2AWNA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
372
structure length
330
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 77
structure length 330
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awnA03
2.40.50.940 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awnA01
3M9BA 3GLHB 1Q1BA 5FL7A 2IYXA 4PPFA 1EQQA 4DR5Q 2WWIA 5DSZA 4LUCA 3MD0A 2JA1A 2AKAB 4F7WA 4YMUA 3THWB 1X9NA 1KDOA 4Q4AA 4Y0VA 3PXGA 5EXSA 3TSOA 1OH6A 3CB4A 5JI3E 4BEBA 2VSXA 5KDDA 3VKWA 2GTPA 4BY7G 2DY1A 5K8TA 1QVGA 2PZEA 5EUQB 3RVBA 3K8AA 1KKLA 3F3YA 3OFNA 4PPNA 2HUPA 1GO3E 1YHQA 1Q3HA 1M1KC 2ZS7A 3BFXA 4Q1AA 4BBRG 3GFTA 4JI5L 4RD4A 1NJFA 4DV1Q 3NDPA 4LJAA 4C3IH 1FP6A 4B3RL 1DS6A 3DZ8A 3Q5DA 4OQFA 3NBHB 4NXMQ 1VS0A 1FTSA 3SNHA 5FTMA 3H0GG 4C3ZA 2ZITA 3AKEA 1XEWX 2VPPA 4O2RA 5IYCH 1KMHA 4A3DG 4I1OA 3GLFA 4RY2A 2WAXA 4RCYA 1IN7A 2UVQA 3K0FB 5GADC 3L0PA 3KL4A 1TWHH 5AJWA 3I1FA 4D80A 3CF6R 4JI7L 1ZCBA 3QOFA 4PZYA 3RRMA 1PYSB 2QORA 1W0KA 2RHSB 4YY3L 1EFTA 3C14C 3IPYA 2QBYA 3U3KA 4S2EA 4DR1L 1SVIA 1T3SA 1E2QA 1PA6A 4BFWA 1EXMA 4JLAA 4DK6C 1PH4A 2ATVA 2JATA 821PA 3QKSA 1RYHA 4A3EG 5FBQB 1YJWA 5CLLA 3B2EA 4AC9A 1H95A 5JLJA 5IT5A 1QHHB 3QVUA 1W4RA 4OX9L 1OF1A 3F8TA 5LB4A 1EWIA 1KI4A 4MH0R 2AXNA 4OQLA 5C2JB 2VNUD 4LF7Q 2JA7G 2G6BA 2CL0X 2VLIA 1VQFA 3BH0A 1U0HC 4DT1B 1TEVA 3HJNA 4FCWA 3SU8A 3S1NH 4BZPA 1CKOA 4BE7B 3KF6B 3I4OA 2VP0A 4MDFA 3C4JA 5EZ5A 3PUVA 2RHQB 3THOA 4GNKA 1E2DA 5DNYB 4DR6Q 1S96A 2UZIR 1IL2A 1XD2B 5CYOA 4BGDA 4Q9HA 4M0LA 4DLRA 4FDBA 1DEKA 1YHAA 1YVCA 2DR3A 3NTUA 1W36C 4KBFA 5LMNW 2E2HH 1XEFA 3UMSA 1Q44A 2KBNA 3KF6A 2E2JH 1NBME 2HXSA 3IO5A 4UNSA 1V43A 2N46A 4C0HA 1KRSA 4B2LA 3GEIA 5C0XJ 1HZBA 4HATA 4Q9KA 4JI0Q 1NVVQ 1A62A 3W5OA 4OWWB 1WXQA 2JJQA 2ZRIA 5K8LA 4FW9A 3PJRA 1XPOA 1F2TB 2JJ2D 4KSCA 4LNQA 2R2AA 2EU8A 5H1YA 2YWGA 4D0GA 2O0HA 1JR3E 3LY5A 4B3SQ 1HE1C 5E4FA 4F4CA 4IW3B 1Z5ZA 1R0YA 1P4SA 3AVOA 1E9RA 4ME3A 2CK3D 4LF8Q 1OKKA 2IS6A 2N8NA 2HJVA 1G8HA 1N2CE 3V4FA 1KI2A 4NZYA 3B78A 4KXFB 3S1RH 3HR7A 3QKRA 2Q9CA 2GWHA 3P4XA 1UE1A 1A4RA 2PMDA 2ZSBA 4C30A 4F91B 2IHEA 2WWXA 4JJZA 3EC1A 2GNOA 1G6HA 2JLYA 1UBCA 2YTVA 4XSGA 2OLJA 2WB1G 1KC8C 3GJ3A 4TT3A 1HZ9A 4JBWA 3C8UA 2F1IA 1P3JA 4X62L 1VCOA 1HNWQ 4JSTA 4LF9Q 1ZYUA 1DE0A 2Z0MA 1D9XA 1MIUA 3JVVA 2GAAA 1HNXQ 1R0ZA 1Z6AA 2YHSA 3UE1A 4GOPA 2FOLA 1Y63A 1K5GA 3QXXA 2WOOA 3UMRA 4DV3Q 4PZZA 2P2LA 2UXDL 1E69A 3CKLA 3TK1A 3CZQA 2UUBQ 5GVSA 1Q1ZA 4TLBA 3PG5A 4Q00A 3NC1C 3I92A 3RS7A 3AF1A 5M3MH 2ZR9A 3TLXA 2R6CA 2IF2A 4EFLA 2WJHA 2X77A 3V9PA 3VR1A 4IO9A 3E2IA 5CB8A 4JI4Q 1E96A 3K70D 4DUGD 3GO5A 5AJ3L 3PO2H 4JI3Q 2FFHA 2PLRA 1DO0A 2WV9A 4UY8C 3AKYA 3HOXH 1Q12A 2CE7A 4P4UA 4PQYA 2BC9A 4EQ5A 3AV0B 3DMDA 2IWRA 2XITA 1QDEA 4E09A 1PH2A 1U90A 3RS2A 5L3SA 3RLOA 3B8HA 2UXCL 4GRAA 3W8NA 3JZMA 2E8GA 4HB2A 4TTRA 3AP1A 1ASYA 2GAOA 2D0PA 1G3RA 1UPTA 1JAIA 1GL6A 4EJSA 1JE5A 2D62A 1P61B 2UXBL 4G5RA 4C0KA 3FYHA 4JVLA 5EE1A 3FMFA 2N42A 3X1ZA 4EKDA 4KCGA 4NONA 4OHVA 3IBGA 3SFVA 3A1WA 3UDIA 1G4UR 4OI4A 4B3TL 3I4LA 4QNMA 4Q9IA 4BFTA 4MDEA 4LJ7A 3PIPA 2JA5G 1KI3A 2AKYA 4JC0A 2GCNA 3NVAA 4WA7A 3VNUA 4UQOA 1JBKA 1S9HA 3S1MH 2ZRNA 4HSEA 1Z3IX 1IN6A 4BLQA 1ETUA 1Z6TA 1RC8A 1JPNA 4B47A 4Y52H 1YKSA 1VQHA 1GD7A 1GM5A 3LX8A 5DLQE 3I7FA 3CNLA 1HQYE 4BLPA 1GTVA 3THXB 2Q6TA 1Z22A 4Q9JA 2GESA 4ARZB 4DC9A 1Q7YC 2O8DA 1NMYA 3H4MA 4OL0A 4DCNA 3QXCA 2XXAB 1Z6XA 3TQCA 3K0XA 1LM0A 1FJGL 221PA 2NPFA 4II7A 3A1VA 2O8EB 1UF9A 1AE3A 2C5LA 1JXMA 4MYUA 3EA5A 1IJFA 2XJ9A 1UKEA 2YWHA 4IXMA 4DDWA 3W3ZB 3KB1A 3NENA 2GK6A 3UANA 3KJOA 1PHJA 5P21A 4A0RA 4KLZA 1YRAA 1JMCA 4TYNA 4LDJA 2VL7A 4PHTA 4M1MA 4NXNL 4DKXA 2JDID 3H1TA 3OYYA 3R20A 4UNRA 3QXSA 4Q1FA 5JEAJ 1T3HA 2FSIA 3AP3A 1CKMA 2GVZC 5JCZA 1X86B 2QZ4A 3GCGA 3OAAD 1IXZA 1MT0A 4MGIR 1VQBA 2R44A 1GRNA 3AEZA 2IXGA 5AUPB 4YCWA 3CW2C 2WMNB 3HDTA 1N33Q 2ORIA 3EC2A 1N34L 3U44B 3FTQA 4NPSA 3CMAA 2WSSD 1E2HA 2CCGA 2RMKA 1CBUA 1JPJA 4O0AA 2FMXA 1G7RA 5HCNA 2MO0A 3WMFA 2ODBA 1XNRL 3TR5A 3SQWA 1ZC3A 2H16A 4ALPA 3ADDA 1K5DA 5JHHB 3U4QA 2HEIA 2IXEA 1IBMQ 2ODWA 3AQQA 4JI2Q 4EFNA 3O8CA 2QMUA 4RZXA 4CEIB 4M9XA 2BMFA 3E70C 1J5EL 3MWYW 4CIDA 1N5KA 4ZIRB 3CC4A 1JI0A 3N2EA 2GZDA 4JV5L 4B43A 4FCTA 2IS2A 4Q4HB 2ATXA 1S72A 1VQ5A 5KYKA 2PQAA 4HAYA 3L8YA 2FXQA 1CULC 1G18A 1E9CA 4LUZA 1EX7A 2CWAA 3SQXA 1G7SA 4IVQA 4DR7L 4A76A 1F48A 2VS1A 1QZXA 4MKGA 1E2LA 2AWOA 2PNHA 4NYIR 2HHHQ 4FWIB 2CLSA 2ZI3A 3MWKA 2Z4SA 3QEOA 4CEIA 2OE2A 4A75A 1S3SA 1ZUIA 3RLNA 4Q7JB 1NVUQ 4BXXG 4DR3Q 1ZM9A 3T61A 3GLGA 3CCUA 4HB0A 5A5GA 3ASYA 4JVSB 2D3WA 1SRUA 2WPDA 5DHAA 3IPXA 4AG6A 5AUNB 4TTQA 1FMLA 2J45A 2IXFA 2YTYA 4Q66C 5E7MA 4R4IA 5FI1B 3CPWA 1IBKL 2UZ3A 1GZSA 2CWPA 4LWZA 5EE3A 4BZQA 4DV5Q 2AHOB 1Z6YA 1XWIA 4KO8A 3GFOA 5K36G 4IKEA 4LFCQ 1VHTA 5FJ8G 3RS4A 4C2MH 2HV8A 2ZRKA 4U02A 3RYTC 3EZ7A 1IM2A 1N6OA 5HR5A 5C18A 3VMFA 4I99A 1HUQA 2Q21A 1QG2A 1E9SA 3AP2A 4LHZA 4D0LB 2DWPA 1GG2A 5AK0A 1KSFX 3AVYA 4AKGA 2G1JA 1Y3AA 4XOIA 3WMEA 1N6LA 4GKKQ 2NZJA 1XNQQ 3JAMc 2K14A 1ZM3A 2VHCA 1EESA 3BD9A 3KDFB 4TQAA 3ZS8A 2V1CC 1CR2A 2GXSA 3OE7A 4HJ7A 5CK5A 3BB1A 4LC0A 1KI8A 1JJGA 4OKSA 4CF7A 3SZRA 2PI2E 1G7CA 3W1GA 3FMPB 3I3SR 2ZS9A 4NTZA 3G71A 2XJ4A 3N70A 4LV5B 2W6JD 1MO6A 3Q8XB 5TVKA 2XSZD 2ORVA 1W48A 2PJZA 2ASEA 3RS0A 2IC5A 4D81A 3FP9A 5A4JA 1D2EA 5SZIA 1HR0W 1YR9A 3BB3A 1PH9A 2KJQA 3DM3A 4GMDA 4OHXA 4P71A 2ZSFA 1JJ7A 2HYDA 2QAGB 4M22A 1IXSB 3W1BA 2ZTCA 1P72A 3EIHA 2ZJ5A 2Q9BA 1MABA 5LD2B 4QM6A 3L8ZA 2NZOA 1XTIA 2A7QA 4GNXB 2H18A 621PA 1SQ5A 3BC1A 3AGPA 3THYB 2Y0SE 5JEDA 1PYBA 4PANA 3ZIAD 3I61A 1G3MA 1XTQA 3WWVA 4DR4L 2KI5A 3ND8A 2LSSA 3KQHA 2OCPA 1KO4A 3VU9B 1S1CA 2F4VQ 3HU3A 3WYGA 1ZD1A 1TQ2A 1HURA 3CH4B 1DAMA 3WP0A 2PMKA 1E0SA 4Q7MB 2X2EA 1ZUHA 1UBGA 3K8YA 2AL7A 2NZ8A 3NG1A 3NELA 4KU4A 5CIQA 3GJ8A 2XOKA 1HTWA 3JVUA 3NKVA 5FR2A 3CWZA 1NY4A 1NI3A 4Q47A 1VCNA 5J4KA 1UE6A 4M1TA 4GOKA 1TAGA 3I8SA 5JSZA 5LMNQ 3K7UC 1E1RA 1KQSA 1FTNA 3I32A 1C1YA 2V7QD 2VP5A 4M1OA 4HZUB 4P32A 5JJLA 4DCSA 5C0XI 3PV0A 2W00A 1CUKA 1P73A 4ILEA 2FWRA 1SR3A 4GOJA 1CR0A 2NVYH 2NO1A 3NXSA 3PO2G 4V02A 3LXRA 5FUXA 3BZCA 1H8ED 3W5JA 1H8HD 1F2UB 3NC0C 4EPTA 1IQPA 1DADA 1SMXA 3NH9A 3IRBA 3A0JA 2VHQA 1WBDA 2JA8H 4KHPL 4J15A 3OEEA 3U4VA 1RZ3A 4FINA 2W6ID 4XIGS 1NY5A 4GOPC 2NVQH 1VQ6A 2C8VA 2BH2A 2BA1A 1HEIA 3MEFA 2CL7X 4DRZA 4GN3B 3ZS9A 4NCIA 4AH6A 2UUAL 2ECKA 5ELOA 2F1RA 2G77B 2ZIAA 1MRNA 1IBLQ 3FMOB 4L15A 4RCZA 1S9DA 5C3EG 1JT8A 2FJUA 2ALYB 1E94E 3KUCA 1UKZA 2J5XA 5FLMH 1QBKC 1JJ2A 2AFIE 3OEHD 3WBKA 2CCKA 4BECA 4ZDWA 4ERNA 5J4LA 1TEXA 2IYTA 4JOIA 1HNZL 2HLDD 4M21A 1PH8A 4L9WA 4PC1A 3G0HA 3A4MA 2DUDA 1P60A 2OESA 2X8AA 5BR8Q 1NVWQ 2B29A 3VDYA 3PCRB 5JWRA 1QHIA 1L0WA 1II8A 2MSEB 1A8VA 4DLWA 4E07A 2BKUA 1AE2A 1VQGA 2R65A 3I5XA 4GL2A 2GEVA 3UPUA 3AM1A 3CD6A 3KJHA 1YZKA 3QI2A 4HIMA 2R6DA 1KO1A 3TVTA 3NEYA 3KYHC 1XXHB 4N1AA 4EJSC 3BJIC 4A2QA 3HR8A 4JLPA 2C03A 4IOAA 4BBRH 3CM0A 3PQCA 1WBBA 5IYDG 1YBYA 2XGTA 3ZGXA 3AKCA 1MRSA 3HYTA 3ZQ6A 3NBZC 4LF4Q 1XEXB 4NE2A 421PA 4B35A 5KDOA 1NSTA 3NBFA 3H0GH 1VCMA 5G40A 4RFVA 4DUYL 1CP2A 1KK2A 4A3DH 1NN0A 1KDRA 1SE8A 2ZI5A 4ZI3A 4TYPA 4NCJA 4Z8YA 4HAUA 4PZ7A 3GLHE 2OM2A 1KJYA 1F6BA 2ZYUX 2NN6G 4AIMA 4A92A 3HFZB 4NYJR 4QBFA 3FHTA 2C9YA 4NBSA 1W36B 3NHBA 2QSYA 3IIJA 2QM7A 1LS6A 2WWWA 2BBOA 3WNCA 1SGWA 5CB6A 4MZ9A 2EFGA 4D4JA 3IBYA 2QE7D 1L1OB 2H5EA 3IUYA 2QNRA 5JHGB 1N6HA 3SJBA 4TZ0A 4A3EH 5JJKA 1VQIA 3DOFA 1L2TA 4W9MC 4NCHA 1G8FA 1OFIA 2F3RA 3S17H 4BASA 4EQ6A 3D6TB 1L2FA 4O25A 5IWAQ 2WAQG 4HIOA 4A3KG 4K0KL 1PLJA 2PZGA 4LBVA 4YCVA 1ZBDA 1L1OA 3TW4A 2XB2A 2BBSA 3CWQA 1Q81C 1X55A 2XZLA 3HPQA 3L43A 2C95A 1KYIA 4DXAA 1G51A 4YMTA 2ZUDA 4GFDA 1Q46A 1J2JA 3TAUA 4LC1A 4B34A 5HZKA 1J8MF 5JS7A 4BA2I 2O8FA 1XMJA 4B3ML 3GTMH 1G3QA 2IA5A 5LBIA 3VR5A 4GPTA 4LPSA 3OW2A 3E1SA 3LLUA 1E2MA 3CMEA 3UWKA 3RC8A 2A9KA 4IJHA 4DPGA 4RD6A 4BEJA 2WFWA 1XU4A 4G0NA 2CHGA 3NEMA 2J0QA 2LKDA 3A6PC 1TQ4A 1SVWA 1TPZA 1YE8A 1PJRA 3A1UA 3KFVA 3RRYA 5EXXA 5EAYA 1G3UA 4IEEA 2ZRHA 1L4UA 1R5OA 4K46A 2PCLA 4JVMA 2JJ2A 3H15A 3CZPA 1B8AA 1R5NA 1TUIA 3A1SA 4M4SA 1XJQA 4JI8Q 1NMXA 1GKHA 3PF5A 3BOSA 4OI1A 2O8CA 1KXLA 4TYQA 5KDLA 4MTNA 2QP3A 1XMQQ 4EPWA 5FBVB 1E9FA 3L2OB 1II0A 2ONKA 1UDWA 2NTYC 1RRCA 2RCNA 3TQFA 4DR5L 2VIIA 4HLCA 2D06A 2Z0SA 5IP7G 3CC2A 1CR1A 1KHTA 2FN4A 4FD2A 2LCFA 4LBWA 5AJYA 3B13B 1AIPA 2JEOA 1OH7A 1CSQA 2Q3HA 1S3GA 4Q7LA 4AYWA 2GJ8A 1C0AA 3CCSA 3AB3A 1Z0FA 1RIFA 4IPHA 2FG5A 2JAQA 4M2LA 1XTSA 3R7WA 5TDHA 2C98A 2P6NA 4OXPA 1A82A 3LO5A 5KNDA 2ES2A 1PH3A 3OESA 2XTMA 1YI2A 2VH5R 4C0SA 3CNOA 1EFWA 4DV1L 1NMZA 1ZVQA 3KQNA 3SGIA 4X65Q 1OHHA 3TSWA 1BH2A 4PC2A 4X64Q 1G291 1NBMD 1X3SA 4R2IA 4AYXA 4IPGA 3EZ2A 3KKOA 3GTPH 4P33A 4LSGA 1MH1A 4JS0A 5BQ5A 3J81k 1R8QA 4GZLA 4BLRA 5L3VA 3LDAA 1IAQA 1XBTA 3MG9A 4JBYA 1FNNA 3OZXA 1HZAA 1X65A 1WRBA 1Z0IA 3OF5A 3J80c 4KODA 4QHYA 1B7YB 2BVNA 2EWVA 3EA0A 1OB5A 5GAGC 1D9ZA 1JR3D 4DUGA 3FB4A 1GKYA 3BAFA 4F38A 1JALA 1W3SA 2QGZA 1UKVY 2B63H 5E7NA 3C41J 5C4MA 1EWQA 3EIVA 2OAP1 4YDHB 4QIWE 4JMPA 3FHOA 5DO9A 3A8TA 3CCVA 4B3XA 4DVGA 4P72A 1KO5A 3S15H 2CVFA 2VF7A 3U6BA 3ZLJA 4QHSA 4MGZR 4TMZA 3ICQB 2OO7A 1P6XA 3HYRA 3PUZA 3TQYA 1SVMA 3ULPA 2C2HA 3P27A 4LJ4A 3VHLB 2RAPA 3FDIA 1AQUA 4PZLA 2MQHA 5JEAG 3CR8A 4LHVA 4POAA 4A3GG 1N36Q 4BRWA 5EJEA 3RRNA 4PR0A 4TMXA 3WHKA 1VQDA 2HIVA 5JWHA 2BDTA 2LWIA 3TS2A 5EE9A 3GJ5A 3M4QA 3FPAA 1R8SA 2OEPA 3ZJYA 3CUEF 3QG1A 1M1YE 2LKCA 3F2BA 4HJ5A 2ZI9A 1RPZA 2WM9B 3LAWA 5JECA 3S1QH 1Z2CA 4DR6L 4DV0Q 2REBA 3IEUA 3SEAA 4Z51A 4Y0AA 5AJXA 4AD8A 2NVTH 1W0JD 2GCPA 1HR0Q 3IHLA 3BGWA 2JA8G 4LJYA 1AGRA 1WI5A 1P62B 3VTKA 4LJ9A 1KKMA 1TWAH 1KAGA 2FPKA 1HE8B 1WDTA 3CR7A 3U4ZA 2F9MA 4MGKR 1JR6A 4JI0L 3LNCA 4PTLA 1EFHA 3BH6A 1MJEA 2VL6A 2W2XA 4UJ5A 1W46A 1XZPA 3D8BA 4YWMA 3RRZA 1N6PA 1E3PA 4Q4AB 2R93G 3U60B 3KZ1E 5BXQC 4B3SL 1OFHA 1AQYA 2JDIA 4LF8L 1T9HA 4LHXA 1P9NA 2AX4A 4WAUA 3T15A 4A3CG 1IHUA 1M7BA 3LBNA 1M8PA 1XD8A 2Z4RA 5KPJA 2XTZA 2FEOA 3UG7A 2VHJA 4CRWB 4V0KA 3ND9A 1K73C 1ZU5A 4YHHQ 2NO6A 1Q86C 4DSOA 2ZREA 5AUOB 4PPQA 5C46F 1YHBA 4LYJA 3T1YQ 3U7FB 5GJBA 1KMHB 3PVSA 4JLBA 4WBSA 3GLFB 3J81j 1SULA 1VQLA 2QTHA 4OQNA 1G6OA 3QG5A 1WJJA 4LI0A 1PLKA 2GVBA 5EUMA 3UE0A 4DK3C 1E1QD 1XZQA 3FKSD 2HIXA 5SZJA 3STBD 1KI9A 1P9WA 1HNXL 3LVQE 4OONA 4JLDA 3WYAA 4JOIC 2V9PA 4X8MA 4JT2A 1F5NA 2WB1E 4JKIA 2QBYB 2RF4A 4DV3L 1KGDA 3GJ0A 2W2TA 2HCJB 4JSYA 1EGAA 5DE3A 2XNSA 1U8ZA 3S1AA 2OBNA 1FMJA 5G53C 3QE0A 4V0OA 5KHOC 2J0UA 3VX3A 4AKIA 1VQEA 2AXPA 2H8KA 4WJ4A 3A74A 3QKSB 2BMDA 4A3JH 1G5TA 2ZJ8A 2JIZD 4QNRA 4X66Q 1ANKA 2PEYA 4JI4L 1JQJC 1PUJA 3M1IA 1N8RC 2G88A 3VAAA 2AN9A 4JI3L 1GRQA 2YC2C 4X8HA 1W4CA 2WTUA 2JJ1A 1VQCA 4LYHA 1R4AA 1WA5A 4IOMA 4NCNA 4OI0A 1JQLB 3AVWA 1U0JA 4NH0A 4JBMA 2QPTA 2ZEJA 4QL5A 3VFDA 4CEJA 4GN4B 1M6NA 2OHFA 4BXXH 4PQRA 4AWXA 4Q1CA 4TMKA 4B6FA 4C9BA 1I5FA 1KY3A 2D0OA 1V9PA 1LF5A 4A8JB 3W34A 4ACAA 2F3IA 4H1VA 1XTJA 4QGFA 2BA0A 5IF9A 1D8LA 2PJRA 2EXDA 1PH1A 4V0ME 3CXCA 2FEMA 2ZU6A 2V55B 4C0AC 1KHIA 2FFQA 4DV7Q 1ELOA 2A5GA 2WHXA 4GLVB 4NKRA 3AUXA 1D8TA 1DGSA 3DM9B 5FJ8H 4FI3C 5FOUA 2ZTEA 1ZNZA 3BXZA 2JGNA 2PEZA 3KJIA 2XTIA 1N5IA 1TL7C 3CO5A 3PEVA 5L8VA 4A8JA 2F55A 4LHWA 5HTKA 1X1RA 3BBPA 3HP1A 3AF2A 2B21A 2AD1A 2E2IH 3FOZA 3EPJA 4A15A 1OH8A 2CVHA 2Q3MA 1CJUC 3G4SA 5H70A 1YZTA 1XRJA 2P5TB 3P26A 1P2SA 1NKSA 2J0VA 2ZM5A 4DR2L 3H2YA 1UDXA 2H92A 4Q1BA 2MNAA 2ZJOA 1UM8A 2IYWA 3A1TA 2XB4A 3OTOQ 2EFDB 3GJ7A 2GVDC 4BY1G 1ZNXA 2JA9A 3ZH9B 1ZC4A 3EAQA 1L1OC 1CRPA 1COWD 2W6JA 4MUBA 1WYDA 3TS0A 1I4TD 3DDCA 1ONBA 1GSIA 2F43B 3QKRB 1JJVA 2XSZA 5DI3A 3ZZTA 1GUAA 2YJTD 4IDPA 4TLDA 1OE0A 2A5JA 2VRWA 2QP9X 2R6AA 3B5JA 4P4SA 2BHRA 2DPXA 2PT7A 1XCPA 2XNDA 1IY2A 2EQSA 3N2IA 1E0KA 3T5DA 2IYQA 5CJ2A 5G3ZA 3HPRA 5B30A 2Q2UA 2K4KA 2DFNA 1U8AA 4WXRA 2F43A 1R5BA 3T1QA 4FWTA 1VKJA 4Z8XA 4ZDJA 2RGBA 2BJVA 2ZI4A 4GOPB 1E4YA 2FE4A 2EVWX 2VA8A 3IO3A 4A36A 2FZLA 1DAFA 1S1MA 4A0GA 1U9IA 1I2DA 2G0NA 4RVCA 5AJZA 1NLYA 4G5QA 4Z1MD 5B64A 2WJJA 2BM0A 2QP4A 3SYLA 5BYKA 5EZ6B 2VTKA 1EWRA 1TX4B 2V3CC 2ZTDA 3CCJA 4O2LA 2WVJA 4L8GA 1KK3A 2JCSA 4JI2L 5HE9A 2D7DA 1SFOH 721PA 4LFBQ 1V1QA 4E22A 5CDFA 3I4NG 2V7QA 2CCZA 1T0JB 5L3SB 4A93G 1Q21A 1IOZA 1SXJD 1US8A 1W5TA 3G5UA 4IFEA 1H8EA 1NTGA 5CLQA 1H8HA 2B63G 2JLRA 3I4MG 3ZZ0A 2HHHL 1UWVA 1NRJB 1UADA 4V03A 1L4YA 1OIWA 4EJSB 5EP2A 3QPWA 2W58A 4PC7A 4OHYA 2QA4A 2K50A 4FCVA 2LXJA 4LHYA 5KNBA 2W6IA 3GTQH 4I4LA 2ZSEA 2R7ZG 5D3MB 4EPYA 3M7NA 2IW3A 4G5SA 4I81A 2IEZA 4QBHA 2HT6A 4C4PA 4N3NA 5F3WB 2HJGA 1YZNA 2ZE7A 1AKEA 3LW7A 3W3AA 3P4YA 3WNDA 3DO6A 3E9IA 4OWXB 3J80i 3ULLA 4DV5L 2ZUCA 2OQKA 1LTQA 3M4PA 5C3EH 3TRFA 1K8GA 5EP1A 3GP8A 4LFCL 2ZJ2A 2IS1A 1W2BA 1YZGA 2RGAA 3DM5A 4JI7Q 4Q1EA 2DBYA 4QGGA 3BFKA 5KSZA 5D3MA 1XDBA 1MO5A 3K70C 3T35A 8OHMA 2ZETA 2PMZE 1KJWA 4BRUA 5G41A 1VQKA 1ZM2A 4IDHA 4DLVA 2O8DB 3GEEA 3DZDA 4S35A 2FFAA 4ZI2A 4TYYA 3AEVA 4HEJA 2RB4A 3RSLA 3WYFA 4RFSA 5DIFA 2IHBA 4N0EA 4PMWA 2JQOA 1DOAA 1I4LD 2ZJQA 2K5HA 2YWFA 3B1ZA 2VQEQ 1CS4C 4KFRA 1N6NA 1XNQL 3RS5A 1FUUA 4BLTA 4QJ3A 3CPHA 1X3FA 1N0UA 2KBFA 1LF0A 1YVDA 1OXTA 4KI0A 4CW7A 4OX9Q 1II9A 1LTLA 4L5SA 1JJCB 1Z07A 4QGUA 4RJLA 1YJ5A 3DVLA 4O2DA 2AFHE 4FN5A 4G5OA 4YMVA 2CHVA 4LF5Q 2A1AA 2R7FA 5IYDH 2JJ8A 2W0MA 3KTAA 3ZJYC 1O87A 2F52A 1KI6A 2IYYA 521PA 1K3RA 4XWAA 1NN5A 1PVOA 2KHJA 1DPFA 4WZAE 4NHOA 5KPDA 3HKSA 2WICA 4KVAA 2GVAA 2J9RA 1YJ9A 3WXMA 3K9LA 3SS8A 4KAXA 2IHFA 1KZGB 1NIJA 4KSBA 4QJ5A 2R6FA 2ZR7A 3ER0A 1N5LA 1XFAA 2UKDA 4AYBG 1FX0A 1BMFA 1ODFA 3BRWD 4MKHA 1LFDB 3SI7A 5KSYA 1LYLA 1G21E 1NMGA 4WZ6A 3U4QB 2BH8A 1N0WA 2MFIA 1KIMA 2QE7A 4ABYA 4C0JA 3E5HA 3FGNA 4GP6A 1E1OA 2GEUA 1LUZA 1N9WA 1QVFA 1AA9A 1AZSC 1G1MA 1Q1QA 2GEDA 3KXKA 4DB4A 1JXOA 2FF7A 1XXHE 4IJLA 3A36A 2D7CA 4YMSA 3L0OA 2PQAB 4MNOA 1H65A 2P67A 1S40A 1U5KA 4HJ9A 1SVSA 4DLSA 2N1BA 4OYHA 4LW1A 4DB2A 3EPKA 4A3MG 4M9SA 4DUZL 1N0VC 5FL7D 1ESNA 5LMNL 4A3KH 4KV9A 4JZKA 3X2SA 2QU8A 3TUJC 2JASA 1JB1A 2C78A 3R9XA 1OXVA 2XEXA 1CEEA 1QHSA 1K9MC 3TUZC 3GLGB 4A3JG 3K80C 1CKNA 4LWCA 3CCRA 1GWNA 4URUR 1SHZA 1V5WA 2F6RA 4K8OA 4R4OA 4BFZA 4I1SA 4PHGA 4EIWA 2DB3A 3V00A 4DDVA 3KFXA 4YXWA 4A3IG 2ZJAA 3QJYA 5F2EA 2YZ2A 1G5PA 1ZD8A 1UEJA 1ZNWA 5J5CA 3SJZA 1BKBA 4X62Q 5JS8A 2IK8A 4Q1DA 2UU9Q 2GA8A 3TRZA 1IBRA 1XNJA 4MYCA 2VP9A 5C4XH 4JVNA 4LF6Q 2DWOA 5DH9A 1ZMXA 2OCEA 3Q5EA 5LB2A 1G4AE 1Q57A 1MR3F 2V8OA 1G17A 3X1DA 2MSDB 2UXDQ 3KOJA 1GKIA 2HDNB 1KY2A 2GKSA 1UJ2A 4PHHA 3GD7A 1J8YF 2IUSA 3KQLA 3UIEA 4Q4JA 2BCJQ 4TL6A 1NMFA 4A82A 2BMJA 5BR8L 4QG7A 4PAQA 2IWHA 3AYHB 5AJ3Q 3HOYG 3AF3A 2EFCB 3B9PA 3ZYCA 2Y8EA 3BB4A 1G6PA 4M1SA 3HOWG 2JLWA 2HT1A 2FH5B 3IQWA 5IP7H 4A3LH 2CFMA 4LCBA 2J3EA 3KLWA 2B3GA 1ZNYA 2YWEA 1C7YA 1LB1B 3RNLA 3TAHA 1S3OA 1W4BA 1DG1G 3ULJA 4DLZA 2UXCQ 4M9QA 1RJ9A 3PO3H 4LUVA 2ZYTX 4I1UA 5GVRA 1GITA 4POFA 2CJWA 3LWNA 4A0FA 3GLIE 2WKQA 1BBUA 1HZCA 5D3QA 4DCUA 4NPHA 3CONA 2KCTA 2A78A 1VG0B 2WKPA 2UXBQ 1JECA 2OBMA 3FHCB 4TLAA 4ASUA 1D7QA 1W47A 5KSPA 3U6KA 1NBMA 4JBJA 2YOHA 5FUVA 1MABB 3I55A 2FU5C 1T3LA 2E87A 5FL3A 1QG4A 5JI2E 4B3TQ 3A4NA 2EW1A 2Z6KA 3LQQA 3K9NA 2CCJA 4NMMA 3VX4A 4GMXA 4L5QA 1XX6A 1SXJE 4A8JC 1YIJA 1FL0A 4LJ6A 1VMAA 3QNUA 4JI1L 1X8LA 4PHFA 5SZKB 1MOZA 4Q03A 1PH5A 1JR3A 3GDEA 2QENA 2REXB 3K0SA 1OSNA 1GIAA 1R0WA 4CEHB 5GQOA 1MV5A 5CM8B 3QKTA 4UP7A 3B9QA 4M53A 3FKIH 2D4HA 4BLOA 3AF4A 4CT5A 5EXTA 2OLKA 2A2ZA 5BYJA 3PCOB 1N32L 1E2IA 1X56A 3Q8DA 1KI1A 1FJGQ 3D0FA 4RKEA 1K8RA 3CX6A 4MGYR 4PPGA 5EE5B 3EPHA 2QL6A 5JSZB 2KENA 3ASZA 4CEHA 3QPUA 4B32A 3CCLA 4QRHA 4MRRA 5B57C 1Q0UA 3G48A 1Z47A 3REFA 4GN5A 3WBJA 3CF5A 1OYYA 4B48A 3DMNA 1KJZA 5A0FA 1SVKA 4A3GH 2JK8A 4JLOA 4MRNA 1AS0A 1E9EA 1W1WA 1Z6GA 1ZP6A 2NN6I 1UE7A 5IDVA 1UAAA 2ZJZA 1XMOQ 4GI7A 4F4JA 2Q0HA 3BJUA 2ZS8A 4BQSA 3EXAA 3EN2A 3PITA 1IXRA 3M6AA 2WAQE 5SZHB 1QUQA 4P75A 3LBHA 1AM4D 4Q4LA 5C44G 1U9IC 2GCOA 3B1XA 3RABA 1NNEA 2AD5A 1BOFA 1W0JA 2L15A 4GS3A 2C96A 4FXPA 2E5LL 3WP1B 1VQ4A 4HDCA 3IGFA 4A3FG 1E0JA 3IHWA 4X8LA 2OXRA 4JYBA 1WB9A 2EQBA 2O5VA 4RZ3A 4DIEA 4IPDA 2G3YA 4OHZA 1GKUB 1XJVA 1J5EQ 5H1SE 1II8B 3QVVA 4OI2A 5B58C 1XTKA 5HGQA 1Y1WG 3GTOH 3W6OA 1AGPA 2C9OA 3N5CA 3TSZA 2GXQA 1IZ6A 2BEJA 2R93H 1G3IA 3RAPR 4W7SA 4KFSA 1EQRA 2VBCA 4AK9A 3EG5A 1B70B 4ZCIA 3F1ZA 4KLNA 4M9ZA 3K53A 1OJLA 3UMFA 4HIDA 1M2OB 4LFAQ 4IFDJ 2VF8A 2FX3A 4A3CH 2ZYWX 3DOEA 1P8LA 1S0UA 1KI7A 4B76A 4DV4Q 3I2ZA 4FMCB 4C2TA 1ZJ6A 4PX9A 5JEEA 2HXYA 4OHWA 4RG1A 4QKQA 4ACBA 1CTQA 3RN5A 3GTJH 1IBKQ 2I1VB 2PX3A 2WJIA 2GJSA 3FKSA 4DEYA 5E7JA 2K5NA 4X65L 3UDXA 5AJVB 2MSCB 1RRPA 3AGQA 4X64L 5DN6D 5IT9c 2GZAA 1NG1A 3TREA 4EUNA 2HQLA 1DAKA 3FE2A 4KHZA 1WP9A 1X8KA 2YU9H 4NYJQ 4GLAC 4WZBE 4XWKA 3AVTA 3I62A 2FZ4A 5B2ZA 4IRUB 1GOTA 3BFVA 3CRQA 4DNIA 3JC66 4DV2L 1RYFA 1VECA 3CIOA 1J7KA 4HJ8A 4DWJA 5L3RA 4Q18A 3HOVG 1F3OA 2RGDA 4OQXA 5E7IA 2P6UA 2P5SA 3U2QA 1DAGA 2P65A 1DG3A 4JJKA 3E0EA 3PUYA 1Z29A 3X1XA 1VQ9A 4GLXA 2QTFA 5IP9G 4B3CA 2EIFA 4L16A 3CPFA 3OHMA 3BORA 5IK2D 2MO1A 1OIXA 3QQ5A 5F98A 4C7OB 4EQ6B 3HKZG 2ZM6Q 1KNXA 2I3BA 2ORWA 3GTLH 2GJKA 3UDFA 1K83H 1T5IA 2NGRA 3FHWA 2OCYC 3PGZA 3MGCA 2B92A 2ODNA 4R7ZA 3VR2A 4KYUA 4E03A 2N78A 1KOFA 2Q9AA 4FIDA 3FFAA 3BH7A 4DV6Q 4UPAA 2NQ2C 2OG2A 1E2PA 1JNYA 2Z5FA 4HUQA 2R8RA 2H5XA 3EWSA 3T1OA 4EPRA 3BWDD 1OIVA 2QT0A 5IRCD 2O8FB 4C7OA 1KK0A 1P2TA 1E2KA 4UJ3A 1XCMA 4P74A 2VHUA 4EAQA 4V0NA 5DGXA 5DYGA 4M1YA 3CX8A 4JBKA 1EK0A 2GZHA 3HU2A 2JLSA 4WIAA 5FBRB 4NYMR 1NN1A 1UBFA 4MYHA 5JRJA 2A5DA 1PV4A 4MA4A 3ZVRA 4KJZA 3T5GA 4DV0L 4IPCA 1X8JA 3KQKA 2DFTA 5FBWB 1E2NA 1KMQA 1TF5A 4GP7A 4OO1I 3ZDQA 1HR0L 4QQBX 1Z0AA 3J7ZC 3PIOA 1E3MA 2ZE5A 5TB5A 5C4XG 4JYAQ 2O8CB 1VYUA 1RKBA 2QGNA 3LH5A 3OIWA 4HDOB 5FFMA 2KWIA 2GF9A 4V0LA 2IT1A 2YOFA 3NDBB 2IYLD 4Q48A 4ZO4A 1COWA 4BY1H 4LK2A 1TQDA 3EARA 2Q2TA 4X8OA 2WIAA 2LXKA 3HU1A 2W2VA 3C7KA 2NIPA 1SHKA 1JEDA 1GL9B 2OV2A 4YC7A 2PH1A 3ZZUA 2K5UA 3R7WB 4URZR 4RKFA 3ZQJA 3Q72A 2CK3A 1FP7A 1KTVA 1T8TA 4G1UC 5KUTA 1XCGB 4L5TA 5GJCA 4A3LG 2AWNA 5M3FG 2H7VA 2VQFQ 1RFLA 4IOKA 4HDQB 4W5WA 3WMGA 4KHPQ 5HPYB 1FQKA 1S8FA 3T12A 3NEJA 5GADl 4DAYB 2JLZA 4YHHL 4RSGA 3PO3G 2X19A 2F3TA 3M3YH 1DVRA 1N25A 3CCEA 3T1YL 4GKJQ 4JLJA 1KIXA 2Z83A 4XVRA 4Z1MA 3QXHA 1KDPA 3MWJA 3FFBA 4CYMA 3GLIA 3R8CA 5J4VA 2KHIA 5IYBG 1OYWA 3B1YA 1KRTA 4FMCF 4TN1A 3K70B 2ZXUA 1Y1VH 2V6IA 5M5WH 4MITA 2ZRLA 3B1VA 2G9NA 4NXML 1LY1A 2PI2A 2A5YB 4QJFA 1EFCA 3FKQA 2VP2A 5EP3A 4BZXA 5J3BA 2O0KA 3I4NH 2BMEA 3O47A 2D2FA 2DCUA 1HH4A 2QEXA 1UFQA 4PSVA 4D6PA 1SXJA 4DLYA 4X66L 4A93H 5M5YH 3QBVA 3TBKA 2BEKA 4Q19A 4DDUA 3SJAA 3FKIG 5G3YA 2H17A 1T0HB 3VHXA 1WMSA 2JE6I 3I56A 2ZJPA 2ZSAA 2NMVA 3T1HQ 3I4MH 3QF4A 5BWMA 5KNCA 4OK5A 4AKHA 3PEWA 4HAZA 4JYCA 3AVVA 2ASBA 2EWWA 4A4DA 1E7ZA 3LLMA 2ZRDA 1W4AA 4OO1G 1VDZA 1ZM7A 2QY9A 2R7ZH 1GNRA 3KB2A 5DISB 1SVOA 5FTKA 1EG7A 3VQTA 1LW7A 3H0KA 1ZW6A 2Z6KC 4Q7KA 3AVXA 3TE6A 2N49A 1Z06A 1XMIA 2J0SA 1TXYA 2JLVA 3PF4A 3F5FA 3OIYA 2I0QA 2OTLA 2NOAA 1DAHA 2QTVB 4DV7L 4LF7L 3IILA 3M4YA 2SHKA 3GQBA 4FMDB 2ERYA 2DFKB 1PLLA 1XJ0A 2G0TA 1E79D 4NU0A 1IN4A 1NLFA 4R9UC 2RH5A 1QHGA 2ZANA 4BFXA 2NO7A 1SKYB 1KSHA 4W5HA 4MRSA 3AFPA 1J70A 4IVRA 2QQEA 4R2HA 5JJIA 2ZRPA 1HV8A 4WW0A 4IFBA 3ZVLA 4TL9A 1BBWA 3OTOL 1L7VC 3RWMB 2O8BA 3KX2A 4TL7A 1VQ8A 4HAWA 1AZTA 5FUWA 4MKIA 3GTGH 4K0KQ 1P16A 4US1R 4KVGA 4O0MA 1E6CA 2ZYVX 5BW8A 1XMSA 3U7HB 1NF3A 1U0LA 4AQYQ 1IXRC 1L8QA 4H02A 3PUWA 1RIPA 2UUCQ 1M34E 2ZAMA 3M85A 4P3YA 4HAVA 3P32A 3VR6A 4WOPA 1IN8A 3J81c 3WNBA 2A19A 1P75A 3TIFA 2OBLA 4PZ6A 1NSFA 2OZEA 3TGPA 2BOVA 1G20E 2VUMG 1SKQA 3OAAA 1X3GA 2DYKA 3FMIA 1GVPA 4LPKA 2R92G 3ADKA 3P1JA 4LYAA 2QEQA 4EPXA 4PSAA 2YINC 1N6RA 5DYIA 5JBQA 1YR6A 3S1AB 4Q21A 2EYQA 3B1WA 4M1KA 1IYJB 1LVGA 3KKMA 1P2VA 1VQMA 2IX1A 2WSSA 2J0UB 3VKHA 2C9CA 2O52A 2OT3B 4PG3A 1HNWL 121PA 1I94Q 4LF9L 2OWOA 2QM8A 1VHLA 3LV8A 5FPSA 2XGJA 1UKYA 2WOJA 4LBZA 4TQ9A 2CXXA 4PO8A 4YONB 4DHEA 1NVXQ 1G16A 4UNPA 4NCKA 3T06B 4LFBL 1FQJA 3MJRA 4JI6Q 3BE4A 2KB0A 3MLEA 4A3MH 2UUBL 4QGHA 2QPAA 3R9IA 3W8RA 1AK2A 2A8VA 4JBXA 4DAMA 3K0AA 2QMEA 1SN8A 1E32A 4CEJB 4BFSA 2NO9A 6Q21A 2D74A 4ESVA 2V1UA 1MKHA 4QJ4A 4BFUA 4ESHA 2CNWD 4D2IA 2OAQ1 4QXAA 1QZHA 1G41A 1U99A 3GLHA 4ITRC 5DLQC 3OIUA 3EBEA 1M74A 1AKYA 3MWLA 4A3IH 4ZCLA 4NB3A 1G8YA 1U2RA 2B7CA 3STBC 3B85A 3ONWA 2OFXA 2NZHA 3PENA 4TMWA 3THWA 5FOVA 5EE0A 3EPLA 3BU2A 3RLFA 1QHYA 5GAHC 1YU9A 5TMPA 4CDGA 1PH6A 3CLVA 4IFDI 3GFPA 5J4HA 3LD9A 1I4DD 4DLXA 2ZJBA 1O7IA 1JB7A 1X6VA 2QI9C 2DGYA 1FFHA 2DWQA 1DAIA 1K0RA 1PUIA 3PIRA 1CJTC 1D2NA 1KSGA 4TSFD 3CRVA 2N3SA 2NVXH 4O3MA 1ZAKA 4CT4B 1WFQA 1DELA 4EX5A 1TU4A 2ZRJA 2XAUA 1RVDA 3A58B 3PFIA 2HF9A 1Z0JA 3GLGE 2QT1A 3HOYH 1T6NA 2J1LA 4U00A 1AN0A 5CK4A 3F2CA 1E9BA 4TQUS 1JAHA 1N6IA 2FFBA 2VQEL 3HOWH 1GL7A 3K0FA 1G5RA 2R62A 2ZU0C 3AKDA 5M04A 4FMDF 2AMCB 2E1RA 1OFUX 3S16H 2OTJA 2MMCA 4IEIA 5DI3B 3RHFA 3Q7PA 1AS3A 1VG1A 2HF8A 2XX3A 4C0LA 4L5RC 1FVIA 4P4SB 1W36D 5GAEC 3U5ZB 4PO9A 5BN4A 2JA6G 1KL9A 1Z0KA 3Q85A 4QFMA 3WY9A 2F1HA 5JWOA 4AY2A 4XWOA 1BVSA 2Q2IA 3ICEA 4LF5L 1TADA 3H3VH 2F9LA 2GRJA 3NHAA 2JEAI 4QGAA 3SDZA 3SYNA 4B74A 1KO7A 5JZVA 1P5ZB 3SC3A 1D6JA 2J7PD 1UEBA 1QHHA 1VPLA 3B60A 1LV7A 2TMKA 1P2UA 1TUEA 3LRPA 4XD7D 5FPHA 3HOZH 3TW8B 3RZOH 2GETA 3TNFA 3PR1A 1ZINA 1KO8A 2GXUA 1TF7A 5LMUQ 2QN6A 4LJ5A 3C5HA 5FBLB 4DT1A 2BBTA 3SFZA 1K6MA 3K9HA 4DZZA 1EYGA 1NLZA 3QY0A 4B3DA 1C4OA 3ZIAA 4HLQB 3WRXC 1O3YA 5JFGA 2O0JA 2QMOA 3PSIA 1WQ1R 3VR3A 1N33L 1MO4A 4J0QA 2FDCA 1OW3B 4RD2A 3W6PA 4OWTB 3VR4A 2RGNA 3CRW1 1XD2A 2KE5A 4C0BA 4AYBE 4U7DA 4HB4A 3SE0A 2J41A 4C3JH 4R98A 4D26A 1HH2P 3ZD6A 4DSNA 1QHNA 1Y1VG 1C9OA 1OT3A 3U3MA 3B7GA 1US8B 4IFDG 2IUUA 1KDTA 1KK1A 1VQPA 1IBML 1NVVR 2PCJA 3L0IB 2FV8A 3CH5A 3BK7A 4TTPA 4B44A 4IOLA 3EIQA 3MFYA 2G1KA 2BV3A 1F2TA 4Q9LA 4BBSG 1P9RA 1A2KC 2RKOA 3GJ6A 3IKJA 2BIFA 4R71A 5FR1A 4A3BH 1W5SA 3L7ZC 4OJQA 1OXSC 4W5JA 5FOTA 2JLQA 4JLMA 3IEVA 5C44H 5F9HA 4L9SA 1D5CA 5HE8A 2UU9L 4RD1A 1RE0A 2BM1A 2YTXA 4LF6L 1W7AA 4DR3L 4JI5Q 4R4CA 1OHHD 1HT1E 4B3BA 2IX0A 3EZFA 4A3FH 4C3HH 1NE3A 3KFUA 4B3RQ 1QZGA 2ZROA 3SYKA 4G3XA 5FPKA 4C2UA 3EASA 3AVQA 3RC3A 4RFSB 2A30A 4LBYA 3OEHA 4XH9B 1YEZA 3BS4A 4A0HA 1EFRD 4DCTA 3QUSA 2GXAA 1SXJC 1Y1WH 2GF0A 2HLDA 3RN2A 3O8RA 1HA3A 3NH6A 3CAMA 1CIPA 4YY3Q 1U98A 2FPLA 2QG6A 2CLCX 2L0XA 1A7JA 4DR1Q 1XMVA 4QY7A 4URWR 5M5XH 1VYTA 2P6RA 2GHIA 1G8PA 2MMGA 1CKEA 4UXIA 3Q3JB 3D7MA 1CF4A 2ZRMA 2C04A 4GKKL 3AH8A 3LW8A 4L5BA 4P0TA 2EFEB 2P3SA 3KTAB 1XEWY 1RL2A 4WXPA 2ZI7A 1BYIA 3QXJA 3UDGA 5GROA 2ONJA 1KI6B 2C77A 4URVR 3GEHA 3K09A 5HKKD 1AS2A 2GBLA 5DN6A 1NIPA 2ANCA 4NL4H 5EP4A 2B7BA 1R9TH 3CF2A 3NWJA 4ON9A 4TWZA 4A6PA 4URXR 4IOCA 4FMBB 1FX0B 2QROA 4Y7NH 3GJXC 1WOCA 1R10A 1E2GA 2RGXA 1R7RA 3O8DA 4RZUA 3SBDA 3X1WA 2WWYA 3MCAA 4A9AA 5ELXA 5CM9C 4BLSA 1X54A 3T1TA 2CE2X 1E0AA 4HIKA 3RNUA 3F0TA 1MKYA 1U8YA 3F2DA 4APVA 4RMFA 4Q5IA 2D2EA 4DCVA 3HOVH 2V4ZA 4OQMA 4F92B 2OILA 5LPNA 4DR2Q 1ZCAA 5IK2A 3DL0A 5FOSA 2IHYA 3SOPA 5IP9H 4B6EA 2WMOB 5CYPA 1WCMH 1QVAA 4GBMA 4LZZA 2IYRA 1NP6A 3TJZA 3CNNA 4UKDA 3MRSA 3H3VI 3KKNA 4JCVE 1Z28A 2OCAA 5JCPA 2F4VL 3KQUA 1J6QA 2VP4A 3PUXA 3CRMA 2ZRFA 3THXA 4ZDKA 4ARZA 2FSHA 2H57A 4JL5A 1CKNB 3R8FA 4LYFA 2GJ9A 3J81i 3V4RA 2XXAA 1ESMA 4XVUA 1J90A 4AIIA 2HCBA 3QSYA 4UP9A 1T4GA 4A1FA 2CDNA 2O8EA 4XVQA 3LGJA 3RWOA 4IDNA 1TF2A 4HLDA 2OSBA 4X6AH 1VG8A 1XMOL 2CL6X 4LOAA 2NG1A 3CCQA 2IBMA 2VSFA 4NYIQ 3BERA 4TMVA 3VNVA 1AJEA 5JRZA 2IY5B 3C16C 2XTNA 1I50H 1NG9A 3S24A 4I1VA 2B8TA 1ZU4A 1E2JA 1FNMA 1YNXA 2I5HA 1KD1C 3CF0A 1A5TA 3OFND 4UNQA 3CX7A 2IL1A 2YVUA 5AR1A 3I73A 1T91A 3KKQA 3WHLA 4Q4JB 1Q20A 2XZOA 1I3QH 4ZDIA 4JG2A 1W49A 2J7KA 4DEXA 3B6YA 2B6HA 5IY0A 3U58A 2GJAA 3KDSE 4HAXA 1EX6A 1M7GA 5IYCG 1S2MA 1K8AC 3HOUH 4DIDA 2NO0A 3U44A 3IDQA 1M90C 2VHTA 1IBLL 1EFUA 1ZRHA 1R6BX 2WSMA 1G64A 4PO1A 2X2FA 3EW9A 1OB2A 2ZTSA 4QBIA 4IOJA 2CKZB 1N5JA 1VQNA 1WF3A 2WKRA 4A6XA 5L3QB 3QENA 4GDFA 1TNDA 1RJ9B 1S4QA 4M1WA 4MRPA 3U3RA 2IYUA 3AF0A 4V0MA 4B3FX 4XJXA 1W0KD 2CJWB 2HYIC 4BWYA 1HJPA 4YLGA 3O8BA 4LFAL 3NIBA 2JJ1D 1OH5A 2BKEA 4ZIRA 5C4GB 4R4TA 4GZMA 3K81C 2AR7A 3TMKA 5M3FH 4DV4L 4Q4HA 2Z43A 1Q1EA 4PZ8A 5H68A 4R1JA 3ZD7A 5L3QA 2QQ0A 3KF8B 2Z6VA 3D3QA 2WJYA 4QHTA 2YC4C 2VP6A 4PAOA 4IDQA 2ERXA 1XP8A 3AVPA 1G19A 4URYR 4H9GA 5TV2A 4CGZA 3JZAA 4POGA 1TQ6A 1UEIA 1WE2A 2QAJA 1OFTA 3IQXA 1KAOA 5IYBH 1R0XA 2WAYA 3FWYA 3E9HA 2ZR0A 3FVQA 5FTLA 5FLXc 2PL3A 4LF4L 3CC7A 2RGCA 1CJKC 1E22A 2ZI6A 3HOZG 2ID0A 2AHOA 1B23P 1OXXK 2VY3A 2GN5A 4HUTA 2VEDA 1NN3A 4K81B 4AG5A 1OLOA 1XJCA 2YNMA 4B75A 3KXIA 1Z2AA 2I5MX 1GFIA 5FOWA 1CJMA 1NL3A 2CQOA 1TU3A 1FPMA 2I1QA 4KYIB 2ZM6L 3L2PA 3REGA 2ZPTX 3GTKH 1A2BA 4D0NA 1SROA 4RZ2A 2XZPA 3J7A5 1BIFA 3EWAA 3QF7A 1HYQA 4LY6A 5J47A 3D31A 2WWFA 1B0UA 5KU1A 4DV6L 5IHPA 1FW6A 3KDFA 3HKZE 4IVPA 4TMTA 3CPEA 5FPTA 4BA1I 1GNQA 3W6NA 4B73A 1QUQB 2CEAA 3MSXA 2XNDD 3MUFA 1A0IA 1VIYA 2C35B 1VQAA 4IJMA 2G83A 4KLKA 5IWAL 1P7CA 2GCOB 4IHQA 5FPYA 4QBGB 4NXNQ 2ZJYA 1N3BA 1GNPA 1Q8KA 2FSGA 4HLUA 1OKKD 1E79A 2IYVA 3TUIC 1X6OA 3CRRA 1IY1A 2ZSDA 2BBWA 2ZVQX 3BIFA 4KFTA 4RD0A 2IUTA 1CRQA 1YR8A 4TYWA 1ZIOA 4B2PA 4A3BG 1XB2A 4HI0E 4Z54A 2QAGA 4HYYA 3R9WA 1N34Q 2RGNC 4XTRA 2QRZA 3EZ9A 4HZIA 2EYUA 4TT3D 5GJVC 3UWOA 4JYAL 4GNXA 2DFLA 1E9DA 3THYA 1TWFH 1XNRQ 1U81A 2RHDA 2V6JA 4DSUA 5JMTA 3QPVA 4US2R 2K5VA 4Q02A 4P31A 1GDDA 1YZ6A 2PT5A 4GSYA 3GPLA 4AI6A 3LVRE 5GJWC 4DUZQ 2OFOA 4LUOA 5TARA 3VU9A 3K0CA 3TEHB 1CJVC 1LS1A 1RW4A 5M3MG 1J99A 1NJIC 1E2EA 1E4VA 2AKWB 1Q3TA 2GILA 4A4IA 4JI8L 4JV5Q 1IONA 3I8XA 4BPBA 3CCMA 1T5LA 1TWGH 3LX5A 3BZKA 1XMQL 1VCIA 2KCMA 4JL6A 1ZM4A 2FGJA 1E1TA 4DR7Q 3W90A 4YWLA 4KBGA 2YYZA 3HOXG 1FGUA 2ZRAA 4JLVA 1ASZA 2IX3A 1TMKA 3RDPA 2QGQA 1IJEA 2IEYA 5LDDC 2R7DA 2VQFL 1U94A 2ZE6A 4YWKA 4QL3A 1CXZA 1NJGA 4U5XA 5J40A 1YR7A 2WWGA 1SKYE 1X3EA 2VUMH 2IYSA 4HZUA 4M8NE 4DSTA 3AFQA 2BCGY 2R92H 5KO2A 1Z83A 4GKJL 4GT1A 3EX7C 2CHQA 2WWHA 2X1VA 2ZJRA 2C99A 4OBEA 4MUAA 3UATA 1I6HH 1VQOA 1F2UA 3UKDA 1GP2A 3SR0A 4A2WA 4BFVA 1QVCA 1E1QA 1XTDA 3IIKA 1GILA 1GVNB 3B82A 4LRWA 4YCUA 3U7GA 3WRYC 2RHMA 1DO2A 3C15C 4TLCA 1KNQA 2ZRCA 4ZV4A 1Z8FA 2FA9A 1TTTA 2JEBI 1MJCA 1VYVA 2J46A 3SHWA 3RS3A 5TY0A 3PEYA 4CZ2A 4D4KA 5C1BA 3S2HH 2ZUBA 1IN5A 3UK6A 2JIZA 2GK7A 2CNWA 4IXNA 1XF9A 2DHRA 1KAWA 4BY7H 2BWJA 4HUQB 4N0DA 3MMPA 3ADBA 1LNZA 3U3OA 4TZ6A 3G6EA 3T1HL 2IF0A 2ZQ5A 3T34A 1WCMG 1ZUNB 2QA5A 2VQSA 3K09C 2GBLC 1YJNA 4EFMA 3A5ZB 3PEUA 3X1YA 1E24A 4B33A 2YV5A 4ZKDA 1QF9A 4G01B 4EPVA 1YITA 3SJCA 2WJVA 3CQZH 1G7TA 3I5YA 3GLFE 3DEFA 2QSZA 2V1XA 3SN6A 1HT2E 3ERSX 3M0EA 4NYMQ 4DLTA 3W9YA 1XXHA 1VG9B 1HQCA 5E95A 3UXMA 3K9GA 3NBXX 4D82A 2A3RA 2Y0SG 3DHWC 5HCIA 4JI1Q 1N36L 4TSFA 4XTCS 1OPXA 3I72A 3GMTA 1CLUA 1FZQA 1XTRA 2WBLC 4KITB 1IY0A 3P20A 1JEEA 5FOXA 1GRRA 5C0XG 1XEXA 4PSKA 4DDTA 5FH9A 1BMFD 5ELNA 4HJAA 1HY3A 3U3JA 2ZVPX 3DPUA 1N32Q 2YOGA 2VO1A 4E5UA 5DHFA 4DR4Q 3K1JA 1UBEA 2I4IA 2ZRBA 1SVLA 4P73A 4G5GA 4HB3A 4MKFA 2ZRGA 2Q2HA 4BUJA 1FUKA 3KUDA 3U61B 2BJWA 4QOSA 2OQ0A 3RR5A 4WJ3M 3AVUA 3AQ4A 3H86A 4PFSA 1Z9FA 2VYFA 2OXCA 1QVRA 2W83A 2KSQA 3CBQA 3LQRA 1ZIPA 4YMWA 1AH9A 1PZNA 2VSOA 5CJPA 1CR4A 5EQTA 1GAJA 4QC2A 4MYTA 3W5IA 4ZPXA 2IS4A 3HOUG 1A63A 4OK6A 2JA7H 2JA6H 4H1UA 3SBEA 2OFWA 2W0SA 5BN5A 4UP8A 2J7PA 2IYZA 2KBEA 4JKYA 1BS1A 4RD3A 4AQYL 4MQBA 5FI0B 1W44A 2OCBA 4UXHA 1T8UA 4XD7A 2UUCL 2PBRA 4KFUA 4MRVA 4TL8A 1Z63A 3ETLA 3DKVA 1PH7A 2WJGA 2QPOA 3L0SA 2ATWA 3MAAC 4BFYA 5K8UA 3ECCA 4YXWD 5UKDA 3GLIB 3TH5A 2GDJA 1YZLA 2AK3A 4JIMA 3QKUA 4F4IA 2E5LQ 3ADCA 1YRBA 3MXNB 1YHNA 2ANBA 4UNNA 3DKPA 2WZQA 2REOA 2WPDD 3QEJA 5FTJA 2RGGA 4GOXA 4D4MA 4PC3A 2UUAQ 1E99A 1WCV1 1NY6A 5K8IA 1I94L 1VTKA 3KXLA 3RANA 1X1SA 3ZVMA 3TVDA 3AUYA 1W2GA 1SXJB 4DKAC 3LFUA 1XPRA 3SHFA 1YQTA 1NKTA 1RRGA 2JLUA 1HNZQ 1MO3A 4NDZA 1R2QA 2H1LA 5KTYA 3GJ4A 4JI6L 4JLKA 1UE5A 1QRAA 4JT4A 4P4TA 3QIAA 1D2MA 3QF4B 5AUQA 2E9SA 3IIMA 3C5CA 5J4YA 3ZVNA 2YKGA 2CBZA 5IE8A 4OJKA 3QBTA 2K52A 4NP6A 1Y14B 5CIWA 3TKLA 1KZ7B 4B3GA 1E9AA 2CLDX 4BBSH 4D25A 5TXGA 4LX0A 2PX0A 4A2PA 4DBLC 1G9XA 5AWFC 3CPJB 3TR0A 5HZHA 4LJ8A 1BYUA 3OE7D 1XD9A 3G82C 1OXUA 4ASUD 2FSFA 2RGEA 4DJTA 3K7AH 1DARA 1QHXA 1BO6A 4JLNA 4CVNA 5CDFE 1SLJA 3CP0A 1PFSA 3Q7QA 3H84A 3LXXA 1A1VA 3KJPA 5KSOA 2J59A 2OUKA 3L82B 3A4LA 3JAMi 1EFRA 4DV2Q 4DUYQ 2QRNA 4YQFA 2F7SA 4Q01A 2WP8J 4YDSA 2VZAA 2V54A 3EZ6A 3LA6A 3KJGA 4AYTA 1DBSA 4DLUA 3B6EA 2VW9A 4PQFA 4B2IA 1M7HA 5CITA 3KKPA 2O8BB 4R4QA 2B8WA 2ZE8A 4QM7A 4LV8B 4EDHA 4PAMA 1XPUA 1Q22A 1N6KA 5HY6A 3DLLA 2R9VA 4D4LA 5FUYA 3MJHA 3Q9LA 5H8WA 3T1VA 2QUZA 1DAEA 5E3HA 5F9FA 4UXJA 5ANRB 2WIBA 3A5UA 4TLEA 5HKKA 1RRFA 2K75A 1EIYB 1EIFA 3HWSA 3VKGA 1BKDR 1C9KA 1VIAA 5EXPA 1E98A 4JL8A 1EOVA 3S14H 1DTSA 3RZDH 1SZPA 2XOKD 5DI9A 2ODEA 3RSOA 5FTNA 2JLXA 4XSHA 4OK3A 1YZUA 2FGKA 4AURA 4HLUC 2J87A 3S2DH 1Z08A 3A37A 1F60A 3UG6A 1OV4A 1E1RD 5KOYA 4IDOA 1E2FA 4US0R 3EIEA 2F1JA 1OTCA 4L4UA 1NBWA 2JA5H 1Z0DA 3M4OH 1FL9A 1FOEB 1TWCH 1KSJA 4F93B 1G8GA 2EFHB 1VQJA 2CMKA 2QAGC 5LMUL 4B3MQ 2FNAA 5LD2C 2ZAOA 1VQ7A 2NPIA 3NBYC 4GNXC 4LGMA 1EUJA 2PLFA 1CU1A 1I2MA 1YZQA 1ZD9A 3U7EB 3OEED 5BN3A 4PXAA 4C0QC 2I5LX 3U50C 2P0EA 3LBIA 4AKEA 3CW2A 1CSPA 4ZKEA 4ZCMA 3K0EA 3K0CC 5FLMG 4B71A 3K0AB 2A5FA 2FPMA 3OIVA 2QMHA 1W2HA 2R6GA 2Q3FA 4PC6A 2AK2A 2PZFA 1Q82C 3KJEA 5C4JH 4WVFA 4LV6A 4TVAB
chains in the Genus database with same CATH superfamily
4L5CA 3PXGA 3R3UA 4BEBA 2VTBA 1USIA 4UTNA 1LDYA 3HYCA 3OO1A 4LWOA 3U48A 3NDPA 4C3IH 1T26A 4KXLA 1R9JA 1BO0A 4FEGA 1QVZA 3KL4A 3CF6R 1IEWA 3PQ3A 1PX2A 4IN3A 4PNYA 1T3SA 1SVIA 2H7YA 4UFNA 5BN4B 4JLAA 3SQMA 3HI6A 4PYKA 3MXPA 2XNCA 4OQLA 4QJBA 4ALJA 4EF6A 3PC8A 4DT1B 1QFMA 4EW1A 3HJNA 4JLSA 5LYJB 1PJSA 3PUVA 1ZWLA 1SM4A 4DY6A 1YVCA 2DR3A 3U9LA 3IAFA 4HATA 4GI5A 4HGQA 4FW9A 3HABA 4COOA 1Y8NB 1BEZA 2UXDB 1XHFA 4INAA 3T5TA 2P5ZX 3EJWA 4M8AA 1GZ3A 4RHUA 1G8HA 4EAAA 3QKRA 1ZXBA 1UXJA 3OJLA 1QXSA 2PD3A 3QA9A 1KC8C 3GJ3A 3VDMA 4GZYC 2GAAA 1NI5A 1BKYA 3EVTA 3QXXA 1N9GA 4PSCA 1E69A 1TS2A 3I92A 1YDGA 4U7PB 1M1YB 1WW2A 2X77A 5AJ3L 3PO2H 3OJOA 1DO0A 4RM2A 2WM8A 2G09A 4S1VA 2XITA 1QDEA 1D2AA 3HO6A 1GLVA 4TTRA 4BAUA 1K7SN 1P61B 5IAJA 3X1ZA 5I5GA 3EIUA 2OXTA 1UMBA 4KLRA 2PWYA 4MDEA 3I0MA 1E5TA 2VNHA 1M33A 4F97A 1VQHA 3UT5A 4RU1A 2Q6TA 5LYJF 4PM4A 1X1TA 1T8YA 3N6XA 5JARA 1DUIA 1UKEA 2PT6A 1P5HA 3LPAA 1L6IA 3SZOA 2QZSA 3M5PA 4TYNA 5IBRA 4UPVA 1CY4A 4CIYA 3EN0A 1MT0A 4RF4A 3BJEA 4XJSA 4ZZ0A 3T7RA 2RMKA 4OMDA 4IIJB 2VWPA 1P80A 1PZJD 4GVXA 2SCUB 4RXTA 4HRAA 3B5EA 5HCUA 5BR4A 5JC1A 1FJXA 2VHXA 3LSTA 4HN2A 2XF8A 3RLNA 3DOUA 2P6MA 5A5GA 2D3WA 2IQ5A 3HB0A 4ZI7B 2PS9A 5A2QE 3D4DA 4BMSA 5JJBA 3E9RA 1HUQA 4MJLA 2OGSA 3PR3A 4GVPA 2JZNA 3EWNA 3KTFA 1BC5A 2FWBA 5JPNC 3L0BA 2YJ4A 5LZ5A 2G04A 4XGNA 1DT5A 1G7CA 4MS1A 3SXUB 1KIFA 1NHGA 1FNSA 9ABPA 4BNVA 2HYDA 2H2WA 1AUQA 1PW7A 5LD2B 3D3WB 2Z6UA 1PK7A 1TCVA 4PLVA 1Y3IA 3HVHA 5DXFA 4D9NA 4DR4L 3ND8A 5ERGB 3HU3A 4BN4A 4FOTA 3VDRA 3GJ8A 5GGXA 2XOKA 1NVAA 3JYPA 1Z35A 5JSZA 2HCIA 3K7UC 5AW7A 4XLTA 1JVSA 4IIJF 1CR0A 4YNBA 1W75A 1H8HD 1RPTA 3OMWA 4HFNA 5KNBD 4IIFA 2VXWA 4DRZA 5BO5A 2CV2A 2CVPA 1HYGA 1TEXA 2CLLB 1SNPA 1V11A 4NFHA 4K28A 1B6RA 2B29A 3I2FA 4ZI7F 3FWZA 4LZAA 3K2EA 3A9WA 2AJBA 2WV7A 4ABTA 1T9CA 3CM0A 2M6RA 3AKCA 2ZUSA 4BTEA 5KDOA 3G17A 4CM4B 1XZGA 2ZQYA 4RFVA 2CXSA 4TYPA 1YJXA 4D46A 2QVYX 4IWNA 4A92A 3HFZB 1ZR2A 1AQIA 4A5SA 1SGWA 4N0QA 3FPKA 4HDAA 3OIFA 2RBEA 1Q1GA 2Q62A 4EQ6A 2Q1TA 4O25A 3SGLA 4O4HB 4E70A 4R8VA 1L8OA 3CT4A 1G51A 5F2KA 2WSYB 3VNQA 5ESDA 1C3JA 1T1GA 1DTWA 3RC8A 5A5EA 4IJHA 4RD6A 1XQWA 4N65A 3KAQA 2XQVA 5LSAA 1L4UA 1G5IA 4KIWA 2CUTA 4OI1A 4AG3A 4MTNA 2XWBB 5IW8A 3CC2A 1ISMA 4OH7A 4YJGA 1JR4A 2OBYA 5TDHA 1A82A 5ALNA 3A6EA 4G0PA 1HMPA 1BH2A 4I4CA 1E62A 2VSQA 3KKOA 2O7SA 4GGMX 3GK3A 5K4AA 5G1PA 5IYZB 1B7YB 4MTLA 1YDMA 1Z2OX 1EWQA 2GA4B 4YH1A 4BO8A 5MFZA 2A6HD 2HCFA 1SKAA 3EXFB 4IG4A 1ENZA 2RAPA 3NTXA 4POAA 4PR0A 2BKLA 4MUJA 3F2BA 2C8JA 1V5EA 3P0JA 1AQNA 3GVHA 3KQSA 5I7FA 4I7AA 3I8ZA 1P62B 5FWYA 4B3HA 3CR7A 3OC0A 2QZPA 1MJEA 1XZPA 4ER6A 4B3RB 2H9YA 2OKCA 1CQPA 3KM0A 1M7BA 1HNNA 1GXSB 1CRWG 4YY3B 4UW9A 2VHJA 3ND9A 2XWBF 4NEHB 1Q86C 5KYWA 1Z17A 1U3TA 3GLFB 4WBSA 4OQNA 4RTOA 4P7JA 1XSEA 1U8ZA 2R7LA 2P2NA 2VNAA 4QD3A 3CB2A 2H8KA 1KGSA 2KLBA 4X66Q 4JI3L 1X70A 1VF5C 2YZKA 2PT9A 4XGKA 4LYHA 1EBBA 5IYZF 2J6IA 4CDDC 4KTAA 4RVUA 4NU6A 4PQRA 4FZJA 4TMKA 3DE1X 2IITA 1EHCA 3DBHA 4HRYA 3L84A 3P0FA 3EDCA 1DGSA 1ZNZA 3JAWA 5L8VA 2F55A 4LHWA 3BBPA 2HEGA 1UJMA 4AO8A 1YZTA 3IR7A 3WGYA 1N3IA 5I7SA 4RK1A 3KAJA 4EKYA 1ZAYA 2Z1MA 1BWRA 5J3JA 4C7MA 1C3XA 3VYRA 4QOIA 4Z8XA 5AVSA 1AQLA 2Y77A 4A0GA 2ADOA 1IJBA 1AUPA 4Y6SA 3ZNOA 2B39A 2NX2A 4JUIA 3EQLC 3JX9A 4FQ7A 3UAXA 1SFOH 3ITPA 1ZD3A 1LI4A 2CCZA 1ZPDA 1T2CA 1U3VA 1SXJD 4BJHB 1Q74A 4K6CA 2GPSA 5EP2A 1K75A 2VDQB 2QVBA 4G5SA 3L8FA 3ISVA 2HT6A 4YUVA 2H7XA 2HJGA 2HNKA 3DEZA 3EPRA 3ULLA 1ECJA 4JI7Q 1BXZA 5D3MA 4ZXPA 4ZI2A 3TRJA 1L4BA 4BQQA 4S1OA 2V4DA 4C4TA 3WIEA 3RS5A 4QJ3A 4CCYB 1ABBA 1X3FA 2W42A 1DQPA 3HZRA 4HPJB 4J8QA 3KTOA 2JJ8A 3DBLB 5E6RB 4WZAE 3QUTA 3V4SA 1SCQA 2YN2A 3WXMA 1IWOA 5TEVA 1CY0A 3A9UA 1V1RB 1H4TA 5AXDA 4I3HA 4U9IS 4OHCA 1BHQ1 1QGED 1EDOA 3C4VA 1WUJS 1BN7A 1SQ6A 4YMSA 2PQAB 5CFOA 3WMWA 4DB2A 3O5AA 4KO3S 1D07A 4HDKA 4G7ZC 3X2SA 3TUJC 1JHQA 3TUZC 2Z5VA 1V5WA 4BFZA 4I1SA 4NICA 2ZJ7A 1OR8A 5BMOA 1IYZA 1M1NA 4Q1DA 4EHIA 2BSQA 3E2MA 3FEWX 1V8FA 3LQ4A 5FT9A 2O1WA 3CU5A 3PJEA 2HU7A 3KQLA 3S2DB 2W2OA 3UJBA 2QMZA 4PAQA 2YFYA 5LXTA 1G38A 3M4OB 3MEHA 3ZWBA 2B82A 3BVZA 2FH5B 5KYNA 5KTNA 3Q6SA 2YWEA 3A2LA 4OSPA 1T5XD 1P77A 2AJLI 4ZEXA 4B08A 3KAKA 2EHDA 1NBMA 2ISSD 4B3TQ 4OHKA 2EW1A 3TBHA 5DM1A 4E1VA 3GGSA 4JEIA 3L9AX 2WFLB 2OLKA 5G2OA 5HM6A 1KI1A 3QELB 4N3BA 2E6UX 1AY0A 3RVPA 3EZNA 4R83A 3KUXA 2NTTA 3D8HA 3DMNA 1FLNA 1YZVA 4XYOA 2BT4A 4P75A 3RABA 1W2WB 3UXHA 5A5FA 4ND8B 3ZX4A 4GS3A 4D8VA 2E5LL 3R7FA 3BXGA 4D3YA 2Z8XA 1O5TA 2EQBA 2A14A 2YYSA 1E6EA 3T3OA 1II8B 2VAPA 1QGDA 4HNHA 5T64A 3AUAA 3NIGB 1D4OA 1YE5A 3IP3A 3KSAC 1S6YA 3O83A 4MQ5A 1BE6A 1WIWA 4B6OA 5FNZA 1QIDA 2FWAA 1NG1A 2E7ZA 2G7MC 2ZBPA 1GTL1 3IEIA 1HUMA 4D56A 3I5AA 4WZAA 2RGDA 3S40A 3M81A 5IP9G 3CPFA 1KNXA 5AXBA 3O84A 4GI3A 4RK0A 3I28A 2P27A 2N78A 1I3MA 5A9SB 3VPAA 4N3CA 2Q8QA 1WHTA 3BH7A 4KN4C 4K5QA 4C3HB 3D0KA 5B3KA 3A3YA 2B0JA 3VKFA 2GZHA 1DAPA 5FBRB 1B41A 4PRYA 1Y6FA 2P0YA 1DM0B 4KX5A 5B7GA 4FFOA 5CFMA 4KQKA 3TLMA 3LH5A 5E2AA 3BF8A 4DNPA 3LWBA 2I6FA 2LXKA 3LC1O 3D2CA 3HUEA 1X77A 1NMQA 2CK3A 2PZJA 1PWXA 3MXOA 4UHDA 3IB3A 3T1YL 2BHTA 4HGNA 1KIXA 4D3SA 4PQGA 1KDPA 4G4GA 3FCXA 1D5WA 3A70A 5ELCA 1Y1VH 1QU2A 1T9DA 2O9JA 2JRLA 2OF1A 2XLCA 3WLNA 1F3LA 1I50B 5AW4A 4CLRB 4OO1G 2VDUE 3Q3CA 4OATA 1ZW6A 2NP6A 3PHLA 2JLVA 5CDUA 2JLAA 3M6LA 1RP7A 2C7OA 4B3SB 1JKXA 2DFKB 1KL7A 3X3HA 3F6BX 4HBGA 5KJCA 3A0RB 3UGJA 3IMFA 1SAYA 4HQ0A 3TSYA 1AZWA 1DKQA 5B1HA 2F1KA 1P16A 2W37A 1S89A 3E9YA 2BFOA 4JBGA 4L4XA 2M9VA 3HCFA 4H02A 2JPDA 1QILA 4NE7A 3QFTA 3J81c 5JNSA 3BGOS 1B8VA 2DYKA 3MSCA 1HPLA 4PIVA 1SKBA 3FLBA 4M0PA 1IYJB 3NV9A 4LF9L 1KDBA 1ZJ5A 2K32A 1C0PA 4IVNA 4LFBL 1TVXA 4X3UA 1L5GB 1AK2A 3JQCA 3V8VA 1KYQA 2D74A 1AKQA 1CLEA 4LW8A 5LL6S 3Q5GA 2VDPB 3C74A 2E49A 3ONWA 1W85A 5H4GA 1JB7A 1ODJA 5ALMA 1A9OA 2AQ8A 5CK4A 4GWKA 2VQEL 1A5AB 4FT4A 4GS5A 2IGBA 3OA2A 2XX3A 4MV5A 4AJLA 3AK4A 4J7AA 4KI7A 4XWOA 4ZWNA 3A0UA 1QH8A 1BKSB 3PQEA 3S2YA 3UJPA 1GU0A 5LBUA 5FBLB 3BM5A 5JFGA 4BY7B 1N33L 4ZAFA 2YFHA 3DVRX 1FUYB 1OT3A 3KT0A 4DV5B 1KDTA 3HWX1 5KVCA 2XDWA 2JK1A 4MO2A 4QWMA 2GN9A 5TPWB 1TEHA 2FEKA 3QOXA 1RE0A 1WF6A 1DP4A 4Z53A 1O03A 3DV9A 3LUBA 1F8GA 2VDLB 2Q1YA 3GWZA 5IXYA 4Q3KA 2XQJA 1CZRA 1Y1WH 5A3RA 3WLMA 2CXHA 1HA3A 3NH6A 5IS2A 4RNCA 1CIPA 4ZU3A 4JB3A 2IL8A 1CKEA 4NV0A 4CETA 4AKSA 2P3SA 3QXJA 1KI6B 4OSOA 4URVR 1PJLA 1EY7A 5CB4A 4UUQA 2QTTA 2AJ8A 3IUEA 3O0TA 1UDRA 3AI3A 1RZUA 5A6SA 5AOCA 4F92B 3MQ2A 1IBSA 3H1GA 2OLEA 4LECA 1FTQA 5B37A 3H8JA 3FPBA 3KQUA 2VJNA 2FSSA 4ZDKA 4JL5A 3TB6A 1Q6YA 1JICA 2CDNA 1DQNA 1CYDA 5AI5A 2LP4Y 4D45A 1I01A 3ZU6A 2TS1A 2PUTA 5KEIA 1L1FA 3BKXA 1Q0QA 4ETMA 2WA2A 3IKTA 4L78A 5E3JA 4EX7A 4HAXA 2FAXA 2YXNA 2CB0A 4P34A 1XGKA 3PRJA 4B6GA 1MGOA 4V0MA 3ZJTA 3G8DA 4GZMA 2AR7A 3HYNA 2VAVA 2XUFA 5DZSA 3PJGA 1HEUA 4UU0A 2F8MA 1G19A 4BB0A 1TQ6A 3OSUA 2X8WA 5FTLA 3QMPA 4YUYA 5KB3A 3TLGB 4KYIB 3QWFA 1H85A 2ZM6L 4Y2TA 1QTQA 3B6KA 4FKMA 3ZWCA 1KQNA 4C3IB 4IJMA 3CZ4A 1TUBB 3GPCA 2G83A 3S29A 1RYMA 3PQ7A 1P0QA 1WMEA 3P2YA 3OTGA 4U5QA 5E3IA 2QHXA 1WCWA 3W5UA 4HZIA 3GBSA 3R0QA 5GJVC 4FNFA 1E9DA 3Q12A 5E4WC 1PFYA 2AV6A 1UXIA 1PR2A 4KRYA 3TQQA 1QIKA 3CCMA 3BZKA 13PKA 4EENA 4YRNA 3RUPA 1ZM4A 4YWLA 2A9RA 3TOVA 1NJGA 3GYGA 3L7JA 3N2YA 3QFCA 2VUMH 1E58A 3GLKA 1VMPA 3EX7C 2B8GA 3V8MA 3FD8A 1VQOA 4MIUA 3Q7EA 2MSWA 1P31A 3WGJA 4ARSA 1FNCA 1PV1A 3UAZA 5H83A 5C1BA 4HQKA 3V96A 4GBJA 4CLOB 4JUCA 2JB9A 1HT2E 1HQCA 4CKWA 5HCIA 4TSFA 5EOVA 5KNBH 4MICA 2PO4A 1IY0A 3P20A 3GBPA 4KQXA 1H9KA 5ELNA 4HJAA 1CQJA 2ZVPX 1N32Q 4ZV9A 2YOGA 1SE3A 4DR4Q 3PO2B 4BUJA 3KSBC 2BJWA 2OQ0A 4WE3A 3PNSA 4H7BA 2CZCA 3H86A 1RODA 2QVXX 2OPBA 3REQB 1K0UA 2G9ZA 4QC2A 2VJYA 2IS4A 3B48A 2OHIA 4EB6B 4YUWA 2IKSA 4KYTA 3IKLA 1RI5A 1C7IA 5TQ2A 1BS1A 1IULA 3RT1A 1Y8RB 3ECCA 1H93A 2H31A 4JIMA 4ZLTF 2YX1A 3OD5A 3RTDA 4UNNA 2WPDD 2RGGA 2YBDA 2JD1A 3O21A 1TB4A 1OROA 1KYZA 2QKYA 3GPBA 4G0ZA 1WSWA 2JLUA 3JWJA 3OQIB 1Y14B 3EXHB 4PLFA 1DMSA 2FUKA 4ZVVA 4WL0A 5AW3A 3CPJB 3TR0A 3NCTA 1TK3A 3OCVA 2P9CA 1Y1RA 2HDLA 2A0WA 5M3BA 3CC8A 3RW9A 2OUKA 3N76A 1CUJA 5FAXA 2QRNA 4MR9B 2V54A 1M7HA 4KWTA 1CUCA 4RF5A 3DEYX 1LFAA 1HM5A 3A5UA 4TLEA 1CZHA 1Z16A 4KDRA 4OK3A 2XEDA 2I2FA 3UG6A 4B9XA 4UU1A 3ETEA 3QLJA 2X9QA 4ALMA 5J2TA 3BRWA 4LZJA 4W5QA 4UBKA 4RFBA 4IZHA 4KPGA 4KIGA 4PGAA 2ZB7A 3A05A 3ZKWA 3KOYA 2RARA 2F0SA 5DYTA 1EWVA 2Y27A 3ZJVA 1SUCA 3IULA 4HUJA 3NO4A 5LKRA 4KWEA 1WDLA 4OX9B 1K86A 3NBHB 1XEWX 5FTWA 4RPGA 3ZXXA 1TWHH 1TQOA 3I1FA 1U4RA 2RHSB 3C14C 1YA8A 4FO2A 3AEUA 3Q1KA 4L2IB 2C5GA 1VIDA 2A35A 4OA5A 4NJOA 4BO9A 1DKRA 2VLIA 2PLNA 2I6SA 2F0DA 2LCQA 4Z9CB 3CPSA 2PIAA 1ZGHA 1X7WA 4GAEA 4IR7A 2DWCA 5LIPA 1JEYA 3NTUA 4HO1X 2HXSA 3R6TA 1W5FA 2X13A 3ITNA 3H4IA 1NVVQ 2OUIA 4KSCA 3U3DA 4B40A 3F47A 4RGTA 1E5LA 2JH3A 1OKKA 2N8NA 1KI2A 4QX6A 3S1RH 5DOVA 3LYHA 3P4XA 2VYQA 5KX5A 2Y1XA 3H1PA 3GTLB 3V8BA 3PQ8A 2XADA 1HFWA 1RJEA 3AMVA 2L1BA 3CRZA 4PG7A 1IB0A 5EL0A 4B8YA 2VF2A 1I0ZA 1YHZA 4INPA 5ALUA 3V9PA 3VR1A 3UJ8A 2B78A 1UXHA 1W9MA 3SZMA 4JI3Q 2PLRA 3ZCQA 1K66A 2D0DA 4IJQA 5A3SA 2R6R1 2WD9A 4K26A 1QQ7A 2BGGA 1UPTA 4EY3A 3IP9A 2C4VA 4NONA 3UDIA 1T9GS 3DLTA 5HF9A 1JNXX 1DX4A 1IN6A 3Q7TA 1GZVA 1GM5A 4AWBA 1UBLS 4MV0A 4BS9A 2MUYA 1HTLD 3UGKA 1LM0A 1QCZA 2F8SA 1GZ5A 1U8CB 3WHIA 3NENA 2GK6A 1IM5A 2GK3A 2M98A 1PXUA 3OYYA 4K05A 4X90A 4QT0A 5JCZA 1ZOIA 1ACJA 3WAGA 3PNMA 2IXGA 2WDZA 2EC5A 2ZAGA 1VJGA 3CMAA 3K5MA 3SZ3A 1HQDA 1MRZA 2MO0A 3ADDA 4D8WA 4UM5A 4B43A 4Q16A 2RDFA 2PM8A 4IVQA 1XDSA 4GXRA 2ZWAA 3IVCA 4Q7JB 2Z2YA 4HB0A 2AA3A 3KOOA 4Q66C 4RWSC 3CPWA 1P7WA 2JH9A 1GZSA 2RGRA 5HVNA 1NQOA 5CCXA 4I5EA 1IM2A 5HR5A 4F8EA 1R8XA 5FXMA 4QUIA 1GG2A 5AK0A 1KSFX 2G1JA 1CDDA 2K14A 3KDFB 3TIGA 4AYBB 3WMRA 1VFNA 4MW9A 3GJQA 2EF0A 4FGZA 5BNFA 3SZRA 2PWZA 1Y69U 2W6JD 3EEQA 2FSVC 2DAPA 2ASEA 3GIDA 3GDHA 1YR9A 3WOVA 3RIEA 4P71A 2BF7A 5CBPB 1P72A 1ZRNA 3L8ZA 3PT5A 1GUYA 2LSSA 2HRBA 2NQ8A 4IBOA 2F4VQ 3CE9A 1TQ2A 2Y9PB 3HJTA 1SQ0A 1ZUHA 2R751 1EY6A 1ZJYA 4GOKA 3JWHA 3I09A 5EYPB 4JYMA 1SO8A 5JO0A 1V3VA 1B14A 3GUVA 3FZNA 1K7CA 3OTQA 1SMXA 3NH9A 4Q6BA 2W6ID 1CY8A 3WWOA 3KUCA 2CWDA 1CUVA 3OEHD 4KEAA 4ZZ2A 4BECA 3G0HA 2WLSA 1P60A 1UQUA 2XMQA 3O95A 3FYTA 5KEEA 4QDOA 4C3VA 3KYHC 4C0WA 4OQQA 2PIDA 2I2DA 4MW7A 2C03A 4NE2A 3INGA 3DWPA 4M89A 5J23A 3PSAA 2OM2A 1LJUA 2BBOA 3S99A 1CYEA 3TNDA 2H5EA 1MC5A 1TIPA 1HGXA 3I58A 5ALYA 5C3WA 4PMBA 3NKLA 1ZBDA 2AVNA 3A9RA 3HPQA 2VUHB 2K5QA 1J56A 1B00A 3JRXA 4N8FA 1G3QA 2EW2A 4LPSA 3OW2A 4HVAA 2Y9MB 3EDMA 3NT5A 3SR1A 1EBUA 2WE8A 1R88A 2HSZA 4G1BA 2Y99A 1R5OA 1DO8A 3F2UA 2O2CA 5K5PA 2EQ5A 1UDWA 2RCNA 5EKXA 4HFMA 2JEOA 1RWWA 2DPLA 4CF6A 1Z3CA 3LO5A 1FA9A 1YK1A 3OESA 4PXSA 1PBTA 4IWYA 1G291 2X40A 3EZ2A 5BQ5A 4BNKA 1DHRA 3LDAA 3QYPA 4KMMA 4EZEA 5HUJA 2G5GX 5TX7A 5TGZA 3ZLJA 2FN3A 4AS3A 4BRWA 5ECWA 3TS2A 1SXIA 4F0JA 4B8ZA 4EQOA 3STTA 2C2MA 2R8ZA 5I4CA 1CK1A 1P4GA 2YXDA 2R93G 3KZ1E 1HQRD 4XCQA 4L5AA 2X14A 3VM6A 3WL6A 1YQQA 2CYAA 5JD4A 4O42A 1V9CA 5KQPA 4ZT2A 6REQA 1YHBA 3T1YQ 3INRA 4G65A 3J81j 2A4MA 2EL7A 4RMJA 1CUXA 2GD2A 4DV3L 2W6OA 4JJIA 3BIJA 5FO9B 1WG8A 2FK8A 4PZPA 5TT1A 1JQLB 4DQUA 2OP0A 1TWFB 2D0OA 4H1VA 1MNQA 5WRFA 1PH1A 4O6VA 2A5GA 5C37A 4EGAA 3Q0AA 3BXZA 2JGNA 3QVMA 3PKJA 4L75A 3W06A