3P75A

Crystal structure of staphylococcal nuclease variant delta+phs v104d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALDRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3p75A00
1SYCA 4KD4A 4KY7A 3TMEA 5C3XA 2EYLA 2F3VA 2LKVA 2F0KA 2PZWA 4IALA 4F8MA 3PMFA 2F0GA 1KDBA 4G57A 3TP6A 4PMCA 4KTAA 1II3A 5IGGA 1EY5A 3P1HA 5EKLA 3U9OA 1EY8A 4I65A 1ENCA 5IIFA 3TP7A 5KIXA 1JOQA 2M00A 4NP5A 1KDCA 1EYCA 3H6MA 5CGKA 2F0VA 1JORA 1TT2A 3SR1A 4ZUIA 2EY1A 3D4WA 5JOBA 3HEJA 4IUNA 1STNA 1A3UA 1EZ8A 3R3OA 3VA5A 2EYPA 1F2ZA 4K14A 4LAAA 4PNYA 2HQEA 5ISRA 2F0SA 1A3VA 3MXPA 5HURA 1SYGA 4B9XA 2F0WA 2ENBA 1U9RA 3T13A 1SNPA 5CV5A 4ZQ3A 1EY0A 1F2YA 2F0PA 4PMBA 5CV6A 5F2DA 4DU9A 2NUCA 3S9WA 5C4ZA 4KV6A 2F3WA 4K8IA 2EYHA 5K5PA 1STYA 2RBMA 4KHVA 1NSNS 2RDFA 4KY5A 1SNDA 4RKLA 5C5LA 5C6AA 2EYFA 4NKLA 4N9PA 1TQOA 3OSOA 5IGEA 4YIJA 2EXZA 5I9OA 5E1FA 4ZUJA 4KJOA 3MHBA 3NQTA 3NUCA 4DFAA 5I6YA 1SYFA 1EY9A 3D4DA 4HMJA 3V2TA 4K6DA 3ERQA 5KRUA 2PYKA 3EJIA 4K5WA 2SNMA 4KY6A 1RKNA 3SK5A 5IGBA 2SNSA 5M9OA 1EY4A 1SYBA 3SXHA 4WORA 2KQ3A 4J1MA 5J39A 1EZ6A 3DMUA 2O4XA 1EYDA 3QOJA 5CV7A 4QB4A 5CV4A 5C4HA 2F0MA 3D8GA 3ITPA 3OMGA 4OL7A 3LX0A 4MIUA 4KJNA 2F0EA 2EYJA 5I9PA 2F0FA 2PZTA 4R8NA 5IGDA 3OMCA 4E6IA 2PQEA 2F0IA 3QB3A 3EVQA 3NP8A 4IZ8A 3TP8A 5HGTA 1KAAA 2EYOA 1KDAA 3BDLA 5C5MA 5DEHA 5JAVA 1STBA 3OWFA 4NMZA 3QOLA 4S3SA 3SK8A 4DF7A 4K2LA 4H7BA 5C3WA 5IODA 1A2TA 2OEOA 2PW7A 4ID6A 2F0NA 1EQVA 1TR5A 3NK9A 1EY7A 2RKSA 4J6HA 4KD3A 5CR3A 5CC4A 1SNQA 1SYDA 4TRDA 1SNCA 4RKBA 5E3FA 1IHZA 2EY5A 2F0DA 2OF1A 4QMGA 5EKKA 4EQPA 2OXPA 5KYLA 2SOBA 2F0JA 2PZUA 2WACA 3D6CA 2EY6A 4N9TA 5NUCA 4K2KA 3SHLA 3C1FA 3E5SA 4B9WA 2F0QA 3HZXA 2QDBA 4EVOA 1JOOA 1KABA 5CV9A 5KYIA 4K5VA 4EQNA 1A2UA 2F0TA 3MZ5A 1NUCA 4ME5A 3C1EA 3BDCA 3T16A 5KGUA 3EROA 3NHHA 5CV8A 4F7XA 5J22A 3RUZA 3DHQA 3MEHA 4K5XA 4K8JA 3NXWA 3MVVA 3TP5A 2KHSA 5KEEA 5J1ZA 4HTHA 3SK4A 1STHA 2EY2A 4NDXA 2F0UA 1SYEA 5I6WA 1ENAA 1F2MA 2F0LA 1EY6A 2F0HA 1STAA 4QF4A 1JOKA 5DAUA 5EGTA 5IOCA 4EQOA 4WRDA 1SNOA 3SK6A 4DGZA 5IGCA 3P75A 1SNMA 1AEXA 1STGA 2PW5A 5IGFA 1A3TA 2F0OA 2EYMA 1EYAA 4HMIA 4ODGA
chains in the Genus database with same CATH superfamily
2HCCA 4JBJA 3PIPA 1YJNA 4JI2L 1XNQL 4KTAA 4DV1Q 2JA5H 4QJFA 3K81C 4YCWA 2PQAA 2MQHA 2D62A 4LF8Q 4IO9A 4B3SL 1YNJD 4JI1L 4OWTB 4LF6Q 3I4MB 4LF7L 2WB1B 2ZJPA 4B3MQ 1UEBA 1V1PB 3A8IE 1A8VA 4L6TB 1CQFA 3FMCA 1GHJA 3QR8A 4A3IB 1U9RA 3W1GA 4ZAIA 1S4ZA 3J81L 1BBXC 1F2LA 4FP5D 3SVMA 5DLQE 1VQ6A 3HG9A 2FINB 3NPPA 4N9PA 3MHBA 3NUCA 1PXUA 3NELA 3T4AC 4HJ8A 1IBLQ 3UDFA 3HP3A 3ERQA 3F1ZA 4LK1C 1J8IA 2Z8LA 4G7ZC 2Q2UA 1SYBA 4ULLA 3UDIA 1IBKQ 5C4XH 1UUPA 2F0MA 3BZDB 3RLOA 2D0PA 4MIUA 3F2UA 3AU7A 1TWAH 5IGDA 4O42A 4A3BH 3BDLA 5C5MA 5A35A 4C3IB 2B2VC 4NMZA 3RLFA 4DF7A 3GV3A 4HIOA 4I7ZC 1LTRD 1A2TA 4ID6A 5LMUQ 2ICIA 4J6HA 1G51A 4WFN3 4DAYA 2K7VA 4G4KA 3RD4A 1V1PA 4B9WA 1B3QA 1MBYA 3S14H 1PRTB 4R8IA 3K5LA 4DR3L 2CW0C 1ILQA 1JQYD 1HRJA 2UXDQ 2J0TD 3BDCA 1DONA 2N55A 2LMCB 2R3ZA 3H94A 1LT6D 1Q3LA 2KOLA 3FHWA 1C8CA 5K36H 1HNXQ 2E2HH 4PMWA 1B70B 3SDZA 4OWWB 1H9SA 2F0LA 2XRQD 4YWMA 2C35B 3GTPH 1I4RA 4RG1A 1MI2A 5FLMH 1C4QA 2MNAA 4FDBA 2HHHQ 4C3HH 2TSSA 3QG1A 4ABNA 5E4XA 4A93B 3PV0A 2VUMH 4HMIA 4ODGA 5IP7H 1G291 3ULJA 4KY7A 4IUUA 3W2DA 1WD1A 2Y0SE 1SJHD 1TS4A 4C3HG 1O7ZA 4A3DH 1ASZA 2F4IA 2OTLA 1YHAA 4X6AH 4R4TA 5CGKA 3GTJB 1JORA 1NMGA 4KLKA 2Z0SA 2DNCA 3PUYA 5FO9B 4JVZA 1JT8A 5KNDA 4B9XA 1HNZQ 1SROA 3GTQB 3RNUA 3I4NB 1RJTA 2NTSA 4RKLA 3F2DA 3H0GH 4X62Q 1BQQT 4RGTA 3TN2A 1VQAA 2A6HC 2E2IH 3S16H 3GQBA 1PV4A 1E2VA 4M1UB 5IP9H 1EY4A 3N6RA 2EJGC 4POGA 1XJVA 2MHVA 1JWMD 1TWFH 1EFWA 4EX5A 3OMGA 4C3HB 1K73C 1HZCA 1MKHA 4KJNA 2IY5B 5GADC 3UDGA 3KBGA 4CDFC 2AMCB 1HPCA 5T1GA 3J80E 5JAVA 2PMZE 1Z47A 1J6QA 2CHBD 5C3WA 4IFDH 3NK9A 3KBXA 2ZJRA 4R9WA 3HOZB 1IL8A 2EY5A 1LTTD 1CKMA 4XQNA 1LT5D 5K36G 2FMMA 4N9TA 4IFDG 3E5SA 1MIUA 3GTPB 4L5SA 3J7A5 1KABA 3E9HA 2NVTH 4BBRH 1I4HA 4JI7L 1I94L 1SFOB 1XX8A 1ENFA 4JOIA 2IWHA 2B39A 1K8AC 5BN5A 2B63B 4L8JA 3K5OA 1W6JA 2Z4IA 5IT9E 1KRTA 3CD6A 5IP7G 3TP5A 5J1ZA 2EDGA 3SK4A 1HQMC 4RCNA 5JJZA 3RR5A 1PDQA 4EQOA 3GTJH 1VQFA 2B2TC 5IGCA 5C3EH 1B9MA 1A3TA 4LF9Q 3K59A 4KHPL 2VY3A 3PF4A 2R6GA 3HS0C 2F0GA 4JBWA 5C4XG 1LUZA 5LMUL 3DWQA 2VUMB 2B2WC 3HOYB 3HOWB 2K5WA 3H0GB 2CWAA 1G2SA 4HEDA 4KHPQ 3MC0B 4IUVA 2B29A 3QO2A 2XSCA 3BDOA 1TWHH 4KN4C 4OHJA 5C44B 5ELEA 4HR7B 1X3GA 2ALYB 1Y1VB 3M7GA 1F9SA 1YVCA 3PO2G 4A3EB 1NBWA 3G6JB 1VCIA 3E0EA 4KY5A 1I5FA 3VYSA 1CT1D 3AYHB 2KBNA 5L37A 1K28A 1WOCA 1BBUA 3GTGB 1F77A 2PYKA 4U673 3OOCA 1IBML 1FGBD 2VQFQ 2BA1A 3SXHA 2OTJA 2KQ3A 4DNRB 3GP7A 2O4XA 3Q22A 1VQ4A 4A93G 1N8RC 1J5EQ 2JA9A 4RAUC 1X3FA 1VQKA 1D1KA 2KVMA 2IW3A 3L9AX 3M4YA 5IYBH 4R8NA 2L15A 4RA8A 4GKJQ 4X3UA 1XXGA 3TEHB 2QF7A 3TDQA 1C0AA 1KDAA 3TREA 4JPBW 4FF1A 1K9MC 5COYA 3RZDH 1JR0D 3EFXD 2RKSA 3PO3G 5A2QE 2GVAA 5CR3A 4GKJL 4H44C 4U68A 4POFA 2HDLA 1HNZL 1PH4A 1RDPD 3FKIB 3LWEA 2F0QA 2LY7A 3S2HH 1WJJA 1QB5D 3ONAB 1NE3A 3T16A 4R4QA 1H9RA 2WKDA 2P5ZX 3HOWH 2DNEA 1ZYRD 1XPRA 1IL2A 4K6LA 3Q8DA 1NCVA 3PF5A 2L5TA 1G6ZA 1ZYRC 2DUDA 5EJWA 3U4ZA 4NDXA 4DUYQ 2F0UA 4JI4L 4BY7G 4X3TA 2H5XA 4DV5Q 2R7ZG 2CVRA 2CCZA 2MFIA 1E3PA 3NEMA 1I50H 5M5WH 4F87A 2PO4A 2PZWA 2IJ0A 4X66Q 3LNNA 4BY1G 4GLVB 1EY5A 3ND9A 3P1HA 4OELB 3M4PA 1HUMA 1VQIA 3W5OA 1VQLA 4DNIA 2QA4A 4JI8L 3PGZA 4LF5L 1PLFA 4PQXA 2E74C 1S72A 1NTGA 3HKZB 1STNA 2OQKA 4JI7Q 2D2CC 4LAAA 4PNYA 4XXEA 4AYBB 4FF4A 2C9OA 1DYQA 3ZJYC 1X3QA 1SE4A 3C2PA 2RSOA 4L5TA 4RGMA 3CPWA 1GJXA 1JWSD 1PVOA 3S1RH 1TWHB 4KMUC 2EYFA 5JJIA 4JI4Q 1S5FD 5TSSA 4DFAA 3VR2A 1EY9A 3DWAA 2Q2HA 4H0LC 1HJPA 5FLXL 1CZWA 4LFAL 3GDEA 4JW0A 3CAMA 1WTVA 1EYDA 1TWFB 4A3FB 1N32Q 1TXYA 2L9HA 1ET9A 2JEBI 3DM3A 1B4OA 4QIWE 2CW0D 1IBLL 3QB3A 1VQ8A 1UAPA 3FP9A 1STBA 3S24A 1E2ZA 3A7AB 3BJUA 3L0OA 1EQVA 3F8TA 4JYAL 1PH2A 2N8NA 5GAEC 5FLXc 2ID0A 2LFNA 2F0DA 1DOMA 5KYLA 2RF4A 3H0GG 2EZVA 2PZUA 3I4OA 1UE7A 4F88A 1O7IA 4ILWA 4BY7H 3S1MB 1EWIA 4DV4L 2K50A 4EQNA 1X6OA 1WCMG 4JI5Q 3CP0A 1P16A 1X54A 4KI0A 4OGQC 3S2HB 3NE5B 3CCVA 3RUZA 1O78A 1VQDA 1Y14B 3GTQH 1CI3M 4BBSG 2A68D 4BXXH 4MN3A 4BY1H 2QGQA 2PNHA 2VL6A 4DR3Q 4LF4L 4WRDA 1Y8OB 1Z6HA 2PPBC 1KRSA 1X3PA 4DR2Q 1SJED 5GAHC 1STGA 2MP1A 2LXKA 4DR1L 4A3MB 4CDEC 3X3NA 1UEAB 1CQVA 3KYHC 2UXBQ 4H02A 4IALA 1XYIA 2BE5D 1KQSA 2EIFA 3GTLH 4BA1I 1KD1C 4BBRG 5IYBG 4R4OA 5FJ8G 1Y69U 1TT2A 2A8VA 3MXNB 2EY1A 1GKHA 5JOBA 1F9QA 4JBMA 1A3UA 2K03A 4AYBG 1YZ6A 1WTRA 2M2LA 2MGSA 2NWGA 2K14A 1SLJA 2F0WA 1DZ1A 2R93G 5LL6X 4PMBA 2K5QA 4R4CA 5FLXE 1JICA 1STEA 4K8IA 1UWVA 3Q23A 1SNDA 4YCVA 5IGEA 5I9OA 1YNNC 4A75A 4N8X1 2B8GA 1WD0A 2YU9H 4HMJA 4DV3Q 2NVYB 3PIO3 4DR4Q 2NVXB 1HFGA 4WORA 2MPMA 4LNQA 3CC2A 3ITPA 4JI6Q 4C3IG 2EYJA 4RHRA 2R7ZB 1V9PA 3NENA 4HCSA 4LJZC 2XN9C 4MNOA 3S17H 1ET6A 1ESRA 5ELBA 2YV5A 2DGYA 2KCTA 4IOAA 1TR5A 4IPDA 3I4NG 1WCMB 5E3FA 3V96A 1JE5A 4A3MH 3C1FA 5GROA 1CSPA 2CQAA 4DUZL 2OT2A 3R2IA 1U4PA 4AYBE 1I3QB 1Q1BA 3MWYW 3VYUA 3I4LA 3KOJA 1RCVD 2NN6H 5E7NA 4O1NA 5ELNA 2JA6H 1H9KA 3C46A 4C56C 1PFSA 5IWAL 3B6YA 3CC7A 2HUGA 1JOKA 1TY2A 1I94Q 1DJRD 4N8FA 3NBHB 1BKBA 1AEXA 4GOPA 3K58A 2EVBA 2NZHA 1YEZA 3CXCA 3Q0AA 3OPOA 3KF6A 2E2HB 1FNVA 3TP6A 2BOSA 1EL0A 1EY8A 3BVMA 4CJ1B 4LFBL 1IKLA 2E76C 1KDCA 4RGOS 2Y0SG 3S15H 2O5IC 4R1JA 1QVGA 4IUNA 1ESFA 2K28A 2ZTCA 1DGSA 2QDLA 4HSVA 3R93A 5HURA 4YY3Q 1ICFB 1WTPA 1Y8NB 3RZOH 3QJYA 1SE2A 4CKEA 3HOUG 3GTKB 2O2LD 2WFWA 1NMFA 1NSNS 1TU2B 2UUCL 3AFQA 3NQTA 3HOUH 4B3RL 4DR6L 2NZ1D 3IFTA 1QJOA 2G9HD 3JAMi 1X9NA 1EZ6A 3OHXC 3I72A 5BN3A 3OTOL 1SMYD 3HOVH 4ZK9B 4DK1A 2CKZB 3EQLC 4CDCC 2IX3A 1RL2A 1I3QH 1PFNA 2PZTA 4XQJA 1TWCB 1QUQB 5DNFA 4HIMA 3NBHA 4IZ8A 1Y8PB 5A2QL 4A3MG 3CQZB 1HR0Q 5ELOA 3HOVG 3STBD 4GN5A 4LUZA 4DV2Q 1PFMA 4TRDA 4RKBA 3T53B 1IHZA 2WAQG 2F0JA 1RODA 3PSIA 1R9TB 3GTMH 3KJPA 2B2VA 3M9BA 3GTOB 3RMHA 1WTXA 4QUCA 4DV7L 4NW2A 2R92G 1BO0A 2ZXPA 3IL8A 2JK8A 2ZJQA 4DAYB 4EQ5A 1W6KA 4DXGA 1EUJA 3MEHA 5JEAJ 3F2CA 1N34L 1GUSA 5GQOA 3KLSX 3VA7A 2EY2A 1HZBA 4DXFA 3SK6A 3S15B 3MXNA 4DNTB 4AIMA 3ZYYX 3HOVB 2EYMA 1I4XA 5I2XA 3QWNA 1WTHA 3TMEA 1TWCH 2EYLA 1KC8C 4DAMA 2VZAA 5EAYA 3M4OH 4B3TL 1PA6A 1BOSA 1JOQA 2M00A 5J3BA 1DD2A 3VR5A 5M3MG 4DV6L 1PHJA 3KLRA 3HOUB 2Z4HA 4JC0A 2WKCA 1GHKA 1LT3D 1TWGH 5LL6S 1PTOB 3P7JA 4B3ML 4K14A 3M4QA 4GNXC 4XYOA 3JC66 1KNAA 1QILA 3WDNA 1B8AA 4UP8A 4HJ9A 4QCLA 3D6WA 2MUYA 4NXNQ 1CUKA 1AFPA 3CW2C 4KHZA 4KV6A 2F3WA 1AZQA 3AEVA 5E1FA 1EQTA 1GUTA 4YHHL 1ASYA 2DN8A 3K80C 2BDOA 3H15A 3S1NH 1PTOC 4K5WA 1B53A 3PQIA 1L1OC 1U4LA 3U50C 2BH8A 2YTXA 3PUZA 1ZKOA 3I91A 3IKJA 2E2DC 4QB4A 1K3RA 1N32L 4H13C 4OIJA 1VF7A 2F0EA 1S3OA 3OWEB 3AMUA 1M4VA 2JQOA 1OTCA 2XGTA 1SMYC 2Q2IA 4LF7Q 2F0IA 1IW7D 2VS1A 4NXMQ 2Z9HA 2JA8G 4JG2A 4DV6Q 1ILPA 2R93H 3T1YL 1CHPD 2KENA 2F0NA 5D3IB 1EY7A 3J80L 1WYDA 3T56B 4DN4M 2R92B 1QZGA 2OF1A 2PI2A 1CHQD 3TRZA 2SOBA 5LMNW 1SRUA 2WAQE 3D6CA 5IYDH 3CCSA 1QCBD 2QDBA 2JA7H 5EBCA 2B2WA 2NZOA 2OCEA 4FXGC 1XPUA 1AH9A 3FPUB 3C1EA 2VB2X 5C0XJ 4CHTB 5J22A 3E6ZX 1ML0D 4RMFA 4LFBQ 3K7AB 2WIIB 1LACA 3CRLC 2JXMB 1R4PB 4HJ7A 4C2MB 2WB1E 1HXYD 4DV4Q 1S5CD 4IPCA 1BF4A 1Z9FA 2F1MA 1OXTA 2ZT9C 3RN2A 1M1KC 2A69C 2B8FA 2I5MX 3VR4A 3D4RA 1HUNA 3CCEA 3PUVA 1MGSA 1K8OA 4LFCQ 1Y1WG 3SE0A 2E2IB 2XWJB 2EXDA 1KAWA 3HGBA 1PYSB 4QL5A 1EIFA 3H3VI 2K32A 3TP7A 1PRTD 5CMDA 1VMCA 1JJ2A 3IRBA 2PQAB 2FHTA 3CCJA 3K5MA 2Z6BA 3GD7A 4GN4B 4TSSA 1F2ZA 2IX1A 2UUBL 3F2BA 4GNXB 4BA2I 4DU9A 3L7ZC 2F0PA 2R7FA 1BBWA 4TVAB 4DR5L 4LUVA 1JE4A 1X56A 1JCKB 1FL0A 1QG7A 4P71A 1AZPA 1PH9A 4DUYL 2HIVA 2EXZA 1GOZA 3LGJA 1N33L 1RTNA 5BR8L 3CU7A 4A3LH 5C4XB 3Q6SA 5M5YB 1XPOA 3EJIA 2SNMA 1RKNA 4HAEA 2SNSA 5M9OA 4DR5Q 2UXDL 3OIQA 2H1EA 1RTOA 3W3AA 3A74A 5CV4A 3URYA 4OL7A 2YTVA 4C1NI 4PV1C 2L4NA 1IBMQ 3EN2A 1GUWA 3K6OA 1YITA 4FNFA 3TP8A 4RCOA 5T1IA 4MHEA 4IFDJ 1LABA 3K7AH 2UU9L 2OEOA 3I4MH 2R93B 4C3JH 3SHLA 5AJ3L 1QUQA 1G91A 4XDXA 4IUQA 1VQHA 1HNWL 1XMOQ 1NUCA 1FGUA 2AWNA 4JI1Q 1LTID 4X65Q 1N33Q 5CV8A 4GZYC 2EJFC 1L0WA 2H4OA 4DV3L 1IYVA 2ATWA 1HTLD 2KHSA 1YJ9A 1STHA 5I6WA 3CQZH 5EPLA 1F2MA 1PH8A 1VQOA 4JI6L 2RQXA 4NB3A 1GUGA 1SNMA 2AQ2B 2HIXA 3OIPA 5IGFA 1YHQA 2A74C 2F0OA 2PCFB 3BVZA 1MJEA 1NR2A 1MD2D 3MFYA 1X3EA 1LTBD 2E8GA 2EPBA 3PMFA 4X3KA 3T1YQ 2QEXA 4PMCA 1PTOD 3GTGH 2K1BA 4J8QA 1MSGA 3H6MA 3FEWX 4UAIA 2E2JB 1B2TA 2FJ2A 1Y1VG 2JA5G 3D4WA 5AJ3Q 1EZ8A 3I55A 3Q24A 1VQCA 2UUAL 2FFKB 5C44H 3HOXH 2EQSA 2N3SA 4A3DG 1Y1VH 4QY7A 4JI3L 1U0LA 4FXKC 3RZDB 3I90A 1I4PA 4A3GH 1KLUD 5IYDG 4FO2A 5I2YA 2GVBA 1N36Q 4ZUJA 3H91A 2IL8A 5I6YA 2B2UC 1B44D 3V2TA 4JI2Q 1WVLA 4HSPA 3S1QH 5EKIA 5M5XH 4JI3Q 3T1HL 1PH7A 2RSNA 3HOWG 4QIWB 2ZXOA 5FO7B 2GN5A 3DEPA 4IURA 3TSSA 1WFQA 1TIID 4LF6L 2HDMA 2IX0A 3NP8A 4YCUA 3E0JA 3G6EA 5DEHA 4S3SA 1BCPD 2XTIA 3OWFA 3OW2A 1PTOF 1VF5C 1JMCA 1E22A 2A73B 3FKIG 1GM5A 2PW7A 3NWTA 3OW7A 2V4DA 4ZLTF 2HD3A 1Y1WH 3PO2B 2A69D 3WOFA 5M5WB 1LTLA 3DXJC 5H1SE 3BVGA 1LYLA 3S1NB 1E1TA 1GVPA 4DR1Q 3BZKA 3CMEA 4AQYL 1JOOA 1K0SA 5D65A 1P8LA 4B08A 4RWSC 1YHBA 5JJKA 4ME5A 3G71A 4DV2L 2I07B 3KK7A 3HKZE 2Q8RE 4DR6Q 1VQJA 2G9DA 3CPFA 1TS2A 4XT1B 2L12A 1WI5A 2F3IA 1OXXK 4R4IA 1E0BA 1QOHA 5JJLA 5EGTA 4KKTA 3RN5A 4A3LG 1Z7TA 2I46A 2UUBQ 1CSQA 3H3VH 2PNRC 3HOYH 4XTCS 4K0KQ 3PIP3 2B63H 1UE1A 1TKWB 3AQQA 3EIVA 1BCPF 1II3A 1I6HB 3OYYA 1XTCD 1E24A 3NTIA 1NJIC 2M9VA 4WJ3M 1SR3A 2WAQB 5ELDA 1HCZA 3TS0A 1DXMA 4BS9A 2JA5B 2CQOA 2F0VA 3G48A 1QE6A 1LLRD 4K0KL 1Q86C 3A55A 4C1NK 2EJMA 2X6LA 2Z6KA 1IXRA 1O80A 1SYGA 1SNPA 4M8AA 1F2YA 3IAYA 1G2TA 2NUCA 4APVA 1L0XB 2EYHA 5K5PA 1STYA 1N34Q 4KHVA 1MSHA 4KN7C 1A62A 4PZ7A 1E2WA 3LWUA 1WTWA 2QW7A 3BS1A 2HCIA 1GXDC 1LV9A 3V05A 4K6DA 1RF2D 4DPGA 3G4SA 1D5XC 1XNRQ 3TZDA 3U9SA 4CKCA 3PO2H 2Q8IB 4A76A 1Q90A 4DUZQ 2EOTA 1Q46A 4LMQD 1YIJA 5CBEE 1KIXA 2RCNA 5FKAC 1KTKA 3J81c 1KAAA 1XTDA 4IQZA 1BXTA 1L1OA 1BDOA 3M85A 1A63A 5LMNL 1LO5D 1GUOA 3X3MA 1FR3A 2NTTA 3NTKA 4CJ0B 2UUAQ 4X66L 3KF8B 1D5ZC 4FXDA 4ZCKA 1YBYA 2KECA 3S1MH 4FF2A 2E5LL 1Q8IA 3L2PA 4L5RC 3T51B 4HIKA 4LF8L 4B3SQ 4A3EH 5EPJA 4L5QA 4IUPA 3S14B 1ONLA 4UHVA 1EEFD 4A3DB 2BCOA 1K83H 1CM9A 2F4VQ 2VUMG 1CTMA 2RHQB 3MVVA 3NBIA 3HOYG 5M3FH 4DR7Q 3S2DB 5KNBA 3CCRA 1MHWC 1R4QB 3R8BA 2A19A 1K0RA 3A5ZB 2LS01 4G7OC 4X3SA 4LF9L 4GOPB 1A0IA 3ICEA 1U4MA 2YYZA 2C5CA 4V0BA 2XNAC 5CYUA 1L2FA 3D31A 1B50A 4MTNA 1PTOH 1NAPA 3PCOB 2F0KA 5LHY1 1U4RA 4C3JG 4G57A 3U9OA 2UXCQ 1YNND 4GOPC 4NP5A 3J7YW 1FNWA 1D1IA 3JAME 1DOLA 4HJAA 3VDYA 3HOZH 2ASBA 2L1BA 1LM0A 1NNXA 2XIWA 3VA5A 1M90C 1T5XD 3FKIH 2JEAI 2EYPA 4Y7NB 4HIDA 3KFUA 2SEBD 4ZQ3A 5IWAQ 1PZKD 3MFGA 3O13A 4XQQA 5C4ZA 1V1QA 1FNUA 1G8ZD 1PYWD 4LW1A 1LTGD 3CF5A 4KJOA 3HKZG 4ZKBB 2UXBL 5BN4A 1C48A 2R7DA 3IFDA 4L63B 3ER0A 2K5DA 5E4WC 5J39A 3D8GA 2FXQA 2K05A 1X32A 1CKOA 4RFBA 4IUTA 4E6IA 3S1RB 1VQEA 3STBC 2K6AA 2FMCA 2UXCL 1PMRA 2CH4A 3QOLA 1FYCA 5C44G 3FDTA 5JVH3 1SSOA 1PRTF 3NTHA 2A6HD 1VQ9A 2L11A 1EFID 3H09A 2B63G 1DOKA 1I4QA 4A3EG 3K5NA 1SNCA 1ZXTA 1XNQQ 2WACA 1Q1EA 1KXLA 4EVOA 4DAVA 5C3EB 3UE0A 5KYIA 1D6EC 4IJLA 5IT9L 3JAMc 1VQ5A 2ICEC 1A15A 4IJHA 4A4IA 5EQ0A 3ULPA 1JB7A 3GV6A 4X65L 5AFWA 3NXWA 2ZM6Q 4OONA 4UP7A 5G3LF 4EGVA 5KNCA 4C3IH 1VS0A 4QF4A 1HZAA 3A7LA 3BYTB 2HHHL 3S2DH 2RDHA 1L0YB 2PW5A 2I5HA 1PRTC 5C3XA 3DUZA 5IT9c 5IP9G 1PYBA 2LKVA 2ES2A 2A6ED 4PZ6A 3PUWA 4BXXG 2JSOA 2ZTEA 4P72A 4YHHQ 5IIFA 4A3CG 3GTMB 3WOEA 4DK6C 1HA6A 1EYCA 4JOIC 1SDFA 1KLGD 3NQIA 4Q5VA 1EOVA 2VB3X 3SR1A 1XWEA 1YNJC 3TZUA 3I2ZA 4A3CH 1S5ED 4RHSA 1N9WA 5ISRA 3J7AF 1EIGA 3K0XA 3E3XA 1O7LA 1BVSA 1S5BD 2IT1A 4UY8C 1VQ7A 2MO1A 2RBMA 4A93H 2NVXH 4DR7L 4KK7A 4X62L 2CFMA 1BUVT 2I0QA 3K7UC 3NWSA 2IHFA 3KLWA 4IPHA 4ZKCB 3GTLB 2A1AA 2UUCQ 4OX9L 1SN8A 1M8AA 3J81E 4BY1B 5FK9C 1AW7A 5IE8A 1EWCA 3CRKC 4UDUC 5C0XG 3I3CA 4J1MA 1T9HA 2WP8J 3DMUA 3QOJA 2YTYA 3VYTA 4QGUA 3T1HQ 3LX0A 3K0YA 3OTOQ 1T5EA 2F0FA 1BR9A 2K01A 4ALPA 3VR3A 2D9UA 4JK1C 3EVQA 4A3KG 2VXWA 4JYAQ 4DKAC 4Y52H 3SK8A 3KDFB 1HR0L 4H7BA 2KJXA 5ELFA 4KD3A 1IKMA 5CC4A 2F52A 4EQPA 2XVSA 2DJGC 2A6EC 4JV5L 1CKNB 5NUCA 3M7NA 1RD9D 3GTOH 5FOBB 3MXGA 4K5VA 2Q8TA 3TS2A 1DM0B 1SEBD 3HOZG 1SFOH 3R2TA 2R7ZH 2K5NA 1H9JA 5I4DA 3EROA 2PMZB 5GAGC 3M3YB 3NHHA 5BR8Q 2LXJA 4F7XA 3KF6B 4K8JA 5G3LD 5ELCA 1WCMH 3J80c 1F9PA 1SYEA 2VNUD 1EIYB 1I4GA 5DAUA 1HA5A 2VW9A 4BBSH 3U4VA 4RH6A 1EYAA 3I8ZA 2NN6G 2JA6G 4LF4Q 2NB0A 3C3LA 2N78A 3A0JA 4UPAA 4XT3B 3HOXB 3PUXA 3FRPB 4P2CB 3UDXA 3M4OB 5EKLA 3D0FA 4B3TQ 1YNXA 1IYJB 5KIXA 1HNXL 4LFCL 3CCUA 5IYCG 2I5LX 1LT4D 2A5HA 3I7FA 2O5JC 4UP9A 4ZUIA 4CJ2C 4G7HC 5JPNC 3GTKH 4HCEA 3J81j 2AHOB 2Z1CA 4OIKA 2WINB 2F0SA 1A3VA 1O7YA 4A3FH 5CV5A 2JJQA 4P74A 2WB1G 5F2DA 3MAQA 1Q82C 1I6VC 5C0XH 1Q81C 3EBEA 2N88A 2RDGA 4C2MH 1CZGA 4MTKA 5C3EG 5C5LA 4A3IG 4DR4L 5C6AA 4BBRB 1QVCA 2UU9Q 1EWHA 1PH1A 3P20A 4PZ8A 4JI0Q 1K8MA 5FO8B 1JJCB 1CKNA 1VQPA 4P75A 2J4XA 2L0CA 1VDZA 2KA7A 1PH5A 4OO1G 2AUKA 2KHIA 4GKKL 4XYQA 5M3MH 2KUMA 4OO1H 4LWCA 4CBVA 1B7YB 2ZM6L 4V190 3MEFA 1SBBB 3RLNA 3SEBA 5EBDA 3DEOA 1SYDA 3S9WA 4IN3A 4QMGA 1HR0W 1EU3A 1TWAB 5IOCA 1D5MC 2EY6A 2R61A 4K2KA 1HHVA 3H3VC 2JA7B 3CC4A 5CV9A 5HY6A 3I73A 4JI8Q 4LF5Q 4LFAQ 1N36L 1HZ9A 4JI0L 2NVQH 1ICWA 1OXVA 3A54A 4GNXA 2F4VL 3QIAA 5CBAE 1LTSD 1JWUD 4OEMB 1PH6A 1EYGA 1FD7D 2NVYH 3M3YH 4NXML 1B9NA 1K3BC 3TBIB 4BWGB 2K52A 1VQGA 1SNOA 3P75A 2B2YC 5DM73 5C4JH 1IBKL 2EE1A 1R9TH 3PO3H 1AE2A 2X69A 2F3VA 1HQRD 5IY0A 2DJFC 1GUNA 1CA5A 5IGGA 3J80i 2GA4B 5LMNQ 5M5YH 1E7ZA 4HN7A 2YU9B 4A3FG 1GD7A 2BA0A 1U5KA 1TWGB 4I65A 1ENCA 3KUPA 3VYRA 1W3SA 4YWLA 4FYDA 4YY3L 4GN3B 1S40A 3CCMA 4AQYQ 4OXPA 3R3OA 1H9SB 1ZEQX 4DK0A 2A68C 2RCFA 4P73A 5IODA 2KHJA 1QVFA 2K4KA 2K04A 2Z6KC 5M3MB 2RDFA 4A3JB 1UE6A 3CKIB 2N49A 2G5DA 2K5VA 1PZID 1SYFA 4C3JB 4MZ9A 5IGBA 5C0XI 2HT1A 4CGYB 2NBFA 2KCMA 4JV5Q 2QKIC 5CV7A 3FPPA 5C4HA 1DCZA 1RIPA 5JEAG 1EOTA 5C4JB 3CCLA 2MO0A 1AE3A 4RGNA 3K8AA 4CKBA 4LUOA 3OMCA 2JE6I 5EPKA 2EYOA 3KF8A 1TS5A 5D14A 4K2LA 3GO5A 3WWVA 3DM1A 3I70A 4YWKA 1OXSC 4ME3A 2AQ1B 5CORA 2XWBB 1L1OB 3MXUA 4GS3A 4KKSA 4DV7Q 1EU4A 3HKSA 4IPGA 5JVG3 3HZXA 4A3JG 4HJ5A 2JA8B 3HFZB 1A2UA 2F0TA 2KEEA 4WJ4A 1SMXA 3MA2B 4GLAC 1TS3A 1S5DD 2RHSB 4A3JH 3ND8A 1D7QA 3BU2A 2R92H 2L55A 4Z9CB 4A3KH 2F0HA 2IHEA 1RHPA 4A3IH 3DLLA 2NVTB 2D5DA 3UE1A 1NR4A 1EIHA 4WJWA 1HFNA 1UNSA 4KKUA 2XRSD 2NN6I 4A3BB 2VQFL 1H95A 1XMQL 4A3GB 4KY6A 1UE5A 2DY7A 1H9MA 2RVLA 3PIOA 3A8JE 5M3FB 1KDBA 1JJGA 1X55A 4TQUS 1J9OA 4X64L 3W1BA 5M5XB 1OXUA 4DK3C 3FVQA 1V8QA 3AFPA 2SDFA 4DA2A 3N52A 1V43A 3L3OC 1V1OA 2K5HA 2E5LQ 3HEJA 1NY4A 3SGIA 1K8GA 2OWOA 1PFBA 2HQEA 1FJGQ 4GKKQ 2ZTDA 2AKWB 2ENBA 4DV0L 5CV6A 4ZRZA 1YI2A 1JB3A 1TVXA 1KL9A 3J7AV 4NKLA 5JEAH 1TQOA 2RA4A 1BCPC 3OSOA 1SE3A 1SAPA 3UI2A 1VQMA 4AH6A 2VQEL 5KRUA 4A3KB 1QNUA 2DY8A 3SK5A 4DV0Q 4JI5L 3K57A 1XMOL 4OO1I 4XIGS 1FVIA 1G6PA 1B3AA 1BCPB 1IYUA 3DWPA 2JA8H 2NYZD 1LTAD 5IYCH 5FJ8H 4QUFA 2PQEA 3A5UA 3S17B 5HGTA 4X64Q 4IOCA 4BBSB 1C7YA 4O2DA 2QILA 2LSSA 1VQBA 2K75A 3ERSX 3G7LA 5FLMG 4DV1L 2OQ0A 1Q7YC 1QWYA 3BG3A 5DM63 1KHIA 1E1OA 1IW7C 4I7AA 2J7ZA 3HRZC 2BE5C 2IPKD 2HQLA 1OO9B 4JBKA 1PH3A 1VQNA 3MZ5A 2KCNA 2Y0SB 5JPMC 4JCVE 5KGUA 2KEDA 2X6GA 3CMAA 1Q8KA 4OX9Q 4PG3A 2NVQB 4Q0FA 3DHQA 2MJ8A 3A56A 1AP0A 1CFMA 5KEEA 4HTHA 1PZJD 1TY0A 1EQRA 1ENAA 1YJWA 2BDNA 4DGZA 4FVMA 5D3DA 4OWXB 4A3BG 2PI2E 2QEJC 1HH2P 3I4NH 1J5EL 1SYCA 4KD4A 2B2UA 4B3RQ 3JAML 1SXTA 4F8MA 2JN4A 1C9OA 2B2YA 3KJOA 2E2JH 3ULLA 3S16B 1I6HH 3CCQA 5HGQA 1X65A 3KLSA 3BYYB 4NPSA 2ZXRA 1I50B 2Q2TA 2AWOA 1EQQA 3MXPA 3T13A 3MTSA 1K83B 1EY0A 1CA6A 3RZOB 1GO3E 3KDFA 1D8LA 2CH4W 3PO3B 4TKOB 1IZ6A 3J7ZC 4YIJA 2WV6D 3U58A 2B2TA 3D4DA 3BZCA 3HOXG 4FF3A 2V1CC 3E9IA 1HNWQ 4O0AA 1Q12A 3J81i 3TQYA 2B3GA 1XMQQ 1BNZA 2JA6B 1MJCA 4A3GG 1SE8A 1QZHA 1VMPA 1F9RA 4DV5L 3AB9A 4DR2L 2JYOA 3EA6A 5M3FG 2F03A 4BY7B 1D2BA 2JA7G 1B1ZA 3VR6A 4Y7NH 1WTQA 1HTPA 4GLXA 1SNQA 1KNEA 4DAPA 3CHBD 3S1QB 5EKKA 4QQBX 2OXPA 1WTOA 5I9PA 2AQ3B 1EEID 4J15A 1AN8A 4IFDI 2BH2A 2JP1A 1XNRL 3I4MG 3NSWA 2KCCA 2AUJD 2D0OA 1A6XA 4CDDC 4ZYSA 2VQEQ 2K33A 4K5XA 3A8KE 1Y1WB 2TMPA 1W2BA 3D3RA 1CK1A 3I56A 1EY6A 2E75C 1STAA 4NXNL 2CWPA 1QNKA 1FJGL 2QCPX 1JC7A
chains in the Genus database with same CATH topology
2HCCA 4KTAA 2D62A 1YNJD 3I4MB 2WB1B 1V1PB 3A8IE 4L6TB 1CQFA 3FMCA 1GHJA 4A3IB 1U9RA 4ZAIA 1S4ZA 3J81L 1BBXC 1F2LA 4FP5D 3SVMA 3HG9A 2FINB 3NPPA 4N9PA 3MHBA 3NUCA 1PXUA 3T4AC 3HP3A 3ERQA 4LK1C 1J8IA 2Z8LA 4G7ZC 1SYBA 4ULLA 1UUPA 2F0MA 3BZDB 4MIUA 3F2UA 3AU7A 5IGDA 4O42A 3BDLA 5C5MA 5A35A 4C3IB 2B2VC 4NMZA 3RLFA 4DF7A 3GV3A 4I7ZC 1LTRD 1A2TA 4ID6A 2ICIA 4J6HA 4WFN3 4DAYA 2K7VA 4G4KA 3RD4A 1V1PA 4B9WA 1MBYA 1PRTB 4R8IA 3K5LA 2CW0C 1ILQA 1JQYD 1HRJA 2J0TD 3BDCA 1DONA 2N55A 2LMCB 2R3ZA 3H94A 1LT6D 1Q3LA 2KOLA 1C8CA 5K36H 4PMWA 3SDZA 1H9SA 2F0LA 2XRQD 1I4RA 1MI2A 1C4QA 2TSSA 3QG1A 4ABNA 5E4XA 4A93B 3PV0A 4HMIA 4ODGA 1G291 4KY7A 4IUUA 3W2DA 1WD1A 1SJHD 1TS4A 4C3HG 1O7ZA 2F4IA 5CGKA 3GTJB 1JORA 2DNCA 3PUYA 5FO9B 5KNDA 4B9XA 3GTQB 3I4NB 1RJTA 2NTSA 4RKLA 1BQQT 4RGTA 3TN2A 2A6HC 3GQBA 1E2VA 4M1UB 1EY4A 3N6RA 2EJGC 2MHVA 1JWMD 3OMGA 4C3HB 4KJNA 3KBGA 1HPCA 5T1GA 3J80E 5JAVA 1Z47A 2CHBD 5C3WA 4IFDH 3NK9A 3KBXA 3HOZB 4R9WA 1IL8A 2EY5A 1LTTD 4XQNA 1LT5D 5K36G 2FMMA 4N9TA 4IFDG 3E5SA 3GTPB 1KABA 1I4HA 1SFOB 1XX8A 1ENFA 2IWHA 2B39A 5BN5A 2B63B 4L8JA 3K5OA 1W6JA 2Z4IA 5IT9E 3TP5A 5J1ZA 2EDGA 3SK4A 1HQMC 4RCNA 5JJZA 1PDQA 4EQOA 2B2TC 5IGCA 1B9MA 1A3TA 3K59A 2R6GA 3HS0C 2F0GA 4JBWA 3DWQA 2VUMB 2B2WC 3HOYB 3HOWB 2K5WA 3H0GB 1G2SA 4HEDA 3MC0B 4IUVA 3QO2A 2XSCA 3BDOA 4KN4C 4OHJA 5C44B 5ELEA 4HR7B 1Y1VB 3M7GA 1F9SA 4A3EB 3G6JB 1VCIA 4KY5A 3VYSA 1CT1D 3GTGB 1F77A 2PYKA 4U673 3OOCA 1FGBD 2BA1A 3SXHA 2KQ3A 4DNRB 3GP7A 2O4XA 3Q22A 4RAUC 1D1KA 2KVMA 2IW3A 3L9AX 3M4YA 4R8NA 4RA8A 4X3UA 1XXGA 2QF7A 3TDQA 1KDAA 4FF1A 5COYA 1JR0D 3EFXD 2RKSA 5A2QE 5CR3A 4H44C 4U68A 2HDLA 1RDPD 3FKIB 3LWEA 2F0QA 2LY7A 1QB5D 3ONAB 3T16A 1H9RA 2WKDA 2DNEA 1ZYRD 4K6LA 1NCVA 2L5TA 1G6ZA 1ZYRC 5EJWA 4NDXA 2F0UA 4X3TA 2CVRA 4F87A 2PO4A 2PZWA 2IJ0A 3LNNA 1EY5A 3ND9A 3P1HA 1HUMA 1PLFA 4PQXA 2E74C 3HKZB 1STNA 2D2CC 4LAAA 4PNYA 4XXEA 4FF4A 4AYBB 2C9OA 1DYQA 1X3QA 1SE4A 3C2PA 2RSOA 4RGMA 1GJXA 1JWSD 1TWHB 4KMUC 2EYFA 1S5FD 5TSSA 4DFAA 3VR2A 1EY9A 3DWAA 4H0LC 5FLXL 1CZWA 1WTVA 1EYDA 1TWFB 4A3FB 2L9HA 1ET9A 2JEBI 1B4OA 2CW0D 3QB3A 1UAPA 1STBA 1E2ZA 3A7AB 1EQVA 2ID0A 2LFNA 2F0DA 1DOMA 5KYLA 2EZVA 2PZUA 4F88A 4ILWA 3S1MB 4EQNA 4KI0A 4OGQC 3S2HB 3NE5B 3RUZA 1O78A 1CI3M 2A68D 4MN3A 4WRDA 1Y8OB 1Z6HA 2PPBC 1X3PA 1SJED 1STGA 2MP1A 4A3MB 3X3NA 1UEAB 1CQVA 4IALA 1XYIA 2BE5D 4BA1I 1Y69U 1TT2A 2EY1A 5JOBA 1F9QA 1A3UA 2K03A 1WTRA 2M2LA 2MGSA 2NWGA 2F0WA 1DZ1A 5LL6X 4PMBA 2K5QA 5FLXE 1JICA 1STEA 4K8IA 3Q23A 1SNDA 5IGEA 5I9OA 1YNNC 2B8GA 1WD0A 4HMJA 2NVYB 3PIO3 2NVXB 1HFGA 4WORA 2MPMA 3ITPA 4C3IG 2EYJA 4RHRA 2R7ZB 4HCSA 4LJZC 2XN9C 1ET6A 1ESRA 5ELBA 1TR5A 1WCMB 5E3FA 3V96A 3C1FA 2CQAA 2OT2A 3R2IA 1U4PA 1I3QB 1Q1BA 3MWYW 3VYUA 3I4LA 1RCVD 2NN6H 4O1NA 1H9KA 3C46A 4C56C 2HUGA 1JOKA 1TY2A 1DJRD 1AEXA 3K58A 2EVBA 3Q0AA 3OPOA 2E2HB 1FNVA 3TP6A 2BOSA 1EL0A 1EY8A 3BVMA 4CJ1B 1IKLA 2E76C 1KDCA 4RGOS 2O5IC 4IUNA 1ESFA 2K28A 4HSVA 3R93A 5HURA 1WTPA 1Y8NB 3QJYA 1SE2A 4CKEA 3GTKB 2O2LD 1NSNS 1TU2B 3NQTA 2NZ1D 3IFTA 1QJOA 2G9HD 1EZ6A 3OHXC 3I72A 5BN3A 1SMYD 4ZK9B 4DK1A 3EQLC 2IX3A 1PFNA 2PZTA 4XQJA 1TWCB 5DNFA 3NBHA 4IZ8A 1Y8PB 5A2QL 3CQZB 1PFMA 4TRDA 4RKBA 3T53B 1IHZA 2F0JA 1RODA 1R9TB 2B2VA 3GTOB 3RMHA 1WTXA 4QUCA 4NW2A 1BO0A 2ZXPA 3IL8A 1W6KA 4DXGA 3MEHA 5JEAJ 1GUSA 3KLSX 3VA7A 2EY2A 4DXFA 3SK6A 3S15B 3MXNA 4DNTB 3ZYYX 3HOVB 2EYMA 1I4XA 5I2XA 3QWNA 3TMEA 2EYLA 1BOSA 1JOQA 2M00A 1DD2A 3VR5A 3KLRA 3HOUB 2Z4HA 2WKCA 1GHKA 1LT3D 5LL6S 1PTOB 3P7JA 4K14A 4XYOA 1KNAA 1QILA 3WDNA 4QCLA 3D6WA 2MUYA 1AFPA 4KHZA 4KV6A 2F3WA 1AZQA 5E1FA 1EQTA 1GUTA 2DN8A 2BDOA 1PTOC 4K5WA 1B53A 1U4LA 3PUZA 1ZKOA 3I91A 3IKJA 2E2DC 4QB4A 4H13C 4OIJA 1VF7A 2F0EA 3OWEB 3AMUA 1M4VA 1SMYC 2F0IA 1IW7D 1ILPA 1CHPD 2F0NA 5D3IB 1EY7A 3J80L 3T56B 4DN4M 2R92B 2OF1A 1CHQD 2SOBA 3D6CA 1QCBD 2QDBA 5EBCA 2B2WA 4FXGC 3FPUB 3C1EA 2VB2X 5C0XJ 4CHTB 5J22A 3E6ZX 1ML0D 3K7AB 2WIIB 1LACA 3CRLC 2JXMB 1R4PB 4C2MB 1HXYD 1S5CD 1BF4A 2F1MA 1OXTA 2ZT9C 2A69C 2B8FA 3VR4A 3D4RA 1HUNA 3PUVA 1MGSA 1K8OA 3SE0A 2E2IB 2XWJB 3HGBA 2K32A 3TP7A 1PRTD 5CMDA 1VMCA 2FHTA 3K5MA 3GD7A 4TSSA 1F2ZA 2IX1A 4BA2I 4DU9A 3L7ZC 2F0PA 1JE4A 1JCKB 1QG7A 1AZPA 2EXZA 1GOZA 1RTNA 3CU7A 5C4XB 3Q6SA 5M5YB 3EJIA 2SNMA 1RKNA 4HAEA 2SNSA 5M9OA 3OIQA 2H1EA 1RTOA 3W3AA 5CV4A 3URYA 4OL7A 4C1NI 4PV1C 2L4NA 1GUWA 3K6OA 4FNFA 3TP8A 4RCOA 5T1IA 4MHEA 4IFDJ 1LABA 2OEOA 2R93B 3SHLA 1G91A 4XDXA 4IUQA 1NUCA 2AWNA 1LTID 5CV8A 4GZYC 2EJFC 2H4OA 1IYVA 1HTLD 2KHSA 1STHA 5I6WA 5EPLA 1F2MA 2RQXA 1GUGA 1SNMA 2AQ2B 3OIPA 5IGFA 2A74C 2F0OA 2PCFB 3BVZA 1NR2A 1MD2D 3MFYA 1LTBD 2EPBA 3PMFA 4X3KA 4PMCA 1PTOD 2K1BA 4J8QA 1MSGA 3H6MA 3FEWX 4UAIA 2E2JB 1B2TA 2FJ2A 3D4WA 1EZ8A 3Q24A 2FFKB 4FXKC 3RZDB 3I90A 1I4PA 1KLUD 4FO2A 5I2YA 4ZUJA 3H91A 2IL8A 5I6YA 2B2UC 1B44D 3V2TA 1WVLA 4HSPA 5EKIA 2RSNA 4QIWB 2ZXOA 5FO7B 3DEPA 4IURA 3TSSA 1TIID 2HDMA 2IX0A 3NP8A 3E0JA 5DEHA 4S3SA 1BCPD 3OWFA 1PTOF 1VF5C 2A73B 2PW7A 3NWTA 3OW7A 2V4DA 4ZLTF 3PO2B 2A69D 3WOFA 5M5WB 3DXJC 3BVGA 3S1NB 1JOOA 5D65A 4B08A 4RWSC 4ME5A 2I07B 3KK7A 2Q8RE 2G9DA 1TS2A 4XT1B 2L12A 1OXXK 1E0BA 1QOHA 5EGTA 4KKTA 1Z7TA 2I46A 2PNRC 4XTCS 3PIP3 1TKWB 1BCPF 1II3A 1I6HB 1XTCD 3NTIA 2M9VA 2WAQB 5ELDA 1HCZA 1DXMA 4BS9A 2JA5B 2F0VA 1QE6A 1LLRD 3A55A 4C1NK 2EJMA 2X6LA 1O80A 1SYGA 1SNPA 4M8AA 1F2YA 3IAYA 1G2TA 2NUCA 1L0XB 2EYHA 5K5PA 1STYA 4KHVA 1MSHA 4KN7C 1E2WA 3LWUA 1WTWA 3BS1A 2HCIA 1GXDC 1LV9A 3V05A 4K6DA 1RF2D 1D5XC 3TZDA 3U9SA 4CKCA 2Q8IB 1Q90A 2EOTA 4LMQD 5CBEE 5FKAC 1KTKA 1KAAA 4IQZA 1BXTA 1BDOA 3M85A 1LO5D 1GUOA 3X3MA 4CJ0B 1FR3A 2NTTA 3NTKA 1D5ZC 4FXDA 2KECA 4FF2A 1Q8IA 3T51B 5EPJA 4IUPA 3S14B 1ONLA 4A3DB 1EEFD 2BCOA 1CM9A 1CTMA 3MVVA 3NBIA 3S2DB 5KNBA 1R4QB 3R8BA 2LS01 4G7OC 4X3SA 1U4MA 2YYZA 2C5CA 4V0BA 2XNAC 5CYUA 3D31A 1B50A 1PTOH 1NAPA 5LHY1 2F0KA 1U4RA 4C3JG 4G57A 3U9OA 1YNND 4NP5A 3J7YW 1FNWA 1D1IA 3JAME 1DOLA 2L1BA 2XIWA 3VA5A 2JEAI 1T5XD 2EYPA 4Y7NB 2SEBD 4ZQ3A 1PZKD 3MFGA 3O13A 4XQQA 5C4ZA 1FNUA 1G8ZD 1PYWD 1LTGD 4KJOA 4ZKBB 5BN4A 1C48A 3IFDA 4L63B 2K5DA 5E4WC 5J39A 3D8GA 2K05A 1X32A 4RFBA 4IUTA 4E6IA 3S1RB 2K6AA 2FMCA 1PMRA 3QOLA 1FYCA 3FDTA 5JVH3 1SSOA 1PRTF 3NTHA 2A6HD 2L11A 1EFID 3H09A 1DOKA 1I4QA 3K5NA 1SNCA 1ZXTA 2WACA 1Q1EA 4EVOA 4DAVA 5C3EB 5KYIA 1D6EC 5IT9L 2ICEC 1A15A 5EQ0A 3GV6A 5AFWA 3NXWA 5G3LF 4EGVA 5KNCA 4QF4A 3A7LA 3BYTB 2RDHA 1L0YB 2PW5A 1PRTC 5C3XA 3DUZA 2LKVA 2A6ED 3PUWA 2JSOA 5IIFA 3GTMB 3WOEA 1HA6A 1EYCA 1SDFA 1KLGD 3NQIA 4Q5VA 2VB3X 3SR1A 1XWEA 1YNJC 3TZUA 1S5ED 4RHSA 5ISRA 3J7AF 1EIGA 1O7LA 1S5BD 2IT1A 2RBMA 4KK7A 1BUVT 3NWSA 4ZKCB 3GTLB 1M8AA 3J81E 4BY1B 5FK9C 1AW7A 1EWCA 3CRKC 4UDUC 5C0XG 3I3CA 2WP8J 4J1MA 3DMUA 3QOJA 3VYTA 3LX0A 3K0YA 1T5EA 2F0FA 1BR9A 2K01A 3VR3A 2D9UA 4JK1C 3EVQA 2VXWA 3SK8A 4H7BA 2KJXA 5ELFA 4KD3A 1IKMA 5CC4A 4EQPA 2XVSA 2A6EC 5NUCA 3M7NA 1RD9D 5FOBB 3MXGA 4K5VA 2Q8TA 1DM0B 1SEBD 3R2TA 1H9JA 5I4DA 3EROA 2PMZB 3M3YB 3NHHA 4F7XA 4K8JA 5G3LD 5ELCA 1SYEA 1F9PA 2VNUD 1I4GA 5DAUA 1HA5A 4RH6A 1EYAA 3I8ZA 2NN6G 2NB0A 3C3LA 3HOXB 4XT3B 3PUXA 3FRPB 4P2CB 3M4OB 5EKLA 5KIXA 1LT4D 2A5HA 2O5JC 4ZUIA 4CJ2C 4G7HC 5JPNC 4HCEA 2Z1CA 2WINB 4OIKA 2F0SA 1A3VA 1O7YA 5CV5A 5F2DA 3MAQA 1I6VC 5C0XH 2N88A 2RDGA 1CZGA 5C5LA 5C6AA 4BBRB 1EWHA 3P20A 1K8MA 5FO8B 2J4XA 2L0CA 1VDZA 2KA7A 4OO1G 2AUKA 4XYQA 2KUMA 4OO1H 4CBVA 4V190 1SBBB 3SEBA 5EBDA 3DEOA 1SYDA 3S9WA 4IN3A 4QMGA 1EU3A 1TWAB 5IOCA 1D5MC 2EY6A 2R61A 4K2KA 1HHVA 3H3VC 2JA7B 5CV9A 3I73A 1ICWA 1OXVA 3A54A 3QIAA 5CBAE 1LTSD 1JWUD 1FD7D 1B9NA 3TBIB 4BWGB 1SNOA 3P75A 2B2YC 5DM73 2EE1A 2X69A 2F3VA 1HQRD 1GUNA 1CA5A 5IGGA 2GA4B 4HN7A 2YU9B 2BA0A 1TWGB 4I65A 1ENCA 3KUPA 3VYRA 4FYDA 3R3OA 1H9SB 1ZEQX 4DK0A 2A68C 5IODA 2K04A 5M3MB 2RDFA 4A3JB 3CKIB 1PZID 1SYFA 4C3JB 5IGBA 5C0XI 4CGYB 2NBFA 2QKIC 5CV7A 3FPPA 5C4HA 1DCZA 5JEAG 1EOTA 5C4JB 4RGNA 4CKBA 3OMCA 2JE6I 5EPKA 2EYOA 3KF8A 1TS5A 5D14A 4K2LA 3GO5A 3DM1A 3I70A 1OXSC 2AQ1B 5CORA 2XWBB 3MXUA 4KKSA 1EU4A 5JVG3 3HZXA 2JA8B 1A2UA 2F0TA 2KEEA 3MA2B 1TS3A 1S5DD 3ND8A 2L55A 4Z9CB 2F0HA 1RHPA 2NVTB 2D5DA 1EIHA 1NR4A 1HFNA 4WJWA 1UNSA 4KKUA 2XRSD 2NN6I 4A3BB 4A3GB 4KY6A 2DY7A 1H9MA 2RVLA 3A8JE 5M3FB 1KDBA 4TQUS 1J9OA 5M5XB 1OXUA 3FVQA 1V8QA 2SDFA 4DA2A 3N52A 1V43A 3L3OC 1V1OA 3HEJA 1PFBA 2HQEA 2ENBA 5CV6A 4ZRZA 1JB3A 1TVXA 3J7AV 4NKLA 5JEAH 1TQOA 2RA4A 1BCPC 3OSOA 1SE3A 1SAPA 3UI2A 5KRUA 4A3KB 1QNUA 2DY8A 3SK5A 3K57A 4OO1I 4XIGS 1B3AA 1BCPB 1IYUA 3DWPA 2NYZD 1LTAD 4QUFA 2PQEA 3S17B 5HGTA 4BBSB 2QILA 3G7LA 1QWYA 3BG3A 5DM63 1IW7C 2J7ZA 3HRZC 2BE5C 2IPKD 1OO9B 3MZ5A 2KCNA 2Y0SB 5JPMC 5KGUA 2KEDA 2X6GA 2NVQB 4Q0FA 3DHQA 2MJ8A 3A56A 1AP0A 1CFMA 5KEEA 4HTHA 1PZJD 1TY0A 1ENAA 2BDNA 4DGZA 4FVMA 5D3DA 2QEJC 1SYCA 4KD4A 2B2UA 3JAML 1SXTA 4F8MA 2B2YA 3S16B 3KLSA 3BYYB 2ZXRA 1I50B 2AWOA 3MXPA 3T13A 3MTSA 1K83B 1EY0A 1CA6A 3RZOB 3PO3B 4TKOB 4YIJA 2WV6D 2B2TA 3D4DA 4FF3A 1Q12A 1BNZA 2JA6B 1VMPA 1F9RA 3AB9A 2JYOA 3EA6A 2F03A 4BY7B 1D2BA 1B1ZA 3VR6A 1WTQA 1HTPA 1SNQA 1KNEA 4DAPA 3CHBD 3S1QB 5EKKA 2OXPA 1WTOA 5I9PA 2AQ3B 1EEID 1AN8A 4IFDI 2JP1A 3NSWA 2KCCA 2AUJD 1A6XA 4ZYSA 2K33A 4K5XA 3A8KE 1Y1WB 2TMPA 3D3RA 1CK1A 1EY6A 2E75C 1STAA 1QNKA 2QCPX 1JC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYC A;  4KD4 A;  4KY7 A;  3TME A;  5C3X A;  2EYL A;  2F3V A;  2LKV A;  2F0K A;  2PZW A;  4IAL A;  4F8M A;  3PMF A;  2F0G A;  1KDB A;  4G57 A;  3TP6 A;  4PMC A;  4KTA A;  1II3 A;  5IGG A;  1EY5 A;  3P1H A;  5EKL A;  3U9O A;  1EY8 A;  4I65 A;  1ENC A;  5IIF A;  3TP7 A;  5KIX A;  1JOQ A;  2M00 A;  4NP5 A;  1KDC A;  1EYC A;  3H6M A;  5CGK A;  2F0V A;  1JOR A;  1TT2 A;  3SR1 A;  4ZUI A;  2EY1 A;  3D4W A;  5JOB A;  3HEJ A;  4IUN A;  1STN A;  1A3U A;  1EZ8 A;  3R3O A;  3VA5 A;  2EYP A;  1F2Z A;  4K14 A;  4LAA A;  4PNY A;  2HQE A;  5ISR A;  2F0S A;  1A3V A;  3MXP A;  5HUR A;  1SYG A;  4B9X A;  2F0W A;  2ENB A;  1U9R A;  3T13 A;  1SNP A;  5CV5 A;  4ZQ3 A;  1EY0 A;  1F2Y A;  2F0P A;  4PMB A;  5CV6 A;  5F2D A;  4DU9 A;  2NUC A;  3S9W A;  5C4Z A;  4KV6 A;  2F3W A;  4K8I A;  2EYH A;  5K5P A;  1STY A;  2RBM A;  4KHV A;  1NSN S;  2RDF A;  4KY5 A;  1SND A;  4RKL A;  5C5L A;  5C6A A;  2EYF A;  4NKL A;  4N9P A;  1TQO A;  3OSO A;  5IGE A;  4YIJ A;  2EXZ A;  5I9O A;  5E1F A;  4ZUJ A;  4KJO A;  3MHB A;  3NQT A;  3NUC A;  4DFA A;  5I6Y A;  1SYF A;  1EY9 A;  3D4D A;  4HMJ A;  3V2T A;  4K6D A;  3ERQ A;  5KRU A;  2PYK A;  3EJI A;  4K5W A;  2SNM A;  4KY6 A;  1RKN A;  3SK5 A;  5IGB A;  2SNS A;  5M9O A;  1EY4 A;  1SYB A;  3SXH A;  4WOR A;  2KQ3 A;  4J1M A;  5J39 A;  1EZ6 A;  3DMU A;  2O4X A;  1EYD A;  3QOJ A;  5CV7 A;  4QB4 A;  5CV4 A;  5C4H A;  2F0M A;  3D8G A;  3ITP A;  3OMG A;  4OL7 A;  3LX0 A;  4MIU A;  4KJN A;  2F0E A;  2EYJ A;  5I9P A;  2F0F A;  2PZT A;  4R8N A;  5IGD A;  3OMC A;  4E6I A;  2PQE A;  2F0I A;  3QB3 A;  3EVQ A;  3NP8 A;  4IZ8 A;  3TP8 A;  5HGT A;  1KAA A;  2EYO A;  1KDA A;  3BDL A;  5C5M A;  5DEH A;  5JAV A;  1STB A;  3OWF A;  4NMZ A;  3QOL A;  4S3S A;  3SK8 A;  4DF7 A;  4K2L A;  4H7B A;  5C3W A;  5IOD A;  1A2T A;  2OEO A;  2PW7 A;  4ID6 A;  2F0N A;  1EQV A;  1TR5 A;  3NK9 A;  1EY7 A;  2RKS A;  4J6H A;  4KD3 A;  5CR3 A;  5CC4 A;  1SNQ A;  1SYD A;  4TRD A;  1SNC A;  4RKB A;  5E3F A;  1IHZ A;  2EY5 A;  2F0D A;  2OF1 A;  4QMG A;  5EKK A;  4EQP A;  2OXP A;  5KYL A;  2SOB A;  2F0J A;  2PZU A;  2WAC A;  3D6C A;  2EY6 A;  4N9T A;  5NUC A;  4K2K A;  3SHL A;  3C1F A;  3E5S A;  4B9W A;  2F0Q A;  3HZX A;  2QDB A;  4EVO A;  1JOO A;  1KAB A;  5CV9 A;  5KYI A;  4K5V A;  4EQN A;  1A2U A;  2F0T A;  3MZ5 A;  1NUC A;  4ME5 A;  3C1E A;  3BDC A;  3T16 A;  5KGU A;  3ERO A;  3NHH A;  5CV8 A;  4F7X A;  5J22 A;  3RUZ A;  3DHQ A;  3MEH A;  4K5X A;  4K8J A;  3NXW A;  3MVV A;  3TP5 A;  2KHS A;  5KEE A;  5J1Z A;  4HTH A;  3SK4 A;  1STH A;  2EY2 A;  4NDX A;  2F0U A;  1SYE A;  5I6W A;  1ENA A;  1F2M A;  2F0L A;  1EY6 A;  2F0H A;  1STA A;  4QF4 A;  1JOK A;  5DAU A;  5EGT A;  5IOC A;  4EQO A;  4WRD A;  1SNO A;  3SK6 A;  4DGZ A;  5IGC A;  3P75 A;  1SNM A;  1AEX A;  1STG A;  2PW5 A;  5IGF A;  1A3T A;  2F0O A;  2EYM A;  1EYA A;  4HMI A;  4ODG A; 
#chains in the Genus database with same CATH topology
 2HCC A;  4JBJ A;  3PIP A;  1YJN A;  4JI2 L;  1XNQ L;  4KTA A;  4DV1 Q;  2JA5 H;  4QJF A;  3K81 C;  4YCW A;  2PQA A;  2MQH A;  2D62 A;  4LF8 Q;  4IO9 A;  4B3S L;  1YNJ D;  4JI1 L;  4OWT B;  4LF6 Q;  3I4M B;  4LF7 L;  2WB1 B;  2ZJP A;  4B3M Q;  1UEB A;  1V1P B;  3A8I E;  1A8V A;  4L6T B;  1CQF A;  3FMC A;  1GHJ A;  3QR8 A;  4A3I B;  1U9R A;  3W1G A;  4ZAI A;  1S4Z A;  3J81 L;  1BBX C;  1F2L A;  4FP5 D;  3SVM A;  5DLQ E;  1VQ6 A;  3HG9 A;  2FIN B;  3NPP A;  4N9P A;  3MHB A;  3NUC A;  1PXU A;  3NEL A;  3T4A C;  4HJ8 A;  1IBL Q;  3UDF A;  3HP3 A;  3ERQ A;  3F1Z A;  4LK1 C;  1J8I A;  2Z8L A;  4G7Z C;  2Q2U A;  1SYB A;  4ULL A;  3UDI A;  1IBK Q;  5C4X H;  1UUP A;  2F0M A;  3BZD B;  3RLO A;  2D0P A;  4MIU A;  3F2U A;  3AU7 A;  1TWA H;  5IGD A;  4O42 A;  4A3B H;  3BDL A;  5C5M A;  5A35 A;  4C3I B;  2B2V C;  4NMZ A;  3RLF A;  4DF7 A;  3GV3 A;  4HIO A;  4I7Z C;  1LTR D;  1A2T A;  4ID6 A;  5LMU Q;  2ICI A;  4J6H A;  1G51 A;  4WFN 3;  4DAY A;  2K7V A;  4G4K A;  3RD4 A;  1V1P A;  4B9W A;  1B3Q A;  1MBY A;  3S14 H;  1PRT B;  4R8I A;  3K5L A;  4DR3 L;  2CW0 C;  1ILQ A;  1JQY D;  1HRJ A;  2UXD Q;  2J0T D;  3BDC A;  1DON A;  2N55 A;  2LMC B;  2R3Z A;  3H94 A;  1LT6 D;  1Q3L A;  2KOL A;  3FHW A;  1C8C A;  5K36 H;  1HNX Q;  2E2H H;  4PMW A;  1B70 B;  3SDZ A;  4OWW B;  1H9S A;  2F0L A;  2XRQ D;  4YWM A;  2C35 B;  3GTP H;  1I4R A;  4RG1 A;  1MI2 A;  5FLM H;  1C4Q A;  2MNA A;  4FDB A;  2HHH Q;  4C3H H;  2TSS A;  3QG1 A;  4ABN A;  5E4X A;  4A93 B;  3PV0 A;  2VUM H;  4HMI A;  4ODG A;  5IP7 H;  1G29 1;  3ULJ A;  4KY7 A;  4IUU A;  3W2D A;  1WD1 A;  2Y0S E;  1SJH D;  1TS4 A;  4C3H G;  1O7Z A;  4A3D H;  1ASZ A;  2F4I A;  2OTL A;  1YHA A;  4X6A H;  4R4T A;  5CGK A;  3GTJ B;  1JOR A;  1NMG A;  4KLK A;  2Z0S A;  2DNC A;  3PUY A;  5FO9 B;  4JVZ A;  1JT8 A;  5KND A;  4B9X A;  1HNZ Q;  1SRO A;  3GTQ B;  3RNU A;  3I4N B;  1RJT A;  2NTS A;  4RKL A;  3F2D A;  3H0G H;  4X62 Q;  1BQQ T;  4RGT A;  3TN2 A;  1VQA A;  2A6H C;  2E2I H;  3S16 H;  3GQB A;  1PV4 A;  1E2V A;  4M1U B;  5IP9 H;  1EY4 A;  3N6R A;  2EJG C;  4POG A;  1XJV A;  2MHV A;  1JWM D;  1TWF H;  1EFW A;  4EX5 A;  3OMG A;  4C3H B;  1K73 C;  1HZC A;  1MKH A;  4KJN A;  2IY5 B;  5GAD C;  3UDG A;  3KBG A;  4CDF C;  2AMC B;  1HPC A;  5T1G A;  3J80 E;  5JAV A;  2PMZ E;  1Z47 A;  1J6Q A;  2CHB D;  5C3W A;  4IFD H;  3NK9 A;  3KBX A;  2ZJR A;  4R9W A;  3HOZ B;  1IL8 A;  2EY5 A;  1LTT D;  1CKM A;  4XQN A;  1LT5 D;  5K36 G;  2FMM A;  4N9T A;  4IFD G;  3E5S A;  1MIU A;  3GTP B;  4L5S A;  3J7A 5;  1KAB A;  3E9H A;  2NVT H;  4BBR H;  1I4H A;  4JI7 L;  1I94 L;  1SFO B;  1XX8 A;  1ENF A;  4JOI A;  2IWH A;  2B39 A;  1K8A C;  5BN5 A;  2B63 B;  4L8J A;  3K5O A;  1W6J A;  2Z4I A;  5IT9 E;  1KRT A;  3CD6 A;  5IP7 G;  3TP5 A;  5J1Z A;  2EDG A;  3SK4 A;  1HQM C;  4RCN A;  5JJZ A;  3RR5 A;  1PDQ A;  4EQO A;  3GTJ H;  1VQF A;  2B2T C;  5IGC A;  5C3E H;  1B9M A;  1A3T A;  4LF9 Q;  3K59 A;  4KHP L;  2VY3 A;  3PF4 A;  2R6G A;  3HS0 C;  2F0G A;  4JBW A;  5C4X G;  1LUZ A;  5LMU L;  3DWQ A;  2VUM B;  2B2W C;  3HOY B;  3HOW B;  2K5W A;  3H0G B;  2CWA A;  1G2S A;  4HED A;  4KHP Q;  3MC0 B;  4IUV A;  2B29 A;  3QO2 A;  2XSC A;  3BDO A;  1TWH H;  4KN4 C;  4OHJ A;  5C44 B;  5ELE A;  4HR7 B;  1X3G A;  2ALY B;  1Y1V B;  3M7G A;  1F9S A;  1YVC A;  3PO2 G;  4A3E B;  1NBW A;  3G6J B;  1VCI A;  3E0E A;  4KY5 A;  1I5F A;  3VYS A;  1CT1 D;  3AYH B;  2KBN A;  5L37 A;  1K28 A;  1WOC A;  1BBU A;  3GTG B;  1F77 A;  2PYK A;  4U67 3;  3OOC A;  1IBM L;  1FGB D;  2VQF Q;  2BA1 A;  3SXH A;  2OTJ A;  2KQ3 A;  4DNR B;  3GP7 A;  2O4X A;  3Q22 A;  1VQ4 A;  4A93 G;  1N8R C;  1J5E Q;  2JA9 A;  4RAU C;  1X3F A;  1VQK A;  1D1K A;  2KVM A;  2IW3 A;  3L9A X;  3M4Y A;  5IYB H;  4R8N A;  2L15 A;  4RA8 A;  4GKJ Q;  4X3U A;  1XXG A;  3TEH B;  2QF7 A;  3TDQ A;  1C0A A;  1KDA A;  3TRE A;  4JPB W;  4FF1 A;  1K9M C;  5COY A;  3RZD H;  1JR0 D;  3EFX D;  2RKS A;  3PO3 G;  5A2Q E;  2GVA A;  5CR3 A;  4GKJ L;  4H44 C;  4U68 A;  4POF A;  2HDL A;  1HNZ L;  1PH4 A;  1RDP D;  3FKI B;  3LWE A;  2F0Q A;  2LY7 A;  3S2H H;  1WJJ A;  1QB5 D;  3ONA B;  1NE3 A;  3T16 A;  4R4Q A;  1H9R A;  2WKD A;  2P5Z X;  3HOW H;  2DNE A;  1ZYR D;  1XPR A;  1IL2 A;  4K6L A;  3Q8D A;  1NCV A;  3PF5 A;  2L5T A;  1G6Z A;  1ZYR C;  2DUD A;  5EJW A;  3U4Z A;  4NDX A;  4DUY Q;  2F0U A;  4JI4 L;  4BY7 G;  4X3T A;  2H5X A;  4DV5 Q;  2R7Z G;  2CVR A;  2CCZ A;  2MFI A;  1E3P A;  3NEM A;  1I50 H;  5M5W H;  4F87 A;  2PO4 A;  2PZW A;  2IJ0 A;  4X66 Q;  3LNN A;  4BY1 G;  4GLV B;  1EY5 A;  3ND9 A;  3P1H A;  4OEL B;  3M4P A;  1HUM A;  1VQI A;  3W5O A;  1VQL A;  4DNI A;  2QA4 A;  4JI8 L;  3PGZ A;  4LF5 L;  1PLF A;  4PQX A;  2E74 C;  1S72 A;  1NTG A;  3HKZ B;  1STN A;  2OQK A;  4JI7 Q;  2D2C C;  4LAA A;  4PNY A;  4XXE A;  4AYB B;  4FF4 A;  2C9O A;  1DYQ A;  3ZJY C;  1X3Q A;  1SE4 A;  3C2P A;  2RSO A;  4L5T A;  4RGM A;  3CPW A;  1GJX A;  1JWS D;  1PVO A;  3S1R H;  1TWH B;  4KMU C;  2EYF A;  5JJI A;  4JI4 Q;  1S5F D;  5TSS A;  4DFA A;  3VR2 A;  1EY9 A;  3DWA A;  2Q2H A;  4H0L C;  1HJP A;  5FLX L;  1CZW A;  4LFA L;  3GDE A;  4JW0 A;  3CAM A;  1WTV A;  1EYD A;  1TWF B;  4A3F B;  1N32 Q;  1TXY A;  2L9H A;  1ET9 A;  2JEB I;  3DM3 A;  1B4O A;  4QIW E;  2CW0 D;  1IBL L;  3QB3 A;  1VQ8 A;  1UAP A;  3FP9 A;  1STB A;  3S24 A;  1E2Z A;  3A7A B;  3BJU A;  3L0O A;  1EQV A;  3F8T A;  4JYA L;  1PH2 A;  2N8N A;  5GAE C;  5FLX c;  2ID0 A;  2LFN A;  2F0D A;  1DOM A;  5KYL A;  2RF4 A;  3H0G G;  2EZV A;  2PZU A;  3I4O A;  1UE7 A;  4F88 A;  1O7I A;  4ILW A;  4BY7 H;  3S1M B;  1EWI A;  4DV4 L;  2K50 A;  4EQN A;  1X6O A;  1WCM G;  4JI5 Q;  3CP0 A;  1P16 A;  1X54 A;  4KI0 A;  4OGQ C;  3S2H B;  3NE5 B;  3CCV A;  3RUZ A;  1O78 A;  1VQD A;  1Y14 B;  3GTQ H;  1CI3 M;  4BBS G;  2A68 D;  4BXX H;  4MN3 A;  4BY1 H;  2QGQ A;  2PNH A;  2VL6 A;  4DR3 Q;  4LF4 L;  4WRD A;  1Y8O B;  1Z6H A;  2PPB C;  1KRS A;  1X3P A;  4DR2 Q;  1SJE D;  5GAH C;  1STG A;  2MP1 A;  2LXK A;  4DR1 L;  4A3M B;  4CDE C;  3X3N A;  1UEA B;  1CQV A;  3KYH C;  2UXB Q;  4H02 A;  4IAL A;  1XYI A;  2BE5 D;  1KQS A;  2EIF A;  3GTL H;  4BA1 I;  1KD1 C;  4BBR G;  5IYB G;  4R4O A;  5FJ8 G;  1Y69 U;  1TT2 A;  2A8V A;  3MXN B;  2EY1 A;  1GKH A;  5JOB A;  1F9Q A;  4JBM A;  1A3U A;  2K03 A;  4AYB G;  1YZ6 A;  1WTR A;  2M2L A;  2MGS A;  2NWG A;  2K14 A;  1SLJ A;  2F0W A;  1DZ1 A;  2R93 G;  5LL6 X;  4PMB A;  2K5Q A;  4R4C A;  5FLX E;  1JIC A;  1STE A;  4K8I A;  1UWV A;  3Q23 A;  1SND A;  4YCV A;  5IGE A;  5I9O A;  1YNN C;  4A75 A;  4N8X 1;  2B8G A;  1WD0 A;  2YU9 H;  4HMJ A;  4DV3 Q;  2NVY B;  3PIO 3;  4DR4 Q;  2NVX B;  1HFG A;  4WOR A;  2MPM A;  4LNQ A;  3CC2 A;  3ITP A;  4JI6 Q;  4C3I G;  2EYJ A;  4RHR A;  2R7Z B;  1V9P A;  3NEN A;  4HCS A;  4LJZ C;  2XN9 C;  4MNO A;  3S17 H;  1ET6 A;  1ESR A;  5ELB A;  2YV5 A;  2DGY A;  2KCT A;  4IOA A;  1TR5 A;  4IPD A;  3I4N G;  1WCM B;  5E3F A;  3V96 A;  1JE5 A;  4A3M H;  3C1F A;  5GRO A;  1CSP A;  2CQA A;  4DUZ L;  2OT2 A;  3R2I A;  1U4P A;  4AYB E;  1I3Q B;  1Q1B A;  3MWY W;  3VYU A;  3I4L A;  3KOJ A;  1RCV D;  2NN6 H;  5E7N A;  4O1N A;  5ELN A;  2JA6 H;  1H9K A;  3C46 A;  4C56 C;  1PFS A;  5IWA L;  3B6Y A;  3CC7 A;  2HUG A;  1JOK A;  1TY2 A;  1I94 Q;  1DJR D;  4N8F A;  3NBH B;  1BKB A;  1AEX A;  4GOP A;  3K58 A;  2EVB A;  2NZH A;  1YEZ A;  3CXC A;  3Q0A A;  3OPO A;  3KF6 A;  2E2H B;  1FNV A;  3TP6 A;  2BOS A;  1EL0 A;  1EY8 A;  3BVM A;  4CJ1 B;  4LFB L;  1IKL A;  2E76 C;  1KDC A;  4RGO S;  2Y0S G;  3S15 H;  2O5I C;  4R1J A;  1QVG A;  4IUN A;  1ESF A;  2K28 A;  2ZTC A;  1DGS A;  2QDL A;  4HSV A;  3R93 A;  5HUR A;  4YY3 Q;  1ICF B;  1WTP A;  1Y8N B;  3RZO H;  3QJY A;  1SE2 A;  4CKE A;  3HOU G;  3GTK B;  2O2L D;  2WFW A;  1NMF A;  1NSN S;  1TU2 B;  2UUC L;  3AFQ A;  3NQT A;  3HOU H;  4B3R L;  4DR6 L;  2NZ1 D;  3IFT A;  1QJO A;  2G9H D;  3JAM i;  1X9N A;  1EZ6 A;  3OHX C;  3I72 A;  5BN3 A;  3OTO L;  1SMY D;  3HOV H;  4ZK9 B;  4DK1 A;  2CKZ B;  3EQL C;  4CDC C;  2IX3 A;  1RL2 A;  1I3Q H;  1PFN A;  2PZT A;  4XQJ A;  1TWC B;  1QUQ B;  5DNF A;  4HIM A;  3NBH A;  4IZ8 A;  1Y8P B;  5A2Q L;  4A3M G;  3CQZ B;  1HR0 Q;  5ELO A;  3HOV G;  3STB D;  4GN5 A;  4LUZ A;  4DV2 Q;  1PFM A;  4TRD A;  4RKB A;  3T53 B;  1IHZ A;  2WAQ G;  2F0J A;  1ROD A;  3PSI A;  1R9T B;  3GTM H;  3KJP A;  2B2V A;  3M9B A;  3GTO B;  3RMH A;  1WTX A;  4QUC A;  4DV7 L;  4NW2 A;  2R92 G;  1BO0 A;  2ZXP A;  3IL8 A;  2JK8 A;  2ZJQ A;  4DAY B;  4EQ5 A;  1W6K A;  4DXG A;  1EUJ A;  3MEH A;  5JEA J;  3F2C A;  1N34 L;  1GUS A;  5GQO A;  3KLS X;  3VA7 A;  2EY2 A;  1HZB A;  4DXF A;  3SK6 A;  3S15 B;  3MXN A;  4DNT B;  4AIM A;  3ZYY X;  3HOV B;  2EYM A;  1I4X A;  5I2X A;  3QWN A;  1WTH A;  3TME A;  1TWC H;  2EYL A;  1KC8 C;  4DAM A;  2VZA A;  5EAY A;  3M4O H;  4B3T L;  1PA6 A;  1BOS A;  1JOQ A;  2M00 A;  5J3B A;  1DD2 A;  3VR5 A;  5M3M G;  4DV6 L;  1PHJ A;  3KLR A;  3HOU B;  2Z4H A;  4JC0 A;  2WKC A;  1GHK A;  1LT3 D;  1TWG H;  5LL6 S;  1PTO B;  3P7J A;  4B3M L;  4K14 A;  3M4Q A;  4GNX C;  4XYO A;  3JC6 6;  1KNA A;  1QIL A;  3WDN A;  1B8A A;  4UP8 A;  4HJ9 A;  4QCL A;  3D6W A;  2MUY A;  4NXN Q;  1CUK A;  1AFP A;  3CW2 C;  4KHZ A;  4KV6 A;  2F3W A;  1AZQ A;  3AEV A;  5E1F A;  1EQT A;  1GUT A;  4YHH L;  1ASY A;  2DN8 A;  3K80 C;  2BDO A;  3H15 A;  3S1N H;  1PTO C;  4K5W A;  1B53 A;  3PQI A;  1L1O C;  1U4L A;  3U50 C;  2BH8 A;  2YTX A;  3PUZ A;  1ZKO A;  3I91 A;  3IKJ A;  2E2D C;  4QB4 A;  1K3R A;  1N32 L;  4H13 C;  4OIJ A;  1VF7 A;  2F0E A;  1S3O A;  3OWE B;  3AMU A;  1M4V A;  2JQO A;  1OTC A;  2XGT A;  1SMY C;  2Q2I A;  4LF7 Q;  2F0I A;  1IW7 D;  2VS1 A;  4NXM Q;  2Z9H A;  2JA8 G;  4JG2 A;  4DV6 Q;  1ILP A;  2R93 H;  3T1Y L;  1CHP D;  2KEN A;  2F0N A;  5D3I B;  1EY7 A;  3J80 L;  1WYD A;  3T56 B;  4DN4 M;  2R92 B;  1QZG A;  2OF1 A;  2PI2 A;  1CHQ D;  3TRZ A;  2SOB A;  5LMN W;  1SRU A;  2WAQ E;  3D6C A;  5IYD H;  3CCS A;  1QCB D;  2QDB A;  2JA7 H;  5EBC A;  2B2W A;  2NZO A;  2OCE A;  4FXG C;  1XPU A;  1AH9 A;  3FPU B;  3C1E A;  2VB2 X;  5C0X J;  4CHT B;  5J22 A;  3E6Z X;  1ML0 D;  4RMF A;  4LFB Q;  3K7A B;  2WII B;  1LAC A;  3CRL C;  2JXM B;  1R4P B;  4HJ7 A;  4C2M B;  2WB1 E;  1HXY D;  4DV4 Q;  1S5C D;  4IPC A;  1BF4 A;  1Z9F A;  2F1M A;  1OXT A;  2ZT9 C;  3RN2 A;  1M1K C;  2A69 C;  2B8F A;  2I5M X;  3VR4 A;  3D4R A;  1HUN A;  3CCE A;  3PUV A;  1MGS A;  1K8O A;  4LFC Q;  1Y1W G;  3SE0 A;  2E2I B;  2XWJ B;  2EXD A;  1KAW A;  3HGB A;  1PYS B;  4QL5 A;  1EIF A;  3H3V I;  2K32 A;  3TP7 A;  1PRT D;  5CMD A;  1VMC A;  1JJ2 A;  3IRB A;  2PQA B;  2FHT A;  3CCJ A;  3K5M A;  2Z6B A;  3GD7 A;  4GN4 B;  4TSS A;  1F2Z A;  2IX1 A;  2UUB L;  3F2B A;  4GNX B;  4BA2 I;  4DU9 A;  3L7Z C;  2F0P A;  2R7F A;  1BBW A;  4TVA B;  4DR5 L;  4LUV A;  1JE4 A;  1X56 A;  1JCK B;  1FL0 A;  1QG7 A;  4P71 A;  1AZP A;  1PH9 A;  4DUY L;  2HIV A;  2EXZ A;  1GOZ A;  3LGJ A;  1N33 L;  1RTN A;  5BR8 L;  3CU7 A;  4A3L H;  5C4X B;  3Q6S A;  5M5Y B;  1XPO A;  3EJI A;  2SNM A;  1RKN A;  4HAE A;  2SNS A;  5M9O A;  4DR5 Q;  2UXD L;  3OIQ A;  2H1E A;  1RTO A;  3W3A A;  3A74 A;  5CV4 A;  3URY A;  4OL7 A;  2YTV A;  4C1N I;  4PV1 C;  2L4N A;  1IBM Q;  3EN2 A;  1GUW A;  3K6O A;  1YIT A;  4FNF A;  3TP8 A;  4RCO A;  5T1I A;  4MHE A;  4IFD J;  1LAB A;  3K7A H;  2UU9 L;  2OEO A;  3I4M H;  2R93 B;  4C3J H;  3SHL A;  5AJ3 L;  1QUQ A;  1G91 A;  4XDX A;  4IUQ A;  1VQH A;  1HNW L;  1XMO Q;  1NUC A;  1FGU A;  2AWN A;  4JI1 Q;  1LTI D;  4X65 Q;  1N33 Q;  5CV8 A;  4GZY C;  2EJF C;  1L0W A;  2H4O A;  4DV3 L;  1IYV A;  2ATW A;  1HTL D;  2KHS A;  1YJ9 A;  1STH A;  5I6W A;  3CQZ H;  5EPL A;  1F2M A;  1PH8 A;  1VQO A;  4JI6 L;  2RQX A;  4NB3 A;  1GUG A;  1SNM A;  2AQ2 B;  2HIX A;  3OIP A;  5IGF A;  1YHQ A;  2A74 C;  2F0O A;  2PCF B;  3BVZ A;  1MJE A;  1NR2 A;  1MD2 D;  3MFY A;  1X3E A;  1LTB D;  2E8G A;  2EPB A;  3PMF A;  4X3K A;  3T1Y Q;  2QEX A;  4PMC A;  1PTO D;  3GTG H;  2K1B A;  4J8Q A;  1MSG A;  3H6M A;  3FEW X;  4UAI A;  2E2J B;  1B2T A;  2FJ2 A;  1Y1V G;  2JA5 G;  3D4W A;  5AJ3 Q;  1EZ8 A;  3I55 A;  3Q24 A;  1VQC A;  2UUA L;  2FFK B;  5C44 H;  3HOX H;  2EQS A;  2N3S A;  4A3D G;  1Y1V H;  4QY7 A;  4JI3 L;  1U0L A;  4FXK C;  3RZD B;  3I90 A;  1I4P A;  4A3G H;  1KLU D;  5IYD G;  4FO2 A;  5I2Y A;  2GVB A;  1N36 Q;  4ZUJ A;  3H91 A;  2IL8 A;  5I6Y A;  2B2U C;  1B44 D;  3V2T A;  4JI2 Q;  1WVL A;  4HSP A;  3S1Q H;  5EKI A;  5M5X H;  4JI3 Q;  3T1H L;  1PH7 A;  2RSN A;  3HOW G;  4QIW B;  2ZXO A;  5FO7 B;  2GN5 A;  3DEP A;  4IUR A;  3TSS A;  1WFQ A;  1TII D;  4LF6 L;  2HDM A;  2IX0 A;  3NP8 A;  4YCU A;  3E0J A;  3G6E A;  5DEH A;  4S3S A;  1BCP D;  2XTI A;  3OWF A;  3OW2 A;  1PTO F;  1VF5 C;  1JMC A;  1E22 A;  2A73 B;  3FKI G;  1GM5 A;  2PW7 A;  3NWT A;  3OW7 A;  2V4D A;  4ZLT F;  2HD3 A;  1Y1W H;  3PO2 B;  2A69 D;  3WOF A;  5M5W B;  1LTL A;  3DXJ C;  5H1S E;  3BVG A;  1LYL A;  3S1N B;  1E1T A;  1GVP A;  4DR1 Q;  3BZK A;  3CME A;  4AQY L;  1JOO A;  1K0S A;  5D65 A;  1P8L A;  4B08 A;  4RWS C;  1YHB A;  5JJK A;  4ME5 A;  3G71 A;  4DV2 L;  2I07 B;  3KK7 A;  3HKZ E;  2Q8R E;  4DR6 Q;  1VQJ A;  2G9D A;  3CPF A;  1TS2 A;  4XT1 B;  2L12 A;  1WI5 A;  2F3I A;  1OXX K;  4R4I A;  1E0B A;  1QOH A;  5JJL A;  5EGT A;  4KKT A;  3RN5 A;  4A3L G;  1Z7T A;  2I46 A;  2UUB Q;  1CSQ A;  3H3V H;  2PNR C;  3HOY H;  4XTC S;  4K0K Q;  3PIP 3;  2B63 H;  1UE1 A;  1TKW B;  3AQQ A;  3EIV A;  1BCP F;  1II3 A;  1I6H B;  3OYY A;  1XTC D;  1E24 A;  3NTI A;  1NJI C;  2M9V A;  4WJ3 M;  1SR3 A;  2WAQ B;  5ELD A;  1HCZ A;  3TS0 A;  1DXM A;  4BS9 A;  2JA5 B;  2CQO A;  2F0V A;  3G48 A;  1QE6 A;  1LLR D;  4K0K L;  1Q86 C;  3A55 A;  4C1N K;  2EJM A;  2X6L A;  2Z6K A;  1IXR A;  1O80 A;  1SYG A;  1SNP A;  4M8A A;  1F2Y A;  3IAY A;  1G2T A;  2NUC A;  4APV A;  1L0X B;  2EYH A;  5K5P A;  1STY A;  1N34 Q;  4KHV A;  1MSH A;  4KN7 C;  1A62 A;  4PZ7 A;  1E2W A;  3LWU A;  1WTW A;  2QW7 A;  3BS1 A;  2HCI A;  1GXD C;  1LV9 A;  3V05 A;  4K6D A;  1RF2 D;  4DPG A;  3G4S A;  1D5X C;  1XNR Q;  3TZD A;  3U9S A;  4CKC A;  3PO2 H;  2Q8I B;  4A76 A;  1Q90 A;  4DUZ Q;  2EOT A;  1Q46 A;  4LMQ D;  1YIJ A;  5CBE E;  1KIX A;  2RCN A;  5FKA C;  1KTK A;  3J81 c;  1KAA A;  1XTD A;  4IQZ A;  1BXT A;  1L1O A;  1BDO A;  3M85 A;  1A63 A;  5LMN L;  1LO5 D;  1GUO A;  3X3M A;  1FR3 A;  2NTT A;  3NTK A;  4CJ0 B;  2UUA Q;  4X66 L;  3KF8 B;  1D5Z C;  4FXD A;  4ZCK A;  1YBY A;  2KEC A;  3S1M H;  4FF2 A;  2E5L L;  1Q8I A;  3L2P A;  4L5R C;  3T51 B;  4HIK A;  4LF8 L;  4B3S Q;  4A3E H;  5EPJ A;  4L5Q A;  4IUP A;  3S14 B;  1ONL A;  4UHV A;  1EEF D;  4A3D B;  2BCO A;  1K83 H;  1CM9 A;  2F4V Q;  2VUM G;  1CTM A;  2RHQ B;  3MVV A;  3NBI A;  3HOY G;  5M3F H;  4DR7 Q;  3S2D B;  5KNB A;  3CCR A;  1MHW C;  1R4Q B;  3R8B A;  2A19 A;  1K0R A;  3A5Z B;  2LS0 1;  4G7O C;  4X3S A;  4LF9 L;  4GOP B;  1A0I A;  3ICE A;  1U4M A;  2YYZ A;  2C5C A;  4V0B A;  2XNA C;  5CYU A;  1L2F A;  3D31 A;  1B50 A;  4MTN A;  1PTO H;  1NAP A;  3PCO B;  2F0K A;  5LHY 1;  1U4R A;  4C3J G;  4G57 A;  3U9O A;  2UXC Q;  1YNN D;  4GOP C;  4NP5 A;  3J7Y W;  1FNW A;  1D1I A;  3JAM E;  1DOL A;  4HJA A;  3VDY A;  3HOZ H;  2ASB A;  2L1B A;  1LM0 A;  1NNX A;  2XIW A;  3VA5 A;  1M90 C;  1T5X D;  3FKI H;  2JEA I;  2EYP A;  4Y7N B;  4HID A;  3KFU A;  2SEB D;  4ZQ3 A;  5IWA Q;  1PZK D;  3MFG A;  3O13 A;  4XQQ A;  5C4Z A;  1V1Q A;  1FNU A;  1G8Z D;  1PYW D;  4LW1 A;  1LTG D;  3CF5 A;  4KJO A;  3HKZ G;  4ZKB B;  2UXB L;  5BN4 A;  1C48 A;  2R7D A;  3IFD A;  4L63 B;  3ER0 A;  2K5D A;  5E4W C;  5J39 A;  3D8G A;  2FXQ A;  2K05 A;  1X32 A;  1CKO A;  4RFB A;  4IUT A;  4E6I A;  3S1R B;  1VQE A;  3STB C;  2K6A A;  2FMC A;  2UXC L;  1PMR A;  2CH4 A;  3QOL A;  1FYC A;  5C44 G;  3FDT A;  5JVH 3;  1SSO A;  1PRT F;  3NTH A;  2A6H D;  1VQ9 A;  2L11 A;  1EFI D;  3H09 A;  2B63 G;  1DOK A;  1I4Q A;  4A3E G;  3K5N A;  1SNC A;  1ZXT A;  1XNQ Q;  2WAC A;  1Q1E A;  1KXL A;  4EVO A;  4DAV A;  5C3E B;  3UE0 A;  5KYI A;  1D6E C;  4IJL A;  5IT9 L;  3JAM c;  1VQ5 A;  2ICE C;  1A15 A;  4IJH A;  4A4I A;  5EQ0 A;  3ULP A;  1JB7 A;  3GV6 A;  4X65 L;  5AFW A;  3NXW A;  2ZM6 Q;  4OON A;  4UP7 A;  5G3L F;  4EGV A;  5KNC A;  4C3I H;  1VS0 A;  4QF4 A;  1HZA A;  3A7L A;  3BYT B;  2HHH L;  3S2D H;  2RDH A;  1L0Y B;  2PW5 A;  2I5H A;  1PRT C;  5C3X A;  3DUZ A;  5IT9 c;  5IP9 G;  1PYB A;  2LKV A;  2ES2 A;  2A6E D;  4PZ6 A;  3PUW A;  4BXX G;  2JSO A;  2ZTE A;  4P72 A;  4YHH Q;  5IIF A;  4A3C G;  3GTM B;  3WOE A;  4DK6 C;  1HA6 A;  1EYC A;  4JOI C;  1SDF A;  1KLG D;  3NQI A;  4Q5V A;  1EOV A;  2VB3 X;  3SR1 A;  1XWE A;  1YNJ C;  3TZU A;  3I2Z A;  4A3C H;  1S5E D;  4RHS A;  1N9W A;  5ISR A;  3J7A F;  1EIG A;  3K0X A;  3E3X A;  1O7L A;  1BVS A;  1S5B D;  2IT1 A;  4UY8 C;  1VQ7 A;  2MO1 A;  2RBM A;  4A93 H;  2NVX H;  4DR7 L;  4KK7 A;  4X62 L;  2CFM A;  1BUV T;  2I0Q A;  3K7U C;  3NWS A;  2IHF A;  3KLW A;  4IPH A;  4ZKC B;  3GTL B;  2A1A A;  2UUC Q;  4OX9 L;  1SN8 A;  1M8A A;  3J81 E;  4BY1 B;  5FK9 C;  1AW7 A;  5IE8 A;  1EWC A;  3CRK C;  4UDU C;  5C0X G;  3I3C A;  4J1M A;  1T9H A;  2WP8 J;  3DMU A;  3QOJ A;  2YTY A;  3VYT A;  4QGU A;  3T1H Q;  3LX0 A;  3K0Y A;  3OTO Q;  1T5E A;  2F0F A;  1BR9 A;  2K01 A;  4ALP A;  3VR3 A;  2D9U A;  4JK1 C;  3EVQ A;  4A3K G;  2VXW A;  4JYA Q;  4DKA C;  4Y52 H;  3SK8 A;  3KDF B;  1HR0 L;  4H7B A;  2KJX A;  5ELF A;  4KD3 A;  1IKM A;  5CC4 A;  2F52 A;  4EQP A;  2XVS A;  2DJG C;  2A6E C;  4JV5 L;  1CKN B;  5NUC A;  3M7N A;  1RD9 D;  3GTO H;  5FOB B;  3MXG A;  4K5V A;  2Q8T A;  3TS2 A;  1DM0 B;  1SEB D;  3HOZ G;  1SFO H;  3R2T A;  2R7Z H;  2K5N A;  1H9J A;  5I4D A;  3ERO A;  2PMZ B;  5GAG C;  3M3Y B;  3NHH A;  5BR8 Q;  2LXJ A;  4F7X A;  3KF6 B;  4K8J A;  5G3L D;  5ELC A;  1WCM H;  3J80 c;  1F9P A;  1SYE A;  2VNU D;  1EIY B;  1I4G A;  5DAU A;  1HA5 A;  2VW9 A;  4BBS H;  3U4V A;  4RH6 A;  1EYA A;  3I8Z A;  2NN6 G;  2JA6 G;  4LF4 Q;  2NB0 A;  3C3L A;  2N78 A;  3A0J A;  4UPA A;  4XT3 B;  3HOX B;  3PUX A;  3FRP B;  4P2C B;  3UDX A;  3M4O B;  5EKL A;  3D0F A;  4B3T Q;  1YNX A;  1IYJ B;  5KIX A;  1HNX L;  4LFC L;  3CCU A;  5IYC G;  2I5L X;  1LT4 D;  2A5H A;  3I7F A;  2O5J C;  4UP9 A;  4ZUI A;  4CJ2 C;  4G7H C;  5JPN C;  3GTK H;  4HCE A;  3J81 j;  2AHO B;  2Z1C A;  4OIK A;  2WIN B;  2F0S A;  1A3V A;  1O7Y A;  4A3F H;  5CV5 A;  2JJQ A;  4P74 A;  2WB1 G;  5F2D A;  3MAQ A;  1Q82 C;  1I6V C;  5C0X H;  1Q81 C;  3EBE A;  2N88 A;  2RDG A;  4C2M H;  1CZG A;  4MTK A;  5C3E G;  5C5L A;  4A3I G;  4DR4 L;  5C6A A;  4BBR B;  1QVC A;  2UU9 Q;  1EWH A;  1PH1 A;  3P20 A;  4PZ8 A;  4JI0 Q;  1K8M A;  5FO8 B;  1JJC B;  1CKN A;  1VQP A;  4P75 A;  2J4X A;  2L0C A;  1VDZ A;  2KA7 A;  1PH5 A;  4OO1 G;  2AUK A;  2KHI A;  4GKK L;  4XYQ A;  5M3M H;  2KUM A;  4OO1 H;  4LWC A;  4CBV A;  1B7Y B;  2ZM6 L;  4V19 0;  3MEF A;  1SBB B;  3RLN A;  3SEB A;  5EBD A;  3DEO A;  1SYD A;  3S9W A;  4IN3 A;  4QMG A;  1HR0 W;  1EU3 A;  1TWA B;  5IOC A;  1D5M C;  2EY6 A;  2R61 A;  4K2K A;  1HHV A;  3H3V C;  2JA7 B;  3CC4 A;  5CV9 A;  5HY6 A;  3I73 A;  4JI8 Q;  4LF5 Q;  4LFA Q;  1N36 L;  1HZ9 A;  4JI0 L;  2NVQ H;  1ICW A;  1OXV A;  3A54 A;  4GNX A;  2F4V L;  3QIA A;  5CBA E;  1LTS D;  1JWU D;  4OEM B;  1PH6 A;  1EYG A;  1FD7 D;  2NVY H;  3M3Y H;  4NXM L;  1B9N A;  1K3B C;  3TBI B;  4BWG B;  2K52 A;  1VQG A;  1SNO A;  3P75 A;  2B2Y C;  5DM7 3;  5C4J H;  1IBK L;  2EE1 A;  1R9T H;  3PO3 H;  1AE2 A;  2X69 A;  2F3V A;  1HQR D;  5IY0 A;  2DJF C;  1GUN A;  1CA5 A;  5IGG A;  3J80 i;  2GA4 B;  5LMN Q;  5M5Y H;  1E7Z A;  4HN7 A;  2YU9 B;  4A3F G;  1GD7 A;  2BA0 A;  1U5K A;  1TWG B;  4I65 A;  1ENC A;  3KUP A;  3VYR A;  1W3S A;  4YWL A;  4FYD A;  4YY3 L;  4GN3 B;  1S40 A;  3CCM A;  4AQY Q;  4OXP A;  3R3O A;  1H9S B;  1ZEQ X;  4DK0 A;  2A68 C;  2RCF A;  4P73 A;  5IOD A;  2KHJ A;  1QVF A;  2K4K A;  2K04 A;  2Z6K C;  5M3M B;  2RDF A;  4A3J B;  1UE6 A;  3CKI B;  2N49 A;  2G5D A;  2K5V A;  1PZI D;  1SYF A;  4C3J B;  4MZ9 A;  5IGB A;  5C0X I;  2HT1 A;  4CGY B;  2NBF A;  2KCM A;  4JV5 Q;  2QKI C;  5CV7 A;  3FPP A;  5C4H A;  1DCZ A;  1RIP A;  5JEA G;  1EOT A;  5C4J B;  3CCL A;  2MO0 A;  1AE3 A;  4RGN A;  3K8A A;  4CKB A;  4LUO A;  3OMC A;  2JE6 I;  5EPK A;  2EYO A;  3KF8 A;  1TS5 A;  5D14 A;  4K2L A;  3GO5 A;  3WWV A;  3DM1 A;  3I70 A;  4YWK A;  1OXS C;  4ME3 A;  2AQ1 B;  5COR A;  2XWB B;  1L1O B;  3MXU A;  4GS3 A;  4KKS A;  4DV7 Q;  1EU4 A;  3HKS A;  4IPG A;  5JVG 3;  3HZX A;  4A3J G;  4HJ5 A;  2JA8 B;  3HFZ B;  1A2U A;  2F0T A;  2KEE A;  4WJ4 A;  1SMX A;  3MA2 B;  4GLA C;  1TS3 A;  1S5D D;  2RHS B;  4A3J H;  3ND8 A;  1D7Q A;  3BU2 A;  2R92 H;  2L55 A;  4Z9C B;  4A3K H;  2F0H A;  2IHE A;  1RHP A;  4A3I H;  3DLL A;  2NVT B;  2D5D A;  3UE1 A;  1NR4 A;  1EIH A;  4WJW A;  1HFN A;  1UNS A;  4KKU A;  2XRS D;  2NN6 I;  4A3B B;  2VQF L;  1H95 A;  1XMQ L;  4A3G B;  4KY6 A;  1UE5 A;  2DY7 A;  1H9M A;  2RVL A;  3PIO A;  3A8J E;  5M3F B;  1KDB A;  1JJG A;  1X55 A;  4TQU S;  1J9O A;  4X64 L;  3W1B A;  5M5X B;  1OXU A;  4DK3 C;  3FVQ A;  1V8Q A;  3AFP A;  2SDF A;  4DA2 A;  3N52 A;  1V43 A;  3L3O C;  1V1O A;  2K5H A;  2E5L Q;  3HEJ A;  1NY4 A;  3SGI A;  1K8G A;  2OWO A;  1PFB A;  2HQE A;  1FJG Q;  4GKK Q;  2ZTD A;  2AKW B;  2ENB A;  4DV0 L;  5CV6 A;  4ZRZ A;  1YI2 A;  1JB3 A;  1TVX A;  1KL9 A;  3J7A V;  4NKL A;  5JEA H;  1TQO A;  2RA4 A;  1BCP C;  3OSO A;  1SE3 A;  1SAP A;  3UI2 A;  1VQM A;  4AH6 A;  2VQE L;  5KRU A;  4A3K B;  1QNU A;  2DY8 A;  3SK5 A;  4DV0 Q;  4JI5 L;  3K57 A;  1XMO L;  4OO1 I;  4XIG S;  1FVI A;  1G6P A;  1B3A A;  1BCP B;  1IYU A;  3DWP A;  2JA8 H;  2NYZ D;  1LTA D;  5IYC H;  5FJ8 H;  4QUF A;  2PQE A;  3A5U A;  3S17 B;  5HGT A;  4X64 Q;  4IOC A;  4BBS B;  1C7Y A;  4O2D A;  2QIL A;  2LSS A;  1VQB A;  2K75 A;  3ERS X;  3G7L A;  5FLM G;  4DV1 L;  2OQ0 A;  1Q7Y C;  1QWY A;  3BG3 A;  5DM6 3;  1KHI A;  1E1O A;  1IW7 C;  4I7A A;  2J7Z A;  3HRZ C;  2BE5 C;  2IPK D;  2HQL A;  1OO9 B;  4JBK A;  1PH3 A;  1VQN A;  3MZ5 A;  2KCN A;  2Y0S B;  5JPM C;  4JCV E;  5KGU A;  2KED A;  2X6G A;  3CMA A;  1Q8K A;  4OX9 Q;  4PG3 A;  2NVQ B;  4Q0F A;  3DHQ A;  2MJ8 A;  3A56 A;  1AP0 A;  1CFM A;  5KEE A;  4HTH A;  1PZJ D;  1TY0 A;  1EQR A;  1ENA A;  1YJW A;  2BDN A;  4DGZ A;  4FVM A;  5D3D A;  4OWX B;  4A3B G;  2PI2 E;  2QEJ C;  1HH2 P;  3I4N H;  1J5E L;  1SYC A;  4KD4 A;  2B2U A;  4B3R Q;  3JAM L;  1SXT A;  4F8M A;  2JN4 A;  1C9O A;  2B2Y A;  3KJO A;  2E2J H;  3ULL A;  3S16 B;  1I6H H;  3CCQ A;  5HGQ A;  1X65 A;  3KLS A;  3BYY B;  4NPS A;  2ZXR A;  1I50 B;  2Q2T A;  2AWO A;  1EQQ A;  3MXP A;  3T13 A;  3MTS A;  1K83 B;  1EY0 A;  1CA6 A;  3RZO B;  1GO3 E;  3KDF A;  1D8L A;  2CH4 W;  3PO3 B;  4TKO B;  1IZ6 A;  3J7Z C;  4YIJ A;  2WV6 D;  3U58 A;  2B2T A;  3D4D A;  3BZC A;  3HOX G;  4FF3 A;  2V1C C;  3E9I A;  1HNW Q;  4O0A A;  1Q12 A;  3J81 i;  3TQY A;  2B3G A;  1XMQ Q;  1BNZ A;  2JA6 B;  1MJC A;  4A3G G;  1SE8 A;  1QZH A;  1VMP A;  1F9R A;  4DV5 L;  3AB9 A;  4DR2 L;  2JYO A;  3EA6 A;  5M3F G;  2F03 A;  4BY7 B;  1D2B A;  2JA7 G;  1B1Z A;  3VR6 A;  4Y7N H;  1WTQ A;  1HTP A;  4GLX A;  1SNQ A;  1KNE A;  4DAP A;  3CHB D;  3S1Q B;  5EKK A;  4QQB X;  2OXP A;  1WTO A;  5I9P A;  2AQ3 B;  1EEI D;  4J15 A;  1AN8 A;  4IFD I;  2BH2 A;  2JP1 A;  1XNR L;  3I4M G;  3NSW A;  2KCC A;  2AUJ D;  2D0O A;  1A6X A;  4CDD C;  4ZYS A;  2VQE Q;  2K33 A;  4K5X A;  3A8K E;  1Y1W B;  2TMP A;  1W2B A;  3D3R A;  1CK1 A;  3I56 A;  1EY6 A;  2E75 C;  1STA A;  4NXN L;  2CWP A;  1QNK A;  1FJG L;  2QCP X;  1JC7 A; 
#chains in the Genus database with same CATH homology
 2HCC A;  4KTA A;  2D62 A;  1YNJ D;  3I4M B;  2WB1 B;  1V1P B;  3A8I E;  4L6T B;  1CQF A;  3FMC A;  1GHJ A;  4A3I B;  1U9R A;  4ZAI A;  1S4Z A;  3J81 L;  1BBX C;  1F2L A;  4FP5 D;  3SVM A;  3HG9 A;  2FIN B;  3NPP A;  4N9P A;  3MHB A;  3NUC A;  1PXU A;  3T4A C;  3HP3 A;  3ERQ A;  4LK1 C;  1J8I A;  2Z8L A;  4G7Z C;  1SYB A;  4ULL A;  1UUP A;  2F0M A;  3BZD B;  4MIU A;  3F2U A;  3AU7 A;  5IGD A;  4O42 A;  3BDL A;  5C5M A;  5A35 A;  4C3I B;  2B2V C;  4NMZ A;  3RLF A;  4DF7 A;  3GV3 A;  4I7Z C;  1LTR D;  1A2T A;  4ID6 A;  2ICI A;  4J6H A;  4WFN 3;  4DAY A;  2K7V A;  4G4K A;  3RD4 A;  1V1P A;  4B9W A;  1MBY A;  1PRT B;  4R8I A;  3K5L A;  2CW0 C;  1ILQ A;  1JQY D;  1HRJ A;  2J0T D;  3BDC A;  1DON A;  2N55 A;  2LMC B;  2R3Z A;  3H94 A;  1LT6 D;  1Q3L A;  2KOL A;  1C8C A;  5K36 H;  4PMW A;  3SDZ A;  1H9S A;  2F0L A;  2XRQ D;  1I4R A;  1MI2 A;  1C4Q A;  2TSS A;  3QG1 A;  4ABN A;  5E4X A;  4A93 B;  3PV0 A;  4HMI A;  4ODG A;  1G29 1;  4KY7 A;  4IUU A;  3W2D A;  1WD1 A;  1SJH D;  1TS4 A;  4C3H G;  1O7Z A;  2F4I A;  5CGK A;  3GTJ B;  1JOR A;  2DNC A;  3PUY A;  5FO9 B;  5KND A;  4B9X A;  3GTQ B;  3I4N B;  1RJT A;  2NTS A;  4RKL A;  1BQQ T;  4RGT A;  3TN2 A;  2A6H C;  3GQB A;  1E2V A;  4M1U B;  1EY4 A;  3N6R A;  2EJG C;  2MHV A;  1JWM D;  3OMG A;  4C3H B;  4KJN A;  3KBG A;  1HPC A;  5T1G A;  3J80 E;  5JAV A;  1Z47 A;  2CHB D;  5C3W A;  4IFD H;  3NK9 A;  3KBX A;  3HOZ B;  4R9W A;  1IL8 A;  2EY5 A;  1LTT D;  4XQN A;  1LT5 D;  5K36 G;  2FMM A;  4N9T A;  4IFD G;  3E5S A;  3GTP B;  1KAB A;  1I4H A;  1SFO B;  1XX8 A;  1ENF A;  2IWH A;  2B39 A;  5BN5 A;  2B63 B;  4L8J A;  3K5O A;  1W6J A;  2Z4I A;  5IT9 E;  3TP5 A;  5J1Z A;  2EDG A;  3SK4 A;  1HQM C;  4RCN A;  5JJZ A;  1PDQ A;  4EQO A;  2B2T C;  5IGC A;  1B9M A;  1A3T A;  3K59 A;  2R6G A;  3HS0 C;  2F0G A;  4JBW A;  3DWQ A;  2VUM B;  2B2W C;  3HOY B;  3HOW B;  2K5W A;  3H0G B;  1G2S A;  4HED A;  3MC0 B;  4IUV A;  3QO2 A;  2XSC A;  3BDO A;  4KN4 C;  4OHJ A;  5C44 B;  5ELE A;  4HR7 B;  1Y1V B;  3M7G A;  1F9S A;  4A3E B;  3G6J B;  1VCI A;  4KY5 A;  3VYS A;  1CT1 D;  3GTG B;  1F77 A;  2PYK A;  4U67 3;  3OOC A;  1FGB D;  2BA1 A;  3SXH A;  2KQ3 A;  4DNR B;  3GP7 A;  2O4X A;  3Q22 A;  4RAU C;  1D1K A;  2KVM A;  2IW3 A;  3L9A X;  3M4Y A;  4R8N A;  4RA8 A;  4X3U A;  1XXG A;  2QF7 A;  3TDQ A;  1KDA A;  4FF1 A;  5COY A;  1JR0 D;  3EFX D;  2RKS A;  5A2Q E;  5CR3 A;  4H44 C;  4U68 A;  2HDL A;  1RDP D;  3FKI B;  3LWE A;  2F0Q A;  2LY7 A;  1QB5 D;  3ONA B;  3T16 A;  1H9R A;  2WKD A;  2DNE A;  1ZYR D;  4K6L A;  1NCV A;  2L5T A;  1G6Z A;  1ZYR C;  5EJW A;  4NDX A;  2F0U A;  4X3T A;  2CVR A;  4F87 A;  2PO4 A;  2PZW A;  2IJ0 A;  3LNN A;  1EY5 A;  3ND9 A;  3P1H A;  1HUM A;  1PLF A;  4PQX A;  2E74 C;  3HKZ B;  1STN A;  2D2C C;  4LAA A;  4PNY A;  4XXE A;  4FF4 A;  4AYB B;  2C9O A;  1DYQ A;  1X3Q A;  1SE4 A;  3C2P A;  2RSO A;  4RGM A;  1GJX A;  1JWS D;  1TWH B;  4KMU C;  2EYF A;  1S5F D;  5TSS A;  4DFA A;  3VR2 A;  1EY9 A;  3DWA A;  4H0L C;  5FLX L;  1CZW A;  1WTV A;  1EYD A;  1TWF B;  4A3F B;  2L9H A;  1ET9 A;  2JEB I;  1B4O A;  2CW0 D;  3QB3 A;  1UAP A;  1STB A;  1E2Z A;  3A7A B;  1EQV A;  2ID0 A;  2LFN A;  2F0D A;  1DOM A;  5KYL A;  2EZV A;  2PZU A;  4F88 A;  4ILW A;  3S1M B;  4EQN A;  4KI0 A;  4OGQ C;  3S2H B;  3NE5 B;  3RUZ A;  1O78 A;  1CI3 M;  2A68 D;  4MN3 A;  4WRD A;  1Y8O B;  1Z6H A;  2PPB C;  1X3P A;  1SJE D;  1STG A;  2MP1 A;  4A3M B;  3X3N A;  1UEA B;  1CQV A;  4IAL A;  1XYI A;  2BE5 D;  4BA1 I;  1Y69 U;  1TT2 A;  2EY1 A;  5JOB A;  1F9Q A;  1A3U A;  2K03 A;  1WTR A;  2M2L A;  2MGS A;  2NWG A;  2F0W A;  1DZ1 A;  5LL6 X;  4PMB A;  2K5Q A;  5FLX E;  1JIC A;  1STE A;  4K8I A;  3Q23 A;  1SND A;  5IGE A;  5I9O A;  1YNN C;  2B8G A;  1WD0 A;  4HMJ A;  2NVY B;  3PIO 3;  2NVX B;  1HFG A;  4WOR A;  2MPM A;  3ITP A;  4C3I G;  2EYJ A;  4RHR A;  2R7Z B;  4HCS A;  4LJZ C;  2XN9 C;  1ET6 A;  1ESR A;  5ELB A;  1TR5 A;  1WCM B;  5E3F A;  3V96 A;  3C1F A;  2CQA A;  2OT2 A;  3R2I A;  1U4P A;  1I3Q B;  1Q1B A;  3MWY W;  3VYU A;  3I4L A;  1RCV D;  2NN6 H;  4O1N A;  1H9K A;  3C46 A;  4C56 C;  2HUG A;  1JOK A;  1TY2 A;  1DJR D;  1AEX A;  3K58 A;  2EVB A;  3Q0A A;  3OPO A;  2E2H B;  1FNV A;  3TP6 A;  2BOS A;  1EL0 A;  1EY8 A;  3BVM A;  4CJ1 B;  1IKL A;  2E76 C;  1KDC A;  4RGO S;  2O5I C;  4IUN A;  1ESF A;  2K28 A;  4HSV A;  3R93 A;  5HUR A;  1WTP A;  1Y8N B;  3QJY A;  1SE2 A;  4CKE A;  3GTK B;  2O2L D;  1NSN S;  1TU2 B;  3NQT A;  2NZ1 D;  3IFT A;  1QJO A;  2G9H D;  1EZ6 A;  3OHX C;  3I72 A;  5BN3 A;  1SMY D;  4ZK9 B;  4DK1 A;  3EQL C;  2IX3 A;  1PFN A;  2PZT A;  4XQJ A;  1TWC B;  5DNF A;  3NBH A;  4IZ8 A;  1Y8P B;  5A2Q L;  3CQZ B;  1PFM A;  4TRD A;  4RKB A;  3T53 B;  1IHZ A;  2F0J A;  1ROD A;  1R9T B;  2B2V A;  3GTO B;  3RMH A;  1WTX A;  4QUC A;  4NW2 A;  1BO0 A;  2ZXP A;  3IL8 A;  1W6K A;  4DXG A;  3MEH A;  5JEA J;  1GUS A;  3KLS X;  3VA7 A;  2EY2 A;  4DXF A;  3SK6 A;  3S15 B;  3MXN A;  4DNT B;  3ZYY X;  3HOV B;  2EYM A;  1I4X A;  5I2X A;  3QWN A;  3TME A;  2EYL A;  1BOS A;  1JOQ A;  2M00 A;  1DD2 A;  3VR5 A;  3KLR A;  3HOU B;  2Z4H A;  2WKC A;  1GHK A;  1LT3 D;  5LL6 S;  1PTO B;  3P7J A;  4K14 A;  4XYO A;  1KNA A;  1QIL A;  3WDN A;  4QCL A;  3D6W A;  2MUY A;  1AFP A;  4KHZ A;  4KV6 A;  2F3W A;  1AZQ A;  5E1F A;  1EQT A;  1GUT A;  2DN8 A;  2BDO A;  1PTO C;  4K5W A;  1B53 A;  1U4L A;  3PUZ A;  1ZKO A;  3I91 A;  3IKJ A;  2E2D C;  4QB4 A;  4H13 C;  4OIJ A;  1VF7 A;  2F0E A;  3OWE B;  3AMU A;  1M4V A;  1SMY C;  2F0I A;  1IW7 D;  1ILP A;  1CHP D;  2F0N A;  5D3I B;  1EY7 A;  3J80 L;  3T56 B;  4DN4 M;  2R92 B;  2OF1 A;  1CHQ D;  2SOB A;  3D6C A;  1QCB D;  2QDB A;  5EBC A;  2B2W A;  4FXG C;  3FPU B;  3C1E A;  2VB2 X;  5C0X J;  4CHT B;  5J22 A;  3E6Z X;  1ML0 D;  3K7A B;  2WII B;  1LAC A;  3CRL C;  2JXM B;  1R4P B;  4C2M B;  1HXY D;  1S5C D;  1BF4 A;  2F1M A;  1OXT A;  2ZT9 C;  2A69 C;  2B8F A;  3VR4 A;  3D4R A;  1HUN A;  3PUV A;  1MGS A;  1K8O A;  3SE0 A;  2E2I B;  2XWJ B;  3HGB A;  2K32 A;  3TP7 A;  1PRT D;  5CMD A;  1VMC A;  2FHT A;  3K5M A;  3GD7 A;  4TSS A;  1F2Z A;  2IX1 A;  4BA2 I;  4DU9 A;  3L7Z C;  2F0P A;  1JE4 A;  1JCK B;  1QG7 A;  1AZP A;  2EXZ A;  1GOZ A;  1RTN A;  3CU7 A;  5C4X B;  3Q6S A;  5M5Y B;  3EJI A;  2SNM A;  1RKN A;  4HAE A;  2SNS A;  5M9O A;  3OIQ A;  2H1E A;  1RTO A;  3W3A A;  5CV4 A;  3URY A;  4OL7 A;  4C1N I;  4PV1 C;  2L4N A;  1GUW A;  3K6O A;  4FNF A;  3TP8 A;  4RCO A;  5T1I A;  4MHE A;  4IFD J;  1LAB A;  2OEO A;  2R93 B;  3SHL A;  1G91 A;  4XDX A;  4IUQ A;  1NUC A;  2AWN A;  1LTI D;  5CV8 A;  4GZY C;  2EJF C;  2H4O A;  1IYV A;  1HTL D;  2KHS A;  1STH A;  5I6W A;  5EPL A;  1F2M A;  2RQX A;  1GUG A;  1SNM A;  2AQ2 B;  3OIP A;  5IGF A;  2A74 C;  2F0O A;  2PCF B;  3BVZ A;  1NR2 A;  1MD2 D;  3MFY A;  1LTB D;  2EPB A;  3PMF A;  4X3K A;  4PMC A;  1PTO D;  2K1B A;  4J8Q A;  1MSG A;  3H6M A;  3FEW X;  4UAI A;  2E2J B;  1B2T A;  2FJ2 A;  3D4W A;  1EZ8 A;  3Q24 A;  2FFK B;  4FXK C;  3RZD B;  3I90 A;  1I4P A;  1KLU D;  4FO2 A;  5I2Y A;  4ZUJ A;  3H91 A;  2IL8 A;  5I6Y A;  2B2U C;  1B44 D;  3V2T A;  1WVL A;  4HSP A;  5EKI A;  2RSN A;  4QIW B;  2ZXO A;  5FO7 B;  3DEP A;  4IUR A;  3TSS A;  1TII D;  2HDM A;  2IX0 A;  3NP8 A;  3E0J A;  5DEH A;  4S3S A;  1BCP D;  3OWF A;  1PTO F;  1VF5 C;  2A73 B;  2PW7 A;  3NWT A;  3OW7 A;  2V4D A;  4ZLT F;  3PO2 B;  2A69 D;  3WOF A;  5M5W B;  3DXJ C;  3BVG A;  3S1N B;  1JOO A;  5D65 A;  4B08 A;  4RWS C;  4ME5 A;  2I07 B;  3KK7 A;  2Q8R E;  2G9D A;  1TS2 A;  4XT1 B;  2L12 A;  1OXX K;  1E0B A;  1QOH A;  5EGT A;  4KKT A;  1Z7T A;  2I46 A;  2PNR C;  4XTC S;  3PIP 3;  1TKW B;  1BCP F;  1II3 A;  1I6H B;  1XTC D;  3NTI A;  2M9V A;  2WAQ B;  5ELD A;  1HCZ A;  1DXM A;  4BS9 A;  2JA5 B;  2F0V A;  1QE6 A;  1LLR D;  3A55 A;  4C1N K;  2EJM A;  2X6L A;  1O80 A;  1SYG A;  1SNP A;  4M8A A;  1F2Y A;  3IAY A;  1G2T A;  2NUC A;  1L0X B;  2EYH A;  5K5P A;  1STY A;  4KHV A;  1MSH A;  4KN7 C;  1E2W A;  3LWU A;  1WTW A;  3BS1 A;  2HCI A;  1GXD C;  1LV9 A;  3V05 A;  4K6D A;  1RF2 D;  1D5X C;  3TZD A;  3U9S A;  4CKC A;  2Q8I B;  1Q90 A;  2EOT A;  4LMQ D;  5CBE E;  5FKA C;  1KTK A;  1KAA A;  4IQZ A;  1BXT A;  1BDO A;  3M85 A;  1LO5 D;  1GUO A;  3X3M A;  4CJ0 B;  1FR3 A;  2NTT A;  3NTK A;  1D5Z C;  4FXD A;  2KEC A;  4FF2 A;  1Q8I A;  3T51 B;  5EPJ A;  4IUP A;  3S14 B;  1ONL A;  4A3D B;  1EEF D;  2BCO A;  1CM9 A;  1CTM A;  3MVV A;  3NBI A;  3S2D B;  5KNB A;  1R4Q B;  3R8B A;  2LS0 1;  4G7O C;  4X3S A;  1U4M A;  2YYZ A;  2C5C A;  4V0B A;  2XNA C;  5CYU A;  3D31 A;  1B50 A;  1PTO H;  1NAP A;  5LHY 1;  2F0K A;  1U4R A;  4C3J G;  4G57 A;  3U9O A;  1YNN D;  4NP5 A;  3J7Y W;  1FNW A;  1D1I A;  3JAM E;  1DOL A;  2L1B A;  2XIW A;  3VA5 A;  2JEA I;  1T5X D;  2EYP A;  4Y7N B;  2SEB D;  4ZQ3 A;  1PZK D;  3MFG A;  3O13 A;  4XQQ A;  5C4Z A;  1FNU A;  1G8Z D;  1PYW D;  1LTG D;  4KJO A;  4ZKB B;  5BN4 A;  1C48 A;  3IFD A;  4L63 B;  2K5D A;  5E4W C;  5J39 A;  3D8G A;  2K05 A;  1X32 A;  4RFB A;  4IUT A;  4E6I A;  3S1R B;  2K6A A;  2FMC A;  1PMR A;  3QOL A;  1FYC A;  3FDT A;  5JVH 3;  1SSO A;  1PRT F;  3NTH A;  2A6H D;  2L11 A;  1EFI D;  3H09 A;  1DOK A;  1I4Q A;  3K5N A;  1SNC A;  1ZXT A;  2WAC A;  1Q1E A;  4EVO A;  4DAV A;  5C3E B;  5KYI A;  1D6E C;  5IT9 L;  2ICE C;  1A15 A;  5EQ0 A;  3GV6 A;  5AFW A;  3NXW A;  5G3L F;  4EGV A;  5KNC A;  4QF4 A;  3A7L A;  3BYT B;  2RDH A;  1L0Y B;  2PW5 A;  1PRT C;  5C3X A;  3DUZ A;  2LKV A;  2A6E D;  3PUW A;  2JSO A;  5IIF A;  3GTM B;  3WOE A;  1HA6 A;  1EYC A;  1SDF A;  1KLG D;  3NQI A;  4Q5V A;  2VB3 X;  3SR1 A;  1XWE A;  1YNJ C;  3TZU A;  1S5E D;  4RHS A;  5ISR A;  3J7A F;  1EIG A;  1O7L A;  1S5B D;  2IT1 A;  2RBM A;  4KK7 A;  1BUV T;  3NWS A;  4ZKC B;  3GTL B;  1M8A A;  3J81 E;  4BY1 B;  5FK9 C;  1AW7 A;  1EWC A;  3CRK C;  4UDU C;  5C0X G;  3I3C A;  2WP8 J;  4J1M A;  3DMU A;  3QOJ A;  3VYT A;  3LX0 A;  3K0Y A;  1T5E A;  2F0F A;  1BR9 A;  2K01 A;  3VR3 A;  2D9U A;  4JK1 C;  3EVQ A;  2VXW A;  3SK8 A;  4H7B A;  2KJX A;  5ELF A;  4KD3 A;  1IKM A;  5CC4 A;  4EQP A;  2XVS A;  2A6E C;  5NUC A;  3M7N A;  1RD9 D;  5FOB B;  3MXG A;  4K5V A;  2Q8T A;  1DM0 B;  1SEB D;  3R2T A;  1H9J A;  5I4D A;  3ERO A;  2PMZ B;  3M3Y B;  3NHH A;  4F7X A;  4K8J A;  5G3L D;  5ELC A;  1SYE A;  1F9P A;  2VNU D;  1I4G A;  5DAU A;  1HA5 A;  4RH6 A;  1EYA A;  3I8Z A;  2NN6 G;  2NB0 A;  3C3L A;  3HOX B;  4XT3 B;  3PUX A;  3FRP B;  4P2C B;  3M4O B;  5EKL A;  5KIX A;  1LT4 D;  2A5H A;  2O5J C;  4ZUI A;  4CJ2 C;  4G7H C;  5JPN C;  4HCE A;  2Z1C A;  2WIN B;  4OIK A;  2F0S A;  1A3V A;  1O7Y A;  5CV5 A;  5F2D A;  3MAQ A;  1I6V C;  5C0X H;  2N88 A;  2RDG A;  1CZG A;  5C5L A;  5C6A A;  4BBR B;  1EWH A;  3P20 A;  1K8M A;  5FO8 B;  2J4X A;  2L0C A;  1VDZ A;  2KA7 A;  4OO1 G;  2AUK A;  4XYQ A;  2KUM A;  4OO1 H;  4CBV A;  4V19 0;  1SBB B;  3SEB A;  5EBD A;  3DEO A;  1SYD A;  3S9W A;  4IN3 A;  4QMG A;  1EU3 A;  1TWA B;  5IOC A;  1D5M C;  2EY6 A;  2R61 A;  4K2K A;  1HHV A;  3H3V C;  2JA7 B;  5CV9 A;  3I73 A;  1ICW A;  1OXV A;  3A54 A;  3QIA A;  5CBA E;  1LTS D;  1JWU D;  1FD7 D;  1B9N A;  3TBI B;  4BWG B;  1SNO A;  3P75 A;  2B2Y C;  5DM7 3;  2EE1 A;  2X69 A;  2F3V A;  1HQR D;  1GUN A;  1CA5 A;  5IGG A;  2GA4 B;  4HN7 A;  2YU9 B;  2BA0 A;  1TWG B;  4I65 A;  1ENC A;  3KUP A;  3VYR A;  4FYD A;  3R3O A;  1H9S B;  1ZEQ X;  4DK0 A;  2A68 C;  5IOD A;  2K04 A;  5M3M B;  2RDF A;  4A3J B;  3CKI B;  1PZI D;  1SYF A;  4C3J B;  5IGB A;  5C0X I;  4CGY B;  2NBF A;  2QKI C;  5CV7 A;  3FPP A;  5C4H A;  1DCZ A;  5JEA G;  1EOT A;  5C4J B;  4RGN A;  4CKB A;  3OMC A;  2JE6 I;  5EPK A;  2EYO A;  3KF8 A;  1TS5 A;  5D14 A;  4K2L A;  3GO5 A;  3DM1 A;  3I70 A;  1OXS C;  2AQ1 B;  5COR A;  2XWB B;  3MXU A;  4KKS A;  1EU4 A;  5JVG 3;  3HZX A;  2JA8 B;  1A2U A;  2F0T A;  2KEE A;  3MA2 B;  1TS3 A;  1S5D D;  3ND8 A;  2L55 A;  4Z9C B;  2F0H A;  1RHP A;  2NVT B;  2D5D A;  1EIH A;  1NR4 A;  1HFN A;  4WJW A;  1UNS A;  4KKU A;  2XRS D;  2NN6 I;  4A3B B;  4A3G B;  4KY6 A;  2DY7 A;  1H9M A;  2RVL A;  3A8J E;  5M3F B;  1KDB A;  4TQU S;  1J9O A;  5M5X B;  1OXU A;  3FVQ A;  1V8Q A;  2SDF A;  4DA2 A;  3N52 A;  1V43 A;  3L3O C;  1V1O A;  3HEJ A;  1PFB A;  2HQE A;  2ENB A;  5CV6 A;  4ZRZ A;  1JB3 A;  1TVX A;  3J7A V;  4NKL A;  5JEA H;  1TQO A;  2RA4 A;  1BCP C;  3OSO A;  1SE3 A;  1SAP A;  3UI2 A;  5KRU A;  4A3K B;  1QNU A;  2DY8 A;  3SK5 A;  3K57 A;  4OO1 I;  4XIG S;  1B3A A;  1BCP B;  1IYU A;  3DWP A;  2NYZ D;  1LTA D;  4QUF A;  2PQE A;  3S17 B;  5HGT A;  4BBS B;  2QIL A;  3G7L A;  1QWY A;  3BG3 A;  5DM6 3;  1IW7 C;  2J7Z A;  3HRZ C;  2BE5 C;  2IPK D;  1OO9 B;  3MZ5 A;  2KCN A;  2Y0S B;  5JPM C;  5KGU A;  2KED A;  2X6G A;  2NVQ B;  4Q0F A;  3DHQ A;  2MJ8 A;  3A56 A;  1AP0 A;  1CFM A;  5KEE A;  4HTH A;  1PZJ D;  1TY0 A;  1ENA A;  2BDN A;  4DGZ A;  4FVM A;  5D3D A;  2QEJ C;  1SYC A;  4KD4 A;  2B2U A;  3JAM L;  1SXT A;  4F8M A;  2B2Y A;  3S16 B;  3KLS A;  3BYY B;  2ZXR A;  1I50 B;  2AWO A;  3MXP A;  3T13 A;  3MTS A;  1K83 B;  1EY0 A;  1CA6 A;  3RZO B;  3PO3 B;  4TKO B;  4YIJ A;  2WV6 D;  2B2T A;  3D4D A;  4FF3 A;  1Q12 A;  1BNZ A;  2JA6 B;  1VMP A;  1F9R A;  3AB9 A;  2JYO A;  3EA6 A;  2F03 A;  4BY7 B;  1D2B A;  1B1Z A;  3VR6 A;  1WTQ A;  1HTP A;  1SNQ A;  1KNE A;  4DAP A;  3CHB D;  3S1Q B;  5EKK A;  2OXP A;  1WTO A;  5I9P A;  2AQ3 B;  1EEI D;  1AN8 A;  4IFD I;  2JP1 A;  3NSW A;  2KCC A;  2AUJ D;  1A6X A;  4ZYS A;  2K33 A;  4K5X A;  3A8K E;  1Y1W B;  2TMP A;  3D3R A;  1CK1 A;  1EY6 A;  2E75 C;  1STA A;  1QNK A;  2QCP X;  1JC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...