4OWXB

Structural basis of soss1 in complex with a 12nt ssdna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
TFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*TP*TP*TP*TP*TP*TP*TP*TP*T)-3')
publication title Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 27
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4owxB00
3W5OA 5FJ8G 2E2JH 3CC4A 3TREA 1VQMA 3GO5A 4KI0A 3RN5A 1KC8C 1N36L 4WJ4A 2JA6G 1CUKA 2B3GA 3J81c 2KHIA 1N34Q 1MKHA 4JI1L 2WP8J 5IY0A 4JI4L 4B3TQ 4UP9A 5IYCG 4DV0Q 3PO2H 3HOXG 4L5QA 1WYDA 1QUQB 2VQFL 4DV3Q 3RLOA 1LUZA 3RZOH 5JJLA 3F2BA 3LGJA 1HH2P 2HT1A 3U4ZA 2WB1G 3AQQA 1VCIA 4OWTB 5C0XI 3RN2A 2CCZA 2UUCL 2MO1A 4DV6L 4R4QA 4GNXB 4GLXA 3HOZH 5IP7G 2C35B 1IBKQ 2E5LQ 2RF4A 1GO3E 1DGSA 2VUMG 3GTMH 1KRTA 3S16H 1MJEA 3Q8DA 1K9MC 4QQBX 4LFCQ 3G6EA 3A0JA 4AYBG 1WFQA 3TQYA 2AMCB 5AJ3L 3G71A 1WCMH 3J7ZC 2E2IH 2PI2E 5FJ8H 2Z6KC 1PH5A 2R92G 3UDGA 1FGUA 2ZJRA 4NXML 2JA6H 1VQGA 1Q46A 5JEAG 4GOPC 2F3IA 1PFSA 4DV6Q 2PMZE 5IYCH 1KL9A 3HOXH 2FXQA 3G4SA 2NZOA 4JG2A 1XNRL 1KHIA 3GTPH 3U4VA 3I4MG 1NJIC 1FJGQ 2D62A 3OW2A 3CD6A 4DR7L 4B3RL 3J80c 1EYGA 4YCVA 2ZM6L 2JA9A 5C44G 1W3SA 3S2HH 3CPWA 2IX1A 2K50A 4OWXB 2Z6KA 4AIMA 4LF8Q 3KDFA 4JV5Q 5M3MG 4A3DG 1EQRA 5IP7H 2IHFA 3JAMi 1VQ5A 1JJCB 4GOPA 4DAYB 4IPGA 3DLLA 1M90C 2VUMH 1JJGA 1WJJA 1HZAA 1VQHA 5ELOA 4DV4Q 1VQLA 4POFA 5GQOA 2NN6I 1V43A 1Q81C 1XNRQ 1Q86C 4PZ8A 4OXPA 2R7FA 1XMOL 2JQOA 2KHJA 1S40A 1LTLA 4B3RQ 2R92H 1AE3A 1CSQA 3AEVA 1NMFA 3I56A 3HKZG 1NBWA 1KRSA 3FKIG 3CPFA 2F52A 3KF8B 4DUZL 3PCOB 4HJ5A 1AE2A 4POGA 3PUWA 1VQ7A 2UXCL 1FL0A 3CMAA 5GAHC 3PUXA 2K5VA 3MXNB 3CCVA 1PH2A 1K8AC 3I4MH 1KXLA 1L2FA 1VQFA 2R6GA 3HOWG 4DV2L 4JI5L 3EIVA 3K0XA 1PH1A 4HIMA 5C44H 4IOAA 1XMOQ 4DV1Q 3W1GA 1B70B 3UDIA 3RR5A 1X6OA 5M3MH 3KF6A 1QVCA 4A3DH 4JYAL 2IY5B 2GVAA 4IFDG 5IP9G 4A3GG 4A93G 4Y7NH 2A8VA 2UXDL 5GADC 2VQEL 1Y1WG 3M9BA 4BA2I 5IE8A 5GROA 4C3IH 3AYHB 1CKNA 5GAGC 5JEAJ 3PF5A 1A0IA 1IBLL 3TS2A 5IWAL 1K83H 1OXXK 4DV2Q 4JI5Q 4O0AA 1I50H 3GTGH 2IT1A 1CSPA 3OYYA 1TWAH 3FKIH 3JC66 4RMFA 4X6AH 3A5UA 3KLWA 4LF5Q 3KOJA 1NMGA 3OTOL 2PQAB 1VQIA 4P74A 1PH4A 4IOCA 4A3KG 3PF4A 2YTYA 1ASYA 3HOWH 2UXDQ 4JI6L 1WI5A 2K14A 3ER0A 3U58A 4YY3L 4UP8A 5DLQE 5IWAQ 2K52A 5IYDG 2HHHL 1W2BA 1X3FA 3M4PA 2KCTA 4GKKQ 3PUVA 4GN3B 4A3EG 3BZKA 5IP9H 1VQPA 2RHSB 4X64Q 1J5EQ 4A93H 4A3GH 4DK3C 2OTLA 2I5HA 3H0GG 1M1KC 1T9HA 3M7NA 4BY1G 4UY8C 2LSSA 2WAQE 1Y1WH 1VQ6A 1Q82C 4P75A 3PO3G 4JI2Q 4HJ7A 4LFBL 1HNWQ 1N9WA 1CKNB 1EIYB 5C0XG 4JI7L 4KHPQ 4B3SL 3S1MH 2Q2HA 3H15A 3D31A 4JC0A 2I5LX 4BA1I 3CC2A 4YY3Q 4YCWA 1A8VA 4R4IA 4ALPA 1IBML 2Q2IA 4LF7Q 2HHHQ 1VQ9A 2ASBA 5C4XG 4APVA 2AKWB 4TQUS 3I55A 4QY7A 1UWVA 4DAMA 2I5MX 4A3KH 1PYBA 4HJ8A 1QZGA 4P72A 4IFDJ 4LFBQ 1RL2A 2LXKA 4JI7Q 2LXJA 1IL2A 1TWFH 1TXYA 3BU2A 4B3SQ 2R7DA 4XTCS 5IYDH 4BXXG 3F2CA 4A3EH 2YTXA 4A3JG 3ERSX 4HJ9A 1QVFA 2R93G 1RIPA 3H0GH 1IBMQ 3BJUA 1YI2A 1N36Q 4BY1H 3MEFA 1PH6A 4GKJL 2KENA 4JI1Q 2MNAA 3PO3H 4JI4Q 4C2MH 4QL5A 4DR6L 1BBWA 1GKHA 2VQFQ 4DR2L 1UE6A 1XPUA 2NVTH 1Z47A 2XTIA 2HIXA 3T1HL 1O7IA 4LW1A 4R1JA 1Y14B 3L0OA 5C4XH 5M5WH 2YU9H 4JI0L 4JBKA 3HOVG 2NN6G 3GTKH 1OXUA 1BVSA 1KD1C 2UUCQ 1YNXA 1VQAA 1HNXL 1Y1VG 4GKJQ 2EIFA 4A3LG 2RCNA 3RLFA 1JMCA 1XMQL 1HR0L 3CCLA 1Q8KA 4DR6Q 1SFOH 4UP7A 3ICEA 3I4NG 5AJ3Q 2AWOA 3HOUG 3CQZH 4BXXH 2VNUD 1SROA 3STBD 4DR3L 2BH8A 3PGZA 4QJFA 3S24A 1S3OA 1I3QH 5C0XJ 3RNUA 3T1HQ 4A3JH 1YHQA 1N8RC 2UUAL 4LF4L 2R93H 4P73A 4NXMQ 4LF9L 4JI0Q 4B3ML 3I7FA 1HNZL 3K80C 1KIXA 4A3CG 4DV5L 3NENA 1CKMA 3E9IA 1G6PA 2ZTDA 1V1QA 1L1OC 3M4QA 4PMWA 4LF6L 2RHQB 3EN2A 4QIWE 4R4CA 1TWHH 4LUZA 4YWLA 3UDFA 1XMQQ 4DR7Q 4IPCA 3J81i 5LMNW 3SGIA 2ZM6Q 1C7YA 1SRUA 5LMUL 1X56A 1PH8A 3HOVH 3U50C 4DR3Q 1N33L 3S1QH 3AFQA 4PZ7A 2Y0SE 1VQKA 1Y1VH 3H3VI 3NELA 4LF9Q 2MFIA 2NZHA 4A3FG 1R9TH 1XPRA 1HNZQ 4OONA 4A3LH 1E22A 2JK8A 4X66L 4NB3A 3TEHB 1L1OA 4A3BG 2OTJA 4JI3L 2GVBA 4L5RC 1UE5A 1PYSB 3I4NH 4KHZA 4LF6Q 1Q1EA 3HOUH 4GS3A 3S2DH 1P16A 5BR8L 5C4JH 1YJWA 1VQCA 4DNIA 3GTLH 2L15A 2MO0A 3S1RH 3KDFB 1XJVA 2K75A 5LMUQ 2BA1A 2VY3A 5C3EG 4NXNL 4DUYL 1FVIA 4DUZQ 4GOPB 3ULPA 3CCJA 4A3CH 2OQKA 4JI8L 2UXCQ 5HGQA 4HIKA 4HIDA 2MQHA 4NPSA 5LMNL 1L0WA 1PH9A 2VL6A 3L7ZC 1PH7A 2OWOA 4YCUA 1YJ9A 4L5SA 4JI3Q 4OX9L 1VS0A 2BA0A 3CW2C 5BR8Q 3CCRA 2NVXH 2N8NA 4JBWA 4A76A 4DR1L 4X65L 3F8TA 4JYAQ 1YBYA 4OO1G 2JE6I 4A3FH 1SR3A 4DUYQ 3J80i 2JA5G 1N32L 2KCMA 3M85A 4LNQA 4A3BH 1C0AA 2F4VL 1IXRA 4X62L 2VW9A 2VQEQ 1L1OB 5LMNQ 1G291 4GN5A 4DR5L 1S72A 2K4KA 1IBLQ 1D8LA 2E2HH 1KQSA 5M5YH 4IJLA 1AH9A 1NTGA 3KF6B 3UDXA 2YTVA 5C3EH 3CCQA 2AHOB 2UU9L 3S17H 1KAWA 1NE3A 4X65Q 1HZCA 4GNXC 3OTOQ 4DR1Q 3J81j 3S15H 3ULLA 1UE1A 3D0FA 3KJOA 5JJKA 1B7YB 1YZ6A 4C3JH 4HJAA 1NY4A 4X62Q 3ULJA 4MNOA 4JI6Q 4BY7G 1QUQA 4JBMA 4XIGS 2WAQG 1VQOA 2B29A 1CKOA 3W1BA 1SE8A 2I0QA 4DR4L 1Q12A 2EXDA 1PH3A 1PV4A 4IPDA 1VQDA 4LUVA 4WJ3M 2JA5H 3GTQH 2UU9Q 1YHBA 2K5NA 3KJPA 1HZBA 4DV0L 4GNXA 1Q1BA 2PI2A 4DV3L 1VQ4A 1MJCA 3CCSA 4GN4B 1EFWA 3KFUA 3JAMc 3GTJH 4OWWB 1U0LA 3UE0A 1HR0W 1LM0A 2N3SA 5FLMG 2YYZA 2VZAA 2XGTA 2D0PA 3HFZB 4RG1A 1U5KA 2IHEA 3K8AA 1E3PA 2HQLA 3BZCA 3UE1A 3PIPA 4P71A 1X3GA 3HKSA 1K0RA 1XPOA 2CQOA 2IX0A 4BBRG 3L2PA 4H02A 3FHWA 1JB7A 1IBKL 2E5LL 3TRZA 4L5TA 4BY7H 1WOCA 1YVCA 2WB1E 2ID0A 3B6YA 4LFCL 1J6QA 3CF5A 1QVGA 1I94L 3I2ZA 1X54A 2JEAI 1K73C 3GD7A 5EAYA 2Q2TA 1PVOA 1PA6A 1YJNA 4JOIC 1BBUA 2JA8G 1I6HH 3CCEA 5ELNA 3M4OH 3J7A5 4IJHA 3HOYG 1IYJB 4PZ6A 4AYBE 3FP9A 3DM3A 2NVYH 4TVAB 1VQBA 3AFPA 3F2DA 4DR2Q 1VQJA 1ASZA 1FJGL 4FDBA 1VQNA 5FLMH 3CAMA 4BBSG 5FLXc 4AQYL 1I94Q 2A1AA 2WFWA 4IO9A 2UUBL 1YITA 1K8GA 4EX5A 4LF8L 5IYBG 4JV5L 4R4TA 1TWCH 2OQ0A 3EBEA 4JOIA 4A4IA 4BBRH 3CXCA 1I5FA 2UXBL 2E8GA 4A75A 1HNXQ 1YEZA 2R7ZG 4DV4L 4R4OA 1HR0Q 3WWVA 5GAEC 3K7UC 4JBJA 4HIOA 4A3MG 2ZJPA 4YWMA 1YIJA 3CMEA 1QZHA 1D7QA 1E7ZA 2ES2A 3NEMA 1EQQA 3F1ZA 3K81C 4AQYQ 2JA8H 3TS0A 2UUBQ 4LF4Q 5J3BA 2UUAQ 1B8AA 1JJ2A 4B3MQ 3HOYH 3M3YH 2JEBI 1YHAA 3CCMA 4K0KL 2UXBQ 2VS1A 4DV5Q 4MZ9A 4C3HH 2ZJQA 4DPGA 2Q2UA 2Y0SG 2EQSA 2N78A 3E0EA 3HKZE 3H3VH 2NVQH 4BBSH 3VDYA 3K7AH 3STBC 2ZTEA 2ATWA 1C9OA 4QGUA 3PUYA 4DV1L 1X65A 3GTOH 1HZ9A 5IYBH 4DK6C 1X3EA 1N33Q 1OXVA 4PG3A 3G48A 3CCUA 3KYHC 4A3IG 1X9NA 1MIUA 2QGQA 2R7ZH 1SN8A 1XNQL 4EQ5A 2PQAA 4K0KQ 1XTDA 1UEBA 4X66Q 3S14H 1E1TA 4A3MH 1A63A 1IZ6A 2PNHA 5M3FG 1K3RA 2CWAA 3A5ZB 1EOVA 1OTCA 2JJQA 1Z9FA 2BH2A 4UPAA 1UE7A 3ZJYC 1PHJA 1HJPA 1OXTA 1P8LA 1VQEA 4LF5L 5K36G 1V9PA 2K5HA 4NXNQ 4JI8Q 4GLAC 2DGYA 2CKZB 3PSIA 4IPHA 2KBNA 4LUOA 2B63G 4MTNA 2DUDA 1XNQQ 3A74A 3S1NH 4YHHL 2JA7G 4JCVE 2QEXA 1GD7A 2OCEA 3GDEA 4OX9Q 4GKKL 2CWPA 4A3IH 2D0OA 4J15A 4X64L 1E24A 1J5EL 4DKAC 5H1SE 3E9HA 3RZDH 4LFAL 4Y52H 1EIFA 4DV7L 1EUJA 1GM5A 1N32Q 2V1CC 3NBHB 5E7NA 2Z0SA 5IT9c 4JI2L 2F4VQ 1HNWL 3RLNA 4KHPL 3PO2G 1OXSC 1LYLA 5M3FH 4O2DA 4IFDI 1JT8A 5HY6A 4DR5Q 3T1YL 4YHHQ 1TWGH 2H5XA 2HIVA 1H95A 1GVPA 4LWCA 2ALYB 3IRBA 4LF7L 2N49A 1JE5A 4KLKA 1N34L 2GN5A 4YWKA 2QA4A 1E1OA 2YV5A 4GLVB 1Q7YC 4B3TL 4LFAQ 2B63H 2ZTCA 4ME3A 1BKBA 4DV7Q 3HOZG 1A62A 3PIOA 2A19A 3PUZA 3PV0A 2JA7H 1X55A 1SLJA 3CP0A 2CFMA 5M5XH 1VQ8A 4AH6A 2AWNA 3T1YQ 3I4OA 4OO1I 5JJIA 1G51A 3CC7A 1WCMG 4DR4Q 1SMXA 1EWIA
chains in the Genus database with same CATH superfamily
2A69C 2E2JH 3CC4A 3TREA 4QMGA 1I3QB 1S5DD 1N36L 1CUKA 1MKHA 4JI4L 1I4HA 4B3TQ 4DV0Q 4FO2A 4L5QA 4DV3Q 3EVQA 2VQFL 3RLOA 1B53A 4OELB 3LWUA 5JJLA 4V190 1PRTC 2F0QA 1I4QA 2BOSA 1GHJA 1A3TA 5C0XI 2F0FA 5IGCA 3RN2A 2CCZA 3HOVB 3S1QB 4R4QA 4GLXA 4HCEA 2E5LQ 2RF4A 2MGSA 3HG9A 1CQFA 1DGSA 2VUMG 3MHBA 3HOYB 3VR3A 1MJEA 1GUNA 4LFCQ 1SNPA 1WFQA 1LTBD 2B2TC 2AMCB 1W6KA 2PI2E 1EU4A 4EVOA 3S2DB 2A6HD 1DJRD 3LX0A 2ZJRA 3S1RB 4NXML 3ND8A 1DZ1A 4GOPC 1H9SA 1PFSA 4K14A 5FK9C 1F2ZA 2PMZE 1KL9A 2KVMA 4RA8A 4RCOA 1EEID 4JG2A 1AP0A 1XNRL 1KHIA 4FNFA 3I4MG 4CKBA 2EVBA 1WVLA 4YCVA 2ZM6L 2JA9A 3EA6A 5C44G 4H44C 4JV5Q 4LF8Q 1DONA 3GV3A 4R8NA 2VUMH 1LTAD 2F0JA 4A3BB 1Q81C 1XNRQ 4OXPA 1XMOL 1DD2A 1S40A 4PNYA 2N88A 1AE3A 1FR3A 4KJNA 1NNXA 1WTPA 1SEBD 3S17B 2K5VA 3MXNB 3CCVA 3I4MH 1KXLA 1U4MA 1STGA 1OO9B 5C44H 4IOAA 2KECA 1XMOQ 3W1GA 3UDIA 2KEDA 2FINB 3KF6A 1QVCA 2BDOA 3QG1A 5IP9G 4RHRA 4A93G 1E2ZA 3ERQA 3DMUA 4CKCA 1Y8OB 4BA2I 3AYHB 3TS2A 1RCVD 4O0AA 4FYDA 2XNAC 5IGEA 1ICFB 2IT1A 5AFWA 4RMFA 1PTOH 1BCPC 3A5UA 1JWMD 4A3KG 2YTYA 4JI6L 2DNEA 3IKJA 3U58A 2ZXPA 1BF4A 1HUNA 4XT3B 5IYDG 3VYRA 3PUVA 3BZKA 5IP9H 1VQPA 1J5EQ 4A93H 1IYVA 2CHBD 1I6HB 2LSSA 2WAQE 3M4OB 3PO3G 4JI2Q 5EPLA 3D6WA 2KHSA 3BVMA 5C0XG 5IT9L 2EY1A 3VR2A 3S1MH 2EYHA 3V05A 2I5LX 3E3XA 1IBML 2F0PA 2ASBA 4XXEA 4TQUS 3I55A 4DAMA 2I5MX 1VF5C 4A3KH 5EJWA 1TVXA 4TKOB 1SYFA 1EQVA 4IFDJ 3JAME 3BDLA 3URYA 4KN4C 5BN4A 4U673 3I90A 1IL2A 1CHQD 1QWYA 5IYDH 1T5EA 5BN3A 1AZPA 1QVFA 1RIPA 3Q23A 3EFXD 1IBMQ 1PH6A 4DAVA 1BUVT 1V1PA 2KENA 3PO3H 1JWUD 1ONLA 3C2PA 5KYIA 5C0XH 2X69A 4DR6L 5EKIA 1GKHA 1RKNA 1UE6A 2NVTH 2K6AA 4OIJA 4MHEA 1RD9D 3T1HL 3GTOB 3GTKH 1J8IA 2F0HA 1VQAA 1HNXL 1ZEQX 3P75A 2R7ZB 3TZDA 4DR6Q 1SNQA 2EJGC 3I4NG 3NE5B 3HOUG 2BH8A 4ZRZA 3T1HQ 4OEMB 1YHQA 4LF4L 1D5XC 4G7HC 4B3ML 3I7FA 4IQZA 3K80C 1KIXA 3C1FA 1G6PA 3M4QA 2HDMA 2Y0SB 1DM0B 3D4DA 2MUYA 3EN2A 1TWHH 2F0TA 4R4CA 4YWLA 3U9SA 4KKTA 2O4XA 1C7YA 1SRUA 2XVSA 2K5QA 4FF1A 1H9SB 4PZ7A 1ENAA 1S4ZA 4A3IB 4A3FG 3D4RA 1EY4A 2OTJA 3I4NH 4EQPA 1LTSD 3HOUH 4GS3A 3GTLH 2MO0A 1TWGB 3AU7A 2H4OA 1AFPA 5C3EG 4NXNL 4DUZQ 1YNJC 3TP6A 3ULPA 1ILQA 3CCJA 1G2SA 5HGQA 4HIDA 4H13C 4XQQA 3GV6A 5LMNL 3DM1A 3NBHA 1PH7A 4X3UA 5EGTA 4L5SA 3BG3A 4OX9L 5M5XB 3CW2C 1DXMA 2JN4A 2QCPX 4DR1L 4JYAQ 4A3FH 1EZ8A 2WV6D 1LTGD 1IXRA 2VQEQ 3N52A 2QW7A 2NB0A 5IGDA 3NSWA 5C3WA 5LMNQ 4RGMA 3PO2B 1G291 2Q8RE 4GN5A 1S72A 1D8LA 3FPUB 3SK6A 1AH9A 3KF6B 3UDXA 5C3EH 2AHOB 2UU9L 2FMCA 3K0YA 2MJ8A 1NCVA 1NE3A 4DR1Q 4A3EB 3J81j 3NQIA 3I72A 3KJOA 4RAUC 1EOTA 4ZQ3A 1HFNA 2F0SA 3GTMB 2ICEC 1QUQA 2X6LA 4WORA 1TIID 2WAQG 4XIGS 4JBMA 1CKOA 1EZ6A 1CHPD 1WCMB 4R9WA 3K5LA 1SNMA 3OIPA 1PV4A 1LTRD 3MEHA 2JA6B 3GTQH 2UU9Q 1HZBA 1SMYC 4GNXA 1MGSA 1JOQA 3K58A 1KABA 3JAMc 4OWWB 1U0LA 3UE0A 5KRUA 3AMUA 2YYZA 4DA2A 2BCOA 2XGTA 2B2VA 2D0PA 2PZUA 3K6OA 3UE1A 3PIPA 3HP3A 2CQOA 3FHWA 1D5ZC 1SDFA 2WB1E 1QOHA 3I2ZA 4AYBB 1K73C 3DUZA 2VXWA 4FF3A 1GHKA 4BWGB 2B8FA 1PA6A 2CH4W 1B50A 2JA8G 2B2YC 1DOKA 3RUZA 3CCEA 1SXTA 1LT6D 4IJHA 2ZXRA 2F0DA 4DXGA 3FP9A 4HTHA 3T13A 3W2DA 2NWGA 3AFPA 4NP5A 1ASZA 1FJGL 2ICIA 1MSGA 3LWEA 1CZGA 2A1AA 2UUBL 2CVRA 2Z1CA 1MBYA 1YITA 2R3ZA 3FPPA 1JOKA 3EBEA 2Z6BA 5M3MB 2A74C 2F0UA 5CV6A 4PV1C 1I5FA 2K1BA 3VR4A 4DXFA 2M2LA 1TR5A 3BS1A 3K7UC 2A6HC 3CMEA 1D7QA 2VB2X 2JP1A 1K83B 3F1ZA 4XQNA 3K81C 2JA8H 3MZ5A 2UUBQ 3HKZB 3GTGB 2UUAQ 1JJ2A 1DCZA 3CCMA 1J9OA 1UNSA 3CRLC 5HURA 3MFYA 2EQSA 3E0EA 2EZVA 5CBAE 3STBC 3VR6A 1IL8A 3PUYA 1X65A 2TSSA 3A56A 4TRDA 4CDFC 4DK6C 1N33Q 1OXVA 3KBXA 1K28A 4FVMA 2QGQA 2RSNA 1SN8A 4EQ5A 4X66Q 5ISRA 3MAQA 1IZ6A 3D4WA 1K3RA 1G2TA 4DU9A 1PFNA 5I9OA 4LF5L 1LTID 1U4PA 2R61A 4JI8Q 4GLAC 2DGYA 2CKZB 3PSIA 4LUOA 5E3FA 1FNUA 2K03A 1K8MA 4YHHL 2OXPA 2L1BA 2JA7G 5CBEE 3A54A 1TWFB 3GDEA 1UUPA 1RHPA 1CA6A 2KOLA 4X64L 3EJIA 4Y52H 4DV7L 5CV9A 1GOZA 1N32Q 3FRPB 3NBHB 5E7NA 2Z0SA 2D5DA 4WJWA 4DK0A 4DGZA 4C2MB 5L37A 4O2DA 1JT8A 4YHHQ 3NTKA 3H3VC 1F9QA 5F2DA 2HIVA 1XTCD 2ALYB 3IRBA 1N34L 2RSOA 2YU9B 2GN5A 4YWKA 4G57A 4DV7Q 3FMCA 3PIOA 2HUGA 4KY7A 2L9HA 3PUZA 4RHSA 4J8QA 1A6XA 4RKLA 2JA7H 1UAPA 1VQ8A 2AWNA 3SE0A 1S5CD 3NQTA 3E6ZX 4A3JB 2B2UC 3J81c 1N34Q 2SNMA 2WP8J 3OWFA 2F0GA 4TSSA 1HRJA 4UP9A 3HOXG 3RZOH 1WYDA 1QUQB 3V2TA 3I91A 2XRSD 2IJ0A 4IURA 1F2MA 2WB1G 3KLSA 4OWTB 2MO1A 3OMGA 1DYQA 3NPPA 4GNXB 5A2QL 1GO3E 3KLSX 1KRTA 3Q8DA 4QQBX 3T16A 1CT1D 3G6EA 3A0JA 4B08A 5AJ3L 4HCSA 1WTWA 3MXGA 2Z6KC 2WKCA 1PH5A 5C4JB 5JEAG 2A73B 3HOXH 1IW7D 3M7GA 5D14A 2NZOA 4QCLA 1EYGA 1H9JA 1QCBD 4RH6A 1C4QA 1WTRA 2B2TA 3SHLA 5FO9B 1W3SA 1ILPA 1EYCA 1PTOF 1JQYD 3KDFA 4A3DG 5J22A 1TU2B 2IHFA 3C46A 3C1EA 4GOPA 3CKIB 1YNJD 3DLLA 1PFBA 1D6EC 1IKLA 1HZAA 1VQHA 5ELOA 2CW0D 2NN6I 4C3IG 4NW2A 3WOEA 1TY0A 2EY6A 2NZ1D 2E2HB 5FOBB 3AEVA 1NMFA 5M5YB 1NBWA 1KRSA 5JEAH 3FKIG 3CPFA 4YIJA 4POGA 3PUWA 1FL0A 2EOTA 5GAHC 4FF4A 3S15B 5A35A 3RZDB 1L2FA 1VQFA 2R6GA 4HIMA 4IUVA 1PZID 1RJTA 4ODGA 4RKBA 4A3DH 5BN5A 3X3NA 1I4RA 3X3MA 3R2TA 4Y7NH 2A8VA 1LV9A 2JA5B 3DHQA 1RODA 3ITPA 4C3IH 2EY5A 3PF5A 2EXZA 1A0IA 1IBLL 1HQMC 2PW5A 1I50H 4KD3A 3VYSA 1CSPA 3FKIH 4X6AH 1NAPA 3MXUA 3KLWA 1NMGA 5ELEA 4IOCA 2HD3A 4HMIA 1L0YB 4BY7B 3TSSA 4UP8A 4YY3L 1EY5A 3QIAA 3TMEA 2K52A 4K8JA 4GKKQ 1X3FA 2KCTA 3NK9A 4GN3B 1LTTD 1EY0A 3H0GG 1M1KC 1AN8A 1T9HA 4BY1G 4UY8C 4FF2A 4LFBL 1HNWQ 1N9WA 3H15A 1HTPA 5ELDA 2RKSA 3NTHA 4JC0A 4BA1I 3CC2A 4YY3Q 1A8VA 2X6GA 2AKWB 3SK5A 4QY7A 4ME5A 1UWVA 2QDLA 4HJ8A 2EYFA 4LFBQ 1RL2A 2LXKA 1G8ZD 1EY6A 1HA5A 5ELBA 1DOLA 3F2CA 2L0CA 2YTXA 4K5WA 2K28A 1F9RA 3ERSX 4HJ9A 3H0GH 1N36Q 4CHTB 4BY1H 3MEFA 4GKJL 1PTOC 5DM63 2MNAA 4JI4Q 3M3YB 4QL5A 5T1GA 3KK7A 4C3HB 2VQFQ 2VUMB 1Y8PB 2Z8LA 2XTIA 3D8GA 1EYAA 1O7IA 1B3AA 4I7ZC 1GUTA 1GUGA 4ZUJA 1Y14B 3HOVG 2NN6G 1OXUA 1GXDC 1FNWA 1TS2A 1Y1VG 1II3A 4GKJQ 2EIFA 2RCNA 3RLFA 1TS4A 1SFOH 4UP7A 3K5MA 1YNNC 3CQZH 3WDNA 2VNUD 3NBIA 3STBD 4DR3L 1I3QH 5C0XJ 2JXMB 5C5MA 2AUKA 4NXMQ 1HNZL 4DV5L 4LJZC 5I9PA 1V1QA 1L1OC 1GUWA 4PMWA 2KA7A 5G3LF 1PRTB 3S1NB 1G6ZA 3SGIA 2ZM6Q 5E1FA 1RF2D 4KKUA 1I4XA 1PH8A 3HOVH 2NN6H 3U50C 4DR3Q 3S1QH 2Y0SE 2QKIC 1Y1VH 4P2CB 4KMUC 3NELA 2NZHA 1HNZQ 3A8KE 1E22A 4A3BG 1IKMA 4L5RC 1Y69U 4KHZA 1Q1EA 1U9RA 3VA7A 3TN2A 3S2DH 1P16A 5BR8L 1YJWA 1VQCA 4DNIA 3S1RH 4OGQC 3KDFB 1XJVA 2RBMA 4K6DA 2VY3A 3AB9A 4GOPB 1FVIA 3A7AB 2OQKA 1TY2A 1TQOA 4HIKA 1E2VA 2MQHA 4UHVA 1L0WA 1PH9A 4CDCC 2VL6A 2B2WC 2OWOA 4YCUA 2HCIA 1ML0D 1TKWB 3EROA 2BA0A 1ESFA 5BR8Q 3CCRA 5IGGA 4X65L 1YBYA 4OO1G 4L6TB 2JE6I 3PIP3 3J80i 4A3BH 2F4VL 4X62L 1L1OB 2JYOA 1SE2A 3MVVA 4DR5L 3OWEB 1JC7A 1KQSA 1CK1A 1NTGA 3OHXC 1XYIA 1BBXC 2RQXA 2YTVA 2FHTA 5TSSA 2M00A 4KN7C 3S17H 4X65Q 1KDCA 3HOZB 1VF7A 2M9VA 1NY4A 4X62Q 3ULJA 4JI6Q 3MXPA 3P20A 3S16B 2B29A 3BDCA 3W1BA 2I0QA 1KNAA 2LMCB 1WTHA 4DR4L 3TDQA 1V1OA 5CC4A 2E2IB 1Q12A 4N9PA 4IPDA 4OO1H 4LUVA 3OOCA 3CCSA 1BDOA 3KFUA 5CV4A 2LFNA 4OIKA 3H94A 1X32A 1HR0W 2P5ZX 1FGBD 2N3SA 2N55A 3EQLC 5KGUA 4HN7A 5EQ0A 1BCPB 4ZYSA 1X3GA 1GJXA 4IUTA 1ENCA 1IBKL 4FP5D 4H02A 1JB7A 5K5PA 4L5TA 1XXGA 2QEJC 1KLUD 1WOCA 4WFN3 3BYYB 1J6QA 2HQEA 2JEAI 4ILWA 1SYCA 1X54A 3MFGA 3E5SA 1F2YA 5KNBA 3Q0AA 2R92B 3KBGA 1B3QA 1I6HH 3IFDA 3M4OH 2MP1A 1IYJB 4PZ6A 4AYBE 1EWCA 2OEOA 3F2DA 3DWAA 1QB5D 5J39A 1VQNA 1K8GA 1F2LA 2OQ0A 4A4IA 2B2YA 5JJZA 3KF8A 1SSOA 4A75A 1HNXQ 3ZYYX 5C4HA 5EBDA 2R7ZG 4DV4L 2E76C 4R4OA 4ZK9B 5C5LA 3WWVA 2FFKB 4IN3A 4JBJA 4KD4A 2ZJPA 4YWMA 4ZLTF 3J80L 3P7JA 5JAVA 1PZKD 4LF4Q 1TWAB 1IW7C 1H9KA 4B3MQ 2VS1A 2ZJQA 2K04A 2Y0SG 4RWSC 2N78A 3HKZE 3L3OC 4HSPA 1WD1A 2NVQH 3HOWB 1C9OA 1LT3D 4QGUA 4DV1L 3GTOH 2BDNA 1PDQA 2IWHA 3KYHC 4N9TA 4A3IG 1WTXA 1X9NA 4A3GB 2CW0C 2R7ZH 1XNQL 1XTDA 3PIO3 1Y1WB 1E1TA 1HHVA 5HGTA 1UE7A 3ZJYC 2IPKD 1OXTA 4F88A 1PHJA 1SYGA 2K5HA 4NXNQ 1O7LA 2IX3A 4IPHA 2KBNA 2B63G 4MTNA 1XNQQ 1QE6A 5KNCA 1GD7A 4OX9Q 1D2BA 4H0LC 5IIFA 4IUPA 5CMDA 4A3IH 4J15A 1E24A 1EIFA 4OL7A 2F0LA 2F0IA 5IODA 3PO2G 1OXSC 4KHPL 1B2TA 4E6IA 1TWGH 4XQJA 4LF7L 3HEJA 5M5WB 5C4XB 2RDFA 1E1OA 4GLVB 5J1ZA 2B63H 1RTNA 2ZTCA 5IGFA 4EQOA 1PTOD 1A62A 1KLGD 1X55A 3NWTA 1SLJA 3CP0A 2CFMA 5M5XH 3O13A 3CC7A 1WCMG 1SMXA 3J81E 3W5OA 1KC8C 3RN5A 2JA6G 2NBFA 2B3GA 1ZKOA 2KHIA 4CGYB 4JI1L 3H09A 5IY0A 5IYCG 3PO2H 4BS9A 4RGOS 5COYA 3LGJA 5KEEA 3U4ZA 3JAML 2EE1A 1YNND 3NUCA 3AQQA 1VCIA 4CKEA 2UUCL 5A2QE 4DV6L 2B2UA 1B4OA 5IP7G 3OW7A 1O7YA 3GTMH 1R9TB 1AW7A 1ZYRC 3TP5A 1Q3LA 4AYBG 3TQYA 3G71A 1WCMH 5CGKA 3H91A 3UDGA 2JA6H 2XIWA 1VQGA 1Q46A 4DV6Q 5IYCH 1A3UA 4K2LA 4EQNA 3GTPH 1NJIC 1FJGQ 3OW2A 4DR7L 4UDUC 1E2WA 1G91A 1E0BA 3MWYW 3S2HH 3CPWA 4RCNA 4AIMA 5CV8A 2Z6KA 4OWXB 5M3MG 1FNVA 2F0WA 2KCCA 3A8IE 4LMQD 5IP7H 2WINB 1VQ5A 3QWNA 1JJCB 4ABNA 4IPGA 1JJGA 2PNRC 5T1IA 3SK4A 4IUQA 1VQLA 1LLRD 1Q86C 1PYWD 2KHJA 1TT2A 3I56A 3HKZG 3KF8B 3PCOB 1AE2A 2RCFA 2UXCL 3OIQA 2O5IC 1PH2A 1PH1A 1EQTA 4CJ0B 1B70B 4NDXA 5M3MH 3N6RA 2UXDL 4MN3A 2KCNA 5GROA 5IE8A 3VR5A 4KKSA 5JEAJ 2RVLA 4PMCA 5IWAL 1K83H 4FXGC 3J7YW 1SE3A 3GTJB 3GTGH 4RGTA 1ET6A 4N8X1 3JC66 2F0KA 2Z4HA 4GZYC 4LF5Q 3OTOL 3QO2A 2WKDA 4P74A 2NVXB 1PH4A 5C6AA 3DXJC 2UXDQ 2Z4IA 4HSVA 2K14A 3ER0A 5IWAQ 1O80A 4KV6A 1PFMA 4DN4M 4I65A 4X64Q 1BQQT 1KDBA 2RDGA 4DK1A 2OTLA 2I5HA 4EGVA 3M7NA 1VQ6A 2G5DA 4HEDA 1V8QA 4P75A 1RDPD 1VDZA 4HJ7A 1EIYB 1CKNB 4JI7L 1S5FD 3K5NA 4B3SL 4X3SA 2Q2HA 1I4GA 4C1NK 5G3LD 2Q2IA 1VQ9A 3RD4A 4APVA 1TWCB 4BBRB 4P72A 3F2UA 1S5BD 2BE5D 2EY2A 4ULLA 4JI7Q 2LXJA 2SDFA 1TWFH 3BU2A 3OPOA 2F0MA 4CDDC 4B3SQ 5JPMC 2L55A 1DOMA 1C8CA 4A3JG 2CH4A 2F0OA 2R93G 1YI2A 3U9OA 1ZXTA 4C2MH 2K33A 1EL0A 4DR2L 1XPUA 4KY6A 3QOLA 1BXTA 4BBSB 3IFTA 3K7AB 2SOBA 1M8AA 1JR0D 1EIGA 4Q5VA 4R1JA 3L0OA 2YU9H 4JI0L 4JBKA 3J7AF 4N8FA 1B44D 1BVSA 1KD1C 1YNXA 4LAAA 2L11A 4A3LG 1JMCA 3CCLA 1XMQL 1HR0L 1Q8KA 2EJMA 3S14B 4A3MB 1AZQA 5AJ3Q 2AWOA 1IYUA 5FLXL 1SROA 3PGZA 5LHY1 4QJFA 3RNUA 4A3JH 1JB3A 2R93H 1N8RC 4QIWB 4P73A 1H9RA 1T5XD 3CU7A 4JI0Q 3K57A 4LF9L 4Q0FA 4A3CG 2IW3A 3D6CA 3V96A 4LF6L 3R8BA 2RHQB 3UDFA 1XMQQ 5LMNW 5DM73 5LMUL 3G7LA 1TS3A 3AFQA 3TZUA 4XT1B 1VQKA 3LNNA 4LF9Q 2MFIA 4A3LH 4NB3A 5D65A 1L1OA 3TEHB 4JI3L 2F4IA 4O42A 1UE5A 1PYSB 1MSHA 2K32A 4LF6Q 5M3FB 5DEHA 3L9AX 5C4JH 4DAPA 1IHZA 1GUSA 2A6EC 1BO0A 5LMUQ 2F1MA 4A3CH 4X3TA 4NPSA 4U68A 3L7ZC 1MHWC 4C3JG 4JI3Q 4S3SA 2LKVA 1VS0A 2F0EA 1LABA 5ELFA 4JBWA 1K3BC 3BYTB 2NTTA 2O2LD 2E2JB 2CQAA 1SR3A 2JA5G 2FMMA 4LNQA 1C0AA 5EKKA 2K4KA 1IBLQ 2E2HH 5M5YH 1LT4D 1SJHD 3UI2A 3CCQA 1Y8NB 1HZCA 1FYCA 2DY8A 5IT9E 3S15H 3D0FA 5JJKA 4IUUA 1B7YB 2TMPA 1YZ6A 2QILA 4C3JH 3NHHA 4HJAA 4BY7G 4MNOA 1L0XB 1VQOA 5LL6X 2LY7A 2DNCA 1PH3A 1VQDA 2PZTA 5I4DA 2JA5H 1YHBA 3KJPA 4DV0L 1Q1BA 2PI2A 4DV3L 2KJXA 3QB3A 4GN4B 1EFWA 4HR7B 4RFBA 1ZYRD 2K05A 1LM0A 1SFOB 3T4AC 3HFZB 1BCPF 4RG1A 1U5KA 2IHEA 3K8AA 3BZDB 1E3PA 4F7XA 2HQLA 3BZCA 4P71A 3HKSA 3TRZA 2IX0A 3I70A 3NP8A 3L2PA 2H1EA 2E5LL 4BY7H 4IZ8A 1YVCA 1I6VC 3B6YA 4LFCL 1RTOA 2D9UA 1I94L 1PVOA 4K5VA 1EIHA 5CR3A 5EAYA 3MTSA 1YJNA 1F9SA 4JOIC 5I6WA 1BBUA 5ELNA 4L63B 2NUCA 3HOYG 1SNCA 3DM3A 1Y1VB 2NVYH 4TVAB 1VQBA 4C3HG 4DAYA 2J0TD 4CDEC 5CV7A 3I4MB 1PZJD 4FDBA 3CAMA 2DJFC 1I94Q 2E2DC 1KAAA 4IO9A 5C44B 1X3PA 1MI2A 4JV5L 4LF8L 5IYBG 2E8GA 1R4PB 1YEZA 3J80E 4HIOA 2B8GA 2IL8A 1QZHA 1O78A 5KIXA 2PPBC 3NEMA 3I3CA 2O5JC 3TS0A 2K5DA 4HMJA 1SNOA 3M3YH 1PTOB 3HOYH 2JEBI 5EBCA 4DV5Q 2Z9HA 4MZ9A 4C3HH 4NKLA 3HS0C 4QUFA 1CQVA 3VDYA 2EYLA 2C5CA 2L4NA 3DEPA 3SK8A 5IYBH 3DWQA 1CTMA 3MA2B 2PCFB 3G48A 5E4XA 1EEFD 1MIUA 4A93B 2K5WA 2PQAA 1B9NA 1UEBA 1A63A 2CWAA 3S1MB 3A5ZB 4DFAA 1OTCA 5FO7B 4UPAA 5K36G 1V9PA 3A7LA 4DNRB 5I6YA 2EJFC 3IAYA 1ICWA 3NXWA 2DUDA 4A3KB 1EWHA 3SXHA 3A74A 3S1NH 5I2YA 1A3VA 2EDGA 4JCVE 1SYBA 2QEXA 5C4ZA 2OCEA 2CWPA 4J6HA 1B1ZA 2D0OA 3ND9A 1J5EL 3NTIA 3C3LA 3K59A 1EY8A 4JVZA 1A15A 1EUJA 5DAUA 1EY7A 1EYDA 5CV5A 2V1CC 5IT9c 4JI2L 1K0SA 2F4VQ 3PO3B 3RLNA 1HQRD 4B9WA 3FEWX 4IFDI 3TBIB 5HY6A 4DR5Q 3T1YL 2NVTB 1SJED 2D2CC 4M8AA 4LWCA 3CHBD 5K36H 2N49A 1JE5A 4KLKA 3SR1A 1LACA 2QA4A 1CA5A 3GTKB 2YV5A 2SEBD 4ME3A 5CORA 3HOZG 1AEXA 3PV0A 3IL8A 1VMCA 4ZKBB 3T1YQ 3I4OA 1G51A 4DR4Q 3OMCA 1EWIA 5M9OA 5FJ8G 1VQMA 3RMHA 3GO5A 4KI0A 4KK7A 4O1NA 3TP7A 5C3XA 5CYUA 3HRZC 1LUZA 3F2BA 5JPNC 4B9XA 1NR2A 1HH2P 2HT1A 1TWHB 1ESRA 2MHVA 3Q24A 2EYJA 3HOZH 1NUCA 2BE5C 2C35B 4H7BA 1MD2D 1IBKQ 3S16H 1K9MC 2PMZB 3I4NB 4G7ZC 4ZUIA 5I2XA 3J7ZC 2E2IH 3HOUB 3QR8A 3T51B 2NVQB 4JPBW 5FJ8H 2R92G 5IGBA 1FGUA 3GTLB 3R2IA 2A68C 2F3IA 3DWPA 4XYOA 2FXQA 4WRDA 3G4SA 3U4VA 2D62A 3CD6A 4B3RL 3BVZA 3J80c 3A8JE 2IX1A 2K50A 4UAIA 5IOCA 2A6ED 1D1KA 2ZXOA 1EQRA 4KY5A 3JAMi 4DAYB 1M90C 4A3FB 1WJJA 5ELCA 4DV4Q 1QNUA 4POFA 2V4DA 5GQOA 1V43A 4PZ8A 5FO8B 2R7FA 1WTQA 4L8JA 2JQOA 1LTLA 4B3RQ 2R92H 1CSQA 3I8ZA 2OT2A 4HJ5A 2F52A 4DUZL 5C3EB 1VQ7A 3CMAA 3PUXA 3HZXA 4LK1C 2C9OA 2HDLA 3OSOA 1K8AC 4JW0A 2E75C 3FVQA 4DV2L 3G6JB 3EIVA 4JI5L 3HOWG 3K0XA 3KUPA 1Q90A 4DV1Q 2I07B 2MPMA 2AQ3B 3RR5A 1X6OA 1BOSA 2IY5B 4JYAL 2GVAA 4IFDG 3DEOA 4A3GG 1CM9A 2AUJD 1SYDA 3GTQB 3FDTA 1TS5A 5GADC 2VQEL 1Y1WG 3M9BA 2B63B 1CKNA 1S5ED 5GAGC 5NUCA 4OHJA 1UEAB 3SEBA 1OXXK 4DV2Q 4JI5Q 1STYA 3OYYA 1TWAH 3M4YA 3VYTA 3W3AA 2XSCA 3KOJA 2PQAB 1VQIA 4ID6A 3PF4A 1ASYA 3HOWH 2G9HD 1U4LA 2PO4A 1WI5A 1Z6HA 2WAQB 5DLQE 3KLRA 3P1HA 3QJYA 2HHHL 1W2BA 3M4PA 4WJ4A 4A3EG 4IFDH 3BDOA 2RHSB 3T56B 4A3GH 1LO5D 4DK3C 1HUMA 2A69D 5JVH3 1Y1WH 1Q8IA 1Q82C 4KHPQ 1QJOA 4C1NI 3TP8A 3D31A 2PW7A 4YCWA 4R4IA 1STAA 1PRTD 1XX8A 2SNSA 2WACA 4ALPA 2HCCA 4LF7Q 2Q8IB 2HHHQ 5C4XG 4K2KA 2PZWA 1O7ZA 1PYBA 5KNDA 1QZGA 1ET9A 2E74C 5DNFA 4FXKC 1TXYA 2QF7A 4QF4A 1X3QA 2OF1A 2R7DA 3GTPB 4XTCS 4BXXG 2I46A 4A3EH 3R3OA 2JA8B 2K01A 3BJUA 2RA4A 1NR4A 3S2HB 4JI1Q 1F77A 1FD7D 2EYMA 2G9DA 1BBWA 4ZAIA 2LS01 4QB4A 1Z47A 2HIXA 5D3IB 4LW1A 5C4XH 4MTKA 5M5WH 3Q22A 4K6LA 1CZWA 2NYZD 2UUCQ 1JOOA 4ZCKA 2KUMA 3GQBA 4ZKCB 1JCKB 5JVG3 3BVGA 3ICEA 5FLXE 4NMZA 4RGNA 2A5HA 4BXXH 4F87A 2XWJB 3S24A 1S3OA 1HXYD 4CJ1B 2UUAL 2EYOA 1JORA 1V1PB 2ZT9C 1QILA 3NENA 1CKMA 3E9IA 2ZTDA 1STEA 3NWSA 2DJGC 3WOFA 1NSNS 3QOJA 1I4PA 4QIWE 1D5MC 3GP7A 4LUZA 5D3DA 4DR7Q 4IPCA 3J81i 2AQ2B 1X56A 2F3WA 2PQEA 1N33L 3H3VI 1R9TH 1XPRA 4OONA 2L5TA 4K5XA 2JK8A 4X66L 2GVBA 3T53B 4CBVA 1PLFA 3CRKC 2L15A 1VMPA 2K75A 2BA1A 4K8IA 4DUYL 1JE4A 2AQ1B 1GUOA 1KTKA 3Q6SA 3PQIA 4JI8L 2UXCQ 1SYEA 1BCPD 3PMFA 5KYLA 4XYQA 1A2UA 1STBA 1U4RA 4I7AA 2XRQD 1YJ9A 5EPJA 2JA7B 4Z9CB 2K7VA 4V0BA 4DNTB 2N8NA 4A76A 3F8TA 1EY9A 1JWSD 4DUYQ 1N32L 2KCMA 3M85A 2VW9A 1SNDA 2FJ2A 5E4WC 4J1MA 3RZOB 1PMRA 2EPBA 4IJLA 4HAEA 2XN9C 2ENBA 2L12A 2KEEA 1HTLD 1KAWA 4GNXC 3OTOQ 3ULLA 1UE1A 1HCZA 4IALA 4M1UB 3S9WA 2F0NA 1SE8A 1H9MA 2B2VC 2F03A 4CJ2C 1EFID 2EXDA 3J7AV 1WD0A 4WJ3M 1WTOA 2NTSA 1QG7A 2K5NA 1CFMA 1VQ4A 3HOXB 1MJCA 2Q8TA 1HPCA 1C48A 3GTJH 5FLMG 2VZAA 3I73A 2WB1B 5LL6S 2NVXH 1HFGA 1K0RA 3K5OA 4BBRG 1BR9A 2A68D 3J81L 1XPOA 2R93B 4KTAA 4MIUA 1LT5D 2ID0A 3CF5A 1QVGA 3A55A 3GD7A 2Q2TA 3MC0B 1WTVA 4F8MA 3R93A 1W6JA 1QNKA 3J7A5 3H6MA 2DY7A 1VQJA 4DR2Q 1EU3A 4G4KA 2PYKA 3VA5A 5FLMH 4BBSG 5FLXc 4AQYL 2WFWA 3E0JA 3I4LA 1XWEA 1SBBB 4EX5A 1A2TA 4R4TA 1TWCH 1JICA 4JOIA 4BBRH 3CXCA 4FXDA 2JSOA 4A3DB 2UXBL 4XDXA 4KJOA 1K8OA 2XWBB 1CI3M 1D1IA 4Y7NB 1PRTF 3HGBA 4IUNA 4C56C 2J7ZA 1HR0Q 3MXNA 5GAEC 4A3MG 4C3IB 1YIJA 1E7ZA 3D3RA 2F0VA 2ES2A 1STHA 1EQQA 4AQYQ 1I50B 5J3BA 1B8AA 3FKIB 1ENFA 1YHAA 1HA6A 4K0KL 2UXBQ 2F3VA 4QUCA 5FKAC 4DPGA 2Q2UA 1B9MA 3H3VH 4BBSH 3K7AH 1SAPA 2ZTEA 2ATWA 1F9PA 1HZ9A 1STNA 4PMBA 1BNZA 1X3EA 2GA4B 4PG3A 3CCUA 4K0KQ 3S14H 4A3MH 2J4XA 2PNHA 2RDHA 5M3FG 1SE4A 4R8IA 4DF7A 4C3JB 1EOVA 3SVMA 2EYPA 2JJQA 1Z9FA 2BH2A 1HJPA 1P8LA 1VQEA 4JK1C 4G7OC 4X3KA 2B2WA 5EKLA 4GKKL 2WIIB 3SDZA 4DKAC 5H1SE 3E9HA 3RZDH 4LFAL 3H0GB 4KHVA 1GM5A 4BY1B 1HNWL 1LYLA 5M3FH 1KDAA 1SMYD 1R4QB 1PXUA 4PQXA 2H5XA 1H95A 1GVPA 1Z7TA 5JOBA 2B39A 3ONAB 1Q7YC 4B3TL 4LFAQ 2QDBA 2VB3X 1BKBA 2A19A 2KQ3A 2DN8A 2NVYB 5EPKA 3VYUA 4AH6A 4OO1I 5JJIA 1KNEA 3CQZB 1M4VA
chains in the Genus database with same CATH topology
3W5OA 5FJ8G 2E2JH 3CC4A 3TREA 1VQMA 3GO5A 4KI0A 3RN5A 1KC8C 1N36L 4WJ4A 2JA6G 1CUKA 2B3GA 3J81c 2KHIA 1N34Q 1MKHA 4JI1L 2WP8J 5IY0A 4JI4L 4B3TQ 4UP9A 5IYCG 4DV0Q 3PO2H 3HOXG 4L5QA 1WYDA 1QUQB 2VQFL 4DV3Q 3RLOA 1LUZA 3RZOH 5JJLA 3F2BA 3LGJA 1HH2P 2HT1A 3U4ZA 2WB1G 3AQQA 1VCIA 4OWTB 5C0XI 3RN2A 2CCZA 2UUCL 2MO1A 4DV6L 4R4QA 4GNXB 4GLXA 3HOZH 5IP7G 2C35B 1IBKQ 2E5LQ 2RF4A 1GO3E 1DGSA 2VUMG 3GTMH 1KRTA 3S16H 1MJEA 3Q8DA 1K9MC 4QQBX 4LFCQ 3G6EA 3A0JA 4AYBG 1WFQA 3TQYA 2AMCB 5AJ3L 3G71A 1WCMH 3J7ZC 2E2IH 2PI2E 5FJ8H 2Z6KC 1PH5A 2R92G 3UDGA 1FGUA 2ZJRA 4NXML 2JA6H 1VQGA 1Q46A 5JEAG 4GOPC 2F3IA 1PFSA 4DV6Q 2PMZE 5IYCH 1KL9A 3HOXH 2FXQA 3G4SA 2NZOA 4JG2A 1XNRL 1KHIA 3GTPH 3U4VA 3I4MG 1NJIC 1FJGQ 2D62A 3OW2A 3CD6A 4DR7L 4B3RL 3J80c 1EYGA 4YCVA 2ZM6L 2JA9A 5C44G 1W3SA 3S2HH 3CPWA 2IX1A 2K50A 4OWXB 2Z6KA 4AIMA 4LF8Q 3KDFA 4JV5Q 5M3MG 4A3DG 1EQRA 5IP7H 2IHFA 3JAMi 1VQ5A 1JJCB 4GOPA 4DAYB 4IPGA 3DLLA 1M90C 2VUMH 1JJGA 1WJJA 1HZAA 1VQHA 5ELOA 4DV4Q 1VQLA 4POFA 5GQOA 2NN6I 1V43A 1Q81C 1XNRQ 1Q86C 4PZ8A 4OXPA 2R7FA 1XMOL 2JQOA 2KHJA 1S40A 1LTLA 4B3RQ 2R92H 1AE3A 1CSQA 3AEVA 1NMFA 3I56A 3HKZG 1NBWA 1KRSA 3FKIG 3CPFA 2F52A 3KF8B 4DUZL 3PCOB 4HJ5A 1AE2A 4POGA 3PUWA 1VQ7A 2UXCL 1FL0A 3CMAA 5GAHC 3PUXA 2K5VA 3MXNB 3CCVA 1PH2A 1K8AC 3I4MH 1KXLA 1L2FA 1VQFA 2R6GA 3HOWG 4DV2L 4JI5L 3EIVA 3K0XA 1PH1A 4HIMA 5C44H 4IOAA 1XMOQ 4DV1Q 3W1GA 1B70B 3UDIA 3RR5A 1X6OA 5M3MH 3KF6A 1QVCA 4A3DH 4JYAL 2IY5B 2GVAA 4IFDG 5IP9G 4A3GG 4A93G 4Y7NH 2A8VA 2UXDL 5GADC 2VQEL 1Y1WG 3M9BA 4BA2I 5IE8A 5GROA 4C3IH 3AYHB 1CKNA 5GAGC 5JEAJ 3PF5A 1A0IA 1IBLL 3TS2A 5IWAL 1K83H 1OXXK 4DV2Q 4JI5Q 4O0AA 1I50H 3GTGH 2IT1A 1CSPA 3OYYA 1TWAH 3FKIH 3JC66 4RMFA 4X6AH 3A5UA 3KLWA 4LF5Q 3KOJA 1NMGA 3OTOL 2PQAB 1VQIA 4P74A 1PH4A 4IOCA 4A3KG 3PF4A 2YTYA 1ASYA 3HOWH 2UXDQ 4JI6L 1WI5A 2K14A 3ER0A 3U58A 4YY3L 4UP8A 5DLQE 5IWAQ 2K52A 5IYDG 2HHHL 1W2BA 1X3FA 3M4PA 2KCTA 4GKKQ 3PUVA 4GN3B 4A3EG 3BZKA 5IP9H 1VQPA 2RHSB 4X64Q 1J5EQ 4A93H 4A3GH 4DK3C 2OTLA 2I5HA 3H0GG 1M1KC 1T9HA 3M7NA 4BY1G 4UY8C 2LSSA 2WAQE 1Y1WH 1VQ6A 1Q82C 4P75A 3PO3G 4JI2Q 4HJ7A 4LFBL 1HNWQ 1N9WA 1CKNB 1EIYB 5C0XG 4JI7L 4KHPQ 4B3SL 3S1MH 2Q2HA 3H15A 3D31A 4JC0A 2I5LX 4BA1I 3CC2A 4YY3Q 4YCWA 1A8VA 4R4IA 4ALPA 1IBML 2Q2IA 4LF7Q 2HHHQ 1VQ9A 2ASBA 5C4XG 4APVA 2AKWB 4TQUS 3I55A 4QY7A 1UWVA 4DAMA 2I5MX 4A3KH 1PYBA 4HJ8A 1QZGA 4P72A 4IFDJ 4LFBQ 1RL2A 2LXKA 4JI7Q 2LXJA 1IL2A 1TWFH 1TXYA 3BU2A 4B3SQ 2R7DA 4XTCS 5IYDH 4BXXG 3F2CA 4A3EH 2YTXA 4A3JG 3ERSX 4HJ9A 1QVFA 2R93G 1RIPA 3H0GH 1IBMQ 3BJUA 1YI2A 1N36Q 4BY1H 3MEFA 1PH6A 4GKJL 2KENA 4JI1Q 2MNAA 3PO3H 4JI4Q 4C2MH 4QL5A 4DR6L 1BBWA 1GKHA 2VQFQ 4DR2L 1UE6A 1XPUA 2NVTH 1Z47A 2XTIA 2HIXA 3T1HL 1O7IA 4LW1A 4R1JA 1Y14B 3L0OA 5C4XH 5M5WH 2YU9H 4JI0L 4JBKA 3HOVG 2NN6G 3GTKH 1OXUA 1BVSA 1KD1C 2UUCQ 1YNXA 1VQAA 1HNXL 1Y1VG 4GKJQ 2EIFA 4A3LG 2RCNA 3RLFA 1JMCA 1XMQL 1HR0L 3CCLA 1Q8KA 4DR6Q 1SFOH 4UP7A 3ICEA 3I4NG 5AJ3Q 2AWOA 3HOUG 3CQZH 4BXXH 2VNUD 1SROA 3STBD 4DR3L 2BH8A 3PGZA 4QJFA 3S24A 1S3OA 1I3QH 5C0XJ 3RNUA 3T1HQ 4A3JH 1YHQA 1N8RC 2UUAL 4LF4L 2R93H 4P73A 4NXMQ 4LF9L 4JI0Q 4B3ML 3I7FA 1HNZL 3K80C 1KIXA 4A3CG 4DV5L 3NENA 1CKMA 3E9IA 1G6PA 2ZTDA 1V1QA 1L1OC 3M4QA 4PMWA 4LF6L 2RHQB 3EN2A 4QIWE 4R4CA 1TWHH 4LUZA 4YWLA 3UDFA 1XMQQ 4DR7Q 4IPCA 3J81i 5LMNW 3SGIA 2ZM6Q 1C7YA 1SRUA 5LMUL 1X56A 1PH8A 3HOVH 3U50C 4DR3Q 1N33L 3S1QH 3AFQA 4PZ7A 2Y0SE 1VQKA 1Y1VH 3H3VI 3NELA 4LF9Q 2MFIA 2NZHA 4A3FG 1R9TH 1XPRA 1HNZQ 4OONA 4A3LH 1E22A 2JK8A 4X66L 4NB3A 3TEHB 1L1OA 4A3BG 2OTJA 4JI3L 2GVBA 4L5RC 1UE5A 1PYSB 3I4NH 4KHZA 4LF6Q 1Q1EA 3HOUH 4GS3A 3S2DH 1P16A 5BR8L 5C4JH 1YJWA 1VQCA 4DNIA 3GTLH 2L15A 2MO0A 3S1RH 3KDFB 1XJVA 2K75A 5LMUQ 2BA1A 2VY3A 5C3EG 4NXNL 4DUYL 1FVIA 4DUZQ 4GOPB 3ULPA 3CCJA 4A3CH 2OQKA 4JI8L 2UXCQ 5HGQA 4HIKA 4HIDA 2MQHA 4NPSA 5LMNL 1L0WA 1PH9A 2VL6A 3L7ZC 1PH7A 2OWOA 4YCUA 1YJ9A 4L5SA 4JI3Q 4OX9L 1VS0A 2BA0A 3CW2C 5BR8Q 3CCRA 2NVXH 2N8NA 4JBWA 4A76A 4DR1L 4X65L 3F8TA 4JYAQ 1YBYA 4OO1G 2JE6I 4A3FH 1SR3A 4DUYQ 3J80i 2JA5G 1N32L 2KCMA 3M85A 4LNQA 4A3BH 1C0AA 2F4VL 1IXRA 4X62L 2VW9A 2VQEQ 1L1OB 5LMNQ 1G291 4GN5A 4DR5L 1S72A 2K4KA 1IBLQ 1D8LA 2E2HH 1KQSA 5M5YH 4IJLA 1AH9A 1NTGA 3KF6B 3UDXA 2YTVA 5C3EH 3CCQA 2AHOB 2UU9L 3S17H 1KAWA 1NE3A 4X65Q 1HZCA 4GNXC 3OTOQ 4DR1Q 3J81j 3S15H 3ULLA 1UE1A 3D0FA 3KJOA 5JJKA 1B7YB 1YZ6A 4C3JH 4HJAA 1NY4A 4X62Q 3ULJA 4MNOA 4JI6Q 4BY7G 1QUQA 4JBMA 4XIGS 2WAQG 1VQOA 2B29A 1CKOA 3W1BA 1SE8A 2I0QA 4DR4L 1Q12A 2EXDA 1PH3A 1PV4A 4IPDA 1VQDA 4LUVA 4WJ3M 2JA5H 3GTQH 2UU9Q 1YHBA 2K5NA 3KJPA 1HZBA 4DV0L 4GNXA 1Q1BA 2PI2A 4DV3L 1VQ4A 1MJCA 3CCSA 4GN4B 1EFWA 3KFUA 3JAMc 3GTJH 4OWWB 1U0LA 3UE0A 1HR0W 1LM0A 2N3SA 5FLMG 2YYZA 2VZAA 2XGTA 2D0PA 3HFZB 4RG1A 1U5KA 2IHEA 3K8AA 1E3PA 2HQLA 3BZCA 3UE1A 3PIPA 4P71A 1X3GA 3HKSA 1K0RA 1XPOA 2CQOA 2IX0A 4BBRG 3L2PA 4H02A 3FHWA 1JB7A 1IBKL 2E5LL 3TRZA 4L5TA 4BY7H 1WOCA 1YVCA 2WB1E 2ID0A 3B6YA 4LFCL 1J6QA 3CF5A 1QVGA 1I94L 3I2ZA 1X54A 2JEAI 1K73C 3GD7A 5EAYA 2Q2TA 1PVOA 1PA6A 1YJNA 4JOIC 1BBUA 2JA8G 1I6HH 3CCEA 5ELNA 3M4OH 3J7A5 4IJHA 3HOYG 1IYJB 4PZ6A 4AYBE 3FP9A 3DM3A 2NVYH 4TVAB 1VQBA 3AFPA 3F2DA 4DR2Q 1VQJA 1ASZA 1FJGL 4FDBA 1VQNA 5FLMH 3CAMA 4BBSG 5FLXc 4AQYL 1I94Q 2A1AA 2WFWA 4IO9A 2UUBL 1YITA 1K8GA 4EX5A 4LF8L 5IYBG 4JV5L 4R4TA 1TWCH 2OQ0A 3EBEA 4JOIA 4A4IA 4BBRH 3CXCA 1I5FA 2UXBL 2E8GA 4A75A 1HNXQ 1YEZA 2R7ZG 4DV4L 4R4OA 1HR0Q 3WWVA 5GAEC 3K7UC 4JBJA 4HIOA 4A3MG 2ZJPA 4YWMA 1YIJA 3CMEA 1QZHA 1D7QA 1E7ZA 2ES2A 3NEMA 1EQQA 3F1ZA 3K81C 4AQYQ 2JA8H 3TS0A 2UUBQ 4LF4Q 5J3BA 2UUAQ 1B8AA 1JJ2A 4B3MQ 3HOYH 3M3YH 2JEBI 1YHAA 3CCMA 4K0KL 2UXBQ 2VS1A 4DV5Q 4MZ9A 4C3HH 2ZJQA 4DPGA 2Q2UA 2Y0SG 2EQSA 2N78A 3E0EA 3HKZE 3H3VH 2NVQH 4BBSH 3VDYA 3K7AH 3STBC 2ZTEA 2ATWA 1C9OA 4QGUA 3PUYA 4DV1L 1X65A 3GTOH 1HZ9A 5IYBH 4DK6C 1X3EA 1N33Q 1OXVA 4PG3A 3G48A 3CCUA 3KYHC 4A3IG 1X9NA 1MIUA 2QGQA 2R7ZH 1SN8A 1XNQL 4EQ5A 2PQAA 4K0KQ 1XTDA 1UEBA 4X66Q 3S14H 1E1TA 4A3MH 1A63A 1IZ6A 2PNHA 5M3FG 1K3RA 2CWAA 3A5ZB 1EOVA 1OTCA 2JJQA 1Z9FA 2BH2A 4UPAA 1UE7A 3ZJYC 1PHJA 1HJPA 1OXTA 1P8LA 1VQEA 4LF5L 5K36G 1V9PA 2K5HA 4NXNQ 4JI8Q 4GLAC 2DGYA 2CKZB 3PSIA 4IPHA 2KBNA 4LUOA 2B63G 4MTNA 2DUDA 1XNQQ 3A74A 3S1NH 4YHHL 2JA7G 4JCVE 2QEXA 1GD7A 2OCEA 3GDEA 4OX9Q 4GKKL 2CWPA 4A3IH 2D0OA 4J15A 4X64L 1E24A 1J5EL 4DKAC 5H1SE 3E9HA 3RZDH 4LFAL 4Y52H 1EIFA 4DV7L 1EUJA 1GM5A 1N32Q 2V1CC 3NBHB 5E7NA 2Z0SA 5IT9c 4JI2L 2F4VQ 1HNWL 3RLNA 4KHPL 3PO2G 1OXSC 1LYLA 5M3FH 4O2DA 4IFDI 1JT8A 5HY6A 4DR5Q 3T1YL 4YHHQ 1TWGH 2H5XA 2HIVA 1H95A 1GVPA 4LWCA 2ALYB 3IRBA 4LF7L 2N49A 1JE5A 4KLKA 1N34L 2GN5A 4YWKA 2QA4A 1E1OA 2YV5A 4GLVB 1Q7YC 4B3TL 4LFAQ 2B63H 2ZTCA 4ME3A 1BKBA 4DV7Q 3HOZG 1A62A 3PIOA 2A19A 3PUZA 3PV0A 2JA7H 1X55A 1SLJA 3CP0A 2CFMA 5M5XH 1VQ8A 4AH6A 2AWNA 3T1YQ 3I4OA 4OO1I 5JJIA 1G51A 3CC7A 1WCMG 4DR4Q 1SMXA 1EWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5O A;  5FJ8 G;  2E2J H;  3CC4 A;  3TRE A;  1VQM A;  3GO5 A;  4KI0 A;  3RN5 A;  1KC8 C;  1N36 L;  4WJ4 A;  2JA6 G;  1CUK A;  2B3G A;  3J81 c;  2KHI A;  1N34 Q;  1MKH A;  4JI1 L;  2WP8 J;  5IY0 A;  4JI4 L;  4B3T Q;  4UP9 A;  5IYC G;  4DV0 Q;  3PO2 H;  3HOX G;  4L5Q A;  1WYD A;  1QUQ B;  2VQF L;  4DV3 Q;  3RLO A;  1LUZ A;  3RZO H;  5JJL A;  3F2B A;  3LGJ A;  1HH2 P;  2HT1 A;  3U4Z A;  2WB1 G;  3AQQ A;  1VCI A;  4OWT B;  5C0X I;  3RN2 A;  2CCZ A;  2UUC L;  2MO1 A;  4DV6 L;  4R4Q A;  4GNX B;  4GLX A;  3HOZ H;  5IP7 G;  2C35 B;  1IBK Q;  2E5L Q;  2RF4 A;  1GO3 E;  1DGS A;  2VUM G;  3GTM H;  1KRT A;  3S16 H;  1MJE A;  3Q8D A;  1K9M C;  4QQB X;  4LFC Q;  3G6E A;  3A0J A;  4AYB G;  1WFQ A;  3TQY A;  2AMC B;  5AJ3 L;  3G71 A;  1WCM H;  3J7Z C;  2E2I H;  2PI2 E;  5FJ8 H;  2Z6K C;  1PH5 A;  2R92 G;  3UDG A;  1FGU A;  2ZJR A;  4NXM L;  2JA6 H;  1VQG A;  1Q46 A;  5JEA G;  4GOP C;  2F3I A;  1PFS A;  4DV6 Q;  2PMZ E;  5IYC H;  1KL9 A;  3HOX H;  2FXQ A;  3G4S A;  2NZO A;  4JG2 A;  1XNR L;  1KHI A;  3GTP H;  3U4V A;  3I4M G;  1NJI C;  1FJG Q;  2D62 A;  3OW2 A;  3CD6 A;  4DR7 L;  4B3R L;  3J80 c;  1EYG A;  4YCV A;  2ZM6 L;  2JA9 A;  5C44 G;  1W3S A;  3S2H H;  3CPW A;  2IX1 A;  2K50 A;  4OWX B;  2Z6K A;  4AIM A;  4LF8 Q;  3KDF A;  4JV5 Q;  5M3M G;  4A3D G;  1EQR A;  5IP7 H;  2IHF A;  3JAM i;  1VQ5 A;  1JJC B;  4GOP A;  4DAY B;  4IPG A;  3DLL A;  1M90 C;  2VUM H;  1JJG A;  1WJJ A;  1HZA A;  1VQH A;  5ELO A;  4DV4 Q;  1VQL A;  4POF A;  5GQO A;  2NN6 I;  1V43 A;  1Q81 C;  1XNR Q;  1Q86 C;  4PZ8 A;  4OXP A;  2R7F A;  1XMO L;  2JQO A;  2KHJ A;  1S40 A;  1LTL A;  4B3R Q;  2R92 H;  1AE3 A;  1CSQ A;  3AEV A;  1NMF A;  3I56 A;  3HKZ G;  1NBW A;  1KRS A;  3FKI G;  3CPF A;  2F52 A;  3KF8 B;  4DUZ L;  3PCO B;  4HJ5 A;  1AE2 A;  4POG A;  3PUW A;  1VQ7 A;  2UXC L;  1FL0 A;  3CMA A;  5GAH C;  3PUX A;  2K5V A;  3MXN B;  3CCV A;  1PH2 A;  1K8A C;  3I4M H;  1KXL A;  1L2F A;  1VQF A;  2R6G A;  3HOW G;  4DV2 L;  4JI5 L;  3EIV A;  3K0X A;  1PH1 A;  4HIM A;  5C44 H;  4IOA A;  1XMO Q;  4DV1 Q;  3W1G A;  1B70 B;  3UDI A;  3RR5 A;  1X6O A;  5M3M H;  3KF6 A;  1QVC A;  4A3D H;  4JYA L;  2IY5 B;  2GVA A;  4IFD G;  5IP9 G;  4A3G G;  4A93 G;  4Y7N H;  2A8V A;  2UXD L;  5GAD C;  2VQE L;  1Y1W G;  3M9B A;  4BA2 I;  5IE8 A;  5GRO A;  4C3I H;  3AYH B;  1CKN A;  5GAG C;  5JEA J;  3PF5 A;  1A0I A;  1IBL L;  3TS2 A;  5IWA L;  1K83 H;  1OXX K;  4DV2 Q;  4JI5 Q;  4O0A A;  1I50 H;  3GTG H;  2IT1 A;  1CSP A;  3OYY A;  1TWA H;  3FKI H;  3JC6 6;  4RMF A;  4X6A H;  3A5U A;  3KLW A;  4LF5 Q;  3KOJ A;  1NMG A;  3OTO L;  2PQA B;  1VQI A;  4P74 A;  1PH4 A;  4IOC A;  4A3K G;  3PF4 A;  2YTY A;  1ASY A;  3HOW H;  2UXD Q;  4JI6 L;  1WI5 A;  2K14 A;  3ER0 A;  3U58 A;  4YY3 L;  4UP8 A;  5DLQ E;  5IWA Q;  2K52 A;  5IYD G;  2HHH L;  1W2B A;  1X3F A;  3M4P A;  2KCT A;  4GKK Q;  3PUV A;  4GN3 B;  4A3E G;  3BZK A;  5IP9 H;  1VQP A;  2RHS B;  4X64 Q;  1J5E Q;  4A93 H;  4A3G H;  4DK3 C;  2OTL A;  2I5H A;  3H0G G;  1M1K C;  1T9H A;  3M7N A;  4BY1 G;  4UY8 C;  2LSS A;  2WAQ E;  1Y1W H;  1VQ6 A;  1Q82 C;  4P75 A;  3PO3 G;  4JI2 Q;  4HJ7 A;  4LFB L;  1HNW Q;  1N9W A;  1CKN B;  1EIY B;  5C0X G;  4JI7 L;  4KHP Q;  4B3S L;  3S1M H;  2Q2H A;  3H15 A;  3D31 A;  4JC0 A;  2I5L X;  4BA1 I;  3CC2 A;  4YY3 Q;  4YCW A;  1A8V A;  4R4I A;  4ALP A;  1IBM L;  2Q2I A;  4LF7 Q;  2HHH Q;  1VQ9 A;  2ASB A;  5C4X G;  4APV A;  2AKW B;  4TQU S;  3I55 A;  4QY7 A;  1UWV A;  4DAM A;  2I5M X;  4A3K H;  1PYB A;  4HJ8 A;  1QZG A;  4P72 A;  4IFD J;  4LFB Q;  1RL2 A;  2LXK A;  4JI7 Q;  2LXJ A;  1IL2 A;  1TWF H;  1TXY A;  3BU2 A;  4B3S Q;  2R7D A;  4XTC S;  5IYD H;  4BXX G;  3F2C A;  4A3E H;  2YTX A;  4A3J G;  3ERS X;  4HJ9 A;  1QVF A;  2R93 G;  1RIP A;  3H0G H;  1IBM Q;  3BJU A;  1YI2 A;  1N36 Q;  4BY1 H;  3MEF A;  1PH6 A;  4GKJ L;  2KEN A;  4JI1 Q;  2MNA A;  3PO3 H;  4JI4 Q;  4C2M H;  4QL5 A;  4DR6 L;  1BBW A;  1GKH A;  2VQF Q;  4DR2 L;  1UE6 A;  1XPU A;  2NVT H;  1Z47 A;  2XTI A;  2HIX A;  3T1H L;  1O7I A;  4LW1 A;  4R1J A;  1Y14 B;  3L0O A;  5C4X H;  5M5W H;  2YU9 H;  4JI0 L;  4JBK A;  3HOV G;  2NN6 G;  3GTK H;  1OXU A;  1BVS A;  1KD1 C;  2UUC Q;  1YNX A;  1VQA A;  1HNX L;  1Y1V G;  4GKJ Q;  2EIF A;  4A3L G;  2RCN A;  3RLF A;  1JMC A;  1XMQ L;  1HR0 L;  3CCL A;  1Q8K A;  4DR6 Q;  1SFO H;  4UP7 A;  3ICE A;  3I4N G;  5AJ3 Q;  2AWO A;  3HOU G;  3CQZ H;  4BXX H;  2VNU D;  1SRO A;  3STB D;  4DR3 L;  2BH8 A;  3PGZ A;  4QJF A;  3S24 A;  1S3O A;  1I3Q H;  5C0X J;  3RNU A;  3T1H Q;  4A3J H;  1YHQ A;  1N8R C;  2UUA L;  4LF4 L;  2R93 H;  4P73 A;  4NXM Q;  4LF9 L;  4JI0 Q;  4B3M L;  3I7F A;  1HNZ L;  3K80 C;  1KIX A;  4A3C G;  4DV5 L;  3NEN A;  1CKM A;  3E9I A;  1G6P A;  2ZTD A;  1V1Q A;  1L1O C;  3M4Q A;  4PMW A;  4LF6 L;  2RHQ B;  3EN2 A;  4QIW E;  4R4C A;  1TWH H;  4LUZ A;  4YWL A;  3UDF A;  1XMQ Q;  4DR7 Q;  4IPC A;  3J81 i;  5LMN W;  3SGI A;  2ZM6 Q;  1C7Y A;  1SRU A;  5LMU L;  1X56 A;  1PH8 A;  3HOV H;  3U50 C;  4DR3 Q;  1N33 L;  3S1Q H;  3AFQ A;  4PZ7 A;  2Y0S E;  1VQK A;  1Y1V H;  3H3V I;  3NEL A;  4LF9 Q;  2MFI A;  2NZH A;  4A3F G;  1R9T H;  1XPR A;  1HNZ Q;  4OON A;  4A3L H;  1E22 A;  2JK8 A;  4X66 L;  4NB3 A;  3TEH B;  1L1O A;  4A3B G;  2OTJ A;  4JI3 L;  2GVB A;  4L5R C;  1UE5 A;  1PYS B;  3I4N H;  4KHZ A;  4LF6 Q;  1Q1E A;  3HOU H;  4GS3 A;  3S2D H;  1P16 A;  5BR8 L;  5C4J H;  1YJW A;  1VQC A;  4DNI A;  3GTL H;  2L15 A;  2MO0 A;  3S1R H;  3KDF B;  1XJV A;  2K75 A;  5LMU Q;  2BA1 A;  2VY3 A;  5C3E G;  4NXN L;  4DUY L;  1FVI A;  4DUZ Q;  4GOP B;  3ULP A;  3CCJ A;  4A3C H;  2OQK A;  4JI8 L;  2UXC Q;  5HGQ A;  4HIK A;  4HID A;  2MQH A;  4NPS A;  5LMN L;  1L0W A;  1PH9 A;  2VL6 A;  3L7Z C;  1PH7 A;  2OWO A;  4YCU A;  1YJ9 A;  4L5S A;  4JI3 Q;  4OX9 L;  1VS0 A;  2BA0 A;  3CW2 C;  5BR8 Q;  3CCR A;  2NVX H;  2N8N A;  4JBW A;  4A76 A;  4DR1 L;  4X65 L;  3F8T A;  4JYA Q;  1YBY A;  4OO1 G;  2JE6 I;  4A3F H;  1SR3 A;  4DUY Q;  3J80 i;  2JA5 G;  1N32 L;  2KCM A;  3M85 A;  4LNQ A;  4A3B H;  1C0A A;  2F4V L;  1IXR A;  4X62 L;  2VW9 A;  2VQE Q;  1L1O B;  5LMN Q;  1G29 1;  4GN5 A;  4DR5 L;  1S72 A;  2K4K A;  1IBL Q;  1D8L A;  2E2H H;  1KQS A;  5M5Y H;  4IJL A;  1AH9 A;  1NTG A;  3KF6 B;  3UDX A;  2YTV A;  5C3E H;  3CCQ A;  2AHO B;  2UU9 L;  3S17 H;  1KAW A;  1NE3 A;  4X65 Q;  1HZC A;  4GNX C;  3OTO Q;  4DR1 Q;  3J81 j;  3S15 H;  3ULL A;  1UE1 A;  3D0F A;  3KJO A;  5JJK A;  1B7Y B;  1YZ6 A;  4C3J H;  4HJA A;  1NY4 A;  4X62 Q;  3ULJ A;  4MNO A;  4JI6 Q;  4BY7 G;  1QUQ A;  4JBM A;  4XIG S;  2WAQ G;  1VQO A;  2B29 A;  1CKO A;  3W1B A;  1SE8 A;  2I0Q A;  4DR4 L;  1Q12 A;  2EXD A;  1PH3 A;  1PV4 A;  4IPD A;  1VQD A;  4LUV A;  4WJ3 M;  2JA5 H;  3GTQ H;  2UU9 Q;  1YHB A;  2K5N A;  3KJP A;  1HZB A;  4DV0 L;  4GNX A;  1Q1B A;  2PI2 A;  4DV3 L;  1VQ4 A;  1MJC A;  3CCS A;  4GN4 B;  1EFW A;  3KFU A;  3JAM c;  3GTJ H;  4OWW B;  1U0L A;  3UE0 A;  1HR0 W;  1LM0 A;  2N3S A;  5FLM G;  2YYZ A;  2VZA A;  2XGT A;  2D0P A;  3HFZ B;  4RG1 A;  1U5K A;  2IHE A;  3K8A A;  1E3P A;  2HQL A;  3BZC A;  3UE1 A;  3PIP A;  4P71 A;  1X3G A;  3HKS A;  1K0R A;  1XPO A;  2CQO A;  2IX0 A;  4BBR G;  3L2P A;  4H02 A;  3FHW A;  1JB7 A;  1IBK L;  2E5L L;  3TRZ A;  4L5T A;  4BY7 H;  1WOC A;  1YVC A;  2WB1 E;  2ID0 A;  3B6Y A;  4LFC L;  1J6Q A;  3CF5 A;  1QVG A;  1I94 L;  3I2Z A;  1X54 A;  2JEA I;  1K73 C;  3GD7 A;  5EAY A;  2Q2T A;  1PVO A;  1PA6 A;  1YJN A;  4JOI C;  1BBU A;  2JA8 G;  1I6H H;  3CCE A;  5ELN A;  3M4O H;  3J7A 5;  4IJH A;  3HOY G;  1IYJ B;  4PZ6 A;  4AYB E;  3FP9 A;  3DM3 A;  2NVY H;  4TVA B;  1VQB A;  3AFP A;  3F2D A;  4DR2 Q;  1VQJ A;  1ASZ A;  1FJG L;  4FDB A;  1VQN A;  5FLM H;  3CAM A;  4BBS G;  5FLX c;  4AQY L;  1I94 Q;  2A1A A;  2WFW A;  4IO9 A;  2UUB L;  1YIT A;  1K8G A;  4EX5 A;  4LF8 L;  5IYB G;  4JV5 L;  4R4T A;  1TWC H;  2OQ0 A;  3EBE A;  4JOI A;  4A4I A;  4BBR H;  3CXC A;  1I5F A;  2UXB L;  2E8G A;  4A75 A;  1HNX Q;  1YEZ A;  2R7Z G;  4DV4 L;  4R4O A;  1HR0 Q;  3WWV A;  5GAE C;  3K7U C;  4JBJ A;  4HIO A;  4A3M G;  2ZJP A;  4YWM A;  1YIJ A;  3CME A;  1QZH A;  1D7Q A;  1E7Z A;  2ES2 A;  3NEM A;  1EQQ A;  3F1Z A;  3K81 C;  4AQY Q;  2JA8 H;  3TS0 A;  2UUB Q;  4LF4 Q;  5J3B A;  2UUA Q;  1B8A A;  1JJ2 A;  4B3M Q;  3HOY H;  3M3Y H;  2JEB I;  1YHA A;  3CCM A;  4K0K L;  2UXB Q;  2VS1 A;  4DV5 Q;  4MZ9 A;  4C3H H;  2ZJQ A;  4DPG A;  2Q2U A;  2Y0S G;  2EQS A;  2N78 A;  3E0E A;  3HKZ E;  3H3V H;  2NVQ H;  4BBS H;  3VDY A;  3K7A H;  3STB C;  2ZTE A;  2ATW A;  1C9O A;  4QGU A;  3PUY A;  4DV1 L;  1X65 A;  3GTO H;  1HZ9 A;  5IYB H;  4DK6 C;  1X3E A;  1N33 Q;  1OXV A;  4PG3 A;  3G48 A;  3CCU A;  3KYH C;  4A3I G;  1X9N A;  1MIU A;  2QGQ A;  2R7Z H;  1SN8 A;  1XNQ L;  4EQ5 A;  2PQA A;  4K0K Q;  1XTD A;  1UEB A;  4X66 Q;  3S14 H;  1E1T A;  4A3M H;  1A63 A;  1IZ6 A;  2PNH A;  5M3F G;  1K3R A;  2CWA A;  3A5Z B;  1EOV A;  1OTC A;  2JJQ A;  1Z9F A;  2BH2 A;  4UPA A;  1UE7 A;  3ZJY C;  1PHJ A;  1HJP A;  1OXT A;  1P8L A;  1VQE A;  4LF5 L;  5K36 G;  1V9P A;  2K5H A;  4NXN Q;  4JI8 Q;  4GLA C;  2DGY A;  2CKZ B;  3PSI A;  4IPH A;  2KBN A;  4LUO A;  2B63 G;  4MTN A;  2DUD A;  1XNQ Q;  3A74 A;  3S1N H;  4YHH L;  2JA7 G;  4JCV E;  2QEX A;  1GD7 A;  2OCE A;  3GDE A;  4OX9 Q;  4GKK L;  2CWP A;  4A3I H;  2D0O A;  4J15 A;  4X64 L;  1E24 A;  1J5E L;  4DKA C;  5H1S E;  3E9H A;  3RZD H;  4LFA L;  4Y52 H;  1EIF A;  4DV7 L;  1EUJ A;  1GM5 A;  1N32 Q;  2V1C C;  3NBH B;  5E7N A;  2Z0S A;  5IT9 c;  4JI2 L;  2F4V Q;  1HNW L;  3RLN A;  4KHP L;  3PO2 G;  1OXS C;  1LYL A;  5M3F H;  4O2D A;  4IFD I;  1JT8 A;  5HY6 A;  4DR5 Q;  3T1Y L;  4YHH Q;  1TWG H;  2H5X A;  2HIV A;  1H95 A;  1GVP A;  4LWC A;  2ALY B;  3IRB A;  4LF7 L;  2N49 A;  1JE5 A;  4KLK A;  1N34 L;  2GN5 A;  4YWK A;  2QA4 A;  1E1O A;  2YV5 A;  4GLV B;  1Q7Y C;  4B3T L;  4LFA Q;  2B63 H;  2ZTC A;  4ME3 A;  1BKB A;  4DV7 Q;  3HOZ G;  1A62 A;  3PIO A;  2A19 A;  3PUZ A;  3PV0 A;  2JA7 H;  1X55 A;  1SLJ A;  3CP0 A;  2CFM A;  5M5X H;  1VQ8 A;  4AH6 A;  2AWN A;  3T1Y Q;  3I4O A;  4OO1 I;  5JJI A;  1G51 A;  3CC7 A;  1WCM G;  4DR4 Q;  1SMX A;  1EWI A; 
#chains in the Genus database with same CATH topology
 2A69 C;  2E2J H;  3CC4 A;  3TRE A;  4QMG A;  1I3Q B;  1S5D D;  1N36 L;  1CUK A;  1MKH A;  4JI4 L;  1I4H A;  4B3T Q;  4DV0 Q;  4FO2 A;  4L5Q A;  4DV3 Q;  3EVQ A;  2VQF L;  3RLO A;  1B53 A;  4OEL B;  3LWU A;  5JJL A;  4V19 0;  1PRT C;  2F0Q A;  1I4Q A;  2BOS A;  1GHJ A;  1A3T A;  5C0X I;  2F0F A;  5IGC A;  3RN2 A;  2CCZ A;  3HOV B;  3S1Q B;  4R4Q A;  4GLX A;  4HCE A;  2E5L Q;  2RF4 A;  2MGS A;  3HG9 A;  1CQF A;  1DGS A;  2VUM G;  3MHB A;  3HOY B;  3VR3 A;  1MJE A;  1GUN A;  4LFC Q;  1SNP A;  1WFQ A;  1LTB D;  2B2T C;  2AMC B;  1W6K A;  2PI2 E;  1EU4 A;  4EVO A;  3S2D B;  2A6H D;  1DJR D;  3LX0 A;  2ZJR A;  3S1R B;  4NXM L;  3ND8 A;  1DZ1 A;  4GOP C;  1H9S A;  1PFS A;  4K14 A;  5FK9 C;  1F2Z A;  2PMZ E;  1KL9 A;  2KVM A;  4RA8 A;  4RCO A;  1EEI D;  4JG2 A;  1AP0 A;  1XNR L;  1KHI A;  4FNF A;  3I4M G;  4CKB A;  2EVB A;  1WVL A;  4YCV A;  2ZM6 L;  2JA9 A;  3EA6 A;  5C44 G;  4H44 C;  4JV5 Q;  4LF8 Q;  1DON A;  3GV3 A;  4R8N A;  2VUM H;  1LTA D;  2F0J A;  4A3B B;  1Q81 C;  1XNR Q;  4OXP A;  1XMO L;  1DD2 A;  1S40 A;  4PNY A;  2N88 A;  1AE3 A;  1FR3 A;  4KJN A;  1NNX A;  1WTP A;  1SEB D;  3S17 B;  2K5V A;  3MXN B;  3CCV A;  3I4M H;  1KXL A;  1U4M A;  1STG A;  1OO9 B;  5C44 H;  4IOA A;  2KEC A;  1XMO Q;  3W1G A;  3UDI A;  2KED A;  2FIN B;  3KF6 A;  1QVC A;  2BDO A;  3QG1 A;  5IP9 G;  4RHR A;  4A93 G;  1E2Z A;  3ERQ A;  3DMU A;  4CKC A;  1Y8O B;  4BA2 I;  3AYH B;  3TS2 A;  1RCV D;  4O0A A;  4FYD A;  2XNA C;  5IGE A;  1ICF B;  2IT1 A;  5AFW A;  4RMF A;  1PTO H;  1BCP C;  3A5U A;  1JWM D;  4A3K G;  2YTY A;  4JI6 L;  2DNE A;  3IKJ A;  3U58 A;  2ZXP A;  1BF4 A;  1HUN A;  4XT3 B;  5IYD G;  3VYR A;  3PUV A;  3BZK A;  5IP9 H;  1VQP A;  1J5E Q;  4A93 H;  1IYV A;  2CHB D;  1I6H B;  2LSS A;  2WAQ E;  3M4O B;  3PO3 G;  4JI2 Q;  5EPL A;  3D6W A;  2KHS A;  3BVM A;  5C0X G;  5IT9 L;  2EY1 A;  3VR2 A;  3S1M H;  2EYH A;  3V05 A;  2I5L X;  3E3X A;  1IBM L;  2F0P A;  2ASB A;  4XXE A;  4TQU S;  3I55 A;  4DAM A;  2I5M X;  1VF5 C;  4A3K H;  5EJW A;  1TVX A;  4TKO B;  1SYF A;  1EQV A;  4IFD J;  3JAM E;  3BDL A;  3URY A;  4KN4 C;  5BN4 A;  4U67 3;  3I90 A;  1IL2 A;  1CHQ D;  1QWY A;  5IYD H;  1T5E A;  5BN3 A;  1AZP A;  1QVF A;  1RIP A;  3Q23 A;  3EFX D;  1IBM Q;  1PH6 A;  4DAV A;  1BUV T;  1V1P A;  2KEN A;  3PO3 H;  1JWU D;  1ONL A;  3C2P A;  5KYI A;  5C0X H;  2X69 A;  4DR6 L;  5EKI A;  1GKH A;  1RKN A;  1UE6 A;  2NVT H;  2K6A A;  4OIJ A;  4MHE A;  1RD9 D;  3T1H L;  3GTO B;  3GTK H;  1J8I A;  2F0H A;  1VQA A;  1HNX L;  1ZEQ X;  3P75 A;  2R7Z B;  3TZD A;  4DR6 Q;  1SNQ A;  2EJG C;  3I4N G;  3NE5 B;  3HOU G;  2BH8 A;  4ZRZ A;  3T1H Q;  4OEM B;  1YHQ A;  4LF4 L;  1D5X C;  4G7H C;  4B3M L;  3I7F A;  4IQZ A;  3K80 C;  1KIX A;  3C1F A;  1G6P A;  3M4Q A;  2HDM A;  2Y0S B;  1DM0 B;  3D4D A;  2MUY A;  3EN2 A;  1TWH H;  2F0T A;  4R4C A;  4YWL A;  3U9S A;  4KKT A;  2O4X A;  1C7Y A;  1SRU A;  2XVS A;  2K5Q A;  4FF1 A;  1H9S B;  4PZ7 A;  1ENA A;  1S4Z A;  4A3I B;  4A3F G;  3D4R A;  1EY4 A;  2OTJ A;  3I4N H;  4EQP A;  1LTS D;  3HOU H;  4GS3 A;  3GTL H;  2MO0 A;  1TWG B;  3AU7 A;  2H4O A;  1AFP A;  5C3E G;  4NXN L;  4DUZ Q;  1YNJ C;  3TP6 A;  3ULP A;  1ILQ A;  3CCJ A;  1G2S A;  5HGQ A;  4HID A;  4H13 C;  4XQQ A;  3GV6 A;  5LMN L;  3DM1 A;  3NBH A;  1PH7 A;  4X3U A;  5EGT A;  4L5S A;  3BG3 A;  4OX9 L;  5M5X B;  3CW2 C;  1DXM A;  2JN4 A;  2QCP X;  4DR1 L;  4JYA Q;  4A3F H;  1EZ8 A;  2WV6 D;  1LTG D;  1IXR A;  2VQE Q;  3N52 A;  2QW7 A;  2NB0 A;  5IGD A;  3NSW A;  5C3W A;  5LMN Q;  4RGM A;  3PO2 B;  1G29 1;  2Q8R E;  4GN5 A;  1S72 A;  1D8L A;  3FPU B;  3SK6 A;  1AH9 A;  3KF6 B;  3UDX A;  5C3E H;  2AHO B;  2UU9 L;  2FMC A;  3K0Y A;  2MJ8 A;  1NCV A;  1NE3 A;  4DR1 Q;  4A3E B;  3J81 j;  3NQI A;  3I72 A;  3KJO A;  4RAU C;  1EOT A;  4ZQ3 A;  1HFN A;  2F0S A;  3GTM B;  2ICE C;  1QUQ A;  2X6L A;  4WOR A;  1TII D;  2WAQ G;  4XIG S;  4JBM A;  1CKO A;  1EZ6 A;  1CHP D;  1WCM B;  4R9W A;  3K5L A;  1SNM A;  3OIP A;  1PV4 A;  1LTR D;  3MEH A;  2JA6 B;  3GTQ H;  2UU9 Q;  1HZB A;  1SMY C;  4GNX A;  1MGS A;  1JOQ A;  3K58 A;  1KAB A;  3JAM c;  4OWW B;  1U0L A;  3UE0 A;  5KRU A;  3AMU A;  2YYZ A;  4DA2 A;  2BCO A;  2XGT A;  2B2V A;  2D0P A;  2PZU A;  3K6O A;  3UE1 A;  3PIP A;  3HP3 A;  2CQO A;  3FHW A;  1D5Z C;  1SDF A;  2WB1 E;  1QOH A;  3I2Z A;  4AYB B;  1K73 C;  3DUZ A;  2VXW A;  4FF3 A;  1GHK A;  4BWG B;  2B8F A;  1PA6 A;  2CH4 W;  1B50 A;  2JA8 G;  2B2Y C;  1DOK A;  3RUZ A;  3CCE A;  1SXT A;  1LT6 D;  4IJH A;  2ZXR A;  2F0D A;  4DXG A;  3FP9 A;  4HTH A;  3T13 A;  3W2D A;  2NWG A;  3AFP A;  4NP5 A;  1ASZ A;  1FJG L;  2ICI A;  1MSG A;  3LWE A;  1CZG A;  2A1A A;  2UUB L;  2CVR A;  2Z1C A;  1MBY A;  1YIT A;  2R3Z A;  3FPP A;  1JOK A;  3EBE A;  2Z6B A;  5M3M B;  2A74 C;  2F0U A;  5CV6 A;  4PV1 C;  1I5F A;  2K1B A;  3VR4 A;  4DXF A;  2M2L A;  1TR5 A;  3BS1 A;  3K7U C;  2A6H C;  3CME A;  1D7Q A;  2VB2 X;  2JP1 A;  1K83 B;  3F1Z A;  4XQN A;  3K81 C;  2JA8 H;  3MZ5 A;  2UUB Q;  3HKZ B;  3GTG B;  2UUA Q;  1JJ2 A;  1DCZ A;  3CCM A;  1J9O A;  1UNS A;  3CRL C;  5HUR A;  3MFY A;  2EQS A;  3E0E A;  2EZV A;  5CBA E;  3STB C;  3VR6 A;  1IL8 A;  3PUY A;  1X65 A;  2TSS A;  3A56 A;  4TRD A;  4CDF C;  4DK6 C;  1N33 Q;  1OXV A;  3KBX A;  1K28 A;  4FVM A;  2QGQ A;  2RSN A;  1SN8 A;  4EQ5 A;  4X66 Q;  5ISR A;  3MAQ A;  1IZ6 A;  3D4W A;  1K3R A;  1G2T A;  4DU9 A;  1PFN A;  5I9O A;  4LF5 L;  1LTI D;  1U4P A;  2R61 A;  4JI8 Q;  4GLA C;  2DGY A;  2CKZ B;  3PSI A;  4LUO A;  5E3F A;  1FNU A;  2K03 A;  1K8M A;  4YHH L;  2OXP A;  2L1B A;  2JA7 G;  5CBE E;  3A54 A;  1TWF B;  3GDE A;  1UUP A;  1RHP A;  1CA6 A;  2KOL A;  4X64 L;  3EJI A;  4Y52 H;  4DV7 L;  5CV9 A;  1GOZ A;  1N32 Q;  3FRP B;  3NBH B;  5E7N A;  2Z0S A;  2D5D A;  4WJW A;  4DK0 A;  4DGZ A;  4C2M B;  5L37 A;  4O2D A;  1JT8 A;  4YHH Q;  3NTK A;  3H3V C;  1F9Q A;  5F2D A;  2HIV A;  1XTC D;  2ALY B;  3IRB A;  1N34 L;  2RSO A;  2YU9 B;  2GN5 A;  4YWK A;  4G57 A;  4DV7 Q;  3FMC A;  3PIO A;  2HUG A;  4KY7 A;  2L9H A;  3PUZ A;  4RHS A;  4J8Q A;  1A6X A;  4RKL A;  2JA7 H;  1UAP A;  1VQ8 A;  2AWN A;  3SE0 A;  1S5C D;  3NQT A;  3E6Z X;  4A3J B;  2B2U C;  3J81 c;  1N34 Q;  2SNM A;  2WP8 J;  3OWF A;  2F0G A;  4TSS A;  1HRJ A;  4UP9 A;  3HOX G;  3RZO H;  1WYD A;  1QUQ B;  3V2T A;  3I91 A;  2XRS D;  2IJ0 A;  4IUR A;  1F2M A;  2WB1 G;  3KLS A;  4OWT B;  2MO1 A;  3OMG A;  1DYQ A;  3NPP A;  4GNX B;  5A2Q L;  1GO3 E;  3KLS X;  1KRT A;  3Q8D A;  4QQB X;  3T16 A;  1CT1 D;  3G6E A;  3A0J A;  4B08 A;  5AJ3 L;  4HCS A;  1WTW A;  3MXG A;  2Z6K C;  2WKC A;  1PH5 A;  5C4J B;  5JEA G;  2A73 B;  3HOX H;  1IW7 D;  3M7G A;  5D14 A;  2NZO A;  4QCL A;  1EYG A;  1H9J A;  1QCB D;  4RH6 A;  1C4Q A;  1WTR A;  2B2T A;  3SHL A;  5FO9 B;  1W3S A;  1ILP A;  1EYC A;  1PTO F;  1JQY D;  3KDF A;  4A3D G;  5J22 A;  1TU2 B;  2IHF A;  3C46 A;  3C1E A;  4GOP A;  3CKI B;  1YNJ D;  3DLL A;  1PFB A;  1D6E C;  1IKL A;  1HZA A;  1VQH A;  5ELO A;  2CW0 D;  2NN6 I;  4C3I G;  4NW2 A;  3WOE A;  1TY0 A;  2EY6 A;  2NZ1 D;  2E2H B;  5FOB B;  3AEV A;  1NMF A;  5M5Y B;  1NBW A;  1KRS A;  5JEA H;  3FKI G;  3CPF A;  4YIJ A;  4POG A;  3PUW A;  1FL0 A;  2EOT A;  5GAH C;  4FF4 A;  3S15 B;  5A35 A;  3RZD B;  1L2F A;  1VQF A;  2R6G A;  4HIM A;  4IUV A;  1PZI D;  1RJT A;  4ODG A;  4RKB A;  4A3D H;  5BN5 A;  3X3N A;  1I4R A;  3X3M A;  3R2T A;  4Y7N H;  2A8V A;  1LV9 A;  2JA5 B;  3DHQ A;  1ROD A;  3ITP A;  4C3I H;  2EY5 A;  3PF5 A;  2EXZ A;  1A0I A;  1IBL L;  1HQM C;  2PW5 A;  1I50 H;  4KD3 A;  3VYS A;  1CSP A;  3FKI H;  4X6A H;  1NAP A;  3MXU A;  3KLW A;  1NMG A;  5ELE A;  4IOC A;  2HD3 A;  4HMI A;  1L0Y B;  4BY7 B;  3TSS A;  4UP8 A;  4YY3 L;  1EY5 A;  3QIA A;  3TME A;  2K52 A;  4K8J A;  4GKK Q;  1X3F A;  2KCT A;  3NK9 A;  4GN3 B;  1LTT D;  1EY0 A;  3H0G G;  1M1K C;  1AN8 A;  1T9H A;  4BY1 G;  4UY8 C;  4FF2 A;  4LFB L;  1HNW Q;  1N9W A;  3H15 A;  1HTP A;  5ELD A;  2RKS A;  3NTH A;  4JC0 A;  4BA1 I;  3CC2 A;  4YY3 Q;  1A8V A;  2X6G A;  2AKW B;  3SK5 A;  4QY7 A;  4ME5 A;  1UWV A;  2QDL A;  4HJ8 A;  2EYF A;  4LFB Q;  1RL2 A;  2LXK A;  1G8Z D;  1EY6 A;  1HA5 A;  5ELB A;  1DOL A;  3F2C A;  2L0C A;  2YTX A;  4K5W A;  2K28 A;  1F9R A;  3ERS X;  4HJ9 A;  3H0G H;  1N36 Q;  4CHT B;  4BY1 H;  3MEF A;  4GKJ L;  1PTO C;  5DM6 3;  2MNA A;  4JI4 Q;  3M3Y B;  4QL5 A;  5T1G A;  3KK7 A;  4C3H B;  2VQF Q;  2VUM B;  1Y8P B;  2Z8L A;  2XTI A;  3D8G A;  1EYA A;  1O7I A;  1B3A A;  4I7Z C;  1GUT A;  1GUG A;  4ZUJ A;  1Y14 B;  3HOV G;  2NN6 G;  1OXU A;  1GXD C;  1FNW A;  1TS2 A;  1Y1V G;  1II3 A;  4GKJ Q;  2EIF A;  2RCN A;  3RLF A;  1TS4 A;  1SFO H;  4UP7 A;  3K5M A;  1YNN C;  3CQZ H;  3WDN A;  2VNU D;  3NBI A;  3STB D;  4DR3 L;  1I3Q H;  5C0X J;  2JXM B;  5C5M A;  2AUK A;  4NXM Q;  1HNZ L;  4DV5 L;  4LJZ C;  5I9P A;  1V1Q A;  1L1O C;  1GUW A;  4PMW A;  2KA7 A;  5G3L F;  1PRT B;  3S1N B;  1G6Z A;  3SGI A;  2ZM6 Q;  5E1F A;  1RF2 D;  4KKU A;  1I4X A;  1PH8 A;  3HOV H;  2NN6 H;  3U50 C;  4DR3 Q;  3S1Q H;  2Y0S E;  2QKI C;  1Y1V H;  4P2C B;  4KMU C;  3NEL A;  2NZH A;  1HNZ Q;  3A8K E;  1E22 A;  4A3B G;  1IKM A;  4L5R C;  1Y69 U;  4KHZ A;  1Q1E A;  1U9R A;  3VA7 A;  3TN2 A;  3S2D H;  1P16 A;  5BR8 L;  1YJW A;  1VQC A;  4DNI A;  3S1R H;  4OGQ C;  3KDF B;  1XJV A;  2RBM A;  4K6D A;  2VY3 A;  3AB9 A;  4GOP B;  1FVI A;  3A7A B;  2OQK A;  1TY2 A;  1TQO A;  4HIK A;  1E2V A;  2MQH A;  4UHV A;  1L0W A;  1PH9 A;  4CDC C;  2VL6 A;  2B2W C;  2OWO A;  4YCU A;  2HCI A;  1ML0 D;  1TKW B;  3ERO A;  2BA0 A;  1ESF A;  5BR8 Q;  3CCR A;  5IGG A;  4X65 L;  1YBY A;  4OO1 G;  4L6T B;  2JE6 I;  3PIP 3;  3J80 i;  4A3B H;  2F4V L;  4X62 L;  1L1O B;  2JYO A;  1SE2 A;  3MVV A;  4DR5 L;  3OWE B;  1JC7 A;  1KQS A;  1CK1 A;  1NTG A;  3OHX C;  1XYI A;  1BBX C;  2RQX A;  2YTV A;  2FHT A;  5TSS A;  2M00 A;  4KN7 C;  3S17 H;  4X65 Q;  1KDC A;  3HOZ B;  1VF7 A;  2M9V A;  1NY4 A;  4X62 Q;  3ULJ A;  4JI6 Q;  3MXP A;  3P20 A;  3S16 B;  2B29 A;  3BDC A;  3W1B A;  2I0Q A;  1KNA A;  2LMC B;  1WTH A;  4DR4 L;  3TDQ A;  1V1O A;  5CC4 A;  2E2I B;  1Q12 A;  4N9P A;  4IPD A;  4OO1 H;  4LUV A;  3OOC A;  3CCS A;  1BDO A;  3KFU A;  5CV4 A;  2LFN A;  4OIK A;  3H94 A;  1X32 A;  1HR0 W;  2P5Z X;  1FGB D;  2N3S A;  2N55 A;  3EQL C;  5KGU A;  4HN7 A;  5EQ0 A;  1BCP B;  4ZYS A;  1X3G A;  1GJX A;  4IUT A;  1ENC A;  1IBK L;  4FP5 D;  4H02 A;  1JB7 A;  5K5P A;  4L5T A;  1XXG A;  2QEJ C;  1KLU D;  1WOC A;  4WFN 3;  3BYY B;  1J6Q A;  2HQE A;  2JEA I;  4ILW A;  1SYC A;  1X54 A;  3MFG A;  3E5S A;  1F2Y A;  5KNB A;  3Q0A A;  2R92 B;  3KBG A;  1B3Q A;  1I6H H;  3IFD A;  3M4O H;  2MP1 A;  1IYJ B;  4PZ6 A;  4AYB E;  1EWC A;  2OEO A;  3F2D A;  3DWA A;  1QB5 D;  5J39 A;  1VQN A;  1K8G A;  1F2L A;  2OQ0 A;  4A4I A;  2B2Y A;  5JJZ A;  3KF8 A;  1SSO A;  4A75 A;  1HNX Q;  3ZYY X;  5C4H A;  5EBD A;  2R7Z G;  4DV4 L;  2E76 C;  4R4O A;  4ZK9 B;  5C5L A;  3WWV A;  2FFK B;  4IN3 A;  4JBJ A;  4KD4 A;  2ZJP A;  4YWM A;  4ZLT F;  3J80 L;  3P7J A;  5JAV A;  1PZK D;  4LF4 Q;  1TWA B;  1IW7 C;  1H9K A;  4B3M Q;  2VS1 A;  2ZJQ A;  2K04 A;  2Y0S G;  4RWS C;  2N78 A;  3HKZ E;  3L3O C;  4HSP A;  1WD1 A;  2NVQ H;  3HOW B;  1C9O A;  1LT3 D;  4QGU A;  4DV1 L;  3GTO H;  2BDN A;  1PDQ A;  2IWH A;  3KYH C;  4N9T A;  4A3I G;  1WTX A;  1X9N A;  4A3G B;  2CW0 C;  2R7Z H;  1XNQ L;  1XTD A;  3PIO 3;  1Y1W B;  1E1T A;  1HHV A;  5HGT A;  1UE7 A;  3ZJY C;  2IPK D;  1OXT A;  4F88 A;  1PHJ A;  1SYG A;  2K5H A;  4NXN Q;  1O7L A;  2IX3 A;  4IPH A;  2KBN A;  2B63 G;  4MTN A;  1XNQ Q;  1QE6 A;  5KNC A;  1GD7 A;  4OX9 Q;  1D2B A;  4H0L C;  5IIF A;  4IUP A;  5CMD A;  4A3I H;  4J15 A;  1E24 A;  1EIF A;  4OL7 A;  2F0L A;  2F0I A;  5IOD A;  3PO2 G;  1OXS C;  4KHP L;  1B2T A;  4E6I A;  1TWG H;  4XQJ A;  4LF7 L;  3HEJ A;  5M5W B;  5C4X B;  2RDF A;  1E1O A;  4GLV B;  5J1Z A;  2B63 H;  1RTN A;  2ZTC A;  5IGF A;  4EQO A;  1PTO D;  1A62 A;  1KLG D;  1X55 A;  3NWT A;  1SLJ A;  3CP0 A;  2CFM A;  5M5X H;  3O13 A;  3CC7 A;  1WCM G;  1SMX A;  3J81 E;  3W5O A;  1KC8 C;  3RN5 A;  2JA6 G;  2NBF A;  2B3G A;  1ZKO A;  2KHI A;  4CGY B;  4JI1 L;  3H09 A;  5IY0 A;  5IYC G;  3PO2 H;  4BS9 A;  4RGO S;  5COY A;  3LGJ A;  5KEE A;  3U4Z A;  3JAM L;  2EE1 A;  1YNN D;  3NUC A;  3AQQ A;  1VCI A;  4CKE A;  2UUC L;  5A2Q E;  4DV6 L;  2B2U A;  1B4O A;  5IP7 G;  3OW7 A;  1O7Y A;  3GTM H;  1R9T B;  1AW7 A;  1ZYR C;  3TP5 A;  1Q3L A;  4AYB G;  3TQY A;  3G71 A;  1WCM H;  5CGK A;  3H91 A;  3UDG A;  2JA6 H;  2XIW A;  1VQG A;  1Q46 A;  4DV6 Q;  5IYC H;  1A3U A;  4K2L A;  4EQN A;  3GTP H;  1NJI C;  1FJG Q;  3OW2 A;  4DR7 L;  4UDU C;  1E2W A;  1G91 A;  1E0B A;  3MWY W;  3S2H H;  3CPW A;  4RCN A;  4AIM A;  5CV8 A;  2Z6K A;  4OWX B;  5M3M G;  1FNV A;  2F0W A;  2KCC A;  3A8I E;  4LMQ D;  5IP7 H;  2WIN B;  1VQ5 A;  3QWN A;  1JJC B;  4ABN A;  4IPG A;  1JJG A;  2PNR C;  5T1I A;  3SK4 A;  4IUQ A;  1VQL A;  1LLR D;  1Q86 C;  1PYW D;  2KHJ A;  1TT2 A;  3I56 A;  3HKZ G;  3KF8 B;  3PCO B;  1AE2 A;  2RCF A;  2UXC L;  3OIQ A;  2O5I C;  1PH2 A;  1PH1 A;  1EQT A;  4CJ0 B;  1B70 B;  4NDX A;  5M3M H;  3N6R A;  2UXD L;  4MN3 A;  2KCN A;  5GRO A;  5IE8 A;  3VR5 A;  4KKS A;  5JEA J;  2RVL A;  4PMC A;  5IWA L;  1K83 H;  4FXG C;  3J7Y W;  1SE3 A;  3GTJ B;  3GTG H;  4RGT A;  1ET6 A;  4N8X 1;  3JC6 6;  2F0K A;  2Z4H A;  4GZY C;  4LF5 Q;  3OTO L;  3QO2 A;  2WKD A;  4P74 A;  2NVX B;  1PH4 A;  5C6A A;  3DXJ C;  2UXD Q;  2Z4I A;  4HSV A;  2K14 A;  3ER0 A;  5IWA Q;  1O80 A;  4KV6 A;  1PFM A;  4DN4 M;  4I65 A;  4X64 Q;  1BQQ T;  1KDB A;  2RDG A;  4DK1 A;  2OTL A;  2I5H A;  4EGV A;  3M7N A;  1VQ6 A;  2G5D A;  4HED A;  1V8Q A;  4P75 A;  1RDP D;  1VDZ A;  4HJ7 A;  1EIY B;  1CKN B;  4JI7 L;  1S5F D;  3K5N A;  4B3S L;  4X3S A;  2Q2H A;  1I4G A;  4C1N K;  5G3L D;  2Q2I A;  1VQ9 A;  3RD4 A;  4APV A;  1TWC B;  4BBR B;  4P72 A;  3F2U A;  1S5B D;  2BE5 D;  2EY2 A;  4ULL A;  4JI7 Q;  2LXJ A;  2SDF A;  1TWF H;  3BU2 A;  3OPO A;  2F0M A;  4CDD C;  4B3S Q;  5JPM C;  2L55 A;  1DOM A;  1C8C A;  4A3J G;  2CH4 A;  2F0O A;  2R93 G;  1YI2 A;  3U9O A;  1ZXT A;  4C2M H;  2K33 A;  1EL0 A;  4DR2 L;  1XPU A;  4KY6 A;  3QOL A;  1BXT A;  4BBS B;  3IFT A;  3K7A B;  2SOB A;  1M8A A;  1JR0 D;  1EIG A;  4Q5V A;  4R1J A;  3L0O A;  2YU9 H;  4JI0 L;  4JBK A;  3J7A F;  4N8F A;  1B44 D;  1BVS A;  1KD1 C;  1YNX A;  4LAA A;  2L11 A;  4A3L G;  1JMC A;  3CCL A;  1XMQ L;  1HR0 L;  1Q8K A;  2EJM A;  3S14 B;  4A3M B;  1AZQ A;  5AJ3 Q;  2AWO A;  1IYU A;  5FLX L;  1SRO A;  3PGZ A;  5LHY 1;  4QJF A;  3RNU A;  4A3J H;  1JB3 A;  2R93 H;  1N8R C;  4QIW B;  4P73 A;  1H9R A;  1T5X D;  3CU7 A;  4JI0 Q;  3K57 A;  4LF9 L;  4Q0F A;  4A3C G;  2IW3 A;  3D6C A;  3V96 A;  4LF6 L;  3R8B A;  2RHQ B;  3UDF A;  1XMQ Q;  5LMN W;  5DM7 3;  5LMU L;  3G7L A;  1TS3 A;  3AFQ A;  3TZU A;  4XT1 B;  1VQK A;  3LNN A;  4LF9 Q;  2MFI A;  4A3L H;  4NB3 A;  5D65 A;  1L1O A;  3TEH B;  4JI3 L;  2F4I A;  4O42 A;  1UE5 A;  1PYS B;  1MSH A;  2K32 A;  4LF6 Q;  5M3F B;  5DEH A;  3L9A X;  5C4J H;  4DAP A;  1IHZ A;  1GUS A;  2A6E C;  1BO0 A;  5LMU Q;  2F1M A;  4A3C H;  4X3T A;  4NPS A;  4U68 A;  3L7Z C;  1MHW C;  4C3J G;  4JI3 Q;  4S3S A;  2LKV A;  1VS0 A;  2F0E A;  1LAB A;  5ELF A;  4JBW A;  1K3B C;  3BYT B;  2NTT A;  2O2L D;  2E2J B;  2CQA A;  1SR3 A;  2JA5 G;  2FMM A;  4LNQ A;  1C0A A;  5EKK A;  2K4K A;  1IBL Q;  2E2H H;  5M5Y H;  1LT4 D;  1SJH D;  3UI2 A;  3CCQ A;  1Y8N B;  1HZC A;  1FYC A;  2DY8 A;  5IT9 E;  3S15 H;  3D0F A;  5JJK A;  4IUU A;  1B7Y B;  2TMP A;  1YZ6 A;  2QIL A;  4C3J H;  3NHH A;  4HJA A;  4BY7 G;  4MNO A;  1L0X B;  1VQO A;  5LL6 X;  2LY7 A;  2DNC A;  1PH3 A;  1VQD A;  2PZT A;  5I4D A;  2JA5 H;  1YHB A;  3KJP A;  4DV0 L;  1Q1B A;  2PI2 A;  4DV3 L;  2KJX A;  3QB3 A;  4GN4 B;  1EFW A;  4HR7 B;  4RFB A;  1ZYR D;  2K05 A;  1LM0 A;  1SFO B;  3T4A C;  3HFZ B;  1BCP F;  4RG1 A;  1U5K A;  2IHE A;  3K8A A;  3BZD B;  1E3P A;  4F7X A;  2HQL A;  3BZC A;  4P71 A;  3HKS A;  3TRZ A;  2IX0 A;  3I70 A;  3NP8 A;  3L2P A;  2H1E A;  2E5L L;  4BY7 H;  4IZ8 A;  1YVC A;  1I6V C;  3B6Y A;  4LFC L;  1RTO A;  2D9U A;  1I94 L;  1PVO A;  4K5V A;  1EIH A;  5CR3 A;  5EAY A;  3MTS A;  1YJN A;  1F9S A;  4JOI C;  5I6W A;  1BBU A;  5ELN A;  4L63 B;  2NUC A;  3HOY G;  1SNC A;  3DM3 A;  1Y1V B;  2NVY H;  4TVA B;  1VQB A;  4C3H G;  4DAY A;  2J0T D;  4CDE C;  5CV7 A;  3I4M B;  1PZJ D;  4FDB A;  3CAM A;  2DJF C;  1I94 Q;  2E2D C;  1KAA A;  4IO9 A;  5C44 B;  1X3P A;  1MI2 A;  4JV5 L;  4LF8 L;  5IYB G;  2E8G A;  1R4P B;  1YEZ A;  3J80 E;  4HIO A;  2B8G A;  2IL8 A;  1QZH A;  1O78 A;  5KIX A;  2PPB C;  3NEM A;  3I3C A;  2O5J C;  3TS0 A;  2K5D A;  4HMJ A;  1SNO A;  3M3Y H;  1PTO B;  3HOY H;  2JEB I;  5EBC A;  4DV5 Q;  2Z9H A;  4MZ9 A;  4C3H H;  4NKL A;  3HS0 C;  4QUF A;  1CQV A;  3VDY A;  2EYL A;  2C5C A;  2L4N A;  3DEP A;  3SK8 A;  5IYB H;  3DWQ A;  1CTM A;  3MA2 B;  2PCF B;  3G48 A;  5E4X A;  1EEF D;  1MIU A;  4A93 B;  2K5W A;  2PQA A;  1B9N A;  1UEB A;  1A63 A;  2CWA A;  3S1M B;  3A5Z B;  4DFA A;  1OTC A;  5FO7 B;  4UPA A;  5K36 G;  1V9P A;  3A7L A;  4DNR B;  5I6Y A;  2EJF C;  3IAY A;  1ICW A;  3NXW A;  2DUD A;  4A3K B;  1EWH A;  3SXH A;  3A74 A;  3S1N H;  5I2Y A;  1A3V A;  2EDG A;  4JCV E;  1SYB A;  2QEX A;  5C4Z A;  2OCE A;  2CWP A;  4J6H A;  1B1Z A;  2D0O A;  3ND9 A;  1J5E L;  3NTI A;  3C3L A;  3K59 A;  1EY8 A;  4JVZ A;  1A15 A;  1EUJ A;  5DAU A;  1EY7 A;  1EYD A;  5CV5 A;  2V1C C;  5IT9 c;  4JI2 L;  1K0S A;  2F4V Q;  3PO3 B;  3RLN A;  1HQR D;  4B9W A;  3FEW X;  4IFD I;  3TBI B;  5HY6 A;  4DR5 Q;  3T1Y L;  2NVT B;  1SJE D;  2D2C C;  4M8A A;  4LWC A;  3CHB D;  5K36 H;  2N49 A;  1JE5 A;  4KLK A;  3SR1 A;  1LAC A;  2QA4 A;  1CA5 A;  3GTK B;  2YV5 A;  2SEB D;  4ME3 A;  5COR A;  3HOZ G;  1AEX A;  3PV0 A;  3IL8 A;  1VMC A;  4ZKB B;  3T1Y Q;  3I4O A;  1G51 A;  4DR4 Q;  3OMC A;  1EWI A;  5M9O A;  5FJ8 G;  1VQM A;  3RMH A;  3GO5 A;  4KI0 A;  4KK7 A;  4O1N A;  3TP7 A;  5C3X A;  5CYU A;  3HRZ C;  1LUZ A;  3F2B A;  5JPN C;  4B9X A;  1NR2 A;  1HH2 P;  2HT1 A;  1TWH B;  1ESR A;  2MHV A;  3Q24 A;  2EYJ A;  3HOZ H;  1NUC A;  2BE5 C;  2C35 B;  4H7B A;  1MD2 D;  1IBK Q;  3S16 H;  1K9M C;  2PMZ B;  3I4N B;  4G7Z C;  4ZUI A;  5I2X A;  3J7Z C;  2E2I H;  3HOU B;  3QR8 A;  3T51 B;  2NVQ B;  4JPB W;  5FJ8 H;  2R92 G;  5IGB A;  1FGU A;  3GTL B;  3R2I A;  2A68 C;  2F3I A;  3DWP A;  4XYO A;  2FXQ A;  4WRD A;  3G4S A;  3U4V A;  2D62 A;  3CD6 A;  4B3R L;  3BVZ A;  3J80 c;  3A8J E;  2IX1 A;  2K50 A;  4UAI A;  5IOC A;  2A6E D;  1D1K A;  2ZXO A;  1EQR A;  4KY5 A;  3JAM i;  4DAY B;  1M90 C;  4A3F B;  1WJJ A;  5ELC A;  4DV4 Q;  1QNU A;  4POF A;  2V4D A;  5GQO A;  1V43 A;  4PZ8 A;  5FO8 B;  2R7F A;  1WTQ A;  4L8J A;  2JQO A;  1LTL A;  4B3R Q;  2R92 H;  1CSQ A;  3I8Z A;  2OT2 A;  4HJ5 A;  2F52 A;  4DUZ L;  5C3E B;  1VQ7 A;  3CMA A;  3PUX A;  3HZX A;  4LK1 C;  2C9O A;  2HDL A;  3OSO A;  1K8A C;  4JW0 A;  2E75 C;  3FVQ A;  4DV2 L;  3G6J B;  3EIV A;  4JI5 L;  3HOW G;  3K0X A;  3KUP A;  1Q90 A;  4DV1 Q;  2I07 B;  2MPM A;  2AQ3 B;  3RR5 A;  1X6O A;  1BOS A;  2IY5 B;  4JYA L;  2GVA A;  4IFD G;  3DEO A;  4A3G G;  1CM9 A;  2AUJ D;  1SYD A;  3GTQ B;  3FDT A;  1TS5 A;  5GAD C;  2VQE L;  1Y1W G;  3M9B A;  2B63 B;  1CKN A;  1S5E D;  5GAG C;  5NUC A;  4OHJ A;  1UEA B;  3SEB A;  1OXX K;  4DV2 Q;  4JI5 Q;  1STY A;  3OYY A;  1TWA H;  3M4Y A;  3VYT A;  3W3A A;  2XSC A;  3KOJ A;  2PQA B;  1VQI A;  4ID6 A;  3PF4 A;  1ASY A;  3HOW H;  2G9H D;  1U4L A;  2PO4 A;  1WI5 A;  1Z6H A;  2WAQ B;  5DLQ E;  3KLR A;  3P1H A;  3QJY A;  2HHH L;  1W2B A;  3M4P A;  4WJ4 A;  4A3E G;  4IFD H;  3BDO A;  2RHS B;  3T56 B;  4A3G H;  1LO5 D;  4DK3 C;  1HUM A;  2A69 D;  5JVH 3;  1Y1W H;  1Q8I A;  1Q82 C;  4KHP Q;  1QJO A;  4C1N I;  3TP8 A;  3D31 A;  2PW7 A;  4YCW A;  4R4I A;  1STA A;  1PRT D;  1XX8 A;  2SNS A;  2WAC A;  4ALP A;  2HCC A;  4LF7 Q;  2Q8I B;  2HHH Q;  5C4X G;  4K2K A;  2PZW A;  1O7Z A;  1PYB A;  5KND A;  1QZG A;  1ET9 A;  2E74 C;  5DNF A;  4FXK C;  1TXY A;  2QF7 A;  4QF4 A;  1X3Q A;  2OF1 A;  2R7D A;  3GTP B;  4XTC S;  4BXX G;  2I46 A;  4A3E H;  3R3O A;  2JA8 B;  2K01 A;  3BJU A;  2RA4 A;  1NR4 A;  3S2H B;  4JI1 Q;  1F77 A;  1FD7 D;  2EYM A;  2G9D A;  1BBW A;  4ZAI A;  2LS0 1;  4QB4 A;  1Z47 A;  2HIX A;  5D3I B;  4LW1 A;  5C4X H;  4MTK A;  5M5W H;  3Q22 A;  4K6L A;  1CZW A;  2NYZ D;  2UUC Q;  1JOO A;  4ZCK A;  2KUM A;  3GQB A;  4ZKC B;  1JCK B;  5JVG 3;  3BVG A;  3ICE A;  5FLX E;  4NMZ A;  4RGN A;  2A5H A;  4BXX H;  4F87 A;  2XWJ B;  3S24 A;  1S3O A;  1HXY D;  4CJ1 B;  2UUA L;  2EYO A;  1JOR A;  1V1P B;  2ZT9 C;  1QIL A;  3NEN A;  1CKM A;  3E9I A;  2ZTD A;  1STE A;  3NWS A;  2DJG C;  3WOF A;  1NSN S;  3QOJ A;  1I4P A;  4QIW E;  1D5M C;  3GP7 A;  4LUZ A;  5D3D A;  4DR7 Q;  4IPC A;  3J81 i;  2AQ2 B;  1X56 A;  2F3W A;  2PQE A;  1N33 L;  3H3V I;  1R9T H;  1XPR A;  4OON A;  2L5T A;  4K5X A;  2JK8 A;  4X66 L;  2GVB A;  3T53 B;  4CBV A;  1PLF A;  3CRK C;  2L15 A;  1VMP A;  2K75 A;  2BA1 A;  4K8I A;  4DUY L;  1JE4 A;  2AQ1 B;  1GUO A;  1KTK A;  3Q6S A;  3PQI A;  4JI8 L;  2UXC Q;  1SYE A;  1BCP D;  3PMF A;  5KYL A;  4XYQ A;  1A2U A;  1STB A;  1U4R A;  4I7A A;  2XRQ D;  1YJ9 A;  5EPJ A;  2JA7 B;  4Z9C B;  2K7V A;  4V0B A;  4DNT B;  2N8N A;  4A76 A;  3F8T A;  1EY9 A;  1JWS D;  4DUY Q;  1N32 L;  2KCM A;  3M85 A;  2VW9 A;  1SND A;  2FJ2 A;  5E4W C;  4J1M A;  3RZO B;  1PMR A;  2EPB A;  4IJL A;  4HAE A;  2XN9 C;  2ENB A;  2L12 A;  2KEE A;  1HTL D;  1KAW A;  4GNX C;  3OTO Q;  3ULL A;  1UE1 A;  1HCZ A;  4IAL A;  4M1U B;  3S9W A;  2F0N A;  1SE8 A;  1H9M A;  2B2V C;  2F03 A;  4CJ2 C;  1EFI D;  2EXD A;  3J7A V;  1WD0 A;  4WJ3 M;  1WTO A;  2NTS A;  1QG7 A;  2K5N A;  1CFM A;  1VQ4 A;  3HOX B;  1MJC A;  2Q8T A;  1HPC A;  1C48 A;  3GTJ H;  5FLM G;  2VZA A;  3I73 A;  2WB1 B;  5LL6 S;  2NVX H;  1HFG A;  1K0R A;  3K5O A;  4BBR G;  1BR9 A;  2A68 D;  3J81 L;  1XPO A;  2R93 B;  4KTA A;  4MIU A;  1LT5 D;  2ID0 A;  3CF5 A;  1QVG A;  3A55 A;  3GD7 A;  2Q2T A;  3MC0 B;  1WTV A;  4F8M A;  3R93 A;  1W6J A;  1QNK A;  3J7A 5;  3H6M A;  2DY7 A;  1VQJ A;  4DR2 Q;  1EU3 A;  4G4K A;  2PYK A;  3VA5 A;  5FLM H;  4BBS G;  5FLX c;  4AQY L;  2WFW A;  3E0J A;  3I4L A;  1XWE A;  1SBB B;  4EX5 A;  1A2T A;  4R4T A;  1TWC H;  1JIC A;  4JOI A;  4BBR H;  3CXC A;  4FXD A;  2JSO A;  4A3D B;  2UXB L;  4XDX A;  4KJO A;  1K8O A;  2XWB B;  1CI3 M;  1D1I A;  4Y7N B;  1PRT F;  3HGB A;  4IUN A;  4C56 C;  2J7Z A;  1HR0 Q;  3MXN A;  5GAE C;  4A3M G;  4C3I B;  1YIJ A;  1E7Z A;  3D3R A;  2F0V A;  2ES2 A;  1STH A;  1EQQ A;  4AQY Q;  1I50 B;  5J3B A;  1B8A A;  3FKI B;  1ENF A;  1YHA A;  1HA6 A;  4K0K L;  2UXB Q;  2F3V A;  4QUC A;  5FKA C;  4DPG A;  2Q2U A;  1B9M A;  3H3V H;  4BBS H;  3K7A H;  1SAP A;  2ZTE A;  2ATW A;  1F9P A;  1HZ9 A;  1STN A;  4PMB A;  1BNZ A;  1X3E A;  2GA4 B;  4PG3 A;  3CCU A;  4K0K Q;  3S14 H;  4A3M H;  2J4X A;  2PNH A;  2RDH A;  5M3F G;  1SE4 A;  4R8I A;  4DF7 A;  4C3J B;  1EOV A;  3SVM A;  2EYP A;  2JJQ A;  1Z9F A;  2BH2 A;  1HJP A;  1P8L A;  1VQE A;  4JK1 C;  4G7O C;  4X3K A;  2B2W A;  5EKL A;  4GKK L;  2WII B;  3SDZ A;  4DKA C;  5H1S E;  3E9H A;  3RZD H;  4LFA L;  3H0G B;  4KHV A;  1GM5 A;  4BY1 B;  1HNW L;  1LYL A;  5M3F H;  1KDA A;  1SMY D;  1R4Q B;  1PXU A;  4PQX A;  2H5X A;  1H95 A;  1GVP A;  1Z7T A;  5JOB A;  2B39 A;  3ONA B;  1Q7Y C;  4B3T L;  4LFA Q;  2QDB A;  2VB3 X;  1BKB A;  2A19 A;  2KQ3 A;  2DN8 A;  2NVY B;  5EPK A;  3VYU A;  4AH6 A;  4OO1 I;  5JJI A;  1KNE A;  3CQZ B;  1M4V A; 
#chains in the Genus database with same CATH homology
 3W5O A;  5FJ8 G;  2E2J H;  3CC4 A;  3TRE A;  1VQM A;  3GO5 A;  4KI0 A;  3RN5 A;  1KC8 C;  1N36 L;  4WJ4 A;  2JA6 G;  1CUK A;  2B3G A;  3J81 c;  2KHI A;  1N34 Q;  1MKH A;  4JI1 L;  2WP8 J;  5IY0 A;  4JI4 L;  4B3T Q;  4UP9 A;  5IYC G;  4DV0 Q;  3PO2 H;  3HOX G;  4L5Q A;  1WYD A;  1QUQ B;  2VQF L;  4DV3 Q;  3RLO A;  1LUZ A;  3RZO H;  5JJL A;  3F2B A;  3LGJ A;  1HH2 P;  2HT1 A;  3U4Z A;  2WB1 G;  3AQQ A;  1VCI A;  4OWT B;  5C0X I;  3RN2 A;  2CCZ A;  2UUC L;  2MO1 A;  4DV6 L;  4R4Q A;  4GNX B;  4GLX A;  3HOZ H;  5IP7 G;  2C35 B;  1IBK Q;  2E5L Q;  2RF4 A;  1GO3 E;  1DGS A;  2VUM G;  3GTM H;  1KRT A;  3S16 H;  1MJE A;  3Q8D A;  1K9M C;  4QQB X;  4LFC Q;  3G6E A;  3A0J A;  4AYB G;  1WFQ A;  3TQY A;  2AMC B;  5AJ3 L;  3G71 A;  1WCM H;  3J7Z C;  2E2I H;  2PI2 E;  5FJ8 H;  2Z6K C;  1PH5 A;  2R92 G;  3UDG A;  1FGU A;  2ZJR A;  4NXM L;  2JA6 H;  1VQG A;  1Q46 A;  5JEA G;  4GOP C;  2F3I A;  1PFS A;  4DV6 Q;  2PMZ E;  5IYC H;  1KL9 A;  3HOX H;  2FXQ A;  3G4S A;  2NZO A;  4JG2 A;  1XNR L;  1KHI A;  3GTP H;  3U4V A;  3I4M G;  1NJI C;  1FJG Q;  2D62 A;  3OW2 A;  3CD6 A;  4DR7 L;  4B3R L;  3J80 c;  1EYG A;  4YCV A;  2ZM6 L;  2JA9 A;  5C44 G;  1W3S A;  3S2H H;  3CPW A;  2IX1 A;  2K50 A;  4OWX B;  2Z6K A;  4AIM A;  4LF8 Q;  3KDF A;  4JV5 Q;  5M3M G;  4A3D G;  1EQR A;  5IP7 H;  2IHF A;  3JAM i;  1VQ5 A;  1JJC B;  4GOP A;  4DAY B;  4IPG A;  3DLL A;  1M90 C;  2VUM H;  1JJG A;  1WJJ A;  1HZA A;  1VQH A;  5ELO A;  4DV4 Q;  1VQL A;  4POF A;  5GQO A;  2NN6 I;  1V43 A;  1Q81 C;  1XNR Q;  1Q86 C;  4PZ8 A;  4OXP A;  2R7F A;  1XMO L;  2JQO A;  2KHJ A;  1S40 A;  1LTL A;  4B3R Q;  2R92 H;  1AE3 A;  1CSQ A;  3AEV A;  1NMF A;  3I56 A;  3HKZ G;  1NBW A;  1KRS A;  3FKI G;  3CPF A;  2F52 A;  3KF8 B;  4DUZ L;  3PCO B;  4HJ5 A;  1AE2 A;  4POG A;  3PUW A;  1VQ7 A;  2UXC L;  1FL0 A;  3CMA A;  5GAH C;  3PUX A;  2K5V A;  3MXN B;  3CCV A;  1PH2 A;  1K8A C;  3I4M H;  1KXL A;  1L2F A;  1VQF A;  2R6G A;  3HOW G;  4DV2 L;  4JI5 L;  3EIV A;  3K0X A;  1PH1 A;  4HIM A;  5C44 H;  4IOA A;  1XMO Q;  4DV1 Q;  3W1G A;  1B70 B;  3UDI A;  3RR5 A;  1X6O A;  5M3M H;  3KF6 A;  1QVC A;  4A3D H;  4JYA L;  2IY5 B;  2GVA A;  4IFD G;  5IP9 G;  4A3G G;  4A93 G;  4Y7N H;  2A8V A;  2UXD L;  5GAD C;  2VQE L;  1Y1W G;  3M9B A;  4BA2 I;  5IE8 A;  5GRO A;  4C3I H;  3AYH B;  1CKN A;  5GAG C;  5JEA J;  3PF5 A;  1A0I A;  1IBL L;  3TS2 A;  5IWA L;  1K83 H;  1OXX K;  4DV2 Q;  4JI5 Q;  4O0A A;  1I50 H;  3GTG H;  2IT1 A;  1CSP A;  3OYY A;  1TWA H;  3FKI H;  3JC6 6;  4RMF A;  4X6A H;  3A5U A;  3KLW A;  4LF5 Q;  3KOJ A;  1NMG A;  3OTO L;  2PQA B;  1VQI A;  4P74 A;  1PH4 A;  4IOC A;  4A3K G;  3PF4 A;  2YTY A;  1ASY A;  3HOW H;  2UXD Q;  4JI6 L;  1WI5 A;  2K14 A;  3ER0 A;  3U58 A;  4YY3 L;  4UP8 A;  5DLQ E;  5IWA Q;  2K52 A;  5IYD G;  2HHH L;  1W2B A;  1X3F A;  3M4P A;  2KCT A;  4GKK Q;  3PUV A;  4GN3 B;  4A3E G;  3BZK A;  5IP9 H;  1VQP A;  2RHS B;  4X64 Q;  1J5E Q;  4A93 H;  4A3G H;  4DK3 C;  2OTL A;  2I5H A;  3H0G G;  1M1K C;  1T9H A;  3M7N A;  4BY1 G;  4UY8 C;  2LSS A;  2WAQ E;  1Y1W H;  1VQ6 A;  1Q82 C;  4P75 A;  3PO3 G;  4JI2 Q;  4HJ7 A;  4LFB L;  1HNW Q;  1N9W A;  1CKN B;  1EIY B;  5C0X G;  4JI7 L;  4KHP Q;  4B3S L;  3S1M H;  2Q2H A;  3H15 A;  3D31 A;  4JC0 A;  2I5L X;  4BA1 I;  3CC2 A;  4YY3 Q;  4YCW A;  1A8V A;  4R4I A;  4ALP A;  1IBM L;  2Q2I A;  4LF7 Q;  2HHH Q;  1VQ9 A;  2ASB A;  5C4X G;  4APV A;  2AKW B;  4TQU S;  3I55 A;  4QY7 A;  1UWV A;  4DAM A;  2I5M X;  4A3K H;  1PYB A;  4HJ8 A;  1QZG A;  4P72 A;  4IFD J;  4LFB Q;  1RL2 A;  2LXK A;  4JI7 Q;  2LXJ A;  1IL2 A;  1TWF H;  1TXY A;  3BU2 A;  4B3S Q;  2R7D A;  4XTC S;  5IYD H;  4BXX G;  3F2C A;  4A3E H;  2YTX A;  4A3J G;  3ERS X;  4HJ9 A;  1QVF A;  2R93 G;  1RIP A;  3H0G H;  1IBM Q;  3BJU A;  1YI2 A;  1N36 Q;  4BY1 H;  3MEF A;  1PH6 A;  4GKJ L;  2KEN A;  4JI1 Q;  2MNA A;  3PO3 H;  4JI4 Q;  4C2M H;  4QL5 A;  4DR6 L;  1BBW A;  1GKH A;  2VQF Q;  4DR2 L;  1UE6 A;  1XPU A;  2NVT H;  1Z47 A;  2XTI A;  2HIX A;  3T1H L;  1O7I A;  4LW1 A;  4R1J A;  1Y14 B;  3L0O A;  5C4X H;  5M5W H;  2YU9 H;  4JI0 L;  4JBK A;  3HOV G;  2NN6 G;  3GTK H;  1OXU A;  1BVS A;  1KD1 C;  2UUC Q;  1YNX A;  1VQA A;  1HNX L;  1Y1V G;  4GKJ Q;  2EIF A;  4A3L G;  2RCN A;  3RLF A;  1JMC A;  1XMQ L;  1HR0 L;  3CCL A;  1Q8K A;  4DR6 Q;  1SFO H;  4UP7 A;  3ICE A;  3I4N G;  5AJ3 Q;  2AWO A;  3HOU G;  3CQZ H;  4BXX H;  2VNU D;  1SRO A;  3STB D;  4DR3 L;  2BH8 A;  3PGZ A;  4QJF A;  3S24 A;  1S3O A;  1I3Q H;  5C0X J;  3RNU A;  3T1H Q;  4A3J H;  1YHQ A;  1N8R C;  2UUA L;  4LF4 L;  2R93 H;  4P73 A;  4NXM Q;  4LF9 L;  4JI0 Q;  4B3M L;  3I7F A;  1HNZ L;  3K80 C;  1KIX A;  4A3C G;  4DV5 L;  3NEN A;  1CKM A;  3E9I A;  1G6P A;  2ZTD A;  1V1Q A;  1L1O C;  3M4Q A;  4PMW A;  4LF6 L;  2RHQ B;  3EN2 A;  4QIW E;  4R4C A;  1TWH H;  4LUZ A;  4YWL A;  3UDF A;  1XMQ Q;  4DR7 Q;  4IPC A;  3J81 i;  5LMN W;  3SGI A;  2ZM6 Q;  1C7Y A;  1SRU A;  5LMU L;  1X56 A;  1PH8 A;  3HOV H;  3U50 C;  4DR3 Q;  1N33 L;  3S1Q H;  3AFQ A;  4PZ7 A;  2Y0S E;  1VQK A;  1Y1V H;  3H3V I;  3NEL A;  4LF9 Q;  2MFI A;  2NZH A;  4A3F G;  1R9T H;  1XPR A;  1HNZ Q;  4OON A;  4A3L H;  1E22 A;  2JK8 A;  4X66 L;  4NB3 A;  3TEH B;  1L1O A;  4A3B G;  2OTJ A;  4JI3 L;  2GVB A;  4L5R C;  1UE5 A;  1PYS B;  3I4N H;  4KHZ A;  4LF6 Q;  1Q1E A;  3HOU H;  4GS3 A;  3S2D H;  1P16 A;  5BR8 L;  5C4J H;  1YJW A;  1VQC A;  4DNI A;  3GTL H;  2L15 A;  2MO0 A;  3S1R H;  3KDF B;  1XJV A;  2K75 A;  5LMU Q;  2BA1 A;  2VY3 A;  5C3E G;  4NXN L;  4DUY L;  1FVI A;  4DUZ Q;  4GOP B;  3ULP A;  3CCJ A;  4A3C H;  2OQK A;  4JI8 L;  2UXC Q;  5HGQ A;  4HIK A;  4HID A;  2MQH A;  4NPS A;  5LMN L;  1L0W A;  1PH9 A;  2VL6 A;  3L7Z C;  1PH7 A;  2OWO A;  4YCU A;  1YJ9 A;  4L5S A;  4JI3 Q;  4OX9 L;  1VS0 A;  2BA0 A;  3CW2 C;  5BR8 Q;  3CCR A;  2NVX H;  2N8N A;  4JBW A;  4A76 A;  4DR1 L;  4X65 L;  3F8T A;  4JYA Q;  1YBY A;  4OO1 G;  2JE6 I;  4A3F H;  1SR3 A;  4DUY Q;  3J80 i;  2JA5 G;  1N32 L;  2KCM A;  3M85 A;  4LNQ A;  4A3B H;  1C0A A;  2F4V L;  1IXR A;  4X62 L;  2VW9 A;  2VQE Q;  1L1O B;  5LMN Q;  1G29 1;  4GN5 A;  4DR5 L;  1S72 A;  2K4K A;  1IBL Q;  1D8L A;  2E2H H;  1KQS A;  5M5Y H;  4IJL A;  1AH9 A;  1NTG A;  3KF6 B;  3UDX A;  2YTV A;  5C3E H;  3CCQ A;  2AHO B;  2UU9 L;  3S17 H;  1KAW A;  1NE3 A;  4X65 Q;  1HZC A;  4GNX C;  3OTO Q;  4DR1 Q;  3J81 j;  3S15 H;  3ULL A;  1UE1 A;  3D0F A;  3KJO A;  5JJK A;  1B7Y B;  1YZ6 A;  4C3J H;  4HJA A;  1NY4 A;  4X62 Q;  3ULJ A;  4MNO A;  4JI6 Q;  4BY7 G;  1QUQ A;  4JBM A;  4XIG S;  2WAQ G;  1VQO A;  2B29 A;  1CKO A;  3W1B A;  1SE8 A;  2I0Q A;  4DR4 L;  1Q12 A;  2EXD A;  1PH3 A;  1PV4 A;  4IPD A;  1VQD A;  4LUV A;  4WJ3 M;  2JA5 H;  3GTQ H;  2UU9 Q;  1YHB A;  2K5N A;  3KJP A;  1HZB A;  4DV0 L;  4GNX A;  1Q1B A;  2PI2 A;  4DV3 L;  1VQ4 A;  1MJC A;  3CCS A;  4GN4 B;  1EFW A;  3KFU A;  3JAM c;  3GTJ H;  4OWW B;  1U0L A;  3UE0 A;  1HR0 W;  1LM0 A;  2N3S A;  5FLM G;  2YYZ A;  2VZA A;  2XGT A;  2D0P A;  3HFZ B;  4RG1 A;  1U5K A;  2IHE A;  3K8A A;  1E3P A;  2HQL A;  3BZC A;  3UE1 A;  3PIP A;  4P71 A;  1X3G A;  3HKS A;  1K0R A;  1XPO A;  2CQO A;  2IX0 A;  4BBR G;  3L2P A;  4H02 A;  3FHW A;  1JB7 A;  1IBK L;  2E5L L;  3TRZ A;  4L5T A;  4BY7 H;  1WOC A;  1YVC A;  2WB1 E;  2ID0 A;  3B6Y A;  4LFC L;  1J6Q A;  3CF5 A;  1QVG A;  1I94 L;  3I2Z A;  1X54 A;  2JEA I;  1K73 C;  3GD7 A;  5EAY A;  2Q2T A;  1PVO A;  1PA6 A;  1YJN A;  4JOI C;  1BBU A;  2JA8 G;  1I6H H;  3CCE A;  5ELN A;  3M4O H;  3J7A 5;  4IJH A;  3HOY G;  1IYJ B;  4PZ6 A;  4AYB E;  3FP9 A;  3DM3 A;  2NVY H;  4TVA B;  1VQB A;  3AFP A;  3F2D A;  4DR2 Q;  1VQJ A;  1ASZ A;  1FJG L;  4FDB A;  1VQN A;  5FLM H;  3CAM A;  4BBS G;  5FLX c;  4AQY L;  1I94 Q;  2A1A A;  2WFW A;  4IO9 A;  2UUB L;  1YIT A;  1K8G A;  4EX5 A;  4LF8 L;  5IYB G;  4JV5 L;  4R4T A;  1TWC H;  2OQ0 A;  3EBE A;  4JOI A;  4A4I A;  4BBR H;  3CXC A;  1I5F A;  2UXB L;  2E8G A;  4A75 A;  1HNX Q;  1YEZ A;  2R7Z G;  4DV4 L;  4R4O A;  1HR0 Q;  3WWV A;  5GAE C;  3K7U C;  4JBJ A;  4HIO A;  4A3M G;  2ZJP A;  4YWM A;  1YIJ A;  3CME A;  1QZH A;  1D7Q A;  1E7Z A;  2ES2 A;  3NEM A;  1EQQ A;  3F1Z A;  3K81 C;  4AQY Q;  2JA8 H;  3TS0 A;  2UUB Q;  4LF4 Q;  5J3B A;  2UUA Q;  1B8A A;  1JJ2 A;  4B3M Q;  3HOY H;  3M3Y H;  2JEB I;  1YHA A;  3CCM A;  4K0K L;  2UXB Q;  2VS1 A;  4DV5 Q;  4MZ9 A;  4C3H H;  2ZJQ A;  4DPG A;  2Q2U A;  2Y0S G;  2EQS A;  2N78 A;  3E0E A;  3HKZ E;  3H3V H;  2NVQ H;  4BBS H;  3VDY A;  3K7A H;  3STB C;  2ZTE A;  2ATW A;  1C9O A;  4QGU A;  3PUY A;  4DV1 L;  1X65 A;  3GTO H;  1HZ9 A;  5IYB H;  4DK6 C;  1X3E A;  1N33 Q;  1OXV A;  4PG3 A;  3G48 A;  3CCU A;  3KYH C;  4A3I G;  1X9N A;  1MIU A;  2QGQ A;  2R7Z H;  1SN8 A;  1XNQ L;  4EQ5 A;  2PQA A;  4K0K Q;  1XTD A;  1UEB A;  4X66 Q;  3S14 H;  1E1T A;  4A3M H;  1A63 A;  1IZ6 A;  2PNH A;  5M3F G;  1K3R A;  2CWA A;  3A5Z B;  1EOV A;  1OTC A;  2JJQ A;  1Z9F A;  2BH2 A;  4UPA A;  1UE7 A;  3ZJY C;  1PHJ A;  1HJP A;  1OXT A;  1P8L A;  1VQE A;  4LF5 L;  5K36 G;  1V9P A;  2K5H A;  4NXN Q;  4JI8 Q;  4GLA C;  2DGY A;  2CKZ B;  3PSI A;  4IPH A;  2KBN A;  4LUO A;  2B63 G;  4MTN A;  2DUD A;  1XNQ Q;  3A74 A;  3S1N H;  4YHH L;  2JA7 G;  4JCV E;  2QEX A;  1GD7 A;  2OCE A;  3GDE A;  4OX9 Q;  4GKK L;  2CWP A;  4A3I H;  2D0O A;  4J15 A;  4X64 L;  1E24 A;  1J5E L;  4DKA C;  5H1S E;  3E9H A;  3RZD H;  4LFA L;  4Y52 H;  1EIF A;  4DV7 L;  1EUJ A;  1GM5 A;  1N32 Q;  2V1C C;  3NBH B;  5E7N A;  2Z0S A;  5IT9 c;  4JI2 L;  2F4V Q;  1HNW L;  3RLN A;  4KHP L;  3PO2 G;  1OXS C;  1LYL A;  5M3F H;  4O2D A;  4IFD I;  1JT8 A;  5HY6 A;  4DR5 Q;  3T1Y L;  4YHH Q;  1TWG H;  2H5X A;  2HIV A;  1H95 A;  1GVP A;  4LWC A;  2ALY B;  3IRB A;  4LF7 L;  2N49 A;  1JE5 A;  4KLK A;  1N34 L;  2GN5 A;  4YWK A;  2QA4 A;  1E1O A;  2YV5 A;  4GLV B;  1Q7Y C;  4B3T L;  4LFA Q;  2B63 H;  2ZTC A;  4ME3 A;  1BKB A;  4DV7 Q;  3HOZ G;  1A62 A;  3PIO A;  2A19 A;  3PUZ A;  3PV0 A;  2JA7 H;  1X55 A;  1SLJ A;  3CP0 A;  2CFM A;  5M5X H;  1VQ8 A;  4AH6 A;  2AWN A;  3T1Y Q;  3I4O A;  4OO1 I;  5JJI A;  1G51 A;  3CC7 A;  1WCM G;  4DR4 Q;  1SMX A;  1EWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...