2AWNA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
372
structure length
330
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
total genus 77
structure length 330
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awnA03
2.40.50.940 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awnA01
2VP6A 1R8SA 1Y1VH 1GD7A 3T1YL 4JKYA 1BIFA 3IHWA 4PC7A 1BS1A 3PR1A 2DFLA 2VRWA 1CJVC 2AWOA 1WXQA 4OHVA 1G17A 1SFOH 4OJQA 5CLQA 1CU1A 1GO3E 2PZFA 5FOVA 2VP9A 3HYTA 3NDPA 2P2LA 3PCRB 4DB2A 3TAHA 1H95A 2Q2HA 2QGQA 1DAKA 2CJWB 1R0ZA 1T8UA 1WQ1R 4Q7LA 4QGHA 3TNFA 2BDTA 4POAA 3W5JA 3X1WA 4DLRA 1I6HH 4KFSA 1VKJA 2MSCB 1XTRA 3B5JA 1OH8A 4A76A 1X65A 2JE6I 1SVOA 3GTOH 1UKYA 2L0XA 1DS6A 1VQMA 3EASA 2V4ZA 3QY0A 4NCHA 1X6OA 3HYRA 1X54A 2HLDD 4TYYA 2NG1A 4WIAA 1A82A 4RD6A 4JBWA 4QBFA 1HQYE 1XBTA 2ZE7A 2VO1A 3IQWA 2EW1A 2GZAA 3THOA 1IOZA 2C96A 4GP6A 4G5RA 3PSIA 2XZPA 4QOSA 4BBSH 2BBTA 2E87A 3EARA 3LH5A 1ZMXA 3CP0A 2IYZA 4LV8B 1MO4A 1Z6YA 3T1HQ 4YC7A 4DV5Q 1XRJA 2W58A 2IHEA 2YJTD 3PFIA 2IY5B 3RLOA 3DEFA 3NBFA 3QI2A 2CCJA 4Q7KA 5JWOA 2QN6A 1VQ7A 1A1VA 1E2MA 2ZRAA 2GWHA 4URVR 1IBMQ 2PEZA 2F6RA 1CUKA 4H02A 1YKSA 5FPKA 5FR2A 2FEMA 4HUQB 5G40A 4ZIRB 1LVGA 1IBRA 2XZLA 3BC1A 1T8TA 1IBML 4Q7JB 3LX8A 3BB1A 1Z0KA 1BO6A 1HUQA 2FFHA 3GTQH 1L2TA 4IPGA 4DR1Q 4IO9A 2ANBA 5E4FA 2MQHA 3PUYA 4HJ9A 1FX0A 5C1BA 2JLRA 3CAMA 3E9HA 4GN3B 1E99A 1ZM2A 4LYJA 5A4JA 2OBNA 5BN3A 1V43A 2C77A 5IYDH 1W2BA 2BBSA 4X65L 2ODWA 1OKKD 1R9TH 1NMZA 2CNWA 1Z0DA 2KI5A 3A58B 2WPDA 2IT1A 4NZYA 3EIQA 2FSFA 1K3RA 4KLZA 4MDEA 4LWCA 1Y3AA 4GOJA 3E2IA 4JS0A 2O0HA 3GLFA 3KKOA 4EQ6A 1NMGA 2HIVA 1AE3A 4JOIA 5IE8A 2LWIA 4DLWA 5F98A 4G5SA 4P0TA 1ZM7A 4A3IG 2WOOA 3T06B 3WRYC 5M04A 1TQ4A 3LX5A 4JVSB 4PZZA 4WA7A 1GFIA 4TZ0A 2A30A 4JLJA 1W0JA 1GNRA 3FHWA 3B60A 1JNYA 1ZU4A 2ZSDA 4LBWA 1N6PA 2D74A 2JLUA 2BC9A 1L7VC 2IS1A 1E9EA 4AY2A 2PLRA 1HURA 3GLHE 5GJVC 1VQBA 3AF1A 3GPLA 4D26A 1HEIA 3U5ZB 4F4JA 3SQXA 1JJ2A 1N6RA 1P9RA 5FTKA 4DSUA 3ICQB 721PA 1NJFA 2J0UA 2Z4RA 4N1AA 4OHYA 2ZVQX 4YCVA 3MWLA 3EA5A 4IXMA 4GKKQ 1NF3A 1ZNYA 4DR7Q 5D3MB 4UXIA 4DR2Q 3R20A 2E8GA 2EWWA 4DPGA 4YONB 3K1JA 4O2RA 2A5GA 3FMPB 1HE1C 3I56A 3B2EA 2IWHA 3S15H 2UUCL 3FKSA 3I32A 5A5GA 3MWJA 2ZSFA 3QPUA 3ZZ0A 1ONBA 1XD8A 2NZJA 5DH9A 4PQFA 5AJVB 4C0BA 1M8PA 1XF9A 4D6PA 1HR0W 3FFBA 3K0EA 2WAQE 4A3EG 1B8AA 1AN0A 1NY6A 2FGKA 1SXJD 4HEJA 4RVCA 3HOVG 3BK7A 4URWR 3SEAA 2C78A 4PO8A 4W5WA 1LNZA 1Z08A 5DHAA 4FCWA 1XMJA 4IFDI 3PJRA 4RJLA 4B33A 2QQEA 1CKEA 2UUBL 4A3BH 4B2PA 1G3RA 2Z5FA 2Z0MA 5TMPA 2QBYB 1GOTA 2BCJQ 2RGDA 2OSBA 1KI4A 3J7ZC 1TQ2A 3F0TA 4Z1MD 3WWVA 3B1YA 1E24A 4B3ML 4XD7D 2DHRA 2OEPA 3N2EA 4PO9A 3GTKH 3W90A 1G4AE 3GLIA 1G18A 1ZP6A 1I2MA 2IEZA 2EFGA 2QENA 2X1VA 4MKHA 4MKFA 4PPQA 4V0OA 1JR3E 1KI1A 1HV8A 3J81i 4XIGS 1TUIA 1BVSA 1CTQA 5IYCH 1NMFA 2GXSA 1SGWA 2R6AA 4LHVA 2ZRBA 2GRJA 4GFDA 4DR6L 1ZRHA 3TW4A 2VH5R 1U98A 2NOAA 1ZUIA 5EUMA 4O2DA 3C4JA 2C9CA 1KOFA 1TF7A 3LA6A 4PSAA 3CX8A 3MGCA 1XCGB 4LF9L 3DVLA 3QBVA 5JZVA 2WWXA 3IUYA 1XTJA 3R7WB 2ZI5A 3VR5A 1ZM9A 1ZW6A 2KCTA 2WM9B 1OXTA 4LFBQ 5HKKD 4CEHB 4M2LA 4OL0A 4PG3A 4LF9Q 1VMAA 4QBIA 4AURA 1Z28A 5KTYA 2O8CB 1X3SA 2CCKA 1N0WA 3ND9A 5EXSA 1UEIA 1W4AA 2F3RA 2EYUA 2F9LA 3QQ5A 4OJKA 4RY2A 2C99A 3UE1A 1JJVA 5LMUQ 4DV0Q 2XNDA 1ODFA 3AKDA 5GAGC 3QOFA 4M1WA 5FLXc 4LHZA 4UNRA 2BKEA 5B30A 5JJLA 2ORIA 1D8LA 3K9HA 5G3ZA 2NVYH 1IL2A 1KYIA 5IRCD 4J15A 2F52A 5HZKA 4DKXA 4LW1A 1X3GA 2DFNA 4BA1I 1WP9A 2JDIA 3K9GA 3OIWA 4ZCLA 3CCQA 4JLNA 2ZS8A 1NG1A 2OV2A 3REGA 3WYFA 4DCTA 4WZ6A 5LMNQ 1FJGQ 4JI3Q 2CHVA 2NVTH 1UE1A 2FX3A 3HU2A 5FUXA 2K5VA 4YXWA 1JB1A 2CQOA 4X8MA 3B82A 1MKHA 1WE2A 4JI3L 4X8HA 2IUUA 5K36G 2F1JA 2P0EA 1YU9A 5AJWA 3S1RH 2Q3FA 1TQ6A 2PT5A 3D6TB 1I4TD 3H86A 1AM4D 4LPSA 4LX0A 3RS7A 4JBJA 3U50C 2V55B 4UNPA 3RSOA 3ULPA 3IEVA 3HOZH 1W49A 2OWOA 4MRVA 2J5XA 2W0SA 3QEOA 1KAGA 1XNJA 1XX6A 3GLGA 5B2ZA 2IYVA 4B75A 1NVVQ 5GAEC 4AYXA 4X64L 4F7WA 1NKSA 2D3WA 2FZ4A 4DV3Q 2WMOB 5BN4A 3TUZC 2F1HA 5BR8L 4UP7A 3EW9A 4OK5A 1KI3A 1U2RA 2W6IA 5DLQC 3TH5A 3T1QA 3B9PA 3VU9B 2GVAA 4BBRG 1JEDA 2IBMA 5BR8Q 4NE2A 1VYUA 4OQNA 4YMSA 1XMOL 3I1FA 3H3VI 5EZ5A 2I4IA 4QJ5A 2NZOA 4GOPC 1MABA 4P72A 4OQFA 5DIFA 3W6PA 1XZQA 4US2R 1W1WA 1PH2A 3S1AA 3AF2A 1TEVA 3EC2A 1G3QA 5IY0A 1XEXA 1NVXQ 3K7UC 1RW4A 4A1FA 1KJWA 4YMTA 4E03A 4PANA 2YWHA 4URXR 1S9DA 2OCBA 2VQSA 3DLLA 4A3GG 3V00A 3AVXA 2H8KA 1Z29A 4KBGA 4TT3A 1OYWA 2Y8EA 3CF2A 2W2TA 4GLXA 4LFAQ 2HEIA 1KI9A 3KKQA 4IJMA 4A0RA 4YMUA 2R7FA 2RGXA 1OLOA 2IXFA 2X77A 2ZUBA 3EC1A 5FFMA 1E3MA 3QG5A 4DDWA 1E0SA 2CNWD 2OBMA 4HLQB 2D4HA 1IYJB 1GVPA 1NP6A 4MRSA 1N5IA 3GO5A 2OFXA 4JCVE 1EK0A 4C0LA 1DE0A 2J46A 2PJRA 4B3BA 3K80C 4PZ7A 3D0FA 1DAHA 1GL6A 4OHXA 4C0HA 3KQHA 2VNUD 2HHHQ 2G1KA 4JSTA 1J6QA 4UNSA 3SBEA 4MTNA 2J45A 1XD2B 2NPIA 4HJ8A 1CP2A 4JVLA 3QBTA 4A3JH 1J70A 1X55A 4C2MH 3G0HA 3NG1A 4B35A 1SE8A 2WFWA 1UBCA 2VHQA 1OXXK 3KDFA 1T3HA 1FNNA 1TQDA 2AX4A 2GCNA 2OFWA 3NC1C 2CCZA 4XOIA 1SKYE 1F60A 1Z6AA 2R8RA 1KTVA 1MH1A 3ZD7A 2XSZD 2CE7A 1OFIA 2PT7A 3EPLA 4UP8A 2ZJOA 4LJ8A 4JSYA 4A3GH 1NLFA 2VQFL 4LF5L 2OE2A 3EBEA 4I1UA 4TYQA 3CMEA 1S1MA 4QXAA 2ZVPX 5KPDA 1YNXA 4JI4L 1G64A 2QAGC 1OXUA 4B3SL 1Q82C 1Q44A 2ZI7A 3Q7PA 5BYJA 4B32A 1R0XA 3RN2A 5GVSA 3CMAA 1G7SA 4UXJA 4F91B 2AN9A 3VDYA 3GLGB 4B3SQ 2IHBA 3L8YA 4Q4HB 2IYUA 1HNXL 1YIJA 1DAFA 4B73A 4OQXA 4URZR 4M9XA 3TSOA 1XCMA 1NSTA 3LXRA 4TMKA 4OHWA 4Q4JA 3RDPA 4PHTA 3GD7A 3TREA 1H65A 4PAOA 1ZM4A 1VECA 2R62A 5FBLB 2XEXA 3SU8A 2YTYA 4LF4L 1IJFA 2F4VL 2JJQA 2XNDD 1VQCA 2QAGB 1RRCA 4ERNA 4BRUA 2GKSA 3TGPA 1QVRA 4DUZL 2NVXH 1AQUA 1MABB 2YV5A 1VIAA 2I1VB 3A5UA 5TV2A 2ZE8A 4ITRC 4DAMA 6Q21A 1G6PA 2IX3A 4QGFA 1SLJA 2GCOA 5C4XG 1RL2A 2PNHA 1N33L 1YJWA 1KJZA 1IN5A 1OJLA 3RS2A 3P32A 1CJUC 3UK6A 1B7YB 1Y14B 1K8GA 5FPTA 3VR6A 5JSZB 4IOKA 3ZQJA 3IILA 2VUMG 2J7KA 3EZ9A 1FZQA 4HIDA 1U9IC 2LKCA 5GJWC 4FW9A 3RVBA 1Y1WH 1GVNB 4JT2A 3OHMA 1E4YA 1VCNA 3R9WA 4OK6A 3JZAA 1P7CA 1YI2A 1XD2A 4HLUC 4EPYA 1VS0A 4JMPA 2QEXA 4IFDJ 2NO1A 1YZKA 3QPVA 3CNNA 2GILA 2RMKA 3FMFA 4URYR 5HCIA 5AK0A 1HR0Q 2JLQA 2WJJA 3F3YA 1SKYB 3U6BA 4DLXA 2UKDA 2O8BB 5F9FA 4Q00A 3KDFB 1KO1A 2K5NA 4NB3A 4WAUA 2R6CA 4PZLA 4TLEA 4QNMA 1HR0L 4M1OA 1CRPA 1M7HA 4C0QC 2YOHA 1D2NA 4A8JC 3ZGXA 4PC6A 2QM8A 5JWRA 1G6OA 3QIAA 5A0FA 1S8FA 2BJWA 4JYCA 2UXCL 3A1VA 3SQWA 4JC0A 1JXOA 4C0JA 5FBWB 1Q22A 3H0GH 1OKKA 4ON9A 4ZO4A 3CB4A 2ID0A 1LM0A 2WWGA 2E2HH 4Z1MA 3U7EB 4IOLA 4F4CA 4KVAA 5K8LA 2UXCQ 1GKIA 5HGQA 3K09A 4RD3A 5FUWA 5KDOA 3BJIC 3IRBA 1LS1A 4Q01A 2GJ8A 1TF2A 1RIPA 4KI0A 1FMLA 2P67A 5JLJA 2XXAB 3HOXH 4NYMQ 3RS5A 4Q4HA 1IJEA 3Q8XB 4K0KQ 3KZ1E 1E2LA 2LXKA 1MOZA 5K8IA 1BBWA 1GM5A 4GKKL 1KXLA 2ZJZA 4FMBB 4Q4JB 4WZBE 5EXTA 2IW3A 5GJCA 4K0KL 1OW3B 4LUOA 5GADC 1EWRA 2WJHA 2GDJA 4D82A 1HT1E 2FE4A 1PH1A 2QP9X 4LBVA 2BOVA 4PAQA 2JA8G 1YRAA 1JQJC 2JA1A 2KJQA 5E7JA 4A92A 1CKNA 1QBKC 4MYCA 1ASYA 5JI3E 1Q1ZA 3LNCA 3FE2A 4TLAA 3I4MG 3CW2C 3W8RA 5JJIA 2VTKA 2X8AA 2IYLD 2IYQA 1HY3A 4FWIB 5J4HA 2GJAA 4LUVA 4MA4A 3EPKA 3CQZH 3SDZA 2NIPA 1RYHA 3PO3G 2B7BA 2YZ2A 3BOSA 4BLSA 2ERXA 5K8UA 1C9OA 3VAAA 1NRJB 3I62A 3BJUA 2QUZA 4RFSA 2QA4A 3T1YQ 3SI7A 3VKGA 4TSFA 1E6CA 3SJZA 3CO5A 4B48A 2O8DA 1EFCA 1QG4A 1II8B 1JMCA 4ZKEA 4GOPA 1ESMA 4NXNQ 2AMCB 3ULLA 1VCMA 2B63H 3QNUA 2PX3A 5FLMH 1XNQQ 1XNRL 1LTQA 3BGWA 4HLDA 4NYIQ 1TL7C 1TMKA 3UMFA 2XB2A 3FMOB 3CM0A 2N49A 3M4YA 2DUDA 1SZPA 1XDBA 5DI3A 5DHFA 4LHWA 3PIPA 4AQYQ 1R5BA 5E95A 1U94A 3MJHA 4R9UC 1M2OB 4HAZA 3FP9A 4IJHA 2VUMH 3VR1A 2P6NA 3EPHA 4C0KA 1CRQA 5EZ6B 2DFKB 2HJVA 3NTUA 5EP3A 3FVQA 1T3SA 4G01B 1KDPA 4QHYA 4V02A 3VMFA 2JA6G 3C7KA 1UKZA 2VQEL 1ZD8A 4AKEA 1IZ6A 1N34Q 2JEAI 1Q1QA 1I2DA 4C3IH 4DCNA 2F3TA 1VYVA 2J41A 2VQEQ 1P16A 3WHLA 1ZNXA 4XSGA 1G5TA 2A9KA 5G3YA 1A7JA 1KK3A 3ZIAA 2OM2A 4DLVA 3OAAD 4D4MA 1G20E 3RRMA 2B3GA 5DO9A 3WYAA 4DC9A 1Z2CA 3PXGA 1W4RA 3CCUA 3IBGA 3KJEA 1XFAA 1KO7A 3VX4A 5KO2A 3T12A 1KL9A 4NP6A 1UAAA 1C9KA 4ZV4A 3D31A 2NN6I 2QI9C 1FUUA 3K0CA 2AD1A 2WKPA 4Y0AA 2I0QA 2EFEB 1BYUA 4A82A 1QZGA 2XZOA 1XB2A 4GOKA 3AM1A 1QZHA 1FOEB 2I3BA 4NBSA 3ZH9B 1N5KA 1B23P 1PJRA 4GLVB 3TAUA 1W4BA 4GKJQ 4LHYA 2IK8A 1PLLA 2JAQA 4GMDA 4AG6A 4MDFA 1NIJA 3BS4A 3U61B 2G0TA 3RSLA 3OF5A 4AYBE 4FMDF 4OWXB 3K8AA 3BH0A 1PLKA 3KF6A 3OE7A 4LY6A 2FG5A 1ANKA 5SZIA 1DO2A 4HI0E 2FFAA 1NG9A 4JV5Q 5C0XJ 1QHHB 1G21E 2OCAA 4RKFA 2PBRA 2ZTCA 2N8NA 1J8YF 1M7GA 1TWCH 3NBHB 2FDCA 1IAQA 4JV5L 4RFSB 3NENA 4FIDA 1XD9A 1WCMH 1EX6A 4YY3L 4DR5Q 2QL6A 1E0JA 2ZRPA 4TMTA 2WAQG 3VHLB 4EPWA 1G8FA 3NKVA 2ZJ2A 4B3CA 2GJSA 3KUCA 4HDQB 3CWQA 1VQIA 1XMOQ 2FPKA 2PH1A 4II7A 4ARZB 4DT1B 5C0XG 1BKBA 2UXDL 2QTHA 4YWKA 2VL7A 2F7SA 2H17A 4JYAQ 1JALA 2H5EA 4TMZA 1XTDA 4GNXC 4ZIRA 4D2IA 3QKUA 3S1MH 1YJ5A 5LDDC 2GZHA 4ZCIA 1KQSA 2B8WA 2ODBA 1EIYB 4POFA 3LW8A 2H1LA 2VP5A 4Q47A 5UKDA 1JECA 3CH5A 5J4YA 3UDFA 1B70B 5B64A 3NDBB 1GILA 2L15A 2IUSA 2R6DA 3SS8A 5KYKA 2QM7A 5DSZA 4OI2A 4A8JA 3LO5A 2FA9A 2D06A 2UVQA 3CC7A 4LFAL 1F2TA 1KDOA 2B29A 1VQ6A 1AGRA 1XTSA 2CLCX 1LW7A 1HYQA 2GXUA 2Q9AA 2W6JA 4LOAA 4J0QA 1UF9A 3MXNB 4RKEA 1Y1VG 4KVGA 1KY3A 3MCAA 1E4VA 2UZ3A 1AK2A 3HU1A 3IHLA 1IHUA 2VA8A 4GNXB 4FINA 3ZZTA 4DB4A 1S4QA 1UFQA 3VTKA 3T34A 1MV5A 1TNDA 1MJEA 4ACAA 1Q81C 4EFLA 1O87A 2D7CA 1EFTA 4JI6Q 4ASUD 2HHHL 5C46F 1G8GA 1BH2A 4M21A 1G5RA 5KNDA 1R7RA 2UUBQ 1E1TA 4RD0A 4EPRA 3GJ5A 2ZM6Q 2V54A 4AI6A 1J5EL 4OWWB 3HKSA 5L3QB 3X1ZA 2VL6A 2OQ0A 3M1IA 1PH7A 1RKBA 4OI1A 4M9ZA 1SVIA 1XCPA 4LDJA 3AKEA 4NKRA 4UJ3A 1EG7A 3CCRA 4AK9A 3OTOL 4AYTA 1NJIC 1EFWA 4ALPA 1DG3A 1PFSA 1OPXA 2X2FA 3Q9LA 4MYTA 1XXHE 2H16A 2REXB 3CX7A 4B34A 1R0YA 4DR6Q 1KI6A 1Z3IX 5HKKA 4NU0A 3KJIA 3J81k 1XWIA 2OO7A 5JHGB 2UUAL 5IHPA 1OTCA 1OB2A 1HZBA 4A3CH 2ZYVX 4KCGA 3S1NH 3JVUA 5D3MA 3KF6B 3B1VA 3VHXA 1A5TA 1II9A 1TU4A 1YHBA 2DCUA 3DMNA 3ERSX 3AUXA 2ZI4A 5IP7H 1WYDA 1GRQA 3B1WA 4NYIR 3LFUA 5CDFE 2Y0SE 2NGRA 2ZSEA 4DSNA 5JJKA 2YWEA 4DLTA 1ZD9A 1K8AC 3ZLJA 4C2UA 3R8CA 2EFHB 2XX3A 1TWGH 4EX5A 2Q9CA 2BCGY 4B47A 5AJ3L 5C4JH 1H8EA 1FQJA 2G3YA 4LF4Q 4IOJA 2WVJA 2ZM5A 5HTKA 3GTGH 4MNOA 1ESNA 4KLNA 3MWYW 4LC1A 1GIAA 2D2EA 2RGAA 4D81A 3U3RA 1DELA 1YJ9A 4LRWA 1AZTA 4AIIA 3QKRB 4OX9L 3AV0B 2FSHA 2CWAA 3QXJA 2XGTA 1C0AA 3S2HH 4TT3D 2OZEA 4IJLA 1KI7A 5SZKB 5FUYA 4Z51A 2K52A 1XTIA 4F38A 3OIYA 3B9QA 4K46A 1GRRA 4OQLA 1CKOA 1OFUX 1KD1C 1S96A 2W6JD 2ZJBA 3CC4A 3NIBA 4G3XA 5HY6A 3WBJA 4IRUB 4B2LA 4A6XA 3GLIB 3VR2A 3TUJC 3M4QA 2VW9A 4N0DA 2P3SA 2EFCB 2WPDD 3T61A 1E1RA 1BMFD 4A3DG 3AEZA 3DM3A 5FR1A 3THXB 4JLDA 3FHOA 4KO8A 4TTRA 2IS4A 4ABYA 5JBQA 1PV4A 1GUAA 4PQYA 5DI9A 3AP3A 4V0KA 3RNLA 1CR0A 3AGPA 2Z6KC 4ESHA 5EE3A 2ONJA 5HPYB 4DSTA 4HAWA 4JT4A 5L3SA 1VG8A 1OIWA 1G8PA 3JZMA 3TSZA 3EZ7A 1E2KA 3RS4A 2LXJA 2O8CA 1TPZA 2BMEA 1S72A 1Z47A 4A3BG 3QXXA 4BFWA 2ZUCA 1KSFX 4V0NA 4EPTA 4Q9LA 4DSOA 2NO9A 4DUGD 2MO1A 4QG7A 3C15C 5GAHC 2VSFA 5J3BA 3PGZA 3UMRA 4UXHA 4A3EH 4JL5A 3U60B 3W5OA 5FJ8H 1Q86C 4BY1H 2GHIA 8OHMA 3TKLA 3UWOA 4PC3A 3A1TA 2A3RA 3C16C 4PQRA 1K5GA 4TMXA 3I5YA 4JLKA 3H4MA 3L8ZA 2QROA 3THYB 3THWA 4LJAA 4Q1CA 1OXSC 5C44G 3AVQA 1W5SA 4HAUA 2PZEA 2XTZA 4AH6A 3PO3H 5M5XH 1TTTA 2AFIE 4LWZA 2JA5G 3HOWH 1WI5A 1NMYA 3R8FA 4MYUA 2FN4A 3HPRA 1PVOA 3B13B 2ZJYA 3ICEA 4HDOB 1TXYA 1TWHH 5EP1A 1H8ED 2AKYA 3SFVA 3L0OA 3RNUA 1UBFA 2YKGA 1Q46A 4IEEA 1LFDB 3UDGA 1NKTA 2DGYA 521PA 3S16H 2WJGA 2OQKA 5C2JB 1GTVA 4RSGA 3BZKA 4Z8XA 3M7NA 1EXMA 4OWTB 4LV5B 1US8A 4EPVA 1AA9A 3ASZA 1KZ7B 1UBEA 4A93H 1G1MA 1SVWA 4JJKA 4XVRA 2D62A 4DEYA 1FMJA 3SNHA 3A5ZB 3OESA 2A78A 5J5CA 2C9YA 3AVOA 1R8QA 4OO1I 1LS6A 3HKZE 1Z5ZA 3P26A 1M34E 2BH8A 2K14A 3PUXA 1FNMA 1NBME 1NY5A 4R2IA 4Q1BA 5CIWA 4BEJA 1EIFA 3EIVA 1PH6A 2R7ZG 3QKRA 4LHXA 1QHSA 3W5IA 1L4YA 3L2OB 4C4PA 1E0KA 2QMEA 4CZ2A 4XVUA 2ZJQA 3HFZB 1YZLA 2FV8A 2R2AA 1DAGA 2VSXA 3KJGA 4Q4LA 4BY1G 3K81C 2YC4C 5J40A 3SOPA 2OAQ1 4ZDIA 2HF8A 1E98A 4LF5Q 3FKQA 4BLPA 4LFCL 4A2WA 4DBLC 2YWFA 4NONA 4PSVA 1P60A 2GXQA 4LFCQ 3BH6A 4UJ5A 1WBBA 1Y1WG 1P2TA 3E70C 2ATVA 1K83H 1M74A 1CEEA 4AQYL 3RR5A 1P73A 4NXML 221PA 5KOYA 1KRSA 1MT0A 1TUEA 2PMKA 4KSBA 5CJPA 5F9HA 3J80c 3NBZC 2YTVA 1VCIA 2BHRA 3IPXA 1E2FA 1G7CA 3GTJH 2GF0A 4Q9JA 2WWYA 1EWQA 4YHHL 2Q3HA 4A4IA 3B1XA 3P4YA 2EU8A 5JS8A 1UE7A 2HYIC 4PMWA 1SXJA 2GETA 2YHSA 1N34L 4GZMA 4DUZQ 4A3LH 4YHHQ 3BH7A 4NH0A 4KFRA 5FOUA 4QM7A 1BKDR 1T3LA 2KB0A 4DV5L 4LV6A 3AKYA 5JI2E 2ZRNA 4NMMA 4EJSB 4TL9A 4IFDG 1NBMD 4AC9A 1E2DA 3L2PA 1GZSA 2KSQA 3L43A 4LBYA 4NCKA 2UZIR 2ZJ5A 1XEFA 1KSHA 2AK3A 1OV4A 4DK6C 4A2QA 3GJ7A 1HQCA 2HQLA 3THWB 3GLIE 3IPYA 4L15A 3V9PA 3B6YA 3Q85A 4O3MA 4R98A 4LBZA 1JPNA 1Q3HA 4OI4A 4ZDWA 3GMTA 1HT2E 3PUVA 1DOAA 1ZAKA 1Q57A 2ZSAA 1Q12A 3EN2A 5CK5A 4CRWB 4CT4B 3L0IB 1Z22A 4TL8A 5HZHA 4IOCA 4A3KH 1IN7A 1R0WA 3BD9A 3LY5A 3NBYC 3TLXA 1PH4A 1UADA 1I5FA 3K9LA 1R2QA 1Z8FA 2Q9BA 2Z0SA 3CCLA 2A8VA 4LCBA 3SJCA 2ZR7A 4Q1EA 3TR0A 4A3MG 4X65Q 2P65A 1UWVA 2ZIAA 1JE5A 4QIWE 2HXSA 3B1ZA 3SFZA 5C44H 2I5LX 2C98A 2HUPA 3CRW1 5DLQE 3LLUA 3AF3A 4HJ7A 1F5NA 3LQQA 3UATA 2ATWA 5TVKA 4P4SB 1N3BA 4UQOA 1AS2A 4FCTA 4HB3A 2F55A 3M0EA 1SQ5A 1UBGA 5LBIA 1TEXA 4RZXA 3I72A 1HA3A 1E2GA 1KO8A 1MR3F 2ORWA 2V1XA 4H1VA 5G41A 5JCZA 1TWAH 4Q48A 2R7DA 2QAGA 3WXMA 3SE0A 1AE2A 2JEBI 1ZNWA 4JI5L 2G88A 3B8HA 3PVSA 1Z83A 2WICA 3E5HA 1E1OA 1X8KA 3N5CA 2HJGA 1XTQA 4JI5Q 2IF2A 2IUTA 3DHWC 1N6OA 1AZSC 3IO3A 4WOPA 1QVGA 2A5FA 4NYMR 3BFKA 3T35A 1ZINA 2WB1G 4M9QA 4A6PA 1X3EA 3G4SA 3K09C 4OI0A 1YQTA 2GAAA 3B7GA 2UXBL 2GK6A 4JOIC 3A4NA 3K0CC 4KLKA 3BAFA 4K8OA 4JYAL 5IYBG 2ZJRA 1JEEA 4C2TA 4DR2L 5FLMG 3X1DA 4I1OA 1VPLA 2V8OA 3U7FB 5JSZA 2CFMA 2FPLA 4IPDA 1MRSA 5IP9G 1KK2A 2HV8A 3V4FA 2NO7A 2RGBA 2BEKA 1QDEA 1OHHD 2PZGA 4CDGA 3NWJA 1LB1B 1KKMA 3NVAA 4JG2A 5ELOA 2YNMA 4OBEA 4U00A 3BIFA 1TX4B 4QJFA 1T5IA 2AL7A 4XTCS 1MRNA 2WWHA 3D8BA 2QMOA 3T1TA 1SVSA 5C3EH 2GVZC 3TRFA 2RHSB 4LJ9A 3AQ4A 4OYHA 1IM2A 1PH8A 4L9WA 3WHKA 2JK8A 2J7PA 4PHGA 1D5CA 2ZI3A 3LGJA 1K6MA 2WWWA 5M5YH 2ZR9A 4ZCMA 4JI6L 1QF9A 1Z2AA 3Q72A 4XD7A 4LC0A 3RABA 2VIIA 2YOFA 4DXAA 4L5RC 1N25A 4JBYA 5EP2A 4B3MQ 3AEVA 3RRNA 3UMSA 1CKNB 3SYKA 3QXHA 4CEHA 4PC1A 3BB4A 3GFOA 1KNQA 4PO1A 1YZTA 1F3OA 1Y63A 2C5LA 5F2EA 3HOXG 4PTLA 1ZCBA 1L1OA 3U3JA 2AK2A 1CR2A 5H70A 1N0UA 1GNPA 4FI3C 4RD4A 3OTOQ 2R92G 1MO3A 3KTAB 1GL7A 4BPBA 3VKHA 1VQAA 4C3HH 1R5NA 1DAIA 1MKYA 4IPHA 1G8YA 1YZQA 3AH8A 1UE5A 3CIOA 4A0FA 3EPJA 4PPGA 4P4SA 4DLUA 2ZRGA 5C4XH 4HZIA 2IX0A 4MITA 4LFBL 4TSFD 3ZIAD 2F9MA 2HCBA 3KKMA 4HLCA 1I50H 2W00A 4NCNA 3I4NG 3L7ZC 1HE8B 5CLLA 5CDFA 4P4TA 4UPAA 3FWYA 1YZUA 2WP8J 5E7NA 4QFMA 4HATA 3ULJA 4CEIA 3VR4A 1N36Q 4DV0L 5HCNA 1EFUA 2BMDA 2B92A 3LW7A 5DNYB 2V1CC 3U3OA 3KQLA 2HCJB 5TB5A 2ZRIA 2JASA 2GBLC 2WWFA 5EE0A 4G1UC 3DDCA 1WA5A 4FN5A 3G48A 2PQAB 3GLFE 4TQ9A 3QJYA 4NCIA 5H8WA 2O8DB 2IC5A 1FJGL 3IDQA 2XJ9A 4CEJB 4GOPB 5IT9c 3BXZA 1OYYA 3ZS9A 1HH2P 4TZ6A 2EIFA 2H7VA 3O8DA 2PMZE 2CL6X 1IBLL 2WJVA 1R4AA 4I4LA 2REBA 4GKJL 2CXXA 1ZVQA 2BA1A 2XOKD 4DIDA 4PX9A 3STBC 4Q1DA 3V4RA 1UEBA 4L5QA 1XJQA 3W8NA 4AG5A 4V0LA 4XWOA 1TADA 5H1SE 1YHQA 3RWOA 3U4QB 3HOYH 2GA8A 3TR5A 4KFUA 2Q2UA 2CEAA 3U3KA 2WSSD 1W0KD 1T0HB 2FNAA 2XOKA 3LD9A 2JEOA 4DIEA 3LRPA 5AJZA 1OH5A 5SZHB 1VQ4A 1RRFA 3PF5A 3U58A 1NI3A 3LAWA 4GMXA 4IOMA 1F6BA 5IK2A 4GSYA 2JLZA 1PH5A 4YY3Q 4DR5L 1SXJC 1Z6XA 3N70A 3S24A 1DAEA 1ZJ6A 3NEJA 4GS3A 3F5FA 1W0JD 1E0AA 1P3JA 1YR6A 1CSPA 2J0UB 4TLDA 1KMHA 2EWVA 3KB2A 1VQFA 1FQKA 3BFXA 3UG6A 4YCWA 4EJSC 1JQLB 2YINC 2VS1A 3ZS8A 4BLRA 4QJ4A 4KXFB 2UXDQ 1QHHA 5DE3A 4BFTA 2I1QA 1ZNZA 1W44A 4JI2Q 2FH5B 4Y52H 2ECKA 1RVDA 3KJPA 2F43B 2GEDA 2V9PA 4M1MA 5KDLA 3PO2G 2K4KA 1D6JA 5TARA 2A7QA 2JGNA 2CVFA 3QPWA 5BYKA 4L9SA 2FF7A 5CM9C 2I5HA 4X6AH 2C2HA 1JR6A 3PCOB 1GKHA 3K0SA 1N32Q 2CKZB 1E79D 2FSIA 1RRGA 2H18A 2FOLA 2N1BA 3A37A 3GJ3A 2GBLA 4A3KG 3CD6A 2CCGA 4R4IA 3CC2A 2PJZA 3L0SA 4R4TA 1VG9B 2FWRA 1XJ0A 1JPJA 2JATA 3CBQA 2WIAA 3CNLA 5TY0A 4DT1A 1ZM3A 5KHOC 2K75A 4ME3A 1M1KC 2Z83A 3ECCA 2QE7D 1KJYA 2XTMA 4IVRA 1OFTA 4LJ6A 1N9WA 4TWZA 1YVDA 2R93G 3CPFA 4DUYQ 2QGNA 3AVPA 2GAOA 5JFGA 1A8VA 4L4UA 1U8YA 4YWMA 1E2QA 1A63A 2C95A 2QP3A 2VHJA 3EXAA 4QGGA 2F1RA 4BFXA 4DUYL 2F1IA 2V1UA 4HDCA 4I1SA 4Q7MB 1QHXA 1WBDA 4BLQA 2D0OA 3ER0A 2XTNA 2G6BA 3MG9A 1J5EQ 1TF5A 5JRJA 4DHEA 3KFUA 2BBWA 1A62A 1VQLA 1XTKA 3VFDA 3NH9A 1AS0A 2QZ4A 3UPUA 3SN6A 1VCOA 3WMGA 2WAYA 3H0KA 5ELXA 3SHFA 1E9DA 3MMPA 3ETLA 1S1CA 4KYIB 3AFPA 5J4LA 3U7GA 3CPWA 2JA6H 4LJ7A 4ARZA 3R7WA 4WVFA 3M85A 1VQOA 1QVCA 1W0KA 3TEHB 3K8YA 4QGAA 2ZJPA 4JI4Q 2N78A 3EZ6A 5IWAL 2CMKA 2GF9A 3EA0A 5JEDA 1TU3A 4WBSA 4PZ6A 4KJZA 4YDHB 1WDTA 1WCV1 2CE2X 1Q3TA 5IWAQ 4IDOA 4HIMA 2VPPA 3U4VA 1E9CA 1FTSA 4A8JB 1KAWA 2JA9A 5J47A 3ZVNA 2OCEA 3AVUA 3ADCA 1OE0A 2JDID 3GQBA 621PA 4Q02A 1U90A 1Z0AA 4HZUB 3DMDA 4PZ8A 4LJ4A 2D0PA 4CGZA 5M3MG 5AJ3Q 4GNXA 4W5HA 3PF4A 1XU4A 2Q21A 4DV2Q 4ZKDA 4K81B 4PHHA 4DLYA 3J80i 4FDBA 2XAUA 3WP0A 1SHZA 5J4KA 3FDIA 2EFDB 4FXPA 3KFVA 3HOZG 3MFYA 3KX2A 2N3SA 2VBCA 1U5KA 2VF7A 1HH4A 5GJBA 4US0R 1WCMG 3U2QA 1E9FA 4IDNA 2V6JA 1UPTA 1U0LA 1A2BA 3LVQE 4LJ5A 3NBXX 4GNKA 4Q66C 1YRBA 2QA5A 3UWKA 1U99A 3GTPH 2VLIA 5GVRA 1U81A 2NZHA 4I99A 1EOVA 1VDZA 2JA5H 3HOWG 3FYHA 1YE8A 3AFQA 1CULC 4S35A 1YVCA 4LF7L 4QNRA 1VQJA 2GZDA 3RS3A 3ZDQA 2R44A 4F4IA 1XPUA 1EESA 1BOFA 5H1YA 3DZDA 2YU9H 3I7FA 1S3SA 3HJNA 3MUFA 2EQBA 4DV1L 4RMFA 1R5OA 4G5OA 1ZYUA 2WSMA 5C4GB 1IN4A 2X2EA 4YCUA 1SVMA 3CF6R 4CW7A 3CPHA 2PLFA 4DV1Q 5C3EG 4Q1FA 3S1AB 5KNBA 1DBSA 1E2HA 1W4CA 2J9RA 4GPTA 2QTFA 1KO4A 4UNQA 1SR3A 1EFRA 2RGNC 3IQXA 4XSHA 4DR4Q 2AFHE 1KAOA 2MNAA 5JEAJ 5D3QA 3QXSA 2WZQA 1GITA 1IXRC 2B21A 1QRAA 3L82B 4TL7A 3RS0A 5IP9H 4IHQA 2GXAA 1N6HA 4B3TQ 4EQ5A 4GOXA 1JB7A 2NZ8A 4QHTA 3BB3A 4HLUA 4B74A 4B3RL 2BWJA 3NH6A 2P6UA 4B44A 2ZI6A 2ZYUX 4C3ZA 4EQ6B 2VY3A 1FPMA 1G291 1EX7A 5FI0B 3TS2A 2ZI9A 3TIFA 4JL6A 1PH3A 1CKMA 3OIUA 1N6LA 4A9AA 5E7IA 4E07A 3RLNA 2Z43A 3CNOA 4A3DH 3LBNA 1SULA 1DGSA 1JR3A 1OIVA 1X6VA 2QG6A 1RRPA 3DO6A 3AVVA 2KHIA 3K0FB 4W5JA 4YDSA 4BFYA 2NMVA 3E1SA 4GZLA 3PEVA 1NL3A 4PAMA 4A15A 4POGA 5GROA 2QTVB 1L1OC 3GJ6A 3VQTA 3QSYA 5FBRB 2YC2C 3W3ZB 2CK3D 1G51A 2BMJA 3D7MA 1AS3A 3D3QA 2ZJAA 5IK2D 4GL2A 1VQ9A 3CF5A 2QMHA 4RCZA 3WYGA 1GNQA 2FJUA 1KZGB 1Z07A 3TQYA 4P33A 1S2MA 1VHTA 1NLZA 4TQAA 5L3SB 1D9ZA 2CK3A 2BVNA 4DDUA 1NIPA 1D7QA 3KYHC 4JVMA 5KSZA 1JXMA 1E2JA 4E5UA 3PITA 4MUBA 4LK2A 3RLFA 1VTKA 5EUQB 4FMDB 1I4LD 3JAMi 1YR9A 3BRWD 1FP6A 2LSSA 1Z63A 2DPXA 3QF4A 1E1QD 3JAMc 4JL8A 3PO2H 5JWHA 2C03A 5GQOA 2ZEJA 4IXNA 3FHTA 1VG0B 1YZGA 3CR7A 3NEYA 2R65A 2VZAA 3K0XA 3HR8A 5CIQA 1XMQQ 1XNQL 1XNRQ 2RHDA 1J99A 2G77B 4Q1AA 4TTPA 1NJGA 1P2UA 4BXXH 3NXSA 3O8BA 1GG2A 4TN1A 5FPYA 1E9RA 4B76A 1WJJA 1VQHA 1KDTA 1O7IA 1IXSB 1DG1G 3RYTC 2P6RA 3THYA 5FL7D 4PXAA 4DV7Q 1DADA 2IF0A 5EP4A 3W1BA 2OLKA 3U7HB 1NVWQ 3KXLA 4O0MA 2RGGA 4EKDA 5JECA 3GLHA 1D9XA 4WXRA 2ALYB 3CH4B 1X8JA 1X9NA 4TMWA 4MKIA 1CR4A 3LXXA 1NBWA 2ZETA 2E1RA 2GCOB 1KGDA 1AGPA 3FTQA 1X56A 3ONWA 4WZAE 2CL7X 2ZTSA 1RFLA 1US8B 4JBMA 2AR7A 5M5WH 1YR8A 5L3VA 3GEIA 5M3FH 1P6XA 1L2FA 1Z9FA 1ZIOA 2DFTA 2WKRA 3STBD 1DVRA 2HYDA 2VF8A 3FHCB 2GN5A 1N5LA 1N36L 4P74A 1OT3A 2A5JA 2K5UA 3I8XA 1YEZA 4A3JG 4JYBA 4U02A 3TVTA 5IYDG 2QAJA 4QKQA 5FTJA 1NTGA 2VEDA 4R7ZA 4B43A 5IDVA 5ELNA 1U0JA 3SHWA 2A1AA 4TQUS 4LUCA 2IHYA 3M9BA 4DV4Q 5L3RA 4EDHA 1COWA 4KHZA 3M3YH 1P9WA 2IYWA 3KXIA 1X86B 2GEUA 4KYUA 4BGDA 4ACBA 1QVAA 4DV4L 1TAGA 4BFSA 2ZE5A 2GJKA 2B63G 1Z0FA 4EJSA 1N0VC 4S2EA 4LYAA 1WRBA 2FFQA 1JR3D 2ZRLA 1X1SA 4XJXA 5FL7A 3ZVRA 1F48A 3U44A 1W46A 3CZPA 3N2IA 5ANRB 3CRQA 2XNSA 3KQKA 3AP1A 3CONA 1GKYA 1KO5A 5SZJA 3IO5A 2JIZA 3REFA 1P9NA 2OLJA 4QJ3A 1S3GA 4GT1A 4D0GA 1JAIA 4HB4A 3PEUA 3CCEA 2Q6TA 1M7BA 2RH5A 4TLBA 3TRZA 4A93G 3W1GA 3KQUA 4LF8Q 3K0AA 2Y0SG 2E9SA 1JT8A 1Z06A 3DZ8A 1SVKA 4OXPA 4EFMA 2EXDA 1E2IA 1E9AA 2ZROA 4QL3A 5BN5A 3P20A 5TDHA 4GI7A 1T0JB 3QF7A 1GAJA 2RF4A 4WJ4A 5L8VA 1EWIA 1G41A 1KK0A 2H5XA 2CHQA 4IEIA 1JAHA 4LF6Q 4YLGA 3MEFA 5C0XI 3T1VA 3MAAC 2BH2A 3H84A 1IBKQ 3WMFA 2WWIA 3TS0A 3HWSA 2A19A 5BW8A 3KQNA 3PQCA 3KUDA 1F2UB 1NN0A 2TMKA 3W34A 1OXVA 1C4OA 4L8GA 5KSOA 3WNBA 3CR8A 4BQSA 1WB9A 3QKSB 3FPAA 2J1LA 3MWKA 1Q8KA 1SHKA 2RGEA 3E9IA 2HF9A 4P32A 4O25A 2VHCA 2G9NA 4BUJA 3PEWA 2WBLC 3A1SA 5FJ8G 1QHGA 1IXRA 4MRPA 3J7A5 3JVVA 5AJYA 2ZAMA 2IEYA 2BBOA 4G5GA 4P71A 1E2EA 3TW8B 3LQRA 4IPCA 2ZRCA 4IKEA 1AQYA 3O8RA 1RPZA 4KHPL 4GDFA 2I5MX 2OXRA 5EE5B 5BQ5A 1E3PA 3T15A 3QENA 5HE9A 2N42A 5DYGA 4KHPQ 1KSGA 4E22A 1VG1A 4LYFA 4BFVA 1Q1EA 2J0VA 3QUSA 4EIWA 1H8HD 4L5SA 1E94E 2ZJ8A 4YMVA 4EFNA 1ZCAA 1ZBDA 1VYTA 4V03A 3UXMA 4BZPA 3AB3A 3SC3A 4A36A 1G9XA 1FL9A 3TUIC 2O5VA 2E2IH 1IN6A 2ZU0C 5IYBH 5EAYA 1DPFA 2BV3A 5DI3B 4ZDKA 5DN6D 1M6NA 4TYWA 4QBHA 5CJ2A 821PA 3CPEA 1JI0A 4XTRA 2ANCA 2ES2A 4UNNA 2ZE6A 2PEYA 3FKIH 2FXQA 3PIOA 3FKSD 3X1YA 4DR3L 3KXKA 4C9BA 3RRYA 4DDVA 3PV0A 3OEHD 1W48A 1E1QA 3U44B 4P3YA 5CM8B 5FOWA 1YJNA 1S40A 1CJMA 4Q4AB 5GADl 2CVHA 4C7OA 2A2ZA 4JI1Q 3KFXA 2JLWA 2W2VA 2UUAQ 2H92A 4DCSA 1IONA 1XMSA 1XMVA 3IGFA 4MH0R 3TJZA 1QVFA 1U8ZA 4CVNA 4FD2A 2KBNA 4KU4A 3NC0C 1VQ5A 2ASEA 2HT6A 1EFHA 3CRMA 4NCJA 4D0NA 3BU2A 2MMCA 3C5HA 3AUYA 4HSEA 5KSYA 4CIDA 2IL1A 2DWPA 1L1OB 3UANA 1N6IA 4YWLA 1HNWQ 1QHNA 1ZU5A 3RC8A 4H1UA 1CJKC 4UP9A 1RIFA 1K9MC 3W6NA 3FFAA 3S14H 4X66L 1ZC3A 2O0JA 5AUPB 4TYNA 2KCMA 2Z6VA 2OUKA 4A75A 2AHOA 3CW2A 5G53C 4ILEA 4RG1A 2KE5A 3EIHA 3CLVA 4D4LA 2OCYC 1IN8A 5IP7G 4DLSA 4BZXA 2EQSA 2IYRA 4BXXG 4DV2L 2HLDA 2XTIA 2YVUA 5F3WB 2WB1E 5DN6A 2IS6A 1MJCA 2HXYA 2PI2E 4JLMA 1FW6A 2QRNA 2E2JH 1E69A 4QHSA 3O47A 2DBYA 4DKAC 3QKSA 1D8TA 4LJYA 4A3CG 3WNDA 4BZQA 1G7TA 3PUWA 4BBRH 1E9BA 3BERA 2GEVA 3QXCA 3J81c 1YITA 3A36A 4W7SA 4B3FX 4B71A 3UG7A 3K70D 2BIFA 1PUJA 2R92H 5KUTA 1K0RA 2IS2A 4GN4B 4B6EA 3B6EA 4KSCA 4F92B 1IBLQ 2ZXUA 2HDNB 2KBFA 2W83A 2O8EB 3W6OA 2YYZA 1XJVA 1QUQA 5CB8A 5LD2B 2EVWX 3KJOA 1FGUA 4A3LG 3B85A 5KDDA 3VNVA 2QPOA 3KTAA 3F2BA 2RHQB 4Y7NH 3F2DA 2XSZA 1I4DD 3I55A 2WJYA 4GBMA 2GVDC 4KODA 2V7QA 4IVPA 2JLYA 2BEJA 1E9SA 3RZOH 3P27A 1VIYA 3HDTA 4CF7A 5KNCA 3MLEA 3Q8DA 1YHNA 5KU1A 1EFRD 3SR0A 1OIXA 3IIKA 4X64Q 5JEAG 4PR0A 5CB6A 2QY9A 3GP8A 3I61A 1EQRA 5CYPA 3I4OA 4OO1G 1PLJA 3BFVA 3P4XA 2QMUA 2O8FB 3G71A 1XPRA 1QG2A 2ZS9A 4MRNA 3GFTA 2PMDA 1NN3A 2VHTA 1KC8C 4CEIB 3QE0A 1I94L 4M4SA 2V6IA 4A4DA 3KKPA 4H9GA 4ZDJA 1DEKA 2QORA 5EJEA 2W2XA 2GK7A 3UKDA 4IDQA 1N6KA 4M1YA 1HNZQ 1KIMA 2QT1A 4DAYB 4JI2L 3Q5EA 2WSSA 4FMCF 3OAAA 2XJ4A 1U9IA 2WJIA 1F2TB 3PUZA 1IQPA 4B3RQ 4RZUA 3RC3A 2PQAA 3F1ZA 4G5QA 1ZUHA 1XPOA 2C04A 3CZQA 3TBKA 4OQMA 3KJHA 2E5LL 1VQ8A 2ODEA 2EYQA 4TVAB 1P62B 1J2JA 2CJWA 4PPNA 4Q9IA 4XVQA 4MGYR 3GEEA 3GLGE 4CT5A 4ZPXA 1J90A 2QSZA 1P8LA 2ZRHA 4PSKA 4IVQA 4DCVA 5HR5A 3AF0A 2OAP1 5AWFC 5FH9A 2NO6A 1P75A 1XEWX 5BWMA 1G3UA 2ZREA 1PH9A 5EQTA 3O8CA 2HIXA 4WJ3M 2ONKA 4DUGA 3EX7C 3CCVA 2B7CA 2ZUDA 1PZNA 3T5DA 4G0NA 3IIMA 3U4QA 3WY9A 1P2SA 2VP2A 2BA0A 2Z6KA 2GJ9A 5L3QA 4EPXA 1YZNA 4AYBG 4LNQA 1G19A 3M4OH 5LB4A 4US1R 2ZU6A 3DKVA 3QVUA 4PC2A 2JLVA 3A74A 2ZPTX 4D0LB 2UU9L 1E79A 4I81A 4BECA 5FOXA 2KBEA 4RD1A 3WRXC 2DY1A 4NDZA 2ZYTX 3TE6A 2MMGA 3AVTA 4NL4H 1KI6B 1ASZA 2UU9Q 1KMHB 3TSWA 2RAPA 4P73A 3ZVMA 2NN6G 2G1JA 4L5BA 4MRRA 1HTWA 2QNRA 1G3MA 4JI0Q 4M22A 3SYLA 4R4OA 1U8AA 3EWSA 1YR7A 3AVWA 2XB4A 1QUQB 4M1KA 4P31A 4BE7B 3C41J 2WAXA 4M9SA 2JQOA 1W2HA 1XMQL 4JI0L 1LF5A 1PUIA 2F43A 3L0PA 4KAXA 2ODNA 4QL5A 4C30A 1RJ9A 2A5DA 2FMXA 2JJ1A 1NBMA 5M3MH 4DV6L 2CLSA 3G5UA 1II8A 5FI1B 4NXMQ 3H15A 3TQCA 2AD5A 2ZRMA 2AKWB 2KWIA 5TXGA 2WTUA 1PYSB 2BKUA 3DM5A 1G4UR 1W36D 2N46A 2ZSBA 2V3CC 3AKCA 1W3SA 3K9NA 4KFTA 2PCJA 4MKGA 2ZRKA 2FFBA 2IXGA 121PA 3ADKA 1J7KA 5P21A 1NNEA 2JIZD 2ZRJA 2OCPA 3HP1A 1CIPA 3AP2A 2Q3MA 1RYFA 1R10A 1OH6A 1JJ7A 2F4VQ 1Q21A 1V5WA 4RD2A 1AH9A 4PPFA 3OYYA 2IYTA 2R9VA 1FP7A 3T1HL 1E7ZA 4KBFA 4DCUA 3HU3A 4JI7Q 421PA 3PIRA 5JS7A 4YMWA 3W3AA 3I92A 1S3OA 4HZUA 1N33Q 3HOYG 3THXA 3A0JA 1NVUQ 1Z0JA 5IYCG 1OHHA 4NYJR 1C7YA 1II0A 1UDWA 3MJRA 2MFIA 3CKLA 5FTNA 1CLUA 4QBGB 3GJ4A 1T6NA 3GLFB 4FCVA 2VP0A 3GFPA 4JLAA 4LF7Q 4QM6A 3ZYCA 2CLDX 4DWJA 4Q9KA 1A0IA 3KB1A 2JLSA 2OXCA 2WIBA 3IIJA 3S2DH 1KMQA 1LY1A 3I4NH 3EZFA 2B8TA 4WXPA 1GDDA 2H57A 3WNCA 5FTLA 1XEWY 3BZCA 4JLBA 2RB4A 1SXJE 3QG1A 4V0MA 4YQFA 4AKHA 4JVNA 1NMXA 2V7QD 3LDAA 2RGNA 3DL0A 3VR3A 3X2SA 3E0EA 1GP2A 2DYKA 1L4UA 4P4UA 2PI2A 3I4MH 4DR4L 2JA8H 1UKEA 3GEHA 2J59A 4R2HA 4U5XA 3C8UA 1UM8A 2YOGA 2JJ8A 1W36B 2D2FA 2J87A 1N2CE 4B3TL 3HPQA 3F8TA 2P5TB 4AYWA 3VKWA 4R1JA 1WF3A 4DRZA 5H68A 4HAVA 2IA5A 4O2LA 4BFZA 1W2GA 1HZ9A 5FOTA 4M0LA 3RZDH 1IXZA 1RJ9B 5AR1A 2UXBQ 3GJ0A 1Q20A 4B6FA 1IBKL 2YTXA 2GESA 3U4ZA 4BY7G 2CL0X 4O0AA 4D4JA 1CJTC 2ZITA 2WKQA 3RWMB 3CCSA 1LV7A 1P4SA 4BWYA 2ZS7A 4MZ9A 1RC8A 1OF1A 3TMKA 1MO5A 1S9HA 3KL4A 4Q21A 4HIOA 3KDSE 5EE9A 4KITB 3CX6A 2DWOA 1XZPA 3K70C 4QC2A 4PZYA 4QQBX 2VHUA 2IHFA 4A3IH 3KOJA 2IYSA 1L8QA 2ZRFA 3CPJB 2UUCQ 4IFEA 2QBYA 5LPNA 2DB3A 4HB2A 2CWPA 1Z0IA 5AUNB 3ZD6A 2ZR0A 4N0EA 2RCNA 1SKQA 4FMCB 4XH9B 1VQEA 1PA6A 2QEQA 3AGQA 3EG5A 4Q03A 1K8RA 2ZTDA 4DLZA 4DVGA 4DNIA 1FUKA 3UIEA 2J0QA 1G6HA 4RZ2A 1YZ6A 3TQFA 3I4LA 3ZJYC 1ZC4A 2NPFA 1IY1A 4QGUA 3QVVA 3KKNA 4JKIA 5DISB 5DGXA 4A0HA 4QY7A 4C3JH 4NXNL 1X1RA 3HR7A 1OH7A 4B3GA 1P2VA 2ZRDA 3FB4A 4I1VA 4DR3Q 1ZUNB 5M3FG 3NHBA 1SVLA 4DV7L 1OB5A 4DEXA 1FVIA 3QF4B 3LBHA 1SXJB 1W5TA 5EXXA 1CBUA 4JI1L 3CCJA 1KKLA 3ZJYA 4IOAA 2P5SA 3DOFA 3H2YA 1C1YA 4RZ3A 4HUTA 3IBYA 4RFVA 2KHJA 3GJ8A 3K0FA 3P1JA 4OHZA 2R6GA 4IDHA 4MYHA 1H8HA 2AXPA 4ZI3A 1T9HA 5FPHA 4NPHA 4IW3B 4N3NA 5LB2A 4L16A 4XWKA 4F93B 4AWXA 3VU9A 3SBDA 3OEHA 3UDIA 1HNWL 4JJZA 3X1XA 1CXZA 1D2MA 1N5JA 2W6ID 3B78A 4TTQA 1EUJA 1E32A 3ADDA 1HZCA 2OILA 5FOSA 1T91A 1GKUB 3CWZA 4X66Q 1Z6GA 1GRNA 5AUQA 3SJAA 2X19A 5LMUL 3ASYA 3KLWA 3SZRA 1GSIA 4FWTA 1GL9B 5J4VA 4B3XA 4C0AC 1E96A 2A5YB 1IY0A 1KIXA 3BBPA 3QKTA 4GP7A 5EE1A 1G16A 5IF9A 3DOEA 2LCFA 1JJCB 3M6AA 4RCYA 1XXHB 4DR1L 2NTYC 1AKYA 5LMNL 1KSJA 4NPSA 3ZZUA 2XITA 3R9XA 5E7MA 1P5ZB 1SRUA 1M90C 2MSEB 3CF0A 4DJTA 3AQQA 4BBSG 1TWFH 4HJAA 1T5LA 3BE4A 5C4MA 1ELOA 2Q2IA 5JEEA 3W9YA 4YXWD 4AKGA 3M4PA 2QPAA 3G6EA 1RZ3A 2FGJA 3GLHB 1UEJA 5FL3A 1KNXA 3S17H 4AKIA 1XP8A 5JRZA 3I2ZA 1AKEA 3LVRE 3T1OA 3PG5A 2W0MA 2IX1A 4URUR 1I3QH 4DV3L 4LF8L 2Z4SA 3TVDA 2OTLA 3R9IA 5C18A 1XEXB 2WOJA 4MQBA 4R71A 2G0NA 4A3FH 2AKAB 4HIKA 3PEYA 1LF0A 3VX3A 3OFND 1MO6A 3AVYA 3MRSA 4LUZA 1D2EA 4Q5IA 1W7AA 1OSNA 5AUOB 1DAMA 3GCGA 1NE3A 4A0GA 2JCSA 4LF6L 1G8HA 4BASA 1YHAA 4NHOA 1BBUA 1SN8A 1BYIA 1U0HC 3PENA 4XWAA 4L5TA 5FUVA 4AD8A 4D80A 4OONA 1KK1A 2MO0A 3CXCA 4JBXA 1COWD 1GWNA 4TMVA 2O0KA 3K7AH 1N6NA 1M1YE 3OE7D 2QGZA 3NEMA 1MIUA 2BMFA 4DR7L 2BM0A 2WHXA 2RKOA 1JBKA 4HYYA 4QRHA 1K73C 1N32L 3KF8B 1IY2A 1FL0A 2NVQH 1L0WA 2R7ZH 1Z6TA 2DWQA 3G82C 3I8SA 4MGZR 4C0SA 1UE6A 1WOCA 1HJPA 5JCPA 2JJ2A 2AXNA 3EWAA 5KSPA 3GDEA 4V0ME 3FOZA 3A6PC 3UE0A 2G83A 2C35B 2QP4A 1EGAA 3BWDD 4E09A 4R4QA 1QZXA 5LD2C 3OW2A 5KPJA 3LWNA 3K53A 5JMTA 1CSQA 4PFSA 1G3IA 1Q7YC 2YWGA 4A3MH 2GCPA 2IWRA 1KY2A 2IYXA 4U7DA 3ZVLA 3LLMA 3IEUA 4X8OA 4A2PA 2OG2A 4LI0A 2RHMA 4Q19A 3DPUA 1EQQA 3WBKA 4GN5A 1VQGA 2DR3A 5B58C 5CK4A 1VQDA 3H1TA 4TYPA 4M53A 4BLTA 2F3IA 4WW0A 3OZXA 4PHFA 3K0AB 3NHAA 4MGKR 1W36C 1W47A 4BY7H 2ZM6L 2K50A 1XXHA 2GTPA 4Z8YA 3CUEF 3AF4A 3H0GG 2JLXA 2GNOA 3A4LA 3Q7QA 1A2KC 2KENA 1DTSA 2ZQ5A 3ZQ6A 1KI8A 2JJ1D 5B57C 2ZANA 3A1WA 4BFUA 1KI2A 2VQFQ 2FZLA 1F2UA 2K5HA 3DKPA 3UDXA 4HAYA 1JJGA 2ZTEA 1UJ2A 3SJBA 2FU5C 2VYFA 4ZI2A 4KV9A 5FBQB 2REOA 4DDTA 4TL6A 4DV6Q 1Q0UA 2J0SA 4R4CA 2C9OA 4APVA 1SROA 1HNXQ 3C5CA 1P61B 2QRZA 3K70B 3DM9B 1P72A 1X8LA 3FGNA 4NTZA 4EAQA 2GVBA 4NYJQ 2QT0A 2JA7G 1A4RA 1T4GA 2VSOA 2CHGA 1NSFA 1E1RD 1ZD1A 2XGJA 4CEJA 2BM1A 3EAQA 1OFHA 2QPTA 3OEEA 2ASBA 4LGMA 1R6BX 2SHKA 4LPKA 4MUAA 5FPSA 2Q2TA 3WP1B 2QE7A 4BA2I 1VQKA 3NELA 1N8RC 4BRWA 4AIMA 1NY4A 1KHIA 1AIPA 1G5PA 1DO0A 4LYHA 1AJEA 2PX0A 2R6FA 4ESVA 4OX9Q 4JIMA 2JJ2D 4D4KA 1LTLA 2BJVA 4JI7L 4HJ5A 2J7PD 2RGCA 3A1UA 4GRAA 4UKDA 3RHFA 1WFQA 5CITA 2XXAA 1O3YA 2AHOB 5IT5A 1QHYA 2O52A 3ND8A 4M1SA 3MSXA 4M1TA 1G7RA 3Q3JB 3GJXC 4OKSA 2ZYWX 4Q4AA 4C7OB 3HOUG 5LMNW 2CBZA 1RE0A 1YBYA 1XMIA 2O8BA 1CS4C 3RRZA 2ERYA 1LYLA 3SGIA 3EZ2A 4JI8L 4X62Q 4LZZA 2D7DA 2Q0HA 3IKJA 2PL3A 1VQNA 4IFBA 4IDPA 3SYNA 3TK1A 2JA7H 4DZZA 1V9PA 4JI8Q 4X62L 3J81j 1E2PA 1XJCA 3I3SR 5E3HA 1ZIPA 2IYYA 3JC66 1PYBA 2QSYA 3ADBA 1E2NA 5CYOA 3GTLH 1KDRA 2OHFA 1HZAA 2FEOA 3A8TA 3OFNA 4Y0VA 4B2IA 2MSDB 1LUZA 2FSGA 1X3FA 4P75A 3HKZG 3OIVA 5AJXA 4ASUA 2R93H 4CYMA 1I94Q 3BORA 1V1QA 2OFOA 4TLCA 4EUNA 4HAXA 5BXQC 4HB0A 2J3EA 4JLVA 1HNZL 1BMFA 1KRTA 2PCLA 3T5GA 3HOVH 3LBIA 3LV8A 2CDNA 2LKDA 3U3MA 1E22A 1VHLA 2B6HA 4BEBA 1CR1A 3FMIA 1PHJA 2OESA 2E5LQ 2C8VA 1NN5A 1WMSA 2OBLA 3I73A 4Q9HA 1KHTA 3S1QH 5K8TA 5JHHB 4HUQA 5HE8A 4MGIR 4B3DA 3RAPR 5FBVB 3EIEA 4JBKA 2O8EA 2AWNA 3FKIG 4Q18A 2ORVA 4GLAC 1Q1BA 3HOUH 5DYIA 3CRRA 3CCMA 3I5XA 3MD0A 3Q5DA 4D25A 4OK3A 1ETUA 2IXEA 3RN5A 4JZKA 1SMXA 1J8MF 4JLOA 3OEED 4Z54A 2HT1A 1FX0B 2NQ2C 4BLOA 4W9MC 2VP4A 4JLPA 5FTMA 4M8NE 2ATXA 3WMEA 4A3FG 5EXPA 4X8LA 1CF4A 1UDXA 2QQ0A 2NO0A 2WV9A 2ZAOA 3H3VH 1VQPA 1B0UA 3RANA 3A4MA 2OT3B 1NVVR 3F2CA 3GTMH 1EYGA 1K5DA 4UY8C 1NN1A 1S0UA 4DK3C 2FPMA 3AYHB 3CRVA 4LSGA 1DARA 1UKVY 2QU8A 3C14C 1QHIA 2O8FA 1FFHA 3QEJA 1NLYA 1FTNA 2WMNB 2OTJA 3U6KA 3VNUA
chains in the Genus database with same CATH superfamily
1M2OA 4O2BB 2DULA 3MERA 3ER8A 4DA4A 1N2IA 4WASA 3ABZA 4PC7A 1BS1A 4BKRA 1RAAA 3LUAA 1C2YA 3DE6X 1G17A 4ZU3A 5CLQA 1CU1A 3GT3A 3DMRA 2PZFA 4PG6A 4ZVRA 2IHUA 2VP9A 3NDPA 5JZBA 2AUJD 3TCXB 2CB0A 1H95A 1L7BA 1VBNA 5KI6A 2P9JA 4TWJA 2PX6A 4J03A 2PA3A 4ZGBA 5CT4A 5G4KB 1T8UA 2DQYA 4B6JA 1Q6ZA 2Z6QA 2DN8A 1WUJS 4POAA 4DLRA 4KFSA 3M5DA 2HLHA 3ANTA 3IUEA 3K5PA 6YASA 1OH8A 3W5DA 5M29A 2L0XA 2RGRA 2Q5FA 1T8YA 3ZC3A 4B46A 1DS6A 1VQMA 2ZKLA 2AZMA 2D1FA 1EHIA 1N3YA 2ZJ4A 3NM6B 5JMOA 5HRCA 1U1CA 2Q07A 4KJXA 4R1TA 4QBFA 2OYSA 4WZAA 2NZ2A 4EQNA 4TTIA 4MHOA 1EVQA 2C4WA 3G89A 4GP6A 5E9WA 4QOSA 3U31A 3M6IA 4TVBA 4EEXA 3J80A 3CZCA 1H1LB 3FBGA 2BBTA 2E87A 1IB6A 1Z6YA 1GXDC 4CKBA 3DE0X 1J1UA 2GM5A 3PFIA 4P8RA 2X86A 4Q7KA 4TV8B 4F5EA 4D57A 4BTEA 4G0QA 4MI6A 5BVGB 4X7PA 2H5LA 4UDNA 2FQYA 1YCGA 3BXOA 1SFRA 3LRTA 5MGBA 3HGQA 4FM9A 2DX7A 2O05A 4HUQB 1M0EA 1LVGA 2PKXA 5J39A 3DDSA 1T3TA 1Q0QA 4OG2A 3C3WA 2IEBA 5KTRA 3BB1A 4O4IA 4FT2A 2FFHA 4P5PA 3C5VA 3PYMA 4XPIA 1AZPA 1J8DA 2Z6BA 3B48A 4R54A 2IYFA 4QDKA 3HWX1 2ANBA 3L7YA 5E4FA 5F73A 4B6GA 5FULA 3ZEAA 1SYFA 5EL0A 1FX0A 1ZMOA 5C1BA 3R74A 2JLRA 4FNMA 3MLBA 3W4JA 2BMAA 1PT7A 2QD2A 2RHLA 3ORQA 3PJFA 4LYJA 4MIKA 5BN3A 1QKJA 3E8XA 3LU1A 3RBAA 5BXYA 2ODWA 4KE6A 3ZZ1A 1RQXA 2WJ6A 4NEQA 2I6FA 1T5DX 3FSEA 4DW8A 2ZCVA 3A05A 3IT2A 5HUQA 2ZUEA 4LWCA 1Y3AA 5FO9B 3DKKA 1A4UA 1P2FA 3E2IA 3V42A 3T9AA 2O2JA 4F5YA 2ZJFA 1SE3A 2LWIA 1KVUA 3D2BA 4PX2A 3OT1A 5B1HA 1DQRA 2ZWIA 4D45A 2BF7A 5AVYA 2BR4A 1D8AA 2FEWB 5LZ7A 1EDZA 1TQ4A 1RQ7A 1UPAA 4OLHA 4QDOA 1KFJB 4KL8S 1R1DA 3EFXD 2HIMA 3F3MA 3IUBA 1W0JA 1JNYA 2ZSDA 4LBWA 3ZWQA 2D74A 4AY2A 2BC9A 3IEXA 2YN2A 1E9EA 1Z13A 3CZRA 1JJAA 3KSRA 1HURA 3GLHE 2JBHA 2LTAA 3AF1A 5A3SA 4C29A 3SQXA 1YQEA 3DF9A 2P6PA 2YWDA 1XVVA 1P9RA 4P82A 3W6OA 4F6CA 4ZYXA 4OHYA 2J0UA 1THTA 1PUXA 2VAWA 3MWLA 2ICEC 2C9ZA 5D3MB 1Z7TA 4UXIA 1VQ1A 4X7BA 3R20A 1T9KA 2EX0A 5G0VA 3K1JA 4G1CA 4O2RA 2PIDA 6GPBA 4CF6A 1Y1LA 1PQYA 2CDRA 1S5FD 3E3AA 3FKSA 1XNHA 4D96A 3GVXA 4G1VA 4HWOA 4R84A 1U8CB 1ONBA 1D1QA 3GRPA 5K0LA 3HXTA 2YL2A 4QAJA 5DJ5A 1M8PA 2FW8A 3TNLA 3WGYA 2PE5A 1Z4PX 3IV9A 4ALLA 2AA3A 4X62B 3PIIA 5K8TA 5IGBA 4L27A 3HOVG 4URWR 1JTFA 5EIWA 2C78A 1W73A 2DOKA 1LNZA 3GNQA 2YHAA 1WTVA 1SU6A 1FJHA 5DHAA 3GLUA 3PJRA 1VJDA 4U9IS 3ZHXA 2AG1A 2DLNA 2QAIA 5K0TA 3WS7A 4A3MB 2A6PA 1X9IA 2BCJQ 2F1OA 2NU6B 3HDJA 4M9UA 3F0TA 3UTDA 2X5KO 5AI9A 1E24A 4B3ML 2OQIA 2DHRA 2OEPA 3FD8A 3U1VA 4EMUA 4KMOA 3W90A 3ZEIA 3RAFC 3CHBD 2R5FA 3N59A 1K28A 1DU4A 1ZP6A 2IEZA 3CA8A 4UARA 2EFGA 4KGXA 3ELUA 1CZGA 4V0OA 5KVQA 1KI1A 1HV8A 3EQ2A 3HWSA 3O0DA 4PAOA 1CTQA 5IYCH 2VJNA 4HWRA 5HS6A 2I2CA 2CUKA 4RTJA 3NHSA 2FTKE 5B1DA 3TW4A 4F84A 3DT8A 4UHJA 1U98A 4FVTA 2OENG 5EUMA 4XX1A 2F4VB 4AU1A 1KOFA 1TF7A 1XN1A 2H2AA 1YD7A 3OZTA 3PNOA 4UEKA 3V1YA 1D1IA 1XCGB 5BMVA 2C7OA 3P2YA 2XYHA 3VR5A 1YS4A 1M0WA 1ZM9A 4O4LA 4TKZA 2WM9B 3W77A 3UAWA 4M2LA 2QM3A 3FJ1A 4PG3A 3AUUA 3RG8A 4AURA 2NT3A 4HFJA 4NZNA 5AJTA 5DULA 4EVQA 4KTAA 1KLGD 4WCDA 1MFZA 4GM1A 4QASA 1REQA 4Y2UA 2F3RA 3Q11A 2F9LA 4MYSA 2AQ3B 3W2DA 4YRIA 2ZXRA 3O3NB 3ZDEA 3FHLA 5ELEA 2BHTA 3EDOA 3GLTA 1JJVA 4DV0Q 3AKDA 3S8YA 5B36A 1BEUB 2IZZA 2KLHA 4ZWNA 5JJLA 2Y9PB 1D8LA 1EOTA 3AL3A 5IRCD 1UPXA 1KYIA 4R3NA 4P7BA 5CV9A 5DV9A 3OC6A 2C31A 2Q6VA 2XVZA 5DNCA 2ILVA 2F52A 4RAOA 1VKNA 5DMXA 4HD8A 5HZKA 2OORA 4FZRA 2JDIA 2VDWB 1ZEJA 1K86A 3W1WA 3NCHA 5HFAA 4S1NA 2ZS8A 4GG1A 5CITA 2QILA 5M9OA 3Q8KA 4WZ6A 3BDLA 5JD3A 4JI3Q 1O9GA 2CHVA 4J0DA 3HU2A 4GO1A 3RYHA 5BSHA 3WZMA 1WEHA 1OWOA 1YI1A 3WOVA 1MKHA 1WE2A 4JI3L 1NTRA 3KLBA 4LOIA 4AJLA 1JDTA 4YV2A 4NS4A 1QQBA 3S15B 4CLRB 1PL0A 4HC4A 5A4IS 3ABIA 3D6TB 4O2AA 2RBKA 4RYLA 1RFGE 2OGSA 3RS7A 1D7OA 2E7ZA 2V55B 3RK4A 3RSOA 2PSEA 1ZGGA 3BRCA 1C8LA 3HOZH 4PLWA 2PM8A 5KPJA 4ZVSA 1HA5A 1W49A 4W7HA 2OWOA 1YBHA 4MRVA 4DTCA 5HHTA 1KAGA 1YCHA 1XNJA 4MR8A 3JALA 2HR1A 5GAEC 2HA0A 4L95C 2FZ4A 1NZDA 2A4MA 5BR8L 4K1XA 3A1NA 3ZCPA 1U2RA 2W6IA 4NESA 4LF8B 3H09A 1LK7A 3FUUA 4H0LC 1NW7A 3BDCA 1RF2D 2A58A 2C2ZA 2WVHA 2JNWA 4BBRG 3A9RA 3F4KA 3HWWA 3KWFA 4TV9F 4ND1A 4BU1A 4KQGA 3G7NA 2VKQA 2X22A 4OQNA 4E4TA 1XMOL 4RVFA 2PO7A 5CMLA 4ALIA 1TW2A 3SQLA 3O2QB 3TGLA 4CKXA 3DEHA 3WQRA 1WDMA 3W6PA 4EATA 2VXYA 4YEDA 2PX5A 3D3KA 2NX2A 3AF2A 2QLBA 2M1ZA 3RYIB 1G3QA 4G36A 4XJTA 4F2WA 5BUCA 3HY6A 2G5CA 4IYJA 3TFWA 1HNXB 1RW4A 4HNHA 1YL7A 3QKSB 2O0MA 3OD1A 1RYMA 4YAUA 2J6CA 4PANA 2CYAA 5EJIA 1CA5A 1EUDB 1S9DA 2NT4A 5EKSA 3DS8A 3GAZA 3AVXA 2P2GA 1ZGZA 2H8KA 1M2GA 1Z29A 5BT9A 2K05A 3CF2A 3W5HA 2W2TA 4GLXA 3AWIA 5JAPA 5JNRA 2FZEA 1JDZA 1I5OA 2RGXA 1KJ8A 1OLOA 2IXFA 1TS4A 2ZUBA 5J59A 4BN5A 2JA6B 3CUKA 3M6UA 4WCVA 4HLQB 3VOSA 2D4HA 3TLGA 1A3VA 1IYJB 4IZ8A 4R1LA 5KVVA 2Q2OA 4EMSA 3N1UA 1LV9A 4IHJA 1YZ3A 1C9EA 4DIBA 1W76A 3I42A 4IKPA 2FK7A 2PJRA 5A1TA 4PZ7A 1DAHA 2GCIA 3KQHA 4DQLA 3F9CA 3GFQA 4DCJA 2B8NA 4G5HA 4OXNA 4MTNA 1OZAA 3M4OB 2XW6A 4HJ8A 3HCEA 1M6WA 1BTOA 3QBTA 2WM8A 3VUFA 2ZQYA 4DCMA 3IELA 1U8UA 1FA9A 3I52A 2QTMA 3LCUA 1UDAA 2XOEA 3PDUA 4Q9NA 4K26A 4XCVA 1SE8A 1GUSA 4K5VA 1EQUA 1UBCA 2XBUA 3KDFA 2AX4A 3LCJA 1ZR2A 2GCNA 2IQ5A 3R5JA 2CCZA 1K3TA 3CMMA 3K59A 4O8CA 1Z6AA 1F60A 4WUTA 3VVBA 2SCUB 1KTVA 4GXNA 5ADHA 2J5QA 1YH3A 4YV7A 2XSZD 3E9QA 3GV6A 4HSVA 4OQYA 4RANA 3UOWA 2X23A 4UP8A 4BWFB 5C3MA 1A9XB 1H6AA 2YJZA 4ED9A 5KTKA 2SEBD 4LJ8A 1B3RA 4JSYA 1NLFA 2OE2A 3MCUA 4H7IA 4KWTA 4LFCB 3DTVA 1RQRA 3CMEA 3C0KA 3F96A 3TI9A 3OHXC 1S1MA 1O9BA 1CS0A 3ROQA 1ZVMA 1D1PA 1MB4A 1YNXA 2AOUB 2W22A 3HV2A 4G4SP 4I50A 3D6UA 2BE5D 2BFOA 4MWGA 4Q9AA 2OQVA 4HQKA 2Z8LA 1R0XA 3JPYA 4F7DA 4IQZA 2W8BA 2HDWA 2ZK7A 3CMAA 1BOOA 1G7SA 1MNAA 5ALXA 5FKJA 1IBCA 2AN9A 3CXRA 5F7JA 4B4WA 4F1WA 2HMTA 1AHIA 3L8YA 2IYUA 2A73B 1O0BA 4XXHA 5K0SA 1YB5A 4OB6A 3BTOA 4X6UA 3NYWA 4OHWA 3CSUA 4Q4JA 3TAXA 3GD7A 1M67A 3TREA 1CUEA 2PGXA 2RHBA 3C3BA 3NORA 2V7BA 4M76B 3VKUA 1ST3A 4Q93A 4NJMB 4FF2A 2XNDD 2QAGB 4RIEA 1RRCA 3K94A 4ZAYA 4KXMA 5SYNA 1KAMA 5BOSA 1VIAA 1VSBA 5TV2A 4ND7A 2XYQA 4ITRC 4DAMA 1CUFA 1TJPB 3DSRA 3OPYB 1QK5A 4R8LA 2NTSA 1G6PA 1NBHA 1X42A 2CNDA 4WE3A 4X64B 1RL2A 5GOZA 3G6KA 4HYEA 1J0BA 3WSWA 1YJWA 5CLJA 5KVCA 1QHFA 1I4EB 1V8QA 4EQOA 1OJLA 5FQOA 2BFFB 2WM2A 4IUVA 2Q4EA 2J07A 2WHPA 1T4DA 3P32A 4QWMA 6CHYA 4NXNB 1WSAA 5JBIA 4Y6RA 5CA0B 2F17A 4HN7A 3PC2A 1B7YB 5FPTA 2FN9A 1FNSA 5JSZB 4IOKA 4AP5A 1ABBA 2JD2A 4F9EA 3PXBA 1QIJA 1L1EA 4FKZA 3B51X 2FLKA 2GAIA 1IQ0A 4HIDA 1U9IC 2BL4A 2Q5CA 4FYIA 3D4WA 3CRZA 2GDZA 2F48A 3NT2A 3R4VA 2E55A 4JOCA 5COBA 4FW9A 3ZHBA 1Y1WH 1I9GA 1GVNB 1MV8A 2DECA 3OHMA 5H80A 3VZCA 1FFDA 4TT8A 1MN6A 1AMOA 2EPBA 4FFVA 3JZAA 1MJ5A 5H0IA 4EPYA 3KAJA 4LZLA 2QEXA 2UUCB 1PJ3A 2GILA 2L12A 1RTOA 3EJWA 3EN0A 4WESA 3TG8A 2ODPA 1YACA 2D2VA 3BMCA 1GUDA 1EUYA 3IAFA 5FI3A 2JLQA 1CRWG 3AU7A 4ATNA 4UFPA 3DOHA 4K28A 4MVJE 1Z6ZA 2OXFA 4P86A 3KDPA 1XVTA 2H1CA 3MRTA 3H6GA 3MM4A 4MR7A 4Q00A 3LS2A 3MA0A 4J9UE 4QUHA 5CNJA 5C32A 1KR2A 4XASA 2J3JA 4M1OA 1CEYA 4AJ1A 3I5MA 2B4KA 4C0QC 1P8JA 3NC4A 2F0IA 2G67A 4A8JC 3ACCA 5L3QA 1J8FA 1JLLB 4OQ4A 5A0FA 3GOQA 2ZB4A 5HJ2A 2UXCL 3U4HA 3SQWA 2PZMA 4JC0A 4N76A 3DTVB 4CG2A 2GFQA 1CQZA 2QN1A 5HDBB 3ZHRA 3U7EB 3L8CA 2E2HH 5IUJC 2PJDA 4BWGB 3AI7A 1NF8A 2FPSA 5HGQA 1BWRA 4RD3A 4JI3B 3IRBA 2W8BB 1JKJA 1S89A 3PKJA 4HP8A 5YASA 5IJ9B 1ICFB 2XXAB 3BRWA 1U0RA 2JVKA 3KZ1E 2FHTA 1UXIA 2LXKA 2RHGB 2HKIA 5KIXA 3PYLA 3ORFA 1GM5A 1FC0A 3F5QA 2ZJZA 4I4TF 4Q4JB 4RV9A 4CJ2C 3C7AA 5E1MA 1JQ5A 1EWRA 2W6PA 3KOYA 2C3PA 2GDJA 1JFVA 3V7YA 1VLHA 1DI0A 2AF3C 3DMTC 4LBVA 2BOVA 2HA2A 4PAQA 4QZVA 1YRAA 1VKHA 2HU5A 2XR1A 2BGTA 3NV7A 3TSYA 4A92A 4OLBA 1CKNA 3R7AA 5JI3E 3FE2A 3I4MG 3CW2C 4P4NA 2VTKA 2RGYA 2Y2VA 4J1NA 1AQJA 2Q2VA 1HY3A 3OZRA 1C81A 1FSSA 1DEXA 3HRZC 1UKBA 2EY6A 2GJAA 4LUVA 3L4EA 4FX5A 1N1MA 4I5FA 2BDOA 4MV6A 4R8KA 3MEHA 4WCFB 5K8UA 4DQKA 4D5GA 5FUMA 5AKXA 3H2HA 1X94A 4OIMA 1X0XA 3RBZA 1NRJB 3BJUA 4RFSA 3SSMA 2GN1A 3VKGA 4W5QA 2RDGA 1E6CA 3LUFA 3SJZA 4B48A 1JHMA 1CETA 4OUDA 1M5RA 4GOPA 3ASVA 7REQB 3ELDA 1I3CA 1UKAA 2PD4A 3RT7A 3MS7A 5ERXA 1VCMA 1GNTA 2JCBA 2PMWB 4QCLA 4KR7A 1QB7A 5AW7A 4HCJA 3UMFA 3E7WA 3MA2B 1TL7C 5F1YA 4OF4A 3CQZB 5DX8A 2Q50A 4BV8A 1WZ2A 1M6VB 5BV0A 3M4YA 4Z6KA 2DUDA 2I8CA 3BULA 1LTRD 3OI7A 5KX5B 1FD7D 4AQYQ 3QVKA 1U94A 5LDGA 2R6R1 3ME5A 4R9UC 3T5MA 3UJAA 1P2DA 4AN4A 3T1HB 3FP9A 4IJHA 3HO1A 3EPHA 1FMFA 3A28A 2QZZA 1J33A 1ZK2A 1E3WB 5EZ6B 3MMNA 3NTUA 1WL8A 2PUHA 1T25A 5EP3A 4P7FA 4ZJPA 3EVBA 4B3MB 2D5DA 3OFKA 4K5QA 2UU9B 3PCXA 4ZJYA 3SF0A 1M2HA 3C7KA 4AKEA 2VQEL 2VDMB 1RLMA 4JBLA 3A3OA 2EQAA 1I2DA 2VTBA 5CT5A 1SXQA 4LAFA 1VYVA 1T0UA 1Y33E 1U5CA 3C3JA 4Z86A 3P9RA 3WHLA 4R6XA 4QDZA 2A9KA 1QFSA 3I28A 1DXOA 2R7ZB 4TWRA 2ZZKA 4HXGA 4XR9A 1GGHA 3RRMA 4DLVA 2B3GA 4ND6A 3WYAA 4DC9A 1Z2CA 1C7JA 1O77A 2VB2X 3PC3A 1W4RA 4NE9A 3IBGA 4MUHA 1XFAA 4RHXA 2WY2D 1KL9A 5TSSA 3F7TA 4WN3A 3T12A 5THXA 1A9SA 3GRVA 3D31A 5MHTA 1IQRA 2QI9C 3DCJA 1T5OA 5EJ8A 2EG9A 1U0FA 4FFRA 4WX2B 1T5BA 2EFEB 2EGUA 2FZVA 4A82A 4XDXA 4CG0A 3AM1A 5J9FA 1FOEB 2I3BA 1P7VA 4CIYA 3NPMA 4PXYA 3V8RA 4RGOS 4PAWA 3RSFA 1EYZA 4QJIA 2QDLA 5SY9A 1MB0A 1A77A 1YFKA 3QFTA 3KR1A 3GNTA 3QMPA 4LHYA 4MUMA 2IIVA 4A16A 1RTKA 3N6RA 1DXYA 3BS4A 3K5HA 5F5NA 3ZNNA 3QU7A 1R16A 5DRTA 5TQ2B 3U61B 2G0TA 1ADFA 5DHPA 2Y05A 3RSLA 4HVCA 2ATCA 1SUEA 3FR7A 4FMDF 4OWXB 1PLKA 5KTTA 3OE7A 1ORTA 1U7HA 3CUYA 4PZAA 2VDKB 4HI0E 4E31A 2FFAA 3RZDB 1KA9H 3OJFA 3FYDA 2N8NA 2GPNA 3DZBA 1TWCH 1STNA 3NBHB 1D6NA 2WUGA 3RUZA 3DG9A 4PFJA 4Y1RA 2FDCA 4FIDA 4YY3L 4DR5Q 2QL6A 1TZ2A 2ZRPA 5HG0A 1LNSA 3ADOA 1Z5OA 4BXOB 5I3CA 2HQEA 1G8FA 5DK6A 1T4MA 2UZ1A 2ZJ2A 5EHNA 3JQ9C 1H1LA 4ZMRA 3KUCA 1A8IA 1K4KA 4Z4GA 1P4RA 1ISRA 1TVEA 2Y0CA 2Y92A 3OQ6A 1EBBA 2Z08A 4ARZB 3RRFA 3K7EA 2FZ5A 2I7XA 2QTHA 3SGLA 3BMOB 1N0HA 5D14A 2PQMA 1R0BA 2R97A 3LIPA 3N8NA 3TL2A 5I7FA 4ZIRA 4D2IA 5KYXA 3QKUA 1PTKA 4N41A 1N92A 4E2XA 2VP5A 1JECA 2ZSUA 1RHKA 3UDFA 1KHHA 1V48A 3LM8A 4H3KB 1GILA 2IUSA 3IA7A 4LDRA 4DFAA 1ZOOA 3B6JA 5EIOA 5KYKA 2QM7A 3D6JA 4OI2A 3E0XA 4G56A 4TSSA 2UVQA 2JIRA 4LYDA 1KDOA 2G76A 2CLCX 4CFYA 2GXUA 5F76A 1HYQA 3SF8A 5K01A 4IMRA 2FPXA 1UF9A 5IT4A 2WACA 3IHLA 4YQEA 1IHUA 2PUWA 4KY5A 2VA8A 1C0IA 1Y69U 3ZZTA 4CCYB 5DCUA 1TNDA 2XSCA 1WR8A 2C3OA 3EOAI 3JQRA 2O8FA 2WB1B 1NVDA 3NDJA 4BBAA 2IXBA 3I01A 3R7SA 4D3DA 4RPJA 4M36A 5EGSA 1JCKB 5CYUA 3L40A 1EDOA 1G8GA 4M21A 5KNDA 1U6JA 2K2QB 2PU5A 3DMYA 5I9SA 1R7RA 2UUBQ 2FX2A 3ED1A 3IPAA 3N7AA 3NAMA 1E1TA 3Q4GA 4C3HB 4B9XA 4Y9DA 3S68A 4KR9A 2V54A 2FWBA 1B0PA 3CNEA 4S04A 5EJGA 2X6GA 4PTZA 4ETIA 3H3JA 4LX8A 4JWKA 4DA9A 4YRQA 2G5PA 1PH7A 4M9ZA 4KGZA 3EZGA 1XCPA 1RTTA 1Y5RA 2XIQA 3L6RA 3OTOL 4QOHA 3W4IA 4DCGA 4POOA 1EFWA 4ALPA 1CT9A 3IAYA 4QO8A 5J63A 4MYTA 3RQSA 1JHAA 1LSOA 3AERB 3PXDA 3CX7A 4B34A 4OOFA 1R0YA 1ZGAA 4DR6Q 2G25A 3EGXB 1RCFA 1ET9A 2PBZA 4YP6A 1XWIA 2OO7A 3LT2A 1O6FA 3SYNA 5IHPA 1FYVA 2Z09A 3E03A 4A3CH 3MWGA 4MQFA 4F9GA 3KF6B 4CM8A 2JBWA 1Y3DE 1A5TA 2JL1A 4BY9E 1KYVA 2DCUA 5IS2A 2GZ1A 1J00A 3RFUA 1NNI1 3GH3A 3LFUA 3S4YA 4UHBA 2ZQZA 2ZSEA 5JAUA 5JJKA 9LDBA 5EZQA 4EF5A 1T36B 3C3DA 4F8JA 4IY1A 4EX5A 2JZOA 2ZTUA 4I36A 1S8AA 4FSHA 3RJ9A 3NP8A 1ODCA 3VPHA 2MGSA 3VYSA 3NVKI 5JNTA 2JHAA 4ZVTA 3NHZA 4EGFA 1H0KA 3B6MA 3ZYZA 3MWYW 1ULTA 1GIAA 1JMVA 1UM9A 4XB6B 3TM5A