2EYOA

Crystal structure of staphylococcal nuclease mutant t120s
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNSHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyoA00
1EY5A 4NP5A 3D6CA 3E5SA 4HTHA 2F0KA 4KJNA 2RDFA 5CC4A 1SNCA 4KV6A 4QB4A 1SNPA 2PW5A 4J6HA 3SHLA 3NK9A 2EY1A 2F0HA 2F0UA 2F3WA 5CV5A 3NP8A 5EGTA 2RBMA 5C5LA 1F2MA 2ENBA 1EYAA 2EY2A 4KD3A 3T13A 4RKLA 5KGUA 5J39A 4K2LA 2F0JA 4KD4A 4WORA 3U9OA 5IGBA 4NMZA 5NUCA 5KYLA 3RUZA 1JOOA 2EYOA 1SYBA 4K6DA 1ENCA 4RKBA 1EY6A 1RKNA 3MHBA 2PZWA 3MEHA 4KY6A 1STYA 2PYKA 3BDCA 4TRDA 5CV6A 5J22A 3DMUA 2EXZA 3D4DA 3OMGA 5HGTA 4E6IA 3ITPA 4HMJA 4DFAA 2OXPA 4DF7A 1SYGA 5I9OA 1A3VA 3BDLA 5IGFA 4KTAA 5I6WA 1U9RA 3T16A 2F0WA 4G57A 5IGCA 3NXWA 2HQEA 1SYEA 4NKLA 4EQNA 3SK8A 2OF1A 4ODGA 1TT2A 4HMIA 4R8NA 1EQVA 1STHA 2SNSA 4ZQ3A 3TP7A 1TR5A 2EYHA 4K14A 2F0SA 1F2ZA 4K5WA 4KJOA 2NUCA 5DEHA 4OL7A 3MVVA 2RKSA 4K8IA 3NUCA 5I6YA 3QB3A 1JOQA 1EYCA 2EYMA 3R3OA 1AEXA 2PZTA 1KDCA 4IZ8A 5CR3A 1ENAA 2M00A 4KY7A 2EYFA 3P1HA 2F0FA 3SK6A 5JOBA 3HEJA 1SNQA 1SNMA 4KHVA 1STBA 5IIFA 2F0TA 5E1FA 5C5MA 4K5VA 1F2YA 2PW7A 5DAUA 5C6AA 3SR1A 1JOKA 5IODA 2F0EA 4PMCA 2F3VA 2WACA 3HZXA 1JORA 1A3TA 1KAAA 2PZUA 1EYDA 1EY0A 1TQOA 3P75A 1STNA 1EY9A 4ID6A 4LAAA 1STGA 2O4XA 5IGDA 5IOCA 5M9OA 3SXHA 3MXPA 4KY5A 5C4HA 2F0PA 3MZ5A 3QOJA 1SYCA 4N9PA 5HURA 1SYFA 3PMFA 1NSNS 4QF4A 1EZ6A 5CV7A 2SNMA 4IUNA 4IALA 3DHQA 2EYPA 4K2KA 4EQPA 4F7XA 3TP8A 2F0GA 3EJIA 5K5PA 5KRUA 2OEOA 3S9WA 3OMCA 2KQ3A 4QMGA 4N9TA 1II3A 2F0VA 2SOBA 4S3SA 1A2TA 1EZ8A 1A3UA 3VA5A 4K8JA 1SNOA 1EY8A 1EY4A 4PNYA 4YIJA 2EYJA 1A2UA 2F0QA 3D4WA 4K5XA 3SK4A 2F0OA 4PMBA 4H7BA 4I65A 4WRDA 5CV4A 1SNDA 2F0LA 4ME5A 3TP6A 2F0DA 4DGZA 2F0IA 3OSOA 5I9PA 2F0MA 3EROA 3EVQA 4NDXA 5KEEA 4MIUA 2KHSA 5CV9A 2EYLA 5F2DA 4EVOA 5IGEA 3QOLA 5EKLA 1IHZA 3SK5A 2EY5A 4EQOA 3H6MA 3NQTA 4B9XA 3NHHA 3D8GA 1SYDA 4J1MA 5ISRA 2EY6A 5KYIA 5C3WA 4ZUJA 5CV8A 4F8MA 2QDBA 5J1ZA 3LX0A 4ZUIA 2F0NA 1KDAA 2LKVA 4DU9A 5IGGA 1EY7A 5CGKA 5C3XA 3V2TA 1KDBA 3C1EA 2PQEA 3C1FA 3OWFA 5EKKA 5JAVA 3TP5A 5E3FA 5KIXA 1NUCA 5C4ZA 4B9WA 3ERQA 1STAA 3TMEA 1KABA
chains in the Genus database with same CATH superfamily
4NP5A 3JAMi 1B44D 1S5FD 2XWJB 4HSPA 1MSHA 4A3EH 1GUNA 1CFMA 5LHY1 1BF4A 5ELOA 1SJED 3GQBA 1LTAD 3NK9A 5EGTA 2G9DA 3M4OH 4K6LA 1AH9A 1H9SB 2BE5C 5C5LA 2UUBL 4OELB 4NXMQ 2WKCA 5EPLA 3S16B 1VF7A 4YWMA 1SMXA 1A63A 3M4YA 2R3ZA 4C3IG 2PZWA 4JPBW 4JOIC 2QW7A 2A69D 1RTOA 2DGYA 1LV9A 1VMCA 1F77A 4HR7B 1GOZA 3UE0A 4DNTB 4JV5Q 4LF7L 1TS2A 4NXML 1I3QB 2NTTA 4DV3Q 1OXTA 2E74C 2AHOB 2SNSA 3I2ZA 4L5QA 1IW7C 1DYQA 4V190 1VQAA 1AEXA 4UPAA 2KBNA 2CWPA 2AWOA 3IFDA 1GUTA 1IZ6A 1CSPA 3DLLA 5C0XH 2GVBA 3AFQA 2Q8RE 1QUQA 1CTMA 3M7GA 4LF7Q 1QZGA 1HNWL 1RJTA 2RDHA 4HJ8A 1H9MA 2Z4HA 2V4DA 2CFMA 4G7HC 2BE5D 5EKIA 3HOXG 2B63G 2MNAA 1AE3A 4CJ1B 3CCEA 1GUSA 1DCZA 1WTXA 4CDCC 1Q46A 1KNAA 1SNDA 4ME5A 2KEDA 1D1KA 4DGZA 5DNFA 2F0MA 2KHSA 5CV9A 5IGEA 4GZYC 1PTOC 1C8CA 3HOZB 4PQXA 4BBSG 4DV1L 1R4QB 5IP7G 2K04A 4JI2L 2AUJD 5CV8A 1LT4D 3UE1A 1HXYD 1O7ZA 1KDAA 1RL2A 3RZDH 4A3BH 4P71A 3TP5A 5E3FA 4HCSA 1LT5D 1GUOA 4DN4M 2R6GA 1KABA 4L6TB 2B29A 4HTHA 4RGOS 2KJXA 3HP3A 4KV6A 1YNNC 1IBKQ 4OO1H 5C0XG 2WB1B 1KTKA 4KLKA 2F0UA 4X62Q 1KXLA 2VXWA 1DM0B 4J15A 5GAHC 3S15B 1JOOA 3Q24A 1HA6A 2MQHA 1IKLA 3L2PA 4DR3L 1MD2D 5HGTA 3SGIA 4KI0A 2KCTA 5A2QL 5IP9G 1MGSA 3BDLA 1BBXC 1WTWA 4A3JB 5M3MH 2OF1A 5KNDA 4LWCA 4ZQ3A 4A4IA 5IT9c 3E9IA 3MXNA 2UXDL 1RCVD 2UUBQ 4OL7A 2R61A 3MVVA 3K6OA 1SDFA 1RDPD 4BA1I 4FP5D 3R8BA 4XQNA 4IFDG 3F1ZA 2K1BA 1STBA 2IHFA 2L9HA 2TMPA 2PW7A 2YU9H 1O7IA 2PQAA 4BS9A 2PMZE 2X6GA 4GNXC 3I4MG 1K3BC 2UXCQ 4X3UA 4DR6L 1PA6A 5G3LF 1EIYB 3NWTA 3U9SA 1JJGA 2KHIA 2XWBB 1YJ9A 1Y8PB 5IWAQ 2J4XA 2B2VA 2D62A 1ZXTA 4UDUC 4HIMA 3DXJC 4UHVA 1HZ9A 2ZM6Q 1H9KA 5IYBG 3V96A 2KVMA 3A7AB 4AQYQ 3KFUA 4Y7NH 3D4RA 4OEMB 5F2DA 2EYLA 5CBEE 2NYZD 4JI0L 3KLSX 2K05A 2K32A 2H5XA 5FLXc 4Q5VA 5ISRA 4POGA 4IFDJ 5JEAG 5JAVA 1NR2A 2YTXA 4A3MG 3GTKH 1HRJA 3KF8B 4AQYL 2RQXA 3KOJA 3DEPA 4L5RC 4FF1A 3PIPA 3H0GH 3C2PA 1PYBA 1SNCA 2ICEC 4B08A 4DV3L 1QNKA 4RHRA 3HOZG 2DY7A 2CVRA 2CH4W 2F1MA 2KOLA 1N34Q 3S17H 5E4WC 4LMQD 2E75C 4DR1L 3M4PA 5I2XA 1PRTB 3BDCA 4TRDA 4DR2L 1TWFH 3H15A 5J22A 2XGTA 5LL6X 1N36Q 2CH4A 5JVG3 1WCMB 2OCEA 2B63B 3M7NA 3R2IA 1A3VA 2NVTH 2AWNA 4DV2Q 1Q8IA 1K8OA 5LMNL 1GUWA 1L1OC 2HDMA 1WTPA 3G6EA 1KD1C 2KUMA 1JE4A 4AYBE 5JEAJ 1X6OA 5IYCH 2F0SA 2GVAA 1UE6A 3L3OC 2NZ1D 2SEBD 1BBWA 5M5YB 1E1OA 4KKTA 4K0KQ 1BR9A 2R93H 3OW2A 3GP7A 4QIWB 3PO2G 1GM5A 1SNMA 4UP8A 4YWKA 3F2CA 3CCJA 1YNJD 1LUZA 2LXKA 3BG3A 1KHIA 1ZYRD 4CHTB 1B50A 3ER0A 4OIKA 1A3TA 2NVTB 1EYDA 4LAAA 2EZVA 1AZQA 2FHTA 2F0PA 2DUDA 4HJ5A 1XPUA 4DR5Q 4HEDA 4IUNA 2Z4IA 3GTQB 1S5ED 2SOBA 5A2QE 1CI3M 4X64L 4JI4Q 1D5XC 1K9MC 1TKWB 4GOPC 1OXUA 4GOPA 2F0OA 4PMBA 2Z1CA 3FEWX 5CV4A 4C3JH 4PMWA 1LTBD 1IBKL 5I9PA 3EROA 3W3AA 5M3MG 5FK9C 4GN3B 1CKOA 1XNRQ 4X62L 2N78A 3OIPA 3S16H 4BBSB 3SK5A 4LF4Q 2EY5A 2R7FA 3TRZA 5EAYA 3LX0A 2K6AA 2OQKA 3K0YA 4ZUIA 4LF9Q 3C1EA 1LTGD 2A74C 1PFMA 5COYA 5EPKA 4QGUA 4QQBX 3MXNB 5C0XI 1VQNA 1X3FA 3W1GA 2R92H 2AQ1B 2NZHA 3FPUB 3S1QH 2J0TD 5BR8L 5D3DA 3RNUA 4LFAQ 1VDZA 3HOXB 1QOHA 3S17B 3J7AF 3HOZH 1I6HH 2O2LD 3UI2A 1F9PA 2IX1A 2OTJA 3DEOA 1LT6D 4DPGA 3K8AA 2UXBQ 3S1NB 4K2LA 5GROA 4BY7B 2PYKA 3AYHB 5CV6A 3RD4A 3WWVA 2ATWA 2P5ZX 2JA7B 3I56A 1OXSC 2QEJC 1X56A 3BZCA 4FO2A 2NWGA 4ZKBB 3TN2A 4G57A 4DR6Q 3R93A 5JJZA 4GN5A 3Q6SA 4ODGA 4GKJL 4HMIA 2A5HA 3A5ZB 4IUUA 2EYHA 2WAQB 3V05A 3M4QA 1VQHA 2Z6KA 1BVSA 2NUCA 3CXCA 1DJRD 2UUCL 2RKSA 5ELBA 4WJWA 3R2TA 1IBLQ 3KUPA 4DAMA 3SK6A 2B2UC 3U4VA 1N36L 1HR0Q 3G48A 4X3TA 4C3IB 3J80L 1TIID 2E2IH 3K0XA 5IODA 1Q81C 3U4ZA 2CCZA 4JI0Q 1VQ8A 4JI6L 3K5MA 1A15A 4CDFC 5IGDA 1STGA 4U68A 5C4HA 1YHQA 4Y7NB 1PHJA 3PUZA 1NBWA 3UDXA 2AQ3B 2EYPA 3TP8A 2F03A 1PDQA 2K75A 4ZYSA 2EXDA 4PNYA 1HR0L 1EIGA 1Q12A 2EYJA 4K5XA 5JJIA 1SMYC 3K80C 3J81L 1QVFA 1E1TA 4NB3A 2BH8A 3OSOA 4NDXA 4PZ7A 4FF4A 1VQMA 1QJOA 3L7ZC 2K33A 2A6ED 1I50B 1PRTC 5JEAH 1PFSA 1Q82C 4JCVE 2JQOA 1D5ZC 1OXXK 2KA7A 4EX5A 1EQTA 3K58A 1SROA 5DM63 4JC0A 5HGQA 1NMGA 3LNNA 2R92G 4DV5L 4DR3Q 4JI4L 3GV3A 2B2UA 4TKOB 2ZTCA 2A73B 3SE0A 4QB4A 2B2WA 2L55A 2B63H 1CHPD 1XWEA 4YCVA 4A3FG 4DR7Q 2ZTEA 4KD3A 2A8VA 1AP0A 4UY8C 3M3YB 1TWFB 2WB1E 4WORA 2MP1A 4NMZA 2B8FA 3FMCA 3MHBA 4DV5Q 4LF8Q 2VB2X 3J81c 5AFWA 1HFGA 4A3LG 1XNQQ 1FJGL 4HMJA 1VQ6A 4BA2I 1BDOA 5FO8B 1Y1VG 1UE5A 2A6HD 3SK8A 1QE6A 4B3RL 3NTHA 3OWEB 1TY2A 1TR5A 4K14A 4CJ0B 1X32A 4K5WA 5M5XB 1XMOL 2UXBL 3PO2H 1JOQA 1GJXA 4DV6L 1H9RA 4IJHA 1ENAA 1XTCD 2M00A 1X55A 4KHPQ 4RG1A 1E2ZA 4DA2A 1SNQA 5IIFA 2F0TA 1PH9A 1WYDA 4MTNA 3JAML 2JA5B 1NCVA 1KAAA 3PO3B 3C46A 3NELA 3OIQA 2IJ0A 2O4XA 1RTNA 2JA6B 1IBML 5T1IA 1C9OA 4EQPA 1PTOD 4PZ6A 2EPBA 1KLUD 1QNUA 3S9WA 2HCCA 3OMCA 1L0XB 2E2IB 3AQQA 4KHPL 4QL5A 2K01A 1DOLA 4LFAL 1Q1EA 4V0BA 4IO9A 4P74A 4OHJA 3EVQA 3I4NH 5FJ8H 4QUFA 4A3EB 1SMYD 2Q2UA 4JI6Q 3CF5A 3CC2A 3A74A 1O7YA 1F9SA 1BCPD 3T1YQ 3EN2A 1KC8C 2RHQB 3I4NB 3VDYA 2VQEL 1PV4A 1XJVA 1W6JA 2VS1A 4OWXB 1PZKD 3ERQA 4KHZA 2BA0A 3I4MH 2NVXB 4DUYQ 2DJFC 3TZUA 4JVZA 1SNPA 3K7UC 3QG1A 4RMFA 5LMNQ 3GTGB 2EY2A 2ENBA 1WD1A 2UU9Q 1KAWA 1SN8A 2A68C 3A5UA 1G291 4P75A 1K8GA 4CDEC 5C3EG 3HRZC 4KY6A 4MHEA 1NMFA 1Y1WH 3S1MH 5C4JB 4QCLA 4JBMA 2WAQG 1R9TH 5GAEC 3UDFA 1QVCA 1I5FA 1AE2A 1PMRA 1HNXL 2WV6D 4KTAA 5I6WA 1T5EA 1Q7YC 1EWIA 3CD6A 4ILWA 3J7A5 2G5DA 1VQ9A 4B3ML 4IN3A 1SFOB 1KNEA 1SR3A 1K8AC 2Y0SG 3HKZE 2EQSA 4RWSC 1NAPA 1Y1VB 5DEHA 5IYCG 2B2VC 2IWHA 4HAEA 4BY7G 3MWYW 2D0PA 4C3JB 4KY7A 1VQDA 1B1ZA 3MAQA 1Q8KA 1EIFA 1ML0D 1CUKA 3VYSA 4R8IA 1V1PB 1EFID 1JICA 3FKIG 2I5MX 4JI8Q 1ICWA 2L11A 5IOCA 3MTSA 4UP9A 1IXRA 3CCRA 3S2HB 3QOJA 1PH4A 3K57A 4XDXA 1V1PA 1TWHH 2MUYA 4R1JA 4I7ZC 2OEOA 4N8FA 1NJIC 2ES2A 2BCOA 1LYLA 4LF9L 4S3SA 3HOUH 3GTPB 2MO0A 3D4WA 1DZ1A 4A3IH 2JXMB 4P2CB 3CKIB 3ERSX 1HNZQ 3HOYB 3W1BA 2VB3X 2AKWB 2HT1A 3H3VH 1VS0A 1IHZA 4RCOA 2UXDQ 1EL0A 1ASZA 3NQTA 1I94Q 2Q8TA 4HIOA 3H94A 5IY0A 1CZGA 3STBC 1EY7A 1Z47A 5C3XA 1ET6A 1L1OA 2EE1A 3OWFA 4BY7H 1TWHB 4L5TA 5M5WH 4DK3C 3TQYA 1ZYRC 3B6YA 1VQPA 1HNZL 4XQQA 1MI2A 2ZJRA 4FVMA 3RZOB 1VQKA 5LMUL 1YNJC 1SXTA 4ULLA 1ENFA 3OW7A 3NWSA 3KLWA 4GKJQ 3HOXH 3U58A 4BY1B 1C0AA 4FXGC 5IGBA 2EYOA 4K6DA 3S1QB 4QJFA 3TEHB 3VR6A 3D4DA 1Y1VH 1VCIA 1A6XA 2PMZB 1U9RA 1L0YB 3HOUG 4BBSH 4JV5L 1WTHA 1PFNA 2SDFA 4NKLA 2KCCA 4B3TQ 1EWHA 1I4RA 1EQVA 1F2ZA 2C5CA 1N8RC 5I6YA 1TWGB 1BXTA 3CU7A 1S5BD 4G7OC 4IURA 2ZXOA 3D0FA 4MTKA 3S15H 3BJUA 3OPOA 1ESFA 3C3LA 1QB5D 5C44H 1H9JA 5LL6S 4JYAQ 4B3TL 1JWUD 1VQGA 3SDZA 3ONAB 3J7YW 1EY9A 2NN6H 4KKUA 1ET9A 3TBIB 4FDBA 3J81i 3GTOB 4M1UB 2I07B 1I4HA 1J5EQ 5FLXE 3J80E 4DR2Q 1SE2A 2E2JB 4H13C 2K03A 2IL8A 2JA8B 4A3GG 1EEFD 3CQZB 3RZDB 3G6JB 4DAYB 1SE4A 1PTOB 2N8NA 5CBAE 3I4NG 3RN5A 4DAVA 2ICIA 3CPWA 2WKDA 1KIXA 1EQRA 2F0LA 5JVH3 2PQAB 3J81E 4DV7Q 4EVOA 5IYDH 3QOLA 1I4GA 1SE8A 3WOEA 4EQOA 3M85A 4J1MA 4A3JH 5KYIA 4ZUJA 4F8MA 4GNXA 2QDBA 3H09A 2VZAA 2VUMH 4A93B 1C48A 5ELFA 1KDBA 2PQEA 3K7AB 3F2DA 2NVYH 4LF8L 3Q23A 3KBXA 4JI3L 2F0KA 1BOSA 4XXEA 2PW5A 2LMCB 5GQOA 1S40A 3NP8A 3VYRA 2OTLA 1EYAA 1LTRD 2NN6G 5JJLA 1WJJA 1I94L 4LFCQ 1F2LA 3I4OA 4BBRB 1ENCA 4RKBA 2BDOA 1IYJB 5IYBH 3BS1A 4X65Q 3PO2B 3X3NA 1BQQT 1PVOA 2D9UA 2R7ZG 1JC7A 2L15A 1SYGA 4A3GH 3E9HA 3PIP3 5M3FB 3A55A 3VA7A 4GLVB 4JI8L 2O5IC 2F0WA 2FMCA 2KECA 1E7ZA 3ULJA 1G6PA 3NXWA 5ELEA 4A3DG 2WP8J 1OO9B 4XYOA 4LF4L 4R4TA 3PV0A 1TT2A 2Y0SB 1STHA 1MJEA 1HZBA 2EVBA 3MFYA 4BY1G 2KHJA 4A3MH 3X3MA 1PRTD 2HIVA 1IL8A 3PUYA 4OWWB 1EYCA 2NVYB 2OWOA 2L1BA 1KDCA 1B53A 2GN5A 1WCMH 1J8IA 2F0FA 4UP7A 4R4QA 3CC7A 4RA8A 1LM0A 1S3OA 4AH6A 4GNXB 3M4OB 3CCQA 2WACA 2NZOA 1V8QA 1QCBD 1STNA 1SBBB 3W2DA 2YU9B 4IPGA 3BU2A 2JN4A 3PSIA 3T56B 2NBFA 5M9OA 1PH2A 1I6HB 1SYFA 1TS4A 2SNMA 3KF6B 2R92B 2VL6A 4JBJA 1A3UA 3VA5A 4K8JA 2D0OA 4YIJA 2AUKA 2F0QA 3P20A 3CAMA 5LMUQ 1TS5A 5EPJA 4Y52H 4XQJA 4RFBA 1FNUA 3CP0A 3E0EA 3KJOA 4OWTB 1SYDA 3EQLC 4IQZA 4JI2Q 4JI7Q 4U673 2JA8G 4H0LC 2CWAA 4B3SQ 1SLJA 3J81j 1UE1A 1EQQA 2X6LA 2GA4B 1WTRA 1YZ6A 2X69A 1GXDC 3TS2A 2FXQA 1E22A 1WTOA 2CW0C 4O1NA 1DXMA 2F0HA 2E8GA 4A3EG 2NVXH 4HSVA 4YCUA 1LTSD 5FLXL 4ABNA 3U9OA 4DR1Q 1S4ZA 4XT1B 4A3LH 1JJCB 1ZKOA 1D7QA 3OHXC 1A8VA 3GTLH 1V1OA 3PF4A 5T1GA 4C56C 1TWGH 2NN6I 5I9OA 4CKBA 4DV2L 1DOMA 2L4NA 3EFXD 1MJCA 5IYDG 1I50H 1SYEA 2LY7A 4R4OA 3Q8DA 1LT3D 2M2LA 2F52A 3DM3A 3A8JE 2HIXA 3MXGA 3STBD 1YEZA 2E2HB 4JI1L 2AMCB 2LS01 3HOVH 5I2YA 1QZHA 1N32L 3BVMA 2EYFA 1YIJA 4CJ2C 5ELNA 1B3QA 2KCMA 1L0WA 1MSGA 3PCOB 2B2YA 4P73A 1EOVA 3NEMA 3S1MB 1G91A 1WI5A 5C6AA 1FGUA 1NE3A 4DAPA 2F3VA 2UUAL 1NNXA 2PZUA 3NE5B 1ILQA 4DUZL 1EY0A 1CSQA 4MZ9A 3HOYH 2UXCL 4IPCA 1L2FA 1K0RA 3S1RB 3PMFA 4RCNA 1RODA 2YYZA 3AFPA 1HJPA 1N32Q 1ONLA 4K2KA 4IOAA 5IWAL 5M5WB 1II3A 2ID0A 4OIJA 1FJGQ 1KRSA 1JQYD 1UEAB 3MA2B 2Q2HA 2VQFQ 4AYBG 2JK8A 3VYTA 4OONA 3WDNA 2F0DA 3NPPA 2MPMA 1I4QA 4DNIA 3RLFA 3S24A 4BY1H 3T53B 4JOIA 1Y14B 2VUMG 2RF4A 4AYBB 1EIHA 2L5TA 1PZJD 1U4LA 2ZTDA 1X3PA 4A3IB 4O0AA 5CGKA 3HOVG 4FXDA 2YV5A 1LO5D 3KDFA 5C4ZA 3MXUA 4UAIA 5BR8Q 3S2DB 1EY5A 4FYDA 4QIWE 3H3VI 4ZKCB 4A3KG 3FKIB 2RDFA 5CC4A 4ALPA 1WOCA 1T9HA 3SHLA 2JP1A 4FNFA 2K5NA 1AFPA 4RKLA 5J39A 3MEFA 5NUCA 3RUZA 1TU2B 4JI7L 2WIIB 1LTID 2ZM6L 3HS0C 4KK7A 4F88A 1PZID 3GTPH 4RGNA 1KRTA 5CMDA 4EGVA 4ZCKA 5IGCA 3I72A 1V9PA 1AN8A 5M5XH 2HQEA 5IP9H 1SAPA 3MC0B 5GADC 2Z6BA 4R9WA 3KBGA 3SVMA 1IKMA 2JSOA 4Q0FA 4K8IA 1DONA 1X65A 5C3EB 1YJNA 1N9WA 2EYMA 3R3OA 4DV0Q 1J5EL 3VYUA 1TVXA 1FVIA 1B70B 2LFNA 1UWVA 5FKAC 1JB7A 4LUVA 5C0XJ 1UEBA 3HOWH 1B9NA 4YHHQ 2QF7A 2KEEA 3QIAA 3LWEA 3Q0AA 2F0EA 4PMCA 2B3GA 1O7LA 1BNZA 1E24A 3M3YH 1UNSA 3PIO3 2MHVA 4C3IH 3IFTA 1QUQB 2NB0A 5CORA 1GUGA 4GLAC 3T4AC 2F0GA 5D3IB 2Z6KC 4DR5L 4QMGA 2KQ3A 1YJWA 1A2TA 1LABA 1EY8A 1EY4A 1HNXQ 1A0IA 3BVGA 3A7LA 1G6ZA 3CQZH 2K5HA 3L9AX 1K83B 2QDLA 2CQOA 2UUAQ 1GHKA 2IX3A 4B9XA 3G7LA 3NHHA 3ULLA 2XSCA 1W3SA 5C3WA 1H9SA 1U4PA 1Y8OB 1G51A 3I91A 4K0KL 2K5VA 4L8JA 5IGGA 1SE3A 3FHWA 3FDTA 1MHWC 2BA1A 3C1FA 3CCSA 1NUCA 1X3QA 1HQMC 2A19A 2DNEA 1JJ2A 1YNND 2Y0SE 4J8QA 4A76A 3ND8A 4N8X1 3GTMB 1K8MA 3HOWG 2QGQA 2VQFL 1Q86C 1VQLA 4QY7A 1BCPB 4OO1G 3I73A 2JA5H 2Z9HA 2WAQE 5KGUA 3CCUA 4IUQA 4KD4A 1EFWA 1YHBA 3URYA 1EY6A 3LGJA 5EQ0A 1QG7A 4BXXH 1HUMA 1VQFA 2CW0D 3ITPA 2OXPA 2K14A 3ICEA 1PH6A 1VQ5A 1YI2A 5FOBB 2PI2A 4DUZQ 4A3JG 1JWSD 3QJYA 5C44B 2HDLA 4ZK9B 1DD2A 1HA5A 3DWAA 2EDGA 3TSSA 4KJOA 3VR5A 4O2DA 4OXPA 3PO3H 3FP9A 4DV6Q 1Z7TA 1XYIA 4X3SA 3SEBA 1HPCA 2QA4A 2UUCQ 3Q22A 3GTJH 3GTMH 1WVLA 4POFA 1RD9D 2BDNA 1WCMG 2KENA 5EBDA 4A3FB 4IFDH 1F2YA 5GAGC 1AZPA 3J7AV 3KYHC 3KK7A 5M3FG 3CW2C 2JEBI 3HZXA 3I55A 3HOVB 2R7ZB 1B4OA 1TQOA 3TZDA 3PF5A 3SXHA 5IT9L 5HURA 3PGZA 1NSNS 1D6EC 1N34L 1I4PA 4IALA 2K4KA 2A68D 1U4RA 4NXNL 1S72A 1R9TB 3AMUA 1FD7D 2N3SA 1K28A 3PQIA 5M5YH 2ZXPA 1VQEA 1SNOA 1JWMD 2CHBD 2HD3A 3CPFA 3AB9A 1XX8A 3CHBD 4LF6L 3OYYA 1PLFA 2MGSA 4YHHL 3DWQA 4JI5L 2M9VA 1Z6HA 1EYGA 2HQLA 5K36H 3I70A 2LSSA 1KL9A 2CKZB 5FLMG 4L63B 3D8GA 5JJKA 4L5SA 5J1ZA 1TXYA 1EU3A 2EJGC 2F0NA 1PTOF 1CQVA 4X6AH 2MFIA 4R4CA 1SEBD 3D6WA 3NTIA 2Q8IB 1STAA 3GTJB 1GKHA 4LF6Q 3JC66 3J7ZC 1E3PA 3H3VC 4KJNA 3ULPA 1CKMA 1CKNA 1ZEQX 2F3WA 5CV5A 5KNCA 2RBMA 2JYOA 1PXUA 3H0GB 4A3KH 1NR4A 2FMMA 3OTOL 1V43A 2WFWA 3RLNA 1FGBD 2JA7H 4DR4L 4CGYB 3I4MB 4BXXG 4DFAA 2QEXA 3UDIA 2WINB 2F4VQ 3GD7A 3DMUA 2EXZA 1F9RA 2I5HA 3OMGA 4X64Q 4IJLA 2Q2TA 1F9QA 1YITA 1XNQL 5C4JH 4XTCS 1Y1WB 3T16A 3M9BA 3G71A 3IAYA 5ELDA 3VR3A 3AU7A 1Y69U 1STEA 4FXKC 4EQNA 4KN4C 3OTOQ 3A8KE 4R8NA 1VMPA 1Q3LA 2B8GA 1JE5A 1W6KA 5FJ8G 4X66Q 2EJMA 1BCPC 2FINB 1PH1A 1BKBA 3K5OA 2ZXRA 1ILPA 1HZAA 1GHJA 1C7YA 2L12A 2A1AA 1CK1A 4K5VA 3K5LA 5DAUA 3GV6A 2RDGA 4IUPA 4A3CH 2B2TA 3NTKA 2IY5B 4A3MB 1HH2P 1JORA 4O42A 4JK1C 4ID6A 1XMQL 1TWAH 4X66L 4LFCL 4IPHA 1CA5A 1PTOH 1EZ6A 3D3RA 1YNXA 2HHHQ 2OQ0A 4X65L 5KRUA 3IKJA 2RCNA 1EZ8A 3GO5A 2I5LX 1P16A 3J80c 2IW3A 4A3GB 3OOCA 2K28A 4OX9Q 2PNRC 2ZJPA 3T51B 2R7ZH 3A54A 4CBVA 5M3MB 1I4XA 2JJQA 1TY0A 4DXGA 2WB1G 3D31A 3BZKA 1JB3A 2RA4A 1BBUA 2EY6A 3KLRA 3CC4A 3O13A 1T5XD 2LKVA 4IUVA 2IT1A 1M8AA 3LWUA 3V2TA 4C3HB 2VQEQ 4HJAA 4NXNQ 5EKKA 4OX9L 4IFDI 3NBIA 3E6ZX 1CT1D 5DLQE 2IHEA 3ND9A 4A93H 1XPOA 1O80A 3HOYG 2I0QA 1OTCA 4J6HA 1Q1BA 3DM1A 4RGMA 4IUTA 4LUOA 4YCWA 2C9OA 5IE8A 2UU9L 1RIPA 5KYLA 5IT9E 2RCFA 1CZWA 3TDQA 4LFBQ 4WRDA 1RKNA 4C3JG 2Z8LA 4DV0L 4Z9CB 4PG3A 4DF7A 5C4XG 1BCPF 1G8ZD 2J7ZA 2ASBA 1U0LA 2Z0SA 3W5OA 4M8AA 5IP7H 3J80i 3CMAA 5H1SE 1HZCA 1XXGA 3BZDB 2RVLA 2K7VA 5TSSA 4LFBL 3RN2A 4B3SL 1MBYA 4FF3A 2PO4A 3KF6A 1IBLL 3I3CA 1IYVA 3S14B 3S2DH 5CR3A 3PIOA 5I4DA 3HKZB 3GDEA 1P8LA 2VNUD 2I46A 1IL2A 2MO1A 3BDOA 4WJ3M 4DNRB 4R4IA 1K83H 4BBRG 4JW0A 3WOFA 3SR1A 1X9NA 2MJ8A 1PH7A 4H02A 5BN5A 4A75A 4A93G 2JA9A 3I7FA 3P75A 1FNVA 2NTSA 3BVZA 4DV4Q 4LJZC 4DAYA 4N9PA 1BUVT 3HOUB 4LK1C 3GTLB 1A62A 4C3HG 1QVGA 2IPKD 1OXVA 2C35B 1CA6A 1VQJA 1IYUA 1LTLA 3F2BA 1SJHD 3NSWA 1X3EA 1VQOA 4KMUC 2VW9A 2EIFA 1PRTF 5KEEA 2NVQB 2B2WC 2BH2A 2JE6I 1M90C 3EA6A 5D65A 2KCNA 4CKCA 4JI1Q 3UDGA 1K73C 2DJGC 3RZOH 5AJ3Q 1LLRD 2B2TC 2QILA 4XT3B 5FO9B 2AQ2B 3NQIA 3FRPB 1K3RA 2HHHL 4HIKA 2PI2E 4RH6A 1HQRD 1S5DD 4LUZA 2H1EA 4JI3Q 3TMEA 3K81C 4YY3Q 2A6EC 3E5SA 4AIMA 1FR3A 1MIUA 2V1CC 4H44C 3BYYB 3ZJYC 2JA5G 2ZT9C 1F2MA 1PH5A 3T13A 1Y1WG 4HN7A 4KKSA 2F0JA 4P72A 1WTQA 2RSNA 1IBMQ 1O78A 1STYA 4IOCA 3T1HQ 1H95A 2E2JH 4C1NK 4E6IA 4YY3L 2QKIC 1E2WA 3U50C 4GS3A 4RHSA 4ZRZA 4DKAC 2YTVA 3EBEA 2F4IA 3NBHA 5IGFA 3S14H 1BO0A 4OGQC 5JPMC 1EOTA 2E5LL 3GTGH 2XRSD 1JMCA 3S2HH 5EBCA 4HCEA 3S1NH 3PUWA 3TP7A 1TWCB 4PZ8A 3QB3A 2PZTA 3FPPA 4IZ8A 1ASYA 4JBKA 1D5MC 2K52A 4A3CG 3QO2A 4A3BB 5JOBA 3GTQH 3HEJA 5C44G 4GOPB 3H0GG 5E1FA 5C5MA 3F2UA 3CCLA 3RMHA 2EOTA 1X3GA 3CMEA 3CRKC 1WTVA 1GO3E 4MN3A 5M3FH 4C2MB 1QILA 1I6VC 1CQFA 2Q2IA 4IPDA 1SYCA 1VQCA 1D8LA 1QWYA 2FFKB 4QF4A 5K5PA 4F7XA 3DHQA 4XYQA 1HCZA 2XTIA 4N9TA 5HY6A 2F0VA 4QUCA 3E0JA 4HJ7A 1B9MA 3FVQA 5EJWA 1JT8A 2K50A 1E0BA 3RLOA 4GLXA 1Q90A 3CCMA 1U4MA 4I65A 1NY4A 1JR0D 2H4OA 1HNWQ 4OO1I 3JAMc 1FNWA 4A3IG 4MIUA 3N52A 2RSOA 3T1YL 5K36G 5ELCA 4KN7C 2R7DA 3K7AH 5FLMH 1TS3A 1CHQD 1ICFB 3NBHB 1IW7D 4X3KA 4DR4Q 1GD7A 2OT2A 1J6QA 1UE7A 5D14A 4B9WA 1AW7A 3BYTB 4DUYL 4G4KA 4BBRH 3TREA 3D6CA 4C2MH 3TS0A 3HKSA 2A69C 3KJPA 1LTTD 4DV1Q 1FYCA 1CKNB 1DOKA 1HR0W 1PYWD 5LMNW 1MKHA 1EU4A 2FJ2A 4DK6C 4DR7L 2N88A 4CDDC 1EUJA 1HFNA 3PUVA 1SYBA 1N33L 2DNCA 4DK1A 5AJ3L 1YBYA 4WJ4A 1EEID 2N49A 3CCVA 5C3EH 2B39A 1FL0A 3KDFB 2D2CC 3P7JA 1TWCH 3G4SA 3NENA 1SSOA 1SRUA 3KF8A 2PCFB 4GN4B 2VY3A 3AEVA 4DV7L 5FO7B 4B3MQ 2F3IA 4RGTA 1WFQA 4EQ5A 4HIDA 4LNQA 4DV4L 2G9HD 3ZYYX 2D5DA 2JA6H 1ESRA 1XNRL 1HHVA 2N55A 4JBWA 1B2TA 4B3RQ 1XMQQ 3JAME 1M4VA 4I7AA 1XMOQ 4MNOA 3E3XA 2LXJA 2JA8H 3T1HL 1HTPA 2K5WA 4DK0A 2R93G 4ZLTF 3GTKB 2XIWA 1SFOH 5A35A 2DN8A 4NW2A 3VR2A 4CKEA 2RHSB 1PFBA 1VQBA 3FKIH 2JA7G 4GKKQ 3KLSA 3IL8A 4KY5A 1I3QH 4C1NI 4A3FH 3CRLC 2IX0A 5BN3A 2CQAA 1B7YB 3A8IE 4C3HH 1A2UA 3K59A 3DUZA 1KQSA 4H7BA 1CM9A 2PPBC 1KLGD 1VQIA 2F0IA 4GKKL 1NTGA 5J3BA 3RR5A 1U5KA 3GTOH 1Y8NB 4ZAIA 2JA6G 3F8TA 1J9OA 1LACA 4DU9A 3DWPA 3PO3G 1JCKB 5E4XA 3HFZB 5KIXA 1HUNA 2L0CA 2R93B 4LW1A 2E5LQ 3HG9A 1VQ4A 3HGBA 1YVCA 2HCIA 1L1OB 5E7NA 1GVPA 1TWAB 5DM73 2JEAI 4JYAL 2EY1A 2ZJQA 2TSSA 4HJ9A 3MFGA 2K5QA 3K5NA 1RF2D 3HKZG 3MEHA 4FF2A 1PYSB 1WD0A 5JPNC 2BOSA 4A3DH 1EWCA 3EIVA 1S5CD 4JI5Q 1UAPA 3QR8A 5C4XH 2O5JC 1HTLD 4APVA 3I4LA 4YWLA 2NVQH 1XTDA 1C4QA 5C4XB 1M1KC 2QCPX 4TQUS 2ALYB 1PH3A 1DGSA 3NUCA 4PV1C 4DXFA 1PH8A 4A3DB 5CYUA 3A0JA 4A3BG 2XRQD 3P1HA 4NPSA 1D1IA 4BWGB 4ME3A 2E2DC 4KHVA 3H91A 2PNHA 1RHPA 1JOKA 5G3LD 4A3KB 1V1QA 3S1RH 4RAUC 2YTYA 3L0OA 4JG2A 3VR4A 4F87A 3MXPA 4LF5L 3MZ5A 1VF5C 1Z9FA 5CV7A 1UUPA 2F4VL 1K0SA 3PUXA 3HOWB 3EJIA 1X54A 1B3AA 1D2BA 2DY8A 2EJFC 3SK4A 2VUMB 5BN4A 1W2BA 1YHAA 2A6HC 3TP6A 2XN9C 3IRBA 4XIGS 1B8AA 4G7ZC 4TSSA 3QWNA 2HUGA 5EKLA 2E2HH 4LF5Q 4WFN3 3A56A 1VQ7A 3H6MA 2E76C 3I8ZA 1N33Q 1G2SA 2K5DA 5KNBA 1G2TA 1R4PB 2XVSA 1E2VA 2XNAC 3N6RA 2B2YC 5L37A 3I90A 1XPRA 4TVAB
chains in the Genus database with same CATH topology
4NP5A 1B44D 1S5FD 2XWJB 4HSPA 1MSHA 1GUNA 1CFMA 5LHY1 1BF4A 1SJED 3GQBA 1LTAD 3NK9A 5EGTA 2G9DA 4K6LA 1H9SB 2BE5C 5C5LA 2WKCA 5EPLA 3S16B 1VF7A 3M4YA 2R3ZA 4C3IG 2PZWA 2A69D 1RTOA 1LV9A 1VMCA 1F77A 4HR7B 1GOZA 4DNTB 1TS2A 1I3QB 2NTTA 1OXTA 2E74C 2SNSA 1IW7C 1DYQA 4V190 1AEXA 2AWOA 3IFDA 1GUTA 5C0XH 2Q8RE 1CTMA 3M7GA 1RJTA 2RDHA 1H9MA 2Z4HA 2V4DA 4G7HC 2BE5D 5EKIA 4CJ1B 1GUSA 1DCZA 1WTXA 1SNDA 1KNAA 4ME5A 2KEDA 1D1KA 4DGZA 5DNFA 2F0MA 2KHSA 5CV9A 5IGEA 4GZYC 1PTOC 1C8CA 3HOZB 4PQXA 1R4QB 2K04A 2AUJD 5CV8A 1LT4D 1HXYD 1O7ZA 1KDAA 3TP5A 5E3FA 4HCSA 1LT5D 1GUOA 4DN4M 2R6GA 1KABA 4L6TB 4HTHA 4RGOS 2KJXA 3HP3A 4KV6A 1YNNC 4OO1H 5C0XG 2WB1B 1KTKA 2F0UA 2VXWA 1DM0B 3S15B 1JOOA 3Q24A 1HA6A 1IKLA 1MD2D 5HGTA 4KI0A 5A2QL 1MGSA 3BDLA 1BBXC 1WTWA 4A3JB 2OF1A 5KNDA 4ZQ3A 3MXNA 1RCVD 4OL7A 2R61A 3MVVA 3K6OA 1SDFA 1RDPD 4BA1I 4FP5D 3R8BA 4XQNA 4IFDG 2K1BA 1STBA 2L9HA 2TMPA 2PW7A 4BS9A 2X6GA 4X3UA 5G3LF 3NWTA 3U9SA 2XWBB 1Y8PB 2J4XA 2B2VA 2D62A 1ZXTA 4UDUC 3DXJC 1H9KA 3V96A 2KVMA 3A7AB 3D4RA 5F2DA 2EYLA 5CBEE 2NYZD 3KLSX 2K05A 2K32A 4Q5VA 5ISRA 4IFDJ 5JEAG 5JAVA 1NR2A 1HRJA 2RQXA 4FF1A 3DEPA 3C2PA 1SNCA 2ICEC 4B08A 1QNKA 4RHRA 2DY7A 2CVRA 2F1MA 2KOLA 5E4WC 4LMQD 2E75C 5I2XA 1PRTB 3BDCA 4TRDA 5J22A 5LL6X 5JVG3 1WCMB 3M7NA 2B63B 3R2IA 1A3VA 2AWNA 1Q8IA 1K8OA 1GUWA 2HDMA 1WTPA 2KUMA 1JE4A 5JEAJ 2F0SA 3L3OC 2NZ1D 2SEBD 5M5YB 4KKTA 1BR9A 3GP7A 4QIWB 1SNMA 1YNJD 3BG3A 1ZYRD 4CHTB 1B50A 4OIKA 1A3TA 2NVTB 1EYDA 4LAAA 2EZVA 1AZQA 2FHTA 2F0PA 4HEDA 4IUNA 2Z4IA 3GTQB 1S5ED 2SOBA 5A2QE 1CI3M 1D5XC 1TKWB 1OXUA 2F0OA 4PMBA 5CV4A 2Z1CA 3FEWX 4PMWA 1LTBD 5I9PA 3EROA 3W3AA 5FK9C 3OIPA 4BBSB 3SK5A 2EY5A 3LX0A 2K6AA 4ZUIA 3K0YA 3C1EA 1LTGD 2A74C 1PFMA 5COYA 5EPKA 5C0XI 2AQ1B 3FPUB 2J0TD 5D3DA 1VDZA 3HOXB 1QOHA 3S17B 3J7AF 2O2LD 3UI2A 1F9PA 2IX1A 3DEOA 1LT6D 3S1NB 4K2LA 4BY7B 2PYKA 5CV6A 3RD4A 2JA7B 1OXSC 2QEJC 4FO2A 2NWGA 4ZKBB 3TN2A 4G57A 3R93A 5JJZA 3Q6SA 4ODGA 4HMIA 2A5HA 4IUUA 2EYHA 2WAQB 3V05A 2NUCA 1DJRD 2RKSA 5ELBA 4WJWA 3R2TA 3KUPA 3SK6A 2B2UC 3J80L 4X3TA 4C3IB 1TIID 5IODA 3K5MA 1A15A 5IGDA 1STGA 4U68A 5C4HA 4Y7NB 3PUZA 2AQ3B 2EYPA 3TP8A 2F03A 1PDQA 4ZYSA 4PNYA 1EIGA 1Q12A 2EYJA 4K5XA 1SMYC 3J81L 3OSOA 4NDXA 4FF4A 1QJOA 3L7ZC 2K33A 2A6ED 1I50B 1PRTC 5JEAH 1D5ZC 1OXXK 2KA7A 3K58A 1EQTA 5DM63 3LNNA 3GV3A 2B2UA 4TKOB 2A73B 3SE0A 4QB4A 2B2WA 2L55A 1CHPD 1XWEA 4KD3A 1AP0A 3M3YB 1TWFB 4WORA 2MP1A 4NMZA 2B8FA 3FMCA 3MHBA 2VB2X 5AFWA 1HFGA 4HMJA 4BA2I 1BDOA 5FO8B 2A6HD 3SK8A 1QE6A 3NTHA 3OWEB 1TY2A 1TR5A 4K14A 4CJ0B 1X32A 4K5WA 5M5XB 1JOQA 1GJXA 1H9RA 1ENAA 1XTCD 2M00A 1E2ZA 4DA2A 1SNQA 5IIFA 2F0TA 3JAML 2JA5B 1NCVA 1KAAA 3PO3B 3C46A 3OIQA 2IJ0A 2O4XA 1RTNA 2JA6B 5T1IA 4EQPA 1PTOD 2EPBA 1KLUD 1QNUA 3S9WA 2HCCA 3OMCA 1L0XB 2E2IB 2K01A 1DOLA 1Q1EA 4V0BA 4OHJA 3EVQA 4QUFA 4A3EB 1SMYD 1O7YA 1F9SA 1BCPD 3I4NB 1W6JA 1PZKD 3ERQA 4KHZA 2BA0A 2NVXB 3TZUA 1SNPA 3QG1A 3GTGB 2EY2A 2ENBA 1WD1A 2A68C 1G291 3HRZC 4KY6A 4MHEA 5C4JB 4QCLA 1PMRA 2WV6D 4KTAA 5I6WA 1T5EA 4ILWA 4IN3A 1SFOB 1KNEA 4RWSC 1NAPA 1Y1VB 5DEHA 2B2VC 2IWHA 4HAEA 3MWYW 4C3JB 4KY7A 1B1ZA 3MAQA 1ML0D 3VYSA 4R8IA 1V1PB 1EFID 1JICA 1ICWA 2L11A 5IOCA 3MTSA 3S2HB 3QOJA 3K57A 4XDXA 1V1PA 2MUYA 4I7ZC 2OEOA 2BCOA 4S3SA 3GTPB 3D4WA 1DZ1A 2JXMB 4P2CB 3CKIB 3HOYB 2VB3X 1IHZA 4RCOA 1EL0A 3NQTA 2Q8TA 3H94A 1CZGA 1EY7A 1Z47A 5C3XA 1ET6A 3OWFA 2EE1A 1TWHB 1ZYRC 4XQQA 1MI2A 4FVMA 3RZOB 1YNJC 1SXTA 4ULLA 1ENFA 3OW7A 3NWSA 4BY1B 4FXGC 5IGBA 2EYOA 4K6DA 3S1QB 3VR6A 3D4DA 1VCIA 1A6XA 2PMZB 1U9RA 1L0YB 1PFNA 2SDFA 4NKLA 2KCCA 1EWHA 1I4RA 1EQVA 1F2ZA 2C5CA 5I6YA 1TWGB 1BXTA 3CU7A 1S5BD 4G7OC 4IURA 2ZXOA 3OPOA 1ESFA 3C3LA 1QB5D 1H9JA 5LL6S 1JWUD 3SDZA 3ONAB 3J7YW 1EY9A 2NN6H 4KKUA 1ET9A 3TBIB 3GTOB 4M1UB 2I07B 1I4HA 5FLXE 3J80E 1SE2A 2E2JB 4H13C 2JA8B 2K03A 2IL8A 1EEFD 3CQZB 3RZDB 3G6JB 1SE4A 1PTOB 5CBAE 4DAVA 2ICIA 2WKDA 2F0LA 5JVH3 3J81E 4EVOA 3QOLA 1I4GA 3WOEA 4EQOA 3M85A 4J1MA 5KYIA 4ZUJA 4F8MA 2QDBA 3H09A 4A93B 1C48A 5ELFA 1KDBA 2PQEA 3K7AB 3Q23A 3KBXA 2F0KA 1BOSA 4XXEA 2PW5A 2LMCB 3NP8A 3VYRA 1EYAA 1LTRD 2NN6G 1F2LA 4BBRB 1ENCA 4RKBA 2BDOA 3BS1A 3PO2B 3X3NA 1BQQT 2D9UA 1JC7A 1SYGA 3PIP3 5M3FB 3A55A 3VA7A 2O5IC 2F0WA 2FMCA 2KECA 3NXWA 5ELEA 2WP8J 1OO9B 4XYOA 3PV0A 1TT2A 2Y0SB 1STHA 2EVBA 3MFYA 3X3MA 1PRTD 1IL8A 3PUYA 1EYCA 2NVYB 2L1BA 1KDCA 1B53A 1J8IA 2F0FA 4RA8A 3M4OB 2WACA 1V8QA 1QCBD 1STNA 1SBBB 3W2DA 2YU9B 5M9OA 1I6HB 3T56B 2NBFA 1SYFA 1TS4A 2SNMA 2R92B 1A3UA 3VA5A 4K8JA 4YIJA 2AUKA 2F0QA 3P20A 1TS5A 5EPJA 4XQJA 4RFBA 1FNUA 1SYDA 3EQLC 4IQZA 4U673 4H0LC 2X6LA 2GA4B 1WTRA 2X69A 1GXDC 1WTOA 2CW0C 4O1NA 1DXMA 2F0HA 4HSVA 1LTSD 5FLXL 4ABNA 3U9OA 1S4ZA 4XT1B 1ZKOA 3OHXC 1V1OA 5T1GA 4C56C 2NN6I 5I9OA 4CKBA 1DOMA 2L4NA 3EFXD 1SYEA 2LY7A 1LT3D 2M2LA 3MXGA 3A8JE 2E2HB 2LS01 5I2YA 3BVMA 2EYFA 4CJ2C 1MSGA 2B2YA 1G91A 3S1MB 5C6AA 4DAPA 2F3VA 2PZUA 3NE5B 1ILQA 1EY0A 3S1RB 3PMFA 4RCNA 1RODA 2YYZA 1ONLA 4K2KA 5M5WB 1II3A 2ID0A 4OIJA 1JQYD 1UEAB 3MA2B 3VYTA 3WDNA 2F0DA 3NPPA 2MPMA 1I4QA 3RLFA 3T53B 4AYBB 1EIHA 2L5TA 1PZJD 1U4LA 1X3PA 4A3IB 4FXDA 5CGKA 1LO5D 5C4ZA 3MXUA 4UAIA 3S2DB 1EY5A 4FYDA 4ZKCB 3FKIB 2RDFA 5CC4A 3SHLA 2JP1A 4FNFA 1AFPA 4RKLA 5J39A 5NUCA 3RUZA 1TU2B 2WIIB 1LTID 3HS0C 4KK7A 4F88A 1PZID 4RGNA 5CMDA 4EGVA 5IGCA 3I72A 1AN8A 2HQEA 1SAPA 3MC0B 4R9WA 3KBGA 3SVMA 1IKMA 2JSOA 4Q0FA 4K8IA 1DONA 5C3EB 2EYMA 3R3OA 3VYUA 1TVXA 2LFNA 5FKAC 5C0XJ 1B9NA 2QF7A 2KEEA 3QIAA 3LWEA 3Q0AA 2F0EA 4PMCA 1O7LA 1BNZA 1UNSA 3PIO3 2MHVA 3IFTA 2NB0A 5CORA 1GUGA 3T4AC 2F0GA 5D3IB 4QMGA 2KQ3A 1A2TA 1LABA 1EY8A 1EY4A 3BVGA 3A7LA 1G6ZA 3L9AX 1K83B 1GHKA 2IX3A 4B9XA 3G7LA 3NHHA 2XSCA 5C3WA 1H9SA 1U4PA 1Y8OB 3I91A 4L8JA 5IGGA 1SE3A 3FDTA 2BA1A 3C1FA 1NUCA 1X3QA 1HQMC 2DNEA 1YNND 4J8QA 3ND8A 3GTMB 1K8MA 1BCPB 4OO1G 3I73A 5KGUA 4IUQA 4KD4A 3URYA 1EY6A 5EQ0A 1QG7A 1HUMA 2CW0D 3ITPA 2OXPA 5FOBB 1JWSD 3QJYA 5C44B 2HDLA 4ZK9B 1DD2A 1HA5A 3DWAA 2EDGA 3TSSA 4KJOA 3VR5A 1Z7TA 1XYIA 4X3SA 3SEBA 1HPCA 3Q22A 1WVLA 1RD9D 2BDNA 5EBDA 4A3FB 4IFDH 1F2YA 1AZPA 3J7AV 3KK7A 3HZXA 2JEBI 3HOVB 2R7ZB 1B4OA 1TQOA 3TZDA 3SXHA 5IT9L 5HURA 1NSNS 1D6EC 1I4PA 4IALA 2A68D 1U4RA 3AMUA 1R9TB 1FD7D 2ZXPA 1SNOA 1JWMD 2CHBD 3AB9A 1XX8A 3CHBD 1PLFA 2MGSA 3DWQA 2M9VA 1Z6HA 5K36H 3I70A 4L63B 3D8GA 5J1ZA 1EU3A 2EJGC 2F0NA 1PTOF 1CQVA 1SEBD 3D6WA 3NTIA 2Q8IB 1STAA 3GTJB 3H3VC 4KJNA 5KNCA 1ZEQX 2F3WA 5CV5A 2RBMA 2JYOA 1PXUA 3H0GB 1NR4A 2FMMA 1V43A 1FGBD 4CGYB 3I4MB 4DFAA 2WINB 3GD7A 3DMUA 2EXZA 1F9RA 3OMGA 1F9QA 4XTCS 1Y1WB 3T16A 3IAYA 5ELDA 3VR3A 3AU7A 1Y69U 1STEA 4FXKC 4EQNA 4KN4C 3A8KE 4R8NA 1VMPA 1Q3LA 2B8GA 1W6KA 2EJMA 1BCPC 2FINB 3K5OA 2ZXRA 1ILPA 1GHJA 2L12A 1CK1A 4K5VA 3K5LA 5DAUA 3GV6A 2RDGA 4IUPA 2B2TA 3NTKA 4A3MB 1JORA 4O42A 4JK1C 4ID6A 1CA5A 1PTOH 1EZ6A 3D3RA 5KRUA 3IKJA 1EZ8A 3GO5A 2IW3A 4A3GB 3OOCA 2K28A 2PNRC 3T51B 3A54A 4CBVA 5M3MB 1I4XA 1TY0A 4DXGA 3D31A 1JB3A 2RA4A 2EY6A 3KLRA 1T5XD 2LKVA 3O13A 4IUVA 2IT1A 1M8AA 3LWUA 3V2TA 4C3HB 5EKKA 4IFDI 3NBIA 3E6ZX 1CT1D 3ND9A 1O80A 4J6HA 1Q1BA 3DM1A 4RGMA 4IUTA 2C9OA 5KYLA 5IT9E 1CZWA 3TDQA 4WRDA 1RKNA 4C3JG 2Z8LA 4Z9CB 4DF7A 1BCPF 1G8ZD 2J7ZA 4M8AA 1XXGA 3BZDB 2RVLA 2K7VA 5TSSA 1MBYA 4FF3A 2PO4A 3I3CA 1IYVA 3S14B 5CR3A 5I4DA 3HKZB 2VNUD 2I46A 3BDOA 4DNRB 3WOFA 3SR1A 2MJ8A 5BN5A 3P75A 1FNVA 2NTSA 3BVZA 4LJZC 4DAYA 4N9PA 1BUVT 3HOUB 4LK1C 3GTLB 4C3HG 2IPKD 1OXVA 1CA6A 1IYUA 1SJHD 3NSWA 4KMUC 1PRTF 5KEEA 2NVQB 2B2WC 2JE6I 3EA6A 5D65A 2KCNA 4CKCA 1LLRD 2B2TC 2QILA 4XT3B 5FO9B 2AQ2B 3NQIA 3FRPB 4RH6A 1HQRD 1S5DD 2H1EA 3TMEA 2A6EC 3E5SA 1FR3A 4H44C 3BYYB 2ZT9C 1F2MA 3T13A 4HN7A 4KKSA 2F0JA 1WTQA 2RSNA 1O78A 1STYA 4C1NK 4E6IA 2QKIC 1E2WA 4RHSA 4ZRZA 2F4IA 3NBHA 5IGFA 1BO0A 4OGQC 5JPMC 1EOTA 2XRSD 5EBCA 4HCEA 3PUWA 3TP7A 1TWCB 3QB3A 2PZTA 3FPPA 4IZ8A 1D5MC 3QO2A 4A3BB 5JOBA 3HEJA 5E1FA 5C5MA 3F2UA 3RMHA 2EOTA 3CRKC 1WTVA 4MN3A 4C2MB 1QILA 1I6VC 1CQFA 1SYCA 1QWYA 2FFKB 4QF4A 5K5PA 4F7XA 3DHQA 4XYQA 1HCZA 4N9TA 2F0VA 4QUCA 3E0JA 1B9MA 3FVQA 5EJWA 1E0BA 1Q90A 1U4MA 4I65A 2H4OA 1JR0D 4OO1I 1FNWA 4MIUA 3N52A 2RSOA 5K36G 5ELCA 4KN7C 1TS3A 1CHQD 1IW7D 4X3KA 2OT2A 5D14A 4B9WA 1AW7A 3BYTB 4G4KA 3D6CA 2A69C 1LTTD 1FYCA 1DOKA 1PYWD 1EU4A 2FJ2A 2N88A 1HFNA 3PUVA 1SYBA 2DNCA 4DK1A 1EEID 2B39A 2D2CC 3P7JA 1SSOA 3KF8A 2PCFB 5FO7B 4RGTA 2G9HD 3ZYYX 2D5DA 1ESRA 1HHVA 2N55A 4JBWA 1B2TA 3JAME 1M4VA 1HTPA 2K5WA 4DK0A 4ZLTF 3GTKB 2XIWA 5A35A 2DN8A 4NW2A 3VR2A 4CKEA 1PFBA 3KLSA 3IL8A 4KY5A 4C1NI 3CRLC 2IX0A 5BN3A 2CQAA 3A8IE 1A2UA 3K59A 3DUZA 2PPBC 1CM9A 4H7BA 1KLGD 2F0IA 1Y8NB 4ZAIA 1J9OA 1LACA 4DU9A 3DWPA 1JCKB 5E4XA 5KIXA 1HUNA 2L0CA 2R93B 3HG9A 3HGBA 2HCIA 1TWAB 5DM73 2JEAI 2EY1A 2TSSA 3MFGA 2K5QA 3K5NA 1RF2D 3MEHA 4FF2A 1WD0A 5JPNC 2BOSA 1EWCA 1S5CD 1UAPA 2O5JC 1HTLD 3I4LA 1C4QA 5C4XB 2QCPX 4TQUS 3NUCA 4PV1C 4DXFA 4A3DB 5CYUA 2XRQD 3P1HA 1D1IA 4BWGB 2E2DC 4KHVA 3H91A 1RHPA 1JOKA 5G3LD 4A3KB 4RAUC 3VR4A 4F87A 3MXPA 3MZ5A 1VF5C 5CV7A 1UUPA 3PUXA 3HOWB 3EJIA 1B3AA 1D2BA 2DY8A 2EJFC 3SK4A 2VUMB 5BN4A 2A6HC 3TP6A 2XN9C 4XIGS 4G7ZC 4TSSA 3QWNA 2HUGA 5EKLA 4WFN3 3A56A 3H6MA 2E76C 3I8ZA 1G2SA 2K5DA 5KNBA 1G2TA 1R4PB 2XVSA 1E2VA 2XNAC 3N6RA 2B2YC 3I90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY5 A;  4NP5 A;  3D6C A;  3E5S A;  4HTH A;  2F0K A;  4KJN A;  2RDF A;  5CC4 A;  1SNC A;  4KV6 A;  4QB4 A;  1SNP A;  2PW5 A;  4J6H A;  3SHL A;  3NK9 A;  2EY1 A;  2F0H A;  2F0U A;  2F3W A;  5CV5 A;  3NP8 A;  5EGT A;  2RBM A;  5C5L A;  1F2M A;  2ENB A;  1EYA A;  2EY2 A;  4KD3 A;  3T13 A;  4RKL A;  5KGU A;  5J39 A;  4K2L A;  2F0J A;  4KD4 A;  4WOR A;  3U9O A;  5IGB A;  4NMZ A;  5NUC A;  5KYL A;  3RUZ A;  1JOO A;  2EYO A;  1SYB A;  4K6D A;  1ENC A;  4RKB A;  1EY6 A;  1RKN A;  3MHB A;  2PZW A;  3MEH A;  4KY6 A;  1STY A;  2PYK A;  3BDC A;  4TRD A;  5CV6 A;  5J22 A;  3DMU A;  2EXZ A;  3D4D A;  3OMG A;  5HGT A;  4E6I A;  3ITP A;  4HMJ A;  4DFA A;  2OXP A;  4DF7 A;  1SYG A;  5I9O A;  1A3V A;  3BDL A;  5IGF A;  4KTA A;  5I6W A;  1U9R A;  3T16 A;  2F0W A;  4G57 A;  5IGC A;  3NXW A;  2HQE A;  1SYE A;  4NKL A;  4EQN A;  3SK8 A;  2OF1 A;  4ODG A;  1TT2 A;  4HMI A;  4R8N A;  1EQV A;  1STH A;  2SNS A;  4ZQ3 A;  3TP7 A;  1TR5 A;  2EYH A;  4K14 A;  2F0S A;  1F2Z A;  4K5W A;  4KJO A;  2NUC A;  5DEH A;  4OL7 A;  3MVV A;  2RKS A;  4K8I A;  3NUC A;  5I6Y A;  3QB3 A;  1JOQ A;  1EYC A;  2EYM A;  3R3O A;  1AEX A;  2PZT A;  1KDC A;  4IZ8 A;  5CR3 A;  1ENA A;  2M00 A;  4KY7 A;  2EYF A;  3P1H A;  2F0F A;  3SK6 A;  5JOB A;  3HEJ A;  1SNQ A;  1SNM A;  4KHV A;  1STB A;  5IIF A;  2F0T A;  5E1F A;  5C5M A;  4K5V A;  1F2Y A;  2PW7 A;  5DAU A;  5C6A A;  3SR1 A;  1JOK A;  5IOD A;  2F0E A;  4PMC A;  2F3V A;  2WAC A;  3HZX A;  1JOR A;  1A3T A;  1KAA A;  2PZU A;  1EYD A;  1EY0 A;  1TQO A;  3P75 A;  1STN A;  1EY9 A;  4ID6 A;  4LAA A;  1STG A;  2O4X A;  5IGD A;  5IOC A;  5M9O A;  3SXH A;  3MXP A;  4KY5 A;  5C4H A;  2F0P A;  3MZ5 A;  3QOJ A;  1SYC A;  4N9P A;  5HUR A;  1SYF A;  3PMF A;  1NSN S;  4QF4 A;  1EZ6 A;  5CV7 A;  2SNM A;  4IUN A;  4IAL A;  3DHQ A;  2EYP A;  4K2K A;  4EQP A;  4F7X A;  3TP8 A;  2F0G A;  3EJI A;  5K5P A;  5KRU A;  2OEO A;  3S9W A;  3OMC A;  2KQ3 A;  4QMG A;  4N9T A;  1II3 A;  2F0V A;  2SOB A;  4S3S A;  1A2T A;  1EZ8 A;  1A3U A;  3VA5 A;  4K8J A;  1SNO A;  1EY8 A;  1EY4 A;  4PNY A;  4YIJ A;  2EYJ A;  1A2U A;  2F0Q A;  3D4W A;  4K5X A;  3SK4 A;  2F0O A;  4PMB A;  4H7B A;  4I65 A;  4WRD A;  5CV4 A;  1SND A;  2F0L A;  4ME5 A;  3TP6 A;  2F0D A;  4DGZ A;  2F0I A;  3OSO A;  5I9P A;  2F0M A;  3ERO A;  3EVQ A;  4NDX A;  5KEE A;  4MIU A;  2KHS A;  5CV9 A;  2EYL A;  5F2D A;  4EVO A;  5IGE A;  3QOL A;  5EKL A;  1IHZ A;  3SK5 A;  2EY5 A;  4EQO A;  3H6M A;  3NQT A;  4B9X A;  3NHH A;  3D8G A;  1SYD A;  4J1M A;  5ISR A;  2EY6 A;  5KYI A;  5C3W A;  4ZUJ A;  5CV8 A;  4F8M A;  2QDB A;  5J1Z A;  3LX0 A;  4ZUI A;  2F0N A;  1KDA A;  2LKV A;  4DU9 A;  5IGG A;  1EY7 A;  5CGK A;  5C3X A;  3V2T A;  1KDB A;  3C1E A;  2PQE A;  3C1F A;  3OWF A;  5EKK A;  5JAV A;  3TP5 A;  5E3F A;  5KIX A;  1NUC A;  5C4Z A;  4B9W A;  3ERQ A;  1STA A;  3TME A;  1KAB A; 
#chains in the Genus database with same CATH topology
 4NP5 A;  3JAM i;  1B44 D;  1S5F D;  2XWJ B;  4HSP A;  1MSH A;  4A3E H;  1GUN A;  1CFM A;  5LHY 1;  1BF4 A;  5ELO A;  1SJE D;  3GQB A;  1LTA D;  3NK9 A;  5EGT A;  2G9D A;  3M4O H;  4K6L A;  1AH9 A;  1H9S B;  2BE5 C;  5C5L A;  2UUB L;  4OEL B;  4NXM Q;  2WKC A;  5EPL A;  3S16 B;  1VF7 A;  4YWM A;  1SMX A;  1A63 A;  3M4Y A;  2R3Z A;  4C3I G;  2PZW A;  4JPB W;  4JOI C;  2QW7 A;  2A69 D;  1RTO A;  2DGY A;  1LV9 A;  1VMC A;  1F77 A;  4HR7 B;  1GOZ A;  3UE0 A;  4DNT B;  4JV5 Q;  4LF7 L;  1TS2 A;  4NXM L;  1I3Q B;  2NTT A;  4DV3 Q;  1OXT A;  2E74 C;  2AHO B;  2SNS A;  3I2Z A;  4L5Q A;  1IW7 C;  1DYQ A;  4V19 0;  1VQA A;  1AEX A;  4UPA A;  2KBN A;  2CWP A;  2AWO A;  3IFD A;  1GUT A;  1IZ6 A;  1CSP A;  3DLL A;  5C0X H;  2GVB A;  3AFQ A;  2Q8R E;  1QUQ A;  1CTM A;  3M7G A;  4LF7 Q;  1QZG A;  1HNW L;  1RJT A;  2RDH A;  4HJ8 A;  1H9M A;  2Z4H A;  2V4D A;  2CFM A;  4G7H C;  2BE5 D;  5EKI A;  3HOX G;  2B63 G;  2MNA A;  1AE3 A;  4CJ1 B;  3CCE A;  1GUS A;  1DCZ A;  1WTX A;  4CDC C;  1Q46 A;  1KNA A;  1SND A;  4ME5 A;  2KED A;  1D1K A;  4DGZ A;  5DNF A;  2F0M A;  2KHS A;  5CV9 A;  5IGE A;  4GZY C;  1PTO C;  1C8C A;  3HOZ B;  4PQX A;  4BBS G;  4DV1 L;  1R4Q B;  5IP7 G;  2K04 A;  4JI2 L;  2AUJ D;  5CV8 A;  1LT4 D;  3UE1 A;  1HXY D;  1O7Z A;  1KDA A;  1RL2 A;  3RZD H;  4A3B H;  4P71 A;  3TP5 A;  5E3F A;  4HCS A;  1LT5 D;  1GUO A;  4DN4 M;  2R6G A;  1KAB A;  4L6T B;  2B29 A;  4HTH A;  4RGO S;  2KJX A;  3HP3 A;  4KV6 A;  1YNN C;  1IBK Q;  4OO1 H;  5C0X G;  2WB1 B;  1KTK A;  4KLK A;  2F0U A;  4X62 Q;  1KXL A;  2VXW A;  1DM0 B;  4J15 A;  5GAH C;  3S15 B;  1JOO A;  3Q24 A;  1HA6 A;  2MQH A;  1IKL A;  3L2P A;  4DR3 L;  1MD2 D;  5HGT A;  3SGI A;  4KI0 A;  2KCT A;  5A2Q L;  5IP9 G;  1MGS A;  3BDL A;  1BBX C;  1WTW A;  4A3J B;  5M3M H;  2OF1 A;  5KND A;  4LWC A;  4ZQ3 A;  4A4I A;  5IT9 c;  3E9I A;  3MXN A;  2UXD L;  1RCV D;  2UUB Q;  4OL7 A;  2R61 A;  3MVV A;  3K6O A;  1SDF A;  1RDP D;  4BA1 I;  4FP5 D;  3R8B A;  4XQN A;  4IFD G;  3F1Z A;  2K1B A;  1STB A;  2IHF A;  2L9H A;  2TMP A;  2PW7 A;  2YU9 H;  1O7I A;  2PQA A;  4BS9 A;  2PMZ E;  2X6G A;  4GNX C;  3I4M G;  1K3B C;  2UXC Q;  4X3U A;  4DR6 L;  1PA6 A;  5G3L F;  1EIY B;  3NWT A;  3U9S A;  1JJG A;  2KHI A;  2XWB B;  1YJ9 A;  1Y8P B;  5IWA Q;  2J4X A;  2B2V A;  2D62 A;  1ZXT A;  4UDU C;  4HIM A;  3DXJ C;  4UHV A;  1HZ9 A;  2ZM6 Q;  1H9K A;  5IYB G;  3V96 A;  2KVM A;  3A7A B;  4AQY Q;  3KFU A;  4Y7N H;  3D4R A;  4OEM B;  5F2D A;  2EYL A;  5CBE E;  2NYZ D;  4JI0 L;  3KLS X;  2K05 A;  2K32 A;  2H5X A;  5FLX c;  4Q5V A;  5ISR A;  4POG A;  4IFD J;  5JEA G;  5JAV A;  1NR2 A;  2YTX A;  4A3M G;  3GTK H;  1HRJ A;  3KF8 B;  4AQY L;  2RQX A;  3KOJ A;  3DEP A;  4L5R C;  4FF1 A;  3PIP A;  3H0G H;  3C2P A;  1PYB A;  1SNC A;  2ICE C;  4B08 A;  4DV3 L;  1QNK A;  4RHR A;  3HOZ G;  2DY7 A;  2CVR A;  2CH4 W;  2F1M A;  2KOL A;  1N34 Q;  3S17 H;  5E4W C;  4LMQ D;  2E75 C;  4DR1 L;  3M4P A;  5I2X A;  1PRT B;  3BDC A;  4TRD A;  4DR2 L;  1TWF H;  3H15 A;  5J22 A;  2XGT A;  5LL6 X;  1N36 Q;  2CH4 A;  5JVG 3;  1WCM B;  2OCE A;  2B63 B;  3M7N A;  3R2I A;  1A3V A;  2NVT H;  2AWN A;  4DV2 Q;  1Q8I A;  1K8O A;  5LMN L;  1GUW A;  1L1O C;  2HDM A;  1WTP A;  3G6E A;  1KD1 C;  2KUM A;  1JE4 A;  4AYB E;  5JEA J;  1X6O A;  5IYC H;  2F0S A;  2GVA A;  1UE6 A;  3L3O C;  2NZ1 D;  2SEB D;  1BBW A;  5M5Y B;  1E1O A;  4KKT A;  4K0K Q;  1BR9 A;  2R93 H;  3OW2 A;  3GP7 A;  4QIW B;  3PO2 G;  1GM5 A;  1SNM A;  4UP8 A;  4YWK A;  3F2C A;  3CCJ A;  1YNJ D;  1LUZ A;  2LXK A;  3BG3 A;  1KHI A;  1ZYR D;  4CHT B;  1B50 A;  3ER0 A;  4OIK A;  1A3T A;  2NVT B;  1EYD A;  4LAA A;  2EZV A;  1AZQ A;  2FHT A;  2F0P A;  2DUD A;  4HJ5 A;  1XPU A;  4DR5 Q;  4HED A;  4IUN A;  2Z4I A;  3GTQ B;  1S5E D;  2SOB A;  5A2Q E;  1CI3 M;  4X64 L;  4JI4 Q;  1D5X C;  1K9M C;  1TKW B;  4GOP C;  1OXU A;  4GOP A;  2F0O A;  4PMB A;  2Z1C A;  3FEW X;  5CV4 A;  4C3J H;  4PMW A;  1LTB D;  1IBK L;  5I9P A;  3ERO A;  3W3A A;  5M3M G;  5FK9 C;  4GN3 B;  1CKO A;  1XNR Q;  4X62 L;  2N78 A;  3OIP A;  3S16 H;  4BBS B;  3SK5 A;  4LF4 Q;  2EY5 A;  2R7F A;  3TRZ A;  5EAY A;  3LX0 A;  2K6A A;  2OQK A;  3K0Y A;  4ZUI A;  4LF9 Q;  3C1E A;  1LTG D;  2A74 C;  1PFM A;  5COY A;  5EPK A;  4QGU A;  4QQB X;  3MXN B;  5C0X I;  1VQN A;  1X3F A;  3W1G A;  2R92 H;  2AQ1 B;  2NZH A;  3FPU B;  3S1Q H;  2J0T D;  5BR8 L;  5D3D A;  3RNU A;  4LFA Q;  1VDZ A;  3HOX B;  1QOH A;  3S17 B;  3J7A F;  3HOZ H;  1I6H H;  2O2L D;  3UI2 A;  1F9P A;  2IX1 A;  2OTJ A;  3DEO A;  1LT6 D;  4DPG A;  3K8A A;  2UXB Q;  3S1N B;  4K2L A;  5GRO A;  4BY7 B;  2PYK A;  3AYH B;  5CV6 A;  3RD4 A;  3WWV A;  2ATW A;  2P5Z X;  2JA7 B;  3I56 A;  1OXS C;  2QEJ C;  1X56 A;  3BZC A;  4FO2 A;  2NWG A;  4ZKB B;  3TN2 A;  4G57 A;  4DR6 Q;  3R93 A;  5JJZ A;  4GN5 A;  3Q6S A;  4ODG A;  4GKJ L;  4HMI A;  2A5H A;  3A5Z B;  4IUU A;  2EYH A;  2WAQ B;  3V05 A;  3M4Q A;  1VQH A;  2Z6K A;  1BVS A;  2NUC A;  3CXC A;  1DJR D;  2UUC L;  2RKS A;  5ELB A;  4WJW A;  3R2T A;  1IBL Q;  3KUP A;  4DAM A;  3SK6 A;  2B2U C;  3U4V A;  1N36 L;  1HR0 Q;  3G48 A;  4X3T A;  4C3I B;  3J80 L;  1TII D;  2E2I H;  3K0X A;  5IOD A;  1Q81 C;  3U4Z A;  2CCZ A;  4JI0 Q;  1VQ8 A;  4JI6 L;  3K5M A;  1A15 A;  4CDF C;  5IGD A;  1STG A;  4U68 A;  5C4H A;  1YHQ A;  4Y7N B;  1PHJ A;  3PUZ A;  1NBW A;  3UDX A;  2AQ3 B;  2EYP A;  3TP8 A;  2F03 A;  1PDQ A;  2K75 A;  4ZYS A;  2EXD A;  4PNY A;  1HR0 L;  1EIG A;  1Q12 A;  2EYJ A;  4K5X A;  5JJI A;  1SMY C;  3K80 C;  3J81 L;  1QVF A;  1E1T A;  4NB3 A;  2BH8 A;  3OSO A;  4NDX A;  4PZ7 A;  4FF4 A;  1VQM A;  1QJO A;  3L7Z C;  2K33 A;  2A6E D;  1I50 B;  1PRT C;  5JEA H;  1PFS A;  1Q82 C;  4JCV E;  2JQO A;  1D5Z C;  1OXX K;  2KA7 A;  4EX5 A;  1EQT A;  3K58 A;  1SRO A;  5DM6 3;  4JC0 A;  5HGQ A;  1NMG A;  3LNN A;  2R92 G;  4DV5 L;  4DR3 Q;  4JI4 L;  3GV3 A;  2B2U A;  4TKO B;  2ZTC A;  2A73 B;  3SE0 A;  4QB4 A;  2B2W A;  2L55 A;  2B63 H;  1CHP D;  1XWE A;  4YCV A;  4A3F G;  4DR7 Q;  2ZTE A;  4KD3 A;  2A8V A;  1AP0 A;  4UY8 C;  3M3Y B;  1TWF B;  2WB1 E;  4WOR A;  2MP1 A;  4NMZ A;  2B8F A;  3FMC A;  3MHB A;  4DV5 Q;  4LF8 Q;  2VB2 X;  3J81 c;  5AFW A;  1HFG A;  4A3L G;  1XNQ Q;  1FJG L;  4HMJ A;  1VQ6 A;  4BA2 I;  1BDO A;  5FO8 B;  1Y1V G;  1UE5 A;  2A6H D;  3SK8 A;  1QE6 A;  4B3R L;  3NTH A;  3OWE B;  1TY2 A;  1TR5 A;  4K14 A;  4CJ0 B;  1X32 A;  4K5W A;  5M5X B;  1XMO L;  2UXB L;  3PO2 H;  1JOQ A;  1GJX A;  4DV6 L;  1H9R A;  4IJH A;  1ENA A;  1XTC D;  2M00 A;  1X55 A;  4KHP Q;  4RG1 A;  1E2Z A;  4DA2 A;  1SNQ A;  5IIF A;  2F0T A;  1PH9 A;  1WYD A;  4MTN A;  3JAM L;  2JA5 B;  1NCV A;  1KAA A;  3PO3 B;  3C46 A;  3NEL A;  3OIQ A;  2IJ0 A;  2O4X A;  1RTN A;  2JA6 B;  1IBM L;  5T1I A;  1C9O A;  4EQP A;  1PTO D;  4PZ6 A;  2EPB A;  1KLU D;  1QNU A;  3S9W A;  2HCC A;  3OMC A;  1L0X B;  2E2I B;  3AQQ A;  4KHP L;  4QL5 A;  2K01 A;  1DOL A;  4LFA L;  1Q1E A;  4V0B A;  4IO9 A;  4P74 A;  4OHJ A;  3EVQ A;  3I4N H;  5FJ8 H;  4QUF A;  4A3E B;  1SMY D;  2Q2U A;  4JI6 Q;  3CF5 A;  3CC2 A;  3A74 A;  1O7Y A;  1F9S A;  1BCP D;  3T1Y Q;  3EN2 A;  1KC8 C;  2RHQ B;  3I4N B;  3VDY A;  2VQE L;  1PV4 A;  1XJV A;  1W6J A;  2VS1 A;  4OWX B;  1PZK D;  3ERQ A;  4KHZ A;  2BA0 A;  3I4M H;  2NVX B;  4DUY Q;  2DJF C;  3TZU A;  4JVZ A;  1SNP A;  3K7U C;  3QG1 A;  4RMF A;  5LMN Q;  3GTG B;  2EY2 A;  2ENB A;  1WD1 A;  2UU9 Q;  1KAW A;  1SN8 A;  2A68 C;  3A5U A;  1G29 1;  4P75 A;  1K8G A;  4CDE C;  5C3E G;  3HRZ C;  4KY6 A;  4MHE A;  1NMF A;  1Y1W H;  3S1M H;  5C4J B;  4QCL A;  4JBM A;  2WAQ G;  1R9T H;  5GAE C;  3UDF A;  1QVC A;  1I5F A;  1AE2 A;  1PMR A;  1HNX L;  2WV6 D;  4KTA A;  5I6W A;  1T5E A;  1Q7Y C;  1EWI A;  3CD6 A;  4ILW A;  3J7A 5;  2G5D A;  1VQ9 A;  4B3M L;  4IN3 A;  1SFO B;  1KNE A;  1SR3 A;  1K8A C;  2Y0S G;  3HKZ E;  2EQS A;  4RWS C;  1NAP A;  1Y1V B;  5DEH A;  5IYC G;  2B2V C;  2IWH A;  4HAE A;  4BY7 G;  3MWY W;  2D0P A;  4C3J B;  4KY7 A;  1VQD A;  1B1Z A;  3MAQ A;  1Q8K A;  1EIF A;  1ML0 D;  1CUK A;  3VYS A;  4R8I A;  1V1P B;  1EFI D;  1JIC A;  3FKI G;  2I5M X;  4JI8 Q;  1ICW A;  2L11 A;  5IOC A;  3MTS A;  4UP9 A;  1IXR A;  3CCR A;  3S2H B;  3QOJ A;  1PH4 A;  3K57 A;  4XDX A;  1V1P A;  1TWH H;  2MUY A;  4R1J A;  4I7Z C;  2OEO A;  4N8F A;  1NJI C;  2ES2 A;  2BCO A;  1LYL A;  4LF9 L;  4S3S A;  3HOU H;  3GTP B;  2MO0 A;  3D4W A;  1DZ1 A;  4A3I H;  2JXM B;  4P2C B;  3CKI B;  3ERS X;  1HNZ Q;  3HOY B;  3W1B A;  2VB3 X;  2AKW B;  2HT1 A;  3H3V H;  1VS0 A;  1IHZ A;  4RCO A;  2UXD Q;  1EL0 A;  1ASZ A;  3NQT A;  1I94 Q;  2Q8T A;  4HIO A;  3H94 A;  5IY0 A;  1CZG A;  3STB C;  1EY7 A;  1Z47 A;  5C3X A;  1ET6 A;  1L1O A;  2EE1 A;  3OWF A;  4BY7 H;  1TWH B;  4L5T A;  5M5W H;  4DK3 C;  3TQY A;  1ZYR C;  3B6Y A;  1VQP A;  1HNZ L;  4XQQ A;  1MI2 A;  2ZJR A;  4FVM A;  3RZO B;  1VQK A;  5LMU L;  1YNJ C;  1SXT A;  4ULL A;  1ENF A;  3OW7 A;  3NWS A;  3KLW A;  4GKJ Q;  3HOX H;  3U58 A;  4BY1 B;  1C0A A;  4FXG C;  5IGB A;  2EYO A;  4K6D A;  3S1Q B;  4QJF A;  3TEH B;  3VR6 A;  3D4D A;  1Y1V H;  1VCI A;  1A6X A;  2PMZ B;  1U9R A;  1L0Y B;  3HOU G;  4BBS H;  4JV5 L;  1WTH A;  1PFN A;  2SDF A;  4NKL A;  2KCC A;  4B3T Q;  1EWH A;  1I4R A;  1EQV A;  1F2Z A;  2C5C A;  1N8R C;  5I6Y A;  1TWG B;  1BXT A;  3CU7 A;  1S5B D;  4G7O C;  4IUR A;  2ZXO A;  3D0F A;  4MTK A;  3S15 H;  3BJU A;  3OPO A;  1ESF A;  3C3L A;  1QB5 D;  5C44 H;  1H9J A;  5LL6 S;  4JYA Q;  4B3T L;  1JWU D;  1VQG A;  3SDZ A;  3ONA B;  3J7Y W;  1EY9 A;  2NN6 H;  4KKU A;  1ET9 A;  3TBI B;  4FDB A;  3J81 i;  3GTO B;  4M1U B;  2I07 B;  1I4H A;  1J5E Q;  5FLX E;  3J80 E;  4DR2 Q;  1SE2 A;  2E2J B;  4H13 C;  2K03 A;  2IL8 A;  2JA8 B;  4A3G G;  1EEF D;  3CQZ B;  3RZD B;  3G6J B;  4DAY B;  1SE4 A;  1PTO B;  2N8N A;  5CBA E;  3I4N G;  3RN5 A;  4DAV A;  2ICI A;  3CPW A;  2WKD A;  1KIX A;  1EQR A;  2F0L A;  5JVH 3;  2PQA B;  3J81 E;  4DV7 Q;  4EVO A;  5IYD H;  3QOL A;  1I4G A;  1SE8 A;  3WOE A;  4EQO A;  3M85 A;  4J1M A;  4A3J H;  5KYI A;  4ZUJ A;  4F8M A;  4GNX A;  2QDB A;  3H09 A;  2VZA A;  2VUM H;  4A93 B;  1C48 A;  5ELF A;  1KDB A;  2PQE A;  3K7A B;  3F2D A;  2NVY H;  4LF8 L;  3Q23 A;  3KBX A;  4JI3 L;  2F0K A;  1BOS A;  4XXE A;  2PW5 A;  2LMC B;  5GQO A;  1S40 A;  3NP8 A;  3VYR A;  2OTL A;  1EYA A;  1LTR D;  2NN6 G;  5JJL A;  1WJJ A;  1I94 L;  4LFC Q;  1F2L A;  3I4O A;  4BBR B;  1ENC A;  4RKB A;  2BDO A;  1IYJ B;  5IYB H;  3BS1 A;  4X65 Q;  3PO2 B;  3X3N A;  1BQQ T;  1PVO A;  2D9U A;  2R7Z G;  1JC7 A;  2L15 A;  1SYG A;  4A3G H;  3E9H A;  3PIP 3;  5M3F B;  3A55 A;  3VA7 A;  4GLV B;  4JI8 L;  2O5I C;  2F0W A;  2FMC A;  2KEC A;  1E7Z A;  3ULJ A;  1G6P A;  3NXW A;  5ELE A;  4A3D G;  2WP8 J;  1OO9 B;  4XYO A;  4LF4 L;  4R4T A;  3PV0 A;  1TT2 A;  2Y0S B;  1STH A;  1MJE A;  1HZB A;  2EVB A;  3MFY A;  4BY1 G;  2KHJ A;  4A3M H;  3X3M A;  1PRT D;  2HIV A;  1IL8 A;  3PUY A;  4OWW B;  1EYC A;  2NVY B;  2OWO A;  2L1B A;  1KDC A;  1B53 A;  2GN5 A;  1WCM H;  1J8I A;  2F0F A;  4UP7 A;  4R4Q A;  3CC7 A;  4RA8 A;  1LM0 A;  1S3O A;  4AH6 A;  4GNX B;  3M4O B;  3CCQ A;  2WAC A;  2NZO A;  1V8Q A;  1QCB D;  1STN A;  1SBB B;  3W2D A;  2YU9 B;  4IPG A;  3BU2 A;  2JN4 A;  3PSI A;  3T56 B;  2NBF A;  5M9O A;  1PH2 A;  1I6H B;  1SYF A;  1TS4 A;  2SNM A;  3KF6 B;  2R92 B;  2VL6 A;  4JBJ A;  1A3U A;  3VA5 A;  4K8J A;  2D0O A;  4YIJ A;  2AUK A;  2F0Q A;  3P20 A;  3CAM A;  5LMU Q;  1TS5 A;  5EPJ A;  4Y52 H;  4XQJ A;  4RFB A;  1FNU A;  3CP0 A;  3E0E A;  3KJO A;  4OWT B;  1SYD A;  3EQL C;  4IQZ A;  4JI2 Q;  4JI7 Q;  4U67 3;  2JA8 G;  4H0L C;  2CWA A;  4B3S Q;  1SLJ A;  3J81 j;  1UE1 A;  1EQQ A;  2X6L A;  2GA4 B;  1WTR A;  1YZ6 A;  2X69 A;  1GXD C;  3TS2 A;  2FXQ A;  1E22 A;  1WTO A;  2CW0 C;  4O1N A;  1DXM A;  2F0H A;  2E8G A;  4A3E G;  2NVX H;  4HSV A;  4YCU A;  1LTS D;  5FLX L;  4ABN A;  3U9O A;  4DR1 Q;  1S4Z A;  4XT1 B;  4A3L H;  1JJC B;  1ZKO A;  1D7Q A;  3OHX C;  1A8V A;  3GTL H;  1V1O A;  3PF4 A;  5T1G A;  4C56 C;  1TWG H;  2NN6 I;  5I9O A;  4CKB A;  4DV2 L;  1DOM A;  2L4N A;  3EFX D;  1MJC A;  5IYD G;  1I50 H;  1SYE A;  2LY7 A;  4R4O A;  3Q8D A;  1LT3 D;  2M2L A;  2F52 A;  3DM3 A;  3A8J E;  2HIX A;  3MXG A;  3STB D;  1YEZ A;  2E2H B;  4JI1 L;  2AMC B;  2LS0 1;  3HOV H;  5I2Y A;  1QZH A;  1N32 L;  3BVM A;  2EYF A;  1YIJ A;  4CJ2 C;  5ELN A;  1B3Q A;  2KCM A;  1L0W A;  1MSG A;  3PCO B;  2B2Y A;  4P73 A;  1EOV A;  3NEM A;  3S1M B;  1G91 A;  1WI5 A;  5C6A A;  1FGU A;  1NE3 A;  4DAP A;  2F3V A;  2UUA L;  1NNX A;  2PZU A;  3NE5 B;  1ILQ A;  4DUZ L;  1EY0 A;  1CSQ A;  4MZ9 A;  3HOY H;  2UXC L;  4IPC A;  1L2F A;  1K0R A;  3S1R B;  3PMF A;  4RCN A;  1ROD A;  2YYZ A;  3AFP A;  1HJP A;  1N32 Q;  1ONL A;  4K2K A;  4IOA A;  5IWA L;  5M5W B;  1II3 A;  2ID0 A;  4OIJ A;  1FJG Q;  1KRS A;  1JQY D;  1UEA B;  3MA2 B;  2Q2H A;  2VQF Q;  4AYB G;  2JK8 A;  3VYT A;  4OON A;  3WDN A;  2F0D A;  3NPP A;  2MPM A;  1I4Q A;  4DNI A;  3RLF A;  3S24 A;  4BY1 H;  3T53 B;  4JOI A;  1Y14 B;  2VUM G;  2RF4 A;  4AYB B;  1EIH A;  2L5T A;  1PZJ D;  1U4L A;  2ZTD A;  1X3P A;  4A3I B;  4O0A A;  5CGK A;  3HOV G;  4FXD A;  2YV5 A;  1LO5 D;  3KDF A;  5C4Z A;  3MXU A;  4UAI A;  5BR8 Q;  3S2D B;  1EY5 A;  4FYD A;  4QIW E;  3H3V I;  4ZKC B;  4A3K G;  3FKI B;  2RDF A;  5CC4 A;  4ALP A;  1WOC A;  1T9H A;  3SHL A;  2JP1 A;  4FNF A;  2K5N A;  1AFP A;  4RKL A;  5J39 A;  3MEF A;  5NUC A;  3RUZ A;  1TU2 B;  4JI7 L;  2WII B;  1LTI D;  2ZM6 L;  3HS0 C;  4KK7 A;  4F88 A;  1PZI D;  3GTP H;  4RGN A;  1KRT A;  5CMD A;  4EGV A;  4ZCK A;  5IGC A;  3I72 A;  1V9P A;  1AN8 A;  5M5X H;  2HQE A;  5IP9 H;  1SAP A;  3MC0 B;  5GAD C;  2Z6B A;  4R9W A;  3KBG A;  3SVM A;  1IKM A;  2JSO A;  4Q0F A;  4K8I A;  1DON A;  1X65 A;  5C3E B;  1YJN A;  1N9W A;  2EYM A;  3R3O A;  4DV0 Q;  1J5E L;  3VYU A;  1TVX A;  1FVI A;  1B70 B;  2LFN A;  1UWV A;  5FKA C;  1JB7 A;  4LUV A;  5C0X J;  1UEB A;  3HOW H;  1B9N A;  4YHH Q;  2QF7 A;  2KEE A;  3QIA A;  3LWE A;  3Q0A A;  2F0E A;  4PMC A;  2B3G A;  1O7L A;  1BNZ A;  1E24 A;  3M3Y H;  1UNS A;  3PIO 3;  2MHV A;  4C3I H;  3IFT A;  1QUQ B;  2NB0 A;  5COR A;  1GUG A;  4GLA C;  3T4A C;  2F0G A;  5D3I B;  2Z6K C;  4DR5 L;  4QMG A;  2KQ3 A;  1YJW A;  1A2T A;  1LAB A;  1EY8 A;  1EY4 A;  1HNX Q;  1A0I A;  3BVG A;  3A7L A;  1G6Z A;  3CQZ H;  2K5H A;  3L9A X;  1K83 B;  2QDL A;  2CQO A;  2UUA Q;  1GHK A;  2IX3 A;  4B9X A;  3G7L A;  3NHH A;  3ULL A;  2XSC A;  1W3S A;  5C3W A;  1H9S A;  1U4P A;  1Y8O B;  1G51 A;  3I91 A;  4K0K L;  2K5V A;  4L8J A;  5IGG A;  1SE3 A;  3FHW A;  3FDT A;  1MHW C;  2BA1 A;  3C1F A;  3CCS A;  1NUC A;  1X3Q A;  1HQM C;  2A19 A;  2DNE A;  1JJ2 A;  1YNN D;  2Y0S E;  4J8Q A;  4A76 A;  3ND8 A;  4N8X 1;  3GTM B;  1K8M A;  3HOW G;  2QGQ A;  2VQF L;  1Q86 C;  1VQL A;  4QY7 A;  1BCP B;  4OO1 G;  3I73 A;  2JA5 H;  2Z9H A;  2WAQ E;  5KGU A;  3CCU A;  4IUQ A;  4KD4 A;  1EFW A;  1YHB A;  3URY A;  1EY6 A;  3LGJ A;  5EQ0 A;  1QG7 A;  4BXX H;  1HUM A;  1VQF A;  2CW0 D;  3ITP A;  2OXP A;  2K14 A;  3ICE A;  1PH6 A;  1VQ5 A;  1YI2 A;  5FOB B;  2PI2 A;  4DUZ Q;  4A3J G;  1JWS D;  3QJY A;  5C44 B;  2HDL A;  4ZK9 B;  1DD2 A;  1HA5 A;  3DWA A;  2EDG A;  3TSS A;  4KJO A;  3VR5 A;  4O2D A;  4OXP A;  3PO3 H;  3FP9 A;  4DV6 Q;  1Z7T A;  1XYI A;  4X3S A;  3SEB A;  1HPC A;  2QA4 A;  2UUC Q;  3Q22 A;  3GTJ H;  3GTM H;  1WVL A;  4POF A;  1RD9 D;  2BDN A;  1WCM G;  2KEN A;  5EBD A;  4A3F B;  4IFD H;  1F2Y A;  5GAG C;  1AZP A;  3J7A V;  3KYH C;  3KK7 A;  5M3F G;  3CW2 C;  2JEB I;  3HZX A;  3I55 A;  3HOV B;  2R7Z B;  1B4O A;  1TQO A;  3TZD A;  3PF5 A;  3SXH A;  5IT9 L;  5HUR A;  3PGZ A;  1NSN S;  1D6E C;  1N34 L;  1I4P A;  4IAL A;  2K4K A;  2A68 D;  1U4R A;  4NXN L;  1S72 A;  1R9T B;  3AMU A;  1FD7 D;  2N3S A;  1K28 A;  3PQI A;  5M5Y H;  2ZXP A;  1VQE A;  1SNO A;  1JWM D;  2CHB D;  2HD3 A;  3CPF A;  3AB9 A;  1XX8 A;  3CHB D;  4LF6 L;  3OYY A;  1PLF A;  2MGS A;  4YHH L;  3DWQ A;  4JI5 L;  2M9V A;  1Z6H A;  1EYG A;  2HQL A;  5K36 H;  3I70 A;  2LSS A;  1KL9 A;  2CKZ B;  5FLM G;  4L63 B;  3D8G A;  5JJK A;  4L5S A;  5J1Z A;  1TXY A;  1EU3 A;  2EJG C;  2F0N A;  1PTO F;  1CQV A;  4X6A H;  2MFI A;  4R4C A;  1SEB D;  3D6W A;  3NTI A;  2Q8I B;  1STA A;  3GTJ B;  1GKH A;  4LF6 Q;  3JC6 6;  3J7Z C;  1E3P A;  3H3V C;  4KJN A;  3ULP A;  1CKM A;  1CKN A;  1ZEQ X;  2F3W A;  5CV5 A;  5KNC A;  2RBM A;  2JYO A;  1PXU A;  3H0G B;  4A3K H;  1NR4 A;  2FMM A;  3OTO L;  1V43 A;  2WFW A;  3RLN A;  1FGB D;  2JA7 H;  4DR4 L;  4CGY B;  3I4M B;  4BXX G;  4DFA A;  2QEX A;  3UDI A;  2WIN B;  2F4V Q;  3GD7 A;  3DMU A;  2EXZ A;  1F9R A;  2I5H A;  3OMG A;  4X64 Q;  4IJL A;  2Q2T A;  1F9Q A;  1YIT A;  1XNQ L;  5C4J H;  4XTC S;  1Y1W B;  3T16 A;  3M9B A;  3G71 A;  3IAY A;  5ELD A;  3VR3 A;  3AU7 A;  1Y69 U;  1STE A;  4FXK C;  4EQN A;  4KN4 C;  3OTO Q;  3A8K E;  4R8N A;  1VMP A;  1Q3L A;  2B8G A;  1JE5 A;  1W6K A;  5FJ8 G;  4X66 Q;  2EJM A;  1BCP C;  2FIN B;  1PH1 A;  1BKB A;  3K5O A;  2ZXR A;  1ILP A;  1HZA A;  1GHJ A;  1C7Y A;  2L12 A;  2A1A A;  1CK1 A;  4K5V A;  3K5L A;  5DAU A;  3GV6 A;  2RDG A;  4IUP A;  4A3C H;  2B2T A;  3NTK A;  2IY5 B;  4A3M B;  1HH2 P;  1JOR A;  4O42 A;  4JK1 C;  4ID6 A;  1XMQ L;  1TWA H;  4X66 L;  4LFC L;  4IPH A;  1CA5 A;  1PTO H;  1EZ6 A;  3D3R A;  1YNX A;  2HHH Q;  2OQ0 A;  4X65 L;  5KRU A;  3IKJ A;  2RCN A;  1EZ8 A;  3GO5 A;  2I5L X;  1P16 A;  3J80 c;  2IW3 A;  4A3G B;  3OOC A;  2K28 A;  4OX9 Q;  2PNR C;  2ZJP A;  3T51 B;  2R7Z H;  3A54 A;  4CBV A;  5M3M B;  1I4X A;  2JJQ A;  1TY0 A;  4DXG A;  2WB1 G;  3D31 A;  3BZK A;  1JB3 A;  2RA4 A;  1BBU A;  2EY6 A;  3KLR A;  3CC4 A;  3O13 A;  1T5X D;  2LKV A;  4IUV A;  2IT1 A;  1M8A A;  3LWU A;  3V2T A;  4C3H B;  2VQE Q;  4HJA A;  4NXN Q;  5EKK A;  4OX9 L;  4IFD I;  3NBI A;  3E6Z X;  1CT1 D;  5DLQ E;  2IHE A;  3ND9 A;  4A93 H;  1XPO A;  1O80 A;  3HOY G;  2I0Q A;  1OTC A;  4J6H A;  1Q1B A;  3DM1 A;  4RGM A;  4IUT A;  4LUO A;  4YCW A;  2C9O A;  5IE8 A;  2UU9 L;  1RIP A;  5KYL A;  5IT9 E;  2RCF A;  1CZW A;  3TDQ A;  4LFB Q;  4WRD A;  1RKN A;  4C3J G;  2Z8L A;  4DV0 L;  4Z9C B;  4PG3 A;  4DF7 A;  5C4X G;  1BCP F;  1G8Z D;  2J7Z A;  2ASB A;  1U0L A;  2Z0S A;  3W5O A;  4M8A A;  5IP7 H;  3J80 i;  3CMA A;  5H1S E;  1HZC A;  1XXG A;  3BZD B;  2RVL A;  2K7V A;  5TSS A;  4LFB L;  3RN2 A;  4B3S L;  1MBY A;  4FF3 A;  2PO4 A;  3KF6 A;  1IBL L;  3I3C A;  1IYV A;  3S14 B;  3S2D H;  5CR3 A;  3PIO A;  5I4D A;  3HKZ B;  3GDE A;  1P8L A;  2VNU D;  2I46 A;  1IL2 A;  2MO1 A;  3BDO A;  4WJ3 M;  4DNR B;  4R4I A;  1K83 H;  4BBR G;  4JW0 A;  3WOF A;  3SR1 A;  1X9N A;  2MJ8 A;  1PH7 A;  4H02 A;  5BN5 A;  4A75 A;  4A93 G;  2JA9 A;  3I7F A;  3P75 A;  1FNV A;  2NTS A;  3BVZ A;  4DV4 Q;  4LJZ C;  4DAY A;  4N9P A;  1BUV T;  3HOU B;  4LK1 C;  3GTL B;  1A62 A;  4C3H G;  1QVG A;  2IPK D;  1OXV A;  2C35 B;  1CA6 A;  1VQJ A;  1IYU A;  1LTL A;  3F2B A;  1SJH D;  3NSW A;  1X3E A;  1VQO A;  4KMU C;  2VW9 A;  2EIF A;  1PRT F;  5KEE A;  2NVQ B;  2B2W C;  2BH2 A;  2JE6 I;  1M90 C;  3EA6 A;  5D65 A;  2KCN A;  4CKC A;  4JI1 Q;  3UDG A;  1K73 C;  2DJG C;  3RZO H;  5AJ3 Q;  1LLR D;  2B2T C;  2QIL A;  4XT3 B;  5FO9 B;  2AQ2 B;  3NQI A;  3FRP B;  1K3R A;  2HHH L;  4HIK A;  2PI2 E;  4RH6 A;  1HQR D;  1S5D D;  4LUZ A;  2H1E A;  4JI3 Q;  3TME A;  3K81 C;  4YY3 Q;  2A6E C;  3E5S A;  4AIM A;  1FR3 A;  1MIU A;  2V1C C;  4H44 C;  3BYY B;  3ZJY C;  2JA5 G;  2ZT9 C;  1F2M A;  1PH5 A;  3T13 A;  1Y1W G;  4HN7 A;  4KKS A;  2F0J A;  4P72 A;  1WTQ A;  2RSN A;  1IBM Q;  1O78 A;  1STY A;  4IOC A;  3T1H Q;  1H95 A;  2E2J H;  4C1N K;  4E6I A;  4YY3 L;  2QKI C;  1E2W A;  3U50 C;  4GS3 A;  4RHS A;  4ZRZ A;  4DKA C;  2YTV A;  3EBE A;  2F4I A;  3NBH A;  5IGF A;  3S14 H;  1BO0 A;  4OGQ C;  5JPM C;  1EOT A;  2E5L L;  3GTG H;  2XRS D;  1JMC A;  3S2H H;  5EBC A;  4HCE A;  3S1N H;  3PUW A;  3TP7 A;  1TWC B;  4PZ8 A;  3QB3 A;  2PZT A;  3FPP A;  4IZ8 A;  1ASY A;  4JBK A;  1D5M C;  2K52 A;  4A3C G;  3QO2 A;  4A3B B;  5JOB A;  3GTQ H;  3HEJ A;  5C44 G;  4GOP B;  3H0G G;  5E1F A;  5C5M A;  3F2U A;  3CCL A;  3RMH A;  2EOT A;  1X3G A;  3CME A;  3CRK C;  1WTV A;  1GO3 E;  4MN3 A;  5M3F H;  4C2M B;  1QIL A;  1I6V C;  1CQF A;  2Q2I A;  4IPD A;  1SYC A;  1VQC A;  1D8L A;  1QWY A;  2FFK B;  4QF4 A;  5K5P A;  4F7X A;  3DHQ A;  4XYQ A;  1HCZ A;  2XTI A;  4N9T A;  5HY6 A;  2F0V A;  4QUC A;  3E0J A;  4HJ7 A;  1B9M A;  3FVQ A;  5EJW A;  1JT8 A;  2K50 A;  1E0B A;  3RLO A;  4GLX A;  1Q90 A;  3CCM A;  1U4M A;  4I65 A;  1NY4 A;  1JR0 D;  2H4O A;  1HNW Q;  4OO1 I;  3JAM c;  1FNW A;  4A3I G;  4MIU A;  3N52 A;  2RSO A;  3T1Y L;  5K36 G;  5ELC A;  4KN7 C;  2R7D A;  3K7A H;  5FLM H;  1TS3 A;  1CHQ D;  1ICF B;  3NBH B;  1IW7 D;  4X3K A;  4DR4 Q;  1GD7 A;  2OT2 A;  1J6Q A;  1UE7 A;  5D14 A;  4B9W A;  1AW7 A;  3BYT B;  4DUY L;  4G4K A;  4BBR H;  3TRE A;  3D6C A;  4C2M H;  3TS0 A;  3HKS A;  2A69 C;  3KJP A;  1LTT D;  4DV1 Q;  1FYC A;  1CKN B;  1DOK A;  1HR0 W;  1PYW D;  5LMN W;  1MKH A;  1EU4 A;  2FJ2 A;  4DK6 C;  4DR7 L;  2N88 A;  4CDD C;  1EUJ A;  1HFN A;  3PUV A;  1SYB A;  1N33 L;  2DNC A;  4DK1 A;  5AJ3 L;  1YBY A;  4WJ4 A;  1EEI D;  2N49 A;  3CCV A;  5C3E H;  2B39 A;  1FL0 A;  3KDF B;  2D2C C;  3P7J A;  1TWC H;  3G4S A;  3NEN A;  1SSO A;  1SRU A;  3KF8 A;  2PCF B;  4GN4 B;  2VY3 A;  3AEV A;  4DV7 L;  5FO7 B;  4B3M Q;  2F3I A;  4RGT A;  1WFQ A;  4EQ5 A;  4HID A;  4LNQ A;  4DV4 L;  2G9H D;  3ZYY X;  2D5D A;  2JA6 H;  1ESR A;  1XNR L;  1HHV A;  2N55 A;  4JBW A;  1B2T A;  4B3R Q;  1XMQ Q;  3JAM E;  1M4V A;  4I7A A;  1XMO Q;  4MNO A;  3E3X A;  2LXJ A;  2JA8 H;  3T1H L;  1HTP A;  2K5W A;  4DK0 A;  2R93 G;  4ZLT F;  3GTK B;  2XIW A;  1SFO H;  5A35 A;  2DN8 A;  4NW2 A;  3VR2 A;  4CKE A;  2RHS B;  1PFB A;  1VQB A;  3FKI H;  2JA7 G;  4GKK Q;  3KLS A;  3IL8 A;  4KY5 A;  1I3Q H;  4C1N I;  4A3F H;  3CRL C;  2IX0 A;  5BN3 A;  2CQA A;  1B7Y B;  3A8I E;  4C3H H;  1A2U A;  3K59 A;  3DUZ A;  1KQS A;  4H7B A;  1CM9 A;  2PPB C;  1KLG D;  1VQI A;  2F0I A;  4GKK L;  1NTG A;  5J3B A;  3RR5 A;  1U5K A;  3GTO H;  1Y8N B;  4ZAI A;  2JA6 G;  3F8T A;  1J9O A;  1LAC A;  4DU9 A;  3DWP A;  3PO3 G;  1JCK B;  5E4X A;  3HFZ B;  5KIX A;  1HUN A;  2L0C A;  2R93 B;  4LW1 A;  2E5L Q;  3HG9 A;  1VQ4 A;  3HGB A;  1YVC A;  2HCI A;  1L1O B;  5E7N A;  1GVP A;  1TWA B;  5DM7 3;  2JEA I;  4JYA L;  2EY1 A;  2ZJQ A;  2TSS A;  4HJ9 A;  3MFG A;  2K5Q A;  3K5N A;  1RF2 D;  3HKZ G;  3MEH A;  4FF2 A;  1PYS B;  1WD0 A;  5JPN C;  2BOS A;  4A3D H;  1EWC A;  3EIV A;  1S5C D;  4JI5 Q;  1UAP A;  3QR8 A;  5C4X H;  2O5J C;  1HTL D;  4APV A;  3I4L A;  4YWL A;  2NVQ H;  1XTD A;  1C4Q A;  5C4X B;  1M1K C;  2QCP X;  4TQU S;  2ALY B;  1PH3 A;  1DGS A;  3NUC A;  4PV1 C;  4DXF A;  1PH8 A;  4A3D B;  5CYU A;  3A0J A;  4A3B G;  2XRQ D;  3P1H A;  4NPS A;  1D1I A;  4BWG B;  4ME3 A;  2E2D C;  4KHV A;  3H91 A;  2PNH A;  1RHP A;  1JOK A;  5G3L D;  4A3K B;  1V1Q A;  3S1R H;  4RAU C;  2YTY A;  3L0O A;  4JG2 A;  3VR4 A;  4F87 A;  3MXP A;  4LF5 L;  3MZ5 A;  1VF5 C;  1Z9F A;  5CV7 A;  1UUP A;  2F4V L;  1K0S A;  3PUX A;  3HOW B;  3EJI A;  1X54 A;  1B3A A;  1D2B A;  2DY8 A;  2EJF C;  3SK4 A;  2VUM B;  5BN4 A;  1W2B A;  1YHA A;  2A6H C;  3TP6 A;  2XN9 C;  3IRB A;  4XIG S;  1B8A A;  4G7Z C;  4TSS A;  3QWN A;  2HUG A;  5EKL A;  2E2H H;  4LF5 Q;  4WFN 3;  3A56 A;  1VQ7 A;  3H6M A;  2E76 C;  3I8Z A;  1N33 Q;  1G2S A;  2K5D A;  5KNB A;  1G2T A;  1R4P B;  2XVS A;  1E2V A;  2XNA C;  3N6R A;  2B2Y C;  5L37 A;  3I90 A;  1XPR A;  4TVA B; 
#chains in the Genus database with same CATH homology
 4NP5 A;  1B44 D;  1S5F D;  2XWJ B;  4HSP A;  1MSH A;  1GUN A;  1CFM A;  5LHY 1;  1BF4 A;  1SJE D;  3GQB A;  1LTA D;  3NK9 A;  5EGT A;  2G9D A;  4K6L A;  1H9S B;  2BE5 C;  5C5L A;  2WKC A;  5EPL A;  3S16 B;  1VF7 A;  3M4Y A;  2R3Z A;  4C3I G;  2PZW A;  2A69 D;  1RTO A;  1LV9 A;  1VMC A;  1F77 A;  4HR7 B;  1GOZ A;  4DNT B;  1TS2 A;  1I3Q B;  2NTT A;  1OXT A;  2E74 C;  2SNS A;  1IW7 C;  1DYQ A;  4V19 0;  1AEX A;  2AWO A;  3IFD A;  1GUT A;  5C0X H;  2Q8R E;  1CTM A;  3M7G A;  1RJT A;  2RDH A;  1H9M A;  2Z4H A;  2V4D A;  4G7H C;  2BE5 D;  5EKI A;  4CJ1 B;  1GUS A;  1DCZ A;  1WTX A;  1SND A;  1KNA A;  4ME5 A;  2KED A;  1D1K A;  4DGZ A;  5DNF A;  2F0M A;  2KHS A;  5CV9 A;  5IGE A;  4GZY C;  1PTO C;  1C8C A;  3HOZ B;  4PQX A;  1R4Q B;  2K04 A;  2AUJ D;  5CV8 A;  1LT4 D;  1HXY D;  1O7Z A;  1KDA A;  3TP5 A;  5E3F A;  4HCS A;  1LT5 D;  1GUO A;  4DN4 M;  2R6G A;  1KAB A;  4L6T B;  4HTH A;  4RGO S;  2KJX A;  3HP3 A;  4KV6 A;  1YNN C;  4OO1 H;  5C0X G;  2WB1 B;  1KTK A;  2F0U A;  2VXW A;  1DM0 B;  3S15 B;  1JOO A;  3Q24 A;  1HA6 A;  1IKL A;  1MD2 D;  5HGT A;  4KI0 A;  5A2Q L;  1MGS A;  3BDL A;  1BBX C;  1WTW A;  4A3J B;  2OF1 A;  5KND A;  4ZQ3 A;  3MXN A;  1RCV D;  4OL7 A;  2R61 A;  3MVV A;  3K6O A;  1SDF A;  1RDP D;  4BA1 I;  4FP5 D;  3R8B A;  4XQN A;  4IFD G;  2K1B A;  1STB A;  2L9H A;  2TMP A;  2PW7 A;  4BS9 A;  2X6G A;  4X3U A;  5G3L F;  3NWT A;  3U9S A;  2XWB B;  1Y8P B;  2J4X A;  2B2V A;  2D62 A;  1ZXT A;  4UDU C;  3DXJ C;  1H9K A;  3V96 A;  2KVM A;  3A7A B;  3D4R A;  5F2D A;  2EYL A;  5CBE E;  2NYZ D;  3KLS X;  2K05 A;  2K32 A;  4Q5V A;  5ISR A;  4IFD J;  5JEA G;  5JAV A;  1NR2 A;  1HRJ A;  2RQX A;  4FF1 A;  3DEP A;  3C2P A;  1SNC A;  2ICE C;  4B08 A;  1QNK A;  4RHR A;  2DY7 A;  2CVR A;  2F1M A;  2KOL A;  5E4W C;  4LMQ D;  2E75 C;  5I2X A;  1PRT B;  3BDC A;  4TRD A;  5J22 A;  5LL6 X;  5JVG 3;  1WCM B;  3M7N A;  2B63 B;  3R2I A;  1A3V A;  2AWN A;  1Q8I A;  1K8O A;  1GUW A;  2HDM A;  1WTP A;  2KUM A;  1JE4 A;  5JEA J;  2F0S A;  3L3O C;  2NZ1 D;  2SEB D;  5M5Y B;  4KKT A;  1BR9 A;  3GP7 A;  4QIW B;  1SNM A;  1YNJ D;  3BG3 A;  1ZYR D;  4CHT B;  1B50 A;  4OIK A;  1A3T A;  2NVT B;  1EYD A;  4LAA A;  2EZV A;  1AZQ A;  2FHT A;  2F0P A;  4HED A;  4IUN A;  2Z4I A;  3GTQ B;  1S5E D;  2SOB A;  5A2Q E;  1CI3 M;  1D5X C;  1TKW B;  1OXU A;  2F0O A;  4PMB A;  5CV4 A;  2Z1C A;  3FEW X;  4PMW A;  1LTB D;  5I9P A;  3ERO A;  3W3A A;  5FK9 C;  3OIP A;  4BBS B;  3SK5 A;  2EY5 A;  3LX0 A;  2K6A A;  4ZUI A;  3K0Y A;  3C1E A;  1LTG D;  2A74 C;  1PFM A;  5COY A;  5EPK A;  5C0X I;  2AQ1 B;  3FPU B;  2J0T D;  5D3D A;  1VDZ A;  3HOX B;  1QOH A;  3S17 B;  3J7A F;  2O2L D;  3UI2 A;  1F9P A;  2IX1 A;  3DEO A;  1LT6 D;  3S1N B;  4K2L A;  4BY7 B;  2PYK A;  5CV6 A;  3RD4 A;  2JA7 B;  1OXS C;  2QEJ C;  4FO2 A;  2NWG A;  4ZKB B;  3TN2 A;  4G57 A;  3R93 A;  5JJZ A;  3Q6S A;  4ODG A;  4HMI A;  2A5H A;  4IUU A;  2EYH A;  2WAQ B;  3V05 A;  2NUC A;  1DJR D;  2RKS A;  5ELB A;  4WJW A;  3R2T A;  3KUP A;  3SK6 A;  2B2U C;  3J80 L;  4X3T A;  4C3I B;  1TII D;  5IOD A;  3K5M A;  1A15 A;  5IGD A;  1STG A;  4U68 A;  5C4H A;  4Y7N B;  3PUZ A;  2AQ3 B;  2EYP A;  3TP8 A;  2F03 A;  1PDQ A;  4ZYS A;  4PNY A;  1EIG A;  1Q12 A;  2EYJ A;  4K5X A;  1SMY C;  3J81 L;  3OSO A;  4NDX A;  4FF4 A;  1QJO A;  3L7Z C;  2K33 A;  2A6E D;  1I50 B;  1PRT C;  5JEA H;  1D5Z C;  1OXX K;  2KA7 A;  3K58 A;  1EQT A;  5DM6 3;  3LNN A;  3GV3 A;  2B2U A;  4TKO B;  2A73 B;  3SE0 A;  4QB4 A;  2B2W A;  2L55 A;  1CHP D;  1XWE A;  4KD3 A;  1AP0 A;  3M3Y B;  1TWF B;  4WOR A;  2MP1 A;  4NMZ A;  2B8F A;  3FMC A;  3MHB A;  2VB2 X;  5AFW A;  1HFG A;  4HMJ A;  4BA2 I;  1BDO A;  5FO8 B;  2A6H D;  3SK8 A;  1QE6 A;  3NTH A;  3OWE B;  1TY2 A;  1TR5 A;  4K14 A;  4CJ0 B;  1X32 A;  4K5W A;  5M5X B;  1JOQ A;  1GJX A;  1H9R A;  1ENA A;  1XTC D;  2M00 A;  1E2Z A;  4DA2 A;  1SNQ A;  5IIF A;  2F0T A;  3JAM L;  2JA5 B;  1NCV A;  1KAA A;  3PO3 B;  3C46 A;  3OIQ A;  2IJ0 A;  2O4X A;  1RTN A;  2JA6 B;  5T1I A;  4EQP A;  1PTO D;  2EPB A;  1KLU D;  1QNU A;  3S9W A;  2HCC A;  3OMC A;  1L0X B;  2E2I B;  2K01 A;  1DOL A;  1Q1E A;  4V0B A;  4OHJ A;  3EVQ A;  4QUF A;  4A3E B;  1SMY D;  1O7Y A;  1F9S A;  1BCP D;  3I4N B;  1W6J A;  1PZK D;  3ERQ A;  4KHZ A;  2BA0 A;  2NVX B;  3TZU A;  1SNP A;  3QG1 A;  3GTG B;  2EY2 A;  2ENB A;  1WD1 A;  2A68 C;  1G29 1;  3HRZ C;  4KY6 A;  4MHE A;  5C4J B;  4QCL A;  1PMR A;  2WV6 D;  4KTA A;  5I6W A;  1T5E A;  4ILW A;  4IN3 A;  1SFO B;  1KNE A;  4RWS C;  1NAP A;  1Y1V B;  5DEH A;  2B2V C;  2IWH A;  4HAE A;  3MWY W;  4C3J B;  4KY7 A;  1B1Z A;  3MAQ A;  1ML0 D;  3VYS A;  4R8I A;  1V1P B;  1EFI D;  1JIC A;  1ICW A;  2L11 A;  5IOC A;  3MTS A;  3S2H B;  3QOJ A;  3K57 A;  4XDX A;  1V1P A;  2MUY A;  4I7Z C;  2OEO A;  2BCO A;  4S3S A;  3GTP B;  3D4W A;  1DZ1 A;  2JXM B;  4P2C B;  3CKI B;  3HOY B;  2VB3 X;  1IHZ A;  4RCO A;  1EL0 A;  3NQT A;  2Q8T A;  3H94 A;  1CZG A;  1EY7 A;  1Z47 A;  5C3X A;  1ET6 A;  3OWF A;  2EE1 A;  1TWH B;  1ZYR C;  4XQQ A;  1MI2 A;  4FVM A;  3RZO B;  1YNJ C;  1SXT A;  4ULL A;  1ENF A;  3OW7 A;  3NWS A;  4BY1 B;  4FXG C;  5IGB A;  2EYO A;  4K6D A;  3S1Q B;  3VR6 A;  3D4D A;  1VCI A;  1A6X A;  2PMZ B;  1U9R A;  1L0Y B;  1PFN A;  2SDF A;  4NKL A;  2KCC A;  1EWH A;  1I4R A;  1EQV A;  1F2Z A;  2C5C A;  5I6Y A;  1TWG B;  1BXT A;  3CU7 A;  1S5B D;  4G7O C;  4IUR A;  2ZXO A;  3OPO A;  1ESF A;  3C3L A;  1QB5 D;  1H9J A;  5LL6 S;  1JWU D;  3SDZ A;  3ONA B;  3J7Y W;  1EY9 A;  2NN6 H;  4KKU A;  1ET9 A;  3TBI B;  3GTO B;  4M1U B;  2I07 B;  1I4H A;  5FLX E;  3J80 E;  1SE2 A;  2E2J B;  4H13 C;  2JA8 B;  2K03 A;  2IL8 A;  1EEF D;  3CQZ B;  3RZD B;  3G6J B;  1SE4 A;  1PTO B;  5CBA E;  4DAV A;  2ICI A;  2WKD A;  2F0L A;  5JVH 3;  3J81 E;  4EVO A;  3QOL A;  1I4G A;  3WOE A;  4EQO A;  3M85 A;  4J1M A;  5KYI A;  4ZUJ A;  4F8M A;  2QDB A;  3H09 A;  4A93 B;  1C48 A;  5ELF A;  1KDB A;  2PQE A;  3K7A B;  3Q23 A;  3KBX A;  2F0K A;  1BOS A;  4XXE A;  2PW5 A;  2LMC B;  3NP8 A;  3VYR A;  1EYA A;  1LTR D;  2NN6 G;  1F2L A;  4BBR B;  1ENC A;  4RKB A;  2BDO A;  3BS1 A;  3PO2 B;  3X3N A;  1BQQ T;  2D9U A;  1JC7 A;  1SYG A;  3PIP 3;  5M3F B;  3A55 A;  3VA7 A;  2O5I C;  2F0W A;  2FMC A;  2KEC A;  3NXW A;  5ELE A;  2WP8 J;  1OO9 B;  4XYO A;  3PV0 A;  1TT2 A;  2Y0S B;  1STH A;  2EVB A;  3MFY A;  3X3M A;  1PRT D;  1IL8 A;  3PUY A;  1EYC A;  2NVY B;  2L1B A;  1KDC A;  1B53 A;  1J8I A;  2F0F A;  4RA8 A;  3M4O B;  2WAC A;  1V8Q A;  1QCB D;  1STN A;  1SBB B;  3W2D A;  2YU9 B;  5M9O A;  1I6H B;  3T56 B;  2NBF A;  1SYF A;  1TS4 A;  2SNM A;  2R92 B;  1A3U A;  3VA5 A;  4K8J A;  4YIJ A;  2AUK A;  2F0Q A;  3P20 A;  1TS5 A;  5EPJ A;  4XQJ A;  4RFB A;  1FNU A;  1SYD A;  3EQL C;  4IQZ A;  4U67 3;  4H0L C;  2X6L A;  2GA4 B;  1WTR A;  2X69 A;  1GXD C;  1WTO A;  2CW0 C;  4O1N A;  1DXM A;  2F0H A;  4HSV A;  1LTS D;  5FLX L;  4ABN A;  3U9O A;  1S4Z A;  4XT1 B;  1ZKO A;  3OHX C;  1V1O A;  5T1G A;  4C56 C;  2NN6 I;  5I9O A;  4CKB A;  1DOM A;  2L4N A;  3EFX D;  1SYE A;  2LY7 A;  1LT3 D;  2M2L A;  3MXG A;  3A8J E;  2E2H B;  2LS0 1;  5I2Y A;  3BVM A;  2EYF A;  4CJ2 C;  1MSG A;  2B2Y A;  1G91 A;  3S1M B;  5C6A A;  4DAP A;  2F3V A;  2PZU A;  3NE5 B;  1ILQ A;  1EY0 A;  3S1R B;  3PMF A;  4RCN A;  1ROD A;  2YYZ A;  1ONL A;  4K2K A;  5M5W B;  1II3 A;  2ID0 A;  4OIJ A;  1JQY D;  1UEA B;  3MA2 B;  3VYT A;  3WDN A;  2F0D A;  3NPP A;  2MPM A;  1I4Q A;  3RLF A;  3T53 B;  4AYB B;  1EIH A;  2L5T A;  1PZJ D;  1U4L A;  1X3P A;  4A3I B;  4FXD A;  5CGK A;  1LO5 D;  5C4Z A;  3MXU A;  4UAI A;  3S2D B;  1EY5 A;  4FYD A;  4ZKC B;  3FKI B;  2RDF A;  5CC4 A;  3SHL A;  2JP1 A;  4FNF A;  1AFP A;  4RKL A;  5J39 A;  5NUC A;  3RUZ A;  1TU2 B;  2WII B;  1LTI D;  3HS0 C;  4KK7 A;  4F88 A;  1PZI D;  4RGN A;  5CMD A;  4EGV A;  5IGC A;  3I72 A;  1AN8 A;  2HQE A;  1SAP A;  3MC0 B;  4R9W A;  3KBG A;  3SVM A;  1IKM A;  2JSO A;  4Q0F A;  4K8I A;  1DON A;  5C3E B;  2EYM A;  3R3O A;  3VYU A;  1TVX A;  2LFN A;  5FKA C;  5C0X J;  1B9N A;  2QF7 A;  2KEE A;  3QIA A;  3LWE A;  3Q0A A;  2F0E A;  4PMC A;  1O7L A;  1BNZ A;  1UNS A;  3PIO 3;  2MHV A;  3IFT A;  2NB0 A;  5COR A;  1GUG A;  3T4A C;  2F0G A;  5D3I B;  4QMG A;  2KQ3 A;  1A2T A;  1LAB A;  1EY8 A;  1EY4 A;  3BVG A;  3A7L A;  1G6Z A;  3L9A X;  1K83 B;  1GHK A;  2IX3 A;  4B9X A;  3G7L A;  3NHH A;  2XSC A;  5C3W A;  1H9S A;  1U4P A;  1Y8O B;  3I91 A;  4L8J A;  5IGG A;  1SE3 A;  3FDT A;  2BA1 A;  3C1F A;  1NUC A;  1X3Q A;  1HQM C;  2DNE A;  1YNN D;  4J8Q A;  3ND8 A;  3GTM B;  1K8M A;  1BCP B;  4OO1 G;  3I73 A;  5KGU A;  4IUQ A;  4KD4 A;  3URY A;  1EY6 A;  5EQ0 A;  1QG7 A;  1HUM A;  2CW0 D;  3ITP A;  2OXP A;  5FOB B;  1JWS D;  3QJY A;  5C44 B;  2HDL A;  4ZK9 B;  1DD2 A;  1HA5 A;  3DWA A;  2EDG A;  3TSS A;  4KJO A;  3VR5 A;  1Z7T A;  1XYI A;  4X3S A;  3SEB A;  1HPC A;  3Q22 A;  1WVL A;  1RD9 D;  2BDN A;  5EBD A;  4A3F B;  4IFD H;  1F2Y A;  1AZP A;  3J7A V;  3KK7 A;  3HZX A;  2JEB I;  3HOV B;  2R7Z B;  1B4O A;  1TQO A;  3TZD A;  3SXH A;  5IT9 L;  5HUR A;  1NSN S;  1D6E C;  1I4P A;  4IAL A;  2A68 D;  1U4R A;  3AMU A;  1R9T B;  1FD7 D;  2ZXP A;  1SNO A;  1JWM D;  2CHB D;  3AB9 A;  1XX8 A;  3CHB D;  1PLF A;  2MGS A;  3DWQ A;  2M9V A;  1Z6H A;  5K36 H;  3I70 A;  4L63 B;  3D8G A;  5J1Z A;  1EU3 A;  2EJG C;  2F0N A;  1PTO F;  1CQV A;  1SEB D;  3D6W A;  3NTI A;  2Q8I B;  1STA A;  3GTJ B;  3H3V C;  4KJN A;  5KNC A;  1ZEQ X;  2F3W A;  5CV5 A;  2RBM A;  2JYO A;  1PXU A;  3H0G B;  1NR4 A;  2FMM A;  1V43 A;  1FGB D;  4CGY B;  3I4M B;  4DFA A;  2WIN B;  3GD7 A;  3DMU A;  2EXZ A;  1F9R A;  3OMG A;  1F9Q A;  4XTC S;  1Y1W B;  3T16 A;  3IAY A;  5ELD A;  3VR3 A;  3AU7 A;  1Y69 U;  1STE A;  4FXK C;  4EQN A;  4KN4 C;  3A8K E;  4R8N A;  1VMP A;  1Q3L A;  2B8G A;  1W6K A;  2EJM A;  1BCP C;  2FIN B;  3K5O A;  2ZXR A;  1ILP A;  1GHJ A;  2L12 A;  1CK1 A;  4K5V A;  3K5L A;  5DAU A;  3GV6 A;  2RDG A;  4IUP A;  2B2T A;  3NTK A;  4A3M B;  1JOR A;  4O42 A;  4JK1 C;  4ID6 A;  1CA5 A;  1PTO H;  1EZ6 A;  3D3R A;  5KRU A;  3IKJ A;  1EZ8 A;  3GO5 A;  2IW3 A;  4A3G B;  3OOC A;  2K28 A;  2PNR C;  3T51 B;  3A54 A;  4CBV A;  5M3M B;  1I4X A;  1TY0 A;  4DXG A;  3D31 A;  1JB3 A;  2RA4 A;  2EY6 A;  3KLR A;  1T5X D;  2LKV A;  3O13 A;  4IUV A;  2IT1 A;  1M8A A;  3LWU A;  3V2T A;  4C3H B;  5EKK A;  4IFD I;  3NBI A;  3E6Z X;  1CT1 D;  3ND9 A;  1O80 A;  4J6H A;  1Q1B A;  3DM1 A;  4RGM A;  4IUT A;  2C9O A;  5KYL A;  5IT9 E;  1CZW A;  3TDQ A;  4WRD A;  1RKN A;  4C3J G;  2Z8L A;  4Z9C B;  4DF7 A;  1BCP F;  1G8Z D;  2J7Z A;  4M8A A;  1XXG A;  3BZD B;  2RVL A;  2K7V A;  5TSS A;  1MBY A;  4FF3 A;  2PO4 A;  3I3C A;  1IYV A;  3S14 B;  5CR3 A;  5I4D A;  3HKZ B;  2VNU D;  2I46 A;  3BDO A;  4DNR B;  3WOF A;  3SR1 A;  2MJ8 A;  5BN5 A;  3P75 A;  1FNV A;  2NTS A;  3BVZ A;  4LJZ C;  4DAY A;  4N9P A;  1BUV T;  3HOU B;  4LK1 C;  3GTL B;  4C3H G;  2IPK D;  1OXV A;  1CA6 A;  1IYU A;  1SJH D;  3NSW A;  4KMU C;  1PRT F;  5KEE A;  2NVQ B;  2B2W C;  2JE6 I;  3EA6 A;  5D65 A;  2KCN A;  4CKC A;  1LLR D;  2B2T C;  2QIL A;  4XT3 B;  5FO9 B;  2AQ2 B;  3NQI A;  3FRP B;  4RH6 A;  1HQR D;  1S5D D;  2H1E A;  3TME A;  2A6E C;  3E5S A;  1FR3 A;  4H44 C;  3BYY B;  2ZT9 C;  1F2M A;  3T13 A;  4HN7 A;  4KKS A;  2F0J A;  1WTQ A;  2RSN A;  1O78 A;  1STY A;  4C1N K;  4E6I A;  2QKI C;  1E2W A;  4RHS A;  4ZRZ A;  2F4I A;  3NBH A;  5IGF A;  1BO0 A;  4OGQ C;  5JPM C;  1EOT A;  2XRS D;  5EBC A;  4HCE A;  3PUW A;  3TP7 A;  1TWC B;  3QB3 A;  2PZT A;  3FPP A;  4IZ8 A;  1D5M C;  3QO2 A;  4A3B B;  5JOB A;  3HEJ A;  5E1F A;  5C5M A;  3F2U A;  3RMH A;  2EOT A;  3CRK C;  1WTV A;  4MN3 A;  4C2M B;  1QIL A;  1I6V C;  1CQF A;  1SYC A;  1QWY A;  2FFK B;  4QF4 A;  5K5P A;  4F7X A;  3DHQ A;  4XYQ A;  1HCZ A;  4N9T A;  2F0V A;  4QUC A;  3E0J A;  1B9M A;  3FVQ A;  5EJW A;  1E0B A;  1Q90 A;  1U4M A;  4I65 A;  2H4O A;  1JR0 D;  4OO1 I;  1FNW A;  4MIU A;  3N52 A;  2RSO A;  5K36 G;  5ELC A;  4KN7 C;  1TS3 A;  1CHQ D;  1IW7 D;  4X3K A;  2OT2 A;  5D14 A;  4B9W A;  1AW7 A;  3BYT B;  4G4K A;  3D6C A;  2A69 C;  1LTT D;  1FYC A;  1DOK A;  1PYW D;  1EU4 A;  2FJ2 A;  2N88 A;  1HFN A;  3PUV A;  1SYB A;  2DNC A;  4DK1 A;  1EEI D;  2B39 A;  2D2C C;  3P7J A;  1SSO A;  3KF8 A;  2PCF B;  5FO7 B;  4RGT A;  2G9H D;  3ZYY X;  2D5D A;  1ESR A;  1HHV A;  2N55 A;  4JBW A;  1B2T A;  3JAM E;  1M4V A;  1HTP A;  2K5W A;  4DK0 A;  4ZLT F;  3GTK B;  2XIW A;  5A35 A;  2DN8 A;  4NW2 A;  3VR2 A;  4CKE A;  1PFB A;  3KLS A;  3IL8 A;  4KY5 A;  4C1N I;  3CRL C;  2IX0 A;  5BN3 A;  2CQA A;  3A8I E;  1A2U A;  3K59 A;  3DUZ A;  2PPB C;  1CM9 A;  4H7B A;  1KLG D;  2F0I A;  1Y8N B;  4ZAI A;  1J9O A;  1LAC A;  4DU9 A;  3DWP A;  1JCK B;  5E4X A;  5KIX A;  1HUN A;  2L0C A;  2R93 B;  3HG9 A;  3HGB A;  2HCI A;  1TWA B;  5DM7 3;  2JEA I;  2EY1 A;  2TSS A;  3MFG A;  2K5Q A;  3K5N A;  1RF2 D;  3MEH A;  4FF2 A;  1WD0 A;  5JPN C;  2BOS A;  1EWC A;  1S5C D;  1UAP A;  2O5J C;  1HTL D;  3I4L A;  1C4Q A;  5C4X B;  2QCP X;  4TQU S;  3NUC A;  4PV1 C;  4DXF A;  4A3D B;  5CYU A;  2XRQ D;  3P1H A;  1D1I A;  4BWG B;  2E2D C;  4KHV A;  3H91 A;  1RHP A;  1JOK A;  5G3L D;  4A3K B;  4RAU C;  3VR4 A;  4F87 A;  3MXP A;  3MZ5 A;  1VF5 C;  5CV7 A;  1UUP A;  3PUX A;  3HOW B;  3EJI A;  1B3A A;  1D2B A;  2DY8 A;  2EJF C;  3SK4 A;  2VUM B;  5BN4 A;  2A6H C;  3TP6 A;  2XN9 C;  4XIG S;  4G7Z C;  4TSS A;  3QWN A;  2HUG A;  5EKL A;  4WFN 3;  3A56 A;  3H6M A;  2E76 C;  3I8Z A;  1G2S A;  2K5D A;  5KNB A;  1G2T A;  1R4P B;  2XVS A;  1E2V A;  2XNA C;  3N6R A;  2B2Y C;  3I90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...