4OWXB

Structural basis of soss1 in complex with a 12nt ssdna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
TFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*TP*TP*TP*TP*TP*TP*TP*TP*T)-3')
publication title Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 27
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4owxB00
1SN8A 2JK8A 5FLMH 2MQHA 1VQ6A 1Q81C 3H0GH 1G291 3CW2C 1PH5A 4OO1I 1TWCH 5IYDG 1LUZA 1EFWA 2F4VQ 1PH3A 2A1AA 2ZJRA 3GTLH 4IFDI 2QEXA 2IT1A 3EBEA 1Y1WH 2Z0SA 3J80c 4A3KH 2OWOA 3TQYA 1X6OA 1IYJB 1NMFA 4BBSG 5JJLA 1S72A 1IBLL 1LTLA 4LFAL 1VQNA 2JEAI 1C9OA 4JI1Q 3RZDH 4B3SQ 3I4NG 1I6HH 4KHPQ 1E1OA 5IWAQ 4UPAA 3GTMH 4JI5Q 2CWAA 1EQRA 4BA1I 5GROA 3KJPA 3M4QA 3CCUA 2JA6H 1B70B 3F1ZA 1VQHA 3PIPA 3GTJH 2JA5H 4DR6L 4OONA 1HNZQ 1UE7A 3CCQA 1BBWA 3H3VH 2LXKA 4GOPC 1K3RA 3HOXG 4A3CG 1NBWA 1GO3E 3L0OA 3S17H 1C0AA 2XTIA 3RLOA 3K81C 4AQYL 4JYAQ 1R9TH 2R93H 2I5LX 1E24A 4LF5L 2VQEL 1TWAH 3FKIH 1O7IA 2F52A 5C0XG 3I56A 5IP9G 1K83H 3J81c 2YU9H 1CSPA 4LWCA 1Q46A 3NBHB 1A62A 2IX0A 4AIMA 1N36Q 4A76A 2OQKA 4BBRG 4QJFA 4LF8L 4JI7L 1E22A 2V1CC 3KDFB 4GN4B 1NTGA 3TRZA 4DR3Q 2Z6KC 1YHQA 1U0LA 5BR8Q 1EIYB 3HOVH 1PV4A 3GTKH 4R4IA 5C4XG 1TWFH 4DR1L 4DUYQ 2R7ZH 4DV2Q 4HJ5A 1JB7A 4IFDJ 1VQMA 2PI2A 5HY6A 2LXJA 4P74A 3EN2A 1PH2A 5FJ8G 2ZM6L 5GAHC 2ES2A 2E2HH 1EUJA 2QGQA 1QUQB 3T1YQ 1VQFA 2EIFA 3J80i 4JI6L 4P71A 5M3MH 2F4VL 4GKJL 1OXUA 1PH9A 3UDGA 3S2HH 4JI2Q 3D31A 1OXTA 5M5WH 4A3IG 3ULLA 1B7YB 1PH7A 2Q2UA 3CC2A 1KIXA 4DR4Q 1WI5A 2RF4A 1E3PA 2MO1A 2B3GA 5H1SE 1XPOA 5C3EG 2RHSB 4OWXB 5IYBH 1DGSA 2A19A 1Q8KA 4A3GH 4X6AH 3CPWA 2GVBA 2VUMG 1TWHH 4KHPL 1VQBA 1LM0A 4R4TA 5IWAL 4JI5L 1NJIC 2NVTH 2VQFL 3HFZB 4HJAA 4AH6A 3CMAA 5IYCH 1HNZL 4BXXG 2PNHA 4O0AA 1HNXL 4JBWA 1QZHA 4A3LH 5JJIA 3HKZG 4UP7A 3J7ZC 2UUBQ 4NXMQ 1HH2P 3KDFA 3W5OA 4GNXB 1X65A 4DPGA 4JYAL 2AHOB 1CSQA 3NEMA 4YCWA 4LF7L 1FVIA 1Y1WG 1ASYA 2VZAA 2VQEQ 4GN3B 2FXQA 4KI0A 4PZ6A 4GOPA 4OWTB 2JA7G 1E7ZA 1RL2A 1X9NA 2A8VA 2I5HA 1GVPA 2AMCB 1N36L 1VQEA 3A0JA 4A3DH 2HHHQ 3J81j 4OXPA 1LYLA 4R4QA 1X54A 2YTYA 4LF8Q 2YV5A 3Q8DA 4L5RC 4DR3L 3T1HQ 1V1QA 4IJHA 1PH4A 4JI7Q 1VQAA 3KJOA 1U5KA 3RZOH 2N78A 5BR8L 1KC8C 3HOUH 1IZ6A 4YCVA 2NN6G 4BY1H 3I4MH 4DUZQ 4DV3Q 4C3HH 4A3JH 2KHJA 4TVAB 4PG3A 4DV2L 2IX1A 3AYHB 1FJGQ 2GN5A 1KXLA 4BY7G 4WJ3M 2K5HA 2Z6KA 3GTOH 1TXYA 1BKBA 1HZAA 1P8LA 3UE0A 3DLLA 1AH9A 5C4JH 4H02A 1L1OB 4HIKA 3T1YL 2OCEA 3U4VA 4B3RQ 1MJCA 1WJJA 3HOWG 1YHAA 1VQ4A 4LUOA 4A3FG 4JI6Q 4JI2L 4A93G 1IBKQ 1Z9FA 1PYBA 4DV1Q 1K9MC 3GTQH 1V43A 2JQOA 2PMZE 3PUWA 4DR4L 4POFA 3M85A 2VS1A 3RN2A 4PMWA 2R92H 1UWVA 2JJQA 4JI3Q 3M4PA 2VY3A 5JEAG 4B3MQ 2CWPA 4LNQA 4GNXA 4DV0Q 1AE2A 3CQZH 4JI4Q 4NB3A 4DK3C 1WCMH 3S2DH 3ULPA 4IFDG 2JA8H 5IP7G 3CMEA 1QVFA 5C44G 3BJUA 3ERSX 2VQFQ 4JI8Q 2WFWA 3KLWA 1XNQQ 3M3YH 1KQSA 3HOZG 3PO3G 2DUDA 4J15A 4X62L 1JJCB 2C35B 2AWOA 4A3MH 1HNXQ 5AJ3Q 2K75A 2UUBL 4NXML 3S1MH 4JBJA 3S24A 1SRUA 4HIDA 2D0PA 3VDYA 1PH8A 1EIFA 1HZBA 2WAQE 3S14H 1X56A 1X3FA 1YIJA 3PUZA 4X65Q 3LGJA 4LF7Q 3HOYH 4DR2Q 1QVGA 1EWIA 3S16H 1T9HA 3F8TA 3KF8B 3FHWA 3L7ZC 3UDFA 4YY3Q 3S1RH 1HR0W 5GQOA 2HHHL 2E5LQ 4DR5Q 3B6YA 2F3IA 1VQDA 2JA9A 2ZTEA 2K4KA 1Q1EA 1J6QA 1CKNB 3KF6A 3PCOB 3PSIA 1KL9A 3UDXA 3T1HL 2VL6A 1M90C 2ID0A 1V9PA 3PO2G 4DUZL 3OTOQ 3F2CA 4DV3L 1K8AC 1UE5A 3CPFA 2KCMA 3U58A 3CCVA 3CC7A 4A3BH 3D0FA 2NVXH 1FJGL 2ATWA 5J3BA 3I2ZA 4POGA 3PUYA 3K80C 3ICEA 5K36G 4LFBQ 4OWWB 1Z47A 4JCVE 1Y14B 1GM5A 2JE6I 2YTVA 1VQ7A 4GS3A 1VQKA 2PQAB 3CC4A 1UEBA 4B3RL 2R7DA 3UE1A 1MIUA 5IYDH 4GNXC 3OYYA 3GTGH 3A5ZB 1IBKL 1VQJA 2BA0A 3CCMA 4DV1L 4JV5Q 3FP9A 1N32Q 3EIVA 2VNUD 3RNUA 3PF4A 1YNXA 1WYDA 4BBSH 1FGUA 2NZOA 4JI3L 4IPGA 2XGTA 1VQ9A 2ZJPA 4B3ML 3U4ZA 4DV0L 4LW1A 3SGIA 3GD7A 4A3EG 4JI4L 3I4NH 1HNWL 1VQIA 3W1GA 2KENA 4R1JA 1A0IA 4O2DA 2Q2HA 1SROA 2EQSA 3S1QH 1HR0Q 4JI8L 3PGZA 2HIXA 2IHFA 1XNQL 3PUXA 5E7NA 4LFCL 4X66Q 5FLMG 2AKWB 5AJ3L 2K5VA 4A3CH 4X62Q 3E9HA 3H0GG 1XMQQ 4Y7NH 1CKNA 1L2FA 2OQ0A 2AWNA 2KBNA 1YZ6A 3UDIA 2IY5B 1JMCA 4X65L 3I55A 1EYGA 4YHHQ 4DR2L 1UE1A 4A3KG 1YVCA 2R92G 5JJKA 5IP9H 1I50H 3I4OA 4C3IH 3S1NH 3WWVA 1L1OC 4HJ8A 2YTXA 1E1TA 1IBMQ 4YY3L 1X3EA 4YWKA 4HIMA 4DNIA 2CQOA 3K7AH 4BBRH 2E5LL 4DR5L 4JBMA 2QA4A 2UU9L 3STBC 1KAWA 2WP8J 4OX9Q 1PVOA 1VQCA 2OTLA 1ASZA 2E2IH 2JA6G 2MFIA 4UP8A 2JA5G 2PQAA 3G4SA 1SE8A 4DV6Q 1QUQA 3E9IA 3OTOL 2UUAL 1CUKA 3ZJYC 1NY4A 2ALYB 5GAEC 2NZHA 5ELOA 3TS0A 1P16A 1XPRA 2R93G 3KOJA 1RIPA 4LF9L 3CP0A 4L5TA 4OO1G 2NVYH 5M3FH 2D0OA 3CAMA 3PIOA 5FJ8H 4LFBL 1K73C 2IHEA 3FKIG 2WAQG 1KD1C 4NXNL 4EX5A 2ZTCA 2CKZB 3U50C 2JEBI 4R4CA 1TWGH 4RG1A 4A75A 1VS0A 2WB1E 4GLAC 3W1BA 4A3IH 4JV5L 3RR5A 1N32L 3RLNA 1WFQA 3I7FA 3NELA 4K0KL 1IXRA 2K50A 2BA1A 1YI2A 4DAYB 1QVCA 3HOVG 5C3EH 4JOIC 2K14A 4XIGS 3G48A 3CCJA 1J5EQ 4YWMA 4DV7Q 1KHIA 2UUCL 2VUMH 4AYBE 4DV5Q 1HNWQ 1N33Q 2B29A 1YITA 2R7ZG 3RLFA 4GKKQ 4HIOA 1HR0L 1N34Q 2MO0A 3K8AA 4BXXH 3KYHC 3CD6A 1HZ9A 4IOCA 4X66L 4DKAC 1OXVA 4LFCQ 1XMQL 1I5FA 3TEHB 4MTNA 3H15A 1I94Q 5M3MG 2HQLA 4FDBA 1GD7A 4NPSA 1SFOH 4KLKA 4ME3A 3F2DA 5LMNQ 3PV0A 2N8NA 2UXCL 4PZ8A 4YHHL 1JJGA 1JT8A 3JC66 1EOVA 4QIWE 2JA7H 4DR6Q 4P75A 5ELNA 1IBML 4A4IA 5IYBG 1GKHA 1YJNA 1SMXA 2UXBL 4A3GG 1G51A 2Q2IA 3TREA 2E8GA 1SR3A 3CXCA 1PHJA 3AFQA 2UU9Q 4OX9L 3GTPH 1YHBA 1YJ9A 2NVQH 4C2MH 5DLQE 1PA6A 5IT9c 2Y0SE 1Y1VH 1N9WA 3ER0A 5IYCG 5C0XI 4DV4Q 1L1OA 1SLJA 4GN5A 4DV6L 1JJ2A 2GVAA 2UUAQ 4JI0Q 1XPUA 4A3LG 2R7FA 1MJEA 3MXNB 2UXDQ 5IE8A 4DR7Q 1VQGA 2KCTA 4IO9A 1QZGA 1W3SA 4B3TL 4BY7H 3IRBA 2RCNA 4KHZA 4LUVA 3TS2A 4BA2I 4UY8C 2B63H 4LF9Q 3BZCA 4Y52H 1OXSC 1C7YA 4X64L 5LMUL 4TQUS 1XMOL 3BU2A 4JBKA 4NXNQ 3J7A5 3M4OH 3HOWH 3M9BA 4A3FH 4A93H 4ALPA 4A3DG 1A63A 2KHIA 1YJWA 1HJPA 5EAYA 1VQPA 4LF4Q 3STBD 3AFPA 1VQ8A 4GLXA 2R6GA 4K0KQ 3L2PA 1W2BA 3JAMi 3E0EA 1N8RC 1Q82C 3HOUG 1S3OA 4LF6Q 5GAGC 5JEAJ 4BY1G 3I4MG 2HT1A 4YWLA 3CCRA 4GOPB 4A3JG 1J5EL 1XNRL 4DV7L 4L5SA 1BBUA 3K0XA 3PUVA 4DV5L 2UUCQ 1N33L 2I0QA 4HJ7A 4HJ9A 4R4OA 3CF5A 1KRSA 4GKKL 2VW9A 5IP7H 5M3FG 3ULJA 5C44H 4EQ5A 1N34L 2HIVA 4C3JH 4QGUA 1CKOA 3HOZH 3PO3H 1H95A 4JOIA 2K5NA 1UE6A 2CCZA 3HOXH 2OTJA 5FLXc 1YBYA 1I94L 1AE3A 2L15A 1XTDA 2D62A 1X3GA 5LMNL 3S15H 3CCLA 2UXCQ 2WB1G 1BVSA 5C0XJ 3BZKA 1IL2A 1IBLQ 1D8LA 3A74A 4JI1L 3A5UA 4B3SL 2LSSA 4LFAQ 4QQBX 1NE3A 1XJVA 3HKSA 1EQQA 1G6PA 2N49A 2RHQB 2UXBQ 1K0RA 1WCMG 4PZ7A 3AQQA 1VCIA 1FL0A 4YCUA 2JA8G 1L0WA 4AYBG 1MKHA 2DGYA 1KRTA 4DV4L 5M5YH 2ZJQA 4JG2A 3F2BA 1Q86C 2ASBA 1X55A 5HGQA 3PO2H 4XTCS 2YYZA 4P72A 1K8GA 4JI0L 4A3MG 2BH2A 4IJLA 1PH1A 4IPCA 1PFSA 5C4XH 4DK6C 5LMNW 4P73A 2UXDL 2N3SA 5GADC 3G6EA 4DR7L 4AQYQ 2H5XA 3J81i 2K52A 4GLVB 2CFMA 4B3TQ 1M1KC 1YEZA 4LF5Q 3CCEA 1HZCA 1NMGA 1VQLA 1B8AA 3CCSA 4DAMA 3PF5A 5IY0A 3H3VI 3HOYG 3DM3A 2E2JH 2Q2TA 1CKMA 2NN6I 1Q12A 4X64Q 1VQ5A 4UP9A 5LMUQ 1A8VA 1XMOQ 4QY7A 4LUZA 3OW2A 1Q1BA 4MNOA 1D7QA 3RN5A 3GO5A 3K7UC 1Q7YC 1PH6A 3M7NA 3AEVA 4LF4L 1JE5A 2BH8A 4JC0A 1OTCA 1Y1VG 4IPDA 3G71A 2I5MX 3MEFA 4LF6L 4IOAA 2PI2E 4WJ4A 4L5QA 4QL5A 4DUYL 4A3EH 4APVA 1S40A 2ZTDA 2Y0SG 1VQOA 4DR1Q 1XNRQ 2EXDA 4RMFA 3GDEA 4A3BG 3JAMc 2MNAA 1PYSB 1OXXK 5M5XH 1WOCA 3NENA 3KF6B 2B63G 1I3QH 4MZ9A 4GKJQ 3HKZE 4IPHA 2ZM6Q 3KFUA
chains in the Genus database with same CATH superfamily
2JK8A 5FLMH 5BN5A 2KHSA 3A54A 5IYDG 1EFWA 4IFDI 2F0UA 2OWOA 4M8AA 4LJZC 1AP0A 5J39A 5M5XB 5IT9L 1VQNA 2JEAI 3EJIA 5IWAQ 4UPAA 1NNXA 4NKLA 4CDFC 4OONA 1BBWA 1LTSD 2QILA 1EYAA 5BN3A 5LL6S 1GO3E 4A3KB 3S17H 4FF1A 3P20A 2RQXA 4AQYL 1E24A 4OO1H 2BDOA 3CQZB 2HQEA 3FKIH 2D9UA 3C1EA 3I56A 1JB3A 3J81c 2CVRA 4FXKC 1LT3D 2JA5B 1N36Q 2B39A 1HTLD 4OHJA 2V1CC 3KDFB 4GN4B 3TRZA 4N9PA 5BR8Q 1HXYD 2AQ1B 2FJ2A 1SNQA 1ESRA 4R4IA 2F4IA 1BCPB 4FO2A 1JB7A 5KEEA 2C9OA 2YU9B 4CJ2C 1YNNC 1PTOH 2Z4IA 5GAHC 4MHEA 2ES2A 2CQAA 4XQJA 1U4RA 2K01A 2RDGA 3HOVB 1OXUA 2D2CC 1PH9A 3S2HH 5C5LA 1B7YB 1PH7A 2Q2UA 1TWFB 1EOTA 1KIXA 4DR4Q 5L37A 2B3GA 5C3EG 5IYBH 4X6AH 3CPWA 1SSOA 2VUMG 1TWHH 2NUCA 4R4TA 4MIUA 5EJWA 1QCBD 5FLXE 4AH6A 1A6XA 1HNZL 4BXXG 1HNXL 2IWHA 4KN7C 1EY5A 1FR3A 2BOSA 1DOKA 4UP7A 3ERQA 3J7ZC 1HH2P 3KDFA 3NTIA 1X65A 4M1UB 1TR5A 4YCWA 5KYIA 3ND9A 1Y1WG 1EZ8A 4A3GB 2F0QA 4GN3B 3RMHA 1DYQA 4KI0A 5A35A 4GOPA 4TRDA 1A15A 2PW7A 3A0JA 4CKCA 4OXPA 4L5RC 1SXTA 1PH4A 1VQAA 1U5KA 3A8IE 2N78A 4DK0A 3ONAB 4IUQA 5JOBA 4RKLA 4TVAB 4XQQA 2F0IA 3SDZA 2GN5A 3W2DA 3GTOH 1B4OA 4U68A 4DNRB 1TXYA 1BKBA 4A3DB 3AB9A 3UE0A 3D6CA 2FMMA 4ZKBB 3GP7A 2MPMA 2OCEA 5EKKA 4B3RQ 1WJJA 1VQ4A 4LUOA 2F3VA 3SVMA 4JI2L 4BY1B 3I4MB 4A93G 1PYBA 5G3LF 1W6KA 1SNDA 1V43A 2PMZE 3FRPB 4Q5VA 1C48A 5JPMC 2QEJC 1EQVA 2ZXOA 3M4PA 2B8FA 3CQZH 3C2PA 4NB3A 1WCMH 3S2DH 3NBIA 1IHZA 2A69D 2JSOA 5C4JB 3ULPA 2EJMA 4UHVA 5IGCA 5IP7G 3Q23A 3BJUA 1SAPA 2DJGC 3FPUB 1YNND 5C4HA 3LWUA 4C3JG 4K14A 3GTQB 1HNXQ 4X62L 1JJCB 3J80E 2AWOA 5AJ3Q 1FD7D 2UUBL 3S24A 2WB1B 1SRUA 2R92B 1PH8A 2EJGC 1EY7A 2WAQE 1TIID 1A2UA 3QWNA 4ZKCB 3S16H 3F8TA 3J7YW 3FHWA 1HR0W 2JN4A 5GQOA 2E76C 3PCOB 4A3MB 3UDXA 1KL9A 4EVOA 4TSSA 2VL6A 1HHVA 2ID0A 2A68C 3PO2G 3KLSX 4DV3L 3FPPA 3S14B 2KCMA 1PTOC 1U4LA 1GUGA 4A3BH 1PZKD 4POGA 3S1RB 4DGZA 1Y14B 4PMBA 2C5CA 1VQKA 4GS3A 1MIUA 3MWYW 3GQBA 1AW7A 4GNXC 3GTGH 1IBKL 2J0TD 2BA0A 4K5WA 1FGUA 3P75A 4JI3L 2O2LD 2NVXB 1EY9A 2HDMA 4CBVA 4B3ML 2ZJPA 1S5ED 2P5ZX 3NP8A 4DV0L 4JI4L 3TP6A 1SEBD 5IGGA 1HR0Q 4JI8L 2EYMA 1XNQL 2NTTA 5E7NA 4LFCL 2F0NA 1NSNS 5FLMG 2K5VA 1WTWA 4X62Q 1XMQQ 1NCVA 1QNUA 2OQ0A 2KBNA 1YZ6A 4RWSC 3UDIA 1XTCD 1EYGA 1G91A 5IP9H 2KECA 3S1NH 1L1OC 1IBMQ 4YY3L 2DJFC 4YWKA 4KD4A 5M9OA 2E5LL 4JBMA 2QA4A 1KAWA 2XRQD 1VQCA 1K8OA 4UP8A 4Y7NB 4HTHA 3O13A 1QUQA 2L12A 1NY4A 5KNDA 3D8GA 3TS0A 2NWGA 2XN9C 1RIPA 2B2WA 3CP0A 4OO1G 5FJ8H 3K7AB 2IHEA 3FKIG 3M4YA 4HAEA 1TWGH 3PIP3 2D5DA 1CZGA 4N8X1 1VF5C 4JV5L 1SYCA 3I7FA 4CGYB 4K0KL 3IFDA 3V2TA 5FO9B 1K28A 1YI2A 4DAYB 3AU7A 4RGOS 2K14A 2A68D 3G48A 2UUCL 2NVYB 5M3FB 2RA4A 4X3KA 4AYBE 4DV5Q 5CGKA 1PTOD 3E3XA 2K7VA 1R4PB 1FYCA 2MO0A 2DNEA 1SYDA 3KYHC 3CD6A 1OXVA 3TBIB 3EROA 4LFCQ 1I5FA 3TEHB 3A55A 1JWMD 2HQLA 4FDBA 1GD7A 5C3EB 2XRSD 1WTHA 2VUMB 1F77A 4DXFA 1EOVA 4QIWE 4DR6Q 4K2LA 5IYBG 1GKHA 2BDNA 4Z9CB 3NHHA 3I72A 3CXCA 3AFQA 4OX9L 1YHBA 2CH4W 2SOBA 5IT9c 2Y0SE 1N9WA 2NN6H 5DNFA 1Y1WB 2Z4HA 4JI0Q 2R7FA 3V05A 2KA7A 1EY6A 2L5TA 5IE8A 1HQMC 2RCNA 3NTKA 1B1ZA 1RCVD 2B63H 1X32A 3BS1A 1A3VA 1EZ6A 4JBKA 3J7AF 3M9BA 1HJPA 2AUKA 1VQPA 1AN8A 3AFPA 1VQ8A 4K0KQ 1CM9A 5J22A 5KRUA 1S3OA 3E0JA 2HT1A 3PQIA 3CCRA 4H44C 2UUCQ 1I4HA 2I0QA 1PFMA 3J7AV 4GKKL 1H9MA 2EYHA 5C44H 1II3A 3HEJA 2HIVA 3OIQA 3PO3H 4K6DA 2J4XA 4A93B 1F2YA 1UE6A 3NXWA 5FK9C 1W6JA 2OTJA 1YBYA 3SK4A 1XTDA 2D62A 1X3GA 4QCLA 1DONA 3L9AX 5LMNL 4DN4M 4CJ0B 5C0XJ 1IBLQ 1D8LA 4JI1L 3HKSA 1EQQA 4LMQD 4C3JB 1WCMG 2PZUA 3QJYA 4PZ7A 1VCIA 3FDTA 4FVMA 3U9SA 1KRTA 2X6LA 2ZJQA 3EFXD 4JG2A 3F2BA 3VA5A 2YYZA 4IPCA 4EGVA 3S15B 5LMNW 4G4KA 5EKIA 3G6EA 2H5XA 5I9PA 2K52A 4GLVB 4LF5Q 1M1KC 3I4LA 1VQLA 1LTGD 1NMGA 3CCSA 5IY0A 2F03A 3P7JA 3NWSA 5DM63 3SEBA 4ZRZA 5M5YB 3RN5A 3GO5A 3PO2B 2NTSA 1JE5A 4IPDA 4LF6L 4G57A 4L5QA 4QL5A 4DUYL 4KHVA 1XYIA 4DR1Q 2EXDA 4A3BG 2MNAA 1AZQA 4KMUC 1WOCA 1B9MA 3KF6B 1I3QH 3T16A 5ISRA 1DD2A 4IPHA 2MQHA 4ODGA 3H0GH 4NMZA 2N55A 1LUZA 2F4VQ 1LTID 2ZJRA 1Y1WH 1X6OA 1I4PA 5JJLA 4LFAL 2EY1A 1C9OA 5E4WC 4JI1Q 5KIXA 5I6YA 4KHPQ 5E4XA 4JI5Q 3VA7A 5EBDA 4BA1I 5D14A 3CCUA 2JA6H 1VQHA 3OOCA 3LX0A 2EYPA 4N9TA 1IL8A 1U9RA 1S5CD 2Z9HA 5EPKA 3HOXG 3HP3A 1F2MA 1C0AA 5IGDA 2XTIA 3RLOA 2RDHA 2R93H 4JYAQ 5ELEA 4U673 1V8QA 5IP9G 3OPOA 4O42A 1K83H 1B2TA 3K5OA 4NW2A 4LWCA 3S9WA 2OEOA 4QJFA 3TP5A 1E22A 2EYOA 4DA2A 1L0XB 4DR3Q 1EY0A 3S1MB 1DXMA 2A6ED 1YHQA 3S17B 1EIYB 1PV4A 2XNAC 1LTBD 1TVXA 1JR0D 5C4XG 3BYTB 3H6MA 3J81E 4DUYQ 1BF4A 2QKIC 3FKIB 4GZYC 4DV2Q 3TN2A 2PO4A 5FLXL 2K05A 4XXEA 1SDFA 4P74A 5FJ8G 2ZM6L 3C46A 4HEDA 4IUUA 1G2TA 4JW0A 3T1YQ 3DUZA 1CA6A 3TDQA 4P71A 1ZEQX 3UDGA 3G7LA 3D31A 1OXTA 3R3OA 2RVLA 2ENBA 1WI5A 3TP8A 1RHPA 2MO1A 4OEMB 5JJZA 3D6WA 1XPOA 2RHSB 4OWXB 1SE2A 1FNVA 1Q8KA 1PTOB 2VB3X 1V1PB 1JORA 5IWAL 1SNOA 2F3WA 1KLGD 3HFZB 1TT2A 3K57A 4K8JA 4FXGC 5IYCH 4RFBA 2PNHA 1WTXA 5KNCA 3S2HB 5A2QE 4JBWA 3G6JB 5CV4A 3HKZG 4KY6A 4NXMQ 4GNXB 4DPGA 2AHOB 1FVIA 4RKBA 4FYDA 5EGTA 1WTRA 4PZ6A 2JYOA 1E7ZA 2XWJB 1X9NA 2MP1A 2A8VA 2I5HA 4ZCKA 1H9SB 1N36L 3SK5A 1LTRD 1CZWA 3J81j 3I3CA 1X54A 2YV5A 4OO1I 2PNRC 3T1HQ 3JAML 5BR8L 3HOUH 2EYLA 2NN6G 4A3JH 4C3HH 3K5MA 1GUOA 1I6VC 2KHJA 1D5XC 1I4GA 3OW7A 2QF7A 1NUCA 1KXLA 4WJ3M 2Z6KA 4EQNA 2XWBB 1B9NA 2M2LA 1CQFA 4RGTA 1P8LA 3J80L 1L1OB 4HIKA 1WTPA 4WFN3 1SYBA 3U4VA 5CV5A 3BVZA 4F88A 4ZAIA 2EXZA 4DV1Q 4DR4L 1G8ZD 3PUWA 1LO5D 3R2IA 3GV3A 4POFA 2VS1A 4KTAA 4RH6A 1DM0B 1UWVA 2JJQA 4QB4A 3FVQA 3IKJA 3I91A 4GNXA 3GTOB 5JVG3 1UNSA 3VYTA 3E5SA 1HRJA 3CMEA 5C44G 3ERSX 2LKVA 5CMDA 3NQIA 3M3YH 3PO3G 4IALA 1H9SA 2KCNA 2K75A 2KEDA 4HR7B 3S1MH 1QOHA 1HZBA 1X56A 4X65Q 1ILPA 3LGJA 1WTVA 3HOYH 1WCMB 2EVBA 3SHLA 3S2DB 4ME5A 3UDFA 2LY7A 3Q22A 5ELBA 2TMPA 2F3IA 2JA9A 1LACA 3H94A 2K4KA 4ABNA 1S4ZA 2B2YC 1JC7A 5IGBA 1M90C 3F2CA 1K8AC 1UE5A 2B2UA 2Z1CA 2BCOA 1LABA 3CC7A 3D0FA 5CBEE 3S16B 4FF4A 3I2ZA 3ICEA 4LFBQ 2ZT9C 1GM5A 1IYUA 2JE6I 2YTVA 4ZQ3A 1VQ7A 2PQAB 3CC4A 1UEBA 4B3RL 2R7DA 4HMJA 1MHWC 1VQJA 2PQEA 1STYA 2VNUD 3FP9A 4IUTA 3EIVA 4A3BB 4BBSH 1D5MC 1VQ9A 1GHKA 4LW1A 1MD2D 3GD7A 3I4NH 1HNWL 2KENA 1EEID 2Q2HA 1HUMA 3KK7A 2EQSA 1ENFA 3F2UA 3S1QH 3KLRA 4MN3A 3GTGB 1CT1D 1PXUA 1PRTD 4A3CH 5AJ3L 3H0GG 1L2FA 5C5MA 2F0WA 4IUPA 3NTHA 1M8AA 2IY5B 4YHHQ 1UE1A 1YVCA 5C0XH 5JJKA 1E1TA 5LHY1 1S5BD 2CQOA 1ESFA 2UU9L 4EQPA 3STBC 5K5PA 1EIHA 1PVOA 2Z6BA 2E2IH 2JA6G 2MFIA 2PQAA 2F0DA 2UUAL 3E9IA 3KLSA 5C6AA 2PPBC 1HFNA 3ZJYC 1S5FD 2ALYB 1A3UA 2NZHA 4KD3A 1XPRA 2R93G 3K5NA 4LF9L 3S1NB 4L5TA 3CU7A 2K33A 2D0OA 3CAMA 2X69A 2M9VA 2IX3A 1GUSA 2JEBI 4RGNA 1KABA 1VMCA 1H9JA 4A75A 2WB1E 4A3IH 3OWFA 2E2DC 1LT4D 1Y8NB 1H9RA 1QILA 4JOIC 3CCJA 4YWMA 1KHIA 3VYUA 4LK1C 1HNWQ 4XYOA 2B29A 2K28A 1WTQA 2B2TC 4HIOA 1HR0L 3QO2A 1N34Q 3K8AA 4C1NK 1TWGB 1SYFA 1HZ9A 4ZUJA 5CV7A 4JVZA 5I9OA 3BDCA 1XMQL 4MTNA 3TMEA 1Y69U 4NPSA 1SFOH 4KLKA 4WJWA 2F0JA 3PV0A 4I7AA 2UXCL 1JJGA 4KKSA 1JT8A 3VR2A 1IBML 1SMXA 2UXBL 3TREA 1M4VA 3GTPH 2UU9Q 1YJ9A 1L0YB 3HKZB 1QB5D 1RTNA 5T1IA 4YIJA 4DV4Q 3ER0A 5IYCG 5CR3A 2UUAQ 1XPUA 3K0YA 3ZYYX 4L63B 2UXDQ 4DR7Q 1VQGA 4BY7H 1WVLA 3IRBA 4X3TA 4LF9Q 4Y52H 1OXSC 1C7YA 3OMGA 4WORA 1HTPA 5IT9E 4TQUS 3D4WA 3HOWH 2KHIA 1PLFA 1YJWA 2KUMA 3STBD 4GLXA 3JAMi 1Q82C 3HOUG 5JEAH 5I2YA 1U4PA 4A3JG 4C3HG 1SYGA 4L5SA 1BBUA 3K0XA 2B63B 1PYWD 4DV5L 1CTMA 4HJ7A 2RDFA 4F8MA 2VW9A 1STHA 4HCSA 2Q8TA 1SBBB 2K5QA 3BG3A 2F0OA 3HOXH 4X3SA 5FLXc 2L15A 1PFNA 3NWTA 3MC0B 2UXCQ 1BO0A 3NPPA 1BVSA 1DOMA 2R61A 1IL2A 4DR6L 3DM1A 3A74A 4B3SL 4QQBX 1B3QA 5C44B 5HGTA 2RHQB 1K8MA 3PO3B 2UXBQ 1K0RA 2FFKB 1Y8PB 1FL0A 3T56B 1MKHA 1O7ZA 2DGYA 1F9SA 2ASBA 1RTOA 1X55A 4KY5A 5HGQA 5D65A 4JI0L 4DK1A 5C4XH 4HSPA 2F0MA 4CDDC 4QMGA 1YEZA 5K36H 1PZJD 3HOYG 4K2KA 3H3VI 2E2JH 1CKMA 2NN6I 1VQ5A 1J8IA 2NZ1D 4QY7A 1D7QA 1Q7YC 3M7NA 3AEVA 1ML0D 2RSOA 1KDAA 4JC0A 1Y1VG 5C3XA 3VYSA 3G71A 4WJ4A 2PI2E 2QW7A 4A3EH 3P1HA 1EY4A 3CRKC 2RBMA 3JAMc 2HUGA 1OXXK 2F0GA 3HG9A 4DNTB 1PFBA 5TSSA 4MZ9A 1CFMA 4DAPA 3K6OA 5DEHA 1KNAA 4IQZA 1Q81C 3CW2C 2G9HD 3Q0AA 1TWCH 1B44D 1A3TA 2EPBA 1PH3A 2A1AA 2PYKA 2RKSA 3GTLH 2Z0SA 3J80c 2IJ0A 2DNCA 1IYJB 1NMFA 2WIIB 4BBSG 1S72A 5F2DA 1IBLL 2F0SA 1LLRD 1I3QB 3RZDH 4B3SQ 3BVGA 3I4NG 5IGEA 1I6HH 4XDXA 1E1OA 3UI2A 3QOLA 2QDLA 3GTMH 1ET6A 2CWAA 1EQRA 3U9OA 4ZLTF 2KEEA 1B70B 3GTJH 3H0GB 5CV6A 3VR6A 1PRTB 3H3VH 2LXKA 4DXGA 4CJ1B 4GOPC 1XWEA 2K32A 2G5DA 3L0OA 1R4QB 2F0VA 1ET9A 2KVMA 4A3CG 3K81C 1R9TH 4LF5L 1HA6A 1TWAH 4DAYA 1ENAA 1O7IA 2F52A 5C0XG 4KKTA 1CSPA 1B53A 1Q46A 3NBHB 1A62A 3WOFA 2JA6B 4AIMA 4A76A 5DAUA 4LF8L 4QF4A 5CORA 1MGSA 4HN7A 1XXGA 2NBFA 2LS01 1A2TA 2R93B 1KDBA 3GTKH 4DR1L 3IAYA 1I4XA 1O7LA 3K5LA 2R7ZH 4HJ5A 1K83B 2CW0C 4IFDJ 2PI2A 2SEBD 3EN2A 1QJOA 2SDFA 1BR9A 2E2HH 1C8CA 2QGQA 1VQFA 2EIFA 2OT2A 4JI6L 3H09A 2PCFB 5M3MH 2F4VL 4B9WA 1YNJC 1HCZA 5M5WH 4A3IG 3ULLA 3CC2A 5E1FA 5H1SE 3C3LA 5EKLA 4KHPL 1VQBA 1LM0A 4JI5L 3LWEA 2NVTH 1TY0A 2VQFL 4HJAA 4N8FA 4O0AA 3URYA 1GUTA 4JYAL 1CSQA 4LF7L 4ILWA 1ASYA 5EQ0A 3RUZA 4V0BA 4XYQA 2FXQA 3ITPA 4BWGB 1AFPA 4OWTB 1PTOF 1RL2A 2KQ3A 4V190 1GVPA 2AMCB 1VQEA 2HHHQ 1LYLA 2YTYA 4LF8Q 4DR3L 1V1QA 3KJOA 4HMIA 3RZOH 3SR1A 1IZ6A 4DUZQ 1STEA 3GV6A 4DV2L 3FEWX 2IX1A 3AYHB 1FJGQ 5KNBA 4BY7G 2K5HA 2B8GA 5IOCA 3NUCA 1AH9A 3MZ5A 3DLLA 1AZPA 4H02A 3NK9A 3T1YL 2H1EA 5JPNC 1MJCA 3HOWG 3HOUB 3D3RA 4JI6Q 4A3JB 3MHBA 2JQOA 4C3HB 2NB0A 1K9MC 1EFID 1RD9D 2L11A 1GJXA 2VY3A 5JEAG 2CWPA 2EY2A 4LNQA 2PZTA 1AE2A 3H3VC 1B50A 4E6IA 1F9QA 2JA8H 2VQFQ 2CW0D 2EJFC 2WFWA 2AUJD 5FO8B 5JAVA 4NXML 1GHJA 2G9DA 2D0PA 2MUYA 2WACA 3VDYA 3MAQA 3MVVA 3CHBD 2FINB 1YIJA 1MBYA 1YNJD 4LF7Q 3BDLA 4DR2Q 1EWIA 1EYCA 2FHTA 1UUPA 1QVGA 2XVSA 1T9HA 4UDUC 3KF8B 4TKOB 1HFGA 1JOKA 3B6YA 3DXJC 4DR5Q 3M3YB 1VQDA 2ZTEA 3KF6A 1JMCA 1Q1EA 3T1HL 1BBXC 2JXMB 2B2WC 2E74C 1V9PA 1D1IA 1SNPA 1F9RA 3OTOQ 3T13A 3CPFA 3IFTA 3U58A 1LV9A 3K58A 5EPJA 3HOYB 4PQXA 1QWYA 2PW5A 5J3BA 1D5ZC 1SE4A 2LFNA 3K80C 3PUYA 2F0PA 5K36G 3SK8A 1Z47A 4JCVE 3T4AC 4H7BA 4G7HC 3UE1A 4ULLA 2EYFA 4DV1L 1N32Q 4HCEA 1JE4A 2H4OA 1IYVA 3T53B 1CHPD 1STNA 4IPGA 2XGTA 1DJRD 3U4ZA 1BUVT 4A3EG 3DWPA 1BCPF 1V1OA 3W1GA 4R1JA 1A0IA 4O2DA 4PV1C 1G6ZA 3KF8A 3LNNA 2IHFA 1QNKA 1EY8A 2F0TA 2F0HA 4K5VA 4X66Q 4ID6A 3E9HA 1H9KA 2B2TA 4BBSB 4CDEC 2F0KA 1ZXTA 4X65L 3I4NB 3DEOA 2I46A 2R92G 1I50H 3I4OA 4C3IH 4RAUC 4HJ8A 2YTXA 2F0FA 3S1QB 3RD4A 1PMRA 1X3EA 1EEFD 4BBRH 4NP5A 1ONLA 1ZKOA 2WP8J 3DWQA 1DZ1A 3G4SA 3M7GA 4DV6Q 1TQOA 4L8JA 1LT5D 1HPCA 3SE0A 5T1GA 1UAPA 5ELOA 5LL6X 3PIOA 4LFBL 1HQRD 1K73C 4G7OC 2WAQG 1KD1C 4H13C 4EX5A 2ZTCA 1V1PA 2CKZB 2E2IB 4R4CA 5E3FA 2QDBA 1VS0A 4GLAC 3RR5A 1WFQA 1KDCA 3KBXA 1K3BC 2K50A 3PMFA 1SJHD 1J5EQ 4DV7Q 1N33Q 2L0CA 5EBCA 3RLFA 2R7ZG 1QG7A 1STAA 2EZVA 4A3IB 4IOCA 5ELFA 4DKAC 4DFAA 1MSGA 3H15A 1I94Q 5M3MG 3A8KE 4ME3A 1EU4A 3EVQA 2N8NA 4K6LA 4PZ8A 4Q0FA 4YHHL 3JC66 4XT3B 1E2VA 2EY5A 2JA7H 2KCCA 1WD1A 1E2WA 5ELNA 4A4IA 1EWHA 2Q2IA 2E8GA 5BN4A 3MXPA 2NVQH 4QUCA 4C2MH 4LAAA 1MSHA 1JCKB 2WKDA 1Y1VH 5G3LD 2ZXRA 5C0XI 1L1OA 1SLJA 4GN5A 1SFOB 1JJ2A 2Q8RE 4K5XA 1MJEA 3MXNB 2KCTA 1QZGA 1W3SA 3QB3A 1BDOA 3TS2A 4RA8A 4UY8C 3BZCA 4JK1C 1JOQA 3QR8A 4X64L 3GTPB 5LMUL 1XMOL 3M4OH 3J7A5 2E75C 4A3FH 1A63A 4ZUIA 4FNFA 5NUCA 2EYJA 4IURA 4LF4Q 2R6GA 1W2BA 3E0EA 1N8RC 2PZWA 4BY7B 4KJOA 5GAGC 1FNWA 2MHVA 4YWLA 4GOPB 1XNRL 2A69C 3PUVA 3QG1A 4I7ZC 1IW7C 4R4OA 3R8BA 4IFDH 2ICIA 3CF5A 5M3FG 3ULJA 4EQ5A 1N34L 3HOWB 3MXUA 4QGUA 1CKOA 3HOZH 2JP1A 2IW3A 1Q90A 4K8IA 5JVH3 3HGBA 3E6ZX 4BS9A 3L3OC 3WOEA 2ICEC 5ELCA 5FO7B 3CCLA 3KBGA 4S3SA 1JWUD 3MXNA 5IODA 2LSSA 1NE3A 1XJVA 3PIO3 4ZYSA 2N49A 4H0LC 4KY7A 2JA8G 1L0WA 4AYBG 3MA2B 3HOXB 4DV4L 1Q86C 5CV8A 4XTCS 4P72A 1GXDC 4IJLA 4DK6C 1O7YA 4P73A 2UXDL 2N3SA 5C3WA 5GADC 4DR7L 4AQYQ 5C4ZA 2CFMA 4XQNA 1JICA 3IL8A 1HZCA 2BE5C 3NE5B 4I65A 3SK6A 1VF7A 2K6AA 3OWEB 3DM3A 2Q2TA 1Q12A 4X64Q 4CKBA 1OO9B 2SNSA 5LMUQ 1A8VA 1XMOQ 5I6WA 4LUZA 1PH6A 5C4XB 5FKAC 4RCOA 1OTCA 3I90A 3OHXC 2ZTDA 2B2VC 2Y0SG 1XNRQ 4RMFA 3GDEA 1WD0A 2E2JB 1PYSB 5M5XH 3HZXA 3QIAA 3NENA 1SYEA 1STGA 1ENCA 3HKZE 1CI3M 2Q8IB 2EOTA 1SN8A 2I07B 4DAVA 1VQ6A 1G291 1PH5A 4J6HA 5KYLA 1TKWB 3WDNA 4F87A 2QEXA 2IT1A 4A3EB 3EBEA 3JAME 4A3KH 3DEPA 3TQYA 4WRDA 2AQ3B 5CBAE 1LTLA 3NSWA 4RHRA 2DY8A 4KJNA 4L6TB 1IW7D 1I4QA 5GROA 3M4QA 3KJPA 4R8NA 3PIPA 3F1ZA 2JA5H 1TWCB 1HNZQ 1UE7A 3CCQA 3GTLB 1K3RA 2L55A 1NBWA 1STBA 1O80A 2PMZB 2I5LX 2VQEL 3ND8A 3RZDB 1I6HB 3KUPA 3GTMB 4C3IG 4R8IA 2YU9H 2IX0A 3GTJB 3EQLC 5CV9A 2OQKA 4BBRG 4G7ZC 2WKCA 4JI7L 1NTGA 2Z6KC 1PRTF 1U0LA 4KKUA 1T5XD 1Q8IA 3HOVH 1R9TB 5DM73 1TWFH 1TWAB 5D3DA 2WAQB 1UEAB 1S5DD 1VQMA 2XIWA 5HY6A 2LXJA 1PH2A 2BE5D 1U4MA 1EWCA 2AQ2B 1EUJA 1QUQB 4KV6A 2M00A 3J80i 4FF3A 3EA6A 3CKIB 4GKJL 1ZYRC 4JI2Q 4B08A 1IKLA 3GTKB 4C56C 2N88A 3HS0C 3Q6SA 2RSNA 2RF4A 1E3PA 2R7ZB 1EU3A 3C1FA 4IN3A 5J1ZA 1HA5A 1XX8A 1DGSA 2A19A 4A3GH 2GVBA 3H91A 4CDCC 3R93A 1NJIC 2E2HB 3CMAA 1D6EC 5M3MB 1J9OA 1QZHA 5M5WB 4A3LH 1SNMA 5JJIA 2UUBQ 3W5OA 4O1NA 3NEMA 1CK1A 2VZAA 2VQEQ 2IPKD 1E2ZA 1BNZA 2JA7G 2NVTB 3V96A 2B2UC 4OIJA 4A3DH 2ZXPA 4R4QA 2EY6A 1SMYC 3SXHA 3Q8DA 4IJHA 4JI7Q 5EPLA 1HUNA 1KC8C 4DU9A 2IL8A 1JQYD 4YCVA 4BY1H 3I4MH 1ICFB 4DV3Q 1X3PA 4PG3A 5FOBB 1KNEA 3DMUA 2HDLA 5CC4A 1HZAA 3MFYA 5C4JH 2Z8LA 1F2LA 2HCCA 3RZOB 3HRZC 4NDXA 4R9WA 1YHAA 2K03A 2A5HA 4A3FG 2L1BA 1IBKQ 1Z9FA 3GTQH 4GKJQ 1RF2D 3I70A 3M85A 3RN2A 2X6GA 4PMWA 2R92H 4JI3Q 4B3MQ 4P2CB 3DHQA 4FF2A 4DV0Q 1K0SA 2VB2X 4JI4Q 1TS5A 3R2TA 1KTKA 4DK3C 1TS3A 4IFDG 1QVFA 1EYDA 5IGFA 1BXTA 2VXWA 4JI8Q 3KLWA 1XNQQ 1KQSA 3HOZG 4UAIA 3VR5A 2DUDA 4J15A 4A3MH 2C35B 2CHBD 1BCPC 4JBJA 3J81L 4HIDA 1EIFA 3S14H 1X3FA 1ZYRD 5I2XA 3PUZA 4KN4C 1TS2A 1Y8OB 3L7ZC 2JA8B 4AYBB 4YY3Q 3S1RH 2HHHL 2E5LQ 3VR4A 1J6QA 1CKNB 3PSIA 1RODA 2F0EA 3X3NA 5I4DA 1Z6HA 4DUZL 3CCVA 1G2SA 1NR4A 2NVXH 1FJGL 1CHQD 2ATWA 4B9XA 5ELDA 2F1MA 2GA4B 1E0BA 4RHSA 2QCPX 4QIWB 5IIFA 1GUNA 3A8JE 4OWWB 5A2QL 4CKEA 4DF7A 5IYDH 2NYZD 3OYYA 3A5ZB 4JV5Q 3CCMA 3RNUA 2Y0SB 1SMYD 3PF4A 1YNXA 1B3AA 1WYDA 2NZOA 1NAPA 3BVMA 3SGIA 1VQIA 5COYA 2J7ZA 1SROA 1C4QA 4HSVA 3TSSA 1D2BA 2L4NA 3PGZA 2HIXA 3PUXA 2R3ZA 3NBHA 4IUNA 4ZK9B 2K5DA 2AKWB 4Y7NH 1CKNA 3N52A 1PDQA 1TU2B 2HCIA 3D4DA 2AWNA 1I4RA 1IKMA 3I55A 4DR2L 4A3KG 3WWVA 1F9PA 1FGBD 4HIMA 4DNIA 3K7AH 2A74C 4J8QA 4DR5L 2A6EC 1LTAD 4IZ8A 4OX9Q 5KGUA 2OTLA 3TZDA 1ASZA 2JA5G 1SE8A 3OTOL 3D4RA 1CUKA 5GAEC 1P16A 1I50B 4C3IB 1BCPD 2RCFA 3KOJA 2B2YA 2NVYH 5M3FH 4C1NI 4BBRB 1DOLA 3A7AB 3X3MA 1EIGA 4NXNL 3U50C 3I8ZA 4RG1A 1GOZA 1ILQA 4OELB 3W1BA 2DN8A 1N32L 3RLNA 2A6HC 3NELA 1IXRA 2BA1A 3MTSA 4X3UA 5CYUA 2K1BA 1QVCA 3HOVG 5C3EH 3K59A 4XIGS 2VUMH 2F0LA 2A73B 2K5WA 4MTKA 1YITA 4GKKQ 4PMCA 2HD3A 2SNMA 3BZDB 4BXXH 1AEXA 4RGMA 1MI2A 4J1MA 3QOJA 4X66L 4JPBW 2MJ8A 3VYRA 2OF1A 3F2DA 1SE3A 5LMNQ 1EL0A 2V4DA 1SJED 3BYYB 3FMCA 4P75A 2KJXA 1YJNA 4A3GG 1G51A 1X3QA 2EE1A 1SR3A 1PHJA 1LTTD 5DLQE 1PA6A 3OSOA 2O5JC 1FNUA 4DV6L 1CA5A 2WV6D 1T5EA 2GVAA 2WINB 3MFGA 4A3LG 4IO9A 4B3TL 2JA7B 4KHZA 4LUVA 1Q3LA 4BA2I 4XT1B 3TZUA 2XSCA 4IUVA 1CQVA 1EQTA 1VMPA 2NVQB 1BOSA 3BU2A 4C2MB 4NXNQ 1PZID 2LMCB 1Y1VB 4A93H 3MXGA 4ALPA 4A3DG 1ICWA 1QE6A 1RKNA 4QUFA 5EAYA 3CRLC 4EQOA 3L2PA 4LF6Q 1O78A 5JEAJ 4BY1G 3I4MG 1J5EL 4DV7L 4FP5D 1N33L 4HJ9A 1KRSA 5IP7H 2K04A 3M4OB 4C3JH 1H95A 4A3FB 4JOIA 2B2VA 2K5NA 4CHTB 2CCZA 3TP7A 1I94L 1AE3A 5D3IB 1SNCA 2KOLA 2MGSA 3S15H 5AFWA 2A6HD 2WB1G 1KAAA 2L9HA 2TSSA 3BZKA 3A5UA 4LFAQ 4RCNA 1G6PA 1JOOA 3HOZB 3AQQA 4YCUA 1WTOA 5M5YH 1D1KA 3PO2H 3VR3A 1K8GA 2BH2A 4A3MG 1TS4A 1PH1A 1PFSA 4FXDA 3DWAA 2DY7A 3N6RA 1DCZA 1LT6D 2OXPA 3J81i 4B3TQ 3CCEA 3AMUA 1TWHB 2CH4A 1B8AA 3A7LA 3I73A 4DAMA 3BDOA 1KLUD 2FMCA 3MEHA 3PF5A 3Q24A 2O5IC 5HURA 4OGQC 2EDGA 4UP9A 1F2ZA 4OL7A 4KK7A 3OW2A 1Q1BA 4MNOA 1TY2A 3K7UC 3T51B 1VDZA 2O4XA 3A56A 4LF4L 3OIPA 1JWSD 2BH8A 2I5MX 1RJTA 3MEFA 4IOAA 1GUWA 1S40A 4APVA 1Z7TA 3OMCA 1VQOA 1NR2A 3W3AA 3NQTA 4OIKA 4PNYA 2B63G 1PRTC 1BQQT 4F7XA 2ZM6Q 3KFUA 1RDPD
chains in the Genus database with same CATH topology
1SN8A 2JK8A 5FLMH 2MQHA 1VQ6A 1Q81C 3H0GH 1G291 3CW2C 1PH5A 4OO1I 1TWCH 5IYDG 1LUZA 1EFWA 2F4VQ 1PH3A 2A1AA 2ZJRA 3GTLH 4IFDI 2QEXA 2IT1A 3EBEA 1Y1WH 2Z0SA 3J80c 4A3KH 2OWOA 3TQYA 1X6OA 1IYJB 1NMFA 4BBSG 5JJLA 1S72A 1IBLL 1LTLA 4LFAL 1VQNA 2JEAI 1C9OA 4JI1Q 3RZDH 4B3SQ 3I4NG 1I6HH 4KHPQ 1E1OA 5IWAQ 4UPAA 3GTMH 4JI5Q 2CWAA 1EQRA 4BA1I 5GROA 3KJPA 3M4QA 3CCUA 2JA6H 1B70B 3F1ZA 1VQHA 3PIPA 3GTJH 2JA5H 4DR6L 4OONA 1HNZQ 1UE7A 3CCQA 1BBWA 3H3VH 2LXKA 4GOPC 1K3RA 3HOXG 4A3CG 1NBWA 1GO3E 3L0OA 3S17H 1C0AA 2XTIA 3RLOA 3K81C 4AQYL 4JYAQ 1R9TH 2R93H 2I5LX 1E24A 4LF5L 2VQEL 1TWAH 3FKIH 1O7IA 2F52A 5C0XG 3I56A 5IP9G 1K83H 3J81c 2YU9H 1CSPA 4LWCA 1Q46A 3NBHB 1A62A 2IX0A 4AIMA 1N36Q 4A76A 2OQKA 4BBRG 4QJFA 4LF8L 4JI7L 1E22A 2V1CC 3KDFB 4GN4B 1NTGA 3TRZA 4DR3Q 2Z6KC 1YHQA 1U0LA 5BR8Q 1EIYB 3HOVH 1PV4A 3GTKH 4R4IA 5C4XG 1TWFH 4DR1L 4DUYQ 2R7ZH 4DV2Q 4HJ5A 1JB7A 4IFDJ 1VQMA 2PI2A 5HY6A 2LXJA 4P74A 3EN2A 1PH2A 5FJ8G 2ZM6L 5GAHC 2ES2A 2E2HH 1EUJA 2QGQA 1QUQB 3T1YQ 1VQFA 2EIFA 3J80i 4JI6L 4P71A 5M3MH 2F4VL 4GKJL 1OXUA 1PH9A 3UDGA 3S2HH 4JI2Q 3D31A 1OXTA 5M5WH 4A3IG 3ULLA 1B7YB 1PH7A 2Q2UA 3CC2A 1KIXA 4DR4Q 1WI5A 2RF4A 1E3PA 2MO1A 2B3GA 5H1SE 1XPOA 5C3EG 2RHSB 4OWXB 5IYBH 1DGSA 2A19A 1Q8KA 4A3GH 4X6AH 3CPWA 2GVBA 2VUMG 1TWHH 4KHPL 1VQBA 1LM0A 4R4TA 5IWAL 4JI5L 1NJIC 2NVTH 2VQFL 3HFZB 4HJAA 4AH6A 3CMAA 5IYCH 1HNZL 4BXXG 2PNHA 4O0AA 1HNXL 4JBWA 1QZHA 4A3LH 5JJIA 3HKZG 4UP7A 3J7ZC 2UUBQ 4NXMQ 1HH2P 3KDFA 3W5OA 4GNXB 1X65A 4DPGA 4JYAL 2AHOB 1CSQA 3NEMA 4YCWA 4LF7L 1FVIA 1Y1WG 1ASYA 2VZAA 2VQEQ 4GN3B 2FXQA 4KI0A 4PZ6A 4GOPA 4OWTB 2JA7G 1E7ZA 1RL2A 1X9NA 2A8VA 2I5HA 1GVPA 2AMCB 1N36L 1VQEA 3A0JA 4A3DH 2HHHQ 3J81j 4OXPA 1LYLA 4R4QA 1X54A 2YTYA 4LF8Q 2YV5A 3Q8DA 4L5RC 4DR3L 3T1HQ 1V1QA 4IJHA 1PH4A 4JI7Q 1VQAA 3KJOA 1U5KA 3RZOH 2N78A 5BR8L 1KC8C 3HOUH 1IZ6A 4YCVA 2NN6G 4BY1H 3I4MH 4DUZQ 4DV3Q 4C3HH 4A3JH 2KHJA 4TVAB 4PG3A 4DV2L 2IX1A 3AYHB 1FJGQ 2GN5A 1KXLA 4BY7G 4WJ3M 2K5HA 2Z6KA 3GTOH 1TXYA 1BKBA 1HZAA 1P8LA 3UE0A 3DLLA 1AH9A 5C4JH 4H02A 1L1OB 4HIKA 3T1YL 2OCEA 3U4VA 4B3RQ 1MJCA 1WJJA 3HOWG 1YHAA 1VQ4A 4LUOA 4A3FG 4JI6Q 4JI2L 4A93G 1IBKQ 1Z9FA 1PYBA 4DV1Q 1K9MC 3GTQH 1V43A 2JQOA 2PMZE 3PUWA 4DR4L 4POFA 3M85A 2VS1A 3RN2A 4PMWA 2R92H 1UWVA 2JJQA 4JI3Q 3M4PA 2VY3A 5JEAG 4B3MQ 2CWPA 4LNQA 4GNXA 4DV0Q 1AE2A 3CQZH 4JI4Q 4NB3A 4DK3C 1WCMH 3S2DH 3ULPA 4IFDG 2JA8H 5IP7G 3CMEA 1QVFA 5C44G 3BJUA 3ERSX 2VQFQ 4JI8Q 2WFWA 3KLWA 1XNQQ 3M3YH 1KQSA 3HOZG 3PO3G 2DUDA 4J15A 4X62L 1JJCB 2C35B 2AWOA 4A3MH 1HNXQ 5AJ3Q 2K75A 2UUBL 4NXML 3S1MH 4JBJA 3S24A 1SRUA 4HIDA 2D0PA 3VDYA 1PH8A 1EIFA 1HZBA 2WAQE 3S14H 1X56A 1X3FA 1YIJA 3PUZA 4X65Q 3LGJA 4LF7Q 3HOYH 4DR2Q 1QVGA 1EWIA 3S16H 1T9HA 3F8TA 3KF8B 3FHWA 3L7ZC 3UDFA 4YY3Q 3S1RH 1HR0W 5GQOA 2HHHL 2E5LQ 4DR5Q 3B6YA 2F3IA 1VQDA 2JA9A 2ZTEA 2K4KA 1Q1EA 1J6QA 1CKNB 3KF6A 3PCOB 3PSIA 1KL9A 3UDXA 3T1HL 2VL6A 1M90C 2ID0A 1V9PA 3PO2G 4DUZL 3OTOQ 3F2CA 4DV3L 1K8AC 1UE5A 3CPFA 2KCMA 3U58A 3CCVA 3CC7A 4A3BH 3D0FA 2NVXH 1FJGL 2ATWA 5J3BA 3I2ZA 4POGA 3PUYA 3K80C 3ICEA 5K36G 4LFBQ 4OWWB 1Z47A 4JCVE 1Y14B 1GM5A 2JE6I 2YTVA 1VQ7A 4GS3A 1VQKA 2PQAB 3CC4A 1UEBA 4B3RL 2R7DA 3UE1A 1MIUA 5IYDH 4GNXC 3OYYA 3GTGH 3A5ZB 1IBKL 1VQJA 2BA0A 3CCMA 4DV1L 4JV5Q 3FP9A 1N32Q 3EIVA 2VNUD 3RNUA 3PF4A 1YNXA 1WYDA 4BBSH 1FGUA 2NZOA 4JI3L 4IPGA 2XGTA 1VQ9A 2ZJPA 4B3ML 3U4ZA 4DV0L 4LW1A 3SGIA 3GD7A 4A3EG 4JI4L 3I4NH 1HNWL 1VQIA 3W1GA 2KENA 4R1JA 1A0IA 4O2DA 2Q2HA 1SROA 2EQSA 3S1QH 1HR0Q 4JI8L 3PGZA 2HIXA 2IHFA 1XNQL 3PUXA 5E7NA 4LFCL 4X66Q 5FLMG 2AKWB 5AJ3L 2K5VA 4A3CH 4X62Q 3E9HA 3H0GG 1XMQQ 4Y7NH 1CKNA 1L2FA 2OQ0A 2AWNA 2KBNA 1YZ6A 3UDIA 2IY5B 1JMCA 4X65L 3I55A 1EYGA 4YHHQ 4DR2L 1UE1A 4A3KG 1YVCA 2R92G 5JJKA 5IP9H 1I50H 3I4OA 4C3IH 3S1NH 3WWVA 1L1OC 4HJ8A 2YTXA 1E1TA 1IBMQ 4YY3L 1X3EA 4YWKA 4HIMA 4DNIA 2CQOA 3K7AH 4BBRH 2E5LL 4DR5L 4JBMA 2QA4A 2UU9L 3STBC 1KAWA 2WP8J 4OX9Q 1PVOA 1VQCA 2OTLA 1ASZA 2E2IH 2JA6G 2MFIA 4UP8A 2JA5G 2PQAA 3G4SA 1SE8A 4DV6Q 1QUQA 3E9IA 3OTOL 2UUAL 1CUKA 3ZJYC 1NY4A 2ALYB 5GAEC 2NZHA 5ELOA 3TS0A 1P16A 1XPRA 2R93G 3KOJA 1RIPA 4LF9L 3CP0A 4L5TA 4OO1G 2NVYH 5M3FH 2D0OA 3CAMA 3PIOA 5FJ8H 4LFBL 1K73C 2IHEA 3FKIG 2WAQG 1KD1C 4NXNL 4EX5A 2ZTCA 2CKZB 3U50C 2JEBI 4R4CA 1TWGH 4RG1A 4A75A 1VS0A 2WB1E 4GLAC 3W1BA 4A3IH 4JV5L 3RR5A 1N32L 3RLNA 1WFQA 3I7FA 3NELA 4K0KL 1IXRA 2K50A 2BA1A 1YI2A 4DAYB 1QVCA 3HOVG 5C3EH 4JOIC 2K14A 4XIGS 3G48A 3CCJA 1J5EQ 4YWMA 4DV7Q 1KHIA 2UUCL 2VUMH 4AYBE 4DV5Q 1HNWQ 1N33Q 2B29A 1YITA 2R7ZG 3RLFA 4GKKQ 4HIOA 1HR0L 1N34Q 2MO0A 3K8AA 4BXXH 3KYHC 3CD6A 1HZ9A 4IOCA 4X66L 4DKAC 1OXVA 4LFCQ 1XMQL 1I5FA 3TEHB 4MTNA 3H15A 1I94Q 5M3MG 2HQLA 4FDBA 1GD7A 4NPSA 1SFOH 4KLKA 4ME3A 3F2DA 5LMNQ 3PV0A 2N8NA 2UXCL 4PZ8A 4YHHL 1JJGA 1JT8A 3JC66 1EOVA 4QIWE 2JA7H 4DR6Q 4P75A 5ELNA 1IBML 4A4IA 5IYBG 1GKHA 1YJNA 1SMXA 2UXBL 4A3GG 1G51A 2Q2IA 3TREA 2E8GA 1SR3A 3CXCA 1PHJA 3AFQA 2UU9Q 4OX9L 3GTPH 1YHBA 1YJ9A 2NVQH 4C2MH 5DLQE 1PA6A 5IT9c 2Y0SE 1Y1VH 1N9WA 3ER0A 5IYCG 5C0XI 4DV4Q 1L1OA 1SLJA 4GN5A 4DV6L 1JJ2A 2GVAA 2UUAQ 4JI0Q 1XPUA 4A3LG 2R7FA 1MJEA 3MXNB 2UXDQ 5IE8A 4DR7Q 1VQGA 2KCTA 4IO9A 1QZGA 1W3SA 4B3TL 4BY7H 3IRBA 2RCNA 4KHZA 4LUVA 3TS2A 4BA2I 4UY8C 2B63H 4LF9Q 3BZCA 4Y52H 1OXSC 1C7YA 4X64L 5LMUL 4TQUS 1XMOL 3BU2A 4JBKA 4NXNQ 3J7A5 3M4OH 3HOWH 3M9BA 4A3FH 4A93H 4ALPA 4A3DG 1A63A 2KHIA 1YJWA 1HJPA 5EAYA 1VQPA 4LF4Q 3STBD 3AFPA 1VQ8A 4GLXA 2R6GA 4K0KQ 3L2PA 1W2BA 3JAMi 3E0EA 1N8RC 1Q82C 3HOUG 1S3OA 4LF6Q 5GAGC 5JEAJ 4BY1G 3I4MG 2HT1A 4YWLA 3CCRA 4GOPB 4A3JG 1J5EL 1XNRL 4DV7L 4L5SA 1BBUA 3K0XA 3PUVA 4DV5L 2UUCQ 1N33L 2I0QA 4HJ7A 4HJ9A 4R4OA 3CF5A 1KRSA 4GKKL 2VW9A 5IP7H 5M3FG 3ULJA 5C44H 4EQ5A 1N34L 2HIVA 4C3JH 4QGUA 1CKOA 3HOZH 3PO3H 1H95A 4JOIA 2K5NA 1UE6A 2CCZA 3HOXH 2OTJA 5FLXc 1YBYA 1I94L 1AE3A 2L15A 1XTDA 2D62A 1X3GA 5LMNL 3S15H 3CCLA 2UXCQ 2WB1G 1BVSA 5C0XJ 3BZKA 1IL2A 1IBLQ 1D8LA 3A74A 4JI1L 3A5UA 4B3SL 2LSSA 4LFAQ 4QQBX 1NE3A 1XJVA 3HKSA 1EQQA 1G6PA 2N49A 2RHQB 2UXBQ 1K0RA 1WCMG 4PZ7A 3AQQA 1VCIA 1FL0A 4YCUA 2JA8G 1L0WA 4AYBG 1MKHA 2DGYA 1KRTA 4DV4L 5M5YH 2ZJQA 4JG2A 3F2BA 1Q86C 2ASBA 1X55A 5HGQA 3PO2H 4XTCS 2YYZA 4P72A 1K8GA 4JI0L 4A3MG 2BH2A 4IJLA 1PH1A 4IPCA 1PFSA 5C4XH 4DK6C 5LMNW 4P73A 2UXDL 2N3SA 5GADC 3G6EA 4DR7L 4AQYQ 2H5XA 3J81i 2K52A 4GLVB 2CFMA 4B3TQ 1M1KC 1YEZA 4LF5Q 3CCEA 1HZCA 1NMGA 1VQLA 1B8AA 3CCSA 4DAMA 3PF5A 5IY0A 3H3VI 3HOYG 3DM3A 2E2JH 2Q2TA 1CKMA 2NN6I 1Q12A 4X64Q 1VQ5A 4UP9A 5LMUQ 1A8VA 1XMOQ 4QY7A 4LUZA 3OW2A 1Q1BA 4MNOA 1D7QA 3RN5A 3GO5A 3K7UC 1Q7YC 1PH6A 3M7NA 3AEVA 4LF4L 1JE5A 2BH8A 4JC0A 1OTCA 1Y1VG 4IPDA 3G71A 2I5MX 3MEFA 4LF6L 4IOAA 2PI2E 4WJ4A 4L5QA 4QL5A 4DUYL 4A3EH 4APVA 1S40A 2ZTDA 2Y0SG 1VQOA 4DR1Q 1XNRQ 2EXDA 4RMFA 3GDEA 4A3BG 3JAMc 2MNAA 1PYSB 1OXXK 5M5XH 1WOCA 3NENA 3KF6B 2B63G 1I3QH 4MZ9A 4GKJQ 3HKZE 4IPHA 2ZM6Q 3KFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SN8 A;  2JK8 A;  5FLM H;  2MQH A;  1VQ6 A;  1Q81 C;  3H0G H;  1G29 1;  3CW2 C;  1PH5 A;  4OO1 I;  1TWC H;  5IYD G;  1LUZ A;  1EFW A;  2F4V Q;  1PH3 A;  2A1A A;  2ZJR A;  3GTL H;  4IFD I;  2QEX A;  2IT1 A;  3EBE A;  1Y1W H;  2Z0S A;  3J80 c;  4A3K H;  2OWO A;  3TQY A;  1X6O A;  1IYJ B;  1NMF A;  4BBS G;  5JJL A;  1S72 A;  1IBL L;  1LTL A;  4LFA L;  1VQN A;  2JEA I;  1C9O A;  4JI1 Q;  3RZD H;  4B3S Q;  3I4N G;  1I6H H;  4KHP Q;  1E1O A;  5IWA Q;  4UPA A;  3GTM H;  4JI5 Q;  2CWA A;  1EQR A;  4BA1 I;  5GRO A;  3KJP A;  3M4Q A;  3CCU A;  2JA6 H;  1B70 B;  3F1Z A;  1VQH A;  3PIP A;  3GTJ H;  2JA5 H;  4DR6 L;  4OON A;  1HNZ Q;  1UE7 A;  3CCQ A;  1BBW A;  3H3V H;  2LXK A;  4GOP C;  1K3R A;  3HOX G;  4A3C G;  1NBW A;  1GO3 E;  3L0O A;  3S17 H;  1C0A A;  2XTI A;  3RLO A;  3K81 C;  4AQY L;  4JYA Q;  1R9T H;  2R93 H;  2I5L X;  1E24 A;  4LF5 L;  2VQE L;  1TWA H;  3FKI H;  1O7I A;  2F52 A;  5C0X G;  3I56 A;  5IP9 G;  1K83 H;  3J81 c;  2YU9 H;  1CSP A;  4LWC A;  1Q46 A;  3NBH B;  1A62 A;  2IX0 A;  4AIM A;  1N36 Q;  4A76 A;  2OQK A;  4BBR G;  4QJF A;  4LF8 L;  4JI7 L;  1E22 A;  2V1C C;  3KDF B;  4GN4 B;  1NTG A;  3TRZ A;  4DR3 Q;  2Z6K C;  1YHQ A;  1U0L A;  5BR8 Q;  1EIY B;  3HOV H;  1PV4 A;  3GTK H;  4R4I A;  5C4X G;  1TWF H;  4DR1 L;  4DUY Q;  2R7Z H;  4DV2 Q;  4HJ5 A;  1JB7 A;  4IFD J;  1VQM A;  2PI2 A;  5HY6 A;  2LXJ A;  4P74 A;  3EN2 A;  1PH2 A;  5FJ8 G;  2ZM6 L;  5GAH C;  2ES2 A;  2E2H H;  1EUJ A;  2QGQ A;  1QUQ B;  3T1Y Q;  1VQF A;  2EIF A;  3J80 i;  4JI6 L;  4P71 A;  5M3M H;  2F4V L;  4GKJ L;  1OXU A;  1PH9 A;  3UDG A;  3S2H H;  4JI2 Q;  3D31 A;  1OXT A;  5M5W H;  4A3I G;  3ULL A;  1B7Y B;  1PH7 A;  2Q2U A;  3CC2 A;  1KIX A;  4DR4 Q;  1WI5 A;  2RF4 A;  1E3P A;  2MO1 A;  2B3G A;  5H1S E;  1XPO A;  5C3E G;  2RHS B;  4OWX B;  5IYB H;  1DGS A;  2A19 A;  1Q8K A;  4A3G H;  4X6A H;  3CPW A;  2GVB A;  2VUM G;  1TWH H;  4KHP L;  1VQB A;  1LM0 A;  4R4T A;  5IWA L;  4JI5 L;  1NJI C;  2NVT H;  2VQF L;  3HFZ B;  4HJA A;  4AH6 A;  3CMA A;  5IYC H;  1HNZ L;  4BXX G;  2PNH A;  4O0A A;  1HNX L;  4JBW A;  1QZH A;  4A3L H;  5JJI A;  3HKZ G;  4UP7 A;  3J7Z C;  2UUB Q;  4NXM Q;  1HH2 P;  3KDF A;  3W5O A;  4GNX B;  1X65 A;  4DPG A;  4JYA L;  2AHO B;  1CSQ A;  3NEM A;  4YCW A;  4LF7 L;  1FVI A;  1Y1W G;  1ASY A;  2VZA A;  2VQE Q;  4GN3 B;  2FXQ A;  4KI0 A;  4PZ6 A;  4GOP A;  4OWT B;  2JA7 G;  1E7Z A;  1RL2 A;  1X9N A;  2A8V A;  2I5H A;  1GVP A;  2AMC B;  1N36 L;  1VQE A;  3A0J A;  4A3D H;  2HHH Q;  3J81 j;  4OXP A;  1LYL A;  4R4Q A;  1X54 A;  2YTY A;  4LF8 Q;  2YV5 A;  3Q8D A;  4L5R C;  4DR3 L;  3T1H Q;  1V1Q A;  4IJH A;  1PH4 A;  4JI7 Q;  1VQA A;  3KJO A;  1U5K A;  3RZO H;  2N78 A;  5BR8 L;  1KC8 C;  3HOU H;  1IZ6 A;  4YCV A;  2NN6 G;  4BY1 H;  3I4M H;  4DUZ Q;  4DV3 Q;  4C3H H;  4A3J H;  2KHJ A;  4TVA B;  4PG3 A;  4DV2 L;  2IX1 A;  3AYH B;  1FJG Q;  2GN5 A;  1KXL A;  4BY7 G;  4WJ3 M;  2K5H A;  2Z6K A;  3GTO H;  1TXY A;  1BKB A;  1HZA A;  1P8L A;  3UE0 A;  3DLL A;  1AH9 A;  5C4J H;  4H02 A;  1L1O B;  4HIK A;  3T1Y L;  2OCE A;  3U4V A;  4B3R Q;  1MJC A;  1WJJ A;  3HOW G;  1YHA A;  1VQ4 A;  4LUO A;  4A3F G;  4JI6 Q;  4JI2 L;  4A93 G;  1IBK Q;  1Z9F A;  1PYB A;  4DV1 Q;  1K9M C;  3GTQ H;  1V43 A;  2JQO A;  2PMZ E;  3PUW A;  4DR4 L;  4POF A;  3M85 A;  2VS1 A;  3RN2 A;  4PMW A;  2R92 H;  1UWV A;  2JJQ A;  4JI3 Q;  3M4P A;  2VY3 A;  5JEA G;  4B3M Q;  2CWP A;  4LNQ A;  4GNX A;  4DV0 Q;  1AE2 A;  3CQZ H;  4JI4 Q;  4NB3 A;  4DK3 C;  1WCM H;  3S2D H;  3ULP A;  4IFD G;  2JA8 H;  5IP7 G;  3CME A;  1QVF A;  5C44 G;  3BJU A;  3ERS X;  2VQF Q;  4JI8 Q;  2WFW A;  3KLW A;  1XNQ Q;  3M3Y H;  1KQS A;  3HOZ G;  3PO3 G;  2DUD A;  4J15 A;  4X62 L;  1JJC B;  2C35 B;  2AWO A;  4A3M H;  1HNX Q;  5AJ3 Q;  2K75 A;  2UUB L;  4NXM L;  3S1M H;  4JBJ A;  3S24 A;  1SRU A;  4HID A;  2D0P A;  3VDY A;  1PH8 A;  1EIF A;  1HZB A;  2WAQ E;  3S14 H;  1X56 A;  1X3F A;  1YIJ A;  3PUZ A;  4X65 Q;  3LGJ A;  4LF7 Q;  3HOY H;  4DR2 Q;  1QVG A;  1EWI A;  3S16 H;  1T9H A;  3F8T A;  3KF8 B;  3FHW A;  3L7Z C;  3UDF A;  4YY3 Q;  3S1R H;  1HR0 W;  5GQO A;  2HHH L;  2E5L Q;  4DR5 Q;  3B6Y A;  2F3I A;  1VQD A;  2JA9 A;  2ZTE A;  2K4K A;  1Q1E A;  1J6Q A;  1CKN B;  3KF6 A;  3PCO B;  3PSI A;  1KL9 A;  3UDX A;  3T1H L;  2VL6 A;  1M90 C;  2ID0 A;  1V9P A;  3PO2 G;  4DUZ L;  3OTO Q;  3F2C A;  4DV3 L;  1K8A C;  1UE5 A;  3CPF A;  2KCM A;  3U58 A;  3CCV A;  3CC7 A;  4A3B H;  3D0F A;  2NVX H;  1FJG L;  2ATW A;  5J3B A;  3I2Z A;  4POG A;  3PUY A;  3K80 C;  3ICE A;  5K36 G;  4LFB Q;  4OWW B;  1Z47 A;  4JCV E;  1Y14 B;  1GM5 A;  2JE6 I;  2YTV A;  1VQ7 A;  4GS3 A;  1VQK A;  2PQA B;  3CC4 A;  1UEB A;  4B3R L;  2R7D A;  3UE1 A;  1MIU A;  5IYD H;  4GNX C;  3OYY A;  3GTG H;  3A5Z B;  1IBK L;  1VQJ A;  2BA0 A;  3CCM A;  4DV1 L;  4JV5 Q;  3FP9 A;  1N32 Q;  3EIV A;  2VNU D;  3RNU A;  3PF4 A;  1YNX A;  1WYD A;  4BBS H;  1FGU A;  2NZO A;  4JI3 L;  4IPG A;  2XGT A;  1VQ9 A;  2ZJP A;  4B3M L;  3U4Z A;  4DV0 L;  4LW1 A;  3SGI A;  3GD7 A;  4A3E G;  4JI4 L;  3I4N H;  1HNW L;  1VQI A;  3W1G A;  2KEN A;  4R1J A;  1A0I A;  4O2D A;  2Q2H A;  1SRO A;  2EQS A;  3S1Q H;  1HR0 Q;  4JI8 L;  3PGZ A;  2HIX A;  2IHF A;  1XNQ L;  3PUX A;  5E7N A;  4LFC L;  4X66 Q;  5FLM G;  2AKW B;  5AJ3 L;  2K5V A;  4A3C H;  4X62 Q;  3E9H A;  3H0G G;  1XMQ Q;  4Y7N H;  1CKN A;  1L2F A;  2OQ0 A;  2AWN A;  2KBN A;  1YZ6 A;  3UDI A;  2IY5 B;  1JMC A;  4X65 L;  3I55 A;  1EYG A;  4YHH Q;  4DR2 L;  1UE1 A;  4A3K G;  1YVC A;  2R92 G;  5JJK A;  5IP9 H;  1I50 H;  3I4O A;  4C3I H;  3S1N H;  3WWV A;  1L1O C;  4HJ8 A;  2YTX A;  1E1T A;  1IBM Q;  4YY3 L;  1X3E A;  4YWK A;  4HIM A;  4DNI A;  2CQO A;  3K7A H;  4BBR H;  2E5L L;  4DR5 L;  4JBM A;  2QA4 A;  2UU9 L;  3STB C;  1KAW A;  2WP8 J;  4OX9 Q;  1PVO A;  1VQC A;  2OTL A;  1ASZ A;  2E2I H;  2JA6 G;  2MFI A;  4UP8 A;  2JA5 G;  2PQA A;  3G4S A;  1SE8 A;  4DV6 Q;  1QUQ A;  3E9I A;  3OTO L;  2UUA L;  1CUK A;  3ZJY C;  1NY4 A;  2ALY B;  5GAE C;  2NZH A;  5ELO A;  3TS0 A;  1P16 A;  1XPR A;  2R93 G;  3KOJ A;  1RIP A;  4LF9 L;  3CP0 A;  4L5T A;  4OO1 G;  2NVY H;  5M3F H;  2D0O A;  3CAM A;  3PIO A;  5FJ8 H;  4LFB L;  1K73 C;  2IHE A;  3FKI G;  2WAQ G;  1KD1 C;  4NXN L;  4EX5 A;  2ZTC A;  2CKZ B;  3U50 C;  2JEB I;  4R4C A;  1TWG H;  4RG1 A;  4A75 A;  1VS0 A;  2WB1 E;  4GLA C;  3W1B A;  4A3I H;  4JV5 L;  3RR5 A;  1N32 L;  3RLN A;  1WFQ A;  3I7F A;  3NEL A;  4K0K L;  1IXR A;  2K50 A;  2BA1 A;  1YI2 A;  4DAY B;  1QVC A;  3HOV G;  5C3E H;  4JOI C;  2K14 A;  4XIG S;  3G48 A;  3CCJ A;  1J5E Q;  4YWM A;  4DV7 Q;  1KHI A;  2UUC L;  2VUM H;  4AYB E;  4DV5 Q;  1HNW Q;  1N33 Q;  2B29 A;  1YIT A;  2R7Z G;  3RLF A;  4GKK Q;  4HIO A;  1HR0 L;  1N34 Q;  2MO0 A;  3K8A A;  4BXX H;  3KYH C;  3CD6 A;  1HZ9 A;  4IOC A;  4X66 L;  4DKA C;  1OXV A;  4LFC Q;  1XMQ L;  1I5F A;  3TEH B;  4MTN A;  3H15 A;  1I94 Q;  5M3M G;  2HQL A;  4FDB A;  1GD7 A;  4NPS A;  1SFO H;  4KLK A;  4ME3 A;  3F2D A;  5LMN Q;  3PV0 A;  2N8N A;  2UXC L;  4PZ8 A;  4YHH L;  1JJG A;  1JT8 A;  3JC6 6;  1EOV A;  4QIW E;  2JA7 H;  4DR6 Q;  4P75 A;  5ELN A;  1IBM L;  4A4I A;  5IYB G;  1GKH A;  1YJN A;  1SMX A;  2UXB L;  4A3G G;  1G51 A;  2Q2I A;  3TRE A;  2E8G A;  1SR3 A;  3CXC A;  1PHJ A;  3AFQ A;  2UU9 Q;  4OX9 L;  3GTP H;  1YHB A;  1YJ9 A;  2NVQ H;  4C2M H;  5DLQ E;  1PA6 A;  5IT9 c;  2Y0S E;  1Y1V H;  1N9W A;  3ER0 A;  5IYC G;  5C0X I;  4DV4 Q;  1L1O A;  1SLJ A;  4GN5 A;  4DV6 L;  1JJ2 A;  2GVA A;  2UUA Q;  4JI0 Q;  1XPU A;  4A3L G;  2R7F A;  1MJE A;  3MXN B;  2UXD Q;  5IE8 A;  4DR7 Q;  1VQG A;  2KCT A;  4IO9 A;  1QZG A;  1W3S A;  4B3T L;  4BY7 H;  3IRB A;  2RCN A;  4KHZ A;  4LUV A;  3TS2 A;  4BA2 I;  4UY8 C;  2B63 H;  4LF9 Q;  3BZC A;  4Y52 H;  1OXS C;  1C7Y A;  4X64 L;  5LMU L;  4TQU S;  1XMO L;  3BU2 A;  4JBK A;  4NXN Q;  3J7A 5;  3M4O H;  3HOW H;  3M9B A;  4A3F H;  4A93 H;  4ALP A;  4A3D G;  1A63 A;  2KHI A;  1YJW A;  1HJP A;  5EAY A;  1VQP A;  4LF4 Q;  3STB D;  3AFP A;  1VQ8 A;  4GLX A;  2R6G A;  4K0K Q;  3L2P A;  1W2B A;  3JAM i;  3E0E A;  1N8R C;  1Q82 C;  3HOU G;  1S3O A;  4LF6 Q;  5GAG C;  5JEA J;  4BY1 G;  3I4M G;  2HT1 A;  4YWL A;  3CCR A;  4GOP B;  4A3J G;  1J5E L;  1XNR L;  4DV7 L;  4L5S A;  1BBU A;  3K0X A;  3PUV A;  4DV5 L;  2UUC Q;  1N33 L;  2I0Q A;  4HJ7 A;  4HJ9 A;  4R4O A;  3CF5 A;  1KRS A;  4GKK L;  2VW9 A;  5IP7 H;  5M3F G;  3ULJ A;  5C44 H;  4EQ5 A;  1N34 L;  2HIV A;  4C3J H;  4QGU A;  1CKO A;  3HOZ H;  3PO3 H;  1H95 A;  4JOI A;  2K5N A;  1UE6 A;  2CCZ A;  3HOX H;  2OTJ A;  5FLX c;  1YBY A;  1I94 L;  1AE3 A;  2L15 A;  1XTD A;  2D62 A;  1X3G A;  5LMN L;  3S15 H;  3CCL A;  2UXC Q;  2WB1 G;  1BVS A;  5C0X J;  3BZK A;  1IL2 A;  1IBL Q;  1D8L A;  3A74 A;  4JI1 L;  3A5U A;  4B3S L;  2LSS A;  4LFA Q;  4QQB X;  1NE3 A;  1XJV A;  3HKS A;  1EQQ A;  1G6P A;  2N49 A;  2RHQ B;  2UXB Q;  1K0R A;  1WCM G;  4PZ7 A;  3AQQ A;  1VCI A;  1FL0 A;  4YCU A;  2JA8 G;  1L0W A;  4AYB G;  1MKH A;  2DGY A;  1KRT A;  4DV4 L;  5M5Y H;  2ZJQ A;  4JG2 A;  3F2B A;  1Q86 C;  2ASB A;  1X55 A;  5HGQ A;  3PO2 H;  4XTC S;  2YYZ A;  4P72 A;  1K8G A;  4JI0 L;  4A3M G;  2BH2 A;  4IJL A;  1PH1 A;  4IPC A;  1PFS A;  5C4X H;  4DK6 C;  5LMN W;  4P73 A;  2UXD L;  2N3S A;  5GAD C;  3G6E A;  4DR7 L;  4AQY Q;  2H5X A;  3J81 i;  2K52 A;  4GLV B;  2CFM A;  4B3T Q;  1M1K C;  1YEZ A;  4LF5 Q;  3CCE A;  1HZC A;  1NMG A;  1VQL A;  1B8A A;  3CCS A;  4DAM A;  3PF5 A;  5IY0 A;  3H3V I;  3HOY G;  3DM3 A;  2E2J H;  2Q2T A;  1CKM A;  2NN6 I;  1Q12 A;  4X64 Q;  1VQ5 A;  4UP9 A;  5LMU Q;  1A8V A;  1XMO Q;  4QY7 A;  4LUZ A;  3OW2 A;  1Q1B A;  4MNO A;  1D7Q A;  3RN5 A;  3GO5 A;  3K7U C;  1Q7Y C;  1PH6 A;  3M7N A;  3AEV A;  4LF4 L;  1JE5 A;  2BH8 A;  4JC0 A;  1OTC A;  1Y1V G;  4IPD A;  3G71 A;  2I5M X;  3MEF A;  4LF6 L;  4IOA A;  2PI2 E;  4WJ4 A;  4L5Q A;  4QL5 A;  4DUY L;  4A3E H;  4APV A;  1S40 A;  2ZTD A;  2Y0S G;  1VQO A;  4DR1 Q;  1XNR Q;  2EXD A;  4RMF A;  3GDE A;  4A3B G;  3JAM c;  2MNA A;  1PYS B;  1OXX K;  5M5X H;  1WOC A;  3NEN A;  3KF6 B;  2B63 G;  1I3Q H;  4MZ9 A;  4GKJ Q;  3HKZ E;  4IPH A;  2ZM6 Q;  3KFU A; 
#chains in the Genus database with same CATH topology
 2JK8 A;  5FLM H;  5BN5 A;  2KHS A;  3A54 A;  5IYD G;  1EFW A;  4IFD I;  2F0U A;  2OWO A;  4M8A A;  4LJZ C;  1AP0 A;  5J39 A;  5M5X B;  5IT9 L;  1VQN A;  2JEA I;  3EJI A;  5IWA Q;  4UPA A;  1NNX A;  4NKL A;  4CDF C;  4OON A;  1BBW A;  1LTS D;  2QIL A;  1EYA A;  5BN3 A;  5LL6 S;  1GO3 E;  4A3K B;  3S17 H;  4FF1 A;  3P20 A;  2RQX A;  4AQY L;  1E24 A;  4OO1 H;  2BDO A;  3CQZ B;  2HQE A;  3FKI H;  2D9U A;  3C1E A;  3I56 A;  1JB3 A;  3J81 c;  2CVR A;  4FXK C;  1LT3 D;  2JA5 B;  1N36 Q;  2B39 A;  1HTL D;  4OHJ A;  2V1C C;  3KDF B;  4GN4 B;  3TRZ A;  4N9P A;  5BR8 Q;  1HXY D;  2AQ1 B;  2FJ2 A;  1SNQ A;  1ESR A;  4R4I A;  2F4I A;  1BCP B;  4FO2 A;  1JB7 A;  5KEE A;  2C9O A;  2YU9 B;  4CJ2 C;  1YNN C;  1PTO H;  2Z4I A;  5GAH C;  4MHE A;  2ES2 A;  2CQA A;  4XQJ A;  1U4R A;  2K01 A;  2RDG A;  3HOV B;  1OXU A;  2D2C C;  1PH9 A;  3S2H H;  5C5L A;  1B7Y B;  1PH7 A;  2Q2U A;  1TWF B;  1EOT A;  1KIX A;  4DR4 Q;  5L37 A;  2B3G A;  5C3E G;  5IYB H;  4X6A H;  3CPW A;  1SSO A;  2VUM G;  1TWH H;  2NUC A;  4R4T A;  4MIU A;  5EJW A;  1QCB D;  5FLX E;  4AH6 A;  1A6X A;  1HNZ L;  4BXX G;  1HNX L;  2IWH A;  4KN7 C;  1EY5 A;  1FR3 A;  2BOS A;  1DOK A;  4UP7 A;  3ERQ A;  3J7Z C;  1HH2 P;  3KDF A;  3NTI A;  1X65 A;  4M1U B;  1TR5 A;  4YCW A;  5KYI A;  3ND9 A;  1Y1W G;  1EZ8 A;  4A3G B;  2F0Q A;  4GN3 B;  3RMH A;  1DYQ A;  4KI0 A;  5A35 A;  4GOP A;  4TRD A;  1A15 A;  2PW7 A;  3A0J A;  4CKC A;  4OXP A;  4L5R C;  1SXT A;  1PH4 A;  1VQA A;  1U5K A;  3A8I E;  2N78 A;  4DK0 A;  3ONA B;  4IUQ A;  5JOB A;  4RKL A;  4TVA B;  4XQQ A;  2F0I A;  3SDZ A;  2GN5 A;  3W2D A;  3GTO H;  1B4O A;  4U68 A;  4DNR B;  1TXY A;  1BKB A;  4A3D B;  3AB9 A;  3UE0 A;  3D6C A;  2FMM A;  4ZKB B;  3GP7 A;  2MPM A;  2OCE A;  5EKK A;  4B3R Q;  1WJJ A;  1VQ4 A;  4LUO A;  2F3V A;  3SVM A;  4JI2 L;  4BY1 B;  3I4M B;  4A93 G;  1PYB A;  5G3L F;  1W6K A;  1SND A;  1V43 A;  2PMZ E;  3FRP B;  4Q5V A;  1C48 A;  5JPM C;  2QEJ C;  1EQV A;  2ZXO A;  3M4P A;  2B8F A;  3CQZ H;  3C2P A;  4NB3 A;  1WCM H;  3S2D H;  3NBI A;  1IHZ A;  2A69 D;  2JSO A;  5C4J B;  3ULP A;  2EJM A;  4UHV A;  5IGC A;  5IP7 G;  3Q23 A;  3BJU A;  1SAP A;  2DJG C;  3FPU B;  1YNN D;  5C4H A;  3LWU A;  4C3J G;  4K14 A;  3GTQ B;  1HNX Q;  4X62 L;  1JJC B;  3J80 E;  2AWO A;  5AJ3 Q;  1FD7 D;  2UUB L;  3S24 A;  2WB1 B;  1SRU A;  2R92 B;  1PH8 A;  2EJG C;  1EY7 A;  2WAQ E;  1TII D;  1A2U A;  3QWN A;  4ZKC B;  3S16 H;  3F8T A;  3J7Y W;  3FHW A;  1HR0 W;  2JN4 A;  5GQO A;  2E76 C;  3PCO B;  4A3M B;  3UDX A;  1KL9 A;  4EVO A;  4TSS A;  2VL6 A;  1HHV A;  2ID0 A;  2A68 C;  3PO2 G;  3KLS X;  4DV3 L;  3FPP A;  3S14 B;  2KCM A;  1PTO C;  1U4L A;  1GUG A;  4A3B H;  1PZK D;  4POG A;  3S1R B;  4DGZ A;  1Y14 B;  4PMB A;  2C5C A;  1VQK A;  4GS3 A;  1MIU A;  3MWY W;  3GQB A;  1AW7 A;  4GNX C;  3GTG H;  1IBK L;  2J0T D;  2BA0 A;  4K5W A;  1FGU A;  3P75 A;  4JI3 L;  2O2L D;  2NVX B;  1EY9 A;  2HDM A;  4CBV A;  4B3M L;  2ZJP A;  1S5E D;  2P5Z X;  3NP8 A;  4DV0 L;  4JI4 L;  3TP6 A;  1SEB D;  5IGG A;  1HR0 Q;  4JI8 L;  2EYM A;  1XNQ L;  2NTT A;  5E7N A;  4LFC L;  2F0N A;  1NSN S;  5FLM G;  2K5V A;  1WTW A;  4X62 Q;  1XMQ Q;  1NCV A;  1QNU A;  2OQ0 A;  2KBN A;  1YZ6 A;  4RWS C;  3UDI A;  1XTC D;  1EYG A;  1G91 A;  5IP9 H;  2KEC A;  3S1N H;  1L1O C;  1IBM Q;  4YY3 L;  2DJF C;  4YWK A;  4KD4 A;  5M9O A;  2E5L L;  4JBM A;  2QA4 A;  1KAW A;  2XRQ D;  1VQC A;  1K8O A;  4UP8 A;  4Y7N B;  4HTH A;  3O13 A;  1QUQ A;  2L12 A;  1NY4 A;  5KND A;  3D8G A;  3TS0 A;  2NWG A;  2XN9 C;  1RIP A;  2B2W A;  3CP0 A;  4OO1 G;  5FJ8 H;  3K7A B;  2IHE A;  3FKI G;  3M4Y A;  4HAE A;  1TWG H;  3PIP 3;  2D5D A;  1CZG A;  4N8X 1;  1VF5 C;  4JV5 L;  1SYC A;  3I7F A;  4CGY B;  4K0K L;  3IFD A;  3V2T A;  5FO9 B;  1K28 A;  1YI2 A;  4DAY B;  3AU7 A;  4RGO S;  2K14 A;  2A68 D;  3G48 A;  2UUC L;  2NVY B;  5M3F B;  2RA4 A;  4X3K A;  4AYB E;  4DV5 Q;  5CGK A;  1PTO D;  3E3X A;  2K7V A;  1R4P B;  1FYC A;  2MO0 A;  2DNE A;  1SYD A;  3KYH C;  3CD6 A;  1OXV A;  3TBI B;  3ERO A;  4LFC Q;  1I5F A;  3TEH B;  3A55 A;  1JWM D;  2HQL A;  4FDB A;  1GD7 A;  5C3E B;  2XRS D;  1WTH A;  2VUM B;  1F77 A;  4DXF A;  1EOV A;  4QIW E;  4DR6 Q;  4K2L A;  5IYB G;  1GKH A;  2BDN A;  4Z9C B;  3NHH A;  3I72 A;  3CXC A;  3AFQ A;  4OX9 L;  1YHB A;  2CH4 W;  2SOB A;  5IT9 c;  2Y0S E;  1N9W A;  2NN6 H;  5DNF A;  1Y1W B;  2Z4H A;  4JI0 Q;  2R7F A;  3V05 A;  2KA7 A;  1EY6 A;  2L5T A;  5IE8 A;  1HQM C;  2RCN A;  3NTK A;  1B1Z A;  1RCV D;  2B63 H;  1X32 A;  3BS1 A;  1A3V A;  1EZ6 A;  4JBK A;  3J7A F;  3M9B A;  1HJP A;  2AUK A;  1VQP A;  1AN8 A;  3AFP A;  1VQ8 A;  4K0K Q;  1CM9 A;  5J22 A;  5KRU A;  1S3O A;  3E0J A;  2HT1 A;  3PQI A;  3CCR A;  4H44 C;  2UUC Q;  1I4H A;  2I0Q A;  1PFM A;  3J7A V;  4GKK L;  1H9M A;  2EYH A;  5C44 H;  1II3 A;  3HEJ A;  2HIV A;  3OIQ A;  3PO3 H;  4K6D A;  2J4X A;  4A93 B;  1F2Y A;  1UE6 A;  3NXW A;  5FK9 C;  1W6J A;  2OTJ A;  1YBY A;  3SK4 A;  1XTD A;  2D62 A;  1X3G A;  4QCL A;  1DON A;  3L9A X;  5LMN L;  4DN4 M;  4CJ0 B;  5C0X J;  1IBL Q;  1D8L A;  4JI1 L;  3HKS A;  1EQQ A;  4LMQ D;  4C3J B;  1WCM G;  2PZU A;  3QJY A;  4PZ7 A;  1VCI A;  3FDT A;  4FVM A;  3U9S A;  1KRT A;  2X6L A;  2ZJQ A;  3EFX D;  4JG2 A;  3F2B A;  3VA5 A;  2YYZ A;  4IPC A;  4EGV A;  3S15 B;  5LMN W;  4G4K A;  5EKI A;  3G6E A;  2H5X A;  5I9P A;  2K52 A;  4GLV B;  4LF5 Q;  1M1K C;  3I4L A;  1VQL A;  1LTG D;  1NMG A;  3CCS A;  5IY0 A;  2F03 A;  3P7J A;  3NWS A;  5DM6 3;  3SEB A;  4ZRZ A;  5M5Y B;  3RN5 A;  3GO5 A;  3PO2 B;  2NTS A;  1JE5 A;  4IPD A;  4LF6 L;  4G57 A;  4L5Q A;  4QL5 A;  4DUY L;  4KHV A;  1XYI A;  4DR1 Q;  2EXD A;  4A3B G;  2MNA A;  1AZQ A;  4KMU C;  1WOC A;  1B9M A;  3KF6 B;  1I3Q H;  3T16 A;  5ISR A;  1DD2 A;  4IPH A;  2MQH A;  4ODG A;  3H0G H;  4NMZ A;  2N55 A;  1LUZ A;  2F4V Q;  1LTI D;  2ZJR A;  1Y1W H;  1X6O A;  1I4P A;  5JJL A;  4LFA L;  2EY1 A;  1C9O A;  5E4W C;  4JI1 Q;  5KIX A;  5I6Y A;  4KHP Q;  5E4X A;  4JI5 Q;  3VA7 A;  5EBD A;  4BA1 I;  5D14 A;  3CCU A;  2JA6 H;  1VQH A;  3OOC A;  3LX0 A;  2EYP A;  4N9T A;  1IL8 A;  1U9R A;  1S5C D;  2Z9H A;  5EPK A;  3HOX G;  3HP3 A;  1F2M A;  1C0A A;  5IGD A;  2XTI A;  3RLO A;  2RDH A;  2R93 H;  4JYA Q;  5ELE A;  4U67 3;  1V8Q A;  5IP9 G;  3OPO A;  4O42 A;  1K83 H;  1B2T A;  3K5O A;  4NW2 A;  4LWC A;  3S9W A;  2OEO A;  4QJF A;  3TP5 A;  1E22 A;  2EYO A;  4DA2 A;  1L0X B;  4DR3 Q;  1EY0 A;  3S1M B;  1DXM A;  2A6E D;  1YHQ A;  3S17 B;  1EIY B;  1PV4 A;  2XNA C;  1LTB D;  1TVX A;  1JR0 D;  5C4X G;  3BYT B;  3H6M A;  3J81 E;  4DUY Q;  1BF4 A;  2QKI C;  3FKI B;  4GZY C;  4DV2 Q;  3TN2 A;  2PO4 A;  5FLX L;  2K05 A;  4XXE A;  1SDF A;  4P74 A;  5FJ8 G;  2ZM6 L;  3C46 A;  4HED A;  4IUU A;  1G2T A;  4JW0 A;  3T1Y Q;  3DUZ A;  1CA6 A;  3TDQ A;  4P71 A;  1ZEQ X;  3UDG A;  3G7L A;  3D31 A;  1OXT A;  3R3O A;  2RVL A;  2ENB A;  1WI5 A;  3TP8 A;  1RHP A;  2MO1 A;  4OEM B;  5JJZ A;  3D6W A;  1XPO A;  2RHS B;  4OWX B;  1SE2 A;  1FNV A;  1Q8K A;  1PTO B;  2VB3 X;  1V1P B;  1JOR A;  5IWA L;  1SNO A;  2F3W A;  1KLG D;  3HFZ B;  1TT2 A;  3K57 A;  4K8J A;  4FXG C;  5IYC H;  4RFB A;  2PNH A;  1WTX A;  5KNC A;  3S2H B;  5A2Q E;  4JBW A;  3G6J B;  5CV4 A;  3HKZ G;  4KY6 A;  4NXM Q;  4GNX B;  4DPG A;  2AHO B;  1FVI A;  4RKB A;  4FYD A;  5EGT A;  1WTR A;  4PZ6 A;  2JYO A;  1E7Z A;  2XWJ B;  1X9N A;  2MP1 A;  2A8V A;  2I5H A;  4ZCK A;  1H9S B;  1N36 L;  3SK5 A;  1LTR D;  1CZW A;  3J81 j;  3I3C A;  1X54 A;  2YV5 A;  4OO1 I;  2PNR C;  3T1H Q;  3JAM L;  5BR8 L;  3HOU H;  2EYL A;  2NN6 G;  4A3J H;  4C3H H;  3K5M A;  1GUO A;  1I6V C;  2KHJ A;  1D5X C;  1I4G A;  3OW7 A;  2QF7 A;  1NUC A;  1KXL A;  4WJ3 M;  2Z6K A;  4EQN A;  2XWB B;  1B9N A;  2M2L A;  1CQF A;  4RGT A;  1P8L A;  3J80 L;  1L1O B;  4HIK A;  1WTP A;  4WFN 3;  1SYB A;  3U4V A;  5CV5 A;  3BVZ A;  4F88 A;  4ZAI A;  2EXZ A;  4DV1 Q;  4DR4 L;  1G8Z D;  3PUW A;  1LO5 D;  3R2I A;  3GV3 A;  4POF A;  2VS1 A;  4KTA A;  4RH6 A;  1DM0 B;  1UWV A;  2JJQ A;  4QB4 A;  3FVQ A;  3IKJ A;  3I91 A;  4GNX A;  3GTO B;  5JVG 3;  1UNS A;  3VYT A;  3E5S A;  1HRJ A;  3CME A;  5C44 G;  3ERS X;  2LKV A;  5CMD A;  3NQI A;  3M3Y H;  3PO3 G;  4IAL A;  1H9S A;  2KCN A;  2K75 A;  2KED A;  4HR7 B;  3S1M H;  1QOH A;  1HZB A;  1X56 A;  4X65 Q;  1ILP A;  3LGJ A;  1WTV A;  3HOY H;  1WCM B;  2EVB A;  3SHL A;  3S2D B;  4ME5 A;  3UDF A;  2LY7 A;  3Q22 A;  5ELB A;  2TMP A;  2F3I A;  2JA9 A;  1LAC A;  3H94 A;  2K4K A;  4ABN A;  1S4Z A;  2B2Y C;  1JC7 A;  5IGB A;  1M90 C;  3F2C A;  1K8A C;  1UE5 A;  2B2U A;  2Z1C A;  2BCO A;  1LAB A;  3CC7 A;  3D0F A;  5CBE E;  3S16 B;  4FF4 A;  3I2Z A;  3ICE A;  4LFB Q;  2ZT9 C;  1GM5 A;  1IYU A;  2JE6 I;  2YTV A;  4ZQ3 A;  1VQ7 A;  2PQA B;  3CC4 A;  1UEB A;  4B3R L;  2R7D A;  4HMJ A;  1MHW C;  1VQJ A;  2PQE A;  1STY A;  2VNU D;  3FP9 A;  4IUT A;  3EIV A;  4A3B B;  4BBS H;  1D5M C;  1VQ9 A;  1GHK A;  4LW1 A;  1MD2 D;  3GD7 A;  3I4N H;  1HNW L;  2KEN A;  1EEI D;  2Q2H A;  1HUM A;  3KK7 A;  2EQS A;  1ENF A;  3F2U A;  3S1Q H;  3KLR A;  4MN3 A;  3GTG B;  1CT1 D;  1PXU A;  1PRT D;  4A3C H;  5AJ3 L;  3H0G G;  1L2F A;  5C5M A;  2F0W A;  4IUP A;  3NTH A;  1M8A A;  2IY5 B;  4YHH Q;  1UE1 A;  1YVC A;  5C0X H;  5JJK A;  1E1T A;  5LHY 1;  1S5B D;  2CQO A;  1ESF A;  2UU9 L;  4EQP A;  3STB C;  5K5P A;  1EIH A;  1PVO A;  2Z6B A;  2E2I H;  2JA6 G;  2MFI A;  2PQA A;  2F0D A;  2UUA L;  3E9I A;  3KLS A;  5C6A A;  2PPB C;  1HFN A;  3ZJY C;  1S5F D;  2ALY B;  1A3U A;  2NZH A;  4KD3 A;  1XPR A;  2R93 G;  3K5N A;  4LF9 L;  3S1N B;  4L5T A;  3CU7 A;  2K33 A;  2D0O A;  3CAM A;  2X69 A;  2M9V A;  2IX3 A;  1GUS A;  2JEB I;  4RGN A;  1KAB A;  1VMC A;  1H9J A;  4A75 A;  2WB1 E;  4A3I H;  3OWF A;  2E2D C;  1LT4 D;  1Y8N B;  1H9R A;  1QIL A;  4JOI C;  3CCJ A;  4YWM A;  1KHI A;  3VYU A;  4LK1 C;  1HNW Q;  4XYO A;  2B29 A;  2K28 A;  1WTQ A;  2B2T C;  4HIO A;  1HR0 L;  3QO2 A;  1N34 Q;  3K8A A;  4C1N K;  1TWG B;  1SYF A;  1HZ9 A;  4ZUJ A;  5CV7 A;  4JVZ A;  5I9O A;  3BDC A;  1XMQ L;  4MTN A;  3TME A;  1Y69 U;  4NPS A;  1SFO H;  4KLK A;  4WJW A;  2F0J A;  3PV0 A;  4I7A A;  2UXC L;  1JJG A;  4KKS A;  1JT8 A;  3VR2 A;  1IBM L;  1SMX A;  2UXB L;  3TRE A;  1M4V A;  3GTP H;  2UU9 Q;  1YJ9 A;  1L0Y B;  3HKZ B;  1QB5 D;  1RTN A;  5T1I A;  4YIJ A;  4DV4 Q;  3ER0 A;  5IYC G;  5CR3 A;  2UUA Q;  1XPU A;  3K0Y A;  3ZYY X;  4L63 B;  2UXD Q;  4DR7 Q;  1VQG A;  4BY7 H;  1WVL A;  3IRB A;  4X3T A;  4LF9 Q;  4Y52 H;  1OXS C;  1C7Y A;  3OMG A;  4WOR A;  1HTP A;  5IT9 E;  4TQU S;  3D4W A;  3HOW H;  2KHI A;  1PLF A;  1YJW A;  2KUM A;  3STB D;  4GLX A;  3JAM i;  1Q82 C;  3HOU G;  5JEA H;  5I2Y A;  1U4P A;  4A3J G;  4C3H G;  1SYG A;  4L5S A;  1BBU A;  3K0X A;  2B63 B;  1PYW D;  4DV5 L;  1CTM A;  4HJ7 A;  2RDF A;  4F8M A;  2VW9 A;  1STH A;  4HCS A;  2Q8T A;  1SBB B;  2K5Q A;  3BG3 A;  2F0O A;  3HOX H;  4X3S A;  5FLX c;  2L15 A;  1PFN A;  3NWT A;  3MC0 B;  2UXC Q;  1BO0 A;  3NPP A;  1BVS A;  1DOM A;  2R61 A;  1IL2 A;  4DR6 L;  3DM1 A;  3A74 A;  4B3S L;  4QQB X;  1B3Q A;  5C44 B;  5HGT A;  2RHQ B;  1K8M A;  3PO3 B;  2UXB Q;  1K0R A;  2FFK B;  1Y8P B;  1FL0 A;  3T56 B;  1MKH A;  1O7Z A;  2DGY A;  1F9S A;  2ASB A;  1RTO A;  1X55 A;  4KY5 A;  5HGQ A;  5D65 A;  4JI0 L;  4DK1 A;  5C4X H;  4HSP A;  2F0M A;  4CDD C;  4QMG A;  1YEZ A;  5K36 H;  1PZJ D;  3HOY G;  4K2K A;  3H3V I;  2E2J H;  1CKM A;  2NN6 I;  1VQ5 A;  1J8I A;  2NZ1 D;  4QY7 A;  1D7Q A;  1Q7Y C;  3M7N A;  3AEV A;  1ML0 D;  2RSO A;  1KDA A;  4JC0 A;  1Y1V G;  5C3X A;  3VYS A;  3G71 A;  4WJ4 A;  2PI2 E;  2QW7 A;  4A3E H;  3P1H A;  1EY4 A;  3CRK C;  2RBM A;  3JAM c;  2HUG A;  1OXX K;  2F0G A;  3HG9 A;  4DNT B;  1PFB A;  5TSS A;  4MZ9 A;  1CFM A;  4DAP A;  3K6O A;  5DEH A;  1KNA A;  4IQZ A;  1Q81 C;  3CW2 C;  2G9H D;  3Q0A A;  1TWC H;  1B44 D;  1A3T A;  2EPB A;  1PH3 A;  2A1A A;  2PYK A;  2RKS A;  3GTL H;  2Z0S A;  3J80 c;  2IJ0 A;  2DNC A;  1IYJ B;  1NMF A;  2WII B;  4BBS G;  1S72 A;  5F2D A;  1IBL L;  2F0S A;  1LLR D;  1I3Q B;  3RZD H;  4B3S Q;  3BVG A;  3I4N G;  5IGE A;  1I6H H;  4XDX A;  1E1O A;  3UI2 A;  3QOL A;  2QDL A;  3GTM H;  1ET6 A;  2CWA A;  1EQR A;  3U9O A;  4ZLT F;  2KEE A;  1B70 B;  3GTJ H;  3H0G B;  5CV6 A;  3VR6 A;  1PRT B;  3H3V H;  2LXK A;  4DXG A;  4CJ1 B;  4GOP C;  1XWE A;  2K32 A;  2G5D A;  3L0O A;  1R4Q B;  2F0V A;  1ET9 A;  2KVM A;  4A3C G;  3K81 C;  1R9T H;  4LF5 L;  1HA6 A;  1TWA H;  4DAY A;  1ENA A;  1O7I A;  2F52 A;  5C0X G;  4KKT A;  1CSP A;  1B53 A;  1Q46 A;  3NBH B;  1A62 A;  3WOF A;  2JA6 B;  4AIM A;  4A76 A;  5DAU A;  4LF8 L;  4QF4 A;  5COR A;  1MGS A;  4HN7 A;  1XXG A;  2NBF A;  2LS0 1;  1A2T A;  2R93 B;  1KDB A;  3GTK H;  4DR1 L;  3IAY A;  1I4X A;  1O7L A;  3K5L A;  2R7Z H;  4HJ5 A;  1K83 B;  2CW0 C;  4IFD J;  2PI2 A;  2SEB D;  3EN2 A;  1QJO A;  2SDF A;  1BR9 A;  2E2H H;  1C8C A;  2QGQ A;  1VQF A;  2EIF A;  2OT2 A;  4JI6 L;  3H09 A;  2PCF B;  5M3M H;  2F4V L;  4B9W A;  1YNJ C;  1HCZ A;  5M5W H;  4A3I G;  3ULL A;  3CC2 A;  5E1F A;  5H1S E;  3C3L A;  5EKL A;  4KHP L;  1VQB A;  1LM0 A;  4JI5 L;  3LWE A;  2NVT H;  1TY0 A;  2VQF L;  4HJA A;  4N8F A;  4O0A A;  3URY A;  1GUT A;  4JYA L;  1CSQ A;  4LF7 L;  4ILW A;  1ASY A;  5EQ0 A;  3RUZ A;  4V0B A;  4XYQ A;  2FXQ A;  3ITP A;  4BWG B;  1AFP A;  4OWT B;  1PTO F;  1RL2 A;  2KQ3 A;  4V19 0;  1GVP A;  2AMC B;  1VQE A;  2HHH Q;  1LYL A;  2YTY A;  4LF8 Q;  4DR3 L;  1V1Q A;  3KJO A;  4HMI A;  3RZO H;  3SR1 A;  1IZ6 A;  4DUZ Q;  1STE A;  3GV6 A;  4DV2 L;  3FEW X;  2IX1 A;  3AYH B;  1FJG Q;  5KNB A;  4BY7 G;  2K5H A;  2B8G A;  5IOC A;  3NUC A;  1AH9 A;  3MZ5 A;  3DLL A;  1AZP A;  4H02 A;  3NK9 A;  3T1Y L;  2H1E A;  5JPN C;  1MJC A;  3HOW G;  3HOU B;  3D3R A;  4JI6 Q;  4A3J B;  3MHB A;  2JQO A;  4C3H B;  2NB0 A;  1K9M C;  1EFI D;  1RD9 D;  2L11 A;  1GJX A;  2VY3 A;  5JEA G;  2CWP A;  2EY2 A;  4LNQ A;  2PZT A;  1AE2 A;  3H3V C;  1B50 A;  4E6I A;  1F9Q A;  2JA8 H;  2VQF Q;  2CW0 D;  2EJF C;  2WFW A;  2AUJ D;  5FO8 B;  5JAV A;  4NXM L;  1GHJ A;  2G9D A;  2D0P A;  2MUY A;  2WAC A;  3VDY A;  3MAQ A;  3MVV A;  3CHB D;  2FIN B;  1YIJ A;  1MBY A;  1YNJ D;  4LF7 Q;  3BDL A;  4DR2 Q;  1EWI A;  1EYC A;  2FHT A;  1UUP A;  1QVG A;  2XVS A;  1T9H A;  4UDU C;  3KF8 B;  4TKO B;  1HFG A;  1JOK A;  3B6Y A;  3DXJ C;  4DR5 Q;  3M3Y B;  1VQD A;  2ZTE A;  3KF6 A;  1JMC A;  1Q1E A;  3T1H L;  1BBX C;  2JXM B;  2B2W C;  2E74 C;  1V9P A;  1D1I A;  1SNP A;  1F9R A;  3OTO Q;  3T13 A;  3CPF A;  3IFT A;  3U58 A;  1LV9 A;  3K58 A;  5EPJ A;  3HOY B;  4PQX A;  1QWY A;  2PW5 A;  5J3B A;  1D5Z C;  1SE4 A;  2LFN A;  3K80 C;  3PUY A;  2F0P A;  5K36 G;  3SK8 A;  1Z47 A;  4JCV E;  3T4A C;  4H7B A;  4G7H C;  3UE1 A;  4ULL A;  2EYF A;  4DV1 L;  1N32 Q;  4HCE A;  1JE4 A;  2H4O A;  1IYV A;  3T53 B;  1CHP D;  1STN A;  4IPG A;  2XGT A;  1DJR D;  3U4Z A;  1BUV T;  4A3E G;  3DWP A;  1BCP F;  1V1O A;  3W1G A;  4R1J A;  1A0I A;  4O2D A;  4PV1 C;  1G6Z A;  3KF8 A;  3LNN A;  2IHF A;  1QNK A;  1EY8 A;  2F0T A;  2F0H A;  4K5V A;  4X66 Q;  4ID6 A;  3E9H A;  1H9K A;  2B2T A;  4BBS B;  4CDE C;  2F0K A;  1ZXT A;  4X65 L;  3I4N B;  3DEO A;  2I46 A;  2R92 G;  1I50 H;  3I4O A;  4C3I H;  4RAU C;  4HJ8 A;  2YTX A;  2F0F A;  3S1Q B;  3RD4 A;  1PMR A;  1X3E A;  1EEF D;  4BBR H;  4NP5 A;  1ONL A;  1ZKO A;  2WP8 J;  3DWQ A;  1DZ1 A;  3G4S A;  3M7G A;  4DV6 Q;  1TQO A;  4L8J A;  1LT5 D;  1HPC A;  3SE0 A;  5T1G A;  1UAP A;  5ELO A;  5LL6 X;  3PIO A;  4LFB L;  1HQR D;  1K73 C;  4G7O C;  2WAQ G;  1KD1 C;  4H13 C;  4EX5 A;  2ZTC A;  1V1P A;  2CKZ B;  2E2I B;  4R4C A;  5E3F A;  2QDB A;  1VS0 A;  4GLA C;  3RR5 A;  1WFQ A;  1KDC A;  3KBX A;  1K3B C;  2K50 A;  3PMF A;  1SJH D;  1J5E Q;  4DV7 Q;  1N33 Q;  2L0C A;  5EBC A;  3RLF A;  2R7Z G;  1QG7 A;  1STA A;  2EZV A;  4A3I B;  4IOC A;  5ELF A;  4DKA C;  4DFA A;  1MSG A;  3H15 A;  1I94 Q;  5M3M G;  3A8K E;  4ME3 A;  1EU4 A;  3EVQ A;  2N8N A;  4K6L A;  4PZ8 A;  4Q0F A;  4YHH L;  3JC6 6;  4XT3 B;  1E2V A;  2EY5 A;  2JA7 H;  2KCC A;  1WD1 A;  1E2W A;  5ELN A;  4A4I A;  1EWH A;  2Q2I A;  2E8G A;  5BN4 A;  3MXP A;  2NVQ H;  4QUC A;  4C2M H;  4LAA A;  1MSH A;  1JCK B;  2WKD A;  1Y1V H;  5G3L D;  2ZXR A;  5C0X I;  1L1O A;  1SLJ A;  4GN5 A;  1SFO B;  1JJ2 A;  2Q8R E;  4K5X A;  1MJE A;  3MXN B;  2KCT A;  1QZG A;  1W3S A;  3QB3 A;  1BDO A;  3TS2 A;  4RA8 A;  4UY8 C;  3BZC A;  4JK1 C;  1JOQ A;  3QR8 A;  4X64 L;  3GTP B;  5LMU L;  1XMO L;  3M4O H;  3J7A 5;  2E75 C;  4A3F H;  1A63 A;  4ZUI A;  4FNF A;  5NUC A;  2EYJ A;  4IUR A;  4LF4 Q;  2R6G A;  1W2B A;  3E0E A;  1N8R C;  2PZW A;  4BY7 B;  4KJO A;  5GAG C;  1FNW A;  2MHV A;  4YWL A;  4GOP B;  1XNR L;  2A69 C;  3PUV A;  3QG1 A;  4I7Z C;  1IW7 C;  4R4O A;  3R8B A;  4IFD H;  2ICI A;  3CF5 A;  5M3F G;  3ULJ A;  4EQ5 A;  1N34 L;  3HOW B;  3MXU A;  4QGU A;  1CKO A;  3HOZ H;  2JP1 A;  2IW3 A;  1Q90 A;  4K8I A;  5JVH 3;  3HGB A;  3E6Z X;  4BS9 A;  3L3O C;  3WOE A;  2ICE C;  5ELC A;  5FO7 B;  3CCL A;  3KBG A;  4S3S A;  1JWU D;  3MXN A;  5IOD A;  2LSS A;  1NE3 A;  1XJV A;  3PIO 3;  4ZYS A;  2N49 A;  4H0L C;  4KY7 A;  2JA8 G;  1L0W A;  4AYB G;  3MA2 B;  3HOX B;  4DV4 L;  1Q86 C;  5CV8 A;  4XTC S;  4P72 A;  1GXD C;  4IJL A;  4DK6 C;  1O7Y A;  4P73 A;  2UXD L;  2N3S A;  5C3W A;  5GAD C;  4DR7 L;  4AQY Q;  5C4Z A;  2CFM A;  4XQN A;  1JIC A;  3IL8 A;  1HZC A;  2BE5 C;  3NE5 B;  4I65 A;  3SK6 A;  1VF7 A;  2K6A A;  3OWE B;  3DM3 A;  2Q2T A;  1Q12 A;  4X64 Q;  4CKB A;  1OO9 B;  2SNS A;  5LMU Q;  1A8V A;  1XMO Q;  5I6W A;  4LUZ A;  1PH6 A;  5C4X B;  5FKA C;  4RCO A;  1OTC A;  3I90 A;  3OHX C;  2ZTD A;  2B2V C;  2Y0S G;  1XNR Q;  4RMF A;  3GDE A;  1WD0 A;  2E2J B;  1PYS B;  5M5X H;  3HZX A;  3QIA A;  3NEN A;  1SYE A;  1STG A;  1ENC A;  3HKZ E;  1CI3 M;  2Q8I B;  2EOT A;  1SN8 A;  2I07 B;  4DAV A;  1VQ6 A;  1G29 1;  1PH5 A;  4J6H A;  5KYL A;  1TKW B;  3WDN A;  4F87 A;  2QEX A;  2IT1 A;  4A3E B;  3EBE A;  3JAM E;  4A3K H;  3DEP A;  3TQY A;  4WRD A;  2AQ3 B;  5CBA E;  1LTL A;  3NSW A;  4RHR A;  2DY8 A;  4KJN A;  4L6T B;  1IW7 D;  1I4Q A;  5GRO A;  3M4Q A;  3KJP A;  4R8N A;  3PIP A;  3F1Z A;  2JA5 H;  1TWC B;  1HNZ Q;  1UE7 A;  3CCQ A;  3GTL B;  1K3R A;  2L55 A;  1NBW A;  1STB A;  1O80 A;  2PMZ B;  2I5L X;  2VQE L;  3ND8 A;  3RZD B;  1I6H B;  3KUP A;  3GTM B;  4C3I G;  4R8I A;  2YU9 H;  2IX0 A;  3GTJ B;  3EQL C;  5CV9 A;  2OQK A;  4BBR G;  4G7Z C;  2WKC A;  4JI7 L;  1NTG A;  2Z6K C;  1PRT F;  1U0L A;  4KKU A;  1T5X D;  1Q8I A;  3HOV H;  1R9T B;  5DM7 3;  1TWF H;  1TWA B;  5D3D A;  2WAQ B;  1UEA B;  1S5D D;  1VQM A;  2XIW A;  5HY6 A;  2LXJ A;  1PH2 A;  2BE5 D;  1U4M A;  1EWC A;  2AQ2 B;  1EUJ A;  1QUQ B;  4KV6 A;  2M00 A;  3J80 i;  4FF3 A;  3EA6 A;  3CKI B;  4GKJ L;  1ZYR C;  4JI2 Q;  4B08 A;  1IKL A;  3GTK B;  4C56 C;  2N88 A;  3HS0 C;  3Q6S A;  2RSN A;  2RF4 A;  1E3P A;  2R7Z B;  1EU3 A;  3C1F A;  4IN3 A;  5J1Z A;  1HA5 A;  1XX8 A;  1DGS A;  2A19 A;  4A3G H;  2GVB A;  3H91 A;  4CDC C;  3R93 A;  1NJI C;  2E2H B;  3CMA A;  1D6E C;  5M3M B;  1J9O A;  1QZH A;  5M5W B;  4A3L H;  1SNM A;  5JJI A;  2UUB Q;  3W5O A;  4O1N A;  3NEM A;  1CK1 A;  2VZA A;  2VQE Q;  2IPK D;  1E2Z A;  1BNZ A;  2JA7 G;  2NVT B;  3V96 A;  2B2U C;  4OIJ A;  4A3D H;  2ZXP A;  4R4Q A;  2EY6 A;  1SMY C;  3SXH A;  3Q8D A;  4IJH A;  4JI7 Q;  5EPL A;  1HUN A;  1KC8 C;  4DU9 A;  2IL8 A;  1JQY D;  4YCV A;  4BY1 H;  3I4M H;  1ICF B;  4DV3 Q;  1X3P A;  4PG3 A;  5FOB B;  1KNE A;  3DMU A;  2HDL A;  5CC4 A;  1HZA A;  3MFY A;  5C4J H;  2Z8L A;  1F2L A;  2HCC A;  3RZO B;  3HRZ C;  4NDX A;  4R9W A;  1YHA A;  2K03 A;  2A5H A;  4A3F G;  2L1B A;  1IBK Q;  1Z9F A;  3GTQ H;  4GKJ Q;  1RF2 D;  3I70 A;  3M85 A;  3RN2 A;  2X6G A;  4PMW A;  2R92 H;  4JI3 Q;  4B3M Q;  4P2C B;  3DHQ A;  4FF2 A;  4DV0 Q;  1K0S A;  2VB2 X;  4JI4 Q;  1TS5 A;  3R2T A;  1KTK A;  4DK3 C;  1TS3 A;  4IFD G;  1QVF A;  1EYD A;  5IGF A;  1BXT A;  2VXW A;  4JI8 Q;  3KLW A;  1XNQ Q;  1KQS A;  3HOZ G;  4UAI A;  3VR5 A;  2DUD A;  4J15 A;  4A3M H;  2C35 B;  2CHB D;  1BCP C;  4JBJ A;  3J81 L;  4HID A;  1EIF A;  3S14 H;  1X3F A;  1ZYR D;  5I2X A;  3PUZ A;  4KN4 C;  1TS2 A;  1Y8O B;  3L7Z C;  2JA8 B;  4AYB B;  4YY3 Q;  3S1R H;  2HHH L;  2E5L Q;  3VR4 A;  1J6Q A;  1CKN B;  3PSI A;  1ROD A;  2F0E A;  3X3N A;  5I4D A;  1Z6H A;  4DUZ L;  3CCV A;  1G2S A;  1NR4 A;  2NVX H;  1FJG L;  1CHQ D;  2ATW A;  4B9X A;  5ELD A;  2F1M A;  2GA4 B;  1E0B A;  4RHS A;  2QCP X;  4QIW B;  5IIF A;  1GUN A;  3A8J E;  4OWW B;  5A2Q L;  4CKE A;  4DF7 A;  5IYD H;  2NYZ D;  3OYY A;  3A5Z B;  4JV5 Q;  3CCM A;  3RNU A;  2Y0S B;  1SMY D;  3PF4 A;  1YNX A;  1B3A A;  1WYD A;  2NZO A;  1NAP A;  3BVM A;  3SGI A;  1VQI A;  5COY A;  2J7Z A;  1SRO A;  1C4Q A;  4HSV A;  3TSS A;  1D2B A;  2L4N A;  3PGZ A;  2HIX A;  3PUX A;  2R3Z A;  3NBH A;  4IUN A;  4ZK9 B;  2K5D A;  2AKW B;  4Y7N H;  1CKN A;  3N52 A;  1PDQ A;  1TU2 B;  2HCI A;  3D4D A;  2AWN A;  1I4R A;  1IKM A;  3I55 A;  4DR2 L;  4A3K G;  3WWV A;  1F9P A;  1FGB D;  4HIM A;  4DNI A;  3K7A H;  2A74 C;  4J8Q A;  4DR5 L;  2A6E C;  1LTA D;  4IZ8 A;  4OX9 Q;  5KGU A;  2OTL A;  3TZD A;  1ASZ A;  2JA5 G;  1SE8 A;  3OTO L;  3D4R A;  1CUK A;  5GAE C;  1P16 A;  1I50 B;  4C3I B;  1BCP D;  2RCF A;  3KOJ A;  2B2Y A;  2NVY H;  5M3F H;  4C1N I;  4BBR B;  1DOL A;  3A7A B;  3X3M A;  1EIG A;  4NXN L;  3U50 C;  3I8Z A;  4RG1 A;  1GOZ A;  1ILQ A;  4OEL B;  3W1B A;  2DN8 A;  1N32 L;  3RLN A;  2A6H C;  3NEL A;  1IXR A;  2BA1 A;  3MTS A;  4X3U A;  5CYU A;  2K1B A;  1QVC A;  3HOV G;  5C3E H;  3K59 A;  4XIG S;  2VUM H;  2F0L A;  2A73 B;  2K5W A;  4MTK A;  1YIT A;  4GKK Q;  4PMC A;  2HD3 A;  2SNM A;  3BZD B;  4BXX H;  1AEX A;  4RGM A;  1MI2 A;  4J1M A;  3QOJ A;  4X66 L;  4JPB W;  2MJ8 A;  3VYR A;  2OF1 A;  3F2D A;  1SE3 A;  5LMN Q;  1EL0 A;  2V4D A;  1SJE D;  3BYY B;  3FMC A;  4P75 A;  2KJX A;  1YJN A;  4A3G G;  1G51 A;  1X3Q A;  2EE1 A;  1SR3 A;  1PHJ A;  1LTT D;  5DLQ E;  1PA6 A;  3OSO A;  2O5J C;  1FNU A;  4DV6 L;  1CA5 A;  2WV6 D;  1T5E A;  2GVA A;  2WIN B;  3MFG A;  4A3L G;  4IO9 A;  4B3T L;  2JA7 B;  4KHZ A;  4LUV A;  1Q3L A;  4BA2 I;  4XT1 B;  3TZU A;  2XSC A;  4IUV A;  1CQV A;  1EQT A;  1VMP A;  2NVQ B;  1BOS A;  3BU2 A;  4C2M B;  4NXN Q;  1PZI D;  2LMC B;  1Y1V B;  4A93 H;  3MXG A;  4ALP A;  4A3D G;  1ICW A;  1QE6 A;  1RKN A;  4QUF A;  5EAY A;  3CRL C;  4EQO A;  3L2P A;  4LF6 Q;  1O78 A;  5JEA J;  4BY1 G;  3I4M G;  1J5E L;  4DV7 L;  4FP5 D;  1N33 L;  4HJ9 A;  1KRS A;  5IP7 H;  2K04 A;  3M4O B;  4C3J H;  1H95 A;  4A3F B;  4JOI A;  2B2V A;  2K5N A;  4CHT B;  2CCZ A;  3TP7 A;  1I94 L;  1AE3 A;  5D3I B;  1SNC A;  2KOL A;  2MGS A;  3S15 H;  5AFW A;  2A6H D;  2WB1 G;  1KAA A;  2L9H A;  2TSS A;  3BZK A;  3A5U A;  4LFA Q;  4RCN A;  1G6P A;  1JOO A;  3HOZ B;  3AQQ A;  4YCU A;  1WTO A;  5M5Y H;  1D1K A;  3PO2 H;  3VR3 A;  1K8G A;  2BH2 A;  4A3M G;  1TS4 A;  1PH1 A;  1PFS A;  4FXD A;  3DWA A;  2DY7 A;  3N6R A;  1DCZ A;  1LT6 D;  2OXP A;  3J81 i;  4B3T Q;  3CCE A;  3AMU A;  1TWH B;  2CH4 A;  1B8A A;  3A7L A;  3I73 A;  4DAM A;  3BDO A;  1KLU D;  2FMC A;  3MEH A;  3PF5 A;  3Q24 A;  2O5I C;  5HUR A;  4OGQ C;  2EDG A;  4UP9 A;  1F2Z A;  4OL7 A;  4KK7 A;  3OW2 A;  1Q1B A;  4MNO A;  1TY2 A;  3K7U C;  3T51 B;  1VDZ A;  2O4X A;  3A56 A;  4LF4 L;  3OIP A;  1JWS D;  2BH8 A;  2I5M X;  1RJT A;  3MEF A;  4IOA A;  1GUW A;  1S40 A;  4APV A;  1Z7T A;  3OMC A;  1VQO A;  1NR2 A;  3W3A A;  3NQT A;  4OIK A;  4PNY A;  2B63 G;  1PRT C;  1BQQ T;  4F7X A;  2ZM6 Q;  3KFU A;  1RDP D; 
#chains in the Genus database with same CATH homology
 1SN8 A;  2JK8 A;  5FLM H;  2MQH A;  1VQ6 A;  1Q81 C;  3H0G H;  1G29 1;  3CW2 C;  1PH5 A;  4OO1 I;  1TWC H;  5IYD G;  1LUZ A;  1EFW A;  2F4V Q;  1PH3 A;  2A1A A;  2ZJR A;  3GTL H;  4IFD I;  2QEX A;  2IT1 A;  3EBE A;  1Y1W H;  2Z0S A;  3J80 c;  4A3K H;  2OWO A;  3TQY A;  1X6O A;  1IYJ B;  1NMF A;  4BBS G;  5JJL A;  1S72 A;  1IBL L;  1LTL A;  4LFA L;  1VQN A;  2JEA I;  1C9O A;  4JI1 Q;  3RZD H;  4B3S Q;  3I4N G;  1I6H H;  4KHP Q;  1E1O A;  5IWA Q;  4UPA A;  3GTM H;  4JI5 Q;  2CWA A;  1EQR A;  4BA1 I;  5GRO A;  3KJP A;  3M4Q A;  3CCU A;  2JA6 H;  1B70 B;  3F1Z A;  1VQH A;  3PIP A;  3GTJ H;  2JA5 H;  4DR6 L;  4OON A;  1HNZ Q;  1UE7 A;  3CCQ A;  1BBW A;  3H3V H;  2LXK A;  4GOP C;  1K3R A;  3HOX G;  4A3C G;  1NBW A;  1GO3 E;  3L0O A;  3S17 H;  1C0A A;  2XTI A;  3RLO A;  3K81 C;  4AQY L;  4JYA Q;  1R9T H;  2R93 H;  2I5L X;  1E24 A;  4LF5 L;  2VQE L;  1TWA H;  3FKI H;  1O7I A;  2F52 A;  5C0X G;  3I56 A;  5IP9 G;  1K83 H;  3J81 c;  2YU9 H;  1CSP A;  4LWC A;  1Q46 A;  3NBH B;  1A62 A;  2IX0 A;  4AIM A;  1N36 Q;  4A76 A;  2OQK A;  4BBR G;  4QJF A;  4LF8 L;  4JI7 L;  1E22 A;  2V1C C;  3KDF B;  4GN4 B;  1NTG A;  3TRZ A;  4DR3 Q;  2Z6K C;  1YHQ A;  1U0L A;  5BR8 Q;  1EIY B;  3HOV H;  1PV4 A;  3GTK H;  4R4I A;  5C4X G;  1TWF H;  4DR1 L;  4DUY Q;  2R7Z H;  4DV2 Q;  4HJ5 A;  1JB7 A;  4IFD J;  1VQM A;  2PI2 A;  5HY6 A;  2LXJ A;  4P74 A;  3EN2 A;  1PH2 A;  5FJ8 G;  2ZM6 L;  5GAH C;  2ES2 A;  2E2H H;  1EUJ A;  2QGQ A;  1QUQ B;  3T1Y Q;  1VQF A;  2EIF A;  3J80 i;  4JI6 L;  4P71 A;  5M3M H;  2F4V L;  4GKJ L;  1OXU A;  1PH9 A;  3UDG A;  3S2H H;  4JI2 Q;  3D31 A;  1OXT A;  5M5W H;  4A3I G;  3ULL A;  1B7Y B;  1PH7 A;  2Q2U A;  3CC2 A;  1KIX A;  4DR4 Q;  1WI5 A;  2RF4 A;  1E3P A;  2MO1 A;  2B3G A;  5H1S E;  1XPO A;  5C3E G;  2RHS B;  4OWX B;  5IYB H;  1DGS A;  2A19 A;  1Q8K A;  4A3G H;  4X6A H;  3CPW A;  2GVB A;  2VUM G;  1TWH H;  4KHP L;  1VQB A;  1LM0 A;  4R4T A;  5IWA L;  4JI5 L;  1NJI C;  2NVT H;  2VQF L;  3HFZ B;  4HJA A;  4AH6 A;  3CMA A;  5IYC H;  1HNZ L;  4BXX G;  2PNH A;  4O0A A;  1HNX L;  4JBW A;  1QZH A;  4A3L H;  5JJI A;  3HKZ G;  4UP7 A;  3J7Z C;  2UUB Q;  4NXM Q;  1HH2 P;  3KDF A;  3W5O A;  4GNX B;  1X65 A;  4DPG A;  4JYA L;  2AHO B;  1CSQ A;  3NEM A;  4YCW A;  4LF7 L;  1FVI A;  1Y1W G;  1ASY A;  2VZA A;  2VQE Q;  4GN3 B;  2FXQ A;  4KI0 A;  4PZ6 A;  4GOP A;  4OWT B;  2JA7 G;  1E7Z A;  1RL2 A;  1X9N A;  2A8V A;  2I5H A;  1GVP A;  2AMC B;  1N36 L;  1VQE A;  3A0J A;  4A3D H;  2HHH Q;  3J81 j;  4OXP A;  1LYL A;  4R4Q A;  1X54 A;  2YTY A;  4LF8 Q;  2YV5 A;  3Q8D A;  4L5R C;  4DR3 L;  3T1H Q;  1V1Q A;  4IJH A;  1PH4 A;  4JI7 Q;  1VQA A;  3KJO A;  1U5K A;  3RZO H;  2N78 A;  5BR8 L;  1KC8 C;  3HOU H;  1IZ6 A;  4YCV A;  2NN6 G;  4BY1 H;  3I4M H;  4DUZ Q;  4DV3 Q;  4C3H H;  4A3J H;  2KHJ A;  4TVA B;  4PG3 A;  4DV2 L;  2IX1 A;  3AYH B;  1FJG Q;  2GN5 A;  1KXL A;  4BY7 G;  4WJ3 M;  2K5H A;  2Z6K A;  3GTO H;  1TXY A;  1BKB A;  1HZA A;  1P8L A;  3UE0 A;  3DLL A;  1AH9 A;  5C4J H;  4H02 A;  1L1O B;  4HIK A;  3T1Y L;  2OCE A;  3U4V A;  4B3R Q;  1MJC A;  1WJJ A;  3HOW G;  1YHA A;  1VQ4 A;  4LUO A;  4A3F G;  4JI6 Q;  4JI2 L;  4A93 G;  1IBK Q;  1Z9F A;  1PYB A;  4DV1 Q;  1K9M C;  3GTQ H;  1V43 A;  2JQO A;  2PMZ E;  3PUW A;  4DR4 L;  4POF A;  3M85 A;  2VS1 A;  3RN2 A;  4PMW A;  2R92 H;  1UWV A;  2JJQ A;  4JI3 Q;  3M4P A;  2VY3 A;  5JEA G;  4B3M Q;  2CWP A;  4LNQ A;  4GNX A;  4DV0 Q;  1AE2 A;  3CQZ H;  4JI4 Q;  4NB3 A;  4DK3 C;  1WCM H;  3S2D H;  3ULP A;  4IFD G;  2JA8 H;  5IP7 G;  3CME A;  1QVF A;  5C44 G;  3BJU A;  3ERS X;  2VQF Q;  4JI8 Q;  2WFW A;  3KLW A;  1XNQ Q;  3M3Y H;  1KQS A;  3HOZ G;  3PO3 G;  2DUD A;  4J15 A;  4X62 L;  1JJC B;  2C35 B;  2AWO A;  4A3M H;  1HNX Q;  5AJ3 Q;  2K75 A;  2UUB L;  4NXM L;  3S1M H;  4JBJ A;  3S24 A;  1SRU A;  4HID A;  2D0P A;  3VDY A;  1PH8 A;  1EIF A;  1HZB A;  2WAQ E;  3S14 H;  1X56 A;  1X3F A;  1YIJ A;  3PUZ A;  4X65 Q;  3LGJ A;  4LF7 Q;  3HOY H;  4DR2 Q;  1QVG A;  1EWI A;  3S16 H;  1T9H A;  3F8T A;  3KF8 B;  3FHW A;  3L7Z C;  3UDF A;  4YY3 Q;  3S1R H;  1HR0 W;  5GQO A;  2HHH L;  2E5L Q;  4DR5 Q;  3B6Y A;  2F3I A;  1VQD A;  2JA9 A;  2ZTE A;  2K4K A;  1Q1E A;  1J6Q A;  1CKN B;  3KF6 A;  3PCO B;  3PSI A;  1KL9 A;  3UDX A;  3T1H L;  2VL6 A;  1M90 C;  2ID0 A;  1V9P A;  3PO2 G;  4DUZ L;  3OTO Q;  3F2C A;  4DV3 L;  1K8A C;  1UE5 A;  3CPF A;  2KCM A;  3U58 A;  3CCV A;  3CC7 A;  4A3B H;  3D0F A;  2NVX H;  1FJG L;  2ATW A;  5J3B A;  3I2Z A;  4POG A;  3PUY A;  3K80 C;  3ICE A;  5K36 G;  4LFB Q;  4OWW B;  1Z47 A;  4JCV E;  1Y14 B;  1GM5 A;  2JE6 I;  2YTV A;  1VQ7 A;  4GS3 A;  1VQK A;  2PQA B;  3CC4 A;  1UEB A;  4B3R L;  2R7D A;  3UE1 A;  1MIU A;  5IYD H;  4GNX C;  3OYY A;  3GTG H;  3A5Z B;  1IBK L;  1VQJ A;  2BA0 A;  3CCM A;  4DV1 L;  4JV5 Q;  3FP9 A;  1N32 Q;  3EIV A;  2VNU D;  3RNU A;  3PF4 A;  1YNX A;  1WYD A;  4BBS H;  1FGU A;  2NZO A;  4JI3 L;  4IPG A;  2XGT A;  1VQ9 A;  2ZJP A;  4B3M L;  3U4Z A;  4DV0 L;  4LW1 A;  3SGI A;  3GD7 A;  4A3E G;  4JI4 L;  3I4N H;  1HNW L;  1VQI A;  3W1G A;  2KEN A;  4R1J A;  1A0I A;  4O2D A;  2Q2H A;  1SRO A;  2EQS A;  3S1Q H;  1HR0 Q;  4JI8 L;  3PGZ A;  2HIX A;  2IHF A;  1XNQ L;  3PUX A;  5E7N A;  4LFC L;  4X66 Q;  5FLM G;  2AKW B;  5AJ3 L;  2K5V A;  4A3C H;  4X62 Q;  3E9H A;  3H0G G;  1XMQ Q;  4Y7N H;  1CKN A;  1L2F A;  2OQ0 A;  2AWN A;  2KBN A;  1YZ6 A;  3UDI A;  2IY5 B;  1JMC A;  4X65 L;  3I55 A;  1EYG A;  4YHH Q;  4DR2 L;  1UE1 A;  4A3K G;  1YVC A;  2R92 G;  5JJK A;  5IP9 H;  1I50 H;  3I4O A;  4C3I H;  3S1N H;  3WWV A;  1L1O C;  4HJ8 A;  2YTX A;  1E1T A;  1IBM Q;  4YY3 L;  1X3E A;  4YWK A;  4HIM A;  4DNI A;  2CQO A;  3K7A H;  4BBR H;  2E5L L;  4DR5 L;  4JBM A;  2QA4 A;  2UU9 L;  3STB C;  1KAW A;  2WP8 J;  4OX9 Q;  1PVO A;  1VQC A;  2OTL A;  1ASZ A;  2E2I H;  2JA6 G;  2MFI A;  4UP8 A;  2JA5 G;  2PQA A;  3G4S A;  1SE8 A;  4DV6 Q;  1QUQ A;  3E9I A;  3OTO L;  2UUA L;  1CUK A;  3ZJY C;  1NY4 A;  2ALY B;  5GAE C;  2NZH A;  5ELO A;  3TS0 A;  1P16 A;  1XPR A;  2R93 G;  3KOJ A;  1RIP A;  4LF9 L;  3CP0 A;  4L5T A;  4OO1 G;  2NVY H;  5M3F H;  2D0O A;  3CAM A;  3PIO A;  5FJ8 H;  4LFB L;  1K73 C;  2IHE A;  3FKI G;  2WAQ G;  1KD1 C;  4NXN L;  4EX5 A;  2ZTC A;  2CKZ B;  3U50 C;  2JEB I;  4R4C A;  1TWG H;  4RG1 A;  4A75 A;  1VS0 A;  2WB1 E;  4GLA C;  3W1B A;  4A3I H;  4JV5 L;  3RR5 A;  1N32 L;  3RLN A;  1WFQ A;  3I7F A;  3NEL A;  4K0K L;  1IXR A;  2K50 A;  2BA1 A;  1YI2 A;  4DAY B;  1QVC A;  3HOV G;  5C3E H;  4JOI C;  2K14 A;  4XIG S;  3G48 A;  3CCJ A;  1J5E Q;  4YWM A;  4DV7 Q;  1KHI A;  2UUC L;  2VUM H;  4AYB E;  4DV5 Q;  1HNW Q;  1N33 Q;  2B29 A;  1YIT A;  2R7Z G;  3RLF A;  4GKK Q;  4HIO A;  1HR0 L;  1N34 Q;  2MO0 A;  3K8A A;  4BXX H;  3KYH C;  3CD6 A;  1HZ9 A;  4IOC A;  4X66 L;  4DKA C;  1OXV A;  4LFC Q;  1XMQ L;  1I5F A;  3TEH B;  4MTN A;  3H15 A;  1I94 Q;  5M3M G;  2HQL A;  4FDB A;  1GD7 A;  4NPS A;  1SFO H;  4KLK A;  4ME3 A;  3F2D A;  5LMN Q;  3PV0 A;  2N8N A;  2UXC L;  4PZ8 A;  4YHH L;  1JJG A;  1JT8 A;  3JC6 6;  1EOV A;  4QIW E;  2JA7 H;  4DR6 Q;  4P75 A;  5ELN A;  1IBM L;  4A4I A;  5IYB G;  1GKH A;  1YJN A;  1SMX A;  2UXB L;  4A3G G;  1G51 A;  2Q2I A;  3TRE A;  2E8G A;  1SR3 A;  3CXC A;  1PHJ A;  3AFQ A;  2UU9 Q;  4OX9 L;  3GTP H;  1YHB A;  1YJ9 A;  2NVQ H;  4C2M H;  5DLQ E;  1PA6 A;  5IT9 c;  2Y0S E;  1Y1V H;  1N9W A;  3ER0 A;  5IYC G;  5C0X I;  4DV4 Q;  1L1O A;  1SLJ A;  4GN5 A;  4DV6 L;  1JJ2 A;  2GVA A;  2UUA Q;  4JI0 Q;  1XPU A;  4A3L G;  2R7F A;  1MJE A;  3MXN B;  2UXD Q;  5IE8 A;  4DR7 Q;  1VQG A;  2KCT A;  4IO9 A;  1QZG A;  1W3S A;  4B3T L;  4BY7 H;  3IRB A;  2RCN A;  4KHZ A;  4LUV A;  3TS2 A;  4BA2 I;  4UY8 C;  2B63 H;  4LF9 Q;  3BZC A;  4Y52 H;  1OXS C;  1C7Y A;  4X64 L;  5LMU L;  4TQU S;  1XMO L;  3BU2 A;  4JBK A;  4NXN Q;  3J7A 5;  3M4O H;  3HOW H;  3M9B A;  4A3F H;  4A93 H;  4ALP A;  4A3D G;  1A63 A;  2KHI A;  1YJW A;  1HJP A;  5EAY A;  1VQP A;  4LF4 Q;  3STB D;  3AFP A;  1VQ8 A;  4GLX A;  2R6G A;  4K0K Q;  3L2P A;  1W2B A;  3JAM i;  3E0E A;  1N8R C;  1Q82 C;  3HOU G;  1S3O A;  4LF6 Q;  5GAG C;  5JEA J;  4BY1 G;  3I4M G;  2HT1 A;  4YWL A;  3CCR A;  4GOP B;  4A3J G;  1J5E L;  1XNR L;  4DV7 L;  4L5S A;  1BBU A;  3K0X A;  3PUV A;  4DV5 L;  2UUC Q;  1N33 L;  2I0Q A;  4HJ7 A;  4HJ9 A;  4R4O A;  3CF5 A;  1KRS A;  4GKK L;  2VW9 A;  5IP7 H;  5M3F G;  3ULJ A;  5C44 H;  4EQ5 A;  1N34 L;  2HIV A;  4C3J H;  4QGU A;  1CKO A;  3HOZ H;  3PO3 H;  1H95 A;  4JOI A;  2K5N A;  1UE6 A;  2CCZ A;  3HOX H;  2OTJ A;  5FLX c;  1YBY A;  1I94 L;  1AE3 A;  2L15 A;  1XTD A;  2D62 A;  1X3G A;  5LMN L;  3S15 H;  3CCL A;  2UXC Q;  2WB1 G;  1BVS A;  5C0X J;  3BZK A;  1IL2 A;  1IBL Q;  1D8L A;  3A74 A;  4JI1 L;  3A5U A;  4B3S L;  2LSS A;  4LFA Q;  4QQB X;  1NE3 A;  1XJV A;  3HKS A;  1EQQ A;  1G6P A;  2N49 A;  2RHQ B;  2UXB Q;  1K0R A;  1WCM G;  4PZ7 A;  3AQQ A;  1VCI A;  1FL0 A;  4YCU A;  2JA8 G;  1L0W A;  4AYB G;  1MKH A;  2DGY A;  1KRT A;  4DV4 L;  5M5Y H;  2ZJQ A;  4JG2 A;  3F2B A;  1Q86 C;  2ASB A;  1X55 A;  5HGQ A;  3PO2 H;  4XTC S;  2YYZ A;  4P72 A;  1K8G A;  4JI0 L;  4A3M G;  2BH2 A;  4IJL A;  1PH1 A;  4IPC A;  1PFS A;  5C4X H;  4DK6 C;  5LMN W;  4P73 A;  2UXD L;  2N3S A;  5GAD C;  3G6E A;  4DR7 L;  4AQY Q;  2H5X A;  3J81 i;  2K52 A;  4GLV B;  2CFM A;  4B3T Q;  1M1K C;  1YEZ A;  4LF5 Q;  3CCE A;  1HZC A;  1NMG A;  1VQL A;  1B8A A;  3CCS A;  4DAM A;  3PF5 A;  5IY0 A;  3H3V I;  3HOY G;  3DM3 A;  2E2J H;  2Q2T A;  1CKM A;  2NN6 I;  1Q12 A;  4X64 Q;  1VQ5 A;  4UP9 A;  5LMU Q;  1A8V A;  1XMO Q;  4QY7 A;  4LUZ A;  3OW2 A;  1Q1B A;  4MNO A;  1D7Q A;  3RN5 A;  3GO5 A;  3K7U C;  1Q7Y C;  1PH6 A;  3M7N A;  3AEV A;  4LF4 L;  1JE5 A;  2BH8 A;  4JC0 A;  1OTC A;  1Y1V G;  4IPD A;  3G71 A;  2I5M X;  3MEF A;  4LF6 L;  4IOA A;  2PI2 E;  4WJ4 A;  4L5Q A;  4QL5 A;  4DUY L;  4A3E H;  4APV A;  1S40 A;  2ZTD A;  2Y0S G;  1VQO A;  4DR1 Q;  1XNR Q;  2EXD A;  4RMF A;  3GDE A;  4A3B G;  3JAM c;  2MNA A;  1PYS B;  1OXX K;  5M5X H;  1WOC A;  3NEN A;  3KF6 B;  2B63 G;  1I3Q H;  4MZ9 A;  4GKJ Q;  3HKZ E;  4IPH A;  2ZM6 Q;  3KFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...