2EYOA

Crystal structure of staphylococcal nuclease mutant t120s
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNSHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyoA00
2NUCA 2EY2A 4S3SA 1KDBA 1EYCA 3NQTA 2F0UA 5CV9A 3PMFA 1ENAA 5C5MA 1SNMA 4G57A 5K5PA 2EXZA 3OMGA 3NXWA 1NUCA 3QOJA 4HMJA 2LKVA 3HZXA 5CV4A 1SYEA 3SK5A 2F0PA 3EJIA 5J39A 1KDCA 2F0EA 1STAA 1SYDA 2SNSA 4DGZA 2EY1A 2PW5A 1F2YA 1STNA 4N9PA 4PNYA 2F0HA 1KDAA 3D4WA 5HURA 5C6AA 4IZ8A 2KHSA 2F3VA 3V2TA 4EQOA 2OF1A 2RDFA 5C4HA 4K8IA 4PMBA 2RBMA 2SOBA 1STGA 3BDLA 3MVVA 1EY7A 4NP5A 2EYJA 1U9RA 2PQEA 4KY5A 1STYA 1AEXA 1EY4A 5DEHA 5C5LA 5E1FA 5I6WA 1II3A 2F0NA 1TQOA 2F0IA 3DMUA 5C4ZA 3TP8A 1SYBA 2RKSA 1EY8A 4KY6A 4K2LA 4MIUA 5IGDA 4YIJA 1EZ6A 3P75A 4QB4A 3NK9A 5JAVA 3R3OA 1F2MA 4KHVA 5IIFA 2O4XA 4K5VA 3SK8A 1TR5A 3DHQA 3D8GA 1EZ8A 3TP5A 1SNPA 2M00A 3EROA 5IGCA 1A3UA 1F2ZA 1KABA 3QOLA 4H7BA 5IGEA 2F0FA 5KGUA 5KRUA 3LX0A 4RKLA 4HTHA 5CV8A 3D6CA 2EYMA 4KD3A 3C1EA 5EKLA 1TT2A 4ME5A 4ZQ3A 1SNOA 2F0GA 3NUCA 3RUZA 2EYOA 4TRDA 1KAAA 4KD4A 5NUCA 3MHBA 1NSNS 4EQNA 3TP7A 5IOCA 1EYDA 2OEOA 5CV6A 5CR3A 4B9XA 3T13A 1EQVA 2EYPA 4ODGA 5KIXA 5KYLA 4LAAA 4QF4A 3SXHA 2F0LA 3TMEA 5KYIA 4IUNA 2F0KA 2PYKA 2PZTA 1SYCA 5M9OA 4J1MA 4NMZA 3T16A 5HGTA 5I9OA 1SNCA 1EYAA 2F0TA 3OMCA 5E3FA 4K8JA 2KQ3A 1SYFA 4DU9A 4RKBA 4N9TA 2SNMA 4DFAA 5DAUA 2EY6A 5IGFA 5J22A 2PZUA 2EY5A 3D4DA 1RKNA 1SNDA 3HEJA 3SK6A 1ENCA 4F8MA 5C3WA 5CC4A 4KY7A 4R8NA 3P1HA 5I6YA 4F7XA 4K2KA 4OL7A 3ITPA 4E6IA 5EGTA 1SYGA 3NHHA 2HQEA 5KEEA 5EKKA 1JORA 4PMCA 2F0DA 5J1ZA 4EVOA 3H6MA 3OWFA 2F0MA 1A2TA 4NKLA 3NP8A 1EY5A 4K5WA 4ZUJA 2OXPA 2F0OA 2F0JA 4KJNA 3MZ5A 1STHA 3QB3A 2ENBA 2F0WA 4KJOA 5IGGA 2QDBA 3E5SA 4WORA 3TP6A 5IGBA 1EY6A 1JOKA 3SHLA 2PW7A 4B9WA 5ISRA 3U9OA 1A3VA 4ID6A 1IHZA 4NDXA 4DF7A 3SK4A 2PZWA 2F3WA 4K5XA 1SNQA 4KTAA 5CV5A 1JOQA 2EYLA 3BDCA 3SR1A 5I9PA 4I65A 1EY9A 5CGKA 4K6DA 1A3TA 4ZUIA 5CV7A 4EQPA 2EYHA 2F0QA 3EVQA 3OSOA 3MXPA 5IODA 3S9WA 2F0SA 5JOBA 4HMIA 5C3XA 4KV6A 2F0VA 4K14A 3C1FA 2WACA 4WRDA 4QMGA 1EY0A 3MEHA 5F2DA 1A2UA 4J6HA 3VA5A 2EYFA 1JOOA 4IALA 1STBA 3ERQA
chains in the Genus database with same CATH superfamily
2LFNA 3K80C 1ENFA 3ER0A 1VQ5A 1SNMA 1PRTF 4JI8L 4QY7A 5EQ0A 4AQYQ 1SYEA 1LUZA 3ZYYX 4DGZA 2PW5A 4A76A 1WD0A 2MO0A 3PIO3 1KLGD 4DNTB 3M4OH 1BXTA 3TDQA 1STGA 3MVVA 4NP5A 4C3IH 5EPJA 5KNBA 1HNXQ 3ULPA 4A3FG 4B3SQ 5E1FA 5I6WA 2UUCQ 3G48A 2WAQB 4A3EG 2E2IB 4BA2I 2KENA 3CRKC 3NQIA 4LFBL 2UXDQ 4HEDA 4IFDG 5M3MG 4X64L 1J5EQ 4RKLA 5JPMC 1JB7A 2XSCA 1GUTA 5D65A 1DOKA 2EIFA 1XMQQ 4DR7Q 3OHXC 4B3RL 1ET9A 5KIXA 2WAQE 3LGJA 4X66L 1LO5D 4MHEA 3K58A 4RGNA 3RLNA 1TS2A 3TMEA 1AFPA 4R4OA 3DEPA 4IJLA 4BY7H 2CVRA 1QCBD 4LF4L 1NJIC 2EY6A 1U4LA 2EY5A 2KCTA 1D5MC 2UUAQ 3I4NG 1VF7A 3KF8A 1DZ1A 1JR0D 3EQLC 4PQXA 3QJYA 4GOPA 4JI7Q 4R4IA 1PFMA 1ZEQX 1IKLA 1HNWL 3M4QA 2AQ3B 1YJ9A 1Y1WG 5IGGA 3H3VC 3OIQA 2EXDA 4IPGA 1D2BA 4DK6C 2NN6I 4FO2A 4ZUIA 2M2LA 3PF5A 1SSOA 4L5QA 4K6LA 4DNIA 4HMIA 4FF4A 1VQBA 2JYOA 4XYQA 3CD6A 1A6XA 3UDIA 2ICEC 4UP9A 2K7VA 4DR1L 1KDBA 2AHOB 4PZ8A 4GLVB 3PMFA 4J15A 5M5YH 4JV5L 1A0IA 3OMGA 2F52A 2PNHA 4P71A 3J80L 5ELNA 5J39A 2G5DA 4DKAC 1G91A 4CGYB 2I0QA 4A3LG 4R1JA 4RHSA 1X55A 2RHSB 3VR5A 3HGBA 4GOPC 2E2JH 2A5HA 4FP5D 1BO0A 4KY5A 5IT9c 3JAME 4KY6A 1B3QA 4K2LA 4MIUA 1JMCA 3HOZB 1PRTC 1XNRQ 1C0AA 4CKBA 2E8GA 1EZ8A 1ESRA 5IGCA 3TZDA 1B3AA 5KGUA 2F0FA 5DLQE 1G291 2D62A 3KOJA 1IYUA 2BA1A 2A73B 1PDQA 3C1EA 2NVXH 3TS0A 2B8GA 2ZTDA 2HIXA 2JA6G 1LTLA 4JI6Q 1I4HA 3S2DH 4IPCA 1IXRA 3A54A 2L9HA 1G2TA 1SN8A 2WIIB 4POFA 3CC2A 2IHFA 5M5XB 1SNCA 3HOXG 4DV2Q 4JPBW 1OXTA 1PMRA 1OTCA 5J22A 2JA5H 3AFPA 3L2PA 3GTKB 3FHWA 4JBKA 2VB3X 2VB2X 1CT1D 3Q8DA 3P1HA 1S3OA 4E6IA 4FNFA 4FVMA 3B6YA 4UHVA 1C7YA 1QNUA 2QILA 1XPUA 4DV5L 1LABA 2OQKA 4KKTA 2Q2TA 1CQVA 1VDZA 3HOYH 3CQZH 5M5WB 1LTSD 1Q82C 3H3VH 4NDXA 4ID6A 2BH8A 1K8MA 1IYJB 4K5XA 1PYBA 5I9PA 2UUBQ 3HRZC 5IYDH 4I65A 4Z9CB 4RGMA 2Y0SE 2PI2E 3QIAA 4B08A 1GOZA 3S9WA 4Y52H 3RZDB 1BBWA 4UDUC 2MFIA 4UPAA 4HJAA 5F2DA 3BU2A 4JI1Q 4A75A 1KD1C 3G7LA 4LF5L 5ELFA 1EYCA 1ZXTA 4A3DH 2LY7A 1ENAA 2GVAA 4DV0Q 4ZRZA 3HZXA 3PO2G 2DGYA 3EJIA 2PCFB 5DM63 1K83H 1SYDA 2AQ1B 3L0OA 4C3HH 4PNYA 1PFSA 4XTCS 2JA9A 1STEA 2RDFA 1XWEA 4FYDA 1V43A 1ML0D 3M4OB 2CQAA 4C3JG 2A6EC 1B7YB 5DNFA 1U4MA 3K8AA 1KL9A 1TQOA 1JCKB 3GD7A 3MEFA 1EY8A 1GUWA 2YV5A 1HNZL 3J7ZC 3JAMi 3CCSA 1I94Q 1KRTA 2F1MA 1CK1A 1XTDA 5I2YA 1HFNA 2JA7H 4DUYQ 5C44H 4YY3L 4ME5A 4ZQ3A 4JI0L 3J7YW 1V1PB 4X62L 4PZ7A 4DR3L 3EN2A 4LFBQ 3U9SA 3U4VA 2EYPA 4FF1A 3Q24A 1CFMA 3HOWG 3T51B 2F0KA 5M9OA 1CKOA 4CBVA 1ICFB 4JOIC 1LACA 4OWWB 5AJ3Q 2CKZB 2F0TA 4BY7B 1MSGA 4B3RQ 1BCPD 1Q1EA 5FLXc 3GTLH 4X66Q 2L0CA 1RKNA 2JP1A 1J9OA 3A5ZB 5EKKA 4LF4Q 1PH7A 3H6MA 3H0GH 4P73A 4XDXA 2XIWA 1X3GA 1SLJA 3KBGA 1X3QA 5JPNC 4HN7A 3MZ5A 4OXPA 2HHHL 3E0EA 3CXCA 1KTKA 2CCZA 2O2LD 3JAML 1LTAD 2R93H 1CZGA 1EFWA 2LSSA 2IW3A 5LMNL 1WVLA 2Z6KA 3SR1A 2VY3A 3MA2B 5ELOA 5CGKA 4A3MH 1L1OB 5IYCH 3MXPA 3HOVB 4Y7NB 3S1NB 3KBXA 4RHRA 1PRTD 3K0XA 2V4DA 3VYSA 3IKJA 4IUTA 4X3KA 4G57A 2Z1CA 3Q0AA 1VQNA 3NTKA 4ILWA 4HMJA 2LKVA 3SK5A 4ZKCB 3TS2A 2LXKA 3FDTA 1IZ6A 2BH2A 4DR1Q 3J7AV 1R4QB 3I91A 1YITA 3VYUA 1B4OA 2WB1B 2OTLA 4LNQA 2OCEA 2JA8H 1E1TA 2N88A 4ZAIA 4JV5Q 1PH4A 1UE6A 2E2JB 5IYBH 1PH5A 2UXCL 1CA5A 2K4KA 2NZ1D 4AQYL 1TIID 1XMOQ 2HDMA 3ZJYC 4CKEA 2KJXA 1II3A 2VUMB 2L12A 3GTQB 3STBC 2X6GA 2ZTCA 2E2DC 1XXGA 4QB4A 4HIMA 4LWCA 5C44G 2OQ0A 2GN5A 1M8AA 1OXUA 1S72A 4A3CG 2MJ8A 2WB1E 2B2UA 4C2MH 3J81E 5E4WC 4JI2L 2QF7A 3F8TA 5EKLA 1NY4A 1QB5D 1SNOA 4IUUA 2PI2A 1S5ED 1P8LA 2OTJA 1E2ZA 5CV6A 4LUZA 4RMFA 3KLSX 2UXDL 3S2DB 4HCSA 1AP0A 4X3SA 1HZAA 2NN6H 2B3GA 1F9RA 1LTBD 1C8CA 1J5EL 1RODA 2E2IH 1GUOA 3WDNA 2KQ3A 3UE0A 4N9TA 1HFGA 2SNMA 3BS1A 3M4PA 2O5IC 3DM1A 2KCNA 3SK6A 1SEBD 5CC4A 5GROA 5I6YA 4N8FA 1EIGA 1HPCA 1SYGA 4XQJA 1MD2D 5KEEA 5I4DA 3M7NA 1IYVA 4QIWB 4A93G 1A2TA 1GUGA 1PZKD 3PQIA 4DK1A 5FK9C 5GAGC 3CPFA 1KAWA 2ZJPA 4JI5Q 4GKJL 4F87A 2QDBA 3VR4A 3HKSA 3SHLA 3W5OA 4IUVA 2PW7A 4EX5A 1JJGA 1U4RA 3BJUA 2XNAC 1JWMD 3WOFA 1JOQA 1HQMC 1K8OA 3BVZA 1IW7C 2NZHA 1HZCA 3UI2A 1K28A 5C3XA 4KV6A 1H9RA 2G9DA 3TQYA 4QIWE 1BCPB 5JJZA 4IPHA 5JJIA 3NTIA 1RTNA 1Y1VB 5D14A 2QEXA 1N32L 1QWYA 1LT3D 2F0UA 2JSOA 2J0TD 4A3DB 5K5PA 4V0BA 2B2TC 3K5NA 3PUVA 4KLKA 1K83B 5IP9G 1EU4A 4LF5Q 2F0HA 4OHJA 1R9TB 2FJ2A 2NTSA 4IZ8A 5C4HA 3AU7A 1V8QA 2B63B 4B3TL 4OO1G 3CHBD 3CC7A 1V1PA 1Z47A 3K59A 2R3ZA 3GTOH 3MWYW 2RHQB 1IBML 1SE3A 5C3EH 3BVMA 1RD9D 2RKSA 5IGDA 1NR2A 3KLRA 2RA4A 1M90C 2E2HH 1TS3A 4PV1C 4KHVA 5IIFA 1PRTB 1YJWA 1Q81C 2VL6A 5IOCA 2JA7B 1RIPA 3E9IA 3ONAB 2Q2IA 3S16H 4LF7Q 2F0GA 4H0LC 3D0FA 3J81i 2WAQG 2RQXA 4O42A 1X56A 4UY8C 1GO3E 3H09A 3I72A 4YY3Q 2J7ZA 3RZOB 1D1KA 4X3TA 3CU7A 3I3CA 4JI0Q 3J7AF 5I9OA 4DR3Q 4NXML 3R2IA 5FLMH 4RA8A 4XYOA 4DFAA 4HSVA 1YBYA 4I7ZC 4CHTB 4JI6L 2JJQA 3WOEA 3GTPH 1EUJA 1SRUA 1L1OA 1A15A 1T9HA 2E76C 3J7A5 3KLWA 3S14H 1CUKA 4XT3B 3NP8A 2DJFC 3TREA 1TWCH 2K5HA 3OOCA 1RF2D 1VQJA 4IOCA 3HS0C 3X3MA 2Q2HA 3S1QB 2R93B 1EQRA 2L55A 2BDNA 2HHHQ 3M3YB 2F0QA 5IE8A 5IODA 4KKSA 2UXBL 3DLLA 4L6TB 3STBD 3S17H 2AWOA 3J81j 3M9BA 2ZXRA 1MJCA 2ZTEA 2A74C 1ONLA 1LTID 1NTGA 2KEEA 1V1OA 5C5MA 2D5DA 5M5WH 3NXWA 1EL0A 1EQQA 3QR8A 4U673 1RJTA 2NVYB 2A69D 2EY1A 3BZDB 3V96A 1KDAA 1L1OC 3BYYB 3M7GA 2F03A 1TS4A 4A3BB 2F3VA 5BN3A 4JI4L 3HOUH 1DONA 2HDLA 4IUPA 4AH6A 3RZDH 1HR0Q 1NMFA 5C5LA 3PUZA 2DUDA 1A63A 3T53B 1JWSD 1ZKOA 3S24A 3MC0B 1WJJA 3CAMA 2UXCQ 1TWAH 1S5FD 3G4SA 2GA4B 1SNPA 1UNSA 5KYLA 1YI2A 2FMMA 3QOLA 4DV7L 1PHJA 5C0XG 4C2MB 4CJ0B 1MKHA 1I94L 3GDEA 3HOZG 4DUZQ 4DUYL 4JI2Q 2NVQH 4MN3A 4RAUC 2PYKA 2EJGC 3AB9A 1IW7D 1QVCA 3W1BA 4HIDA 4QUCA 4DU9A 4RKBA 4R9WA 3CCEA 4J8QA 3MTSA 1O7YA 3HEJA 4A3KB 1PH9A 1GUSA 1UUPA 4MTNA 1D7QA 1ET6A 3DXJC 4AIMA 1S5CD 4CJ1B 4P74A 5J1ZA 5AJ3L 3D3RA 5K36H 3P7JA 1OO9B 1NR4A 1EY5A 1SJED 2OXPA 1Q90A 4QJFA 5T1IA 2CWAA 1YNXA 1D5ZC 1W2BA 4AYBB 3TEHB 4GKKQ 3GV6A 1HTLD 3J80i 1IHZA 3SK4A 3CCVA 1F9QA 2Q2UA 1UAPA 3N52A 3FKIB 2R6GA 3V05A 1CSQA 2B2YC 4GKJQ 1RTOA 1YEZA 3DM3A 1EEID 5ELCA 1LT6D 4IFDJ 1WCMG 2K04A 1C48A 3VA5A 1A62A 3E9HA 2OT2A 1NE3A 1SBBB 3LWEA 5FOBB 1T5EA 1QILA 2WP8J 1S4ZA 2QW7A 2B2VC 3A74A 3DWQA 1MGSA 3CKIB 1Q3LA 1Z7TA 4AYBE 2KECA 1K8GA 3K0YA 1SDFA 3GTMB 1HXYD 1N32Q 5TSSA 3A7LA 3HFZB 2BDOA 3HOVH 3GP7A 4K8IA 4Y7NH 1KLUD 2D9UA 3S1NH 1BCPC 4A3GH 2DJGC 2N78A 2AMCB 2EYJA 1STYA 2DNCA 2WKCA 3OW7A 1QUQB 4QGUA 3GTOB 2LMCB 1DOLA 5C3EB 1TS5A 2B29A 5D3DA 4B3TQ 1EZ6A 5C4XH 2E2HB 1PYWD 2O4XA 4LMQD 4JI3Q 2HCIA 1IBMQ 1XMOL 4XT1B 3S15B 4C3IG 2EYMA 4EQ5A 3HP3A 2IX0A 3S16B 4K0KL 4LF9Q 1RHPA 4GS3A 4KD4A 2KHJA 3A8IE 2M9VA 2KEDA 5JEAH 4BBSH 1NAPA 2VUMH 2UU9Q 2VS1A 3GTQH 1HQRD 3K5LA 1SYCA 3T1YQ 4J1MA 3I8ZA 4DPGA 3PO3H 4DR4L 3O13A 2D0OA 4Q0FA 1E2WA 4KN7C 3A0JA 1PZJD 5M3FH 4F8MA 5C3WA 3PIP3 2K75A 1PV4A 1I4QA 4BXXH 2C35B 4IN3A 4F7XA 3GTPB 3QG1A 1LYLA 5T1GA 2L5TA 5BN5A 4NXMQ 3S14B 3A7AB 4A3IB 3E6ZX 4TKOB 2F0OA 1PH6A 3CCQA 3HG9A 4BY7G 3QB3A 1TWCB 1HUMA 4A3EB 2BOSA 2Q8RE 3IFTA 1H95A 4KTAA 2XRQD 2CW0D 4JBMA 1C9OA 2K5NA 3AQQA 1B8AA 5CV7A 3EVQA 1KRSA 2EE1A 4JI5L 2F0SA 5GQOA 2F4IA 2Y0SB 1I4PA 3A8KE 3S17B 3GO5A 1K9MC 2K28A 4HAEA 1EY0A 4L5RC 3MXNB 1I3QH 4IALA 1F2LA 2Z4IA 2EY2A 1HA6A 4R8IA 3M85A 2HT1A 2UXBQ 1VQIA 4JW0A 1B53A 2DNEA 2BE5D 1TY0A 5E4XA 4F88A 1VF5C 3V2TA 5FJ8H 3HOUB 4HJ9A 1VQCA 4DV1L 3I2ZA 2KCCA 3H94A 1Y1VH 3G71A 3R2TA 4JI4Q 1DOMA 5C0XI 1IL8A 1DXMA 3I55A 1Y1WB 1TWAB 2WB1G 3AFQA 4JOIA 3D8GA 4CKCA 5IT9E 1TWFB 4ZYSA 5DM73 1PH8A 2KBNA 1R9TH 2C5CA 5CV8A 3L9AX 4XQNA 2B63H 1HUNA 4R4TA 2ALYB 4IPDA 1Q12A 4EQNA 3TP7A 5IP7H 1E2VA 2DN8A 5LHY1 1LTTD 2YTXA 3FVQA 4Q5VA 4A3JH 4DV7Q 4LAAA 4B3ML 5JEAJ 3K7AH 4IFDI 3I56A 2NVQB 5JJKA 1FNVA 1K73C 1N36L 4LF7L 3KDFB 3D31A 2O5JC 1DCZA 2B39A 4GLAC 1GM5A 4N8X1 1F77A 1D6EC 1EWCA 4U68A 2RDHA 3ICEA 1MHWC 2NTTA 1AN8A 2RCFA 2FFKB 1C4QA 1GD7A 2ENBA 3RZOH 4BA1I 3KF6B 4UP8A 4HJ7A 1EY6A 1KHIA 2JA5G 4FDBA 1WTHA 4OX9L 3I7FA 3KLSA 1XPRA 3W1GA 3L3OC 3TZUA 4JBWA 2AUJD 2XWJB 1FVIA 4DAYB 4DK3C 5C4JB 3C3LA 3HOYG 2EYFA 1W3SA 1QUQA 2TSSA 4S3SA 4M1UB 4WJWA 1ILPA 2NYZD 2K01A 3I4MH 4NW2A 3GTGH 2H5XA 3A5UA 1A8VA 5IYDG 4MNOA 1NBWA 3S1QH 1Y8OB 2F0EA 3HOXB 1EWHA 1F2YA 4N9PA 3SE0A 1VQ4A 1S40A 5GADC 3M3YH 4FXKC 3AYHB 2JN4A 4NXNL 2RBMA 4OGQC 4A3GB 4WJ3M 4TSSA 1FJGL 4R4QA 4A3DG 5DEHA 3NSWA 1MBYA 2F0NA 1VQOA 3G6JB 1VQAA 4ME3A 1N34L 4JCVE 2VW9A 3N6RA 3F2BA 3BYTB 4C3HG 1L2FA 5C4XB 2Z4HA 3PIOA 1HR0L 1WTWA 3NBIA 2NVYH 2KOLA 4NPSA 2PQAB 2AQ2B 3A56A 2QEJC 1U5KA 1JJCB 5LMUQ 3D6CA 3VR6A 4A3BH 1EEFD 3GTJB 5LL6X 5NUCA 3BZKA 1UEAB 2YTYA 3BZCA 4G7OC 4BBSB 1JQYD 1HCZA 1KIXA 3SGIA 2YYZA 2ASBA 4QF4A 1O80A 3OTOQ 1OXVA 2LS01 2B8FA 4O1NA 1KC8C 4K0KQ 5HGTA 1GHKA 1LLRD 3RLOA 3VR2A 2JA7G 3PO3B 1RL2A 3RLFA 1P16A 2DY8A 1SFOB 4PG3A 2XTIA 3F1ZA 4OELB 4HR7B 4ZKBB 4MZ9A 3PO2B 4DUZL 5M3FB 2R7FA 4C1NI 2EPBA 3MXUA 4KY7A 2WKDA 3MFYA 2HQEA 4DR4Q 1JORA 2A69C 2F0DA 3P20A 2VNUD 5FLXE 2LXJA 3MXNA 1I5FA 4C3JB 2MP1A 4KJNA 3A8JE 2EZVA 1VQLA 3I90A 4UAIA 1AW7A 2PZWA 2B2TA 5CV5A 1BBUA 1HJPA 1EQTA 2K14A 1JT8A 4A3KH 3QO2A 3OSOA 5IT9L 1Q7YC 3H0GG 4GN3B 3S1RB 3G6EA 1PH3A 2EQSA 1VQEA 2AUKA 2ICIA 4LF8Q 4GKKL 3PF4A 3D4RA 1ASZA 1SJHD 3Q6SA 1I3QB 4JC0A 2R93G 2WV6D 1QZGA 3VYRA 1ZYRD 3VR3A 3FMCA 1Q8IA 3PSIA 2PO4A 3TRZA 3U50C 4A3MG 2IWHA 5IYCG 3I4OA 3FKIH 2BA0A 4YCVA 1PH1A 2ID0A 5AFWA 5C6AA 4EQOA 2IPKD 2HIVA 2FMCA 1Q1BA 2MO1A 4IOAA 1AEXA 1EY4A 1E24A 4JYAL 1G6PA 1SAPA 2XVSA 1CZWA 2QA4A 1BF4A 5JAVA 4DV1Q 4GNXC 1GUNA 3KDFA 1TR5A 3GTMH 1AH9A 3TP5A 2JA8G 5KRUA 5KNDA 2K5DA 4H7BA 1FGBD 4LFCL 1B50A 5IYBG 2KVMA 4OONA 1IKMA 2E74C 2R92H 2B2WA 1VQHA 1UE1A 1GKHA 1YNND 3I70A 1M4VA 4ODGA 2XN9C 4JI3L 5LMNW 4A3JB 1O7ZA 1UWVA 3ULLA 4O0AA 4MTKA 1QJOA 3K7AB 1L0YB 3PIPA 1WTXA 1SE4A 3VYTA 4LF9L 4P72A 1V9PA 3FRPB 2R7ZH 1HHVA 4B3MQ 1UE5A 1H9SB 2QDLA 2UU9L 3S15H 2A6HD 4K2KA 1VQFA 4CDCC 3NBHB 1N36Q 2EVBA 3T1YL 1FR3A 1CHQD 4P75A 2NN6G 2GVBA 3W3AA 4BY1H 1B44D 1J6QA 3NWSA 4KJOA 5IGBA 2MPMA 2JK8A 3GV3A 3URYA 1UEBA 4A3KG 1BBXC 3U9OA 1A3VA 1AZQA 2IJ0A 2HQLA 1WTPA 2TMPA 4DAVA 4YHHL 1PFBA 2VQEL 1M1KC 3H3VI 5JOBA 2B2WC 5JVH3 4OX9Q 2WACA 5ELEA 3PUXA 4A3IH 1A2UA 4J6HA 2Z6BA 4L5SA 5ELDA 4UP7A 1GHJA 2OWOA 4DV3L 1IBLL 1X3EA 2I46A 3NQTA 1D1IA 4A3FH 3I73A 1EYGA 4A4IA 4A3EH 3I4MB 4YWMA 3GTGB 4DV4L 3TSSA 1STAA 3IFDA 2PQAA 3D4WA 1DD2A 3EBEA 1WYDA 4G7HC 4IFDH 5M3MH 4PMBA 2SOBA 3K57A 5G3LF 1VQPA 1CI3M 2I07B 5H1SE 2X69A 2F0IA 1CM9A 4JBJA 5CYUA 3CCRA 5FLXL 3KJPA 4NXNQ 3SEBA 4EGVA 1O7IA 3NK9A 3VDYA 4DAPA 3HKZB 3R3OA 4K5VA 1FJGQ 1LM0A 3PCOB 2VQFL 3DHQA 1G2SA 3UDFA 1N34Q 1FD7D 1CHPD 1E0BA 4HTHA 4RH6A 3F2CA 2K50A 1K3BC 1HZBA 2CW0C 5C3EG 3I4NH 1EQVA 4BBRB 3MXGA 1WD1A 4DAMA 2F0LA 5GAHC 2Q8TA 1QG7A 4X65Q 1O7LA 3HKZE 2MGSA 1EYAA 1VQ8A 2CWPA 1Y1WH 1E22A 5EBCA 4BS9A 2XRSD 4KKUA 5CORA 1TWFH 3F2DA 1BDOA 3D4DA 1SNDA 2F4VQ 1Y14B 2L15A 2BE5C 1PVOA 4PMCA 2B2YA 2YTVA 1YHAA 2P5ZX 1HA5A 4NKLA 4P2CB 1SMYD 2N49A 1O78A 1AE3A 2K05A 1I6HB 3BVGA 4HIOA 1K0RA 2F0WA 1KQSA 5FLMG 3TP6A 1VQ7A 1LV9A 2B2VA 4TVAB 4B9WA 1X54A 1SNQA 5A2QE 3S2HH 5JJLA 3UDGA 2EJMA 1I50B 1VQDA 2IX3A 2MUYA 4R4CA 1XPOA 2N3SA 4XXEA 4A3IG 1R4PB 2L11A 1VQMA 4YWKA 1B9NA 4A3LH 3R8BA 4WRDA 3MEHA 5C0XJ 2NUCA 5EJWA 2I5HA 3DEOA 2Z9HA 2EXZA 1NUCA 3RN5A 3OYYA 3PUWA 1Y8PB 2QGQA 2EOTA 2K03A 1WOCA 2Y0SG 3NELA 3JAMc 4KK7A 1X9NA 1HRJA 2KHSA 1DM0B 2JE6I 3KUPA 4ALPA 1ILQA 4HSPA 2E5LL 1YHQA 2XGTA 1SR3A 5C4JH 1JC7A 3CCMA 4OIJA 2JA6H 3H15A 3TP8A 1SYBA 1PTOF 4IJHA 4QUFA 1N9WA 4ABNA 2N8NA 1F2MA 1NCVA 1B70B 4RCNA 4OO1I 3SDZA 3F2UA 3HOXH 3HOUG 1F2ZA 3AMUA 4JYAQ 1I6VC 2K33A 2A19A 1H9SA 3LWUA 5HY6A 1EIYB 4M8AA 3NBHA 2VXWA 1I4GA 1NSNS 2R92B 4NB3A 4B9XA 4CDFC 4LUOA 3PGZA 4LFCQ 3SXHA 1VQKA 5LMUL 2PZTA 1GXDC 1Z6HA 3BDOA 2BCOA 3OMCA 2PPBC 1EWIA 1W6KA 2N55A 4QCLA 5IGFA 3LNNA 5EKIA 2R7ZB 3UE1A 1EFID 1LTRD 1ENCA 3UDXA 1QNKA 3OTOL 3GTJH 5L37A 1DYQA 3PV0A 1HTPA 1K8AC 1BNZA 4ZUJA 1I4XA 3RN2A 1XNQL 1ICWA 4BY1B 1STHA 2G9HD 1VMPA 4LF6L 4PZ6A 2IL8A 4ULLA 2H1EA 1KNEA 1X3FA 5FO8B 1Y69U 1SFOH 2K1BA 2F3WA 1YIJA 3EIVA 1Z9FA 3PO2H 4GLXA 4LFAL 4K6DA 4KMUC 3X3NA 5K36G 4LUVA 1CQFA 2IX1A 2NWGA 2MNAA 3DWAA 4GN5A 2D2CC 4OWTB 2HCCA 3CC4A 3ERQA 4YHHQ 3T1HL 2VQEQ 4C3JH 2FINB 1TWHH 4A3FB 1QVGA 2I5LX 4CJ2C 3FPUB 4IQZA 2MQHA 1KDCA 2SNSA 4LF8L 3JC66 1MI2A 3K6OA 2ES2A 4L5TA 4DV3Q 5FO7B 1IBLQ 2RF4A 5HURA 2JXMB 1Q46A 5M3MB 4DV4Q 1BOSA 3BDLA 3S1RH 2F3IA 2DY7A 3FEWX 3DMUA 1YNJC 5C4ZA 3KYHC 3MFGA 1EOVA 3ND8A 5CBEE 1FL0A 3HOWH 2J4XA 3SK8A 4GNXB 3TN2A 1FNWA 2KHIA 2K32A 3HOVG 2M00A 3EROA 2R61A 3LX0A 4A3GG 2ZJQA 5A2QL 3K5OA 2YU9B 1GJXA 1E1OA 2MHVA 1BQQT 5IWAL 3EFXD 1H9KA 2VQFQ 4POGA 3I4NB 3RNUA 1WCMB 3NEMA 5C4XG 1VQGA 2ZM6L 1PTOC 4IUNA 1F9PA 4NMZA 4LK1C 3T16A 4RFBA 3E0JA 3S1MH 3GQBA 1YHBA 3Q23A 1UE7A 3K7UC 5J3BA 2H4OA 2FXQA 2ZT9C 1ZYRC 1JWUD 5JEAG 4BBSG 1TWGH 5EGTA 5EPLA 1XYIA 3AEVA 1IL2A 2VUMG 1TU2B 3OWFA 3VA7A 3KK7A 4TQUS 4DXFA 3PO3G 1MIUA 1JICA 4KHPL 1SXTA 4WORA 1YVCA 5M3FG 3CW2C 2I5MX 4BXXG 1QZHA 1WTVA 4OEMB 1VCIA 3S2HB 1FYCA 2K52A 1TY2A 1SROA 2EYHA 5FO9B 3RR5A 1HH2P 5BN4A 4JI8Q 2HD3A 2Z8LA 2F0VA 4K14A 4C3IB 4IO9A 1CA6A 1CKNB 4C56C 3U4ZA 2RDGA 1QVFA 1T5XD 1PA6A 5COYA 4KN4C 3CMEA 4DR2L 3OWEB 4DNRB 3QOJA 2K5WA 1VQ6A 1YNNC 1OXSC 4RG1A 1STNA 5G3LD 3TBIB 3ULJA 3OPOA 2CH4A 2NB0A 4A3CH 2K6AA 1FNUA 1B1ZA 1AZPA 3ERSX 1N33L 4JG2A 1PFNA 4X64Q 1X6OA 1WTQA 2A6HC 3J81c 4ZLTF 2JA6B 1SMXA 1SE8A 1TXYA 1SE2A 2E5LQ 3KJOA 3NWTA 1VMCA 4OWXB 5FJ8G 1KABA 3U58A 1EU3A 2KA7A 3NUCA 3RUZA 1YJNA 3R93A 1Y1VG 4V190 5CR3A 4DR5L 2ZXPA 1W6JA 1JE4A 1KXLA 4A93H 5KYIA 4WJ4A 4FXGC 2L4NA 5FKAC 1BKBA 1PTOH 4IURA 2ATWA 2NVTH 3DWPA 5E3FA 2JQOA 4H13C 4DXGA 1S5DD 4KI0A 4G4KA 4DV6L 5HGQA 1HNWQ 1Q86C 4DR6L 5DAUA 2B63G 1EIHA 3MAQA 1PYSB 4R8NA 5IP7G 3ND9A 1JB3A 1I4RA 4L8JA 4C1NK 4A3JG 4X65L 5A35A 1LT4D 2F0MA 2AWNA 5EAYA 1JE5A 2F0JA 2C9OA 3IL8A 3CF5A 2Z0SA 4O2DA 4BBRH 1WTOA 4WFN3 5M5YB 2F4VL 3E5SA 2R7DA 3Q22A 1JOKA 1XTCD 1IBKL 5BR8L 1PH2A 3W2DA 2JEAI 1L0XB 1XNQQ 3BDCA 1JJ2A 4HIKA 1ESFA 1EY9A 3L7ZC 3D6WA 5IP9H 2IT1A 3CP0A 1YNJD 4LF6Q 2E75C 5KNCA 4QMGA 1G51A 1NMGA 5GAEC 4ZK9B 3KFUA 4OO1H 4XQQA 1STBA 3M4YA 4LFAQ 5JVG3 1PZID 3RMHA 1I6HH 2CFMA 2CQOA 2NBFA 1TWHB 2A68C 1AE2A 3WWVA 1DGSA 4GZYC 2Z6KC 4LJZC 5CV4A 4HJ8A 1RCVD 1E7ZA 1VQ9A 3CRLC 3EA6A 4CDEC 3CCUA 1HNXL 2WFWA 3H91A 3T56B 4GNXA 3T1HQ 4B3SL 2UUCL 1I50H 2OF1A 2ZXOA 2NVXB 3NPPA 4IUQA 1PTOD 2PQEA 2RVLA 1PXUA 4DK0A 1OXXK 3I4MG 3BG3A 2IY5B 1E3PA 5CBAE 1WTRA 4YIJA 2K5QA 1Y8NB 1XMQL 4DR7L 2JEBI 3HOWB 1SMYC 2CHBD 4X3UA 5IGEA 2JA5B 4YCWA 1TKWB 1ASYA 1U0LA 1D5XC 4RCOA 1QE6A 1TT2A 3OIPA 1L0WA 1BUVT 4HJ5A 3MHBA 2IHEA 2OEOA 1CTMA 1F9SA 1WI5A 2K5VA 2EDGA 3HKZG 5ELBA 1KNAA 3HOYB 1S5BD 2A1AA 3CQZB 2UUAL 2RSNA 2CH4W 5IWAQ 2RCNA 3NENA 3IAYA 5IY0A 4DV5Q 3RD4A 4JI7L 3S1MB 4G7ZC 2B2UC 1V1QA 3OW2A 1X32A 1BVSA 3NTHA 4A3BG 2A6ED 1CKMA 2PZUA 2ZM6Q 1HZ9A 3J80c 4OL7A 1D8LA 3ITPA 3K81C 2KUMA 3NHHA 4HCEA 2WINB 1TWGB 4BBRG 4YWLA 1CKNA 4FXDA 3T4AC 3CCLA 3I4LA 3QWNA 4L63B 1QOHA 1YZ6A 1CSPA 1PLFA 3KF6A 2PMZB 2Q8IB 5ISRA 1K0SA 5EPKA 4CDDC 3NE5B 4C3HB 2D0PA 4RWSC 4QL5A 4RGOS 4KHPQ 3CCJA 3C46A 3KF8B 1G6ZA 4ZCKA 4GOPB 5EBDA 2EJFC 3C1FA 1LT5D 1HR0W 1DJRD 3IRBA 4DAYA 2QCPX 1RDPD 4I7AA 5CV9A 1FGUA 2NZOA 2PMZE 3SVMA 2F0PA 2ZJRA 5C44B 4DR2Q 1HNZQ 1NNXA 1EOTA 1XNRL 1U4PA 1EY7A 5C0XH 1H9JA 1X65A 1U9RA 2V1CC 1TVXA 1H9MA 4AYBG 2X6LA 3PUYA 3HOZH 5D3IB 2SDFA 4X62Q 5LL6S 1B2TA 3FPPA 3P75A 5CMDA 2XWBB 1N33Q 3FKIG 4FF3A 3GTLB 1A3UA 4XIGS 1VS0A 4KD3A 1EIFA 2EYOA 4TRDA 1KAAA 4DV2L 1EYDA 3H0GB 3T13A 2FHTA 4DN4M 1MJEA 2A8VA 1X3PA 3J80E 4A93B 1Q8KA 2L1BA 5E7NA 5M5XH 1WFQA 1PTOB 1K3RA 2RSOA 5I2XA 2NVTB 4K8JA 1SYFA 4DR5Q 1J8IA 4APVA 3GTKH 1G8ZD 1XX8A 4A3MB 2R92G 4FF2A 1MSHA 1N8RC 4OIKA 1BCPF 2YU9H 3J81L 4PMWA 4JVZA 3DUZA 4LW1A 4KHZA 2KCMA 2A68D 2SEBD 4EVOA 5LMNQ 4DV6Q 2PNRC 4H02A 4K5WA 4DR6Q 3E3XA 4X6AH 3C2PA 1WCMH 2UUBL 4RGTA 4GN4B 4YCUA 1LTGD 2R7ZG 3FP9A 2VZAA 2AKWB 4DF7A 4JI1L 2EYLA 1A3TA 4EQPA 2HUGA 1B9MA 3CPWA 2JA8B 4BWGB 4QQBX 1GVPA 1IBKQ 4H44C 5BR8Q 4DV0L 1BR9A 1XJVA 4BY1G 2QKIC 4DA2A 4JK1C 1JOOA 3A55A 3K5MA 3CMAA
chains in the Genus database with same CATH topology
2LFNA 1ENFA 1SNMA 1PRTF 5EQ0A 1SYEA 3ZYYX 4DGZA 2PW5A 1WD0A 3PIO3 1KLGD 4DNTB 1BXTA 3TDQA 1STGA 3MVVA 4NP5A 5EPJA 5KNBA 5E1FA 5I6WA 2WAQB 2E2IB 4BA2I 3CRKC 3NQIA 4HEDA 4IFDG 4RKLA 5JPMC 2XSCA 1GUTA 5D65A 1DOKA 3OHXC 1ET9A 5KIXA 1LO5D 4MHEA 3K58A 4RGNA 1TS2A 3TMEA 1AFPA 3DEPA 2CVRA 1QCBD 2EY6A 1U4LA 2EY5A 1D5MC 1VF7A 3KF8A 1DZ1A 1JR0D 3EQLC 4PQXA 3QJYA 1PFMA 1ZEQX 1IKLA 2AQ3B 5IGGA 3H3VC 3OIQA 1D2BA 2NN6I 4FO2A 4ZUIA 2M2LA 1SSOA 4K6LA 4FF4A 4HMIA 2JYOA 4XYQA 1A6XA 2ICEC 2K7VA 1KDBA 3PMFA 3OMGA 3J80L 5J39A 1G91A 4CGYB 4RHSA 3VR5A 3HGBA 2A5HA 4FP5D 1BO0A 4KY5A 3JAME 4KY6A 3HOZB 4K2LA 4MIUA 1PRTC 4CKBA 1EZ8A 1ESRA 5IGCA 3TZDA 1B3AA 5KGUA 2F0FA 1G291 2D62A 1IYUA 2BA1A 2A73B 1PDQA 3C1EA 2B8GA 1I4HA 3A54A 2L9HA 1G2TA 2WIIB 5M5XB 1SNCA 1OXTA 1PMRA 5J22A 3GTKB 2VB3X 2VB2X 1CT1D 4E6IA 3P1HA 4FNFA 4FVMA 1QNUA 2QILA 1LABA 4KKTA 1CQVA 1VDZA 5M5WB 1LTSD 4NDXA 4ID6A 1K8MA 4K5XA 5I9PA 3HRZC 4I65A 4Z9CB 4RGMA 3S9WA 3QIAA 4B08A 1GOZA 3RZDB 4UDUC 5F2DA 3G7LA 5ELFA 1EYCA 1ZXTA 2LY7A 1ENAA 4ZRZA 3HZXA 3EJIA 5DM63 2PCFB 1SYDA 2AQ1B 4PNYA 4XTCS 1STEA 2RDFA 1XWEA 4FYDA 1V43A 1ML0D 3M4OB 2CQAA 4C3JG 2A6EC 5DNFA 1U4MA 1TQOA 1JCKB 3GD7A 1EY8A 1GUWA 2F1MA 1CK1A 5I2YA 1HFNA 4ME5A 4ZQ3A 3J7YW 1V1PB 3U9SA 2EYPA 4FF1A 3Q24A 1CFMA 3T51B 2F0KA 5M9OA 4CBVA 1LACA 2F0TA 4BY7B 1MSGA 1BCPD 1Q1EA 2L0CA 1RKNA 2JP1A 1J9OA 5EKKA 3H6MA 4XDXA 2XIWA 3KBGA 1X3QA 5JPNC 4HN7A 3MZ5A 1KTKA 2O2LD 3JAML 1LTAD 1CZGA 2IW3A 1WVLA 3SR1A 3MA2B 5CGKA 3HOVB 3MXPA 4Y7NB 3S1NB 3KBXA 4RHRA 1PRTD 2V4DA 3VYSA 3IKJA 4IUTA 4X3KA 4G57A 2Z1CA 3Q0AA 3NTKA 4ILWA 4HMJA 2LKVA 3SK5A 4ZKCB 3FDTA 3J7AV 1R4QB 3I91A 3VYUA 1B4OA 2WB1B 2N88A 4ZAIA 2E2JB 1CA5A 2NZ1D 1TIID 2HDMA 4CKEA 2KJXA 1II3A 2VUMB 2L12A 3GTQB 2X6GA 2E2DC 1XXGA 4QB4A 1M8AA 1OXUA 2MJ8A 2B2UA 3J81E 5E4WC 2QF7A 5EKLA 1QB5D 1SNOA 4IUUA 1S5ED 1E2ZA 5CV6A 3KLSX 3S2DB 4HCSA 1AP0A 4X3SA 1C8CA 2NN6H 1F9RA 1LTBD 1RODA 1GUOA 3WDNA 2KQ3A 4N9TA 1HFGA 2SNMA 3BS1A 2O5IC 3DM1A 2KCNA 3SK6A 1SEBD 5CC4A 5I6YA 1EIGA 1HPCA 1SYGA 4XQJA 1MD2D 5KEEA 5I4DA 3M7NA 1IYVA 4QIWB 1A2TA 1GUGA 1PZKD 4DK1A 5FK9C 4F87A 2QDBA 3VR4A 3SHLA 4IUVA 2PW7A 1U4RA 2XNAC 1JWMD 3WOFA 1JOQA 1HQMC 1K8OA 3BVZA 1IW7C 3UI2A 5C3XA 4KV6A 1H9RA 2G9DA 1BCPB 5JJZA 3NTIA 1RTNA 5D14A 1Y1VB 1QWYA 1LT3D 2F0UA 2JSOA 2J0TD 4A3DB 5K5PA 4V0BA 2B2TC 3K5NA 3PUVA 1K83B 1EU4A 2F0HA 4OHJA 1R9TB 2FJ2A 2NTSA 4IZ8A 5C4HA 3AU7A 1V8QA 2B63B 4OO1G 3CHBD 1V1PA 1Z47A 3K59A 2R3ZA 3MWYW 1SE3A 3BVMA 1RD9D 2RKSA 5IGDA 1NR2A 3KLRA 2RA4A 1TS3A 4PV1C 4KHVA 5IIFA 1PRTB 5IOCA 2JA7B 3ONAB 2F0GA 4H0LC 2RQXA 4O42A 3H09A 3I72A 2J7ZA 3RZOB 1D1KA 4X3TA 3CU7A 3I3CA 3J7AF 5I9OA 3R2IA 4RA8A 4XYOA 4DFAA 4HSVA 4I7ZC 4CHTB 3WOEA 1A15A 2E76C 4XT3B 3NP8A 3OOCA 1RF2D 3HS0C 3X3MA 3S1QB 2R93B 2L55A 2BDNA 3M3YB 2F0QA 5IODA 4KKSA 4L6TB 2AWOA 2ZXRA 2A74C 1ONLA 1LTID 2KEEA 1V1OA 5C5MA 2D5DA 3NXWA 1EL0A 4U673 1RJTA 2NVYB 2A69D 2EY1A 3BZDB 3V96A 1KDAA 3M7GA 3BYYB 2F03A 1TS4A 4A3BB 2F3VA 5BN3A 1DONA 2HDLA 4IUPA 5C5LA 3PUZA 3T53B 1JWSD 1ZKOA 3MC0B 1S5FD 2GA4B 1SNPA 1UNSA 5KYLA 2FMMA 3QOLA 5C0XG 4C2MB 4CJ0B 4MN3A 4RAUC 2PYKA 2EJGC 3AB9A 1IW7D 4QUCA 4DU9A 4RKBA 4R9WA 4J8QA 3MTSA 1O7YA 3HEJA 4A3KB 1GUSA 1UUPA 1ET6A 3DXJC 1S5CD 4CJ1B 5J1ZA 3D3RA 5K36H 3P7JA 1OO9B 1NR4A 1EY5A 1SJED 2OXPA 1Q90A 5T1IA 1D5ZC 4AYBB 3GV6A 1HTLD 1IHZA 3SK4A 1F9QA 1UAPA 3N52A 3FKIB 2R6GA 3V05A 2B2YC 1RTOA 1EEID 5ELCA 1LT6D 4IFDJ 2K04A 1C48A 3VA5A 2OT2A 1SBBB 3LWEA 5FOBB 1T5EA 1QILA 2WP8J 1S4ZA 2B2VC 3CKIB 1MGSA 3DWQA 1Q3LA 1Z7TA 2KECA 3K0YA 1SDFA 3GTMB 1HXYD 5TSSA 3A7LA 2BDOA 3GP7A 4K8IA 1KLUD 2D9UA 1BCPC 2EYJA 1STYA 2DNCA 2WKCA 3OW7A 3GTOB 2LMCB 1DOLA 5C3EB 1TS5A 5D3DA 1EZ6A 2E2HB 1PYWD 2O4XA 4LMQD 2HCIA 4XT1B 3S15B 4C3IG 2EYMA 3HP3A 2IX0A 3S16B 1RHPA 4KD4A 3A8IE 2M9VA 2KEDA 5JEAH 1NAPA 1HQRD 3K5LA 1SYCA 4J1MA 3I8ZA 3O13A 4Q0FA 1E2WA 4KN7C 1PZJD 4F8MA 5C3WA 3PIP3 1I4QA 4IN3A 4F7XA 3GTPB 3QG1A 5T1GA 2L5TA 5BN5A 3S14B 3A7AB 4A3IB 3E6ZX 4TKOB 2F0OA 3HG9A 3QB3A 1TWCB 1HUMA 4A3EB 2BOSA 2Q8RE 3IFTA 4KTAA 2XRQD 2CW0D 5CV7A 3EVQA 2EE1A 2F0SA 2F4IA 2Y0SB 1I4PA 3A8KE 3S17B 3GO5A 2K28A 4HAEA 1EY0A 4IALA 1F2LA 2Z4IA 2EY2A 1HA6A 4R8IA 3M85A 1B53A 2DNEA 2BE5D 1TY0A 5E4XA 4F88A 1VF5C 3V2TA 3HOUB 2KCCA 3H94A 3R2TA 1DOMA 5C0XI 1IL8A 1DXMA 1Y1WB 1TWAB 3D8GA 4CKCA 5IT9E 1TWFB 4ZYSA 5DM73 2C5CA 5CV8A 3L9AX 4XQNA 1HUNA 1Q12A 4EQNA 3TP7A 1E2VA 2DN8A 5LHY1 1LTTD 4Q5VA 3FVQA 4LAAA 5JEAJ 4IFDI 2NVQB 1FNVA 3D31A 2O5JC 1DCZA 2B39A 1F77A 1D6EC 1EWCA 4U68A 2RDHA 2NTTA 1AN8A 2FFKB 1C4QA 2ENBA 4BA1I 1EY6A 3KLSA 3L3OC 3TZUA 4JBWA 2AUJD 2XWJB 5C4JB 3C3LA 2EYFA 2TSSA 4S3SA 4M1UB 4WJWA 1ILPA 2NYZD 2K01A 4NW2A 1Y8OB 2F0EA 3HOXB 1EWHA 1F2YA 4N9PA 3SE0A 4FXKC 2RBMA 4OGQC 4A3GB 4TSSA 5DEHA 3NSWA 1MBYA 2F0NA 3G6JB 3N6RA 3BYTB 4C3HG 5C4XB 2Z4HA 1WTWA 3NBIA 2KOLA 3A56A 2AQ2B 2QEJC 3D6CA 3VR6A 1EEFD 3GTJB 5LL6X 5NUCA 1UEAB 4G7OC 4BBSB 1JQYD 1HCZA 2YYZA 4QF4A 1O80A 1OXVA 2LS01 2B8FA 4O1NA 1GHKA 5HGTA 1LLRD 3VR2A 3PO3B 3RLFA 2DY8A 1SFOB 4HR7B 4ZKBB 3PO2B 5M3FB 4C1NI 2EPBA 3MXUA 4KY7A 2WKDA 3MFYA 2HQEA 1JORA 2A69C 2F0DA 3P20A 2VNUD 5FLXE 3MXNA 4C3JB 2MP1A 4KJNA 3A8JE 2EZVA 3I90A 4UAIA 1AW7A 2PZWA 2B2TA 5CV5A 1EQTA 3QO2A 3OSOA 5IT9L 3S1RB 2ICIA 2AUKA 3D4RA 1SJHD 3Q6SA 1I3QB 2WV6D 3VYRA 1ZYRD 3VR3A 3FMCA 1Q8IA 2PO4A 2IWHA 2BA0A 2ID0A 5AFWA 5C6AA 4EQOA 2IPKD 2FMCA 1Q1BA 1AEXA 1EY4A 1SAPA 2XVSA 1CZWA 1BF4A 5JAVA 1GUNA 1TR5A 3TP5A 5KRUA 5KNDA 2K5DA 4H7BA 1FGBD 1B50A 2KVMA 1IKMA 2E74C 2B2WA 1YNND 3I70A 1M4VA 4ODGA 2XN9C 4A3JB 1O7ZA 1QJOA 3K7AB 1L0YB 1WTXA 1SE4A 3VYTA 3FRPB 1HHVA 1H9SB 2A6HD 4K2KA 2EVBA 1FR3A 1CHQD 2NN6G 3W3AA 1B44D 3NWSA 4KJOA 5IGBA 2MPMA 3GV3A 3URYA 1BBXC 3U9OA 1A3VA 1AZQA 2IJ0A 1WTPA 2TMPA 4DAVA 1PFBA 5JOBA 2B2WC 5JVH3 2WACA 5ELEA 3PUXA 1A2UA 4J6HA 5ELDA 1GHJA 2I46A 3NQTA 1D1IA 3I73A 3I4MB 3GTGB 3TSSA 1STAA 3IFDA 3D4WA 1DD2A 4G7HC 4IFDH 4PMBA 2SOBA 3K57A 5G3LF 1CI3M 2I07B 2X69A 2F0IA 1CM9A 5CYUA 5FLXL 3SEBA 4EGVA 3NK9A 4DAPA 3HKZB 3R3OA 4K5VA 3DHQA 1G2SA 1FD7D 1CHPD 1E0BA 4HTHA 4RH6A 2CW0C 1EQVA 4BBRB 3MXGA 1WD1A 2F0LA 2Q8TA 1QG7A 1O7LA 2MGSA 1EYAA 5EBCA 4BS9A 2XRSD 4KKUA 5CORA 1BDOA 3D4DA 1SNDA 2BE5C 4PMCA 2B2YA 1HA5A 4NKLA 4P2CB 1SMYD 1O78A 2K05A 1I6HB 3BVGA 2F0WA 3TP6A 1LV9A 2B2VA 4B9WA 1SNQA 5A2QE 2EJMA 1I50B 2IX3A 2MUYA 4XXEA 1R4PB 2L11A 1B9NA 3R8BA 4WRDA 3MEHA 5C0XJ 2NUCA 5EJWA 3DEOA 2EXZA 1NUCA 3PUWA 1Y8PB 2EOTA 2K03A 4KK7A 1HRJA 2KHSA 1DM0B 2JE6I 3KUPA 1ILQA 4HSPA 1JC7A 4OIJA 3TP8A 1SYBA 1PTOF 4QUFA 4ABNA 1F2MA 1NCVA 4RCNA 4OO1I 3SDZA 3F2UA 1F2ZA 3AMUA 1I6VC 2K33A 1H9SA 3LWUA 4M8AA 3NBHA 2VXWA 1I4GA 1NSNS 2R92B 4B9XA 3SXHA 2PZTA 1GXDC 1Z6HA 3BDOA 2BCOA 3OMCA 2PPBC 1W6KA 2N55A 4QCLA 5IGFA 3LNNA 5EKIA 2R7ZB 1EFID 1LTRD 1ENCA 1QNKA 1DYQA 3PV0A 1HTPA 1BNZA 4ZUJA 1I4XA 1ICWA 4BY1B 1STHA 2G9HD 1VMPA 2IL8A 4ULLA 2H1EA 1KNEA 5FO8B 1Y69U 2K1BA 2F3WA 4K6DA 4KMUC 3X3NA 5K36G 1CQFA 2IX1A 2NWGA 3DWAA 2D2CC 2HCCA 3ERQA 2FINB 4A3FB 4CJ2C 3FPUB 4IQZA 1KDCA 2SNSA 1MI2A 3K6OA 5FO7B 5HURA 2JXMB 5M3MB 1BOSA 3BDLA 2DY7A 3FEWX 3DMUA 1YNJC 5C4ZA 3MFGA 3ND8A 5CBEE 2J4XA 3SK8A 3TN2A 1FNWA 2K32A 2M00A 3EROA 2R61A 3LX0A 5A2QL 3K5OA 2YU9B 1GJXA 2MHVA 1BQQT 3EFXD 1H9KA 3I4NB 1WCMB 1PTOC 4IUNA 1F9PA 4NMZA 4LK1C 3T16A 4RFBA 3E0JA 3GQBA 3Q23A 2H4OA 2ZT9C 1ZYRC 1JWUD 5JEAG 5EGTA 5EPLA 1XYIA 1TU2B 3OWFA 3VA7A 3KK7A 4TQUS 4DXFA 1JICA 1SXTA 4WORA 1WTVA 1VCIA 3S2HB 1FYCA 5FO9B 1TY2A 2EYHA 5BN4A 2Z8LA 2F0VA 4K14A 4C3IB 1CA6A 4C56C 2RDGA 1T5XD 5COYA 4KN4C 3OWEB 4DNRB 3QOJA 2K5WA 1YNNC 1OXSC 1STNA 5G3LD 3TBIB 3OPOA 2NB0A 2K6AA 1FNUA 1B1ZA 1AZPA 1PFNA 1WTQA 2A6HC 4ZLTF 2JA6B 1SE2A 3NWTA 1VMCA 1KABA 1EU3A 2KA7A 3NUCA 3RUZA 3R93A 4V190 5CR3A 2ZXPA 1W6JA 1JE4A 5KYIA 4FXGC 2L4NA 5FKAC 1PTOH 4IURA 3DWPA 5E3FA 4H13C 4DXGA 1S5DD 4KI0A 4G4KA 5DAUA 1EIHA 3MAQA 4R8NA 3ND9A 1JB3A 1I4RA 4L8JA 4C1NK 5A35A 1LT4D 2F0MA 2AWNA 2F0JA 2C9OA 3IL8A 1WTOA 4WFN3 5M5YB 3E5SA 3Q22A 1JOKA 1XTCD 3W2DA 2JEAI 1L0XB 3BDCA 1ESFA 1EY9A 3L7ZC 3D6WA 2IT1A 1YNJD 2E75C 5KNCA 4QMGA 4ZK9B 4OO1H 4XQQA 1STBA 3M4YA 5JVG3 1PZID 3RMHA 2NBFA 1TWHB 2A68C 4GZYC 4LJZC 5CV4A 1RCVD 3CRLC 3EA6A 3H91A 3T56B 2OF1A 2ZXOA 2NVXB 3NPPA 4IUQA 1PTOD 2PQEA 2RVLA 1PXUA 4DK0A 1OXXK 3BG3A 5CBAE 1WTRA 4YIJA 2K5QA 1Y8NB 2JEBI 3HOWB 1SMYC 2CHBD 4X3UA 5IGEA 2JA5B 1TKWB 1D5XC 4RCOA 1QE6A 1TT2A 3OIPA 1BUVT 3MHBA 2OEOA 1CTMA 1F9SA 2EDGA 5ELBA 1KNAA 3HOYB 1S5BD 3CQZB 2RSNA 3IAYA 3RD4A 3S1MB 4G7ZC 2B2UC 1X32A 3NTHA 2A6ED 2PZUA 4OL7A 3ITPA 2KUMA 3NHHA 4HCEA 2WINB 1TWGB 4FXDA 3T4AC 3I4LA 3QWNA 4L63B 1QOHA 1PLFA 2PMZB 2Q8IB 5ISRA 5EPKA 3NE5B 4C3HB 4RWSC 4RGOS 3C46A 1G6ZA 5EBDA 2EJFC 3C1FA 1LT5D 1DJRD 4DAYA 2QCPX 1RDPD 5CV9A 3SVMA 2F0PA 5C44B 1EOTA 1U4PA 1EY7A 5C0XH 1H9JA 1U9RA 1TVXA 1H9MA 2X6LA 3PUYA 5D3IB 2SDFA 5LL6S 1B2TA 3FPPA 3P75A 5CMDA 2XWBB 4FF3A 3GTLB 1A3UA 4XIGS 4KD3A 2EYOA 4TRDA 1KAAA 1EYDA 3H0GB 3T13A 2FHTA 4DN4M 1X3PA 3J80E 4A93B 2L1BA 1PTOB 2RSOA 5I2XA 2NVTB 4K8JA 1SYFA 1J8IA 1G8ZD 1XX8A 4A3MB 4FF2A 1MSHA 4OIKA 1BCPF 3J81L 4PMWA 3DUZA 4KHZA 2A68D 2SEBD 4EVOA 2PNRC 4K5WA 3C2PA 4RGTA 1LTGD 4DF7A 2EYLA 1A3TA 4EQPA 2HUGA 1B9MA 2JA8B 4BWGB 4H44C 1BR9A 2QKIC 4DA2A 4JK1C 1JOOA 3A55A 3K5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUC A;  2EY2 A;  4S3S A;  1KDB A;  1EYC A;  3NQT A;  2F0U A;  5CV9 A;  3PMF A;  1ENA A;  5C5M A;  1SNM A;  4G57 A;  5K5P A;  2EXZ A;  3OMG A;  3NXW A;  1NUC A;  3QOJ A;  4HMJ A;  2LKV A;  3HZX A;  5CV4 A;  1SYE A;  3SK5 A;  2F0P A;  3EJI A;  5J39 A;  1KDC A;  2F0E A;  1STA A;  1SYD A;  2SNS A;  4DGZ A;  2EY1 A;  2PW5 A;  1F2Y A;  1STN A;  4N9P A;  4PNY A;  2F0H A;  1KDA A;  3D4W A;  5HUR A;  5C6A A;  4IZ8 A;  2KHS A;  2F3V A;  3V2T A;  4EQO A;  2OF1 A;  2RDF A;  5C4H A;  4K8I A;  4PMB A;  2RBM A;  2SOB A;  1STG A;  3BDL A;  3MVV A;  1EY7 A;  4NP5 A;  2EYJ A;  1U9R A;  2PQE A;  4KY5 A;  1STY A;  1AEX A;  1EY4 A;  5DEH A;  5C5L A;  5E1F A;  5I6W A;  1II3 A;  2F0N A;  1TQO A;  2F0I A;  3DMU A;  5C4Z A;  3TP8 A;  1SYB A;  2RKS A;  1EY8 A;  4KY6 A;  4K2L A;  4MIU A;  5IGD A;  4YIJ A;  1EZ6 A;  3P75 A;  4QB4 A;  3NK9 A;  5JAV A;  3R3O A;  1F2M A;  4KHV A;  5IIF A;  2O4X A;  4K5V A;  3SK8 A;  1TR5 A;  3DHQ A;  3D8G A;  1EZ8 A;  3TP5 A;  1SNP A;  2M00 A;  3ERO A;  5IGC A;  1A3U A;  1F2Z A;  1KAB A;  3QOL A;  4H7B A;  5IGE A;  2F0F A;  5KGU A;  5KRU A;  3LX0 A;  4RKL A;  4HTH A;  5CV8 A;  3D6C A;  2EYM A;  4KD3 A;  3C1E A;  5EKL A;  1TT2 A;  4ME5 A;  4ZQ3 A;  1SNO A;  2F0G A;  3NUC A;  3RUZ A;  2EYO A;  4TRD A;  1KAA A;  4KD4 A;  5NUC A;  3MHB A;  1NSN S;  4EQN A;  3TP7 A;  5IOC A;  1EYD A;  2OEO A;  5CV6 A;  5CR3 A;  4B9X A;  3T13 A;  1EQV A;  2EYP A;  4ODG A;  5KIX A;  5KYL A;  4LAA A;  4QF4 A;  3SXH A;  2F0L A;  3TME A;  5KYI A;  4IUN A;  2F0K A;  2PYK A;  2PZT A;  1SYC A;  5M9O A;  4J1M A;  4NMZ A;  3T16 A;  5HGT A;  5I9O A;  1SNC A;  1EYA A;  2F0T A;  3OMC A;  5E3F A;  4K8J A;  2KQ3 A;  1SYF A;  4DU9 A;  4RKB A;  4N9T A;  2SNM A;  4DFA A;  5DAU A;  2EY6 A;  5IGF A;  5J22 A;  2PZU A;  2EY5 A;  3D4D A;  1RKN A;  1SND A;  3HEJ A;  3SK6 A;  1ENC A;  4F8M A;  5C3W A;  5CC4 A;  4KY7 A;  4R8N A;  3P1H A;  5I6Y A;  4F7X A;  4K2K A;  4OL7 A;  3ITP A;  4E6I A;  5EGT A;  1SYG A;  3NHH A;  2HQE A;  5KEE A;  5EKK A;  1JOR A;  4PMC A;  2F0D A;  5J1Z A;  4EVO A;  3H6M A;  3OWF A;  2F0M A;  1A2T A;  4NKL A;  3NP8 A;  1EY5 A;  4K5W A;  4ZUJ A;  2OXP A;  2F0O A;  2F0J A;  4KJN A;  3MZ5 A;  1STH A;  3QB3 A;  2ENB A;  2F0W A;  4KJO A;  5IGG A;  2QDB A;  3E5S A;  4WOR A;  3TP6 A;  5IGB A;  1EY6 A;  1JOK A;  3SHL A;  2PW7 A;  4B9W A;  5ISR A;  3U9O A;  1A3V A;  4ID6 A;  1IHZ A;  4NDX A;  4DF7 A;  3SK4 A;  2PZW A;  2F3W A;  4K5X A;  1SNQ A;  4KTA A;  5CV5 A;  1JOQ A;  2EYL A;  3BDC A;  3SR1 A;  5I9P A;  4I65 A;  1EY9 A;  5CGK A;  4K6D A;  1A3T A;  4ZUI A;  5CV7 A;  4EQP A;  2EYH A;  2F0Q A;  3EVQ A;  3OSO A;  3MXP A;  5IOD A;  3S9W A;  2F0S A;  5JOB A;  4HMI A;  5C3X A;  4KV6 A;  2F0V A;  4K14 A;  3C1F A;  2WAC A;  4WRD A;  4QMG A;  1EY0 A;  3MEH A;  5F2D A;  1A2U A;  4J6H A;  3VA5 A;  2EYF A;  1JOO A;  4IAL A;  1STB A;  3ERQ A; 
#chains in the Genus database with same CATH topology
 2LFN A;  3K80 C;  1ENF A;  3ER0 A;  1VQ5 A;  1SNM A;  1PRT F;  4JI8 L;  4QY7 A;  5EQ0 A;  4AQY Q;  1SYE A;  1LUZ A;  3ZYY X;  4DGZ A;  2PW5 A;  4A76 A;  1WD0 A;  2MO0 A;  3PIO 3;  1KLG D;  4DNT B;  3M4O H;  1BXT A;  3TDQ A;  1STG A;  3MVV A;  4NP5 A;  4C3I H;  5EPJ A;  5KNB A;  1HNX Q;  3ULP A;  4A3F G;  4B3S Q;  5E1F A;  5I6W A;  2UUC Q;  3G48 A;  2WAQ B;  4A3E G;  2E2I B;  4BA2 I;  2KEN A;  3CRK C;  3NQI A;  4LFB L;  2UXD Q;  4HED A;  4IFD G;  5M3M G;  4X64 L;  1J5E Q;  4RKL A;  5JPM C;  1JB7 A;  2XSC A;  1GUT A;  5D65 A;  1DOK A;  2EIF A;  1XMQ Q;  4DR7 Q;  3OHX C;  4B3R L;  1ET9 A;  5KIX A;  2WAQ E;  3LGJ A;  4X66 L;  1LO5 D;  4MHE A;  3K58 A;  4RGN A;  3RLN A;  1TS2 A;  3TME A;  1AFP A;  4R4O A;  3DEP A;  4IJL A;  4BY7 H;  2CVR A;  1QCB D;  4LF4 L;  1NJI C;  2EY6 A;  1U4L A;  2EY5 A;  2KCT A;  1D5M C;  2UUA Q;  3I4N G;  1VF7 A;  3KF8 A;  1DZ1 A;  1JR0 D;  3EQL C;  4PQX A;  3QJY A;  4GOP A;  4JI7 Q;  4R4I A;  1PFM A;  1ZEQ X;  1IKL A;  1HNW L;  3M4Q A;  2AQ3 B;  1YJ9 A;  1Y1W G;  5IGG A;  3H3V C;  3OIQ A;  2EXD A;  4IPG A;  1D2B A;  4DK6 C;  2NN6 I;  4FO2 A;  4ZUI A;  2M2L A;  3PF5 A;  1SSO A;  4L5Q A;  4K6L A;  4DNI A;  4HMI A;  4FF4 A;  1VQB A;  2JYO A;  4XYQ A;  3CD6 A;  1A6X A;  3UDI A;  2ICE C;  4UP9 A;  2K7V A;  4DR1 L;  1KDB A;  2AHO B;  4PZ8 A;  4GLV B;  3PMF A;  4J15 A;  5M5Y H;  4JV5 L;  1A0I A;  3OMG A;  2F52 A;  2PNH A;  4P71 A;  3J80 L;  5ELN A;  5J39 A;  2G5D A;  4DKA C;  1G91 A;  4CGY B;  2I0Q A;  4A3L G;  4R1J A;  4RHS A;  1X55 A;  2RHS B;  3VR5 A;  3HGB A;  4GOP C;  2E2J H;  2A5H A;  4FP5 D;  1BO0 A;  4KY5 A;  5IT9 c;  3JAM E;  4KY6 A;  1B3Q A;  4K2L A;  4MIU A;  1JMC A;  3HOZ B;  1PRT C;  1XNR Q;  1C0A A;  4CKB A;  2E8G A;  1EZ8 A;  1ESR A;  5IGC A;  3TZD A;  1B3A A;  5KGU A;  2F0F A;  5DLQ E;  1G29 1;  2D62 A;  3KOJ A;  1IYU A;  2BA1 A;  2A73 B;  1PDQ A;  3C1E A;  2NVX H;  3TS0 A;  2B8G A;  2ZTD A;  2HIX A;  2JA6 G;  1LTL A;  4JI6 Q;  1I4H A;  3S2D H;  4IPC A;  1IXR A;  3A54 A;  2L9H A;  1G2T A;  1SN8 A;  2WII B;  4POF A;  3CC2 A;  2IHF A;  5M5X B;  1SNC A;  3HOX G;  4DV2 Q;  4JPB W;  1OXT A;  1PMR A;  1OTC A;  5J22 A;  2JA5 H;  3AFP A;  3L2P A;  3GTK B;  3FHW A;  4JBK A;  2VB3 X;  2VB2 X;  1CT1 D;  3Q8D A;  3P1H A;  1S3O A;  4E6I A;  4FNF A;  4FVM A;  3B6Y A;  4UHV A;  1C7Y A;  1QNU A;  2QIL A;  1XPU A;  4DV5 L;  1LAB A;  2OQK A;  4KKT A;  2Q2T A;  1CQV A;  1VDZ A;  3HOY H;  3CQZ H;  5M5W B;  1LTS D;  1Q82 C;  3H3V H;  4NDX A;  4ID6 A;  2BH8 A;  1K8M A;  1IYJ B;  4K5X A;  1PYB A;  5I9P A;  2UUB Q;  3HRZ C;  5IYD H;  4I65 A;  4Z9C B;  4RGM A;  2Y0S E;  2PI2 E;  3QIA A;  4B08 A;  1GOZ A;  3S9W A;  4Y52 H;  3RZD B;  1BBW A;  4UDU C;  2MFI A;  4UPA A;  4HJA A;  5F2D A;  3BU2 A;  4JI1 Q;  4A75 A;  1KD1 C;  3G7L A;  4LF5 L;  5ELF A;  1EYC A;  1ZXT A;  4A3D H;  2LY7 A;  1ENA A;  2GVA A;  4DV0 Q;  4ZRZ A;  3HZX A;  3PO2 G;  2DGY A;  3EJI A;  2PCF B;  5DM6 3;  1K83 H;  1SYD A;  2AQ1 B;  3L0O A;  4C3H H;  4PNY A;  1PFS A;  4XTC S;  2JA9 A;  1STE A;  2RDF A;  1XWE A;  4FYD A;  1V43 A;  1ML0 D;  3M4O B;  2CQA A;  4C3J G;  2A6E C;  1B7Y B;  5DNF A;  1U4M A;  3K8A A;  1KL9 A;  1TQO A;  1JCK B;  3GD7 A;  3MEF A;  1EY8 A;  1GUW A;  2YV5 A;  1HNZ L;  3J7Z C;  3JAM i;  3CCS A;  1I94 Q;  1KRT A;  2F1M A;  1CK1 A;  1XTD A;  5I2Y A;  1HFN A;  2JA7 H;  4DUY Q;  5C44 H;  4YY3 L;  4ME5 A;  4ZQ3 A;  4JI0 L;  3J7Y W;  1V1P B;  4X62 L;  4PZ7 A;  4DR3 L;  3EN2 A;  4LFB Q;  3U9S A;  3U4V A;  2EYP A;  4FF1 A;  3Q24 A;  1CFM A;  3HOW G;  3T51 B;  2F0K A;  5M9O A;  1CKO A;  4CBV A;  1ICF B;  4JOI C;  1LAC A;  4OWW B;  5AJ3 Q;  2CKZ B;  2F0T A;  4BY7 B;  1MSG A;  4B3R Q;  1BCP D;  1Q1E A;  5FLX c;  3GTL H;  4X66 Q;  2L0C A;  1RKN A;  2JP1 A;  1J9O A;  3A5Z B;  5EKK A;  4LF4 Q;  1PH7 A;  3H6M A;  3H0G H;  4P73 A;  4XDX A;  2XIW A;  1X3G A;  1SLJ A;  3KBG A;  1X3Q A;  5JPN C;  4HN7 A;  3MZ5 A;  4OXP A;  2HHH L;  3E0E A;  3CXC A;  1KTK A;  2CCZ A;  2O2L D;  3JAM L;  1LTA D;  2R93 H;  1CZG A;  1EFW A;  2LSS A;  2IW3 A;  5LMN L;  1WVL A;  2Z6K A;  3SR1 A;  2VY3 A;  3MA2 B;  5ELO A;  5CGK A;  4A3M H;  1L1O B;  5IYC H;  3MXP A;  3HOV B;  4Y7N B;  3S1N B;  3KBX A;  4RHR A;  1PRT D;  3K0X A;  2V4D A;  3VYS A;  3IKJ A;  4IUT A;  4X3K A;  4G57 A;  2Z1C A;  3Q0A A;  1VQN A;  3NTK A;  4ILW A;  4HMJ A;  2LKV A;  3SK5 A;  4ZKC B;  3TS2 A;  2LXK A;  3FDT A;  1IZ6 A;  2BH2 A;  4DR1 Q;  3J7A V;  1R4Q B;  3I91 A;  1YIT A;  3VYU A;  1B4O A;  2WB1 B;  2OTL A;  4LNQ A;  2OCE A;  2JA8 H;  1E1T A;  2N88 A;  4ZAI A;  4JV5 Q;  1PH4 A;  1UE6 A;  2E2J B;  5IYB H;  1PH5 A;  2UXC L;  1CA5 A;  2K4K A;  2NZ1 D;  4AQY L;  1TII D;  1XMO Q;  2HDM A;  3ZJY C;  4CKE A;  2KJX A;  1II3 A;  2VUM B;  2L12 A;  3GTQ B;  3STB C;  2X6G A;  2ZTC A;  2E2D C;  1XXG A;  4QB4 A;  4HIM A;  4LWC A;  5C44 G;  2OQ0 A;  2GN5 A;  1M8A A;  1OXU A;  1S72 A;  4A3C G;  2MJ8 A;  2WB1 E;  2B2U A;  4C2M H;  3J81 E;  5E4W C;  4JI2 L;  2QF7 A;  3F8T A;  5EKL A;  1NY4 A;  1QB5 D;  1SNO A;  4IUU A;  2PI2 A;  1S5E D;  1P8L A;  2OTJ A;  1E2Z A;  5CV6 A;  4LUZ A;  4RMF A;  3KLS X;  2UXD L;  3S2D B;  4HCS A;  1AP0 A;  4X3S A;  1HZA A;  2NN6 H;  2B3G A;  1F9R A;  1LTB D;  1C8C A;  1J5E L;  1ROD A;  2E2I H;  1GUO A;  3WDN A;  2KQ3 A;  3UE0 A;  4N9T A;  1HFG A;  2SNM A;  3BS1 A;  3M4P A;  2O5I C;  3DM1 A;  2KCN A;  3SK6 A;  1SEB D;  5CC4 A;  5GRO A;  5I6Y A;  4N8F A;  1EIG A;  1HPC A;  1SYG A;  4XQJ A;  1MD2 D;  5KEE A;  5I4D A;  3M7N A;  1IYV A;  4QIW B;  4A93 G;  1A2T A;  1GUG A;  1PZK D;  3PQI A;  4DK1 A;  5FK9 C;  5GAG C;  3CPF A;  1KAW A;  2ZJP A;  4JI5 Q;  4GKJ L;  4F87 A;  2QDB A;  3VR4 A;  3HKS A;  3SHL A;  3W5O A;  4IUV A;  2PW7 A;  4EX5 A;  1JJG A;  1U4R A;  3BJU A;  2XNA C;  1JWM D;  3WOF A;  1JOQ A;  1HQM C;  1K8O A;  3BVZ A;  1IW7 C;  2NZH A;  1HZC A;  3UI2 A;  1K28 A;  5C3X A;  4KV6 A;  1H9R A;  2G9D A;  3TQY A;  4QIW E;  1BCP B;  5JJZ A;  4IPH A;  5JJI A;  3NTI A;  1RTN A;  1Y1V B;  5D14 A;  2QEX A;  1N32 L;  1QWY A;  1LT3 D;  2F0U A;  2JSO A;  2J0T D;  4A3D B;  5K5P A;  4V0B A;  2B2T C;  3K5N A;  3PUV A;  4KLK A;  1K83 B;  5IP9 G;  1EU4 A;  4LF5 Q;  2F0H A;  4OHJ A;  1R9T B;  2FJ2 A;  2NTS A;  4IZ8 A;  5C4H A;  3AU7 A;  1V8Q A;  2B63 B;  4B3T L;  4OO1 G;  3CHB D;  3CC7 A;  1V1P A;  1Z47 A;  3K59 A;  2R3Z A;  3GTO H;  3MWY W;  2RHQ B;  1IBM L;  1SE3 A;  5C3E H;  3BVM A;  1RD9 D;  2RKS A;  5IGD A;  1NR2 A;  3KLR A;  2RA4 A;  1M90 C;  2E2H H;  1TS3 A;  4PV1 C;  4KHV A;  5IIF A;  1PRT B;  1YJW A;  1Q81 C;  2VL6 A;  5IOC A;  2JA7 B;  1RIP A;  3E9I A;  3ONA B;  2Q2I A;  3S16 H;  4LF7 Q;  2F0G A;  4H0L C;  3D0F A;  3J81 i;  2WAQ G;  2RQX A;  4O42 A;  1X56 A;  4UY8 C;  1GO3 E;  3H09 A;  3I72 A;  4YY3 Q;  2J7Z A;  3RZO B;  1D1K A;  4X3T A;  3CU7 A;  3I3C A;  4JI0 Q;  3J7A F;  5I9O A;  4DR3 Q;  4NXM L;  3R2I A;  5FLM H;  4RA8 A;  4XYO A;  4DFA A;  4HSV A;  1YBY A;  4I7Z C;  4CHT B;  4JI6 L;  2JJQ A;  3WOE A;  3GTP H;  1EUJ A;  1SRU A;  1L1O A;  1A15 A;  1T9H A;  2E76 C;  3J7A 5;  3KLW A;  3S14 H;  1CUK A;  4XT3 B;  3NP8 A;  2DJF C;  3TRE A;  1TWC H;  2K5H A;  3OOC A;  1RF2 D;  1VQJ A;  4IOC A;  3HS0 C;  3X3M A;  2Q2H A;  3S1Q B;  2R93 B;  1EQR A;  2L55 A;  2BDN A;  2HHH Q;  3M3Y B;  2F0Q A;  5IE8 A;  5IOD A;  4KKS A;  2UXB L;  3DLL A;  4L6T B;  3STB D;  3S17 H;  2AWO A;  3J81 j;  3M9B A;  2ZXR A;  1MJC A;  2ZTE A;  2A74 C;  1ONL A;  1LTI D;  1NTG A;  2KEE A;  1V1O A;  5C5M A;  2D5D A;  5M5W H;  3NXW A;  1EL0 A;  1EQQ A;  3QR8 A;  4U67 3;  1RJT A;  2NVY B;  2A69 D;  2EY1 A;  3BZD B;  3V96 A;  1KDA A;  1L1O C;  3BYY B;  3M7G A;  2F03 A;  1TS4 A;  4A3B B;  2F3V A;  5BN3 A;  4JI4 L;  3HOU H;  1DON A;  2HDL A;  4IUP A;  4AH6 A;  3RZD H;  1HR0 Q;  1NMF A;  5C5L A;  3PUZ A;  2DUD A;  1A63 A;  3T53 B;  1JWS D;  1ZKO A;  3S24 A;  3MC0 B;  1WJJ A;  3CAM A;  2UXC Q;  1TWA H;  1S5F D;  3G4S A;  2GA4 B;  1SNP A;  1UNS A;  5KYL A;  1YI2 A;  2FMM A;  3QOL A;  4DV7 L;  1PHJ A;  5C0X G;  4C2M B;  4CJ0 B;  1MKH A;  1I94 L;  3GDE A;  3HOZ G;  4DUZ Q;  4DUY L;  4JI2 Q;  2NVQ H;  4MN3 A;  4RAU C;  2PYK A;  2EJG C;  3AB9 A;  1IW7 D;  1QVC A;  3W1B A;  4HID A;  4QUC A;  4DU9 A;  4RKB A;  4R9W A;  3CCE A;  4J8Q A;  3MTS A;  1O7Y A;  3HEJ A;  4A3K B;  1PH9 A;  1GUS A;  1UUP A;  4MTN A;  1D7Q A;  1ET6 A;  3DXJ C;  4AIM A;  1S5C D;  4CJ1 B;  4P74 A;  5J1Z A;  5AJ3 L;  3D3R A;  5K36 H;  3P7J A;  1OO9 B;  1NR4 A;  1EY5 A;  1SJE D;  2OXP A;  1Q90 A;  4QJF A;  5T1I A;  2CWA A;  1YNX A;  1D5Z C;  1W2B A;  4AYB B;  3TEH B;  4GKK Q;  3GV6 A;  1HTL D;  3J80 i;  1IHZ A;  3SK4 A;  3CCV A;  1F9Q A;  2Q2U A;  1UAP A;  3N52 A;  3FKI B;  2R6G A;  3V05 A;  1CSQ A;  2B2Y C;  4GKJ Q;  1RTO A;  1YEZ A;  3DM3 A;  1EEI D;  5ELC A;  1LT6 D;  4IFD J;  1WCM G;  2K04 A;  1C48 A;  3VA5 A;  1A62 A;  3E9H A;  2OT2 A;  1NE3 A;  1SBB B;  3LWE A;  5FOB B;  1T5E A;  1QIL A;  2WP8 J;  1S4Z A;  2QW7 A;  2B2V C;  3A74 A;  3DWQ A;  1MGS A;  3CKI B;  1Q3L A;  1Z7T A;  4AYB E;  2KEC A;  1K8G A;  3K0Y A;  1SDF A;  3GTM B;  1HXY D;  1N32 Q;  5TSS A;  3A7L A;  3HFZ B;  2BDO A;  3HOV H;  3GP7 A;  4K8I A;  4Y7N H;  1KLU D;  2D9U A;  3S1N H;  1BCP C;  4A3G H;  2DJG C;  2N78 A;  2AMC B;  2EYJ A;  1STY A;  2DNC A;  2WKC A;  3OW7 A;  1QUQ B;  4QGU A;  3GTO B;  2LMC B;  1DOL A;  5C3E B;  1TS5 A;  2B29 A;  5D3D A;  4B3T Q;  1EZ6 A;  5C4X H;  2E2H B;  1PYW D;  2O4X A;  4LMQ D;  4JI3 Q;  2HCI A;  1IBM Q;  1XMO L;  4XT1 B;  3S15 B;  4C3I G;  2EYM A;  4EQ5 A;  3HP3 A;  2IX0 A;  3S16 B;  4K0K L;  4LF9 Q;  1RHP A;  4GS3 A;  4KD4 A;  2KHJ A;  3A8I E;  2M9V A;  2KED A;  5JEA H;  4BBS H;  1NAP A;  2VUM H;  2UU9 Q;  2VS1 A;  3GTQ H;  1HQR D;  3K5L A;  1SYC A;  3T1Y Q;  4J1M A;  3I8Z A;  4DPG A;  3PO3 H;  4DR4 L;  3O13 A;  2D0O A;  4Q0F A;  1E2W A;  4KN7 C;  3A0J A;  1PZJ D;  5M3F H;  4F8M A;  5C3W A;  3PIP 3;  2K75 A;  1PV4 A;  1I4Q A;  4BXX H;  2C35 B;  4IN3 A;  4F7X A;  3GTP B;  3QG1 A;  1LYL A;  5T1G A;  2L5T A;  5BN5 A;  4NXM Q;  3S14 B;  3A7A B;  4A3I B;  3E6Z X;  4TKO B;  2F0O A;  1PH6 A;  3CCQ A;  3HG9 A;  4BY7 G;  3QB3 A;  1TWC B;  1HUM A;  4A3E B;  2BOS A;  2Q8R E;  3IFT A;  1H95 A;  4KTA A;  2XRQ D;  2CW0 D;  4JBM A;  1C9O A;  2K5N A;  3AQQ A;  1B8A A;  5CV7 A;  3EVQ A;  1KRS A;  2EE1 A;  4JI5 L;  2F0S A;  5GQO A;  2F4I A;  2Y0S B;  1I4P A;  3A8K E;  3S17 B;  3GO5 A;  1K9M C;  2K28 A;  4HAE A;  1EY0 A;  4L5R C;  3MXN B;  1I3Q H;  4IAL A;  1F2L A;  2Z4I A;  2EY2 A;  1HA6 A;  4R8I A;  3M85 A;  2HT1 A;  2UXB Q;  1VQI A;  4JW0 A;  1B53 A;  2DNE A;  2BE5 D;  1TY0 A;  5E4X A;  4F88 A;  1VF5 C;  3V2T A;  5FJ8 H;  3HOU B;  4HJ9 A;  1VQC A;  4DV1 L;  3I2Z A;  2KCC A;  3H94 A;  1Y1V H;  3G71 A;  3R2T A;  4JI4 Q;  1DOM A;  5C0X I;  1IL8 A;  1DXM A;  3I55 A;  1Y1W B;  1TWA B;  2WB1 G;  3AFQ A;  4JOI A;  3D8G A;  4CKC A;  5IT9 E;  1TWF B;  4ZYS A;  5DM7 3;  1PH8 A;  2KBN A;  1R9T H;  2C5C A;  5CV8 A;  3L9A X;  4XQN A;  2B63 H;  1HUN A;  4R4T A;  2ALY B;  4IPD A;  1Q12 A;  4EQN A;  3TP7 A;  5IP7 H;  1E2V A;  2DN8 A;  5LHY 1;  1LTT D;  2YTX A;  3FVQ A;  4Q5V A;  4A3J H;  4DV7 Q;  4LAA A;  4B3M L;  5JEA J;  3K7A H;  4IFD I;  3I56 A;  2NVQ B;  5JJK A;  1FNV A;  1K73 C;  1N36 L;  4LF7 L;  3KDF B;  3D31 A;  2O5J C;  1DCZ A;  2B39 A;  4GLA C;  1GM5 A;  4N8X 1;  1F77 A;  1D6E C;  1EWC A;  4U68 A;  2RDH A;  3ICE A;  1MHW C;  2NTT A;  1AN8 A;  2RCF A;  2FFK B;  1C4Q A;  1GD7 A;  2ENB A;  3RZO H;  4BA1 I;  3KF6 B;  4UP8 A;  4HJ7 A;  1EY6 A;  1KHI A;  2JA5 G;  4FDB A;  1WTH A;  4OX9 L;  3I7F A;  3KLS A;  1XPR A;  3W1G A;  3L3O C;  3TZU A;  4JBW A;  2AUJ D;  2XWJ B;  1FVI A;  4DAY B;  4DK3 C;  5C4J B;  3C3L A;  3HOY G;  2EYF A;  1W3S A;  1QUQ A;  2TSS A;  4S3S A;  4M1U B;  4WJW A;  1ILP A;  2NYZ D;  2K01 A;  3I4M H;  4NW2 A;  3GTG H;  2H5X A;  3A5U A;  1A8V A;  5IYD G;  4MNO A;  1NBW A;  3S1Q H;  1Y8O B;  2F0E A;  3HOX B;  1EWH A;  1F2Y A;  4N9P A;  3SE0 A;  1VQ4 A;  1S40 A;  5GAD C;  3M3Y H;  4FXK C;  3AYH B;  2JN4 A;  4NXN L;  2RBM A;  4OGQ C;  4A3G B;  4WJ3 M;  4TSS A;  1FJG L;  4R4Q A;  4A3D G;  5DEH A;  3NSW A;  1MBY A;  2F0N A;  1VQO A;  3G6J B;  1VQA A;  4ME3 A;  1N34 L;  4JCV E;  2VW9 A;  3N6R A;  3F2B A;  3BYT B;  4C3H G;  1L2F A;  5C4X B;  2Z4H A;  3PIO A;  1HR0 L;  1WTW A;  3NBI A;  2NVY H;  2KOL A;  4NPS A;  2PQA B;  2AQ2 B;  3A56 A;  2QEJ C;  1U5K A;  1JJC B;  5LMU Q;  3D6C A;  3VR6 A;  4A3B H;  1EEF D;  3GTJ B;  5LL6 X;  5NUC A;  3BZK A;  1UEA B;  2YTY A;  3BZC A;  4G7O C;  4BBS B;  1JQY D;  1HCZ A;  1KIX A;  3SGI A;  2YYZ A;  2ASB A;  4QF4 A;  1O80 A;  3OTO Q;  1OXV A;  2LS0 1;  2B8F A;  4O1N A;  1KC8 C;  4K0K Q;  5HGT A;  1GHK A;  1LLR D;  3RLO A;  3VR2 A;  2JA7 G;  3PO3 B;  1RL2 A;  3RLF A;  1P16 A;  2DY8 A;  1SFO B;  4PG3 A;  2XTI A;  3F1Z A;  4OEL B;  4HR7 B;  4ZKB B;  4MZ9 A;  3PO2 B;  4DUZ L;  5M3F B;  2R7F A;  4C1N I;  2EPB A;  3MXU A;  4KY7 A;  2WKD A;  3MFY A;  2HQE A;  4DR4 Q;  1JOR A;  2A69 C;  2F0D A;  3P20 A;  2VNU D;  5FLX E;  2LXJ A;  3MXN A;  1I5F A;  4C3J B;  2MP1 A;  4KJN A;  3A8J E;  2EZV A;  1VQL A;  3I90 A;  4UAI A;  1AW7 A;  2PZW A;  2B2T A;  5CV5 A;  1BBU A;  1HJP A;  1EQT A;  2K14 A;  1JT8 A;  4A3K H;  3QO2 A;  3OSO A;  5IT9 L;  1Q7Y C;  3H0G G;  4GN3 B;  3S1R B;  3G6E A;  1PH3 A;  2EQS A;  1VQE A;  2AUK A;  2ICI A;  4LF8 Q;  4GKK L;  3PF4 A;  3D4R A;  1ASZ A;  1SJH D;  3Q6S A;  1I3Q B;  4JC0 A;  2R93 G;  2WV6 D;  1QZG A;  3VYR A;  1ZYR D;  3VR3 A;  3FMC A;  1Q8I A;  3PSI A;  2PO4 A;  3TRZ A;  3U50 C;  4A3M G;  2IWH A;  5IYC G;  3I4O A;  3FKI H;  2BA0 A;  4YCV A;  1PH1 A;  2ID0 A;  5AFW A;  5C6A A;  4EQO A;  2IPK D;  2HIV A;  2FMC A;  1Q1B A;  2MO1 A;  4IOA A;  1AEX A;  1EY4 A;  1E24 A;  4JYA L;  1G6P A;  1SAP A;  2XVS A;  1CZW A;  2QA4 A;  1BF4 A;  5JAV A;  4DV1 Q;  4GNX C;  1GUN A;  3KDF A;  1TR5 A;  3GTM H;  1AH9 A;  3TP5 A;  2JA8 G;  5KRU A;  5KND A;  2K5D A;  4H7B A;  1FGB D;  4LFC L;  1B50 A;  5IYB G;  2KVM A;  4OON A;  1IKM A;  2E74 C;  2R92 H;  2B2W A;  1VQH A;  1UE1 A;  1GKH A;  1YNN D;  3I70 A;  1M4V A;  4ODG A;  2XN9 C;  4JI3 L;  5LMN W;  4A3J B;  1O7Z A;  1UWV A;  3ULL A;  4O0A A;  4MTK A;  1QJO A;  3K7A B;  1L0Y B;  3PIP A;  1WTX A;  1SE4 A;  3VYT A;  4LF9 L;  4P72 A;  1V9P A;  3FRP B;  2R7Z H;  1HHV A;  4B3M Q;  1UE5 A;  1H9S B;  2QDL A;  2UU9 L;  3S15 H;  2A6H D;  4K2K A;  1VQF A;  4CDC C;  3NBH B;  1N36 Q;  2EVB A;  3T1Y L;  1FR3 A;  1CHQ D;  4P75 A;  2NN6 G;  2GVB A;  3W3A A;  4BY1 H;  1B44 D;  1J6Q A;  3NWS A;  4KJO A;  5IGB A;  2MPM A;  2JK8 A;  3GV3 A;  3URY A;  1UEB A;  4A3K G;  1BBX C;  3U9O A;  1A3V A;  1AZQ A;  2IJ0 A;  2HQL A;  1WTP A;  2TMP A;  4DAV A;  4YHH L;  1PFB A;  2VQE L;  1M1K C;  3H3V I;  5JOB A;  2B2W C;  5JVH 3;  4OX9 Q;  2WAC A;  5ELE A;  3PUX A;  4A3I H;  1A2U A;  4J6H A;  2Z6B A;  4L5S A;  5ELD A;  4UP7 A;  1GHJ A;  2OWO A;  4DV3 L;  1IBL L;  1X3E A;  2I46 A;  3NQT A;  1D1I A;  4A3F H;  3I73 A;  1EYG A;  4A4I A;  4A3E H;  3I4M B;  4YWM A;  3GTG B;  4DV4 L;  3TSS A;  1STA A;  3IFD A;  2PQA A;  3D4W A;  1DD2 A;  3EBE A;  1WYD A;  4G7H C;  4IFD H;  5M3M H;  4PMB A;  2SOB A;  3K57 A;  5G3L F;  1VQP A;  1CI3 M;  2I07 B;  5H1S E;  2X69 A;  2F0I A;  1CM9 A;  4JBJ A;  5CYU A;  3CCR A;  5FLX L;  3KJP A;  4NXN Q;  3SEB A;  4EGV A;  1O7I A;  3NK9 A;  3VDY A;  4DAP A;  3HKZ B;  3R3O A;  4K5V A;  1FJG Q;  1LM0 A;  3PCO B;  2VQF L;  3DHQ A;  1G2S A;  3UDF A;  1N34 Q;  1FD7 D;  1CHP D;  1E0B A;  4HTH A;  4RH6 A;  3F2C A;  2K50 A;  1K3B C;  1HZB A;  2CW0 C;  5C3E G;  3I4N H;  1EQV A;  4BBR B;  3MXG A;  1WD1 A;  4DAM A;  2F0L A;  5GAH C;  2Q8T A;  1QG7 A;  4X65 Q;  1O7L A;  3HKZ E;  2MGS A;  1EYA A;  1VQ8 A;  2CWP A;  1Y1W H;  1E22 A;  5EBC A;  4BS9 A;  2XRS D;  4KKU A;  5COR A;  1TWF H;  3F2D A;  1BDO A;  3D4D A;  1SND A;  2F4V Q;  1Y14 B;  2L15 A;  2BE5 C;  1PVO A;  4PMC A;  2B2Y A;  2YTV A;  1YHA A;  2P5Z X;  1HA5 A;  4NKL A;  4P2C B;  1SMY D;  2N49 A;  1O78 A;  1AE3 A;  2K05 A;  1I6H B;  3BVG A;  4HIO A;  1K0R A;  2F0W A;  1KQS A;  5FLM G;  3TP6 A;  1VQ7 A;  1LV9 A;  2B2V A;  4TVA B;  4B9W A;  1X54 A;  1SNQ A;  5A2Q E;  3S2H H;  5JJL A;  3UDG A;  2EJM A;  1I50 B;  1VQD A;  2IX3 A;  2MUY A;  4R4C A;  1XPO A;  2N3S A;  4XXE A;  4A3I G;  1R4P B;  2L11 A;  1VQM A;  4YWK A;  1B9N A;  4A3L H;  3R8B A;  4WRD A;  3MEH A;  5C0X J;  2NUC A;  5EJW A;  2I5H A;  3DEO A;  2Z9H A;  2EXZ A;  1NUC A;  3RN5 A;  3OYY A;  3PUW A;  1Y8P B;  2QGQ A;  2EOT A;  2K03 A;  1WOC A;  2Y0S G;  3NEL A;  3JAM c;  4KK7 A;  1X9N A;  1HRJ A;  2KHS A;  1DM0 B;  2JE6 I;  3KUP A;  4ALP A;  1ILQ A;  4HSP A;  2E5L L;  1YHQ A;  2XGT A;  1SR3 A;  5C4J H;  1JC7 A;  3CCM A;  4OIJ A;  2JA6 H;  3H15 A;  3TP8 A;  1SYB A;  1PTO F;  4IJH A;  4QUF A;  1N9W A;  4ABN A;  2N8N A;  1F2M A;  1NCV A;  1B70 B;  4RCN A;  4OO1 I;  3SDZ A;  3F2U A;  3HOX H;  3HOU G;  1F2Z A;  3AMU A;  4JYA Q;  1I6V C;  2K33 A;  2A19 A;  1H9S A;  3LWU A;  5HY6 A;  1EIY B;  4M8A A;  3NBH A;  2VXW A;  1I4G A;  1NSN S;  2R92 B;  4NB3 A;  4B9X A;  4CDF C;  4LUO A;  3PGZ A;  4LFC Q;  3SXH A;  1VQK A;  5LMU L;  2PZT A;  1GXD C;  1Z6H A;  3BDO A;  2BCO A;  3OMC A;  2PPB C;  1EWI A;  1W6K A;  2N55 A;  4QCL A;  5IGF A;  3LNN A;  5EKI A;  2R7Z B;  3UE1 A;  1EFI D;  1LTR D;  1ENC A;  3UDX A;  1QNK A;  3OTO L;  3GTJ H;  5L37 A;  1DYQ A;  3PV0 A;  1HTP A;  1K8A C;  1BNZ A;  4ZUJ A;  1I4X A;  3RN2 A;  1XNQ L;  1ICW A;  4BY1 B;  1STH A;  2G9H D;  1VMP A;  4LF6 L;  4PZ6 A;  2IL8 A;  4ULL A;  2H1E A;  1KNE A;  1X3F A;  5FO8 B;  1Y69 U;  1SFO H;  2K1B A;  2F3W A;  1YIJ A;  3EIV A;  1Z9F A;  3PO2 H;  4GLX A;  4LFA L;  4K6D A;  4KMU C;  3X3N A;  5K36 G;  4LUV A;  1CQF A;  2IX1 A;  2NWG A;  2MNA A;  3DWA A;  4GN5 A;  2D2C C;  4OWT B;  2HCC A;  3CC4 A;  3ERQ A;  4YHH Q;  3T1H L;  2VQE Q;  4C3J H;  2FIN B;  1TWH H;  4A3F B;  1QVG A;  2I5L X;  4CJ2 C;  3FPU B;  4IQZ A;  2MQH A;  1KDC A;  2SNS A;  4LF8 L;  3JC6 6;  1MI2 A;  3K6O A;  2ES2 A;  4L5T A;  4DV3 Q;  5FO7 B;  1IBL Q;  2RF4 A;  5HUR A;  2JXM B;  1Q46 A;  5M3M B;  4DV4 Q;  1BOS A;  3BDL A;  3S1R H;  2F3I A;  2DY7 A;  3FEW X;  3DMU A;  1YNJ C;  5C4Z A;  3KYH C;  3MFG A;  1EOV A;  3ND8 A;  5CBE E;  1FL0 A;  3HOW H;  2J4X A;  3SK8 A;  4GNX B;  3TN2 A;  1FNW A;  2KHI A;  2K32 A;  3HOV G;  2M00 A;  3ERO A;  2R61 A;  3LX0 A;  4A3G G;  2ZJQ A;  5A2Q L;  3K5O A;  2YU9 B;  1GJX A;  1E1O A;  2MHV A;  1BQQ T;  5IWA L;  3EFX D;  1H9K A;  2VQF Q;  4POG A;  3I4N B;  3RNU A;  1WCM B;  3NEM A;  5C4X G;  1VQG A;  2ZM6 L;  1PTO C;  4IUN A;  1F9P A;  4NMZ A;  4LK1 C;  3T16 A;  4RFB A;  3E0J A;  3S1M H;  3GQB A;  1YHB A;  3Q23 A;  1UE7 A;  3K7U C;  5J3B A;  2H4O A;  2FXQ A;  2ZT9 C;  1ZYR C;  1JWU D;  5JEA G;  4BBS G;  1TWG H;  5EGT A;  5EPL A;  1XYI A;  3AEV A;  1IL2 A;  2VUM G;  1TU2 B;  3OWF A;  3VA7 A;  3KK7 A;  4TQU S;  4DXF A;  3PO3 G;  1MIU A;  1JIC A;  4KHP L;  1SXT A;  4WOR A;  1YVC A;  5M3F G;  3CW2 C;  2I5M X;  4BXX G;  1QZH A;  1WTV A;  4OEM B;  1VCI A;  3S2H B;  1FYC A;  2K52 A;  1TY2 A;  1SRO A;  2EYH A;  5FO9 B;  3RR5 A;  1HH2 P;  5BN4 A;  4JI8 Q;  2HD3 A;  2Z8L A;  2F0V A;  4K14 A;  4C3I B;  4IO9 A;  1CA6 A;  1CKN B;  4C56 C;  3U4Z A;  2RDG A;  1QVF A;  1T5X D;  1PA6 A;  5COY A;  4KN4 C;  3CME A;  4DR2 L;  3OWE B;  4DNR B;  3QOJ A;  2K5W A;  1VQ6 A;  1YNN C;  1OXS C;  4RG1 A;  1STN A;  5G3L D;  3TBI B;  3ULJ A;  3OPO A;  2CH4 A;  2NB0 A;  4A3C H;  2K6A A;  1FNU A;  1B1Z A;  1AZP A;  3ERS X;  1N33 L;  4JG2 A;  1PFN A;  4X64 Q;  1X6O A;  1WTQ A;  2A6H C;  3J81 c;  4ZLT F;  2JA6 B;  1SMX A;  1SE8 A;  1TXY A;  1SE2 A;  2E5L Q;  3KJO A;  3NWT A;  1VMC A;  4OWX B;  5FJ8 G;  1KAB A;  3U58 A;  1EU3 A;  2KA7 A;  3NUC A;  3RUZ A;  1YJN A;  3R93 A;  1Y1V G;  4V19 0;  5CR3 A;  4DR5 L;  2ZXP A;  1W6J A;  1JE4 A;  1KXL A;  4A93 H;  5KYI A;  4WJ4 A;  4FXG C;  2L4N A;  5FKA C;  1BKB A;  1PTO H;  4IUR A;  2ATW A;  2NVT H;  3DWP A;  5E3F A;  2JQO A;  4H13 C;  4DXG A;  1S5D D;  4KI0 A;  4G4K A;  4DV6 L;  5HGQ A;  1HNW Q;  1Q86 C;  4DR6 L;  5DAU A;  2B63 G;  1EIH A;  3MAQ A;  1PYS B;  4R8N A;  5IP7 G;  3ND9 A;  1JB3 A;  1I4R A;  4L8J A;  4C1N K;  4A3J G;  4X65 L;  5A35 A;  1LT4 D;  2F0M A;  2AWN A;  5EAY A;  1JE5 A;  2F0J A;  2C9O A;  3IL8 A;  3CF5 A;  2Z0S A;  4O2D A;  4BBR H;  1WTO A;  4WFN 3;  5M5Y B;  2F4V L;  3E5S A;  2R7D A;  3Q22 A;  1JOK A;  1XTC D;  1IBK L;  5BR8 L;  1PH2 A;  3W2D A;  2JEA I;  1L0X B;  1XNQ Q;  3BDC A;  1JJ2 A;  4HIK A;  1ESF A;  1EY9 A;  3L7Z C;  3D6W A;  5IP9 H;  2IT1 A;  3CP0 A;  1YNJ D;  4LF6 Q;  2E75 C;  5KNC A;  4QMG A;  1G51 A;  1NMG A;  5GAE C;  4ZK9 B;  3KFU A;  4OO1 H;  4XQQ A;  1STB A;  3M4Y A;  4LFA Q;  5JVG 3;  1PZI D;  3RMH A;  1I6H H;  2CFM A;  2CQO A;  2NBF A;  1TWH B;  2A68 C;  1AE2 A;  3WWV A;  1DGS A;  4GZY C;  2Z6K C;  4LJZ C;  5CV4 A;  4HJ8 A;  1RCV D;  1E7Z A;  1VQ9 A;  3CRL C;  3EA6 A;  4CDE C;  3CCU A;  1HNX L;  2WFW A;  3H91 A;  3T56 B;  4GNX A;  3T1H Q;  4B3S L;  2UUC L;  1I50 H;  2OF1 A;  2ZXO A;  2NVX B;  3NPP A;  4IUQ A;  1PTO D;  2PQE A;  2RVL A;  1PXU A;  4DK0 A;  1OXX K;  3I4M G;  3BG3 A;  2IY5 B;  1E3P A;  5CBA E;  1WTR A;  4YIJ A;  2K5Q A;  1Y8N B;  1XMQ L;  4DR7 L;  2JEB I;  3HOW B;  1SMY C;  2CHB D;  4X3U A;  5IGE A;  2JA5 B;  4YCW A;  1TKW B;  1ASY A;  1U0L A;  1D5X C;  4RCO A;  1QE6 A;  1TT2 A;  3OIP A;  1L0W A;  1BUV T;  4HJ5 A;  3MHB A;  2IHE A;  2OEO A;  1CTM A;  1F9S A;  1WI5 A;  2K5V A;  2EDG A;  3HKZ G;  5ELB A;  1KNA A;  3HOY B;  1S5B D;  2A1A A;  3CQZ B;  2UUA L;  2RSN A;  2CH4 W;  5IWA Q;  2RCN A;  3NEN A;  3IAY A;  5IY0 A;  4DV5 Q;  3RD4 A;  4JI7 L;  3S1M B;  4G7Z C;  2B2U C;  1V1Q A;  3OW2 A;  1X32 A;  1BVS A;  3NTH A;  4A3B G;  2A6E D;  1CKM A;  2PZU A;  2ZM6 Q;  1HZ9 A;  3J80 c;  4OL7 A;  1D8L A;  3ITP A;  3K81 C;  2KUM A;  3NHH A;  4HCE A;  2WIN B;  1TWG B;  4BBR G;  4YWL A;  1CKN A;  4FXD A;  3T4A C;  3CCL A;  3I4L A;  3QWN A;  4L63 B;  1QOH A;  1YZ6 A;  1CSP A;  1PLF A;  3KF6 A;  2PMZ B;  2Q8I B;  5ISR A;  1K0S A;  5EPK A;  4CDD C;  3NE5 B;  4C3H B;  2D0P A;  4RWS C;  4QL5 A;  4RGO S;  4KHP Q;  3CCJ A;  3C46 A;  3KF8 B;  1G6Z A;  4ZCK A;  4GOP B;  5EBD A;  2EJF C;  3C1F A;  1LT5 D;  1HR0 W;  1DJR D;  3IRB A;  4DAY A;  2QCP X;  1RDP D;  4I7A A;  5CV9 A;  1FGU A;  2NZO A;  2PMZ E;  3SVM A;  2F0P A;  2ZJR A;  5C44 B;  4DR2 Q;  1HNZ Q;  1NNX A;  1EOT A;  1XNR L;  1U4P A;  1EY7 A;  5C0X H;  1H9J A;  1X65 A;  1U9R A;  2V1C C;  1TVX A;  1H9M A;  4AYB G;  2X6L A;  3PUY A;  3HOZ H;  5D3I B;  2SDF A;  4X62 Q;  5LL6 S;  1B2T A;  3FPP A;  3P75 A;  5CMD A;  2XWB B;  1N33 Q;  3FKI G;  4FF3 A;  3GTL B;  1A3U A;  4XIG S;  1VS0 A;  4KD3 A;  1EIF A;  2EYO A;  4TRD A;  1KAA A;  4DV2 L;  1EYD A;  3H0G B;  3T13 A;  2FHT A;  4DN4 M;  1MJE A;  2A8V A;  1X3P A;  3J80 E;  4A93 B;  1Q8K A;  2L1B A;  5E7N A;  5M5X H;  1WFQ A;  1PTO B;  1K3R A;  2RSO A;  5I2X A;  2NVT B;  4K8J A;  1SYF A;  4DR5 Q;  1J8I A;  4APV A;  3GTK H;  1G8Z D;  1XX8 A;  4A3M B;  2R92 G;  4FF2 A;  1MSH A;  1N8R C;  4OIK A;  1BCP F;  2YU9 H;  3J81 L;  4PMW A;  4JVZ A;  3DUZ A;  4LW1 A;  4KHZ A;  2KCM A;  2A68 D;  2SEB D;  4EVO A;  5LMN Q;  4DV6 Q;  2PNR C;  4H02 A;  4K5W A;  4DR6 Q;  3E3X A;  4X6A H;  3C2P A;  1WCM H;  2UUB L;  4RGT A;  4GN4 B;  4YCU A;  1LTG D;  2R7Z G;  3FP9 A;  2VZA A;  2AKW B;  4DF7 A;  4JI1 L;  2EYL A;  1A3T A;  4EQP A;  2HUG A;  1B9M A;  3CPW A;  2JA8 B;  4BWG B;  4QQB X;  1GVP A;  1IBK Q;  4H44 C;  5BR8 Q;  4DV0 L;  1BR9 A;  1XJV A;  4BY1 G;  2QKI C;  4DA2 A;  4JK1 C;  1JOO A;  3A55 A;  3K5M A;  3CMA A; 
#chains in the Genus database with same CATH homology
 2LFN A;  1ENF A;  1SNM A;  1PRT F;  5EQ0 A;  1SYE A;  3ZYY X;  4DGZ A;  2PW5 A;  1WD0 A;  3PIO 3;  1KLG D;  4DNT B;  1BXT A;  3TDQ A;  1STG A;  3MVV A;  4NP5 A;  5EPJ A;  5KNB A;  5E1F A;  5I6W A;  2WAQ B;  2E2I B;  4BA2 I;  3CRK C;  3NQI A;  4HED A;  4IFD G;  4RKL A;  5JPM C;  2XSC A;  1GUT A;  5D65 A;  1DOK A;  3OHX C;  1ET9 A;  5KIX A;  1LO5 D;  4MHE A;  3K58 A;  4RGN A;  1TS2 A;  3TME A;  1AFP A;  3DEP A;  2CVR A;  1QCB D;  2EY6 A;  1U4L A;  2EY5 A;  1D5M C;  1VF7 A;  3KF8 A;  1DZ1 A;  1JR0 D;  3EQL C;  4PQX A;  3QJY A;  1PFM A;  1ZEQ X;  1IKL A;  2AQ3 B;  5IGG A;  3H3V C;  3OIQ A;  1D2B A;  2NN6 I;  4FO2 A;  4ZUI A;  2M2L A;  1SSO A;  4K6L A;  4FF4 A;  4HMI A;  2JYO A;  4XYQ A;  1A6X A;  2ICE C;  2K7V A;  1KDB A;  3PMF A;  3OMG A;  3J80 L;  5J39 A;  1G91 A;  4CGY B;  4RHS A;  3VR5 A;  3HGB A;  2A5H A;  4FP5 D;  1BO0 A;  4KY5 A;  3JAM E;  4KY6 A;  3HOZ B;  4K2L A;  4MIU A;  1PRT C;  4CKB A;  1EZ8 A;  1ESR A;  5IGC A;  3TZD A;  1B3A A;  5KGU A;  2F0F A;  1G29 1;  2D62 A;  1IYU A;  2BA1 A;  2A73 B;  1PDQ A;  3C1E A;  2B8G A;  1I4H A;  3A54 A;  2L9H A;  1G2T A;  2WII B;  5M5X B;  1SNC A;  1OXT A;  1PMR A;  5J22 A;  3GTK B;  2VB3 X;  2VB2 X;  1CT1 D;  4E6I A;  3P1H A;  4FNF A;  4FVM A;  1QNU A;  2QIL A;  1LAB A;  4KKT A;  1CQV A;  1VDZ A;  5M5W B;  1LTS D;  4NDX A;  4ID6 A;  1K8M A;  4K5X A;  5I9P A;  3HRZ C;  4I65 A;  4Z9C B;  4RGM A;  3S9W A;  3QIA A;  4B08 A;  1GOZ A;  3RZD B;  4UDU C;  5F2D A;  3G7L A;  5ELF A;  1EYC A;  1ZXT A;  2LY7 A;  1ENA A;  4ZRZ A;  3HZX A;  3EJI A;  5DM6 3;  2PCF B;  1SYD A;  2AQ1 B;  4PNY A;  4XTC S;  1STE A;  2RDF A;  1XWE A;  4FYD A;  1V43 A;  1ML0 D;  3M4O B;  2CQA A;  4C3J G;  2A6E C;  5DNF A;  1U4M A;  1TQO A;  1JCK B;  3GD7 A;  1EY8 A;  1GUW A;  2F1M A;  1CK1 A;  5I2Y A;  1HFN A;  4ME5 A;  4ZQ3 A;  3J7Y W;  1V1P B;  3U9S A;  2EYP A;  4FF1 A;  3Q24 A;  1CFM A;  3T51 B;  2F0K A;  5M9O A;  4CBV A;  1LAC A;  2F0T A;  4BY7 B;  1MSG A;  1BCP D;  1Q1E A;  2L0C A;  1RKN A;  2JP1 A;  1J9O A;  5EKK A;  3H6M A;  4XDX A;  2XIW A;  3KBG A;  1X3Q A;  5JPN C;  4HN7 A;  3MZ5 A;  1KTK A;  2O2L D;  3JAM L;  1LTA D;  1CZG A;  2IW3 A;  1WVL A;  3SR1 A;  3MA2 B;  5CGK A;  3HOV B;  3MXP A;  4Y7N B;  3S1N B;  3KBX A;  4RHR A;  1PRT D;  2V4D A;  3VYS A;  3IKJ A;  4IUT A;  4X3K A;  4G57 A;  2Z1C A;  3Q0A A;  3NTK A;  4ILW A;  4HMJ A;  2LKV A;  3SK5 A;  4ZKC B;  3FDT A;  3J7A V;  1R4Q B;  3I91 A;  3VYU A;  1B4O A;  2WB1 B;  2N88 A;  4ZAI A;  2E2J B;  1CA5 A;  2NZ1 D;  1TII D;  2HDM A;  4CKE A;  2KJX A;  1II3 A;  2VUM B;  2L12 A;  3GTQ B;  2X6G A;  2E2D C;  1XXG A;  4QB4 A;  1M8A A;  1OXU A;  2MJ8 A;  2B2U A;  3J81 E;  5E4W C;  2QF7 A;  5EKL A;  1QB5 D;  1SNO A;  4IUU A;  1S5E D;  1E2Z A;  5CV6 A;  3KLS X;  3S2D B;  4HCS A;  1AP0 A;  4X3S A;  1C8C A;  2NN6 H;  1F9R A;  1LTB D;  1ROD A;  1GUO A;  3WDN A;  2KQ3 A;  4N9T A;  1HFG A;  2SNM A;  3BS1 A;  2O5I C;  3DM1 A;  2KCN A;  3SK6 A;  1SEB D;  5CC4 A;  5I6Y A;  1EIG A;  1HPC A;  1SYG A;  4XQJ A;  1MD2 D;  5KEE A;  5I4D A;  3M7N A;  1IYV A;  4QIW B;  1A2T A;  1GUG A;  1PZK D;  4DK1 A;  5FK9 C;  4F87 A;  2QDB A;  3VR4 A;  3SHL A;  4IUV A;  2PW7 A;  1U4R A;  2XNA C;  1JWM D;  3WOF A;  1JOQ A;  1HQM C;  1K8O A;  3BVZ A;  1IW7 C;  3UI2 A;  5C3X A;  4KV6 A;  1H9R A;  2G9D A;  1BCP B;  5JJZ A;  3NTI A;  1RTN A;  5D14 A;  1Y1V B;  1QWY A;  1LT3 D;  2F0U A;  2JSO A;  2J0T D;  4A3D B;  5K5P A;  4V0B A;  2B2T C;  3K5N A;  3PUV A;  1K83 B;  1EU4 A;  2F0H A;  4OHJ A;  1R9T B;  2FJ2 A;  2NTS A;  4IZ8 A;  5C4H A;  3AU7 A;  1V8Q A;  2B63 B;  4OO1 G;  3CHB D;  1V1P A;  1Z47 A;  3K59 A;  2R3Z A;  3MWY W;  1SE3 A;  3BVM A;  1RD9 D;  2RKS A;  5IGD A;  1NR2 A;  3KLR A;  2RA4 A;  1TS3 A;  4PV1 C;  4KHV A;  5IIF A;  1PRT B;  5IOC A;  2JA7 B;  3ONA B;  2F0G A;  4H0L C;  2RQX A;  4O42 A;  3H09 A;  3I72 A;  2J7Z A;  3RZO B;  1D1K A;  4X3T A;  3CU7 A;  3I3C A;  3J7A F;  5I9O A;  3R2I A;  4RA8 A;  4XYO A;  4DFA A;  4HSV A;  4I7Z C;  4CHT B;  3WOE A;  1A15 A;  2E76 C;  4XT3 B;  3NP8 A;  3OOC A;  1RF2 D;  3HS0 C;  3X3M A;  3S1Q B;  2R93 B;  2L55 A;  2BDN A;  3M3Y B;  2F0Q A;  5IOD A;  4KKS A;  4L6T B;  2AWO A;  2ZXR A;  2A74 C;  1ONL A;  1LTI D;  2KEE A;  1V1O A;  5C5M A;  2D5D A;  3NXW A;  1EL0 A;  4U67 3;  1RJT A;  2NVY B;  2A69 D;  2EY1 A;  3BZD B;  3V96 A;  1KDA A;  3M7G A;  3BYY B;  2F03 A;  1TS4 A;  4A3B B;  2F3V A;  5BN3 A;  1DON A;  2HDL A;  4IUP A;  5C5L A;  3PUZ A;  3T53 B;  1JWS D;  1ZKO A;  3MC0 B;  1S5F D;  2GA4 B;  1SNP A;  1UNS A;  5KYL A;  2FMM A;  3QOL A;  5C0X G;  4C2M B;  4CJ0 B;  4MN3 A;  4RAU C;  2PYK A;  2EJG C;  3AB9 A;  1IW7 D;  4QUC A;  4DU9 A;  4RKB A;  4R9W A;  4J8Q A;  3MTS A;  1O7Y A;  3HEJ A;  4A3K B;  1GUS A;  1UUP A;  1ET6 A;  3DXJ C;  1S5C D;  4CJ1 B;  5J1Z A;  3D3R A;  5K36 H;  3P7J A;  1OO9 B;  1NR4 A;  1EY5 A;  1SJE D;  2OXP A;  1Q90 A;  5T1I A;  1D5Z C;  4AYB B;  3GV6 A;  1HTL D;  1IHZ A;  3SK4 A;  1F9Q A;  1UAP A;  3N52 A;  3FKI B;  2R6G A;  3V05 A;  2B2Y C;  1RTO A;  1EEI D;  5ELC A;  1LT6 D;  4IFD J;  2K04 A;  1C48 A;  3VA5 A;  2OT2 A;  1SBB B;  3LWE A;  5FOB B;  1T5E A;  1QIL A;  2WP8 J;  1S4Z A;  2B2V C;  3CKI B;  1MGS A;  3DWQ A;  1Q3L A;  1Z7T A;  2KEC A;  3K0Y A;  1SDF A;  3GTM B;  1HXY D;  5TSS A;  3A7L A;  2BDO A;  3GP7 A;  4K8I A;  1KLU D;  2D9U A;  1BCP C;  2EYJ A;  1STY A;  2DNC A;  2WKC A;  3OW7 A;  3GTO B;  2LMC B;  1DOL A;  5C3E B;  1TS5 A;  5D3D A;  1EZ6 A;  2E2H B;  1PYW D;  2O4X A;  4LMQ D;  2HCI A;  4XT1 B;  3S15 B;  4C3I G;  2EYM A;  3HP3 A;  2IX0 A;  3S16 B;  1RHP A;  4KD4 A;  3A8I E;  2M9V A;  2KED A;  5JEA H;  1NAP A;  1HQR D;  3K5L A;  1SYC A;  4J1M A;  3I8Z A;  3O13 A;  4Q0F A;  1E2W A;  4KN7 C;  1PZJ D;  4F8M A;  5C3W A;  3PIP 3;  1I4Q A;  4IN3 A;  4F7X A;  3GTP B;  3QG1 A;  5T1G A;  2L5T A;  5BN5 A;  3S14 B;  3A7A B;  4A3I B;  3E6Z X;  4TKO B;  2F0O A;  3HG9 A;  3QB3 A;  1TWC B;  1HUM A;  4A3E B;  2BOS A;  2Q8R E;  3IFT A;  4KTA A;  2XRQ D;  2CW0 D;  5CV7 A;  3EVQ A;  2EE1 A;  2F0S A;  2F4I A;  2Y0S B;  1I4P A;  3A8K E;  3S17 B;  3GO5 A;  2K28 A;  4HAE A;  1EY0 A;  4IAL A;  1F2L A;  2Z4I A;  2EY2 A;  1HA6 A;  4R8I A;  3M85 A;  1B53 A;  2DNE A;  2BE5 D;  1TY0 A;  5E4X A;  4F88 A;  1VF5 C;  3V2T A;  3HOU B;  2KCC A;  3H94 A;  3R2T A;  1DOM A;  5C0X I;  1IL8 A;  1DXM A;  1Y1W B;  1TWA B;  3D8G A;  4CKC A;  5IT9 E;  1TWF B;  4ZYS A;  5DM7 3;  2C5C A;  5CV8 A;  3L9A X;  4XQN A;  1HUN A;  1Q12 A;  4EQN A;  3TP7 A;  1E2V A;  2DN8 A;  5LHY 1;  1LTT D;  4Q5V A;  3FVQ A;  4LAA A;  5JEA J;  4IFD I;  2NVQ B;  1FNV A;  3D31 A;  2O5J C;  1DCZ A;  2B39 A;  1F77 A;  1D6E C;  1EWC A;  4U68 A;  2RDH A;  2NTT A;  1AN8 A;  2FFK B;  1C4Q A;  2ENB A;  4BA1 I;  1EY6 A;  3KLS A;  3L3O C;  3TZU A;  4JBW A;  2AUJ D;  2XWJ B;  5C4J B;  3C3L A;  2EYF A;  2TSS A;  4S3S A;  4M1U B;  4WJW A;  1ILP A;  2NYZ D;  2K01 A;  4NW2 A;  1Y8O B;  2F0E A;  3HOX B;  1EWH A;  1F2Y A;  4N9P A;  3SE0 A;  4FXK C;  2RBM A;  4OGQ C;  4A3G B;  4TSS A;  5DEH A;  3NSW A;  1MBY A;  2F0N A;  3G6J B;  3N6R A;  3BYT B;  4C3H G;  5C4X B;  2Z4H A;  1WTW A;  3NBI A;  2KOL A;  3A56 A;  2AQ2 B;  2QEJ C;  3D6C A;  3VR6 A;  1EEF D;  3GTJ B;  5LL6 X;  5NUC A;  1UEA B;  4G7O C;  4BBS B;  1JQY D;  1HCZ A;  2YYZ A;  4QF4 A;  1O80 A;  1OXV A;  2LS0 1;  2B8F A;  4O1N A;  1GHK A;  5HGT A;  1LLR D;  3VR2 A;  3PO3 B;  3RLF A;  2DY8 A;  1SFO B;  4HR7 B;  4ZKB B;  3PO2 B;  5M3F B;  4C1N I;  2EPB A;  3MXU A;  4KY7 A;  2WKD A;  3MFY A;  2HQE A;  1JOR A;  2A69 C;  2F0D A;  3P20 A;  2VNU D;  5FLX E;  3MXN A;  4C3J B;  2MP1 A;  4KJN A;  3A8J E;  2EZV A;  3I90 A;  4UAI A;  1AW7 A;  2PZW A;  2B2T A;  5CV5 A;  1EQT A;  3QO2 A;  3OSO A;  5IT9 L;  3S1R B;  2ICI A;  2AUK A;  3D4R A;  1SJH D;  3Q6S A;  1I3Q B;  2WV6 D;  3VYR A;  1ZYR D;  3VR3 A;  3FMC A;  1Q8I A;  2PO4 A;  2IWH A;  2BA0 A;  2ID0 A;  5AFW A;  5C6A A;  4EQO A;  2IPK D;  2FMC A;  1Q1B A;  1AEX A;  1EY4 A;  1SAP A;  2XVS A;  1CZW A;  1BF4 A;  5JAV A;  1GUN A;  1TR5 A;  3TP5 A;  5KRU A;  5KND A;  2K5D A;  4H7B A;  1FGB D;  1B50 A;  2KVM A;  1IKM A;  2E74 C;  2B2W A;  1YNN D;  3I70 A;  1M4V A;  4ODG A;  2XN9 C;  4A3J B;  1O7Z A;  1QJO A;  3K7A B;  1L0Y B;  1WTX A;  1SE4 A;  3VYT A;  3FRP B;  1HHV A;  1H9S B;  2A6H D;  4K2K A;  2EVB A;  1FR3 A;  1CHQ D;  2NN6 G;  3W3A A;  1B44 D;  3NWS A;  4KJO A;  5IGB A;  2MPM A;  3GV3 A;  3URY A;  1BBX C;  3U9O A;  1A3V A;  1AZQ A;  2IJ0 A;  1WTP A;  2TMP A;  4DAV A;  1PFB A;  5JOB A;  2B2W C;  5JVH 3;  2WAC A;  5ELE A;  3PUX A;  1A2U A;  4J6H A;  5ELD A;  1GHJ A;  2I46 A;  3NQT A;  1D1I A;  3I73 A;  3I4M B;  3GTG B;  3TSS A;  1STA A;  3IFD A;  3D4W A;  1DD2 A;  4G7H C;  4IFD H;  4PMB A;  2SOB A;  3K57 A;  5G3L F;  1CI3 M;  2I07 B;  2X69 A;  2F0I A;  1CM9 A;  5CYU A;  5FLX L;  3SEB A;  4EGV A;  3NK9 A;  4DAP A;  3HKZ B;  3R3O A;  4K5V A;  3DHQ A;  1G2S A;  1FD7 D;  1CHP D;  1E0B A;  4HTH A;  4RH6 A;  2CW0 C;  1EQV A;  4BBR B;  3MXG A;  1WD1 A;  2F0L A;  2Q8T A;  1QG7 A;  1O7L A;  2MGS A;  1EYA A;  5EBC A;  4BS9 A;  2XRS D;  4KKU A;  5COR A;  1BDO A;  3D4D A;  1SND A;  2BE5 C;  4PMC A;  2B2Y A;  1HA5 A;  4NKL A;  4P2C B;  1SMY D;  1O78 A;  2K05 A;  1I6H B;  3BVG A;  2F0W A;  3TP6 A;  1LV9 A;  2B2V A;  4B9W A;  1SNQ A;  5A2Q E;  2EJM A;  1I50 B;  2IX3 A;  2MUY A;  4XXE A;  1R4P B;  2L11 A;  1B9N A;  3R8B A;  4WRD A;  3MEH A;  5C0X J;  2NUC A;  5EJW A;  3DEO A;  2EXZ A;  1NUC A;  3PUW A;  1Y8P B;  2EOT A;  2K03 A;  4KK7 A;  1HRJ A;  2KHS A;  1DM0 B;  2JE6 I;  3KUP A;  1ILQ A;  4HSP A;  1JC7 A;  4OIJ A;  3TP8 A;  1SYB A;  1PTO F;  4QUF A;  4ABN A;  1F2M A;  1NCV A;  4RCN A;  4OO1 I;  3SDZ A;  3F2U A;  1F2Z A;  3AMU A;  1I6V C;  2K33 A;  1H9S A;  3LWU A;  4M8A A;  3NBH A;  2VXW A;  1I4G A;  1NSN S;  2R92 B;  4B9X A;  3SXH A;  2PZT A;  1GXD C;  1Z6H A;  3BDO A;  2BCO A;  3OMC A;  2PPB C;  1W6K A;  2N55 A;  4QCL A;  5IGF A;  3LNN A;  5EKI A;  2R7Z B;  1EFI D;  1LTR D;  1ENC A;  1QNK A;  1DYQ A;  3PV0 A;  1HTP A;  1BNZ A;  4ZUJ A;  1I4X A;  1ICW A;  4BY1 B;  1STH A;  2G9H D;  1VMP A;  2IL8 A;  4ULL A;  2H1E A;  1KNE A;  5FO8 B;  1Y69 U;  2K1B A;  2F3W A;  4K6D A;  4KMU C;  3X3N A;  5K36 G;  1CQF A;  2IX1 A;  2NWG A;  3DWA A;  2D2C C;  2HCC A;  3ERQ A;  2FIN B;  4A3F B;  4CJ2 C;  3FPU B;  4IQZ A;  1KDC A;  2SNS A;  1MI2 A;  3K6O A;  5FO7 B;  5HUR A;  2JXM B;  5M3M B;  1BOS A;  3BDL A;  2DY7 A;  3FEW X;  3DMU A;  1YNJ C;  5C4Z A;  3MFG A;  3ND8 A;  5CBE E;  2J4X A;  3SK8 A;  3TN2 A;  1FNW A;  2K32 A;  2M00 A;  3ERO A;  2R61 A;  3LX0 A;  5A2Q L;  3K5O A;  2YU9 B;  1GJX A;  2MHV A;  1BQQ T;  3EFX D;  1H9K A;  3I4N B;  1WCM B;  1PTO C;  4IUN A;  1F9P A;  4NMZ A;  4LK1 C;  3T16 A;  4RFB A;  3E0J A;  3GQB A;  3Q23 A;  2H4O A;  2ZT9 C;  1ZYR C;  1JWU D;  5JEA G;  5EGT A;  5EPL A;  1XYI A;  1TU2 B;  3OWF A;  3VA7 A;  3KK7 A;  4TQU S;  4DXF A;  1JIC A;  1SXT A;  4WOR A;  1WTV A;  1VCI A;  3S2H B;  1FYC A;  5FO9 B;  1TY2 A;  2EYH A;  5BN4 A;  2Z8L A;  2F0V A;  4K14 A;  4C3I B;  1CA6 A;  4C56 C;  2RDG A;  1T5X D;  5COY A;  4KN4 C;  3OWE B;  4DNR B;  3QOJ A;  2K5W A;  1YNN C;  1OXS C;  1STN A;  5G3L D;  3TBI B;  3OPO A;  2NB0 A;  2K6A A;  1FNU A;  1B1Z A;  1AZP A;  1PFN A;  1WTQ A;  2A6H C;  4ZLT F;  2JA6 B;  1SE2 A;  3NWT A;  1VMC A;  1KAB A;  1EU3 A;  2KA7 A;  3NUC A;  3RUZ A;  3R93 A;  4V19 0;  5CR3 A;  2ZXP A;  1W6J A;  1JE4 A;  5KYI A;  4FXG C;  2L4N A;  5FKA C;  1PTO H;  4IUR A;  3DWP A;  5E3F A;  4H13 C;  4DXG A;  1S5D D;  4KI0 A;  4G4K A;  5DAU A;  1EIH A;  3MAQ A;  4R8N A;  3ND9 A;  1JB3 A;  1I4R A;  4L8J A;  4C1N K;  5A35 A;  1LT4 D;  2F0M A;  2AWN A;  2F0J A;  2C9O A;  3IL8 A;  1WTO A;  4WFN 3;  5M5Y B;  3E5S A;  3Q22 A;  1JOK A;  1XTC D;  3W2D A;  2JEA I;  1L0X B;  3BDC A;  1ESF A;  1EY9 A;  3L7Z C;  3D6W A;  2IT1 A;  1YNJ D;  2E75 C;  5KNC A;  4QMG A;  4ZK9 B;  4OO1 H;  4XQQ A;  1STB A;  3M4Y A;  5JVG 3;  1PZI D;  3RMH A;  2NBF A;  1TWH B;  2A68 C;  4GZY C;  4LJZ C;  5CV4 A;  1RCV D;  3CRL C;  3EA6 A;  3H91 A;  3T56 B;  2OF1 A;  2ZXO A;  2NVX B;  3NPP A;  4IUQ A;  1PTO D;  2PQE A;  2RVL A;  1PXU A;  4DK0 A;  1OXX K;  3BG3 A;  5CBA E;  1WTR A;  4YIJ A;  2K5Q A;  1Y8N B;  2JEB I;  3HOW B;  1SMY C;  2CHB D;  4X3U A;  5IGE A;  2JA5 B;  1TKW B;  1D5X C;  4RCO A;  1QE6 A;  1TT2 A;  3OIP A;  1BUV T;  3MHB A;  2OEO A;  1CTM A;  1F9S A;  2EDG A;  5ELB A;  1KNA A;  3HOY B;  1S5B D;  3CQZ B;  2RSN A;  3IAY A;  3RD4 A;  3S1M B;  4G7Z C;  2B2U C;  1X32 A;  3NTH A;  2A6E D;  2PZU A;  4OL7 A;  3ITP A;  2KUM A;  3NHH A;  4HCE A;  2WIN B;  1TWG B;  4FXD A;  3T4A C;  3I4L A;  3QWN A;  4L63 B;  1QOH A;  1PLF A;  2PMZ B;  2Q8I B;  5ISR A;  5EPK A;  3NE5 B;  4C3H B;  4RWS C;  4RGO S;  3C46 A;  1G6Z A;  5EBD A;  2EJF C;  3C1F A;  1LT5 D;  1DJR D;  4DAY A;  2QCP X;  1RDP D;  5CV9 A;  3SVM A;  2F0P A;  5C44 B;  1EOT A;  1U4P A;  1EY7 A;  5C0X H;  1H9J A;  1U9R A;  1TVX A;  1H9M A;  2X6L A;  3PUY A;  5D3I B;  2SDF A;  5LL6 S;  1B2T A;  3FPP A;  3P75 A;  5CMD A;  2XWB B;  4FF3 A;  3GTL B;  1A3U A;  4XIG S;  4KD3 A;  2EYO A;  4TRD A;  1KAA A;  1EYD A;  3H0G B;  3T13 A;  2FHT A;  4DN4 M;  1X3P A;  3J80 E;  4A93 B;  2L1B A;  1PTO B;  2RSO A;  5I2X A;  2NVT B;  4K8J A;  1SYF A;  1J8I A;  1G8Z D;  1XX8 A;  4A3M B;  4FF2 A;  1MSH A;  4OIK A;  1BCP F;  3J81 L;  4PMW A;  3DUZ A;  4KHZ A;  2A68 D;  2SEB D;  4EVO A;  2PNR C;  4K5W A;  3C2P A;  4RGT A;  1LTG D;  4DF7 A;  2EYL A;  1A3T A;  4EQP A;  2HUG A;  1B9M A;  2JA8 B;  4BWG B;  4H44 C;  1BR9 A;  2QKI C;  4DA2 A;  4JK1 C;  1JOO A;  3A55 A;  3K5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...