1PRTF

The crystal structure of pertussis toxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
b'LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title The crystal structure of pertussis toxin.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Toxin
total genus 19
structure length 98
sequence length 98
chains with identical sequence L
ec nomenclature
pdb deposition date 1993-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09276 Pertus-S5-tox Pertussis toxin S5 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1prtF00
3URYA 1D5MC 5ELDA 3MC0B 1S5ED 4OHJA 3CHBD 1JWSD 1PRTF 1HQRD 2NTSA 1M4VA 1PTOF 1CK1A 1S5DD 4O1NA 1BCPC 1EFID 1I4RA 4TSSA 2RDHA 4DXGA 3O13A 1TS5A 4RFBA 1L0XB 4UDUC 1TY0A 3BYTB 1RDPD 5ELCA 2ICIA 1LT6D 1RD9D 1PZKD 3BVGA 1KLGD 1V1PA 1G8ZD 1LT3D 1QILA 4L63B 4K6LA 5ELEA 1LT5D 1DJRD 3TSSA 1FNVA 1KLUD 3SEBA 1HXYD 1D6EC 1EEID 1LO5D 1LLRD 1S5BD 1BCPB 1LT4D 1S5FD 1XXGA 1SBBB 2AQ3B 1FD7D 2IJ0A 4RH6A 5FK9C 2QILA 1D5XC 3OWEB 2CHBD 4RHRA 4Z9CB 1I4GA 1PZID 1JR0D 1PRTC 1KTKA 1SE3A 1F77A 1D5ZC 2AQ1B 2NTTA 2O2LD 2TSSA 1PRTD 2WV6D 3GP7A 4RGMA 1FNWA 2XRQD 1PZJD 3V05A 1LTSD 1PTOC 1GOZA 1FGBD 1PTOD 1BCPF 1UNSA 1JQYD 1JWUD 1SXTA 4BWGB 4ZYSA 1ESFA 5D3IB 3DWPA 3R8BA 1BXTA 1MD2D 2Z8LA 1DYQA 1I4QA 1TS2A 1RCVD 1STEA 1SE4A 1ENFA 2IPKD 3BVMA 1EEFD 1FNUA 1PRTB 5FKAC 1HTLD 1ET9A 1LTGD 1LTID 1PYWD 1AW7A 1V1OA 1PTOB 3R2IA 3KLSX 2XNAC 1CHPD 1I4PA 5D3DA 1EU4A 1PTOH 3MFGA 1CQVA 1TS3A 2SEBD 1EU3A 1T5XD 2J4XA 5ELBA 2XN9C 1S5CD 3BYYB 1L0YB 1UUPA 4RGOS 2XRSD 1LTTD 3EFXD 4RGNA 1I4XA 3DWQA 3EA6A 3BVZA 1AN8A 1CT1D 1TS4A 1SJHD 1LTAD 5ELFA 4C56C 1ET6A 3R2TA 2QEJC 4RHSA 1CHQD 3DWAA 5I4DA 4L6TB 1I4HA 1LTBD 1RF2D 1BCPD 4RGTA 1XTCD 1B44D 1SJED 1TY2A 1V1PB 2G9HD 4DXFA 4RCOA 5TSSA 1EWCA 1HA5A 1JWMD 3W2DA 2R61A 1SE2A 2AQ2B 3BZDB 1JCKB 1B1ZA 1SEBD 1LTRD 2RDGA
chains in the Genus database with same CATH superfamily
5C4JH 4HJ8A 2XGTA 4K5WA 3LWEA 1HQRD 4JI4Q 4FXGC 4A3IG 1OXVA 4A3DG 3D8GA 3DM3A 3PO3H 2Y0SE 2BH2A 2L5TA 2OTJA 2LSSA 1W6KA 3HOXB 4LFAL 4PV1C 2QDBA 4UDUC 4DAMA 1OXSC 3DLLA 1QUQA 5ELCA 1L0WA 1UWVA 4DV7Q 1RD9D 1PZKD 5KIXA 2UUCQ 4OWTB 1I6HH 1C0AA 5ELEA 2PQAB 4JPBW 2B63G 2NWGA 4ME5A 1KLUD 3J80E 2L15A 4QMGA 4JBWA 3S14B 4QIWE 4R9WA 2K01A 2A6EC 4DGZA 3S17H 2F0NA 1RL2A 4LF8L 3S16H 1QE6A 1A63A 4ODGA 4DF7A 4FDBA 2F0UA 2K75A 1HNWL 1C7YA 2FFKB 2PO4A 3OWEB 2V1CC 2KCNA 1SYFA 2X6LA 2DGYA 2EYHA 4N9TA 3A8JE 4MN3A 1SNMA 3T1HQ 2F52A 2EJFC 3VYUA 1K3RA 4UAIA 3K5LA 2ZJRA 1AH9A 1OXXK 3RLFA 2CVRA 2L4NA 1ESFA 2NZOA 5KNCA 4JI6L 2KCCA 2VXWA 2AMCB 3J7AV 1B7YB 4QF4A 1XMQQ 4V190 3T16A 1VQIA 4RKLA 3L9AX 5C4HA 1RHPA 1IXRA 1PRTB 4Q5VA 4DR1L 4ALPA 2EDGA 4IUPA 1YBYA 4KLKA 4QUFA 4JI7L 1Q3LA 5FLMG 1FGUA 3MZ5A 2CH4W 4GLXA 1J8IA 3TS0A 3I91A 1CHQD 1Y69U 5ELOA 3F2CA 4L8JA 4QUCA 4PZ6A 4HCEA 4BY1H 3NQIA 2R93G 3TP7A 2PYKA 4FNFA 4DXFA 4ZCKA 1GD7A 1CQFA 1UE1A 2CWPA 2D2CC 4RWSC 1Z47A 1XMOQ 2YU9B 3BZDB 1EFWA 1H9RA 4RKBA 5C4XH 1K3BC 2IL8A 5J1ZA 3IFDA 5M3MG 2NTSA 4X3TA 1TR5A 1XJVA 2JA6B 3UE0A 1ICFB 3KDFB 5C4ZA 3KDFA 2KHSA 2E2HB 4PG3A 1X3QA 4A3FB 4GKKL 3I4MH 1JJGA 3MXNA 5EBDA 2IX3A 2ALYB 2VUMH 3W5OA 4LF7Q 5DLQE 4MNOA 3J80L 2DNCA 3SDZA 1SNQA 4LAAA 2KA7A 1QZHA 3S2HB 1MGSA 5CV5A 1IBKQ 1CSPA 3M3YB 1BR9A 4IJHA 1I3QB 5KNBA 4FXKC 1IBMQ 5J3BA 3U58A 5IY0A 3BS1A 4JBKA 1IL8A 2N88A 2FXQA 3KJPA 2IX0A 5J22A 4OO1I 3BDLA 1JOKA 1VQBA 2Z9HA 2PNHA 5A2QL 2K14A 3RZDB 3KLWA 1KL9A 5KNDA 3K0XA 2OQKA 5CC4A 1JWUD 4C3HB 4DUZQ 2J7ZA 1HRJA 4OO1G 1JE5A 2BCOA 5FJ8G 2O5IC 3FKIG 4LF8Q 3U50C 2JJQA 3S9WA 4DR4Q 1VQDA 1XNQL 3M4PA 1X32A 3OWFA 5AFWA 1U0LA 2CH4A 2L9HA 2EY6A 3J7AF 1GUWA 1B50A 4LFCL 1YITA 2EVBA 3RD4A 4G7ZC 3FEWX 1EL0A 2K52A 3G71A 4F8MA 3CCSA 4A3IB 4A3DB 2A1AA 2A68D 1WTXA 3RNUA 2SNSA 4U673 4UP8A 3GDEA 4EVOA 1G51A 1RKNA 3OW2A 1VF7A 1B2TA 5E7NA 3HOYG 1SNOA 4OXPA 2B63B 4XDXA 3SGIA 3NHHA 3D0FA 3G6EA 3HOXH 4HEDA 1WJJA 3SR1A 2G5DA 4LK1C 3W2DA 1K8AC 5JEAH 1U9RA 3KF8B 1I50B 3QR8A 1HJPA 1NR2A 1A2UA 3AB9A 5ELDA 4KJOA 5CV8A 5C0XI 1NCVA 3S1MH 3S14H 3HEJA 4ZKCB 2E2JH 2IX1A 4DR2Q 2OEOA 1ENCA 1G6PA 1SRUA 4NMZA 1OTCA 5IGBA 4UP7A 4C3IG 1Y1VG 2RDHA 1VQOA 2IHFA 4XYQA 4A3BG 2MQHA 5C0XG 1PXUA 3BVGA 2EXZA 3MFYA 3A8IE 4IJLA 3TSSA 2EYOA 1DD2A 2HCCA 4Y7NB 2SDFA 5CORA 4QL5A 4O0AA 3GTLB 3MXPA 3PF5A 5HURA 3DEPA 1G291 5FK9C 1FD7D 1MI2A 5IOCA 2PMZE 2UUAQ 1KD1C 2ZT9C 3K80C 2C5CA 1V1QA 5H1SE 2K5DA 1SE3A 2PI2A 4PNYA 2XRQD 3K58A 1LTSD 1ML0D 2EPBA 3MVVA 5FLXE 1JQYD 4GN3B 3KLSA 5I6YA 5IYBH 1PH6A 3N52A 4EQPA 1PH2A 2V4DA 3I3CA 4HJ7A 2R93B 3L7ZC 2JYOA 2R7ZG 5LMNW 4H7BA 3I4LA 4ULLA 2K33A 1E3PA 1WOCA 2UUBL 1GUNA 2XNAC 3PO2H 2I07B 4NXNL 3QIAA 1TXYA 2KBNA 4LF5L 1F2ZA 5KYIA 2YU9H 5M3MB 4IOAA 2R6GA 2YTYA 1YJWA 1UEAB 4JYAL 3MTSA 4MHEA 3C2PA 3NELA 2R92G 3VDYA 1NJIC 3VR6A 2XIWA 2JA6H 5EPLA 3NXWA 4AIMA 3T13A 3VYSA 2SOBA 1HNXL 1FL0A 2E2HH 1XNQQ 2KCMA 1EWCA 4FF3A 2JE6I 4CGYB 2Z6KC 3BDOA 4R8IA 3K81C 4DV4Q 2JN4A 3UI2A 1S5ED 1L1OC 3NUCA 3H0GH 3CQZB 1IZ6A 3S2HH 5EKIA 4CKEA 3M3YH 3J7A5 2WB1G 1DOMA 1I3QH 2UXBL 1EFID 4ME3A 2WACA 4K5VA 4JI2L 3C1FA 3GV3A 3M7GA 3E6ZX 3EIVA 3TP5A 1KDCA 4K0KQ 4IURA 1IW7C 1TU2B 3FKIB 1Q46A 1KIXA 4KK7A 1ZYRC 1LLRD 5IYCH 1OXUA 2FHTA 1B4OA 1DM0B 3FPPA 1AEXA 5M3FG 1ZKOA 2Z6KA 3JC66 4X64L 2VB2X 3UDIA 4V0BA 1EY0A 1TKWB 3K7AB 5FO8B 1XNRQ 1TWGB 2ZTDA 1L1OA 4C3JH 4XQQA 1IYVA 2LMCB 4FF1A 4IOCA 3TDQA 4A3DH 4B3TL 5C44G 3PQIA 3HOYB 4YWMA 4DR5L 3LX0A 1EEFD 2JA8H 3EQLC 3T51B 4WORA 5LL6S 2JA7G 4GNXC 3HOUG 1O80A 1QWYA 1PH3A 2ZTCA 4DAYB 5KGUA 1PV4A 3J81i 1NUCA 1SMYD 2ZJQA 2WB1E 1I50H 3QWNA 2NB0A 4AYBE 1CT1D 4C3IB 1QCBD 1E22A 5E1FA 4A3BB 4IFDI 2XSCA 3F2BA 1B44D 3VR2A 2ZM6L 2F0GA 2VQFL 1EQVA 2IHEA 2UUBQ 1I94L 2E5LL 5DM63 3PUXA 4C2MB 1PVOA 2WP8J 1MSGA 4IFDG 1B1ZA 3CCUA 5CGKA 2NVXH 5GAHC 5IP9G 3HKZG 1JE4A 3GTLH 4JI5L 2DUDA 3U4VA 2GVAA 5M5YB 3AU7A 4BY7G 2YV5A 4OELB 5ELNA 1U4RA 5GADC 4GNXA 5KYLA 1HR0L 2XTIA 1GM5A 3U9OA 1NBWA 4A93G 3PUWA 2KOLA 4C1NI 5M9OA 3AEVA 3IRBA 2DY8A 2PPBC 3C3LA 1P16A 1Q1BA 5DM73 3ER0A 3BZCA 2R7ZB 3A0JA 1BCPB 2K05A 1CKMA 4KD3A 2AQ3B 2WKCA 2J0TD 2DJFC 3A7AB 4HIMA 2R93H 1LYLA 3I4NG 4OIJA 5BR8L 3M4OB 1HZCA 1TWCB 1STAA 3D4WA 4POGA 2RCNA 2A73B 3L2PA 4JI2Q 4XXEA 1N33L 3RLOA 3WDNA 5GQOA 5CYUA 4K14A 2R92B 5M3MH 4GOPA 2MUYA 4X3SA 4A3MG 2ZTEA 2QDLA 1SLJA 1TWFB 3IAYA 3PGZA 3BVMA 1FNUA 3EVQA 1LTID 1B9NA 3F2UA 3KLSX 4A3CG 3KOJA 2BH8A 1YHQA 3MAQA 2NVYH 3HKZE 4WJ4A 4KD4A 3S1QB 1D1KA 1HTPA 2Y0SG 1STYA 5EQ0A 3CCEA 4F87A 2K6AA 3H91A 4NXMQ 4DR3L 1GO3E 1YIJA 2HQEA 3WWVA 5EPJA 3K8AA 4KTAA 1WD0A 4DV3Q 1A15A 4B3TQ 2EE1A 1FR3A 4KKSA 4B3RQ 1DOKA 5CV6A 3NWSA 1H9KA 1MJCA 4BA1I 2G9HD 1XPOA 2B2TC 3DUZA 2UXDQ 5M5WH 1YNJC 1NSNS 4RMFA 3D6CA 4OO1H 1NR4A 1Z7TA 2RKSA 5FJ8H 2KVMA 3JAMc 4KMUC 2KHJA 3FKIH 4KHVA 1EY5A 4A3GB 4GKJL 4IPDA 3M9BA 5K36G 5D65A 5M3FB 2X6GA 4KN4C 1H9JA 4DUYL 3I90A 3CC4A 4DV5Q 4KJNA 1V1PA 1PH8A 3TZUA 3Q24A 3BJUA 3QO2A 1IHZA 3R3OA 3VYRA 1I94Q 2F1MA 2M2LA 1Q8KA 5J39A 4A3JG 5C44B 1TWGH 1QVFA 4L5SA 1EEID 2A6ED 1S5BD 3QJYA 4N8X1 3GD7A 1XXGA 3FPUB 4RG1A 2JA7B 3I55A 1C8CA 1XX8A 1CSQA 3HOYH 4JI0L 2VS1A 2A69C 4RHRA 4Z9CB 1EYGA 1C48A 4X66L 1PFSA 1PRTC 1HR0Q 2WV6D 3GP7A 4DK1A 2K28A 2ASBA 2K32A 2PQAA 4HR7B 5JPMC 2QA4A 3E9HA 2VY3A 4ZYSA 5EKLA 3K57A 1JORA 4DV0L 1D7QA 4R1JA 1FJGQ 4C3IH 4JI8Q 2LFNA 3BZKA 1SYEA 1U5KA 4A3BH 5C0XH 1PLFA 1E2VA 3EN2A 1PTOB 3HOZB 3GTOB 2CQOA 4DPGA 2HCIA 2K5HA 3K5OA 3C46A 5BR8Q 1C4QA 1EU4A 4A3LG 3OTOL 5A2QE 4HSVA 2EOTA 3I56A 3HKZB 2D0PA 4DK0A 4C2MH 3RMHA 2JQOA 5T1IA 1S72A 4K8JA 1KDAA 1PYSB 4OX9Q 1EIYB 4BY7B 3CCMA 1I4XA 1HH2P 2HHHL 2MO0A 4IFDJ 1IYJB 2NN6I 1II3A 1I4HA 4P73A 2JEAI 4RGTA 1GUTA 1XTCD 2HQLA 3GTPB 4X65L 1X9NA 2OWOA 2LXKA 1PH4A 4YCWA 1WCMG 1R9TH 4CDEC 3M7NA 4P75A 3PIP3 2BOSA 1JCKB 2NN6G 4WRDA 3T56B 2QEXA 1L2FA 3CC2A 4BBRH 2AHOB 5CV7A 4R4TA 2NZHA 4ZAIA 2R7ZH 1V43A 3S1NB 4LMQD 1F2LA 4K5XA 4JI1L 3X3NA 1EY6A 2H4OA 4B9WA 1SYDA 2KHIA 2Q8IB 1L0XB 1S40A 3NWTA 4XYOA 3M4OH 1TWCH 2EIFA 2VZAA 2NBFA 4K6LA 3J80i 1BDOA 2LXJA 4TRDA 4A3MB 1ILQA 2YYZA 4ZLTF 1X3EA 1FYCA 2R92H 2G9DA 5IGFA 2KCTA 2EQSA 2LKVA 2B2YC 5FO9B 1SROA 2Y0SB 1PZID 4JG2A 1F77A 2HDLA 1BVSA 1SE8A 3H6MA 5IWAL 1FNWA 1BBUA 4GLAC 1GOZA 2JA5G 3S1QH 1BCPF 5JJZA 5IGDA 3DHQA 2CCZA 2UU9L 1TWAB 1XPUA 2A6HC 3NK9A 3H15A 1BXTA 1B9MA 1QNUA 4JI3L 4H13C 4DR7L 4QIWB 1I6VC 4HMIA 2IPKD 3BDCA 3D31A 2Z4IA 5FKAC 3E0EA 4G7OC 1A0IA 2NVTH 4WJ3M 5C5LA 2AUKA 3R2IA 2F4VL 4LFAQ 2DN8A 3V96A 1CKOA 3T1YL 1Q8IA 1PH9A 1E0BA 1VQHA 4QJFA 2E2IB 4RGOS 1OXTA 2B3GA 3RZOB 3TRZA 1TQOA 4J6HA 1IBLL 1E2WA 3GTQB 1LTAD 2A19A 4LFBL 4NP5A 4A3GH 2B2YA 3R2TA 4TVAB 3X3MA 4BXXG 1UE5A 2E75C 4HIKA 4OWWB 2F0JA 4DU9A 4F7XA 1HNWQ 1XYIA 1A6XA 1Y8NB 3PSIA 1Y1WH 4A3JB 3KUPA 2XVSA 3LGJA 2OQ0A 4LF4L 2C9OA 3I72A 3HGBA 3OTOQ 2D5DA 2IY5B 2EY2A 3G4SA 1SEBD 5DEHA 5CBEE 2B8FA 5JPNC 3HOVG 3J7ZC 5C44H 3A5ZB 5I2YA 1SFOH 4JI6Q 2ID0A 1PHJA 1DOLA 3HZXA 4LUVA 2N55A 3D4DA 1I4RA 2O5JC 1RJTA 4DR1Q 1UEBA 3NTIA 5BN3A 2P5ZX 1DJRD 1UE7A 1FNVA 1Q12A 2H5XA 3KF6B 3KF8A 1D6EC 1CM9A 2B8GA 3VR3A 4JI7Q 2MPMA 4KI0A 1EWIA 4FO2A 2M9VA 4IPCA 2F0WA 2IJ0A 4A75A 3WOFA 4HJ9A 1F9PA 4R4OA 1EIHA 1LTLA 3NBHB 2VQEL 2BE5C 5LMUL 2EXDA 2Z4HA 4R8NA 3JAME 1SNDA 4DK3C 5EJWA 2F4IA 2NTTA 4IUTA 3HOZH 2QF7A 3GTOH 4O42A 1EZ8A 1FGBD 1MIUA 1Q1EA 1UNSA 2HUGA 5IP9H 1SYBA 1HZAA 3FMCA 1EIFA 1GHJA 4CDDC 4HMJA 3S2DB 1CA6A 3AFPA 1KAAA 1WCMB 4YHHL 1V1OA 3ZYYX 4G4KA 2LY7A 5E3FA 3GTPH 4GKKQ 2F3WA 1LUZA 2B2UC 2SEBD 5JAVA 4A3EG 2J4XA 3J81j 4JK1C 2B29A 2I46A 1K83B 1XWEA 1SNCA 3TS2A 4CHTB 1HFNA 1QVCA 4DV1L 4JC0A 2UU9Q 2E8GA 2FMCA 1VQEA 1TS4A 3TREA 5AJ3L 1YNNC 3OYYA 2R7FA 1TIID 4JI3Q 4CKBA 4HSPA 4L6TB 1EY4A 3S1NH 3NP8A 4L5RC 1B8AA 1H95A 1EOVA 2CWAA 3F1ZA 4RCOA 2F0HA 3G7LA 1MSHA 3KBXA 4KY6A 3FRPB 4DFAA 4DAVA 2ATWA 1TT2A 3D6WA 4A3MH 4UY8C 2RBMA 1BF4A 4JV5L 5FOBB 3CHBD 1H9MA 2EJGC 1PRTF 1H9SB 1BBWA 1N36L 4GN5A 5L37A 4NPSA 1IBLQ 1S5DD 2BA0A 4O1NA 2FJ2A 5EGTA 4RFBA 2B2UA 2JA5B 2ICIA 1QB5D 3MA2B 3M85A 4A3FH 2FINB 3UE1A 4KHPL 2I5HA 5CV9A 1GHKA 1O7IA 3SEBA 1IW7D 4LF4Q 1VQ5A 4LFCQ 1N8RC 2HT1A 1E2ZA 1FVIA 2K7VA 1AP0A 5C4XG 1TWAH 3PUVA 1ZYRD 1LABA 1VCIA 5CMDA 4R4CA 2H1EA 1YI2A 3CCVA 4EGVA 1WTVA 1A3TA 4DV2L 2N49A 3K5MA 4A3KG 4AYBG 1QOHA 1BNZA 3I4MG 4JOIC 3JAML 2I5MX 5C6AA 4EQOA 2VUMG 3CAMA 3ULPA 3RZDH 2HDMA 1HCZA 4X62L 3N6RA 3P20A 5CV4A 3VA5A 1B53A 5IODA 2E2IH 3R93A 5K36H 1MD2D 4I7AA 2ZXRA 4C3HH 1HR0W 1ZEQX 2RQXA 2F0TA 1E1OA 1SE4A 2ENBA 3TMEA 3SK6A 2Q2TA 3I4OA 1MHWC 4DR6L 5C5MA 3PUZA 2F3IA 2PMZB 2EY1A 1A62A 2F0PA 5LMUQ 1VS0A 4A76A 3PCOB 3MFGA 3HOVB 4B3ML 1N9WA 1EYAA 1KXLA 4YY3L 1UUPA 3W3AA 1STNA 1UE6A 3UDGA 2CKZB 2PQEA 4JBJA 3K59A 4LF9L 4J8QA 4A3IH 4C56C 4CDCC 2PCFB 3DWAA 4YCUA 4IUNA 2BDNA 4G57A 2JEBI 2F0MA 3QB3A 1BCPD 4JOIA 2IWHA 4DV6L 3CPFA 3HOWG 1B70B 5M5XB 3TP8A 2AUJD 2B63H 5LMNL 1K8MA 5ISRA 1PH5A 1LM0A 4DAYA 5GAGC 1F2YA 1VQKA 1X3FA 1EWHA 4RCNA 5I2XA 1KNAA 3HFZB 5C4JB 4CDFC 4Q0FA 2AWOA 5IT9c 1NAPA 3CC7A 3URYA 1D5MC 1X54A 2B2WC 5IP7G 1B3AA 1JWSD 4M1UB 1M8AA 1Y1VB 1DONA 4R4IA 5JJKA 3WOEA 3H94A 3OW7A 1RTOA 4ABNA 3W1GA 1BCPC 3ZJYC 1I6HB 4L5TA 3OMGA 4A3LH 3D4RA 3E3XA 3HOXG 2I5LX 3STBC 3H3VI 4DN4M 2HD3A 4NXNQ 5JEAG 4QGUA 3S16B 4E6IA 2R3ZA 1EQRA 4LF5Q 1LO5D 1WTQA 4PZ8A 1STBA 4Y7NH 1SYCA 4QY7A 4R4QA 3S2DH 5C3EG 4AQYL 4JYAQ 1E7ZA 5CR3A 4WFN3 1K0SA 4A3EB 3AYHB 3CCLA 1UAPA 2K5QA 5HY6A 3KLRA 4P72A 1JOOA 4WJWA 4XIGS 4CBVA 2VB3X 2NN6H 1Y8OB 4XT3B 1HNXQ 2I0QA 1U4MA 3P75A 2B2WA 1HNZL 5FLMH 5NUCA 4B08A 1K83H 4ZUJA 4KKUA 1EYDA 4JI4L 1ASYA 1JJCB 3S15B 2F03A 3ND8A 2MNAA 3G48A 1GUOA 1ENFA 2K4KA 1KHIA 4RA8A 4O2DA 4DV7L 3VYTA 1C9OA 2WKDA 2UUCL 3MEFA 4POFA 3TN2A 5I9OA 2L0CA 2UXBQ 4MTKA 1NE3A 1I4PA 4DV2Q 1CFMA 2M00A 1EU3A 1T5XD 5CBAE 4LJZC 2MP1A 3NBIA 3K5NA 1ICWA 2K50A 2Z6BA 2K04A 3GV6A 3QOLA 4P71A 2B39A 5KEEA 1SJHD 5HGTA 1F9QA 2EY5A 4ZRZA 1HZBA 3A56A 5I4DA 3T1HL 2K5WA 1YVCA 2C35B 3CCQA 3MXUA 4ZQ3A 2JA5H 1HHVA 3PO2G 2RCFA 1CA5A 1HA5A 4KHZA 1EQTA 5E4WC 2R61A 1SE2A 3HRZC 5C4XB 4X64Q 1YNJD 2QW7A 2E74C 2MHVA 4OHJA 4G7HC 1J9OA 2AKWB 2WB1B 2HIXA 4NKLA 4A3KB 3CQZH 4AYBB 3I4MB 1RIPA 4DR5Q 3VR5A 2VUMB 5G3LF 1RDPD 5BN5A 1WVLA 3F8TA 1X3PA 2CW0C 1M1KC 4LNQA 4DAPA 5LMNQ 2BA1A 1ONLA 4OONA 1HXYD 1PH1A 1E24A 1S3OA 3NTKA 2EYJA 1X65A 2Z1CA 3H0GG 4BXXH 1YJNA 3NENA 1YHBA 3SK5A 3E0JA 5C3XA 2EJMA 3UDXA 3CRLC 2A69D 1Q86C 2ZJPA 1X55A 1A3UA 1XMOL 1G91A 1O7ZA 4ID6A 4TQUS 1PRTD 3V05A 2ZM6Q 1YNXA 2VQFQ 2Z0SA 1PTOC 4MIUA 1YHAA 3A55A 3CD6A 1IKMA 4NW2A 2E5LQ 3HOVH 3K0YA 3MEHA 3K7AH 4PZ7A 3EROA 2HIVA 2YTVA 5IYCG 2TMPA 5HGQA 3HOWB 4JI5Q 3HOUB 1KRSA 2JXMB 2K5NA 1CUKA 2B2TA 2PNRC 1X3GA 2OTLA 4UPAA 1Y8PB 3PIPA 1D8LA 3K6OA 4L5QA 4FF4A 2L12A 1IBKL 4MTNA 4M8AA 4C3JG 4GZYC 1HNZQ 5JJIA 1IBML 3EFXD 4RGNA 2NZ1D 3KK7A 1IKLA 3RR5A 1O7YA 1SMXA 5FLXc 1SR3A 4RHSA 2QEJC 1MBYA 3I8ZA 5LHY1 1HA6A 2KEEA 3PIOA 1Y1VH 1LTBD 2JA8G 1EZ6A 1NY4A 5LL6X 1QUQB 2F0OA 1TY2A 1ESRA 2D62A 4LF6L 4ZUIA 1AZQA 4DUZL 2N3SA 3S1MB 2OF1A 1WFQA 4QB4A 1N33Q 2E2JB 2QGQA 4PQXA 2CQAA 5COYA 5C3EB 1F9SA 1OO9B 3Q0AA 4DR4L 4FYDA 5JEAJ 1EY9A 1Z9FA 2K5VA 3KBGA 2Q8TA 5M5YH 4TSSA 3IFTA 1TS5A 1DXMA 4A93B 2RHSB 1AFPA 4A3EH 1JICA 1RTNA 1K73C 4L63B 3GTJB 2X69A 4OWXB 2RSNA 1VQCA 2EYFA 5D14A 5T1GA 1SN8A 3F2DA 4BBSG 2Q2IA 1Z6HA 4IPGA 3S15H 1LT4D 1MKHA 1EOTA 4DR3Q 2E76C 1X56A 4RH6A 3I4NB 3J81c 1Q90A 2D0OA 3NSWA 5IGGA 1JT8A 4HAEA 3PIO3 1O78A 4YWLA 5IT9E 1JR0D 3HS0C 1U4PA 4I7ZC 2AQ1B 2F0DA 1NTGA 4APVA 1VQ9A 2KUMA 4CJ1B 2RVLA 4DR2L 3L3OC 3D3RA 2A6HD 2IW3A 3AQQA 1TS2A 2F0EA 1IYUA 4CJ2C 1STEA 1MJEA 4GKJQ 3SE0A 3CMAA 1TWFH 3PO2B 3GTGB 1PYWD 1YZ6A 4K6DA 1HQMC 2SNMA 2A5HA 3VR4A 4DUYQ 1CHPD 3Q22A 3LWUA 2EYMA 4DK6C 2KJXA 2OXPA 4H02A 3KJOA 2F0SA 3H09A 2KQ3A 3ULJA 3A5UA 3CPWA 1AN8A 1I5FA 3OPOA 1J5EL 2R7DA 1KQSA 5ELFA 2UUAL 4OIKA 1CI3M 3K7UC 4A3KH 2OT2A 4I65A 1KABA 3MXNB 1SJED 4JI0Q 1KNEA 4LUZA 2GN5A 3KFUA 4ZK9B 3FDTA 4X66Q 4EQNA 2ICEC 1EIGA 1DGSA 1G2SA 5IGEA 4IUVA 3H0GB 2Q2HA 4HJ5A 3MC0B 5IGCA 1P8LA 2F0QA 1Y14B 2D9UA 4GLVB 1E1TA 3GTKB 1ZXTA 2RHQB 4B3SL 4LUOA 2F0FA 4JVZA 2PI2E 4DV0Q 5M3FH 4J1MA 3LNNA 3O13A 3OIPA 1S4ZA 3GO5A 3T4AC 3FVQA 1LT6D 3S24A 3BU2A 1KLGD 1WTPA 3CRKC 4K8IA 1LT3D 4LF6Q 3OSOA 1HPCA 1KRTA 1JJ2A 4PMWA 1VDZA 1BOSA 2ZXOA 1DZ1A 4N9PA 4UP9A 2HHHQ 1D5XC 3HOWH 2JA7H 3MWYW 1VQNA 1STHA 1VQJA 5IT9L 3HOUH 2BE5D 4TKOB 2O2LD 4C3JB 1PZJD 4DV4L 4X65Q 5IYDG 1V9PA 2JP1A 3KF6A 4J15A 5IP7H 3U9SA 1O7LA 3DWPA 5G3LD 3CKIB 1VQ4A 2NVQB 3ULLA 2JA8B 3CCJA 1RCVD 1QJOA 2L1BA 4ILWA 4RAUC 1CZWA 1K8OA 1HTLD 3PO3G 1ET9A 3I73A 5DNFA 1AW7A 1TWHB 2OCEA 1NMGA 3NBHA 4YCVA 2RF4A 3RLNA 3U4ZA 4JI1Q 4K0KL 2Q8RE 1QNKA 4H0LC 3OMCA 1KDBA 1PTOH 1CQVA 3Q8DA 2E2DC 1S5CD 4IFDH 2PZTA 1U4LA 3NEMA 1N32L 2A68C 3EA6A 3BVZA 3H3VH 5C3EH 1LV9A 5E4XA 4BY7H 1ET6A 1YNND 4JW0A 1EY8A 3GTMB 4KY5A 2F0VA 2N8NA 1RF2D 1GUGA 1XNRL 4A93H 1RODA 3I2ZA 5TSSA 2ZXPA 1EUJA 2NVXB 5KRUA 3I70A 2AQ2B 4BBSB 1KAWA 3GTJH 5IWAQ 1HUMA 4UHVA 3MXGA 1LTRD 3TQYA 1K9MC 3P7JA 4KV6A 2EZVA 3S1RB 1VQ6A 4DNRB 1BUVT 4HJAA 1M4VA 1Q81C 4JBMA 1ASZA 1J5EQ 1PTOF 3I4NH 1PH7A 4DR7Q 3FHWA 4DXGA 4XTCS 2IT1A 1VQLA 1BQQT 3I7FA 3TZDA 2F4VQ 3CCRA 1HZ9A 4BS9A 3PV0A 3T1YQ 4DNTB 3HP3A 4BBRG 2A74C 3TBIB 1VQGA 4X6AH 1H9SA 3E5SA 3MHBA 4LFBQ 1VQMA 3M4YA 2F0KA 1D1IA 2RSOA 2CHBD 1QZGA 4B3SQ 3IL8A 4JCVE 1I4GA 3C1EA 4A3CH 4K2LA 4U68A 4OL7A 3JAMi 3GTGH 4BY1G 2Q2UA 4RGMA 3CXCA 1T5EA 2MJ8A 3NQTA 2PW7A 1SXTA 2DY7A 4BWGB 5IE8A 5D3IB 3ITPA 5F2DA 3Q6SA 4OEMB 4IN3A 1DYQA 1I4QA 3SHLA 3HKSA 2UXCL 3CU7A 3ICEA 4Y52H 4PMCA 4EQ5A 1WI5A 4K2KA 5GAEC 2NVYB 1A3VA 1HFGA 2GA4B 1SSOA 2MO1A 4H44C 4XQNA 4QQBX 2WAQG 2L11A 3J81E 3PUYA 1EQQA 5I9PA 1N34L 1WTHA 2XRSD 2KECA 4FF2A 3KYHC 1CTMA 1NNXA 3SVMA 3RZOH 2B2VC 3J80c 2XWJB 3GTQH 2QCPX 3GTKH 3RUZA 1JMCA 2F0LA 5A35A 4YIJA 1AE2A 2L55A 1WTOA 4IALA 1G6ZA 1A8VA 5M5WB 5EAYA 1JB3A 2VQEQ 1STGA 2KENA 1XPRA 1VMCA 1X6OA 4A3JH 1GVPA 2F0IA 4HIOA 1D2BA 1GUSA 4XQJA 2BDOA 1N32Q 4B9XA 4HTHA 4CKCA 4A3GG 1T9HA 3QOJA 1WTWA 5I6WA 1GJXA 3L0OA 1AE3A 1SDFA 5GROA 1TY0A 4DNIA 1DCZA 1W2BA 5JJLA 4YHHQ 3BG3A 1YJ9A 1Y1WG 1G8ZD 1QILA 3EBEA 2JA9A 3STBD 4NXML 5FLXL 1PMRA 1L1OB 4AH6A 2NYZD 1EYCA 1IL2A 1PYBA 5JOBA 5IIFA 2B2VA 4DV3L 3A74A 3W1BA 2NVQH 1SNPA 3PO3B 4B3RL 3OHXC 2KEDA 3M4QA 4DV1Q 1VQ8A 4HIDA 3IKJA 2WAQE 5AJ3Q 1VQ7A 2XWBB 4HN7A 1B3QA 4MZ9A 3B6YA 2NUCA 2UXDL 1K8GA 4CJ0B 2RDFA 1SAPA 1D5ZC 1TWHH 2TSSA 3CMEA 1A2TA 3NTHA 3CF5A 2WFWA 4XT1B 3SK8A 5C3WA 2LS01 3S17B 2VW9A 3R8BA 4X3UA 2Z8LA 4FVMA 2WINB 3AMUA 3CW2C 1KC8C 4JV5Q 4BA2I 4DV5L 5FO7B 5BN4A 1WTRA 2DNEA 1HUNA 1N36Q 1VQAA 3ND9A 3TEHB 4DKAC 1LTGD 1VMPA 4KY7A 3GTMH 1LACA 2VNUD 1WCMH 2FMMA 3PMFA 5D3DA 3ERSX 3HOZG 1SMYC 4DA2A 4P74A 4KHPQ 3J81L 5C0XJ 1Q7YC 4BBSH 3V2TA 2CFMA 4IO9A 3A7LA 1V8QA 3DWQA 3E9IA 3OIQA 3S1RH 4GOPC 2QKIC 3RN5A 2EYLA 2WIIB 4GNXB 1F2MA 5DAUA 4PMBA 2UXCQ 1PFNA 4GS3A 2DJGC 1F9RA 1R9TB 2RA4A 2K03A 2EYPA 3QG1A 4NDXA 4OGQC 1VF5C 4IZ8A 4GN4B 1VQFA 1R4PB 4S3SA 3FP9A 4IUUA 1K0RA 4BBRB 2GVBA 1KTKA 1BKBA 3NE5B 1FJGL 1N34Q 5IYBG 2O4XA 4JI8L 4X62Q 3HG9A 3SK4A 1W6JA 3DXJC 1CK1A 4BY1B 2F3VA 3RN2A 3DEOA 3SXHA 4QCLA 3OOCA 3EJIA 5JVH3 3BYTB 4A4IA 1BO0A 3A54A 4ZKBB 4DR6Q 1LT5D 4NB3A 2CW0D 3G6JB 4F88A 1QG7A 3Q23A 4OX9L 4B3MQ 4GOPB 3DM1A 4YY3Q 1XMQL 1PA6A 1ENAA 3A8KE 4HCSA 1S5FD 3ERQA 1SBBB 3DMUA 4IPHA 5EKKA 5JVG3 2K1BA 4LW1A 2N78A 2QILA 4LF9Q 4LWCA 4FXDA 1VQPA 2WAQB 2JA6G 3PF4A 4X3KA 4DV6Q 1PDQA 1BBXC 1GKHA 3NPPA 3ONAB 4A3FG 5EBCA 1PTOD 2JK8A 1WYDA 2JSOA 2AWNA 5EPKA 4KN7C 1PFMA 1R4QB 1W3SA 1WD1A 1K28A 2NVTB 4IQZA 3J7YW 4C1NK 2MGSA 3UDFA 3VA7A 1JB7A 4IUQA 4KKTA 1JC7A 1GXDC 3GQBA 1TS3A 1XTDA 5ELBA 2XN9C 2MFIA 3BYYB 1Q82C 1L0YB 3AFQA 2PZWA 4N8FA 4P2CB 3CP0A 1PFBA 1LTTD 3P1HA 4EX5A 1AZPA 1G2TA 1JOQA 2YTXA 5K5PA 4C3HG 1NMFA 2A8VA 1YEZA 3H3VC 1SYGA 4YWKA 1QVGA 1Y1WB 3TP6A 3T53B 4FP5D 4AQYQ 1V1PB 1J6QA 2PW5A 4LF7L 1CZGA 5IYDH 5M5XH 1M90C 1TVXA 1JWMD 2VL6A 2PZUA 2ES2A 1EY7A 1ILPA 1CKNB 1CKNA 2RDGA 1SFOB
chains in the Genus database with same CATH topology
4K5WA 3LWEA 1HQRD 4FXGC 1OXVA 3D8GA 2L5TA 1W6KA 3HOXB 4G7OC 4PV1C 2QDBA 4UDUC 1OXSC 5ELCA 1RD9D 1PZKD 5KIXA 5ELEA 2NWGA 4ME5A 1KLUD 3J80E 4QMGA 4JBWA 3S14B 4R9WA 2K01A 2A6EC 4DGZA 2F0NA 1QE6A 4ODGA 4DF7A 2F0UA 2FFKB 2PO4A 3OWEB 2KCNA 1SYFA 2X6LA 2EYHA 4N9TA 3A8JE 4MN3A 1SNMA 2EJFC 3VYUA 4UAIA 3K5LA 1OXXK 3RLFA 2CVRA 2L4NA 1ESFA 5KNCA 2KCCA 2VXWA 3J7AV 4QF4A 4V190 3T16A 4RKLA 3L9AX 5C4HA 1RHPA 1PRTB 4Q5VA 2EDGA 4IUPA 4QUFA 1Q3LA 3MZ5A 1J8IA 3I91A 1CHQD 1Y69U 4L8JA 4QUCA 4HCEA 3NQIA 3TP7A 2PYKA 4FNFA 4DXFA 1CQFA 2D2CC 4RWSC 1Z47A 2YU9B 3BZDB 1H9RA 4RKBA 2IL8A 5J1ZA 3IFDA 2NTSA 4X3TA 1TR5A 2JA6B 5C4ZA 2KHSA 2E2HB 1X3QA 4A3FB 3MXNA 5EBDA 2IX3A 3J80L 2DNCA 3SDZA 1SNQA 4LAAA 2KA7A 3S2HB 1MGSA 5CV5A 3M3YB 1BR9A 5KNBA 1I3QB 4FXKC 3BS1A 1IL8A 2N88A 2IX0A 5J22A 4OO1I 3BDLA 1JOKA 5A2QL 3RZDB 5KNDA 5CC4A 1JWUD 4C3HB 2J7ZA 1HRJA 4OO1G 2BCOA 2O5IC 3S9WA 1X32A 3OWFA 5AFWA 2L9HA 2EY6A 3J7AF 1GUWA 1B50A 2EVBA 3RD4A 4G7ZC 3FEWX 1EL0A 4F8MA 4A3IB 4A3DB 2A68D 1WTXA 2SNSA 4U673 4EVOA 1RKNA 1VF7A 1B2TA 1SNOA 2B63B 4XDXA 3NHHA 4HEDA 3SR1A 4LK1C 3W2DA 5JEAH 1U9RA 1I50B 1NR2A 1A2UA 3AB9A 5ELDA 4KJOA 5CV8A 5C0XI 1NCVA 3HEJA 4ZKCB 2IX1A 2OEOA 1ENCA 4NMZA 5IGBA 4C3IG 2RDHA 4XYQA 5C0XG 1PXUA 3BVGA 2EXZA 3MFYA 3A8IE 3TSSA 2EYOA 1DD2A 2HCCA 4Y7NB 2SDFA 5CORA 3GTLB 3MXPA 5HURA 3DEPA 1G291 5FK9C 1FD7D 1MI2A 5IOCA 2ZT9C 2C5CA 2K5DA 1SE3A 4PNYA 2XRQD 3K58A 1LTSD 1ML0D 2EPBA 3MVVA 5FLXE 1JQYD 3KLSA 5I6YA 3N52A 4EQPA 2V4DA 3I3CA 2R93B 3L7ZC 2JYOA 4H7BA 3I4LA 4ULLA 2K33A 1GUNA 2XNAC 2I07B 3QIAA 1F2ZA 5KYIA 5M3MB 2R6GA 1UEAB 3MTSA 4MHEA 3C2PA 3VR6A 2XIWA 5EPLA 3NXWA 3T13A 3VYSA 2SOBA 1EWCA 4FF3A 2JE6I 4CGYB 3BDOA 4R8IA 3UI2A 1S5ED 3NUCA 3CQZB 5EKIA 4CKEA 1DOMA 1EFID 2WACA 4K5VA 3C1FA 3GV3A 3M7GA 3E6ZX 3TP5A 1KDCA 4IURA 1IW7C 1TU2B 3FKIB 4KK7A 1ZYRC 1LLRD 1OXUA 2FHTA 1B4OA 1DM0B 3FPPA 1AEXA 1ZKOA 2VB2X 4V0BA 1EY0A 1TKWB 3K7AB 5FO8B 1TWGB 4XQQA 1IYVA 2LMCB 4FF1A 3TDQA 3HOYB 3LX0A 1EEFD 3EQLC 3T51B 4WORA 5LL6S 1O80A 1QWYA 5KGUA 1NUCA 1SMYD 3QWNA 2NB0A 1CT1D 4C3IB 1QCBD 5E1FA 4A3BB 4IFDI 2XSCA 1B44D 3VR2A 2F0GA 1EQVA 5DM63 3PUXA 4C2MB 2WP8J 1MSGA 4IFDG 1B1ZA 5CGKA 1JE4A 5M5YB 3AU7A 1U4RA 5KYLA 3U9OA 3PUWA 2KOLA 4C1NI 5M9OA 2DY8A 2PPBC 3C3LA 1Q1BA 5DM73 2R7ZB 1BCPB 2K05A 4KD3A 2AQ3B 2WKCA 2J0TD 3A7AB 4OIJA 3M4OB 1TWCB 1STAA 3D4WA 2A73B 4XXEA 3WDNA 5CYUA 4K14A 2R92B 2MUYA 4X3SA 1TWFB 3IAYA 3BVMA 1FNUA 3EVQA 1LTID 1B9NA 3F2UA 3KLSX 3MAQA 4KD4A 3S1QB 1D1KA 1HTPA 1STYA 5EQ0A 4F87A 2K6AA 3H91A 2HQEA 5EPJA 4KTAA 1WD0A 1A15A 2EE1A 1FR3A 4KKSA 1DOKA 5CV6A 3NWSA 1H9KA 4BA1I 2G9HD 2B2TC 3DUZA 1YNJC 1NSNS 3D6CA 4OO1H 1NR4A 1Z7TA 2RKSA 2KVMA 4KMUC 4KHVA 1EY5A 4A3GB 5K36G 5D65A 5M3FB 2X6GA 4KN4C 1H9JA 3I90A 4KJNA 1V1PA 3TZUA 3Q24A 3QO2A 1IHZA 3R3OA 3VYRA 2F1MA 2M2LA 5J39A 5C44B 1EEID 2A6ED 1S5BD 3QJYA 3GD7A 1XXGA 3FPUB 2JA7B 1C8CA 1XX8A 2A69C 4RHRA 4Z9CB 1C48A 1PRTC 2WV6D 3GP7A 4DK1A 2K28A 2K32A 4HR7B 5JPMC 4ZYSA 5EKLA 3K57A 1JORA 2LFNA 1SYEA 5C0XH 1PLFA 1E2VA 1PTOB 3HOZB 3GTOB 2HCIA 3K5OA 3C46A 1C4QA 1EU4A 5A2QE 4HSVA 2EOTA 3HKZB 4DK0A 3RMHA 5T1IA 4K8JA 1KDAA 4BY7B 1I4XA 4IFDJ 2NN6I 1II3A 1I4HA 2JEAI 4RGTA 1GUTA 1XTCD 3GTPB 3M7NA 3PIP3 2BOSA 1JCKB 2NN6G 4WRDA 3T56B 5CV7A 4ZAIA 1V43A 3S1NB 4LMQD 1F2LA 4K5XA 3X3NA 1EY6A 2H4OA 4B9WA 1SYDA 2Q8IB 1L0XB 3NWTA 4XYOA 2NBFA 4K6LA 1BDOA 4TRDA 4A3MB 1ILQA 2YYZA 4ZLTF 1FYCA 2G9DA 5IGFA 2LKVA 2B2YC 5FO9B 2Y0SB 1PZID 1F77A 2HDLA 3H6MA 1FNWA 1GOZA 1BCPF 5JJZA 5IGDA 3DHQA 1TWAB 2A6HC 3NK9A 1BXTA 1B9MA 1QNUA 4H13C 4QIWB 1I6VC 4HMIA 2IPKD 3BDCA 3D31A 2Z4IA 5FKAC 5C5LA 2AUKA 3R2IA 2DN8A 3V96A 1Q8IA 1E0BA 2E2IB 4RGOS 1OXTA 3RZOB 1TQOA 4J6HA 3GTQB 1E2WA 1LTAD 4NP5A 2B2YA 3R2TA 3X3MA 2E75C 2F0JA 4DU9A 4F7XA 1XYIA 1A6XA 1Y8NB 4A3JB 3KUPA 2XVSA 2C9OA 3I72A 3HGBA 2D5DA 2EY2A 1SEBD 5DEHA 5CBEE 2B8FA 5JPNC 5I2YA 2ID0A 1DOLA 3HZXA 2N55A 3D4DA 1I4RA 2O5JC 1RJTA 5BN3A 3NTIA 1DJRD 1FNVA 1Q12A 3KF8A 1D6EC 1CM9A 2B8GA 3VR3A 2MPMA 4KI0A 4FO2A 2M9VA 2F0WA 2IJ0A 3WOFA 1F9PA 1EIHA 2BE5C 2Z4HA 4R8NA 3JAME 1SNDA 5EJWA 2F4IA 2NTTA 4IUTA 2QF7A 4O42A 1EZ8A 1FGBD 1Q1EA 1UNSA 2HUGA 1SYBA 3FMCA 1GHJA 4HMJA 3S2DB 1CA6A 1KAAA 1WCMB 1V1OA 3ZYYX 4G4KA 2LY7A 5E3FA 2F3WA 2B2UC 5JAVA 2SEBD 2J4XA 4JK1C 2I46A 1K83B 1XWEA 1SNCA 4CHTB 1HFNA 2FMCA 1TS4A 1YNNC 1TIID 4CKBA 4HSPA 4L6TB 1EY4A 3NP8A 4RCOA 2F0HA 3G7LA 1MSHA 3KBXA 4KY6A 3FRPB 4DFAA 4DAVA 1TT2A 3D6WA 2RBMA 1BF4A 5FOBB 3CHBD 1H9MA 2EJGC 1PRTF 1H9SB 1S5DD 2BA0A 4O1NA 2FJ2A 5EGTA 4RFBA 2B2UA 2JA5B 2ICIA 1QB5D 3MA2B 3M85A 2FINB 5CV9A 1GHKA 3SEBA 1IW7D 1E2ZA 2K7VA 1AP0A 3PUVA 1ZYRD 1LABA 1VCIA 5CMDA 2H1EA 4EGVA 1WTVA 1A3TA 1BNZA 3K5MA 1QOHA 3JAML 5C6AA 4EQOA 2HDMA 1HCZA 3N6RA 3P20A 5CV4A 3VA5A 1B53A 5IODA 5K36H 3R93A 1MD2D 2ZXRA 1ZEQX 2RQXA 2F0TA 1SE4A 2ENBA 3TMEA 3SK6A 5C5MA 3PUZA 2PMZB 2EY1A 2F0PA 3MFGA 3HOVB 1EYAA 1UUPA 3W3AA 1STNA 2PQEA 3K59A 4J8QA 4C56C 2PCFB 3DWAA 4IUNA 2BDNA 4G57A 2JEBI 2F0MA 3QB3A 1BCPD 2IWHA 5M5XB 3TP8A 2AUJD 1K8MA 5ISRA 4DAYA 1F2YA 1EWHA 4RCNA 5I2XA 1KNAA 5C4JB 4Q0FA 2AWOA 1NAPA 3URYA 1D5MC 2B2WC 1B3AA 1JWSD 4M1UB 1M8AA 1Y1VB 1DONA 3WOEA 3H94A 3OW7A 1RTOA 4ABNA 1BCPC 1I6HB 3OMGA 3D4RA 4DN4M 5JEAG 3S16B 4E6IA 2R3ZA 1LO5D 1WTQA 1STBA 1SYCA 5CR3A 4WFN3 4A3EB 1UAPA 2K5QA 3KLRA 4CBVA 1JOOA 4WJWA 4XIGS 2VB3X 2NN6H 1Y8OB 4XT3B 1U4MA 3P75A 2B2WA 5NUCA 4B08A 4ZUJA 4KKUA 1EYDA 3S15B 2F03A 3ND8A 1GUOA 1ENFA 4RA8A 3VYTA 2WKDA 5I9OA 3TN2A 2L0CA 1I4PA 1CFMA 2M00A 1EU3A 1T5XD 5CBAE 4LJZC 2MP1A 3NBIA 3K5NA 1ICWA 3GV6A 2K04A 3QOLA 5KEEA 2B39A 1SJHD 5HGTA 1F9QA 2EY5A 4ZRZA 3A56A 5I4DA 2K5WA 3MXUA 4ZQ3A 1HHVA 1CA5A 1HA5A 4KHZA 1EQTA 5E4WC 2R61A 1SE2A 3HRZC 5C4XB 1YNJD 2E74C 2MHVA 4OHJA 4G7HC 1J9OA 2WB1B 4NKLA 4A3KB 4AYBB 3I4MB 3VR5A 2VUMB 5G3LF 1RDPD 5BN5A 1WVLA 1X3PA 2CW0C 4DAPA 2BA1A 1ONLA 1HXYD 3NTKA 2EYJA 2Z1CA 3SK5A 5C3XA 3E0JA 2EJMA 3CRLC 2A69D 1A3UA 1G91A 1O7ZA 4ID6A 4TQUS 1PRTD 3V05A 1PTOC 4MIUA 3A55A 1IKMA 4NW2A 3K0YA 3MEHA 3EROA 2TMPA 3HOWB 3HOUB 2JXMB 2B2TA 2PNRC 1Y8PB 3K6OA 4FF4A 2L12A 4C3JG 4M8AA 4GZYC 3EFXD 4RGNA 2NZ1D 3KK7A 1IKLA 1O7YA 4RHSA 2QEJC 1MBYA 3I8ZA 5LHY1 1HA6A 2KEEA 1LTBD 1EZ6A 5LL6X 2F0OA 1TY2A 1ESRA 2D62A 4ZUIA 1AZQA 3S1MB 2OF1A 4QB4A 2E2JB 4PQXA 2CQAA 5COYA 5C3EB 1F9SA 1OO9B 3Q0AA 4FYDA 5JEAJ 1EY9A 3KBGA 2Q8TA 4TSSA 3IFTA 1TS5A 1DXMA 4A93B 1AFPA 1JICA 1RTNA 4L63B 3GTJB 2X69A 2RSNA 2EYFA 5D14A 5T1GA 1Z6HA 1LT4D 1EOTA 2E76C 3I4NB 4RH6A 1Q90A 3NSWA 5IGGA 4HAEA 3PIO3 1O78A 5IT9E 1JR0D 3HS0C 1U4PA 4I7ZC 2AQ1B 2F0DA 2KUMA 4CJ1B 2RVLA 3L3OC 3D3RA 2A6HD 2IW3A 1TS2A 2F0EA 1IYUA 4CJ2C 1STEA 3SE0A 3PO2B 3GTGB 1PYWD 4K6DA 1HQMC 2SNMA 2A5HA 3VR4A 1CHPD 3Q22A 3LWUA 2EYMA 2KJXA 2OXPA 2F0SA 3H09A 2KQ3A 1AN8A 3OPOA 5ELFA 4OIKA 1CI3M 2OT2A 4I65A 1KABA 1SJED 1KNEA 4ZK9B 3FDTA 4EQNA 2ICEC 1EIGA 1G2SA 5IGEA 4IUVA 3H0GB 3MC0B 5IGCA 2F0QA 2D9UA 3GTKB 1ZXTA 2F0FA 4J1MA 3LNNA 3O13A 3OIPA 1S4ZA 3GO5A 3T4AC 3FVQA 1LT6D 1KLGD 1WTPA 3CRKC 4K8IA 1LT3D 3OSOA 1HPCA 4PMWA 1VDZA 1BOSA 2ZXOA 1DZ1A 4N9PA 1D5XC 3MWYW 1STHA 5IT9L 2BE5D 4TKOB 2O2LD 4C3JB 1PZJD 2JP1A 3U9SA 1O7LA 3DWPA 5G3LD 3CKIB 2NVQB 2JA8B 1RCVD 1QJOA 2L1BA 4ILWA 4RAUC 1CZWA 1K8OA 1HTLD 1ET9A 3I73A 5DNFA 1AW7A 1TWHB 3NBHA 2Q8RE 1QNKA 4H0LC 3OMCA 1KDBA 1PTOH 1CQVA 2E2DC 1S5CD 4IFDH 2PZTA 1U4LA 2A68C 3EA6A 3BVZA 1LV9A 5E4XA 1ET6A 1YNND 1EY8A 3GTMB 4KY5A 2F0VA 1RF2D 1GUGA 1RODA 5TSSA 2ZXPA 2NVXB 5KRUA 3I70A 2AQ2B 4BBSB 1HUMA 3MXGA 1LTRD 3P7JA 4KV6A 2EZVA 3S1RB 4DNRB 1BUVT 1M4VA 1PTOF 4DXGA 4XTCS 2IT1A 1BQQT 3TZDA 4BS9A 3PV0A 4DNTB 3HP3A 2A74C 3TBIB 1H9SA 3E5SA 3MHBA 3M4YA 2F0KA 1D1IA 2RSOA 2CHBD 3IL8A 1I4GA 3C1EA 4K2LA 4U68A 4OL7A 4RGMA 1T5EA 2MJ8A 3NQTA 2PW7A 1SXTA 2DY7A 4BWGB 5D3IB 3ITPA 5F2DA 3Q6SA 4IN3A 1DYQA 1I4QA 3SHLA 3CU7A 4PMCA 4K2KA 2NVYB 1A3VA 1HFGA 2GA4B 1SSOA 4H44C 4XQNA 2L11A 3J81E 3PUYA 5I9PA 2XRSD 2KECA 4FF2A 1CTMA 3SVMA 2B2VC 2XWJB 2QCPX 3RUZA 2F0LA 5A35A 4YIJA 2L55A 1WTOA 4IALA 1G6ZA 5M5WB 1JB3A 1STGA 1VMCA 2F0IA 1D2BA 1GUSA 4XQJA 2BDOA 4B9XA 4HTHA 4CKCA 3QOJA 1WTWA 5I6WA 1GJXA 1SDFA 1TY0A 1DCZA 3BG3A 1G8ZD 1QILA 5FLXL 1PMRA 2NYZD 1EYCA 5JOBA 5IIFA 2B2VA 1SNPA 3PO3B 3OHXC 2KEDA 3IKJA 2XWBB 4HN7A 2NUCA 4CJ0B 2RDFA 1SAPA 1D5ZC 2TSSA 1A2TA 3NTHA 4XT1B 3SK8A 5C3WA 2LS01 3S17B 3R8BA 4X3UA 2Z8LA 4FVMA 2WINB 3AMUA 4BA2I 5FO7B 5BN4A 1WTRA 2DNEA 1HUNA 3ND9A 1LTGD 1VMPA 4KY7A 1LACA 2VNUD 2FMMA 3PMFA 5D3DA 1SMYC 4DA2A 3J81L 5C0XJ 3V2TA 3A7LA 1V8QA 3DWQA 3OIQA 2QKIC 2EYLA 2WIIB 1F2MA 5DAUA 4PMBA 1PFNA 1F9RA 1R9TB 2RA4A 2K03A 2EYPA 4OGQC 3QG1A 4NDXA 1VF5C 4IZ8A 1R4PB 4S3SA 4IUUA 4BBRB 1KTKA 3NE5B 2O4XA 3HG9A 3SK4A 1W6JA 3DXJC 1CK1A 4BY1B 2F3VA 3DEOA 3SXHA 4QCLA 3OOCA 3EJIA 5JVH3 3BYTB 1BO0A 3A54A 4ZKBB 1LT5D 2CW0D 3G6JB 4F88A 1QG7A 3Q23A 3DM1A 1ENAA 3A8KE 4HCSA 1S5FD 3ERQA 1SBBB 5EKKA 3DMUA 5JVG3 2K1BA 2QILA 4FXDA 2WAQB 4X3KA 1PDQA 1BBXC 3NPPA 3ONAB 5EBCA 1PTOD 2JSOA 2AWNA 5EPKA 4KN7C 1PFMA 1R4QB 1WD1A 2NVTB 4IQZA 3J7YW 4C1NK 2MGSA 3VA7A 4IUQA 4KKTA 1JC7A 1GXDC 3GQBA 1TS3A 5ELBA 2XN9C 3BYYB 1L0YB 2PZWA 4P2CB 1PFBA 1LTTD 3P1HA 1AZPA 1G2TA 1JOQA 5K5PA 4C3HG 3H3VC 1SYGA 1Y1WB 3TP6A 3T53B 4FP5D 1V1PB 2PW5A 1CZGA 1TVXA 1JWMD 2PZUA 1EY7A 1ILPA 2RDGA 1SFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3URY A;  1D5M C;  5ELD A;  3MC0 B;  1S5E D;  4OHJ A;  3CHB D;  1JWS D;  1PRT F;  1HQR D;  2NTS A;  1M4V A;  1PTO F;  1CK1 A;  1S5D D;  4O1N A;  1BCP C;  1EFI D;  1I4R A;  4TSS A;  2RDH A;  4DXG A;  3O13 A;  1TS5 A;  4RFB A;  1L0X B;  4UDU C;  1TY0 A;  3BYT B;  1RDP D;  5ELC A;  2ICI A;  1LT6 D;  1RD9 D;  1PZK D;  3BVG A;  1KLG D;  1V1P A;  1G8Z D;  1LT3 D;  1QIL A;  4L63 B;  4K6L A;  5ELE A;  1LT5 D;  1DJR D;  3TSS A;  1FNV A;  1KLU D;  3SEB A;  1HXY D;  1D6E C;  1EEI D;  1LO5 D;  1LLR D;  1S5B D;  1BCP B;  1LT4 D;  1S5F D;  1XXG A;  1SBB B;  2AQ3 B;  1FD7 D;  2IJ0 A;  4RH6 A;  5FK9 C;  2QIL A;  1D5X C;  3OWE B;  2CHB D;  4RHR A;  4Z9C B;  1I4G A;  1PZI D;  1JR0 D;  1PRT C;  1KTK A;  1SE3 A;  1F77 A;  1D5Z C;  2AQ1 B;  2NTT A;  2O2L D;  2TSS A;  1PRT D;  2WV6 D;  3GP7 A;  4RGM A;  1FNW A;  2XRQ D;  1PZJ D;  3V05 A;  1LTS D;  1PTO C;  1GOZ A;  1FGB D;  1PTO D;  1BCP F;  1UNS A;  1JQY D;  1JWU D;  1SXT A;  4BWG B;  4ZYS A;  1ESF A;  5D3I B;  3DWP A;  3R8B A;  1BXT A;  1MD2 D;  2Z8L A;  1DYQ A;  1I4Q A;  1TS2 A;  1RCV D;  1STE A;  1SE4 A;  1ENF A;  2IPK D;  3BVM A;  1EEF D;  1FNU A;  1PRT B;  5FKA C;  1HTL D;  1ET9 A;  1LTG D;  1LTI D;  1PYW D;  1AW7 A;  1V1O A;  1PTO B;  3R2I A;  3KLS X;  2XNA C;  1CHP D;  1I4P A;  5D3D A;  1EU4 A;  1PTO H;  3MFG A;  1CQV A;  1TS3 A;  2SEB D;  1EU3 A;  1T5X D;  2J4X A;  5ELB A;  2XN9 C;  1S5C D;  3BYY B;  1L0Y B;  1UUP A;  4RGO S;  2XRS D;  1LTT D;  3EFX D;  4RGN A;  1I4X A;  3DWQ A;  3EA6 A;  3BVZ A;  1AN8 A;  1CT1 D;  1TS4 A;  1SJH D;  1LTA D;  5ELF A;  4C56 C;  1ET6 A;  3R2T A;  2QEJ C;  4RHS A;  1CHQ D;  3DWA A;  5I4D A;  4L6T B;  1I4H A;  1LTB D;  1RF2 D;  1BCP D;  4RGT A;  1XTC D;  1B44 D;  1SJE D;  1TY2 A;  1V1P B;  2G9H D;  4DXF A;  4RCO A;  5TSS A;  1EWC A;  1HA5 A;  1JWM D;  3W2D A;  2R61 A;  1SE2 A;  2AQ2 B;  3BZD B;  1JCK B;  1B1Z A;  1SEB D;  1LTR D;  2RDG A; 
#chains in the Genus database with same CATH topology
 5C4J H;  4HJ8 A;  2XGT A;  4K5W A;  3LWE A;  1HQR D;  4JI4 Q;  4FXG C;  4A3I G;  1OXV A;  4A3D G;  3D8G A;  3DM3 A;  3PO3 H;  2Y0S E;  2BH2 A;  2L5T A;  2OTJ A;  2LSS A;  1W6K A;  3HOX B;  4LFA L;  4PV1 C;  2QDB A;  4UDU C;  4DAM A;  1OXS C;  3DLL A;  1QUQ A;  5ELC A;  1L0W A;  1UWV A;  4DV7 Q;  1RD9 D;  1PZK D;  5KIX A;  2UUC Q;  4OWT B;  1I6H H;  1C0A A;  5ELE A;  2PQA B;  4JPB W;  2B63 G;  2NWG A;  4ME5 A;  1KLU D;  3J80 E;  2L15 A;  4QMG A;  4JBW A;  3S14 B;  4QIW E;  4R9W A;  2K01 A;  2A6E C;  4DGZ A;  3S17 H;  2F0N A;  1RL2 A;  4LF8 L;  3S16 H;  1QE6 A;  1A63 A;  4ODG A;  4DF7 A;  4FDB A;  2F0U A;  2K75 A;  1HNW L;  1C7Y A;  2FFK B;  2PO4 A;  3OWE B;  2V1C C;  2KCN A;  1SYF A;  2X6L A;  2DGY A;  2EYH A;  4N9T A;  3A8J E;  4MN3 A;  1SNM A;  3T1H Q;  2F52 A;  2EJF C;  3VYU A;  1K3R A;  4UAI A;  3K5L A;  2ZJR A;  1AH9 A;  1OXX K;  3RLF A;  2CVR A;  2L4N A;  1ESF A;  2NZO A;  5KNC A;  4JI6 L;  2KCC A;  2VXW A;  2AMC B;  3J7A V;  1B7Y B;  4QF4 A;  1XMQ Q;  4V19 0;  3T16 A;  1VQI A;  4RKL A;  3L9A X;  5C4H A;  1RHP A;  1IXR A;  1PRT B;  4Q5V A;  4DR1 L;  4ALP A;  2EDG A;  4IUP A;  1YBY A;  4KLK A;  4QUF A;  4JI7 L;  1Q3L A;  5FLM G;  1FGU A;  3MZ5 A;  2CH4 W;  4GLX A;  1J8I A;  3TS0 A;  3I91 A;  1CHQ D;  1Y69 U;  5ELO A;  3F2C A;  4L8J A;  4QUC A;  4PZ6 A;  4HCE A;  4BY1 H;  3NQI A;  2R93 G;  3TP7 A;  2PYK A;  4FNF A;  4DXF A;  4ZCK A;  1GD7 A;  1CQF A;  1UE1 A;  2CWP A;  2D2C C;  4RWS C;  1Z47 A;  1XMO Q;  2YU9 B;  3BZD B;  1EFW A;  1H9R A;  4RKB A;  5C4X H;  1K3B C;  2IL8 A;  5J1Z A;  3IFD A;  5M3M G;  2NTS A;  4X3T A;  1TR5 A;  1XJV A;  2JA6 B;  3UE0 A;  1ICF B;  3KDF B;  5C4Z A;  3KDF A;  2KHS A;  2E2H B;  4PG3 A;  1X3Q A;  4A3F B;  4GKK L;  3I4M H;  1JJG A;  3MXN A;  5EBD A;  2IX3 A;  2ALY B;  2VUM H;  3W5O A;  4LF7 Q;  5DLQ E;  4MNO A;  3J80 L;  2DNC A;  3SDZ A;  1SNQ A;  4LAA A;  2KA7 A;  1QZH A;  3S2H B;  1MGS A;  5CV5 A;  1IBK Q;  1CSP A;  3M3Y B;  1BR9 A;  4IJH A;  1I3Q B;  5KNB A;  4FXK C;  1IBM Q;  5J3B A;  3U58 A;  5IY0 A;  3BS1 A;  4JBK A;  1IL8 A;  2N88 A;  2FXQ A;  3KJP A;  2IX0 A;  5J22 A;  4OO1 I;  3BDL A;  1JOK A;  1VQB A;  2Z9H A;  2PNH A;  5A2Q L;  2K14 A;  3RZD B;  3KLW A;  1KL9 A;  5KND A;  3K0X A;  2OQK A;  5CC4 A;  1JWU D;  4C3H B;  4DUZ Q;  2J7Z A;  1HRJ A;  4OO1 G;  1JE5 A;  2BCO A;  5FJ8 G;  2O5I C;  3FKI G;  4LF8 Q;  3U50 C;  2JJQ A;  3S9W A;  4DR4 Q;  1VQD A;  1XNQ L;  3M4P A;  1X32 A;  3OWF A;  5AFW A;  1U0L A;  2CH4 A;  2L9H A;  2EY6 A;  3J7A F;  1GUW A;  1B50 A;  4LFC L;  1YIT A;  2EVB A;  3RD4 A;  4G7Z C;  3FEW X;  1EL0 A;  2K52 A;  3G71 A;  4F8M A;  3CCS A;  4A3I B;  4A3D B;  2A1A A;  2A68 D;  1WTX A;  3RNU A;  2SNS A;  4U67 3;  4UP8 A;  3GDE A;  4EVO A;  1G51 A;  1RKN A;  3OW2 A;  1VF7 A;  1B2T A;  5E7N A;  3HOY G;  1SNO A;  4OXP A;  2B63 B;  4XDX A;  3SGI A;  3NHH A;  3D0F A;  3G6E A;  3HOX H;  4HED A;  1WJJ A;  3SR1 A;  2G5D A;  4LK1 C;  3W2D A;  1K8A C;  5JEA H;  1U9R A;  3KF8 B;  1I50 B;  3QR8 A;  1HJP A;  1NR2 A;  1A2U A;  3AB9 A;  5ELD A;  4KJO A;  5CV8 A;  5C0X I;  1NCV A;  3S1M H;  3S14 H;  3HEJ A;  4ZKC B;  2E2J H;  2IX1 A;  4DR2 Q;  2OEO A;  1ENC A;  1G6P A;  1SRU A;  4NMZ A;  1OTC A;  5IGB A;  4UP7 A;  4C3I G;  1Y1V G;  2RDH A;  1VQO A;  2IHF A;  4XYQ A;  4A3B G;  2MQH A;  5C0X G;  1PXU A;  3BVG A;  2EXZ A;  3MFY A;  3A8I E;  4IJL A;  3TSS A;  2EYO A;  1DD2 A;  2HCC A;  4Y7N B;  2SDF A;  5COR A;  4QL5 A;  4O0A A;  3GTL B;  3MXP A;  3PF5 A;  5HUR A;  3DEP A;  1G29 1;  5FK9 C;  1FD7 D;  1MI2 A;  5IOC A;  2PMZ E;  2UUA Q;  1KD1 C;  2ZT9 C;  3K80 C;  2C5C A;  1V1Q A;  5H1S E;  2K5D A;  1SE3 A;  2PI2 A;  4PNY A;  2XRQ D;  3K58 A;  1LTS D;  1ML0 D;  2EPB A;  3MVV A;  5FLX E;  1JQY D;  4GN3 B;  3KLS A;  5I6Y A;  5IYB H;  1PH6 A;  3N52 A;  4EQP A;  1PH2 A;  2V4D A;  3I3C A;  4HJ7 A;  2R93 B;  3L7Z C;  2JYO A;  2R7Z G;  5LMN W;  4H7B A;  3I4L A;  4ULL A;  2K33 A;  1E3P A;  1WOC A;  2UUB L;  1GUN A;  2XNA C;  3PO2 H;  2I07 B;  4NXN L;  3QIA A;  1TXY A;  2KBN A;  4LF5 L;  1F2Z A;  5KYI A;  2YU9 H;  5M3M B;  4IOA A;  2R6G A;  2YTY A;  1YJW A;  1UEA B;  4JYA L;  3MTS A;  4MHE A;  3C2P A;  3NEL A;  2R92 G;  3VDY A;  1NJI C;  3VR6 A;  2XIW A;  2JA6 H;  5EPL A;  3NXW A;  4AIM A;  3T13 A;  3VYS A;  2SOB A;  1HNX L;  1FL0 A;  2E2H H;  1XNQ Q;  2KCM A;  1EWC A;  4FF3 A;  2JE6 I;  4CGY B;  2Z6K C;  3BDO A;  4R8I A;  3K81 C;  4DV4 Q;  2JN4 A;  3UI2 A;  1S5E D;  1L1O C;  3NUC A;  3H0G H;  3CQZ B;  1IZ6 A;  3S2H H;  5EKI A;  4CKE A;  3M3Y H;  3J7A 5;  2WB1 G;  1DOM A;  1I3Q H;  2UXB L;  1EFI D;  4ME3 A;  2WAC A;  4K5V A;  4JI2 L;  3C1F A;  3GV3 A;  3M7G A;  3E6Z X;  3EIV A;  3TP5 A;  1KDC A;  4K0K Q;  4IUR A;  1IW7 C;  1TU2 B;  3FKI B;  1Q46 A;  1KIX A;  4KK7 A;  1ZYR C;  1LLR D;  5IYC H;  1OXU A;  2FHT A;  1B4O A;  1DM0 B;  3FPP A;  1AEX A;  5M3F G;  1ZKO A;  2Z6K A;  3JC6 6;  4X64 L;  2VB2 X;  3UDI A;  4V0B A;  1EY0 A;  1TKW B;  3K7A B;  5FO8 B;  1XNR Q;  1TWG B;  2ZTD A;  1L1O A;  4C3J H;  4XQQ A;  1IYV A;  2LMC B;  4FF1 A;  4IOC A;  3TDQ A;  4A3D H;  4B3T L;  5C44 G;  3PQI A;  3HOY B;  4YWM A;  4DR5 L;  3LX0 A;  1EEF D;  2JA8 H;  3EQL C;  3T51 B;  4WOR A;  5LL6 S;  2JA7 G;  4GNX C;  3HOU G;  1O80 A;  1QWY A;  1PH3 A;  2ZTC A;  4DAY B;  5KGU A;  1PV4 A;  3J81 i;  1NUC A;  1SMY D;  2ZJQ A;  2WB1 E;  1I50 H;  3QWN A;  2NB0 A;  4AYB E;  1CT1 D;  4C3I B;  1QCB D;  1E22 A;  5E1F A;  4A3B B;  4IFD I;  2XSC A;  3F2B A;  1B44 D;  3VR2 A;  2ZM6 L;  2F0G A;  2VQF L;  1EQV A;  2IHE A;  2UUB Q;  1I94 L;  2E5L L;  5DM6 3;  3PUX A;  4C2M B;  1PVO A;  2WP8 J;  1MSG A;  4IFD G;  1B1Z A;  3CCU A;  5CGK A;  2NVX H;  5GAH C;  5IP9 G;  3HKZ G;  1JE4 A;  3GTL H;  4JI5 L;  2DUD A;  3U4V A;  2GVA A;  5M5Y B;  3AU7 A;  4BY7 G;  2YV5 A;  4OEL B;  5ELN A;  1U4R A;  5GAD C;  4GNX A;  5KYL A;  1HR0 L;  2XTI A;  1GM5 A;  3U9O A;  1NBW A;  4A93 G;  3PUW A;  2KOL A;  4C1N I;  5M9O A;  3AEV A;  3IRB A;  2DY8 A;  2PPB C;  3C3L A;  1P16 A;  1Q1B A;  5DM7 3;  3ER0 A;  3BZC A;  2R7Z B;  3A0J A;  1BCP B;  2K05 A;  1CKM A;  4KD3 A;  2AQ3 B;  2WKC A;  2J0T D;  2DJF C;  3A7A B;  4HIM A;  2R93 H;  1LYL A;  3I4N G;  4OIJ A;  5BR8 L;  3M4O B;  1HZC A;  1TWC B;  1STA A;  3D4W A;  4POG A;  2RCN A;  2A73 B;  3L2P A;  4JI2 Q;  4XXE A;  1N33 L;  3RLO A;  3WDN A;  5GQO A;  5CYU A;  4K14 A;  2R92 B;  5M3M H;  4GOP A;  2MUY A;  4X3S A;  4A3M G;  2ZTE A;  2QDL A;  1SLJ A;  1TWF B;  3IAY A;  3PGZ A;  3BVM A;  1FNU A;  3EVQ A;  1LTI D;  1B9N A;  3F2U A;  3KLS X;  4A3C G;  3KOJ A;  2BH8 A;  1YHQ A;  3MAQ A;  2NVY H;  3HKZ E;  4WJ4 A;  4KD4 A;  3S1Q B;  1D1K A;  1HTP A;  2Y0S G;  1STY A;  5EQ0 A;  3CCE A;  4F87 A;  2K6A A;  3H91 A;  4NXM Q;  4DR3 L;  1GO3 E;  1YIJ A;  2HQE A;  3WWV A;  5EPJ A;  3K8A A;  4KTA A;  1WD0 A;  4DV3 Q;  1A15 A;  4B3T Q;  2EE1 A;  1FR3 A;  4KKS A;  4B3R Q;  1DOK A;  5CV6 A;  3NWS A;  1H9K A;  1MJC A;  4BA1 I;  2G9H D;  1XPO A;  2B2T C;  3DUZ A;  2UXD Q;  5M5W H;  1YNJ C;  1NSN S;  4RMF A;  3D6C A;  4OO1 H;  1NR4 A;  1Z7T A;  2RKS A;  5FJ8 H;  2KVM A;  3JAM c;  4KMU C;  2KHJ A;  3FKI H;  4KHV A;  1EY5 A;  4A3G B;  4GKJ L;  4IPD A;  3M9B A;  5K36 G;  5D65 A;  5M3F B;  2X6G A;  4KN4 C;  1H9J A;  4DUY L;  3I90 A;  3CC4 A;  4DV5 Q;  4KJN A;  1V1P A;  1PH8 A;  3TZU A;  3Q24 A;  3BJU A;  3QO2 A;  1IHZ A;  3R3O A;  3VYR A;  1I94 Q;  2F1M A;  2M2L A;  1Q8K A;  5J39 A;  4A3J G;  5C44 B;  1TWG H;  1QVF A;  4L5S A;  1EEI D;  2A6E D;  1S5B D;  3QJY A;  4N8X 1;  3GD7 A;  1XXG A;  3FPU B;  4RG1 A;  2JA7 B;  3I55 A;  1C8C A;  1XX8 A;  1CSQ A;  3HOY H;  4JI0 L;  2VS1 A;  2A69 C;  4RHR A;  4Z9C B;  1EYG A;  1C48 A;  4X66 L;  1PFS A;  1PRT C;  1HR0 Q;  2WV6 D;  3GP7 A;  4DK1 A;  2K28 A;  2ASB A;  2K32 A;  2PQA A;  4HR7 B;  5JPM C;  2QA4 A;  3E9H A;  2VY3 A;  4ZYS A;  5EKL A;  3K57 A;  1JOR A;  4DV0 L;  1D7Q A;  4R1J A;  1FJG Q;  4C3I H;  4JI8 Q;  2LFN A;  3BZK A;  1SYE A;  1U5K A;  4A3B H;  5C0X H;  1PLF A;  1E2V A;  3EN2 A;  1PTO B;  3HOZ B;  3GTO B;  2CQO A;  4DPG A;  2HCI A;  2K5H A;  3K5O A;  3C46 A;  5BR8 Q;  1C4Q A;  1EU4 A;  4A3L G;  3OTO L;  5A2Q E;  4HSV A;  2EOT A;  3I56 A;  3HKZ B;  2D0P A;  4DK0 A;  4C2M H;  3RMH A;  2JQO A;  5T1I A;  1S72 A;  4K8J A;  1KDA A;  1PYS B;  4OX9 Q;  1EIY B;  4BY7 B;  3CCM A;  1I4X A;  1HH2 P;  2HHH L;  2MO0 A;  4IFD J;  1IYJ B;  2NN6 I;  1II3 A;  1I4H A;  4P73 A;  2JEA I;  4RGT A;  1GUT A;  1XTC D;  2HQL A;  3GTP B;  4X65 L;  1X9N A;  2OWO A;  2LXK A;  1PH4 A;  4YCW A;  1WCM G;  1R9T H;  4CDE C;  3M7N A;  4P75 A;  3PIP 3;  2BOS A;  1JCK B;  2NN6 G;  4WRD A;  3T56 B;  2QEX A;  1L2F A;  3CC2 A;  4BBR H;  2AHO B;  5CV7 A;  4R4T A;  2NZH A;  4ZAI A;  2R7Z H;  1V43 A;  3S1N B;  4LMQ D;  1F2L A;  4K5X A;  4JI1 L;  3X3N A;  1EY6 A;  2H4O A;  4B9W A;  1SYD A;  2KHI A;  2Q8I B;  1L0X B;  1S40 A;  3NWT A;  4XYO A;  3M4O H;  1TWC H;  2EIF A;  2VZA A;  2NBF A;  4K6L A;  3J80 i;  1BDO A;  2LXJ A;  4TRD A;  4A3M B;  1ILQ A;  2YYZ A;  4ZLT F;  1X3E A;  1FYC A;  2R92 H;  2G9D A;  5IGF A;  2KCT A;  2EQS A;  2LKV A;  2B2Y C;  5FO9 B;  1SRO A;  2Y0S B;  1PZI D;  4JG2 A;  1F77 A;  2HDL A;  1BVS A;  1SE8 A;  3H6M A;  5IWA L;  1FNW A;  1BBU A;  4GLA C;  1GOZ A;  2JA5 G;  3S1Q H;  1BCP F;  5JJZ A;  5IGD A;  3DHQ A;  2CCZ A;  2UU9 L;  1TWA B;  1XPU A;  2A6H C;  3NK9 A;  3H15 A;  1BXT A;  1B9M A;  1QNU A;  4JI3 L;  4H13 C;  4DR7 L;  4QIW B;  1I6V C;  4HMI A;  2IPK D;  3BDC A;  3D31 A;  2Z4I A;  5FKA C;  3E0E A;  4G7O C;  1A0I A;  2NVT H;  4WJ3 M;  5C5L A;  2AUK A;  3R2I A;  2F4V L;  4LFA Q;  2DN8 A;  3V96 A;  1CKO A;  3T1Y L;  1Q8I A;  1PH9 A;  1E0B A;  1VQH A;  4QJF A;  2E2I B;  4RGO S;  1OXT A;  2B3G A;  3RZO B;  3TRZ A;  1TQO A;  4J6H A;  1IBL L;  1E2W A;  3GTQ B;  1LTA D;  2A19 A;  4LFB L;  4NP5 A;  4A3G H;  2B2Y A;  3R2T A;  4TVA B;  3X3M A;  4BXX G;  1UE5 A;  2E75 C;  4HIK A;  4OWW B;  2F0J A;  4DU9 A;  4F7X A;  1HNW Q;  1XYI A;  1A6X A;  1Y8N B;  3PSI A;  1Y1W H;  4A3J B;  3KUP A;  2XVS A;  3LGJ A;  2OQ0 A;  4LF4 L;  2C9O A;  3I72 A;  3HGB A;  3OTO Q;  2D5D A;  2IY5 B;  2EY2 A;  3G4S A;  1SEB D;  5DEH A;  5CBE E;  2B8F A;  5JPN C;  3HOV G;  3J7Z C;  5C44 H;  3A5Z B;  5I2Y A;  1SFO H;  4JI6 Q;  2ID0 A;  1PHJ A;  1DOL A;  3HZX A;  4LUV A;  2N55 A;  3D4D A;  1I4R A;  2O5J C;  1RJT A;  4DR1 Q;  1UEB A;  3NTI A;  5BN3 A;  2P5Z X;  1DJR D;  1UE7 A;  1FNV A;  1Q12 A;  2H5X A;  3KF6 B;  3KF8 A;  1D6E C;  1CM9 A;  2B8G A;  3VR3 A;  4JI7 Q;  2MPM A;  4KI0 A;  1EWI A;  4FO2 A;  2M9V A;  4IPC A;  2F0W A;  2IJ0 A;  4A75 A;  3WOF A;  4HJ9 A;  1F9P A;  4R4O A;  1EIH A;  1LTL A;  3NBH B;  2VQE L;  2BE5 C;  5LMU L;  2EXD A;  2Z4H A;  4R8N A;  3JAM E;  1SND A;  4DK3 C;  5EJW A;  2F4I A;  2NTT A;  4IUT A;  3HOZ H;  2QF7 A;  3GTO H;  4O42 A;  1EZ8 A;  1FGB D;  1MIU A;  1Q1E A;  1UNS A;  2HUG A;  5IP9 H;  1SYB A;  1HZA A;  3FMC A;  1EIF A;  1GHJ A;  4CDD C;  4HMJ A;  3S2D B;  1CA6 A;  3AFP A;  1KAA A;  1WCM B;  4YHH L;  1V1O A;  3ZYY X;  4G4K A;  2LY7 A;  5E3F A;  3GTP H;  4GKK Q;  2F3W A;  1LUZ A;  2B2U C;  2SEB D;  5JAV A;  4A3E G;  2J4X A;  3J81 j;  4JK1 C;  2B29 A;  2I46 A;  1K83 B;  1XWE A;  1SNC A;  3TS2 A;  4CHT B;  1HFN A;  1QVC A;  4DV1 L;  4JC0 A;  2UU9 Q;  2E8G A;  2FMC A;  1VQE A;  1TS4 A;  3TRE A;  5AJ3 L;  1YNN C;  3OYY A;  2R7F A;  1TII D;  4JI3 Q;  4CKB A;  4HSP A;  4L6T B;  1EY4 A;  3S1N H;  3NP8 A;  4L5R C;  1B8A A;  1H95 A;  1EOV A;  2CWA A;  3F1Z A;  4RCO A;  2F0H A;  3G7L A;  1MSH A;  3KBX A;  4KY6 A;  3FRP B;  4DFA A;  4DAV A;  2ATW A;  1TT2 A;  3D6W A;  4A3M H;  4UY8 C;  2RBM A;  1BF4 A;  4JV5 L;  5FOB B;  3CHB D;  1H9M A;  2EJG C;  1PRT F;  1H9S B;  1BBW A;  1N36 L;  4GN5 A;  5L37 A;  4NPS A;  1IBL Q;  1S5D D;  2BA0 A;  4O1N A;  2FJ2 A;  5EGT A;  4RFB A;  2B2U A;  2JA5 B;  2ICI A;  1QB5 D;  3MA2 B;  3M85 A;  4A3F H;  2FIN B;  3UE1 A;  4KHP L;  2I5H A;  5CV9 A;  1GHK A;  1O7I A;  3SEB A;  1IW7 D;  4LF4 Q;  1VQ5 A;  4LFC Q;  1N8R C;  2HT1 A;  1E2Z A;  1FVI A;  2K7V A;  1AP0 A;  5C4X G;  1TWA H;  3PUV A;  1ZYR D;  1LAB A;  1VCI A;  5CMD A;  4R4C A;  2H1E A;  1YI2 A;  3CCV A;  4EGV A;  1WTV A;  1A3T A;  4DV2 L;  2N49 A;  3K5M A;  4A3K G;  4AYB G;  1QOH A;  1BNZ A;  3I4M G;  4JOI C;  3JAM L;  2I5M X;  5C6A A;  4EQO A;  2VUM G;  3CAM A;  3ULP A;  3RZD H;  2HDM A;  1HCZ A;  4X62 L;  3N6R A;  3P20 A;  5CV4 A;  3VA5 A;  1B53 A;  5IOD A;  2E2I H;  3R93 A;  5K36 H;  1MD2 D;  4I7A A;  2ZXR A;  4C3H H;  1HR0 W;  1ZEQ X;  2RQX A;  2F0T A;  1E1O A;  1SE4 A;  2ENB A;  3TME A;  3SK6 A;  2Q2T A;  3I4O A;  1MHW C;  4DR6 L;  5C5M A;  3PUZ A;  2F3I A;  2PMZ B;  2EY1 A;  1A62 A;  2F0P A;  5LMU Q;  1VS0 A;  4A76 A;  3PCO B;  3MFG A;  3HOV B;  4B3M L;  1N9W A;  1EYA A;  1KXL A;  4YY3 L;  1UUP A;  3W3A A;  1STN A;  1UE6 A;  3UDG A;  2CKZ B;  2PQE A;  4JBJ A;  3K59 A;  4LF9 L;  4J8Q A;  4A3I H;  4C56 C;  4CDC C;  2PCF B;  3DWA A;  4YCU A;  4IUN A;  2BDN A;  4G57 A;  2JEB I;  2F0M A;  3QB3 A;  1BCP D;  4JOI A;  2IWH A;  4DV6 L;  3CPF A;  3HOW G;  1B70 B;  5M5X B;  3TP8 A;  2AUJ D;  2B63 H;  5LMN L;  1K8M A;  5ISR A;  1PH5 A;  1LM0 A;  4DAY A;  5GAG C;  1F2Y A;  1VQK A;  1X3F A;  1EWH A;  4RCN A;  5I2X A;  1KNA A;  3HFZ B;  5C4J B;  4CDF C;  4Q0F A;  2AWO A;  5IT9 c;  1NAP A;  3CC7 A;  3URY A;  1D5M C;  1X54 A;  2B2W C;  5IP7 G;  1B3A A;  1JWS D;  4M1U B;  1M8A A;  1Y1V B;  1DON A;  4R4I A;  5JJK A;  3WOE A;  3H94 A;  3OW7 A;  1RTO A;  4ABN A;  3W1G A;  1BCP C;  3ZJY C;  1I6H B;  4L5T A;  3OMG A;  4A3L H;  3D4R A;  3E3X A;  3HOX G;  2I5L X;  3STB C;  3H3V I;  4DN4 M;  2HD3 A;  4NXN Q;  5JEA G;  4QGU A;  3S16 B;  4E6I A;  2R3Z A;  1EQR A;  4LF5 Q;  1LO5 D;  1WTQ A;  4PZ8 A;  1STB A;  4Y7N H;  1SYC A;  4QY7 A;  4R4Q A;  3S2D H;  5C3E G;  4AQY L;  4JYA Q;  1E7Z A;  5CR3 A;  4WFN 3;  1K0S A;  4A3E B;  3AYH B;  3CCL A;  1UAP A;  2K5Q A;  5HY6 A;  3KLR A;  4P72 A;  1JOO A;  4WJW A;  4XIG S;  4CBV A;  2VB3 X;  2NN6 H;  1Y8O B;  4XT3 B;  1HNX Q;  2I0Q A;  1U4M A;  3P75 A;  2B2W A;  1HNZ L;  5FLM H;  5NUC A;  4B08 A;  1K83 H;  4ZUJ A;  4KKU A;  1EYD A;  4JI4 L;  1ASY A;  1JJC B;  3S15 B;  2F03 A;  3ND8 A;  2MNA A;  3G48 A;  1GUO A;  1ENF A;  2K4K A;  1KHI A;  4RA8 A;  4O2D A;  4DV7 L;  3VYT A;  1C9O A;  2WKD A;  2UUC L;  3MEF A;  4POF A;  3TN2 A;  5I9O A;  2L0C A;  2UXB Q;  4MTK A;  1NE3 A;  1I4P A;  4DV2 Q;  1CFM A;  2M00 A;  1EU3 A;  1T5X D;  5CBA E;  4LJZ C;  2MP1 A;  3NBI A;  3K5N A;  1ICW A;  2K50 A;  2Z6B A;  2K04 A;  3GV6 A;  3QOL A;  4P71 A;  2B39 A;  5KEE A;  1SJH D;  5HGT A;  1F9Q A;  2EY5 A;  4ZRZ A;  1HZB A;  3A56 A;  5I4D A;  3T1H L;  2K5W A;  1YVC A;  2C35 B;  3CCQ A;  3MXU A;  4ZQ3 A;  2JA5 H;  1HHV A;  3PO2 G;  2RCF A;  1CA5 A;  1HA5 A;  4KHZ A;  1EQT A;  5E4W C;  2R61 A;  1SE2 A;  3HRZ C;  5C4X B;  4X64 Q;  1YNJ D;  2QW7 A;  2E74 C;  2MHV A;  4OHJ A;  4G7H C;  1J9O A;  2AKW B;  2WB1 B;  2HIX A;  4NKL A;  4A3K B;  3CQZ H;  4AYB B;  3I4M B;  1RIP A;  4DR5 Q;  3VR5 A;  2VUM B;  5G3L F;  1RDP D;  5BN5 A;  1WVL A;  3F8T A;  1X3P A;  2CW0 C;  1M1K C;  4LNQ A;  4DAP A;  5LMN Q;  2BA1 A;  1ONL A;  4OON A;  1HXY D;  1PH1 A;  1E24 A;  1S3O A;  3NTK A;  2EYJ A;  1X65 A;  2Z1C A;  3H0G G;  4BXX H;  1YJN A;  3NEN A;  1YHB A;  3SK5 A;  3E0J A;  5C3X A;  2EJM A;  3UDX A;  3CRL C;  2A69 D;  1Q86 C;  2ZJP A;  1X55 A;  1A3U A;  1XMO L;  1G91 A;  1O7Z A;  4ID6 A;  4TQU S;  1PRT D;  3V05 A;  2ZM6 Q;  1YNX A;  2VQF Q;  2Z0S A;  1PTO C;  4MIU A;  1YHA A;  3A55 A;  3CD6 A;  1IKM A;  4NW2 A;  2E5L Q;  3HOV H;  3K0Y A;  3MEH A;  3K7A H;  4PZ7 A;  3ERO A;  2HIV A;  2YTV A;  5IYC G;  2TMP A;  5HGQ A;  3HOW B;  4JI5 Q;  3HOU B;  1KRS A;  2JXM B;  2K5N A;  1CUK A;  2B2T A;  2PNR C;  1X3G A;  2OTL A;  4UPA A;  1Y8P B;  3PIP A;  1D8L A;  3K6O A;  4L5Q A;  4FF4 A;  2L12 A;  1IBK L;  4MTN A;  4M8A A;  4C3J G;  4GZY C;  1HNZ Q;  5JJI A;  1IBM L;  3EFX D;  4RGN A;  2NZ1 D;  3KK7 A;  1IKL A;  3RR5 A;  1O7Y A;  1SMX A;  5FLX c;  1SR3 A;  4RHS A;  2QEJ C;  1MBY A;  3I8Z A;  5LHY 1;  1HA6 A;  2KEE A;  3PIO A;  1Y1V H;  1LTB D;  2JA8 G;  1EZ6 A;  1NY4 A;  5LL6 X;  1QUQ B;  2F0O A;  1TY2 A;  1ESR A;  2D62 A;  4LF6 L;  4ZUI A;  1AZQ A;  4DUZ L;  2N3S A;  3S1M B;  2OF1 A;  1WFQ A;  4QB4 A;  1N33 Q;  2E2J B;  2QGQ A;  4PQX A;  2CQA A;  5COY A;  5C3E B;  1F9S A;  1OO9 B;  3Q0A A;  4DR4 L;  4FYD A;  5JEA J;  1EY9 A;  1Z9F A;  2K5V A;  3KBG A;  2Q8T A;  5M5Y H;  4TSS A;  3IFT A;  1TS5 A;  1DXM A;  4A93 B;  2RHS B;  1AFP A;  4A3E H;  1JIC A;  1RTN A;  1K73 C;  4L63 B;  3GTJ B;  2X69 A;  4OWX B;  2RSN A;  1VQC A;  2EYF A;  5D14 A;  5T1G A;  1SN8 A;  3F2D A;  4BBS G;  2Q2I A;  1Z6H A;  4IPG A;  3S15 H;  1LT4 D;  1MKH A;  1EOT A;  4DR3 Q;  2E76 C;  1X56 A;  4RH6 A;  3I4N B;  3J81 c;  1Q90 A;  2D0O A;  3NSW A;  5IGG A;  1JT8 A;  4HAE A;  3PIO 3;  1O78 A;  4YWL A;  5IT9 E;  1JR0 D;  3HS0 C;  1U4P A;  4I7Z C;  2AQ1 B;  2F0D A;  1NTG A;  4APV A;  1VQ9 A;  2KUM A;  4CJ1 B;  2RVL A;  4DR2 L;  3L3O C;  3D3R A;  2A6H D;  2IW3 A;  3AQQ A;  1TS2 A;  2F0E A;  1IYU A;  4CJ2 C;  1STE A;  1MJE A;  4GKJ Q;  3SE0 A;  3CMA A;  1TWF H;  3PO2 B;  3GTG B;  1PYW D;  1YZ6 A;  4K6D A;  1HQM C;  2SNM A;  2A5H A;  3VR4 A;  4DUY Q;  1CHP D;  3Q22 A;  3LWU A;  2EYM A;  4DK6 C;  2KJX A;  2OXP A;  4H02 A;  3KJO A;  2F0S A;  3H09 A;  2KQ3 A;  3ULJ A;  3A5U A;  3CPW A;  1AN8 A;  1I5F A;  3OPO A;  1J5E L;  2R7D A;  1KQS A;  5ELF A;  2UUA L;  4OIK A;  1CI3 M;  3K7U C;  4A3K H;  2OT2 A;  4I65 A;  1KAB A;  3MXN B;  1SJE D;  4JI0 Q;  1KNE A;  4LUZ A;  2GN5 A;  3KFU A;  4ZK9 B;  3FDT A;  4X66 Q;  4EQN A;  2ICE C;  1EIG A;  1DGS A;  1G2S A;  5IGE A;  4IUV A;  3H0G B;  2Q2H A;  4HJ5 A;  3MC0 B;  5IGC A;  1P8L A;  2F0Q A;  1Y14 B;  2D9U A;  4GLV B;  1E1T A;  3GTK B;  1ZXT A;  2RHQ B;  4B3S L;  4LUO A;  2F0F A;  4JVZ A;  2PI2 E;  4DV0 Q;  5M3F H;  4J1M A;  3LNN A;  3O13 A;  3OIP A;  1S4Z A;  3GO5 A;  3T4A C;  3FVQ A;  1LT6 D;  3S24 A;  3BU2 A;  1KLG D;  1WTP A;  3CRK C;  4K8I A;  1LT3 D;  4LF6 Q;  3OSO A;  1HPC A;  1KRT A;  1JJ2 A;  4PMW A;  1VDZ A;  1BOS A;  2ZXO A;  1DZ1 A;  4N9P A;  4UP9 A;  2HHH Q;  1D5X C;  3HOW H;  2JA7 H;  3MWY W;  1VQN A;  1STH A;  1VQJ A;  5IT9 L;  3HOU H;  2BE5 D;  4TKO B;  2O2L D;  4C3J B;  1PZJ D;  4DV4 L;  4X65 Q;  5IYD G;  1V9P A;  2JP1 A;  3KF6 A;  4J15 A;  5IP7 H;  3U9S A;  1O7L A;  3DWP A;  5G3L D;  3CKI B;  1VQ4 A;  2NVQ B;  3ULL A;  2JA8 B;  3CCJ A;  1RCV D;  1QJO A;  2L1B A;  4ILW A;  4RAU C;  1CZW A;  1K8O A;  1HTL D;  3PO3 G;  1ET9 A;  3I73 A;  5DNF A;  1AW7 A;  1TWH B;  2OCE A;  1NMG A;  3NBH A;  4YCV A;  2RF4 A;  3RLN A;  3U4Z A;  4JI1 Q;  4K0K L;  2Q8R E;  1QNK A;  4H0L C;  3OMC A;  1KDB A;  1PTO H;  1CQV A;  3Q8D A;  2E2D C;  1S5C D;  4IFD H;  2PZT A;  1U4L A;  3NEM A;  1N32 L;  2A68 C;  3EA6 A;  3BVZ A;  3H3V H;  5C3E H;  1LV9 A;  5E4X A;  4BY7 H;  1ET6 A;  1YNN D;  4JW0 A;  1EY8 A;  3GTM B;  4KY5 A;  2F0V A;  2N8N A;  1RF2 D;  1GUG A;  1XNR L;  4A93 H;  1ROD A;  3I2Z A;  5TSS A;  2ZXP A;  1EUJ A;  2NVX B;  5KRU A;  3I70 A;  2AQ2 B;  4BBS B;  1KAW A;  3GTJ H;  5IWA Q;  1HUM A;  4UHV A;  3MXG A;  1LTR D;  3TQY A;  1K9M C;  3P7J A;  4KV6 A;  2EZV A;  3S1R B;  1VQ6 A;  4DNR B;  1BUV T;  4HJA A;  1M4V A;  1Q81 C;  4JBM A;  1ASZ A;  1J5E Q;  1PTO F;  3I4N H;  1PH7 A;  4DR7 Q;  3FHW A;  4DXG A;  4XTC S;  2IT1 A;  1VQL A;  1BQQ T;  3I7F A;  3TZD A;  2F4V Q;  3CCR A;  1HZ9 A;  4BS9 A;  3PV0 A;  3T1Y Q;  4DNT B;  3HP3 A;  4BBR G;  2A74 C;  3TBI B;  1VQG A;  4X6A H;  1H9S A;  3E5S A;  3MHB A;  4LFB Q;  1VQM A;  3M4Y A;  2F0K A;  1D1I A;  2RSO A;  2CHB D;  1QZG A;  4B3S Q;  3IL8 A;  4JCV E;  1I4G A;  3C1E A;  4A3C H;  4K2L A;  4U68 A;  4OL7 A;  3JAM i;  3GTG H;  4BY1 G;  2Q2U A;  4RGM A;  3CXC A;  1T5E A;  2MJ8 A;  3NQT A;  2PW7 A;  1SXT A;  2DY7 A;  4BWG B;  5IE8 A;  5D3I B;  3ITP A;  5F2D A;  3Q6S A;  4OEM B;  4IN3 A;  1DYQ A;  1I4Q A;  3SHL A;  3HKS A;  2UXC L;  3CU7 A;  3ICE A;  4Y52 H;  4PMC A;  4EQ5 A;  1WI5 A;  4K2K A;  5GAE C;  2NVY B;  1A3V A;  1HFG A;  2GA4 B;  1SSO A;  2MO1 A;  4H44 C;  4XQN A;  4QQB X;  2WAQ G;  2L11 A;  3J81 E;  3PUY A;  1EQQ A;  5I9P A;  1N34 L;  1WTH A;  2XRS D;  2KEC A;  4FF2 A;  3KYH C;  1CTM A;  1NNX A;  3SVM A;  3RZO H;  2B2V C;  3J80 c;  2XWJ B;  3GTQ H;  2QCP X;  3GTK H;  3RUZ A;  1JMC A;  2F0L A;  5A35 A;  4YIJ A;  1AE2 A;  2L55 A;  1WTO A;  4IAL A;  1G6Z A;  1A8V A;  5M5W B;  5EAY A;  1JB3 A;  2VQE Q;  1STG A;  2KEN A;  1XPR A;  1VMC A;  1X6O A;  4A3J H;  1GVP A;  2F0I A;  4HIO A;  1D2B A;  1GUS A;  4XQJ A;  2BDO A;  1N32 Q;  4B9X A;  4HTH A;  4CKC A;  4A3G G;  1T9H A;  3QOJ A;  1WTW A;  5I6W A;  1GJX A;  3L0O A;  1AE3 A;  1SDF A;  5GRO A;  1TY0 A;  4DNI A;  1DCZ A;  1W2B A;  5JJL A;  4YHH Q;  3BG3 A;  1YJ9 A;  1Y1W G;  1G8Z D;  1QIL A;  3EBE A;  2JA9 A;  3STB D;  4NXM L;  5FLX L;  1PMR A;  1L1O B;  4AH6 A;  2NYZ D;  1EYC A;  1IL2 A;  1PYB A;  5JOB A;  5IIF A;  2B2V A;  4DV3 L;  3A74 A;  3W1B A;  2NVQ H;  1SNP A;  3PO3 B;  4B3R L;  3OHX C;  2KED A;  3M4Q A;  4DV1 Q;  1VQ8 A;  4HID A;  3IKJ A;  2WAQ E;  5AJ3 Q;  1VQ7 A;  2XWB B;  4HN7 A;  1B3Q A;  4MZ9 A;  3B6Y A;  2NUC A;  2UXD L;  1K8G A;  4CJ0 B;  2RDF A;  1SAP A;  1D5Z C;  1TWH H;  2TSS A;  3CME A;  1A2T A;  3NTH A;  3CF5 A;  2WFW A;  4XT1 B;  3SK8 A;  5C3W A;  2LS0 1;  3S17 B;  2VW9 A;  3R8B A;  4X3U A;  2Z8L A;  4FVM A;  2WIN B;  3AMU A;  3CW2 C;  1KC8 C;  4JV5 Q;  4BA2 I;  4DV5 L;  5FO7 B;  5BN4 A;  1WTR A;  2DNE A;  1HUN A;  1N36 Q;  1VQA A;  3ND9 A;  3TEH B;  4DKA C;  1LTG D;  1VMP A;  4KY7 A;  3GTM H;  1LAC A;  2VNU D;  1WCM H;  2FMM A;  3PMF A;  5D3D A;  3ERS X;  3HOZ G;  1SMY C;  4DA2 A;  4P74 A;  4KHP Q;  3J81 L;  5C0X J;  1Q7Y C;  4BBS H;  3V2T A;  2CFM A;  4IO9 A;  3A7L A;  1V8Q A;  3DWQ A;  3E9I A;  3OIQ A;  3S1R H;  4GOP C;  2QKI C;  3RN5 A;  2EYL A;  2WII B;  4GNX B;  1F2M A;  5DAU A;  4PMB A;  2UXC Q;  1PFN A;  4GS3 A;  2DJG C;  1F9R A;  1R9T B;  2RA4 A;  2K03 A;  2EYP A;  3QG1 A;  4NDX A;  4OGQ C;  1VF5 C;  4IZ8 A;  4GN4 B;  1VQF A;  1R4P B;  4S3S A;  3FP9 A;  4IUU A;  1K0R A;  4BBR B;  2GVB A;  1KTK A;  1BKB A;  3NE5 B;  1FJG L;  1N34 Q;  5IYB G;  2O4X A;  4JI8 L;  4X62 Q;  3HG9 A;  3SK4 A;  1W6J A;  3DXJ C;  1CK1 A;  4BY1 B;  2F3V A;  3RN2 A;  3DEO A;  3SXH A;  4QCL A;  3OOC A;  3EJI A;  5JVH 3;  3BYT B;  4A4I A;  1BO0 A;  3A54 A;  4ZKB B;  4DR6 Q;  1LT5 D;  4NB3 A;  2CW0 D;  3G6J B;  4F88 A;  1QG7 A;  3Q23 A;  4OX9 L;  4B3M Q;  4GOP B;  3DM1 A;  4YY3 Q;  1XMQ L;  1PA6 A;  1ENA A;  3A8K E;  4HCS A;  1S5F D;  3ERQ A;  1SBB B;  3DMU A;  4IPH A;  5EKK A;  5JVG 3;  2K1B A;  4LW1 A;  2N78 A;  2QIL A;  4LF9 Q;  4LWC A;  4FXD A;  1VQP A;  2WAQ B;  2JA6 G;  3PF4 A;  4X3K A;  4DV6 Q;  1PDQ A;  1BBX C;  1GKH A;  3NPP A;  3ONA B;  4A3F G;  5EBC A;  1PTO D;  2JK8 A;  1WYD A;  2JSO A;  2AWN A;  5EPK A;  4KN7 C;  1PFM A;  1R4Q B;  1W3S A;  1WD1 A;  1K28 A;  2NVT B;  4IQZ A;  3J7Y W;  4C1N K;  2MGS A;  3UDF A;  3VA7 A;  1JB7 A;  4IUQ A;  4KKT A;  1JC7 A;  1GXD C;  3GQB A;  1TS3 A;  1XTD A;  5ELB A;  2XN9 C;  2MFI A;  3BYY B;  1Q82 C;  1L0Y B;  3AFQ A;  2PZW A;  4N8F A;  4P2C B;  3CP0 A;  1PFB A;  1LTT D;  3P1H A;  4EX5 A;  1AZP A;  1G2T A;  1JOQ A;  2YTX A;  5K5P A;  4C3H G;  1NMF A;  2A8V A;  1YEZ A;  3H3V C;  1SYG A;  4YWK A;  1QVG A;  1Y1W B;  3TP6 A;  3T53 B;  4FP5 D;  4AQY Q;  1V1P B;  1J6Q A;  2PW5 A;  4LF7 L;  1CZG A;  5IYD H;  5M5X H;  1M90 C;  1TVX A;  1JWM D;  2VL6 A;  2PZU A;  2ES2 A;  1EY7 A;  1ILP A;  1CKN B;  1CKN A;  2RDG A;  1SFO B; 
#chains in the Genus database with same CATH homology
 4K5W A;  3LWE A;  1HQR D;  4FXG C;  1OXV A;  3D8G A;  2L5T A;  1W6K A;  3HOX B;  4G7O C;  4PV1 C;  2QDB A;  4UDU C;  1OXS C;  5ELC A;  1RD9 D;  1PZK D;  5KIX A;  5ELE A;  2NWG A;  4ME5 A;  1KLU D;  3J80 E;  4QMG A;  4JBW A;  3S14 B;  4R9W A;  2K01 A;  2A6E C;  4DGZ A;  2F0N A;  1QE6 A;  4ODG A;  4DF7 A;  2F0U A;  2FFK B;  2PO4 A;  3OWE B;  2KCN A;  1SYF A;  2X6L A;  2EYH A;  4N9T A;  3A8J E;  4MN3 A;  1SNM A;  2EJF C;  3VYU A;  4UAI A;  3K5L A;  1OXX K;  3RLF A;  2CVR A;  2L4N A;  1ESF A;  5KNC A;  2KCC A;  2VXW A;  3J7A V;  4QF4 A;  4V19 0;  3T16 A;  4RKL A;  3L9A X;  5C4H A;  1RHP A;  1PRT B;  4Q5V A;  2EDG A;  4IUP A;  4QUF A;  1Q3L A;  3MZ5 A;  1J8I A;  3I91 A;  1CHQ D;  1Y69 U;  4L8J A;  4QUC A;  4HCE A;  3NQI A;  3TP7 A;  2PYK A;  4FNF A;  4DXF A;  1CQF A;  2D2C C;  4RWS C;  1Z47 A;  2YU9 B;  3BZD B;  1H9R A;  4RKB A;  2IL8 A;  5J1Z A;  3IFD A;  2NTS A;  4X3T A;  1TR5 A;  2JA6 B;  5C4Z A;  2KHS A;  2E2H B;  1X3Q A;  4A3F B;  3MXN A;  5EBD A;  2IX3 A;  3J80 L;  2DNC A;  3SDZ A;  1SNQ A;  4LAA A;  2KA7 A;  3S2H B;  1MGS A;  5CV5 A;  3M3Y B;  1BR9 A;  5KNB A;  1I3Q B;  4FXK C;  3BS1 A;  1IL8 A;  2N88 A;  2IX0 A;  5J22 A;  4OO1 I;  3BDL A;  1JOK A;  5A2Q L;  3RZD B;  5KND A;  5CC4 A;  1JWU D;  4C3H B;  2J7Z A;  1HRJ A;  4OO1 G;  2BCO A;  2O5I C;  3S9W A;  1X32 A;  3OWF A;  5AFW A;  2L9H A;  2EY6 A;  3J7A F;  1GUW A;  1B50 A;  2EVB A;  3RD4 A;  4G7Z C;  3FEW X;  1EL0 A;  4F8M A;  4A3I B;  4A3D B;  2A68 D;  1WTX A;  2SNS A;  4U67 3;  4EVO A;  1RKN A;  1VF7 A;  1B2T A;  1SNO A;  2B63 B;  4XDX A;  3NHH A;  4HED A;  3SR1 A;  4LK1 C;  3W2D A;  5JEA H;  1U9R A;  1I50 B;  1NR2 A;  1A2U A;  3AB9 A;  5ELD A;  4KJO A;  5CV8 A;  5C0X I;  1NCV A;  3HEJ A;  4ZKC B;  2IX1 A;  2OEO A;  1ENC A;  4NMZ A;  5IGB A;  4C3I G;  2RDH A;  4XYQ A;  5C0X G;  1PXU A;  3BVG A;  2EXZ A;  3MFY A;  3A8I E;  3TSS A;  2EYO A;  1DD2 A;  2HCC A;  4Y7N B;  2SDF A;  5COR A;  3GTL B;  3MXP A;  5HUR A;  3DEP A;  1G29 1;  5FK9 C;  1FD7 D;  1MI2 A;  5IOC A;  2ZT9 C;  2C5C A;  2K5D A;  1SE3 A;  4PNY A;  2XRQ D;  3K58 A;  1LTS D;  1ML0 D;  2EPB A;  3MVV A;  5FLX E;  1JQY D;  3KLS A;  5I6Y A;  3N52 A;  4EQP A;  2V4D A;  3I3C A;  2R93 B;  3L7Z C;  2JYO A;  4H7B A;  3I4L A;  4ULL A;  2K33 A;  1GUN A;  2XNA C;  2I07 B;  3QIA A;  1F2Z A;  5KYI A;  5M3M B;  2R6G A;  1UEA B;  3MTS A;  4MHE A;  3C2P A;  3VR6 A;  2XIW A;  5EPL A;  3NXW A;  3T13 A;  3VYS A;  2SOB A;  1EWC A;  4FF3 A;  2JE6 I;  4CGY B;  3BDO A;  4R8I A;  3UI2 A;  1S5E D;  3NUC A;  3CQZ B;  5EKI A;  4CKE A;  1DOM A;  1EFI D;  2WAC A;  4K5V A;  3C1F A;  3GV3 A;  3M7G A;  3E6Z X;  3TP5 A;  1KDC A;  4IUR A;  1IW7 C;  1TU2 B;  3FKI B;  4KK7 A;  1ZYR C;  1LLR D;  1OXU A;  2FHT A;  1B4O A;  1DM0 B;  3FPP A;  1AEX A;  1ZKO A;  2VB2 X;  4V0B A;  1EY0 A;  1TKW B;  3K7A B;  5FO8 B;  1TWG B;  4XQQ A;  1IYV A;  2LMC B;  4FF1 A;  3TDQ A;  3HOY B;  3LX0 A;  1EEF D;  3EQL C;  3T51 B;  4WOR A;  5LL6 S;  1O80 A;  1QWY A;  5KGU A;  1NUC A;  1SMY D;  3QWN A;  2NB0 A;  1CT1 D;  4C3I B;  1QCB D;  5E1F A;  4A3B B;  4IFD I;  2XSC A;  1B44 D;  3VR2 A;  2F0G A;  1EQV A;  5DM6 3;  3PUX A;  4C2M B;  2WP8 J;  1MSG A;  4IFD G;  1B1Z A;  5CGK A;  1JE4 A;  5M5Y B;  3AU7 A;  1U4R A;  5KYL A;  3U9O A;  3PUW A;  2KOL A;  4C1N I;  5M9O A;  2DY8 A;  2PPB C;  3C3L A;  1Q1B A;  5DM7 3;  2R7Z B;  1BCP B;  2K05 A;  4KD3 A;  2AQ3 B;  2WKC A;  2J0T D;  3A7A B;  4OIJ A;  3M4O B;  1TWC B;  1STA A;  3D4W A;  2A73 B;  4XXE A;  3WDN A;  5CYU A;  4K14 A;  2R92 B;  2MUY A;  4X3S A;  1TWF B;  3IAY A;  3BVM A;  1FNU A;  3EVQ A;  1LTI D;  1B9N A;  3F2U A;  3KLS X;  3MAQ A;  4KD4 A;  3S1Q B;  1D1K A;  1HTP A;  1STY A;  5EQ0 A;  4F87 A;  2K6A A;  3H91 A;  2HQE A;  5EPJ A;  4KTA A;  1WD0 A;  1A15 A;  2EE1 A;  1FR3 A;  4KKS A;  1DOK A;  5CV6 A;  3NWS A;  1H9K A;  4BA1 I;  2G9H D;  2B2T C;  3DUZ A;  1YNJ C;  1NSN S;  3D6C A;  4OO1 H;  1NR4 A;  1Z7T A;  2RKS A;  2KVM A;  4KMU C;  4KHV A;  1EY5 A;  4A3G B;  5K36 G;  5D65 A;  5M3F B;  2X6G A;  4KN4 C;  1H9J A;  3I90 A;  4KJN A;  1V1P A;  3TZU A;  3Q24 A;  3QO2 A;  1IHZ A;  3R3O A;  3VYR A;  2F1M A;  2M2L A;  5J39 A;  5C44 B;  1EEI D;  2A6E D;  1S5B D;  3QJY A;  3GD7 A;  1XXG A;  3FPU B;  2JA7 B;  1C8C A;  1XX8 A;  2A69 C;  4RHR A;  4Z9C B;  1C48 A;  1PRT C;  2WV6 D;  3GP7 A;  4DK1 A;  2K28 A;  2K32 A;  4HR7 B;  5JPM C;  4ZYS A;  5EKL A;  3K57 A;  1JOR A;  2LFN A;  1SYE A;  5C0X H;  1PLF A;  1E2V A;  1PTO B;  3HOZ B;  3GTO B;  2HCI A;  3K5O A;  3C46 A;  1C4Q A;  1EU4 A;  5A2Q E;  4HSV A;  2EOT A;  3HKZ B;  4DK0 A;  3RMH A;  5T1I A;  4K8J A;  1KDA A;  4BY7 B;  1I4X A;  4IFD J;  2NN6 I;  1II3 A;  1I4H A;  2JEA I;  4RGT A;  1GUT A;  1XTC D;  3GTP B;  3M7N A;  3PIP 3;  2BOS A;  1JCK B;  2NN6 G;  4WRD A;  3T56 B;  5CV7 A;  4ZAI A;  1V43 A;  3S1N B;  4LMQ D;  1F2L A;  4K5X A;  3X3N A;  1EY6 A;  2H4O A;  4B9W A;  1SYD A;  2Q8I B;  1L0X B;  3NWT A;  4XYO A;  2NBF A;  4K6L A;  1BDO A;  4TRD A;  4A3M B;  1ILQ A;  2YYZ A;  4ZLT F;  1FYC A;  2G9D A;  5IGF A;  2LKV A;  2B2Y C;  5FO9 B;  2Y0S B;  1PZI D;  1F77 A;  2HDL A;  3H6M A;  1FNW A;  1GOZ A;  1BCP F;  5JJZ A;  5IGD A;  3DHQ A;  1TWA B;  2A6H C;  3NK9 A;  1BXT A;  1B9M A;  1QNU A;  4H13 C;  4QIW B;  1I6V C;  4HMI A;  2IPK D;  3BDC A;  3D31 A;  2Z4I A;  5FKA C;  5C5L A;  2AUK A;  3R2I A;  2DN8 A;  3V96 A;  1Q8I A;  1E0B A;  2E2I B;  4RGO S;  1OXT A;  3RZO B;  1TQO A;  4J6H A;  3GTQ B;  1E2W A;  1LTA D;  4NP5 A;  2B2Y A;  3R2T A;  3X3M A;  2E75 C;  2F0J A;  4DU9 A;  4F7X A;  1XYI A;  1A6X A;  1Y8N B;  4A3J B;  3KUP A;  2XVS A;  2C9O A;  3I72 A;  3HGB A;  2D5D A;  2EY2 A;  1SEB D;  5DEH A;  5CBE E;  2B8F A;  5JPN C;  5I2Y A;  2ID0 A;  1DOL A;  3HZX A;  2N55 A;  3D4D A;  1I4R A;  2O5J C;  1RJT A;  5BN3 A;  3NTI A;  1DJR D;  1FNV A;  1Q12 A;  3KF8 A;  1D6E C;  1CM9 A;  2B8G A;  3VR3 A;  2MPM A;  4KI0 A;  4FO2 A;  2M9V A;  2F0W A;  2IJ0 A;  3WOF A;  1F9P A;  1EIH A;  2BE5 C;  2Z4H A;  4R8N A;  3JAM E;  1SND A;  5EJW A;  2F4I A;  2NTT A;  4IUT A;  2QF7 A;  4O42 A;  1EZ8 A;  1FGB D;  1Q1E A;  1UNS A;  2HUG A;  1SYB A;  3FMC A;  1GHJ A;  4HMJ A;  3S2D B;  1CA6 A;  1KAA A;  1WCM B;  1V1O A;  3ZYY X;  4G4K A;  2LY7 A;  5E3F A;  2F3W A;  2B2U C;  5JAV A;  2SEB D;  2J4X A;  4JK1 C;  2I46 A;  1K83 B;  1XWE A;  1SNC A;  4CHT B;  1HFN A;  2FMC A;  1TS4 A;  1YNN C;  1TII D;  4CKB A;  4HSP A;  4L6T B;  1EY4 A;  3NP8 A;  4RCO A;  2F0H A;  3G7L A;  1MSH A;  3KBX A;  4KY6 A;  3FRP B;  4DFA A;  4DAV A;  1TT2 A;  3D6W A;  2RBM A;  1BF4 A;  5FOB B;  3CHB D;  1H9M A;  2EJG C;  1PRT F;  1H9S B;  1S5D D;  2BA0 A;  4O1N A;  2FJ2 A;  5EGT A;  4RFB A;  2B2U A;  2JA5 B;  2ICI A;  1QB5 D;  3MA2 B;  3M85 A;  2FIN B;  5CV9 A;  1GHK A;  3SEB A;  1IW7 D;  1E2Z A;  2K7V A;  1AP0 A;  3PUV A;  1ZYR D;  1LAB A;  1VCI A;  5CMD A;  2H1E A;  4EGV A;  1WTV A;  1A3T A;  1BNZ A;  3K5M A;  1QOH A;  3JAM L;  5C6A A;  4EQO A;  2HDM A;  1HCZ A;  3N6R A;  3P20 A;  5CV4 A;  3VA5 A;  1B53 A;  5IOD A;  5K36 H;  3R93 A;  1MD2 D;  2ZXR A;  1ZEQ X;  2RQX A;  2F0T A;  1SE4 A;  2ENB A;  3TME A;  3SK6 A;  5C5M A;  3PUZ A;  2PMZ B;  2EY1 A;  2F0P A;  3MFG A;  3HOV B;  1EYA A;  1UUP A;  3W3A A;  1STN A;  2PQE A;  3K59 A;  4J8Q A;  4C56 C;  2PCF B;  3DWA A;  4IUN A;  2BDN A;  4G57 A;  2JEB I;  2F0M A;  3QB3 A;  1BCP D;  2IWH A;  5M5X B;  3TP8 A;  2AUJ D;  1K8M A;  5ISR A;  4DAY A;  1F2Y A;  1EWH A;  4RCN A;  5I2X A;  1KNA A;  5C4J B;  4Q0F A;  2AWO A;  1NAP A;  3URY A;  1D5M C;  2B2W C;  1B3A A;  1JWS D;  4M1U B;  1M8A A;  1Y1V B;  1DON A;  3WOE A;  3H94 A;  3OW7 A;  1RTO A;  4ABN A;  1BCP C;  1I6H B;  3OMG A;  3D4R A;  4DN4 M;  5JEA G;  3S16 B;  4E6I A;  2R3Z A;  1LO5 D;  1WTQ A;  1STB A;  1SYC A;  5CR3 A;  4WFN 3;  4A3E B;  1UAP A;  2K5Q A;  3KLR A;  4CBV A;  1JOO A;  4WJW A;  4XIG S;  2VB3 X;  2NN6 H;  1Y8O B;  4XT3 B;  1U4M A;  3P75 A;  2B2W A;  5NUC A;  4B08 A;  4ZUJ A;  4KKU A;  1EYD A;  3S15 B;  2F03 A;  3ND8 A;  1GUO A;  1ENF A;  4RA8 A;  3VYT A;  2WKD A;  5I9O A;  3TN2 A;  2L0C A;  1I4P A;  1CFM A;  2M00 A;  1EU3 A;  1T5X D;  5CBA E;  4LJZ C;  2MP1 A;  3NBI A;  3K5N A;  1ICW A;  3GV6 A;  2K04 A;  3QOL A;  5KEE A;  2B39 A;  1SJH D;  5HGT A;  1F9Q A;  2EY5 A;  4ZRZ A;  3A56 A;  5I4D A;  2K5W A;  3MXU A;  4ZQ3 A;  1HHV A;  1CA5 A;  1HA5 A;  4KHZ A;  1EQT A;  5E4W C;  2R61 A;  1SE2 A;  3HRZ C;  5C4X B;  1YNJ D;  2E74 C;  2MHV A;  4OHJ A;  4G7H C;  1J9O A;  2WB1 B;  4NKL A;  4A3K B;  4AYB B;  3I4M B;  3VR5 A;  2VUM B;  5G3L F;  1RDP D;  5BN5 A;  1WVL A;  1X3P A;  2CW0 C;  4DAP A;  2BA1 A;  1ONL A;  1HXY D;  3NTK A;  2EYJ A;  2Z1C A;  3SK5 A;  5C3X A;  3E0J A;  2EJM A;  3CRL C;  2A69 D;  1A3U A;  1G91 A;  1O7Z A;  4ID6 A;  4TQU S;  1PRT D;  3V05 A;  1PTO C;  4MIU A;  3A55 A;  1IKM A;  4NW2 A;  3K0Y A;  3MEH A;  3ERO A;  2TMP A;  3HOW B;  3HOU B;  2JXM B;  2B2T A;  2PNR C;  1Y8P B;  3K6O A;  4FF4 A;  2L12 A;  4C3J G;  4M8A A;  4GZY C;  3EFX D;  4RGN A;  2NZ1 D;  3KK7 A;  1IKL A;  1O7Y A;  4RHS A;  2QEJ C;  1MBY A;  3I8Z A;  5LHY 1;  1HA6 A;  2KEE A;  1LTB D;  1EZ6 A;  5LL6 X;  2F0O A;  1TY2 A;  1ESR A;  2D62 A;  4ZUI A;  1AZQ A;  3S1M B;  2OF1 A;  4QB4 A;  2E2J B;  4PQX A;  2CQA A;  5COY A;  5C3E B;  1F9S A;  1OO9 B;  3Q0A A;  4FYD A;  5JEA J;  1EY9 A;  3KBG A;  2Q8T A;  4TSS A;  3IFT A;  1TS5 A;  1DXM A;  4A93 B;  1AFP A;  1JIC A;  1RTN A;  4L63 B;  3GTJ B;  2X69 A;  2RSN A;  2EYF A;  5D14 A;  5T1G A;  1Z6H A;  1LT4 D;  1EOT A;  2E76 C;  3I4N B;  4RH6 A;  1Q90 A;  3NSW A;  5IGG A;  4HAE A;  3PIO 3;  1O78 A;  5IT9 E;  1JR0 D;  3HS0 C;  1U4P A;  4I7Z C;  2AQ1 B;  2F0D A;  2KUM A;  4CJ1 B;  2RVL A;  3L3O C;  3D3R A;  2A6H D;  2IW3 A;  1TS2 A;  2F0E A;  1IYU A;  4CJ2 C;  1STE A;  3SE0 A;  3PO2 B;  3GTG B;  1PYW D;  4K6D A;  1HQM C;  2SNM A;  2A5H A;  3VR4 A;  1CHP D;  3Q22 A;  3LWU A;  2EYM A;  2KJX A;  2OXP A;  2F0S A;  3H09 A;  2KQ3 A;  1AN8 A;  3OPO A;  5ELF A;  4OIK A;  1CI3 M;  2OT2 A;  4I65 A;  1KAB A;  1SJE D;  1KNE A;  4ZK9 B;  3FDT A;  4EQN A;  2ICE C;  1EIG A;  1G2S A;  5IGE A;  4IUV A;  3H0G B;  3MC0 B;  5IGC A;  2F0Q A;  2D9U A;  3GTK B;  1ZXT A;  2F0F A;  4J1M A;  3LNN A;  3O13 A;  3OIP A;  1S4Z A;  3GO5 A;  3T4A C;  3FVQ A;  1LT6 D;  1KLG D;  1WTP A;  3CRK C;  4K8I A;  1LT3 D;  3OSO A;  1HPC A;  4PMW A;  1VDZ A;  1BOS A;  2ZXO A;  1DZ1 A;  4N9P A;  1D5X C;  3MWY W;  1STH A;  5IT9 L;  2BE5 D;  4TKO B;  2O2L D;  4C3J B;  1PZJ D;  2JP1 A;  3U9S A;  1O7L A;  3DWP A;  5G3L D;  3CKI B;  2NVQ B;  2JA8 B;  1RCV D;  1QJO A;  2L1B A;  4ILW A;  4RAU C;  1CZW A;  1K8O A;  1HTL D;  1ET9 A;  3I73 A;  5DNF A;  1AW7 A;  1TWH B;  3NBH A;  2Q8R E;  1QNK A;  4H0L C;  3OMC A;  1KDB A;  1PTO H;  1CQV A;  2E2D C;  1S5C D;  4IFD H;  2PZT A;  1U4L A;  2A68 C;  3EA6 A;  3BVZ A;  1LV9 A;  5E4X A;  1ET6 A;  1YNN D;  1EY8 A;  3GTM B;  4KY5 A;  2F0V A;  1RF2 D;  1GUG A;  1ROD A;  5TSS A;  2ZXP A;  2NVX B;  5KRU A;  3I70 A;  2AQ2 B;  4BBS B;  1HUM A;  3MXG A;  1LTR D;  3P7J A;  4KV6 A;  2EZV A;  3S1R B;  4DNR B;  1BUV T;  1M4V A;  1PTO F;  4DXG A;  4XTC S;  2IT1 A;  1BQQ T;  3TZD A;  4BS9 A;  3PV0 A;  4DNT B;  3HP3 A;  2A74 C;  3TBI B;  1H9S A;  3E5S A;  3MHB A;  3M4Y A;  2F0K A;  1D1I A;  2RSO A;  2CHB D;  3IL8 A;  1I4G A;  3C1E A;  4K2L A;  4U68 A;  4OL7 A;  4RGM A;  1T5E A;  2MJ8 A;  3NQT A;  2PW7 A;  1SXT A;  2DY7 A;  4BWG B;  5D3I B;  3ITP A;  5F2D A;  3Q6S A;  4IN3 A;  1DYQ A;  1I4Q A;  3SHL A;  3CU7 A;  4PMC A;  4K2K A;  2NVY B;  1A3V A;  1HFG A;  2GA4 B;  1SSO A;  4H44 C;  4XQN A;  2L11 A;  3J81 E;  3PUY A;  5I9P A;  2XRS D;  2KEC A;  4FF2 A;  1CTM A;  3SVM A;  2B2V C;  2XWJ B;  2QCP X;  3RUZ A;  2F0L A;  5A35 A;  4YIJ A;  2L55 A;  1WTO A;  4IAL A;  1G6Z A;  5M5W B;  1JB3 A;  1STG A;  1VMC A;  2F0I A;  1D2B A;  1GUS A;  4XQJ A;  2BDO A;  4B9X A;  4HTH A;  4CKC A;  3QOJ A;  1WTW A;  5I6W A;  1GJX A;  1SDF A;  1TY0 A;  1DCZ A;  3BG3 A;  1G8Z D;  1QIL A;  5FLX L;  1PMR A;  2NYZ D;  1EYC A;  5JOB A;  5IIF A;  2B2V A;  1SNP A;  3PO3 B;  3OHX C;  2KED A;  3IKJ A;  2XWB B;  4HN7 A;  2NUC A;  4CJ0 B;  2RDF A;  1SAP A;  1D5Z C;  2TSS A;  1A2T A;  3NTH A;  4XT1 B;  3SK8 A;  5C3W A;  2LS0 1;  3S17 B;  3R8B A;  4X3U A;  2Z8L A;  4FVM A;  2WIN B;  3AMU A;  4BA2 I;  5FO7 B;  5BN4 A;  1WTR A;  2DNE A;  1HUN A;  3ND9 A;  1LTG D;  1VMP A;  4KY7 A;  1LAC A;  2VNU D;  2FMM A;  3PMF A;  5D3D A;  1SMY C;  4DA2 A;  3J81 L;  5C0X J;  3V2T A;  3A7L A;  1V8Q A;  3DWQ A;  3OIQ A;  2QKI C;  2EYL A;  2WII B;  1F2M A;  5DAU A;  4PMB A;  1PFN A;  1F9R A;  1R9T B;  2RA4 A;  2K03 A;  2EYP A;  4OGQ C;  3QG1 A;  4NDX A;  1VF5 C;  4IZ8 A;  1R4P B;  4S3S A;  4IUU A;  4BBR B;  1KTK A;  3NE5 B;  2O4X A;  3HG9 A;  3SK4 A;  1W6J A;  3DXJ C;  1CK1 A;  4BY1 B;  2F3V A;  3DEO A;  3SXH A;  4QCL A;  3OOC A;  3EJI A;  5JVH 3;  3BYT B;  1BO0 A;  3A54 A;  4ZKB B;  1LT5 D;  2CW0 D;  3G6J B;  4F88 A;  1QG7 A;  3Q23 A;  3DM1 A;  1ENA A;  3A8K E;  4HCS A;  1S5F D;  3ERQ A;  1SBB B;  5EKK A;  3DMU A;  5JVG 3;  2K1B A;  2QIL A;  4FXD A;  2WAQ B;  4X3K A;  1PDQ A;  1BBX C;  3NPP A;  3ONA B;  5EBC A;  1PTO D;  2JSO A;  2AWN A;  5EPK A;  4KN7 C;  1PFM A;  1R4Q B;  1WD1 A;  2NVT B;  4IQZ A;  3J7Y W;  4C1N K;  2MGS A;  3VA7 A;  4IUQ A;  4KKT A;  1JC7 A;  1GXD C;  3GQB A;  1TS3 A;  5ELB A;  2XN9 C;  3BYY B;  1L0Y B;  2PZW A;  4P2C B;  1PFB A;  1LTT D;  3P1H A;  1AZP A;  1G2T A;  1JOQ A;  5K5P A;  4C3H G;  3H3V C;  1SYG A;  1Y1W B;  3TP6 A;  3T53 B;  4FP5 D;  1V1P B;  2PW5 A;  1CZG A;  1TVX A;  1JWM D;  2PZU A;  1EY7 A;  1ILP A;  2RDG A;  1SFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...