3P75A

Crystal structure of staphylococcal nuclease variant delta+phs v104d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALDRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3p75A00
5CV9A 3QB3A 5C6AA 1NUCA 4ZUJA 3DHQA 5KYLA 1JORA 4QF4A 1EQVA 2EYMA 5ISRA 1EYDA 2F0QA 5EKKA 2F3WA 3D8GA 3EROA 4NDXA 3MXPA 2RBMA 3MZ5A 4H7BA 4HTHA 4KD3A 2WACA 3EVQA 3PMFA 2RKSA 1EY8A 2F0UA 2F0JA 1SNQA 4F8MA 4QMGA 1SNDA 4RKLA 1STAA 2SOBA 1KDCA 5IGEA 3OMGA 4KY5A 5CV6A 3NHHA 4KY6A 5KEEA 4KJOA 2F0GA 4NKLA 2PYKA 5J1ZA 2EYJA 2F0SA 4K8IA 5KIXA 2EY5A 2EY2A 5I9OA 4EQPA 3TMEA 3OWFA 3TP7A 2PZUA 1EY5A 2F0KA 5C3XA 5CGKA 5I6WA 2HQEA 5J22A 2EYOA 1ENAA 4ID6A 5DEHA 3MHBA 3OSOA 2F0VA 5IOCA 1STBA 1SYFA 3D6CA 5J39A 2F0DA 2PZTA 4DGZA 1STNA 2F0FA 4RKBA 4PMCA 2F0EA 3C1FA 2KHSA 4YIJA 4HMJA 3ERQA 4J6HA 4NMZA 4S3SA 5CV5A 4DFAA 1EY7A 3HEJA 5I9PA 5C5MA 1KAAA 4DF7A 3T16A 3SXHA 5IGFA 1TR5A 4K6DA 2PQEA 3R3OA 1KABA 5C3WA 2F0MA 2F0LA 5KYIA 1A3UA 3SHLA 1II3A 1KDBA 1EYCA 5C5LA 1STHA 1TQOA 2M00A 4K5VA 1EY6A 4B9XA 3P75A 1EZ6A 1KDAA 4DU9A 1F2YA 5DAUA 2LKVA 2EY6A 2RDFA 4MIUA 5IGGA 1IHZA 4N9TA 3S9WA 4HMIA 4ME5A 3MEHA 4KV6A 4EQNA 3OMCA 2EYPA 1TT2A 4B9WA 4I65A 4R8NA 1SNPA 5CV7A 2QDBA 5IGDA 5K5PA 4KTAA 4IALA 1SYGA 2ENBA 5KGUA 4PNYA 2NUCA 2F0TA 1AEXA 4F7XA 5IODA 3MVVA 5C4ZA 4LAAA 4KY7A 3E5SA 1U9RA 1EY4A 4EQOA 1F2ZA 4QB4A 4EVOA 3D4DA 4PMBA 5KRUA 3TP8A 4ZQ3A 2EYHA 3VA5A 1SNCA 4KJNA 4WORA 3DMUA 1SYCA 3ITPA 2OF1A 3QOLA 4K5WA 1F2MA 5E3FA 1A2TA 1SYBA 2EYFA 2KQ3A 4IUNA 1A2UA 1STGA 3NK9A 4ODGA 2SNSA 5IGCA 4NP5A 2F0PA 3HZXA 5M9OA 3BDLA 4KD4A 2OXPA 3SR1A 1A3VA 3NP8A 3NXWA 2F3VA 1SNMA 5CV4A 5I6YA 5IGBA 5EGTA 3NUCA 3LX0A 4IZ8A 3P1HA 5E1FA 4E6IA 5CC4A 5HURA 3TP5A 5HGTA 1A3TA 2F0HA 1JOKA 4K5XA 2PW7A 3NQTA 3H6MA 1EY9A 1EY0A 4N9PA 4OL7A 3BDCA 4K2LA 4K2KA 5NUCA 5JAVA 2F0WA 4K8JA 2EXZA 5JOBA 1ENCA 2SNMA 3C1EA 2F0OA 5EKLA 4G57A 1SYDA 3T13A 3SK8A 3V2TA 3SK6A 1SYEA 3SK5A 4K14A 2PW5A 3D4WA 1JOQA 4J1MA 5C4HA 2F0IA 4WRDA 3EJIA 5IIFA 4TRDA 5CV8A 1STYA 2EY1A 3TP6A 1NSNS 5F2DA 1JOOA 1RKNA 1SNOA 2EYLA 2O4XA 2PZWA 3QOJA 4ZUIA 2F0NA 4KHVA 3RUZA 5CR3A 3SK4A 1EYAA 3U9OA 1EZ8A 2OEOA
chains in the Genus database with same CATH superfamily
2P5ZX 3A7LA 5JJKA 3CCMA 3NEMA 4QGUA 5JJIA 2E2HB 2JA6H 4A3KH 2RKSA 4L5QA 1SNDA 1YNXA 3RMHA 3HOZH 1SJHD 4DPGA 1KQSA 2K5QA 3F1ZA 1HNXL 1VMPA 3GDEA 1VQIA 1JICA 3GTPH 1QB5D 2F4IA 1S5BD 3J80E 4J15A 4GN3B 4QL5A 1CZWA 1LTTD 2K5HA 1SMYD 4X66Q 4KLKA 1OXUA 5IWAL 4GS3A 1NCVA 4YIJA 1KNEA 1R9TB 4S3SA 3CCLA 1E1OA 4LUZA 2CFMA 4KMUC 1SLJA 1TR5A 4RA8A 5C3WA 4JI3Q 3CCEA 4DK6C 5IGEA 1K8OA 1WTWA 1QCBD 4QIWE 5M3MH 1BKBA 1TWGB 4C56C 3FHWA 2EYPA 4I65A 1QOHA 3S17B 3PUYA 3I8ZA 5FKAC 1Q81C 4F7XA 4O1NA 1PTOC 4OXPA 4PZ7A 2HIVA 3D4DA 4CHTB 3KDFA 4K0KL 1B44D 3W5OA 2B2YA 2KEEA 3M85A 2C35B 2SDFA 3KUPA 4LFBQ 4K5WA 4DUZL 2RSNA 5E3FA 3RLNA 4A3EH 1FGUA 3PF5A 1A2UA 3GTGH 1G2SA 2EE1A 3R2TA 2OXPA 4IN3A 3SR1A 3NXWA 2NN6I 1B7YB 3HOYG 1HUMA 4O42A 2AWOA 1KRSA 1HR0W 3TP5A 1AH9A 1JOKA 3K5OA 2JA5G 1U0LA 3BVGA 1CKOA 1EY0A 3H6MA 4N9PA 1U4PA 1HA5A 1Q86C 1VQLA 2LXKA 1IKMA 1YBYA 1WTQA 3DEPA 3SK8A 1O7IA 3FPUB 3Q22A 2WAQB 5ELFA 3HRZC 1ENFA 3TDQA 4B3MQ 3R2IA 5F2DA 1EWIA 1MI2A 1QVCA 1EWCA 2F0NA 4LF9L 4FYDA 1PXUA 1WI5A 1JJCB 3JAML 2ZJQA 4CKCA 5ISRA 2NVQB 2K50A 3FKIH 3PMFA 4AYBB 4FO2A 4X66L 1DYQA 4R4CA 4R1JA 3H0GG 4KY5A 4HJ9A 1MGSA 2F0GA 2RCNA 3NBHA 2ZXOA 4DR1L 3S1MH 3FDTA 1KNAA 3K59A 3GP7A 4CDDC 4OGQC 1I3QH 2Z8LA 4BBRB 4JI3L 2C5CA 1STBA 1D8LA 1M4VA 4LF5L 2M9VA 1VQBA 1A62A 3C1FA 1XPOA 1GKHA 1SMYC 5I9PA 4BY1B 4LF8Q 5KNBA 4JBJA 2JSOA 2F0MA 5KYIA 1PFNA 4CDCC 1D5ZC 4ILWA 2K75A 4UY8C 1H9KA 1N36L 5A2QL 2JA7H 1FD7D 3QG1A 1IHZA 4JI8L 3AMUA 2FXQA 5LL6X 3KBXA 3I4MG 4B3SQ 4B3TL 1TWCB 1Q1EA 3IRBA 1SYGA 3ULPA 1D5XC 3D6WA 4U68A 4RFBA 3X3NA 2HT1A 1BVSA 2CKZB 2HDLA 2R6GA 1G291 1KLUD 3MC0B 3D3RA 1LTAD 1QUQB 1IL8A 2EYFA 2QW7A 1HH2P 1STGA 4ODGA 2KENA 1SFOB 4C3JG 1OXTA 1B9MA 4CKBA 2OTJA 4TVAB 3I4NB 2KCTA 4DV0Q 4JOIC 1XTDA 1PTOH 5AJ3Q 3P1HA 2R92H 1XMQQ 5M3FH 2RDGA 2F0HA 2PW7A 2F52A 1FGBD 3P20A 1GM5A 2YU9H 2MGSA 2NB0A 1EY9A 3BZDB 5CBEE 1S5CD 1RTOA 4LMQD 2LS01 1YNJC 2QCPX 1JOQA 3BJUA 1X3QA 5JVG3 2I07B 1J5EQ 4WRDA 3FP9A 4A3FG 3B6YA 2Y0SB 3VR5A 1JOOA 3S2DB 2R7ZB 2WKCA 1CHQD 1Q8KA 1KRTA 3S14H 1B50A 5C6AA 2L12A 1EYDA 4A3DG 1IBMQ 1IYJB 2JQOA 4KN7C 3ULJA 3RLOA 4N8FA 1G6ZA 2WV6D 4A3KB 2F0JA 2L5TA 1PH2A 3IKJA 3E3XA 1LT4D 5J1ZA 4AQYL 3RLFA 1ZKOA 3CC7A 3FPPA 2F0SA 3M3YH 4A3JG 2UXBL 1RCVD 3OWFA 1WCMH 3CCSA 3HS0C 3NTKA 3GTPB 3I55A 2NN6G 2R93G 4JI0Q 4LFCQ 1PFBA 1FJGQ 2F0DA 3L2PA 4KHPL 1VF5C 1A8VA 2A69D 1ILPA 5GROA 1TU2B 3OW2A 4ZYSA 4A76A 1TS2A 4JI1L 1B1ZA 1A0IA 2JA9A 2Z6BA 4BY7B 5IYBH 4K5VA 1XPRA 1TS3A 2MP1A 4JI5Q 3HOWB 4JBMA 3F2UA 3AQQA 1TS4A 1E0BA 3SEBA 3K7UC 1UAPA 1TT2A 5G3LF 2FHTA 4HIDA 1UE5A 2E2IH 1K3RA 4LAAA 3NQIA 4OWTB 5KRUA 3PGZA 3GTLH 1F2MA 1XJVA 1O7LA 5D14A 2D9UA 3OWEB 2SNSA 4DKAC 1K9MC 4PZ6A 4C3IG 2EIFA 1J5EL 4A3MG 4C3HB 5E1FA 3RD4A 5CC4A 5HURA 4LFAL 4CJ1B 4P73A 3OIPA 5C0XG 2K32A 3TS0A 3EA6A 3D0FA 1IBML 5JEAJ 4DN4M 4IUTA 3D4WA 2BH2A 2UUAL 3HOVG 1C4QA 4X6AH 4QUFA 4GKJQ 2XIWA 1QUQA 4OELB 3TEHB 3MFGA 4ZUJA 1K73C 1JORA 5IP7G 1PRTD 4Y52H 1KHIA 3G6JB 2UUCL 4B08A 5M5YB 1JB3A 4H7BA 2E2JH 1NBWA 3DXJC 4FF2A 5FO9B 4QQBX 4DR7Q 2AMCB 5BR8L 2IPKD 2SOBA 3IL8A 1FJGL 3EQLC 2VUMH 1IZ6A 2QDLA 5C44H 5C3EG 1GJXA 2EPBA 3MTSA 1N9WA 4R9WA 5IYCH 3J80L 1GVPA 1RF2D 1G91A 4JVZA 1CSPA 2F0VA 4UAIA 3A5ZB 2CVRA 5IE8A 2BE5D 1U5KA 1CA5A 4OONA 2I5MX 1XNQL 2D62A 1KAAA 2HHHQ 1PTOF 1SBBB 4A3DH 1TKWB 2D2CC 3CQZB 2B2VA 4DAPA 3WWVA 4JV5Q 2A69C 4Y7NH 1F2YA 2X6LA 3DUZA 4LF6L 4C2MB 1BBUA 1OXSC 1GUSA 2DY7A 2WINB 5JEAG 3G6EA 1XNRL 2VQEQ 4JYAQ 2ZXPA 5IT9c 1VQKA 4GNXB 2ATWA 2JP1A 1U9RA 2NN6H 4FVMA 2LSSA 1UE7A 4PV1C 1DOMA 4YCWA 3NK9A 4DNRB 4L5TA 2F0PA 4CBVA 3GTKB 1F9SA 4KD4A 1VQEA 2Q2UA 1VQJA 4NXNL 3NP8A 2E5LL 1SN8A 3G71A 3HOUG 3DWAA 1CA6A 1PTOB 4QCLA 3K5NA 1KLGD 4ZRZA 1IL2A 1UEBA 4K2KA 1Q8IA 5NUCA 1VF7A 4GKJL 2B8GA 2YTXA 2F0OA 1HNZL 1Y1VH 2NBFA 4LW1A 3Q8DA 4ZK9B 3S2HB 2NWGA 2Q8RE 4H02A 3L3OC 1E2ZA 4JG2A 4GOPB 1I6HB 1NSNS 3F2DA 1NMGA 4IO9A 2NTSA 1SE2A 2K5NA 4LWCA 3RUZA 4CJ2C 3QR8A 3K57A 1I94L 4IFDI 5KYLA 3J81c 1HRJA 3TSSA 1HFNA 2RBMA 3MZ5A 3HOZG 1LTRD 2WACA 3EVQA 1QILA 2K7VA 4WJ4A 2E8GA 4XQQA 3HOXH 4F88A 1XPUA 4JC0A 2F0UA 4FXDA 5I2XA 1WVLA 4QMGA 1XMOL 3HOYB 4KJOA 1WTHA 3U9SA 2UUBQ 1TWHB 3NSWA 2MNAA 2JA5B 2QKIC 2HHHL 1EY5A 3A54A 4DR3L 4A3GH 1HQMC 2B8FA 1RDPD 1E22A 2R61A 4QY7A 4ZKCB 2LXJA 2PCFB 4JV5L 4NW2A 4LK1C 3UDGA 2A19A 1STNA 1HZBA 4I7AA 1S5FD 4HMJA 4DFAA 1U4MA 1CZGA 1ESRA 3PUWA 4RAUC 4JI4L 4QIWB 4OO1I 4X62Q 5IP7H 1EOTA 1OXVA 4J8QA 1G6PA 2BE5C 5M3MG 1A3UA 3S1QH 4GKKL 2L11A 1JCKB 2I5HA 2SEBD 1Q82C 1WD0A 4A3CG 5ELOA 3ERSX 1CSQA 1SSOA 1RL2A 5HY6A 2K04A 1LABA 3H0GB 5CV7A 3PO3H 3S1RH 1UE6A 2A74C 5H1SE 4A3EG 5LMNQ 1YI2A 2ZTDA 3H94A 1PH8A 4OX9L 3STBD 3DMUA 2BDNA 4ME3A 1YJNA 2Q8TA 3A55A 1NY4A 1D5MC 3T1HL 1KTKA 1SXTA 1LT3D 5CV4A 4XYQA 1F9RA 5IGBA 1C7YA 2B3GA 4DV6L 4ZCKA 4DV7Q 3GQBA 1CI3M 4OL7A 1EQQA 2G9DA 1YIJA 2EXZA 1Q90A 2O5IC 3M4OH 1SYDA 4IFDJ 1SYEA 5EPKA 2A68D 4DV4L 4GNXA 1TWAH 2RHSB 3EJIA 2NVTB 3I4MB 3FKIG 3D4RA 1K0RA 2O4XA 4ZUIA 3A7AB 1DOLA 3T4AC 4XQJA 1EZ8A 2DJGC 1JE5A 4QF4A 3ULLA 4UPAA 1PMRA 1HZCA 3GTOH 1GD7A 2AUJD 2FINB 2K5VA 4C3JB 1QNKA 4JI2Q 1GHJA 3OYYA 1NTGA 1EIGA 4H13C 4DUYL 3OTOQ 4DAYB 4MNOA 5KEEA 4YHHQ 4P2CB 4QUCA 2EYJA 2WB1E 4IUPA 4A93G 3BVMA 3K58A 1LV9A 5I6WA 1PH4A 4X3UA 1Q46A 4GOPA 1JE4A 3H3VI 3VR2A 1OO9B 3K80C 2UXCQ 2GVAA 3Q23A 2F4VQ 4DXFA 4A3FB 3HP3A 2B2TC 3TBIB 2WFWA 4YWMA 3CD6A 2JA7G 1O7ZA 2RDHA 5ELEA 1UE1A 1YITA 4A3DB 2QA4A 1M90C 5COYA 1ET6A 2PNHA 2L15A 4IJHA 4DR5L 4MIUA 5IP9H 3BVZA 1W6JA 4IJLA 4Y7NB 3K5LA 3CCVA 2KBNA 3IAYA 4GN4B 1LT6D 1FVIA 4IFDG 2WP8J 2AUKA 2VQFQ 4YWLA 4A3JB 4JI6Q 1BCPC 4JK1C 3OOCA 3U4VA 2R93B 2OF1A 2V4DA 4DR4Q 2G9HD 2R92G 1SYBA 2ZTCA 5M3FG 1CFMA 2WB1G 4HCSA 1K28A 5M9OA 4RMFA 3STBC 3AEVA 1MJEA 2ZM6L 1FR3A 1T5XD 1JC7A 3Q0AA 5M5WH 2N8NA 4A3LG 4A3CH 1HCZA 5M5XB 2NTTA 4DF7A 3E9HA 4HAEA 3K8AA 5EKLA 4G57A 2YTYA 2XSCA 1VQOA 3V2TA 4YY3L 4YWKA 1VQPA 5I2YA 3I4LA 3KLSA 5CYUA 3F2BA 3S16B 1ML0D 1W2BA 2Z1CA 3I56A 4RH6A 2EVBA 1RKNA 1NAPA 2UXDQ 3S15H 2A68C 4DXGA 3OTOL 2N49A 4P72A 3CCRA 3A8KE 4K6LA 5GADC 4HN7A 2NVXB 1MHWC 3CHBD 3VA7A 4BXXH 4FP5D 2TSSA 4KD3A 1YNJD 1UWVA 2FJ2A 1B4OA 2PI2E 3PIOA 1EY8A 1N8RC 3GTMB 2DNCA 3RZDB 5IYDG 1WCMG 1K8AC 2EXDA 3OMGA 4C3IB 2UXCL 2JEBI 5C4JB 4HJ7A 4A3MB 3UDFA 5KIXA 5I9OA 4UP9A 5CGKA 1PFSA 1Y14B 2GN5A 3CP0A 2OQKA 2K33A 5FO8B 4JOIA 4B3RQ 5CORA 1V1PB 3NBIA 4PQXA 2NVYH 3FMCA 1YHBA 4N8X1 1HR0Q 1DOKA 3HOVB 1KAWA 1RHPA 1D1KA 5IYBG 3UE1A 2J0TD 1DXMA 3T16A 1F77A 2VXWA 5AFWA 2F0LA 1EEFD 4R4OA 3ZJYC 2NZ1D 4JI6L 1K83B 1EZ6A 4A3BH 1OTCA 4DAYA 1JJGA 3BZKA 1O78A 1YVCA 4UP7A 4ME5A 1IBLQ 4DR2Q 4DR4L 2Z0SA 3PSIA 1DZ1A 5E4WC 1CUKA 4KN4C 4A93H 5C3EB 1B3AA 5KGUA 5IT9E 4GZYC 3SDZA 3PV0A 1GUTA 2B29A 1K8MA 3TZDA 1X65A 4PMBA 2VB3X 3VA5A 2ASBA 1SYCA 1HHVA 4GLXA 4DV3Q 2QILA 1TWFH 1SNMA 1SR3A 4LFBL 3CW2C 2A5HA 4OWWB 4JPBW 5FLMH 3SGIA 1I6VC 4O2DA 3KLSX 3MFYA 3MA2B 1PH1A 1RTNA 1JWUD 1PRTF 3NWTA 5A35A 5C4XH 4IFDH 4K14A 1I4QA 4TRDA 3VR4A 1Z47A 2WKDA 4POGA 3DWPA 5EQ0A 3CF5A 2K28A 1PDQA 1WTXA 3H3VC 2YV5A 3K7AB 3K5MA 1S4ZA 1YZ6A 4IPCA 1L1OB 1AW7A 4B3ML 4HTHA 4I7ZC 2VUMG 1P16A 3MEFA 5DLQE 5C44G 1Y1WH 1LACA 4IURA 4CKEA 4PZ8A 3CPWA 3FEWX 5IYCG 3U50C 1N32Q 2K14A 4KY6A 4NKLA 3HOUB 1NJIC 4A3LH 1LTSD 4DV2Q 2F1MA 1I50B 2VZAA 4EQPA 4GLVB 4DNIA 2QEJC 1EU4A 4DR6Q 4OO1H 2EYOA 2Z6KC 2IL8A 5ELNA 5ELDA 3NENA 1PRTB 2PZTA 5J3BA 1VQ4A 5IGFA 4NMZA 2CWPA 2JA6B 4M8AA 4RG1A 4OWXB 3HFZB 1CQFA 3D31A 1KDBA 1EFID 3HOZB 3KBGA 3VYSA 4LF8L 3M4QA 2EY6A 4TSSA 5IYDH 1J8IA 1ONLA 4B9WA 3NPPA 2QDBA 4LUOA 4IALA 1DONA 1W3SA 2NUCA 3M4PA 1EUJA 1V1PA 3MVVA 5C4ZA 3BG3A 2JXMB 2HD3A 2J4XA 2PNRC 4B3SL 2E76C 1E2WA 1A2TA 2B2WC 5DM73 4G7ZC 2V1CC 4NP5A 2WAQE 3J80i 3PO2H 1PA6A 1QZGA 1AE2A 2OCEA 2BA0A 3AU7A 2WIIB 1Y1VG 3NWSA 4RHRA 3MWYW 5M3MB 4R4TA 2Z4HA 5GQOA 5E4XA 4K8JA 1IYVA 4Q0FA 4DV0L 5AJ3L 3SK5A 3TS2A 1XMQL 4QJFA 1BO0A 4XQNA 1NR2A 1WFQA 4CDFC 1SNOA 4L6TB 3J80c 4A3EB 1GUNA 3HOXG 4A3IH 3GTGB 2L55A 3QB3A 1WTVA 3S15B 1PZJD 5L37A 3DM3A 3CC2A 1TY2A 1UNSA 1A63A 3J7ZC 4MZ9A 1MKHA 4P75A 3QO2A 4BBSG 1E1TA 3QWNA 2A8VA 1R4PB 4A3GG 4LF7Q 5EKIA 1TXYA 3H3VH 3TZUA 1S72A 2AHOB 2PYKA 1L0YB 1VQ5A 1YJ9A 5CMDA 2XVSA 2EY5A 1RD9D 2PZUA 1EU3A 1X3PA 2WAQG 5DEHA 2RHQB 2UU9Q 1PH3A 4LUVA 4HJAA 1L2FA 5BN5A 1LUZA 1ESFA 1Q1BA 1FNUA 1FNWA 3FKIB 4J6HA 4ULLA 3GTQH 1L1OA 1IKLA 4JI7Q 4JI0L 4LFCL 1BR9A 4DK0A 1II3A 4X64Q 3PO3G 1EY6A 2QEXA 5FJ8H 1JB7A 2M2LA 3S1MB 4MHEA 2D0OA 2MO1A 2AQ1B 3S1NH 3KF6B 3KLWA 1NR4A 1I3QB 3FVQA 1QG7A 2KHJA 4H44C 1EQRA 2N88A 4MN3A 4JI5L 3CCJA 1IBKQ 3M7NA 2F0TA 1AEXA 1F9PA 4KY7A 5FLXc 4JBKA 2XWJB 3FRPB 4G4KA 4QB4A 3PUVA 4X65Q 4LF4Q 3W3AA 5FO7B 4ZQ3A 3PIO3 4BWGB 4IOCA 4UP8A 2DGYA 3I91A 4YCVA 1B3QA 1U4LA 1E7ZA 3AFQA 3VYRA 1KXLA 1CKNB 2MFIA 2E2HH 1JR0D 2A6HC 3KF8A 2JA7B 2ZJPA 1H9SB 2ICEC 1GXDC 2Z4IA 3N6RA 3C2PA 1IYUA 2IY5B 4H0LC 2EJMA 3E6ZX 2PMZE 1WD1A 4DV1Q 1ENCA 1SROA 1K3BC 1LTLA 3T56B 3HKSA 5I4DA 3T1YQ 1JWSD 1XX8A 2HIXA 1STYA 1Y8NB 1FNVA 5JPMC 1G2TA 1ZYRD 2KHIA 4XTCS 4HJ8A 2C9OA 2BH8A 2JEAI 4R4QA 5GAHC 5CV9A 2PO4A 1EQVA 2EYMA 3DM1A 1R9TH 2N55A 3J81i 2B2UC 4MTKA 3KFUA 1K0SA 2R92B 4NXMQ 4DV5Q 1SE8A 5M3FB 2WB1B 2YU9B 4HJ5A 1CM9A 5LL6S 4F8MA 3I3CA 2UU9L 5EPJA 3UI2A 4A75A 2CQOA 3KJPA 3E9IA 2J7ZA 5EJWA 1TWGH 4DR7L 4XDXA 1AN8A 1HJPA 5K36H 1BUVT 3S17H 2LY7A 1VQ9A 1SYFA 3S14B 5J39A 5GAEC 4TKOB 4IPHA 4LNQA 2H4OA 3BZCA 2JE6I 1H9JA 3RR5A 5IP9G 2PQEA 3SE0A 1N34Q 3U58A 2DUDA 3PF4A 2BDOA 4BBSH 1VQCA 2DY8A 1QNUA 3ER0A 3WDNA 3M3YB 1TY0A 1WCMB 2K05A 5IT9L 4M1UB 3ICEA 1VQGA 1GHKA 1Z6HA 1PH7A 2K52A 1I4PA 2MPMA 2K01A 4CGYB 4IUQA 2AQ3B 2Q2TA 3A74A 2EYHA 2B2VC 1D1IA 3Q6SA 2VQEL 4JYAL 4IUNA 1QVFA 2E2DC 3NTHA 4DAVA 4IOAA 3W1BA 1PZKD 2FFKB 2NVQH 1HUNA 2XN9C 2JN4A 1BBXC 4E6IA 1MIUA 1BCPD 1VQDA 3QIAA 1ASYA 3WOEA 2OQ0A 2NYZD 1HNWQ 2Q2HA 4IPGA 5LMNW 4PG3A 3KF6A 2B2TA 3T13A 5DNFA 1M1KC 1BBWA 2E2IB 1SEBD 1EYGA 4FF1A 3DWQA 1NNXA 3NTIA 4BA2I 4DA2A 4DK3C 4BXXG 4OHJA 2PZWA 3A8JE 4BBRH 3CXCA 4R8IA 3GTLB 4HCEA 2K5DA 5T1IA 3OHXC 2GVBA 1HZ9A 4KI0A 1D6EC 1LTBD 1DM0B 3D8GA 4OIKA 3MXPA 4BY1H 1CKNA 1V1QA 1ZYRC 1ASZA 3H91A 3VYUA 1HNXQ 4GLAC 1H9SA 1PFMA 1VDZA 2I46A 1GUWA 3VDYA 2MQHA 1SNQA 2K6AA 4KKUA 3KJOA 1M8AA 3TMEA 2RVLA 1ZXTA 4RGOS 3KYHC 2JA8G 1TWCH 2LFNA 4RCOA 3OW7A 5DM63 1HQRD 2FMCA 2UUBL 3ERQA 2E2JB 1EL0A 3HEJA 5ELCA 1BDOA 4R4IA 1I4XA 3GTJH 1OXXK 4A3BG 3SXHA 4K6DA 2HUGA 3R3OA 3N52A 1SFOH 1QE6A 4CJ0B 4XT1B 1WJJA 2MUYA 1B2TA 1EYCA 1I5FA 1TQOA 3BYTB 2VUMB 4G7OC 1O7YA 2L1BA 1QWYA 5C44B 1XWEA 2YYZA 4X62L 3S9WA 2KEDA 2L4NA 1L0WA 3GO5A 4K0KQ 3LGJA 4KV6A 3G48A 1NMFA 1ZEQX 4EQ5A 3I4OA 1SNPA 3S1NB 4KTAA 1VMCA 4DUZQ 1IXRA 3K0XA 2CWAA 1BQQT 3HKZE 4EQOA 3BS1A 4EVOA 4BS9A 5TSSA 3AFPA 3W2DA 2CHBD 3TRZA 3S2DH 3QOLA 2R7ZH 1X3GA 1YNND 1VQMA 4MTNA 1BXTA 2PQAB 5FLMG 2B63G 5LMNL 2ZT9C 4XT3B 3V05A 1PZID 3H09A 5D65A 1PH5A 4IZ8A 1EQTA 2IWHA 1RJTA 2VW9A 3JAMi 2OTLA 5C4XG 1PV4A 1A3TA 1PH6A 1T5EA 3OIQA 3BDCA 4K2LA 4O0AA 4ZAIA 4JCVE 1B9NA 1IW7C 5JOBA 2SNMA 1CKMA 4LF9Q 4FF3A 2CCZA 2RF4A 1H95A 3O13A 4DV7L 2Q2IA 5FOBB 1O80A 1MBYA 2GA4B 1Y1WG 1QZHA 4KHVA 1ET9A 4PMCA 2LMCB 3JAMc 2R7FA 1X55A 3DHQA 4HSPA 3DEOA 3I2ZA 1KC8C 1BNZA 4DR1Q 3CKIB 1CTMA 3HKZG 3PIPA 1KDCA 4BY7H 4GNXC 4OO1G 3HOWH 4LF5Q 1Y1VB 2VNUD 3MXGA 2K4KA 4JI2L 3TP7A 1ENAA 4L63B 3CPFA 1R4QB 2ZTEA 2RA4A 3IFTA 4YHHL 4IUUA 4RCNA 2PI2A 4DGZA 1S3OA 1VQFA 4RKBA 2I0QA 2F0EA 1N36Q 1Z7TA 2PPBC 3HOXB 4JI8Q 2X69A 4WJ3M 2F4VL 3LWEA 2M00A 3G4SA 4B3TQ 1WOCA 4C3HH 4BBSB 4HMIA 2KUMA 5T1GA 1EIFA 4GOPC 1HTPA 4EQNA 3RN2A 4A3GB 5K5PA 1LTGD 3IFDA 1SAPA 3ND9A 3I90A 1E3PA 1DJRD 1Q3LA 4PNYA 2BA1A 4DNTB 5FLXE 2IX1A 3C46A 2JA8H 5BN3A 1VQAA 3TP8A 3Q24A 1W6KA 3PO2G 3ITPA 2VQFL 2XWBB 3OPOA 2OT2A 3AB9A 5IGCA 3S1QB 2XRSD 4UHVA 1A3VA 2JK8A 2NZHA 1YNNC 2Z6KA 5M5YH 4IQZA 1X6OA 3LX0A 5CBAE 4P71A 5D3IB 4Z9CB 3T51B 2JJQA 3EFXD 1YHAA 3PO3B 2F3IA 1WTPA 1HA6A 3H15A 3S1RB 4PMWA 3UDXA 3CMEA 3SK6A 3T53B 4A3IG 2TMPA 5C4HA 4L5RC 5IIFA 2BOSA 1HZAA 3TP6A 3EIVA 1H9RA 4Q5VA 3QOJA 4JBWA 3SK4A 2DNEA 2PQAA 1FYCA 4V190 1NUCA 3G7LA 1DGSA 4KKTA 1X3EA 1X54A 4AIMA 4NB3A 5C0XI 4AQYQ 3C3LA 2B63H 2UXDL 3R93A 4C1NK 1ILQA 1GUOA 2UXBQ 1VS0A 4XXEA 1VQ8A 2A73B 3CQZH 1PH9A 2EDGA 3PQIA 1T9HA 2K1BA 2B2YC 1SMXA 2HQLA 2N3SA 3PUZA 4X3TA 4APVA 2VB2X 1TVXA 3M4OB 1DD2A 3URYA 1E24A 1DCZA 1PYBA 2B2WA 2D5DA 4F87A 4C2MH 1TWAB 2HDMA 3S24A 4KHPQ 2F0KA 3J81j 5FK9C 4RGTA 5J22A 1Q7YC 2FMMA 2O2LD 1LO5D 3J81E 2RSOA 4NPSA 4JI1Q 1XYIA 4HSVA 3BDOA 4X3SA 5IGDA 2CH4W 4RHSA 5C5MA 2KA7A 5FJ8G 3GV3A 4B3RL 3GTOB 3WOFA 2E74C 3GTJB 1KABA 2CQAA 2KJXA 4HR7B 1HR0L 3GTKH 3SHLA 4B9XA 4V0BA 1QJOA 1JQYD 1STHA 1ICWA 3P75A 4DU9A 1GOZA 5DAUA 4OIJA 2RQXA 1RIPA 3M9BA 3CCUA 3LWUA 1BF4A 4R8NA 2AQ2B 3L0OA 3GV6A 2K03A 1E2VA 2VY3A 1PLFA 4DR2L 1IBLL 4C1NI 3HG9A 3S2HH 3MXUA 4WORA 1I6HH 1JT8A 4LFAQ 3CRLC 4IPDA 5EBDA 3KF8B 1JJ2A 3HZXA 2OWOA 3PCOB 2PMZB 2HCIA 4WJWA 1WYDA 4FF4A 5HGTA 2UUAQ 2KVMA 1G51A 4RGMA 4DV3L 2IX0A 2F0WA 3HOYH 1MD2D 4TQUS 3RNUA 5LHY1 4U673 1TWHH 4HIOA 2XNAC 2JA5H 2Q8IB 5C0XJ 2UUCQ 1N33Q 2A6HD 2AWNA 2MJ8A 5EBCA 5CR3A 1EYAA 4IUVA 5BN4A 1PHJA 4XIGS 1B53A 5E7NA 1A6XA 2KCNA 5BR8Q 1Y8PB 4FXGC 3A56A 1Z9FA 1JMCA 5M5WB 2XRQD 3RZOH 3A0JA 5K36G 4AYBE 3BYYB 4A4IA 3AYHB 3K6OA 4P74A 3TREA 1N32L 2HQEA 5KNDA 3H0GH 1XNQQ 4ID6A 4FDBA 3MHBA 2A1AA 1B8AA 3GD7A 3CU7A 1Q12A 4HEDA 1ICFB 3CAMA 4DV2L 3NE5B 4KHZA 2Z9HA 3I73A 3CMAA 5JVH3 3A8IE 2MO0A 3F8TA 1QVGA 4DR6L 1AE3A 2QF7A 1AZPA 3I72A 1YEZA 5HGQA 4LF6Q 1MSGA 1C8CA 1XTCD 1HTLD 1AFPA 1I4RA 1XNRQ 1SJED 2RDFA 1LTID 1GUGA 1STEA 3MAQA 1KIXA 1J6QA 1HFGA 2ALYB 2B2UA 2ENBA 5JJLA 2NVYB 4EX5A 5IODA 3CC4A 1KL9A 2DN8A 1EY4A 3QJYA 1VQ7A 3M7GA 1BCPF 1VQHA 4RGNA 2EJGC 4NXNQ 2NVTH 2H5XA 3UDIA 2E5LQ 3I4MH 3P7JA 2JA8B 2MHVA 3F2CA 5JPNC 1F9QA 4AYBG 2ID0A 1VQ6A 2KQ3A 3PIP3 1U4RA 3TN2A 2ES2A 3W1GA 1EFWA 3BDLA 3VR6A 2CW0D 4AH6A 4G7HC 1HNZQ 2X6GA 1UUPA 4OEMB 5EGTA 4A3BB 2B39A 1JWMD 1N33L 4CDEC 4C3JH 1EIYB 2IT1A 4ABNA 5JAVA 1PYSB 4A93B 3KLRA 4BBRG 1J9OA 3UE0A 3DLLA 1I94Q 2PW5A 3EN2A 1PVOA 2F0IA 2IHFA 2ZJRA 1SE4A 2VS1A 1LM0A 4BY1G 3X3MA 1CK1A 2QGQA 2IJ0A 3SVMA 1P8LA 1TIID 3U9OA 2H1EA 3JAME 3A5UA 4A3FH 1XMOQ 2KOLA 2Y0SE 1BCPB 1TWFB 2F0QA 1VQNA 3MXNB 4NDXA 2NZOA 4X3KA 1RODA 5ELBA 1CHPD 3M4YA 1C48A 2B63B 4DAMA 5LMUQ 3EBEA 3BU2A 4FXKC 4DR3Q 1STAA 1GO3E 3NELA 1EOVA 4UDUC 5C4XB 1VCIA 4K8IA 2EY2A 4JW0A 2K5WA 5C3XA 1AZQA 2KECA 1SDFA 4LF7L 3OSOA 4JI4Q 1X32A 4A3JH 1EEID 4GKKQ 3PUXA 1S5ED 2KHSA 2N78A 2BCOA 5CV5A 1EY7A 1H9MA 2RCFA 3I4NG 2XGTA 1Y1WB 2R93H 5C5LA 2DJFC 2A6ED 4HIKA 1S5DD 2LKVA 4BA1I 5A2QE 4JI7L 4N9TA 4KKSA 4L8JA 3HKZB 1X3FA 1LLRD 5M5XH 4OX9Q 1G8ZD 2Y0SG 4X64L 1WTRA 2IX3A 3R8BA 1D7QA 2R7ZG 4RWSC 1HXYD 1L1OC 5FLXL 1TS5A 3J7AF 3E5SA 1F2ZA 3J7AV 2KCMA 3T1HQ 3S16H 5EPLA 1LT5D 1SNCA 1BOSA 1LYLA 4DV6Q 1IBKL 2IHEA 5G3LD 2JA6G 2L9HA 1CQVA 4A3KG 2R3ZA 2NVXH 3U4ZA 4X65L 4LF4L 2F3VA 3CRKC 5JJZA 4DV4Q 3NQTA 1EIHA 2CW0C 3GTMH 3JC66 3RZDH 1PRTC 1I4HA 4C3IH 2ZXRA 5C4JH 4A3MH 4YCUA 3CCQA 2AKWB 3I7FA 1C0AA 5CV8A 2EY1A 5C0XH 2XTIA 3VR3A 5LMUL 2HCCA 2EOTA 4DV1L 2EYLA 3ONAB 1YJWA 3T1YL 3HOVH 1IW7D 1V43A 4DUYQ 5EKKA 2ICIA 2F3WA 5CV6A 3EROA 5GAGC 4XYOA 3I70A 4BY7G 3PO2B 1K8GA 3HOWG 3J7YW 1PYWD 4RKLA 1K83H 4GN5A 3NHHA 4ZLTF 2L0CA 3HGBA 1V9PA 3RZOB 2O5JC 3L9AX 4NXML 4DV5L 5IY0A 2G5DA 3LNNA 3ZYYX 3VYTA 5EAYA 3J81L 5IOCA 5C3EH 4ZKBB 3D6CA 1B70B 4A3IB 1NE3A 4HIMA 3KDFB 2F0FA 3E0JA 4KK7A 5KNCA 3RN5A 1YHQA 3K81C 3MXNA 1S40A 1SE3A 4DR5Q 1D2BA 4C3HG 2YTVA 1HPCA 3L7ZC 1SRUA 2I5LX 1CT1D 5D3DA 1KDAA 4WFN3 5IWAQ 1Y69U 3ND8A 5IGGA 1L0XB 4FNFA 2CH4A 2R7DA 3MEHA 1X56A 1MSHA 2A6EC 1N34L 4ALPA 3OMCA 2JYOA 1KD1C 1PTOD 3V96A 3E0EA 4EGVA 2D0PA 4POFA 2KCCA 2EJFC 1I4GA 5JEAH 3GTQB 1C9OA 2ZM6Q 1F2LA 2EZVA 4KJNA 2IW3A 3TQYA 1V1OA 1XXGA 3K7AH 3I4NH 1AP0A 2VL6A 3KOJA 5I6YA 1UEAB 1Y8OB 3NUCA 4YY3Q 4DK1A 1A15A 2E75C 4K5XA 3J7A5 1V8QA 1X9NA 1EWHA 4L5SA 3C1EA 3NBHB 3HOUH 1WTOA 1HNWL 4J1MA 2EQSA 1I50H 2F03A 1FL0A 1MJCA 3K0YA 3KK7A 4LJZC 2OEOA
chains in the Genus database with same CATH topology
3A7LA 2E2HB 2RKSA 1SNDA 3RMHA 1SJHD 2K5QA 1VMPA 1JICA 1QB5D 2F4IA 1S5BD 3J80E 1CZWA 1LTTD 1SMYD 1OXUA 1NCVA 4YIJA 1KNEA 1R9TB 4S3SA 4KMUC 1TR5A 4RA8A 5C3WA 5IGEA 1K8OA 1WTWA 1QCBD 1TWGB 4C56C 2EYPA 4I65A 1QOHA 3S17B 3PUYA 3I8ZA 5FKAC 4F7XA 4O1NA 1PTOC 4CHTB 3D4DA 1B44D 2B2YA 2KEEA 3M85A 2SDFA 3KUPA 4K5WA 2RSNA 5E3FA 1A2UA 1G2SA 2EE1A 3R2TA 2OXPA 4IN3A 3SR1A 3NXWA 2NN6I 1HUMA 4O42A 2AWOA 3TP5A 1JOKA 3K5OA 3BVGA 3H6MA 1EY0A 4N9PA 1U4PA 1HA5A 1IKMA 1WTQA 3DEPA 3SK8A 3FPUB 3Q22A 2WAQB 5ELFA 3HRZC 1ENFA 3TDQA 3R2IA 5F2DA 1MI2A 1EWCA 2F0NA 4FYDA 1PXUA 3JAML 4CKCA 5ISRA 2NVQB 3PMFA 4AYBB 4FO2A 1DYQA 4KY5A 1MGSA 2F0GA 3NBHA 2ZXOA 3FDTA 1KNAA 3K59A 3GP7A 4OGQC 2Z8LA 4BBRB 2C5CA 1STBA 1M4VA 2M9VA 3C1FA 1SMYC 5I9PA 4BY1B 5KNBA 2JSOA 2F0MA 5KYIA 1PFNA 1D5ZC 4ILWA 1H9KA 5A2QL 1FD7D 3QG1A 1IHZA 3AMUA 5LL6X 3KBXA 1TWCB 1Q1EA 1SYGA 1D5XC 3D6WA 4U68A 4RFBA 3X3NA 2HDLA 2R6GA 1G291 1KLUD 3MC0B 3D3RA 1LTAD 1IL8A 2EYFA 1STGA 4ODGA 1SFOB 4C3JG 1OXTA 1B9MA 4CKBA 3I4NB 1PTOH 3P1HA 2RDGA 2F0HA 2PW7A 3P20A 1FGBD 2MGSA 2NB0A 1EY9A 3BZDB 5CBEE 1S5CD 1RTOA 4LMQD 2LS01 1YNJC 2QCPX 1JOQA 1X3QA 5JVG3 2I07B 4WRDA 2Y0SB 3VR5A 1JOOA 3S2DB 2R7ZB 2WKCA 1CHQD 1B50A 5C6AA 2L12A 1EYDA 4KN7C 1G6ZA 2WV6D 4A3KB 2F0JA 2L5TA 3IKJA 1LT4D 5J1ZA 3RLFA 1ZKOA 3FPPA 2F0SA 1RCVD 3OWFA 3HS0C 3NTKA 3GTPB 2NN6G 1PFBA 2F0DA 1VF5C 2A69D 1ILPA 1TU2B 4ZYSA 1TS2A 1B1ZA 4BY7B 4K5VA 1TS3A 2MP1A 3HOWB 3F2UA 1TS4A 1E0BA 3SEBA 1UAPA 1TT2A 5G3LF 2FHTA 4LAAA 3NQIA 5KRUA 1F2MA 1O7LA 5D14A 2D9UA 3OWEB 2SNSA 4C3IG 4C3HB 5E1FA 3RD4A 5CC4A 5HURA 4CJ1B 3OIPA 5C0XG 2K32A 3EA6A 5JEAJ 4DN4M 4IUTA 3D4WA 1C4QA 4QUFA 2XIWA 3MFGA 4ZUJA 1JORA 1PRTD 3G6JB 4B08A 5M5YB 1JB3A 4H7BA 3DXJC 4FF2A 5FO9B 2IPKD 2SOBA 3IL8A 3EQLC 1GJXA 2EPBA 3MTSA 4R9WA 3J80L 1RF2D 1G91A 2F0VA 4UAIA 2CVRA 2BE5D 1CA5A 2D62A 1KAAA 1PTOF 1SBBB 1TKWB 2D2CC 3CQZB 2B2VA 4DAPA 2A69C 1F2YA 2X6LA 3DUZA 4C2MB 1OXSC 1GUSA 2DY7A 2WINB 5JEAG 2ZXPA 2JP1A 1U9RA 2NN6H 4FVMA 4PV1C 1DOMA 3NK9A 4DNRB 2F0PA 4CBVA 3GTKB 1F9SA 4KD4A 3NP8A 3DWAA 1CA6A 1PTOB 4QCLA 3K5NA 1KLGD 4ZRZA 4K2KA 1Q8IA 5NUCA 1VF7A 2B8GA 2F0OA 2NBFA 4ZK9B 3S2HB 2NWGA 2Q8RE 3L3OC 1E2ZA 1I6HB 1NSNS 2NTSA 1SE2A 3RUZA 4CJ2C 3K57A 4IFDI 5KYLA 1HRJA 3TSSA 1HFNA 2RBMA 3MZ5A 1LTRD 2WACA 3EVQA 1QILA 2K7VA 4XQQA 4F88A 2F0UA 4FXDA 5I2XA 1WVLA 4QMGA 3HOYB 4KJOA 3U9SA 1TWHB 3NSWA 2JA5B 2QKIC 1EY5A 3A54A 1HQMC 2B8FA 1RDPD 2R61A 4ZKCB 2PCFB 4NW2A 4LK1C 1STNA 1S5FD 4HMJA 4DFAA 1U4MA 1CZGA 1ESRA 3PUWA 4RAUC 4OO1I 4QIWB 1EOTA 1OXVA 4J8QA 2BE5C 1A3UA 2L11A 1JCKB 2SEBD 1WD0A 1SSOA 2K04A 1LABA 3H0GB 5CV7A 2A74C 3H94A 3DMUA 2BDNA 2Q8TA 3A55A 1D5MC 1KTKA 1SXTA 1LT3D 5CV4A 4XYQA 1F9RA 5IGBA 3GQBA 1CI3M 4OL7A 2G9DA 2EXZA 1Q90A 2O5IC 1SYDA 4IFDJ 1SYEA 5EPKA 2A68D 3EJIA 2NVTB 3I4MB 3D4RA 2O4XA 4ZUIA 3A7AB 1DOLA 3T4AC 4XQJA 1EZ8A 4QF4A 1PMRA 2AUJD 2FINB 4C3JB 1QNKA 1GHJA 1EIGA 4H13C 5KEEA 4P2CB 4QUCA 2EYJA 4IUPA 3BVMA 3K58A 1LV9A 5I6WA 4X3UA 1JE4A 3VR2A 1OO9B 3Q23A 4DXFA 4A3FB 3HP3A 2B2TC 3TBIB 1O7ZA 2RDHA 5ELEA 4A3DB 5COYA 1ET6A 4MIUA 3BVZA 1W6JA 4Y7NB 3K5LA 3IAYA 1LT6D 4IFDG 2WP8J 2AUKA 4A3JB 1BCPC 4JK1C 3OOCA 2R93B 2OF1A 2V4DA 2G9HD 1SYBA 1CFMA 4HCSA 5M9OA 1FR3A 1T5XD 1JC7A 3Q0AA 1HCZA 5M5XB 2NTTA 4DF7A 4HAEA 5EKLA 4G57A 2XSCA 3V2TA 5I2YA 3I4LA 3KLSA 5CYUA 3S16B 1ML0D 2Z1CA 4RH6A 2EVBA 1RKNA 1NAPA 2A68C 4DXGA 3A8KE 4K6LA 4HN7A 2NVXB 3CHBD 3VA7A 4FP5D 2TSSA 4KD3A 1YNJD 2FJ2A 1B4OA 1EY8A 3GTMB 2DNCA 3RZDB 3OMGA 4C3IB 2JEBI 5C4JB 4A3MB 5KIXA 5I9OA 5CGKA 2K33A 5FO8B 5CORA 1V1PB 3NBIA 4PQXA 3FMCA 1DOKA 3HOVB 1RHPA 1D1KA 2J0TD 1DXMA 3T16A 1F77A 2VXWA 5AFWA 2F0LA 1EEFD 2NZ1D 1K83B 1EZ6A 4DAYA 1O78A 4ME5A 1DZ1A 5E4WC 4KN4C 5C3EB 1B3AA 5KGUA 5IT9E 4GZYC 3SDZA 3PV0A 1GUTA 1K8MA 3TZDA 4PMBA 2VB3X 3VA5A 1SYCA 1HHVA 2QILA 1SNMA 2A5HA 1I6VC 3KLSX 3MFYA 3MA2B 1RTNA 1JWUD 1PRTF 3NWTA 5A35A 4IFDH 4K14A 1I4QA 4TRDA 3VR4A 1Z47A 2WKDA 3DWPA 5EQ0A 2K28A 1PDQA 1WTXA 3H3VC 3K5MA 3K7AB 1S4ZA 1AW7A 4HTHA 4I7ZC 1LACA 4IURA 4CKEA 3FEWX 4KY6A 4NKLA 3HOUB 1LTSD 2F1MA 1I50B 4EQPA 2QEJC 1EU4A 4OO1H 2EYOA 2IL8A 5ELDA 1PRTB 2PZTA 5IGFA 4NMZA 2JA6B 4M8AA 1CQFA 3D31A 1KDBA 1EFID 3HOZB 3KBGA 3VYSA 2EY6A 4TSSA 1J8IA 1ONLA 4B9WA 3NPPA 2QDBA 4IALA 1DONA 2NUCA 1V1PA 3MVVA 5C4ZA 3BG3A 2JXMB 2J4XA 2PNRC 2E76C 1E2WA 1A2TA 2B2WC 5DM73 4G7ZC 4NP5A 2BA0A 3AU7A 2WIIB 3NWSA 4RHRA 3MWYW 5M3MB 2Z4HA 5E4XA 4K8JA 1IYVA 4Q0FA 3SK5A 1BO0A 4XQNA 1NR2A 1SNOA 4L6TB 4A3EB 1GUNA 3GTGB 2L55A 3QB3A 1WTVA 3S15B 1PZJD 1TY2A 1UNSA 3QO2A 3QWNA 1R4PB 5EKIA 3TZUA 2PYKA 1L0YB 5CMDA 2XVSA 2EY5A 1RD9D 2PZUA 1EU3A 1X3PA 5DEHA 5BN5A 1ESFA 1Q1BA 1FNUA 1FNWA 3FKIB 4J6HA 4ULLA 1IKLA 1BR9A 4DK0A 1II3A 1EY6A 2M2LA 3S1MB 4MHEA 2AQ1B 1NR4A 1I3QB 3FVQA 1QG7A 4H44C 2N88A 4MN3A 3M7NA 2F0TA 1AEXA 1F9PA 4KY7A 2XWJB 3FRPB 4G4KA 4QB4A 3PUVA 3W3AA 5FO7B 4ZQ3A 3PIO3 4BWGB 3I91A 1U4LA 3VYRA 1JR0D 2A6HC 3KF8A 2JA7B 1H9SB 2ICEC 1GXDC 2Z4IA 3N6RA 3C2PA 1IYUA 4H0LC 2EJMA 3E6ZX 1WD1A 1ENCA 3T56B 5I4DA 1JWSD 1XX8A 1STYA 1Y8NB 1FNVA 5JPMC 1G2TA 1ZYRD 4XTCS 2C9OA 2JEAI 5CV9A 2PO4A 1EQVA 2EYMA 3DM1A 2N55A 2B2UC 2R92B 5M3FB 2WB1B 2YU9B 1CM9A 5LL6S 4F8MA 3I3CA 5EPJA 3UI2A 2J7ZA 5EJWA 4XDXA 1AN8A 5K36H 1BUVT 2LY7A 1SYFA 3S14B 5J39A 4TKOB 2H4OA 2JE6I 1H9JA 2PQEA 3SE0A 2BDOA 2DY8A 1QNUA 3WDNA 3M3YB 1TY0A 1WCMB 2K05A 5IT9L 4M1UB 1GHKA 1Z6HA 1I4PA 2MPMA 2K01A 4CGYB 4IUQA 2AQ3B 2EYHA 2B2VC 1D1IA 3Q6SA 4IUNA 2E2DC 3NTHA 4DAVA 1PZKD 2FFKB 1HUNA 2XN9C 1BBXC 4E6IA 3QIAA 1BCPD 3WOEA 2NYZD 2B2TA 3T13A 5DNFA 2E2IB 1SEBD 4FF1A 3DWQA 3NTIA 4BA2I 4DA2A 4OHJA 2PZWA 3A8JE 3GTLB 4R8IA 4HCEA 2K5DA 5T1IA 3OHXC 4KI0A 1D6EC 1LTBD 1DM0B 3D8GA 4OIKA 3MXPA 1ZYRC 3H91A 3VYUA 1H9SA 1PFMA 1VDZA 2I46A 1GUWA 1SNQA 2K6AA 4KKUA 1M8AA 3TMEA 2RVLA 1ZXTA 4RGOS 2LFNA 4RCOA 3OW7A 5DM63 1HQRD 2FMCA 3ERQA 2E2JB 1EL0A 3HEJA 5ELCA 1BDOA 1I4XA 1OXXK 3SXHA 4K6DA 2HUGA 3R3OA 3N52A 1QE6A 4CJ0B 4XT1B 2MUYA 1B2TA 1EYCA 1TQOA 3BYTB 2VUMB 4G7OC 1O7YA 2L1BA 1QWYA 5C44B 1XWEA 2YYZA 3S9WA 2KEDA 2L4NA 3GO5A 4KV6A 1ZEQX 1SNPA 3S1NB 4KTAA 1VMCA 1BQQT 4EQOA 3BS1A 4EVOA 4BS9A 5TSSA 3W2DA 2CHBD 3QOLA 1YNND 1BXTA 2ZT9C 4XT3B 3V05A 1PZID 3H09A 5D65A 4IZ8A 1EQTA 2IWHA 1RJTA 1A3TA 1T5EA 3OIQA 3BDCA 4K2LA 4ZAIA 1B9NA 1IW7C 5JOBA 2SNMA 4FF3A 3O13A 5FOBB 1O80A 1MBYA 2GA4B 4KHVA 1ET9A 4PMCA 2LMCB 3DHQA 4HSPA 3DEOA 1BNZA 3CKIB 1CTMA 1KDCA 4OO1G 1Y1VB 2VNUD 3MXGA 3TP7A 1ENAA 4L63B 1R4QB 2RA4A 3IFTA 4IUUA 4RCNA 4DGZA 4RKBA 2F0EA 1Z7TA 2PPBC 3HOXB 2X69A 3LWEA 2M00A 4BBSB 4HMIA 2KUMA 5T1GA 1HTPA 4EQNA 4A3GB 5K5PA 1LTGD 3IFDA 1SAPA 3I90A 3ND9A 1DJRD 4PNYA 1Q3LA 2BA1A 4DNTB 5FLXE 2IX1A 3C46A 5BN3A 3TP8A 3Q24A 1W6KA 3ITPA 2XWBB 3OPOA 2OT2A 3AB9A 5IGCA 3S1QB 2XRSD 1A3VA 1YNNC 4IQZA 3LX0A 5CBAE 5D3IB 3T51B 4Z9CB 3EFXD 3PO3B 1WTPA 1HA6A 3S1RB 4PMWA 3SK6A 3T53B 2TMPA 5C4HA 5IIFA 2BOSA 3TP6A 1H9RA 4Q5VA 3QOJA 4JBWA 3SK4A 2DNEA 1FYCA 4V190 1NUCA 3G7LA 4KKTA 5C0XI 3C3LA 3R93A 4C1NK 1ILQA 1GUOA 4XXEA 2A73B 2EDGA 2K1BA 2B2YC 3PUZA 4X3TA 3M4OB 2VB2X 1TVXA 1DD2A 3URYA 1DCZA 2B2WA 2D5DA 4F87A 1TWAB 2HDMA 2F0KA 5FK9C 4RGTA 5J22A 2FMMA 2O2LD 1LO5D 3J81E 2RSOA 1XYIA 4HSVA 3BDOA 4X3SA 5IGDA 4RHSA 5C5MA 2KA7A 3GV3A 3GTOB 3WOFA 2E74C 3GTJB 1KABA 2CQAA 2KJXA 4HR7B 3SHLA 4B9XA 4V0BA 1QJOA 1STHA 1JQYD 1ICWA 3P75A 4DU9A 1GOZA 5DAUA 4OIJA 2RQXA 3LWUA 1BF4A 4R8NA 2AQ2B 3GV6A 2K03A 1E2VA 1PLFA 4C1NI 3HG9A 3MXUA 4WORA 3CRLC 5EBDA 3HZXA 2PMZB 2HCIA 4WJWA 4FF4A 5HGTA 2KVMA 4RGMA 2IX0A 2F0WA 1MD2D 4TQUS 5LHY1 4U673 2XNAC 2Q8IB 5C0XJ 2A6HD 2AWNA 2MJ8A 5EBCA 5CR3A 1EYAA 4IUVA 5BN4A 4XIGS 1B53A 1A6XA 2KCNA 1Y8PB 4FXGC 3A56A 5M5WB 2XRQD 5K36G 3BYYB 3K6OA 2HQEA 5KNDA 4ID6A 3MHBA 4HEDA 3GD7A 3CU7A 1Q12A 3NE5B 4KHZA 3I73A 5JVH3 3A8IE 2QF7A 1AZPA 3I72A 1MSGA 1C8CA 1XTCD 1HTLD 1AFPA 1I4RA 1SJED 2RDFA 1LTID 1GUGA 1STEA 3MAQA 1HFGA 2B2UA 2ENBA 2NVYB 5IODA 2DN8A 1EY4A 3QJYA 3M7GA 1BCPF 4RGNA 2EJGC 3P7JA 2JA8B 2MHVA 5JPNC 1F9QA 2ID0A 2KQ3A 3PIP3 1U4RA 3TN2A 3BDLA 3VR6A 2CW0D 4G7HC 2X6GA 1UUPA 4A3BB 5EGTA 2B39A 1JWMD 2IT1A 4ABNA 5JAVA 4A93B 3KLRA 1J9OA 2PW5A 2F0IA 1SE4A 3X3MA 1CK1A 2IJ0A 3SVMA 1TIID 3U9OA 2H1EA 3JAME 2KOLA 1BCPB 1TWFB 2F0QA 4NDXA 4X3KA 1RODA 5ELBA 1CHPD 3M4YA 1C48A 2B63B 4FXKC 1STAA 4UDUC 5C4XB 1VCIA 4K8IA 2EY2A 2K5WA 5C3XA 1AZQA 2KECA 1SDFA 3OSOA 1X32A 1EEID 3PUXA 1S5ED 2KHSA 2BCOA 5CV5A 1EY7A 1H9MA 1Y1WB 5C5LA 2A6ED 1S5DD 2LKVA 4BA1I 5A2QE 4N9TA 4KKSA 4L8JA 3HKZB 1LLRD 1G8ZD 1WTRA 2IX3A 3R8BA 4RWSC 1HXYD 5FLXL 1TS5A 3J7AF 3E5SA 1F2ZA 3J7AV 5EPLA 1LT5D 1SNCA 1BOSA 5G3LD 2L9HA 1CQVA 2R3ZA 2F3VA 3CRKC 5JJZA 3NQTA 1EIHA 2CW0C 1PRTC 1I4HA 2ZXRA 5CV8A 2EY1A 5C0XH 3VR3A 2HCCA 2EOTA 2EYLA 3ONAB 1IW7D 1V43A 5EKKA 2ICIA 2F3WA 5CV6A 3EROA 3PO2B 4XYOA 3I70A 3J7YW 1PYWD 4RKLA 3NHHA 4ZLTF 2L0CA 3HGBA 3RZOB 2O5JC 3L9AX 3LNNA 3ZYYX 3VYTA 3J81L 5IOCA 4ZKBB 3D6CA 4A3IB 2F0FA 3E0JA 4KK7A 5KNCA 3MXNA 1D2BA 1SE3A 4C3HG 1HPCA 3L7ZC 1CT1D 5D3DA 1KDAA 4WFN3 1Y69U 3ND8A 5IGGA 1L0XB 4FNFA 3MEHA 1MSHA 2A6EC 3OMCA 2JYOA 1PTOD 3V96A 4EGVA 2KCCA 2EJFC 1I4GA 5JEAH 3GTQB 1F2LA 2EZVA 4KJNA 2IW3A 1V1OA 1XXGA 1AP0A 5I6YA 1UEAB 1Y8OB 3NUCA 4DK1A 1A15A 2E75C 4K5XA 1V8QA 1EWHA 3C1EA 1WTOA 4J1MA 2F03A 3K0YA 3KK7A 4LJZC 2OEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV9 A;  3QB3 A;  5C6A A;  1NUC A;  4ZUJ A;  3DHQ A;  5KYL A;  1JOR A;  4QF4 A;  1EQV A;  2EYM A;  5ISR A;  1EYD A;  2F0Q A;  5EKK A;  2F3W A;  3D8G A;  3ERO A;  4NDX A;  3MXP A;  2RBM A;  3MZ5 A;  4H7B A;  4HTH A;  4KD3 A;  2WAC A;  3EVQ A;  3PMF A;  2RKS A;  1EY8 A;  2F0U A;  2F0J A;  1SNQ A;  4F8M A;  4QMG A;  1SND A;  4RKL A;  1STA A;  2SOB A;  1KDC A;  5IGE A;  3OMG A;  4KY5 A;  5CV6 A;  3NHH A;  4KY6 A;  5KEE A;  4KJO A;  2F0G A;  4NKL A;  2PYK A;  5J1Z A;  2EYJ A;  2F0S A;  4K8I A;  5KIX A;  2EY5 A;  2EY2 A;  5I9O A;  4EQP A;  3TME A;  3OWF A;  3TP7 A;  2PZU A;  1EY5 A;  2F0K A;  5C3X A;  5CGK A;  5I6W A;  2HQE A;  5J22 A;  2EYO A;  1ENA A;  4ID6 A;  5DEH A;  3MHB A;  3OSO A;  2F0V A;  5IOC A;  1STB A;  1SYF A;  3D6C A;  5J39 A;  2F0D A;  2PZT A;  4DGZ A;  1STN A;  2F0F A;  4RKB A;  4PMC A;  2F0E A;  3C1F A;  2KHS A;  4YIJ A;  4HMJ A;  3ERQ A;  4J6H A;  4NMZ A;  4S3S A;  5CV5 A;  4DFA A;  1EY7 A;  3HEJ A;  5I9P A;  5C5M A;  1KAA A;  4DF7 A;  3T16 A;  3SXH A;  5IGF A;  1TR5 A;  4K6D A;  2PQE A;  3R3O A;  1KAB A;  5C3W A;  2F0M A;  2F0L A;  5KYI A;  1A3U A;  3SHL A;  1II3 A;  1KDB A;  1EYC A;  5C5L A;  1STH A;  1TQO A;  2M00 A;  4K5V A;  1EY6 A;  4B9X A;  3P75 A;  1EZ6 A;  1KDA A;  4DU9 A;  1F2Y A;  5DAU A;  2LKV A;  2EY6 A;  2RDF A;  4MIU A;  5IGG A;  1IHZ A;  4N9T A;  3S9W A;  4HMI A;  4ME5 A;  3MEH A;  4KV6 A;  4EQN A;  3OMC A;  2EYP A;  1TT2 A;  4B9W A;  4I65 A;  4R8N A;  1SNP A;  5CV7 A;  2QDB A;  5IGD A;  5K5P A;  4KTA A;  4IAL A;  1SYG A;  2ENB A;  5KGU A;  4PNY A;  2NUC A;  2F0T A;  1AEX A;  4F7X A;  5IOD A;  3MVV A;  5C4Z A;  4LAA A;  4KY7 A;  3E5S A;  1U9R A;  1EY4 A;  4EQO A;  1F2Z A;  4QB4 A;  4EVO A;  3D4D A;  4PMB A;  5KRU A;  3TP8 A;  4ZQ3 A;  2EYH A;  3VA5 A;  1SNC A;  4KJN A;  4WOR A;  3DMU A;  1SYC A;  3ITP A;  2OF1 A;  3QOL A;  4K5W A;  1F2M A;  5E3F A;  1A2T A;  1SYB A;  2EYF A;  2KQ3 A;  4IUN A;  1A2U A;  1STG A;  3NK9 A;  4ODG A;  2SNS A;  5IGC A;  4NP5 A;  2F0P A;  3HZX A;  5M9O A;  3BDL A;  4KD4 A;  2OXP A;  3SR1 A;  1A3V A;  3NP8 A;  3NXW A;  2F3V A;  1SNM A;  5CV4 A;  5I6Y A;  5IGB A;  5EGT A;  3NUC A;  3LX0 A;  4IZ8 A;  3P1H A;  5E1F A;  4E6I A;  5CC4 A;  5HUR A;  3TP5 A;  5HGT A;  1A3T A;  2F0H A;  1JOK A;  4K5X A;  2PW7 A;  3NQT A;  3H6M A;  1EY9 A;  1EY0 A;  4N9P A;  4OL7 A;  3BDC A;  4K2L A;  4K2K A;  5NUC A;  5JAV A;  2F0W A;  4K8J A;  2EXZ A;  5JOB A;  1ENC A;  2SNM A;  3C1E A;  2F0O A;  5EKL A;  4G57 A;  1SYD A;  3T13 A;  3SK8 A;  3V2T A;  3SK6 A;  1SYE A;  3SK5 A;  4K14 A;  2PW5 A;  3D4W A;  1JOQ A;  4J1M A;  5C4H A;  2F0I A;  4WRD A;  3EJI A;  5IIF A;  4TRD A;  5CV8 A;  1STY A;  2EY1 A;  3TP6 A;  1NSN S;  5F2D A;  1JOO A;  1RKN A;  1SNO A;  2EYL A;  2O4X A;  2PZW A;  3QOJ A;  4ZUI A;  2F0N A;  4KHV A;  3RUZ A;  5CR3 A;  3SK4 A;  1EYA A;  3U9O A;  1EZ8 A;  2OEO A; 
#chains in the Genus database with same CATH topology
 2P5Z X;  3A7L A;  5JJK A;  3CCM A;  3NEM A;  4QGU A;  5JJI A;  2E2H B;  2JA6 H;  4A3K H;  2RKS A;  4L5Q A;  1SND A;  1YNX A;  3RMH A;  3HOZ H;  1SJH D;  4DPG A;  1KQS A;  2K5Q A;  3F1Z A;  1HNX L;  1VMP A;  3GDE A;  1VQI A;  1JIC A;  3GTP H;  1QB5 D;  2F4I A;  1S5B D;  3J80 E;  4J15 A;  4GN3 B;  4QL5 A;  1CZW A;  1LTT D;  2K5H A;  1SMY D;  4X66 Q;  4KLK A;  1OXU A;  5IWA L;  4GS3 A;  1NCV A;  4YIJ A;  1KNE A;  1R9T B;  4S3S A;  3CCL A;  1E1O A;  4LUZ A;  2CFM A;  4KMU C;  1SLJ A;  1TR5 A;  4RA8 A;  5C3W A;  4JI3 Q;  3CCE A;  4DK6 C;  5IGE A;  1K8O A;  1WTW A;  1QCB D;  4QIW E;  5M3M H;  1BKB A;  1TWG B;  4C56 C;  3FHW A;  2EYP A;  4I65 A;  1QOH A;  3S17 B;  3PUY A;  3I8Z A;  5FKA C;  1Q81 C;  4F7X A;  4O1N A;  1PTO C;  4OXP A;  4PZ7 A;  2HIV A;  3D4D A;  4CHT B;  3KDF A;  4K0K L;  1B44 D;  3W5O A;  2B2Y A;  2KEE A;  3M85 A;  2C35 B;  2SDF A;  3KUP A;  4LFB Q;  4K5W A;  4DUZ L;  2RSN A;  5E3F A;  3RLN A;  4A3E H;  1FGU A;  3PF5 A;  1A2U A;  3GTG H;  1G2S A;  2EE1 A;  3R2T A;  2OXP A;  4IN3 A;  3SR1 A;  3NXW A;  2NN6 I;  1B7Y B;  3HOY G;  1HUM A;  4O42 A;  2AWO A;  1KRS A;  1HR0 W;  3TP5 A;  1AH9 A;  1JOK A;  3K5O A;  2JA5 G;  1U0L A;  3BVG A;  1CKO A;  1EY0 A;  3H6M A;  4N9P A;  1U4P A;  1HA5 A;  1Q86 C;  1VQL A;  2LXK A;  1IKM A;  1YBY A;  1WTQ A;  3DEP A;  3SK8 A;  1O7I A;  3FPU B;  3Q22 A;  2WAQ B;  5ELF A;  3HRZ C;  1ENF A;  3TDQ A;  4B3M Q;  3R2I A;  5F2D A;  1EWI A;  1MI2 A;  1QVC A;  1EWC A;  2F0N A;  4LF9 L;  4FYD A;  1PXU A;  1WI5 A;  1JJC B;  3JAM L;  2ZJQ A;  4CKC A;  5ISR A;  2NVQ B;  2K50 A;  3FKI H;  3PMF A;  4AYB B;  4FO2 A;  4X66 L;  1DYQ A;  4R4C A;  4R1J A;  3H0G G;  4KY5 A;  4HJ9 A;  1MGS A;  2F0G A;  2RCN A;  3NBH A;  2ZXO A;  4DR1 L;  3S1M H;  3FDT A;  1KNA A;  3K59 A;  3GP7 A;  4CDD C;  4OGQ C;  1I3Q H;  2Z8L A;  4BBR B;  4JI3 L;  2C5C A;  1STB A;  1D8L A;  1M4V A;  4LF5 L;  2M9V A;  1VQB A;  1A62 A;  3C1F A;  1XPO A;  1GKH A;  1SMY C;  5I9P A;  4BY1 B;  4LF8 Q;  5KNB A;  4JBJ A;  2JSO A;  2F0M A;  5KYI A;  1PFN A;  4CDC C;  1D5Z C;  4ILW A;  2K75 A;  4UY8 C;  1H9K A;  1N36 L;  5A2Q L;  2JA7 H;  1FD7 D;  3QG1 A;  1IHZ A;  4JI8 L;  3AMU A;  2FXQ A;  5LL6 X;  3KBX A;  3I4M G;  4B3S Q;  4B3T L;  1TWC B;  1Q1E A;  3IRB A;  1SYG A;  3ULP A;  1D5X C;  3D6W A;  4U68 A;  4RFB A;  3X3N A;  2HT1 A;  1BVS A;  2CKZ B;  2HDL A;  2R6G A;  1G29 1;  1KLU D;  3MC0 B;  3D3R A;  1LTA D;  1QUQ B;  1IL8 A;  2EYF A;  2QW7 A;  1HH2 P;  1STG A;  4ODG A;  2KEN A;  1SFO B;  4C3J G;  1OXT A;  1B9M A;  4CKB A;  2OTJ A;  4TVA B;  3I4N B;  2KCT A;  4DV0 Q;  4JOI C;  1XTD A;  1PTO H;  5AJ3 Q;  3P1H A;  2R92 H;  1XMQ Q;  5M3F H;  2RDG A;  2F0H A;  2PW7 A;  2F52 A;  1FGB D;  3P20 A;  1GM5 A;  2YU9 H;  2MGS A;  2NB0 A;  1EY9 A;  3BZD B;  5CBE E;  1S5C D;  1RTO A;  4LMQ D;  2LS0 1;  1YNJ C;  2QCP X;  1JOQ A;  3BJU A;  1X3Q A;  5JVG 3;  2I07 B;  1J5E Q;  4WRD A;  3FP9 A;  4A3F G;  3B6Y A;  2Y0S B;  3VR5 A;  1JOO A;  3S2D B;  2R7Z B;  2WKC A;  1CHQ D;  1Q8K A;  1KRT A;  3S14 H;  1B50 A;  5C6A A;  2L12 A;  1EYD A;  4A3D G;  1IBM Q;  1IYJ B;  2JQO A;  4KN7 C;  3ULJ A;  3RLO A;  4N8F A;  1G6Z A;  2WV6 D;  4A3K B;  2F0J A;  2L5T A;  1PH2 A;  3IKJ A;  3E3X A;  1LT4 D;  5J1Z A;  4AQY L;  3RLF A;  1ZKO A;  3CC7 A;  3FPP A;  2F0S A;  3M3Y H;  4A3J G;  2UXB L;  1RCV D;  3OWF A;  1WCM H;  3CCS A;  3HS0 C;  3NTK A;  3GTP B;  3I55 A;  2NN6 G;  2R93 G;  4JI0 Q;  4LFC Q;  1PFB A;  1FJG Q;  2F0D A;  3L2P A;  4KHP L;  1VF5 C;  1A8V A;  2A69 D;  1ILP A;  5GRO A;  1TU2 B;  3OW2 A;  4ZYS A;  4A76 A;  1TS2 A;  4JI1 L;  1B1Z A;  1A0I A;  2JA9 A;  2Z6B A;  4BY7 B;  5IYB H;  4K5V A;  1XPR A;  1TS3 A;  2MP1 A;  4JI5 Q;  3HOW B;  4JBM A;  3F2U A;  3AQQ A;  1TS4 A;  1E0B A;  3SEB A;  3K7U C;  1UAP A;  1TT2 A;  5G3L F;  2FHT A;  4HID A;  1UE5 A;  2E2I H;  1K3R A;  4LAA A;  3NQI A;  4OWT B;  5KRU A;  3PGZ A;  3GTL H;  1F2M A;  1XJV A;  1O7L A;  5D14 A;  2D9U A;  3OWE B;  2SNS A;  4DKA C;  1K9M C;  4PZ6 A;  4C3I G;  2EIF A;  1J5E L;  4A3M G;  4C3H B;  5E1F A;  3RD4 A;  5CC4 A;  5HUR A;  4LFA L;  4CJ1 B;  4P73 A;  3OIP A;  5C0X G;  2K32 A;  3TS0 A;  3EA6 A;  3D0F A;  1IBM L;  5JEA J;  4DN4 M;  4IUT A;  3D4W A;  2BH2 A;  2UUA L;  3HOV G;  1C4Q A;  4X6A H;  4QUF A;  4GKJ Q;  2XIW A;  1QUQ A;  4OEL B;  3TEH B;  3MFG A;  4ZUJ A;  1K73 C;  1JOR A;  5IP7 G;  1PRT D;  4Y52 H;  1KHI A;  3G6J B;  2UUC L;  4B08 A;  5M5Y B;  1JB3 A;  4H7B A;  2E2J H;  1NBW A;  3DXJ C;  4FF2 A;  5FO9 B;  4QQB X;  4DR7 Q;  2AMC B;  5BR8 L;  2IPK D;  2SOB A;  3IL8 A;  1FJG L;  3EQL C;  2VUM H;  1IZ6 A;  2QDL A;  5C44 H;  5C3E G;  1GJX A;  2EPB A;  3MTS A;  1N9W A;  4R9W A;  5IYC H;  3J80 L;  1GVP A;  1RF2 D;  1G91 A;  4JVZ A;  1CSP A;  2F0V A;  4UAI A;  3A5Z B;  2CVR A;  5IE8 A;  2BE5 D;  1U5K A;  1CA5 A;  4OON A;  2I5M X;  1XNQ L;  2D62 A;  1KAA A;  2HHH Q;  1PTO F;  1SBB B;  4A3D H;  1TKW B;  2D2C C;  3CQZ B;  2B2V A;  4DAP A;  3WWV A;  4JV5 Q;  2A69 C;  4Y7N H;  1F2Y A;  2X6L A;  3DUZ A;  4LF6 L;  4C2M B;  1BBU A;  1OXS C;  1GUS A;  2DY7 A;  2WIN B;  5JEA G;  3G6E A;  1XNR L;  2VQE Q;  4JYA Q;  2ZXP A;  5IT9 c;  1VQK A;  4GNX B;  2ATW A;  2JP1 A;  1U9R A;  2NN6 H;  4FVM A;  2LSS A;  1UE7 A;  4PV1 C;  1DOM A;  4YCW A;  3NK9 A;  4DNR B;  4L5T A;  2F0P A;  4CBV A;  3GTK B;  1F9S A;  4KD4 A;  1VQE A;  2Q2U A;  1VQJ A;  4NXN L;  3NP8 A;  2E5L L;  1SN8 A;  3G71 A;  3HOU G;  3DWA A;  1CA6 A;  1PTO B;  4QCL A;  3K5N A;  1KLG D;  4ZRZ A;  1IL2 A;  1UEB A;  4K2K A;  1Q8I A;  5NUC A;  1VF7 A;  4GKJ L;  2B8G A;  2YTX A;  2F0O A;  1HNZ L;  1Y1V H;  2NBF A;  4LW1 A;  3Q8D A;  4ZK9 B;  3S2H B;  2NWG A;  2Q8R E;  4H02 A;  3L3O C;  1E2Z A;  4JG2 A;  4GOP B;  1I6H B;  1NSN S;  3F2D A;  1NMG A;  4IO9 A;  2NTS A;  1SE2 A;  2K5N A;  4LWC A;  3RUZ A;  4CJ2 C;  3QR8 A;  3K57 A;  1I94 L;  4IFD I;  5KYL A;  3J81 c;  1HRJ A;  3TSS A;  1HFN A;  2RBM A;  3MZ5 A;  3HOZ G;  1LTR D;  2WAC A;  3EVQ A;  1QIL A;  2K7V A;  4WJ4 A;  2E8G A;  4XQQ A;  3HOX H;  4F88 A;  1XPU A;  4JC0 A;  2F0U A;  4FXD A;  5I2X A;  1WVL A;  4QMG A;  1XMO L;  3HOY B;  4KJO A;  1WTH A;  3U9S A;  2UUB Q;  1TWH B;  3NSW A;  2MNA A;  2JA5 B;  2QKI C;  2HHH L;  1EY5 A;  3A54 A;  4DR3 L;  4A3G H;  1HQM C;  2B8F A;  1RDP D;  1E22 A;  2R61 A;  4QY7 A;  4ZKC B;  2LXJ A;  2PCF B;  4JV5 L;  4NW2 A;  4LK1 C;  3UDG A;  2A19 A;  1STN A;  1HZB A;  4I7A A;  1S5F D;  4HMJ A;  4DFA A;  1U4M A;  1CZG A;  1ESR A;  3PUW A;  4RAU C;  4JI4 L;  4QIW B;  4OO1 I;  4X62 Q;  5IP7 H;  1EOT A;  1OXV A;  4J8Q A;  1G6P A;  2BE5 C;  5M3M G;  1A3U A;  3S1Q H;  4GKK L;  2L11 A;  1JCK B;  2I5H A;  2SEB D;  1Q82 C;  1WD0 A;  4A3C G;  5ELO A;  3ERS X;  1CSQ A;  1SSO A;  1RL2 A;  5HY6 A;  2K04 A;  1LAB A;  3H0G B;  5CV7 A;  3PO3 H;  3S1R H;  1UE6 A;  2A74 C;  5H1S E;  4A3E G;  5LMN Q;  1YI2 A;  2ZTD A;  3H94 A;  1PH8 A;  4OX9 L;  3STB D;  3DMU A;  2BDN A;  4ME3 A;  1YJN A;  2Q8T A;  3A55 A;  1NY4 A;  1D5M C;  3T1H L;  1KTK A;  1SXT A;  1LT3 D;  5CV4 A;  4XYQ A;  1F9R A;  5IGB A;  1C7Y A;  2B3G A;  4DV6 L;  4ZCK A;  4DV7 Q;  3GQB A;  1CI3 M;  4OL7 A;  1EQQ A;  2G9D A;  1YIJ A;  2EXZ A;  1Q90 A;  2O5I C;  3M4O H;  1SYD A;  4IFD J;  1SYE A;  5EPK A;  2A68 D;  4DV4 L;  4GNX A;  1TWA H;  2RHS B;  3EJI A;  2NVT B;  3I4M B;  3FKI G;  3D4R A;  1K0R A;  2O4X A;  4ZUI A;  3A7A B;  1DOL A;  3T4A C;  4XQJ A;  1EZ8 A;  2DJG C;  1JE5 A;  4QF4 A;  3ULL A;  4UPA A;  1PMR A;  1HZC A;  3GTO H;  1GD7 A;  2AUJ D;  2FIN B;  2K5V A;  4C3J B;  1QNK A;  4JI2 Q;  1GHJ A;  3OYY A;  1NTG A;  1EIG A;  4H13 C;  4DUY L;  3OTO Q;  4DAY B;  4MNO A;  5KEE A;  4YHH Q;  4P2C B;  4QUC A;  2EYJ A;  2WB1 E;  4IUP A;  4A93 G;  3BVM A;  3K58 A;  1LV9 A;  5I6W A;  1PH4 A;  4X3U A;  1Q46 A;  4GOP A;  1JE4 A;  3H3V I;  3VR2 A;  1OO9 B;  3K80 C;  2UXC Q;  2GVA A;  3Q23 A;  2F4V Q;  4DXF A;  4A3F B;  3HP3 A;  2B2T C;  3TBI B;  2WFW A;  4YWM A;  3CD6 A;  2JA7 G;  1O7Z A;  2RDH A;  5ELE A;  1UE1 A;  1YIT A;  4A3D B;  2QA4 A;  1M90 C;  5COY A;  1ET6 A;  2PNH A;  2L15 A;  4IJH A;  4DR5 L;  4MIU A;  5IP9 H;  3BVZ A;  1W6J A;  4IJL A;  4Y7N B;  3K5L A;  3CCV A;  2KBN A;  3IAY A;  4GN4 B;  1LT6 D;  1FVI A;  4IFD G;  2WP8 J;  2AUK A;  2VQF Q;  4YWL A;  4A3J B;  4JI6 Q;  1BCP C;  4JK1 C;  3OOC A;  3U4V A;  2R93 B;  2OF1 A;  2V4D A;  4DR4 Q;  2G9H D;  2R92 G;  1SYB A;  2ZTC A;  5M3F G;  1CFM A;  2WB1 G;  4HCS A;  1K28 A;  5M9O A;  4RMF A;  3STB C;  3AEV A;  1MJE A;  2ZM6 L;  1FR3 A;  1T5X D;  1JC7 A;  3Q0A A;  5M5W H;  2N8N A;  4A3L G;  4A3C H;  1HCZ A;  5M5X B;  2NTT A;  4DF7 A;  3E9H A;  4HAE A;  3K8A A;  5EKL A;  4G57 A;  2YTY A;  2XSC A;  1VQO A;  3V2T A;  4YY3 L;  4YWK A;  1VQP A;  5I2Y A;  3I4L A;  3KLS A;  5CYU A;  3F2B A;  3S16 B;  1ML0 D;  1W2B A;  2Z1C A;  3I56 A;  4RH6 A;  2EVB A;  1RKN A;  1NAP A;  2UXD Q;  3S15 H;  2A68 C;  4DXG A;  3OTO L;  2N49 A;  4P72 A;  3CCR A;  3A8K E;  4K6L A;  5GAD C;  4HN7 A;  2NVX B;  1MHW C;  3CHB D;  3VA7 A;  4BXX H;  4FP5 D;  2TSS A;  4KD3 A;  1YNJ D;  1UWV A;  2FJ2 A;  1B4O A;  2PI2 E;  3PIO A;  1EY8 A;  1N8R C;  3GTM B;  2DNC A;  3RZD B;  5IYD G;  1WCM G;  1K8A C;  2EXD A;  3OMG A;  4C3I B;  2UXC L;  2JEB I;  5C4J B;  4HJ7 A;  4A3M B;  3UDF A;  5KIX A;  5I9O A;  4UP9 A;  5CGK A;  1PFS A;  1Y14 B;  2GN5 A;  3CP0 A;  2OQK A;  2K33 A;  5FO8 B;  4JOI A;  4B3R Q;  5COR A;  1V1P B;  3NBI A;  4PQX A;  2NVY H;  3FMC A;  1YHB A;  4N8X 1;  1HR0 Q;  1DOK A;  3HOV B;  1KAW A;  1RHP A;  1D1K A;  5IYB G;  3UE1 A;  2J0T D;  1DXM A;  3T16 A;  1F77 A;  2VXW A;  5AFW A;  2F0L A;  1EEF D;  4R4O A;  3ZJY C;  2NZ1 D;  4JI6 L;  1K83 B;  1EZ6 A;  4A3B H;  1OTC A;  4DAY A;  1JJG A;  3BZK A;  1O78 A;  1YVC A;  4UP7 A;  4ME5 A;  1IBL Q;  4DR2 Q;  4DR4 L;  2Z0S A;  3PSI A;  1DZ1 A;  5E4W C;  1CUK A;  4KN4 C;  4A93 H;  5C3E B;  1B3A A;  5KGU A;  5IT9 E;  4GZY C;  3SDZ A;  3PV0 A;  1GUT A;  2B29 A;  1K8M A;  3TZD A;  1X65 A;  4PMB A;  2VB3 X;  3VA5 A;  2ASB A;  1SYC A;  1HHV A;  4GLX A;  4DV3 Q;  2QIL A;  1TWF H;  1SNM A;  1SR3 A;  4LFB L;  3CW2 C;  2A5H A;  4OWW B;  4JPB W;  5FLM H;  3SGI A;  1I6V C;  4O2D A;  3KLS X;  3MFY A;  3MA2 B;  1PH1 A;  1RTN A;  1JWU D;  1PRT F;  3NWT A;  5A35 A;  5C4X H;  4IFD H;  4K14 A;  1I4Q A;  4TRD A;  3VR4 A;  1Z47 A;  2WKD A;  4POG A;  3DWP A;  5EQ0 A;  3CF5 A;  2K28 A;  1PDQ A;  1WTX A;  3H3V C;  2YV5 A;  3K7A B;  3K5M A;  1S4Z A;  1YZ6 A;  4IPC A;  1L1O B;  1AW7 A;  4B3M L;  4HTH A;  4I7Z C;  2VUM G;  1P16 A;  3MEF A;  5DLQ E;  5C44 G;  1Y1W H;  1LAC A;  4IUR A;  4CKE A;  4PZ8 A;  3CPW A;  3FEW X;  5IYC G;  3U50 C;  1N32 Q;  2K14 A;  4KY6 A;  4NKL A;  3HOU B;  1NJI C;  4A3L H;  1LTS D;  4DV2 Q;  2F1M A;  1I50 B;  2VZA A;  4EQP A;  4GLV B;  4DNI A;  2QEJ C;  1EU4 A;  4DR6 Q;  4OO1 H;  2EYO A;  2Z6K C;  2IL8 A;  5ELN A;  5ELD A;  3NEN A;  1PRT B;  2PZT A;  5J3B A;  1VQ4 A;  5IGF A;  4NMZ A;  2CWP A;  2JA6 B;  4M8A A;  4RG1 A;  4OWX B;  3HFZ B;  1CQF A;  3D31 A;  1KDB A;  1EFI D;  3HOZ B;  3KBG A;  3VYS A;  4LF8 L;  3M4Q A;  2EY6 A;  4TSS A;  5IYD H;  1J8I A;  1ONL A;  4B9W A;  3NPP A;  2QDB A;  4LUO A;  4IAL A;  1DON A;  1W3S A;  2NUC A;  3M4P A;  1EUJ A;  1V1P A;  3MVV A;  5C4Z A;  3BG3 A;  2JXM B;  2HD3 A;  2J4X A;  2PNR C;  4B3S L;  2E76 C;  1E2W A;  1A2T A;  2B2W C;  5DM7 3;  4G7Z C;  2V1C C;  4NP5 A;  2WAQ E;  3J80 i;  3PO2 H;  1PA6 A;  1QZG A;  1AE2 A;  2OCE A;  2BA0 A;  3AU7 A;  2WII B;  1Y1V G;  3NWS A;  4RHR A;  3MWY W;  5M3M B;  4R4T A;  2Z4H A;  5GQO A;  5E4X A;  4K8J A;  1IYV A;  4Q0F A;  4DV0 L;  5AJ3 L;  3SK5 A;  3TS2 A;  1XMQ L;  4QJF A;  1BO0 A;  4XQN A;  1NR2 A;  1WFQ A;  4CDF C;  1SNO A;  4L6T B;  3J80 c;  4A3E B;  1GUN A;  3HOX G;  4A3I H;  3GTG B;  2L55 A;  3QB3 A;  1WTV A;  3S15 B;  1PZJ D;  5L37 A;  3DM3 A;  3CC2 A;  1TY2 A;  1UNS A;  1A63 A;  3J7Z C;  4MZ9 A;  1MKH A;  4P75 A;  3QO2 A;  4BBS G;  1E1T A;  3QWN A;  2A8V A;  1R4P B;  4A3G G;  4LF7 Q;  5EKI A;  1TXY A;  3H3V H;  3TZU A;  1S72 A;  2AHO B;  2PYK A;  1L0Y B;  1VQ5 A;  1YJ9 A;  5CMD A;  2XVS A;  2EY5 A;  1RD9 D;  2PZU A;  1EU3 A;  1X3P A;  2WAQ G;  5DEH A;  2RHQ B;  2UU9 Q;  1PH3 A;  4LUV A;  4HJA A;  1L2F A;  5BN5 A;  1LUZ A;  1ESF A;  1Q1B A;  1FNU A;  1FNW A;  3FKI B;  4J6H A;  4ULL A;  3GTQ H;  1L1O A;  1IKL A;  4JI7 Q;  4JI0 L;  4LFC L;  1BR9 A;  4DK0 A;  1II3 A;  4X64 Q;  3PO3 G;  1EY6 A;  2QEX A;  5FJ8 H;  1JB7 A;  2M2L A;  3S1M B;  4MHE A;  2D0O A;  2MO1 A;  2AQ1 B;  3S1N H;  3KF6 B;  3KLW A;  1NR4 A;  1I3Q B;  3FVQ A;  1QG7 A;  2KHJ A;  4H44 C;  1EQR A;  2N88 A;  4MN3 A;  4JI5 L;  3CCJ A;  1IBK Q;  3M7N A;  2F0T A;  1AEX A;  1F9P A;  4KY7 A;  5FLX c;  4JBK A;  2XWJ B;  3FRP B;  4G4K A;  4QB4 A;  3PUV A;  4X65 Q;  4LF4 Q;  3W3A A;  5FO7 B;  4ZQ3 A;  3PIO 3;  4BWG B;  4IOC A;  4UP8 A;  2DGY A;  3I91 A;  4YCV A;  1B3Q A;  1U4L A;  1E7Z A;  3AFQ A;  3VYR A;  1KXL A;  1CKN B;  2MFI A;  2E2H H;  1JR0 D;  2A6H C;  3KF8 A;  2JA7 B;  2ZJP A;  1H9S B;  2ICE C;  1GXD C;  2Z4I A;  3N6R A;  3C2P A;  1IYU A;  2IY5 B;  4H0L C;  2EJM A;  3E6Z X;  2PMZ E;  1WD1 A;  4DV1 Q;  1ENC A;  1SRO A;  1K3B C;  1LTL A;  3T56 B;  3HKS A;  5I4D A;  3T1Y Q;  1JWS D;  1XX8 A;  2HIX A;  1STY A;  1Y8N B;  1FNV A;  5JPM C;  1G2T A;  1ZYR D;  2KHI A;  4XTC S;  4HJ8 A;  2C9O A;  2BH8 A;  2JEA I;  4R4Q A;  5GAH C;  5CV9 A;  2PO4 A;  1EQV A;  2EYM A;  3DM1 A;  1R9T H;  2N55 A;  3J81 i;  2B2U C;  4MTK A;  3KFU A;  1K0S A;  2R92 B;  4NXM Q;  4DV5 Q;  1SE8 A;  5M3F B;  2WB1 B;  2YU9 B;  4HJ5 A;  1CM9 A;  5LL6 S;  4F8M A;  3I3C A;  2UU9 L;  5EPJ A;  3UI2 A;  4A75 A;  2CQO A;  3KJP A;  3E9I A;  2J7Z A;  5EJW A;  1TWG H;  4DR7 L;  4XDX A;  1AN8 A;  1HJP A;  5K36 H;  1BUV T;  3S17 H;  2LY7 A;  1VQ9 A;  1SYF A;  3S14 B;  5J39 A;  5GAE C;  4TKO B;  4IPH A;  4LNQ A;  2H4O A;  3BZC A;  2JE6 I;  1H9J A;  3RR5 A;  5IP9 G;  2PQE A;  3SE0 A;  1N34 Q;  3U58 A;  2DUD A;  3PF4 A;  2BDO A;  4BBS H;  1VQC A;  2DY8 A;  1QNU A;  3ER0 A;  3WDN A;  3M3Y B;  1TY0 A;  1WCM B;  2K05 A;  5IT9 L;  4M1U B;  3ICE A;  1VQG A;  1GHK A;  1Z6H A;  1PH7 A;  2K52 A;  1I4P A;  2MPM A;  2K01 A;  4CGY B;  4IUQ A;  2AQ3 B;  2Q2T A;  3A74 A;  2EYH A;  2B2V C;  1D1I A;  3Q6S A;  2VQE L;  4JYA L;  4IUN A;  1QVF A;  2E2D C;  3NTH A;  4DAV A;  4IOA A;  3W1B A;  1PZK D;  2FFK B;  2NVQ H;  1HUN A;  2XN9 C;  2JN4 A;  1BBX C;  4E6I A;  1MIU A;  1BCP D;  1VQD A;  3QIA A;  1ASY A;  3WOE A;  2OQ0 A;  2NYZ D;  1HNW Q;  2Q2H A;  4IPG A;  5LMN W;  4PG3 A;  3KF6 A;  2B2T A;  3T13 A;  5DNF A;  1M1K C;  1BBW A;  2E2I B;  1SEB D;  1EYG A;  4FF1 A;  3DWQ A;  1NNX A;  3NTI A;  4BA2 I;  4DA2 A;  4DK3 C;  4BXX G;  4OHJ A;  2PZW A;  3A8J E;  4BBR H;  3CXC A;  4R8I A;  3GTL B;  4HCE A;  2K5D A;  5T1I A;  3OHX C;  2GVB A;  1HZ9 A;  4KI0 A;  1D6E C;  1LTB D;  1DM0 B;  3D8G A;  4OIK A;  3MXP A;  4BY1 H;  1CKN A;  1V1Q A;  1ZYR C;  1ASZ A;  3H91 A;  3VYU A;  1HNX Q;  4GLA C;  1H9S A;  1PFM A;  1VDZ A;  2I46 A;  1GUW A;  3VDY A;  2MQH A;  1SNQ A;  2K6A A;  4KKU A;  3KJO A;  1M8A A;  3TME A;  2RVL A;  1ZXT A;  4RGO S;  3KYH C;  2JA8 G;  1TWC H;  2LFN A;  4RCO A;  3OW7 A;  5DM6 3;  1HQR D;  2FMC A;  2UUB L;  3ERQ A;  2E2J B;  1EL0 A;  3HEJ A;  5ELC A;  1BDO A;  4R4I A;  1I4X A;  3GTJ H;  1OXX K;  4A3B G;  3SXH A;  4K6D A;  2HUG A;  3R3O A;  3N52 A;  1SFO H;  1QE6 A;  4CJ0 B;  4XT1 B;  1WJJ A;  2MUY A;  1B2T A;  1EYC A;  1I5F A;  1TQO A;  3BYT B;  2VUM B;  4G7O C;  1O7Y A;  2L1B A;  1QWY A;  5C44 B;  1XWE A;  2YYZ A;  4X62 L;  3S9W A;  2KED A;  2L4N A;  1L0W A;  3GO5 A;  4K0K Q;  3LGJ A;  4KV6 A;  3G48 A;  1NMF A;  1ZEQ X;  4EQ5 A;  3I4O A;  1SNP A;  3S1N B;  4KTA A;  1VMC A;  4DUZ Q;  1IXR A;  3K0X A;  2CWA A;  1BQQ T;  3HKZ E;  4EQO A;  3BS1 A;  4EVO A;  4BS9 A;  5TSS A;  3AFP A;  3W2D A;  2CHB D;  3TRZ A;  3S2D H;  3QOL A;  2R7Z H;  1X3G A;  1YNN D;  1VQM A;  4MTN A;  1BXT A;  2PQA B;  5FLM G;  2B63 G;  5LMN L;  2ZT9 C;  4XT3 B;  3V05 A;  1PZI D;  3H09 A;  5D65 A;  1PH5 A;  4IZ8 A;  1EQT A;  2IWH A;  1RJT A;  2VW9 A;  3JAM i;  2OTL A;  5C4X G;  1PV4 A;  1A3T A;  1PH6 A;  1T5E A;  3OIQ A;  3BDC A;  4K2L A;  4O0A A;  4ZAI A;  4JCV E;  1B9N A;  1IW7 C;  5JOB A;  2SNM A;  1CKM A;  4LF9 Q;  4FF3 A;  2CCZ A;  2RF4 A;  1H95 A;  3O13 A;  4DV7 L;  2Q2I A;  5FOB B;  1O80 A;  1MBY A;  2GA4 B;  1Y1W G;  1QZH A;  4KHV A;  1ET9 A;  4PMC A;  2LMC B;  3JAM c;  2R7F A;  1X55 A;  3DHQ A;  4HSP A;  3DEO A;  3I2Z A;  1KC8 C;  1BNZ A;  4DR1 Q;  3CKI B;  1CTM A;  3HKZ G;  3PIP A;  1KDC A;  4BY7 H;  4GNX C;  4OO1 G;  3HOW H;  4LF5 Q;  1Y1V B;  2VNU D;  3MXG A;  2K4K A;  4JI2 L;  3TP7 A;  1ENA A;  4L63 B;  3CPF A;  1R4Q B;  2ZTE A;  2RA4 A;  3IFT A;  4YHH L;  4IUU A;  4RCN A;  2PI2 A;  4DGZ A;  1S3O A;  1VQF A;  4RKB A;  2I0Q A;  2F0E A;  1N36 Q;  1Z7T A;  2PPB C;  3HOX B;  4JI8 Q;  2X69 A;  4WJ3 M;  2F4V L;  3LWE A;  2M00 A;  3G4S A;  4B3T Q;  1WOC A;  4C3H H;  4BBS B;  4HMI A;  2KUM A;  5T1G A;  1EIF A;  4GOP C;  1HTP A;  4EQN A;  3RN2 A;  4A3G B;  5K5P A;  1LTG D;  3IFD A;  1SAP A;  3ND9 A;  3I90 A;  1E3P A;  1DJR D;  1Q3L A;  4PNY A;  2BA1 A;  4DNT B;  5FLX E;  2IX1 A;  3C46 A;  2JA8 H;  5BN3 A;  1VQA A;  3TP8 A;  3Q24 A;  1W6K A;  3PO2 G;  3ITP A;  2VQF L;  2XWB B;  3OPO A;  2OT2 A;  3AB9 A;  5IGC A;  3S1Q B;  2XRS D;  4UHV A;  1A3V A;  2JK8 A;  2NZH A;  1YNN C;  2Z6K A;  5M5Y H;  4IQZ A;  1X6O A;  3LX0 A;  5CBA E;  4P71 A;  5D3I B;  4Z9C B;  3T51 B;  2JJQ A;  3EFX D;  1YHA A;  3PO3 B;  2F3I A;  1WTP A;  1HA6 A;  3H15 A;  3S1R B;  4PMW A;  3UDX A;  3CME A;  3SK6 A;  3T53 B;  4A3I G;  2TMP A;  5C4H A;  4L5R C;  5IIF A;  2BOS A;  1HZA A;  3TP6 A;  3EIV A;  1H9R A;  4Q5V A;  3QOJ A;  4JBW A;  3SK4 A;  2DNE A;  2PQA A;  1FYC A;  4V19 0;  1NUC A;  3G7L A;  1DGS A;  4KKT A;  1X3E A;  1X54 A;  4AIM A;  4NB3 A;  5C0X I;  4AQY Q;  3C3L A;  2B63 H;  2UXD L;  3R93 A;  4C1N K;  1ILQ A;  1GUO A;  2UXB Q;  1VS0 A;  4XXE A;  1VQ8 A;  2A73 B;  3CQZ H;  1PH9 A;  2EDG A;  3PQI A;  1T9H A;  2K1B A;  2B2Y C;  1SMX A;  2HQL A;  2N3S A;  3PUZ A;  4X3T A;  4APV A;  2VB2 X;  1TVX A;  3M4O B;  1DD2 A;  3URY A;  1E24 A;  1DCZ A;  1PYB A;  2B2W A;  2D5D A;  4F87 A;  4C2M H;  1TWA B;  2HDM A;  3S24 A;  4KHP Q;  2F0K A;  3J81 j;  5FK9 C;  4RGT A;  5J22 A;  1Q7Y C;  2FMM A;  2O2L D;  1LO5 D;  3J81 E;  2RSO A;  4NPS A;  4JI1 Q;  1XYI A;  4HSV A;  3BDO A;  4X3S A;  5IGD A;  2CH4 W;  4RHS A;  5C5M A;  2KA7 A;  5FJ8 G;  3GV3 A;  4B3R L;  3GTO B;  3WOF A;  2E74 C;  3GTJ B;  1KAB A;  2CQA A;  2KJX A;  4HR7 B;  1HR0 L;  3GTK H;  3SHL A;  4B9X A;  4V0B A;  1QJO A;  1JQY D;  1STH A;  1ICW A;  3P75 A;  4DU9 A;  1GOZ A;  5DAU A;  4OIJ A;  2RQX A;  1RIP A;  3M9B A;  3CCU A;  3LWU A;  1BF4 A;  4R8N A;  2AQ2 B;  3L0O A;  3GV6 A;  2K03 A;  1E2V A;  2VY3 A;  1PLF A;  4DR2 L;  1IBL L;  4C1N I;  3HG9 A;  3S2H H;  3MXU A;  4WOR A;  1I6H H;  1JT8 A;  4LFA Q;  3CRL C;  4IPD A;  5EBD A;  3KF8 B;  1JJ2 A;  3HZX A;  2OWO A;  3PCO B;  2PMZ B;  2HCI A;  4WJW A;  1WYD A;  4FF4 A;  5HGT A;  2UUA Q;  2KVM A;  1G51 A;  4RGM A;  4DV3 L;  2IX0 A;  2F0W A;  3HOY H;  1MD2 D;  4TQU S;  3RNU A;  5LHY 1;  4U67 3;  1TWH H;  4HIO A;  2XNA C;  2JA5 H;  2Q8I B;  5C0X J;  2UUC Q;  1N33 Q;  2A6H D;  2AWN A;  2MJ8 A;  5EBC A;  5CR3 A;  1EYA A;  4IUV A;  5BN4 A;  1PHJ A;  4XIG S;  1B53 A;  5E7N A;  1A6X A;  2KCN A;  5BR8 Q;  1Y8P B;  4FXG C;  3A56 A;  1Z9F A;  1JMC A;  5M5W B;  2XRQ D;  3RZO H;  3A0J A;  5K36 G;  4AYB E;  3BYY B;  4A4I A;  3AYH B;  3K6O A;  4P74 A;  3TRE A;  1N32 L;  2HQE A;  5KND A;  3H0G H;  1XNQ Q;  4ID6 A;  4FDB A;  3MHB A;  2A1A A;  1B8A A;  3GD7 A;  3CU7 A;  1Q12 A;  4HED A;  1ICF B;  3CAM A;  4DV2 L;  3NE5 B;  4KHZ A;  2Z9H A;  3I73 A;  3CMA A;  5JVH 3;  3A8I E;  2MO0 A;  3F8T A;  1QVG A;  4DR6 L;  1AE3 A;  2QF7 A;  1AZP A;  3I72 A;  1YEZ A;  5HGQ A;  4LF6 Q;  1MSG A;  1C8C A;  1XTC D;  1HTL D;  1AFP A;  1I4R A;  1XNR Q;  1SJE D;  2RDF A;  1LTI D;  1GUG A;  1STE A;  3MAQ A;  1KIX A;  1J6Q A;  1HFG A;  2ALY B;  2B2U A;  2ENB A;  5JJL A;  2NVY B;  4EX5 A;  5IOD A;  3CC4 A;  1KL9 A;  2DN8 A;  1EY4 A;  3QJY A;  1VQ7 A;  3M7G A;  1BCP F;  1VQH A;  4RGN A;  2EJG C;  4NXN Q;  2NVT H;  2H5X A;  3UDI A;  2E5L Q;  3I4M H;  3P7J A;  2JA8 B;  2MHV A;  3F2C A;  5JPN C;  1F9Q A;  4AYB G;  2ID0 A;  1VQ6 A;  2KQ3 A;  3PIP 3;  1U4R A;  3TN2 A;  2ES2 A;  3W1G A;  1EFW A;  3BDL A;  3VR6 A;  2CW0 D;  4AH6 A;  4G7H C;  1HNZ Q;  2X6G A;  1UUP A;  4OEM B;  5EGT A;  4A3B B;  2B39 A;  1JWM D;  1N33 L;  4CDE C;  4C3J H;  1EIY B;  2IT1 A;  4ABN A;  5JAV A;  1PYS B;  4A93 B;  3KLR A;  4BBR G;  1J9O A;  3UE0 A;  3DLL A;  1I94 Q;  2PW5 A;  3EN2 A;  1PVO A;  2F0I A;  2IHF A;  2ZJR A;  1SE4 A;  2VS1 A;  1LM0 A;  4BY1 G;  3X3M A;  1CK1 A;  2QGQ A;  2IJ0 A;  3SVM A;  1P8L A;  1TII D;  3U9O A;  2H1E A;  3JAM E;  3A5U A;  4A3F H;  1XMO Q;  2KOL A;  2Y0S E;  1BCP B;  1TWF B;  2F0Q A;  1VQN A;  3MXN B;  4NDX A;  2NZO A;  4X3K A;  1ROD A;  5ELB A;  1CHP D;  3M4Y A;  1C48 A;  2B63 B;  4DAM A;  5LMU Q;  3EBE A;  3BU2 A;  4FXK C;  4DR3 Q;  1STA A;  1GO3 E;  3NEL A;  1EOV A;  4UDU C;  5C4X B;  1VCI A;  4K8I A;  2EY2 A;  4JW0 A;  2K5W A;  5C3X A;  1AZQ A;  2KEC A;  1SDF A;  4LF7 L;  3OSO A;  4JI4 Q;  1X32 A;  4A3J H;  1EEI D;  4GKK Q;  3PUX A;  1S5E D;  2KHS A;  2N78 A;  2BCO A;  5CV5 A;  1EY7 A;  1H9M A;  2RCF A;  3I4N G;  2XGT A;  1Y1W B;  2R93 H;  5C5L A;  2DJF C;  2A6E D;  4HIK A;  1S5D D;  2LKV A;  4BA1 I;  5A2Q E;  4JI7 L;  4N9T A;  4KKS A;  4L8J A;  3HKZ B;  1X3F A;  1LLR D;  5M5X H;  4OX9 Q;  1G8Z D;  2Y0S G;  4X64 L;  1WTR A;  2IX3 A;  3R8B A;  1D7Q A;  2R7Z G;  4RWS C;  1HXY D;  1L1O C;  5FLX L;  1TS5 A;  3J7A F;  3E5S A;  1F2Z A;  3J7A V;  2KCM A;  3T1H Q;  3S16 H;  5EPL A;  1LT5 D;  1SNC A;  1BOS A;  1LYL A;  4DV6 Q;  1IBK L;  2IHE A;  5G3L D;  2JA6 G;  2L9H A;  1CQV A;  4A3K G;  2R3Z A;  2NVX H;  3U4Z A;  4X65 L;  4LF4 L;  2F3V A;  3CRK C;  5JJZ A;  4DV4 Q;  3NQT A;  1EIH A;  2CW0 C;  3GTM H;  3JC6 6;  3RZD H;  1PRT C;  1I4H A;  4C3I H;  2ZXR A;  5C4J H;  4A3M H;  4YCU A;  3CCQ A;  2AKW B;  3I7F A;  1C0A A;  5CV8 A;  2EY1 A;  5C0X H;  2XTI A;  3VR3 A;  5LMU L;  2HCC A;  2EOT A;  4DV1 L;  2EYL A;  3ONA B;  1YJW A;  3T1Y L;  3HOV H;  1IW7 D;  1V43 A;  4DUY Q;  5EKK A;  2ICI A;  2F3W A;  5CV6 A;  3ERO A;  5GAG C;  4XYO A;  3I70 A;  4BY7 G;  3PO2 B;  1K8G A;  3HOW G;  3J7Y W;  1PYW D;  4RKL A;  1K83 H;  4GN5 A;  3NHH A;  4ZLT F;  2L0C A;  3HGB A;  1V9P A;  3RZO B;  2O5J C;  3L9A X;  4NXM L;  4DV5 L;  5IY0 A;  2G5D A;  3LNN A;  3ZYY X;  3VYT A;  5EAY A;  3J81 L;  5IOC A;  5C3E H;  4ZKB B;  3D6C A;  1B70 B;  4A3I B;  1NE3 A;  4HIM A;  3KDF B;  2F0F A;  3E0J A;  4KK7 A;  5KNC A;  3RN5 A;  1YHQ A;  3K81 C;  3MXN A;  1S40 A;  1SE3 A;  4DR5 Q;  1D2B A;  4C3H G;  2YTV A;  1HPC A;  3L7Z C;  1SRU A;  2I5L X;  1CT1 D;  5D3D A;  1KDA A;  4WFN 3;  5IWA Q;  1Y69 U;  3ND8 A;  5IGG A;  1L0X B;  4FNF A;  2CH4 A;  2R7D A;  3MEH A;  1X56 A;  1MSH A;  2A6E C;  1N34 L;  4ALP A;  3OMC A;  2JYO A;  1KD1 C;  1PTO D;  3V96 A;  3E0E A;  4EGV A;  2D0P A;  4POF A;  2KCC A;  2EJF C;  1I4G A;  5JEA H;  3GTQ B;  1C9O A;  2ZM6 Q;  1F2L A;  2EZV A;  4KJN A;  2IW3 A;  3TQY A;  1V1O A;  1XXG A;  3K7A H;  3I4N H;  1AP0 A;  2VL6 A;  3KOJ A;  5I6Y A;  1UEA B;  1Y8O B;  3NUC A;  4YY3 Q;  4DK1 A;  1A15 A;  2E75 C;  4K5X A;  3J7A 5;  1V8Q A;  1X9N A;  1EWH A;  4L5S A;  3C1E A;  3NBH B;  3HOU H;  1WTO A;  1HNW L;  4J1M A;  2EQS A;  1I50 H;  2F03 A;  1FL0 A;  1MJC A;  3K0Y A;  3KK7 A;  4LJZ C;  2OEO A; 
#chains in the Genus database with same CATH homology
 3A7L A;  2E2H B;  2RKS A;  1SND A;  3RMH A;  1SJH D;  2K5Q A;  1VMP A;  1JIC A;  1QB5 D;  2F4I A;  1S5B D;  3J80 E;  1CZW A;  1LTT D;  1SMY D;  1OXU A;  1NCV A;  4YIJ A;  1KNE A;  1R9T B;  4S3S A;  4KMU C;  1TR5 A;  4RA8 A;  5C3W A;  5IGE A;  1K8O A;  1WTW A;  1QCB D;  1TWG B;  4C56 C;  2EYP A;  4I65 A;  1QOH A;  3S17 B;  3PUY A;  3I8Z A;  5FKA C;  4F7X A;  4O1N A;  1PTO C;  4CHT B;  3D4D A;  1B44 D;  2B2Y A;  2KEE A;  3M85 A;  2SDF A;  3KUP A;  4K5W A;  2RSN A;  5E3F A;  1A2U A;  1G2S A;  2EE1 A;  3R2T A;  2OXP A;  4IN3 A;  3SR1 A;  3NXW A;  2NN6 I;  1HUM A;  4O42 A;  2AWO A;  3TP5 A;  1JOK A;  3K5O A;  3BVG A;  3H6M A;  1EY0 A;  4N9P A;  1U4P A;  1HA5 A;  1IKM A;  1WTQ A;  3DEP A;  3SK8 A;  3FPU B;  3Q22 A;  2WAQ B;  5ELF A;  3HRZ C;  1ENF A;  3TDQ A;  3R2I A;  5F2D A;  1MI2 A;  1EWC A;  2F0N A;  4FYD A;  1PXU A;  3JAM L;  4CKC A;  5ISR A;  2NVQ B;  3PMF A;  4AYB B;  4FO2 A;  1DYQ A;  4KY5 A;  1MGS A;  2F0G A;  3NBH A;  2ZXO A;  3FDT A;  1KNA A;  3K59 A;  3GP7 A;  4OGQ C;  2Z8L A;  4BBR B;  2C5C A;  1STB A;  1M4V A;  2M9V A;  3C1F A;  1SMY C;  5I9P A;  4BY1 B;  5KNB A;  2JSO A;  2F0M A;  5KYI A;  1PFN A;  1D5Z C;  4ILW A;  1H9K A;  5A2Q L;  1FD7 D;  3QG1 A;  1IHZ A;  3AMU A;  5LL6 X;  3KBX A;  1TWC B;  1Q1E A;  1SYG A;  1D5X C;  3D6W A;  4U68 A;  4RFB A;  3X3N A;  2HDL A;  2R6G A;  1G29 1;  1KLU D;  3MC0 B;  3D3R A;  1LTA D;  1IL8 A;  2EYF A;  1STG A;  4ODG A;  1SFO B;  4C3J G;  1OXT A;  1B9M A;  4CKB A;  3I4N B;  1PTO H;  3P1H A;  2RDG A;  2F0H A;  2PW7 A;  3P20 A;  1FGB D;  2MGS A;  2NB0 A;  1EY9 A;  3BZD B;  5CBE E;  1S5C D;  1RTO A;  4LMQ D;  2LS0 1;  1YNJ C;  2QCP X;  1JOQ A;  1X3Q A;  5JVG 3;  2I07 B;  4WRD A;  2Y0S B;  3VR5 A;  1JOO A;  3S2D B;  2R7Z B;  2WKC A;  1CHQ D;  1B50 A;  5C6A A;  2L12 A;  1EYD A;  4KN7 C;  1G6Z A;  2WV6 D;  4A3K B;  2F0J A;  2L5T A;  3IKJ A;  1LT4 D;  5J1Z A;  3RLF A;  1ZKO A;  3FPP A;  2F0S A;  1RCV D;  3OWF A;  3HS0 C;  3NTK A;  3GTP B;  2NN6 G;  1PFB A;  2F0D A;  1VF5 C;  2A69 D;  1ILP A;  1TU2 B;  4ZYS A;  1TS2 A;  1B1Z A;  4BY7 B;  4K5V A;  1TS3 A;  2MP1 A;  3HOW B;  3F2U A;  1TS4 A;  1E0B A;  3SEB A;  1UAP A;  1TT2 A;  5G3L F;  2FHT A;  4LAA A;  3NQI A;  5KRU A;  1F2M A;  1O7L A;  5D14 A;  2D9U A;  3OWE B;  2SNS A;  4C3I G;  4C3H B;  5E1F A;  3RD4 A;  5CC4 A;  5HUR A;  4CJ1 B;  3OIP A;  5C0X G;  2K32 A;  3EA6 A;  5JEA J;  4DN4 M;  4IUT A;  3D4W A;  1C4Q A;  4QUF A;  2XIW A;  3MFG A;  4ZUJ A;  1JOR A;  1PRT D;  3G6J B;  4B08 A;  5M5Y B;  1JB3 A;  4H7B A;  3DXJ C;  4FF2 A;  5FO9 B;  2IPK D;  2SOB A;  3IL8 A;  3EQL C;  1GJX A;  2EPB A;  3MTS A;  4R9W A;  3J80 L;  1RF2 D;  1G91 A;  2F0V A;  4UAI A;  2CVR A;  2BE5 D;  1CA5 A;  2D62 A;  1KAA A;  1PTO F;  1SBB B;  1TKW B;  2D2C C;  3CQZ B;  2B2V A;  4DAP A;  2A69 C;  1F2Y A;  2X6L A;  3DUZ A;  4C2M B;  1OXS C;  1GUS A;  2DY7 A;  2WIN B;  5JEA G;  2ZXP A;  2JP1 A;  1U9R A;  2NN6 H;  4FVM A;  4PV1 C;  1DOM A;  3NK9 A;  4DNR B;  2F0P A;  4CBV A;  3GTK B;  1F9S A;  4KD4 A;  3NP8 A;  3DWA A;  1CA6 A;  1PTO B;  4QCL A;  3K5N A;  1KLG D;  4ZRZ A;  4K2K A;  1Q8I A;  5NUC A;  1VF7 A;  2B8G A;  2F0O A;  2NBF A;  4ZK9 B;  3S2H B;  2NWG A;  2Q8R E;  3L3O C;  1E2Z A;  1I6H B;  1NSN S;  2NTS A;  1SE2 A;  3RUZ A;  4CJ2 C;  3K57 A;  4IFD I;  5KYL A;  1HRJ A;  3TSS A;  1HFN A;  2RBM A;  3MZ5 A;  1LTR D;  2WAC A;  3EVQ A;  1QIL A;  2K7V A;  4XQQ A;  4F88 A;  2F0U A;  4FXD A;  5I2X A;  1WVL A;  4QMG A;  3HOY B;  4KJO A;  3U9S A;  1TWH B;  3NSW A;  2JA5 B;  2QKI C;  1EY5 A;  3A54 A;  1HQM C;  2B8F A;  1RDP D;  2R61 A;  4ZKC B;  2PCF B;  4NW2 A;  4LK1 C;  1STN A;  1S5F D;  4HMJ A;  4DFA A;  1U4M A;  1CZG A;  1ESR A;  3PUW A;  4RAU C;  4OO1 I;  4QIW B;  1EOT A;  1OXV A;  4J8Q A;  2BE5 C;  1A3U A;  2L11 A;  1JCK B;  2SEB D;  1WD0 A;  1SSO A;  2K04 A;  1LAB A;  3H0G B;  5CV7 A;  2A74 C;  3H94 A;  3DMU A;  2BDN A;  2Q8T A;  3A55 A;  1D5M C;  1KTK A;  1SXT A;  1LT3 D;  5CV4 A;  4XYQ A;  1F9R A;  5IGB A;  3GQB A;  1CI3 M;  4OL7 A;  2G9D A;  2EXZ A;  1Q90 A;  2O5I C;  1SYD A;  4IFD J;  1SYE A;  5EPK A;  2A68 D;  3EJI A;  2NVT B;  3I4M B;  3D4R A;  2O4X A;  4ZUI A;  3A7A B;  1DOL A;  3T4A C;  4XQJ A;  1EZ8 A;  4QF4 A;  1PMR A;  2AUJ D;  2FIN B;  4C3J B;  1QNK A;  1GHJ A;  1EIG A;  4H13 C;  5KEE A;  4P2C B;  4QUC A;  2EYJ A;  4IUP A;  3BVM A;  3K58 A;  1LV9 A;  5I6W A;  4X3U A;  1JE4 A;  3VR2 A;  1OO9 B;  3Q23 A;  4DXF A;  4A3F B;  3HP3 A;  2B2T C;  3TBI B;  1O7Z A;  2RDH A;  5ELE A;  4A3D B;  5COY A;  1ET6 A;  4MIU A;  3BVZ A;  1W6J A;  4Y7N B;  3K5L A;  3IAY A;  1LT6 D;  4IFD G;  2WP8 J;  2AUK A;  4A3J B;  1BCP C;  4JK1 C;  3OOC A;  2R93 B;  2OF1 A;  2V4D A;  2G9H D;  1SYB A;  1CFM A;  4HCS A;  5M9O A;  1FR3 A;  1T5X D;  1JC7 A;  3Q0A A;  1HCZ A;  5M5X B;  2NTT A;  4DF7 A;  4HAE A;  5EKL A;  4G57 A;  2XSC A;  3V2T A;  5I2Y A;  3I4L A;  3KLS A;  5CYU A;  3S16 B;  1ML0 D;  2Z1C A;  4RH6 A;  2EVB A;  1RKN A;  1NAP A;  2A68 C;  4DXG A;  3A8K E;  4K6L A;  4HN7 A;  2NVX B;  3CHB D;  3VA7 A;  4FP5 D;  2TSS A;  4KD3 A;  1YNJ D;  2FJ2 A;  1B4O A;  1EY8 A;  3GTM B;  2DNC A;  3RZD B;  3OMG A;  4C3I B;  2JEB I;  5C4J B;  4A3M B;  5KIX A;  5I9O A;  5CGK A;  2K33 A;  5FO8 B;  5COR A;  1V1P B;  3NBI A;  4PQX A;  3FMC A;  1DOK A;  3HOV B;  1RHP A;  1D1K A;  2J0T D;  1DXM A;  3T16 A;  1F77 A;  2VXW A;  5AFW A;  2F0L A;  1EEF D;  2NZ1 D;  1K83 B;  1EZ6 A;  4DAY A;  1O78 A;  4ME5 A;  1DZ1 A;  5E4W C;  4KN4 C;  5C3E B;  1B3A A;  5KGU A;  5IT9 E;  4GZY C;  3SDZ A;  3PV0 A;  1GUT A;  1K8M A;  3TZD A;  4PMB A;  2VB3 X;  3VA5 A;  1SYC A;  1HHV A;  2QIL A;  1SNM A;  2A5H A;  1I6V C;  3KLS X;  3MFY A;  3MA2 B;  1RTN A;  1JWU D;  1PRT F;  3NWT A;  5A35 A;  4IFD H;  4K14 A;  1I4Q A;  4TRD A;  3VR4 A;  1Z47 A;  2WKD A;  3DWP A;  5EQ0 A;  2K28 A;  1PDQ A;  1WTX A;  3H3V C;  3K5M A;  3K7A B;  1S4Z A;  1AW7 A;  4HTH A;  4I7Z C;  1LAC A;  4IUR A;  4CKE A;  3FEW X;  4KY6 A;  4NKL A;  3HOU B;  1LTS D;  2F1M A;  1I50 B;  4EQP A;  2QEJ C;  1EU4 A;  4OO1 H;  2EYO A;  2IL8 A;  5ELD A;  1PRT B;  2PZT A;  5IGF A;  4NMZ A;  2JA6 B;  4M8A A;  1CQF A;  3D31 A;  1KDB A;  1EFI D;  3HOZ B;  3KBG A;  3VYS A;  2EY6 A;  4TSS A;  1J8I A;  1ONL A;  4B9W A;  3NPP A;  2QDB A;  4IAL A;  1DON A;  2NUC A;  1V1P A;  3MVV A;  5C4Z A;  3BG3 A;  2JXM B;  2J4X A;  2PNR C;  2E76 C;  1E2W A;  1A2T A;  2B2W C;  5DM7 3;  4G7Z C;  4NP5 A;  2BA0 A;  3AU7 A;  2WII B;  3NWS A;  4RHR A;  3MWY W;  5M3M B;  2Z4H A;  5E4X A;  4K8J A;  1IYV A;  4Q0F A;  3SK5 A;  1BO0 A;  4XQN A;  1NR2 A;  1SNO A;  4L6T B;  4A3E B;  1GUN A;  3GTG B;  2L55 A;  3QB3 A;  1WTV A;  3S15 B;  1PZJ D;  1TY2 A;  1UNS A;  3QO2 A;  3QWN A;  1R4P B;  5EKI A;  3TZU A;  2PYK A;  1L0Y B;  5CMD A;  2XVS A;  2EY5 A;  1RD9 D;  2PZU A;  1EU3 A;  1X3P A;  5DEH A;  5BN5 A;  1ESF A;  1Q1B A;  1FNU A;  1FNW A;  3FKI B;  4J6H A;  4ULL A;  1IKL A;  1BR9 A;  4DK0 A;  1II3 A;  1EY6 A;  2M2L A;  3S1M B;  4MHE A;  2AQ1 B;  1NR4 A;  1I3Q B;  3FVQ A;  1QG7 A;  4H44 C;  2N88 A;  4MN3 A;  3M7N A;  2F0T A;  1AEX A;  1F9P A;  4KY7 A;  2XWJ B;  3FRP B;  4G4K A;  4QB4 A;  3PUV A;  3W3A A;  5FO7 B;  4ZQ3 A;  3PIO 3;  4BWG B;  3I91 A;  1U4L A;  3VYR A;  1JR0 D;  2A6H C;  3KF8 A;  2JA7 B;  1H9S B;  2ICE C;  1GXD C;  2Z4I A;  3N6R A;  3C2P A;  1IYU A;  4H0L C;  2EJM A;  3E6Z X;  1WD1 A;  1ENC A;  3T56 B;  5I4D A;  1JWS D;  1XX8 A;  1STY A;  1Y8N B;  1FNV A;  5JPM C;  1G2T A;  1ZYR D;  4XTC S;  2C9O A;  2JEA I;  5CV9 A;  2PO4 A;  1EQV A;  2EYM A;  3DM1 A;  2N55 A;  2B2U C;  2R92 B;  5M3F B;  2WB1 B;  2YU9 B;  1CM9 A;  5LL6 S;  4F8M A;  3I3C A;  5EPJ A;  3UI2 A;  2J7Z A;  5EJW A;  4XDX A;  1AN8 A;  5K36 H;  1BUV T;  2LY7 A;  1SYF A;  3S14 B;  5J39 A;  4TKO B;  2H4O A;  2JE6 I;  1H9J A;  2PQE A;  3SE0 A;  2BDO A;  2DY8 A;  1QNU A;  3WDN A;  3M3Y B;  1TY0 A;  1WCM B;  2K05 A;  5IT9 L;  4M1U B;  1GHK A;  1Z6H A;  1I4P A;  2MPM A;  2K01 A;  4CGY B;  4IUQ A;  2AQ3 B;  2EYH A;  2B2V C;  1D1I A;  3Q6S A;  4IUN A;  2E2D C;  3NTH A;  4DAV A;  1PZK D;  2FFK B;  1HUN A;  2XN9 C;  1BBX C;  4E6I A;  3QIA A;  1BCP D;  3WOE A;  2NYZ D;  2B2T A;  3T13 A;  5DNF A;  2E2I B;  1SEB D;  4FF1 A;  3DWQ A;  3NTI A;  4BA2 I;  4DA2 A;  4OHJ A;  2PZW A;  3A8J E;  3GTL B;  4R8I A;  4HCE A;  2K5D A;  5T1I A;  3OHX C;  4KI0 A;  1D6E C;  1LTB D;  1DM0 B;  3D8G A;  4OIK A;  3MXP A;  1ZYR C;  3H91 A;  3VYU A;  1H9S A;  1PFM A;  1VDZ A;  2I46 A;  1GUW A;  1SNQ A;  2K6A A;  4KKU A;  1M8A A;  3TME A;  2RVL A;  1ZXT A;  4RGO S;  2LFN A;  4RCO A;  3OW7 A;  5DM6 3;  1HQR D;  2FMC A;  3ERQ A;  2E2J B;  1EL0 A;  3HEJ A;  5ELC A;  1BDO A;  1I4X A;  1OXX K;  3SXH A;  4K6D A;  2HUG A;  3R3O A;  3N52 A;  1QE6 A;  4CJ0 B;  4XT1 B;  2MUY A;  1B2T A;  1EYC A;  1TQO A;  3BYT B;  2VUM B;  4G7O C;  1O7Y A;  2L1B A;  1QWY A;  5C44 B;  1XWE A;  2YYZ A;  3S9W A;  2KED A;  2L4N A;  3GO5 A;  4KV6 A;  1ZEQ X;  1SNP A;  3S1N B;  4KTA A;  1VMC A;  1BQQ T;  4EQO A;  3BS1 A;  4EVO A;  4BS9 A;  5TSS A;  3W2D A;  2CHB D;  3QOL A;  1YNN D;  1BXT A;  2ZT9 C;  4XT3 B;  3V05 A;  1PZI D;  3H09 A;  5D65 A;  4IZ8 A;  1EQT A;  2IWH A;  1RJT A;  1A3T A;  1T5E A;  3OIQ A;  3BDC A;  4K2L A;  4ZAI A;  1B9N A;  1IW7 C;  5JOB A;  2SNM A;  4FF3 A;  3O13 A;  5FOB B;  1O80 A;  1MBY A;  2GA4 B;  4KHV A;  1ET9 A;  4PMC A;  2LMC B;  3DHQ A;  4HSP A;  3DEO A;  1BNZ A;  3CKI B;  1CTM A;  1KDC A;  4OO1 G;  1Y1V B;  2VNU D;  3MXG A;  3TP7 A;  1ENA A;  4L63 B;  1R4Q B;  2RA4 A;  3IFT A;  4IUU A;  4RCN A;  4DGZ A;  4RKB A;  2F0E A;  1Z7T A;  2PPB C;  3HOX B;  2X69 A;  3LWE A;  2M00 A;  4BBS B;  4HMI A;  2KUM A;  5T1G A;  1HTP A;  4EQN A;  4A3G B;  5K5P A;  1LTG D;  3IFD A;  1SAP A;  3I90 A;  3ND9 A;  1DJR D;  4PNY A;  1Q3L A;  2BA1 A;  4DNT B;  5FLX E;  2IX1 A;  3C46 A;  5BN3 A;  3TP8 A;  3Q24 A;  1W6K A;  3ITP A;  2XWB B;  3OPO A;  2OT2 A;  3AB9 A;  5IGC A;  3S1Q B;  2XRS D;  1A3V A;  1YNN C;  4IQZ A;  3LX0 A;  5CBA E;  5D3I B;  3T51 B;  4Z9C B;  3EFX D;  3PO3 B;  1WTP A;  1HA6 A;  3S1R B;  4PMW A;  3SK6 A;  3T53 B;  2TMP A;  5C4H A;  5IIF A;  2BOS A;  3TP6 A;  1H9R A;  4Q5V A;  3QOJ A;  4JBW A;  3SK4 A;  2DNE A;  1FYC A;  4V19 0;  1NUC A;  3G7L A;  4KKT A;  5C0X I;  3C3L A;  3R93 A;  4C1N K;  1ILQ A;  1GUO A;  4XXE A;  2A73 B;  2EDG A;  2K1B A;  2B2Y C;  3PUZ A;  4X3T A;  3M4O B;  2VB2 X;  1TVX A;  1DD2 A;  3URY A;  1DCZ A;  2B2W A;  2D5D A;  4F87 A;  1TWA B;  2HDM A;  2F0K A;  5FK9 C;  4RGT A;  5J22 A;  2FMM A;  2O2L D;  1LO5 D;  3J81 E;  2RSO A;  1XYI A;  4HSV A;  3BDO A;  4X3S A;  5IGD A;  4RHS A;  5C5M A;  2KA7 A;  3GV3 A;  3GTO B;  3WOF A;  2E74 C;  3GTJ B;  1KAB A;  2CQA A;  2KJX A;  4HR7 B;  3SHL A;  4B9X A;  4V0B A;  1QJO A;  1STH A;  1JQY D;  1ICW A;  3P75 A;  4DU9 A;  1GOZ A;  5DAU A;  4OIJ A;  2RQX A;  3LWU A;  1BF4 A;  4R8N A;  2AQ2 B;  3GV6 A;  2K03 A;  1E2V A;  1PLF A;  4C1N I;  3HG9 A;  3MXU A;  4WOR A;  3CRL C;  5EBD A;  3HZX A;  2PMZ B;  2HCI A;  4WJW A;  4FF4 A;  5HGT A;  2KVM A;  4RGM A;  2IX0 A;  2F0W A;  1MD2 D;  4TQU S;  5LHY 1;  4U67 3;  2XNA C;  2Q8I B;  5C0X J;  2A6H D;  2AWN A;  2MJ8 A;  5EBC A;  5CR3 A;  1EYA A;  4IUV A;  5BN4 A;  4XIG S;  1B53 A;  1A6X A;  2KCN A;  1Y8P B;  4FXG C;  3A56 A;  5M5W B;  2XRQ D;  5K36 G;  3BYY B;  3K6O A;  2HQE A;  5KND A;  4ID6 A;  3MHB A;  4HED A;  3GD7 A;  3CU7 A;  1Q12 A;  3NE5 B;  4KHZ A;  3I73 A;  5JVH 3;  3A8I E;  2QF7 A;  1AZP A;  3I72 A;  1MSG A;  1C8C A;  1XTC D;  1HTL D;  1AFP A;  1I4R A;  1SJE D;  2RDF A;  1LTI D;  1GUG A;  1STE A;  3MAQ A;  1HFG A;  2B2U A;  2ENB A;  2NVY B;  5IOD A;  2DN8 A;  1EY4 A;  3QJY A;  3M7G A;  1BCP F;  4RGN A;  2EJG C;  3P7J A;  2JA8 B;  2MHV A;  5JPN C;  1F9Q A;  2ID0 A;  2KQ3 A;  3PIP 3;  1U4R A;  3TN2 A;  3BDL A;  3VR6 A;  2CW0 D;  4G7H C;  2X6G A;  1UUP A;  4A3B B;  5EGT A;  2B39 A;  1JWM D;  2IT1 A;  4ABN A;  5JAV A;  4A93 B;  3KLR A;  1J9O A;  2PW5 A;  2F0I A;  1SE4 A;  3X3M A;  1CK1 A;  2IJ0 A;  3SVM A;  1TII D;  3U9O A;  2H1E A;  3JAM E;  2KOL A;  1BCP B;  1TWF B;  2F0Q A;  4NDX A;  4X3K A;  1ROD A;  5ELB A;  1CHP D;  3M4Y A;  1C48 A;  2B63 B;  4FXK C;  1STA A;  4UDU C;  5C4X B;  1VCI A;  4K8I A;  2EY2 A;  2K5W A;  5C3X A;  1AZQ A;  2KEC A;  1SDF A;  3OSO A;  1X32 A;  1EEI D;  3PUX A;  1S5E D;  2KHS A;  2BCO A;  5CV5 A;  1EY7 A;  1H9M A;  1Y1W B;  5C5L A;  2A6E D;  1S5D D;  2LKV A;  4BA1 I;  5A2Q E;  4N9T A;  4KKS A;  4L8J A;  3HKZ B;  1LLR D;  1G8Z D;  1WTR A;  2IX3 A;  3R8B A;  4RWS C;  1HXY D;  5FLX L;  1TS5 A;  3J7A F;  3E5S A;  1F2Z A;  3J7A V;  5EPL A;  1LT5 D;  1SNC A;  1BOS A;  5G3L D;  2L9H A;  1CQV A;  2R3Z A;  2F3V A;  3CRK C;  5JJZ A;  3NQT A;  1EIH A;  2CW0 C;  1PRT C;  1I4H A;  2ZXR A;  5CV8 A;  2EY1 A;  5C0X H;  3VR3 A;  2HCC A;  2EOT A;  2EYL A;  3ONA B;  1IW7 D;  1V43 A;  5EKK A;  2ICI A;  2F3W A;  5CV6 A;  3ERO A;  3PO2 B;  4XYO A;  3I70 A;  3J7Y W;  1PYW D;  4RKL A;  3NHH A;  4ZLT F;  2L0C A;  3HGB A;  3RZO B;  2O5J C;  3L9A X;  3LNN A;  3ZYY X;  3VYT A;  3J81 L;  5IOC A;  4ZKB B;  3D6C A;  4A3I B;  2F0F A;  3E0J A;  4KK7 A;  5KNC A;  3MXN A;  1D2B A;  1SE3 A;  4C3H G;  1HPC A;  3L7Z C;  1CT1 D;  5D3D A;  1KDA A;  4WFN 3;  1Y69 U;  3ND8 A;  5IGG A;  1L0X B;  4FNF A;  3MEH A;  1MSH A;  2A6E C;  3OMC A;  2JYO A;  1PTO D;  3V96 A;  4EGV A;  2KCC A;  2EJF C;  1I4G A;  5JEA H;  3GTQ B;  1F2L A;  2EZV A;  4KJN A;  2IW3 A;  1V1O A;  1XXG A;  1AP0 A;  5I6Y A;  1UEA B;  1Y8O B;  3NUC A;  4DK1 A;  1A15 A;  2E75 C;  4K5X A;  1V8Q A;  1EWH A;  3C1E A;  1WTO A;  4J1M A;  2F03 A;  3K0Y A;  3KK7 A;  4LJZ C;  2OEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...