4OWXB

Structural basis of soss1 in complex with a 12nt ssdna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
b'TFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*TP*TP*TP*TP*TP*TP*TP*TP*T)-3')
molecule tags Dna binding protein/dna
source organism Homo sapiens
publication title Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
pubmed doi rcsb
total genus 27
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4owxB00
5IYCG 3I4NH 2OQ0A 2B63G 1K83H 2ZJQA 3I4NG 1YVCA 2EIFA 3AEVA 4JI7Q 1TWFH 2OTLA 2Y0SG 2B29A 2JE6I 4EX5A 3F2BA 3CCJA 5E7NA 1HNXQ 3RR5A 4BY1H 4O2DA 4DR2L 4JYAQ 2ZTDA 2Y0SE 4A3MH 4AQYL 1OXSC 2LXKA 4LF9Q 3CC7A 2UUBQ 1KQSA 3D0FA 4B3SQ 2HIXA 4DR7L 3RZOH 1MIUA 4LFAQ 2JA8H 4OO1G 1HNWQ 5FLMH 4JI6Q 1CSPA 4DV4L 3D31A 3G71A 3M9BA 4YWMA 4DK6C 3K0XA 2VL6A 1ASZA 3HOUH 1L1OA 1UE6A 2N8NA 4JI5L 3GTMH 3M85A 3HOYH 4A93H 1HZBA 2MO0A 2JA6G 2E8GA 3HOXG 4DNIA 2K14A 3HKSA 3CCMA 1VQAA 3S1RH 1V9PA 3GTJH 4DV1Q 1AH9A 1FGUA 3ULJA 4MZ9A 1A8VA 1W2BA 4WJ3M 4DR1Q 1E7ZA 3FKIG 2Z0SA 1PVOA 2JJQA 4DV4Q 1Q86C 2BA0A 1X3GA 3H3VI 2CQOA 5C44H 5BR8L 1M90C 3S16H 4NXNL 4LF4L 2VY3A 2NZHA 1VQFA 4R4TA 2K75A 1Q81C 3UDIA 2VZAA 1HZAA 3E0EA 1VQEA 3T1HQ 1R9TH 4YWKA 4LF5Q 4LF8L 2VNUD 5C4XH 3ERSX 3W5OA 3KFUA 3J7ZC 1IZ6A 3S24A 1EWIA 4WJ4A 4L5RC 3EBEA 4DAMA 1TWAH 2JA8G 4QJFA 5JJLA 3GD7A 3HOZG 3GTKH 4X64Q 2CWPA 1BKBA 4C3HH 2AWOA 1IBMQ 1N33Q 2K5HA 4BA2I 1PH8A 2JA5H 1JE5A 4DV2Q 1X3FA 2IHFA 2E2HH 1QZHA 4KHPQ 1BVSA 1N8RC 1C0AA 2GN5A 4OWXB 3RLFA 4K0KQ 4LF8Q 4B3RL 4OXPA 3S1MH 2H5XA 1I6HH 4OO1I 2A1AA 1E1TA 2NVYH 2B63H 1XNQQ 1KRTA 4A3LG 1L1OC 4ME3A 2GVBA 1YIJA 1PH4A 3PF4A 4Y52H 3PSIA 4HIMA 1VQ8A 3TRZA 2VQEL 4DV0Q 1NMGA 3GDEA 1YEZA 4RMFA 4IOCA 2E2IH 4JI0Q 1WYDA 1JT8A 1I50H 4QL5A 4NXML 1OXTA 1PHJA 4L5SA 3S17H 3G48A 3I7FA 2HHHL 1XMQQ 4LFBQ 5HGQA 4B3RQ 4GKJL 2IHEA 3KDFA 3KF6B 4GOPA 4UP9A 1PH3A 5C4XG 3J81c 1IXRA 1GVPA 2D62A 2IT1A 1K9MC 2NN6I 4JG2A 1SR3A 3RLNA 4A3JG 1HR0L 5LMUL 1B8AA 1QZGA 5GAGC 1WOCA 3BJUA 5EAYA 2UUAL 4OX9L 3AFPA 2F4VL 5M5YH 2WP8J 3AQQA 4AYBE 5IYBG 3HOZH 2OTJA 4A3FG 5M3MG 3TS0A 1PH5A 2RCNA 3FKIH 2AMCB 1EUJA 1KL9A 5FJ8H 4YY3L 3UE1A 5C0XG 5FJ8G 2HHHQ 2I0QA 2NVTH 4LFBL 1XPOA 3TQYA 1WCMH 1X54A 5IWAQ 5IT9c 2Q2TA 4UP8A 1SFOH 2N49A 3I4OA 1VQLA 4TQUS 1EFWA 4B3SL 4OX9Q 1IBLQ 1HNWL 3M4QA 4BY1G 1Z9FA 1S72A 4BY7H 1GKHA 5IYDG 5LMNQ 4H02A 5IYDH 4JI4Q 1JJCB 4DR5L 4DR3Q 3I4MG 1X65A 1VQJA 2CKZB 5IWAL 4P72A 5JJKA 5FLMG 3EIVA 3W1GA 2CFMA 4YHHL 3T1YQ 1YJNA 1IBKQ 1A0IA 3K8AA 4LF7Q 3AFQA 3RNUA 3S2HH 3LGJA 1I5FA 2AWNA 2C35B 2I5HA 3PV0A 3L2PA 1VQDA 3H3VH 2HQLA 3OTOL 1IBLL 2V1CC 5C4JH 3H15A 1X55A 3A5UA 3PO3H 5LMNL 3HOWG 4AH6A 1Y1WH 1YHQA 4IPCA 4PZ6A 1YI2A 4LF4Q 1HZCA 2N78A 1QUQB 1Y14B 3F1ZA 1H95A 1PH1A 2N3SA 4TVAB 4LNQA 4XTCS 5IP7G 3HFZB 3PUZA 4A3DG 4IPGA 1S40A 3OTOQ 1VQ7A 3DLLA 1KHIA 1OXXK 4HJAA 5BR8Q 1OXVA 4BXXH 1HZ9A 3L7ZC 3CQZH 2UXCQ 4DV3Q 5M5XH 3CAMA 1CKMA 3KLWA 4PZ7A 3JAMc 1N33L 4O0AA 1CSQA 1N32L 4XIGS 4GNXB 3I56A 4X62L 4DV6L 1MJEA 4HJ7A 3F8TA 1I3QH 1G291 2CWAA 4POFA 2NVXH 4LFCQ 1PA6A 1N34Q 1EQQA 1N36L 1GO3E 1YHAA 5IYCH 4DUYL 4UP7A 2QA4A 2WB1E 4BBSH 1VCIA 1P8LA 5JEAG 5C0XI 4BA1I 4DPGA 4X66L 3M7NA 4NB3A 4KHZA 4APVA 2CCZA 4A75A 1I94Q 2JEAI 2Q2UA 4LUOA 3S15H 1G6PA 4JBJA 1PH7A 3PUXA 3I55A 3CD6A 4B3TL 1GM5A 4NXMQ 1YJWA 1LUZA 1VQKA 3U50C 1VQ5A 2R7DA 4AIMA 1FL0A 4OWWB 4GKKQ 2NN6G 1TXYA 4BY7G 1B7YB 2L15A 1N36Q 1XNQL 2R7ZH 1SN8A 4A3DH 1NY4A 3MEFA 4IJHA 3ICEA 4QY7A 4GNXC 4HJ9A 2I5MX 1XMOL 4R4QA 3HOXH 4DR4L 3A0JA 2F4VQ 1LTLA 4LUZA 2JA7H 3CF5A 2K4KA 4C2MH 3K81C 3A5ZB 1L1OB 4GOPC 3S2DH 1A62A 3ULLA 1UEBA 1JMCA 3PGZA 4Y7NH 1G51A 4GLVB 4GKKL 2IX0A 4DV7L 4HIDA 3HOWH 2ES2A 5IYBH 1N9WA 4IOAA 4A3FH 1SLJA 2YYZA 1Y1VH 3BZCA 5C3EG 1CKOA 2PI2A 4DR7Q 1UWVA 4IFDI 3CPFA 1WFQA 3CCEA 5M5WH 3GTPH 4EQ5A 3PUWA 4A3EG 1EIYB 2KCMA 2FXQA 3RLOA 2UUCQ 1YJ9A 2BH2A 4A3KH 1L2FA 2A8VA 1K3RA 3H0GG 1IBKL 2WFWA 4RG1A 5M3MH 1X3EA 4P74A 2K50A 3CCVA 3PUYA 2JA5G 5M3FG 3IRBA 3J81j 1DGSA 4OONA 4IO9A 4JV5L 1NMFA 4JI2L 1XJVA 4ALPA 4X65L 2XGTA 1KD1C 2KBNA 4J15A 3F2DA 4JI4L 4DUZL 2E5LQ 2MQHA 1VQOA 3F2CA 3UDFA 4YCVA 2UUCL 2D0OA 4DR5Q 4NPSA 2I5LX 1P16A 3RZDH 3G4SA 3T1HL 1SRUA 4AQYQ 2K5VA 3UDGA 2ZM6Q 1Y1WG 2KHJA 1VQCA 4MTNA 3PIOA 5IE8A 4BBRH 1VQBA 1EIFA 1OTCA 4LF9L 4A3GH 1J6QA 3PUVA 3AYHB 3K80C 4JOIC 3CCSA 1SE8A 1YITA 3STBD 2E2JH 4DV5Q 4DR6Q 4X64L 4A3EH 4GN4B 1YZ6A 4P73A 3GO5A 5GROA 5IP7H 3BU2A 1TWCH 1M1KC 2K5NA 3K7AH 3KF8B 4GLXA 3S14H 3GTLH 1Q12A 4UPAA 1PFSA 5IY0A 4JBKA 3JC66 3H0GH 4DV6Q 4BXXG 2PQAA 1S3OA 5C0XJ 3UDXA 1PH2A 4IPDA 2ZJRA 2JA9A 2PNHA 4AYBG 1VQ4A 1C7YA 4JC0A 3KJPA 4PMWA 3I2ZA 4NXNQ 3U58A 4DV3L 1Q7YC 3J7A5 4OWTB 5JJIA 3HOVG 2BA1A 3J80c 5C3EH 1Q82C 4PZ8A 3HKZG 1JJ2A 4IJLA 1WJJA 1D8LA 2RHQB 4POGA 1J5EQ 1K0RA 2QGQA 4X62Q 1XMQL 4LF5L 4X6AH 2DGYA 4LFCL 4JBMA 1N34L 5GAEC 2YTYA 4A3IG 3HOUG 1K8AC 4DUYQ 1KIXA 3FP9A 2ATWA 3E9HA 2ZTCA 1HR0Q 2F52A 2ID0A 4IPHA 1E24A 3G6EA 1SMXA 2VQFQ 3S1QH 1Q8KA 4IFDJ 4HIOA 4A4IA 4A3CG 3M4PA 4DR4Q 4A3CH 4DV2L 1OXUA 2KCTA 2GVAA 1E3PA 1L0WA 1NTGA 4KHPL 3PCOB 2MNAA 1VQ9A 4A3BH 4BBSG 2YU9H 2R92H 4JI3Q 1VQIA 4K0KL 1LM0A 3B6YA 3CMAA 2UXDQ 5AJ3Q 4JI8L 3PO3G 2PI2E 4DV7Q 1NBWA 1AE2A 3NEMA 3CCUA 2YV5A 4QIWE 3TEHB 4LW1A 2PQAB 1HJPA 4YCUA 1E1OA 1UE1A 1KC8C 3HKZE 1KRSA 2R6GA 1V43A 1RIPA 4DAYB 5ELNA 3RN2A 1JJGA 2B3GA 2YTVA 5IP9G 1LYLA 2HIVA 1VQNA 3NENA 5IP9H 5GADC 2UU9Q 3CCLA 5C44G 1JB7A 1C9OA 1TWHH 5DLQE 2OCEA 3CMEA 3SGIA 4PG3A 5JEAJ 3ER0A 4JI3L 4JI7L 2NZOA 1PYBA 1NJIC 1W3SA 4JI8Q 2RF4A 4LF7L 2UXBL 3MXNB 2EXDA 3KF6A 4GOPB 2IX1A 1O7IA 2JA7G 3PO2G 3PF5A 1V1QA 5LMNW 5LMUQ 4P75A 3OYYA 1BBWA 2ALYB 2JA6H 4A76A 4JV5Q 4JI2Q 1X6OA 3FHWA 1X9NA 2UU9L 3WWVA 1A63A 4X65Q 2R93H 4A3MG 2R93G 3U4ZA 3M3YH 1E22A 4A3LH 1U5KA 3JAMi 1PH9A 3L0OA 4JI5Q 3CC2A 2F3IA 1FVIA 4YWLA 3RN5A 2R92G 3NBHB 3U4VA 1NE3A 3KYHC 1IYJB 4DR2Q 4JYAL 2UXBQ 3PIPA 1K73C 2ASBA 1VQGA 2PMZE 3J81i 5FLXc 2R7ZG 2ZM6L 2UUBL 3HOVH 4A93G 1MJCA 1QUQA 1CKNB 3W1BA 2RHSB 4C3JH 4DR1L 1EOVA 4JI1L 1XNRQ 2NVQH 3GTGH 4DUZQ 2E5LL 4A3IH 2HT1A 3DM3A 1K8GA 4LF6Q 3EN2A 2EQSA 2AKWB 5M3FH 2QEXA 4DR3L 3CC4A 1QVCA 3OW2A 2JQOA 1N32Q 1X56A 4YHHQ 1T9HA 2R7FA 3T1YL 4QQBX 4DV1L 2KHIA 2VW9A 1YNXA 3CPWA 3J80i 1UE7A 1XPUA 4UY8C 5GAHC 1Q46A 2WAQE 2Z6KC 3VDYA 4JI1Q 1WCMG 3KJOA 3BZKA 3CXCA 4DV5L 1XNRL 4DR6L 2ZJPA 1EYGA 4X66Q 1U0LA 1XPRA 1EQRA 1HR0W 4LF6L 2IY5B 1I94L 3CW2C 2OWOA 5HY6A 1GD7A 1Q1BA 1Y1VG 1AE3A 4B3TQ 4A3KG 1KXLA 1SROA 3KDFB 4P71A 2BH8A 4GN3B 2LXJA 1WI5A 3S1NH 1CUKA 1QVFA 3Q8DA 2MO1A 1Z47A 4MNOA 4GLAC 1VQPA 1YHBA 2Z6KA 2LSSA 4B3ML 2JK8A 4HJ8A 3HOYG 4IFDG 1CKNA 3NELA 4GN5A 4JCVE 1Q1EA 1IBML 2VQFL 1IL2A 5K36G 2D0PA 1B70B 2UXCL 4GS3A 1MKHA 4LWCA 5J3BA 3PO2H 3STBC 1VQMA 4A3JH 3CP0A 2VS1A 1J5EL 2XTIA 1VS0A 3I4MH 1HNZL 5GQOA 2YTXA 1TWGH 3KOJA 1FJGQ 4GKJQ 3ULPA 4R4CA 4B3MQ 3E9IA 1VQ6A 3GTOH 2WAQG 4BBRG 2KENA 2Q2HA 4A3GG 2A19A 4YCWA 1VQHA 4QGUA 2VUMG 2DUDA 2VQEQ 4DV0L 2VUMH 4KLKA 5ELOA 3UE0A 3K7UC 2WB1G 1HH2P 4GNXA 4JI0L 4L5TA 1RL2A 4JBWA 1KAWA 2Q2IA 1ASYA 4R1JA 3CCRA 2AHOB 3ZJYC 2ZTEA 1HNZQ 3CCQA 1BBUA 4YY3Q 2UXDL 3TREA 5AJ3L 1HNXL 2JEBI 1FJGL 5H1SE 3TS2A 4DKAC 1XTDA 2K52A 4FDBA 4HJ5A 3GTQH 4HIKA 3A74A 3M4OH 1QVGA 1D7QA 1UE5A 4R4OA 1PYSB 4KI0A 1YBYA 2OQKA 4JOIA 4LUVA 4R4IA 1XMOQ 2MFIA 1PH6A 2UUAQ 4JI6L 4LFAL 4A3BG 4C3IH 1PV4A 4L5QA 4DK3C
chains in the Genus database with same CATH superfamily
3K5NA 4N8X1 4PNYA 5IYCG 3I4NH 2O4XA 1YVCA 1TWFH 1B4OA 2Y0SG 3CCJA 1HNXQ 3LNNA 4KJOA 4CDFC 3RR5A 4Q5VA 4DR2L 1D2BA 3VA5A 4LF9Q 3CC7A 1KQSA 5DAUA 2EYMA 4LFAQ 3RZOH 4OO1G 1VF5C 4R9WA 4BY1B 2E2HB 5CV6A 4YWMA 4Y7NB 1BF4A 2G5DA 4DK6C 5M3MB 3I70A 3HOUH 3MFYA 2B8GA 1HZBA 1RDPD 2JA6G 1SYEA 1VQAA 1V9PA 3KLSX 3OMCA 1FGUA 1RODA 1YNNC 4ID6A 1W2BA 2ZXOA 3U9SA 4DR1Q 3TSSA 3N52A 1GUGA 3H3VI 1M90C 2WAQB 2KCCA 1VQFA 4R4TA 2K75A 3UDIA 2WACA 4LF5Q 5C4XH 1EWHA 3E6ZX 2XWBB 1WTVA 4QJFA 2RDFA 1IBMQ 4HSPA 1GOZA 1N33Q 5KNDA 2K5HA 2JA5H 2IHFA 2LMCB 1QZHA 1N8RC 2GN5A 2ICEC 2K7VA 3C46A 1Y1VB 4K0KQ 1A3TA 1U4RA 2NVYH 1SSOA 1L1OC 4E6IA 1D1KA 4G7HC 4IOCA 2P5ZX 2XRQD 2F0HA 3S17H 2WIIB 1X3QA 4B3RQ 4GKJL 2L55A 1IXRA 2D62A 3WOFA 1K9MC 1HR0L 4A3IB 5LMUL 1B8AA 4MHEA 1KNAA 1G8ZD 5M5YH 4A93B 3NP8A 1PH5A 1DOMA 2AMCB 1EUJA 4LFBL 3A54A 3UE1A 3TQYA 5IWAQ 2NB0A 3MFGA 2EDGA 2PNRC 5C4XB 4MTKA 4TQUS 4DAVA 1WCMB 1JWSD 1E2WA 1S72A 4BY7H 1GKHA 3QOLA 2NVXB 4DR3Q 1VQJA 5IWAL 5FLMG 3T56B 3W1GA 4C1NI 1JICA 3T1YQ 4LF7Q 3AFQA 2AQ2B 5FO8B 1IBLL 2JA7B 3H15A 1A3VA 4I7ZC 5IT9E 3HOWG 4IPCA 4PZ6A 1YI2A 4LF4Q 3C2PA 2G9DA 1Y14B 3F1ZA 1HFNA 3GTGB 2N3SA 5D65A 3PUZA 4A3DG 1ESFA 1VQ7A 1OXXK 4HJAA 1OXVA 2A6EC 3CQZH 2VUMB 1CKMA 2SEBD 1ZYRD 4PZ7A 3FEWX 1F9SA 4PV1C 4DV6L 4HJ7A 1C48A 3DEPA 2ENBA 4DA2A 1PLFA 1AW7A 2Q8IB 5C4JB 1N34Q 4DUYL 1EEID 4F7XA 4DU9A 4LMQD 4O42A 3HOXB 1AP0A 1MGSA 1STGA 4LUOA 1PH7A 4B3TL 1U9RA 2AUKA 1VQKA 1L0XB 1FL0A 4BY7G 1B7YB 1I6VC 3ND9A 2R7ZH 2R93B 1IKMA 4GNXC 4C3JG 4F87A 3HOXH 1SYCA 2JA7H 4C2MH 3J80L 3PO2B 1B50A 1L1OB 3S2DH 1A62A 3EQLC 3I72A 1JMCA 4Y7NH 3S2HB 1G51A 4GLVB 2IX0A 3HOWH 2PCFB 4CBVA 2EY5A 4A3FH 1Y1VH 3BZCA 5C3EG 2EY2A 2YU9B 4DR7Q 1UWVA 1LLRD 5JPMC 1HHVA 2Q8TA 1EEFD 3BG3A 3BZDB 4C3HG 3CHBD 5AFWA 2KCMA 5JAVA 2JN4A 3VR3A 3CCVA 3PUYA 5M3FG 3IRBA 3J81j 4JV5L 3R93A 1XJVA 4JI2L 1K8OA 1KD1C 4J15A 3F2DA 4IUTA 2E5LQ 4RFBA 2HCCA 2MQHA 2SDFA 3F2CA 2B2WA 4K2LA 2I5LX 1WD0A 4OIJA 4ZLTF 1SE2A 1VMCA 1JOQA 4AQYQ 3UDGA 1Y1WG 3HOVB 4L63B 2B2UC 3SR1A 1OTCA 3M4YA 4A3GH 2KCNA 3PUVA 3AYHB 1SNPA 3STBD 4ZQ3A 2HCIA 1IYVA 4P73A 4BBSH 3BU2A 2K5NA 3KF8B 3GTLH 1VF7A 3MZ5A 3QJYA 1WTXA 1B9MA 4BXXG 4UHVA 2PQAA 3BDOA 1PH2A 3NTIA 2PNHA 3I2ZA 4NXNQ 1Q7YC 1I50B 2KOLA 1PTOF 5FO7B 3J80c 5C3EH 4PZ8A 4IJLA 4KY5A 4X6AH 4P2CB 4LFCL 2YTYA 3HOUG 1G2TA 1KIXA 3NE5B 3OIQA 3KK7A 4C3IB 4IPHA 3IAYA 1CA6A 1NR2A 3UI2A 2VQFQ 1SMXA 3S1QH 5C5LA 5ELFA 4B9WA 5L37A 1HQRD 1OXUA 2G9HD 2K5QA 1EQVA 4BY7B 2ZT9C 1WTPA 5AJ3Q 1SMYD 2PI2E 3JAML 1WD1A 2CH4W 2PQAB 1BQQT 1UE1A 3NWSA 4C3HB 1KC8C 5ELNA 3K5LA 1J8IA 2HIVA 1V8QA 2UU9Q 2E74C 5C44G 5I9PA 3V2TA 1IW7C 2F0LA 2OCEA 3DM1A 2OXPA 4JI3L 2RF4A 2IX3A 1NNXA 1EU3A 2F0WA 3PO2G 3PF5A 1RCVD 3OW7A 2IPKD 1MBYA 1BBWA 2ALYB 1JC7A 2E75C 1X6OA 4CKBA 2EJFC 2R93H 2R93G 1E22A 4A3LH 3FVQA 3RD4A 3CC2A 5C3XA 3HEJA 3E5SA 3U4VA 3KYHC 1IYJB 3NBHA 4JYAL 1KLGD 2PYKA 3PIPA 3NK9A 1K73C 2PMZE 2ASBA 4TSSA 2BDOA 3G6JB 2UUBL 4KD4A 1Q8IA 1I6HB 2RHSB 4DR1L 1RD9D 1SXTA 5M9OA 1CA5A 1JWMD 2DNEA 5KEEA 4WFN3 4YHHQ 2R7FA 1RTOA 4QQBX 1I4RA 1F9RA 5I9OA 1UE7A 5GAHC 4RKBA 2Z6KC 2K1BA 4JI1Q 1WCMG 3KJOA 2ZJPA 1EYGA 1XPRA 2OWOA 5HY6A 3VYUA 1AE3A 4B3TQ 1GHJA 3KDFB 4GN3B 4MNOA 1O78A 1Z47A 2D2CC 2MO1A 3Q8DA 5CV4A 2Z6KA 4RH6A 2LSSA 4B3ML 1SJED 3P20A 1GUTA 2B8FA 1ET9A 4HEDA 5LHY1 1TU2B 5J3BA 1VQMA 2F0DA 2BDNA 2RDGA 2XNAC 3CP0A 2VS1A 1ENFA 2WV6D 1H9JA 3D6CA 2VXWA 1Q3LA 3E9IA 4B3MQ 1VQ6A 4QCLA 4NMZA 2TSSA 2KENA 4NKLA 4H44C 2AUJD 2DUDA 4KLKA 3H09A 3OWEB 3K7UC 1HH2P 4G7OC 1PFMA 3RZDB 4JBWA 4R1JA 2CHBD 1HXYD 1DJRD 1JOOA 1HNZQ 1BBUA 3NPPA 5K5PA 2JEBI 1FJGL 5H1SE 3K5OA 2K52A 3GTQH 4HIKA 5D3DA 3IKJA 4OELB 4QUCA 1PYSB 4LUVA 2UUAQ 1W6KA 4C3IH 1PV4A 4L5QA 4DK3C 2ZJQA 3GTMB 2EIFA 3AEVA 1GXDC 2B29A 2JE6I 4EX5A 1PZJD 4JYAQ 1S5CD 2EYLA 1OXSC 4HAEA 2UUBQ 4DNTB 2JA8H 1HNWQ 1WTOA 1STYA 4JI6Q 1CSPA 3G71A 3QOJA 1Y8PB 3M9BA 1PRTC 5ISRA 2D9UA 3GTMH 2MO0A 2O5IC 4DNIA 5G3LF 4ZAIA 4FF4A 4DV1Q 1AH9A 1VMPA 2EVBA 1E7ZA 2Z0SA 3MXUA 2JJQA 2TMPA 2J4XA 1X3GA 2B2TA 2CQOA 4FO2A 4LF4L 2VY3A 4OGQC 1HZAA 1VQEA 1F2ZA 4LF8L 3AMUA 3ERSX 3KFUA 5CV5A 4QUFA 2A73B 2M9VA 2EXZA 4LK1C 2K5WA 5C5MA 4L5RC 2HDMA 1TWAH 3SK8A 5JJLA 3HOZG 3MXNA 4X64Q 2CWPA 4C3HH 2AWOA 5CBEE 2B2WC 4IUPA 2H1EA 1EFID 2PZUA 1G91A 4OXPA 2H5XA 1C8CA 3J7YW 4OO1I 1E1TA 4MIUA 3T16A 1STBA 4ME3A 1YIJA 3PF4A 3TP6A 1ICFB 3GTPB 3PSIA 4HIMA 2R61A 4K5XA 2VQEL 4DV0Q 3GDEA 1PDQA 2A6HC 4JI0Q 4CDEC 2JA8B 4A3KB 4QL5A 2F0MA 1U4MA 3H6MA 1PHJA 1MSGA 1H9SB 3I7FA 4N9PA 2HHHL 2EYFA 3KDFA 1FD7D 3SK4A 1U4LA 3J81c 2IT1A 2KEEA 3RLNA 4JVZA 5GAGC 2F4VL 3AQQA 5IYBG 4H7BA 4A3FG 4EQNA 5M3MG 4XQNA 3TS0A 1ZKOA 3HZXA 4PMCA 4DAYA 4EGVA 3FKIH 3A7LA 2HHHQ 5FJ8G 4QB4A 2C5CA 1SFOH 2MHVA 2N49A 1CK1A 3KUPA 3ZYYX 2HQEA 4B3SL 2Y0SB 1QJOA 2WB1B 4OX9Q 1IBLQ 3Q0AA 4KN7C 1B9NA 5LMNQ 4H02A 2K5DA 4FXDA 1S5DD 1PMRA 3C1EA 4Q0FA 1LTID 3ND8A 4F8MA 1S4ZA 4YHHL 2CFMA 1DXMA 3TMEA 1FGBD 3RNUA 2EJGC 3FMCA 2AWNA 2A68C 4TKOB 1WTHA 2I5HA 3PV0A 4KMUC 1AZQA 5LMNL 1Y1WH 1YHQA 1MI2A 1LT4D 1QUQB 3PIP3 3M7GA 1PH1A 4ULLA 2NWGA 4RGMA 4XTCS 2MGSA 1XXGA 1EY6A 3OTOQ 2EYHA 3DLLA 4K5VA 5BR8Q 2CW0D 1V1OA 4ZCKA 4CKEA 2UXCQ 2D5DA 2BOSA 4DV3Q 3KLWA 1B3AA 1CM9A 3MAQA 2A69D 2F0QA 4GNXB 4N8FA 1NSNS 1MJEA 1G291 2CWAA 4JW0A 4LFCQ 1IHZA 2Z1CA 1EQQA 1GO3E 5IYCH 2JP1A 3GV6A 3NBIA 1EY8A 5JEAG 4BA1I 1R9TB 4X66L 4APVA 2JEAI 4JBJA 4KKSA 2RQXA 4JK1C 1LUZA 2A74C 2R7DA 4OEMB 2NN6H 4KD3A 4CDCC 2B2YA 5FK9C 2L15A 1N36Q 4AYBB 2E2JB 4H13C 4A3DH 2XRSD 3MEFA 3ICEA 1HA6A 4R4QA 1UAPA 1LTLA 2K4KA 4GOPC 1K83B 1JQYD 2LS01 1UEBA 3PGZA 2B2VA 4CJ0B 5I6YA 1HTPA 4GKKL 1I4QA 2PW5A 3I4LA 4DV7L 3OMGA 4DFAA 4IOAA 1SLJA 1HPCA 2YYZA 1JB3A 4GZYC 3EA6A 1CKOA 1I3QB 2B39A 1HUNA 2B2VC 1Y8NB 4IFDI 1WVLA 2EY1A 3GTPH 4EQ5A 3DWPA 1EIYB 4OHJA 4IURA 3A8KE 2UUCQ 4A3KH 3QR8A 1L2FA 3DWQA 1EZ6A 1K3RA 4R8NA 3H0GG 1F2MA 1TWCB 4RG1A 2K50A 2JA5G 3GTKB 1NMFA 2IWHA 1ESRA 5C3EB 3S1RB 2KBNA 1SNOA 1PFBA 3MA2B 5EGTA 1BCPB 2D0OA 1D1IA 3HOWB 4NPSA 5IT9L 2DJGC 2SOBA 2M00A 2MPMA 2ZM6Q 1VQCA 4LF9L 4BBRH 1VQBA 1TIID 2E2IB 3GTOB 3CCSA 1YITA 2E2JH 3DUZA 5KYIA 1CHQD 4X64L 4RA8A 5GROA 3GO5A 1M1KC 2JXMB 3E0JA 4UPAA 2RDHA 3TP8A 5IY0A 4X3UA 4DV6Q 3I8ZA 2LFNA 3KLRA 1NR4A 2RSNA 2ZJRA 2JA9A 4K6DA 4AYBG 1VQ4A 1X3PA 4KHVA 3IL8A 2EYOA 4JC0A 4V0BA 4PMWA 4DV3L 3RZOB 5NUCA 3K0YA 3HKZG 5ELCA 2RHQB 4POGA 3HOUB 4X62Q 2QGQA 4A3IG 1H9RA 1K8AC 1I4XA 5M5XB 3FP9A 3E9HA 2ZTCA 3R2TA 4CKCA 2F52A 3I90A 2K28A 2PQEA 1R4QB 4C1NK 5KYLA 1Q8KA 4IFDJ 3M4PA 4A3CH 4DV2L 1EWCA 5KIXA 3PCOB 2SNMA 2MJ8A 1STHA 1TY2A 2MNAA 4BBSG 4JI3Q 1VQIA 4K0KL 4IUQA 3A55A 3NEMA 3L9AX 4QIWE 4LW1A 2RCFA 3HKZE 5IP9G 4I65A 5IP9H 1JB7A 2A6HD 5DLQE 3CU7A 3OOCA 3CMEA 5JEAJ 3AB9A 1Y1WB 1BDOA 1PYBA 1NUCA 1W3SA 4JI8Q 4LF7L 1AN8A 3MXNB 2PPBC 4GOPB 2UXBL 1I4GA 4KY6A 5LMNW 4P75A 3OYYA 3S16B 4K14A 2WINB 1X9NA 3OHXC 5IGCA 4X65Q 3U4ZA 3M3YH 2K33A 1U5KA 3L0OA 5CV8A 1KDCA 4YWLA 2F0GA 2R92G 5JVH3 4DR2Q 2UXBQ 4RGTA 1VQGA 5FLXc 1EU4A 2R7ZG 2ZM6L 4UDUC 3HOVH 4A93G 4IN3A 2F0PA 3W1BA 1CKNB 1R4PB 2WKDA 2NVQH 3D6WA 1KLUD 3EROA 3BYTB 2E5LL 4A3IH 1BOSA 1K8GA 3K57A 2Z6BA 4DNRB 2KECA 3MEHA 2QEXA 4C3JB 1QVCA 1DOLA 1X56A 4EQPA 1KDBA 3Q23A 4M1UB 1K8MA 1YNJC 1FNWA 2ZXRA 4ILWA 2EJMA 2WAQE 1PTOB 1LTSD 3NXWA 3CXCA 1XNRL 4DV5L 2NVQB 1EQRA 1EIGA 2F0VA 1I94L 4LJZC 1Y1VG 1F9QA 4OIKA 4HN7A 2BH8A 3NWTA 3MVVA 1U4PA 1LTRD 4GLAC 1YHBA 1XYIA 1LT6D 2EE1A 5I6WA 5FKAC 4HJ8A 1HQMC 3HOZB 4IFDG 3NELA 4IFDH 1G6ZA 4JCVE 1EQTA 3S1QB 1LT5D 2SNSA 1IBML 2VQFL 1B70B 1O7ZA 4GS3A 1MKHA 3QWNA 2L4NA 1M4VA 2IJ0A 3Q22A 2XTIA 3GP7A 3KOJA 1TWGH 2PMZB 2RSOA 3R3OA 1STEA 2WAQG 4A3GG 1JWUD 1RJTA 2VUMG 4DV0L 3UE0A 4JI0L 3W3AA 4L5TA 1IL8A 1RTNA 1RL2A 1GJXA 1KAWA 2Q2IA 3CCRA 2AHOB 3ZJYC 4FVMA 3CCQA 2UXDL 2NVTB 2A68D 4RGOS 4DKAC 1SJHD 2F0EA 4FDBA 4NDXA 3A74A 1FNVA 1EOTA 1PFNA 1D7QA 3C3LA 1UE5A 1TS5A 4KI0A 1YBYA 4JOIA 2MFIA 5IGBA 2OQ0A 2B63G 3I4NG 4HMIA 3S2DB 1UUPA 4JI7Q 1SNMA 4BY1H 4A3MH 1T5XD 4AQYL 1TWAB 3CRKC 2LXKA 2Z4IA 4B3SQ 2HIXA 4RKLA 4N9TA 4MN3A 3SDZA 3D31A 3S9WA 2F0TA 3MXGA 2VL6A 1L1OA 1UE6A 3M85A 3HOYH 2NBFA 3QB3A 2E8GA 2K14A 3S1RH 1H9SA 3GTJH 4FF1A 2K01A 3VR6A 2ZXPA 3KBGA 5DNFA 1PVOA 4IUVA 2F1MA 5FO9B 1Q86C 5EPLA 5JVG3 2DJFC 5C44H 3S16H 5I2XA 4NXNL 2NZHA 1TT2A 1Q81C 4KTAA 3VR2A 5D3IB 3T1HQ 2RVLA 1R9TH 4YWKA 3HP3A 2VNUD 3W5OA 1KDAA 1EY9A 4WJ4A 2K03A 4A3GB 4FXGC 5E3FA 3FDTA 1JOKA 3NUCA 2JA8G 2I46A 5TSSA 5HGTA 3FKIB 2J7ZA 2F0FA 4O1NA 3NTHA 1BVSA 3SHLA 1CQFA 3RLFA 4B3RL 3Q24A 4CJ2C 3S1MH 2B63H 4A3LG 5IOCA 4X3TA 1PH4A 1AZPA 3PO3B 1CTMA 1Z6HA 4PMBA 1VQ8A 3O13A 3P1HA 1WYDA 4K5WA 1JT8A 2HUGA 1I50H 5FOBB 3FPPA 4LFBQ 1XMQQ 5HGQA 1SYFA 5ELDA 3KF6B 3BVZA 1PH3A 3GTQB 3K6OA 2B63B 2NN6I 4JG2A 1SR3A 1QZGA 3T51B 5EAYA 2UUAL 4OX9L 3AFPA 3A7AB 3HOZH 2WP8J 4RCNA 4AYBE 2OTJA 1PXUA 4TRDA 1TY0A 2RCNA 2CVRA 2F3WA 1KL9A 5EBCA 3H94A 1EY5A 5C0XG 2CQAA 2I0QA 1F2YA 1WCMH 4UP8A 2L9HA 4ZYSA 3D4DA 1ENCA 1TWGB 3NQIA 1VQLA 2KUMA 1Z9FA 4A3BB 3D4WA 4M8AA 1QCBD 4BBRB 5DM63 3KF8A 1X65A 1BXTA 1ICWA 4P72A 1IBKQ 1A0IA 3K8AA 3LGJA 1RF2D 3L2PA 1VQDA 2HQLA 1IW7D 3J80E 5JPNC 3A5UA 3SK5A 3VYTA 4B9XA 4L8JA 3PO3H 4AH6A 2QKIC 1GUSA 3EFXD 2N78A 2Z8LA 4ABNA 1SFOB 3M4OB 1H95A 4UAIA 3S1NB 3QG1A 4TVAB 3FPUB 2EOTA 3HFZB 4IPGA 1S40A 1A2TA 4IALA 5E1FA 4C3IG 1UNSA 1A6XA 1II3A 1HZ9A 3QO2A 3L7ZC 5JOBA 2K6AA 3VYSA 5M5XH 4A3EB 1WTQA 1CQVA 4XIGS 1JE4A 1ILQA 3PIO3 1DD2A 1I3QH 4POFA 5T1GA 1TS2A 1YHAA 4UP7A 2QA4A 5C0XH 2PW7A 1T5EA 2WB1E 4ODGA 1VCIA 4DPGA 1WTRA 4NB3A 4KHZA 2CCZA 4A75A 1I94Q 1D5ZC 1G6PA 4IQZA 3CD6A 3PUXA 2R7ZB 2F0IA 1B1ZA 5A35A 5JJZA 1GM5A 3T13A 3U50C 1EY7A 4OWWB 4GKKQ 3HS0C 1TXYA 4X3KA 1XX8A 3A8IE 1LT3D 5A2QL 4HCEA 1NY4A 1GHKA 2I5MX 1XMOL 5G3LD 1SYGA 3IFTA 1SYDA 1S5FD 2HDLA 3BVGA 1EIHA 3K7AB 3A8JE 3TZDA 4DK1A 3P7JA 3A5ZB 3ULLA 1ILPA 1LABA 5CORA 5IYBH 4G7ZC 1BCPC 1QNUA 2QF7A 2PI2A 3D8GA 4DN4M 1E2VA 3CPFA 1KAAA 1WFQA 1TQOA 2BCOA 3PUWA 4A3EG 4XT3B 5E4XA 4BWGB 4BS9A 1YJ9A 1KTKA 3LX0A 4KKUA 3V96A 5IGDA 3RMHA 4IO9A 4RHSA 3MC0B 4ALPA 3URYA 2X6GA 4JI4L 4DUZL 1C4QA 1NCVA 1EY4A 1V1PA 4YCVA 2C9OA 3RZDH 1P16A 3G4SA 3NHHA 3T1HL 3H91A 3I73A 1SRUA 5EKLA 4MTNA 3PIOA 1QOHA 5CV9A 1CFMA 1QILA 1SE3A 1J6QA 3K80C 1SE8A 2IL8A 4DR6Q 1SEBD 4RWSC 2L11A 4GN4B 2JSOA 1YZ6A 5IP7H 1GUNA 3DEOA 4KN4C 1TWCH 1CT1D 2GA4B 3K7AH 1DOKA 1PFSA 5DEHA 1YNJD 2LKVA 3JC66 3K58A 1HCZA 4L6TB 2L12A 1J9OA 3H0GH 1F2LA 1EY0A 5C0XJ 3UDXA 1C7YA 4Z9CB 2XIWA 4KK7A 3J7A5 1Q82C 1RKNA 3WDNA 4K2KA 5EBDA 1D8LA 3PMFA 1J5EQ 4ZK9B 4LF5L 3SEBA 3SK6A 4JBMA 4YIJA 2J0TD 4RCOA 3L3OC 2KA7A 2K05A 1XWEA 3D4RA 1E24A 1TVXA 4XDXA 2B2TC 3G6EA 4HIOA 5HURA 4CDDC 2KCTA 1L0WA 2GVAA 1EZ8A 5IGEA 1NTGA 1CHPD 4A3BH 1BUVT 2R92H 1DZ1A 4EQOA 2BE5D 3CMAA 2UXDQ 3E3XA 4FF2A 4K8IA 3CCUA 3S14B 4A3DB 2EPBA 5JJKA 1V43A 1JJGA 1OO9B 2B3GA 2YTVA 1LYLA 1DM0B 3NENA 5GADC 3SGIA 3ER0A 3LWUA 1PYWD 3KF6A 2IX1A 2JA7G 1O7IA 2AQ3B 2EYPA 5C3WA 3WOEA 5LMUQ 4JV5Q 1A63A 4A3MG 2I07B 3D3RA 3JAMi 1PH9A 1V1PB 5M3FB 4JI5Q 3DHQA 2F3IA 3RUZA 1E2ZA 1BCPF 2L1BA 1TR5A 1FR3A 1MJCA 3A56A 1BNZA 2H4OA 4J8QA 5DM73 2NUCA 1XNRQ 1EL0A 3ONAB 4LF6Q 5FLXE 4F88A 2EQSA 3MTSA 5M3FH 4DR3L 3CC4A 4HR7B 1M8AA 2JQOA 3OSOA 5CYUA 4A3FB 1T9HA 1N32Q 1DYQA 4DV1L 2KHIA 1TWFB 3VA7A 3TBIB 4FXKC 2VW9A 4QIWB 4IZ8A 3CPWA 2FHTA 3SE0A 1XPUA 4DAPA 1Q46A 3OPOA 3VDYA 3BZKA 4DR6L 4X66Q 1U0LA 1HR0W 4LF6L 3FRPB 1PTOD 3N6RA 5C6AA 4A3KG 1QWYA 4P71A 2LXJA 5C4ZA 1WI5A 5I2YA 4C56C 1W6JA 3VR5A 3NQTA 1B3QA 4XYOA 2D0PA 2UXCL 3TP5A 3PO2H 4A3JH 2K04A 2MP1A 1VS0A 1JORA 1HNZL 3KLSA 2YTXA 1FJGQ 1O7LA 1SDFA 5CMDA 4S3SA 2EYJA 4R4CA 3ULPA 4GKJQ 5IGGA 1TWHB 3R8BA 2CW0C 4BBRG 2QEJC 4FP5D 4YCWA 2VQEQ 4OO1H 5ELOA 2KJXA 1NAPA 3DXJC 5COYA 5E4WC 4YY3Q 2JA6B 3TREA 5AJ3L 1HNXL 3TS2A 3W2DA 4XT1B 3QIAA 4HJ5A 1B53A 4J1MA 4R4OA 1XMOQ 2NVYB 2OQKA 1PRTD 1HRJA 2VB3X 1K83H 2OTLA 3F2BA 5E7NA 2Z4HA 3TDQA 4O2DA 2ZTDA 2Y0SE 1O80A 1VDZA 1SE4A 3K5MA 3D0FA 1BCPD 4DR7L 1MIUA 1GUWA 2L0CA 5FLMH 1CZGA 4DV4L 5BN3A 4X3SA 4ZKCB 3K0XA 5IIFA 2AQ1B 1ASZA 2N8NA 4JI5L 4KY7A 4A93H 5M5YB 3GTLB 1A2UA 3HOXG 3HKSA 3CCMA 5ELBA 1H9KA 3ULJA 4MZ9A 1A8VA 4WJ3M 3FKIG 4J6HA 4DV4Q 5LL6X 2BA0A 4LAAA 5BR8L 3DWAA 4K6LA 1DONA 2VZAA 4A3MB 3E0EA 5KNBA 4U68A 1PTOC 5JEAH 1MSHA 3BDLA 3S17B 3J7ZC 1IZ6A 3S24A 3NTKA 1Y69U 1EWIA 3EBEA 4DAMA 4ZUIA 3GD7A 3HOYB 3GTKH 1CI3M 1BKBA 4BA2I 1PH8A 1JE5A 4DV2Q 1X3FA 2E2HH 1S5ED 4KHPQ 1KNEA 1C0AA 4OWXB 1F9PA 4LF8Q 5IODA 1BBXC 1I6HH 5J1ZA 2A1AA 1AEXA 2FINB 1XNQQ 1KRTA 2GVBA 2F0NA 4Y52H 5M5WB 2N88A 3TRZA 2RA4A 1UEAB 1NMGA 4RMFA 1YEZA 2E2IH 5EKKA 4CHTB 4R8IA 4NXML 1OXTA 4L5SA 3G48A 2F3VA 2O5JC 2IHEA 4GOPA 4UP9A 5C4XG 3MXPA 1GVPA 3I4NB 2F0OA 1LV9A 4A3JG 3I3CA 1WOCA 2XVSA 3BJUA 1SBBB 4QF4A 2F0JA 2F4IA 4U673 5EKIA 4YY3L 3GTJB 5FJ8H 5EPKA 2NVTH 1XPOA 4ZKBB 1X54A 5IT9c 2Q2TA 5J22A 4OL7A 3JAME 4DXGA 3I4OA 4G57A 1EFWA 4DK0A 2EZVA 1HNWL 5K36H 2DNCA 3M4QA 1LTAD 4BY1G 5IYDG 4KKTA 5IYDH 3BS1A 4JI4Q 5IGFA 5CV7A 1FYCA 3EJIA 1JJCB 1SNQA 2DN8A 4DR5L 3I4MG 2CKZB 1MHWC 3EIVA 1YJNA 4IUNA 3VR4A 3SVMA 3S2HH 1I5FA 4JPBW 2DY8A 2C35B 3H3VH 4G4KA 3OTOL 1X32A 2V1CC 5C4JH 5KRUA 1X55A 2OT2A 2A6ED 1GUOA 1PZID 1HZCA 4DXFA 5A2QE 2NTTA 3C1FA 4B08A 1B2TA 5EQ0A 4LNQA 2JA5B 1WTWA 5IP7G 1KHIA 1A15A 4BXXH 3GQBA 1SNCA 1JR0D 3CAMA 3JAMc 1N33L 4O0AA 1CSQA 3T4AC 1N32L 3ERQA 3VYRA 3AU7A 3MHBA 1L0YB 3M3YB 3I56A 2WKCA 1K3BC 1H9MA 2QW7A 4X62L 3F8TA 1BR9A 2NVXH 1PA6A 1BO0A 1N36L 2XSCA 1P8LA 2MUYA 5CBAE 5C0XI 3M7NA 1SYBA 3BVMA 3KBXA 2Q2UA 3EVQA 3S15H 3I55A 4NXMQ 2X6LA 1YJWA 3ITPA 1VQ5A 4ZRZA 4AIMA 2QDLA 2NN6G 4BBSB 3TP7A 1XNQL 1STNA 1SN8A 4IJHA 4QY7A 5EPJA 4HJ9A 3NSWA 4DR4L 4WORA 3A0JA 1PTOH 1LACA 3TZUA 2F4VQ 4LUZA 3CF5A 3K81C 2QCPX 2K32A 1EYCA 4FNFA 2LY7A 4HIDA 3HKZB 2ES2A 1D6EC 1N9WA 2XN9C 2R92B 2F0SA 1HFGA 4FYDA 3CCEA 5M5WH 1XTCD 4XQJA 1LTBD 2A5HA 2FXQA 3RLOA 3J81E 2BH2A 2A8VA 1IBKL 2WFWA 5M3MH 1PRTB 1X3EA 4IUUA 4P74A 2CH4A 2FFKB 1D5XC 1DGSA 4OONA 1TKWB 2E2DC 4X65L 2XGTA 2KEDA 3J7AF 1QE6A 1VQOA 3UDFA 2XWJB 2UUCL 4DR5Q 1ZXTA 2KVMA 4XXEA 2B2YC 5F2DA 4DF7A 1G2SA 2K5VA 3MWYW 2KHJA 1IYUA 3BDCA 4I7AA 2HD3A 1EIFA 5IE8A 3HRZC 3OWFA 1PRTF 3HGBA 4JOIC 4DV5Q 1LTTD 4A3EH 4PQXA 5I4DA 4A3BG 4EVOA 4GLXA 3S14H 5J39A 1Q12A 4JBKA 2PZWA 1ZEQX 3X3MA 1S3OA 3IFDA 1QG7A 4IPDA 4KV6A 1KABA 3KJPA 3CKIB 1A3UA 5C4HA 2L5TA 5KNCA 3U58A 5FLXL 1FNUA 1IKLA 1ENAA 2EY6A 4OWTB 5JJIA 3HOVG 2BA1A 2QILA 1Q90A 1JJ2A 1SNDA 1WJJA 1K0RA 1XMQL 2RKSA 2DGYA 1N34L 5GAEC 3CQZB 1AFPA 4DUYQ 1MD2D 1DCZA 5CC4A 2ATWA 2RBMA 1HR0Q 2ID0A 4RGNA 4A4IA 4A3CG 4DR4Q 2N55A 4HTHA 1E0BA 1ML0D 1E3PA 1TS3A 4KHPL 1QNKA 3H0GB 4KJNA 2YU9H 2JYOA 3BYYB 1LM0A 3B6YA 1ZYRC 2F0KA 4JI8L 2F03A 3PO3G 4XQQA 4DV7Q 1NBWA 1AE2A 2YV5A 3TEHB 1HJPA 4YCUA 1E1OA 1VQ9A 3H3VC 3RN2A 1KRSA 2R6GA 4DAYB 1RIPA 4NP5A 1VQNA 3CCLA 1C9OA 1TWHH 2R3ZA 2KQ3A 2DY7A 4PG3A 5C44B 2A69C 2PO4A 3HG9A 2NZOA 4JI7L 3S15B 1NJIC 2NYZD 2X69A 3GV3A 1Z7TA 2EXDA 5T1IA 5D14A 1B44D 4C2MB 2OEOA 1V1QA 4DGZA 5BN5A 3S1MB 1ET6A 1TS4A 3OIPA 2JA6H 4A76A 4JI2Q 2QDBA 3FHWA 2UU9L 1HTLD 3WWVA 4FF3A 4WRDA 3I4MB 3LWEA 4XYQA 1FVIA 3RN5A 3NBHB 1NE3A 4RAUC 1Y8OB 1QB5D 3J81i 4HCSA 1PZKD 2V4DA 1QUQA 1EYAA 4C3JH 2Z9HA 1EOVA 4JI1L 4A3JB 3GTGH 4DUZQ 2HT1A 3DM3A 3EN2A 4QMGA 2AKWB 2KHSA 4ME5A 1RHPA 4HSVA 1CZWA 1EYDA 3J7AV 2B2UA 1LO5D 2M2LA 3OW2A 4H0LC 3T1YL 1YNND 4V190 1HA5A 1I4HA 1YNXA 5ELEA 2IW3A 3R2IA 3J80i 2E76C 4UY8C 4CJ1B 1I4PA 3DMUA 3P75A 1LTGD 2FMCA 4HMJA 4K8JA 2IY5B 3CRLC 3CW2C 3J81L 2FJ2A 1GD7A 2PZTA 1Q1BA 4NW2A 1KXLA 1SROA 3S1NH 1CUKA 1QVFA 1VQPA 3G7LA 3U9OA 3T53B 2JK8A 2Q8RE 2NZ1D 1SAPA 3PQIA 3HOYG 1CKNA 5LL6S 3X3NA 4GN5A 1Q1EA 1D5MC 1IL2A 5K36G 1HUMA 4LWCA 3SXHA 3TN2A 3STBC 2OF1A 5KGUA 1J5EL 3F2UA 4RHRA 3I4MH 5GQOA 3GTOH 5CR3A 2Q2HA 2A19A 1VQHA 2NTSA 4QGUA 2VUMH 1ONLA 2FMMA 2WB1G 1STAA 4GNXA 1K0SA 1JCKB 5EJWA 4WJWA 1ASYA 2BE5C 4CGYB 2ZTEA 2VB2X 2ICIA 3V05A 1SMYC 3K59A 1F77A 1XTDA 3M4OH 1QVGA 2F0UA 3I91A 1K28A 2O2LD 5CGKA 4R4IA 4ZUJA 4LFAL 1S5BD 1PH6A 4JI6L 1O7YA 3Q6SA 5BN4A
chains in the Genus database with same CATH topology
5IYCG 3I4NH 2OQ0A 2B63G 1K83H 2ZJQA 3I4NG 1YVCA 2EIFA 3AEVA 4JI7Q 1TWFH 2OTLA 2Y0SG 2B29A 2JE6I 4EX5A 3F2BA 3CCJA 5E7NA 1HNXQ 3RR5A 4BY1H 4O2DA 4DR2L 4JYAQ 2ZTDA 2Y0SE 4A3MH 4AQYL 1OXSC 2LXKA 4LF9Q 3CC7A 2UUBQ 1KQSA 3D0FA 4B3SQ 2HIXA 4DR7L 3RZOH 1MIUA 4LFAQ 2JA8H 4OO1G 1HNWQ 5FLMH 4JI6Q 1CSPA 4DV4L 3D31A 3G71A 3M9BA 4YWMA 4DK6C 3K0XA 2VL6A 1ASZA 3HOUH 1L1OA 1UE6A 2N8NA 4JI5L 3GTMH 3M85A 3HOYH 4A93H 1HZBA 2MO0A 2JA6G 2E8GA 3HOXG 4DNIA 2K14A 3HKSA 3CCMA 1VQAA 3S1RH 1V9PA 3GTJH 4DV1Q 1AH9A 1FGUA 3ULJA 4MZ9A 1A8VA 1W2BA 4WJ3M 4DR1Q 1E7ZA 3FKIG 2Z0SA 1PVOA 2JJQA 4DV4Q 1Q86C 2BA0A 1X3GA 3H3VI 2CQOA 5C44H 5BR8L 1M90C 3S16H 4NXNL 4LF4L 2VY3A 2NZHA 1VQFA 4R4TA 2K75A 1Q81C 3UDIA 2VZAA 1HZAA 3E0EA 1VQEA 3T1HQ 1R9TH 4YWKA 4LF5Q 4LF8L 2VNUD 5C4XH 3ERSX 3W5OA 3KFUA 3J7ZC 1IZ6A 3S24A 1EWIA 4WJ4A 4L5RC 3EBEA 4DAMA 1TWAH 2JA8G 4QJFA 5JJLA 3GD7A 3HOZG 3GTKH 4X64Q 2CWPA 1BKBA 4C3HH 2AWOA 1IBMQ 1N33Q 2K5HA 4BA2I 1PH8A 2JA5H 1JE5A 4DV2Q 1X3FA 2IHFA 2E2HH 1QZHA 4KHPQ 1BVSA 1N8RC 1C0AA 2GN5A 4OWXB 3RLFA 4K0KQ 4LF8Q 4B3RL 4OXPA 3S1MH 2H5XA 1I6HH 4OO1I 2A1AA 1E1TA 2NVYH 2B63H 1XNQQ 1KRTA 4A3LG 1L1OC 4ME3A 2GVBA 1YIJA 1PH4A 3PF4A 4Y52H 3PSIA 4HIMA 1VQ8A 3TRZA 2VQEL 4DV0Q 1NMGA 3GDEA 1YEZA 4RMFA 4IOCA 2E2IH 4JI0Q 1WYDA 1JT8A 1I50H 4QL5A 4NXML 1OXTA 1PHJA 4L5SA 3S17H 3G48A 3I7FA 2HHHL 1XMQQ 4LFBQ 5HGQA 4B3RQ 4GKJL 2IHEA 3KDFA 3KF6B 4GOPA 4UP9A 1PH3A 5C4XG 3J81c 1IXRA 1GVPA 2D62A 2IT1A 1K9MC 2NN6I 4JG2A 1SR3A 3RLNA 4A3JG 1HR0L 5LMUL 1B8AA 1QZGA 5GAGC 1WOCA 3BJUA 5EAYA 2UUAL 4OX9L 3AFPA 2F4VL 5M5YH 2WP8J 3AQQA 4AYBE 5IYBG 3HOZH 2OTJA 4A3FG 5M3MG 3TS0A 1PH5A 2RCNA 3FKIH 2AMCB 1EUJA 1KL9A 5FJ8H 4YY3L 3UE1A 5C0XG 5FJ8G 2HHHQ 2I0QA 2NVTH 4LFBL 1XPOA 3TQYA 1WCMH 1X54A 5IWAQ 5IT9c 2Q2TA 4UP8A 1SFOH 2N49A 3I4OA 1VQLA 4TQUS 1EFWA 4B3SL 4OX9Q 1IBLQ 1HNWL 3M4QA 4BY1G 1Z9FA 1S72A 4BY7H 1GKHA 5IYDG 5LMNQ 4H02A 5IYDH 4JI4Q 1JJCB 4DR5L 4DR3Q 3I4MG 1X65A 1VQJA 2CKZB 5IWAL 4P72A 5JJKA 5FLMG 3EIVA 3W1GA 2CFMA 4YHHL 3T1YQ 1YJNA 1IBKQ 1A0IA 3K8AA 4LF7Q 3AFQA 3RNUA 3S2HH 3LGJA 1I5FA 2AWNA 2C35B 2I5HA 3PV0A 3L2PA 1VQDA 3H3VH 2HQLA 3OTOL 1IBLL 2V1CC 5C4JH 3H15A 1X55A 3A5UA 3PO3H 5LMNL 3HOWG 4AH6A 1Y1WH 1YHQA 4IPCA 4PZ6A 1YI2A 4LF4Q 1HZCA 2N78A 1QUQB 1Y14B 3F1ZA 1H95A 1PH1A 2N3SA 4TVAB 4LNQA 4XTCS 5IP7G 3HFZB 3PUZA 4A3DG 4IPGA 1S40A 3OTOQ 1VQ7A 3DLLA 1KHIA 1OXXK 4HJAA 5BR8Q 1OXVA 4BXXH 1HZ9A 3L7ZC 3CQZH 2UXCQ 4DV3Q 5M5XH 3CAMA 1CKMA 3KLWA 4PZ7A 3JAMc 1N33L 4O0AA 1CSQA 1N32L 4XIGS 4GNXB 3I56A 4X62L 4DV6L 1MJEA 4HJ7A 3F8TA 1I3QH 1G291 2CWAA 4POFA 2NVXH 4LFCQ 1PA6A 1N34Q 1EQQA 1N36L 1GO3E 1YHAA 5IYCH 4DUYL 4UP7A 2QA4A 2WB1E 4BBSH 1VCIA 1P8LA 5JEAG 5C0XI 4BA1I 4DPGA 4X66L 3M7NA 4NB3A 4KHZA 4APVA 2CCZA 4A75A 1I94Q 2JEAI 2Q2UA 4LUOA 3S15H 1G6PA 4JBJA 1PH7A 3PUXA 3I55A 3CD6A 4B3TL 1GM5A 4NXMQ 1YJWA 1LUZA 1VQKA 3U50C 1VQ5A 2R7DA 4AIMA 1FL0A 4OWWB 4GKKQ 2NN6G 1TXYA 4BY7G 1B7YB 2L15A 1N36Q 1XNQL 2R7ZH 1SN8A 4A3DH 1NY4A 3MEFA 4IJHA 3ICEA 4QY7A 4GNXC 4HJ9A 2I5MX 1XMOL 4R4QA 3HOXH 4DR4L 3A0JA 2F4VQ 1LTLA 4LUZA 2JA7H 3CF5A 2K4KA 4C2MH 3K81C 3A5ZB 1L1OB 4GOPC 3S2DH 1A62A 3ULLA 1UEBA 1JMCA 3PGZA 4Y7NH 1G51A 4GLVB 4GKKL 2IX0A 4DV7L 4HIDA 3HOWH 2ES2A 5IYBH 1N9WA 4IOAA 4A3FH 1SLJA 2YYZA 1Y1VH 3BZCA 5C3EG 1CKOA 2PI2A 4DR7Q 1UWVA 4IFDI 3CPFA 1WFQA 3CCEA 5M5WH 3GTPH 4EQ5A 3PUWA 4A3EG 1EIYB 2KCMA 2FXQA 3RLOA 2UUCQ 1YJ9A 2BH2A 4A3KH 1L2FA 2A8VA 1K3RA 3H0GG 1IBKL 2WFWA 4RG1A 5M3MH 1X3EA 4P74A 2K50A 3CCVA 3PUYA 2JA5G 5M3FG 3IRBA 3J81j 1DGSA 4OONA 4IO9A 4JV5L 1NMFA 4JI2L 1XJVA 4ALPA 4X65L 2XGTA 1KD1C 2KBNA 4J15A 3F2DA 4JI4L 4DUZL 2E5LQ 2MQHA 1VQOA 3F2CA 3UDFA 4YCVA 2UUCL 2D0OA 4DR5Q 4NPSA 2I5LX 1P16A 3RZDH 3G4SA 3T1HL 1SRUA 4AQYQ 2K5VA 3UDGA 2ZM6Q 1Y1WG 2KHJA 1VQCA 4MTNA 3PIOA 5IE8A 4BBRH 1VQBA 1EIFA 1OTCA 4LF9L 4A3GH 1J6QA 3PUVA 3AYHB 3K80C 4JOIC 3CCSA 1SE8A 1YITA 3STBD 2E2JH 4DV5Q 4DR6Q 4X64L 4A3EH 4GN4B 1YZ6A 4P73A 3GO5A 5GROA 5IP7H 3BU2A 1TWCH 1M1KC 2K5NA 3K7AH 3KF8B 4GLXA 3S14H 3GTLH 1Q12A 4UPAA 1PFSA 5IY0A 4JBKA 3JC66 3H0GH 4DV6Q 4BXXG 2PQAA 1S3OA 5C0XJ 3UDXA 1PH2A 4IPDA 2ZJRA 2JA9A 2PNHA 4AYBG 1VQ4A 1C7YA 4JC0A 3KJPA 4PMWA 3I2ZA 4NXNQ 3U58A 4DV3L 1Q7YC 3J7A5 4OWTB 5JJIA 3HOVG 2BA1A 3J80c 5C3EH 1Q82C 4PZ8A 3HKZG 1JJ2A 4IJLA 1WJJA 1D8LA 2RHQB 4POGA 1J5EQ 1K0RA 2QGQA 4X62Q 1XMQL 4LF5L 4X6AH 2DGYA 4LFCL 4JBMA 1N34L 5GAEC 2YTYA 4A3IG 3HOUG 1K8AC 4DUYQ 1KIXA 3FP9A 2ATWA 3E9HA 2ZTCA 1HR0Q 2F52A 2ID0A 4IPHA 1E24A 3G6EA 1SMXA 2VQFQ 3S1QH 1Q8KA 4IFDJ 4HIOA 4A4IA 4A3CG 3M4PA 4DR4Q 4A3CH 4DV2L 1OXUA 2KCTA 2GVAA 1E3PA 1L0WA 1NTGA 4KHPL 3PCOB 2MNAA 1VQ9A 4A3BH 4BBSG 2YU9H 2R92H 4JI3Q 1VQIA 4K0KL 1LM0A 3B6YA 3CMAA 2UXDQ 5AJ3Q 4JI8L 3PO3G 2PI2E 4DV7Q 1NBWA 1AE2A 3NEMA 3CCUA 2YV5A 4QIWE 3TEHB 4LW1A 2PQAB 1HJPA 4YCUA 1E1OA 1UE1A 1KC8C 3HKZE 1KRSA 2R6GA 1V43A 1RIPA 4DAYB 5ELNA 3RN2A 1JJGA 2B3GA 2YTVA 5IP9G 1LYLA 2HIVA 1VQNA 3NENA 5IP9H 5GADC 2UU9Q 3CCLA 5C44G 1JB7A 1C9OA 1TWHH 5DLQE 2OCEA 3CMEA 3SGIA 4PG3A 5JEAJ 3ER0A 4JI3L 4JI7L 2NZOA 1PYBA 1NJIC 1W3SA 4JI8Q 2RF4A 4LF7L 2UXBL 3MXNB 2EXDA 3KF6A 4GOPB 2IX1A 1O7IA 2JA7G 3PO2G 3PF5A 1V1QA 5LMNW 5LMUQ 4P75A 3OYYA 1BBWA 2ALYB 2JA6H 4A76A 4JV5Q 4JI2Q 1X6OA 3FHWA 1X9NA 2UU9L 3WWVA 1A63A 4X65Q 2R93H 4A3MG 2R93G 3U4ZA 3M3YH 1E22A 4A3LH 1U5KA 3JAMi 1PH9A 3L0OA 4JI5Q 3CC2A 2F3IA 1FVIA 4YWLA 3RN5A 2R92G 3NBHB 3U4VA 1NE3A 3KYHC 1IYJB 4DR2Q 4JYAL 2UXBQ 3PIPA 1K73C 2ASBA 1VQGA 2PMZE 3J81i 5FLXc 2R7ZG 2ZM6L 2UUBL 3HOVH 4A93G 1MJCA 1QUQA 1CKNB 3W1BA 2RHSB 4C3JH 4DR1L 1EOVA 4JI1L 1XNRQ 2NVQH 3GTGH 4DUZQ 2E5LL 4A3IH 2HT1A 3DM3A 1K8GA 4LF6Q 3EN2A 2EQSA 2AKWB 5M3FH 2QEXA 4DR3L 3CC4A 1QVCA 3OW2A 2JQOA 1N32Q 1X56A 4YHHQ 1T9HA 2R7FA 3T1YL 4QQBX 4DV1L 2KHIA 2VW9A 1YNXA 3CPWA 3J80i 1UE7A 1XPUA 4UY8C 5GAHC 1Q46A 2WAQE 2Z6KC 3VDYA 4JI1Q 1WCMG 3KJOA 3BZKA 3CXCA 4DV5L 1XNRL 4DR6L 2ZJPA 1EYGA 4X66Q 1U0LA 1XPRA 1EQRA 1HR0W 4LF6L 2IY5B 1I94L 3CW2C 2OWOA 5HY6A 1GD7A 1Q1BA 1Y1VG 1AE3A 4B3TQ 4A3KG 1KXLA 1SROA 3KDFB 4P71A 2BH8A 4GN3B 2LXJA 1WI5A 3S1NH 1CUKA 1QVFA 3Q8DA 2MO1A 1Z47A 4MNOA 4GLAC 1VQPA 1YHBA 2Z6KA 2LSSA 4B3ML 2JK8A 4HJ8A 3HOYG 4IFDG 1CKNA 3NELA 4GN5A 4JCVE 1Q1EA 1IBML 2VQFL 1IL2A 5K36G 2D0PA 1B70B 2UXCL 4GS3A 1MKHA 4LWCA 5J3BA 3PO2H 3STBC 1VQMA 4A3JH 3CP0A 2VS1A 1J5EL 2XTIA 1VS0A 3I4MH 1HNZL 5GQOA 2YTXA 1TWGH 3KOJA 1FJGQ 4GKJQ 3ULPA 4R4CA 4B3MQ 3E9IA 1VQ6A 3GTOH 2WAQG 4BBRG 2KENA 2Q2HA 4A3GG 2A19A 4YCWA 1VQHA 4QGUA 2VUMG 2DUDA 2VQEQ 4DV0L 2VUMH 4KLKA 5ELOA 3UE0A 3K7UC 2WB1G 1HH2P 4GNXA 4JI0L 4L5TA 1RL2A 4JBWA 1KAWA 2Q2IA 1ASYA 4R1JA 3CCRA 2AHOB 3ZJYC 2ZTEA 1HNZQ 3CCQA 1BBUA 4YY3Q 2UXDL 3TREA 5AJ3L 1HNXL 2JEBI 1FJGL 5H1SE 3TS2A 4DKAC 1XTDA 2K52A 4FDBA 4HJ5A 3GTQH 4HIKA 3A74A 3M4OH 1QVGA 1D7QA 1UE5A 4R4OA 1PYSB 4KI0A 1YBYA 2OQKA 4JOIA 4LUVA 4R4IA 1XMOQ 2MFIA 1PH6A 2UUAQ 4JI6L 4LFAL 4A3BG 4C3IH 1PV4A 4L5QA 4DK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC G;  3I4N H;  2OQ0 A;  2B63 G;  1K83 H;  2ZJQ A;  3I4N G;  1YVC A;  2EIF A;  3AEV A;  4JI7 Q;  1TWF H;  2OTL A;  2Y0S G;  2B29 A;  2JE6 I;  4EX5 A;  3F2B A;  3CCJ A;  5E7N A;  1HNX Q;  3RR5 A;  4BY1 H;  4O2D A;  4DR2 L;  4JYA Q;  2ZTD A;  2Y0S E;  4A3M H;  4AQY L;  1OXS C;  2LXK A;  4LF9 Q;  3CC7 A;  2UUB Q;  1KQS A;  3D0F A;  4B3S Q;  2HIX A;  4DR7 L;  3RZO H;  1MIU A;  4LFA Q;  2JA8 H;  4OO1 G;  1HNW Q;  5FLM H;  4JI6 Q;  1CSP A;  4DV4 L;  3D31 A;  3G71 A;  3M9B A;  4YWM A;  4DK6 C;  3K0X A;  2VL6 A;  1ASZ A;  3HOU H;  1L1O A;  1UE6 A;  2N8N A;  4JI5 L;  3GTM H;  3M85 A;  3HOY H;  4A93 H;  1HZB A;  2MO0 A;  2JA6 G;  2E8G A;  3HOX G;  4DNI A;  2K14 A;  3HKS A;  3CCM A;  1VQA A;  3S1R H;  1V9P A;  3GTJ H;  4DV1 Q;  1AH9 A;  1FGU A;  3ULJ A;  4MZ9 A;  1A8V A;  1W2B A;  4WJ3 M;  4DR1 Q;  1E7Z A;  3FKI G;  2Z0S A;  1PVO A;  2JJQ A;  4DV4 Q;  1Q86 C;  2BA0 A;  1X3G A;  3H3V I;  2CQO A;  5C44 H;  5BR8 L;  1M90 C;  3S16 H;  4NXN L;  4LF4 L;  2VY3 A;  2NZH A;  1VQF A;  4R4T A;  2K75 A;  1Q81 C;  3UDI A;  2VZA A;  1HZA A;  3E0E A;  1VQE A;  3T1H Q;  1R9T H;  4YWK A;  4LF5 Q;  4LF8 L;  2VNU D;  5C4X H;  3ERS X;  3W5O A;  3KFU A;  3J7Z C;  1IZ6 A;  3S24 A;  1EWI A;  4WJ4 A;  4L5R C;  3EBE A;  4DAM A;  1TWA H;  2JA8 G;  4QJF A;  5JJL A;  3GD7 A;  3HOZ G;  3GTK H;  4X64 Q;  2CWP A;  1BKB A;  4C3H H;  2AWO A;  1IBM Q;  1N33 Q;  2K5H A;  4BA2 I;  1PH8 A;  2JA5 H;  1JE5 A;  4DV2 Q;  1X3F A;  2IHF A;  2E2H H;  1QZH A;  4KHP Q;  1BVS A;  1N8R C;  1C0A A;  2GN5 A;  4OWX B;  3RLF A;  4K0K Q;  4LF8 Q;  4B3R L;  4OXP A;  3S1M H;  2H5X A;  1I6H H;  4OO1 I;  2A1A A;  1E1T A;  2NVY H;  2B63 H;  1XNQ Q;  1KRT A;  4A3L G;  1L1O C;  4ME3 A;  2GVB A;  1YIJ A;  1PH4 A;  3PF4 A;  4Y52 H;  3PSI A;  4HIM A;  1VQ8 A;  3TRZ A;  2VQE L;  4DV0 Q;  1NMG A;  3GDE A;  1YEZ A;  4RMF A;  4IOC A;  2E2I H;  4JI0 Q;  1WYD A;  1JT8 A;  1I50 H;  4QL5 A;  4NXM L;  1OXT A;  1PHJ A;  4L5S A;  3S17 H;  3G48 A;  3I7F A;  2HHH L;  1XMQ Q;  4LFB Q;  5HGQ A;  4B3R Q;  4GKJ L;  2IHE A;  3KDF A;  3KF6 B;  4GOP A;  4UP9 A;  1PH3 A;  5C4X G;  3J81 c;  1IXR A;  1GVP A;  2D62 A;  2IT1 A;  1K9M C;  2NN6 I;  4JG2 A;  1SR3 A;  3RLN A;  4A3J G;  1HR0 L;  5LMU L;  1B8A A;  1QZG A;  5GAG C;  1WOC A;  3BJU A;  5EAY A;  2UUA L;  4OX9 L;  3AFP A;  2F4V L;  5M5Y H;  2WP8 J;  3AQQ A;  4AYB E;  5IYB G;  3HOZ H;  2OTJ A;  4A3F G;  5M3M G;  3TS0 A;  1PH5 A;  2RCN A;  3FKI H;  2AMC B;  1EUJ A;  1KL9 A;  5FJ8 H;  4YY3 L;  3UE1 A;  5C0X G;  5FJ8 G;  2HHH Q;  2I0Q A;  2NVT H;  4LFB L;  1XPO A;  3TQY A;  1WCM H;  1X54 A;  5IWA Q;  5IT9 c;  2Q2T A;  4UP8 A;  1SFO H;  2N49 A;  3I4O A;  1VQL A;  4TQU S;  1EFW A;  4B3S L;  4OX9 Q;  1IBL Q;  1HNW L;  3M4Q A;  4BY1 G;  1Z9F A;  1S72 A;  4BY7 H;  1GKH A;  5IYD G;  5LMN Q;  4H02 A;  5IYD H;  4JI4 Q;  1JJC B;  4DR5 L;  4DR3 Q;  3I4M G;  1X65 A;  1VQJ A;  2CKZ B;  5IWA L;  4P72 A;  5JJK A;  5FLM G;  3EIV A;  3W1G A;  2CFM A;  4YHH L;  3T1Y Q;  1YJN A;  1IBK Q;  1A0I A;  3K8A A;  4LF7 Q;  3AFQ A;  3RNU A;  3S2H H;  3LGJ A;  1I5F A;  2AWN A;  2C35 B;  2I5H A;  3PV0 A;  3L2P A;  1VQD A;  3H3V H;  2HQL A;  3OTO L;  1IBL L;  2V1C C;  5C4J H;  3H15 A;  1X55 A;  3A5U A;  3PO3 H;  5LMN L;  3HOW G;  4AH6 A;  1Y1W H;  1YHQ A;  4IPC A;  4PZ6 A;  1YI2 A;  4LF4 Q;  1HZC A;  2N78 A;  1QUQ B;  1Y14 B;  3F1Z A;  1H95 A;  1PH1 A;  2N3S A;  4TVA B;  4LNQ A;  4XTC S;  5IP7 G;  3HFZ B;  3PUZ A;  4A3D G;  4IPG A;  1S40 A;  3OTO Q;  1VQ7 A;  3DLL A;  1KHI A;  1OXX K;  4HJA A;  5BR8 Q;  1OXV A;  4BXX H;  1HZ9 A;  3L7Z C;  3CQZ H;  2UXC Q;  4DV3 Q;  5M5X H;  3CAM A;  1CKM A;  3KLW A;  4PZ7 A;  3JAM c;  1N33 L;  4O0A A;  1CSQ A;  1N32 L;  4XIG S;  4GNX B;  3I56 A;  4X62 L;  4DV6 L;  1MJE A;  4HJ7 A;  3F8T A;  1I3Q H;  1G29 1;  2CWA A;  4POF A;  2NVX H;  4LFC Q;  1PA6 A;  1N34 Q;  1EQQ A;  1N36 L;  1GO3 E;  1YHA A;  5IYC H;  4DUY L;  4UP7 A;  2QA4 A;  2WB1 E;  4BBS H;  1VCI A;  1P8L A;  5JEA G;  5C0X I;  4BA1 I;  4DPG A;  4X66 L;  3M7N A;  4NB3 A;  4KHZ A;  4APV A;  2CCZ A;  4A75 A;  1I94 Q;  2JEA I;  2Q2U A;  4LUO A;  3S15 H;  1G6P A;  4JBJ A;  1PH7 A;  3PUX A;  3I55 A;  3CD6 A;  4B3T L;  1GM5 A;  4NXM Q;  1YJW A;  1LUZ A;  1VQK A;  3U50 C;  1VQ5 A;  2R7D A;  4AIM A;  1FL0 A;  4OWW B;  4GKK Q;  2NN6 G;  1TXY A;  4BY7 G;  1B7Y B;  2L15 A;  1N36 Q;  1XNQ L;  2R7Z H;  1SN8 A;  4A3D H;  1NY4 A;  3MEF A;  4IJH A;  3ICE A;  4QY7 A;  4GNX C;  4HJ9 A;  2I5M X;  1XMO L;  4R4Q A;  3HOX H;  4DR4 L;  3A0J A;  2F4V Q;  1LTL A;  4LUZ A;  2JA7 H;  3CF5 A;  2K4K A;  4C2M H;  3K81 C;  3A5Z B;  1L1O B;  4GOP C;  3S2D H;  1A62 A;  3ULL A;  1UEB A;  1JMC A;  3PGZ A;  4Y7N H;  1G51 A;  4GLV B;  4GKK L;  2IX0 A;  4DV7 L;  4HID A;  3HOW H;  2ES2 A;  5IYB H;  1N9W A;  4IOA A;  4A3F H;  1SLJ A;  2YYZ A;  1Y1V H;  3BZC A;  5C3E G;  1CKO A;  2PI2 A;  4DR7 Q;  1UWV A;  4IFD I;  3CPF A;  1WFQ A;  3CCE A;  5M5W H;  3GTP H;  4EQ5 A;  3PUW A;  4A3E G;  1EIY B;  2KCM A;  2FXQ A;  3RLO A;  2UUC Q;  1YJ9 A;  2BH2 A;  4A3K H;  1L2F A;  2A8V A;  1K3R A;  3H0G G;  1IBK L;  2WFW A;  4RG1 A;  5M3M H;  1X3E A;  4P74 A;  2K50 A;  3CCV A;  3PUY A;  2JA5 G;  5M3F G;  3IRB A;  3J81 j;  1DGS A;  4OON A;  4IO9 A;  4JV5 L;  1NMF A;  4JI2 L;  1XJV A;  4ALP A;  4X65 L;  2XGT A;  1KD1 C;  2KBN A;  4J15 A;  3F2D A;  4JI4 L;  4DUZ L;  2E5L Q;  2MQH A;  1VQO A;  3F2C A;  3UDF A;  4YCV A;  2UUC L;  2D0O A;  4DR5 Q;  4NPS A;  2I5L X;  1P16 A;  3RZD H;  3G4S A;  3T1H L;  1SRU A;  4AQY Q;  2K5V A;  3UDG A;  2ZM6 Q;  1Y1W G;  2KHJ A;  1VQC A;  4MTN A;  3PIO A;  5IE8 A;  4BBR H;  1VQB A;  1EIF A;  1OTC A;  4LF9 L;  4A3G H;  1J6Q A;  3PUV A;  3AYH B;  3K80 C;  4JOI C;  3CCS A;  1SE8 A;  1YIT A;  3STB D;  2E2J H;  4DV5 Q;  4DR6 Q;  4X64 L;  4A3E H;  4GN4 B;  1YZ6 A;  4P73 A;  3GO5 A;  5GRO A;  5IP7 H;  3BU2 A;  1TWC H;  1M1K C;  2K5N A;  3K7A H;  3KF8 B;  4GLX A;  3S14 H;  3GTL H;  1Q12 A;  4UPA A;  1PFS A;  5IY0 A;  4JBK A;  3JC6 6;  3H0G H;  4DV6 Q;  4BXX G;  2PQA A;  1S3O A;  5C0X J;  3UDX A;  1PH2 A;  4IPD A;  2ZJR A;  2JA9 A;  2PNH A;  4AYB G;  1VQ4 A;  1C7Y A;  4JC0 A;  3KJP A;  4PMW A;  3I2Z A;  4NXN Q;  3U58 A;  4DV3 L;  1Q7Y C;  3J7A 5;  4OWT B;  5JJI A;  3HOV G;  2BA1 A;  3J80 c;  5C3E H;  1Q82 C;  4PZ8 A;  3HKZ G;  1JJ2 A;  4IJL A;  1WJJ A;  1D8L A;  2RHQ B;  4POG A;  1J5E Q;  1K0R A;  2QGQ A;  4X62 Q;  1XMQ L;  4LF5 L;  4X6A H;  2DGY A;  4LFC L;  4JBM A;  1N34 L;  5GAE C;  2YTY A;  4A3I G;  3HOU G;  1K8A C;  4DUY Q;  1KIX A;  3FP9 A;  2ATW A;  3E9H A;  2ZTC A;  1HR0 Q;  2F52 A;  2ID0 A;  4IPH A;  1E24 A;  3G6E A;  1SMX A;  2VQF Q;  3S1Q H;  1Q8K A;  4IFD J;  4HIO A;  4A4I A;  4A3C G;  3M4P A;  4DR4 Q;  4A3C H;  4DV2 L;  1OXU A;  2KCT A;  2GVA A;  1E3P A;  1L0W A;  1NTG A;  4KHP L;  3PCO B;  2MNA A;  1VQ9 A;  4A3B H;  4BBS G;  2YU9 H;  2R92 H;  4JI3 Q;  1VQI A;  4K0K L;  1LM0 A;  3B6Y A;  3CMA A;  2UXD Q;  5AJ3 Q;  4JI8 L;  3PO3 G;  2PI2 E;  4DV7 Q;  1NBW A;  1AE2 A;  3NEM A;  3CCU A;  2YV5 A;  4QIW E;  3TEH B;  4LW1 A;  2PQA B;  1HJP A;  4YCU A;  1E1O A;  1UE1 A;  1KC8 C;  3HKZ E;  1KRS A;  2R6G A;  1V43 A;  1RIP A;  4DAY B;  5ELN A;  3RN2 A;  1JJG A;  2B3G A;  2YTV A;  5IP9 G;  1LYL A;  2HIV A;  1VQN A;  3NEN A;  5IP9 H;  5GAD C;  2UU9 Q;  3CCL A;  5C44 G;  1JB7 A;  1C9O A;  1TWH H;  5DLQ E;  2OCE A;  3CME A;  3SGI A;  4PG3 A;  5JEA J;  3ER0 A;  4JI3 L;  4JI7 L;  2NZO A;  1PYB A;  1NJI C;  1W3S A;  4JI8 Q;  2RF4 A;  4LF7 L;  2UXB L;  3MXN B;  2EXD A;  3KF6 A;  4GOP B;  2IX1 A;  1O7I A;  2JA7 G;  3PO2 G;  3PF5 A;  1V1Q A;  5LMN W;  5LMU Q;  4P75 A;  3OYY A;  1BBW A;  2ALY B;  2JA6 H;  4A76 A;  4JV5 Q;  4JI2 Q;  1X6O A;  3FHW A;  1X9N A;  2UU9 L;  3WWV A;  1A63 A;  4X65 Q;  2R93 H;  4A3M G;  2R93 G;  3U4Z A;  3M3Y H;  1E22 A;  4A3L H;  1U5K A;  3JAM i;  1PH9 A;  3L0O A;  4JI5 Q;  3CC2 A;  2F3I A;  1FVI A;  4YWL A;  3RN5 A;  2R92 G;  3NBH B;  3U4V A;  1NE3 A;  3KYH C;  1IYJ B;  4DR2 Q;  4JYA L;  2UXB Q;  3PIP A;  1K73 C;  2ASB A;  1VQG A;  2PMZ E;  3J81 i;  5FLX c;  2R7Z G;  2ZM6 L;  2UUB L;  3HOV H;  4A93 G;  1MJC A;  1QUQ A;  1CKN B;  3W1B A;  2RHS B;  4C3J H;  4DR1 L;  1EOV A;  4JI1 L;  1XNR Q;  2NVQ H;  3GTG H;  4DUZ Q;  2E5L L;  4A3I H;  2HT1 A;  3DM3 A;  1K8G A;  4LF6 Q;  3EN2 A;  2EQS A;  2AKW B;  5M3F H;  2QEX A;  4DR3 L;  3CC4 A;  1QVC A;  3OW2 A;  2JQO A;  1N32 Q;  1X56 A;  4YHH Q;  1T9H A;  2R7F A;  3T1Y L;  4QQB X;  4DV1 L;  2KHI A;  2VW9 A;  1YNX A;  3CPW A;  3J80 i;  1UE7 A;  1XPU A;  4UY8 C;  5GAH C;  1Q46 A;  2WAQ E;  2Z6K C;  3VDY A;  4JI1 Q;  1WCM G;  3KJO A;  3BZK A;  3CXC A;  4DV5 L;  1XNR L;  4DR6 L;  2ZJP A;  1EYG A;  4X66 Q;  1U0L A;  1XPR A;  1EQR A;  1HR0 W;  4LF6 L;  2IY5 B;  1I94 L;  3CW2 C;  2OWO A;  5HY6 A;  1GD7 A;  1Q1B A;  1Y1V G;  1AE3 A;  4B3T Q;  4A3K G;  1KXL A;  1SRO A;  3KDF B;  4P71 A;  2BH8 A;  4GN3 B;  2LXJ A;  1WI5 A;  3S1N H;  1CUK A;  1QVF A;  3Q8D A;  2MO1 A;  1Z47 A;  4MNO A;  4GLA C;  1VQP A;  1YHB A;  2Z6K A;  2LSS A;  4B3M L;  2JK8 A;  4HJ8 A;  3HOY G;  4IFD G;  1CKN A;  3NEL A;  4GN5 A;  4JCV E;  1Q1E A;  1IBM L;  2VQF L;  1IL2 A;  5K36 G;  2D0P A;  1B70 B;  2UXC L;  4GS3 A;  1MKH A;  4LWC A;  5J3B A;  3PO2 H;  3STB C;  1VQM A;  4A3J H;  3CP0 A;  2VS1 A;  1J5E L;  2XTI A;  1VS0 A;  3I4M H;  1HNZ L;  5GQO A;  2YTX A;  1TWG H;  3KOJ A;  1FJG Q;  4GKJ Q;  3ULP A;  4R4C A;  4B3M Q;  3E9I A;  1VQ6 A;  3GTO H;  2WAQ G;  4BBR G;  2KEN A;  2Q2H A;  4A3G G;  2A19 A;  4YCW A;  1VQH A;  4QGU A;  2VUM G;  2DUD A;  2VQE Q;  4DV0 L;  2VUM H;  4KLK A;  5ELO A;  3UE0 A;  3K7U C;  2WB1 G;  1HH2 P;  4GNX A;  4JI0 L;  4L5T A;  1RL2 A;  4JBW A;  1KAW A;  2Q2I A;  1ASY A;  4R1J A;  3CCR A;  2AHO B;  3ZJY C;  2ZTE A;  1HNZ Q;  3CCQ A;  1BBU A;  4YY3 Q;  2UXD L;  3TRE A;  5AJ3 L;  1HNX L;  2JEB I;  1FJG L;  5H1S E;  3TS2 A;  4DKA C;  1XTD A;  2K52 A;  4FDB A;  4HJ5 A;  3GTQ H;  4HIK A;  3A74 A;  3M4O H;  1QVG A;  1D7Q A;  1UE5 A;  4R4O A;  1PYS B;  4KI0 A;  1YBY A;  2OQK A;  4JOI A;  4LUV A;  4R4I A;  1XMO Q;  2MFI A;  1PH6 A;  2UUA Q;  4JI6 L;  4LFA L;  4A3B G;  4C3I H;  1PV4 A;  4L5Q A;  4DK3 C; 
#chains in the Genus database with same CATH topology
 3K5N A;  4N8X 1;  4PNY A;  5IYC G;  3I4N H;  2O4X A;  1YVC A;  1TWF H;  1B4O A;  2Y0S G;  3CCJ A;  1HNX Q;  3LNN A;  4KJO A;  4CDF C;  3RR5 A;  4Q5V A;  4DR2 L;  1D2B A;  3VA5 A;  4LF9 Q;  3CC7 A;  1KQS A;  5DAU A;  2EYM A;  4LFA Q;  3RZO H;  4OO1 G;  1VF5 C;  4R9W A;  4BY1 B;  2E2H B;  5CV6 A;  4YWM A;  4Y7N B;  1BF4 A;  2G5D A;  4DK6 C;  5M3M B;  3I70 A;  3HOU H;  3MFY A;  2B8G A;  1HZB A;  1RDP D;  2JA6 G;  1SYE A;  1VQA A;  1V9P A;  3KLS X;  3OMC A;  1FGU A;  1ROD A;  1YNN C;  4ID6 A;  1W2B A;  2ZXO A;  3U9S A;  4DR1 Q;  3TSS A;  3N52 A;  1GUG A;  3H3V I;  1M90 C;  2WAQ B;  2KCC A;  1VQF A;  4R4T A;  2K75 A;  3UDI A;  2WAC A;  4LF5 Q;  5C4X H;  1EWH A;  3E6Z X;  2XWB B;  1WTV A;  4QJF A;  2RDF A;  1IBM Q;  4HSP A;  1GOZ A;  1N33 Q;  5KND A;  2K5H A;  2JA5 H;  2IHF A;  2LMC B;  1QZH A;  1N8R C;  2GN5 A;  2ICE C;  2K7V A;  3C46 A;  1Y1V B;  4K0K Q;  1A3T A;  1U4R A;  2NVY H;  1SSO A;  1L1O C;  4E6I A;  1D1K A;  4G7H C;  4IOC A;  2P5Z X;  2XRQ D;  2F0H A;  3S17 H;  2WII B;  1X3Q A;  4B3R Q;  4GKJ L;  2L55 A;  1IXR A;  2D62 A;  3WOF A;  1K9M C;  1HR0 L;  4A3I B;  5LMU L;  1B8A A;  4MHE A;  1KNA A;  1G8Z D;  5M5Y H;  4A93 B;  3NP8 A;  1PH5 A;  1DOM A;  2AMC B;  1EUJ A;  4LFB L;  3A54 A;  3UE1 A;  3TQY A;  5IWA Q;  2NB0 A;  3MFG A;  2EDG A;  2PNR C;  5C4X B;  4MTK A;  4TQU S;  4DAV A;  1WCM B;  1JWS D;  1E2W A;  1S72 A;  4BY7 H;  1GKH A;  3QOL A;  2NVX B;  4DR3 Q;  1VQJ A;  5IWA L;  5FLM G;  3T56 B;  3W1G A;  4C1N I;  1JIC A;  3T1Y Q;  4LF7 Q;  3AFQ A;  2AQ2 B;  5FO8 B;  1IBL L;  2JA7 B;  3H15 A;  1A3V A;  4I7Z C;  5IT9 E;  3HOW G;  4IPC A;  4PZ6 A;  1YI2 A;  4LF4 Q;  3C2P A;  2G9D A;  1Y14 B;  3F1Z A;  1HFN A;  3GTG B;  2N3S A;  5D65 A;  3PUZ A;  4A3D G;  1ESF A;  1VQ7 A;  1OXX K;  4HJA A;  1OXV A;  2A6E C;  3CQZ H;  2VUM B;  1CKM A;  2SEB D;  1ZYR D;  4PZ7 A;  3FEW X;  1F9S A;  4PV1 C;  4DV6 L;  4HJ7 A;  1C48 A;  3DEP A;  2ENB A;  4DA2 A;  1PLF A;  1AW7 A;  2Q8I B;  5C4J B;  1N34 Q;  4DUY L;  1EEI D;  4F7X A;  4DU9 A;  4LMQ D;  4O42 A;  3HOX B;  1AP0 A;  1MGS A;  1STG A;  4LUO A;  1PH7 A;  4B3T L;  1U9R A;  2AUK A;  1VQK A;  1L0X B;  1FL0 A;  4BY7 G;  1B7Y B;  1I6V C;  3ND9 A;  2R7Z H;  2R93 B;  1IKM A;  4GNX C;  4C3J G;  4F87 A;  3HOX H;  1SYC A;  2JA7 H;  4C2M H;  3J80 L;  3PO2 B;  1B50 A;  1L1O B;  3S2D H;  1A62 A;  3EQL C;  3I72 A;  1JMC A;  4Y7N H;  3S2H B;  1G51 A;  4GLV B;  2IX0 A;  3HOW H;  2PCF B;  4CBV A;  2EY5 A;  4A3F H;  1Y1V H;  3BZC A;  5C3E G;  2EY2 A;  2YU9 B;  4DR7 Q;  1UWV A;  1LLR D;  5JPM C;  1HHV A;  2Q8T A;  1EEF D;  3BG3 A;  3BZD B;  4C3H G;  3CHB D;  5AFW A;  2KCM A;  5JAV A;  2JN4 A;  3VR3 A;  3CCV A;  3PUY A;  5M3F G;  3IRB A;  3J81 j;  4JV5 L;  3R93 A;  1XJV A;  4JI2 L;  1K8O A;  1KD1 C;  4J15 A;  3F2D A;  4IUT A;  2E5L Q;  4RFB A;  2HCC A;  2MQH A;  2SDF A;  3F2C A;  2B2W A;  4K2L A;  2I5L X;  1WD0 A;  4OIJ A;  4ZLT F;  1SE2 A;  1VMC A;  1JOQ A;  4AQY Q;  3UDG A;  1Y1W G;  3HOV B;  4L63 B;  2B2U C;  3SR1 A;  1OTC A;  3M4Y A;  4A3G H;  2KCN A;  3PUV A;  3AYH B;  1SNP A;  3STB D;  4ZQ3 A;  2HCI A;  1IYV A;  4P73 A;  4BBS H;  3BU2 A;  2K5N A;  3KF8 B;  3GTL H;  1VF7 A;  3MZ5 A;  3QJY A;  1WTX A;  1B9M A;  4BXX G;  4UHV A;  2PQA A;  3BDO A;  1PH2 A;  3NTI A;  2PNH A;  3I2Z A;  4NXN Q;  1Q7Y C;  1I50 B;  2KOL A;  1PTO F;  5FO7 B;  3J80 c;  5C3E H;  4PZ8 A;  4IJL A;  4KY5 A;  4X6A H;  4P2C B;  4LFC L;  2YTY A;  3HOU G;  1G2T A;  1KIX A;  3NE5 B;  3OIQ A;  3KK7 A;  4C3I B;  4IPH A;  3IAY A;  1CA6 A;  1NR2 A;  3UI2 A;  2VQF Q;  1SMX A;  3S1Q H;  5C5L A;  5ELF A;  4B9W A;  5L37 A;  1HQR D;  1OXU A;  2G9H D;  2K5Q A;  1EQV A;  4BY7 B;  2ZT9 C;  1WTP A;  5AJ3 Q;  1SMY D;  2PI2 E;  3JAM L;  1WD1 A;  2CH4 W;  2PQA B;  1BQQ T;  1UE1 A;  3NWS A;  4C3H B;  1KC8 C;  5ELN A;  3K5L A;  1J8I A;  2HIV A;  1V8Q A;  2UU9 Q;  2E74 C;  5C44 G;  5I9P A;  3V2T A;  1IW7 C;  2F0L A;  2OCE A;  3DM1 A;  2OXP A;  4JI3 L;  2RF4 A;  2IX3 A;  1NNX A;  1EU3 A;  2F0W A;  3PO2 G;  3PF5 A;  1RCV D;  3OW7 A;  2IPK D;  1MBY A;  1BBW A;  2ALY B;  1JC7 A;  2E75 C;  1X6O A;  4CKB A;  2EJF C;  2R93 H;  2R93 G;  1E22 A;  4A3L H;  3FVQ A;  3RD4 A;  3CC2 A;  5C3X A;  3HEJ A;  3E5S A;  3U4V A;  3KYH C;  1IYJ B;  3NBH A;  4JYA L;  1KLG D;  2PYK A;  3PIP A;  3NK9 A;  1K73 C;  2PMZ E;  2ASB A;  4TSS A;  2BDO A;  3G6J B;  2UUB L;  4KD4 A;  1Q8I A;  1I6H B;  2RHS B;  4DR1 L;  1RD9 D;  1SXT A;  5M9O A;  1CA5 A;  1JWM D;  2DNE A;  5KEE A;  4WFN 3;  4YHH Q;  2R7F A;  1RTO A;  4QQB X;  1I4R A;  1F9R A;  5I9O A;  1UE7 A;  5GAH C;  4RKB A;  2Z6K C;  2K1B A;  4JI1 Q;  1WCM G;  3KJO A;  2ZJP A;  1EYG A;  1XPR A;  2OWO A;  5HY6 A;  3VYU A;  1AE3 A;  4B3T Q;  1GHJ A;  3KDF B;  4GN3 B;  4MNO A;  1O78 A;  1Z47 A;  2D2C C;  2MO1 A;  3Q8D A;  5CV4 A;  2Z6K A;  4RH6 A;  2LSS A;  4B3M L;  1SJE D;  3P20 A;  1GUT A;  2B8F A;  1ET9 A;  4HED A;  5LHY 1;  1TU2 B;  5J3B A;  1VQM A;  2F0D A;  2BDN A;  2RDG A;  2XNA C;  3CP0 A;  2VS1 A;  1ENF A;  2WV6 D;  1H9J A;  3D6C A;  2VXW A;  1Q3L A;  3E9I A;  4B3M Q;  1VQ6 A;  4QCL A;  4NMZ A;  2TSS A;  2KEN A;  4NKL A;  4H44 C;  2AUJ D;  2DUD A;  4KLK A;  3H09 A;  3OWE B;  3K7U C;  1HH2 P;  4G7O C;  1PFM A;  3RZD B;  4JBW A;  4R1J A;  2CHB D;  1HXY D;  1DJR D;  1JOO A;  1HNZ Q;  1BBU A;  3NPP A;  5K5P A;  2JEB I;  1FJG L;  5H1S E;  3K5O A;  2K52 A;  3GTQ H;  4HIK A;  5D3D A;  3IKJ A;  4OEL B;  4QUC A;  1PYS B;  4LUV A;  2UUA Q;  1W6K A;  4C3I H;  1PV4 A;  4L5Q A;  4DK3 C;  2ZJQ A;  3GTM B;  2EIF A;  3AEV A;  1GXD C;  2B29 A;  2JE6 I;  4EX5 A;  1PZJ D;  4JYA Q;  1S5C D;  2EYL A;  1OXS C;  4HAE A;  2UUB Q;  4DNT B;  2JA8 H;  1HNW Q;  1WTO A;  1STY A;  4JI6 Q;  1CSP A;  3G71 A;  3QOJ A;  1Y8P B;  3M9B A;  1PRT C;  5ISR A;  2D9U A;  3GTM H;  2MO0 A;  2O5I C;  4DNI A;  5G3L F;  4ZAI A;  4FF4 A;  4DV1 Q;  1AH9 A;  1VMP A;  2EVB A;  1E7Z A;  2Z0S A;  3MXU A;  2JJQ A;  2TMP A;  2J4X A;  1X3G A;  2B2T A;  2CQO A;  4FO2 A;  4LF4 L;  2VY3 A;  4OGQ C;  1HZA A;  1VQE A;  1F2Z A;  4LF8 L;  3AMU A;  3ERS X;  3KFU A;  5CV5 A;  4QUF A;  2A73 B;  2M9V A;  2EXZ A;  4LK1 C;  2K5W A;  5C5M A;  4L5R C;  2HDM A;  1TWA H;  3SK8 A;  5JJL A;  3HOZ G;  3MXN A;  4X64 Q;  2CWP A;  4C3H H;  2AWO A;  5CBE E;  2B2W C;  4IUP A;  2H1E A;  1EFI D;  2PZU A;  1G91 A;  4OXP A;  2H5X A;  1C8C A;  3J7Y W;  4OO1 I;  1E1T A;  4MIU A;  3T16 A;  1STB A;  4ME3 A;  1YIJ A;  3PF4 A;  3TP6 A;  1ICF B;  3GTP B;  3PSI A;  4HIM A;  2R61 A;  4K5X A;  2VQE L;  4DV0 Q;  3GDE A;  1PDQ A;  2A6H C;  4JI0 Q;  4CDE C;  2JA8 B;  4A3K B;  4QL5 A;  2F0M A;  1U4M A;  3H6M A;  1PHJ A;  1MSG A;  1H9S B;  3I7F A;  4N9P A;  2HHH L;  2EYF A;  3KDF A;  1FD7 D;  3SK4 A;  1U4L A;  3J81 c;  2IT1 A;  2KEE A;  3RLN A;  4JVZ A;  5GAG C;  2F4V L;  3AQQ A;  5IYB G;  4H7B A;  4A3F G;  4EQN A;  5M3M G;  4XQN A;  3TS0 A;  1ZKO A;  3HZX A;  4PMC A;  4DAY A;  4EGV A;  3FKI H;  3A7L A;  2HHH Q;  5FJ8 G;  4QB4 A;  2C5C A;  1SFO H;  2MHV A;  2N49 A;  1CK1 A;  3KUP A;  3ZYY X;  2HQE A;  4B3S L;  2Y0S B;  1QJO A;  2WB1 B;  4OX9 Q;  1IBL Q;  3Q0A A;  4KN7 C;  1B9N A;  5LMN Q;  4H02 A;  2K5D A;  4FXD A;  1S5D D;  1PMR A;  3C1E A;  4Q0F A;  1LTI D;  3ND8 A;  4F8M A;  1S4Z A;  4YHH L;  2CFM A;  1DXM A;  3TME A;  1FGB D;  3RNU A;  2EJG C;  3FMC A;  2AWN A;  2A68 C;  4TKO B;  1WTH A;  2I5H A;  3PV0 A;  4KMU C;  1AZQ A;  5LMN L;  1Y1W H;  1YHQ A;  1MI2 A;  1LT4 D;  1QUQ B;  3PIP 3;  3M7G A;  1PH1 A;  4ULL A;  2NWG A;  4RGM A;  4XTC S;  2MGS A;  1XXG A;  1EY6 A;  3OTO Q;  2EYH A;  3DLL A;  4K5V A;  5BR8 Q;  2CW0 D;  1V1O A;  4ZCK A;  4CKE A;  2UXC Q;  2D5D A;  2BOS A;  4DV3 Q;  3KLW A;  1B3A A;  1CM9 A;  3MAQ A;  2A69 D;  2F0Q A;  4GNX B;  4N8F A;  1NSN S;  1MJE A;  1G29 1;  2CWA A;  4JW0 A;  4LFC Q;  1IHZ A;  2Z1C A;  1EQQ A;  1GO3 E;  5IYC H;  2JP1 A;  3GV6 A;  3NBI A;  1EY8 A;  5JEA G;  4BA1 I;  1R9T B;  4X66 L;  4APV A;  2JEA I;  4JBJ A;  4KKS A;  2RQX A;  4JK1 C;  1LUZ A;  2A74 C;  2R7D A;  4OEM B;  2NN6 H;  4KD3 A;  4CDC C;  2B2Y A;  5FK9 C;  2L15 A;  1N36 Q;  4AYB B;  2E2J B;  4H13 C;  4A3D H;  2XRS D;  3MEF A;  3ICE A;  1HA6 A;  4R4Q A;  1UAP A;  1LTL A;  2K4K A;  4GOP C;  1K83 B;  1JQY D;  2LS0 1;  1UEB A;  3PGZ A;  2B2V A;  4CJ0 B;  5I6Y A;  1HTP A;  4GKK L;  1I4Q A;  2PW5 A;  3I4L A;  4DV7 L;  3OMG A;  4DFA A;  4IOA A;  1SLJ A;  1HPC A;  2YYZ A;  1JB3 A;  4GZY C;  3EA6 A;  1CKO A;  1I3Q B;  2B39 A;  1HUN A;  2B2V C;  1Y8N B;  4IFD I;  1WVL A;  2EY1 A;  3GTP H;  4EQ5 A;  3DWP A;  1EIY B;  4OHJ A;  4IUR A;  3A8K E;  2UUC Q;  4A3K H;  3QR8 A;  1L2F A;  3DWQ A;  1EZ6 A;  1K3R A;  4R8N A;  3H0G G;  1F2M A;  1TWC B;  4RG1 A;  2K50 A;  2JA5 G;  3GTK B;  1NMF A;  2IWH A;  1ESR A;  5C3E B;  3S1R B;  2KBN A;  1SNO A;  1PFB A;  3MA2 B;  5EGT A;  1BCP B;  2D0O A;  1D1I A;  3HOW B;  4NPS A;  5IT9 L;  2DJG C;  2SOB A;  2M00 A;  2MPM A;  2ZM6 Q;  1VQC A;  4LF9 L;  4BBR H;  1VQB A;  1TII D;  2E2I B;  3GTO B;  3CCS A;  1YIT A;  2E2J H;  3DUZ A;  5KYI A;  1CHQ D;  4X64 L;  4RA8 A;  5GRO A;  3GO5 A;  1M1K C;  2JXM B;  3E0J A;  4UPA A;  2RDH A;  3TP8 A;  5IY0 A;  4X3U A;  4DV6 Q;  3I8Z A;  2LFN A;  3KLR A;  1NR4 A;  2RSN A;  2ZJR A;  2JA9 A;  4K6D A;  4AYB G;  1VQ4 A;  1X3P A;  4KHV A;  3IL8 A;  2EYO A;  4JC0 A;  4V0B A;  4PMW A;  4DV3 L;  3RZO B;  5NUC A;  3K0Y A;  3HKZ G;  5ELC A;  2RHQ B;  4POG A;  3HOU B;  4X62 Q;  2QGQ A;  4A3I G;  1H9R A;  1K8A C;  1I4X A;  5M5X B;  3FP9 A;  3E9H A;  2ZTC A;  3R2T A;  4CKC A;  2F52 A;  3I90 A;  2K28 A;  2PQE A;  1R4Q B;  4C1N K;  5KYL A;  1Q8K A;  4IFD J;  3M4P A;  4A3C H;  4DV2 L;  1EWC A;  5KIX A;  3PCO B;  2SNM A;  2MJ8 A;  1STH A;  1TY2 A;  2MNA A;  4BBS G;  4JI3 Q;  1VQI A;  4K0K L;  4IUQ A;  3A55 A;  3NEM A;  3L9A X;  4QIW E;  4LW1 A;  2RCF A;  3HKZ E;  5IP9 G;  4I65 A;  5IP9 H;  1JB7 A;  2A6H D;  5DLQ E;  3CU7 A;  3OOC A;  3CME A;  5JEA J;  3AB9 A;  1Y1W B;  1BDO A;  1PYB A;  1NUC A;  1W3S A;  4JI8 Q;  4LF7 L;  1AN8 A;  3MXN B;  2PPB C;  4GOP B;  2UXB L;  1I4G A;  4KY6 A;  5LMN W;  4P75 A;  3OYY A;  3S16 B;  4K14 A;  2WIN B;  1X9N A;  3OHX C;  5IGC A;  4X65 Q;  3U4Z A;  3M3Y H;  2K33 A;  1U5K A;  3L0O A;  5CV8 A;  1KDC A;  4YWL A;  2F0G A;  2R92 G;  5JVH 3;  4DR2 Q;  2UXB Q;  4RGT A;  1VQG A;  5FLX c;  1EU4 A;  2R7Z G;  2ZM6 L;  4UDU C;  3HOV H;  4A93 G;  4IN3 A;  2F0P A;  3W1B A;  1CKN B;  1R4P B;  2WKD A;  2NVQ H;  3D6W A;  1KLU D;  3ERO A;  3BYT B;  2E5L L;  4A3I H;  1BOS A;  1K8G A;  3K57 A;  2Z6B A;  4DNR B;  2KEC A;  3MEH A;  2QEX A;  4C3J B;  1QVC A;  1DOL A;  1X56 A;  4EQP A;  1KDB A;  3Q23 A;  4M1U B;  1K8M A;  1YNJ C;  1FNW A;  2ZXR A;  4ILW A;  2EJM A;  2WAQ E;  1PTO B;  1LTS D;  3NXW A;  3CXC A;  1XNR L;  4DV5 L;  2NVQ B;  1EQR A;  1EIG A;  2F0V A;  1I94 L;  4LJZ C;  1Y1V G;  1F9Q A;  4OIK A;  4HN7 A;  2BH8 A;  3NWT A;  3MVV A;  1U4P A;  1LTR D;  4GLA C;  1YHB A;  1XYI A;  1LT6 D;  2EE1 A;  5I6W A;  5FKA C;  4HJ8 A;  1HQM C;  3HOZ B;  4IFD G;  3NEL A;  4IFD H;  1G6Z A;  4JCV E;  1EQT A;  3S1Q B;  1LT5 D;  2SNS A;  1IBM L;  2VQF L;  1B70 B;  1O7Z A;  4GS3 A;  1MKH A;  3QWN A;  2L4N A;  1M4V A;  2IJ0 A;  3Q22 A;  2XTI A;  3GP7 A;  3KOJ A;  1TWG H;  2PMZ B;  2RSO A;  3R3O A;  1STE A;  2WAQ G;  4A3G G;  1JWU D;  1RJT A;  2VUM G;  4DV0 L;  3UE0 A;  4JI0 L;  3W3A A;  4L5T A;  1IL8 A;  1RTN A;  1RL2 A;  1GJX A;  1KAW A;  2Q2I A;  3CCR A;  2AHO B;  3ZJY C;  4FVM A;  3CCQ A;  2UXD L;  2NVT B;  2A68 D;  4RGO S;  4DKA C;  1SJH D;  2F0E A;  4FDB A;  4NDX A;  3A74 A;  1FNV A;  1EOT A;  1PFN A;  1D7Q A;  3C3L A;  1UE5 A;  1TS5 A;  4KI0 A;  1YBY A;  4JOI A;  2MFI A;  5IGB A;  2OQ0 A;  2B63 G;  3I4N G;  4HMI A;  3S2D B;  1UUP A;  4JI7 Q;  1SNM A;  4BY1 H;  4A3M H;  1T5X D;  4AQY L;  1TWA B;  3CRK C;  2LXK A;  2Z4I A;  4B3S Q;  2HIX A;  4RKL A;  4N9T A;  4MN3 A;  3SDZ A;  3D31 A;  3S9W A;  2F0T A;  3MXG A;  2VL6 A;  1L1O A;  1UE6 A;  3M85 A;  3HOY H;  2NBF A;  3QB3 A;  2E8G A;  2K14 A;  3S1R H;  1H9S A;  3GTJ H;  4FF1 A;  2K01 A;  3VR6 A;  2ZXP A;  3KBG A;  5DNF A;  1PVO A;  4IUV A;  2F1M A;  5FO9 B;  1Q86 C;  5EPL A;  5JVG 3;  2DJF C;  5C44 H;  3S16 H;  5I2X A;  4NXN L;  2NZH A;  1TT2 A;  1Q81 C;  4KTA A;  3VR2 A;  5D3I B;  3T1H Q;  2RVL A;  1R9T H;  4YWK A;  3HP3 A;  2VNU D;  3W5O A;  1KDA A;  1EY9 A;  4WJ4 A;  2K03 A;  4A3G B;  4FXG C;  5E3F A;  3FDT A;  1JOK A;  3NUC A;  2JA8 G;  2I46 A;  5TSS A;  5HGT A;  3FKI B;  2J7Z A;  2F0F A;  4O1N A;  3NTH A;  1BVS A;  3SHL A;  1CQF A;  3RLF A;  4B3R L;  3Q24 A;  4CJ2 C;  3S1M H;  2B63 H;  4A3L G;  5IOC A;  4X3T A;  1PH4 A;  1AZP A;  3PO3 B;  1CTM A;  1Z6H A;  4PMB A;  1VQ8 A;  3O13 A;  3P1H A;  1WYD A;  4K5W A;  1JT8 A;  2HUG A;  1I50 H;  5FOB B;  3FPP A;  4LFB Q;  1XMQ Q;  5HGQ A;  1SYF A;  5ELD A;  3KF6 B;  3BVZ A;  1PH3 A;  3GTQ B;  3K6O A;  2B63 B;  2NN6 I;  4JG2 A;  1SR3 A;  1QZG A;  3T51 B;  5EAY A;  2UUA L;  4OX9 L;  3AFP A;  3A7A B;  3HOZ H;  2WP8 J;  4RCN A;  4AYB E;  2OTJ A;  1PXU A;  4TRD A;  1TY0 A;  2RCN A;  2CVR A;  2F3W A;  1KL9 A;  5EBC A;  3H94 A;  1EY5 A;  5C0X G;  2CQA A;  2I0Q A;  1F2Y A;  1WCM H;  4UP8 A;  2L9H A;  4ZYS A;  3D4D A;  1ENC A;  1TWG B;  3NQI A;  1VQL A;  2KUM A;  1Z9F A;  4A3B B;  3D4W A;  4M8A A;  1QCB D;  4BBR B;  5DM6 3;  3KF8 A;  1X65 A;  1BXT A;  1ICW A;  4P72 A;  1IBK Q;  1A0I A;  3K8A A;  3LGJ A;  1RF2 D;  3L2P A;  1VQD A;  2HQL A;  1IW7 D;  3J80 E;  5JPN C;  3A5U A;  3SK5 A;  3VYT A;  4B9X A;  4L8J A;  3PO3 H;  4AH6 A;  2QKI C;  1GUS A;  3EFX D;  2N78 A;  2Z8L A;  4ABN A;  1SFO B;  3M4O B;  1H95 A;  4UAI A;  3S1N B;  3QG1 A;  4TVA B;  3FPU B;  2EOT A;  3HFZ B;  4IPG A;  1S40 A;  1A2T A;  4IAL A;  5E1F A;  4C3I G;  1UNS A;  1A6X A;  1II3 A;  1HZ9 A;  3QO2 A;  3L7Z C;  5JOB A;  2K6A A;  3VYS A;  5M5X H;  4A3E B;  1WTQ A;  1CQV A;  4XIG S;  1JE4 A;  1ILQ A;  3PIO 3;  1DD2 A;  1I3Q H;  4POF A;  5T1G A;  1TS2 A;  1YHA A;  4UP7 A;  2QA4 A;  5C0X H;  2PW7 A;  1T5E A;  2WB1 E;  4ODG A;  1VCI A;  4DPG A;  1WTR A;  4NB3 A;  4KHZ A;  2CCZ A;  4A75 A;  1I94 Q;  1D5Z C;  1G6P A;  4IQZ A;  3CD6 A;  3PUX A;  2R7Z B;  2F0I A;  1B1Z A;  5A35 A;  5JJZ A;  1GM5 A;  3T13 A;  3U50 C;  1EY7 A;  4OWW B;  4GKK Q;  3HS0 C;  1TXY A;  4X3K A;  1XX8 A;  3A8I E;  1LT3 D;  5A2Q L;  4HCE A;  1NY4 A;  1GHK A;  2I5M X;  1XMO L;  5G3L D;  1SYG A;  3IFT A;  1SYD A;  1S5F D;  2HDL A;  3BVG A;  1EIH A;  3K7A B;  3A8J E;  3TZD A;  4DK1 A;  3P7J A;  3A5Z B;  3ULL A;  1ILP A;  1LAB A;  5COR A;  5IYB H;  4G7Z C;  1BCP C;  1QNU A;  2QF7 A;  2PI2 A;  3D8G A;  4DN4 M;  1E2V A;  3CPF A;  1KAA A;  1WFQ A;  1TQO A;  2BCO A;  3PUW A;  4A3E G;  4XT3 B;  5E4X A;  4BWG B;  4BS9 A;  1YJ9 A;  1KTK A;  3LX0 A;  4KKU A;  3V96 A;  5IGD A;  3RMH A;  4IO9 A;  4RHS A;  3MC0 B;  4ALP A;  3URY A;  2X6G A;  4JI4 L;  4DUZ L;  1C4Q A;  1NCV A;  1EY4 A;  1V1P A;  4YCV A;  2C9O A;  3RZD H;  1P16 A;  3G4S A;  3NHH A;  3T1H L;  3H91 A;  3I73 A;  1SRU A;  5EKL A;  4MTN A;  3PIO A;  1QOH A;  5CV9 A;  1CFM A;  1QIL A;  1SE3 A;  1J6Q A;  3K80 C;  1SE8 A;  2IL8 A;  4DR6 Q;  1SEB D;  4RWS C;  2L11 A;  4GN4 B;  2JSO A;  1YZ6 A;  5IP7 H;  1GUN A;  3DEO A;  4KN4 C;  1TWC H;  1CT1 D;  2GA4 B;  3K7A H;  1DOK A;  1PFS A;  5DEH A;  1YNJ D;  2LKV A;  3JC6 6;  3K58 A;  1HCZ A;  4L6T B;  2L12 A;  1J9O A;  3H0G H;  1F2L A;  1EY0 A;  5C0X J;  3UDX A;  1C7Y A;  4Z9C B;  2XIW A;  4KK7 A;  3J7A 5;  1Q82 C;  1RKN A;  3WDN A;  4K2K A;  5EBD A;  1D8L A;  3PMF A;  1J5E Q;  4ZK9 B;  4LF5 L;  3SEB A;  3SK6 A;  4JBM A;  4YIJ A;  2J0T D;  4RCO A;  3L3O C;  2KA7 A;  2K05 A;  1XWE A;  3D4R A;  1E24 A;  1TVX A;  4XDX A;  2B2T C;  3G6E A;  4HIO A;  5HUR A;  4CDD C;  2KCT A;  1L0W A;  2GVA A;  1EZ8 A;  5IGE A;  1NTG A;  1CHP D;  4A3B H;  1BUV T;  2R92 H;  1DZ1 A;  4EQO A;  2BE5 D;  3CMA A;  2UXD Q;  3E3X A;  4FF2 A;  4K8I A;  3CCU A;  3S14 B;  4A3D B;  2EPB A;  5JJK A;  1V43 A;  1JJG A;  1OO9 B;  2B3G A;  2YTV A;  1LYL A;  1DM0 B;  3NEN A;  5GAD C;  3SGI A;  3ER0 A;  3LWU A;  1PYW D;  3KF6 A;  2IX1 A;  2JA7 G;  1O7I A;  2AQ3 B;  2EYP A;  5C3W A;  3WOE A;  5LMU Q;  4JV5 Q;  1A63 A;  4A3M G;  2I07 B;  3D3R A;  3JAM i;  1PH9 A;  1V1P B;  5M3F B;  4JI5 Q;  3DHQ A;  2F3I A;  3RUZ A;  1E2Z A;  1BCP F;  2L1B A;  1TR5 A;  1FR3 A;  1MJC A;  3A56 A;  1BNZ A;  2H4O A;  4J8Q A;  5DM7 3;  2NUC A;  1XNR Q;  1EL0 A;  3ONA B;  4LF6 Q;  5FLX E;  4F88 A;  2EQS A;  3MTS A;  5M3F H;  4DR3 L;  3CC4 A;  4HR7 B;  1M8A A;  2JQO A;  3OSO A;  5CYU A;  4A3F B;  1T9H A;  1N32 Q;  1DYQ A;  4DV1 L;  2KHI A;  1TWF B;  3VA7 A;  3TBI B;  4FXK C;  2VW9 A;  4QIW B;  4IZ8 A;  3CPW A;  2FHT A;  3SE0 A;  1XPU A;  4DAP A;  1Q46 A;  3OPO A;  3VDY A;  3BZK A;  4DR6 L;  4X66 Q;  1U0L A;  1HR0 W;  4LF6 L;  3FRP B;  1PTO D;  3N6R A;  5C6A A;  4A3K G;  1QWY A;  4P71 A;  2LXJ A;  5C4Z A;  1WI5 A;  5I2Y A;  4C56 C;  1W6J A;  3VR5 A;  3NQT A;  1B3Q A;  4XYO A;  2D0P A;  2UXC L;  3TP5 A;  3PO2 H;  4A3J H;  2K04 A;  2MP1 A;  1VS0 A;  1JOR A;  1HNZ L;  3KLS A;  2YTX A;  1FJG Q;  1O7L A;  1SDF A;  5CMD A;  4S3S A;  2EYJ A;  4R4C A;  3ULP A;  4GKJ Q;  5IGG A;  1TWH B;  3R8B A;  2CW0 C;  4BBR G;  2QEJ C;  4FP5 D;  4YCW A;  2VQE Q;  4OO1 H;  5ELO A;  2KJX A;  1NAP A;  3DXJ C;  5COY A;  5E4W C;  4YY3 Q;  2JA6 B;  3TRE A;  5AJ3 L;  1HNX L;  3TS2 A;  3W2D A;  4XT1 B;  3QIA A;  4HJ5 A;  1B53 A;  4J1M A;  4R4O A;  1XMO Q;  2NVY B;  2OQK A;  1PRT D;  1HRJ A;  2VB3 X;  1K83 H;  2OTL A;  3F2B A;  5E7N A;  2Z4H A;  3TDQ A;  4O2D A;  2ZTD A;  2Y0S E;  1O80 A;  1VDZ A;  1SE4 A;  3K5M A;  3D0F A;  1BCP D;  4DR7 L;  1MIU A;  1GUW A;  2L0C A;  5FLM H;  1CZG A;  4DV4 L;  5BN3 A;  4X3S A;  4ZKC B;  3K0X A;  5IIF A;  2AQ1 B;  1ASZ A;  2N8N A;  4JI5 L;  4KY7 A;  4A93 H;  5M5Y B;  3GTL B;  1A2U A;  3HOX G;  3HKS A;  3CCM A;  5ELB A;  1H9K A;  3ULJ A;  4MZ9 A;  1A8V A;  4WJ3 M;  3FKI G;  4J6H A;  4DV4 Q;  5LL6 X;  2BA0 A;  4LAA A;  5BR8 L;  3DWA A;  4K6L A;  1DON A;  2VZA A;  4A3M B;  3E0E A;  5KNB A;  4U68 A;  1PTO C;  5JEA H;  1MSH A;  3BDL A;  3S17 B;  3J7Z C;  1IZ6 A;  3S24 A;  3NTK A;  1Y69 U;  1EWI A;  3EBE A;  4DAM A;  4ZUI A;  3GD7 A;  3HOY B;  3GTK H;  1CI3 M;  1BKB A;  4BA2 I;  1PH8 A;  1JE5 A;  4DV2 Q;  1X3F A;  2E2H H;  1S5E D;  4KHP Q;  1KNE A;  1C0A A;  4OWX B;  1F9P A;  4LF8 Q;  5IOD A;  1BBX C;  1I6H H;  5J1Z A;  2A1A A;  1AEX A;  2FIN B;  1XNQ Q;  1KRT A;  2GVB A;  2F0N A;  4Y52 H;  5M5W B;  2N88 A;  3TRZ A;  2RA4 A;  1UEA B;  1NMG A;  4RMF A;  1YEZ A;  2E2I H;  5EKK A;  4CHT B;  4R8I A;  4NXM L;  1OXT A;  4L5S A;  3G48 A;  2F3V A;  2O5J C;  2IHE A;  4GOP A;  4UP9 A;  5C4X G;  3MXP A;  1GVP A;  3I4N B;  2F0O A;  1LV9 A;  4A3J G;  3I3C A;  1WOC A;  2XVS A;  3BJU A;  1SBB B;  4QF4 A;  2F0J A;  2F4I A;  4U67 3;  5EKI A;  4YY3 L;  3GTJ B;  5FJ8 H;  5EPK A;  2NVT H;  1XPO A;  4ZKB B;  1X54 A;  5IT9 c;  2Q2T A;  5J22 A;  4OL7 A;  3JAM E;  4DXG A;  3I4O A;  4G57 A;  1EFW A;  4DK0 A;  2EZV A;  1HNW L;  5K36 H;  2DNC A;  3M4Q A;  1LTA D;  4BY1 G;  5IYD G;  4KKT A;  5IYD H;  3BS1 A;  4JI4 Q;  5IGF A;  5CV7 A;  1FYC A;  3EJI A;  1JJC B;  1SNQ A;  2DN8 A;  4DR5 L;  3I4M G;  2CKZ B;  1MHW C;  3EIV A;  1YJN A;  4IUN A;  3VR4 A;  3SVM A;  3S2H H;  1I5F A;  4JPB W;  2DY8 A;  2C35 B;  3H3V H;  4G4K A;  3OTO L;  1X32 A;  2V1C C;  5C4J H;  5KRU A;  1X55 A;  2OT2 A;  2A6E D;  1GUO A;  1PZI D;  1HZC A;  4DXF A;  5A2Q E;  2NTT A;  3C1F A;  4B08 A;  1B2T A;  5EQ0 A;  4LNQ A;  2JA5 B;  1WTW A;  5IP7 G;  1KHI A;  1A15 A;  4BXX H;  3GQB A;  1SNC A;  1JR0 D;  3CAM A;  3JAM c;  1N33 L;  4O0A A;  1CSQ A;  3T4A C;  1N32 L;  3ERQ A;  3VYR A;  3AU7 A;  3MHB A;  1L0Y B;  3M3Y B;  3I56 A;  2WKC A;  1K3B C;  1H9M A;  2QW7 A;  4X62 L;  3F8T A;  1BR9 A;  2NVX H;  1PA6 A;  1BO0 A;  1N36 L;  2XSC A;  1P8L A;  2MUY A;  5CBA E;  5C0X I;  3M7N A;  1SYB A;  3BVM A;  3KBX A;  2Q2U A;  3EVQ A;  3S15 H;  3I55 A;  4NXM Q;  2X6L A;  1YJW A;  3ITP A;  1VQ5 A;  4ZRZ A;  4AIM A;  2QDL A;  2NN6 G;  4BBS B;  3TP7 A;  1XNQ L;  1STN A;  1SN8 A;  4IJH A;  4QY7 A;  5EPJ A;  4HJ9 A;  3NSW A;  4DR4 L;  4WOR A;  3A0J A;  1PTO H;  1LAC A;  3TZU A;  2F4V Q;  4LUZ A;  3CF5 A;  3K81 C;  2QCP X;  2K32 A;  1EYC A;  4FNF A;  2LY7 A;  4HID A;  3HKZ B;  2ES2 A;  1D6E C;  1N9W A;  2XN9 C;  2R92 B;  2F0S A;  1HFG A;  4FYD A;  3CCE A;  5M5W H;  1XTC D;  4XQJ A;  1LTB D;  2A5H A;  2FXQ A;  3RLO A;  3J81 E;  2BH2 A;  2A8V A;  1IBK L;  2WFW A;  5M3M H;  1PRT B;  1X3E A;  4IUU A;  4P74 A;  2CH4 A;  2FFK B;  1D5X C;  1DGS A;  4OON A;  1TKW B;  2E2D C;  4X65 L;  2XGT A;  2KED A;  3J7A F;  1QE6 A;  1VQO A;  3UDF A;  2XWJ B;  2UUC L;  4DR5 Q;  1ZXT A;  2KVM A;  4XXE A;  2B2Y C;  5F2D A;  4DF7 A;  1G2S A;  2K5V A;  3MWY W;  2KHJ A;  1IYU A;  3BDC A;  4I7A A;  2HD3 A;  1EIF A;  5IE8 A;  3HRZ C;  3OWF A;  1PRT F;  3HGB A;  4JOI C;  4DV5 Q;  1LTT D;  4A3E H;  4PQX A;  5I4D A;  4A3B G;  4EVO A;  4GLX A;  3S14 H;  5J39 A;  1Q12 A;  4JBK A;  2PZW A;  1ZEQ X;  3X3M A;  1S3O A;  3IFD A;  1QG7 A;  4IPD A;  4KV6 A;  1KAB A;  3KJP A;  3CKI B;  1A3U A;  5C4H A;  2L5T A;  5KNC A;  3U58 A;  5FLX L;  1FNU A;  1IKL A;  1ENA A;  2EY6 A;  4OWT B;  5JJI A;  3HOV G;  2BA1 A;  2QIL A;  1Q90 A;  1JJ2 A;  1SND A;  1WJJ A;  1K0R A;  1XMQ L;  2RKS A;  2DGY A;  1N34 L;  5GAE C;  3CQZ B;  1AFP A;  4DUY Q;  1MD2 D;  1DCZ A;  5CC4 A;  2ATW A;  2RBM A;  1HR0 Q;  2ID0 A;  4RGN A;  4A4I A;  4A3C G;  4DR4 Q;  2N55 A;  4HTH A;  1E0B A;  1ML0 D;  1E3P A;  1TS3 A;  4KHP L;  1QNK A;  3H0G B;  4KJN A;  2YU9 H;  2JYO A;  3BYY B;  1LM0 A;  3B6Y A;  1ZYR C;  2F0K A;  4JI8 L;  2F03 A;  3PO3 G;  4XQQ A;  4DV7 Q;  1NBW A;  1AE2 A;  2YV5 A;  3TEH B;  1HJP A;  4YCU A;  1E1O A;  1VQ9 A;  3H3V C;  3RN2 A;  1KRS A;  2R6G A;  4DAY B;  1RIP A;  4NP5 A;  1VQN A;  3CCL A;  1C9O A;  1TWH H;  2R3Z A;  2KQ3 A;  2DY7 A;  4PG3 A;  5C44 B;  2A69 C;  2PO4 A;  3HG9 A;  2NZO A;  4JI7 L;  3S15 B;  1NJI C;  2NYZ D;  2X69 A;  3GV3 A;  1Z7T A;  2EXD A;  5T1I A;  5D14 A;  1B44 D;  4C2M B;  2OEO A;  1V1Q A;  4DGZ A;  5BN5 A;  3S1M B;  1ET6 A;  1TS4 A;  3OIP A;  2JA6 H;  4A76 A;  4JI2 Q;  2QDB A;  3FHW A;  2UU9 L;  1HTL D;  3WWV A;  4FF3 A;  4WRD A;  3I4M B;  3LWE A;  4XYQ A;  1FVI A;  3RN5 A;  3NBH B;  1NE3 A;  4RAU C;  1Y8O B;  1QB5 D;  3J81 i;  4HCS A;  1PZK D;  2V4D A;  1QUQ A;  1EYA A;  4C3J H;  2Z9H A;  1EOV A;  4JI1 L;  4A3J B;  3GTG H;  4DUZ Q;  2HT1 A;  3DM3 A;  3EN2 A;  4QMG A;  2AKW B;  2KHS A;  4ME5 A;  1RHP A;  4HSV A;  1CZW A;  1EYD A;  3J7A V;  2B2U A;  1LO5 D;  2M2L A;  3OW2 A;  4H0L C;  3T1Y L;  1YNN D;  4V19 0;  1HA5 A;  1I4H A;  1YNX A;  5ELE A;  2IW3 A;  3R2I A;  3J80 i;  2E76 C;  4UY8 C;  4CJ1 B;  1I4P A;  3DMU A;  3P75 A;  1LTG D;  2FMC A;  4HMJ A;  4K8J A;  2IY5 B;  3CRL C;  3CW2 C;  3J81 L;  2FJ2 A;  1GD7 A;  2PZT A;  1Q1B A;  4NW2 A;  1KXL A;  1SRO A;  3S1N H;  1CUK A;  1QVF A;  1VQP A;  3G7L A;  3U9O A;  3T53 B;  2JK8 A;  2Q8R E;  2NZ1 D;  1SAP A;  3PQI A;  3HOY G;  1CKN A;  5LL6 S;  3X3N A;  4GN5 A;  1Q1E A;  1D5M C;  1IL2 A;  5K36 G;  1HUM A;  4LWC A;  3SXH A;  3TN2 A;  3STB C;  2OF1 A;  5KGU A;  1J5E L;  3F2U A;  4RHR A;  3I4M H;  5GQO A;  3GTO H;  5CR3 A;  2Q2H A;  2A19 A;  1VQH A;  2NTS A;  4QGU A;  2VUM H;  1ONL A;  2FMM A;  2WB1 G;  1STA A;  4GNX A;  1K0S A;  1JCK B;  5EJW A;  4WJW A;  1ASY A;  2BE5 C;  4CGY B;  2ZTE A;  2VB2 X;  2ICI A;  3V05 A;  1SMY C;  3K59 A;  1F77 A;  1XTD A;  3M4O H;  1QVG A;  2F0U A;  3I91 A;  1K28 A;  2O2L D;  5CGK A;  4R4I A;  4ZUJ A;  4LFA L;  1S5B D;  1PH6 A;  4JI6 L;  1O7Y A;  3Q6S A;  5BN4 A; 
#chains in the Genus database with same CATH homology
 5IYC G;  3I4N H;  2OQ0 A;  2B63 G;  1K83 H;  2ZJQ A;  3I4N G;  1YVC A;  2EIF A;  3AEV A;  4JI7 Q;  1TWF H;  2OTL A;  2Y0S G;  2B29 A;  2JE6 I;  4EX5 A;  3F2B A;  3CCJ A;  5E7N A;  1HNX Q;  3RR5 A;  4BY1 H;  4O2D A;  4DR2 L;  4JYA Q;  2ZTD A;  2Y0S E;  4A3M H;  4AQY L;  1OXS C;  2LXK A;  4LF9 Q;  3CC7 A;  2UUB Q;  1KQS A;  3D0F A;  4B3S Q;  2HIX A;  4DR7 L;  3RZO H;  1MIU A;  4LFA Q;  2JA8 H;  4OO1 G;  1HNW Q;  5FLM H;  4JI6 Q;  1CSP A;  4DV4 L;  3D31 A;  3G71 A;  3M9B A;  4YWM A;  4DK6 C;  3K0X A;  2VL6 A;  1ASZ A;  3HOU H;  1L1O A;  1UE6 A;  2N8N A;  4JI5 L;  3GTM H;  3M85 A;  3HOY H;  4A93 H;  1HZB A;  2MO0 A;  2JA6 G;  2E8G A;  3HOX G;  4DNI A;  2K14 A;  3HKS A;  3CCM A;  1VQA A;  3S1R H;  1V9P A;  3GTJ H;  4DV1 Q;  1AH9 A;  1FGU A;  3ULJ A;  4MZ9 A;  1A8V A;  1W2B A;  4WJ3 M;  4DR1 Q;  1E7Z A;  3FKI G;  2Z0S A;  1PVO A;  2JJQ A;  4DV4 Q;  1Q86 C;  2BA0 A;  1X3G A;  3H3V I;  2CQO A;  5C44 H;  5BR8 L;  1M90 C;  3S16 H;  4NXN L;  4LF4 L;  2VY3 A;  2NZH A;  1VQF A;  4R4T A;  2K75 A;  1Q81 C;  3UDI A;  2VZA A;  1HZA A;  3E0E A;  1VQE A;  3T1H Q;  1R9T H;  4YWK A;  4LF5 Q;  4LF8 L;  2VNU D;  5C4X H;  3ERS X;  3W5O A;  3KFU A;  3J7Z C;  1IZ6 A;  3S24 A;  1EWI A;  4WJ4 A;  4L5R C;  3EBE A;  4DAM A;  1TWA H;  2JA8 G;  4QJF A;  5JJL A;  3GD7 A;  3HOZ G;  3GTK H;  4X64 Q;  2CWP A;  1BKB A;  4C3H H;  2AWO A;  1IBM Q;  1N33 Q;  2K5H A;  4BA2 I;  1PH8 A;  2JA5 H;  1JE5 A;  4DV2 Q;  1X3F A;  2IHF A;  2E2H H;  1QZH A;  4KHP Q;  1BVS A;  1N8R C;  1C0A A;  2GN5 A;  4OWX B;  3RLF A;  4K0K Q;  4LF8 Q;  4B3R L;  4OXP A;  3S1M H;  2H5X A;  1I6H H;  4OO1 I;  2A1A A;  1E1T A;  2NVY H;  2B63 H;  1XNQ Q;  1KRT A;  4A3L G;  1L1O C;  4ME3 A;  2GVB A;  1YIJ A;  1PH4 A;  3PF4 A;  4Y52 H;  3PSI A;  4HIM A;  1VQ8 A;  3TRZ A;  2VQE L;  4DV0 Q;  1NMG A;  3GDE A;  1YEZ A;  4RMF A;  4IOC A;  2E2I H;  4JI0 Q;  1WYD A;  1JT8 A;  1I50 H;  4QL5 A;  4NXM L;  1OXT A;  1PHJ A;  4L5S A;  3S17 H;  3G48 A;  3I7F A;  2HHH L;  1XMQ Q;  4LFB Q;  5HGQ A;  4B3R Q;  4GKJ L;  2IHE A;  3KDF A;  3KF6 B;  4GOP A;  4UP9 A;  1PH3 A;  5C4X G;  3J81 c;  1IXR A;  1GVP A;  2D62 A;  2IT1 A;  1K9M C;  2NN6 I;  4JG2 A;  1SR3 A;  3RLN A;  4A3J G;  1HR0 L;  5LMU L;  1B8A A;  1QZG A;  5GAG C;  1WOC A;  3BJU A;  5EAY A;  2UUA L;  4OX9 L;  3AFP A;  2F4V L;  5M5Y H;  2WP8 J;  3AQQ A;  4AYB E;  5IYB G;  3HOZ H;  2OTJ A;  4A3F G;  5M3M G;  3TS0 A;  1PH5 A;  2RCN A;  3FKI H;  2AMC B;  1EUJ A;  1KL9 A;  5FJ8 H;  4YY3 L;  3UE1 A;  5C0X G;  5FJ8 G;  2HHH Q;  2I0Q A;  2NVT H;  4LFB L;  1XPO A;  3TQY A;  1WCM H;  1X54 A;  5IWA Q;  5IT9 c;  2Q2T A;  4UP8 A;  1SFO H;  2N49 A;  3I4O A;  1VQL A;  4TQU S;  1EFW A;  4B3S L;  4OX9 Q;  1IBL Q;  1HNW L;  3M4Q A;  4BY1 G;  1Z9F A;  1S72 A;  4BY7 H;  1GKH A;  5IYD G;  5LMN Q;  4H02 A;  5IYD H;  4JI4 Q;  1JJC B;  4DR5 L;  4DR3 Q;  3I4M G;  1X65 A;  1VQJ A;  2CKZ B;  5IWA L;  4P72 A;  5JJK A;  5FLM G;  3EIV A;  3W1G A;  2CFM A;  4YHH L;  3T1Y Q;  1YJN A;  1IBK Q;  1A0I A;  3K8A A;  4LF7 Q;  3AFQ A;  3RNU A;  3S2H H;  3LGJ A;  1I5F A;  2AWN A;  2C35 B;  2I5H A;  3PV0 A;  3L2P A;  1VQD A;  3H3V H;  2HQL A;  3OTO L;  1IBL L;  2V1C C;  5C4J H;  3H15 A;  1X55 A;  3A5U A;  3PO3 H;  5LMN L;  3HOW G;  4AH6 A;  1Y1W H;  1YHQ A;  4IPC A;  4PZ6 A;  1YI2 A;  4LF4 Q;  1HZC A;  2N78 A;  1QUQ B;  1Y14 B;  3F1Z A;  1H95 A;  1PH1 A;  2N3S A;  4TVA B;  4LNQ A;  4XTC S;  5IP7 G;  3HFZ B;  3PUZ A;  4A3D G;  4IPG A;  1S40 A;  3OTO Q;  1VQ7 A;  3DLL A;  1KHI A;  1OXX K;  4HJA A;  5BR8 Q;  1OXV A;  4BXX H;  1HZ9 A;  3L7Z C;  3CQZ H;  2UXC Q;  4DV3 Q;  5M5X H;  3CAM A;  1CKM A;  3KLW A;  4PZ7 A;  3JAM c;  1N33 L;  4O0A A;  1CSQ A;  1N32 L;  4XIG S;  4GNX B;  3I56 A;  4X62 L;  4DV6 L;  1MJE A;  4HJ7 A;  3F8T A;  1I3Q H;  1G29 1;  2CWA A;  4POF A;  2NVX H;  4LFC Q;  1PA6 A;  1N34 Q;  1EQQ A;  1N36 L;  1GO3 E;  1YHA A;  5IYC H;  4DUY L;  4UP7 A;  2QA4 A;  2WB1 E;  4BBS H;  1VCI A;  1P8L A;  5JEA G;  5C0X I;  4BA1 I;  4DPG A;  4X66 L;  3M7N A;  4NB3 A;  4KHZ A;  4APV A;  2CCZ A;  4A75 A;  1I94 Q;  2JEA I;  2Q2U A;  4LUO A;  3S15 H;  1G6P A;  4JBJ A;  1PH7 A;  3PUX A;  3I55 A;  3CD6 A;  4B3T L;  1GM5 A;  4NXM Q;  1YJW A;  1LUZ A;  1VQK A;  3U50 C;  1VQ5 A;  2R7D A;  4AIM A;  1FL0 A;  4OWW B;  4GKK Q;  2NN6 G;  1TXY A;  4BY7 G;  1B7Y B;  2L15 A;  1N36 Q;  1XNQ L;  2R7Z H;  1SN8 A;  4A3D H;  1NY4 A;  3MEF A;  4IJH A;  3ICE A;  4QY7 A;  4GNX C;  4HJ9 A;  2I5M X;  1XMO L;  4R4Q A;  3HOX H;  4DR4 L;  3A0J A;  2F4V Q;  1LTL A;  4LUZ A;  2JA7 H;  3CF5 A;  2K4K A;  4C2M H;  3K81 C;  3A5Z B;  1L1O B;  4GOP C;  3S2D H;  1A62 A;  3ULL A;  1UEB A;  1JMC A;  3PGZ A;  4Y7N H;  1G51 A;  4GLV B;  4GKK L;  2IX0 A;  4DV7 L;  4HID A;  3HOW H;  2ES2 A;  5IYB H;  1N9W A;  4IOA A;  4A3F H;  1SLJ A;  2YYZ A;  1Y1V H;  3BZC A;  5C3E G;  1CKO A;  2PI2 A;  4DR7 Q;  1UWV A;  4IFD I;  3CPF A;  1WFQ A;  3CCE A;  5M5W H;  3GTP H;  4EQ5 A;  3PUW A;  4A3E G;  1EIY B;  2KCM A;  2FXQ A;  3RLO A;  2UUC Q;  1YJ9 A;  2BH2 A;  4A3K H;  1L2F A;  2A8V A;  1K3R A;  3H0G G;  1IBK L;  2WFW A;  4RG1 A;  5M3M H;  1X3E A;  4P74 A;  2K50 A;  3CCV A;  3PUY A;  2JA5 G;  5M3F G;  3IRB A;  3J81 j;  1DGS A;  4OON A;  4IO9 A;  4JV5 L;  1NMF A;  4JI2 L;  1XJV A;  4ALP A;  4X65 L;  2XGT A;  1KD1 C;  2KBN A;  4J15 A;  3F2D A;  4JI4 L;  4DUZ L;  2E5L Q;  2MQH A;  1VQO A;  3F2C A;  3UDF A;  4YCV A;  2UUC L;  2D0O A;  4DR5 Q;  4NPS A;  2I5L X;  1P16 A;  3RZD H;  3G4S A;  3T1H L;  1SRU A;  4AQY Q;  2K5V A;  3UDG A;  2ZM6 Q;  1Y1W G;  2KHJ A;  1VQC A;  4MTN A;  3PIO A;  5IE8 A;  4BBR H;  1VQB A;  1EIF A;  1OTC A;  4LF9 L;  4A3G H;  1J6Q A;  3PUV A;  3AYH B;  3K80 C;  4JOI C;  3CCS A;  1SE8 A;  1YIT A;  3STB D;  2E2J H;  4DV5 Q;  4DR6 Q;  4X64 L;  4A3E H;  4GN4 B;  1YZ6 A;  4P73 A;  3GO5 A;  5GRO A;  5IP7 H;  3BU2 A;  1TWC H;  1M1K C;  2K5N A;  3K7A H;  3KF8 B;  4GLX A;  3S14 H;  3GTL H;  1Q12 A;  4UPA A;  1PFS A;  5IY0 A;  4JBK A;  3JC6 6;  3H0G H;  4DV6 Q;  4BXX G;  2PQA A;  1S3O A;  5C0X J;  3UDX A;  1PH2 A;  4IPD A;  2ZJR A;  2JA9 A;  2PNH A;  4AYB G;  1VQ4 A;  1C7Y A;  4JC0 A;  3KJP A;  4PMW A;  3I2Z A;  4NXN Q;  3U58 A;  4DV3 L;  1Q7Y C;  3J7A 5;  4OWT B;  5JJI A;  3HOV G;  2BA1 A;  3J80 c;  5C3E H;  1Q82 C;  4PZ8 A;  3HKZ G;  1JJ2 A;  4IJL A;  1WJJ A;  1D8L A;  2RHQ B;  4POG A;  1J5E Q;  1K0R A;  2QGQ A;  4X62 Q;  1XMQ L;  4LF5 L;  4X6A H;  2DGY A;  4LFC L;  4JBM A;  1N34 L;  5GAE C;  2YTY A;  4A3I G;  3HOU G;  1K8A C;  4DUY Q;  1KIX A;  3FP9 A;  2ATW A;  3E9H A;  2ZTC A;  1HR0 Q;  2F52 A;  2ID0 A;  4IPH A;  1E24 A;  3G6E A;  1SMX A;  2VQF Q;  3S1Q H;  1Q8K A;  4IFD J;  4HIO A;  4A4I A;  4A3C G;  3M4P A;  4DR4 Q;  4A3C H;  4DV2 L;  1OXU A;  2KCT A;  2GVA A;  1E3P A;  1L0W A;  1NTG A;  4KHP L;  3PCO B;  2MNA A;  1VQ9 A;  4A3B H;  4BBS G;  2YU9 H;  2R92 H;  4JI3 Q;  1VQI A;  4K0K L;  1LM0 A;  3B6Y A;  3CMA A;  2UXD Q;  5AJ3 Q;  4JI8 L;  3PO3 G;  2PI2 E;  4DV7 Q;  1NBW A;  1AE2 A;  3NEM A;  3CCU A;  2YV5 A;  4QIW E;  3TEH B;  4LW1 A;  2PQA B;  1HJP A;  4YCU A;  1E1O A;  1UE1 A;  1KC8 C;  3HKZ E;  1KRS A;  2R6G A;  1V43 A;  1RIP A;  4DAY B;  5ELN A;  3RN2 A;  1JJG A;  2B3G A;  2YTV A;  5IP9 G;  1LYL A;  2HIV A;  1VQN A;  3NEN A;  5IP9 H;  5GAD C;  2UU9 Q;  3CCL A;  5C44 G;  1JB7 A;  1C9O A;  1TWH H;  5DLQ E;  2OCE A;  3CME A;  3SGI A;  4PG3 A;  5JEA J;  3ER0 A;  4JI3 L;  4JI7 L;  2NZO A;  1PYB A;  1NJI C;  1W3S A;  4JI8 Q;  2RF4 A;  4LF7 L;  2UXB L;  3MXN B;  2EXD A;  3KF6 A;  4GOP B;  2IX1 A;  1O7I A;  2JA7 G;  3PO2 G;  3PF5 A;  1V1Q A;  5LMN W;  5LMU Q;  4P75 A;  3OYY A;  1BBW A;  2ALY B;  2JA6 H;  4A76 A;  4JV5 Q;  4JI2 Q;  1X6O A;  3FHW A;  1X9N A;  2UU9 L;  3WWV A;  1A63 A;  4X65 Q;  2R93 H;  4A3M G;  2R93 G;  3U4Z A;  3M3Y H;  1E22 A;  4A3L H;  1U5K A;  3JAM i;  1PH9 A;  3L0O A;  4JI5 Q;  3CC2 A;  2F3I A;  1FVI A;  4YWL A;  3RN5 A;  2R92 G;  3NBH B;  3U4V A;  1NE3 A;  3KYH C;  1IYJ B;  4DR2 Q;  4JYA L;  2UXB Q;  3PIP A;  1K73 C;  2ASB A;  1VQG A;  2PMZ E;  3J81 i;  5FLX c;  2R7Z G;  2ZM6 L;  2UUB L;  3HOV H;  4A93 G;  1MJC A;  1QUQ A;  1CKN B;  3W1B A;  2RHS B;  4C3J H;  4DR1 L;  1EOV A;  4JI1 L;  1XNR Q;  2NVQ H;  3GTG H;  4DUZ Q;  2E5L L;  4A3I H;  2HT1 A;  3DM3 A;  1K8G A;  4LF6 Q;  3EN2 A;  2EQS A;  2AKW B;  5M3F H;  2QEX A;  4DR3 L;  3CC4 A;  1QVC A;  3OW2 A;  2JQO A;  1N32 Q;  1X56 A;  4YHH Q;  1T9H A;  2R7F A;  3T1Y L;  4QQB X;  4DV1 L;  2KHI A;  2VW9 A;  1YNX A;  3CPW A;  3J80 i;  1UE7 A;  1XPU A;  4UY8 C;  5GAH C;  1Q46 A;  2WAQ E;  2Z6K C;  3VDY A;  4JI1 Q;  1WCM G;  3KJO A;  3BZK A;  3CXC A;  4DV5 L;  1XNR L;  4DR6 L;  2ZJP A;  1EYG A;  4X66 Q;  1U0L A;  1XPR A;  1EQR A;  1HR0 W;  4LF6 L;  2IY5 B;  1I94 L;  3CW2 C;  2OWO A;  5HY6 A;  1GD7 A;  1Q1B A;  1Y1V G;  1AE3 A;  4B3T Q;  4A3K G;  1KXL A;  1SRO A;  3KDF B;  4P71 A;  2BH8 A;  4GN3 B;  2LXJ A;  1WI5 A;  3S1N H;  1CUK A;  1QVF A;  3Q8D A;  2MO1 A;  1Z47 A;  4MNO A;  4GLA C;  1VQP A;  1YHB A;  2Z6K A;  2LSS A;  4B3M L;  2JK8 A;  4HJ8 A;  3HOY G;  4IFD G;  1CKN A;  3NEL A;  4GN5 A;  4JCV E;  1Q1E A;  1IBM L;  2VQF L;  1IL2 A;  5K36 G;  2D0P A;  1B70 B;  2UXC L;  4GS3 A;  1MKH A;  4LWC A;  5J3B A;  3PO2 H;  3STB C;  1VQM A;  4A3J H;  3CP0 A;  2VS1 A;  1J5E L;  2XTI A;  1VS0 A;  3I4M H;  1HNZ L;  5GQO A;  2YTX A;  1TWG H;  3KOJ A;  1FJG Q;  4GKJ Q;  3ULP A;  4R4C A;  4B3M Q;  3E9I A;  1VQ6 A;  3GTO H;  2WAQ G;  4BBR G;  2KEN A;  2Q2H A;  4A3G G;  2A19 A;  4YCW A;  1VQH A;  4QGU A;  2VUM G;  2DUD A;  2VQE Q;  4DV0 L;  2VUM H;  4KLK A;  5ELO A;  3UE0 A;  3K7U C;  2WB1 G;  1HH2 P;  4GNX A;  4JI0 L;  4L5T A;  1RL2 A;  4JBW A;  1KAW A;  2Q2I A;  1ASY A;  4R1J A;  3CCR A;  2AHO B;  3ZJY C;  2ZTE A;  1HNZ Q;  3CCQ A;  1BBU A;  4YY3 Q;  2UXD L;  3TRE A;  5AJ3 L;  1HNX L;  2JEB I;  1FJG L;  5H1S E;  3TS2 A;  4DKA C;  1XTD A;  2K52 A;  4FDB A;  4HJ5 A;  3GTQ H;  4HIK A;  3A74 A;  3M4O H;  1QVG A;  1D7Q A;  1UE5 A;  4R4O A;  1PYS B;  4KI0 A;  1YBY A;  2OQK A;  4JOI A;  4LUV A;  4R4I A;  1XMO Q;  2MFI A;  1PH6 A;  2UUA Q;  4JI6 L;  4LFA L;  4A3B G;  4C3I H;  1PV4 A;  4L5Q A;  4DK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...