3P75A

Crystal structure of staphylococcal nuclease variant delta+phs v104d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALDRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3p75A00
2OEOA 2F0SA 3DHQA 4KHVA 1IHZA 3QB3A 5JOBA 4B9WA 2F0OA 3OMGA 4LAAA 5KYIA 1A2UA 3ERQA 3OMCA 3SXHA 3TP6A 2F3WA 3PMFA 4DF7A 5EKLA 4EVOA 1NSNS 2EY1A 5F2DA 2HQEA 1RKNA 1SYCA 3NP8A 4H7BA 4ZUIA 3EJIA 5ISRA 5C3WA 4K5XA 3NUCA 3H6MA 3SK6A 5IOCA 4IZ8A 2ENBA 3OSOA 2F0KA 5J22A 3D4WA 4KTAA 2F0TA 2SNMA 4KV6A 1KDBA 2M00A 2PZUA 4YIJA 4ZQ3A 4E6IA 5IGDA 4WORA 3ITPA 4NDXA 3EROA 4HTHA 4J6HA 4DGZA 3RUZA 3TMEA 1SYGA 4QB4A 1STHA 5HGTA 1EY6A 1STGA 2RDFA 2SOBA 3MXPA 4K8IA 4NP5A 2F0NA 2EY6A 1SYEA 5CR3A 3MVVA 4N9PA 1F2ZA 1A2TA 1STNA 3TP8A 4EQNA 5IGEA 3NK9A 5M9OA 5CC4A 4J1MA 4KY5A 5CV6A 4DFAA 4K2LA 3EVQA 1TR5A 5IGBA 2KHSA 4PMCA 5JAVA 4WRDA 2EYLA 1SYFA 2WACA 5IGCA 1EYDA 2PW7A 1F2MA 5IGFA 3MZ5A 3BDLA 1JOQA 2F0FA 3NQTA 3U9OA 1F2YA 5C4ZA 1SNCA 2EY2A 3SHLA 2EYOA 3SK4A 2F0MA 5E1FA 2F0WA 4G57A 2F0HA 1ENAA 3SR1A 3C1FA 3OWFA 3S9WA 4HMIA 4F8MA 4RKLA 2O4XA 1EQVA 4ODGA 4B9XA 4MIUA 2EYFA 2KQ3A 1KDAA 2PQEA 3MHBA 5DAUA 5NUCA 5I6YA 5CV9A 5I9PA 2PYKA 4ZUJA 1KDCA 5E3FA 2F0EA 1II3A 2F0VA 3QOLA 5HURA 3TP7A 1EYAA 4K6DA 1EY0A 1EY4A 3T16A 2F0QA 2F0JA 2SNSA 4F7XA 4K14A 1EYCA 1SNQA 3LX0A 5C6AA 1A3TA 5I6WA 1KABA 3QOJA 4K2KA 5C5MA 4ID6A 2PW5A 3V2TA 3MEHA 5DEHA 4HMJA 5IODA 4EQPA 4QF4A 5C4HA 1TT2A 2F0GA 1SNOA 1STYA 1SYBA 1JOOA 4N9TA 2PZTA 3D8GA 1STAA 5C5LA 4K5WA 1SNPA 4RKBA 5CGKA 1KAAA 4KD4A 4NMZA 5KIXA 4ME5A 3SK5A 4IUNA 5J39A 1NUCA 4OL7A 3D6CA 1A3VA 1TQOA 4KJNA 5CV5A 3TP5A 5KGUA 2EYJA 1EY8A 3E5SA 1SNDA 5EGTA 2F0UA 2F0IA 3D4DA 4TRDA 4K5VA 5IIFA 1U9RA 3R3OA 2F3VA 3P1HA 4KY6A 2OXPA 3T13A 1EZ6A 1EY9A 3DMUA 4NKLA 5CV8A 5KYLA 2EY5A 4S3SA 2F0PA 4I65A 2NUCA 3NXWA 4KY7A 5CV7A 4DU9A 1SYDA 4R8NA 3VA5A 2EYPA 4PMBA 4EQOA 4KJOA 3HZXA 1EZ8A 1JORA 3NHHA 2F0DA 2LKVA 3C1EA 1SNMA 2RKSA 2OF1A 4QMGA 2EXZA 4KD3A 3HEJA 4K8JA 4PNYA 4IALA 5CV4A 2RBMA 3SK8A 1JOKA 5C3XA 1EY7A 5J1ZA 1ENCA 5KEEA 5IGGA 1AEXA 2QDBA 1EY5A 2PZWA 5EKKA 5I9OA 5KRUA 1STBA 3P75A 3BDCA 1A3UA 2F0LA 5K5PA 2EYHA 2EYMA
chains in the Genus database with same CATH superfamily
3ER0A 4GS3A 3DWQA 2A74C 2QEJC 4RFBA 5FJ8G 4DF7A 5M5WH 1ILPA 4NW2A 4EGVA 2B2WC 3EJIA 1VQLA 1ESRA 3IFDA 1HTPA 3DM1A 1T5XD 3AQQA 1BNZA 3HOYH 1YHAA 5LMNL 3CKIB 4KV6A 2F1MA 4ZQ3A 4JBMA 3TN2A 4DGZA 4GLXA 1BR9A 2NN6G 3U58A 3CD6A 4LNQA 5IGEA 3RR5A 4POFA 2KHSA 3GTJB 5FO8B 3S1NB 1MD2D 2IPKD 2R92B 4L8JA 1EIFA 1LABA 5C3EG 1F9SA 2XWJB 1VS0A 2HCIA 1WTPA 1O78A 2EJGC 2K6AA 3SDZA 2RHSB 2N88A 4HJ5A 1VQ7A 2KCMA 1FR3A 3W5OA 1S3OA 3S9WA 5HGQA 1KQSA 3KBXA 2F03A 1BBUA 3ND8A 3PO2H 3HOVB 3M4OB 1JE5A 1F9RA 1JE4A 2EZVA 3HOXG 1NTGA 3QG1A 5C0XH 3KFUA 2NVTH 4LMQD 5C6AA 1NY4A 2EE1A 4JI8Q 3K6OA 4JI0Q 3H3VC 1AE2A 3L0OA 2F0GA 1SNOA 3CC7A 1TWHB 2OT2A 3M85A 1YNJD 3AFPA 1PZKD 4C3HB 2Z6KC 5M5XH 1GKHA 4C2MB 1JR0D 4JI3L 2NVXB 1D1IA 1PA6A 3OIQA 2PNRC 5DLQE 3I4NG 1DYQA 4DUYQ 2ZT9C 1K73C 2E75C 2A19A 1PYWD 2NUCA 5BR8Q 3D0FA 1SYDA 3U9SA 3VYUA 1FNVA 2F0DA 2OF1A 3H0GG 4IALA 1Y1WB 3RLOA 2AUKA 4I7AA 3G6EA 5G3LD 3U4VA 1ENCA 4P2CB 1ICWA 1XTCD 2KJXA 4IURA 4FDBA 4DNTB 1ICFB 1VQJA 2F0OA 3OMGA 5KYIA 4DNRB 1SE3A 3PMFA 3CMEA 2EY1A 2VS1A 2HQEA 3MXGA 4H7BA 2AQ1B 1CZWA 1R4PB 1VQCA 3FDTA 1PFMA 4R9WA 3NEMA 3R8BA 4FXGC 5C44B 3A54A 3LWEA 1LTGD 3PUYA 4LF9Q 4J6HA 2NZOA 3IL8A 2FINB 2Q2HA 2SOBA 4NP5A 1Q81C 2PI2A 2XGTA 3K57A 2JEBI 4X62L 1PYSB 1ET9A 3RZDH 2CQAA 4GLVB 5AJ3L 5JAVA 2B2YC 4POGA 1S4ZA 1HRJA 1X3QA 1BCPB 3FKIB 3RD4A 5KNCA 2QA4A 2MGSA 3KDFB 2DUDA 4K6LA 1CKOA 1GUWA 3TS2A 2K5VA 2WKCA 3MHBA 3CMAA 4H0LC 1BQQT 4JI5Q 2AUJD 3SVMA 3M4PA 4BY1G 2F0EA 5EPKA 4JI8L 3HG9A 4IFDG 4JYAQ 4K6DA 4JI0L 1DONA 1FNUA 2F0QA 1A3TA 4J8QA 1G6PA 1KABA 3T4AC 1BUVT 2R7FA 5GAGC 1LYLA 1EQTA 4N9TA 5K36G 5H1SE 4DXGA 2WB1E 2Y0SE 2AMCB 1I5FA 2F4VQ 2NB0A 1GD7A 1YHBA 3D6CA 2R93B 3OPOA 4FF1A 2D9UA 1TWCH 3KF8B 5BR8L 3R3OA 5JPMC 5IYBG 5IYCH 1B44D 2E2HH 1EY9A 2QKIC 1HR0W 1PTOB 2KVMA 5FLXL 1Z7TA 2F0PA 1SMXA 1WD1A 2BCOA 4H44C 4OO1G 1L0WA 1EWCA 1EZ8A 1JORA 5IT9c 3VDYA 1WYDA 4KD3A 3OTOQ 2R7ZB 3SK8A 4DNIA 1WOCA 1X3PA 1EY5A 2X69A 2EJMA 3I8ZA 3PIPA 3EQLC 1L0YB 4CJ2C 2JA8B 1JJCB 4FXDA 4EQ5A 3MFGA 4LF7Q 3P7JA 4N8FA 3CPWA 2Q2UA 1PHJA 4A3KB 4GNXC 2HUGA 3S2DH 3H6MA 2FMCA 2F0KA 1JWUD 4LF9L 4FXKC 1AN8A 4IFDJ 3G71A 5IGDA 1HNWQ 3ULPA 1OTCA 4A3IB 2ID0A 5KNBA 3UE1A 4QB4A 5IYDH 1PH5A 3GTQH 4DAPA 2A73B 1UE6A 4B3MQ 4CDDC 1PH3A 3HOZB 3NBHA 1MSGA 3AU7A 2NBFA 1WCMH 4QUFA 3MZ5A 5CBEE 3BG3A 2VL6A 4R4QA 4XQNA 1Q90A 4GN4B 4MN3A 2RCFA 1Q7YC 1K3BC 1EQRA 4JYAL 1SFOB 3HKZE 1PVOA 3S16B 1Z9FA 3I2ZA 4DV2Q 1D5MC 1EOVA 2E2DC 1VF7A 1SEBD 1KRTA 4L5SA 4FNFA 3EIVA 3FVQA 2EQSA 1JCKB 1I4XA 4A3GG 2ZTCA 3BVZA 2NVYH 2ZM6L 3K81C 3RZOH 4GKJL 2AWOA 1AH9A 1EWHA 3MFYA 2F4VL 2JP1A 3FMCA 2G9DA 1JOOA 4A3JG 2V1CC 4MTNA 4HAEA 1HNZQ 3NTIA 2BA0A 1CSQA 5FK9C 3TQYA 2JN4A 3S1RB 2VNUD 1DOLA 5IP7G 3I90A 4IPGA 2E74C 4HR7B 3OTOL 3K5MA 4RGNA 3I4MB 1IL8A 2E5LQ 1EWIA 4OELB 5ELNA 1CA5A 3L3OC 1QVFA 3S1MH 1G2TA 3JAMi 1A15A 3A5ZB 4OWTB 4PZ7A 1MHWC 2SDFA 5C0XJ 3STBD 4A3LH 1V8QA 4OHJA 3GTLH 1E1TA 4JC0A 3WDNA 1PRTF 1A0IA 4DV3Q 4DAYA 1ZEQX 3KF6B 2UUAL 3NPPA 1KIXA 2KEEA 2SEBD 2PCFB 4IZ8A 2ENBA 4BS9A 3PIP3 2F0TA 1KDBA 3GTMH 2M00A 1PH6A 1V1PB 3ITPA 4X3UA 2A1AA 1A63A 5A2QE 1QILA 4IUUA 2VB3X 4A3EB 2AKWB 2OTLA 5FO7B 3NK9A 3JC66 1PRTD 1TS5A 4GN3B 5CV6A 4U673 3MXNB 1KL9A 4WRDA 4DUZQ 2PQAB 1HFNA 2RQXA 1EYDA 1F2MA 5C3EB 1JOQA 1J6QA 2VUMH 2O5IC 1EUJA 1RD9D 1L1OB 1VDZA 4QIWB 1OXTA 3R2IA 3QOLA 3RLNA 3HOXB 1I3QH 2KENA 4JOIA 5IYCG 5LMUL 4DV5Q 2JA7G 5EBCA 3S14H 1ML0D 5I6WA 3FHWA 3QOJA 4YCUA 4QQBX 1LM0A 1RODA 4LUOA 2HIVA 1LTLA 2JA9A 3J81i 3T53B 4JI6L 4FVMA 1IYVA 3QO2A 2EPBA 3KBGA 1IKLA 5KIXA 3KLRA 4DR5Q 4JW0A 1UWVA 4X66L 4XYQA 2EIFA 4KJNA 1QUQA 3I4NB 1HUMA 3RN2A 1STEA 2E5LL 2OXPA 3ULLA 4NKLA 2RDHA 1PFNA 5M5YB 2AQ3B 3KOJA 1E2ZA 3TZDA 2YYZA 4KY7A 1NCVA 3GTPB 3BVMA 1J5EQ 1XNRQ 1MI2A 3EN2A 1YEZA 1J9OA 1FVIA 3Q8DA 1SBBB 5CMDA 2RCNA 1CZGA 2DY8A 2MO1A 2KHIA 5C4JH 4DV3L 1PH4A 1NR2A 1IKMA 4LW1A 5IYDG 4ZK9B 1R4QB 3GTKH 1Y1VH 1LTTD 3GP7A 3PCOB 4EVOA 2KUMA 2ATWA 4A3MH 5F2DA 1VQHA 1I6HH 2K5HA 3OOCA 4RGTA 3NUCA 1WCMG 3G6JB 3GO5A 4EX5A 3M3YH 3G4SA 1XNQL 3KLSA 2LS01 3A56A 2B3GA 1PLFA 2LXKA 5GQOA 4B3SQ 1M90C 2ICIA 2KECA 4ULLA 2MQHA 4XDXA 2IL8A 1WTRA 1S40A 4FF4A 1D2BA 4BBRH 2G9HD 2O5JC 4OWWB 3LGJA 3OW7A 1XPUA 4DFAA 3EVQA 5IGBA 3E0EA 5IP9H 4DR6Q 2H5XA 1G291 3HOWH 2IX1A 1SMYD 2A6EC 4BY7G 5I2XA 1RIPA 2OCEA 2PPBC 1CKNB 2XIWA 4XT1B 2L55A 5EPLA 4BXXG 2O4XA 2CWAA 2OQKA 2EYFA 2VQEL 4DV5L 1HUNA 3F2UA 3GTGH 3DUZA 4RG1A 4A3FH 5JEAH 5M3FH 3M9BA 2OWOA 1EYCA 1TWFB 1ZYRD 1DCZA 1JICA 2WINB 4X64Q 1A6XA 1QE6A 1RCVD 3NSWA 5GAHC 2HCCA 1EFWA 4OGQC 5IE8A 3DLLA 3HGBA 1U9RA 1E22A 2F3VA 2ZXPA 4ME3A 4DR1Q 1J5EL 2B63G 2IW3A 2XSCA 3I4LA 2IWHA 1GHKA 3K80C 1IYUA 1W6KA 4JI4Q 2VY3A 1VQ8A 3VR3A 3DEPA 4KHPQ 4H13C 2E2IH 3OHXC 1HZAA 4AYBB 1Q46A 3AMUA 1STBA 2GN5A 4OEMB 5EJWA 2OEOA 2LMCB 2QW7A 1EU3A 1QWYA 1YNXA 4F87A 4BA2I 4ZUIA 4DK0A 1K9MC 2DN8A 4HIDA 4JI7Q 4A3CH 4L5QA 1N32L 5EQ0A 2SNMA 5ELFA 2VUMG 4KKUA 3CCVA 3D4RA 3STBC 2Q8TA 3T1HQ 4WORA 1VQBA 1C0AA 1W3SA 3JAML 1N9WA 3Q24A 2IHFA 1BBWA 3J80E 5IWAQ 5HGTA 1EY6A 2RDFA 4CDEC 4DR6L 3M4YA 1NMGA 3BZKA 1Q86C 2WKDA 5ELEA 3I3CA 5M9OA 1P16A 3J7A5 4L6TB 1SN8A 2DNCA 1WD0A 4C3IH 1KNEA 3A7AB 2N49A 3N52A 1HCZA 5IGFA 3CQZB 3ERSX 4CGYB 3JAMc 4DV7Q 1F2YA 2TMPA 4RGOS 1K8MA 1EQQA 3MEFA 3VR2A 4LFAL 1S5CD 3G7LA 2NN6I 1ASZA 4ODGA 4R4TA 1PRTC 4KN7C 1AE3A 2Z1CA 3VYSA 5CBAE 5I9PA 2Q2IA 4GNXB 4QIWE 5HURA 3A8JE 4RHRA 4OX9Q 3DEOA 4DPGA 4TQUS 2NTTA 4A3GB 1IZ6A 1GO3E 1HJPA 1HPCA 2SNSA 3UI2A 3E9HA 1XPRA 4K2KA 1EL0A 1TWAH 4HMJA 3GTOB 4EQPA 1N36L 4A3JB 2JEAI 1STYA 1Z47A 4DAMA 1V43A 1SLJA 4KD4A 4NMZA 3S2HH 2OTJA 4DR1L 1B3AA 1TU2B 2P5ZX 5D3IB 2UXBQ 2R61A 2UXDQ 3TP5A 4JI2Q 3D6WA 4K5VA 1SE2A 1VF5C 3HOUH 3WOEA 1EZ6A 5EBDA 1CFMA 3K59A 2IX0A 2B2UA 3B6YA 4L5TA 1LLRD 1DOMA 1EEID 2EDGA 4EQOA 2ZJQA 3NHHA 1H9SB 1LTAD 1P8LA 4BBSG 2EXZA 3J81L 1O80A 1EY7A 2I5HA 5G3LF 4C3JH 3KDFA 3CU7A 5DNFA 1WTOA 3CP0A 1X55A 4LFBQ 3S15B 4DR4Q 1VQNA 1UE1A 4HSPA 2L5TA 3KYHC 5JOBA 4AQYQ 2L1BA 3ERQA 2UUCQ 1W2BA 2O2LD 2F3WA 1K8AC 2C5CA 2XWBB 2E76C 3J81c 5IP9G 3IFTA 1SJED 5C3WA 2F52A 3T1HL 2CKZB 2F4IA 1UEAB 3D4WA 4KTAA 1WTWA 3KK7A 5IWAL 4NDXA 1B53A 1O7YA 1S5ED 3TMEA 1LO5D 3PO3G 2A8VA 1OXXK 3MXPA 2ASBA 1CQFA 1TS3A 1DGSA 5C4XB 2J7ZA 5CR3A 1SJHD 2DY7A 4EQNA 1F2ZA 1K28A 3KF8A 1XTDA 2XRQD 3EFXD 3GTJH 2JA6G 4DV7L 1NNXA 3S1NH 2R92H 5M3FG 1IL2A 2PW7A 1K3RA 1KNAA 3BDLA 3SHLA 3A74A 2F0MA 1PFBA 4G57A 3J7YW 1PZID 2WAQB 4KLKA 1MGSA 2XVSA 1RTOA 2A69D 3HOVH 2D0OA 3M4OH 1B9MA 1LV9A 1DM0B 2LY7A 2ZXOA 1SMYC 1UEBA 3EA6A 3T16A 4X3SA 2JA7B 4A3DG 3PUXA 5GADC 3LWUA 4IUVA 2I5MX 3ZJYC 1S5FD 1KRSA 3R93A 3SGIA 1TWHH 1X56A 2KCTA 3DM3A 4QF4A 2UXBL 1RDPD 1SYBA 3NQIA 4XIGS 4C3HH 5IT9E 4C2MH 1EU4A 1WTHA 4JI2L 4QJFA 3BZDB 4MZ9A 1CM9A 2NVXH 1U4MA 3NENA 3FP9A 2R6GA 4DAVA 1SNDA 1ZYRC 3KUPA 4A75A 2KOLA 1GOZA 3Q0AA 1T5EA 5E4XA 1PDQA 1FL0A 2B8FA 3F2BA 4N8X1 2ES2A 2ZTEA 5M3MG 1I50B 3UDFA 4R8NA 4A3BG 1SE8A 2VQFQ 2K5QA 1HFGA 2XTIA 1Y1WH 4A93G 4LFBL 1JQYD 2CH4W 2N55A 3W1BA 3I56A 1KAWA 4JBWA 2VW9A 4DUYL 3P75A 5JEAJ 4AYBE 1ONLA 4KK7A 3BJUA 1QVCA 3PGZA 4NXNQ 4KKTA 4JI1Q 4DV4Q 4OO1I 2D5DA 5CORA 5EKLA 5DM73 2HDLA 1WCMB 3VYRA 3AFQA 1VQ5A 2JYOA 2L9HA 4GKKQ 2YU9B 5C44H 3RLFA 1AFPA 3HOYG 5EAYA 2A6HC 3EROA 3I73A 1D1KA 4NXMQ 4PMWA 1STHA 3CCMA 1WJJA 1E2WA 2A68D 5FLXc 2IY5B 4R4CA 3HS0C 5ELBA 4FYDA 1VQEA 3IKJA 1X9NA 1UNSA 4Y7NB 4PV1C 4BY7B 3FKIH 3NQTA 2CHBD 3K8AA 1SNCA 4LFCQ 3BS1A 2EYOA 1IBLQ 1B7YB 4PZ8A 1LT4D 1BKBA 4IJHA 1G91A 2HIXA 1LTBD 3T1YQ 2ZTDA 1D5XC 1YIJA 1EYAA 5JPNC 3PO2G 3NBIA 4GN5A 3TRZA 5C0XG 3KF6A 1BO0A 1U4LA 2H4OA 4OIKA 2MFIA 2UU9Q 3S1QB 4JI5L 4UAIA 4R4OA 2H1EA 1V1PA 2R93H 4CJ1B 4XXEA 3AEVA 4C3JG 5EGTA 2PMZB 1EYGA 2B63B 3D3RA 1PTOH 2VQFL 1F9QA 3MXNA 4IPHA 4CJ0B 3NXWA 4OWXB 1YHQA 2KA7A 2R7ZH 4YWLA 1V1OA 4K8JA 4DV1Q 1L1OA 4OONA 4HIKA 4NXNL 4DV4L 2NYZD 1SROA 1HA5A 1OXSC 2JA8H 1HHVA 1X54A 2EYMA 4DV0Q 4PZ6A 3M7GA 5T1GA 3F2DA 3PV0A 2HDMA 3Q23A 2V4DA 1H9JA 4A3KH 2KCNA 4B3TQ 5ISRA 2ICEC 1SE4A 1FJGQ 5FO9B 1YNJC 1HR0Q 4NXML 3VA7A 1JB3A 1JWSD 3HKZG 4A3IH 1LTSD 2QF7A 1OXUA 4MTKA 2K04A 1SYGA 4LF7L 3MC0B 3HOVG 4JK1C 4KHZA 3HOZH 1K83B 1W6JA 1STNA 3M7NA 3DWAA 4X6AH 2B2VA 1VQPA 5CC4A 4G7OC 4LF6Q 4HIMA 4LFCL 4XTCS 4A76A 2K01A 4C1NK 2M9VA 2Z4IA 2Q8IB 4YCWA 1UUPA 1WTXA 5IGCA 1HNWL 2B39A 1RF2D 2J4XA 1XJVA 1EFID 2EJFC 2GVBA 1SFOH 1NJIC 3S16H 1DD2A 2F0HA 1ENAA 5D14A 4C3HG 4UDUC 1EQVA 4BWGB 4B3ML 3WWVA 1VQ6A 2WAQE 2L0CA 3CCRA 2F0VA 4XT3B 2QCPX 5LHY1 1KLUD 3UDXA 3TP7A 1E24A 4HJ8A 1QCBD 1VQ9A 2WV6D 5KNDA 2R7DA 1SNQA 3K0XA 2UU9L 2RA4A 5JVH3 1XMOQ 4LF4Q 1RJTA 4TSSA 5GAEC 1HQRD 1M1KC 4APVA 1C48A 2PW5A 4LUZA 1E7ZA 2VB2X 5C4HA 4LF5Q 2A69C 1BDOA 4DV2L 5T1IA 1E2VA 2QGQA 2NWGA 3K7AH 3V05A 3RMHA 2E2JB 3S1RH 3J80i 3CPFA 1EY8A 1QB5D 1VQIA 2K03A 4ZYSA 3ND9A 4A4IA 3DMUA 4MHEA 1Q8IA 3I4MH 1TXYA 1HNZL 2KCCA 4IPCA 3CCLA 4BBSB 2D2CC 1DXMA 5LMNW 4PNYA 3HEJA 3K5OA 4GOPA 3BU2A 1I4RA 5J1ZA 3HKSA 3CCJA 1B8AA 5KRUA 1CQVA 2K33A 3EBEA 5HY6A 5A2QL 4B3TL 5FJ8H 1G8ZD 2HT1A 1F77A 3OMCA 3TP6A 1HR0L 3QIAA 1IBKQ 3H09A 1VQOA 1CSPA 4HIOA 1A8VA 2FMMA 4YHHQ 4IOAA 1N34Q 4FP5D 1IW7D 3H0GB 1MKHA 1TY2A 2NN6H 3PO3B 4LF6L 2B2YA 1KHIA 4A3EH 1VQAA 2MUYA 3OW2A 3CRKC 1SYEA 3J81j 1A2TA 3CCQA 4J1MA 2JA6B 4K2LA 1R9TH 1CI3M 3GV6A 4HEDA 4PMCA 5C3EH 4NPSA 2ZJPA 1C9OA 1GVPA 5LL6X 2ZJRA 3U9OA 1HZ9A 3NWTA 4P73A 3A8IE 2HQLA 3KLSX 4DV6Q 2A68C 1L2FA 1QNKA 4YWKA 2K50A 1LUZA 5K5PA 1KDAA 2MP1A 1L0XB 3HOXH 3I7FA 4R8IA 3Q22A 1XMOL 1QVGA 4KMUC 4DUZL 4ZRZA 3F2CA 1EY0A 4A3DB 2B8GA 3OYYA 5GROA 4K14A 4LF5L 3LX0A 1N8RC 3CHBD 2QILA 4DA2A 4X65Q 1DOKA 3HP3A 4O42A 3MA2B 4JVZA 3FPUB 1TT2A 1XPOA 1TVXA 3UDIA 1LACA 5C5LA 4K5WA 3CCUA 4UY8C 1YVCA 1NUCA 3E6ZX 3I4NH 4R4IA 1PXUA 2K4KA 1TQOA 4BY1B 2F0IA 1TWGB 2PMZE 5M5YH 2MHVA 4HJAA 2K5WA 3GTPH 3T56B 4B08A 4LJZC 5M3MB 5JJLA 1C7YA 1IXRA 4A3BB 3VA5A 5D65A 3L2PA 2NVQB 2RF4A 1OO9B 4YWMA 4A93B 2B29A 1EOTA 4WJWA 4DR5L 1ILQA 2LKVA 4QMGA 4FF2A 3S17B 4ZKBB 3K5NA 3VYTA 1Y8PB 3U4ZA 4KN4C 4FO2A 5IGGA 5LMNQ 2PZWA 1QUQB 2Z8LA 4CKBA 5BN3A 4GNXA 3E0JA 2B2TA 2K05A 3TREA 1Y8NB 4A3LG 1PH8A 1HZBA 4YHHL 4OXPA 4XQJA 1TKWB 1YBYA 1XNRL 5M5WB 4YCVA 1XMQQ 3ULJA 5IOCA 3OSOA 5E4WC 1IBMQ 3JAME 1Q82C 4UPAA 3PUWA 3HOYB 2JE6I 1CHPD 3WOFA 2J0TD 5EKIA 4U68A 2N8NA 1ZXTA 2JA5H 2C9OA 2IJ0A 3DWPA 4HJ7A 1TR5A 3E3XA 1D8LA 3O13A 3BDOA 1MBYA 4B3SL 2K5NA 5C4ZA 1H9SA 3SK4A 4UHVA 2YTVA 5E1FA 2R3ZA 1SAPA 4B9XA 1JB7A 1QNUA 2KQ3A 2PYKA 1CTMA 4I7ZC 3PO2B 1F2LA 1RHPA 1EY4A 1TWFH 1B4OA 5I4DA 1PFSA 2CWPA 3RN5A 2NVTB 3I4MG 4C1NI 3A5UA 1YJ9A 4QL5A 4CHTB 5K36H 1YITA 3E9IA 3TDQA 3NTHA 2PZTA 2KHJA 1QZHA 3BYTB 2QDLA 2MO0A 1KAAA 1LT3D 4ME5A 4IUNA 1HZCA 5M5XB 2IX3A 1WTVA 5IYBH 1JT8A 3D4DA 4X3KA 4PG3A 1O7LA 1L1OC 2GVAA 3PF5A 4X64L 4OO1H 5CV8A 2D0PA 4KKSA 1BF4A 2HHHQ 4Q5VA 4XQQA 4QUCA 3V96A 3J81E 1B70B 1JC7A 2CH4A 1XYIA 3ONAB 1S72A 2K7VA 1GUGA 3BYYB 1CK1A 1JJGA 2JXMB 1K0SA 1I6VC 1VMPA 3U50C 3DXJC 1SSOA 2EYHA 3J80L 4A3EG 1O7ZA 3DHQA 1XMQL 1YJWA 2K5DA 3SEBA 4JI4L 1B1ZA 4ZCKA 1IBML 1Y1VG 2G5DA 4YY3Q 4X62Q 3NP8A 4JCVE 4KI0A 4K5XA 1DJRD 1VMCA 1KTKA 4A3MG 3CC2A 4KHPL 2B2VC 4P71A 5AJ3Q 2CFMA 3HKZB 2PZUA 3J80c 2UUBQ 4ALPA 1STGA 4GLAC 2F0NA 2DJFC 4N9PA 3C46A 1H9RA 4BBRG 1FD7D 1AZPA 2YV5A 1LTRD 4JI7L 1IW7C 3RZDB 1SYFA 1SDFA 3CQZH 1CKMA 1WI5A 1A62A 3F8TA 1GUSA 2F0FA 3HOWG 5A35A 2EY2A 1X3EA 1VQ4A 4TVAB 4IJLA 4V0BA 4RCNA 1X3GA 2EVBA 5IY0A 1SXTA 4MIUA 4G7HC 3H3VI 3GQBA 3G48A 4ZUJA 1G6ZA 4C56C 1I4GA 4A3GH 2FHTA 1K8OA 1PV4A 1PYBA 1AZQA 5JJIA 1BCPF 4A3FG 4M1UB 5JEAG 1CHQD 2TSSA 3GTOH 1Z6HA 4IO9A 4A3JH 1NMFA 2K75A 3MAQA 1WVLA 4IOCA 4JOIC 1QG7A 2C35B 3A0JA 2RDGA 4OX9L 5J39A 1NE3A 5IP7H 5CV5A 4RMFA 2EYJA 3E5SA 4GOPC 2HHHL 4KY6A 2JJQA 1TWCB 3PQIA 1YNND 4XYOA 2Z4HA 5JJZA 2E2HB 1BCPD 5CV7A 4MNOA 1XXGA 4PMBA 3A8KE 1G51A 3J7ZC 3C2PA 2VZAA 1SNMA 2RKSA 1C4QA 2UXDL 3GV3A 5KEEA 3HRZC 2NTSA 3TBIB 2QDBA 3S15H 4IFDI 5EKKA 2WP8J 2LFNA 4JG2A 2AWNA 1BXTA 2F0LA 1PTOF 4YY3L 3RNUA 4B9WA 1KXLA 1C8CA 2JA5G 5FLXE 1Q1EA 1N33Q 3VR4A 2UUBL 3KJPA 5J22A 3S2DB 1U5KA 1RL2A 4YIJA 4A3CG 2QEXA 1Q1BA 4DR4L 4IUQA 2DNEA 3RUZA 1ASYA 1I4HA 2GA4B 1FNWA 5C4XH 4AQYL 4Y52H 1QJOA 3TSSA 2FJ2A 2UUCL 1H95A 2EY6A 1HNXQ 3GTQB 1PTOD 3MVVA 5ELOA 1HA6A 1FGUA 3TP8A 2OQ0A 2BE5D 4KY5A 2VXWA 1JMCA 5BN5A 4P74A 1H9KA 2WACA 4JV5Q 2MNAA 4C3IG 1FYCA 4ABNA 2WIIB 1WFQA 2ZM6Q 3GD7A 3CW2C 4TKOB 4GKJQ 4AH6A 1UAPA 2IHEA 4G7ZC 5IT9L 4RHSA 2RSNA 3GDEA 5CV9A 1V9PA 4LUVA 5E3FA 1H9MA 2A5HA 2JA7H 1PH7A 2DJGC 2ALYB 4WJ4A 3CCSA 5COYA 4G4KA 2NVYB 2L11A 1HTLD 3RZOB 1MJCA 5JJKA 2HD3A 2RHQB 4P75A 3D8GA 1STAA 2X6LA 4HSVA 2WB1G 4ILWA 1MIUA 2PO4A 2WFWA 2Y0SG 1GUOA 3QWNA 3VR5A 4AYBG 1I4PA 4OL7A 5KGUA 1JWMD 1NR4A 4DXFA 5C0XI 3IRBA 4WFN3 1HQMC 4L63B 5FOBB 2X6GA 2E8GA 1I50H 1O7IA 3HOUG 1MSHA 1VCIA 2EY5A 4S3SA 4HCEA 2LXJA 1TS4A 2B2TC 1KD1C 1Q12A 1E1OA 3LNNA 2NZHA 2I07B 1PMRA 4DR3Q 3C1EA 2UUAQ 2M2LA 5ELCA 1X32A 5CV4A 1BVSA 2A6ED 1AP0A 3S1MB 1XWEA 1N33L 5I9OA 3TEHB 1WTQA 4LWCA 1I4QA 2F0SA 1IHZA 3GTLB 1I94Q 1GXDC 1NSNS 1ZKOA 4JPBW 1D5ZC 2PQAA 1V1QA 2YU9H 1NAPA 2K1BA 1SRUA 4RH6A 1HXYD 1ESFA 1ET6A 1T9HA 3H91A 1HNXL 3CXCA 3GTMB 3K0YA 5CYUA 1UE5A 4K0KQ 4K8IA 3M4QA 2B2WA 4JI1L 3KJOA 4JV5L 1MJEA 3PIOA 2XNAC 4Z9CB 4Y7NH 2K28A 4DR2Q 4BY7H 4GKKL 1OXVA 3FEWX 2R92G 4DK1A 5LMUQ 1BBXC 2BA1A 3OIPA 3X3NA 5DM63 4BXXH 2VUMB 3URYA 2CQOA 1VQGA 3SR1A 4HMIA 2K52A 4M8AA 4RKLA 4CDFC 4F8MA 4JI6Q 3K7AB 2PQEA 1KDCA 2CW0D 1K0RA 2BOSA 4X66Q 2AQ2B 4UP9A 2F0JA 1GUNA 1PH1A 1I3QB 3S14B 1GJXA 1IBLL 3V2TA 1JJ2A 2EXDA 3S1QH 1BOSA 1Y14B 3ICEA 1G2SA 2CCZA 2RSOA 2N78A 3K58A 4QY7A 4RKBA 2LSSA 3T1YL 3UDGA 1CA6A 4IN3A 1A3VA 3W1GA 2B63H 2BH2A 5IIFA 5TSSA 1KC8C 1IYJB 3UE0A 3NBHB 4DR3L 1X6OA 4HN7A 3TS0A 2MJ8A 1KLGD 2Z6KA 3I70A 5BN4A 5ELDA 3VR6A 2L4NA 4DKAC 2Z6BA 4RWSC 2I0QA 2JK8A 4ZLTF 1JOKA 5C3XA 3K7UC 2B2UC 1Y1WG 2CVRA 3P20A 1U4PA 1XNQQ 4F88A 1RTNA 1GM5A 1YNNC 4GZYC 1I94L 3I55A 1A3UA 5C4XG 5C4JB 2IT1A 1BCPC 4AIMA 3C3LA 1EIGA 5I2YA 5FLMH 3GTKB 3SXHA 4V190 3J7AV 2FXQA 1Y1VB 1R9TB 1RKNA 1SYCA 2L12A 4RCOA 4A3MB 4DV1L 1PRTB 1I6HB 3M3YB 4RAUC 4K0KL 1CKNA 5C44G 1Y8OB 2EOTA 3A55A 2WAQG 4DV0L 4HTHA 1QZGA 2BH8A 1K83H 2AHOB 4DR2L 4IQZA 2Z9HA 3CAMA 4BBRB 2VQEQ 2UXCQ 1FJGL 1D7QA 2Z0SA 3L9AX 1U0LA 3PUZA 3HOWB 2K14A 4DN4M 3FKIG 4O2DA 4CKEA 3PIO3 3C1FA 1PTOC 3W2DA 1U4RA 1E0BA 4X3TA 2BE5C 5I6YA 4DK3C 2YTXA 2D62A 4J15A 1II3A 2MPMA 2PNHA 1S5BD 3GTGB 1J8IA 4B3RQ 1VQMA 3NE5B 4DAYB 4F7XA 4A3FB 3L7ZC 4DK6C 5LL6S 1E3PA 5M3FB 4UP7A 1PH2A 3SE0A 3AB9A 1NBWA 3MEHA 1Y69U 2BDOA 4JBKA 4LF8Q 4LK1C 4O1NA 3J7AF 3NELA 4UP8A 3FPPA 1SNPA 1TS2A 2E2JH 3S24A 3W3AA 3SK5A 3K5LA 1EEFD 1CUKA 5JVG3 2R93G 1GHJA 1ENFA 2F0UA 2PI2E 4TRDA 4LF4L 2Q2TA 3MWYW 5FKAC 1S5DD 4WJ3M 2BDNA 4BA1I 5KYLA 1HH2P 3MTSA 3BVGA 1Q8KA 4I65A 4DU9A 4PQXA 4BBSH 1LTID 3HZXA 1VQKA 3MXUA 5L37A 2R7ZG 2XN9C 4O0AA 4IUTA 3F1ZA 1N32Q 4CDCC 4RGMA 2ZXRA 3H94A 3PSIA 2E2IB 1EIHA 3KLWA 3BDCA 2F0WA 1AEXA 2NZ1D 4DR7Q 2JA5B 4HJ9A 4KHVA 3QB3A 4JBJA 1B50A 4LAAA 2JA8G 1A2UA 3OWEB 1DZ1A 1M4VA 3PUVA 2I46A 4ZKCB 4QGUA 1VQDA 3SK6A 4A3KG 4H02A 1YZ6A 2DGYA 2N3SA 3H0GH 4NB3A 4GOPB 4P72A 3ZYYX 5E7NA 3R2TA 4E6IA 4QCLA 3PO3H 1YJNA 3NWSA 4L5RC 4A3IG 4IUPA 2UXCL 3H3VH 1B2TA 4LFAQ 3QJYA 3T51B 1IBKL 2JA6H 1EIYB 1PZJD 1SR3A 3HOZG 1F9PA 2KEDA 2EYLA 1N34L 3QR8A 4C3IB 4CBVA 3FRPB 2JSOA 1FGBD 3NTKA 3PF4A 2FFKB 2F3IA 3OWFA 1N36Q 1X3FA 5NUCA 5DAUA 1LT6D 4B3RL 3CF5A 4A3DH 1B9NA 4IPDA 5EPJA 2RVLA 1AW7A 1M8AA 4LF8L 2YTYA 1X65A 4OIJA 5C5MA 1VQFA 1Q3LA 1CT1D 4ID6A 4RA8A 5DEHA 4ZAIA 4DV6L 1PH9A 5IODA 4Q0FA 3BZCA 1TWAB 2WB1B 3I4OA 3X3MA 3A7LA 2Y0SB 1UE7A 2CW0C 5CGKA 1TY0A 1LT5D 5J3BA 1K8GA 4BY1H 1XX8A 4IFDH 3S2HB 3CCEA 3H15A 3CRLC 3N6RA 2A6HD 3D31A 2KBNA 1TWGH 3HFZB 5D3DA 3P1HA 2K32A 1TIID 3T13A 5M3MH 4X65L 3I91A 3I72A 2JQOA 2XRSD 2L15A 4HCSA 4JI3Q 5FLMG 3HOUB 4A3BH 1GUTA 2NVQH 1D6EC 4CKCA 4A93H 2EYPA 3S17H 4KJOA 3CC4A 1YI2A 1B3QA 1QOHA 2RBMA 3IAYA 4FF3A 4DR7L 3TZUA 5AFWA 3Q6SA 2I5LX 2Q8RE 4R1JA 4C3JB 3AYHB
chains in the Genus database with same CATH topology
3DWQA 2A74C 2QEJC 4RFBA 4DF7A 1ILPA 4NW2A 4EGVA 2B2WC 3EJIA 1ESRA 3IFDA 1HTPA 3DM1A 1T5XD 1BNZA 3CKIB 4KV6A 2F1MA 4ZQ3A 3TN2A 4DGZA 1BR9A 2NN6G 5IGEA 2KHSA 3GTJB 5FO8B 3S1NB 1MD2D 2IPKD 2R92B 4L8JA 1LABA 1F9SA 2XWJB 2HCIA 1WTPA 1O78A 2EJGC 2K6AA 3SDZA 2N88A 1FR3A 3S9WA 3KBXA 2F03A 3ND8A 3HOVB 3M4OB 1F9RA 1JE4A 2EZVA 3QG1A 5C0XH 4LMQD 5C6AA 2EE1A 3K6OA 3H3VC 2F0GA 1SNOA 1TWHB 2OT2A 3M85A 1YNJD 1PZKD 4C3HB 4C2MB 1JR0D 2NVXB 1D1IA 3OIQA 2PNRC 1DYQA 2ZT9C 2E75C 1PYWD 2NUCA 1SYDA 3U9SA 3VYUA 1FNVA 2F0DA 2OF1A 4IALA 1Y1WB 2AUKA 5G3LD 1ENCA 4P2CB 1ICWA 1XTCD 2KJXA 4IURA 4DNTB 2F0OA 3OMGA 5KYIA 4DNRB 1SE3A 3PMFA 2EY1A 3MXGA 2HQEA 4H7BA 2AQ1B 1CZWA 1R4PB 3FDTA 1PFMA 4R9WA 3R8BA 4FXGC 5C44B 3A54A 3LWEA 1LTGD 3PUYA 4J6HA 3IL8A 2FINB 2SOBA 4NP5A 3K57A 2JEBI 1ET9A 2CQAA 5JAVA 2B2YC 1S4ZA 1HRJA 1X3QA 1BCPB 3FKIB 3RD4A 5KNCA 2MGSA 4K6LA 1GUWA 2WKCA 3MHBA 4H0LC 1BQQT 2AUJD 3SVMA 4IFDG 2F0EA 5EPKA 3HG9A 4K6DA 1DONA 1FNUA 2F0QA 1A3TA 4J8QA 1KABA 3T4AC 1BUVT 1EQTA 4N9TA 5K36G 4DXGA 2NB0A 3D6CA 2R93B 3OPOA 4FF1A 2D9UA 3R3OA 5JPMC 1B44D 1EY9A 2QKIC 1PTOB 2KVMA 5FLXL 1Z7TA 2F0PA 1WD1A 2BCOA 4H44C 4OO1G 1EWCA 1EZ8A 1JORA 4KD3A 2R7ZB 3SK8A 1X3PA 1EY5A 2X69A 2EJMA 3I8ZA 3EQLC 1L0YB 4CJ2C 2JA8B 4FXDA 3MFGA 3P7JA 4A3KB 2HUGA 3H6MA 2FMCA 2F0KA 1JWUD 4FXKC 1AN8A 4IFDJ 5IGDA 4A3IB 2ID0A 5KNBA 4QB4A 4DAPA 2A73B 3HOZB 3NBHA 1MSGA 3AU7A 2NBFA 4QUFA 3MZ5A 5CBEE 3BG3A 4XQNA 1Q90A 4MN3A 1SFOB 3S16B 1D5MC 2E2DC 1VF7A 1SEBD 4FNFA 3FVQA 1JCKB 1I4XA 3BVZA 2AWOA 1EWHA 3MFYA 2JP1A 3FMCA 2G9DA 1JOOA 4HAEA 3NTIA 2BA0A 5FK9C 3S1RB 2VNUD 1DOLA 3I90A 2E74C 4HR7B 3K5MA 4RGNA 3I4MB 1IL8A 1CA5A 3L3OC 1G2TA 1A15A 2SDFA 5C0XJ 1V8QA 4OHJA 3WDNA 1PRTF 4DAYA 1ZEQX 3NPPA 2KEEA 2SEBD 2PCFB 4IZ8A 2ENBA 4BS9A 3PIP3 2F0TA 1KDBA 2M00A 1V1PB 3ITPA 4X3UA 5A2QE 1QILA 4IUUA 2VB3X 4A3EB 5FO7B 3NK9A 1PRTD 1TS5A 5CV6A 4U673 1HFNA 4WRDA 2RQXA 1EYDA 1F2MA 5C3EB 1JOQA 2O5IC 1RD9D 1VDZA 4QIWB 1OXTA 3R2IA 3QOLA 3HOXB 5EBCA 1ML0D 5I6WA 3QOJA 1RODA 3T53B 4FVMA 1IYVA 3QO2A 2EPBA 3KBGA 1IKLA 5KIXA 3KLRA 4XYQA 4KJNA 3I4NB 1HUMA 1STEA 2OXPA 4NKLA 2RDHA 1PFNA 5M5YB 2AQ3B 1E2ZA 3TZDA 2YYZA 4KY7A 1NCVA 3GTPB 3BVMA 1MI2A 1J9OA 1SBBB 5CMDA 1CZGA 2DY8A 1NR2A 1IKMA 4ZK9B 1R4QB 1LTTD 3GP7A 4EVOA 2KUMA 5F2DA 4RGTA 3OOCA 3NUCA 3G6JB 3GO5A 3KLSA 2LS01 3A56A 1PLFA 2ICIA 2KECA 4ULLA 4XDXA 2IL8A 1WTRA 4FF4A 1D2BA 2G9HD 2O5JC 3OW7A 4DFAA 3EVQA 5IGBA 1G291 2IX1A 1SMYD 2A6EC 5I2XA 2PPBC 2XIWA 4XT1B 2L55A 5EPLA 2O4XA 2EYFA 1HUNA 3F2UA 3DUZA 5JEAH 1EYCA 1TWFB 1ZYRD 1DCZA 1JICA 2WINB 1A6XA 1QE6A 1RCVD 3NSWA 2HCCA 4OGQC 3HGBA 1U9RA 2F3VA 2ZXPA 2IW3A 2XSCA 2IWHA 3I4LA 1GHKA 1IYUA 1W6KA 3VR3A 3DEPA 4H13C 3OHXC 4AYBB 3AMUA 1STBA 5EJWA 2OEOA 2LMCB 1EU3A 1QWYA 4F87A 4BA2I 4ZUIA 4DK0A 2DN8A 5EQ0A 2SNMA 5ELFA 4KKUA 3D4RA 2Q8TA 4WORA 3JAML 3Q24A 3J80E 5HGTA 1EY6A 2RDFA 3M4YA 2WKDA 5ELEA 3I3CA 5M9OA 4L6TB 2DNCA 1WD0A 1KNEA 3A7AB 3N52A 1HCZA 5IGFA 3CQZB 4CGYB 1F2YA 2TMPA 4RGOS 1K8MA 3VR2A 1S5CD 3G7LA 2NN6I 4ODGA 1PRTC 4KN7C 2Z1CA 3VYSA 5CBAE 5I9PA 5HURA 3A8JE 4RHRA 3DEOA 4TQUS 2NTTA 4A3GB 1HPCA 2SNSA 3UI2A 4K2KA 1EL0A 4HMJA 3GTOB 4EQPA 4A3JB 2JEAI 1STYA 1Z47A 1V43A 4KD4A 4NMZA 1B3AA 1TU2B 5D3IB 2R61A 3TP5A 3D6WA 4K5VA 1SE2A 1VF5C 3WOEA 1EZ6A 5EBDA 1CFMA 3K59A 2IX0A 2B2UA 1LLRD 1DOMA 1EEID 2EDGA 4EQOA 3NHHA 1H9SB 1LTAD 2EXZA 3J81L 5G3LF 1O80A 1EY7A 1WTOA 3CU7A 5DNFA 3S15B 4HSPA 2L5TA 5JOBA 2L1BA 3ERQA 2O2LD 2F3WA 2C5CA 2XWBB 2E76C 3IFTA 1SJED 5C3WA 2F4IA 1UEAB 3D4WA 4KTAA 1WTWA 3KK7A 4NDXA 1B53A 1O7YA 1S5ED 3TMEA 1LO5D 1OXXK 3MXPA 1CQFA 1TS3A 5C4XB 2J7ZA 5CR3A 1SJHD 2DY7A 4EQNA 1F2ZA 3KF8A 2XRQD 3EFXD 2PW7A 1KNAA 3BDLA 3SHLA 2F0MA 1PFBA 4G57A 3J7YW 1PZID 2WAQB 1MGSA 2XVSA 1RTOA 2A69D 1B9MA 1LV9A 1DM0B 2LY7A 2ZXOA 1SMYC 3EA6A 3T16A 4X3SA 2JA7B 3PUXA 3LWUA 4IUVA 1S5FD 3R93A 4QF4A 1RDPD 1SYBA 3NQIA 4XIGS 5IT9E 1EU4A 3BZDB 1CM9A 1U4MA 2R6GA 4DAVA 1SNDA 1ZYRC 3KUPA 2KOLA 1GOZA 3Q0AA 1T5EA 5E4XA 1PDQA 2B8FA 1I50B 4R8NA 2K5QA 1HFGA 1JQYD 2N55A 4JBWA 3P75A 5JEAJ 1ONLA 4KK7A 4KKTA 4OO1I 2D5DA 5CORA 5EKLA 5DM73 2HDLA 1WCMB 3VYRA 2JYOA 2L9HA 2YU9B 3RLFA 1AFPA 2A6HC 3EROA 3I73A 1D1KA 4PMWA 1STHA 1E2WA 2A68D 3HS0C 5ELBA 4FYDA 3IKJA 1UNSA 4Y7NB 4PV1C 4BY7B 3NQTA 2CHBD 1SNCA 3BS1A 2EYOA 1LT4D 1G91A 1LTBD 1D5XC 1EYAA 5JPNC 3NBIA 5C0XG 1BO0A 1U4LA 2H4OA 4OIKA 3S1QB 4UAIA 2H1EA 1V1PA 4CJ1B 4XXEA 4C3JG 5EGTA 2PMZB 2B63B 3D3RA 1PTOH 1F9QA 3MXNA 4CJ0B 3NXWA 2KA7A 1V1OA 4K8JA 2NYZD 1HA5A 1OXSC 1HHVA 2EYMA 3M7GA 5T1GA 3PV0A 2HDMA 3Q23A 2V4DA 1H9JA 2KCNA 5ISRA 2ICEC 1SE4A 5FO9B 1YNJC 3VA7A 1JB3A 1JWSD 1LTSD 2QF7A 1OXUA 2K04A 1SYGA 3MC0B 4JK1C 4KHZA 1K83B 1W6JA 1STNA 3M7NA 3DWAA 2B2VA 4G7OC 5CC4A 4XTCS 2K01A 4C1NK 2M9VA 2Z4IA 2Q8IB 1WTXA 1UUPA 5IGCA 2B39A 1RF2D 2J4XA 1EFID 2EJFC 1DD2A 2F0HA 1ENAA 5D14A 4C3HG 4UDUC 1EQVA 4BWGB 2L0CA 2F0VA 4XT3B 2QCPX 5LHY1 1KLUD 3TP7A 1QCBD 2WV6D 5KNDA 1SNQA 2RA4A 5JVH3 1RJTA 4TSSA 1HQRD 1C48A 2PW5A 2VB2X 5C4HA 2A69C 1BDOA 5T1IA 1E2VA 2NWGA 3V05A 3RMHA 2E2JB 1EY8A 1QB5D 2K03A 4ZYSA 3ND9A 3DMUA 4MHEA 1Q8IA 2KCCA 4BBSB 2D2CC 1DXMA 4PNYA 3HEJA 3K5OA 1I4RA 5J1ZA 5KRUA 1CQVA 2K33A 5A2QL 1G8ZD 1F77A 3OMCA 3TP6A 3QIAA 3H09A 2FMMA 4FP5D 1IW7D 3H0GB 1TY2A 2NN6H 3PO3B 2B2YA 2MUYA 3CRKC 1SYEA 1A2TA 4J1MA 2JA6B 4K2LA 1CI3M 3GV6A 4HEDA 4PMCA 5LL6X 3U9OA 3NWTA 3A8IE 3KLSX 2A68C 1QNKA 1KDAA 2MP1A 1L0XB 4R8IA 3Q22A 4KMUC 4ZRZA 1EY0A 4A3DB 2B8GA 4K14A 3LX0A 3CHBD 2QILA 4DA2A 1DOKA 3HP3A 4O42A 3MA2B 3FPUB 1TT2A 1TVXA 1LACA 5C5LA 4K5WA 3E6ZX 1NUCA 1PXUA 1TQOA 4BY1B 2F0IA 1TWGB 2MHVA 2K5WA 3T56B 4B08A 4LJZC 5M3MB 4A3BB 3VA5A 5D65A 2NVQB 1OO9B 4A93B 4WJWA 1EOTA 4FF2A 3S17B 1ILQA 2LKVA 4QMGA 4ZKBB 3K5NA 3VYTA 1Y8PB 4KN4C 4FO2A 5IGGA 2PZWA 2Z8LA 4CKBA 5BN3A 3E0JA 2B2TA 2K05A 1Y8NB 4XQJA 1TKWB 5M5WB 5IOCA 3OSOA 5E4WC 3JAME 3PUWA 3HOYB 2JE6I 1CHPD 3WOFA 2J0TD 5EKIA 4U68A 1ZXTA 2C9OA 2IJ0A 3DWPA 1TR5A 3O13A 3BDOA 1MBYA 5C4ZA 1H9SA 3SK4A 5E1FA 2R3ZA 1SAPA 4B9XA 1QNUA 2KQ3A 2PYKA 1CTMA 4I7ZC 3PO2B 1F2LA 1RHPA 1EY4A 1B4OA 5I4DA 2NVTB 4C1NI 4CHTB 5K36H 3TDQA 3NTHA 2PZTA 3BYTB 1KAAA 1LT3D 4ME5A 4IUNA 5M5XB 2IX3A 1WTVA 3D4DA 4X3KA 1O7LA 4OO1H 5CV8A 4KKSA 1BF4A 4Q5VA 4XQQA 4QUCA 3V96A 3J81E 1JC7A 1XYIA 3ONAB 2K7VA 1GUGA 3BYYB 1CK1A 2JXMB 1I6VC 1VMPA 3DXJC 1SSOA 2EYHA 3J80L 1O7ZA 3DHQA 2K5DA 3SEBA 1B1ZA 3NP8A 4KI0A 4K5XA 1DJRD 1VMCA 1KTKA 2B2VC 3HKZB 2PZUA 1STGA 2F0NA 4N9PA 3C46A 1H9RA 1FD7D 1AZPA 1LTRD 1IW7C 3RZDB 1SYFA 1SDFA 1GUSA 2F0FA 5A35A 2EY2A 4V0BA 4RCNA 2EVBA 1SXTA 4MIUA 4G7HC 3GQBA 4ZUJA 1G6ZA 4C56C 1I4GA 2FHTA 1K8OA 1AZQA 1BCPF 4M1UB 5JEAG 1CHQD 2TSSA 1Z6HA 3MAQA 1WVLA 1QG7A 2RDGA 5J39A 5CV5A 2EYJA 3E5SA 4KY6A 1TWCB 4XYOA 1YNND 2Z4HA 5JJZA 2E2HB 1BCPD 5CV7A 1XXGA 4PMBA 3A8KE 3C2PA 1SNMA 2RKSA 1C4QA 3GV3A 5KEEA 3HRZC 2NTSA 3TBIB 2QDBA 4IFDI 5EKKA 2WP8J 2LFNA 2AWNA 1BXTA 2F0LA 1PTOF 4B9WA 1C8CA 5FLXE 1Q1EA 3VR4A 5J22A 3S2DB 4YIJA 1Q1BA 4IUQA 2DNEA 3RUZA 1I4HA 2GA4B 1FNWA 1QJOA 3TSSA 2FJ2A 2EY6A 3GTQB 1PTOD 3MVVA 1HA6A 3TP8A 2BE5D 4KY5A 2VXWA 5BN5A 1H9KA 2WACA 4C3IG 1FYCA 4ABNA 2WIIB 3GD7A 4TKOB 1UAPA 4G7ZC 5IT9L 4RHSA 2RSNA 5CV9A 5E3FA 1H9MA 2A5HA 5COYA 4G4KA 2NVYB 2L11A 1HTLD 3RZOB 3D8GA 1STAA 2X6LA 4HSVA 4ILWA 2PO4A 3QWNA 1GUOA 3VR5A 1I4PA 4OL7A 5KGUA 1JWMD 1NR4A 4DXFA 5C0XI 4WFN3 1HQMC 4L63B 5FOBB 2X6GA 1MSHA 1VCIA 2EY5A 4S3SA 4HCEA 1TS4A 2B2TC 1Q12A 3LNNA 2I07B 1PMRA 3C1EA 2M2LA 5ELCA 1X32A 5CV4A 2A6ED 1AP0A 3S1MB 1XWEA 5I9OA 1WTQA 1I4QA 2F0SA 1IHZA 3GTLB 1GXDC 1NSNS 1ZKOA 1D5ZC 1NAPA 2K1BA 4RH6A 1HXYD 1ESFA 1ET6A 3H91A 3GTMB 3K0YA 5CYUA 4K8IA 2B2WA 2XNAC 4Z9CB 2K28A 1OXVA 3FEWX 4DK1A 1BBXC 2BA1A 3OIPA 3X3NA 5DM63 2VUMB 3URYA 3SR1A 4HMIA 4M8AA 4F8MA 4RKLA 3K7AB 2PQEA 1KDCA 2CW0D 2BOSA 2AQ2B 2F0JA 1GUNA 1I3QB 3S14B 1GJXA 3V2TA 1BOSA 1G2SA 2RSOA 3K58A 4RKBA 1CA6A 4IN3A 1A3VA 5IIFA 5TSSA 4HN7A 2MJ8A 1KLGD 3I70A 5BN4A 5ELDA 3VR6A 2L4NA 4RWSC 4ZLTF 1JOKA 5C3XA 2B2UC 2CVRA 3P20A 1U4PA 4F88A 1RTNA 1YNNC 4GZYC 1A3UA 5C4JB 2IT1A 1BCPC 3C3LA 1EIGA 5I2YA 3GTKB 3SXHA 4V190 3J7AV 1Y1VB 1R9TB 1RKNA 1SYCA 2L12A 4RCOA 4A3MB 1PRTB 1I6HB 3M3YB 4RAUC 1Y8OB 2EOTA 3A55A 4HTHA 4IQZA 4BBRB 3L9AX 3PUZA 3HOWB 4DN4M 4CKEA 3PIO3 3C1FA 1PTOC 3W2DA 1U4RA 1E0BA 4X3TA 2BE5C 5I6YA 2D62A 1II3A 2MPMA 1S5BD 3GTGB 1J8IA 3NE5B 4F7XA 4A3FB 3L7ZC 5LL6S 5M3FB 3SE0A 3AB9A 3MEHA 1Y69U 2BDOA 4LK1C 4O1NA 3J7AF 3FPPA 1SNPA 1TS2A 3W3AA 3SK5A 3K5LA 1EEFD 5JVG3 1GHJA 1ENFA 2F0UA 4TRDA 3MWYW 5FKAC 1S5DD 2BDNA 4BA1I 5KYLA 3MTSA 3BVGA 4I65A 4DU9A 4PQXA 1LTID 3HZXA 3MXUA 2XN9C 4IUTA 4RGMA 2ZXRA 3H94A 2E2IB 1EIHA 3BDCA 2F0WA 1AEXA 2NZ1D 2JA5B 4KHVA 3QB3A 1B50A 4LAAA 1A2UA 3OWEB 1DZ1A 1M4VA 3PUVA 2I46A 4ZKCB 3SK6A 3ZYYX 3R2TA 4E6IA 4QCLA 3NWSA 4IUPA 1B2TA 3QJYA 3T51B 1PZJD 1F9PA 2KEDA 2EYLA 4C3IB 4CBVA 3FRPB 2JSOA 1FGBD 3NTKA 2FFKB 3OWFA 5NUCA 5DAUA 1LT6D 1B9NA 5EPJA 2RVLA 1AW7A 1M8AA 4OIJA 5C5MA 4ID6A 1Q3LA 1CT1D 4RA8A 5DEHA 4ZAIA 5IODA 4Q0FA 1TWAB 2WB1B 3X3MA 3A7LA 2Y0SB 2CW0C 5CGKA 1TY0A 1LT5D 4IFDH 1XX8A 3S2HB 3CRLC 3N6RA 2A6HD 3D31A 5D3DA 3P1HA 2K32A 1TIID 3T13A 3I91A 3I72A 2XRSD 3HOUB 4HCSA 1GUTA 1D6EC 4CKCA 2EYPA 4KJOA 1QOHA 2RBMA 3IAYA 4FF3A 3TZUA 5AFWA 3Q6SA 2Q8RE 4C3JB 5K5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEO A;  2F0S A;  3DHQ A;  4KHV A;  1IHZ A;  3QB3 A;  5JOB A;  4B9W A;  2F0O A;  3OMG A;  4LAA A;  5KYI A;  1A2U A;  3ERQ A;  3OMC A;  3SXH A;  3TP6 A;  2F3W A;  3PMF A;  4DF7 A;  5EKL A;  4EVO A;  1NSN S;  2EY1 A;  5F2D A;  2HQE A;  1RKN A;  1SYC A;  3NP8 A;  4H7B A;  4ZUI A;  3EJI A;  5ISR A;  5C3W A;  4K5X A;  3NUC A;  3H6M A;  3SK6 A;  5IOC A;  4IZ8 A;  2ENB A;  3OSO A;  2F0K A;  5J22 A;  3D4W A;  4KTA A;  2F0T A;  2SNM A;  4KV6 A;  1KDB A;  2M00 A;  2PZU A;  4YIJ A;  4ZQ3 A;  4E6I A;  5IGD A;  4WOR A;  3ITP A;  4NDX A;  3ERO A;  4HTH A;  4J6H A;  4DGZ A;  3RUZ A;  3TME A;  1SYG A;  4QB4 A;  1STH A;  5HGT A;  1EY6 A;  1STG A;  2RDF A;  2SOB A;  3MXP A;  4K8I A;  4NP5 A;  2F0N A;  2EY6 A;  1SYE A;  5CR3 A;  3MVV A;  4N9P A;  1F2Z A;  1A2T A;  1STN A;  3TP8 A;  4EQN A;  5IGE A;  3NK9 A;  5M9O A;  5CC4 A;  4J1M A;  4KY5 A;  5CV6 A;  4DFA A;  4K2L A;  3EVQ A;  1TR5 A;  5IGB A;  2KHS A;  4PMC A;  5JAV A;  4WRD A;  2EYL A;  1SYF A;  2WAC A;  5IGC A;  1EYD A;  2PW7 A;  1F2M A;  5IGF A;  3MZ5 A;  3BDL A;  1JOQ A;  2F0F A;  3NQT A;  3U9O A;  1F2Y A;  5C4Z A;  1SNC A;  2EY2 A;  3SHL A;  2EYO A;  3SK4 A;  2F0M A;  5E1F A;  2F0W A;  4G57 A;  2F0H A;  1ENA A;  3SR1 A;  3C1F A;  3OWF A;  3S9W A;  4HMI A;  4F8M A;  4RKL A;  2O4X A;  1EQV A;  4ODG A;  4B9X A;  4MIU A;  2EYF A;  2KQ3 A;  1KDA A;  2PQE A;  3MHB A;  5DAU A;  5NUC A;  5I6Y A;  5CV9 A;  5I9P A;  2PYK A;  4ZUJ A;  1KDC A;  5E3F A;  2F0E A;  1II3 A;  2F0V A;  3QOL A;  5HUR A;  3TP7 A;  1EYA A;  4K6D A;  1EY0 A;  1EY4 A;  3T16 A;  2F0Q A;  2F0J A;  2SNS A;  4F7X A;  4K14 A;  1EYC A;  1SNQ A;  3LX0 A;  5C6A A;  1A3T A;  5I6W A;  1KAB A;  3QOJ A;  4K2K A;  5C5M A;  4ID6 A;  2PW5 A;  3V2T A;  3MEH A;  5DEH A;  4HMJ A;  5IOD A;  4EQP A;  4QF4 A;  5C4H A;  1TT2 A;  2F0G A;  1SNO A;  1STY A;  1SYB A;  1JOO A;  4N9T A;  2PZT A;  3D8G A;  1STA A;  5C5L A;  4K5W A;  1SNP A;  4RKB A;  5CGK A;  1KAA A;  4KD4 A;  4NMZ A;  5KIX A;  4ME5 A;  3SK5 A;  4IUN A;  5J39 A;  1NUC A;  4OL7 A;  3D6C A;  1A3V A;  1TQO A;  4KJN A;  5CV5 A;  3TP5 A;  5KGU A;  2EYJ A;  1EY8 A;  3E5S A;  1SND A;  5EGT A;  2F0U A;  2F0I A;  3D4D A;  4TRD A;  4K5V A;  5IIF A;  1U9R A;  3R3O A;  2F3V A;  3P1H A;  4KY6 A;  2OXP A;  3T13 A;  1EZ6 A;  1EY9 A;  3DMU A;  4NKL A;  5CV8 A;  5KYL A;  2EY5 A;  4S3S A;  2F0P A;  4I65 A;  2NUC A;  3NXW A;  4KY7 A;  5CV7 A;  4DU9 A;  1SYD A;  4R8N A;  3VA5 A;  2EYP A;  4PMB A;  4EQO A;  4KJO A;  3HZX A;  1EZ8 A;  1JOR A;  3NHH A;  2F0D A;  2LKV A;  3C1E A;  1SNM A;  2RKS A;  2OF1 A;  4QMG A;  2EXZ A;  4KD3 A;  3HEJ A;  4K8J A;  4PNY A;  4IAL A;  5CV4 A;  2RBM A;  3SK8 A;  1JOK A;  5C3X A;  1EY7 A;  5J1Z A;  1ENC A;  5KEE A;  5IGG A;  1AEX A;  2QDB A;  1EY5 A;  2PZW A;  5EKK A;  5I9O A;  5KRU A;  1STB A;  3P75 A;  3BDC A;  1A3U A;  2F0L A;  5K5P A;  2EYH A;  2EYM A; 
#chains in the Genus database with same CATH topology
 3ER0 A;  4GS3 A;  3DWQ A;  2A74 C;  2QEJ C;  4RFB A;  5FJ8 G;  4DF7 A;  5M5W H;  1ILP A;  4NW2 A;  4EGV A;  2B2W C;  3EJI A;  1VQL A;  1ESR A;  3IFD A;  1HTP A;  3DM1 A;  1T5X D;  3AQQ A;  1BNZ A;  3HOY H;  1YHA A;  5LMN L;  3CKI B;  4KV6 A;  2F1M A;  4ZQ3 A;  4JBM A;  3TN2 A;  4DGZ A;  4GLX A;  1BR9 A;  2NN6 G;  3U58 A;  3CD6 A;  4LNQ A;  5IGE A;  3RR5 A;  4POF A;  2KHS A;  3GTJ B;  5FO8 B;  3S1N B;  1MD2 D;  2IPK D;  2R92 B;  4L8J A;  1EIF A;  1LAB A;  5C3E G;  1F9S A;  2XWJ B;  1VS0 A;  2HCI A;  1WTP A;  1O78 A;  2EJG C;  2K6A A;  3SDZ A;  2RHS B;  2N88 A;  4HJ5 A;  1VQ7 A;  2KCM A;  1FR3 A;  3W5O A;  1S3O A;  3S9W A;  5HGQ A;  1KQS A;  3KBX A;  2F03 A;  1BBU A;  3ND8 A;  3PO2 H;  3HOV B;  3M4O B;  1JE5 A;  1F9R A;  1JE4 A;  2EZV A;  3HOX G;  1NTG A;  3QG1 A;  5C0X H;  3KFU A;  2NVT H;  4LMQ D;  5C6A A;  1NY4 A;  2EE1 A;  4JI8 Q;  3K6O A;  4JI0 Q;  3H3V C;  1AE2 A;  3L0O A;  2F0G A;  1SNO A;  3CC7 A;  1TWH B;  2OT2 A;  3M85 A;  1YNJ D;  3AFP A;  1PZK D;  4C3H B;  2Z6K C;  5M5X H;  1GKH A;  4C2M B;  1JR0 D;  4JI3 L;  2NVX B;  1D1I A;  1PA6 A;  3OIQ A;  2PNR C;  5DLQ E;  3I4N G;  1DYQ A;  4DUY Q;  2ZT9 C;  1K73 C;  2E75 C;  2A19 A;  1PYW D;  2NUC A;  5BR8 Q;  3D0F A;  1SYD A;  3U9S A;  3VYU A;  1FNV A;  2F0D A;  2OF1 A;  3H0G G;  4IAL A;  1Y1W B;  3RLO A;  2AUK A;  4I7A A;  3G6E A;  5G3L D;  3U4V A;  1ENC A;  4P2C B;  1ICW A;  1XTC D;  2KJX A;  4IUR A;  4FDB A;  4DNT B;  1ICF B;  1VQJ A;  2F0O A;  3OMG A;  5KYI A;  4DNR B;  1SE3 A;  3PMF A;  3CME A;  2EY1 A;  2VS1 A;  2HQE A;  3MXG A;  4H7B A;  2AQ1 B;  1CZW A;  1R4P B;  1VQC A;  3FDT A;  1PFM A;  4R9W A;  3NEM A;  3R8B A;  4FXG C;  5C44 B;  3A54 A;  3LWE A;  1LTG D;  3PUY A;  4LF9 Q;  4J6H A;  2NZO A;  3IL8 A;  2FIN B;  2Q2H A;  2SOB A;  4NP5 A;  1Q81 C;  2PI2 A;  2XGT A;  3K57 A;  2JEB I;  4X62 L;  1PYS B;  1ET9 A;  3RZD H;  2CQA A;  4GLV B;  5AJ3 L;  5JAV A;  2B2Y C;  4POG A;  1S4Z A;  1HRJ A;  1X3Q A;  1BCP B;  3FKI B;  3RD4 A;  5KNC A;  2QA4 A;  2MGS A;  3KDF B;  2DUD A;  4K6L A;  1CKO A;  1GUW A;  3TS2 A;  2K5V A;  2WKC A;  3MHB A;  3CMA A;  4H0L C;  1BQQ T;  4JI5 Q;  2AUJ D;  3SVM A;  3M4P A;  4BY1 G;  2F0E A;  5EPK A;  4JI8 L;  3HG9 A;  4IFD G;  4JYA Q;  4K6D A;  4JI0 L;  1DON A;  1FNU A;  2F0Q A;  1A3T A;  4J8Q A;  1G6P A;  1KAB A;  3T4A C;  1BUV T;  2R7F A;  5GAG C;  1LYL A;  1EQT A;  4N9T A;  5K36 G;  5H1S E;  4DXG A;  2WB1 E;  2Y0S E;  2AMC B;  1I5F A;  2F4V Q;  2NB0 A;  1GD7 A;  1YHB A;  3D6C A;  2R93 B;  3OPO A;  4FF1 A;  2D9U A;  1TWC H;  3KF8 B;  5BR8 L;  3R3O A;  5JPM C;  5IYB G;  5IYC H;  1B44 D;  2E2H H;  1EY9 A;  2QKI C;  1HR0 W;  1PTO B;  2KVM A;  5FLX L;  1Z7T A;  2F0P A;  1SMX A;  1WD1 A;  2BCO A;  4H44 C;  4OO1 G;  1L0W A;  1EWC A;  1EZ8 A;  1JOR A;  5IT9 c;  3VDY A;  1WYD A;  4KD3 A;  3OTO Q;  2R7Z B;  3SK8 A;  4DNI A;  1WOC A;  1X3P A;  1EY5 A;  2X69 A;  2EJM A;  3I8Z A;  3PIP A;  3EQL C;  1L0Y B;  4CJ2 C;  2JA8 B;  1JJC B;  4FXD A;  4EQ5 A;  3MFG A;  4LF7 Q;  3P7J A;  4N8F A;  3CPW A;  2Q2U A;  1PHJ A;  4A3K B;  4GNX C;  2HUG A;  3S2D H;  3H6M A;  2FMC A;  2F0K A;  1JWU D;  4LF9 L;  4FXK C;  1AN8 A;  4IFD J;  3G71 A;  5IGD A;  1HNW Q;  3ULP A;  1OTC A;  4A3I B;  2ID0 A;  5KNB A;  3UE1 A;  4QB4 A;  5IYD H;  1PH5 A;  3GTQ H;  4DAP A;  2A73 B;  1UE6 A;  4B3M Q;  4CDD C;  1PH3 A;  3HOZ B;  3NBH A;  1MSG A;  3AU7 A;  2NBF A;  1WCM H;  4QUF A;  3MZ5 A;  5CBE E;  3BG3 A;  2VL6 A;  4R4Q A;  4XQN A;  1Q90 A;  4GN4 B;  4MN3 A;  2RCF A;  1Q7Y C;  1K3B C;  1EQR A;  4JYA L;  1SFO B;  3HKZ E;  1PVO A;  3S16 B;  1Z9F A;  3I2Z A;  4DV2 Q;  1D5M C;  1EOV A;  2E2D C;  1VF7 A;  1SEB D;  1KRT A;  4L5S A;  4FNF A;  3EIV A;  3FVQ A;  2EQS A;  1JCK B;  1I4X A;  4A3G G;  2ZTC A;  3BVZ A;  2NVY H;  2ZM6 L;  3K81 C;  3RZO H;  4GKJ L;  2AWO A;  1AH9 A;  1EWH A;  3MFY A;  2F4V L;  2JP1 A;  3FMC A;  2G9D A;  1JOO A;  4A3J G;  2V1C C;  4MTN A;  4HAE A;  1HNZ Q;  3NTI A;  2BA0 A;  1CSQ A;  5FK9 C;  3TQY A;  2JN4 A;  3S1R B;  2VNU D;  1DOL A;  5IP7 G;  3I90 A;  4IPG A;  2E74 C;  4HR7 B;  3OTO L;  3K5M A;  4RGN A;  3I4M B;  1IL8 A;  2E5L Q;  1EWI A;  4OEL B;  5ELN A;  1CA5 A;  3L3O C;  1QVF A;  3S1M H;  1G2T A;  3JAM i;  1A15 A;  3A5Z B;  4OWT B;  4PZ7 A;  1MHW C;  2SDF A;  5C0X J;  3STB D;  4A3L H;  1V8Q A;  4OHJ A;  3GTL H;  1E1T A;  4JC0 A;  3WDN A;  1PRT F;  1A0I A;  4DV3 Q;  4DAY A;  1ZEQ X;  3KF6 B;  2UUA L;  3NPP A;  1KIX A;  2KEE A;  2SEB D;  2PCF B;  4IZ8 A;  2ENB A;  4BS9 A;  3PIP 3;  2F0T A;  1KDB A;  3GTM H;  2M00 A;  1PH6 A;  1V1P B;  3ITP A;  4X3U A;  2A1A A;  1A63 A;  5A2Q E;  1QIL A;  4IUU A;  2VB3 X;  4A3E B;  2AKW B;  2OTL A;  5FO7 B;  3NK9 A;  3JC6 6;  1PRT D;  1TS5 A;  4GN3 B;  5CV6 A;  4U67 3;  3MXN B;  1KL9 A;  4WRD A;  4DUZ Q;  2PQA B;  1HFN A;  2RQX A;  1EYD A;  1F2M A;  5C3E B;  1JOQ A;  1J6Q A;  2VUM H;  2O5I C;  1EUJ A;  1RD9 D;  1L1O B;  1VDZ A;  4QIW B;  1OXT A;  3R2I A;  3QOL A;  3RLN A;  3HOX B;  1I3Q H;  2KEN A;  4JOI A;  5IYC G;  5LMU L;  4DV5 Q;  2JA7 G;  5EBC A;  3S14 H;  1ML0 D;  5I6W A;  3FHW A;  3QOJ A;  4YCU A;  4QQB X;  1LM0 A;  1ROD A;  4LUO A;  2HIV A;  1LTL A;  2JA9 A;  3J81 i;  3T53 B;  4JI6 L;  4FVM A;  1IYV A;  3QO2 A;  2EPB A;  3KBG A;  1IKL A;  5KIX A;  3KLR A;  4DR5 Q;  4JW0 A;  1UWV A;  4X66 L;  4XYQ A;  2EIF A;  4KJN A;  1QUQ A;  3I4N B;  1HUM A;  3RN2 A;  1STE A;  2E5L L;  2OXP A;  3ULL A;  4NKL A;  2RDH A;  1PFN A;  5M5Y B;  2AQ3 B;  3KOJ A;  1E2Z A;  3TZD A;  2YYZ A;  4KY7 A;  1NCV A;  3GTP B;  3BVM A;  1J5E Q;  1XNR Q;  1MI2 A;  3EN2 A;  1YEZ A;  1J9O A;  1FVI A;  3Q8D A;  1SBB B;  5CMD A;  2RCN A;  1CZG A;  2DY8 A;  2MO1 A;  2KHI A;  5C4J H;  4DV3 L;  1PH4 A;  1NR2 A;  1IKM A;  4LW1 A;  5IYD G;  4ZK9 B;  1R4Q B;  3GTK H;  1Y1V H;  1LTT D;  3GP7 A;  3PCO B;  4EVO A;  2KUM A;  2ATW A;  4A3M H;  5F2D A;  1VQH A;  1I6H H;  2K5H A;  3OOC A;  4RGT A;  3NUC A;  1WCM G;  3G6J B;  3GO5 A;  4EX5 A;  3M3Y H;  3G4S A;  1XNQ L;  3KLS A;  2LS0 1;  3A56 A;  2B3G A;  1PLF A;  2LXK A;  5GQO A;  4B3S Q;  1M90 C;  2ICI A;  2KEC A;  4ULL A;  2MQH A;  4XDX A;  2IL8 A;  1WTR A;  1S40 A;  4FF4 A;  1D2B A;  4BBR H;  2G9H D;  2O5J C;  4OWW B;  3LGJ A;  3OW7 A;  1XPU A;  4DFA A;  3EVQ A;  5IGB A;  3E0E A;  5IP9 H;  4DR6 Q;  2H5X A;  1G29 1;  3HOW H;  2IX1 A;  1SMY D;  2A6E C;  4BY7 G;  5I2X A;  1RIP A;  2OCE A;  2PPB C;  1CKN B;  2XIW A;  4XT1 B;  2L55 A;  5EPL A;  4BXX G;  2O4X A;  2CWA A;  2OQK A;  2EYF A;  2VQE L;  4DV5 L;  1HUN A;  3F2U A;  3GTG H;  3DUZ A;  4RG1 A;  4A3F H;  5JEA H;  5M3F H;  3M9B A;  2OWO A;  1EYC A;  1TWF B;  1ZYR D;  1DCZ A;  1JIC A;  2WIN B;  4X64 Q;  1A6X A;  1QE6 A;  1RCV D;  3NSW A;  5GAH C;  2HCC A;  1EFW A;  4OGQ C;  5IE8 A;  3DLL A;  3HGB A;  1U9R A;  1E22 A;  2F3V A;  2ZXP A;  4ME3 A;  4DR1 Q;  1J5E L;  2B63 G;  2IW3 A;  2XSC A;  3I4L A;  2IWH A;  1GHK A;  3K80 C;  1IYU A;  1W6K A;  4JI4 Q;  2VY3 A;  1VQ8 A;  3VR3 A;  3DEP A;  4KHP Q;  4H13 C;  2E2I H;  3OHX C;  1HZA A;  4AYB B;  1Q46 A;  3AMU A;  1STB A;  2GN5 A;  4OEM B;  5EJW A;  2OEO A;  2LMC B;  2QW7 A;  1EU3 A;  1QWY A;  1YNX A;  4F87 A;  4BA2 I;  4ZUI A;  4DK0 A;  1K9M C;  2DN8 A;  4HID A;  4JI7 Q;  4A3C H;  4L5Q A;  1N32 L;  5EQ0 A;  2SNM A;  5ELF A;  2VUM G;  4KKU A;  3CCV A;  3D4R A;  3STB C;  2Q8T A;  3T1H Q;  4WOR A;  1VQB A;  1C0A A;  1W3S A;  3JAM L;  1N9W A;  3Q24 A;  2IHF A;  1BBW A;  3J80 E;  5IWA Q;  5HGT A;  1EY6 A;  2RDF A;  4CDE C;  4DR6 L;  3M4Y A;  1NMG A;  3BZK A;  1Q86 C;  2WKD A;  5ELE A;  3I3C A;  5M9O A;  1P16 A;  3J7A 5;  4L6T B;  1SN8 A;  2DNC A;  1WD0 A;  4C3I H;  1KNE A;  3A7A B;  2N49 A;  3N52 A;  1HCZ A;  5IGF A;  3CQZ B;  3ERS X;  4CGY B;  3JAM c;  4DV7 Q;  1F2Y A;  2TMP A;  4RGO S;  1K8M A;  1EQQ A;  3MEF A;  3VR2 A;  4LFA L;  1S5C D;  3G7L A;  2NN6 I;  1ASZ A;  4ODG A;  4R4T A;  1PRT C;  4KN7 C;  1AE3 A;  2Z1C A;  3VYS A;  5CBA E;  5I9P A;  2Q2I A;  4GNX B;  4QIW E;  5HUR A;  3A8J E;  4RHR A;  4OX9 Q;  3DEO A;  4DPG A;  4TQU S;  2NTT A;  4A3G B;  1IZ6 A;  1GO3 E;  1HJP A;  1HPC A;  2SNS A;  3UI2 A;  3E9H A;  1XPR A;  4K2K A;  1EL0 A;  1TWA H;  4HMJ A;  3GTO B;  4EQP A;  1N36 L;  4A3J B;  2JEA I;  1STY A;  1Z47 A;  4DAM A;  1V43 A;  1SLJ A;  4KD4 A;  4NMZ A;  3S2H H;  2OTJ A;  4DR1 L;  1B3A A;  1TU2 B;  2P5Z X;  5D3I B;  2UXB Q;  2R61 A;  2UXD Q;  3TP5 A;  4JI2 Q;  3D6W A;  4K5V A;  1SE2 A;  1VF5 C;  3HOU H;  3WOE A;  1EZ6 A;  5EBD A;  1CFM A;  3K59 A;  2IX0 A;  2B2U A;  3B6Y A;  4L5T A;  1LLR D;  1DOM A;  1EEI D;  2EDG A;  4EQO A;  2ZJQ A;  3NHH A;  1H9S B;  1LTA D;  1P8L A;  4BBS G;  2EXZ A;  3J81 L;  1O80 A;  1EY7 A;  2I5H A;  5G3L F;  4C3J H;  3KDF A;  3CU7 A;  5DNF A;  1WTO A;  3CP0 A;  1X55 A;  4LFB Q;  3S15 B;  4DR4 Q;  1VQN A;  1UE1 A;  4HSP A;  2L5T A;  3KYH C;  5JOB A;  4AQY Q;  2L1B A;  3ERQ A;  2UUC Q;  1W2B A;  2O2L D;  2F3W A;  1K8A C;  2C5C A;  2XWB B;  2E76 C;  3J81 c;  5IP9 G;  3IFT A;  1SJE D;  5C3W A;  2F52 A;  3T1H L;  2CKZ B;  2F4I A;  1UEA B;  3D4W A;  4KTA A;  1WTW A;  3KK7 A;  5IWA L;  4NDX A;  1B53 A;  1O7Y A;  1S5E D;  3TME A;  1LO5 D;  3PO3 G;  2A8V A;  1OXX K;  3MXP A;  2ASB A;  1CQF A;  1TS3 A;  1DGS A;  5C4X B;  2J7Z A;  5CR3 A;  1SJH D;  2DY7 A;  4EQN A;  1F2Z A;  1K28 A;  3KF8 A;  1XTD A;  2XRQ D;  3EFX D;  3GTJ H;  2JA6 G;  4DV7 L;  1NNX A;  3S1N H;  2R92 H;  5M3F G;  1IL2 A;  2PW7 A;  1K3R A;  1KNA A;  3BDL A;  3SHL A;  3A74 A;  2F0M A;  1PFB A;  4G57 A;  3J7Y W;  1PZI D;  2WAQ B;  4KLK A;  1MGS A;  2XVS A;  1RTO A;  2A69 D;  3HOV H;  2D0O A;  3M4O H;  1B9M A;  1LV9 A;  1DM0 B;  2LY7 A;  2ZXO A;  1SMY C;  1UEB A;  3EA6 A;  3T16 A;  4X3S A;  2JA7 B;  4A3D G;  3PUX A;  5GAD C;  3LWU A;  4IUV A;  2I5M X;  3ZJY C;  1S5F D;  1KRS A;  3R93 A;  3SGI A;  1TWH H;  1X56 A;  2KCT A;  3DM3 A;  4QF4 A;  2UXB L;  1RDP D;  1SYB A;  3NQI A;  4XIG S;  4C3H H;  5IT9 E;  4C2M H;  1EU4 A;  1WTH A;  4JI2 L;  4QJF A;  3BZD B;  4MZ9 A;  1CM9 A;  2NVX H;  1U4M A;  3NEN A;  3FP9 A;  2R6G A;  4DAV A;  1SND A;  1ZYR C;  3KUP A;  4A75 A;  2KOL A;  1GOZ A;  3Q0A A;  1T5E A;  5E4X A;  1PDQ A;  1FL0 A;  2B8F A;  3F2B A;  4N8X 1;  2ES2 A;  2ZTE A;  5M3M G;  1I50 B;  3UDF A;  4R8N A;  4A3B G;  1SE8 A;  2VQF Q;  2K5Q A;  1HFG A;  2XTI A;  1Y1W H;  4A93 G;  4LFB L;  1JQY D;  2CH4 W;  2N55 A;  3W1B A;  3I56 A;  1KAW A;  4JBW A;  2VW9 A;  4DUY L;  3P75 A;  5JEA J;  4AYB E;  1ONL A;  4KK7 A;  3BJU A;  1QVC A;  3PGZ A;  4NXN Q;  4KKT A;  4JI1 Q;  4DV4 Q;  4OO1 I;  2D5D A;  5COR A;  5EKL A;  5DM7 3;  2HDL A;  1WCM B;  3VYR A;  3AFQ A;  1VQ5 A;  2JYO A;  2L9H A;  4GKK Q;  2YU9 B;  5C44 H;  3RLF A;  1AFP A;  3HOY G;  5EAY A;  2A6H C;  3ERO A;  3I73 A;  1D1K A;  4NXM Q;  4PMW A;  1STH A;  3CCM A;  1WJJ A;  1E2W A;  2A68 D;  5FLX c;  2IY5 B;  4R4C A;  3HS0 C;  5ELB A;  4FYD A;  1VQE A;  3IKJ A;  1X9N A;  1UNS A;  4Y7N B;  4PV1 C;  4BY7 B;  3FKI H;  3NQT A;  2CHB D;  3K8A A;  1SNC A;  4LFC Q;  3BS1 A;  2EYO A;  1IBL Q;  1B7Y B;  4PZ8 A;  1LT4 D;  1BKB A;  4IJH A;  1G91 A;  2HIX A;  1LTB D;  3T1Y Q;  2ZTD A;  1D5X C;  1YIJ A;  1EYA A;  5JPN C;  3PO2 G;  3NBI A;  4GN5 A;  3TRZ A;  5C0X G;  3KF6 A;  1BO0 A;  1U4L A;  2H4O A;  4OIK A;  2MFI A;  2UU9 Q;  3S1Q B;  4JI5 L;  4UAI A;  4R4O A;  2H1E A;  1V1P A;  2R93 H;  4CJ1 B;  4XXE A;  3AEV A;  4C3J G;  5EGT A;  2PMZ B;  1EYG A;  2B63 B;  3D3R A;  1PTO H;  2VQF L;  1F9Q A;  3MXN A;  4IPH A;  4CJ0 B;  3NXW A;  4OWX B;  1YHQ A;  2KA7 A;  2R7Z H;  4YWL A;  1V1O A;  4K8J A;  4DV1 Q;  1L1O A;  4OON A;  4HIK A;  4NXN L;  4DV4 L;  2NYZ D;  1SRO A;  1HA5 A;  1OXS C;  2JA8 H;  1HHV A;  1X54 A;  2EYM A;  4DV0 Q;  4PZ6 A;  3M7G A;  5T1G A;  3F2D A;  3PV0 A;  2HDM A;  3Q23 A;  2V4D A;  1H9J A;  4A3K H;  2KCN A;  4B3T Q;  5ISR A;  2ICE C;  1SE4 A;  1FJG Q;  5FO9 B;  1YNJ C;  1HR0 Q;  4NXM L;  3VA7 A;  1JB3 A;  1JWS D;  3HKZ G;  4A3I H;  1LTS D;  2QF7 A;  1OXU A;  4MTK A;  2K04 A;  1SYG A;  4LF7 L;  3MC0 B;  3HOV G;  4JK1 C;  4KHZ A;  3HOZ H;  1K83 B;  1W6J A;  1STN A;  3M7N A;  3DWA A;  4X6A H;  2B2V A;  1VQP A;  5CC4 A;  4G7O C;  4LF6 Q;  4HIM A;  4LFC L;  4XTC S;  4A76 A;  2K01 A;  4C1N K;  2M9V A;  2Z4I A;  2Q8I B;  4YCW A;  1UUP A;  1WTX A;  5IGC A;  1HNW L;  2B39 A;  1RF2 D;  2J4X A;  1XJV A;  1EFI D;  2EJF C;  2GVB A;  1SFO H;  1NJI C;  3S16 H;  1DD2 A;  2F0H A;  1ENA A;  5D14 A;  4C3H G;  4UDU C;  1EQV A;  4BWG B;  4B3M L;  3WWV A;  1VQ6 A;  2WAQ E;  2L0C A;  3CCR A;  2F0V A;  4XT3 B;  2QCP X;  5LHY 1;  1KLU D;  3UDX A;  3TP7 A;  1E24 A;  4HJ8 A;  1QCB D;  1VQ9 A;  2WV6 D;  5KND A;  2R7D A;  1SNQ A;  3K0X A;  2UU9 L;  2RA4 A;  5JVH 3;  1XMO Q;  4LF4 Q;  1RJT A;  4TSS A;  5GAE C;  1HQR D;  1M1K C;  4APV A;  1C48 A;  2PW5 A;  4LUZ A;  1E7Z A;  2VB2 X;  5C4H A;  4LF5 Q;  2A69 C;  1BDO A;  4DV2 L;  5T1I A;  1E2V A;  2QGQ A;  2NWG A;  3K7A H;  3V05 A;  3RMH A;  2E2J B;  3S1R H;  3J80 i;  3CPF A;  1EY8 A;  1QB5 D;  1VQI A;  2K03 A;  4ZYS A;  3ND9 A;  4A4I A;  3DMU A;  4MHE A;  1Q8I A;  3I4M H;  1TXY A;  1HNZ L;  2KCC A;  4IPC A;  3CCL A;  4BBS B;  2D2C C;  1DXM A;  5LMN W;  4PNY A;  3HEJ A;  3K5O A;  4GOP A;  3BU2 A;  1I4R A;  5J1Z A;  3HKS A;  3CCJ A;  1B8A A;  5KRU A;  1CQV A;  2K33 A;  3EBE A;  5HY6 A;  5A2Q L;  4B3T L;  5FJ8 H;  1G8Z D;  2HT1 A;  1F77 A;  3OMC A;  3TP6 A;  1HR0 L;  3QIA A;  1IBK Q;  3H09 A;  1VQO A;  1CSP A;  4HIO A;  1A8V A;  2FMM A;  4YHH Q;  4IOA A;  1N34 Q;  4FP5 D;  1IW7 D;  3H0G B;  1MKH A;  1TY2 A;  2NN6 H;  3PO3 B;  4LF6 L;  2B2Y A;  1KHI A;  4A3E H;  1VQA A;  2MUY A;  3OW2 A;  3CRK C;  1SYE A;  3J81 j;  1A2T A;  3CCQ A;  4J1M A;  2JA6 B;  4K2L A;  1R9T H;  1CI3 M;  3GV6 A;  4HED A;  4PMC A;  5C3E H;  4NPS A;  2ZJP A;  1C9O A;  1GVP A;  5LL6 X;  2ZJR A;  3U9O A;  1HZ9 A;  3NWT A;  4P73 A;  3A8I E;  2HQL A;  3KLS X;  4DV6 Q;  2A68 C;  1L2F A;  1QNK A;  4YWK A;  2K50 A;  1LUZ A;  5K5P A;  1KDA A;  2MP1 A;  1L0X B;  3HOX H;  3I7F A;  4R8I A;  3Q22 A;  1XMO L;  1QVG A;  4KMU C;  4DUZ L;  4ZRZ A;  3F2C A;  1EY0 A;  4A3D B;  2B8G A;  3OYY A;  5GRO A;  4K14 A;  4LF5 L;  3LX0 A;  1N8R C;  3CHB D;  2QIL A;  4DA2 A;  4X65 Q;  1DOK A;  3HP3 A;  4O42 A;  3MA2 B;  4JVZ A;  3FPU B;  1TT2 A;  1XPO A;  1TVX A;  3UDI A;  1LAC A;  5C5L A;  4K5W A;  3CCU A;  4UY8 C;  1YVC A;  1NUC A;  3E6Z X;  3I4N H;  4R4I A;  1PXU A;  2K4K A;  1TQO A;  4BY1 B;  2F0I A;  1TWG B;  2PMZ E;  5M5Y H;  2MHV A;  4HJA A;  2K5W A;  3GTP H;  3T56 B;  4B08 A;  4LJZ C;  5M3M B;  5JJL A;  1C7Y A;  1IXR A;  4A3B B;  3VA5 A;  5D65 A;  3L2P A;  2NVQ B;  2RF4 A;  1OO9 B;  4YWM A;  4A93 B;  2B29 A;  1EOT A;  4WJW A;  4DR5 L;  1ILQ A;  2LKV A;  4QMG A;  4FF2 A;  3S17 B;  4ZKB B;  3K5N A;  3VYT A;  1Y8P B;  3U4Z A;  4KN4 C;  4FO2 A;  5IGG A;  5LMN Q;  2PZW A;  1QUQ B;  2Z8L A;  4CKB A;  5BN3 A;  4GNX A;  3E0J A;  2B2T A;  2K05 A;  3TRE A;  1Y8N B;  4A3L G;  1PH8 A;  1HZB A;  4YHH L;  4OXP A;  4XQJ A;  1TKW B;  1YBY A;  1XNR L;  5M5W B;  4YCV A;  1XMQ Q;  3ULJ A;  5IOC A;  3OSO A;  5E4W C;  1IBM Q;  3JAM E;  1Q82 C;  4UPA A;  3PUW A;  3HOY B;  2JE6 I;  1CHP D;  3WOF A;  2J0T D;  5EKI A;  4U68 A;  2N8N A;  1ZXT A;  2JA5 H;  2C9O A;  2IJ0 A;  3DWP A;  4HJ7 A;  1TR5 A;  3E3X A;  1D8L A;  3O13 A;  3BDO A;  1MBY A;  4B3S L;  2K5N A;  5C4Z A;  1H9S A;  3SK4 A;  4UHV A;  2YTV A;  5E1F A;  2R3Z A;  1SAP A;  4B9X A;  1JB7 A;  1QNU A;  2KQ3 A;  2PYK A;  1CTM A;  4I7Z C;  3PO2 B;  1F2L A;  1RHP A;  1EY4 A;  1TWF H;  1B4O A;  5I4D A;  1PFS A;  2CWP A;  3RN5 A;  2NVT B;  3I4M G;  4C1N I;  3A5U A;  1YJ9 A;  4QL5 A;  4CHT B;  5K36 H;  1YIT A;  3E9I A;  3TDQ A;  3NTH A;  2PZT A;  2KHJ A;  1QZH A;  3BYT B;  2QDL A;  2MO0 A;  1KAA A;  1LT3 D;  4ME5 A;  4IUN A;  1HZC A;  5M5X B;  2IX3 A;  1WTV A;  5IYB H;  1JT8 A;  3D4D A;  4X3K A;  4PG3 A;  1O7L A;  1L1O C;  2GVA A;  3PF5 A;  4X64 L;  4OO1 H;  5CV8 A;  2D0P A;  4KKS A;  1BF4 A;  2HHH Q;  4Q5V A;  4XQQ A;  4QUC A;  3V96 A;  3J81 E;  1B70 B;  1JC7 A;  2CH4 A;  1XYI A;  3ONA B;  1S72 A;  2K7V A;  1GUG A;  3BYY B;  1CK1 A;  1JJG A;  2JXM B;  1K0S A;  1I6V C;  1VMP A;  3U50 C;  3DXJ C;  1SSO A;  2EYH A;  3J80 L;  4A3E G;  1O7Z A;  3DHQ A;  1XMQ L;  1YJW A;  2K5D A;  3SEB A;  4JI4 L;  1B1Z A;  4ZCK A;  1IBM L;  1Y1V G;  2G5D A;  4YY3 Q;  4X62 Q;  3NP8 A;  4JCV E;  4KI0 A;  4K5X A;  1DJR D;  1VMC A;  1KTK A;  4A3M G;  3CC2 A;  4KHP L;  2B2V C;  4P71 A;  5AJ3 Q;  2CFM A;  3HKZ B;  2PZU A;  3J80 c;  2UUB Q;  4ALP A;  1STG A;  4GLA C;  2F0N A;  2DJF C;  4N9P A;  3C46 A;  1H9R A;  4BBR G;  1FD7 D;  1AZP A;  2YV5 A;  1LTR D;  4JI7 L;  1IW7 C;  3RZD B;  1SYF A;  1SDF A;  3CQZ H;  1CKM A;  1WI5 A;  1A62 A;  3F8T A;  1GUS A;  2F0F A;  3HOW G;  5A35 A;  2EY2 A;  1X3E A;  1VQ4 A;  4TVA B;  4IJL A;  4V0B A;  4RCN A;  1X3G A;  2EVB A;  5IY0 A;  1SXT A;  4MIU A;  4G7H C;  3H3V I;  3GQB A;  3G48 A;  4ZUJ A;  1G6Z A;  4C56 C;  1I4G A;  4A3G H;  2FHT A;  1K8O A;  1PV4 A;  1PYB A;  1AZQ A;  5JJI A;  1BCP F;  4A3F G;  4M1U B;  5JEA G;  1CHQ D;  2TSS A;  3GTO H;  1Z6H A;  4IO9 A;  4A3J H;  1NMF A;  2K75 A;  3MAQ A;  1WVL A;  4IOC A;  4JOI C;  1QG7 A;  2C35 B;  3A0J A;  2RDG A;  4OX9 L;  5J39 A;  1NE3 A;  5IP7 H;  5CV5 A;  4RMF A;  2EYJ A;  3E5S A;  4GOP C;  2HHH L;  4KY6 A;  2JJQ A;  1TWC B;  3PQI A;  1YNN D;  4XYO A;  2Z4H A;  5JJZ A;  2E2H B;  1BCP D;  5CV7 A;  4MNO A;  1XXG A;  4PMB A;  3A8K E;  1G51 A;  3J7Z C;  3C2P A;  2VZA A;  1SNM A;  2RKS A;  1C4Q A;  2UXD L;  3GV3 A;  5KEE A;  3HRZ C;  2NTS A;  3TBI B;  2QDB A;  3S15 H;  4IFD I;  5EKK A;  2WP8 J;  2LFN A;  4JG2 A;  2AWN A;  1BXT A;  2F0L A;  1PTO F;  4YY3 L;  3RNU A;  4B9W A;  1KXL A;  1C8C A;  2JA5 G;  5FLX E;  1Q1E A;  1N33 Q;  3VR4 A;  2UUB L;  3KJP A;  5J22 A;  3S2D B;  1U5K A;  1RL2 A;  4YIJ A;  4A3C G;  2QEX A;  1Q1B A;  4DR4 L;  4IUQ A;  2DNE A;  3RUZ A;  1ASY A;  1I4H A;  2GA4 B;  1FNW A;  5C4X H;  4AQY L;  4Y52 H;  1QJO A;  3TSS A;  2FJ2 A;  2UUC L;  1H95 A;  2EY6 A;  1HNX Q;  3GTQ B;  1PTO D;  3MVV A;  5ELO A;  1HA6 A;  1FGU A;  3TP8 A;  2OQ0 A;  2BE5 D;  4KY5 A;  2VXW A;  1JMC A;  5BN5 A;  4P74 A;  1H9K A;  2WAC A;  4JV5 Q;  2MNA A;  4C3I G;  1FYC A;  4ABN A;  2WII B;  1WFQ A;  2ZM6 Q;  3GD7 A;  3CW2 C;  4TKO B;  4GKJ Q;  4AH6 A;  1UAP A;  2IHE A;  4G7Z C;  5IT9 L;  4RHS A;  2RSN A;  3GDE A;  5CV9 A;  1V9P A;  4LUV A;  5E3F A;  1H9M A;  2A5H A;  2JA7 H;  1PH7 A;  2DJG C;  2ALY B;  4WJ4 A;  3CCS A;  5COY A;  4G4K A;  2NVY B;  2L11 A;  1HTL D;  3RZO B;  1MJC A;  5JJK A;  2HD3 A;  2RHQ B;  4P75 A;  3D8G A;  1STA A;  2X6L A;  4HSV A;  2WB1 G;  4ILW A;  1MIU A;  2PO4 A;  2WFW A;  2Y0S G;  1GUO A;  3QWN A;  3VR5 A;  4AYB G;  1I4P A;  4OL7 A;  5KGU A;  1JWM D;  1NR4 A;  4DXF A;  5C0X I;  3IRB A;  4WFN 3;  1HQM C;  4L63 B;  5FOB B;  2X6G A;  2E8G A;  1I50 H;  1O7I A;  3HOU G;  1MSH A;  1VCI A;  2EY5 A;  4S3S A;  4HCE A;  2LXJ A;  1TS4 A;  2B2T C;  1KD1 C;  1Q12 A;  1E1O A;  3LNN A;  2NZH A;  2I07 B;  1PMR A;  4DR3 Q;  3C1E A;  2UUA Q;  2M2L A;  5ELC A;  1X32 A;  5CV4 A;  1BVS A;  2A6E D;  1AP0 A;  3S1M B;  1XWE A;  1N33 L;  5I9O A;  3TEH B;  1WTQ A;  4LWC A;  1I4Q A;  2F0S A;  1IHZ A;  3GTL B;  1I94 Q;  1GXD C;  1NSN S;  1ZKO A;  4JPB W;  1D5Z C;  2PQA A;  1V1Q A;  2YU9 H;  1NAP A;  2K1B A;  1SRU A;  4RH6 A;  1HXY D;  1ESF A;  1ET6 A;  1T9H A;  3H91 A;  1HNX L;  3CXC A;  3GTM B;  3K0Y A;  5CYU A;  1UE5 A;  4K0K Q;  4K8I A;  3M4Q A;  2B2W A;  4JI1 L;  3KJO A;  4JV5 L;  1MJE A;  3PIO A;  2XNA C;  4Z9C B;  4Y7N H;  2K28 A;  4DR2 Q;  4BY7 H;  4GKK L;  1OXV A;  3FEW X;  2R92 G;  4DK1 A;  5LMU Q;  1BBX C;  2BA1 A;  3OIP A;  3X3N A;  5DM6 3;  4BXX H;  2VUM B;  3URY A;  2CQO A;  1VQG A;  3SR1 A;  4HMI A;  2K52 A;  4M8A A;  4RKL A;  4CDF C;  4F8M A;  4JI6 Q;  3K7A B;  2PQE A;  1KDC A;  2CW0 D;  1K0R A;  2BOS A;  4X66 Q;  2AQ2 B;  4UP9 A;  2F0J A;  1GUN A;  1PH1 A;  1I3Q B;  3S14 B;  1GJX A;  1IBL L;  3V2T A;  1JJ2 A;  2EXD A;  3S1Q H;  1BOS A;  1Y14 B;  3ICE A;  1G2S A;  2CCZ A;  2RSO A;  2N78 A;  3K58 A;  4QY7 A;  4RKB A;  2LSS A;  3T1Y L;  3UDG A;  1CA6 A;  4IN3 A;  1A3V A;  3W1G A;  2B63 H;  2BH2 A;  5IIF A;  5TSS A;  1KC8 C;  1IYJ B;  3UE0 A;  3NBH B;  4DR3 L;  1X6O A;  4HN7 A;  3TS0 A;  2MJ8 A;  1KLG D;  2Z6K A;  3I70 A;  5BN4 A;  5ELD A;  3VR6 A;  2L4N A;  4DKA C;  2Z6B A;  4RWS C;  2I0Q A;  2JK8 A;  4ZLT F;  1JOK A;  5C3X A;  3K7U C;  2B2U C;  1Y1W G;  2CVR A;  3P20 A;  1U4P A;  1XNQ Q;  4F88 A;  1RTN A;  1GM5 A;  1YNN C;  4GZY C;  1I94 L;  3I55 A;  1A3U A;  5C4X G;  5C4J B;  2IT1 A;  1BCP C;  4AIM A;  3C3L A;  1EIG A;  5I2Y A;  5FLM H;  3GTK B;  3SXH A;  4V19 0;  3J7A V;  2FXQ A;  1Y1V B;  1R9T B;  1RKN A;  1SYC A;  2L12 A;  4RCO A;  4A3M B;  4DV1 L;  1PRT B;  1I6H B;  3M3Y B;  4RAU C;  4K0K L;  1CKN A;  5C44 G;  1Y8O B;  2EOT A;  3A55 A;  2WAQ G;  4DV0 L;  4HTH A;  1QZG A;  2BH8 A;  1K83 H;  2AHO B;  4DR2 L;  4IQZ A;  2Z9H A;  3CAM A;  4BBR B;  2VQE Q;  2UXC Q;  1FJG L;  1D7Q A;  2Z0S A;  3L9A X;  1U0L A;  3PUZ A;  3HOW B;  2K14 A;  4DN4 M;  3FKI G;  4O2D A;  4CKE A;  3PIO 3;  3C1F A;  1PTO C;  3W2D A;  1U4R A;  1E0B A;  4X3T A;  2BE5 C;  5I6Y A;  4DK3 C;  2YTX A;  2D62 A;  4J15 A;  1II3 A;  2MPM A;  2PNH A;  1S5B D;  3GTG B;  1J8I A;  4B3R Q;  1VQM A;  3NE5 B;  4DAY B;  4F7X A;  4A3F B;  3L7Z C;  4DK6 C;  5LL6 S;  1E3P A;  5M3F B;  4UP7 A;  1PH2 A;  3SE0 A;  3AB9 A;  1NBW A;  3MEH A;  1Y69 U;  2BDO A;  4JBK A;  4LF8 Q;  4LK1 C;  4O1N A;  3J7A F;  3NEL A;  4UP8 A;  3FPP A;  1SNP A;  1TS2 A;  2E2J H;  3S24 A;  3W3A A;  3SK5 A;  3K5L A;  1EEF D;  1CUK A;  5JVG 3;  2R93 G;  1GHJ A;  1ENF A;  2F0U A;  2PI2 E;  4TRD A;  4LF4 L;  2Q2T A;  3MWY W;  5FKA C;  1S5D D;  4WJ3 M;  2BDN A;  4BA1 I;  5KYL A;  1HH2 P;  3MTS A;  3BVG A;  1Q8K A;  4I65 A;  4DU9 A;  4PQX A;  4BBS H;  1LTI D;  3HZX A;  1VQK A;  3MXU A;  5L37 A;  2R7Z G;  2XN9 C;  4O0A A;  4IUT A;  3F1Z A;  1N32 Q;  4CDC C;  4RGM A;  2ZXR A;  3H94 A;  3PSI A;  2E2I B;  1EIH A;  3KLW A;  3BDC A;  2F0W A;  1AEX A;  2NZ1 D;  4DR7 Q;  2JA5 B;  4HJ9 A;  4KHV A;  3QB3 A;  4JBJ A;  1B50 A;  4LAA A;  2JA8 G;  1A2U A;  3OWE B;  1DZ1 A;  1M4V A;  3PUV A;  2I46 A;  4ZKC B;  4QGU A;  1VQD A;  3SK6 A;  4A3K G;  4H02 A;  1YZ6 A;  2DGY A;  2N3S A;  3H0G H;  4NB3 A;  4GOP B;  4P72 A;  3ZYY X;  5E7N A;  3R2T A;  4E6I A;  4QCL A;  3PO3 H;  1YJN A;  3NWS A;  4L5R C;  4A3I G;  4IUP A;  2UXC L;  3H3V H;  1B2T A;  4LFA Q;  3QJY A;  3T51 B;  1IBK L;  2JA6 H;  1EIY B;  1PZJ D;  1SR3 A;  3HOZ G;  1F9P A;  2KED A;  2EYL A;  1N34 L;  3QR8 A;  4C3I B;  4CBV A;  3FRP B;  2JSO A;  1FGB D;  3NTK A;  3PF4 A;  2FFK B;  2F3I A;  3OWF A;  1N36 Q;  1X3F A;  5NUC A;  5DAU A;  1LT6 D;  4B3R L;  3CF5 A;  4A3D H;  1B9N A;  4IPD A;  5EPJ A;  2RVL A;  1AW7 A;  1M8A A;  4LF8 L;  2YTY A;  1X65 A;  4OIJ A;  5C5M A;  1VQF A;  1Q3L A;  1CT1 D;  4ID6 A;  4RA8 A;  5DEH A;  4ZAI A;  4DV6 L;  1PH9 A;  5IOD A;  4Q0F A;  3BZC A;  1TWA B;  2WB1 B;  3I4O A;  3X3M A;  3A7L A;  2Y0S B;  1UE7 A;  2CW0 C;  5CGK A;  1TY0 A;  1LT5 D;  5J3B A;  1K8G A;  4BY1 H;  1XX8 A;  4IFD H;  3S2H B;  3CCE A;  3H15 A;  3CRL C;  3N6R A;  2A6H D;  3D31 A;  2KBN A;  1TWG H;  3HFZ B;  5D3D A;  3P1H A;  2K32 A;  1TII D;  3T13 A;  5M3M H;  4X65 L;  3I91 A;  3I72 A;  2JQO A;  2XRS D;  2L15 A;  4HCS A;  4JI3 Q;  5FLM G;  3HOU B;  4A3B H;  1GUT A;  2NVQ H;  1D6E C;  4CKC A;  4A93 H;  2EYP A;  3S17 H;  4KJO A;  3CC4 A;  1YI2 A;  1B3Q A;  1QOH A;  2RBM A;  3IAY A;  4FF3 A;  4DR7 L;  3TZU A;  5AFW A;  3Q6S A;  2I5L X;  2Q8R E;  4R1J A;  4C3J B;  3AYH B; 
#chains in the Genus database with same CATH homology
 3DWQ A;  2A74 C;  2QEJ C;  4RFB A;  4DF7 A;  1ILP A;  4NW2 A;  4EGV A;  2B2W C;  3EJI A;  1ESR A;  3IFD A;  1HTP A;  3DM1 A;  1T5X D;  1BNZ A;  3CKI B;  4KV6 A;  2F1M A;  4ZQ3 A;  3TN2 A;  4DGZ A;  1BR9 A;  2NN6 G;  5IGE A;  2KHS A;  3GTJ B;  5FO8 B;  3S1N B;  1MD2 D;  2IPK D;  2R92 B;  4L8J A;  1LAB A;  1F9S A;  2XWJ B;  2HCI A;  1WTP A;  1O78 A;  2EJG C;  2K6A A;  3SDZ A;  2N88 A;  1FR3 A;  3S9W A;  3KBX A;  2F03 A;  3ND8 A;  3HOV B;  3M4O B;  1F9R A;  1JE4 A;  2EZV A;  3QG1 A;  5C0X H;  4LMQ D;  5C6A A;  2EE1 A;  3K6O A;  3H3V C;  2F0G A;  1SNO A;  1TWH B;  2OT2 A;  3M85 A;  1YNJ D;  1PZK D;  4C3H B;  4C2M B;  1JR0 D;  2NVX B;  1D1I A;  3OIQ A;  2PNR C;  1DYQ A;  2ZT9 C;  2E75 C;  1PYW D;  2NUC A;  1SYD A;  3U9S A;  3VYU A;  1FNV A;  2F0D A;  2OF1 A;  4IAL A;  1Y1W B;  2AUK A;  5G3L D;  1ENC A;  4P2C B;  1ICW A;  1XTC D;  2KJX A;  4IUR A;  4DNT B;  2F0O A;  3OMG A;  5KYI A;  4DNR B;  1SE3 A;  3PMF A;  2EY1 A;  3MXG A;  2HQE A;  4H7B A;  2AQ1 B;  1CZW A;  1R4P B;  3FDT A;  1PFM A;  4R9W A;  3R8B A;  4FXG C;  5C44 B;  3A54 A;  3LWE A;  1LTG D;  3PUY A;  4J6H A;  3IL8 A;  2FIN B;  2SOB A;  4NP5 A;  3K57 A;  2JEB I;  1ET9 A;  2CQA A;  5JAV A;  2B2Y C;  1S4Z A;  1HRJ A;  1X3Q A;  1BCP B;  3FKI B;  3RD4 A;  5KNC A;  2MGS A;  4K6L A;  1GUW A;  2WKC A;  3MHB A;  4H0L C;  1BQQ T;  2AUJ D;  3SVM A;  4IFD G;  2F0E A;  5EPK A;  3HG9 A;  4K6D A;  1DON A;  1FNU A;  2F0Q A;  1A3T A;  4J8Q A;  1KAB A;  3T4A C;  1BUV T;  1EQT A;  4N9T A;  5K36 G;  4DXG A;  2NB0 A;  3D6C A;  2R93 B;  3OPO A;  4FF1 A;  2D9U A;  3R3O A;  5JPM C;  1B44 D;  1EY9 A;  2QKI C;  1PTO B;  2KVM A;  5FLX L;  1Z7T A;  2F0P A;  1WD1 A;  2BCO A;  4H44 C;  4OO1 G;  1EWC A;  1EZ8 A;  1JOR A;  4KD3 A;  2R7Z B;  3SK8 A;  1X3P A;  1EY5 A;  2X69 A;  2EJM A;  3I8Z A;  3EQL C;  1L0Y B;  4CJ2 C;  2JA8 B;  4FXD A;  3MFG A;  3P7J A;  4A3K B;  2HUG A;  3H6M A;  2FMC A;  2F0K A;  1JWU D;  4FXK C;  1AN8 A;  4IFD J;  5IGD A;  4A3I B;  2ID0 A;  5KNB A;  4QB4 A;  4DAP A;  2A73 B;  3HOZ B;  3NBH A;  1MSG A;  3AU7 A;  2NBF A;  4QUF A;  3MZ5 A;  5CBE E;  3BG3 A;  4XQN A;  1Q90 A;  4MN3 A;  1SFO B;  3S16 B;  1D5M C;  2E2D C;  1VF7 A;  1SEB D;  4FNF A;  3FVQ A;  1JCK B;  1I4X A;  3BVZ A;  2AWO A;  1EWH A;  3MFY A;  2JP1 A;  3FMC A;  2G9D A;  1JOO A;  4HAE A;  3NTI A;  2BA0 A;  5FK9 C;  3S1R B;  2VNU D;  1DOL A;  3I90 A;  2E74 C;  4HR7 B;  3K5M A;  4RGN A;  3I4M B;  1IL8 A;  1CA5 A;  3L3O C;  1G2T A;  1A15 A;  2SDF A;  5C0X J;  1V8Q A;  4OHJ A;  3WDN A;  1PRT F;  4DAY A;  1ZEQ X;  3NPP A;  2KEE A;  2SEB D;  2PCF B;  4IZ8 A;  2ENB A;  4BS9 A;  3PIP 3;  2F0T A;  1KDB A;  2M00 A;  1V1P B;  3ITP A;  4X3U A;  5A2Q E;  1QIL A;  4IUU A;  2VB3 X;  4A3E B;  5FO7 B;  3NK9 A;  1PRT D;  1TS5 A;  5CV6 A;  4U67 3;  1HFN A;  4WRD A;  2RQX A;  1EYD A;  1F2M A;  5C3E B;  1JOQ A;  2O5I C;  1RD9 D;  1VDZ A;  4QIW B;  1OXT A;  3R2I A;  3QOL A;  3HOX B;  5EBC A;  1ML0 D;  5I6W A;  3QOJ A;  1ROD A;  3T53 B;  4FVM A;  1IYV A;  3QO2 A;  2EPB A;  3KBG A;  1IKL A;  5KIX A;  3KLR A;  4XYQ A;  4KJN A;  3I4N B;  1HUM A;  1STE A;  2OXP A;  4NKL A;  2RDH A;  1PFN A;  5M5Y B;  2AQ3 B;  1E2Z A;  3TZD A;  2YYZ A;  4KY7 A;  1NCV A;  3GTP B;  3BVM A;  1MI2 A;  1J9O A;  1SBB B;  5CMD A;  1CZG A;  2DY8 A;  1NR2 A;  1IKM A;  4ZK9 B;  1R4Q B;  1LTT D;  3GP7 A;  4EVO A;  2KUM A;  5F2D A;  4RGT A;  3OOC A;  3NUC A;  3G6J B;  3GO5 A;  3KLS A;  2LS0 1;  3A56 A;  1PLF A;  2ICI A;  2KEC A;  4ULL A;  4XDX A;  2IL8 A;  1WTR A;  4FF4 A;  1D2B A;  2G9H D;  2O5J C;  3OW7 A;  4DFA A;  3EVQ A;  5IGB A;  1G29 1;  2IX1 A;  1SMY D;  2A6E C;  5I2X A;  2PPB C;  2XIW A;  4XT1 B;  2L55 A;  5EPL A;  2O4X A;  2EYF A;  1HUN A;  3F2U A;  3DUZ A;  5JEA H;  1EYC A;  1TWF B;  1ZYR D;  1DCZ A;  1JIC A;  2WIN B;  1A6X A;  1QE6 A;  1RCV D;  3NSW A;  2HCC A;  4OGQ C;  3HGB A;  1U9R A;  2F3V A;  2ZXP A;  2IW3 A;  2XSC A;  2IWH A;  3I4L A;  1GHK A;  1IYU A;  1W6K A;  3VR3 A;  3DEP A;  4H13 C;  3OHX C;  4AYB B;  3AMU A;  1STB A;  5EJW A;  2OEO A;  2LMC B;  1EU3 A;  1QWY A;  4F87 A;  4BA2 I;  4ZUI A;  4DK0 A;  2DN8 A;  5EQ0 A;  2SNM A;  5ELF A;  4KKU A;  3D4R A;  2Q8T A;  4WOR A;  3JAM L;  3Q24 A;  3J80 E;  5HGT A;  1EY6 A;  2RDF A;  3M4Y A;  2WKD A;  5ELE A;  3I3C A;  5M9O A;  4L6T B;  2DNC A;  1WD0 A;  1KNE A;  3A7A B;  3N52 A;  1HCZ A;  5IGF A;  3CQZ B;  4CGY B;  1F2Y A;  2TMP A;  4RGO S;  1K8M A;  3VR2 A;  1S5C D;  3G7L A;  2NN6 I;  4ODG A;  1PRT C;  4KN7 C;  2Z1C A;  3VYS A;  5CBA E;  5I9P A;  5HUR A;  3A8J E;  4RHR A;  3DEO A;  4TQU S;  2NTT A;  4A3G B;  1HPC A;  2SNS A;  3UI2 A;  4K2K A;  1EL0 A;  4HMJ A;  3GTO B;  4EQP A;  4A3J B;  2JEA I;  1STY A;  1Z47 A;  1V43 A;  4KD4 A;  4NMZ A;  1B3A A;  1TU2 B;  5D3I B;  2R61 A;  3TP5 A;  3D6W A;  4K5V A;  1SE2 A;  1VF5 C;  3WOE A;  1EZ6 A;  5EBD A;  1CFM A;  3K59 A;  2IX0 A;  2B2U A;  1LLR D;  1DOM A;  1EEI D;  2EDG A;  4EQO A;  3NHH A;  1H9S B;  1LTA D;  2EXZ A;  3J81 L;  5G3L F;  1O80 A;  1EY7 A;  1WTO A;  3CU7 A;  5DNF A;  3S15 B;  4HSP A;  2L5T A;  5JOB A;  2L1B A;  3ERQ A;  2O2L D;  2F3W A;  2C5C A;  2XWB B;  2E76 C;  3IFT A;  1SJE D;  5C3W A;  2F4I A;  1UEA B;  3D4W A;  4KTA A;  1WTW A;  3KK7 A;  4NDX A;  1B53 A;  1O7Y A;  1S5E D;  3TME A;  1LO5 D;  1OXX K;  3MXP A;  1CQF A;  1TS3 A;  5C4X B;  2J7Z A;  5CR3 A;  1SJH D;  2DY7 A;  4EQN A;  1F2Z A;  3KF8 A;  2XRQ D;  3EFX D;  2PW7 A;  1KNA A;  3BDL A;  3SHL A;  2F0M A;  1PFB A;  4G57 A;  3J7Y W;  1PZI D;  2WAQ B;  1MGS A;  2XVS A;  1RTO A;  2A69 D;  1B9M A;  1LV9 A;  1DM0 B;  2LY7 A;  2ZXO A;  1SMY C;  3EA6 A;  3T16 A;  4X3S A;  2JA7 B;  3PUX A;  3LWU A;  4IUV A;  1S5F D;  3R93 A;  4QF4 A;  1RDP D;  1SYB A;  3NQI A;  4XIG S;  5IT9 E;  1EU4 A;  3BZD B;  1CM9 A;  1U4M A;  2R6G A;  4DAV A;  1SND A;  1ZYR C;  3KUP A;  2KOL A;  1GOZ A;  3Q0A A;  1T5E A;  5E4X A;  1PDQ A;  2B8F A;  1I50 B;  4R8N A;  2K5Q A;  1HFG A;  1JQY D;  2N55 A;  4JBW A;  3P75 A;  5JEA J;  1ONL A;  4KK7 A;  4KKT A;  4OO1 I;  2D5D A;  5COR A;  5EKL A;  5DM7 3;  2HDL A;  1WCM B;  3VYR A;  2JYO A;  2L9H A;  2YU9 B;  3RLF A;  1AFP A;  2A6H C;  3ERO A;  3I73 A;  1D1K A;  4PMW A;  1STH A;  1E2W A;  2A68 D;  3HS0 C;  5ELB A;  4FYD A;  3IKJ A;  1UNS A;  4Y7N B;  4PV1 C;  4BY7 B;  3NQT A;  2CHB D;  1SNC A;  3BS1 A;  2EYO A;  1LT4 D;  1G91 A;  1LTB D;  1D5X C;  1EYA A;  5JPN C;  3NBI A;  5C0X G;  1BO0 A;  1U4L A;  2H4O A;  4OIK A;  3S1Q B;  4UAI A;  2H1E A;  1V1P A;  4CJ1 B;  4XXE A;  4C3J G;  5EGT A;  2PMZ B;  2B63 B;  3D3R A;  1PTO H;  1F9Q A;  3MXN A;  4CJ0 B;  3NXW A;  2KA7 A;  1V1O A;  4K8J A;  2NYZ D;  1HA5 A;  1OXS C;  1HHV A;  2EYM A;  3M7G A;  5T1G A;  3PV0 A;  2HDM A;  3Q23 A;  2V4D A;  1H9J A;  2KCN A;  5ISR A;  2ICE C;  1SE4 A;  5FO9 B;  1YNJ C;  3VA7 A;  1JB3 A;  1JWS D;  1LTS D;  2QF7 A;  1OXU A;  2K04 A;  1SYG A;  3MC0 B;  4JK1 C;  4KHZ A;  1K83 B;  1W6J A;  1STN A;  3M7N A;  3DWA A;  2B2V A;  4G7O C;  5CC4 A;  4XTC S;  2K01 A;  4C1N K;  2M9V A;  2Z4I A;  2Q8I B;  1WTX A;  1UUP A;  5IGC A;  2B39 A;  1RF2 D;  2J4X A;  1EFI D;  2EJF C;  1DD2 A;  2F0H A;  1ENA A;  5D14 A;  4C3H G;  4UDU C;  1EQV A;  4BWG B;  2L0C A;  2F0V A;  4XT3 B;  2QCP X;  5LHY 1;  1KLU D;  3TP7 A;  1QCB D;  2WV6 D;  5KND A;  1SNQ A;  2RA4 A;  5JVH 3;  1RJT A;  4TSS A;  1HQR D;  1C48 A;  2PW5 A;  2VB2 X;  5C4H A;  2A69 C;  1BDO A;  5T1I A;  1E2V A;  2NWG A;  3V05 A;  3RMH A;  2E2J B;  1EY8 A;  1QB5 D;  2K03 A;  4ZYS A;  3ND9 A;  3DMU A;  4MHE A;  1Q8I A;  2KCC A;  4BBS B;  2D2C C;  1DXM A;  4PNY A;  3HEJ A;  3K5O A;  1I4R A;  5J1Z A;  5KRU A;  1CQV A;  2K33 A;  5A2Q L;  1G8Z D;  1F77 A;  3OMC A;  3TP6 A;  3QIA A;  3H09 A;  2FMM A;  4FP5 D;  1IW7 D;  3H0G B;  1TY2 A;  2NN6 H;  3PO3 B;  2B2Y A;  2MUY A;  3CRK C;  1SYE A;  1A2T A;  4J1M A;  2JA6 B;  4K2L A;  1CI3 M;  3GV6 A;  4HED A;  4PMC A;  5LL6 X;  3U9O A;  3NWT A;  3A8I E;  3KLS X;  2A68 C;  1QNK A;  1KDA A;  2MP1 A;  1L0X B;  4R8I A;  3Q22 A;  4KMU C;  4ZRZ A;  1EY0 A;  4A3D B;  2B8G A;  4K14 A;  3LX0 A;  3CHB D;  2QIL A;  4DA2 A;  1DOK A;  3HP3 A;  4O42 A;  3MA2 B;  3FPU B;  1TT2 A;  1TVX A;  1LAC A;  5C5L A;  4K5W A;  3E6Z X;  1NUC A;  1PXU A;  1TQO A;  4BY1 B;  2F0I A;  1TWG B;  2MHV A;  2K5W A;  3T56 B;  4B08 A;  4LJZ C;  5M3M B;  4A3B B;  3VA5 A;  5D65 A;  2NVQ B;  1OO9 B;  4A93 B;  4WJW A;  1EOT A;  4FF2 A;  3S17 B;  1ILQ A;  2LKV A;  4QMG A;  4ZKB B;  3K5N A;  3VYT A;  1Y8P B;  4KN4 C;  4FO2 A;  5IGG A;  2PZW A;  2Z8L A;  4CKB A;  5BN3 A;  3E0J A;  2B2T A;  2K05 A;  1Y8N B;  4XQJ A;  1TKW B;  5M5W B;  5IOC A;  3OSO A;  5E4W C;  3JAM E;  3PUW A;  3HOY B;  2JE6 I;  1CHP D;  3WOF A;  2J0T D;  5EKI A;  4U68 A;  1ZXT A;  2C9O A;  2IJ0 A;  3DWP A;  1TR5 A;  3O13 A;  3BDO A;  1MBY A;  5C4Z A;  1H9S A;  3SK4 A;  5E1F A;  2R3Z A;  1SAP A;  4B9X A;  1QNU A;  2KQ3 A;  2PYK A;  1CTM A;  4I7Z C;  3PO2 B;  1F2L A;  1RHP A;  1EY4 A;  1B4O A;  5I4D A;  2NVT B;  4C1N I;  4CHT B;  5K36 H;  3TDQ A;  3NTH A;  2PZT A;  3BYT B;  1KAA A;  1LT3 D;  4ME5 A;  4IUN A;  5M5X B;  2IX3 A;  1WTV A;  3D4D A;  4X3K A;  1O7L A;  4OO1 H;  5CV8 A;  4KKS A;  1BF4 A;  4Q5V A;  4XQQ A;  4QUC A;  3V96 A;  3J81 E;  1JC7 A;  1XYI A;  3ONA B;  2K7V A;  1GUG A;  3BYY B;  1CK1 A;  2JXM B;  1I6V C;  1VMP A;  3DXJ C;  1SSO A;  2EYH A;  3J80 L;  1O7Z A;  3DHQ A;  2K5D A;  3SEB A;  1B1Z A;  3NP8 A;  4KI0 A;  4K5X A;  1DJR D;  1VMC A;  1KTK A;  2B2V C;  3HKZ B;  2PZU A;  1STG A;  2F0N A;  4N9P A;  3C46 A;  1H9R A;  1FD7 D;  1AZP A;  1LTR D;  1IW7 C;  3RZD B;  1SYF A;  1SDF A;  1GUS A;  2F0F A;  5A35 A;  2EY2 A;  4V0B A;  4RCN A;  2EVB A;  1SXT A;  4MIU A;  4G7H C;  3GQB A;  4ZUJ A;  1G6Z A;  4C56 C;  1I4G A;  2FHT A;  1K8O A;  1AZQ A;  1BCP F;  4M1U B;  5JEA G;  1CHQ D;  2TSS A;  1Z6H A;  3MAQ A;  1WVL A;  1QG7 A;  2RDG A;  5J39 A;  5CV5 A;  2EYJ A;  3E5S A;  4KY6 A;  1TWC B;  4XYO A;  1YNN D;  2Z4H A;  5JJZ A;  2E2H B;  1BCP D;  5CV7 A;  1XXG A;  4PMB A;  3A8K E;  3C2P A;  1SNM A;  2RKS A;  1C4Q A;  3GV3 A;  5KEE A;  3HRZ C;  2NTS A;  3TBI B;  2QDB A;  4IFD I;  5EKK A;  2WP8 J;  2LFN A;  2AWN A;  1BXT A;  2F0L A;  1PTO F;  4B9W A;  1C8C A;  5FLX E;  1Q1E A;  3VR4 A;  5J22 A;  3S2D B;  4YIJ A;  1Q1B A;  4IUQ A;  2DNE A;  3RUZ A;  1I4H A;  2GA4 B;  1FNW A;  1QJO A;  3TSS A;  2FJ2 A;  2EY6 A;  3GTQ B;  1PTO D;  3MVV A;  1HA6 A;  3TP8 A;  2BE5 D;  4KY5 A;  2VXW A;  5BN5 A;  1H9K A;  2WAC A;  4C3I G;  1FYC A;  4ABN A;  2WII B;  3GD7 A;  4TKO B;  1UAP A;  4G7Z C;  5IT9 L;  4RHS A;  2RSN A;  5CV9 A;  5E3F A;  1H9M A;  2A5H A;  5COY A;  4G4K A;  2NVY B;  2L11 A;  1HTL D;  3RZO B;  3D8G A;  1STA A;  2X6L A;  4HSV A;  4ILW A;  2PO4 A;  3QWN A;  1GUO A;  3VR5 A;  1I4P A;  4OL7 A;  5KGU A;  1JWM D;  1NR4 A;  4DXF A;  5C0X I;  4WFN 3;  1HQM C;  4L63 B;  5FOB B;  2X6G A;  1MSH A;  1VCI A;  2EY5 A;  4S3S A;  4HCE A;  1TS4 A;  2B2T C;  1Q12 A;  3LNN A;  2I07 B;  1PMR A;  3C1E A;  2M2L A;  5ELC A;  1X32 A;  5CV4 A;  2A6E D;  1AP0 A;  3S1M B;  1XWE A;  5I9O A;  1WTQ A;  1I4Q A;  2F0S A;  1IHZ A;  3GTL B;  1GXD C;  1NSN S;  1ZKO A;  1D5Z C;  1NAP A;  2K1B A;  4RH6 A;  1HXY D;  1ESF A;  1ET6 A;  3H91 A;  3GTM B;  3K0Y A;  5CYU A;  4K8I A;  2B2W A;  2XNA C;  4Z9C B;  2K28 A;  1OXV A;  3FEW X;  4DK1 A;  1BBX C;  2BA1 A;  3OIP A;  3X3N A;  5DM6 3;  2VUM B;  3URY A;  3SR1 A;  4HMI A;  4M8A A;  4F8M A;  4RKL A;  3K7A B;  2PQE A;  1KDC A;  2CW0 D;  2BOS A;  2AQ2 B;  2F0J A;  1GUN A;  1I3Q B;  3S14 B;  1GJX A;  3V2T A;  1BOS A;  1G2S A;  2RSO A;  3K58 A;  4RKB A;  1CA6 A;  4IN3 A;  1A3V A;  5IIF A;  5TSS A;  4HN7 A;  2MJ8 A;  1KLG D;  3I70 A;  5BN4 A;  5ELD A;  3VR6 A;  2L4N A;  4RWS C;  4ZLT F;  1JOK A;  5C3X A;  2B2U C;  2CVR A;  3P20 A;  1U4P A;  4F88 A;  1RTN A;  1YNN C;  4GZY C;  1A3U A;  5C4J B;  2IT1 A;  1BCP C;  3C3L A;  1EIG A;  5I2Y A;  3GTK B;  3SXH A;  4V19 0;  3J7A V;  1Y1V B;  1R9T B;  1RKN A;  1SYC A;  2L12 A;  4RCO A;  4A3M B;  1PRT B;  1I6H B;  3M3Y B;  4RAU C;  1Y8O B;  2EOT A;  3A55 A;  4HTH A;  4IQZ A;  4BBR B;  3L9A X;  3PUZ A;  3HOW B;  4DN4 M;  4CKE A;  3PIO 3;  3C1F A;  1PTO C;  3W2D A;  1U4R A;  1E0B A;  4X3T A;  2BE5 C;  5I6Y A;  2D62 A;  1II3 A;  2MPM A;  1S5B D;  3GTG B;  1J8I A;  3NE5 B;  4F7X A;  4A3F B;  3L7Z C;  5LL6 S;  5M3F B;  3SE0 A;  3AB9 A;  3MEH A;  1Y69 U;  2BDO A;  4LK1 C;  4O1N A;  3J7A F;  3FPP A;  1SNP A;  1TS2 A;  3W3A A;  3SK5 A;  3K5L A;  1EEF D;  5JVG 3;  1GHJ A;  1ENF A;  2F0U A;  4TRD A;  3MWY W;  5FKA C;  1S5D D;  2BDN A;  4BA1 I;  5KYL A;  3MTS A;  3BVG A;  4I65 A;  4DU9 A;  4PQX A;  1LTI D;  3HZX A;  3MXU A;  2XN9 C;  4IUT A;  4RGM A;  2ZXR A;  3H94 A;  2E2I B;  1EIH A;  3BDC A;  2F0W A;  1AEX A;  2NZ1 D;  2JA5 B;  4KHV A;  3QB3 A;  1B50 A;  4LAA A;  1A2U A;  3OWE B;  1DZ1 A;  1M4V A;  3PUV A;  2I46 A;  4ZKC B;  3SK6 A;  3ZYY X;  3R2T A;  4E6I A;  4QCL A;  3NWS A;  4IUP A;  1B2T A;  3QJY A;  3T51 B;  1PZJ D;  1F9P A;  2KED A;  2EYL A;  4C3I B;  4CBV A;  3FRP B;  2JSO A;  1FGB D;  3NTK A;  2FFK B;  3OWF A;  5NUC A;  5DAU A;  1LT6 D;  1B9N A;  5EPJ A;  2RVL A;  1AW7 A;  1M8A A;  4OIJ A;  5C5M A;  4ID6 A;  1Q3L A;  1CT1 D;  4RA8 A;  5DEH A;  4ZAI A;  5IOD A;  4Q0F A;  1TWA B;  2WB1 B;  3X3M A;  3A7L A;  2Y0S B;  2CW0 C;  5CGK A;  1TY0 A;  1LT5 D;  4IFD H;  1XX8 A;  3S2H B;  3CRL C;  3N6R A;  2A6H D;  3D31 A;  5D3D A;  3P1H A;  2K32 A;  1TII D;  3T13 A;  3I91 A;  3I72 A;  2XRS D;  3HOU B;  4HCS A;  1GUT A;  1D6E C;  4CKC A;  2EYP A;  4KJO A;  1QOH A;  2RBM A;  3IAY A;  4FF3 A;  3TZU A;  5AFW A;  3Q6S A;  2Q8R E;  4C3J B;  5K5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...