1CA6A

Intercalation site of hyperthermophile chromosomal protein sso7d/sac7d bound to dna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
b'MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*GP*AP*TP*CP*GP*C)-3'
publication title Crystal structures of the chromosomal proteins Sso7d/Sac7d bound to DNA containing T-G mismatched base-pairs
pubmed doi rcsb
molecule tags Structural protein/dna
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1999-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ca6A00
1JE4A 2L11A 1VMCA 3GV6A 1NAPA 4ZKBB 1HRJA 2D9UA 1X3PA 1EIGA 1B53A 2B2VA 4HSVA 2B2UA 4X3SA 1WVLA 2K1BA 2RSOA 1ZXTA 1WD1A 1PLFA 2BDNA 3Q6SA 3MTSA 4MN3A 1NCVA 1B2TA 1PFBA 1A15A 1VMPA 3LWEA 4XT1B 2K28A 3G7LA 1IKMA 1G6ZA 1HHVA 1ESRA 2XIWA 1DOMA 4RA8A 1EOTA 3P7JA 1DOKA 1O7ZA 4CJ2C 1O80A 1AP0A 5D14A 2EE1A 1PFMA 1WTVA 2X69A 1WTRA 2JP1A 4HCSA 1MI2A 1CM9A 2RVLA 5AFWA 1RJTA 3D6WA 3DEOA 5EPLA 1XX8A 3MWYW 3QO2A 3I3CA 1DOLA 2KECA 2DY7A 3I90A 2FINB 1WD0A 2B2WA 2X6GA 4HEDA 4XDXA 3UI2A 2B2WC 5DNFA 1WTWA 2KEEA 2KOLA 2MGSA 1AZQA 1NR4A 2NZ1D 3I8ZA 2HDMA 3HP3A 2J7ZA 5D65A 1AZPA 2L12A 3KBXA 4RWSC 2NWGA 4RAUC 5COYA 3GV3A 1HFGA 2B2VC 1CA6A 4R8IA 2B2UC 4IUVA 4HAEA 1F9QA 1ML0D 1XYIA 2MJ8A 5T1GA 5CMDA 1GUWA 2M2LA 2K03A 5EKIA 1IKLA 1Q3LA 1F2LA 4LMQD 4X3UA 1RTOA 1G2TA 4IUUA 1O7YA 1E0BA 2HUGA 3IFDA 2EOTA 1BO0A 1BBXC 1X3QA 4IURA 1KNAA 1ILQA 5JJZA 1M8AA 2IL8A 2R3ZA 2N88A 2Q8RE 1EIHA 2FMMA 4R9WA 2N55A 2KVMA 5EPKA 1MGSA 1X32A 1IL8A 3TZDA 1B3AA 1F9SA 2FJ2A 2NYZD 1B4OA 1F9PA 2VXWA 5E4XA 1MSHA 4ZK9B 4DN4M 4QUCA 4NW2A 2CVRA 3SVMA 1G91A 1SDFA 2DY8A 1WTQA 1ICWA 1SSOA 1G2SA 2HDLA 2K01A 1QE6A 1RHPA 1U4PA 2FHTA 1NR2A 2MP1A 3FPUB 1HA6A 1WTXA 1BF4A 1U4MA 2FFKB 2RSNA 2B2YA 4MHEA 1J8IA 4OIJA 4X3KA 2B2YC 1F9RA 2B2TA 2L4NA 2Q8TA 1MSGA 1BNZA 5E4WC 1CA5A 1U4LA 2RA4A 2H1EA 1WTPA 1WTOA 1DONA 1J9OA 4IUQA 1QG7A 3IL8A 4IUTA 4ZKCB 3N52A 2SDFA 4X3TA 4XT3B 1RTNA 1DZ1A 1PDQA 4OIKA 2JYOA 4CJ1B 2L1BA 2X6LA 5EQ0A 1S4ZA 1EL0A 1TVXA 2KUMA 1HFNA 4ZLTF 3ONAB 4U68A 4QUFA 2HCIA 5CBAE 1QNKA 4UAIA 1JICA 3TN2A 1U4RA 3F2UA 4CJ0B 3KUPA 1SAPA 2K04A 1C8CA 5EJWA 2KEDA 5CORA 4IUPA 5CBEE 3DEPA 2EPBA 3DM1A 1KNEA 1HUMA 3H91A 2HCCA 2K05A 4O42A 1EQTA 3R93A 1B50A 1RODA 3FDTA 5EPJA 1HUNA 3I91A 2L9HA 2B2TC 5T1IA 1ILPA 1PFNA 4ZAIA 2MPMA 1LV9A
chains in the Genus database with same CATH superfamily
1PRTD 3GV6A 4KHZA 4K0KL 2NN6H 1L1OB 1B53A 5M5XH 2LKVA 1K3BC 2RHSB 3KFUA 2RCNA 3E3XA 3FMCA 3I4MB 1Q1BA 2EJMA 1IYUA 2ZJQA 4F88A 2F0LA 5E3FA 3TBIB 4UPAA 3FHWA 1S5ED 3TMEA 4LFCQ 2LSSA 5ELFA 2XGTA 4CDFC 2QF7A 3C1EA 1SYFA 1VQAA 1SNPA 2IJ0A 2X6GA 5JEAJ 3UI2A 3A8IE 1ASYA 2KOLA 1PXUA 1SR3A 1V1PB 1HXYD 1OXTA 3CKIB 1SFOB 2UU9L 4A3DG 4HAEA 4S3SA 3EA6A 3CD6A 3KDFA 2JEAI 3PSIA 2ZJRA 1G2TA 4IUUA 4R4CA 2K50A 3HOWB 1I94Q 3H0GB 3K5LA 4JI1L 1YNXA 1Z9FA 5JJZA 5LMUL 1EIHA 3D31A 3MHBA 2ZTDA 2Z8LA 4A3EH 5J22A 4ME3A 4IJHA 4XQNA 3RLOA 1L2FA 3S1QB 4KTAA 2CWAA 3OSOA 3R8BA 1OO9B 1LTSD 3GTMH 3RD4A 4CKCA 3T51B 1VQPA 2EYJA 5LMNW 4TRDA 3P75A 1A62A 3KJOA 2F0FA 2O5IC 3U4VA 5IE8A 1NY4A 4R4IA 1TKWB 2GVBA 1O78A 1S4ZA 3CC4A 1U9RA 5CBAE 3J80i 1NUCA 2XTIA 3HOXH 3MFGA 4I7ZC 4KHPQ 3HOUB 3F2BA 2K05A 1I4HA 3PIPA 3R93A 1FNWA 1I6HH 1K83H 2VQEQ 1XNRL 3J7AF 4LFAL 4JYAL 4GOPB 5FJ8G 4DR5Q 1KIXA 2NB0A 3DWPA 1KL9A 2K4KA 4HJ8A 1H95A 1PH9A 2WKCA 1PRTB 3ND8A 4G7OC 1RD9D 1I5FA 5M3MB 1B70B 5ELEA 3K7UC 1G6ZA 3VR3A 1L0XB 1UE6A 2KA7A 1PTOH 1SNMA 1J6QA 2JQOA 4IQZA 3GTQB 2KJXA 2X69A 4RGOS 5IGGA 3JAMc 2SEBD 3SK8A 3DEOA 4TVAB 1Y69U 1YNND 1BQQT 2F0NA 3I3CA 2WAQG 4WJWA 1A8VA 2DY7A 3PO2G 4YCVA 4A3CG 2NBFA 1EU3A 1AZQA 4KN7C 1GUSA 3CRKC 3U58A 4PNYA 1ENCA 5IGEA 3UDIA 2JA5G 3DWAA 4GN4B 3GTKB 1S3OA 5T1GA 3BDCA 4KKSA 4A3MG 1X56A 3D4DA 1Q3LA 1IBML 1EWCA 3CP0A 3NSWA 2CFMA 4FF2A 5K36G 5FO9B 1ASZA 2IL8A 2F4VQ 1A0IA 1MGSA 4X64L 3HEJA 1STEA 1QZGA 1F9PA 2YTXA 2OTJA 1UUPA 1VQOA 1I4QA 3A7LA 1EYGA 1J5EL 2FHTA 1N34Q 5E7NA 4NXNQ 5L37A 3OPOA 1LTTD 4GKJQ 4RMFA 5M5XB 3MXGA 4BWGB 1J9OA 4IUQA 3IL8A 5CV8A 3SXHA 2Z6KC 1GM5A 4J8QA 5AJ3L 3T56B 3NQIA 2CQAA 5CYUA 4KMUC 3KYHC 2WAQE 3ONAB 1NTGA 1L1OA 3STBC 2F0WA 3U50C 2SOBA 1IXRA 1A3VA 3MEHA 1ONLA 1STAA 3DEPA 1EYCA 2TSSA 2VQFQ 1WYDA 4BA1I 4OX9L 3HOYG 3EQLC 3I91A 2VS1A 3VYSA 4KKUA 3MC0B 1YJ9A 1PFNA 2EIFA 3Q8DA 1HNXQ 1LTGD 1LLRD 3W1BA 2CHBD 4E6IA 1EZ6A 3PGZA 3QJYA 1HPCA 2D9UA 1F2YA 1VQMA 2R7ZG 1JCKB 1V1PA 2EJGC 2I5MX 5C44H 1SE3A 2BDNA 3Q6SA 5FK9C 4R4OA 4RA8A 2UXDQ 1L0YB 2LMCB 2KHJA 4A3EB 4V0BA 1SXTA 1KHIA 4HJ7A 3OHXC 3PO2H 3F2CA 4DXFA 3E6ZX 4B3TL 3HKSA 3T1YL 1XNQQ 1R9TH 4A3CH 5ELOA 4LF9Q 3GTMB 4IFDH 5M3FG 5DNFA 2JA5H 3IKJA 3I4LA 5LMNL 3CQZB 2EXDA 2NWGA 3GD7A 1HFGA 2P5ZX 4DV0Q 3S16B 1XYIA 2IHEA 5K36H 2VZAA 1GUWA 1JMCA 1S72A 2AQ1B 2ICIA 4V190 4DR1Q 4YHHQ 4BY1H 4KKTA 2KCTA 2TMPA 3VR6A 4JOIC 1ILQA 3HOXB 1SE4A 2I0QA 3A5ZB 3D4RA 1JJGA 1RDPD 2ENBA 4C3JG 3A55A 1B4OA 4DN4M 4IJLA 1IW7D 1LTLA 3BZDB 1TY2A 1YHAA 1YI2A 1OXVA 2YTYA 4KLKA 3BVGA 2QDBA 3CPWA 1N32Q 3HRZC 1GO3E 5H1SE 1DCZA 3I55A 4JI4Q 1EZ8A 1NE3A 2EDGA 1NBWA 5E4WC 1GHKA 1MKHA 3NPPA 1BKBA 2SDFA 2XRSD 4GOPA 2VUMH 4JW0A 1RTNA 1C7YA 4A3KH 2UUCL 2E76C 4ME5A 4CJ1B 1DGSA 4TSSA 3JAML 4JI5Q 3HOYH 1K73C 1C8CA 5EJWA 3S1NB 1TWGH 3CW2C 2XRQD 1X65A 4K0KQ 1TWHH 2HCCA 1C48A 4BBSG 1HUNA 2PI2E 3TREA 3PF5A 4C2MH 3TDQA 2R7ZH 3M3YB 1IYVA 4DV6L 5IP9H 1HRJA 4DUZL 2B2VA 4P74A 1H9KA 1WD1A 2RBMA 3S9WA 2AUJD 3CU7A 3G7LA 4DV4Q 4IZ8A 1STGA 1C9OA 3S17H 2YU9H 1G51A 2Z4IA 1DJRD 4BY7B 3TP7A 2JP1A 1ESFA 4IPHA 3J80L 4DNIA 4MNOA 1YHBA 2UU9Q 4TQUS 3A8JE 3MEFA 3CC7A 4BS9A 3CCUA 4K14A 3BYYB 4XDXA 3GO5A 5C0XI 2K52A 2OWOA 1V43A 3NWTA 4OGQC 1G6PA 2WINB 3DWQA 3NBIA 1PYBA 2BA1A 5C4ZA 4G7HC 2MJ8A 5JJLA 2AMCB 2XWJB 2KQ3A 1JOQA 3Q23A 2Z9HA 2E2HH 1CZWA 3CMAA 4C3IG 2RQXA 1SNOA 2OEOA 4A3LG 2JA7G 2KHIA 2LY7A 1GUNA 1NMGA 1HR0W 1B44D 4ZCKA 2G9DA 2ICEC 1CFMA 5C3WA 1SYBA 3PIP3 1U4PA 1EY9A 1HZCA 1Q46A 1U4MA 4UP9A 5CV4A 1QCBD 4XYOA 2BE5D 2QEXA 3H3VI 3VR5A 1NNXA 1HH2P 1WI5A 4JI0L 1J8IA 2NVXH 1ZYRC 2B2TA 3SDZA 3J81i 3S2DH 3GTPH 2PZTA 2UUBL 2BH8A 1VCIA 5C44B 2JE6I 5J1ZA 5CC4A 4KD3A 1S5CD 1FL0A 4X66L 2L1BA 1LT5D 2IPKD 3PO2B 4U68A 4LFAQ 2HCIA 3NWSA 3K5NA 2L5TA 1BXTA 2F0SA 4A3GH 1N36Q 4X6AH 1HZ9A 2EPBA 2JK8A 1SBBB 4GNXB 4ILWA 2JA5B 1SNQA 3CCJA 4HIKA 1FGBD 4QB4A 4JPBW 4POGA 1TQOA 1M1KC 2WFWA 4LUOA 4OEMB 4DR4L 2B2UA 5I2YA 3GTOB 1QVCA 4BY1B 1NCVA 3QIAA 1PFBA 4RKBA 4XT1B 1IBKL 1XPUA 2IWHA 3BVZA 5IWAQ 4HCEA 1JJ2A 4Z9CB 1JQYD 4U673 2PMZE 3P7JA 1K9MC 1E3PA 2PPBC 1PFMA 1U0LA 5FOBB 5GROA 4Y52H 2K5VA 3TP6A 2PQAB 4IPGA 1MHWC 3RN2A 2A19A 2GA4B 1DOLA 3I90A 3OIQA 2F0DA 4B9WA 2YV5A 2EJFC 2H5XA 4HEDA 3CF5A 3GTGH 3MAQA 1SN8A 5DM63 1UEAB 4RG1A 1Q8KA 3A5UA 1YEZA 4QCLA 5NUCA 2I07B 4OWXB 5BN3A 1EIYB 4GLXA 1HNWQ 2VUMB 2Q2IA 4X64Q 1IKLA 1JJCB 4A3KB 4C3IH 1SJED 1EOVA 4A3LH 1E0BA 2JA7H 3I4NG 1J5EQ 2A6HC 1V8QA 1Y1VH 4DAPA 2R3ZA 1Q7YC 1LACA 1E1OA 4FO2A 3HOYB 2N55A 2Z0SA 1IL8A 1TWHB 2NTSA 5K5PA 1G2SA 4JVZA 2ID0A 1L0WA 1YITA 4NP5A 5AJ3Q 5ELDA 4HTHA 3OOCA 2AHOB 1EFID 5KYLA 4AYBG 1I50H 2JA8H 1CHPD 3ULLA 3T1HL 4LUVA 1VQ4A 2F0VA 1ICFB 1YNJC 1K0SA 4L5RC 2YU9B 4PZ8A 4OX9Q 2R7DA 1HFNA 4C1NK 2Z4HA 4Y7NH 1U4RA 1L1OC 2R92G 3KOJA 5ISRA 3MXUA 1Z47A 4GLAC 1BCPD 5CBEE 1A63A 3DM1A 1MBYA 1TWFH 3A8KE 1SMYC 2RDFA 3NBHB 5C0XG 3EROA 4GLVB 4AH6A 2EY5A 2F0OA 2E2IH 3D4WA 1BR9A 5IYCH 5G3LD 4OO1G 2K6AA 2XWBB 2ZM6Q 2NVTH 4ZKBB 4KY5A 1D5MC 3M4OH 1KDBA 1WVLA 1PH7A 4B3TQ 1S40A 3HOVG 1H9JA 1XTCD 5KRUA 4A3BG 1ZKOA 1A3TA 2GN5A 3OTOL 2VNUD 4QIWE 1HR0L 5KYIA 1T5EA 2L0CA 5C0XJ 5LMNQ 2RVLA 1X3EA 3AQQA 2WACA 3QO2A 1ET6A 2K14A 4AYBE 1WOCA 5CGKA 2NVXB 2J7ZA 1E24A 4O0AA 3K57A 1VQGA 4CBVA 4XQQA 1IL2A 4OL7A 1OXXK 4PMCA 3K80C 2M2LA 5ELCA 1RTOA 2DNCA 3AU7A 2N78A 1SEBD 3OW2A 3SGIA 5A35A 3K58A 4DR3L 2E2JH 5EPKA 4A3GB 2DJGC 3KLSX 5GAGC 4K6LA 3G71A 1YZ6A 2QEJC 1PH5A 2R93G 2PQEA 4DR6L 1HNZQ 1KTKA 3NUCA 1WTQA 1HA5A 3L9AX 4KV6A 3MA2B 3G6EA 2NUCA 5I9OA 3SEBA 1WTXA 3MFYA 2B2YA 1CK1A 2Y0SB 4OIJA 4IALA 5C3EG 1T9HA 3UDGA 3MXNB 4OWTB 1OXUA 2EY2A 4GNXA 1JWMD 2A68C 3HKZG 3JAMi 3QOJA 3NP8A 2FXQA 2VB3X 1E22A 1U5KA 3I56A 3C3LA 1EY0A 4GOPC 1PDQA 2RDHA 2JYOA 4YCUA 1YJWA 5DEHA 5C4XB 4LAAA 3A54A 1PRTC 4GZYC 3DLLA 1D6EC 5IT9E 1TS3A 1LT4D 3PO3G 4DV6Q 3TZUA 1BCPB 1KNEA 1NMFA 3GTGB 4DUZQ 1I4PA 1EUJA 5IT9c 2BCOA 5IYDG 4OO1H 4KY6A 4JI7L 4DF7A 4DAVA 2L9HA 3S14H 1KLUD 2F4IA 4KK7A 5IY0A 2L55A 1VQFA 2MPMA 2PQAA 2JSOA 1KDCA 1EIGA 5KIXA 3J81L 4DV2L 4A3BH 4GN5A 1DD2A 1MIUA 3SR1A 1Y1VB 3BJUA 1IHZA 4IO9A 5TSSA 2L15A 1Y1WG 1K8AC 1JC7A 3E9IA 5AFWA 5HY6A 5EAYA 5EPLA 4DK0A 1LUZA 2R61A 5JEAH 4EX5A 1WD0A 2DN8A 1VQ7A 3RNUA 3VR2A 4LF5L 2KEEA 1UNSA 3E0EA 2PCFB 4DV1L 4RWSC 1AEXA 1CSPA 2PW5A 3GV3A 4LF7L 4AQYL 2JA8B 1WCMG 4B3SL 2UXCQ 4KY7A 1H9SB 1Q90A 4L5TA 5KEEA 1Z6HA 2EOTA 1X6OA 1X3QA 2R93H 4A93B 4HSPA 1GHJA 4A4IA 4JI3L 4CDCC 1TWFB 4JI0Q 4A3DH 4NXML 3M85A 2UUBQ 2JA6G 1F2ZA 1RHPA 2B63G 2E2IB 4MIUA 4WORA 1NR2A 3FPUB 2M00A 4BBRG 3T13A 4OWWB 2ZJPA 3UDXA 2NVTB 4X66Q 1XMOL 4HR7B 2MO1A 3M4OB 3NBHA 2O5JC 3I7FA 4A3IB 3GP7A 2EYLA 2PI2A 1CHQD 5FLXE 3A0JA 4DKAC 4EGVA 3BDOA 1I6VC 5HGQA 3STBD 1CQVA 1DZ1A 1EY8A 2UXBL 1FYCA 1F2MA 1YIJA 1M90C 2CKZB 3OMCA 1GXDC 2D0PA 3VYTA 3RZOH 3G48A 5EBDA 2AWNA 2IHFA 4DK6C 2O4XA 2F0QA 3L3OC 3IAYA 1SAPA 2K04A 2HQEA 5IYDH 4OXPA 3FKIG 4M1UB 4DU9A 4LF4L 2LXJA 4DR4Q 1B50A 1EEFD 1GUTA 5CV6A 2Z6BA 3M7NA 2MFIA 1QVFA 4H44C 1QWYA 3CCLA 1EY6A 1Q81C 4HIMA 3PUXA 1PTOD 1EIFA 1EQVA 4HSVA 4X3SA 1Y1WH 4R4QA 1SYEA 5JVH3 2RDGA 1XPOA 3CPFA 3KBGA 3KF6B 3K7AH 1O80A 1Z7TA 3K6OA 5FJ8H 1CQFA 2ATWA 3H09A 1UEBA 4JBKA 3H3VC 1O7LA 4O2DA 1X55A 1QJOA 2E75C 2F0IA 5C5LA 2A69D 3FP9A 4LFBQ 2B2WA 4UP7A 3UE0A 1KDAA 4C1NI 2UUAQ 3C46A 1EQRA 2MGSA 1HTPA 4DAMA 3HP3A 1PYWD 1VQ6A 5IODA 3RN5A 4LF6L 1FJGL 4GKKQ 5EKIA 4X3UA 4LNQA 1XTDA 3F1ZA 4G57A 4DPGA 3MXNA 4IPCA 2D5DA 2QGQA 1PZID 1VQ5A 1M8AA 2PYKA 2N88A 5C5MA 2JA6H 2A1AA 3WWVA 1F9SA 5E4XA 5JPNC 1SDFA 1YBYA 4A3MH 3S14B 3CMEA 5M5YH 1KAAA 2MUYA 1KABA 1B1ZA 4FYDA 1E1TA 2K5QA 1O7IA 1X54A 1IBLL 3KF8B 4A3BB 3T4AC 4RKLA 4R8NA 4B9XA 2D0OA 2IX0A 1K0RA 4QL5A 4JV5L 2AQ2B 4HJ9A 1GKHA 1SNDA 2X6LA 5D3DA 1I6HB 1ENAA 1K83B 4A3JG 2DJFC 3GTLH 3FKIH 1IYJB 5JOBA 3NHHA 2V1CC 2PO4A 3H91A 4C56C 1AE2A 4XTCS 4HIDA 3I2ZA 5M9OA 1JOKA 3BYTB 4DV7L 4XIGS 1SLJA 1JB3A 4L6TB 3T53B 4ZAIA 5LL6X 5BR8L 1LTAD 1Q12A 1QB5D 1NAPA 4LFCL 1PTOB 3LX0A 1MJCA 1X3PA 3JC66 1X3GA 1W2BA 5IGBA 2K1BA 5KNCA 1ZXTA 1FNUA 2XN9C 1VMPA 2IX3A 1HHVA 1DOKA 1O7ZA 2K5DA 3DM3A 3Q22A 3PQIA 1WTRA 1LTRD 1I4GA 3X3MA 4A3DB 1H9SA 2NN6I 2A8VA 3PUYA 2AQ3B 1EYAA 1QUQB 2H4OA 3NTHA 4RHRA 1BBUA 1QOHA 2K5WA 3I4MG 4YCWA 3EN2A 1BOSA 3S1MH 3PCOB 1AZPA 2ZTEA 1TS5A 3RMHA 1GD7A 4IUVA 1VQJA 1VQHA 2ZXOA 4FF4A 1F2LA 5EGTA 1I3QH 1PVOA 4DR6Q 3R3OA 3DUZA 2PW7A 5M3FH 3U9OA 3TQYA 1HZBA 4R9WA 4CDEC 1D8LA 2BA0A 4EQOA 1SYDA 2EVBA 3KK7A 5JJKA 3F2DA 1ICWA 3VYRA 1TWCH 2E5LL 3VYUA 4JI1Q 1WFQA 3H0GG 4P75A 3CCRA 1XJVA 5LMUQ 2FFKB 2RSNA 4H13C 1NSNS 2AUKA 3PUWA 2B2YC 3N6RA 2F03A 1JOOA 2RCFA 1CA5A 4DK1A 2F0PA 4GNXC 4ZKCB 4C3JH 1K8GA 4KHPL 3M7GA 1V1OA 2WP8J 5IOCA 4A3JH 2JN4A 3BG3A 3CC2A 1TS2A 4JI7Q 1PRTF 4APVA 1BDOA 3KUPA 1A3UA 3KJPA 2HIXA 2ZXRA 4N9TA 4B3ML 3KF6A 4PG3A 2MNAA 4DV2Q 1A2UA 3CCEA 2B29A 2MQHA 3Q24A 2EQSA 4WFN3 1EWIA 3PF4A 3EVQA 5I4DA 4WJ3M 2B3GA 2B8GA 2EZVA 1JE4A 3IRBA 2F0MA 1JT8A 4F8MA 3HOUG 3OWFA 5GAHC 2WAQB 1XNRQ 4UY8C 3A74A 5BN5A 4JYAQ 1R9TB 2K28A 3NELA 3QG1A 1ESRA 3A56A 3U9SA 1DOMA 4BBSH 4LF5Q 2JA6B 4KD4A 5CV5A 4DV1Q 4IN3A 4ZYSA 4LF7Q 1XX8A 4M8AA 4AQYQ 5GQOA 4A3MB 5M5YB 3RLNA 1HZAA 5M3MG 3BVMA 3P1HA 3BS1A 5IYBG 2JXMB 5LHY1 3UDFA 2OCEA 5D3IB 4X65L 4R8IA 4KHVA 1E2WA 2F4VL 2PZWA 2HHHL 1TS4A 1VQIA 2A6HD 4N9PA 5I6YA 1STHA 4JI3Q 2K33A 5IGFA 2A6ED 4FNFA 3Q0AA 3W5OA 3A7AB 4OONA 3S1RH 4IOCA 3KF8A 2BE5C 3NTIA 2XVSA 2I5LX 3GTLB 4NXNL 3GTJH 4RCOA 2FMMA 1VQKA 1X32A 3D0FA 4LK1C 1W3SA 1B3AA 1IBMQ 2LFNA 4XYQA 1AW7A 3SVMA 1G91A 1V1QA 1N33L 5FLMG 5E1FA 1KQSA 2MP1A 4LUZA 1SYGA 2CW0D 5FO8B 5I6WA 1RIPA 4X3KA 3S1QH 1F9RA 4FXKC 4C3HG 1YNJD 1DONA 2C5CA 4PV1C 2KBNA 1DXMA 4P73A 4XT3B 1D5XC 3AMUA 2VQFL 1TWGB 3K81C 5JPMC 1VQLA 4LF4Q 2QW7A 3AEVA 4HIOA 3HOZG 4JI6L 3TN2A 3F2UA 1VDZA 4TKOB 1QILA 4O1NA 2QKIC 4C2MB 4F7XA 2R7ZB 2OQKA 2OXPA 3ND9A 1HCZA 1EQTA 1F77A 3B6YA 5EKLA 4FF3A 1A6XA 1QUQA 2L11A 1FNVA 1VMCA 1S5BD 1I3QB 3S17B 3K8AA 1XNQL 1CSQA 3TSSA 3CRLC 2I5HA 3ITPA 1PH1A 1DYQA 4HMJA 4IUNA 5M3FB 1EQQA 4JBWA 1UE5A 3BU2A 2VL6A 1P8LA 1LM0A 2R7FA 1BVSA 5D14A 2WB1G 2EE1A 1E2ZA 3GDEA 4JOIA 4HCSA 1RJTA 2BDOA 5M3MH 1OTCA 1TWCB 2EY1A 2SNSA 3EFXD 5IYBH 4P72A 4H02A 1TU2B 1E7ZA 4J15A 2BH2A 3GTQH 1D7QA 1WTWA 1XXGA 2B2WC 1X3FA 3PIO3 2OF1A 4NKLA 4DR1L 3MZ5A 1GVPA 3NE5B 3T1YQ 2E2HB 2CH4A 3FEWX 4C3JB 2A73B 1ML0D 3HFZB 4YY3L 1WJJA 4JK1C 2JEBI 2HIVA 4IFDI 2VB2X 3IFDA 4RGTA 4YWMA 4IURA 4CDDC 4QQBX 1PHJA 1CZGA 1N32L 3L0OA 5EBCA 5FLMH 3RZDH 1VQEA 2FJ2A 1IBLQ 4QUCA 4NW2A 2PNHA 2A5HA 2HDLA 3S2DB 2J4XA 3K0YA 1JB7A 1ENFA 3GTPB 4JI8L 4C3HH 2A68D 3LGJA 1CUKA 4JV5Q 1GJXA 1PZJD 3I4NH 2IW3A 4JBJA 5HURA 1YHQA 1BCPC 4JI5L 2F0EA 3E9HA 3DXJC 4DV5L 3WOFA 3N52A 3SK4A 2WB1E 4EQNA 1Q82C 3HOZH 4BBSB 2LS01 4I7AA 2B39A 4DV7Q 4DUYL 4K8IA 5BR8Q 4ID6A 4XQJA 4IUPA 2F3VA 1R4PB 3L7ZC 2UUCQ 1XMQL 2N8NA 3J81j 2EYMA 3OMGA 2KCCA 4DV4L 4X62L 4UP8A 1PZKD 4CHTB 2KHSA 5J3BA 2F52A 1W6KA 2VW9A 2R92H 2I46A 1KRSA 5F2DA 3H6MA 3S1RB 4BXXG 1TWAH 3FVQA 2AWOA 1A15A 1UE1A 5C0XH 1ZEQX 2K7VA 2XIWA 3GTJB 3CHBD 2R6GA 1MI2A 1CM9A 1PH3A 2Q2TA 3K59A 2F0TA 4YWLA 1UWVA 1S5FD 3FRPB 3EJIA 2MHVA 3HOVH 1HJPA 2HDMA 4C3IB 3AYHB 4RAUC 2JA7B 4B3RL 2B2VC 4BY7G 4HN7A 3X3NA 4DAYB 5IGDA 1SE8A 1I4RA 3TS0A 3AB9A 2PMZB 4Q5VA 1RCVD 3CQZH 4DV3L 1O7YA 4ABNA 2HUGA 2E5LQ 3S16H 5CV9A 3PUZA 4QF4A 3M4YA 3H3VH 1Y14B 4DA2A 1JWSD 3SHLA 4DGZA 3O13A 3HKZE 1SSOA 2NVYH 5IP7G 1I50B 1DM0B 4PZ7A 1PA6A 1CT1D 4A75A 2AKWB 3BDLA 3W2DA 2QA4A 4R1JA 3V05A 4CGYB 1G8ZD 3TP5A 4F87A 5KNBA 1NJIC 1BNZA 1WTPA 3ERQA 4JI2L 4Y7NB 4FVMA 2NZOA 1N36L 4FDBA 4K2KA 4B3MQ 3TEHB 5A2QL 2ALYB 4JCVE 1TVXA 1WTHA 2YYZA 1CTMA 1VF5C 1VF7A 2EY6A 3JAME 5JAVA 1H9RA 1CI3M 4CJ0B 4ULLA 5C6AA 1S5DD 4K5WA 5I9PA 5C3EH 5C44G 5KNDA 2HQLA 5M5WH 2LXKA 5C4JH 2CH4W 4ODGA 3NXWA 5EPJA 2K32A 2C9OA 2B2TC 3S1NH 1ILPA 5IWAL 4A3FG 1QVGA 1PMRA 4BXXH 3DMUA 1KRTA 3CCQA 1IZ6A 2F0JA 5CR3A 4IFDG 4FF1A 3PO3H 5FLXc 3NTKA 3M3YH 1SMXA 1VQDA 3MTSA 1B7YB 4MN3A 3LWEA 2EYPA 2V4DA 1MD2D 1LABA 1Q8IA 3KLWA 3J7YW 5ELNA 1GOZA 4CJ2C 1AP0A 4ALPA 3RZDB 3TS2A 3C1FA 3ER0A 1WTVA 3OW7A 2WKDA 2Z1CA 4X65Q 3D6WA 3J80E 4LF8L 2KECA 1HNWL 1IBKQ 4BY1G 2HHHQ 2F3WA 3M4QA 3PV0A 4C3HB 3D8GA 4BY7H 3J80c 4KN4C 3I4NB 1XWEA 1YNNC 2ZTCA 5LL6S 1TIID 4DR7L 4CKBA 4IFDJ 1BUVT 1PFSA 1CA6A 3CAMA 2B2UC 1KAWA 2E2JB 4J6HA 4GN3B 3HOZB 1YJNA 4QIWB 1T5XD 1AN8A 1EY7A 2G9HD 4UHVA 4PMWA 5IGCA 1N33Q 3ICEA 1AFPA 4BA2I 4WJ4A 1B8AA 4L8JA 5ELBA 4DR2L 2J0TD 3KLRA 2Q8IB 3TZDA 4AYBB 5IP7H 2VUMG 1YVCA 3RLFA 4A3KG 1WCMH 3EIVA 4G7ZC 3S15H 4FXDA 5IIFA 3BZCA 3NK9A 1K3RA 1KLGD 4KI0A 4DXGA 4PQXA 4ZUIA 2Q8TA 4HJAA 1XPRA 2F3IA 4HMIA 2R92B 5JVG3 4JI6Q 1WTOA 3CXCA 4IUTA 1TWAB 4LJZC 4P2CB 2WB1B 1RL2A 1TT2A 3LNNA 4OIKA 3LWUA 5EQ0A 2B63H 4NPSA 1EL0A 2KUMA 4QUFA 4BBRH 4AIMA 4DK3C 4EQPA 5IP9G 1PTOC 4RGNA 4RFBA 3VDYA 3KLSA 3ULJA 1W6JA 5IT9L 1M4VA 2N3SA 2F1MA 5I2XA 2KEDA 3PIOA 3T1HQ 3C2PA 2ZM6L 3S2HH 3L2PA 2QCPX 2ES2A 3TP8A 1HQRD 4A3FH 3FDTA 3K5MA 3HOVB 4IPDA 1SE2A 1JE5A 3WOEA 2FMCA 5T1IA 1FGUA 4H7BA 2DUDA 2QDLA 3D3RA 1K8OA 1FVIA 4ZQ3A 3UE1A 5GADC 1A2TA 1CKNB 4K5XA 2A69C 3W3AA 2KCNA 1KD1C 3V96A 4MZ9A 3SK5A 1PH4A 1B2TA 3P20A 1LT3D 1EOTA 4DAYA 1Y8OB 4MTNA 5DAUA 1D2BA 3GTOH 1D1IA 4JG2A 2NZHA 3M4PA 1RKNA 2JJQA 2NVYB 2F0GA 4IOAA 2FINB 1STYA 4YY3Q 3NEMA 2M9VA 2NVQH 1LYLA 3OTOQ 3CCVA 4QGUA 3VA7A 2NZ1D 3J7A5 1HR0Q 1C0AA 3VR4A 2WIIB 4JC0A 5COYA 4LWCA 4DNRB 1SJHD 1EWHA 1F9QA 1ET9A 5KGUA 2R93B 4MTKA 2K03A 3M9BA 1Y8NB 3QB3A 1HNZL 3E0JA 1D5ZC 1QZHA 4I65A 4Q0FA 2NTTA 1KNAA 2E8GA 2Q8RE 1FD7D 4JI8Q 3HGBA 2JA9A 4OELB 5C3EB 3J7ZC 4OHJA 4ZRZA 5M5WB 2YTVA 5C4JB 1Y8PB 3HKZB 1I4XA 1HQMC 3T16A 1I94L 2OTLA 3J7AV 3W1GA 4DV5Q 2RF4A 4DR3Q 1STBA 3AFQA 1BF4A 1IW7C 4A3GG 1MSGA 1U4LA 1BCPF 2H1EA 2RA4A 2EYFA 3CCSA 4DUYQ 1VQ8A 3PO3B 3RZOB 3E5SA 5FLXL 1V9PA 1LTBD 3I70A 5FO7B 1JR0D 3G4SA 1XMQQ 2KCMA 2OT2A 5G3LF 4PMBA 2Y0SG 4ZLTF 5HGTA 2ZT9C 2CQOA 1EFWA 1JICA 3HOWG 1ZYRD 4X62Q 3PMFA 1HTLD 1HUMA 1UAPA 2K5NA 1B3QA 3I73A 2Q2HA 4KJOA 2Q2UA 4R4TA 1TXYA 4PZ6A 1Y1WB 5C4XG 3K0XA 1LV9A 4K5VA 2E2DC 3K7AB 3TRZA 3R2TA 2VQEL 3NQTA 3S24A 1PLFA 4HJ5A 4DR5L 4OO1I 2C35B 3GQBA 4N8FA 1IKMA 3I4OA 4DFAA 1II3A 2DNEA 2GVAA 1AH9A 1EY4A 4QMGA 3ULPA 2E74C 1VQBA 3ZJYC 4B3RQ 1WCMB 4WRDA 3S15B 3DHQA 4FP5D 2UXCL 3H94A 2F0KA 2F0HA 1Y1VG 3F8TA 3R2IA 1SNCA 4DV3Q 1NR4A 3I8ZA 5D65A 3KBXA 2L12A 2WV6D 3U4ZA 2G5DA 3OYYA 1H9MA 5CMDA 1SROA 2Y0SE 1N8RC 3MXPA 2B63B 1VQCA 2DGYA 5DM73 2VY3A 3I4MH 4BBRB 1VQ9A 2BOSA 2D2CC 3NENA 3ERSX 3D6CA 4B3SQ 2JA8G 3S2HB 2KENA 1GUOA 2RHQB 4NDXA 4L5SA 2VXWA 2NYZD 3OWEB 4K6DA 4A3FB 1C4QA 2B8FA 1GUGA 2K01A 4FXGC 3KDFB 1QE6A 4JI2Q 1KXLA 1CKMA 1FR3A 1G291 3HZXA 1UE7A 4GS3A 4LW1A 1PH6A 1KC8C 4A93G 2EYOA 2QILA 2L4NA 1JWUD 4UDUC 4POFA 1SFOH 4NXMQ 2RKSA 3EBEA 2Z6KA 4XXEA 2IT1A 3I72A 3VA5A 1N34L 2O2LD 2ZXPA 3FKIB 4N8X1 4X3TA 4H0LC 3HG9A 1BBWA 1MJEA 2IY5B 5IYCG 3BZKA 1X9NA 1E2VA 3HOWH 1Q1EA 4EVOA 4K8JA 3H0GH 1XMOQ 4GKJL 1CKNA 2A74C 4UAIA 1R4QB 1P16A 2IX1A 4A3IG 2PNRC 4J1MA 2CCZA 1PH2A 5EKKA 2UXBQ 4NMZA 2NVQB 4RCNA 5C4XH 1RODA 1EYDA 2XNAC 4QY7A 4KJNA 3HS0C 2MO0A 4JBMA 3PUVA 3WDNA 1STNA 3J81E 2F0UA 1B9NA 1CKOA 2RSOA 3URYA 2CWPA 3QOLA 1SMYD 4LF8Q 2NN6G 3SE0A 4LFBL 5JJIA 1HNXL 3CCMA 2UUAL 3QWNA 3J81c 2N49A 2OQ0A 1LT6D 4DR7Q 1EEID 4QJFA 1AE3A 3K5OA 1TR5A 4L5QA 3S1MB 4B08A 1PV4A 5GAEC 2A6EC 3MWYW 2HT1A 3HOUH 4GKKL 2UXDL 5FKAC 5DLQE 1RF2D 4P71A 3RR5A 5J39A 1QNUA 4LF9L 4DR2Q 1K28A 2XSCA 4LMQD 2K75A 4K2LA 5CV7A 1BO0A 1BBXC 1TY0A 2CW0C 4DV0L 1LTID 1OXSC 2SNMA 3AFPA 1LO5D 3QR8A 4LF6Q 3RUZA 2KVMA 4YWKA 2K5HA 3MVVA 4RHSA 3IFTA 1FJGQ 5A2QE 4ZK9B 4G4KA 1Q86C 1MSHA 1B9MA 2CVRA 5C4HA 4YHHL 2DY8A 4A3EG 1VS0A 1PYSB 4DNTB 4A93H 3FPPA 5C3XA 1K8MA 2D62A 1HA6A 4EQ5A 1JORA 4RGMA 4RH6A 4MHEA 4A3JB 4CKEA 4A76A 3G6JB 1EU4A 2ASBA 1QG7A 3GTKH 3H15A 2PZUA 4JI4L 1D1KA 1SYCA 4A3IH 3SK6A 4L63B 1PH8A 1N9WA 1QNKA 2HD3A 1PTOF 1EY5A 3V2TA 5CORA 5BN4A 4ZUJA 3HOXG 4O42A 3ZYYX 1VQNA 4NB3A 2EXZA 3OIPA 1SRUA 4YIJA 5JEAG 2EYHA
chains in the Genus database with same CATH topology
1PRTD 3GV6A 4KHZA 2NN6H 1B53A 2LKVA 3FMCA 3I4MB 1Q1BA 2EJMA 1IYUA 4F88A 2F0LA 5E3FA 3TBIB 1S5ED 3TMEA 5ELFA 2QF7A 3C1EA 1SYFA 1SNPA 2IJ0A 2X6GA 5JEAJ 3UI2A 3A8IE 2KOLA 1PXUA 1V1PB 1HXYD 1OXTA 3CKIB 1SFOB 4HAEA 4S3SA 3EA6A 2JEAI 1G2TA 4IUUA 3HOWB 3H0GB 3K5LA 5JJZA 1EIHA 3D31A 3MHBA 2Z8LA 5J22A 4XQNA 3S1QB 4KTAA 3OSOA 3R8BA 1OO9B 1LTSD 3RD4A 4CKCA 3T51B 2EYJA 4TRDA 3P75A 2F0FA 2O5IC 1TKWB 1O78A 1S4ZA 1U9RA 5CBAE 1NUCA 3MFGA 4I7ZC 3HOUB 2K05A 1I4HA 3R93A 1FNWA 3J7AF 2NB0A 3DWPA 2WKCA 1PRTB 3ND8A 4G7OC 1RD9D 5M3MB 5ELEA 1G6ZA 3VR3A 1L0XB 2KA7A 1PTOH 1SNMA 4IQZA 3GTQB 2KJXA 2X69A 4RGOS 5IGGA 2SEBD 3SK8A 3DEOA 1Y69U 1YNND 1BQQT 2F0NA 3I3CA 4WJWA 2DY7A 2NBFA 1EU3A 1AZQA 4KN7C 1GUSA 3CRKC 4PNYA 1ENCA 5IGEA 3DWAA 3GTKB 5T1GA 3BDCA 4KKSA 3D4DA 1Q3LA 1EWCA 3NSWA 4FF2A 5K36G 5FO9B 2IL8A 1MGSA 3HEJA 1STEA 1F9PA 1UUPA 1I4QA 3A7LA 2FHTA 3OPOA 1LTTD 5M5XB 3MXGA 4BWGB 1J9OA 4IUQA 3IL8A 5CV8A 3SXHA 4J8QA 3T56B 3NQIA 2CQAA 5CYUA 4KMUC 3ONAB 2F0WA 2SOBA 1A3VA 3MEHA 1ONLA 1STAA 3DEPA 1EYCA 2TSSA 4BA1I 3EQLC 3I91A 3VYSA 4KKUA 3MC0B 1PFNA 1LTGD 1LLRD 2CHBD 4E6IA 1EZ6A 3QJYA 1HPCA 2D9UA 1F2YA 1JCKB 1V1PA 2EJGC 1SE3A 2BDNA 3Q6SA 5FK9C 4RA8A 1L0YB 2LMCB 4A3EB 4V0BA 1SXTA 3OHXC 4DXFA 3E6ZX 3GTMB 4IFDH 5DNFA 3IKJA 3I4LA 3CQZB 2NWGA 3GD7A 1HFGA 3S16B 1XYIA 5K36H 1GUWA 2AQ1B 2ICIA 4V190 4KKTA 2TMPA 3VR6A 3HOXB 1ILQA 1SE4A 3D4RA 1RDPD 2ENBA 4C3JG 3A55A 1B4OA 4DN4M 1IW7D 3BZDB 1TY2A 1OXVA 3BVGA 2QDBA 3HRZC 1DCZA 1EZ8A 2EDGA 5E4WC 1GHKA 3NPPA 2SDFA 2XRSD 1RTNA 2E76C 4ME5A 4CJ1B 4TSSA 3JAML 1C8CA 3S1NB 5EJWA 2XRQD 2HCCA 1C48A 1HUNA 3TDQA 3M3YB 1IYVA 1HRJA 2B2VA 1H9KA 1WD1A 2RBMA 3S9WA 2AUJD 3CU7A 3G7LA 4IZ8A 1STGA 2Z4IA 1DJRD 4BY7B 3TP7A 2JP1A 1ESFA 3J80L 4TQUS 3A8JE 4BS9A 4K14A 3BYYB 4XDXA 3GO5A 5C0XI 1V43A 3NWTA 4OGQC 2WINB 3DWQA 3NBIA 2BA1A 5C4ZA 4G7HC 2MJ8A 2XWJB 2KQ3A 1JOQA 3Q23A 1CZWA 4C3IG 2RQXA 1SNOA 2OEOA 2LY7A 1GUNA 1B44D 2G9DA 2ICEC 1CFMA 5C3WA 1SYBA 3PIP3 1U4PA 1EY9A 1U4MA 5CV4A 1QCBD 4XYOA 2BE5D 3VR5A 1J8IA 1ZYRC 2B2TA 3SDZA 2PZTA 1VCIA 5C44B 2JE6I 5J1ZA 5CC4A 4KD3A 1S5CD 2L1BA 1LT5D 2IPKD 3PO2B 4U68A 3K5NA 2HCIA 3NWSA 1BXTA 2L5TA 2F0SA 2EPBA 1SBBB 4ILWA 2JA5B 1SNQA 1FGBD 4QB4A 1TQOA 2B2UA 5I2YA 3GTOB 4BY1B 1NCVA 3QIAA 1PFBA 4RKBA 4XT1B 2IWHA 3BVZA 4HCEA 4Z9CB 1JQYD 4U673 3P7JA 2PPBC 1PFMA 5FOBB 3TP6A 2GA4B 1DOLA 3I90A 3OIQA 2F0DA 4B9WA 2EJFC 4HEDA 3MAQA 5DM63 1UEAB 4QCLA 5NUCA 2I07B 5BN3A 2VUMB 1IKLA 4A3KB 1SJED 1E0BA 2A6HC 1V8QA 4DAPA 2R3ZA 1LACA 4FO2A 3HOYB 2N55A 1IL8A 1TWHB 2NTSA 5K5PA 1G2SA 2ID0A 4NP5A 5ELDA 4HTHA 3OOCA 1EFID 5KYLA 1CHPD 2F0VA 1YNJC 2YU9B 1HFNA 4C1NK 2Z4HA 1U4RA 5ISRA 3MXUA 1Z47A 1BCPD 5CBEE 3DM1A 1MBYA 3A8KE 1SMYC 2RDFA 5C0XG 3EROA 2EY5A 2F0OA 3D4WA 1BR9A 5G3LD 4OO1G 2K6AA 2XWBB 4ZKBB 4KY5A 1D5MC 1KDBA 1WVLA 1H9JA 1XTCD 5KRUA 1ZKOA 1A3TA 2VNUD 5KYIA 1T5EA 2L0CA 5C0XJ 2RVLA 2WACA 3QO2A 1ET6A 5CGKA 2NVXB 2J7ZA 3K57A 4CBVA 4XQQA 4OL7A 1OXXK 4PMCA 2M2LA 5ELCA 1RTOA 2DNCA 3AU7A 1SEBD 5A35A 3K58A 5EPKA 4A3GB 3KLSX 4K6LA 2QEJC 2PQEA 1KTKA 3NUCA 1WTQA 1HA5A 3L9AX 4KV6A 3MA2B 2NUCA 5I9OA 3SEBA 1WTXA 3MFYA 2B2YA 1CK1A 2Y0SB 4OIJA 4IALA 1OXUA 2EY2A 1JWMD 2A68C 3QOJA 3NP8A 2VB3X 3C3LA 1EY0A 1PDQA 2RDHA 2JYOA 5DEHA 5C4XB 4LAAA 3A54A 1PRTC 4GZYC 1D6EC 5IT9E 1TS3A 1LT4D 3TZUA 1BCPB 1KNEA 3GTGB 1I4PA 2BCOA 4OO1H 4KY6A 4DF7A 4DAVA 2L9HA 1KLUD 2F4IA 4KK7A 2L55A 2MPMA 2JSOA 1KDCA 1EIGA 5KIXA 3J81L 1DD2A 3SR1A 1Y1VB 1IHZA 5TSSA 1JC7A 5AFWA 5EPLA 4DK0A 2R61A 5JEAH 1WD0A 2DN8A 3VR2A 2KEEA 1UNSA 2PCFB 4RWSC 1AEXA 2PW5A 3GV3A 2JA8B 4KY7A 1H9SB 1Q90A 5KEEA 1Z6HA 2EOTA 1X3QA 4A93B 4HSPA 1GHJA 1TWFB 3M85A 1F2ZA 1RHPA 2E2IB 4MIUA 4WORA 1NR2A 3FPUB 2M00A 3T13A 2NVTB 4HR7B 3M4OB 3NBHA 2O5JC 4A3IB 3GP7A 2EYLA 1CHQD 5FLXE 4EGVA 3BDOA 1I6VC 1CQVA 1DZ1A 1EY8A 1FYCA 1F2MA 3OMCA 1GXDC 3VYTA 5EBDA 2AWNA 2O4XA 2F0QA 3L3OC 3IAYA 1SAPA 2K04A 2HQEA 4DU9A 4M1UB 1B50A 1EEFD 1GUTA 5CV6A 3M7NA 4H44C 1QWYA 1EY6A 3PUXA 1PTOD 1EQVA 4HSVA 4X3SA 1SYEA 5JVH3 2RDGA 3KBGA 1O80A 1Z7TA 3K6OA 1CQFA 3H09A 3H3VC 1O7LA 1QJOA 2E75C 2F0IA 5C5LA 2A69D 2B2WA 1KDAA 4C1NI 3C46A 2MGSA 1HTPA 3HP3A 1PYWD 5IODA 5EKIA 4X3UA 4G57A 3MXNA 2D5DA 1PZID 1M8AA 2PYKA 2N88A 5C5MA 1F9SA 5E4XA 5JPNC 1SDFA 3S14B 1KAAA 2MUYA 1KABA 1B1ZA 4FYDA 2K5QA 4A3BB 3T4AC 4RKLA 4R8NA 4B9XA 2IX0A 2AQ2B 1SNDA 2X6LA 5D3DA 1I6HB 1ENAA 1K83B 5JOBA 3NHHA 2PO4A 3H91A 4C56C 4XTCS 5M9OA 1JOKA 3BYTB 4XIGS 1JB3A 4L6TB 3T53B 4ZAIA 5LL6X 1LTAD 1Q12A 1QB5D 1NAPA 1PTOB 3LX0A 1X3PA 5IGBA 2K1BA 5KNCA 1ZXTA 1FNUA 2XN9C 1VMPA 2IX3A 1HHVA 1DOKA 1O7ZA 2K5DA 3Q22A 1WTRA 1LTRD 1I4GA 3X3MA 4A3DB 1H9SA 2NN6I 3PUYA 2AQ3B 1EYAA 2H4OA 3NTHA 4RHRA 1QOHA 2K5WA 1BOSA 1AZPA 1TS5A 3RMHA 4IUVA 2ZXOA 4FF4A 1F2LA 5EGTA 3R3OA 3DUZA 2PW7A 3U9OA 4R9WA 2BA0A 4EQOA 1SYDA 2EVBA 3KK7A 1ICWA 3VYRA 3VYUA 2FFKB 2RSNA 4H13C 1NSNS 2AUKA 3PUWA 2B2YC 3N6RA 2F03A 1JOOA 1CA5A 4DK1A 2F0PA 4ZKCB 3M7GA 1V1OA 2WP8J 5IOCA 3BG3A 1TS2A 1PRTF 1BDOA 3KUPA 1A3UA 2ZXRA 4N9TA 1A2UA 3Q24A 4WFN3 3EVQA 5I4DA 2B8GA 2EZVA 1JE4A 2F0MA 4F8MA 3OWFA 2WAQB 5BN5A 1R9TB 2K28A 3QG1A 1ESRA 3A56A 3U9SA 1DOMA 2JA6B 4KD4A 5CV5A 4IN3A 4ZYSA 1XX8A 4M8AA 4A3MB 5M5YB 3BVMA 3P1HA 3BS1A 2JXMB 5LHY1 5D3IB 4R8IA 4KHVA 1E2WA 2PZWA 1TS4A 2A6HD 4N9PA 5I6YA 1STHA 2K33A 5IGFA 2A6ED 4FNFA 3Q0AA 3A7AB 3KF8A 2BE5C 3NTIA 2XVSA 3GTLB 4RCOA 2FMMA 1X32A 4LK1C 1B3AA 2LFNA 4XYQA 1AW7A 3SVMA 1G91A 5E1FA 2MP1A 1SYGA 2CW0D 5FO8B 5I6WA 4X3KA 1F9RA 4FXKC 4C3HG 1YNJD 1DONA 2C5CA 4PV1C 1DXMA 4XT3B 1D5XC 3AMUA 1TWGB 5JPMC 3TN2A 3F2UA 1VDZA 4TKOB 1QILA 4O1NA 2QKIC 4C2MB 4F7XA 2R7ZB 2OXPA 3ND9A 1HCZA 1EQTA 1F77A 5EKLA 4FF3A 1A6XA 2L11A 1FNVA 1VMCA 1S5BD 1I3QB 3S17B 3TSSA 3CRLC 3ITPA 1DYQA 4HMJA 4IUNA 5M3FB 4JBWA 5D14A 2EE1A 1E2ZA 4HCSA 1RJTA 2BDOA 1TWCB 2EY1A 2SNSA 3EFXD 1TU2B 1WTWA 1XXGA 2B2WC 3PIO3 2OF1A 4NKLA 3MZ5A 3NE5B 2E2HB 3FEWX 4C3JB 2A73B 1ML0D 4JK1C 2JEBI 4IFDI 2VB2X 3IFDA 4RGTA 4IURA 1CZGA 5EBCA 2FJ2A 4QUCA 4NW2A 2A5HA 2HDLA 3S2DB 2J4XA 3K0YA 1ENFA 3GTPB 2A68D 1GJXA 1PZJD 2IW3A 5HURA 1BCPC 2F0EA 3DXJC 3WOFA 3N52A 3SK4A 4EQNA 4BBSB 2LS01 2B39A 4K8IA 4ID6A 4XQJA 4IUPA 2F3VA 1R4PB 3L7ZC 2EYMA 3OMGA 2KCCA 4CHTB 1PZKD 2KHSA 1W6KA 2I46A 5F2DA 3H6MA 3S1RB 3FVQA 2AWOA 1A15A 5C0XH 1ZEQX 2K7VA 2XIWA 3GTJB 3CHBD 2R6GA 1MI2A 1CM9A 3K59A 2F0TA 1S5FD 3FRPB 3EJIA 2MHVA 2HDMA 4C3IB 4RAUC 2JA7B 2B2VC 4HN7A 3X3NA 5IGDA 1I4RA 3AB9A 2PMZB 4Q5VA 1RCVD 1O7YA 4ABNA 2HUGA 5CV9A 3PUZA 4QF4A 3M4YA 4DA2A 1JWSD 3SHLA 4DGZA 3O13A 1SSOA 1I50B 1DM0B 1CT1D 3BDLA 3W2DA 3V05A 4CGYB 1G8ZD 3TP5A 4F87A 5KNBA 1BNZA 1WTPA 3ERQA 4Y7NB 4FVMA 4K2KA 5A2QL 1TVXA 2YYZA 1CTMA 1VF5C 1VF7A 2EY6A 3JAME 5JAVA 1H9RA 1CI3M 4CJ0B 4ULLA 5C6AA 1S5DD 4K5WA 5I9PA 5KNDA 4ODGA 3NXWA 5EPJA 2K32A 2C9OA 2B2TC 1ILPA 1PMRA 3DMUA 2F0JA 5CR3A 4IFDG 4FF1A 3NTKA 3MTSA 4MN3A 3LWEA 2EYPA 2V4DA 1MD2D 1LABA 1Q8IA 3J7YW 4CJ2C 1GOZA 1AP0A 3RZDB 3C1FA 1WTVA 3OW7A 2WKDA 2Z1CA 3D6WA 3J80E 2KECA 2F3WA 3PV0A 4C3HB 3D8GA 4KN4C 3I4NB 1XWEA 1YNNC 5LL6S 1TIID 4CKBA 4IFDJ 1BUVT 1CA6A 2B2UC 2E2JB 4J6HA 3HOZB 4QIWB 1T5XD 1AN8A 1EY7A 2G9HD 4PMWA 5IGCA 1AFPA 4BA2I 4L8JA 5ELBA 2J0TD 3KLRA 2Q8IB 3TZDA 4AYBB 3RLFA 4G7ZC 4FXDA 5IIFA 3NK9A 1KLGD 4KI0A 4DXGA 4PQXA 4ZUIA 2Q8TA 4HMIA 2R92B 5JVG3 1WTOA 4IUTA 1TWAB 4LJZC 4P2CB 2WB1B 1TT2A 3LNNA 4OIKA 3LWUA 5EQ0A 1EL0A 2KUMA 4QUFA 4EQPA 1PTOC 4RGNA 4RFBA 3KLSA 5IT9L 1W6JA 1M4VA 2F1MA 5I2XA 2KEDA 3C2PA 2QCPX 3TP8A 1HQRD 3FDTA 3K5MA 3HOVB 1SE2A 3WOEA 2FMCA 5T1IA 4H7BA 3D3RA 1K8OA 4ZQ3A 1A2TA 4K5XA 2A69C 3W3AA 2KCNA 3V96A 1B2TA 3SK5A 3P20A 1LT3D 1EOTA 4DAYA 1Y8OB 5DAUA 1D2BA 1D1IA 1RKNA 2NVYB 2F0GA 2FINB 1STYA 2M9VA 3VA7A 2NZ1D 3VR4A 2WIIB 5COYA 4DNRB 1SJHD 1EWHA 1F9QA 1ET9A 5KGUA 2R93B 2K03A 3QB3A 1Y8NB 3E0JA 1D5ZC 4I65A 4Q0FA 2NTTA 1KNAA 2Q8RE 1FD7D 3HGBA 5C3EB 4OHJA 4ZRZA 5M5WB 5C4JB 3T16A 1Y8PB 1I4XA 1HQMC 3HKZB 3J7AV 1STBA 1BF4A 1IW7C 1MSGA 1U4LA 1BCPF 2H1EA 2RA4A 2EYFA 3PO3B 3RZOB 3E5SA 5FLXL 1LTBD 3I70A 5FO7B 1JR0D 2OT2A 5G3LF 4PMBA 4ZLTF 5HGTA 2ZT9C 1JICA 1ZYRD 3PMFA 1HTLD 1HUMA 1UAPA 3I73A 4KJOA 1Y1WB 1LV9A 4K5VA 2E2DC 3K7AB 3R2TA 3NQTA 1PLFA 4OO1I 3GQBA 1IKMA 4DFAA 1II3A 2DNEA 1EY4A 4QMGA 2E74C 1WCMB 4WRDA 3S15B 3DHQA 4FP5D 3H94A 2F0KA 2F0HA 3R2IA 1SNCA 1NR4A 3I8ZA 5D65A 2L12A 2WV6D 3KBXA 1H9MA 5CMDA 3MXPA 2B63B 5DM73 4BBRB 2BOSA 2D2CC 3D6CA 3S2HB 1GUOA 4NDXA 2VXWA 2NYZD 3OWEB 4K6DA 4A3FB 1C4QA 2B8FA 1GUGA 2K01A 4FXGC 1QE6A 1FR3A 1G291 3HZXA 2EYOA 2QILA 2L4NA 1JWUD 4UDUC 2RKSA 4XXEA 2IT1A 3I72A 3VA5A 2O2LD 2ZXPA 3FKIB 4X3TA 4H0LC 3HG9A 1E2VA 1Q1EA 4EVOA 4K8JA 2A74C 4UAIA 1R4QB 2IX1A 2PNRC 4J1MA 5EKKA 4NMZA 2NVQB 4RCNA 1RODA 1EYDA 2XNAC 4KJNA 3HS0C 3PUVA 3WDNA 1STNA 3J81E 2F0UA 1B9NA 2RSOA 3URYA 3QOLA 1SMYD 2NN6G 3SE0A 3QWNA 1LT6D 1EEID 3K5OA 1TR5A 3S1MB 4B08A 2A6EC 3MWYW 5FKAC 1RF2D 5J39A 1QNUA 2XSCA 4LMQD 4K2LA 5CV7A 1BO0A 1BBXC 1TY0A 2CW0C 1LTID 1OXSC 2SNMA 1LO5D 3RUZA 2KVMA 3MVVA 4RHSA 3IFTA 5A2QE 4ZK9B 4G4KA 1MSHA 1B9MA 2CVRA 5C4HA 2DY8A 4DNTB 3FPPA 5C3XA 1K8MA 2D62A 1HA6A 1JORA 4RGMA 4RH6A 4MHEA 4A3JB 4CKEA 3G6JB 1EU4A 1QG7A 2PZUA 1D1KA 1SYCA 3SK6A 4L63B 1QNKA 1PTOF 1EY5A 3V2TA 5CORA 5BN4A 4ZUJA 4O42A 3ZYYX 2EXZA 3OIPA 4YIJA 5JEAG 2EYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JE4 A;  2L11 A;  1VMC A;  3GV6 A;  1NAP A;  4ZKB B;  1HRJ A;  2D9U A;  1X3P A;  1EIG A;  1B53 A;  2B2V A;  4HSV A;  2B2U A;  4X3S A;  1WVL A;  2K1B A;  2RSO A;  1ZXT A;  1WD1 A;  1PLF A;  2BDN A;  3Q6S A;  3MTS A;  4MN3 A;  1NCV A;  1B2T A;  1PFB A;  1A15 A;  1VMP A;  3LWE A;  4XT1 B;  2K28 A;  3G7L A;  1IKM A;  1G6Z A;  1HHV A;  1ESR A;  2XIW A;  1DOM A;  4RA8 A;  1EOT A;  3P7J A;  1DOK A;  1O7Z A;  4CJ2 C;  1O80 A;  1AP0 A;  5D14 A;  2EE1 A;  1PFM A;  1WTV A;  2X69 A;  1WTR A;  2JP1 A;  4HCS A;  1MI2 A;  1CM9 A;  2RVL A;  5AFW A;  1RJT A;  3D6W A;  3DEO A;  5EPL A;  1XX8 A;  3MWY W;  3QO2 A;  3I3C A;  1DOL A;  2KEC A;  2DY7 A;  3I90 A;  2FIN B;  1WD0 A;  2B2W A;  2X6G A;  4HED A;  4XDX A;  3UI2 A;  2B2W C;  5DNF A;  1WTW A;  2KEE A;  2KOL A;  2MGS A;  1AZQ A;  1NR4 A;  2NZ1 D;  3I8Z A;  2HDM A;  3HP3 A;  2J7Z A;  5D65 A;  1AZP A;  2L12 A;  3KBX A;  4RWS C;  2NWG A;  4RAU C;  5COY A;  3GV3 A;  1HFG A;  2B2V C;  1CA6 A;  4R8I A;  2B2U C;  4IUV A;  4HAE A;  1F9Q A;  1ML0 D;  1XYI A;  2MJ8 A;  5T1G A;  5CMD A;  1GUW A;  2M2L A;  2K03 A;  5EKI A;  1IKL A;  1Q3L A;  1F2L A;  4LMQ D;  4X3U A;  1RTO A;  1G2T A;  4IUU A;  1O7Y A;  1E0B A;  2HUG A;  3IFD A;  2EOT A;  1BO0 A;  1BBX C;  1X3Q A;  4IUR A;  1KNA A;  1ILQ A;  5JJZ A;  1M8A A;  2IL8 A;  2R3Z A;  2N88 A;  2Q8R E;  1EIH A;  2FMM A;  4R9W A;  2N55 A;  2KVM A;  5EPK A;  1MGS A;  1X32 A;  1IL8 A;  3TZD A;  1B3A A;  1F9S A;  2FJ2 A;  2NYZ D;  1B4O A;  1F9P A;  2VXW A;  5E4X A;  1MSH A;  4ZK9 B;  4DN4 M;  4QUC A;  4NW2 A;  2CVR A;  3SVM A;  1G91 A;  1SDF A;  2DY8 A;  1WTQ A;  1ICW A;  1SSO A;  1G2S A;  2HDL A;  2K01 A;  1QE6 A;  1RHP A;  1U4P A;  2FHT A;  1NR2 A;  2MP1 A;  3FPU B;  1HA6 A;  1WTX A;  1BF4 A;  1U4M A;  2FFK B;  2RSN A;  2B2Y A;  4MHE A;  1J8I A;  4OIJ A;  4X3K A;  2B2Y C;  1F9R A;  2B2T A;  2L4N A;  2Q8T A;  1MSG A;  1BNZ A;  5E4W C;  1CA5 A;  1U4L A;  2RA4 A;  2H1E A;  1WTP A;  1WTO A;  1DON A;  1J9O A;  4IUQ A;  1QG7 A;  3IL8 A;  4IUT A;  4ZKC B;  3N52 A;  2SDF A;  4X3T A;  4XT3 B;  1RTN A;  1DZ1 A;  1PDQ A;  4OIK A;  2JYO A;  4CJ1 B;  2L1B A;  2X6L A;  5EQ0 A;  1S4Z A;  1EL0 A;  1TVX A;  2KUM A;  1HFN A;  4ZLT F;  3ONA B;  4U68 A;  4QUF A;  2HCI A;  5CBA E;  1QNK A;  4UAI A;  1JIC A;  3TN2 A;  1U4R A;  3F2U A;  4CJ0 B;  3KUP A;  1SAP A;  2K04 A;  1C8C A;  5EJW A;  2KED A;  5COR A;  4IUP A;  5CBE E;  3DEP A;  2EPB A;  3DM1 A;  1KNE A;  1HUM A;  3H91 A;  2HCC A;  2K05 A;  4O42 A;  1EQT A;  3R93 A;  1B50 A;  1ROD A;  3FDT A;  5EPJ A;  1HUN A;  3I91 A;  2L9H A;  2B2T C;  5T1I A;  1ILP A;  1PFN A;  4ZAI A;  2MPM A;  1LV9 A; 
#chains in the Genus database with same CATH topology
 1PRT D;  3GV6 A;  4KHZ A;  4K0K L;  2NN6 H;  1L1O B;  1B53 A;  5M5X H;  2LKV A;  1K3B C;  2RHS B;  3KFU A;  2RCN A;  3E3X A;  3FMC A;  3I4M B;  1Q1B A;  2EJM A;  1IYU A;  2ZJQ A;  4F88 A;  2F0L A;  5E3F A;  3TBI B;  4UPA A;  3FHW A;  1S5E D;  3TME A;  4LFC Q;  2LSS A;  5ELF A;  2XGT A;  4CDF C;  2QF7 A;  3C1E A;  1SYF A;  1VQA A;  1SNP A;  2IJ0 A;  2X6G A;  5JEA J;  3UI2 A;  3A8I E;  1ASY A;  2KOL A;  1PXU A;  1SR3 A;  1V1P B;  1HXY D;  1OXT A;  3CKI B;  1SFO B;  2UU9 L;  4A3D G;  4HAE A;  4S3S A;  3EA6 A;  3CD6 A;  3KDF A;  2JEA I;  3PSI A;  2ZJR A;  1G2T A;  4IUU A;  4R4C A;  2K50 A;  3HOW B;  1I94 Q;  3H0G B;  3K5L A;  4JI1 L;  1YNX A;  1Z9F A;  5JJZ A;  5LMU L;  1EIH A;  3D31 A;  3MHB A;  2ZTD A;  2Z8L A;  4A3E H;  5J22 A;  4ME3 A;  4IJH A;  4XQN A;  3RLO A;  1L2F A;  3S1Q B;  4KTA A;  2CWA A;  3OSO A;  3R8B A;  1OO9 B;  1LTS D;  3GTM H;  3RD4 A;  4CKC A;  3T51 B;  1VQP A;  2EYJ A;  5LMN W;  4TRD A;  3P75 A;  1A62 A;  3KJO A;  2F0F A;  2O5I C;  3U4V A;  5IE8 A;  1NY4 A;  4R4I A;  1TKW B;  2GVB A;  1O78 A;  1S4Z A;  3CC4 A;  1U9R A;  5CBA E;  3J80 i;  1NUC A;  2XTI A;  3HOX H;  3MFG A;  4I7Z C;  4KHP Q;  3HOU B;  3F2B A;  2K05 A;  1I4H A;  3PIP A;  3R93 A;  1FNW A;  1I6H H;  1K83 H;  2VQE Q;  1XNR L;  3J7A F;  4LFA L;  4JYA L;  4GOP B;  5FJ8 G;  4DR5 Q;  1KIX A;  2NB0 A;  3DWP A;  1KL9 A;  2K4K A;  4HJ8 A;  1H95 A;  1PH9 A;  2WKC A;  1PRT B;  3ND8 A;  4G7O C;  1RD9 D;  1I5F A;  5M3M B;  1B70 B;  5ELE A;  3K7U C;  1G6Z A;  3VR3 A;  1L0X B;  1UE6 A;  2KA7 A;  1PTO H;  1SNM A;  1J6Q A;  2JQO A;  4IQZ A;  3GTQ B;  2KJX A;  2X69 A;  4RGO S;  5IGG A;  3JAM c;  2SEB D;  3SK8 A;  3DEO A;  4TVA B;  1Y69 U;  1YNN D;  1BQQ T;  2F0N A;  3I3C A;  2WAQ G;  4WJW A;  1A8V A;  2DY7 A;  3PO2 G;  4YCV A;  4A3C G;  2NBF A;  1EU3 A;  1AZQ A;  4KN7 C;  1GUS A;  3CRK C;  3U58 A;  4PNY A;  1ENC A;  5IGE A;  3UDI A;  2JA5 G;  3DWA A;  4GN4 B;  3GTK B;  1S3O A;  5T1G A;  3BDC A;  4KKS A;  4A3M G;  1X56 A;  3D4D A;  1Q3L A;  1IBM L;  1EWC A;  3CP0 A;  3NSW A;  2CFM A;  4FF2 A;  5K36 G;  5FO9 B;  1ASZ A;  2IL8 A;  2F4V Q;  1A0I A;  1MGS A;  4X64 L;  3HEJ A;  1STE A;  1QZG A;  1F9P A;  2YTX A;  2OTJ A;  1UUP A;  1VQO A;  1I4Q A;  3A7L A;  1EYG A;  1J5E L;  2FHT A;  1N34 Q;  5E7N A;  4NXN Q;  5L37 A;  3OPO A;  1LTT D;  4GKJ Q;  4RMF A;  5M5X B;  3MXG A;  4BWG B;  1J9O A;  4IUQ A;  3IL8 A;  5CV8 A;  3SXH A;  2Z6K C;  1GM5 A;  4J8Q A;  5AJ3 L;  3T56 B;  3NQI A;  2CQA A;  5CYU A;  4KMU C;  3KYH C;  2WAQ E;  3ONA B;  1NTG A;  1L1O A;  3STB C;  2F0W A;  3U50 C;  2SOB A;  1IXR A;  1A3V A;  3MEH A;  1ONL A;  1STA A;  3DEP A;  1EYC A;  2TSS A;  2VQF Q;  1WYD A;  4BA1 I;  4OX9 L;  3HOY G;  3EQL C;  3I91 A;  2VS1 A;  3VYS A;  4KKU A;  3MC0 B;  1YJ9 A;  1PFN A;  2EIF A;  3Q8D A;  1HNX Q;  1LTG D;  1LLR D;  3W1B A;  2CHB D;  4E6I A;  1EZ6 A;  3PGZ A;  3QJY A;  1HPC A;  2D9U A;  1F2Y A;  1VQM A;  2R7Z G;  1JCK B;  1V1P A;  2EJG C;  2I5M X;  5C44 H;  1SE3 A;  2BDN A;  3Q6S A;  5FK9 C;  4R4O A;  4RA8 A;  2UXD Q;  1L0Y B;  2LMC B;  2KHJ A;  4A3E B;  4V0B A;  1SXT A;  1KHI A;  4HJ7 A;  3OHX C;  3PO2 H;  3F2C A;  4DXF A;  3E6Z X;  4B3T L;  3HKS A;  3T1Y L;  1XNQ Q;  1R9T H;  4A3C H;  5ELO A;  4LF9 Q;  3GTM B;  4IFD H;  5M3F G;  5DNF A;  2JA5 H;  3IKJ A;  3I4L A;  5LMN L;  3CQZ B;  2EXD A;  2NWG A;  3GD7 A;  1HFG A;  2P5Z X;  4DV0 Q;  3S16 B;  1XYI A;  2IHE A;  5K36 H;  2VZA A;  1GUW A;  1JMC A;  1S72 A;  2AQ1 B;  2ICI A;  4V19 0;  4DR1 Q;  4YHH Q;  4BY1 H;  4KKT A;  2KCT A;  2TMP A;  3VR6 A;  4JOI C;  1ILQ A;  3HOX B;  1SE4 A;  2I0Q A;  3A5Z B;  3D4R A;  1JJG A;  1RDP D;  2ENB A;  4C3J G;  3A55 A;  1B4O A;  4DN4 M;  4IJL A;  1IW7 D;  1LTL A;  3BZD B;  1TY2 A;  1YHA A;  1YI2 A;  1OXV A;  2YTY A;  4KLK A;  3BVG A;  2QDB A;  3CPW A;  1N32 Q;  3HRZ C;  1GO3 E;  5H1S E;  1DCZ A;  3I55 A;  4JI4 Q;  1EZ8 A;  1NE3 A;  2EDG A;  1NBW A;  5E4W C;  1GHK A;  1MKH A;  3NPP A;  1BKB A;  2SDF A;  2XRS D;  4GOP A;  2VUM H;  4JW0 A;  1RTN A;  1C7Y A;  4A3K H;  2UUC L;  2E76 C;  4ME5 A;  4CJ1 B;  1DGS A;  4TSS A;  3JAM L;  4JI5 Q;  3HOY H;  1K73 C;  1C8C A;  5EJW A;  3S1N B;  1TWG H;  3CW2 C;  2XRQ D;  1X65 A;  4K0K Q;  1TWH H;  2HCC A;  1C48 A;  4BBS G;  1HUN A;  2PI2 E;  3TRE A;  3PF5 A;  4C2M H;  3TDQ A;  2R7Z H;  3M3Y B;  1IYV A;  4DV6 L;  5IP9 H;  1HRJ A;  4DUZ L;  2B2V A;  4P74 A;  1H9K A;  1WD1 A;  2RBM A;  3S9W A;  2AUJ D;  3CU7 A;  3G7L A;  4DV4 Q;  4IZ8 A;  1STG A;  1C9O A;  3S17 H;  2YU9 H;  1G51 A;  2Z4I A;  1DJR D;  4BY7 B;  3TP7 A;  2JP1 A;  1ESF A;  4IPH A;  3J80 L;  4DNI A;  4MNO A;  1YHB A;  2UU9 Q;  4TQU S;  3A8J E;  3MEF A;  3CC7 A;  4BS9 A;  3CCU A;  4K14 A;  3BYY B;  4XDX A;  3GO5 A;  5C0X I;  2K52 A;  2OWO A;  1V43 A;  3NWT A;  4OGQ C;  1G6P A;  2WIN B;  3DWQ A;  3NBI A;  1PYB A;  2BA1 A;  5C4Z A;  4G7H C;  2MJ8 A;  5JJL A;  2AMC B;  2XWJ B;  2KQ3 A;  1JOQ A;  3Q23 A;  2Z9H A;  2E2H H;  1CZW A;  3CMA A;  4C3I G;  2RQX A;  1SNO A;  2OEO A;  4A3L G;  2JA7 G;  2KHI A;  2LY7 A;  1GUN A;  1NMG A;  1HR0 W;  1B44 D;  4ZCK A;  2G9D A;  2ICE C;  1CFM A;  5C3W A;  1SYB A;  3PIP 3;  1U4P A;  1EY9 A;  1HZC A;  1Q46 A;  1U4M A;  4UP9 A;  5CV4 A;  1QCB D;  4XYO A;  2BE5 D;  2QEX A;  3H3V I;  3VR5 A;  1NNX A;  1HH2 P;  1WI5 A;  4JI0 L;  1J8I A;  2NVX H;  1ZYR C;  2B2T A;  3SDZ A;  3J81 i;  3S2D H;  3GTP H;  2PZT A;  2UUB L;  2BH8 A;  1VCI A;  5C44 B;  2JE6 I;  5J1Z A;  5CC4 A;  4KD3 A;  1S5C D;  1FL0 A;  4X66 L;  2L1B A;  1LT5 D;  2IPK D;  3PO2 B;  4U68 A;  4LFA Q;  2HCI A;  3NWS A;  3K5N A;  2L5T A;  1BXT A;  2F0S A;  4A3G H;  1N36 Q;  4X6A H;  1HZ9 A;  2EPB A;  2JK8 A;  1SBB B;  4GNX B;  4ILW A;  2JA5 B;  1SNQ A;  3CCJ A;  4HIK A;  1FGB D;  4QB4 A;  4JPB W;  4POG A;  1TQO A;  1M1K C;  2WFW A;  4LUO A;  4OEM B;  4DR4 L;  2B2U A;  5I2Y A;  3GTO B;  1QVC A;  4BY1 B;  1NCV A;  3QIA A;  1PFB A;  4RKB A;  4XT1 B;  1IBK L;  1XPU A;  2IWH A;  3BVZ A;  5IWA Q;  4HCE A;  1JJ2 A;  4Z9C B;  1JQY D;  4U67 3;  2PMZ E;  3P7J A;  1K9M C;  1E3P A;  2PPB C;  1PFM A;  1U0L A;  5FOB B;  5GRO A;  4Y52 H;  2K5V A;  3TP6 A;  2PQA B;  4IPG A;  1MHW C;  3RN2 A;  2A19 A;  2GA4 B;  1DOL A;  3I90 A;  3OIQ A;  2F0D A;  4B9W A;  2YV5 A;  2EJF C;  2H5X A;  4HED A;  3CF5 A;  3GTG H;  3MAQ A;  1SN8 A;  5DM6 3;  1UEA B;  4RG1 A;  1Q8K A;  3A5U A;  1YEZ A;  4QCL A;  5NUC A;  2I07 B;  4OWX B;  5BN3 A;  1EIY B;  4GLX A;  1HNW Q;  2VUM B;  2Q2I A;  4X64 Q;  1IKL A;  1JJC B;  4A3K B;  4C3I H;  1SJE D;  1EOV A;  4A3L H;  1E0B A;  2JA7 H;  3I4N G;  1J5E Q;  2A6H C;  1V8Q A;  1Y1V H;  4DAP A;  2R3Z A;  1Q7Y C;  1LAC A;  1E1O A;  4FO2 A;  3HOY B;  2N55 A;  2Z0S A;  1IL8 A;  1TWH B;  2NTS A;  5K5P A;  1G2S A;  4JVZ A;  2ID0 A;  1L0W A;  1YIT A;  4NP5 A;  5AJ3 Q;  5ELD A;  4HTH A;  3OOC A;  2AHO B;  1EFI D;  5KYL A;  4AYB G;  1I50 H;  2JA8 H;  1CHP D;  3ULL A;  3T1H L;  4LUV A;  1VQ4 A;  2F0V A;  1ICF B;  1YNJ C;  1K0S A;  4L5R C;  2YU9 B;  4PZ8 A;  4OX9 Q;  2R7D A;  1HFN A;  4C1N K;  2Z4H A;  4Y7N H;  1U4R A;  1L1O C;  2R92 G;  3KOJ A;  5ISR A;  3MXU A;  1Z47 A;  4GLA C;  1BCP D;  5CBE E;  1A63 A;  3DM1 A;  1MBY A;  1TWF H;  3A8K E;  1SMY C;  2RDF A;  3NBH B;  5C0X G;  3ERO A;  4GLV B;  4AH6 A;  2EY5 A;  2F0O A;  2E2I H;  3D4W A;  1BR9 A;  5IYC H;  5G3L D;  4OO1 G;  2K6A A;  2XWB B;  2ZM6 Q;  2NVT H;  4ZKB B;  4KY5 A;  1D5M C;  3M4O H;  1KDB A;  1WVL A;  1PH7 A;  4B3T Q;  1S40 A;  3HOV G;  1H9J A;  1XTC D;  5KRU A;  4A3B G;  1ZKO A;  1A3T A;  2GN5 A;  3OTO L;  2VNU D;  4QIW E;  1HR0 L;  5KYI A;  1T5E A;  2L0C A;  5C0X J;  5LMN Q;  2RVL A;  1X3E A;  3AQQ A;  2WAC A;  3QO2 A;  1ET6 A;  2K14 A;  4AYB E;  1WOC A;  5CGK A;  2NVX B;  2J7Z A;  1E24 A;  4O0A A;  3K57 A;  1VQG A;  4CBV A;  4XQQ A;  1IL2 A;  4OL7 A;  1OXX K;  4PMC A;  3K80 C;  2M2L A;  5ELC A;  1RTO A;  2DNC A;  3AU7 A;  2N78 A;  1SEB D;  3OW2 A;  3SGI A;  5A35 A;  3K58 A;  4DR3 L;  2E2J H;  5EPK A;  4A3G B;  2DJG C;  3KLS X;  5GAG C;  4K6L A;  3G71 A;  1YZ6 A;  2QEJ C;  1PH5 A;  2R93 G;  2PQE A;  4DR6 L;  1HNZ Q;  1KTK A;  3NUC A;  1WTQ A;  1HA5 A;  3L9A X;  4KV6 A;  3MA2 B;  3G6E A;  2NUC A;  5I9O A;  3SEB A;  1WTX A;  3MFY A;  2B2Y A;  1CK1 A;  2Y0S B;  4OIJ A;  4IAL A;  5C3E G;  1T9H A;  3UDG A;  3MXN B;  4OWT B;  1OXU A;  2EY2 A;  4GNX A;  1JWM D;  2A68 C;  3HKZ G;  3JAM i;  3QOJ A;  3NP8 A;  2FXQ A;  2VB3 X;  1E22 A;  1U5K A;  3I56 A;  3C3L A;  1EY0 A;  4GOP C;  1PDQ A;  2RDH A;  2JYO A;  4YCU A;  1YJW A;  5DEH A;  5C4X B;  4LAA A;  3A54 A;  1PRT C;  4GZY C;  3DLL A;  1D6E C;  5IT9 E;  1TS3 A;  1LT4 D;  3PO3 G;  4DV6 Q;  3TZU A;  1BCP B;  1KNE A;  1NMF A;  3GTG B;  4DUZ Q;  1I4P A;  1EUJ A;  5IT9 c;  2BCO A;  5IYD G;  4OO1 H;  4KY6 A;  4JI7 L;  4DF7 A;  4DAV A;  2L9H A;  3S14 H;  1KLU D;  2F4I A;  4KK7 A;  5IY0 A;  2L55 A;  1VQF A;  2MPM A;  2PQA A;  2JSO A;  1KDC A;  1EIG A;  5KIX A;  3J81 L;  4DV2 L;  4A3B H;  4GN5 A;  1DD2 A;  1MIU A;  3SR1 A;  1Y1V B;  3BJU A;  1IHZ A;  4IO9 A;  5TSS A;  2L15 A;  1Y1W G;  1K8A C;  1JC7 A;  3E9I A;  5AFW A;  5HY6 A;  5EAY A;  5EPL A;  4DK0 A;  1LUZ A;  2R61 A;  5JEA H;  4EX5 A;  1WD0 A;  2DN8 A;  1VQ7 A;  3RNU A;  3VR2 A;  4LF5 L;  2KEE A;  1UNS A;  3E0E A;  2PCF B;  4DV1 L;  4RWS C;  1AEX A;  1CSP A;  2PW5 A;  3GV3 A;  4LF7 L;  4AQY L;  2JA8 B;  1WCM G;  4B3S L;  2UXC Q;  4KY7 A;  1H9S B;  1Q90 A;  4L5T A;  5KEE A;  1Z6H A;  2EOT A;  1X6O A;  1X3Q A;  2R93 H;  4A93 B;  4HSP A;  1GHJ A;  4A4I A;  4JI3 L;  4CDC C;  1TWF B;  4JI0 Q;  4A3D H;  4NXM L;  3M85 A;  2UUB Q;  2JA6 G;  1F2Z A;  1RHP A;  2B63 G;  2E2I B;  4MIU A;  4WOR A;  1NR2 A;  3FPU B;  2M00 A;  4BBR G;  3T13 A;  4OWW B;  2ZJP A;  3UDX A;  2NVT B;  4X66 Q;  1XMO L;  4HR7 B;  2MO1 A;  3M4O B;  3NBH A;  2O5J C;  3I7F A;  4A3I B;  3GP7 A;  2EYL A;  2PI2 A;  1CHQ D;  5FLX E;  3A0J A;  4DKA C;  4EGV A;  3BDO A;  1I6V C;  5HGQ A;  3STB D;  1CQV A;  1DZ1 A;  1EY8 A;  2UXB L;  1FYC A;  1F2M A;  1YIJ A;  1M90 C;  2CKZ B;  3OMC A;  1GXD C;  2D0P A;  3VYT A;  3RZO H;  3G48 A;  5EBD A;  2AWN A;  2IHF A;  4DK6 C;  2O4X A;  2F0Q A;  3L3O C;  3IAY A;  1SAP A;  2K04 A;  2HQE A;  5IYD H;  4OXP A;  3FKI G;  4M1U B;  4DU9 A;  4LF4 L;  2LXJ A;  4DR4 Q;  1B50 A;  1EEF D;  1GUT A;  5CV6 A;  2Z6B A;  3M7N A;  2MFI A;  1QVF A;  4H44 C;  1QWY A;  3CCL A;  1EY6 A;  1Q81 C;  4HIM A;  3PUX A;  1PTO D;  1EIF A;  1EQV A;  4HSV A;  4X3S A;  1Y1W H;  4R4Q A;  1SYE A;  5JVH 3;  2RDG A;  1XPO A;  3CPF A;  3KBG A;  3KF6 B;  3K7A H;  1O80 A;  1Z7T A;  3K6O A;  5FJ8 H;  1CQF A;  2ATW A;  3H09 A;  1UEB A;  4JBK A;  3H3V C;  1O7L A;  4O2D A;  1X55 A;  1QJO A;  2E75 C;  2F0I A;  5C5L A;  2A69 D;  3FP9 A;  4LFB Q;  2B2W A;  4UP7 A;  3UE0 A;  1KDA A;  4C1N I;  2UUA Q;  3C46 A;  1EQR A;  2MGS A;  1HTP A;  4DAM A;  3HP3 A;  1PYW D;  1VQ6 A;  5IOD A;  3RN5 A;  4LF6 L;  1FJG L;  4GKK Q;  5EKI A;  4X3U A;  4LNQ A;  1XTD A;  3F1Z A;  4G57 A;  4DPG A;  3MXN A;  4IPC A;  2D5D A;  2QGQ A;  1PZI D;  1VQ5 A;  1M8A A;  2PYK A;  2N88 A;  5C5M A;  2JA6 H;  2A1A A;  3WWV A;  1F9S A;  5E4X A;  5JPN C;  1SDF A;  1YBY A;  4A3M H;  3S14 B;  3CME A;  5M5Y H;  1KAA A;  2MUY A;  1KAB A;  1B1Z A;  4FYD A;  1E1T A;  2K5Q A;  1O7I A;  1X54 A;  1IBL L;  3KF8 B;  4A3B B;  3T4A C;  4RKL A;  4R8N A;  4B9X A;  2D0O A;  2IX0 A;  1K0R A;  4QL5 A;  4JV5 L;  2AQ2 B;  4HJ9 A;  1GKH A;  1SND A;  2X6L A;  5D3D A;  1I6H B;  1ENA A;  1K83 B;  4A3J G;  2DJF C;  3GTL H;  3FKI H;  1IYJ B;  5JOB A;  3NHH A;  2V1C C;  2PO4 A;  3H91 A;  4C56 C;  1AE2 A;  4XTC S;  4HID A;  3I2Z A;  5M9O A;  1JOK A;  3BYT B;  4DV7 L;  4XIG S;  1SLJ A;  1JB3 A;  4L6T B;  3T53 B;  4ZAI A;  5LL6 X;  5BR8 L;  1LTA D;  1Q12 A;  1QB5 D;  1NAP A;  4LFC L;  1PTO B;  3LX0 A;  1MJC A;  1X3P A;  3JC6 6;  1X3G A;  1W2B A;  5IGB A;  2K1B A;  5KNC A;  1ZXT A;  1FNU A;  2XN9 C;  1VMP A;  2IX3 A;  1HHV A;  1DOK A;  1O7Z A;  2K5D A;  3DM3 A;  3Q22 A;  3PQI A;  1WTR A;  1LTR D;  1I4G A;  3X3M A;  4A3D B;  1H9S A;  2NN6 I;  2A8V A;  3PUY A;  2AQ3 B;  1EYA A;  1QUQ B;  2H4O A;  3NTH A;  4RHR A;  1BBU A;  1QOH A;  2K5W A;  3I4M G;  4YCW A;  3EN2 A;  1BOS A;  3S1M H;  3PCO B;  1AZP A;  2ZTE A;  1TS5 A;  3RMH A;  1GD7 A;  4IUV A;  1VQJ A;  1VQH A;  2ZXO A;  4FF4 A;  1F2L A;  5EGT A;  1I3Q H;  1PVO A;  4DR6 Q;  3R3O A;  3DUZ A;  2PW7 A;  5M3F H;  3U9O A;  3TQY A;  1HZB A;  4R9W A;  4CDE C;  1D8L A;  2BA0 A;  4EQO A;  1SYD A;  2EVB A;  3KK7 A;  5JJK A;  3F2D A;  1ICW A;  3VYR A;  1TWC H;  2E5L L;  3VYU A;  4JI1 Q;  1WFQ A;  3H0G G;  4P75 A;  3CCR A;  1XJV A;  5LMU Q;  2FFK B;  2RSN A;  4H13 C;  1NSN S;  2AUK A;  3PUW A;  2B2Y C;  3N6R A;  2F03 A;  1JOO A;  2RCF A;  1CA5 A;  4DK1 A;  2F0P A;  4GNX C;  4ZKC B;  4C3J H;  1K8G A;  4KHP L;  3M7G A;  1V1O A;  2WP8 J;  5IOC A;  4A3J H;  2JN4 A;  3BG3 A;  3CC2 A;  1TS2 A;  4JI7 Q;  1PRT F;  4APV A;  1BDO A;  3KUP A;  1A3U A;  3KJP A;  2HIX A;  2ZXR A;  4N9T A;  4B3M L;  3KF6 A;  4PG3 A;  2MNA A;  4DV2 Q;  1A2U A;  3CCE A;  2B29 A;  2MQH A;  3Q24 A;  2EQS A;  4WFN 3;  1EWI A;  3PF4 A;  3EVQ A;  5I4D A;  4WJ3 M;  2B3G A;  2B8G A;  2EZV A;  1JE4 A;  3IRB A;  2F0M A;  1JT8 A;  4F8M A;  3HOU G;  3OWF A;  5GAH C;  2WAQ B;  1XNR Q;  4UY8 C;  3A74 A;  5BN5 A;  4JYA Q;  1R9T B;  2K28 A;  3NEL A;  3QG1 A;  1ESR A;  3A56 A;  3U9S A;  1DOM A;  4BBS H;  4LF5 Q;  2JA6 B;  4KD4 A;  5CV5 A;  4DV1 Q;  4IN3 A;  4ZYS A;  4LF7 Q;  1XX8 A;  4M8A A;  4AQY Q;  5GQO A;  4A3M B;  5M5Y B;  3RLN A;  1HZA A;  5M3M G;  3BVM A;  3P1H A;  3BS1 A;  5IYB G;  2JXM B;  5LHY 1;  3UDF A;  2OCE A;  5D3I B;  4X65 L;  4R8I A;  4KHV A;  1E2W A;  2F4V L;  2PZW A;  2HHH L;  1TS4 A;  1VQI A;  2A6H D;  4N9P A;  5I6Y A;  1STH A;  4JI3 Q;  2K33 A;  5IGF A;  2A6E D;  4FNF A;  3Q0A A;  3W5O A;  3A7A B;  4OON A;  3S1R H;  4IOC A;  3KF8 A;  2BE5 C;  3NTI A;  2XVS A;  2I5L X;  3GTL B;  4NXN L;  3GTJ H;  4RCO A;  2FMM A;  1VQK A;  1X32 A;  3D0F A;  4LK1 C;  1W3S A;  1B3A A;  1IBM Q;  2LFN A;  4XYQ A;  1AW7 A;  3SVM A;  1G91 A;  1V1Q A;  1N33 L;  5FLM G;  5E1F A;  1KQS A;  2MP1 A;  4LUZ A;  1SYG A;  2CW0 D;  5FO8 B;  5I6W A;  1RIP A;  4X3K A;  3S1Q H;  1F9R A;  4FXK C;  4C3H G;  1YNJ D;  1DON A;  2C5C A;  4PV1 C;  2KBN A;  1DXM A;  4P73 A;  4XT3 B;  1D5X C;  3AMU A;  2VQF L;  1TWG B;  3K81 C;  5JPM C;  1VQL A;  4LF4 Q;  2QW7 A;  3AEV A;  4HIO A;  3HOZ G;  4JI6 L;  3TN2 A;  3F2U A;  1VDZ A;  4TKO B;  1QIL A;  4O1N A;  2QKI C;  4C2M B;  4F7X A;  2R7Z B;  2OQK A;  2OXP A;  3ND9 A;  1HCZ A;  1EQT A;  1F77 A;  3B6Y A;  5EKL A;  4FF3 A;  1A6X A;  1QUQ A;  2L11 A;  1FNV A;  1VMC A;  1S5B D;  1I3Q B;  3S17 B;  3K8A A;  1XNQ L;  1CSQ A;  3TSS A;  3CRL C;  2I5H A;  3ITP A;  1PH1 A;  1DYQ A;  4HMJ A;  4IUN A;  5M3F B;  1EQQ A;  4JBW A;  1UE5 A;  3BU2 A;  2VL6 A;  1P8L A;  1LM0 A;  2R7F A;  1BVS A;  5D14 A;  2WB1 G;  2EE1 A;  1E2Z A;  3GDE A;  4JOI A;  4HCS A;  1RJT A;  2BDO A;  5M3M H;  1OTC A;  1TWC B;  2EY1 A;  2SNS A;  3EFX D;  5IYB H;  4P72 A;  4H02 A;  1TU2 B;  1E7Z A;  4J15 A;  2BH2 A;  3GTQ H;  1D7Q A;  1WTW A;  1XXG A;  2B2W C;  1X3F A;  3PIO 3;  2OF1 A;  4NKL A;  4DR1 L;  3MZ5 A;  1GVP A;  3NE5 B;  3T1Y Q;  2E2H B;  2CH4 A;  3FEW X;  4C3J B;  2A73 B;  1ML0 D;  3HFZ B;  4YY3 L;  1WJJ A;  4JK1 C;  2JEB I;  2HIV A;  4IFD I;  2VB2 X;  3IFD A;  4RGT A;  4YWM A;  4IUR A;  4CDD C;  4QQB X;  1PHJ A;  1CZG A;  1N32 L;  3L0O A;  5EBC A;  5FLM H;  3RZD H;  1VQE A;  2FJ2 A;  1IBL Q;  4QUC A;  4NW2 A;  2PNH A;  2A5H A;  2HDL A;  3S2D B;  2J4X A;  3K0Y A;  1JB7 A;  1ENF A;  3GTP B;  4JI8 L;  4C3H H;  2A68 D;  3LGJ A;  1CUK A;  4JV5 Q;  1GJX A;  1PZJ D;  3I4N H;  2IW3 A;  4JBJ A;  5HUR A;  1YHQ A;  1BCP C;  4JI5 L;  2F0E A;  3E9H A;  3DXJ C;  4DV5 L;  3WOF A;  3N52 A;  3SK4 A;  2WB1 E;  4EQN A;  1Q82 C;  3HOZ H;  4BBS B;  2LS0 1;  4I7A A;  2B39 A;  4DV7 Q;  4DUY L;  4K8I A;  5BR8 Q;  4ID6 A;  4XQJ A;  4IUP A;  2F3V A;  1R4P B;  3L7Z C;  2UUC Q;  1XMQ L;  2N8N A;  3J81 j;  2EYM A;  3OMG A;  2KCC A;  4DV4 L;  4X62 L;  4UP8 A;  1PZK D;  4CHT B;  2KHS A;  5J3B A;  2F52 A;  1W6K A;  2VW9 A;  2R92 H;  2I46 A;  1KRS A;  5F2D A;  3H6M A;  3S1R B;  4BXX G;  1TWA H;  3FVQ A;  2AWO A;  1A15 A;  1UE1 A;  5C0X H;  1ZEQ X;  2K7V A;  2XIW A;  3GTJ B;  3CHB D;  2R6G A;  1MI2 A;  1CM9 A;  1PH3 A;  2Q2T A;  3K59 A;  2F0T A;  4YWL A;  1UWV A;  1S5F D;  3FRP B;  3EJI A;  2MHV A;  3HOV H;  1HJP A;  2HDM A;  4C3I B;  3AYH B;  4RAU C;  2JA7 B;  4B3R L;  2B2V C;  4BY7 G;  4HN7 A;  3X3N A;  4DAY B;  5IGD A;  1SE8 A;  1I4R A;  3TS0 A;  3AB9 A;  2PMZ B;  4Q5V A;  1RCV D;  3CQZ H;  4DV3 L;  1O7Y A;  4ABN A;  2HUG A;  2E5L Q;  3S16 H;  5CV9 A;  3PUZ A;  4QF4 A;  3M4Y A;  3H3V H;  1Y14 B;  4DA2 A;  1JWS D;  3SHL A;  4DGZ A;  3O13 A;  3HKZ E;  1SSO A;  2NVY H;  5IP7 G;  1I50 B;  1DM0 B;  4PZ7 A;  1PA6 A;  1CT1 D;  4A75 A;  2AKW B;  3BDL A;  3W2D A;  2QA4 A;  4R1J A;  3V05 A;  4CGY B;  1G8Z D;  3TP5 A;  4F87 A;  5KNB A;  1NJI C;  1BNZ A;  1WTP A;  3ERQ A;  4JI2 L;  4Y7N B;  4FVM A;  2NZO A;  1N36 L;  4FDB A;  4K2K A;  4B3M Q;  3TEH B;  5A2Q L;  2ALY B;  4JCV E;  1TVX A;  1WTH A;  2YYZ A;  1CTM A;  1VF5 C;  1VF7 A;  2EY6 A;  3JAM E;  5JAV A;  1H9R A;  1CI3 M;  4CJ0 B;  4ULL A;  5C6A A;  1S5D D;  4K5W A;  5I9P A;  5C3E H;  5C44 G;  5KND A;  2HQL A;  5M5W H;  2LXK A;  5C4J H;  2CH4 W;  4ODG A;  3NXW A;  5EPJ A;  2K32 A;  2C9O A;  2B2T C;  3S1N H;  1ILP A;  5IWA L;  4A3F G;  1QVG A;  1PMR A;  4BXX H;  3DMU A;  1KRT A;  3CCQ A;  1IZ6 A;  2F0J A;  5CR3 A;  4IFD G;  4FF1 A;  3PO3 H;  5FLX c;  3NTK A;  3M3Y H;  1SMX A;  1VQD A;  3MTS A;  1B7Y B;  4MN3 A;  3LWE A;  2EYP A;  2V4D A;  1MD2 D;  1LAB A;  1Q8I A;  3KLW A;  3J7Y W;  5ELN A;  1GOZ A;  4CJ2 C;  1AP0 A;  4ALP A;  3RZD B;  3TS2 A;  3C1F A;  3ER0 A;  1WTV A;  3OW7 A;  2WKD A;  2Z1C A;  4X65 Q;  3D6W A;  3J80 E;  4LF8 L;  2KEC A;  1HNW L;  1IBK Q;  4BY1 G;  2HHH Q;  2F3W A;  3M4Q A;  3PV0 A;  4C3H B;  3D8G A;  4BY7 H;  3J80 c;  4KN4 C;  3I4N B;  1XWE A;  1YNN C;  2ZTC A;  5LL6 S;  1TII D;  4DR7 L;  4CKB A;  4IFD J;  1BUV T;  1PFS A;  1CA6 A;  3CAM A;  2B2U C;  1KAW A;  2E2J B;  4J6H A;  4GN3 B;  3HOZ B;  1YJN A;  4QIW B;  1T5X D;  1AN8 A;  1EY7 A;  2G9H D;  4UHV A;  4PMW A;  5IGC A;  1N33 Q;  3ICE A;  1AFP A;  4BA2 I;  4WJ4 A;  1B8A A;  4L8J A;  5ELB A;  4DR2 L;  2J0T D;  3KLR A;  2Q8I B;  3TZD A;  4AYB B;  5IP7 H;  2VUM G;  1YVC A;  3RLF A;  4A3K G;  1WCM H;  3EIV A;  4G7Z C;  3S15 H;  4FXD A;  5IIF A;  3BZC A;  3NK9 A;  1K3R A;  1KLG D;  4KI0 A;  4DXG A;  4PQX A;  4ZUI A;  2Q8T A;  4HJA A;  1XPR A;  2F3I A;  4HMI A;  2R92 B;  5JVG 3;  4JI6 Q;  1WTO A;  3CXC A;  4IUT A;  1TWA B;  4LJZ C;  4P2C B;  2WB1 B;  1RL2 A;  1TT2 A;  3LNN A;  4OIK A;  3LWU A;  5EQ0 A;  2B63 H;  4NPS A;  1EL0 A;  2KUM A;  4QUF A;  4BBR H;  4AIM A;  4DK3 C;  4EQP A;  5IP9 G;  1PTO C;  4RGN A;  4RFB A;  3VDY A;  3KLS A;  3ULJ A;  1W6J A;  5IT9 L;  1M4V A;  2N3S A;  2F1M A;  5I2X A;  2KED A;  3PIO A;  3T1H Q;  3C2P A;  2ZM6 L;  3S2H H;  3L2P A;  2QCP X;  2ES2 A;  3TP8 A;  1HQR D;  4A3F H;  3FDT A;  3K5M A;  3HOV B;  4IPD A;  1SE2 A;  1JE5 A;  3WOE A;  2FMC A;  5T1I A;  1FGU A;  4H7B A;  2DUD A;  2QDL A;  3D3R A;  1K8O A;  1FVI A;  4ZQ3 A;  3UE1 A;  5GAD C;  1A2T A;  1CKN B;  4K5X A;  2A69 C;  3W3A A;  2KCN A;  1KD1 C;  3V96 A;  4MZ9 A;  3SK5 A;  1PH4 A;  1B2T A;  3P20 A;  1LT3 D;  1EOT A;  4DAY A;  1Y8O B;  4MTN A;  5DAU A;  1D2B A;  3GTO H;  1D1I A;  4JG2 A;  2NZH A;  3M4P A;  1RKN A;  2JJQ A;  2NVY B;  2F0G A;  4IOA A;  2FIN B;  1STY A;  4YY3 Q;  3NEM A;  2M9V A;  2NVQ H;  1LYL A;  3OTO Q;  3CCV A;  4QGU A;  3VA7 A;  2NZ1 D;  3J7A 5;  1HR0 Q;  1C0A A;  3VR4 A;  2WII B;  4JC0 A;  5COY A;  4LWC A;  4DNR B;  1SJH D;  1EWH A;  1F9Q A;  1ET9 A;  5KGU A;  2R93 B;  4MTK A;  2K03 A;  3M9B A;  1Y8N B;  3QB3 A;  1HNZ L;  3E0J A;  1D5Z C;  1QZH A;  4I65 A;  4Q0F A;  2NTT A;  1KNA A;  2E8G A;  2Q8R E;  1FD7 D;  4JI8 Q;  3HGB A;  2JA9 A;  4OEL B;  5C3E B;  3J7Z C;  4OHJ A;  4ZRZ A;  5M5W B;  2YTV A;  5C4J B;  1Y8P B;  3HKZ B;  1I4X A;  1HQM C;  3T16 A;  1I94 L;  2OTL A;  3J7A V;  3W1G A;  4DV5 Q;  2RF4 A;  4DR3 Q;  1STB A;  3AFQ A;  1BF4 A;  1IW7 C;  4A3G G;  1MSG A;  1U4L A;  1BCP F;  2H1E A;  2RA4 A;  2EYF A;  3CCS A;  4DUY Q;  1VQ8 A;  3PO3 B;  3RZO B;  3E5S A;  5FLX L;  1V9P A;  1LTB D;  3I70 A;  5FO7 B;  1JR0 D;  3G4S A;  1XMQ Q;  2KCM A;  2OT2 A;  5G3L F;  4PMB A;  2Y0S G;  4ZLT F;  5HGT A;  2ZT9 C;  2CQO A;  1EFW A;  1JIC A;  3HOW G;  1ZYR D;  4X62 Q;  3PMF A;  1HTL D;  1HUM A;  1UAP A;  2K5N A;  1B3Q A;  3I73 A;  2Q2H A;  4KJO A;  2Q2U A;  4R4T A;  1TXY A;  4PZ6 A;  1Y1W B;  5C4X G;  3K0X A;  1LV9 A;  4K5V A;  2E2D C;  3K7A B;  3TRZ A;  3R2T A;  2VQE L;  3NQT A;  3S24 A;  1PLF A;  4HJ5 A;  4DR5 L;  4OO1 I;  2C35 B;  3GQB A;  4N8F A;  1IKM A;  3I4O A;  4DFA A;  1II3 A;  2DNE A;  2GVA A;  1AH9 A;  1EY4 A;  4QMG A;  3ULP A;  2E74 C;  1VQB A;  3ZJY C;  4B3R Q;  1WCM B;  4WRD A;  3S15 B;  3DHQ A;  4FP5 D;  2UXC L;  3H94 A;  2F0K A;  2F0H A;  1Y1V G;  3F8T A;  3R2I A;  1SNC A;  4DV3 Q;  1NR4 A;  3I8Z A;  5D65 A;  3KBX A;  2L12 A;  2WV6 D;  3U4Z A;  2G5D A;  3OYY A;  1H9M A;  5CMD A;  1SRO A;  2Y0S E;  1N8R C;  3MXP A;  2B63 B;  1VQC A;  2DGY A;  5DM7 3;  2VY3 A;  3I4M H;  4BBR B;  1VQ9 A;  2BOS A;  2D2C C;  3NEN A;  3ERS X;  3D6C A;  4B3S Q;  2JA8 G;  3S2H B;  2KEN A;  1GUO A;  2RHQ B;  4NDX A;  4L5S A;  2VXW A;  2NYZ D;  3OWE B;  4K6D A;  4A3F B;  1C4Q A;  2B8F A;  1GUG A;  2K01 A;  4FXG C;  3KDF B;  1QE6 A;  4JI2 Q;  1KXL A;  1CKM A;  1FR3 A;  1G29 1;  3HZX A;  1UE7 A;  4GS3 A;  4LW1 A;  1PH6 A;  1KC8 C;  4A93 G;  2EYO A;  2QIL A;  2L4N A;  1JWU D;  4UDU C;  4POF A;  1SFO H;  4NXM Q;  2RKS A;  3EBE A;  2Z6K A;  4XXE A;  2IT1 A;  3I72 A;  3VA5 A;  1N34 L;  2O2L D;  2ZXP A;  3FKI B;  4N8X 1;  4X3T A;  4H0L C;  3HG9 A;  1BBW A;  1MJE A;  2IY5 B;  5IYC G;  3BZK A;  1X9N A;  1E2V A;  3HOW H;  1Q1E A;  4EVO A;  4K8J A;  3H0G H;  1XMO Q;  4GKJ L;  1CKN A;  2A74 C;  4UAI A;  1R4Q B;  1P16 A;  2IX1 A;  4A3I G;  2PNR C;  4J1M A;  2CCZ A;  1PH2 A;  5EKK A;  2UXB Q;  4NMZ A;  2NVQ B;  4RCN A;  5C4X H;  1ROD A;  1EYD A;  2XNA C;  4QY7 A;  4KJN A;  3HS0 C;  2MO0 A;  4JBM A;  3PUV A;  3WDN A;  1STN A;  3J81 E;  2F0U A;  1B9N A;  1CKO A;  2RSO A;  3URY A;  2CWP A;  3QOL A;  1SMY D;  4LF8 Q;  2NN6 G;  3SE0 A;  4LFB L;  5JJI A;  1HNX L;  3CCM A;  2UUA L;  3QWN A;  3J81 c;  2N49 A;  2OQ0 A;  1LT6 D;  4DR7 Q;  1EEI D;  4QJF A;  1AE3 A;  3K5O A;  1TR5 A;  4L5Q A;  3S1M B;  4B08 A;  1PV4 A;  5GAE C;  2A6E C;  3MWY W;  2HT1 A;  3HOU H;  4GKK L;  2UXD L;  5FKA C;  5DLQ E;  1RF2 D;  4P71 A;  3RR5 A;  5J39 A;  1QNU A;  4LF9 L;  4DR2 Q;  1K28 A;  2XSC A;  4LMQ D;  2K75 A;  4K2L A;  5CV7 A;  1BO0 A;  1BBX C;  1TY0 A;  2CW0 C;  4DV0 L;  1LTI D;  1OXS C;  2SNM A;  3AFP A;  1LO5 D;  3QR8 A;  4LF6 Q;  3RUZ A;  2KVM A;  4YWK A;  2K5H A;  3MVV A;  4RHS A;  3IFT A;  1FJG Q;  5A2Q E;  4ZK9 B;  4G4K A;  1Q86 C;  1MSH A;  1B9M A;  2CVR A;  5C4H A;  4YHH L;  2DY8 A;  4A3E G;  1VS0 A;  1PYS B;  4DNT B;  4A93 H;  3FPP A;  5C3X A;  1K8M A;  2D62 A;  1HA6 A;  4EQ5 A;  1JOR A;  4RGM A;  4RH6 A;  4MHE A;  4A3J B;  4CKE A;  4A76 A;  3G6J B;  1EU4 A;  2ASB A;  1QG7 A;  3GTK H;  3H15 A;  2PZU A;  4JI4 L;  1D1K A;  1SYC A;  4A3I H;  3SK6 A;  4L63 B;  1PH8 A;  1N9W A;  1QNK A;  2HD3 A;  1PTO F;  1EY5 A;  3V2T A;  5COR A;  5BN4 A;  4ZUJ A;  3HOX G;  4O42 A;  3ZYY X;  1VQN A;  4NB3 A;  2EXZ A;  3OIP A;  1SRU A;  4YIJ A;  5JEA G;  2EYH A; 
#chains in the Genus database with same CATH homology
 1PRT D;  3GV6 A;  4KHZ A;  2NN6 H;  1B53 A;  2LKV A;  3FMC A;  3I4M B;  1Q1B A;  2EJM A;  1IYU A;  4F88 A;  2F0L A;  5E3F A;  3TBI B;  1S5E D;  3TME A;  5ELF A;  2QF7 A;  3C1E A;  1SYF A;  1SNP A;  2IJ0 A;  2X6G A;  5JEA J;  3UI2 A;  3A8I E;  2KOL A;  1PXU A;  1V1P B;  1HXY D;  1OXT A;  3CKI B;  1SFO B;  4HAE A;  4S3S A;  3EA6 A;  2JEA I;  1G2T A;  4IUU A;  3HOW B;  3H0G B;  3K5L A;  5JJZ A;  1EIH A;  3D31 A;  3MHB A;  2Z8L A;  5J22 A;  4XQN A;  3S1Q B;  4KTA A;  3OSO A;  3R8B A;  1OO9 B;  1LTS D;  3RD4 A;  4CKC A;  3T51 B;  2EYJ A;  4TRD A;  3P75 A;  2F0F A;  2O5I C;  1TKW B;  1O78 A;  1S4Z A;  1U9R A;  5CBA E;  1NUC A;  3MFG A;  4I7Z C;  3HOU B;  2K05 A;  1I4H A;  3R93 A;  1FNW A;  3J7A F;  2NB0 A;  3DWP A;  2WKC A;  1PRT B;  3ND8 A;  4G7O C;  1RD9 D;  5M3M B;  5ELE A;  1G6Z A;  3VR3 A;  1L0X B;  2KA7 A;  1PTO H;  1SNM A;  4IQZ A;  3GTQ B;  2KJX A;  2X69 A;  4RGO S;  5IGG A;  2SEB D;  3SK8 A;  3DEO A;  1Y69 U;  1YNN D;  1BQQ T;  2F0N A;  3I3C A;  4WJW A;  2DY7 A;  2NBF A;  1EU3 A;  1AZQ A;  4KN7 C;  1GUS A;  3CRK C;  4PNY A;  1ENC A;  5IGE A;  3DWA A;  3GTK B;  5T1G A;  3BDC A;  4KKS A;  3D4D A;  1Q3L A;  1EWC A;  3NSW A;  4FF2 A;  5K36 G;  5FO9 B;  2IL8 A;  1MGS A;  3HEJ A;  1STE A;  1F9P A;  1UUP A;  1I4Q A;  3A7L A;  2FHT A;  3OPO A;  1LTT D;  5M5X B;  3MXG A;  4BWG B;  1J9O A;  4IUQ A;  3IL8 A;  5CV8 A;  3SXH A;  4J8Q A;  3T56 B;  3NQI A;  2CQA A;  5CYU A;  4KMU C;  3ONA B;  2F0W A;  2SOB A;  1A3V A;  3MEH A;  1ONL A;  1STA A;  3DEP A;  1EYC A;  2TSS A;  4BA1 I;  3EQL C;  3I91 A;  3VYS A;  4KKU A;  3MC0 B;  1PFN A;  1LTG D;  1LLR D;  2CHB D;  4E6I A;  1EZ6 A;  3QJY A;  1HPC A;  2D9U A;  1F2Y A;  1JCK B;  1V1P A;  2EJG C;  1SE3 A;  2BDN A;  3Q6S A;  5FK9 C;  4RA8 A;  1L0Y B;  2LMC B;  4A3E B;  4V0B A;  1SXT A;  3OHX C;  4DXF A;  3E6Z X;  3GTM B;  4IFD H;  5DNF A;  3IKJ A;  3I4L A;  3CQZ B;  2NWG A;  3GD7 A;  1HFG A;  3S16 B;  1XYI A;  5K36 H;  1GUW A;  2AQ1 B;  2ICI A;  4V19 0;  4KKT A;  2TMP A;  3VR6 A;  3HOX B;  1ILQ A;  1SE4 A;  3D4R A;  1RDP D;  2ENB A;  4C3J G;  3A55 A;  1B4O A;  4DN4 M;  1IW7 D;  3BZD B;  1TY2 A;  1OXV A;  3BVG A;  2QDB A;  3HRZ C;  1DCZ A;  1EZ8 A;  2EDG A;  5E4W C;  1GHK A;  3NPP A;  2SDF A;  2XRS D;  1RTN A;  2E76 C;  4ME5 A;  4CJ1 B;  4TSS A;  3JAM L;  1C8C A;  3S1N B;  5EJW A;  2XRQ D;  2HCC A;  1C48 A;  1HUN A;  3TDQ A;  3M3Y B;  1IYV A;  1HRJ A;  2B2V A;  1H9K A;  1WD1 A;  2RBM A;  3S9W A;  2AUJ D;  3CU7 A;  3G7L A;  4IZ8 A;  1STG A;  2Z4I A;  1DJR D;  4BY7 B;  3TP7 A;  2JP1 A;  1ESF A;  3J80 L;  4TQU S;  3A8J E;  4BS9 A;  4K14 A;  3BYY B;  4XDX A;  3GO5 A;  5C0X I;  1V43 A;  3NWT A;  4OGQ C;  2WIN B;  3DWQ A;  3NBI A;  2BA1 A;  5C4Z A;  4G7H C;  2MJ8 A;  2XWJ B;  2KQ3 A;  1JOQ A;  3Q23 A;  1CZW A;  4C3I G;  2RQX A;  1SNO A;  2OEO A;  2LY7 A;  1GUN A;  1B44 D;  2G9D A;  2ICE C;  1CFM A;  5C3W A;  1SYB A;  3PIP 3;  1U4P A;  1EY9 A;  1U4M A;  5CV4 A;  1QCB D;  4XYO A;  2BE5 D;  3VR5 A;  1J8I A;  1ZYR C;  2B2T A;  3SDZ A;  2PZT A;  1VCI A;  5C44 B;  2JE6 I;  5J1Z A;  5CC4 A;  4KD3 A;  1S5C D;  2L1B A;  1LT5 D;  2IPK D;  3PO2 B;  4U68 A;  3K5N A;  2HCI A;  3NWS A;  1BXT A;  2L5T A;  2F0S A;  2EPB A;  1SBB B;  4ILW A;  2JA5 B;  1SNQ A;  1FGB D;  4QB4 A;  1TQO A;  2B2U A;  5I2Y A;  3GTO B;  4BY1 B;  1NCV A;  3QIA A;  1PFB A;  4RKB A;  4XT1 B;  2IWH A;  3BVZ A;  4HCE A;  4Z9C B;  1JQY D;  4U67 3;  3P7J A;  2PPB C;  1PFM A;  5FOB B;  3TP6 A;  2GA4 B;  1DOL A;  3I90 A;  3OIQ A;  2F0D A;  4B9W A;  2EJF C;  4HED A;  3MAQ A;  5DM6 3;  1UEA B;  4QCL A;  5NUC A;  2I07 B;  5BN3 A;  2VUM B;  1IKL A;  4A3K B;  1SJE D;  1E0B A;  2A6H C;  1V8Q A;  4DAP A;  2R3Z A;  1LAC A;  4FO2 A;  3HOY B;  2N55 A;  1IL8 A;  1TWH B;  2NTS A;  5K5P A;  1G2S A;  2ID0 A;  4NP5 A;  5ELD A;  4HTH A;  3OOC A;  1EFI D;  5KYL A;  1CHP D;  2F0V A;  1YNJ C;  2YU9 B;  1HFN A;  4C1N K;  2Z4H A;  1U4R A;  5ISR A;  3MXU A;  1Z47 A;  1BCP D;  5CBE E;  3DM1 A;  1MBY A;  3A8K E;  1SMY C;  2RDF A;  5C0X G;  3ERO A;  2EY5 A;  2F0O A;  3D4W A;  1BR9 A;  5G3L D;  4OO1 G;  2K6A A;  2XWB B;  4ZKB B;  4KY5 A;  1D5M C;  1KDB A;  1WVL A;  1H9J A;  1XTC D;  5KRU A;  1ZKO A;  1A3T A;  2VNU D;  5KYI A;  1T5E A;  2L0C A;  5C0X J;  2RVL A;  2WAC A;  3QO2 A;  1ET6 A;  5CGK A;  2NVX B;  2J7Z A;  3K57 A;  4CBV A;  4XQQ A;  4OL7 A;  1OXX K;  4PMC A;  2M2L A;  5ELC A;  1RTO A;  2DNC A;  3AU7 A;  1SEB D;  5A35 A;  3K58 A;  5EPK A;  4A3G B;  3KLS X;  4K6L A;  2QEJ C;  2PQE A;  1KTK A;  3NUC A;  1WTQ A;  1HA5 A;  3L9A X;  4KV6 A;  3MA2 B;  2NUC A;  5I9O A;  3SEB A;  1WTX A;  3MFY A;  2B2Y A;  1CK1 A;  2Y0S B;  4OIJ A;  4IAL A;  1OXU A;  2EY2 A;  1JWM D;  2A68 C;  3QOJ A;  3NP8 A;  2VB3 X;  3C3L A;  1EY0 A;  1PDQ A;  2RDH A;  2JYO A;  5DEH A;  5C4X B;  4LAA A;  3A54 A;  1PRT C;  4GZY C;  1D6E C;  5IT9 E;  1TS3 A;  1LT4 D;  3TZU A;  1BCP B;  1KNE A;  3GTG B;  1I4P A;  2BCO A;  4OO1 H;  4KY6 A;  4DF7 A;  4DAV A;  2L9H A;  1KLU D;  2F4I A;  4KK7 A;  2L55 A;  2MPM A;  2JSO A;  1KDC A;  1EIG A;  5KIX A;  3J81 L;  1DD2 A;  3SR1 A;  1Y1V B;  1IHZ A;  5TSS A;  1JC7 A;  5AFW A;  5EPL A;  4DK0 A;  2R61 A;  5JEA H;  1WD0 A;  2DN8 A;  3VR2 A;  2KEE A;  1UNS A;  2PCF B;  4RWS C;  1AEX A;  2PW5 A;  3GV3 A;  2JA8 B;  4KY7 A;  1H9S B;  1Q90 A;  5KEE A;  1Z6H A;  2EOT A;  1X3Q A;  4A93 B;  4HSP A;  1GHJ A;  1TWF B;  3M85 A;  1F2Z A;  1RHP A;  2E2I B;  4MIU A;  4WOR A;  1NR2 A;  3FPU B;  2M00 A;  3T13 A;  2NVT B;  4HR7 B;  3M4O B;  3NBH A;  2O5J C;  4A3I B;  3GP7 A;  2EYL A;  1CHQ D;  5FLX E;  4EGV A;  3BDO A;  1I6V C;  1CQV A;  1DZ1 A;  1EY8 A;  1FYC A;  1F2M A;  3OMC A;  1GXD C;  3VYT A;  5EBD A;  2AWN A;  2O4X A;  2F0Q A;  3L3O C;  3IAY A;  1SAP A;  2K04 A;  2HQE A;  4DU9 A;  4M1U B;  1B50 A;  1EEF D;  1GUT A;  5CV6 A;  3M7N A;  4H44 C;  1QWY A;  1EY6 A;  3PUX A;  1PTO D;  1EQV A;  4HSV A;  4X3S A;  1SYE A;  5JVH 3;  2RDG A;  3KBG A;  1O80 A;  1Z7T A;  3K6O A;  1CQF A;  3H09 A;  3H3V C;  1O7L A;  1QJO A;  2E75 C;  2F0I A;  5C5L A;  2A69 D;  2B2W A;  1KDA A;  4C1N I;  3C46 A;  2MGS A;  1HTP A;  3HP3 A;  1PYW D;  5IOD A;  5EKI A;  4X3U A;  4G57 A;  3MXN A;  2D5D A;  1PZI D;  1M8A A;  2PYK A;  2N88 A;  5C5M A;  1F9S A;  5E4X A;  5JPN C;  1SDF A;  3S14 B;  1KAA A;  2MUY A;  1KAB A;  1B1Z A;  4FYD A;  2K5Q A;  4A3B B;  3T4A C;  4RKL A;  4R8N A;  4B9X A;  2IX0 A;  2AQ2 B;  1SND A;  2X6L A;  5D3D A;  1I6H B;  1ENA A;  1K83 B;  5JOB A;  3NHH A;  2PO4 A;  3H91 A;  4C56 C;  4XTC S;  5M9O A;  1JOK A;  3BYT B;  4XIG S;  1JB3 A;  4L6T B;  3T53 B;  4ZAI A;  5LL6 X;  1LTA D;  1Q12 A;  1QB5 D;  1NAP A;  1PTO B;  3LX0 A;  1X3P A;  5IGB A;  2K1B A;  5KNC A;  1ZXT A;  1FNU A;  2XN9 C;  1VMP A;  2IX3 A;  1HHV A;  1DOK A;  1O7Z A;  2K5D A;  3Q22 A;  1WTR A;  1LTR D;  1I4G A;  3X3M A;  4A3D B;  1H9S A;  2NN6 I;  3PUY A;  2AQ3 B;  1EYA A;  2H4O A;  3NTH A;  4RHR A;  1QOH A;  2K5W A;  1BOS A;  1AZP A;  1TS5 A;  3RMH A;  4IUV A;  2ZXO A;  4FF4 A;  1F2L A;  5EGT A;  3R3O A;  3DUZ A;  2PW7 A;  3U9O A;  4R9W A;  2BA0 A;  4EQO A;  1SYD A;  2EVB A;  3KK7 A;  1ICW A;  3VYR A;  3VYU A;  2FFK B;  2RSN A;  4H13 C;  1NSN S;  2AUK A;  3PUW A;  2B2Y C;  3N6R A;  2F03 A;  1JOO A;  1CA5 A;  4DK1 A;  2F0P A;  4ZKC B;  3M7G A;  1V1O A;  2WP8 J;  5IOC A;  3BG3 A;  1TS2 A;  1PRT F;  1BDO A;  3KUP A;  1A3U A;  2ZXR A;  4N9T A;  1A2U A;  3Q24 A;  4WFN 3;  3EVQ A;  5I4D A;  2B8G A;  2EZV A;  1JE4 A;  2F0M A;  4F8M A;  3OWF A;  2WAQ B;  5BN5 A;  1R9T B;  2K28 A;  3QG1 A;  1ESR A;  3A56 A;  3U9S A;  1DOM A;  2JA6 B;  4KD4 A;  5CV5 A;  4IN3 A;  4ZYS A;  1XX8 A;  4M8A A;  4A3M B;  5M5Y B;  3BVM A;  3P1H A;  3BS1 A;  2JXM B;  5LHY 1;  5D3I B;  4R8I A;  4KHV A;  1E2W A;  2PZW A;  1TS4 A;  2A6H D;  4N9P A;  5I6Y A;  1STH A;  2K33 A;  5IGF A;  2A6E D;  4FNF A;  3Q0A A;  3A7A B;  3KF8 A;  2BE5 C;  3NTI A;  2XVS A;  3GTL B;  4RCO A;  2FMM A;  1X32 A;  4LK1 C;  1B3A A;  2LFN A;  4XYQ A;  1AW7 A;  3SVM A;  1G91 A;  5E1F A;  2MP1 A;  1SYG A;  2CW0 D;  5FO8 B;  5I6W A;  4X3K A;  1F9R A;  4FXK C;  4C3H G;  1YNJ D;  1DON A;  2C5C A;  4PV1 C;  1DXM A;  4XT3 B;  1D5X C;  3AMU A;  1TWG B;  5JPM C;  3TN2 A;  3F2U A;  1VDZ A;  4TKO B;  1QIL A;  4O1N A;  2QKI C;  4C2M B;  4F7X A;  2R7Z B;  2OXP A;  3ND9 A;  1HCZ A;  1EQT A;  1F77 A;  5EKL A;  4FF3 A;  1A6X A;  2L11 A;  1FNV A;  1VMC A;  1S5B D;  1I3Q B;  3S17 B;  3TSS A;  3CRL C;  3ITP A;  1DYQ A;  4HMJ A;  4IUN A;  5M3F B;  4JBW A;  5D14 A;  2EE1 A;  1E2Z A;  4HCS A;  1RJT A;  2BDO A;  1TWC B;  2EY1 A;  2SNS A;  3EFX D;  1TU2 B;  1WTW A;  1XXG A;  2B2W C;  3PIO 3;  2OF1 A;  4NKL A;  3MZ5 A;  3NE5 B;  2E2H B;  3FEW X;  4C3J B;  2A73 B;  1ML0 D;  4JK1 C;  2JEB I;  4IFD I;  2VB2 X;  3IFD A;  4RGT A;  4IUR A;  1CZG A;  5EBC A;  2FJ2 A;  4QUC A;  4NW2 A;  2A5H A;  2HDL A;  3S2D B;  2J4X A;  3K0Y A;  1ENF A;  3GTP B;  2A68 D;  1GJX A;  1PZJ D;  2IW3 A;  5HUR A;  1BCP C;  2F0E A;  3DXJ C;  3WOF A;  3N52 A;  3SK4 A;  4EQN A;  4BBS B;  2LS0 1;  2B39 A;  4K8I A;  4ID6 A;  4XQJ A;  4IUP A;  2F3V A;  1R4P B;  3L7Z C;  2EYM A;  3OMG A;  2KCC A;  4CHT B;  1PZK D;  2KHS A;  1W6K A;  2I46 A;  5F2D A;  3H6M A;  3S1R B;  3FVQ A;  2AWO A;  1A15 A;  5C0X H;  1ZEQ X;  2K7V A;  2XIW A;  3GTJ B;  3CHB D;  2R6G A;  1MI2 A;  1CM9 A;  3K59 A;  2F0T A;  1S5F D;  3FRP B;  3EJI A;  2MHV A;  2HDM A;  4C3I B;  4RAU C;  2JA7 B;  2B2V C;  4HN7 A;  3X3N A;  5IGD A;  1I4R A;  3AB9 A;  2PMZ B;  4Q5V A;  1RCV D;  1O7Y A;  4ABN A;  2HUG A;  5CV9 A;  3PUZ A;  4QF4 A;  3M4Y A;  4DA2 A;  1JWS D;  3SHL A;  4DGZ A;  3O13 A;  1SSO A;  1I50 B;  1DM0 B;  1CT1 D;  3BDL A;  3W2D A;  3V05 A;  4CGY B;  1G8Z D;  3TP5 A;  4F87 A;  5KNB A;  1BNZ A;  1WTP A;  3ERQ A;  4Y7N B;  4FVM A;  4K2K A;  5A2Q L;  1TVX A;  2YYZ A;  1CTM A;  1VF5 C;  1VF7 A;  2EY6 A;  3JAM E;  5JAV A;  1H9R A;  1CI3 M;  4CJ0 B;  4ULL A;  5C6A A;  1S5D D;  4K5W A;  5I9P A;  5KND A;  4ODG A;  3NXW A;  5EPJ A;  2K32 A;  2C9O A;  2B2T C;  1ILP A;  1PMR A;  3DMU A;  2F0J A;  5CR3 A;  4IFD G;  4FF1 A;  3NTK A;  3MTS A;  4MN3 A;  3LWE A;  2EYP A;  2V4D A;  1MD2 D;  1LAB A;  1Q8I A;  3J7Y W;  4CJ2 C;  1GOZ A;  1AP0 A;  3RZD B;  3C1F A;  1WTV A;  3OW7 A;  2WKD A;  2Z1C A;  3D6W A;  3J80 E;  2KEC A;  2F3W A;  3PV0 A;  4C3H B;  3D8G A;  4KN4 C;  3I4N B;  1XWE A;  1YNN C;  5LL6 S;  1TII D;  4CKB A;  4IFD J;  1BUV T;  1CA6 A;  2B2U C;  2E2J B;  4J6H A;  3HOZ B;  4QIW B;  1T5X D;  1AN8 A;  1EY7 A;  2G9H D;  4PMW A;  5IGC A;  1AFP A;  4BA2 I;  4L8J A;  5ELB A;  2J0T D;  3KLR A;  2Q8I B;  3TZD A;  4AYB B;  3RLF A;  4G7Z C;  4FXD A;  5IIF A;  3NK9 A;  1KLG D;  4KI0 A;  4DXG A;  4PQX A;  4ZUI A;  2Q8T A;  4HMI A;  2R92 B;  5JVG 3;  1WTO A;  4IUT A;  1TWA B;  4LJZ C;  4P2C B;  2WB1 B;  1TT2 A;  3LNN A;  4OIK A;  3LWU A;  5EQ0 A;  1EL0 A;  2KUM A;  4QUF A;  4EQP A;  1PTO C;  4RGN A;  4RFB A;  3KLS A;  5IT9 L;  1W6J A;  1M4V A;  2F1M A;  5I2X A;  2KED A;  3C2P A;  2QCP X;  3TP8 A;  1HQR D;  3FDT A;  3K5M A;  3HOV B;  1SE2 A;  3WOE A;  2FMC A;  5T1I A;  4H7B A;  3D3R A;  1K8O A;  4ZQ3 A;  1A2T A;  4K5X A;  2A69 C;  3W3A A;  2KCN A;  3V96 A;  1B2T A;  3SK5 A;  3P20 A;  1LT3 D;  1EOT A;  4DAY A;  1Y8O B;  5DAU A;  1D2B A;  1D1I A;  1RKN A;  2NVY B;  2F0G A;  2FIN B;  1STY A;  2M9V A;  3VA7 A;  2NZ1 D;  3VR4 A;  2WII B;  5COY A;  4DNR B;  1SJH D;  1EWH A;  1F9Q A;  1ET9 A;  5KGU A;  2R93 B;  2K03 A;  3QB3 A;  1Y8N B;  3E0J A;  1D5Z C;  4I65 A;  4Q0F A;  2NTT A;  1KNA A;  2Q8R E;  1FD7 D;  3HGB A;  5C3E B;  4OHJ A;  4ZRZ A;  5M5W B;  5C4J B;  3T16 A;  1Y8P B;  1I4X A;  1HQM C;  3HKZ B;  3J7A V;  1STB A;  1BF4 A;  1IW7 C;  1MSG A;  1U4L A;  1BCP F;  2H1E A;  2RA4 A;  2EYF A;  3PO3 B;  3RZO B;  3E5S A;  5FLX L;  1LTB D;  3I70 A;  5FO7 B;  1JR0 D;  2OT2 A;  5G3L F;  4PMB A;  4ZLT F;  5HGT A;  2ZT9 C;  1JIC A;  1ZYR D;  3PMF A;  1HTL D;  1HUM A;  1UAP A;  3I73 A;  4KJO A;  1Y1W B;  1LV9 A;  4K5V A;  2E2D C;  3K7A B;  3R2T A;  3NQT A;  1PLF A;  4OO1 I;  3GQB A;  1IKM A;  4DFA A;  1II3 A;  2DNE A;  1EY4 A;  4QMG A;  2E74 C;  1WCM B;  4WRD A;  3S15 B;  3DHQ A;  4FP5 D;  3H94 A;  2F0K A;  2F0H A;  3R2I A;  1SNC A;  1NR4 A;  3I8Z A;  5D65 A;  2L12 A;  2WV6 D;  3KBX A;  1H9M A;  5CMD A;  3MXP A;  2B63 B;  5DM7 3;  4BBR B;  2BOS A;  2D2C C;  3D6C A;  3S2H B;  1GUO A;  4NDX A;  2VXW A;  2NYZ D;  3OWE B;  4K6D A;  4A3F B;  1C4Q A;  2B8F A;  1GUG A;  2K01 A;  4FXG C;  1QE6 A;  1FR3 A;  1G29 1;  3HZX A;  2EYO A;  2QIL A;  2L4N A;  1JWU D;  4UDU C;  2RKS A;  4XXE A;  2IT1 A;  3I72 A;  3VA5 A;  2O2L D;  2ZXP A;  3FKI B;  4X3T A;  4H0L C;  3HG9 A;  1E2V A;  1Q1E A;  4EVO A;  4K8J A;  2A74 C;  4UAI A;  1R4Q B;  2IX1 A;  2PNR C;  4J1M A;  5EKK A;  4NMZ A;  2NVQ B;  4RCN A;  1ROD A;  1EYD A;  2XNA C;  4KJN A;  3HS0 C;  3PUV A;  3WDN A;  1STN A;  3J81 E;  2F0U A;  1B9N A;  2RSO A;  3URY A;  3QOL A;  1SMY D;  2NN6 G;  3SE0 A;  3QWN A;  1LT6 D;  1EEI D;  3K5O A;  1TR5 A;  3S1M B;  4B08 A;  2A6E C;  3MWY W;  5FKA C;  1RF2 D;  5J39 A;  1QNU A;  2XSC A;  4LMQ D;  4K2L A;  5CV7 A;  1BO0 A;  1BBX C;  1TY0 A;  2CW0 C;  1LTI D;  1OXS C;  2SNM A;  1LO5 D;  3RUZ A;  2KVM A;  3MVV A;  4RHS A;  3IFT A;  5A2Q E;  4ZK9 B;  4G4K A;  1MSH A;  1B9M A;  2CVR A;  5C4H A;  2DY8 A;  4DNT B;  3FPP A;  5C3X A;  1K8M A;  2D62 A;  1HA6 A;  1JOR A;  4RGM A;  4RH6 A;  4MHE A;  4A3J B;  4CKE A;  3G6J B;  1EU4 A;  1QG7 A;  2PZU A;  1D1K A;  1SYC A;  3SK6 A;  4L63 B;  1QNK A;  1PTO F;  1EY5 A;  3V2T A;  5COR A;  5BN4 A;  4ZUJ A;  4O42 A;  3ZYY X;  2EXZ A;  3OIP A;  4YIJ A;  5JEA G;  2EYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...