L 1EOTA 4JVZA 5CV6A 3B6YA 1IYVA 2Z1CA 3QO2A 2ZXRA 1STEA 2OXPA 4O0AA 4YCUA 4IUUA 4DR4Q 4GOPA 2Y0SB 1PFNA 1B3QA 4DPGA 4ZK9B 2UUAQ 2WACA 1CKNA 2PO4A 3AYHB 1GUGA 5CYUA 5JJLA 5IY0A 4DV0Q 1GHJA 1R9TB 4DAYA 3R93A 5KNCA 3Q24A 4AIMA 1F2YA 4XTCS 4DV2Q 1PHJA 1WD1A 5TSSA 1D5ZC 1LT4D 4H7BA 5J22A 1BBXC 2HQEA 3OIPA
chains in the Genus database with same CATH topology
4QIWB 1SYGA 3K5MA 2X6LA 3ZYYX 3NQTA 1KNAA 2LY7A 1KDBA 4KHVA 5JOBA 4IUTA 5C3EB 3FRPB 1ESRA 2A69C 2Q8IB 1TVXA 3RZOB 5J39A 2KECA 5I9PA 2A69D 4S3SA 2SOBA 3R2IA 4I7ZC 2B2UA 3I91A 3KBXA 2EZVA 1F2MA 2F4IA 1AP0A 3SK8A 5M5WB 1SNOA 3GV6A 1BCPC 3D6WA 2EYFA 1DOLA 1BCPD 2EYHA 5FO8B 4RCOA 1KLUD 1V1OA 1HQMC 4DNRB 2EE1A 3X3NA 2FMMA 1X3QA 3PUWA 2K5QA 2NN6G 1B53A 4IFDJ 3TN2A 1PLFA 2NB0A 1MSHA 5JPNC 1ZEQX 3H3VC 3MAQA 4DAPA 2EJMA 1A2UA 1Q90A 2JA8B 2QKIC 1EEID 3NSWA 1KLGD 2JSOA 1G8ZD 2IX0A 1H9RA 3KBGA 3DWPA 4QCLA 3SEBA 4QF4A 1STAA 3MA2B 5IODA 1STYA 3IAYA 1AZQA 2ENBA 1DYQA 4J6HA 1LLRD 1DM0B 1SNQA 4CKBA 2J0TD 5KYLA 4KD3A 1IKMA 3F2UA 4DGZA 5CORA 4IUQA 4TQUS 2G9DA 4F8MA 4K8JA 4A3BB 3QWNA 1Q3LA 3VR5A 3NBHA 5CC4A 1E2ZA 1H9KA 2AQ1B 3MZ5A 1FNWA 2G9HD 4IFDI 2CQAA 3DMUA 1F2LA 4GZYC 5C3WA 4WJWA 1BQQT 1JOQA 5F2DA 1LTGD 1WVLA 1PFMA 3NK9A 4PNYA 3FPUB 2OT2A 4G7HC 2BCOA 1BOSA 1SNMA 2JA5B 4X3SA 5A2QE 2RBMA 4ZRZA 1DONA 4C1NI 2LKVA 4F7XA 2VXWA 3S15B 5C44B 1EEFD 1PTOF 4M1UB 3K5OA 3H09A 4EQPA 3ITPA 1PYWD 2E2DC 1PZJD 2L5TA 4A3DB 2XVSA 2PZWA 1L0XB 2LMCB 4ZQ3A 4ZUJA 3EA6A 3A7AB 5E1FA 4FXDA 3NE5B 5FLXL 4B9XA 2F1MA 2MPMA 1HPCA 4IURA 4KJNA 2F0VA 3A54A 1V8QA 5LHY1 2RSNA 4BBRB 1JWSD 1IW7C 3GTOB 2IX1A 1IW7D 1ICWA 2MUYA 1KABA 3BYTB 4ZYSA 1EYCA 3S9WA 1AEXA 1QILA 5I6YA 4KV6A 2RQXA 1QJOA 2YU9B 1KDAA 4NMZA 3RLFA 1PDQA 2I46A 1BCPF 2R92B 1C8CA 1DCZA 3M7NA 2WV6D 1U4MA 2ZXPA 4KN4C 1A3VA 1HTLD 2PCFB 3K6OA 5I9OA 1HUNA 3X3MA 4K6DA 2L11A 3FKIB 1Y1VB 2EYJA 4BS9A 5K5PA 3HOVB 3HGBA 1YNJC 1W6KA 4XDXA 3GTPB 1KDCA 1X3PA 1YNJD 1TU2B 2C9OA 2K32A 3MXNA 1CA6A 3R8BA 2KCNA 1SE2A 5EPLA 2L9HA 4DN4M 1HUMA 1I3QB 4DA2A 5E3FA 1WTXA 2N88A 2Z4IA 1UUPA 1ET6A 1SSOA 2VNUD 4FF3A 2D62A 4O42A 3TP8A 2BA0A 4RKLA 3I4NB 5JVH3 5T1GA 4CHTB 4PMBA 4LJZC 1CK1A 1LTRD 4Q5VA 2K6AA 1TY2A 2F0PA 1I4XA 4MIUA 4LK1C 4H44C 3Q6SA 2A6EC 1MSGA 1FYCA 5IT9L 1G2SA 5CV7A 1S4ZA 4XIGS 3SR1A 1B3AA 3T51B 1BNZA 2A6ED 5E4WC 3J7AF 2KA7A 2ICEC 1MD2D 2NUCA 1PXUA 2K03A 2K5WA 3DHQA 4N9PA 5JEAH 3I3CA 3GTJB 1GOZA 1E2WA 3VR2A 3NP8A 2B2TC 2RSOA 2NWGA 3I72A 4DF7A 3PUXA 5C3XA 3WOFA 2PW5A 3NTKA 3T53B 4C3IG 4RA8A 5DM63 3H0GB 4IFDH 2TSSA 2EXZA 4KKTA 3S2HB 4ILWA 1V1PA 5C5MA 2QF7A 2HCCA 3N52A 3CRKC 1SNCA 4KI0A 1SNDA 4RGMA 1RF2D 3NHHA 4C56C 1SBBB 4V190 2AQ3B 2Q8RE 1WTOA 1O7LA 3RMHA 1PZKD 1EWCA 3SHLA 3H94A 1STGA 4ODGA 4OIKA 4RGOS 4KKUA 1SJED 4J8QA 3S2DB 3TP7A 1JICA 3OWEB 4ZAIA 5EKKA 4UDUC 1OXXK 1ZYRC 1W6JA 3T56B 1ZYRD 1WTQA 5JJZA 2FHTA 2O2LD 5C4ZA 1TIID 2FMCA 2B2YC 3BS1A 2A68C 3CU7A 5LL6X 2NYZD 2OEOA 2HDMA 2A68D 3EQLC 4EQOA 4JBWA 3K0YA 3GTGB 2KHSA 4HMJA 5NUCA 1F9PA 3S14B 4OIJA 4ME5A 1RTNA 1ENCA 2XIWA 4C2MB 2K7VA 2EPBA 2B39A 4A3IB 3FPPA 2SNSA 2DY7A 4K14A 2CHBD 1B9NA 3IFTA 2F0NA 4QB4A 1OXUA 3VA7A 1I4QA 4EQNA 3Q0AA 2Z4HA 4EVOA 1BF4A 1D1IA 1XWEA 1VMCA 3OWFA 1PRTF 4RHSA 3VR4A 4FF4A 2XNAC 2B2VA 4ID6A 2H4OA 1HA5A 3J80L 1DJRD 1MGSA 3IFDA 2QDBA 1GUTA 2I07B 1TY0A 1PTOH 2WAQB 5ELCA 2SNMA 4XT1B 5D3IB 3WDNA 4ZLTF 4DU9A 1EFID 1O78A 3P1HA 3SK4A 2OF1A 1ESFA 3SDZA 1IHZA 1SJHD 2QCPX 2B8FA 5G3LD 1JORA 3HOUB 3J81L 2KCCA 3L7ZC 4C3JG 1OO9B 2K01A 4IFDG 4FXGC 1HXYD 5M3MB 3K57A 1TKWB 3PMFA 4HSVA 2F0GA 2Z8LA 4DNTB 2XWJB 1EIHA 5HGTA 2NTTA 4IUPA 2A5HA 2AQ2B 1IL8A 1HHVA 3OIQA 3SE0A 1I4RA 4RWSC 1RCVD 3D31A 3KK7A 4C3JB 1G91A 1SDFA 2PW7A 1B50A 5D65A 2QILA 2JEAI 1SE4A 3RD4A 5JEAJ 1ENAA 3C1FA 1SEBD 4O1NA 1D6EC 3G6JB 4HTHA 2PNRC 4E6IA 1OXVA 5BN4A 2F0LA 3PIO3 3IKJA 4K2LA 4EGVA 4IALA 1V43A 1O80A 5FKAC 1GHKA 1LV9A 2B2UC 1HFNA 1JB3A 4FF2A 1II3A 1LTBD 2A6HC 1HQRD 3L9AX 3BVMA 4HCSA 2A6HD 3HKZB 2PZUA 5EKLA 1C48A 2F0KA 2CW0D 1O7ZA 3TDQA 4YIJA 2EYMA 2L55A 3Q23A 3LX0A 3L3OC 4TSSA 4UAIA 1F2ZA 2JEBI 5IIFA 5JPMC 1TS3A 3H6MA 2VB3X 1V1PB 2DNCA 2IWHA 1S5FD 4B08A 5M3FB 2O4XA 1SFOB 2K1BA 3A55A 5CV4A 5FK9C 3K5LA 3ND9A 1I4PA 3DM1A 4FXKC 2A73B 5I2XA 3HS0C 5C4JB 3VR3A 4G7OC 4X3TA 3OMCA 1Z7TA 3D6CA 4PQXA 1OXTA 1MI2A 1B2TA 3NXWA 3MTSA 5EBDA 3HOYB 3E5SA 1PMRA 2V4DA 3I4MB 3K7AB 3R2TA 3I73A 2KEDA 2BOSA 2KUMA 2DNEA 1PTOB 2K5DA 1SNPA 2F03A 5KIXA 1GUOA 2WINB 1D1KA 1Q12A 1F9RA 1CI3M 4IZ8A 2M00A 2RDGA 4A3JB 5CBAE 1Y1WB 1ZXTA 1IKLA 4OGQC 3D8GA 3OPOA 1AZPA 1EY8A 2R61A 1U4LA 2VB2X 3TZDA 1M4VA 1CZWA 3OMGA 1DXMA 2NTSA 2PZTA 2IPKD 3U9OA 1VF7A 3LNNA 1I4HA 2K33A 3HEJA 1Z47A 2E2JB 2HDLA 2KVMA 2MHVA 4M8AA 3DXJC 1STBA 3M4YA 2F0MA 1TWCB 3GP7A 4A3KB 2F0IA 3I4LA 5ELFA 3AMUA 5HURA 5FLXE 5EPJA 2AWOA 2XRQD 4G4KA 4CKCA 1J8IA 1LTAD 1CTMA 4HMIA 2K05A 4K5XA 2XN9C 4OHJA 2R93B 3GO5A 4NKLA 1B1ZA 2SDFA 2Q8TA 2XSCA 1SXTA 5LL6S 2IW3A 3BZDB 2XWBB 4TRDA 2MJ8A 2E74C 1R4QB 1A3UA 3KUPA 1WTVA 4FVMA 5CV9A 3PV0A 4KTAA 2EYPA 3E0JA 1JQYD 4C3HG 3JAML 3PUYA 1Q1BA 4DK1A 2C5CA 1RODA 2RKSA 3OOCA 4HAEA 3HOWB 4KJOA 3GTQB 5J1ZA 3QIAA 5CV8A 3EVQA 3LWUA 5JAVA 4IUVA 4L63B 3EROA 4R9WA 1JR0D 3NBIA 3K5NA 1RTOA 2FINB 4C3HB 4A3FB 3PO2B 2L12A 3V2TA 3CHBD 3E6ZX 4MHEA 1LT5D 1LTSD 4NP5A 5T1IA 3QOJA 1C4QA 1GJXA 1EZ6A 2QEJC 5JVG3 4KMUC 1JOKA 1Y8NB 3A8JE 3V96A 4K8IA 4XQNA 1SYEA 3NTHA 2IT1A 1GUNA 4G7ZC 1BDOA 1B44D 1XXGA 3HRZC 4K5VA 4RHRA 1TWHB 4N9TA 5IGGA 3MFYA 4BWGB 1QNUA 5A35A 5DEHA 1EY9A 1DD2A 2NZ1D 1UAPA 1F9QA 3MFGA 5IT9E 1QE6A 2D5DA 4I65A 3PO3B 1AW7A 3NUCA 4CGYB 4A93B 1SYFA 4KY5A 3P75A 2R7ZB 1RHPA 3G7LA 3AB9A 2K04A 3MWYW 1I4GA 4CJ2C 2XRSD 2EY5A 1T5XD 2F0FA 5ELDA 3GTLB 4Q0FA 5EJWA 1ET9A 3NQIA 2B2WA 5K36H 2WKCA 3HOZB 5C0XI 3A8IE 5ELBA 4DFAA 4H13C 3C46A 2F0JA 1U9RA 5CV5A 5IGDA 3C2PA 3BVGA 2O5JC 1JWUD 1DOMA 5KYIA 5CR3A 4BA1I 1KTKA 5EKIA 1ML0D 5KRUA 1A15A 2JP1A 5EQ0A 3ND8A 4JK1C 5C5LA 4CKEA 2RDHA 2EY6A 1LTTD 3DEPA 3K59A 1H9SA 1CHQD 4P2CB 3DEOA 4DK0A 4OO1I 2IL8A 5M9OA 1U4RA 3SXHA 3W2DA 4NW2A 2NVXB 4KY6A 1HA6A 2E75C 2EYOA 5M5XB 1EL0A 4QUFA 2NVQB 3S17B 3OW7A 4CJ1B 2JE6I 4B9WA 2RDFA 5AFWA 3FMCA 3A8KE 2J7ZA 1NAPA 4U68A 3AU7A 1TWGB 1EWHA 3CKIB 2L0CA 1S5CD 1PRTB 3TSSA 4IUNA 1F9SA 4R8NA 2PQEA 3S1QB 3WOEA 5FOBB 4IN3A 2F0HA 1PTOC 1Q1EA 1EY4A 3T4AC 5JEAG 1PTOD 2R3ZA 1G6ZA 3OSOA 4KHZA 1CZGA 3N6RA 1S5DD 2YYZA 3U9SA 3KLRA 2E76C 1EY6A 2AUJD 3VYTA 1MBYA 3O13A 3J80E 1BO0A 3BYYB 3RUZA 1CT1D 1LT3D 4K6LA 1CQFA 1J9OA 3PIP3 1DZ1A 4RKBA 4CBVA 4AYBB 2M9VA 3FEWX 5BN5A 2KOLA 3J81E 5I4DA 5K36G 3BG3A 1TWAB 3GD7A 1Z6HA 1Y8PB 2EVBA 4IQZA 3QJYA 2MP1A 4RAUC 1RD9D 3GTMB 5CGKA 3M7GA 1S5ED 1UNSA 4U673 1I6VC 2B2VC 2SEBD 1QWYA 2KQ3A 1BR9A 3GV3A 3QOLA 3GQBA 1B9MA 1NUCA 5IOCA 2WP8J 1G2TA 4TKOB 5KEEA 2X69A 4ZKBB 1JE4A 1UEAB 2BDNA 2O5IC 2NVTB 4L6TB 1Y8OB 4Y7NB 1XYIA 1ZKOA 1E0BA 3BDLA 3NTIA 2CW0C 1NSNS 3TMEA 1JCKB 1VF5C 1LT6D 2X6GA 3CRLC 4L8JA 2WKDA 1PFBA 1LO5D 2BA1A 1D5XC 4X3UA 4LMQD 3D4RA 2AUKA 3T16A 5C0XH 3M85A 3SK6A 4WORA 4RH6A 1SE3A 2EJGC 3HG9A 2EY1A 3VYRA 4A3GB 4FF1A 5CMDA 3QG1A 2E2IB 1HFGA 3R3OA 5KGUA 4X3KA 3I90A 3HOXB 1JWMD 4ULLA 1JOOA 1FNUA 1E2VA 4XQJA 1NR4A 2NBFA 1TQOA 3IL8A 1CHPD 1I6HB 4HSPA 2F3WA 1SYBA 1HCZA 1EYAA 1GUWA 4XYOA 4OO1H 4H0LC 3RZDB 2EDGA 1HTPA 3VR6A 4PV1C 2EOTA 1LACA 2AWNA 4ZUIA 5I6WA 3UI2A 4RGNA 4FNFA 1H9SB 3C1EA 3FDTA 1VDZA 4J1MA 4QUCA 1KAAA 2JA6B 1EZ8A 1K83B 4DAVA 1SMYC 4K2KA 3NWSA 4FYDA 1Y69U 2JYOA 4BBSB 1SMYD 2BDOA 1FD7D 2KJXA 5A2QL 4OL7A 5COYA 1WTPA 1PZID 1OXSC 3J7YW 2D2CC 1ILPA 3HP3A 3HZXA 1SYCA 1IYUA 3MHBA 1BUVT 1ILQA 1CA5A 5FO9B 2R6GA 1L0YB 1Q8IA 2JXMB 3J7AV 1WTWA 2RA4A 2M2LA 2F0WA 1EQTA 3QB3A 3M3YB 1K8MA 4ZKCB 2IX3A 1EU4A 4R8IA 3VA5A 1DOKA 1WCMB 3SVMA 1FR3A 1RKNA 5G3LF 3TBIB 1VCIA 4BY7B 2NN6I 3BDOA 5FO7B 3SK5A 2PYKA 4RFBA 1FNVA 1EYDA 1RDPD 4DXGA 3MEHA 1EY7A 1TT2A 1LTID 3Q22A 4XT3B 2DY8A 1R4PB 2EJFC 4KN7C 3ERQA 1BCPB 5C4HA 4XYQA 5C0XG 1GXDC 1GUSA 2F3VA 2RVLA 3S1MB 5D3DA 4RGTA 4RCNA 1K8OA 2L4NA 1EY0A 1SYDA 2DN8A 1X32A 1I50B 3TZUA 3V05A 1QOHA 1CFMA 2B63B 1TS4A 1KNEA 3JAME 2NVYB 4HCEA 2B8GA 3S1RB 1PRTC 2MGSA 2PMZB 3MXPA 4OO1G 1JC7A 1HRJA 4Z9CB 1PRTD 5M5YB 4PMCA 4G57A 1O7YA 4HN7A 2F0QA 2F0EA 3KF8A 3VYUA 1CQVA 3NWTA 3URYA 5E4XA 1BXTA 1EQVA 2HUGA 2WB1B 1ENFA 2B2TA 2CVRA 5C0XJ 3TP5A 1STHA 4BY1B 2F0DA 3LWEA 1EIGA 2BE5C 1EY5A 5DAUA 5BN3A 5EGTA 2BE5D 2FJ2A 3ONAB 3I70A 3FVQA 5KNBA 2PPBC 1QNKA 1B4OA 4XXEA 2ICIA 1TWFB 1AFPA 3W3AA 5C6AA 4FP5D 2A74C 3I8ZA 4CJ0B 3KLSA 3KLSX 2HCIA 2L1BA 5C4XB 3GTKB 5I2YA 2H1EA 1M8AA 1QCBD 3PUZA 1TS2A 4KY7A 4C1NK 1A3TA 4KKSA 1A6XA 1YNNC 2ZXOA 1YNND 1QG7A 3MXGA 5KNDA 2VUMB 3DWAA 5IGEA 4HEDA 2K28A 1VMPA 1D5MC 2LFNA 2JA7B 4V0BA 5EBCA 1T5EA 4WFN3 4FO2A 1LABA 1WD0A 2IJ0A 4NDXA 1TR5A 1EU3A 3H91A 4HR7B 3TP6A 1QB5D 3PUVA 3BVZA 5IGCA 3EJIA 5IGBA 1S5BD 2EYLA 2E2HB 1WTRA 4LAAA 2N55A 1D2BA 2J4XA 4ABNA 2B2YA 3MVVA 1ONLA 1H9MA 5D14A 2F0TA 4C3IB 1RJTA 2TMPA 4KD4A 3MXUA 4PMWA 5CBEE 3BDCA 1FGBD 5EPKA 3T13A 1XX8A 2F0SA 5IGFA 3CQZB 1H9JA 3A56A 1XTCD 1TS5A 3VYSA 3P7JA 2WIIB 3NPPA 2B2WC 3DWQA 2EY2A 3K58A 1STNA 5DM73 4KK7A 4WRDA 3MC0B 2ZT9C 3EFXD 1AN8A 1NR2A 3D4WA 2NN6H 1SAPA 4F87A 3C3LA 1G291 3OHXC 2F0OA 5ISRA 3P20A 1NCVA 2F0UA 1U4PA 2GA4B 5DNFA 5ELEA 2KEEA 2D9UA 3DUZA 1A2TA 4A3MB 2FFKB 2LS01 1F77A 4K5WA 4BA2I 1CM9A 3S1NB 4XQQA 4F88A 3S16B 3M4OB 4A3EB 4MN3A 3A7LA 4QMGA 4DXFA 3D4DA 3D3RA 2ID0A 1EOTA 5CV6A 1IYVA 2Z1CA 3QO2A 2ZXRA 1STEA 2OXPA 4IUUA 2Y0SB 1PFNA 4ZK9B 2WACA 2PO4A 5CYUA 1GUGA 1GHJA 1R9TB 4DAYA 3R93A 5KNCA 3Q24A 1F2YA 4XTCS 1WD1A 5TSSA 1D5ZC 1LT4D 4H7BA 5J22A 1BBXC 2HQEA 3OIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PTO B;  1PZJ D;  3R8B A;  3DWP A;  3SEB A;  1XTC D;  1PRT F;  2SEB D;  1I4G A;  1JQY D;  4RHS A;  1SE2 A;  1TS5 A;  1RF2 D;  2XNA C;  4RGM A;  5FKA C;  4C56 C;  1BCP B;  1HA5 A;  3KLS X;  1DYQ A;  1L0X B;  1DJR D;  1SBB B;  2XRS D;  3DWQ A;  2AQ3 B;  1T5X D;  1LTB D;  1LLR D;  2RDG A;  1S5C D;  1UUP A;  5D3D A;  4RGT A;  1ET6 A;  5ELD A;  1HQR D;  1TY0 A;  1PTO H;  1ET9 A;  1PRT B;  3BVM A;  3MC0 B;  3EA6 A;  3EFX D;  1AN8 A;  3R2I A;  4RGN A;  5ELC A;  3TSS A;  1TS2 A;  5D3I B;  1EFI D;  1PZK D;  1EWC A;  4L63 B;  1JR0 D;  1ESF A;  1SJH D;  5ELB A;  2R61 A;  4RGO S;  1PTO C;  1CK1 A;  1M4V A;  1SJE D;  3V05 A;  1HXY D;  4L6T B;  1LTR D;  3BVG A;  1FD7 D;  1PTO D;  3DWA A;  2NTS A;  3OWE B;  2IPK D;  1TY2 A;  1JWS D;  4UDU C;  1PZI D;  1TS4 A;  1BCP C;  4TSS A;  5ELE A;  1I4H A;  1I4X A;  1S5D D;  3CHB D;  1JWU D;  1D5M C;  1LT5 D;  1LTS D;  2Z8L A;  1BCP D;  1KTK A;  3O13 A;  2AQ1 B;  1TS3 A;  2NTT A;  1FNW A;  2G9H D;  3BYT B;  4RCO A;  1KLU D;  4ZYS A;  1PRT C;  1JCK B;  1F77 A;  1V1P B;  2QEJ C;  3BYY B;  2O2L D;  2AQ2 B;  1CT1 D;  4Z9C B;  1L0Y B;  1S5F D;  1V1O A;  1QIL A;  1LT6 D;  2IJ0 A;  1PRT D;  1LT3 D;  4K6L A;  1MD2 D;  1EU3 A;  2RDH A;  1LO5 D;  1LTG D;  1LTT D;  1D5X C;  4DXF A;  3GP7 A;  1B44 D;  5ELF A;  1I4R A;  1CHQ D;  1GOZ A;  1RCV D;  3BVZ A;  5FK9 C;  1XXG A;  4RH6 A;  1SE3 A;  4RHR A;  1S5B D;  1I4P A;  5I4D A;  1CQV A;  2J4X A;  1BCP F;  1EU4 A;  2QIL A;  3URY A;  1BXT A;  4BWG B;  1STE A;  2XRQ D;  3W2D A;  1SE4 A;  2WV6 D;  1ENF A;  1SEB D;  4O1N A;  1HTL D;  1LTA D;  1D6E C;  1JWM D;  3MFG A;  1FNU A;  1RD9 D;  1EEF D;  2XN9 C;  4OHJ A;  1PTO F;  2TSS A;  1B1Z A;  1AW7 A;  1EEI D;  1SXT A;  4RFB A;  1FNV A;  1V1P A;  2CHB D;  1CHP D;  5TSS A;  1RDP D;  1S5E D;  1UNS A;  3BZD B;  1FGB D;  1D5Z C;  1LT4 D;  4DXG A;  1KLG D;  3R2T A;  1I4Q A;  1G8Z D;  1PYW D;  2ICI A;  1LTI D; 
#chains in the Genus database with same CATH topology
 4QIW B;  1SYG A;  3S15 H;  2G5D A;  3K5M A;  2X6L A;  3ZYY X;  2RHS B;  3NQT A;  1KNA A;  1EOV A;  4PZ8 A;  1VQH A;  2LY7 A;  1KDB A;  4KHV A;  5JOB A;  4IUT A;  5C3E B;  3KDF B;  3FRP B;  1ESR A;  1UE1 A;  2A69 C;  2Q8I B;  4DR7 Q;  1TVX A;  4QQB X;  3RZO B;  5J39 A;  1WCM H;  2KEC A;  5I9P A;  4CDE C;  2A69 D;  4S3S A;  1CUK A;  2SOB A;  3R2I A;  4I7Z C;  5EAY A;  2B2U A;  3TS0 A;  1N36 L;  5IYD H;  3I91 A;  2K5V A;  3KBX A;  3KF8 B;  4MNO A;  2EZV A;  4IOA A;  1F2M A;  2F4I A;  1X9N A;  5IP9 H;  4BY7 H;  1AP0 A;  3G4S A;  3SK8 A;  5M5W B;  3PF5 A;  4OX9 L;  1SNO A;  3GV6 A;  1BCP C;  3D6W A;  4DUY L;  2EYF A;  1VQJ A;  4AQY L;  1DOL A;  1BCP D;  2EYH A;  5FO8 B;  4RCO A;  1KLU D;  1V1O A;  3PIP A;  2JA8 G;  4BBR H;  1XNR L;  1K9M C;  4IJL A;  1HQM C;  3S1M H;  1IYJ B;  3A0J A;  4DNR B;  2QA4 A;  2EE1 A;  3X3N A;  2FMM A;  2JN4 A;  4DV4 Q;  1X3Q A;  4X65 L;  3PUW A;  4B3T Q;  3W1B A;  1XMO L;  2K5Q A;  2NN6 G;  2UXD L;  1B53 A;  3CCU A;  1I50 H;  4IFD J;  3TN2 A;  2R7D A;  1PLF A;  2NB0 A;  3UDI A;  1MSH A;  4NXN Q;  5JPN C;  1ZEQ X;  2UUB Q;  1XPR A;  4CDF C;  3H3V C;  3MAQ A;  2R92 H;  3HFZ B;  4DAP A;  4DR5 Q;  2EJM A;  1A2U A;  1Q90 A;  2JA8 B;  2QKI C;  1EEI D;  3CCL A;  3NSW A;  1KLG D;  2JSO A;  1G8Z D;  2IX0 A;  2HT1 A;  1H9R A;  3KBG A;  3DWP A;  4QCL A;  3SEB A;  1HZC A;  3FKI H;  5IYC G;  3I55 A;  4QF4 A;  1STA A;  3MA2 B;  5IOD A;  1STY A;  3T1Y Q;  4PZ7 A;  1AZQ A;  3IAY A;  2ENB A;  2N49 A;  1DYQ A;  4YWM A;  4J6H A;  5ELO A;  4LUO A;  1LLR D;  1A0I A;  1DM0 B;  4LF9 Q;  4JPB W;  1SNQ A;  4UHV A;  4CKB A;  1Z9F A;  2J0T D;  5KYL A;  4KD3 A;  4QGU A;  1IKM A;  3F2U A;  4DGZ A;  5COR A;  4J15 A;  4IUQ A;  4TQU S;  2G9D A;  4F8M A;  4K8J A;  4P75 A;  3S24 A;  4A3B B;  1XTD A;  3QWN A;  1Q3L A;  3VR5 A;  3NBH A;  5CC4 A;  4GKJ L;  1E2Z A;  1H9K A;  2AQ1 B;  2GVB A;  3MZ5 A;  1FNW A;  2G9H D;  2Q2H A;  4IFD I;  2CQA A;  3DMU A;  4X66 L;  1F2L A;  4GZY C;  5C3W A;  4WJW A;  4JI3 L;  1BQQ T;  1JOQ A;  4QL5 A;  5F2D A;  5C4X H;  3GTK H;  1LTG D;  1WVL A;  3CPW A;  1PFM A;  5JJK A;  3NK9 A;  1VQK A;  4DV5 L;  2CH4 A;  3G71 A;  1HNW Q;  4A3L H;  4PNY A;  3FPU B;  2OT2 A;  4G7H C;  1LTL A;  1QVF A;  1WCM G;  2BCO A;  1BOS A;  4OON A;  1SNM A;  5IYD G;  3CW2 C;  1S72 A;  1CSP A;  2JA5 B;  1B7Y B;  4LF5 L;  4X3S A;  5A2Q E;  2DJF C;  2RBM A;  4JBK A;  4ZRZ A;  1BBW A;  1DON A;  4C1N I;  4Y52 H;  2VUM H;  5IP9 G;  4BY7 G;  3GTJ H;  2LKV A;  2FXQ A;  4F7X A;  2VXW A;  4JI5 L;  4JI7 L;  3S15 B;  1X3G A;  1WTH A;  5JJI A;  5C44 B;  1EEF D;  1PH1 A;  1PTO F;  4M1U B;  2JA7 H;  3K5O A;  3H09 A;  4JI1 Q;  1JJ2 A;  4EQP A;  1Q82 C;  3ITP A;  1PYW D;  2Z0S A;  3H0G H;  2VQF Q;  4IPD A;  2E2D C;  5LMN Q;  1PZJ D;  1PH5 A;  2L5T A;  1QVC A;  5IP7 H;  4BBR G;  2YV5 A;  3SGI A;  4A3D B;  4B3S L;  3S2H H;  4P71 A;  2XVS A;  2K75 A;  1N8R C;  2PZW A;  1L0X B;  4P72 A;  2LMC B;  4ZQ3 A;  1QZG A;  1SE8 A;  4ZUJ A;  1MIU A;  2QGQ A;  4TVA B;  3EA6 A;  4IOC A;  3A7A B;  1KQS A;  5E1F A;  4FXD A;  1I94 Q;  1BVS A;  3NE5 B;  4WJ4 A;  5FLX L;  4OEM B;  4C3I H;  4B9X A;  2F1M A;  2MPM A;  1HPC A;  4IUR A;  2OWO A;  4KJN A;  2F0V A;  3A54 A;  4UP7 A;  1V8Q A;  2R92 G;  5LHY 1;  1Q8K A;  2RSN A;  5IT9 c;  4BBR B;  1N34 Q;  1JWS D;  1IW7 C;  3PSI A;  3GTO B;  4JI2 L;  1YNX A;  2IX1 A;  4DAY B;  1IW7 D;  2HHH L;  3CQZ H;  2MO0 A;  1ICW A;  3I2Z A;  2MUY A;  1HJP A;  2AKW B;  1EIF A;  1KAB A;  3BYT B;  1AE3 A;  4ZYS A;  2ZTD A;  1EYC A;  1A8V A;  3S9W A;  3FKI G;  1AEX A;  1KIX A;  3K8A A;  3S2D H;  1QIL A;  3PGZ A;  5I6Y A;  4FDB A;  4KV6 A;  2RQX A;  1QJO A;  2YU9 B;  1KDA A;  4NMZ A;  1EIY B;  3RLF A;  1E1O A;  2P5Z X;  2R7F A;  3AEV A;  4MZ9 A;  1PDQ A;  2WB1 G;  1TXY A;  2I46 A;  1BCP F;  4JV5 L;  2R92 B;  1C8C A;  1DCZ A;  3M7N A;  2WV6 D;  1U4M A;  2ZXP A;  2UU9 Q;  4KN4 C;  1A3V A;  1HTL D;  4K0K Q;  2PCF B;  3K6O A;  5I9O A;  1HUN A;  3X3M A;  4K6D A;  4LFB L;  2L11 A;  3FKI B;  1Y1V B;  2EYJ A;  4BS9 A;  5K5P A;  3TRE A;  3HOV B;  3HGB A;  1YNJ C;  1W6K A;  4NXM Q;  4A3M H;  3T1H Q;  4XDX A;  3GTP B;  1KDC A;  3S1N H;  1X3P A;  1YNJ D;  3M4O H;  1TU2 B;  3E9H A;  2C9O A;  2K32 A;  4HIM A;  3MXN A;  1CA6 A;  3R8B A;  1J5E Q;  2KCN A;  5C4X G;  1SE2 A;  2LXK A;  4X64 Q;  5EPL A;  1X56 A;  2L9H A;  4DN4 M;  1X3F A;  1HUM A;  4AYB E;  4A3L G;  1I3Q B;  4DA2 A;  1KRS A;  5E3F A;  1WTX A;  2N88 A;  1L1O C;  2Z4I A;  1UUP A;  5BR8 Q;  1ET6 A;  1SSO A;  1X6O A;  2VNU D;  1VQA A;  4FF3 A;  2D62 A;  4O42 A;  3TP8 A;  1YJ9 A;  2BA0 A;  4RKL A;  3I4N B;  1FVI A;  1E7Z A;  5JVH 3;  5T1G A;  2VUM G;  1R9T H;  4CHT B;  4PMB A;  1VQD A;  1VQF A;  1M1K C;  4LJZ C;  2E8G A;  1CK1 A;  1IBK L;  1LTR D;  1HR0 L;  3KLW A;  3K0X A;  4Q5V A;  2JA7 G;  2K6A A;  1TY2 A;  2F0P A;  3Q8D A;  1I4X A;  4MIU A;  4LK1 C;  3IRB A;  4H44 C;  3Q6S A;  2A6E C;  4CDD C;  1MSG A;  1FYC A;  1G2S A;  3H0G G;  1S4Z A;  5CV7 A;  4XIG S;  3SR1 A;  5IT9 L;  1B3A A;  3T51 B;  1BNZ A;  2A6E D;  5E4W C;  3J7A F;  4DK3 C;  2KA7 A;  5IP7 G;  1FGU A;  1PH8 A;  2ICE C;  5C3E H;  1MD2 D;  2NUC A;  1PXU A;  2K03 A;  2K5W A;  4GLA C;  3DHQ A;  4N9P A;  5JEA H;  2HIV A;  3I3C A;  3GTJ B;  1GOZ A;  1E2W A;  3VR2 A;  3NP8 A;  4JC0 A;  2B2T C;  2ZM6 L;  2RSO A;  2NWG A;  3I72 A;  4DF7 A;  3NEL A;  3PUX A;  3CMA A;  5C3X A;  3WOF A;  2PW5 A;  2PI2 E;  3NTK A;  3T53 B;  4RA8 A;  4PG3 A;  4C3I G;  1N33 Q;  5M5W H;  5DM6 3;  3H0G B;  1SRO A;  4C3J H;  1LM0 A;  4IFD H;  3OW2 A;  2TSS A;  2EXZ A;  1VQL A;  1KC8 C;  4KKT A;  4LF4 Q;  5ELN A;  1AH9 A;  1BKB A;  3HKS A;  2L15 A;  4ILW A;  1V1P A;  1VS0 A;  3S2H B;  2Z6K A;  5C5M A;  3F2C A;  3A74 A;  2QF7 A;  4DV1 Q;  2HCC A;  3N52 A;  4LW1 A;  3CRK C;  1SNC A;  4DV6 L;  4KI0 A;  3NBH B;  1SND A;  4HJA A;  4RGM A;  1RF2 D;  3NHH A;  4C56 C;  1SBB B;  2H5X A;  4V19 0;  2AQ3 B;  1M90 C;  4JYA L;  2Q8R E;  1WTO A;  1O7L A;  3J81 c;  4DUY Q;  4DR2 L;  1L2F A;  1MJC A;  3RMH A;  1PZK D;  1EWC A;  3SHL A;  1D7Q A;  3H94 A;  1IBL Q;  1STG A;  4ODG A;  4OIK A;  4RGO S;  2MFI A;  4KKU A;  4DR1 Q;  4R1J A;  1SJE D;  4J8Q A;  4A76 A;  4GS3 A;  1Q81 C;  3S2D B;  3TP7 A;  4LUV A;  1EUJ A;  1JIC A;  3OWE B;  2F4V L;  4ZAI A;  5EKK A;  4UDU C;  1OXX K;  4A3M G;  1ZYR C;  2QW7 A;  4YY3 L;  1XMO Q;  1W6J A;  3T56 B;  1ZYR D;  1WTQ A;  5JJZ A;  3H15 A;  1VQN A;  1WOC A;  4L5S A;  2FHT A;  2O2L D;  5C4Z A;  1TII D;  2FMC A;  2RCN A;  1NE3 A;  4B3M Q;  2B2Y C;  4HJ7 A;  3BS1 A;  3OTO L;  2K4K A;  2A68 C;  3CU7 A;  1UE5 A;  5LL6 X;  3F8T A;  4IO9 A;  2MO1 A;  2NYZ D;  2OEO A;  2Y0S G;  2HDM A;  2A68 D;  3EQL C;  4EQO A;  4JBW A;  3QR8 A;  1SFO H;  1EQR A;  3K0Y A;  2E5L L;  3GTG B;  2KHS A;  4HMJ A;  5NUC A;  1LUZ A;  1S40 A;  1F9P A;  3S14 B;  4OIJ A;  4BXX H;  4ME5 A;  1RTN A;  4JI0 Q;  1RL2 A;  4LF7 Q;  1ENC A;  2XIW A;  2WAQ G;  2KHJ A;  4C2M B;  2K7V A;  1IBM Q;  5C4J H;  2EPB A;  2B39 A;  4A3I B;  3FPP A;  2SNS A;  2DY7 A;  2EQS A;  4K14 A;  2CHB D;  4LNQ A;  1B9N A;  3IFT A;  2F0N A;  4QB4 A;  1OXU A;  3VA7 A;  1I4Q A;  4EQN A;  1MHW C;  3Q0A A;  1PH9 A;  4DR6 Q;  1Q46 A;  2Z4H A;  4EVO A;  1BF4 A;  1D1I A;  1XWE A;  5C3E G;  1VMC A;  3OWF A;  1PRT F;  4RHS A;  3VR4 A;  4FF4 A;  3HOY H;  2XNA C;  2B2V A;  4ID6 A;  2H4O A;  1HA5 A;  3I4M H;  3RLN A;  3RN2 A;  3J80 L;  1DJR D;  2GN5 A;  1MGS A;  3IFD A;  2QDB A;  2JA5 H;  1GUT A;  1X55 A;  2I07 B;  4UY8 C;  1TY0 A;  1PTO H;  2WAQ B;  3F1Z A;  5ELC A;  2SNM A;  4XT1 B;  5D3I B;  3WDN A;  4DUZ Q;  4ZLT F;  4DU9 A;  1EFI D;  1NY4 A;  1PVO A;  1O78 A;  3P1H A;  1U5K A;  3SK4 A;  2OF1 A;  4GN4 B;  4X66 Q;  1ESF A;  3SDZ A;  1IHZ A;  1SJH D;  2QCP X;  2B8F A;  2ZTC A;  5G3L D;  5C44 H;  3GDE A;  3J81 L;  3HOU B;  2KCC A;  1GKH A;  3L7Z C;  4C3J G;  1OO9 B;  2LXJ A;  2K01 A;  4IFD G;  2YTX A;  1VQP A;  4FXG C;  1Y1W H;  1HXY D;  5M3M B;  3CXC A;  3PQI A;  1YHQ A;  3K57 A;  1KD1 C;  1VQI A;  2UXC Q;  4IJH A;  1TKW B;  3PMF A;  4HSV A;  2F0G A;  2Z8L A;  4O2D A;  4DNT B;  2XWJ B;  4JI4 L;  1EIH A;  5HGT A;  2NTT A;  3E3X A;  4IUP A;  4A3D H;  1OTC A;  2A5H A;  2AQ2 B;  1IL8 A;  4GKK Q;  1HHV A;  2VZA A;  3OIQ A;  4A4I A;  5FLM H;  4OEL B;  4GNX A;  3MXN B;  3SE0 A;  2DJG C;  1WI5 A;  2ZTE A;  1I4R A;  4RWS C;  1K28 A;  1RCV D;  2OTL A;  3D31 A;  3KK7 A;  4C3J B;  4GOP C;  1PH3 A;  1G91 A;  2K50 A;  1SDF A;  1IL2 A;  2PW7 A;  1B50 A;  2LSS A;  5D65 A;  2QIL A;  2JEA I;  2MQH A;  5LMU L;  1SE4 A;  2KCM A;  3RD4 A;  5JEA J;  1TWC H;  4A3K H;  1ENA A;  3C1F A;  1SEB D;  4O1N A;  4HJ8 A;  1D6E C;  3G6J B;  4HTH A;  4NB3 A;  2PNR C;  4E6I A;  3GTO H;  3RN5 A;  1OXV A;  5BN4 A;  3HKZ G;  4H02 A;  2F0L A;  1XJV A;  3PIO 3;  3IKJ A;  4WJ3 M;  3CC4 A;  2PMZ E;  4K2L A;  4EGV A;  4IAL A;  1V43 A;  1O80 A;  2YTV A;  2YU9 H;  1GM5 A;  5FKA C;  1GHK A;  1LV9 A;  4HIK A;  2B2U C;  1HFN A;  1JB3 A;  4FF2 A;  3J81 i;  1II3 A;  1LTB D;  2A6H C;  1HQR D;  1BBU A;  3L9A X;  3BVM A;  4HCS A;  4JI8 L;  3EBE A;  2A6H D;  3HKZ B;  1EQQ A;  5AJ3 L;  2PZU A;  5EKL A;  1C48 A;  4DV7 Q;  2F0K A;  2CW0 D;  1O7Z A;  3BU2 A;  3TDQ A;  4R4I A;  4BXX G;  1Y1V H;  2EYM A;  4YIJ A;  2L55 A;  3Q23 A;  4A3B G;  3LX0 A;  5L37 A;  3HOV H;  3L3O C;  1FJG Q;  3GTQ H;  3GTP H;  5DLQ E;  1PYB A;  4TSS A;  5FLX c;  4UAI A;  1F2Z A;  2JEB I;  2ASB A;  5IIF A;  5JPM C;  1TS3 A;  3H6M A;  2VB3 X;  1N32 L;  4EQ5 A;  4JOI A;  1V1P B;  2DNC A;  3ULJ A;  2IWH A;  3HOY G;  1S5F D;  4B08 A;  5M3F B;  1I3Q H;  4C3H H;  2O4X A;  3I4M G;  1Q7Y C;  1SFO B;  2K1B A;  3E9I A;  5IWA L;  1JMC A;  3A55 A;  5CV4 A;  4LFB Q;  5FK9 C;  4DR3 L;  3K5L A;  2JA5 G;  3ND9 A;  1KRT A;  1V9P A;  1I4P A;  3DM1 A;  3I4N H;  4FXK C;  2A73 B;  4LWC A;  1I5F A;  3HS0 C;  2B29 A;  5I2X A;  3VR3 A;  5C4J B;  4G7O C;  4X3T A;  4R4Q A;  4YWL A;  3OMC A;  4DR4 L;  1Z7T A;  3D6C A;  4POF A;  2UUA L;  4PQX A;  5C44 G;  1OXT A;  1MI2 A;  1B2T A;  4DV0 L;  3NXW A;  1G6P A;  1Y1W G;  4UPA A;  1TWH H;  3MTS A;  4DV2 L;  5EBD A;  3HOY B;  4HJ9 A;  3E5S A;  2OQK A;  1PMR A;  3DLL A;  2V4D A;  5HGQ A;  3I4M B;  3CCS A;  3K7A B;  3JAM c;  3R2T A;  2VQE L;  3I73 A;  2KED A;  4A3D G;  2BOS A;  2KUM A;  2DNE A;  1PTO B;  4JBM A;  4MTN A;  2K5D A;  2Q2I A;  1SNP A;  4R4T A;  2F03 A;  5FLM G;  5KIX A;  1GUO A;  2WIN B;  1O7I A;  1D1K A;  1Q12 A;  1F9R A;  1CI3 M;  4IZ8 A;  4DR7 L;  2M00 A;  2R7Z H;  3ULL A;  2NZH A;  2RDG A;  4A3J B;  5CBA E;  1Y1W B;  1ZXT A;  2XGT A;  3NEM A;  1IKL A;  1CKM A;  4OGQ C;  3TS2 A;  4APV A;  4A3K G;  3D8G A;  3OPO A;  1AZP A;  1EY8 A;  2VL6 A;  2R61 A;  1U4L A;  2F3I A;  1UWV A;  3KFU A;  2VB2 X;  3TZD A;  1M4V A;  2CCZ A;  1CZW A;  1YEZ A;  3GTL H;  3OMG A;  1DXM A;  2NTS A;  2PZT A;  2IPK D;  3U9O A;  1VF7 A;  3LNN A;  1I4H A;  2K33 A;  3E0E A;  1E24 A;  3HEJ A;  1Z47 A;  3CCV A;  2ZM6 Q;  2E2J B;  2HDL A;  1W3S A;  3BZK A;  4RG1 A;  1B70 B;  1X3E A;  2KVM A;  2MHV A;  4M8A A;  3DXJ C;  4KHP Q;  1STB A;  3M4Y A;  2F0M A;  1PH2 A;  2V1C C;  1TWC B;  3GP7 A;  4A3K B;  2F0I A;  3I4L A;  5ELF A;  3AMU A;  5HUR A;  4DV4 L;  1JOR A;  5FLX E;  2MNA A;  4B3T L;  3AFQ A;  1SN8 A;  5EPJ A;  3RLO A;  2AWO A;  1H95 A;  5GAH C;  1AE2 A;  2XRQ D;  4NXN L;  2Z6B A;  4G4K A;  4NPS A;  2UUB L;  4CKC A;  4DV6 Q;  1Y1V G;  1J8I A;  1LTA D;  3RNU A;  1CTM A;  4HMI A;  2K05 A;  4DR5 L;  3HOV G;  3ERS X;  4OXP A;  4K5X A;  2XN9 C;  4OHJ A;  4R4O A;  2R93 B;  3GO5 A;  4NKL A;  1B1Z A;  2SDF A;  2Q8T A;  2XSC A;  1K3B C;  1SXT A;  5LL6 S;  2IW3 A;  1XNQ Q;  1HR0 W;  2NVX H;  3BZD B;  2XWB B;  1YBY A;  4TRD A;  2MJ8 A;  2E74 C;  1R4Q B;  1A3U A;  3KUP A;  1N9W A;  1E1T A;  1WTV A;  4FVM A;  2NVQ H;  5CV9 A;  3PV0 A;  4KTA A;  2EYP A;  2N3S A;  3E0J A;  1JQY D;  4GN3 B;  4C3H G;  3JAM L;  3T1Y L;  3PUY A;  1HNX L;  1Q1B A;  4DK1 A;  2C5C A;  4JI6 Q;  1ROD A;  2RKS A;  3OOC A;  4B3R Q;  5IYB H;  4HAE A;  2F4V Q;  4X62 Q;  4GNX B;  3I4N G;  3HOW B;  4KJO A;  4LF9 L;  3GTQ B;  1CKO A;  3QIA A;  5J1Z A;  5CV8 A;  3EVQ A;  3GTG H;  3LWU A;  3S14 H;  2Y0S E;  4ZCK A;  5JAV A;  4IUV A;  4L63 B;  3U4Z A;  3ERO A;  4R9W A;  1TWG H;  4C2M H;  1JR0 D;  4LF6 Q;  3NBI A;  4IPH A;  3G6E A;  4A3I H;  2BH8 A;  3K5N A;  1RTO A;  2FIN B;  1PH4 A;  4C3H B;  3BZC A;  4A3F B;  3PO2 B;  3CF5 A;  2L12 A;  3V2T A;  3S1Q H;  3CHB D;  3E6Z X;  4MHE A;  1LT5 D;  1LTS D;  4ME3 A;  4NP5 A;  4YCW A;  5T1I A;  4QIW E;  1K8A C;  3QOJ A;  3J81 j;  1XMQ Q;  1C4Q A;  2YTY A;  1GJX A;  1EZ6 A;  1B8A A;  2QEJ C;  4JG2 A;  5JVG 3;  4KMU C;  1JOK A;  2E5L Q;  2A1A A;  1YI2 A;  1Y8N B;  3A8J E;  3V96 A;  4K8I A;  4CDC C;  3NTH A;  1SYE A;  2IT1 A;  1GUN A;  4XQN A;  4G7Z C;  1BDO A;  1B44 D;  1XXG A;  3HRZ C;  4K5V A;  4RHR A;  1D8L A;  1TWH B;  2NZO A;  3CCR A;  4N9T A;  2KEN A;  5IGG A;  2A19 A;  3MFY A;  4DV3 Q;  4LF8 Q;  2PI2 A;  1NJI C;  1G51 A;  4BWG B;  3HOU H;  1QNU A;  5A35 A;  1X54 A;  5M3M H;  1XPO A;  5DEH A;  1EY9 A;  1DD2 A;  2NZ1 D;  1UAP A;  1F9Q A;  3MFG A;  5IT9 E;  1QE6 A;  2D5D A;  3CD6 A;  1QVG A;  3CP0 A;  4I65 A;  3PO3 B;  3JAM i;  3KJP A;  2OQ0 A;  1AW7 A;  3NUC A;  4JI1 L;  3UDX A;  4HJ5 A;  1TWA H;  4CGY B;  4A93 B;  1SYF A;  4KY5 A;  3I7F A;  2VQF L;  1VQM A;  3P75 A;  2R7Z B;  1RHP A;  3G7L A;  5LMN L;  1P16 A;  2A8V A;  3AB9 A;  2K04 A;  2AMC B;  3MWY W;  3GTM H;  1JJG A;  1I4G A;  2C35 B;  1HNZ L;  4HID A;  4YCV A;  4CJ2 C;  4YHH L;  2XRS D;  2EY5 A;  1T5X D;  4P73 A;  2F0F A;  5ELD A;  3GTL B;  4Q0F A;  5EJW A;  5FJ8 H;  1ET9 A;  2JQO A;  3NQI A;  1I94 L;  3FP9 A;  1K73 C;  2B2W A;  5K36 H;  1N36 Q;  2WKC A;  3MEF A;  3HOZ B;  2EIF A;  3J80 c;  5C0X I;  3A8I E;  5ELB A;  4DFA A;  4L5T A;  4H13 C;  3C46 A;  2F0J A;  4A75 A;  1U0L A;  1U9R A;  5CV5 A;  5IGD A;  3H3V I;  3C2P A;  3BVG A;  2O5J C;  4I7A A;  1CSQ A;  4OX9 Q;  1JWU D;  1DOM A;  5KYI A;  3F2B A;  2PNH A;  5CR3 A;  4BA1 I;  1KTK A;  5EKI A;  4AQY Q;  1ML0 D;  5KRU A;  2NVT H;  1A15 A;  2JP1 A;  5EQ0 A;  3CCM A;  1HH2 P;  3CCQ A;  3ND8 A;  3RR5 A;  4JK1 C;  1J6Q A;  5C5L A;  5GQO A;  4CKE A;  2RDH A;  2EY6 A;  1XNR Q;  1LTT D;  3DEP A;  3K59 A;  3CC7 A;  1YVC A;  3KF6 A;  1H9S A;  5IYB G;  1CHQ D;  4P2C B;  3DEO A;  4DK0 A;  4OO1 I;  1PA6 A;  3ZJY C;  1JE5 A;  4X65 Q;  2OTJ A;  2IL8 A;  5M9O A;  2UXB L;  1U4R A;  3SXH A;  3LGJ A;  2UXD Q;  1HZA A;  2UU9 L;  3W2D A;  4NW2 A;  2NVX B;  4KY6 A;  1HA6 A;  2E75 C;  4K0K L;  2EYO A;  5M5X B;  4A3I G;  5GRO A;  1EL0 A;  2Z6K C;  3PCO B;  4QUF A;  2NVQ B;  5GAD C;  2D0P A;  4A3G H;  3U4V A;  4NXM L;  3S17 B;  2E2I H;  3T1H L;  3OW7 A;  4CJ1 B;  1GD7 A;  2JE6 I;  5M3F H;  3HOX H;  1J5E L;  2GVA A;  5AJ3 Q;  4B9W A;  2RDF A;  5AFW A;  3UE1 A;  3FMC A;  3I56 A;  3A8K E;  4X64 L;  2J7Z A;  1NAP A;  4U68 A;  1XPU A;  4LFC L;  3AU7 A;  1I6H H;  1TWG B;  4QJF A;  1EWH A;  5BR8 L;  2Q2T A;  3CKI B;  2L0C A;  1S5C D;  1PH6 A;  1PRT B;  3KJO A;  3TSS A;  4IUN A;  1F9S A;  1FL0 A;  2D0O A;  1VQE A;  4OWX B;  3HOU G;  4R8N A;  2PQE A;  3D0F A;  3S1Q B;  3WOE A;  5M3M G;  4IPG A;  4AYB G;  5FOB B;  4IN3 A;  4MTK A;  3L2P A;  2HIX A;  2F0H A;  2VW9 A;  1PTO C;  1Q1E A;  1EY4 A;  3T4A C;  5JEA G;  2EXD A;  1PTO D;  2R3Z A;  3K7A H;  1G6Z A;  3OSO A;  4KHZ A;  4DR3 Q;  1CZG A;  3N6R A;  1S5D D;  2YYZ A;  3U9S A;  2K5N A;  3M4Q A;  2JA6 H;  1VQ8 A;  3KLR A;  2E76 C;  1EY6 A;  1K83 H;  2AUJ D;  3VYT A;  1MBY A;  3O13 A;  2KHI A;  2CKZ B;  3J80 E;  1C0A A;  4GKJ Q;  5H1S E;  4PZ6 A;  4DKA C;  2BH2 A;  1BO0 A;  3BYY B;  4BBS H;  3RUZ A;  1CT1 D;  1LT3 D;  4K6L A;  3CC2 A;  4JI3 Q;  1V1Q A;  1CQF A;  1L1O B;  1J9O A;  1QUQ A;  4A3J H;  3PIP 3;  2F52 A;  1DZ1 A;  4RKB A;  4CBV A;  4AYB B;  2AHO B;  1NBW A;  2M9V A;  3FEW X;  2KOL A;  5BN5 A;  2JA9 A;  4DV5 Q;  5FJ8 G;  2I5M X;  3J81 E;  1PFS A;  5I4D A;  1VQO A;  1K8G A;  5K36 G;  3FHW A;  4GLV B;  2Q2U A;  3BG3 A;  2VQE Q;  1TWA B;  4AH6 A;  1N33 L;  1SR3 A;  1YJN A;  2HQL A;  3GD7 A;  1Z6H A;  4LF5 Q;  1Y8P B;  3M3Y H;  2EVB A;  2OCE A;  2DGY A;  1KHI A;  4IQZ A;  3QJY A;  2MP1 A;  4RAU C;  4DK6 C;  1RD9 D;  4JI5 Q;  4JI7 Q;  3ICE A;  3GTM B;  4LF4 L;  5CGK A;  1E3P A;  3DM3 A;  3WWV A;  1YJW A;  2VY3 A;  3U50 C;  2E2J H;  1P8L A;  3M7G A;  4L5Q A;  1S5E D;  1UNS A;  4JCV E;  4U67 3;  1I6V C;  4DV1 L;  1WFQ A;  2CWP A;  2B2V C;  1VQ9 A;  3TQY A;  1UE6 A;  2SEB D;  1QWY A;  2KQ3 A;  2QDL A;  1BR9 A;  3GV3 A;  2RCF A;  3QOL A;  4B3S Q;  3GQB A;  1HZB A;  1B9M A;  3ER0 A;  1NUC A;  5IOC A;  3J80 i;  2WP8 J;  3F2D A;  1G2T A;  4TKO B;  5KEE A;  1IBL L;  2X69 A;  4ZKB B;  2KBN A;  1EWI A;  4N8X 1;  4DR1 L;  1JE4 A;  1UEA B;  2BDN A;  2R93 H;  2O5I C;  2NVT B;  4L6T B;  1Y8O B;  1SLJ A;  4A3G G;  1ICF B;  1PYS B;  4Y7N B;  1Y14 B;  1XYI A;  3K80 C;  1YZ6 A;  1ZKO A;  4JI2 Q;  5M3F G;  1E0B A;  3HOX G;  3BDL A;  4GNX C;  3NTI A;  2HHH Q;  2CW0 C;  5GAG C;  2UUC L;  1NSN S;  2WB1 E;  3TME A;  1JCK B;  5HY6 A;  1VF5 C;  1LT6 D;  2X6G A;  1LYL A;  3CRL C;  2B63 H;  4B3M L;  4L8J A;  2I5L X;  2WKD A;  1UEB A;  1PFB A;  1LO5 D;  2BA1 A;  1D5X C;  4X3U A;  3HOW H;  4LMQ D;  3D4R A;  1A63 A;  2AUK A;  3T16 A;  2NVY H;  5C0X H;  3M85 A;  3SK6 A;  4LFA L;  4WOR A;  4RH6 A;  1SE3 A;  3S1R H;  2CWA A;  2EJG C;  3HG9 A;  2EY1 A;  3VYR A;  3H3V H;  4A3G B;  4FF1 A;  5M5Y H;  4JV5 Q;  5CMD A;  3QG1 A;  3VDY A;  2E2I B;  4A3C H;  1HFG A;  3R3O A;  4JI0 L;  4LF7 L;  5KGU A;  4X3K A;  3I90 A;  3KYH C;  4DNI A;  3HOX B;  1JWM D;  4ULL A;  1JOO A;  3CCE A;  4QY7 A;  1IBM L;  1FNU A;  1E2V A;  4A3F H;  4XQJ A;  1HNX Q;  3PO2 H;  1NR4 A;  2NBF A;  3PIO A;  2CH4 W;  3I4O A;  1TQO A;  3IL8 A;  2JA6 G;  1CHP D;  1I6H B;  4HSP A;  2F3W A;  1SYB A;  2ES2 A;  5IE8 A;  1HCZ A;  4DR6 L;  4BY1 H;  1EYA A;  2IY5 B;  4BBS G;  1GUW A;  4XYO A;  4OO1 H;  2K52 A;  4H0L C;  3RZD B;  2EDG A;  1HTP A;  4KLK A;  3VR6 A;  4PV1 C;  4A3J G;  2EOT A;  1LAC A;  2AWN A;  4ZUI A;  4YWK A;  5I6W A;  1EYG A;  1PH7 A;  1TWF H;  4DUZ L;  3UI2 A;  1C7Y A;  1X65 A;  4RGN A;  3KF6 B;  4FNF A;  1H9S B;  3C1E A;  3FDT A;  1VDZ A;  4J1M A;  4QUC A;  1KAA A;  2JA6 B;  1VQB A;  1EZ8 A;  1K83 B;  1VQG A;  4DAV A;  1SMY C;  4K2K A;  3PO3 H;  2KCT A;  3NWS A;  4FYD A;  1JB7 A;  1Y69 U;  2JYO A;  1VQ6 A;  4BBS B;  1SMY D;  2BDO A;  4A93 H;  2JK8 A;  1FD7 D;  1IBK Q;  2UXC L;  2KJX A;  1PV4 A;  5A2Q L;  1HR0 Q;  4OL7 A;  5COY A;  1WTP A;  1PZI D;  1OXS C;  2WFW A;  4JOI C;  3J7Y W;  1K0R A;  2D2C C;  1ILP A;  3HP3 A;  2VS1 A;  3HZX A;  1SYC A;  1IYU A;  3MHB A;  1BUV T;  1ILQ A;  1DGS A;  1CA5 A;  1ASZ A;  4GKK L;  5FO9 B;  2R6G A;  1L0Y B;  1Q8I A;  2JXM B;  3J7A V;  1WTW A;  2JJQ A;  2RA4 A;  1NMF A;  2M2L A;  1KL9 A;  2F0W A;  4POG A;  2XTI A;  1EQT A;  3QB3 A;  3M3Y B;  1K8M A;  4ZKC B;  2IX3 A;  3TEH B;  1EU4 A;  3HOZ H;  4R8I A;  3VA5 A;  1JT8 A;  1DOK A;  1WCM B;  3TRZ A;  3SVM A;  1FR3 A;  1VQ7 A;  1RKN A;  2R93 G;  5G3L F;  2IHF A;  3TBI B;  1SMX A;  1HNZ Q;  2E2H H;  1JJC B;  1VCI A;  4BY7 B;  2NN6 I;  3BDO A;  5FO7 B;  3SK5 A;  4YHH Q;  2PYK A;  4RFB A;  3BJU A;  1FNV A;  1EYD A;  1KAW A;  1RDP D;  4DXG A;  3MEH A;  1NNX A;  1EY7 A;  2PQA B;  1SRU A;  1TT2 A;  1LTI D;  3Q22 A;  1YHA A;  1KXL A;  4OWW B;  4XT3 B;  2CFM A;  2DY8 A;  1R4P B;  2B63 G;  2EJF C;  3AFP A;  3K7U C;  4KN7 C;  4GOP B;  3HOW G;  3ERQ A;  1BCP B;  5C4H A;  4XYQ A;  5C0X G;  4GN5 A;  1CKN B;  4R4C A;  1T9H A;  1GXD C;  1GUS A;  2F3V A;  2RVL A;  3S1M B;  5D3D A;  4RGT A;  4RMF A;  1QUQ B;  4IPC A;  4RCN A;  4JYA Q;  3J7A 5;  1K8O A;  5M5X H;  4DV7 L;  4DR2 Q;  4A3C G;  2L4N A;  1L1O A;  1EY0 A;  1SYD A;  1VQC A;  2DN8 A;  1YIJ A;  1X32 A;  1I50 B;  3TZU A;  4A3F G;  3V05 A;  3PO2 G;  3CME A;  3S17 H;  1FJG L;  2ZJR A;  3KOJ A;  4UP9 A;  1QOH A;  1CFM A;  1UE7 A;  3L0O A;  2B63 B;  1TS4 A;  3UDF A;  1KNE A;  3JAM E;  1NTG A;  2NVY B;  2ATW A;  4BY1 G;  2K14 A;  4YY3 Q;  2N78 A;  4HCE A;  2B8G A;  3S1R B;  2UXB Q;  1PRT C;  2MGS A;  2PMZ B;  3MXP A;  4OO1 G;  1JC7 A;  1HRJ A;  4JW0 A;  3KDF A;  4Z9C B;  1PRT D;  5LMN W;  3CAM A;  5M5Y B;  3J7Z C;  4PMC A;  4G57 A;  1O7Y A;  4HN7 A;  4L5R C;  2F0Q A;  3CPF A;  5J3B A;  2F0E A;  1QZH A;  3OTO Q;  3KF8 A;  2WAQ E;  1VQ4 A;  3VYU A;  1CQV A;  3ULP A;  3NWT A;  3URY A;  5E4X A;  3S16 H;  1BXT A;  1EQV A;  2HUG A;  4X6A H;  4A3E H;  2WB1 B;  1ENF A;  2N8N A;  2B2T A;  2CVR A;  5C0X J;  2ZJQ A;  3TP5 A;  3PO3 G;  1STH A;  1A62 A;  4DAM A;  4BY1 B;  2F0D A;  3LWE A;  3UE0 A;  1EIG A;  2BE5 C;  3M9B A;  2I0Q A;  4LFC Q;  4A93 G;  1HNW L;  1EY5 A;  5DAU A;  5BN3 A;  5EGT A;  1S3O A;  2BE5 D;  2R7Z G;  2FJ2 A;  4HIO A;  2B3G A;  3ONA B;  3I70 A;  3FVQ A;  5KNB A;  3U58 A;  1NMG A;  2PPB C;  1QNK A;  1B4O A;  4JBJ A;  4XXE A;  1K0S A;  2ICI A;  5GAE C;  1TWF B;  1AFP A;  3W3A A;  5C6A A;  4FP5 D;  2CQO A;  2A74 C;  3I8Z A;  4CJ0 B;  3KLS A;  3G48 A;  3KLS X;  2RF4 A;  2HCI A;  2L1B A;  5C4X B;  4LUZ A;  3GTK B;  5I2Y A;  2H1E A;  1K3R A;  1GO3 E;  3HOZ G;  1M8A A;  1QCB D;  3PUZ A;  1TS2 A;  2IHE A;  4KY7 A;  4C1N K;  3A5Z B;  3UDG A;  1A3T A;  4KKS A;  1L0W A;  1A6X A;  1YNN C;  2ZXO A;  1GVP A;  1MJE A;  3RZO H;  1YHB A;  1YNN D;  1QG7 A;  3AQQ A;  3MXG A;  5KND A;  2VUM B;  3PF4 A;  3DWA A;  1EFW A;  5IGE A;  4HED A;  4N8F A;  3W1G A;  2K28 A;  1VMP A;  1D5M C;  2LFN A;  2JA7 B;  4V0B A;  5EBC A;  4JI4 Q;  1T5E A;  2HD3 A;  4WFN 3;  4FO2 A;  1LAB A;  1WD0 A;  4KHP L;  2IJ0 A;  4NDX A;  1TR5 A;  1EU3 A;  3H91 A;  4HR7 B;  3TP6 A;  1QB5 D;  3PUV A;  1RIP A;  1N34 L;  3BVZ A;  5IGC A;  1ASY A;  1E22 A;  3EJI A;  5IGB A;  3EIV A;  1WYD A;  1S5B D;  2EYL A;  2E2H B;  2RHQ B;  1WTR A;  4LAA A;  2N55 A;  1D2B A;  2J4X A;  4ABN A;  2B2Y A;  3HKZ E;  1IXR A;  2ZJP A;  3MVV A;  1VQ5 A;  5LMU Q;  1ONL A;  1W2B A;  1H9M A;  4GLX A;  4P74 A;  5D14 A;  2F0T A;  4Y7N H;  4C3I B;  1RJT A;  2TMP A;  4ALP A;  1C9O A;  4KD4 A;  3MXU A;  4UP8 A;  1XNQ L;  4PMW A;  5CBE E;  2ALY B;  3BDC A;  1FGB D;  4OWT B;  5EPK A;  3W5O A;  3T13 A;  2QEX A;  5E7N A;  1XX8 A;  2F0S A;  5IGF A;  3CQZ B;  1H9J A;  3A56 A;  1XTC D;  2K5H A;  3CCJ A;  1TS5 A;  3VYS A;  2JA8 H;  4JI6 L;  3P7J A;  1IZ6 A;  4B3R L;  1HZ9 A;  2WII B;  3NPP A;  1WJJ A;  2B2W C;  2EY2 A;  3DWQ A;  4X62 L;  3K58 A;  1STN A;  5DM7 3;  4KK7 A;  1MKH A;  4WRD A;  3MC0 B;  2ZT9 C;  3EFX D;  1AN8 A;  1NR2 A;  3D4W A;  2NN6 H;  4JI8 Q;  4A3E G;  1Q86 C;  1SAP A;  1YIT A;  2UUC Q;  4LF6 L;  3K81 C;  4F87 A;  3A5U A;  3EN2 A;  3C3L A;  1G29 1;  3OHX C;  2F0O A;  3JC6 6;  2I5H A;  5ISR A;  3P20 A;  3STB C;  1NCV A;  2F0U A;  2DUD A;  1U4P A;  2GA4 B;  5DNF A;  3STB D;  4LFA Q;  5ELE A;  3NEN A;  2KEE A;  2D9U A;  1XMQ L;  3DUZ A;  3RZD H;  1A2T A;  4A3M B;  2FFK B;  2LS0 1;  1F77 A;  4K5W A;  4BA2 I;  1CM9 A;  3S1N B;  4XQQ A;  4F88 A;  1N32 Q;  3S16 B;  3M4O B;  5IYC H;  4A3E B;  4MN3 A;  4A3B H;  3A7L A;  4QMG A;  3OYY A;  4DXF A;  3D4D A;  3D3R A;  5IWA Q;  2Z9H A;  2ID0 A;  2PQA A;  3M4P A;  4LF8 L;  4EX5 A;  4DV3 L;  1EOT A;  4JVZ A;  5CV6 A;  3B6Y A;  1IYV A;  2Z1C A;  3QO2 A;  2ZXR A;  1STE A;  2OXP A;  4O0A A;  4YCU A;  4IUU A;  4DR4 Q;  4GOP A;  2Y0S B;  1PFN A;  1B3Q A;  4DPG A;  4ZK9 B;  2UUA Q;  2WAC A;  1CKN A;  2PO4 A;  3AYH B;  1GUG A;  5CYU A;  5JJL A;  5IY0 A;  4DV0 Q;  1GHJ A;  1R9T B;  4DAY A;  3R93 A;  5KNC A;  3Q24 A;  4AIM A;  1F2Y A;  4XTC S;  4DV2 Q;  1PHJ A;  1WD1 A;  5TSS A;  1D5Z C;  1LT4 D;  4H7B A;  5J22 A;  1BBX C;  2HQE A;  3OIP A; 
#chains in the Genus database with same CATH homology
 4QIW B;  1SYG A;  3K5M A;  2X6L A;  3ZYY X;  3NQT A;  1KNA A;  2LY7 A;  1KDB A;  4KHV A;  5JOB A;  4IUT A;  5C3E B;  3FRP B;  1ESR A;  2A69 C;  2Q8I B;  1TVX A;  3RZO B;  5J39 A;  2KEC A;  5I9P A;  2A69 D;  4S3S A;  2SOB A;  3R2I A;  4I7Z C;  2B2U A;  3I91 A;  3KBX A;  2EZV A;  1F2M A;  2F4I A;  1AP0 A;  3SK8 A;  5M5W B;  1SNO A;  3GV6 A;  1BCP C;  3D6W A;  2EYF A;  1DOL A;  1BCP D;  2EYH A;  5FO8 B;  4RCO A;  1KLU D;  1V1O A;  1HQM C;  4DNR B;  2EE1 A;  3X3N A;  2FMM A;  1X3Q A;  3PUW A;  2K5Q A;  2NN6 G;  1B53 A;  4IFD J;  3TN2 A;  1PLF A;  2NB0 A;  1MSH A;  5JPN C;  1ZEQ X;  3H3V C;  3MAQ A;  4DAP A;  2EJM A;  1A2U A;  1Q90 A;  2JA8 B;  2QKI C;  1EEI D;  3NSW A;  1KLG D;  2JSO A;  1G8Z D;  2IX0 A;  1H9R A;  3KBG A;  3DWP A;  4QCL A;  3SEB A;  4QF4 A;  1STA A;  3MA2 B;  5IOD A;  1STY A;  3IAY A;  1AZQ A;  2ENB A;  1DYQ A;  4J6H A;  1LLR D;  1DM0 B;  1SNQ A;  4CKB A;  2J0T D;  5KYL A;  4KD3 A;  1IKM A;  3F2U A;  4DGZ A;  5COR A;  4IUQ A;  4TQU S;  2G9D A;  4F8M A;  4K8J A;  4A3B B;  3QWN A;  1Q3L A;  3VR5 A;  3NBH A;  5CC4 A;  1E2Z A;  1H9K A;  2AQ1 B;  3MZ5 A;  1FNW A;  2G9H D;  4IFD I;  2CQA A;  3DMU A;  1F2L A;  4GZY C;  5C3W A;  4WJW A;  1BQQ T;  1JOQ A;  5F2D A;  1LTG D;  1WVL A;  1PFM A;  3NK9 A;  4PNY A;  3FPU B;  2OT2 A;  4G7H C;  2BCO A;  1BOS A;  1SNM A;  2JA5 B;  4X3S A;  5A2Q E;  2RBM A;  4ZRZ A;  1DON A;  4C1N I;  2LKV A;  4F7X A;  2VXW A;  3S15 B;  5C44 B;  1EEF D;  1PTO F;  4M1U B;  3K5O A;  3H09 A;  4EQP A;  3ITP A;  1PYW D;  2E2D C;  1PZJ D;  2L5T A;  4A3D B;  2XVS A;  2PZW A;  1L0X B;  2LMC B;  4ZQ3 A;  4ZUJ A;  3EA6 A;  3A7A B;  5E1F A;  4FXD A;  3NE5 B;  5FLX L;  4B9X A;  2F1M A;  2MPM A;  1HPC A;  4IUR A;  4KJN A;  2F0V A;  3A54 A;  1V8Q A;  5LHY 1;  2RSN A;  4BBR B;  1JWS D;  1IW7 C;  3GTO B;  2IX1 A;  1IW7 D;  1ICW A;  2MUY A;  1KAB A;  3BYT B;  4ZYS A;  1EYC A;  3S9W A;  1AEX A;  1QIL A;  5I6Y A;  4KV6 A;  2RQX A;  1QJO A;  2YU9 B;  1KDA A;  4NMZ A;  3RLF A;  1PDQ A;  2I46 A;  1BCP F;  2R92 B;  1C8C A;  1DCZ A;  3M7N A;  2WV6 D;  1U4M A;  2ZXP A;  4KN4 C;  1A3V A;  1HTL D;  2PCF B;  3K6O A;  5I9O A;  1HUN A;  3X3M A;  4K6D A;  2L11 A;  3FKI B;  1Y1V B;  2EYJ A;  4BS9 A;  5K5P A;  3HOV B;  3HGB A;  1YNJ C;  1W6K A;  4XDX A;  3GTP B;  1KDC A;  1X3P A;  1YNJ D;  1TU2 B;  2C9O A;  2K32 A;  3MXN A;  1CA6 A;  3R8B A;  2KCN A;  1SE2 A;  5EPL A;  2L9H A;  4DN4 M;  1HUM A;  1I3Q B;  4DA2 A;  5E3F A;  1WTX A;  2N88 A;  2Z4I A;  1UUP A;  1ET6 A;  1SSO A;  2VNU D;  4FF3 A;  2D62 A;  4O42 A;  3TP8 A;  2BA0 A;  4RKL A;  3I4N B;  5JVH 3;  5T1G A;  4CHT B;  4PMB A;  4LJZ C;  1CK1 A;  1LTR D;  4Q5V A;  2K6A A;  1TY2 A;  2F0P A;  1I4X A;  4MIU A;  4LK1 C;  4H44 C;  3Q6S A;  2A6E C;  1MSG A;  1FYC A;  5IT9 L;  1G2S A;  5CV7 A;  1S4Z A;  4XIG S;  3SR1 A;  1B3A A;  3T51 B;  1BNZ A;  2A6E D;  5E4W C;  3J7A F;  2KA7 A;  2ICE C;  1MD2 D;  2NUC A;  1PXU A;  2K03 A;  2K5W A;  3DHQ A;  4N9P A;  5JEA H;  3I3C A;  3GTJ B;  1GOZ A;  1E2W A;  3VR2 A;  3NP8 A;  2B2T C;  2RSO A;  2NWG A;  3I72 A;  4DF7 A;  3PUX A;  5C3X A;  3WOF A;  2PW5 A;  3NTK A;  3T53 B;  4C3I G;  4RA8 A;  5DM6 3;  3H0G B;  4IFD H;  2TSS A;  2EXZ A;  4KKT A;  3S2H B;  4ILW A;  1V1P A;  5C5M A;  2QF7 A;  2HCC A;  3N52 A;  3CRK C;  1SNC A;  4KI0 A;  1SND A;  4RGM A;  1RF2 D;  3NHH A;  4C56 C;  1SBB B;  4V19 0;  2AQ3 B;  2Q8R E;  1WTO A;  1O7L A;  3RMH A;  1PZK D;  1EWC A;  3SHL A;  3H94 A;  1STG A;  4ODG A;  4OIK A;  4RGO S;  4KKU A;  1SJE D;  4J8Q A;  3S2D B;  3TP7 A;  1JIC A;  3OWE B;  4ZAI A;  5EKK A;  4UDU C;  1OXX K;  1ZYR C;  1W6J A;  3T56 B;  1ZYR D;  1WTQ A;  5JJZ A;  2FHT A;  2O2L D;  5C4Z A;  1TII D;  2FMC A;  2B2Y C;  3BS1 A;  2A68 C;  3CU7 A;  5LL6 X;  2NYZ D;  2OEO A;  2HDM A;  2A68 D;  3EQL C;  4EQO A;  4JBW A;  3K0Y A;  3GTG B;  2KHS A;  4HMJ A;  5NUC A;  1F9P A;  3S14 B;  4OIJ A;  4ME5 A;  1RTN A;  1ENC A;  2XIW A;  4C2M B;  2K7V A;  2EPB A;  2B39 A;  4A3I B;  3FPP A;  2SNS A;  2DY7 A;  4K14 A;  2CHB D;  1B9N A;  3IFT A;  2F0N A;  4QB4 A;  1OXU A;  3VA7 A;  1I4Q A;  4EQN A;  3Q0A A;  2Z4H A;  4EVO A;  1BF4 A;  1D1I A;  1XWE A;  1VMC A;  3OWF A;  1PRT F;  4RHS A;  3VR4 A;  4FF4 A;  2XNA C;  2B2V A;  4ID6 A;  2H4O A;  1HA5 A;  3J80 L;  1DJR D;  1MGS A;  3IFD A;  2QDB A;  1GUT A;  2I07 B;  1TY0 A;  1PTO H;  2WAQ B;  5ELC A;  2SNM A;  4XT1 B;  5D3I B;  3WDN A;  4ZLT F;  4DU9 A;  1EFI D;  1O78 A;  3P1H A;  3SK4 A;  2OF1 A;  1ESF A;  3SDZ A;  1IHZ A;  1SJH D;  2QCP X;  2B8F A;  5G3L D;  1JOR A;  3HOU B;  3J81 L;  2KCC A;  3L7Z C;  4C3J G;  1OO9 B;  2K01 A;  4IFD G;  4FXG C;  1HXY D;  5M3M B;  3K57 A;  1TKW B;  3PMF A;  4HSV A;  2F0G A;  2Z8L A;  4DNT B;  2XWJ B;  1EIH A;  5HGT A;  2NTT A;  4IUP A;  2A5H A;  2AQ2 B;  1IL8 A;  1HHV A;  3OIQ A;  3SE0 A;  1I4R A;  4RWS C;  1RCV D;  3D31 A;  3KK7 A;  4C3J B;  1G91 A;  1SDF A;  2PW7 A;  1B50 A;  5D65 A;  2QIL A;  2JEA I;  1SE4 A;  3RD4 A;  5JEA J;  1ENA A;  3C1F A;  1SEB D;  4O1N A;  1D6E C;  3G6J B;  4HTH A;  2PNR C;  4E6I A;  1OXV A;  5BN4 A;  2F0L A;  3PIO 3;  3IKJ A;  4K2L A;  4EGV A;  4IAL A;  1V43 A;  1O80 A;  5FKA C;  1GHK A;  1LV9 A;  2B2U C;  1HFN A;  1JB3 A;  4FF2 A;  1II3 A;  1LTB D;  2A6H C;  1HQR D;  3L9A X;  3BVM A;  4HCS A;  2A6H D;  3HKZ B;  2PZU A;  5EKL A;  1C48 A;  2F0K A;  2CW0 D;  1O7Z A;  3TDQ A;  4YIJ A;  2EYM A;  2L55 A;  3Q23 A;  3LX0 A;  3L3O C;  4TSS A;  4UAI A;  1F2Z A;  2JEB I;  5IIF A;  5JPM C;  1TS3 A;  3H6M A;  2VB3 X;  1V1P B;  2DNC A;  2IWH A;  1S5F D;  4B08 A;  5M3F B;  2O4X A;  1SFO B;  2K1B A;  3A55 A;  5CV4 A;  5FK9 C;  3K5L A;  3ND9 A;  1I4P A;  3DM1 A;  4FXK C;  2A73 B;  5I2X A;  3HS0 C;  5C4J B;  3VR3 A;  4G7O C;  4X3T A;  3OMC A;  1Z7T A;  3D6C A;  4PQX A;  1OXT A;  1MI2 A;  1B2T A;  3NXW A;  3MTS A;  5EBD A;  3HOY B;  3E5S A;  1PMR A;  2V4D A;  3I4M B;  3K7A B;  3R2T A;  3I73 A;  2KED A;  2BOS A;  2KUM A;  2DNE A;  1PTO B;  2K5D A;  1SNP A;  2F03 A;  5KIX A;  1GUO A;  2WIN B;  1D1K A;  1Q12 A;  1F9R A;  1CI3 M;  4IZ8 A;  2M00 A;  2RDG A;  4A3J B;  5CBA E;  1Y1W B;  1ZXT A;  1IKL A;  4OGQ C;  3D8G A;  3OPO A;  1AZP A;  1EY8 A;  2R61 A;  1U4L A;  2VB2 X;  3TZD A;  1M4V A;  1CZW A;  3OMG A;  1DXM A;  2NTS A;  2PZT A;  2IPK D;  3U9O A;  1VF7 A;  3LNN A;  1I4H A;  2K33 A;  3HEJ A;  1Z47 A;  2E2J B;  2HDL A;  2KVM A;  2MHV A;  4M8A A;  3DXJ C;  1STB A;  3M4Y A;  2F0M A;  1TWC B;  3GP7 A;  4A3K B;  2F0I A;  3I4L A;  5ELF A;  3AMU A;  5HUR A;  5FLX E;  5EPJ A;  2AWO A;  2XRQ D;  4G4K A;  4CKC A;  1J8I A;  1LTA D;  1CTM A;  4HMI A;  2K05 A;  4K5X A;  2XN9 C;  4OHJ A;  2R93 B;  3GO5 A;  4NKL A;  1B1Z A;  2SDF A;  2Q8T A;  2XSC A;  1SXT A;  5LL6 S;  2IW3 A;  3BZD B;  2XWB B;  4TRD A;  2MJ8 A;  2E74 C;  1R4Q B;  1A3U A;  3KUP A;  1WTV A;  4FVM A;  5CV9 A;  3PV0 A;  4KTA A;  2EYP A;  3E0J A;  1JQY D;  4C3H G;  3JAM L;  3PUY A;  1Q1B A;  4DK1 A;  2C5C A;  1ROD A;  2RKS A;  3OOC A;  4HAE A;  3HOW B;  4KJO A;  3GTQ B;  5J1Z A;  3QIA A;  5CV8 A;  3EVQ A;  3LWU A;  5JAV A;  4IUV A;  4L63 B;  3ERO A;  4R9W A;  1JR0 D;  3NBI A;  3K5N A;  1RTO A;  2FIN B;  4C3H B;  4A3F B;  3PO2 B;  2L12 A;  3V2T A;  3CHB D;  3E6Z X;  4MHE A;  1LT5 D;  1LTS D;  4NP5 A;  5T1I A;  3QOJ A;  1C4Q A;  1GJX A;  1EZ6 A;  2QEJ C;  5JVG 3;  4KMU C;  1JOK A;  1Y8N B;  3A8J E;  3V96 A;  4K8I A;  4XQN A;  1SYE A;  3NTH A;  2IT1 A;  1GUN A;  4G7Z C;  1BDO A;  1B44 D;  1XXG A;  3HRZ C;  4K5V A;  4RHR A;  1TWH B;  4N9T A;  5IGG A;  3MFY A;  4BWG B;  1QNU A;  5A35 A;  5DEH A;  1EY9 A;  1DD2 A;  2NZ1 D;  1UAP A;  1F9Q A;  3MFG A;  5IT9 E;  1QE6 A;  2D5D A;  4I65 A;  3PO3 B;  1AW7 A;  3NUC A;  4CGY B;  4A93 B;  1SYF A;  4KY5 A;  3P75 A;  2R7Z B;  1RHP A;  3G7L A;  3AB9 A;  2K04 A;  3MWY W;  1I4G A;  4CJ2 C;  2XRS D;  2EY5 A;  1T5X D;  2F0F A;  5ELD A;  3GTL B;  4Q0F A;  5EJW A;  1ET9 A;  3NQI A;  2B2W A;  5K36 H;  2WKC A;  3HOZ B;  5C0X I;  3A8I E;  5ELB A;  4DFA A;  4H13 C;  3C46 A;  2F0J A;  1U9R A;  5CV5 A;  5IGD A;  3C2P A;  3BVG A;  2O5J C;  1JWU D;  1DOM A;  5KYI A;  5CR3 A;  4BA1 I;  1KTK A;  5EKI A;  1ML0 D;  5KRU A;  1A15 A;  2JP1 A;  5EQ0 A;  3ND8 A;  4JK1 C;  5C5L A;  4CKE A;  2RDH A;  2EY6 A;  1LTT D;  3DEP A;  3K59 A;  1H9S A;  1CHQ D;  4P2C B;  3DEO A;  4DK0 A;  4OO1 I;  2IL8 A;  5M9O A;  1U4R A;  3SXH A;  3W2D A;  4NW2 A;  2NVX B;  4KY6 A;  1HA6 A;  2E75 C;  2EYO A;  5M5X B;  1EL0 A;  4QUF A;  2NVQ B;  3S17 B;  3OW7 A;  4CJ1 B;  2JE6 I;  4B9W A;  2RDF A;  5AFW A;  3FMC A;  3A8K E;  2J7Z A;  1NAP A;  4U68 A;  3AU7 A;  1TWG B;  1EWH A;  3CKI B;  2L0C A;  1S5C D;  1PRT B;  3TSS A;  4IUN A;  1F9S A;  4R8N A;  2PQE A;  3S1Q B;  3WOE A;  5FOB B;  4IN3 A;  2F0H A;  1PTO C;  1Q1E A;  1EY4 A;  3T4A C;  5JEA G;  1PTO D;  2R3Z A;  1G6Z A;  3OSO A;  4KHZ A;  1CZG A;  3N6R A;  1S5D D;  2YYZ A;  3U9S A;  3KLR A;  2E76 C;  1EY6 A;  2AUJ D;  3VYT A;  1MBY A;  3O13 A;  3J80 E;  1BO0 A;  3BYY B;  3RUZ A;  1CT1 D;  1LT3 D;  4K6L A;  1CQF A;  1J9O A;  3PIP 3;  1DZ1 A;  4RKB A;  4CBV A;  4AYB B;  2M9V A;  3FEW X;  5BN5 A;  2KOL A;  3J81 E;  5I4D A;  5K36 G;  3BG3 A;  1TWA B;  3GD7 A;  1Z6H A;  1Y8P B;  2EVB A;  4IQZ A;  3QJY A;  2MP1 A;  4RAU C;  1RD9 D;  3GTM B;  5CGK A;  3M7G A;  1S5E D;  1UNS A;  4U67 3;  1I6V C;  2B2V C;  2SEB D;  1QWY A;  2KQ3 A;  1BR9 A;  3GV3 A;  3QOL A;  3GQB A;  1B9M A;  1NUC A;  5IOC A;  2WP8 J;  1G2T A;  4TKO B;  5KEE A;  2X69 A;  4ZKB B;  1JE4 A;  1UEA B;  2BDN A;  2O5I C;  2NVT B;  4L6T B;  1Y8O B;  4Y7N B;  1XYI A;  1ZKO A;  1E0B A;  3BDL A;  3NTI A;  2CW0 C;  1NSN S;  3TME A;  1JCK B;  1VF5 C;  1LT6 D;  2X6G A;  3CRL C;  4L8J A;  2WKD A;  1PFB A;  1LO5 D;  2BA1 A;  1D5X C;  4X3U A;  4LMQ D;  3D4R A;  2AUK A;  3T16 A;  5C0X H;  3M85 A;  3SK6 A;  4WOR A;  4RH6 A;  1SE3 A;  2EJG C;  3HG9 A;  2EY1 A;  3VYR A;  4A3G B;  4FF1 A;  5CMD A;  3QG1 A;  2E2I B;  1HFG A;  3R3O A;  5KGU A;  4X3K A;  3I90 A;  3HOX B;  1JWM D;  4ULL A;  1JOO A;  1FNU A;  1E2V A;  4XQJ A;  1NR4 A;  2NBF A;  1TQO A;  3IL8 A;  1CHP D;  1I6H B;  4HSP A;  2F3W A;  1SYB A;  1HCZ A;  1EYA A;  1GUW A;  4XYO A;  4OO1 H;  4H0L C;  3RZD B;  2EDG A;  1HTP A;  3VR6 A;  4PV1 C;  2EOT A;  1LAC A;  2AWN A;  4ZUI A;  5I6W A;  3UI2 A;  4RGN A;  4FNF A;  1H9S B;  3C1E A;  3FDT A;  1VDZ A;  4J1M A;  4QUC A;  1KAA A;  2JA6 B;  1EZ8 A;  1K83 B;  4DAV A;  1SMY C;  4K2K A;  3NWS A;  4FYD A;  1Y69 U;  2JYO A;  4BBS B;  1SMY D;  2BDO A;  1FD7 D;  2KJX A;  5A2Q L;  4OL7 A;  5COY A;  1WTP A;  1PZI D;  1OXS C;  3J7Y W;  2D2C C;  1ILP A;  3HP3 A;  3HZX A;  1SYC A;  1IYU A;  3MHB A;  1BUV T;  1ILQ A;  1CA5 A;  5FO9 B;  2R6G A;  1L0Y B;  1Q8I A;  2JXM B;  3J7A V;  1WTW A;  2RA4 A;  2M2L A;  2F0W A;  1EQT A;  3QB3 A;  3M3Y B;  1K8M A;  4ZKC B;  2IX3 A;  1EU4 A;  4R8I A;  3VA5 A;  1DOK A;  1WCM B;  3SVM A;  1FR3 A;  1RKN A;  5G3L F;  3TBI B;  1VCI A;  4BY7 B;  2NN6 I;  3BDO A;  5FO7 B;  3SK5 A;  2PYK A;  4RFB A;  1FNV A;  1EYD A;  1RDP D;  4DXG A;  3MEH A;  1EY7 A;  1TT2 A;  1LTI D;  3Q22 A;  4XT3 B;  2DY8 A;  1R4P B;  2EJF C;  4KN7 C;  3ERQ A;  1BCP B;  5C4H A;  4XYQ A;  5C0X G;  1GXD C;  1GUS A;  2F3V A;  2RVL A;  3S1M B;  5D3D A;  4RGT A;  4RCN A;  1K8O A;  2L4N A;  1EY0 A;  1SYD A;  2DN8 A;  1X32 A;  1I50 B;  3TZU A;  3V05 A;  1QOH A;  1CFM A;  2B63 B;  1TS4 A;  1KNE A;  3JAM E;  2NVY B;  4HCE A;  2B8G A;  3S1R B;  1PRT C;  2MGS A;  2PMZ B;  3MXP A;  4OO1 G;  1JC7 A;  1HRJ A;  4Z9C B;  1PRT D;  5M5Y B;  4PMC A;  4G57 A;  1O7Y A;  4HN7 A;  2F0Q A;  2F0E A;  3KF8 A;  3VYU A;  1CQV A;  3NWT A;  3URY A;  5E4X A;  1BXT A;  1EQV A;  2HUG A;  2WB1 B;  1ENF A;  2B2T A;  2CVR A;  5C0X J;  3TP5 A;  1STH A;  4BY1 B;  2F0D A;  3LWE A;  1EIG A;  2BE5 C;  1EY5 A;  5DAU A;  5BN3 A;  5EGT A;  2BE5 D;  2FJ2 A;  3ONA B;  3I70 A;  3FVQ A;  5KNB A;  2PPB C;  1QNK A;  1B4O A;  4XXE A;  2ICI A;  1TWF B;  1AFP A;  3W3A A;  5C6A A;  4FP5 D;  2A74 C;  3I8Z A;  4CJ0 B;  3KLS A;  3KLS X;  2HCI A;  2L1B A;  5C4X B;  3GTK B;  5I2Y A;  2H1E A;  1M8A A;  1QCB D;  3PUZ A;  1TS2 A;  4KY7 A;  4C1N K;  1A3T A;  4KKS A;  1A6X A;  1YNN C;  2ZXO A;  1YNN D;  1QG7 A;  3MXG A;  5KND A;  2VUM B;  3DWA A;  5IGE A;  4HED A;  2K28 A;  1VMP A;  1D5M C;  2LFN A;  2JA7 B;  4V0B A;  5EBC A;  1T5E A;  4WFN 3;  4FO2 A;  1LAB A;  1WD0 A;  2IJ0 A;  4NDX A;  1TR5 A;  1EU3 A;  3H91 A;  4HR7 B;  3TP6 A;  1QB5 D;  3PUV A;  3BVZ A;  5IGC A;  3EJI A;  5IGB A;  1S5B D;  2EYL A;  2E2H B;  1WTR A;  4LAA A;  2N55 A;  1D2B A;  2J4X A;  4ABN A;  2B2Y A;  3MVV A;  1ONL A;  1H9M A;  5D14 A;  2F0T A;  4C3I B;  1RJT A;  2TMP A;  4KD4 A;  3MXU A;  4PMW A;  5CBE E;  3BDC A;  1FGB D;  5EPK A;  3T13 A;  1XX8 A;  2F0S A;  5IGF A;  3CQZ B;  1H9J A;  3A56 A;  1XTC D;  1TS5 A;  3VYS A;  3P7J A;  2WII B;  3NPP A;  2B2W C;  3DWQ A;  2EY2 A;  3K58 A;  1STN A;  5DM7 3;  4KK7 A;  4WRD A;  3MC0 B;  2ZT9 C;  3EFX D;  1AN8 A;  1NR2 A;  3D4W A;  2NN6 H;  1SAP A;  4F87 A;  3C3L A;  1G29 1;  3OHX C;  2F0O A;  5ISR A;  3P20 A;  1NCV A;  2F0U A;  1U4P A;  2GA4 B;  5DNF A;  5ELE A;  2KEE A;  2D9U A;  3DUZ A;  1A2T A;  4A3M B;  2FFK B;  2LS0 1;  1F77 A;  4K5W A;  4BA2 I;  1CM9 A;  3S1N B;  4XQQ A;  4F88 A;  3S16 B;  3M4O B;  4A3E B;  4MN3 A;  3A7L A;  4QMG A;  4DXF A;  3D4D A;  3D3R A;  2ID0 A;  1EOT A;  5CV6 A;  1IYV A;  2Z1C A;  3QO2 A;  2ZXR A;  1STE A;  2OXP A;  4IUU A;  2Y0S B;  1PFN A;  4ZK9 B;  2WAC A;  2PO4 A;  5CYU A;  1GUG A;  1GHJ A;  1R9T B;  4DAY A;  3R93 A;  5KNC A;  3Q24 A;  1F2Y A;  4XTC S;  1WD1 A;  5TSS A;  1D5Z C;  1LT4 D;  4H7B A;  5J22 A;  1BBX C;  2HQE A;  3OIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...