2EYOA

Crystal structure of staphylococcal nuclease mutant t120s
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNSHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyoA00
1A2UA 2O4XA 3NUCA 3SHLA 1KAAA 2F0NA 5J1ZA 1EY7A 4ME5A 1SYBA 5M9OA 5IGGA 3DHQA 5EKLA 5KRUA 1JOOA 1SNCA 2F0PA 3D4WA 3H6MA 1F2YA 2KHSA 5ISRA 5C6AA 5EKKA 2SNMA 4B9XA 3TP8A 2F0DA 2NUCA 3SR1A 3DMUA 1U9RA 3QB3A 5IGEA 5C5MA 5KEEA 2F0IA 4KTAA 5JAVA 1A3VA 5KGUA 4IALA 2F0HA 5E1FA 5EGTA 4NKLA 4J6HA 2F0EA 4RKBA 3OWFA 5HURA 1STHA 2EY6A 3EJIA 3T16A 5C3WA 2OF1A 5IGCA 2EYOA 1SNDA 4YIJA 4R8NA 2RDFA 4PMBA 3SK4A 4N9TA 4J1MA 3C1EA 1SYDA 3E5SA 3QOJA 1SYEA 1EY9A 3OSOA 4KHVA 4KY6A 3SK6A 1EY8A 1STGA 2M00A 1EY4A 3LX0A 4WORA 2F0GA 5CV5A 4KD3A 2EXZA 1ENAA 2ENBA 2PW7A 3OMGA 3ERQA 4KJOA 4F7XA 5C5LA 3BDLA 2HQEA 5DAUA 5IGFA 4OL7A 4NDXA 2F0FA 3ITPA 4NP5A 5CGKA 1SNMA 3NP8A 1SNQA 2F0WA 2F0LA 1KDBA 1STYA 3MXPA 3MHBA 1EZ6A 1SYFA 3NHHA 1SNOA 1NSNS 1TT2A 2WACA 1KDCA 2F0QA 4KD4A 3C1FA 1EYAA 5F2DA 2EY5A 5I9PA 3EVQA 3RUZA 3SK5A 1A3TA 1NUCA 3P75A 4N9PA 4QB4A 4PNYA 5JOBA 1II3A 4DU9A 2OEOA 4K5WA 5K5PA 1IHZA 1EY5A 5IIFA 1EY0A 2F0KA 4ODGA 4DGZA 1EY6A 1TR5A 2F0TA 2EYPA 3MVVA 1EYCA 2LKVA 2KQ3A 2SOBA 2SNSA 3SXHA 5IGDA 4F8MA 4QMGA 4MIUA 4TRDA 3EROA 5IODA 2F0MA 5KYIA 4HMIA 5CV9A 4KV6A 2PZUA 2EYFA 4QF4A 3SK8A 5J22A 4KY5A 3NXWA 5C4ZA 2PQEA 3S9WA 4K8JA 1STBA 5CV8A 3PMFA 3HZXA 5I9OA 4HTHA 2RKSA 1KDAA 4H7BA 5CV4A 4HMJA 3D8GA 1RKNA 4PMCA 3VA5A 2EYMA 4ZQ3A 5IOCA 4K2LA 3QOLA 2PW5A 4K14A 4G57A 1ENCA 4LAAA 3P1HA 5C4HA 1SNPA 1SYGA 2EYHA 2EYJA 2F0SA 3MZ5A 3NQTA 4ZUJA 4IUNA 3TMEA 3U9OA 2PYKA 4EQNA 4EQOA 5NUCA 5KYLA 1STAA 1F2MA 4K2KA 4IZ8A 1EQVA 2QDBA 4K8IA 4KJNA 4WRDA 4S3SA 5CV7A 2F0OA 5DEHA 1JOKA 5E3FA 4EQPA 5IGBA 1EYDA 4B9WA 2PZWA 3R3OA 1JOQA 1STNA 4KY7A 1F2ZA 3V2TA 1A3UA 4ID6A 4I65A 2F0UA 2F0JA 4K5XA 3OMCA 2OXPA 5J39A 3D4DA 4ZUIA 1AEXA 5HGTA 5CR3A 5CC4A 4DF7A 3HEJA 2F3WA 4EVOA 4K5VA 4NMZA 2F3VA 3BDCA 5C3XA 4K6DA 2PZTA 1EZ8A 2EY2A 3TP5A 2EY1A 5I6WA 2F0VA 3MEHA 1JORA 3TP6A 2RBMA 5CV6A 4RKLA 5KIXA 3T13A 1TQOA 1KABA 4DFAA 5I6YA 1A2TA 4E6IA 3D6CA 3NK9A 1SYCA 3TP7A 2EYLA
chains in the Genus database with same CATH superfamily
1TWAB 4GNXC 5BR8Q 1I50H 5J1ZA 4LFCL 4RH6A 2D2CC 2Y0SE 3A5ZB 3FMCA 3UE0A 2F0EA 1Q81C 3OYYA 3OWEB 3KLWA 4LF7Q 1YNNC 2N8NA 2YYZA 4MN3A 2Y0SG 3HOUH 2AKWB 3CF5A 3MFGA 4DV7Q 3NBHB 2NVXB 1SLJA 1YI2A 1EY8A 1H9KA 1MGSA 2O2LD 1ZXTA 1LLRD 1CSQA 1Z47A 3OMGA 1WTWA 4A3BG 1LTSD 3J81E 1HA5A 2JA6B 3I4MH 4QQBX 3NP8A 4PNYA 1CA5A 4B3MQ 2KENA 1HUNA 1UUPA 1PXUA 2PMZB 3A0JA 3E6ZX 3RN2A 1JWUD 3P75A 3GD7A 1DD2A 1RTOA 2B2UA 2UUCQ 2B63H 1KL9A 2N49A 2XRSD 2NVQB 3T53B 4X6AH 3BYTB 1X6OA 3MVVA 4OONA 2SOBA 3HOVG 3ICEA 4QMGA 4RAUC 1TWCB 3SK8A 4QF4A 3VR4A 2I5HA 1PV4A 1XPUA 1Y14B 4YCVA 3HOZH 3JAMc 5LL6X 1EWCA 2JQOA 4FF1A 4BY7H 4X3SA 1C7YA 1BCPF 4EQOA 1O7LA 1F2MA 4UHVA 4DK6C 3OIQA 1QOHA 4S3SA 1G51A 3L2PA 3GTGB 1V9PA 3D3RA 4A3GB 3NE5B 1Y8NB 2IX1A 1D2BA 1K8OA 3L3OC 1AE2A 3HOVB 1HRJA 5D14A 4K5XA 3OMCA 1J5EL 4JI1Q 3R2IA 1L1OA 4IUQA 1IYVA 2K04A 3PO2G 2JA7B 4APVA 2F3VA 1PZJD 3HKZB 1TS2A 2AQ3B 2D62A 1Y1VG 3NENA 1TWAH 3F1ZA 4DU9A 2QGQA 3S24A 4DR5L 2K5DA 1PRTD 3MA2B 1G291 1U4RA 4F87A 1NBWA 2EE1A 2HHHQ 2R7FA 2FMCA 3QB3A 4OEMB 2OT2A 5IP9G 1I4GA 2VW9A 2LXJA 3FKIG 3CC4A 4CGYB 4DR7L 4JK1C 3BVMA 3STBD 4DN4M 1CZGA 1K83B 3EJIA 5M5XB 1HNWQ 1S5BD 1JCKB 4R8NA 1VQMA 1F77A 1PRTF 4Z9CB 1BBWA 4NW2A 4OX9Q 1EY9A 4KY6A 1I4XA 4P2CB 4LFBL 1IBKL 1JC7A 3HGBA 5EBCA 1DOKA 1RL2A 1X32A 1PH9A 4U673 2CH4W 2RHQB 1CUKA 2HDMA 1PH8A 3ULLA 4GKKQ 3MXNA 4BBRG 4JI0Q 2A6ED 2PI2A 1BF4A 1K0SA 3FEWX 3FKIB 5M9OA 1X3EA 1CKNB 2EOTA 3NTIA 3PIOA 4HJAA 3RUZA 2NVQH 5IYDH 5J3BA 1A63A 2TSSA 2MPMA 3U4VA 2RSOA 2VL6A 5JPNC 5I4DA 3SXHA 1EYCA 1S5DD 1TWCH 5JEAG 4DV1L 2A6HD 3F2DA 4IFDJ 1K3RA 1Y8PB 2PI2E 3H3VH 5C4ZA 3Q8DA 3PUVA 1LACA 2E8GA 2MHVA 4UP7A 2R92G 4DV4Q 4H02A 4LAAA 2IHEA 1SYGA 2DGYA 2EYHA 2N78A 5KYLA 1ASZA 3BU2A 1XJVA 1GUSA 1HQMC 4A3GH 1OXTA 4EQPA 4JI2L 3A5UA 1KLGD 1K8GA 4RWSC 1E1TA 2Q8TA 1VQHA 1Y69U 3GTMB 1MJEA 2JA7H 4Y52H 4R9WA 4HN7A 1Q1EA 2VUMG 4HCEA 2D0OA 5TSSA 4IPDA 3GTLB 1GUOA 2XTIA 2Z6KA 4A3KB 4C2MB 1T9HA 2H5XA 2I46A 3D6CA 1EIFA 1SYCA 4BBSG 2CVRA 1AZQA 2H4OA 2CHBD 3VR3A 4HJ5A 1HR0L 4XT3B 3IL8A 5ISRA 4A3EB 4ZKBB 4ULLA 3NSWA 1HNXL 2L0CA 4AQYQ 3NPPA 3B6YA 2VQEL 1VQ4A 4XQNA 5JJLA 1K83H 5M5XH 1D5MC 2I07B 4BWGB 1YJ9A 1XNQL 2Q2IA 3U58A 1W6KA 3E3XA 2VUMB 3UDXA 5CMDA 4WFN3 4PMBA 1FYCA 4J1MA 5BN4A 3TRZA 4CDEC 1L2FA 2EXDA 4BY1G 2F4VQ 4L8JA 1EQQA 1HPCA 3OTOQ 2ZXOA 2UXDQ 3CQZB 2RCNA 1E2ZA 2XWJB 3GTPH 2BDNA 1PH6A 2L9HA 2LY7A 3PV0A 1AZPA 4CBVA 5M5WH 2X6GA 4GS3A 2XN9C 1ET6A 1B3QA 4JI4Q 3RN5A 1A6XA 4JBWA 1H9MA 2VS1A 1IL8A 3M7NA 4DV0Q 3SGIA 3F2BA 3RNUA 3BZKA 5C0XH 3HOWG 2LSSA 5J22A 1FGUA 2B3GA 1SMYD 2WP8J 2VNUD 1MKHA 1KTKA 4HTHA 3UDFA 3CRLC 1VQDA 2PO4A 1V43A 4YWMA 4Q5VA 4HIOA 3HOYH 3NELA 3CPWA 1Z6HA 5C4HA 1D6EC 1SNPA 2QCPX 1ZYRC 1FNWA 1RCVD 2F0SA 3H3VC 4WRDA 4IPHA 3GV3A 5IYCG 3TSSA 4IOCA 3J7ZC 5JVG3 5K36H 3GV6A 5M3MG 1N34Q 4FP5D 1RHPA 4XIGS 3V2TA 1ENFA 1WD1A 2B39A 1WYDA 4B3RL 3GTJB 4EX5A 3G6EA 3BVGA 5C4XB 4KI0A 2Z4HA 3HOWB 5CBAE 2A69C 1Y1WH 3GTLH 1QUQA 4A3KH 3I4OA 2NZHA 1EU3A 4X62L 1Z9FA 2A73B 4IUPA 4FF4A 1FJGL 1CI3M 2JA9A 4AYBB 2XIWA 2E2DC 3PCOB 4RGMA 3QJYA 4RGOS 1EWHA 2F0PA 1I94L 3KDFB 2SNMA 4JI3L 2B2VC 1OTCA 1TVXA 4PV1C 1DJRD 1X65A 2F0IA 2WAQE 3I4NG 1A3VA 2QEJC 3EN2A 5KGUA 1WVLA 1XPRA 1HNZQ 4DXFA 3A8KE 1F9QA 4O1NA 3T16A 3H0GH 2OF1A 4DAMA 1HZBA 1X3FA 4JVZA 3KBGA 1MD2D 3BJUA 5FLXL 5DNFA 4GNXB 2BH2A 4HJ7A 1Q46A 1PZID 3JC66 1VQNA 5IYBG 3CQZH 1ESRA 3U50C 2PW7A 2E2HH 2ZTCA 1KLUD 4X65L 1LT4D 2VB2X 3I73A 1GUNA 1H9RA 1X55A 4CDFC 4A4IA 3K5NA 2UU9Q 4P75A 1ONLA 4KD4A 4LF9Q 4C3JG 1TT2A 5I9PA 2K1BA 4FXDA 3EVQA 4MHEA 3SK5A 4MNOA 3CKIB 4N9PA 2JA8B 1JJCB 2JA5G 1FGBD 4G4KA 5FOBB 4HEDA 3L7ZC 3K59A 1STEA 1ICWA 2ZT9C 5D3IB 2E76C 3I91A 3OPOA 1VQJA 4UPAA 2RCFA 3BDOA 1F2LA 1KD1C 2K5NA 1JE5A 1CA6A 2OTLA 3MXGA 4A3FH 1B3AA 4DAYA 3DWQA 3PMFA 3CCLA 1N33Q 4A3DB 2RKSA 4OWTB 4A3MH 2NBFA 4RHRA 1V8QA 4K14A 1QWYA 1PZKD 2RHSB 2JN4A 1CQVA 5NUCA 3CCUA 4UP8A 4V190 2UUAQ 3CC7A 3S1NB 4TSSA 4JI5L 2R7ZH 1C8CA 2UXCL 3MEFA 1G8ZD 2ZXPA 4BS9A 3J80i 1B4OA 2HDLA 3WOFA 1HCZA 3D4DA 4GLAC 5AJ3Q 1B2TA 1S5ED 5IWAQ 2RA4A 3S1RH 1PVOA 1EZ8A 4IUVA 2D5DA 1SN8A 4IOAA 5CV6A 5CBEE 4UAIA 1SSOA 1SEBD 1X54A 2KEDA 2O4XA 2C35B 1B50A 1KAAA 2IHFA 3DHQA 5EKLA 4CJ0B 4DKAC 3A56A 1YVCA 5C6AA 4N8X1 2B2YC 4C3IB 5KEEA 4DAPA 1EIGA 3R93A 3KF8B 1L0WA 4GOPC 4YHHL 2PQAA 3E9IA 5A35A 3AFQA 1XMQL 1SE8A 2BE5D 2KUMA 3PSIA 3PUWA 5BN5A 3HOUG 1SYDA 2DY7A 2UXBL 4C3HH 2UUBQ 2IT1A 1STGA 3ULPA 5M5YH 3ER0A 2C5CA 1I50B 4IN3A 3TS2A 5FLXE 3I4MG 2F0LA 3ZYYX 1TWHH 4I7AA 2L1BA 2ZM6L 3MHBA 2ZJQA 1EYAA 2VXWA 2JA8H 4JG2A 3MTSA 1BDOA 1H9JA 3D6WA 1WTVA 1A15A 1EIYB 1QCBD 2K6AA 4DR6L 3QWNA 5K5PA 1V1QA 2B63G 3FPUB 2LKVA 2SNSA 2DNEA 4DUYL 2R93G 1D8LA 2J7ZA 4FVMA 1QJOA 2H1EA 1PMRA 2VY3A 4F88A 2ASBA 2JJQA 1HTPA 1Q90A 3M7GA 3MXUA 4UDUC 4A3DH 3S14B 1KDAA 2EDGA 1YNND 4RCOA 3K6OA 2CWAA 1M4VA 2F3IA 3HOZG 4RA8A 4QIWE 3MZ5A 4BY7G 1RF2D 3A8IE 4DK0A 1JOKA 4R4OA 2NVYB 5AFWA 2PZWA 4CKCA 2B63B 4JV5L 2K28A 1LM0A 5ELCA 4I65A 3DLLA 3PUYA 4OIJA 1IBMQ 1WTQA 2WV6D 1U4LA 3TEHB 4ZCKA 2QF7A 1A62A 3NBHA 4G7ZC 3BDCA 2KOLA 5I6WA 1RIPA 4IPCA 1TQOA 4DR2L 4FXGC 5KYIA 2FINB 2ICIA 3TP7A 3C46A 2EYLA 1GO3E 4DR3L 1QILA 4DV3L 4DR4L 1EQRA 1JOOA 4JOIC 1MIUA 2QA4A 3J80L 2XRQD 3V96A 2N88A 4NPSA 2KCNA 2EY6A 4KN7C 1VQKA 3PIO3 4OELB 1FNUA 4B3TL 4O0AA 2HT1A 1KNEA 4ZK9B 3I72A 2E5LL 2KBNA 1ML0D 2BDOA 1U0LA 1M8AA 5GROA 2K5QA 4JI6L 1WOCA 5LL6S 3EQLC 2RSNA 2EXZA 3DEPA 4KKUA 1B8AA 1N36Q 3Q23A 2JA6G 3BDLA 2HQEA 2PMZE 4RMFA 1S40A 1EUJA 3U4ZA 3BZDB 2OCEA 1KDBA 3ULJA 1K8AC 1ESFA 3CAMA 3FVQA 4RG1A 1SAPA 2ZTDA 1N32L 2BA0A 1SMXA 4LF4L 2OQKA 3P7JA 5LMNQ 1YJNA 3OOCA 2VQFL 1II3A 2GVBA 4DUZQ 5E4XA 3KJOA 4UP9A 1M90C 1CZWA 1FR3A 2EYPA 1FL0A 2K5WA 1WTHA 1YHQA 2K05A 2CW0C 4XTCS 1U5KA 3JAMi 1J8IA 4MIUA 5ELFA 1GXDC 2F0MA 3T1HL 3S14H 3S9WA 1XNRL 5JPMC 4LMQD 1SE3A 3I3CA 3F2UA 2K4KA 2B2WC 1TS3A 1VDZA 1HR0W 2BCOA 2NVYH 1EQVA 3P20A 1BCPD 4PZ7A 1BVSA 1M1KC 1E22A 1TY2A 1J5EQ 2WKCA 3S2DH 4A3GG 3G7LA 3R3OA 2A68C 1O7ZA 1GHJA 3QG1A 3GO5A 1VQ6A 1YNJD 3QIAA 3HKZE 1G6PA 4OHJA 4OO1H 2JA7G 2XSCA 3HEJA 3HFZB 1P8LA 2Q2HA 4GLVB 3HKZG 5C3XA 4DR5Q 5C4JB 2F52A 2E2JH 2WFWA 4DNIA 3TQYA 3K80C 1PTOC 2I5MX 4L6TB 4OIKA 5JEAJ 4R4TA 2K14A 2ES2A 2Z0SA 3C3LA 4DV7L 2EZVA 3PO3B 1F2YA 4DR7Q 1CKNA 2F0DA 3SR1A 1NJIC 1U9RA 1TWFH 5C5MA 1LTAD 2G9HD 1SE2A 5E1FA 1MJCA 3J7YW 2NN6H 3NWSA 4LFBQ 3J80E 1IW7C 2JYOA 2JEAI 1GOZA 2NTTA 3X3MA 2FMMA 2ALYB 2ATWA 1L0YB 1DOMA 1K0RA 3S15B 1RJTA 1UE6A 1DCZA 3H15A 3RLOA 5FK9C 3FP9A 5CGKA 3IKJA 1YJWA 2R6GA 4YY3Q 4XQJA 5ELNA 1LTBD 1A3TA 2L15A 3A54A 4DV1Q 5H1SE 4ZLTF 1EEID 2G5DA 5BN3A 2CQAA 2PNRC 5COYA 4IPGA 1W2BA 4JI7Q 2K5VA 4A93B 5C0XG 1BQQT 1YIJA 3GTPB 1G6ZA 1I6VC 4PMCA 2EYMA 1I3QB 3A8JE 3W3AA 4HSVA 5M5WB 4JI2Q 1PH3A 2HCCA 1KRSA 3TMEA 3HOYG 3U9OA 2G9DA 2EVBA 4K2KA 4K8IA 1QZHA 1GHKA 3PIPA 4A75A 4X3KA 5K36G 2PCFB 3CCMA 4KY7A 1NTGA 5IT9c 1DZ1A 1X9NA 2V4DA 4X64L 5DM63 1PYSB 3BS1A 1JICA 1X3PA 5C4JH 3RR5A 3I56A 1Y1WG 4NMZA 1VQEA 3H3VI 4A3KG 4KLKA 4DA2A 1PDQA 1Y8OB 2GVAA 2FXQA 4AH6A 3HOYB 1HNWL 3G4SA 3PO3H 1I4PA 1F9SA 4ME5A 4V0BA 4A3BH 4A3EG 4QCLA 1GJXA 1SNCA 3RZOB 5LMUL 2Z6BA 4B9XA 4DK1A 1QVGA 2NUCA 3CU7A 3I8ZA 4K0KL 4HIMA 2MO0A 3KYHC 4RKBA 3CP0A 1U4MA 1GUWA 1LYLA 3TZDA 3SVMA 1CKMA 3KLSA 1Y1WB 1ZYRD 2XNAC 3RLNA 3BZCA 3E5SA 3K58A 1JE4A 2YV5A 1G2TA 3I55A 4X3TA 3S15H 3K81C 5CV5A 5GAEC 2HIVA 3VYUA 1D1IA 2E74C 5ELDA 3Q0AA 4GOPB 2A69D 1CT1D 3I90A 3CCJA 2K50A 1S72A 4PQXA 1H9SB 3STBC 4P71A 3MWYW 3GP7A 5G3LD 5E4WC 5I2YA 3CXCA 5FLMH 4POGA 1QVCA 3H0GB 1VQFA 5GAHC 2MQHA 4LFAL 2K7VA 2NWGA 1IHZA 3PUXA 1PYBA 3HG9A 2HD3A 1R4PB 2F4IA 2K52A 2XWBB 5IGDA 4DV2L 3CD6A 3DWPA 3EROA 4A93H 4LJZC 5CV9A 4IUTA 1EOVA 3QR8A 1I4RA 3J7AV 2B2TA 2Q8RE 2PQEA 3NXWA 1STBA 1SROA 1I3QH 1SE4A 1SJED 4A3FG 5G3LF 5I9OA 1DOLA 1PH5A 4L5QA 3KF6B 2KCTA 2IJ0A 2WB1B 4JI8L 3KDFA 3TDQA 1GUTA 1STAA 3CCVA 1JJ2A 5JJIA 1SDFA 1XTDA 2Q2TA 1HH2P 4B3RQ 4Y7NH 2R7ZG 2D9UA 3DM1A 5DM73 2A6HC 5C4XG 1LT6D 4QGUA 4LF8L 2KCMA 3AYHB 1OXUA 3HP3A 5D65A 3H94A 4PMWA 4GNXA 3OIPA 3A7AB 4AYBE 4H13C 5C0XI 2JEBI 2A5HA 1IL2A 2TMPA 4A3FB 4UY8C 3MEHA 1DGSA 5KIXA 2RBMA 3GTKH 1JQYD 4DFAA 5I6YA 4A3MB 2Z4IA 4AYBG 4XT1B 3NK9A 1I94Q 4HR7B 1WFQA 4JI3Q 3RZOH 4WJ3M 2R7ZB 1VQ5A 5CYUA 3TP8A 1W3SA 3D0FA 3OTOL 2UXDL 2OWOA 3Q24A 1F9RA 1VQ7A 1JT8A 1XMOL 4YIJA 3CRKC 3S1RB 4N9TA 3AMUA 3L9AX 4K6LA 4JW0A 1RDPD 4ALPA 4X65Q 3LX0A 1WCMH 2F0GA 5HY6A 4N8FA 4DV0L 1IXRA 2XGTA 4PG3A 1O7IA 1UE1A 2R92H 2DJFC 4O42A 2JA8G 3T1YL 2MO1A 4NXNQ 5JOBA 1AW7A 4ZAIA 5IIFA 4KMUC 2AWOA 1EY0A 4DGZA 2F0TA 1ET9A 4R1JA 4C3HB 5M5YB 1WTOA 2NVTH 5L37A 1QG7A 1JB7A 1DM0B 4A3DG 1V1PB 3HZXA 4M1UB 1TWHB 4QJFA 2UXCQ 2FJ2A 3X3NA 5CV7A 2X69A 1GKHA 1YHAA 2B8GA 1BO0A 1A3UA 3KF8A 2F0JA 1VQIA 2ZTEA 3AB9A 1C4QA 3VDYA 4CHTB 1VQLA 4LUOA 2EJGC 1SMYC 4KN4C 1XXGA 5GAGC 1EYGA 1I4QA 1AFPA 4ILWA 1JORA 2WAQB 2JSOA 4FXKC 2IWHA 4BY1H 1L1OC 3NUCA 4LUZA 2F0NA 2K75A 3G48A 3M3YH 1EL0A 3J81c 4C3IG 5C44B 1ZEQX 1QNUA 5C3EH 3CPFA 4IFDH 2F0HA 2AUKA 4NKLA 1XMQQ 1TXYA 2AWNA 2LXKA 1Q82C 1PTOB 2UU9L 2EQSA 1SFOB 5FJ8G 2RF4A 1E0BA 1A0IA 3K57A 1E2WA 3E0JA 1VQOA 3S1QH 4POFA 2N3SA 3HS0C 4C1NI 3M85A 3LNNA 3NTKA 4GN4B 2PNHA 4LF5L 5JJZA 2I5LX 1IBLQ 3S16B 2ZJRA 3WDNA 1K28A 3NHHA 2CKZB 1KDCA 3S1MH 5F2DA 3MAQA 1O78A 2E2HB 3CCSA 4DR1L 3G71A 4B3SL 2OEOA 4DUYQ 4NXMQ 1OXSC 5DLQE 3KOJA 3LWUA 1K3BC 3TBIB 2LS01 3H09A 5EPLA 4TRDA 1YBYA 1MSHA 3D4RA 1UEAB 1KXLA 1P16A 4IO9A 1DYQA 1SBBB 5FKAC 5CV4A 3HOXB 2E2IH 3R2TA 2L55A 4X66Q 4ME3A 2EJMA 3P1HA 1HJPA 3ONAB 2EYJA 1G2SA 3A55A 1VQ8A 3URYA 1FNVA 4EQNA 4GKJL 4JV5Q 4LNQA 1G91A 1PFMA 5DEHA 4IJLA 4DV6Q 5E3FA 3ERSX 1CK1A 4HCSA 1BR9A 1VF5C 1AE3A 2SEBD 1R9TH 1Q8IA 1VMPA 4OO1G 4DR2Q 2F3WA 2FFKB 3Q6SA 1WTXA 2HCIA 3KFUA 2JXMB 3N6RA 3T13A 4DR4Q 4EQ5A 1E1OA 1PFSA 1Q3LA 4I7ZC 1YITA 2KHJA 4A3CH 1YEZA 5KRUA 5C44H 1RTNA 2UUBL 4KHPL 2OTJA 3S2DB 2DNCA 3CW2C 5EKKA 2Z6KC 2Z1CA 4RGNA 4IURA 1CSPA 1EFID 2O5IC 4C3JH 3KK7A 1TWGH 2B29A 5CORA 3BVZA 3J7A5 1PTOH 3AU7A 5HURA 1NMFA 1SFOH 2E5LQ 2NN6G 3NEMA 1CHPD 4L5RC 2RDFA 1I6HB 1E24A 3I70A 4GN3B 3E0EA 3QOJA 4LK1C 2E2JB 1SYEA 3OSOA 4A3LH 2RVLA 4LFCQ 4BXXH 1VQCA 4MTKA 3GDEA 4C1NK 2ENBA 4F7XA 2KHIA 1J6QA 3S16H 5C5LA 3F2CA 4OL7A 2AHOB 4A3IB 4FF3A 3VYTA 1TIID 4LF4Q 3DWAA 2L4NA 2NTSA 3SDZA 1NSNS 3EA6A 2P5ZX 1TWFB 2F0QA 2WACA 4JBJA 2VQFQ 1LTLA 2Q8IB 1QE6A 3KBXA 2AQ1B 1Z7TA 3CCEA 2Q2UA 4A76A 1KNAA 1TU2B 3F8TA 2BE5C 3HRZC 4DNRB 1PA6A 4JYAL 2WINB 2VZAA 3T1HQ 3PIP3 3H91A 2VB3X 2BOSA 2KQ3A 3M4QA 3BYYB 1ILPA 2IX0A 1HXYD 4HMIA 1BKBA 2PZUA 3GTQB 5ELEA 3HOXH 5JVH3 5IODA 3VA5A 1PTOF 4FNFA 5T1IA 3TZUA 4A3JH 1IW7D 2GA4B 4ZUJA 3K5LA 2FHTA 1LABA 3NTHA 4IUNA 2NB0A 4DV5L 2PYKA 5IYDG 3RMHA 5M3FB 1VS0A 3Q22A 4TKOB 1UEBA 2MP1A 1JOQA 3KLRA 2K33A 3UI2A 4LF6L 2F0UA 2K01A 2R3ZA 4CJ1B 2OXPA 2JK8A 1KAWA 1QVFA 4DF7A 4XDXA 1OO9B 4JCVE 4K6DA 2EY2A 2F0VA 1HFNA 2DN8A 2B2VA 1UAPA 2L12A 3O13A 3VYRA 4JBKA 4MZ9A 1VQPA 3LWEA 1EWIA 1XTCD 2EIFA 5IP7H 1EY7A 3PO3G 2MJ8A 5IGGA 1HZ9A 3H6MA 5C0XJ 1OXXK 2KHSA 4HIKA 4H0LC 2KEEA 5BR8L 4H44C 1Q12A 1BNZA 4M8AA 1N36L 1B9MA 1UWVA 4J6HA 3K8AA 4OO1I 2ICEC 5C3WA 2DY8A 1XPOA 3IRBA 4IJHA 1I6HH 2YU9H 1IZ6A 4CDCC 2Y0SB 4L63B 3M4OH 1CTMA 1Q1BA 3DUZA 4LF7L 1VMCA 5LMNL 1UE7A 1X3GA 2R93H 2F03A 1EY4A 1GUGA 3VYSA 3M9BA 4DUZL 2D0PA 4WJWA 4A3IH 1ENAA 1EIHA 3ERQA 1LTID 4A3BB 2WKDA 1WTPA 1C0AA 2DJGC 1FVIA 4J15A 2O5JC 3MFYA 3NQIA 1AP0A 2CFMA 4KKSA 1EZ6A 5FO8B 1O80A 2B8FA 2HQLA 4OXPA 2NN6I 1IBKQ 3NWTA 4B3ML 5FLMG 2R61A 1Q7YC 4K5WA 1LO5D 1FD7D 2MNAA 1LV9A 2F0KA 4C56C 4O2DA 1TY0A 3CC2A 2UUCL 3A74A 3GTQH 2L11A 1U4PA 4A93G 4IQZA 2AUJD 4KY5A 1NR4A 2A74C 2J0TD 1JMCA 5IOCA 4KK7A 1RKNA 3TN2A 1IKMA 4ABNA 1J9OA 2PW5A 4DXGA 1UNSA 5EKIA 3OHXC 1ENCA 1DXMA 1LTGD 1T5XD 5M3FH 3S17B 2Z8LA 3CCRA 1VQAA 4IUUA 1JWMD 3CMAA 4JC0A 4X64Q 2DUDA 3WWVA 1CFMA 1S4ZA 4ID6A 3EIVA 4HAEA 4ZUIA 5GADC 1AEXA 1ILQA 4J8QA 3RD4A 3T4AC 1PYWD 4EVOA 3PO2B 4TVAB 4JI1L 1BXTA 3TP5A 2EY1A 2NVXH 2B2YA 1O7YA 1LTRD 1Y1VB 4E6IA 2XVSA 5LMUQ 5HGTA 1BCPC 1K9MC 4FDBA 4GOPA 1PFNA 2HUGA 4WJ4A 2JA6H 1H9SA 4K0KQ 1CM9A 1JWSD 1YNJC 4Y7NB 3JAML 2A8VA 2PPBC 3FRPB 5IGEA 5EQ0A 4ZRZA 1WJJA 4XYOA 1BBXC 4QUFA 1DONA 2AMCB 2HHHL 1SR3A 1I4HA 5D3DA 4L5TA 4FYDA 4YWLA 3D31A 1L1OB 4YY3L 3SK4A 1AH9A 3ND8A 1HR0Q 2IPKD 1GM5A 4RHSA 3GTKB 3VR2A 1LTTD 1UE5A 1KC8C 1KRTA 3UE1A 1HNXQ 5T1GA 4OX9L 1WCMG 2VQEQ 4CKBA 2RDGA 3DEOA 1KQSA 1C48A 5DAUA 1XNQQ 3KF6A 3KJPA 4BBRB 1Q8KA 4GKKL 3MXPA 1SYFA 5CC4A 1SNOA 4JI7L 4JI0L 4LFAQ 1WI5A 2M2LA 3T56B 3IAYA 3H0GG 2CCZA 3GTGH 2IX3A 1PH2A 4DV2Q 5IE8A 4XYQA 1EY5A 1I5FA 1D5ZC 1EY6A 3HOVH 1PRTC 3W5OA 4Q0FA 4KHZA 1CHQD 1WCMB 3I4LA 4KV6A 3DXJC 2WB1E 2EYFA 1N9WA 4G7OC 5CV8A 4JI8Q 3EBEA 2F1MA 1ICFB 3MXNB 3S17H 2WB1G 2R92B 2MFIA 1NMGA 3NQTA 2E75C 4ZKCB 4IZ8A 2QDBA 4DV4L 3HKSA 2F0OA 3TS0A 3K7UC 4B9WA 4LF8Q 1MI2A 1V1OA 1LUZA 4MTNA 4G7HC 1QZGA 4LUVA 4FF2A 1PFBA 2ZXRA 3CMEA 2A6EC 2IL8A 3PO2H 5CR3A 2YTYA 3AEVA 1B1ZA 1EFWA 2NVTB 3K7AB 4CDDC 4JOIA 3I7FA 3PGZA 1Y1VH 4A3MG 3TREA 2RQXA 1QNKA 1VF7A 5IT9L 1AN8A 5EPKA 3SHLA 4BBSB 3GTOB 2NZOA 5FLXc 1NY4A 3K5MA 4DNTB 5IP9H 3DMUA 3FKIH 4X62Q 4XXEA 1TKWB 5C3EG 1XMOQ 3AQQA 2R7DA 3C2PA 4IFDG 4R4CA 1STHA 2HIXA 4XQQA 4AQYL 1FJGQ 1W6JA 1MSGA 3W1GA 2EYOA 5E7NA 3OW7A 3UDIA 3LGJA 3JAME 3C1EA 3W2DA 1D1KA 4WORA 3IFTA 4BY1B 4KD3A 1V1PA 4KJOA 4R8IA 1JJGA 4CJ2C 4BBRH 2KVMA 3M3YB 3ND9A 2F4VL 2F0WA 1STYA 3T1YQ 4PZ8A 5C3EB 3DM3A 1BUVT 1VQGA 5KNBA 1NR2A 3FPPA 4RFBA 1PHJA 1HA6A 4JI4L 2BA1A 4C3HG 5JEAH 3GTMH 4B08A 1B44D 2B2WA 3S1QB 2KJXA 3L0OA 2WIIB 2J4XA 4DAVA 4HIDA 5EAYA 1XX8A 2MUYA 1HHVA 2C9OA 1PLFA 4C2MH 1S3OA 4HMJA 4ZQ3A 4K2LA 3S1MB 1NNXA 1JR0D 2KA7A 2EJFC 1IKLA 4KJNA 3BG3A 1HQRD 1E3PA 2K32A 4A3EH 1EYDA 4TQUS 1S5CD 3MC0B 4DK3C 5M3MB 2ID0A 1HTLD 1NAPA 1OXVA 3K7AH 1N34L 3T51B 2VUMH 2B2UC 2EPBA 2CWPA 3UDGA 2A1AA 1L0XB 2WAQG 3WOEA 3J7AF 3K5OA 3TP6A 3J81i 4RKLA 4JI5Q 1XYIA 2E2IB 4BBSH 1HZAA 3GTOH 1YHBA 3S2HB 1A2UA 4QY7A 4ZYSA 3FDTA 4A3CG 5C44G 3G6JB 5IT9E 2KCCA 3I4NB 1TS4A 1R9TB 3GQBA 3OWFA 4P72A 3VR5A 4PZ6A 2K5HA 1YZ6A 5IGCA 1SNDA 5A2QL 1HNZL 1KIXA 1CKOA 4NB3A 5JJKA 1QUQB 4KHVA 2L5TA 4NXNL 3SK6A 4LF5Q 2M00A 1GVPA 4U68A 4A3LG 4BXXG 4YCUA 4LWCA 2QILA 1N8RC 1LT5D 1EQTA 2JP1A 3K0YA 3K0XA 4OGQC 5IGFA 2YTXA 4NP5A 2F0FA 2YTVA 1SNMA 3IFDA 4HJ9A 4YHHQ 1CQFA 1TS5A 4DR1Q 4B3SQ 1NCVA 5LHY1 4JBMA 4C3JB 1A8VA 1TWGB 2EY5A 4IFDI 2UXBQ 1R4QB 2ZJPA 1RODA 5FO7B 4LF9L 1NUCA 4YCWA 3KUPA 2CH4A 2K03A 1X56A 3PUZA 1VQ9A 2JA5B 5KNCA 3GTJH 5C4XH 2LFNA 3EFXD 3U9SA 2SDFA 1VQBA 3R8BA 3SEBA 3HOWH 1YNXA 2KECA 2ZM6Q 1IYJB 2N55A 1BBUA 1LT3D 1PH4A 4R4IA 3V05A 4K8JA 3SE0A 3OW2A 3HOXG 4GKJQ 2IW3A 3D8GA 4RGTA 1D5XC 1EU4A 2AQ2B 2BH8A 4DR6Q 4HSPA 1IYUA 2NZ1D 4A3JG 1N33L 5IYCH 1C9OA 3RZDB 1E2VA 5IGBA 5M3MH 1STNA 1JB3A 1F2ZA 4X3UA 1EEFD 4HJ8A 2UUAL 2GN5A 5J39A 1PH1A 2Z9HA 1B9NA 4K5VA 3M4PA 5AJ3L 3FHWA 3J80c 5LMNW 5IWAL 3S2HH 4JPBW 4BA2I 1HUMA 4DAYB 3QO2A 4A3JB 4KHPQ 3A7LA 1X3QA 1SJHD 5ELBA 2OQ0A 3AFPA 1SYBA 5IP7G 3PF4A 4R4QA 3D4WA 2M9VA 4QUCA 3I4NH 4OWXB 4EGVA 2QEXA 1B7YB 5JAVA 4KTAA 4GZYC 4GN5A 4IALA 5EGTA 5ELOA 1ASYA 2QDLA 3J81j 1K8MA 1IBLL 2QKIC 1ZKOA 5EPJA 4DR3Q 1BCPB 4DV3Q 3J81L 1BOSA 1EOTA 2RDHA 3HOUB 3ZJYC 2I0QA 1K73C 5IYBH 1D7QA 3NBIA 4NXML 1B53A 1MBYA 2CW0D 4CKEA 3I2ZA 1SRUA 5A2QE 2X6LA 4A3IG 3CHBD 4KKTA 4NDXA 3ITPA 4FO2A 1SNQA 3I4MB 1WD0A 1F9PA 4B3TQ 4LW1A 3C1FA 2IY5B 4JYAQ 1HFGA 2QW7A 4AIMA 1WTRA 2MGSA 3S1NH 4QB4A 4JI6Q 4X66L 5FO9B 2JA5H 2YU9B 3PF5A 1HZCA 4ODGA 1RD9D 2PQAB 1TR5A 4L5SA 3M4OB 3E9HA 4GLXA 2A68D 2LMCB 5EJWA 4F8MA 4DV6L 2R93B 1Q86C 2V1CC 3M4YA 3RLFA 1N32Q 1H95A 3PQIA 4OWWB 4DV5Q 4H7BA 5HGQA 3QOLA 3W1BA 4G57A 3VR6A 1PH7A 3HOZB 3RZDH 1PRTB 4P73A 5GQOA 1PTOD 1B70B 4BY7B 5M3FG 1VCIA 4BA1I 4RCNA 1S5FD 2B2TC 4LF6Q 3KLSX 2NYZD 4C3IH 1SXTA 4YWKA 4QIWB 1MHWC 3VA7A 1QB5D 1T5EA 1XNRQ 4DPGA 5IY0A 5EBDA 3CCQA 5KNDA 1IBML 1KHIA 1XWEA 5I2XA 1GD7A 2CQOA 2PZTA 5FJ8H 2JE6I 1E7ZA 1KABA 4P74A 4QL5A 1A2TA 1NE3A 3N52A 2A19A
chains in the Genus database with same CATH topology
1TWAB 5J1ZA 4RH6A 2D2CC 3FMCA 2F0EA 3OWEB 1YNNC 2YYZA 4MN3A 3MFGA 2NVXB 1EY8A 1H9KA 1MGSA 2O2LD 1ZXTA 1LLRD 1Z47A 3OMGA 1WTWA 1LTSD 3J81E 1HA5A 2JA6B 3NP8A 4PNYA 1CA5A 1HUNA 1UUPA 1PXUA 2PMZB 3E6ZX 1JWUD 3P75A 3GD7A 1DD2A 1RTOA 2B2UA 2NVQB 2XRSD 3T53B 3BYTB 3MVVA 2SOBA 4QMGA 4RAUC 1TWCB 3SK8A 4QF4A 3VR4A 5LL6X 1EWCA 4FF1A 4X3SA 1BCPF 4EQOA 1O7LA 1F2MA 3OIQA 1QOHA 4S3SA 3GTGB 3D3RA 4A3GB 3NE5B 1Y8NB 2IX1A 1D2BA 1K8OA 3L3OC 3HOVB 1HRJA 5D14A 4K5XA 3OMCA 3R2IA 4IUQA 1IYVA 2K04A 2JA7B 2F3VA 1PZJD 3HKZB 1TS2A 2AQ3B 2D62A 4DU9A 2K5DA 1PRTD 3MA2B 1G291 1U4RA 4F87A 2EE1A 2FMCA 3QB3A 2OT2A 1I4GA 4CGYB 4JK1C 3BVMA 4DN4M 1CZGA 1K83B 3EJIA 5M5XB 1S5BD 1JCKB 4R8NA 1F77A 1PRTF 4Z9CB 4NW2A 1EY9A 4KY6A 1I4XA 4P2CB 1JC7A 3HGBA 5EBCA 1DOKA 1X32A 4U673 2HDMA 3MXNA 2A6ED 1BF4A 3FEWX 3FKIB 5M9OA 2EOTA 3NTIA 3RUZA 2TSSA 2MPMA 2RSOA 5JPNC 5I4DA 3SXHA 1EYCA 1S5DD 5JEAG 2A6HD 4IFDJ 1Y8PB 5C4ZA 3PUVA 1LACA 2MHVA 4LAAA 1SYGA 2EYHA 5KYLA 1GUSA 1HQMC 1OXTA 4EQPA 1KLGD 4RWSC 2Q8TA 1Y69U 3GTMB 4R9WA 4HN7A 1Q1EA 4HCEA 5TSSA 3GTLB 1GUOA 4A3KB 4C2MB 2I46A 3D6CA 1SYCA 2CVRA 1AZQA 2H4OA 2CHBD 3VR3A 4XT3B 3IL8A 5ISRA 4A3EB 4ZKBB 4ULLA 3NSWA 2L0CA 3NPPA 4XQNA 1D5MC 2I07B 4BWGB 1W6KA 2VUMB 5CMDA 4WFN3 4PMBA 1FYCA 4J1MA 5BN4A 4L8JA 1HPCA 2ZXOA 3CQZB 1E2ZA 2XWJB 2BDNA 2L9HA 2LY7A 3PV0A 1AZPA 4CBVA 2X6GA 2XN9C 1ET6A 1A6XA 4JBWA 1H9MA 1IL8A 3M7NA 5C0XH 5J22A 1SMYD 2WP8J 2VNUD 1KTKA 4HTHA 3CRLC 2PO4A 1V43A 4Q5VA 5C4HA 1Z6HA 1D6EC 1SNPA 2QCPX 1ZYRC 1FNWA 1RCVD 2F0SA 3H3VC 4WRDA 3GV3A 3TSSA 5JVG3 5K36H 3GV6A 4FP5D 1RHPA 4XIGS 3V2TA 1ENFA 1WD1A 2B39A 3GTJB 5C4XB 3BVGA 4KI0A 2Z4HA 3HOWB 5CBAE 2A69C 1EU3A 2A73B 4IUPA 4FF4A 1CI3M 4AYBB 2XIWA 2E2DC 4RGMA 3QJYA 4RGOS 1EWHA 2F0PA 2SNMA 2B2VC 1TVXA 4PV1C 1DJRD 2F0IA 1A3VA 2QEJC 5KGUA 1WVLA 4DXFA 3A8KE 1F9QA 4O1NA 3T16A 2OF1A 3KBGA 1MD2D 5FLXL 5DNFA 1PZID 1ESRA 2PW7A 1KLUD 1LT4D 2VB2X 3I73A 1GUNA 1H9RA 3K5NA 1ONLA 4KD4A 4C3JG 1TT2A 5I9PA 2K1BA 4FXDA 3EVQA 4MHEA 3SK5A 3CKIB 4N9PA 2JA8B 1FGBD 4G4KA 5FOBB 4HEDA 3L7ZC 3K59A 1STEA 1ICWA 2ZT9C 5D3IB 2E76C 3I91A 3OPOA 1CA6A 3BDOA 1F2LA 3MXGA 1B3AA 4DAYA 3DWQA 3PMFA 4A3DB 2RKSA 2NBFA 4RHRA 4K14A 1V8QA 1QWYA 1PZKD 1CQVA 5NUCA 4V190 3S1NB 4TSSA 1C8CA 1G8ZD 2ZXPA 4BS9A 1B4OA 2HDLA 3WOFA 1HCZA 3D4DA 1B2TA 1S5ED 2RA4A 1EZ8A 4IUVA 2D5DA 5CV6A 5CBEE 4UAIA 1SSOA 1SEBD 2KEDA 2O4XA 1B50A 1KAAA 3DHQA 5EKLA 4CJ0B 3A56A 5C6AA 2B2YC 4C3IB 5KEEA 4DAPA 1EIGA 3R93A 5A35A 2BE5D 2KUMA 5BN5A 3PUWA 1SYDA 2DY7A 2IT1A 1STGA 2C5CA 1I50B 4IN3A 5FLXE 2F0LA 3ZYYX 2L1BA 3MHBA 1EYAA 2VXWA 3MTSA 1BDOA 1H9JA 3D6WA 1WTVA 1A15A 1QCBD 2K6AA 3QWNA 5K5PA 3FPUB 2LKVA 2SNSA 2DNEA 2J7ZA 4FVMA 1QJOA 2H1EA 1PMRA 4F88A 4UDUC 1HTPA 1Q90A 3M7GA 3MXUA 3S14B 1KDAA 2EDGA 1YNND 4RCOA 3K6OA 1M4VA 4RA8A 3MZ5A 1RF2D 3A8IE 4DK0A 1JOKA 2NVYB 5AFWA 2PZWA 4CKCA 2B63B 2K28A 5ELCA 4I65A 3PUYA 4OIJA 1WTQA 2WV6D 1U4LA 2QF7A 3NBHA 4G7ZC 3BDCA 2KOLA 5I6WA 1TQOA 4FXGC 5KYIA 2FINB 2ICIA 3TP7A 3C46A 2EYLA 1QILA 1JOOA 3J80L 2XRQD 3V96A 2N88A 2KCNA 2EY6A 4KN7C 3PIO3 1FNUA 1KNEA 4ZK9B 3I72A 1ML0D 2BDOA 1M8AA 2K5QA 5LL6S 3EQLC 2RSNA 2EXZA 3DEPA 4KKUA 3Q23A 3BDLA 2HQEA 3BZDB 1KDBA 1ESFA 3FVQA 1SAPA 2BA0A 3P7JA 3OOCA 1II3A 5E4XA 1CZWA 1FR3A 2EYPA 2K5WA 2K05A 2CW0C 4XTCS 1J8IA 4MIUA 5ELFA 1GXDC 2F0MA 3S9WA 5JPMC 4LMQD 1SE3A 3I3CA 3F2UA 2B2WC 1TS3A 1VDZA 2BCOA 1EQVA 3P20A 1BCPD 1TY2A 2WKCA 3G7LA 3R3OA 2A68C 1O7ZA 1GHJA 3QG1A 3GO5A 1YNJD 3QIAA 4OHJA 4OO1H 2XSCA 3HEJA 5C3XA 5C4JB 1PTOC 4L6TB 4OIKA 5JEAJ 3C3LA 2EZVA 3PO3B 1F2YA 2F0DA 3SR1A 1U9RA 5C5MA 1LTAD 2G9HD 1SE2A 5E1FA 3J7YW 2NN6H 3NWSA 3J80E 1IW7C 2JYOA 2JEAI 1GOZA 2NTTA 3X3MA 2FMMA 1L0YB 1DOMA 3S15B 1RJTA 1DCZA 5FK9C 5CGKA 3IKJA 2R6GA 4XQJA 1LTBD 1A3TA 3A54A 4ZLTF 1EEID 5BN3A 2CQAA 2PNRC 5COYA 4A93B 5C0XG 1BQQT 3GTPB 1G6ZA 1I6VC 4PMCA 2EYMA 1I3QB 3A8JE 3W3AA 4HSVA 5M5WB 2HCCA 3TMEA 3U9OA 2G9DA 2EVBA 4K2KA 4K8IA 1GHKA 4X3KA 5K36G 2PCFB 4KY7A 1DZ1A 2V4DA 5DM63 3BS1A 1JICA 1X3PA 4NMZA 4DA2A 1PDQA 1Y8OB 3HOYB 1I4PA 1F9SA 4ME5A 4V0BA 1GJXA 4QCLA 1SNCA 3RZOB 4B9XA 4DK1A 2NUCA 3CU7A 3I8ZA 4RKBA 1U4MA 1GUWA 3TZDA 3SVMA 3KLSA 1Y1WB 1ZYRD 2XNAC 3E5SA 3K58A 1JE4A 1G2TA 4X3TA 5CV5A 3VYUA 1D1IA 2E74C 5ELDA 3Q0AA 2A69D 1CT1D 3I90A 4PQXA 1H9SB 3MWYW 3GP7A 5G3LD 5E4WC 5I2YA 3H0GB 2K7VA 2NWGA 1IHZA 3PUXA 3HG9A 1R4PB 2F4IA 2XWBB 5IGDA 3DWPA 3EROA 4LJZC 5CV9A 4IUTA 1I4RA 3J7AV 2B2TA 2Q8RE 2PQEA 3NXWA 1STBA 1SE4A 1SJED 5G3LF 5I9OA 1DOLA 2WB1B 2IJ0A 3TDQA 1GUTA 1STAA 1SDFA 2D9UA 3DM1A 5DM73 2A6HC 1LT6D 1OXUA 3HP3A 5D65A 3H94A 4PMWA 3OIPA 3A7AB 4H13C 5C0XI 2JEBI 2A5HA 2TMPA 4A3FB 3MEHA 5KIXA 2RBMA 1JQYD 4DFAA 5I6YA 4A3MB 2Z4IA 4XT1B 3NK9A 4HR7B 2R7ZB 5CYUA 3TP8A 3Q24A 1F9RA 4YIJA 3CRKC 3S1RB 4N9TA 3AMUA 3L9AX 4K6LA 1RDPD 3LX0A 2F0GA 4O42A 5JOBA 1AW7A 4ZAIA 5IIFA 4KMUC 2AWOA 1EY0A 4DGZA 2F0TA 1ET9A 4C3HB 5M5YB 1WTOA 1QG7A 1DM0B 1V1PB 3HZXA 4M1UB 1TWHB 2FJ2A 3X3NA 5CV7A 2X69A 2B8GA 1BO0A 1A3UA 3KF8A 2F0JA 3AB9A 1C4QA 4CHTB 2EJGC 1SMYC 4KN4C 1XXGA 1I4QA 1AFPA 4ILWA 1JORA 2WAQB 2JSOA 4FXKC 2IWHA 3NUCA 2F0NA 1EL0A 4C3IG 5C44B 1ZEQX 1QNUA 4IFDH 2F0HA 2AUKA 4NKLA 2AWNA 1PTOB 1SFOB 1E0BA 3K57A 1E2WA 3E0JA 4C1NI 3HS0C 3M85A 3LNNA 3NTKA 5JJZA 3S16B 3WDNA 3NHHA 1KDCA 5F2DA 3MAQA 1O78A 2E2HB 2OEOA 1OXSC 3LWUA 3TBIB 2LS01 3H09A 5EPLA 4TRDA 1MSHA 3D4RA 1UEAB 1DYQA 1SBBB 5FKAC 5CV4A 3HOXB 3R2TA 2L55A 2EJMA 3P1HA 3ONAB 2EYJA 1G2SA 3A55A 3URYA 1FNVA 4EQNA 1G91A 1PFMA 5DEHA 5E3FA 1CK1A 4HCSA 1BR9A 1VF5C 2SEBD 1Q8IA 1VMPA 4OO1G 2F3WA 2FFKB 3Q6SA 2HCIA 2JXMB 3N6RA 3T13A 1Q3LA 4I7ZC 5KRUA 1RTNA 3S2DB 2DNCA 5EKKA 2Z1CA 4RGNA 4IURA 1EFID 2O5IC 3KK7A 5CORA 3BVZA 1PTOH 3AU7A 5HURA 2NN6G 1CHPD 2RDFA 1I6HB 3I70A 3QOJA 4LK1C 2E2JB 1SYEA 3OSOA 2RVLA 4C1NK 2ENBA 4F7XA 5C5LA 4OL7A 4A3IB 4FF3A 3VYTA 1TIID 3DWAA 2L4NA 2NTSA 3SDZA 1NSNS 2WACA 1TWFB 2F0QA 3EA6A 2Q8IB 1QE6A 3KBXA 2AQ1B 1Z7TA 1KNAA 1TU2B 2BE5C 3HRZC 4DNRB 2WINB 3PIP3 3H91A 2VB3X 2BOSA 2KQ3A 3BYYB 1ILPA 2IX0A 1HXYD 4HMIA 2PZUA 3GTQB 5ELEA 5JVH3 5IODA 3VA5A 1PTOF 4FNFA 3TZUA 5T1IA 1IW7D 2GA4B 4ZUJA 3K5LA 2FHTA 1LABA 3NTHA 4IUNA 2NB0A 2PYKA 3RMHA 5M3FB 3Q22A 4TKOB 2MP1A 1JOQA 3KLRA 2K33A 3UI2A 2F0UA 2K01A 2R3ZA 4CJ1B 2OXPA 4DF7A 4XDXA 1OO9B 4K6DA 2EY2A 2F0VA 1HFNA 2DN8A 2B2VA 1UAPA 2L12A 3O13A 3VYRA 3LWEA 1XTCD 1EY7A 2MJ8A 5IGGA 5C0XJ 3H6MA 1OXXK 2KHSA 4H0LC 2KEEA 4H44C 1Q12A 1BNZA 4M8AA 1B9MA 4J6HA 4OO1I 2ICEC 5C3WA 2DY8A 2Y0SB 4L63B 1CTMA 1Q1BA 3DUZA 1VMCA 2F03A 1EY4A 1GUGA 3VYSA 4WJWA 1EIHA 1ENAA 3ERQA 1LTID 4A3BB 2WKDA 1WTPA 2O5JC 3MFYA 3NQIA 1AP0A 4KKSA 1EZ6A 5FO8B 1O80A 2B8FA 2NN6I 3NWTA 2R61A 4K5WA 1LO5D 1FD7D 1LV9A 2F0KA 4C56C 1TY0A 2L11A 1U4PA 4IQZA 2AUJD 4KY5A 1NR4A 2A74C 2J0TD 5IOCA 4KK7A 1RKNA 3TN2A 1IKMA 4DXGA 4ABNA 1J9OA 2PW5A 1UNSA 5EKIA 3OHXC 1ENCA 1DXMA 1LTGD 1T5XD 3S17B 2Z8LA 4IUUA 1JWMD 1CFMA 1S4ZA 4ID6A 4HAEA 4ZUIA 1AEXA 1ILQA 4J8QA 3RD4A 3T4AC 1PYWD 4EVOA 3PO2B 1BXTA 3TP5A 2EY1A 2B2YA 1O7YA 1LTRD 1Y1VB 4E6IA 2XVSA 5HGTA 1BCPC 1PFNA 2HUGA 1H9SA 1CM9A 1JWSD 1YNJC 4Y7NB 3JAML 2PPBC 3FRPB 5IGEA 5EQ0A 4ZRZA 4XYOA 1BBXC 4QUFA 1DONA 1I4HA 5D3DA 4FYDA 3D31A 3SK4A 3ND8A 2IPKD 4RHSA 3GTKB 3VR2A 1LTTD 5T1GA 4CKBA 2RDGA 3DEOA 1C48A 5DAUA 4BBRB 3MXPA 1SYFA 5CC4A 1SNOA 2M2LA 3T56B 3IAYA 2IX3A 4XYQA 1EY5A 1D5ZC 1EY6A 1PRTC 4Q0FA 4KHZA 1CHQD 1WCMB 3I4LA 4KV6A 3DXJC 2EYFA 4G7OC 5CV8A 2F1MA 2R92B 3NQTA 2E75C 4ZKCB 4IZ8A 2QDBA 2F0OA 4B9WA 1MI2A 1V1OA 4G7HC 4FF2A 1PFBA 2ZXRA 2A6EC 2IL8A 5CR3A 1B1ZA 2NVTB 3K7AB 2RQXA 1QNKA 1VF7A 5IT9L 1AN8A 5EPKA 3SHLA 4BBSB 3GTOB 3K5MA 4DNTB 3DMUA 4XXEA 1TKWB 3C2PA 4IFDG 1STHA 4XQQA 1W6JA 1MSGA 2EYOA 3OW7A 3JAME 3C1EA 3W2DA 1D1KA 4WORA 3IFTA 4BY1B 4KD3A 1V1PA 4KJOA 4R8IA 4CJ2C 2KVMA 3M3YB 3ND9A 2F0WA 1STYA 5C3EB 1BUVT 5KNBA 1NR2A 3FPPA 4RFBA 1HA6A 2BA1A 4C3HG 5JEAH 4B08A 1B44D 2B2WA 3S1QB 2KJXA 2WIIB 2J4XA 4DAVA 1XX8A 2MUYA 1HHVA 2C9OA 1PLFA 4HMJA 4ZQ3A 4K2LA 3S1MB 1JR0D 2KA7A 2EJFC 1IKLA 4KJNA 3BG3A 1HQRD 2K32A 1EYDA 4TQUS 1S5CD 3MC0B 5M3MB 2ID0A 1HTLD 1NAPA 1OXVA 3T51B 2B2UC 2EPBA 1L0XB 3WOEA 3J7AF 3K5OA 3TP6A 4RKLA 1XYIA 2E2IB 3S2HB 1A2UA 4ZYSA 3FDTA 3G6JB 5IT9E 2KCCA 3I4NB 1TS4A 1R9TB 3GQBA 3OWFA 3VR5A 5IGCA 1SNDA 5A2QL 4KHVA 2L5TA 3SK6A 2M00A 4U68A 2QILA 1LT5D 1EQTA 2JP1A 3K0YA 4OGQC 5IGFA 4NP5A 2F0FA 1SNMA 3IFDA 1CQFA 1TS5A 1NCVA 5LHY1 4C3JB 2EY5A 1TWGB 4IFDI 1R4QB 1RODA 5FO7B 1NUCA 3KUPA 2K03A 3PUZA 2JA5B 5KNCA 2LFNA 3EFXD 3U9SA 2SDFA 3R8BA 3SEBA 2KECA 2N55A 1LT3D 3V05A 4K8JA 3SE0A 2IW3A 3D8GA 4RGTA 1D5XC 1EU4A 2AQ2B 4HSPA 1IYUA 2NZ1D 3RZDB 1E2VA 5IGBA 1STNA 1JB3A 1F2ZA 4X3UA 1EEFD 5J39A 1B9NA 4K5VA 4BA2I 1HUMA 3QO2A 4A3JB 3A7LA 1X3QA 1SJHD 5ELBA 1SYBA 3D4WA 2M9VA 4QUCA 4EGVA 5JAVA 4KTAA 4GZYC 4IALA 5EGTA 1K8MA 2QKIC 1ZKOA 5EPJA 1BCPB 3J81L 1BOSA 1EOTA 2RDHA 3HOUB 3NBIA 1B53A 1MBYA 2CW0D 4CKEA 5A2QE 2X6LA 3CHBD 4KKTA 4NDXA 3ITPA 4FO2A 1SNQA 3I4MB 1WD0A 1F9PA 3C1FA 1HFGA 1WTRA 2MGSA 4QB4A 5FO9B 2YU9B 4ODGA 1RD9D 1TR5A 3M4OB 2A68D 2LMCB 5EJWA 4F8MA 2R93B 3M4YA 3RLFA 4H7BA 3QOLA 4G57A 3VR6A 3HOZB 1PRTB 1PTOD 4BY7B 1VCIA 4BA1I 4RCNA 1S5FD 2B2TC 3KLSX 2NYZD 1SXTA 4QIWB 3VA7A 1QB5D 1T5EA 5EBDA 5KNDA 1XWEA 5I2XA 2PZTA 2JE6I 1KABA 1A2TA 3N52A 1WTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2U A;  2O4X A;  3NUC A;  3SHL A;  1KAA A;  2F0N A;  5J1Z A;  1EY7 A;  4ME5 A;  1SYB A;  5M9O A;  5IGG A;  3DHQ A;  5EKL A;  5KRU A;  1JOO A;  1SNC A;  2F0P A;  3D4W A;  3H6M A;  1F2Y A;  2KHS A;  5ISR A;  5C6A A;  5EKK A;  2SNM A;  4B9X A;  3TP8 A;  2F0D A;  2NUC A;  3SR1 A;  3DMU A;  1U9R A;  3QB3 A;  5IGE A;  5C5M A;  5KEE A;  2F0I A;  4KTA A;  5JAV A;  1A3V A;  5KGU A;  4IAL A;  2F0H A;  5E1F A;  5EGT A;  4NKL A;  4J6H A;  2F0E A;  4RKB A;  3OWF A;  5HUR A;  1STH A;  2EY6 A;  3EJI A;  3T16 A;  5C3W A;  2OF1 A;  5IGC A;  2EYO A;  1SND A;  4YIJ A;  4R8N A;  2RDF A;  4PMB A;  3SK4 A;  4N9T A;  4J1M A;  3C1E A;  1SYD A;  3E5S A;  3QOJ A;  1SYE A;  1EY9 A;  3OSO A;  4KHV A;  4KY6 A;  3SK6 A;  1EY8 A;  1STG A;  2M00 A;  1EY4 A;  3LX0 A;  4WOR A;  2F0G A;  5CV5 A;  4KD3 A;  2EXZ A;  1ENA A;  2ENB A;  2PW7 A;  3OMG A;  3ERQ A;  4KJO A;  4F7X A;  5C5L A;  3BDL A;  2HQE A;  5DAU A;  5IGF A;  4OL7 A;  4NDX A;  2F0F A;  3ITP A;  4NP5 A;  5CGK A;  1SNM A;  3NP8 A;  1SNQ A;  2F0W A;  2F0L A;  1KDB A;  1STY A;  3MXP A;  3MHB A;  1EZ6 A;  1SYF A;  3NHH A;  1SNO A;  1NSN S;  1TT2 A;  2WAC A;  1KDC A;  2F0Q A;  4KD4 A;  3C1F A;  1EYA A;  5F2D A;  2EY5 A;  5I9P A;  3EVQ A;  3RUZ A;  3SK5 A;  1A3T A;  1NUC A;  3P75 A;  4N9P A;  4QB4 A;  4PNY A;  5JOB A;  1II3 A;  4DU9 A;  2OEO A;  4K5W A;  5K5P A;  1IHZ A;  1EY5 A;  5IIF A;  1EY0 A;  2F0K A;  4ODG A;  4DGZ A;  1EY6 A;  1TR5 A;  2F0T A;  2EYP A;  3MVV A;  1EYC A;  2LKV A;  2KQ3 A;  2SOB A;  2SNS A;  3SXH A;  5IGD A;  4F8M A;  4QMG A;  4MIU A;  4TRD A;  3ERO A;  5IOD A;  2F0M A;  5KYI A;  4HMI A;  5CV9 A;  4KV6 A;  2PZU A;  2EYF A;  4QF4 A;  3SK8 A;  5J22 A;  4KY5 A;  3NXW A;  5C4Z A;  2PQE A;  3S9W A;  4K8J A;  1STB A;  5CV8 A;  3PMF A;  3HZX A;  5I9O A;  4HTH A;  2RKS A;  1KDA A;  4H7B A;  5CV4 A;  4HMJ A;  3D8G A;  1RKN A;  4PMC A;  3VA5 A;  2EYM A;  4ZQ3 A;  5IOC A;  4K2L A;  3QOL A;  2PW5 A;  4K14 A;  4G57 A;  1ENC A;  4LAA A;  3P1H A;  5C4H A;  1SNP A;  1SYG A;  2EYH A;  2EYJ A;  2F0S A;  3MZ5 A;  3NQT A;  4ZUJ A;  4IUN A;  3TME A;  3U9O A;  2PYK A;  4EQN A;  4EQO A;  5NUC A;  5KYL A;  1STA A;  1F2M A;  4K2K A;  4IZ8 A;  1EQV A;  2QDB A;  4K8I A;  4KJN A;  4WRD A;  4S3S A;  5CV7 A;  2F0O A;  5DEH A;  1JOK A;  5E3F A;  4EQP A;  5IGB A;  1EYD A;  4B9W A;  2PZW A;  3R3O A;  1JOQ A;  1STN A;  4KY7 A;  1F2Z A;  3V2T A;  1A3U A;  4ID6 A;  4I65 A;  2F0U A;  2F0J A;  4K5X A;  3OMC A;  2OXP A;  5J39 A;  3D4D A;  4ZUI A;  1AEX A;  5HGT A;  5CR3 A;  5CC4 A;  4DF7 A;  3HEJ A;  2F3W A;  4EVO A;  4K5V A;  4NMZ A;  2F3V A;  3BDC A;  5C3X A;  4K6D A;  2PZT A;  1EZ8 A;  2EY2 A;  3TP5 A;  2EY1 A;  5I6W A;  2F0V A;  3MEH A;  1JOR A;  3TP6 A;  2RBM A;  5CV6 A;  4RKL A;  5KIX A;  3T13 A;  1TQO A;  1KAB A;  4DFA A;  5I6Y A;  1A2T A;  4E6I A;  3D6C A;  3NK9 A;  1SYC A;  3TP7 A;  2EYL A; 
#chains in the Genus database with same CATH topology
 1TWA B;  4GNX C;  5BR8 Q;  1I50 H;  5J1Z A;  4LFC L;  4RH6 A;  2D2C C;  2Y0S E;  3A5Z B;  3FMC A;  3UE0 A;  2F0E A;  1Q81 C;  3OYY A;  3OWE B;  3KLW A;  4LF7 Q;  1YNN C;  2N8N A;  2YYZ A;  4MN3 A;  2Y0S G;  3HOU H;  2AKW B;  3CF5 A;  3MFG A;  4DV7 Q;  3NBH B;  2NVX B;  1SLJ A;  1YI2 A;  1EY8 A;  1H9K A;  1MGS A;  2O2L D;  1ZXT A;  1LLR D;  1CSQ A;  1Z47 A;  3OMG A;  1WTW A;  4A3B G;  1LTS D;  3J81 E;  1HA5 A;  2JA6 B;  3I4M H;  4QQB X;  3NP8 A;  4PNY A;  1CA5 A;  4B3M Q;  2KEN A;  1HUN A;  1UUP A;  1PXU A;  2PMZ B;  3A0J A;  3E6Z X;  3RN2 A;  1JWU D;  3P75 A;  3GD7 A;  1DD2 A;  1RTO A;  2B2U A;  2UUC Q;  2B63 H;  1KL9 A;  2N49 A;  2XRS D;  2NVQ B;  3T53 B;  4X6A H;  3BYT B;  1X6O A;  3MVV A;  4OON A;  2SOB A;  3HOV G;  3ICE A;  4QMG A;  4RAU C;  1TWC B;  3SK8 A;  4QF4 A;  3VR4 A;  2I5H A;  1PV4 A;  1XPU A;  1Y14 B;  4YCV A;  3HOZ H;  3JAM c;  5LL6 X;  1EWC A;  2JQO A;  4FF1 A;  4BY7 H;  4X3S A;  1C7Y A;  1BCP F;  4EQO A;  1O7L A;  1F2M A;  4UHV A;  4DK6 C;  3OIQ A;  1QOH A;  4S3S A;  1G51 A;  3L2P A;  3GTG B;  1V9P A;  3D3R A;  4A3G B;  3NE5 B;  1Y8N B;  2IX1 A;  1D2B A;  1K8O A;  3L3O C;  1AE2 A;  3HOV B;  1HRJ A;  5D14 A;  4K5X A;  3OMC A;  1J5E L;  4JI1 Q;  3R2I A;  1L1O A;  4IUQ A;  1IYV A;  2K04 A;  3PO2 G;  2JA7 B;  4APV A;  2F3V A;  1PZJ D;  3HKZ B;  1TS2 A;  2AQ3 B;  2D62 A;  1Y1V G;  3NEN A;  1TWA H;  3F1Z A;  4DU9 A;  2QGQ A;  3S24 A;  4DR5 L;  2K5D A;  1PRT D;  3MA2 B;  1G29 1;  1U4R A;  4F87 A;  1NBW A;  2EE1 A;  2HHH Q;  2R7F A;  2FMC A;  3QB3 A;  4OEM B;  2OT2 A;  5IP9 G;  1I4G A;  2VW9 A;  2LXJ A;  3FKI G;  3CC4 A;  4CGY B;  4DR7 L;  4JK1 C;  3BVM A;  3STB D;  4DN4 M;  1CZG A;  1K83 B;  3EJI A;  5M5X B;  1HNW Q;  1S5B D;  1JCK B;  4R8N A;  1VQM A;  1F77 A;  1PRT F;  4Z9C B;  1BBW A;  4NW2 A;  4OX9 Q;  1EY9 A;  4KY6 A;  1I4X A;  4P2C B;  4LFB L;  1IBK L;  1JC7 A;  3HGB A;  5EBC A;  1DOK A;  1RL2 A;  1X32 A;  1PH9 A;  4U67 3;  2CH4 W;  2RHQ B;  1CUK A;  2HDM A;  1PH8 A;  3ULL A;  4GKK Q;  3MXN A;  4BBR G;  4JI0 Q;  2A6E D;  2PI2 A;  1BF4 A;  1K0S A;  3FEW X;  3FKI B;  5M9O A;  1X3E A;  1CKN B;  2EOT A;  3NTI A;  3PIO A;  4HJA A;  3RUZ A;  2NVQ H;  5IYD H;  5J3B A;  1A63 A;  2TSS A;  2MPM A;  3U4V A;  2RSO A;  2VL6 A;  5JPN C;  5I4D A;  3SXH A;  1EYC A;  1S5D D;  1TWC H;  5JEA G;  4DV1 L;  2A6H D;  3F2D A;  4IFD J;  1K3R A;  1Y8P B;  2PI2 E;  3H3V H;  5C4Z A;  3Q8D A;  3PUV A;  1LAC A;  2E8G A;  2MHV A;  4UP7 A;  2R92 G;  4DV4 Q;  4H02 A;  4LAA A;  2IHE A;  1SYG A;  2DGY A;  2EYH A;  2N78 A;  5KYL A;  1ASZ A;  3BU2 A;  1XJV A;  1GUS A;  1HQM C;  4A3G H;  1OXT A;  4EQP A;  4JI2 L;  3A5U A;  1KLG D;  1K8G A;  4RWS C;  1E1T A;  2Q8T A;  1VQH A;  1Y69 U;  3GTM B;  1MJE A;  2JA7 H;  4Y52 H;  4R9W A;  4HN7 A;  1Q1E A;  2VUM G;  4HCE A;  2D0O A;  5TSS A;  4IPD A;  3GTL B;  1GUO A;  2XTI A;  2Z6K A;  4A3K B;  4C2M B;  1T9H A;  2H5X A;  2I46 A;  3D6C A;  1EIF A;  1SYC A;  4BBS G;  2CVR A;  1AZQ A;  2H4O A;  2CHB D;  3VR3 A;  4HJ5 A;  1HR0 L;  4XT3 B;  3IL8 A;  5ISR A;  4A3E B;  4ZKB B;  4ULL A;  3NSW A;  1HNX L;  2L0C A;  4AQY Q;  3NPP A;  3B6Y A;  2VQE L;  1VQ4 A;  4XQN A;  5JJL A;  1K83 H;  5M5X H;  1D5M C;  2I07 B;  4BWG B;  1YJ9 A;  1XNQ L;  2Q2I A;  3U58 A;  1W6K A;  3E3X A;  2VUM B;  3UDX A;  5CMD A;  4WFN 3;  4PMB A;  1FYC A;  4J1M A;  5BN4 A;  3TRZ A;  4CDE C;  1L2F A;  2EXD A;  4BY1 G;  2F4V Q;  4L8J A;  1EQQ A;  1HPC A;  3OTO Q;  2ZXO A;  2UXD Q;  3CQZ B;  2RCN A;  1E2Z A;  2XWJ B;  3GTP H;  2BDN A;  1PH6 A;  2L9H A;  2LY7 A;  3PV0 A;  1AZP A;  4CBV A;  5M5W H;  2X6G A;  4GS3 A;  2XN9 C;  1ET6 A;  1B3Q A;  4JI4 Q;  3RN5 A;  1A6X A;  4JBW A;  1H9M A;  2VS1 A;  1IL8 A;  3M7N A;  4DV0 Q;  3SGI A;  3F2B A;  3RNU A;  3BZK A;  5C0X H;  3HOW G;  2LSS A;  5J22 A;  1FGU A;  2B3G A;  1SMY D;  2WP8 J;  2VNU D;  1MKH A;  1KTK A;  4HTH A;  3UDF A;  3CRL C;  1VQD A;  2PO4 A;  1V43 A;  4YWM A;  4Q5V A;  4HIO A;  3HOY H;  3NEL A;  3CPW A;  1Z6H A;  5C4H A;  1D6E C;  1SNP A;  2QCP X;  1ZYR C;  1FNW A;  1RCV D;  2F0S A;  3H3V C;  4WRD A;  4IPH A;  3GV3 A;  5IYC G;  3TSS A;  4IOC A;  3J7Z C;  5JVG 3;  5K36 H;  3GV6 A;  5M3M G;  1N34 Q;  4FP5 D;  1RHP A;  4XIG S;  3V2T A;  1ENF A;  1WD1 A;  2B39 A;  1WYD A;  4B3R L;  3GTJ B;  4EX5 A;  3G6E A;  3BVG A;  5C4X B;  4KI0 A;  2Z4H A;  3HOW B;  5CBA E;  2A69 C;  1Y1W H;  3GTL H;  1QUQ A;  4A3K H;  3I4O A;  2NZH A;  1EU3 A;  4X62 L;  1Z9F A;  2A73 B;  4IUP A;  4FF4 A;  1FJG L;  1CI3 M;  2JA9 A;  4AYB B;  2XIW A;  2E2D C;  3PCO B;  4RGM A;  3QJY A;  4RGO S;  1EWH A;  2F0P A;  1I94 L;  3KDF B;  2SNM A;  4JI3 L;  2B2V C;  1OTC A;  1TVX A;  4PV1 C;  1DJR D;  1X65 A;  2F0I A;  2WAQ E;  3I4N G;  1A3V A;  2QEJ C;  3EN2 A;  5KGU A;  1WVL A;  1XPR A;  1HNZ Q;  4DXF A;  3A8K E;  1F9Q A;  4O1N A;  3T16 A;  3H0G H;  2OF1 A;  4DAM A;  1HZB A;  1X3F A;  4JVZ A;  3KBG A;  1MD2 D;  3BJU A;  5FLX L;  5DNF A;  4GNX B;  2BH2 A;  4HJ7 A;  1Q46 A;  1PZI D;  3JC6 6;  1VQN A;  5IYB G;  3CQZ H;  1ESR A;  3U50 C;  2PW7 A;  2E2H H;  2ZTC A;  1KLU D;  4X65 L;  1LT4 D;  2VB2 X;  3I73 A;  1GUN A;  1H9R A;  1X55 A;  4CDF C;  4A4I A;  3K5N A;  2UU9 Q;  4P75 A;  1ONL A;  4KD4 A;  4LF9 Q;  4C3J G;  1TT2 A;  5I9P A;  2K1B A;  4FXD A;  3EVQ A;  4MHE A;  3SK5 A;  4MNO A;  3CKI B;  4N9P A;  2JA8 B;  1JJC B;  2JA5 G;  1FGB D;  4G4K A;  5FOB B;  4HED A;  3L7Z C;  3K59 A;  1STE A;  1ICW A;  2ZT9 C;  5D3I B;  2E76 C;  3I91 A;  3OPO A;  1VQJ A;  4UPA A;  2RCF A;  3BDO A;  1F2L A;  1KD1 C;  2K5N A;  1JE5 A;  1CA6 A;  2OTL A;  3MXG A;  4A3F H;  1B3A A;  4DAY A;  3DWQ A;  3PMF A;  3CCL A;  1N33 Q;  4A3D B;  2RKS A;  4OWT B;  4A3M H;  2NBF A;  4RHR A;  1V8Q A;  4K14 A;  1QWY A;  1PZK D;  2RHS B;  2JN4 A;  1CQV A;  5NUC A;  3CCU A;  4UP8 A;  4V19 0;  2UUA Q;  3CC7 A;  3S1N B;  4TSS A;  4JI5 L;  2R7Z H;  1C8C A;  2UXC L;  3MEF A;  1G8Z D;  2ZXP A;  4BS9 A;  3J80 i;  1B4O A;  2HDL A;  3WOF A;  1HCZ A;  3D4D A;  4GLA C;  5AJ3 Q;  1B2T A;  1S5E D;  5IWA Q;  2RA4 A;  3S1R H;  1PVO A;  1EZ8 A;  4IUV A;  2D5D A;  1SN8 A;  4IOA A;  5CV6 A;  5CBE E;  4UAI A;  1SSO A;  1SEB D;  1X54 A;  2KED A;  2O4X A;  2C35 B;  1B50 A;  1KAA A;  2IHF A;  3DHQ A;  5EKL A;  4CJ0 B;  4DKA C;  3A56 A;  1YVC A;  5C6A A;  4N8X 1;  2B2Y C;  4C3I B;  5KEE A;  4DAP A;  1EIG A;  3R93 A;  3KF8 B;  1L0W A;  4GOP C;  4YHH L;  2PQA A;  3E9I A;  5A35 A;  3AFQ A;  1XMQ L;  1SE8 A;  2BE5 D;  2KUM A;  3PSI A;  3PUW A;  5BN5 A;  3HOU G;  1SYD A;  2DY7 A;  2UXB L;  4C3H H;  2UUB Q;  2IT1 A;  1STG A;  3ULP A;  5M5Y H;  3ER0 A;  2C5C A;  1I50 B;  4IN3 A;  3TS2 A;  5FLX E;  3I4M G;  2F0L A;  3ZYY X;  1TWH H;  4I7A A;  2L1B A;  2ZM6 L;  3MHB A;  2ZJQ A;  1EYA A;  2VXW A;  2JA8 H;  4JG2 A;  3MTS A;  1BDO A;  1H9J A;  3D6W A;  1WTV A;  1A15 A;  1EIY B;  1QCB D;  2K6A A;  4DR6 L;  3QWN A;  5K5P A;  1V1Q A;  2B63 G;  3FPU B;  2LKV A;  2SNS A;  2DNE A;  4DUY L;  2R93 G;  1D8L A;  2J7Z A;  4FVM A;  1QJO A;  2H1E A;  1PMR A;  2VY3 A;  4F88 A;  2ASB A;  2JJQ A;  1HTP A;  1Q90 A;  3M7G A;  3MXU A;  4UDU C;  4A3D H;  3S14 B;  1KDA A;  2EDG A;  1YNN D;  4RCO A;  3K6O A;  2CWA A;  1M4V A;  2F3I A;  3HOZ G;  4RA8 A;  4QIW E;  3MZ5 A;  4BY7 G;  1RF2 D;  3A8I E;  4DK0 A;  1JOK A;  4R4O A;  2NVY B;  5AFW A;  2PZW A;  4CKC A;  2B63 B;  4JV5 L;  2K28 A;  1LM0 A;  5ELC A;  4I65 A;  3DLL A;  3PUY A;  4OIJ A;  1IBM Q;  1WTQ A;  2WV6 D;  1U4L A;  3TEH B;  4ZCK A;  2QF7 A;  1A62 A;  3NBH A;  4G7Z C;  3BDC A;  2KOL A;  5I6W A;  1RIP A;  4IPC A;  1TQO A;  4DR2 L;  4FXG C;  5KYI A;  2FIN B;  2ICI A;  3TP7 A;  3C46 A;  2EYL A;  1GO3 E;  4DR3 L;  1QIL A;  4DV3 L;  4DR4 L;  1EQR A;  1JOO A;  4JOI C;  1MIU A;  2QA4 A;  3J80 L;  2XRQ D;  3V96 A;  2N88 A;  4NPS A;  2KCN A;  2EY6 A;  4KN7 C;  1VQK A;  3PIO 3;  4OEL B;  1FNU A;  4B3T L;  4O0A A;  2HT1 A;  1KNE A;  4ZK9 B;  3I72 A;  2E5L L;  2KBN A;  1ML0 D;  2BDO A;  1U0L A;  1M8A A;  5GRO A;  2K5Q A;  4JI6 L;  1WOC A;  5LL6 S;  3EQL C;  2RSN A;  2EXZ A;  3DEP A;  4KKU A;  1B8A A;  1N36 Q;  3Q23 A;  2JA6 G;  3BDL A;  2HQE A;  2PMZ E;  4RMF A;  1S40 A;  1EUJ A;  3U4Z A;  3BZD B;  2OCE A;  1KDB A;  3ULJ A;  1K8A C;  1ESF A;  3CAM A;  3FVQ A;  4RG1 A;  1SAP A;  2ZTD A;  1N32 L;  2BA0 A;  1SMX A;  4LF4 L;  2OQK A;  3P7J A;  5LMN Q;  1YJN A;  3OOC A;  2VQF L;  1II3 A;  2GVB A;  4DUZ Q;  5E4X A;  3KJO A;  4UP9 A;  1M90 C;  1CZW A;  1FR3 A;  2EYP A;  1FL0 A;  2K5W A;  1WTH A;  1YHQ A;  2K05 A;  2CW0 C;  4XTC S;  1U5K A;  3JAM i;  1J8I A;  4MIU A;  5ELF A;  1GXD C;  2F0M A;  3T1H L;  3S14 H;  3S9W A;  1XNR L;  5JPM C;  4LMQ D;  1SE3 A;  3I3C A;  3F2U A;  2K4K A;  2B2W C;  1TS3 A;  1VDZ A;  1HR0 W;  2BCO A;  2NVY H;  1EQV A;  3P20 A;  1BCP D;  4PZ7 A;  1BVS A;  1M1K C;  1E22 A;  1TY2 A;  1J5E Q;  2WKC A;  3S2D H;  4A3G G;  3G7L A;  3R3O A;  2A68 C;  1O7Z A;  1GHJ A;  3QG1 A;  3GO5 A;  1VQ6 A;  1YNJ D;  3QIA A;  3HKZ E;  1G6P A;  4OHJ A;  4OO1 H;  2JA7 G;  2XSC A;  3HEJ A;  3HFZ B;  1P8L A;  2Q2H A;  4GLV B;  3HKZ G;  5C3X A;  4DR5 Q;  5C4J B;  2F52 A;  2E2J H;  2WFW A;  4DNI A;  3TQY A;  3K80 C;  1PTO C;  2I5M X;  4L6T B;  4OIK A;  5JEA J;  4R4T A;  2K14 A;  2ES2 A;  2Z0S A;  3C3L A;  4DV7 L;  2EZV A;  3PO3 B;  1F2Y A;  4DR7 Q;  1CKN A;  2F0D A;  3SR1 A;  1NJI C;  1U9R A;  1TWF H;  5C5M A;  1LTA D;  2G9H D;  1SE2 A;  5E1F A;  1MJC A;  3J7Y W;  2NN6 H;  3NWS A;  4LFB Q;  3J80 E;  1IW7 C;  2JYO A;  2JEA I;  1GOZ A;  2NTT A;  3X3M A;  2FMM A;  2ALY B;  2ATW A;  1L0Y B;  1DOM A;  1K0R A;  3S15 B;  1RJT A;  1UE6 A;  1DCZ A;  3H15 A;  3RLO A;  5FK9 C;  3FP9 A;  5CGK A;  3IKJ A;  1YJW A;  2R6G A;  4YY3 Q;  4XQJ A;  5ELN A;  1LTB D;  1A3T A;  2L15 A;  3A54 A;  4DV1 Q;  5H1S E;  4ZLT F;  1EEI D;  2G5D A;  5BN3 A;  2CQA A;  2PNR C;  5COY A;  4IPG A;  1W2B A;  4JI7 Q;  2K5V A;  4A93 B;  5C0X G;  1BQQ T;  1YIJ A;  3GTP B;  1G6Z A;  1I6V C;  4PMC A;  2EYM A;  1I3Q B;  3A8J E;  3W3A A;  4HSV A;  5M5W B;  4JI2 Q;  1PH3 A;  2HCC A;  1KRS A;  3TME A;  3HOY G;  3U9O A;  2G9D A;  2EVB A;  4K2K A;  4K8I A;  1QZH A;  1GHK A;  3PIP A;  4A75 A;  4X3K A;  5K36 G;  2PCF B;  3CCM A;  4KY7 A;  1NTG A;  5IT9 c;  1DZ1 A;  1X9N A;  2V4D A;  4X64 L;  5DM6 3;  1PYS B;  3BS1 A;  1JIC A;  1X3P A;  5C4J H;  3RR5 A;  3I56 A;  1Y1W G;  4NMZ A;  1VQE A;  3H3V I;  4A3K G;  4KLK A;  4DA2 A;  1PDQ A;  1Y8O B;  2GVA A;  2FXQ A;  4AH6 A;  3HOY B;  1HNW L;  3G4S A;  3PO3 H;  1I4P A;  1F9S A;  4ME5 A;  4V0B A;  4A3B H;  4A3E G;  4QCL A;  1GJX A;  1SNC A;  3RZO B;  5LMU L;  2Z6B A;  4B9X A;  4DK1 A;  1QVG A;  2NUC A;  3CU7 A;  3I8Z A;  4K0K L;  4HIM A;  2MO0 A;  3KYH C;  4RKB A;  3CP0 A;  1U4M A;  1GUW A;  1LYL A;  3TZD A;  3SVM A;  1CKM A;  3KLS A;  1Y1W B;  1ZYR D;  2XNA C;  3RLN A;  3BZC A;  3E5S A;  3K58 A;  1JE4 A;  2YV5 A;  1G2T A;  3I55 A;  4X3T A;  3S15 H;  3K81 C;  5CV5 A;  5GAE C;  2HIV A;  3VYU A;  1D1I A;  2E74 C;  5ELD A;  3Q0A A;  4GOP B;  2A69 D;  1CT1 D;  3I90 A;  3CCJ A;  2K50 A;  1S72 A;  4PQX A;  1H9S B;  3STB C;  4P71 A;  3MWY W;  3GP7 A;  5G3L D;  5E4W C;  5I2Y A;  3CXC A;  5FLM H;  4POG A;  1QVC A;  3H0G B;  1VQF A;  5GAH C;  2MQH A;  4LFA L;  2K7V A;  2NWG A;  1IHZ A;  3PUX A;  1PYB A;  3HG9 A;  2HD3 A;  1R4P B;  2F4I A;  2K52 A;  2XWB B;  5IGD A;  4DV2 L;  3CD6 A;  3DWP A;  3ERO A;  4A93 H;  4LJZ C;  5CV9 A;  4IUT A;  1EOV A;  3QR8 A;  1I4R A;  3J7A V;  2B2T A;  2Q8R E;  2PQE A;  3NXW A;  1STB A;  1SRO A;  1I3Q H;  1SE4 A;  1SJE D;  4A3F G;  5G3L F;  5I9O A;  1DOL A;  1PH5 A;  4L5Q A;  3KF6 B;  2KCT A;  2IJ0 A;  2WB1 B;  4JI8 L;  3KDF A;  3TDQ A;  1GUT A;  1STA A;  3CCV A;  1JJ2 A;  5JJI A;  1SDF A;  1XTD A;  2Q2T A;  1HH2 P;  4B3R Q;  4Y7N H;  2R7Z G;  2D9U A;  3DM1 A;  5DM7 3;  2A6H C;  5C4X G;  1LT6 D;  4QGU A;  4LF8 L;  2KCM A;  3AYH B;  1OXU A;  3HP3 A;  5D65 A;  3H94 A;  4PMW A;  4GNX A;  3OIP A;  3A7A B;  4AYB E;  4H13 C;  5C0X I;  2JEB I;  2A5H A;  1IL2 A;  2TMP A;  4A3F B;  4UY8 C;  3MEH A;  1DGS A;  5KIX A;  2RBM A;  3GTK H;  1JQY D;  4DFA A;  5I6Y A;  4A3M B;  2Z4I A;  4AYB G;  4XT1 B;  3NK9 A;  1I94 Q;  4HR7 B;  1WFQ A;  4JI3 Q;  3RZO H;  4WJ3 M;  2R7Z B;  1VQ5 A;  5CYU A;  3TP8 A;  1W3S A;  3D0F A;  3OTO L;  2UXD L;  2OWO A;  3Q24 A;  1F9R A;  1VQ7 A;  1JT8 A;  1XMO L;  4YIJ A;  3CRK C;  3S1R B;  4N9T A;  3AMU A;  3L9A X;  4K6L A;  4JW0 A;  1RDP D;  4ALP A;  4X65 Q;  3LX0 A;  1WCM H;  2F0G A;  5HY6 A;  4N8F A;  4DV0 L;  1IXR A;  2XGT A;  4PG3 A;  1O7I A;  1UE1 A;  2R92 H;  2DJF C;  4O42 A;  2JA8 G;  3T1Y L;  2MO1 A;  4NXN Q;  5JOB A;  1AW7 A;  4ZAI A;  5IIF A;  4KMU C;  2AWO A;  1EY0 A;  4DGZ A;  2F0T A;  1ET9 A;  4R1J A;  4C3H B;  5M5Y B;  1WTO A;  2NVT H;  5L37 A;  1QG7 A;  1JB7 A;  1DM0 B;  4A3D G;  1V1P B;  3HZX A;  4M1U B;  1TWH B;  4QJF A;  2UXC Q;  2FJ2 A;  3X3N A;  5CV7 A;  2X69 A;  1GKH A;  1YHA A;  2B8G A;  1BO0 A;  1A3U A;  3KF8 A;  2F0J A;  1VQI A;  2ZTE A;  3AB9 A;  1C4Q A;  3VDY A;  4CHT B;  1VQL A;  4LUO A;  2EJG C;  1SMY C;  4KN4 C;  1XXG A;  5GAG C;  1EYG A;  1I4Q A;  1AFP A;  4ILW A;  1JOR A;  2WAQ B;  2JSO A;  4FXK C;  2IWH A;  4BY1 H;  1L1O C;  3NUC A;  4LUZ A;  2F0N A;  2K75 A;  3G48 A;  3M3Y H;  1EL0 A;  3J81 c;  4C3I G;  5C44 B;  1ZEQ X;  1QNU A;  5C3E H;  3CPF A;  4IFD H;  2F0H A;  2AUK A;  4NKL A;  1XMQ Q;  1TXY A;  2AWN A;  2LXK A;  1Q82 C;  1PTO B;  2UU9 L;  2EQS A;  1SFO B;  5FJ8 G;  2RF4 A;  1E0B A;  1A0I A;  3K57 A;  1E2W A;  3E0J A;  1VQO A;  3S1Q H;  4POF A;  2N3S A;  3HS0 C;  4C1N I;  3M85 A;  3LNN A;  3NTK A;  4GN4 B;  2PNH A;  4LF5 L;  5JJZ A;  2I5L X;  1IBL Q;  3S16 B;  2ZJR A;  3WDN A;  1K28 A;  3NHH A;  2CKZ B;  1KDC A;  3S1M H;  5F2D A;  3MAQ A;  1O78 A;  2E2H B;  3CCS A;  4DR1 L;  3G71 A;  4B3S L;  2OEO A;  4DUY Q;  4NXM Q;  1OXS C;  5DLQ E;  3KOJ A;  3LWU A;  1K3B C;  3TBI B;  2LS0 1;  3H09 A;  5EPL A;  4TRD A;  1YBY A;  1MSH A;  3D4R A;  1UEA B;  1KXL A;  1P16 A;  4IO9 A;  1DYQ A;  1SBB B;  5FKA C;  5CV4 A;  3HOX B;  2E2I H;  3R2T A;  2L55 A;  4X66 Q;  4ME3 A;  2EJM A;  3P1H A;  1HJP A;  3ONA B;  2EYJ A;  1G2S A;  3A55 A;  1VQ8 A;  3URY A;  1FNV A;  4EQN A;  4GKJ L;  4JV5 Q;  4LNQ A;  1G91 A;  1PFM A;  5DEH A;  4IJL A;  4DV6 Q;  5E3F A;  3ERS X;  1CK1 A;  4HCS A;  1BR9 A;  1VF5 C;  1AE3 A;  2SEB D;  1R9T H;  1Q8I A;  1VMP A;  4OO1 G;  4DR2 Q;  2F3W A;  2FFK B;  3Q6S A;  1WTX A;  2HCI A;  3KFU A;  2JXM B;  3N6R A;  3T13 A;  4DR4 Q;  4EQ5 A;  1E1O A;  1PFS A;  1Q3L A;  4I7Z C;  1YIT A;  2KHJ A;  4A3C H;  1YEZ A;  5KRU A;  5C44 H;  1RTN A;  2UUB L;  4KHP L;  2OTJ A;  3S2D B;  2DNC A;  3CW2 C;  5EKK A;  2Z6K C;  2Z1C A;  4RGN A;  4IUR A;  1CSP A;  1EFI D;  2O5I C;  4C3J H;  3KK7 A;  1TWG H;  2B29 A;  5COR A;  3BVZ A;  3J7A 5;  1PTO H;  3AU7 A;  5HUR A;  1NMF A;  1SFO H;  2E5L Q;  2NN6 G;  3NEM A;  1CHP D;  4L5R C;  2RDF A;  1I6H B;  1E24 A;  3I70 A;  4GN3 B;  3E0E A;  3QOJ A;  4LK1 C;  2E2J B;  1SYE A;  3OSO A;  4A3L H;  2RVL A;  4LFC Q;  4BXX H;  1VQC A;  4MTK A;  3GDE A;  4C1N K;  2ENB A;  4F7X A;  2KHI A;  1J6Q A;  3S16 H;  5C5L A;  3F2C A;  4OL7 A;  2AHO B;  4A3I B;  4FF3 A;  3VYT A;  1TII D;  4LF4 Q;  3DWA A;  2L4N A;  2NTS A;  3SDZ A;  1NSN S;  3EA6 A;  2P5Z X;  1TWF B;  2F0Q A;  2WAC A;  4JBJ A;  2VQF Q;  1LTL A;  2Q8I B;  1QE6 A;  3KBX A;  2AQ1 B;  1Z7T A;  3CCE A;  2Q2U A;  4A76 A;  1KNA A;  1TU2 B;  3F8T A;  2BE5 C;  3HRZ C;  4DNR B;  1PA6 A;  4JYA L;  2WIN B;  2VZA A;  3T1H Q;  3PIP 3;  3H91 A;  2VB3 X;  2BOS A;  2KQ3 A;  3M4Q A;  3BYY B;  1ILP A;  2IX0 A;  1HXY D;  4HMI A;  1BKB A;  2PZU A;  3GTQ B;  5ELE A;  3HOX H;  5JVH 3;  5IOD A;  3VA5 A;  1PTO F;  4FNF A;  5T1I A;  3TZU A;  4A3J H;  1IW7 D;  2GA4 B;  4ZUJ A;  3K5L A;  2FHT A;  1LAB A;  3NTH A;  4IUN A;  2NB0 A;  4DV5 L;  2PYK A;  5IYD G;  3RMH A;  5M3F B;  1VS0 A;  3Q22 A;  4TKO B;  1UEB A;  2MP1 A;  1JOQ A;  3KLR A;  2K33 A;  3UI2 A;  4LF6 L;  2F0U A;  2K01 A;  2R3Z A;  4CJ1 B;  2OXP A;  2JK8 A;  1KAW A;  1QVF A;  4DF7 A;  4XDX A;  1OO9 B;  4JCV E;  4K6D A;  2EY2 A;  2F0V A;  1HFN A;  2DN8 A;  2B2V A;  1UAP A;  2L12 A;  3O13 A;  3VYR A;  4JBK A;  4MZ9 A;  1VQP A;  3LWE A;  1EWI A;  1XTC D;  2EIF A;  5IP7 H;  1EY7 A;  3PO3 G;  2MJ8 A;  5IGG A;  1HZ9 A;  3H6M A;  5C0X J;  1OXX K;  2KHS A;  4HIK A;  4H0L C;  2KEE A;  5BR8 L;  4H44 C;  1Q12 A;  1BNZ A;  4M8A A;  1N36 L;  1B9M A;  1UWV A;  4J6H A;  3K8A A;  4OO1 I;  2ICE C;  5C3W A;  2DY8 A;  1XPO A;  3IRB A;  4IJH A;  1I6H H;  2YU9 H;  1IZ6 A;  4CDC C;  2Y0S B;  4L63 B;  3M4O H;  1CTM A;  1Q1B A;  3DUZ A;  4LF7 L;  1VMC A;  5LMN L;  1UE7 A;  1X3G A;  2R93 H;  2F03 A;  1EY4 A;  1GUG A;  3VYS A;  3M9B A;  4DUZ L;  2D0P A;  4WJW A;  4A3I H;  1ENA A;  1EIH A;  3ERQ A;  1LTI D;  4A3B B;  2WKD A;  1WTP A;  1C0A A;  2DJG C;  1FVI A;  4J15 A;  2O5J C;  3MFY A;  3NQI A;  1AP0 A;  2CFM A;  4KKS A;  1EZ6 A;  5FO8 B;  1O80 A;  2B8F A;  2HQL A;  4OXP A;  2NN6 I;  1IBK Q;  3NWT A;  4B3M L;  5FLM G;  2R61 A;  1Q7Y C;  4K5W A;  1LO5 D;  1FD7 D;  2MNA A;  1LV9 A;  2F0K A;  4C56 C;  4O2D A;  1TY0 A;  3CC2 A;  2UUC L;  3A74 A;  3GTQ H;  2L11 A;  1U4P A;  4A93 G;  4IQZ A;  2AUJ D;  4KY5 A;  1NR4 A;  2A74 C;  2J0T D;  1JMC A;  5IOC A;  4KK7 A;  1RKN A;  3TN2 A;  1IKM A;  4ABN A;  1J9O A;  2PW5 A;  4DXG A;  1UNS A;  5EKI A;  3OHX C;  1ENC A;  1DXM A;  1LTG D;  1T5X D;  5M3F H;  3S17 B;  2Z8L A;  3CCR A;  1VQA A;  4IUU A;  1JWM D;  3CMA A;  4JC0 A;  4X64 Q;  2DUD A;  3WWV A;  1CFM A;  1S4Z A;  4ID6 A;  3EIV A;  4HAE A;  4ZUI A;  5GAD C;  1AEX A;  1ILQ A;  4J8Q A;  3RD4 A;  3T4A C;  1PYW D;  4EVO A;  3PO2 B;  4TVA B;  4JI1 L;  1BXT A;  3TP5 A;  2EY1 A;  2NVX H;  2B2Y A;  1O7Y A;  1LTR D;  1Y1V B;  4E6I A;  2XVS A;  5LMU Q;  5HGT A;  1BCP C;  1K9M C;  4FDB A;  4GOP A;  1PFN A;  2HUG A;  4WJ4 A;  2JA6 H;  1H9S A;  4K0K Q;  1CM9 A;  1JWS D;  1YNJ C;  4Y7N B;  3JAM L;  2A8V A;  2PPB C;  3FRP B;  5IGE A;  5EQ0 A;  4ZRZ A;  1WJJ A;  4XYO A;  1BBX C;  4QUF A;  1DON A;  2AMC B;  2HHH L;  1SR3 A;  1I4H A;  5D3D A;  4L5T A;  4FYD A;  4YWL A;  3D31 A;  1L1O B;  4YY3 L;  3SK4 A;  1AH9 A;  3ND8 A;  1HR0 Q;  2IPK D;  1GM5 A;  4RHS A;  3GTK B;  3VR2 A;  1LTT D;  1UE5 A;  1KC8 C;  1KRT A;  3UE1 A;  1HNX Q;  5T1G A;  4OX9 L;  1WCM G;  2VQE Q;  4CKB A;  2RDG A;  3DEO A;  1KQS A;  1C48 A;  5DAU A;  1XNQ Q;  3KF6 A;  3KJP A;  4BBR B;  1Q8K A;  4GKK L;  3MXP A;  1SYF A;  5CC4 A;  1SNO A;  4JI7 L;  4JI0 L;  4LFA Q;  1WI5 A;  2M2L A;  3T56 B;  3IAY A;  3H0G G;  2CCZ A;  3GTG H;  2IX3 A;  1PH2 A;  4DV2 Q;  5IE8 A;  4XYQ A;  1EY5 A;  1I5F A;  1D5Z C;  1EY6 A;  3HOV H;  1PRT C;  3W5O A;  4Q0F A;  4KHZ A;  1CHQ D;  1WCM B;  3I4L A;  4KV6 A;  3DXJ C;  2WB1 E;  2EYF A;  1N9W A;  4G7O C;  5CV8 A;  4JI8 Q;  3EBE A;  2F1M A;  1ICF B;  3MXN B;  3S17 H;  2WB1 G;  2R92 B;  2MFI A;  1NMG A;  3NQT A;  2E75 C;  4ZKC B;  4IZ8 A;  2QDB A;  4DV4 L;  3HKS A;  2F0O A;  3TS0 A;  3K7U C;  4B9W A;  4LF8 Q;  1MI2 A;  1V1O A;  1LUZ A;  4MTN A;  4G7H C;  1QZG A;  4LUV A;  4FF2 A;  1PFB A;  2ZXR A;  3CME A;  2A6E C;  2IL8 A;  3PO2 H;  5CR3 A;  2YTY A;  3AEV A;  1B1Z A;  1EFW A;  2NVT B;  3K7A B;  4CDD C;  4JOI A;  3I7F A;  3PGZ A;  1Y1V H;  4A3M G;  3TRE A;  2RQX A;  1QNK A;  1VF7 A;  5IT9 L;  1AN8 A;  5EPK A;  3SHL A;  4BBS B;  3GTO B;  2NZO A;  5FLX c;  1NY4 A;  3K5M A;  4DNT B;  5IP9 H;  3DMU A;  3FKI H;  4X62 Q;  4XXE A;  1TKW B;  5C3E G;  1XMO Q;  3AQQ A;  2R7D A;  3C2P A;  4IFD G;  4R4C A;  1STH A;  2HIX A;  4XQQ A;  4AQY L;  1FJG Q;  1W6J A;  1MSG A;  3W1G A;  2EYO A;  5E7N A;  3OW7 A;  3UDI A;  3LGJ A;  3JAM E;  3C1E A;  3W2D A;  1D1K A;  4WOR A;  3IFT A;  4BY1 B;  4KD3 A;  1V1P A;  4KJO A;  4R8I A;  1JJG A;  4CJ2 C;  4BBR H;  2KVM A;  3M3Y B;  3ND9 A;  2F4V L;  2F0W A;  1STY A;  3T1Y Q;  4PZ8 A;  5C3E B;  3DM3 A;  1BUV T;  1VQG A;  5KNB A;  1NR2 A;  3FPP A;  4RFB A;  1PHJ A;  1HA6 A;  4JI4 L;  2BA1 A;  4C3H G;  5JEA H;  3GTM H;  4B08 A;  1B44 D;  2B2W A;  3S1Q B;  2KJX A;  3L0O A;  2WII B;  2J4X A;  4DAV A;  4HID A;  5EAY A;  1XX8 A;  2MUY A;  1HHV A;  2C9O A;  1PLF A;  4C2M H;  1S3O A;  4HMJ A;  4ZQ3 A;  4K2L A;  3S1M B;  1NNX A;  1JR0 D;  2KA7 A;  2EJF C;  1IKL A;  4KJN A;  3BG3 A;  1HQR D;  1E3P A;  2K32 A;  4A3E H;  1EYD A;  4TQU S;  1S5C D;  3MC0 B;  4DK3 C;  5M3M B;  2ID0 A;  1HTL D;  1NAP A;  1OXV A;  3K7A H;  1N34 L;  3T51 B;  2VUM H;  2B2U C;  2EPB A;  2CWP A;  3UDG A;  2A1A A;  1L0X B;  2WAQ G;  3WOE A;  3J7A F;  3K5O A;  3TP6 A;  3J81 i;  4RKL A;  4JI5 Q;  1XYI A;  2E2I B;  4BBS H;  1HZA A;  3GTO H;  1YHB A;  3S2H B;  1A2U A;  4QY7 A;  4ZYS A;  3FDT A;  4A3C G;  5C44 G;  3G6J B;  5IT9 E;  2KCC A;  3I4N B;  1TS4 A;  1R9T B;  3GQB A;  3OWF A;  4P72 A;  3VR5 A;  4PZ6 A;  2K5H A;  1YZ6 A;  5IGC A;  1SND A;  5A2Q L;  1HNZ L;  1KIX A;  1CKO A;  4NB3 A;  5JJK A;  1QUQ B;  4KHV A;  2L5T A;  4NXN L;  3SK6 A;  4LF5 Q;  2M00 A;  1GVP A;  4U68 A;  4A3L G;  4BXX G;  4YCU A;  4LWC A;  2QIL A;  1N8R C;  1LT5 D;  1EQT A;  2JP1 A;  3K0Y A;  3K0X A;  4OGQ C;  5IGF A;  2YTX A;  4NP5 A;  2F0F A;  2YTV A;  1SNM A;  3IFD A;  4HJ9 A;  4YHH Q;  1CQF A;  1TS5 A;  4DR1 Q;  4B3S Q;  1NCV A;  5LHY 1;  4JBM A;  4C3J B;  1A8V A;  1TWG B;  2EY5 A;  4IFD I;  2UXB Q;  1R4Q B;  2ZJP A;  1ROD A;  5FO7 B;  4LF9 L;  1NUC A;  4YCW A;  3KUP A;  2CH4 A;  2K03 A;  1X56 A;  3PUZ A;  1VQ9 A;  2JA5 B;  5KNC A;  3GTJ H;  5C4X H;  2LFN A;  3EFX D;  3U9S A;  2SDF A;  1VQB A;  3R8B A;  3SEB A;  3HOW H;  1YNX A;  2KEC A;  2ZM6 Q;  1IYJ B;  2N55 A;  1BBU A;  1LT3 D;  1PH4 A;  4R4I A;  3V05 A;  4K8J A;  3SE0 A;  3OW2 A;  3HOX G;  4GKJ Q;  2IW3 A;  3D8G A;  4RGT A;  1D5X C;  1EU4 A;  2AQ2 B;  2BH8 A;  4DR6 Q;  4HSP A;  1IYU A;  2NZ1 D;  4A3J G;  1N33 L;  5IYC H;  1C9O A;  3RZD B;  1E2V A;  5IGB A;  5M3M H;  1STN A;  1JB3 A;  1F2Z A;  4X3U A;  1EEF D;  4HJ8 A;  2UUA L;  2GN5 A;  5J39 A;  1PH1 A;  2Z9H A;  1B9N A;  4K5V A;  3M4P A;  5AJ3 L;  3FHW A;  3J80 c;  5LMN W;  5IWA L;  3S2H H;  4JPB W;  4BA2 I;  1HUM A;  4DAY B;  3QO2 A;  4A3J B;  4KHP Q;  3A7L A;  1X3Q A;  1SJH D;  5ELB A;  2OQ0 A;  3AFP A;  1SYB A;  5IP7 G;  3PF4 A;  4R4Q A;  3D4W A;  2M9V A;  4QUC A;  3I4N H;  4OWX B;  4EGV A;  2QEX A;  1B7Y B;  5JAV A;  4KTA A;  4GZY C;  4GN5 A;  4IAL A;  5EGT A;  5ELO A;  1ASY A;  2QDL A;  3J81 j;  1K8M A;  1IBL L;  2QKI C;  1ZKO A;  5EPJ A;  4DR3 Q;  1BCP B;  4DV3 Q;  3J81 L;  1BOS A;  1EOT A;  2RDH A;  3HOU B;  3ZJY C;  2I0Q A;  1K73 C;  5IYB H;  1D7Q A;  3NBI A;  4NXM L;  1B53 A;  1MBY A;  2CW0 D;  4CKE A;  3I2Z A;  1SRU A;  5A2Q E;  2X6L A;  4A3I G;  3CHB D;  4KKT A;  4NDX A;  3ITP A;  4FO2 A;  1SNQ A;  3I4M B;  1WD0 A;  1F9P A;  4B3T Q;  4LW1 A;  3C1F A;  2IY5 B;  4JYA Q;  1HFG A;  2QW7 A;  4AIM A;  1WTR A;  2MGS A;  3S1N H;  4QB4 A;  4JI6 Q;  4X66 L;  5FO9 B;  2JA5 H;  2YU9 B;  3PF5 A;  1HZC A;  4ODG A;  1RD9 D;  2PQA B;  1TR5 A;  4L5S A;  3M4O B;  3E9H A;  4GLX A;  2A68 D;  2LMC B;  5EJW A;  4F8M A;  4DV6 L;  2R93 B;  1Q86 C;  2V1C C;  3M4Y A;  3RLF A;  1N32 Q;  1H95 A;  3PQI A;  4OWW B;  4DV5 Q;  4H7B A;  5HGQ A;  3QOL A;  3W1B A;  4G57 A;  3VR6 A;  1PH7 A;  3HOZ B;  3RZD H;  1PRT B;  4P73 A;  5GQO A;  1PTO D;  1B70 B;  4BY7 B;  5M3F G;  1VCI A;  4BA1 I;  4RCN A;  1S5F D;  2B2T C;  4LF6 Q;  3KLS X;  2NYZ D;  4C3I H;  1SXT A;  4YWK A;  4QIW B;  1MHW C;  3VA7 A;  1QB5 D;  1T5E A;  1XNR Q;  4DPG A;  5IY0 A;  5EBD A;  3CCQ A;  5KND A;  1IBM L;  1KHI A;  1XWE A;  5I2X A;  1GD7 A;  2CQO A;  2PZT A;  5FJ8 H;  2JE6 I;  1E7Z A;  1KAB A;  4P74 A;  4QL5 A;  1A2T A;  1NE3 A;  3N52 A;  2A19 A; 
#chains in the Genus database with same CATH homology
 1TWA B;  5J1Z A;  4RH6 A;  2D2C C;  3FMC A;  2F0E A;  3OWE B;  1YNN C;  2YYZ A;  4MN3 A;  3MFG A;  2NVX B;  1EY8 A;  1H9K A;  1MGS A;  2O2L D;  1ZXT A;  1LLR D;  1Z47 A;  3OMG A;  1WTW A;  1LTS D;  3J81 E;  1HA5 A;  2JA6 B;  3NP8 A;  4PNY A;  1CA5 A;  1HUN A;  1UUP A;  1PXU A;  2PMZ B;  3E6Z X;  1JWU D;  3P75 A;  3GD7 A;  1DD2 A;  1RTO A;  2B2U A;  2NVQ B;  2XRS D;  3T53 B;  3BYT B;  3MVV A;  2SOB A;  4QMG A;  4RAU C;  1TWC B;  3SK8 A;  4QF4 A;  3VR4 A;  5LL6 X;  1EWC A;  4FF1 A;  4X3S A;  1BCP F;  4EQO A;  1O7L A;  1F2M A;  3OIQ A;  1QOH A;  4S3S A;  3GTG B;  3D3R A;  4A3G B;  3NE5 B;  1Y8N B;  2IX1 A;  1D2B A;  1K8O A;  3L3O C;  3HOV B;  1HRJ A;  5D14 A;  4K5X A;  3OMC A;  3R2I A;  4IUQ A;  1IYV A;  2K04 A;  2JA7 B;  2F3V A;  1PZJ D;  3HKZ B;  1TS2 A;  2AQ3 B;  2D62 A;  4DU9 A;  2K5D A;  1PRT D;  3MA2 B;  1G29 1;  1U4R A;  4F87 A;  2EE1 A;  2FMC A;  3QB3 A;  2OT2 A;  1I4G A;  4CGY B;  4JK1 C;  3BVM A;  4DN4 M;  1CZG A;  1K83 B;  3EJI A;  5M5X B;  1S5B D;  1JCK B;  4R8N A;  1F77 A;  1PRT F;  4Z9C B;  4NW2 A;  1EY9 A;  4KY6 A;  1I4X A;  4P2C B;  1JC7 A;  3HGB A;  5EBC A;  1DOK A;  1X32 A;  4U67 3;  2HDM A;  3MXN A;  2A6E D;  1BF4 A;  3FEW X;  3FKI B;  5M9O A;  2EOT A;  3NTI A;  3RUZ A;  2TSS A;  2MPM A;  2RSO A;  5JPN C;  5I4D A;  3SXH A;  1EYC A;  1S5D D;  5JEA G;  2A6H D;  4IFD J;  1Y8P B;  5C4Z A;  3PUV A;  1LAC A;  2MHV A;  4LAA A;  1SYG A;  2EYH A;  5KYL A;  1GUS A;  1HQM C;  1OXT A;  4EQP A;  1KLG D;  4RWS C;  2Q8T A;  1Y69 U;  3GTM B;  4R9W A;  4HN7 A;  1Q1E A;  4HCE A;  5TSS A;  3GTL B;  1GUO A;  4A3K B;  4C2M B;  2I46 A;  3D6C A;  1SYC A;  2CVR A;  1AZQ A;  2H4O A;  2CHB D;  3VR3 A;  4XT3 B;  3IL8 A;  5ISR A;  4A3E B;  4ZKB B;  4ULL A;  3NSW A;  2L0C A;  3NPP A;  4XQN A;  1D5M C;  2I07 B;  4BWG B;  1W6K A;  2VUM B;  5CMD A;  4WFN 3;  4PMB A;  1FYC A;  4J1M A;  5BN4 A;  4L8J A;  1HPC A;  2ZXO A;  3CQZ B;  1E2Z A;  2XWJ B;  2BDN A;  2L9H A;  2LY7 A;  3PV0 A;  1AZP A;  4CBV A;  2X6G A;  2XN9 C;  1ET6 A;  1A6X A;  4JBW A;  1H9M A;  1IL8 A;  3M7N A;  5C0X H;  5J22 A;  1SMY D;  2WP8 J;  2VNU D;  1KTK A;  4HTH A;  3CRL C;  2PO4 A;  1V43 A;  4Q5V A;  5C4H A;  1Z6H A;  1D6E C;  1SNP A;  2QCP X;  1ZYR C;  1FNW A;  1RCV D;  2F0S A;  3H3V C;  4WRD A;  3GV3 A;  3TSS A;  5JVG 3;  5K36 H;  3GV6 A;  4FP5 D;  1RHP A;  4XIG S;  3V2T A;  1ENF A;  1WD1 A;  2B39 A;  3GTJ B;  5C4X B;  3BVG A;  4KI0 A;  2Z4H A;  3HOW B;  5CBA E;  2A69 C;  1EU3 A;  2A73 B;  4IUP A;  4FF4 A;  1CI3 M;  4AYB B;  2XIW A;  2E2D C;  4RGM A;  3QJY A;  4RGO S;  1EWH A;  2F0P A;  2SNM A;  2B2V C;  1TVX A;  4PV1 C;  1DJR D;  2F0I A;  1A3V A;  2QEJ C;  5KGU A;  1WVL A;  4DXF A;  3A8K E;  1F9Q A;  4O1N A;  3T16 A;  2OF1 A;  3KBG A;  1MD2 D;  5FLX L;  5DNF A;  1PZI D;  1ESR A;  2PW7 A;  1KLU D;  1LT4 D;  2VB2 X;  3I73 A;  1GUN A;  1H9R A;  3K5N A;  1ONL A;  4KD4 A;  4C3J G;  1TT2 A;  5I9P A;  2K1B A;  4FXD A;  3EVQ A;  4MHE A;  3SK5 A;  3CKI B;  4N9P A;  2JA8 B;  1FGB D;  4G4K A;  5FOB B;  4HED A;  3L7Z C;  3K59 A;  1STE A;  1ICW A;  2ZT9 C;  5D3I B;  2E76 C;  3I91 A;  3OPO A;  1CA6 A;  3BDO A;  1F2L A;  3MXG A;  1B3A A;  4DAY A;  3DWQ A;  3PMF A;  4A3D B;  2RKS A;  2NBF A;  4RHR A;  4K14 A;  1V8Q A;  1QWY A;  1PZK D;  1CQV A;  5NUC A;  4V19 0;  3S1N B;  4TSS A;  1C8C A;  1G8Z D;  2ZXP A;  4BS9 A;  1B4O A;  2HDL A;  3WOF A;  1HCZ A;  3D4D A;  1B2T A;  1S5E D;  2RA4 A;  1EZ8 A;  4IUV A;  2D5D A;  5CV6 A;  5CBE E;  4UAI A;  1SSO A;  1SEB D;  2KED A;  2O4X A;  1B50 A;  1KAA A;  3DHQ A;  5EKL A;  4CJ0 B;  3A56 A;  5C6A A;  2B2Y C;  4C3I B;  5KEE A;  4DAP A;  1EIG A;  3R93 A;  5A35 A;  2BE5 D;  2KUM A;  5BN5 A;  3PUW A;  1SYD A;  2DY7 A;  2IT1 A;  1STG A;  2C5C A;  1I50 B;  4IN3 A;  5FLX E;  2F0L A;  3ZYY X;  2L1B A;  3MHB A;  1EYA A;  2VXW A;  3MTS A;  1BDO A;  1H9J A;  3D6W A;  1WTV A;  1A15 A;  1QCB D;  2K6A A;  3QWN A;  5K5P A;  3FPU B;  2LKV A;  2SNS A;  2DNE A;  2J7Z A;  4FVM A;  1QJO A;  2H1E A;  1PMR A;  4F88 A;  4UDU C;  1HTP A;  1Q90 A;  3M7G A;  3MXU A;  3S14 B;  1KDA A;  2EDG A;  1YNN D;  4RCO A;  3K6O A;  1M4V A;  4RA8 A;  3MZ5 A;  1RF2 D;  3A8I E;  4DK0 A;  1JOK A;  2NVY B;  5AFW A;  2PZW A;  4CKC A;  2B63 B;  2K28 A;  5ELC A;  4I65 A;  3PUY A;  4OIJ A;  1WTQ A;  2WV6 D;  1U4L A;  2QF7 A;  3NBH A;  4G7Z C;  3BDC A;  2KOL A;  5I6W A;  1TQO A;  4FXG C;  5KYI A;  2FIN B;  2ICI A;  3TP7 A;  3C46 A;  2EYL A;  1QIL A;  1JOO A;  3J80 L;  2XRQ D;  3V96 A;  2N88 A;  2KCN A;  2EY6 A;  4KN7 C;  3PIO 3;  1FNU A;  1KNE A;  4ZK9 B;  3I72 A;  1ML0 D;  2BDO A;  1M8A A;  2K5Q A;  5LL6 S;  3EQL C;  2RSN A;  2EXZ A;  3DEP A;  4KKU A;  3Q23 A;  3BDL A;  2HQE A;  3BZD B;  1KDB A;  1ESF A;  3FVQ A;  1SAP A;  2BA0 A;  3P7J A;  3OOC A;  1II3 A;  5E4X A;  1CZW A;  1FR3 A;  2EYP A;  2K5W A;  2K05 A;  2CW0 C;  4XTC S;  1J8I A;  4MIU A;  5ELF A;  1GXD C;  2F0M A;  3S9W A;  5JPM C;  4LMQ D;  1SE3 A;  3I3C A;  3F2U A;  2B2W C;  1TS3 A;  1VDZ A;  2BCO A;  1EQV A;  3P20 A;  1BCP D;  1TY2 A;  2WKC A;  3G7L A;  3R3O A;  2A68 C;  1O7Z A;  1GHJ A;  3QG1 A;  3GO5 A;  1YNJ D;  3QIA A;  4OHJ A;  4OO1 H;  2XSC A;  3HEJ A;  5C3X A;  5C4J B;  1PTO C;  4L6T B;  4OIK A;  5JEA J;  3C3L A;  2EZV A;  3PO3 B;  1F2Y A;  2F0D A;  3SR1 A;  1U9R A;  5C5M A;  1LTA D;  2G9H D;  1SE2 A;  5E1F A;  3J7Y W;  2NN6 H;  3NWS A;  3J80 E;  1IW7 C;  2JYO A;  2JEA I;  1GOZ A;  2NTT A;  3X3M A;  2FMM A;  1L0Y B;  1DOM A;  3S15 B;  1RJT A;  1DCZ A;  5FK9 C;  5CGK A;  3IKJ A;  2R6G A;  4XQJ A;  1LTB D;  1A3T A;  3A54 A;  4ZLT F;  1EEI D;  5BN3 A;  2CQA A;  2PNR C;  5COY A;  4A93 B;  5C0X G;  1BQQ T;  3GTP B;  1G6Z A;  1I6V C;  4PMC A;  2EYM A;  1I3Q B;  3A8J E;  3W3A A;  4HSV A;  5M5W B;  2HCC A;  3TME A;  3U9O A;  2G9D A;  2EVB A;  4K2K A;  4K8I A;  1GHK A;  4X3K A;  5K36 G;  2PCF B;  4KY7 A;  1DZ1 A;  2V4D A;  5DM6 3;  3BS1 A;  1JIC A;  1X3P A;  4NMZ A;  4DA2 A;  1PDQ A;  1Y8O B;  3HOY B;  1I4P A;  1F9S A;  4ME5 A;  4V0B A;  1GJX A;  4QCL A;  1SNC A;  3RZO B;  4B9X A;  4DK1 A;  2NUC A;  3CU7 A;  3I8Z A;  4RKB A;  1U4M A;  1GUW A;  3TZD A;  3SVM A;  3KLS A;  1Y1W B;  1ZYR D;  2XNA C;  3E5S A;  3K58 A;  1JE4 A;  1G2T A;  4X3T A;  5CV5 A;  3VYU A;  1D1I A;  2E74 C;  5ELD A;  3Q0A A;  2A69 D;  1CT1 D;  3I90 A;  4PQX A;  1H9S B;  3MWY W;  3GP7 A;  5G3L D;  5E4W C;  5I2Y A;  3H0G B;  2K7V A;  2NWG A;  1IHZ A;  3PUX A;  3HG9 A;  1R4P B;  2F4I A;  2XWB B;  5IGD A;  3DWP A;  3ERO A;  4LJZ C;  5CV9 A;  4IUT A;  1I4R A;  3J7A V;  2B2T A;  2Q8R E;  2PQE A;  3NXW A;  1STB A;  1SE4 A;  1SJE D;  5G3L F;  5I9O A;  1DOL A;  2WB1 B;  2IJ0 A;  3TDQ A;  1GUT A;  1STA A;  1SDF A;  2D9U A;  3DM1 A;  5DM7 3;  2A6H C;  1LT6 D;  1OXU A;  3HP3 A;  5D65 A;  3H94 A;  4PMW A;  3OIP A;  3A7A B;  4H13 C;  5C0X I;  2JEB I;  2A5H A;  2TMP A;  4A3F B;  3MEH A;  5KIX A;  2RBM A;  1JQY D;  4DFA A;  5I6Y A;  4A3M B;  2Z4I A;  4XT1 B;  3NK9 A;  4HR7 B;  2R7Z B;  5CYU A;  3TP8 A;  3Q24 A;  1F9R A;  4YIJ A;  3CRK C;  3S1R B;  4N9T A;  3AMU A;  3L9A X;  4K6L A;  1RDP D;  3LX0 A;  2F0G A;  4O42 A;  5JOB A;  1AW7 A;  4ZAI A;  5IIF A;  4KMU C;  2AWO A;  1EY0 A;  4DGZ A;  2F0T A;  1ET9 A;  4C3H B;  5M5Y B;  1WTO A;  1QG7 A;  1DM0 B;  1V1P B;  3HZX A;  4M1U B;  1TWH B;  2FJ2 A;  3X3N A;  5CV7 A;  2X69 A;  2B8G A;  1BO0 A;  1A3U A;  3KF8 A;  2F0J A;  3AB9 A;  1C4Q A;  4CHT B;  2EJG C;  1SMY C;  4KN4 C;  1XXG A;  1I4Q A;  1AFP A;  4ILW A;  1JOR A;  2WAQ B;  2JSO A;  4FXK C;  2IWH A;  3NUC A;  2F0N A;  1EL0 A;  4C3I G;  5C44 B;  1ZEQ X;  1QNU A;  4IFD H;  2F0H A;  2AUK A;  4NKL A;  2AWN A;  1PTO B;  1SFO B;  1E0B A;  3K57 A;  1E2W A;  3E0J A;  4C1N I;  3HS0 C;  3M85 A;  3LNN A;  3NTK A;  5JJZ A;  3S16 B;  3WDN A;  3NHH A;  1KDC A;  5F2D A;  3MAQ A;  1O78 A;  2E2H B;  2OEO A;  1OXS C;  3LWU A;  3TBI B;  2LS0 1;  3H09 A;  5EPL A;  4TRD A;  1MSH A;  3D4R A;  1UEA B;  1DYQ A;  1SBB B;  5FKA C;  5CV4 A;  3HOX B;  3R2T A;  2L55 A;  2EJM A;  3P1H A;  3ONA B;  2EYJ A;  1G2S A;  3A55 A;  3URY A;  1FNV A;  4EQN A;  1G91 A;  1PFM A;  5DEH A;  5E3F A;  1CK1 A;  4HCS A;  1BR9 A;  1VF5 C;  2SEB D;  1Q8I A;  1VMP A;  4OO1 G;  2F3W A;  2FFK B;  3Q6S A;  2HCI A;  2JXM B;  3N6R A;  3T13 A;  1Q3L A;  4I7Z C;  5KRU A;  1RTN A;  3S2D B;  2DNC A;  5EKK A;  2Z1C A;  4RGN A;  4IUR A;  1EFI D;  2O5I C;  3KK7 A;  5COR A;  3BVZ A;  1PTO H;  3AU7 A;  5HUR A;  2NN6 G;  1CHP D;  2RDF A;  1I6H B;  3I70 A;  3QOJ A;  4LK1 C;  2E2J B;  1SYE A;  3OSO A;  2RVL A;  4C1N K;  2ENB A;  4F7X A;  5C5L A;  4OL7 A;  4A3I B;  4FF3 A;  3VYT A;  1TII D;  3DWA A;  2L4N A;  2NTS A;  3SDZ A;  1NSN S;  2WAC A;  1TWF B;  2F0Q A;  3EA6 A;  2Q8I B;  1QE6 A;  3KBX A;  2AQ1 B;  1Z7T A;  1KNA A;  1TU2 B;  2BE5 C;  3HRZ C;  4DNR B;  2WIN B;  3PIP 3;  3H91 A;  2VB3 X;  2BOS A;  2KQ3 A;  3BYY B;  1ILP A;  2IX0 A;  1HXY D;  4HMI A;  2PZU A;  3GTQ B;  5ELE A;  5JVH 3;  5IOD A;  3VA5 A;  1PTO F;  4FNF A;  3TZU A;  5T1I A;  1IW7 D;  2GA4 B;  4ZUJ A;  3K5L A;  2FHT A;  1LAB A;  3NTH A;  4IUN A;  2NB0 A;  2PYK A;  3RMH A;  5M3F B;  3Q22 A;  4TKO B;  2MP1 A;  1JOQ A;  3KLR A;  2K33 A;  3UI2 A;  2F0U A;  2K01 A;  2R3Z A;  4CJ1 B;  2OXP A;  4DF7 A;  4XDX A;  1OO9 B;  4K6D A;  2EY2 A;  2F0V A;  1HFN A;  2DN8 A;  2B2V A;  1UAP A;  2L12 A;  3O13 A;  3VYR A;  3LWE A;  1XTC D;  1EY7 A;  2MJ8 A;  5IGG A;  5C0X J;  3H6M A;  1OXX K;  2KHS A;  4H0L C;  2KEE A;  4H44 C;  1Q12 A;  1BNZ A;  4M8A A;  1B9M A;  4J6H A;  4OO1 I;  2ICE C;  5C3W A;  2DY8 A;  2Y0S B;  4L63 B;  1CTM A;  1Q1B A;  3DUZ A;  1VMC A;  2F03 A;  1EY4 A;  1GUG A;  3VYS A;  4WJW A;  1EIH A;  1ENA A;  3ERQ A;  1LTI D;  4A3B B;  2WKD A;  1WTP A;  2O5J C;  3MFY A;  3NQI A;  1AP0 A;  4KKS A;  1EZ6 A;  5FO8 B;  1O80 A;  2B8F A;  2NN6 I;  3NWT A;  2R61 A;  4K5W A;  1LO5 D;  1FD7 D;  1LV9 A;  2F0K A;  4C56 C;  1TY0 A;  2L11 A;  1U4P A;  4IQZ A;  2AUJ D;  4KY5 A;  1NR4 A;  2A74 C;  2J0T D;  5IOC A;  4KK7 A;  1RKN A;  3TN2 A;  1IKM A;  4DXG A;  4ABN A;  1J9O A;  2PW5 A;  1UNS A;  5EKI A;  3OHX C;  1ENC A;  1DXM A;  1LTG D;  1T5X D;  3S17 B;  2Z8L A;  4IUU A;  1JWM D;  1CFM A;  1S4Z A;  4ID6 A;  4HAE A;  4ZUI A;  1AEX A;  1ILQ A;  4J8Q A;  3RD4 A;  3T4A C;  1PYW D;  4EVO A;  3PO2 B;  1BXT A;  3TP5 A;  2EY1 A;  2B2Y A;  1O7Y A;  1LTR D;  1Y1V B;  4E6I A;  2XVS A;  5HGT A;  1BCP C;  1PFN A;  2HUG A;  1H9S A;  1CM9 A;  1JWS D;  1YNJ C;  4Y7N B;  3JAM L;  2PPB C;  3FRP B;  5IGE A;  5EQ0 A;  4ZRZ A;  4XYO A;  1BBX C;  4QUF A;  1DON A;  1I4H A;  5D3D A;  4FYD A;  3D31 A;  3SK4 A;  3ND8 A;  2IPK D;  4RHS A;  3GTK B;  3VR2 A;  1LTT D;  5T1G A;  4CKB A;  2RDG A;  3DEO A;  1C48 A;  5DAU A;  4BBR B;  3MXP A;  1SYF A;  5CC4 A;  1SNO A;  2M2L A;  3T56 B;  3IAY A;  2IX3 A;  4XYQ A;  1EY5 A;  1D5Z C;  1EY6 A;  1PRT C;  4Q0F A;  4KHZ A;  1CHQ D;  1WCM B;  3I4L A;  4KV6 A;  3DXJ C;  2EYF A;  4G7O C;  5CV8 A;  2F1M A;  2R92 B;  3NQT A;  2E75 C;  4ZKC B;  4IZ8 A;  2QDB A;  2F0O A;  4B9W A;  1MI2 A;  1V1O A;  4G7H C;  4FF2 A;  1PFB A;  2ZXR A;  2A6E C;  2IL8 A;  5CR3 A;  1B1Z A;  2NVT B;  3K7A B;  2RQX A;  1QNK A;  1VF7 A;  5IT9 L;  1AN8 A;  5EPK A;  3SHL A;  4BBS B;  3GTO B;  3K5M A;  4DNT B;  3DMU A;  4XXE A;  1TKW B;  3C2P A;  4IFD G;  1STH A;  4XQQ A;  1W6J A;  1MSG A;  2EYO A;  3OW7 A;  3JAM E;  3C1E A;  3W2D A;  1D1K A;  4WOR A;  3IFT A;  4BY1 B;  4KD3 A;  1V1P A;  4KJO A;  4R8I A;  4CJ2 C;  2KVM A;  3M3Y B;  3ND9 A;  2F0W A;  1STY A;  5C3E B;  1BUV T;  5KNB A;  1NR2 A;  3FPP A;  4RFB A;  1HA6 A;  2BA1 A;  4C3H G;  5JEA H;  4B08 A;  1B44 D;  2B2W A;  3S1Q B;  2KJX A;  2WII B;  2J4X A;  4DAV A;  1XX8 A;  2MUY A;  1HHV A;  2C9O A;  1PLF A;  4HMJ A;  4ZQ3 A;  4K2L A;  3S1M B;  1JR0 D;  2KA7 A;  2EJF C;  1IKL A;  4KJN A;  3BG3 A;  1HQR D;  2K32 A;  1EYD A;  4TQU S;  1S5C D;  3MC0 B;  5M3M B;  2ID0 A;  1HTL D;  1NAP A;  1OXV A;  3T51 B;  2B2U C;  2EPB A;  1L0X B;  3WOE A;  3J7A F;  3K5O A;  3TP6 A;  4RKL A;  1XYI A;  2E2I B;  3S2H B;  1A2U A;  4ZYS A;  3FDT A;  3G6J B;  5IT9 E;  2KCC A;  3I4N B;  1TS4 A;  1R9T B;  3GQB A;  3OWF A;  3VR5 A;  5IGC A;  1SND A;  5A2Q L;  4KHV A;  2L5T A;  3SK6 A;  2M00 A;  4U68 A;  2QIL A;  1LT5 D;  1EQT A;  2JP1 A;  3K0Y A;  4OGQ C;  5IGF A;  4NP5 A;  2F0F A;  1SNM A;  3IFD A;  1CQF A;  1TS5 A;  1NCV A;  5LHY 1;  4C3J B;  2EY5 A;  1TWG B;  4IFD I;  1R4Q B;  1ROD A;  5FO7 B;  1NUC A;  3KUP A;  2K03 A;  3PUZ A;  2JA5 B;  5KNC A;  2LFN A;  3EFX D;  3U9S A;  2SDF A;  3R8B A;  3SEB A;  2KEC A;  2N55 A;  1LT3 D;  3V05 A;  4K8J A;  3SE0 A;  2IW3 A;  3D8G A;  4RGT A;  1D5X C;  1EU4 A;  2AQ2 B;  4HSP A;  1IYU A;  2NZ1 D;  3RZD B;  1E2V A;  5IGB A;  1STN A;  1JB3 A;  1F2Z A;  4X3U A;  1EEF D;  5J39 A;  1B9N A;  4K5V A;  4BA2 I;  1HUM A;  3QO2 A;  4A3J B;  3A7L A;  1X3Q A;  1SJH D;  5ELB A;  1SYB A;  3D4W A;  2M9V A;  4QUC A;  4EGV A;  5JAV A;  4KTA A;  4GZY C;  4IAL A;  5EGT A;  1K8M A;  2QKI C;  1ZKO A;  5EPJ A;  1BCP B;  3J81 L;  1BOS A;  1EOT A;  2RDH A;  3HOU B;  3NBI A;  1B53 A;  1MBY A;  2CW0 D;  4CKE A;  5A2Q E;  2X6L A;  3CHB D;  4KKT A;  4NDX A;  3ITP A;  4FO2 A;  1SNQ A;  3I4M B;  1WD0 A;  1F9P A;  3C1F A;  1HFG A;  1WTR A;  2MGS A;  4QB4 A;  5FO9 B;  2YU9 B;  4ODG A;  1RD9 D;  1TR5 A;  3M4O B;  2A68 D;  2LMC B;  5EJW A;  4F8M A;  2R93 B;  3M4Y A;  3RLF A;  4H7B A;  3QOL A;  4G57 A;  3VR6 A;  3HOZ B;  1PRT B;  1PTO D;  4BY7 B;  1VCI A;  4BA1 I;  4RCN A;  1S5F D;  2B2T C;  3KLS X;  2NYZ D;  1SXT A;  4QIW B;  3VA7 A;  1QB5 D;  1T5E A;  5EBD A;  5KND A;  1XWE A;  5I2X A;  2PZT A;  2JE6 I;  1KAB A;  1A2T A;  3N52 A;  1WTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...