2AWNA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
372
structure length
330
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
total genus 77
structure length 330
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awnA03
2.40.50.940 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awnA01
2I1VB 4URYR 3M4OH 1H8EA 4DCSA 2EQSA 1GSIA 1RIFA 2CE7A 1P6XA 2OFXA 3TQCA 1G18A 5AJXA 4D0LB 3KF8B 2OCBA 3RS5A 1ZCAA 1NVVR 121PA 3RYTC 2JATA 1N5KA 3BH6A 3CPEA 4N3NA 1YEZA 5IP9H 3P27A 4IDNA 2ZRAA 2EXDA 1YKSA 4GOPB 3EIQA 1D2MA 1TF5A 1Z0DA 4ZIRA 1E2HA 2BMFA 5J4LA 3EZ9A 2ZI5A 4ARZB 3AEVA 4LI0A 3CPFA 1GZSA 2AD5A 4RFSA 4HLUA 2YTYA 5HY6A 5GROA 2GVBA 1GD7A 1II9A 2BCJQ 4JG2A 2IXEA 1Q8KA 3H4MA 4HDQB 4OWTB 2DPXA 5EZ6B 1UE6A 4UP8A 2JA6G 4HUQB 4DLRA 5TB5A 3W5IA 3T1HL 4G1UC 3ZIAA 5FLMG 5BYKA 2JLQA 2F3RA 1N6NA 3VNVA 2UXDQ 2FSHA 4QRHA 1UE7A 4IJHA 1BH2A 1S2MA 3IEUA 4MRRA 1NI3A 3BB1A 2LSSA 1KO7A 1W0KD 1ZM9A 2OBLA 3LAWA 4JBXA 2GBLC 5E7MA 3TUIC 4NYJR 4X66L 1NBME 4HB4A 3H2YA 1OV4A 4K0KL 1NE3A 4R4QA 3KZ1E 3FB4A 1Y1VG 4OJQA 3W6PA 2IL1A 3W9YA 3OESA 4JC0A 5FPKA 1WF3A 2XJ4A 2NO7A 4FCTA 1I4DD 1TAGA 4JMPA 3K09C 3DM5A 1R2QA 1RJ9B 4B3RQ 3KL4A 2IX1A 4NU0A 1GG2A 1JBKA 2ZJZA 1GM5A 4MRSA 4KVGA 5JRJA 2IHEA 2CDNA 1F60A 4LBVA 2D2FA 4DR2L 1UM8A 1YE8A 1U81A 5HZKA 4OWXB 1UWVA 3S1NH 3QF4A 1P9RA 1KK3A 2IXGA 4D6PA 4UNNA 1OSNA 2A5JA 2C04A 3RRYA 3OF5A 3FMPB 2VUMG 1CULC 1NVUQ 2OZEA 1RIPA 4EIWA 4LF8Q 4POFA 3ZD7A 5J5CA 1IZ6A 2H5XA 2ODNA 3PUYA 4KSBA 3OTOL 1YHAA 4GKJL 4WJ4A 1E69A 2ECKA 4LFAQ 2WVJA 4URVR 5CITA 3EZFA 3ZZTA 4A3MH 2XTIA 1AS3A 4LJ4A 4QL3A 4UP9A 2YTVA 4MUBA 821PA 2PX3A 2J45A 5ELOA 1E9EA 1E1QD 1WA5A 2VP9A 2ZUBA 2IX0A 3OE7A 5EE3A 1WDTA 1VG0B 2YC4C 3I55A 1ETUA 2ZS8A 4MGKR 4MQBA 5LD2B 1VQJA 1OIXA 4MRPA 1CRPA 2GJKA 5G53C 4B3XA 2BBOA 2D4HA 4QGAA 2ZU6A 3G4SA 2XX3A 2IXFA 3I4MH 3PXGA 1GUAA 4L15A 1G3MA 3T5DA 1P73A 1QHHB 2JGNA 1VQLA 3TMKA 2ZAOA 3CRMA 2BJVA 4LF8L 3LA6A 4TMXA 1T4GA 2QPOA 4Q48A 1HNXL 4LJAA 2CL0X 1KSHA 5C1BA 3RR5A 1GL6A 5LD2C 2X19A 1YZNA 1NL3A 3BGWA 4TVAB 4PAMA 3RSOA 4RKEA 3LWNA 3GTPH 1Q86C 1NN3A 4PQYA 1IOZA 1HEIA 1FMLA 2FFHA 1XD9A 5J40A 5AUQA 4UPAA 4UNSA 3K0AA 2IUTA 3DZDA 3M85A 5C4XH 4B33A 2MQHA 1QVFA 3CD6A 4UXIA 1W4BA 5F9FA 4GSYA 1QDEA 2C9YA 3AVYA 1XMOQ 4RD3A 2DFLA 4A3IG 2QM8A 4M1YA 3DLLA 1G8PA 4R98A 2X2FA 5SZKB 4C9BA 5KNDA 3THYA 3RHFA 2WJJA 1D5CA 3NBZC 2C5LA 3AEZA 1EQQA 1K8AC 2NVXH 2RGBA 3KTAA 1R8QA 3VHLB 1HQCA 1ESNA 2ZVQX 4HZIA 1HE1C 4HZUB 4C0HA 1TXYA 5TMPA 2QORA 1UAAA 4DLWA 1SMXA 4C2TA 1P75A 4JCVE 4RFVA 4RZ3A 3MGCA 2YWEA 4HB3A 2J9RA 3F5FA 1FZQA 4ACAA 4DV6L 2PT5A 1NVXQ 4A2WA 2I0QA 3KJHA 3CCQA 4DLZA 5JSZA 4PHGA 5EE5B 1KJYA 3J80i 2PCLA 3AKDA 1G7CA 2WJYA 1W0JD 2PJRA 2ZJAA 4P0TA 3GLGE 1MIUA 2Z4RA 4DR6L 1VQHA 4HJAA 2XOKA 2JLWA 3C14C 4OK5A 5DYGA 4JVSB 1GTVA 1Z0KA 2VQSA 4DJTA 3A37A 1EIYB 1OE0A 1Q21A 1NF3A 1GITA 1F2TB 2ZIAA 1U8AA 3TQFA 1XJVA 1P62B 4JJKA 2VEDA 1GWNA 4X8OA 2ASBA 4MUAA 3S17H 4BBSG 4KFSA 5EP3A 3CCRA 3GJ4A 1A2BA 1DPFA 4PQRA 4JBWA 3PUVA 2EWWA 4JV5Q 2ZSEA 5SZJA 3CP0A 5IE8A 5KSYA 5FUWA 1GP2A 2N78A 1EGAA 1TUEA 1VKJA 3FKSA 3AFPA 4IVQA 2X2EA 4A3LG 3K0SA 2ZS9A 4AYXA 5FLMH 1S0UA 3I92A 4HATA 1KTVA 1Z6YA 5HCIA 3K70C 5EXXA 4L5TA 3U58A 4JBKA 3TE6A 4AH6A 5CJ2A 2WOOA 3HOZG 2YOFA 3SYKA 4PSVA 1G64A 4RZ2A 2OO7A 5FLXc 2X1VA 2ZUCA 3K9NA 4BFUA 1A8VA 1Z06A 1D6JA 4OK6A 3FE2A 4W5WA 2AK3A 2R6FA 3R9WA 2NOAA 2CE2X 5D3MB 2D7DA 4B3BA 4DLUA 5JFGA 5G3ZA 4HSEA 2JJ1A 1Y1VH 1JJGA 1E2EA 1T0JB 5M3MH 4AIMA 1Z22A 1P4SA 1YZ6A 2ZRDA 3PIRA 4MYTA 1QVCA 4TMWA 2A2ZA 1AA9A 1AQUA 1ZNXA 4EPXA 5BW8A 1CLUA 1M6NA 3SOPA 1G3RA 4XSHA 1Z6TA 1U94A 5E7JA 4AIIA 1DARA 5C0XI 5JEDA 1IN6A 1G17A 1MT0A 1O3YA 1R5OA 3CH4B 2YVUA 4HLUC 5TARA 3U3RA 2QT1A 3SYLA 4QBHA 3QIAA 1RE0A 5L3SA 2A5FA 2VNUD 1JEDA 1IBMQ 2UUBQ 5FOVA 2L15A 2QSYA 1AN0A 2CCKA 5CYPA 5BYJA 4DSOA 5IP7H 3LXXA 1G3QA 3HJNA 3U3KA 4ARZA 2GXQA 2FZLA 5JHGB 1P9NA 5M5XH 1JALA 3FDIA 5C2JB 4LCBA 2ZRFA 5D3MA 5B57C 1P60A 4LC0A 4AURA 4JOIC 1KK0A 3FPAA 4YHHQ 3AVWA 5IK2A 5AWFC 2QAGC 1CIPA 1LV7A 4DC9A 2QGQA 2FG5A 3JZMA 4V0ME 4FN5A 3C16C 4CDGA 3RLOA 3K1JA 2HUPA 3QBVA 2WAQG 1OXVA 1UKZA 4GMXA 4PZYA 4Q7JB 5C3EG 3L8YA 1VIYA 3KXLA 3DOFA 2ZTSA 1SKYE 4XVUA 1JJCB 1G3IA 3OAAA 4P4SA 1EFHA 4A3GH 5AJVB 2F1IA 2P0EA 2VHUA 3ZVNA 1NSTA 2AHOB 4HJ8A 2DFTA 1QHSA 1SR3A 1B70B 1KD1C 1QHXA 2A5GA 2OV2A 4M22A 2N49A 1FL9A 1F2UA 4HAZA 4KYIB 4DB2A 3C7KA 2UUBL 1Z47A 4NB3A 1RJ9A 2RKOA 5M04A 3HOZH 4DR1L 4OO1G 1A0IA 2CK3D 2YWFA 4F4CA 4OQLA 1EIFA 4ZDJA 2KI5A 3S14H 2B92A 2NQ2C 3BB4A 4A3BH 3AUXA 2C03A 1DGSA 4IO9A 3QF4B 3N70A 4CT4B 1KY3A 4OQNA 1V43A 4C2MH 3BXZA 3C5CA 3RAPR 4M1MA 1GVNB 4F7WA 1KKMA 5EXPA 2NO6A 1LS1A 5EXSA 4HJ7A 3LNCA 2JLVA 3TS0A 1X3GA 1KI7A 3MEFA 5DO9A 3GTKH 1N25A 1K5DA 2GVDC 1EWRA 5FOUA 4TYNA 1KO4A 1US8A 2BEKA 3H0KA 3T1HQ 1VQKA 3ZZ0A 2HYIC 2UU9L 5KO2A 3JVUA 4IJMA 3THYB 5TV2A 3V4RA 4ASUA 5JECA 4UQOA 3GJ7A 1OHHD 2GK7A 3HOWH 3EIEA 2WKPA 3UMSA 4QHTA 3PJRA 1Q81C 1SE8A 2CJWA 4X66Q 4B44A 1DAIA 4F38A 3U6KA 2V1XA 4OQXA 1YJNA 1NJIC 1PLJA 5FBQB 5FL7A 2PI2A 3PG5A 4C0AC 1W0KA 1YHBA 2RAPA 3S15H 1L1OB 3TEHB 1ZNYA 1Q1EA 1NLZA 2W0SA 1E2DA 2XXAA 3L7ZC 1VG8A 4D26A 1AZTA 3DKVA 1RYHA 2GF9A 2WJHA 2XSZD 4Z8YA 1EFRD 2WWXA 3BC1A 3AV0B 3T1YL 5CJPA 2ZJYA 3JZAA 2QENA 3CXCA 5K8LA 1IY2A 4AYBG 3CPHA 4LJYA 4MGYR 1VQGA 5F9HA 1Q3TA 2GXUA 3U4QA 2G88A 4QG7A 1XCPA 3AF4A 1L2FA 2ZJOA 2OXCA 2PBRA 3L0IB 5GJVC 1E99A 1HT1E 2EQBA 1FQJA 1LW7A 1HR0W 4C0KA 4HDOB 5G41A 4QJFA 4W7SA 2OLKA 1L1OA 1CR4A 3AP2A 4LFAL 2PZGA 3NDBB 2CCZA 1JJVA 1E0AA 3ZQJA 4K81B 3AUYA 4GOKA 4PZ7A 621PA 4I1SA 1R9TH 1XZQA 1YZGA 5IRCD 4HLDA 2VHJA 1OH6A 5LB2A 1CF4A 2IYSA 2CNWD 1E2LA 1XEXA 2IWHA 2AK2A 3A1SA 3EN2A 4WXRA 2NVYH 3X1ZA 1XTKA 1OFIA 4A3LH 4LPKA 1W5TA 3T1YQ 1E1OA 3B13B 5GVRA 3U44B 1HR0Q 2JA8G 1WI5A 4BLPA 2CL6X 4B34A 2BMJA 3U5ZB 4V0OA 3AVXA 1DE0A 2MSEB 4Y7NH 1JQJC 1NN5A 1E9BA 4DLTA 2QEQA 5HE9A 5JCZA 3HOUG 4L5QA 4NYJQ 3RC8A 3VTKA 2CLDX 5DHFA 4W9MC 4B3ML 3OEHD 3UKDA 3VNUA 5L3QA 1G20E 3BB3A 3PENA 3QY0A 5DYIA 2A9KA 2MNAA 3ULJA 3GLHB 2BM1A 4Q7MB 2ZEJA 4BFWA 2F4VQ 3IKJA 4HAUA 1K8GA 2HYDA 3HR8A 3HWSA 3PV0A 3HDTA 4JKIA 4QY7A 1MJEA 4JL5A 2BH8A 2R65A 4JYCA 2ZR0A 2J0QA 1TU3A 2QZ4A 4OQMA 1XXHB 4MZ9A 1JB1A 3U44A 4AKIA 3CX7A 4WBSA 1W48A 1KAOA 2CL7X 4KJZA 3M6AA 3FGNA 1LNZA 3ND9A 2KE5A 3RS7A 1P72A 4IW3B 4UNRA 1UJ2A 1ZNWA 4D0GA 1E0JA 4QBFA 1KRSA 3ULPA 221PA 2NVTH 1ZC4A 1NVVQ 4H9GA 1W2GA 4LZZA 2ZI6A 3LV8A 3MJHA 3Q5DA 4IOLA 1FVIA 4V0KA 5JJIA 2D3WA 3QXHA 1X1RA 5JHHB 1E3MA 2FZ4A 1WCMG 2NVQH 4NONA 3H0GH 4LUZA 1E9CA 1U9IA 2PZEA 3EG5A 1KSJA 1QVAA 1R8SA 1N0VC 1XTSA 2DWQA 3K0CA 3NWJA 4LY6A 4V02A 5C3EH 2D7CA 4MH0R 1H8HD 4GZMA 1E2PA 4DV6Q 4W5HA 3RC3A 4CIDA 4ZIRB 2ZJRA 2E2IH 4JL8A 1G16A 1QHYA 5B30A 3PITA 4RZXA 3RRZA 4A3GG 1NBWA 2OLJA 1KDRA 1RVDA 2O52A 3SBEA 2PCJA 1VCIA 2JA9A 3QPVA 5L8VA 1FNNA 4ZKEA 4GS3A 1MRNA 3F2BA 3EW9A 4IOJA 4KO8A 4UXJA 1KI8A 2A5YB 3TVTA 2P5TB 1VS0A 4M4SA 1DAEA 1DAHA 2NO1A 1V9PA 2ERXA 2VP2A 2C9CA 3K8AA 1NN0A 4L8GA 5FUXA 5TY0A 5CIWA 1AZSC 2CCGA 3NC1C 3AVPA 2G9NA 4YXWA 1KK2A 3SFZA 1TWFH 3OZXA 2OTLA 1KDOA 3CC4A 1TL7C 1G3UA 1LS6A 3VU9B 4C3JH 4F91B 5IP9G 4PAOA 4PSAA 4DSNA 5J3BA 5LMNQ 1XP8A 4WZBE 4A15A 4EQ5A 2CJWB 4D82A 4L4UA 4P4TA 3MFYA 3W6OA 3AF0A 3HKZG 2ES2A 4QGUA 2GJAA 4MGIR 4RD6A 4LRWA 1X55A 5C0XJ 1XRJA 1Q1QA 2Q2HA 1OYYA 1N9WA 3SEAA 5TXGA 2XXAB 1D9ZA 4P4SB 5CLLA 5HTKA 4EDHA 5CDFE 3A5ZB 1TNDA 1ZINA 3ERSX 5C4MA 4DAMA 1HNWQ 1HQYE 4UXHA 4B3CA 1UKEA 2WSSD 2HLDA 3U7FB 1W2HA 1KYIA 3X2SA 4DV2L 1KAGA 4C30A 5FOWA 2EYQA 1HZBA 1M1YE 2W2VA 2XNDD 4HEJA 3VR5A 4TWZA 5JWOA 4J15A 3V00A 4WA7A 1A1VA 1KXLA 2ZSBA 4XVQA 3STBC 2R9VA 3UWOA 5EP1A 2AKYA 3KJEA 5LBIA 4MKGA 3WHLA 2D74A 3AB3A 4DEXA 4PZ8A 2NN6I 2IC5A 1G19A 3KDFB 4RMFA 3KXIA 1GRQA 1RRGA 3IO3A 4PZ6A 2PLFA 3A1WA 1D2NA 4NCIA 4QBIA 4YMWA 4OHWA 3PSIA 4OI1A 4RD4A 2G0TA 2JLRA 1IN7A 3HR7A 3OEED 3ZVRA 4PANA 1E9DA 2A3RA 4LWZA 2J7PA 5DIFA 1YJ5A 1ZMXA 3ZLJA 2WP8J 3QKTA 4DV5Q 1L4UA 2EFEB 2O5VA 3F1ZA 2A19A 1E79A 3KJOA 1WQ1R 2R62A 3HKSA 3KX2A 3N2IA 3PR1A 5C4GB 5JCPA 4TQ9A 3GLFE 2NN6G 3F8TA 2A1AA 1ZUNB 4JLKA 1Z0JA 2GILA 1PHJA 4PC2A 4PPFA 1S1MA 1EK0A 2W2XA 2YC2C 1NG9A 4Q4AA 4RD0A 4CEIA 2BA0A 1KNXA 4A3MG 1D9XA 2JASA 3HOYG 3A58B 5B64A 5DN6D 1DAMA 3TS2A 3D6TB 1QVRA 1K3RA 2PNHA 1SN8A 4XWOA 3HOVH 2QT0A 4DLSA 3K0AB 5K8IA 4A3DH 3CCMA 2VZAA 1PUIA 2MMCA 2VLIA 4PHFA 1N6PA 3C15C 5H8WA 3LBHA 3J80c 1YITA 4BGDA 3K81C 3HOUH 4GI7A 4A75A 3AQ4A 4V0LA 2X8AA 4IOMA 3GD7A 1IXZA 1XEWX 2CQOA 4HB0A 4MKHA 4F92B 1N3BA 2JA1A 1BBUA 1ZM7A 2CK3A 1DAGA 3N2EA 3T1TA 2BH2A 2NIPA 3KFUA 3FP9A 2GA8A 3CNNA 3D7MA 4WXPA 3W90A 4KU4A 5KU1A 4A8JB 4NXNL 1COWA 5AR1A 1SVWA 5JSZB 3GLIE 4JSYA 1X86B 2D62A 2GTPA 2ZE5A 4M1OA 4PC7A 3WBKA 3NC0C 4JI8L 3A1UA 3K09A 4LUOA 2BIFA 2UU9Q 2QE7A 2QROA 4PHTA 2I4IA 3B78A 2RH5A 4D4JA 3GTMH 2ZITA 1AE3A 4POGA 3T06B 3SGIA 4IEIA 3BH0A 5HZHA 1WE2A 1XEXB 5DSZA 5HCNA 3DHWC 1PFSA 1EESA 3I5YA 4DV3Q 5FPHA 1V1QA 2VSXA 2CXXA 3BS4A 4IJLA 2NZOA 3EWAA 3HU3A 4DLYA 5A4JA 1JECA 3ND8A 3RS0A 4JLJA 3S2HH 1ZD8A 5D3QA 4JI5Q 5KPJA 1XMSA 2O0KA 3E2IA 3O8RA 1TEVA 2ZTCA 1UBCA 1N6HA 3I4NH 4N0DA 3U7EB 2JA5H 3RSLA 3D3QA 4Q18A 1MV5A 2MSDB 4IOCA 2QUZA 3TVDA 5J4HA 1VQOA 1KI4A 2OILA 4EUNA 4BLRA 4JIMA 1YZKA 5CK5A 1OFHA 1SLJA 1GVPA 4DUYQ 4ME3A 1J5EQ 3DEFA 1VDZA 3SFVA 1ZUHA 3W1GA 3REFA 3SJZA 2UXCL 3WBJA 6Q21A 3IILA 4BY1H 5JJKA 3NH9A 4AQYQ 3CM0A 3J81i 1FTNA 2GESA 1XPUA 3W5OA 1JNYA 1LB1B 3AGPA 3Q8XB 1OFUX 8OHMA 3MRSA 4TYWA 2B21A 2VF8A 3DPUA 1XBTA 2OQKA 5CDFA 3VR4A 4Y0VA 1EWIA 1W2BA 4DHEA 3LQRA 4ILEA 1Y14B 2W58A 2ZJPA 5ANRB 4HDCA 2W6IA 4DV7L 5FL3A 2N42A 2J59A 3BD9A 3W34A 3GFPA 1HH2P 2GWHA 5IYDG 1M90C 1W44A 1HURA 1XTIA 2JJ2A 2EIFA 3QI2A 1RYFA 3EPHA 4TZ0A 4JI6L 1LTQA 1OKKD 3J81j 4M9QA 5EE1A 4P75A 4ZPXA 1AS2A 1HUQA 2C95A 1SVMA 4ZI3A 2CHGA 2UZ3A 3P26A 1EG7A 3RZDH 4TN1A 1Q1BA 5C44G 2GXAA 1XEFA 1WB9A 2CLSA 4IFDG 2WM9B 2ZQ5A 4JI2Q 5EP2A 4R7ZA 4JT2A 2GJSA 4AQYL 3H3VH 4E09A 4EQ6B 4OK3A 1X9NA 2OAP1 3R8CA 3WHKA 3T34A 4GN4B 5C46F 3LBIA 2IS4A 2QMUA 4GNXB 2JAQA 1PJRA 3S24A 1S96A 1G5TA 5KNCA 5CM8B 3CO5A 2ODBA 3I72A 3MWLA 1G4UR 3UANA 4R4IA 1FX0A 2IYVA 2QAGA 1GFIA 2ZAMA 4Q1EA 3S1AA 1BIFA 3B6EA 2OFWA 5LDDC 1X65A 4Q01A 3OIUA 2Q3HA 3QBTA 1G5PA 3L43A 4B3GA 3Q5EA 1E1RD 1PH5A 4XTCS 4A3CH 3TRZA 3T1OA 2R7FA 3LXRA 4HLCA 4YY3L 1CSQA 4BE7B 4QBGB 2VP6A 3ADKA 2OEPA 1KIXA 3A1TA 2R8RA 3IQWA 4JVNA 1WCV1 4HJ9A 4NYMR 2VA8A 1Z9FA 1I5FA 3FHCB 4TLAA 4OXPA 5IP7G 3SDZA 3W5JA 2V9PA 4RCYA 4L9SA 2FSGA 1T8UA 4LF9L 3LX5A 3CRQA 3CWZA 4PZLA 4ZDWA 2O8BA 4AKHA 1E6CA 4X65L 1MO3A 4ESHA 1OTCA 4HIKA 1UE5A 1WRBA 3H84A 4IOAA 2QAGB 1N6LA 2RGAA 4BFXA 1ZD1A 3IEVA 1B7YB 1E7ZA 2QGZA 1H8HA 1YR9A 4RG1A 5EXTA 3I73A 2QPTA 1SKQA 1Z6AA 1N6IA 4Y52H 2HCBA 3KFVA 1PH9A 3NEJA 4LX0A 4PTLA 3WNDA 3BWDD 3A4LA 2OCYC 2YU9H 4ZCIA 4DT1B 4XSGA 3ZYCA 2F52A 3NEYA 4Q1BA 3C8UA 2BBWA 1XNQL 1DVRA 3G82C 1Y1WG 1XD8A 4TL7A 5IDVA 1AS0A 3K9HA 2C96A 3B9QA 3Q7PA 4I99A 4E07A 2OTJA 2ZPTX 3AVQA 4R2IA 4NCHA 3WXMA 5M5YH 5DNYB 4BZPA 4B3SL 4JLDA 4A8JA 3KQUA 2R2AA 2W83A 1HZAA 5J4VA 2NG1A 2Q2IA 2V55B 2MFIA 4HUQA 5L3RA 2UUAQ 5FBVB 3GPLA 1G41A 4UKDA 1I4TD 3VR6A 1M34E 2G1KA 2MSCB 3EAQA 5C4JH 1XNJA 4JBYA 1KL9A 1WXQA 3EA5A 4A3BG 1T5IA 2OAQ1 1S3SA 4CW7A 2Q9BA 4DT1A 4PO1A 2BC9A 4A76A 2H57A 2Z6VA 3CNOA 3U4QB 2YTXA 1XTJA 1X54A 1FP6A 2HF8A 3M4QA 3UWKA 2JIZA 2F7SA 3QUSA 1XEWY 4B47A 5FTLA 4YDSA 4Q9JA 3OFNA 4TYPA 4Z51A 3CX6A 3HOXH 5FI0B 4NCJA 3TRFA 4QJ5A 4ZCLA 2F9MA 2QNRA 1K83H 3BZKA 1RFLA 3UDFA 2XZLA 3GJ8A 2A30A 4DV2Q 1GKYA 3SE0A 2GN5A 5K36G 1NSFA 2AFHE 4BASA 4M8NE 3GLFB 4CGZA 1XWIA 4LWCA 2XNDA 1N6KA 4JI3Q 3I7FA 3F3YA 4G5QA 2FPLA 4LDJA 2DFKB 4GOXA 3P20A 1CTQA 3QXJA 3SQXA 1IBRA 4Q21A 3B2EA 1UEIA 1CKMA 2IHBA 3H15A 4R1JA 3P4YA 2QAJA 4G5GA 4HI0E 3STBD 2B6HA 3OIWA 1IXRC 4PC3A 3KLWA 4DCUA 4JLPA 1FUUA 1Q7YC 1SVIA 2VSFA 1NVWQ 3FMOB 1FPMA 3QG5A 4JSTA 4A6PA 1GRRA 5JS8A 2F1RA 2BJWA 3IO5A 4Q7LA 2ZSAA 5A0FA 2ANCA 4AK9A 4JBJA 1I2DA 3TSOA 3L0OA 4IDPA 4P3YA 1SVOA 4TT3D 1CR0A 2ZM6Q 3RS2A 1I94Q 1L4YA 4QXAA 4CRWB 4FCVA 4JVLA 3I61A 2F43A 5GJCA 3UK6A 3KF6A 5JEAJ 1G7SA 1GL9B 4JI3L 1NY5A 1XPRA 3MAAC 2E87A 4GNKA 4OJKA 4XWAA 2N46A 3VR3A 2HV8A 5DN6A 4DVGA 4A2PA 4B3TL 5C44H 1VYTA 1OXSC 2WZQA 3MD0A 3KJIA 3QNUA 4BUJA 1LFDB 3GTGH 3BE4A 3B5JA 2J3EA 4NCKA 1G7RA 2I3BA 3W6NA 1E98A 4II7A 4D80A 2OG2A 1JXMA 2JDID 2VL6A 1AM4D 1AKEA 2PMZE 5JEAG 4R71A 2PJZA 3DM9B 3CX8A 1BYIA 1X8LA 4M9XA 5JBQA 4LHWA 4NHOA 2ZJBA 2VY3A 3C4JA 3OHMA 4LHZA 4Q4JB 3GTOH 1GNRA 2HT1A 2HJGA 2WJVA 3B1ZA 1ZNZA 4MDEA 4JI4Q 2R93H 2WIAA 1PH6A 2BOVA 4GP6A 3O8DA 2I5LX 2RHMA 3X1DA 2E1RA 3Q72A 3IUYA 3L2OB 1LUZA 1ZIOA 3E0EA 3VR2A 5IT9c 5KSOA 3WNCA 2ZSDA 4W5JA 2BEJA 3KUDA 4FDBA 5KDOA 4L5BA 4Q9IA 1G8HA 1RZ3A 4TTPA 2CBZA 3K8YA 5E95A 5FPSA 1MRSA 2FFAA 3IIMA 2IBMA 1E9FA 1MABA 4IDQA 2ZSFA 4B3TQ 5K8UA 4IPCA 4LF6Q 4BXXH 1WBDA 1OIWA 4JOIA 1MJCA 2HT6A 1HV8A 1KZ7B 1ODFA 2D0OA 2CHVA 4ALPA 2H18A 2ZRJA 3ASYA 4FMDB 1N33L 4OL0A 4B74A 2Q9CA 3GMTA 4CT5A 4NDZA 3UG7A 2NTYC 3HYTA 4DLXA 2V3CC 3TAUA 2WICA 1VQMA 3F2CA 4JYBA 4BPBA 5KUTA 2K52A 2JJ1D 4EX5A 1U0HC 2QY9A 3X1WA 5LB4A 1Y3AA 1Q44A 1K73C 4DUZL 3QKSB 4V0NA 2I5HA 1TWGH 5AJYA 3VAAA 4U5XA 3CW2C 1CEEA 4PFSA 2REXB 2JEAI 2Q3MA 3PFIA 1KMHB 3BJIC 1GKHA 5UKDA 3NHAA 4LFCQ 2LXJA 1SZPA 3NENA 5GJBA 2GZHA 3QJYA 5IYCH 1KGDA 3BFKA 2WJIA 1NMGA 1XD2B 3BBPA 1NP6A 4PC6A 1IXRA 1UKYA 2ZRIA 5LMUQ 3IHLA 1Q1ZA 2PZFA 2GNOA 3DMDA 1BMFD 5ELNA 1EFTA 3CF0A 1QZXA 3B1VA 4FMBB 4URXR 5B2ZA 3QSYA 2QP9X 3SI7A 4DLVA 4LF6L 4PPGA 2C99A 2O8EB 2NZJA 3GDEA 2V54A 5SZIA 3LO5A 3S1MH 2P2LA 3BZCA 2UKDA 5EP4A 5M3MG 3WP1B 3DOEA 5IT5A 3B1YA 4DKAC 1Q82C 1JMCA 2PEZA 2DUDA 1E9SA 3CF5A 4WOPA 5GJWC 1W36B 1NY4A 3A36A 1SXJA 3VKHA 4R4CA 4R4TA 1NG1A 4UJ5A 5IHPA 1VQCA 2J0UB 4DUZQ 1E3PA 2ZTDA 1IJFA 2FPKA 2ZYVX 4UP7A 4JVMA 4RY2A 1NIJA 5CLQA 3ZZUA 4A3KH 4YCWA 1V5WA 4KLKA 4NYIQ 5KSPA 3CCVA 1YNXA 1FJGQ 1KI1A 2WJGA 4Q1FA 5FTJA 3J81k 4OX9L 2K50A 4LFCL 3HOXG 3S1RH 2RGEA 2BDTA 5GAHC 1CKEA 4DSUA 1MO6A 4TLDA 2R6GA 1OH5A 4OI2A 2NPFA 2C9OA 4M2LA 4TSFD 4JV5L 5M3FG 2KBEA 3UG6A 3TK1A 1X8JA 4NPSA 1TUIA 3TW8B 4DKXA 1ZUIA 1F2TA 1N6RA 2VRWA 2JLUA 3SYNA 4DR5Q 2P67A 4HLQB 4QGHA 3U2QA 3TUJC 4CYMA 2BHRA 3EARA 4OYHA 2QI9C 1W46A 1ASZA 1XJ0A 1DG1G 3LFUA 2EVWX 4IVPA 3GEEA 4BLQA 4G5SA 4FW9A 3KQKA 1K9MC 2YZ2A 4Q1DA 3B7GA 1KO1A 1ZC3A 4AC9A 1KI6B 1RRFA 1YZQA 1E2GA 1Y63A 3TIFA 4IFDI 3M4YA 4A0HA 1KAWA 3I8XA 1Z2AA 4Q9LA 1E1QA 4KITB 2AWOA 1HH4A 2ZYWX 4DR7L 2K4KA 2RGDA 3GJXC 3PEVA 1ANKA 4Q4HA 4AG6A 1XJQA 2O8CA 5A5GA 2P65A 4C4PA 2K75A 5J4KA 4ASUD 2P6RA 3TSWA 1CKOA 3GFTA 4PO9A 2GEUA 1X6VA 4D2IA 2XITA 2Z83A 3RANA 3I2ZA 1DG3A 2W6JA 3DO6A 4LJ6A 3QXCA 1PH3A 2BBSA 1JI0A 3IIKA 3PIPA 2KENA 4DIDA 1K0RA 2BMEA 3AH8A 4I1UA 1RPZA 4C7OB 2GK6A 4GRAA 2FDCA 1S9HA 1ZM2A 4XWKA 5JZVA 3E9IA 2Q21A 1W47A 5HKKD 1EFRA 5IYBH 3CMAA 2RHSB 2YKGA 2PLRA 2OHFA 1TQ4A 2ZE8A 3A0JA 1DO2A 4UNPA 1Z3IX 4TMKA 1E2QA 2VO1A 2ORVA 4G5RA 4OONA 2ORWA 2GBLA 4D4LA 3AVUA 2ODEA 5K8TA 3CR7A 4A3DG 1R4AA 4DV0L 1E0SA 4IVRA 3GP8A 4KLZA 1KKLA 4PPNA 2J0SA 2NO9A 2VPPA 4Q4JA 5EE9A 1X3FA 2ZVPX 4X64L 1LF0A 1A5TA 4NH0A 4LK2A 2E2HH 2DR3A 3OIYA 1W4AA 2Z0MA 3CC7A 1R0ZA 721PA 4OBEA 3B1XA 4IXNA 3U4ZA 4TMZA 1Z0IA 3CWQA 3CW2A 3FVQA 3U3JA 4D25A 2V4ZA 1YR7A 5JS7A 2WPDA 1HZ9A 2BCGY 1II8B 1E2MA 2ZRLA 1W4RA 2IYUA 3F2DA 1G5RA 3CKLA 4DR1Q 1P16A 3HU1A 3RS4A 4MA4A 4LF5Q 2IYYA 4Y0AA 4FMCF 1HTWA 5EE0A 2AKAB 5AUPB 4KV9A 5KYKA 1O87A 3SJBA 3FMFA 5EUMA 2G83A 1GIAA 4Q66C 4FMCB 1OH7A 3GLHE 2R6CA 3TR0A 4LFBQ 4AWXA 1N5JA 5IK2D 4D4KA 5P21A 3KTAB 4KFUA 4DV0Q 4DZZA 2E2JH 3FWYA 4MTNA 5JWRA 1GNPA 1A62A 3K53A 3ICEA 2HF9A 5DLQC 4DK6C 2PQAB 5FOSA 2FSIA 3NELA 1YIJA 1NTGA 2IK8A 3I4NG 2R44A 2OXRA 5JLJA 3JC66 2RB4A 3TAHA 2ATVA 3OW2A 2B63G 3RWOA 5E7IA 3MWKA 2FNAA 3QG1A 1R5BA 1QG2A 4A3JH 1HE8B 4FD2A 5ELXA 1IN4A 2IT1A 2BKEA 3G0HA 4I81A 2GEDA 2N3SA 1GL7A 3MWYW 1L7VC 2ZJ8A 4V03A 2ZI4A 3CIOA 4P72A 2PH1A 4ZI2A 3B6YA 3S1QH 2GKSA 2QG6A 4PR0A 5JEEA 4LF5L 1BKBA 4WW0A 3FYHA 1TQDA 3SZRA 4M9SA 2FX3A 1AE2A 1P2TA 2G0NA 5E4FA 4BRWA 2BM0A 2IS1A 3H86A 4EPTA 5EQTA 1VQBA 1OFTA 2VHTA 2P5SA 4ITRC 3RS3A 3CAMA 1OJLA 5GADl 1I94L 1OLOA 3AKYA 3NHBA 4IDOA 3ADCA 2OCPA 5GAGC 4DV4L 3CF6R 4E03A 4P4UA 3PF5A 4WZAE 4C0SA 2QP3A 5DLQE 1PYSB 1KK1A 1Z6GA 4CF7A 2NPIA 1HNXQ 2IUUA 2F55A 1SKYB 4YDHB 4HAWA 2XGTA 4PC1A 1G21E 4D81A 5F3WB 1XMJA 1CU1A 1DEKA 5H68A 3CQZH 4K0KQ 2DBYA 3AYHB 1XMQQ 3MMPA 1FP7A 1VQDA 1OH8A 2PMDA 5FPTA 1SRUA 2ODWA 5M3FH 3TUZC 2OM2A 4KYUA 1KDPA 4EPVA 3TH5A 2A78A 4UJ3A 1JJ7A 3LVQE 4MYHA 1EWQA 2WIBA 3K9GA 1PA6A 3CH5A 3LW8A 4BZQA 3KUCA 1G291 421PA 4E22A 1FMJA 1XMOL 2IW3A 3KKQA 4KBFA 4YXWD 1QZHA 4X6AH 1OF1A 1PYBA 2R6DA 4AD8A 4ZDKA 1VQ4A 3CRVA 1E1TA 3Q7QA 1TMKA 4LW1A 2CEAA 2ID0A 1RRPA 3UMRA 1IN8A 2Z4SA 3CONA 3CZQA 1T3LA 3EZ6A 2IX3A 4U02A 1XTQA 3TBKA 4A3JG 4BFVA 4GLAC 3T35A 2I1QA 2ATXA 1FQKA 2H8KA 3UXMA 1VQIA 2JQOA 4I1VA 4IKEA 3VQTA 1MOZA 1QVGA 1N33Q 1KOFA 4OQFA 1MKYA 1NIPA 4Q02A 3KJGA 4C0LA 5TVKA 1QUQB 2UUCL 1C4OA 4TYQA 3I62A 1K8RA 1VQ8A 2FOLA 3NBFA 1N32Q 4MNOA 4OI4A 3EX7C 4A93G 1IHUA 4AY2A 1E0KA 2AD1A 2HLDD 2AR7A 2ZROA 2R7DA 5FOXA 3ZS8A 2QBYA 4GOPA 5IYBG 1T9HA 3QXXA 2CCJA 4TQAA 3AVVA 5M5WH 3VU9A 3ZJYC 2RGNC 4OHXA 4BY1G 4RFSB 3KQHA 1DADA 1H65A 1Z6XA 1N5IA 2KHIA 1CJUC 2ZRPA 3CB4A 1Q22A 3NTUA 4N1AA 4DDUA 4QL5A 3MCAA 4A8JC 1S3OA 1KC8C 5B58C 2WKQA 4IPHA 2KBNA 2GVAA 1G6OA 4FXPA 4QNMA 4CZ2A 4IDHA 3OEEA 1NBMA 2VL7A 4HIOA 1BMFA 3CPWA 4PHHA 2ALYB 4DDWA 4OHYA 2QEXA 3BJUA 4DDTA 4JKYA 1G8GA 2G77B 1K5GA 2KBFA 3U3MA 4EJSB 4IRUB 4LGMA 3PF4A 2FMXA 1NJGA 3QPUA 1UADA 3RNUA 1EQRA 1W4CA 2WAQE 1E4VA 1FFHA 1J2JA 1W5SA 2XSZA 3TKLA 3C41J 1LM0A 3HYRA 3GCGA 2KCMA 3VR1A 1JE5A 1CKNB 1ZU5A 4HYYA 2WWFA 5BWMA 1RC8A 4YLGA 1U0LA 3CF2A 4JLVA 4OX9Q 3W8NA 4IFEA 1JR3E 1MO5A 5DHAA 3BFXA 4GP7A 1MH1A 2ZXUA 1A63A 3WWVA 1IY0A 1YRAA 2C77A 2FFQA 3WMGA 4GLXA 2FU5C 1DOAA 2IYRA 1U2RA 3KDSE 5H1YA 1DTSA 4BQSA 4NBSA 3K7AH 1IBML 2AX4A 1UKVY 1OXTA 2B7CA 1QHGA 4DUGD 3P32A 1HT2E 4JI0Q 2CLCX 3T61A 5BN5A 2A5DA 3U7GA 1N36L 1IBKQ 2IYTA 2ZRBA 4QHYA 1S9DA 3BH7A 4TMTA 1PLLA 4CEHB 2AHOA 3K80C 3VKGA 1E32A 3TJZA 5AJ3Q 1COWD 3QVUA 1AIPA 1PVOA 1IAQA 3IIJA 4DXAA 1OXXK 1VQPA 5FTMA 4B2PA 1S1CA 4GOJA 2GRJA 1DBSA 5DGXA 4Z54A 4DR7Q 4HZUA 2KCTA 1LYLA 2QE7D 4YWKA 3HOVG 5LPNA 4YMSA 2W0MA 1IYJB 3ZH9B 4TQUS 1PH8A 3U4VA 2UXBL 4FINA 2Q0HA 1N2CE 1J70A 3KKOA 4DR4L 5GAEC 4B3DA 3PEWA 2WAXA 3GEIA 4M9ZA 1ZW6A 3OYYA 2J7KA 3NIBA 3K7UC 1YJ9A 4NXML 4NTZA 3GEHA 3D31A 1IXSB 1QRAA 1UBEA 2LCFA 3OEHA 4CEHA 4V0MA 2VHCA 4MYUA 5KOYA 3D0FA 2YWGA 4AI6A 2DYKA 3MSXA 2D2EA 2GETA 3EZ7A 3QKUA 1VECA 3UIEA 1IBKL 1EYGA 2VQEQ 5BQ5A 3RVBA 3I56A 4M1SA 3ADDA 1SVLA 4PAQA 4M1WA 1E2FA 5IY0A 3EZ2A 2QRNA 4IXMA 1JXOA 2GCOB 2RHQB 4HAXA 5FBWB 2QQ0A 1L0WA 1IBLQ 4EAQA 1EX7A 2LKCA 3UE0A 1PV4A 4CVNA 1R0XA 3SBDA 5L3QB 1R0YA 1XX6A 1JPJA 3ZIAD 2H16A 4L9WA 2V7QA 4AYTA 2P6UA 1YHQA 1T91A 2MMGA 3WMEA 5SZHB 1Z63A 3GFOA 1YBYA 1RKBA 1HYQA 1JPNA 2QMEA 4HIMA 2JA7H 2E5LQ 1GAJA 3RRNA 1R5NA 4G01B 3KB1A 2W6ID 3KQNA 3W3ZB 3ZQ6A 2R7ZG 3FOZA 1NRJB 2MO0A 3THOA 1E2IA 4QJ3A 4L5SA 2FGKA 1IM2A 3PO2G 1VCNA 3DVLA 2GCOA 1NLYA 2WPDD 1N0WA 1E96A 3NG1A 1GO3E 4P71A 4P73A 4PQFA 5GADC 4QGFA 3SHFA 4S2EA 2VQEL 2O0JA 4MRNA 3X1YA 1QUQA 4TLCA 4BLTA 2GJ9A 1TU4A 4HIDA 2J7PD 2QTVB 3CR8A 2QTHA 3TSZA 2O8FB 3E9HA 1PH7A 1RRCA 1YHNA 4Z8XA 5FUYA 5AUOB 1BYUA 4EJSC 4BXXG 1CJVC 2JA5G 5CM9C 5DI9A 3PCOB 1M7GA 4KLNA 3SJAA 4PX9A 4AG5A 1Z07A 4R4OA 2FEOA 1BKDR 1M2OB 2XZPA 2OBMA 2WKRA 5FFMA 2XZOA 4MDFA 5IYDH 2IEZA 5H70A 2XTNA 1F48A 4AYWA 3PUZA 4QFMA 2C98A 2HDNB 1E4YA 2XEXA 1WOCA 2V6JA 1X56A 3IPYA 5BR8Q 4KFTA 3V9PA 1VG9B 2OUKA 2EFDB 4ZDIA 2XOKD 1HA3A 2DFNA 1C0AA 4DBLC 1E1RA 1OYWA 3P4XA 1GDDA 3B9PA 1OXUA 4BFZA 3OE7D 1XCGB 3A5UA 4GL2A 4B3RL 2IF0A 4EJSA 1SHKA 1X6OA 4WJ3M 1HR0L 2G1JA 1SHZA 2ZJ5A 1E9AA 1VCMA 1M7HA 5GVSA 3AF1A 3BK7A 1PUJA 5DH9A 4HAYA 3TGPA 1G9XA 2F6RA 4G0NA 1J5EL 3H0GG 4PG3A 1CS4C 2WSSA 3EIHA 4DV4Q 1Q12A 4LF4Q 4B2IA 4EQ6A 2ZREA 2I5MX 1WJJA 1QHNA 2ZYTX 1W3SA 4GNXA 1T3SA 3FKSD 3PCRB 2VTKA 1SVSA 1SXJC 5KDLA 3WYAA 3OTOQ 1N6OA 3L0SA 3CMEA 4A0RA 2LXKA 1S72A 2OWOA 3HPRA 4RZUA 3REGA 1R7RA 1YVCA 4NYIR 1VG1A 5CB6A 1XMQL 4QM6A 1KJZA 4QM7A 3AGQA 1R0WA 2O8CB 1IQPA 2A7QA 1H8ED 1HNZL 2QBYB 1NMFA 4MKIA 1P7CA 1C1YA 4OHZA 1N0UA 1US8B 4JZKA 4Z1MD 4YCVA 1G8FA 2JEBI 1R10A 5FUVA 5BXQC 4XJXA 3PEYA 5JJLA 5FPYA 4EPWA 2WTUA 4FWTA 3A4MA 3RDPA 2IF2A 2R92G 2DWPA 4KODA 3MWJA 4A0GA 5HGQA 4F93B 1EFUA 4BRUA 3FTQA 4MKFA 2JLSA 5KSZA 4YWLA 1CJTC 2GAOA 4R2HA 3SN6A 2VQFL 4XH9B 1NMYA 4LHXA 1HZCA 3WRXC 1X8KA 4NL4H 1VYUA 2JJQA 4DR3L 5DI3A 1Q20A 1UF9A 3FHWA 1EOVA 2YYZA 4LC1A 4BECA 3WYFA 3ASZA 2QU8A 4LJ5A 1L2TA 1J90A 2BKUA 5AK0A 3I5XA 2FJUA 2Q6TA 3R9IA 2UUCQ 2FXQA 1ZIPA 1Z2CA 4TL6A 2VSOA 2J87A 3A74A 5JI3E 1UEBA 4PO8A 1HNZQ 1AH9A 1WP9A 2GEVA 3P1JA 3QVVA 2CVHA 4DRZA 4Q5IA 2ZM5A 3GJ0A 3B8HA 3I8SA 4QKQA 3FKIG 4L16A 1FGUA 1VMAA 2J0VA 3VDYA 4Q4AB 2JJ2D 3L8ZA 2WMNB 4O3MA 2WB1G 2JLZA 1I6HH 4AYBE 5E3HA 1P9WA 4B6FA 1XF9A 3R9XA 1CR1A 2AN9A 3GJ3A 4IFBA 4O0MA 4PXAA 4TTQA 1G6HA 3L82B 1ZCBA 4ZKDA 4C3ZA 2HEIA 1C9OA 4EKDA 4LV5B 3WNBA 2Q2TA 4B3MQ 3R7WB 4KAXA 3J7A5 5KDDA 1WBBA 3AP1A 4DR3Q 3C5HA 4WZ6A 5AJZA 2GCPA 2TMKA 4DV1L 4U00A 3T15A 4UY8C 2F4VL 3BFVA 3K0CC 1U9IC 2HXYA 1AGRA 1ZYUA 1GRNA 2HXSA 1R6BX 2C78A 2Z5FA 3AP3A 4AKEA 1E22A 1KO8A 2EFCB 4DR6Q 1JAIA 3S2DH 5FTNA 2XGJA 1VQ7A 1NBMD 4E5UA 1G51A 4OHVA 3ZD6A 1X3SA 4A3EH 2Z43A 3ECCA 2FH5B 2RGXA 3TLXA 1TTTA 1XNQQ 1Q46A 2R92H 1J8MF 2Y8EA 4XD7D 1T3HA 3RLFA 5FR2A 4EFMA 3RLNA 1I4LD 4NKRA 1TADA 5FTKA 4LNQA 1EFWA 3GTQH 1ZAKA 4BY7G 5FJ8H 2O8FA 4JLBA 1KI3A 4B32A 1Z29A 1FL0A 2KJQA 3Q3JB 4LHYA 3CRRA 4DEYA 4TLEA 4KSCA 3CRW1 4IPDA 4BA1I 3B85A 3DL0A 4A9AA 1NJFA 1Z8FA 1T5LA 2PX0A 2NMVA 2Y0SE 2IY5B 2EFHB 1W1WA 1D2EA 1AQYA 4KVAA 3LW7A 4JI0L 3WY9A 1KO5A 3M0EA 5CIQA 4DV1Q 2Q9AA 4C0JA 3CCJA 1T0HB 2VP5A 2F1HA 4L5RC 5G40A 4XOIA 4K46A 5EUQB 5AJ3L 2AMCB 2B8TA 3I4LA 4RKFA 4DV5L 3HKZE 1U90A 1UEJA 4Q9KA 2ZUDA 1VQFA 3I4OA 3ZGXA 3NKVA 1YI2A 3H3VI 2VH5R 3NVAA 2UZIR 4KBGA 1U98A 2B63H 2VW9A 3RN5A 3JAMi 2J46A 2ZRMA 4H1UA 4NZYA 1SQ5A 5JRZA 1XNRQ 1LVGA 3FFBA 4B43A 2UXBQ 1TX4B 3QE0A 5IF9A 3K70B 1XCMA 3IPXA 1KSGA 1VQ5A 1YQTA 1WYDA 1OB2A 1YVDA 2F43B 1E2NA 3O47A 1FNMA 1KSFX 4BBRG 2REOA 4C3HH 4OWWB 3SHWA 3TW4A 4XVRA 4F4IA 1XXHE 4TL8A 1X3EA 3WMFA 3S16H 1P2SA 4GBMA 2XNSA 2OSBA 2AKWB 2EU8A 4J0QA 1W36D 1A2KC 3K0EA 4U7DA 2EWVA 2IUSA 4B73A 3ADBA 1MO4A 4Q00A 4DCNA 2F9LA 4YHHL 3ZS9A 3PO3G 1EFCA 1CJMA 3CUEF 1W0JA 4DB4A 5TDHA 1VPLA 1ZP6A 2ATWA 1BS1A 3WYGA 2XTMA 2N1BA 4LYHA 3AM1A 4LV8B 2QA5A 4US1R 2EFGA 3OFND 4RSGA 1OIVA 1F5NA 1UDWA 2FV8A 2KHJA 1E24A 4JI8Q 1HNWL 3I3SR 4RJLA 1LF5A 3VMFA 5KTYA 3CPJB 1AK2A 2ZR7A 2QM7A 2H17A 2WWIA 2CMKA 2H92A 2QMOA 2WHXA 3ZVLA 2L0XA 2IYWA 2ZM6L 1OHHA 1DO0A 2VP4A 3KYHC 1IL2A 1YR6A 2FEMA 2ZYUX 4KI0A 3EPLA 2V7QD 1FW6A 4JBMA 1ESMA 1MABB 3GLIA 2W2TA 3W1BA 1VQ6A 2K5HA 1G6PA 2PEYA 4GT1A 1NNEA 3ONWA 1BO6A 4LUVA 2JEOA 4URUR 2DCUA 4M1KA 4UNQA 2KSQA 4PMWA 2QMHA 3QF7A 4WAUA 3L2PA 2CVFA 1KY2A 3H1TA 3FHTA 1WMSA 2BWJA 1CSPA 1DELA 5C0XG 1AKYA 1B0UA 1T6NA 2OESA 2WSMA 4P74A 1ZM4A 4PSKA 4Q1AA 4B71A 2PMKA 3KOJA 2B7BA 5F2EA 4BEJA 2VIIA 3E1SA 3JVVA 4MRVA 2ZRCA 1P2VA 3LLUA 1Q3HA 1XTDA 2HQLA 1BVSA 2B29A 1QF9A 2RHDA 5JWHA 4Q9HA 1XMVA 4D0NA 1DAKA 2O8BB 1L8QA 1RL2A 4GNXC 3CCEA 1D8LA 4GKKQ 3AFQA 3I4MG 4JYAL 1ZVQA 3EC2A 4IFDJ 5G3YA 4LYAA 2IYQA 3IBGA 4LJ9A 3THXA 2VYFA 1YZUA 1B23P 3HFZB 2ZI3A 3PGZA 1GILA 4GZLA 3G71A 2OQ0A 2E9SA 4O0AA 3R8FA 2FFBA 2CWAA 4FMDF 2QP4A 1H95A 3T5GA 4YMTA 1N8RC 3BERA 2Y0SG 5BR8L 3LD9A 4QGGA 3U7HB 4LJ7A 1ZU4A 1G8YA 2CNWA 2JE6I 4A4DA 1QHIA 3UDXA 5IYCG 1KQSA 3FHOA 1Z83A 3EPKA 1VQEA 2GXSA 4JLOA 4KFRA 3BORA 3IRBA 1TPZA 1N34Q 4PPQA 1EXMA 1YZTA 2Z0SA 4JI6Q 1MR3F 1SXJB 2JDIA 4O2LA 3RNLA 1X1SA 2QL6A 2YHSA 1YZLA 4A3IH 4LSGA 3UMFA 4M0LA 4IOKA 4YWMA 2ZRNA 2CKZB 1E2JA 3U3OA 1A7JA 4LF4L 2CWPA 3DDCA 2GZDA 4TTRA 3ER0A 3U60B 4GKKL 4JYAQ 4CEJA 4JI7Q 2WWYA 4X62L 1GKIA 3IDQA 3UDGA 3EPJA 1TEXA 3HOYH 2CHQA 4YQFA 4HB2A 5KPDA 3O8BA 2XB4A 1S4QA 1E2KA 4ZV4A 3CCLA 3TREA 4QIWE 1DAFA 4LBYA 4JI5L 1PZNA 1CUKA 4NMMA 4OI0A 1XD2A 3G5UA 2ZANA 3Q9LA 4H02A 3GLGB 2H5EA 4Z1MA 1FUKA 1JR3D 3GLHA 3ULLA 1J8YF 2ZS7A 1G1MA 2IHYA 3DM3A 3K0XA 2DY1A 4URZR 4G3XA 3R7WA 2H1LA 4DPGA 3T12A 1IY1A 4EPYA 1VIAA 4HAVA 1PH2A 3DKPA 2ONKA 3FKQA 2G6BA 1TWAH 4WVFA 3I1FA 3FMIA 2VQFQ 1T8TA 4LF9Q 2AFIE 4TT3A 3UPUA 3L0PA 3M4PA 1VTKA 4JI7L 1Z28A 1ELOA 2AWNA 4URWR 3SU8A 1ASYA 1E9RA 1CXZA 2VHQA 2VBCA 3RN2A 4FIDA 4R9UC 4JLAA 4B48A 1U5KA 5DISB 3LX8A 4FWIB 2JA8H 3WRYC 4YCUA 1PLKA 1YJWA 2IHFA 1KRTA 5FL7D 3X1XA 3VKWA 4B2LA 1XTRA 3GLGA 1SULA 3IBYA 4BFYA 2RGNA 3K0FB 3ZJYA 1E79D 3MG9A 4GDFA 4US0R 4M53A 5E7NA 2HHHQ 4Q7KA 2OCAA 4A92A 3A8TA 4MGZR 2NZHA 4XIGS 3PQCA 4DAYB 1IN5A 4YMVA 4HJ5A 1KMQA 4LBWA 3THWB 4JL6A 2ANBA 1SXJD 2UUAL 2DGYA 3PO3H 4B76A 3HP1A 3SNHA 3ZDQA 3M9BA 2IS2A 5EJEA 4DIEA 3AVTA 4H1VA 2ERYA 5HR5A 4A6XA 1KI6A 4NP6A 4A36A 2WAYA 4ZO4A 3LLMA 3LBNA 4QNRA 3QQ5A 1W36C 1W7AA 5FI1B 5EAYA 2XJ9A 4RVCA 4GOPC 3GLFA 4TSFA 1EX6A 3UDIA 2ASEA 4X8MA 2O8DA 1I50H 2JJ8A 2ZE6A 1J7KA 2Z6KA 2FA9A 2KWIA 4DSTA 2ZRGA 1XXHA 5H1SE 4A0FA 1QZGA 3THWA 1WFQA 2VS1A 3BU2A 3F0TA 2BA1A 1KNQA 1UBGA 2VP0A 3I32A 3QEJA 4O2DA 4BZXA 2JA7G 4ACBA 3B82A 1SFOH 3CNLA 4LYFA 4NCNA 3HU2A 2XTZA 3T1VA 1VQAA 2ZR9A 1M8PA 2NZ8A 3LVRE 4XD7A 3VX4A 1P5ZB 4EPRA 2X77A 3MXNB 4Q19A 2RF4A 3E70C 4O2RA 4A82A 1TQ2A 2ZI7A 2C35B 1XZPA 1AJEA 1TWCH 2JA6H 2DWOA 1FX0B 3KKPA 3S1AB 2Q2UA 3KKMA 4RD2A 2GCNA 4GLVB 5LMNL 1JT8A 4ESVA 2W6JD 3BRWD 3W3AA 2YOGA 3TNFA 4DDVA 1U0JA 5DE3A 5KHOC 2WB1E 2GF0A 4GN5A 4NYMQ 5BN4A 4BFSA 4A3EG 1KIMA 1P3JA 4RCZA 3RWMB 2GZAA 2P3SA 3SS8A 3UATA 4TZ6A 2PL3A 2E8GA 1F3OA 3NH6A 3PIOA 3PUXA 1DS6A 3EIVA 1YU9A 1TF7A 3B1WA 3CBQA 4EFNA 1P61B 4M21A 2R93G 2WMOB 1M74A 1SXJE 4Q1CA 3O8CA 1JR6A 4BLOA 4NE2A 4LFBL 1XNRL 2YINC 4MYCA 4QJ4A 3LH5A 4JI1Q 3KDFA 3T1QA 4I1OA 2QGNA 2WFWA 1G7TA 1XPOA 2W00A 1P8LA 1Q57A 2GHIA 2RMKA 4A3FH 2ZETA 2J41A 2V8OA 5IWAL 2WWWA 3QPWA 3KQLA 2K5NA 1C7YA 1CR2A 3EASA 4LJ8A 2IS6A 2VUMH 2P6NA 1UBFA 2C8VA 2YV5A 4DK3C 2ORIA 3SQWA 2O0HA 2BBTA 3KB2A 5GQOA 3VHXA 4LBZA 3PUWA 1XB2A 4A2QA 4CEIB 1OPXA 3QOFA 4PZZA 4FCWA 3CCUA 3D8BA 1EUJA 2GJ8A 5FR1A 4GMDA 4C0QC 4OO1I 1M7BA 4B6EA 3U6BA 2JCSA 5DI3B 2WBLC 3IQXA 1MKHA 1VHTA 2FN4A 3V4FA 2NGRA 1JEEA 3W8RA 3AF2A 3G6EA 3TQYA 4DCTA 4JI1L 2FE4A 1XDBA 2LKDA 3LRPA 1J99A 1UE1A 4DR2Q 3WP0A 4DNIA 4ERNA 4GPTA 1KHIA 4IEEA 3LDAA 4B3FX 1FTSA 2OT3B 4M1TA 1E94E 3A4NA 5IWAQ 1XJCA 3NBYC 2RCNA 2K5UA 2JLXA 3LQQA 5AJWA 1HJPA 1CP2A 2CFMA 1KMHA 2IYLD 2HCJB 3A1VA 1KZGB 3U50C 4A93H 1LY1A 2DB3A 2D06A 1VCOA 1YR8A 2JK8A 1A82A 2A8VA 4GKJQ 2V1CC 2F3TA 1YRBA 1XU4A 2IEYA 4GFDA 4DWJA 1OB5A 1KHTA 5FBRB 4TL9A 3EXAA 5JI2E 5HKKA 4NXNQ 1C9KA 4Q4HB 1I3QH 1A4RA 1NMZA 4CEJB 5L3SB 5F98A 2YJTD 4LHVA 2O8EA 2H7VA 2SHKA 4HUTA 4QC2A 1W49A 5C4XG 5CB8A 2B3GA 1OT3A 1ZBDA 4Q4LA 1TQ6A 2IYXA 2UVQA 2WWGA 1B8AA 4A3FG 2F1JA 4X8HA 4KHPL 3G48A 4ZCMA 4TMVA 1VQNA 4Q47A 2FF7A 4B35A 2ZTEA 4BEBA 4C3IH 2AXPA 5LMUL 3IHWA 2C2HA 2DHRA 2HIXA 4DV3L 2D0PA 1ZD9A 4TYYA 5HE8A 521PA 4OKSA 3CCSA 4P31A 4EFLA 3SJCA 4P32A 2EW1A 4JLMA 4YONB 4US2R 3Q85A 3GTJH 2R6AA 2RGCA 2QPAA 1NN1A 1Z0AA 2N8NA 1KI9A 3R20A 2V1UA 3RRMA 1N34L 1SGWA 4YC7A 5J47A 2O8DB 1PH1A 1LTLA 4A4IA 1OKKA 5J4YA 3ETLA 3EA0A 3OIVA 1N32L 1Z0FA 4POAA 2ZE7A 3UE1A 4JLNA 4ABYA 4DUYL 1NLFA 4KCGA 2NO0A 1VQ9A 1CKNA 1F2UB 3KF6B 4G5OA 2QQEA 2UXCQ 3GTLH 1NY6A 2VF7A 3MJRA 1WCMH 1FOEB 1XFAA 4JI4L 3GJ6A 1FJGL 3RABA 4YMUA 1KI2A 3EC1A 4S35A 4KHPQ 1ZRHA 4TLBA 4X62Q 3JAMc 2BMDA 2KB0A 4JS0A 2IYZA 2PT7A 3PEUA 2ONJA 1P2UA 4BBSH 2OBNA 2ZU0C 4JJZA 4B75A 1II8A 3MLEA 3K0FA 1II0A 4C2UA 4LUCA 3NBHB 1K6MA 4P33A 5FOTA 4X8LA 2ZI9A 2B8WA 4XTRA 3TR5A 5L3VA 4DV7Q 1PH4A 2JIZD 2K14A 5BN3A 2YOHA 4KXFB 2OFOA 3M7NA 5KNBA 2IA5A 3KFXA 4BY7H 3NBXX 1Z5ZA 3QENA 2K5VA 3EBEA 3BIFA 1NKTA 4LOAA 3GQBA 5CYOA 3N5CA 5AUNB 3A6PC 2FWRA 1S8FA 4Q03A 4C7OA 1IONA 3SR0A 3GJ5A 2MO1A 2AL7A 1L1OC 4JT4A 3NEMA 1CBUA 4APVA 2RGGA 3J81c 4K8OA 2ZJ2A 4QOSA 1RW4A 2QSZA 1U8YA 1KDTA 1JR3A 1XMIA 4JI2L 1Z08A 2XAUA 2QN6A 2LWIA 3ZVMA 1F6BA 2REBA 4IHQA 2WOJA 4MITA 2G3YA 1GKUB 3CC2A 2GDJA 3AF3A 1U8ZA 1UFQA 5FH9A 3B60A 4RD1A 3K70D 1J6QA 1BBWA 1JJ2A 2BV3A 3GO5A 2QA4A 2IWRA 1SROA 3AQQA 2ZJQA 1OW3B 3CZPA 1BOFA 3CLVA 3MUFA 3QKSA 4LPSA 1N36Q 1O7IA 1ONBA 1QG4A 1UPTA 2AXNA 1GNQA 2HHHL 2QTFA 1N5LA 4DCVA 2J5XA 3AKCA 3VX3A 3VFDA 4BBRH 1GOTA 1G4AE 5LMNW 4YY3Q 2GAAA 1JQLB 2OE2A 3BAFA 2WWHA 3HPQA 4QHSA 3EWSA 3GLIB 3ICQB 4ON9A 4D4MA 3FKIH 4LF7L 3FFAA 1D7QA 2FSFA 2Q3FA 3AKEA 4GN3B 2QRZA 1ZM3A 1JAHA 1HY3A 1QBKC 3DMNA 4X64Q 5JMTA 5C18A 1NMXA 2YNMA 3LGJA 1NKSA 1QHHA 2Z6KC 3PO2H 4X65Q 4LV6A 4DR4Q 4I4LA 4LYJA 3PVSA 3NDPA 2ZRHA 4QQBX 4N0EA 4NXMQ 3IGFA 3KJPA 3M3YH 1UDXA 1CJKC 4BFTA 5CK4A 1D8TA 2XB2A 1JB7A 3AVOA 2PQAA 1CRQA 1KJWA 4DR5L 4NPHA 2PI2E 4WIAA 4IPGA 1U99A 3QKRA 5EZ5A 4A1FA 2BVNA 4FI3C 4DUGA 2J0UA 1IJEA 2EYUA 1S3GA 1TWHH 2J1LA 4C0BA 2ZRKA 1I2MA 2JLYA 3RZOH 3THXB 3Q8DA 2HIVA 4BWYA 5HPYB 3QEOA 1TF2A 2R7ZH 3K9LA 4B3SQ 2F3IA 3BOSA 1ZJ6A 1VYVA 3DZ8A 1IBLL 1S40A 1M1KC 4LF7Q 2V6IA 4BLSA 2OCEA 3OAAD 1VHLA 2FGJA 5FJ8G 3SC3A 3NXSA 1AGPA 4AKGA 4A3CG 4A3KG 1Q0UA 2GVZC 5FBLB 2FPMA 2YWHA 3QXSA 4O25A 2UXDL 3KXKA 3KKNA 3E5HA 4F4JA 2WV9A 4KHZA 1SVKA 1Y1WH 3QKRB 3U61B 3LY5A 2E5LL 3J7ZC 4BA2I 2HJVA 3M1IA 3HOWG
chains in the Genus database with same CATH superfamily
3GRCA 1IZ0A 3M4OH 4H4CA 1WL8A 4HDRA 5DPMA 4RABA 4C78A 1RIFA 4O2BB 3ELUA 4YCDA 3TQCA 2PXXA 4F97A 1D1PA 1HMPA 1YRHA 2NU7A 4K88A 3RUIA 1ZCAA 3ZE6A 3PI7A 1T43A 2J3JA 1KAHA 1N5KA 3BH6A 3ZWAA 2WNHA 4KOEC 3GAZA 5ECDA 1YKSA 4R9VA 1FDTA 3V4VB 1FRVA 3KR0A 2Z1NA 3IRUA 3ZIDA 5A7FA 1QH9A 4MWZA 3EZ9A 3HJTA 4LI0A 3CPFA 1INLA 3OY2A 4MA5A 5KJ6A 4E4TA 5HY6A 1GD7A 3LOPA 2MGSA 1AUOA 2ZBVA 2E2JB 1CJBA 3PUHA 3AI1A 3NNSA 1PEDA 5EZ6B 4MWEA 5B37A 4BNLA 2VZ8A 4DLRA 5A4IS 3DEYX 2AMLA 3NCTA 1GPH1 3L18A 1PFWA 3HSSA 3K5PA 2H59A 1N6NA 1V8QA 5EQFA 3SKXA 3CZMA 2UXDQ 1I32A 4XIIA 2IOFA 5IFKA 4IJHA 2YFYA 3AUSA 3IEUA 2J9FB 4GYWA 3TQFA 4EHAA 4EZIA 2OBLA 1W6UA 1DX6A 2QTWB 1HRDA 3UHPA 1F51E 1NDQA 3B1JA 1NE3A 2H0AA 5CNMA 4OJQA 3FB4A 4WKNA 1T6XA 5FXMA 3JRNA 5B58C 1ZOSA 3ECAA 3CVOA 2IHKA 4RMNA 4QOEA 2C2MA 2R8OA 3OESA 4CV1A 2ZT7A 4GF5A 3ONNA 4BYMA 5K01A 1CY6A 3L05A 2JHGA 4F1JA 5BVGB 1RJ9B 4OKIA 3KL4A 2IX1A 3VKVA 3O26A 3JD0A 4CTJA 3KR1A 3RBXA 1B53A 1FJXA 4BAZA 3LGAA 4XT3B 1KYXA 1F60A 1JVBA 3EDMA 2D2FA 1UM8A 4FZ5A 5EHGA 1YE8A 1TKCA 3LWDA 4DMGA 5HZKA 2XMBA 3GF4A 1P9RA 3PUJA 1KK3A 3DFUA 4D6PA 4UNNA 4V0BA 1K4KA 3DWFA 4ZXPA 4DXFA 2JI6A 4Y9TA 2G9VA 3D4BA 3NWEA 1MXHA 1GPDG 1GTMA 2VUMG 3FMPB 3PYLA 4JHLA 5H59A 1RIPA 2Z5GA 3PE4A 5FUWA 3UI2A 4BO9A 1XLVA 1Z7BA 3M3HA 4IKOA 3CEPB 4BUCA 5J5CA 1IZ6A 1QNKA 2VNHA 3Q4GA 4QQKA 3U3DA 2OR3A 1SJHD 4KSBA 4GKJL 4QDKA 3UT5A 2JYOA 1QGUB 4OHMA 4R0VA 2MDTA 3TW6A 4FR2A 5AVWA 3A8JE 5CXXA 3HXMA 3I5UA 4ZKBB 3S2UA 2IYOA 4HGOA 4P7KA 3R0ZA 2BAGA 3CV3A 3DBLA 4RY9A 1AS3A 4LJ4A 2YHUA 4BLVA 4C4AA 4EW1A 2OV4A 4BRZA 3LI2A 4B81A 5BNIA 2PX3A 3P9SA 2IHVA 2EZ9A 3K2BA 1LT3D 5ESDA 2IX0A 2GOYA 1RTKA 4QPPA 5EE3A 1ETUA 3KU4A 5HJEA 3RIYA 4R8NA 2HU2A 2VHEA 5B4VA 1OIXA 2CVRA 2ZBFA 3OO0A 4MRPA 3EXHA 5ALFA 4ZRDA 1VKRA 3TMYA 5G53C 5K4AA 1UJNA 2OTCA 3WQRA 4E2YA 2ENUA 5E2IA 2D4HA 1ZPDA 2QU7A 5KMGA 2YNMC 4DCCA 4YRLA 2IXFA 6GPBA 5CCDA 3D1LA 4ND2A 1T10A 5AYVA 2F8MA 2YYYA 1IZ9A 1CDZA 3O7MA 5JEAH 3NZEA 3TMKA 4BNJA 2HHAA 2ZAOA 2BJVA 1QNUA 1T15A 4GPEA 2QPOA 4TMXA 4V24A 1HNXL 3WR5A 2P4EA 3ZJ5A 4TUYF 1KSHA 4CV0A 2HMYB 3VPCA 2WIFA 4O42A 1GZ4A 1A2QA 3VA5A 1N8TA 1PL6A 4JP5A 2VEOA 4LNHA 4XA8A 3GFVA 1TUBB 1NN3A 4PQYA 1U1EA 1WHSB 2RAVA 1HEIA 3ZWCA 5BSMA 2OC9A 2CWDA 2XUQA 5LQAA 3AFGA 2XB8A 5BWLA 3TRDA 3NTVA 4WK6A 1U3DA 2OK7A 5LFAA 5DKFA 1QFYA 4TKUB 1QVFA 5F9FA 2OHVA 1RTNA 4GSYA 1F77A 1J7JA 4QUEA 2VBIA 4FF2A 4A3IG 3EC7A 3DLLA 4R98A 2OLEA 2AOWA 5KNDA 3FMGA 3MTDA 4ITUA 3W5DA 5BN4B 8LDHA 3ZCSA 1IN1A 4NMXB 1CJCA 4E31A 2RGBA 2CB0A 3TZLA 2V0GA 3Q3VA 1HE1C 4HZUB 1TXYA 4UBOA 2PL1A 3IX7A 3EE6A 2YU9B 3VOTA 4CQMB 4XWWA 1X1EA 5E8JA 1SMYD 1K98A 1M9NA 3F5FA 3DF7A 4HP8A 4LY9A 1FZQA 4DV6L 5LP6B 3DBIA 4PRLA 1YTLA 5I6DA 2I0QA 1IG0A 4AECA 3J80i 2DKOA 4E7OA 4RKYA 3OZUA 1W0JD 3PT9A 5TNXA 4P0TA 5C37A 2IEIA 2ZT6A 3UAGA 2OKGA 1PZMA 2XCIA 4PN7A 3RKUA 1T9AA 1NSYA 4HJAA 3C3EA 3H0EA 3N2GA 3U7JA 2G40A 1NFFA 4P82A 2JLWA 3TIXB 3C14C 4ALMA 1YDMA 4WKOA 1GTVA 3WB2A 1EK6A 2VQSA 3SC2A 3A37A 4BWFB 2VPZA 1EIYB 1T8SA 1U4MA 1G8SA 4KN8A 3JX9A 4PZDA 5DTIA 1NF3A 4WCVA 1F2TB 1DJRD 2F0WA 1U8AA 3T7SA 3DWPA 1WX1A 3W9SA 4BNVA 4KKTA 1PD0A 3RYHA 5BNTA 3Q3HA 2DY8A 4PIPA 1GWNA 4OHOA 1YDHA 4BATA 2MJLA 4KFSA 3AQIA 4NBTA 3UB2A 3GJ4A 4DABA 2WSBA 4DEVA 1HE3A 5BMVF 1DPFA 2WPNA 2EWWA 4DRXA 2ZSEA 3CP0A 2XMGA 1U9JA 5KSYA 1V45E 5U4QA 3CLRD 1F9SA 3DZKA 5FLEX 3M7GA 1F8GA 3OJFA 4QMGA 5H3HA 4IVQA 3AFPA 3JQBA 2G07A 2QTAA 1Z4JA 3K0SA 5HM6A 2ZB2A 5HCIA 1Z6YA 3O4HA 2RKBA 3TE6A 3U58A 1O7YA 5EIFA 2WOOA 2C00A 1GEGA 3T5CA 4RZ2A 3ABRB 2X1VA 3VI3B 2ZUCA 4F12A 4RHSA 1ECBA 3GOHA 4ESEA 2VNJA 2D0IA 3AOEC 1ZHFA 5CAEA 1ZD2P 5FO0A 2PWBA 4RAOA 3GMSA 1XPJA 1Y1VH 5HRCA 3W5UA 2GAJA 1T0JB 2J6IA 4AIMA 1Z22A 2ZRDA 3PIRA 4BP3A 4RTQA 2PH7A 4MR7B 2HW8A 2WB4A 1AA9A 4DJJA 2QW1A 2JFVA 3FWPA 4X94A 5EQDA 3RQIA 3EDRA 2X8LA 1Z6TA 4HDRB 3DHNA 3LY9A 1NQWA 1DARA 3P0JA 2VAVA 5E7JA 2IV7A 1G17A 1Z5GA 5IGGA 1G0OA 2PSFA 2YVUA 4PEVA 5TARA 2M2LA 2HLHA 2CXOA 3S1RB 2P62A 4QBHA 1RE0A 4R1PA 2A5FA 2A9VA 2QE6A 2NO5A 4UDXX 3UMGA 2AR9A 2QSYA 5ETJA 5C5MA 5CYPA 2I71A 5LBUA 1KKUA 2PCFB 3U3KA 4F56A 3WYCA 1PO7A 1V5EA 1P5FA 1QK3A 2G09A 1P9NA 2NU8A 2C84A 3VC3A 3PRYA 1O0SA 1P60A 4BWGB 1PGOA 2PFKA 2R66A 3W7VA 1XVIA 3FNGA 3FPAA 4E5YA 9MHTA 1X74A 5K5PA 1JYEA 3JZMA 2P40A 4LY0A 3KR9A 3KXDA 2I2FA 3I9KA 3NHFA 1EU1A 3K1JA 4B85A 3P9YA 4I50A 4NJEB 3WJ1A 2ESRA 2EDCA 1UH5A 4KV6A 3DR5A 5DNAA 4AUMA 5HDBB 1JHYA 1R27A 3OAAA 1OX4A 4P4SA 3O03A 1GA6A 3A4IA 5AJHA 2P0EA 5JPNC 3FRPB 3WL6A 1CR6A 1JQDA 4RTSA 2YWRA 2DUJA 4GD3Q 3VDRA 3JVEA 5IASA 2C4NA 2XDWA 2FR1A 4O33A 2VXYA 5CNJA 2WHPB 3OCZA 3C7KA 3ROPA 3DWAA 1RJ9A 4NB3A 3UJPA 4DA0A 1QQTA 5LP1A 1ISPA 4DR1L 4DCPA 2IIBA 4RETA 2I76A 3AJDA 3WZ2A 2F0LA 4G63A 4OQLA 4C4SA 4Y2YA 2KI5A 1TM5E 2H1RA 3P9RA 3QE4A 3SAJA 3UFXB 2X5NA 1XMQB 2BCEA 1DGSA 1QJOA 4IO9A 1J9EA 4K6MA 4OIKA 1WPGA 3VNRA 4RTMA 3RAPR 4M1MA 2PZTA 5HW0A 2ECOA 5EXPA 4GQBA 5EXSA 1XN4A 2EZTA 3LNCA 2LVBA 1YB5A 1NRWA 2AX3A 1CZWA 2KM1A 3MEFA 2WD7A 3GTKH 1N25A 1K5DA 5DO9A 3BS1A 1Y3BE 3FETA 1US8A 5JAOA 2B4AA 3L0YA 1VQKA 2P41A 4BVJA 4I7ZC 2HYIC 1NE7A 4ALNA 3JVUA 3D2LA 1NSNS 4MQEB 3THYB 3C24A 3E0QA 3CEAA 2M9VA 1GQFA 4K7JA 1KAEA 4NFHA 4UQOA 2GUWA 2GK7A 3EIEA 3HOWH 3ET4A 4G0OA 3F9RA 4X3KA 1FFWA 1TAHA 2VUTA 3JALB 5DRYA 4PMCA 5IIFA 2BHSA 4BVHA 1YJNA 2R60A 3ZWQA 1DYQA 4DWVA 2PE5A 3CVVA 4P7FA 3WKAA 1YHBA 1ENCA 5JQGB 1L1OB 2J3LA 1Q1EA 3WYNA 4W99A 1L6IA 4D5EA 1VG8A 5AKEA 3OPYB 4JXJA 4AYBB 1D1QA 3DDWA 3L4SO 1RYEA 5IJAA 3RAJA 3MHBA 3QI7A 1RZVA 3MJDA 4MGYR 4BQQA 1T9DA 5KC9A 4L0MA 4MPRA 5F9HA 1KA9H 5HKOA 4QG7A 4Z49A 1EK5A 1L2FA 2MHCA 3FJYA 1EVEA 2ZIXA 1VZ3A 4OHJA 1JG1A 3GLVA 3UHOA 4LSZA 2EQBA 2IIQA 2YWCA 3VJLA 5B5SA 3R8BA 3RBVA 2DJIA 3HBMA 2AMFA 1TDJA 2QTMA 3VM6A 3NJRA 5JVG3 2K32A 4QJFA 2I46A 3SIPA 3G2JA 3NQIA 3P1HA 4KIFA 1FRZA 4AG3A 2CCZA 3LCCA 2A74C 2A69C 1KF0A 4LGYA 3AUJB 1DOZA 3AUYA 3ETHA 4PZ7A 1N77A 2Y99A 2XXBA 1YZGA 4RV4A 5EEHA 3OJLA 5LB2A 4ARBA 4RGBA 2IYSA 2VCEA 1E2LA 2VDVE 4PYKA 1G2SA 2NAPA 4NG4A 3SHTA 2OT2A 1GU0A 3X1ZA 1HDYA 4DF3A 1JG2A 1M8FA 3DE3X 1W52X 1E58A 3UV6A 3BA6A 2ZT5A 3QTTA 4BLPA 5CFMA 1W93A 1DQRA 2HB6A 4MZXA 4B34A 1A5AB 1OBVA 1JQJC 2H1CA 1P0FA 3PNLA 5JCJD 1J0DA 5BQ3A 1NJ8A 4L5QA 1RM5A 1OWLA 3L8DA 4WDQA 3PFFA 3RC8A 4JC4A 4B3ML 3D3KA 2EG5A 5L3QA 1XRQA 2X14A 1O0BA 1G20E 1Q1NA 3DE5X 5DYIA 1Z5NA 3U7QB 5I4BA 2WE8A 2BM1A 5JT1A 4IJVA 3FWKA 3IKJA 3RU9A 2V97A 1K8GA 2HYDA 3WGKA 3F96A 4D92A 1YZVA 3HWSA 3HDTA 3VXKA 4JKIA 3TMEA 4QY7A 2ZB4A 4JL5A 1JL3A 4MSUA 3QLUA 3V8BA 4L3OA 4BMZA 1S7GA 1TU3A 1E3TA 1P9LA 2J0QA 4MZ9A 1TT5A 3W2HA 4EB6A 1F9EA 3WG9A 2QLFA 5KQRA 1W48A 4KJZA 3DLAA 1SFOB 4EVQA 3CQ9A 1I7SB 1S6YA 1L5QA 3LK7A 1P72A 1UJ2A 3I09A 1YS7A 4H27A 3BQMB 1KRSA 3NYWA 3H2KA 4L76A 2NVTH 4M49A 4EI8A 4MVJP 4EMBA 4WT7A 1NXTA 4MR9B 2PX2A 4RPJA 1MLDA 4CF5A 4XVHA 4MDYA 1VIVA 3C6ZA 3QXHA 1X1RA 1D09A 1X77A 3UGTA 2NVQH 5JY1A 1HKHA 4N18A 2H3EA 3ZV3A 1WZEA 4H6VA 3W0LB 3BD8A 3TQIA 1U9IA 4PVDA 2PZEA 1VL1A 1T9CA 3C2QA 4H2DA 4LY6A 4F5WA 1JIXA 3BA1A 3LQ2A 3PVCA 1FXSA 2D7CA 3FSRA 3O0DA 5DGIA 2UYHA 1P4HA 3RC3A 1KVQA 4FHZA 5BNWA 2FEPA 2CMGA 3KEQA 4OYLA 2EFJA 2BFBA 3RRZA 2XUFA 1UXJA 3DVAA 2CBXA 2O52A 2GCIA 4ZT4A 1PTJC 2Y0PA 2IE8A 3RTAA 1RAGA 2JA9A 1UOQA 2P2ZA 4KGDA 2O1SA 5JMPA 5PNTA 4GS3A 5A2QL 2NM0A 4XARA 3SXUB 3ZH2A 4BO8A 5JSUA 4BVGA 4KO8A 2A5YB 5AVQA 3C3MA 1WZIA 3H94A 1C9JA 1WUYA 3C1FA 2IUYA 3GUUA 4FLFA 4M4SA 5K3CA 1DAEA 4BVKA 5M7EA 4TXHA 2QHXA 3PC7A 3UXHA 3K8AA 1NN0A 2NVWA 3ETJA 1GPLA 1QB7A 1GYRA 1U7DA 3ABOB 3MJSA 2CCGA 1U3UA 3NC1C 4LHSA 7AT1A 5AVZA 5H81A 1GGFA 3OZXA 3ZK8A 1TKBA 2OTLA 2GAFA 1IKLA 2HNKA 3N74A 1GHJA 4FO2A 4MS1B 3UW3A 2R0QC 1D1TA 3SYTA 1NNXA 4LYYA 3GI1A 2C2ZA 3TSSA 1DNPA 1ZHHA 1XWFA 4L51A 4PSAA 4U4AA 1XP8A 4F8MA 1EEXB 1Q7EA 3WJ7A 3QX9A 1IBCA 4L8LA 4AJOA 3OZEA 1H2ZA 4D82A 3KTOA 3W6OA 1STHA 1AA6A 3V1UA 2HCCA 2KECA 3HKZG 1T4BA 4QGUA 4B4WA 1T1SA 3BXPA 4FZJA 3SLRA 3WLEA 1X55A 5CC4A 5C0XJ 2EZ8A 1Q1QA 2JLCA 3BWEA 2Q5FA 3HS3A 3NHSA 1MO2A 4J4HA 1MB3A 4BKRA 4L6TB 1EDDA 2COEA 5TXGA 3AR8A 4OEMB 1D9ZA 1EU3A 4P4SB 3D6JA 3A5ZB 1TNDA 1J9GA 3OPOA 1ZINA 2C59A 2ZYSA 4RKRA 5C4MA 1LJ8A 1UKCA 5J58A 1UKEA 4Z0NA 4X64B 3ZHQA 3DO5A 5TVGA 1KYIA 4DV2L 1KAGA 1V1RB 2H9IA 1M1YE 1H05A 1ULTA 3VR5A 4HEJA 1W73A 4MRAA 4TWZA 4UCWA 4J15A 4B46A 1A1VA 4EGVA 1GGVA 1S5CD 2ZSBA 4XVQA 1NUQA 2GJ4A 1OLUA 5G4KA 5BNZA 3IQDB 3KSZO 4H1TA 5THQA 2ZBUA 3WHLA 2D74A 5A9SA 2NN6I 4IUYA 4F3NA 2IC5A 3REOA 1G2TA 4RMFA 3HKEB 4PZ6A 2PLFA 4OI1A 1D2NA 3FTDA 4NCIA 4QBIA 4Y6PA 2D5DA 3PSIA 1Q7RA 3ZVRA 4AXXA 4IQ8A 2WD7B 1E9DA 3RGGA 1QWOA 4LWZA 2J7PA 3W2GA 5DIFA 4CTKA 1YJ5A 3IQEA 3DOUA 3PQ7A 2EFEB 3N86A 4RGYA 3F1ZA 4CKEA 2IX3A 4KY6A 3KJOA 1CJSA 1CZGA 3KX2A 4EGQA 1IIRA 1O96B 1V3UA 2O2SA 3QP9A 3SZGA 1MX3A 1UBHS 2NN6G 2D1QA 2Z04A 3EGOA 3HCCA 5CVJA 3SM3A 3FI9A 1I3LA 4PPFA 1G6ZA 2HDMA 2W2XA 4HYTA 1P6UA 4BIIA 4FQ5A 3S8YA 3N8NA 5FIUA 3UGJA 2EG9A 3NW9A 1BS9A 4L8WB 1EIWA 2P4QA 1DAMA 1JKMA 3TOXA 3HZXA 5C1IA 1XZLA 1QVRA 1K3RA 2PNHA 4ML3A 3TZEA 4UTNA 3K1ZA 5DM0A 4XWOA 3K0AB 4A3DH 3NAGA 3ZUGA 4ETMA 2QDBA 2MINA 3FRIA 2B4QA 1N6PA 1XE3A 2H4WA 3BTSA 1M4VA 1VJ5A 4J6FA 2Y0EA 4NEGA 4Y6OA 5FWXA 1QZTA 3DDZX 5BSTA 1ADBA 4GI7A 1ABFA 2HMAA 1HMYA 1FYXA 3PR3A 4V0LA 2C7QA 1MVLA 4MKHA 4IGFA 3VHQA 4GG1A 2ATIA 4RE6A 3QFSA 3NHWA 3UJ8A 4OEHA 2EW2A 3D7MA 2DBVO 5KWVA 5FNVB 3I92A 2XWBB 3TOZA 4HO1X 3UAZA 4ZU1X 4BL5A 2PQ0A 3E35A 5AQEA 3V7UA 1X86B 4M1OA 4CN8A 1M10A 3TTXA 4KJNA 3B9BA 1DJLA 1MB4A 2VHVA 4WZBA 5A4FS 5F4ZA 3S1NB 5HZMA 2XQIA 4OA8A 2UU9Q 2VJPA 2VNIA 3KLPX 2QE7A 4HAIA 4LMAA 3OTGA 2I4IA 1I4HA 3K6SB 1YWGO 3B78A 4DSZA 2RH5A 3GTMH 3WJ2A 4POGA 4IFDH 1GADO 3JASA 2RDFA 1C8CA 4MV7A 1WE2A 1ZWKA 1V8BA 2RQXA 1V3VA 3TTTA 5FPHA 1V1QA 1E0BA 4IJLA 2PVCA 4BBPA 5J1TB 4G0ZA 5KKCA 5EMHA 4N48A 1TWCB 5HS4A 2AYXA 1TEVA 5L3ZA 1CP3A 2QX8A 3VH2A 4BNYA 3D3QA 2COUA 2MSDB 2QUZA 3RIGA 2RHBA 3VYSB 1QUEA 4B6OA 1VQOA 4G5HA 2QRVB 4WMLA 4EUNA 4BLRA 5AKYA 4GP9A 4JBHA 2EYLA 5KWIA 4CMHA 2G9UA 2R4TA 3JWJA 4QUGA 1YRQA 3SFVA 3E8MA 5ICMA 2UXCL 3OF3A 3GMIA 4I4IA 4CLEA 6Q21A 5I47A 3KD2A 5J3JA 2UYCA 3OU6A 2JHFA 3NH9A 4EVOA 1E7QA 1O6ZA 2Q3JA 1PF7E 3WADA 4DY6A 4AQYQ 3CM0A 4X00A 3D4WA 1WU7A 2GESA 2HNBA 1XPUA 3W5OA 2WKCA 3AGPA 4JU9A 5DIZA 4CKWA 2PGOA 3EPRA 4UHCA 5GV8A 3UAVA 3DHYA 3DT9A 2RHOA 1EWIA 1RWNA 1R6XA 2BKVA 2C2YA 3R4CA 4ZEOA 2OKCA 3ZTTA 5CV5A 5DEOA 3S2DB 3JAMA 3CLRC 4LZNA 2Q27A 4DV7L 1NMEA 1SUIA 1B3RA 4S1PA 3FBTA 1EUZA 3OCWA 1L5MA 3IDFA 4RF2A 1F7UA 3NKFA 1UP6A 4MCJA 1FVXA 2MYTA 4MQMA 1RS0A 1XTVA 1HG1A 5H3CA 2QX4A 3I0MA 1X7XB 1W44A 5EHQA 1XTIA 4MJ3A 1CV2A 2JJ2A 3QEBZ 3WRXA 4TZ0A 3HEAA 3KBGA 4M0UA 2UZ4A 1OKKD 3J81j 4L4RA 1E5DA 4P75A 3FVTA 5B36A 1AS2A 3OIQA 1LV8A 3E15A 4S1WA 3MS2A 1SVMA 3QW2A 5ISRA 2J3IA 2UZ3A 2Z5LA 1EG7A 1QGAA 1PT9A 1T2FA 2PZBA 4BBRB 2ZPUA 4OL9A 4ZA2A 3S28A 3H1PA 1C9MA 2RBKA 3FPCA 3IAM1 2CLSA 4IFDG 1M8KA 3NX4A 4KQXA 4JJEA 4JT2A 2I2CA 4R0MA 1V3TA 5CX1A 3H3VH 4FTWA 1ZLXA 4PZ0A 4E09A 5KRUA 1AOXA 4JJ6A 3KZXA 3T34A 1J1UA 2HU8A 3LBIA 3PHIA 4KI7A 2QMUA 4Q15A 3ZDFA 4F9FA 2IS4A 1S96A 1LZLA 2LP4Y 3NUQA 3QOXA 3V4ZA 4X20B 5CM8B 3FD8A 2ODBA 1I4PA 2JGKA 1NJ2A 1FX0A 1EWKA 2ZAMA 5HQ3B 3QX7A 1BIFA 4F4UA 5BUCA 3B6EA 2OFWA 3F49S 1W5AA 3OIUA 5DYTA 2EOAA 3GTJB 1ISHA 1KEEB 2PKWA