4JI0Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji0Q00
3F2DA 4MTNA 4JI5L 3J80c 4B3ML 1PH6A 2HT1A 4JI8L 3GDEA 1UEBA 1VQFA 4NXNL 1GM5A 1HNZQ 5C0XJ 1XNQL 5IYBH 3E0EA 3A0JA 1OXTA 2CKZB 2OTJA 4GKKL 4OWXB 2JEBI 1NE3A 4DAYB 1OXUA 4LF6Q 4LF9Q 1IBLQ 2MFIA 3ZJYC 2EIFA 4DK6C 2UUBQ 3OTOQ 3KDFA 2VQEL 4NXMQ 2YU9H 4OX9Q 2VY3A 3S15H 2Q2TA 3A5UA 5C3EH 4GLVB 4K0KQ 2EQSA 2AHOB 2LSSA 2I5LX 1JJCB 2GN5A 3L0OA 4AYBG 2Z6KA 4B3TL 4LFBQ 3RN5A 1R9TH 2OQKA 5LMNL 1Q82C 1NTGA 5C44H 3KDFB 5FLMG 4LF7Q 1QVFA 2QEXA 5DLQE 2NVQH 1N36Q 4A3JH 3CW2C 1X3GA 2B3GA 1YJ9A 1CKMA 4AYBE 2I0QA 1PA6A 1C0AA 1KAWA 4R1JA 3AFPA 4LFCL 1WJJA 3M7NA 4KHPQ 1VCIA 4DV7L 3J81i 2OCEA 4QQBX 4GN3B 4JI7L 4DAMA 3SGIA 3I2ZA 1UE7A 2ZJPA 4BA1I 4GLAC 4HIKA 3PO2G 3K0XA 2VL6A 4X65L 1N33Q 4DR7Q 1L1OA 2VZAA 2ID0A 4A3KG 4BBRH 1MIUA 1Z9FA 1X3EA 3PUWA 3CCQA 4A3EG 2F4VL 1CSQA 3PCOB 4DV3Q 3J81j 5GROA 1PYSB 4DV6L 1VQEA 4X64L 3HOXH 3RR5A 2OWOA 4GNXA 2ZTCA 1QVGA 3ULPA 5IT9c 4JI2Q 4LUOA 1WOCA 2PI2E 3GD7A 4A93G 2UXDQ 2JA9A 1I94Q 3PUYA 3G71A 2QA4A 4DUZL 1NBWA 1N8RC 1SMXA 1L1OB 4GN5A 1WI5A 2R7FA 4IOCA 1Y1WH 1ASZA 5BR8Q 2R93G 1BBUA 2PNHA 5LMUL 3W1GA 4LWCA 5HGQA 2D0OA 3PO3H 4GNXB 1S40A 3UDFA 2ZM6L 1VQ7A 2ZJQA 4YCWA 5IYCG 4LNQA 2PQAB 4JI3Q 2YTXA 3FKIH 2VQFL 2NVTH 2L15A 3STBC 3W1BA 3CC4A 1TWCH 1PH9A 4OO1I 2YYZA 1V9PA 4JI6Q 1K0RA 3M4PA 4GKJQ 3FP9A 2CFMA 3HKSA 1WCMH 5IP9G 1J5EL 1QVCA 1I50H 1VQCA 3KLWA 3AFQA 3HOVG 4B3SQ 4JV5Q 3K80C 1IXRA 3GTGH 3AYHB 4DK3C 2D0PA 1DGSA 3JC66 3KF6A 5J3BA 5JJKA 1XNRL 3GTQH 1JE5A 1G291 4DV5Q 4X62L 1HNXL 4L5SA 4JCVE 3S1NH 1VQ5A 1BVSA 4A75A 3HOWG 1IYJB 2BH2A 2UUAL 5C0XI 4DR6Q 1N9WA 3CCJA 1SFOH 1I6HH 1Q86C 1OXSC 5IYBG 1VQDA 1W3SA 1VQ4A 2K5NA 3S2HH 3KYHC 4A3FG 1VQGA 2NN6I 4BY1G 1IBKL 4LF5L 1O7IA 3CF5A 4DR5L 3CCLA 4LF8L 3I4OA 1PFSA 4A3LH 4MZ9A 1K9MC 2JQOA 1CUKA 3I55A 4HIDA 5AJ3L 4R4OA 2ZJRA 4A3GH 2ASBA 4PZ6A 1XMQL 1C7YA 3OYYA 2LXKA 3ULLA 4HJ5A 5IWAQ 1K8AC 2Q2IA 3M3YH 1YVCA 1Q7YC 1VQJA 1HR0Q 1E22A 5IP7G 4DV0Q 4XIGS 3JAMc 4A3JG 3CD6A 1H95A 2ALYB 3OW2A 2A1AA 4IPCA 3HOUH 1YBYA 4A3IH 4BBSH 1JB7A 2V1CC 1LM0A 2XTIA 2ZTEA 1I3QH 1CKOA 5GAHC 3CP0A 3EIVA 2I5HA 3RLFA 4RMFA 3I7FA 5JEAG 1HR0W 2ES2A 1A0IA 4IOAA 4DV2L 2D62A 2E5LQ 2R92G 3E9IA 4JOIA 1N34Q 1KRSA 1FVIA 4OX9L 2JA5H 4PMWA 2OTLA 2WP8J 3GTMH 1AE2A 4BY7G 1WYDA 2HQLA 4NB3A 2IY5B 1L1OC 3TS0A 2IHFA 5FJ8G 1JJ2A 5M5YH 4LFBL 1VQIA 4QJFA 1VQPA 1PH2A 2YTYA 4JI4L 1HJPA 4WJ4A 3UDGA 1UWVA 2BH8A 4ALPA 1YZ6A 2B63G 3T1HL 1B7YB 1TXYA 2KHIA 3HOYH 1W2BA 2JA8G 4IO9A 4DR4L 4A4IA 1CSPA 3H0GH 3CAMA 3TS2A 3KF8B 1FJGQ 5IYDG 2JEAI 4HIMA 4AIMA 2ATWA 1EWIA 1HZBA 4X66L 3MEFA 2JA7H 2N78A 3A5ZB 3NEMA 2R7DA 3PUZA 2HHHL 3PV0A 4JYAQ 1VQ9A 2AKWB 4DUYQ 3PO3G 1XPRA 2UUCL 3A74A 3PIOA 3I4NH 1VQNA 2R7ZG 2WB1G 2Q2UA 4JI5Q 1J6QA 1LTLA 2HIVA 4QGUA 4JI8Q 1LUZA 2KCMA 5C4JH 4DR1Q 4NXNQ 1MJCA 4P72A 1P8LA 4YWMA 4DR2L 1XNQQ 2CWPA 1Q1EA 1PH5A 1WCMG 3FHWA 3PUXA 2WB1E 2Y0SG 3BZCA 4YHHL 1X55A 3CC7A 1PH7A 4OWWB 1Q46A 4JI2L 1EIFA 1HH2P 3GTLH 2E2IH 4LFAL 2K4KA 2N8NA 4C2MH 5M3FH 1XPOA 1VQKA 3CCUA 1SRUA 2N3SA 2VQEQ 4R4CA 4DR3Q 2UXBQ 3RZOH 5BR8L 4JC0A 1PH4A 2KHJA 2Y0SE 1E24A 3WWVA 1YIJA 3G4SA 5GQOA 2UU9L 1Y1VH 5E7NA 3F2CA 3MXNB 4B3TQ 3HKZG 3TQYA 2MNAA 3S1QH 2PQAA 4PG3A 3KJOA 5LMNQ 1B8AA 2WAQG 4GOPC 4A3MG 3DM3A 5M3MG 1LYLA 4IFDG 4A3BG 1VQAA 1UE1A 4B3RQ 3HKZE 3T1YL 3PSIA 2DGYA 1XMOL 3CC2A 1N32L 1KXLA 1JT8A 3U4VA 4JI1Q 2VUMH 1KD1C 3KOJA 4B3SL 3ERSX 2WAQE 2HIXA 4BXXG 5LMNW 4A3GG 4LFCQ 3CCEA 1V43A 3U4ZA 4DV7Q 1IBML 3GTJH 1XTDA 3CCSA 4JI7Q 4X6AH 2OQ0A 1YHQA 2MO1A 1NMFA 1P16A 3PGZA 3L2PA 3I56A 4A3CG 1E1TA 1C9OA 3CMEA 1EFWA 2JA6G 3NELA 4EQ5A 3HOZG 3S16H 3K81C 2GVAA 4LUZA 4GLXA 4X65Q 4Y52H 3L7ZC 1EYGA 1SN8A 5FLMH 3I4MG 3PF4A 3HOUG 3D31A 4BBSG 2PMZE 4DV6Q 4X64Q 1E3PA 3B6YA 5M5WH 4JOIC 2C35B 1SR3A 4C3IH 1M90C 4UP8A 3HFZB 3M85A 4KI0A 4YY3L 3J80i 2K14A 4DUZQ 1PH1A 3J81c 1YEZA 1PVOA 4HJ9A 1KHIA 1A63A 4DKAC 2UXCQ 1L2FA 1D7QA 3NENA 1YJWA 3GO5A 4OXPA 1QZHA 1GVPA 1NJIC 2BA0A 2NZHA 3F1ZA 1B70B 3LGJA 2IX0A 4FDBA 2ZM6Q 3S1MH 1YITA 4GS3A 4L5RC 3TEHB 3PO2H 2N49A 2VQFQ 2VNUD 4JBWA 5IY0A 2F52A 4QY7A 4DV0L 4A3EH 1M1KC 1E1OA 3M4OH 2YV5A 3KFUA 5C3EG 2Z6KC 4PZ7A 3PF5A 4DV4Q 1J5EQ 3ICEA 1VS0A 2VS1A 3S17H 2IT1A 4MNOA 4A93H 1TWAH 4OO1G 1EOVA 2JK8A 4DPGA 4OWTB 4POGA 1N34L 4K0KL 5C44G 1HNZL 1E7ZA 1T9HA 1X56A 1XNRQ 3H3VH 2R93H 1BBWA 2NVYH 1EQQA 4O2DA 2NZOA 4X62Q 1HNXQ 3BU2A 1PH8A 4R4TA 1G6PA 1FL0A 4J15A 1KRTA 1HZ9A 5HY6A 3CPFA 1GD7A 2GVBA 4LF6L 1IBLL 1X54A 4LF9L 2UUAQ 5IYCH 1VQ6A 4A76A 4DV1Q 2UUBL 3OTOL 5C4XH 4NXML 4YWKA 2I5MX 2MO0A 4O0AA 3M9BA 1VQHA 3UDIA 1IBKQ 1EUJA 1PYBA 3EBEA 3RLNA 2E8GA 1KL9A 3IRBA 5IP9H 5C0XG 1SE8A 4DR5Q 4LF8Q 4JBJA 4AH6A 4HIOA 4AQYQ 2PI2A 5M3FG 3HOVH 2VW9A 4LF4Q 2NN6G 4BBRG 2E2HH 2FXQA 5AJ3Q 4GNXC 4LF7L 1N36L 3RZDH 3PUVA 2K5HA 5JEAJ 3HOXG 4DUYL 5JJIA 1XMQQ 2F3IA 3K7AH 1K3RA 3RLOA 1KIXA 3D0FA 4C3JH 1RL2A 1NY4A 3HOWH 3CCRA 4A3DH 2QGQA 3M4QA 3S24A 3CCVA 4KHPL 2JE6I 4DR1L 1PH3A 1Y1WG 1EQRA 3ER0A 4A3FH 1YHBA 4BY1H 4JI0Q 1BKBA 2JJQA 2RCNA 1HNWQ 2VUMG 4JG2A 2DUDA 2LXJA 3RN2A 3H15A 1PV4A 4B3MQ 3FKIG 3Q8DA 4L5TA 1N33L 4DR3L 4DV2Q 4DR7L 2UXBL 2AMCB 4P74A 3S1RH 1A62A 2Q2HA 1TWHH 3K8AA 4DV3L 3F8TA 4UP7A 5EAYA 2CQOA 2Z0SA 4IJHA 3H3VI 4GKKQ 4IFDI 1K73C 1UE5A 1PHJA 2A8VA 3CCMA 3BZKA 4WJ3M 2UXDL 3NBHB 1X3FA 4ME3A 1I94L 4JI4Q 4IPHA 4LUVA 1UE6A 4HJ8A 5JJLA 5IP7H 3KJPA 3T1HQ 1EIYB 2RF4A 3GTOH 2CCZA 4B3RL 1KQSA 4XTCS 5GAEC 1AE3A 4NPSA 4JI1L 4DR4Q 3G6EA 1YHAA 4JI3L 2AWNA 3E9HA 2IHEA 2R92H 4POFA 4TVAB 4X66Q 1Q1BA 3RNUA 3VDYA 1RIPA 4P75A 2HHHQ 4JI6L 2IX1A 3S14H 1X9NA 4BY7H 5H1SE 4GKJL 1SLJA 4L5QA 2K50A 2UUCQ 5FJ8H 2XGTA 1U5KA 4A3LG 2RHSB 4R4IA 5GAGC 4JV5L 4P73A 1YI2A 4JBKA 4Y7NH 4DR2Q 1Q81C 5ELNA 1QZGA 1U0LA 4DV5L 2B63H 2WFWA 1NMGA 1L0WA 2YTVA 2BA1A 3STBD 4YHHQ 1Q12A 4YWLA 1MKHA 2JA8H 4LFAQ 3W5OA 4DR6L 4IFDJ 4TQUS 1X6OA 5IYDH 4EX5A 2E2JH 3CMAA 2UXCL 1HZCA 2F4VQ 2K52A 5IE8A 3JAMi 3AQQA 3U58A 2R6GA 4A3IG 4YCVA 1SROA 2KCTA 4IJLA 3CXCA 1VQOA 3UE0A 2UU9Q 2H5XA 1JMCA 4KHZA 2NVXH 2K5VA 2R7ZH 1MJEA 5GADC 2B29A 4DNIA 5C4XG 2JA5G 1QUQA 4BA2I 1XJVA 4DV4L 4QL5A 3F2BA 3T1YQ 1N32Q 4H02A 4QIWE 5LMUQ 1XMOQ 1VQLA 4OONA 1G51A 1S72A 5IWAL 4JBMA 4YCUA 1GO3E 1HR0L 2KBNA 1IBMQ 1OXXK 4A3KH 1Y14B 2AWOA 4C3HH 1TWFH 1QUQB 4LW1A 3GTPH 3DLLA 3CPWA 3HOYG 1S3OA 3UE1A 1XPUA 1KC8C 1AH9A 4IPGA 3H0GG 4A3DG 1OTCA 4DV1L 2E5LL 3G48A 1X65A 3EN2A 1D8LA 3KF6B 4A3MH 5M3MH 2JA7G 1FGUA 4HJAA 4PZ8A 2K75A 2EXDA 3GTKH 1CKNA 4A3BH 4GOPA 2A19A 2KENA 3I4NG 4AQYL 4HJ7A 4UY8C 1YJNA 3U50C 3PIPA 1TWGH 3CQZH 3BJUA 4APVA 4YY3Q 4LF4L 4BXXH 2CWAA 4RG1A 1YNXA 3UDXA 5FLXc 3J7ZC 1IL2A 2RHQB 3TRZA 5ELOA 2ZTDA 4UPAA 1I5FA 1K83H 4GN4B 5K36G 3AEVA 1Z47A 2MQHA 4R4QA 3J7A5 4LF5Q 1CKNB 1VQBA 4GOPB 4KLKA 4A3CH 1VQ8A 1VQMA 3ULJA 4P71A 5M5XH 2JA6H 4UP9A 3HOZH 1JJGA 1WFQA 1FJGL 1GKHA 1V1QA 3S2DH 4IPDA 1HZAA 3TREA 1ASYA 4JI0L 1Q8KA 3I4MH 1K8GA 3K7UC 4JYAL 1HNWL 1A8VA 1Y1VG 1OXVA 1IZ6A
chains in the Genus database with same CATH superfamily
3J80c 4JI5L 5C4ZA 4CBVA 4UDUC 4KJNA 3BVZA 2OTJA 4OWXB 2JEBI 1NR2A 1H9KA 1PTOH 2MFIA 4DK6C 5M3MB 2VQEL 3HS0C 2YU9H 1SAPA 2VY3A 3A5UA 2EYFA 4TKOB 5C3EH 3D6CA 2EQSA 2M9VA 4PQXA 3MFGA 2I5LX 2XRQD 3RN5A 2B2VA 1JB3A 1W6JA 5FLMG 5I6WA 5DLQE 3L9AX 4A3JH 1CKMA 3ZYYX 2I0QA 1FR3A 1Q3LA 3VA7A 3HOZB 1HFGA 1KAWA 3I4LA 3KBGA 1DCZA 1STYA 1O78A 5L37A 4DV7L 1D5MC 1Z6HA 1X32A 4RKBA 1I3QB 2PNRC 1KTKA 4KKUA 4CGYB 4GLAC 1ILQA 4HIKA 4DR7Q 1Z9FA 1X3EA 1CZGA 1NAPA 3PCOB 1SYEA 3J81j 5KYLA 1VQEA 3HOXH 1TS2A 2ZTCA 3ULPA 4LUOA 2UXDQ 1I94Q 2IPKD 2SNMA 4RGOS 3G71A 2QA4A 1N8RC 2K04A 3S15B 4GN5A 1WI5A 5FO7B 2R93G 5T1IA 1ENCA 2CW0D 2PNHA 2L12A 2F0PA 4LK1C 4LWCA 4GNXB 1S40A 3UDFA 1VQ7A 3TZUA 2ZJQA 4LNQA 2PQAB 2B2YC 2VQFL 2O5IC 2L15A 4QF4A 5EKIA 3W1BA 1H9RA 4OO1I 1WTQA 3M4PA 3J80E 1CHQD 1AZPA 1F9RA 1LO5D 3C1FA 3TP5A 3GTGH 5G3LD 1LABA 2D0PA 1DGSA 2Z4HA 3VYSA 4DK3C 5JJKA 1IKMA 3D3RA 3GTQH 1JE5A 2HDMA 5JPNC 5I9PA 4JCVE 3T56B 1JORA 1JWUD 5KEEA 2BH2A 4BBRB 1A3UA 4WFN3 2JSOA 4K6LA 5IYBG 1VQ4A 3S2HH 1RTNA 4LF5L 1S5CD 4WORA 1QOHA 4MZ9A 1K9MC 1PZKD 3BDOA 1SDFA 4R4OA 1EY8A 2DY7A 3I90A 2VUMB 2A74C 1C7YA 5DM73 4FXKC 2B2VC 1UEAB 2V4DA 3M3YH 5J1ZA 1YVCA 1E22A 1G2SA 4DA2A 4XIGS 5COYA 4IPCA 1I4XA 3HOUH 2A68D 5K5PA 4HCEA 2I07B 3BVGA 3RLFA 1HR0W 2RKSA 2D62A 1TT2A 1PTOC 2OTLA 3KLSX 3GTMH 3V96A 2HQLA 1CZWA 1K28A 1JJ2A 5M5YH 4CKCA 3KF8A 1VQIA 2K01A 1HJPA 1XYIA 2BH8A 3KBXA 4N9PA 2DNEA 1W2BA 4IO9A 3PO2B 1Q8IA 3H0GH 4A4IA 3TS2A 1I4RA 5J22A 3ND8A 4HIMA 3DHQA 1HZBA 1PXUA 3A8JE 2HHHL 1EWCA 4RGMA 2UUCL 3A74A 2KQ3A 3I4NH 3U9SA 2EOTA 4QGUA 1LUZA 5C4JH 1B50A 1XNQQ 1QG7A 1EU4A 2CWPA 1Q1EA 5I4DA 2J4XA 2WB1E 3J80L 1CTMA 4YHHL 4QIWB 4JI2L 2E2DC 3GQBA 2N3SA 2UXBQ 1SE4A 4JC0A 3WWVA 3QOJA 3G4SA 1HTPA 2UU9L 1SNQA 5E3FA 1ML0D 3TP6A 3HKZG 4B3TQ 4JVZA 4ID6A 4GOPC 3RZDB 4A3MG 3K7AB 3E5SA 4IFDG 1UE1A 4X3UA 2DGYA 1XMOL 4A3DB 4RGTA 1JT8A 2LMCB 4B3SL 1KLUD 1B9NA 4X3SA 5LMNW 2F0FA 4LAAA 1IBML 1JOOA 3CCSA 4JI7Q 4X6AH 4HR7B 1P16A 1EQTA 2HDLA 1GUGA 5ELEA 1UNSA 1BCPF 4FF2A 2JA6G 1S5ED 1DZ1A 3A54A 1WTXA 4LUZA 1UUPA 1EYGA 4J6HA 1EZ8A 4X64Q 5M5WH 5BN5A 5D3IB 4YY3L 1C4QA 4DUZQ 1A63A 1L2FA 1TS3A 3GO5A 1NJIC 3P20A 1TKWB 5JJZA 2ZM6Q 5CV4A 1A3TA 1T5XD 1GUTA 2TSSA 1R4QB 4DV0L 2F52A 3NTIA 3M4OH 3KFUA 1KNAA 2Z6KC 4PZ7A 4WRDA 2EY1A 1GHKA 4RKLA 4U673 5EBDA 2F03A 1TWAH 2DJFC 4Y7NB 2JK8A 4DPGA 1PRTB 4OWTB 5C44G 3VA5A 2NZOA 2AUJD 4NDXA 4X62Q 1HNXQ 4R4TA 1FL0A 1VMPA 4J15A 1F2YA 1I4GA 2UUBL 3RD4A 5CV5A 1QB5D 2MO0A 4O0AA 3M9BA 3CRLC 2NVXB 3W3AA 4DR5Q 5C0XG 1SE8A 4MHEA 4LF8Q 4LJZC 4HIOA 5M3FG 3HOVH 3IL8A 5D3DA 3MXUA 4LF4Q 5EPLA 4DF7A 4LF7L 3MFYA 1N36L 3BG3A 3PUVA 5JJIA 2IW3A 1XMQQ 2F3IA 3I70A 1E2ZA 1BUVT 4C3JH 1RL2A 3X3MA 4KN4C 1NY4A 4RCNA 3HOWH 3M4QA 2A6HC 2JE6I 1NCVA 3NWSA 1PH3A 4K2LA 1NUCA 4F88A 1BKBA 1HHVA 4JG2A 2DUDA 1PDQA 1TU2B 1PV4A 3FKIG 4HN7A 4DR3L 1IW7C 1WTPA 2NVYB 4A3BB 5A2QE 2A69C 3K8AA 2Z0SA 3MVVA 3O13A 1PHJA 3UI2A 1X3FA 1LT5D 2PW7A 1Z7TA 1E2WA 1H9SA 2HD3A 3T1HQ 1IL8A 1A3VA 2FHTA 4C3IG 4DR4Q 4BWGB 1RCVD 5JEAH 4JI3L 5TSSA 3I4MB 5LHY1 3VDYA 5CV8A 1Q1BA 4P75A 1X9NA 4BY7H 1WVLA 2K50A 3EQLC 1EU3A 4PMCA 4OELB 3MWYW 4P73A 3U9OA 2E76C 1ONLA 4DR2Q 1Q81C 4DV5L 2YTVA 3NQIA 1F9PA 1O7LA 2JA8H 2JP1A 4LFAQ 2NBFA 4TQUS 1X6OA 5IYDH 4EX5A 1LT6D 1HZCA 2IL8A 1GUNA 3JAMi 3AQQA 4IJLA 1PFBA 3CXCA 1JMCA 4KHZA 1AW7A 4KJOA 1MJEA 2B29A 1IKLA 1C8CA 2JA5G 2F3WA 2XNAC 3OIPA 4DV4L 1N32Q 4QIWE 5LMUQ 1HUNA 4OONA 1SSOA 4YCUA 3HEJA 3VR6A 1F9QA 4ODGA 2AWOA 4C1NK 1TWFH 1QUQB 5LL6X 3K5MA 3DM1A 5FOBB 3UE1A 1XPUA 1HQRD 1D1IA 2K5DA 3CHBD 2ICEC 2E5LL 4CDFC 3G48A 3EN2A 3KF6B 5M3MH 3OMCA 4PZ8A 4B9XA 1E2VA 5IOCA 1CKNA 4AQYL 1QNUA 4UY8C 1YJNA 3PIO3 3CQZH 4APVA 1Y1WB 4DXGA 1IL2A 4RG1A 3TRZA 4A3GH 1O7ZA 2RHQB 2ZTDA 2EYHA 3J7A5 1PTOD 1VQBA 1E0BA 2RBMA 4KLKA 1VQMA 4K5VA 1NSNS 4NP5A 2KHSA 3HOZH 1WFQA 2BE5C 1GKHA 1HZAA 2WIIB 1G91A 4JYAL 1IZ6A 5JVG3 4FNFA 3F2DA 4B3ML 1PH6A 2HT1A 3GDEA 4NXNL 1HNZQ 1SMYC 1OXTA 2CKZB 4GKKL 2CQAA 3HKZB 5E4WC 1SFOB 5JVH3 1SEBD 1GJXA 4LF6Q 4LF9Q 2F0EA 4I65A 4A3MB 2F0VA 3OTOQ 4N9TA 3WOEA 4OX9Q 2NYZD 1HFNA 3DWQA 3S15H 2Q2TA 4Z9CB 4K0KQ 4G7OC 2LSSA 5KNBA 1JJCB 2GN5A 2RDHA 1BO0A 4CDDC 1K83B 1Q82C 4RH6A 1QVFA 2O5JC 2BCOA 5M5XB 2PCFB 4K2KA 1C0AA 4R1JA 3S2DB 1D2BA 3T53B 2LKVA 2OCEA 1KAAA 4QQBX 3AU7A 1HQMC 4GN3B 1QJOA 3SGIA 2DNCA 4FP5D 4KKSA 2ZXOA 3N52A 4BA1I 3PO2G 3K0XA 1I4HA 1N33Q 5EGTA 4A3KG 4BBRH 1CQFA 1B3QA 3CCQA 2PPBC 2F4VL 2CH4W 4DV6L 3RR5A 2OWOA 4GNXA 3C46A 1QVGA 5G3LF 1WOCA 1VF7A 3PUYA 1NBWA 1ILPA 1L1OB 3QB3A 2EJGC 3Q23A 4DAVA 2N88A 4UAIA 3W1GA 1EY5A 4FYDA 4S3SA 2NVTH 5IODA 4CJ2C 1TWCH 2YYZA 1GUWA 2K32A 3VYUA 3Q6SA 1SJHD 5IP9G 1J5EL 3AFQA 1EFID 4JV5Q 3K80C 1IXRA 1G291 1Q90A 2E2IB 3BZDB 3K5OA 3S1NH 4A75A 5M3FB 4IUUA 3R2TA 5IGBA 1IYJB 4DXFA 5C0XI 3NP8A 1I6HH 1VQDA 4K8IA 3KYHC 4KV6A 1LTAD 2PO4A 5D65A 1O7IA 3CCLA 3MXPA 4ABNA 2EYOA 4A3LH 4DAPA 3P75A 4OIJA 4IUNA 4HIDA 2ZXRA 4XYOA 2ASBA 3R3OA 1GUOA 2F0MA 4HJ5A 1TQOA 2F0JA 3ND9A 2Q2IA 1HCZA 2KCCA 2EVBA 4A3JG 3CD6A 1I50B 3OW2A 4KY6A 4BBSH 1JB7A 2SEBD 2MHVA 2ZTEA 3EIVA 2I5HA 2ES2A 1MSHA 4C56C 4IOAA 2R92G 1UAPA 1N34Q 4PMWA 2WP8J 2Q8IB 2A6HD 4C3IB 5M9OA 4O42A 4QJFA 1VQPA 3VR3A 2G9HD 3UDGA 1LTTD 2B63G 2IX3A 1B7YB 2B8FA 5I6YA 1TXYA 2HUGA 2KHIA 4RHSA 3HOYH 1D5ZC 2A69D 3LX0A 2JN4A 3BVMA 3TMEA 4A3EB 1AEXA 1C48A 1EWIA 3S17B 4QCLA 3ONAB 2B39A 1VQ9A 4DUYQ 4A93B 3PIOA 3FPPA 1VQNA 2Q2UA 4JI5Q 3E0JA 2LFNA 1MJCA 1A2UA 3FHWA 3K59A 3SR1A 2Y0SG 1WD1A 4OWWB 2X69A 1Y8OB 3GTLH 1HH2P 4C2MH 3A7LA 4HMIA 1XPOA 2JA5B 2VQEQ 2NN6H 3RZOH 4ZQ3A 5FK9C 1PH4A 1YIJA 4LMQD 4V190 5E7NA 5JAVA 3MXNB 3TQYA 2MNAA 2E2HB 2EYMA 1B4OA 1B8AA 4H13C 5DAUA 4DK1A 2FMCA 1EQVA 1VQAA 4A3BG 4B3RQ 3HKZE 3CC2A 3PSIA 2NTSA 3SE0A 2K03A 1SYDA 4JI1Q 1FYCA 3ERSX 5C3XA 3CCEA 4A3FB 4DV7Q 4BY1B 1BQQT 2OQ0A 4K5XA 2NUCA 5DNFA 2MO1A 3LWUA 3PGZA 5C5MA 3V05A 3OHXC 1HXYD 3CMEA 1EFWA 3S16H 3K81C 2JXMB 2B2WC 1HPCA 4B08A 5FLMH 3I4MG 5F2DA 3PF4A 3HOUG 2PMZE 1SNCA 3B6YA 4UP8A 1CA5A 4KI0A 3J80i 1PH1A 1DOKA 3J81c 4HJ9A 1KHIA 1D7QA 1YJWA 1LTGD 3TBIB 2BA0A 4MIUA 3F1ZA 1KLGD 1EEFD 2LY7A 4L5RC 2VQFQ 5IY0A 4M1UB 4QY7A 3PF5A 1B53A 3ICEA 3S9WA 5KIXA 2IT1A 1EOVA 1EY6A 3GTJB 1MI2A 1V1OA 4RAUC 3Q22A 1E7ZA 1T9HA 3IKJA 2RSOA 2R93H 1LT3D 2NVYH 1CQVA 1EQQA 2BE5D 1PH8A 1EYDA 5I2XA 3CPFA 2KVMA 1IBLL 1F2MA 5C4XH 4NXML 2I5MX 4RHRA 1G8ZD 1VQHA 3EBEA 2E8GA 1MBYA 2KECA 5CV6A 3EVQA 2L4NA 1GXDC 2VW9A 2A6EC 4U68A 2FXQA 2R61A 3C1EA 4R9WA 3A56A 5JEAJ 4ILWA 2X6GA 2RSNA 1K3RA 2Z1CA 3RLOA 1KIXA 3KUPA 3ERQA 3CCRA 4A3KB 3BS1A 5CBAE 4KHPL 1B44D 4CJ1B 1Y1WG 2F0KA 1II3A 3ER0A 1YHBA 4JI0Q 1TY2A 2JJQA 4XT3B 3CRKC 3K0YA 1LTSD 3FEWX 3SEBA 1KDAA 3Q8DA 4L5TA 2UXBL 3GTKB 1A62A 4DV3L 2D5DA 4UP7A 4KN7C 4IJHA 3H3VI 1TWGB 1UE5A 2A8VA 3CCMA 4ME3A 5FKAC 1UE6A 4HJ8A 3MXGA 2K1BA 3KJPA 1BCPB 2RF4A 2F0SA 1KQSA 4NPSA 2H4OA 4KK7A 1YHAA 4FF4A 3RNUA 1RIPA 2HHHQ 2K05A 4JI6L 4GKJL 3W2DA 1PRTC 1B9MA 1SLJA 4ZUIA 1XWEA 5CC4A 2UUCQ 2XGTA 1U5KA 2F0IA 3NXWA 1K3BC 4JBKA 1SXTA 4KD4A 1QZGA 5ELNA 1U0LA 2WFWA 1NMGA 1L0WA 2F3VA 4YHHQ 1PTOB 1Q12A 4YWLA 2F0HA 1STGA 2L5TA 2WV6D 3W5OA 5KGUA 3TP7A 2YU9B 4DR6L 3EA6A 3S1RB 1TWHB 5C3EB 3DWPA 1G2TA 3IFDA 5IE8A 4A3IG 4YCVA 2UU9Q 1PMRA 4O1NA 5IGDA 4EQOA 5GADC 3K5LA 3TDQA 3GTOB 4A3JB 4EVOA 1QUQA 1I6VC 3Q0AA 4OEMB 1XJVA 1H9MA 3F2BA 3FDTA 5KNDA 1XMOQ 1VQLA 5IWAL 1GO3E 2R92B 1XX8A 1KDCA 1T5EA 1HR0L 1IBMQ 1PTOF 4C3HH 1U4LA 1JR0D 4ZK9B 3GTPH 2K28A 3HRZC 1DOLA 1OO9B 1PLFA 1S3OA 1AH9A 4IPGA 4IN3A 1OTCA 5EKKA 2B63B 4CKEA 1R4PB 4A3MH 3C3LA 3HOXB 1BF4A 2JA7G 4HJAA 4IFDH 2RCFA 2SNSA 2A19A 1IYVA 2KENA 4HJ7A 3U50C 2E2JB 4YY3Q 4LF4L 3R93A 5FLXc 1F2LA 1I5FA 1K83H 4GN4B 3AEVA 2MPMA 2MQHA 4R4QA 1HA6A 1K8MA 2X6LA 4GOPB 2PQEA 3J81L 4P71A 5M5XH 2JA6H 1JJGA 1FJGL 4HSPA 4FXGC 3S2DH 4IPDA 2XIWA 1HRJA 3HP3A 1Q8KA 2Y0SB 2B8GA 3K7UC 1K8GA 1Y1VG 1OXVA 1DOMA 3GTGB 4MTNA 2MJ8A 3NPPA 4JI8L 1VQFA 1GM5A 5A35A 1NNXA 2EY2A 1NE3A 5KRUA 3ZJYC 2EIFA 3S2HB 3GP7A 2UUBQ 4CDCC 2MUYA 1Y8PB 2XWJB 2TMPA 4IUPA 3F2UA 3L0OA 4AYBG 4LFBQ 1PFNA 1MD2D 4DK0A 2OQKA 5LMNL 1YNNC 2WKCA 3KDFB 4HMJA 5C44H 4K5WA 4LF7Q 2NVQH 4MTKA 3KLRA 1RHPA 1N36Q 1LTBD 3M3YB 5AFWA 3BYYB 3MA2B 3AFPA 4K8JA 4LFCL 2WINB 3NTHA 3M7NA 3MZ5A 5KNCA 3HOUB 4XQQA 3I2ZA 1UE7A 5C0XH 2ZJPA 3NUCA 3J7YW 4X65L 2VL6A 3GTMB 1L1OA 1FNVA 2RQXA 4A3EG 1CSQA 4G7HC 5M5YB 2CVRA 1W6KA 2EJFC 4A93G 1FNUA 1JWSD 1I4PA 4IOCA 2R7FA 1ASZA 1B1ZA 3SXHA 5BR8Q 4YIJA 4CHTB 4DNRB 5LMUL 2ZT9C 3PO3H 2D0OA 1R9TB 1RODA 3A8KE 5IYCG 4JI3Q 3FKIH 1CA6A 4ULLA 1V9PA 3I4NB 3FP9A 2CFMA 1WCMH 1I50H 2O4XA 1TR5A 3KLWA 5C4JB 5J3BA 1XNRL 1EL0A 4DV5Q 1WTVA 1A6XA 4L5SA 5ELDA 3H6MA 1VQ5A 1BVSA 2A5HA 1QCBD 1B3AA 2UUAL 5ISRA 3SHLA 1Q86C 1EOTA 1OXSC 2L55A 4A3FG 4BY1G 2J7ZA 1IBKL 1ET9A 5IGFA 1PFSA 2FINB 1LACA 2VXWA 2D2CC 2JQOA 5JOBA 4PMBA 3I55A 5AJ3L 1TVXA 2ZJRA 3SDZA 4IUVA 4PZ6A 4DGZA 3MAQA 1L0XB 1FD7D 2L1BA 2LXKA 3R8BA 1BBXC 1K8AC 2Z6BA 1STBA 3DXJC 5IP7G 1H95A 2A6ED 3M4YA 1YBYA 1AZQA 2V1CC 2XTIA 1K8OA 1I3QH 5GAHC 4B9WA 2K7VA 3CP0A 3TZDA 2VB3X 1EY4A 1GUSA 1A0IA 1SYGA 1CI3M 4DV2L 2E5LQ 3E9IA 1SE2A 3CU7A 1KRSA 1FVIA 4JOIA 2JA5H 4OX9L 1AE2A 4C1NI 4NB3A 2IY5B 1L1OC 2IHFA 5FJ8G 1PH2A 3BYTB 1S5BD 1ENFA 4JI4L 1UWVA 1YZ6A 2BDOA 2F0LA 2KUMA 2L9HA 5FLXL 1CSPA 1SE3A 4OO1H 4AIMA 1SNMA 2A73B 4X66L 3MEFA 2N78A 3A5ZB 2SDFA 4JYAQ 3QG1A 2AKWB 1TWAB 2R7ZG 2I46A 1LT4D 2OXPA 1S5FD 4DR1Q 4NXNQ 1LLRD 1P8LA 4A3IB 2M00A 1PH5A 2R3ZA 2K6AA 1DD2A 2QCPX 2F0TA 1PH7A 3BZCA 1EIFA 1PRTD 2K4KA 2N8NA 4ZRZA 1VQKA 1SRUA 1SNPA 2GA4B 4KD3A 4R4CA 1J9OA 2KHJA 2Y0SE 1E24A 1U4PA 5ELBA 3HOVB 1JCKB 3F2CA 1IYUA 1EYAA 2PQAA 4N8FA 1RD9D 4PG3A 3QR8A 2IWHA 2WAQG 3I73A 4X3TA 3TSSA 1LYLA 1BXTA 4C3JB 3T1YL 3HOWB 1KXLA 3OPOA 2VUMH 3I8ZA 1KD1C 3KOJA 3J7AV 2F0DA 4BXXG 3PIP3 4Q0FA 1V43A 1Y69U 2JA7B 4FO2A 3GTJH 4L6TB 3IAYA 1YHQA 2OEOA 1NMFA 3SVMA 3I56A 4A3CG 1E1TA 3H94A 1D1KA 1RJTA 3N6RA 3NELA 4EQ5A 5IGCA 3EROA 1LTRD 2C9OA 3L7ZC 1G6ZA 5IGEA 3D31A 3SK6A 4BBSG 4DV6Q 2RA4A 1E3PA 1STNA 4JOIC 2C35B 1M90C 2K14A 2N55A 3FPUB 1YEZA 5EPKA 1BOSA 2UXCQ 1Y1VB 2F0QA 4OXPA 3WOFA 3S1QB 1TS4A 2NZHA 2QEJC 3LGJA 5CV7A 4FDBA 2E75C 3TEHB 2QDLA 3PO2H 1VDZA 1AP0A 4BY7B 1M1KC 5C3EG 1J5EQ 2JYOA 1VS0A 2VS1A 4V0BA 2P5ZX 1U4RA 5CORA 4POGA 1N34L 3H3VH 1BBWA 3M7GA 4O2DA 3BU2A 4AYBB 1KRTA 1HZ9A 5HY6A 1GD7A 3A7AB 2GVBA 4RA8A 4A76A 4DV1Q 1FNWA 1JQYD 4YWKA 1EEID 2PW5A 2MP1A 3T4AC 4I7AA 1EUJA 5IP9H 1ZXTA 4DN4M 1I4QA 5FO8B 2NN6G 5CMDA 4GNXC 4E6IA 3RZDH 2K5HA 3HOXG 4DUYL 1IW7D 3S1MB 3K7AH 2EY6A 4A3DH 1TWFB 4IURA 1QWYA 3V2TA 1NR4A 2KCNA 1RF2D 5JPMC 1STEA 1HNWQ 1YNND 2EE1A 2HQEA 3QIAA 3OWEB 2LXJA 3H15A 4F8MA 4DR7L 1PYWD 4QUFA 2AMCB 2IJ0A 4J8QA 4OL7A 3S1RH 2Q2HA 1TWHH 1HTLD 5K36H 2CQOA 2ICIA 1O7YA 2RDGA 3CQZB 1S5DD 3C2PA 4A3GB 1ESRA 3HG9A 4XYQA 3NBHB 5I9OA 2UXDL 1I94L 1U9RA 2PZTA 4IPHA 4DFAA 3P7JA 3GTOH 4NMZA 4B3RL 5NUCA 4XTCS 5CR3A 5GAEC 1MGSA 4JI1L 3G6EA 2M2LA 3FMCA 2R92H 1A15A 4TVAB 3D6WA 2IX1A 5C3WA 1CHPD 3HZXA 4NW2A 2EYLA 4R4IA 1O80A 1YI2A 3PQIA 4XDXA 4Y7NH 3OOCA 4R8NA 2B63H 3URYA 4EQPA 1MKHA 4IFDJ 3TN2A 1B2TA 2E2JH 3CMAA 2XWBB 2K52A 3U58A 1SROA 1VQOA 2H5XA 4L8JA 2PZWA 2NVXH 1RTOA 4QMGA 5C4XG 4BA2I 1ICWA 1DYQA 3QO2A 1DJRD 2WKDA 3NTKA 4H02A 1G51A 1S72A 2NB0A 4JBMA 2KEDA 3S14B 1OXXK 1Y14B 1PZID 4LW1A 4ZCKA 3CPWA 3H3VC 1MHWC 1BDOA 4OGQC 4HCSA 3H0GG 5CBEE 1JOQA 1DONA 1PFMA 1X65A 5EJWA 4F7XA 3RUZA 2K75A 4A3BH 2D9UA 4GOPA 3D4WA 3I4NG 1BCPC 2Z4IA 1JC7A 3PIPA 2DN8A 4TRDA 2CWAA 3E6ZX 3UDXA 2L0CA 4QUCA 1Y8NB 4OHJA 1Z47A 2QKIC 2R7ZB 4LF5Q 4NKLA 1VQ8A 1RDPD 2NVTB 1SMYD 4UP9A 1DXMA 2BDNA 1TWCB 2EPBA 3I91A 5EPJA 3DEPA 1V1QA 1BNZA 4ZKCB 3D4RA 4JI0L 2H1EA 2RVLA 3I4MH 2CH4A 1A8VA 4G4KA 1JWMD 1UEBA 5C0XJ 1XNQL 5IYBH 1V1PB 3S1NB 3E0EA 3A0JA 3AMUA 4DAYB 1OXUA 1I6HB 2RDFA 1IBLQ 1GHJA 2B2UA 2WAQB 4K6DA 4X3KA 5EBCA 3KDFA 4NXMQ 4IQZA 2F0NA 1LTID 4GLVB 2AHOB 4G57A 4B3TL 2Z6KA 2EY5A 3J81E 1R9TH 3T51B 1STHA 1NTGA 1JE4A 4UHVA 2QEXA 3CW2C 1X3GA 2B3GA 1YJ9A 4AYBE 2ENBA 4RFBA 1PA6A 1GOZA 3CKIB 4FF1A 1IHZA 1WJJA 4KHPQ 1VCIA 5HURA 1SYFA 3J81i 4BBSB 1K0SA 4JI7L 4DAMA 3NK9A 3MHBA 3OWFA 1ICFB 3P1HA 2VZAA 2ID0A 3BDCA 3GV3A 2QW7A 4J1MA 1MIUA 3PUWA 3DUZA 4C3HG 3QOLA 4DV3Q 5GROA 1PYSB 2L11A 3Q24A 4X64L 3IFTA 1WTHA 3J7AF 5IT9c 4JI2Q 1EWHA 2PI2E 3A8IE 1EY7A 3GD7A 2JA9A 4DUZL 1KABA 1SMXA 1BR9A 1Y1WH 3HOYB 1CFMA 3MC0B 1BBUA 1ZYRC 3D8GA 4MN3A 5HGQA 2ZM6L 1JOKA 3NWTA 4YCWA 4IZ8A 3QWNA 1QNKA 2YTXA 4IALA 2KEEA 3STBC 3CC4A 1PH9A 1STAA 4JI6Q 1K0RA 4OIKA 3D4DA 3HKSA 4GKJQ 1QVCA 4HAEA 3NSWA 1VQCA 4KKTA 4IUQA 3HOVG 4B3SQ 1L0YB 3AYHB 3JC66 3KF6A 3KK7A 3H91A 4M8AA 4X62L 1HNXL 3GTLB 1QE6A 4C2MB 2B2TA 4C3JG 3HOWG 3RZOB 4JK1C 5CYUA 1N9WA 2OF1A 4EQNA 3CCJA 1SFOH 4DR6Q 1SYBA 1W3SA 2K5NA 1VQGA 1XXGA 2NN6I 2B2UC 3CF5A 1ENAA 4DR5L 4LF8L 3I4OA 2Z9HA 1EY9A 2C5CA 3T13A 1EZ6A 4EGVA 1CUKA 1YNJC 3FVQA 5C4HA 1XMQL 3OYYA 3ULLA 5IWAQ 4KTAA 4XQJA 3QJYA 2LS01 1VMCA 1Q7YC 1VQJA 4KY7A 1HR0Q 4DV0Q 3JAMc 1S4ZA 2VB2X 2ALYB 2A1AA 3KLSA 4A3IH 3S16B 1LM0A 1CKOA 3G6JB 3VR4A 1V8QA 4PNYA 4RMFA 2HCCA 1EYCA 3I7FA 5ELFA 5JEAG 2KA7A 3GTQB 3OSOA 4BY7G 1WYDA 5IT9E 3FRPB 3TS0A 5EQ0A 4LFBL 2EYJA 5HGTA 2YTYA 4WJ4A 1ESFA 2BOSA 2SOBA 4ALPA 3NHHA 3T1HL 2EDGA 3WDNA 3LWEA 2EZVA 1PRTF 4TSSA 2JA8G 4DR4L 3CAMA 4F87A 3KF8B 1FJGQ 4IUTA 5IYDG 2JEAI 2ATWA 1D6EC 2JA7H 3NEMA 3PUZA 2R7DA 1H9JA 3PV0A 3PO3G 1XPRA 2F0WA 2WB1G 1ZKOA 1F77A 1J6QA 1CM9A 1LTLA 2F4IA 2HIVA 2QDBA 2R93B 4Q5VA 4JI8Q 2KCMA 3DWAA 2NTTA 4K14A 4P72A 4YWMA 4DR2L 1WCMG 2XN9C 3X3NA 3PUXA 4GZYC 4H7BA 1X55A 3CC7A 3OIQA 1J8IA 1Q46A 5C4XB 2E2IH 1JICA 4LFAL 1F9SA 1M8AA 5M3FH 2AUKA 3CCUA 4DR3Q 2XVSA 3RMHA 1QILA 2B2TC 5BR8L 1WTWA 5GQOA 1SBBB 1Y1VH 1HUMA 5FLXE 3S1QH 2PZUA 3KJOA 5LMNQ 4ME5A 4ZKBB 3DM3A 5M3MG 1X3QA 3T16A 2AQ1B 3H0GB 3SK5A 2K5WA 5E1FA 1N32L 3U4VA 1EIGA 2WAQE 2HIXA 2AQ2B 4A3GG 4LFCQ 1DM0B 3JAME 3LNNA 3U4ZA 4RCOA 2FJ2A 1XTDA 2NWGA 1A2TA 3L2PA 1C9OA 3HOZG 4BS9A 2GVAA 4GLXA 1F2ZA 2EJMA 2CW0C 4X65Q 4Y52H 4CKBA 1SN8A 4ZAIA 4G7ZC 4L63B 3NQTA 4H44C 5T1GA 1SR3A 4C3IH 1M4VA 2NZ1D 3HFZB 3M85A 2MGSA 2F0UA 1PVOA 4DKAC 3NENA 5IT9L 1QZHA 1TS5A 1GVPA 2FFKB 1B70B 2IX0A 3S1MH 1X3PA 4RGNA 4GS3A 1YITA 2N49A 1AFPA 4JPBW 2VNUD 1BCPD 4JBWA 1WTOA 4A3EH 1E1OA 2YV5A 4DV4Q 3SK8A 3S17H 4DNTB 4HSVA 4MNOA 4A93H 3H09A 4OO1G 1TY0A 2DJGC 2E74C 2Z8LA 1HNZL 1X56A 1XNRQ 1SJED 2K5QA 5C5LA 1G6PA 1U4MA 2WACA 3NE5B 4R8IA 5DM63 5BN4A 2F0OA 4LF6L 4LF9L 1X54A 4RWSC 4XT1B 5IYCH 2UUAQ 1VQ6A 3OTOL 4XXEA 5A2QL 3UDIA 1IBKQ 3OMGA 5M5WB 4PV1C 1PYBA 3RLNA 4K0KL 1KL9A 3IRBA 2QILA 4JBJA 4AH6A 4AQYQ 2PI2A 3SK4A 4ZLTF 2QF7A 4BBRG 1XTCD 2A68C 4JW0A 2E2HH 5AJ3Q 2F1MA 3K6OA 5CV9A 1KDBA 3D0FA 5LL6S 2QGQA 3EJIA 3S24A 1FGBD 4C3HB 3CCVA 4DR1L 3GTPB 3M4OB 1EQRA 4A3FH 3E3XA 4WJWA 4BY1H 2RCNA 2VUMG 3NBHA 3RN2A 4B3MQ 5I2YA 3JAML 1N33L 4DV2Q 1EIHA 3TP8A 1ZEQX 4P74A 2CHBD 3F8TA 5EAYA 4GKKQ 4IFDI 3K58A 4QB4A 1K73C 3MXNA 3BZKA 4WJ3M 4JI4Q 4LUVA 5JJLA 5IP7H 5DEHA 4FXDA 1EIYB 2CCZA 1CT1D 2PMZB 2JA6B 1AE3A 3A55A 1WD0A 3NBIA 3L3OC 4KHVA 1AN8A 2AWNA 3BDLA 3E9HA 5IGGA 1LV9A 2IHEA 5E4XA 4P2CB 3G7LA 5IIFA 2PYKA 4POFA 1H9SB 4KY5A 4X66Q 3S14H 1HA5A 4I7ZC 1VF5C 5H1SE 4L5QA 3AB9A 4N8X1 5FJ8H 4A3LG 2RHSB 5GAGC 4JV5L 3VR2A 3VR5A 1ZYRD 2BA1A 1CK1A 1RKNA 2XSCA 3STBD 5CGKA 2G5DA 5BN3A 1WTRA 3ITPA 2KJXA 5FO9B 3K57A 1EY0A 2UXCL 2F4VQ 3K5NA 5EKLA 2DY8A 2R6GA 2KCTA 5D14A 3UE0A 4KMUC 2R7ZH 2K5VA 3OW7A 5C44B 3VYRA 4HTHA 4DNIA 2NVQB 3GV6A 2AQ3B 4ZYSA 4HEDA 2EXZA 4QL5A 1TIID 3T1YQ 3PMFA 3VYTA 1D5XC 2Q8RE 2J0TD 4DU9A 5ELCA 2KBNA 2KOLA 4A3KH 2G9DA 3DLLA 3HOYG 5J39A 1KC8C 5KYIA 1YNJD 3HGBA 4A3DG 4H0LC 3MTSA 2HCIA 4DV1L 1SNDA 2ZXPA 1KNEA 1D8LA 2O2LD 1FGUA 5C6AA 4CDEC 3GTKH 2EXDA 2JA8B 3R2IA 1TWGH 2OT2A 3I72A 4FVMA 1SNOA 3BJUA 4FF3A 4BXXH 3J7ZC 1YNXA 5ELOA 4UPAA 2XRSD 3PO3B 5K36G 2K33A 2B2YA 2FMMA 3EFXD 1CKNB 2WB1B 4A3CH 3FKIB 3ULJA 4XQNA 1MSGA 3MEHA 3DMUA 3I3CA 3TREA 1ASYA 1V1PA 1WCMB 4CJ0B 1SYCA 2F0GA 2EYPA 1ET6A 2B2WA 2Q8TA 1HNWL 4DAYA 4ZUJA 1PZJD 3DEOA
chains in the Genus database with same CATH topology
3F2DA 4MTNA 4JI5L 3J80c 4B3ML 1PH6A 2HT1A 4JI8L 3GDEA 1UEBA 1VQFA 4NXNL 1GM5A 1HNZQ 5C0XJ 1XNQL 5IYBH 3E0EA 3A0JA 1OXTA 2CKZB 2OTJA 4GKKL 4OWXB 2JEBI 1NE3A 4DAYB 1OXUA 4LF6Q 4LF9Q 1IBLQ 2MFIA 3ZJYC 2EIFA 4DK6C 2UUBQ 3OTOQ 3KDFA 2VQEL 4NXMQ 2YU9H 4OX9Q 2VY3A 3S15H 2Q2TA 3A5UA 5C3EH 4GLVB 4K0KQ 2EQSA 2AHOB 2LSSA 2I5LX 1JJCB 2GN5A 3L0OA 4AYBG 2Z6KA 4B3TL 4LFBQ 3RN5A 1R9TH 2OQKA 5LMNL 1Q82C 1NTGA 5C44H 3KDFB 5FLMG 4LF7Q 1QVFA 2QEXA 5DLQE 2NVQH 1N36Q 4A3JH 3CW2C 1X3GA 2B3GA 1YJ9A 1CKMA 4AYBE 2I0QA 1PA6A 1C0AA 1KAWA 4R1JA 3AFPA 4LFCL 1WJJA 3M7NA 4KHPQ 1VCIA 4DV7L 3J81i 2OCEA 4QQBX 4GN3B 4JI7L 4DAMA 3SGIA 3I2ZA 1UE7A 2ZJPA 4BA1I 4GLAC 4HIKA 3PO2G 3K0XA 2VL6A 4X65L 1N33Q 4DR7Q 1L1OA 2VZAA 2ID0A 4A3KG 4BBRH 1MIUA 1Z9FA 1X3EA 3PUWA 3CCQA 4A3EG 2F4VL 1CSQA 3PCOB 4DV3Q 3J81j 5GROA 1PYSB 4DV6L 1VQEA 4X64L 3HOXH 3RR5A 2OWOA 4GNXA 2ZTCA 1QVGA 3ULPA 5IT9c 4JI2Q 4LUOA 1WOCA 2PI2E 3GD7A 4A93G 2UXDQ 2JA9A 1I94Q 3PUYA 3G71A 2QA4A 4DUZL 1NBWA 1N8RC 1SMXA 1L1OB 4GN5A 1WI5A 2R7FA 4IOCA 1Y1WH 1ASZA 5BR8Q 2R93G 1BBUA 2PNHA 5LMUL 3W1GA 4LWCA 5HGQA 2D0OA 3PO3H 4GNXB 1S40A 3UDFA 2ZM6L 1VQ7A 2ZJQA 4YCWA 5IYCG 4LNQA 2PQAB 4JI3Q 2YTXA 3FKIH 2VQFL 2NVTH 2L15A 3STBC 3W1BA 3CC4A 1TWCH 1PH9A 4OO1I 2YYZA 1V9PA 4JI6Q 1K0RA 3M4PA 4GKJQ 3FP9A 2CFMA 3HKSA 1WCMH 5IP9G 1J5EL 1QVCA 1I50H 1VQCA 3KLWA 3AFQA 3HOVG 4B3SQ 4JV5Q 3K80C 1IXRA 3GTGH 3AYHB 4DK3C 2D0PA 1DGSA 3JC66 3KF6A 5J3BA 5JJKA 1XNRL 3GTQH 1JE5A 1G291 4DV5Q 4X62L 1HNXL 4L5SA 4JCVE 3S1NH 1VQ5A 1BVSA 4A75A 3HOWG 1IYJB 2BH2A 2UUAL 5C0XI 4DR6Q 1N9WA 3CCJA 1SFOH 1I6HH 1Q86C 1OXSC 5IYBG 1VQDA 1W3SA 1VQ4A 2K5NA 3S2HH 3KYHC 4A3FG 1VQGA 2NN6I 4BY1G 1IBKL 4LF5L 1O7IA 3CF5A 4DR5L 3CCLA 4LF8L 3I4OA 1PFSA 4A3LH 4MZ9A 1K9MC 2JQOA 1CUKA 3I55A 4HIDA 5AJ3L 4R4OA 2ZJRA 4A3GH 2ASBA 4PZ6A 1XMQL 1C7YA 3OYYA 2LXKA 3ULLA 4HJ5A 5IWAQ 1K8AC 2Q2IA 3M3YH 1YVCA 1Q7YC 1VQJA 1HR0Q 1E22A 5IP7G 4DV0Q 4XIGS 3JAMc 4A3JG 3CD6A 1H95A 2ALYB 3OW2A 2A1AA 4IPCA 3HOUH 1YBYA 4A3IH 4BBSH 1JB7A 2V1CC 1LM0A 2XTIA 2ZTEA 1I3QH 1CKOA 5GAHC 3CP0A 3EIVA 2I5HA 3RLFA 4RMFA 3I7FA 5JEAG 1HR0W 2ES2A 1A0IA 4IOAA 4DV2L 2D62A 2E5LQ 2R92G 3E9IA 4JOIA 1N34Q 1KRSA 1FVIA 4OX9L 2JA5H 4PMWA 2OTLA 2WP8J 3GTMH 1AE2A 4BY7G 1WYDA 2HQLA 4NB3A 2IY5B 1L1OC 3TS0A 2IHFA 5FJ8G 1JJ2A 5M5YH 4LFBL 1VQIA 4QJFA 1VQPA 1PH2A 2YTYA 4JI4L 1HJPA 4WJ4A 3UDGA 1UWVA 2BH8A 4ALPA 1YZ6A 2B63G 3T1HL 1B7YB 1TXYA 2KHIA 3HOYH 1W2BA 2JA8G 4IO9A 4DR4L 4A4IA 1CSPA 3H0GH 3CAMA 3TS2A 3KF8B 1FJGQ 5IYDG 2JEAI 4HIMA 4AIMA 2ATWA 1EWIA 1HZBA 4X66L 3MEFA 2JA7H 2N78A 3A5ZB 3NEMA 2R7DA 3PUZA 2HHHL 3PV0A 4JYAQ 1VQ9A 2AKWB 4DUYQ 3PO3G 1XPRA 2UUCL 3A74A 3PIOA 3I4NH 1VQNA 2R7ZG 2WB1G 2Q2UA 4JI5Q 1J6QA 1LTLA 2HIVA 4QGUA 4JI8Q 1LUZA 2KCMA 5C4JH 4DR1Q 4NXNQ 1MJCA 4P72A 1P8LA 4YWMA 4DR2L 1XNQQ 2CWPA 1Q1EA 1PH5A 1WCMG 3FHWA 3PUXA 2WB1E 2Y0SG 3BZCA 4YHHL 1X55A 3CC7A 1PH7A 4OWWB 1Q46A 4JI2L 1EIFA 1HH2P 3GTLH 2E2IH 4LFAL 2K4KA 2N8NA 4C2MH 5M3FH 1XPOA 1VQKA 3CCUA 1SRUA 2N3SA 2VQEQ 4R4CA 4DR3Q 2UXBQ 3RZOH 5BR8L 4JC0A 1PH4A 2KHJA 2Y0SE 1E24A 3WWVA 1YIJA 3G4SA 5GQOA 2UU9L 1Y1VH 5E7NA 3F2CA 3MXNB 4B3TQ 3HKZG 3TQYA 2MNAA 3S1QH 2PQAA 4PG3A 3KJOA 5LMNQ 1B8AA 2WAQG 4GOPC 4A3MG 3DM3A 5M3MG 1LYLA 4IFDG 4A3BG 1VQAA 1UE1A 4B3RQ 3HKZE 3T1YL 3PSIA 2DGYA 1XMOL 3CC2A 1N32L 1KXLA 1JT8A 3U4VA 4JI1Q 2VUMH 1KD1C 3KOJA 4B3SL 3ERSX 2WAQE 2HIXA 4BXXG 5LMNW 4A3GG 4LFCQ 3CCEA 1V43A 3U4ZA 4DV7Q 1IBML 3GTJH 1XTDA 3CCSA 4JI7Q 4X6AH 2OQ0A 1YHQA 2MO1A 1NMFA 1P16A 3PGZA 3L2PA 3I56A 4A3CG 1E1TA 1C9OA 3CMEA 1EFWA 2JA6G 3NELA 4EQ5A 3HOZG 3S16H 3K81C 2GVAA 4LUZA 4GLXA 4X65Q 4Y52H 3L7ZC 1EYGA 1SN8A 5FLMH 3I4MG 3PF4A 3HOUG 3D31A 4BBSG 2PMZE 4DV6Q 4X64Q 1E3PA 3B6YA 5M5WH 4JOIC 2C35B 1SR3A 4C3IH 1M90C 4UP8A 3HFZB 3M85A 4KI0A 4YY3L 3J80i 2K14A 4DUZQ 1PH1A 3J81c 1YEZA 1PVOA 4HJ9A 1KHIA 1A63A 4DKAC 2UXCQ 1L2FA 1D7QA 3NENA 1YJWA 3GO5A 4OXPA 1QZHA 1GVPA 1NJIC 2BA0A 2NZHA 3F1ZA 1B70B 3LGJA 2IX0A 4FDBA 2ZM6Q 3S1MH 1YITA 4GS3A 4L5RC 3TEHB 3PO2H 2N49A 2VQFQ 2VNUD 4JBWA 5IY0A 2F52A 4QY7A 4DV0L 4A3EH 1M1KC 1E1OA 3M4OH 2YV5A 3KFUA 5C3EG 2Z6KC 4PZ7A 3PF5A 4DV4Q 1J5EQ 3ICEA 1VS0A 2VS1A 3S17H 2IT1A 4MNOA 4A93H 1TWAH 4OO1G 1EOVA 2JK8A 4DPGA 4OWTB 4POGA 1N34L 4K0KL 5C44G 1HNZL 1E7ZA 1T9HA 1X56A 1XNRQ 3H3VH 2R93H 1BBWA 2NVYH 1EQQA 4O2DA 2NZOA 4X62Q 1HNXQ 3BU2A 1PH8A 4R4TA 1G6PA 1FL0A 4J15A 1KRTA 1HZ9A 5HY6A 3CPFA 1GD7A 2GVBA 4LF6L 1IBLL 1X54A 4LF9L 2UUAQ 5IYCH 1VQ6A 4A76A 4DV1Q 2UUBL 3OTOL 5C4XH 4NXML 4YWKA 2I5MX 2MO0A 4O0AA 3M9BA 1VQHA 3UDIA 1IBKQ 1EUJA 1PYBA 3EBEA 3RLNA 2E8GA 1KL9A 3IRBA 5IP9H 5C0XG 1SE8A 4DR5Q 4LF8Q 4JBJA 4AH6A 4HIOA 4AQYQ 2PI2A 5M3FG 3HOVH 2VW9A 4LF4Q 2NN6G 4BBRG 2E2HH 2FXQA 5AJ3Q 4GNXC 4LF7L 1N36L 3RZDH 3PUVA 2K5HA 5JEAJ 3HOXG 4DUYL 5JJIA 1XMQQ 2F3IA 3K7AH 1K3RA 3RLOA 1KIXA 3D0FA 4C3JH 1RL2A 1NY4A 3HOWH 3CCRA 4A3DH 2QGQA 3M4QA 3S24A 3CCVA 4KHPL 2JE6I 4DR1L 1PH3A 1Y1WG 1EQRA 3ER0A 4A3FH 1YHBA 4BY1H 4JI0Q 1BKBA 2JJQA 2RCNA 1HNWQ 2VUMG 4JG2A 2DUDA 2LXJA 3RN2A 3H15A 1PV4A 4B3MQ 3FKIG 3Q8DA 4L5TA 1N33L 4DR3L 4DV2Q 4DR7L 2UXBL 2AMCB 4P74A 3S1RH 1A62A 2Q2HA 1TWHH 3K8AA 4DV3L 3F8TA 4UP7A 5EAYA 2CQOA 2Z0SA 4IJHA 3H3VI 4GKKQ 4IFDI 1K73C 1UE5A 1PHJA 2A8VA 3CCMA 3BZKA 4WJ3M 2UXDL 3NBHB 1X3FA 4ME3A 1I94L 4JI4Q 4IPHA 4LUVA 1UE6A 4HJ8A 5JJLA 5IP7H 3KJPA 3T1HQ 1EIYB 2RF4A 3GTOH 2CCZA 4B3RL 1KQSA 4XTCS 5GAEC 1AE3A 4NPSA 4JI1L 4DR4Q 3G6EA 1YHAA 4JI3L 2AWNA 3E9HA 2IHEA 2R92H 4POFA 4TVAB 4X66Q 1Q1BA 3RNUA 3VDYA 1RIPA 4P75A 2HHHQ 4JI6L 2IX1A 3S14H 1X9NA 4BY7H 5H1SE 4GKJL 1SLJA 4L5QA 2K50A 2UUCQ 5FJ8H 2XGTA 1U5KA 4A3LG 2RHSB 4R4IA 5GAGC 4JV5L 4P73A 1YI2A 4JBKA 4Y7NH 4DR2Q 1Q81C 5ELNA 1QZGA 1U0LA 4DV5L 2B63H 2WFWA 1NMGA 1L0WA 2YTVA 2BA1A 3STBD 4YHHQ 1Q12A 4YWLA 1MKHA 2JA8H 4LFAQ 3W5OA 4DR6L 4IFDJ 4TQUS 1X6OA 5IYDH 4EX5A 2E2JH 3CMAA 2UXCL 1HZCA 2F4VQ 2K52A 5IE8A 3JAMi 3AQQA 3U58A 2R6GA 4A3IG 4YCVA 1SROA 2KCTA 4IJLA 3CXCA 1VQOA 3UE0A 2UU9Q 2H5XA 1JMCA 4KHZA 2NVXH 2K5VA 2R7ZH 1MJEA 5GADC 2B29A 4DNIA 5C4XG 2JA5G 1QUQA 4BA2I 1XJVA 4DV4L 4QL5A 3F2BA 3T1YQ 1N32Q 4H02A 4QIWE 5LMUQ 1XMOQ 1VQLA 4OONA 1G51A 1S72A 5IWAL 4JBMA 4YCUA 1GO3E 1HR0L 2KBNA 1IBMQ 1OXXK 4A3KH 1Y14B 2AWOA 4C3HH 1TWFH 1QUQB 4LW1A 3GTPH 3DLLA 3CPWA 3HOYG 1S3OA 3UE1A 1XPUA 1KC8C 1AH9A 4IPGA 3H0GG 4A3DG 1OTCA 4DV1L 2E5LL 3G48A 1X65A 3EN2A 1D8LA 3KF6B 4A3MH 5M3MH 2JA7G 1FGUA 4HJAA 4PZ8A 2K75A 2EXDA 3GTKH 1CKNA 4A3BH 4GOPA 2A19A 2KENA 3I4NG 4AQYL 4HJ7A 4UY8C 1YJNA 3U50C 3PIPA 1TWGH 3CQZH 3BJUA 4APVA 4YY3Q 4LF4L 4BXXH 2CWAA 4RG1A 1YNXA 3UDXA 5FLXc 3J7ZC 1IL2A 2RHQB 3TRZA 5ELOA 2ZTDA 4UPAA 1I5FA 1K83H 4GN4B 5K36G 3AEVA 1Z47A 2MQHA 4R4QA 3J7A5 4LF5Q 1CKNB 1VQBA 4GOPB 4KLKA 4A3CH 1VQ8A 1VQMA 3ULJA 4P71A 5M5XH 2JA6H 4UP9A 3HOZH 1JJGA 1WFQA 1FJGL 1GKHA 1V1QA 3S2DH 4IPDA 1HZAA 3TREA 1ASYA 4JI0L 1Q8KA 3I4MH 1K8GA 3K7UC 4JYAL 1HNWL 1A8VA 1Y1VG 1OXVA 1IZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2D A;  4MTN A;  4JI5 L;  3J80 c;  4B3M L;  1PH6 A;  2HT1 A;  4JI8 L;  3GDE A;  1UEB A;  1VQF A;  4NXN L;  1GM5 A;  1HNZ Q;  5C0X J;  1XNQ L;  5IYB H;  3E0E A;  3A0J A;  1OXT A;  2CKZ B;  2OTJ A;  4GKK L;  4OWX B;  2JEB I;  1NE3 A;  4DAY B;  1OXU A;  4LF6 Q;  4LF9 Q;  1IBL Q;  2MFI A;  3ZJY C;  2EIF A;  4DK6 C;  2UUB Q;  3OTO Q;  3KDF A;  2VQE L;  4NXM Q;  2YU9 H;  4OX9 Q;  2VY3 A;  3S15 H;  2Q2T A;  3A5U A;  5C3E H;  4GLV B;  4K0K Q;  2EQS A;  2AHO B;  2LSS A;  2I5L X;  1JJC B;  2GN5 A;  3L0O A;  4AYB G;  2Z6K A;  4B3T L;  4LFB Q;  3RN5 A;  1R9T H;  2OQK A;  5LMN L;  1Q82 C;  1NTG A;  5C44 H;  3KDF B;  5FLM G;  4LF7 Q;  1QVF A;  2QEX A;  5DLQ E;  2NVQ H;  1N36 Q;  4A3J H;  3CW2 C;  1X3G A;  2B3G A;  1YJ9 A;  1CKM A;  4AYB E;  2I0Q A;  1PA6 A;  1C0A A;  1KAW A;  4R1J A;  3AFP A;  4LFC L;  1WJJ A;  3M7N A;  4KHP Q;  1VCI A;  4DV7 L;  3J81 i;  2OCE A;  4QQB X;  4GN3 B;  4JI7 L;  4DAM A;  3SGI A;  3I2Z A;  1UE7 A;  2ZJP A;  4BA1 I;  4GLA C;  4HIK A;  3PO2 G;  3K0X A;  2VL6 A;  4X65 L;  1N33 Q;  4DR7 Q;  1L1O A;  2VZA A;  2ID0 A;  4A3K G;  4BBR H;  1MIU A;  1Z9F A;  1X3E A;  3PUW A;  3CCQ A;  4A3E G;  2F4V L;  1CSQ A;  3PCO B;  4DV3 Q;  3J81 j;  5GRO A;  1PYS B;  4DV6 L;  1VQE A;  4X64 L;  3HOX H;  3RR5 A;  2OWO A;  4GNX A;  2ZTC A;  1QVG A;  3ULP A;  5IT9 c;  4JI2 Q;  4LUO A;  1WOC A;  2PI2 E;  3GD7 A;  4A93 G;  2UXD Q;  2JA9 A;  1I94 Q;  3PUY A;  3G71 A;  2QA4 A;  4DUZ L;  1NBW A;  1N8R C;  1SMX A;  1L1O B;  4GN5 A;  1WI5 A;  2R7F A;  4IOC A;  1Y1W H;  1ASZ A;  5BR8 Q;  2R93 G;  1BBU A;  2PNH A;  5LMU L;  3W1G A;  4LWC A;  5HGQ A;  2D0O A;  3PO3 H;  4GNX B;  1S40 A;  3UDF A;  2ZM6 L;  1VQ7 A;  2ZJQ A;  4YCW A;  5IYC G;  4LNQ A;  2PQA B;  4JI3 Q;  2YTX A;  3FKI H;  2VQF L;  2NVT H;  2L15 A;  3STB C;  3W1B A;  3CC4 A;  1TWC H;  1PH9 A;  4OO1 I;  2YYZ A;  1V9P A;  4JI6 Q;  1K0R A;  3M4P A;  4GKJ Q;  3FP9 A;  2CFM A;  3HKS A;  1WCM H;  5IP9 G;  1J5E L;  1QVC A;  1I50 H;  1VQC A;  3KLW A;  3AFQ A;  3HOV G;  4B3S Q;  4JV5 Q;  3K80 C;  1IXR A;  3GTG H;  3AYH B;  4DK3 C;  2D0P A;  1DGS A;  3JC6 6;  3KF6 A;  5J3B A;  5JJK A;  1XNR L;  3GTQ H;  1JE5 A;  1G29 1;  4DV5 Q;  4X62 L;  1HNX L;  4L5S A;  4JCV E;  3S1N H;  1VQ5 A;  1BVS A;  4A75 A;  3HOW G;  1IYJ B;  2BH2 A;  2UUA L;  5C0X I;  4DR6 Q;  1N9W A;  3CCJ A;  1SFO H;  1I6H H;  1Q86 C;  1OXS C;  5IYB G;  1VQD A;  1W3S A;  1VQ4 A;  2K5N A;  3S2H H;  3KYH C;  4A3F G;  1VQG A;  2NN6 I;  4BY1 G;  1IBK L;  4LF5 L;  1O7I A;  3CF5 A;  4DR5 L;  3CCL A;  4LF8 L;  3I4O A;  1PFS A;  4A3L H;  4MZ9 A;  1K9M C;  2JQO A;  1CUK A;  3I55 A;  4HID A;  5AJ3 L;  4R4O A;  2ZJR A;  4A3G H;  2ASB A;  4PZ6 A;  1XMQ L;  1C7Y A;  3OYY A;  2LXK A;  3ULL A;  4HJ5 A;  5IWA Q;  1K8A C;  2Q2I A;  3M3Y H;  1YVC A;  1Q7Y C;  1VQJ A;  1HR0 Q;  1E22 A;  5IP7 G;  4DV0 Q;  4XIG S;  3JAM c;  4A3J G;  3CD6 A;  1H95 A;  2ALY B;  3OW2 A;  2A1A A;  4IPC A;  3HOU H;  1YBY A;  4A3I H;  4BBS H;  1JB7 A;  2V1C C;  1LM0 A;  2XTI A;  2ZTE A;  1I3Q H;  1CKO A;  5GAH C;  3CP0 A;  3EIV A;  2I5H A;  3RLF A;  4RMF A;  3I7F A;  5JEA G;  1HR0 W;  2ES2 A;  1A0I A;  4IOA A;  4DV2 L;  2D62 A;  2E5L Q;  2R92 G;  3E9I A;  4JOI A;  1N34 Q;  1KRS A;  1FVI A;  4OX9 L;  2JA5 H;  4PMW A;  2OTL A;  2WP8 J;  3GTM H;  1AE2 A;  4BY7 G;  1WYD A;  2HQL A;  4NB3 A;  2IY5 B;  1L1O C;  3TS0 A;  2IHF A;  5FJ8 G;  1JJ2 A;  5M5Y H;  4LFB L;  1VQI A;  4QJF A;  1VQP A;  1PH2 A;  2YTY A;  4JI4 L;  1HJP A;  4WJ4 A;  3UDG A;  1UWV A;  2BH8 A;  4ALP A;  1YZ6 A;  2B63 G;  3T1H L;  1B7Y B;  1TXY A;  2KHI A;  3HOY H;  1W2B A;  2JA8 G;  4IO9 A;  4DR4 L;  4A4I A;  1CSP A;  3H0G H;  3CAM A;  3TS2 A;  3KF8 B;  1FJG Q;  5IYD G;  2JEA I;  4HIM A;  4AIM A;  2ATW A;  1EWI A;  1HZB A;  4X66 L;  3MEF A;  2JA7 H;  2N78 A;  3A5Z B;  3NEM A;  2R7D A;  3PUZ A;  2HHH L;  3PV0 A;  4JYA Q;  1VQ9 A;  2AKW B;  4DUY Q;  3PO3 G;  1XPR A;  2UUC L;  3A74 A;  3PIO A;  3I4N H;  1VQN A;  2R7Z G;  2WB1 G;  2Q2U A;  4JI5 Q;  1J6Q A;  1LTL A;  2HIV A;  4QGU A;  4JI8 Q;  1LUZ A;  2KCM A;  5C4J H;  4DR1 Q;  4NXN Q;  1MJC A;  4P72 A;  1P8L A;  4YWM A;  4DR2 L;  1XNQ Q;  2CWP A;  1Q1E A;  1PH5 A;  1WCM G;  3FHW A;  3PUX A;  2WB1 E;  2Y0S G;  3BZC A;  4YHH L;  1X55 A;  3CC7 A;  1PH7 A;  4OWW B;  1Q46 A;  4JI2 L;  1EIF A;  1HH2 P;  3GTL H;  2E2I H;  4LFA L;  2K4K A;  2N8N A;  4C2M H;  5M3F H;  1XPO A;  1VQK A;  3CCU A;  1SRU A;  2N3S A;  2VQE Q;  4R4C A;  4DR3 Q;  2UXB Q;  3RZO H;  5BR8 L;  4JC0 A;  1PH4 A;  2KHJ A;  2Y0S E;  1E24 A;  3WWV A;  1YIJ A;  3G4S A;  5GQO A;  2UU9 L;  1Y1V H;  5E7N A;  3F2C A;  3MXN B;  4B3T Q;  3HKZ G;  3TQY A;  2MNA A;  3S1Q H;  2PQA A;  4PG3 A;  3KJO A;  5LMN Q;  1B8A A;  2WAQ G;  4GOP C;  4A3M G;  3DM3 A;  5M3M G;  1LYL A;  4IFD G;  4A3B G;  1VQA A;  1UE1 A;  4B3R Q;  3HKZ E;  3T1Y L;  3PSI A;  2DGY A;  1XMO L;  3CC2 A;  1N32 L;  1KXL A;  1JT8 A;  3U4V A;  4JI1 Q;  2VUM H;  1KD1 C;  3KOJ A;  4B3S L;  3ERS X;  2WAQ E;  2HIX A;  4BXX G;  5LMN W;  4A3G G;  4LFC Q;  3CCE A;  1V43 A;  3U4Z A;  4DV7 Q;  1IBM L;  3GTJ H;  1XTD A;  3CCS A;  4JI7 Q;  4X6A H;  2OQ0 A;  1YHQ A;  2MO1 A;  1NMF A;  1P16 A;  3PGZ A;  3L2P A;  3I56 A;  4A3C G;  1E1T A;  1C9O A;  3CME A;  1EFW A;  2JA6 G;  3NEL A;  4EQ5 A;  3HOZ G;  3S16 H;  3K81 C;  2GVA A;  4LUZ A;  4GLX A;  4X65 Q;  4Y52 H;  3L7Z C;  1EYG A;  1SN8 A;  5FLM H;  3I4M G;  3PF4 A;  3HOU G;  3D31 A;  4BBS G;  2PMZ E;  4DV6 Q;  4X64 Q;  1E3P A;  3B6Y A;  5M5W H;  4JOI C;  2C35 B;  1SR3 A;  4C3I H;  1M90 C;  4UP8 A;  3HFZ B;  3M85 A;  4KI0 A;  4YY3 L;  3J80 i;  2K14 A;  4DUZ Q;  1PH1 A;  3J81 c;  1YEZ A;  1PVO A;  4HJ9 A;  1KHI A;  1A63 A;  4DKA C;  2UXC Q;  1L2F A;  1D7Q A;  3NEN A;  1YJW A;  3GO5 A;  4OXP A;  1QZH A;  1GVP A;  1NJI C;  2BA0 A;  2NZH A;  3F1Z A;  1B70 B;  3LGJ A;  2IX0 A;  4FDB A;  2ZM6 Q;  3S1M H;  1YIT A;  4GS3 A;  4L5R C;  3TEH B;  3PO2 H;  2N49 A;  2VQF Q;  2VNU D;  4JBW A;  5IY0 A;  2F52 A;  4QY7 A;  4DV0 L;  4A3E H;  1M1K C;  1E1O A;  3M4O H;  2YV5 A;  3KFU A;  5C3E G;  2Z6K C;  4PZ7 A;  3PF5 A;  4DV4 Q;  1J5E Q;  3ICE A;  1VS0 A;  2VS1 A;  3S17 H;  2IT1 A;  4MNO A;  4A93 H;  1TWA H;  4OO1 G;  1EOV A;  2JK8 A;  4DPG A;  4OWT B;  4POG A;  1N34 L;  4K0K L;  5C44 G;  1HNZ L;  1E7Z A;  1T9H A;  1X56 A;  1XNR Q;  3H3V H;  2R93 H;  1BBW A;  2NVY H;  1EQQ A;  4O2D A;  2NZO A;  4X62 Q;  1HNX Q;  3BU2 A;  1PH8 A;  4R4T A;  1G6P A;  1FL0 A;  4J15 A;  1KRT A;  1HZ9 A;  5HY6 A;  3CPF A;  1GD7 A;  2GVB A;  4LF6 L;  1IBL L;  1X54 A;  4LF9 L;  2UUA Q;  5IYC H;  1VQ6 A;  4A76 A;  4DV1 Q;  2UUB L;  3OTO L;  5C4X H;  4NXM L;  4YWK A;  2I5M X;  2MO0 A;  4O0A A;  3M9B A;  1VQH A;  3UDI A;  1IBK Q;  1EUJ A;  1PYB A;  3EBE A;  3RLN A;  2E8G A;  1KL9 A;  3IRB A;  5IP9 H;  5C0X G;  1SE8 A;  4DR5 Q;  4LF8 Q;  4JBJ A;  4AH6 A;  4HIO A;  4AQY Q;  2PI2 A;  5M3F G;  3HOV H;  2VW9 A;  4LF4 Q;  2NN6 G;  4BBR G;  2E2H H;  2FXQ A;  5AJ3 Q;  4GNX C;  4LF7 L;  1N36 L;  3RZD H;  3PUV A;  2K5H A;  5JEA J;  3HOX G;  4DUY L;  5JJI A;  1XMQ Q;  2F3I A;  3K7A H;  1K3R A;  3RLO A;  1KIX A;  3D0F A;  4C3J H;  1RL2 A;  1NY4 A;  3HOW H;  3CCR A;  4A3D H;  2QGQ A;  3M4Q A;  3S24 A;  3CCV A;  4KHP L;  2JE6 I;  4DR1 L;  1PH3 A;  1Y1W G;  1EQR A;  3ER0 A;  4A3F H;  1YHB A;  4BY1 H;  4JI0 Q;  1BKB A;  2JJQ A;  2RCN A;  1HNW Q;  2VUM G;  4JG2 A;  2DUD A;  2LXJ A;  3RN2 A;  3H15 A;  1PV4 A;  4B3M Q;  3FKI G;  3Q8D A;  4L5T A;  1N33 L;  4DR3 L;  4DV2 Q;  4DR7 L;  2UXB L;  2AMC B;  4P74 A;  3S1R H;  1A62 A;  2Q2H A;  1TWH H;  3K8A A;  4DV3 L;  3F8T A;  4UP7 A;  5EAY A;  2CQO A;  2Z0S A;  4IJH A;  3H3V I;  4GKK Q;  4IFD I;  1K73 C;  1UE5 A;  1PHJ A;  2A8V A;  3CCM A;  3BZK A;  4WJ3 M;  2UXD L;  3NBH B;  1X3F A;  4ME3 A;  1I94 L;  4JI4 Q;  4IPH A;  4LUV A;  1UE6 A;  4HJ8 A;  5JJL A;  5IP7 H;  3KJP A;  3T1H Q;  1EIY B;  2RF4 A;  3GTO H;  2CCZ A;  4B3R L;  1KQS A;  4XTC S;  5GAE C;  1AE3 A;  4NPS A;  4JI1 L;  4DR4 Q;  3G6E A;  1YHA A;  4JI3 L;  2AWN A;  3E9H A;  2IHE A;  2R92 H;  4POF A;  4TVA B;  4X66 Q;  1Q1B A;  3RNU A;  3VDY A;  1RIP A;  4P75 A;  2HHH Q;  4JI6 L;  2IX1 A;  3S14 H;  1X9N A;  4BY7 H;  5H1S E;  4GKJ L;  1SLJ A;  4L5Q A;  2K50 A;  2UUC Q;  5FJ8 H;  2XGT A;  1U5K A;  4A3L G;  2RHS B;  4R4I A;  5GAG C;  4JV5 L;  4P73 A;  1YI2 A;  4JBK A;  4Y7N H;  4DR2 Q;  1Q81 C;  5ELN A;  1QZG A;  1U0L A;  4DV5 L;  2B63 H;  2WFW A;  1NMG A;  1L0W A;  2YTV A;  2BA1 A;  3STB D;  4YHH Q;  1Q12 A;  4YWL A;  1MKH A;  2JA8 H;  4LFA Q;  3W5O A;  4DR6 L;  4IFD J;  4TQU S;  1X6O A;  5IYD H;  4EX5 A;  2E2J H;  3CMA A;  2UXC L;  1HZC A;  2F4V Q;  2K52 A;  5IE8 A;  3JAM i;  3AQQ A;  3U58 A;  2R6G A;  4A3I G;  4YCV A;  1SRO A;  2KCT A;  4IJL A;  3CXC A;  1VQO A;  3UE0 A;  2UU9 Q;  2H5X A;  1JMC A;  4KHZ A;  2NVX H;  2K5V A;  2R7Z H;  1MJE A;  5GAD C;  2B29 A;  4DNI A;  5C4X G;  2JA5 G;  1QUQ A;  4BA2 I;  1XJV A;  4DV4 L;  4QL5 A;  3F2B A;  3T1Y Q;  1N32 Q;  4H02 A;  4QIW E;  5LMU Q;  1XMO Q;  1VQL A;  4OON A;  1G51 A;  1S72 A;  5IWA L;  4JBM A;  4YCU A;  1GO3 E;  1HR0 L;  2KBN A;  1IBM Q;  1OXX K;  4A3K H;  1Y14 B;  2AWO A;  4C3H H;  1TWF H;  1QUQ B;  4LW1 A;  3GTP H;  3DLL A;  3CPW A;  3HOY G;  1S3O A;  3UE1 A;  1XPU A;  1KC8 C;  1AH9 A;  4IPG A;  3H0G G;  4A3D G;  1OTC A;  4DV1 L;  2E5L L;  3G48 A;  1X65 A;  3EN2 A;  1D8L A;  3KF6 B;  4A3M H;  5M3M H;  2JA7 G;  1FGU A;  4HJA A;  4PZ8 A;  2K75 A;  2EXD A;  3GTK H;  1CKN A;  4A3B H;  4GOP A;  2A19 A;  2KEN A;  3I4N G;  4AQY L;  4HJ7 A;  4UY8 C;  1YJN A;  3U50 C;  3PIP A;  1TWG H;  3CQZ H;  3BJU A;  4APV A;  4YY3 Q;  4LF4 L;  4BXX H;  2CWA A;  4RG1 A;  1YNX A;  3UDX A;  5FLX c;  3J7Z C;  1IL2 A;  2RHQ B;  3TRZ A;  5ELO A;  2ZTD A;  4UPA A;  1I5F A;  1K83 H;  4GN4 B;  5K36 G;  3AEV A;  1Z47 A;  2MQH A;  4R4Q A;  3J7A 5;  4LF5 Q;  1CKN B;  1VQB A;  4GOP B;  4KLK A;  4A3C H;  1VQ8 A;  1VQM A;  3ULJ A;  4P71 A;  5M5X H;  2JA6 H;  4UP9 A;  3HOZ H;  1JJG A;  1WFQ A;  1FJG L;  1GKH A;  1V1Q A;  3S2D H;  4IPD A;  1HZA A;  3TRE A;  1ASY A;  4JI0 L;  1Q8K A;  3I4M H;  1K8G A;  3K7U C;  4JYA L;  1HNW L;  1A8V A;  1Y1V G;  1OXV A;  1IZ6 A; 
#chains in the Genus database with same CATH topology
 3J80 c;  4JI5 L;  5C4Z A;  4CBV A;  4UDU C;  4KJN A;  3BVZ A;  2OTJ A;  4OWX B;  2JEB I;  1NR2 A;  1H9K A;  1PTO H;  2MFI A;  4DK6 C;  5M3M B;  2VQE L;  3HS0 C;  2YU9 H;  1SAP A;  2VY3 A;  3A5U A;  2EYF A;  4TKO B;  5C3E H;  3D6C A;  2EQS A;  2M9V A;  4PQX A;  3MFG A;  2I5L X;  2XRQ D;  3RN5 A;  2B2V A;  1JB3 A;  1W6J A;  5FLM G;  5I6W A;  5DLQ E;  3L9A X;  4A3J H;  1CKM A;  3ZYY X;  2I0Q A;  1FR3 A;  1Q3L A;  3VA7 A;  3HOZ B;  1HFG A;  1KAW A;  3I4L A;  3KBG A;  1DCZ A;  1STY A;  1O78 A;  5L37 A;  4DV7 L;  1D5M C;  1Z6H A;  1X32 A;  4RKB A;  1I3Q B;  2PNR C;  1KTK A;  4KKU A;  4CGY B;  4GLA C;  1ILQ A;  4HIK A;  4DR7 Q;  1Z9F A;  1X3E A;  1CZG A;  1NAP A;  3PCO B;  1SYE A;  3J81 j;  5KYL A;  1VQE A;  3HOX H;  1TS2 A;  2ZTC A;  3ULP A;  4LUO A;  2UXD Q;  1I94 Q;  2IPK D;  2SNM A;  4RGO S;  3G71 A;  2QA4 A;  1N8R C;  2K04 A;  3S15 B;  4GN5 A;  1WI5 A;  5FO7 B;  2R93 G;  5T1I A;  1ENC A;  2CW0 D;  2PNH A;  2L12 A;  2F0P A;  4LK1 C;  4LWC A;  4GNX B;  1S40 A;  3UDF A;  1VQ7 A;  3TZU A;  2ZJQ A;  4LNQ A;  2PQA B;  2B2Y C;  2VQF L;  2O5I C;  2L15 A;  4QF4 A;  5EKI A;  3W1B A;  1H9R A;  4OO1 I;  1WTQ A;  3M4P A;  3J80 E;  1CHQ D;  1AZP A;  1F9R A;  1LO5 D;  3C1F A;  3TP5 A;  3GTG H;  5G3L D;  1LAB A;  2D0P A;  1DGS A;  2Z4H A;  3VYS A;  4DK3 C;  5JJK A;  1IKM A;  3D3R A;  3GTQ H;  1JE5 A;  2HDM A;  5JPN C;  5I9P A;  4JCV E;  3T56 B;  1JOR A;  1JWU D;  5KEE A;  2BH2 A;  4BBR B;  1A3U A;  4WFN 3;  2JSO A;  4K6L A;  5IYB G;  1VQ4 A;  3S2H H;  1RTN A;  4LF5 L;  1S5C D;  4WOR A;  1QOH A;  4MZ9 A;  1K9M C;  1PZK D;  3BDO A;  1SDF A;  4R4O A;  1EY8 A;  2DY7 A;  3I90 A;  2VUM B;  2A74 C;  1C7Y A;  5DM7 3;  4FXK C;  2B2V C;  1UEA B;  2V4D A;  3M3Y H;  5J1Z A;  1YVC A;  1E22 A;  1G2S A;  4DA2 A;  4XIG S;  5COY A;  4IPC A;  1I4X A;  3HOU H;  2A68 D;  5K5P A;  4HCE A;  2I07 B;  3BVG A;  3RLF A;  1HR0 W;  2RKS A;  2D62 A;  1TT2 A;  1PTO C;  2OTL A;  3KLS X;  3GTM H;  3V96 A;  2HQL A;  1CZW A;  1K28 A;  1JJ2 A;  5M5Y H;  4CKC A;  3KF8 A;  1VQI A;  2K01 A;  1HJP A;  1XYI A;  2BH8 A;  3KBX A;  4N9P A;  2DNE A;  1W2B A;  4IO9 A;  3PO2 B;  1Q8I A;  3H0G H;  4A4I A;  3TS2 A;  1I4R A;  5J22 A;  3ND8 A;  4HIM A;  3DHQ A;  1HZB A;  1PXU A;  3A8J E;  2HHH L;  1EWC A;  4RGM A;  2UUC L;  3A74 A;  2KQ3 A;  3I4N H;  3U9S A;  2EOT A;  4QGU A;  1LUZ A;  5C4J H;  1B50 A;  1XNQ Q;  1QG7 A;  1EU4 A;  2CWP A;  1Q1E A;  5I4D A;  2J4X A;  2WB1 E;  3J80 L;  1CTM A;  4YHH L;  4QIW B;  4JI2 L;  2E2D C;  3GQB A;  2N3S A;  2UXB Q;  1SE4 A;  4JC0 A;  3WWV A;  3QOJ A;  3G4S A;  1HTP A;  2UU9 L;  1SNQ A;  5E3F A;  1ML0 D;  3TP6 A;  3HKZ G;  4B3T Q;  4JVZ A;  4ID6 A;  4GOP C;  3RZD B;  4A3M G;  3K7A B;  3E5S A;  4IFD G;  1UE1 A;  4X3U A;  2DGY A;  1XMO L;  4A3D B;  4RGT A;  1JT8 A;  2LMC B;  4B3S L;  1KLU D;  1B9N A;  4X3S A;  5LMN W;  2F0F A;  4LAA A;  1IBM L;  1JOO A;  3CCS A;  4JI7 Q;  4X6A H;  4HR7 B;  1P16 A;  1EQT A;  2HDL A;  1GUG A;  5ELE A;  1UNS A;  1BCP F;  4FF2 A;  2JA6 G;  1S5E D;  1DZ1 A;  3A54 A;  1WTX A;  4LUZ A;  1UUP A;  1EYG A;  4J6H A;  1EZ8 A;  4X64 Q;  5M5W H;  5BN5 A;  5D3I B;  4YY3 L;  1C4Q A;  4DUZ Q;  1A63 A;  1L2F A;  1TS3 A;  3GO5 A;  1NJI C;  3P20 A;  1TKW B;  5JJZ A;  2ZM6 Q;  5CV4 A;  1A3T A;  1T5X D;  1GUT A;  2TSS A;  1R4Q B;  4DV0 L;  2F52 A;  3NTI A;  3M4O H;  3KFU A;  1KNA A;  2Z6K C;  4PZ7 A;  4WRD A;  2EY1 A;  1GHK A;  4RKL A;  4U67 3;  5EBD A;  2F03 A;  1TWA H;  2DJF C;  4Y7N B;  2JK8 A;  4DPG A;  1PRT B;  4OWT B;  5C44 G;  3VA5 A;  2NZO A;  2AUJ D;  4NDX A;  4X62 Q;  1HNX Q;  4R4T A;  1FL0 A;  1VMP A;  4J15 A;  1F2Y A;  1I4G A;  2UUB L;  3RD4 A;  5CV5 A;  1QB5 D;  2MO0 A;  4O0A A;  3M9B A;  3CRL C;  2NVX B;  3W3A A;  4DR5 Q;  5C0X G;  1SE8 A;  4MHE A;  4LF8 Q;  4LJZ C;  4HIO A;  5M3F G;  3HOV H;  3IL8 A;  5D3D A;  3MXU A;  4LF4 Q;  5EPL A;  4DF7 A;  4LF7 L;  3MFY A;  1N36 L;  3BG3 A;  3PUV A;  5JJI A;  2IW3 A;  1XMQ Q;  2F3I A;  3I70 A;  1E2Z A;  1BUV T;  4C3J H;  1RL2 A;  3X3M A;  4KN4 C;  1NY4 A;  4RCN A;  3HOW H;  3M4Q A;  2A6H C;  2JE6 I;  1NCV A;  3NWS A;  1PH3 A;  4K2L A;  1NUC A;  4F88 A;  1BKB A;  1HHV A;  4JG2 A;  2DUD A;  1PDQ A;  1TU2 B;  1PV4 A;  3FKI G;  4HN7 A;  4DR3 L;  1IW7 C;  1WTP A;  2NVY B;  4A3B B;  5A2Q E;  2A69 C;  3K8A A;  2Z0S A;  3MVV A;  3O13 A;  1PHJ A;  3UI2 A;  1X3F A;  1LT5 D;  2PW7 A;  1Z7T A;  1E2W A;  1H9S A;  2HD3 A;  3T1H Q;  1IL8 A;  1A3V A;  2FHT A;  4C3I G;  4DR4 Q;  4BWG B;  1RCV D;  5JEA H;  4JI3 L;  5TSS A;  3I4M B;  5LHY 1;  3VDY A;  5CV8 A;  1Q1B A;  4P75 A;  1X9N A;  4BY7 H;  1WVL A;  2K50 A;  3EQL C;  1EU3 A;  4PMC A;  4OEL B;  3MWY W;  4P73 A;  3U9O A;  2E76 C;  1ONL A;  4DR2 Q;  1Q81 C;  4DV5 L;  2YTV A;  3NQI A;  1F9P A;  1O7L A;  2JA8 H;  2JP1 A;  4LFA Q;  2NBF A;  4TQU S;  1X6O A;  5IYD H;  4EX5 A;  1LT6 D;  1HZC A;  2IL8 A;  1GUN A;  3JAM i;  3AQQ A;  4IJL A;  1PFB A;  3CXC A;  1JMC A;  4KHZ A;  1AW7 A;  4KJO A;  1MJE A;  2B29 A;  1IKL A;  1C8C A;  2JA5 G;  2F3W A;  2XNA C;  3OIP A;  4DV4 L;  1N32 Q;  4QIW E;  5LMU Q;  1HUN A;  4OON A;  1SSO A;  4YCU A;  3HEJ A;  3VR6 A;  1F9Q A;  4ODG A;  2AWO A;  4C1N K;  1TWF H;  1QUQ B;  5LL6 X;  3K5M A;  3DM1 A;  5FOB B;  3UE1 A;  1XPU A;  1HQR D;  1D1I A;  2K5D A;  3CHB D;  2ICE C;  2E5L L;  4CDF C;  3G48 A;  3EN2 A;  3KF6 B;  5M3M H;  3OMC A;  4PZ8 A;  4B9X A;  1E2V A;  5IOC A;  1CKN A;  4AQY L;  1QNU A;  4UY8 C;  1YJN A;  3PIO 3;  3CQZ H;  4APV A;  1Y1W B;  4DXG A;  1IL2 A;  4RG1 A;  3TRZ A;  4A3G H;  1O7Z A;  2RHQ B;  2ZTD A;  2EYH A;  3J7A 5;  1PTO D;  1VQB A;  1E0B A;  2RBM A;  4KLK A;  1VQM A;  4K5V A;  1NSN S;  4NP5 A;  2KHS A;  3HOZ H;  1WFQ A;  2BE5 C;  1GKH A;  1HZA A;  2WII B;  1G91 A;  4JYA L;  1IZ6 A;  5JVG 3;  4FNF A;  3F2D A;  4B3M L;  1PH6 A;  2HT1 A;  3GDE A;  4NXN L;  1HNZ Q;  1SMY C;  1OXT A;  2CKZ B;  4GKK L;  2CQA A;  3HKZ B;  5E4W C;  1SFO B;  5JVH 3;  1SEB D;  1GJX A;  4LF6 Q;  4LF9 Q;  2F0E A;  4I65 A;  4A3M B;  2F0V A;  3OTO Q;  4N9T A;  3WOE A;  4OX9 Q;  2NYZ D;  1HFN A;  3DWQ A;  3S15 H;  2Q2T A;  4Z9C B;  4K0K Q;  4G7O C;  2LSS A;  5KNB A;  1JJC B;  2GN5 A;  2RDH A;  1BO0 A;  4CDD C;  1K83 B;  1Q82 C;  4RH6 A;  1QVF A;  2O5J C;  2BCO A;  5M5X B;  2PCF B;  4K2K A;  1C0A A;  4R1J A;  3S2D B;  1D2B A;  3T53 B;  2LKV A;  2OCE A;  1KAA A;  4QQB X;  3AU7 A;  1HQM C;  4GN3 B;  1QJO A;  3SGI A;  2DNC A;  4FP5 D;  4KKS A;  2ZXO A;  3N52 A;  4BA1 I;  3PO2 G;  3K0X A;  1I4H A;  1N33 Q;  5EGT A;  4A3K G;  4BBR H;  1CQF A;  1B3Q A;  3CCQ A;  2PPB C;  2F4V L;  2CH4 W;  4DV6 L;  3RR5 A;  2OWO A;  4GNX A;  3C46 A;  1QVG A;  5G3L F;  1WOC A;  1VF7 A;  3PUY A;  1NBW A;  1ILP A;  1L1O B;  3QB3 A;  2EJG C;  3Q23 A;  4DAV A;  2N88 A;  4UAI A;  3W1G A;  1EY5 A;  4FYD A;  4S3S A;  2NVT H;  5IOD A;  4CJ2 C;  1TWC H;  2YYZ A;  1GUW A;  2K32 A;  3VYU A;  3Q6S A;  1SJH D;  5IP9 G;  1J5E L;  3AFQ A;  1EFI D;  4JV5 Q;  3K80 C;  1IXR A;  1G29 1;  1Q90 A;  2E2I B;  3BZD B;  3K5O A;  3S1N H;  4A75 A;  5M3F B;  4IUU A;  3R2T A;  5IGB A;  1IYJ B;  4DXF A;  5C0X I;  3NP8 A;  1I6H H;  1VQD A;  4K8I A;  3KYH C;  4KV6 A;  1LTA D;  2PO4 A;  5D65 A;  1O7I A;  3CCL A;  3MXP A;  4ABN A;  2EYO A;  4A3L H;  4DAP A;  3P75 A;  4OIJ A;  4IUN A;  4HID A;  2ZXR A;  4XYO A;  2ASB A;  3R3O A;  1GUO A;  2F0M A;  4HJ5 A;  1TQO A;  2F0J A;  3ND9 A;  2Q2I A;  1HCZ A;  2KCC A;  2EVB A;  4A3J G;  3CD6 A;  1I50 B;  3OW2 A;  4KY6 A;  4BBS H;  1JB7 A;  2SEB D;  2MHV A;  2ZTE A;  3EIV A;  2I5H A;  2ES2 A;  1MSH A;  4C56 C;  4IOA A;  2R92 G;  1UAP A;  1N34 Q;  4PMW A;  2WP8 J;  2Q8I B;  2A6H D;  4C3I B;  5M9O A;  4O42 A;  4QJF A;  1VQP A;  3VR3 A;  2G9H D;  3UDG A;  1LTT D;  2B63 G;  2IX3 A;  1B7Y B;  2B8F A;  5I6Y A;  1TXY A;  2HUG A;  2KHI A;  4RHS A;  3HOY H;  1D5Z C;  2A69 D;  3LX0 A;  2JN4 A;  3BVM A;  3TME A;  4A3E B;  1AEX A;  1C48 A;  1EWI A;  3S17 B;  4QCL A;  3ONA B;  2B39 A;  1VQ9 A;  4DUY Q;  4A93 B;  3PIO A;  3FPP A;  1VQN A;  2Q2U A;  4JI5 Q;  3E0J A;  2LFN A;  1MJC A;  1A2U A;  3FHW A;  3K59 A;  3SR1 A;  2Y0S G;  1WD1 A;  4OWW B;  2X69 A;  1Y8O B;  3GTL H;  1HH2 P;  4C2M H;  3A7L A;  4HMI A;  1XPO A;  2JA5 B;  2VQE Q;  2NN6 H;  3RZO H;  4ZQ3 A;  5FK9 C;  1PH4 A;  1YIJ A;  4LMQ D;  4V19 0;  5E7N A;  5JAV A;  3MXN B;  3TQY A;  2MNA A;  2E2H B;  2EYM A;  1B4O A;  1B8A A;  4H13 C;  5DAU A;  4DK1 A;  2FMC A;  1EQV A;  1VQA A;  4A3B G;  4B3R Q;  3HKZ E;  3CC2 A;  3PSI A;  2NTS A;  3SE0 A;  2K03 A;  1SYD A;  4JI1 Q;  1FYC A;  3ERS X;  5C3X A;  3CCE A;  4A3F B;  4DV7 Q;  4BY1 B;  1BQQ T;  2OQ0 A;  4K5X A;  2NUC A;  5DNF A;  2MO1 A;  3LWU A;  3PGZ A;  5C5M A;  3V05 A;  3OHX C;  1HXY D;  3CME A;  1EFW A;  3S16 H;  3K81 C;  2JXM B;  2B2W C;  1HPC A;  4B08 A;  5FLM H;  3I4M G;  5F2D A;  3PF4 A;  3HOU G;  2PMZ E;  1SNC A;  3B6Y A;  4UP8 A;  1CA5 A;  4KI0 A;  3J80 i;  1PH1 A;  1DOK A;  3J81 c;  4HJ9 A;  1KHI A;  1D7Q A;  1YJW A;  1LTG D;  3TBI B;  2BA0 A;  4MIU A;  3F1Z A;  1KLG D;  1EEF D;  2LY7 A;  4L5R C;  2VQF Q;  5IY0 A;  4M1U B;  4QY7 A;  3PF5 A;  1B53 A;  3ICE A;  3S9W A;  5KIX A;  2IT1 A;  1EOV A;  1EY6 A;  3GTJ B;  1MI2 A;  1V1O A;  4RAU C;  3Q22 A;  1E7Z A;  1T9H A;  3IKJ A;  2RSO A;  2R93 H;  1LT3 D;  2NVY H;  1CQV A;  1EQQ A;  2BE5 D;  1PH8 A;  1EYD A;  5I2X A;  3CPF A;  2KVM A;  1IBL L;  1F2M A;  5C4X H;  4NXM L;  2I5M X;  4RHR A;  1G8Z D;  1VQH A;  3EBE A;  2E8G A;  1MBY A;  2KEC A;  5CV6 A;  3EVQ A;  2L4N A;  1GXD C;  2VW9 A;  2A6E C;  4U68 A;  2FXQ A;  2R61 A;  3C1E A;  4R9W A;  3A56 A;  5JEA J;  4ILW A;  2X6G A;  2RSN A;  1K3R A;  2Z1C A;  3RLO A;  1KIX A;  3KUP A;  3ERQ A;  3CCR A;  4A3K B;  3BS1 A;  5CBA E;  4KHP L;  1B44 D;  4CJ1 B;  1Y1W G;  2F0K A;  1II3 A;  3ER0 A;  1YHB A;  4JI0 Q;  1TY2 A;  2JJQ A;  4XT3 B;  3CRK C;  3K0Y A;  1LTS D;  3FEW X;  3SEB A;  1KDA A;  3Q8D A;  4L5T A;  2UXB L;  3GTK B;  1A62 A;  4DV3 L;  2D5D A;  4UP7 A;  4KN7 C;  4IJH A;  3H3V I;  1TWG B;  1UE5 A;  2A8V A;  3CCM A;  4ME3 A;  5FKA C;  1UE6 A;  4HJ8 A;  3MXG A;  2K1B A;  3KJP A;  1BCP B;  2RF4 A;  2F0S A;  1KQS A;  4NPS A;  2H4O A;  4KK7 A;  1YHA A;  4FF4 A;  3RNU A;  1RIP A;  2HHH Q;  2K05 A;  4JI6 L;  4GKJ L;  3W2D A;  1PRT C;  1B9M A;  1SLJ A;  4ZUI A;  1XWE A;  5CC4 A;  2UUC Q;  2XGT A;  1U5K A;  2F0I A;  3NXW A;  1K3B C;  4JBK A;  1SXT A;  4KD4 A;  1QZG A;  5ELN A;  1U0L A;  2WFW A;  1NMG A;  1L0W A;  2F3V A;  4YHH Q;  1PTO B;  1Q12 A;  4YWL A;  2F0H A;  1STG A;  2L5T A;  2WV6 D;  3W5O A;  5KGU A;  3TP7 A;  2YU9 B;  4DR6 L;  3EA6 A;  3S1R B;  1TWH B;  5C3E B;  3DWP A;  1G2T A;  3IFD A;  5IE8 A;  4A3I G;  4YCV A;  2UU9 Q;  1PMR A;  4O1N A;  5IGD A;  4EQO A;  5GAD C;  3K5L A;  3TDQ A;  3GTO B;  4A3J B;  4EVO A;  1QUQ A;  1I6V C;  3Q0A A;  4OEM B;  1XJV A;  1H9M A;  3F2B A;  3FDT A;  5KND A;  1XMO Q;  1VQL A;  5IWA L;  1GO3 E;  2R92 B;  1XX8 A;  1KDC A;  1T5E A;  1HR0 L;  1IBM Q;  1PTO F;  4C3H H;  1U4L A;  1JR0 D;  4ZK9 B;  3GTP H;  2K28 A;  3HRZ C;  1DOL A;  1OO9 B;  1PLF A;  1S3O A;  1AH9 A;  4IPG A;  4IN3 A;  1OTC A;  5EKK A;  2B63 B;  4CKE A;  1R4P B;  4A3M H;  3C3L A;  3HOX B;  1BF4 A;  2JA7 G;  4HJA A;  4IFD H;  2RCF A;  2SNS A;  2A19 A;  1IYV A;  2KEN A;  4HJ7 A;  3U50 C;  2E2J B;  4YY3 Q;  4LF4 L;  3R93 A;  5FLX c;  1F2L A;  1I5F A;  1K83 H;  4GN4 B;  3AEV A;  2MPM A;  2MQH A;  4R4Q A;  1HA6 A;  1K8M A;  2X6L A;  4GOP B;  2PQE A;  3J81 L;  4P71 A;  5M5X H;  2JA6 H;  1JJG A;  1FJG L;  4HSP A;  4FXG C;  3S2D H;  4IPD A;  2XIW A;  1HRJ A;  3HP3 A;  1Q8K A;  2Y0S B;  2B8G A;  3K7U C;  1K8G A;  1Y1V G;  1OXV A;  1DOM A;  3GTG B;  4MTN A;  2MJ8 A;  3NPP A;  4JI8 L;  1VQF A;  1GM5 A;  5A35 A;  1NNX A;  2EY2 A;  1NE3 A;  5KRU A;  3ZJY C;  2EIF A;  3S2H B;  3GP7 A;  2UUB Q;  4CDC C;  2MUY A;  1Y8P B;  2XWJ B;  2TMP A;  4IUP A;  3F2U A;  3L0O A;  4AYB G;  4LFB Q;  1PFN A;  1MD2 D;  4DK0 A;  2OQK A;  5LMN L;  1YNN C;  2WKC A;  3KDF B;  4HMJ A;  5C44 H;  4K5W A;  4LF7 Q;  2NVQ H;  4MTK A;  3KLR A;  1RHP A;  1N36 Q;  1LTB D;  3M3Y B;  5AFW A;  3BYY B;  3MA2 B;  3AFP A;  4K8J A;  4LFC L;  2WIN B;  3NTH A;  3M7N A;  3MZ5 A;  5KNC A;  3HOU B;  4XQQ A;  3I2Z A;  1UE7 A;  5C0X H;  2ZJP A;  3NUC A;  3J7Y W;  4X65 L;  2VL6 A;  3GTM B;  1L1O A;  1FNV A;  2RQX A;  4A3E G;  1CSQ A;  4G7H C;  5M5Y B;  2CVR A;  1W6K A;  2EJF C;  4A93 G;  1FNU A;  1JWS D;  1I4P A;  4IOC A;  2R7F A;  1ASZ A;  1B1Z A;  3SXH A;  5BR8 Q;  4YIJ A;  4CHT B;  4DNR B;  5LMU L;  2ZT9 C;  3PO3 H;  2D0O A;  1R9T B;  1ROD A;  3A8K E;  5IYC G;  4JI3 Q;  3FKI H;  1CA6 A;  4ULL A;  1V9P A;  3I4N B;  3FP9 A;  2CFM A;  1WCM H;  1I50 H;  2O4X A;  1TR5 A;  3KLW A;  5C4J B;  5J3B A;  1XNR L;  1EL0 A;  4DV5 Q;  1WTV A;  1A6X A;  4L5S A;  5ELD A;  3H6M A;  1VQ5 A;  1BVS A;  2A5H A;  1QCB D;  1B3A A;  2UUA L;  5ISR A;  3SHL A;  1Q86 C;  1EOT A;  1OXS C;  2L55 A;  4A3F G;  4BY1 G;  2J7Z A;  1IBK L;  1ET9 A;  5IGF A;  1PFS A;  2FIN B;  1LAC A;  2VXW A;  2D2C C;  2JQO A;  5JOB A;  4PMB A;  3I55 A;  5AJ3 L;  1TVX A;  2ZJR A;  3SDZ A;  4IUV A;  4PZ6 A;  4DGZ A;  3MAQ A;  1L0X B;  1FD7 D;  2L1B A;  2LXK A;  3R8B A;  1BBX C;  1K8A C;  2Z6B A;  1STB A;  3DXJ C;  5IP7 G;  1H95 A;  2A6E D;  3M4Y A;  1YBY A;  1AZQ A;  2V1C C;  2XTI A;  1K8O A;  1I3Q H;  5GAH C;  4B9W A;  2K7V A;  3CP0 A;  3TZD A;  2VB3 X;  1EY4 A;  1GUS A;  1A0I A;  1SYG A;  1CI3 M;  4DV2 L;  2E5L Q;  3E9I A;  1SE2 A;  3CU7 A;  1KRS A;  1FVI A;  4JOI A;  2JA5 H;  4OX9 L;  1AE2 A;  4C1N I;  4NB3 A;  2IY5 B;  1L1O C;  2IHF A;  5FJ8 G;  1PH2 A;  3BYT B;  1S5B D;  1ENF A;  4JI4 L;  1UWV A;  1YZ6 A;  2BDO A;  2F0L A;  2KUM A;  2L9H A;  5FLX L;  1CSP A;  1SE3 A;  4OO1 H;  4AIM A;  1SNM A;  2A73 B;  4X66 L;  3MEF A;  2N78 A;  3A5Z B;  2SDF A;  4JYA Q;  3QG1 A;  2AKW B;  1TWA B;  2R7Z G;  2I46 A;  1LT4 D;  2OXP A;  1S5F D;  4DR1 Q;  4NXN Q;  1LLR D;  1P8L A;  4A3I B;  2M00 A;  1PH5 A;  2R3Z A;  2K6A A;  1DD2 A;  2QCP X;  2F0T A;  1PH7 A;  3BZC A;  1EIF A;  1PRT D;  2K4K A;  2N8N A;  4ZRZ A;  1VQK A;  1SRU A;  1SNP A;  2GA4 B;  4KD3 A;  4R4C A;  1J9O A;  2KHJ A;  2Y0S E;  1E24 A;  1U4P A;  5ELB A;  3HOV B;  1JCK B;  3F2C A;  1IYU A;  1EYA A;  2PQA A;  4N8F A;  1RD9 D;  4PG3 A;  3QR8 A;  2IWH A;  2WAQ G;  3I73 A;  4X3T A;  3TSS A;  1LYL A;  1BXT A;  4C3J B;  3T1Y L;  3HOW B;  1KXL A;  3OPO A;  2VUM H;  3I8Z A;  1KD1 C;  3KOJ A;  3J7A V;  2F0D A;  4BXX G;  3PIP 3;  4Q0F A;  1V43 A;  1Y69 U;  2JA7 B;  4FO2 A;  3GTJ H;  4L6T B;  3IAY A;  1YHQ A;  2OEO A;  1NMF A;  3SVM A;  3I56 A;  4A3C G;  1E1T A;  3H94 A;  1D1K A;  1RJT A;  3N6R A;  3NEL A;  4EQ5 A;  5IGC A;  3ERO A;  1LTR D;  2C9O A;  3L7Z C;  1G6Z A;  5IGE A;  3D31 A;  3SK6 A;  4BBS G;  4DV6 Q;  2RA4 A;  1E3P A;  1STN A;  4JOI C;  2C35 B;  1M90 C;  2K14 A;  2N55 A;  3FPU B;  1YEZ A;  5EPK A;  1BOS A;  2UXC Q;  1Y1V B;  2F0Q A;  4OXP A;  3WOF A;  3S1Q B;  1TS4 A;  2NZH A;  2QEJ C;  3LGJ A;  5CV7 A;  4FDB A;  2E75 C;  3TEH B;  2QDL A;  3PO2 H;  1VDZ A;  1AP0 A;  4BY7 B;  1M1K C;  5C3E G;  1J5E Q;  2JYO A;  1VS0 A;  2VS1 A;  4V0B A;  2P5Z X;  1U4R A;  5COR A;  4POG A;  1N34 L;  3H3V H;  1BBW A;  3M7G A;  4O2D A;  3BU2 A;  4AYB B;  1KRT A;  1HZ9 A;  5HY6 A;  1GD7 A;  3A7A B;  2GVB A;  4RA8 A;  4A76 A;  4DV1 Q;  1FNW A;  1JQY D;  4YWK A;  1EEI D;  2PW5 A;  2MP1 A;  3T4A C;  4I7A A;  1EUJ A;  5IP9 H;  1ZXT A;  4DN4 M;  1I4Q A;  5FO8 B;  2NN6 G;  5CMD A;  4GNX C;  4E6I A;  3RZD H;  2K5H A;  3HOX G;  4DUY L;  1IW7 D;  3S1M B;  3K7A H;  2EY6 A;  4A3D H;  1TWF B;  4IUR A;  1QWY A;  3V2T A;  1NR4 A;  2KCN A;  1RF2 D;  5JPM C;  1STE A;  1HNW Q;  1YNN D;  2EE1 A;  2HQE A;  3QIA A;  3OWE B;  2LXJ A;  3H15 A;  4F8M A;  4DR7 L;  1PYW D;  4QUF A;  2AMC B;  2IJ0 A;  4J8Q A;  4OL7 A;  3S1R H;  2Q2H A;  1TWH H;  1HTL D;  5K36 H;  2CQO A;  2ICI A;  1O7Y A;  2RDG A;  3CQZ B;  1S5D D;  3C2P A;  4A3G B;  1ESR A;  3HG9 A;  4XYQ A;  3NBH B;  5I9O A;  2UXD L;  1I94 L;  1U9R A;  2PZT A;  4IPH A;  4DFA A;  3P7J A;  3GTO H;  4NMZ A;  4B3R L;  5NUC A;  4XTC S;  5CR3 A;  5GAE C;  1MGS A;  4JI1 L;  3G6E A;  2M2L A;  3FMC A;  2R92 H;  1A15 A;  4TVA B;  3D6W A;  2IX1 A;  5C3W A;  1CHP D;  3HZX A;  4NW2 A;  2EYL A;  4R4I A;  1O80 A;  1YI2 A;  3PQI A;  4XDX A;  4Y7N H;  3OOC A;  4R8N A;  2B63 H;  3URY A;  4EQP A;  1MKH A;  4IFD J;  3TN2 A;  1B2T A;  2E2J H;  3CMA A;  2XWB B;  2K52 A;  3U58 A;  1SRO A;  1VQO A;  2H5X A;  4L8J A;  2PZW A;  2NVX H;  1RTO A;  4QMG A;  5C4X G;  4BA2 I;  1ICW A;  1DYQ A;  3QO2 A;  1DJR D;  2WKD A;  3NTK A;  4H02 A;  1G51 A;  1S72 A;  2NB0 A;  4JBM A;  2KED A;  3S14 B;  1OXX K;  1Y14 B;  1PZI D;  4LW1 A;  4ZCK A;  3CPW A;  3H3V C;  1MHW C;  1BDO A;  4OGQ C;  4HCS A;  3H0G G;  5CBE E;  1JOQ A;  1DON A;  1PFM A;  1X65 A;  5EJW A;  4F7X A;  3RUZ A;  2K75 A;  4A3B H;  2D9U A;  4GOP A;  3D4W A;  3I4N G;  1BCP C;  2Z4I A;  1JC7 A;  3PIP A;  2DN8 A;  4TRD A;  2CWA A;  3E6Z X;  3UDX A;  2L0C A;  4QUC A;  1Y8N B;  4OHJ A;  1Z47 A;  2QKI C;  2R7Z B;  4LF5 Q;  4NKL A;  1VQ8 A;  1RDP D;  2NVT B;  1SMY D;  4UP9 A;  1DXM A;  2BDN A;  1TWC B;  2EPB A;  3I91 A;  5EPJ A;  3DEP A;  1V1Q A;  1BNZ A;  4ZKC B;  3D4R A;  4JI0 L;  2H1E A;  2RVL A;  3I4M H;  2CH4 A;  1A8V A;  4G4K A;  1JWM D;  1UEB A;  5C0X J;  1XNQ L;  5IYB H;  1V1P B;  3S1N B;  3E0E A;  3A0J A;  3AMU A;  4DAY B;  1OXU A;  1I6H B;  2RDF A;  1IBL Q;  1GHJ A;  2B2U A;  2WAQ B;  4K6D A;  4X3K A;  5EBC A;  3KDF A;  4NXM Q;  4IQZ A;  2F0N A;  1LTI D;  4GLV B;  2AHO B;  4G57 A;  4B3T L;  2Z6K A;  2EY5 A;  3J81 E;  1R9T H;  3T51 B;  1STH A;  1NTG A;  1JE4 A;  4UHV A;  2QEX A;  3CW2 C;  1X3G A;  2B3G A;  1YJ9 A;  4AYB E;  2ENB A;  4RFB A;  1PA6 A;  1GOZ A;  3CKI B;  4FF1 A;  1IHZ A;  1WJJ A;  4KHP Q;  1VCI A;  5HUR A;  1SYF A;  3J81 i;  4BBS B;  1K0S A;  4JI7 L;  4DAM A;  3NK9 A;  3MHB A;  3OWF A;  1ICF B;  3P1H A;  2VZA A;  2ID0 A;  3BDC A;  3GV3 A;  2QW7 A;  4J1M A;  1MIU A;  3PUW A;  3DUZ A;  4C3H G;  3QOL A;  4DV3 Q;  5GRO A;  1PYS B;  2L11 A;  3Q24 A;  4X64 L;  3IFT A;  1WTH A;  3J7A F;  5IT9 c;  4JI2 Q;  1EWH A;  2PI2 E;  3A8I E;  1EY7 A;  3GD7 A;  2JA9 A;  4DUZ L;  1KAB A;  1SMX A;  1BR9 A;  1Y1W H;  3HOY B;  1CFM A;  3MC0 B;  1BBU A;  1ZYR C;  3D8G A;  4MN3 A;  5HGQ A;  2ZM6 L;  1JOK A;  3NWT A;  4YCW A;  4IZ8 A;  3QWN A;  1QNK A;  2YTX A;  4IAL A;  2KEE A;  3STB C;  3CC4 A;  1PH9 A;  1STA A;  4JI6 Q;  1K0R A;  4OIK A;  3D4D A;  3HKS A;  4GKJ Q;  1QVC A;  4HAE A;  3NSW A;  1VQC A;  4KKT A;  4IUQ A;  3HOV G;  4B3S Q;  1L0Y B;  3AYH B;  3JC6 6;  3KF6 A;  3KK7 A;  3H91 A;  4M8A A;  4X62 L;  1HNX L;  3GTL B;  1QE6 A;  4C2M B;  2B2T A;  4C3J G;  3HOW G;  3RZO B;  4JK1 C;  5CYU A;  1N9W A;  2OF1 A;  4EQN A;  3CCJ A;  1SFO H;  4DR6 Q;  1SYB A;  1W3S A;  2K5N A;  1VQG A;  1XXG A;  2NN6 I;  2B2U C;  3CF5 A;  1ENA A;  4DR5 L;  4LF8 L;  3I4O A;  2Z9H A;  1EY9 A;  2C5C A;  3T13 A;  1EZ6 A;  4EGV A;  1CUK A;  1YNJ C;  3FVQ A;  5C4H A;  1XMQ L;  3OYY A;  3ULL A;  5IWA Q;  4KTA A;  4XQJ A;  3QJY A;  2LS0 1;  1VMC A;  1Q7Y C;  1VQJ A;  4KY7 A;  1HR0 Q;  4DV0 Q;  3JAM c;  1S4Z A;  2VB2 X;  2ALY B;  2A1A A;  3KLS A;  4A3I H;  3S16 B;  1LM0 A;  1CKO A;  3G6J B;  3VR4 A;  1V8Q A;  4PNY A;  4RMF A;  2HCC A;  1EYC A;  3I7F A;  5ELF A;  5JEA G;  2KA7 A;  3GTQ B;  3OSO A;  4BY7 G;  1WYD A;  5IT9 E;  3FRP B;  3TS0 A;  5EQ0 A;  4LFB L;  2EYJ A;  5HGT A;  2YTY A;  4WJ4 A;  1ESF A;  2BOS A;  2SOB A;  4ALP A;  3NHH A;  3T1H L;  2EDG A;  3WDN A;  3LWE A;  2EZV A;  1PRT F;  4TSS A;  2JA8 G;  4DR4 L;  3CAM A;  4F87 A;  3KF8 B;  1FJG Q;  4IUT A;  5IYD G;  2JEA I;  2ATW A;  1D6E C;  2JA7 H;  3NEM A;  3PUZ A;  2R7D A;  1H9J A;  3PV0 A;  3PO3 G;  1XPR A;  2F0W A;  2WB1 G;  1ZKO A;  1F77 A;  1J6Q A;  1CM9 A;  1LTL A;  2F4I A;  2HIV A;  2QDB A;  2R93 B;  4Q5V A;  4JI8 Q;  2KCM A;  3DWA A;  2NTT A;  4K14 A;  4P72 A;  4YWM A;  4DR2 L;  1WCM G;  2XN9 C;  3X3N A;  3PUX A;  4GZY C;  4H7B A;  1X55 A;  3CC7 A;  3OIQ A;  1J8I A;  1Q46 A;  5C4X B;  2E2I H;  1JIC A;  4LFA L;  1F9S A;  1M8A A;  5M3F H;  2AUK A;  3CCU A;  4DR3 Q;  2XVS A;  3RMH A;  1QIL A;  2B2T C;  5BR8 L;  1WTW A;  5GQO A;  1SBB B;  1Y1V H;  1HUM A;  5FLX E;  3S1Q H;  2PZU A;  3KJO A;  5LMN Q;  4ME5 A;  4ZKB B;  3DM3 A;  5M3M G;  1X3Q A;  3T16 A;  2AQ1 B;  3H0G B;  3SK5 A;  2K5W A;  5E1F A;  1N32 L;  3U4V A;  1EIG A;  2WAQ E;  2HIX A;  2AQ2 B;  4A3G G;  4LFC Q;  1DM0 B;  3JAM E;  3LNN A;  3U4Z A;  4RCO A;  2FJ2 A;  1XTD A;  2NWG A;  1A2T A;  3L2P A;  1C9O A;  3HOZ G;  4BS9 A;  2GVA A;  4GLX A;  1F2Z A;  2EJM A;  2CW0 C;  4X65 Q;  4Y52 H;  4CKB A;  1SN8 A;  4ZAI A;  4G7Z C;  4L63 B;  3NQT A;  4H44 C;  5T1G A;  1SR3 A;  4C3I H;  1M4V A;  2NZ1 D;  3HFZ B;  3M85 A;  2MGS A;  2F0U A;  1PVO A;  4DKA C;  3NEN A;  5IT9 L;  1QZH A;  1TS5 A;  1GVP A;  2FFK B;  1B70 B;  2IX0 A;  3S1M H;  1X3P A;  4RGN A;  4GS3 A;  1YIT A;  2N49 A;  1AFP A;  4JPB W;  2VNU D;  1BCP D;  4JBW A;  1WTO A;  4A3E H;  1E1O A;  2YV5 A;  4DV4 Q;  3SK8 A;  3S17 H;  4DNT B;  4HSV A;  4MNO A;  4A93 H;  3H09 A;  4OO1 G;  1TY0 A;  2DJG C;  2E74 C;  2Z8L A;  1HNZ L;  1X56 A;  1XNR Q;  1SJE D;  2K5Q A;  5C5L A;  1G6P A;  1U4M A;  2WAC A;  3NE5 B;  4R8I A;  5DM6 3;  5BN4 A;  2F0O A;  4LF6 L;  4LF9 L;  1X54 A;  4RWS C;  4XT1 B;  5IYC H;  2UUA Q;  1VQ6 A;  3OTO L;  4XXE A;  5A2Q L;  3UDI A;  1IBK Q;  3OMG A;  5M5W B;  4PV1 C;  1PYB A;  3RLN A;  4K0K L;  1KL9 A;  3IRB A;  2QIL A;  4JBJ A;  4AH6 A;  4AQY Q;  2PI2 A;  3SK4 A;  4ZLT F;  2QF7 A;  4BBR G;  1XTC D;  2A68 C;  4JW0 A;  2E2H H;  5AJ3 Q;  2F1M A;  3K6O A;  5CV9 A;  1KDB A;  3D0F A;  5LL6 S;  2QGQ A;  3EJI A;  3S24 A;  1FGB D;  4C3H B;  3CCV A;  4DR1 L;  3GTP B;  3M4O B;  1EQR A;  4A3F H;  3E3X A;  4WJW A;  4BY1 H;  2RCN A;  2VUM G;  3NBH A;  3RN2 A;  4B3M Q;  5I2Y A;  3JAM L;  1N33 L;  4DV2 Q;  1EIH A;  3TP8 A;  1ZEQ X;  4P74 A;  2CHB D;  3F8T A;  5EAY A;  4GKK Q;  4IFD I;  3K58 A;  4QB4 A;  1K73 C;  3MXN A;  3BZK A;  4WJ3 M;  4JI4 Q;  4LUV A;  5JJL A;  5IP7 H;  5DEH A;  4FXD A;  1EIY B;  2CCZ A;  1CT1 D;  2PMZ B;  2JA6 B;  1AE3 A;  3A55 A;  1WD0 A;  3NBI A;  3L3O C;  4KHV A;  1AN8 A;  2AWN A;  3BDL A;  3E9H A;  5IGG A;  1LV9 A;  2IHE A;  5E4X A;  4P2C B;  3G7L A;  5IIF A;  2PYK A;  4POF A;  1H9S B;  4KY5 A;  4X66 Q;  3S14 H;  1HA5 A;  4I7Z C;  1VF5 C;  5H1S E;  4L5Q A;  3AB9 A;  4N8X 1;  5FJ8 H;  4A3L G;  2RHS B;  5GAG C;  4JV5 L;  3VR2 A;  3VR5 A;  1ZYR D;  2BA1 A;  1CK1 A;  1RKN A;  2XSC A;  3STB D;  5CGK A;  2G5D A;  5BN3 A;  1WTR A;  3ITP A;  2KJX A;  5FO9 B;  3K57 A;  1EY0 A;  2UXC L;  2F4V Q;  3K5N A;  5EKL A;  2DY8 A;  2R6G A;  2KCT A;  5D14 A;  3UE0 A;  4KMU C;  2R7Z H;  2K5V A;  3OW7 A;  5C44 B;  3VYR A;  4HTH A;  4DNI A;  2NVQ B;  3GV6 A;  2AQ3 B;  4ZYS A;  4HED A;  2EXZ A;  4QL5 A;  1TII D;  3T1Y Q;  3PMF A;  3VYT A;  1D5X C;  2Q8R E;  2J0T D;  4DU9 A;  5ELC A;  2KBN A;  2KOL A;  4A3K H;  2G9D A;  3DLL A;  3HOY G;  5J39 A;  1KC8 C;  5KYI A;  1YNJ D;  3HGB A;  4A3D G;  4H0L C;  3MTS A;  2HCI A;  4DV1 L;  1SND A;  2ZXP A;  1KNE A;  1D8L A;  2O2L D;  1FGU A;  5C6A A;  4CDE C;  3GTK H;  2EXD A;  2JA8 B;  3R2I A;  1TWG H;  2OT2 A;  3I72 A;  4FVM A;  1SNO A;  3BJU A;  4FF3 A;  4BXX H;  3J7Z C;  1YNX A;  5ELO A;  4UPA A;  2XRS D;  3PO3 B;  5K36 G;  2K33 A;  2B2Y A;  2FMM A;  3EFX D;  1CKN B;  2WB1 B;  4A3C H;  3FKI B;  3ULJ A;  4XQN A;  1MSG A;  3MEH A;  3DMU A;  3I3C A;  3TRE A;  1ASY A;  1V1P A;  1WCM B;  4CJ0 B;  1SYC A;  2F0G A;  2EYP A;  1ET6 A;  2B2W A;  2Q8T A;  1HNW L;  4DAY A;  4ZUJ A;  1PZJ D;  3DEO A; 
#chains in the Genus database with same CATH homology
 3F2D A;  4MTN A;  4JI5 L;  3J80 c;  4B3M L;  1PH6 A;  2HT1 A;  4JI8 L;  3GDE A;  1UEB A;  1VQF A;  4NXN L;  1GM5 A;  1HNZ Q;  5C0X J;  1XNQ L;  5IYB H;  3E0E A;  3A0J A;  1OXT A;  2CKZ B;  2OTJ A;  4GKK L;  4OWX B;  2JEB I;  1NE3 A;  4DAY B;  1OXU A;  4LF6 Q;  4LF9 Q;  1IBL Q;  2MFI A;  3ZJY C;  2EIF A;  4DK6 C;  2UUB Q;  3OTO Q;  3KDF A;  2VQE L;  4NXM Q;  2YU9 H;  4OX9 Q;  2VY3 A;  3S15 H;  2Q2T A;  3A5U A;  5C3E H;  4GLV B;  4K0K Q;  2EQS A;  2AHO B;  2LSS A;  2I5L X;  1JJC B;  2GN5 A;  3L0O A;  4AYB G;  2Z6K A;  4B3T L;  4LFB Q;  3RN5 A;  1R9T H;  2OQK A;  5LMN L;  1Q82 C;  1NTG A;  5C44 H;  3KDF B;  5FLM G;  4LF7 Q;  1QVF A;  2QEX A;  5DLQ E;  2NVQ H;  1N36 Q;  4A3J H;  3CW2 C;  1X3G A;  2B3G A;  1YJ9 A;  1CKM A;  4AYB E;  2I0Q A;  1PA6 A;  1C0A A;  1KAW A;  4R1J A;  3AFP A;  4LFC L;  1WJJ A;  3M7N A;  4KHP Q;  1VCI A;  4DV7 L;  3J81 i;  2OCE A;  4QQB X;  4GN3 B;  4JI7 L;  4DAM A;  3SGI A;  3I2Z A;  1UE7 A;  2ZJP A;  4BA1 I;  4GLA C;  4HIK A;  3PO2 G;  3K0X A;  2VL6 A;  4X65 L;  1N33 Q;  4DR7 Q;  1L1O A;  2VZA A;  2ID0 A;  4A3K G;  4BBR H;  1MIU A;  1Z9F A;  1X3E A;  3PUW A;  3CCQ A;  4A3E G;  2F4V L;  1CSQ A;  3PCO B;  4DV3 Q;  3J81 j;  5GRO A;  1PYS B;  4DV6 L;  1VQE A;  4X64 L;  3HOX H;  3RR5 A;  2OWO A;  4GNX A;  2ZTC A;  1QVG A;  3ULP A;  5IT9 c;  4JI2 Q;  4LUO A;  1WOC A;  2PI2 E;  3GD7 A;  4A93 G;  2UXD Q;  2JA9 A;  1I94 Q;  3PUY A;  3G71 A;  2QA4 A;  4DUZ L;  1NBW A;  1N8R C;  1SMX A;  1L1O B;  4GN5 A;  1WI5 A;  2R7F A;  4IOC A;  1Y1W H;  1ASZ A;  5BR8 Q;  2R93 G;  1BBU A;  2PNH A;  5LMU L;  3W1G A;  4LWC A;  5HGQ A;  2D0O A;  3PO3 H;  4GNX B;  1S40 A;  3UDF A;  2ZM6 L;  1VQ7 A;  2ZJQ A;  4YCW A;  5IYC G;  4LNQ A;  2PQA B;  4JI3 Q;  2YTX A;  3FKI H;  2VQF L;  2NVT H;  2L15 A;  3STB C;  3W1B A;  3CC4 A;  1TWC H;  1PH9 A;  4OO1 I;  2YYZ A;  1V9P A;  4JI6 Q;  1K0R A;  3M4P A;  4GKJ Q;  3FP9 A;  2CFM A;  3HKS A;  1WCM H;  5IP9 G;  1J5E L;  1QVC A;  1I50 H;  1VQC A;  3KLW A;  3AFQ A;  3HOV G;  4B3S Q;  4JV5 Q;  3K80 C;  1IXR A;  3GTG H;  3AYH B;  4DK3 C;  2D0P A;  1DGS A;  3JC6 6;  3KF6 A;  5J3B A;  5JJK A;  1XNR L;  3GTQ H;  1JE5 A;  1G29 1;  4DV5 Q;  4X62 L;  1HNX L;  4L5S A;  4JCV E;  3S1N H;  1VQ5 A;  1BVS A;  4A75 A;  3HOW G;  1IYJ B;  2BH2 A;  2UUA L;  5C0X I;  4DR6 Q;  1N9W A;  3CCJ A;  1SFO H;  1I6H H;  1Q86 C;  1OXS C;  5IYB G;  1VQD A;  1W3S A;  1VQ4 A;  2K5N A;  3S2H H;  3KYH C;  4A3F G;  1VQG A;  2NN6 I;  4BY1 G;  1IBK L;  4LF5 L;  1O7I A;  3CF5 A;  4DR5 L;  3CCL A;  4LF8 L;  3I4O A;  1PFS A;  4A3L H;  4MZ9 A;  1K9M C;  2JQO A;  1CUK A;  3I55 A;  4HID A;  5AJ3 L;  4R4O A;  2ZJR A;  4A3G H;  2ASB A;  4PZ6 A;  1XMQ L;  1C7Y A;  3OYY A;  2LXK A;  3ULL A;  4HJ5 A;  5IWA Q;  1K8A C;  2Q2I A;  3M3Y H;  1YVC A;  1Q7Y C;  1VQJ A;  1HR0 Q;  1E22 A;  5IP7 G;  4DV0 Q;  4XIG S;  3JAM c;  4A3J G;  3CD6 A;  1H95 A;  2ALY B;  3OW2 A;  2A1A A;  4IPC A;  3HOU H;  1YBY A;  4A3I H;  4BBS H;  1JB7 A;  2V1C C;  1LM0 A;  2XTI A;  2ZTE A;  1I3Q H;  1CKO A;  5GAH C;  3CP0 A;  3EIV A;  2I5H A;  3RLF A;  4RMF A;  3I7F A;  5JEA G;  1HR0 W;  2ES2 A;  1A0I A;  4IOA A;  4DV2 L;  2D62 A;  2E5L Q;  2R92 G;  3E9I A;  4JOI A;  1N34 Q;  1KRS A;  1FVI A;  4OX9 L;  2JA5 H;  4PMW A;  2OTL A;  2WP8 J;  3GTM H;  1AE2 A;  4BY7 G;  1WYD A;  2HQL A;  4NB3 A;  2IY5 B;  1L1O C;  3TS0 A;  2IHF A;  5FJ8 G;  1JJ2 A;  5M5Y H;  4LFB L;  1VQI A;  4QJF A;  1VQP A;  1PH2 A;  2YTY A;  4JI4 L;  1HJP A;  4WJ4 A;  3UDG A;  1UWV A;  2BH8 A;  4ALP A;  1YZ6 A;  2B63 G;  3T1H L;  1B7Y B;  1TXY A;  2KHI A;  3HOY H;  1W2B A;  2JA8 G;  4IO9 A;  4DR4 L;  4A4I A;  1CSP A;  3H0G H;  3CAM A;  3TS2 A;  3KF8 B;  1FJG Q;  5IYD G;  2JEA I;  4HIM A;  4AIM A;  2ATW A;  1EWI A;  1HZB A;  4X66 L;  3MEF A;  2JA7 H;  2N78 A;  3A5Z B;  3NEM A;  2R7D A;  3PUZ A;  2HHH L;  3PV0 A;  4JYA Q;  1VQ9 A;  2AKW B;  4DUY Q;  3PO3 G;  1XPR A;  2UUC L;  3A74 A;  3PIO A;  3I4N H;  1VQN A;  2R7Z G;  2WB1 G;  2Q2U A;  4JI5 Q;  1J6Q A;  1LTL A;  2HIV A;  4QGU A;  4JI8 Q;  1LUZ A;  2KCM A;  5C4J H;  4DR1 Q;  4NXN Q;  1MJC A;  4P72 A;  1P8L A;  4YWM A;  4DR2 L;  1XNQ Q;  2CWP A;  1Q1E A;  1PH5 A;  1WCM G;  3FHW A;  3PUX A;  2WB1 E;  2Y0S G;  3BZC A;  4YHH L;  1X55 A;  3CC7 A;  1PH7 A;  4OWW B;  1Q46 A;  4JI2 L;  1EIF A;  1HH2 P;  3GTL H;  2E2I H;  4LFA L;  2K4K A;  2N8N A;  4C2M H;  5M3F H;  1XPO A;  1VQK A;  3CCU A;  1SRU A;  2N3S A;  2VQE Q;  4R4C A;  4DR3 Q;  2UXB Q;  3RZO H;  5BR8 L;  4JC0 A;  1PH4 A;  2KHJ A;  2Y0S E;  1E24 A;  3WWV A;  1YIJ A;  3G4S A;  5GQO A;  2UU9 L;  1Y1V H;  5E7N A;  3F2C A;  3MXN B;  4B3T Q;  3HKZ G;  3TQY A;  2MNA A;  3S1Q H;  2PQA A;  4PG3 A;  3KJO A;  5LMN Q;  1B8A A;  2WAQ G;  4GOP C;  4A3M G;  3DM3 A;  5M3M G;  1LYL A;  4IFD G;  4A3B G;  1VQA A;  1UE1 A;  4B3R Q;  3HKZ E;  3T1Y L;  3PSI A;  2DGY A;  1XMO L;  3CC2 A;  1N32 L;  1KXL A;  1JT8 A;  3U4V A;  4JI1 Q;  2VUM H;  1KD1 C;  3KOJ A;  4B3S L;  3ERS X;  2WAQ E;  2HIX A;  4BXX G;  5LMN W;  4A3G G;  4LFC Q;  3CCE A;  1V43 A;  3U4Z A;  4DV7 Q;  1IBM L;  3GTJ H;  1XTD A;  3CCS A;  4JI7 Q;  4X6A H;  2OQ0 A;  1YHQ A;  2MO1 A;  1NMF A;  1P16 A;  3PGZ A;  3L2P A;  3I56 A;  4A3C G;  1E1T A;  1C9O A;  3CME A;  1EFW A;  2JA6 G;  3NEL A;  4EQ5 A;  3HOZ G;  3S16 H;  3K81 C;  2GVA A;  4LUZ A;  4GLX A;  4X65 Q;  4Y52 H;  3L7Z C;  1EYG A;  1SN8 A;  5FLM H;  3I4M G;  3PF4 A;  3HOU G;  3D31 A;  4BBS G;  2PMZ E;  4DV6 Q;  4X64 Q;  1E3P A;  3B6Y A;  5M5W H;  4JOI C;  2C35 B;  1SR3 A;  4C3I H;  1M90 C;  4UP8 A;  3HFZ B;  3M85 A;  4KI0 A;  4YY3 L;  3J80 i;  2K14 A;  4DUZ Q;  1PH1 A;  3J81 c;  1YEZ A;  1PVO A;  4HJ9 A;  1KHI A;  1A63 A;  4DKA C;  2UXC Q;  1L2F A;  1D7Q A;  3NEN A;  1YJW A;  3GO5 A;  4OXP A;  1QZH A;  1GVP A;  1NJI C;  2BA0 A;  2NZH A;  3F1Z A;  1B70 B;  3LGJ A;  2IX0 A;  4FDB A;  2ZM6 Q;  3S1M H;  1YIT A;  4GS3 A;  4L5R C;  3TEH B;  3PO2 H;  2N49 A;  2VQF Q;  2VNU D;  4JBW A;  5IY0 A;  2F52 A;  4QY7 A;  4DV0 L;  4A3E H;  1M1K C;  1E1O A;  3M4O H;  2YV5 A;  3KFU A;  5C3E G;  2Z6K C;  4PZ7 A;  3PF5 A;  4DV4 Q;  1J5E Q;  3ICE A;  1VS0 A;  2VS1 A;  3S17 H;  2IT1 A;  4MNO A;  4A93 H;  1TWA H;  4OO1 G;  1EOV A;  2JK8 A;  4DPG A;  4OWT B;  4POG A;  1N34 L;  4K0K L;  5C44 G;  1HNZ L;  1E7Z A;  1T9H A;  1X56 A;  1XNR Q;  3H3V H;  2R93 H;  1BBW A;  2NVY H;  1EQQ A;  4O2D A;  2NZO A;  4X62 Q;  1HNX Q;  3BU2 A;  1PH8 A;  4R4T A;  1G6P A;  1FL0 A;  4J15 A;  1KRT A;  1HZ9 A;  5HY6 A;  3CPF A;  1GD7 A;  2GVB A;  4LF6 L;  1IBL L;  1X54 A;  4LF9 L;  2UUA Q;  5IYC H;  1VQ6 A;  4A76 A;  4DV1 Q;  2UUB L;  3OTO L;  5C4X H;  4NXM L;  4YWK A;  2I5M X;  2MO0 A;  4O0A A;  3M9B A;  1VQH A;  3UDI A;  1IBK Q;  1EUJ A;  1PYB A;  3EBE A;  3RLN A;  2E8G A;  1KL9 A;  3IRB A;  5IP9 H;  5C0X G;  1SE8 A;  4DR5 Q;  4LF8 Q;  4JBJ A;  4AH6 A;  4HIO A;  4AQY Q;  2PI2 A;  5M3F G;  3HOV H;  2VW9 A;  4LF4 Q;  2NN6 G;  4BBR G;  2E2H H;  2FXQ A;  5AJ3 Q;  4GNX C;  4LF7 L;  1N36 L;  3RZD H;  3PUV A;  2K5H A;  5JEA J;  3HOX G;  4DUY L;  5JJI A;  1XMQ Q;  2F3I A;  3K7A H;  1K3R A;  3RLO A;  1KIX A;  3D0F A;  4C3J H;  1RL2 A;  1NY4 A;  3HOW H;  3CCR A;  4A3D H;  2QGQ A;  3M4Q A;  3S24 A;  3CCV A;  4KHP L;  2JE6 I;  4DR1 L;  1PH3 A;  1Y1W G;  1EQR A;  3ER0 A;  4A3F H;  1YHB A;  4BY1 H;  4JI0 Q;  1BKB A;  2JJQ A;  2RCN A;  1HNW Q;  2VUM G;  4JG2 A;  2DUD A;  2LXJ A;  3RN2 A;  3H15 A;  1PV4 A;  4B3M Q;  3FKI G;  3Q8D A;  4L5T A;  1N33 L;  4DR3 L;  4DV2 Q;  4DR7 L;  2UXB L;  2AMC B;  4P74 A;  3S1R H;  1A62 A;  2Q2H A;  1TWH H;  3K8A A;  4DV3 L;  3F8T A;  4UP7 A;  5EAY A;  2CQO A;  2Z0S A;  4IJH A;  3H3V I;  4GKK Q;  4IFD I;  1K73 C;  1UE5 A;  1PHJ A;  2A8V A;  3CCM A;  3BZK A;  4WJ3 M;  2UXD L;  3NBH B;  1X3F A;  4ME3 A;  1I94 L;  4JI4 Q;  4IPH A;  4LUV A;  1UE6 A;  4HJ8 A;  5JJL A;  5IP7 H;  3KJP A;  3T1H Q;  1EIY B;  2RF4 A;  3GTO H;  2CCZ A;  4B3R L;  1KQS A;  4XTC S;  5GAE C;  1AE3 A;  4NPS A;  4JI1 L;  4DR4 Q;  3G6E A;  1YHA A;  4JI3 L;  2AWN A;  3E9H A;  2IHE A;  2R92 H;  4POF A;  4TVA B;  4X66 Q;  1Q1B A;  3RNU A;  3VDY A;  1RIP A;  4P75 A;  2HHH Q;  4JI6 L;  2IX1 A;  3S14 H;  1X9N A;  4BY7 H;  5H1S E;  4GKJ L;  1SLJ A;  4L5Q A;  2K50 A;  2UUC Q;  5FJ8 H;  2XGT A;  1U5K A;  4A3L G;  2RHS B;  4R4I A;  5GAG C;  4JV5 L;  4P73 A;  1YI2 A;  4JBK A;  4Y7N H;  4DR2 Q;  1Q81 C;  5ELN A;  1QZG A;  1U0L A;  4DV5 L;  2B63 H;  2WFW A;  1NMG A;  1L0W A;  2YTV A;  2BA1 A;  3STB D;  4YHH Q;  1Q12 A;  4YWL A;  1MKH A;  2JA8 H;  4LFA Q;  3W5O A;  4DR6 L;  4IFD J;  4TQU S;  1X6O A;  5IYD H;  4EX5 A;  2E2J H;  3CMA A;  2UXC L;  1HZC A;  2F4V Q;  2K52 A;  5IE8 A;  3JAM i;  3AQQ A;  3U58 A;  2R6G A;  4A3I G;  4YCV A;  1SRO A;  2KCT A;  4IJL A;  3CXC A;  1VQO A;  3UE0 A;  2UU9 Q;  2H5X A;  1JMC A;  4KHZ A;  2NVX H;  2K5V A;  2R7Z H;  1MJE A;  5GAD C;  2B29 A;  4DNI A;  5C4X G;  2JA5 G;  1QUQ A;  4BA2 I;  1XJV A;  4DV4 L;  4QL5 A;  3F2B A;  3T1Y Q;  1N32 Q;  4H02 A;  4QIW E;  5LMU Q;  1XMO Q;  1VQL A;  4OON A;  1G51 A;  1S72 A;  5IWA L;  4JBM A;  4YCU A;  1GO3 E;  1HR0 L;  2KBN A;  1IBM Q;  1OXX K;  4A3K H;  1Y14 B;  2AWO A;  4C3H H;  1TWF H;  1QUQ B;  4LW1 A;  3GTP H;  3DLL A;  3CPW A;  3HOY G;  1S3O A;  3UE1 A;  1XPU A;  1KC8 C;  1AH9 A;  4IPG A;  3H0G G;  4A3D G;  1OTC A;  4DV1 L;  2E5L L;  3G48 A;  1X65 A;  3EN2 A;  1D8L A;  3KF6 B;  4A3M H;  5M3M H;  2JA7 G;  1FGU A;  4HJA A;  4PZ8 A;  2K75 A;  2EXD A;  3GTK H;  1CKN A;  4A3B H;  4GOP A;  2A19 A;  2KEN A;  3I4N G;  4AQY L;  4HJ7 A;  4UY8 C;  1YJN A;  3U50 C;  3PIP A;  1TWG H;  3CQZ H;  3BJU A;  4APV A;  4YY3 Q;  4LF4 L;  4BXX H;  2CWA A;  4RG1 A;  1YNX A;  3UDX A;  5FLX c;  3J7Z C;  1IL2 A;  2RHQ B;  3TRZ A;  5ELO A;  2ZTD A;  4UPA A;  1I5F A;  1K83 H;  4GN4 B;  5K36 G;  3AEV A;  1Z47 A;  2MQH A;  4R4Q A;  3J7A 5;  4LF5 Q;  1CKN B;  1VQB A;  4GOP B;  4KLK A;  4A3C H;  1VQ8 A;  1VQM A;  3ULJ A;  4P71 A;  5M5X H;  2JA6 H;  4UP9 A;  3HOZ H;  1JJG A;  1WFQ A;  1FJG L;  1GKH A;  1V1Q A;  3S2D H;  4IPD A;  1HZA A;  3TRE A;  1ASY A;  4JI0 L;  1Q8K A;  3I4M H;  1K8G A;  3K7U C;  4JYA L;  1HNW L;  1A8V A;  1Y1V G;  1OXV A;  1IZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...