2AWNA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
372
structure length
330
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
total genus 77
structure length 330
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awnA03
2.40.50.940 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awnA01
2JLVA 3DVLA 4DCVA 2WIAA 221PA 3LWNA 3U3OA 5KNBA 4KHZA 1P75A 2ORVA 1EFHA 2MNAA 1IXSB 3E1SA 4WBSA 1W0JD 5IYCH 2F1JA 3MJHA 1NE3A 2OSBA 1KO7A 3ZQJA 1Q12A 4DNIA 2XX3A 3I8XA 2B8TA 1ZM3A 4IFDJ 2C9OA 2WWIA 2J45A 3PUXA 4D4LA 3N2EA 4B33A 1VQ9A 3D31A 1UDXA 1AIPA 2K50A 1VS0A 1DO0A 2VYFA 4DRZA 3SS8A 3UPUA 3TS2A 3KXKA 1OSNA 2QA4A 1XEWY 4LUVA 1OW3B 3C41J 1NG1A 1UE6A 2A19A 4BA1I 1E2PA 2H8KA 3SYNA 4G01B 2IUTA 1QG2A 2OESA 2OT3B 3TNFA 1GAJA 4BRUA 4DLWA 2A5FA 3PCRB 4HAXA 1OB2A 4L5QA 2W0SA 2AKYA 4QIWE 2JLZA 2IEYA 3QEOA 4UNSA 1VQLA 2XB2A 4R4TA 3T1HL 3J80i 5TVKA 4DLSA 4E09A 4ZV4A 3MLEA 1T8UA 3LH5A 4Z8YA 2YTXA 2EWVA 4Q66C 1YR6A 3E9IA 1WMSA 2A7QA 2CK3A 1T4GA 2UZIR 3KQNA 1A63A 4Q03A 1T6NA 4OO1I 2EFGA 3BB1A 4D80A 2YC2C 2ECKA 3DLLA 1YKSA 5BWMA 4IFEA 2VW9A 1UEIA 3UDIA 2ATWA 4WJ4A 5HZKA 3UWKA 4DV6Q 4UP8A 4L4UA 2G3YA 3TR0A 4KFUA 4BRWA 4DIDA 3ULPA 1NKTA 3U7GA 2QSZA 4GNXB 2OHFA 3SFVA 2PQAB 3BERA 3ULLA 3B85A 4GP6A 4DWJA 1I4LD 4DR5Q 1Z9FA 4XTRA 4B34A 1W0KD 3DZDA 4GOPA 3MXNB 1EK0A 4L15A 4ZIRA 4IFBA 1BVSA 2B63H 1A7JA 4XD7D 4HJ9A 1PZNA 2OV2A 4I1VA 3SJZA 4BBRH 4HLUA 4QNRA 2IYVA 1WOCA 5JJLA 1E3MA 1WCMH 2HF8A 1ZD1A 2K5HA 5IP9H 2WPDD 1N6PA 2P6UA 3A1UA 2R7ZH 3HOWH 1KGDA 5BR8Q 1WP9A 1YZLA 3U4ZA 3CH4B 3FHCB 3PIRA 1GWNA 4QNMA 1TWHH 4DV0Q 2OFWA 2ZI4A 2ZTSA 4B2PA 4RZ3A 5FBVB 1D9XA 2ERXA 1O7IA 1BIFA 2ZJZA 1H8ED 1N5JA 4OL0A 2V6JA 3NEMA 3U3RA 3VHLB 4KI0A 3OZXA 4EPVA 1CR2A 3QG5A 3IIMA 3CX7A 1PH6A 1QG4A 2OWOA 2FZLA 5FOWA 1VQAA 1K73C 4NPHA 4B3TQ 4ZI2A 2Z6VA 4A0FA 4CVNA 1RFLA 1R0YA 3DOEA 1W36D 4LPSA 4TMVA 4X8HA 1EFRD 4OHXA 1B0UA 1G4AE 1PH3A 4D0NA 2BA0A 4B3XA 4DVGA 4BY1G 4H02A 2PZEA 2VP2A 2WJJA 4A3JH 1PV4A 4X6AH 1YZQA 3Q9LA 4BFUA 5G53C 1R7RA 1L2TA 1M34E 1JR3A 2KB0A 4TYWA 4Q9HA 4PHTA 1N32Q 1J90A 3QXSA 4TL6A 1GKHA 1PH9A 1II0A 3L0IB 3LBNA 1HQCA 3NG1A 4KAXA 1VG9B 1G16A 2HYDA 3LLMA 3H2YA 1MOZA 1D9ZA 2CCGA 3P27A 4LHYA 1RZ3A 2R44A 2ZM6Q 1SMXA 1ZIPA 3RZDH 1E69A 3TR5A 2A5DA 3CM0A 4S35A 3SBDA 2O8FB 3R7WB 2VP9A 4DV0L 2C9CA 3DM5A 2PJZA 4GOXA 4A3KG 1U5KA 2NPIA 5FOXA 4Q4JA 4JI7L 2I0QA 2GJAA 4IDHA 4TLDA 1MJCA 1RKBA 2FJUA 4NBSA 4F91B 2QA5A 2NO9A 3QF7A 1LNZA 3OEEA 5H70A 3CO5A 3LY5A 2DFTA 3K70C 3OIVA 2CEAA 2FXQA 2CL7X 3F0TA 4JYCA 4MKIA 4TL7A 2AK3A 2GAOA 2WMNB 2ZJPA 1X8LA 3RANA 3VNUA 1T3LA 1IN6A 1Z29A 2AWOA 2IYXA 2F9MA 2LKCA 1D8LA 3PO2H 4TLCA 1DELA 3MAAC 1JQLB 2GTPA 3AKEA 2WWGA 3EC2A 4QGGA 5L3SA 5JS7A 4P33A 4I4LA 2ONJA 4AG5A 1WYDA 4YCUA 3CR7A 5E7IA 1CR1A 2YHSA 4CEJA 1K83H 4IOKA 1Z8FA 1KMQA 4EDHA 1NIJA 3MMPA 5GVSA 4Q1EA 2ZSFA 1XMQQ 3VU9B 1II8B 3CNLA 3AH8A 5D3MA 3EX7C 3U44B 4BPBA 2LCFA 2ZRNA 1YVCA 5AR1A 2BV3A 2BHRA 5CITA 1X3FA 2AR7A 3LNCA 1HZBA 1L1OA 1G64A 3BZCA 1QDEA 3ASYA 3IIJA 4TMTA 3SJCA 4YXWA 1ZVQA 4RD4A 4C30A 2ZM6L 1KK1A 4JI4Q 3U50C 1VTKA 1Z6GA 3EIHA 3UXMA 5C1BA 1DG3A 5JHHB 3W6PA 3HOXH 1LVGA 3NC0C 2BCJQ 5JI3E 4CRWB 4OQFA 3TQFA 5IWAQ 5FL7A 1HNZQ 1H95A 1E2HA 1D8TA 1RRCA 1CKEA 1UBGA 1OH8A 1GRRA 1NBMD 1NBME 4RD0A 3GJ0A 5CYOA 2V1CC 2BJVA 3TW4A 2Q3MA 2GXUA 4IVQA 5C44H 4R4QA 2QP3A 1VIYA 2VIIA 2ZU0C 1W4AA 3ZS9A 4BEJA 1DADA 1WCMG 4BZPA 3BE4A 2YOFA 4JI6Q 3N5CA 5EE1A 1CJKC 3CRRA 3FMOB 3QY0A 3BFXA 4F4CA 4JI2Q 1Z08A 4TZ0A 2LSSA 2QGZA 2ZSEA 3F3YA 5EQTA 3CCJA 3QKRA 1B23P 1S3GA 3KJIA 5TARA 1PH2A 4DV2Q 4CDGA 4OQNA 4DEXA 3KQKA 1KKLA 2VTKA 3ND8A 2OBLA 1G51A 3A1VA 3FFBA 2D0PA 1PH8A 2FA9A 2J1LA 2QE7D 2RGBA 4FIDA 4NYMQ 3S1AA 4QHTA 5K8UA 3GTOH 1W2HA 4I1SA 2H5EA 2G83A 2LWIA 1WJJA 4LYJA 1JR3E 3KTAB 1GG2A 1MABB 1X56A 4BE7B 3KXIA 1G6PA 2RH5A 1G8YA 2IA5A 3LA6A 4JT4A 4NCJA 4YMSA 1J2JA 2RGXA 4JKYA 4JZKA 4OI4A 4TMXA 4C7OA 4QGAA 4JG2A 1FL0A 4A2WA 5EAYA 5IWAL 3T61A 3V9PA 1MV5A 1NLFA 1XXHB 2FWRA 3VR2A 1TUIA 2GDJA 4TLAA 3SEAA 2UU9Q 2JATA 2W2TA 5JFGA 3CF5A 3RAPR 3U61B 1FOEB 3P4YA 1OIWA 1W49A 3NBZC 4RFSB 5EE3A 2R62A 5SZKB 2IHYA 2XXAB 4YQFA 4Q19A 4DSNA 2Z6KC 3QXJA 3CONA 1JXMA 2WJVA 5EXPA 5AJ3Q 1QZHA 1D2MA 1NY5A 1HT2E 4DT1A 2VP5A 4DR7Q 1VPLA 4M8NE 3H3VI 2JJ1A 3S2DH 1N2CE 4ZPXA 5AUOB 1FJGL 2FSIA 4KU4A 3CAMA 1TF2A 2NO0A 1KQSA 4PZLA 4JI2L 3I72A 1N5IA 3MCAA 2YINC 3NH9A 3WNBA 4M1YA 4URVR 3NWJA 4A3IH 1G7TA 1N8RC 1LB1B 5EXTA 1GFIA 4G5QA 2QPAA 1ZJ6A 4LF8Q 4N0DA 4HZUB 1XTKA 1MKHA 1E96A 2RMKA 2BBSA 4TTRA 4DR1Q 3PITA 4PAOA 5FJ8G 2C98A 3AF4A 4Q7LA 4KV9A 4PPFA 3NTUA 4JBJA 4M1TA 4F93B 1X6OA 1E79D 1KZ7B 2IS6A 3H3VH 2OAP1 2WJIA 2VQEQ 3PO2G 4UY8C 5HPYB 2JEAI 4O0AA 2P6RA 5AK0A 3OTOQ 4JYAQ 4DB4A 1EGAA 4C2UA 4Q1AA 2KWIA 1GNRA 4ASUD 2GBLC 2VNUD 1IN5A 2FH5B 1QZXA 5KYKA 3LLUA 4JLVA 4MGZR 2G0TA 1AE2A 2VF8A 4LC1A 2JJ2A 1TXYA 1KK2A 1G3IA 2I1QA 1PA6A 5J4LA 1SVMA 2F52A 4DCUA 2WJHA 1VHTA 4NXNQ 2VO1A 4Q4AA 4Q02A 1P2VA 2VF7A 2A5JA 4AC9A 3GJ8A 4FDBA 2ZSDA 3NBYC 2PEZA 3DHWC 1IJEA 5E4FA 2BBOA 5BN4A 3A4NA 3K0FB 4B3GA 3HOYG 2ZAMA 2JJ8A 4JCVE 4DK6C 2AWNA 4PQFA 2IK8A 1Q57A 3MJRA 3TGPA 2RCNA 5EP1A 5JMTA 1I2DA 3KDFB 2FFHA 3NIBA 1HUQA 4L5BA 3VR5A 2D7CA 1O87A 4KXFB 2YWGA 3QPWA 1KI3A 2WV9A 4HUTA 4LBZA 1Z0DA 4UP7A 2QNRA 2CDNA 4M1OA 4QGUA 3ADBA 4C2MH 1E98A 2AKWB 2VQEL 1AKYA 3F2CA 1NJIC 3RRZA 3RS3A 1VQHA 4B6EA 1R6BX 2R93H 2QMUA 4A93H 1QVAA 4A8JB 3RC8A 2PT5A 3OTOL 2OTJA 5TMPA 1GL7A 1J70A 2OXCA 1IXZA 3NH6A 2JA7H 2QAJA 4OBEA 2O8DB 4F4JA 1AQYA 3C16C 2V4ZA 2CCZA 3I4OA 5FOTA 4DDTA 1K8RA 4LF7L 4O3MA 4H1UA 3PUVA 1IL2A 4HZIA 3ZH9B 5CM8B 4AH6A 4XTCS 2GJ8A 3FKSD 1SVWA 3AVWA 1UKEA 4XOIA 3HYTA 3W6OA 4EFLA 3SYKA 4OI1A 1KL9A 2W0MA 1VG1A 4X66Q 2H7VA 4LSGA 1H8HD 3GLHB 1E0SA 4POFA 1XMIA 4FWTA 2AHOB 3K7UC 1PUJA 3HR7A 4CYMA 1KY3A 4GFDA 1JR6A 2H57A 4ESVA 3AQ4A 4CEIA 2FSFA 2ODEA 3F1ZA 1C9KA 2X1VA 4JI5Q 4LUZA 2IUSA 3GLGE 1DS6A 2J0UB 3ND9A 3MD0A 2F3TA 3JVVA 2EFHB 3WY9A 5LMUQ 3L0PA 4WOPA 3CCQA 4M2LA 3AUXA 3LW8A 4AYXA 2Z6KA 1G7SA 1CXZA 1BKBA 1NL3A 4IDOA 2FDCA 1JNYA 3ADKA 4F4IA 2ASEA 4PQRA 821PA 3CXCA 1NJGA 1KIXA 1AH9A 1FMJA 4JI3Q 3HOUG 5C4XG 1P3JA 2OBNA 3N70A 3OESA 5KDLA 4IVPA 3W90A 3PUYA 1E1QD 2J9RA 1FMLA 3ZVRA 3H84A 4JI8Q 3L0OA 4ZDJA 1NVUQ 1AK2A 3SZRA 2NZOA 4DUZQ 2GHIA 4C3JH 3B9PA 3TK1A 4JV5L 3VR3A 2NZJA 4TL8A 2AFHE 4A3IG 3PFIA 2ZTCA 4JOIC 4GKJQ 1N6RA 4MGKR 2OCYC 1QUQA 4OWTB 5IT9c 1UEJA 4UQOA 3LFUA 2VHQA 4G5OA 4JLDA 1H65A 1DPFA 5SZJA 3CCSA 4V0MA 3I62A 1T3HA 5DLQE 4DR4L 4KITB 3EPJA 5JI2E 1GRNA 1ZU4A 1X1SA 2KI5A 3O8RA 4Q1DA 1TTTA 1YZUA 2IC5A 2YWHA 1VQEA 5M3FG 2F1HA 5FUVA 3STBD 4DK3C 2JA5H 4G5RA 5B2ZA 3KX2A 4TTQA 4QKQA 1SVIA 3G5UA 4MUBA 2WFWA 3NHAA 2DB3A 4G3XA 1DTSA 2OXRA 3GJ6A 4JI5L 4NPSA 3HWSA 3QPUA 3FKQA 4BASA 1ETUA 2GBLA 3KFVA 4RCYA 5KNDA 1HJPA 2E5LL 1P61B 4D26A 4TLBA 1IXRC 1XMSA 2Q9CA 3W34A 2QQEA 2D06A 5BYKA 3E5HA 2I1VB 2AX4A 4RD6A 2ZRGA 4JBXA 3D3QA 4HUQB 2E8GA 3KF6B 4NL4H 2ASBA 4K46A 4GLXA 2WJGA 4JI3L 3GJXC 1E9RA 2HLDD 3QKTA 4PO8A 4ARZB 2ZJ2A 1E9BA 4HAVA 5AJZA 3SHWA 4B74A 3JZAA 1M74A 1ZNZA 4B71A 5JWRA 3NVAA 1CBUA 5KPDA 3FWYA 3BU2A 1XMJA 2BBTA 1XCGB 4X8OA 3UATA 5F9FA 3THOA 1CU1A 1HE1C 4DV5Q 3IEUA 4TSFA 4JL8A 3CRMA 3HKZG 4A3DH 3BH0A 3WNCA 1N0WA 1PVOA 5EZ5A 1LTLA 3UDGA 3AVQA 5JCPA 5F3WB 4AKGA 3AFQA 1AJEA 4C0QC 5CIWA 1Q3TA 4I81A 3THYB 3KOJA 3HOZH 3SE0A 2AXPA 3A74A 1GNQA 4QGHA 1CF4A 2I5LX 2WZQA 4XH9B 4BY7G 1JE5A 4BFZA 1XEXA 2IS4A 2CNWD 1FW6A 4P71A 3T5DA 3GFOA 3UKDA 1EX6A 2VZAA 3PEVA 2P67A 1ZM2A 1NSFA 3DMNA 1YIJA 2V7QA 4LV8B 3DM3A 4PC2A 3AKYA 1R4AA 4JBYA 5CK4A 2JA9A 4GMDA 1I4TD 2VBCA 2PMDA 4YC7A 1F48A 3CF0A 3QXHA 3UMRA 3GLFA 4JI1L 3HU3A 4K81B 4HAYA 2ZJBA 4FMCF 1E2JA 4A3MH 2YNMA 4TT3D 4RJLA 3LVRE 1GVNB 5L3RA 2IYZA 1OFHA 4LF5Q 4AYTA 4MKFA 1KNXA 1FTSA 3HP1A 1E7ZA 1CJTC 1BBUA 2VSXA 3GFTA 3UANA 4A6PA 4QC2A 5HZHA 4PMWA 1MT0A 4YMTA 5KUTA 2C77A 2L0XA 3TBKA 2EWWA 2IYLD 3IRBA 1R0WA 4MH0R 1NRJB 4ALPA 2H17A 2OE2A 3C14C 4NH0A 4QBFA 2GJ9A 3PCOB 3LVQE 4EJSB 3LGJA 2FN4A 1XJVA 2NIPA 2ZYVX 2GF0A 2WB1G 1TQ6A 1XU4A 5TDHA 5FI1B 1I6HH 2JDID 4M9SA 1N0VC 2VY3A 3FHWA 4LDJA 2NG1A 2BH8A 4DR6L 1YR7A 2W00A 3BH7A 3CF2A 4KO8A 1COWA 5IK2D 4A3CH 1SR3A 1Q3HA 2XTIA 4DV4Q 4POGA 2I4IA 3CCUA 2Q6TA 4DLZA 4I99A 2P6NA 3KUDA 2KHJA 5LMNQ 3GFPA 1T0HB 1YRAA 1MR3F 2ZAOA 4ZCLA 5EJEA 2ZR7A 5M5YH 1SKYE 2ZJYA 4UXJA 5ANRB 3CRW1 1SULA 3BB3A 2QMEA 3THWA 3GTKH 2NVYH 1W36C 3QENA 1ESMA 2GCOB 1RJ9B 4FMCB 2LKDA 1G6OA 4B3ML 1FVIA 1G20E 2QL6A 5DIFA 3ZGXA 2J5XA 4BLOA 1E99A 1YU9A 3S1QH 1IY1A 3AB3A 4P72A 4M9XA 4BWYA 5KSPA 3CMAA 4GRAA 2O0KA 1OF1A 1IXRA 2YWEA 2HCBA 4DAYB 2ZUBA 2CHQA 1WB9A 1DO2A 4ITRC 1BO6A 1S4QA 2PCLA 4LYFA 1X8JA 2VHCA 3GJ5A 4BXXG 3SN6A 5KNCA 5JWHA 1ZP6A 3R9IA 3P1JA 3SQWA 3K9NA 5GADC 2XSZD 1J99A 4KYUA 2W2XA 2REOA 1ZD8A 3Q8XB 5FPYA 4FCWA 2XGTA 1XBTA 2G77B 2UZ3A 2ZS9A 4PZ6A 4Q00A 1Y1WH 3TE6A 1HNXQ 4IXNA 2G9NA 4GKKQ 1CKNB 4M1MA 2A3RA 2JA8H 3UG6A 1JJCB 1C9OA 2C95A 4PZYA 4LJ5A 5A5GA 5IYDH 1ZUIA 2HXYA 3TVTA 2HYIC 1JBKA 2IF2A 4Q47A 1NBWA 4V0OA 4AD8A 1R0XA 2IL1A 4DUGA 1IN7A 1JMCA 5LMNL 3KF8B 2CVFA 2ZEJA 3I4NG 1U0JA 4WAUA 1PLKA 3LXXA 3HOZG 3J81c 4UPAA 2CLCX 4Q7JB 3AVVA 1P16A 3AF3A 4LFCQ 4B43A 1G8GA 3I92A 3WMEA 3FVQA 1R9TH 1P6XA 4Q1CA 1OHHA 1RVDA 1TNDA 4Q5IA 4NXMQ 4BBSH 5E7JA 3ZZ0A 5JJIA 1KK3A 4GBMA 1VQIA 3GLFE 1WFQA 1LUZA 2X19A 1NIPA 4EQ6A 1QHSA 1X9NA 4LF9Q 1DG1G 2JIZD 4TYYA 4RY2A 3U3MA 4URXR 4KFTA 1SXJA 5KO2A 1CKOA 5JSZB 2PI2A 2C96A 4A9AA 5LPNA 2W6IA 4D82A 4Q7KA 1LF5A 1PYBA 5EE5B 3RWOA 2RHDA 1AS0A 4IPGA 2EFEB 1ZUNB 1VECA 2Z0MA 5FLMG 5GJVC 1OIVA 5E95A 1YNXA 2BH2A 4UJ5A 2XB4A 1E0AA 3K7AH 4KCGA 4B3CA 5JBQA 3S2HH 2D0OA 1K8AC 421PA 4HDOB 1X65A 1PH4A 1EXMA 2EYUA 1LF0A 4GKKL 5M5XH 2C2HA 4Z1MD 4R7ZA 1VQPA 2CFMA 2ES2A 1JJGA 5C4MA 1NMGA 3B6EA 1ZNXA 5CJPA 3I5YA 2CWAA 4YWLA 5G41A 4NU0A 2IX3A 2GN5A 1C7YA 1YZ6A 5UKDA 3NDBB 5ELOA 3JAMc 1E1OA 1UBCA 2J59A 2QORA 2QTHA 3LX8A 1Y1VG 4HJ5A 3VR1A 4TLEA 3M9BA 3IO3A 4YMVA 4PR0A 5FUWA 4DKAC 2QEXA 3OAAD 2ZVPX 4GNKA 5C4GB 4OHZA 2PMZE 2IS2A 4LJ4A 1A2KC 4A3LH 2JLSA 3RWMB 1GUAA 1XD8A 4BLSA 4WXPA 2OZEA 4LF9L 2G0NA 4E07A 4D4KA 2QGNA 1M8PA 2R7DA 3MWLA 3RC3A 3WRYC 1Z0KA 4PC3A 4LF4Q 4BUJA 1T5IA 3U4QB 1BBWA 3CH5A 4W5JA 4LCBA 2ZJRA 3BIFA 5HCNA 3R8FA 4EPXA 1Q46A 4V0NA 2IHEA 1TEXA 1P73A 5JS8A 4Q4HB 1ZM7A 2ZROA 4G5GA 4R2IA 4DSTA 1VHLA 1UM8A 4LV5B 1YHAA 3ZIAA 1L8QA 4GI7A 1YITA 1P2UA 3EA0A 1X3GA 2Q9BA 3CIOA 4TMWA 3QXCA 3BORA 1T3SA 1KAGA 1P60A 1MRSA 3KB2A 4IJLA 2DGYA 4R1JA 1JI0A 4TQAA 2ANCA 4EFNA 1WQ1R 3HU2A 1VQGA 4HIKA 1G41A 4RD3A 2QAGB 1E2KA 4QJ5A 4A3BG 3W8NA 2H16A 3EPLA 2J7PA 1YHNA 1GTVA 1E2EA 2R6DA 3Q85A 4IHQA 3U7FB 2O8EB 1BS1A 4PXAA 1N3BA 3GD7A 3AP2A 1J8YF 1TQDA 4B3DA 1R5NA 1Y1WG 1P2SA 4QJ4A 4C0AC 1BYIA 2F43A 2CE2X 2ZS8A 3C4JA 1VCOA 2EIFA 4YHHQ 3NKVA 1QZGA 2V3CC 4TQUS 3NEYA 3AVYA 5FOVA 3CC2A 2WIBA 4DV1Q 4JBKA 2PH1A 3QSYA 2R2AA 5FTNA 4LF4L 1LM0A 5IRCD 4HYYA 3I8SA 2V55B 3T1YQ 1AM4D 2NN6I 1D2EA 1DE0A 1XRJA 4BQSA 1SXJE 2DR3A 3U4VA 4EPTA 5IYBG 2OCBA 2ZTDA 4LHWA 5B30A 1ZNYA 3KJGA 4C0JA 1U8YA 5EXXA 4IJHA 3BRWD 1NLYA 2IHBA 1B7YB 1IY2A 1KSHA 1YJWA 1YZKA 5CYPA 2WWXA 4PO1A 4RZUA 1V43A 3TSWA 1M1YE 3PENA 1KO8A 1VQFA 1TU3A 4V0LA 2YV5A 4BA2I 1GIAA 1NVXQ 2HT1A 4LF6Q 4DUYQ 3JC66 4OXPA 1VQOA 1WXQA 1I4DD 3WXMA 1R5OA 5JZVA 4OX9Q 4Q9JA 2J41A 3R9WA 2GJKA 5JEEA 1SROA 3K80C 1OIXA 4O2RA 3HOVH 1ASYA 3ZZUA 2E2IH 2NPFA 4AURA 1US8B 3PJRA 4GL2A 5DGXA 2BBWA 4QQBX 3U2QA 4QL5A 1VCNA 2XEXA 5A4JA 4JBMA 3DKPA 1I50H 2CMKA 3CB4A 2IX0A 2GXSA 3B78A 4DV1L 4A3GH 4DV6L 3CD6A 5H1SE 4K0KQ 4IXMA 4EUNA 2OILA 2JA6H 3C5CA 3FE2A 1WBDA 1VG0B 2C5LA 4Y52H 3AF0A 2CKZB 2RB4A 2W6JA 4LY6A 1F2UA 1OPXA 4H9GA 5HR5A 4DR5L 4MGIR 4QY7A 3GTGH 3CWQA 4RCZA 1IY0A 4ZI3A 2KJQA 2A2ZA 1JB7A 4Q9KA 2BIFA 2CLDX 2ZVQX 4Y0AA 2XAUA 1I94Q 2VP4A 1PH1A 4UXHA 1L1OB 1UJ2A 3FHTA 3RS2A 5EP3A 5IYCG 121PA 3CLVA 4B2LA 2OEPA 5FBQB 4FXPA 1JJ7A 3W6NA 5BR8L 1Q1EA 1HZCA 1X55A 5ELNA 4DUYL 4LF6L 1E94E 2ONKA 2P2LA 3TLXA 1VQMA 4CT4B 1Y3AA 3ZZTA 1NLZA 1G9XA 4B73A 3K0SA 2IYRA 3FMIA 3S1NH 3W1BA 2HQLA 2IT1A 1IBMQ 1T5LA 2ZE7A 3DZ8A 2J7KA 2VSOA 4P4SA 4HB0A 1NI3A 5GAGC 5P21A 4F7WA 3KFXA 4RKEA 5L3QB 4PQYA 2EQBA 2JAQA 3U3KA 4NKRA 3U4QA 1F2TB 1MIUA 3IILA 1OFTA 2JGNA 2Q3HA 3FMPB 4KJZA 4LHZA 4OONA 2CK3D 4BGDA 4B3TL 1G7CA 2FE4A 2RGDA 3CP0A 4BFTA 3NBXX 3BXZA 3GEHA 2WKQA 1MO3A 1EQRA 3KUCA 5AUNB 1Z5ZA 1G8HA 1Q1ZA 3TVDA 1WI5A 1P2TA 3QKRB 1KDPA 4AKHA 5AWFC 4IOJA 3U6KA 4PZ8A 2V54A 5DN6A 2ZSBA 3B1ZA 3VMFA 4MDFA 3LXRA 4M1SA 3B9QA 1N32L 5K8LA 4Q1FA 3WMGA 4Z8XA 1N5KA 1VYVA 1XF9A 4FI3C 3LO5A 4OHVA 3IGFA 1IN8A 4MRPA 3WBJA 2YZ2A 1E1RA 2IXFA 4C7OB 4HIDA 3PUZA 3RN2A 3GQBA 3KDSE 2KCMA 1UBFA 1N34Q 3B8HA 1BMFA 1M7BA 2JEOA 3QKSA 5E7MA 1XZPA 1QVGA 1XPRA 1G5PA 1E2DA 2EU8A 3T15A 4BZQA 4BFYA 5FLXc 4NP6A 4TYNA 1TF5A 2GZDA 4IDNA 3RYTC 2ZANA 3TQCA 1P7CA 1E2MA 1MKYA 3I5XA 2B63G 4X8MA 3W5IA 1R8QA 4BBRG 2N49A 3QBVA 4C3ZA 2UUBQ 2DFLA 3PR1A 4N1AA 4JLPA 2UXDQ 1MO6A 2UXBQ 3G82C 5IP9G 1TPZA 4DJTA 5FH9A 2FNAA 3K09C 3HOWG 2R7ZG 2ALYB 4P3YA 1SVKA 5CDFA 2BEJA 3GLGB 3KQUA 1B8AA 2Y0SG 5D3QA 3SQXA 2EQSA 1DAKA 4W5HA 1TWCH 4LZZA 2NN6G 1VG8A 3A8TA 3OEHA 2GVZC 2XNDA 1KSJA 4LUCA 2DYKA 1XMQL 2PT7A 1ZAKA 3M6AA 4C3HH 1HY3A 3ECCA 3I7FA 3HOVG 5FPTA 1XMOQ 5CM9C 5GADl 1S40A 3I2ZA 1D7QA 4PAQA 3W1GA 2IXGA 3TEHB 4KYIB 1QHYA 1JR3D 1EG7A 1NMXA 3QPVA 1KI8A 4N3NA 1SVSA 4X64Q 1NN5A 3V4FA 2ODBA 3ULJA 3DM9B 2NMVA 4AYWA 3MFYA 2PL3A 2HF9A 4ZCIA 4JI4L 5DHAA 4K8OA 3VDYA 2HHHQ 1KO1A 2F1RA 1G8PA 2J0VA 5HKKA 2JA6G 2OO7A 4U00A 5GVRA 2ODNA 4C0SA 5JRZA 2NO7A 2ZI3A 4A3JG 3VKHA 3TAHA 3Q7QA 1HNZL 2MO0A 1G17A 5E7NA 2RGCA 2W83A 4F92B 2CJWA 1YZTA 3IPXA 1RIPA 3R20A 4URWR 1AN0A 1KI6B 4A4DA 2VL7A 1XEWX 3AUYA 4QHSA 2OFXA 1CRQA 1PJRA 3C5HA 4NCNA 3C7KA 2XITA 2UUBL 4WVFA 5LB4A 4E5UA 3OEED 2UXBL 2CCKA 1ZCBA 1M2OB 4JI6L 1XNQQ 4L8GA 2ZU6A 4M0LA 3T35A 1XFAA 1EFCA 3EASA 1S2MA 1CSPA 4IRUB 3MUFA 1GKUB 2X2FA 4M53A 2J3EA 3K8YA 3T1QA 1XDBA 1W5TA 2N1BA 4DDUA 5ELXA 3EG5A 3DPUA 3QBTA 4DV2L 1OTCA 2JE6I 3P26A 2QMOA 3PO3H 1X1RA 1J8MF 2O8DA 4DIEA 4J0QA 4P0TA 3GEEA 4JSYA 1GL9B 3REFA 4XVRA 1TADA 5B64A 3SHFA 1FGUA 3RLNA 1BYUA 4X64L 1QVFA 1TL7C 3B7GA 2O8FA 3M0EA 5EE9A 3BH6A 4R71A 1Z0IA 4Q01A 2A9KA 2X8AA 3VFDA 4A8JC 4KFRA 4YXWD 1AKEA 3ZQ6A 1GVPA 4N0EA 1E4YA 3V00A 3S17H 2O8BA 2UU9L 1Q21A 3FFAA 4NONA 2G1JA 5KPJA 3THXA 2CQOA 3MWKA 3M1IA 4MKHA 3CCLA 3T34A 4A2QA 4DAMA 4US0R 5FL7D 2R9VA 2ZREA 3QOFA 1QHHB 5AJ3L 4JIMA 2N8NA 1KRTA 2JEBI 2WJYA 4PHGA 3VX4A 4DR7L 2Z0SA 4FN5A 4LFAQ 4QOSA 2ZYUX 5FBWB 4KSCA 4B6FA 4HEJA 4CEIB 3HOXG 4MRVA 1KDTA 3QG1A 5DSZA 2UUCQ 1AGPA 1TQ4A 4HJ7A 3GJ3A 3QJYA 1IBKQ 2Q9AA 1G1MA 5CDFE 3ICQB 2NVTH 3QIAA 3CBQA 4R9UC 3AFPA 3G71A 3Q7PA 4GSYA 1XNRQ 4LF8L 2PMKA 2GZAA 4JLBA 3RNLA 1KAOA 2ZETA 4DR1L 2BA1A 5C44G 1YJ9A 2R92H 2W58A 3ONWA 2QM8A 2XXAA 4M22A 1GM5A 2QROA 5EP2A 2GZHA 4AIIA 3ZLJA 4C4PA 4GMXA 1AS2A 5FPKA 5GQOA 3T1TA 3SC3A 3K09A 3I3SR 2VUMH 4JYAL 1A2BA 2QN6A 1U2RA 2R6CA 2GK6A 4FD2A 1F60A 3SNHA 3HFZB 3LW7A 4BLTA 4IJMA 4LFBQ 1GNPA 1RRFA 3RDPA 1YJ5A 3SR0A 2VH5R 4EX5A 5FI0B 4TZ6A 4PSKA 5JLJA 4W7SA 3IBGA 2WP8J 4HLDA 1Q7YC 5BN3A 2OLJA 1JECA 1G3RA 1ZC4A 2FU5C 2RAPA 2R8RA 1LTQA 1F6BA 3HR8A 4DV7Q 2WWFA 2PLFA 3UWOA 5IF9A 5HGQA 4NDZA 1WDTA 4NXNL 1NP6A 1E22A 1VMAA 5J4HA 1Q20A 3NXSA 4J15A 1N6NA 1ZUHA 1KMHA 1EQQA 1FNMA 3CPWA 1RW4A 2ZQ5A 3CCRA 3QVVA 1WCV1 3OIYA 4BFXA 1HZ9A 2NZ8A 3AGPA 2UUCL 2JJ1D 1OLOA 4URYR 1IBKL 3W5JA 5M3MH 3CC4A 3JZMA 3W9YA 5DHFA 5HE8A 4URUR 1GKYA 1W4CA 3SGIA 5AJXA 2OCAA 1SKYB 2QTVB 2VP0A 5JEAG 1KHTA 5FL3A 2BJWA 4US1R 1CJUC 2ZE8A 3CNOA 4A3FH 2QBYA 4LRWA 4HB3A 5IP7H 3J81i 5L3SB 3K70D 3EA5A 3ADCA 5LD2B 2I5HA 1UPTA 5KDOA 1KO4A 4QJ3A 3BOSA 1U0HC 2BOVA 2NOAA 5FTKA 1IONA 1DAFA 2OCPA 3FTQA 4LFBL 4LBYA 4KHPQ 1X86B 5AJVB 3QI2A 1G5TA 1QHGA 4OQXA 1X8KA 2QENA 3GPLA 3EZ6A 2PX0A 2EXDA 2RGNC 2V8OA 5DO9A 3EW9A 4HSEA 1DAGA 3EWAA 4HLQB 4F38A 5C2JB 3JVUA 1TX4B 1NVWQ 4X66L 2ZXUA 1YJNA 3RHFA 3P4XA 3RZOH 1JEDA 2JJ2D 4EPRA 1Z28A 3DDCA 1Z3IX 4PANA 4MTNA 2V1XA 4UJ3A 2CLSA 5IY0A 3A1SA 4KSBA 4A8JA 1T9HA 3E0EA 4II7A 1XTSA 3L43A 2GETA 1W2BA 2HCJB 5B57C 4WA7A 2HT6A 1RL2A 2WVJA 2F1IA 2ZITA 1OKKA 4KLKA 3H15A 3PF4A 5E3HA 2O0JA 3OIWA 1L7VC 1VQKA 5LMUL 1HR0Q 4DR3Q 4JVNA 3VKGA 3G6EA 4WZ6A 2GESA 3HKZE 4DV3Q 2WOOA 1TWFH 4JJKA 3GLFB 1E2LA 1UKVY 3JAMi 1S8FA 2IBMA 2ZRAA 3GLHA 2JLWA 2VQFQ 3B6YA 5AUPB 2AHOA 2RGEA 4TL9A 4AG6A 2IW3A 1E9DA 1MJEA 1FX0A 3L7ZC 4JI8L 2B8WA 3CCEA 1KI1A 2GRJA 3RSOA 1VCMA 1PFSA 2ZI7A 4EKDA 3KXLA 4DUZL 2RKOA 4I1OA 2ZJOA 4DB2A 5JECA 1KDOA 4GKJL 4IOCA 4MRNA 4PTLA 2XOKA 1KI7A 3BWDD 3QVUA 4US2R 1NN0A 5H8WA 1JAHA 3TJZA 3OE7A 5LMNW 1Q1QA 5TB5A 2DUDA 1OXVA 2R92G 3UMSA 1GD7A 4IO9A 1CR0A 4MYHA 4P73A 4OHWA 3CR8A 5BXQC 1GDDA 2D4HA 2P65A 2WSSA 1HURA 2R93G 4D6PA 2QY9A 2CBZA 2NVXH 4A93G 4JVMA 4Q18A 4EJSC 3H0GH 1HH4A 1ODFA 1W44A 4MNOA 1DBSA 4KLNA 3WHKA 2JA7G 4CW7A 4AKIA 2R6AA 4OWXB 1JPNA 4QBHA 4NYJQ 5JEAJ 1SN8A 4Q1BA 1M90C 4DKXA 2EYQA 1U0LA 1OXTA 2AKAB 2BM0A 1E9AA 1J5EQ 1G4UR 2B3GA 5EXSA 1KD1C 1G291 1HR0L 2Q2TA 4A75A 1IBRA 4X65Q 1S3OA 1FUKA 1I2MA 1KDRA 5LBIA 1Q0UA 1W46A 1XJ0A 2GK7A 2GEDA 3X1ZA 4LJ9A 4MYCA 3J7ZC 3KFUA 1CJVC 2Q0HA 3K0CC 4JT2A 1E32A 3U3JA 3THWB 3CKLA 3QKUA 1G3UA 1XD2A 1PLJA 4JLKA 3VQTA 4FINA 1U90A 2CE7A 3P20A 2KBEA 1TWAH 5CJ2A 2WB1E 4B44A 3GJ4A 1G18A 4DV5L 1HTWA 3DMDA 4B3FX 3PF5A 1E2IA 3VR4A 2IHFA 1QHXA 5C0XJ 4KVAA 3U6BA 2OQ0A 2MO1A 1YHQA 4YWKA 4TWZA 4YCVA 4A3FG 2CXXA 4HUQA 4V0ME 3KF6A 4DSUA 1A0IA 2JLQA 1OH7A 3BB4A 1XJCA 4JLNA 3AVXA 3TS0A 4ARZA 2D7DA 3O8BA 1R2QA 4FCTA 2ORWA 3UE0A 1NJFA 3LBHA 3KKNA 1RYFA 5J3BA 4JOIA 1LFDB 3ZD6A 2GEVA 2ZRJA 4UNPA 1Z07A 2C99A 2HDNB 1T0JB 3S16H 1R10A 1Z06A 3I61A 1A5TA 4D81A 3BD9A 4AYBE 1WE2A 5DISB 1YZGA 2GKSA 2REXB 1N6IA 1U8ZA 2IF0A 4MRSA 3GLIA 1DAIA 4ERNA 2JA5G 3CW2C 4B3RQ 2ZJ5A 2BKUA 2IYTA 4M9ZA 4NYJR 5A0FA 2FFQA 5CLQA 1XTQA 1XPUA 4GN5A 3FYHA 4LF5L 3OFNA 2WMOB 3W5OA 4EQ6B 2OFOA 3FP9A 1KYIA 1SXJB 2K14A 3A0JA 2TMKA 2XNSA 3CZPA 1N6LA 4GN4B 3VKWA 2AD5A 4G0NA 2RHQB 4QM6A 4TSFD 2QPOA 2ERYA 2OQKA 1YVDA 4FWIB 3TMKA 3FPAA 4GOJA 5IE8A 4YLGA 2NZHA 4YY3Q 2ZRKA 2J0QA 3IBYA 3D0FA 3BBPA 4M1WA 1KO5A 3BAFA 2K52A 4HLCA 4ACAA 1W0JA 1W4BA 1W7AA 2PNHA 2VSFA 1G3MA 1AQUA 1HE8B 2G1KA 1W48A 3F8TA 4QXAA 4IOAA 2YKGA 1YR8A 1ZC3A 1N33Q 4GN3B 2F4VQ 4LJ6A 4MGYR 3QF4B 4OI2A 4OQLA 4FMDF 4QHYA 1LYLA 2K75A 2IEZA 3TRZA 1NN1A 4YMWA 2YJTD 4DV4L 4A3DG 3O8DA 3GTPH 2K5NA 1C4OA 1FQJA 2BMFA 4POAA 2YVUA 5K36G 4Z51A 3A36A 2JLYA 4JS0A 3B2EA 4B48A 4GP7A 2GXAA 1AZTA 1SRUA 4OQMA 2V7QD 4QM7A 5CIQA 1AA9A 1E2GA 2DBYA 4PC1A 1RRGA 2ZJ8A 4EJSA 2B29A 2QGQA 1HZAA 4B3RL 2EFDB 4GZLA 2L15A 5DNYB 1D5CA 6Q21A 1IZ6A 2F7SA 4LHXA 1CP2A 3WRXC 1HNWQ 1IBLQ 3AEVA 4AQYQ 3IHWA 2GNOA 3DL0A 1HEIA 2YC4C 4V0KA 3ASZA 4YONB 3B5JA 3A5ZB 5EE0A 4ON9A 2IY5B 4CIDA 2J46A 1OXXK 4HB2A 1N6HA 5B58C 1GZSA 1YQTA 3ZVNA 1CEEA 3KKPA 4UXIA 2FMXA 1AZSC 4Q9IA 3U5ZB 4YY3L 5FUYA 5H68A 5JWOA 4CEHA 2ZR9A 1ASZA 4B32A 2ANBA 1GP2A 1MH1A 2A1AA 2JK8A 4A3MG 2QRZA 1HNXL 2GCOA 4PPNA 1RJ9A 4OKSA 5J40A 4BLPA 2F4VL 1JT8A 2QU8A 4PZ7A 3TQYA 2IYYA 3F2DA 1TU4A 1Z6XA 1AGRA 2QTFA 5TXGA 4LBWA 3Q72A 1U9IC 2N46A 3AP3A 4C0KA 1W0KA 4FMDB 2XZLA 1XTRA 2F6RA 5GJBA 1COWD 1CLUA 2FZ4A 1TF7A 4XD7A 4A3EH 1UWVA 3EZ2A 1N36Q 5TV2A 1IYJB 2QAGC 4LFCL 1EIYB 1G8FA 3AP1A 1RPZA 4XIGS 4A0GA 2WPDA 1EIFA 3BJUA 1L0WA 3S14H 4X62Q 1PLLA 1SVLA 3FMFA 2F43B 4NXML 1DAMA 3GLIE 1G19A 1W4RA 3SJAA 3X1DA 2WAQG 1IBLL 4C9BA 3TUZC 2AD1A 3OYYA 5DH9A 3MG9A 4R4CA 4KODA 1W47A 4C3IH 1H8EA 4A3CG 1ZW6A 4LHVA 4TTPA 2BC9A 4BFVA 1G7RA 3I1FA 4BY1H 3S15H 2ORIA 1CS4C 4AKEA 4I1UA 4GNXC 4GOPB 1RC8A 2FFBA 1UAAA 3GTQH 1QVRA 2A5GA 2DFNA 3DOFA 3VAAA 4ZIRB 3CX6A 5FFMA 1Z6YA 5IT5A 2AN9A 3A58B 4XWOA 5KSYA 1OH6A 3K0AA 2FGKA 3RS5A 3A5UA 3CW2A 3HU1A 1QHIA 1VDZA 3K0EA 4LUOA 1EFRA 1XPOA 4LV6A 4GZMA 3TRFA 1ESNA 4B75A 1E6CA 1KRSA 2HIXA 1R5BA 1P9RA 4YDSA 2FF7A 4IEIA 1PUIA 2FPKA 2QM7A 3PVSA 5EZ6B 3K53A 2GCPA 1YR9A 4JI0Q 4DDVA 1Z0FA 2WTUA 3M3YH 3UG7A 5C46F 1UFQA 4A3KH 5K8IA 1NG9A 5JSZA 1VIAA 1L2FA 4XJXA 3ZVMA 1SHZA 1XMVA 3H86A 4W5WA 5CLLA 1FL9A 1N36L 3I55A 3GJ7A 3Q3JB 4MRRA 3VTKA 2AL7A 4ME3A 1LV7A 4DBLC 5FBRB 3MEFA 4DUGD 4PAMA 1I3QH 2RF4A 4X62L 1VQ4A 2EW1A 3IQXA 4RFVA 2K4KA 3TUJC 4XVQA 3T1VA 3L2PA 4OHYA 2DPXA 3C8UA 4UNNA 3LDAA 1S1CA 3ER0A 3GO5A 3BFKA 5DI3A 3ZVLA 4LNQA 1OHHD 2JA8G 4CF7A 4TMZA 1VYUA 3W3ZB 2DFKB 1UF9A 4QL3A 5IYDG 5GAEC 2WICA 3CC7A 4S2EA 3RNUA 4O0MA 1F2UB 4APVA 4NCHA 4NE2A 1SXJD 2O8CA 1KZGB 3WHLA 2PI2E 1KOFA 1MRNA 3SBEA 3KQLA 5FOUA 2W6ID 4Q48A 2FSGA 1KSFX 3ZYCA 4DCTA 2IS1A 1VQ5A 5SZIA 1PH7A 4PFSA 1RIFA 4LYHA 2DWPA 4A15A 3CMEA 3IO5A 3S24A 3UMFA 4BBSG 2ZRDA 2DWOA 3KKMA 1L1OC 4JL6A 5GJWC 5G3YA 4B76A 1XD9A 2REBA 1S1MA 4IPCA 1IOZA 1UDWA 3I73A 1F3OA 4JI0L 3VR6A 3CPEA 4EAQA 1UEBA 2D74A 3P32A 4Q4JB 2FEOA 3AYHB 4PG3A 4DPGA 1Y63A 1E2NA 1Z2AA 2C78A 2IXEA 2CVHA 1M1KC 2D2EA 3AGQA 4LJ7A 4P4SB 1EYGA 2X2EA 5HCIA 1EFWA 2KHIA 4MITA 2NGRA 4U7DA 2XZOA 2E2HH 2N42A 3H0KA 4Q4HA 4NYIQ 1AE3A 1IN4A 3U60B 8OHMA 4A0RA 4U5XA 2AMCB 1R8SA 1YE8A 5C3EH 1JB1A 1OE0A 4YHHL 4M9QA 4B2IA 2FOLA 2VA8A 3GMTA 4M4SA 4R4OA 3VNVA 3PSIA 1U9IA 4LGMA 1ZRHA 4D0LB 4W9MC 4CEJB 3KYHC 2IYSA 5EP4A 1NBMA 4D2IA 2KCTA 1TEVA 3CF6R 3PIOA 3T1YL 4JI7Q 2DWQA 1LW7A 2WSMA 3L8ZA 5D3MB 3ZJYC 4A3EG 1A82A 3EZFA 4DHEA 4DZZA 3ETLA 2P3SA 2QAGA 4E22A 1W2GA 2FGJA 1E9CA 2PJRA 2O8EA 4OJQA 4DXAA 1X3EA 4CGZA 1NKSA 3B13B 3M7NA 1XX6A 4A3LG 1V5WA 2O52A 4A2PA 4OI0A 4IPHA 4B3SQ 2E87A 3ZIAD 4NHOA 1E0JA 4LOAA 3LAWA 3E70C 3QKSB 2VEDA 1G6HA 1KJWA 3ERSX 4OX9L 2JQOA 4Y7NH 2GCNA 2QE7A 3IPYA 4Q4LA 2D62A 4D4MA 3NENA 4GNXA 1Z0JA 4JJZA 2PQAA 1E2QA 3TW8B 2ZRCA 5CB6A 1A62A 4O2DA 1CKMA 1TUEA 2DCUA 4PPQA 4LJAA 1HH2P 2XZPA 2ZUCA 1U81A 2JLRA 5FR2A 4JBWA 2P0EA 3UIEA 1U98A 2P5TB 2J7PD 2BMEA 4URZR 4V02A 3EARA 1HQYE 4L5SA 5KSOA 1UKYA 2E1RA 3IIKA 5AUQA 1KSGA 1W5SA 2CHGA 4KFSA 3RS7A 2E9SA 4LWZA 4K0KL 1A4RA 1II9A 1GO3E 3FDIA 2OM2A 2QZ4A 1YI2A 1ANKA 1K6MA 3TKLA 2MMGA 1X6VA 4DLTA 4EPWA 1JJVA 3ZD7A 3J7A5 3WYAA 3H4MA 3S1AB 4XSGA 1I94L 4NYIR 1F5NA 4HAZA 1US8A 3GTMH 5FJ8H 5F9HA 3M4OH 1OFIA 3BK7A 3TSZA 4C2TA 2Q2UA 2C35B 4Y0VA 4O25A 3X1YA 4GLAC 2GEUA 1E0KA 1P9WA 1U8AA 4MYTA 4Q7MB 3RVBA 1K8GA 4B3SL 4XWKA 1N5LA 2VHUA 1P72A 2UVQA 1ZINA 2YU9H 3VX3A 3Q5EA 4Z54A 1Q86C 4LBVA 2ZTEA 4FW9A 4FCVA 4AWXA 1X3SA 2R7FA 4DR2Q 1L4YA 3D8BA 2VL6A 2CJWB 4JLAA 2Y0SE 1IBML 1LS1A 4KBFA 4PPGA 3RRNA 5DLQC 3QQ5A 3U58A 1VQNA 1Q22A 2EVWX 1YRBA 1E79A 3NC1C 3RLFA 1E2FA 3K9GA 3DKVA 3PQCA 3PGZA 3CX8A 4DT1B 3STBC 4P32A 4WJ3M 2PX3A 4O2LA 1VYTA 3L82B 4P4UA 5BW8A 1WF3A 1EX7A 4ASUA 3X1XA 3HOYH 1GKIA 2GVDC 3EAQA 2ZR0A 3MWYW 4L9WA 1C1YA 4R98A 4UKDA 4OWWB 1XTDA 3I56A 3R7WA 2HJVA 3BZKA 5CB8A 5GROA 1DAHA 2OBMA 2MFIA 2ZJQA 1EFTA 2YOHA 4WZBE 4QRHA 1N6OA 3UE1A 3UDXA 4QJFA 4GT1A 1Z0AA 2P5SA 2W6JD 3B1WA 5FTMA 3K70B 5L3QA 4OO1G 5FPSA 1XTIA 3T1OA 2B7CA 2C8VA 1K5DA 1RRPA 3WBKA 1F2TA 3KJPA 3E9HA 2D3WA 3CNNA 3PEUA 5EUMA 1SHKA 2IWHA 4JLJA 5C3EG 4B3BA 3W8RA 1XCMA 2UXCQ 1CUKA 2GWHA 4GS3A 2GVAA 1ZIOA 3RSLA 4ESHA 1FJGQ 1U94A 3FGNA 4A3GG 2I5MX 2NO1A 2XJ4A 2Z4SA 4IVRA 5G40A 3RS4A 4YMUA 5KTYA 1FFHA 2C9YA 3X1WA 2ZI9A 1N34L 4DEYA 4DR2L 4XSHA 4DC9A 2O8BB 1HT1E 2BMJA 1B70B 2F3RA 3THXB 3ZJYA 5J5CA 4RD2A 3W3AA 3EC1A 4BECA 521PA 5K8TA 3KKOA 3QUSA 3VU9A 4A36A 1II8A 3U44A 2CL0X 5KOYA 1BKDR 1P4SA 2V9PA 4OJKA 4ABYA 2PZGA 3KLWA 4Q4AB 1JEEA 4Q9LA 4TYQA 3PV0A 2GXQA 5J4KA 4P31A 1ZU5A 2UXDL 2GAAA 2BKEA 1E9EA 5FUXA 5L3VA 3C15C 2Q2IA 3CCMA 2QEQA 5C0XI 4UP9A 3M85A 2A5YB 3CRQA 3U7HB 2FEMA 3AQQA 4R2HA 3FKSA 2GILA 2HXSA 2Y8EA 4IOMA 3T5GA 1ONBA 5KHOC 3J80c 2ID0A 2LXKA 1SKQA 4ZDIA 1SQ5A 4L16A 1DAEA 2NTYC 3MRSA 1XMOL 1H8HA 4LYAA 4C0BA 5DN6D 2MQHA 4TYPA 5HY6A 1UADA 3NDPA 1Y14B 1KKMA 2B6HA 3SFZA 4MUAA 1FNNA 3WMFA 1GL6A 2UXCL 5C4XH 3K0XA 3HOUH 4GOKA 1W3SA 3I4LA 5IHPA 1KXLA 4AIMA 1OH5A 1V1QA 4NTZA 2HHHL 3LBIA 3SOPA 2GA8A 3CRVA 3GLGA 2BEKA 2PEYA 1SE8A 1Q81C 1E1RD 1Q1BA 2KBNA 2C04A 2OUKA 1K3RA 1P5ZB 2YOGA 3R9XA 1V9PA 4D0GA 2B21A 3F2BA 4CT5A 1BMFD 1VQDA 4BFWA 3A6PC 1HV8A 2MSEB 2FX3A 4HDCA 1CRPA 3A4MA 3PG5A 2KBFA 3BS4A 3J81j 3WYGA 1E1QA 2OLKA 1Q44A 2H92A 1KMHB 2PLRA 2ZPTX 3KTAA 1MABA 2VRWA 4LX0A 1XNQL 4C0LA 3AKCA 2WM9B 2N3SA 5M3FH 5FPHA 2UUAQ 1BOFA 2ATVA 3QEJA 1SLJA 3FKIH 1OYYA 3WP0A 4LF7Q 1NSTA 4NB3A 4PC7A 4NYMR 1XXHA 2KSQA 3A1WA 2YTVA 3OEHD 2WBLC 3UDFA 2WAXA 2H5XA 2XNDD 2AXNA 2FPLA 4RFSA 1KI6A 4U02A 2VPPA 1XEFA 3B82A 2ZE5A 4BZXA 2QBYB 2QPTA 2VLIA 1MO4A 1IQPA 1DVRA 1L4UA 5KSZA 3TREA 4L5RC 1VQ6A 4OYHA 5SZHB 5HE9A 3LQRA 4OK3A 3NELA 5LD2C 1DEKA 2FG5A 2HIVA 1PYSB 1UBEA 2GF9A 2WHXA 4PC6A 1CIPA 3T06B 1E4VA 3S1RH 2CHVA 2F55A 2QSYA 3OW2A 4QG7A 1QUQB 5KDDA 5HKKD 3TH5A 2ZJAA 3CPHA 2BDTA 3I4MH 1HR0W 1BH2A 1P9NA 5JEDA 1P8LA 4UNRA 4L9SA 3IEVA 4RG1A 1Q82C 1DGSA 3BFVA 4HZUA 4IDQA 3U7EB 2XJ9A 3NEJA 2HLDA 2PBRA 4DLRA 3TIFA 5GAHC 1NMZA 4GLVB 2ZSAA 4WW0A 1SFOH 1Z47A 2ODWA 3MGCA 5CK5A 2F3IA 4LFAL 4M1KA 1LS6A 2KE5A 3D7MA 4B35A 5F98A 2UUAL 4BY7H 4NMMA 3N2IA 2B92A 1NN3A 4HDQB 1E1TA 2V6IA 2Z83A 4JV5Q 1CTQA 1UKZA 1I5FA 1S9HA 2CCJA 5DYIA 3J81k 2N78A 3CPJB 3K81C 1XNRL 4R4IA 1Z6TA 4JLOA 3GP8A 2RHMA 2LXJA 2ZE6A 1RE0A 5TY0A 2QRNA 4IKEA 4ZDKA 4DR4Q 1FTNA 4DCSA 3AVUA 1QHHA 2E2JH 3KZ1E 2GJSA 4YWMA 2CNWA 5AJYA 1J7KA 1DARA 2ZRHA 1FX0B 5JRJA 3LRPA 1FQKA 2OCEA 3B1VA 4ACBA 4D4JA 1CULC 4UNQA 1A8VA 1JXOA 4PHFA 1JALA 4LI0A 3GTJH 3K0FA 3G0HA 2QQ0A 3V4RA 2K5UA 5FBLB 4DLXA 2ATXA 1CSQA 2E5LQ 3PO3G 3IKJA 5H1YA 2R6GA 4DCNA 4YCWA 3KDFA 1KI9A 1NY6A 1QHNA 3B1YA 3WYFA 2BWJA 3EIVA 1K0RA 4IW3B 5GJCA 3EZ9A 2J0SA 4HAUA 3RR5A 1VQJA 4DV7L 2CWPA 1SZPA 3B60A 1TAGA 3K9HA 1Z83A 2IYQA 2O5VA 1ELOA 1YZNA 2ZI5A 4TT3A 4X8LA 2IWRA 1VQ7A 2HV8A 5C0XG 3BGWA 1EWQA 1N9WA 3H1TA 1KJYA 1XEXB 3SU8A 4BLRA 4NCKA 1YBYA 3WWVA 3WP1B 4D25A 3G4SA 1OXSC 4JC0A 1JQJC 2C03A 2WAYA 3KB1A 3BC1A 1NVVQ 2ZIAA 4MKGA 1VQCA 3IQWA 4P4TA 2ZYTX 2OG2A 4DDWA 1HYQA 4YDHB 4G5SA 4ZCMA 2AFIE 5FTJA 4QBIA 1KC8C 1OYWA 1XXHE 4JSTA 4PO9A 5FTLA 5J4VA 1GITA 3RS0A 2SHKA 1QRAA 2JDIA 1EOVA 1IHUA 2R6FA 4A0HA 3KQHA 2IYWA 1XD2B 3AKDA 1N0UA 1SVOA 3MWJA 2JLUA 4A4IA 4IFDI 5DI9A 4LPKA 3SDZA 3EWSA 5IK2A 3DEFA 2XGJA 4FMBB 3SI7A 1D2NA 4RMFA 4KBGA 4JYBA 3ZS8A 3FKIG 1GRQA 4KHPL 3MSXA 2ZRLA 3LQQA 3K8AA 4BLQA 5KU1A 1IAQA 1KK0A 2A78A 2J0UA 3EZ7A 2NO6A 3Q5DA 5BQ5A 4PSAA 1VQ8A 4A76A 1P62B 4MQBA 4MZ9A 1PH5A 3AVTA 1XCPA 3CUEF 3G48A 4BXXH 2VP6A 3O47A 1EFUA 4JI1Q 2WWHA 3OIUA 3QE0A 2IUUA 4DLYA 1GILA 3PEWA 2VUMG 4B47A 1E24A 5F2EA 3A4LA 4RZ2A 3NBHB 4NCIA 4C0HA 1Q8KA 1KAWA 1UE1A 2BM1A 4MDEA 1ZYUA 2MSCB 4TQ9A 5AJWA 4P74A 3L2OB 3I4MG 1ZNWA 1Z63A 4QBGB 3ADDA 3Q8DA 4DR3L 5C4JH 3AF1A 2PCJA 4P75A 3KKQA 4JL5A 2Z43A 3D6TB 1ZM9A 4DV3L 2XSZA 4ILEA 1OT3A 3I4NH 1S0UA 5JCZA 3GLIB 1A1VA 2VQFL 4IEEA 2YTYA 4DLVA 5HTKA 1S9DA 4G1UC 1J6QA 1LY1A 1EESA 5DYGA 2RHSB 4HJAA 1XJQA 2PZFA 2XTZA 4RD1A 3DO6A 1NVVR 3CPFA 1FUUA 2AK2A 5M3MG 2G88A 3LD9A 4DR6Q 2FSHA 3CCVA 5FOSA 1R0ZA 4HI0E 4LW1A 1UE5A 1TMKA 3TAUA 1SXJC 4ZKDA 4NZYA 3PIPA 1FP6A 3WNDA 1MO5A 2ZRIA 3AEZA 2KENA 1N6KA 1S96A 1GSIA 3RN5A 3RRMA 1W1WA 4A6XA 2JLXA 3RLOA 1SGWA 3EPHA 3M4PA 5JJKA 2GVBA 3EIEA 5FLMH 2QT0A 3HPQA 5IP7G 3ICEA 4MA4A 3O8CA 1TQ2A 2X77A 1ZMXA 3KJEA 3OHMA 1NNEA 4HIMA 3M4YA 1M7GA 2JIZA 3OF5A 5IDVA 1NMYA 4B3MQ 1K9MC 1KI4A 1Z6AA 3LX5A 3SYLA 2QI9C 2ZUDA 2Z5FA 1RYHA 3CWZA 1XWIA 3LV8A 1E9SA 4JVLA 4LJ8A 4PX9A 1KY2A 1WRBA 1J5EL 1Z22A 3GTLH 4A92A 1VKJA 2BMDA 2QUZA 2RGNA 2UKDA 2WKPA 4GPTA 4L5TA 4WZAE 5DE3A 2A30A 2K5VA 1EUJA 4X65L 1OKKD 2MMCA 3BJIC 1IM2A 1JJ2A 2YWFA 2DY1A 2A8VA 2R65A 3I32A 2H18A 3PXGA 1QVCA 1M7HA 4AY2A 2HUPA 3GEIA 5BN5A 1Y1VH 2ZRFA 3THYA 2EFCB 1OV4A 1KIMA 3AM1A 4Z1MA 3EN2A 2J87A 4E03A 4EFMA 4AI6A 1KJZA 3GLHE 2Z4RA 1O3YA 1T8TA 3X2SA 1G5RA 1YEZA 3IDQA 4BFSA 4A82A 3KJOA 3EXAA 5J47A 4RKFA 4RVCA 1T91A 5LB2A 2ZRBA 4AK9A 5C18A 3NHBA 2V1UA 1ZBDA 2Q3FA 1QF9A 3CZQA 1S3SA 4MYUA 4HB4A 2JASA 2XOKD 1DOAA 1N25A 3REGA 4CEHB 1FP7A 2IYUA 1JAIA 2D2FA 3OE7D 3OAAA 1IJFA 2FV8A 2I3BA 621PA 4WXRA 3AV0B 1XZQA 4GDFA 1S72A 3L0SA 3QXXA 4LC0A 1EWIA 2HJGA 4ZDWA 1KI2A 1NF3A 3KL4A 2WSSD 4LK2A 1OJLA 3HYRA 2VS1A 3EPKA 3A37A 4DLUA 1UE7A 4XWAA 2VHJA 2YYZA 1EWRA 3TUIC 2WKRA 2WWYA 1E3PA 1QBKC 4EQ5A 4IPDA 3K1JA 3QNUA 4AYBG 1GOTA 2O0HA 3IUYA 2ZRPA 2BVNA 4TVAB 2W2VA 2VQSA 5L8VA 2H1LA 1WBBA 5FR1A 3FHOA 3HKSA 1AS3A 3HPRA 4JMPA 1XP8A 2RGAA 4A3BH 4Q21A 1NY4A 721PA 4IFDG 1M6NA 2OAQ1 4TMKA 3VHXA 2CL6X 3F5FA 1NMFA 3H0GG 2VHTA 1XNJA 2MSDB 2ZS7A 4ZKEA 5M04A 4HJ8A 4LWCA 2G6BA 3KJHA 3SJBA 2XTMA 2HEIA 2WWWA 3ZDQA 1HA3A 4BEBA 2QP4A 3E2IA 1Z2CA 4PZZA 3EIQA 5EUQB 3GDEA 1PHJA 4A1FA 1XB2A 4JVSB 4CZ2A 3S1MH 1CJMA 5IYBH 4GOPC 4WIAA 1ZM4A 4JLMA 3K0AB 3AF2A 3K0CA 1KTVA 3B1XA 4IDPA 4QFMA 3R8CA 1WA5A 3T12A 2ZM5A 1W36B 4QGFA 1G3QA 3K9LA 2Q21A 3PEYA 4HLUC 4V03A 1G21E 2F9LA 4PHHA 1JPJA 2QG6A 4RZXA 3EBEA 1N33L 4OK5A 1D6JA 2DHRA 4KVGA 2XTNA 4DSOA 4HIOA 3HJNA 2JCSA 2ZI6A 3RABA 2JJQA 2WAQE 3A1TA 2WOJA 2JA1A 2ZRMA 2RGGA 1OXUA 1TWGH 1YHBA 3PUWA 3IHLA 4XVUA 2FFAA 1OFUX 1X54A 2QT1A 3M4QA 3AVPA 4KLZA 4M21A 4OK6A 1K5GA 1FPMA 1VCIA 2Q2HA 1OB5A 5J4YA 2ZYWX 5M5WH 4IOLA 4ZO4A 2NQ2C 3CQZH 1ZCAA 2B7BA 3AVOA 4JKIA 4TN1A 1C0AA 2IX1A 1KNQA 4H1VA 1FZQA 3L8YA 3HDTA 4HAWA 2BCGY 4EPYA 4PSVA 5DI3B 1HNWL 5LDDC 1KHIA 4HATA 4AQYL 1ZD9A 4LJYA 4EIWA 1U99A 3NBFA 3GCGA 3QF4A 1CKNA 1NTGA 3TSOA 3FOZA 3RRYA 1E9FA 1XTJA 2QMHA 3OFND 5BYJA 3UK6A 1CR4A 2OTLA 5G3ZA 2NVQH 2FPMA 2QP9X 2O8CB 3T1HQ 1VQBA 4RSGA 5JHGB 3FB4A
chains in the Genus database with same CATH superfamily
4GX2A 1V95A 2ZTVA 4DCVA 1D09A 3DLAA 4HWPA 4AJ9A 1FA9A 3IVCA 2MNAA 4IZHA 3SQNA 2OSBA 3IR5A 4ITUA 1Z13A 2Q0SA 3F2UA 4KQ9A 1UE6A 4IQFA 4DLSA 4ZV4A 3G89A 3KT3A 1GGNA 4D6XA 2EWVA 4DV4B 2OORC 4HPWA 1A5BB 2GTHA 2GPAA 3ZHQA 3DFMA 2PZWA 3BN3A 1PZID 8ADHA 3DZIA 3NM5A 1XZ8A 4AXBA 3L4KA 4W6QA 1I4LD 3NM6B 3LKBA 4E51A 2VRNA 3HZZA 3DTVA 5IZCA 1SD5A 4BMDA 2OV2A 1K7XB 4BBRH 2IYVA 1W29A 3PIRA 1YZLA 1J06A 4JENA 5CYGA 2EARA 2ZJZA 1N5JA 2Q1XA 4ZOEA 1EK5A 2F1MA 1TQOA 1QG4A 1YONA 3E3OA 2HFKA 4NPHA 1C8BA 4S0ZA 4OYLA 1B0UA 1CFZA 4BY1G 1EE1A 1YZQA 3KALA 4KN7C 4NKLA 1E6UA 4DMFA 5C44B 1JG7A 4C0AC 1E69A 2A5DA 2BCEA 5ER9A 4LOKA 1U5KA 4ZD6A 1M6WA 3GTOB 3NWBA 5H70A 3HABA 3OIVA 4JYCA 3PDHA 4PX2A 4C4RA 3QO2A 4H44C 3NTRA 1RT9A 5JDCA 2WWTA 3MMPA 4ZAGA 3EX7C 3VYSB 4LF4B 3NTQA 2ZP1A 4KG7A 3SZOA 4II2A 2K5DA 3E7PA 2GNPA 2BFEA 1F3LA 2CD7A 3V34A 3K1ZA 1UBSB 1QU2A 3TW8A 2JXMB 5JD3A 3SQLA 1STOA 4BZPA 1Y5MA 3BE4A 2LSSA 1H22A 3ICOA 3JU3A 1B23P 4DV1B 3E9MA 5IODA 3ZHBA 5IM4A 3T1YB 3QUQA 1X7YB 2CBXA 2YHIB 4OG2A 2A0FA 5EAYA 1K0UA 3RUPA 1XXHB 2R60A 2FWRA 5T4HA 5GIPE 4LF6B 5GV8A 2G9QA 3QIVA 1QZHA 1FYWA 2E0IA 2NTNA 4A93B 1YMQA 2XF8A 1G7TA 3OO1A 3HJRA 5KTRA 1E96A 5HGJA 4RLHA 4KV9A 4PLHA 3WYEA 2KWIA 2VNUD 1Z75A 3DWQA 2I1QA 3PFWO 1IBMB 2VO1A 4HDSA 1WTAA 3TXYA 3DHWC 1IJEA 2UYCA 2XWJI 3ELDA 4UM9D 4PQFA 3NKFA 5E1DA 1VDMA 1ZD4A 4BRZA 1ZN2A 3Q0IA 2OAEA 2HPVA 5IKMA 1R6BX 5CMLA 2QAJA 5FOTA 1IL2A 5C8VA 3ZH9B 1QNKA 4F97A 3MGKA 3EEIA 2E2DC 2VDWA 2I2WA 4LSGA 4JJ6A 4FWTA 2HF2A 2WUFA 1FR3A 5LIRA 2I8CA 4JI5Q 1ORDA 2BP7B 1Z17A 1HF3A 5ADHA 4RVNA 2F3TA 3JVVA 3BT7A 3AUXA 5AI5A 1NQWA 2AG6A 1AK2A 4JV5L 3OLXA 2B0JA 2FOXA 3DAOA 3VZDA 1M6YA 1GSHA 4JJ7A 2C5BA 1T3HA 1PDOA 2ZWPA 3RKSA 3J80E 3SEZA 3P94A 3ILYA 3COJA 3H11B 2BGLA 4ZVVA 4D9EA 5AM4A 1XMSA 2Q9CA 5CD1A 1K8ZB 4I9NA 3NQ41 4ARZB 3WJ7A 4OXQA 2NT3A 1CQVA 2HHCA 2AQIA 4X8OA 2RI0A 2OBFA 3IEUA 3GH3A 1UPFA 1AJEA 5SYNA 2GLTA 1ZQ1A 3A74A 3R7FA 1ZN8A 5EWJB 1XEXA 2RHHA 4M0CA 1G2OA 4NZNA 1YVPA 1NBHA 1U1EA 3BWXA 1VP3A 4KFCA 4QA9A 2C4NA 3BMQB 1I4TD 2FK7A 1TM3E 3QXHA 2GBCA 5EZYF 4FMCF 4UHJA 4A3MH 2NADA 3ABOB 5ELEA 4F21A 3U1VA 1L4NA 4KKTA 1R0WA 1TLTA 5BRAA 3AOEA 3C14C 3O4IA 2GJ9A 3VHXB 2ZYVX 2Q3EA 3JWPA 4BNZA 4NMWA 3HSKA 1OZHA 1V7CA 2BH8A 3E5RA 4F9EA 4V0RA 1ECCA 3IT1A 5JCJD 4ALLA 3UT5A 1KKUA 4F4DA 3K7AB 3L6DA 3QENA 1RJ9B 3S1QH 3ZG6A 3S2UA 3F5QA 2VNKA 4XW2A 4CG2A 1M6VA 4WI1A 2A86A 2W2XA 3K96A 4CUJA 4GKKQ 1N2ZA 4PZYA 2OZLB 3TVTA 3IJEB 3VU8A 4XDYA 1JMCA 3LIPA 3SIXA 1GQRA 1TNDA 1KK3A 3GLFE 3MIIA 2C8JA 1TJ3A 1CKOA 1H3NA 4Q7KA 3VDMA 4LY0A 4OBBA 2PX2A 5J58A 3K94A 1LA2A 421PA 1UEXC 1NW8A 2ZATA 1GU0A 4MVJI 1SR8A 4Z7OB 3OMCA 1MV8A 3V48A 3EBOA 5B1YA 3JAMc 4R05A 2QTHA 3LX8A 5KX5A 4Y6GB 1QYIA 2QX8A 5C4GB 2B82A 1XL0A 2V8BA 3J81A 3ZPXA 3G9XA 2R7DA 3WRYC 5CA1F 4QREA 4ES6A 1BBWA 2CQAA 3W1VA 4QJIA 1ZM7A 2ZROA 3MCWA 1UAYA 2E48A 1YITA 3MT0A 1XVIA 4Q0FA 1JZQA 4NR0A 3OU6A 1TAQA 1H5UA 4ZZ1A 3EPLA 1C8CA 5IMBA 4HEHA 2DQYA 4B3DA 3MOGA 1X13A 3NKVA 1J42A 5FOVA 4YI3A 1YFJA 2V55B 1D2EA 1R64A 1QE6A 1ZNYA 3AIMA 4IJKA 3FI9A 5HBRA 4YUWA 4GL2A 3U2QA 3INTA 1I50H 2ESRA 4ME6A 2RHWA 1F2UA 1VE7A 4A6EA 4WGFA 2I76A 2AG8A 3E2PA 1XQ1A 3C2PA 1TWCB 3FMIA 2V6FA 4HB0A 2EQBA 2R86A 2VDMB 4UM9B 1MBYA 3EK2A 2RGDA 1LGYA 1Z5ZA 1WI5A 1YZVA 4ZICA 2Q4RA 2QF7A 3AI1A 1JA1A 4IUNA 2OORA 3I4FA 2GWRA 1JYEA 1F8FA 1IHOA 4RA6B 3UMJA 1E1RA 2FDXA 3QKSA 3TZUA 3H2SA 4HX5A 4JI0B 4NZOA 4F2WA 4Q82A 1JFRA 2UXBQ 3G82C 4DJTA 2BTOA 5A04A 3OE4A 2AEEA 1O95D 5CP8A 3S1SA 3AK4A 3C4VA 1XMOQ 1I5EA 5CM9C 4K6CA 4HVLA 4XQ9A 4IH4A 2P27A 4PNPA 4O4IB 3C1AA 3V4FA 4C6HA 3L4JA 4M46A 4LX8A 5HKKA 5GVRA 2DCMA 3KK0A 1PV1A 1J0XO 3TAHA 3PI6A 2W83A 1RADA 4GWGA 1F0PA 3TM5A 1E2ZA 2W2LA 1DKMA 1ZYRC 4JR0A 4Y6OA 3CVXA 4HWSA 1L4KA 3PHGA 1IK4A 5LOVF 4YCJA 4J0QA 4FBMA 4Q9NA 3CN7A 3S81A 2AOWA 1SY7A 3Q3IA 2N0SA 4LGVA 3PNYA 4IIXA 1EAMA 4ZVTA 4TXLA 4LOLA 1KF0A 2O8BA 4H0FA 3KJQA 1MTZA 3AR3A 1XYIA 4PAGA 1KE1A 3VX4A 3O4JA 4LFAQ 4GU5A 1Z56C 1M8AA 4CCAA 4RHXA 4UATA 1LTAD 1MC8A 3SC2B 3G71A 4GSYA 4P92A 4JLBA 4XQEA 3RNLA 1LT4D 2ZG6A 2K1BA 2Y1FA 2B34A 2INGX 3HFZB 1N9ZA 3UCFA 1TM2A 1NUUA 1TE2A 3SR0A 4FPXA 2XCLA 4BFLA 2RH9B 3QOYA 1LTQA 1PX2A 3WGHA 4R8SA 2ZQ5A 1F9EA 3PTZA 1FDRA 1DLJA 1KWGA 1W59A 3CT6A 4PLGA 1STYA 3VPBA 3LKDA 3VXKA 1CJUC 2OENG 4MS1A 2NVXB 1BDBA 3C8MA 4NK5A 3HO6A 1I6MA 5IARA 4N7MA 3EZ6A 2ZB7A 2ON6A 4KMOA 3GMDA 3MWGA 1YZYA 3IUEA 4EOGA 4LJRA 4J4TA 3DDWA 3RVPA 5TGDA 1ORHA 3OIWA 3L04A 2C2WA 2ZJ3A 1L7VC 3HVKA 2O2EA 4L5IA 5DXJA 4IICA 4WZ6A 2B1QA 4TX1A 2XKAA 4JJKA 4OTZA 3JAMi 2YFQA 4DNQA 4JUCA 5H3HA 5TMDA 4WCVA 1PFSA 2ZI7A 1C30A 2Q5FA 1Z5PA 3IAM1 1KDOA 2YWDA 4IOCA 4MRNA 1KI7A 2VH1A 4MWOA 4HTFA 1I7NA 4IO9A 3MA0A 2H4FA 1RMQA 2O7SA 3DS8A 4JVMA 3G8DA 4MNOA 4KX3A 4BNNA 5EYPA 2ETVA 2AE2A 5CRIA 2IZ7A 1U0LA 5HM6A 2UUAB 4LKRA 1KDRA 4A75A 4WLUA 5C5MA 4C6TA 2K7ZA 3IEMA 4DV5L 3PF5A 3RHTA 3CZRA 3AJAA 1FDWA 1M6VB 1SIWA 5KZMB 2RIRA 4MWTA 3HFSA 1RDPD 1KYZA 5DEHA 1K7CA 2DF8A 5MN6A 1K92A 3U1BA 3H5NA 2YASA 1VLMA 1JBQA 2FWAA 3TTWA 1KVQA 4EI2A 4M1WA 2WVHA 4HLCA 3AUAA 1W7AA 1G3MA 2E49A 3VVMA 1Y3HA 2FHSA 2RG1A 2BMAA 3EXG2 2PAFA 1NN1A 2K5NA 4UE2A 3GBPA 1SRUA 1MTOA 4OQMA 4KN9S 5IXYA 2KHZA 4E11A 3K0BA 2ZJ8A 3P2KA 4EJSA 1FFXB 5DNYB 4CQLB 4FHEA 1IBLQ 1PJ4A 1CDZA 1SO8A 1ETHA 2VWHA 3CHYA 2N3ZA 3U5ZB 3I64A 3MZ5A 2GN0A 4UTOA 4RGYA 5IC5A 2I1LA 4ARAA 3OZBA 5G4KB 3F2DA 4DTCA 1TK9A 3PXCX 4R41A 3LPAA 4A3EH 3EZ2A 1N36Q 5JSYA 3HRHA 4LFCL 1G8FA 3IR7A 1L0WA 5KMGB 1Q16A 3R7SA 2ECOA 1UCFA 1NI4B 3RMHA 3BTUA 3PYLA 4G8CA 4D74A 4BNIA 2ZDHA 5IT5A 5KSYA 1LK0A 1ESNA 3B52X 3VBEA 1AVTA 3F6BX 1YR9A 3H5TA 1Z0FA 2G4VA 4B3MB 1H4TA 3A56A 3KZOA 1T4DA 2QDXA 4MRRA 1OZGA 4DUGD 1I3QH 3Q0EA 1Z16A 4CF7A 2JA8G 2KLHA 2DFKB 2JFQA 5FWNA 2IOQA 1F2UB 2YJNA 4CR6A 1I8TA 3SD7A 1ZDMA 2QW7A 4NJMA 2XUOA 2P41A 5CV4A 1O4WA 3AR4A 5H8WA 2GYWA 4ZQIA 4U7DA 1EFWA 3GTMB 1IZ7A 1R5JA 4L5YA 3UWDA 1L8OA 1S5DD 1QPBA 1X39A 5KAPA 3MJDA 4IJQA 3AZPA 2QZZA 1LW7A 3HB1A 2JCYA 1SC4A 3DG9A 1NKSA 1GTL1 4IEFB 3X3MA 4CGZA 1U7DA 3D8GA 3O83A 5THQA 4MUHA 3LNTA 3QKSB 3WRYA 4P4NA 3WAJA 5J2UF 4YGXB 4MO2A 4LZWA 5CORA 5BOSA 1NTRA 4RCNA 4GEGA 2W71A 1YVUA 1EI9A 4I46A 1TR5A 3J7A5 3UM9A 1US8A 2XYGA 4FNMA 1ONPA 1IVNA 3ORRA 4M9CA 3T7DA 2Y0SE 1Q0RA 2BFPA 1SAYA 4I1IA 3PC3A 3DKVA 2GYVA 5K6TA 3L82B 4EJ0A 1P5FA 4HJXA 4UEKA 1C1YA 2HQRA 1Y9EA 4H77A 5BUZA 2YOHA 4QJFA 4GT1A 1FNWA 5FPSA 5L3QA 3T1OA 2D3WA 5EPOA 3WWOA 1SUFA 3G1WA 4PHCA 1QB8A 5C5CA 1QGAA 1FJGQ 1X1BA 3RS4A 3UEOA 3FKIB 3KSBC 2O8BB 2BMJA 4BECA 3Q1KA 4CTKA 4WVLA 4F56A 4K88A 2XQFA 4M55A 4IH9A 2B37A 4RGVA 4NEHB 2F0HA 2LIVA 3O8OB 1OU4A 4R2HA 2GF2A 1AV7A 2Q41A 3GIDA 4N54A 1DAEA 1K8YB 3RSGA 1NOJA 1UWLA 1QFXA 3CH6A 4BIMA 4YRFA 4L8VA 4GYWA 1QB7A 3UPDA 1PGJA 1V1QA 13PKA 4LVCA 5T4FA 3N28A 3OQOA 2WE7A 2GNAA 4BP3A 3KJZA 1RQRA 2IU6A 5F2NA 1SLJA 2JK1A 2KSQA 3H9UA 2Z9CA 3NK9A 4L8JA 4ZEVA 4U02A 1H6AA 4MS1B 5LLDA 5HKLA 1T26A 1LSSA 4PC6A 2UZ4A 3UJDA 5A1TA 5BSFA 3IEVA 4DADA 2WHRA 2B2WA 1WO8A 1RLJA 2XJ9A 2ZSAA 2K03A 2HRZA 3OIDA 5CK5A 3ZWOA 5KVQA 1VFNA 2V6IA 3FY4A 4KLCA 1FK8A 3U7QA 1WX1A 1NZDA 1EQ2A 1RE0A 5FWAA 1JDUA 4YAIA 4QPNA 5H83A 2C54A 4CQJA 3VAYA 2XT9A 1QK4A 4LTDA 1TJNA 1A8VA 2P4UA 1CEYA 4QFBA 3HLKA 4HTFB 4HN7A 3HUUA 4L2IA 4X8LA 5CVDA 3P2IA 5G1PA 1QQAA 2CXQA 4NCKA 1Y9DA 1PYOA 4D0RA 3TOCA 1U2EA 2P9EA 4AVYA 3NTKA 1QRAA 3HYSA 1V9LA 1L7DA 1IAVA 4JFRA 4BYMA 2GAFA 3ZS8A 1SEVA 3MSXA 1LSUA 2ZRLA 3K8AA 3W8EA 1H05A 1THZA 2JAWA 3GELA 2B99A 3WAGA 3AB9A 4C4TA 1D5XC 4JI1Q 2WWHA 4B47A 4P74A 3L2OB 4JYAB 3M2PA 2FZKA 1OT3A 3Q2KA 3FR8A 5IWCA 2VN8A 1BGWA 1ZYRD 3ZV3A 2RHSB 4RD1A 2FN7A 1NVVR 3EGCA 2XOXA 3KQWA 4J16C 1UE5A 1PR3A 1EFVB 2TYSB 3GEGA 1BMQA 3LT4A 3HRKA 5JJKA 4M3NA 4MDHA 1FTYA 1NYLA 2VCYA 1SIBE 3E58A 4IDAA 3I2IA 1NC3A 3FWKA 4PX9A 1WUHS 2V7PA 4DOMA 1OKKD 2DN8A 4P0PB 1Y1VH 5L53A 4KN6A 2H3EA 2IHUA 1OVMA 3IURA 3PJGA 2NU6B 4D9CA 2HRDA 1C7QA 1FP7A 4LE0A 1LTTD 1D4ZA 1BROA 4EHHA 2VNJA 4O2BF 4BWGB 4IUCS 3NANA 2WM8A 5AW6A 1E3LA 1WSBA 4JI8B 2GH1A 1ZIDA 3K5OA 2PSHA 5FR1A 1ISHA 1H9AA 3KYBA 4GVPA 3WGKA 4I4TB 2VDJA 5B58T 5EUQB 2D0DA 5FEMA 4GOPC 4C0XA 2OV8A 4U4AA 1KTVA 4YJ3F 1WTOA 3T7SA 2QG6A 2DHRA 5DGTA 4DSOA 1YC2A 2JCSA 3T3GA 2CDRA 2HQ1A 2Y1EA 3AVPA 4WMLA 3CQZH 1EEXB 4O5AA 1FFGA 2OZKA 1C5KA 3D4PA 2R11A 1H0SA 1SIOA 2QTTA 3CVWA 4BNWA 4GM1A 3DVLA 3MEQA 3ILSA 5B2FA 1VQ1A 3VZRA 1P75A 2ORVA 4NJMB 3Q41A 5IPFA 1AKMA 3GPDG 2BE9A 2WTBA 1VS0A 1JEAA 1ZUNA 4YAUA 1CF9A 2J32A 1GAJA 4EK9A 3NBMA 2QTNA 4Y98A 4EQOA 2IEYA 3QEOA 3T1HL 2I54A 4GR4A 4R31A 4NNJA 2YC2C 4YCLA 4XGKA 1X7XA 4ZCTA 5EPUA 4DR5Q 4R1UA 3V4PB 3T4EA 3VYRA 1LT3D 5BOSB 1QQBA 4BV8A 5ERXA 3A1EA 3HOWH 4O4HF 3RT1A 2XHEA 5BWLA 1D9XA 2ERXA 2F0UA 2OT2A 4QGSA 4OHJA 4A0FA 3VSEA 4RIGA 3LA8A 1YWGO 3MTQA 3NP7A 1D0IA 3Q0TA 2O3SA 1G16A 3TZKA 3VTFA 2CCGA 1HZJA 3SR4A 3BE8A 3RTAA 3N87A 1YR2A 2NPIA 2GJAA 2I0QA 5GWXA 3UGTA 4MO9A 3DEYX 4LJSA 1YNSA 4MULA 4BNKA 5LQUA 3EIFA 3MJFA 3OT1A 1Y6QA 4I4LA 4GOMD 4QUHA 2PRYA 3H99A 2EBFX 1G55A 4OAQA 4O2AA 3EEOA 1XMQQ 3CNLA 4HAOA 1GD1O 1EUZA 3F8SA 4HNVA 1HZBA 3K2BA 5ADVA 1AN9A 1GA6A 4R8NA 2RHBA 4JI4Q 5COYA 4NBLA 4LOIA 2P5UA 1D0SA 2VIIA 1VIYA 3R0JA 3IXLA 2YOFA 3N5CA 1CJKC 2O23A 1U4PA 5JANA 4WJLA 5TARA 4LRUA 4WY8A 3FNGA 1Z0SA 2WINI 5BT9A 2BHNA 1EQUA 1MIOA 3ADOA 2B2UA 1A76A 1M2GA 1NXSA 4OI4A 2Q2NA 4TMXA 2ZTMA 1FL0A 2HY7A 3KQPA 3V9PA 2RK6A 2EF0A 4ZYWA 3P9CA 1KRHA 3BQNB 4ZGWA 5EE3A 4OX9B 2QW8A 2R62A 4YQFA 1QU3A 2XQGA 2AUNA 4ENQA 4M8NE 2XUJA 4JODA 1UXGA 5EGTA 4JI2L 5E0KB 5TEVA 3I9MA 2XWQA 3R0ZA 4G5QA 4P22A 1WMBA 2NSHA 1Z33A 2WIIB 4PAOA 1P7WA 3T5TA 5K0CA 3PO2G 2KW5A 4RZIA 1GPH1 3U7QB 5FO1A 3W2DA 4GGOA 2FUG1 3CEJA 3GG2A 4B3IA 1MZVA 5ALKA 4RELA 1U0TA 4MWCA 4Q4AA 2W6ZA 2YWXA 1V16B 4L72A 4NBVA 2EYHA 3O4HA 2WM3A 2COEA 1V8QA 3BQ9A 4IIJF 2YWGA 1IB6A 4HYQA 4MJ3A 4L2IB 1IDOA 3WZ2A 4NVRA 4YMIA 1IXZA 3NFYA 4DGZA 5D6NA 2DBQA 5LUAA 3C5EA 1NOIA 4AUNA 3H13A 2OY0A 2IPOA 4I9UA 2X1VA 2X6RA 3GLSA 3F4KA 2XZDA 4MLPA 1V1JA 4RIHA 4IV8A 3PUYA 3FUVA 1N8NA 3QOJA 2GHIA 4TYWA 2LGJA 2XQJA 2ZTCA 1N6RA 1SCUB 3LFUA 1O9HA 1ZU4A 3JWGA 4W82A 1JRLA 2IC5A 4JU8A 1N2OA 1SQ6A 2CXOA 4UUBA 4QKQA 1U0BB 2JL1A 2VPWA 2BN4A 4BB6A 3ME5A 4BASA 1ETUA 2R5WA 5HFJA 2VG8A 1GEEA 2E8GA 4K46A 4JI3L 1E9BA 5AJZA 1BJRE 5I9OA 4ZTZB 2FKAA 4GC9A 1P74A 2Z95A 2KHSA 3AVQA 5JCPA 2DBZA 3NW9A 2IKQA 3PEEA 1CF4A 2I5LX 4BY7G 3LY9A 1M2EA 1PFBA 1FYFA 4NBTA 4Q7EA 4X71A 4QOGA 1RWMA 1D6MA 1PEKE 1FXSA 4UCQA 4MTLA 5C32A 3CS3A 1J2RA 3EGWA 4BQRA 4PV7A 1G60A 4X0EA 3RYCA 3FTCA 3UFXA 2A68C 2OB1A 1WF6A 5DW0A 1G38A 1R0SA 2NQ8A 1DXMA 2O2YA 4JLSA 3LGJA 3T3PB 2Z6AA 1QILA 1K1EA 1XU4A 5A06A 3N52A 2W00A 1PFMA 4I99A 1I0IA 3ESYA 3INYA 3W04A 3CMAA 2O0KA 3VZQA 3OMLA 3MEHA 5TGTA 2IUEA 4KHPB 4N8SA 4IALA 2AN3A 3O38A 1ZD8A 1RI5A 2XGTA 4PBSA 2A9QA 5ILQA 3IB3A 4C3IB 4R8LA 1BKSB 5EA2A 1XELA 1K98A 1IN7A 5LMNL 3KF8B 3ND6A 4WAUA 2B20A 3QTBA 3AF3A 2XRZA 1NW4A 4ZQCB 1VQIA 1T3ZA 5K3FA 4RY2A 3CUTA 4FNOA 1E9VA 4LE2A 5AI0A 1ZUNB 1OIVA 1YNND 3EUWA 1EXMA 1U31A 1T29A 3D4BA 1DXOA 1STAA 2FRXA 4JY7A 5AVZA 2PPLA 3KPJA 4O4LA 3GARA 1IEXA 5KWVA 2JLSA 2EY1A 3CH5A 2OZVA 4Z4HA 4J0KA 1UM8A 2HO5A 4RE6A 3B7PA 3GF4A 3D7RA 1MRSA 1GHJA 1KDCA 2HB6A 2BF7A 3AHFA 3SF8A 3NVKI 1JN0A 4R1QA 4IHQA 1TU0A 3EGOA 3ST7A 2WIBA 2DP4E 2HV9A <