1CA6A

Intercalation site of hyperthermophile chromosomal protein sso7d/sac7d bound to dna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the chromosomal proteins Sso7d/Sac7d bound to DNA containing T-G mismatched base-pairs
pubmed doi rcsb
molecule tags Structural protein/dna
molecule keywords 5'-D(*GP*TP*GP*AP*TP*CP*GP*C)-3'
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1999-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ca6A00
4XT1B 1O7ZA 2X6GA 1M8AA 2FMMA 5CBEE 3R93A 5JJZA 1WTPA 1HUNA 1HFNA 3MWYW 1ILPA 1O7YA 3GV6A 3MTSA 1WVLA 1ZXTA 2EE1A 2L11A 5CMDA 1XYIA 1BBXC 1E0BA 2HCCA 4NW2A 4X3KA 2L4NA 4MN3A 1J9OA 1NCVA 1PDQA 1RHPA 2DY8A 2KUMA 2VXWA 2X69A 1AZPA 1IKMA 1BO0A 2RA4A 5EJWA 4O42A 4CJ0B 1VMPA 2NYZD 5DNFA 2K03A 5T1IA 4ZKBB 2K04A 4OIKA 1F9RA 4RA8A 2EOTA 4R9WA 1HFGA 2JYOA 4UAIA 1PFMA 3UI2A 1WD1A 1EOTA 1BF4A 1B50A 1DZ1A 1X3QA 1DOLA 2B2WC 1EIGA 1EQTA 2B2WA 2M2LA 4CJ1B 1MGSA 2IL8A 1RTOA 1Q3LA 2MPMA 2NZ1D 1AZQA 1SSOA 1ILQA 1PFBA 2Q8RE 2B2YA 2B2YC 1MI2A 4X3UA 5EPLA 1KNAA 1PFNA 2KEDA 2L12A 5D14A 2K01A 1JE4A 3I91A 5EPJA 4R8IA 2CVRA 4RAUC 1J8IA 2KVMA 2B2VA 2B2VC 3IL8A 2K28A 3D6WA 3QO2A 4DN4M 1RTNA 3DEPA 4QUFA 3G7LA 2B2TA 2B2TC 1HA6A 2Q8TA 3ONAB 5AFWA 4ZAIA 4IUTA 2R3ZA 1HHVA 4XT3B 2HDMA 1GUWA 5EKIA 2H1EA 2KEEA 3LWEA 1U4LA 4HCSA 2N88A 2RSOA 4IUPA 3GV3A 1CA5A 2MP1A 5EPKA 1IL8A 2L1BA 1NAPA 1O80A 1RODA 3Q6SA 1WTQA 3SVMA 1G91A 1U4PA 1HRJA 3HP3A 1G2TA 3I90A 1F9PA 3DEOA 1RJTA 1WTVA 3F2UA 1G2SA 3IFDA 2X6LA 1TVXA 3KBXA 3FPUB 2L9HA 2HDLA 4ZKCB 1CM9A 2DY7A 5CBAE 1QNKA 2B2UA 2B2UC 2HCIA 3TN2A 4ZLTF 1DONA 4X3SA 4MHEA 3TZDA 4IURA 4OIJA 1F2LA 1LV9A 2D9UA 4HEDA 1NR2A 2MGSA 2N55A 1B4OA 4CJ2C 1JICA 1MSHA 2SDFA 3KUPA 1F9SA 1PLFA 1S4ZA 1WTWA 1ICWA 3I3CA 1U4MA 1MSGA 5E4XA 2RSNA 1ESRA 1A15A 1X32A 5D65A 1EIHA 1XX8A 1WD0A 4X3TA 5CORA 2JP1A 4IUVA 1DOKA 4HSVA 1EL0A 4QUCA 2BDNA 2RVLA 3N52A 4LMQD 1B53A 5EQ0A 2KECA 5COYA 1QE6A 1DOMA 1SAPA 2FHTA 4IUUA 4XDXA 1WTOA 1QG7A 1NR4A 1IKLA 1ML0D 1VMCA 1B3AA 1X3PA 2K1BA 3FDTA 2NWGA 1F9QA 2XIWA 3H91A 1C8CA 1CA6A 2FFKB 2FINB 1HUMA 4RWSC 1AP0A 4HAEA 1BNZA 2KOLA 2HUGA 3DM1A 4IUQA 2K05A 5E4WC 5T1GA 4ZK9B 3P7JA 1WTXA 1WTRA 1G6ZA 2J7ZA 2FJ2A 2MJ8A 1U4RA 1B2TA 2EPBA 1SDFA 1KNEA 3I8ZA 4U68A
chains in the Genus database with same CATH superfamily
2OQKA 1IW7D 1WVLA 1Y1VG 1PRTC 4WJ4A 3AFQA 3U58A 1AN8A 1NCVA 2CCZA 4JBWA 3VYRA 5EBDA 1TQOA 1TWCH 1V9PA 5IOCA 3M7NA 2R93B 3TRZA 1WCMB 2EOTA 3PF4A 1MD2D 1BF4A 2F0UA 3PUVA 4XYOA 1KTKA 5LL6X 4I7AA 2UUBL 4HCEA 4NPSA 4MIUA 4X6AH 1EUJA 1Q90A 1PTOH 1BBUA 1UUPA 1HZ9A 2F0WA 4ZRZA 3IL8A 5JVH3 5F2DA 1HTLD 4C3IB 3DEPA 4Q0FA 4IUNA 1FNWA 4DFAA 3ICEA 3ZYYX 4DR5L 1S5CD 2R3ZA 4BXXH 2UXCQ 5M5WB 5EKIA 1SROA 2CWAA 1GUWA 1AFPA 3BDLA 2OQ0A 3E5SA 3K8AA 3M85A 1LM0A 2K33A 5G3LF 3KF8B 3CCEA 3EJIA 3PV0A 1CA5A 1TY0A 3SDZA 1U4PA 4NDXA 1W2BA 4I65A 4BBRH 1SLJA 1YNJC 3U50C 4R4OA 5IYDG 3FPUB 2K7VA 2VZAA 2KHSA 2UU9L 2B2UA 3KK7A 3S2HH 1LV9A 1SNCA 4DNTB 3I4MB 4CJ2C 2F4VL 5IGDA 2R92B 1T5XD 2AUJD 1SYEA 1CT1D 5E4XA 3CCLA 1XNQQ 1KDBA 2RSNA 2WAQB 1HJPA 1L1OA 1XNRL 1MJEA 4GLVB 2NVXH 3TZUA 2R93G 1D8LA 4IUUA 3KF6B 5HGQA 5C3XA 4DNRB 5LMNW 3WWVA 2GVBA 1F2ZA 4LUOA 1CK1A 1AH9A 5M5YB 2FFKB 1WYDA 5C3EB 1S3OA 3MC0B 1YEZA 1HZBA 4ZK9B 4PZ7A 2CH4W 1Y1VH 1Q86C 4DK0A 5CV5A 1B2TA 4RGMA 4H02A 3JAMc 3ND9A 1O7ZA 3BDOA 4DUZQ 4JBMA 2A6ED 1PH8A 3L3OC 2E76C 3L0OA 2Z8LA 1TWCB 1SE8A 1STGA 1IHZA 4A3MH 3CC2A 4X3KA 1K8AC 4F88A 1RHPA 2KUMA 4QF4A 3HGBA 2KCNA 3T56B 2NYZD 1K83B 3VYUA 1RCVD 5T1IA 3E9HA 2DNCA 4BA1I 4KD3A 4K6LA 1BUVT 3DUZA 3PO3B 1PTOC 1STNA 4BY7B 1G8ZD 3I4NB 2Z6KA 2NZ1D 4JYAL 1TIID 4GN4B 3RZOB 2OTJA 3RLOA 1EU3A 1H95A 1IL2A 1VQCA 2F0VA 3FP9A 4LFCL 5ELDA 2EY6A 1JOOA 4G7OC 3S2DH 1SXTA 1SFOH 2C9OA 5ISRA 2B2TA 2ZXPA 4YHHQ 2MHVA 4X62Q 1FNUA 3CW2C 5JPNC 1K0SA 1UE7A 4K2KA 2LXJA 4DAYB 4P75A 3RR5A 2NVTH 1PZJD 2H5XA 1A2UA 4IPGA 3BDCA 4JW0A 2UXDQ 4J15A 2E75C 1ESFA 2EYPA 3I90A 4JI5L 1VQNA 1G2TA 4F7XA 3GTQB 1FYCA 1HR0W 3HOUG 2L9HA 4RG1A 3M4QA 3VR4A 1CM9A 3F2BA 1LTSD 1E2VA 4HEDA 5IP7H 3AEVA 5E3FA 3KDFA 4AYBB 2J4XA 3C46A 3PO3G 3K6OA 1XPRA 3I3CA 1Z47A 1SE4A 2JA9A 5D3DA 1IW7C 4ID6A 4IFDH 1IBLQ 2PQAB 4HSVA 1H9RA 3FMCA 1EWIA 4LMQD 2E2JH 3H0GG 5COYA 1SAPA 1JB7A 2E8GA 5IIFA 3Q22A 1NR4A 4LK1C 1PZID 1X3PA 2K1BA 3FDTA 1DCZA 1CUKA 4DXFA 3I4NH 5JAVA 1BR9A 1A3UA 2NVYH 1SR3A 5KNDA 3BJUA 4BBSB 1WTXA 4BBRG 2BE5D 2J7ZA 1A2TA 3I8ZA 4PZ8A 2O2LD 3FKIH 2EY5A 5IWAQ 1UEAB 4IFDJ 1CSPA 1SMYD 4OXPA 2VL6A 1STBA 3RN5A 2RHQB 1S40A 2F0TA 4H44C 1IKMA 2JA7G 2BDOA 1HH2P 2ALYB 1G291 2K03A 1CFMA 2ATWA 4ODGA 1F9RA 1JR0D 1IXRA 2IPKD 2JYOA 3KF6A 1VQGA 3UI2A 2WB1E 2XNAC 2RDHA 3GTKB 2B2WA 1EQTA 2NVYB 3H15A 1NY4A 1LTAD 3OMCA 2MQHA 3CRLC 2KEDA 1GOZA 4JOIA 1SNOA 4BY1G 2N49A 3K7AB 1JWMD 3QO2A 2D62A 4IPCA 3S16B 5EGTA 1QB5D 2XVSA 3TP7A 4YIJA 5JJLA 4KKTA 3VYTA 1S5ED 4B08A 4DAMA 2JEBI 3C1EA 5C5MA 1CSQA 4HJ5A 1HCZA 4RHSA 2JSOA 2EJGC 1WTQA 2O5JC 3KLWA 3NPPA 3HP3A 1YITA 1NMFA 1AE2A 3RLFA 2BA1A 4O0AA 2DY7A 3FHWA 4RFBA 3TN2A 1LTLA 2DNEA 3K0XA 3PO2H 2A68C 3FVQA 3S9WA 5FLMH 3HOXH 2JXMB 4NMZA 3L7ZC 4CGYB 1ESRA 4F8MA 3J81i 3CXCA 4HMJA 1L2FA 4DV6Q 3E0EA 4HN7A 5I2YA 1V1QA 5IGBA 3H6MA 2KECA 2E2HH 3OW7A 1KDCA 1SYDA 2AMCB 2I5HA 4K6DA 4UP7A 1VQ6A 3H91A 1VQFA 2HD3A 1G51A 4YHHL 2K32A 1H9JA 1K8OA 2Z4HA 3V96A 1E2ZA 3D0FA 5C4JB 2A6HC 1I6HB 3ER0A 4FP5D 4A3GB 1Q8KA 4U673 2F0LA 1KDAA 1K73C 4FF3A 2BA0A 1H9SB 5JEAH 3E6ZX 1T5EA 2L11A 4A3KG 4A3DB 2XWBB 4A3JB 2ZTDA 3QB3A 2CW0D 5IT9L 1TWFB 2K5HA 2E5LL 2E2DC 2K04A 2K5NA 3A54A 2NTSA 1HZAA 3TBIB 1WD1A 4UY8C 3W3AA 1M1KC 1VDZA 2EYHA 2RDFA 4X62L 1JC7A 3SR1A 3UE1A 3BYTB 1SSOA 4DR2Q 2L55A 1JQYD 4JBKA 5EPLA 2L12A 3W1BA 5FO8B 4QB4A 1SMYC 1I4HA 4DK3C 4FO2A 1J8IA 1KXLA 5GQOA 2F0QA 4LFCQ 3T4AC 5EAYA 3G7LA 4JBJA 3NTHA 4RGOS 2Q8TA 4A3BB 4JI8Q 5M5XB 4DR4L 2PW7A 3NK9A 4ILWA 1X54A 4Y7NH 4A3IH 1D2BA 1IL8A 1Q46A 4BY1B 4LF5Q 1HRJA 4K0KL 4PZ6A 2OXPA 2QCPX 1BBWA 2B2UC 3DM3A 2PZUA 4MHEA 2OT2A 2GA4B 3HOWH 2F3IA 3NSWA 1JICA 4KY5A 4Z9CB 3CQZH 1EIFA 4K5XA 3U4ZA 1L1OC 2F0MA 2XN9C 4JI5Q 2VB2X 2Z6BA 2B63G 1TXYA 1PRTD 2OWOA 3HOVH 4GZYC 3S1MH 1BOSA 4JI6L 1N36L 2VQFL 1WTOA 1VMCA 4GKJQ 1HNZL 4QCLA 3OHXC 1HA5A 1JJCB 1B9NA 1NMGA 1V1OA 3S2HB 4DV7Q 1GHKA 4DGZA 2ZXOA 3F1ZA 1S72A 1QZHA 1O7YA 3NBHB 3PSIA 4L5SA 2EYLA 1GUSA 3A7AB 3BG3A 4LFAL 4KY7A 4DAVA 1XPOA 1GJXA 1UE6A 5E7NA 1XTCD 4RA8A 4QL5A 3TS0A 3SK8A 1B70B 1GM5A 1K28A 1X3FA 4ALPA 1O7LA 2A69D 4IPDA 2A6HD 2O4XA 3S24A 4CJ1B 1VQ9A 1PFSA 4KLKA 5KRUA 1ENFA 3OTOL 1PTOF 3WOFA 4JI0Q 2Q2UA 1FL0A 4RAUC 3VR2A 2VUMH 1E1TA 3KJOA 4KI0A 3PUZA 2K28A 3M7GA 5I2XA 4PV1C 4IJLA 3HOYB 2LXKA 1D7QA 1E1OA 1LTTD 3JAML 3GD7A 3CCQA 2HHHQ 4IN3A 2EQSA 2PMZE 4HJ8A 2PPBC 4DR1Q 4RMFA 3PQIA 1L0YB 4JYAQ 1H9KA 5LMNQ 4LF9Q 4TQUS 4XYQA 3AFPA 4YWLA 4JI2L 2WB1G 4KN7C 3ITPA 3MXNA 5KIXA 4CKCA 4ZUJA 2N55A 1TWFH 4C3HG 4MNOA 3K5NA 2NVQB 2D0OA 1LACA 3U9OA 4DV3Q 1S4ZA 1V43A 1QVFA 1EY9A 3QOLA 3H09A 4JC0A 2QDBA 4GNXB 1C4QA 1A63A 2CW0C 4LFAQ 4E6IA 4RCNA 3F2DA 4LWCA 1UE5A 3MEFA 2ENBA 1FVIA 1B3AA 3L2PA 2XIWA 5A2QL 1BXTA 5L37A 3PUYA 4H7BA 4ULLA 2R7FA 1XWEA 2QEJC 2RCFA 1RDPD 4R4QA 4C2MB 2LY7A 4N8X1 1DM0B 1MHWC 1TWGB 3OIPA 3I4OA 1N8RC 2OF1A 1Q1BA 1YNNC 3DWAA 3NQTA 5CBEE 3ULJA 5C4XB 4EQNA 3MTSA 5HGTA 4AQYQ 1EWCA 5IT9E 2Q2TA 3BYYB 1J9OA 4DR3Q 1I6HH 4OX9Q 1XNQL 2B8GA 2RA4A 1ENCA 4CJ0B 4YCVA 1Y8PB 4ZKBB 2SEBD 4LF7Q 3NBIA 3OYYA 4KTAA 4P73A 4GOPA 3CQZB 1VQOA 1EOTA 3T1YL 4EX5A 1HNWL 2BE5C 1R4PB 2IL8A 3KFUA 2AWOA 2OTLA 3H94A 5ELCA 4HIMA 4BY7H 1SYCA 2EYJA 2PMZB 3FKIB 5C0XJ 1YJ9A 2KVMA 4K0KQ 5C4XH 3GTLB 4DR4Q 4A3LG 1B3QA 2MFIA 5C44H 4GKKL 4OWWB 4A3GG 1GUTA 4KD4A 4IUTA 1VQ5A 2R7ZG 4MTNA 4FF1A 3Q0AA 4JI0L 2A19A 4JI8L 2VS1A 4HIDA 1KABA 2MP1A 1RODA 1O80A 2NN6G 2YU9B 3FEWX 3K5MA 1GD7A 1JCKB 1X6OA 3S15B 3CC4A 2RBMA 2HIVA 5EKLA 3ULPA 1NTGA 4G4KA 3GQBA 4JI6Q 4AIMA 1SJHD 4LF8L 1I3QH 1I5FA 1Q1EA 1B1ZA 1J5EQ 1K8GA 1CHQD 5C5LA 3CP0A 2NUCA 3CMEA 1N32L 5JOBA 2PCFB 1CZGA 1I4RA 2EJMA 4JI4L 3N52A 3NP8A 5CC4A 1K3BC 5AJ3L 3PGZA 4C1NI 2F0NA 2Q2IA 1HR0L 1Y8OB 3EA6A 3EBEA 4A3FB 4C3HB 3E9IA 1A62A 2VQEQ 5KGUA 5IP9G 2FINB 2KJXA 1HUMA 3RZDH 2N3SA 2FXQA 3W5OA 1BNZA 1V1PA 4WJWA 5IT9c 1KQSA 1W6JA 1T9HA 3Q24A 2JA8B 4UP8A 1VQ8A 2KENA 4B3MQ 1MIUA 3KJPA 3EVQA 4F87A 1IZ6A 1OXXK 5NUCA 1SBBB 2YTVA 4JI7L 3S1QH 2B63B 1EU4A 2HCCA 2IX3A 2Z0SA 1KRSA 1Z6HA 1X55A 1LUZA 4OO1I 3FPPA 1ET6A 5K5PA 1V8QA 2K14A 1X3EA 4X65Q 3GTOB 1DZ1A 3S2DB 1B50A 2PW5A 2KCCA 2UUCQ 4RGTA 4HJ9A 5H1SE 3OMGA 2B2YC 3X3MA 3P20A 4DUZL 1PFNA 1EY0A 5M5WH 3FRPB 3K58A 3A8KE 5FLMG 5M3FB 2B2VA 2JA8G 4K5WA 4XQJA 2QEXA 1UAPA 1GKHA 4L5QA 4H0LC 2RHSB 3I73A 4OHJA 3VDYA 4A93H 1I94Q 4BBSG 5K36G 4LUZA 2KBNA 3AQQA 2KEEA 2Q8IB 3A8JE 2YV5A 1GXDC 4L8JA 1KAAA 2RSOA 2OEOA 5M5XH 4IUPA 3GV3A 1PHJA 3P1HA 1CKMA 1BKBA 2SNMA 3MFGA 4OWXB 1CKOA 4GKJL 3IFDA 1G2SA 4DV1L 1KL9A 5ELNA 1ASYA 3EIVA 4K8IA 4WFN3 3A56A 2B39A 1CI3M 3QWNA 4PMCA 3B6YA 4DV6L 1LTID 1RIPA 1NSNS 2PI2E 5CORA 1QCBD 1TS2A 1YVCA 3HOWB 4DR7L 2F1MA 4A3DG 5CR3A 5I9OA 1I50B 5LMUL 2EIFA 4IJHA 3SXHA 3MAQA 1KLUD 1SE2A 4AYBE 2F0EA 3J81j 5KEEA 3S1RH 2AQ2B 3DMUA 1U0LA 2R7ZH 3OOCA 4POFA 2JA7H 2HUGA 1PYBA 3L9AX 5M9OA 3S1RB 1EQQA 4ZYSA 1A3TA 5C4XG 1U4RA 4KV6A 3TS2A 4KK7A 3K57A 3GTMB 1VF7A 3FKIG 4DXGA 5DM63 3MWYW 4A3IG 4DR1L 2EE1A 4X66L 2HT1A 3AYHB 3STBD 1TWGH 2X69A 4LAAA 3GDEA 2E2HB 3S14B 2FMCA 4GKKQ 4OIKA 3BVMA 4N9PA 4B3RQ 2PNHA 4DV5Q 1XMOQ 4UPAA 1SYFA 3NQIA 2RF4A 4JI1Q 2F0KA 1AZQA 1LT4D 2NVXB 5E1FA 4GNXC 1FR3A 5AJ3Q 1CTMA 4DR7Q 4HTHA 1EEID 1KNAA 1NBWA 3SE0A 1I4PA 4KHZA 2F0OA 1HTPA 4DR3L 5J22A 2V4DA 4DKAC 3LWUA 2L0CA 5DEHA 2K5QA 2NZHA 2G9HD 3J81E 2UUAQ 3HOUH 3ULLA 2PI2A 3D4DA 1U4LA 3JAMi 3A5UA 3Q6SA 3K5OA 1HNXQ 4Q5VA 1RJTA 3VA7A 4DF7A 4TKOB 5FOBB 4A4IA 4YCUA 4IOCA 4DR2L 2EZVA 1Y8NB 1SN8A 3EN2A 2LKVA 1QVGA 5DAUA 5ELFA 1SNPA 4A3FH 2IJ0A 3K7UC 2E2IB 3SK4A 2R92H 4X3TA 1O7IA 3NEMA 5EQ0A 1HZCA 4MTKA 1QE6A 4JG2A 4NXML 3D4RA 5DM73 3ERSX 3RNUA 4LNQA 2LS01 1HQRD 4FF2A 1AP0A 4HAEA 2ZTEA 3T16A 5C44B 3MXGA 1XTDA 2HIXA 1X3GA 4JV5Q 1TWAH 1ZKOA 2LSSA 1WTRA 4WRDA 2MJ8A 2VUMG 1OTCA 4C2MH 4OEMB 1TWHH 4IOAA 2XSCA 4DNIA 1JOQA 4X64L 2A6EC 1HNZQ 2WFWA 1TWHB 2L4NA 1EYAA 3TEHB 4APVA 2A73B 1AZPA 2EXDA 1NNXA 5M3FG 3S17H 1ICFB 2ZJPA 1EY6A 3GO5A 4DA2A 3NWTA 4JV5L 2CHBD 2K50A 1KHIA 1CQVA 1I3QB 4DUYL 5C4HA 3PO2G 2ZM6L 4CDEC 2PQAA 1X56A 3G6EA 1A0IA 3KDFB 4POGA 1EY5A 4QJFA 4JPBW 1PTOD 3HG9A 3A55A 4IO9A 4R8NA 2PNRC 1GUNA 3CHBD 4B3SQ 1SNQA 1PRTB 3IAYA 5J3BA 4DV5L 1XMOL 3STBC 3GTJB 5D3IB 2VY3A 3RZOH 2R7ZB 4NXNQ 3MEHA 3GTPB 3J80c 3Q23A 2N88A 4DR5Q 5LMNL 4EGVA 5EPKA 1DD2A 1VQDA 2AWNA 2IHEA 5JJIA 3CRKC 2YTYA 1LTRD 2HHHL 2SNSA 3T1HQ 2F0JA 2CFMA 4A3JH 3I4NG 1HXYD 3KLSX 3GTQH 4WORA 2WINB 4LJZC 3E3XA 5IGCA 2VNUD 3T51B 2AQ1B 2IX0A 1F9SA 3CMAA 3HOWG 3J7AF 3DHQA 2IW3A 2NB0A 3O13A 2ASBA 2DJFC 3CCRA 1EL0A 4CKEA 3PO2B 3TQYA 3OIQA 3HZXA 4DV4Q 4J1MA 2AKWB 3J81L 3CCJA 4HMIA 3EROA 2I5LX 4IQZA 2OCEA 1HNWQ 1PYWD 4PMBA 3QIAA 4OO1H 1C8CA 2YYZA 5A35A 1OXSC 4UDUC 2D0PA 3MXUA 4FXKC 4LF7L 1F77A 5ELEA 4A3BG 2ICIA 3A74A 3RZDB 2F0GA 4KHPL 3M3YB 1LO5D 4A3IB 4NKLA 5IYBH 3WDNA 4XT1B 1M8AA 4KN4C 5IGGA 1HFNA 3H0GH 5KYLA 1EY8A 3UDXA 4XIGS 4TVAB 3DWPA 3T1HL 3PF5A 4X66Q 1VMPA 3SEBA 2LFNA 2WAQG 3D8GA 5IP7G 4QQBX 3KLRA 3JC66 2A1AA 4KMUC 2I07B 2B2WC 4HIKA 1MGSA 1Q3LA 5J1ZA 3N6RA 4C1NK 3QG1A 2IWHA 3CCVA 2R92G 2ID0A 2WIIB 5C4ZA 4X3UA 1STYA 1ENAA 5D14A 4JOIC 4C3IH 1JE4A 4EVOA 2F3VA 1CKNB 1IYUA 4B3SL 3TP5A 2DN8A 2BOSA 1VQJA 2K52A 4ZQ3A 5BN4A 2F0DA 1HA6A 1VQAA 1EYCA 4ZAIA 4HJ7A 4JI2Q 4C3JB 3HFZB 1YHAA 3KF8A 3GP7A 2ZM6Q 4A3CH 3J7A5 4K2LA 5IYBG 5C3WA 4P2CB 2UUBQ 3S1NH 4XXEA 1VCIA 2EY1A 5FLXc 4MZ9A 3HKZG 4FXGC 2HQLA 2VQFQ 4ZKCB 2JA6B 2F3WA 1X9NA 3V2TA 2CQOA 3M4OH 3TZDA 3TDQA 3HOXG 2JEAI 1O78A 1D1IA 1B4OA 4LF4Q 3AU7A 2K4KA 3I72A 3W2DA 4CHTB 4EQ5A 5D65A 2PQEA 4CDDC 4AYBG 1OXTA 1II3A 2MNAA 1VQBA 4HSPA 4QUCA 4YWKA 4PG3A 1KLGD 2F0SA 3PIPA 2RKSA 3MFYA 1MKHA 1ML0D 1M4VA 3VA5A 3R2TA 1JB3A 1VQLA 4A3BH 2F0FA 3CAMA 3M4YA 3H3VH 4A3JG 3IFTA 4DV0L 1U5KA 1PH9A 1HPCA 1KNEA 2K5DA 2X6GA 1U9RA 1ZEQX 5FK9C 3CCMA 1SRUA 2R93H 3NENA 3DWQA 5IODA 2Y0SG 1FGBD 3PIP3 3A8IE 3Q8DA 4G57A 1IBKQ 1RD9D 5EKKA 1LT5D 3CKIB 2NVQH 2I0QA 3R8BA 4S3SA 1EQVA 4UAIA 1LLRD 1WI5A 1STEA 2K75A 1RTOA 2MPMA 3PCOB 2GN5A 5IYDH 4GNXA 1QVCA 2F4VQ 1OXUA 1SFOB 1K8MA 5J39A 1BCPF 1YHQA 4IALA 1D6EC 3KBGA 3PUXA 1EYDA 4M1UB 3U4VA 3UDIA 1QILA 4BXXG 2BH2A 1E7ZA 4QUFA 3G6JB 2B2TC 4I7ZC 5M3FH 4IFDI 1P16A 5AFWA 1TS3A 4KKUA 2Z4IA 1Y1VB 5GAEC 2C35B 1Y14B 2VUMB 2PZTA 1EIYB 5JVG3 3R3OA 5C0XI 2L1BA 3WOEA 3KOJA 2CQAA 3CD6A 3F2UA 4RHRA 2X6LA 4IFDG 1PRTF 1SNDA 3SHLA 2HDLA 4OONA 4A93G 1LT6D 3W1GA 4BWGB 4EQPA 1ONLA 2E74C 3RUZA 4N8FA 2MGSA 4LF6L 1L0WA 2IHFA 4JI3L 1GUGA 2SDFA 3KUPA 4J6HA 1DGSA 1EIHA 3S1QB 2E2JB 3S16H 2A69C 1L1OB 3HOUB 1P8LA 4FNFA 4CDCC 4QGUA 1LTGD 3J80i 1PH6A 2JA6G 3CPWA 4IPHA 2XGTA 4A3CG 2R61A 1EQRA 1VQKA 4R4CA 1IKLA 1HR0Q 1D5ZC 1F9QA 1Y69U 4DV2L 3G4SA 3D6CA 2A5HA 2E5LQ 2KOLA 2M9VA 5JPMC 3HOZB 1CQFA 3C2PA 5CYUA 1SNMA 5T1GA 3BS1A 3P7JA 4C3JH 4JI1L 4CDFC 1YNND 2EPBA 3RMHA 4KHVA 4QMGA 4C3IG 5JJZA 5FO7B 4LF5L 3HOYG 3S1NB 2WACA 2IT1A 3HKSA 2VXWA 4DR6L 4DV1Q 1C9OA 3D31A 4OL7A 5EJWA 3CPFA 4NB3A 2WKDA 2F0PA 1Z9FA 5LHY1 1DXMA 3NXWA 4GOPB 4LF6Q 1DJRD 1QOHA 1XJVA 5GAGC 1Q8IA 1PFMA 2NBFA 2N8NA 1GO3E 5IGEA 1DOLA 1IYJB 1EIGA 1YNXA 4DV0Q 1B7YB 1E22A 2AUKA 1TY2A 1UEBA 1BDOA 1PH4A 3X3NA 4JI4Q 4A3MG 1ILQA 4C56C 1K9MC 5HY6A 3C1FA 4OELB 1TS4A 2K01A 3TREA 3K81C 5CV8A 2TSSA 3MXNB 3ZJYC 1E3PA 1UNSA 5DLQE 2F03A 1RTNA 2WB1B 2L15A 2UUCL 1PZKD 1Y1WB 3KLSA 3T1YQ 1YI2A 4OO1G 4FVMA 2R6GA 4IZ8A 2L5TA 4JK1C 4DV4L 2Y0SE 3BVZA 1NAPA 2G9DA 3OWFA 1EEFD 3SVMA 3I2ZA 1JWUD 1LT3D 1YJNA 3DEOA 3H3VI 4G7HC 1ZYRC 4ME5A 5CBAE 1EFWA 1BCPB 1PH7A 3QR8A 2MO1A 4A3EB 4KJNA 2EYOA 2PZWA 3NUCA 4FF4A 3SGIA 1EOVA 1EFID 1I4GA 1ICWA 5I6YA 3I56A 1F2YA 1Q12A 1LYLA 4XQQA 4OGQC 4BY7G 1TR5A 4A3DH 1FD7D 4O2DA 4GS3A 4K5VA 1OXVA 4IUVA 1B44D 2JQOA 2VQEL 3S14H 1DOMA 3F2CA 1YZ6A 1CHPD 1D5MC 1PH1A 1UE1A 5C0XH 1WCMG 1QWYA 1ZYRD 3TMEA 5EBCA 5GROA 3GTMH 4BBRB 2UXBQ 1Q82C 2JA5B 1I6VC 3QJYA 3BZKA 1YIJA 4FYDA 2CKZB 3QOJA 4DV3L 3LX0A 4Y52H 1BVSA 3VR5A 2KCTA 2N78A 4QIWB 3HEJA 3J7ZC 1VQ4A 5G3LD 5IE8A 2K6AA 5C3EG 4GLAC 4NW2A 4BBSH 2QF7A 4GN5A 1Y1WG 1VQEA 1I4QA 2ZJRA 2LMCB 3VR6A 4R9WA 4UP9A 2B29A 2K5WA 5FJ8H 1K83H 1HQMC 1QUQB 3HRZC 4V0BA 4DV7L 1WTHA 1N36Q 4NXNL 1A6XA 1VF5C 3C3LA 3RD4A 1LABA 2Q8RE 1MI2A 4YY3L 3LNNA 3MHBA 4J8QA 4PQXA 2DUDA 1I50H 5BR8L 4FDBA 5EPJA 5FO9B 2DJGC 3GTKH 1UWVA 3A5ZB 4C3HH 3K5LA 4DAYA 1XPUA 3I4MG 2IY5B 3D6WA 1VQIA 2JA7B 3HOZH 4LW1A 4PMWA 3CC7A 2ZT9C 2JA8H 1VQPA 2VW9A 4HCSA 5HURA 4EQOA 3NTIA 5M3MG 4YY3Q 1J5EL 4YCWA 3OW2A 2AHOB 1IBML 4A76A 5A2QE 4A3EH 3KBXA 4OX9L 5BR8Q 2RQXA 1QNKA 1DONA 2B8FA 4X3SA 4A3FG 4ZUIA 2HQEA 1PH5A 2QKIC 1XXGA 1CZWA 4ABNA 1PLFA 2KA7A 3GTLH 3GTOH 1WTWA 1B9MA 5IYCG 3P75A 1XX8A 1WD0A 1SMXA 1PVOA 3S1MB 3KYHC 2QGQA 1GUOA 1BCPC 2RVLA 1E2WA 1B53A 2F0HA 5BN3A 1N34Q 5I9PA 1QG7A 2TMPA 3CCUA 4NXMQ 4WJ3M 2RCNA 3GTGH 2F0IA 2AQ3B 2H4OA 3BZDB 4IUQA 1ASZA 2K05A 3V05A 3LGJA 3K80C 5IP9H 5JJKA 4QY7A 4ZCKA 1EZ8A 2NN6H 4U68A 2ZJQA 1N34L 4R4TA 1RF2D 1WTPA 2UXDL 1F2MA 3M4PA 5TSSA 5CV6A 1BBXC 1MJCA 2XTIA 1S5FD 2JA5G 1VQHA 3DLLA 4LF9L 3I70A 2DGYA 4A3GH 2PO4A 4DU9A 5DNFA 4A3LH 4B3TQ 1SE3A 3NWSA 1HFGA 1Z7TA 5GADC 3A7LA 1PTOB 3G48A 1KIXA 1EYGA 1WFQA 1KC8C 3UDGA 1JJGA 1PFBA 2XWJB 2B2YA 1YNJD 5IY0A 3J80E 3GTJH 5KNCA 3OWEB 3MVVA 3I91A 1QZGA 3I55A 3G71A 4RGNA 4LFBL 1WOCA 4DN4M 4BS9A 1H9MA 5C44G 1PV4A 1HHVA 2HDMA 3A0JA 3NELA 1N32Q 1L0XB 1JOKA 4G7ZC 1FGUA 3RLNA 1EWHA 3LWEA 4A75A 2EVBA 4K8JA 2XRQD 2NTTA 3GTGB 2EXZA 1JORA 4LFBQ 2KCMA 2Q2HA 2PYKA 4ME3A 4GLXA 1K0RA 2UXCL 4OIJA 3TP8A 2QDLA 3J80L 4JI7Q 2GVAA 2QILA 4LUVA 1QJOA 4B9WA 3K7AH 1U4MA 3PIOA 4KJOA 1X32A 1YHBA 4HJAA 4A3MB 1XMQQ 4A93B 4DK6C 1QUQA 1DOKA 5I6WA 1HNXL 3CCSA 2A74C 3NBHA 2ES2A 3J7YW 3SK5A 4AH6A 2FHTA 1R4QB 1SYBA 2P5ZX 3HKZB 3ERQA 5KYIA 5LMUQ 5CV7A 1CA6A 4P72A 5ELBA 5K36H 1S5BD 1JJ2A 4RWSC 3OTOQ 1RKNA 3H3VC 3DM1A 1Q7YC 3M4OB 4L5TA 2EYFA 1FJGQ 4N9TA 4A3KH 1G6ZA 1DYQA 5IGFA 1SDFA 4CBVA 1B8AA 5C4JH 1PH3A 2FMMA 4B3RL 3R93A 1WJJA 1HUNA 3BU2A 4DAPA 4DV2Q 1ZXTA 4RCOA 2D5DA 3VYSA 3OSOA 1XYIA 1E0BA 1J6QA 3TP6A 2BCOA 4MN3A 1D1KA 2DY8A 3CU7A 4AQYL 1JE5A 1BO0A 4YWMA 4O42A 4X65L 1N33Q 3ND8A 5IYCH 3MA2B 4JI3Q 4XTCS 3NHHA 3I4MH 2KHJA 4XQNA 3K0YA 2NVTB 4GOPC 2EY2A 5CV4A 2SOBA 4RKLA 1I94L 2Z6KC 2V1CC 4A3EG 2Z1CA 1STAA 2I46A 5LL6S 3AMUA 1R9TH 3I4LA 3MZ5A 2Y0SB 5M3MH 2NN6I 4B9XA 3CF5A 4R8IA 1H9SA 1TT2A 4JCVE 1SEBD 2UUAL 5M5YH 3AB9A 1K3RA 1RL2A 1C48A 3HOZG 3ONAB 3URYA 4JVZA 4RH6A 2H1EA 5GAHC 3MXPA 3K59A 1G91A 3NTKA 1ET9A 1NJIC 2IX1A 1JWSD 5JEAJ 1NUCA 1IYVA 1WTVA 1TVXA 3D3RA 3UE0A 4ZLTF 2R7DA 2EJFC 4K14A 1R9TB 2XRSD 2D9UA 1A3VA 5FJ8G 1PXUA 1KAWA 3E0JA 4BY1H 4LF8Q 1WCMH 4L63B 1PMRA 1AE3A 4H13C 4O1NA 1LTBD 4DR6Q 1W6KA 4M8AA 5I4DA 3HOVG 1C0AA 2I5MX 2B63H 2KQ3A 1PYSB 4X64Q 1Y1WH 4B3TL 4FXDA 2CH4A 5C3EH 1STHA 1W3SA 3DXJC 5FLXE 4R1JA 2E2IH 4P71A 2M00A 1TU2B 1IBKL 2WKCA 4OWTB 4XDXA 4QIWE 2RDGA 4TSSA 1A8VA 4RKBA 1SYGA 1BQQT 1GHJA 2NWGA 2WV6D 2YTXA 1FNVA 2CWPA 4HR7B 1IBLL 3EQLC 2NZOA 2MO0A 5E4WC 3EFXD 3BVGA 1S5DD 3UDFA 3F8TA 2C5CA 2FJ2A 5C0XG 5M3MB 3HS0C 3HKZE 1EZ6A 1ILPA 5IWAL 3GV6A 3RN2A 2YU9H 3IRBA 5CMDA 1PA6A 1EY7A 4R4IA 1PDQA 1SJED 1FJGL 2EDGA 1X65A 3HOVB 4DUYQ 1M90C 4NP5A 2ZXRA 3H0GB 4L5RC 2Z9HA 4P74A 2ZTCA 4L6TB 2WP8J 1X3QA 2M2LA 2QA4A 3S17B 3PIO3 1VQ7A 2JA5H 3I7FA 4LF4L 1N33L 1KD1C 3IKJA 2QW7A 4CKBA 2B3GA 2F52A 3PO3H 4KHPQ 1QNUA 2CVRA 3HOXB 2B2VC 3D4WA 1IBMQ 2ICEC 1VQMA 4HIOA 5ELOA 3PUWA 1TS5A 4Y7NB 4UHVA 2EYMA 1XNRQ 4XT3B 1YBYA 3M3YH 1YJWA 3BZCA 3HOYH 1GVPA 1BCPD 2WAQE 1JMCA 5KNBA 2G5DA 1F9PA 3VR3A 1V1PB 4C3JG 2UU9Q 1Q81C 4TRDA 1OO9B 3GTPH 1D5XC 2HCIA 1TWAB 4DPGA 2A68D 4IURA 5FLXL 3R2IA 1F2LA 3M9BA 3T53B 1MBYA 1NR2A 4V190 2UXBL 3PMFA 2D2CC 2JJQA 1MSHA 1CKNA 1E24A 3SK6A 1AEXA 5CGKA 1XMQL 1JT8A 4GN3B 2MUYA 3S15H 3J7AV 1MSGA 2JA6H 1A15A 1AW7A 2JK8A 1C7YA 5C6AA 1NE3A 2K5VA 3J81c 3OPOA 2JP1A 4PNYA 3JAME 2O5IC 1G6PA 1N9WA 2BDNA 2J0TD 4B3ML 2KHIA 3T13A 5JEAG 4KKSA 3TSSA 2JN4A 4A3KB 3U9SA 1PH2A 5CV9A 4DK1A 2VB3X 1VS0A 1TKWB 4KY6A 5BN5A 2JE6I 2F4IA 1KRTA 1EY4A 1I4XA 3NE5B 5FKAC 2BH8A 4BA2I 2A8VA
chains in the Genus database with same CATH topology
1IW7D 1WVLA 1PRTC 1AN8A 1NCVA 4JBWA 3VYRA 5EBDA 1TQOA 5IOCA 3M7NA 2R93B 1WCMB 2EOTA 1MD2D 1BF4A 2F0UA 3PUVA 4XYOA 1KTKA 5LL6X 4HCEA 4MIUA 1Q90A 1PTOH 1UUPA 2F0WA 4ZRZA 3IL8A 5JVH3 5F2DA 1HTLD 4C3IB 3DEPA 4Q0FA 4IUNA 1FNWA 4DFAA 3ZYYX 1S5CD 2R3ZA 5M5WB 5EKIA 1GUWA 1AFPA 3BDLA 3E5SA 3M85A 2K33A 5G3LF 3EJIA 3PV0A 1CA5A 1TY0A 3SDZA 1U4PA 4NDXA 4I65A 1YNJC 3FPUB 2K7VA 2KHSA 2B2UA 3KK7A 1LV9A 1SNCA 4DNTB 3I4MB 4CJ2C 5IGDA 2R92B 1T5XD 2AUJD 1SYEA 1CT1D 5E4XA 1KDBA 2RSNA 2WAQB 3TZUA 4IUUA 5C3XA 4DNRB 1F2ZA 1CK1A 5M5YB 2FFKB 5C3EB 3MC0B 4ZK9B 4DK0A 5CV5A 1B2TA 4RGMA 3ND9A 1O7ZA 3BDOA 2A6ED 3L3OC 2E76C 2Z8LA 1TWCB 1STGA 1IHZA 4X3KA 4F88A 1RHPA 2KUMA 4QF4A 3HGBA 2KCNA 3T56B 2NYZD 1K83B 3VYUA 1RCVD 5T1IA 2DNCA 4BA1I 4KD3A 4K6LA 1BUVT 3DUZA 3PO3B 1PTOC 1STNA 4BY7B 1G8ZD 3I4NB 2NZ1D 1TIID 3RZOB 1EU3A 2F0VA 5ELDA 2EY6A 1JOOA 4G7OC 1SXTA 2C9OA 5ISRA 2B2TA 2ZXPA 2MHVA 1FNUA 5JPNC 4K2KA 1PZJD 1A2UA 3BDCA 2E75C 1ESFA 2EYPA 3I90A 1G2TA 4F7XA 3GTQB 1FYCA 2L9HA 3VR4A 1CM9A 1LTSD 1E2VA 4HEDA 5E3FA 4AYBB 2J4XA 3C46A 3K6OA 3I3CA 1Z47A 1SE4A 5D3DA 1IW7C 4ID6A 4IFDH 4HSVA 1H9RA 3FMCA 4LMQD 5COYA 1SAPA 5IIFA 3Q22A 1NR4A 4LK1C 1PZID 1X3PA 2K1BA 3FDTA 1DCZA 4DXFA 5JAVA 1BR9A 1A3UA 5KNDA 4BBSB 1WTXA 2BE5D 2J7ZA 1A2TA 3I8ZA 2O2LD 2EY5A 1UEAB 4IFDJ 1SMYD 1STBA 2F0TA 4H44C 1IKMA 2BDOA 1G291 2K03A 1CFMA 4ODGA 1F9RA 1JR0D 2IPKD 2JYOA 3UI2A 2XNAC 2RDHA 3GTKB 2B2WA 1EQTA 2NVYB 1LTAD 3OMCA 3CRLC 2KEDA 1GOZA 1SNOA 3K7AB 1JWMD 3QO2A 2D62A 3S16B 5EGTA 1QB5D 2XVSA 3TP7A 4YIJA 4KKTA 4B08A 1S5ED 3VYTA 2JEBI 3C1EA 5C5MA 1HCZA 4RHSA 2JSOA 2EJGC 1WTQA 2O5JC 3NPPA 3HP3A 3RLFA 2BA1A 2DY7A 4RFBA 3TN2A 2DNEA 2A68C 3FVQA 3S9WA 2JXMB 4NMZA 3L7ZC 4CGYB 1ESRA 4F8MA 4HMJA 4HN7A 5I2YA 5IGBA 3H6MA 2KECA 3OW7A 1KDCA 1SYDA 4K6DA 3H91A 2K32A 1H9JA 1K8OA 2Z4HA 3V96A 1E2ZA 5C4JB 2A6HC 1I6HB 4FP5D 4A3GB 4U673 2F0LA 1KDAA 4FF3A 2BA0A 1H9SB 5JEAH 3E6ZX 1T5EA 2L11A 4A3DB 2XWBB 4A3JB 3QB3A 2CW0D 5IT9L 1TWFB 2E2DC 2K04A 3A54A 2NTSA 3TBIB 1WD1A 3W3AA 1VDZA 2EYHA 2RDFA 1JC7A 3SR1A 3BYTB 1SSOA 2L55A 1JQYD 5EPLA 2L12A 5FO8B 4QB4A 1SMYC 1I4HA 4FO2A 1J8IA 2F0QA 3T4AC 3G7LA 4RGOS 3NTHA 2Q8TA 4A3BB 5M5XB 2PW7A 3NK9A 4ILWA 1D2BA 1IL8A 4BY1B 1HRJA 2OXPA 2QCPX 2B2UC 2PZUA 2OT2A 4MHEA 2GA4B 3NSWA 1JICA 4KY5A 4Z9CB 4K5XA 2F0MA 2XN9C 2VB2X 1PRTD 4GZYC 1BOSA 1WTOA 1VMCA 4QCLA 3OHXC 1HA5A 1B9NA 1V1OA 3S2HB 1GHKA 4DGZA 2ZXOA 1O7YA 2EYLA 1GUSA 3A7AB 3BG3A 4KY7A 4DAVA 1GJXA 1XTCD 4RA8A 3SK8A 1O7LA 2A69D 2A6HD 2O4XA 4CJ1B 5KRUA 1ENFA 1PTOF 3WOFA 4RAUC 3VR2A 4KI0A 3PUZA 2K28A 3M7GA 5I2XA 4PV1C 3HOYB 1LTTD 3JAML 3GD7A 4IN3A 2PPBC 1L0YB 1H9KA 4TQUS 4XYQA 4KN7C 3ITPA 3MXNA 5KIXA 4CKCA 4ZUJA 2N55A 4C3HG 3K5NA 2NVQB 1LACA 3U9OA 1S4ZA 1V43A 1EY9A 3QOLA 3H09A 2QDBA 1C4QA 2CW0C 4E6IA 4RCNA 2ENBA 1B3AA 2XIWA 5A2QL 1BXTA 3PUYA 4H7BA 4ULLA 1XWEA 2QEJC 1RDPD 4C2MB 2LY7A 1DM0B 1TWGB 3OIPA 2OF1A 1Q1BA 1YNNC 3DWAA 3NQTA 5CBEE 5C4XB 4EQNA 3MTSA 5HGTA 1EWCA 5IT9E 3BYYB 1J9OA 2B8GA 2RA4A 1ENCA 4CJ0B 1Y8PB 4ZKBB 2SEBD 3NBIA 4KTAA 3CQZB 1EOTA 2BE5C 1R4PB 2IL8A 2AWOA 3H94A 5ELCA 1SYCA 2EYJA 2PMZB 3FKIB 5C0XJ 2KVMA 3GTLB 1GUTA 4KD4A 4IUTA 4FF1A 3Q0AA 1KABA 2MP1A 1RODA 1O80A 2NN6G 2YU9B 3FEWX 3K5MA 1JCKB 3S15B 2RBMA 5EKLA 4G4KA 3GQBA 1SJHD 1Q1EA 1B1ZA 1CHQD 5C5LA 2NUCA 5JOBA 2PCFB 1CZGA 1I4RA 2EJMA 3N52A 3NP8A 5CC4A 4C1NI 2F0NA 1Y8OB 3EA6A 4A3FB 4C3HB 5KGUA 2FINB 2KJXA 1HUMA 1BNZA 1V1PA 4WJWA 1W6JA 3Q24A 2JA8B 3EVQA 4F87A 1OXXK 5NUCA 1SBBB 2B63B 1EU4A 2HCCA 2IX3A 1Z6HA 4OO1I 3FPPA 1ET6A 5K5PA 1V8QA 3GTOB 1DZ1A 3S2DB 1B50A 2PW5A 2KCCA 4RGTA 3OMGA 2B2YC 3X3MA 3P20A 1PFNA 1EY0A 3FRPB 3K58A 3A8KE 5M3FB 2B2VA 4K5WA 4XQJA 1UAPA 4H0LC 3I73A 4OHJA 5K36G 2KEEA 2Q8IB 3A8JE 1GXDC 4L8JA 1KAAA 2RSOA 2OEOA 4IUPA 3GV3A 3P1HA 2SNMA 3MFGA 3IFDA 1G2SA 4K8IA 4WFN3 3A56A 2B39A 1CI3M 3QWNA 4PMCA 1LTID 1NSNS 5CORA 1QCBD 1TS2A 3HOWB 2F1MA 5CR3A 5I9OA 1I50B 3SXHA 3MAQA 1KLUD 1SE2A 2F0EA 5KEEA 2AQ2B 3DMUA 3OOCA 2HUGA 3L9AX 5M9OA 3S1RB 4ZYSA 1A3TA 1U4RA 4KV6A 3GTMB 3K57A 4KK7A 1VF7A 4DXGA 5DM63 3MWYW 2EE1A 2X69A 4LAAA 2E2HB 3S14B 2FMCA 4OIKA 3BVMA 4N9PA 1SYFA 3NQIA 2F0KA 1AZQA 1LT4D 2NVXB 5E1FA 1FR3A 1CTMA 4HTHA 1EEID 1KNAA 3SE0A 1I4PA 4KHZA 2F0OA 1HTPA 5J22A 2V4DA 3LWUA 2L0CA 5DEHA 2K5QA 2G9HD 3J81E 3D4DA 1U4LA 3Q6SA 3K5OA 4Q5VA 1RJTA 3VA7A 4DF7A 4TKOB 5FOBB 2EZVA 1Y8NB 2LKVA 5DAUA 5ELFA 1SNPA 2IJ0A 2E2IB 3SK4A 4X3TA 5EQ0A 1QE6A 3D4RA 5DM73 2LS01 1HQRD 4FF2A 1AP0A 4HAEA 3T16A 5C44B 3MXGA 1ZKOA 1WTRA 4WRDA 2MJ8A 2XSCA 1JOQA 2A6EC 1TWHB 2L4NA 1EYAA 1AZPA 2A73B 1EY6A 3GO5A 4DA2A 3NWTA 2CHBD 1CQVA 1I3QB 5C4HA 1EY5A 1PTOD 3HG9A 3A55A 4R8NA 2PNRC 1GUNA 3CHBD 1SNQA 1PRTB 3IAYA 3GTJB 5D3IB 2R7ZB 3MEHA 3GTPB 3Q23A 2N88A 4EGVA 5EPKA 1DD2A 2AWNA 3CRKC 1LTRD 2SNSA 2F0JA 1HXYD 3KLSX 4WORA 2WINB 4LJZC 5IGCA 2VNUD 3T51B 2AQ1B 2IX0A 1F9SA 3J7AF 3DHQA 2IW3A 2NB0A 3O13A 1EL0A 4CKEA 3PO2B 3OIQA 3HZXA 4J1MA 3J81L 4HMIA 3EROA 4IQZA 1PYWD 4PMBA 3QIAA 4OO1H 1C8CA 2YYZA 5A35A 1OXSC 4UDUC 3MXUA 4FXKC 1F77A 5ELEA 2ICIA 3RZDB 2F0GA 3M3YB 1LO5D 4A3IB 4NKLA 3WDNA 4XT1B 1M8AA 4KN4C 5IGGA 1HFNA 5KYLA 1EY8A 4XIGS 3DWPA 1VMPA 3SEBA 2LFNA 3D8GA 3KLRA 4KMUC 2I07B 2B2WC 1MGSA 1Q3LA 5J1ZA 3N6RA 4C1NK 3QG1A 2IWHA 2ID0A 2WIIB 5C4ZA 4X3UA 1STYA 1ENAA 5D14A 1JE4A 4EVOA 2F3VA 1IYUA 3TP5A 2DN8A 2BOSA 4ZQ3A 5BN4A 2F0DA 1HA6A 1EYCA 4ZAIA 4C3JB 3KF8A 3GP7A 4K2LA 5C3WA 4P2CB 4XXEA 1VCIA 2EY1A 4FXGC 4ZKCB 2JA6B 2F3WA 3V2TA 3TZDA 3TDQA 2JEAI 1O78A 1D1IA 1B4OA 3AU7A 3I72A 3W2DA 4CHTB 5D65A 2PQEA 1OXTA 1II3A 4HSPA 4QUCA 1KLGD 2F0SA 2RKSA 3MFYA 1ML0D 1M4VA 3VA5A 3R2TA 1JB3A 2F0FA 3M4YA 3IFTA 1HPCA 1KNEA 2K5DA 2X6GA 1U9RA 1ZEQX 5FK9C 3DWQA 5IODA 1FGBD 3PIP3 3A8IE 4G57A 1RD9D 5EKKA 1LT5D 3CKIB 3R8BA 4S3SA 1EQVA 4UAIA 1LLRD 1STEA 1RTOA 2MPMA 1OXUA 1SFOB 1K8MA 5J39A 1BCPF 4IALA 1D6EC 3KBGA 3PUXA 1EYDA 4M1UB 1QILA 4QUFA 3G6JB 2B2TC 4I7ZC 4IFDI 5AFWA 1TS3A 4KKUA 2Z4IA 1Y1VB 2VUMB 2PZTA 5JVG3 3R3OA 5C0XI 2L1BA 3WOEA 2CQAA 3F2UA 4RHRA 2X6LA 4IFDG 1PRTF 1SNDA 3SHLA 2HDLA 1LT6D 4BWGB 4EQPA 1ONLA 2E74C 3RUZA 2MGSA 1GUGA 2SDFA 3KUPA 4J6HA 1EIHA 3S1QB 2E2JB 2A69C 3HOUB 4FNFA 1LTGD 2R61A 1IKLA 1D5ZC 1F9QA 1Y69U 3D6CA 2A5HA 2KOLA 3HOZB 2M9VA 5JPMC 3C2PA 1CQFA 5CYUA 1SNMA 5T1GA 3BS1A 3P7JA 1YNND 2EPBA 3RMHA 4KHVA 4QMGA 4C3IG 5JJZA 5FO7B 3S1NB 2WACA 2IT1A 2VXWA 3D31A 4OL7A 5EJWA 2WKDA 2F0PA 5LHY1 1DXMA 3NXWA 1DJRD 1QOHA 1Q8IA 1PFMA 2NBFA 5IGEA 1DOLA 1EIGA 2AUKA 1TY2A 1BDOA 3X3NA 1ILQA 4C56C 3C1FA 1TS4A 2K01A 5CV8A 2TSSA 1UNSA 2F03A 1RTNA 2WB1B 1PZKD 1Y1WB 3KLSA 4OO1G 4FVMA 2R6GA 4IZ8A 2L5TA 4JK1C 3BVZA 1NAPA 2G9DA 3OWFA 1EEFD 3SVMA 1JWUD 1LT3D 3DEOA 4G7HC 1ZYRC 4ME5A 5CBAE 1BCPB 4A3EB 4KJNA 2EYOA 2PZWA 3NUCA 4FF4A 1EFID 1I4GA 1ICWA 5I6YA 1F2YA 1Q12A 4XQQA 4OGQC 1TR5A 1FD7D 4K5VA 1OXVA 4IUVA 1B44D 1DOMA 1CHPD 1D5MC 5C0XH 1QWYA 1ZYRD 3TMEA 5EBCA 4BBRB 2JA5B 1I6VC 3QJYA 4FYDA 3QOJA 3LX0A 3VR5A 4QIWB 3HEJA 5G3LD 2K6AA 4NW2A 2QF7A 1I4QA 2LMCB 3VR6A 4R9WA 2K5WA 1HQMC 3HRZC 4V0BA 1A6XA 1VF5C 3C3LA 3RD4A 1LABA 2Q8RE 1MI2A 3LNNA 3MHBA 4J8QA 4PQXA 5EPJA 5FO9B 3K5LA 4DAYA 3D6WA 2JA7B 4PMWA 2ZT9C 4HCSA 5HURA 4EQOA 3NTIA 5A2QE 3KBXA 2RQXA 1QNKA 1DONA 2B8FA 4X3SA 4ZUIA 2HQEA 2QKIC 1XXGA 1CZWA 4ABNA 1PLFA 2KA7A 1WTWA 1B9MA 3P75A 1XX8A 1WD0A 3S1MB 1GUOA 1BCPC 2RVLA 1E2WA 1B53A 2F0HA 5BN3A 5I9PA 1QG7A 2TMPA 2F0IA 2AQ3B 2H4OA 3BZDB 4IUQA 2K05A 3V05A 1EZ8A 2NN6H 4U68A 1RF2D 1WTPA 1F2MA 5TSSA 5CV6A 1BBXC 1S5FD 3I70A 2PO4A 4DU9A 5DNFA 1SE3A 3NWSA 1HFGA 1Z7TA 3A7LA 1PTOB 1PFBA 2XWJB 2B2YA 1YNJD 3J80E 5KNCA 3OWEB 3MVVA 3I91A 4RGNA 4DN4M 4BS9A 1H9MA 1HHVA 2HDMA 1L0XB 1JOKA 4G7ZC 1EWHA 3LWEA 2EVBA 4K8JA 2XRQD 3GTGB 2NTTA 2EXZA 1JORA 2PYKA 4OIJA 3TP8A 3J80L 2QILA 1QJOA 4B9WA 1U4MA 4KJOA 1X32A 4A3MB 4A93B 1DOKA 5I6WA 2A74C 3NBHA 3J7YW 3SK5A 2FHTA 1R4QB 1SYBA 3HKZB 3ERQA 5KYIA 5CV7A 1CA6A 5ELBA 5K36H 1S5BD 4RWSC 1RKNA 3H3VC 3DM1A 3M4OB 2EYFA 4N9TA 1G6ZA 1DYQA 5IGFA 1SDFA 4CBVA 2FMMA 3R93A 1HUNA 4DAPA 1ZXTA 4RCOA 2D5DA 3VYSA 3OSOA 1XYIA 1E0BA 3TP6A 2BCOA 4MN3A 1D1KA 2DY8A 3CU7A 1BO0A 4O42A 3ND8A 3MA2B 4XTCS 3NHHA 4XQNA 3K0YA 2NVTB 2EY2A 5CV4A 2SOBA 4RKLA 2Z1CA 1STAA 2I46A 3AMUA 5LL6S 3I4LA 3MZ5A 2Y0SB 2NN6I 4B9XA 4R8IA 1H9SA 1TT2A 1SEBD 3AB9A 1C48A 3ONAB 3URYA 4RH6A 2H1EA 3MXPA 3K59A 1G91A 3NTKA 1ET9A 2IX1A 1JWSD 5JEAJ 1NUCA 1IYVA 1WTVA 1TVXA 3D3RA 4ZLTF 2EJFC 4K14A 1R9TB 2XRSD 2D9UA 1A3VA 1PXUA 3E0JA 4L63B 1PMRA 4H13C 4O1NA 1LTBD 1W6KA 4M8AA 5I4DA 2KQ3A 4FXDA 1STHA 3DXJC 5FLXE 2M00A 1TU2B 2WKCA 4XDXA 2RDGA 4TSSA 4RKBA 1SYGA 1BQQT 1GHJA 2NWGA 2WV6D 1FNVA 4HR7B 3EQLC 5E4WC 3EFXD 3BVGA 1S5DD 2C5CA 2FJ2A 5C0XG 5M3MB 3HS0C 1EZ6A 1ILPA 3GV6A 5CMDA 1EY7A 1PDQA 1SJED 2EDGA 3HOVB 4NP5A 2ZXRA 3H0GB 4L6TB 2WP8J 1X3QA 2M2LA 3S17B 3PIO3 3IKJA 4CKBA 1QNUA 2CVRA 3HOXB 2B2VC 3D4WA 2ICEC 3PUWA 1TS5A 4Y7NB 2EYMA 4XT3B 1BCPD 5KNBA 1F9PA 3VR3A 1V1PB 4C3JG 4TRDA 1OO9B 1D5XC 2HCIA 1TWAB 2A68D 4IURA 5FLXL 3R2IA 1F2LA 3T53B 1MBYA 1NR2A 4V190 2D2CC 3PMFA 1MSHA 3SK6A 5CGKA 1AEXA 2MUYA 3J7AV 1MSGA 1A15A 1AW7A 5C6AA 3OPOA 2JP1A 4PNYA 3JAME 2O5IC 2BDNA 2J0TD 5JEAG 3T13A 4KKSA 3TSSA 4A3KB 3U9SA 5CV9A 4DK1A 2VB3X 1TKWB 4KY6A 5BN5A 2JE6I 2F4IA 1EY4A 1I4XA 3NE5B 5FKAC 4BA2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XT1 B;  1O7Z A;  2X6G A;  1M8A A;  2FMM A;  5CBE E;  3R93 A;  5JJZ A;  1WTP A;  1HUN A;  1HFN A;  3MWY W;  1ILP A;  1O7Y A;  3GV6 A;  3MTS A;  1WVL A;  1ZXT A;  2EE1 A;  2L11 A;  5CMD A;  1XYI A;  1BBX C;  1E0B A;  2HCC A;  4NW2 A;  4X3K A;  2L4N A;  4MN3 A;  1J9O A;  1NCV A;  1PDQ A;  1RHP A;  2DY8 A;  2KUM A;  2VXW A;  2X69 A;  1AZP A;  1IKM A;  1BO0 A;  2RA4 A;  5EJW A;  4O42 A;  4CJ0 B;  1VMP A;  2NYZ D;  5DNF A;  2K03 A;  5T1I A;  4ZKB B;  2K04 A;  4OIK A;  1F9R A;  4RA8 A;  2EOT A;  4R9W A;  1HFG A;  2JYO A;  4UAI A;  1PFM A;  3UI2 A;  1WD1 A;  1EOT A;  1BF4 A;  1B50 A;  1DZ1 A;  1X3Q A;  1DOL A;  2B2W C;  1EIG A;  1EQT A;  2B2W A;  2M2L A;  4CJ1 B;  1MGS A;  2IL8 A;  1RTO A;  1Q3L A;  2MPM A;  2NZ1 D;  1AZQ A;  1SSO A;  1ILQ A;  1PFB A;  2Q8R E;  2B2Y A;  2B2Y C;  1MI2 A;  4X3U A;  5EPL A;  1KNA A;  1PFN A;  2KED A;  2L12 A;  5D14 A;  2K01 A;  1JE4 A;  3I91 A;  5EPJ A;  4R8I A;  2CVR A;  4RAU C;  1J8I A;  2KVM A;  2B2V A;  2B2V C;  3IL8 A;  2K28 A;  3D6W A;  3QO2 A;  4DN4 M;  1RTN A;  3DEP A;  4QUF A;  3G7L A;  2B2T A;  2B2T C;  1HA6 A;  2Q8T A;  3ONA B;  5AFW A;  4ZAI A;  4IUT A;  2R3Z A;  1HHV A;  4XT3 B;  2HDM A;  1GUW A;  5EKI A;  2H1E A;  2KEE A;  3LWE A;  1U4L A;  4HCS A;  2N88 A;  2RSO A;  4IUP A;  3GV3 A;  1CA5 A;  2MP1 A;  5EPK A;  1IL8 A;  2L1B A;  1NAP A;  1O80 A;  1ROD A;  3Q6S A;  1WTQ A;  3SVM A;  1G91 A;  1U4P A;  1HRJ A;  3HP3 A;  1G2T A;  3I90 A;  1F9P A;  3DEO A;  1RJT A;  1WTV A;  3F2U A;  1G2S A;  3IFD A;  2X6L A;  1TVX A;  3KBX A;  3FPU B;  2L9H A;  2HDL A;  4ZKC B;  1CM9 A;  2DY7 A;  5CBA E;  1QNK A;  2B2U A;  2B2U C;  2HCI A;  3TN2 A;  4ZLT F;  1DON A;  4X3S A;  4MHE A;  3TZD A;  4IUR A;  4OIJ A;  1F2L A;  1LV9 A;  2D9U A;  4HED A;  1NR2 A;  2MGS A;  2N55 A;  1B4O A;  4CJ2 C;  1JIC A;  1MSH A;  2SDF A;  3KUP A;  1F9S A;  1PLF A;  1S4Z A;  1WTW A;  1ICW A;  3I3C A;  1U4M A;  1MSG A;  5E4X A;  2RSN A;  1ESR A;  1A15 A;  1X32 A;  5D65 A;  1EIH A;  1XX8 A;  1WD0 A;  4X3T A;  5COR A;  2JP1 A;  4IUV A;  1DOK A;  4HSV A;  1EL0 A;  4QUC A;  2BDN A;  2RVL A;  3N52 A;  4LMQ D;  1B53 A;  5EQ0 A;  2KEC A;  5COY A;  1QE6 A;  1DOM A;  1SAP A;  2FHT A;  4IUU A;  4XDX A;  1WTO A;  1QG7 A;  1NR4 A;  1IKL A;  1ML0 D;  1VMC A;  1B3A A;  1X3P A;  2K1B A;  3FDT A;  2NWG A;  1F9Q A;  2XIW A;  3H91 A;  1C8C A;  1CA6 A;  2FFK B;  2FIN B;  1HUM A;  4RWS C;  1AP0 A;  4HAE A;  1BNZ A;  2KOL A;  2HUG A;  3DM1 A;  4IUQ A;  2K05 A;  5E4W C;  5T1G A;  4ZK9 B;  3P7J A;  1WTX A;  1WTR A;  1G6Z A;  2J7Z A;  2FJ2 A;  2MJ8 A;  1U4R A;  1B2T A;  2EPB A;  1SDF A;  1KNE A;  3I8Z A;  4U68 A; 
#chains in the Genus database with same CATH topology
 2OQK A;  1IW7 D;  1WVL A;  1Y1V G;  1PRT C;  4WJ4 A;  3AFQ A;  3U58 A;  1AN8 A;  1NCV A;  2CCZ A;  4JBW A;  3VYR A;  5EBD A;  1TQO A;  1TWC H;  1V9P A;  5IOC A;  3M7N A;  2R93 B;  3TRZ A;  1WCM B;  2EOT A;  3PF4 A;  1MD2 D;  1BF4 A;  2F0U A;  3PUV A;  4XYO A;  1KTK A;  5LL6 X;  4I7A A;  2UUB L;  4HCE A;  4NPS A;  4MIU A;  4X6A H;  1EUJ A;  1Q90 A;  1PTO H;  1BBU A;  1UUP A;  1HZ9 A;  2F0W A;  4ZRZ A;  3IL8 A;  5JVH 3;  5F2D A;  1HTL D;  4C3I B;  3DEP A;  4Q0F A;  4IUN A;  1FNW A;  4DFA A;  3ICE A;  3ZYY X;  4DR5 L;  1S5C D;  2R3Z A;  4BXX H;  2UXC Q;  5M5W B;  5EKI A;  1SRO A;  2CWA A;  1GUW A;  1AFP A;  3BDL A;  2OQ0 A;  3E5S A;  3K8A A;  3M85 A;  1LM0 A;  2K33 A;  5G3L F;  3KF8 B;  3CCE A;  3EJI A;  3PV0 A;  1CA5 A;  1TY0 A;  3SDZ A;  1U4P A;  4NDX A;  1W2B A;  4I65 A;  4BBR H;  1SLJ A;  1YNJ C;  3U50 C;  4R4O A;  5IYD G;  3FPU B;  2K7V A;  2VZA A;  2KHS A;  2UU9 L;  2B2U A;  3KK7 A;  3S2H H;  1LV9 A;  1SNC A;  4DNT B;  3I4M B;  4CJ2 C;  2F4V L;  5IGD A;  2R92 B;  1T5X D;  2AUJ D;  1SYE A;  1CT1 D;  5E4X A;  3CCL A;  1XNQ Q;  1KDB A;  2RSN A;  2WAQ B;  1HJP A;  1L1O A;  1XNR L;  1MJE A;  4GLV B;  2NVX H;  3TZU A;  2R93 G;  1D8L A;  4IUU A;  3KF6 B;  5HGQ A;  5C3X A;  4DNR B;  5LMN W;  3WWV A;  2GVB A;  1F2Z A;  4LUO A;  1CK1 A;  1AH9 A;  5M5Y B;  2FFK B;  1WYD A;  5C3E B;  1S3O A;  3MC0 B;  1YEZ A;  1HZB A;  4ZK9 B;  4PZ7 A;  2CH4 W;  1Y1V H;  1Q86 C;  4DK0 A;  5CV5 A;  1B2T A;  4RGM A;  4H02 A;  3JAM c;  3ND9 A;  1O7Z A;  3BDO A;  4DUZ Q;  4JBM A;  2A6E D;  1PH8 A;  3L3O C;  2E76 C;  3L0O A;  2Z8L A;  1TWC B;  1SE8 A;  1STG A;  1IHZ A;  4A3M H;  3CC2 A;  4X3K A;  1K8A C;  4F88 A;  1RHP A;  2KUM A;  4QF4 A;  3HGB A;  2KCN A;  3T56 B;  2NYZ D;  1K83 B;  3VYU A;  1RCV D;  5T1I A;  3E9H A;  2DNC A;  4BA1 I;  4KD3 A;  4K6L A;  1BUV T;  3DUZ A;  3PO3 B;  1PTO C;  1STN A;  4BY7 B;  1G8Z D;  3I4N B;  2Z6K A;  2NZ1 D;  4JYA L;  1TII D;  4GN4 B;  3RZO B;  2OTJ A;  3RLO A;  1EU3 A;  1H95 A;  1IL2 A;  1VQC A;  2F0V A;  3FP9 A;  4LFC L;  5ELD A;  2EY6 A;  1JOO A;  4G7O C;  3S2D H;  1SXT A;  1SFO H;  2C9O A;  5ISR A;  2B2T A;  2ZXP A;  4YHH Q;  2MHV A;  4X62 Q;  1FNU A;  3CW2 C;  5JPN C;  1K0S A;  1UE7 A;  4K2K A;  2LXJ A;  4DAY B;  4P75 A;  3RR5 A;  2NVT H;  1PZJ D;  2H5X A;  1A2U A;  4IPG A;  3BDC A;  4JW0 A;  2UXD Q;  4J15 A;  2E75 C;  1ESF A;  2EYP A;  3I90 A;  4JI5 L;  1VQN A;  1G2T A;  4F7X A;  3GTQ B;  1FYC A;  1HR0 W;  3HOU G;  2L9H A;  4RG1 A;  3M4Q A;  3VR4 A;  1CM9 A;  3F2B A;  1LTS D;  1E2V A;  4HED A;  5IP7 H;  3AEV A;  5E3F A;  3KDF A;  4AYB B;  2J4X A;  3C46 A;  3PO3 G;  3K6O A;  1XPR A;  3I3C A;  1Z47 A;  1SE4 A;  2JA9 A;  5D3D A;  1IW7 C;  4ID6 A;  4IFD H;  1IBL Q;  2PQA B;  4HSV A;  1H9R A;  3FMC A;  1EWI A;  4LMQ D;  2E2J H;  3H0G G;  5COY A;  1SAP A;  1JB7 A;  2E8G A;  5IIF A;  3Q22 A;  1NR4 A;  4LK1 C;  1PZI D;  1X3P A;  2K1B A;  3FDT A;  1DCZ A;  1CUK A;  4DXF A;  3I4N H;  5JAV A;  1BR9 A;  1A3U A;  2NVY H;  1SR3 A;  5KND A;  3BJU A;  4BBS B;  1WTX A;  4BBR G;  2BE5 D;  2J7Z A;  1A2T A;  3I8Z A;  4PZ8 A;  2O2L D;  3FKI H;  2EY5 A;  5IWA Q;  1UEA B;  4IFD J;  1CSP A;  1SMY D;  4OXP A;  2VL6 A;  1STB A;  3RN5 A;  2RHQ B;  1S40 A;  2F0T A;  4H44 C;  1IKM A;  2JA7 G;  2BDO A;  1HH2 P;  2ALY B;  1G29 1;  2K03 A;  1CFM A;  2ATW A;  4ODG A;  1F9R A;  1JR0 D;  1IXR A;  2IPK D;  2JYO A;  3KF6 A;  1VQG A;  3UI2 A;  2WB1 E;  2XNA C;  2RDH A;  3GTK B;  2B2W A;  1EQT A;  2NVY B;  3H15 A;  1NY4 A;  1LTA D;  3OMC A;  2MQH A;  3CRL C;  2KED A;  1GOZ A;  4JOI A;  1SNO A;  4BY1 G;  2N49 A;  3K7A B;  1JWM D;  3QO2 A;  2D62 A;  4IPC A;  3S16 B;  5EGT A;  1QB5 D;  2XVS A;  3TP7 A;  4YIJ A;  5JJL A;  4KKT A;  3VYT A;  1S5E D;  4B08 A;  4DAM A;  2JEB I;  3C1E A;  5C5M A;  1CSQ A;  4HJ5 A;  1HCZ A;  4RHS A;  2JSO A;  2EJG C;  1WTQ A;  2O5J C;  3KLW A;  3NPP A;  3HP3 A;  1YIT A;  1NMF A;  1AE2 A;  3RLF A;  2BA1 A;  4O0A A;  2DY7 A;  3FHW A;  4RFB A;  3TN2 A;  1LTL A;  2DNE A;  3K0X A;  3PO2 H;  2A68 C;  3FVQ A;  3S9W A;  5FLM H;  3HOX H;  2JXM B;  4NMZ A;  3L7Z C;  4CGY B;  1ESR A;  4F8M A;  3J81 i;  3CXC A;  4HMJ A;  1L2F A;  4DV6 Q;  3E0E A;  4HN7 A;  5I2Y A;  1V1Q A;  5IGB A;  3H6M A;  2KEC A;  2E2H H;  3OW7 A;  1KDC A;  1SYD A;  2AMC B;  2I5H A;  4K6D A;  4UP7 A;  1VQ6 A;  3H91 A;  1VQF A;  2HD3 A;  1G51 A;  4YHH L;  2K32 A;  1H9J A;  1K8O A;  2Z4H A;  3V96 A;  1E2Z A;  3D0F A;  5C4J B;  2A6H C;  1I6H B;  3ER0 A;  4FP5 D;  4A3G B;  1Q8K A;  4U67 3;  2F0L A;  1KDA A;  1K73 C;  4FF3 A;  2BA0 A;  1H9S B;  5JEA H;  3E6Z X;  1T5E A;  2L11 A;  4A3K G;  4A3D B;  2XWB B;  4A3J B;  2ZTD A;  3QB3 A;  2CW0 D;  5IT9 L;  1TWF B;  2K5H A;  2E5L L;  2E2D C;  2K04 A;  2K5N A;  3A54 A;  2NTS A;  1HZA A;  3TBI B;  1WD1 A;  4UY8 C;  3W3A A;  1M1K C;  1VDZ A;  2EYH A;  2RDF A;  4X62 L;  1JC7 A;  3SR1 A;  3UE1 A;  3BYT B;  1SSO A;  4DR2 Q;  2L55 A;  1JQY D;  4JBK A;  5EPL A;  2L12 A;  3W1B A;  5FO8 B;  4QB4 A;  1SMY C;  1I4H A;  4DK3 C;  4FO2 A;  1J8I A;  1KXL A;  5GQO A;  2F0Q A;  4LFC Q;  3T4A C;  5EAY A;  3G7L A;  4JBJ A;  3NTH A;  4RGO S;  2Q8T A;  4A3B B;  4JI8 Q;  5M5X B;  4DR4 L;  2PW7 A;  3NK9 A;  4ILW A;  1X54 A;  4Y7N H;  4A3I H;  1D2B A;  1IL8 A;  1Q46 A;  4BY1 B;  4LF5 Q;  1HRJ A;  4K0K L;  4PZ6 A;  2OXP A;  2QCP X;  1BBW A;  2B2U C;  3DM3 A;  2PZU A;  4MHE A;  2OT2 A;  2GA4 B;  3HOW H;  2F3I A;  3NSW A;  1JIC A;  4KY5 A;  4Z9C B;  3CQZ H;  1EIF A;  4K5X A;  3U4Z A;  1L1O C;  2F0M A;  2XN9 C;  4JI5 Q;  2VB2 X;  2Z6B A;  2B63 G;  1TXY A;  1PRT D;  2OWO A;  3HOV H;  4GZY C;  3S1M H;  1BOS A;  4JI6 L;  1N36 L;  2VQF L;  1WTO A;  1VMC A;  4GKJ Q;  1HNZ L;  4QCL A;  3OHX C;  1HA5 A;  1JJC B;  1B9N A;  1NMG A;  1V1O A;  3S2H B;  4DV7 Q;  1GHK A;  4DGZ A;  2ZXO A;  3F1Z A;  1S72 A;  1QZH A;  1O7Y A;  3NBH B;  3PSI A;  4L5S A;  2EYL A;  1GUS A;  3A7A B;  3BG3 A;  4LFA L;  4KY7 A;  4DAV A;  1XPO A;  1GJX A;  1UE6 A;  5E7N A;  1XTC D;  4RA8 A;  4QL5 A;  3TS0 A;  3SK8 A;  1B70 B;  1GM5 A;  1K28 A;  1X3F A;  4ALP A;  1O7L A;  2A69 D;  4IPD A;  2A6H D;  2O4X A;  3S24 A;  4CJ1 B;  1VQ9 A;  1PFS A;  4KLK A;  5KRU A;  1ENF A;  3OTO L;  1PTO F;  3WOF A;  4JI0 Q;  2Q2U A;  1FL0 A;  4RAU C;  3VR2 A;  2VUM H;  1E1T A;  3KJO A;  4KI0 A;  3PUZ A;  2K28 A;  3M7G A;  5I2X A;  4PV1 C;  4IJL A;  3HOY B;  2LXK A;  1D7Q A;  1E1O A;  1LTT D;  3JAM L;  3GD7 A;  3CCQ A;  2HHH Q;  4IN3 A;  2EQS A;  2PMZ E;  4HJ8 A;  2PPB C;  4DR1 Q;  4RMF A;  3PQI A;  1L0Y B;  4JYA Q;  1H9K A;  5LMN Q;  4LF9 Q;  4TQU S;  4XYQ A;  3AFP A;  4YWL A;  4JI2 L;  2WB1 G;  4KN7 C;  3ITP A;  3MXN A;  5KIX A;  4CKC A;  4ZUJ A;  2N55 A;  1TWF H;  4C3H G;  4MNO A;  3K5N A;  2NVQ B;  2D0O A;  1LAC A;  3U9O A;  4DV3 Q;  1S4Z A;  1V43 A;  1QVF A;  1EY9 A;  3QOL A;  3H09 A;  4JC0 A;  2QDB A;  4GNX B;  1C4Q A;  1A63 A;  2CW0 C;  4LFA Q;  4E6I A;  4RCN A;  3F2D A;  4LWC A;  1UE5 A;  3MEF A;  2ENB A;  1FVI A;  1B3A A;  3L2P A;  2XIW A;  5A2Q L;  1BXT A;  5L37 A;  3PUY A;  4H7B A;  4ULL A;  2R7F A;  1XWE A;  2QEJ C;  2RCF A;  1RDP D;  4R4Q A;  4C2M B;  2LY7 A;  4N8X 1;  1DM0 B;  1MHW C;  1TWG B;  3OIP A;  3I4O A;  1N8R C;  2OF1 A;  1Q1B A;  1YNN C;  3DWA A;  3NQT A;  5CBE E;  3ULJ A;  5C4X B;  4EQN A;  3MTS A;  5HGT A;  4AQY Q;  1EWC A;  5IT9 E;  2Q2T A;  3BYY B;  1J9O A;  4DR3 Q;  1I6H H;  4OX9 Q;  1XNQ L;  2B8G A;  2RA4 A;  1ENC A;  4CJ0 B;  4YCV A;  1Y8P B;  4ZKB B;  2SEB D;  4LF7 Q;  3NBI A;  3OYY A;  4KTA A;  4P73 A;  4GOP A;  3CQZ B;  1VQO A;  1EOT A;  3T1Y L;  4EX5 A;  1HNW L;  2BE5 C;  1R4P B;  2IL8 A;  3KFU A;  2AWO A;  2OTL A;  3H94 A;  5ELC A;  4HIM A;  4BY7 H;  1SYC A;  2EYJ A;  2PMZ B;  3FKI B;  5C0X J;  1YJ9 A;  2KVM A;  4K0K Q;  5C4X H;  3GTL B;  4DR4 Q;  4A3L G;  1B3Q A;  2MFI A;  5C44 H;  4GKK L;  4OWW B;  4A3G G;  1GUT A;  4KD4 A;  4IUT A;  1VQ5 A;  2R7Z G;  4MTN A;  4FF1 A;  3Q0A A;  4JI0 L;  2A19 A;  4JI8 L;  2VS1 A;  4HID A;  1KAB A;  2MP1 A;  1ROD A;  1O80 A;  2NN6 G;  2YU9 B;  3FEW X;  3K5M A;  1GD7 A;  1JCK B;  1X6O A;  3S15 B;  3CC4 A;  2RBM A;  2HIV A;  5EKL A;  3ULP A;  1NTG A;  4G4K A;  3GQB A;  4JI6 Q;  4AIM A;  1SJH D;  4LF8 L;  1I3Q H;  1I5F A;  1Q1E A;  1B1Z A;  1J5E Q;  1K8G A;  1CHQ D;  5C5L A;  3CP0 A;  2NUC A;  3CME A;  1N32 L;  5JOB A;  2PCF B;  1CZG A;  1I4R A;  2EJM A;  4JI4 L;  3N52 A;  3NP8 A;  5CC4 A;  1K3B C;  5AJ3 L;  3PGZ A;  4C1N I;  2F0N A;  2Q2I A;  1HR0 L;  1Y8O B;  3EA6 A;  3EBE A;  4A3F B;  4C3H B;  3E9I A;  1A62 A;  2VQE Q;  5KGU A;  5IP9 G;  2FIN B;  2KJX A;  1HUM A;  3RZD H;  2N3S A;  2FXQ A;  3W5O A;  1BNZ A;  1V1P A;  4WJW A;  5IT9 c;  1KQS A;  1W6J A;  1T9H A;  3Q24 A;  2JA8 B;  4UP8 A;  1VQ8 A;  2KEN A;  4B3M Q;  1MIU A;  3KJP A;  3EVQ A;  4F87 A;  1IZ6 A;  1OXX K;  5NUC A;  1SBB B;  2YTV A;  4JI7 L;  3S1Q H;  2B63 B;  1EU4 A;  2HCC A;  2IX3 A;  2Z0S A;  1KRS A;  1Z6H A;  1X55 A;  1LUZ A;  4OO1 I;  3FPP A;  1ET6 A;  5K5P A;  1V8Q A;  2K14 A;  1X3E A;  4X65 Q;  3GTO B;  1DZ1 A;  3S2D B;  1B50 A;  2PW5 A;  2KCC A;  2UUC Q;  4RGT A;  4HJ9 A;  5H1S E;  3OMG A;  2B2Y C;  3X3M A;  3P20 A;  4DUZ L;  1PFN A;  1EY0 A;  5M5W H;  3FRP B;  3K58 A;  3A8K E;  5FLM G;  5M3F B;  2B2V A;  2JA8 G;  4K5W A;  4XQJ A;  2QEX A;  1UAP A;  1GKH A;  4L5Q A;  4H0L C;  2RHS B;  3I73 A;  4OHJ A;  3VDY A;  4A93 H;  1I94 Q;  4BBS G;  5K36 G;  4LUZ A;  2KBN A;  3AQQ A;  2KEE A;  2Q8I B;  3A8J E;  2YV5 A;  1GXD C;  4L8J A;  1KAA A;  2RSO A;  2OEO A;  5M5X H;  4IUP A;  3GV3 A;  1PHJ A;  3P1H A;  1CKM A;  1BKB A;  2SNM A;  3MFG A;  4OWX B;  1CKO A;  4GKJ L;  3IFD A;  1G2S A;  4DV1 L;  1KL9 A;  5ELN A;  1ASY A;  3EIV A;  4K8I A;  4WFN 3;  3A56 A;  2B39 A;  1CI3 M;  3QWN A;  4PMC A;  3B6Y A;  4DV6 L;  1LTI D;  1RIP A;  1NSN S;  2PI2 E;  5COR A;  1QCB D;  1TS2 A;  1YVC A;  3HOW B;  4DR7 L;  2F1M A;  4A3D G;  5CR3 A;  5I9O A;  1I50 B;  5LMU L;  2EIF A;  4IJH A;  3SXH A;  3MAQ A;  1KLU D;  1SE2 A;  4AYB E;  2F0E A;  3J81 j;  5KEE A;  3S1R H;  2AQ2 B;  3DMU A;  1U0L A;  2R7Z H;  3OOC A;  4POF A;  2JA7 H;  2HUG A;  1PYB A;  3L9A X;  5M9O A;  3S1R B;  1EQQ A;  4ZYS A;  1A3T A;  5C4X G;  1U4R A;  4KV6 A;  3TS2 A;  4KK7 A;  3K57 A;  3GTM B;  1VF7 A;  3FKI G;  4DXG A;  5DM6 3;  3MWY W;  4A3I G;  4DR1 L;  2EE1 A;  4X66 L;  2HT1 A;  3AYH B;  3STB D;  1TWG H;  2X69 A;  4LAA A;  3GDE A;  2E2H B;  3S14 B;  2FMC A;  4GKK Q;  4OIK A;  3BVM A;  4N9P A;  4B3R Q;  2PNH A;  4DV5 Q;  1XMO Q;  4UPA A;  1SYF A;  3NQI A;  2RF4 A;  4JI1 Q;  2F0K A;  1AZQ A;  1LT4 D;  2NVX B;  5E1F A;  4GNX C;  1FR3 A;  5AJ3 Q;  1CTM A;  4DR7 Q;  4HTH A;  1EEI D;  1KNA A;  1NBW A;  3SE0 A;  1I4P A;  4KHZ A;  2F0O A;  1HTP A;  4DR3 L;  5J22 A;  2V4D A;  4DKA C;  3LWU A;  2L0C A;  5DEH A;  2K5Q A;  2NZH A;  2G9H D;  3J81 E;  2UUA Q;  3HOU H;  3ULL A;  2PI2 A;  3D4D A;  1U4L A;  3JAM i;  3A5U A;  3Q6S A;  3K5O A;  1HNX Q;  4Q5V A;  1RJT A;  3VA7 A;  4DF7 A;  4TKO B;  5FOB B;  4A4I A;  4YCU A;  4IOC A;  4DR2 L;  2EZV A;  1Y8N B;  1SN8 A;  3EN2 A;  2LKV A;  1QVG A;  5DAU A;  5ELF A;  1SNP A;  4A3F H;  2IJ0 A;  3K7U C;  2E2I B;  3SK4 A;  2R92 H;  4X3T A;  1O7I A;  3NEM A;  5EQ0 A;  1HZC A;  4MTK A;  1QE6 A;  4JG2 A;  4NXM L;  3D4R A;  5DM7 3;  3ERS X;  3RNU A;  4LNQ A;  2LS0 1;  1HQR D;  4FF2 A;  1AP0 A;  4HAE A;  2ZTE A;  3T16 A;  5C44 B;  3MXG A;  1XTD A;  2HIX A;  1X3G A;  4JV5 Q;  1TWA H;  1ZKO A;  2LSS A;  1WTR A;  4WRD A;  2MJ8 A;  2VUM G;  1OTC A;  4C2M H;  4OEM B;  1TWH H;  4IOA A;  2XSC A;  4DNI A;  1JOQ A;  4X64 L;  2A6E C;  1HNZ Q;  2WFW A;  1TWH B;  2L4N A;  1EYA A;  3TEH B;  4APV A;  2A73 B;  1AZP A;  2EXD A;  1NNX A;  5M3F G;  3S17 H;  1ICF B;  2ZJP A;  1EY6 A;  3GO5 A;  4DA2 A;  3NWT A;  4JV5 L;  2CHB D;  2K50 A;  1KHI A;  1CQV A;  1I3Q B;  4DUY L;  5C4H A;  3PO2 G;  2ZM6 L;  4CDE C;  2PQA A;  1X56 A;  3G6E A;  1A0I A;  3KDF B;  4POG A;  1EY5 A;  4QJF A;  4JPB W;  1PTO D;  3HG9 A;  3A55 A;  4IO9 A;  4R8N A;  2PNR C;  1GUN A;  3CHB D;  4B3S Q;  1SNQ A;  1PRT B;  3IAY A;  5J3B A;  4DV5 L;  1XMO L;  3STB C;  3GTJ B;  5D3I B;  2VY3 A;  3RZO H;  2R7Z B;  4NXN Q;  3MEH A;  3GTP B;  3J80 c;  3Q23 A;  2N88 A;  4DR5 Q;  5LMN L;  4EGV A;  5EPK A;  1DD2 A;  1VQD A;  2AWN A;  2IHE A;  5JJI A;  3CRK C;  2YTY A;  1LTR D;  2HHH L;  2SNS A;  3T1H Q;  2F0J A;  2CFM A;  4A3J H;  3I4N G;  1HXY D;  3KLS X;  3GTQ H;  4WOR A;  2WIN B;  4LJZ C;  3E3X A;  5IGC A;  2VNU D;  3T51 B;  2AQ1 B;  2IX0 A;  1F9S A;  3CMA A;  3HOW G;  3J7A F;  3DHQ A;  2IW3 A;  2NB0 A;  3O13 A;  2ASB A;  2DJF C;  3CCR A;  1EL0 A;  4CKE A;  3PO2 B;  3TQY A;  3OIQ A;  3HZX A;  4DV4 Q;  4J1M A;  2AKW B;  3J81 L;  3CCJ A;  4HMI A;  3ERO A;  2I5L X;  4IQZ A;  2OCE A;  1HNW Q;  1PYW D;  4PMB A;  3QIA A;  4OO1 H;  1C8C A;  2YYZ A;  5A35 A;  1OXS C;  4UDU C;  2D0P A;  3MXU A;  4FXK C;  4LF7 L;  1F77 A;  5ELE A;  4A3B G;  2ICI A;  3A74 A;  3RZD B;  2F0G A;  4KHP L;  3M3Y B;  1LO5 D;  4A3I B;  4NKL A;  5IYB H;  3WDN A;  4XT1 B;  1M8A A;  4KN4 C;  5IGG A;  1HFN A;  3H0G H;  5KYL A;  1EY8 A;  3UDX A;  4XIG S;  4TVA B;  3DWP A;  3T1H L;  3PF5 A;  4X66 Q;  1VMP A;  3SEB A;  2LFN A;  2WAQ G;  3D8G A;  5IP7 G;  4QQB X;  3KLR A;  3JC6 6;  2A1A A;  4KMU C;  2I07 B;  2B2W C;  4HIK A;  1MGS A;  1Q3L A;  5J1Z A;  3N6R A;  4C1N K;  3QG1 A;  2IWH A;  3CCV A;  2R92 G;  2ID0 A;  2WII B;  5C4Z A;  4X3U A;  1STY A;  1ENA A;  5D14 A;  4JOI C;  4C3I H;  1JE4 A;  4EVO A;  2F3V A;  1CKN B;  1IYU A;  4B3S L;  3TP5 A;  2DN8 A;  2BOS A;  1VQJ A;  2K52 A;  4ZQ3 A;  5BN4 A;  2F0D A;  1HA6 A;  1VQA A;  1EYC A;  4ZAI A;  4HJ7 A;  4JI2 Q;  4C3J B;  3HFZ B;  1YHA A;  3KF8 A;  3GP7 A;  2ZM6 Q;  4A3C H;  3J7A 5;  4K2L A;  5IYB G;  5C3W A;  4P2C B;  2UUB Q;  3S1N H;  4XXE A;  1VCI A;  2EY1 A;  5FLX c;  4MZ9 A;  3HKZ G;  4FXG C;  2HQL A;  2VQF Q;  4ZKC B;  2JA6 B;  2F3W A;  1X9N A;  3V2T A;  2CQO A;  3M4O H;  3TZD A;  3TDQ A;  3HOX G;  2JEA I;  1O78 A;  1D1I A;  1B4O A;  4LF4 Q;  3AU7 A;  2K4K A;  3I72 A;  3W2D A;  4CHT B;  4EQ5 A;  5D65 A;  2PQE A;  4CDD C;  4AYB G;  1OXT A;  1II3 A;  2MNA A;  1VQB A;  4HSP A;  4QUC A;  4YWK A;  4PG3 A;  1KLG D;  2F0S A;  3PIP A;  2RKS A;  3MFY A;  1MKH A;  1ML0 D;  1M4V A;  3VA5 A;  3R2T A;  1JB3 A;  1VQL A;  4A3B H;  2F0F A;  3CAM A;  3M4Y A;  3H3V H;  4A3J G;  3IFT A;  4DV0 L;  1U5K A;  1PH9 A;  1HPC A;  1KNE A;  2K5D A;  2X6G A;  1U9R A;  1ZEQ X;  5FK9 C;  3CCM A;  1SRU A;  2R93 H;  3NEN A;  3DWQ A;  5IOD A;  2Y0S G;  1FGB D;  3PIP 3;  3A8I E;  3Q8D A;  4G57 A;  1IBK Q;  1RD9 D;  5EKK A;  1LT5 D;  3CKI B;  2NVQ H;  2I0Q A;  3R8B A;  4S3S A;  1EQV A;  4UAI A;  1LLR D;  1WI5 A;  1STE A;  2K75 A;  1RTO A;  2MPM A;  3PCO B;  2GN5 A;  5IYD H;  4GNX A;  1QVC A;  2F4V Q;  1OXU A;  1SFO B;  1K8M A;  5J39 A;  1BCP F;  1YHQ A;  4IAL A;  1D6E C;  3KBG A;  3PUX A;  1EYD A;  4M1U B;  3U4V A;  3UDI A;  1QIL A;  4BXX G;  2BH2 A;  1E7Z A;  4QUF A;  3G6J B;  2B2T C;  4I7Z C;  5M3F H;  4IFD I;  1P16 A;  5AFW A;  1TS3 A;  4KKU A;  2Z4I A;  1Y1V B;  5GAE C;  2C35 B;  1Y14 B;  2VUM B;  2PZT A;  1EIY B;  5JVG 3;  3R3O A;  5C0X I;  2L1B A;  3WOE A;  3KOJ A;  2CQA A;  3CD6 A;  3F2U A;  4RHR A;  2X6L A;  4IFD G;  1PRT F;  1SND A;  3SHL A;  2HDL A;  4OON A;  4A93 G;  1LT6 D;  3W1G A;  4BWG B;  4EQP A;  1ONL A;  2E74 C;  3RUZ A;  4N8F A;  2MGS A;  4LF6 L;  1L0W A;  2IHF A;  4JI3 L;  1GUG A;  2SDF A;  3KUP A;  4J6H A;  1DGS A;  1EIH A;  3S1Q B;  2E2J B;  3S16 H;  2A69 C;  1L1O B;  3HOU B;  1P8L A;  4FNF A;  4CDC C;  4QGU A;  1LTG D;  3J80 i;  1PH6 A;  2JA6 G;  3CPW A;  4IPH A;  2XGT A;  4A3C G;  2R61 A;  1EQR A;  1VQK A;  4R4C A;  1IKL A;  1HR0 Q;  1D5Z C;  1F9Q A;  1Y69 U;  4DV2 L;  3G4S A;  3D6C A;  2A5H A;  2E5L Q;  2KOL A;  2M9V A;  5JPM C;  3HOZ B;  1CQF A;  3C2P A;  5CYU A;  1SNM A;  5T1G A;  3BS1 A;  3P7J A;  4C3J H;  4JI1 L;  4CDF C;  1YNN D;  2EPB A;  3RMH A;  4KHV A;  4QMG A;  4C3I G;  5JJZ A;  5FO7 B;  4LF5 L;  3HOY G;  3S1N B;  2WAC A;  2IT1 A;  3HKS A;  2VXW A;  4DR6 L;  4DV1 Q;  1C9O A;  3D31 A;  4OL7 A;  5EJW A;  3CPF A;  4NB3 A;  2WKD A;  2F0P A;  1Z9F A;  5LHY 1;  1DXM A;  3NXW A;  4GOP B;  4LF6 Q;  1DJR D;  1QOH A;  1XJV A;  5GAG C;  1Q8I A;  1PFM A;  2NBF A;  2N8N A;  1GO3 E;  5IGE A;  1DOL A;  1IYJ B;  1EIG A;  1YNX A;  4DV0 Q;  1B7Y B;  1E22 A;  2AUK A;  1TY2 A;  1UEB A;  1BDO A;  1PH4 A;  3X3N A;  4JI4 Q;  4A3M G;  1ILQ A;  4C56 C;  1K9M C;  5HY6 A;  3C1F A;  4OEL B;  1TS4 A;  2K01 A;  3TRE A;  3K81 C;  5CV8 A;  2TSS A;  3MXN B;  3ZJY C;  1E3P A;  1UNS A;  5DLQ E;  2F03 A;  1RTN A;  2WB1 B;  2L15 A;  2UUC L;  1PZK D;  1Y1W B;  3KLS A;  3T1Y Q;  1YI2 A;  4OO1 G;  4FVM A;  2R6G A;  4IZ8 A;  2L5T A;  4JK1 C;  4DV4 L;  2Y0S E;  3BVZ A;  1NAP A;  2G9D A;  3OWF A;  1EEF D;  3SVM A;  3I2Z A;  1JWU D;  1LT3 D;  1YJN A;  3DEO A;  3H3V I;  4G7H C;  1ZYR C;  4ME5 A;  5CBA E;  1EFW A;  1BCP B;  1PH7 A;  3QR8 A;  2MO1 A;  4A3E B;  4KJN A;  2EYO A;  2PZW A;  3NUC A;  4FF4 A;  3SGI A;  1EOV A;  1EFI D;  1I4G A;  1ICW A;  5I6Y A;  3I56 A;  1F2Y A;  1Q12 A;  1LYL A;  4XQQ A;  4OGQ C;  4BY7 G;  1TR5 A;  4A3D H;  1FD7 D;  4O2D A;  4GS3 A;  4K5V A;  1OXV A;  4IUV A;  1B44 D;  2JQO A;  2VQE L;  3S14 H;  1DOM A;  3F2C A;  1YZ6 A;  1CHP D;  1D5M C;  1PH1 A;  1UE1 A;  5C0X H;  1WCM G;  1QWY A;  1ZYR D;  3TME A;  5EBC A;  5GRO A;  3GTM H;  4BBR B;  2UXB Q;  1Q82 C;  2JA5 B;  1I6V C;  3QJY A;  3BZK A;  1YIJ A;  4FYD A;  2CKZ B;  3QOJ A;  4DV3 L;  3LX0 A;  4Y52 H;  1BVS A;  3VR5 A;  2KCT A;  2N78 A;  4QIW B;  3HEJ A;  3J7Z C;  1VQ4 A;  5G3L D;  5IE8 A;  2K6A A;  5C3E G;  4GLA C;  4NW2 A;  4BBS H;  2QF7 A;  4GN5 A;  1Y1W G;  1VQE A;  1I4Q A;  2ZJR A;  2LMC B;  3VR6 A;  4R9W A;  4UP9 A;  2B29 A;  2K5W A;  5FJ8 H;  1K83 H;  1HQM C;  1QUQ B;  3HRZ C;  4V0B A;  4DV7 L;  1WTH A;  1N36 Q;  4NXN L;  1A6X A;  1VF5 C;  3C3L A;  3RD4 A;  1LAB A;  2Q8R E;  1MI2 A;  4YY3 L;  3LNN A;  3MHB A;  4J8Q A;  4PQX A;  2DUD A;  1I50 H;  5BR8 L;  4FDB A;  5EPJ A;  5FO9 B;  2DJG C;  3GTK H;  1UWV A;  3A5Z B;  4C3H H;  3K5L A;  4DAY A;  1XPU A;  3I4M G;  2IY5 B;  3D6W A;  1VQI A;  2JA7 B;  3HOZ H;  4LW1 A;  4PMW A;  3CC7 A;  2ZT9 C;  2JA8 H;  1VQP A;  2VW9 A;  4HCS A;  5HUR A;  4EQO A;  3NTI A;  5M3M G;  4YY3 Q;  1J5E L;  4YCW A;  3OW2 A;  2AHO B;  1IBM L;  4A76 A;  5A2Q E;  4A3E H;  3KBX A;  4OX9 L;  5BR8 Q;  2RQX A;  1QNK A;  1DON A;  2B8F A;  4X3S A;  4A3F G;  4ZUI A;  2HQE A;  1PH5 A;  2QKI C;  1XXG A;  1CZW A;  4ABN A;  1PLF A;  2KA7 A;  3GTL H;  3GTO H;  1WTW A;  1B9M A;  5IYC G;  3P75 A;  1XX8 A;  1WD0 A;  1SMX A;  1PVO A;  3S1M B;  3KYH C;  2QGQ A;  1GUO A;  1BCP C;  2RVL A;  1E2W A;  1B53 A;  2F0H A;  5BN3 A;  1N34 Q;  5I9P A;  1QG7 A;  2TMP A;  3CCU A;  4NXM Q;  4WJ3 M;  2RCN A;  3GTG H;  2F0I A;  2AQ3 B;  2H4O A;  3BZD B;  4IUQ A;  1ASZ A;  2K05 A;  3V05 A;  3LGJ A;  3K80 C;  5IP9 H;  5JJK A;  4QY7 A;  4ZCK A;  1EZ8 A;  2NN6 H;  4U68 A;  2ZJQ A;  1N34 L;  4R4T A;  1RF2 D;  1WTP A;  2UXD L;  1F2M A;  3M4P A;  5TSS A;  5CV6 A;  1BBX C;  1MJC A;  2XTI A;  1S5F D;  2JA5 G;  1VQH A;  3DLL A;  4LF9 L;  3I70 A;  2DGY A;  4A3G H;  2PO4 A;  4DU9 A;  5DNF A;  4A3L H;  4B3T Q;  1SE3 A;  3NWS A;  1HFG A;  1Z7T A;  5GAD C;  3A7L A;  1PTO B;  3G48 A;  1KIX A;  1EYG A;  1WFQ A;  1KC8 C;  3UDG A;  1JJG A;  1PFB A;  2XWJ B;  2B2Y A;  1YNJ D;  5IY0 A;  3J80 E;  3GTJ H;  5KNC A;  3OWE B;  3MVV A;  3I91 A;  1QZG A;  3I55 A;  3G71 A;  4RGN A;  4LFB L;  1WOC A;  4DN4 M;  4BS9 A;  1H9M A;  5C44 G;  1PV4 A;  1HHV A;  2HDM A;  3A0J A;  3NEL A;  1N32 Q;  1L0X B;  1JOK A;  4G7Z C;  1FGU A;  3RLN A;  1EWH A;  3LWE A;  4A75 A;  2EVB A;  4K8J A;  2XRQ D;  2NTT A;  3GTG B;  2EXZ A;  1JOR A;  4LFB Q;  2KCM A;  2Q2H A;  2PYK A;  4ME3 A;  4GLX A;  1K0R A;  2UXC L;  4OIJ A;  3TP8 A;  2QDL A;  3J80 L;  4JI7 Q;  2GVA A;  2QIL A;  4LUV A;  1QJO A;  4B9W A;  3K7A H;  1U4M A;  3PIO A;  4KJO A;  1X32 A;  1YHB A;  4HJA A;  4A3M B;  1XMQ Q;  4A93 B;  4DK6 C;  1QUQ A;  1DOK A;  5I6W A;  1HNX L;  3CCS A;  2A74 C;  3NBH A;  2ES2 A;  3J7Y W;  3SK5 A;  4AH6 A;  2FHT A;  1R4Q B;  1SYB A;  2P5Z X;  3HKZ B;  3ERQ A;  5KYI A;  5LMU Q;  5CV7 A;  1CA6 A;  4P72 A;  5ELB A;  5K36 H;  1S5B D;  1JJ2 A;  4RWS C;  3OTO Q;  1RKN A;  3H3V C;  3DM1 A;  1Q7Y C;  3M4O B;  4L5T A;  2EYF A;  1FJG Q;  4N9T A;  4A3K H;  1G6Z A;  1DYQ A;  5IGF A;  1SDF A;  4CBV A;  1B8A A;  5C4J H;  1PH3 A;  2FMM A;  4B3R L;  3R93 A;  1WJJ A;  1HUN A;  3BU2 A;  4DAP A;  4DV2 Q;  1ZXT A;  4RCO A;  2D5D A;  3VYS A;  3OSO A;  1XYI A;  1E0B A;  1J6Q A;  3TP6 A;  2BCO A;  4MN3 A;  1D1K A;  2DY8 A;  3CU7 A;  4AQY L;  1JE5 A;  1BO0 A;  4YWM A;  4O42 A;  4X65 L;  1N33 Q;  3ND8 A;  5IYC H;  3MA2 B;  4JI3 Q;  4XTC S;  3NHH A;  3I4M H;  2KHJ A;  4XQN A;  3K0Y A;  2NVT B;  4GOP C;  2EY2 A;  5CV4 A;  2SOB A;  4RKL A;  1I94 L;  2Z6K C;  2V1C C;  4A3E G;  2Z1C A;  1STA A;  2I46 A;  5LL6 S;  3AMU A;  1R9T H;  3I4L A;  3MZ5 A;  2Y0S B;  5M3M H;  2NN6 I;  4B9X A;  3CF5 A;  4R8I A;  1H9S A;  1TT2 A;  4JCV E;  1SEB D;  2UUA L;  5M5Y H;  3AB9 A;  1K3R A;  1RL2 A;  1C48 A;  3HOZ G;  3ONA B;  3URY A;  4JVZ A;  4RH6 A;  2H1E A;  5GAH C;  3MXP A;  3K59 A;  1G91 A;  3NTK A;  1ET9 A;  1NJI C;  2IX1 A;  1JWS D;  5JEA J;  1NUC A;  1IYV A;  1WTV A;  1TVX A;  3D3R A;  3UE0 A;  4ZLT F;  2R7D A;  2EJF C;  4K14 A;  1R9T B;  2XRS D;  2D9U A;  1A3V A;  5FJ8 G;  1PXU A;  1KAW A;  3E0J A;  4BY1 H;  4LF8 Q;  1WCM H;  4L63 B;  1PMR A;  1AE3 A;  4H13 C;  4O1N A;  1LTB D;  4DR6 Q;  1W6K A;  4M8A A;  5I4D A;  3HOV G;  1C0A A;  2I5M X;  2B63 H;  2KQ3 A;  1PYS B;  4X64 Q;  1Y1W H;  4B3T L;  4FXD A;  2CH4 A;  5C3E H;  1STH A;  1W3S A;  3DXJ C;  5FLX E;  4R1J A;  2E2I H;  4P71 A;  2M00 A;  1TU2 B;  1IBK L;  2WKC A;  4OWT B;  4XDX A;  4QIW E;  2RDG A;  4TSS A;  1A8V A;  4RKB A;  1SYG A;  1BQQ T;  1GHJ A;  2NWG A;  2WV6 D;  2YTX A;  1FNV A;  2CWP A;  4HR7 B;  1IBL L;  3EQL C;  2NZO A;  2MO0 A;  5E4W C;  3EFX D;  3BVG A;  1S5D D;  3UDF A;  3F8T A;  2C5C A;  2FJ2 A;  5C0X G;  5M3M B;  3HS0 C;  3HKZ E;  1EZ6 A;  1ILP A;  5IWA L;  3GV6 A;  3RN2 A;  2YU9 H;  3IRB A;  5CMD A;  1PA6 A;  1EY7 A;  4R4I A;  1PDQ A;  1SJE D;  1FJG L;  2EDG A;  1X65 A;  3HOV B;  4DUY Q;  1M90 C;  4NP5 A;  2ZXR A;  3H0G B;  4L5R C;  2Z9H A;  4P74 A;  2ZTC A;  4L6T B;  2WP8 J;  1X3Q A;  2M2L A;  2QA4 A;  3S17 B;  3PIO 3;  1VQ7 A;  2JA5 H;  3I7F A;  4LF4 L;  1N33 L;  1KD1 C;  3IKJ A;  2QW7 A;  4CKB A;  2B3G A;  2F52 A;  3PO3 H;  4KHP Q;  1QNU A;  2CVR A;  3HOX B;  2B2V C;  3D4W A;  1IBM Q;  2ICE C;  1VQM A;  4HIO A;  5ELO A;  3PUW A;  1TS5 A;  4Y7N B;  4UHV A;  2EYM A;  1XNR Q;  4XT3 B;  1YBY A;  3M3Y H;  1YJW A;  3BZC A;  3HOY H;  1GVP A;  1BCP D;  2WAQ E;  1JMC A;  5KNB A;  2G5D A;  1F9P A;  3VR3 A;  1V1P B;  4C3J G;  2UU9 Q;  1Q81 C;  4TRD A;  1OO9 B;  3GTP H;  1D5X C;  2HCI A;  1TWA B;  4DPG A;  2A68 D;  4IUR A;  5FLX L;  3R2I A;  1F2L A;  3M9B A;  3T53 B;  1MBY A;  1NR2 A;  4V19 0;  2UXB L;  3PMF A;  2D2C C;  2JJQ A;  1MSH A;  1CKN A;  1E24 A;  3SK6 A;  1AEX A;  5CGK A;  1XMQ L;  1JT8 A;  4GN3 B;  2MUY A;  3S15 H;  3J7A V;  1MSG A;  2JA6 H;  1A15 A;  1AW7 A;  2JK8 A;  1C7Y A;  5C6A A;  1NE3 A;  2K5V A;  3J81 c;  3OPO A;  2JP1 A;  4PNY A;  3JAM E;  2O5I C;  1G6P A;  1N9W A;  2BDN A;  2J0T D;  4B3M L;  2KHI A;  3T13 A;  5JEA G;  4KKS A;  3TSS A;  2JN4 A;  4A3K B;  3U9S A;  1PH2 A;  5CV9 A;  4DK1 A;  2VB3 X;  1VS0 A;  1TKW B;  4KY6 A;  5BN5 A;  2JE6 I;  2F4I A;  1KRT A;  1EY4 A;  1I4X A;  3NE5 B;  5FKA C;  2BH8 A;  4BA2 I;  2A8V A; 
#chains in the Genus database with same CATH homology
 1IW7 D;  1WVL A;  1PRT C;  1AN8 A;  1NCV A;  4JBW A;  3VYR A;  5EBD A;  1TQO A;  5IOC A;  3M7N A;  2R93 B;  1WCM B;  2EOT A;  1MD2 D;  1BF4 A;  2F0U A;  3PUV A;  4XYO A;  1KTK A;  5LL6 X;  4HCE A;  4MIU A;  1Q90 A;  1PTO H;  1UUP A;  2F0W A;  4ZRZ A;  3IL8 A;  5JVH 3;  5F2D A;  1HTL D;  4C3I B;  3DEP A;  4Q0F A;  4IUN A;  1FNW A;  4DFA A;  3ZYY X;  1S5C D;  2R3Z A;  5M5W B;  5EKI A;  1GUW A;  1AFP A;  3BDL A;  3E5S A;  3M85 A;  2K33 A;  5G3L F;  3EJI A;  3PV0 A;  1CA5 A;  1TY0 A;  3SDZ A;  1U4P A;  4NDX A;  4I65 A;  1YNJ C;  3FPU B;  2K7V A;  2KHS A;  2B2U A;  3KK7 A;  1LV9 A;  1SNC A;  4DNT B;  3I4M B;  4CJ2 C;  5IGD A;  2R92 B;  1T5X D;  2AUJ D;  1SYE A;  1CT1 D;  5E4X A;  1KDB A;  2RSN A;  2WAQ B;  3TZU A;  4IUU A;  5C3X A;  4DNR B;  1F2Z A;  1CK1 A;  5M5Y B;  2FFK B;  5C3E B;  3MC0 B;  4ZK9 B;  4DK0 A;  5CV5 A;  1B2T A;  4RGM A;  3ND9 A;  1O7Z A;  3BDO A;  2A6E D;  3L3O C;  2E76 C;  2Z8L A;  1TWC B;  1STG A;  1IHZ A;  4X3K A;  4F88 A;  1RHP A;  2KUM A;  4QF4 A;  3HGB A;  2KCN A;  3T56 B;  2NYZ D;  1K83 B;  3VYU A;  1RCV D;  5T1I A;  2DNC A;  4BA1 I;  4KD3 A;  4K6L A;  1BUV T;  3DUZ A;  3PO3 B;  1PTO C;  1STN A;  4BY7 B;  1G8Z D;  3I4N B;  2NZ1 D;  1TII D;  3RZO B;  1EU3 A;  2F0V A;  5ELD A;  2EY6 A;  1JOO A;  4G7O C;  1SXT A;  2C9O A;  5ISR A;  2B2T A;  2ZXP A;  2MHV A;  1FNU A;  5JPN C;  4K2K A;  1PZJ D;  1A2U A;  3BDC A;  2E75 C;  1ESF A;  2EYP A;  3I90 A;  1G2T A;  4F7X A;  3GTQ B;  1FYC A;  2L9H A;  3VR4 A;  1CM9 A;  1LTS D;  1E2V A;  4HED A;  5E3F A;  4AYB B;  2J4X A;  3C46 A;  3K6O A;  3I3C A;  1Z47 A;  1SE4 A;  5D3D A;  1IW7 C;  4ID6 A;  4IFD H;  4HSV A;  1H9R A;  3FMC A;  4LMQ D;  5COY A;  1SAP A;  5IIF A;  3Q22 A;  1NR4 A;  4LK1 C;  1PZI D;  1X3P A;  2K1B A;  3FDT A;  1DCZ A;  4DXF A;  5JAV A;  1BR9 A;  1A3U A;  5KND A;  4BBS B;  1WTX A;  2BE5 D;  2J7Z A;  1A2T A;  3I8Z A;  2O2L D;  2EY5 A;  1UEA B;  4IFD J;  1SMY D;  1STB A;  2F0T A;  4H44 C;  1IKM A;  2BDO A;  1G29 1;  2K03 A;  1CFM A;  4ODG A;  1F9R A;  1JR0 D;  2IPK D;  2JYO A;  3UI2 A;  2XNA C;  2RDH A;  3GTK B;  2B2W A;  1EQT A;  2NVY B;  1LTA D;  3OMC A;  3CRL C;  2KED A;  1GOZ A;  1SNO A;  3K7A B;  1JWM D;  3QO2 A;  2D62 A;  3S16 B;  5EGT A;  1QB5 D;  2XVS A;  3TP7 A;  4YIJ A;  4KKT A;  4B08 A;  1S5E D;  3VYT A;  2JEB I;  3C1E A;  5C5M A;  1HCZ A;  4RHS A;  2JSO A;  2EJG C;  1WTQ A;  2O5J C;  3NPP A;  3HP3 A;  3RLF A;  2BA1 A;  2DY7 A;  4RFB A;  3TN2 A;  2DNE A;  2A68 C;  3FVQ A;  3S9W A;  2JXM B;  4NMZ A;  3L7Z C;  4CGY B;  1ESR A;  4F8M A;  4HMJ A;  4HN7 A;  5I2Y A;  5IGB A;  3H6M A;  2KEC A;  3OW7 A;  1KDC A;  1SYD A;  4K6D A;  3H91 A;  2K32 A;  1H9J A;  1K8O A;  2Z4H A;  3V96 A;  1E2Z A;  5C4J B;  2A6H C;  1I6H B;  4FP5 D;  4A3G B;  4U67 3;  2F0L A;  1KDA A;  4FF3 A;  2BA0 A;  1H9S B;  5JEA H;  3E6Z X;  1T5E A;  2L11 A;  4A3D B;  2XWB B;  4A3J B;  3QB3 A;  2CW0 D;  5IT9 L;  1TWF B;  2E2D C;  2K04 A;  3A54 A;  2NTS A;  3TBI B;  1WD1 A;  3W3A A;  1VDZ A;  2EYH A;  2RDF A;  1JC7 A;  3SR1 A;  3BYT B;  1SSO A;  2L55 A;  1JQY D;  5EPL A;  2L12 A;  5FO8 B;  4QB4 A;  1SMY C;  1I4H A;  4FO2 A;  1J8I A;  2F0Q A;  3T4A C;  3G7L A;  4RGO S;  3NTH A;  2Q8T A;  4A3B B;  5M5X B;  2PW7 A;  3NK9 A;  4ILW A;  1D2B A;  1IL8 A;  4BY1 B;  1HRJ A;  2OXP A;  2QCP X;  2B2U C;  2PZU A;  2OT2 A;  4MHE A;  2GA4 B;  3NSW A;  1JIC A;  4KY5 A;  4Z9C B;  4K5X A;  2F0M A;  2XN9 C;  2VB2 X;  1PRT D;  4GZY C;  1BOS A;  1WTO A;  1VMC A;  4QCL A;  3OHX C;  1HA5 A;  1B9N A;  1V1O A;  3S2H B;  1GHK A;  4DGZ A;  2ZXO A;  1O7Y A;  2EYL A;  1GUS A;  3A7A B;  3BG3 A;  4KY7 A;  4DAV A;  1GJX A;  1XTC D;  4RA8 A;  3SK8 A;  1O7L A;  2A69 D;  2A6H D;  2O4X A;  4CJ1 B;  5KRU A;  1ENF A;  1PTO F;  3WOF A;  4RAU C;  3VR2 A;  4KI0 A;  3PUZ A;  2K28 A;  3M7G A;  5I2X A;  4PV1 C;  3HOY B;  1LTT D;  3JAM L;  3GD7 A;  4IN3 A;  2PPB C;  1L0Y B;  1H9K A;  4TQU S;  4XYQ A;  4KN7 C;  3ITP A;  3MXN A;  5KIX A;  4CKC A;  4ZUJ A;  2N55 A;  4C3H G;  3K5N A;  2NVQ B;  1LAC A;  3U9O A;  1S4Z A;  1V43 A;  1EY9 A;  3QOL A;  3H09 A;  2QDB A;  1C4Q A;  2CW0 C;  4E6I A;  4RCN A;  2ENB A;  1B3A A;  2XIW A;  5A2Q L;  1BXT A;  3PUY A;  4H7B A;  4ULL A;  1XWE A;  2QEJ C;  1RDP D;  4C2M B;  2LY7 A;  1DM0 B;  1TWG B;  3OIP A;  2OF1 A;  1Q1B A;  1YNN C;  3DWA A;  3NQT A;  5CBE E;  5C4X B;  4EQN A;  3MTS A;  5HGT A;  1EWC A;  5IT9 E;  3BYY B;  1J9O A;  2B8G A;  2RA4 A;  1ENC A;  4CJ0 B;  1Y8P B;  4ZKB B;  2SEB D;  3NBI A;  4KTA A;  3CQZ B;  1EOT A;  2BE5 C;  1R4P B;  2IL8 A;  2AWO A;  3H94 A;  5ELC A;  1SYC A;  2EYJ A;  2PMZ B;  3FKI B;  5C0X J;  2KVM A;  3GTL B;  1GUT A;  4KD4 A;  4IUT A;  4FF1 A;  3Q0A A;  1KAB A;  2MP1 A;  1ROD A;  1O80 A;  2NN6 G;  2YU9 B;  3FEW X;  3K5M A;  1JCK B;  3S15 B;  2RBM A;  5EKL A;  4G4K A;  3GQB A;  1SJH D;  1Q1E A;  1B1Z A;  1CHQ D;  5C5L A;  2NUC A;  5JOB A;  2PCF B;  1CZG A;  1I4R A;  2EJM A;  3N52 A;  3NP8 A;  5CC4 A;  4C1N I;  2F0N A;  1Y8O B;  3EA6 A;  4A3F B;  4C3H B;  5KGU A;  2FIN B;  2KJX A;  1HUM A;  1BNZ A;  1V1P A;  4WJW A;  1W6J A;  3Q24 A;  2JA8 B;  3EVQ A;  4F87 A;  1OXX K;  5NUC A;  1SBB B;  2B63 B;  1EU4 A;  2HCC A;  2IX3 A;  1Z6H A;  4OO1 I;  3FPP A;  1ET6 A;  5K5P A;  1V8Q A;  3GTO B;  1DZ1 A;  3S2D B;  1B50 A;  2PW5 A;  2KCC A;  4RGT A;  3OMG A;  2B2Y C;  3X3M A;  3P20 A;  1PFN A;  1EY0 A;  3FRP B;  3K58 A;  3A8K E;  5M3F B;  2B2V A;  4K5W A;  4XQJ A;  1UAP A;  4H0L C;  3I73 A;  4OHJ A;  5K36 G;  2KEE A;  2Q8I B;  3A8J E;  1GXD C;  4L8J A;  1KAA A;  2RSO A;  2OEO A;  4IUP A;  3GV3 A;  3P1H A;  2SNM A;  3MFG A;  3IFD A;  1G2S A;  4K8I A;  4WFN 3;  3A56 A;  2B39 A;  1CI3 M;  3QWN A;  4PMC A;  1LTI D;  1NSN S;  5COR A;  1QCB D;  1TS2 A;  3HOW B;  2F1M A;  5CR3 A;  5I9O A;  1I50 B;  3SXH A;  3MAQ A;  1KLU D;  1SE2 A;  2F0E A;  5KEE A;  2AQ2 B;  3DMU A;  3OOC A;  2HUG A;  3L9A X;  5M9O A;  3S1R B;  4ZYS A;  1A3T A;  1U4R A;  4KV6 A;  3GTM B;  3K57 A;  4KK7 A;  1VF7 A;  4DXG A;  5DM6 3;  3MWY W;  2EE1 A;  2X69 A;  4LAA A;  2E2H B;  3S14 B;  2FMC A;  4OIK A;  3BVM A;  4N9P A;  1SYF A;  3NQI A;  2F0K A;  1AZQ A;  1LT4 D;  2NVX B;  5E1F A;  1FR3 A;  1CTM A;  4HTH A;  1EEI D;  1KNA A;  3SE0 A;  1I4P A;  4KHZ A;  2F0O A;  1HTP A;  5J22 A;  2V4D A;  3LWU A;  2L0C A;  5DEH A;  2K5Q A;  2G9H D;  3J81 E;  3D4D A;  1U4L A;  3Q6S A;  3K5O A;  4Q5V A;  1RJT A;  3VA7 A;  4DF7 A;  4TKO B;  5FOB B;  2EZV A;  1Y8N B;  2LKV A;  5DAU A;  5ELF A;  1SNP A;  2IJ0 A;  2E2I B;  3SK4 A;  4X3T A;  5EQ0 A;  1QE6 A;  3D4R A;  5DM7 3;  2LS0 1;  1HQR D;  4FF2 A;  1AP0 A;  4HAE A;  3T16 A;  5C44 B;  3MXG A;  1ZKO A;  1WTR A;  4WRD A;  2MJ8 A;  2XSC A;  1JOQ A;  2A6E C;  1TWH B;  2L4N A;  1EYA A;  1AZP A;  2A73 B;  1EY6 A;  3GO5 A;  4DA2 A;  3NWT A;  2CHB D;  1CQV A;  1I3Q B;  5C4H A;  1EY5 A;  1PTO D;  3HG9 A;  3A55 A;  4R8N A;  2PNR C;  1GUN A;  3CHB D;  1SNQ A;  1PRT B;  3IAY A;  3GTJ B;  5D3I B;  2R7Z B;  3MEH A;  3GTP B;  3Q23 A;  2N88 A;  4EGV A;  5EPK A;  1DD2 A;  2AWN A;  3CRK C;  1LTR D;  2SNS A;  2F0J A;  1HXY D;  3KLS X;  4WOR A;  2WIN B;  4LJZ C;  5IGC A;  2VNU D;  3T51 B;  2AQ1 B;  2IX0 A;  1F9S A;  3J7A F;  3DHQ A;  2IW3 A;  2NB0 A;  3O13 A;  1EL0 A;  4CKE A;  3PO2 B;  3OIQ A;  3HZX A;  4J1M A;  3J81 L;  4HMI A;  3ERO A;  4IQZ A;  1PYW D;  4PMB A;  3QIA A;  4OO1 H;  1C8C A;  2YYZ A;  5A35 A;  1OXS C;  4UDU C;  3MXU A;  4FXK C;  1F77 A;  5ELE A;  2ICI A;  3RZD B;  2F0G A;  3M3Y B;  1LO5 D;  4A3I B;  4NKL A;  3WDN A;  4XT1 B;  1M8A A;  4KN4 C;  5IGG A;  1HFN A;  5KYL A;  1EY8 A;  4XIG S;  3DWP A;  1VMP A;  3SEB A;  2LFN A;  3D8G A;  3KLR A;  4KMU C;  2I07 B;  2B2W C;  1MGS A;  1Q3L A;  5J1Z A;  3N6R A;  4C1N K;  3QG1 A;  2IWH A;  2ID0 A;  2WII B;  5C4Z A;  4X3U A;  1STY A;  1ENA A;  5D14 A;  1JE4 A;  4EVO A;  2F3V A;  1IYU A;  3TP5 A;  2DN8 A;  2BOS A;  4ZQ3 A;  5BN4 A;  2F0D A;  1HA6 A;  1EYC A;  4ZAI A;  4C3J B;  3KF8 A;  3GP7 A;  4K2L A;  5C3W A;  4P2C B;  4XXE A;  1VCI A;  2EY1 A;  4FXG C;  4ZKC B;  2JA6 B;  2F3W A;  3V2T A;  3TZD A;  3TDQ A;  2JEA I;  1O78 A;  1D1I A;  1B4O A;  3AU7 A;  3I72 A;  3W2D A;  4CHT B;  5D65 A;  2PQE A;  1OXT A;  1II3 A;  4HSP A;  4QUC A;  1KLG D;  2F0S A;  2RKS A;  3MFY A;  1ML0 D;  1M4V A;  3VA5 A;  3R2T A;  1JB3 A;  2F0F A;  3M4Y A;  3IFT A;  1HPC A;  1KNE A;  2K5D A;  2X6G A;  1U9R A;  1ZEQ X;  5FK9 C;  3DWQ A;  5IOD A;  1FGB D;  3PIP 3;  3A8I E;  4G57 A;  1RD9 D;  5EKK A;  1LT5 D;  3CKI B;  3R8B A;  4S3S A;  1EQV A;  4UAI A;  1LLR D;  1STE A;  1RTO A;  2MPM A;  1OXU A;  1SFO B;  1K8M A;  5J39 A;  1BCP F;  4IAL A;  1D6E C;  3KBG A;  3PUX A;  1EYD A;  4M1U B;  1QIL A;  4QUF A;  3G6J B;  2B2T C;  4I7Z C;  4IFD I;  5AFW A;  1TS3 A;  4KKU A;  2Z4I A;  1Y1V B;  2VUM B;  2PZT A;  5JVG 3;  3R3O A;  5C0X I;  2L1B A;  3WOE A;  2CQA A;  3F2U A;  4RHR A;  2X6L A;  4IFD G;  1PRT F;  1SND A;  3SHL A;  2HDL A;  1LT6 D;  4BWG B;  4EQP A;  1ONL A;  2E74 C;  3RUZ A;  2MGS A;  1GUG A;  2SDF A;  3KUP A;  4J6H A;  1EIH A;  3S1Q B;  2E2J B;  2A69 C;  3HOU B;  4FNF A;  1LTG D;  2R61 A;  1IKL A;  1D5Z C;  1F9Q A;  1Y69 U;  3D6C A;  2A5H A;  2KOL A;  3HOZ B;  2M9V A;  5JPM C;  3C2P A;  1CQF A;  5CYU A;  1SNM A;  5T1G A;  3BS1 A;  3P7J A;  1YNN D;  2EPB A;  3RMH A;  4KHV A;  4QMG A;  4C3I G;  5JJZ A;  5FO7 B;  3S1N B;  2WAC A;  2IT1 A;  2VXW A;  3D31 A;  4OL7 A;  5EJW A;  2WKD A;  2F0P A;  5LHY 1;  1DXM A;  3NXW A;  1DJR D;  1QOH A;  1Q8I A;  1PFM A;  2NBF A;  5IGE A;  1DOL A;  1EIG A;  2AUK A;  1TY2 A;  1BDO A;  3X3N A;  1ILQ A;  4C56 C;  3C1F A;  1TS4 A;  2K01 A;  5CV8 A;  2TSS A;  1UNS A;  2F03 A;  1RTN A;  2WB1 B;  1PZK D;  1Y1W B;  3KLS A;  4OO1 G;  4FVM A;  2R6G A;  4IZ8 A;  2L5T A;  4JK1 C;  3BVZ A;  1NAP A;  2G9D A;  3OWF A;  1EEF D;  3SVM A;  1JWU D;  1LT3 D;  3DEO A;  4G7H C;  1ZYR C;  4ME5 A;  5CBA E;  1BCP B;  4A3E B;  4KJN A;  2EYO A;  2PZW A;  3NUC A;  4FF4 A;  1EFI D;  1I4G A;  1ICW A;  5I6Y A;  1F2Y A;  1Q12 A;  4XQQ A;  4OGQ C;  1TR5 A;  1FD7 D;  4K5V A;  1OXV A;  4IUV A;  1B44 D;  1DOM A;  1CHP D;  1D5M C;  5C0X H;  1QWY A;  1ZYR D;  3TME A;  5EBC A;  4BBR B;  2JA5 B;  1I6V C;  3QJY A;  4FYD A;  3QOJ A;  3LX0 A;  3VR5 A;  4QIW B;  3HEJ A;  5G3L D;  2K6A A;  4NW2 A;  2QF7 A;  1I4Q A;  2LMC B;  3VR6 A;  4R9W A;  2K5W A;  1HQM C;  3HRZ C;  4V0B A;  1A6X A;  1VF5 C;  3C3L A;  3RD4 A;  1LAB A;  2Q8R E;  1MI2 A;  3LNN A;  3MHB A;  4J8Q A;  4PQX A;  5EPJ A;  5FO9 B;  3K5L A;  4DAY A;  3D6W A;  2JA7 B;  4PMW A;  2ZT9 C;  4HCS A;  5HUR A;  4EQO A;  3NTI A;  5A2Q E;  3KBX A;  2RQX A;  1QNK A;  1DON A;  2B8F A;  4X3S A;  4ZUI A;  2HQE A;  2QKI C;  1XXG A;  1CZW A;  4ABN A;  1PLF A;  2KA7 A;  1WTW A;  1B9M A;  3P75 A;  1XX8 A;  1WD0 A;  3S1M B;  1GUO A;  1BCP C;  2RVL A;  1E2W A;  1B53 A;  2F0H A;  5BN3 A;  5I9P A;  1QG7 A;  2TMP A;  2F0I A;  2AQ3 B;  2H4O A;  3BZD B;  4IUQ A;  2K05 A;  3V05 A;  1EZ8 A;  2NN6 H;  4U68 A;  1RF2 D;  1WTP A;  1F2M A;  5TSS A;  5CV6 A;  1BBX C;  1S5F D;  3I70 A;  2PO4 A;  4DU9 A;  5DNF A;  1SE3 A;  3NWS A;  1HFG A;  1Z7T A;  3A7L A;  1PTO B;  1PFB A;  2XWJ B;  2B2Y A;  1YNJ D;  3J80 E;  5KNC A;  3OWE B;  3MVV A;  3I91 A;  4RGN A;  4DN4 M;  4BS9 A;  1H9M A;  1HHV A;  2HDM A;  1L0X B;  1JOK A;  4G7Z C;  1EWH A;  3LWE A;  2EVB A;  4K8J A;  2XRQ D;  3GTG B;  2NTT A;  2EXZ A;  1JOR A;  2PYK A;  4OIJ A;  3TP8 A;  3J80 L;  2QIL A;  1QJO A;  4B9W A;  1U4M A;  4KJO A;  1X32 A;  4A3M B;  4A93 B;  1DOK A;  5I6W A;  2A74 C;  3NBH A;  3J7Y W;  3SK5 A;  2FHT A;  1R4Q B;  1SYB A;  3HKZ B;  3ERQ A;  5KYI A;  5CV7 A;  1CA6 A;  5ELB A;  5K36 H;  1S5B D;  4RWS C;  1RKN A;  3H3V C;  3DM1 A;  3M4O B;  2EYF A;  4N9T A;  1G6Z A;  1DYQ A;  5IGF A;  1SDF A;  4CBV A;  2FMM A;  3R93 A;  1HUN A;  4DAP A;  1ZXT A;  4RCO A;  2D5D A;  3VYS A;  3OSO A;  1XYI A;  1E0B A;  3TP6 A;  2BCO A;  4MN3 A;  1D1K A;  2DY8 A;  3CU7 A;  1BO0 A;  4O42 A;  3ND8 A;  3MA2 B;  4XTC S;  3NHH A;  4XQN A;  3K0Y A;  2NVT B;  2EY2 A;  5CV4 A;  2SOB A;  4RKL A;  2Z1C A;  1STA A;  2I46 A;  3AMU A;  5LL6 S;  3I4L A;  3MZ5 A;  2Y0S B;  2NN6 I;  4B9X A;  4R8I A;  1H9S A;  1TT2 A;  1SEB D;  3AB9 A;  1C48 A;  3ONA B;  3URY A;  4RH6 A;  2H1E A;  3MXP A;  3K59 A;  1G91 A;  3NTK A;  1ET9 A;  2IX1 A;  1JWS D;  5JEA J;  1NUC A;  1IYV A;  1WTV A;  1TVX A;  3D3R A;  4ZLT F;  2EJF C;  4K14 A;  1R9T B;  2XRS D;  2D9U A;  1A3V A;  1PXU A;  3E0J A;  4L63 B;  1PMR A;  4H13 C;  4O1N A;  1LTB D;  1W6K A;  4M8A A;  5I4D A;  2KQ3 A;  4FXD A;  1STH A;  3DXJ C;  5FLX E;  2M00 A;  1TU2 B;  2WKC A;  4XDX A;  2RDG A;  4TSS A;  4RKB A;  1SYG A;  1BQQ T;  1GHJ A;  2NWG A;  2WV6 D;  1FNV A;  4HR7 B;  3EQL C;  5E4W C;  3EFX D;  3BVG A;  1S5D D;  2C5C A;  2FJ2 A;  5C0X G;  5M3M B;  3HS0 C;  1EZ6 A;  1ILP A;  3GV6 A;  5CMD A;  1EY7 A;  1PDQ A;  1SJE D;  2EDG A;  3HOV B;  4NP5 A;  2ZXR A;  3H0G B;  4L6T B;  2WP8 J;  1X3Q A;  2M2L A;  3S17 B;  3PIO 3;  3IKJ A;  4CKB A;  1QNU A;  2CVR A;  3HOX B;  2B2V C;  3D4W A;  2ICE C;  3PUW A;  1TS5 A;  4Y7N B;  2EYM A;  4XT3 B;  1BCP D;  5KNB A;  1F9P A;  3VR3 A;  1V1P B;  4C3J G;  4TRD A;  1OO9 B;  1D5X C;  2HCI A;  1TWA B;  2A68 D;  4IUR A;  5FLX L;  3R2I A;  1F2L A;  3T53 B;  1MBY A;  1NR2 A;  4V19 0;  2D2C C;  3PMF A;  1MSH A;  3SK6 A;  5CGK A;  1AEX A;  2MUY A;  3J7A V;  1MSG A;  1A15 A;  1AW7 A;  5C6A A;  3OPO A;  2JP1 A;  4PNY A;  3JAM E;  2O5I C;  2BDN A;  2J0T D;  5JEA G;  3T13 A;  4KKS A;  3TSS A;  4A3K B;  3U9S A;  5CV9 A;  4DK1 A;  2VB3 X;  1TKW B;  4KY6 A;  5BN5 A;  2JE6 I;  2F4I A;  1EY4 A;  1I4X A;  3NE5 B;  5FKA C;  4BA2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...