4JI0Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji0Q00
1RL2A 3CCMA 2IHEA 5LMNL 1MKHA 5FJ8H 4DK6C 1AE3A 3KYHC 4DV5L 1N34L 1N36Q 1SR3A 4R4TA 1X56A 4X66L 4P71A 5EAYA 3WWVA 1QVCA 1E22A 3F2DA 1HNWQ 4LW1A 2D0OA 2UUAQ 3U58A 1UE7A 3I7FA 3I55A 1ASZA 1VQKA 4EQ5A 4O2DA 3BU2A 2OCEA 2PNHA 4DR2L 3ULPA 3F2BA 1XMOQ 1MJEA 4HIMA 1PH9A 1I94Q 3AEVA 4GLXA 1XNRL 2K5NA 2D0PA 2NN6G 1Y1WH 2OTLA 2A19A 1QUQA 3A5ZB 3M4QA 3PUWA 5IP7G 1XPOA 1M1KC 4GOPB 4LUOA 1IBLL 3BZKA 1JJ2A 2VUMH 4WJ4A 4KHPQ 4JI4Q 4K0KQ 1IBLQ 3EIVA 4A3GG 3TQYA 5LMNQ 1N34Q 3K80C 2IX1A 4DV5Q 4QIWE 3PSIA 4X66Q 4YWKA 2BH8A 1CKNA 4A3KH 3HOWG 4A3DH 1I50H 2WAQE 4LFCL 1G51A 1S40A 5JJKA 1KRTA 4DV6L 4GNXA 4JI7L 4DV1L 4A3CG 4BBSH 3K8AA 1JJCB 1RIPA 3HOXH 3CC4A 2PMZE 3GTLH 1SN8A 1XNRQ 1QUQB 4C2MH 1Q81C 1GD7A 1HJPA 5C4JH 4P75A 1XMQL 5C44G 3I4NG 1K0RA 1PH7A 5C4XG 2N78A 3AQQA 1YZ6A 5GAGC 5GADC 1IXRA 4DUZL 4BBRH 1YIJA 3W5OA 1XJVA 2K14A 4QL5A 1FL0A 1TWAH 4R4CA 1YJ9A 4IPCA 1IBML 1VQMA 1CKNB 5JJIA 1Y1VH 3OTOL 4AQYL 4R4OA 1AE2A 1HZBA 4UY8C 3HOZG 2R93H 4LFCQ 2YTXA 4A4IA 4GNXB 4JI1L 1HZCA 3RZOH 4A3BH 4DV6Q 1NJIC 2FXQA 5IP9G 4JI7Q 1X55A 3KDFA 3D31A 4QY7A 4DV1Q 1WCMG 2OQKA 3GO5A 2QEXA 1JB7A 4B3TL 1A0IA 3T1HL 4L5TA 2B63G 3TS2A 1YJWA 1PA6A 4A3EH 3S17H 1L1OC 2DGYA 3W1GA 2K4KA 3JAMc 4TQUS 5C3EH 2E2JH 1NTGA 4DR3L 1VQPA 1SRUA 3A0JA 3L2PA 3I56A 2QA4A 4DNIA 3EBEA 2LXJA 2PI2E 1VQ7A 2ZM6L 1XMQQ 4JV5L 1EIFA 3STBD 2HIVA 1WFQA 3GTGH 1PH3A 4DUZQ 3FKIG 1OTCA 1XNQL 2JA8G 2LSSA 2NVTH 4JG2A 4IO9A 3ER0A 1ASYA 3PO2G 5IYDG 3UDGA 4B3RL 4LF9L 1IBMQ 2A8VA 1UWVA 4EX5A 1PH2A 4JBJA 4QQBX 1O7IA 3OTOQ 1CUKA 2C35B 4AQYQ 3TRZA 3H0GH 1KAWA 5FLXc 4DV7Q 4X6AH 4LF4Q 3KDFB 4JI1Q 1PHJA 4DV2L 3CF5A 4BY7H 1UE5A 1P8LA 2E5LL 4LF6L 3H3VH 4IJLA 1D7QA 1E1OA 1YNXA 1P16A 4IPHA 1CKMA 2ID0A 5IYCG 4B3TQ 1A62A 2E8GA 3T1HQ 3ULJA 2HIXA 1YITA 1VQCA 2Q2HA 3A74A 3AFQA 5IT9c 4DR5L 2HT1A 3AFPA 4DR3Q 4JOIA 2ZTEA 1Z47A 2OQ0A 1J6QA 4DPGA 4MTNA 2ES2A 2ZM6Q 1DGSA 3I4MG 4JV5Q 1KRSA 1VQ6A 4A93H 2UXBL 1NMGA 1NY4A 3RLFA 1EFWA 1X65A 2UU9Q 4L5RC 4LF9Q 4B3RQ 1VQJA 1Y14B 5C0XI 2CCZA 2R7ZG 3DLLA 3PGZA 4DAYB 1V43A 3UDIA 3HOYG 5JJLA 1B70B 1I3QH 4YCVA 2KHIA 3TS0A 1PV4A 1JMCA 4DV2Q 2AWOA 3PUVA 2BA0A 3CCRA 2E5LQ 4LF6Q 4GKJL 1BKBA 3EN2A 1OXVA 4A3GH 1TXYA 5M5XH 2YU9H 1U0LA 3RR5A 4JBWA 4XIGS 2RHSB 4GN5A 1SMXA 4PZ6A 4DR5Q 1YHQA 1TWFH 4JI5L 1FJGL 1LUZA 2UUCL 3M3YH 3S16H 2VL6A 1UE6A 4IOAA 1X3FA 4BY1G 5J3BA 4JI6L 1V9PA 3J81j 4A3CH 4UPAA 1QVFA 5GAEC 3M9BA 3K0XA 4YCUA 4L5SA 2H5XA 4BA1I 2R7DA 1EUJA 4APVA 5C0XG 4DV0L 2JA5H 1NE3A 4B3SQ 4JBMA 2LXKA 4BXXH 4OXPA 3PF4A 4P74A 4TVAB 4YCWA 4LFBL 1GVPA 4DKAC 2IHFA 2I0QA 1X3GA 4LUZA 3PO3G 2IY5B 4A3FG 5JEAJ 3RLOA 4Y52H 1VQDA 1C9OA 4IPDA 4GKJQ 3HOVH 3CPWA 3F1ZA 2R92H 3F2CA 2E2HH 3CXCA 5LMUL 1TWCH 4PMWA 3BJUA 1D8LA 3GTJH 2ZTDA 4J15A 3HOZH 4JI8L 4X64L 1Q8KA 4JI5Q 3UDFA 1FJGQ 2UUCQ 4A3LH 4MNOA 3CCJA 5M3FH 5M3MH 5IP9H 1PH1A 5M5WH 4JI6Q 1KHIA 5IYBG 2OWOA 3GTPH 1K3RA 2B63H 3CCVA 1PYSB 3B6YA 3KF8B 3G71A 1SROA 1YHBA 2K52A 3PUXA 3BZCA 2JA8H 3S15H 4DR2Q 4OO1I 1Q46A 1Q86C 4A3MG 3GTOH 3H15A 1EOVA 3FKIH 4WJ3M 3J81c 1GM5A 1L1OA 4FDBA 1T9HA 3PO2H 5IYDH 4LUVA 2WAQG 2JE6I 2CQOA 4GN4B 2F4VL 2JQOA 5LMUQ 1EYGA 1X6OA 2IX0A 2MFIA 3F8TA 3U4ZA 1G291 3CCUA 1QVGA 2K5HA 2Q2UA 1CSPA 1MIUA 4BY7G 3PF5A 5K36G 1H95A 4YHHL 4JI8Q 4X64Q 4K0KL 4IFDI 5FJ8G 4A3JH 1VS0A 2VZAA 2Y0SE 4QJFA 2BA1A 5IYCH 3J81i 1MJCA 1BBWA 1SE8A 1XPRA 1C0AA 4DR6L 1L2FA 2ATWA 4O0AA 1TWHH 2AKWB 2VQEL 4HIDA 3CW2C 1L1OB 3CCLA 2PQAA 2Y0SG 5BR8L 2JA7G 1S3OA 4PG3A 4YWMA 1X3EA 2F4VQ 2PI2A 1HNZL 2R7ZH 2VUMG 5IE8A 2RHQB 4PZ8A 3J7A5 3HOYH 3NENA 1YI2A 4IFDG 4YHHQ 1I5FA 2IT1A 5FLMH 2MO0A 2NVXH 1OXUA 3L0OA 3GTQH 3OW2A 3JAMi 2WB1E 1VQFA 2AMCB 4OWTB 1SLJA 5GROA 3STBC 1FVIA 4A3KG 3ZJYC 1VQ8A 2F52A 2AHOB 3HKZE 4JI0L 4DR6Q 4X65L 4KHZA 4H02A 2MNAA 4A76A 1PVOA 1QZHA 1N33L 1GO3E 2VQEQ 4OWWB 4BBSG 1E24A 3HOXG 3HOUG 3RNUA 2UXDL 1LTLA 3E9HA 3ICEA 3CD6A 5IY0A 3U50C 4C3JH 1KD1C 1E1TA 1Q12A 5BR8Q 1VQIA 1R9TH 4LF5L 2VNUD 4DV4L 3AYHB 4JYAL 3ULLA 3RLNA 1VQ4A 2HQLA 1HNZQ 3HKZG 1PH5A 1WOCA 2XTIA 1VQNA 2JA9A 4KI0A 1XNQQ 4BBRG 2K50A 2R6GA 3IRBA 2E2IH 2UUBL 4DR1L 1VQ9A 1CKOA 4UP7A 5IP7H 1Y1VG 1PH8A 1PYBA 2XGTA 4HJAA 1VQHA 1NMFA 4JI0Q 1B7YB 1LYLA 1EWIA 4X65Q 1N9WA 1M90C 2A1AA 1VQ5A 1N33Q 3HKSA 1B8AA 3H3VI 3M4OH 2UXDQ 2K75A 4A3EG 5IYBH 2I5LX 3MXNB 3HOWH 2ZJPA 3JC66 3CQZH 1KQSA 4LF5Q 3RN5A 4DV4Q 1KXLA 4HJ5A 4JYAQ 2ZJRA 4NXML 4POGA 4HJ7A 3CCQA 5GAHC 2UXBQ 3A5UA 1PFSA 4POFA 2UUBQ 3LGJA 4DR1Q 4LF7L 2N3SA 2YV5A 1JE5A 5M5YH 3FHWA 5C44H 3I4NH 4A3IG 4JCVE 5C4XH 3PIPA 2B29A 4P73A 3E0EA 4AH6A 3J7ZC 3M85A 4A75A 1Q82C 1Q7YC 4Y7NH 2MQHA 3CPFA 2NZHA 4HJ9A 4GOPA 3J80c 1K8AC 3HFZB 3KFUA 4BA2I 2KCTA 2JA6G 1HZAA 3D0FA 4R1JA 1N32L 1NBWA 2L15A 2VY3A 3CMEA 1UE1A 1W2BA 1HNXL 2CWAA 1K83H 3ERSX 3G6EA 1X9NA 1JT8A 3S1MH 4RG1A 3SGIA 4NXMQ 1WCMH 4OWXB 4YY3L 2NVQH 1BBUA 3KJOA 3KJPA 3OYYA 1E7ZA 1J5EL 3J80i 3S1NH 4A93G 4JBKA 1U5KA 1Q1BA 1K73C 4DV0Q 1G6PA 1VCIA 3FP9A 2EXDA 1VQEA 1WI5A 4LF7Q 3CCEA 3S1RH 3CMAA 2JA7H 4PZ7A 4LFBQ 3K7UC 4HIOA 3U4VA 4GOPC 3M7NA 4HJ8A 1I6HH 3RN2A 5HGQA 4DAMA 3PIOA 2VS1A 4DR4L 2KENA 1GKHA 2Q2TA 1YBYA 1N32Q 1EQQA 3KF6A 3PUYA 1JJGA 2WP8J 4DV3L 2ZJQA 1A63A 1N8RC 5C0XJ 2GN5A 1HNXQ 3VDYA 3G48A 1OXTA 4YWLA 2CFMA 3GTKH 3M4PA 1TWGH 1SFOH 4YY3Q 1S72A 1X54A 2I5MX 1YEZA 3NELA 1J5EQ 3CAMA 3HOUH 4GKKL 2KCMA 1UEBA 2ALYB 2JA5G 2BH2A 4OO1G 2KBNA 2VQFL 4NXNL 4BXXG 3I2ZA 3I4MH 1OXSC 4R4QA 1XTDA 2Q2IA 3GTMH 3GDEA 2Z0SA 1V1QA 2UXCL 2YTYA 2QGQA 4JC0A 1Y1WG 4DR7L 3KF6B 4IOCA 4OONA 4JI2L 2ASBA 1XPUA 4NB3A 4GLAC 3HOVG 1CSQA 4LNQA 4DR4Q 5IWAL 2R92G 1AH9A 2YTVA 1W3SA 3CC2A 1VQAA 3RZDH 4DV3Q 4DV7L 2JJQA 2WFWA 1KL9A 5E7NA 5ELNA 3UDXA 4GNXC 4LF4L 2AWNA 3MEFA 1VQGA 5M3FG 5HY6A 4A3LG 2JEBI 5M3MG 2D62A 2N8NA 2HHHL 2MO1A 4NPSA 4LF8L 5ELOA 4AYBE 4GS3A 4A3DG 4GKKQ 3T1YL 4OX9L 1E3PA 4R4IA 1C7YA 1KC8C 3PV0A 4HIKA 1QZGA 2VQFQ 1WYDA 4NXNQ 4C3IH 1BVSA 4BY1H 4XTCS 2PQAB 3S2DH 3E9IA 4DK3C 4GLVB 1VQBA 4ALPA 2N49A 2UU9L 3UE1A 4LFAL 4KLKA 3S1QH 3CC7A 2K5VA 5H1SE 2UXCQ 2KHJA 2WB1G 4LWCA 1K9MC 4DR7Q 4AYBG 4JI2Q 4X62L 3CP0A 1EIYB 2YYZA 5GQOA 3GD7A 5IWAQ 4MZ9A 2OTJA 2EQSA 3G4SA 2GVAA 1IZ6A 3S24A 1KIXA 1HR0W 4A3IH 1K8GA 1FGUA 3PO3H 3KOJA 1A8VA 2R7FA 1IBKL 4JI3L 2ZTCA 4A3FH 4IJHA 4A3JG 2Z6KA 1HZ9A 2HHHQ 2JA6H 2RCNA 3K7AH 1HR0L 4L5QA 4LF8Q 4B3ML 2R93G 3CCSA 4AIMA 4DUYL 1IYJB 3T1YQ 5AJ3L 2B3GA 5DLQE 4OX9Q 3TREA 4A3BG 1HNWL 1OXXK 3S14H 1LM0A 2NZOA 1YHAA 1Z9FA 5JEAG 1N36L 2F3IA 3S2HH 4IFDJ 1HH2P 1WJJA 2CKZB 2GVBA 1Q1EA 2I5HA 2V1CC 3DM3A 4P72A 4LFAQ 5C3EG 4C3HH 2UUAL 2JEAI 1L0WA 1VQOA 3KLWA 4X62Q 3PUZA 1YJNA 4B3SL 1PH6A 1IL2A 3NEMA 2VW9A 1XMOL 1I94L 4A3MH 2RF4A 2Z6KC 3L7ZC 4ME3A 4UP8A 1VQLA 1IBKQ 4JI3Q 5FLMG 4QGUA 3Q8DA 3NBHB 4RMFA 3TEHB 2JK8A 2NN6I 3UE0A 4GN3B 1YVCA 3W1BA 5LMNW 2CWPA 2DUDA 3H0GG 1PH4A 1HR0Q 4B3MQ 1EQRA 4JOIC 2EIFA 3K81C 3PCOB 4DUYQ 4UP9A 4IPGA 5AJ3Q 4KHPL 3I4OA 4JI4L 2NVYH
chains in the Genus database with same CATH superfamily
4PQXA 1RL2A 3CCMA 5FJ8H 1AE3A 4IALA 4UHVA 1X56A 4P71A 2NTSA 1QVCA 2XN9C 5TSSA 1C4QA 4DNTB 1CHPD 1RHPA 3SXHA 1KAAA 1JR0D 3AEVA 4GLXA 2K5NA 1FGBD 2D0PA 2NN6G 3MA2B 3PUWA 5IP7G 2PNRC 1PTOF 4ZUJA 1AN8A 2A6ED 4WJ4A 3C1EA 1W6JA 4A93B 1HFGA 3TQYA 2Q8IB 1RTNA 1N34Q 3PSIA 4X66Q 1PTOD 2BH8A 1O7LA 1KRTA 1CI3M 4DV1L 1AW7A 3TP7A 2ZXOA 2HQEA 3CC4A 1EY7A 1TS2A 2YU9B 1QUQB 4JVZA 2E74C 4HSVA 1AP0A 1XMQL 1PH7A 1ML0D 2EOTA 1IXRA 1KNAA 1IL8A 3BDLA 3W5OA 4CJ2C 1ENCA 1TWAH 4CGYB 1SBBB 1Y1VH 1LABA 1HZBA 1SXTA 4GNXB 1PRTF 4X3UA 3I91A 1HZCA 2QEJC 1YNNC 3KDFA 1D1IA 3ITPA 4QY7A 5JEAH 3AMUA 3T1HL 4L5TA 1EY9A 3SK6A 3S17H 2DGYA 2E2JH 1VQPA 4Q0FA 1II3A 4NW2A 1PRTD 4DNIA 4JV5L 5M3MB 2HIVA 3GTGH 1F9SA 1PH3A 4EGVA 5M5WB 3FKIG 1OTCA 1W6KA 2TSSA 2LMCB 1EEFD 1GUGA 1CT1D 5COYA 4QQBX 1O7IA 3OTOQ 4AQYQ 3S15B 4DV7Q 4K2LA 2EYJA 4LF4Q 4NMZA 1TVXA 2B2TC 1CM9A 4IURA 4C2MB 3FKIB 1P8LA 2E5LL 1D7QA 5D65A 5C4JB 1ICFB 1P16A 4IPHA 2ID0A 5IYCG 2E8GA 3ULJA 2V4DA 3A74A 4DR5L 3T53B 4DR3Q 3MXNA 1B50A 2ZM6Q 1DGSA 1WTHA 4A93H 3KLSX 3RLFA 2X69A 1I4GA 3OIQA 3W2DA 1X65A 3C1FA 3NE5B 3OWFA 2J7ZA 1F9PA 1Y14B 5C0XI 3DLLA 2EYOA 4H44C 4DAYB 1V43A 5HGTA 2KHIA 3TS0A 2AWOA 3ZYYX 2BA0A 1BKBA 2OF1A 2PCFB 1TXYA 2XSCA 2YU9H 2WIIB 1CZGA 1EU4A 2RHSB 3I90A 2I07B 3A7AB 4IOAA 3RUZA 3EVQA 5GAEC 3M9BA 5DM63 4YCUA 2ENBA 4FO2A 2MPMA 1EUJA 1MBYA 2LXKA 3I4LA 3PF4A 4TVAB 1BDOA 2HDLA 4YCWA 1ONLA 4DNRB 1DJRD 1GVPA 2L1BA 3PO3G 5T1GA 2PZWA 3RLOA 1V1PB 4GKJQ 1R9TB 3SK8A 3F1ZA 5LL6S 4PMWA 4CJ1B 4J15A 4CDEC 1FJGQ 2L55A 3K5OA 4U68A 5M3MH 5M5WH 4QUCA 1KHIA 5IYBG 2OWOA 1K3BC 4R8NA 4XT3B 3K5NA 3KF8B 4HAEA 3QO2A 1A3UA 1SSOA 3S15H 1BNZA 2F0HA 2MHVA 4A3GB 1Q86C 3GTOH 1GUWA 3T4AC 3FKIH 3TP6A 3HOWB 1PMRA 2RA4A 3S16B 4LUVA 5JOBA 4KY7A 5LMUQ 2L5TA 3U4ZA 1CSPA 3PF5A 4YHHL 3IFTA 5CGKA 3TZUA 2VZAA 3IAYA 2CHBD 5IYCH 5C44B 1BBWA 1C0AA 2JSOA 5C4XB 3E0JA 1CA5A 2F0FA 1YNJC 5FK9C 1B44D 5CYUA 2VQEL 4HIDA 5EKKA 2R3ZA 1U4RA 3G7LA 3J7YW 5BR8L 1YNND 4DK1A 4PG3A 4YWMA 1D5ZC 2F4VQ 1HNZL 1D6EC 1WCMB 2FINB 3I70A 2B63B 1I5FA 1SE4A 3MWYW 5E4XA 2WB1E 4OWTB 3S1RB 3CRKC 1SLJA 3STBC 4A3KG 1FVIA 3TMEA 4U673 3MXGA 4X65L 3TBIB 1HTPA 1N33L 3HOXG 4J6HA 1BO0A 5IY0A 1Q12A 1R9TH 1VQIA 2JYOA 2VNUD 1SYDA 5D3IB 2WKDA 4H0LC 3HKZG 1TWGB 1VQNA 1GOZA 2JA9A 4LK1C 3DWAA 4BBRG 2R6GA 4DN4M 2G5DA 1PYBA 1ZXTA 3SE0A 3A8IE 1NMFA 1CQVA 1SNCA 1LYLA 4N8X1 2VXWA 4H13C 2UXDQ 3FRPB 4ZK9B 2FMMA 2R7ZB 3MC0B 4FF1A 5IYBH 3HOWH 3Q6SA 3JC66 1DOLA 4K6LA 4LF5Q 3K58A 3GP7A 1B2TA 4HJ5A 4JYAQ 2ZJRA 4NXML 2L4NA 4HJ7A 5GAHC 3GTQB 4F88A 3R2TA 3A5UA 5KGUA 2XNAC 2UUBQ 3LGJA 4DR1Q 2F0IA 2EYMA 1JE5A 5C44H 4C3IB 3VA5A 5C4XH 4BY1B 3E0EA 3J7ZC 4ABNA 4HJ9A 3J80c 3HFZB 2L15A 4QF4A 1EY6A 3TN2A 2KJXA 3SGIA 4A3FB 1WCMH 4YY3L 1LT3D 1BBUA 4C3HG 1H9SB 3KJPA 3J80i 4ME5A 1K73C 2EXDA 3NP8A 3MVVA 1JE4A 3MXUA 3T16A 3S1RH 1HTLD 3CMAA 3K7UC 4GOPC 5CMDA 4HJ8A 3MEHA 3DWQA 5ELFA 1EYAA 1B3AA 2VS1A 2KENA 2PW5A 1YBYA 3KF6A 3PUYA 2ZJQA 2K5QA 1BCPC 3VDYA 3G48A 2CFMA 2F0TA 3TP8A 1TWGH 4NP5A 4E6IA 1X54A 2EJMA 1YEZA 3NELA 5I2XA 2F0OA 2EY2A 3GV3A 1QJOA 2JA5G 2BH2A 2KBNA 1WD1A 4BXXG 2A68C 4I7AA 5CV8A 1Y1WG 3CRLC 4B08A 4IOCA 4OONA 2ICIA 4LNQA 5IWAL 4N9PA 1W3SA 4DV3Q 2WFWA 5C5LA 3UDXA 4A3LG 5HY6A 2D62A 4RFBA 5AFWA 2MO1A 1Y1WB 2JA7B 1NUCA 4A3DG 2F0EA 4R4IA 3PV0A 3SHLA 4HIKA 2PZUA 3HS0C 4NXNQ 4C3IH 4IQZA 4BY1H 1BUVT 4XTCS 1FNUA 4LFAL 3MXPA 4KLKA 2BCOA 2UXCQ 3NTKA 2K33A 2WB1G 4LWCA 4DR7Q 2NTTA 4AYBG 4MZ9A 2EQSA 2WINB 3G4SA 2GVAA 1HR0W 3S24A 1CA6A 2XWJB 1IBKL 1LV9A 4A3FH 5CV9A 4IJHA 2B2VC 4KD3A 4J1MA 2E76C 3RD4A 1HR0L 4LF8Q 4B3ML 5EPLA 2R93G 1JOKA 2B3GA 4A3BG 1TU2B 5D14A 1B9MA 1F2ZA 2NZOA 1YHAA 3J7AV 3DM3A 3F2CA 1MD2D 4IFDJ 5C3EG 4C3HH 2PQEA 3RZDB 1SJHD 1LTID 3KLWA 2R93B 4X62Q 2O5JC 4ZLTF 1TKWB 3RZOB 4A3BB 1M4VA 2F0QA 1FD7D 3GTLB 4K8IA 3OIPA 2Z6KC 3L7ZC 5FLMG 3LWUA 5IT9L 2A69D 2BDOA 3UE0A 4CHTB 1ZKOA 1PH4A 4K5VA 1EQRA 4JOIC 4UP9A 1D2BA 1HNWQ 1PXUA 4EVOA 1EWCA 1N34L 1RCVD 3HEJA 4X66L 1STHA 3HGBA 3WWVA 4FP5D 2D0OA 2UUAQ 3U58A 1VQKA 3I7FA 4FF2A 3D6CA 5ELEA 4K14A 1MJEA 3K7AB 1S4ZA 1SNDA 1Y1WH 1SYCA 1QE6A 2A19A 3M4QA 3S14B 1A3TA 3KLSA 1XPOA 5IGGA 1JJ2A 5ELBA 1PTOB 2AUKA 4KHPQ 5JVG3 1EIGA 3HP3A 3K80C 2IX1A 2EPBA 3OHXC 4DV5Q 4QIWE 1MHWC 4YWKA 4BS9A 4A3DH 2BE5D 3QG1A 4C1NI 5KRUA 5CV4A 3SK5A 2QDBA 3M4YA 1HCZA 5M5XB 1SN8A 2AQ3B 1Q81C 1HJPA 4P75A 1AFPA 3I4NG 1EZ8A 1K0RA 2EXZA 2N78A 4N9TA 1YZ6A 4K5WA 1XJVA 4RHRA 4LMQD 4V190 4XYOA 1VMPA 2HCIA 5IIFA 1E2ZA 2SDFA 1XTCD 3OTOL 4AQYL 1STEA 3K59A 1K8MA 2R93H 2RVLA 3RMHA 4A4IA 4A3BH 3RZOH 1I6VC 2SEBD 5IP9G 4JI7Q 1PRTB 3GTLH 3D31A 3GO5A 3J81L 2QEXA 2B2VA 2R92B 2E2HB 5E4WC 2K4KA 5C3EH 4DR3L 4DK0A 1PFNA 3I56A 2JA8G 2QA4A 1Q8IA 1VQ7A 2LXJA 2P5ZX 5C4HA 2ZM6L 1EIFA 4DUZQ 5EGTA 2LSSA 3GTPB 1TS3A 1SNOA 5IYDG 1IBMQ 3VR5A 1A2UA 1KAWA 1KTKA 3DEOA 4X6AH 3KDFB 4JI1Q 5JAVA 2K7VA 1UE5A 3I8ZA 4IJLA 3NPPA 1CKMA 2XIWA 4F87A 1QOHA 3A7LA 2DY7A 1YITA 3AFPA 2F03A 4JOIA 1Z47A 2OQ0A 4DPGA 2F1MA 3I4MG 4KK7A 1PTOH 2LY7A 3WOEA 5HURA 4KY5A 3Q23A 1NY4A 4ZRZA 5ELDA 4L5RC 1AZQA 1TWHB 1JOQA 3FDTA 5JJLA 3QB3A 2RSOA 3S17B 1PV4A 1JMCA 3GV6A 3PUVA 4GKJL 3CCRA 4LF6Q 3MAQA 1OXVA 4MTKA 5M5XH 5EKLA 3RR5A 1H9RA 4JBWA 4L6TB 1SMXA 3T13A 2F0KA 5G3LF 1FJGL 5ISRA 1I4HA 1E0BA 1VF7A 2TMPA 5J3BA 3S9WA 2NVXB 3K0XA 2VB2X 3A54A 1NE3A 5G3LD 1K8OA 1STAA 2L12A 1EU3A 4G4KA 2IHFA 1SE2A 1C9OA 1JQYD 5ELCA 2R92H 2E2HH 3CXCA 5LMUL 1D8LA 1SMYC 2RQXA 5FKAC 4JI5Q 3UDFA 2UUCQ 3CCJA 3KK7A 4N8FA 5IP9H 1PH1A 4JI6Q 4G57A 3J7AF 3GTPH 3CCVA 1V1OA 1PYSB 2QKIC 3B6YA 3BYTB 2NZ1D 3G71A 2QCPX 1SROA 1YHBA 3VR4A 2JA8H 3MHBA 1NNXA 4WJ3M 4V0BA 1LLRD 5C6AA 1T9HA 3CQZB 3V2TA 5IYDH 2CQOA 2F4VL 2IX0A 2F3VA 1QVGA 2D5DA 3CCUA 1MIUA 4X64Q 1I4RA 1VS0A 1IKMA 4QIWB 3NHHA 3U9SA 2F0JA 4KY6A 1Q90A 1HFNA 4OEMB 5EBCA 1TWHH 1KDCA 4UDUC 2QF7A 3DWPA 3CW2C 3CCLA 2PQAA 3BDOA 2Y0SG 2DN8A 4KTAA 1S3OA 1QILA 1GUSA 3S1MB 3A56A 1HA6A 2PW7A 2VUMG 5IE8A 1WVLA 1EIHA 2AQ1B 2NVQB 2EZVA 4IFDG 4HSPA 4I7ZC 2NVXH 3CHBD 3OW2A 5GROA 3D3RA 3GTOB 1TIID 2AHOB 4IUTA 2M9VA 3HKZE 4DR6Q 1I4PA 2OT2A 4OWWB 4BBSG 2UXDL 1LACA 3HOUG 1UAPA 3U50C 1A6XA 4LF5L 1KDBA 2F0DA 4JYAL 3RLNA 3K5LA 1BQQT 3U9OA 1PH5A 1WOCA 2K50A 2G9DA 1IYUA 2X6LA 2UUBL 2NN6H 4DR1L 3Q0AA 1PH8A 5IP7H 4GZYC 2B2YA 4JI0Q 1EYDA 2KHSA 2SOBA 1WTPA 4B9XA 2IPKD 1VF5C 3TSSA 1I4QA 5BN4A 3DM1A 2K75A 4A3EG 2ZJPA 3CQZH 5LHY1 1KQSA 1GUNA 4OHJA 3RN5A 2IL8A 4POGA 3OWEB 3DXJC 1F9RA 4A3IG 3S2DB 1T5XD 4P73A 4AH6A 2MQHA 4RKLA 4OIKA 5EPKA 1K8AC 4BA2I 3KFUA 2KEEA 2JA6G 5C3WA 1NBWA 2EYPA 2VY3A 1UE1A 1G6ZA 2CWAA 3ERSX 4A3IB 3S1MH 4RG1A 3PO3B 3HZXA 1IYVA 2NVQH 3H3VC 1OO9B 3KJOA 3E6ZX 2JA6B 3OYYA 1M8AA 1VCIA 3EJIA 1JC7A 5KNCA 2EDGA 1A15A 3CCEA 3U4VA 1X3QA 1FR3A 3R93A 3M7NA 2E2DC 2PPBC 3J81E 5HGQA 2QDLA 4DAMA 3PIOA 1QB5D 3FPUB 2K32A 1GKHA 4RGOS 2K03A 4DV3L 5C0XJ 1HNXQ 1OXTA 1WD0A 2Z6BA 5EPJA 2CQAA 3HOUH 5FOBB 3NBIA 2KOLA 4F7XA 2PYKA 2ALYB 5A2QL 1X3PA 4PMCA 4NXNL 2A5HA 1OXSC 4R4QA 5CBEE 1B3QA 2UXCL 3Q22A 2QGQA 4JC0A 4DR7L 3KF6B 2DJGC 4GLAC 3HOVG 3K0YA 4HTHA 2YTVA 1VQAA 1B4OA 2A74C 2JJQA 1O7YA 1G91A 5M3FG 2F0LA 4LF8L 5ELOA 4AYBE 1MI2A 4GKKQ 2NBFA 1E3PA 3KUPA 2F0PA 1KC8C 3PIO3 1WYDA 3S2DH 3E9IA 4DK3C 1VQBA 4ALPA 2N49A 3C2PA 1JWSD 3D4RA 2KHJA 4JW0A 1K9MC 4HCEA 4A3KB 1PZID 4JI2Q 5E3FA 4X62L 3CP0A 1SE3A 2PO4A 1QNKA 4A3IH 1H9MA 2KUMA 1K8GA 1FGUA 3H94A 3HOXB 3PO3H 4DAYA 2ZTCA 4G7OC 4A3JG 2JA6H 2NB0A 1TQOA 3CKIB 2J4XA 4K5XA 3DEPA 3HG9A 2KVMA 4K2KA 3TDQA 3T1YQ 3HKZB 5DLQE 3TREA 4OX9Q 1HNWL 1OXXK 2FMCA 3EFXD 4BBRB 1JORA 1Z9FA 2F4IA 4CJ0B 1CTMA 2UU9Q 4CDDC 4P72A 3P20A 1VDZA 4PMBA 2C5CA 3PQIA 2UUAL 1DCZA 1L0WA 5FLXL 2FHTA 4B3SL 3KBXA 3Q24A 1PH6A 2CW0C 2RF4A 4UP8A 2K5DA 4JI3Q 1ICWA 4QGUA 3Q8DA 3QIAA 1SNMA 3NBHB 4RMFA 3TEHB 2NN6I 4GN3B 1YVCA 3W1BA 2CWPA 1V1PA 3FEWX 2EIFA 4IPGA 4KHPL 3I4OA 5DM73 2IHEA 4CBVA 2NVTB 1MKHA 4DK6C 4DV5L 1AZPA 5DEHA 3V96A 4LW1A 1DOKA 2J0TD 1UE7A 3I55A 4CKCA 4O2DA 3KF8A 3BU2A 1ENFA 2OCEA 3UI2A 4DR2L 3F2BA 1PH9A 3SEBA 5CORA 3A5ZB 4GOPB 4LUOA 2G9HD 2R61A 2F0VA 5CBAE 1LTGD 4JI4Q 4C3HB 4K0KQ 1TY2A 5LMNQ 3NQIA 1I4XA 2EY5A 1KABA 3N52A 1LTTD 5JJZA 2X6GA 4HR7B 1BCPB 1CKNA 5KNBA 4A3KH 1G51A 5JJKA 4JI7L 1H9JA 2K01A 5JPNC 4XXEA 3HOXH 1PFMA 1F2LA 1XNRQ 1GD7A 1PLFA 2H4OA 3MTSA 3M3YB 1CQFA 2AQ2B 3AQQA 5GADC 1U4PA 4DUZL 1J9OA 4BBRH 1L0XB 1UNSA 2K14A 1YNJD 2DJFC 1FL0A 4MHEA 4QL5A 4DFAA 1YJ9A 4KHVA 4IPCA 1IBML 2JA5B 1WTRA 1Y8NB 1AE2A 4UY8C 3HOZG 2O2LD 3NUCA 2D2CC 4LFCQ 2ICEC 4JI1L 3EA6A 4DV6Q 1NJIC 2FXQA 1A0IA 2ZXPA 2B2UC 4BWGB 1E2VA 1L1OC 1TWCB 3JAMc 3GTJB 1NTGA 2HCCA 1SRUA 3HOZB 1QG7A 2XWBB 3STBD 2NVTH 4JG2A 4IO9A 4A3DB 3ER0A 3PMFA 1ASYA 3PO2G 1BXTA 2A8VA 1UWVA 4EX5A 1PH2A 2CH4A 4JBJA 5JJIA 1CUKA 2C35B 4ZCKA 3TRZA 4RA8A 1PHJA 4KN7C 3CF5A 4BY7H 3JAML 2WB1B 4LF6L 3FMCA 1E1OA 4B3TQ 4AYBB 3PO2B 1A3VA 2Q2HA 3AFQA 5IT9c 1E2WA 5E1FA 1STYA 5J22A 2HDMA 2ZTEA 1J6QA 2ES2A 1K28A 4ZUIA 2Z4HA 2EY1A 4C56C 5KYIA 4G7HC 2UXBL 5J39A 4KD4A 4XT1B 1EFWA 2L9HA 4LF9Q 4B3RQ 1VQJA 3URYA 3FVQA 1TT2A 1WTXA 4TRDA 4G7ZC 3UDIA 3HOYG 2SNSA 2A6HC 1ENAA 2CH4W 4MIUA 5C3EB 4DV2Q 5I2YA 2K6AA 3F2UA 2CW0D 4XIGS 1YHQA 4JI5L 3M3YH 1LUZA 2UUCL 4IUPA 1L0YB 1UE6A 1X3FA 4JI6L 2JXMB 3J81j 4UPAA 1TY0A 4C3JG 3A8JE 4L5SA 4RGTA 2H5XA 3KLRA 4P2CB 5BN3A 2R7DA 4APVA 1Q3LA 5C0XG 4DV0L 1H9SA 2JA5H 4B3SQ 4JBMA 4BXXH 4OXPA 4P74A 1NSNS 4EQPA 1XWEA 5IODA 4LFBL 3AU7A 3VA7A 4ZYSA 2I0QA 1ZYRC 4KJNA 1S5CD 3VYUA 1VQDA 3NTHA 4C3JB 4IPDA 4DGZA 1B1ZA 4TKOB 3OMGA 5A2QE 1TWCH 3QWNA 2F0WA 2RDGA 3BYYB 4ID6A 3GTJH 3HOZH 4O1NA 4X64L 1Q8KA 4A3LH 4MNOA 2DNCA 1BCPF 3VR2A 1HUNA 3E5SA 4LJZC 1HUMA 4YIJA 1QWYA 2K52A 3PUXA 3OPOA 1EEID 1ET9A 5CV5A 4DR2Q 1ESFA 1BCPD 4A3MG 1EOVA 3M4OB 4ULLA 2B2UA 3A55A 3J81c 1L1OA 1GM5A 2NYZD 3PO2H 2C9OA 5CR3A 5FO9B 1RJTA 2QW7A 1NR4A 4BY7G 4JI8Q 5FJ8G 2Y0SE 4QJFA 1AEXA 2BA1A 5M5YB 2A68D 2CVRA 3J81i 3I4NB 2M00A 1SE8A 1XPRA 4RKBA 1SJED 5KYLA 4DR6L 1L2FA 3BG3A 2AKWB 3QOLA 1KLUD 3H91A 4H7BA 4C1NK 5CV6A 1K83B 1EOTA 5IGEA 2PI2A 1X32A 2RHQB 4PZ8A 3J7A5 3HOYH 1EY4A 3NENA 5F2DA 1RODA 3S1NB 4XQNA 3I72A 2IT1A 5FLMH 1KDAA 2MO0A 1EL0A 1FNWA 3L0OA 3D4DA 2JA8B 1VQFA 5I4DA 5DNFA 4NDXA 4JI0L 4KHZA 2MNAA 4A76A 3EQLC 1WTQA 1UUPA 3CD6A 1KD1C 4C3JH 1EY8A 4DAPA 1XX8A 4RH6A 2KECA 4PNYA 2XTIA 1STNA 1LTRD 3IRBA 4QMGA 3HRZC 4RGNA 1RKNA 4LAAA 1CKOA 2I46A 1Y1VG 4QCLA 3NWTA 5M9OA 4CDCC 4HJAA 3D4WA 3I4MB 3GTMB 3LX0A 1N9WA 1M90C 1VQ5A 3ND8A 4OL7A 2QILA 1B8AA 3M4OH 5FO8B 2A6HD 2I5LX 3MXNB 2NWGA 1D5XC 4DXGA 4DV4Q 3KBGA 4KKTA 3G6JB 3K57A 1Z6HA 1CZWA 5IGDA 3NQTA 4RWSC 5IGCA 2UXBQ 1EY0A 1QCBD 2FFKB 3X3NA 2WACA 1RTOA 2F0MA 4FF3A 2H1EA 2N3SA 3N6RA 4S3SA 5M5YH 2N88A 2B2YC 3I4NH 4ZKBB 2HD3A 4JCVE 3PIPA 2B29A 2RBMA 3M85A 1Q82C 3BVGA 1ILQA 2KCTA 3NK9A 1HZAA 3D0FA 4R1JA 1SYEA 3CMEA 4FXKC 4KN4C 1ZYRD 1HNXL 1U4LA 4DF7A 1K83H 3G6EA 1JT8A 2EYHA 2N55A 2XRSD 3S1NH 1E7ZA 4A93G 4JBKA 2D9UA 1U5KA 1Q1BA 2B2WC 4KKUA 4DV0Q 1G6PA 1F2MA 3VYSA 1VQEA 4LF7Q 1H9KA 3A8KE 4PZ7A 4LFBQ 4CKEA 2RDHA 3R2IA 3S2HB 5LL6X 1F77A 3RN2A 3CU7A 5EJWA 2KEDA 4DXFA 2Q2TA 4OELB 1N32Q 1EQQA 2MGSA 1A63A 1N8RC 1SEBD 2GN5A 1EQVA 4YWLA 3M7GA 3M4PA 2EJFC 1XYIA 4HMJA 2I5MX 4EQNA 1LT5D 3PIP3 2PZTA 3CAMA 1J5EQ 4GKKL 3E3XA 1PZKD 4OO1G 2NVYB 3I4MH 3JAME 2Q2IA 3GTMH 1V1QA 2YTYA 4B9WA 4JI2L 4DR4Q 4NB3A 5NUCA 1AH9A 1S5FD 1SYBA 4TSSA 5E7NA 4GNXC 5ELNA 3T56B 1BR9A 3LWEA 3MEFA 5M3MG 4KMUC 2Y0SB 4NPSA 4RHSA 1S5BD 2JP1A 4GS3A 2F0SA 2EJGC 3T1YL 4OX9L 2VUMB 4WJWA 1QZGA 3L9AX 2VQFQ 1BVSA 3EROA 4HCSA 5IT9E 2UU9L 1DYQA 4FYDA 1I50B 1EIYB 2YYZA 3OW7A 2JN4A 2OTJA 1MGSA 4OGQC 2EYFA 1IZ6A 2KCNA 3DUZA 4BBSB 4UAIA 3KOJA 3HOUB 1A8VA 4JI3L 5EQ0A 1SYFA 1HZ9A 2HHHQ 2RCNA 4L5QA 1O7ZA 4AIMA 2L11A 1LM0A 3S2HH 2Q8RE 2EY6A 2CKZB 1WTVA 3PUZA 1IL2A 3SVMA 1ESRA 2K05A 1VQLA 3NWSA 4CKBA 4A3EB 2B2WA 5LMNW 5T1IA 3H0GG 2DUDA 5L37A 1RD9D 1PZJD 3K81C 4DUYQ 3AB9A 1FNVA 5AJ3Q 5K36G 4JI4L 2NVYH 1LTBD 2IX3A 4K0KL 1JOOA 5LMNL 2L0CA 1EFID 3KYHC 3BDCA 1N36Q 1SR3A 4R4TA 4CDFC 2DNEA 5J1ZA 5EAYA 3F2DA 1E22A 3MFYA 3L3OC 3H0GB 1ASZA 4OO1H 4EQ5A 4X3SA 1Y8OB 2Z4IA 1SMYD 2PNHA 3ULPA 1XMOQ 1I94Q 4HIMA 4J8QA 1XNRL 2OTLA 4HMIA 1QUQA 1IW7C 1V8QA 1SAPA 5CC4A 1M1KC 1KLGD 1IBLL 2VUMH 3BZKA 1DM0B 3BS1A 1CFMA 2FJ2A 4IFDH 3TZDA 4PV1C 5IOCA 3EIVA 4A3GG 3OSOA 1K0SA 1JICA 3HOWG 1EY5A 1I50H 2WAQE 4LFCL 1S40A 3DMUA 4DV6L 1I3QB 2EE1A 4GNXA 4RCOA 1Y69U 4A3CG 4BBSH 3K8AA 1JJCB 1RIPA 2HUGA 2PMZE 4K6DA 4C2MH 5C4JH 2K04A 1TWFB 1GHJA 5C44G 3BVMA 5C4XG 5GAGC 1YIJA 3MFGA 3X3MA 3LNNA 4QUFA 4R4CA 1VQMA 1CKNB 5EKIA 1IHZA 3H09A 4R4OA 4WFN3 2YTXA 3TP5A 5I6WA 4XQQA 1X55A 4DV1Q 4B3TL 1WCMG 2OQKA 1JB7A 5I9OA 2B2TA 3HOVB 2B63G 3TS2A 1YJWA 1PA6A 4A3EH 3W1GA 4TQUS 3L2PA 3A0JA 1JWUD 3EBEA 2PI2E 4Z9CB 1SDFA 5C5MA 4XYQA 3V05A 1XMQQ 5M3FB 1G8ZD 1WFQA 1U4MA 1RDPD 1XNQL 1J8IA 3QOJA 3UDGA 4B3RL 4LF9L 1GUOA 2GA4B 3ND9A 3H0GH 3P7JA 5FLXc 1EQTA 1MSHA 5K36H 4DV2L 3H3VH 1YNXA 1A62A 3T1HQ 2HIXA 1VQCA 2HT1A 1DZ1A 1KNEA 2Z1CA 4O42A 5IGFA 4MTNA 4JV5Q 4IUNA 1KRSA 2IW3A 4A3JB 1VQ6A 2F0NA 1NMGA 1MSGA 3OMCA 1F2YA 4HEDA 1PFBA 2R7ZG 2CCZA 5KEEA 3ONAB 3PGZA 2XVSA 1LTAD 1B70B 1I3QH 4YCVA 3VR3A 3D8GA 1GUTA 3SDZA 2E5LQ 3C46A 2BOSA 3EN2A 4IUUA 4A3GH 1HPCA 3P75A 1U0LA 2OXPA 1Z7TA 3SK4A 4GN5A 4PZ6A 4DR5Q 4L63B 1TWFH 2RDFA 3GQBA 3VR6A 3S16H 2VL6A 2B39A 4C3IG 4BY1G 1V9PA 4I65A 2A69C 4A3CH 1QVFA 5I9PA 1T5EA 2K1BA 4KV6A 5DAUA 3SR1A 4BA1I 4WORA 5KNDA 4DKAC 2IY5B 1X3GA 4LUZA 4A3FG 5JEAJ 4Y52H 3HOVH 3CPWA 3NSWA 3I3CA 3BJUA 1O78A 4X3TA 1S5DD 4DA2A 5KIXA 1HQMC 1BF4A 2ZTDA 1IKLA 3QJYA 4JI8L 5IGBA 5M3FH 2E2IB 1IW7D 4FVMA 1K3RA 4FXGC 2B63H 3DHQA 1UEAB 1CK1A 2BDNA 3BZCA 4QB4A 3WDNA 3VYTA 3J80L 4OO1I 1S5ED 5EBDA 1Q46A 2WV6D 3H15A 2LFNA 1GJXA 1C48A 2BE5C 1HRJA 4FDBA 1D1KA 2F0UA 2WAQG 3MZ5A 2JE6I 2AUJD 4GN4B 4KKSA 2JQOA 1IBLQ 1EYGA 1X6OA 3F8TA 2MFIA 1G291 2Q2UA 1H95A 2K5HA 4ZKCB 4JK1C 1G2SA 2RSNA 4F8MA 4IFDI 1LT6D 4A3JH 3R8BA 4ZQ3A 2B8FA 2WAQB 1MJCA 2ZT9C 3BVZA 1BOSA 2ATWA 4O0AA 4RGMA 5C3XA 4Y7NB 1NCVA 2LKVA 2PMZB 2KA7A 1L1OB 2MUYA 4OIJA 2JA7G 1X3EA 1JWMD 1DXMA 3I73A 4FF4A 2R7ZH 3VYRA 1YI2A 4YHHQ 1F9QA 1DOMA 1OXUA 3GTQH 3JAMi 1TR5A 2AMCB 1LO5D 1QNUA 4IUVA 1Y8PB 3ZJYC 1VQ8A 2F52A 1I6HB 1G2TA 1B53A 1STBA 1PVOA 4H02A 2SNMA 1QZHA 1EYCA 4RCNA 1GO3E 2VQEQ 3O13A 1E24A 4DU9A 3RNUA 1LTLA 3E9HA 3ICEA 1E1TA 5BR8Q 1A2TA 1R4QB 4DV4L 3AYHB 3ULLA 3D6WA 1VQ4A 3GTKB 2HQLA 1HNZQ 1PDQA 1SFOB 4KI0A 1XNQQ 2E2IH 2Z8LA 4KJOA 1VQ9A 4UP7A 3OOCA 1HA5A 2XGTA 3NBHA 1VQHA 4R8IA 3C3LA 1ET6A 1B7YB 4X65Q 1EWIA 4DAVA 2O4XA 2A1AA 1N33Q 3HKSA 3H3VI 3NXWA 5A35A 4L8JA 2F0GA 2RKSA 3HOYB 4RAUC 1KXLA 2K28A 3CCQA 1SNQA 3P1HA 4NKLA 1PFSA 4POFA 4K8JA 1DONA 4LF7L 2YV5A 3FHWA 3IKJA 4A75A 1BBXC 1Q7YC 4Y7NH 3CPFA 3K5MA 2NZHA 4GOPA 3S1QB 4IN3A 1D5MC 1N32L 2EVBA 1JCKB 4Q5VA 1W2BA 4R9WA 1STGA 1X9NA 4FNFA 4NXMQ 3R3OA 4FXDA 2IWHA 4OWXB 3H6MA 4IUQA 2IJ0A 2A6EC 1J5EL 4XDXA 3FP9A 1WI5A 2JA7H 1C8CA 4HIOA 3QR8A 3WOFA 1I6HH 1ILPA 1PTOC 1O80A 2Q8TA 5JVH3 4DR4L 2OEOA 1JJGA 2WP8J 4HN7A 1WTOA 3IL8A 1NR2A 4A3MB 3GTKH 2WKCA 5K5PA 4ODGA 1SFOH 1JB3A 4YY3Q 1S72A 1LTSD 5BN5A 3T51B 2KCMA 1UEBA 1TS5A 2MJ8A 4EQOA 1RF2D 4BY7B 2K5WA 2VQFL 1HHVA 3I2ZA 4MN3A 1FYCA 1XTDA 1ZEQX 1WTWA 3GDEA 3IFDA 2Z0SA 4WRDA 2O5IC 1HQRD 1XPUA 2ASBA 1CSQA 2R92G 2VB3X 2RCFA 3CC2A 3RZDH 4DV7L 1KL9A 2DY8A 1NAPA 2AWNA 4LF4L 1VQGA 2JEBI 2B8GA 1PRTC 2N8NA 2A73B 2HHHL 5FLXE 3FPPA 1TS4A 1C7YA 2KQ3A 4ILWA 4IZ8A 5FO7B 3NTIA 5D3DA 5I6YA 2PQAB 1PYWD 4GLVB 2XRQD 3UE1A 1HXYD 3S1QH 3CC7A 2K5VA 2ZXRA 4ZAIA 5H1SE 4JPBW 5C0XH 4M8AA 5GQOA 3GD7A 5IWAQ 1KIXA 1CHQD 1XXGA 1GXDC 2LS01 2R7FA 1DD2A 2F3WA 2Z6KA 4X3KA 1SNPA 3K7AH 3W3AA 1B9NA 3CCSA 4DUYL 1IYJB 5AJ3L 3BZDB 2M2LA 5JPMC 3S14H 1LT4D 5JEAG 1TWAB 2F3IA 1N36L 1HH2P 1WJJA 2E75C 2GVBA 1Q1EA 2I5HA 2V1CC 4LFAQ 1Y1VB 1R4PB 1GHKA 2JEAI 1VQOA 2MP1A 2EYLA 1YJNA 1SYGA 1EWHA 4M1UB 3NEMA 2VW9A 1XMOL 1I94L 4A3MH 5CV7A 5C4ZA 1VMCA 4ME3A 3K6OA 1IBKQ 2NUCA 1EZ6A 3ERQA 2Z9HA 2E2JB 2KCCA 1U9RA 2JK8A 1HR0Q 4B3MQ 3PCOB 4XQJA 3GTGB 3J80E
chains in the Genus database with same CATH topology
1RL2A 3CCMA 2IHEA 5LMNL 1MKHA 5FJ8H 4DK6C 1AE3A 3KYHC 4DV5L 1N34L 1N36Q 1SR3A 4R4TA 1X56A 4X66L 4P71A 5EAYA 3WWVA 1QVCA 1E22A 3F2DA 1HNWQ 4LW1A 2D0OA 2UUAQ 3U58A 1UE7A 3I7FA 3I55A 1ASZA 1VQKA 4EQ5A 4O2DA 3BU2A 2OCEA 2PNHA 4DR2L 3ULPA 3F2BA 1XMOQ 1MJEA 4HIMA 1PH9A 1I94Q 3AEVA 4GLXA 1XNRL 2K5NA 2D0PA 2NN6G 1Y1WH 2OTLA 2A19A 1QUQA 3A5ZB 3M4QA 3PUWA 5IP7G 1XPOA 1M1KC 4GOPB 4LUOA 1IBLL 3BZKA 1JJ2A 2VUMH 4WJ4A 4KHPQ 4JI4Q 4K0KQ 1IBLQ 3EIVA 4A3GG 3TQYA 5LMNQ 1N34Q 3K80C 2IX1A 4DV5Q 4QIWE 3PSIA 4X66Q 4YWKA 2BH8A 1CKNA 4A3KH 3HOWG 4A3DH 1I50H 2WAQE 4LFCL 1G51A 1S40A 5JJKA 1KRTA 4DV6L 4GNXA 4JI7L 4DV1L 4A3CG 4BBSH 3K8AA 1JJCB 1RIPA 3HOXH 3CC4A 2PMZE 3GTLH 1SN8A 1XNRQ 1QUQB 4C2MH 1Q81C 1GD7A 1HJPA 5C4JH 4P75A 1XMQL 5C44G 3I4NG 1K0RA 1PH7A 5C4XG 2N78A 3AQQA 1YZ6A 5GAGC 5GADC 1IXRA 4DUZL 4BBRH 1YIJA 3W5OA 1XJVA 2K14A 4QL5A 1FL0A 1TWAH 4R4CA 1YJ9A 4IPCA 1IBML 1VQMA 1CKNB 5JJIA 1Y1VH 3OTOL 4AQYL 4R4OA 1AE2A 1HZBA 4UY8C 3HOZG 2R93H 4LFCQ 2YTXA 4A4IA 4GNXB 4JI1L 1HZCA 3RZOH 4A3BH 4DV6Q 1NJIC 2FXQA 5IP9G 4JI7Q 1X55A 3KDFA 3D31A 4QY7A 4DV1Q 1WCMG 2OQKA 3GO5A 2QEXA 1JB7A 4B3TL 1A0IA 3T1HL 4L5TA 2B63G 3TS2A 1YJWA 1PA6A 4A3EH 3S17H 1L1OC 2DGYA 3W1GA 2K4KA 3JAMc 4TQUS 5C3EH 2E2JH 1NTGA 4DR3L 1VQPA 1SRUA 3A0JA 3L2PA 3I56A 2QA4A 4DNIA 3EBEA 2LXJA 2PI2E 1VQ7A 2ZM6L 1XMQQ 4JV5L 1EIFA 3STBD 2HIVA 1WFQA 3GTGH 1PH3A 4DUZQ 3FKIG 1OTCA 1XNQL 2JA8G 2LSSA 2NVTH 4JG2A 4IO9A 3ER0A 1ASYA 3PO2G 5IYDG 3UDGA 4B3RL 4LF9L 1IBMQ 2A8VA 1UWVA 4EX5A 1PH2A 4JBJA 4QQBX 1O7IA 3OTOQ 1CUKA 2C35B 4AQYQ 3TRZA 3H0GH 1KAWA 5FLXc 4DV7Q 4X6AH 4LF4Q 3KDFB 4JI1Q 1PHJA 4DV2L 3CF5A 4BY7H 1UE5A 1P8LA 2E5LL 4LF6L 3H3VH 4IJLA 1D7QA 1E1OA 1YNXA 1P16A 4IPHA 1CKMA 2ID0A 5IYCG 4B3TQ 1A62A 2E8GA 3T1HQ 3ULJA 2HIXA 1YITA 1VQCA 2Q2HA 3A74A 3AFQA 5IT9c 4DR5L 2HT1A 3AFPA 4DR3Q 4JOIA 2ZTEA 1Z47A 2OQ0A 1J6QA 4DPGA 4MTNA 2ES2A 2ZM6Q 1DGSA 3I4MG 4JV5Q 1KRSA 1VQ6A 4A93H 2UXBL 1NMGA 1NY4A 3RLFA 1EFWA 1X65A 2UU9Q 4L5RC 4LF9Q 4B3RQ 1VQJA 1Y14B 5C0XI 2CCZA 2R7ZG 3DLLA 3PGZA 4DAYB 1V43A 3UDIA 3HOYG 5JJLA 1B70B 1I3QH 4YCVA 2KHIA 3TS0A 1PV4A 1JMCA 4DV2Q 2AWOA 3PUVA 2BA0A 3CCRA 2E5LQ 4LF6Q 4GKJL 1BKBA 3EN2A 1OXVA 4A3GH 1TXYA 5M5XH 2YU9H 1U0LA 3RR5A 4JBWA 4XIGS 2RHSB 4GN5A 1SMXA 4PZ6A 4DR5Q 1YHQA 1TWFH 4JI5L 1FJGL 1LUZA 2UUCL 3M3YH 3S16H 2VL6A 1UE6A 4IOAA 1X3FA 4BY1G 5J3BA 4JI6L 1V9PA 3J81j 4A3CH 4UPAA 1QVFA 5GAEC 3M9BA 3K0XA 4YCUA 4L5SA 2H5XA 4BA1I 2R7DA 1EUJA 4APVA 5C0XG 4DV0L 2JA5H 1NE3A 4B3SQ 4JBMA 2LXKA 4BXXH 4OXPA 3PF4A 4P74A 4TVAB 4YCWA 4LFBL 1GVPA 4DKAC 2IHFA 2I0QA 1X3GA 4LUZA 3PO3G 2IY5B 4A3FG 5JEAJ 3RLOA 4Y52H 1VQDA 1C9OA 4IPDA 4GKJQ 3HOVH 3CPWA 3F1ZA 2R92H 3F2CA 2E2HH 3CXCA 5LMUL 1TWCH 4PMWA 3BJUA 1D8LA 3GTJH 2ZTDA 4J15A 3HOZH 4JI8L 4X64L 1Q8KA 4JI5Q 3UDFA 1FJGQ 2UUCQ 4A3LH 4MNOA 3CCJA 5M3FH 5M3MH 5IP9H 1PH1A 5M5WH 4JI6Q 1KHIA 5IYBG 2OWOA 3GTPH 1K3RA 2B63H 3CCVA 1PYSB 3B6YA 3KF8B 3G71A 1SROA 1YHBA 2K52A 3PUXA 3BZCA 2JA8H 3S15H 4DR2Q 4OO1I 1Q46A 1Q86C 4A3MG 3GTOH 3H15A 1EOVA 3FKIH 4WJ3M 3J81c 1GM5A 1L1OA 4FDBA 1T9HA 3PO2H 5IYDH 4LUVA 2WAQG 2JE6I 2CQOA 4GN4B 2F4VL 2JQOA 5LMUQ 1EYGA 1X6OA 2IX0A 2MFIA 3F8TA 3U4ZA 1G291 3CCUA 1QVGA 2K5HA 2Q2UA 1CSPA 1MIUA 4BY7G 3PF5A 5K36G 1H95A 4YHHL 4JI8Q 4X64Q 4K0KL 4IFDI 5FJ8G 4A3JH 1VS0A 2VZAA 2Y0SE 4QJFA 2BA1A 5IYCH 3J81i 1MJCA 1BBWA 1SE8A 1XPRA 1C0AA 4DR6L 1L2FA 2ATWA 4O0AA 1TWHH 2AKWB 2VQEL 4HIDA 3CW2C 1L1OB 3CCLA 2PQAA 2Y0SG 5BR8L 2JA7G 1S3OA 4PG3A 4YWMA 1X3EA 2F4VQ 2PI2A 1HNZL 2R7ZH 2VUMG 5IE8A 2RHQB 4PZ8A 3J7A5 3HOYH 3NENA 1YI2A 4IFDG 4YHHQ 1I5FA 2IT1A 5FLMH 2MO0A 2NVXH 1OXUA 3L0OA 3GTQH 3OW2A 3JAMi 2WB1E 1VQFA 2AMCB 4OWTB 1SLJA 5GROA 3STBC 1FVIA 4A3KG 3ZJYC 1VQ8A 2F52A 2AHOB 3HKZE 4JI0L 4DR6Q 4X65L 4KHZA 4H02A 2MNAA 4A76A 1PVOA 1QZHA 1N33L 1GO3E 2VQEQ 4OWWB 4BBSG 1E24A 3HOXG 3HOUG 3RNUA 2UXDL 1LTLA 3E9HA 3ICEA 3CD6A 5IY0A 3U50C 4C3JH 1KD1C 1E1TA 1Q12A 5BR8Q 1VQIA 1R9TH 4LF5L 2VNUD 4DV4L 3AYHB 4JYAL 3ULLA 3RLNA 1VQ4A 2HQLA 1HNZQ 3HKZG 1PH5A 1WOCA 2XTIA 1VQNA 2JA9A 4KI0A 1XNQQ 4BBRG 2K50A 2R6GA 3IRBA 2E2IH 2UUBL 4DR1L 1VQ9A 1CKOA 4UP7A 5IP7H 1Y1VG 1PH8A 1PYBA 2XGTA 4HJAA 1VQHA 1NMFA 4JI0Q 1B7YB 1LYLA 1EWIA 4X65Q 1N9WA 1M90C 2A1AA 1VQ5A 1N33Q 3HKSA 1B8AA 3H3VI 3M4OH 2UXDQ 2K75A 4A3EG 5IYBH 2I5LX 3MXNB 3HOWH 2ZJPA 3JC66 3CQZH 1KQSA 4LF5Q 3RN5A 4DV4Q 1KXLA 4HJ5A 4JYAQ 2ZJRA 4NXML 4POGA 4HJ7A 3CCQA 5GAHC 2UXBQ 3A5UA 1PFSA 4POFA 2UUBQ 3LGJA 4DR1Q 4LF7L 2N3SA 2YV5A 1JE5A 5M5YH 3FHWA 5C44H 3I4NH 4A3IG 4JCVE 5C4XH 3PIPA 2B29A 4P73A 3E0EA 4AH6A 3J7ZC 3M85A 4A75A 1Q82C 1Q7YC 4Y7NH 2MQHA 3CPFA 2NZHA 4HJ9A 4GOPA 3J80c 1K8AC 3HFZB 3KFUA 4BA2I 2KCTA 2JA6G 1HZAA 3D0FA 4R1JA 1N32L 1NBWA 2L15A 2VY3A 3CMEA 1UE1A 1W2BA 1HNXL 2CWAA 1K83H 3ERSX 3G6EA 1X9NA 1JT8A 3S1MH 4RG1A 3SGIA 4NXMQ 1WCMH 4OWXB 4YY3L 2NVQH 1BBUA 3KJOA 3KJPA 3OYYA 1E7ZA 1J5EL 3J80i 3S1NH 4A93G 4JBKA 1U5KA 1Q1BA 1K73C 4DV0Q 1G6PA 1VCIA 3FP9A 2EXDA 1VQEA 1WI5A 4LF7Q 3CCEA 3S1RH 3CMAA 2JA7H 4PZ7A 4LFBQ 3K7UC 4HIOA 3U4VA 4GOPC 3M7NA 4HJ8A 1I6HH 3RN2A 5HGQA 4DAMA 3PIOA 2VS1A 4DR4L 2KENA 1GKHA 2Q2TA 1YBYA 1N32Q 1EQQA 3KF6A 3PUYA 1JJGA 2WP8J 4DV3L 2ZJQA 1A63A 1N8RC 5C0XJ 2GN5A 1HNXQ 3VDYA 3G48A 1OXTA 4YWLA 2CFMA 3GTKH 3M4PA 1TWGH 1SFOH 4YY3Q 1S72A 1X54A 2I5MX 1YEZA 3NELA 1J5EQ 3CAMA 3HOUH 4GKKL 2KCMA 1UEBA 2ALYB 2JA5G 2BH2A 4OO1G 2KBNA 2VQFL 4NXNL 4BXXG 3I2ZA 3I4MH 1OXSC 4R4QA 1XTDA 2Q2IA 3GTMH 3GDEA 2Z0SA 1V1QA 2UXCL 2YTYA 2QGQA 4JC0A 1Y1WG 4DR7L 3KF6B 4IOCA 4OONA 4JI2L 2ASBA 1XPUA 4NB3A 4GLAC 3HOVG 1CSQA 4LNQA 4DR4Q 5IWAL 2R92G 1AH9A 2YTVA 1W3SA 3CC2A 1VQAA 3RZDH 4DV3Q 4DV7L 2JJQA 2WFWA 1KL9A 5E7NA 5ELNA 3UDXA 4GNXC 4LF4L 2AWNA 3MEFA 1VQGA 5M3FG 5HY6A 4A3LG 2JEBI 5M3MG 2D62A 2N8NA 2HHHL 2MO1A 4NPSA 4LF8L 5ELOA 4AYBE 4GS3A 4A3DG 4GKKQ 3T1YL 4OX9L 1E3PA 4R4IA 1C7YA 1KC8C 3PV0A 4HIKA 1QZGA 2VQFQ 1WYDA 4NXNQ 4C3IH 1BVSA 4BY1H 4XTCS 2PQAB 3S2DH 3E9IA 4DK3C 4GLVB 1VQBA 4ALPA 2N49A 2UU9L 3UE1A 4LFAL 4KLKA 3S1QH 3CC7A 2K5VA 5H1SE 2UXCQ 2KHJA 2WB1G 4LWCA 1K9MC 4DR7Q 4AYBG 4JI2Q 4X62L 3CP0A 1EIYB 2YYZA 5GQOA 3GD7A 5IWAQ 4MZ9A 2OTJA 2EQSA 3G4SA 2GVAA 1IZ6A 3S24A 1KIXA 1HR0W 4A3IH 1K8GA 1FGUA 3PO3H 3KOJA 1A8VA 2R7FA 1IBKL 4JI3L 2ZTCA 4A3FH 4IJHA 4A3JG 2Z6KA 1HZ9A 2HHHQ 2JA6H 2RCNA 3K7AH 1HR0L 4L5QA 4LF8Q 4B3ML 2R93G 3CCSA 4AIMA 4DUYL 1IYJB 3T1YQ 5AJ3L 2B3GA 5DLQE 4OX9Q 3TREA 4A3BG 1HNWL 1OXXK 3S14H 1LM0A 2NZOA 1YHAA 1Z9FA 5JEAG 1N36L 2F3IA 3S2HH 4IFDJ 1HH2P 1WJJA 2CKZB 2GVBA 1Q1EA 2I5HA 2V1CC 3DM3A 4P72A 4LFAQ 5C3EG 4C3HH 2UUAL 2JEAI 1L0WA 1VQOA 3KLWA 4X62Q 3PUZA 1YJNA 4B3SL 1PH6A 1IL2A 3NEMA 2VW9A 1XMOL 1I94L 4A3MH 2RF4A 2Z6KC 3L7ZC 4ME3A 4UP8A 1VQLA 1IBKQ 4JI3Q 5FLMG 4QGUA 3Q8DA 3NBHB 4RMFA 3TEHB 2JK8A 2NN6I 3UE0A 4GN3B 1YVCA 3W1BA 5LMNW 2CWPA 2DUDA 3H0GG 1PH4A 1HR0Q 4B3MQ 1EQRA 4JOIC 2EIFA 3K81C 3PCOB 4DUYQ 4UP9A 4IPGA 5AJ3Q 4KHPL 3I4OA 4JI4L 2NVYH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL2 A;  3CCM A;  2IHE A;  5LMN L;  1MKH A;  5FJ8 H;  4DK6 C;  1AE3 A;  3KYH C;  4DV5 L;  1N34 L;  1N36 Q;  1SR3 A;  4R4T A;  1X56 A;  4X66 L;  4P71 A;  5EAY A;  3WWV A;  1QVC A;  1E22 A;  3F2D A;  1HNW Q;  4LW1 A;  2D0O A;  2UUA Q;  3U58 A;  1UE7 A;  3I7F A;  3I55 A;  1ASZ A;  1VQK A;  4EQ5 A;  4O2D A;  3BU2 A;  2OCE A;  2PNH A;  4DR2 L;  3ULP A;  3F2B A;  1XMO Q;  1MJE A;  4HIM A;  1PH9 A;  1I94 Q;  3AEV A;  4GLX A;  1XNR L;  2K5N A;  2D0P A;  2NN6 G;  1Y1W H;  2OTL A;  2A19 A;  1QUQ A;  3A5Z B;  3M4Q A;  3PUW A;  5IP7 G;  1XPO A;  1M1K C;  4GOP B;  4LUO A;  1IBL L;  3BZK A;  1JJ2 A;  2VUM H;  4WJ4 A;  4KHP Q;  4JI4 Q;  4K0K Q;  1IBL Q;  3EIV A;  4A3G G;  3TQY A;  5LMN Q;  1N34 Q;  3K80 C;  2IX1 A;  4DV5 Q;  4QIW E;  3PSI A;  4X66 Q;  4YWK A;  2BH8 A;  1CKN A;  4A3K H;  3HOW G;  4A3D H;  1I50 H;  2WAQ E;  4LFC L;  1G51 A;  1S40 A;  5JJK A;  1KRT A;  4DV6 L;  4GNX A;  4JI7 L;  4DV1 L;  4A3C G;  4BBS H;  3K8A A;  1JJC B;  1RIP A;  3HOX H;  3CC4 A;  2PMZ E;  3GTL H;  1SN8 A;  1XNR Q;  1QUQ B;  4C2M H;  1Q81 C;  1GD7 A;  1HJP A;  5C4J H;  4P75 A;  1XMQ L;  5C44 G;  3I4N G;  1K0R A;  1PH7 A;  5C4X G;  2N78 A;  3AQQ A;  1YZ6 A;  5GAG C;  5GAD C;  1IXR A;  4DUZ L;  4BBR H;  1YIJ A;  3W5O A;  1XJV A;  2K14 A;  4QL5 A;  1FL0 A;  1TWA H;  4R4C A;  1YJ9 A;  4IPC A;  1IBM L;  1VQM A;  1CKN B;  5JJI A;  1Y1V H;  3OTO L;  4AQY L;  4R4O A;  1AE2 A;  1HZB A;  4UY8 C;  3HOZ G;  2R93 H;  4LFC Q;  2YTX A;  4A4I A;  4GNX B;  4JI1 L;  1HZC A;  3RZO H;  4A3B H;  4DV6 Q;  1NJI C;  2FXQ A;  5IP9 G;  4JI7 Q;  1X55 A;  3KDF A;  3D31 A;  4QY7 A;  4DV1 Q;  1WCM G;  2OQK A;  3GO5 A;  2QEX A;  1JB7 A;  4B3T L;  1A0I A;  3T1H L;  4L5T A;  2B63 G;  3TS2 A;  1YJW A;  1PA6 A;  4A3E H;  3S17 H;  1L1O C;  2DGY A;  3W1G A;  2K4K A;  3JAM c;  4TQU S;  5C3E H;  2E2J H;  1NTG A;  4DR3 L;  1VQP A;  1SRU A;  3A0J A;  3L2P A;  3I56 A;  2QA4 A;  4DNI A;  3EBE A;  2LXJ A;  2PI2 E;  1VQ7 A;  2ZM6 L;  1XMQ Q;  4JV5 L;  1EIF A;  3STB D;  2HIV A;  1WFQ A;  3GTG H;  1PH3 A;  4DUZ Q;  3FKI G;  1OTC A;  1XNQ L;  2JA8 G;  2LSS A;  2NVT H;  4JG2 A;  4IO9 A;  3ER0 A;  1ASY A;  3PO2 G;  5IYD G;  3UDG A;  4B3R L;  4LF9 L;  1IBM Q;  2A8V A;  1UWV A;  4EX5 A;  1PH2 A;  4JBJ A;  4QQB X;  1O7I A;  3OTO Q;  1CUK A;  2C35 B;  4AQY Q;  3TRZ A;  3H0G H;  1KAW A;  5FLX c;  4DV7 Q;  4X6A H;  4LF4 Q;  3KDF B;  4JI1 Q;  1PHJ A;  4DV2 L;  3CF5 A;  4BY7 H;  1UE5 A;  1P8L A;  2E5L L;  4LF6 L;  3H3V H;  4IJL A;  1D7Q A;  1E1O A;  1YNX A;  1P16 A;  4IPH A;  1CKM A;  2ID0 A;  5IYC G;  4B3T Q;  1A62 A;  2E8G A;  3T1H Q;  3ULJ A;  2HIX A;  1YIT A;  1VQC A;  2Q2H A;  3A74 A;  3AFQ A;  5IT9 c;  4DR5 L;  2HT1 A;  3AFP A;  4DR3 Q;  4JOI A;  2ZTE A;  1Z47 A;  2OQ0 A;  1J6Q A;  4DPG A;  4MTN A;  2ES2 A;  2ZM6 Q;  1DGS A;  3I4M G;  4JV5 Q;  1KRS A;  1VQ6 A;  4A93 H;  2UXB L;  1NMG A;  1NY4 A;  3RLF A;  1EFW A;  1X65 A;  2UU9 Q;  4L5R C;  4LF9 Q;  4B3R Q;  1VQJ A;  1Y14 B;  5C0X I;  2CCZ A;  2R7Z G;  3DLL A;  3PGZ A;  4DAY B;  1V43 A;  3UDI A;  3HOY G;  5JJL A;  1B70 B;  1I3Q H;  4YCV A;  2KHI A;  3TS0 A;  1PV4 A;  1JMC A;  4DV2 Q;  2AWO A;  3PUV A;  2BA0 A;  3CCR A;  2E5L Q;  4LF6 Q;  4GKJ L;  1BKB A;  3EN2 A;  1OXV A;  4A3G H;  1TXY A;  5M5X H;  2YU9 H;  1U0L A;  3RR5 A;  4JBW A;  4XIG S;  2RHS B;  4GN5 A;  1SMX A;  4PZ6 A;  4DR5 Q;  1YHQ A;  1TWF H;  4JI5 L;  1FJG L;  1LUZ A;  2UUC L;  3M3Y H;  3S16 H;  2VL6 A;  1UE6 A;  4IOA A;  1X3F A;  4BY1 G;  5J3B A;  4JI6 L;  1V9P A;  3J81 j;  4A3C H;  4UPA A;  1QVF A;  5GAE C;  3M9B A;  3K0X A;  4YCU A;  4L5S A;  2H5X A;  4BA1 I;  2R7D A;  1EUJ A;  4APV A;  5C0X G;  4DV0 L;  2JA5 H;  1NE3 A;  4B3S Q;  4JBM A;  2LXK A;  4BXX H;  4OXP A;  3PF4 A;  4P74 A;  4TVA B;  4YCW A;  4LFB L;  1GVP A;  4DKA C;  2IHF A;  2I0Q A;  1X3G A;  4LUZ A;  3PO3 G;  2IY5 B;  4A3F G;  5JEA J;  3RLO A;  4Y52 H;  1VQD A;  1C9O A;  4IPD A;  4GKJ Q;  3HOV H;  3CPW A;  3F1Z A;  2R92 H;  3F2C A;  2E2H H;  3CXC A;  5LMU L;  1TWC H;  4PMW A;  3BJU A;  1D8L A;  3GTJ H;  2ZTD A;  4J15 A;  3HOZ H;  4JI8 L;  4X64 L;  1Q8K A;  4JI5 Q;  3UDF A;  1FJG Q;  2UUC Q;  4A3L H;  4MNO A;  3CCJ A;  5M3F H;  5M3M H;  5IP9 H;  1PH1 A;  5M5W H;  4JI6 Q;  1KHI A;  5IYB G;  2OWO A;  3GTP H;  1K3R A;  2B63 H;  3CCV A;  1PYS B;  3B6Y A;  3KF8 B;  3G71 A;  1SRO A;  1YHB A;  2K52 A;  3PUX A;  3BZC A;  2JA8 H;  3S15 H;  4DR2 Q;  4OO1 I;  1Q46 A;  1Q86 C;  4A3M G;  3GTO H;  3H15 A;  1EOV A;  3FKI H;  4WJ3 M;  3J81 c;  1GM5 A;  1L1O A;  4FDB A;  1T9H A;  3PO2 H;  5IYD H;  4LUV A;  2WAQ G;  2JE6 I;  2CQO A;  4GN4 B;  2F4V L;  2JQO A;  5LMU Q;  1EYG A;  1X6O A;  2IX0 A;  2MFI A;  3F8T A;  3U4Z A;  1G29 1;  3CCU A;  1QVG A;  2K5H A;  2Q2U A;  1CSP A;  1MIU A;  4BY7 G;  3PF5 A;  5K36 G;  1H95 A;  4YHH L;  4JI8 Q;  4X64 Q;  4K0K L;  4IFD I;  5FJ8 G;  4A3J H;  1VS0 A;  2VZA A;  2Y0S E;  4QJF A;  2BA1 A;  5IYC H;  3J81 i;  1MJC A;  1BBW A;  1SE8 A;  1XPR A;  1C0A A;  4DR6 L;  1L2F A;  2ATW A;  4O0A A;  1TWH H;  2AKW B;  2VQE L;  4HID A;  3CW2 C;  1L1O B;  3CCL A;  2PQA A;  2Y0S G;  5BR8 L;  2JA7 G;  1S3O A;  4PG3 A;  4YWM A;  1X3E A;  2F4V Q;  2PI2 A;  1HNZ L;  2R7Z H;  2VUM G;  5IE8 A;  2RHQ B;  4PZ8 A;  3J7A 5;  3HOY H;  3NEN A;  1YI2 A;  4IFD G;  4YHH Q;  1I5F A;  2IT1 A;  5FLM H;  2MO0 A;  2NVX H;  1OXU A;  3L0O A;  3GTQ H;  3OW2 A;  3JAM i;  2WB1 E;  1VQF A;  2AMC B;  4OWT B;  1SLJ A;  5GRO A;  3STB C;  1FVI A;  4A3K G;  3ZJY C;  1VQ8 A;  2F52 A;  2AHO B;  3HKZ E;  4JI0 L;  4DR6 Q;  4X65 L;  4KHZ A;  4H02 A;  2MNA A;  4A76 A;  1PVO A;  1QZH A;  1N33 L;  1GO3 E;  2VQE Q;  4OWW B;  4BBS G;  1E24 A;  3HOX G;  3HOU G;  3RNU A;  2UXD L;  1LTL A;  3E9H A;  3ICE A;  3CD6 A;  5IY0 A;  3U50 C;  4C3J H;  1KD1 C;  1E1T A;  1Q12 A;  5BR8 Q;  1VQI A;  1R9T H;  4LF5 L;  2VNU D;  4DV4 L;  3AYH B;  4JYA L;  3ULL A;  3RLN A;  1VQ4 A;  2HQL A;  1HNZ Q;  3HKZ G;  1PH5 A;  1WOC A;  2XTI A;  1VQN A;  2JA9 A;  4KI0 A;  1XNQ Q;  4BBR G;  2K50 A;  2R6G A;  3IRB A;  2E2I H;  2UUB L;  4DR1 L;  1VQ9 A;  1CKO A;  4UP7 A;  5IP7 H;  1Y1V G;  1PH8 A;  1PYB A;  2XGT A;  4HJA A;  1VQH A;  1NMF A;  4JI0 Q;  1B7Y B;  1LYL A;  1EWI A;  4X65 Q;  1N9W A;  1M90 C;  2A1A A;  1VQ5 A;  1N33 Q;  3HKS A;  1B8A A;  3H3V I;  3M4O H;  2UXD Q;  2K75 A;  4A3E G;  5IYB H;  2I5L X;  3MXN B;  3HOW H;  2ZJP A;  3JC6 6;  3CQZ H;  1KQS A;  4LF5 Q;  3RN5 A;  4DV4 Q;  1KXL A;  4HJ5 A;  4JYA Q;  2ZJR A;  4NXM L;  4POG A;  4HJ7 A;  3CCQ A;  5GAH C;  2UXB Q;  3A5U A;  1PFS A;  4POF A;  2UUB Q;  3LGJ A;  4DR1 Q;  4LF7 L;  2N3S A;  2YV5 A;  1JE5 A;  5M5Y H;  3FHW A;  5C44 H;  3I4N H;  4A3I G;  4JCV E;  5C4X H;  3PIP A;  2B29 A;  4P73 A;  3E0E A;  4AH6 A;  3J7Z C;  3M85 A;  4A75 A;  1Q82 C;  1Q7Y C;  4Y7N H;  2MQH A;  3CPF A;  2NZH A;  4HJ9 A;  4GOP A;  3J80 c;  1K8A C;  3HFZ B;  3KFU A;  4BA2 I;  2KCT A;  2JA6 G;  1HZA A;  3D0F A;  4R1J A;  1N32 L;  1NBW A;  2L15 A;  2VY3 A;  3CME A;  1UE1 A;  1W2B A;  1HNX L;  2CWA A;  1K83 H;  3ERS X;  3G6E A;  1X9N A;  1JT8 A;  3S1M H;  4RG1 A;  3SGI A;  4NXM Q;  1WCM H;  4OWX B;  4YY3 L;  2NVQ H;  1BBU A;  3KJO A;  3KJP A;  3OYY A;  1E7Z A;  1J5E L;  3J80 i;  3S1N H;  4A93 G;  4JBK A;  1U5K A;  1Q1B A;  1K73 C;  4DV0 Q;  1G6P A;  1VCI A;  3FP9 A;  2EXD A;  1VQE A;  1WI5 A;  4LF7 Q;  3CCE A;  3S1R H;  3CMA A;  2JA7 H;  4PZ7 A;  4LFB Q;  3K7U C;  4HIO A;  3U4V A;  4GOP C;  3M7N A;  4HJ8 A;  1I6H H;  3RN2 A;  5HGQ A;  4DAM A;  3PIO A;  2VS1 A;  4DR4 L;  2KEN A;  1GKH A;  2Q2T A;  1YBY A;  1N32 Q;  1EQQ A;  3KF6 A;  3PUY A;  1JJG A;  2WP8 J;  4DV3 L;  2ZJQ A;  1A63 A;  1N8R C;  5C0X J;  2GN5 A;  1HNX Q;  3VDY A;  3G48 A;  1OXT A;  4YWL A;  2CFM A;  3GTK H;  3M4P A;  1TWG H;  1SFO H;  4YY3 Q;  1S72 A;  1X54 A;  2I5M X;  1YEZ A;  3NEL A;  1J5E Q;  3CAM A;  3HOU H;  4GKK L;  2KCM A;  1UEB A;  2ALY B;  2JA5 G;  2BH2 A;  4OO1 G;  2KBN A;  2VQF L;  4NXN L;  4BXX G;  3I2Z A;  3I4M H;  1OXS C;  4R4Q A;  1XTD A;  2Q2I A;  3GTM H;  3GDE A;  2Z0S A;  1V1Q A;  2UXC L;  2YTY A;  2QGQ A;  4JC0 A;  1Y1W G;  4DR7 L;  3KF6 B;  4IOC A;  4OON A;  4JI2 L;  2ASB A;  1XPU A;  4NB3 A;  4GLA C;  3HOV G;  1CSQ A;  4LNQ A;  4DR4 Q;  5IWA L;  2R92 G;  1AH9 A;  2YTV A;  1W3S A;  3CC2 A;  1VQA A;  3RZD H;  4DV3 Q;  4DV7 L;  2JJQ A;  2WFW A;  1KL9 A;  5E7N A;  5ELN A;  3UDX A;  4GNX C;  4LF4 L;  2AWN A;  3MEF A;  1VQG A;  5M3F G;  5HY6 A;  4A3L G;  2JEB I;  5M3M G;  2D62 A;  2N8N A;  2HHH L;  2MO1 A;  4NPS A;  4LF8 L;  5ELO A;  4AYB E;  4GS3 A;  4A3D G;  4GKK Q;  3T1Y L;  4OX9 L;  1E3P A;  4R4I A;  1C7Y A;  1KC8 C;  3PV0 A;  4HIK A;  1QZG A;  2VQF Q;  1WYD A;  4NXN Q;  4C3I H;  1BVS A;  4BY1 H;  4XTC S;  2PQA B;  3S2D H;  3E9I A;  4DK3 C;  4GLV B;  1VQB A;  4ALP A;  2N49 A;  2UU9 L;  3UE1 A;  4LFA L;  4KLK A;  3S1Q H;  3CC7 A;  2K5V A;  5H1S E;  2UXC Q;  2KHJ A;  2WB1 G;  4LWC A;  1K9M C;  4DR7 Q;  4AYB G;  4JI2 Q;  4X62 L;  3CP0 A;  1EIY B;  2YYZ A;  5GQO A;  3GD7 A;  5IWA Q;  4MZ9 A;  2OTJ A;  2EQS A;  3G4S A;  2GVA A;  1IZ6 A;  3S24 A;  1KIX A;  1HR0 W;  4A3I H;  1K8G A;  1FGU A;  3PO3 H;  3KOJ A;  1A8V A;  2R7F A;  1IBK L;  4JI3 L;  2ZTC A;  4A3F H;  4IJH A;  4A3J G;  2Z6K A;  1HZ9 A;  2HHH Q;  2JA6 H;  2RCN A;  3K7A H;  1HR0 L;  4L5Q A;  4LF8 Q;  4B3M L;  2R93 G;  3CCS A;  4AIM A;  4DUY L;  1IYJ B;  3T1Y Q;  5AJ3 L;  2B3G A;  5DLQ E;  4OX9 Q;  3TRE A;  4A3B G;  1HNW L;  1OXX K;  3S14 H;  1LM0 A;  2NZO A;  1YHA A;  1Z9F A;  5JEA G;  1N36 L;  2F3I A;  3S2H H;  4IFD J;  1HH2 P;  1WJJ A;  2CKZ B;  2GVB A;  1Q1E A;  2I5H A;  2V1C C;  3DM3 A;  4P72 A;  4LFA Q;  5C3E G;  4C3H H;  2UUA L;  2JEA I;  1L0W A;  1VQO A;  3KLW A;  4X62 Q;  3PUZ A;  1YJN A;  4B3S L;  1PH6 A;  1IL2 A;  3NEM A;  2VW9 A;  1XMO L;  1I94 L;  4A3M H;  2RF4 A;  2Z6K C;  3L7Z C;  4ME3 A;  4UP8 A;  1VQL A;  1IBK Q;  4JI3 Q;  5FLM G;  4QGU A;  3Q8D A;  3NBH B;  4RMF A;  3TEH B;  2JK8 A;  2NN6 I;  3UE0 A;  4GN3 B;  1YVC A;  3W1B A;  5LMN W;  2CWP A;  2DUD A;  3H0G G;  1PH4 A;  1HR0 Q;  4B3M Q;  1EQR A;  4JOI C;  2EIF A;  3K81 C;  3PCO B;  4DUY Q;  4UP9 A;  4IPG A;  5AJ3 Q;  4KHP L;  3I4O A;  4JI4 L;  2NVY H; 
#chains in the Genus database with same CATH topology
 4PQX A;  1RL2 A;  3CCM A;  5FJ8 H;  1AE3 A;  4IAL A;  4UHV A;  1X56 A;  4P71 A;  2NTS A;  1QVC A;  2XN9 C;  5TSS A;  1C4Q A;  4DNT B;  1CHP D;  1RHP A;  3SXH A;  1KAA A;  1JR0 D;  3AEV A;  4GLX A;  2K5N A;  1FGB D;  2D0P A;  2NN6 G;  3MA2 B;  3PUW A;  5IP7 G;  2PNR C;  1PTO F;  4ZUJ A;  1AN8 A;  2A6E D;  4WJ4 A;  3C1E A;  1W6J A;  4A93 B;  1HFG A;  3TQY A;  2Q8I B;  1RTN A;  1N34 Q;  3PSI A;  4X66 Q;  1PTO D;  2BH8 A;  1O7L A;  1KRT A;  1CI3 M;  4DV1 L;  1AW7 A;  3TP7 A;  2ZXO A;  2HQE A;  3CC4 A;  1EY7 A;  1TS2 A;  2YU9 B;  1QUQ B;  4JVZ A;  2E74 C;  4HSV A;  1AP0 A;  1XMQ L;  1PH7 A;  1ML0 D;  2EOT A;  1IXR A;  1KNA A;  1IL8 A;  3BDL A;  3W5O A;  4CJ2 C;  1ENC A;  1TWA H;  4CGY B;  1SBB B;  1Y1V H;  1LAB A;  1HZB A;  1SXT A;  4GNX B;  1PRT F;  4X3U A;  3I91 A;  1HZC A;  2QEJ C;  1YNN C;  3KDF A;  1D1I A;  3ITP A;  4QY7 A;  5JEA H;  3AMU A;  3T1H L;  4L5T A;  1EY9 A;  3SK6 A;  3S17 H;  2DGY A;  2E2J H;  1VQP A;  4Q0F A;  1II3 A;  4NW2 A;  1PRT D;  4DNI A;  4JV5 L;  5M3M B;  2HIV A;  3GTG H;  1F9S A;  1PH3 A;  4EGV A;  5M5W B;  3FKI G;  1OTC A;  1W6K A;  2TSS A;  2LMC B;  1EEF D;  1GUG A;  1CT1 D;  5COY A;  4QQB X;  1O7I A;  3OTO Q;  4AQY Q;  3S15 B;  4DV7 Q;  4K2L A;  2EYJ A;  4LF4 Q;  4NMZ A;  1TVX A;  2B2T C;  1CM9 A;  4IUR A;  4C2M B;  3FKI B;  1P8L A;  2E5L L;  1D7Q A;  5D65 A;  5C4J B;  1ICF B;  1P16 A;  4IPH A;  2ID0 A;  5IYC G;  2E8G A;  3ULJ A;  2V4D A;  3A74 A;  4DR5 L;  3T53 B;  4DR3 Q;  3MXN A;  1B50 A;  2ZM6 Q;  1DGS A;  1WTH A;  4A93 H;  3KLS X;  3RLF A;  2X69 A;  1I4G A;  3OIQ A;  3W2D A;  1X65 A;  3C1F A;  3NE5 B;  3OWF A;  2J7Z A;  1F9P A;  1Y14 B;  5C0X I;  3DLL A;  2EYO A;  4H44 C;  4DAY B;  1V43 A;  5HGT A;  2KHI A;  3TS0 A;  2AWO A;  3ZYY X;  2BA0 A;  1BKB A;  2OF1 A;  2PCF B;  1TXY A;  2XSC A;  2YU9 H;  2WII B;  1CZG A;  1EU4 A;  2RHS B;  3I90 A;  2I07 B;  3A7A B;  4IOA A;  3RUZ A;  3EVQ A;  5GAE C;  3M9B A;  5DM6 3;  4YCU A;  2ENB A;  4FO2 A;  2MPM A;  1EUJ A;  1MBY A;  2LXK A;  3I4L A;  3PF4 A;  4TVA B;  1BDO A;  2HDL A;  4YCW A;  1ONL A;  4DNR B;  1DJR D;  1GVP A;  2L1B A;  3PO3 G;  5T1G A;  2PZW A;  3RLO A;  1V1P B;  4GKJ Q;  1R9T B;  3SK8 A;  3F1Z A;  5LL6 S;  4PMW A;  4CJ1 B;  4J15 A;  4CDE C;  1FJG Q;  2L55 A;  3K5O A;  4U68 A;  5M3M H;  5M5W H;  4QUC A;  1KHI A;  5IYB G;  2OWO A;  1K3B C;  4R8N A;  4XT3 B;  3K5N A;  3KF8 B;  4HAE A;  3QO2 A;  1A3U A;  1SSO A;  3S15 H;  1BNZ A;  2F0H A;  2MHV A;  4A3G B;  1Q86 C;  3GTO H;  1GUW A;  3T4A C;  3FKI H;  3TP6 A;  3HOW B;  1PMR A;  2RA4 A;  3S16 B;  4LUV A;  5JOB A;  4KY7 A;  5LMU Q;  2L5T A;  3U4Z A;  1CSP A;  3PF5 A;  4YHH L;  3IFT A;  5CGK A;  3TZU A;  2VZA A;  3IAY A;  2CHB D;  5IYC H;  5C44 B;  1BBW A;  1C0A A;  2JSO A;  5C4X B;  3E0J A;  1CA5 A;  2F0F A;  1YNJ C;  5FK9 C;  1B44 D;  5CYU A;  2VQE L;  4HID A;  5EKK A;  2R3Z A;  1U4R A;  3G7L A;  3J7Y W;  5BR8 L;  1YNN D;  4DK1 A;  4PG3 A;  4YWM A;  1D5Z C;  2F4V Q;  1HNZ L;  1D6E C;  1WCM B;  2FIN B;  3I70 A;  2B63 B;  1I5F A;  1SE4 A;  3MWY W;  5E4X A;  2WB1 E;  4OWT B;  3S1R B;  3CRK C;  1SLJ A;  3STB C;  4A3K G;  1FVI A;  3TME A;  4U67 3;  3MXG A;  4X65 L;  3TBI B;  1HTP A;  1N33 L;  3HOX G;  4J6H A;  1BO0 A;  5IY0 A;  1Q12 A;  1R9T H;  1VQI A;  2JYO A;  2VNU D;  1SYD A;  5D3I B;  2WKD A;  4H0L C;  3HKZ G;  1TWG B;  1VQN A;  1GOZ A;  2JA9 A;  4LK1 C;  3DWA A;  4BBR G;  2R6G A;  4DN4 M;  2G5D A;  1PYB A;  1ZXT A;  3SE0 A;  3A8I E;  1NMF A;  1CQV A;  1SNC A;  1LYL A;  4N8X 1;  2VXW A;  4H13 C;  2UXD Q;  3FRP B;  4ZK9 B;  2FMM A;  2R7Z B;  3MC0 B;  4FF1 A;  5IYB H;  3HOW H;  3Q6S A;  3JC6 6;  1DOL A;  4K6L A;  4LF5 Q;  3K58 A;  3GP7 A;  1B2T A;  4HJ5 A;  4JYA Q;  2ZJR A;  4NXM L;  2L4N A;  4HJ7 A;  5GAH C;  3GTQ B;  4F88 A;  3R2T A;  3A5U A;  5KGU A;  2XNA C;  2UUB Q;  3LGJ A;  4DR1 Q;  2F0I A;  2EYM A;  1JE5 A;  5C44 H;  4C3I B;  3VA5 A;  5C4X H;  4BY1 B;  3E0E A;  3J7Z C;  4ABN A;  4HJ9 A;  3J80 c;  3HFZ B;  2L15 A;  4QF4 A;  1EY6 A;  3TN2 A;  2KJX A;  3SGI A;  4A3F B;  1WCM H;  4YY3 L;  1LT3 D;  1BBU A;  4C3H G;  1H9S B;  3KJP A;  3J80 i;  4ME5 A;  1K73 C;  2EXD A;  3NP8 A;  3MVV A;  1JE4 A;  3MXU A;  3T16 A;  3S1R H;  1HTL D;  3CMA A;  3K7U C;  4GOP C;  5CMD A;  4HJ8 A;  3MEH A;  3DWQ A;  5ELF A;  1EYA A;  1B3A A;  2VS1 A;  2KEN A;  2PW5 A;  1YBY A;  3KF6 A;  3PUY A;  2ZJQ A;  2K5Q A;  1BCP C;  3VDY A;  3G48 A;  2CFM A;  2F0T A;  3TP8 A;  1TWG H;  4NP5 A;  4E6I A;  1X54 A;  2EJM A;  1YEZ A;  3NEL A;  5I2X A;  2F0O A;  2EY2 A;  3GV3 A;  1QJO A;  2JA5 G;  2BH2 A;  2KBN A;  1WD1 A;  4BXX G;  2A68 C;  4I7A A;  5CV8 A;  1Y1W G;  3CRL C;  4B08 A;  4IOC A;  4OON A;  2ICI A;  4LNQ A;  5IWA L;  4N9P A;  1W3S A;  4DV3 Q;  2WFW A;  5C5L A;  3UDX A;  4A3L G;  5HY6 A;  2D62 A;  4RFB A;  5AFW A;  2MO1 A;  1Y1W B;  2JA7 B;  1NUC A;  4A3D G;  2F0E A;  4R4I A;  3PV0 A;  3SHL A;  4HIK A;  2PZU A;  3HS0 C;  4NXN Q;  4C3I H;  4IQZ A;  4BY1 H;  1BUV T;  4XTC S;  1FNU A;  4LFA L;  3MXP A;  4KLK A;  2BCO A;  2UXC Q;  3NTK A;  2K33 A;  2WB1 G;  4LWC A;  4DR7 Q;  2NTT A;  4AYB G;  4MZ9 A;  2EQS A;  2WIN B;  3G4S A;  2GVA A;  1HR0 W;  3S24 A;  1CA6 A;  2XWJ B;  1IBK L;  1LV9 A;  4A3F H;  5CV9 A;  4IJH A;  2B2V C;  4KD3 A;  4J1M A;  2E76 C;  3RD4 A;  1HR0 L;  4LF8 Q;  4B3M L;  5EPL A;  2R93 G;  1JOK A;  2B3G A;  4A3B G;  1TU2 B;  5D14 A;  1B9M A;  1F2Z A;  2NZO A;  1YHA A;  3J7A V;  3DM3 A;  3F2C A;  1MD2 D;  4IFD J;  5C3E G;  4C3H H;  2PQE A;  3RZD B;  1SJH D;  1LTI D;  3KLW A;  2R93 B;  4X62 Q;  2O5J C;  4ZLT F;  1TKW B;  3RZO B;  4A3B B;  1M4V A;  2F0Q A;  1FD7 D;  3GTL B;  4K8I A;  3OIP A;  2Z6K C;  3L7Z C;  5FLM G;  3LWU A;  5IT9 L;  2A69 D;  2BDO A;  3UE0 A;  4CHT B;  1ZKO A;  1PH4 A;  4K5V A;  1EQR A;  4JOI C;  4UP9 A;  1D2B A;  1HNW Q;  1PXU A;  4EVO A;  1EWC A;  1N34 L;  1RCV D;  3HEJ A;  4X66 L;  1STH A;  3HGB A;  3WWV A;  4FP5 D;  2D0O A;  2UUA Q;  3U58 A;  1VQK A;  3I7F A;  4FF2 A;  3D6C A;  5ELE A;  4K14 A;  1MJE A;  3K7A B;  1S4Z A;  1SND A;  1Y1W H;  1SYC A;  1QE6 A;  2A19 A;  3M4Q A;  3S14 B;  1A3T A;  3KLS A;  1XPO A;  5IGG A;  1JJ2 A;  5ELB A;  1PTO B;  2AUK A;  4KHP Q;  5JVG 3;  1EIG A;  3HP3 A;  3K80 C;  2IX1 A;  2EPB A;  3OHX C;  4DV5 Q;  4QIW E;  1MHW C;  4YWK A;  4BS9 A;  4A3D H;  2BE5 D;  3QG1 A;  4C1N I;  5KRU A;  5CV4 A;  3SK5 A;  2QDB A;  3M4Y A;  1HCZ A;  5M5X B;  1SN8 A;  2AQ3 B;  1Q81 C;  1HJP A;  4P75 A;  1AFP A;  3I4N G;  1EZ8 A;  1K0R A;  2EXZ A;  2N78 A;  4N9T A;  1YZ6 A;  4K5W A;  1XJV A;  4RHR A;  4LMQ D;  4V19 0;  4XYO A;  1VMP A;  2HCI A;  5IIF A;  1E2Z A;  2SDF A;  1XTC D;  3OTO L;  4AQY L;  1STE A;  3K59 A;  1K8M A;  2R93 H;  2RVL A;  3RMH A;  4A4I A;  4A3B H;  3RZO H;  1I6V C;  2SEB D;  5IP9 G;  4JI7 Q;  1PRT B;  3GTL H;  3D31 A;  3GO5 A;  3J81 L;  2QEX A;  2B2V A;  2R92 B;  2E2H B;  5E4W C;  2K4K A;  5C3E H;  4DR3 L;  4DK0 A;  1PFN A;  3I56 A;  2JA8 G;  2QA4 A;  1Q8I A;  1VQ7 A;  2LXJ A;  2P5Z X;  5C4H A;  2ZM6 L;  1EIF A;  4DUZ Q;  5EGT A;  2LSS A;  3GTP B;  1TS3 A;  1SNO A;  5IYD G;  1IBM Q;  3VR5 A;  1A2U A;  1KAW A;  1KTK A;  3DEO A;  4X6A H;  3KDF B;  4JI1 Q;  5JAV A;  2K7V A;  1UE5 A;  3I8Z A;  4IJL A;  3NPP A;  1CKM A;  2XIW A;  4F87 A;  1QOH A;  3A7L A;  2DY7 A;  1YIT A;  3AFP A;  2F03 A;  4JOI A;  1Z47 A;  2OQ0 A;  4DPG A;  2F1M A;  3I4M G;  4KK7 A;  1PTO H;  2LY7 A;  3WOE A;  5HUR A;  4KY5 A;  3Q23 A;  1NY4 A;  4ZRZ A;  5ELD A;  4L5R C;  1AZQ A;  1TWH B;  1JOQ A;  3FDT A;  5JJL A;  3QB3 A;  2RSO A;  3S17 B;  1PV4 A;  1JMC A;  3GV6 A;  3PUV A;  4GKJ L;  3CCR A;  4LF6 Q;  3MAQ A;  1OXV A;  4MTK A;  5M5X H;  5EKL A;  3RR5 A;  1H9R A;  4JBW A;  4L6T B;  1SMX A;  3T13 A;  2F0K A;  5G3L F;  1FJG L;  5ISR A;  1I4H A;  1E0B A;  1VF7 A;  2TMP A;  5J3B A;  3S9W A;  2NVX B;  3K0X A;  2VB2 X;  3A54 A;  1NE3 A;  5G3L D;  1K8O A;  1STA A;  2L12 A;  1EU3 A;  4G4K A;  2IHF A;  1SE2 A;  1C9O A;  1JQY D;  5ELC A;  2R92 H;  2E2H H;  3CXC A;  5LMU L;  1D8L A;  1SMY C;  2RQX A;  5FKA C;  4JI5 Q;  3UDF A;  2UUC Q;  3CCJ A;  3KK7 A;  4N8F A;  5IP9 H;  1PH1 A;  4JI6 Q;  4G57 A;  3J7A F;  3GTP H;  3CCV A;  1V1O A;  1PYS B;  2QKI C;  3B6Y A;  3BYT B;  2NZ1 D;  3G71 A;  2QCP X;  1SRO A;  1YHB A;  3VR4 A;  2JA8 H;  3MHB A;  1NNX A;  4WJ3 M;  4V0B A;  1LLR D;  5C6A A;  1T9H A;  3CQZ B;  3V2T A;  5IYD H;  2CQO A;  2F4V L;  2IX0 A;  2F3V A;  1QVG A;  2D5D A;  3CCU A;  1MIU A;  4X64 Q;  1I4R A;  1VS0 A;  1IKM A;  4QIW B;  3NHH A;  3U9S A;  2F0J A;  4KY6 A;  1Q90 A;  1HFN A;  4OEM B;  5EBC A;  1TWH H;  1KDC A;  4UDU C;  2QF7 A;  3DWP A;  3CW2 C;  3CCL A;  2PQA A;  3BDO A;  2Y0S G;  2DN8 A;  4KTA A;  1S3O A;  1QIL A;  1GUS A;  3S1M B;  3A56 A;  1HA6 A;  2PW7 A;  2VUM G;  5IE8 A;  1WVL A;  1EIH A;  2AQ1 B;  2NVQ B;  2EZV A;  4IFD G;  4HSP A;  4I7Z C;  2NVX H;  3CHB D;  3OW2 A;  5GRO A;  3D3R A;  3GTO B;  1TII D;  2AHO B;  4IUT A;  2M9V A;  3HKZ E;  4DR6 Q;  1I4P A;  2OT2 A;  4OWW B;  4BBS G;  2UXD L;  1LAC A;  3HOU G;  1UAP A;  3U50 C;  1A6X A;  4LF5 L;  1KDB A;  2F0D A;  4JYA L;  3RLN A;  3K5L A;  1BQQ T;  3U9O A;  1PH5 A;  1WOC A;  2K50 A;  2G9D A;  1IYU A;  2X6L A;  2UUB L;  2NN6 H;  4DR1 L;  3Q0A A;  1PH8 A;  5IP7 H;  4GZY C;  2B2Y A;  4JI0 Q;  1EYD A;  2KHS A;  2SOB A;  1WTP A;  4B9X A;  2IPK D;  1VF5 C;  3TSS A;  1I4Q A;  5BN4 A;  3DM1 A;  2K75 A;  4A3E G;  2ZJP A;  3CQZ H;  5LHY 1;  1KQS A;  1GUN A;  4OHJ A;  3RN5 A;  2IL8 A;  4POG A;  3OWE B;  3DXJ C;  1F9R A;  4A3I G;  3S2D B;  1T5X D;  4P73 A;  4AH6 A;  2MQH A;  4RKL A;  4OIK A;  5EPK A;  1K8A C;  4BA2 I;  3KFU A;  2KEE A;  2JA6 G;  5C3W A;  1NBW A;  2EYP A;  2VY3 A;  1UE1 A;  1G6Z A;  2CWA A;  3ERS X;  4A3I B;  3S1M H;  4RG1 A;  3PO3 B;  3HZX A;  1IYV A;  2NVQ H;  3H3V C;  1OO9 B;  3KJO A;  3E6Z X;  2JA6 B;  3OYY A;  1M8A A;  1VCI A;  3EJI A;  1JC7 A;  5KNC A;  2EDG A;  1A15 A;  3CCE A;  3U4V A;  1X3Q A;  1FR3 A;  3R93 A;  3M7N A;  2E2D C;  2PPB C;  3J81 E;  5HGQ A;  2QDL A;  4DAM A;  3PIO A;  1QB5 D;  3FPU B;  2K32 A;  1GKH A;  4RGO S;  2K03 A;  4DV3 L;  5C0X J;  1HNX Q;  1OXT A;  1WD0 A;  2Z6B A;  5EPJ A;  2CQA A;  3HOU H;  5FOB B;  3NBI A;  2KOL A;  4F7X A;  2PYK A;  2ALY B;  5A2Q L;  1X3P A;  4PMC A;  4NXN L;  2A5H A;  1OXS C;  4R4Q A;  5CBE E;  1B3Q A;  2UXC L;  3Q22 A;  2QGQ A;  4JC0 A;  4DR7 L;  3KF6 B;  2DJG C;  4GLA C;  3HOV G;  3K0Y A;  4HTH A;  2YTV A;  1VQA A;  1B4O A;  2A74 C;  2JJQ A;  1O7Y A;  1G91 A;  5M3F G;  2F0L A;  4LF8 L;  5ELO A;  4AYB E;  1MI2 A;  4GKK Q;  2NBF A;  1E3P A;  3KUP A;  2F0P A;  1KC8 C;  3PIO 3;  1WYD A;  3S2D H;  3E9I A;  4DK3 C;  1VQB A;  4ALP A;  2N49 A;  3C2P A;  1JWS D;  3D4R A;  2KHJ A;  4JW0 A;  1K9M C;  4HCE A;  4A3K B;  1PZI D;  4JI2 Q;  5E3F A;  4X62 L;  3CP0 A;  1SE3 A;  2PO4 A;  1QNK A;  4A3I H;  1H9M A;  2KUM A;  1K8G A;  1FGU A;  3H94 A;  3HOX B;  3PO3 H;  4DAY A;  2ZTC A;  4G7O C;  4A3J G;  2JA6 H;  2NB0 A;  1TQO A;  3CKI B;  2J4X A;  4K5X A;  3DEP A;  3HG9 A;  2KVM A;  4K2K A;  3TDQ A;  3T1Y Q;  3HKZ B;  5DLQ E;  3TRE A;  4OX9 Q;  1HNW L;  1OXX K;  2FMC A;  3EFX D;  4BBR B;  1JOR A;  1Z9F A;  2F4I A;  4CJ0 B;  1CTM A;  2UU9 Q;  4CDD C;  4P72 A;  3P20 A;  1VDZ A;  4PMB A;  2C5C A;  3PQI A;  2UUA L;  1DCZ A;  1L0W A;  5FLX L;  2FHT A;  4B3S L;  3KBX A;  3Q24 A;  1PH6 A;  2CW0 C;  2RF4 A;  4UP8 A;  2K5D A;  4JI3 Q;  1ICW A;  4QGU A;  3Q8D A;  3QIA A;  1SNM A;  3NBH B;  4RMF A;  3TEH B;  2NN6 I;  4GN3 B;  1YVC A;  3W1B A;  2CWP A;  1V1P A;  3FEW X;  2EIF A;  4IPG A;  4KHP L;  3I4O A;  5DM7 3;  2IHE A;  4CBV A;  2NVT B;  1MKH A;  4DK6 C;  4DV5 L;  1AZP A;  5DEH A;  3V96 A;  4LW1 A;  1DOK A;  2J0T D;  1UE7 A;  3I55 A;  4CKC A;  4O2D A;  3KF8 A;  3BU2 A;  1ENF A;  2OCE A;  3UI2 A;  4DR2 L;  3F2B A;  1PH9 A;  3SEB A;  5COR A;  3A5Z B;  4GOP B;  4LUO A;  2G9H D;  2R61 A;  2F0V A;  5CBA E;  1LTG D;  4JI4 Q;  4C3H B;  4K0K Q;  1TY2 A;  5LMN Q;  3NQI A;  1I4X A;  2EY5 A;  1KAB A;  3N52 A;  1LTT D;  5JJZ A;  2X6G A;  4HR7 B;  1BCP B;  1CKN A;  5KNB A;  4A3K H;  1G51 A;  5JJK A;  4JI7 L;  1H9J A;  2K01 A;  5JPN C;  4XXE A;  3HOX H;  1PFM A;  1F2L A;  1XNR Q;  1GD7 A;  1PLF A;  2H4O A;  3MTS A;  3M3Y B;  1CQF A;  2AQ2 B;  3AQQ A;  5GAD C;  1U4P A;  4DUZ L;  1J9O A;  4BBR H;  1L0X B;  1UNS A;  2K14 A;  1YNJ D;  2DJF C;  1FL0 A;  4MHE A;  4QL5 A;  4DFA A;  1YJ9 A;  4KHV A;  4IPC A;  1IBM L;  2JA5 B;  1WTR A;  1Y8N B;  1AE2 A;  4UY8 C;  3HOZ G;  2O2L D;  3NUC A;  2D2C C;  4LFC Q;  2ICE C;  4JI1 L;  3EA6 A;  4DV6 Q;  1NJI C;  2FXQ A;  1A0I A;  2ZXP A;  2B2U C;  4BWG B;  1E2V A;  1L1O C;  1TWC B;  3JAM c;  3GTJ B;  1NTG A;  2HCC A;  1SRU A;  3HOZ B;  1QG7 A;  2XWB B;  3STB D;  2NVT H;  4JG2 A;  4IO9 A;  4A3D B;  3ER0 A;  3PMF A;  1ASY A;  3PO2 G;  1BXT A;  2A8V A;  1UWV A;  4EX5 A;  1PH2 A;  2CH4 A;  4JBJ A;  5JJI A;  1CUK A;  2C35 B;  4ZCK A;  3TRZ A;  4RA8 A;  1PHJ A;  4KN7 C;  3CF5 A;  4BY7 H;  3JAM L;  2WB1 B;  4LF6 L;  3FMC A;  1E1O A;  4B3T Q;  4AYB B;  3PO2 B;  1A3V A;  2Q2H A;  3AFQ A;  5IT9 c;  1E2W A;  5E1F A;  1STY A;  5J22 A;  2HDM A;  2ZTE A;  1J6Q A;  2ES2 A;  1K28 A;  4ZUI A;  2Z4H A;  2EY1 A;  4C56 C;  5KYI A;  4G7H C;  2UXB L;  5J39 A;  4KD4 A;  4XT1 B;  1EFW A;  2L9H A;  4LF9 Q;  4B3R Q;  1VQJ A;  3URY A;  3FVQ A;  1TT2 A;  1WTX A;  4TRD A;  4G7Z C;  3UDI A;  3HOY G;  2SNS A;  2A6H C;  1ENA A;  2CH4 W;  4MIU A;  5C3E B;  4DV2 Q;  5I2Y A;  2K6A A;  3F2U A;  2CW0 D;  4XIG S;  1YHQ A;  4JI5 L;  3M3Y H;  1LUZ A;  2UUC L;  4IUP A;  1L0Y B;  1UE6 A;  1X3F A;  4JI6 L;  2JXM B;  3J81 j;  4UPA A;  1TY0 A;  4C3J G;  3A8J E;  4L5S A;  4RGT A;  2H5X A;  3KLR A;  4P2C B;  5BN3 A;  2R7D A;  4APV A;  1Q3L A;  5C0X G;  4DV0 L;  1H9S A;  2JA5 H;  4B3S Q;  4JBM A;  4BXX H;  4OXP A;  4P74 A;  1NSN S;  4EQP A;  1XWE A;  5IOD A;  4LFB L;  3AU7 A;  3VA7 A;  4ZYS A;  2I0Q A;  1ZYR C;  4KJN A;  1S5C D;  3VYU A;  1VQD A;  3NTH A;  4C3J B;  4IPD A;  4DGZ A;  1B1Z A;  4TKO B;  3OMG A;  5A2Q E;  1TWC H;  3QWN A;  2F0W A;  2RDG A;  3BYY B;  4ID6 A;  3GTJ H;  3HOZ H;  4O1N A;  4X64 L;  1Q8K A;  4A3L H;  4MNO A;  2DNC A;  1BCP F;  3VR2 A;  1HUN A;  3E5S A;  4LJZ C;  1HUM A;  4YIJ A;  1QWY A;  2K52 A;  3PUX A;  3OPO A;  1EEI D;  1ET9 A;  5CV5 A;  4DR2 Q;  1ESF A;  1BCP D;  4A3M G;  1EOV A;  3M4O B;  4ULL A;  2B2U A;  3A55 A;  3J81 c;  1L1O A;  1GM5 A;  2NYZ D;  3PO2 H;  2C9O A;  5CR3 A;  5FO9 B;  1RJT A;  2QW7 A;  1NR4 A;  4BY7 G;  4JI8 Q;  5FJ8 G;  2Y0S E;  4QJF A;  1AEX A;  2BA1 A;  5M5Y B;  2A68 D;  2CVR A;  3J81 i;  3I4N B;  2M00 A;  1SE8 A;  1XPR A;  4RKB A;  1SJE D;  5KYL A;  4DR6 L;  1L2F A;  3BG3 A;  2AKW B;  3QOL A;  1KLU D;  3H91 A;  4H7B A;  4C1N K;  5CV6 A;  1K83 B;  1EOT A;  5IGE A;  2PI2 A;  1X32 A;  2RHQ B;  4PZ8 A;  3J7A 5;  3HOY H;  1EY4 A;  3NEN A;  5F2D A;  1ROD A;  3S1N B;  4XQN A;  3I72 A;  2IT1 A;  5FLM H;  1KDA A;  2MO0 A;  1EL0 A;  1FNW A;  3L0O A;  3D4D A;  2JA8 B;  1VQF A;  5I4D A;  5DNF A;  4NDX A;  4JI0 L;  4KHZ A;  2MNA A;  4A76 A;  3EQL C;  1WTQ A;  1UUP A;  3CD6 A;  1KD1 C;  4C3J H;  1EY8 A;  4DAP A;  1XX8 A;  4RH6 A;  2KEC A;  4PNY A;  2XTI A;  1STN A;  1LTR D;  3IRB A;  4QMG A;  3HRZ C;  4RGN A;  1RKN A;  4LAA A;  1CKO A;  2I46 A;  1Y1V G;  4QCL A;  3NWT A;  5M9O A;  4CDC C;  4HJA A;  3D4W A;  3I4M B;  3GTM B;  3LX0 A;  1N9W A;  1M90 C;  1VQ5 A;  3ND8 A;  4OL7 A;  2QIL A;  1B8A A;  3M4O H;  5FO8 B;  2A6H D;  2I5L X;  3MXN B;  2NWG A;  1D5X C;  4DXG A;  4DV4 Q;  3KBG A;  4KKT A;  3G6J B;  3K57 A;  1Z6H A;  1CZW A;  5IGD A;  3NQT A;  4RWS C;  5IGC A;  2UXB Q;  1EY0 A;  1QCB D;  2FFK B;  3X3N A;  2WAC A;  1RTO A;  2F0M A;  4FF3 A;  2H1E A;  2N3S A;  3N6R A;  4S3S A;  5M5Y H;  2N88 A;  2B2Y C;  3I4N H;  4ZKB B;  2HD3 A;  4JCV E;  3PIP A;  2B29 A;  2RBM A;  3M85 A;  1Q82 C;  3BVG A;  1ILQ A;  2KCT A;  3NK9 A;  1HZA A;  3D0F A;  4R1J A;  1SYE A;  3CME A;  4FXK C;  4KN4 C;  1ZYR D;  1HNX L;  1U4L A;  4DF7 A;  1K83 H;  3G6E A;  1JT8 A;  2EYH A;  2N55 A;  2XRS D;  3S1N H;  1E7Z A;  4A93 G;  4JBK A;  2D9U A;  1U5K A;  1Q1B A;  2B2W C;  4KKU A;  4DV0 Q;  1G6P A;  1F2M A;  3VYS A;  1VQE A;  4LF7 Q;  1H9K A;  3A8K E;  4PZ7 A;  4LFB Q;  4CKE A;  2RDH A;  3R2I A;  3S2H B;  5LL6 X;  1F77 A;  3RN2 A;  3CU7 A;  5EJW A;  2KED A;  4DXF A;  2Q2T A;  4OEL B;  1N32 Q;  1EQQ A;  2MGS A;  1A63 A;  1N8R C;  1SEB D;  2GN5 A;  1EQV A;  4YWL A;  3M7G A;  3M4P A;  2EJF C;  1XYI A;  4HMJ A;  2I5M X;  4EQN A;  1LT5 D;  3PIP 3;  2PZT A;  3CAM A;  1J5E Q;  4GKK L;  3E3X A;  1PZK D;  4OO1 G;  2NVY B;  3I4M H;  3JAM E;  2Q2I A;  3GTM H;  1V1Q A;  2YTY A;  4B9W A;  4JI2 L;  4DR4 Q;  4NB3 A;  5NUC A;  1AH9 A;  1S5F D;  1SYB A;  4TSS A;  5E7N A;  4GNX C;  5ELN A;  3T56 B;  1BR9 A;  3LWE A;  3MEF A;  5M3M G;  4KMU C;  2Y0S B;  4NPS A;  4RHS A;  1S5B D;  2JP1 A;  4GS3 A;  2F0S A;  2EJG C;  3T1Y L;  4OX9 L;  2VUM B;  4WJW A;  1QZG A;  3L9A X;  2VQF Q;  1BVS A;  3ERO A;  4HCS A;  5IT9 E;  2UU9 L;  1DYQ A;  4FYD A;  1I50 B;  1EIY B;  2YYZ A;  3OW7 A;  2JN4 A;  2OTJ A;  1MGS A;  4OGQ C;  2EYF A;  1IZ6 A;  2KCN A;  3DUZ A;  4BBS B;  4UAI A;  3KOJ A;  3HOU B;  1A8V A;  4JI3 L;  5EQ0 A;  1SYF A;  1HZ9 A;  2HHH Q;  2RCN A;  4L5Q A;  1O7Z A;  4AIM A;  2L11 A;  1LM0 A;  3S2H H;  2Q8R E;  2EY6 A;  2CKZ B;  1WTV A;  3PUZ A;  1IL2 A;  3SVM A;  1ESR A;  2K05 A;  1VQL A;  3NWS A;  4CKB A;  4A3E B;  2B2W A;  5LMN W;  5T1I A;  3H0G G;  2DUD A;  5L37 A;  1RD9 D;  1PZJ D;  3K81 C;  4DUY Q;  3AB9 A;  1FNV A;  5AJ3 Q;  5K36 G;  4JI4 L;  2NVY H;  1LTB D;  2IX3 A;  4K0K L;  1JOO A;  5LMN L;  2L0C A;  1EFI D;  3KYH C;  3BDC A;  1N36 Q;  1SR3 A;  4R4T A;  4CDF C;  2DNE A;  5J1Z A;  5EAY A;  3F2D A;  1E22 A;  3MFY A;  3L3O C;  3H0G B;  1ASZ A;  4OO1 H;  4EQ5 A;  4X3S A;  1Y8O B;  2Z4I A;  1SMY D;  2PNH A;  3ULP A;  1XMO Q;  1I94 Q;  4HIM A;  4J8Q A;  1XNR L;  2OTL A;  4HMI A;  1QUQ A;  1IW7 C;  1V8Q A;  1SAP A;  5CC4 A;  1M1K C;  1KLG D;  1IBL L;  2VUM H;  3BZK A;  1DM0 B;  3BS1 A;  1CFM A;  2FJ2 A;  4IFD H;  3TZD A;  4PV1 C;  5IOC A;  3EIV A;  4A3G G;  3OSO A;  1K0S A;  1JIC A;  3HOW G;  1EY5 A;  1I50 H;  2WAQ E;  4LFC L;  1S40 A;  3DMU A;  4DV6 L;  1I3Q B;  2EE1 A;  4GNX A;  4RCO A;  1Y69 U;  4A3C G;  4BBS H;  3K8A A;  1JJC B;  1RIP A;  2HUG A;  2PMZ E;  4K6D A;  4C2M H;  5C4J H;  2K04 A;  1TWF B;  1GHJ A;  5C44 G;  3BVM A;  5C4X G;  5GAG C;  1YIJ A;  3MFG A;  3X3M A;  3LNN A;  4QUF A;  4R4C A;  1VQM A;  1CKN B;  5EKI A;  1IHZ A;  3H09 A;  4R4O A;  4WFN 3;  2YTX A;  3TP5 A;  5I6W A;  4XQQ A;  1X55 A;  4DV1 Q;  4B3T L;  1WCM G;  2OQK A;  1JB7 A;  5I9O A;  2B2T A;  3HOV B;  2B63 G;  3TS2 A;  1YJW A;  1PA6 A;  4A3E H;  3W1G A;  4TQU S;  3L2P A;  3A0J A;  1JWU D;  3EBE A;  2PI2 E;  4Z9C B;  1SDF A;  5C5M A;  4XYQ A;  3V05 A;  1XMQ Q;  5M3F B;  1G8Z D;  1WFQ A;  1U4M A;  1RDP D;  1XNQ L;  1J8I A;  3QOJ A;  3UDG A;  4B3R L;  4LF9 L;  1GUO A;  2GA4 B;  3ND9 A;  3H0G H;  3P7J A;  5FLX c;  1EQT A;  1MSH A;  5K36 H;  4DV2 L;  3H3V H;  1YNX A;  1A62 A;  3T1H Q;  2HIX A;  1VQC A;  2HT1 A;  1DZ1 A;  1KNE A;  2Z1C A;  4O42 A;  5IGF A;  4MTN A;  4JV5 Q;  4IUN A;  1KRS A;  2IW3 A;  4A3J B;  1VQ6 A;  2F0N A;  1NMG A;  1MSG A;  3OMC A;  1F2Y A;  4HED A;  1PFB A;  2R7Z G;  2CCZ A;  5KEE A;  3ONA B;  3PGZ A;  2XVS A;  1LTA D;  1B70 B;  1I3Q H;  4YCV A;  3VR3 A;  3D8G A;  1GUT A;  3SDZ A;  2E5L Q;  3C46 A;  2BOS A;  3EN2 A;  4IUU A;  4A3G H;  1HPC A;  3P75 A;  1U0L A;  2OXP A;  1Z7T A;  3SK4 A;  4GN5 A;  4PZ6 A;  4DR5 Q;  4L63 B;  1TWF H;  2RDF A;  3GQB A;  3VR6 A;  3S16 H;  2VL6 A;  2B39 A;  4C3I G;  4BY1 G;  1V9P A;  4I65 A;  2A69 C;  4A3C H;  1QVF A;  5I9P A;  1T5E A;  2K1B A;  4KV6 A;  5DAU A;  3SR1 A;  4BA1 I;  4WOR A;  5KND A;  4DKA C;  2IY5 B;  1X3G A;  4LUZ A;  4A3F G;  5JEA J;  4Y52 H;  3HOV H;  3CPW A;  3NSW A;  3I3C A;  3BJU A;  1O78 A;  4X3T A;  1S5D D;  4DA2 A;  5KIX A;  1HQM C;  1BF4 A;  2ZTD A;  1IKL A;  3QJY A;  4JI8 L;  5IGB A;  5M3F H;  2E2I B;  1IW7 D;  4FVM A;  1K3R A;  4FXG C;  2B63 H;  3DHQ A;  1UEA B;  1CK1 A;  2BDN A;  3BZC A;  4QB4 A;  3WDN A;  3VYT A;  3J80 L;  4OO1 I;  1S5E D;  5EBD A;  1Q46 A;  2WV6 D;  3H15 A;  2LFN A;  1GJX A;  1C48 A;  2BE5 C;  1HRJ A;  4FDB A;  1D1K A;  2F0U A;  2WAQ G;  3MZ5 A;  2JE6 I;  2AUJ D;  4GN4 B;  4KKS A;  2JQO A;  1IBL Q;  1EYG A;  1X6O A;  3F8T A;  2MFI A;  1G29 1;  2Q2U A;  1H95 A;  2K5H A;  4ZKC B;  4JK1 C;  1G2S A;  2RSN A;  4F8M A;  4IFD I;  1LT6 D;  4A3J H;  3R8B A;  4ZQ3 A;  2B8F A;  2WAQ B;  1MJC A;  2ZT9 C;  3BVZ A;  1BOS A;  2ATW A;  4O0A A;  4RGM A;  5C3X A;  4Y7N B;  1NCV A;  2LKV A;  2PMZ B;  2KA7 A;  1L1O B;  2MUY A;  4OIJ A;  2JA7 G;  1X3E A;  1JWM D;  1DXM A;  3I73 A;  4FF4 A;  2R7Z H;  3VYR A;  1YI2 A;  4YHH Q;  1F9Q A;  1DOM A;  1OXU A;  3GTQ H;  3JAM i;  1TR5 A;  2AMC B;  1LO5 D;  1QNU A;  4IUV A;  1Y8P B;  3ZJY C;  1VQ8 A;  2F52 A;  1I6H B;  1G2T A;  1B53 A;  1STB A;  1PVO A;  4H02 A;  2SNM A;  1QZH A;  1EYC A;  4RCN A;  1GO3 E;  2VQE Q;  3O13 A;  1E24 A;  4DU9 A;  3RNU A;  1LTL A;  3E9H A;  3ICE A;  1E1T A;  5BR8 Q;  1A2T A;  1R4Q B;  4DV4 L;  3AYH B;  3ULL A;  3D6W A;  1VQ4 A;  3GTK B;  2HQL A;  1HNZ Q;  1PDQ A;  1SFO B;  4KI0 A;  1XNQ Q;  2E2I H;  2Z8L A;  4KJO A;  1VQ9 A;  4UP7 A;  3OOC A;  1HA5 A;  2XGT A;  3NBH A;  1VQH A;  4R8I A;  3C3L A;  1ET6 A;  1B7Y B;  4X65 Q;  1EWI A;  4DAV A;  2O4X A;  2A1A A;  1N33 Q;  3HKS A;  3H3V I;  3NXW A;  5A35 A;  4L8J A;  2F0G A;  2RKS A;  3HOY B;  4RAU C;  1KXL A;  2K28 A;  3CCQ A;  1SNQ A;  3P1H A;  4NKL A;  1PFS A;  4POF A;  4K8J A;  1DON A;  4LF7 L;  2YV5 A;  3FHW A;  3IKJ A;  4A75 A;  1BBX C;  1Q7Y C;  4Y7N H;  3CPF A;  3K5M A;  2NZH A;  4GOP A;  3S1Q B;  4IN3 A;  1D5M C;  1N32 L;  2EVB A;  1JCK B;  4Q5V A;  1W2B A;  4R9W A;  1STG A;  1X9N A;  4FNF A;  4NXM Q;  3R3O A;  4FXD A;  2IWH A;  4OWX B;  3H6M A;  4IUQ A;  2IJ0 A;  2A6E C;  1J5E L;  4XDX A;  3FP9 A;  1WI5 A;  2JA7 H;  1C8C A;  4HIO A;  3QR8 A;  3WOF A;  1I6H H;  1ILP A;  1PTO C;  1O80 A;  2Q8T A;  5JVH 3;  4DR4 L;  2OEO A;  1JJG A;  2WP8 J;  4HN7 A;  1WTO A;  3IL8 A;  1NR2 A;  4A3M B;  3GTK H;  2WKC A;  5K5P A;  4ODG A;  1SFO H;  1JB3 A;  4YY3 Q;  1S72 A;  1LTS D;  5BN5 A;  3T51 B;  2KCM A;  1UEB A;  1TS5 A;  2MJ8 A;  4EQO A;  1RF2 D;  4BY7 B;  2K5W A;  2VQF L;  1HHV A;  3I2Z A;  4MN3 A;  1FYC A;  1XTD A;  1ZEQ X;  1WTW A;  3GDE A;  3IFD A;  2Z0S A;  4WRD A;  2O5I C;  1HQR D;  1XPU A;  2ASB A;  1CSQ A;  2R92 G;  2VB3 X;  2RCF A;  3CC2 A;  3RZD H;  4DV7 L;  1KL9 A;  2DY8 A;  1NAP A;  2AWN A;  4LF4 L;  1VQG A;  2JEB I;  2B8G A;  1PRT C;  2N8N A;  2A73 B;  2HHH L;  5FLX E;  3FPP A;  1TS4 A;  1C7Y A;  2KQ3 A;  4ILW A;  4IZ8 A;  5FO7 B;  3NTI A;  5D3D A;  5I6Y A;  2PQA B;  1PYW D;  4GLV B;  2XRQ D;  3UE1 A;  1HXY D;  3S1Q H;  3CC7 A;  2K5V A;  2ZXR A;  4ZAI A;  5H1S E;  4JPB W;  5C0X H;  4M8A A;  5GQO A;  3GD7 A;  5IWA Q;  1KIX A;  1CHQ D;  1XXG A;  1GXD C;  2LS0 1;  2R7F A;  1DD2 A;  2F3W A;  2Z6K A;  4X3K A;  1SNP A;  3K7A H;  3W3A A;  1B9N A;  3CCS A;  4DUY L;  1IYJ B;  5AJ3 L;  3BZD B;  2M2L A;  5JPM C;  3S14 H;  1LT4 D;  5JEA G;  1TWA B;  2F3I A;  1N36 L;  1HH2 P;  1WJJ A;  2E75 C;  2GVB A;  1Q1E A;  2I5H A;  2V1C C;  4LFA Q;  1Y1V B;  1R4P B;  1GHK A;  2JEA I;  1VQO A;  2MP1 A;  2EYL A;  1YJN A;  1SYG A;  1EWH A;  4M1U B;  3NEM A;  2VW9 A;  1XMO L;  1I94 L;  4A3M H;  5CV7 A;  5C4Z A;  1VMC A;  4ME3 A;  3K6O A;  1IBK Q;  2NUC A;  1EZ6 A;  3ERQ A;  2Z9H A;  2E2J B;  2KCC A;  1U9R A;  2JK8 A;  1HR0 Q;  4B3M Q;  3PCO B;  4XQJ A;  3GTG B;  3J80 E; 
#chains in the Genus database with same CATH homology
 1RL2 A;  3CCM A;  2IHE A;  5LMN L;  1MKH A;  5FJ8 H;  4DK6 C;  1AE3 A;  3KYH C;  4DV5 L;  1N34 L;  1N36 Q;  1SR3 A;  4R4T A;  1X56 A;  4X66 L;  4P71 A;  5EAY A;  3WWV A;  1QVC A;  1E22 A;  3F2D A;  1HNW Q;  4LW1 A;  2D0O A;  2UUA Q;  3U58 A;  1UE7 A;  3I7F A;  3I55 A;  1ASZ A;  1VQK A;  4EQ5 A;  4O2D A;  3BU2 A;  2OCE A;  2PNH A;  4DR2 L;  3ULP A;  3F2B A;  1XMO Q;  1MJE A;  4HIM A;  1PH9 A;  1I94 Q;  3AEV A;  4GLX A;  1XNR L;  2K5N A;  2D0P A;  2NN6 G;  1Y1W H;  2OTL A;  2A19 A;  1QUQ A;  3A5Z B;  3M4Q A;  3PUW A;  5IP7 G;  1XPO A;  1M1K C;  4GOP B;  4LUO A;  1IBL L;  3BZK A;  1JJ2 A;  2VUM H;  4WJ4 A;  4KHP Q;  4JI4 Q;  4K0K Q;  1IBL Q;  3EIV A;  4A3G G;  3TQY A;  5LMN Q;  1N34 Q;  3K80 C;  2IX1 A;  4DV5 Q;  4QIW E;  3PSI A;  4X66 Q;  4YWK A;  2BH8 A;  1CKN A;  4A3K H;  3HOW G;  4A3D H;  1I50 H;  2WAQ E;  4LFC L;  1G51 A;  1S40 A;  5JJK A;  1KRT A;  4DV6 L;  4GNX A;  4JI7 L;  4DV1 L;  4A3C G;  4BBS H;  3K8A A;  1JJC B;  1RIP A;  3HOX H;  3CC4 A;  2PMZ E;  3GTL H;  1SN8 A;  1XNR Q;  1QUQ B;  4C2M H;  1Q81 C;  1GD7 A;  1HJP A;  5C4J H;  4P75 A;  1XMQ L;  5C44 G;  3I4N G;  1K0R A;  1PH7 A;  5C4X G;  2N78 A;  3AQQ A;  1YZ6 A;  5GAG C;  5GAD C;  1IXR A;  4DUZ L;  4BBR H;  1YIJ A;  3W5O A;  1XJV A;  2K14 A;  4QL5 A;  1FL0 A;  1TWA H;  4R4C A;  1YJ9 A;  4IPC A;  1IBM L;  1VQM A;  1CKN B;  5JJI A;  1Y1V H;  3OTO L;  4AQY L;  4R4O A;  1AE2 A;  1HZB A;  4UY8 C;  3HOZ G;  2R93 H;  4LFC Q;  2YTX A;  4A4I A;  4GNX B;  4JI1 L;  1HZC A;  3RZO H;  4A3B H;  4DV6 Q;  1NJI C;  2FXQ A;  5IP9 G;  4JI7 Q;  1X55 A;  3KDF A;  3D31 A;  4QY7 A;  4DV1 Q;  1WCM G;  2OQK A;  3GO5 A;  2QEX A;  1JB7 A;  4B3T L;  1A0I A;  3T1H L;  4L5T A;  2B63 G;  3TS2 A;  1YJW A;  1PA6 A;  4A3E H;  3S17 H;  1L1O C;  2DGY A;  3W1G A;  2K4K A;  3JAM c;  4TQU S;  5C3E H;  2E2J H;  1NTG A;  4DR3 L;  1VQP A;  1SRU A;  3A0J A;  3L2P A;  3I56 A;  2QA4 A;  4DNI A;  3EBE A;  2LXJ A;  2PI2 E;  1VQ7 A;  2ZM6 L;  1XMQ Q;  4JV5 L;  1EIF A;  3STB D;  2HIV A;  1WFQ A;  3GTG H;  1PH3 A;  4DUZ Q;  3FKI G;  1OTC A;  1XNQ L;  2JA8 G;  2LSS A;  2NVT H;  4JG2 A;  4IO9 A;  3ER0 A;  1ASY A;  3PO2 G;  5IYD G;  3UDG A;  4B3R L;  4LF9 L;  1IBM Q;  2A8V A;  1UWV A;  4EX5 A;  1PH2 A;  4JBJ A;  4QQB X;  1O7I A;  3OTO Q;  1CUK A;  2C35 B;  4AQY Q;  3TRZ A;  3H0G H;  1KAW A;  5FLX c;  4DV7 Q;  4X6A H;  4LF4 Q;  3KDF B;  4JI1 Q;  1PHJ A;  4DV2 L;  3CF5 A;  4BY7 H;  1UE5 A;  1P8L A;  2E5L L;  4LF6 L;  3H3V H;  4IJL A;  1D7Q A;  1E1O A;  1YNX A;  1P16 A;  4IPH A;  1CKM A;  2ID0 A;  5IYC G;  4B3T Q;  1A62 A;  2E8G A;  3T1H Q;  3ULJ A;  2HIX A;  1YIT A;  1VQC A;  2Q2H A;  3A74 A;  3AFQ A;  5IT9 c;  4DR5 L;  2HT1 A;  3AFP A;  4DR3 Q;  4JOI A;  2ZTE A;  1Z47 A;  2OQ0 A;  1J6Q A;  4DPG A;  4MTN A;  2ES2 A;  2ZM6 Q;  1DGS A;  3I4M G;  4JV5 Q;  1KRS A;  1VQ6 A;  4A93 H;  2UXB L;  1NMG A;  1NY4 A;  3RLF A;  1EFW A;  1X65 A;  2UU9 Q;  4L5R C;  4LF9 Q;  4B3R Q;  1VQJ A;  1Y14 B;  5C0X I;  2CCZ A;  2R7Z G;  3DLL A;  3PGZ A;  4DAY B;  1V43 A;  3UDI A;  3HOY G;  5JJL A;  1B70 B;  1I3Q H;  4YCV A;  2KHI A;  3TS0 A;  1PV4 A;  1JMC A;  4DV2 Q;  2AWO A;  3PUV A;  2BA0 A;  3CCR A;  2E5L Q;  4LF6 Q;  4GKJ L;  1BKB A;  3EN2 A;  1OXV A;  4A3G H;  1TXY A;  5M5X H;  2YU9 H;  1U0L A;  3RR5 A;  4JBW A;  4XIG S;  2RHS B;  4GN5 A;  1SMX A;  4PZ6 A;  4DR5 Q;  1YHQ A;  1TWF H;  4JI5 L;  1FJG L;  1LUZ A;  2UUC L;  3M3Y H;  3S16 H;  2VL6 A;  1UE6 A;  4IOA A;  1X3F A;  4BY1 G;  5J3B A;  4JI6 L;  1V9P A;  3J81 j;  4A3C H;  4UPA A;  1QVF A;  5GAE C;  3M9B A;  3K0X A;  4YCU A;  4L5S A;  2H5X A;  4BA1 I;  2R7D A;  1EUJ A;  4APV A;  5C0X G;  4DV0 L;  2JA5 H;  1NE3 A;  4B3S Q;  4JBM A;  2LXK A;  4BXX H;  4OXP A;  3PF4 A;  4P74 A;  4TVA B;  4YCW A;  4LFB L;  1GVP A;  4DKA C;  2IHF A;  2I0Q A;  1X3G A;  4LUZ A;  3PO3 G;  2IY5 B;  4A3F G;  5JEA J;  3RLO A;  4Y52 H;  1VQD A;  1C9O A;  4IPD A;  4GKJ Q;  3HOV H;  3CPW A;  3F1Z A;  2R92 H;  3F2C A;  2E2H H;  3CXC A;  5LMU L;  1TWC H;  4PMW A;  3BJU A;  1D8L A;  3GTJ H;  2ZTD A;  4J15 A;  3HOZ H;  4JI8 L;  4X64 L;  1Q8K A;  4JI5 Q;  3UDF A;  1FJG Q;  2UUC Q;  4A3L H;  4MNO A;  3CCJ A;  5M3F H;  5M3M H;  5IP9 H;  1PH1 A;  5M5W H;  4JI6 Q;  1KHI A;  5IYB G;  2OWO A;  3GTP H;  1K3R A;  2B63 H;  3CCV A;  1PYS B;  3B6Y A;  3KF8 B;  3G71 A;  1SRO A;  1YHB A;  2K52 A;  3PUX A;  3BZC A;  2JA8 H;  3S15 H;  4DR2 Q;  4OO1 I;  1Q46 A;  1Q86 C;  4A3M G;  3GTO H;  3H15 A;  1EOV A;  3FKI H;  4WJ3 M;  3J81 c;  1GM5 A;  1L1O A;  4FDB A;  1T9H A;  3PO2 H;  5IYD H;  4LUV A;  2WAQ G;  2JE6 I;  2CQO A;  4GN4 B;  2F4V L;  2JQO A;  5LMU Q;  1EYG A;  1X6O A;  2IX0 A;  2MFI A;  3F8T A;  3U4Z A;  1G29 1;  3CCU A;  1QVG A;  2K5H A;  2Q2U A;  1CSP A;  1MIU A;  4BY7 G;  3PF5 A;  5K36 G;  1H95 A;  4YHH L;  4JI8 Q;  4X64 Q;  4K0K L;  4IFD I;  5FJ8 G;  4A3J H;  1VS0 A;  2VZA A;  2Y0S E;  4QJF A;  2BA1 A;  5IYC H;  3J81 i;  1MJC A;  1BBW A;  1SE8 A;  1XPR A;  1C0A A;  4DR6 L;  1L2F A;  2ATW A;  4O0A A;  1TWH H;  2AKW B;  2VQE L;  4HID A;  3CW2 C;  1L1O B;  3CCL A;  2PQA A;  2Y0S G;  5BR8 L;  2JA7 G;  1S3O A;  4PG3 A;  4YWM A;  1X3E A;  2F4V Q;  2PI2 A;  1HNZ L;  2R7Z H;  2VUM G;  5IE8 A;  2RHQ B;  4PZ8 A;  3J7A 5;  3HOY H;  3NEN A;  1YI2 A;  4IFD G;  4YHH Q;  1I5F A;  2IT1 A;  5FLM H;  2MO0 A;  2NVX H;  1OXU A;  3L0O A;  3GTQ H;  3OW2 A;  3JAM i;  2WB1 E;  1VQF A;  2AMC B;  4OWT B;  1SLJ A;  5GRO A;  3STB C;  1FVI A;  4A3K G;  3ZJY C;  1VQ8 A;  2F52 A;  2AHO B;  3HKZ E;  4JI0 L;  4DR6 Q;  4X65 L;  4KHZ A;  4H02 A;  2MNA A;  4A76 A;  1PVO A;  1QZH A;  1N33 L;  1GO3 E;  2VQE Q;  4OWW B;  4BBS G;  1E24 A;  3HOX G;  3HOU G;  3RNU A;  2UXD L;  1LTL A;  3E9H A;  3ICE A;  3CD6 A;  5IY0 A;  3U50 C;  4C3J H;  1KD1 C;  1E1T A;  1Q12 A;  5BR8 Q;  1VQI A;  1R9T H;  4LF5 L;  2VNU D;  4DV4 L;  3AYH B;  4JYA L;  3ULL A;  3RLN A;  1VQ4 A;  2HQL A;  1HNZ Q;  3HKZ G;  1PH5 A;  1WOC A;  2XTI A;  1VQN A;  2JA9 A;  4KI0 A;  1XNQ Q;  4BBR G;  2K50 A;  2R6G A;  3IRB A;  2E2I H;  2UUB L;  4DR1 L;  1VQ9 A;  1CKO A;  4UP7 A;  5IP7 H;  1Y1V G;  1PH8 A;  1PYB A;  2XGT A;  4HJA A;  1VQH A;  1NMF A;  4JI0 Q;  1B7Y B;  1LYL A;  1EWI A;  4X65 Q;  1N9W A;  1M90 C;  2A1A A;  1VQ5 A;  1N33 Q;  3HKS A;  1B8A A;  3H3V I;  3M4O H;  2UXD Q;  2K75 A;  4A3E G;  5IYB H;  2I5L X;  3MXN B;  3HOW H;  2ZJP A;  3JC6 6;  3CQZ H;  1KQS A;  4LF5 Q;  3RN5 A;  4DV4 Q;  1KXL A;  4HJ5 A;  4JYA Q;  2ZJR A;  4NXM L;  4POG A;  4HJ7 A;  3CCQ A;  5GAH C;  2UXB Q;  3A5U A;  1PFS A;  4POF A;  2UUB Q;  3LGJ A;  4DR1 Q;  4LF7 L;  2N3S A;  2YV5 A;  1JE5 A;  5M5Y H;  3FHW A;  5C44 H;  3I4N H;  4A3I G;  4JCV E;  5C4X H;  3PIP A;  2B29 A;  4P73 A;  3E0E A;  4AH6 A;  3J7Z C;  3M85 A;  4A75 A;  1Q82 C;  1Q7Y C;  4Y7N H;  2MQH A;  3CPF A;  2NZH A;  4HJ9 A;  4GOP A;  3J80 c;  1K8A C;  3HFZ B;  3KFU A;  4BA2 I;  2KCT A;  2JA6 G;  1HZA A;  3D0F A;  4R1J A;  1N32 L;  1NBW A;  2L15 A;  2VY3 A;  3CME A;  1UE1 A;  1W2B A;  1HNX L;  2CWA A;  1K83 H;  3ERS X;  3G6E A;  1X9N A;  1JT8 A;  3S1M H;  4RG1 A;  3SGI A;  4NXM Q;  1WCM H;  4OWX B;  4YY3 L;  2NVQ H;  1BBU A;  3KJO A;  3KJP A;  3OYY A;  1E7Z A;  1J5E L;  3J80 i;  3S1N H;  4A93 G;  4JBK A;  1U5K A;  1Q1B A;  1K73 C;  4DV0 Q;  1G6P A;  1VCI A;  3FP9 A;  2EXD A;  1VQE A;  1WI5 A;  4LF7 Q;  3CCE A;  3S1R H;  3CMA A;  2JA7 H;  4PZ7 A;  4LFB Q;  3K7U C;  4HIO A;  3U4V A;  4GOP C;  3M7N A;  4HJ8 A;  1I6H H;  3RN2 A;  5HGQ A;  4DAM A;  3PIO A;  2VS1 A;  4DR4 L;  2KEN A;  1GKH A;  2Q2T A;  1YBY A;  1N32 Q;  1EQQ A;  3KF6 A;  3PUY A;  1JJG A;  2WP8 J;  4DV3 L;  2ZJQ A;  1A63 A;  1N8R C;  5C0X J;  2GN5 A;  1HNX Q;  3VDY A;  3G48 A;  1OXT A;  4YWL A;  2CFM A;  3GTK H;  3M4P A;  1TWG H;  1SFO H;  4YY3 Q;  1S72 A;  1X54 A;  2I5M X;  1YEZ A;  3NEL A;  1J5E Q;  3CAM A;  3HOU H;  4GKK L;  2KCM A;  1UEB A;  2ALY B;  2JA5 G;  2BH2 A;  4OO1 G;  2KBN A;  2VQF L;  4NXN L;  4BXX G;  3I2Z A;  3I4M H;  1OXS C;  4R4Q A;  1XTD A;  2Q2I A;  3GTM H;  3GDE A;  2Z0S A;  1V1Q A;  2UXC L;  2YTY A;  2QGQ A;  4JC0 A;  1Y1W G;  4DR7 L;  3KF6 B;  4IOC A;  4OON A;  4JI2 L;  2ASB A;  1XPU A;  4NB3 A;  4GLA C;  3HOV G;  1CSQ A;  4LNQ A;  4DR4 Q;  5IWA L;  2R92 G;  1AH9 A;  2YTV A;  1W3S A;  3CC2 A;  1VQA A;  3RZD H;  4DV3 Q;  4DV7 L;  2JJQ A;  2WFW A;  1KL9 A;  5E7N A;  5ELN A;  3UDX A;  4GNX C;  4LF4 L;  2AWN A;  3MEF A;  1VQG A;  5M3F G;  5HY6 A;  4A3L G;  2JEB I;  5M3M G;  2D62 A;  2N8N A;  2HHH L;  2MO1 A;  4NPS A;  4LF8 L;  5ELO A;  4AYB E;  4GS3 A;  4A3D G;  4GKK Q;  3T1Y L;  4OX9 L;  1E3P A;  4R4I A;  1C7Y A;  1KC8 C;  3PV0 A;  4HIK A;  1QZG A;  2VQF Q;  1WYD A;  4NXN Q;  4C3I H;  1BVS A;  4BY1 H;  4XTC S;  2PQA B;  3S2D H;  3E9I A;  4DK3 C;  4GLV B;  1VQB A;  4ALP A;  2N49 A;  2UU9 L;  3UE1 A;  4LFA L;  4KLK A;  3S1Q H;  3CC7 A;  2K5V A;  5H1S E;  2UXC Q;  2KHJ A;  2WB1 G;  4LWC A;  1K9M C;  4DR7 Q;  4AYB G;  4JI2 Q;  4X62 L;  3CP0 A;  1EIY B;  2YYZ A;  5GQO A;  3GD7 A;  5IWA Q;  4MZ9 A;  2OTJ A;  2EQS A;  3G4S A;  2GVA A;  1IZ6 A;  3S24 A;  1KIX A;  1HR0 W;  4A3I H;  1K8G A;  1FGU A;  3PO3 H;  3KOJ A;  1A8V A;  2R7F A;  1IBK L;  4JI3 L;  2ZTC A;  4A3F H;  4IJH A;  4A3J G;  2Z6K A;  1HZ9 A;  2HHH Q;  2JA6 H;  2RCN A;  3K7A H;  1HR0 L;  4L5Q A;  4LF8 Q;  4B3M L;  2R93 G;  3CCS A;  4AIM A;  4DUY L;  1IYJ B;  3T1Y Q;  5AJ3 L;  2B3G A;  5DLQ E;  4OX9 Q;  3TRE A;  4A3B G;  1HNW L;  1OXX K;  3S14 H;  1LM0 A;  2NZO A;  1YHA A;  1Z9F A;  5JEA G;  1N36 L;  2F3I A;  3S2H H;  4IFD J;  1HH2 P;  1WJJ A;  2CKZ B;  2GVB A;  1Q1E A;  2I5H A;  2V1C C;  3DM3 A;  4P72 A;  4LFA Q;  5C3E G;  4C3H H;  2UUA L;  2JEA I;  1L0W A;  1VQO A;  3KLW A;  4X62 Q;  3PUZ A;  1YJN A;  4B3S L;  1PH6 A;  1IL2 A;  3NEM A;  2VW9 A;  1XMO L;  1I94 L;  4A3M H;  2RF4 A;  2Z6K C;  3L7Z C;  4ME3 A;  4UP8 A;  1VQL A;  1IBK Q;  4JI3 Q;  5FLM G;  4QGU A;  3Q8D A;  3NBH B;  4RMF A;  3TEH B;  2JK8 A;  2NN6 I;  3UE0 A;  4GN3 B;  1YVC A;  3W1B A;  5LMN W;  2CWP A;  2DUD A;  3H0G G;  1PH4 A;  1HR0 Q;  4B3M Q;  1EQR A;  4JOI C;  2EIF A;  3K81 C;  3PCO B;  4DUY Q;  4UP9 A;  4IPG A;  5AJ3 Q;  4KHP L;  3I4O A;  4JI4 L;  2NVY H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...