4F88A

X-ray crystal structure of plyc
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
INVNVENVSGVQGFLFHTDGKESYGYRAFINGVEIGIKDIETVQGFQQIIPSINISKSDVEAIRKAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein, viral protein
molecule keywords PlyCA
publication title X-ray crystal structure of the streptococcal specific phage lysin PlyC.
pubmed doi rcsb
source organism Streptococcus phage c1
total genus 10
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2012-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.850 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f88A00
4F87A 4ZRZA 4F88A
chains in the Genus database with same CATH superfamily
2YU9H 4UPAA 4A3KH 3R2TA 1EZ6A 1LLRD 3K6OA 1C7YA 5C4ZA 1IYUA 1WTHA 1TS3A 4C1NK 1LT6D 4UP8A 3V05A 1EWIA 5M3FB 2DJGC 4N9TA 2B2YC 2F0OA 5IGFA 1A2TA 2EOTA 2QF7A 5AFWA 4FF1A 3S17B 5E3FA 1KDAA 3H0GH 4BY7H 4HN7A 3PO3B 2A68D 4B3SQ 4O1NA 3MA2B 4IPGA 4FNFA 2PW5A 4OWTB 2OQ0A 4QQBX 1U9RA 4KY7A 1CKNB 3KLSA 1MHWC 3CCLA 1Z9FA 3I72A 4C2MH 4DR5Q 3G48A 1I6HH 2D9UA 1XTCD 2NBFA 1EQRA 1S5FD 4XYQA 3S1NB 1PH5A 1YJ9A 2JN4A 3W1GA 5BR8L 3EIVA 1NY4A 2BOSA 1BVSA 4P71A 1KIXA 4RWSC 1VQ6A 1UE7A 4A3EH 3S2DB 3KLSX 2FHTA 4BS9A 4OELB 1X3PA 4JI3L 4MNOA 4DN4M 2UUAL 1G8ZD 3L3OC 4YY3Q 4AQYQ 2OT2A 5LHY1 1SLJA 2B2UA 5A2QE 3HG9A 4HAEA 3L9AX 5CORA 2NZ1D 1A8VA 2R7FA 1K73C 3TSSA 3M4YA 1SNCA 1TY0A 3MTSA 1HQRD 3D0FA 2AMCB 4L5TA 2R3ZA 2IT1A 4RKBA 4LF4Q 3K81C 2FMMA 3NUCA 5I9PA 1GD7A 1TWGH 4XTCS 2KCTA 3URYA 5FOBB 1CUKA 4L6TB 2CFMA 1DZ1A 2RDFA 4L5RC 1SSOA 2KHJA 4DR6Q 1DONA 1NSNS 3J80E 5IGBA 1Q7YC 4UDUC 2UUCL 1LTBD 2F0PA 3JC66 1IHZA 1HR0L 1VMCA 2AWOA 3VA5A 2NVTB 3H3VI 4QJFA 2NVXH 2ID0A 2AUJD 3IRBA 4QF4A 1KQSA 1ESRA 3H09A 1I50H 1IKLA 5IE8A 5FLXE 5IGEA 4QGUA 1D5ZC 2QDLA 3ULJA 3NHHA 2NUCA 2KCNA 2H1EA 1HXYD 3A56A 4P2CB 3DWQA 2PZTA 3B6YA 2PNRC 4KKUA 4ZUJA 4RGTA 4LNQA 1D6EC 4A3FB 3BVGA 4ME3A 5JVG3 4CKBA 2C5CA 4NXNL 2WIIB 1CKNA 1CI3M 3TS0A 3HOWH 3PUXA 3W2DA 4X3KA 2HIXA 2X6LA 1AP0A 5KRUA 2WAQG 2LMCB 1W6KA 3GTLH 2EYFA 2RQXA 5IYCG 2HHHQ 2XVSA 1BBWA 4NPSA 5JJLA 1C8CA 5FO7B 1E22A 2EJMA 3IL8A 3S2HH 2A68C 4CDEC 4HJAA 3FHWA 4DNRB 1HHVA 4PG3A 1GVPA 1N36Q 1L1OB 2RDHA 4RCOA 3TP7A 1N34L 4G7HC 1PRTF 4UP9A 3UDIA 1RODA 3DEOA 1HNZQ 1VQ9A 2B2UC 4Q5VA 3F2CA 1DOKA 1TWHB 1CKOA 1LTLA 1SE8A 1TWFH 4IPDA 1W2BA 4DR4L 1KLGD 3OWEB 3PSIA 2F0UA 1TU2B 2LXJA 5AJ3Q 2AQ1B 1Y69U 2K01A 2PZUA 2JEBI 4TRDA 4A93H 1UNSA 2H4OA 4K14A 3TN2A 1SR3A 1SMXA 2CWPA 4NDXA 2XRQD 1IBKQ 4YWMA 2KECA 2E5LQ 3TS2A 4XDXA 4XIGS 4JI2Q 1TWAH 4A3DG 3DLLA 3KLRA 3QB3A 3ONAB 1PH3A 2JP1A 3H15A 1VF5C 4CKEA 1I5FA 3KJOA 2F4VL 1TQOA 2RDGA 4HMJA 4DR2L 1A15A 1YNJD 3TP5A 1O7IA 3KFUA 5EJWA 4HSVA 1TS5A 4X66L 3HZXA 3M4PA 1QVCA 3UE0A 1MSHA 2LXKA 2X6GA 5DM63 4LFCQ 1ZYRC 4KI0A 4R9WA 3S14B 4K6LA 4JBMA 1GJXA 1TWFB 1TXYA 3FPPA 4TSSA 3BZDB 1U4RA 1S5BD 3BDCA 4R4IA 5HGTA 4JV5Q 1JWSD 4DAPA 4RA8A 1JR0D 4EQOA 2OTLA 1WVLA 1SXTA 2LKVA 3W3AA 2SEBD 3GTQH 5E7NA 2N55A 4JI8L 2WB1G 4WFN3 2N49A 1BKBA 2B8FA 4DK0A 5A2QL 1EUJA 3BZCA 1JQYD 2R7DA 1SYBA 3OTOL 4XT1B 1M8AA 3CC7A 1OXXK 3RZDH 1A0IA 1N33L 1ENFA 3PF4A 2NZOA 1EY6A 1PFMA 3HEJA 4X62L 1Y1VH 1IBMQ 3QWNA 1F9RA 1MD2D 3PO2G 3OMGA 2K6AA 5KYLA 1KRTA 2NN6G 2WINB 1L1OA 4F87A 4G7ZC 1GOZA 1UE6A 2IHFA 1VQJA 4IUQA 2R92H 1KHIA 1PTOD 1N32Q 1KXLA 1HQMC 1GHKA 4DR3L 1FJGQ 4YCUA 4JI1Q 5LL6S 1TWCB 3G4SA 3SXHA 3A0JA 2F3WA 2EIFA 4BY1G 1RDPD 1JICA 3J7YW 1HZBA 4A3GH 5E4XA 2KCCA 5L37A 4DV7Q 2Z4IA 1VDZA 4HJ9A 1ICWA 5FLXL 3P1HA 2VS1A 4P75A 2F0IA 5IP7H 1SMYD 4LAAA 3HP3A 1WYDA 5HGQA 3CC4A 1XNRQ 4QIWE 1STHA 4LF9L 1IW7C 2RSNA 4POGA 4OGQC 1WTRA 1AZPA 2UXBL 1D1KA 2NB0A 1Y8OB 3NTIA 3VYUA 4M8AA 1CQFA 3MVVA 3K5LA 4ALPA 2L1BA 1UUPA 1D7QA 4LF8Q 2R92B 1K3BC 2EE1A 3TZDA 2B2TA 2EYPA 1I94L 4HIMA 1HZCA 2KEDA 5T1IA 3HKSA 2L5TA 5K5PA 2Q2IA 1AE3A 2QEXA 3GTOB 4OWXB 3CW2C 2WP8J 3M3YH 2YTVA 4A3DB 4DR7Q 1Q90A 5IT9E 1DM0B 3F2DA 4AYBE 3PQIA 3AB9A 2ZXRA 1VQ7A 2VB2X 4F7XA 1ML0D 3I4MG 5I4DA 1WI5A 1DOMA 2A69C 3E0EA 5LMUL 4OO1G 4YHHL 2AQ3B 4DKAC 1SE2A 3RR5A 1HNWL 4CJ2C 4ZLTF 1SDFA 4A3IB 4JG2A 3HOUH 1PYWD 2B63G 3T53B 3S1MH 5GAHC 2JA5B 4YCWA 1K8MA 5KEEA 2BCOA 5DLQE 5C44G 3CP0A 1GKHA 2SNSA 2WB1B 1QB5D 4DV0Q 4GN4B 1M1KC 2Z6KA 3L2PA 1PHJA 4XT3B 4DR1Q 3BU2A 1V1PB 4B3MQ 3HOYG 1A3TA 5IWAL 4P73A 2FXQA 3NENA 4S3SA 2ALYB 5EPKA 2WFWA 3KBXA 4LF7L 3HKZE 3S24A 1B53A 3K5NA 5GROA 3A8IE 4X3TA 3ZJYC 5C5MA 4P74A 4KJNA 1H9JA 2EY2A 5IYBG 4BBRG 2WACA 1I4QA 1V1OA 2CQOA 4ZKBB 4Y7NB 1E2ZA 3NXWA 2UUBL 1WCMB 1XPOA 1V9PA 1JOKA 3HOUB 2CKZB 5JJKA 1SFOH 3VYSA 4EQ5A 4JOIA 4V0BA 1I3QB 1PVOA 3I4OA 1EYGA 1Y1WB 3PF5A 3I4LA 3D31A 3J7AF 2JA6G 3C1EA 3NE5B 1T5XD 4KHVA 1PTOC 4TQUS 2TMPA 2HUGA 5IP9H 4B3RL 2JQOA 1XYIA 3E6ZX 1KABA 1RL2A 3KK7A 3ULPA 4LF6Q 5IYDH 2L4NA 1HTPA 5C3XA 1VQKA 3TBIB 2B2TC 2ZXPA 1RJTA 3CCUA 5JOBA 2E2DC 1E1TA 2F0DA 1JJ2A 2VQFQ 1JB3A 2F0KA 5JVH3 1HNXL 3TMEA 2ZM6Q 4LF5Q 2J0TD 2DNCA 5F2DA 1FD7D 5TSSA 3AEVA 2A6EC 3LGJA 1JJCB 4X6AH 3FKIH 2Q8RE 1L2FA 1HZAA 2B2YA 4A3JH 3KLWA 3AMUA 5JEAJ 1ENAA 4L8JA 1BUVT 3AQQA 4RGNA 5GAGC 1SYDA 5C4XG 1BDOA 1SJHD 3F1ZA 5M5WB 3GTPH 3J80c 3PIP3 1VQAA 1IBLQ 2VB3X 1LT4D 3CQZH 3KOJA 1STYA 2ASBA 4HIOA 3RD4A 4IFDH 2PMZE 2QW7A 3SE0A 2VUMG 2JA8G 2K33A 1SNDA 3U9SA 5T1GA 4DV1Q 5EBCA 3I4MB 4A3KG 3U4VA 2PW7A 4CDFC 5FLXc 4RHSA 3J80i 1PZKD 5HURA 1V1PA 2I5MX 2CW0C 2E2HH 2Z6KC 1X65A 1YNND 2I5LX 3T51B 2E2JH 4RHRA 5J22A 3GP7A 3HOXB 4PZ6A 3ERSX 3HS0C 2B63B 4DV2Q 4DV4L 2Z6BA 3H0GG 1RHPA 4BY7G 2NVYB 2O5JC 1FGUA 4KHPQ 2Y0SG 1ILPA 5C44B 3S16H 1HZ9A 3HOZG 4ILWA 2UXCL 1X54A 5M3FH 3Q22A 3S15B 3Q0AA 2KJXA 1FVIA 3IKJA 3S17H 4DK1A 1S4ZA 1EQQA 2ZTEA 1J5EL 4DV5L 2JE6I 2DUDA 5C3EH 2BDNA 1QUQB 2PI2E 3PO3H 4JOIC 4KN4C 4IFDJ 1EEFD 4DAMA 1CK1A 5E1FA 1GUSA 2E74C 3OPOA 5D3IB 4BBRB 5KNCA 1E0BA 1M90C 3MXNA 2F3VA 2Z0SA 4A3EG 5CGKA 5H1SE 3S1NH 2I46A 1VF7A 3I8ZA 5BR8Q 1Q86C 1RF2D 2B2VC 1ASZA 1Q1EA 4X65L 5ELEA 1STEA 4LFAQ 2JA6B 2CHBD 4ZUIA 3NBHB 4XQJA 3S16B 3S2DH 3K57A 1HRJA 5G3LD 4JI3Q 4WJWA 1E7ZA 1F9PA 4AYBG 1F77A 1VQBA 1YZ6A 1NBWA 4MN3A 2HCCA 1Y14B 1SNPA 3MAQA 3I91A 4KJOA 4YWKA 5CV4A 5C3EB 4WJ3M 4ZCKA 2HDLA 1K8GA 1PDQA 2KUMA 3STBD 2F0VA 1CTMA 2QA4A 1CSQA 3A5UA 4AIMA 1J9OA 1WTOA 4RFBA 5FLMH 4FXKC 2A19A 4FVMA 4I65A 2F03A 3GTGB 1D5MC 3KF6B 4K2LA 3MFGA 1O7ZA 4H44C 2GA4B 1NAPA 1U4MA 2G5DA 2RCNA 3X3NA 1DYQA 5DAUA 4H02A 5CV7A 4IURA 1O78A 4DAYB 5FO8B 1HR0Q 4HCSA 1H9SB 5ELBA 1SAPA 5ELDA 4ZAIA 3M9BA 3WOEA 2NVTH 3EJIA 4DU9A 1PRTD 1G6PA 1A3VA 1CSPA 3HKZG 2KOLA 3CKIB 1Z7TA 3OIPA 3DWPA 2VUMB 1D8LA 1BBUA 2VW9A 4XXEA 1SNMA 3A55A 2NVQB 4IUPA 3I4NB 5K36H 3D6WA 2UU9L 3DUZA 5BN5A 3HOWG 4B9WA 5KNBA 1P16A 1QUQA 2BDOA 3C46A 3OWFA 4A3BH 4A3FH 1O7YA 3IAYA 2JA7G 3BYTB 1EIYB 3EQLC 5CV6A 3K5MA 2N3SA 4GKKQ 1EQTA 2IWHA 3BZKA 2Y0SB 3OW7A 4A3CG 1YHBA 5FO9B 2E8GA 4B3SL 1D1IA 3K8AA 3HOZB 3SHLA 2QGQA 2EYOA 4N8X1 1KC8C 1VQNA 4F8MA 2K52A 4JYAQ 1EYAA 1H9RA 4DGZA 2BE5C 4C3IB 1B7YB 3RLOA 3G71A 3NBHA 3OYYA 1Q1BA 4KD4A 4K0KQ 3N52A 3PMFA 3FPUB 1MSGA 4DXGA 2B39A 5LL6X 4Q0FA 4RKLA 2DY8A 4FO2A 3TP6A 4DK3C 1HH2P 3RN5A 3HGBA 3G7LA 4C1NI 1CT1D 3UDXA 3EA6A 4A3BB 5CYUA 4ODGA 4A93G 4YY3L 1GUGA 4OIJA 4JI4L 1TWHH 1SROA 4DR4Q 3E9HA 2A1AA 1U4LA 4NXMQ 2EZVA 4LMQD 3KF6A 1RTOA 5JPMC 2M00A 5FKAC 1EY8A 3CMEA 5DM73 4G57A 1OXUA 2MQHA 2IX3A 1KTKA 4G7OC 5J3BA 4BWGB 1QZGA 4LF4L 4WRDA 2MJ8A 4DAYA 3ITPA 1PTOH 1PFSA 2OWOA 4JBKA 1O7LA 2F4VQ 4DR6L 5IT9c 2VY3A 2OCEA 2PYKA 4DR2Q 2G9DA 3IFDA 4NP5A 3STBC 4PV1C 4ZQ3A 4WORA 1RCVD 2RSOA 1QWYA 1AW7A 1XWEA 4JCVE 3NSWA 1VQCA 5C3WA 3PUVA 4JC0A 3S14H 1BCPD 4OWWB 3DWAA 3W5OA 1EEID 2F0SA 1SYFA 2GVBA 2HT1A 3F2BA 3I90A 4M1UB 3NEMA 3H94A 3Q24A 2FMCA 2H5XA 2OF1A 3H6MA 4UAIA 3GTJB 1FYCA 1HA5A 1NE3A 3CMAA 1Y1VG 2F0WA 4H0LC 2NWGA 1FGBD 1HUNA 1PTOB 3OTOQ 4DUZQ 2E2IB 1HCZA 4U673 3S1RB 1N33Q 1JC7A 1EYDA 4FDBA 2M2LA 4ME5A 2PCFB 2K32A 1H95A 4X62Q 5LMNQ 1QG7A 3LWEA 3CC2A 4U68A 2F0MA 1X56A 4MZ9A 1PV4A 2I5HA 2EYLA 2F1MA 1CHQD 3CCVA 3RLNA 1ASYA 2UXDL 2Z1CA 1W3SA 4GS3A 2ZT9C 4A3GG 2K5WA 5I9OA 3CD6A 1WD0A 3CCMA 4L5QA 3J81E 4DR3Q 1NR4A 2JK8A 1PYBA 1EY0A 5IIFA 5IYCH 1Y8NB 1TWCH 4OONA 3VA7A 1VQ4A 1MBYA 2MP1A 3MXGA 1JORA 3I73A 2X69A 2HDMA 2K28A 3DM3A 1VQ8A 1UE5A 2R6GA 1CA5A 1HTLD 4GOPB 1AFPA 4R8NA 1SYEA 2CWAA 3GDEA 1E2WA 1PMRA 4IQZA 4OIKA 5KYIA 5JAVA 3MXPA 3D3RA 1FNWA 1JOOA 2N88A 3ND9A 5ELNA 1KDBA 4LF9Q 3PIO3 2YTYA 2UXBQ 3I70A 4J6HA 3QJYA 3J81j 4RGMA 1IBKL 1SJED 4JI5Q 2BH8A 2IY5B 1SBBB 2E5LL 1LTSD 1SNQA 4TKOB 1VCIA 5NUCA 2F52A 2R61A 2NTTA 2JA9A 1I94Q 3ND8A 1FNUA 2WAQB 4Z9CB 3M4OB 3FEWX 3KBGA 1HJPA 1P8LA 1JB7A 1QVFA 3V96A 4IUTA 1DCZA 3NQIA 3GTOH 2PNHA 3SDZA 1XMQQ 4APVA 1AEXA 4A3DH 5COYA 5CV5A 1O80A 4QY7A 5CBAE 4A3MG 4GLVB 1I4GA 4NW2A 2HQEA 2XWBB 4LFBQ 2KENA 4C3HG 4NB3A 1UAPA 4KY6A 4C3JG 3GO5A 4JV5L 4OEMB 1TS2A 3PUWA 4OHJA 4JI0L 2PPBC 3V2TA 4N9PA 4CBVA 3A8KE 4UHVA 3TZUA 4A3IH 4KK7A 4PQXA 2Z4HA 4ZK9B 1EFWA 1KAWA 4A3LH 3SVMA 3MEFA 1YNXA 3T56B 5C4JB 1MJCA 3T1HL 2JA5H 1M4VA 2EDGA 1C48A 1NR2A 1BF4A 4YWLA 1WTWA 1F2YA 1ET9A 3S1QB 1UWVA 4FXGC 3M7GA 2RHQB 4DUYQ 1STAA 1STBA 3VR6A 1E3PA 5A35A 5IWAQ 2A6HD 1C9OA 2OTJA 5IGDA 2B29A 4LF7Q 1DXMA 4YIJA 4GLAC 4KMUC 2R7ZG 3NP8A 2XNAC 3PIPA 2RA4A 1N32L 1FL0A 1TIID 4GOPA 2D62A 1VQPA 2I0QA 1Q8KA 4Y7NH 1YNJC 1PYSB 2I07B 1Q12A 4JI1L 3GTKB 2KQ3A 1WCMH 5IP9G 2MPMA 3L0OA 3HOVG 2NN6H 2ZXOA 1LM0A 4DPGA 2K50A 3U50C 4POFA 3AU7A 3J7AV 2MGSA 2B3GA 4LUZA 5C0XI 3TRZA 1J8IA 3UDGA 1I3QH 1DOLA 5HY6A 1Y1WH 2XRSD 4IPCA 2F0QA 2FINB 1HFNA 2HCIA 4B3RQ 3LWUA 1TS4A 5D14A 4K8JA 1H9MA 2L0CA 4L63B 3T1YL 2MUYA 1YJNA 1IKMA 1G6ZA 1FR3A 4A3JG 4LWCA 3CRKC 2VL6A 1XJVA 4R1JA 4LF8L 1HNXQ 1NNXA 2MO1A 3RMHA 4JK1C 2Q8TA 3IFTA 1WD1A 2Q2TA 4H13C 1YVCA 2PO4A 3RZOH 3U9OA 4HJ7A 3PO2B 4JI6Q 1JMCA 2JJQA 3ICEA 1EYCA 1WTXA 4IFDI 1VQHA 4TVAB 5JEAH 1NTGA 4BBSG 4FXDA 1GO3E 4QL5A 3OIQA 3VR2A 4G4KA 3TDQA 1QE6A 2K14A 4MTKA 3PUZA 2IX0A 1PTOF 1V43A 5M5WH 2SOBA 4DV6Q 3J81L 3I7FA 4GKJL 4J8QA 1B3QA 4O0AA 4RG1A 4DK6C 4DNIA 5M3MG 3ZYYX 4QCLA 5M5XH 1F9SA 4BY1B 4HIKA 1EIGA 2PZWA 2R93G 3EN2A 1G51A 3M85A 2EYHA 1XMOL 3OW2A 1PH7A 4JBWA 1B9NA 2ICEC 1DD2A 5C0XH 1VQGA 3I4MH 2B2VA 4OO1H 1B2TA 3PCOB 3LNNA 4IALA 2EJGC 3BDLA 1ONLA 2D0OA 1HR0W 3E0JA 2ES2A 3DHQA 1PZJD 1SMYC 4IOAA 3RZOB 1EY9A 5M3FG 2IW3A 1AN8A 1K0SA 3HOXH 4OX9L 2B63H 3NTHA 1VQIA 2ATWA 1X55A 4DR1L 1PH9A 2NVYH 3KJPA 3GV3A 2ZJPA 3H3VC 5C44H 4V190 2MO0A 4GOPC 1I4HA 2UXCQ 3J7A5 2N78A 1UEBA 3S15H 1LABA 1UEAB 1I4XA 2EPBA 4LUVA 1QZHA 2A74C 1WTPA 5M5XB 1J5EQ 5FK9C 4ZKCB 1GUNA 2VQEL 1LYLA 5IODA 1ENCA 2F0EA 3HOYH 2F0GA 1LTTD 5M9OA 1X3GA 2CQAA 2R7ZB 2O2LD 3NELA 3A74A 2A6HC 3P75A 1PH2A 4RAUC 3UI2A 2XWJB 1B50A 5IYBH 5C0XJ 4BBRH 4B3TL 3TP8A 2YV5A 2KHSA 4KN7C 3T13A 3GD7A 5CC4A 1A3UA 4XYOA 1T9HA 1X32A 3ER0A 4K5XA 2AQ2B 2P5ZX 4LF6L 4GN5A 4X65Q 1HPCA 2AWNA 1B44D 5FJ8H 2KEEA 1QNUA 2JA6H 4JI7L 1VQMA 1K0RA 3WWVA 5KIXA 5EQ0A 4IO9A 3EVQA 1EY5A 2VQFL 2VNUD 1ICFB 5FLMG 3I2ZA 5CMDA 3MFYA 2Q8IB 3E5SA 3VYRA 2IX1A 3A7LA 2A73B 3HOYB 3QR8A 3SK6A 1X3FA 1W6JA 3LX0A 3R3OA 3SK5A 1U5KA 3K0YA 1EZ8A 3R93A 3M7NA 4WJ4A 4O2DA 4P72A 4DXFA 2G9HD 1EY4A 1PRTB 1PH1A 3GTGH 1B9MA 1IBLL 1QVGA 3MEHA 1CZWA 1JWMD 1YBYA 4J15A 1K8AC 2DJFC 1XNQL 5C4XH 4BXXH 3R8BA 4KKSA 1B4OA 1I4RA 4DV1L 5K36G 2F0HA 2DN8A 5M3MB 3CCRA 1CZGA 2NYZD 2B8GA 5EKLA 2UUAQ 4EQNA 4YCVA 4CGYB 2HIVA 1F2LA 1Z47A 2NZHA 4A3FG 2VUMH 4LW1A 2K03A 1PH4A 2Q2UA 3FDTA 5ELOA 2CH4A 2DNEA 3DXJC 2NVQH 1IZ6A 1E1OA 1GHJA 3I4NH 5D65A 4DV2L 5JJIA 2BA1A 2UU9Q 4R4TA 4PMWA 3M4QA 1WFQA 3E9IA 4KHPL 2L12A 1KNEA 1LTGD 3CRLC 4X3UA 5EGTA 1V1QA 3QIAA 1PFBA 3TREA 3GTMB 4B08A 4K5WA 4FYDA 4CJ0B 3NK9A 4PMBA 2OQKA 4IUNA 4HIDA 2IL8A 3FVQA 5C4XB 1Q3LA 1CA6A 2UUCQ 3HOZH 1GXDC 2EXZA 4PNYA 1TR5A 2WB1E 4X64L 4JPBW 1JCKB 3UE1A 2KHIA 4HSPA 2CCZA 4F88A 3J81c 3VR4A 4C3IH 2EYJA 2QDBA 2NTSA 4MHEA 4X3SA 5CV8A 5LMNW 1E2VA 4HR7B 3D6CA 4QUCA 1MIUA 3PV0A 2JA8B 3CCSA 2GN5A 4DV3L 1L0YB 2YTXA 2ZTDA 5I6YA 4RMFA 2QCPX 2XTIA 3E3XA 2YU9B 4A3KB 4CHTB 1S5ED 2K75A 4NKLA 1X3EA 3K7UC 5IGGA 4LFAL 1EIHA 4FF2A 2MFIA 3AFQA 1JT8A 2L55A 3J81i 1NCVA 4ABNA 1SNOA 1IYVA 4PZ7A 3PUYA 3WDNA 1VMPA 4NXNQ 4JI4Q 3K59A 1CKMA 1YNNC 3H0GB 3CCJA 4BY7B 3D4WA 1KAAA 4A75A 2F3IA 2K4KA 1D2BA 2SDFA 4N8FA 4K6DA 2CH4W 4CDCC 4L5SA 3F2UA 2JSOA 1B3AA 3BDOA 4O42A 4GN3B 1EU3A 1S5CD 2RBMA 4C2MB 3BJUA 1I6HB 4DR5L 3KDFB 2EY6A 4AH6A 5ELCA 1BCPB 4XQNA 1ZYRD 1LT5D 4IJHA 4QIWB 2BH2A 2K5HA 2K7VA 1K83H 4LJZC 4C56C 1K8OA 4HEDA 5GADC 2L9HA 3O13A 2QILA 4CJ1B 4FP5D 3S9WA 2JEAI 1SYCA 3Q23A 1N34Q 1ESFA 4A3EB 1PXUA 1VQLA 4PMCA 1SEBD 1X6OA 3L7ZC 4DA2A 2O5IC 2ZJRA 4AQYL 1IXRA 2EJFC 2K5QA 1NUCA 4KD3A 1YHQA 1HA6A 4GNXB 4IJLA 4J1MA 3AFPA 1R4QB 2EVBA 5C5LA 2K5NA 1OO9B 3PIOA 3CAMA 5DNFA 5G3LF 4K2KA 5I2XA 1Q81C 2HD3A 1RTNA 5JPNC 2Z8LA 4AYBB 3T16A 3J7ZC 2TSSA 1JJGA 4IUUA 2IJ0A 4OXPA 1CQVA 3I56A 3JAME 2DY7A 3GTJH 1HUMA 4ID6A 1TWGB 1IL8A 2K5DA 3HFZB 4HJ5A 5IGCA 1H9SA 4GKKL 2F0TA 1RIPA 2M9VA 2E2IH 3S1RH 2XSCA 3G6JB 4PZ8A 1Q82C 1K83B 1CM9A 3P7JA 1MI2A 3GV6A 2Q2HA 4DF7A 4X66Q 2JA7H 3QOJA 1EY7A 4JYAL 2WV6D 2YYZA 3D8GA 1X9NA 2NVXB 3EBEA 2UXDQ 1JOQA 4A3CH 1SN8A 1NMGA 4K0KL 4OL7A 1I50B 1ILQA 5IOCA 2SNMA 1OXSC 1YI2A 1F9QA 3KF8B 3FMCA 2XGTA 1EWCA 1IW7D 2F0FA 3K0XA 3OSOA 1TT2A 2J7ZA 1NMFA 4R4OA 2ICIA 3HKZB 1LACA 4JI8Q 3TEHB 2MNAA 4FF4A 3H3VH 1PRTC 1BOSA 4EX5A 2D5DA 1UE1A 3MWYW 1GM5A 3BYYB 4BA2I 4NXML 5M5YH 5J39A 3HOWB 1Y8PB 3C3LA 1ZKOA 3KDFA 2EYMA 2R92G 3N6RA 4CDDC 2ZJQA 1D5XC 1A62A 3T4AC 1G2SA 2A8VA 2JA7B 1G91A 2KA7A 3GTLB 1S3OA 1EOTA 5J1ZA 1WJJA 3F8TA 3NQTA 2HHHL 2EXDA 2KVMA 2N8NA 1XTDA 3S2HB 3K58A 3M4OH 2A69D 1PA6A 5EBDA 1YHAA 2EQSA 1XX8A 4KKTA 3UDFA 3I55A 3CCQA 4GNXA 5IP7G 5JJZA 1N36L 3QOLA 5ELFA 2IPKD 4XQQA 1HNZL 4I7AA 2B2WA 1J6QA 1AH9A 3GQBA 3EROA 4A3IG 1VQDA 1YJWA 2QEJC 3Q6SA 1X3QA 4A3LG 2L11A 5M5YB 2JA5G 5GAEC 4JI0Q 3NBIA 3MHBA 5AJ3L 5ISRA 5EPJA 1HFGA 4A93B 4JW0A 2K5VA 4ZRZA 3D4DA 1FNVA 5BN3A 1XPRA 5IY0A 3NWSA 1TKWB 1B8AA 3K5OA 1SYGA 4QB4A 1TWAB 4KTAA 3KYHC 3T1HQ 1N9WA 1AE2A 4R4QA 5C4JH 1VQOA 1Q8IA 4JI2L 2K1BA 4DNTB 1CFMA 4DUZL 1DJRD 2WKCA 2PMZB 3K7AH 1R4PB 1V8QA 1XXGA 3S1QH 2VXWA 2NN6I 3RNUA 4DAVA 3A7AB 1L0WA 5LMNL 4HMIA 4UY8C 4Y52H 4IUVA 1JE4A 3KF8A 2A5HA 3MXUA 2LSSA 1WCMG 2RF4A 1LO5D 2F0JA 3MZ5A 4RCNA 1U4PA 1N8RC 4LFCL 3HOUG 1OXVA 2RHSB 1QNKA 3A8JE 3FRPB 4R4CA 2OXPA 3A5ZB 3J80L 1Y1WG 2Z9HA 5LMUQ 2LS01 4EVOA 4YHHQ 3GTKH 2Y0SE 1HNWQ 2L15A 3GTQB 2V1CC 1BCPF 1NJIC 3AYHB 2AKWB 1MJEA 5CBEE 2KCMA 2ZTCA 1BCPC 2AUKA 4RGOS 1LTAD 3K80C 4K8IA 1I6VC 1BXTA 3RZDB 4ULLA 2A6ED 3K7AB 1QOHA 3CPWA 3T1YQ 5I2YA 1Y1VB 3QO2A 1MKHA 1YEZA 1IBML 1TY2A 3JAML 4IOCA 4JBJA 1KL9A 5JEAG 3D4RA 4JI5L 3C1FA 1ZEQX 4EQPA 2C35B 2KBNA 4GNXC 2CVRA 4HTHA 4HJ8A 4QUFA 1KNAA 5EAYA 1B1ZA 3OOCA 3DEPA 1FJGL 2F0LA 3WOFA 3PO2H 2UUBQ 3SK8A 1EIFA 3CXCA 1PH8A 3A54A 2B2WC 3P20A 1XMQL 3DMUA 3U58A 1EQVA 4IN3A 1SRUA 2E76C 4A3GB 5IYDG 2FJ2A 2K04A 4OO1I 1VQFA 4DV7L 3VDYA 3BG3A 4LFBL 1S5DD 5C0XG 3CHBD 4GKJQ 2AHOB 3MC0B 2CW0D 4GLXA 5GQOA 3BVMA 3EFXD 1Q46A 4BA1I 1KRSA 2RCFA 4BY1H 4FF3A 1XNRL 2MHVA 2OEOA 4K5VA 4CKCA 4A3MH 1XMOQ 3RLFA 3NTKA 1DGSA 3FKIG 5BN4A 3HOXG 2K05A 3OMCA 2WKDA 4C3HH 1PH6A 2FFKB 5D3DA 3TQYA 5KNDA 4C3JH 3OHXC 3I3CA 2GVAA 4MTNA 2JYOA 2RKSA 3PGZA 1QILA 1KDCA 3Q8DA 3SEBA 1S72A 3U4ZA 1B70B 1VQEA 3SR1A 1STNA 1BNZA 1LT3D 2LFNA 4OX9Q 1ET6A 4RH6A 4A76A 4DUYL 4ZYSA 1L1OC 2LY7A 3M3YB 5C6AA 2XN9C 4LUOA 4KLKA 4DR7L 1U0LA 3CU7A 2E75C 1TVXA 2JXMB 3SK4A 4IFDG 1F2MA 3VYTA 1PZID 1C0AA 1A6XA 3VR3A 3CF5A 3R2IA 1EWHA 5KGUA 2PQAB 2VQEQ 1VQ5A 2PQEA 2PI2A 4A3MB 3HRZC 4LK1C 1WOCA 2R7ZH 1KD1C 5DEHA 1LUZA 4C3HB 2J4XA 1RKNA 3S1MB 5FJ8G 5C4HA 3RN2A 1WTQA 4C3JB 1BBXC 1OTCA 1AZQA 4B3TQ 1K28A 3W1BA 1IL2A 1SE3A 3HOVH 5I6WA 1CHPD 3X3MA 1GUTA 4DV0L 2RVLA 4DV4Q 1PLFA 4I7ZC 3MXNB 4JI7Q 2EY1A 5C3EG 4B3ML 5CV9A 3PO3G 4EGVA 1I4PA 2IHEA 3CCEA 1BQQT 1LV9A 5EKIA 2EY5A 3C2PA 4E6IA 1EOVA 4GZYC 4JI6L 4DV5Q 1A63A 1EU4A 1H9KA 1L0XB 3ERQA 1SFOB 2F4IA 3G6EA 3SGIA 2VZAA 4BXXG 1G291 4HCEA 1WTVA 2ENBA 1A2UA 4H7BA 1BO0A 3VR5A 1LTID 1PFNA 1OXTA 4JVZA 1C4QA 4DV6L 5EKKA 4QMGA 3HOVB 4BBSH 1KLUD 3QG1A 1XNQQ 1JWUD 1K3RA 2WAQE 1IYJB 1XPUA 2QKIC 1G2TA 1R9TH 3ULLA 1QCBD 3I4NG 4IPHA 5M3MH 1E24A 1JE5A 1II3A 4A4IA 1K9MC 1BR9A 4R8IA 2ZM6L 4LF5L 2R93H 2BA0A 2F0NA 3CPFA 4KHZA 3FKIB 1EFID 3NPPA 1VS0A 4A3JB 4UP7A 3JAMc 3BVZA 1EL0A 1F2ZA 2PQAA 1GUWA 2D2CC 2D0PA 1SE4A 2DGYA 3RUZA 5EPLA 1T5EA 3GTPB 2BE5D 4KV6A 5E4WC 3GTMH 2XIWA 4KY5A 1ZXTA 1YITA 3FP9A 4MIUA 4DFAA 4NMZA 3CQZB 4BBSB 4C3IG 1QJOA 3NWTA 3JAMi 2C9OA 5IT9L 5CR3A 4B9XA 4X64Q 1MGSA 2O4XA 1Z6HA 1R9TB 1STGA 1S40A 2V4DA 1GUOA 3BS1A 1YIJA 1LTRD 3DM1A 4IZ8A 2HQLA 2R93B 2E2HB 3H91A 4A3BG 4DV3Q 3KUPA 2JA8H 1RD9D 2E2JB
chains in the Genus database with same CATH topology
3R2TA 1EZ6A 1LLRD 3K6OA 5C4ZA 1IYUA 1TS3A 4C1NK 1LT6D 3V05A 5M3FB 4N9TA 2B2YC 2F0OA 5IGFA 1A2TA 2EOTA 2QF7A 5AFWA 4FF1A 3S17B 5E3FA 1KDAA 4HN7A 3PO3B 2A68D 4O1NA 3MA2B 4FNFA 2PW5A 1U9RA 4KY7A 3KLSA 3I72A 2D9UA 1XTCD 2NBFA 1S5FD 4XYQA 3S1NB 2BOSA 4RWSC 3S2DB 3KLSX 2FHTA 4BS9A 1X3PA 4DN4M 1G8ZD 3L3OC 2OT2A 5LHY1 5A2QE 2B2UA 3HG9A 4HAEA 3L9AX 5CORA 2NZ1D 3TSSA 3M4YA 1SNCA 1TY0A 3MTSA 1HQRD 2R3ZA 2IT1A 4RKBA 2FMMA 3NUCA 5I9PA 4XTCS 3URYA 5FOBB 4L6TB 1DZ1A 2RDFA 1SSOA 1DONA 1NSNS 3J80E 5IGBA 4UDUC 1LTBD 2F0PA 1IHZA 1VMCA 2AWOA 3VA5A 2NVTB 2ID0A 2AUJD 4QF4A 1ESRA 3H09A 1IKLA 5IGEA 5FLXE 1D5ZC 3NHHA 2NUCA 2KCNA 2H1EA 1HXYD 3A56A 4P2CB 3DWQA 2PZTA 2PNRC 4KKUA 4ZUJA 4RGTA 1D6EC 4A3FB 3BVGA 5JVG3 4CKBA 2C5CA 2WIIB 1CI3M 3PUXA 3W2DA 4X3KA 2X6LA 1AP0A 5KRUA 2LMCB 1W6KA 2EYFA 2RQXA 2XVSA 1C8CA 5FO7B 2EJMA 3IL8A 2A68C 4DNRB 1HHVA 4RCOA 2RDHA 3TP7A 4G7HC 1PRTF 1RODA 3DEOA 2B2UC 4Q5VA 1DOKA 1TWHB 1KLGD 3OWEB 2F0UA 1TU2B 2AQ1B 1Y69U 2K01A 2PZUA 2JEBI 4TRDA 1UNSA 2H4OA 4K14A 3TN2A 4NDXA 2XRQD 2KECA 4XDXA 4XIGS 3KLRA 3QB3A 3ONAB 2JP1A 1VF5C 4CKEA 1TQOA 2RDGA 4HMJA 1A15A 1YNJD 3TP5A 5EJWA 4HSVA 1TS5A 3HZXA 1MSHA 2X6GA 5DM63 1ZYRC 4KI0A 4R9WA 3S14B 4K6LA 1GJXA 1TWFB 3FPPA 4TSSA 3BZDB 1U4RA 1S5BD 3BDCA 5HGTA 1JWSD 4DAPA 4RA8A 1JR0D 4EQOA 1WVLA 1SXTA 2LKVA 3W3AA 2SEBD 2N55A 4WFN3 2B8FA 4DK0A 5A2QL 1JQYD 1SYBA 4XT1B 1M8AA 1OXXK 1ENFA 1EY6A 1PFMA 3HEJA 3QWNA 1F9RA 1MD2D 3OMGA 2K6AA 5KYLA 2NN6G 2WINB 4F87A 4G7ZC 1GOZA 4IUQA 1PTOD 1HQMC 1GHKA 5LL6S 1TWCB 3SXHA 2F3WA 1RDPD 1JICA 3J7YW 5E4XA 2KCCA 2Z4IA 1VDZA 1ICWA 5FLXL 3P1HA 2F0IA 1SMYD 4LAAA 3HP3A 1STHA 1IW7C 2RSNA 4OGQC 1WTRA 1AZPA 1D1KA 2NB0A 1Y8OB 3NTIA 3VYUA 4M8AA 1CQFA 3MVVA 3K5LA 2L1BA 1UUPA 2R92B 2EE1A 3TZDA 2B2TA 2EYPA 2KEDA 5T1IA 2L5TA 5K5PA 3GTOB 2WP8J 4A3DB 1Q90A 5IT9E 1DM0B 3AB9A 2ZXRA 2VB2X 4F7XA 1ML0D 5I4DA 1DOMA 2A69C 4OO1G 2AQ3B 1SE2A 4CJ2C 4ZLTF 1SDFA 4A3IB 1PYWD 3T53B 2JA5B 1K8MA 5KEEA 2BCOA 2SNSA 2WB1B 1QB5D 4XT3B 1V1PB 1A3TA 4S3SA 5EPKA 3KBXA 1B53A 3K5NA 3A8IE 4X3TA 5C5MA 4KJNA 1H9JA 2EY2A 2WACA 1I4QA 1V1OA 4Y7NB 4ZKBB 1E2ZA 3NXWA 1WCMB 1JOKA 3HOUB 3VYSA 4V0BA 1I3QB 1Y1WB 3I4LA 3D31A 3J7AF 3C1EA 3NE5B 1T5XD 4KHVA 1PTOC 4TQUS 2TMPA 2HUGA 1XYIA 3E6ZX 1KABA 3KK7A 2L4NA 1HTPA 5C3XA 3TBIB 2B2TC 2ZXPA 1RJTA 5JOBA 2E2DC 2F0DA 1JB3A 2F0KA 5JVH3 3TMEA 2J0TD 2DNCA 5F2DA 1FD7D 5TSSA 2A6EC 2Q8RE 2B2YA 3AMUA 5JEAJ 1ENAA 4L8JA 1BUVT 4RGNA 1SYDA 1BDOA 1SJHD 5M5WB 3PIP3 2VB3X 1LT4D 1STYA 3RD4A 4IFDH 3SE0A 2K33A 1SNDA 3U9SA 5T1GA 5EBCA 3I4MB 2PW7A 4RHSA 1PZKD 5HURA 1V1PA 2CW0C 1YNND 3T51B 4RHRA 5J22A 3GP7A 3HOXB 3HS0C 2B63B 1RHPA 2NVYB 2O5JC 1ILPA 5C44B 4ILWA 3Q22A 3S15B 3Q0AA 2KJXA 3IKJA 4DK1A 1S4ZA 2JE6I 2BDNA 4KN4C 4IFDJ 1EEFD 1CK1A 5E1FA 1GUSA 2E74C 3OPOA 5D3IB 4BBRB 5KNCA 1E0BA 3MXNA 2F3VA 5CGKA 2I46A 1VF7A 3I8ZA 1RF2D 2B2VC 1Q1EA 5ELEA 1STEA 2JA6B 2CHBD 4ZUIA 4XQJA 3S16B 3K57A 1HRJA 5G3LD 4WJWA 1F9PA 1F77A 4MN3A 2HCCA 1SNPA 3MAQA 3I91A 4KJOA 5C3EB 5CV4A 2HDLA 1PDQA 2KUMA 2F0VA 1CTMA 1J9OA 1WTOA 4RFBA 4FXKC 4FVMA 4I65A 2F03A 3GTGB 1D5MC 4K2LA 3MFGA 1O7ZA 4H44C 2GA4B 1NAPA 1U4MA 3X3NA 1DYQA 5DAUA 5CV7A 4IURA 1O78A 5FO8B 4HCSA 1H9SB 3WOEA 5ELBA 1SAPA 5ELDA 4ZAIA 3EJIA 4DU9A 1PRTD 1A3VA 2KOLA 3CKIB 1Z7TA 3OIPA 3DWPA 2VUMB 4XXEA 1SNMA 3A55A 2NVQB 4IUPA 3I4NB 5K36H 3D6WA 3DUZA 5BN5A 4B9WA 5KNBA 2BDOA 3C46A 3OWFA 1O7YA 3IAYA 3BYTB 3EQLC 5CV6A 3K5MA 1EQTA 2IWHA 2Y0SB 3OW7A 5FO9B 1D1IA 3HOZB 3SHLA 2EYOA 4F8MA 1EYAA 1H9RA 4DGZA 2BE5C 4C3IB 3NBHA 1Q1BA 4KD4A 3N52A 3PMFA 3FPUB 1MSGA 4DXGA 2B39A 5LL6X 4Q0FA 4RKLA 2DY8A 4FO2A 3TP6A 3HGBA 3G7LA 4C1NI 1CT1D 3EA6A 4A3BB 5CYUA 4ODGA 1GUGA 4OIJA 1U4LA 2EZVA 4LMQD 1RTOA 5JPMC 2M00A 5FKAC 1EY8A 5DM73 4G57A 1OXUA 2IX3A 1KTKA 4G7OC 4BWGB 4WRDA 2MJ8A 4DAYA 3ITPA 1PTOH 1O7LA 2PYKA 2G9DA 3IFDA 4NP5A 4PV1C 4ZQ3A 4WORA 1RCVD 2RSOA 1QWYA 1AW7A 1XWEA 3NSWA 5C3WA 3PUVA 1BCPD 3DWAA 1EEID 2F0SA 1SYFA 3I90A 4M1UB 3H94A 3Q24A 2FMCA 2OF1A 3H6MA 4UAIA 3GTJB 1FYCA 1HA5A 2F0WA 4H0LC 2NWGA 1FGBD 1HUNA 1PTOB 2E2IB 1HCZA 4U673 3S1RB 1JC7A 1EYDA 2M2LA 4ME5A 2PCFB 2K32A 1QG7A 3LWEA 4U68A 2F0MA 2EYLA 2F1MA 1CHQD 2Z1CA 2ZT9C 2K5WA 5I9OA 1WD0A 3J81E 1NR4A 1EY0A 5IIFA 1Y8NB 3VA7A 1MBYA 2MP1A 3MXGA 1JORA 3I73A 2X69A 2HDMA 2K28A 2R6GA 1CA5A 1HTLD 1AFPA 4R8NA 1SYEA 4OIKA 1E2WA 1PMRA 4IQZA 5KYIA 5JAVA 3MXPA 3D3RA 1FNWA 1JOOA 2N88A 3ND9A 1KDBA 3PIO3 3I70A 4J6HA 3QJYA 4RGMA 1SJED 1SBBB 1LTSD 1SNQA 4TKOB 1VCIA 5NUCA 2R61A 2NTTA 3ND8A 4Z9CB 1FNUA 2WAQB 3M4OB 3FEWX 3KBGA 3V96A 4IUTA 1DCZA 3NQIA 3SDZA 1AEXA 5COYA 5CV5A 1O80A 5CBAE 1I4GA 4NW2A 2HQEA 2XWBB 4C3HG 1UAPA 4KY6A 4C3JG 3GO5A 1TS2A 3PUWA 4OHJA 2PPBC 3V2TA 4N9PA 4CBVA 3A8KE 3TZUA 4KK7A 4PQXA 2Z4HA 4ZK9B 3SVMA 3T56B 5C4JB 1M4VA 2EDGA 1C48A 1NR2A 1BF4A 1WTWA 1F2YA 1ET9A 3S1QB 4FXGC 3M7GA 1STAA 1STBA 3VR6A 5A35A 2A6HD 5IGDA 1DXMA 4YIJA 4KMUC 3NP8A 2XNAC 2RA4A 1TIID 2D62A 1YNJC 2I07B 1Q12A 3GTKB 2KQ3A 2MPMA 2NN6H 2ZXOA 3AU7A 3J7AV 2MGSA 5C0XI 1J8IA 1DOLA 2XRSD 2F0QA 2FINB 1HFNA 2HCIA 3LWUA 1TS4A 5D14A 4K8JA 1H9MA 2L0CA 4L63B 2MUYA 1IKMA 1G6ZA 1FR3A 3CRKC 3RMHA 4JK1C 2Q8TA 3IFTA 1WD1A 4H13C 2PO4A 3U9OA 3PO2B 4IFDI 1EYCA 1WTXA 5JEAH 4FXDA 3OIQA 3VR2A 4G4KA 3TDQA 1QE6A 3PUZA 2IX0A 1PTOF 1V43A 2SOBA 3J81L 4J8QA 4QCLA 3ZYYX 1F9SA 4BY1B 1EIGA 2PZWA 3M85A 2EYHA 4JBWA 1B9NA 2ICEC 1DD2A 5C0XH 2B2VA 4OO1H 1B2TA 3LNNA 4IALA 2EJGC 3BDLA 1ONLA 3E0JA 3DHQA 1PZJD 1SMYC 3RZOB 1EY9A 2IW3A 1AN8A 3NTHA 3GV3A 3H3VC 4V190 1I4HA 1LABA 1UEAB 1I4XA 2EPBA 2A74C 1WTPA 5M5XB 5FK9C 4ZKCB 1GUNA 5IODA 1ENCA 2F0EA 2F0GA 1LTTD 5M9OA 2CQAA 2R7ZB 2O2LD 2A6HC 3P75A 4RAUC 3UI2A 2XWJB 1B50A 5C0XJ 3TP8A 2KHSA 4KN7C 3T13A 3GD7A 5CC4A 1A3UA 4XYOA 1X32A 4K5XA 2AQ2B 1HPCA 2AWNA 1B44D 2KEEA 1QNUA 5KIXA 5EQ0A 3EVQA 1EY5A 2VNUD 5CMDA 3MFYA 2Q8IB 3VYRA 3E5SA 2IX1A 3A7LA 2A73B 3HOYB 3SK6A 3R3OA 1W6JA 3LX0A 3SK5A 3K0YA 1EZ8A 3R93A 3M7NA 4DXFA 2G9HD 1EY4A 1PRTB 1B9MA 3MEHA 1CZWA 1JWMD 3R8BA 4KKSA 1B4OA 1I4RA 5K36G 2F0HA 2DN8A 5M3MB 1CZGA 2NYZD 2B8GA 5EKLA 4EQNA 4CGYB 1F2LA 1Z47A 2K03A 3FDTA 2DNEA 3DXJC 1GHJA 5D65A 2BA1A 4PMWA 2L12A 1KNEA 1LTGD 3CRLC 4X3UA 5EGTA 3QIAA 1PFBA 3GTMB 4B08A 4K5WA 4FYDA 4CJ0B 3NK9A 4PMBA 4IUNA 2IL8A 3FVQA 5C4XB 1Q3LA 1CA6A 1GXDC 2EXZA 4PNYA 1TR5A 1JCKB 4HSPA 4F88A 3VR4A 2EYJA 2QDBA 2NTSA 4MHEA 4X3SA 5CV8A 1E2VA 4HR7B 3D6CA 4QUCA 3PV0A 2JA8B 1L0YB 5I6YA 2QCPX 2YU9B 4A3KB 4CHTB 1S5ED 4NKLA 5IGGA 1EIHA 4FF2A 2L55A 1NCVA 4ABNA 1SNOA 1IYVA 3PUYA 3WDNA 1VMPA 3K59A 1YNNC 3H0GB 4BY7B 3D4WA 1KAAA 1D2BA 2SDFA 4K6DA 3F2UA 2JSOA 1B3AA 3BDOA 4O42A 1EU3A 1S5CD 2RBMA 4C2MB 1I6HB 2EY6A 5ELCA 1BCPB 4XQNA 1ZYRD 1LT5D 4QIWB 2K7VA 4LJZC 4C56C 1K8OA 4HEDA 2L9HA 3O13A 4CJ1B 2QILA 4FP5D 3S9WA 2JEAI 1SYCA 3Q23A 1ESFA 4A3EB 1PXUA 4PMCA 1SEBD 3L7ZC 4DA2A 2O5IC 2EJFC 2K5QA 1NUCA 4KD3A 1HA6A 4J1MA 1R4QB 2EVBA 5C5LA 1OO9B 5DNFA 5G3LF 4K2KA 5I2XA 1RTNA 5JPNC 2Z8LA 4AYBB 3T16A 2TSSA 4IUUA 2IJ0A 1CQVA 3JAME 2DY7A 1HUMA 4ID6A 1TWGB 1IL8A 2K5DA 5IGCA 1H9SA 2F0TA 2M9VA 2XSCA 3G6JB 1K83B 1CM9A 3P7JA 1MI2A 3GV6A 4DF7A 3QOJA 1EY7A 2WV6D 2YYZA 3D8GA 2NVXB 1JOQA 4OL7A 1I50B 1ILQA 5IOCA 2SNMA 1OXSC 1F9QA 3FMCA 1EWCA 1IW7D 2F0FA 3OSOA 1TT2A 2J7ZA 2ICIA 3HKZB 1LACA 4FF4A 1PRTC 1BOSA 2D5DA 3MWYW 3BYYB 4BA2I 5J39A 3HOWB 1Y8PB 3C3LA 1ZKOA 2EYMA 3N6RA 1D5XC 3T4AC 1G2SA 2JA7B 1G91A 2KA7A 3GTLB 1EOTA 5J1ZA 3NQTA 2KVMA 3S2HB 3K58A 2A69D 5EBDA 1XX8A 4KKTA 5JJZA 3QOLA 5ELFA 2IPKD 4XQQA 2B2WA 3GQBA 3EROA 2QEJC 3Q6SA 1X3QA 2L11A 5M5YB 3NBIA 3MHBA 5ISRA 5EPJA 1HFGA 4A93B 4ZRZA 3D4DA 1FNVA 5BN3A 3NWSA 1TKWB 3K5OA 1SYGA 4QB4A 1TWAB 4KTAA 1Q8IA 2K1BA 4DNTB 1CFMA 1DJRD 2WKCA 2PMZB 1R4PB 1V8QA 1XXGA 2VXWA 2NN6I 4DAVA 3A7AB 4HMIA 4IUVA 1JE4A 3KF8A 2A5HA 3MXUA 1LO5D 2F0JA 3MZ5A 4RCNA 1U4PA 1OXVA 3FRPB 1QNKA 3A8JE 2OXPA 3J80L 2LS01 4EVOA 3GTQB 1BCPF 5CBEE 1BCPC 2AUKA 4RGOS 1LTAD 4K8IA 1I6VC 1BXTA 3RZDB 4ULLA 2A6ED 3K7AB 1QOHA 5I2YA 1Y1VB 3QO2A 1TY2A 3JAML 5JEAG 3D4RA 3C1FA 1ZEQX 4EQPA 2CVRA 4HTHA 4QUFA 1KNAA 1B1ZA 3OOCA 3DEPA 2F0LA 3WOFA 3SK8A 3A54A 2B2WC 3P20A 3DMUA 1EQVA 4IN3A 2E76C 4A3GB 2FJ2A 2K04A 4OO1I 3BG3A 1S5DD 5C0XG 3CHBD 3MC0B 2CW0D 3BVMA 3EFXD 4BA1I 4FF3A 2MHVA 2OEOA 4K5VA 4CKCA 3RLFA 3NTKA 5BN4A 2K05A 3OMCA 2WKDA 2FFKB 5D3DA 5KNDA 3OHXC 3I3CA 2JYOA 2RKSA 1QILA 1KDCA 3SEBA 3SR1A 1STNA 1BNZA 1LT3D 2LFNA 1ET6A 4RH6A 4ZYSA 2LY7A 3M3YB 5C6AA 2XN9C 3CU7A 2E75C 1TVXA 2JXMB 3SK4A 4IFDG 1F2MA 3VYTA 1PZID 1A6XA 3VR3A 3R2IA 1EWHA 5KGUA 2PQEA 4A3MB 3HRZC 4LK1C 5DEHA 4C3HB 2J4XA 1RKNA 3S1MB 5C4HA 1WTQA 4C3JB 1BBXC 1AZQA 1SE3A 5I6WA 1CHPD 3X3MA 1GUTA 2RVLA 1PLFA 4I7ZC 2EY1A 5CV9A 4EGVA 1I4PA 1BQQT 1LV9A 5EKIA 2EY5A 3C2PA 4E6IA 4GZYC 1EU4A 1H9KA 1L0XB 3ERQA 1SFOB 2F4IA 1G291 4HCEA 1WTVA 2ENBA 1A2UA 4H7BA 1BO0A 3VR5A 1LTID 1PFNA 1OXTA 1C4QA 5EKKA 4QMGA 3HOVB 1KLUD 3QG1A 1JWUD 2QKIC 1G2TA 1QCBD 1II3A 1BR9A 4R8IA 2BA0A 2F0NA 4KHZA 3FKIB 1EFID 3NPPA 4A3JB 3BVZA 1EL0A 1F2ZA 1GUWA 2D2CC 1SE4A 3RUZA 5EPLA 1T5EA 3GTPB 2BE5D 5E4WC 4KV6A 2XIWA 4KY5A 1ZXTA 4MIUA 4DFAA 4NMZA 3CQZB 4BBSB 4C3IG 1QJOA 3NWTA 2C9OA 5IT9L 5CR3A 4B9XA 1MGSA 2O4XA 1Z6HA 1R9TB 1STGA 2V4DA 1GUOA 3BS1A 1LTRD 3DM1A 4IZ8A 2R93B 2E2HB 3H91A 3KUPA 1RD9D 2E2JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F87 A;  4ZRZ A;  4F88 A; 
#chains in the Genus database with same CATH topology
 2YU9 H;  4UPA A;  4A3K H;  3R2T A;  1EZ6 A;  1LLR D;  3K6O A;  1C7Y A;  5C4Z A;  1IYU A;  1WTH A;  1TS3 A;  4C1N K;  1LT6 D;  4UP8 A;  3V05 A;  1EWI A;  5M3F B;  2DJG C;  4N9T A;  2B2Y C;  2F0O A;  5IGF A;  1A2T A;  2EOT A;  2QF7 A;  5AFW A;  4FF1 A;  3S17 B;  5E3F A;  1KDA A;  3H0G H;  4BY7 H;  4HN7 A;  3PO3 B;  2A68 D;  4B3S Q;  4O1N A;  3MA2 B;  4IPG A;  4FNF A;  2PW5 A;  4OWT B;  2OQ0 A;  4QQB X;  1U9R A;  4KY7 A;  1CKN B;  3KLS A;  1MHW C;  3CCL A;  1Z9F A;  3I72 A;  4C2M H;  4DR5 Q;  3G48 A;  1I6H H;  2D9U A;  1XTC D;  2NBF A;  1EQR A;  1S5F D;  4XYQ A;  3S1N B;  1PH5 A;  1YJ9 A;  2JN4 A;  3W1G A;  5BR8 L;  3EIV A;  1NY4 A;  2BOS A;  1BVS A;  4P71 A;  1KIX A;  4RWS C;  1VQ6 A;  1UE7 A;  4A3E H;  3S2D B;  3KLS X;  2FHT A;  4BS9 A;  4OEL B;  1X3P A;  4JI3 L;  4MNO A;  4DN4 M;  2UUA L;  1G8Z D;  3L3O C;  4YY3 Q;  4AQY Q;  2OT2 A;  5LHY 1;  1SLJ A;  2B2U A;  5A2Q E;  3HG9 A;  4HAE A;  3L9A X;  5COR A;  2NZ1 D;  1A8V A;  2R7F A;  1K73 C;  3TSS A;  3M4Y A;  1SNC A;  1TY0 A;  3MTS A;  1HQR D;  3D0F A;  2AMC B;  4L5T A;  2R3Z A;  2IT1 A;  4RKB A;  4LF4 Q;  3K81 C;  2FMM A;  3NUC A;  5I9P A;  1GD7 A;  1TWG H;  4XTC S;  2KCT A;  3URY A;  5FOB B;  1CUK A;  4L6T B;  2CFM A;  1DZ1 A;  2RDF A;  4L5R C;  1SSO A;  2KHJ A;  4DR6 Q;  1DON A;  1NSN S;  3J80 E;  5IGB A;  1Q7Y C;  4UDU C;  2UUC L;  1LTB D;  2F0P A;  3JC6 6;  1IHZ A;  1HR0 L;  1VMC A;  2AWO A;  3VA5 A;  2NVT B;  3H3V I;  4QJF A;  2NVX H;  2ID0 A;  2AUJ D;  3IRB A;  4QF4 A;  1KQS A;  1ESR A;  3H09 A;  1I50 H;  1IKL A;  5IE8 A;  5FLX E;  5IGE A;  4QGU A;  1D5Z C;  2QDL A;  3ULJ A;  3NHH A;  2NUC A;  2KCN A;  2H1E A;  1HXY D;  3A56 A;  4P2C B;  3DWQ A;  2PZT A;  3B6Y A;  2PNR C;  4KKU A;  4ZUJ A;  4RGT A;  4LNQ A;  1D6E C;  4A3F B;  3BVG A;  4ME3 A;  5JVG 3;  4CKB A;  2C5C A;  4NXN L;  2WII B;  1CKN A;  1CI3 M;  3TS0 A;  3HOW H;  3PUX A;  3W2D A;  4X3K A;  2HIX A;  2X6L A;  1AP0 A;  5KRU A;  2WAQ G;  2LMC B;  1W6K A;  3GTL H;  2EYF A;  2RQX A;  5IYC G;  2HHH Q;  2XVS A;  1BBW A;  4NPS A;  5JJL A;  1C8C A;  5FO7 B;  1E22 A;  2EJM A;  3IL8 A;  3S2H H;  2A68 C;  4CDE C;  4HJA A;  3FHW A;  4DNR B;  1HHV A;  4PG3 A;  1GVP A;  1N36 Q;  1L1O B;  2RDH A;  4RCO A;  3TP7 A;  1N34 L;  4G7H C;  1PRT F;  4UP9 A;  3UDI A;  1ROD A;  3DEO A;  1HNZ Q;  1VQ9 A;  2B2U C;  4Q5V A;  3F2C A;  1DOK A;  1TWH B;  1CKO A;  1LTL A;  1SE8 A;  1TWF H;  4IPD A;  1W2B A;  4DR4 L;  1KLG D;  3OWE B;  3PSI A;  2F0U A;  1TU2 B;  2LXJ A;  5AJ3 Q;  2AQ1 B;  1Y69 U;  2K01 A;  2PZU A;  2JEB I;  4TRD A;  4A93 H;  1UNS A;  2H4O A;  4K14 A;  3TN2 A;  1SR3 A;  1SMX A;  2CWP A;  4NDX A;  2XRQ D;  1IBK Q;  4YWM A;  2KEC A;  2E5L Q;  3TS2 A;  4XDX A;  4XIG S;  4JI2 Q;  1TWA H;  4A3D G;  3DLL A;  3KLR A;  3QB3 A;  3ONA B;  1PH3 A;  2JP1 A;  3H15 A;  1VF5 C;  4CKE A;  1I5F A;  3KJO A;  2F4V L;  1TQO A;  2RDG A;  4HMJ A;  4DR2 L;  1A15 A;  1YNJ D;  3TP5 A;  1O7I A;  3KFU A;  5EJW A;  4HSV A;  1TS5 A;  4X66 L;  3HZX A;  3M4P A;  1QVC A;  3UE0 A;  1MSH A;  2LXK A;  2X6G A;  5DM6 3;  4LFC Q;  1ZYR C;  4KI0 A;  4R9W A;  3S14 B;  4K6L A;  4JBM A;  1GJX A;  1TWF B;  1TXY A;  3FPP A;  4TSS A;  3BZD B;  1U4R A;  1S5B D;  3BDC A;  4R4I A;  5HGT A;  4JV5 Q;  1JWS D;  4DAP A;  4RA8 A;  1JR0 D;  4EQO A;  2OTL A;  1WVL A;  1SXT A;  2LKV A;  3W3A A;  2SEB D;  3GTQ H;  5E7N A;  2N55 A;  4JI8 L;  2WB1 G;  4WFN 3;  2N49 A;  1BKB A;  2B8F A;  4DK0 A;  5A2Q L;  1EUJ A;  3BZC A;  1JQY D;  2R7D A;  1SYB A;  3OTO L;  4XT1 B;  1M8A A;  3CC7 A;  1OXX K;  3RZD H;  1A0I A;  1N33 L;  1ENF A;  3PF4 A;  2NZO A;  1EY6 A;  1PFM A;  3HEJ A;  4X62 L;  1Y1V H;  1IBM Q;  3QWN A;  1F9R A;  1MD2 D;  3PO2 G;  3OMG A;  2K6A A;  5KYL A;  1KRT A;  2NN6 G;  2WIN B;  1L1O A;  4F87 A;  4G7Z C;  1GOZ A;  1UE6 A;  2IHF A;  1VQJ A;  4IUQ A;  2R92 H;  1KHI A;  1PTO D;  1N32 Q;  1KXL A;  1HQM C;  1GHK A;  4DR3 L;  1FJG Q;  4YCU A;  4JI1 Q;  5LL6 S;  1TWC B;  3G4S A;  3SXH A;  3A0J A;  2F3W A;  2EIF A;  4BY1 G;  1RDP D;  1JIC A;  3J7Y W;  1HZB A;  4A3G H;  5E4X A;  2KCC A;  5L37 A;  4DV7 Q;  2Z4I A;  1VDZ A;  4HJ9 A;  1ICW A;  5FLX L;  3P1H A;  2VS1 A;  4P75 A;  2F0I A;  5IP7 H;  1SMY D;  4LAA A;  3HP3 A;  1WYD A;  5HGQ A;  3CC4 A;  1XNR Q;  4QIW E;  1STH A;  4LF9 L;  1IW7 C;  2RSN A;  4POG A;  4OGQ C;  1WTR A;  1AZP A;  2UXB L;  1D1K A;  2NB0 A;  1Y8O B;  3NTI A;  3VYU A;  4M8A A;  1CQF A;  3MVV A;  3K5L A;  4ALP A;  2L1B A;  1UUP A;  1D7Q A;  4LF8 Q;  2R92 B;  1K3B C;  2EE1 A;  3TZD A;  2B2T A;  2EYP A;  1I94 L;  4HIM A;  1HZC A;  2KED A;  5T1I A;  3HKS A;  2L5T A;  5K5P A;  2Q2I A;  1AE3 A;  2QEX A;  3GTO B;  4OWX B;  3CW2 C;  2WP8 J;  3M3Y H;  2YTV A;  4A3D B;  4DR7 Q;  1Q90 A;  5IT9 E;  1DM0 B;  3F2D A;  4AYB E;  3PQI A;  3AB9 A;  2ZXR A;  1VQ7 A;  2VB2 X;  4F7X A;  1ML0 D;  3I4M G;  5I4D A;  1WI5 A;  1DOM A;  2A69 C;  3E0E A;  5LMU L;  4OO1 G;  4YHH L;  2AQ3 B;  4DKA C;  1SE2 A;  3RR5 A;  1HNW L;  4CJ2 C;  4ZLT F;  1SDF A;  4A3I B;  4JG2 A;  3HOU H;  1PYW D;  2B63 G;  3T53 B;  3S1M H;  5GAH C;  2JA5 B;  4YCW A;  1K8M A;  5KEE A;  2BCO A;  5DLQ E;  5C44 G;  3CP0 A;  1GKH A;  2SNS A;  2WB1 B;  1QB5 D;  4DV0 Q;  4GN4 B;  1M1K C;  2Z6K A;  3L2P A;  1PHJ A;  4XT3 B;  4DR1 Q;  3BU2 A;  1V1P B;  4B3M Q;  3HOY G;  1A3T A;  5IWA L;  4P73 A;  2FXQ A;  3NEN A;  4S3S A;  2ALY B;  5EPK A;  2WFW A;  3KBX A;  4LF7 L;  3HKZ E;  3S24 A;  1B53 A;  3K5N A;  5GRO A;  3A8I E;  4X3T A;  3ZJY C;  5C5M A;  4P74 A;  4KJN A;  1H9J A;  2EY2 A;  5IYB G;  4BBR G;  2WAC A;  1I4Q A;  1V1O A;  2CQO A;  4ZKB B;  4Y7N B;  1E2Z A;  3NXW A;  2UUB L;  1WCM B;  1XPO A;  1V9P A;  1JOK A;  3HOU B;  2CKZ B;  5JJK A;  1SFO H;  3VYS A;  4EQ5 A;  4JOI A;  4V0B A;  1I3Q B;  1PVO A;  3I4O A;  1EYG A;  1Y1W B;  3PF5 A;  3I4L A;  3D31 A;  3J7A F;  2JA6 G;  3C1E A;  3NE5 B;  1T5X D;  4KHV A;  1PTO C;  4TQU S;  2TMP A;  2HUG A;  5IP9 H;  4B3R L;  2JQO A;  1XYI A;  3E6Z X;  1KAB A;  1RL2 A;  3KK7 A;  3ULP A;  4LF6 Q;  5IYD H;  2L4N A;  1HTP A;  5C3X A;  1VQK A;  3TBI B;  2B2T C;  2ZXP A;  1RJT A;  3CCU A;  5JOB A;  2E2D C;  1E1T A;  2F0D A;  1JJ2 A;  2VQF Q;  1JB3 A;  2F0K A;  5JVH 3;  1HNX L;  3TME A;  2ZM6 Q;  4LF5 Q;  2J0T D;  2DNC A;  5F2D A;  1FD7 D;  5TSS A;  3AEV A;  2A6E C;  3LGJ A;  1JJC B;  4X6A H;  3FKI H;  2Q8R E;  1L2F A;  1HZA A;  2B2Y A;  4A3J H;  3KLW A;  3AMU A;  5JEA J;  1ENA A;  4L8J A;  1BUV T;  3AQQ A;  4RGN A;  5GAG C;  1SYD A;  5C4X G;  1BDO A;  1SJH D;  3F1Z A;  5M5W B;  3GTP H;  3J80 c;  3PIP 3;  1VQA A;  1IBL Q;  2VB3 X;  1LT4 D;  3CQZ H;  3KOJ A;  1STY A;  2ASB A;  4HIO A;  3RD4 A;  4IFD H;  2PMZ E;  2QW7 A;  3SE0 A;  2VUM G;  2JA8 G;  2K33 A;  1SND A;  3U9S A;  5T1G A;  4DV1 Q;  5EBC A;  3I4M B;  4A3K G;  3U4V A;  2PW7 A;  4CDF C;  5FLX c;  4RHS A;  3J80 i;  1PZK D;  5HUR A;  1V1P A;  2I5M X;  2CW0 C;  2E2H H;  2Z6K C;  1X65 A;  1YNN D;  2I5L X;  3T51 B;  2E2J H;  4RHR A;  5J22 A;  3GP7 A;  3HOX B;  4PZ6 A;  3ERS X;  3HS0 C;  2B63 B;  4DV2 Q;  4DV4 L;  2Z6B A;  3H0G G;  1RHP A;  4BY7 G;  2NVY B;  2O5J C;  1FGU A;  4KHP Q;  2Y0S G;  1ILP A;  5C44 B;  3S16 H;  1HZ9 A;  3HOZ G;  4ILW A;  2UXC L;  1X54 A;  5M3F H;  3Q22 A;  3S15 B;  3Q0A A;  2KJX A;  1FVI A;  3IKJ A;  3S17 H;  4DK1 A;  1S4Z A;  1EQQ A;  2ZTE A;  1J5E L;  4DV5 L;  2JE6 I;  2DUD A;  5C3E H;  2BDN A;  1QUQ B;  2PI2 E;  3PO3 H;  4JOI C;  4KN4 C;  4IFD J;  1EEF D;  4DAM A;  1CK1 A;  5E1F A;  1GUS A;  2E74 C;  3OPO A;  5D3I B;  4BBR B;  5KNC A;  1E0B A;  1M90 C;  3MXN A;  2F3V A;  2Z0S A;  4A3E G;  5CGK A;  5H1S E;  3S1N H;  2I46 A;  1VF7 A;  3I8Z A;  5BR8 Q;  1Q86 C;  1RF2 D;  2B2V C;  1ASZ A;  1Q1E A;  4X65 L;  5ELE A;  1STE A;  4LFA Q;  2JA6 B;  2CHB D;  4ZUI A;  3NBH B;  4XQJ A;  3S16 B;  3S2D H;  3K57 A;  1HRJ A;  5G3L D;  4JI3 Q;  4WJW A;  1E7Z A;  1F9P A;  4AYB G;  1F77 A;  1VQB A;  1YZ6 A;  1NBW A;  4MN3 A;  2HCC A;  1Y14 B;  1SNP A;  3MAQ A;  3I91 A;  4KJO A;  4YWK A;  5CV4 A;  5C3E B;  4WJ3 M;  4ZCK A;  2HDL A;  1K8G A;  1PDQ A;  2KUM A;  3STB D;  2F0V A;  1CTM A;  2QA4 A;  1CSQ A;  3A5U A;  4AIM A;  1J9O A;  1WTO A;  4RFB A;  5FLM H;  4FXK C;  2A19 A;  4FVM A;  4I65 A;  2F03 A;  3GTG B;  1D5M C;  3KF6 B;  4K2L A;  3MFG A;  1O7Z A;  4H44 C;  2GA4 B;  1NAP A;  1U4M A;  2G5D A;  2RCN A;  3X3N A;  1DYQ A;  5DAU A;  4H02 A;  5CV7 A;  4IUR A;  1O78 A;  4DAY B;  5FO8 B;  1HR0 Q;  4HCS A;  1H9S B;  5ELB A;  1SAP A;  5ELD A;  4ZAI A;  3M9B A;  3WOE A;  2NVT H;  3EJI A;  4DU9 A;  1PRT D;  1G6P A;  1A3V A;  1CSP A;  3HKZ G;  2KOL A;  3CKI B;  1Z7T A;  3OIP A;  3DWP A;  2VUM B;  1D8L A;  1BBU A;  2VW9 A;  4XXE A;  1SNM A;  3A55 A;  2NVQ B;  4IUP A;  3I4N B;  5K36 H;  3D6W A;  2UU9 L;  3DUZ A;  5BN5 A;  3HOW G;  4B9W A;  5KNB A;  1P16 A;  1QUQ A;  2BDO A;  3C46 A;  3OWF A;  4A3B H;  4A3F H;  1O7Y A;  3IAY A;  2JA7 G;  3BYT B;  1EIY B;  3EQL C;  5CV6 A;  3K5M A;  2N3S A;  4GKK Q;  1EQT A;  2IWH A;  3BZK A;  2Y0S B;  3OW7 A;  4A3C G;  1YHB A;  5FO9 B;  2E8G A;  4B3S L;  1D1I A;  3K8A A;  3HOZ B;  3SHL A;  2QGQ A;  2EYO A;  4N8X 1;  1KC8 C;  1VQN A;  4F8M A;  2K52 A;  4JYA Q;  1EYA A;  1H9R A;  4DGZ A;  2BE5 C;  4C3I B;  1B7Y B;  3RLO A;  3G71 A;  3NBH A;  3OYY A;  1Q1B A;  4KD4 A;  4K0K Q;  3N52 A;  3PMF A;  3FPU B;  1MSG A;  4DXG A;  2B39 A;  5LL6 X;  4Q0F A;  4RKL A;  2DY8 A;  4FO2 A;  3TP6 A;  4DK3 C;  1HH2 P;  3RN5 A;  3HGB A;  3G7L A;  4C1N I;  1CT1 D;  3UDX A;  3EA6 A;  4A3B B;  5CYU A;  4ODG A;  4A93 G;  4YY3 L;  1GUG A;  4OIJ A;  4JI4 L;  1TWH H;  1SRO A;  4DR4 Q;  3E9H A;  2A1A A;  1U4L A;  4NXM Q;  2EZV A;  4LMQ D;  3KF6 A;  1RTO A;  5JPM C;  2M00 A;  5FKA C;  1EY8 A;  3CME A;  5DM7 3;  4G57 A;  1OXU A;  2MQH A;  2IX3 A;  1KTK A;  4G7O C;  5J3B A;  4BWG B;  1QZG A;  4LF4 L;  4WRD A;  2MJ8 A;  4DAY A;  3ITP A;  1PTO H;  1PFS A;  2OWO A;  4JBK A;  1O7L A;  2F4V Q;  4DR6 L;  5IT9 c;  2VY3 A;  2OCE A;  2PYK A;  4DR2 Q;  2G9D A;  3IFD A;  4NP5 A;  3STB C;  4PV1 C;  4ZQ3 A;  4WOR A;  1RCV D;  2RSO A;  1QWY A;  1AW7 A;  1XWE A;  4JCV E;  3NSW A;  1VQC A;  5C3W A;  3PUV A;  4JC0 A;  3S14 H;  1BCP D;  4OWW B;  3DWA A;  3W5O A;  1EEI D;  2F0S A;  1SYF A;  2GVB A;  2HT1 A;  3F2B A;  3I90 A;  4M1U B;  3NEM A;  3H94 A;  3Q24 A;  2FMC A;  2H5X A;  2OF1 A;  3H6M A;  4UAI A;  3GTJ B;  1FYC A;  1HA5 A;  1NE3 A;  3CMA A;  1Y1V G;  2F0W A;  4H0L C;  2NWG A;  1FGB D;  1HUN A;  1PTO B;  3OTO Q;  4DUZ Q;  2E2I B;  1HCZ A;  4U67 3;  3S1R B;  1N33 Q;  1JC7 A;  1EYD A;  4FDB A;  2M2L A;  4ME5 A;  2PCF B;  2K32 A;  1H95 A;  4X62 Q;  5LMN Q;  1QG7 A;  3LWE A;  3CC2 A;  4U68 A;  2F0M A;  1X56 A;  4MZ9 A;  1PV4 A;  2I5H A;  2EYL A;  2F1M A;  1CHQ D;  3CCV A;  3RLN A;  1ASY A;  2UXD L;  2Z1C A;  1W3S A;  4GS3 A;  2ZT9 C;  4A3G G;  2K5W A;  5I9O A;  3CD6 A;  1WD0 A;  3CCM A;  4L5Q A;  3J81 E;  4DR3 Q;  1NR4 A;  2JK8 A;  1PYB A;  1EY0 A;  5IIF A;  5IYC H;  1Y8N B;  1TWC H;  4OON A;  3VA7 A;  1VQ4 A;  1MBY A;  2MP1 A;  3MXG A;  1JOR A;  3I73 A;  2X69 A;  2HDM A;  2K28 A;  3DM3 A;  1VQ8 A;  1UE5 A;  2R6G A;  1CA5 A;  1HTL D;  4GOP B;  1AFP A;  4R8N A;  1SYE A;  2CWA A;  3GDE A;  1E2W A;  1PMR A;  4IQZ A;  4OIK A;  5KYI A;  5JAV A;  3MXP A;  3D3R A;  1FNW A;  1JOO A;  2N88 A;  3ND9 A;  5ELN A;  1KDB A;  4LF9 Q;  3PIO 3;  2YTY A;  2UXB Q;  3I70 A;  4J6H A;  3QJY A;  3J81 j;  4RGM A;  1IBK L;  1SJE D;  4JI5 Q;  2BH8 A;  2IY5 B;  1SBB B;  2E5L L;  1LTS D;  1SNQ A;  4TKO B;  1VCI A;  5NUC A;  2F52 A;  2R61 A;  2NTT A;  2JA9 A;  1I94 Q;  3ND8 A;  1FNU A;  2WAQ B;  4Z9C B;  3M4O B;  3FEW X;  3KBG A;  1HJP A;  1P8L A;  1JB7 A;  1QVF A;  3V96 A;  4IUT A;  1DCZ A;  3NQI A;  3GTO H;  2PNH A;  3SDZ A;  1XMQ Q;  4APV A;  1AEX A;  4A3D H;  5COY A;  5CV5 A;  1O80 A;  4QY7 A;  5CBA E;  4A3M G;  4GLV B;  1I4G A;  4NW2 A;  2HQE A;  2XWB B;  4LFB Q;  2KEN A;  4C3H G;  4NB3 A;  1UAP A;  4KY6 A;  4C3J G;  3GO5 A;  4JV5 L;  4OEM B;  1TS2 A;  3PUW A;  4OHJ A;  4JI0 L;  2PPB C;  3V2T A;  4N9P A;  4CBV A;  3A8K E;  4UHV A;  3TZU A;  4A3I H;  4KK7 A;  4PQX A;  2Z4H A;  4ZK9 B;  1EFW A;  1KAW A;  4A3L H;  3SVM A;  3MEF A;  1YNX A;  3T56 B;  5C4J B;  1MJC A;  3T1H L;  2JA5 H;  1M4V A;  2EDG A;  1C48 A;  1NR2 A;  1BF4 A;  4YWL A;  1WTW A;  1F2Y A;  1ET9 A;  3S1Q B;  1UWV A;  4FXG C;  3M7G A;  2RHQ B;  4DUY Q;  1STA A;  1STB A;  3VR6 A;  1E3P A;  5A35 A;  5IWA Q;  2A6H D;  1C9O A;  2OTJ A;  5IGD A;  2B29 A;  4LF7 Q;  1DXM A;  4YIJ A;  4GLA C;  4KMU C;  2R7Z G;  3NP8 A;  2XNA C;  3PIP A;  2RA4 A;  1N32 L;  1FL0 A;  1TII D;  4GOP A;  2D62 A;  1VQP A;  2I0Q A;  1Q8K A;  4Y7N H;  1YNJ C;  1PYS B;  2I07 B;  1Q12 A;  4JI1 L;  3GTK B;  2KQ3 A;  1WCM H;  5IP9 G;  2MPM A;  3L0O A;  3HOV G;  2NN6 H;  2ZXO A;  1LM0 A;  4DPG A;  2K50 A;  3U50 C;  4POF A;  3AU7 A;  3J7A V;  2MGS A;  2B3G A;  4LUZ A;  5C0X I;  3TRZ A;  1J8I A;  3UDG A;  1I3Q H;  1DOL A;  5HY6 A;  1Y1W H;  2XRS D;  4IPC A;  2F0Q A;  2FIN B;  1HFN A;  2HCI A;  4B3R Q;  3LWU A;  1TS4 A;  5D14 A;  4K8J A;  1H9M A;  2L0C A;  4L63 B;  3T1Y L;  2MUY A;  1YJN A;  1IKM A;  1G6Z A;  1FR3 A;  4A3J G;  4LWC A;  3CRK C;  2VL6 A;  1XJV A;  4R1J A;  4LF8 L;  1HNX Q;  1NNX A;  2MO1 A;  3RMH A;  4JK1 C;  2Q8T A;  3IFT A;  1WD1 A;  2Q2T A;  4H13 C;  1YVC A;  2PO4 A;  3RZO H;  3U9O A;  4HJ7 A;  3PO2 B;  4JI6 Q;  1JMC A;  2JJQ A;  3ICE A;  1EYC A;  1WTX A;  4IFD I;  1VQH A;  4TVA B;  5JEA H;  1NTG A;  4BBS G;  4FXD A;  1GO3 E;  4QL5 A;  3OIQ A;  3VR2 A;  4G4K A;  3TDQ A;  1QE6 A;  2K14 A;  4MTK A;  3PUZ A;  2IX0 A;  1PTO F;  1V43 A;  5M5W H;  2SOB A;  4DV6 Q;  3J81 L;  3I7F A;  4GKJ L;  4J8Q A;  1B3Q A;  4O0A A;  4RG1 A;  4DK6 C;  4DNI A;  5M3M G;  3ZYY X;  4QCL A;  5M5X H;  1F9S A;  4BY1 B;  4HIK A;  1EIG A;  2PZW A;  2R93 G;  3EN2 A;  1G51 A;  3M85 A;  2EYH A;  1XMO L;  3OW2 A;  1PH7 A;  4JBW A;  1B9N A;  2ICE C;  1DD2 A;  5C0X H;  1VQG A;  3I4M H;  2B2V A;  4OO1 H;  1B2T A;  3PCO B;  3LNN A;  4IAL A;  2EJG C;  3BDL A;  1ONL A;  2D0O A;  1HR0 W;  3E0J A;  2ES2 A;  3DHQ A;  1PZJ D;  1SMY C;  4IOA A;  3RZO B;  1EY9 A;  5M3F G;  2IW3 A;  1AN8 A;  1K0S A;  3HOX H;  4OX9 L;  2B63 H;  3NTH A;  1VQI A;  2ATW A;  1X55 A;  4DR1 L;  1PH9 A;  2NVY H;  3KJP A;  3GV3 A;  2ZJP A;  3H3V C;  5C44 H;  4V19 0;  2MO0 A;  4GOP C;  1I4H A;  2UXC Q;  3J7A 5;  2N78 A;  1UEB A;  3S15 H;  1LAB A;  1UEA B;  1I4X A;  2EPB A;  4LUV A;  1QZH A;  2A74 C;  1WTP A;  5M5X B;  1J5E Q;  5FK9 C;  4ZKC B;  1GUN A;  2VQE L;  1LYL A;  5IOD A;  1ENC A;  2F0E A;  3HOY H;  2F0G A;  1LTT D;  5M9O A;  1X3G A;  2CQA A;  2R7Z B;  2O2L D;  3NEL A;  3A74 A;  2A6H C;  3P75 A;  1PH2 A;  4RAU C;  3UI2 A;  2XWJ B;  1B50 A;  5IYB H;  5C0X J;  4BBR H;  4B3T L;  3TP8 A;  2YV5 A;  2KHS A;  4KN7 C;  3T13 A;  3GD7 A;  5CC4 A;  1A3U A;  4XYO A;  1T9H A;  1X32 A;  3ER0 A;  4K5X A;  2AQ2 B;  2P5Z X;  4LF6 L;  4GN5 A;  4X65 Q;  1HPC A;  2AWN A;  1B44 D;  5FJ8 H;  2KEE A;  1QNU A;  2JA6 H;  4JI7 L;  1VQM A;  1K0R A;  3WWV A;  5KIX A;  5EQ0 A;  4IO9 A;  3EVQ A;  1EY5 A;  2VQF L;  2VNU D;  1ICF B;  5FLM G;  3I2Z A;  5CMD A;  3MFY A;  2Q8I B;  3E5S A;  3VYR A;  2IX1 A;  3A7L A;  2A73 B;  3HOY B;  3QR8 A;  3SK6 A;  1X3F A;  1W6J A;  3LX0 A;  3R3O A;  3SK5 A;  1U5K A;  3K0Y A;  1EZ8 A;  3R93 A;  3M7N A;  4WJ4 A;  4O2D A;  4P72 A;  4DXF A;  2G9H D;  1EY4 A;  1PRT B;  1PH1 A;  3GTG H;  1B9M A;  1IBL L;  1QVG A;  3MEH A;  1CZW A;  1JWM D;  1YBY A;  4J15 A;  1K8A C;  2DJF C;  1XNQ L;  5C4X H;  4BXX H;  3R8B A;  4KKS A;  1B4O A;  1I4R A;  4DV1 L;  5K36 G;  2F0H A;  2DN8 A;  5M3M B;  3CCR A;  1CZG A;  2NYZ D;  2B8G A;  5EKL A;  2UUA Q;  4EQN A;  4YCV A;  4CGY B;  2HIV A;  1F2L A;  1Z47 A;  2NZH A;  4A3F G;  2VUM H;  4LW1 A;  2K03 A;  1PH4 A;  2Q2U A;  3FDT A;  5ELO A;  2CH4 A;  2DNE A;  3DXJ C;  2NVQ H;  1IZ6 A;  1E1O A;  1GHJ A;  3I4N H;  5D65 A;  4DV2 L;  5JJI A;  2BA1 A;  2UU9 Q;  4R4T A;  4PMW A;  3M4Q A;  1WFQ A;  3E9I A;  4KHP L;  2L12 A;  1KNE A;  1LTG D;  3CRL C;  4X3U A;  5EGT A;  1V1Q A;  3QIA A;  1PFB A;  3TRE A;  3GTM B;  4B08 A;  4K5W A;  4FYD A;  4CJ0 B;  3NK9 A;  4PMB A;  2OQK A;  4IUN A;  4HID A;  2IL8 A;  3FVQ A;  5C4X B;  1Q3L A;  1CA6 A;  2UUC Q;  3HOZ H;  1GXD C;  2EXZ A;  4PNY A;  1TR5 A;  2WB1 E;  4X64 L;  4JPB W;  1JCK B;  3UE1 A;  2KHI A;  4HSP A;  2CCZ A;  4F88 A;  3J81 c;  3VR4 A;  4C3I H;  2EYJ A;  2QDB A;  2NTS A;  4MHE A;  4X3S A;  5CV8 A;  5LMN W;  1E2V A;  4HR7 B;  3D6C A;  4QUC A;  1MIU A;  3PV0 A;  2JA8 B;  3CCS A;  2GN5 A;  4DV3 L;  1L0Y B;  2YTX A;  2ZTD A;  5I6Y A;  4RMF A;  2QCP X;  2XTI A;  3E3X A;  2YU9 B;  4A3K B;  4CHT B;  1S5E D;  2K75 A;  4NKL A;  1X3E A;  3K7U C;  5IGG A;  4LFA L;  1EIH A;  4FF2 A;  2MFI A;  3AFQ A;  1JT8 A;  2L55 A;  3J81 i;  1NCV A;  4ABN A;  1SNO A;  1IYV A;  4PZ7 A;  3PUY A;  3WDN A;  1VMP A;  4NXN Q;  4JI4 Q;  3K59 A;  1CKM A;  1YNN C;  3H0G B;  3CCJ A;  4BY7 B;  3D4W A;  1KAA A;  4A75 A;  2F3I A;  2K4K A;  1D2B A;  2SDF A;  4N8F A;  4K6D A;  2CH4 W;  4CDC C;  4L5S A;  3F2U A;  2JSO A;  1B3A A;  3BDO A;  4O42 A;  4GN3 B;  1EU3 A;  1S5C D;  2RBM A;  4C2M B;  3BJU A;  1I6H B;  4DR5 L;  3KDF B;  2EY6 A;  4AH6 A;  5ELC A;  1BCP B;  4XQN A;  1ZYR D;  1LT5 D;  4IJH A;  4QIW B;  2BH2 A;  2K5H A;  2K7V A;  1K83 H;  4LJZ C;  4C56 C;  1K8O A;  4HED A;  5GAD C;  2L9H A;  3O13 A;  2QIL A;  4CJ1 B;  4FP5 D;  3S9W A;  2JEA I;  1SYC A;  3Q23 A;  1N34 Q;  1ESF A;  4A3E B;  1PXU A;  1VQL A;  4PMC A;  1SEB D;  1X6O A;  3L7Z C;  4DA2 A;  2O5I C;  2ZJR A;  4AQY L;  1IXR A;  2EJF C;  2K5Q A;  1NUC A;  4KD3 A;  1YHQ A;  1HA6 A;  4GNX B;  4IJL A;  4J1M A;  3AFP A;  1R4Q B;  2EVB A;  5C5L A;  2K5N A;  1OO9 B;  3PIO A;  3CAM A;  5DNF A;  5G3L F;  4K2K A;  5I2X A;  1Q81 C;  2HD3 A;  1RTN A;  5JPN C;  2Z8L A;  4AYB B;  3T16 A;  3J7Z C;  2TSS A;  1JJG A;  4IUU A;  2IJ0 A;  4OXP A;  1CQV A;  3I56 A;  3JAM E;  2DY7 A;  3GTJ H;  1HUM A;  4ID6 A;  1TWG B;  1IL8 A;  2K5D A;  3HFZ B;  4HJ5 A;  5IGC A;  1H9S A;  4GKK L;  2F0T A;  1RIP A;  2M9V A;  2E2I H;  3S1R H;  2XSC A;  3G6J B;  4PZ8 A;  1Q82 C;  1K83 B;  1CM9 A;  3P7J A;  1MI2 A;  3GV6 A;  2Q2H A;  4DF7 A;  4X66 Q;  2JA7 H;  3QOJ A;  1EY7 A;  4JYA L;  2WV6 D;  2YYZ A;  3D8G A;  1X9N A;  2NVX B;  3EBE A;  2UXD Q;  1JOQ A;  4A3C H;  1SN8 A;  1NMG A;  4K0K L;  4OL7 A;  1I50 B;  1ILQ A;  5IOC A;  2SNM A;  1OXS C;  1YI2 A;  1F9Q A;  3KF8 B;  3FMC A;  2XGT A;  1EWC A;  1IW7 D;  2F0F A;  3K0X A;  3OSO A;  1TT2 A;  2J7Z A;  1NMF A;  4R4O A;  2ICI A;  3HKZ B;  1LAC A;  4JI8 Q;  3TEH B;  2MNA A;  4FF4 A;  3H3V H;  1PRT C;  1BOS A;  4EX5 A;  2D5D A;  1UE1 A;  3MWY W;  1GM5 A;  3BYY B;  4BA2 I;  4NXM L;  5M5Y H;  5J39 A;  3HOW B;  1Y8P B;  3C3L A;  1ZKO A;  3KDF A;  2EYM A;  2R92 G;  3N6R A;  4CDD C;  2ZJQ A;  1D5X C;  1A62 A;  3T4A C;  1G2S A;  2A8V A;  2JA7 B;  1G91 A;  2KA7 A;  3GTL B;  1S3O A;  1EOT A;  5J1Z A;  1WJJ A;  3F8T A;  3NQT A;  2HHH L;  2EXD A;  2KVM A;  2N8N A;  1XTD A;  3S2H B;  3K58 A;  3M4O H;  2A69 D;  1PA6 A;  5EBD A;  1YHA A;  2EQS A;  1XX8 A;  4KKT A;  3UDF A;  3I55 A;  3CCQ A;  4GNX A;  5IP7 G;  5JJZ A;  1N36 L;  3QOL A;  5ELF A;  2IPK D;  4XQQ A;  1HNZ L;  4I7A A;  2B2W A;  1J6Q A;  1AH9 A;  3GQB A;  3ERO A;  4A3I G;  1VQD A;  1YJW A;  2QEJ C;  3Q6S A;  1X3Q A;  4A3L G;  2L11 A;  5M5Y B;  2JA5 G;  5GAE C;  4JI0 Q;  3NBI A;  3MHB A;  5AJ3 L;  5ISR A;  5EPJ A;  1HFG A;  4A93 B;  4JW0 A;  2K5V A;  4ZRZ A;  3D4D A;  1FNV A;  5BN3 A;  1XPR A;  5IY0 A;  3NWS A;  1TKW B;  1B8A A;  3K5O A;  1SYG A;  4QB4 A;  1TWA B;  4KTA A;  3KYH C;  3T1H Q;  1N9W A;  1AE2 A;  4R4Q A;  5C4J H;  1VQO A;  1Q8I A;  4JI2 L;  2K1B A;  4DNT B;  1CFM A;  4DUZ L;  1DJR D;  2WKC A;  2PMZ B;  3K7A H;  1R4P B;  1V8Q A;  1XXG A;  3S1Q H;  2VXW A;  2NN6 I;  3RNU A;  4DAV A;  3A7A B;  1L0W A;  5LMN L;  4HMI A;  4UY8 C;  4Y52 H;  4IUV A;  1JE4 A;  3KF8 A;  2A5H A;  3MXU A;  2LSS A;  1WCM G;  2RF4 A;  1LO5 D;  2F0J A;  3MZ5 A;  4RCN A;  1U4P A;  1N8R C;  4LFC L;  3HOU G;  1OXV A;  2RHS B;  1QNK A;  3A8J E;  3FRP B;  4R4C A;  2OXP A;  3A5Z B;  3J80 L;  1Y1W G;  2Z9H A;  5LMU Q;  2LS0 1;  4EVO A;  4YHH Q;  3GTK H;  2Y0S E;  1HNW Q;  2L15 A;  3GTQ B;  2V1C C;  1BCP F;  1NJI C;  3AYH B;  2AKW B;  1MJE A;  5CBE E;  2KCM A;  2ZTC A;  1BCP C;  2AUK A;  4RGO S;  1LTA D;  3K80 C;  4K8I A;  1I6V C;  1BXT A;  3RZD B;  4ULL A;  2A6E D;  3K7A B;  1QOH A;  3CPW A;  3T1Y Q;  5I2Y A;  1Y1V B;  3QO2 A;  1MKH A;  1YEZ A;  1IBM L;  1TY2 A;  3JAM L;  4IOC A;  4JBJ A;  1KL9 A;  5JEA G;  3D4R A;  4JI5 L;  3C1F A;  1ZEQ X;  4EQP A;  2C35 B;  2KBN A;  4GNX C;  2CVR A;  4HTH A;  4HJ8 A;  4QUF A;  1KNA A;  5EAY A;  1B1Z A;  3OOC A;  3DEP A;  1FJG L;  2F0L A;  3WOF A;  3PO2 H;  2UUB Q;  3SK8 A;  1EIF A;  3CXC A;  1PH8 A;  3A54 A;  2B2W C;  3P20 A;  1XMQ L;  3DMU A;  3U58 A;  1EQV A;  4IN3 A;  1SRU A;  2E76 C;  4A3G B;  5IYD G;  2FJ2 A;  2K04 A;  4OO1 I;  1VQF A;  4DV7 L;  3VDY A;  3BG3 A;  4LFB L;  1S5D D;  5C0X G;  3CHB D;  4GKJ Q;  2AHO B;  3MC0 B;  2CW0 D;  4GLX A;  5GQO A;  3BVM A;  3EFX D;  1Q46 A;  4BA1 I;  1KRS A;  2RCF A;  4BY1 H;  4FF3 A;  1XNR L;  2MHV A;  2OEO A;  4K5V A;  4CKC A;  4A3M H;  1XMO Q;  3RLF A;  3NTK A;  1DGS A;  3FKI G;  5BN4 A;  3HOX G;  2K05 A;  3OMC A;  2WKD A;  4C3H H;  1PH6 A;  2FFK B;  5D3D A;  3TQY A;  5KND A;  4C3J H;  3OHX C;  3I3C A;  2GVA A;  4MTN A;  2JYO A;  2RKS A;  3PGZ A;  1QIL A;  1KDC A;  3Q8D A;  3SEB A;  1S72 A;  3U4Z A;  1B70 B;  1VQE A;  3SR1 A;  1STN A;  1BNZ A;  1LT3 D;  2LFN A;  4OX9 Q;  1ET6 A;  4RH6 A;  4A76 A;  4DUY L;  4ZYS A;  1L1O C;  2LY7 A;  3M3Y B;  5C6A A;  2XN9 C;  4LUO A;  4KLK A;  4DR7 L;  1U0L A;  3CU7 A;  2E75 C;  1TVX A;  2JXM B;  3SK4 A;  4IFD G;  1F2M A;  3VYT A;  1PZI D;  1C0A A;  1A6X A;  3VR3 A;  3CF5 A;  3R2I A;  1EWH A;  5KGU A;  2PQA B;  2VQE Q;  1VQ5 A;  2PQE A;  2PI2 A;  4A3M B;  3HRZ C;  4LK1 C;  1WOC A;  2R7Z H;  1KD1 C;  5DEH A;  1LUZ A;  4C3H B;  2J4X A;  1RKN A;  3S1M B;  5FJ8 G;  5C4H A;  3RN2 A;  1WTQ A;  4C3J B;  1BBX C;  1OTC A;  1AZQ A;  4B3T Q;  1K28 A;  3W1B A;  1IL2 A;  1SE3 A;  3HOV H;  5I6W A;  1CHP D;  3X3M A;  1GUT A;  4DV0 L;  2RVL A;  4DV4 Q;  1PLF A;  4I7Z C;  3MXN B;  4JI7 Q;  2EY1 A;  5C3E G;  4B3M L;  5CV9 A;  3PO3 G;  4EGV A;  1I4P A;  2IHE A;  3CCE A;  1BQQ T;  1LV9 A;  5EKI A;  2EY5 A;  3C2P A;  4E6I A;  1EOV A;  4GZY C;  4JI6 L;  4DV5 Q;  1A63 A;  1EU4 A;  1H9K A;  1L0X B;  3ERQ A;  1SFO B;  2F4I A;  3G6E A;  3SGI A;  2VZA A;  4BXX G;  1G29 1;  4HCE A;  1WTV A;  2ENB A;  1A2U A;  4H7B A;  1BO0 A;  3VR5 A;  1LTI D;  1PFN A;  1OXT A;  4JVZ A;  1C4Q A;  4DV6 L;  5EKK A;  4QMG A;  3HOV B;  4BBS H;  1KLU D;  3QG1 A;  1XNQ Q;  1JWU D;  1K3R A;  2WAQ E;  1IYJ B;  1XPU A;  2QKI C;  1G2T A;  1R9T H;  3ULL A;  1QCB D;  3I4N G;  4IPH A;  5M3M H;  1E24 A;  1JE5 A;  1II3 A;  4A4I A;  1K9M C;  1BR9 A;  4R8I A;  2ZM6 L;  4LF5 L;  2R93 H;  2BA0 A;  2F0N A;  3CPF A;  4KHZ A;  3FKI B;  1EFI D;  3NPP A;  1VS0 A;  4A3J B;  4UP7 A;  3JAM c;  3BVZ A;  1EL0 A;  1F2Z A;  2PQA A;  1GUW A;  2D2C C;  2D0P A;  1SE4 A;  2DGY A;  3RUZ A;  5EPL A;  1T5E A;  3GTP B;  2BE5 D;  4KV6 A;  5E4W C;  3GTM H;  2XIW A;  4KY5 A;  1ZXT A;  1YIT A;  3FP9 A;  4MIU A;  4DFA A;  4NMZ A;  3CQZ B;  4BBS B;  4C3I G;  1QJO A;  3NWT A;  3JAM i;  2C9O A;  5IT9 L;  5CR3 A;  4B9X A;  4X64 Q;  1MGS A;  2O4X A;  1Z6H A;  1R9T B;  1STG A;  1S40 A;  2V4D A;  1GUO A;  3BS1 A;  1YIJ A;  1LTR D;  3DM1 A;  4IZ8 A;  2HQL A;  2R93 B;  2E2H B;  3H91 A;  4A3B G;  4DV3 Q;  3KUP A;  2JA8 H;  1RD9 D;  2E2J B; 
#chains in the Genus database with same CATH homology
 3R2T A;  1EZ6 A;  1LLR D;  3K6O A;  5C4Z A;  1IYU A;  1TS3 A;  4C1N K;  1LT6 D;  3V05 A;  5M3F B;  4N9T A;  2B2Y C;  2F0O A;  5IGF A;  1A2T A;  2EOT A;  2QF7 A;  5AFW A;  4FF1 A;  3S17 B;  5E3F A;  1KDA A;  4HN7 A;  3PO3 B;  2A68 D;  4O1N A;  3MA2 B;  4FNF A;  2PW5 A;  1U9R A;  4KY7 A;  3KLS A;  3I72 A;  2D9U A;  1XTC D;  2NBF A;  1S5F D;  4XYQ A;  3S1N B;  2BOS A;  4RWS C;  3S2D B;  3KLS X;  2FHT A;  4BS9 A;  1X3P A;  4DN4 M;  1G8Z D;  3L3O C;  2OT2 A;  5LHY 1;  5A2Q E;  2B2U A;  3HG9 A;  4HAE A;  3L9A X;  5COR A;  2NZ1 D;  3TSS A;  3M4Y A;  1SNC A;  1TY0 A;  3MTS A;  1HQR D;  2R3Z A;  2IT1 A;  4RKB A;  2FMM A;  3NUC A;  5I9P A;  4XTC S;  3URY A;  5FOB B;  4L6T B;  1DZ1 A;  2RDF A;  1SSO A;  1DON A;  1NSN S;  3J80 E;  5IGB A;  4UDU C;  1LTB D;  2F0P A;  1IHZ A;  1VMC A;  2AWO A;  3VA5 A;  2NVT B;  2ID0 A;  2AUJ D;  4QF4 A;  1ESR A;  3H09 A;  1IKL A;  5IGE A;  5FLX E;  1D5Z C;  3NHH A;  2NUC A;  2KCN A;  2H1E A;  1HXY D;  3A56 A;  4P2C B;  3DWQ A;  2PZT A;  2PNR C;  4KKU A;  4ZUJ A;  4RGT A;  1D6E C;  4A3F B;  3BVG A;  5JVG 3;  4CKB A;  2C5C A;  2WII B;  1CI3 M;  3PUX A;  3W2D A;  4X3K A;  2X6L A;  1AP0 A;  5KRU A;  2LMC B;  1W6K A;  2EYF A;  2RQX A;  2XVS A;  1C8C A;  5FO7 B;  2EJM A;  3IL8 A;  2A68 C;  4DNR B;  1HHV A;  4RCO A;  2RDH A;  3TP7 A;  4G7H C;  1PRT F;  1ROD A;  3DEO A;  2B2U C;  4Q5V A;  1DOK A;  1TWH B;  1KLG D;  3OWE B;  2F0U A;  1TU2 B;  2AQ1 B;  1Y69 U;  2K01 A;  2PZU A;  2JEB I;  4TRD A;  1UNS A;  2H4O A;  4K14 A;  3TN2 A;  4NDX A;  2XRQ D;  2KEC A;  4XDX A;  4XIG S;  3KLR A;  3QB3 A;  3ONA B;  2JP1 A;  1VF5 C;  4CKE A;  1TQO A;  2RDG A;  4HMJ A;  1A15 A;  1YNJ D;  3TP5 A;  5EJW A;  4HSV A;  1TS5 A;  3HZX A;  1MSH A;  2X6G A;  5DM6 3;  1ZYR C;  4KI0 A;  4R9W A;  3S14 B;  4K6L A;  1GJX A;  1TWF B;  3FPP A;  4TSS A;  3BZD B;  1U4R A;  1S5B D;  3BDC A;  5HGT A;  1JWS D;  4DAP A;  4RA8 A;  1JR0 D;  4EQO A;  1WVL A;  1SXT A;  2LKV A;  3W3A A;  2SEB D;  2N55 A;  4WFN 3;  2B8F A;  4DK0 A;  5A2Q L;  1JQY D;  1SYB A;  4XT1 B;  1M8A A;  1OXX K;  1ENF A;  1EY6 A;  1PFM A;  3HEJ A;  3QWN A;  1F9R A;  1MD2 D;  3OMG A;  2K6A A;  5KYL A;  2NN6 G;  2WIN B;  4F87 A;  4G7Z C;  1GOZ A;  4IUQ A;  1PTO D;  1HQM C;  1GHK A;  5LL6 S;  1TWC B;  3SXH A;  2F3W A;  1RDP D;  1JIC A;  3J7Y W;  5E4X A;  2KCC A;  2Z4I A;  1VDZ A;  1ICW A;  5FLX L;  3P1H A;  2F0I A;  1SMY D;  4LAA A;  3HP3 A;  1STH A;  1IW7 C;  2RSN A;  4OGQ C;  1WTR A;  1AZP A;  1D1K A;  2NB0 A;  1Y8O B;  3NTI A;  3VYU A;  4M8A A;  1CQF A;  3MVV A;  3K5L A;  2L1B A;  1UUP A;  2R92 B;  2EE1 A;  3TZD A;  2B2T A;  2EYP A;  2KED A;  5T1I A;  2L5T A;  5K5P A;  3GTO B;  2WP8 J;  4A3D B;  1Q90 A;  5IT9 E;  1DM0 B;  3AB9 A;  2ZXR A;  2VB2 X;  4F7X A;  1ML0 D;  5I4D A;  1DOM A;  2A69 C;  4OO1 G;  2AQ3 B;  1SE2 A;  4CJ2 C;  4ZLT F;  1SDF A;  4A3I B;  1PYW D;  3T53 B;  2JA5 B;  1K8M A;  5KEE A;  2BCO A;  2SNS A;  2WB1 B;  1QB5 D;  4XT3 B;  1V1P B;  1A3T A;  4S3S A;  5EPK A;  3KBX A;  1B53 A;  3K5N A;  3A8I E;  4X3T A;  5C5M A;  4KJN A;  1H9J A;  2EY2 A;  2WAC A;  1I4Q A;  1V1O A;  4Y7N B;  4ZKB B;  1E2Z A;  3NXW A;  1WCM B;  1JOK A;  3HOU B;  3VYS A;  4V0B A;  1I3Q B;  1Y1W B;  3I4L A;  3D31 A;  3J7A F;  3C1E A;  3NE5 B;  1T5X D;  4KHV A;  1PTO C;  4TQU S;  2TMP A;  2HUG A;  1XYI A;  3E6Z X;  1KAB A;  3KK7 A;  2L4N A;  1HTP A;  5C3X A;  3TBI B;  2B2T C;  2ZXP A;  1RJT A;  5JOB A;  2E2D C;  2F0D A;  1JB3 A;  2F0K A;  5JVH 3;  3TME A;  2J0T D;  2DNC A;  5F2D A;  1FD7 D;  5TSS A;  2A6E C;  2Q8R E;  2B2Y A;  3AMU A;  5JEA J;  1ENA A;  4L8J A;  1BUV T;  4RGN A;  1SYD A;  1BDO A;  1SJH D;  5M5W B;  3PIP 3;  2VB3 X;  1LT4 D;  1STY A;  3RD4 A;  4IFD H;  3SE0 A;  2K33 A;  1SND A;  3U9S A;  5T1G A;  5EBC A;  3I4M B;  2PW7 A;  4RHS A;  1PZK D;  5HUR A;  1V1P A;  2CW0 C;  1YNN D;  3T51 B;  4RHR A;  5J22 A;  3GP7 A;  3HOX B;  3HS0 C;  2B63 B;  1RHP A;  2NVY B;  2O5J C;  1ILP A;  5C44 B;  4ILW A;  3Q22 A;  3S15 B;  3Q0A A;  2KJX A;  3IKJ A;  4DK1 A;  1S4Z A;  2JE6 I;  2BDN A;  4KN4 C;  4IFD J;  1EEF D;  1CK1 A;  5E1F A;  1GUS A;  2E74 C;  3OPO A;  5D3I B;  4BBR B;  5KNC A;  1E0B A;  3MXN A;  2F3V A;  5CGK A;  2I46 A;  1VF7 A;  3I8Z A;  1RF2 D;  2B2V C;  1Q1E A;  5ELE A;  1STE A;  2JA6 B;  2CHB D;  4ZUI A;  4XQJ A;  3S16 B;  3K57 A;  1HRJ A;  5G3L D;  4WJW A;  1F9P A;  1F77 A;  4MN3 A;  2HCC A;  1SNP A;  3MAQ A;  3I91 A;  4KJO A;  5C3E B;  5CV4 A;  2HDL A;  1PDQ A;  2KUM A;  2F0V A;  1CTM A;  1J9O A;  1WTO A;  4RFB A;  4FXK C;  4FVM A;  4I65 A;  2F03 A;  3GTG B;  1D5M C;  4K2L A;  3MFG A;  1O7Z A;  4H44 C;  2GA4 B;  1NAP A;  1U4M A;  3X3N A;  1DYQ A;  5DAU A;  5CV7 A;  4IUR A;  1O78 A;  5FO8 B;  4HCS A;  1H9S B;  3WOE A;  5ELB A;  1SAP A;  5ELD A;  4ZAI A;  3EJI A;  4DU9 A;  1PRT D;  1A3V A;  2KOL A;  3CKI B;  1Z7T A;  3OIP A;  3DWP A;  2VUM B;  4XXE A;  1SNM A;  3A55 A;  2NVQ B;  4IUP A;  3I4N B;  5K36 H;  3D6W A;  3DUZ A;  5BN5 A;  4B9W A;  5KNB A;  2BDO A;  3C46 A;  3OWF A;  1O7Y A;  3IAY A;  3BYT B;  3EQL C;  5CV6 A;  3K5M A;  1EQT A;  2IWH A;  2Y0S B;  3OW7 A;  5FO9 B;  1D1I A;  3HOZ B;  3SHL A;  2EYO A;  4F8M A;  1EYA A;  1H9R A;  4DGZ A;  2BE5 C;  4C3I B;  3NBH A;  1Q1B A;  4KD4 A;  3N52 A;  3PMF A;  3FPU B;  1MSG A;  4DXG A;  2B39 A;  5LL6 X;  4Q0F A;  4RKL A;  2DY8 A;  4FO2 A;  3TP6 A;  3HGB A;  3G7L A;  4C1N I;  1CT1 D;  3EA6 A;  4A3B B;  5CYU A;  4ODG A;  1GUG A;  4OIJ A;  1U4L A;  2EZV A;  4LMQ D;  1RTO A;  5JPM C;  2M00 A;  5FKA C;  1EY8 A;  5DM7 3;  4G57 A;  1OXU A;  2IX3 A;  1KTK A;  4G7O C;  4BWG B;  4WRD A;  2MJ8 A;  4DAY A;  3ITP A;  1PTO H;  1O7L A;  2PYK A;  2G9D A;  3IFD A;  4NP5 A;  4PV1 C;  4ZQ3 A;  4WOR A;  1RCV D;  2RSO A;  1QWY A;  1AW7 A;  1XWE A;  3NSW A;  5C3W A;  3PUV A;  1BCP D;  3DWA A;  1EEI D;  2F0S A;  1SYF A;  3I90 A;  4M1U B;  3H94 A;  3Q24 A;  2FMC A;  2OF1 A;  3H6M A;  4UAI A;  3GTJ B;  1FYC A;  1HA5 A;  2F0W A;  4H0L C;  2NWG A;  1FGB D;  1HUN A;  1PTO B;  2E2I B;  1HCZ A;  4U67 3;  3S1R B;  1JC7 A;  1EYD A;  2M2L A;  4ME5 A;  2PCF B;  2K32 A;  1QG7 A;  3LWE A;  4U68 A;  2F0M A;  2EYL A;  2F1M A;  1CHQ D;  2Z1C A;  2ZT9 C;  2K5W A;  5I9O A;  1WD0 A;  3J81 E;  1NR4 A;  1EY0 A;  5IIF A;  1Y8N B;  3VA7 A;  1MBY A;  2MP1 A;  3MXG A;  1JOR A;  3I73 A;  2X69 A;  2HDM A;  2K28 A;  2R6G A;  1CA5 A;  1HTL D;  1AFP A;  4R8N A;  1SYE A;  4OIK A;  1E2W A;  1PMR A;  4IQZ A;  5KYI A;  5JAV A;  3MXP A;  3D3R A;  1FNW A;  1JOO A;  2N88 A;  3ND9 A;  1KDB A;  3PIO 3;  3I70 A;  4J6H A;  3QJY A;  4RGM A;  1SJE D;  1SBB B;  1LTS D;  1SNQ A;  4TKO B;  1VCI A;  5NUC A;  2R61 A;  2NTT A;  3ND8 A;  4Z9C B;  1FNU A;  2WAQ B;  3M4O B;  3FEW X;  3KBG A;  3V96 A;  4IUT A;  1DCZ A;  3NQI A;  3SDZ A;  1AEX A;  5COY A;  5CV5 A;  1O80 A;  5CBA E;  1I4G A;  4NW2 A;  2HQE A;  2XWB B;  4C3H G;  1UAP A;  4KY6 A;  4C3J G;  3GO5 A;  1TS2 A;  3PUW A;  4OHJ A;  2PPB C;  3V2T A;  4N9P A;  4CBV A;  3A8K E;  3TZU A;  4KK7 A;  4PQX A;  2Z4H A;  4ZK9 B;  3SVM A;  3T56 B;  5C4J B;  1M4V A;  2EDG A;  1C48 A;  1NR2 A;  1BF4 A;  1WTW A;  1F2Y A;  1ET9 A;  3S1Q B;  4FXG C;  3M7G A;  1STA A;  1STB A;  3VR6 A;  5A35 A;  2A6H D;  5IGD A;  1DXM A;  4YIJ A;  4KMU C;  3NP8 A;  2XNA C;  2RA4 A;  1TII D;  2D62 A;  1YNJ C;  2I07 B;  1Q12 A;  3GTK B;  2KQ3 A;  2MPM A;  2NN6 H;  2ZXO A;  3AU7 A;  3J7A V;  2MGS A;  5C0X I;  1J8I A;  1DOL A;  2XRS D;  2F0Q A;  2FIN B;  1HFN A;  2HCI A;  3LWU A;  1TS4 A;  5D14 A;  4K8J A;  1H9M A;  2L0C A;  4L63 B;  2MUY A;  1IKM A;  1G6Z A;  1FR3 A;  3CRK C;  3RMH A;  4JK1 C;  2Q8T A;  3IFT A;  1WD1 A;  4H13 C;  2PO4 A;  3U9O A;  3PO2 B;  4IFD I;  1EYC A;  1WTX A;  5JEA H;  4FXD A;  3OIQ A;  3VR2 A;  4G4K A;  3TDQ A;  1QE6 A;  3PUZ A;  2IX0 A;  1PTO F;  1V43 A;  2SOB A;  3J81 L;  4J8Q A;  4QCL A;  3ZYY X;  1F9S A;  4BY1 B;  1EIG A;  2PZW A;  3M85 A;  2EYH A;  4JBW A;  1B9N A;  2ICE C;  1DD2 A;  5C0X H;  2B2V A;  4OO1 H;  1B2T A;  3LNN A;  4IAL A;  2EJG C;  3BDL A;  1ONL A;  3E0J A;  3DHQ A;  1PZJ D;  1SMY C;  3RZO B;  1EY9 A;  2IW3 A;  1AN8 A;  3NTH A;  3GV3 A;  3H3V C;  4V19 0;  1I4H A;  1LAB A;  1UEA B;  1I4X A;  2EPB A;  2A74 C;  1WTP A;  5M5X B;  5FK9 C;  4ZKC B;  1GUN A;  5IOD A;  1ENC A;  2F0E A;  2F0G A;  1LTT D;  5M9O A;  2CQA A;  2R7Z B;  2O2L D;  2A6H C;  3P75 A;  4RAU C;  3UI2 A;  2XWJ B;  1B50 A;  5C0X J;  3TP8 A;  2KHS A;  4KN7 C;  3T13 A;  3GD7 A;  5CC4 A;  1A3U A;  4XYO A;  1X32 A;  4K5X A;  2AQ2 B;  1HPC A;  2AWN A;  1B44 D;  2KEE A;  1QNU A;  5KIX A;  5EQ0 A;  3EVQ A;  1EY5 A;  2VNU D;  5CMD A;  3MFY A;  2Q8I B;  3VYR A;  3E5S A;  2IX1 A;  3A7L A;  2A73 B;  3HOY B;  3SK6 A;  3R3O A;  1W6J A;  3LX0 A;  3SK5 A;  3K0Y A;  1EZ8 A;  3R93 A;  3M7N A;  4DXF A;  2G9H D;  1EY4 A;  1PRT B;  1B9M A;  3MEH A;  1CZW A;  1JWM D;  3R8B A;  4KKS A;  1B4O A;  1I4R A;  5K36 G;  2F0H A;  2DN8 A;  5M3M B;  1CZG A;  2NYZ D;  2B8G A;  5EKL A;  4EQN A;  4CGY B;  1F2L A;  1Z47 A;  2K03 A;  3FDT A;  2DNE A;  3DXJ C;  1GHJ A;  5D65 A;  2BA1 A;  4PMW A;  2L12 A;  1KNE A;  1LTG D;  3CRL C;  4X3U A;  5EGT A;  3QIA A;  1PFB A;  3GTM B;  4B08 A;  4K5W A;  4FYD A;  4CJ0 B;  3NK9 A;  4PMB A;  4IUN A;  2IL8 A;  3FVQ A;  5C4X B;  1Q3L A;  1CA6 A;  1GXD C;  2EXZ A;  4PNY A;  1TR5 A;  1JCK B;  4HSP A;  4F88 A;  3VR4 A;  2EYJ A;  2QDB A;  2NTS A;  4MHE A;  4X3S A;  5CV8 A;  1E2V A;  4HR7 B;  3D6C A;  4QUC A;  3PV0 A;  2JA8 B;  1L0Y B;  5I6Y A;  2QCP X;  2YU9 B;  4A3K B;  4CHT B;  1S5E D;  4NKL A;  5IGG A;  1EIH A;  4FF2 A;  2L55 A;  1NCV A;  4ABN A;  1SNO A;  1IYV A;  3PUY A;  3WDN A;  1VMP A;  3K59 A;  1YNN C;  3H0G B;  4BY7 B;  3D4W A;  1KAA A;  1D2B A;  2SDF A;  4K6D A;  3F2U A;  2JSO A;  1B3A A;  3BDO A;  4O42 A;  1EU3 A;  1S5C D;  2RBM A;  4C2M B;  1I6H B;  2EY6 A;  5ELC A;  1BCP B;  4XQN A;  1ZYR D;  1LT5 D;  4QIW B;  2K7V A;  4LJZ C;  4C56 C;  1K8O A;  4HED A;  2L9H A;  3O13 A;  4CJ1 B;  2QIL A;  4FP5 D;  3S9W A;  2JEA I;  1SYC A;  3Q23 A;  1ESF A;  4A3E B;  1PXU A;  4PMC A;  1SEB D;  3L7Z C;  4DA2 A;  2O5I C;  2EJF C;  2K5Q A;  1NUC A;  4KD3 A;  1HA6 A;  4J1M A;  1R4Q B;  2EVB A;  5C5L A;  1OO9 B;  5DNF A;  5G3L F;  4K2K A;  5I2X A;  1RTN A;  5JPN C;  2Z8L A;  4AYB B;  3T16 A;  2TSS A;  4IUU A;  2IJ0 A;  1CQV A;  3JAM E;  2DY7 A;  1HUM A;  4ID6 A;  1TWG B;  1IL8 A;  2K5D A;  5IGC A;  1H9S A;  2F0T A;  2M9V A;  2XSC A;  3G6J B;  1K83 B;  1CM9 A;  3P7J A;  1MI2 A;  3GV6 A;  4DF7 A;  3QOJ A;  1EY7 A;  2WV6 D;  2YYZ A;  3D8G A;  2NVX B;  1JOQ A;  4OL7 A;  1I50 B;  1ILQ A;  5IOC A;  2SNM A;  1OXS C;  1F9Q A;  3FMC A;  1EWC A;  1IW7 D;  2F0F A;  3OSO A;  1TT2 A;  2J7Z A;  2ICI A;  3HKZ B;  1LAC A;  4FF4 A;  1PRT C;  1BOS A;  2D5D A;  3MWY W;  3BYY B;  4BA2 I;  5J39 A;  3HOW B;  1Y8P B;  3C3L A;  1ZKO A;  2EYM A;  3N6R A;  1D5X C;  3T4A C;  1G2S A;  2JA7 B;  1G91 A;  2KA7 A;  3GTL B;  1EOT A;  5J1Z A;  3NQT A;  2KVM A;  3S2H B;  3K58 A;  2A69 D;  5EBD A;  1XX8 A;  4KKT A;  5JJZ A;  3QOL A;  5ELF A;  2IPK D;  4XQQ A;  2B2W A;  3GQB A;  3ERO A;  2QEJ C;  3Q6S A;  1X3Q A;  2L11 A;  5M5Y B;  3NBI A;  3MHB A;  5ISR A;  5EPJ A;  1HFG A;  4A93 B;  4ZRZ A;  3D4D A;  1FNV A;  5BN3 A;  3NWS A;  1TKW B;  3K5O A;  1SYG A;  4QB4 A;  1TWA B;  4KTA A;  1Q8I A;  2K1B A;  4DNT B;  1CFM A;  1DJR D;  2WKC A;  2PMZ B;  1R4P B;  1V8Q A;  1XXG A;  2VXW A;  2NN6 I;  4DAV A;  3A7A B;  4HMI A;  4IUV A;  1JE4 A;  3KF8 A;  2A5H A;  3MXU A;  1LO5 D;  2F0J A;  3MZ5 A;  4RCN A;  1U4P A;  1OXV A;  3FRP B;  1QNK A;  3A8J E;  2OXP A;  3J80 L;  2LS0 1;  4EVO A;  3GTQ B;  1BCP F;  5CBE E;  1BCP C;  2AUK A;  4RGO S;  1LTA D;  4K8I A;  1I6V C;  1BXT A;  3RZD B;  4ULL A;  2A6E D;  3K7A B;  1QOH A;  5I2Y A;  1Y1V B;  3QO2 A;  1TY2 A;  3JAM L;  5JEA G;  3D4R A;  3C1F A;  1ZEQ X;  4EQP A;  2CVR A;  4HTH A;  4QUF A;  1KNA A;  1B1Z A;  3OOC A;  3DEP A;  2F0L A;  3WOF A;  3SK8 A;  3A54 A;  2B2W C;  3P20 A;  3DMU A;  1EQV A;  4IN3 A;  2E76 C;  4A3G B;  2FJ2 A;  2K04 A;  4OO1 I;  3BG3 A;  1S5D D;  5C0X G;  3CHB D;  3MC0 B;  2CW0 D;  3BVM A;  3EFX D;  4BA1 I;  4FF3 A;  2MHV A;  2OEO A;  4K5V A;  4CKC A;  3RLF A;  3NTK A;  5BN4 A;  2K05 A;  3OMC A;  2WKD A;  2FFK B;  5D3D A;  5KND A;  3OHX C;  3I3C A;  2JYO A;  2RKS A;  1QIL A;  1KDC A;  3SEB A;  3SR1 A;  1STN A;  1BNZ A;  1LT3 D;  2LFN A;  1ET6 A;  4RH6 A;  4ZYS A;  2LY7 A;  3M3Y B;  5C6A A;  2XN9 C;  3CU7 A;  2E75 C;  1TVX A;  2JXM B;  3SK4 A;  4IFD G;  1F2M A;  3VYT A;  1PZI D;  1A6X A;  3VR3 A;  3R2I A;  1EWH A;  5KGU A;  2PQE A;  4A3M B;  3HRZ C;  4LK1 C;  5DEH A;  4C3H B;  2J4X A;  1RKN A;  3S1M B;  5C4H A;  1WTQ A;  4C3J B;  1BBX C;  1AZQ A;  1SE3 A;  5I6W A;  1CHP D;  3X3M A;  1GUT A;  2RVL A;  1PLF A;  4I7Z C;  2EY1 A;  5CV9 A;  4EGV A;  1I4P A;  1BQQ T;  1LV9 A;  5EKI A;  2EY5 A;  3C2P A;  4E6I A;  4GZY C;  1EU4 A;  1H9K A;  1L0X B;  3ERQ A;  1SFO B;  2F4I A;  1G29 1;  4HCE A;  1WTV A;  2ENB A;  1A2U A;  4H7B A;  1BO0 A;  3VR5 A;  1LTI D;  1PFN A;  1OXT A;  1C4Q A;  5EKK A;  4QMG A;  3HOV B;  1KLU D;  3QG1 A;  1JWU D;  2QKI C;  1G2T A;  1QCB D;  1II3 A;  1BR9 A;  4R8I A;  2BA0 A;  2F0N A;  4KHZ A;  3FKI B;  1EFI D;  3NPP A;  4A3J B;  3BVZ A;  1EL0 A;  1F2Z A;  1GUW A;  2D2C C;  1SE4 A;  3RUZ A;  5EPL A;  1T5E A;  3GTP B;  2BE5 D;  5E4W C;  4KV6 A;  2XIW A;  4KY5 A;  1ZXT A;  4MIU A;  4DFA A;  4NMZ A;  3CQZ B;  4BBS B;  4C3I G;  1QJO A;  3NWT A;  2C9O A;  5IT9 L;  5CR3 A;  4B9X A;  1MGS A;  2O4X A;  1Z6H A;  1R9T B;  1STG A;  2V4D A;  1GUO A;  3BS1 A;  1LTR D;  3DM1 A;  4IZ8 A;  2R93 B;  2E2H B;  3H91 A;  3KUP A;  1RD9 D;  2E2J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...