5KEEA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92f at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYFYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92F at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5keeA00
2PW5A 2F0QA 1EYAA 5F2DA 1IHZA 4KY5A 2SNSA 2F0TA 3C1FA 4KD3A 5EKLA 4KY6A 4YIJA 4ZUJA 3TP5A 4H7BA 2SOBA 5HURA 2F0JA 1JOKA 4B9WA 5IIFA 3EVQA 4EQNA 2F0UA 5HGTA 4ZUIA 2KHSA 4IUNA 3NHHA 4J6HA 3OMGA 4R8NA 4EQPA 2M00A 5IGDA 2EYFA 5CV6A 2EYLA 2F0LA 2F0DA 1RKNA 2SNMA 5CV4A 3H6MA 3QOLA 1II3A 5CR3A 1SYBA 4E6IA 3RUZA 5C4HA 3HEJA 1F2MA 2EY2A 2F0IA 2PW7A 3SK5A 4F7XA 5DAUA 4WORA 2F0PA 5CC4A 5I6YA 2PYKA 1SYCA 2F0HA 2KQ3A 5ISRA 2NUCA 3ERQA 2ENBA 1KDAA 1A3TA 3TP6A 4NKLA 1SYGA 5EGTA 1EY5A 3T16A 3DMUA 4IALA 1KABA 5J39A 4K2LA 4K6DA 1STHA 2EYJA 1TQOA 1STAA 3OWFA 3P75A 4KY7A 4IZ8A 2LKVA 3NP8A 4HMIA 1EZ8A 3SR1A 4PMBA 2F3WA 4MIUA 3MVVA 2OEOA 3TMEA 2RBMA 3E5SA 4KD4A 5CV7A 1A3UA 3D6CA 3SXHA 5C5MA 4EVOA 1JORA 2EY5A 4K14A 1A2TA 2F0EA 3OSOA 4F8MA 5IGBA 2PZWA 5K5PA 1A3VA 5NUCA 5KGUA 4K8JA 4NP5A 5JOBA 1SYDA 1A2UA 4DFAA 5C3XA 2PZUA 1TR5A 4NDXA 1AEXA 2F0WA 1EY8A 1F2ZA 2WACA 3HZXA 1NSNS 4J1MA 4KJOA 4K2KA 3V2TA 4N9PA 4DF7A 5DEHA 3T13A 3NQTA 1EY6A 4KTAA 2PZTA 3MXPA 2EY1A 4HMJA 3D8GA 4ID6A 3TP7A 4EQOA 5I9PA 1STGA 1EQVA 1SYEA 1SYFA 2RDFA 2EYMA 1EY0A 3D4DA 3R3OA 4KHVA 5C5LA 3VA5A 1EYDA 4K8IA 4PMCA 3SK4A 1SNDA 2EXZA 3MHBA 3MEHA 3SK8A 5KYIA 1TT2A 4HTHA 5C6AA 2QDBA 2OF1A 3MZ5A 5C4ZA 5C3WA 2EYHA 3ITPA 4NMZA 5CGKA 4K5XA 5CV8A 5E1FA 4TRDA 4OL7A 1ENAA 5I9OA 2O4XA 4ODGA 3TP8A 3DHQA 1SNCA 1STBA 4S3SA 5CV5A 5KEEA 5KIXA 3PMFA 2F0KA 5JAVA 4G57A 3OMCA 1EZ6A 1JOOA 1EY9A 3QB3A 4I65A 2EY6A 4QB4A 5KYLA 4B9XA 5J1ZA 5IGGA 3NUCA 5EKKA 5KRUA 3P1HA 4K5WA 4KV6A 1KDBA 2F0OA 4QF4A 1SNOA 5M9OA 1SNMA 4N9TA 2F0VA 4LAAA 5IGEA 1EY4A 2PQEA 2RKSA 4DU9A 3BDCA 3EROA 4PNYA 3S9WA 2F0FA 1JOQA 4DGZA 3D4WA 2EYOA 3SHLA 2F0MA 1ENCA 2F0SA 3NK9A 5IODA 1EYCA 1STYA 3BDLA 3EJIA 5E3FA 5J22A 3NXWA 1F2YA 4QMGA 1NUCA 5IGFA 4K5VA 1SNPA 5I6WA 1STNA 1KDCA 1U9RA 4RKLA 4RKBA 3QOJA 5IOCA 4KJNA 3LX0A 2F3VA 1EY7A 2F0NA 2HQEA 2OXPA 4ME5A 5CV9A 3SK6A 3C1EA 3U9OA 1SNQA 4ZQ3A 4WRDA 2F0GA 5IGCA 1KAAA 2EYPA
chains in the Genus database with same CATH superfamily
4Y7NB 5EPJA 3IKJA 2UUAL 1F2LA 3I4NH 4KD3A 5HURA 2Q8RE 1E7ZA 1EU3A 2L0CA 3DXJC 1VQFA 4LK1C 3PIO3 3RLOA 1CT1D 2B2TC 1IW7D 4FDBA 2I46A 1PH4A 1MHWC 4FYDA 3PIP3 3CXCA 4YY3L 2EY2A 1BQQT 2EOTA 3U4VA 4LF9Q 4NXML 1PRTD 3I8ZA 2OTJA 4TKOB 5LMUQ 4IJLA 2DY8A 2B8FA 2B63B 3S24A 1ONLA 2ZXOA 1STHA 4K2LA 4BY1G 2NVXH 2JSOA 2VL6A 1PH5A 2RDHA 2NYZD 4GLVB 2JA8B 1XYIA 1EEID 1Y69U 1DGSA 2B2YC 4A3KB 4K14A 1X9NA 4A75A 4OX9L 3FKIB 2A74C 5JJZA 4YWMA 4DXFA 2PZUA 2VB2X 3BU2A 1ZYRD 3HOYG 3JC66 5ELOA 2A6EC 4J1MA 1EWHA 2C5CA 2F4VL 1QG7A 4GN3B 3CCVA 1HNWQ 4IFDJ 5KNBA 2VNUD 1GKHA 2K33A 3E9HA 2EJFC 1B2TA 2HT1A 2OQ0A 1M4VA 4P72A 1K8GA 2AQ2B 4MHEA 4HIOA 4DKAC 4OGQC 4Q0FA 5EKKA 5KRUA 2LXKA 4B3SL 2DNCA 4PV1C 1RD9D 2RKSA 1V9PA 1HTLD 4A3BG 3Q23A 1WI5A 3KYHC 1YNJD 5BN4A 4LUZA 1CK1A 1EOVA 1K9MC 1VQCA 4CKCA 2PPBC 1D1IA 4POFA 2RF4A 2J4XA 4WRDA 1GUSA 5D14A 2DUDA 3T51B 3L7ZC 3AQQA 1LT6D 2R7ZB 1STEA 1LACA 2KUMA 3C1FA 1PZID 4A3FB 1C7YA 1HR0L 4BY1H 4A3MB 2UXBL 2KCCA 4QIWB 2RVLA 2N3SA 4RCOA 3KOJA 1D5MC 1E2ZA 1VQMA 4IUQA 1PZJD 1GUTA 1LTSD 5IYCG 5JPMC 2XRQD 5JJLA 3MXGA 1KHIA 4HIMA 4X6AH 1JB3A 1XX8A 2B2UC 2B3GA 2ICIA 3VYTA 2YTVA 5J39A 4KKTA 3OIPA 2FMCA 3BG3A 4QUCA 2RSOA 3OHXC 5LL6S 2MGSA 3SR1A 2CKZB 2UXCQ 4G7OC 2OEOA 4OIKA 2M2LA 4UP9A 1JWMD 3K7UC 1GM5A 4F8MA 3HOUG 2K7VA 5FO8B 3S16B 4K8JA 1HR0W 2NVYH 3TZUA 4DR6Q 4A3EG 1B8AA 1IW7C 2X6LA 1KQSA 1JR0D 1A62A 2BA1A 3F2CA 4KTAA 2HHHQ 2A6ED 5JVG3 5C5LA 2LMCB 1LM0A 4K8IA 3SK4A 5FLXc 1MSGA 1SNDA 4BBSG 4R4TA 1HA5A 4BS9A 2L9HA 3CAMA 3HOZG 4DV2Q 1JT8A 1TWCH 4ODGA 3K81C 4ZCKA 5DNFA 2E2IB 4HJ7A 3WOEA 5KIXA 2DNEA 3S1NH 1Y8OB 3NUCA 1HNXL 4FXDA 1E1OA 1NY4A 3NBIA 1EOTA 4C1NK 4LF7Q 4H13C 1VQ5A 1VQNA 1VF5C 2NVTB 4NB3A 4DNRB 5A35A 1W6KA 3BS1A 5EAYA 4AYBB 2R7DA 4I7ZC 4CBVA 4GOPA 3EJIA 1C0AA 3S1QB 3S1MH 5D65A 4C3JG 4O42A 2K28A 2YV5A 3CRKC 1SNPA 1TS2A 1STNA 5I6WA 4C3JB 1K8AC 2WFWA 2PMZE 2PO4A 1N33Q 2ZT9C 3SE0A 4XYOA 2Y0SG 4ZAIA 1G2TA 3BDOA 3EFXD 1YI2A 4C3JH 4O1NA 2HD3A 4IURA 3A8IE 4IFDG 4G7HC 1I6HH 3AEVA 1ILPA 2WAQB 1XWEA 1VS0A 4ZYSA 3DM1A 4DR4Q 1DOMA 1AZPA 4BBRH 4DA2A 2FJ2A 2L4NA 4HCEA 1SLJA 3ERQA 4BXXH 4AYBE 4GNXC 1YJWA 2XSCA 2R7FA 4KY7A 3SDZA 2JA6G 1WCMG 2QF7A 1I6VC 1E2WA 2AUJD 2WINB 1I4XA 1SSOA 4A3EH 3GTMH 1OXUA 4HSVA 1QZGA 4DV6L 1HTPA 1IXRA 3HOUH 3KK7A 4DV1L 5IWAL 4RAUC 3A54A 3HZXA 4HJ8A 3V2TA 1DD2A 1I94L 4DR3L 1QJOA 3DWPA 3IRBA 1BF4A 1HRJA 3MXNA 1B44D 1QILA 1EQVA 1SYEA 1SYFA 1T5XD 3S14B 3VA5A 3NWTA 3I4MG 2EXZA 3I73A 4A3DH 2LS01 2VUMH 1L0YB 1LO5D 1LTTD 4IUPA 3DEPA 4JYAQ 1RODA 1UNSA 3VYSA 3PMFA 4DV5Q 2DJGC 3KF6B 5KYLA 3NBHB 4JI5Q 3J80c 5CMDA 4XTCS 2VUMG 4ZLTF 4A3DG 3GDEA 1VQDA 2K14A 3EQLC 2ALYB 3VR3A 2EYOA 2IX0A 2CQAA 1RJTA 5IODA 1G6ZA 5J22A 4CGYB 4M1UB 2D0PA 4BY7G 2VQFQ 3I2ZA 5D3IB 5GAGC 4ZK9B 4ALPA 3S16H 2F3VA 4R4IA 4A3IH 1HFGA 1VQBA 1SJHD 4A93G 4OWXB 4DV1Q 2F3IA 1B4OA 2CWAA 3A74A 1UAPA 3W2DA 2HHHL 4X3TA 1WCMH 2CHBD 4JI8Q 2JA6H 5M5WB 3CD6A 4A3BH 3CRLC 3M3YH 4DNTB 4R8NA 2M00A 1YJNA 1EU4A 4GLAC 4KN4C 4DR4L 2Q2IA 1RKNA 3V96A 1FR3A 3AFQA 2F0IA 1PTOH 4WORA 1BR9A 5IT9c 4CJ1B 3PO3G 3MFYA 1SRUA 1D1KA 1I6HB 4BY1B 2VXWA 1VQPA 1Y8PB 3G7LA 4IFDH 2Q8TA 1B9MA 4IZ8A 5C3EB 3G71A 1D2BA 2ID0A 2BA0A 2QGQA 2B2YA 4MN3A 2F4IA 3HOYH 1PRTF 1T9HA 2N55A 3KF8A 4LUOA 2AKWB 3TREA 3H0GB 5IWAQ 1O78A 4G7ZC 2KEDA 5K36H 4LFBQ 4N8FA 1E0BA 5I2YA 1NAPA 4N9PA 4UAIA 2MNAA 3MXUA 2NVTH 2PQAA 5J3BA 3HP3A 1PV4A 1VQ4A 4PMCA 4DV4Q 4RGOS 5E7NA 4YCWA 2BDNA 2QDBA 1IL2A 3S1NB 3ITPA 4XT3B 1VQKA 1ILQA 5HGQA 1ENAA 2E74C 1N32Q 1ET9A 4DAVA 1L2FA 1VQIA 3OMCA 2VW9A 2ZTEA 3UE1A 4B3ML 4A3CG 3J7AF 4OONA 1V43A 2Y0SE 3HOZH 4A3LH 1SMYD 1VQJA 2JYOA 3L3OC 3BDCA 2H1EA 1JOQA 2F0FA 1GHJA 4C3IG 4HJ9A 2NZ1D 1XMOL 1X3GA 3NXWA 3W1BA 1YZ6A 1I5FA 4DV6Q 1PHJA 5FOBB 3BYYB 4J8QA 3SK6A 3T1YQ 2Q2UA 1HZBA 2VQEL 3PQIA 4C3HB 5I9PA 4TSSA 1K3BC 2PW5A 4WFN3 2F0QA 4GZYC 3D4RA 4HIDA 1UEAB 1U4RA 3K5OA 4KY6A 4YIJA 2IPKD 4H7BA 4A3MG 3MWYW 1IBLQ 3MA2B 1V8QA 2UXBQ 1PRTC 2B2VC 1I4PA 1WYDA 1S40A 1CA6A 3KJOA 3S2DB 1AN8A 5HY6A 1PMRA 1IBKL 2JA9A 4Z9CB 1Z47A 5KNCA 2JA5H 3K5NA 2G9DA 2XWJB 3STBC 2B2UA 1SYCA 4P2CB 1LTRD 2ZJPA 1TVXA 2M9VA 3WWVA 2RA4A 1HNZL 3RD4A 1JICA 2QEJC 5C3EG 1BNZA 4JV5L 3V05A 3M4OB 4LNQA 4B3RL 4R9WA 3NBHA 1XNQQ 3GTQH 4L5QA 1QVCA 3VR4A 5C5MA 1AZQA 2ZM6L 2I5HA 2YYZA 2NZHA 1SYDA 3J81c 1HFNA 3TZDA 1K28A 4Q5VA 1ZKOA 1PYSB 1NSNS 3FPPA 5A2QL 4HN7A 5A2QE 1HUMA 1QUQA 4CHTB 2K75A 1KNAA 4JI8L 1VQ6A 3MTSA 3TP7A 4BBSB 3DWQA 4YWKA 4I7AA 3NQIA 3GTOH 3PO2G 1TWGB 3E9IA 3FVQA 3MZ5A 1OXTA 2OF1A 4A3JB 1U4LA 1XPRA 2CW0D 1UUPA 4RFBA 4K5XA 5CV8A 1N32L 2MUYA 1SAPA 2L15A 4MZ9A 2CH4A 1N34L 1QVFA 2NVYB 1CKMA 4A3KG 2F0KA 4RH6A 4CDEC 3VR2A 2Q8IB 1L0WA 4CDCC 4JI4L 4F88A 3QJYA 5I2XA 3PUZA 3M4PA 2K4KA 4DU9A 2O5IC 1H9MA 4F87A 3A56A 5IP9H 3CKIB 2F0MA 2CQOA 1D6EC 1WVLA 4DPGA 4BY7B 3T1YL 3TS2A 5CORA 5ELNA 1G291 1J5EQ 2RDFA 4ILWA 3HKZE 3U58A 1SXTA 1TY2A 2QKIC 4EQ5A 1SROA 2NVXB 3AFPA 3K80C 1CQVA 2QW7A 5CV6A 4FF1A 2F0LA 3M4QA 3H0GH 3H6MA 2PQAB 1Y1WH 5FKAC 1H9JA 1CZGA 1QNUA 4DR2L 3SK5A 1YJ9A 1PYWD 2F0PA 3FEWX 5M5YH 2F0HA 2DGYA 2RQXA 1C48A 2LFNA 3PO3B 1FD7D 5M5WH 1TS3A 3CCMA 4ME3A 3I7FA 3P75A 1AW7A 2Q2TA 1XNQL 3KFUA 2E75C 5ELFA 1YHBA 2K5HA 1BCPF 4WJ3M 4NP5A 5C3XA 1A2UA 2B8GA 5KNDA 2K5QA 2R7ZG 5E4XA 3BYTB 3J81L 3J81E 2JA8H 2ATWA 5FLMH 1TWFB 1G8ZD 2WAQE 2PZTA 5GAEC 4EQOA 2YTXA 2G9HD 1SR3A 1H9SB 3MEHA 1FGBD 1IBKQ 3KLRA 3IFDA 3HOWG 1XTDA 4TRDA 1P16A 1K3RA 4K0KQ 3VA7A 2CVRA 5KEEA 2PI2E 2JA7G 1ENFA 4IUTA 3SEBA 2A69C 5IT9L 5IT9E 2X6GA 5JJIA 4K5WA 1W2BA 1NCVA 4X65L 2LSSA 3D0FA 1KDBA 1HNZQ 2XVSA 4B3SQ 4A3FG 5IY0A 1IBMQ 4B3RQ 1F77A 1I3QH 2VQFL 4GNXB 1NUCA 1SDFA 3A8JE 1FGUA 2MPMA 3O13A 1YHAA 2HQEA 2F0NA 3PUYA 2DJFC 2F0GA 3KUPA 2JQOA 1IHZA 1SEBD 4B9WA 4FO2A 3URYA 1GO3E 5HGTA 1EEFD 3G6JB 2B63G 4OWWB 2CWPA 3DM3A 1XPUA 1HZCA 3QIAA 3QOLA 5CR3A 2MP1A 2A19A 1PTOC 3J7ZC 2B2WA 2I0QA 1F2MA 2PW7A 4DR1Q 2D5DA 4WJ4A 1G91A 3J80E 3J80L 3BVGA 3C46A 5M3FH 1EQTA 3WOFA 4NKLA 4CJ0B 3GTKH 1KD1C 5M3FB 2LKVA 2Z6KA 1UEBA 3GTKB 1YNND 3Q24A 3LGJA 3D6CA 1XJVA 5G3LD 1BCPC 1PZKD 1Y1VB 1A2TA 1Y14B 2KBNA 4BBRB 1A3VA 2QILA 4LFBL 1CHQD 3NTKA 3Q0AA 4QGUA 4K2KA 2HCIA 1KNEA 1TWGH 2MQHA 1EY6A 1PFBA 1K0RA 4GKKQ 1HH2P 4GKJQ 5C6AA 4V0BA 1EWIA 1JJGA 4RHRA 4L6TB 1TKWB 4DV3L 4NMZA 4OIJA 5C4XG 1C8CA 2J7ZA 2O4XA 1VQ9A 2UXDQ 3I4OA 1YVCA 3GV6A 3CCRA 1IYVA 4R4QA 5J1ZA 4YWLA 4A3GG 1B50A 1NR2A 5IP7H 2YU9H 5L37A 1EY4A 4PQXA 1TIID 4WJWA 3MC0B 1I4HA 3SHLA 1AH9A 3I55A 1C4QA 2Z6KC 5C44H 4N8X1 5ELBA 1XTCD 2JA5B 2E2IH 4KJNA 3KDFB 1PTOB 2D0OA 5CV9A 4OELB 3C2PA 1NBWA 4KHPL 3FRPB 5IGCA 1JE5A 3S2DH 2ZJQA 2NN6H 3AYHB 1EYGA 4LMQD 3K7AB 1JOKA 3NWSA 1G6PA 2AHOB 2EJMA 5DLQE 1B3QA 3M9BA 1PA6A 3PO2B 5IGDA 1YIJA 1VMPA 3HOXG 2R92H 3U9SA 4HEDA 3CC4A 4HJAA 3A5ZB 3HEJA 3H91A 3CPFA 2R93G 1WTPA 2PNHA 3J80i 4H0LC 3HGBA 4MNOA 1S5BD 4IALA 1E22A 1WTOA 3CW2C 2ZTDA 1VDZA 1JE4A 2DN8A 3OYYA 2KHJA 2NTSA 2F3WA 5AJ3L 4MIUA 4KKSA 4KD4A 2ZM6Q 3RZOH 1A3UA 3NELA 4GN4B 3CCUA 2PZWA 5M5YB 4OX9Q 1A8VA 5IYBG 2AQ1B 1PLFA 1EY8A 2ASBA 2HDLA 4A3JH 3IFTA 2L5TA 5C0XG 1QZHA 1I94Q 5M3MH 1JCKB 2EY1A 3A55A 3D8GA 1STGA 3ULJA 2EYMA 1EY0A 3S14H 4JBJA 1HNWL 2K6AA 3E0EA 4FF2A 1B53A 3S17H 5C4ZA 1LABA 2IJ0A 4QL5A 3CU7A 3HOXB 1BUVT 4XIGS 5E1FA 2SDFA 4J15A 4PZ8A 4LFAQ 4DR5L 4YY3Q 1UE1A 5EJWA 1STBA 2SEBD 3HOUB 3OOCA 1V1QA 4QCLA 2Z1CA 3FKIG 2A8VA 4I65A 3RZOB 2EY6A 2JEAI 3MXNB 3CC7A 5GQOA 4C2MB 2MFIA 3HOVH 2B2WC 2WKDA 1SN8A 1WTXA 3CHBD 4RG1A 4YHHL 1ENCA 4OO1G 2A68D 1I4GA 1STYA 1B70B 1DXMA 3CCSA 4PZ6A 1ICWA 4OWTB 1A15A 4RKBA 1B9NA 3EIVA 3A0JA 3R93A 3T4AC 3CF5A 4UDUC 1LTID 3PF5A 1PFNA 2H4OA 3KBXA 1L1OA 3NENA 3I70A 4KY5A 3L0OA 1BBUA 1EL0A 2K04A 5EPLA 2BDOA 3VR5A 1J9OA 4LWCA 3M7NA 1CZWA 1HR0Q 2QCPX 4O0AA 5CYUA 2MO0A 3I4NB 1LTLA 1J8IA 2EYFA 1RDPD 2EYLA 2F0DA 4M8AA 1N8RC 2XNAC 1WTVA 4HJ5A 4DR2Q 1VCIA 3K5LA 1JWUD 2D9UA 2O2LD 4UHVA 2C9OA 4C3HG 5FJ8H 1RIPA 2CFMA 2FMMA 5IYDG 5COYA 4U673 1ESFA 4L8JA 1CUKA 3L2PA 1N9WA 1SFOB 2JK8A 3I4LA 3SXHA 1LTBD 5LL6X 1ET6A 3OSOA 1DCZA 4DAYB 5K5PA 5NUCA 4XQNA 3R8BA 2A5HA 4EGVA 2CW0C 1OXSC 3W5OA 2XRSD 1Z6HA 2F0WA 3GP7A 5T1IA 4XXEA 3F2UA 1FVIA 1EIYB 3VYRA 3N52A 1GUGA 1BO0A 1DZ1A 4HMJA 4JOIA 2L11A 1BCPB 1BDOA 2Z0SA 3R3OA 1JQYD 1M8AA 4RMFA 3SK8A 5BR8Q 2OTLA 4H02A 1H95A 5JEAG 4L5SA 3S1RH 4DV0Q 1X3QA 1XMQL 2R93H 4QIWE 4C56C 3NPPA 1SE3A 2RCFA 3PUVA 1AFPA 1GUOA 2JN4A 1LT3D 1H9RA 1KRTA 2XTIA 3J7AV 3S1RB 1I50B 1I4RA 2B39A 1X3FA 4P73A 2VZAA 4QF4A 2FFKB 1WTHA 2EDGA 2E8GA 1Q82C 4LF7L 1KLGD 3CQZH 4JI1Q 1HJPA 3D4WA 3CCLA 1DOLA 1EYCA 3NEMA 3BDLA 2E2HH 3I90A 3AU7A 1OXVA 2KHIA 2V4DA 1H9KA 3QOJA 2OXPA 3H09A 3K6OA 3DEOA 3E6ZX 4ZQ3A 4UP8A 3NSWA 4ZKBB 5GADC 1N33L 3KF6A 1QOHA 4LFCL 1XXGA 1Q1EA 3K8AA 1GD7A 2Q2HA 4X66L 2DY7A 2KCMA 1PRTB 3RMHA 3UDFA 2AMCB 2XIWA 1PH7A 2F0UA 3PUWA 4ZUIA 2B2TA 3CPWA 2KHSA 4XYQA 5IYDH 3M7GA 1A0IA 2R61A 4DV2L 1BOSA 5BR8L 1C9OA 4DV7Q 1K8MA 3HKZG 4DR5Q 4OHJA 2D62A 4HIKA 1Q1BA 4GOPC 3RUZA 5C4HA 4LF9L 4NXMQ 1Y1VH 1G51A 1YBYA 3HOYB 2LY7A 5BN3A 5I6YA 3T56B 4DV5L 5ISRA 1IKMA 3IL8A 1DYQA 1KDAA 1I3QB 3W3AA 3CC2A 3MEFA 3S17B 3TDQA 1X65A 3OWFA 2K01A 1VQEA 4JCVE 5C4JH 3PIPA 4BA1I 1TXYA 5ELDA 4OXPA 2HDMA 2WAQG 3TMEA 1L0XB 4DUZL 1AP0A 1HPCA 3RR5A 5IGBA 2A6HC 3GTGB 4LF4Q 2N49A 2WB1G 4NDXA 3JAMi 5DEHA 3T13A 2NTTA 4JI3L 3S15B 4DAMA 4UY8C 4FF4A 4KHVA 4B3TL 1Q8IA 1X6OA 4A3BB 3LNNA 2A6HD 2RCNA 4HAEA 1SE2A 2E2DC 4GLXA 3PSIA 5CGKA 3HKZB 3KJPA 3HS0C 3L9AX 4OL7A 3GTJH 1VQLA 2I07B 4V190 4S3SA 1S5CD 4Y7NH 1FJGQ 4G57A 3EBEA 1EY9A 1Z7TA 1MSHA 4XT1B 1S3OA 2I5MX 1HQRD 1SNOA 1HCZA 2RHQB 4DNIA 4JI1L 3PV0A 1HHVA 1EIHA 1QNKA 5M3MG 2HCCA 3S15H 1GUNA 3EA6A 5C0XH 1EFWA 1O7LA 1UE6A 4GNXA 4JVZA 5C0XI 2N78A 5IYBH 1MKHA 4X3SA 3I72A 1IL8A 3U9OA 1L1OB 3QB3A 4LF4L 2EYPA 4X66Q 3GTLH 1J5EL 4IQZA 2IWHA 3F2DA 3ICEA 3TEHB 5JEAJ 4ZUJA 1RCVD 2E2HB 3BZDB 4JI3Q 1LT4D 1QCBD 3ULLA 4DUYL 4IUNA 4J6HA 3NHHA 1S4ZA 1S5DD 2GN5A 1BBXC 1ML0D 3B6YA 1PYBA 4JYAL 4YCVA 1I50H 4A93B 1NE3A 1QUQB 3MFGA 1HZ9A 3H15A 3A5UA 2XGTA 2IW3A 4A3EB 2Y0SB 4HSPA 3GTMB 4X3UA 2E5LL 1FJGL 2R92G 3A7LA 1QVGA 1BCPD 2EZVA 1O80A 5TSSA 1YEZA 1HNXQ 1Q81C 2RSNA 3T16A 1WTQA 2EPBA 2EQSA 5CBAE 3OIQA 1Q12A 4AQYL 3NP8A 3OTOL 3PIOA 3G4SA 3DWAA 2A1AA 5FLMG 3VYUA 3DUZA 1XNRQ 4EVOA 4LW1A 2EY5A 1PH2A 2KJXA 4DFAA 3M85A 4LFCQ 2E2JH 2JA7B 2NN6I 2I5LX 1DM0B 2WACA 2QA4A 1JC7A 4JI7L 3Q8DA 5ELEA 2VUMB 3MXPA 5JAVA 1X32A 5EKIA 4C3IB 5M5XB 3H3VI 1KXLA 3KLWA 2UUBQ 3MHBA 2B2VA 4DV7L 1GXDC 5IP7G 4DV4L 3ND8A 1TWAB 1OTCA 1ESRA 3I91A 1P8LA 2RHSB 3HRZC 2IHFA 1Y1VG 4K0KL 1TWAH 1X3EA 5C4XH 2CCZA 4GOPB 1F9SA 3H0GG 3GTPH 3VDYA 3P1HA 1X55A 4KV6A 4IO9A 2KA7A 3BZKA 1PH8A 2WV6D 1VQAA 2G5DA 4JC0A 4YHHQ 4DR7Q 3SVMA 2HQLA 1KLUD 4FNFA 4KI0A 5IGFA 3OWEB 3D6WA 1XNRL 5FO9B 1R9TB 2WB1B 4BWGB 5C4XB 1MJCA 3BZCA 3ULPA 3A7AB 3S2HH 1D5XC 2Z4HA 3TP5A 1PDQA 2NBFA 1Q8KA 3S1MB 1KL9A 3UDGA 3K5MA 3CMEA 1KAWA 1K83H 4EQPA 3HOVB 5C0XJ 2SNMA 4L5RC 1K73C 4POGA 2EXDA 1VQOA 3GTPB 2MHVA 4MTKA 4NXNL 4CDFC 4A3KH 2AWNA 3GTQB 1U0LA 5LMNW 5LMUL 3IAYA 2NUCA 3FMCA 5JEAH 2WB1E 3TP6A 2LXJA 3S1QH 4JBKA 4FXGC 2B63H 1KABA 1E1TA 1TQOA 1MBYA 1STAA 2KECA 3OTOQ 1WD0A 2K5VA 2BOSA 4HMIA 2C35B 1D8LA 1S5ED 3PGZA 4JV5Q 3Q22A 3I4MB 3W1GA 3E5SA 4CDDC 2ZTCA 1JORA 2KCTA 3BJUA 1U4PA 1GUWA 1E3PA 2NVQB 4Y52H 2F03A 2O5JC 2TMPA 4DR3Q 3G48A 4IPCA 1MD2D 1RL2A 2R3ZA 1IBLL 1SE8A 3BVMA 4DUYQ 5C3EH 1H9SA 2Z8LA 3R2TA 3TRZA 1AE3A 2PMZB 3K0XA 4HTHA 5JJKA 1ASZA 2XN9C 1Q90A 5FJ8G 2OQKA 4C3HH 1N36Q 3QG1A 2KOLA 2BH2A 2JA5G 2K32A 4GS3A 1PTOF 4DAYA 3RLNA 3GTLB 2A68C 4FVMA 1N34Q 4NXNQ 1Z9FA 4HCSA 2QDLA 4YCUA 2HIXA 1CI3M 3A8KE 3U4ZA 4DR7L 4AQYQ 3X3MA 1DJRD 4DN4M 1S72A 3KDFA 3EN2A 1OXXK 5FK9C 4A3MH 3K7AH 3E3XA 1IYUA 1F9PA 1PTOD 2FHTA 1KRSA 1NJIC 3F1ZA 2R7ZH 2L55A 4CKBA 4JI6Q 4NPSA 4ME5A 2UU9L 2YTYA 3C1EA 1JJ2A 1IYJB 4X62Q 2IX1A 2JE6I 4KHPQ 1V1PB 1EYAA 1YITA 1LTGD 5CBEE 1WTWA 3TSSA 1D7QA 3QO2A 1BVSA 2EJGC 2J0TD 3EVQA 1TWHH 4X3KA 1U5KA 2TSSA 2Z9HA 1KIXA 4A3LG 4LF6Q 2Z4IA 1UE7A 4A3CH 3TBIB 3FKIH 1CTMA 5JVH3 1E2VA 2IL8A 5DAUA 4JI5L 1UWVA 2PNRC 3K59A 5CC4A 1FL0A 4JI4Q 2ENBA 1HUNA 4B3MQ 1NMGA 4X65Q 1PH1A 4IUVA 3J81i 1SBBB 3KF8B 3M4YA 4RGMA 4JI0Q 1NNXA 1ZEQX 2B29A 4LUVA 5ELCA 4PMBA 2P5ZX 1W6JA 3TQYA 5LHY1 4QUFA 5K36G 4FXKC 1CFMA 1QE6A 4O2DA 1CA5A 2E76C 5KGUA 3J7YW 4JBWA 5JOBA 3T1HQ 1ICFB 4U68A 1TR5A 1Q7YC 4NW2A 3ERSX 4G4KA 4DK3C 1MIUA 2L12A 4DF7A 4A3DB 1LTAD 2NB0A 3CQZB 5EBDA 1D5ZC 2K03A 1EIGA 1GVPA 3N6RA 2ZJRA 5C4JB 3M4OH 3NE5B 1LLRD 1J6QA 5LMNQ 1KC8C 4IOAA 3QWNA 1UE5A 2NWGA 1ZYRC 1PH6A 3PO3H 1YNXA 2EVBA 4LF6L 2JP1A 3LWUA 4IPDA 2WIIB 1F9QA 4TVAB 2UUCQ 5CV5A 3MAQA 3PCOB 1EZ6A 1JOOA 2EE1A 4QB4A 3HFZB 1WD1A 2FXQA 1F9RA 5EBCA 2Z6BA 3RZDB 1Q46A 2PI2A 5E4WC 2F52A 3CP0A 1KTKA 3QR8A 2EIFA 2PQEA 1Y8NB 4IUUA 2RDGA 4DGZA 1TS4A 1CKNA 5JPNC 4ABNA 4QMGA 1WTRA 1IZ6A 1TU2B 1KDCA 2UU9Q 4LF5L 4R8IA 2A73B 3GTGH 4JG2A 1PFMA 2K5DA 4HR7B 2GVBA 3FP9A 1KAAA 1RF2D 1MGSA 4JI2L 4BY7H 5C44G 3CCQA 4A3GB 1MJEA 2SOBA 4X64L 1DONA 3C3LA 1DOKA 2JXMB 3HKSA 1N36L 4A3GH 1O7ZA 2NVQH 2ZXRA 5EQ0A 1II3A 3HOZB 2BE5C 2OWOA 5T1GA 2IX3A 1JWSD 4OO1I 4RHSA 4F7XA 2UUCL 4DR1L 4R4CA 3T53B 1BBWA 3ONAB 4QQBX 2X69A 1SYGA 1VMCA 3I4MH 2KENA 4IPGA 4RGNA 1IBML 2BE5D 2EYJA 2K5WA 4JW0A 1FNUA 1EZ8A 4MTNA 1YHQA 3D3RA 2CH4W 4DK6C 3CCJA 4LF8Q 1GHKA 4JBMA 2VQEQ 1LUZA 1HQMC 4X62L 3K58A 4DK1A 1AEXA 2MO1A 3F8TA 4KJOA 4P75A 1EIFA 1MI2A 4PZ7A 3ER0A 4JI2Q 4A4IA 3H3VH 4OO1H 4C3IH 5M9OA 5M5XH 3S9WA 1JB7A 1GJXA 2A69D 5I4DA 4K6LA 1V1PA 3HOVG 3GD7A 5KYIA 1VQHA 3NTHA 4RWSC 4TQUS 5M3FG 5FO7B 2FINB 4DV0L 3R2IA 3ND9A 4A76A 3DHQA 1R9TH 1CHPD 2KVMA 4C1NI 1SMXA 3TN2A 1PFSA 4BBRG 4IJHA 2HIVA 1PH3A 3LWEA 2OCEA 4QY7A 4JK1C 3KLSA 2F0VA 4LAAA 5IGEA 3CCEA 2IY5B 1SE4A 1NMFA 1VQ7A 1VQGA 1TWFH 2AQ3B 3NK9A 3RLFA 4APVA 3HOWB 5E3FA 5D3DA 4A3JG 4C2MH 4LF5Q 3RNUA 3I3CA 3SGIA 1BXTA 3KBGA 3AB9A 3STBD 2JJQA 4LF8L 1TWCB 2F1MA 3VR6A 5EPKA 1WJJA 1QB5D 4IFDI 2K1BA 2SNSA 2R6GA 3FPUB 4X64Q 3G6EA 1AE2A 5IIFA 2L1BA 2VB3X 4EQNA 1M1KC 4BA2I 4UPAA 4A3FH 5LMNL 3J7A5 1RTOA 1VQ8A 1PVOA 2BCOA 1EQQA 2WKCA 1LT5D 5CV4A 5M3MB 1B1ZA 2VS1A 3BVZA 4P71A 1O7YA 2UXDL 5GAHC 3KLSX 3S2HB 4LFAL 4QJFA 1FNVA 1B3AA 5G3LF 1I4QA 4FF3A 1YNNC 1L1OC 3HOXH 3HOWH 5DM63 1A3TA 2AWOA 3CMAA 4H44C 1EY5A 3GTOB 1T5EA 3JAML 3JAME 1TY0A 1ASYA 1FYCA 3UDIA 4EX5A 3Q6SA 3RZDH 2NN6G 3OPOA 2JA8G 2RBMA 5IE8A 2GVAA 4DUZQ 4A3IB 2F0EA 1G2SA 4A93H 2N8NA 4A3IG 3GTJB 3OW7A 3PUXA 1A63A 2KEEA 1F2ZA 3D31A 4DR6L 2WP8J 2R92B 1CM9A 1M90C 3H94A 1K0SA 1X3PA 3TS0A 1K83B 4XDXA 1EYDA 4B3TQ 1S5FD 1TT2A 1E24A 4RA8A 5C3WA 5FLXE 5FLXL 2EYHA 3GV3A 4DK0A 2GA4B 1W3SA 3ZJYC 2IHEA 1SNCA 4KKUA 5AFWA 5IYCH 1SJED 2ICEC 3K0YA 4IN3A 1U4MA 1SMYC 4GN5A 1Y1WG 1OO9B 4B9XA 3P20A 4DXGA 1Y1WB 4KHZA 4DAPA 2F0OA 1SNMA 1IKLA 4JOIC 3M3YB 4RCNA 2N88A 1A6XA 1GOZA 3OW2A 1XMOQ 2F0SA 2K5NA 3UI2A 1CSPA 3RN2A 1JMCA 4K5VA 3DLLA 4JI6L 4RKLA 1V1OA 4LJZC 1EY7A 4AH6A 1ZXTA 1SNQA 4OEMB 2AUKA 4FP5D 4KMUC 1CKOA 5F2DA 2F0TA 5EKLA 4AIMA 4B08A 2K05A 2F0JA 5IP9G 1R4QB 3GO5A 4ZRZA 1TWHB 1PXUA 4IPHA 4CJ2C 4GKKL 4GKJL 2QEXA 4XQJA 2K50A 3OMGA 4PMWA 3HG9A 4BXXG 1VF7A 2IT1A 4E6IA 1SYBA 1YNJC 2ZXPA 4IOCA 1B7YB 1RHPA 3K57A 1LYLA 3ZYYX 2JEBI 4KN7C 2MJ8A 2PYKA 2KQ3A 2E5LQ 3FDTA 1RTNA 4XQQA 5BN5A 1XPOA 2VY3A 3JAMc 1PH9A 3WDNA 1BKBA 4R1JA 5EGTA 2ES2A 3PO2H 3RN5A 3DMUA 4ZKCB 4K6DA 4JI0L 1X54A 4R4OA 1HA6A 2V1CC 3P7JA 2NZOA 1TS5A 3GQBA 5DM73 3MVVA 2YU9B 5CV7A 1EWCA 5H1SE 3T1HL 1NR4A 3FHWA 2R93B 3H3VC 1QWYA 1Q3LA 2UUAQ 5C44B 2D2CC 3X3NA 1HZAA 1Q86C 1EUJA 3PF4A 1K8OA 3NQTA 4JI7Q 1CSQA 4ID6A 2F4VQ 3D4DA 4RGTA 1O7IA 1X56A 3UE0A 4DV3Q 2UUBL 2PCFB 1WFQA 2HUGA 4P74A 1WOCA 3E0JA 1CQFA 5I9OA 3TP8A 3F2BA 3J81j 3U50C 1XMQQ 2JA7H 2E2JB 1EFID 1EQRA 5GROA 4KLKA 1CKNB 1NTGA 2OT2A 5IGGA 1SFOH 4L63B 1LV9A 4UP7A 4BBSH 3AMUA 4L5TA 1JJCB 4N9TA 3EROA 4PNYA 1HXYD 4PG3A 4AYBG 2JA6B 4JPBW 2H5XA 2BH8A 1WCMB 4ULLA 3I4NG 3NTIA 4CKEA 2K52A 1F2YA 1R4PB 2UXCL 5AJ3Q 1U9RA 2XWBB 5IOCA 3UDXA 3LX0A 1FNWA 3I56A 4KK7A 2KCNA
chains in the Genus database with same CATH topology
4Y7NB 5EPJA 3IKJA 1F2LA 4KD3A 5HURA 2Q8RE 1EU3A 2L0CA 3DXJC 4LK1C 3PIO3 1CT1D 2B2TC 1IW7D 2I46A 4FYDA 3PIP3 2EY2A 1BQQT 2EOTA 1PRTD 3I8ZA 4TKOB 2DY8A 2B8FA 2B63B 1ONLA 2ZXOA 1STHA 4K2LA 2JSOA 2RDHA 2NYZD 2JA8B 1XYIA 1EEID 1Y69U 2B2YC 4A3KB 4K14A 3FKIB 2A74C 5JJZA 4DXFA 2PZUA 2VB2X 1ZYRD 2A6EC 4J1MA 1EWHA 2C5CA 1QG7A 4IFDJ 5KNBA 2VNUD 2K33A 2EJFC 1B2TA 1M4VA 2AQ2B 4MHEA 4OGQC 4Q0FA 5EKKA 5KRUA 2DNCA 4PV1C 1RD9D 2RKSA 1HTLD 3Q23A 1YNJD 5BN4A 1CK1A 4CKCA 2PPBC 1D1IA 2J4XA 4WRDA 1GUSA 5D14A 3T51B 3L7ZC 1LT6D 2R7ZB 1STEA 1LACA 2KUMA 3C1FA 1PZID 4A3FB 4A3MB 2KCCA 4QIWB 2RVLA 4RCOA 1D5MC 1E2ZA 4IUQA 1GUTA 1LTSD 1PZJD 5JPMC 2XRQD 3MXGA 1JB3A 1XX8A 2B2UC 2ICIA 3VYTA 5J39A 4KKTA 3OIPA 2FMCA 3BG3A 4QUCA 2RSOA 3OHXC 5LL6S 2MGSA 3SR1A 4G7OC 2OEOA 4OIKA 2M2LA 1JWMD 4F8MA 2K7VA 5FO8B 3S16B 4K8JA 3TZUA 1IW7C 2X6LA 1JR0D 2BA1A 4KTAA 2A6ED 5JVG3 5C5LA 2LMCB 4K8IA 3SK4A 1MSGA 1SNDA 1HA5A 4BS9A 2L9HA 4ODGA 5DNFA 2E2IB 3WOEA 5KIXA 2DNEA 1Y8OB 3NUCA 4FXDA 1EOTA 3NBIA 4C1NK 4H13C 1VF5C 2NVTB 4DNRB 5A35A 3BS1A 1W6KA 4CBVA 4AYBB 4I7ZC 3EJIA 3S1QB 5D65A 4C3JG 4O42A 2K28A 3CRKC 1SNPA 1TS2A 1STNA 5I6WA 4C3JB 2PO4A 2ZT9C 3SE0A 4XYOA 1G2TA 4ZAIA 3BDOA 3EFXD 4O1NA 4IURA 3A8IE 4IFDG 4G7HC 1ILPA 2WAQB 1XWEA 4ZYSA 3DM1A 1DOMA 1AZPA 4DA2A 2FJ2A 2L4NA 4HCEA 3ERQA 2XSCA 4KY7A 3SDZA 2QF7A 1I6VC 1E2WA 2AUJD 2WINB 1I4XA 1SSOA 1OXUA 4HSVA 1HTPA 3KK7A 4RAUC 3A54A 3HZXA 3V2TA 1DD2A 1QJOA 3DWPA 1BF4A 1HRJA 3MXNA 1B44D 1SYFA 1EQVA 1QILA 1SYEA 1T5XD 3S14B 3VA5A 3NWTA 2EXZA 3I73A 2LS01 1L0YB 1LO5D 1LTTD 4IUPA 3DEPA 1RODA 1UNSA 3VYSA 3PMFA 5KYLA 5CMDA 4XTCS 4ZLTF 3EQLC 3VR3A 2EYOA 2IX0A 2CQAA 1RJTA 5IODA 1G6ZA 5J22A 4CGYB 4M1UB 5D3IB 4ZK9B 2F3VA 1HFGA 1SJHD 1B4OA 1UAPA 3W2DA 4X3TA 2CHBD 5M5WB 3CRLC 4DNTB 4R8NA 2M00A 1EU4A 4KN4C 1RKNA 3V96A 1FR3A 2F0IA 1PTOH 4WORA 1BR9A 4CJ1B 3MFYA 1D1KA 1I6HB 4BY1B 2VXWA 1Y8PB 3G7LA 4IFDH 2Q8TA 1B9MA 4IZ8A 5C3EB 1D2BA 2ID0A 2BA0A 2B2YA 4MN3A 2F4IA 1PRTF 3KF8A 2N55A 3H0GB 4G7ZC 1O78A 2KEDA 5K36H 1E0BA 5I2YA 1NAPA 4N9PA 4UAIA 3MXUA 3HP3A 4PMCA 4RGOS 2BDNA 2QDBA 3S1NB 3ITPA 4XT3B 1ILQA 1ENAA 2E74C 1ET9A 4DAVA 3OMCA 3J7AF 1V43A 1SMYD 2JYOA 3L3OC 3BDCA 2H1EA 1JOQA 2F0FA 1GHJA 4C3IG 2NZ1D 3NXWA 5FOBB 3BYYB 4J8QA 3SK6A 4C3HB 5I9PA 4TSSA 2PW5A 4WFN3 2F0QA 4GZYC 3D4RA 1UEAB 1U4RA 3K5OA 4KY6A 4YIJA 2IPKD 4H7BA 3MWYW 3MA2B 1V8QA 1PRTC 2B2VC 1I4PA 1CA6A 3S2DB 1AN8A 1PMRA 4Z9CB 1Z47A 5KNCA 3K5NA 2G9DA 2XWJB 2B2UA 1SYCA 4P2CB 1LTRD 1TVXA 2M9VA 2RA4A 3RD4A 1JICA 2QEJC 1BNZA 3V05A 3M4OB 4R9WA 3NBHA 3VR4A 5C5MA 1AZQA 2YYZA 1SYDA 1HFNA 3TZDA 4Q5VA 1ZKOA 1NSNS 3FPPA 5A2QL 4HN7A 5A2QE 1HUMA 4CHTB 1KNAA 3MTSA 3TP7A 4BBSB 3DWQA 3NQIA 1TWGB 3FVQA 3MZ5A 1OXTA 2OF1A 4A3JB 1U4LA 2CW0D 1UUPA 4RFBA 4K5XA 5CV8A 2MUYA 1SAPA 2NVYB 2F0KA 4RH6A 3VR2A 2Q8IB 4F88A 3QJYA 5I2XA 3PUZA 4DU9A 2O5IC 1H9MA 4F87A 3A56A 3CKIB 2F0MA 1D6EC 1WVLA 4BY7B 5CORA 1G291 2RDFA 4ILWA 1SXTA 1TY2A 2QKIC 2NVXB 1CQVA 5CV6A 4FF1A 2F0LA 3H6MA 5FKAC 1H9JA 1CZGA 1QNUA 3SK5A 1PYWD 2F0PA 3FEWX 2F0HA 2RQXA 1C48A 2LFNA 3PO3B 1FD7D 1TS3A 3P75A 1AW7A 2E75C 5ELFA 1BCPF 4NP5A 5C3XA 1A2UA 2B8GA 5KNDA 2K5QA 5E4XA 3BYTB 3J81L 3J81E 1TWFB 1G8ZD 2PZTA 4EQOA 2G9HD 1H9SB 3MEHA 1FGBD 3KLRA 3IFDA 4TRDA 3VA7A 2CVRA 5KEEA 1ENFA 4IUTA 3SEBA 2A69C 5IT9L 5IT9E 2X6GA 4K5WA 1NCVA 1KDBA 2XVSA 1F77A 1NUCA 1SDFA 3A8JE 2MPMA 3O13A 2HQEA 2F0NA 3PUYA 2F0GA 3KUPA 1IHZA 1SEBD 4B9WA 4FO2A 3URYA 5HGTA 1EEFD 3G6JB 3QIAA 3QOLA 5CR3A 2MP1A 1PTOC 2B2WA 1F2MA 2PW7A 2D5DA 1G91A 3J80E 3J80L 3BVGA 3C46A 1EQTA 3WOFA 4NKLA 4CJ0B 5M3FB 2LKVA 3GTKB 1YNND 3Q24A 3D6CA 5G3LD 1BCPC 1PZKD 1Y1VB 1A2TA 4BBRB 1A3VA 2QILA 1CHQD 3NTKA 3Q0AA 4K2KA 2HCIA 1KNEA 1EY6A 1PFBA 5C6AA 4V0BA 4RHRA 4L6TB 1TKWB 4NMZA 4OIJA 1C8CA 2J7ZA 2O4XA 3GV6A 1IYVA 5J1ZA 1B50A 1NR2A 1EY4A 4PQXA 1TIID 4WJWA 3MC0B 1I4HA 3SHLA 1C4QA 5ELBA 1XTCD 2JA5B 4KJNA 1PTOB 5CV9A 3C2PA 3FRPB 5IGCA 2NN6H 4LMQD 3K7AB 1JOKA 3NWSA 2EJMA 3PO2B 5IGDA 1VMPA 3U9SA 4HEDA 3HEJA 3H91A 1WTPA 4H0LC 3HGBA 1S5BD 4IALA 1WTOA 1VDZA 1JE4A 2DN8A 2NTSA 2F3WA 4MIUA 4KKSA 4KD4A 1A3UA 2PZWA 5M5YB 2AQ1B 1PLFA 1EY8A 2HDLA 3IFTA 2L5TA 5C0XG 1JCKB 2EY1A 3A55A 3D8GA 1STGA 2EYMA 1EY0A 2K6AA 4FF2A 1B53A 5C4ZA 1LABA 2IJ0A 3CU7A 3HOXB 1BUVT 4XIGS 5E1FA 2SDFA 5EJWA 1STBA 2SEBD 3HOUB 3OOCA 4QCLA 2Z1CA 3RZOB 4I65A 2EY6A 2JEAI 4C2MB 2B2WC 2WKDA 1WTXA 3CHBD 1ENCA 4OO1G 2A68D 1I4GA 1STYA 1DXMA 1ICWA 1A15A 4RKBA 1B9NA 3R93A 3T4AC 4UDUC 1LTID 1PFNA 2H4OA 3KBXA 3I70A 4KY5A 1EL0A 2K04A 5EPLA 2BDOA 3VR5A 1J9OA 3M7NA 1CZWA 2QCPX 5CYUA 3I4NB 1J8IA 2EYFA 1RDPD 2EYLA 2F0DA 4M8AA 2XNAC 1WTVA 1VCIA 3K5LA 1JWUD 2D9UA 2O2LD 2C9OA 4C3HG 2FMMA 5COYA 4U673 1ESFA 4L8JA 1SFOB 3I4LA 3SXHA 1LTBD 5LL6X 1ET6A 3OSOA 1DCZA 5K5PA 5NUCA 4XQNA 3R8BA 2A5HA 4EGVA 2CW0C 1OXSC 2XRSD 1Z6HA 2F0WA 3GP7A 5T1IA 4XXEA 3F2UA 3VYRA 3N52A 1GUGA 1BO0A 1DZ1A 4HMJA 2L11A 1BCPB 1BDOA 3R3OA 1JQYD 1M8AA 3SK8A 5JEAG 1X3QA 4C56C 3NPPA 1SE3A 3PUVA 1AFPA 1GUOA 1LT3D 1H9RA 3J7AV 3S1RB 1I50B 1I4RA 2B39A 4QF4A 2FFKB 2EDGA 1KLGD 3D4WA 1DOLA 1EYCA 3BDLA 3I90A 3AU7A 1OXVA 2V4DA 1H9KA 3QOJA 2OXPA 3H09A 3K6OA 3DEOA 3E6ZX 4ZQ3A 3NSWA 4ZKBB 1QOHA 1XXGA 1Q1EA 2DY7A 1PRTB 3RMHA 2XIWA 2F0UA 3PUWA 4ZUIA 2B2TA 2KHSA 4XYQA 3M7GA 2R61A 1BOSA 1K8MA 2D62A 4OHJA 1Q1BA 3RUZA 5C4HA 3HOYB 2LY7A 5BN3A 5I6YA 3T56B 5ISRA 1IKMA 3IL8A 1DYQA 1KDAA 1I3QB 3W3AA 3S17B 3TDQA 3OWFA 2K01A 4BA1I 5ELDA 2HDMA 3TMEA 1L0XB 1AP0A 1HPCA 5IGBA 2A6HC 3GTGB 4NDXA 5DEHA 3T13A 2NTTA 3S15B 4FF4A 4KHVA 1Q8IA 4A3BB 3LNNA 2A6HD 4HAEA 1SE2A 2E2DC 5CGKA 3HKZB 3HS0C 3L9AX 4OL7A 2I07B 4V190 4S3SA 1S5CD 4G57A 1EY9A 1Z7TA 1MSHA 4XT1B 1HQRD 1SNOA 1HCZA 3PV0A 1HHVA 1EIHA 1QNKA 2HCCA 1GUNA 3EA6A 5C0XH 1O7LA 5C0XI 4X3SA 3I72A 1IL8A 3U9OA 3QB3A 2EYPA 4IQZA 2IWHA 5JEAJ 4ZUJA 1RCVD 2E2HB 3BZDB 1LT4D 1QCBD 4IUNA 4J6HA 3NHHA 1S4ZA 1S5DD 1BBXC 1ML0D 4A93B 3MFGA 2IW3A 4A3EB 2Y0SB 4HSPA 3GTMB 4X3UA 3A7LA 1BCPD 2EZVA 1O80A 5TSSA 2RSNA 3T16A 1WTQA 2EPBA 5CBAE 3OIQA 1Q12A 3NP8A 3DWAA 3VYUA 3DUZA 4EVOA 2EY5A 2KJXA 4DFAA 3M85A 2JA7B 2NN6I 2WACA 1DM0B 1JC7A 5ELEA 2VUMB 3MXPA 5JAVA 1X32A 5EKIA 5M5XB 4C3IB 3MHBA 2B2VA 1GXDC 3ND8A 1TWAB 1ESRA 3I91A 3HRZC 1F9SA 3P1HA 4KV6A 2KA7A 2WV6D 3SVMA 1KLUD 4FNFA 4KI0A 5IGFA 3OWEB 3D6WA 5FO9B 1R9TB 2WB1B 4BWGB 5C4XB 3A7AB 1D5XC 2Z4HA 3TP5A 1PDQA 2NBFA 3S1MB 3K5MA 4EQPA 3HOVB 5C0XJ 2SNMA 3GTPB 2MHVA 2AWNA 3GTQB 3IAYA 2NUCA 3FMCA 5JEAH 3TP6A 4FXGC 1KABA 1TQOA 1MBYA 1STAA 2KECA 1WD0A 2BOSA 4HMIA 1S5ED 3Q22A 3I4MB 3E5SA 1JORA 1U4PA 1GUWA 2NVQB 2F03A 2O5JC 2TMPA 1MD2D 2R3ZA 3BVMA 1H9SA 2Z8LA 3R2TA 2PMZB 4HTHA 2XN9C 1Q90A 3QG1A 2KOLA 2K32A 1PTOF 4DAYA 3GTLB 2A68C 4FVMA 4HCSA 1CI3M 3A8KE 3X3MA 1DJRD 4DN4M 1OXXK 5FK9C 1IYUA 1F9PA 1PTOD 2FHTA 2L55A 4CKBA 4ME5A 3C1EA 2IX1A 2JE6I 1V1PB 1EYAA 1LTGD 5CBEE 1WTWA 3TSSA 3QO2A 2EJGC 2J0TD 3EVQA 4X3KA 2TSSA 2Z4IA 3TBIB 1CTMA 5JVH3 1E2VA 2IL8A 5DAUA 2PNRC 3K59A 5CC4A 2ENBA 1HUNA 4IUVA 1SBBB 3M4YA 4RGMA 1ZEQX 5ELCA 4PMBA 1W6JA 5LHY1 4QUFA 5K36G 4FXKC 1CFMA 1QE6A 1CA5A 2E76C 5KGUA 3J7YW 4JBWA 5JOBA 4U68A 1TR5A 4NW2A 4G4KA 2L12A 4DF7A 4A3DB 1LTAD 2NB0A 3CQZB 5EBDA 1D5ZC 2K03A 1EIGA 3N6RA 5C4JB 3NE5B 1LLRD 3QWNA 2NWGA 1ZYRC 2EVBA 2JP1A 3LWUA 2WIIB 1F9QA 5CV5A 3MAQA 1EZ6A 1JOOA 2EE1A 4QB4A 1WD1A 1F9RA 5EBCA 3RZDB 5E4WC 1KTKA 2PQEA 1Y8NB 4IUUA 2RDGA 4DGZA 1TS4A 5JPNC 4ABNA 4QMGA 1WTRA 1TU2B 1KDCA 4R8IA 2A73B 1PFMA 2K5DA 4HR7B 1KAAA 1RF2D 1MGSA 4A3GB 2SOBA 1DONA 3C3LA 1DOKA 2JXMB 1O7ZA 2ZXRA 5EQ0A 1II3A 3HOZB 2BE5C 5T1GA 2IX3A 1JWSD 4OO1I 4RHSA 4F7XA 3T53B 3ONAB 2X69A 1SYGA 1VMCA 4RGNA 2BE5D 2EYJA 2K5WA 1FNUA 1EZ8A 3D3RA 1GHKA 1HQMC 3K58A 4DK1A 1AEXA 4KJOA 1MI2A 4OO1H 5M9OA 1GJXA 3S9WA 2A69D 5I4DA 4K6LA 1V1PA 3GD7A 5KYIA 3NTHA 4RWSC 4TQUS 5FO7B 2FINB 3R2IA 3ND9A 3DHQA 1CHPD 2KVMA 4C1NI 3TN2A 3LWEA 4JK1C 3KLSA 2F0VA 4LAAA 5IGEA 1SE4A 2AQ3B 3NK9A 3RLFA 3HOWB 5E3FA 5D3DA 3I3CA 1BXTA 3KBGA 3AB9A 1TWCB 2F1MA 3VR6A 5EPKA 1QB5D 4IFDI 2K1BA 2SNSA 2R6GA 3FPUB 5IIFA 2L1BA 2VB3X 4EQNA 4BA2I 1RTOA 2BCOA 2WKCA 1LT5D 5CV4A 5M3MB 1B1ZA 3BVZA 1O7YA 3KLSX 3S2HB 1FNVA 1B3AA 5G3LF 1I4QA 4FF3A 1YNNC 5DM63 1A3TA 2AWOA 4H44C 1EY5A 3GTOB 1T5EA 3JAML 3JAME 1TY0A 1FYCA 3Q6SA 2NN6G 3OPOA 2RBMA 4A3IB 2F0EA 1G2SA 3GTJB 3OW7A 3PUXA 2KEEA 1F2ZA 3D31A 2WP8J 2R92B 1CM9A 3H94A 1X3PA 1K83B 4XDXA 1EYDA 1S5FD 1TT2A 4RA8A 5C3WA 5FLXE 5FLXL 2EYHA 3GV3A 4DK0A 2GA4B 4KKUA 1SNCA 5AFWA 1SJED 2ICEC 3K0YA 4IN3A 1U4MA 1SMYC 1OO9B 4B9XA 3P20A 4DXGA 1Y1WB 4KHZA 4DAPA 2F0OA 1SNMA 1IKLA 3M3YB 4RCNA 2N88A 1A6XA 1GOZA 2F0SA 3UI2A 4K5VA 4RKLA 1V1OA 4LJZC 1EY7A 1ZXTA 1SNQA 2AUKA 4FP5D 4KMUC 5F2DA 2F0TA 5EKLA 4B08A 2K05A 2F0JA 1R4QB 3GO5A 4ZRZA 1TWHB 1PXUA 4CJ2C 4XQJA 3OMGA 4PMWA 3HG9A 1VF7A 2IT1A 4E6IA 1SYBA 1YNJC 2ZXPA 1RHPA 3K57A 3ZYYX 2JEBI 4KN7C 2MJ8A 2PYKA 2KQ3A 3FDTA 1RTNA 4XQQA 5BN5A 3WDNA 5EGTA 3DMUA 4ZKCB 4K6DA 1HA6A 3P7JA 1TS5A 3GQBA 5DM73 3MVVA 2YU9B 5CV7A 1EWCA 1NR4A 2R93B 3H3VC 1QWYA 1Q3LA 1K8OA 5C44B 2D2CC 3X3NA 3NQTA 4ID6A 3D4DA 4RGTA 2PCFB 2HUGA 3E0JA 1CQFA 5I9OA 3TP8A 2E2JB 1EFID 2OT2A 5IGGA 4L63B 1LV9A 3AMUA 4N9TA 3EROA 4PNYA 1HXYD 2JA6B 1WCMB 4ULLA 3NTIA 4CKEA 1F2YA 1R4PB 1U9RA 2XWBB 5IOCA 3LX0A 1FNWA 4KK7A 2KCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PW5 A;  2F0Q A;  1EYA A;  5F2D A;  1IHZ A;  4KY5 A;  2SNS A;  2F0T A;  3C1F A;  4KD3 A;  5EKL A;  4KY6 A;  4YIJ A;  4ZUJ A;  3TP5 A;  4H7B A;  2SOB A;  5HUR A;  2F0J A;  1JOK A;  4B9W A;  5IIF A;  3EVQ A;  4EQN A;  2F0U A;  5HGT A;  4ZUI A;  2KHS A;  4IUN A;  3NHH A;  4J6H A;  3OMG A;  4R8N A;  4EQP A;  2M00 A;  5IGD A;  2EYF A;  5CV6 A;  2EYL A;  2F0L A;  2F0D A;  1RKN A;  2SNM A;  5CV4 A;  3H6M A;  3QOL A;  1II3 A;  5CR3 A;  1SYB A;  4E6I A;  3RUZ A;  5C4H A;  3HEJ A;  1F2M A;  2EY2 A;  2F0I A;  2PW7 A;  3SK5 A;  4F7X A;  5DAU A;  4WOR A;  2F0P A;  5CC4 A;  5I6Y A;  2PYK A;  1SYC A;  2F0H A;  2KQ3 A;  5ISR A;  2NUC A;  3ERQ A;  2ENB A;  1KDA A;  1A3T A;  3TP6 A;  4NKL A;  1SYG A;  5EGT A;  1EY5 A;  3T16 A;  3DMU A;  4IAL A;  1KAB A;  5J39 A;  4K2L A;  4K6D A;  1STH A;  2EYJ A;  1TQO A;  1STA A;  3OWF A;  3P75 A;  4KY7 A;  4IZ8 A;  2LKV A;  3NP8 A;  4HMI A;  1EZ8 A;  3SR1 A;  4PMB A;  2F3W A;  4MIU A;  3MVV A;  2OEO A;  3TME A;  2RBM A;  3E5S A;  4KD4 A;  5CV7 A;  1A3U A;  3D6C A;  3SXH A;  5C5M A;  4EVO A;  1JOR A;  2EY5 A;  4K14 A;  1A2T A;  2F0E A;  3OSO A;  4F8M A;  5IGB A;  2PZW A;  5K5P A;  1A3V A;  5NUC A;  5KGU A;  4K8J A;  4NP5 A;  5JOB A;  1SYD A;  1A2U A;  4DFA A;  5C3X A;  2PZU A;  1TR5 A;  4NDX A;  1AEX A;  2F0W A;  1EY8 A;  1F2Z A;  2WAC A;  3HZX A;  1NSN S;  4J1M A;  4KJO A;  4K2K A;  3V2T A;  4N9P A;  4DF7 A;  5DEH A;  3T13 A;  3NQT A;  1EY6 A;  4KTA A;  2PZT A;  3MXP A;  2EY1 A;  4HMJ A;  3D8G A;  4ID6 A;  3TP7 A;  4EQO A;  5I9P A;  1STG A;  1EQV A;  1SYE A;  1SYF A;  2RDF A;  2EYM A;  1EY0 A;  3D4D A;  3R3O A;  4KHV A;  5C5L A;  3VA5 A;  1EYD A;  4K8I A;  4PMC A;  3SK4 A;  1SND A;  2EXZ A;  3MHB A;  3MEH A;  3SK8 A;  5KYI A;  1TT2 A;  4HTH A;  5C6A A;  2QDB A;  2OF1 A;  3MZ5 A;  5C4Z A;  5C3W A;  2EYH A;  3ITP A;  4NMZ A;  5CGK A;  4K5X A;  5CV8 A;  5E1F A;  4TRD A;  4OL7 A;  1ENA A;  5I9O A;  2O4X A;  4ODG A;  3TP8 A;  3DHQ A;  1SNC A;  1STB A;  4S3S A;  5CV5 A;  5KEE A;  5KIX A;  3PMF A;  2F0K A;  5JAV A;  4G57 A;  3OMC A;  1EZ6 A;  1JOO A;  1EY9 A;  3QB3 A;  4I65 A;  2EY6 A;  4QB4 A;  5KYL A;  4B9X A;  5J1Z A;  5IGG A;  3NUC A;  5EKK A;  5KRU A;  3P1H A;  4K5W A;  4KV6 A;  1KDB A;  2F0O A;  4QF4 A;  1SNO A;  5M9O A;  1SNM A;  4N9T A;  2F0V A;  4LAA A;  5IGE A;  1EY4 A;  2PQE A;  2RKS A;  4DU9 A;  3BDC A;  3ERO A;  4PNY A;  3S9W A;  2F0F A;  1JOQ A;  4DGZ A;  3D4W A;  2EYO A;  3SHL A;  2F0M A;  1ENC A;  2F0S A;  3NK9 A;  5IOD A;  1EYC A;  1STY A;  3BDL A;  3EJI A;  5E3F A;  5J22 A;  3NXW A;  1F2Y A;  4QMG A;  1NUC A;  5IGF A;  4K5V A;  1SNP A;  5I6W A;  1STN A;  1KDC A;  1U9R A;  4RKL A;  4RKB A;  3QOJ A;  5IOC A;  4KJN A;  3LX0 A;  2F3V A;  1EY7 A;  2F0N A;  2HQE A;  2OXP A;  4ME5 A;  5CV9 A;  3SK6 A;  3C1E A;  3U9O A;  1SNQ A;  4ZQ3 A;  4WRD A;  2F0G A;  5IGC A;  1KAA A;  2EYP A; 
#chains in the Genus database with same CATH topology
 4Y7N B;  5EPJ A;  3IKJ A;  2UUA L;  1F2L A;  3I4N H;  4KD3 A;  5HUR A;  2Q8R E;  1E7Z A;  1EU3 A;  2L0C A;  3DXJ C;  1VQF A;  4LK1 C;  3PIO 3;  3RLO A;  1CT1 D;  2B2T C;  1IW7 D;  4FDB A;  2I46 A;  1PH4 A;  1MHW C;  4FYD A;  3PIP 3;  3CXC A;  4YY3 L;  2EY2 A;  1BQQ T;  2EOT A;  3U4V A;  4LF9 Q;  4NXM L;  1PRT D;  3I8Z A;  2OTJ A;  4TKO B;  5LMU Q;  4IJL A;  2DY8 A;  2B8F A;  2B63 B;  3S24 A;  1ONL A;  2ZXO A;  1STH A;  4K2L A;  4BY1 G;  2NVX H;  2JSO A;  2VL6 A;  1PH5 A;  2RDH A;  2NYZ D;  4GLV B;  2JA8 B;  1XYI A;  1EEI D;  1Y69 U;  1DGS A;  2B2Y C;  4A3K B;  4K14 A;  1X9N A;  4A75 A;  4OX9 L;  3FKI B;  2A74 C;  5JJZ A;  4YWM A;  4DXF A;  2PZU A;  2VB2 X;  3BU2 A;  1ZYR D;  3HOY G;  3JC6 6;  5ELO A;  2A6E C;  4J1M A;  1EWH A;  2C5C A;  2F4V L;  1QG7 A;  4GN3 B;  3CCV A;  1HNW Q;  4IFD J;  5KNB A;  2VNU D;  1GKH A;  2K33 A;  3E9H A;  2EJF C;  1B2T A;  2HT1 A;  2OQ0 A;  1M4V A;  4P72 A;  1K8G A;  2AQ2 B;  4MHE A;  4HIO A;  4DKA C;  4OGQ C;  4Q0F A;  5EKK A;  5KRU A;  2LXK A;  4B3S L;  2DNC A;  4PV1 C;  1RD9 D;  2RKS A;  1V9P A;  1HTL D;  4A3B G;  3Q23 A;  1WI5 A;  3KYH C;  1YNJ D;  5BN4 A;  4LUZ A;  1CK1 A;  1EOV A;  1K9M C;  1VQC A;  4CKC A;  2PPB C;  1D1I A;  4POF A;  2RF4 A;  2J4X A;  4WRD A;  1GUS A;  5D14 A;  2DUD A;  3T51 B;  3L7Z C;  3AQQ A;  1LT6 D;  2R7Z B;  1STE A;  1LAC A;  2KUM A;  3C1F A;  1PZI D;  4A3F B;  1C7Y A;  1HR0 L;  4BY1 H;  4A3M B;  2UXB L;  2KCC A;  4QIW B;  2RVL A;  2N3S A;  4RCO A;  3KOJ A;  1D5M C;  1E2Z A;  1VQM A;  4IUQ A;  1PZJ D;  1GUT A;  1LTS D;  5IYC G;  5JPM C;  2XRQ D;  5JJL A;  3MXG A;  1KHI A;  4HIM A;  4X6A H;  1JB3 A;  1XX8 A;  2B2U C;  2B3G A;  2ICI A;  3VYT A;  2YTV A;  5J39 A;  4KKT A;  3OIP A;  2FMC A;  3BG3 A;  4QUC A;  2RSO A;  3OHX C;  5LL6 S;  2MGS A;  3SR1 A;  2CKZ B;  2UXC Q;  4G7O C;  2OEO A;  4OIK A;  2M2L A;  4UP9 A;  1JWM D;  3K7U C;  1GM5 A;  4F8M A;  3HOU G;  2K7V A;  5FO8 B;  3S16 B;  4K8J A;  1HR0 W;  2NVY H;  3TZU A;  4DR6 Q;  4A3E G;  1B8A A;  1IW7 C;  2X6L A;  1KQS A;  1JR0 D;  1A62 A;  2BA1 A;  3F2C A;  4KTA A;  2HHH Q;  2A6E D;  5JVG 3;  5C5L A;  2LMC B;  1LM0 A;  4K8I A;  3SK4 A;  5FLX c;  1MSG A;  1SND A;  4BBS G;  4R4T A;  1HA5 A;  4BS9 A;  2L9H A;  3CAM A;  3HOZ G;  4DV2 Q;  1JT8 A;  1TWC H;  4ODG A;  3K81 C;  4ZCK A;  5DNF A;  2E2I B;  4HJ7 A;  3WOE A;  5KIX A;  2DNE A;  3S1N H;  1Y8O B;  3NUC A;  1HNX L;  4FXD A;  1E1O A;  1NY4 A;  3NBI A;  1EOT A;  4C1N K;  4LF7 Q;  4H13 C;  1VQ5 A;  1VQN A;  1VF5 C;  2NVT B;  4NB3 A;  4DNR B;  5A35 A;  1W6K A;  3BS1 A;  5EAY A;  4AYB B;  2R7D A;  4I7Z C;  4CBV A;  4GOP A;  3EJI A;  1C0A A;  3S1Q B;  3S1M H;  5D65 A;  4C3J G;  4O42 A;  2K28 A;  2YV5 A;  3CRK C;  1SNP A;  1TS2 A;  1STN A;  5I6W A;  4C3J B;  1K8A C;  2WFW A;  2PMZ E;  2PO4 A;  1N33 Q;  2ZT9 C;  3SE0 A;  4XYO A;  2Y0S G;  4ZAI A;  1G2T A;  3BDO A;  3EFX D;  1YI2 A;  4C3J H;  4O1N A;  2HD3 A;  4IUR A;  3A8I E;  4IFD G;  4G7H C;  1I6H H;  3AEV A;  1ILP A;  2WAQ B;  1XWE A;  1VS0 A;  4ZYS A;  3DM1 A;  4DR4 Q;  1DOM A;  1AZP A;  4BBR H;  4DA2 A;  2FJ2 A;  2L4N A;  4HCE A;  1SLJ A;  3ERQ A;  4BXX H;  4AYB E;  4GNX C;  1YJW A;  2XSC A;  2R7F A;  4KY7 A;  3SDZ A;  2JA6 G;  1WCM G;  2QF7 A;  1I6V C;  1E2W A;  2AUJ D;  2WIN B;  1I4X A;  1SSO A;  4A3E H;  3GTM H;  1OXU A;  4HSV A;  1QZG A;  4DV6 L;  1HTP A;  1IXR A;  3HOU H;  3KK7 A;  4DV1 L;  5IWA L;  4RAU C;  3A54 A;  3HZX A;  4HJ8 A;  3V2T A;  1DD2 A;  1I94 L;  4DR3 L;  1QJO A;  3DWP A;  3IRB A;  1BF4 A;  1HRJ A;  3MXN A;  1B44 D;  1QIL A;  1EQV A;  1SYE A;  1SYF A;  1T5X D;  3S14 B;  3VA5 A;  3NWT A;  3I4M G;  2EXZ A;  3I73 A;  4A3D H;  2LS0 1;  2VUM H;  1L0Y B;  1LO5 D;  1LTT D;  4IUP A;  3DEP A;  4JYA Q;  1ROD A;  1UNS A;  3VYS A;  3PMF A;  4DV5 Q;  2DJG C;  3KF6 B;  5KYL A;  3NBH B;  4JI5 Q;  3J80 c;  5CMD A;  4XTC S;  2VUM G;  4ZLT F;  4A3D G;  3GDE A;  1VQD A;  2K14 A;  3EQL C;  2ALY B;  3VR3 A;  2EYO A;  2IX0 A;  2CQA A;  1RJT A;  5IOD A;  1G6Z A;  5J22 A;  4CGY B;  4M1U B;  2D0P A;  4BY7 G;  2VQF Q;  3I2Z A;  5D3I B;  5GAG C;  4ZK9 B;  4ALP A;  3S16 H;  2F3V A;  4R4I A;  4A3I H;  1HFG A;  1VQB A;  1SJH D;  4A93 G;  4OWX B;  4DV1 Q;  2F3I A;  1B4O A;  2CWA A;  3A74 A;  1UAP A;  3W2D A;  2HHH L;  4X3T A;  1WCM H;  2CHB D;  4JI8 Q;  2JA6 H;  5M5W B;  3CD6 A;  4A3B H;  3CRL C;  3M3Y H;  4DNT B;  4R8N A;  2M00 A;  1YJN A;  1EU4 A;  4GLA C;  4KN4 C;  4DR4 L;  2Q2I A;  1RKN A;  3V96 A;  1FR3 A;  3AFQ A;  2F0I A;  1PTO H;  4WOR A;  1BR9 A;  5IT9 c;  4CJ1 B;  3PO3 G;  3MFY A;  1SRU A;  1D1K A;  1I6H B;  4BY1 B;  2VXW A;  1VQP A;  1Y8P B;  3G7L A;  4IFD H;  2Q8T A;  1B9M A;  4IZ8 A;  5C3E B;  3G71 A;  1D2B A;  2ID0 A;  2BA0 A;  2QGQ A;  2B2Y A;  4MN3 A;  2F4I A;  3HOY H;  1PRT F;  1T9H A;  2N55 A;  3KF8 A;  4LUO A;  2AKW B;  3TRE A;  3H0G B;  5IWA Q;  1O78 A;  4G7Z C;  2KED A;  5K36 H;  4LFB Q;  4N8F A;  1E0B A;  5I2Y A;  1NAP A;  4N9P A;  4UAI A;  2MNA A;  3MXU A;  2NVT H;  2PQA A;  5J3B A;  3HP3 A;  1PV4 A;  1VQ4 A;  4PMC A;  4DV4 Q;  4RGO S;  5E7N A;  4YCW A;  2BDN A;  2QDB A;  1IL2 A;  3S1N B;  3ITP A;  4XT3 B;  1VQK A;  1ILQ A;  5HGQ A;  1ENA A;  2E74 C;  1N32 Q;  1ET9 A;  4DAV A;  1L2F A;  1VQI A;  3OMC A;  2VW9 A;  2ZTE A;  3UE1 A;  4B3M L;  4A3C G;  3J7A F;  4OON A;  1V43 A;  2Y0S E;  3HOZ H;  4A3L H;  1SMY D;  1VQJ A;  2JYO A;  3L3O C;  3BDC A;  2H1E A;  1JOQ A;  2F0F A;  1GHJ A;  4C3I G;  4HJ9 A;  2NZ1 D;  1XMO L;  1X3G A;  3NXW A;  3W1B A;  1YZ6 A;  1I5F A;  4DV6 Q;  1PHJ A;  5FOB B;  3BYY B;  4J8Q A;  3SK6 A;  3T1Y Q;  2Q2U A;  1HZB A;  2VQE L;  3PQI A;  4C3H B;  5I9P A;  4TSS A;  1K3B C;  2PW5 A;  4WFN 3;  2F0Q A;  4GZY C;  3D4R A;  4HID A;  1UEA B;  1U4R A;  3K5O A;  4KY6 A;  4YIJ A;  2IPK D;  4H7B A;  4A3M G;  3MWY W;  1IBL Q;  3MA2 B;  1V8Q A;  2UXB Q;  1PRT C;  2B2V C;  1I4P A;  1WYD A;  1S40 A;  1CA6 A;  3KJO A;  3S2D B;  1AN8 A;  5HY6 A;  1PMR A;  1IBK L;  2JA9 A;  4Z9C B;  1Z47 A;  5KNC A;  2JA5 H;  3K5N A;  2G9D A;  2XWJ B;  3STB C;  2B2U A;  1SYC A;  4P2C B;  1LTR D;  2ZJP A;  1TVX A;  2M9V A;  3WWV A;  2RA4 A;  1HNZ L;  3RD4 A;  1JIC A;  2QEJ C;  5C3E G;  1BNZ A;  4JV5 L;  3V05 A;  3M4O B;  4LNQ A;  4B3R L;  4R9W A;  3NBH A;  1XNQ Q;  3GTQ H;  4L5Q A;  1QVC A;  3VR4 A;  5C5M A;  1AZQ A;  2ZM6 L;  2I5H A;  2YYZ A;  2NZH A;  1SYD A;  3J81 c;  1HFN A;  3TZD A;  1K28 A;  4Q5V A;  1ZKO A;  1PYS B;  1NSN S;  3FPP A;  5A2Q L;  4HN7 A;  5A2Q E;  1HUM A;  1QUQ A;  4CHT B;  2K75 A;  1KNA A;  4JI8 L;  1VQ6 A;  3MTS A;  3TP7 A;  4BBS B;  3DWQ A;  4YWK A;  4I7A A;  3NQI A;  3GTO H;  3PO2 G;  1TWG B;  3E9I A;  3FVQ A;  3MZ5 A;  1OXT A;  2OF1 A;  4A3J B;  1U4L A;  1XPR A;  2CW0 D;  1UUP A;  4RFB A;  4K5X A;  5CV8 A;  1N32 L;  2MUY A;  1SAP A;  2L15 A;  4MZ9 A;  2CH4 A;  1N34 L;  1QVF A;  2NVY B;  1CKM A;  4A3K G;  2F0K A;  4RH6 A;  4CDE C;  3VR2 A;  2Q8I B;  1L0W A;  4CDC C;  4JI4 L;  4F88 A;  3QJY A;  5I2X A;  3PUZ A;  3M4P A;  2K4K A;  4DU9 A;  2O5I C;  1H9M A;  4F87 A;  3A56 A;  5IP9 H;  3CKI B;  2F0M A;  2CQO A;  1D6E C;  1WVL A;  4DPG A;  4BY7 B;  3T1Y L;  3TS2 A;  5COR A;  5ELN A;  1G29 1;  1J5E Q;  2RDF A;  4ILW A;  3HKZ E;  3U58 A;  1SXT A;  1TY2 A;  2QKI C;  4EQ5 A;  1SRO A;  2NVX B;  3AFP A;  3K80 C;  1CQV A;  2QW7 A;  5CV6 A;  4FF1 A;  2F0L A;  3M4Q A;  3H0G H;  3H6M A;  2PQA B;  1Y1W H;  5FKA C;  1H9J A;  1CZG A;  1QNU A;  4DR2 L;  3SK5 A;  1YJ9 A;  1PYW D;  2F0P A;  3FEW X;  5M5Y H;  2F0H A;  2DGY A;  2RQX A;  1C48 A;  2LFN A;  3PO3 B;  1FD7 D;  5M5W H;  1TS3 A;  3CCM A;  4ME3 A;  3I7F A;  3P75 A;  1AW7 A;  2Q2T A;  1XNQ L;  3KFU A;  2E75 C;  5ELF A;  1YHB A;  2K5H A;  1BCP F;  4WJ3 M;  4NP5 A;  5C3X A;  1A2U A;  2B8G A;  5KND A;  2K5Q A;  2R7Z G;  5E4X A;  3BYT B;  3J81 L;  3J81 E;  2JA8 H;  2ATW A;  5FLM H;  1TWF B;  1G8Z D;  2WAQ E;  2PZT A;  5GAE C;  4EQO A;  2YTX A;  2G9H D;  1SR3 A;  1H9S B;  3MEH A;  1FGB D;  1IBK Q;  3KLR A;  3IFD A;  3HOW G;  1XTD A;  4TRD A;  1P16 A;  1K3R A;  4K0K Q;  3VA7 A;  2CVR A;  5KEE A;  2PI2 E;  2JA7 G;  1ENF A;  4IUT A;  3SEB A;  2A69 C;  5IT9 L;  5IT9 E;  2X6G A;  5JJI A;  4K5W A;  1W2B A;  1NCV A;  4X65 L;  2LSS A;  3D0F A;  1KDB A;  1HNZ Q;  2XVS A;  4B3S Q;  4A3F G;  5IY0 A;  1IBM Q;  4B3R Q;  1F77 A;  1I3Q H;  2VQF L;  4GNX B;  1NUC A;  1SDF A;  3A8J E;  1FGU A;  2MPM A;  3O13 A;  1YHA A;  2HQE A;  2F0N A;  3PUY A;  2DJF C;  2F0G A;  3KUP A;  2JQO A;  1IHZ A;  1SEB D;  4B9W A;  4FO2 A;  3URY A;  1GO3 E;  5HGT A;  1EEF D;  3G6J B;  2B63 G;  4OWW B;  2CWP A;  3DM3 A;  1XPU A;  1HZC A;  3QIA A;  3QOL A;  5CR3 A;  2MP1 A;  2A19 A;  1PTO C;  3J7Z C;  2B2W A;  2I0Q A;  1F2M A;  2PW7 A;  4DR1 Q;  2D5D A;  4WJ4 A;  1G91 A;  3J80 E;  3J80 L;  3BVG A;  3C46 A;  5M3F H;  1EQT A;  3WOF A;  4NKL A;  4CJ0 B;  3GTK H;  1KD1 C;  5M3F B;  2LKV A;  2Z6K A;  1UEB A;  3GTK B;  1YNN D;  3Q24 A;  3LGJ A;  3D6C A;  1XJV A;  5G3L D;  1BCP C;  1PZK D;  1Y1V B;  1A2T A;  1Y14 B;  2KBN A;  4BBR B;  1A3V A;  2QIL A;  4LFB L;  1CHQ D;  3NTK A;  3Q0A A;  4QGU A;  4K2K A;  2HCI A;  1KNE A;  1TWG H;  2MQH A;  1EY6 A;  1PFB A;  1K0R A;  4GKK Q;  1HH2 P;  4GKJ Q;  5C6A A;  4V0B A;  1EWI A;  1JJG A;  4RHR A;  4L6T B;  1TKW B;  4DV3 L;  4NMZ A;  4OIJ A;  5C4X G;  1C8C A;  2J7Z A;  2O4X A;  1VQ9 A;  2UXD Q;  3I4O A;  1YVC A;  3GV6 A;  3CCR A;  1IYV A;  4R4Q A;  5J1Z A;  4YWL A;  4A3G G;  1B50 A;  1NR2 A;  5IP7 H;  2YU9 H;  5L37 A;  1EY4 A;  4PQX A;  1TII D;  4WJW A;  3MC0 B;  1I4H A;  3SHL A;  1AH9 A;  3I55 A;  1C4Q A;  2Z6K C;  5C44 H;  4N8X 1;  5ELB A;  1XTC D;  2JA5 B;  2E2I H;  4KJN A;  3KDF B;  1PTO B;  2D0O A;  5CV9 A;  4OEL B;  3C2P A;  1NBW A;  4KHP L;  3FRP B;  5IGC A;  1JE5 A;  3S2D H;  2ZJQ A;  2NN6 H;  3AYH B;  1EYG A;  4LMQ D;  3K7A B;  1JOK A;  3NWS A;  1G6P A;  2AHO B;  2EJM A;  5DLQ E;  1B3Q A;  3M9B A;  1PA6 A;  3PO2 B;  5IGD A;  1YIJ A;  1VMP A;  3HOX G;  2R92 H;  3U9S A;  4HED A;  3CC4 A;  4HJA A;  3A5Z B;  3HEJ A;  3H91 A;  3CPF A;  2R93 G;  1WTP A;  2PNH A;  3J80 i;  4H0L C;  3HGB A;  4MNO A;  1S5B D;  4IAL A;  1E22 A;  1WTO A;  3CW2 C;  2ZTD A;  1VDZ A;  1JE4 A;  2DN8 A;  3OYY A;  2KHJ A;  2NTS A;  2F3W A;  5AJ3 L;  4MIU A;  4KKS A;  4KD4 A;  2ZM6 Q;  3RZO H;  1A3U A;  3NEL A;  4GN4 B;  3CCU A;  2PZW A;  5M5Y B;  4OX9 Q;  1A8V A;  5IYB G;  2AQ1 B;  1PLF A;  1EY8 A;  2ASB A;  2HDL A;  4A3J H;  3IFT A;  2L5T A;  5C0X G;  1QZH A;  1I94 Q;  5M3M H;  1JCK B;  2EY1 A;  3A55 A;  3D8G A;  1STG A;  3ULJ A;  2EYM A;  1EY0 A;  3S14 H;  4JBJ A;  1HNW L;  2K6A A;  3E0E A;  4FF2 A;  1B53 A;  3S17 H;  5C4Z A;  1LAB A;  2IJ0 A;  4QL5 A;  3CU7 A;  3HOX B;  1BUV T;  4XIG S;  5E1F A;  2SDF A;  4J15 A;  4PZ8 A;  4LFA Q;  4DR5 L;  4YY3 Q;  1UE1 A;  5EJW A;  1STB A;  2SEB D;  3HOU B;  3OOC A;  1V1Q A;  4QCL A;  2Z1C A;  3FKI G;  2A8V A;  4I65 A;  3RZO B;  2EY6 A;  2JEA I;  3MXN B;  3CC7 A;  5GQO A;  4C2M B;  2MFI A;  3HOV H;  2B2W C;  2WKD A;  1SN8 A;  1WTX A;  3CHB D;  4RG1 A;  4YHH L;  1ENC A;  4OO1 G;  2A68 D;  1I4G A;  1STY A;  1B70 B;  1DXM A;  3CCS A;  4PZ6 A;  1ICW A;  4OWT B;  1A15 A;  4RKB A;  1B9N A;  3EIV A;  3A0J A;  3R93 A;  3T4A C;  3CF5 A;  4UDU C;  1LTI D;  3PF5 A;  1PFN A;  2H4O A;  3KBX A;  1L1O A;  3NEN A;  3I70 A;  4KY5 A;  3L0O A;  1BBU A;  1EL0 A;  2K04 A;  5EPL A;  2BDO A;  3VR5 A;  1J9O A;  4LWC A;  3M7N A;  1CZW A;  1HR0 Q;  2QCP X;  4O0A A;  5CYU A;  2MO0 A;  3I4N B;  1LTL A;  1J8I A;  2EYF A;  1RDP D;  2EYL A;  2F0D A;  4M8A A;  1N8R C;  2XNA C;  1WTV A;  4HJ5 A;  4DR2 Q;  1VCI A;  3K5L A;  1JWU D;  2D9U A;  2O2L D;  4UHV A;  2C9O A;  4C3H G;  5FJ8 H;  1RIP A;  2CFM A;  2FMM A;  5IYD G;  5COY A;  4U67 3;  1ESF A;  4L8J A;  1CUK A;  3L2P A;  1N9W A;  1SFO B;  2JK8 A;  3I4L A;  3SXH A;  1LTB D;  5LL6 X;  1ET6 A;  3OSO A;  1DCZ A;  4DAY B;  5K5P A;  5NUC A;  4XQN A;  3R8B A;  2A5H A;  4EGV A;  2CW0 C;  1OXS C;  3W5O A;  2XRS D;  1Z6H A;  2F0W A;  3GP7 A;  5T1I A;  4XXE A;  3F2U A;  1FVI A;  1EIY B;  3VYR A;  3N52 A;  1GUG A;  1BO0 A;  1DZ1 A;  4HMJ A;  4JOI A;  2L11 A;  1BCP B;  1BDO A;  2Z0S A;  3R3O A;  1JQY D;  1M8A A;  4RMF A;  3SK8 A;  5BR8 Q;  2OTL A;  4H02 A;  1H95 A;  5JEA G;  4L5S A;  3S1R H;  4DV0 Q;  1X3Q A;  1XMQ L;  2R93 H;  4QIW E;  4C56 C;  3NPP A;  1SE3 A;  2RCF A;  3PUV A;  1AFP A;  1GUO A;  2JN4 A;  1LT3 D;  1H9R A;  1KRT A;  2XTI A;  3J7A V;  3S1R B;  1I50 B;  1I4R A;  2B39 A;  1X3F A;  4P73 A;  2VZA A;  4QF4 A;  2FFK B;  1WTH A;  2EDG A;  2E8G A;  1Q82 C;  4LF7 L;  1KLG D;  3CQZ H;  4JI1 Q;  1HJP A;  3D4W A;  3CCL A;  1DOL A;  1EYC A;  3NEM A;  3BDL A;  2E2H H;  3I90 A;  3AU7 A;  1OXV A;  2KHI A;  2V4D A;  1H9K A;  3QOJ A;  2OXP A;  3H09 A;  3K6O A;  3DEO A;  3E6Z X;  4ZQ3 A;  4UP8 A;  3NSW A;  4ZKB B;  5GAD C;  1N33 L;  3KF6 A;  1QOH A;  4LFC L;  1XXG A;  1Q1E A;  3K8A A;  1GD7 A;  2Q2H A;  4X66 L;  2DY7 A;  2KCM A;  1PRT B;  3RMH A;  3UDF A;  2AMC B;  2XIW A;  1PH7 A;  2F0U A;  3PUW A;  4ZUI A;  2B2T A;  3CPW A;  2KHS A;  4XYQ A;  5IYD H;  3M7G A;  1A0I A;  2R61 A;  4DV2 L;  1BOS A;  5BR8 L;  1C9O A;  4DV7 Q;  1K8M A;  3HKZ G;  4DR5 Q;  4OHJ A;  2D62 A;  4HIK A;  1Q1B A;  4GOP C;  3RUZ A;  5C4H A;  4LF9 L;  4NXM Q;  1Y1V H;  1G51 A;  1YBY A;  3HOY B;  2LY7 A;  5BN3 A;  5I6Y A;  3T56 B;  4DV5 L;  5ISR A;  1IKM A;  3IL8 A;  1DYQ A;  1KDA A;  1I3Q B;  3W3A A;  3CC2 A;  3MEF A;  3S17 B;  3TDQ A;  1X65 A;  3OWF A;  2K01 A;  1VQE A;  4JCV E;  5C4J H;  3PIP A;  4BA1 I;  1TXY A;  5ELD A;  4OXP A;  2HDM A;  2WAQ G;  3TME A;  1L0X B;  4DUZ L;  1AP0 A;  1HPC A;  3RR5 A;  5IGB A;  2A6H C;  3GTG B;  4LF4 Q;  2N49 A;  2WB1 G;  4NDX A;  3JAM i;  5DEH A;  3T13 A;  2NTT A;  4JI3 L;  3S15 B;  4DAM A;  4UY8 C;  4FF4 A;  4KHV A;  4B3T L;  1Q8I A;  1X6O A;  4A3B B;  3LNN A;  2A6H D;  2RCN A;  4HAE A;  1SE2 A;  2E2D C;  4GLX A;  3PSI A;  5CGK A;  3HKZ B;  3KJP A;  3HS0 C;  3L9A X;  4OL7 A;  3GTJ H;  1VQL A;  2I07 B;  4V19 0;  4S3S A;  1S5C D;  4Y7N H;  1FJG Q;  4G57 A;  3EBE A;  1EY9 A;  1Z7T A;  1MSH A;  4XT1 B;  1S3O A;  2I5M X;  1HQR D;  1SNO A;  1HCZ A;  2RHQ B;  4DNI A;  4JI1 L;  3PV0 A;  1HHV A;  1EIH A;  1QNK A;  5M3M G;  2HCC A;  3S15 H;  1GUN A;  3EA6 A;  5C0X H;  1EFW A;  1O7L A;  1UE6 A;  4GNX A;  4JVZ A;  5C0X I;  2N78 A;  5IYB H;  1MKH A;  4X3S A;  3I72 A;  1IL8 A;  3U9O A;  1L1O B;  3QB3 A;  4LF4 L;  2EYP A;  4X66 Q;  3GTL H;  1J5E L;  4IQZ A;  2IWH A;  3F2D A;  3ICE A;  3TEH B;  5JEA J;  4ZUJ A;  1RCV D;  2E2H B;  3BZD B;  4JI3 Q;  1LT4 D;  1QCB D;  3ULL A;  4DUY L;  4IUN A;  4J6H A;  3NHH A;  1S4Z A;  1S5D D;  2GN5 A;  1BBX C;  1ML0 D;  3B6Y A;  1PYB A;  4JYA L;  4YCV A;  1I50 H;  4A93 B;  1NE3 A;  1QUQ B;  3MFG A;  1HZ9 A;  3H15 A;  3A5U A;  2XGT A;  2IW3 A;  4A3E B;  2Y0S B;  4HSP A;  3GTM B;  4X3U A;  2E5L L;  1FJG L;  2R92 G;  3A7L A;  1QVG A;  1BCP D;  2EZV A;  1O80 A;  5TSS A;  1YEZ A;  1HNX Q;  1Q81 C;  2RSN A;  3T16 A;  1WTQ A;  2EPB A;  2EQS A;  5CBA E;  3OIQ A;  1Q12 A;  4AQY L;  3NP8 A;  3OTO L;  3PIO A;  3G4S A;  3DWA A;  2A1A A;  5FLM G;  3VYU A;  3DUZ A;  1XNR Q;  4EVO A;  4LW1 A;  2EY5 A;  1PH2 A;  2KJX A;  4DFA A;  3M85 A;  4LFC Q;  2E2J H;  2JA7 B;  2NN6 I;  2I5L X;  1DM0 B;  2WAC A;  2QA4 A;  1JC7 A;  4JI7 L;  3Q8D A;  5ELE A;  2VUM B;  3MXP A;  5JAV A;  1X32 A;  5EKI A;  4C3I B;  5M5X B;  3H3V I;  1KXL A;  3KLW A;  2UUB Q;  3MHB A;  2B2V A;  4DV7 L;  1GXD C;  5IP7 G;  4DV4 L;  3ND8 A;  1TWA B;  1OTC A;  1ESR A;  3I91 A;  1P8L A;  2RHS B;  3HRZ C;  2IHF A;  1Y1V G;  4K0K L;  1TWA H;  1X3E A;  5C4X H;  2CCZ A;  4GOP B;  1F9S A;  3H0G G;  3GTP H;  3VDY A;  3P1H A;  1X55 A;  4KV6 A;  4IO9 A;  2KA7 A;  3BZK A;  1PH8 A;  2WV6 D;  1VQA A;  2G5D A;  4JC0 A;  4YHH Q;  4DR7 Q;  3SVM A;  2HQL A;  1KLU D;  4FNF A;  4KI0 A;  5IGF A;  3OWE B;  3D6W A;  1XNR L;  5FO9 B;  1R9T B;  2WB1 B;  4BWG B;  5C4X B;  1MJC A;  3BZC A;  3ULP A;  3A7A B;  3S2H H;  1D5X C;  2Z4H A;  3TP5 A;  1PDQ A;  2NBF A;  1Q8K A;  3S1M B;  1KL9 A;  3UDG A;  3K5M A;  3CME A;  1KAW A;  1K83 H;  4EQP A;  3HOV B;  5C0X J;  2SNM A;  4L5R C;  1K73 C;  4POG A;  2EXD A;  1VQO A;  3GTP B;  2MHV A;  4MTK A;  4NXN L;  4CDF C;  4A3K H;  2AWN A;  3GTQ B;  1U0L A;  5LMN W;  5LMU L;  3IAY A;  2NUC A;  3FMC A;  5JEA H;  2WB1 E;  3TP6 A;  2LXJ A;  3S1Q H;  4JBK A;  4FXG C;  2B63 H;  1KAB A;  1E1T A;  1TQO A;  1MBY A;  1STA A;  2KEC A;  3OTO Q;  1WD0 A;  2K5V A;  2BOS A;  4HMI A;  2C35 B;  1D8L A;  1S5E D;  3PGZ A;  4JV5 Q;  3Q22 A;  3I4M B;  3W1G A;  3E5S A;  4CDD C;  2ZTC A;  1JOR A;  2KCT A;  3BJU A;  1U4P A;  1GUW A;  1E3P A;  2NVQ B;  4Y52 H;  2F03 A;  2O5J C;  2TMP A;  4DR3 Q;  3G48 A;  4IPC A;  1MD2 D;  1RL2 A;  2R3Z A;  1IBL L;  1SE8 A;  3BVM A;  4DUY Q;  5C3E H;  1H9S A;  2Z8L A;  3R2T A;  3TRZ A;  1AE3 A;  2PMZ B;  3K0X A;  4HTH A;  5JJK A;  1ASZ A;  2XN9 C;  1Q90 A;  5FJ8 G;  2OQK A;  4C3H H;  1N36 Q;  3QG1 A;  2KOL A;  2BH2 A;  2JA5 G;  2K32 A;  4GS3 A;  1PTO F;  4DAY A;  3RLN A;  3GTL B;  2A68 C;  4FVM A;  1N34 Q;  4NXN Q;  1Z9F A;  4HCS A;  2QDL A;  4YCU A;  2HIX A;  1CI3 M;  3A8K E;  3U4Z A;  4DR7 L;  4AQY Q;  3X3M A;  1DJR D;  4DN4 M;  1S72 A;  3KDF A;  3EN2 A;  1OXX K;  5FK9 C;  4A3M H;  3K7A H;  3E3X A;  1IYU A;  1F9P A;  1PTO D;  2FHT A;  1KRS A;  1NJI C;  3F1Z A;  2R7Z H;  2L55 A;  4CKB A;  4JI6 Q;  4NPS A;  4ME5 A;  2UU9 L;  2YTY A;  3C1E A;  1JJ2 A;  1IYJ B;  4X62 Q;  2IX1 A;  2JE6 I;  4KHP Q;  1V1P B;  1EYA A;  1YIT A;  1LTG D;  5CBE E;  1WTW A;  3TSS A;  1D7Q A;  3QO2 A;  1BVS A;  2EJG C;  2J0T D;  3EVQ A;  1TWH H;  4X3K A;  1U5K A;  2TSS A;  2Z9H A;  1KIX A;  4A3L G;  4LF6 Q;  2Z4I A;  1UE7 A;  4A3C H;  3TBI B;  3FKI H;  1CTM A;  5JVH 3;  1E2V A;  2IL8 A;  5DAU A;  4JI5 L;  1UWV A;  2PNR C;  3K59 A;  5CC4 A;  1FL0 A;  4JI4 Q;  2ENB A;  1HUN A;  4B3M Q;  1NMG A;  4X65 Q;  1PH1 A;  4IUV A;  3J81 i;  1SBB B;  3KF8 B;  3M4Y A;  4RGM A;  4JI0 Q;  1NNX A;  1ZEQ X;  2B29 A;  4LUV A;  5ELC A;  4PMB A;  2P5Z X;  1W6J A;  3TQY A;  5LHY 1;  4QUF A;  5K36 G;  4FXK C;  1CFM A;  1QE6 A;  4O2D A;  1CA5 A;  2E76 C;  5KGU A;  3J7Y W;  4JBW A;  5JOB A;  3T1H Q;  1ICF B;  4U68 A;  1TR5 A;  1Q7Y C;  4NW2 A;  3ERS X;  4G4K A;  4DK3 C;  1MIU A;  2L12 A;  4DF7 A;  4A3D B;  1LTA D;  2NB0 A;  3CQZ B;  5EBD A;  1D5Z C;  2K03 A;  1EIG A;  1GVP A;  3N6R A;  2ZJR A;  5C4J B;  3M4O H;  3NE5 B;  1LLR D;  1J6Q A;  5LMN Q;  1KC8 C;  4IOA A;  3QWN A;  1UE5 A;  2NWG A;  1ZYR C;  1PH6 A;  3PO3 H;  1YNX A;  2EVB A;  4LF6 L;  2JP1 A;  3LWU A;  4IPD A;  2WII B;  1F9Q A;  4TVA B;  2UUC Q;  5CV5 A;  3MAQ A;  3PCO B;  1EZ6 A;  1JOO A;  2EE1 A;  4QB4 A;  3HFZ B;  1WD1 A;  2FXQ A;  1F9R A;  5EBC A;  2Z6B A;  3RZD B;  1Q46 A;  2PI2 A;  5E4W C;  2F52 A;  3CP0 A;  1KTK A;  3QR8 A;  2EIF A;  2PQE A;  1Y8N B;  4IUU A;  2RDG A;  4DGZ A;  1TS4 A;  1CKN A;  5JPN C;  4ABN A;  4QMG A;  1WTR A;  1IZ6 A;  1TU2 B;  1KDC A;  2UU9 Q;  4LF5 L;  4R8I A;  2A73 B;  3GTG H;  4JG2 A;  1PFM A;  2K5D A;  4HR7 B;  2GVB A;  3FP9 A;  1KAA A;  1RF2 D;  1MGS A;  4JI2 L;  4BY7 H;  5C44 G;  3CCQ A;  4A3G B;  1MJE A;  2SOB A;  4X64 L;  1DON A;  3C3L A;  1DOK A;  2JXM B;  3HKS A;  1N36 L;  4A3G H;  1O7Z A;  2NVQ H;  2ZXR A;  5EQ0 A;  1II3 A;  3HOZ B;  2BE5 C;  2OWO A;  5T1G A;  2IX3 A;  1JWS D;  4OO1 I;  4RHS A;  4F7X A;  2UUC L;  4DR1 L;  4R4C A;  3T53 B;  1BBW A;  3ONA B;  4QQB X;  2X69 A;  1SYG A;  1VMC A;  3I4M H;  2KEN A;  4IPG A;  4RGN A;  1IBM L;  2BE5 D;  2EYJ A;  2K5W A;  4JW0 A;  1FNU A;  1EZ8 A;  4MTN A;  1YHQ A;  3D3R A;  2CH4 W;  4DK6 C;  3CCJ A;  4LF8 Q;  1GHK A;  4JBM A;  2VQE Q;  1LUZ A;  1HQM C;  4X62 L;  3K58 A;  4DK1 A;  1AEX A;  2MO1 A;  3F8T A;  4KJO A;  4P75 A;  1EIF A;  1MI2 A;  4PZ7 A;  3ER0 A;  4JI2 Q;  4A4I A;  3H3V H;  4OO1 H;  4C3I H;  5M9O A;  5M5X H;  3S9W A;  1JB7 A;  1GJX A;  2A69 D;  5I4D A;  4K6L A;  1V1P A;  3HOV G;  3GD7 A;  5KYI A;  1VQH A;  3NTH A;  4RWS C;  4TQU S;  5M3F G;  5FO7 B;  2FIN B;  4DV0 L;  3R2I A;  3ND9 A;  4A76 A;  3DHQ A;  1R9T H;  1CHP D;  2KVM A;  4C1N I;  1SMX A;  3TN2 A;  1PFS A;  4BBR G;  4IJH A;  2HIV A;  1PH3 A;  3LWE A;  2OCE A;  4QY7 A;  4JK1 C;  3KLS A;  2F0V A;  4LAA A;  5IGE A;  3CCE A;  2IY5 B;  1SE4 A;  1NMF A;  1VQ7 A;  1VQG A;  1TWF H;  2AQ3 B;  3NK9 A;  3RLF A;  4APV A;  3HOW B;  5E3F A;  5D3D A;  4A3J G;  4C2M H;  4LF5 Q;  3RNU A;  3I3C A;  3SGI A;  1BXT A;  3KBG A;  3AB9 A;  3STB D;  2JJQ A;  4LF8 L;  1TWC B;  2F1M A;  3VR6 A;  5EPK A;  1WJJ A;  1QB5 D;  4IFD I;  2K1B A;  2SNS A;  2R6G A;  3FPU B;  4X64 Q;  3G6E A;  1AE2 A;  5IIF A;  2L1B A;  2VB3 X;  4EQN A;  1M1K C;  4BA2 I;  4UPA A;  4A3F H;  5LMN L;  3J7A 5;  1RTO A;  1VQ8 A;  1PVO A;  2BCO A;  1EQQ A;  2WKC A;  1LT5 D;  5CV4 A;  5M3M B;  1B1Z A;  2VS1 A;  3BVZ A;  4P71 A;  1O7Y A;  2UXD L;  5GAH C;  3KLS X;  3S2H B;  4LFA L;  4QJF A;  1FNV A;  1B3A A;  5G3L F;  1I4Q A;  4FF3 A;  1YNN C;  1L1O C;  3HOX H;  3HOW H;  5DM6 3;  1A3T A;  2AWO A;  3CMA A;  4H44 C;  1EY5 A;  3GTO B;  1T5E A;  3JAM L;  3JAM E;  1TY0 A;  1ASY A;  1FYC A;  3UDI A;  4EX5 A;  3Q6S A;  3RZD H;  2NN6 G;  3OPO A;  2JA8 G;  2RBM A;  5IE8 A;  2GVA A;  4DUZ Q;  4A3I B;  2F0E A;  1G2S A;  4A93 H;  2N8N A;  4A3I G;  3GTJ B;  3OW7 A;  3PUX A;  1A63 A;  2KEE A;  1F2Z A;  3D31 A;  4DR6 L;  2WP8 J;  2R92 B;  1CM9 A;  1M90 C;  3H94 A;  1K0S A;  1X3P A;  3TS0 A;  1K83 B;  4XDX A;  1EYD A;  4B3T Q;  1S5F D;  1TT2 A;  1E24 A;  4RA8 A;  5C3W A;  5FLX E;  5FLX L;  2EYH A;  3GV3 A;  4DK0 A;  2GA4 B;  1W3S A;  3ZJY C;  2IHE A;  1SNC A;  4KKU A;  5AFW A;  5IYC H;  1SJE D;  2ICE C;  3K0Y A;  4IN3 A;  1U4M A;  1SMY C;  4GN5 A;  1Y1W G;  1OO9 B;  4B9X A;  3P20 A;  4DXG A;  1Y1W B;  4KHZ A;  4DAP A;  2F0O A;  1SNM A;  1IKL A;  4JOI C;  3M3Y B;  4RCN A;  2N88 A;  1A6X A;  1GOZ A;  3OW2 A;  1XMO Q;  2F0S A;  2K5N A;  3UI2 A;  1CSP A;  3RN2 A;  1JMC A;  4K5V A;  3DLL A;  4JI6 L;  4RKL A;  1V1O A;  4LJZ C;  1EY7 A;  4AH6 A;  1ZXT A;  1SNQ A;  4OEM B;  2AUK A;  4FP5 D;  4KMU C;  1CKO A;  5F2D A;  2F0T A;  5EKL A;  4AIM A;  4B08 A;  2K05 A;  2F0J A;  5IP9 G;  1R4Q B;  3GO5 A;  4ZRZ A;  1TWH B;  1PXU A;  4IPH A;  4CJ2 C;  4GKK L;  4GKJ L;  2QEX A;  4XQJ A;  2K50 A;  3OMG A;  4PMW A;  3HG9 A;  4BXX G;  1VF7 A;  2IT1 A;  4E6I A;  1SYB A;  1YNJ C;  2ZXP A;  4IOC A;  1B7Y B;  1RHP A;  3K57 A;  1LYL A;  3ZYY X;  2JEB I;  4KN7 C;  2MJ8 A;  2PYK A;  2KQ3 A;  2E5L Q;  3FDT A;  1RTN A;  4XQQ A;  5BN5 A;  1XPO A;  2VY3 A;  3JAM c;  1PH9 A;  3WDN A;  1BKB A;  4R1J A;  5EGT A;  2ES2 A;  3PO2 H;  3RN5 A;  3DMU A;  4ZKC B;  4K6D A;  4JI0 L;  1X54 A;  4R4O A;  1HA6 A;  2V1C C;  3P7J A;  2NZO A;  1TS5 A;  3GQB A;  5DM7 3;  3MVV A;  2YU9 B;  5CV7 A;  1EWC A;  5H1S E;  3T1H L;  1NR4 A;  3FHW A;  2R93 B;  3H3V C;  1QWY A;  1Q3L A;  2UUA Q;  5C44 B;  2D2C C;  3X3N A;  1HZA A;  1Q86 C;  1EUJ A;  3PF4 A;  1K8O A;  3NQT A;  4JI7 Q;  1CSQ A;  4ID6 A;  2F4V Q;  3D4D A;  4RGT A;  1O7I A;  1X56 A;  3UE0 A;  4DV3 Q;  2UUB L;  2PCF B;  1WFQ A;  2HUG A;  4P74 A;  1WOC A;  3E0J A;  1CQF A;  5I9O A;  3TP8 A;  3F2B A;  3J81 j;  3U50 C;  1XMQ Q;  2JA7 H;  2E2J B;  1EFI D;  1EQR A;  5GRO A;  4KLK A;  1CKN B;  1NTG A;  2OT2 A;  5IGG A;  1SFO H;  4L63 B;  1LV9 A;  4UP7 A;  4BBS H;  3AMU A;  4L5T A;  1JJC B;  4N9T A;  3ERO A;  4PNY A;  1HXY D;  4PG3 A;  4AYB G;  2JA6 B;  4JPB W;  2H5X A;  2BH8 A;  1WCM B;  4ULL A;  3I4N G;  3NTI A;  4CKE A;  2K52 A;  1F2Y A;  1R4P B;  2UXC L;  5AJ3 Q;  1U9R A;  2XWB B;  5IOC A;  3UDX A;  3LX0 A;  1FNW A;  3I56 A;  4KK7 A;  2KCN A; 
#chains in the Genus database with same CATH homology
 4Y7N B;  5EPJ A;  3IKJ A;  1F2L A;  4KD3 A;  5HUR A;  2Q8R E;  1EU3 A;  2L0C A;  3DXJ C;  4LK1 C;  3PIO 3;  1CT1 D;  2B2T C;  1IW7 D;  2I46 A;  4FYD A;  3PIP 3;  2EY2 A;  1BQQ T;  2EOT A;  1PRT D;  3I8Z A;  4TKO B;  2DY8 A;  2B8F A;  2B63 B;  1ONL A;  2ZXO A;  1STH A;  4K2L A;  2JSO A;  2RDH A;  2NYZ D;  2JA8 B;  1XYI A;  1EEI D;  1Y69 U;  2B2Y C;  4A3K B;  4K14 A;  3FKI B;  2A74 C;  5JJZ A;  4DXF A;  2PZU A;  2VB2 X;  1ZYR D;  2A6E C;  4J1M A;  1EWH A;  2C5C A;  1QG7 A;  4IFD J;  5KNB A;  2VNU D;  2K33 A;  2EJF C;  1B2T A;  1M4V A;  2AQ2 B;  4MHE A;  4OGQ C;  4Q0F A;  5EKK A;  5KRU A;  2DNC A;  4PV1 C;  1RD9 D;  2RKS A;  1HTL D;  3Q23 A;  1YNJ D;  5BN4 A;  1CK1 A;  4CKC A;  2PPB C;  1D1I A;  2J4X A;  4WRD A;  1GUS A;  5D14 A;  3T51 B;  3L7Z C;  1LT6 D;  2R7Z B;  1STE A;  1LAC A;  2KUM A;  3C1F A;  1PZI D;  4A3F B;  4A3M B;  2KCC A;  4QIW B;  2RVL A;  4RCO A;  1D5M C;  1E2Z A;  4IUQ A;  1GUT A;  1LTS D;  1PZJ D;  5JPM C;  2XRQ D;  3MXG A;  1JB3 A;  1XX8 A;  2B2U C;  2ICI A;  3VYT A;  5J39 A;  4KKT A;  3OIP A;  2FMC A;  3BG3 A;  4QUC A;  2RSO A;  3OHX C;  5LL6 S;  2MGS A;  3SR1 A;  4G7O C;  2OEO A;  4OIK A;  2M2L A;  1JWM D;  4F8M A;  2K7V A;  5FO8 B;  3S16 B;  4K8J A;  3TZU A;  1IW7 C;  2X6L A;  1JR0 D;  2BA1 A;  4KTA A;  2A6E D;  5JVG 3;  5C5L A;  2LMC B;  4K8I A;  3SK4 A;  1MSG A;  1SND A;  1HA5 A;  4BS9 A;  2L9H A;  4ODG A;  5DNF A;  2E2I B;  3WOE A;  5KIX A;  2DNE A;  1Y8O B;  3NUC A;  4FXD A;  1EOT A;  3NBI A;  4C1N K;  4H13 C;  1VF5 C;  2NVT B;  4DNR B;  5A35 A;  3BS1 A;  1W6K A;  4CBV A;  4AYB B;  4I7Z C;  3EJI A;  3S1Q B;  5D65 A;  4C3J G;  4O42 A;  2K28 A;  3CRK C;  1SNP A;  1TS2 A;  1STN A;  5I6W A;  4C3J B;  2PO4 A;  2ZT9 C;  3SE0 A;  4XYO A;  1G2T A;  4ZAI A;  3BDO A;  3EFX D;  4O1N A;  4IUR A;  3A8I E;  4IFD G;  4G7H C;  1ILP A;  2WAQ B;  1XWE A;  4ZYS A;  3DM1 A;  1DOM A;  1AZP A;  4DA2 A;  2FJ2 A;  2L4N A;  4HCE A;  3ERQ A;  2XSC A;  4KY7 A;  3SDZ A;  2QF7 A;  1I6V C;  1E2W A;  2AUJ D;  2WIN B;  1I4X A;  1SSO A;  1OXU A;  4HSV A;  1HTP A;  3KK7 A;  4RAU C;  3A54 A;  3HZX A;  3V2T A;  1DD2 A;  1QJO A;  3DWP A;  1BF4 A;  1HRJ A;  3MXN A;  1B44 D;  1SYF A;  1EQV A;  1QIL A;  1SYE A;  1T5X D;  3S14 B;  3VA5 A;  3NWT A;  2EXZ A;  3I73 A;  2LS0 1;  1L0Y B;  1LO5 D;  1LTT D;  4IUP A;  3DEP A;  1ROD A;  1UNS A;  3VYS A;  3PMF A;  5KYL A;  5CMD A;  4XTC S;  4ZLT F;  3EQL C;  3VR3 A;  2EYO A;  2IX0 A;  2CQA A;  1RJT A;  5IOD A;  1G6Z A;  5J22 A;  4CGY B;  4M1U B;  5D3I B;  4ZK9 B;  2F3V A;  1HFG A;  1SJH D;  1B4O A;  1UAP A;  3W2D A;  4X3T A;  2CHB D;  5M5W B;  3CRL C;  4DNT B;  4R8N A;  2M00 A;  1EU4 A;  4KN4 C;  1RKN A;  3V96 A;  1FR3 A;  2F0I A;  1PTO H;  4WOR A;  1BR9 A;  4CJ1 B;  3MFY A;  1D1K A;  1I6H B;  4BY1 B;  2VXW A;  1Y8P B;  3G7L A;  4IFD H;  2Q8T A;  1B9M A;  4IZ8 A;  5C3E B;  1D2B A;  2ID0 A;  2BA0 A;  2B2Y A;  4MN3 A;  2F4I A;  1PRT F;  3KF8 A;  2N55 A;  3H0G B;  4G7Z C;  1O78 A;  2KED A;  5K36 H;  1E0B A;  5I2Y A;  1NAP A;  4N9P A;  4UAI A;  3MXU A;  3HP3 A;  4PMC A;  4RGO S;  2BDN A;  2QDB A;  3S1N B;  3ITP A;  4XT3 B;  1ILQ A;  1ENA A;  2E74 C;  1ET9 A;  4DAV A;  3OMC A;  3J7A F;  1V43 A;  1SMY D;  2JYO A;  3L3O C;  3BDC A;  2H1E A;  1JOQ A;  2F0F A;  1GHJ A;  4C3I G;  2NZ1 D;  3NXW A;  5FOB B;  3BYY B;  4J8Q A;  3SK6 A;  4C3H B;  5I9P A;  4TSS A;  2PW5 A;  4WFN 3;  2F0Q A;  4GZY C;  3D4R A;  1UEA B;  1U4R A;  3K5O A;  4KY6 A;  4YIJ A;  2IPK D;  4H7B A;  3MWY W;  3MA2 B;  1V8Q A;  1PRT C;  2B2V C;  1I4P A;  1CA6 A;  3S2D B;  1AN8 A;  1PMR A;  4Z9C B;  1Z47 A;  5KNC A;  3K5N A;  2G9D A;  2XWJ B;  2B2U A;  1SYC A;  4P2C B;  1LTR D;  1TVX A;  2M9V A;  2RA4 A;  3RD4 A;  1JIC A;  2QEJ C;  1BNZ A;  3V05 A;  3M4O B;  4R9W A;  3NBH A;  3VR4 A;  5C5M A;  1AZQ A;  2YYZ A;  1SYD A;  1HFN A;  3TZD A;  4Q5V A;  1ZKO A;  1NSN S;  3FPP A;  5A2Q L;  4HN7 A;  5A2Q E;  1HUM A;  4CHT B;  1KNA A;  3MTS A;  3TP7 A;  4BBS B;  3DWQ A;  3NQI A;  1TWG B;  3FVQ A;  3MZ5 A;  1OXT A;  2OF1 A;  4A3J B;  1U4L A;  2CW0 D;  1UUP A;  4RFB A;  4K5X A;  5CV8 A;  2MUY A;  1SAP A;  2NVY B;  2F0K A;  4RH6 A;  3VR2 A;  2Q8I B;  4F88 A;  3QJY A;  5I2X A;  3PUZ A;  4DU9 A;  2O5I C;  1H9M A;  4F87 A;  3A56 A;  3CKI B;  2F0M A;  1D6E C;  1WVL A;  4BY7 B;  5COR A;  1G29 1;  2RDF A;  4ILW A;  1SXT A;  1TY2 A;  2QKI C;  2NVX B;  1CQV A;  5CV6 A;  4FF1 A;  2F0L A;  3H6M A;  5FKA C;  1H9J A;  1CZG A;  1QNU A;  3SK5 A;  1PYW D;  2F0P A;  3FEW X;  2F0H A;  2RQX A;  1C48 A;  2LFN A;  3PO3 B;  1FD7 D;  1TS3 A;  3P75 A;  1AW7 A;  2E75 C;  5ELF A;  1BCP F;  4NP5 A;  5C3X A;  1A2U A;  2B8G A;  5KND A;  2K5Q A;  5E4X A;  3BYT B;  3J81 L;  3J81 E;  1TWF B;  1G8Z D;  2PZT A;  4EQO A;  2G9H D;  1H9S B;  3MEH A;  1FGB D;  3KLR A;  3IFD A;  4TRD A;  3VA7 A;  2CVR A;  5KEE A;  1ENF A;  4IUT A;  3SEB A;  2A69 C;  5IT9 L;  5IT9 E;  2X6G A;  4K5W A;  1NCV A;  1KDB A;  2XVS A;  1F77 A;  1NUC A;  1SDF A;  3A8J E;  2MPM A;  3O13 A;  2HQE A;  2F0N A;  3PUY A;  2F0G A;  3KUP A;  1IHZ A;  1SEB D;  4B9W A;  4FO2 A;  3URY A;  5HGT A;  1EEF D;  3G6J B;  3QIA A;  3QOL A;  5CR3 A;  2MP1 A;  1PTO C;  2B2W A;  1F2M A;  2PW7 A;  2D5D A;  1G91 A;  3J80 E;  3J80 L;  3BVG A;  3C46 A;  1EQT A;  3WOF A;  4NKL A;  4CJ0 B;  5M3F B;  2LKV A;  3GTK B;  1YNN D;  3Q24 A;  3D6C A;  5G3L D;  1BCP C;  1PZK D;  1Y1V B;  1A2T A;  4BBR B;  1A3V A;  2QIL A;  1CHQ D;  3NTK A;  3Q0A A;  4K2K A;  2HCI A;  1KNE A;  1EY6 A;  1PFB A;  5C6A A;  4V0B A;  4RHR A;  4L6T B;  1TKW B;  4NMZ A;  4OIJ A;  1C8C A;  2J7Z A;  2O4X A;  3GV6 A;  1IYV A;  5J1Z A;  1B50 A;  1NR2 A;  1EY4 A;  4PQX A;  1TII D;  4WJW A;  3MC0 B;  1I4H A;  3SHL A;  1C4Q A;  5ELB A;  1XTC D;  2JA5 B;  4KJN A;  1PTO B;  5CV9 A;  3C2P A;  3FRP B;  5IGC A;  2NN6 H;  4LMQ D;  3K7A B;  1JOK A;  3NWS A;  2EJM A;  3PO2 B;  5IGD A;  1VMP A;  3U9S A;  4HED A;  3HEJ A;  3H91 A;  1WTP A;  4H0L C;  3HGB A;  1S5B D;  4IAL A;  1WTO A;  1VDZ A;  1JE4 A;  2DN8 A;  2NTS A;  2F3W A;  4MIU A;  4KKS A;  4KD4 A;  1A3U A;  2PZW A;  5M5Y B;  2AQ1 B;  1PLF A;  1EY8 A;  2HDL A;  3IFT A;  2L5T A;  5C0X G;  1JCK B;  2EY1 A;  3A55 A;  3D8G A;  1STG A;  2EYM A;  1EY0 A;  2K6A A;  4FF2 A;  1B53 A;  5C4Z A;  1LAB A;  2IJ0 A;  3CU7 A;  3HOX B;  1BUV T;  4XIG S;  5E1F A;  2SDF A;  5EJW A;  1STB A;  2SEB D;  3HOU B;  3OOC A;  4QCL A;  2Z1C A;  3RZO B;  4I65 A;  2EY6 A;  2JEA I;  4C2M B;  2B2W C;  2WKD A;  1WTX A;  3CHB D;  1ENC A;  4OO1 G;  2A68 D;  1I4G A;  1STY A;  1DXM A;  1ICW A;  1A15 A;  4RKB A;  1B9N A;  3R93 A;  3T4A C;  4UDU C;  1LTI D;  1PFN A;  2H4O A;  3KBX A;  3I70 A;  4KY5 A;  1EL0 A;  2K04 A;  5EPL A;  2BDO A;  3VR5 A;  1J9O A;  3M7N A;  1CZW A;  2QCP X;  5CYU A;  3I4N B;  1J8I A;  2EYF A;  1RDP D;  2EYL A;  2F0D A;  4M8A A;  2XNA C;  1WTV A;  1VCI A;  3K5L A;  1JWU D;  2D9U A;  2O2L D;  2C9O A;  4C3H G;  2FMM A;  5COY A;  4U67 3;  1ESF A;  4L8J A;  1SFO B;  3I4L A;  3SXH A;  1LTB D;  5LL6 X;  1ET6 A;  3OSO A;  1DCZ A;  5K5P A;  5NUC A;  4XQN A;  3R8B A;  2A5H A;  4EGV A;  2CW0 C;  1OXS C;  2XRS D;  1Z6H A;  2F0W A;  3GP7 A;  5T1I A;  4XXE A;  3F2U A;  3VYR A;  3N52 A;  1GUG A;  1BO0 A;  1DZ1 A;  4HMJ A;  2L11 A;  1BCP B;  1BDO A;  3R3O A;  1JQY D;  1M8A A;  3SK8 A;  5JEA G;  1X3Q A;  4C56 C;  3NPP A;  1SE3 A;  3PUV A;  1AFP A;  1GUO A;  1LT3 D;  1H9R A;  3J7A V;  3S1R B;  1I50 B;  1I4R A;  2B39 A;  4QF4 A;  2FFK B;  2EDG A;  1KLG D;  3D4W A;  1DOL A;  1EYC A;  3BDL A;  3I90 A;  3AU7 A;  1OXV A;  2V4D A;  1H9K A;  3QOJ A;  2OXP A;  3H09 A;  3K6O A;  3DEO A;  3E6Z X;  4ZQ3 A;  3NSW A;  4ZKB B;  1QOH A;  1XXG A;  1Q1E A;  2DY7 A;  1PRT B;  3RMH A;  2XIW A;  2F0U A;  3PUW A;  4ZUI A;  2B2T A;  2KHS A;  4XYQ A;  3M7G A;  2R61 A;  1BOS A;  1K8M A;  2D62 A;  4OHJ A;  1Q1B A;  3RUZ A;  5C4H A;  3HOY B;  2LY7 A;  5BN3 A;  5I6Y A;  3T56 B;  5ISR A;  1IKM A;  3IL8 A;  1DYQ A;  1KDA A;  1I3Q B;  3W3A A;  3S17 B;  3TDQ A;  3OWF A;  2K01 A;  4BA1 I;  5ELD A;  2HDM A;  3TME A;  1L0X B;  1AP0 A;  1HPC A;  5IGB A;  2A6H C;  3GTG B;  4NDX A;  5DEH A;  3T13 A;  2NTT A;  3S15 B;  4FF4 A;  4KHV A;  1Q8I A;  4A3B B;  3LNN A;  2A6H D;  4HAE A;  1SE2 A;  2E2D C;  5CGK A;  3HKZ B;  3HS0 C;  3L9A X;  4OL7 A;  2I07 B;  4V19 0;  4S3S A;  1S5C D;  4G57 A;  1EY9 A;  1Z7T A;  1MSH A;  4XT1 B;  1HQR D;  1SNO A;  1HCZ A;  3PV0 A;  1HHV A;  1EIH A;  1QNK A;  2HCC A;  1GUN A;  3EA6 A;  5C0X H;  1O7L A;  5C0X I;  4X3S A;  3I72 A;  1IL8 A;  3U9O A;  3QB3 A;  2EYP A;  4IQZ A;  2IWH A;  5JEA J;  4ZUJ A;  1RCV D;  2E2H B;  3BZD B;  1LT4 D;  1QCB D;  4IUN A;  4J6H A;  3NHH A;  1S4Z A;  1S5D D;  1BBX C;  1ML0 D;  4A93 B;  3MFG A;  2IW3 A;  4A3E B;  2Y0S B;  4HSP A;  3GTM B;  4X3U A;  3A7L A;  1BCP D;  2EZV A;  1O80 A;  5TSS A;  2RSN A;  3T16 A;  1WTQ A;  2EPB A;  5CBA E;  3OIQ A;  1Q12 A;  3NP8 A;  3DWA A;  3VYU A;  3DUZ A;  4EVO A;  2EY5 A;  2KJX A;  4DFA A;  3M85 A;  2JA7 B;  2NN6 I;  2WAC A;  1DM0 B;  1JC7 A;  5ELE A;  2VUM B;  3MXP A;  5JAV A;  1X32 A;  5EKI A;  5M5X B;  4C3I B;  3MHB A;  2B2V A;  1GXD C;  3ND8 A;  1TWA B;  1ESR A;  3I91 A;  3HRZ C;  1F9S A;  3P1H A;  4KV6 A;  2KA7 A;  2WV6 D;  3SVM A;  1KLU D;  4FNF A;  4KI0 A;  5IGF A;  3OWE B;  3D6W A;  5FO9 B;  1R9T B;  2WB1 B;  4BWG B;  5C4X B;  3A7A B;  1D5X C;  2Z4H A;  3TP5 A;  1PDQ A;  2NBF A;  3S1M B;  3K5M A;  4EQP A;  3HOV B;  5C0X J;  2SNM A;  3GTP B;  2MHV A;  2AWN A;  3GTQ B;  3IAY A;  2NUC A;  3FMC A;  5JEA H;  3TP6 A;  4FXG C;  1KAB A;  1TQO A;  1MBY A;  1STA A;  2KEC A;  1WD0 A;  2BOS A;  4HMI A;  1S5E D;  3Q22 A;  3I4M B;  3E5S A;  1JOR A;  1U4P A;  1GUW A;  2NVQ B;  2F03 A;  2O5J C;  2TMP A;  1MD2 D;  2R3Z A;  3BVM A;  1H9S A;  2Z8L A;  3R2T A;  2PMZ B;  4HTH A;  2XN9 C;  1Q90 A;  3QG1 A;  2KOL A;  2K32 A;  1PTO F;  4DAY A;  3GTL B;  2A68 C;  4FVM A;  4HCS A;  1CI3 M;  3A8K E;  3X3M A;  1DJR D;  4DN4 M;  1OXX K;  5FK9 C;  1IYU A;  1F9P A;  1PTO D;  2FHT A;  2L55 A;  4CKB A;  4ME5 A;  3C1E A;  2IX1 A;  2JE6 I;  1V1P B;  1EYA A;  1LTG D;  5CBE E;  1WTW A;  3TSS A;  3QO2 A;  2EJG C;  2J0T D;  3EVQ A;  4X3K A;  2TSS A;  2Z4I A;  3TBI B;  1CTM A;  5JVH 3;  1E2V A;  2IL8 A;  5DAU A;  2PNR C;  3K59 A;  5CC4 A;  2ENB A;  1HUN A;  4IUV A;  1SBB B;  3M4Y A;  4RGM A;  1ZEQ X;  5ELC A;  4PMB A;  1W6J A;  5LHY 1;  4QUF A;  5K36 G;  4FXK C;  1CFM A;  1QE6 A;  1CA5 A;  2E76 C;  5KGU A;  3J7Y W;  4JBW A;  5JOB A;  4U68 A;  1TR5 A;  4NW2 A;  4G4K A;  2L12 A;  4DF7 A;  4A3D B;  1LTA D;  2NB0 A;  3CQZ B;  5EBD A;  1D5Z C;  2K03 A;  1EIG A;  3N6R A;  5C4J B;  3NE5 B;  1LLR D;  3QWN A;  2NWG A;  1ZYR C;  2EVB A;  2JP1 A;  3LWU A;  2WII B;  1F9Q A;  5CV5 A;  3MAQ A;  1EZ6 A;  1JOO A;  2EE1 A;  4QB4 A;  1WD1 A;  1F9R A;  5EBC A;  3RZD B;  5E4W C;  1KTK A;  2PQE A;  1Y8N B;  4IUU A;  2RDG A;  4DGZ A;  1TS4 A;  5JPN C;  4ABN A;  4QMG A;  1WTR A;  1TU2 B;  1KDC A;  4R8I A;  2A73 B;  1PFM A;  2K5D A;  4HR7 B;  1KAA A;  1RF2 D;  1MGS A;  4A3G B;  2SOB A;  1DON A;  3C3L A;  1DOK A;  2JXM B;  1O7Z A;  2ZXR A;  5EQ0 A;  1II3 A;  3HOZ B;  2BE5 C;  5T1G A;  2IX3 A;  1JWS D;  4OO1 I;  4RHS A;  4F7X A;  3T53 B;  3ONA B;  2X69 A;  1SYG A;  1VMC A;  4RGN A;  2BE5 D;  2EYJ A;  2K5W A;  1FNU A;  1EZ8 A;  3D3R A;  1GHK A;  1HQM C;  3K58 A;  4DK1 A;  1AEX A;  4KJO A;  1MI2 A;  4OO1 H;  5M9O A;  1GJX A;  3S9W A;  2A69 D;  5I4D A;  4K6L A;  1V1P A;  3GD7 A;  5KYI A;  3NTH A;  4RWS C;  4TQU S;  5FO7 B;  2FIN B;  3R2I A;  3ND9 A;  3DHQ A;  1CHP D;  2KVM A;  4C1N I;  3TN2 A;  3LWE A;  4JK1 C;  3KLS A;  2F0V A;  4LAA A;  5IGE A;  1SE4 A;  2AQ3 B;  3NK9 A;  3RLF A;  3HOW B;  5E3F A;  5D3D A;  3I3C A;  1BXT A;  3KBG A;  3AB9 A;  1TWC B;  2F1M A;  3VR6 A;  5EPK A;  1QB5 D;  4IFD I;  2K1B A;  2SNS A;  2R6G A;  3FPU B;  5IIF A;  2L1B A;  2VB3 X;  4EQN A;  4BA2 I;  1RTO A;  2BCO A;  2WKC A;  1LT5 D;  5CV4 A;  5M3M B;  1B1Z A;  3BVZ A;  1O7Y A;  3KLS X;  3S2H B;  1FNV A;  1B3A A;  5G3L F;  1I4Q A;  4FF3 A;  1YNN C;  5DM6 3;  1A3T A;  2AWO A;  4H44 C;  1EY5 A;  3GTO B;  1T5E A;  3JAM L;  3JAM E;  1TY0 A;  1FYC A;  3Q6S A;  2NN6 G;  3OPO A;  2RBM A;  4A3I B;  2F0E A;  1G2S A;  3GTJ B;  3OW7 A;  3PUX A;  2KEE A;  1F2Z A;  3D31 A;  2WP8 J;  2R92 B;  1CM9 A;  3H94 A;  1X3P A;  1K83 B;  4XDX A;  1EYD A;  1S5F D;  1TT2 A;  4RA8 A;  5C3W A;  5FLX E;  5FLX L;  2EYH A;  3GV3 A;  4DK0 A;  2GA4 B;  4KKU A;  1SNC A;  5AFW A;  1SJE D;  2ICE C;  3K0Y A;  4IN3 A;  1U4M A;  1SMY C;  1OO9 B;  4B9X A;  3P20 A;  4DXG A;  1Y1W B;  4KHZ A;  4DAP A;  2F0O A;  1SNM A;  1IKL A;  3M3Y B;  4RCN A;  2N88 A;  1A6X A;  1GOZ A;  2F0S A;  3UI2 A;  4K5V A;  4RKL A;  1V1O A;  4LJZ C;  1EY7 A;  1ZXT A;  1SNQ A;  2AUK A;  4FP5 D;  4KMU C;  5F2D A;  2F0T A;  5EKL A;  4B08 A;  2K05 A;  2F0J A;  1R4Q B;  3GO5 A;  4ZRZ A;  1TWH B;  1PXU A;  4CJ2 C;  4XQJ A;  3OMG A;  4PMW A;  3HG9 A;  1VF7 A;  2IT1 A;  4E6I A;  1SYB A;  1YNJ C;  2ZXP A;  1RHP A;  3K57 A;  3ZYY X;  2JEB I;  4KN7 C;  2MJ8 A;  2PYK A;  2KQ3 A;  3FDT A;  1RTN A;  4XQQ A;  5BN5 A;  3WDN A;  5EGT A;  3DMU A;  4ZKC B;  4K6D A;  1HA6 A;  3P7J A;  1TS5 A;  3GQB A;  5DM7 3;  3MVV A;  2YU9 B;  5CV7 A;  1EWC A;  1NR4 A;  2R93 B;  3H3V C;  1QWY A;  1Q3L A;  1K8O A;  5C44 B;  2D2C C;  3X3N A;  3NQT A;  4ID6 A;  3D4D A;  4RGT A;  2PCF B;  2HUG A;  3E0J A;  1CQF A;  5I9O A;  3TP8 A;  2E2J B;  1EFI D;  2OT2 A;  5IGG A;  4L63 B;  1LV9 A;  3AMU A;  4N9T A;  3ERO A;  4PNY A;  1HXY D;  2JA6 B;  1WCM B;  4ULL A;  3NTI A;  4CKE A;  1F2Y A;  1R4P B;  1U9R A;  2XWB B;  5IOC A;  3LX0 A;  1FNW A;  4KK7 A;  2KCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...