3P75A

Crystal structure of staphylococcal nuclease variant delta+phs v104d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALDRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3p75A00
3D4DA 4RKLA 3MEHA 5C3WA 4WRDA 5C5MA 3BDCA 2O4XA 4IUNA 5F2DA 5CV6A 3TP6A 3VA5A 1KDBA 4KD3A 2F0UA 3TMEA 1KABA 5CV4A 3SXHA 4DU9A 2F0DA 1ENAA 3MZ5A 1KDCA 2F0MA 4F7XA 1KDAA 1STBA 2F0OA 4YIJA 3NQTA 5IGDA 3LX0A 5KRUA 2RDFA 4G57A 4PMBA 5IODA 3HEJA 1ENCA 2F0TA 3R3OA 2F0VA 2OEOA 5C3XA 5KGUA 1F2YA 2PZTA 1KAAA 4DF7A 1NUCA 1NSNS 2F3VA 4K2KA 1EY4A 1TT2A 3SK8A 3NXWA 1A3UA 1EY9A 4J6HA 5C4ZA 5CV9A 1SYDA 2F0GA 4WORA 5K5PA 2OF1A 4K5VA 5C6AA 2F0IA 2PQEA 2EYPA 2PZUA 3OMCA 2F0FA 1SNQA 2NUCA 5KYLA 5E3FA 5J39A 1JORA 2EYMA 2M00A 3EJIA 2EYHA 4NDXA 1SNDA 3ERQA 5IOCA 3U9OA 1SYCA 2EY1A 4K8JA 3MHBA 4F8MA 3SR1A 4S3SA 3P75A 3S9WA 2PZWA 4ZQ3A 1EYCA 2KQ3A 1EY8A 4HTHA 3TP5A 5IGFA 5JAVA 3BDLA 5KYIA 2F3WA 4KJOA 5EGTA 1EY7A 4IZ8A 4K8IA 1U9RA 1JOKA 5I6YA 4NP5A 4K2LA 4EQOA 2SNSA 4MIUA 5CV5A 4EQNA 3EROA 5DEHA 3SK6A 1EZ8A 5IGGA 2F0KA 3E5SA 3H6MA 4QB4A 3PMFA 4ZUIA 5IGEA 1SNPA 2QDBA 3OSOA 3MVVA 4HMJA 5KIXA 3EVQA 3QOJA 1SYBA 1II3A 5DAUA 3DHQA 4ODGA 4R8NA 5EKLA 4N9PA 4EVOA 1A2UA 1EYAA 1STYA 1EQVA 1EY6A 2EY5A 4KTAA 2F0QA 4I65A 4NMZA 5E1FA 4K14A 3OMGA 5CGKA 2F0LA 3SK5A 4KY5A 5HGTA 2F0HA 3TP7A 3NP8A 4K5XA 1STNA 4KY7A 4PMCA 4N9TA 4PNYA 5HURA 3ITPA 3NK9A 3P1HA 4KD4A 2EYOA 1EY0A 2SOBA 4DFAA 3DMUA 1JOQA 3D6CA 2F0SA 1SNCA 1F2ZA 4KHVA 4ME5A 5NUCA 2EYLA 5M9OA 4K6DA 3SK4A 4TRDA 5EKKA 2EY6A 2HQEA 2LKVA 1STHA 5IGBA 5KEEA 4HMIA 1EY5A 4KV6A 1SYGA 3RUZA 1EYDA 4RKBA 3MXPA 3OWFA 5J1ZA 2RBMA 4LAAA 5J22A 3HZXA 2EY2A 3D4WA 4B9XA 2EYFA 1SYFA 4EQPA 3T16A 5I6WA 1A3VA 4KY6A 2RKSA 3V2TA 2PYKA 3TP8A 1JOOA 4NKLA 3QB3A 4KJNA 2F0JA 5IGCA 3NUCA 4ID6A 5I9PA 2EYJA 5CR3A 1A2TA 3SHLA 1STAA 5I9OA 5ISRA 3T13A 4J1MA 5C5LA 5IIFA 4E6IA 2F0NA 2PW5A 2PW7A 4B9WA 5C4HA 2F0WA 5CC4A 4QMGA 2ENBA 5CV8A 1TR5A 1IHZA 4ZUJA 4IALA 4K5WA 1SYEA 2OXPA 2SNMA 1A3TA 1RKNA 2F0EA 1SNMA 1TQOA 1SNOA 2KHSA 4H7BA 4QF4A 2WACA 1F2MA 3D8GA 1EZ6A 5JOBA 1AEXA 3C1EA 3QOLA 3C1FA 4OL7A 2EXZA 2F0PA 3NHHA 5CV7A 1STGA 4DGZA
chains in the Genus database with same CATH superfamily
2FJ2A 2L9HA 1KLUD 2R7DA 3HOWG 1EU4A 4C3IG 4GOPC 1Q7YC 5TSSA 3SGIA 4P72A 4YCWA 1EL0A 1KABA 2JA5B 2Q2HA 2J4XA 3KUPA 3C3LA 1NBWA 3HEJA 3CXCA 4YHHL 3A55A 1CSPA 4P71A 4QGUA 1OTCA 3K0YA 5C4ZA 3D4RA 1K8MA 1O7ZA 2F0FA 2NVTB 1XXGA 3HOZH 1H9SA 2HDMA 2G5DA 2M00A 3P7JA 1I50B 1KAWA 4OHJA 3OIQA 2EY1A 1CTMA 1RDPD 3SVMA 4GKJL 4C1NK 2KQ3A 2F4VQ 2BCOA 2KCMA 1G2SA 1TS4A 2A5HA 4DUYL 1QJOA 4B3MQ 3NBHA 1QB5D 4POGA 3S1MH 2EZVA 5IGGA 3H6MA 4ZUIA 3PMFA 3S2DH 3SEBA 4BY1H 4LF4L 3J80L 3U58A 2QCPX 2EY5A 1EQVA 1OXXK 2QDLA 4KTAA 1DZ1A 4K14A 5M3FG 1VS0A 4G7OC 1EWCA 5G3LF 4JC0A 2Z6BA 3BVMA 1AZPA 1HNXQ 3P1HA 1I5FA 4IPHA 4LNQA 2MPMA 2B2WC 4A3GB 2RHQB 1I3QB 2DY7A 1K83H 1MJEA 3PQIA 1X3GA 4DR4L 1X3EA 2EYFA 2E2DC 1T5XD 1JR0D 2G9HD 1B70B 2IWHA 2F0JA 3GTJH 5I9PA 1A2TA 1FGUA 1STAA 2I5HA 1OXVA 2CWPA 3CF5A 4HIDA 4LF6L 4X62L 4GZYC 5C4HA 1QVFA 1HJPA 5CV8A 1VQFA 3DWAA 5IYDG 4JI7L 3E0JA 3K5OA 1RKNA 2F0EA 3CCVA 5C0XG 1CA5A 1JJGA 3QOLA 4JI2Q 1SSOA 1YNXA 2EXZA 5HY6A 2IX0A 5CV7A 2EJMA 2JQOA 2V4DA 3CKIB 3HRZC 2JA8H 2B29A 1I4PA 2XGTA 3VA5A 1E1TA 1WCMB 4DV3Q 1EIYB 2NN6H 4A3BG 1HNWL 2JXMB 1IZ6A 4OELB 4F7XA 1Y8NB 2A6HC 1AN8A 4TKOB 1RTOA 2R93B 1WOCA 5FLMH 1BNZA 4PZ7A 2UU9L 2DJFC 3UE1A 1A3UA 4IJLA 2L55A 2B2VA 1V8QA 1O78A 3IAYA 1LTLA 2PMZE 4X3SA 5ELCA 4AH6A 3HOYB 1PA6A 4P73A 5DNFA 2E2HB 4HTHA 3EQLC 3O13A 2UUCL 3NE5B 4QUCA 3HOZG 4GKKL 3T51B 4OO1I 1LV9A 2JA7B 1AE3A 3H3VH 3SK6A 5E4XA 5AFWA 5C0XJ 2DJGC 1QOHA 4HMJA 3CMAA 5DAUA 1Q82C 4OWTB 1A2UA 3MEFA 1ZKOA 3I91A 1IYUA 1IBMQ 4I65A 1BCPC 5E1FA 1B2TA 2R3ZA 3NP8A 1TWAB 1SN8A 4LK1C 4X65Q 4Y52H 3ITPA 2JA5H 2VB3X 1DJRD 1B44D 4BY1G 2NVYB 1JOQA 2BH2A 2R92H 2Z0SA 2IX1A 5NUCA 4A3LG 4RMFA 2K28A 4CJ0B 2VQFQ 2LKVA 4HMIA 4RG1A 4DV0Q 4DR3Q 1K73C 2NTSA 4LAAA 2A68C 5IP9G 4A3FH 2UUBQ 3HS0C 1RCVD 3R93A 2B2YA 2VUMB 3NEMA 3WOFA 2DY8A 1ML0D 3I56A 1GUWA 2CHBD 4E6IA 3CCSA 1Y14B 2JYOA 1JICA 3T53B 1CA6A 5CORA 3K5MA 1EZ6A 2E2JB 1B7YB 2M2LA 4PZ6A 4ALPA 4DGZA 4XXEA 3NWSA 1X32A 1KTKA 3HKZB 5C0XI 1HPCA 4YIJA 1KL9A 4L5QA 1GJXA 2F0VA 1X54A 5GQOA 1NE3A 5C3XA 1LYLA 4DF7A 5KGUA 5IWAL 5GAHC 3RZDB 4N8X1 1PHJA 2NN6G 4R4TA 2B63B 2LY7A 1EWIA 3RMHA 3MWYW 4YHHQ 1VQKA 2WB1B 2F1MA 4XQNA 4MHEA 3UI2A 1I4XA 2PO4A 2WAQB 4QL5A 1BO0A 5C4XB 2KENA 3A74A 4DV1Q 1EIFA 1VQNA 3STBD 1LUZA 2CWAA 4L63B 5BR8L 3BDLA 1EIHA 4IFDI 2XN9C 2B2VC 3QIAA 5IYCH 5BN3A 1PH6A 3TN2A 5EKLA 4EVOA 4A3KH 3BZDB 1HCZA 1RTNA 3BYTB 4A3EH 2DGYA 3TBIB 4PZ8A 4UDUC 2B3GA 2I5MX 1X6OA 4JI1Q 4R4OA 5L37A 3PUZA 1M1KC 1ICFB 3J81c 2MO0A 1VQ7A 4DV5L 2NYZD 4A3DH 2K05A 3RR5A 3A8KE 3PUWA 1WVLA 4IUUA 5K36H 2YTXA 1EYGA 1FJGL 4FNFA 1H95A 1IBKL 4FXGC 3CC7A 3HZXA 2JA5G 4B9XA 3OWEB 3T16A 3TREA 1SXTA 1PZKD 4Q5VA 2R92G 4IN3A 1QVCA 2H4OA 4KJNA 1SAPA 1AE2A 3QR8A 1PZID 2LXJA 2K50A 4LF9L 5C5LA 4A3CH 1N33L 1I6VC 3GTLB 3ND9A 4ZKCB 2WACA 3CAMA 1U0LA 4OL7A 1BF4A 1MHWC 2B2YC 1Y8PB 4IUNA 5CV6A 4CDFC 3J81i 2IHFA 5CV4A 3SDZA 2ALYB 1GO3E 1DXMA 3S2HB 3TSSA 3S14B 1CQFA 1JT8A 4FP5D 1LO5D 1ENCA 2ES2A 2E75C 4FO2A 2CQAA 2NVYH 1SEBD 2OEOA 4A93H 1TT2A 3GP7A 1RIPA 4ZAIA 2OF1A 2F0IA 2I0QA 5LMNW 1C9OA 1PH7A 4HJ5A 3C46A 2EYHA 2UU9Q 4GN3B 4NDXA 4DNTB 1SNDA 3CCLA 3N52A 5IOCA 1V1QA 3U9OA 3M7NA 1LACA 5C44H 1VCIA 4DV7Q 1H9MA 2A69D 5BN5A 5JAVA 1S4ZA 2MO1A 1I6HB 4AQYQ 4YWKA 1X3FA 3GTPH 3E9IA 3RD4A 2EXDA 4KK7A 3PO2H 2RSNA 2O5IC 1STYA 1EY6A 5EPJA 4NMZA 2AUJD 1TXYA 1RODA 3TP7A 2JE6I 4PMCA 2LFNA 4PNYA 4XT1B 5IYCG 3JAME 1FVIA 1HA5A 2ZM6Q 1PH4A 1SNCA 2AQ1B 1F2ZA 2EJFC 2WKDA 1WJJA 4A3KG 4KHPL 2BOSA 1QG7A 2CH4A 4A4IA 4MN3A 4K0KQ 4A3EG 2XRQD 5J3BA 4JI0Q 2UXDQ 4IUTA 1DYQA 3DXJC 1W6JA 5DM63 5J22A 2B63H 1HNXL 1U5KA 2ATWA 1SYFA 5JJZA 1JWMD 3HP3A 1NCVA 2R93G 4FDBA 2NZ1D 4A3DG 1HHVA 1L0XB 2EQSA 4LFCQ 5C4XH 4ID6A 3AEVA 5K36G 4I7ZC 3MXNA 2XWJB 2KA7A 4RFBA 4CHTB 5GADC 5CC4A 3FP9A 3QG1A 5JJLA 3KF8A 4UP8A 3ZJYC 1SYEA 2OXPA 1A3TA 2HCCA 2K5NA 2K03A 4NB3A 1C7YA 5CBEE 2NWGA 1SMYD 2F0PA 3J7AF 3HOZB 3HOYG 3GV6A 4WRDA 4A3CG 3PV0A 5LMNQ 2Z4IA 3CCQA 4KD3A 1Z47A 4WJWA 1PYSB 4JOIA 1Z9FA 3K57A 1TS5A 3M4PA 1WTOA 2UUAQ 5IYBH 1RJTA 1XPUA 1YNND 1N9WA 3S1MB 1WTHA 1NY4A 1X55A 2K7VA 3S2DB 4BY1B 1B9NA 2EYPA 4F87A 2KBNA 3CP0A 4G7HC 4C2MH 1B3AA 1UE5A 2RF4A 2H1EA 2RVLA 1EUJA 2MUYA 4JBJA 3T1YL 4JG2A 1CM9A 4X64L 4IZ8A 2IT1A 3CW2C 3G4SA 4FXKC 1K83B 4LFBL 2QA4A 5C44G 2YTYA 3DWPA 5CYUA 1S5DD 2I46A 5BR8Q 1QWYA 4R8NA 2JP1A 4X66L 1IYJB 4CKEA 2OCEA 1JMCA 1PXUA 3TZDA 1O7YA 3CC2A 4RGTA 2F0HA 3NQIA 4RHRA 4IUVA 1J6QA 2GN5A 3PO2G 1PTOF 2PQAB 1MSHA 1YHBA 1V1OA 4K6DA 3K6OA 3TZUA 1R4PB 1JJCB 1MJCA 2HQEA 2JK8A 1STHA 2NB0A 1EY5A 1IBLL 4GNXB 5LL6X 3HKZG 3VYRA 2LS01 3D31A 4X65L 3FEWX 1PH2A 4DV5Q 2JA8B 1RF2D 4NW2A 1YITA 4UP7A 3QB3A 4KN4C 4ME3A 1GHKA 3I3CA 2VQFL 1IBKQ 4DV0L 4XDXA 1SR3A 2C9OA 2RCFA 4AYBB 5C3EH 2B63G 1PV4A 1D5MC 1Y1VB 2E74C 2UUBL 2SNMA 1S5CD 5ELFA 2UXCQ 2MP1A 2ZTCA 4A3MB 2A6EC 2K75A 5JOBA 5C4XG 1AEXA 5JVH3 1Q90A 4LF9Q 3PF4A 3PGZA 2KHJA 2BA1A 3CU7A 1N33Q 4R1JA 3PUXA 4XQJA 1FNVA 3CRLC 2KUMA 3W2DA 2PNRC 4TVAB 3OHXC 2TMPA 3R2IA 2WINB 2F0DA 5FLXL 2I07B 3V96A 1PH8A 1SFOH 1FYCA 4H02A 1SE8A 4K2KA 1EY4A 1Q1EA 1WYDA 3NXWA 3R8BA 1EQRA 2R6GA 3L0OA 2PZUA 1SDFA 5KYLA 2HUGA 2Q8RE 2R7FA 5IYBG 1HFGA 4F88A 1V1PB 3VR3A 1Q12A 4X3KA 4JOIC 2ZTEA 4K8JA 1YHQA 3SR1A 3P75A 3OTOQ 3WOEA 1IYVA 4BWGB 4ZQ3A 1EY8A 3TP5A 1PRTD 1LTBD 1A15A 2R92B 2VQEQ 4KN7C 4K2LA 1ICWA 4LMQD 3PIPA 1PH5A 2F0KA 2EOTA 2K5VA 2XNAC 4DV1L 4DK6C 4AIMA 1EU3A 4LF7L 3WDNA 1NTGA 4A3FB 2OWOA 3AFPA 1HNZL 1OO9B 2C35B 2RDHA 1XMOL 4KY5A 1FGBD 3QO2A 4EGVA 2R61A 2BE5C 1MD2D 2D5DA 3J7YW 1NAPA 4L5SA 5M9OA 1HTLD 5EKKA 1XYIA 1VQPA 2N78A 4C3JH 1HUMA 1QNUA 2QF7A 2L11A 1O7LA 4DAPA 4JI1L 2CCZA 1LABA 4LWCA 3HOXH 4KHPQ 2PYKA 4HAEA 3I90A 1TWGH 5CR3A 2Q8TA 1DCZA 3DEPA 1ENFA 4Z9CB 5ISRA 4DUZQ 1BR9A 2HT1A 1SMXA 3EBEA 3DEOA 1VQLA 1TR5A 4GLXA 4ZKBB 1TY2A 5EAYA 2Q8IB 1HZ9A 1CT1D 1SNOA 4QF4A 4R4CA 1EWHA 1F9RA 4EQ5A 1CKNB 2GA4B 3NHHA 5LL6S 3RN5A 2ZJPA 2NVQH 1QUQA 5FJ8G 3TS0A 1OXUA 2Y0SG 3SXHA 4DU9A 1UE7A 1KDAA 1PVOA 1XPRA 4XT3B 2AQ2B 3BVGA 4NXNL 2YU9H 2GVBA 4GNXA 2MJ8A 1N32L 1FNUA 1Q8IA 3DM1A 1K3RA 1WTQA 1D6EC 2F0GA 4A75A 1XNRQ 1HA6A 3I4NH 2XWBB 2PCFB 4A3KB 4A3EB 3ERQA 1SE4A 1LT5D 1STEA 3MHBA 2F3IA 2QEJC 4JYAQ 3L3OC 4K8IA 1YZ6A 4JV5Q 1HR0W 1H9KA 4A3DB 3V05A 1JOKA 5I6YA 3AYHB 1Y1VH 2N55A 2G9DA 5GAEC 3E5SA 2QEXA 4A3MH 4R4QA 3T1YQ 2K52A 4H0LC 4X64Q 4DV7L 2PMZB 3VR6A 3JAMc 2IX3A 4AQYL 1D1KA 4LFBQ 1VQAA 2A1AA 3R2TA 1PYBA 1GM5A 3LWEA 5M5WH 1PTOC 1VDZA 3DMUA 3JC66 4GLAC 4X66Q 4G7ZC 2IHEA 1O7IA 4BBSH 4IJHA 2EIFA 3I4OA 4YWLA 5KEEA 3UE0A 1MSGA 1V1PA 5J1ZA 2RBMA 5GROA 2BE5D 3KFUA 2ZM6L 4IPCA 4JCVE 3A56A 2O2LD 3KK7A 1IBLQ 2AMCB 2D2CC 1YHAA 4K0KL 4C3JG 4JI0L 2UXDL 4OGQC 1W3SA 4OONA 5IIFA 5KNBA 2I5LX 2PW5A 1W2BA 3ICEA 2CW0C 4QMGA 3D0FA 1SLJA 3D3RA 3A8JE 3HOXG 4A93B 3OIPA 4U673 1FL0A 1G51A 2UXBL 3JAMi 3PUVA 1EQQA 4LFCL 1CI3M 1TY0A 1U4LA 1EOVA 3IRBA 4HJ9A 1H9RA 5C4JH 3FHWA 3GTOH 4HSVA 2X69A 2R7ZH 1VMPA 5C44B 3A5ZB 1PRTB 1XX8A 1YI2A 4KKTA 3K8AA 2VS1A 4G57A 2AUKA 5ELBA 1S5FD 1HQMC 4ZYSA 1NMGA 4HCSA 5LMNL 1KNEA 3GTPB 2PI2A 3SK8A 3PO2B 2PQEA 1RHPA 1WI5A 2SDFA 2UUAL 4HSPA 4DR1Q 4OWWB 3J81j 1S5ED 2D0OA 1QZGA 4S3SA 4XQQA 2VNUD 3S9WA 5A2QL 4GNXC 4CBVA 2Q2UA 4A76A 1B50A 4QIWE 2ZXRA 2JA6H 1CSQA 1BBWA 3E0EA 1Q3LA 1CKNA 3E6ZX 4L8JA 4EQOA 2JA8G 2KVMA 1EZ8A 3K0XA 1E2WA 2TSSA 1JB7A 3LGJA 1EEID 3MVVA 4DR6L 5IY0A 2B2TA 2NVXH 2A6HD 4A3IH 2AHOB 2XVSA 1UNSA 4MNOA 3J80E 3BJUA 4J15A 3G71A 1K8AC 4A3JH 4AYBG 5FLMG 1Y1VG 3GTKH 4RA8A 4KY7A 4CJ2C 4LF7Q 3PO3H 4A3MG 1N34Q 3K81C 1E22A 1HNZQ 4Y7NH 4YCUA 1XWEA 1XMOQ 4GS3A 1I4HA 2EJGC 4UY8C 1SYGA 4YWMA 1K0SA 2Z6KA 3AQQA 3NENA 4BY7H 1PTOD 4EQPA 2WB1E 3J7AV 4ZCKA 2WAQE 3H3VC 3H94A 4DPGA 4LJZC 3U50C 2BDNA 3ULLA 3PIP3 1PFMA 4IPGA 1M8AA 5BN4A 3OW7A 5EKIA 3ND8A 1H9JA 1LTGD 1PYWD 4PMWA 4IALA 1JCKB 2J0TD 1LT6D 2KHIA 3VYSA 1VQ4A 1BCPD 1S5BD 2MNAA 3OPOA 2K6AA 3TQYA 1X56A 3KF6B 3A5UA 4M1UB 2O4XA 4C2MB 3TP6A 2RDGA 5JJKA 3F2CA 1CHQD 2UXCL 4GOPB 4PMBA 1JE4A 5M5YH 1Q86C 2A68D 4LUVA 3S16H 1WTWA 1VQ8A 4A3FG 1IW7C 1SBBB 1RL2A 2QKIC 3F2UA 2AQ3B 1UAPA 4DNRB 4NXNQ 1D1IA 4HJAA 1LTID 1GUGA 1N32Q 1SROA 1KIXA 5IP7H 1HZAA 1YJWA 3IKJA 4HIKA 1PDQA 1HQRD 4LUOA 3ONAB 4M8AA 2F3WA 4QJFA 3VR2A 3K7AH 1GVPA 3TEHB 5CV5A 2YTVA 4MIUA 3T4AC 4EQNA 4HIOA 3NELA 3HOUH 2N49A 4GLVB 4ZRZA 1MGSA 3OTOL 4N8FA 3BU2A 5COYA 4CJ1B 2JA6G 2VQEL 1X3QA 1YNJC 2F0LA 2NTTA 2HIXA 2VL6A 2NN6I 5T1GA 5LMUQ 1S72A 2LSSA 1W6KA 2SOBA 1EIGA 2EPBA 5C3EB 2K5DA 4A3IG 5FO9B 1F9PA 2FXQA 2Y0SB 3J81L 2EY6A 2AWNA 1WTXA 2AWOA 2IY5B 2B2TC 4A3JG 3RUZA 3LWUA 4C3HH 1B8AA 3PO3G 1VQMA 2HHHL 2KOLA 1FR3A 1HZBA 4KY6A 4DKAC 1AFPA 2K33A 4R4IA 2WV6D 2E76C 2MHVA 4BBRB 5IGCA 3CHBD 3UDIA 4UP9A 2HIVA 3T56B 2FMMA 1SFOB 4BY7G 3G48A 1U4PA 1WD1A 1K0RA 3N6RA 1ASZA 2D62A 3VR5A 3Q22A 2Z6KC 3P20A 3PSIA 5G3LD 3H3VI 1M90C 1KRTA 2B8FA 3S1QH 1JC7A 3H15A 3FKIH 3NTHA 4DK3C 1X65A 3GTMH 1E0BA 3G6EA 3D4DA 4RKLA 4DUZL 1X9NA 3MEHA 2Q2TA 2VY3A 1V9PA 4PQXA 3M4QA 2UXBQ 1PH9A 1JQYD 1ENAA 1F9SA 3NQTA 2O5JC 4FF4A 2DN8A 2KECA 4DAVA 4WJ3M 3BDOA 2C5CA 1G6ZA 2NZHA 3I70A 1EOTA 2PZTA 1YJ9A 1R9TH 2DUDA 1MKHA 4V0BA 1HH2P 1G91A 2FINB 2Q2IA 3F8TA 4J6HA 5HGQA 1A0IA 5K5PA 1MIUA 3VDYA 1I94L 1QVGA 1JORA 1QNKA 5J39A 5E3FA 1Y1WH 3NTIA 4DR5Q 3VR4A 5IT9E 3HKSA 1IW7D 2B8GA 3J7ZC 1D8LA 1BOSA 4JBKA 1C8CA 3B6YA 3KBGA 4X3TA 1EYCA 5JJIA 1XNRL 4MTKA 4NPSA 2SEBD 2BH8A 1X3PA 4UHVA 3A54A 4DXFA 4C3JB 1I4RA 5IP7G 1IKLA 1A8VA 3I72A 3U4VA 4CDDC 4LFAL 2MGSA 3QOJA 1C48A 3HOXB 3A0JA 5D3IB 4JYAL 1EYAA 1L1OB 4JV5L 4CDCC 1TWGB 4A93G 2N8NA 4DR6Q 5FKAC 5HURA 3HOWH 1UUPA 4C3IH 1EY0A 4DFAA 2K01A 1AP0A 1HRJA 1BCPB 1YBYA 2RQXA 2K5QA 4B3TQ 4KKUA 5KNCA 3U9SA 2ZTDA 5IGBA 1V43A 4DV4Q 3D6WA 3MXPA 3NBHB 1KQSA 2NVQB 3KBXA 4GN5A 5M5XH 3H09A 1D5XC 3KLSA 3NUCA 4K6LA 3NPPA 2ID0A 1TWFH 3KLRA 4OO1H 2PW7A 2YU9B 5KNDA 1ESRA 1TWCH 1VQ9A 1DGSA 2E2IH 5FO8B 1YVCA 1VMCA 3I4NB 3S1NH 3F1ZA 5M3MH 4CKBA 5C5MA 3BDCA 5CMDA 3K80C 1GXDC 2XIWA 2KCNA 2F0UA 1ASYA 5IGDA 2F0MA 1AZQA 3TRZA 3LX0A 1CKMA 2RDFA 2JA9A 5IODA 1B9MA 3FKIG 5M3FH 3RNUA 3CRKC 1LTTD 1TVXA 3GTGH 2WKCA 1ESFA 2RSOA 4KLKA 1SYDA 4K5VA 3MC0B 2IJ0A 3LNNA 5JEAH 2XSCA 2EYMA 2KJXA 5I2YA 1GD7A 1S40A 1FNWA 2AKWB 4BA2I 1XTDA 4JI4Q 1HR0L 1U4RA 4F8MA 3M4OH 3M3YH 4BBRH 4B3RL 5GAGC 5M5WB 3ZYYX 3ERSX 4BBSB 5FO7B 4P74A 1Y1WG 4FF2A 4DR1L 4O0AA 3Q0AA 3KDFB 3J80c 1IL2A 4QCLA 5IGEA 1XMQQ 1CHPD 4U68A 4ZK9B 1KD1C 3OSOA 1PFNA 3RZOH 3FDTA 5IYDH 4ODGA 4O2DA 4N9PA 1UE6A 4TQUS 2KEEA 4EX5A 3MXGA 3W1BA 2K4KA 1VQIA 3F2BA 1VF7A 4K5XA 3RLNA 4KD4A 4FYDA 4RGMA 1U4MA 3CD6A 2X6LA 2MQHA 3NSWA 4A3BH 4L5TA 1S3OA 1UE1A 4IUPA 4KI0A 1RD9D 1N36Q 1PZJD 1LM0A 5C4JB 3UDGA 1A62A 3ULJA 1N34L 3GTOB 2R7ZB 4R9WA 3GD7A 3S15H 1XJVA 1TWHH 4LUZA 1Z7TA 2HHHQ 2VXWA 3J80i 4B9WA 1TU2B 1ILPA 2OQ0A 3AB9A 4IFDH 4QY7A 1G6PA 1TQOA 4H7BA 1UEBA 2QGQA 3HGBA 3KOJA 2NBFA 4QUFA 1L1OA 1PTOH 3K5LA 4IQZA 3C2PA 5C3WA 1CKOA 4OO1G 1J8IA 2K04A 2YV5A 4DAYB 1KDBA 3TMEA 4HCEA 2A73B 3OOCA 3DM3A 1P16A 3I8ZA 1J9OA 4P2CB 5M3MG 2JA6B 1CQVA 4YCVA 2K14A 4OEMB 4RGOS 3T1HQ 4JI8Q 1HUNA 1BKBA 2L4NA 2DNCA 4OX9L 1SRUA 2F3VA 3S1RH 1PH3A 4LF5L 3GTQH 5CV9A 4JI3L 2NVXB 4A3IB 2NUCA 3WWVA 4A3LH 1SJED 2XRSD 2PI2E 3VYTA 2WFWA 4A3JB 5C3EG 3PUYA 1AW7A 2HDLA 3VA7A 3GTKB 3I7FA 3PO3B 2A6ED 1PMRA 1B3QA 2PQAA 5IP9H 1I94Q 4Y7NB 1XNQL 3SE0A 2VW9A 5JEAG 1WTPA 3IL8A 4NP5A 2SNSA 5D3DA 5DEHA 4C1NI 3Q23A 2HQLA 4LW1A 1SNPA 1TKWB 4BBRG 2JN4A 4BY7B 2Z8LA 1VQ5A 1VF5C 1GUSA 1TIID 1WFQA 3OMGA 1L0WA 5I4DA 3K59A 4LFAQ 3NK9A 1PLFA 1JWSD 3MAQA 3MTSA 3SK4A 1EFWA 4HEDA 2ZT9C 2EE1A 1ET6A 4RKBA 2RHSB 1JE5A 3KYHC 2EY2A 1Y69U 5LMUL 3S17H 1LT3D 3K5NA 3CCEA 4IOAA 2RKSA 4X3UA 3FRPB 1JOOA 5I2XA 3IFTA 3HFZB 4JI5L 3CQZH 3T13A 4J1MA 1CZWA 4NXMQ 5M5YB 2F0NA 3KDFA 3S16B 5JEAJ 2ZXPA 3NTKA 4V190 4CGYB 3STBC 3CCUA 1VQBA 4RGNA 2HD3A 1OXSC 3C1FA 3HOVH 2F4IA 1N8RC 4IFDG 1ZXTA 1M4VA 1UEAB 1QZHA 3MZ5A 3A7LA 4JW0A 3U4ZA 3UDFA 4L5RC 1DOMA 3FPPA 3K7AB 3R3OA 5FLXE 3QWNA 2KCCA 1XTCD 1L1OC 1Q46A 3OW2A 3HOUB 4OWXB 1C4QA 3BZCA 4MZ9A 4IO9A 4YY3L 5IT9c 3H0GH 4WORA 4DXGA 5C6AA 3L2PA 4APVA 5AJ3L 3EJIA 1L0YB 1QILA 5EJWA 2FHTA 3K58A 2QW7A 3A8IE 3GDEA 4LF8L 3KLSX 5KYIA 4WJ4A 1PH1A 3E3XA 4P75A 4J8QA 1BVSA 1LLRD 4KJOA 1Q1BA 5EGTA 5ELNA 4HIMA 1DD2A 4JI6L 5EBDA 4FF3A 3MXUA 1ILQA 4CDEC 4DR5L 1HR0Q 1VQGA 2K1BA 3ULPA 4B3RQ 4C56C 4C3HB 3DLLA 3GV3A 4DAYA 2L5TA 5KIXA 4IPDA 1Q81C 3EVQA 5IGFA 1SYBA 1GKHA 3DHQA 2NVTH 1K8GA 1I50H 3X3MA 4DV6Q 4IFDJ 1KHIA 3GO5A 3JAML 3SK5A 3EA6A 5ELOA 3KLWA 3BS1A 5T1IA 4RAUC 2PPBC 3AFQA 4QIWB 2A74C 4UPAA 1BUVT 1CFMA 3D6CA 2N3SA 3I4NG 2L1BA 3G6JB 3DWQA 1YEZA 1LTRD 3S1QB 3I4LA 3FKIB 5DM73 1NNXA 3GTMB 1E2ZA 1G291 2LMCB 3CCRA 1A3VA 1E1OA 2IL8A 2CH4W 2CKZB 3FMCA 4B3TL 3S24A 1BBXC 1VQCA 1CUKA 3HKZE 4DV4L 1EFID 4DA2A 1CK1A 3K7UC 1WTRA 4ZUJA 2E5LL 1KRSA 1Z6HA 1R9TB 3H91A 4A3GH 1I3QH 3PIOA 3I4MB 3D8GA 4BXXH 3BVZA 2K5HA 2A69C 1I4GA 5IT9L 1PRTF 1HXYD 1STGA 1DONA 4B3SL 2K5WA 1Y1WB 1K28A 1SJHD 2CVRA 3J7A5 1J5EL 2OTLA 1G8ZD 4I7AA 4BBSG 4DNIA 4OXPA 1TS3A 1L2FA 1NR2A 2F0OA 1T9HA 1KLGD 3BYYB 3HOVG 5FK9C 3MXNB 3QJYA 5H1SE 1NUCA 1NSNS 3KF8B 4H13C 4GKJQ 2IPKD 1F77A 3OMCA 4DUYQ 1SNQA 1UWVA 4DV2L 3KJOA 3EN2A 2B2UA 1VQJA 2CW0D 3FVQA 4OX9Q 4LF5Q 1DOKA 1IXRA 1WCMH 4L6TB 4O42A 4LF4Q 1I4QA 4JI3Q 2JEBI 1BXTA 4DR2L 3HOWB 4ZLTF 1ET9A 2PZWA 4C3IB 3H0GG 1OXTA 1IL8A 3URYA 3I55A 4DR7L 1EY7A 1MI2A 1ZEQX 2R93H 3EIVA 1R4QB 2R7ZG 4JI4L 5DLQE 4JBWA 3W5OA 1EQTA 1XNQQ 1II3A 5M5XB 4JK1C 3W3AA 5E4WC 1DOLA 2WP8J 1SMYC 1STNA 2VB2X 4DR4Q 4N9TA 3VYUA 1TWFB 3I2ZA 3HOYH 1KXLA 4KHZA 1SE3A 1XMQL 2E2HH 2IW3A 4XYQA 1SE2A 1TWCB 2EYLA 4DK1A 4IUQA 1AH9A 2JA7H 1B53A 1LT4D 4KV6A 2E2IB 4LF6Q 2QILA 1WD0A 4X62Q 3S1NB 5M3MB 1YNNC 2JSOA 5ELEA 2CFMA 3PCOB 3D4WA 4ULLA 1KNAA 5I6WA 4JI7Q 4X6AH 3V2TA 3ER0A 2LXKA 4GN4B 4XTCS 2EDGA 3BG3A 3SHLA 1TWAH 4O1NA 5I9OA 1E7ZA 2BA0A 1F2LA 3HG9A 3W1GA 5M3FB 1N36L 4JVZA 1IHZA 1ZYRC 1F9QA 4RCNA 1HNWQ 3Q6SA 3CCJA 2KHSA 3GTGB 3FPUB 1F2MA 4JI5Q 1BQQT 3C1EA 3EFXD 1NJIC 4IURA 4OIKA 3DUZA 1FD7D 5CBAE 4WFN3 2KCTA 5JPNC 1T5EA 2Z4HA 4A3GG 3M4OB 3M3YB 5JVG3 2VUMH 5E7NA 4BXXG 1D2BA 2F0TA 2JEAI 1QE6A 2FMCA 2ICIA 3E9HA 1F2YA 1D7QA 2Y0SE 2YYZA 1EY9A 2WIIB 2UUCQ 4H44C 5EBCA 2E2JH 3M7GA 1BDOA 3RZOB 3AU7A 2F4VL 4PV1C 4GKKQ 1VQOA 2RCNA 3M9BA 2ZJQA 2A8VA 4B3ML 2KEDA 2D0PA 4YY3Q 4JI8L 3T1HL 3CPFA 3GQBA 4KMUC 2K32A 2OTJA 1VQDA 4HJ7A 2DNEA 4DN4M 5AJ3Q 2ZXOA 4RHSA 1WTVA 2B39A 1K3BC 5A2QE 2ICEC 2RA4A 1A6XA 4A3BB 1VQHA 4LF8Q 4BA1I 3EROA 3RZDH 1WCMG 4MTNA 3I4MH 2B2UC 1Q8KA 1K9MC 5D14A 2L12A 1BBUA 1VQ6A 4JI6Q 3RLOA 2GVAA 1CZGA 1A63A 5D65A 3A7AB 4OIJA 1P8LA 4HJ8A 5CGKA 4BS9A 3S15B 4RH6A 2BDOA 1TWHB 2J7ZA 4JPBW 4HR7B 2EYOA 3TS2A 2F52A 1JWUD 1GUNA 2F0SA 2OT2A 4KKSA 4TRDA 2H5XA 3IFDA 2CQOA 1YIJA 5A35A 1EYDA 1PTOB 3KF6A 3OWFA 3L9AX 2M9VA 1QCBD 1E3PA 2ASBA 3CPWA 2Z9HA 2E8GA 3M85A 3CC4A 4NKLA 1H9SB 4GOPA 2JA7G 3L7ZC 4TSSA 2EYJA 1E2VA 5LHY1 1EEFD 3HOUG 4JI2L 4XIGS 5EQ0A 5EPKA 1MBYA 5ELDA 2F0WA 4JBMA 1PFBA 1GUTA 3OYYA 4K5WA 3CCMA 3NBIA 2NZOA 4RCOA 4UAIA 1YNJD 1B1ZA 3S1RB 3GTQB 3Q24A 4DV3L 1LTSD 1PRTC 3UDXA 3M4YA 3KJPA 3I73A 3G7LA 5IWAQ 2E5LQ 4NXML 1ZYRD 3AMUA 5F2DA 4DAMA 2L15A 5FLXc 4XYOA 4IOCA 1GHJA 3F2DA 1KDCA 3Q8DA 4G4KA 1STBA 2FFKB 5KRUA 4B3SQ 4C3HG 4PG3A 1PFSA 3PF5A 2HCIA 3NWTA 2PNHA 1J5EQ 1KAAA 3MFGA 3GTLH 1JJ2A 4Q0FA 1GOZA 1YJNA 2EVBA 2VUMG 1K8OA 4HN7A 3RLFA 2A19A 3GTJB 1SYCA 1D5ZC 3PIO3 1QUQB 1ONLA 3S2HH 4FXDA 4DV2Q 3S14H 1DM0B 4FF1A 2L0CA 1JB3A 1XPOA 1U9RA 1NMFA 1VQEA 1KC8C 1IBML 1HTPA 2Z1CA 4QB4A 4DR2Q 1NR4A 2B2WA 2D9UA 2QDBA 4DR7Q 1GUOA 1TS2A 3MFYA 1Y8OB 1E24A 3S17B 4QQBX 5IE8A 2VZAA 2F0QA 3CMEA 1FJGQ 5HGTA 1BCPF 3X3NA 2ZJRA 2MFIA 1C0AA 3RN2A 3CQZB 4DR3L 1O80A 3I4MG 3BZKA 5EPLA 5FOBB 5FJ8H 4POFA 1I6HH 4RWSC 2WB1G 4ABNA 4KHVA 4ME5A 2XTIA 2V1CC 4AYBE 1HFNA 2WAQG 4DV6L 4B08A 1G2TA 3J81E 3HOVB 2N88A 5JPMC 2OQKA 2X6GA 3TP8A 4FVMA 1B4OA 2P5ZX 5C0XH 4DK0A 4ILWA 4CKCA 2ENBA 2JJQA 2F03A 1LTAD 1SNMA 3TDQA 1IKMA 3MA2B 3H0GB 4R8IA 1HZCA
chains in the Genus database with same CATH topology
2FJ2A 2L9HA 1KLUD 1EU4A 4C3IG 5TSSA 1EL0A 1KABA 2JA5B 2J4XA 3KUPA 3C3LA 3HEJA 3A55A 3K0YA 5C4ZA 3D4RA 1K8MA 1O7ZA 2F0FA 2NVTB 1XXGA 1H9SA 2HDMA 2M00A 3P7JA 1I50B 4OHJA 3OIQA 2EY1A 1CTMA 1RDPD 3SVMA 4C1NK 2KQ3A 2BCOA 1G2SA 1TS4A 2A5HA 1QJOA 3NBHA 1QB5D 2EZVA 5IGGA 3H6MA 4ZUIA 3PMFA 3SEBA 3J80L 2QCPX 2EY5A 1EQVA 1OXXK 4KTAA 1DZ1A 4K14A 4G7OC 1EWCA 5G3LF 3BVMA 1AZPA 3P1HA 2MPMA 2B2WC 4A3GB 1I3QB 2DY7A 2EYFA 2E2DC 1T5XD 1JR0D 2G9HD 2IWHA 2F0JA 5I9PA 1A2TA 1STAA 1OXVA 4GZYC 5C4HA 5CV8A 3DWAA 3E0JA 3K5OA 1RKNA 2F0EA 5C0XG 1CA5A 3QOLA 1SSOA 2EXZA 2IX0A 5CV7A 2EJMA 2V4DA 3CKIB 3HRZC 1I4PA 3VA5A 1WCMB 2NN6H 2JXMB 4F7XA 1Y8NB 2A6HC 1AN8A 4TKOB 1RTOA 2R93B 1BNZA 1A3UA 2L55A 2B2VA 1V8QA 1O78A 3IAYA 4X3SA 5ELCA 3HOYB 5DNFA 2E2HB 4HTHA 3EQLC 3O13A 3NE5B 4QUCA 3T51B 4OO1I 1LV9A 2JA7B 3SK6A 5E4XA 5AFWA 5C0XJ 1QOHA 4HMJA 5DAUA 1A2UA 1ZKOA 3I91A 1IYUA 4I65A 1BCPC 5E1FA 1B2TA 2R3ZA 3NP8A 1TWAB 4LK1C 3ITPA 2VB3X 1DJRD 1B44D 2NVYB 1JOQA 2IX1A 5NUCA 4CJ0B 2K28A 2LKVA 4HMIA 2NTSA 4LAAA 2A68C 3HS0C 1RCVD 3R93A 2B2YA 2VUMB 3WOFA 2DY8A 1ML0D 1GUWA 2CHBD 4E6IA 2JYOA 1JICA 3T53B 1CA6A 5CORA 3K5MA 1EZ6A 2E2JB 2M2LA 4DGZA 4XXEA 3NWSA 1X32A 1KTKA 3HKZB 5C0XI 1HPCA 4YIJA 1GJXA 2F0VA 5C3XA 5KGUA 4DF7A 3RZDB 2NN6G 2B63B 2LY7A 3RMHA 3MWYW 2WB1B 2F1MA 4XQNA 4MHEA 3UI2A 1I4XA 2PO4A 2WAQB 1BO0A 5C4XB 4L63B 3BDLA 1EIHA 4IFDI 2XN9C 2B2VC 3QIAA 5BN3A 3TN2A 5EKLA 4EVOA 3BZDB 1HCZA 1RTNA 3BYTB 3TBIB 4UDUC 3PUZA 2NYZD 2K05A 3A8KE 3PUWA 1WVLA 4IUUA 5K36H 4FNFA 4FXGC 3HZXA 4B9XA 3OWEB 3T16A 1SXTA 1PZKD 4Q5VA 4IN3A 2H4OA 4KJNA 1SAPA 1PZID 5C5LA 1I6VC 3GTLB 3ND9A 4ZKCB 2WACA 4OL7A 1BF4A 2B2YC 1Y8PB 4IUNA 5CV6A 3SDZA 5CV4A 1DXMA 3S2HB 3TSSA 3S14B 1CQFA 4FP5D 1LO5D 1ENCA 2E75C 4FO2A 2CQAA 1SEBD 2OEOA 1TT2A 3GP7A 4ZAIA 2OF1A 2F0IA 3C46A 2EYHA 4NDXA 4DNTB 1SNDA 3N52A 5IOCA 3U9OA 3M7NA 1LACA 1VCIA 1H9MA 2A69D 5BN5A 5JAVA 1S4ZA 1I6HB 3RD4A 4KK7A 2RSNA 2O5IC 1STYA 1EY6A 5EPJA 4NMZA 2AUJD 1RODA 3TP7A 2JE6I 4PMCA 2LFNA 4PNYA 4XT1B 3JAME 1HA5A 1SNCA 2AQ1B 1F2ZA 2EJFC 2WKDA 2BOSA 1QG7A 4MN3A 2XRQD 4IUTA 1DYQA 3DXJC 1W6JA 5DM63 5J22A 1SYFA 5JJZA 1JWMD 3HP3A 1NCVA 2NZ1D 1HHVA 1L0XB 4ID6A 5K36G 4I7ZC 3MXNA 2XWJB 2KA7A 4RFBA 4CHTB 5CC4A 3QG1A 3KF8A 1SYEA 2OXPA 1A3TA 2HCCA 2K03A 5CBEE 2NWGA 1SMYD 2F0PA 3J7AF 3HOZB 3GV6A 4WRDA 3PV0A 2Z4IA 4KD3A 1Z47A 4WJWA 3K57A 1TS5A 1WTOA 1RJTA 1YNND 3S1MB 2K7VA 3S2DB 4BY1B 1B9NA 2EYPA 4F87A 4G7HC 1B3AA 2H1EA 2RVLA 2MUYA 1CM9A 4IZ8A 2IT1A 4FXKC 1K83B 3DWPA 5CYUA 1S5DD 2I46A 1QWYA 4R8NA 2JP1A 4CKEA 1PXUA 3TZDA 1O7YA 4RGTA 2F0HA 3NQIA 4RHRA 4IUVA 1PTOF 1MSHA 1V1OA 4K6DA 3K6OA 3TZUA 1R4PB 2HQEA 1STHA 2NB0A 1EY5A 5LL6X 3VYRA 2LS01 3D31A 3FEWX 2JA8B 1RF2D 4NW2A 3QB3A 4KN4C 1GHKA 3I3CA 4XDXA 2C9OA 4AYBB 1D5MC 1Y1VB 2E74C 2SNMA 1S5CD 5ELFA 2MP1A 4A3MB 2A6EC 5JOBA 1AEXA 5JVH3 1Q90A 2BA1A 3CU7A 3PUXA 4XQJA 1FNVA 3CRLC 2KUMA 3W2DA 2PNRC 3OHXC 2TMPA 3R2IA 2WINB 2F0DA 5FLXL 2I07B 3V96A 1FYCA 4K2KA 1EY4A 1Q1EA 3NXWA 3R8BA 2R6GA 2PZUA 1SDFA 5KYLA 2HUGA 2Q8RE 1HFGA 4F88A 1V1PB 3VR3A 1Q12A 4X3KA 4K8JA 3SR1A 3P75A 1IYVA 3WOEA 4BWGB 4ZQ3A 1EY8A 3TP5A 1PRTD 1LTBD 1A15A 2R92B 4KN7C 4K2LA 1ICWA 4LMQD 2F0KA 2EOTA 2XNAC 1EU3A 3WDNA 4A3FB 1OO9B 2RDHA 4KY5A 1FGBD 3QO2A 4EGVA 2R61A 2BE5C 1MD2D 2D5DA 3J7YW 1NAPA 5M9OA 1HTLD 5EKKA 1XYIA 1HUMA 1QNUA 2QF7A 2L11A 1O7LA 4DAPA 1LABA 2PYKA 4HAEA 3I90A 5CR3A 2Q8TA 1DCZA 3DEPA 1ENFA 4Z9CB 5ISRA 1BR9A 3DEOA 1TR5A 4ZKBB 1TY2A 2Q8IB 1CT1D 1SNOA 4QF4A 1EWHA 1F9RA 2GA4B 5LL6S 3NHHA 1OXUA 3SXHA 4DU9A 1KDAA 4XT3B 2AQ2B 3BVGA 2MJ8A 1FNUA 1Q8IA 3DM1A 1WTQA 1D6EC 2F0GA 1HA6A 2XWBB 2PCFB 4A3KB 4A3EB 3ERQA 1SE4A 1LT5D 1STEA 3MHBA 2QEJC 3L3OC 4K8IA 1H9KA 4A3DB 3V05A 1JOKA 5I6YA 2N55A 2G9DA 3E5SA 4H0LC 2PMZB 3VR6A 2IX3A 1D1KA 3R2TA 3LWEA 1PTOC 1VDZA 3DMUA 4G7ZC 5KEEA 1MSGA 1V1PA 5J1ZA 2RBMA 2BE5D 3A56A 2O2LD 3KK7A 2D2CC 4C3JG 4OGQC 5IIFA 5KNBA 2PW5A 2CW0C 4QMGA 3D3RA 3A8JE 4A93B 3OIPA 4U673 3PUVA 1CI3M 1TY0A 1U4LA 1H9RA 4HSVA 2X69A 1VMPA 5C44B 1PRTB 1XX8A 4KKTA 4G57A 2AUKA 5ELBA 1S5FD 1HQMC 4ZYSA 4HCSA 1KNEA 3GTPB 3SK8A 3PO2B 2PQEA 1RHPA 2SDFA 4HSPA 1S5ED 4S3SA 4XQQA 2VNUD 3S9WA 5A2QL 4CBVA 1B50A 2ZXRA 1Q3LA 4EQOA 3E6ZX 4L8JA 2KVMA 1EZ8A 1E2WA 2TSSA 1EEID 3MVVA 2B2TA 2A6HD 2XVSA 1UNSA 3J80E 4RA8A 4KY7A 4CJ2C 1XWEA 1I4HA 2EJGC 1SYGA 1PTOD 4EQPA 3J7AV 3H3VC 3H94A 4LJZC 2BDNA 3PIP3 1PFMA 1M8AA 5BN4A 3OW7A 5EKIA 3ND8A 1H9JA 1LTGD 1PYWD 4PMWA 4IALA 1JCKB 2J0TD 1LT6D 3VYSA 1BCPD 1S5BD 3OPOA 2K6AA 4M1UB 2O4XA 4C2MB 3TP6A 2RDGA 1CHQD 4PMBA 1JE4A 2A68D 1WTWA 1IW7C 1SBBB 2QKIC 3F2UA 2AQ3B 1UAPA 4DNRB 1D1IA 1LTID 1GUGA 3IKJA 1PDQA 1HQRD 3ONAB 4M8AA 3VR2A 2F3WA 5CV5A 4MIUA 3T4AC 4EQNA 4ZRZA 1MGSA 5COYA 4CJ1B 1X3QA 1YNJC 2F0LA 2NTTA 2NN6I 5T1GA 1W6KA 2SOBA 1EIGA 2EPBA 5C3EB 2K5DA 5FO9B 1F9PA 2Y0SB 3J81L 2EY6A 2AWNA 1WTXA 2AWOA 2B2TC 3RUZA 3LWUA 2KOLA 1FR3A 4KY6A 1AFPA 2K33A 2WV6D 2E76C 2MHVA 4BBRB 5IGCA 3CHBD 3T56B 2FMMA 1SFOB 1U4PA 1WD1A 3N6RA 2D62A 3VR5A 3Q22A 3P20A 5G3LD 2B8FA 1JC7A 3NTHA 1E0BA 3D4DA 4RKLA 3MEHA 4PQXA 1JQYD 1ENAA 1F9SA 3NQTA 2O5JC 4FF4A 2DN8A 2KECA 4DAVA 3BDOA 2C5CA 1G6ZA 3I70A 1EOTA 2PZTA 4V0BA 1G91A 2FINB 4J6HA 5K5PA 1JORA 1QNKA 5J39A 5E3FA 3NTIA 3VR4A 5IT9E 1IW7D 2B8GA 1BOSA 1C8CA 3KBGA 4X3TA 1EYCA 2SEBD 1X3PA 3A54A 4DXFA 4C3JB 1I4RA 1IKLA 3I72A 2MGSA 3QOJA 1C48A 3HOXB 5D3IB 1EYAA 1TWGB 5FKAC 5HURA 1UUPA 1EY0A 4DFAA 2K01A 1AP0A 1HRJA 1BCPB 2RQXA 2K5QA 4KKUA 5KNCA 3U9SA 5IGBA 1V43A 3D6WA 3MXPA 2NVQB 3KBXA 3H09A 1D5XC 3KLSA 3NUCA 4K6LA 3NPPA 2ID0A 3KLRA 4OO1H 2PW7A 2YU9B 5KNDA 1ESRA 5FO8B 1VMCA 3I4NB 4CKBA 5C5MA 3BDCA 5CMDA 1GXDC 2XIWA 2KCNA 2F0UA 5IGDA 2F0MA 1AZQA 3LX0A 2RDFA 5IODA 1B9MA 3CRKC 1LTTD 1TVXA 2WKCA 1ESFA 2RSOA 1SYDA 4K5VA 3MC0B 2IJ0A 3LNNA 5JEAH 2XSCA 2EYMA 2KJXA 5I2YA 1FNWA 4BA2I 1U4RA 4F8MA 5M5WB 3ZYYX 4BBSB 5FO7B 4FF2A 3Q0AA 4QCLA 5IGEA 1CHPD 4U68A 4ZK9B 3OSOA 1PFNA 3FDTA 4ODGA 4N9PA 4TQUS 2KEEA 3MXGA 1VF7A 4K5XA 4KD4A 4FYDA 4RGMA 1U4MA 2X6LA 3NSWA 4IUPA 4KI0A 1RD9D 1PZJD 5C4JB 3GTOB 2R7ZB 4R9WA 3GD7A 1Z7TA 2VXWA 4B9WA 1TU2B 1ILPA 3AB9A 4IFDH 1TQOA 4H7BA 3HGBA 2NBFA 4QUFA 1PTOH 3K5LA 4IQZA 3C2PA 5C3WA 1J8IA 4OO1G 2K04A 1KDBA 3TMEA 4HCEA 2A73B 3OOCA 3I8ZA 1J9OA 4P2CB 2JA6B 1CQVA 4RGOS 1HUNA 2L4NA 2DNCA 2F3VA 5CV9A 2NVXB 4A3IB 2NUCA 1SJED 2XRSD 3VYTA 4A3JB 3PUYA 1AW7A 2HDLA 3VA7A 3GTKB 3PO3B 2A6ED 1PMRA 4Y7NB 3SE0A 5JEAG 1WTPA 3IL8A 4NP5A 2SNSA 5D3DA 5DEHA 4C1NI 3Q23A 1SNPA 1TKWB 4BY7B 2Z8LA 1VF5C 1GUSA 1TIID 3OMGA 5I4DA 3K59A 3NK9A 1PLFA 1JWSD 3MAQA 3MTSA 3SK4A 4HEDA 2ZT9C 2EE1A 1ET6A 4RKBA 2EY2A 1Y69U 1LT3D 3K5NA 2RKSA 4X3UA 3FRPB 1JOOA 5I2XA 3IFTA 3T13A 4J1MA 1CZWA 5M5YB 2F0NA 3S16B 5JEAJ 2ZXPA 3NTKA 4V190 4CGYB 4RGNA 1OXSC 3C1FA 2F4IA 4IFDG 1ZXTA 1M4VA 1UEAB 3MZ5A 3A7LA 1DOMA 3FPPA 3K7AB 3R3OA 5FLXE 3QWNA 2KCCA 1XTCD 3HOUB 1C4QA 4WORA 4DXGA 5C6AA 3EJIA 1L0YB 1QILA 5EJWA 2FHTA 3K58A 3A8IE 3KLSX 5KYIA 5EGTA 4J8QA 4KJOA 1LLRD 1Q1BA 1DD2A 5EBDA 4FF3A 3MXUA 1ILQA 2K1BA 4C56C 4C3HB 3GV3A 4DAYA 2L5TA 5KIXA 3EVQA 5IGFA 1SYBA 3DHQA 3X3MA 4IFDJ 3GO5A 3JAML 3SK5A 3EA6A 3BS1A 5T1IA 4RAUC 2PPBC 4QIWB 2A74C 1BUVT 1CFMA 3D6CA 2L1BA 3G6JB 3DWQA 1LTRD 3S1QB 3I4LA 3FKIB 5DM73 3GTMB 1E2ZA 1G291 2LMCB 1A3VA 2IL8A 3FMCA 1BBXC 1EFID 4DA2A 1CK1A 1WTRA 4ZUJA 1Z6HA 1R9TB 3H91A 3I4MB 3D8GA 3BVZA 2A69C 1I4GA 5IT9L 1PRTF 1HXYD 1STGA 1DONA 2K5WA 1Y1WB 1SJHD 2CVRA 1G8ZD 1TS3A 1NR2A 2F0OA 1KLGD 3BYYB 5FK9C 3QJYA 1NUCA 1NSNS 4H13C 2IPKD 1F77A 3OMCA 1SNQA 2B2UA 2CW0D 3FVQA 1DOKA 4L6TB 4O42A 1I4QA 2JEBI 1BXTA 3HOWB 4ZLTF 1ET9A 2PZWA 4C3IB 3URYA 1IL8A 1OXTA 1EY7A 1MI2A 1ZEQX 1R4QB 4JBWA 1EQTA 1II3A 5M5XB 4JK1C 3W3AA 5E4WC 1DOLA 2WP8J 1SMYC 1STNA 2VB2X 4N9TA 3VYUA 1TWFB 4KHZA 1SE3A 2IW3A 4XYQA 1SE2A 1TWCB 2EYLA 4DK1A 4IUQA 1B53A 1LT4D 4KV6A 2E2IB 2QILA 1WD0A 3S1NB 5M3MB 1YNNC 2JSOA 5ELEA 3D4WA 4ULLA 1KNAA 5I6WA 3V2TA 4XTCS 2EDGA 3BG3A 3SHLA 5I9OA 4O1NA 2BA0A 1F2LA 3HG9A 5M3FB 1IHZA 1ZYRC 1F9QA 4RCNA 3Q6SA 2KHSA 3GTGB 3FPUB 1F2MA 1BQQT 3C1EA 3EFXD 4IURA 4OIKA 3DUZA 1FD7D 5CBAE 4WFN3 5JPNC 1T5EA 2Z4HA 3M4OB 3M3YB 5JVG3 1D2BA 2F0TA 2JEAI 1QE6A 2FMCA 2ICIA 1F2YA 2YYZA 1EY9A 2WIIB 4H44C 5EBCA 3M7GA 1BDOA 3RZOB 3AU7A 4PV1C 2KEDA 3GQBA 4KMUC 2K32A 2DNEA 4DN4M 2ZXOA 4RHSA 1WTVA 2B39A 5A2QE 2ICEC 2RA4A 1A6XA 4A3BB 4BA1I 3EROA 2B2UC 5D14A 2L12A 1CZGA 5D65A 3A7AB 4OIJA 5CGKA 4BS9A 3S15B 4RH6A 2BDOA 1TWHB 2J7ZA 4HR7B 2EYOA 1JWUD 1GUNA 2F0SA 2OT2A 4KKSA 4TRDA 3IFDA 5A35A 1EYDA 1PTOB 3OWFA 3L9AX 2M9VA 1QCBD 3M85A 4NKLA 1H9SB 3L7ZC 4TSSA 2EYJA 1E2VA 5LHY1 1EEFD 4XIGS 5EQ0A 5EPKA 1MBYA 5ELDA 2F0WA 1PFBA 1GUTA 4K5WA 3NBIA 4RCOA 3S1RB 4UAIA 1YNJD 1B1ZA 3GTQB 3Q24A 1LTSD 1PRTC 3M4YA 3I73A 3G7LA 1ZYRD 3AMUA 5F2DA 4XYOA 1GHJA 1KDCA 4G4KA 1STBA 2FFKB 5KRUA 4C3HG 2HCIA 3NWTA 1KAAA 3MFGA 4Q0FA 1GOZA 2EVBA 1K8OA 4HN7A 3RLFA 3GTJB 1SYCA 1D5ZC 3PIO3 1ONLA 4FXDA 1DM0B 4FF1A 2L0CA 1JB3A 1U9RA 1HTPA 2Z1CA 4QB4A 1NR4A 2B2WA 2D9UA 2QDBA 1GUOA 1TS2A 3MFYA 1Y8OB 3S17B 2F0QA 5HGTA 1BCPF 3X3NA 3CQZB 1O80A 5EPLA 5FOBB 4RWSC 4ABNA 4KHVA 4ME5A 1HFNA 1G2TA 4B08A 3J81E 3HOVB 2N88A 5JPMC 2X6GA 3TP8A 4FVMA 1B4OA 5C0XH 4DK0A 4ILWA 4CKCA 2ENBA 2F03A 1LTAD 1SNMA 3TDQA 1IKMA 3MA2B 3H0GB 4R8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4D A;  4RKL A;  3MEH A;  5C3W A;  4WRD A;  5C5M A;  3BDC A;  2O4X A;  4IUN A;  5F2D A;  5CV6 A;  3TP6 A;  3VA5 A;  1KDB A;  4KD3 A;  2F0U A;  3TME A;  1KAB A;  5CV4 A;  3SXH A;  4DU9 A;  2F0D A;  1ENA A;  3MZ5 A;  1KDC A;  2F0M A;  4F7X A;  1KDA A;  1STB A;  2F0O A;  4YIJ A;  3NQT A;  5IGD A;  3LX0 A;  5KRU A;  2RDF A;  4G57 A;  4PMB A;  5IOD A;  3HEJ A;  1ENC A;  2F0T A;  3R3O A;  2F0V A;  2OEO A;  5C3X A;  5KGU A;  1F2Y A;  2PZT A;  1KAA A;  4DF7 A;  1NUC A;  1NSN S;  2F3V A;  4K2K A;  1EY4 A;  1TT2 A;  3SK8 A;  3NXW A;  1A3U A;  1EY9 A;  4J6H A;  5C4Z A;  5CV9 A;  1SYD A;  2F0G A;  4WOR A;  5K5P A;  2OF1 A;  4K5V A;  5C6A A;  2F0I A;  2PQE A;  2EYP A;  2PZU A;  3OMC A;  2F0F A;  1SNQ A;  2NUC A;  5KYL A;  5E3F A;  5J39 A;  1JOR A;  2EYM A;  2M00 A;  3EJI A;  2EYH A;  4NDX A;  1SND A;  3ERQ A;  5IOC A;  3U9O A;  1SYC A;  2EY1 A;  4K8J A;  3MHB A;  4F8M A;  3SR1 A;  4S3S A;  3P75 A;  3S9W A;  2PZW A;  4ZQ3 A;  1EYC A;  2KQ3 A;  1EY8 A;  4HTH A;  3TP5 A;  5IGF A;  5JAV A;  3BDL A;  5KYI A;  2F3W A;  4KJO A;  5EGT A;  1EY7 A;  4IZ8 A;  4K8I A;  1U9R A;  1JOK A;  5I6Y A;  4NP5 A;  4K2L A;  4EQO A;  2SNS A;  4MIU A;  5CV5 A;  4EQN A;  3ERO A;  5DEH A;  3SK6 A;  1EZ8 A;  5IGG A;  2F0K A;  3E5S A;  3H6M A;  4QB4 A;  3PMF A;  4ZUI A;  5IGE A;  1SNP A;  2QDB A;  3OSO A;  3MVV A;  4HMJ A;  5KIX A;  3EVQ A;  3QOJ A;  1SYB A;  1II3 A;  5DAU A;  3DHQ A;  4ODG A;  4R8N A;  5EKL A;  4N9P A;  4EVO A;  1A2U A;  1EYA A;  1STY A;  1EQV A;  1EY6 A;  2EY5 A;  4KTA A;  2F0Q A;  4I65 A;  4NMZ A;  5E1F A;  4K14 A;  3OMG A;  5CGK A;  2F0L A;  3SK5 A;  4KY5 A;  5HGT A;  2F0H A;  3TP7 A;  3NP8 A;  4K5X A;  1STN A;  4KY7 A;  4PMC A;  4N9T A;  4PNY A;  5HUR A;  3ITP A;  3NK9 A;  3P1H A;  4KD4 A;  2EYO A;  1EY0 A;  2SOB A;  4DFA A;  3DMU A;  1JOQ A;  3D6C A;  2F0S A;  1SNC A;  1F2Z A;  4KHV A;  4ME5 A;  5NUC A;  2EYL A;  5M9O A;  4K6D A;  3SK4 A;  4TRD A;  5EKK A;  2EY6 A;  2HQE A;  2LKV A;  1STH A;  5IGB A;  5KEE A;  4HMI A;  1EY5 A;  4KV6 A;  1SYG A;  3RUZ A;  1EYD A;  4RKB A;  3MXP A;  3OWF A;  5J1Z A;  2RBM A;  4LAA A;  5J22 A;  3HZX A;  2EY2 A;  3D4W A;  4B9X A;  2EYF A;  1SYF A;  4EQP A;  3T16 A;  5I6W A;  1A3V A;  4KY6 A;  2RKS A;  3V2T A;  2PYK A;  3TP8 A;  1JOO A;  4NKL A;  3QB3 A;  4KJN A;  2F0J A;  5IGC A;  3NUC A;  4ID6 A;  5I9P A;  2EYJ A;  5CR3 A;  1A2T A;  3SHL A;  1STA A;  5I9O A;  5ISR A;  3T13 A;  4J1M A;  5C5L A;  5IIF A;  4E6I A;  2F0N A;  2PW5 A;  2PW7 A;  4B9W A;  5C4H A;  2F0W A;  5CC4 A;  4QMG A;  2ENB A;  5CV8 A;  1TR5 A;  1IHZ A;  4ZUJ A;  4IAL A;  4K5W A;  1SYE A;  2OXP A;  2SNM A;  1A3T A;  1RKN A;  2F0E A;  1SNM A;  1TQO A;  1SNO A;  2KHS A;  4H7B A;  4QF4 A;  2WAC A;  1F2M A;  3D8G A;  1EZ6 A;  5JOB A;  1AEX A;  3C1E A;  3QOL A;  3C1F A;  4OL7 A;  2EXZ A;  2F0P A;  3NHH A;  5CV7 A;  1STG A;  4DGZ A; 
#chains in the Genus database with same CATH topology
 2FJ2 A;  2L9H A;  1KLU D;  2R7D A;  3HOW G;  1EU4 A;  4C3I G;  4GOP C;  1Q7Y C;  5TSS A;  3SGI A;  4P72 A;  4YCW A;  1EL0 A;  1KAB A;  2JA5 B;  2Q2H A;  2J4X A;  3KUP A;  3C3L A;  1NBW A;  3HEJ A;  3CXC A;  4YHH L;  3A55 A;  1CSP A;  4P71 A;  4QGU A;  1OTC A;  3K0Y A;  5C4Z A;  3D4R A;  1K8M A;  1O7Z A;  2F0F A;  2NVT B;  1XXG A;  3HOZ H;  1H9S A;  2HDM A;  2G5D A;  2M00 A;  3P7J A;  1I50 B;  1KAW A;  4OHJ A;  3OIQ A;  2EY1 A;  1CTM A;  1RDP D;  3SVM A;  4GKJ L;  4C1N K;  2KQ3 A;  2F4V Q;  2BCO A;  2KCM A;  1G2S A;  1TS4 A;  2A5H A;  4DUY L;  1QJO A;  4B3M Q;  3NBH A;  1QB5 D;  4POG A;  3S1M H;  2EZV A;  5IGG A;  3H6M A;  4ZUI A;  3PMF A;  3S2D H;  3SEB A;  4BY1 H;  4LF4 L;  3J80 L;  3U58 A;  2QCP X;  2EY5 A;  1EQV A;  1OXX K;  2QDL A;  4KTA A;  1DZ1 A;  4K14 A;  5M3F G;  1VS0 A;  4G7O C;  1EWC A;  5G3L F;  4JC0 A;  2Z6B A;  3BVM A;  1AZP A;  1HNX Q;  3P1H A;  1I5F A;  4IPH A;  4LNQ A;  2MPM A;  2B2W C;  4A3G B;  2RHQ B;  1I3Q B;  2DY7 A;  1K83 H;  1MJE A;  3PQI A;  1X3G A;  4DR4 L;  1X3E A;  2EYF A;  2E2D C;  1T5X D;  1JR0 D;  2G9H D;  1B70 B;  2IWH A;  2F0J A;  3GTJ H;  5I9P A;  1A2T A;  1FGU A;  1STA A;  2I5H A;  1OXV A;  2CWP A;  3CF5 A;  4HID A;  4LF6 L;  4X62 L;  4GZY C;  5C4H A;  1QVF A;  1HJP A;  5CV8 A;  1VQF A;  3DWA A;  5IYD G;  4JI7 L;  3E0J A;  3K5O A;  1RKN A;  2F0E A;  3CCV A;  5C0X G;  1CA5 A;  1JJG A;  3QOL A;  4JI2 Q;  1SSO A;  1YNX A;  2EXZ A;  5HY6 A;  2IX0 A;  5CV7 A;  2EJM A;  2JQO A;  2V4D A;  3CKI B;  3HRZ C;  2JA8 H;  2B29 A;  1I4P A;  2XGT A;  3VA5 A;  1E1T A;  1WCM B;  4DV3 Q;  1EIY B;  2NN6 H;  4A3B G;  1HNW L;  2JXM B;  1IZ6 A;  4OEL B;  4F7X A;  1Y8N B;  2A6H C;  1AN8 A;  4TKO B;  1RTO A;  2R93 B;  1WOC A;  5FLM H;  1BNZ A;  4PZ7 A;  2UU9 L;  2DJF C;  3UE1 A;  1A3U A;  4IJL A;  2L55 A;  2B2V A;  1V8Q A;  1O78 A;  3IAY A;  1LTL A;  2PMZ E;  4X3S A;  5ELC A;  4AH6 A;  3HOY B;  1PA6 A;  4P73 A;  5DNF A;  2E2H B;  4HTH A;  3EQL C;  3O13 A;  2UUC L;  3NE5 B;  4QUC A;  3HOZ G;  4GKK L;  3T51 B;  4OO1 I;  1LV9 A;  2JA7 B;  1AE3 A;  3H3V H;  3SK6 A;  5E4X A;  5AFW A;  5C0X J;  2DJG C;  1QOH A;  4HMJ A;  3CMA A;  5DAU A;  1Q82 C;  4OWT B;  1A2U A;  3MEF A;  1ZKO A;  3I91 A;  1IYU A;  1IBM Q;  4I65 A;  1BCP C;  5E1F A;  1B2T A;  2R3Z A;  3NP8 A;  1TWA B;  1SN8 A;  4LK1 C;  4X65 Q;  4Y52 H;  3ITP A;  2JA5 H;  2VB3 X;  1DJR D;  1B44 D;  4BY1 G;  2NVY B;  1JOQ A;  2BH2 A;  2R92 H;  2Z0S A;  2IX1 A;  5NUC A;  4A3L G;  4RMF A;  2K28 A;  4CJ0 B;  2VQF Q;  2LKV A;  4HMI A;  4RG1 A;  4DV0 Q;  4DR3 Q;  1K73 C;  2NTS A;  4LAA A;  2A68 C;  5IP9 G;  4A3F H;  2UUB Q;  3HS0 C;  1RCV D;  3R93 A;  2B2Y A;  2VUM B;  3NEM A;  3WOF A;  2DY8 A;  1ML0 D;  3I56 A;  1GUW A;  2CHB D;  4E6I A;  3CCS A;  1Y14 B;  2JYO A;  1JIC A;  3T53 B;  1CA6 A;  5COR A;  3K5M A;  1EZ6 A;  2E2J B;  1B7Y B;  2M2L A;  4PZ6 A;  4ALP A;  4DGZ A;  4XXE A;  3NWS A;  1X32 A;  1KTK A;  3HKZ B;  5C0X I;  1HPC A;  4YIJ A;  1KL9 A;  4L5Q A;  1GJX A;  2F0V A;  1X54 A;  5GQO A;  1NE3 A;  5C3X A;  1LYL A;  4DF7 A;  5KGU A;  5IWA L;  5GAH C;  3RZD B;  4N8X 1;  1PHJ A;  2NN6 G;  4R4T A;  2B63 B;  2LY7 A;  1EWI A;  3RMH A;  3MWY W;  4YHH Q;  1VQK A;  2WB1 B;  2F1M A;  4XQN A;  4MHE A;  3UI2 A;  1I4X A;  2PO4 A;  2WAQ B;  4QL5 A;  1BO0 A;  5C4X B;  2KEN A;  3A74 A;  4DV1 Q;  1EIF A;  1VQN A;  3STB D;  1LUZ A;  2CWA A;  4L63 B;  5BR8 L;  3BDL A;  1EIH A;  4IFD I;  2XN9 C;  2B2V C;  3QIA A;  5IYC H;  5BN3 A;  1PH6 A;  3TN2 A;  5EKL A;  4EVO A;  4A3K H;  3BZD B;  1HCZ A;  1RTN A;  3BYT B;  4A3E H;  2DGY A;  3TBI B;  4PZ8 A;  4UDU C;  2B3G A;  2I5M X;  1X6O A;  4JI1 Q;  4R4O A;  5L37 A;  3PUZ A;  1M1K C;  1ICF B;  3J81 c;  2MO0 A;  1VQ7 A;  4DV5 L;  2NYZ D;  4A3D H;  2K05 A;  3RR5 A;  3A8K E;  3PUW A;  1WVL A;  4IUU A;  5K36 H;  2YTX A;  1EYG A;  1FJG L;  4FNF A;  1H95 A;  1IBK L;  4FXG C;  3CC7 A;  3HZX A;  2JA5 G;  4B9X A;  3OWE B;  3T16 A;  3TRE A;  1SXT A;  1PZK D;  4Q5V A;  2R92 G;  4IN3 A;  1QVC A;  2H4O A;  4KJN A;  1SAP A;  1AE2 A;  3QR8 A;  1PZI D;  2LXJ A;  2K50 A;  4LF9 L;  5C5L A;  4A3C H;  1N33 L;  1I6V C;  3GTL B;  3ND9 A;  4ZKC B;  2WAC A;  3CAM A;  1U0L A;  4OL7 A;  1BF4 A;  1MHW C;  2B2Y C;  1Y8P B;  4IUN A;  5CV6 A;  4CDF C;  3J81 i;  2IHF A;  5CV4 A;  3SDZ A;  2ALY B;  1GO3 E;  1DXM A;  3S2H B;  3TSS A;  3S14 B;  1CQF A;  1JT8 A;  4FP5 D;  1LO5 D;  1ENC A;  2ES2 A;  2E75 C;  4FO2 A;  2CQA A;  2NVY H;  1SEB D;  2OEO A;  4A93 H;  1TT2 A;  3GP7 A;  1RIP A;  4ZAI A;  2OF1 A;  2F0I A;  2I0Q A;  5LMN W;  1C9O A;  1PH7 A;  4HJ5 A;  3C46 A;  2EYH A;  2UU9 Q;  4GN3 B;  4NDX A;  4DNT B;  1SND A;  3CCL A;  3N52 A;  5IOC A;  1V1Q A;  3U9O A;  3M7N A;  1LAC A;  5C44 H;  1VCI A;  4DV7 Q;  1H9M A;  2A69 D;  5BN5 A;  5JAV A;  1S4Z A;  2MO1 A;  1I6H B;  4AQY Q;  4YWK A;  1X3F A;  3GTP H;  3E9I A;  3RD4 A;  2EXD A;  4KK7 A;  3PO2 H;  2RSN A;  2O5I C;  1STY A;  1EY6 A;  5EPJ A;  4NMZ A;  2AUJ D;  1TXY A;  1ROD A;  3TP7 A;  2JE6 I;  4PMC A;  2LFN A;  4PNY A;  4XT1 B;  5IYC G;  3JAM E;  1FVI A;  1HA5 A;  2ZM6 Q;  1PH4 A;  1SNC A;  2AQ1 B;  1F2Z A;  2EJF C;  2WKD A;  1WJJ A;  4A3K G;  4KHP L;  2BOS A;  1QG7 A;  2CH4 A;  4A4I A;  4MN3 A;  4K0K Q;  4A3E G;  2XRQ D;  5J3B A;  4JI0 Q;  2UXD Q;  4IUT A;  1DYQ A;  3DXJ C;  1W6J A;  5DM6 3;  5J22 A;  2B63 H;  1HNX L;  1U5K A;  2ATW A;  1SYF A;  5JJZ A;  1JWM D;  3HP3 A;  1NCV A;  2R93 G;  4FDB A;  2NZ1 D;  4A3D G;  1HHV A;  1L0X B;  2EQS A;  4LFC Q;  5C4X H;  4ID6 A;  3AEV A;  5K36 G;  4I7Z C;  3MXN A;  2XWJ B;  2KA7 A;  4RFB A;  4CHT B;  5GAD C;  5CC4 A;  3FP9 A;  3QG1 A;  5JJL A;  3KF8 A;  4UP8 A;  3ZJY C;  1SYE A;  2OXP A;  1A3T A;  2HCC A;  2K5N A;  2K03 A;  4NB3 A;  1C7Y A;  5CBE E;  2NWG A;  1SMY D;  2F0P A;  3J7A F;  3HOZ B;  3HOY G;  3GV6 A;  4WRD A;  4A3C G;  3PV0 A;  5LMN Q;  2Z4I A;  3CCQ A;  4KD3 A;  1Z47 A;  4WJW A;  1PYS B;  4JOI A;  1Z9F A;  3K57 A;  1TS5 A;  3M4P A;  1WTO A;  2UUA Q;  5IYB H;  1RJT A;  1XPU A;  1YNN D;  1N9W A;  3S1M B;  1WTH A;  1NY4 A;  1X55 A;  2K7V A;  3S2D B;  4BY1 B;  1B9N A;  2EYP A;  4F87 A;  2KBN A;  3CP0 A;  4G7H C;  4C2M H;  1B3A A;  1UE5 A;  2RF4 A;  2H1E A;  2RVL A;  1EUJ A;  2MUY A;  4JBJ A;  3T1Y L;  4JG2 A;  1CM9 A;  4X64 L;  4IZ8 A;  2IT1 A;  3CW2 C;  3G4S A;  4FXK C;  1K83 B;  4LFB L;  2QA4 A;  5C44 G;  2YTY A;  3DWP A;  5CYU A;  1S5D D;  2I46 A;  5BR8 Q;  1QWY A;  4R8N A;  2JP1 A;  4X66 L;  1IYJ B;  4CKE A;  2OCE A;  1JMC A;  1PXU A;  3TZD A;  1O7Y A;  3CC2 A;  4RGT A;  2F0H A;  3NQI A;  4RHR A;  4IUV A;  1J6Q A;  2GN5 A;  3PO2 G;  1PTO F;  2PQA B;  1MSH A;  1YHB A;  1V1O A;  4K6D A;  3K6O A;  3TZU A;  1R4P B;  1JJC B;  1MJC A;  2HQE A;  2JK8 A;  1STH A;  2NB0 A;  1EY5 A;  1IBL L;  4GNX B;  5LL6 X;  3HKZ G;  3VYR A;  2LS0 1;  3D31 A;  4X65 L;  3FEW X;  1PH2 A;  4DV5 Q;  2JA8 B;  1RF2 D;  4NW2 A;  1YIT A;  4UP7 A;  3QB3 A;  4KN4 C;  4ME3 A;  1GHK A;  3I3C A;  2VQF L;  1IBK Q;  4DV0 L;  4XDX A;  1SR3 A;  2C9O A;  2RCF A;  4AYB B;  5C3E H;  2B63 G;  1PV4 A;  1D5M C;  1Y1V B;  2E74 C;  2UUB L;  2SNM A;  1S5C D;  5ELF A;  2UXC Q;  2MP1 A;  2ZTC A;  4A3M B;  2A6E C;  2K75 A;  5JOB A;  5C4X G;  1AEX A;  5JVH 3;  1Q90 A;  4LF9 Q;  3PF4 A;  3PGZ A;  2KHJ A;  2BA1 A;  3CU7 A;  1N33 Q;  4R1J A;  3PUX A;  4XQJ A;  1FNV A;  3CRL C;  2KUM A;  3W2D A;  2PNR C;  4TVA B;  3OHX C;  2TMP A;  3R2I A;  2WIN B;  2F0D A;  5FLX L;  2I07 B;  3V96 A;  1PH8 A;  1SFO H;  1FYC A;  4H02 A;  1SE8 A;  4K2K A;  1EY4 A;  1Q1E A;  1WYD A;  3NXW A;  3R8B A;  1EQR A;  2R6G A;  3L0O A;  2PZU A;  1SDF A;  5KYL A;  2HUG A;  2Q8R E;  2R7F A;  5IYB G;  1HFG A;  4F88 A;  1V1P B;  3VR3 A;  1Q12 A;  4X3K A;  4JOI C;  2ZTE A;  4K8J A;  1YHQ A;  3SR1 A;  3P75 A;  3OTO Q;  3WOE A;  1IYV A;  4BWG B;  4ZQ3 A;  1EY8 A;  3TP5 A;  1PRT D;  1LTB D;  1A15 A;  2R92 B;  2VQE Q;  4KN7 C;  4K2L A;  1ICW A;  4LMQ D;  3PIP A;  1PH5 A;  2F0K A;  2EOT A;  2K5V A;  2XNA C;  4DV1 L;  4DK6 C;  4AIM A;  1EU3 A;  4LF7 L;  3WDN A;  1NTG A;  4A3F B;  2OWO A;  3AFP A;  1HNZ L;  1OO9 B;  2C35 B;  2RDH A;  1XMO L;  4KY5 A;  1FGB D;  3QO2 A;  4EGV A;  2R61 A;  2BE5 C;  1MD2 D;  2D5D A;  3J7Y W;  1NAP A;  4L5S A;  5M9O A;  1HTL D;  5EKK A;  1XYI A;  1VQP A;  2N78 A;  4C3J H;  1HUM A;  1QNU A;  2QF7 A;  2L11 A;  1O7L A;  4DAP A;  4JI1 L;  2CCZ A;  1LAB A;  4LWC A;  3HOX H;  4KHP Q;  2PYK A;  4HAE A;  3I90 A;  1TWG H;  5CR3 A;  2Q8T A;  1DCZ A;  3DEP A;  1ENF A;  4Z9C B;  5ISR A;  4DUZ Q;  1BR9 A;  2HT1 A;  1SMX A;  3EBE A;  3DEO A;  1VQL A;  1TR5 A;  4GLX A;  4ZKB B;  1TY2 A;  5EAY A;  2Q8I B;  1HZ9 A;  1CT1 D;  1SNO A;  4QF4 A;  4R4C A;  1EWH A;  1F9R A;  4EQ5 A;  1CKN B;  2GA4 B;  3NHH A;  5LL6 S;  3RN5 A;  2ZJP A;  2NVQ H;  1QUQ A;  5FJ8 G;  3TS0 A;  1OXU A;  2Y0S G;  3SXH A;  4DU9 A;  1UE7 A;  1KDA A;  1PVO A;  1XPR A;  4XT3 B;  2AQ2 B;  3BVG A;  4NXN L;  2YU9 H;  2GVB A;  4GNX A;  2MJ8 A;  1N32 L;  1FNU A;  1Q8I A;  3DM1 A;  1K3R A;  1WTQ A;  1D6E C;  2F0G A;  4A75 A;  1XNR Q;  1HA6 A;  3I4N H;  2XWB B;  2PCF B;  4A3K B;  4A3E B;  3ERQ A;  1SE4 A;  1LT5 D;  1STE A;  3MHB A;  2F3I A;  2QEJ C;  4JYA Q;  3L3O C;  4K8I A;  1YZ6 A;  4JV5 Q;  1HR0 W;  1H9K A;  4A3D B;  3V05 A;  1JOK A;  5I6Y A;  3AYH B;  1Y1V H;  2N55 A;  2G9D A;  5GAE C;  3E5S A;  2QEX A;  4A3M H;  4R4Q A;  3T1Y Q;  2K52 A;  4H0L C;  4X64 Q;  4DV7 L;  2PMZ B;  3VR6 A;  3JAM c;  2IX3 A;  4AQY L;  1D1K A;  4LFB Q;  1VQA A;  2A1A A;  3R2T A;  1PYB A;  1GM5 A;  3LWE A;  5M5W H;  1PTO C;  1VDZ A;  3DMU A;  3JC6 6;  4GLA C;  4X66 Q;  4G7Z C;  2IHE A;  1O7I A;  4BBS H;  4IJH A;  2EIF A;  3I4O A;  4YWL A;  5KEE A;  3UE0 A;  1MSG A;  1V1P A;  5J1Z A;  2RBM A;  5GRO A;  2BE5 D;  3KFU A;  2ZM6 L;  4IPC A;  4JCV E;  3A56 A;  2O2L D;  3KK7 A;  1IBL Q;  2AMC B;  2D2C C;  1YHA A;  4K0K L;  4C3J G;  4JI0 L;  2UXD L;  4OGQ C;  1W3S A;  4OON A;  5IIF A;  5KNB A;  2I5L X;  2PW5 A;  1W2B A;  3ICE A;  2CW0 C;  4QMG A;  3D0F A;  1SLJ A;  3D3R A;  3A8J E;  3HOX G;  4A93 B;  3OIP A;  4U67 3;  1FL0 A;  1G51 A;  2UXB L;  3JAM i;  3PUV A;  1EQQ A;  4LFC L;  1CI3 M;  1TY0 A;  1U4L A;  1EOV A;  3IRB A;  4HJ9 A;  1H9R A;  5C4J H;  3FHW A;  3GTO H;  4HSV A;  2X69 A;  2R7Z H;  1VMP A;  5C44 B;  3A5Z B;  1PRT B;  1XX8 A;  1YI2 A;  4KKT A;  3K8A A;  2VS1 A;  4G57 A;  2AUK A;  5ELB A;  1S5F D;  1HQM C;  4ZYS A;  1NMG A;  4HCS A;  5LMN L;  1KNE A;  3GTP B;  2PI2 A;  3SK8 A;  3PO2 B;  2PQE A;  1RHP A;  1WI5 A;  2SDF A;  2UUA L;  4HSP A;  4DR1 Q;  4OWW B;  3J81 j;  1S5E D;  2D0O A;  1QZG A;  4S3S A;  4XQQ A;  2VNU D;  3S9W A;  5A2Q L;  4GNX C;  4CBV A;  2Q2U A;  4A76 A;  1B50 A;  4QIW E;  2ZXR A;  2JA6 H;  1CSQ A;  1BBW A;  3E0E A;  1Q3L A;  1CKN A;  3E6Z X;  4L8J A;  4EQO A;  2JA8 G;  2KVM A;  1EZ8 A;  3K0X A;  1E2W A;  2TSS A;  1JB7 A;  3LGJ A;  1EEI D;  3MVV A;  4DR6 L;  5IY0 A;  2B2T A;  2NVX H;  2A6H D;  4A3I H;  2AHO B;  2XVS A;  1UNS A;  4MNO A;  3J80 E;  3BJU A;  4J15 A;  3G71 A;  1K8A C;  4A3J H;  4AYB G;  5FLM G;  1Y1V G;  3GTK H;  4RA8 A;  4KY7 A;  4CJ2 C;  4LF7 Q;  3PO3 H;  4A3M G;  1N34 Q;  3K81 C;  1E22 A;  1HNZ Q;  4Y7N H;  4YCU A;  1XWE A;  1XMO Q;  4GS3 A;  1I4H A;  2EJG C;  4UY8 C;  1SYG A;  4YWM A;  1K0S A;  2Z6K A;  3AQQ A;  3NEN A;  4BY7 H;  1PTO D;  4EQP A;  2WB1 E;  3J7A V;  4ZCK A;  2WAQ E;  3H3V C;  3H94 A;  4DPG A;  4LJZ C;  3U50 C;  2BDN A;  3ULL A;  3PIP 3;  1PFM A;  4IPG A;  1M8A A;  5BN4 A;  3OW7 A;  5EKI A;  3ND8 A;  1H9J A;  1LTG D;  1PYW D;  4PMW A;  4IAL A;  1JCK B;  2J0T D;  1LT6 D;  2KHI A;  3VYS A;  1VQ4 A;  1BCP D;  1S5B D;  2MNA A;  3OPO A;  2K6A A;  3TQY A;  1X56 A;  3KF6 B;  3A5U A;  4M1U B;  2O4X A;  4C2M B;  3TP6 A;  2RDG A;  5JJK A;  3F2C A;  1CHQ D;  2UXC L;  4GOP B;  4PMB A;  1JE4 A;  5M5Y H;  1Q86 C;  2A68 D;  4LUV A;  3S16 H;  1WTW A;  1VQ8 A;  4A3F G;  1IW7 C;  1SBB B;  1RL2 A;  2QKI C;  3F2U A;  2AQ3 B;  1UAP A;  4DNR B;  4NXN Q;  1D1I A;  4HJA A;  1LTI D;  1GUG A;  1N32 Q;  1SRO A;  1KIX A;  5IP7 H;  1HZA A;  1YJW A;  3IKJ A;  4HIK A;  1PDQ A;  1HQR D;  4LUO A;  3ONA B;  4M8A A;  2F3W A;  4QJF A;  3VR2 A;  3K7A H;  1GVP A;  3TEH B;  5CV5 A;  2YTV A;  4MIU A;  3T4A C;  4EQN A;  4HIO A;  3NEL A;  3HOU H;  2N49 A;  4GLV B;  4ZRZ A;  1MGS A;  3OTO L;  4N8F A;  3BU2 A;  5COY A;  4CJ1 B;  2JA6 G;  2VQE L;  1X3Q A;  1YNJ C;  2F0L A;  2NTT A;  2HIX A;  2VL6 A;  2NN6 I;  5T1G A;  5LMU Q;  1S72 A;  2LSS A;  1W6K A;  2SOB A;  1EIG A;  2EPB A;  5C3E B;  2K5D A;  4A3I G;  5FO9 B;  1F9P A;  2FXQ A;  2Y0S B;  3J81 L;  2EY6 A;  2AWN A;  1WTX A;  2AWO A;  2IY5 B;  2B2T C;  4A3J G;  3RUZ A;  3LWU A;  4C3H H;  1B8A A;  3PO3 G;  1VQM A;  2HHH L;  2KOL A;  1FR3 A;  1HZB A;  4KY6 A;  4DKA C;  1AFP A;  2K33 A;  4R4I A;  2WV6 D;  2E76 C;  2MHV A;  4BBR B;  5IGC A;  3CHB D;  3UDI A;  4UP9 A;  2HIV A;  3T56 B;  2FMM A;  1SFO B;  4BY7 G;  3G48 A;  1U4P A;  1WD1 A;  1K0R A;  3N6R A;  1ASZ A;  2D62 A;  3VR5 A;  3Q22 A;  2Z6K C;  3P20 A;  3PSI A;  5G3L D;  3H3V I;  1M90 C;  1KRT A;  2B8F A;  3S1Q H;  1JC7 A;  3H15 A;  3FKI H;  3NTH A;  4DK3 C;  1X65 A;  3GTM H;  1E0B A;  3G6E A;  3D4D A;  4RKL A;  4DUZ L;  1X9N A;  3MEH A;  2Q2T A;  2VY3 A;  1V9P A;  4PQX A;  3M4Q A;  2UXB Q;  1PH9 A;  1JQY D;  1ENA A;  1F9S A;  3NQT A;  2O5J C;  4FF4 A;  2DN8 A;  2KEC A;  4DAV A;  4WJ3 M;  3BDO A;  2C5C A;  1G6Z A;  2NZH A;  3I70 A;  1EOT A;  2PZT A;  1YJ9 A;  1R9T H;  2DUD A;  1MKH A;  4V0B A;  1HH2 P;  1G91 A;  2FIN B;  2Q2I A;  3F8T A;  4J6H A;  5HGQ A;  1A0I A;  5K5P A;  1MIU A;  3VDY A;  1I94 L;  1QVG A;  1JOR A;  1QNK A;  5J39 A;  5E3F A;  1Y1W H;  3NTI A;  4DR5 Q;  3VR4 A;  5IT9 E;  3HKS A;  1IW7 D;  2B8G A;  3J7Z C;  1D8L A;  1BOS A;  4JBK A;  1C8C A;  3B6Y A;  3KBG A;  4X3T A;  1EYC A;  5JJI A;  1XNR L;  4MTK A;  4NPS A;  2SEB D;  2BH8 A;  1X3P A;  4UHV A;  3A54 A;  4DXF A;  4C3J B;  1I4R A;  5IP7 G;  1IKL A;  1A8V A;  3I72 A;  3U4V A;  4CDD C;  4LFA L;  2MGS A;  3QOJ A;  1C48 A;  3HOX B;  3A0J A;  5D3I B;  4JYA L;  1EYA A;  1L1O B;  4JV5 L;  4CDC C;  1TWG B;  4A93 G;  2N8N A;  4DR6 Q;  5FKA C;  5HUR A;  3HOW H;  1UUP A;  4C3I H;  1EY0 A;  4DFA A;  2K01 A;  1AP0 A;  1HRJ A;  1BCP B;  1YBY A;  2RQX A;  2K5Q A;  4B3T Q;  4KKU A;  5KNC A;  3U9S A;  2ZTD A;  5IGB A;  1V43 A;  4DV4 Q;  3D6W A;  3MXP A;  3NBH B;  1KQS A;  2NVQ B;  3KBX A;  4GN5 A;  5M5X H;  3H09 A;  1D5X C;  3KLS A;  3NUC A;  4K6L A;  3NPP A;  2ID0 A;  1TWF H;  3KLR A;  4OO1 H;  2PW7 A;  2YU9 B;  5KND A;  1ESR A;  1TWC H;  1VQ9 A;  1DGS A;  2E2I H;  5FO8 B;  1YVC A;  1VMC A;  3I4N B;  3S1N H;  3F1Z A;  5M3M H;  4CKB A;  5C5M A;  3BDC A;  5CMD A;  3K80 C;  1GXD C;  2XIW A;  2KCN A;  2F0U A;  1ASY A;  5IGD A;  2F0M A;  1AZQ A;  3TRZ A;  3LX0 A;  1CKM A;  2RDF A;  2JA9 A;  5IOD A;  1B9M A;  3FKI G;  5M3F H;  3RNU A;  3CRK C;  1LTT D;  1TVX A;  3GTG H;  2WKC A;  1ESF A;  2RSO A;  4KLK A;  1SYD A;  4K5V A;  3MC0 B;  2IJ0 A;  3LNN A;  5JEA H;  2XSC A;  2EYM A;  2KJX A;  5I2Y A;  1GD7 A;  1S40 A;  1FNW A;  2AKW B;  4BA2 I;  1XTD A;  4JI4 Q;  1HR0 L;  1U4R A;  4F8M A;  3M4O H;  3M3Y H;  4BBR H;  4B3R L;  5GAG C;  5M5W B;  3ZYY X;  3ERS X;  4BBS B;  5FO7 B;  4P74 A;  1Y1W G;  4FF2 A;  4DR1 L;  4O0A A;  3Q0A A;  3KDF B;  3J80 c;  1IL2 A;  4QCL A;  5IGE A;  1XMQ Q;  1CHP D;  4U68 A;  4ZK9 B;  1KD1 C;  3OSO A;  1PFN A;  3RZO H;  3FDT A;  5IYD H;  4ODG A;  4O2D A;  4N9P A;  1UE6 A;  4TQU S;  2KEE A;  4EX5 A;  3MXG A;  3W1B A;  2K4K A;  1VQI A;  3F2B A;  1VF7 A;  4K5X A;  3RLN A;  4KD4 A;  4FYD A;  4RGM A;  1U4M A;  3CD6 A;  2X6L A;  2MQH A;  3NSW A;  4A3B H;  4L5T A;  1S3O A;  1UE1 A;  4IUP A;  4KI0 A;  1RD9 D;  1N36 Q;  1PZJ D;  1LM0 A;  5C4J B;  3UDG A;  1A62 A;  3ULJ A;  1N34 L;  3GTO B;  2R7Z B;  4R9W A;  3GD7 A;  3S15 H;  1XJV A;  1TWH H;  4LUZ A;  1Z7T A;  2HHH Q;  2VXW A;  3J80 i;  4B9W A;  1TU2 B;  1ILP A;  2OQ0 A;  3AB9 A;  4IFD H;  4QY7 A;  1G6P A;  1TQO A;  4H7B A;  1UEB A;  2QGQ A;  3HGB A;  3KOJ A;  2NBF A;  4QUF A;  1L1O A;  1PTO H;  3K5L A;  4IQZ A;  3C2P A;  5C3W A;  1CKO A;  4OO1 G;  1J8I A;  2K04 A;  2YV5 A;  4DAY B;  1KDB A;  3TME A;  4HCE A;  2A73 B;  3OOC A;  3DM3 A;  1P16 A;  3I8Z A;  1J9O A;  4P2C B;  5M3M G;  2JA6 B;  1CQV A;  4YCV A;  2K14 A;  4OEM B;  4RGO S;  3T1H Q;  4JI8 Q;  1HUN A;  1BKB A;  2L4N A;  2DNC A;  4OX9 L;  1SRU A;  2F3V A;  3S1R H;  1PH3 A;  4LF5 L;  3GTQ H;  5CV9 A;  4JI3 L;  2NVX B;  4A3I B;  2NUC A;  3WWV A;  4A3L H;  1SJE D;  2XRS D;  2PI2 E;  3VYT A;  2WFW A;  4A3J B;  5C3E G;  3PUY A;  1AW7 A;  2HDL A;  3VA7 A;  3GTK B;  3I7F A;  3PO3 B;  2A6E D;  1PMR A;  1B3Q A;  2PQA A;  5IP9 H;  1I94 Q;  4Y7N B;  1XNQ L;  3SE0 A;  2VW9 A;  5JEA G;  1WTP A;  3IL8 A;  4NP5 A;  2SNS A;  5D3D A;  5DEH A;  4C1N I;  3Q23 A;  2HQL A;  4LW1 A;  1SNP A;  1TKW B;  4BBR G;  2JN4 A;  4BY7 B;  2Z8L A;  1VQ5 A;  1VF5 C;  1GUS A;  1TII D;  1WFQ A;  3OMG A;  1L0W A;  5I4D A;  3K59 A;  4LFA Q;  3NK9 A;  1PLF A;  1JWS D;  3MAQ A;  3MTS A;  3SK4 A;  1EFW A;  4HED A;  2ZT9 C;  2EE1 A;  1ET6 A;  4RKB A;  2RHS B;  1JE5 A;  3KYH C;  2EY2 A;  1Y69 U;  5LMU L;  3S17 H;  1LT3 D;  3K5N A;  3CCE A;  4IOA A;  2RKS A;  4X3U A;  3FRP B;  1JOO A;  5I2X A;  3IFT A;  3HFZ B;  4JI5 L;  3CQZ H;  3T13 A;  4J1M A;  1CZW A;  4NXM Q;  5M5Y B;  2F0N A;  3KDF A;  3S16 B;  5JEA J;  2ZXP A;  3NTK A;  4V19 0;  4CGY B;  3STB C;  3CCU A;  1VQB A;  4RGN A;  2HD3 A;  1OXS C;  3C1F A;  3HOV H;  2F4I A;  1N8R C;  4IFD G;  1ZXT A;  1M4V A;  1UEA B;  1QZH A;  3MZ5 A;  3A7L A;  4JW0 A;  3U4Z A;  3UDF A;  4L5R C;  1DOM A;  3FPP A;  3K7A B;  3R3O A;  5FLX E;  3QWN A;  2KCC A;  1XTC D;  1L1O C;  1Q46 A;  3OW2 A;  3HOU B;  4OWX B;  1C4Q A;  3BZC A;  4MZ9 A;  4IO9 A;  4YY3 L;  5IT9 c;  3H0G H;  4WOR A;  4DXG A;  5C6A A;  3L2P A;  4APV A;  5AJ3 L;  3EJI A;  1L0Y B;  1QIL A;  5EJW A;  2FHT A;  3K58 A;  2QW7 A;  3A8I E;  3GDE A;  4LF8 L;  3KLS X;  5KYI A;  4WJ4 A;  1PH1 A;  3E3X A;  4P75 A;  4J8Q A;  1BVS A;  1LLR D;  4KJO A;  1Q1B A;  5EGT A;  5ELN A;  4HIM A;  1DD2 A;  4JI6 L;  5EBD A;  4FF3 A;  3MXU A;  1ILQ A;  4CDE C;  4DR5 L;  1HR0 Q;  1VQG A;  2K1B A;  3ULP A;  4B3R Q;  4C56 C;  4C3H B;  3DLL A;  3GV3 A;  4DAY A;  2L5T A;  5KIX A;  4IPD A;  1Q81 C;  3EVQ A;  5IGF A;  1SYB A;  1GKH A;  3DHQ A;  2NVT H;  1K8G A;  1I50 H;  3X3M A;  4DV6 Q;  4IFD J;  1KHI A;  3GO5 A;  3JAM L;  3SK5 A;  3EA6 A;  5ELO A;  3KLW A;  3BS1 A;  5T1I A;  4RAU C;  2PPB C;  3AFQ A;  4QIW B;  2A74 C;  4UPA A;  1BUV T;  1CFM A;  3D6C A;  2N3S A;  3I4N G;  2L1B A;  3G6J B;  3DWQ A;  1YEZ A;  1LTR D;  3S1Q B;  3I4L A;  3FKI B;  5DM7 3;  1NNX A;  3GTM B;  1E2Z A;  1G29 1;  2LMC B;  3CCR A;  1A3V A;  1E1O A;  2IL8 A;  2CH4 W;  2CKZ B;  3FMC A;  4B3T L;  3S24 A;  1BBX C;  1VQC A;  1CUK A;  3HKZ E;  4DV4 L;  1EFI D;  4DA2 A;  1CK1 A;  3K7U C;  1WTR A;  4ZUJ A;  2E5L L;  1KRS A;  1Z6H A;  1R9T B;  3H91 A;  4A3G H;  1I3Q H;  3PIO A;  3I4M B;  3D8G A;  4BXX H;  3BVZ A;  2K5H A;  2A69 C;  1I4G A;  5IT9 L;  1PRT F;  1HXY D;  1STG A;  1DON A;  4B3S L;  2K5W A;  1Y1W B;  1K28 A;  1SJH D;  2CVR A;  3J7A 5;  1J5E L;  2OTL A;  1G8Z D;  4I7A A;  4BBS G;  4DNI A;  4OXP A;  1TS3 A;  1L2F A;  1NR2 A;  2F0O A;  1T9H A;  1KLG D;  3BYY B;  3HOV G;  5FK9 C;  3MXN B;  3QJY A;  5H1S E;  1NUC A;  1NSN S;  3KF8 B;  4H13 C;  4GKJ Q;  2IPK D;  1F77 A;  3OMC A;  4DUY Q;  1SNQ A;  1UWV A;  4DV2 L;  3KJO A;  3EN2 A;  2B2U A;  1VQJ A;  2CW0 D;  3FVQ A;  4OX9 Q;  4LF5 Q;  1DOK A;  1IXR A;  1WCM H;  4L6T B;  4O42 A;  4LF4 Q;  1I4Q A;  4JI3 Q;  2JEB I;  1BXT A;  4DR2 L;  3HOW B;  4ZLT F;  1ET9 A;  2PZW A;  4C3I B;  3H0G G;  1OXT A;  1IL8 A;  3URY A;  3I55 A;  4DR7 L;  1EY7 A;  1MI2 A;  1ZEQ X;  2R93 H;  3EIV A;  1R4Q B;  2R7Z G;  4JI4 L;  5DLQ E;  4JBW A;  3W5O A;  1EQT A;  1XNQ Q;  1II3 A;  5M5X B;  4JK1 C;  3W3A A;  5E4W C;  1DOL A;  2WP8 J;  1SMY C;  1STN A;  2VB2 X;  4DR4 Q;  4N9T A;  3VYU A;  1TWF B;  3I2Z A;  3HOY H;  1KXL A;  4KHZ A;  1SE3 A;  1XMQ L;  2E2H H;  2IW3 A;  4XYQ A;  1SE2 A;  1TWC B;  2EYL A;  4DK1 A;  4IUQ A;  1AH9 A;  2JA7 H;  1B53 A;  1LT4 D;  4KV6 A;  2E2I B;  4LF6 Q;  2QIL A;  1WD0 A;  4X62 Q;  3S1N B;  5M3M B;  1YNN C;  2JSO A;  5ELE A;  2CFM A;  3PCO B;  3D4W A;  4ULL A;  1KNA A;  5I6W A;  4JI7 Q;  4X6A H;  3V2T A;  3ER0 A;  2LXK A;  4GN4 B;  4XTC S;  2EDG A;  3BG3 A;  3SHL A;  1TWA H;  4O1N A;  5I9O A;  1E7Z A;  2BA0 A;  1F2L A;  3HG9 A;  3W1G A;  5M3F B;  1N36 L;  4JVZ A;  1IHZ A;  1ZYR C;  1F9Q A;  4RCN A;  1HNW Q;  3Q6S A;  3CCJ A;  2KHS A;  3GTG B;  3FPU B;  1F2M A;  4JI5 Q;  1BQQ T;  3C1E A;  3EFX D;  1NJI C;  4IUR A;  4OIK A;  3DUZ A;  1FD7 D;  5CBA E;  4WFN 3;  2KCT A;  5JPN C;  1T5E A;  2Z4H A;  4A3G G;  3M4O B;  3M3Y B;  5JVG 3;  2VUM H;  5E7N A;  4BXX G;  1D2B A;  2F0T A;  2JEA I;  1QE6 A;  2FMC A;  2ICI A;  3E9H A;  1F2Y A;  1D7Q A;  2Y0S E;  2YYZ A;  1EY9 A;  2WII B;  2UUC Q;  4H44 C;  5EBC A;  2E2J H;  3M7G A;  1BDO A;  3RZO B;  3AU7 A;  2F4V L;  4PV1 C;  4GKK Q;  1VQO A;  2RCN A;  3M9B A;  2ZJQ A;  2A8V A;  4B3M L;  2KED A;  2D0P A;  4YY3 Q;  4JI8 L;  3T1H L;  3CPF A;  3GQB A;  4KMU C;  2K32 A;  2OTJ A;  1VQD A;  4HJ7 A;  2DNE A;  4DN4 M;  5AJ3 Q;  2ZXO A;  4RHS A;  1WTV A;  2B39 A;  1K3B C;  5A2Q E;  2ICE C;  2RA4 A;  1A6X A;  4A3B B;  1VQH A;  4LF8 Q;  4BA1 I;  3ERO A;  3RZD H;  1WCM G;  4MTN A;  3I4M H;  2B2U C;  1Q8K A;  1K9M C;  5D14 A;  2L12 A;  1BBU A;  1VQ6 A;  4JI6 Q;  3RLO A;  2GVA A;  1CZG A;  1A63 A;  5D65 A;  3A7A B;  4OIJ A;  1P8L A;  4HJ8 A;  5CGK A;  4BS9 A;  3S15 B;  4RH6 A;  2BDO A;  1TWH B;  2J7Z A;  4JPB W;  4HR7 B;  2EYO A;  3TS2 A;  2F52 A;  1JWU D;  1GUN A;  2F0S A;  2OT2 A;  4KKS A;  4TRD A;  2H5X A;  3IFD A;  2CQO A;  1YIJ A;  5A35 A;  1EYD A;  1PTO B;  3KF6 A;  3OWF A;  3L9A X;  2M9V A;  1QCB D;  1E3P A;  2ASB A;  3CPW A;  2Z9H A;  2E8G A;  3M85 A;  3CC4 A;  4NKL A;  1H9S B;  4GOP A;  2JA7 G;  3L7Z C;  4TSS A;  2EYJ A;  1E2V A;  5LHY 1;  1EEF D;  3HOU G;  4JI2 L;  4XIG S;  5EQ0 A;  5EPK A;  1MBY A;  5ELD A;  2F0W A;  4JBM A;  1PFB A;  1GUT A;  3OYY A;  4K5W A;  3CCM A;  3NBI A;  2NZO A;  4RCO A;  4UAI A;  1YNJ D;  1B1Z A;  3S1R B;  3GTQ B;  3Q24 A;  4DV3 L;  1LTS D;  1PRT C;  3UDX A;  3M4Y A;  3KJP A;  3I73 A;  3G7L A;  5IWA Q;  2E5L Q;  4NXM L;  1ZYR D;  3AMU A;  5F2D A;  4DAM A;  2L15 A;  5FLX c;  4XYO A;  4IOC A;  1GHJ A;  3F2D A;  1KDC A;  3Q8D A;  4G4K A;  1STB A;  2FFK B;  5KRU A;  4B3S Q;  4C3H G;  4PG3 A;  1PFS A;  3PF5 A;  2HCI A;  3NWT A;  2PNH A;  1J5E Q;  1KAA A;  3MFG A;  3GTL H;  1JJ2 A;  4Q0F A;  1GOZ A;  1YJN A;  2EVB A;  2VUM G;  1K8O A;  4HN7 A;  3RLF A;  2A19 A;  3GTJ B;  1SYC A;  1D5Z C;  3PIO 3;  1QUQ B;  1ONL A;  3S2H H;  4FXD A;  4DV2 Q;  3S14 H;  1DM0 B;  4FF1 A;  2L0C A;  1JB3 A;  1XPO A;  1U9R A;  1NMF A;  1VQE A;  1KC8 C;  1IBM L;  1HTP A;  2Z1C A;  4QB4 A;  4DR2 Q;  1NR4 A;  2B2W A;  2D9U A;  2QDB A;  4DR7 Q;  1GUO A;  1TS2 A;  3MFY A;  1Y8O B;  1E24 A;  3S17 B;  4QQB X;  5IE8 A;  2VZA A;  2F0Q A;  3CME A;  1FJG Q;  5HGT A;  1BCP F;  3X3N A;  2ZJR A;  2MFI A;  1C0A A;  3RN2 A;  3CQZ B;  4DR3 L;  1O80 A;  3I4M G;  3BZK A;  5EPL A;  5FOB B;  5FJ8 H;  4POF A;  1I6H H;  4RWS C;  2WB1 G;  4ABN A;  4KHV A;  4ME5 A;  2XTI A;  2V1C C;  4AYB E;  1HFN A;  2WAQ G;  4DV6 L;  4B08 A;  1G2T A;  3J81 E;  3HOV B;  2N88 A;  5JPM C;  2OQK A;  2X6G A;  3TP8 A;  4FVM A;  1B4O A;  2P5Z X;  5C0X H;  4DK0 A;  4ILW A;  4CKC A;  2ENB A;  2JJQ A;  2F03 A;  1LTA D;  1SNM A;  3TDQ A;  1IKM A;  3MA2 B;  3H0G B;  4R8I A;  1HZC A; 
#chains in the Genus database with same CATH homology
 2FJ2 A;  2L9H A;  1KLU D;  1EU4 A;  4C3I G;  5TSS A;  1EL0 A;  1KAB A;  2JA5 B;  2J4X A;  3KUP A;  3C3L A;  3HEJ A;  3A55 A;  3K0Y A;  5C4Z A;  3D4R A;  1K8M A;  1O7Z A;  2F0F A;  2NVT B;  1XXG A;  1H9S A;  2HDM A;  2M00 A;  3P7J A;  1I50 B;  4OHJ A;  3OIQ A;  2EY1 A;  1CTM A;  1RDP D;  3SVM A;  4C1N K;  2KQ3 A;  2BCO A;  1G2S A;  1TS4 A;  2A5H A;  1QJO A;  3NBH A;  1QB5 D;  2EZV A;  5IGG A;  3H6M A;  4ZUI A;  3PMF A;  3SEB A;  3J80 L;  2QCP X;  2EY5 A;  1EQV A;  1OXX K;  4KTA A;  1DZ1 A;  4K14 A;  4G7O C;  1EWC A;  5G3L F;  3BVM A;  1AZP A;  3P1H A;  2MPM A;  2B2W C;  4A3G B;  1I3Q B;  2DY7 A;  2EYF A;  2E2D C;  1T5X D;  1JR0 D;  2G9H D;  2IWH A;  2F0J A;  5I9P A;  1A2T A;  1STA A;  1OXV A;  4GZY C;  5C4H A;  5CV8 A;  3DWA A;  3E0J A;  3K5O A;  1RKN A;  2F0E A;  5C0X G;  1CA5 A;  3QOL A;  1SSO A;  2EXZ A;  2IX0 A;  5CV7 A;  2EJM A;  2V4D A;  3CKI B;  3HRZ C;  1I4P A;  3VA5 A;  1WCM B;  2NN6 H;  2JXM B;  4F7X A;  1Y8N B;  2A6H C;  1AN8 A;  4TKO B;  1RTO A;  2R93 B;  1BNZ A;  1A3U A;  2L55 A;  2B2V A;  1V8Q A;  1O78 A;  3IAY A;  4X3S A;  5ELC A;  3HOY B;  5DNF A;  2E2H B;  4HTH A;  3EQL C;  3O13 A;  3NE5 B;  4QUC A;  3T51 B;  4OO1 I;  1LV9 A;  2JA7 B;  3SK6 A;  5E4X A;  5AFW A;  5C0X J;  1QOH A;  4HMJ A;  5DAU A;  1A2U A;  1ZKO A;  3I91 A;  1IYU A;  4I65 A;  1BCP C;  5E1F A;  1B2T A;  2R3Z A;  3NP8 A;  1TWA B;  4LK1 C;  3ITP A;  2VB3 X;  1DJR D;  1B44 D;  2NVY B;  1JOQ A;  2IX1 A;  5NUC A;  4CJ0 B;  2K28 A;  2LKV A;  4HMI A;  2NTS A;  4LAA A;  2A68 C;  3HS0 C;  1RCV D;  3R93 A;  2B2Y A;  2VUM B;  3WOF A;  2DY8 A;  1ML0 D;  1GUW A;  2CHB D;  4E6I A;  2JYO A;  1JIC A;  3T53 B;  1CA6 A;  5COR A;  3K5M A;  1EZ6 A;  2E2J B;  2M2L A;  4DGZ A;  4XXE A;  3NWS A;  1X32 A;  1KTK A;  3HKZ B;  5C0X I;  1HPC A;  4YIJ A;  1GJX A;  2F0V A;  5C3X A;  5KGU A;  4DF7 A;  3RZD B;  2NN6 G;  2B63 B;  2LY7 A;  3RMH A;  3MWY W;  2WB1 B;  2F1M A;  4XQN A;  4MHE A;  3UI2 A;  1I4X A;  2PO4 A;  2WAQ B;  1BO0 A;  5C4X B;  4L63 B;  3BDL A;  1EIH A;  4IFD I;  2XN9 C;  2B2V C;  3QIA A;  5BN3 A;  3TN2 A;  5EKL A;  4EVO A;  3BZD B;  1HCZ A;  1RTN A;  3BYT B;  3TBI B;  4UDU C;  3PUZ A;  2NYZ D;  2K05 A;  3A8K E;  3PUW A;  1WVL A;  4IUU A;  5K36 H;  4FNF A;  4FXG C;  3HZX A;  4B9X A;  3OWE B;  3T16 A;  1SXT A;  1PZK D;  4Q5V A;  4IN3 A;  2H4O A;  4KJN A;  1SAP A;  1PZI D;  5C5L A;  1I6V C;  3GTL B;  3ND9 A;  4ZKC B;  2WAC A;  4OL7 A;  1BF4 A;  2B2Y C;  1Y8P B;  4IUN A;  5CV6 A;  3SDZ A;  5CV4 A;  1DXM A;  3S2H B;  3TSS A;  3S14 B;  1CQF A;  4FP5 D;  1LO5 D;  1ENC A;  2E75 C;  4FO2 A;  2CQA A;  1SEB D;  2OEO A;  1TT2 A;  3GP7 A;  4ZAI A;  2OF1 A;  2F0I A;  3C46 A;  2EYH A;  4NDX A;  4DNT B;  1SND A;  3N52 A;  5IOC A;  3U9O A;  3M7N A;  1LAC A;  1VCI A;  1H9M A;  2A69 D;  5BN5 A;  5JAV A;  1S4Z A;  1I6H B;  3RD4 A;  4KK7 A;  2RSN A;  2O5I C;  1STY A;  1EY6 A;  5EPJ A;  4NMZ A;  2AUJ D;  1ROD A;  3TP7 A;  2JE6 I;  4PMC A;  2LFN A;  4PNY A;  4XT1 B;  3JAM E;  1HA5 A;  1SNC A;  2AQ1 B;  1F2Z A;  2EJF C;  2WKD A;  2BOS A;  1QG7 A;  4MN3 A;  2XRQ D;  4IUT A;  1DYQ A;  3DXJ C;  1W6J A;  5DM6 3;  5J22 A;  1SYF A;  5JJZ A;  1JWM D;  3HP3 A;  1NCV A;  2NZ1 D;  1HHV A;  1L0X B;  4ID6 A;  5K36 G;  4I7Z C;  3MXN A;  2XWJ B;  2KA7 A;  4RFB A;  4CHT B;  5CC4 A;  3QG1 A;  3KF8 A;  1SYE A;  2OXP A;  1A3T A;  2HCC A;  2K03 A;  5CBE E;  2NWG A;  1SMY D;  2F0P A;  3J7A F;  3HOZ B;  3GV6 A;  4WRD A;  3PV0 A;  2Z4I A;  4KD3 A;  1Z47 A;  4WJW A;  3K57 A;  1TS5 A;  1WTO A;  1RJT A;  1YNN D;  3S1M B;  2K7V A;  3S2D B;  4BY1 B;  1B9N A;  2EYP A;  4F87 A;  4G7H C;  1B3A A;  2H1E A;  2RVL A;  2MUY A;  1CM9 A;  4IZ8 A;  2IT1 A;  4FXK C;  1K83 B;  3DWP A;  5CYU A;  1S5D D;  2I46 A;  1QWY A;  4R8N A;  2JP1 A;  4CKE A;  1PXU A;  3TZD A;  1O7Y A;  4RGT A;  2F0H A;  3NQI A;  4RHR A;  4IUV A;  1PTO F;  1MSH A;  1V1O A;  4K6D A;  3K6O A;  3TZU A;  1R4P B;  2HQE A;  1STH A;  2NB0 A;  1EY5 A;  5LL6 X;  3VYR A;  2LS0 1;  3D31 A;  3FEW X;  2JA8 B;  1RF2 D;  4NW2 A;  3QB3 A;  4KN4 C;  1GHK A;  3I3C A;  4XDX A;  2C9O A;  4AYB B;  1D5M C;  1Y1V B;  2E74 C;  2SNM A;  1S5C D;  5ELF A;  2MP1 A;  4A3M B;  2A6E C;  5JOB A;  1AEX A;  5JVH 3;  1Q90 A;  2BA1 A;  3CU7 A;  3PUX A;  4XQJ A;  1FNV A;  3CRL C;  2KUM A;  3W2D A;  2PNR C;  3OHX C;  2TMP A;  3R2I A;  2WIN B;  2F0D A;  5FLX L;  2I07 B;  3V96 A;  1FYC A;  4K2K A;  1EY4 A;  1Q1E A;  3NXW A;  3R8B A;  2R6G A;  2PZU A;  1SDF A;  5KYL A;  2HUG A;  2Q8R E;  1HFG A;  4F88 A;  1V1P B;  3VR3 A;  1Q12 A;  4X3K A;  4K8J A;  3SR1 A;  3P75 A;  1IYV A;  3WOE A;  4BWG B;  4ZQ3 A;  1EY8 A;  3TP5 A;  1PRT D;  1LTB D;  1A15 A;  2R92 B;  4KN7 C;  4K2L A;  1ICW A;  4LMQ D;  2F0K A;  2EOT A;  2XNA C;  1EU3 A;  3WDN A;  4A3F B;  1OO9 B;  2RDH A;  4KY5 A;  1FGB D;  3QO2 A;  4EGV A;  2R61 A;  2BE5 C;  1MD2 D;  2D5D A;  3J7Y W;  1NAP A;  5M9O A;  1HTL D;  5EKK A;  1XYI A;  1HUM A;  1QNU A;  2QF7 A;  2L11 A;  1O7L A;  4DAP A;  1LAB A;  2PYK A;  4HAE A;  3I90 A;  5CR3 A;  2Q8T A;  1DCZ A;  3DEP A;  1ENF A;  4Z9C B;  5ISR A;  1BR9 A;  3DEO A;  1TR5 A;  4ZKB B;  1TY2 A;  2Q8I B;  1CT1 D;  1SNO A;  4QF4 A;  1EWH A;  1F9R A;  2GA4 B;  5LL6 S;  3NHH A;  1OXU A;  3SXH A;  4DU9 A;  1KDA A;  4XT3 B;  2AQ2 B;  3BVG A;  2MJ8 A;  1FNU A;  1Q8I A;  3DM1 A;  1WTQ A;  1D6E C;  2F0G A;  1HA6 A;  2XWB B;  2PCF B;  4A3K B;  4A3E B;  3ERQ A;  1SE4 A;  1LT5 D;  1STE A;  3MHB A;  2QEJ C;  3L3O C;  4K8I A;  1H9K A;  4A3D B;  3V05 A;  1JOK A;  5I6Y A;  2N55 A;  2G9D A;  3E5S A;  4H0L C;  2PMZ B;  3VR6 A;  2IX3 A;  1D1K A;  3R2T A;  3LWE A;  1PTO C;  1VDZ A;  3DMU A;  4G7Z C;  5KEE A;  1MSG A;  1V1P A;  5J1Z A;  2RBM A;  2BE5 D;  3A56 A;  2O2L D;  3KK7 A;  2D2C C;  4C3J G;  4OGQ C;  5IIF A;  5KNB A;  2PW5 A;  2CW0 C;  4QMG A;  3D3R A;  3A8J E;  4A93 B;  3OIP A;  4U67 3;  3PUV A;  1CI3 M;  1TY0 A;  1U4L A;  1H9R A;  4HSV A;  2X69 A;  1VMP A;  5C44 B;  1PRT B;  1XX8 A;  4KKT A;  4G57 A;  2AUK A;  5ELB A;  1S5F D;  1HQM C;  4ZYS A;  4HCS A;  1KNE A;  3GTP B;  3SK8 A;  3PO2 B;  2PQE A;  1RHP A;  2SDF A;  4HSP A;  1S5E D;  4S3S A;  4XQQ A;  2VNU D;  3S9W A;  5A2Q L;  4CBV A;  1B50 A;  2ZXR A;  1Q3L A;  4EQO A;  3E6Z X;  4L8J A;  2KVM A;  1EZ8 A;  1E2W A;  2TSS A;  1EEI D;  3MVV A;  2B2T A;  2A6H D;  2XVS A;  1UNS A;  3J80 E;  4RA8 A;  4KY7 A;  4CJ2 C;  1XWE A;  1I4H A;  2EJG C;  1SYG A;  1PTO D;  4EQP A;  3J7A V;  3H3V C;  3H94 A;  4LJZ C;  2BDN A;  3PIP 3;  1PFM A;  1M8A A;  5BN4 A;  3OW7 A;  5EKI A;  3ND8 A;  1H9J A;  1LTG D;  1PYW D;  4PMW A;  4IAL A;  1JCK B;  2J0T D;  1LT6 D;  3VYS A;  1BCP D;  1S5B D;  3OPO A;  2K6A A;  4M1U B;  2O4X A;  4C2M B;  3TP6 A;  2RDG A;  1CHQ D;  4PMB A;  1JE4 A;  2A68 D;  1WTW A;  1IW7 C;  1SBB B;  2QKI C;  3F2U A;  2AQ3 B;  1UAP A;  4DNR B;  1D1I A;  1LTI D;  1GUG A;  3IKJ A;  1PDQ A;  1HQR D;  3ONA B;  4M8A A;  3VR2 A;  2F3W A;  5CV5 A;  4MIU A;  3T4A C;  4EQN A;  4ZRZ A;  1MGS A;  5COY A;  4CJ1 B;  1X3Q A;  1YNJ C;  2F0L A;  2NTT A;  2NN6 I;  5T1G A;  1W6K A;  2SOB A;  1EIG A;  2EPB A;  5C3E B;  2K5D A;  5FO9 B;  1F9P A;  2Y0S B;  3J81 L;  2EY6 A;  2AWN A;  1WTX A;  2AWO A;  2B2T C;  3RUZ A;  3LWU A;  2KOL A;  1FR3 A;  4KY6 A;  1AFP A;  2K33 A;  2WV6 D;  2E76 C;  2MHV A;  4BBR B;  5IGC A;  3CHB D;  3T56 B;  2FMM A;  1SFO B;  1U4P A;  1WD1 A;  3N6R A;  2D62 A;  3VR5 A;  3Q22 A;  3P20 A;  5G3L D;  2B8F A;  1JC7 A;  3NTH A;  1E0B A;  3D4D A;  4RKL A;  3MEH A;  4PQX A;  1JQY D;  1ENA A;  1F9S A;  3NQT A;  2O5J C;  4FF4 A;  2DN8 A;  2KEC A;  4DAV A;  3BDO A;  2C5C A;  1G6Z A;  3I70 A;  1EOT A;  2PZT A;  4V0B A;  1G91 A;  2FIN B;  4J6H A;  5K5P A;  1JOR A;  1QNK A;  5J39 A;  5E3F A;  3NTI A;  3VR4 A;  5IT9 E;  1IW7 D;  2B8G A;  1BOS A;  1C8C A;  3KBG A;  4X3T A;  1EYC A;  2SEB D;  1X3P A;  3A54 A;  4DXF A;  4C3J B;  1I4R A;  1IKL A;  3I72 A;  2MGS A;  3QOJ A;  1C48 A;  3HOX B;  5D3I B;  1EYA A;  1TWG B;  5FKA C;  5HUR A;  1UUP A;  1EY0 A;  4DFA A;  2K01 A;  1AP0 A;  1HRJ A;  1BCP B;  2RQX A;  2K5Q A;  4KKU A;  5KNC A;  3U9S A;  5IGB A;  1V43 A;  3D6W A;  3MXP A;  2NVQ B;  3KBX A;  3H09 A;  1D5X C;  3KLS A;  3NUC A;  4K6L A;  3NPP A;  2ID0 A;  3KLR A;  4OO1 H;  2PW7 A;  2YU9 B;  5KND A;  1ESR A;  5FO8 B;  1VMC A;  3I4N B;  4CKB A;  5C5M A;  3BDC A;  5CMD A;  1GXD C;  2XIW A;  2KCN A;  2F0U A;  5IGD A;  2F0M A;  1AZQ A;  3LX0 A;  2RDF A;  5IOD A;  1B9M A;  3CRK C;  1LTT D;  1TVX A;  2WKC A;  1ESF A;  2RSO A;  1SYD A;  4K5V A;  3MC0 B;  2IJ0 A;  3LNN A;  5JEA H;  2XSC A;  2EYM A;  2KJX A;  5I2Y A;  1FNW A;  4BA2 I;  1U4R A;  4F8M A;  5M5W B;  3ZYY X;  4BBS B;  5FO7 B;  4FF2 A;  3Q0A A;  4QCL A;  5IGE A;  1CHP D;  4U68 A;  4ZK9 B;  3OSO A;  1PFN A;  3FDT A;  4ODG A;  4N9P A;  4TQU S;  2KEE A;  3MXG A;  1VF7 A;  4K5X A;  4KD4 A;  4FYD A;  4RGM A;  1U4M A;  2X6L A;  3NSW A;  4IUP A;  4KI0 A;  1RD9 D;  1PZJ D;  5C4J B;  3GTO B;  2R7Z B;  4R9W A;  3GD7 A;  1Z7T A;  2VXW A;  4B9W A;  1TU2 B;  1ILP A;  3AB9 A;  4IFD H;  1TQO A;  4H7B A;  3HGB A;  2NBF A;  4QUF A;  1PTO H;  3K5L A;  4IQZ A;  3C2P A;  5C3W A;  1J8I A;  4OO1 G;  2K04 A;  1KDB A;  3TME A;  4HCE A;  2A73 B;  3OOC A;  3I8Z A;  1J9O A;  4P2C B;  2JA6 B;  1CQV A;  4RGO S;  1HUN A;  2L4N A;  2DNC A;  2F3V A;  5CV9 A;  2NVX B;  4A3I B;  2NUC A;  1SJE D;  2XRS D;  3VYT A;  4A3J B;  3PUY A;  1AW7 A;  2HDL A;  3VA7 A;  3GTK B;  3PO3 B;  2A6E D;  1PMR A;  4Y7N B;  3SE0 A;  5JEA G;  1WTP A;  3IL8 A;  4NP5 A;  2SNS A;  5D3D A;  5DEH A;  4C1N I;  3Q23 A;  1SNP A;  1TKW B;  4BY7 B;  2Z8L A;  1VF5 C;  1GUS A;  1TII D;  3OMG A;  5I4D A;  3K59 A;  3NK9 A;  1PLF A;  1JWS D;  3MAQ A;  3MTS A;  3SK4 A;  4HED A;  2ZT9 C;  2EE1 A;  1ET6 A;  4RKB A;  2EY2 A;  1Y69 U;  1LT3 D;  3K5N A;  2RKS A;  4X3U A;  3FRP B;  1JOO A;  5I2X A;  3IFT A;  3T13 A;  4J1M A;  1CZW A;  5M5Y B;  2F0N A;  3S16 B;  5JEA J;  2ZXP A;  3NTK A;  4V19 0;  4CGY B;  4RGN A;  1OXS C;  3C1F A;  2F4I A;  4IFD G;  1ZXT A;  1M4V A;  1UEA B;  3MZ5 A;  3A7L A;  1DOM A;  3FPP A;  3K7A B;  3R3O A;  5FLX E;  3QWN A;  2KCC A;  1XTC D;  3HOU B;  1C4Q A;  4WOR A;  4DXG A;  5C6A A;  3EJI A;  1L0Y B;  1QIL A;  5EJW A;  2FHT A;  3K58 A;  3A8I E;  3KLS X;  5KYI A;  5EGT A;  4J8Q A;  4KJO A;  1LLR D;  1Q1B A;  1DD2 A;  5EBD A;  4FF3 A;  3MXU A;  1ILQ A;  2K1B A;  4C56 C;  4C3H B;  3GV3 A;  4DAY A;  2L5T A;  5KIX A;  3EVQ A;  5IGF A;  1SYB A;  3DHQ A;  3X3M A;  4IFD J;  3GO5 A;  3JAM L;  3SK5 A;  3EA6 A;  3BS1 A;  5T1I A;  4RAU C;  2PPB C;  4QIW B;  2A74 C;  1BUV T;  1CFM A;  3D6C A;  2L1B A;  3G6J B;  3DWQ A;  1LTR D;  3S1Q B;  3I4L A;  3FKI B;  5DM7 3;  3GTM B;  1E2Z A;  1G29 1;  2LMC B;  1A3V A;  2IL8 A;  3FMC A;  1BBX C;  1EFI D;  4DA2 A;  1CK1 A;  1WTR A;  4ZUJ A;  1Z6H A;  1R9T B;  3H91 A;  3I4M B;  3D8G A;  3BVZ A;  2A69 C;  1I4G A;  5IT9 L;  1PRT F;  1HXY D;  1STG A;  1DON A;  2K5W A;  1Y1W B;  1SJH D;  2CVR A;  1G8Z D;  1TS3 A;  1NR2 A;  2F0O A;  1KLG D;  3BYY B;  5FK9 C;  3QJY A;  1NUC A;  1NSN S;  4H13 C;  2IPK D;  1F77 A;  3OMC A;  1SNQ A;  2B2U A;  2CW0 D;  3FVQ A;  1DOK A;  4L6T B;  4O42 A;  1I4Q A;  2JEB I;  1BXT A;  3HOW B;  4ZLT F;  1ET9 A;  2PZW A;  4C3I B;  3URY A;  1IL8 A;  1OXT A;  1EY7 A;  1MI2 A;  1ZEQ X;  1R4Q B;  4JBW A;  1EQT A;  1II3 A;  5M5X B;  4JK1 C;  3W3A A;  5E4W C;  1DOL A;  2WP8 J;  1SMY C;  1STN A;  2VB2 X;  4N9T A;  3VYU A;  1TWF B;  4KHZ A;  1SE3 A;  2IW3 A;  4XYQ A;  1SE2 A;  1TWC B;  2EYL A;  4DK1 A;  4IUQ A;  1B53 A;  1LT4 D;  4KV6 A;  2E2I B;  2QIL A;  1WD0 A;  3S1N B;  5M3M B;  1YNN C;  2JSO A;  5ELE A;  3D4W A;  4ULL A;  1KNA A;  5I6W A;  3V2T A;  4XTC S;  2EDG A;  3BG3 A;  3SHL A;  5I9O A;  4O1N A;  2BA0 A;  1F2L A;  3HG9 A;  5M3F B;  1IHZ A;  1ZYR C;  1F9Q A;  4RCN A;  3Q6S A;  2KHS A;  3GTG B;  3FPU B;  1F2M A;  1BQQ T;  3C1E A;  3EFX D;  4IUR A;  4OIK A;  3DUZ A;  1FD7 D;  5CBA E;  4WFN 3;  5JPN C;  1T5E A;  2Z4H A;  3M4O B;  3M3Y B;  5JVG 3;  1D2B A;  2F0T A;  2JEA I;  1QE6 A;  2FMC A;  2ICI A;  1F2Y A;  2YYZ A;  1EY9 A;  2WII B;  4H44 C;  5EBC A;  3M7G A;  1BDO A;  3RZO B;  3AU7 A;  4PV1 C;  2KED A;  3GQB A;  4KMU C;  2K32 A;  2DNE A;  4DN4 M;  2ZXO A;  4RHS A;  1WTV A;  2B39 A;  5A2Q E;  2ICE C;  2RA4 A;  1A6X A;  4A3B B;  4BA1 I;  3ERO A;  2B2U C;  5D14 A;  2L12 A;  1CZG A;  5D65 A;  3A7A B;  4OIJ A;  5CGK A;  4BS9 A;  3S15 B;  4RH6 A;  2BDO A;  1TWH B;  2J7Z A;  4HR7 B;  2EYO A;  1JWU D;  1GUN A;  2F0S A;  2OT2 A;  4KKS A;  4TRD A;  3IFD A;  5A35 A;  1EYD A;  1PTO B;  3OWF A;  3L9A X;  2M9V A;  1QCB D;  3M85 A;  4NKL A;  1H9S B;  3L7Z C;  4TSS A;  2EYJ A;  1E2V A;  5LHY 1;  1EEF D;  4XIG S;  5EQ0 A;  5EPK A;  1MBY A;  5ELD A;  2F0W A;  1PFB A;  1GUT A;  4K5W A;  3NBI A;  4RCO A;  3S1R B;  4UAI A;  1YNJ D;  1B1Z A;  3GTQ B;  3Q24 A;  1LTS D;  1PRT C;  3M4Y A;  3I73 A;  3G7L A;  1ZYR D;  3AMU A;  5F2D A;  4XYO A;  1GHJ A;  1KDC A;  4G4K A;  1STB A;  2FFK B;  5KRU A;  4C3H G;  2HCI A;  3NWT A;  1KAA A;  3MFG A;  4Q0F A;  1GOZ A;  2EVB A;  1K8O A;  4HN7 A;  3RLF A;  3GTJ B;  1SYC A;  1D5Z C;  3PIO 3;  1ONL A;  4FXD A;  1DM0 B;  4FF1 A;  2L0C A;  1JB3 A;  1U9R A;  1HTP A;  2Z1C A;  4QB4 A;  1NR4 A;  2B2W A;  2D9U A;  2QDB A;  1GUO A;  1TS2 A;  3MFY A;  1Y8O B;  3S17 B;  2F0Q A;  5HGT A;  1BCP F;  3X3N A;  3CQZ B;  1O80 A;  5EPL A;  5FOB B;  4RWS C;  4ABN A;  4KHV A;  4ME5 A;  1HFN A;  1G2T A;  4B08 A;  3J81 E;  3HOV B;  2N88 A;  5JPM C;  2X6G A;  3TP8 A;  4FVM A;  1B4O A;  5C0X H;  4DK0 A;  4ILW A;  4CKC A;  2ENB A;  2F03 A;  1LTA D;  1SNM A;  3TDQ A;  1IKM A;  3MA2 B;  3H0G B;  4R8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...