2AWNA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
372
structure length
330
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 77
structure length 330
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awnA03
2.40.50.940 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awnA01
4C0QC 4M2LA 5C4JH 4HJ8A 1EX6A 4TMZA 5HKKA 5DO9A 2XGTA 1M2OB 3NHAA 2DWPA 1FMJA 4JI4Q 1TF2A 4A3IG 4FMBB 1OXVA 4A3DG 2BMFA 3DM3A 3PO3H 2Y0SE 2BH2A 3M1IA 1OPXA 5JLJA 2OTJA 2YWFA 2C99A 2LSSA 2XOKD 4POAA 1G1MA 4LFAL 4DAMA 2QSYA 1SULA 3DLLA 1OXSC 1IXRC 1QUQA 1C9KA 1L0WA 2H57A 2OG2A 3RS7A 1UWVA 4DV7Q 1R0ZA 2UUCQ 1I6HH 4OWTB 1C0AA 2WOJA 2PQAB 2B63G 3U2QA 4NCKA 1N5LA 4WXRA 5K8UA 4S2EA 1PZNA 2FSIA 2L15A 1ZM7A 3QKTA 1YZGA 4JBWA 1F2UA 4RCZA 5FUWA 1A4RA 4QIWE 4GZMA 3GCGA 3KJGA 1X1RA 3S17H 3BIFA 1RL2A 4LF8L 4EIWA 3S16H 5FI1B 1A63A 3EZ2A 2XTNA 4FDBA 2VHUA 5GJVC 2Q3MA 5DSZA 1OKKA 4PPGA 2K75A 1TMKA 1HNWL 1C7YA 4R2HA 2F9LA 2ORVA 1LF5A 1CXZA 2VF8A 2V1CC 1RZ3A 3RS0A 4EPXA 1TUEA 4B3FX 2DGYA 2GZDA 1G20E 4Q5IA 2CL0X 2B92A 2ZEJA 5FOXA 3T1HQ 1E9RA 2F52A 1GP2A 3T5DA 4GL2A 3IBGA 1K3RA 4PAMA 3KKPA 1RJ9A 4BRUA 2B21A 2ZJRA 5CM9C 4URWR 2RH5A 1ZUIA 1AH9A 4MGZR 4TZ0A 1OXXK 3RLFA 1JI0A 1CJTC 3K70C 2NZOA 5KNCA 4JI6L 2J0SA 2IS4A 1M7GA 5K8TA 5DI3A 4AYTA 5FH9A 2AMCB 1B7YB 1Z63A 1XMQQ 2IUTA 2PEZA 2ZJ2A 4QGGA 1CJMA 1A82A 1VQIA 1XD9A 2ZPTX 2ASEA 1IXRA 1G3IA 4DR1L 4ALPA 1CIPA 2HV8A 1XFAA 1XJQA 3SYLA 5JI2E 3ZVNA 3ZD7A 4Q4AB 4JYBA 4Q4AA 3V4RA 5AK0A 3GJ3A 2A2ZA 1S1MA 5JS7A 4B44A 1E98A 1G7RA 4NL4H 1E96A 3UMFA 2QMEA 2XEXA 2EFEB 4QG7A 4Z8XA 5LDDC 1M8PA 5EE5B 3X1ZA 2AX4A 4RFSB 1YBYA 4KLKA 3VR1A 2RMKA 3OF5A 1SXJB 4JI7L 2GHIA 3QPVA 1GUAA 5FLMG 3PQCA 1FGUA 1R5NA 1R8SA 4W9MC 3THWA 1B23P 1LY1A 4IDHA 2BBTA 1NNEA 4GLXA 1D9ZA 3OEEA 3TS0A 2ZR9A 2ZANA 5ELOA 2H1LA 4IHQA 2WBLC 3QXHA 3F2CA 3QUSA 1GNRA 4PZ6A 3EIEA 4BY1H 2I3BA 2R93G 2IS6A 2OXRA 3A37A 4P4UA 2P67A 1XCPA 1UKEA 2WSMA 1GD7A 4M4SA 2A3RA 3QG5A 1UE1A 2CCKA 2CWPA 3CF2A 3UK6A 2P65A 5DE3A 1Z47A 1XMOQ 2ZETA 3K70B 4PO8A 1EFWA 1UBEA 1G4AE 5JFGA 3MWJA 2ZRDA 3SI7A 4JJKA 2ZJAA 2F43B 5C4XH 4MKIA 1WP9A 1EK0A 4PZYA 1Z08A 5J4HA 5EZ5A 2RKOA 4FMDF 5B58C 5M3MG 1LS6A 4DDVA 1P6XA 3QSYA 2OLKA 1NIJA 1G4UR 1XJVA 1OHHA 2ATVA 3MRSA 3UE0A 2H92A 3KDFB 3L0SA 3KDFA 3RNLA 4PG3A 4BZPA 3IO3A 3D6TB 4GKKL 3I4MH 1JJGA 4FINA 4UNNA 2P0EA 1AM4D 2WJHA 2ZTSA 3NG1A 4LHVA 4HLDA 3N70A 1C1YA 3P4YA 2VUMH 2ALYB 3AV0B 5JEDA 2IX3A 3W5OA 4LF7Q 5DLQE 2FFBA 4OK6A 1P4SA 2VPPA 4C0JA 3B1XA 4L8GA 4MNOA 4DEXA 4E07A 1OJLA 2J0VA 3AGPA 3SDZA 2FGKA 4JZKA 1QZHA 2ZRPA 3FGNA 1O87A 4GPTA 1CR0A 3W6OA 2VF7A 2FMXA 3DHWC 1IBKQ 1ESNA 3HWSA 4IKEA 3WHLA 1CSPA 3C5HA 4IJHA 1IBMQ 1JR3E 3FPAA 5KNBA 5J3BA 1WA5A 3LNCA 2IYWA 3U58A 5L3RA 1Y3AA 2H5EA 1UKVY 5IY0A 4AKGA 4JBKA 1KSGA 2G1KA 3O8BA 3WYGA 4RD4A 1FZQA 2FXQA 3KJPA 2IX0A 2FJUA 4OO1I 2GKSA 2JLQA 3P27A 3VU9A 1Q22A 2OCYC 1N5IA 4AURA 3ZQJA 2QEQA 4UXHA 1JBKA 2BHRA 1VQBA 4US1R 2PNHA 1XXHA 2K14A 1NL3A 3S1AB 3KLWA 3THXB 1P9RA 1KL9A 1QRAA 2QBYB 5KNDA 3K0XA 1IN6A 2PL3A 2OQKA 3QF4B 2C2HA 4DUZQ 3NEJA 5TY0A 4Q7MB 4CYMA 5P21A 1G3MA 4OO1G 1E9DA 1M7BA 2BOVA 1JE5A 3IBYA 4G3XA 3SBEA 5KTYA 5FJ8G 3FKIG 3ADCA 1XBTA 4LF8Q 1ZNZA 3SN6A 4JT2A 3U50C 2Q3HA 2JJQA 1VCNA 1YZUA 1ZNXA 2JIZA 2BBWA 4DR4Q 2V9PA 1VQDA 3MD0A 3UWKA 3EASA 4EPYA 3FHOA 1XNQL 3KB2A 1KK0A 3B60A 3M4PA 4LHZA 3R8FA 3W3ZB 4CW7A 4D81A 1U0LA 1UEIA 3GJ8A 4RZ3A 4MGIR 4MH0R 5GJCA 4OQMA 4LFCL 1YITA 5FI0B 4C2TA 2WMNB 4Q19A 3SHFA 2B8WA 3IIKA 1SHKA 4JT4A 1L8QA 1OH8A 2F1HA 2PH1A 1I2DA 2NZJA 2PZFA 2K52A 3G71A 3CCSA 1H8ED 1E0SA 1E2KA 1M74A 2A1AA 3H2YA 3KJIA 1IN5A 3G5UA 1OF1A 1TPZA 2REXB 3RNUA 4BZXA 3PJRA 4UP8A 1NLFA 3GDEA 2ORWA 1OH6A 4FW9A 1G51A 2ZRFA 2WWHA 3BD9A 4NZYA 3OW2A 1KI6B 4AC9A 1KI6A 2F3TA 2ZVPX 5E7NA 3HOYG 1N5KA 4OXPA 1AIPA 2VSFA 3SGIA 3D0FA 3G6EA 3HOXH 2WTUA 5KU1A 1WJJA 2VLIA 4GDFA 1DOAA 2ZM5A 1W0JD 2GVDC 1FTNA 2D2FA 3OIUA 1K8AC 2CLSA 4ACAA 1FFHA 1OW3B 3KF8B 1NMXA 2H16A 1E3MA 4PZZA 1HJPA 4QNMA 3UATA 4BFYA 1IM2A 3TGPA 3S1MH 2ZI7A 5C0XI 4PXAA 4RKEA 3S14H 2PZGA 2G83A 3GP8A 2E2JH 2IX1A 1KOFA 4DR2Q 1EG7A 2QPAA 3IO5A 4UNPA 1G6PA 1SRUA 1OTCA 3QEJA 4F38A 4UP7A 1Y1VG 1VQOA 1D8TA 1NVVR 2IHFA 3L82B 3TBKA 1CR2A 4A3BG 2MQHA 5C0XG 2WWFA 1OFIA 3OIWA 3MFYA 4DZZA 5LPNA 4IJLA 1G5RA 4B3GA 1E2QA 2YWEA 3DEFA 4UNQA 2BMDA 4RD2A 5C2JB 4QL5A 4O0AA 2R44A 3IQXA 2CK3D 3PF5A 1AZTA 4LHXA 3W5IA 4IOJA 4DUGA 1G291 4KO8A 1ODFA 2RHMA 3T1VA 2WV9A 3BBPA 3CO5A 4GFDA 1Z0KA 4TLCA 2PMZE 4BFSA 2UUAQ 2JA1A 1U98A 1KD1C 4Q18A 1OYWA 2E1RA 5FPYA 1QHYA 5IHPA 3KUDA 5D3MB 3K80C 2NGRA 1Z22A 4LY6A 1V1QA 1MRNA 4CF7A 5H1SE 3TSWA 2PI2A 1IOZA 4Z1MD 2HUPA 2QMHA 5GVRA 5FUXA 2BCJQ 5KHOC 1E9AA 1WCV1 4BZQA 1H8EA 3N5CA 5ELXA 2WICA 5E95A 4JKIA 4GN3B 5IYBH 1PH6A 2KJQA 3TR5A 4URVR 1VIAA 1XMVA 1PH2A 2AL7A 4HJ7A 2FF7A 2I1VB 4D26A 3L7ZC 4M53A 3Q72A 4C7OA 2R7ZG 5LMNW 3I4LA 5CM8B 1YR8A 1HQCA 1E3PA 5FPKA 1WOCA 2UUBL 1EX7A 5G3ZA 1WF3A 1Z2CA 5JSZB 4MA4A 3PO2H 4MRSA 4C0KA 4NXNL 2J59A 2RGAA 3QKSA 3DPUA 2SHKA 3EARA 3QIAA 3H1TA 1TXYA 2KBNA 4LF5L 4AI6A 2YU9H 2PJZA 3ONWA 1XEFA 3FMOB 2WJJA 3MAAC 4QFMA 5CLLA 4IOAA 2FV8A 2HJGA 1U0JA 2R6GA 4ZI2A 2YTYA 1YJWA 5KPDA 4JYAL 3EAQA 1E1RA 1FUUA 1MO6A 1Z6YA 3I32A 3NELA 2R92G 4PTLA 2G6BA 3SHWA 3T5GA 2O8DB 3VDYA 1NJIC 1ZCBA 2AN9A 3BH0A 3LBNA 3VR6A 2IXFA 4XOIA 3WMEA 2JA6H 2GJAA 3SFZA 4AIMA 3IPYA 3B2EA 2FWRA 1HNXL 1FL0A 2E2HH 2PMDA 1XNQQ 4TLBA 2EFHB 2KCMA 3SQXA 1N6LA 3A6PC 2JJ1A 2JE6I 4X8OA 3ZGXA 2Z6KC 2IBMA 3C15C 3GJ7A 3MJHA 4US2R 2CK3A 4M1YA 4Z54A 1WE2A 2ODNA 1L2TA 3HR7A 3K81C 4DV4Q 1IONA 4K81B 4DJTA 1W4AA 4QXAA 5F9HA 3Q9LA 4EPWA 3MUFA 3UKDA 1DE0A 1P61B 4DIEA 1L1OC 3RRNA 3H0GH 1K6MA 4QJ4A 1JQJC 1IZ6A 3CH4B 4MRNA 4C0LA 3S2HH 2FSFA 4DHEA 4LHYA 1VKJA 4OQNA 5IRCD 1KK3A 2GJ9A 2PJRA 2ZE8A 2ZRKA 3M3YH 1F48A 3J7A5 2WB1G 1Z0DA 1I3QH 2UXBL 1KTVA 1U2RA 2B8TA 2C9CA 3QENA 1J8MF 4RZXA 1XTIA 4ME3A 1JJ7A 1BO6A 1ZU4A 2EYQA 1E0AA 1T0JB 2F55A 3K9HA 1OYYA 2O8FB 4B3DA 5AUPB 4JI2L 1K8RA 2ZRMA 1GNQA 4B48A 3EIVA 4K0KQ 3LD9A 3T61A 4R9UC 1J2JA 1YZLA 2WKPA 4G5GA 2YJTD 2OAQ1 1Q46A 3ZIAD 1KIXA 1K5DA 4LX0A 2GF9A 2NO9A 5IYCH 4NCJA 1CU1A 1OXUA 1IJEA 4TQAA 2PT5A 3VFDA 2IUSA 4JBYA 1DO0A 3T1TA 5M3FG 3KUCA 1T8TA 1S3SA 2NMVA 4TYQA 2Z6KA 4JL6A 1EGAA 4LJ9A 3JC66 2QUZA 4X64L 3UDIA 5FBLB 3QKUA 2YC2C 2BEJA 1XNRQ 5SZJA 3LXRA 4MITA 5FTLA 2ZTDA 3QXXA 1L1OA 4C3JH 4JLOA 1XF9A 4E03A 821PA 1AK2A 2NTYC 3AP2A 2V6IA 4RZUA 5JHHB 2IS1A 2QL6A 4MUBA 4IOCA 1LTQA 1KHTA 2YWGA 1QVAA 4PO9A 2GCOB 1HE8B 2GCOA 4A3DH 1N0VC 4B3TL 5C44G 1NJGA 3ZZUA 4YWMA 3X1WA 4XVRA 4DR5L 4OL0A 3NTUA 4M1MA 1YHNA 2JA8H 4TMVA 3ZS9A 2E9SA 5J40A 1KO5A 4KBFA 4KJZA 4OK3A 2JA7G 4IEEA 1Z6AA 4GNXC 1T0HB 4QM7A 4NHOA 3HOUG 3LRPA 1PH3A 1AS3A 2ZTCA 4DAYB 3PIRA 2OUKA 1PV4A 2GZAA 2ZSEA 6Q21A 1G5PA 4FCWA 3RABA 3J81i 2OAP1 3GEHA 2ZJQA 1T5IA 2KBEA 2WB1E 3DKVA 3BRWD 1I50H 3DZ8A 1ZM3A 1YZNA 3CB4A 1E4VA 4AYBE 2FNAA 3GLFA 4QM6A 3I61A 2G0NA 4CGZA 1E22A 4TTQA 3SNHA 2AD5A 2C9YA 5HCIA 4IFDI 3IILA 4AD8A 3F2BA 4DWJA 4B75A 1KYIA 4CRWB 3A4LA 2ZM6L 3VR2A 2VQFL 1FP7A 1DPFA 3REGA 2GAAA 2WVJA 4Q1BA 4UXJA 2IHEA 1W2GA 5F2EA 2UUBQ 1I94L 2E5LL 1P2SA 3FHCB 3HPRA 4EJSC 3PUXA 3ZIAA 1PVOA 2WP8J 2C77A 3K9GA 4QBIA 1P7CA 3VNVA 4LSGA 3R9IA 2J0QA 4IFDG 4CZ2A 1S96A 1FQKA 2AFIE 3CCUA 5L3QA 2NVXH 1F60A 4R71A 5GAHC 2PEYA 4MRVA 1S4QA 3JZMA 5IP9G 1JAHA 3HKZG 2A30A 2XITA 4QRHA 3RWMB 1EFRD 3GTLH 3NH6A 4LYFA 5JHGB 4JI5L 5TXGA 4QGFA 4DRZA 2DUDA 3JZAA 4JLAA 3U4VA 2GVAA 2JLVA 4BY7G 4WIAA 2YV5A 4YMTA 5ELNA 5GADC 4GNXA 1LW7A 1OLOA 4OK5A 3ZDQA 1EESA 3QBTA 1LF0A 3K09C 5DH9A 1DVRA 1XTQA 4A0FA 1HR0L 2XTIA 1GM5A 4FMCB 2BDTA 4KFUA 1FP6A 4XVUA 4ZDKA 4TMTA 1NBWA 2CEAA 4AG6A 4WBSA 1FNNA 4A93G 2J87A 3PUWA 3NBZC 4L15A 3KJHA 3AEVA 2XAUA 3GLHA 3GLHB 3IRBA 2YNMA 4P4SB 2ZRJA 4QOSA 2GXQA 1G41A 2QRZA 4NYJR 1P16A 1Q1BA 1KK1A 3BC1A 3ER0A 3BZCA 3ASZA 3WBKA 3FWYA 4HEJA 3A0JA 3OFNA 3W90A 4PPNA 1CKMA 1G8YA 2J7KA 4F7WA 3NBXX 2DB3A 4G01B 5JI3E 4HIMA 1YZQA 3TSOA 2HEIA 2R93H 2ZYUX 1LYLA 4CDGA 3I4NG 1KI3A 2DFKB 4URUR 4S35A 3TJZA 4EJSA 5BR8L 1ZAKA 1HZCA 3AKEA 5H70A 2EW1A 4POGA 2RCNA 2QA5A 1F2TA 2O8BA 3L2PA 4JI2Q 1U9IC 4HSEA 2ZR0A 1N33L 3EXAA 3P4XA 4P31A 3RSLA 3RLOA 1KI7A 1R4AA 3QXSA 1YZKA 5GQOA 4I4LA 2FPMA 2AKYA 3VKGA 4ESHA 5M3MH 4GOPA 1M6NA 1WDTA 1JAIA 2ZYWX 4IDQA 1D2EA 4A3MG 2JJ8A 2ZTEA 1SLJA 5DI9A 2J3EA 1TF5A 3U5ZB 2UZ3A 2OBLA 4ZDJA 3GMTA 1DTSA 3K09A 3PGZA 3IEVA 5F9FA 1Z6TA 1GRRA 5HKKD 3LBIA 1G7SA 4P4TA 3U3RA 3KQNA 3C7KA 1AGPA 4DBLC 4A3CG 3KOJA 2BH8A 1YHQA 1U8ZA 2R6CA 3KXKA 2NVYH 3HKZE 4WJ4A 1XD2A 2CLDX 2D7CA 3P32A 3A1SA 5H68A 2HCJB 3AVWA 2LKCA 2Y0SG 3CPJB 4IFBA 1EWQA 2KBFA 1ZCAA 3CCEA 1EFRA 2XZPA 3HP1A 1QHHB 4HUQB 4NXMQ 1IY0A 4HYYA 3TUIC 1XZPA 2Z6VA 3TVDA 4DR3L 1GO3E 1YIJA 3WWVA 4TSFA 1GDDA 1E69A 3K8AA 1BS1A 4JVSB 1W47A 3AVOA 1VG9B 3NC1C 1XEXA 2RGDA 4DV3Q 5A0FA 4PSVA 4XTRA 4B3TQ 1S8FA 1SVIA 2DPXA 5IK2D 5JZVA 4N0EA 2GXSA 4B3RQ 4LHWA 5TDHA 2QAGC 4V03A 3CRMA 1OKKD 1MJCA 2FU5C 4BA1I 5LB2A 4Y0AA 1U9IA 1XPOA 2CHQA 3TAUA 3CR8A 3L0IB 1R6BX 1ZUHA 1RRCA 2CNWA 1II9A 2WHXA 3B8HA 4LYJA 4LC1A 2UXDQ 4JSTA 5M5WH 3B7GA 3RVBA 4RMFA 1FPMA 1FUKA 2XJ4A 2NOAA 3NDBB 3AF1A 1R5OA 2NPFA 5L3SB 5L3SA 3Q3JB 5FJ8H 3JAMc 4HUTA 1NBMD 2O8CB 2KHJA 3FKIH 2FEOA 2GXAA 1W5TA 4JVLA 4GKJL 4IPDA 3M9BA 5K36G 1XMIA 1G6OA 2O0JA 2VTKA 2OEPA 221PA 2X77A 1ZINA 3F5FA 3PFIA 4URZR 1EFUA 4D0GA 1G16A 5EE1A 3E5HA 4DUYL 1LB1B 4EDHA 3CC4A 4DV5Q 2JLYA 1WBDA 4G0NA 4Q9IA 5EXPA 1RKBA 3ASYA 4G5QA 3WYFA 4URYR 2IYZA 2D3WA 2ZRHA 1GVNB 1PH8A 4DIDA 3BJUA 2J0UA 2OESA 4JLBA 1I94Q 4MYHA 2QU8A 5EP1A 3GLIA 2ZS9A 1Q8KA 1XMJA 4A3JG 4LI0A 4CEJB 1TWGH 1QVFA 3GJ5A 3QF7A 3KTAB 4L5SA 4PHTA 2MMGA 2QT1A 2DWQA 2IF0A 2OFXA 3QJYA 4R98A 5E7IA 1GILA 3GD7A 1B0UA 1HQYE 2PLRA 1G18A 2ZSFA 3NKVA 4ZO4A 4RG1A 2QAGB 3I55A 2QAGA 4P0TA 1LFDB 3O47A 3ECCA 1CSQA 3HOYH 4BLTA 1EFCA 4JI0L 1P5ZB 2VS1A 1IN7A 3OEED 4HLUC 1Q3TA 1SQ5A 1WBBA 1EYGA 2AK2A 4HDOB 4X66L 4Q48A 1PFSA 4HB4A 4L5BA 1HR0Q 4LJ4A 3AUYA 4UNSA 2ASBA 1Z0FA 2PQAA 3P1JA 3N2IA 1CR1A 4IXMA 4G5OA 4ITRC 2QA4A 3E9HA 2VY3A 3K1JA 1QG2A 4IVRA 3K70D 1UKYA 3WRXC 2O0KA 2ZREA 3ZYCA 1SXJC 1II0A 2FSHA 5IK2A 4U00A 4DV0L 1D7QA 3QKRB 4R1JA 1FJGQ 1T3HA 2W0SA 1Q3HA 3WY9A 4PAOA 4C3IH 5FOVA 2C8VA 4E22A 5AUQA 4JI8Q 4RJLA 3BZKA 4Q7KA 1U5KA 1QHSA 4A3BH 1JQLB 4LYHA 3RC3A 3BB1A 3EN2A 1OHHD 2CCJA 1U90A 2OCAA 4DEYA 2CE2X 2CQOA 4DPGA 1XWIA 2K5HA 2NO7A 3PCRB 5BR8Q 1R7RA 3AVTA 4A3LG 3OTOL 3B78A 3I56A 2B7BA 2D0PA 1NBMA 2ZSAA 5E3HA 4F91B 4C2MH 1E4YA 2JQOA 4C30A 1S72A 2HDNB 3GJ6A 4UXIA 5FBWB 1GRQA 1PYSB 4OX9Q 1DELA 1EIYB 1E9EA 3CCMA 1KIMA 1NVWQ 1HH2P 4IFEA 2HHHL 3QVVA 2BM0A 2MO0A 4IFDJ 1IYJB 4DCUA 4YQFA 4GP6A 4HLUA 4XSGA 2NN6I 4IOKA 4M1KA 3CZQA 2QTVB 1XXHE 5JWHA 5CYOA 1XDBA 4P73A 2JEAI 3CRW1 4LDJA 1KSJA 1OFTA 3TLXA 2HQLA 4OJQA 3GFOA 4RZ2A 3WHKA 4X65L 1X9NA 3OESA 2OWOA 4KFTA 2LXKA 1PH4A 5KSPA 4YCWA 1WCMG 1R9TH 3M7NA 1DAIA 2RGGA 1VCMA 4P75A 2R65A 3OE7D 3WBJA 3NDPA 2NN6G 4RFSA 4QHSA 2QEXA 1L2FA 3CC2A 1CEEA 1VHTA 4BBRH 1SXJA 4BGDA 1SVKA 2AHOB 4R4TA 2NZHA 4LYAA 2G3YA 4YMUA 4A2QA 1HTWA 1G17A 1W4BA 2R7ZH 3NXSA 1V43A 5KSYA 2H7VA 2ZI5A 5CDFE 4DCNA 4JI1L 1G7CA 2JDID 2QM8A 2ERXA 1KDTA 3DMNA 5DYGA 4ERNA 2KHIA 1S40A 5TVKA 1NY6A 2FFQA 4WOPA 3VHXA 5JRZA 2O8EB 2JIZD 2JAQA 3M4OH 4JVNA 4ZI3A 1TWCH 4M22A 2G1JA 2EIFA 2VZAA 1MH1A 1T5LA 3CWQA 2W2VA 3WNDA 4HAWA 1KK2A 4II7A 4BPBA 3J80i 1OH7A 2ZJZA 2P6RA 2LXJA 2FZ4A 4TLDA 1A1VA 2XTMA 3OIVA 1G21E 1VYTA 1YZTA 5LBIA 4C9BA 2ZI3A 2EFGA 4D6PA 2F43A 2YYZA 5FUVA 4D4LA 1XJCA 1X3EA 1X6VA 2R92H 1LNZA 3W5JA 3ADBA 4KSCA 3FOZA 2ZRBA 4FMCF 2KCTA 3X1XA 2EQSA 2IYYA 3CNOA 3V4FA 4DXAA 5KPJA 4HLQB 3SQWA 1YQTA 1WB9A 1HT1E 3Q7QA 3SU8A 1SROA 4OBEA 5BW8A 4JG2A 1H65A 4OHZA 1BVSA 1SE8A 5IWAL 3AF0A 4KU4A 1BBUA 3B1ZA 3SFVA 4GLAC 1BOFA 1W48A 2GTPA 2JA5G 5G41A 3KXLA 4WZBE 3THOA 3S1QH 1ZD1A 2CCZA 2UU9L 4OQLA 1XPUA 4MYUA 2MMCA 1BYUA 3H15A 1E2JA 1KI8A 2F9MA 2O52A 4W5JA 4JI3L 2C95A 4PSKA 2REOA 1ZC3A 4DR7L 3A36A 3VHLB 1KJYA 4JS0A 5AJYA 1ANKA 1CTQA 3D31A 4JVMA 4BASA 1NN0A 2ONJA 1KSHA 2P2LA 3E0EA 2UZIR 1A0IA 2NVTH 4WJ3M 1TF7A 2ZJYA 1D6JA 2F4VL 3OE7A 2ZI9A 4I1OA 3FYHA 2WJYA 3KX2A 1OB5A 4LFAQ 4Q00A 5AUNB 4RSGA 1XU4A 4HAXA 2ZE7A 4IEIA 5HZHA 1CKOA 3T1YL 3CR7A 4D2IA 5EE9A 1PH9A 3SS8A 1ZYUA 4FIDA 4TMXA 5SZHB 3S1AA 1VQHA 3THXA 1FTSA 3G0HA 4QJFA 1ELOA 3UWOA 2QBYA 1UBFA 1OXTA 1KI1A 2KWIA 2ODEA 2B3GA 3QF4A 4EPRA 2JATA 3RS2A 3TRZA 1E2HA 1LV7A 1NSFA 1NKSA 1IBLL 1KO1A 2O0HA 4MKFA 4LGMA 2A19A 4LFBL 3LDAA 2JDIA 4LRWA 4A3GH 4NYMQ 3WRYC 4RD1A 4BFTA 2ZU0C 4M9QA 4TVAB 5J4KA 4BXXG 2OILA 1UE5A 4HIKA 4DUGD 4OWWB 3A58B 1HNWQ 3LW7A 4PAQA 3PSIA 1Y1WH 1ZVQA 3PVSA 4YMWA 3TKLA 3LGJA 1GSIA 2OQ0A 4LF4L 1KZGB 4M9ZA 2C9OA 3I72A 3OTOQ 2ZYVX 3GEIA 4LJ5A 3K0FB 2IY5B 3K0FA 2XXAB 3E2IA 3G4SA 4C3ZA 2XZLA 4IDOA 4O2LA 1TEVA 3HOVG 2ZSBA 1W2HA 1DS6A 3J7ZC 1MR3F 5C44H 1AQYA 3A5ZB 2FFAA 3RRMA 2Q9BA 5DLQC 1SFOH 4JI6Q 2ID0A 1PHJA 1HY3A 3K0EA 4LUVA 1MABB 4DLYA 5FOWA 3ZZTA 3FMFA 3AVUA 2N1BA 1J8YF 4QC2A 4BFVA 2IEZA 4AK9A 3CRQA 4B33A 4C0HA 1NF3A 1S2MA 2DFTA 4LJ6A 4DR1Q 4JLMA 1UEBA 4L9WA 5BN3A 5FOTA 3MWLA 5FR2A 1YVDA 5H8WA 4PQFA 4OHXA 5KUTA 3K0AB 3TAHA 4DCSA 3WNBA 1UE7A 4ZKEA 5HE9A 2ONKA 2VRWA 1OIVA 4AYWA 1Q12A 2H5XA 3KF6B 2G9NA 2GBLC 4NCIA 4P32A 5HZKA 3PEYA 3Q7PA 1YR9A 2UVQA 3Q5DA 1N0WA 1P62B 1NVVQ 3VR3A 1R8QA 1RVDA 2VP4A 2GWHA 4JI7Q 2GCPA 4KI0A 1EWIA 4ARZB 3GLGE 2IYRA 5EP2A 2MSDB 4IPCA 3KKQA 3LA6A 4A75A 1R10A 4HJ9A 1SKYE 3FFAA 3MLEA 4R4OA 3NC0C 3C16C 2FGJA 4BQSA 2VEDA 1LTLA 1E2NA 3NBHB 2VQEL 1E1RD 2IYSA 3I1FA 2IXGA 5LMUL 1SVMA 2EXDA 521PA 4DK3C 1UBCA 3HOZH 1HE1C 2VP9A 3GTOH 2GK7A 2FPKA 2AK3A 3AQ4A 1MIUA 1VTKA 4PZLA 1Q1EA 2ZJOA 1RW4A 5IP9H 2JJ1D 2BMJA 1E9SA 2IYVA 3L2OB 4E09A 1HZAA 2NPIA 1AA9A 3IQWA 1EIFA 4LV5B 3AVVA 4HAUA 2XNDA 2EVWX 4F4JA 1N3BA 4OYHA 5FPHA 1RRFA 5FR1A 4Q7JB 3C14C 4HI0E 3NVAA 1QBKC 2D7DA 1E2LA 1E9FA 1N6RA 3TUJC 4U5XA 3AFPA 2QSZA 5JMTA 1DEKA 1E9BA 4YHHL 2WAYA 5CIQA 1GKIA 4LJ8A 3I5YA 1IHUA 1JR3A 1O3YA 1IY1A 1RC8A 4Q47A 4GOKA 1JPJA 2PLFA 2ZSDA 2I4IA 4XD7A 5D3MA 4A1FA 3KXIA 2JLXA 3GTPH 4GKKQ 1Z28A 1LUZA 4A3EG 2D06A 2GBLA 3J81j 2B29A 2CXXA 3LY5A 2CDNA 4D4JA 3TS2A 2JEOA 1Q21A 2DHRA 1QVCA 4DV1L 4JC0A 2UU9Q 2E8GA 1YE8A 1VQEA 3SR0A 3TREA 5AJ3L 1HURA 2J9RA 3OYYA 4EFLA 2R7FA 3ADDA 4JI3Q 5FTJA 3U6KA 3H0KA 1FW6A 4B2LA 1QDEA 2QRNA 1N6IA 2VSXA 3GEEA 2CE7A 3S1NH 1M34E 4L5RC 3QOFA 1B8AA 1XMSA 3TSZA 4BUJA 1H95A 1EOVA 1CULC 1TADA 2JJ2A 2OBNA 1MV5A 2CWAA 1UBGA 1J90A 1A2BA 3F1ZA 3CPEA 4XWKA 2VH5R 5JSZA 3B85A 4Q21A 4OI2A 5JECA 1MRSA 3VAAA 5AJVB 2A7QA 4Q1DA 2EFDB 2QMOA 4FWTA 2ATWA 1E99A 5KDLA 5KOYA 4A3MH 3CKLA 2G0TA 1QF9A 4UY8C 4JV5L 2Q0HA 1E1QD 5EP3A 5J47A 2ZI6A 2C5LA 1BBWA 1N36L 4GN5A 5E7MA 1N6OA 2FPLA 4NPSA 1IBLQ 5UKDA 1N2CE 4M9XA 2R2AA 1U8YA 2QY9A 3T35A 2O8DA 2BA0A 3A4NA 5FTMA 2VP5A 4EPVA 1TQ6A 1TX4B 4PQYA 1GL9B 4KBGA 4HB0A 4BLRA 3KQKA 2C98A 4MYCA 3M85A 5FTKA 4G1UC 4A3FH 1E0KA 4KHPL 3UE1A 1KMHB 2I5HA 1UAAA 4TL6A 2BBSA 4ZDWA 3GLFE 3ADKA 1O7IA 2ZRLA 3CIOA 5CITA 3BFXA 3RYTC 3GJ0A 3C41J 4LF4Q 2QGZA 3TQFA 1VQ5A 1GTVA 4LFCQ 2ZRNA 4EFMA 3EWSA 2CL7X 1N8RC 1XNJA 2NZ8A 2HT1A 1JEEA 5C4GB 2Q9CA 1FVIA 1ZM9A 3PENA 5C4XG 4PC7A 1TWAH 3PUVA 5B57C 2WOOA 4A8JB 2A5GA 2K5UA 3QBVA 5FOUA 4ABYA 1VCIA 1NG9A 2AKAB 4R4CA 3LAWA 1YI2A 1LS1A 3GLGB 3CCVA 1JJVA 2PCLA 2QP9X 3DOEA 4DV2L 2N49A 4A3KG 2GAOA 4AYBG 4ZCMA 621PA 3I4MG 4G5RA 1G8GA 4JOIC 4GNKA 4JSYA 4V0KA 2O8FA 2I5MX 1YJ5A 3LLMA 3F0TA 5C18A 2VUMG 5AJXA 1Z83A 1X8LA 3CAMA 2C04A 1G19A 5BWMA 4F93B 4WA7A 2BEKA 3ULPA 4AKIA 4KYUA 3RZDH 1T4GA 1XCMA 4X62L 1IXSB 3P20A 4D82A 1N5JA 3ZVRA 2E2IH 2ANCA 5H1YA 3R20A 4DB4A 4M1WA 4C3HH 1XD8A 4XVQA 2NQ2C 1HR0W 1J70A 3DKPA 4F4IA 4U7DA 3CPHA 4LPSA 2FN4A 4I81A 4V0ME 1E1OA 2GNOA 5TARA 1II8B 3I92A 3W6PA 2YVUA 2Q2TA 3NH9A 3U3KA 3I4OA 5B64A 3BJIC 4DR6L 2VL7A 3ZVLA 2F3IA 3PUZA 3FMPB 1A62A 3UG6A 3GFPA 5LMUQ 1VS0A 4A76A 3A1TA 3PCOB 3EZ7A 2QPOA 2YZ2A 4B3ML 1N9WA 4JLPA 3T34A 1KXLA 4YY3L 1W5SA 3AVQA 4C2UA 3T15A 1E1QA 1ZJ6A 2VIIA 5C1BA 3W3AA 1R0YA 1KO8A 4NYIR 1UE6A 5J4VA 3I8XA 3FE2A 3AH8A 2QTHA 3UDGA 4KVGA 1G8FA 4F4CA 2CKZB 3Q85A 2MSCB 4JBJA 4LF9L 2WIAA 4A3IH 2FFHA 2OSBA 1IQPA 3WP1B 4DSNA 3IEUA 3QEOA 2W6JA 2CLCX 4Q1FA 4EPTA 4YCUA 1UEJA 2JEBI 4LBYA 2BBOA 3OFND 4JOIA 1X1SA 4M21A 2IWHA 4DV6L 3CPFA 3HJNA 3HOWG 1B70B 4DSTA 3BE4A 1XB2A 1LVGA 3LFUA 2B63H 2WWWA 4JLJA 5LMNL 3D3QA 1PH5A 1LM0A 1YU9A 5GAGC 1VQKA 1COWD 1X3FA 3KFXA 3VKHA 3HFZB 4RVCA 1T3LA 1L4YA 2F7SA 2AWOA 5IT9c 4JLDA 1J7KA 4WZ6A 3CC7A 3IGFA 4KFSA 1X54A 3L0PA 5IP7G 2ZRAA 3CONA 5DN6A 5CYPA 2D4HA 2W83A 4NTZA 5KSOA 1KAGA 4B73A 3AM1A 4QJ5A 4R4IA 5JJKA 1L7VC 1I2MA 3W1GA 1EFTA 2I1QA 1RIFA 3BORA 2R9VA 4YONB 1CP2A 3ZJYC 1Q1ZA 3KDSE 4L5TA 2GETA 2Z4SA 4A82A 5C4MA 1X8KA 4A3LH 1NN5A 2DWOA 2JLRA 3B1VA 4PQRA 3TK1A 3HOXG 2NO0A 4FCVA 2I5LX 1CLUA 5M04A 3STBC 1VYVA 3H3VI 2OO7A 2REBA 3K53A 4LBVA 1FMLA 1DAFA 4NXNQ 1P75A 2J45A 3FKSA 5JEAG 3HDTA 1TTTA 4QGUA 3VMFA 1NKTA 4N3NA 2RAPA 5AJZA 4DLRA 1ZM4A 4AIIA 1EQRA 4LF5Q 1SKQA 2W6IA 5K8IA 3FHTA 3H4MA 4PZ8A 1PJRA 4Y7NH 1EXMA 3DVLA 4P3YA 3VX4A 1E2EA 1NLZA 2P5SA 4QY7A 1X3SA 3AP3A 4R4QA 4KAXA 4TYPA 3S2DH 5C3EG 4AQYL 4JYAQ 4I1UA 2VHJA 4N1AA 4TSFD 4V0LA 4XWOA 1E7ZA 4RD3A 4UNRA 1XEWY 3ZS8A 4TT3D 3MJRA 3R7WB 1PUIA 1IY2A 1NN3A 4JMPA 3AYHB 3CCLA 4NYJQ 5HY6A 4KITB 1AS0A 4P72A 4XIGS 2FE4A 3E1SA 3IDQA 3K8YA 1HNXQ 4HLCA 1UADA 2F1IA 2WSSD 4TMWA 2I0QA 3TW4A 3C8UA 3ETLA 4FI3C 1FNMA 2KI5A 1HNZL 2OHFA 3K9NA 5FLMH 2CNWD 4ON9A 1CJVC 1HYQA 4P4SA 1OE0A 1K83H 3SBDA 5L8VA 4JI4L 3KB1A 1ASYA 1JJCB 1DG1G 1VECA 2FX3A 3X1DA 2QQ0A 2IYUA 4W5HA 4CVNA 1CKEA 4D25A 1Z2AA 3ND8A 2MNAA 1DO2A 4MGYR 3G48A 5D3QA 1ZNYA 4R7ZA 4B2IA 4HB2A 4EQ6B 2F3RA 1J99A 3ZJYA 2K4KA 1KHIA 4O2DA 4DV7L 2FH5B 1C9OA 2P5TB 2ZS8A 5CIWA 3LLUA 2UUCL 3VX3A 3RRZA 3MEFA 4C4PA 1NJFA 5HE8A 1NMZA 4AYXA 4POFA 5TMPA 2RHDA 2UXBQ 2CCGA 5EE0A 1NE3A 1COWA 3WNCA 4DV2Q 2CHVA 1MO4A 4NONA 2EFCB 2HYDA 3THYB 2C03A 5KDDA 1KI9A 4PHFA 4IDPA 3U44B 4QJ3A 1E2MA 2VA8A 1G5TA 2K50A 4P71A 1XEWX 2A5YB 4IW3B 2DYKA 2OCPA 4GRAA 1W36C 1T3SA 1TU4A 3CRRA 4MKGA 2X2EA 3SOPA 1CBUA 4JYCA 4A6XA 4A9AA 1NY5A 4LWZA 3U7HB 3CWZA 1HZBA 1BMFA 4HATA 3D7MA 4Q4JB 1CS4C 2OCBA 3T1HL 2WIBA 2ZJ8A 5A4JA 1YVCA 4OHVA 1KDOA 2C35B 1VMAA 3B9QA 3CCQA 1G3UA 2CMKA 2JA5H 3PO2G 4LJ7A 3K0CC 4KHZA 1WXQA 4TL8A 4CEIB 3PEWA 3DM5A 4CEIA 4BLOA 4BWYA 4B74A 4X64Q 2W0MA 4J0QA 1GL7A 4C0AC 2HLDA 2HXSA 4HUQA 1QHHA 3QXJA 4GI7A 3MSXA 3K0SA 3QPWA 4V0OA 2WM9B 2AKWB 3NEYA 5FFMA 3U3JA 4B3CA 2HIXA 4TL9A 1US8B 4GSYA 5KYKA 1E0JA 1M1YE 1Z5ZA 1G3RA 3CQZH 1G7TA 4Y0VA 4TT3A 3CH5A 5EUMA 4NDZA 4TLEA 1KKLA 3B5JA 4Q4HB 3F3YA 3LXXA 3X2SA 4CT4B 4OI1A 1AKEA 1RIPA 4DR5Q 4HDCA 1G8PA 3VR5A 2R6FA 1NBME 1JEDA 3D8BA 5BN5A 1TQDA 5EZ6B 2WSSA 3F8TA 4D0LB 1AGRA 2A5FA 3A1UA 3WYAA 1N6PA 5AUOB 2QORA 4JKYA 3KQUA 3T1OA 3U4QB 1Z0JA 2Y8EA 1M1KC 4LNQA 3SEAA 5LMNQ 1GKUB 2BA1A 5EJEA 2HF8A 1VG1A 4OONA 1U99A 1A2KC 1JXOA 1XZQA 1IBRA 4B43A 2GRJA 1W36B 1PH1A 2ZJ5A 3A1WA 4DVGA 1AQUA 2JLUA 2WWIA 1E24A 1S3OA 3FDIA 4LZZA 5B30A 3R9XA 1X65A 2O8CA 3H0GG 4D4KA 1VPLA 4IRUB 4BXXH 4PSAA 4TWZA 1H8HA 3WP0A 4A92A 3DL0A 2GK6A 5GADl 1XTKA 1YJNA 2BC9A 3LBHA 4WVFA 4ZIRB 5EXSA 1W44A 5EXXA 3NENA 1YHBA 2DFNA 5LD2B 4ILEA 3UDXA 3RS5A 4DLTA 3U7FB 2OZEA 2JLSA 2F1RA 1Q86C 2ZJPA 1QHGA 1X55A 1W4RA 3K0CA 1F6BA 1XMOL 4NU0A 4TQUS 1Q0UA 2IYLD 2ZM6Q 1YNXA 2VQFQ 2Z0SA 1P72A 4YXWD 1YHAA 5FTNA 3CD6A 5FPSA 3ZLJA 2Q6TA 2E5LQ 2BCGY 3HOVH 4CIDA 1VG8A 4DKXA 3L8ZA 5CJ2A 3UXMA 3K7AH 4LJYA 4PZ7A 3W8NA 2X1VA 4W5WA 1W1WA 3EX7C 4CEJA 3T12A 4B34A 3KTAA 1KDPA 2HIVA 2YTVA 5IYCG 1GWNA 1L4UA 2D74A 1SXJD 5HGQA 2WZQA 4BECA 5K8LA 3O8CA 4I99A 3W9YA 4B76A 4JI5Q 4Q01A 1RE0A 1YRAA 3AGQA 1KRSA 2K5NA 1DG3A 1T6NA 1WQ1R 1CUKA 1UF9A 3SYKA 3IUYA 2CVFA 421PA 1X3GA 2OTLA 4UPAA 1NN1A 1RYFA 3NWJA 5F98A 1E9CA 4O3MA 3PIPA 2IK8A 1D8LA 3FB4A 2C78A 1D9XA 1Z06A 3EA0A 4L5QA 5G40A 4IXNA 4ASUA 2ZUCA 3U7GA 1OIXA 1IBKL 4M8NE 2GJSA 4MTNA 5FOSA 3W8RA 1HNZQ 5JJIA 3DDCA 1QVRA 1IBML 4GMDA 3OHMA 1AJEA 3RR5A 4DDWA 1SMXA 4OQXA 5FLXc 4GZLA 1SR3A 5IF9A 3U3MA 3QKRA 2G77B 4XSHA 1E2PA 1S3GA 4M1OA 5L3VA 3PIOA 1Y1VH 3Q5EA 2JA8G 1NY4A 4PC2A 1QUQB 1X86B 2WJVA 3B13B 4KODA 3RAPR 2XSZA 4A4DA 4MQBA 2D62A 3T06B 2E87A 4LF6L 2OBMA 1RRPA 4LPKA 2Q3FA 2ZITA 3BH7A 4DUZL 2N3SA 2NO6A 1F2UB 1JXMA 3B1YA 4O25A 1WFQA 1ZW6A 1G9XA 2CJWB 1N33Q 1SVSA 2CJWA 3OEHA 2QGQA 4JL8A 4WW0A 2X8AA 1SZPA 3J81k 2UKDA 3R9WA 3IIJA 3CNNA 4DR4L 5JEAJ 1Z9FA 2K5VA 2OV2A 3IHLA 2WJIA 2GJKA 4NPHA 4PHHA 3MMPA 2FEMA 4TN1A 4JLVA 1CF4A 4G5SA 1E94E 4B47A 5M5YH 1E2DA 2YC4C 2ZE6A 4WAUA 4RY2A 3RWOA 2RHSB 1P2VA 1EFHA 2IWRA 4YXWA 4A3EH 2EQBA 3LH5A 4CT5A 8OHMA 2VP0A 4Q4LA 1K73C 1GIAA 4UQOA 1AZSC 3UANA 1RJ9B 4L9SA 3PEVA 4AKHA 4OWXB 1VQCA 3EIHA 2IHBA 3WMFA 1K5GA 1VYUA 3HYRA 5DI3B 1FL9A 4BEJA 1SN8A 3F2DA 4BBSG 2IEYA 2Q2IA 4IPGA 2AHOA 5EXTA 3S15H 2IYQA 1MKHA 1Q1QA 3CM0A 4DR3Q 2F1JA 4Q7LA 1X56A 4Q9JA 4A0HA 5GJBA 3J81c 2D0OA 1RFLA 3AP1A 4ZV4A 2XX3A 1IAQA 1V5WA 4B2PA 1JT8A 2IHYA 3RHFA 3MCAA 3KQHA 1KNXA 1YKSA 3EWAA 4YWLA 4N0DA 3QNUA 2QENA 3L8YA 5KO2A 2O8EA 4AY2A 1OIWA 1NTGA 4APVA 2R8RA 4WXPA 1VQ9A 3BH6A 2YINC 2PCJA 1TL7C 1RPZA 4M1TA 3UMRA 3QVUA 3THWB 5SZKB 2RGEA 5CK5A 121PA 2KSQA 4Q1AA 4DR2L 1D2NA 1IN4A 2IW3A 4K8OA 4W7SA 1GRNA 3AQQA 1IXZA 3AKCA 4DT1B 2XOKA 1XRJA 3HR8A 4DT1A 2QAJA 2WKRA 1MJEA 1KZ7B 3O8RA 2FG5A 3RDPA 4GKJQ 2PT7A 4Q03A 1VIYA 3SE0A 4B3BA 3CMAA 1TWFH 1G64A 1E6CA 4PANA 2V1UA 1CR4A 1YZ6A 3NHBA 4KV9A 3VR4A 1W0KD 4DLVA 4DUYQ 3CBQA 3PITA 4JLNA 4M9SA 3RS3A 4BEBA 5J4LA 1GKYA 3HU1A 4D4MA 4QNRA 3BFKA 3H86A 4DK6C 5FBRB 4B6EA 2P6NA 4C0SA 1DBSA 5FL3A 3SJAA 3EPLA 3AKYA 2BJWA 1ONBA 2IF2A 4IDNA 4B32A 5KSZA 5CK4A 4H02A 3KJOA 2FA9A 1T91A 3C4JA 3ULJA 2GF0A 3BXZA 3A5UA 3CPWA 3IIMA 3X1YA 2ZRGA 1I5FA 1VCOA 3HU2A 1UM8A 1J5EL 2R7DA 1KQSA 2UUAL 1KI2A 1NP6A 3CX8A 3NIBA 3K7UC 2ERYA 4A3KH 4A2WA 2LKDA 1U81A 3MXNB 4HZUB 3PEUA 4HZUA 5CLQA 4JI0Q 4OHYA 2GEUA 2XGJA 2H18A 4B6FA 4LUZA 3I62A 2GN5A 3KFUA 4E5UA 3W6NA 4X66Q 1OT3A 1D2MA 2WAXA 3FTQA 1AKYA 1KI4A 1F5NA 4KXFB 3IPXA 4A36A 1DGSA 5F3WB 2BJVA 2Q2HA 3CLVA 4HJ5A 3CF6R 2QTFA 1E79D 4TYNA 1G8HA 2JASA 4BFUA 1P8LA 2V7QD 3FFBA 4P33A 5EP4A 3EPHA 1Y14B 4GLVB 2GILA 1E1TA 1EWRA 4JLKA 4XWAA 1GFIA 4K46A 4TYYA 2VO1A 2RHQB 4B3SL 4LUOA 2XNDD 2PI2E 4DV0Q 1NLYA 3L43A 2A5JA 4O0MA 5M3FH 3VU9B 3EC1A 2RB4A 4RFVA 2DY1A 5TB5A 3GO5A 3E70C 3FVQA 4MDEA 3S24A 1XXHB 2R6AA 3BU2A 5DHAA 2WJGA 2IUUA 2EU8A 4LF6Q 2QQEA 1JR3D 4Q1EA 2ZQ5A 4V02A 3QE0A 1KRTA 4LOAA 2RGCA 4XD7D 4LC0A 1JJ2A 1MO5A 2XZOA 4PC1A 2X19A 3W34A 1Q44A 1I4LD 4PMWA 4NH0A 4L4UA 2XXAA 2HF9A 2IYXA 1IN8A 1I4DD 1VDZA 4FD2A 4HDQB 2WWYA 3QQ5A 3TRFA 4UP9A 5A5GA 1MABA 4HAYA 2HHHQ 4PR0A 5JEEA 1W0KA 3HOWH 1JALA 1Z6XA 1BH2A 1HA3A 2GEVA 2JA7H 3MWYW 1VQNA 1A7JA 1NSTA 2ZRCA 1VQJA 1UKZA 1ZNWA 3HOUH 5CDFA 1JB1A 1KY3A 4NYMR 4OI4A 4GOXA 4B35A 4DV4L 3AVYA 1ZU5A 3BGWA 4X65Q 1YR7A 2JJ2D 3K0AA 5IYDG 5KDOA 5JBQA 4EUNA 1OH5A 1SHZA 1W4CA 3AB3A 1P3JA 1V9PA 3KF6A 4J15A 1E2IA 3OIYA 5IP7H 2IA5A 4FN5A 3UMSA 4QKQA 2JGNA 1VQ4A 1BYIA 1ZMXA 4B3XA 3ULLA 1P9WA 1ZUNB 1HH4A 4YLGA 5GVSA 1N6KA 3CCJA 4NMMA 5EUQB 3TUZC 3AEZA 4ARZA 3KL4A 4LBWA 2JLWA 1Z0IA 4HAZA 4TYWA 4QBHA 2ZJBA 5CB6A 2B6HA 4RD6A 3SJZA 1G6HA 1DAMA 2FOLA 3H84A 3QXCA 3PO3G 3I73A 4D80A 3I5XA 3AF3A 2GEDA 4BFWA 3RLNA 2OCEA 1NMGA 4YCVA 3U4ZA 2RF4A 2RGNC 4K0KL 4JI1Q 3BAFA 3GFTA 4A0GA 5C46F 3PG5A 4LBZA 1U0HC 1QHXA 2PX0A 1ZIOA 5FBQB 1TU3A 1YR6A 2JCSA 3ZZ0A 4TZ6A 4BE7B 3Q8DA 4B71A 3RC8A 1FQJA 2W2TA 4QBFA 2YOHA 3B82A 2AXPA 3NEMA 1E79A 2ZYTX 2ORIA 4Q9KA 5JCZA 1N32L 2V7QA 1DAKA 3EZFA 3REFA 4JIMA 4AWXA 4GBMA 2Z0MA 2EWVA 3SZRA 2ZS7A 2PZEA 2QPTA 3H3VH 2ZAMA 3EC2A 4X8LA 5C3EH 4BY7H 4TMKA 3DOFA 1IJFA 4JJZA 4DSOA 5DGXA 2V6JA 4M1SA 5HPYB 4GT1A 2N8NA 2W2XA 2R6DA 1DAEA 4OQFA 3R8CA 4DLWA 4TTPA 2GVZC 3LW8A 1XNRL 4A93H 3IHWA 3MG9A 4H1VA 1TEXA 2RGXA 3I2ZA 3SJBA 4TTRA 2P3SA 2BVNA 3LVRE 1EUJA 4URXR 3NBYC 3U60B 4DDTA 2YKGA 1KAWA 3GTJH 1NI3A 5IWAQ 4KCGA 3KKMA 5IDVA 3TQYA 2OT3B 5DHFA 5DYIA 1K9MC 5DIFA 4DLUA 1TNDA 1VQ6A 2D2EA 1P2TA 2A5DA 1RYHA 3CX6A 4HJAA 5G53C 1Q81C 4JBMA 1ASZA 1PLKA 2XJ9A 1J5EQ 4OKSA 3I4NH 4YDSA 1PH7A 2RGNA 4DR7Q 4IVQA 3I3SR 3LX8A 1E32A 4A8JC 1OV4A 4BFXA 2QG6A 3FHWA 2ZIAA 3EIQA 5BYJA 4IOMA 2NO1A 4XTCS 4ZPXA 2IT1A 1VQLA 2F6RA 2C96A 1N6NA 4M0LA 4ESVA 3I7FA 4H9GA 2F4VQ 4PHGA 2XNSA 3BWDD 3CCRA 3MGCA 1SGWA 1HZ9A 3AUXA 3NBFA 3PV0A 2PMKA 1CRPA 3T1YQ 1ZIPA 2EYUA 4A0RA 4NBSA 4AG5A 4BBRG 3OZXA 4KYIB 1NMYA 4NKRA 4ZDIA 1PUJA 1VQGA 4GOJA 1ZD8A 4X6AH 4A2PA 3GJXC 1TAGA 2V8OA 4C7OB 2CBZA 3PR1A 3B9PA 1GNPA 2KB0A 4LFBQ 1VQMA 1CJUC 3M4YA 4B3SQ 1QZGA 1KDRA 2CHGA 1W0JA 4JCVE 1OFUX 4A3CH 2W6JD 3V9PA 3JAMi 2PX3A 4U02A 4DB2A 3GTGH 1ZC4A 4BY1G 2V4ZA 3CX7A 1TQ2A 3QKSB 2ZXUA 1A5TA 2Q2UA 5AJWA 3CXCA 2XTZA 3CNLA 2QE7D 4QGHA 5FUYA 1KMHA 3RANA 2LWIA 4US0R 2XB2A 2H17A 5EQTA 4H1UA 3EZ9A 3EPKA 5IE8A 1KO4A 4D0NA 4BLSA 4XJXA 4DDUA 3O8DA 1Z6GA 4FXPA 5FL7D 3TIFA 3HKSA 2UXCL 4A8JA 3ICEA 4UJ3A 4Q66C 4Y52H 1GZSA 1ZD9A 4EQ5A 5DN6D 3GLGA 1WI5A 5GAEC 4UJ5A 2VYFA 1DARA 1GITA 1GL6A 1SKYB 3A1VA 4LUCA 2ODBA 1ZBDA 2YWHA 2BKEA 4YDHB 5SZIA 4AKEA 2MO1A 3ZD6A 1KJWA 4QQBX 2OLJA 2WAQG 3FMIA 5GJWC 3OAAD 4MRRA 2QNRA 3KFVA 721PA 3PUYA 1EQQA 1KMQA 1UDWA 1N34L 1XP8A 1QHIA 4FWIB 4O2RA 1P2UA 2DFLA 1FOEB 3FKSD 3KYHC 4UKDA 2Z83A 2HYIC 2IS2A 4DLZA 4QL3A 1PLJA 1Q20A 3RZOH 2HT6A 3BB4A 1FX0B 4IJMA 1FX0A 1Z29A 2OFWA 3J80c 2FZLA 3VNUA 3GTQH 3GTKH 2W6ID 1NRJB 1II8A 1JMCA 1XTRA 4Z1MA 3TR0A 1Y63A 4PFSA 2MSEB 1AE2A 2TMKA 2YHSA 2ZUBA 3LQRA 3GLHE 2WMOB 1A8VA 4NYIQ 3UPUA 1RRGA 3ICQB 5EAYA 1W7AA 5CB8A 2VQEQ 1YRBA 2KENA 1XPRA 1DAHA 4I1VA 4HAVA 4LV6A 1M7HA 1X6OA 4A3JH 1OFHA 1W46A 1GVPA 4HIOA 1XTJA 2QN6A 2LCFA 5TV2A 1S1CA 2KE5A 1N32Q 2A78A 2J7PD 1P73A 2FSGA 3T1QA 3JVUA 2R62A 5JCPA 1HT2E 1ZP6A 3ZH9B 1DADA 3EW9A 4JL5A 1MO3A 3K9LA 4A3GG 1QZXA 1T9HA 2VP6A 3EZ6A 5E4FA 1N25A 2V54A 5ANRB 3L0OA 3AVPA 1AE3A 3JVVA 4JBXA 3V00A 5GROA 5BQ5A 4DNIA 5J5CA 3UIEA 2QE7A 2DR3A 2ZVQX 2W00A 4LCBA 3LWNA 4QHYA 1W2BA 5JJLA 1SVLA 3C5CA 4YHHQ 2VSOA 1YJ9A 1Y1WG 1KY2A 3Q8XB 5E7JA 4NP6A 3EBEA 4Z51A 2IYTA 2JA9A 3STBD 4NXML 4TL7A 2BKUA 2L0XA 1L1OB 2N42A 4AH6A 1R0XA 1KJZA 2X2FA 1P60A 4QHTA 4BFZA 3TW8B 3AVXA 1UJ2A 2ODWA 5FL7A 3GPLA 2QP4A 1IL2A 1JPNA 3QI2A 4Q1CA 5CJPA 1PYBA 4DV3L 5DISB 2IC5A 3LO5A 2GCNA 3A74A 2ZRIA 5HR5A 3W1BA 2AXNA 2NVQH 3TH5A 2AD1A 4QGAA 4B3RL 4QBGB 3M4QA 4DV1Q 1VQ8A 1Z3IX 3VTKA 4HIDA 1NVXQ 2OXCA 3IKJA 2WAQE 5AJ3Q 1VQ7A 1NG1A 2IL1A 3KZ1E 3SC3A 5JRJA 2H8KA 1UDXA 5BXQC 4MZ9A 1OSNA 3B6YA 1Z07A 2UXDL 3WMGA 1K8GA 1BMFD 2OM2A 3GJ4A 1VHLA 3OAAA 1TWHH 3CMEA 2ANBA 4TLAA 2Q21A 3CF5A 4C0BA 2WFWA 3AF2A 2O5VA 1QHNA 4MYTA 2VW9A 2Z43A 2J5XA 4GMXA 3GLFB 4PPQA 1AN0A 1G3QA 1UFQA 2GA8A 1XJ0A 4YMVA 3WXMA 2P6UA 1JNYA 2A9KA 3CW2C 4LJAA 2HLDD 2BWJA 1KGDA 4HZIA 1KC8C 4JV5Q 4BA2I 4DV5L 4WZAE 5BN4A 1KSFX 1WRBA 3CF0A 1SVWA 3U3OA 4ZCIA 2BM1A 2JLZA 1N36Q 1VQAA 3TEHB 3ND9A 4KLNA 4DKAC 4DCVA 5B2ZA 3GTMH 2GXUA 4PPFA 4FCTA 3R7WA 1MKYA 3A8TA 3QPUA 2VNUD 1WCMH 3CRVA 4YC7A 3ERSX 2EWWA 4XH9B 3HOZG 3RS4A 3I8SA 1Z0AA 4Q02A 4ZKDA 3AKDA 3M6AA 4P74A 4KVAA 2ZU6A 4BRWA 4KHPQ 5L3QB 5C0XJ 2J7PA 2Z5FA 1Q7YC 2IXEA 4EFNA 1F3OA 4X8MA 4RKFA 3A4MA 4NE2A 4BBSH 1T8UA 4DC9A 2CFMA 2VHTA 4IO9A 1E2FA 5FBVB 1KKMA 3LV8A 2NG1A 2GESA 3LVQE 4MGKR 1UPTA 3E9IA 1R0WA 2PBRA 2QROA 2Z4RA 3HPQA 4RCYA 3S1RH 1U8AA 4GOPC 5AR1A 3RN5A 2VBCA 1W36D 2VQSA 4GNXB 1CJKC 2UXCQ 4EQ6A 1C4OA 4FMDB 3DZDA 2HJVA 4GS3A 1H8HD 2J1LA 4KLZA 4V0MA 3QG1A 4IOLA 3SYNA 3EG5A 3KKOA 1Z8FA 3BB3A 4GN4B 5LB4A 3GLIE 1VQFA 1W49A 2WWGA 2XB4A 1BKDR 3VKWA 1ZM2A 3FP9A 4EKDA 2W58A 2ZR7A 3TMKA 1K0RA 5JS8A 2GVBA 1S0UA 2BIFA 3N2EA 3THYA 2HCBA 3DO6A 4IVPA 1TUIA 1WMSA 1BKBA 1CRQA 2YOFA 1D5CA 2ZI4A 1FJGL 3CW2A 3U44A 1JR6A 2WWXA 1N34Q 5IYBG 1AS2A 4JI8L 4X62Q 2AR7A 5HCNA 3LQQA 1TQ4A 2OE2A 5AWFC 1NIPA 4PC6A 3AF4A 5HTKA 4DLSA 3RN2A 3U7EB 4EJSB 4Q4JA 1P9NA 2B7CA 2HXYA 3DM9B 3SJCA 1F2TB 2YOGA 3B6EA 4A4IA 2QM7A 4RD0A 5LD2C 2ZE5A 2V55B 2O8BB 4DR6Q 4LK2A 4MUAA 4DCTA 1OB2A 4NB3A 1S9HA 3KKNA 5IT5A 4OX9L 5J4YA 2OFOA 2RGBA 2WPDD 4ACBA 3G82C 4DSUA 1ZRHA 2V3CC 1E2GA 4R2IA 4BLQA 4B3MQ 1N0UA 3EA5A 1BIFA 4GOPB 2G88A 4OJKA 4YY3Q 1XMQL 4GP7A 1PA6A 4BLPA 1PLLA 4ASUD 4PX9A 3TNFA 4L16A 4IPHA 1MOZA 1US8A 4LW1A 2N78A 4LF9Q 4OI0A 4LWCA 3BERA 5DNYB 1XCGB 2ATXA 4Q4HA 3TQCA 1DAGA 1VQPA 1ETUA 1R5BA 2QMUA 3DMDA 2JA6G 3U6BA 4KFRA 5JWOA 1XD2B 3HYTA 1QG4A 3PF4A 4X8HA 2QP3A 4DV6Q 2V1XA 2BV3A 2WKQA 3P26A 1GKHA 4A3FG 1KO7A 1HV8A 2CVHA 2XSZD 3U4QA 1X8JA 3BOSA 1N6HA 2JK8A 2N46A 1WYDA 3LX5A 3TVTA 1SVOA 4ZCLA 4Z8YA 2VHQA 4PO1A 2AWNA 1W3SA 2QZ4A 4MRPA 3UG7A 1XEXB 2QGNA 3CUEF 3OEHD 4KSBA 4MKHA 1GOTA 1XTSA 3RSOA 4ZIRA 3UDFA 2ECKA 4YMSA 4A15A 3B1WA 4OHWA 5JWRA 1JB7A 1GAJA 3QY0A 4Q9HA 2AFHE 1GG2A 4MDFA 4TQ9A 2BMEA 3GQBA 4EAQA 3KQLA 3VQTA 2VP2A 4F92B 1SXJE 4LV8B 5FPTA 1XTDA 5G3YA 1KAOA 3ZQ6A 2MFIA 1Q82C 2J41A 4A6PA 3RRYA 3AFQA 1ESMA 3BFVA 3BK7A 4CEHA 2NIPA 4CEHB 4PC3A 3CP0A 2CL6X 4EX5A 2DCUA 3MWKA 3HU3A 4Q9LA 1HUQA 2ZAOA 2Q9AA 2YTXA 3PXGA 1U94A 2A8VA 1NMFA 2GJ8A 1YEZA 1I4TD 3U61B 1HEIA 2ZROA 2GDJA 2ZUDA 3FKQA 4NCHA 4NCNA 1XX6A 5EE3A 3ZVMA 3TE6A 4YWKA 1JECA 5BYKA 1QVGA 1MT0A 2FDCA 2GZHA 4AQYQ 2VHCA 2DBYA 2QI9C 4DLXA 4LF7L 1J6QA 3BS4A 1VG0B 1S9DA 2WPDA 2J0UB 5IYDH 5M5XH 1M90C 1KNQA 2VL6A 3CZPA 4I1SA 3EPJA 3GLIB 4V0NA 3M0EA 2QT0A 2ES2A 3KJEA 4HB3A 1CKNB 1CKNA 1NVUQ 2J46A 1R2QA 1Q57A
chains in the Genus database with same CATH superfamily
4MPDA 4G81A 1C7QA 3QV1A 3N05A 5DO9A 5F4BA 4K5WA 3NHAA 1RKQA 1CQXA 5JLJA 4PV1C 2H57A 1QUQA 1L0WA 2R87A 3D6NB 2JCYA 2NWGA 3LT4A 3FBTA 4Q3AA 3BIFA 3ONEA 1YQUA 1RC0A 4ODGA 4J90A 1DC5A 3NYWA 5E6SB 1OKKA 3H17A 2ORVA 3E8XA 5J3JA 4UHHA 1MRZA 3V48A 4Q5IA 4F71A 1GP2A 2PKYX 4XPZA 5KZMB 5HQTA 2QRLA 1OXXK 1JI0A 2J0SA 4KWTA 4YJ3F 5DI3A 5JBIA 3T16A 2R25B 2PEZA 1K88A 1EVIA 2IRWA 1AD2A 5CBPA 1B6GA 4IIFA 5FLMG 3C3JA 2CH4W 3E81A 5BT9A 3K71B 3VNBA 2PQMA 3ZDDA 4JLUA 3KOUA 2YHIB 1RHJA 3IFSA 1KEWA 1HI9A 2RK4A 4PO8A 4R68A 1H9RA 4YJ2A 1YS2X 1C0PA 1J8QA 3QSYA 4RMNA 5HQ3B 3MRSA 8ADHA 3UE0A 4LXQA 2PHZA 3I4MH 1MAWA 2XCOA 3S8YA 3WB1A 2RIRA 1P5HA 2YH2A 5D7NA 1RD4A 4LF7Q 4C0JA 1WETA 5ADHA 4DEXA 1ZEJA 2XQGA 3EVDA 5BUZA 3S2HB 5JC1A 2UVPA 3M3YB 1BR9A 5J3BA 4O4LA 4JBKA 1KSGA 3WYGA 4LOKA 3IP1A 3JQDA 4RTJA 2BHRA 3OQVA 1QFJA 1PCXA 2EERA 2BEUA 2FW7A 3ZDZB 3S1AB 3KLWA 1QRAA 1UOOA 3OPNA 2PL3A 5CC4A 2Q0SA 1G3MA 2BOVA 4PAWA 2O5IC 1M0TA 1OT5A 5GOZA 1U7XA 1YZUA 4TLMB 2PWYA 3EASA 3M4PA 2JGJA 2OLEA 1ZK2A 3UQYS 2PZFA 2Z6QA 1U1CA 1M74A 3MCUA 4BZXA 4P7JA 1NLFA 1CF2O 1RAEA 2ORWA 2VYCA 4ZQBA 4FW9A 2HC9A 1X9HA 1AIPA 3TNJA 2O9JA 3R6LA 1U2GA 2IXDA 4HNTA 2YVLA 1H05A 5LP6F 2H16A 3VKVA 1RJWA 3Q3VA 3SIWA 3GFVA 4D8XA 2E2JH 5D1NA 5IJ0B 1NVVR 2IHFA 1UQTA 2XGMA 5C0XG 3A9WA 3PP8A 4LK3A 1JLHA 2H3HA 3IA7A 3V7UA 5HURA 1IDN1 2BFCB 1OYWA 2C5CA 4CF7A 2PD3A 1U7PA 5AKEA 4F3KA 1RAAA 5KHOC 4XCVA 3KEGA 3AJ9A 4DQDA 2IH4A 4URVR 1QHFA 5C8DA 2AL7A 1A9ZA 1L7BA 3ZHSA 5C35A 3WKDA 4F85A 4KE7A 1RXWA 2INGX 1E3SA 3VISA 4LF5L 5U4QA 4O3FA 1S8AA 2YTYA 3PC7A 4UBNA 1D6SA 5CT9A 2VDUE 3DMYA 3C2PA 3SF8B 2XIWA 2C4TA 1Y5RA 4UU7A 2KM1A 1RXCA 3A6PC 1O95D 5K9ZA 2ZJ7A 4CGYB 4X8OA 4PLZA 4US2R 4R8IA 4Z54A 1WE2A 3CVXA 5AW2A 5F9HA 2IY8A 3Q9LA 3MUFA 1DE0A 3QHPA 2WB2A 2FSFA 1VL8A 3A9UA 4H7IA 2B8TA 1I3QH 4TKLA 3OU6A 1FXWF 1E60A 1OA0A 1PHRA 3E6ZX 1TJ5A 4WGFA 4RPIA 2AHRA 2AZMA 1GCOA 1UBKS 5ALOA 2C5BA 4Z7JA 2VNHA 4HDKB 1CU1A 1OXUA 1F9AA 2PT5A 1N2GA 4I55F 3RF6A 5CT4A 3I0NA 2QUZA 3PJGA 5KYWA 2H7XA 2AN1A 1DQZA 3OZUA 2IS1A 2LMCB 2YNMD 1QVAA 4A3DH 3SXUB 2BGGA 1UZUA 2FZ5A 5KOJA 2NV2B 3KZOA 1QWYA 1OU0A 1N1DA 4QA9A 4BNHA 1PV4A 2UXDB 3J81i 1O9BA 1DCMA 1QCZA 1RI5A 2W6OA 1YZNA 1QQ6A 2FNAA 2NAPA 2WTXA 1QFZA 4XUCA 2O0LA 4I9UA 1EP3B 1UC9A 1JIVA 4C20A 1KVSA 2XMDA 5DM63 1LQTA 2IH5A 5DU2A 2NVXH 2PVPA 3KPVA 2A30A 3ER9A 4LYFA 3PEEA 5ALMA 3B53X 4N3AA 3O74A 4PZEA 4BE7B 4A0FA 1NBWA 1PJ8A 1LW6E 2I03A 1JG4A 3BD8A 5A7HA 2JIBA 4G4JA 1T3GA 1KK1A 1I1QB 5DM73 2FCRA 3OFNA 5HGXA 3I9V6 4EJSA 1ZAKA 3M4OB 1WV0A 3AKEA 4L08A 1HO3A 3LQ1A 1KZYC 1Z38A 3C6BA 1YGYA 2OZPA 3QLVC 3QXSA 1E20A 2R1TB 2OBLA 5LP6C 3BVMA 4CQJA 2W6ZA 1KBQA 2IPXA 4TV8A 1TZMA 3ESQA 5EIWA 2BE9A 5D87A 2P5UA 4YWHA 1TM4E 2I34A 2KBFA 4HUQB 3EN0A 4FDMA 2Z6VA 4AICA 1BS1A 3PHLA 3ODPA 4XTRA 3CUYA 4K88A 1YZ3A 5TDHA 1IK4A 3CGGA 3TAUA 1ZUHA 3U0VA 4M1ZA 3RVBA 4RMFA 3P2JA 1NR4A 4WOKA 5L3SA 4LVCA 4A3GB 6NULA 4DUYL 3CC4A 2R6JA 4EKNB 1UOPA 1NUUA 3V55A 4JLBA 4KRXA 1V7ZA 3GGDA 4AIRA 2A6ED 2VDQB 1B0UA 3NKVA 1S3FA 1RBMA 4LYYA 4IILA 1DQPA 3FJOA 2H1IA 1ABFA 4OHBA 4HWPA 3P1JA 4MYDA 4IXMA 4AP9A 2I22A 2VY3A 4UAVA 4IVRA 4POOA 2W2QA 3DWEX 3K57A 2ZREA 2J32A 1D7QA 4PINA 3BQ9A 2G08A 5EMKA 4JX9A 5E6SA 2ECFA 4QG3A 3PQ8A 3NDIA 4NS4A 4KYVA 3N7AA 4ZOLB 3KLNA 3GJ6A 2WPNA 1EIYB 4ZOEA 3OIFA 5HTOA 3QW4B 3A28A 4M1KA 4P73A 1Z5UA 3M6WA 1YDWA 2P4QA 4GLJA 5JARA 3N2NA 3PC8A 1L2FA 3SEQA 1UBHS 4PZPA 4BGDA 4R4TA 3E9YA 4LMQD 3L1HA 3DLTA 1L0XB 4HNGA 5KYVA 5IKXA 2X5NA 2QXYA 1CX9B 4UMVA 4MUMA 4IV8A 2YYZA 2R92H 3UB3A 5HQ3A 5KPJA 1WB9A 4GHWA 1K7FB 2WWTA 3DXFA 3QYAA 3UMBA 5KQGA 1LPSA 5PGMA 4BE4A 1DT5A 5IGDA 4D9FA 3BTUA 4NBNA 3L7AA 5C7IO 2BONA 4EA7A 4CDRA 2NVTH 4WASA 4E1BA 3QEKA 4RSGA 1H6AA 1K4MA 1G20A 3S1AA 4PW0A 1ELOA 5BSUA 1AN9A 3RS2A 1FBTA 4Z4CA 1KO1A 2JDIA 4M9QA 4CKWA 4DUGD 3DUFB 2NNWB 2XVSA 4WACA 1HDCA 1UMDB 3HOVG 5AVJA 3OQ1A 5JDCA 4WJLA 2Q9BA 4JP1A 1KEEB 3JQFC 1ZVJA 4C4TA 3GJQA 4OQDA 4JLMA 1UEBA 4XJSA 1JS1X 3JD4A 1TDJA 5KJCA 4KNWA 5A4IS 1YR9A 5JT1A 1UDCA 2X6RA 3HI4A 2LGJA 4Z99A 4WJKB 2P9JA 3QELB 2BE5C 2AV6A 3P45A 3GTOH 4BCDA 1D6MA 4C3UA 3HCFA 4OXXA 1UNSA 2WNHA 4UMFA 4E09A 1Y42X 4EARA 1TJ3A 2O2ZA 2XNDA 3C6ZA 2GLXA 3AJ8A 3OLVA 2BFCA 4A0QA 2FCAA 1JPJA 2NACA 3KJQA 5CP8A 4GI2A 2JCXA 1G5FA 3T9EA 1TIID 1ICIA 5JAIA 2B20A 3SP1A 4BUJA 4IIVA 2B2XA 2XNCA 4DA7A 3GLRA 1H95A 1CULC 2PAAA 1MV5A 3B85A 3JY6A 1QC5B 4RQBA 4IPTA 1D03A 3EGXB 2RHOA 1MVLA 2AYXA 4X45A 2PGJA 4AUNA 3TI7A 1E3JA 3SF8A 4EPVA 4IWYA 3B12A 4M46A 2ICIA 3TSYA 2BBSA 1FYWA 4CGYA 5CITA 3RYTC 3HABA 3R8FA 4WCDA 1ZM9A 4PC7A 2P2SA 4X6LA 1QOHA 3I4MG 4HNVA 2UXBB 4XGIA 1Z83A 1QM5A 4EF6A 1G19A 4WA7A 1T25A 4ALLA 5K1ZA 3IE2A 2PUGA 3ZVRA 1UK7A 3R20A 4FYHA 1WW3A 4LPSA 4HDKA 2CFRA 1II8B 4QEKA 2VL7A 1EJ6A 3MQFA 1A62A 4FFDA 1UK6A 1LRJA 1L8AA 2JS7A 4C2UA 4HS9A 1YQXA 1GG9A 1V7QA 5J4VA 3U7JA 3STHA 5A4AA 4CKCB 3IDOA 3SXUA 2NXWA 1UEJA 2A33A 3QB3A 1GA6A 1U7DA 5M5XB 3ZTYA 4MQ6A 3OQ6A 1T8PA 2VKQA 2VKTA 1T3LA 1GKKA 4YRMA 2R85A 2B2WC 5CFRA 3AM1A 3FYSA 3WOEA 4BN5A 3OW7A 2I1QA 3UCFA 3MF4A 3AR4A 2Z4SA 1X8KA 4A3LH 4WLEA 1NN5A 4IIHA 2HDOA 3H3VI 1FMLA 1VRCA 1L4KA 2EHDA 4RJIA 2CWWA 1ZM4A 4P3YA 3Q7EA 4KAXA 1M8GA 4FSXA 2BGRA 4JXZA 1NN3A 5AM1A 2HX1A 1H69A 1A9XB 3P75A 1G1AA 5HF8A 1LPMA 2JFFA 4ON9A 3SGLA 5A05A 2ZIEA 4B08A 1MB3A 1TIPA 3RASA 1DO2A 4HG2A 1KHIA 3PNMA 1FQWA 2ZS8A 2L0CA 3WNCA 1HFJA 2PLNA 3SHVA 4P71A 5BWLA 1XL0A 4R0MA 2PX8A 4IDDA 4ZI7B 4JYCA 1Y5MA 2R1TA 4ZRZA 4D1YA 2R1VB 4CUKA 4GXNA 2XBMA 2RCFA 2QTBA 4C0AC 4HUQA 2YWDA 4OHJA 3QWIA 2WM9B 2M1ZA 3AY0A 4B6SA 3TQRA 3BL8A 1N6PA 1Z5VA 1U99A 1A2KC 5LZ7A 1XTKA 4FR5A 5EXSA 1M6YA 4KW7A 3WQHA 3A7DA 4C4AA 1XNGA 2GKGA 2UYOA 1Q0UA 3I1JA 3ZLJA 2CT8A 1UJBA 1VG8A 3W8FA 4B34A 4Q3DA 1BZYA 3STTA 3E5NA 1ULAA 4RLFA 4QYWA 3PF8A 2JXMB 1CUKA 1UF9A 1A27A 2IK8A 5CNKA 3BHMA 1LDBA 4CMCA 1D7OA 2GJSA 3GPIA 3HUEA 3NNSA 4UATA 1Y1VH 5LL6X 3O95A 5JE8A 5AJHA 4JB0A 1RRPA 4RF5A 1PG5A 3A6FA 4CETA 3ZXUB 4IGIA 3TLZA 1SVSA 2DR0A 4ZOLA 4RTSA 5CFOA 3EMBA 3MJFA 1HORA 4C88A 1G8SA 1MB9A 3I39X 1NPTO 3RVJA 3GTJB 2X69A 4PRYA 5H5JA 4UHDA 5T1GA 3EG9B 1HEUA 3LUGA 1V5WA 4YWLA 2QENA 2JHPA 5TQ0B 3QFHA 3HLYA 4I7ZC 5HILA 2PTHA 3MT7A 1NTGA 4CM4B 1TL7C 3L3OC 3A9RA 1DCKA 4W7SA 3EULA 2ZCJA 4U8HA 3O8RA 4LNUB 1E6CA 1LLFA 3IMKA 4JLNA 3RS3A 3LFTA 3H86A 2C9BA 2O5RA 3L1IA 2AOVA 1ZLYA 1SPBS 3QVXA 4H6VA 3AHCA 3LDGA 3FWHA 4QXQA 1U81A 2FRDC 2OXFA 4I65A 3MXNB 5CLQA 4OHYA 4B6FA 4IGFA 1OT3A 2W8BA 3ZWWA 5ALZA 3EEBA 1XDGA 3CLVA 2XWJI 3OKFA 5EP4A 1V45E 4FI3F 3VU9B 1FC0A 4RFVA 1JMKC 5TB5A 2GERA 3WTBA 1L3IA 3DUFA 2RGCA 1VLMA 1JYSA 2XZDA 4FD2A 1UMDA 4G8CA 2ZXOA 1KEEA 1VMIA 1Z6XA 4MR7B 5CDFA 2O6LA 4NYMR 4YV7A 3AB3A 1XDDA 1FRVA 1WU7A 5GVSA 1T1SA 2E18A 3AEZA 1S8OA 2G70A 3S7TA 2X9VA 3PO3G 2GARA 2HQ1A 5DYNA 4A0GA 5FBQB 3DVQX 2OV4A 2FSUA 2ZYTX 4EMTA 1NW8A 3DWGA 1T9CA 5E4XA 1K9VF 5IABA 3V46A 3WLNA 4B5LA 2GVZC 2APJA 2B94A 3NBYC 4BMCA 1LTRD 2QV7A 2EZVA 3LZCA 1WXEA 4ALIA 5G53C 3I4NH 2YTZA 4Q3BA 4XTCS 4WK0B 3SOZA 4F60A 3FMVA 3WG9A 1W5EA 1QC5A 2QLFA 1GZUA 1RSZA 2XA2A 4HNQA 3EGXA 3V8QA 4OP3A 4EJFA 3HCNA 2IV7A 4JV5B 2P68A 4LFBQ 3RUCA 2F0KA 3R2JA 1KJJA 1K8XB 4PYLA 3UC5A 1H2XA 4Z53A 4F3NA 4TUYF 4US0R 4XX0B 1ENPA 4O4IB 2AKEA 3SHLA 3HB9A 3ICEA 3I0ZA 3QVSA 1SBQA 3V8EA 1ZD9A 4H7EA 2BKEA 1RLMA 3OAAD 3HVRA 3R41A 1UDWA 3DWFA 4FWIB 1VJGA 1C80A 1TK2A 2A14A 4CKEB 4EKYA 3FJYA 1II8A 2MR6A 5A35A 2L55A 5B3LA 1O95C 4XIYA 2B1GA 1PYGA 2ZLBA 2EBFX 4ZZ1A 2LZ0A 3DNPA 4I5IA 4R6WA 3KQPA 4CKCA 4KQIA 1DTWB 3EZ6A 4E21A 3ITDA 4MX8A 1KQOA 2QRJA 4WKBA 1H9AA 3F3KA 3BL5A 1KY2A 1QILA 1QGUA 2N42A 5JYCA 2NLOA 1XA0A 1Z39A 1IL2A 1XVVA 5CJPA 2IC5A 2GCNA 3W5DA 2NVQH 1STOA 1WDMA 3GJRA 3IKJA 3OOWA 4HN7A 3Q2OA 4MZ9A 3B6YA 2R00C 2UXDL 2JKVA 3ZR4B 2ZJ1A 2AJDA 2OWDA 1TRKA 2LS01 3A4YA 2J5XA 2YNMC 1P4RA 4PPQA 1V16B 3PCTA 1KC8C 1CIJA 2Y67A 3LG2A 5BW5A 4DCVA 1ZN2A 1DCTA 2ODTX 1J5PA 4TYMA 2G9UA 3M6AA 4GUDA 5C0XJ 2JGFA 1A9XA 1Q7YC 4BBSH 1T8UA 4R8LA 4BRSA 3L92A 1W36D 1C0LA 4Y1RB 1C4OA 6LDHA 5LB4A 2O6HA 2ZR7A 4DBZA 3PT5A 3TW6A 3WSWA 2WWXA 2O4XA 4FFSA 4YRAA 4ZI7A 3AU8A 2F3VA 1RBZA 1HTBA 4OGLA 3LL7A 1UPCA 3V7WA 4BLQA 4LE0A 2A57A 4OJKA 3DM1A 3D3KA 1PLLA 2OGSA 3ERQA 1MOZA 2K1BA 3PD7A 1V26A 3AR9A 1QZ3A 3U6BA 1ETUA 4EQZA 5A6SA 4UZFA 3DULA 1SUSA 1BBXC 5AVRA 5EBCA 1KO7A 4GXRA 2JK8A 1WYDA 4Z8YA 2VHQA 4OLHA 1E7MA 1R4QB 3OQJA 2I6TA 4ZYTA 5A4KA 3E9DA 5F9MA 2IZ1A 3G2LA 3CJRA 4LV8B 3MPOA 1P45A 1GR0A 1ESMA 5JS6A 1W8IA 2IDJA 3VC3A 4Q9LA 1U94A 2A8VA 1YEZA 1HEIA 1QIGA 2RD2A 4YWKA 3ENZA 1J1ZA 3AFIA 1JTFA 1RYMA 1KNQA 3OFSA 1K92A 2C4MA 1CKNB 2J46A 1O9GA 1IZ0A 1KS9A 1HQRD 1XTTA 1X87A 1GZ7A 1ONNA 4ZCQA 2QDBA 1IOWA 1KQGA 1PZKD 1DXOA 4NCKA 2A6EC 3KJGA 3S16H 3EZ2A 3NETA 2Y1EA 5DWDA 1H4SA 4LE1A 1TMKA 5HS4A 1MJFA 3MRXA 4DR4B 2WTNA 2P1ZA 3T1HQ 1O2DA 3QYPA 1PR6A 2BLLA 1JHRA 1RQNA 1L7OA 3VC7A 3NCTA 2GR9A 1M9NA 3EG9A 1I3CA 3ON5A 1RHPA 1PL7A 3EAFA 5JI2E 3ZD7A 4Q4AB 4QXMA 4IUPA 5TQ0A 2PSFA 4CM4A 3CX4A 4QUFA 1SXJB 5EL0A 1R5NA 2J5BA 1UJ4A 3CC8A 2VJNA 3D3JA 3VH4A 4L5CA 1J0CA 1Q19A 3QXHA 3GA5A 4LNUA 4L8JA 2I87A 1RWXA 4JKOA 3D7LA 4EITA 3N1UA 2ZJAA 1EK0A 4CM5A 2VUUA 1M76A 4FMDF 4K2HA 4M1QA 2ATVA 2O3JA 5C4ZA 1RBYA 1GQFA 4DWWA 3MXNA 5EBDA 3SCZA 3LQYA 1JLKA 3P19A 3BHIA 3W8EA 1I3QB 2FI1A 4XFDA 1FZQA 3VU9A 1VCHA 1JOKA 3HGTA 2IXAA 2VRCA 1OFGA 3NP9A 1JWUD 4CYMA 3VYWA 4N8EA 2O8NA 4QAQA 3HR4A 2C7OA 2JIZA 3FHOA 3LHSA 1LDGA 4X41A 4MR7A 3CVYA 2M9MA 4GKBA 1UFOA 4D4HA 4G7ZC 2NU9B 2WDZA 4YDRA 3LX6A 1HSOA 1LU9A 5BYAA 4A3DB 4UU8A 5GZ3A 4OMUA 2CUZA 4U673 5JQGF 2JD0A 4FT4A 3JWIA 1NJ2A 2AMLA 1V39A 3R3ZA 5BN3B 1XN4A 1OC4A 1WJJA 2VLIA 2YYAA 2YR0A 3WB0A 1RXEA 3OIUA 1OW3B 3TGPA 1E6MA 1DJLA 4BVJA 2QPAA 4ZYYA 1G6PA 2QUBA 4F38A 4UP7A 1Y1VG 5JC8A 3F7MA 4RA9A 3H2IA 4R2LA 5KI6A 1ZZGA 4ZC8A 3PF5A 3R1IA 1FJHA 5FK9C 3I6BA 2PMZE 2AOXA 1PKEA 1JDNA 4RVSA 2A35A 5D3MB 1KOLA 2YVAA 1KAQA 5DRYA 5GPBA 3KLSA 4MV5A 3CT4A 3TR5A 4X1KB 4EQPA 3O5AA 3RUPA 3HA2A 3A1DA 1L8OA 2RGAA 3EARA 3GI1A 3H1TA 4DILA 4XX0A 2P7HA 2JANA 4O4IA 4EJMA 3VDYA 4IM7A 1NQUA 3DKRA 4BUZA 3I2YX 4FF3A 1MVOA 2P69A 1KJIA 2O05A 2C1XA 2VZ0A 1KK3A 2GJ9A 4CKEA 2UXBL 1WM1A 2XGGA 3C1FA 4QXRA 3OF2A 5D6OA 2FRVA 4FYKA 3ROTA 3ND6A 1CUFA 1EU1A 1L5OA 3ORFA 5BSFA 5EEGA 5IYCH 2OKGA 3LYAA 1Z18A 4ZRMA 5MFZA 4R9SA 1DTWA 2Y1DA 1NYRA 3QLTA 3FSRA 3WICA 4LJ9A 3BWYA 3LXRA 3IHTA 4C3JH 1PZGA 2FZWA 3EWIA 4MUBA 3FXAA 2J9GA 4K6OA 4LXHA 5LZ8A 4E1AA 2JA8H 1ZIYA 3OTHA 5FX2A 3UO8B 2JFQA 1O80A 1RHQA 1Z7BA 2WB1E 1E4VA 4AYBE 1QV6A 1V16A 1QCBD 3UT0A 3OZBA 2XSCA 2GAAA 2ZBEA 1VI6A 1W2GA 3RFXA 4R1OA 2AUMA 2C77A 2J0QA 4CPDA 1UP7A 2PEYA 3RWMB 5TXGA 4I1RA 4N6OA 2JH3A 2LDXA 4KUEA 3B20A 4Y1RA 4WTOA 1W87A 1XTQA 3TSAA 3UCXA 1P1FA 5LIRA 2J87A 2R6R1 4L15A 3GLHA 5DHUA 3QVKA 2ZRJA 1WOMA 3PLNA 4BFCA 3REQA 1RCFA 2DLDA 1FJGB 2DERA 1EK6A 2DB3A 1QAOA 3A7AB 4JI8B 3I4NG 4MIKA 2VPIA 3SZMA 1GGVA 4H17A 1JAXA 3WDNA 5K7SA 3VKGA 2R92B 3GVIA 3STYA 2JJ8A 2ZTEA 2QDLA 1TWFB 2J3EA 3MA0A 3DKKA 3VR6H 1AGPA 5A7GA 3KOJA 1IEXA 1ZI8A 3CPJB 1NDUA 4F87A 2K6AA 1RQPA 2VF4X 1RKUA 1XZPA 4PG8A 4TSFA 2GPYA 1XHLA 2L18A 5F73A 4W8GA 1ZK4A 5JBNA 3SJ7A 2WHXA 2J3LA 4JSTA 3UJ8A 2Q3BA 3DB2A 4E4TA 4YIKA 1M2EA 4BQRA 2GXAA 3ER8A 2X41A 1EX9A 2I1LA 1CQJB 3C5WP 3E5RA 3HWWA 3ZX5A 4R05A 4FHGA 3B6KA 4HGNA 3DZFA