5KEEA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92f at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYFYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92F at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5keeA00
4ID6A 3C1EA 1SNQA 3T13A 3EROA 4F7XA 1F2ZA 2F0SA 4K14A 4YIJA 3SK6A 4DFAA 5J22A 5JOBA 3OMCA 1EZ8A 2NUCA 3S9WA 2QDBA 5IIFA 1A2TA 5I6YA 2EYLA 5IGDA 1AEXA 2EY1A 3BDCA 4KHVA 4F8MA 1F2YA 1EY8A 2O4XA 5HGTA 3NP8A 1JOQA 3HZXA 4H7BA 4N9TA 3P75A 4I65A 5CV7A 5HURA 3OSOA 3LX0A 5DAUA 2F0OA 1SNDA 3OWFA 2F0EA 2F0TA 1SNOA 2F0FA 4PMCA 5EKKA 2F0NA 3VA5A 1KDCA 1KABA 4IZ8A 1NSNS 5C5LA 3SXHA 3U9OA 2F3VA 3D6CA 3D4DA 2F3WA 4PNYA 4HMIA 4R8NA 4EQOA 4ZUJA 1A2UA 3ITPA 1KAAA 1SYEA 5IGGA 4K5WA 2RKSA 3SK5A 4E6IA 3ERQA 1EYCA 2PYKA 5CV8A 1JOOA 2EYJA 2EY6A 2PW5A 1EY7A 2EYMA 1SYCA 2F0WA 4PMBA 4J1MA 1TQOA 2F0MA 3EVQA 5CV5A 5J1ZA 5IGEA 2HQEA 1STGA 2F0LA 3QOJA 1ENCA 5E1FA 3C1FA 5E3FA 5IGCA 1SYGA 2OF1A 1U9RA 3DMUA 3QOLA 2EYFA 1STNA 4ME5A 2F0HA 2F0QA 2SNSA 4KY6A 1ENAA 1STHA 2F0UA 3SK4A 5C3XA 5KEEA 5ISRA 4LAAA 3MZ5A 2F0IA 2PZWA 1II3A 5CV4A 4ZQ3A 3TP6A 4DF7A 2ENBA 3D4WA 2PQEA 1NUCA 3BDLA 4DGZA 1EY0A 4J6HA 5JAVA 4KD4A 5IGFA 4NDXA 2F0JA 2F0GA 2M00A 3HEJA 4RKLA 4EQPA 4KJOA 4G57A 5I9OA 5K5PA 5EKLA 5KGUA 3NQTA 2WACA 5KYLA 3TP8A 1TT2A 5NUCA 5KRUA 1A3UA 4K6DA 4KY5A 4KD3A 3H6MA 5EGTA 5I6WA 2PW7A 4KV6A 3QB3A 5IOCA 2PZTA 3E5SA 1JOKA 4N9PA 5CV6A 4B9WA 1EY9A 3MEHA 5KYIA 5IODA 1SNPA 4K5VA 3P1HA 5CV9A 1F2MA 2KHSA 3NXWA 4DU9A 5C4ZA 5C5MA 4QF4A 3NK9A 5F2DA 4KJNA 1EYDA 4K5XA 2EYPA 2KQ3A 4WORA 2F0KA 2SNMA 2EYOA 4HMJA 2EYHA 1EQVA 5C3WA 4K2KA 2EY5A 1RKNA 4K8IA 4K2LA 3D8GA 1EZ6A 4S3SA 4RKBA 2F0PA 1KDAA 5KIXA 4QB4A 1JORA 3MXPA 2OXPA 3MVVA 4NP5A 3R3OA 4IUNA 4OL7A 4QMGA 4ZUIA 1A3TA 1STBA 5CGKA 4NKLA 5CC4A 3DHQA 4EVOA 2OEOA 1TR5A 5CR3A 3SR1A 3T16A 2F0DA 3NHHA 1SNMA 3V2TA 2SOBA 1SYDA 5IGBA 3NUCA 1SYFA 2F0VA 4IALA 5DEHA 1KDBA 2EY2A 1STAA 3EJIA 1EY4A 3TP5A 4HTHA 4WRDA 3PMFA 5J39A 1EY5A 1SYBA 4TRDA 1A3VA 4KY7A 2EXZA 4EQNA 4B9XA 4MIUA 5I9PA 4ODGA 5C4HA 5C6AA 3MHBA 3OMGA 2LKVA 4K8JA 3SK8A 1EYAA 2RDFA 4NMZA 1EY6A 3RUZA 1SNCA 2RBMA 3SHLA 3TMEA 1IHZA 1STYA 3TP7A 5M9OA 4KTAA 2PZUA
chains in the Genus database with same CATH superfamily
3WDNA 2JQOA 2R93G 1SNQA 4JI6Q 4JBMA 1U4RA 1RIPA 4HSPA 5JOBA 3OMCA 3W2DA 4GNXC 1UE7A 2IW3A 2XTIA 1AEXA 5E7NA 1UUPA 4LK1C 2O5JC 4I65A 4IUPA 2L9HA 3OSOA 1X32A 3A5ZB 1HXYD 4WJ3M 3NWSA 4P72A 1D8LA 3SXHA 3KYHC 2F3VA 5C0XJ 4ZUJA 4AIMA 1P16A 3GTPB 2E2HB 5KNCA 2RKSA 5IP9H 5FLMH 4IURA 4DV0Q 4CJ2C 2BH2A 2PQAB 1EEID 1IBLQ 1S5ED 2K50A 3S14H 1TQOA 4KKTA 1HH2P 1A0IA 4ZAIA 1M1KC 1HNZL 1SYGA 2K32A 2ICIA 2K05A 1I50H 1GO3E 1HZBA 2R93B 1IYJB 1RTNA 3AYHB 5ISRA 3U4ZA 4B3TL 1CFMA 4A3CH 1CA5A 4CJ1B 1NUCA 5JAVA 4X6AH 3KLWA 2NN6H 1VMPA 4ZK9B 4QIWE 1BOSA 3GV6A 2WAQG 1FVIA 1LTAD 4A3JH 5CV6A 1BNZA 1KTKA 2J7ZA 4AH6A 4JOIC 1AP0A 1VQJA 3L7ZC 4IN3A 3KF8A 2EOTA 2RHQB 4KJNA 2EYPA 3ULLA 4DUYL 1TS4A 2BA0A 2EYHA 3K80C 2XIWA 4HR7B 3C2PA 2MUYA 4A3IB 4B08A 3HKSA 3A74A 4IUNA 1YEZA 2LS01 5CGKA 3AQQA 2E5LL 1PRTF 3PO2H 4JI8L 4JI4L 3SR1A 1TR5A 2NZOA 2UUAQ 2HIVA 1Y8OB 4Y7NB 5FO8B 1B50A 5G3LD 3F2DA 5JVH3 4C56C 2BE5D 1XX8A 2PNRC 5I9PA 4LF7L 4IJHA 2ZXOA 3ZYYX 3E6ZX 1A63A 3HOUH 4LJZC 2KCNA 4X62L 2PZUA 2WAQB 2A68D 3ND9A 2AUKA 4ID6A 2CWAA 1SMXA 1NBWA 3I7FA 3D0FA 3GTKB 4IPCA 1MKHA 3BDCA 1BDOA 2DJGC 5GAHC 5JEAH 4DV4L 1TS2A 4QCLA 4YCUA 3TZUA 4DV2Q 2A5HA 1HR0W 4BY1G 4BXXG 3I3CA 1SNDA 1YHQA 1KQSA 4H44C 3VYRA 1KDCA 3KDFA 2GN5A 4EQOA 3D6CA 1IXRA 1GOZA 3K59A 4K5WA 3CD6A 3O13A 5CV8A 3V05A 3SDZA 2F0MA 1KXLA 4N8X1 4LFAL 1K0SA 3WWVA 3DMUA 4A93H 4GS3A 1KLUD 4FP5D 3RNUA 3QR8A 3CQZH 4FNFA 1PH9A 3WOEA 4LFCQ 1VQAA 5EQ0A 3P7JA 4JV5Q 3KLSA 3S17B 4DK1A 1CK1A 2KECA 2M00A 2DN8A 3FHWA 4WJWA 1Q81C 3M7NA 4JBKA 1JE4A 2Z4HA 2BDNA 1QOHA 4MTNA 2RCFA 1SJED 2EIFA 3I91A 4A3FH 4A3GH 3X3NA 2ICEC 1J9OA 4K8IA 2JE6I 2RSOA 1QE6A 3HGBA 2OXPA 2FMMA 4QMGA 2VQFQ 2L5TA 2KHJA 2K4KA 1W3SA 2RDHA 5E4XA 3S1QH 4LUZA 2N88A 4OWTB 1HJPA 2YYZA 4R1JA 4R8IA 2K33A 4UP9A 3GTGH 2L12A 5J39A 5IYBH 2K1BA 2V4DA 4WJ4A 1G2SA 5CMDA 4OO1G 5C4HA 5DLQE 2LKVA 5GROA 1X3PA 4ZYSA 2UXDQ 3RUZA 4EQ5A 1SNCA 5M5WH 1PH1A 3J81L 1G2TA 4B3MQ 1WD1A 1EWIA 4IPGA 2X6LA 4DFAA 4JI7L 3RR5A 4JC0A 2Z9HA 5ELDA 1UE6A 2F4IA 3PUVA 5JEAJ 2IX3A 1SE4A 4AYBG 3ZJYC 2K5WA 4N8FA 4PMCA 2F0FA 5L37A 3N6RA 1V8QA 4XYOA 3FEWX 2JA6H 4DV7L 2PNHA 4DR6L 2NVTB 4NXNL 5I4DA 4DV5Q 4LWCA 4DR2Q 2PI2E 2EDGA 4BWGB 3PIP3 2EVBA 2R6GA 1YJ9A 4C3JB 1VF5C 2ZTCA 4JI1Q 1RODA 3KDFB 1AN8A 4GKJQ 3QOLA 2VNUD 4ME5A 4RAUC 2UXCQ 2WB1B 2XWBB 2LSSA 4LAAA 4HIOA 4BA2I 4F87A 4DXGA 2Y0SG 3M4OH 2CH4A 3BDLA 1EY0A 1WOCA 1R9TB 2E2HH 3GTPH 2B39A 2NVQH 1LLRD 3I4NH 1HA5A 3PIOA 4K6DA 5EGTA 1JR0D 1Q7YC 4IFDG 2A69C 5KNDA 4R4IA 5IODA 1SNPA 4XIGS 1SMYD 1YNJD 5F2DA 1T5EA 4LF8Q 3M4QA 3G6EA 2CCZA 1B9NA 2K28A 2R7FA 3OYYA 4P75A 1CA6A 2A1AA 2EY5A 4ME3A 4BBRG 4RKBA 2F0PA 2IT1A 5FKAC 4OL7A 3T1YQ 3NBHB 2K5DA 3OTOL 4O1NA 3DLLA 2NZHA 2K75A 4IALA 5DM73 4IPDA 4JBWA 2Y0SB 2JEBI 3FKIB 2L1BA 1KHIA 4Q0FA 5TSSA 4MIUA 2VXWA 2YV5A 1MBYA 4DN4M 4K8JA 1H9MA 4P2CB 1EY6A 2GA4B 3K7UC 3BZDB 5T1IA 3TMEA 4F7XA 1EFWA 2R92G 3L9AX 4CDFC 2OWOA 1WJJA 2JK8A 4OIJA 1LTRD 3I2ZA 3S15B 1TWGB 1VQHA 2IWHA 1HTLD 3FPPA 4PG3A 4Y7NH 3G7LA 1D1IA 4TSSA 1BKBA 4IUVA 5HURA 1ICWA 4BBRB 2JSOA 5LMNQ 3EQLC 1O7LA 4CDDC 3AB9A 2A6EC 1I3QH 1T5XD 4XQNA 2FINB 4YY3L 3GTOB 1N32Q 4YWLA 1IW7D 3NBIA 2HDLA 2AQ2B 1J5EL 1IL2A 2D0PA 4TKOB 4JI3Q 2QCPX 1EQRA 4GKKQ 2D9UA 5AJ3L 3N52A 1OXXK 1A8VA 1EQQA 2OF1A 2EYFA 1E1OA 1VQIA 1G6PA 1MSHA 1CTMA 1VQPA 4UP8A 4NXMQ 2E74C 4XDXA 5CV4A 3NE5B 1ET6A 1HQMC 2HHHQ 5K5PA 4MHEA 4G57A 5FLXL 2E75C 5IYDG 3NQTA 1CZWA 3A0JA 1TT2A 4DK3C 5KRUA 1A3UA 2JN4A 4M1UB 5IWAL 3K81C 1M90C 2PW7A 3HS0C 4P74A 1D2BA 4C3HG 2NTSA 2KCCA 1QG7A 3DEOA 4DNTB 4HIDA 4X64L 5M3MG 2Q2IA 2R7ZB 5FO9B 3S2HB 3EA6A 2SNMA 1XMOL 1EQVA 3K7AB 3J7ZC 2UXBQ 3M4PA 3K5MA 4G4KA 3TEHB 3TDQA 3R3OA 2QA4A 1VQOA 1IZ6A 4BY1H 4BXXH 1SYFA 1Q1EA 4V0BA 1KRSA 1LV9A 1B44D 1TWCB 1RL2A 2BDOA 3FMCA 1DOLA 1K83H 4HTHA 1PRTD 1LO5D 3GTMH 1DOMA 2CQOA 1GJXA 5M5XB 3NTIA 4A3BG 4CDEC 2JJQA 3PIPA 5M9OA 1QVCA 1LTSD 3D31A 1RDPD 2YTXA 3HG9A 3W3AA 1TS3A 1JJCB 2FMCA 1K8GA 2ZM6Q 1F2ZA 3BVMA 4C3HB 2UU9Q 4MTKA 1SAPA 2NUCA 4O0AA 1X54A 5M3MB 1LTID 5I6YA 3JC66 1ILQA 1VQ6A 4FVMA 2EE1A 3KK7A 2OTJA 4LNQA 2O4XA 2TMPA 3EN2A 4HAEA 5AFWA 1DXMA 3IKJA 2K04A 3BDOA 3J81E 4A4IA 3S2DB 2IL8A 4LFBL 4H13C 3J80i 1FJGL 1PH3A 1VQ9A 2NVXB 1JMCA 3GTQB 4DR1Q 1VQ5A 5I2XA 1CI3M 1VQ4A 1S72A 5IGEA 2B63G 5DM63 4BBSB 4G7OC 4A3BB 3C1FA 1PTOC 4LF5L 4QIWB 2K03A 2MP1A 1PA6A 2SNSA 3EBEA 5CYUA 1ENAA 4A3KH 3H15A 1S40A 2A19A 5KEEA 4BY7B 4B3RL 1V9PA 2KHIA 2ENBA 4KD4A 2VY3A 1TS5A 3S16H 4HCEA 1QJOA 2HQLA 3HFZB 2NN6I 4QJFA 5KYLA 5C4JB 1F2LA 3TQYA 3ER0A 4OO1H 1A15A 1PZJD 1UEBA 4B9WA 1HNWL 2RCNA 1HR0Q 1LUZA 1JB7A 1Y1WG 4DR7Q 1S5DD 2I5LX 2KHSA 1GUSA 3CCQA 2CFMA 3F2BA 2UUBQ 3J80L 2AQ3B 1AZQA 3SGIA 1PH2A 5KIXA 3A8KE 2EZVA 3MVVA 1TIID 4R9WA 2YTYA 4ZUIA 4DV6L 1BO0A 1GUOA 2IX0A 1R9TH 3CC7A 2NZ1D 4HSVA 4X65L 1YJNA 2F0DA 5H1SE 2FXQA 3E0EA 2A8VA 5EPJA 1EY4A 4CDCC 5C44G 5ELCA 4DV1L 2UUCQ 3R2IA 4ZKBB 1PTOH 3BJUA 4O42A 3DWQA 2J0TD 3G71A 3TRZA 1QVFA 1TWAH 3T13A 3EROA 1LYLA 3HKZE 1C7YA 1TY2A 1DYQA 4RCNA 1Y1WB 4DR5Q 1HTPA 2G5DA 5BR8Q 1WTHA 3Q0AA 4IUTA 4JBJA 2VUMG 1EY8A 2K5HA 2R7DA 5HGTA 3S1MB 2N3SA 4JPBW 3ICEA 1MJCA 1YNND 5EKKA 4IZ8A 1FYCA 2P5ZX 5IYCG 5JJIA 4H0LC 2BOSA 3Q8DA 4IFDH 2KENA 1VDZA 3QG1A 2KUMA 4MNOA 1DONA 1E7ZA 3I72A 1V1QA 5C44B 1IBLL 2NB0A 3DM1A 1SRUA 2F0LA 4GN5A 5E3FA 4XT1B 1CKOA 1BCPF 5LL6X 2BCOA 2F4VQ 3U58A 1BBWA 1STNA 4PZ7A 3GO5A 3CW2C 3ULJA 4OGQC 1VQLA 4KHPQ 4RGTA 1TWFB 3G6JB 1OXVA 2VUMB 5IGFA 4JYAL 2F52A 1L0YB 2RHSB 4NB3A 4Y52H 3TP8A 3L3OC 1H9KA 2Q8TA 3CP0A 4IOCA 2AUJD 1W6KA 4A3IG 3NQIA 2PCFB 4KHZA 3UDFA 1JWSD 2R92H 3FP9A 2IHEA 3I4LA 5IT9c 4L5SA 2XVSA 5LMUQ 3J7A5 1Y1VG 1EZ6A 5FLXE 1JORA 3MXPA 3P20A 2RQXA 4DV3Q 1EOTA 1EIHA 3DEPA 1SNMA 1UE5A 4HEDA 3V2TA 1MJEA 4LMQD 4IQZA 1NJIC 1F9PA 1PMRA 2A6HD 5JPNC 4B9XA 1NMFA 1I6HB 2ZJPA 4UDUC 4NMZA 2RBMA 1N36Q 4GLAC 4KLKA 1VQGA 3LWUA 2KEDA 1EZ8A 1EUJA 1K8AC 2NVYB 2B2VA 3M4YA 2E2IH 3W1GA 5FOBB 1PH4A 2YU9B 1JOQA 4N9TA 1HNZQ 1Y1VB 5FO7B 3PIO3 4B3TQ 3HOXG 2JXMB 1XWEA 4YWMA 3HOVG 4HMIA 3BYYB 1A2UA 2BE5C 4IFDJ 4L5TA 3SK5A 1I5FA 4I7AA 1KAWA 5KNBA 2GVBA 4LW1A 5ELFA 1TKWB 3T51B 3CRKC 1CQFA 1XNRQ 2F0QA 4RH6A 4UP7A 1S3OA 1WD0A 2Z0SA 3MZ5A 1E24A 2K7VA 4LFCL 1CM9A 1N33Q 2AKWB 3S1NH 1VQBA 4Q5VA 1Q90A 2XSCA 2RA4A 4LUVA 1CSPA 3GTQH 4JI4Q 3I4MH 3H0GG 5FJ8G 4C3IG 1Y69U 1L1OA 5ELNA 3HOXB 4A3BH 3HOVB 3TREA 5CV9A 3NK9A 2IX1A 1H9JA 1Z47A 4QL5A 3URYA 2KQ3A 1MD2D 4KK7A 4WORA 5IE8A 1GUWA 2QDLA 4Z9CB 4K2LA 1G291 3NENA 1KDAA 2VQFL 4LF6L 1TWHB 2B2TA 4LF4Q 3DHQA 3HOYG 1FNUA 2DNCA 1XNQL 3J81i 5C4JH 1SYDA 2ZXRA 2B29A 1DGSA 2BH8A 3J80E 3F2UA 3NBHA 1BCPB 1EY5A 4TRDA 1A3VA 2OCEA 5JJKA 3MFGA 1DD2A 1E2WA 5CBAE 2UXDL 3RZOB 4KKSA 4GZYC 4B3ML 3H0GB 1Q46A 1P8LA 3BG3A 3KLRA 4C3IB 2B63H 1RJTA 4FXKC 2SDFA 3OW2A 2EYLA 2K5VA 2H1EA 4FO2A 4LFAQ 3G4SA 4DA2A 3NP8A 1DOKA 2TSSA 3R2TA 1SFOH 2R61A 3KF6A 1Y14B 2F0TA 1ZYRD 1WTQA 3HOZG 1EIYB 3FRPB 4C3JG 3HOYB 1NSNS 4JVZA 3V96A 1X3FA 5EJWA 2DY8A 3A5UA 2SEBD 4YCVA 5D14A 1K73C 3ITPA 1JJ2A 1D6EC 2R3ZA 3K8AA 4MZ9A 2WB1G 4DV5L 1LT5D 3KUPA 5C0XG 1EIGA 4DR2L 2PW5A 1Y1WH 2JA7H 4XQJA 2E2JB 5JJLA 1GKHA 1I4HA 1C9OA 1BR9A 4JI1L 2Z8LA 4KN4C 1X6OA 1HPCA 2C5CA 5IGCA 4KN7C 4FF2A 2UXCL 2Z6BA 1EYGA 1ILPA 5T1GA 1K28A 4B3SQ 4JK1C 1UWVA 4IUQA 2PQEA 4J6HA 1BVSA 4A3MB 3MEFA 4DUZQ 3OOCA 2B2YA 1IKMA 3M3YB 1PRTB 5C44H 1DZ1A 4DPGA 3VR4A 4DNRB 3HOZB 1HRJA 5IOCA 1UEAB 3TSSA 1EY9A 1UNSA 1FR3A 1Y8PB 4POFA 4LF8L 1MIUA 4DAPA 1PH5A 5EPKA 3T1HQ 3GTJB 4HCSA 3VR6A 4HMJA 3CPFA 1B1ZA 1B9MA 1JT8A 1RKNA 5BN3A 3D8GA 1H9SA 3FKIG 1PH6A 2VUMH 1XPRA 1QUQA 3MWYW 1HFGA 4DK0A 1L1OB 5CR3A 3ND8A 3K5OA 2QEJC 1PFMA 2WAQE 3Q6SA 2O2LD 5IYCH 3CCSA 3CCLA 4AQYQ 1VCIA 3RZDB 1JWMD 1E0BA 2R93H 1D5ZC 1B3QA 2DNEA 2CW0C 2MQHA 4GLVB 5COYA 3E9HA 3SHLA 1L2FA 3X3MA 4MN3A 1SMYC 2KVMA 1J6QA 1YBYA 1GUNA 4A3EG 1C4QA 2I07B 1NCVA 1WTXA 1E2ZA 4OELB 3UDIA 4RHRA 3A54A 2NTTA 3W1BA 1C8CA 1HQRD 2N49A 1W6JA 5LMNL 4LF9Q 1Q1BA 1Q12A 1SNOA 1EL0A 4FXDA 1N32L 2F0NA 3I70A 3HOWB 1ESFA 2ZJRA 1ENFA 3C3LA 2L11A 2MPMA 1KAAA 1CKMA 2KEEA 4A3IH 3VR3A 4QY7A 3CPWA 4JI3L 1HFNA 4ABNA 2VW9A 2ZXPA 4GKKL 3F8TA 3KF6B 5FLMG 2JA5G 1ET9A 1GXDC 1UE1A 1Y1VH 3SK4A 3CCUA 2F0UA 3H91A 2NWGA 4A3EB 4NXML 1V1OA 2DJFC 1YITA 1LT3D 1G8ZD 1BCPD 1QZHA 2R7ZG 5C0XI 2K5QA 5M5YB 3HEJA 4JOIA 3TN2A 1IW7C 4EX5A 3OIPA 3GTKH 5I6WA 1WFQA 1LACA 2NN6G 3OIQA 2B8GA 1LTBD 2MO0A 3A8IE 5KYIA 4PV1C 5C5MA 4QF4A 4A3JG 3STBD 3D6WA 1U4MA 2H5XA 4K2KA 1B53A 2B2UA 3U4VA 2JA5B 1LM0A 5HGQA 3TBIB 3S14B 1ICFB 1NY4A 4L6TB 1I94Q 1CQVA 3GDEA 2MNAA 3AEVA 3PO2G 5A35A 2M9VA 3TP5A 3HOXH 2QKIC 3HOVH 2MGSA 1H9SB 1HNXL 2B2VC 4JI2L 1QUQB 3RLNA 4KMUC 4YY3Q 2RDFA 3T4AC 2ZM6L 1ZEQX 5EPLA 1K9MC 3S17H 3S9WA 1W2BA 3NPPA 1FNWA 3H3VC 4A3JB 2QW7A 4KHVA 3UE0A 3MAQA 3BYTB 1SROA 1VQEA 2V1CC 2B3GA 1LT4D 4OHJA 2RF4A 2E8GA 2IHFA 1KD1C 1Y8NB 5JEAG 2KBNA 1X55A 4BBSG 2MHVA 3KBGA 3UI2A 1IBMQ 1BBUA 3CCMA 5D3DA 1IKLA 3H0GH 1VQDA 1O78A 3PO2B 1SSOA 2ALYB 4DR1L 4XT3B 1EYCA 4BY7G 4CJ0B 1U4PA 3L2PA 2QGQA 1NMGA 4J15A 2EXDA 1DCZA 1GVPA 3VYTA 2X6GA 1ENCA 1XYIA 1EU4A 2K14A 3A56A 5CORA 4X64Q 4RGNA 1KNEA 1WCMG 2KCMA 1SBBB 1HZCA 1GUGA 4AYBE 1IBKQ 3HOYH 1FGUA 1WYDA 4DAVA 4DGZA 1J8IA 2H4OA 3I73A 4K0KL 4R4QA 1N34Q 4YHHQ 3PF4A 1WTVA 2Z1CA 2HUGA 2QF7A 5GAEC 4U673 2E2JH 4DR4Q 4KD3A 3GQBA 1HHVA 3QB3A 1VQNA 1PYWD 2PZTA 3E5SA 4ZLTF 2ATWA 2B2TC 2IY5B 4ZRZA 4R4CA 1LT6D 4U68A 3PUWA 3NXWA 3H3VH 5LL6S 1PHJA 2Z6KA 1EYDA 4NW2A 1CKNA 1QNUA 1PFNA 3H94A 1A62A 1V1PA 4X66L 1XMQQ 4NP5A 1TU2B 3NSWA 1BXTA 1IYUA 2NVTH 5IY0A 2FHTA 1KRTA 1PLFA 3DWAA 3D3RA 1WCMB 3J7YW 1KIXA 5DEHA 3HOZH 4OONA 5GADC 4GLXA 2AWOA 1STAA 4C3JH 3UE1A 1H9RA 3H09A 4BS9A 1YVCA 3KBXA 3CC4A 3CCEA 1XPUA 4ODGA 2I5HA 3GTJH 1I4PA 5IYBG 3TS0A 3BZKA 5I2YA 4HJ8A 2F0SA 5J22A 3SK6A 4DR5L 1N8RC 4OEMB 1SLJA 4CKCA 4DK6C 2WKDA 5BR8L 4JI5L 3PUXA 3DUZA 4X3SA 2E76C 2YTVA 3HZXA 4LF5Q 5CV7A 4A3FB 4DXFA 2F0OA 1E3PA 5A2QL 2Q8RE 2D62A 4JI0Q 2LXJA 3OWFA 1CHQD 4TQUS 3DXJC 2KCTA 3QWNA 2PI2A 4JI6L 3S1QB 1PZKD 4E6IA 3OW7A 3ERQA 2EYJA 5IP7G 2EYMA 4PZ8A 4KKUA 1MHWC 4J1MA 1LTLA 5M3FG 5C4XG 4PZ6A 2B2YC 3GTGB 1V43A 1EEFD 1U9RA 3LNNA 1KNAA 3FKIH 2CWPA 4KHPL 4NPSA 1PH7A 3G48A 4K6LA 1II3A 5M5WB 3CRLC 4OX9Q 3TP6A 3SE0A 1YNNC 1PFBA 3MXUA 3JAML 3RN5A 4GOPA 2FJ2A 4NDXA 2F0GA 1F9SA 4DV0L 4X3TA 4X3UA 3JAMc 2B2WA 2VQEQ 2XGTA 1WTRA 3S15H 3F1ZA 1TWGH 1K0RA 3CCJA 3QJYA 4DKAC 3D4RA 3I4NG 3P1HA 1PYSB 5EKIA 3KJOA 4DV1Q 1K8MA 4BBRH 1PVOA 1X3GA 1CSQA 5LHY1 5LMUL 4A3EH 1XPOA 3FVQA 4CKBA 3J7AF 2MO1A 3GTOH 3R8BA 5C3EG 1OXUA 5M3FB 3ULPA 5C4XB 1LTGD 1TY0A 4DV3L 5M5YH 1B8AA 1YZ6A 4HIMA 4EVOA 2OQ0A 4I7ZC 3HRZC 5HY6A 4DR3Q 1KDBA 1CKNB 1FD7D 3RN2A 5IT9L 2PMZE 1XJVA 4KY7A 4EQNA 1V1PB 1ZKOA 5CBEE 3AU7A 3MHBA 1NAPA 1N36L 3M4OB 3TP7A 3UDXA 5K36G 3K6OA 1EWHA 2NVQB 2JA5H 4OXPA 4YIJA 3I4NB 4QGUA 2HCIA 4C1NK 3MC0B 2G9DA 2UUAL 4F8MA 2EQSA 4OWWB 2Q2TA 1EFID 1QVGA 1JJGA 2G9HD 4H7BA 4OWXB 1X9NA 1VF7A 1O80A 3CU7A 5C3EB 3F2CA 2R7ZH 2L0CA 2D0OA 1YI2A 3QIAA 2ZTDA 3S2HH 1RTOA 2AQ1B 1JB3A 3U9OA 1QILA 3S1RB 3D4DA 1D5XC 1VQCA 1PXUA 2A6HC 3K7AH 4JYAQ 4UAIA 2CHBD 2F0WA 2HDMA 1F9QA 1CUKA 4HJ9A 5CV5A 1I4XA 3K0YA 1HZ9A 2E2DC 3GD7A 4DV2L 1XNRL 1JC7A 1TWCH 2NYZD 2BA1A 5D3IB 1R4QB 1SE3A 4UY8C 2QILA 5M5XH 1N33L 3E3XA 1D1KA 4JCVE 4TVAB 5IYDH 3PUZA 1I4QA 3PV0A 3J7AV 4RA8A 5EKLA 4C3HH 4KI0A 2B2UC 3C46A 5M3MH 2IJ0A 1PV4A 3SEBA 2A68C 1TXYA 3MEHA 2CQAA 4P71A 1I3QB 1H95A 4GOPB 4K5XA 2F0KA 2JA8G 5C3WA 4DUYQ 4GN3B 2C35B 3S2DH 3VR5A 4JV5L 4IPHA 3MXNA 4LF4L 1I6VC 1STBA 2NVXH 4RCOA 3PO3G 1E1TA 1U4LA 5CC4A 1FGBD 2E5LQ 4JI8Q 2B8FA 4CKEA 2ZTEA 3NTKA 4BBSH 3EJIA 4ZCKA 4WRDA 4DAYA 5EBCA 2L4NA 1GHJA 2EXZA 1O7ZA 1S5BD 2LXKA 3BVZA 2ID0A 5JPMC 2ES2A 2OTLA 1DJRD 4RWSC 4LF7Q 1PTOF 3OMGA 2D5DA 3SK8A 1JE5A 1FNVA 3OWEB 4BY7H 1O7YA 4KTAA 4X62Q 2K01A 1E22A 3RD4A 4G7HC 2XWJB 4RGMA 1WCMH 1Q3LA 3BS1A 3MFYA 2K52A 3CCRA 4DV4Q 2JA8B 1YHBA 3LWEA 3M7GA 1X56A 1XXGA 4YWKA 3Q22A 2VB2X 1Q82C 4FF3A 3PO3B 2I5MX 1Z9FA 1SE8A 2F3WA 4L5QA 2PO4A 1EQTA 3AFPA 3A7AB 4UHVA 1AFPA 1HUNA 1SYEA 1SDFA 2GVAA 4QUFA 1JCKB 2A73B 4BY1B 1VQ8A 4JW0A 3EVQA 4FF4A 2KJXA 2N8NA 1EIFA 1AW7A 3IL8A 3TZDA 5A2QE 1G6ZA 3GP7A 3QOJA 1K83B 3GTMB 4A3MG 1B4OA 1B3AA 3BU2A 1BF4A 2Q2UA 2F0HA 5C3XA 1X65A 4B3SL 1CT1D 2LFNA 2RDGA 4A75A 3GTLB 2HT1A 4A3KG 2Z6KC 2K6AA 1ZYRC 4LF6Q 4DUZL 2K5NA 3I56A 2N55A 4KJOA 3VYUA 2XRSD 4HJAA 3PGZA 2WACA 3KF8B 2KA7A 5NUCA 1XNQQ 2ASBA 1DM0B 3H6MA 2WFWA 4IJLA 4HJ5A 1LTTD 3S1MH 4GKJL 5ELOA 1GD7A 3T1HL 1D5MC 4PMWA 3JAME 5BN5A 1K3RA 4S3SA 1RD9D 1JWUD 4QB4A 1F77A 1WI5A 3J81c 1VQ7A 4A3DG 1HCZA 1YNXA 1F9RA 2F1MA 3LGJA 4A3LG 4OIKA 5JJZA 2HIXA 2KOLA 1Q86C 4R4TA 3M9BA 4RG1A 4C2MB 1D7QA 3M85A 2LMCB 2EY2A 4AQYL 4A3KB 1SYBA 3A7LA 1RCVD 2DGYA 4IUUA 1WTPA 3MXNB 2VZAA 3VYSA 2JEAI 1X3QA 4FF1A 5IP7H 2XRQD 5E1FA 1IYVA 1TWFH 1MSGA 3S16B 5M3FH 3T1YL 3CHBD 1NR2A 5C4XH 4XQQA 2QDBA 4JI7Q 4DAYB 5IIFA 1A2TA 3AMUA 1JQYD 3HOWG 5IT9E 1EWCA 1AE3A 1CHPD 4J8QA 2VL6A 1PDQA 4HIKA 3P75A 4LF9L 2Q8IB 5ELBA 4A3DB 4QUCA 1VMCA 1Z7TA 3IFDA 3FPUB 4GNXA 1HUMA 1S5CD 4PNYA 4R8NA 4HJ7A 4DV7Q 3NTHA 1YNJC 2VS1A 2A69D 5IGGA 4DR6Q 1OXSC 4NXNQ 4AYBB 2PYKA 3E0JA 2EY6A 3IRBA 1EY7A 2F03A 1SYCA 1XTCD 2AHOB 4GOPC 1STGA 1YHAA 2CW0D 1JICA 2B2WC 3NELA 1UAPA 1Z6HA 3W5OA 1EU3A 5C3EH 2AMCB 1STHA 1EOVA 1A6XA 3T53B 1BUVT 4RHSA 1CZGA 2DUDA 1K3BC 1PTOB 4R4OA 1I6HH 3PCOB 4L63B 3S1RH 4L8JA 1TWAB 3D4WA 4IO9A 2O5IC 3HP3A 4RKLA 4EQPA 3RLFA 3S24A 4RFBA 1Q8KA 2NVYH 2F3IA 5IP9G 4N9PA 1ASZA 1HA6A 4UPAA 2YU9H 4DU9A 1YIJA 5K36H 2WIIB 1VQMA 3RLOA 3H3VI 2EJGC 3HKZG 1WTOA 4HN7A 5G3LF 1KL9A 2HHHL 4G7ZC 3MTSA 4NKLA 2J4XA 1SEBD 4JG2A 5GAGC 1N9WA 3IFTA 1SXTA 4A3CG 2L55A 3OTOQ 1BCPC 1I94L 2SOBA 3NUCA 1ESRA 2A6ED 2F0VA 4M8AA 4P73A 4XTCS 1GUTA 1E2VA 3GV3A 4OO1I 3K57A 2A74C 1FL0A 2I0QA 1EYAA 3PQIA 4APVA 2UXBL 3QO2A 4EGVA 3SVMA 3A8JE 3CAMA 3C1EA 3STBC 3K5NA 1M4VA 4K14A 4DNIA 1MGSA 4WFN3 4ULLA 1WTWA 4C1NI 3VDYA 1IL8A 2HD3A 1F2YA 3K58A 4L5RC 4IOAA 2R92B 2EPBA 3HKZB 4ZKCB 1I50B 3OPOA 1KC8C 3B6YA 1KLGD 3L0OA 2F0EA 3KOJA 3VA5A 1IBML 1KABA 5C5LA 1ASYA 1OTCA 3U9SA 2JA9A 2ZJQA 4LUOA 3PSIA 4CHTB 3KLSX 1ZXTA 1J5EQ 1PH8A 2UU9L 3HOUG 4X3KA 1TWHH 3I4OA 4V190 4H02A 5FLXc 2CVRA 3CC2A 4ILWA 3K0XA 2X69A 5AJ3Q 1O7IA 2JA8H 2Z4IA 1T9HA 5FK9C 1LABA 4GNXB 1GHKA 1QB5D 3BVGA 4QQBX 1QWYA 3I55A 1IBKL 3PO3H 3CKIB 1SR3A 3RZOH 2I46A 1PRTC 4DF7A 4FYDA 1N34L 5FJ8H 4YHHL 4C3IH 2F0JA 5KGUA 2OQKA 1YJWA 5I9OA 1RF2D 4IFDI 1WVLA 4DR4L 2WB1E 2E2IB 5IWAQ 2EJFC 1JOKA 1VQFA 3I8ZA 4CBVA 4DAMA 2WINB 4O2DA 4K5VA 1NE3A 4CGYB 3I4MG 1F2MA 3ERSX 2LY7A 3NEMA 2L15A 5E4WC 1B2TA 1HNXQ 4ALPA 2AWNA 4JI2Q 1QNKA 3HOUB 1G91A 1L1OC 1XTDA 2RSNA 1XMOQ 3CXCA 1AE2A 2XNAC 5DNFA 1XMQL 2PMZB 3GTLH 4A93G 4BA1I 2NBFA 3MXGA 1A3TA 1OXTA 1RHPA 2OEOA 3T16A 3KFUA 1B7YB 1G51A 5IGBA 3CCVA 1HZAA 3BZCA 1R4PB 1C48A 1U5KA 2C9OA 2XN9C 1HR0L 4DR7L 1K8OA 5J3BA 3PMFA 3VA7A 1NTGA 5GQOA 1AH9A 3DWPA 2UUBL 5JVG3 3CF5A 5C6AA 2ZT9C 2RVLA 1TVXA 1PZID 3S1NB 1MI2A 1IHZA 1STYA 4A3FG 3U50C 3J81j 4A3GG 3OHXC 1BQQT 1BBXC 1NNXA 2Y0SE 3I4MB 1PTOD 1QCBD 4GN4B 4A3MH 3PUYA 5IGDA 1S5FD 2JYOA 3NWTA 2EY1A 4A76A 3M3YH 3IAYA 3A55A 5D65A 2D2CC 4XXEA 3FDTA 3Q23A 4C2MH 2PQAA 2WKCA 2Q2HA 3CMEA 3LX0A 2VB3X 5DAUA 4A93B 4JI0L 3K5LA 4F88A 1I4RA 2HCCA 3EIVA 2FFKB 3KJPA 2UUCL 3CQZB 1PFSA 5C0XH 4LFBQ 5EAYA 3VR2A 1QZGA 4FXGC 3UDGA 1FJGQ 4K0KQ 1JOOA 2DY7A 2CKZB 1U0LA 4PMBA 3JAMi 1I4GA 5J1ZA 4FDBA 2HQEA 1NR4A 1VS0A 1L0XB 3R93A 2JA7G 3CMAA 3E9IA 4A3GB 4KY6A 1VQKA 1C0AA 2MJ8A 1SJHD 3RZDH 2F0IA 2PZWA 4POGA 4A3DH 3TS2A 4A3LH 3J80c 4OX9L 3PF5A 1PYBA 2PPBC 4B3RQ 2B63B 2WP8J 4ZQ3A 2WV6D 5BN4A 4X66Q 1SN8A 3RMHA 2VQEL 3ONAB 2JA6G 2N78A 4KY5A 1AZPA 3AFQA 4KV6A 2JP1A 5ELEA 1SFOB 3EFXD 1HNWQ 1Q8IA 2F4VL 3I90A 1S4ZA 5C4ZA 1B70B 3T56B 5LMNW 4XYQA 1OO9B 2M2LA 4YCWA 2EYOA 3DM3A 2IPKD 2EJMA 3HOWH 1X3EA 4DV6Q 2JA7B 4X65Q 3NHHA 1L0WA 4JI5Q 2MFIA 1STEA 4DR3L 5EBDA 3MA2B 1GM5A 1ML0D 1ONLA 3Q24A 2OT2A 2CH4W 4PQXA 1SE2A 3WOFA 2QEXA 1M8AA 4RGOS 2JA6B 4RMFA
chains in the Genus database with same CATH topology
3WDNA 1SNQA 1U4RA 4HSPA 5JOBA 3OMCA 3W2DA 2IW3A 1AEXA 1UUPA 4LK1C 2O5JC 4I65A 4IUPA 2L9HA 3OSOA 1X32A 1HXYD 3NWSA 3SXHA 2F3VA 5C0XJ 4ZUJA 3GTPB 2E2HB 5KNCA 2RKSA 4IURA 4CJ2C 1EEID 1S5ED 1TQOA 4KKTA 4ZAIA 1SYGA 2K32A 2ICIA 2K05A 2R93B 1RTNA 5ISRA 1CFMA 1CA5A 4CJ1B 1NUCA 5JAVA 2NN6H 1VMPA 4ZK9B 1BOSA 3GV6A 1LTAD 5CV6A 1BNZA 1KTKA 2J7ZA 1AP0A 3L7ZC 4IN3A 3KF8A 2EOTA 4KJNA 2EYPA 1TS4A 2BA0A 2EYHA 2XIWA 4HR7B 3C2PA 2MUYA 4A3IB 4B08A 4IUNA 2LS01 5CGKA 1PRTF 3SR1A 1TR5A 1Y8OB 4Y7NB 5FO8B 1B50A 5G3LD 5JVH3 4C56C 2BE5D 1XX8A 2PNRC 5I9PA 2ZXOA 3ZYYX 3E6ZX 4LJZC 2KCNA 2PZUA 2WAQB 2A68D 3ND9A 2AUKA 4ID6A 3GTKB 3BDCA 1BDOA 5JEAH 1TS2A 4QCLA 3TZUA 2A5HA 3I3CA 1SNDA 4H44C 3VYRA 1KDCA 4EQOA 3D6CA 1GOZA 3K59A 4K5WA 3O13A 5CV8A 3V05A 3SDZA 2F0MA 3DMUA 1KLUD 4FP5D 4FNFA 3WOEA 5EQ0A 3P7JA 3KLSA 3S17B 4DK1A 1CK1A 2KECA 2M00A 2DN8A 4WJWA 3M7NA 1JE4A 2Z4HA 2BDNA 1QOHA 1SJED 3I91A 3X3NA 2ICEC 1J9OA 4K8IA 2JE6I 2RSOA 1QE6A 3HGBA 2OXPA 2FMMA 4QMGA 2L5TA 2RDHA 5E4XA 2N88A 2YYZA 4R8IA 2K33A 2L12A 5J39A 2K1BA 2V4DA 1G2SA 5CMDA 4OO1G 5C4HA 2LKVA 1X3PA 4ZYSA 3RUZA 1SNCA 3J81L 1G2TA 1WD1A 2X6LA 4DFAA 5ELDA 2F4IA 3PUVA 5JEAJ 2IX3A 1SE4A 2K5WA 4PMCA 2F0FA 3N6RA 1V8QA 4XYOA 3FEWX 2NVTB 5I4DA 4BWGB 2EDGA 3PIP3 2EVBA 2R6GA 4C3JB 1VF5C 1RODA 1AN8A 3QOLA 2VNUD 4ME5A 4RAUC 2WB1B 2XWBB 4LAAA 4BA2I 4F87A 4DXGA 3BDLA 1EY0A 1R9TB 2B39A 1LLRD 1HA5A 4K6DA 5EGTA 1JR0D 4IFDG 2A69C 5KNDA 5IODA 1SNPA 4XIGS 1SMYD 1YNJD 5F2DA 1T5EA 1B9NA 2K28A 1CA6A 2EY5A 4RKBA 2F0PA 2IT1A 5FKAC 4OL7A 2K5DA 4O1NA 4IALA 5DM73 4JBWA 2Y0SB 2JEBI 3FKIB 2L1BA 4Q0FA 5TSSA 4MIUA 2VXWA 1MBYA 4DN4M 4K8JA 1H9MA 4P2CB 1EY6A 2GA4B 5T1IA 3BZDB 3TMEA 4F7XA 3L9AX 4OIJA 1LTRD 3S15B 1TWGB 2IWHA 1HTLD 3FPPA 3G7LA 1D1IA 4TSSA 5HURA 4IUVA 1ICWA 4BBRB 2JSOA 3EQLC 1O7LA 3AB9A 2A6EC 1T5XD 4XQNA 2FINB 3GTOB 1IW7D 3NBIA 2HDLA 2AQ2B 4TKOB 2QCPX 2D9UA 3N52A 1OXXK 2OF1A 2EYFA 1MSHA 1CTMA 2E74C 4XDXA 5CV4A 3NE5B 1ET6A 1HQMC 5K5PA 4MHEA 4G57A 5FLXL 2E75C 3NQTA 1CZWA 1TT2A 5KRUA 1A3UA 4M1UB 2PW7A 3HS0C 1D2BA 4C3HG 2NTSA 2KCCA 1QG7A 3DEOA 4DNTB 2R7ZB 5FO9B 3S2HB 3EA6A 2SNMA 1EQVA 3K7AB 3K5MA 4G4KA 3TDQA 3R3OA 1SYFA 1Q1EA 4V0BA 1LV9A 1B44D 1TWCB 4HTHA 2BDOA 3FMCA 1DOLA 1PRTD 1LO5D 1DOMA 1GJXA 5M5XB 3NTIA 5M9OA 1LTSD 3D31A 1RDPD 3HG9A 3W3AA 1TS3A 2FMCA 1F2ZA 3BVMA 4C3HB 1SAPA 2NUCA 5M3MB 1LTID 5I6YA 1ILQA 4FVMA 2EE1A 3KK7A 2O4XA 2TMPA 4HAEA 5AFWA 1DXMA 3IKJA 2K04A 3BDOA 3J81E 3S2DB 2IL8A 4H13C 2NVXB 3GTQB 5I2XA 1CI3M 5IGEA 5DM63 4BBSB 4G7OC 4A3BB 3C1FA 1PTOC 4QIWB 2K03A 2MP1A 2SNSA 5CYUA 1ENAA 5KEEA 4BY7B 2ENBA 4KD4A 1TS5A 4HCEA 1QJOA 5KYLA 2NN6I 5C4JB 1F2LA 4OO1H 1A15A 1PZJD 4B9WA 1S5DD 2KHSA 1GUSA 3J80L 2AQ3B 1AZQA 5KIXA 3A8KE 2EZVA 3MVVA 1TIID 4R9WA 4ZUIA 1BO0A 1GUOA 2IX0A 2NZ1D 4HSVA 2F0DA 5EPJA 1EY4A 5ELCA 3R2IA 4ZKBB 1PTOH 4O42A 3DWQA 2J0TD 3T13A 3EROA 1TY2A 1DYQA 4RCNA 1Y1WB 1HTPA 3Q0AA 4IUTA 1EY8A 5HGTA 3S1MB 1YNND 5EKKA 4IZ8A 1FYCA 4H0LC 2BOSA 4IFDH 1VDZA 3QG1A 2KUMA 1DONA 3I72A 5C44B 2NB0A 3DM1A 2F0LA 5E3FA 4XT1B 1BCPF 5LL6X 2BCOA 1STNA 3GO5A 4OGQC 4RGTA 1TWFB 3G6JB 1OXVA 2VUMB 5IGFA 1L0YB 3TP8A 3L3OC 1H9KA 2Q8TA 2AUJD 1W6KA 3NQIA 2PCFB 4KHZA 1JWSD 3I4LA 2XVSA 1EZ6A 5FLXE 1JORA 3MXPA 3P20A 2RQXA 1EOTA 1EIHA 3DEPA 1SNMA 4HEDA 3V2TA 4LMQD 4IQZA 1F9PA 1PMRA 2A6HD 5JPNC 4B9XA 1I6HB 4UDUC 4NMZA 2RBMA 3LWUA 2KEDA 1EZ8A 2NVYB 2B2VA 3M4YA 5FOBB 2YU9B 1JOQA 4N9TA 1Y1VB 5FO7B 3PIO3 2JXMB 1XWEA 4HMIA 3BYYB 1A2UA 2BE5C 4IFDJ 3SK5A 5KNBA 5ELFA 1TKWB 3T51B 3CRKC 1CQFA 2F0QA 4RH6A 1WD0A 3MZ5A 2K7VA 1CM9A 4Q5VA 1Q90A 2XSCA 2RA4A 4C3IG 1Y69U 3HOXB 3HOVB 5CV9A 3NK9A 2IX1A 1H9JA 1Z47A 3URYA 2KQ3A 1MD2D 4KK7A 4WORA 1GUWA 4Z9CB 4K2LA 1G291 1KDAA 1TWHB 2B2TA 3DHQA 1FNUA 2DNCA 1SYDA 2ZXRA 3J80E 3F2UA 3NBHA 1BCPB 1EY5A 4TRDA 1A3VA 3MFGA 1DD2A 1E2WA 5CBAE 3RZOB 4KKSA 4GZYC 3H0GB 3BG3A 3KLRA 4C3IB 1RJTA 4FXKC 2SDFA 2EYLA 2H1EA 4FO2A 4DA2A 3NP8A 1DOKA 2TSSA 3R2TA 2R61A 2F0TA 1ZYRD 1WTQA 3FRPB 4C3JG 3HOYB 1NSNS 3V96A 5EJWA 2DY8A 2SEBD 5D14A 3ITPA 1D6EC 2R3ZA 1LT5D 3KUPA 5C0XG 1EIGA 2E2JB 2PW5A 4XQJA 1I4HA 1BR9A 2Z8LA 4KN4C 1HPCA 2C5CA 5IGCA 4KN7C 4FF2A 1ILPA 5T1GA 4JK1C 4IUQA 2PQEA 4J6HA 4A3MB 3OOCA 2B2YA 1IKMA 3M3YB 1PRTB 1DZ1A 3VR4A 4DNRB 3HOZB 1HRJA 5IOCA 1UEAB 3TSSA 1EY9A 1UNSA 1FR3A 1Y8PB 4DAPA 5EPKA 3GTJB 4HCSA 3VR6A 4HMJA 1B1ZA 1B9MA 1RKNA 5BN3A 3D8GA 1H9SA 3MWYW 1HFGA 4DK0A 5CR3A 3ND8A 3K5OA 2QEJC 1PFMA 3Q6SA 2O2LD 1VCIA 3RZDB 1JWMD 1E0BA 1D5ZC 2DNEA 5COYA 2CW0C 3X3MA 3SHLA 4MN3A 1SMYC 2KVMA 1GUNA 1C4QA 2I07B 1NCVA 1WTXA 1E2ZA 4RHRA 3A54A 2NTTA 1C8CA 1HQRD 1W6JA 1Q1BA 1Q12A 1SNOA 1EL0A 4FXDA 2F0NA 3I70A 3HOWB 1ESFA 1ENFA 3C3LA 2L11A 2MPMA 1KAAA 2KEEA 3VR3A 1HFNA 4ABNA 2ZXPA 1ET9A 1GXDC 3SK4A 2F0UA 3H91A 2NWGA 4A3EB 1V1OA 1LT3D 1G8ZD 1BCPD 5C0XI 2K5QA 5M5YB 3HEJA 3TN2A 1IW7C 3OIPA 5I6WA 1LACA 2NN6G 3OIQA 2B8GA 1LTBD 3A8IE 5KYIA 4PV1C 5C5MA 4QF4A 3D6WA 1U4MA 4K2KA 1B53A 2B2UA 2JA5B 3TBIB 3S14B 4L6TB 1CQVA 5A35A 2M9VA 3TP5A 2QKIC 2MGSA 1H9SB 2B2VC 4KMUC 2RDFA 3T4AC 1ZEQX 5EPLA 3S9WA 3NPPA 1FNWA 3H3VC 4A3JB 4KHVA 3MAQA 3BYTB 1LT4D 4OHJA 1Y8NB 5JEAG 2MHVA 3KBGA 3UI2A 5D3DA 1IKLA 1O78A 3PO2B 1SSOA 4XT3B 1EYCA 4CJ0B 1U4PA 1DCZA 3VYTA 2X6GA 1ENCA 1XYIA 1EU4A 3A56A 5CORA 4RGNA 1KNEA 1SBBB 1GUGA 4DAVA 4DGZA 1J8IA 2H4OA 3I73A 1WTVA 2Z1CA 2HUGA 2QF7A 4U673 4KD3A 3GQBA 1HHVA 3QB3A 1PYWD 2PZTA 3E5SA 4ZLTF 2B2TC 4ZRZA 1LT6D 4U68A 3PUWA 3NXWA 5LL6S 1EYDA 4NW2A 1QNUA 1PFNA 3H94A 1V1PA 4NP5A 1TU2B 3NSWA 1BXTA 1IYUA 2FHTA 1PLFA 3DWAA 3D3RA 1WCMB 3J7YW 5DEHA 2AWOA 1STAA 1H9RA 3H09A 4BS9A 3KBXA 4ODGA 1I4PA 5I2YA 2F0SA 5J22A 3SK6A 4CKCA 2WKDA 3PUXA 3DUZA 4X3SA 2E76C 3HZXA 5CV7A 4A3FB 4DXFA 2F0OA 5A2QL 2Q8RE 2D62A 3OWFA 1CHQD 4TQUS 3DXJC 3QWNA 3S1QB 1PZKD 4E6IA 3OW7A 3ERQA 2EYJA 2EYMA 4KKUA 4J1MA 2B2YC 3GTGB 1V43A 1EEFD 1U9RA 3LNNA 1KNAA 4K6LA 5M5WB 1II3A 3CRLC 3TP6A 3SE0A 1YNNC 1PFBA 3MXUA 3JAML 2FJ2A 4NDXA 2F0GA 1F9SA 4X3TA 4X3UA 2B2WA 1WTRA 3QJYA 3D4RA 3P1HA 5EKIA 1K8MA 5LHY1 3FVQA 4CKBA 3J7AF 3R8BA 1OXUA 5M3FB 5C4XB 1LTGD 1TY0A 4EVOA 4I7ZC 3HRZC 1KDBA 1FD7D 5IT9L 4KY7A 4EQNA 1V1PB 1ZKOA 5CBEE 3AU7A 3MHBA 1NAPA 3M4OB 3TP7A 5K36G 3K6OA 1EWHA 2NVQB 4YIJA 3I4NB 2HCIA 4C1NK 3MC0B 2G9DA 4F8MA 1EFID 2G9HD 4H7BA 1VF7A 1O80A 3CU7A 5C3EB 2L0CA 3QIAA 1RTOA 2AQ1B 1JB3A 3U9OA 1QILA 3S1RB 3D4DA 1D5XC 2A6HC 1PXUA 4UAIA 2CHBD 2F0WA 2HDMA 1F9QA 5CV5A 1I4XA 3K0YA 2E2DC 3GD7A 1JC7A 2NYZD 2BA1A 5D3IB 1R4QB 1SE3A 2QILA 1D1KA 3PUZA 1I4QA 3PV0A 3J7AV 4RA8A 5EKLA 4KI0A 2B2UC 3C46A 2IJ0A 3SEBA 2A68C 3MEHA 2CQAA 1I3QB 4K5XA 2F0KA 5C3WA 3VR5A 3MXNA 1I6VC 1STBA 4RCOA 1U4LA 5CC4A 1FGBD 2B8FA 4CKEA 3NTKA 3EJIA 4DAYA 4WRDA 5EBCA 2L4NA 1GHJA 2EXZA 1O7ZA 1S5BD 3BVZA 2ID0A 5JPMC 1DJRD 4RWSC 1PTOF 3OMGA 2D5DA 3SK8A 1FNVA 3OWEB 1O7YA 4KTAA 2K01A 3RD4A 4G7HC 2XWJB 4RGMA 1Q3LA 3BS1A 3MFYA 2JA8B 3LWEA 3M7GA 1XXGA 3Q22A 2VB2X 4FF3A 3PO3B 2F3WA 2PO4A 1EQTA 3A7AB 1AFPA 1HUNA 1SYEA 1SDFA 4QUFA 1JCKB 2A73B 4BY1B 3EVQA 4FF4A 2KJXA 5A2QE 1AW7A 3IL8A 3TZDA 1G6ZA 3GP7A 3QOJA 1K83B 3GTMB 1B4OA 1B3AA 1BF4A 2F0HA 5C3XA 1CT1D 2LFNA 2RDGA 3GTLB 2K6AA 1ZYRC 2N55A 4KJOA 3VYUA 2XRSD 2WACA 2KA7A 5NUCA 1DM0B 3H6MA 1LTTD 1D5MC 4PMWA 3JAME 5BN5A 4S3SA 1RD9D 1JWUD 4QB4A 1F77A 1HCZA 1F9RA 2F1MA 4OIKA 5JJZA 2KOLA 4C2MB 3M85A 2LMCB 2EY2A 4A3KB 1SYBA 3A7LA 1RCVD 4IUUA 1WTPA 3VYSA 2JEAI 1X3QA 4FF1A 2XRQD 5E1FA 1IYVA 1MSGA 3S16B 3CHBD 1NR2A 4XQQA 2QDBA 5IIFA 1A2TA 3AMUA 1JQYD 5IT9E 1EWCA 1CHPD 4J8QA 1PDQA 3P75A 2Q8IB 5ELBA 4A3DB 4QUCA 1VMCA 1Z7TA 3IFDA 3FPUB 1HUMA 1S5CD 4PNYA 4R8NA 3NTHA 1YNJC 2A69D 5IGGA 1OXSC 4AYBB 2PYKA 3E0JA 2EY6A 2F03A 1EY7A 1SYCA 1XTCD 1STGA 2CW0D 1JICA 2B2WC 1UAPA 1Z6HA 1EU3A 1STHA 1A6XA 3T53B 1BUVT 4RHSA 1CZGA 1PTOB 4L63B 4L8JA 1TWAB 3D4WA 2O5IC 3HP3A 4RKLA 4EQPA 3RLFA 4RFBA 4N9PA 1HA6A 4DU9A 5K36H 2WIIB 2EJGC 1WTOA 4HN7A 5G3LF 4G7ZC 3MTSA 4NKLA 2J4XA 1SEBD 3IFTA 1SXTA 2L55A 1BCPC 2SOBA 3NUCA 1ESRA 2A6ED 2F0VA 4M8AA 4XTCS 1GUTA 1E2VA 3GV3A 4OO1I 3K57A 2A74C 1EYAA 3QO2A 4EGVA 3SVMA 3A8JE 3C1EA 3K5NA 1M4VA 4K14A 1MGSA 4WFN3 4ULLA 1WTWA 4C1NI 1IL8A 1F2YA 3K58A 2R92B 2EPBA 3HKZB 4ZKCB 1I50B 3OPOA 1KLGD 2F0EA 3VA5A 1KABA 5C5LA 3U9SA 4CHTB 3KLSX 1ZXTA 4X3KA 4V190 2CVRA 4ILWA 2X69A 2Z4IA 5FK9C 1LABA 1GHKA 1QB5D 3BVGA 1QWYA 3CKIB 2I46A 1PRTC 4DF7A 4FYDA 2F0JA 5KGUA 5I9OA 1RF2D 4IFDI 1WVLA 2E2IB 2EJFC 1JOKA 3I8ZA 4CBVA 2WINB 4K5VA 4CGYB 1F2MA 2LY7A 5E4WC 1B2TA 2AWNA 1QNKA 3HOUB 1G91A 2RSNA 2XNAC 5DNFA 2PMZB 4BA1I 2NBFA 3MXGA 1A3TA 1OXTA 1RHPA 2OEOA 3T16A 5IGBA 1R4PB 1C48A 2C9OA 2XN9C 1K8OA 3PMFA 3VA7A 3DWPA 5JVG3 5C6AA 2ZT9C 2RVLA 1TVXA 1PZID 3S1NB 1MI2A 1IHZA 1STYA 3OHXC 1BQQT 1BBXC 3I4MB 1PTOD 1QCBD 3PUYA 5IGDA 1S5FD 2JYOA 3NWTA 2EY1A 3IAYA 3A55A 5D65A 2D2CC 4XXEA 3FDTA 3Q23A 2WKCA 3LX0A 2VB3X 5DAUA 4A93B 3K5LA 4F88A 1I4RA 2HCCA 2FFKB 3CQZB 5C0XH 3VR2A 4FXGC 1JOOA 2DY7A 4PMBA 1I4GA 5J1ZA 2HQEA 1NR4A 1L0XB 3R93A 4A3GB 4KY6A 2MJ8A 1SJHD 2F0IA 2PZWA 2PPBC 2B63B 2WP8J 4ZQ3A 2WV6D 5BN4A 3RMHA 3ONAB 4KY5A 1AZPA 4KV6A 2JP1A 5ELEA 1SFOB 3EFXD 1Q8IA 3I90A 1S4ZA 5C4ZA 3T56B 4XYQA 1OO9B 2M2LA 2EYOA 2IPKD 2EJMA 2JA7B 3NHHA 1STEA 5EBDA 3MA2B 1ML0D 1ONLA 3Q24A 2OT2A 4PQXA 1SE2A 3WOFA 1M8AA 4RGOS 2JA6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ID6 A;  3C1E A;  1SNQ A;  3T13 A;  3ERO A;  4F7X A;  1F2Z A;  2F0S A;  4K14 A;  4YIJ A;  3SK6 A;  4DFA A;  5J22 A;  5JOB A;  3OMC A;  1EZ8 A;  2NUC A;  3S9W A;  2QDB A;  5IIF A;  1A2T A;  5I6Y A;  2EYL A;  5IGD A;  1AEX A;  2EY1 A;  3BDC A;  4KHV A;  4F8M A;  1F2Y A;  1EY8 A;  2O4X A;  5HGT A;  3NP8 A;  1JOQ A;  3HZX A;  4H7B A;  4N9T A;  3P75 A;  4I65 A;  5CV7 A;  5HUR A;  3OSO A;  3LX0 A;  5DAU A;  2F0O A;  1SND A;  3OWF A;  2F0E A;  2F0T A;  1SNO A;  2F0F A;  4PMC A;  5EKK A;  2F0N A;  3VA5 A;  1KDC A;  1KAB A;  4IZ8 A;  1NSN S;  5C5L A;  3SXH A;  3U9O A;  2F3V A;  3D6C A;  3D4D A;  2F3W A;  4PNY A;  4HMI A;  4R8N A;  4EQO A;  4ZUJ A;  1A2U A;  3ITP A;  1KAA A;  1SYE A;  5IGG A;  4K5W A;  2RKS A;  3SK5 A;  4E6I A;  3ERQ A;  1EYC A;  2PYK A;  5CV8 A;  1JOO A;  2EYJ A;  2EY6 A;  2PW5 A;  1EY7 A;  2EYM A;  1SYC A;  2F0W A;  4PMB A;  4J1M A;  1TQO A;  2F0M A;  3EVQ A;  5CV5 A;  5J1Z A;  5IGE A;  2HQE A;  1STG A;  2F0L A;  3QOJ A;  1ENC A;  5E1F A;  3C1F A;  5E3F A;  5IGC A;  1SYG A;  2OF1 A;  1U9R A;  3DMU A;  3QOL A;  2EYF A;  1STN A;  4ME5 A;  2F0H A;  2F0Q A;  2SNS A;  4KY6 A;  1ENA A;  1STH A;  2F0U A;  3SK4 A;  5C3X A;  5KEE A;  5ISR A;  4LAA A;  3MZ5 A;  2F0I A;  2PZW A;  1II3 A;  5CV4 A;  4ZQ3 A;  3TP6 A;  4DF7 A;  2ENB A;  3D4W A;  2PQE A;  1NUC A;  3BDL A;  4DGZ A;  1EY0 A;  4J6H A;  5JAV A;  4KD4 A;  5IGF A;  4NDX A;  2F0J A;  2F0G A;  2M00 A;  3HEJ A;  4RKL A;  4EQP A;  4KJO A;  4G57 A;  5I9O A;  5K5P A;  5EKL A;  5KGU A;  3NQT A;  2WAC A;  5KYL A;  3TP8 A;  1TT2 A;  5NUC A;  5KRU A;  1A3U A;  4K6D A;  4KY5 A;  4KD3 A;  3H6M A;  5EGT A;  5I6W A;  2PW7 A;  4KV6 A;  3QB3 A;  5IOC A;  2PZT A;  3E5S A;  1JOK A;  4N9P A;  5CV6 A;  4B9W A;  1EY9 A;  3MEH A;  5KYI A;  5IOD A;  1SNP A;  4K5V A;  3P1H A;  5CV9 A;  1F2M A;  2KHS A;  3NXW A;  4DU9 A;  5C4Z A;  5C5M A;  4QF4 A;  3NK9 A;  5F2D A;  4KJN A;  1EYD A;  4K5X A;  2EYP A;  2KQ3 A;  4WOR A;  2F0K A;  2SNM A;  2EYO A;  4HMJ A;  2EYH A;  1EQV A;  5C3W A;  4K2K A;  2EY5 A;  1RKN A;  4K8I A;  4K2L A;  3D8G A;  1EZ6 A;  4S3S A;  4RKB A;  2F0P A;  1KDA A;  5KIX A;  4QB4 A;  1JOR A;  3MXP A;  2OXP A;  3MVV A;  4NP5 A;  3R3O A;  4IUN A;  4OL7 A;  4QMG A;  4ZUI A;  1A3T A;  1STB A;  5CGK A;  4NKL A;  5CC4 A;  3DHQ A;  4EVO A;  2OEO A;  1TR5 A;  5CR3 A;  3SR1 A;  3T16 A;  2F0D A;  3NHH A;  1SNM A;  3V2T A;  2SOB A;  1SYD A;  5IGB A;  3NUC A;  1SYF A;  2F0V A;  4IAL A;  5DEH A;  1KDB A;  2EY2 A;  1STA A;  3EJI A;  1EY4 A;  3TP5 A;  4HTH A;  4WRD A;  3PMF A;  5J39 A;  1EY5 A;  1SYB A;  4TRD A;  1A3V A;  4KY7 A;  2EXZ A;  4EQN A;  4B9X A;  4MIU A;  5I9P A;  4ODG A;  5C4H A;  5C6A A;  3MHB A;  3OMG A;  2LKV A;  4K8J A;  3SK8 A;  1EYA A;  2RDF A;  4NMZ A;  1EY6 A;  3RUZ A;  1SNC A;  2RBM A;  3SHL A;  3TME A;  1IHZ A;  1STY A;  3TP7 A;  5M9O A;  4KTA A;  2PZU A; 
#chains in the Genus database with same CATH topology
 3WDN A;  2JQO A;  2R93 G;  1SNQ A;  4JI6 Q;  4JBM A;  1U4R A;  1RIP A;  4HSP A;  5JOB A;  3OMC A;  3W2D A;  4GNX C;  1UE7 A;  2IW3 A;  2XTI A;  1AEX A;  5E7N A;  1UUP A;  4LK1 C;  2O5J C;  4I65 A;  4IUP A;  2L9H A;  3OSO A;  1X32 A;  3A5Z B;  1HXY D;  4WJ3 M;  3NWS A;  4P72 A;  1D8L A;  3SXH A;  3KYH C;  2F3V A;  5C0X J;  4ZUJ A;  4AIM A;  1P16 A;  3GTP B;  2E2H B;  5KNC A;  2RKS A;  5IP9 H;  5FLM H;  4IUR A;  4DV0 Q;  4CJ2 C;  2BH2 A;  2PQA B;  1EEI D;  1IBL Q;  1S5E D;  2K50 A;  3S14 H;  1TQO A;  4KKT A;  1HH2 P;  1A0I A;  4ZAI A;  1M1K C;  1HNZ L;  1SYG A;  2K32 A;  2ICI A;  2K05 A;  1I50 H;  1GO3 E;  1HZB A;  2R93 B;  1IYJ B;  1RTN A;  3AYH B;  5ISR A;  3U4Z A;  4B3T L;  1CFM A;  4A3C H;  1CA5 A;  4CJ1 B;  1NUC A;  5JAV A;  4X6A H;  3KLW A;  2NN6 H;  1VMP A;  4ZK9 B;  4QIW E;  1BOS A;  3GV6 A;  2WAQ G;  1FVI A;  1LTA D;  4A3J H;  5CV6 A;  1BNZ A;  1KTK A;  2J7Z A;  4AH6 A;  4JOI C;  1AP0 A;  1VQJ A;  3L7Z C;  4IN3 A;  3KF8 A;  2EOT A;  2RHQ B;  4KJN A;  2EYP A;  3ULL A;  4DUY L;  1TS4 A;  2BA0 A;  2EYH A;  3K80 C;  2XIW A;  4HR7 B;  3C2P A;  2MUY A;  4A3I B;  4B08 A;  3HKS A;  3A74 A;  4IUN A;  1YEZ A;  2LS0 1;  5CGK A;  3AQQ A;  2E5L L;  1PRT F;  3PO2 H;  4JI8 L;  4JI4 L;  3SR1 A;  1TR5 A;  2NZO A;  2UUA Q;  2HIV A;  1Y8O B;  4Y7N B;  5FO8 B;  1B50 A;  5G3L D;  3F2D A;  5JVH 3;  4C56 C;  2BE5 D;  1XX8 A;  2PNR C;  5I9P A;  4LF7 L;  4IJH A;  2ZXO A;  3ZYY X;  3E6Z X;  1A63 A;  3HOU H;  4LJZ C;  2KCN A;  4X62 L;  2PZU A;  2WAQ B;  2A68 D;  3ND9 A;  2AUK A;  4ID6 A;  2CWA A;  1SMX A;  1NBW A;  3I7F A;  3D0F A;  3GTK B;  4IPC A;  1MKH A;  3BDC A;  1BDO A;  2DJG C;  5GAH C;  5JEA H;  4DV4 L;  1TS2 A;  4QCL A;  4YCU A;  3TZU A;  4DV2 Q;  2A5H A;  1HR0 W;  4BY1 G;  4BXX G;  3I3C A;  1SND A;  1YHQ A;  1KQS A;  4H44 C;  3VYR A;  1KDC A;  3KDF A;  2GN5 A;  4EQO A;  3D6C A;  1IXR A;  1GOZ A;  3K59 A;  4K5W A;  3CD6 A;  3O13 A;  5CV8 A;  3V05 A;  3SDZ A;  2F0M A;  1KXL A;  4N8X 1;  4LFA L;  1K0S A;  3WWV A;  3DMU A;  4A93 H;  4GS3 A;  1KLU D;  4FP5 D;  3RNU A;  3QR8 A;  3CQZ H;  4FNF A;  1PH9 A;  3WOE A;  4LFC Q;  1VQA A;  5EQ0 A;  3P7J A;  4JV5 Q;  3KLS A;  3S17 B;  4DK1 A;  1CK1 A;  2KEC A;  2M00 A;  2DN8 A;  3FHW A;  4WJW A;  1Q81 C;  3M7N A;  4JBK A;  1JE4 A;  2Z4H A;  2BDN A;  1QOH A;  4MTN A;  2RCF A;  1SJE D;  2EIF A;  3I91 A;  4A3F H;  4A3G H;  3X3N A;  2ICE C;  1J9O A;  4K8I A;  2JE6 I;  2RSO A;  1QE6 A;  3HGB A;  2OXP A;  2FMM A;  4QMG A;  2VQF Q;  2L5T A;  2KHJ A;  2K4K A;  1W3S A;  2RDH A;  5E4X A;  3S1Q H;  4LUZ A;  2N88 A;  4OWT B;  1HJP A;  2YYZ A;  4R1J A;  4R8I A;  2K33 A;  4UP9 A;  3GTG H;  2L12 A;  5J39 A;  5IYB H;  2K1B A;  2V4D A;  4WJ4 A;  1G2S A;  5CMD A;  4OO1 G;  5C4H A;  5DLQ E;  2LKV A;  5GRO A;  1X3P A;  4ZYS A;  2UXD Q;  3RUZ A;  4EQ5 A;  1SNC A;  5M5W H;  1PH1 A;  3J81 L;  1G2T A;  4B3M Q;  1WD1 A;  1EWI A;  4IPG A;  2X6L A;  4DFA A;  4JI7 L;  3RR5 A;  4JC0 A;  2Z9H A;  5ELD A;  1UE6 A;  2F4I A;  3PUV A;  5JEA J;  2IX3 A;  1SE4 A;  4AYB G;  3ZJY C;  2K5W A;  4N8F A;  4PMC A;  2F0F A;  5L37 A;  3N6R A;  1V8Q A;  4XYO A;  3FEW X;  2JA6 H;  4DV7 L;  2PNH A;  4DR6 L;  2NVT B;  4NXN L;  5I4D A;  4DV5 Q;  4LWC A;  4DR2 Q;  2PI2 E;  2EDG A;  4BWG B;  3PIP 3;  2EVB A;  2R6G A;  1YJ9 A;  4C3J B;  1VF5 C;  2ZTC A;  4JI1 Q;  1ROD A;  3KDF B;  1AN8 A;  4GKJ Q;  3QOL A;  2VNU D;  4ME5 A;  4RAU C;  2UXC Q;  2WB1 B;  2XWB B;  2LSS A;  4LAA A;  4HIO A;  4BA2 I;  4F87 A;  4DXG A;  2Y0S G;  3M4O H;  2CH4 A;  3BDL A;  1EY0 A;  1WOC A;  1R9T B;  2E2H H;  3GTP H;  2B39 A;  2NVQ H;  1LLR D;  3I4N H;  1HA5 A;  3PIO A;  4K6D A;  5EGT A;  1JR0 D;  1Q7Y C;  4IFD G;  2A69 C;  5KND A;  4R4I A;  5IOD A;  1SNP A;  4XIG S;  1SMY D;  1YNJ D;  5F2D A;  1T5E A;  4LF8 Q;  3M4Q A;  3G6E A;  2CCZ A;  1B9N A;  2K28 A;  2R7F A;  3OYY A;  4P75 A;  1CA6 A;  2A1A A;  2EY5 A;  4ME3 A;  4BBR G;  4RKB A;  2F0P A;  2IT1 A;  5FKA C;  4OL7 A;  3T1Y Q;  3NBH B;  2K5D A;  3OTO L;  4O1N A;  3DLL A;  2NZH A;  2K75 A;  4IAL A;  5DM7 3;  4IPD A;  4JBW A;  2Y0S B;  2JEB I;  3FKI B;  2L1B A;  1KHI A;  4Q0F A;  5TSS A;  4MIU A;  2VXW A;  2YV5 A;  1MBY A;  4DN4 M;  4K8J A;  1H9M A;  4P2C B;  1EY6 A;  2GA4 B;  3K7U C;  3BZD B;  5T1I A;  3TME A;  4F7X A;  1EFW A;  2R92 G;  3L9A X;  4CDF C;  2OWO A;  1WJJ A;  2JK8 A;  4OIJ A;  1LTR D;  3I2Z A;  3S15 B;  1TWG B;  1VQH A;  2IWH A;  1HTL D;  3FPP A;  4PG3 A;  4Y7N H;  3G7L A;  1D1I A;  4TSS A;  1BKB A;  4IUV A;  5HUR A;  1ICW A;  4BBR B;  2JSO A;  5LMN Q;  3EQL C;  1O7L A;  4CDD C;  3AB9 A;  2A6E C;  1I3Q H;  1T5X D;  4XQN A;  2FIN B;  4YY3 L;  3GTO B;  1N32 Q;  4YWL A;  1IW7 D;  3NBI A;  2HDL A;  2AQ2 B;  1J5E L;  1IL2 A;  2D0P A;  4TKO B;  4JI3 Q;  2QCP X;  1EQR A;  4GKK Q;  2D9U A;  5AJ3 L;  3N52 A;  1OXX K;  1A8V A;  1EQQ A;  2OF1 A;  2EYF A;  1E1O A;  1VQI A;  1G6P A;  1MSH A;  1CTM A;  1VQP A;  4UP8 A;  4NXM Q;  2E74 C;  4XDX A;  5CV4 A;  3NE5 B;  1ET6 A;  1HQM C;  2HHH Q;  5K5P A;  4MHE A;  4G57 A;  5FLX L;  2E75 C;  5IYD G;  3NQT A;  1CZW A;  3A0J A;  1TT2 A;  4DK3 C;  5KRU A;  1A3U A;  2JN4 A;  4M1U B;  5IWA L;  3K81 C;  1M90 C;  2PW7 A;  3HS0 C;  4P74 A;  1D2B A;  4C3H G;  2NTS A;  2KCC A;  1QG7 A;  3DEO A;  4DNT B;  4HID A;  4X64 L;  5M3M G;  2Q2I A;  2R7Z B;  5FO9 B;  3S2H B;  3EA6 A;  2SNM A;  1XMO L;  1EQV A;  3K7A B;  3J7Z C;  2UXB Q;  3M4P A;  3K5M A;  4G4K A;  3TEH B;  3TDQ A;  3R3O A;  2QA4 A;  1VQO A;  1IZ6 A;  4BY1 H;  4BXX H;  1SYF A;  1Q1E A;  4V0B A;  1KRS A;  1LV9 A;  1B44 D;  1TWC B;  1RL2 A;  2BDO A;  3FMC A;  1DOL A;  1K83 H;  4HTH A;  1PRT D;  1LO5 D;  3GTM H;  1DOM A;  2CQO A;  1GJX A;  5M5X B;  3NTI A;  4A3B G;  4CDE C;  2JJQ A;  3PIP A;  5M9O A;  1QVC A;  1LTS D;  3D31 A;  1RDP D;  2YTX A;  3HG9 A;  3W3A A;  1TS3 A;  1JJC B;  2FMC A;  1K8G A;  2ZM6 Q;  1F2Z A;  3BVM A;  4C3H B;  2UU9 Q;  4MTK A;  1SAP A;  2NUC A;  4O0A A;  1X54 A;  5M3M B;  1LTI D;  5I6Y A;  3JC6 6;  1ILQ A;  1VQ6 A;  4FVM A;  2EE1 A;  3KK7 A;  2OTJ A;  4LNQ A;  2O4X A;  2TMP A;  3EN2 A;  4HAE A;  5AFW A;  1DXM A;  3IKJ A;  2K04 A;  3BDO A;  3J81 E;  4A4I A;  3S2D B;  2IL8 A;  4LFB L;  4H13 C;  3J80 i;  1FJG L;  1PH3 A;  1VQ9 A;  2NVX B;  1JMC A;  3GTQ B;  4DR1 Q;  1VQ5 A;  5I2X A;  1CI3 M;  1VQ4 A;  1S72 A;  5IGE A;  2B63 G;  5DM6 3;  4BBS B;  4G7O C;  4A3B B;  3C1F A;  1PTO C;  4LF5 L;  4QIW B;  2K03 A;  2MP1 A;  1PA6 A;  2SNS A;  3EBE A;  5CYU A;  1ENA A;  4A3K H;  3H15 A;  1S40 A;  2A19 A;  5KEE A;  4BY7 B;  4B3R L;  1V9P A;  2KHI A;  2ENB A;  4KD4 A;  2VY3 A;  1TS5 A;  3S16 H;  4HCE A;  1QJO A;  2HQL A;  3HFZ B;  2NN6 I;  4QJF A;  5KYL A;  5C4J B;  1F2L A;  3TQY A;  3ER0 A;  4OO1 H;  1A15 A;  1PZJ D;  1UEB A;  4B9W A;  1HNW L;  2RCN A;  1HR0 Q;  1LUZ A;  1JB7 A;  1Y1W G;  4DR7 Q;  1S5D D;  2I5L X;  2KHS A;  1GUS A;  3CCQ A;  2CFM A;  3F2B A;  2UUB Q;  3J80 L;  2AQ3 B;  1AZQ A;  3SGI A;  1PH2 A;  5KIX A;  3A8K E;  2EZV A;  3MVV A;  1TII D;  4R9W A;  2YTY A;  4ZUI A;  4DV6 L;  1BO0 A;  1GUO A;  2IX0 A;  1R9T H;  3CC7 A;  2NZ1 D;  4HSV A;  4X65 L;  1YJN A;  2F0D A;  5H1S E;  2FXQ A;  3E0E A;  2A8V A;  5EPJ A;  1EY4 A;  4CDC C;  5C44 G;  5ELC A;  4DV1 L;  2UUC Q;  3R2I A;  4ZKB B;  1PTO H;  3BJU A;  4O42 A;  3DWQ A;  2J0T D;  3G71 A;  3TRZ A;  1QVF A;  1TWA H;  3T13 A;  3ERO A;  1LYL A;  3HKZ E;  1C7Y A;  1TY2 A;  1DYQ A;  4RCN A;  1Y1W B;  4DR5 Q;  1HTP A;  2G5D A;  5BR8 Q;  1WTH A;  3Q0A A;  4IUT A;  4JBJ A;  2VUM G;  1EY8 A;  2K5H A;  2R7D A;  5HGT A;  3S1M B;  2N3S A;  4JPB W;  3ICE A;  1MJC A;  1YNN D;  5EKK A;  4IZ8 A;  1FYC A;  2P5Z X;  5IYC G;  5JJI A;  4H0L C;  2BOS A;  3Q8D A;  4IFD H;  2KEN A;  1VDZ A;  3QG1 A;  2KUM A;  4MNO A;  1DON A;  1E7Z A;  3I72 A;  1V1Q A;  5C44 B;  1IBL L;  2NB0 A;  3DM1 A;  1SRU A;  2F0L A;  4GN5 A;  5E3F A;  4XT1 B;  1CKO A;  1BCP F;  5LL6 X;  2BCO A;  2F4V Q;  3U58 A;  1BBW A;  1STN A;  4PZ7 A;  3GO5 A;  3CW2 C;  3ULJ A;  4OGQ C;  1VQL A;  4KHP Q;  4RGT A;  1TWF B;  3G6J B;  1OXV A;  2VUM B;  5IGF A;  4JYA L;  2F52 A;  1L0Y B;  2RHS B;  4NB3 A;  4Y52 H;  3TP8 A;  3L3O C;  1H9K A;  2Q8T A;  3CP0 A;  4IOC A;  2AUJ D;  1W6K A;  4A3I G;  3NQI A;  2PCF B;  4KHZ A;  3UDF A;  1JWS D;  2R92 H;  3FP9 A;  2IHE A;  3I4L A;  5IT9 c;  4L5S A;  2XVS A;  5LMU Q;  3J7A 5;  1Y1V G;  1EZ6 A;  5FLX E;  1JOR A;  3MXP A;  3P20 A;  2RQX A;  4DV3 Q;  1EOT A;  1EIH A;  3DEP A;  1SNM A;  1UE5 A;  4HED A;  3V2T A;  1MJE A;  4LMQ D;  4IQZ A;  1NJI C;  1F9P A;  1PMR A;  2A6H D;  5JPN C;  4B9X A;  1NMF A;  1I6H B;  2ZJP A;  4UDU C;  4NMZ A;  2RBM A;  1N36 Q;  4GLA C;  4KLK A;  1VQG A;  3LWU A;  2KED A;  1EZ8 A;  1EUJ A;  1K8A C;  2NVY B;  2B2V A;  3M4Y A;  2E2I H;  3W1G A;  5FOB B;  1PH4 A;  2YU9 B;  1JOQ A;  4N9T A;  1HNZ Q;  1Y1V B;  5FO7 B;  3PIO 3;  4B3T Q;  3HOX G;  2JXM B;  1XWE A;  4YWM A;  3HOV G;  4HMI A;  3BYY B;  1A2U A;  2BE5 C;  4IFD J;  4L5T A;  3SK5 A;  1I5F A;  4I7A A;  1KAW A;  5KNB A;  2GVB A;  4LW1 A;  5ELF A;  1TKW B;  3T51 B;  3CRK C;  1CQF A;  1XNR Q;  2F0Q A;  4RH6 A;  4UP7 A;  1S3O A;  1WD0 A;  2Z0S A;  3MZ5 A;  1E24 A;  2K7V A;  4LFC L;  1CM9 A;  1N33 Q;  2AKW B;  3S1N H;  1VQB A;  4Q5V A;  1Q90 A;  2XSC A;  2RA4 A;  4LUV A;  1CSP A;  3GTQ H;  4JI4 Q;  3I4M H;  3H0G G;  5FJ8 G;  4C3I G;  1Y69 U;  1L1O A;  5ELN A;  3HOX B;  4A3B H;  3HOV B;  3TRE A;  5CV9 A;  3NK9 A;  2IX1 A;  1H9J A;  1Z47 A;  4QL5 A;  3URY A;  2KQ3 A;  1MD2 D;  4KK7 A;  4WOR A;  5IE8 A;  1GUW A;  2QDL A;  4Z9C B;  4K2L A;  1G29 1;  3NEN A;  1KDA A;  2VQF L;  4LF6 L;  1TWH B;  2B2T A;  4LF4 Q;  3DHQ A;  3HOY G;  1FNU A;  2DNC A;  1XNQ L;  3J81 i;  5C4J H;  1SYD A;  2ZXR A;  2B29 A;  1DGS A;  2BH8 A;  3J80 E;  3F2U A;  3NBH A;  1BCP B;  1EY5 A;  4TRD A;  1A3V A;  2OCE A;  5JJK A;  3MFG A;  1DD2 A;  1E2W A;  5CBA E;  2UXD L;  3RZO B;  4KKS A;  4GZY C;  4B3M L;  3H0G B;  1Q46 A;  1P8L A;  3BG3 A;  3KLR A;  4C3I B;  2B63 H;  1RJT A;  4FXK C;  2SDF A;  3OW2 A;  2EYL A;  2K5V A;  2H1E A;  4FO2 A;  4LFA Q;  3G4S A;  4DA2 A;  3NP8 A;  1DOK A;  2TSS A;  3R2T A;  1SFO H;  2R61 A;  3KF6 A;  1Y14 B;  2F0T A;  1ZYR D;  1WTQ A;  3HOZ G;  1EIY B;  3FRP B;  4C3J G;  3HOY B;  1NSN S;  4JVZ A;  3V96 A;  1X3F A;  5EJW A;  2DY8 A;  3A5U A;  2SEB D;  4YCV A;  5D14 A;  1K73 C;  3ITP A;  1JJ2 A;  1D6E C;  2R3Z A;  3K8A A;  4MZ9 A;  2WB1 G;  4DV5 L;  1LT5 D;  3KUP A;  5C0X G;  1EIG A;  4DR2 L;  2PW5 A;  1Y1W H;  2JA7 H;  4XQJ A;  2E2J B;  5JJL A;  1GKH A;  1I4H A;  1C9O A;  1BR9 A;  4JI1 L;  2Z8L A;  4KN4 C;  1X6O A;  1HPC A;  2C5C A;  5IGC A;  4KN7 C;  4FF2 A;  2UXC L;  2Z6B A;  1EYG A;  1ILP A;  5T1G A;  1K28 A;  4B3S Q;  4JK1 C;  1UWV A;  4IUQ A;  2PQE A;  4J6H A;  1BVS A;  4A3M B;  3MEF A;  4DUZ Q;  3OOC A;  2B2Y A;  1IKM A;  3M3Y B;  1PRT B;  5C44 H;  1DZ1 A;  4DPG A;  3VR4 A;  4DNR B;  3HOZ B;  1HRJ A;  5IOC A;  1UEA B;  3TSS A;  1EY9 A;  1UNS A;  1FR3 A;  1Y8P B;  4POF A;  4LF8 L;  1MIU A;  4DAP A;  1PH5 A;  5EPK A;  3T1H Q;  3GTJ B;  4HCS A;  3VR6 A;  4HMJ A;  3CPF A;  1B1Z A;  1B9M A;  1JT8 A;  1RKN A;  5BN3 A;  3D8G A;  1H9S A;  3FKI G;  1PH6 A;  2VUM H;  1XPR A;  1QUQ A;  3MWY W;  1HFG A;  4DK0 A;  1L1O B;  5CR3 A;  3ND8 A;  3K5O A;  2QEJ C;  1PFM A;  2WAQ E;  3Q6S A;  2O2L D;  5IYC H;  3CCS A;  3CCL A;  4AQY Q;  1VCI A;  3RZD B;  1JWM D;  1E0B A;  2R93 H;  1D5Z C;  1B3Q A;  2DNE A;  2CW0 C;  2MQH A;  4GLV B;  5COY A;  3E9H A;  3SHL A;  1L2F A;  3X3M A;  4MN3 A;  1SMY C;  2KVM A;  1J6Q A;  1YBY A;  1GUN A;  4A3E G;  1C4Q A;  2I07 B;  1NCV A;  1WTX A;  1E2Z A;  4OEL B;  3UDI A;  4RHR A;  3A54 A;  2NTT A;  3W1B A;  1C8C A;  1HQR D;  2N49 A;  1W6J A;  5LMN L;  4LF9 Q;  1Q1B A;  1Q12 A;  1SNO A;  1EL0 A;  4FXD A;  1N32 L;  2F0N A;  3I70 A;  3HOW B;  1ESF A;  2ZJR A;  1ENF A;  3C3L A;  2L11 A;  2MPM A;  1KAA A;  1CKM A;  2KEE A;  4A3I H;  3VR3 A;  4QY7 A;  3CPW A;  4JI3 L;  1HFN A;  4ABN A;  2VW9 A;  2ZXP A;  4GKK L;  3F8T A;  3KF6 B;  5FLM G;  2JA5 G;  1ET9 A;  1GXD C;  1UE1 A;  1Y1V H;  3SK4 A;  3CCU A;  2F0U A;  3H91 A;  2NWG A;  4A3E B;  4NXM L;  1V1O A;  2DJF C;  1YIT A;  1LT3 D;  1G8Z D;  1BCP D;  1QZH A;  2R7Z G;  5C0X I;  2K5Q A;  5M5Y B;  3HEJ A;  4JOI A;  3TN2 A;  1IW7 C;  4EX5 A;  3OIP A;  3GTK H;  5I6W A;  1WFQ A;  1LAC A;  2NN6 G;  3OIQ A;  2B8G A;  1LTB D;  2MO0 A;  3A8I E;  5KYI A;  4PV1 C;  5C5M A;  4QF4 A;  4A3J G;  3STB D;  3D6W A;  1U4M A;  2H5X A;  4K2K A;  1B53 A;  2B2U A;  3U4V A;  2JA5 B;  1LM0 A;  5HGQ A;  3TBI B;  3S14 B;  1ICF B;  1NY4 A;  4L6T B;  1I94 Q;  1CQV A;  3GDE A;  2MNA A;  3AEV A;  3PO2 G;  5A35 A;  2M9V A;  3TP5 A;  3HOX H;  2QKI C;  3HOV H;  2MGS A;  1H9S B;  1HNX L;  2B2V C;  4JI2 L;  1QUQ B;  3RLN A;  4KMU C;  4YY3 Q;  2RDF A;  3T4A C;  2ZM6 L;  1ZEQ X;  5EPL A;  1K9M C;  3S17 H;  3S9W A;  1W2B A;  3NPP A;  1FNW A;  3H3V C;  4A3J B;  2QW7 A;  4KHV A;  3UE0 A;  3MAQ A;  3BYT B;  1SRO A;  1VQE A;  2V1C C;  2B3G A;  1LT4 D;  4OHJ A;  2RF4 A;  2E8G A;  2IHF A;  1KD1 C;  1Y8N B;  5JEA G;  2KBN A;  1X55 A;  4BBS G;  2MHV A;  3KBG A;  3UI2 A;  1IBM Q;  1BBU A;  3CCM A;  5D3D A;  1IKL A;  3H0G H;  1VQD A;  1O78 A;  3PO2 B;  1SSO A;  2ALY B;  4DR1 L;  4XT3 B;  1EYC A;  4BY7 G;  4CJ0 B;  1U4P A;  3L2P A;  2QGQ A;  1NMG A;  4J15 A;  2EXD A;  1DCZ A;  1GVP A;  3VYT A;  2X6G A;  1ENC A;  1XYI A;  1EU4 A;  2K14 A;  3A56 A;  5COR A;  4X64 Q;  4RGN A;  1KNE A;  1WCM G;  2KCM A;  1SBB B;  1HZC A;  1GUG A;  4AYB E;  1IBK Q;  3HOY H;  1FGU A;  1WYD A;  4DAV A;  4DGZ A;  1J8I A;  2H4O A;  3I73 A;  4K0K L;  4R4Q A;  1N34 Q;  4YHH Q;  3PF4 A;  1WTV A;  2Z1C A;  2HUG A;  2QF7 A;  5GAE C;  4U67 3;  2E2J H;  4DR4 Q;  4KD3 A;  3GQB A;  1HHV A;  3QB3 A;  1VQN A;  1PYW D;  2PZT A;  3E5S A;  4ZLT F;  2ATW A;  2B2T C;  2IY5 B;  4ZRZ A;  4R4C A;  1LT6 D;  4U68 A;  3PUW A;  3NXW A;  3H3V H;  5LL6 S;  1PHJ A;  2Z6K A;  1EYD A;  4NW2 A;  1CKN A;  1QNU A;  1PFN A;  3H94 A;  1A62 A;  1V1P A;  4X66 L;  1XMQ Q;  4NP5 A;  1TU2 B;  3NSW A;  1BXT A;  1IYU A;  2NVT H;  5IY0 A;  2FHT A;  1KRT A;  1PLF A;  3DWA A;  3D3R A;  1WCM B;  3J7Y W;  1KIX A;  5DEH A;  3HOZ H;  4OON A;  5GAD C;  4GLX A;  2AWO A;  1STA A;  4C3J H;  3UE1 A;  1H9R A;  3H09 A;  4BS9 A;  1YVC A;  3KBX A;  3CC4 A;  3CCE A;  1XPU A;  4ODG A;  2I5H A;  3GTJ H;  1I4P A;  5IYB G;  3TS0 A;  3BZK A;  5I2Y A;  4HJ8 A;  2F0S A;  5J22 A;  3SK6 A;  4DR5 L;  1N8R C;  4OEM B;  1SLJ A;  4CKC A;  4DK6 C;  2WKD A;  5BR8 L;  4JI5 L;  3PUX A;  3DUZ A;  4X3S A;  2E76 C;  2YTV A;  3HZX A;  4LF5 Q;  5CV7 A;  4A3F B;  4DXF A;  2F0O A;  1E3P A;  5A2Q L;  2Q8R E;  2D62 A;  4JI0 Q;  2LXJ A;  3OWF A;  1CHQ D;  4TQU S;  3DXJ C;  2KCT A;  3QWN A;  2PI2 A;  4JI6 L;  3S1Q B;  1PZK D;  4E6I A;  3OW7 A;  3ERQ A;  2EYJ A;  5IP7 G;  2EYM A;  4PZ8 A;  4KKU A;  1MHW C;  4J1M A;  1LTL A;  5M3F G;  5C4X G;  4PZ6 A;  2B2Y C;  3GTG B;  1V43 A;  1EEF D;  1U9R A;  3LNN A;  1KNA A;  3FKI H;  2CWP A;  4KHP L;  4NPS A;  1PH7 A;  3G48 A;  4K6L A;  1II3 A;  5M5W B;  3CRL C;  4OX9 Q;  3TP6 A;  3SE0 A;  1YNN C;  1PFB A;  3MXU A;  3JAM L;  3RN5 A;  4GOP A;  2FJ2 A;  4NDX A;  2F0G A;  1F9S A;  4DV0 L;  4X3T A;  4X3U A;  3JAM c;  2B2W A;  2VQE Q;  2XGT A;  1WTR A;  3S15 H;  3F1Z A;  1TWG H;  1K0R A;  3CCJ A;  3QJY A;  4DKA C;  3D4R A;  3I4N G;  3P1H A;  1PYS B;  5EKI A;  3KJO A;  4DV1 Q;  1K8M A;  4BBR H;  1PVO A;  1X3G A;  1CSQ A;  5LHY 1;  5LMU L;  4A3E H;  1XPO A;  3FVQ A;  4CKB A;  3J7A F;  2MO1 A;  3GTO H;  3R8B A;  5C3E G;  1OXU A;  5M3F B;  3ULP A;  5C4X B;  1LTG D;  1TY0 A;  4DV3 L;  5M5Y H;  1B8A A;  1YZ6 A;  4HIM A;  4EVO A;  2OQ0 A;  4I7Z C;  3HRZ C;  5HY6 A;  4DR3 Q;  1KDB A;  1CKN B;  1FD7 D;  3RN2 A;  5IT9 L;  2PMZ E;  1XJV A;  4KY7 A;  4EQN A;  1V1P B;  1ZKO A;  5CBE E;  3AU7 A;  3MHB A;  1NAP A;  1N36 L;  3M4O B;  3TP7 A;  3UDX A;  5K36 G;  3K6O A;  1EWH A;  2NVQ B;  2JA5 H;  4OXP A;  4YIJ A;  3I4N B;  4QGU A;  2HCI A;  4C1N K;  3MC0 B;  2G9D A;  2UUA L;  4F8M A;  2EQS A;  4OWW B;  2Q2T A;  1EFI D;  1QVG A;  1JJG A;  2G9H D;  4H7B A;  4OWX B;  1X9N A;  1VF7 A;  1O80 A;  3CU7 A;  5C3E B;  3F2C A;  2R7Z H;  2L0C A;  2D0O A;  1YI2 A;  3QIA A;  2ZTD A;  3S2H H;  1RTO A;  2AQ1 B;  1JB3 A;  3U9O A;  1QIL A;  3S1R B;  3D4D A;  1D5X C;  1VQC A;  1PXU A;  2A6H C;  3K7A H;  4JYA Q;  4UAI A;  2CHB D;  2F0W A;  2HDM A;  1F9Q A;  1CUK A;  4HJ9 A;  5CV5 A;  1I4X A;  3K0Y A;  1HZ9 A;  2E2D C;  3GD7 A;  4DV2 L;  1XNR L;  1JC7 A;  1TWC H;  2NYZ D;  2BA1 A;  5D3I B;  1R4Q B;  1SE3 A;  4UY8 C;  2QIL A;  5M5X H;  1N33 L;  3E3X A;  1D1K A;  4JCV E;  4TVA B;  5IYD H;  3PUZ A;  1I4Q A;  3PV0 A;  3J7A V;  4RA8 A;  5EKL A;  4C3H H;  4KI0 A;  2B2U C;  3C46 A;  5M3M H;  2IJ0 A;  1PV4 A;  3SEB A;  2A68 C;  1TXY A;  3MEH A;  2CQA A;  4P71 A;  1I3Q B;  1H95 A;  4GOP B;  4K5X A;  2F0K A;  2JA8 G;  5C3W A;  4DUY Q;  4GN3 B;  2C35 B;  3S2D H;  3VR5 A;  4JV5 L;  4IPH A;  3MXN A;  4LF4 L;  1I6V C;  1STB A;  2NVX H;  4RCO A;  3PO3 G;  1E1T A;  1U4L A;  5CC4 A;  1FGB D;  2E5L Q;  4JI8 Q;  2B8F A;  4CKE A;  2ZTE A;  3NTK A;  4BBS H;  3EJI A;  4ZCK A;  4WRD A;  4DAY A;  5EBC A;  2L4N A;  1GHJ A;  2EXZ A;  1O7Z A;  1S5B D;  2LXK A;  3BVZ A;  2ID0 A;  5JPM C;  2ES2 A;  2OTL A;  1DJR D;  4RWS C;  4LF7 Q;  1PTO F;  3OMG A;  2D5D A;  3SK8 A;  1JE5 A;  1FNV A;  3OWE B;  4BY7 H;  1O7Y A;  4KTA A;  4X62 Q;  2K01 A;  1E22 A;  3RD4 A;  4G7H C;  2XWJ B;  4RGM A;  1WCM H;  1Q3L A;  3BS1 A;  3MFY A;  2K52 A;  3CCR A;  4DV4 Q;  2JA8 B;  1YHB A;  3LWE A;  3M7G A;  1X56 A;  1XXG A;  4YWK A;  3Q22 A;  2VB2 X;  1Q82 C;  4FF3 A;  3PO3 B;  2I5M X;  1Z9F A;  1SE8 A;  2F3W A;  4L5Q A;  2PO4 A;  1EQT A;  3AFP A;  3A7A B;  4UHV A;  1AFP A;  1HUN A;  1SYE A;  1SDF A;  2GVA A;  4QUF A;  1JCK B;  2A73 B;  4BY1 B;  1VQ8 A;  4JW0 A;  3EVQ A;  4FF4 A;  2KJX A;  2N8N A;  1EIF A;  1AW7 A;  3IL8 A;  3TZD A;  5A2Q E;  1G6Z A;  3GP7 A;  3QOJ A;  1K83 B;  3GTM B;  4A3M G;  1B4O A;  1B3A A;  3BU2 A;  1BF4 A;  2Q2U A;  2F0H A;  5C3X A;  1X65 A;  4B3S L;  1CT1 D;  2LFN A;  2RDG A;  4A75 A;  3GTL B;  2HT1 A;  4A3K G;  2Z6K C;  2K6A A;  1ZYR C;  4LF6 Q;  4DUZ L;  2K5N A;  3I56 A;  2N55 A;  4KJO A;  3VYU A;  2XRS D;  4HJA A;  3PGZ A;  2WAC A;  3KF8 B;  2KA7 A;  5NUC A;  1XNQ Q;  2ASB A;  1DM0 B;  3H6M A;  2WFW A;  4IJL A;  4HJ5 A;  1LTT D;  3S1M H;  4GKJ L;  5ELO A;  1GD7 A;  3T1H L;  1D5M C;  4PMW A;  3JAM E;  5BN5 A;  1K3R A;  4S3S A;  1RD9 D;  1JWU D;  4QB4 A;  1F77 A;  1WI5 A;  3J81 c;  1VQ7 A;  4A3D G;  1HCZ A;  1YNX A;  1F9R A;  2F1M A;  3LGJ A;  4A3L G;  4OIK A;  5JJZ A;  2HIX A;  2KOL A;  1Q86 C;  4R4T A;  3M9B A;  4RG1 A;  4C2M B;  1D7Q A;  3M85 A;  2LMC B;  2EY2 A;  4AQY L;  4A3K B;  1SYB A;  3A7L A;  1RCV D;  2DGY A;  4IUU A;  1WTP A;  3MXN B;  2VZA A;  3VYS A;  2JEA I;  1X3Q A;  4FF1 A;  5IP7 H;  2XRQ D;  5E1F A;  1IYV A;  1TWF H;  1MSG A;  3S16 B;  5M3F H;  3T1Y L;  3CHB D;  1NR2 A;  5C4X H;  4XQQ A;  2QDB A;  4JI7 Q;  4DAY B;  5IIF A;  1A2T A;  3AMU A;  1JQY D;  3HOW G;  5IT9 E;  1EWC A;  1AE3 A;  1CHP D;  4J8Q A;  2VL6 A;  1PDQ A;  4HIK A;  3P75 A;  4LF9 L;  2Q8I B;  5ELB A;  4A3D B;  4QUC A;  1VMC A;  1Z7T A;  3IFD A;  3FPU B;  4GNX A;  1HUM A;  1S5C D;  4PNY A;  4R8N A;  4HJ7 A;  4DV7 Q;  3NTH A;  1YNJ C;  2VS1 A;  2A69 D;  5IGG A;  4DR6 Q;  1OXS C;  4NXN Q;  4AYB B;  2PYK A;  3E0J A;  2EY6 A;  3IRB A;  1EY7 A;  2F03 A;  1SYC A;  1XTC D;  2AHO B;  4GOP C;  1STG A;  1YHA A;  2CW0 D;  1JIC A;  2B2W C;  3NEL A;  1UAP A;  1Z6H A;  3W5O A;  1EU3 A;  5C3E H;  2AMC B;  1STH A;  1EOV A;  1A6X A;  3T53 B;  1BUV T;  4RHS A;  1CZG A;  2DUD A;  1K3B C;  1PTO B;  4R4O A;  1I6H H;  3PCO B;  4L63 B;  3S1R H;  4L8J A;  1TWA B;  3D4W A;  4IO9 A;  2O5I C;  3HP3 A;  4RKL A;  4EQP A;  3RLF A;  3S24 A;  4RFB A;  1Q8K A;  2NVY H;  2F3I A;  5IP9 G;  4N9P A;  1ASZ A;  1HA6 A;  4UPA A;  2YU9 H;  4DU9 A;  1YIJ A;  5K36 H;  2WII B;  1VQM A;  3RLO A;  3H3V I;  2EJG C;  3HKZ G;  1WTO A;  4HN7 A;  5G3L F;  1KL9 A;  2HHH L;  4G7Z C;  3MTS A;  4NKL A;  2J4X A;  1SEB D;  4JG2 A;  5GAG C;  1N9W A;  3IFT A;  1SXT A;  4A3C G;  2L55 A;  3OTO Q;  1BCP C;  1I94 L;  2SOB A;  3NUC A;  1ESR A;  2A6E D;  2F0V A;  4M8A A;  4P73 A;  4XTC S;  1GUT A;  1E2V A;  3GV3 A;  4OO1 I;  3K57 A;  2A74 C;  1FL0 A;  2I0Q A;  1EYA A;  3PQI A;  4APV A;  2UXB L;  3QO2 A;  4EGV A;  3SVM A;  3A8J E;  3CAM A;  3C1E A;  3STB C;  3K5N A;  1M4V A;  4K14 A;  4DNI A;  1MGS A;  4WFN 3;  4ULL A;  1WTW A;  4C1N I;  3VDY A;  1IL8 A;  2HD3 A;  1F2Y A;  3K58 A;  4L5R C;  4IOA A;  2R92 B;  2EPB A;  3HKZ B;  4ZKC B;  1I50 B;  3OPO A;  1KC8 C;  3B6Y A;  1KLG D;  3L0O A;  2F0E A;  3KOJ A;  3VA5 A;  1IBM L;  1KAB A;  5C5L A;  1ASY A;  1OTC A;  3U9S A;  2JA9 A;  2ZJQ A;  4LUO A;  3PSI A;  4CHT B;  3KLS X;  1ZXT A;  1J5E Q;  1PH8 A;  2UU9 L;  3HOU G;  4X3K A;  1TWH H;  3I4O A;  4V19 0;  4H02 A;  5FLX c;  2CVR A;  3CC2 A;  4ILW A;  3K0X A;  2X69 A;  5AJ3 Q;  1O7I A;  2JA8 H;  2Z4I A;  1T9H A;  5FK9 C;  1LAB A;  4GNX B;  1GHK A;  1QB5 D;  3BVG A;  4QQB X;  1QWY A;  3I55 A;  1IBK L;  3PO3 H;  3CKI B;  1SR3 A;  3RZO H;  2I46 A;  1PRT C;  4DF7 A;  4FYD A;  1N34 L;  5FJ8 H;  4YHH L;  4C3I H;  2F0J A;  5KGU A;  2OQK A;  1YJW A;  5I9O A;  1RF2 D;  4IFD I;  1WVL A;  4DR4 L;  2WB1 E;  2E2I B;  5IWA Q;  2EJF C;  1JOK A;  1VQF A;  3I8Z A;  4CBV A;  4DAM A;  2WIN B;  4O2D A;  4K5V A;  1NE3 A;  4CGY B;  3I4M G;  1F2M A;  3ERS X;  2LY7 A;  3NEM A;  2L15 A;  5E4W C;  1B2T A;  1HNX Q;  4ALP A;  2AWN A;  4JI2 Q;  1QNK A;  3HOU B;  1G91 A;  1L1O C;  1XTD A;  2RSN A;  1XMO Q;  3CXC A;  1AE2 A;  2XNA C;  5DNF A;  1XMQ L;  2PMZ B;  3GTL H;  4A93 G;  4BA1 I;  2NBF A;  3MXG A;  1A3T A;  1OXT A;  1RHP A;  2OEO A;  3T16 A;  3KFU A;  1B7Y B;  1G51 A;  5IGB A;  3CCV A;  1HZA A;  3BZC A;  1R4P B;  1C48 A;  1U5K A;  2C9O A;  2XN9 C;  1HR0 L;  4DR7 L;  1K8O A;  5J3B A;  3PMF A;  3VA7 A;  1NTG A;  5GQO A;  1AH9 A;  3DWP A;  2UUB L;  5JVG 3;  3CF5 A;  5C6A A;  2ZT9 C;  2RVL A;  1TVX A;  1PZI D;  3S1N B;  1MI2 A;  1IHZ A;  1STY A;  4A3F G;  3U50 C;  3J81 j;  4A3G G;  3OHX C;  1BQQ T;  1BBX C;  1NNX A;  2Y0S E;  3I4M B;  1PTO D;  1QCB D;  4GN4 B;  4A3M H;  3PUY A;  5IGD A;  1S5F D;  2JYO A;  3NWT A;  2EY1 A;  4A76 A;  3M3Y H;  3IAY A;  3A55 A;  5D65 A;  2D2C C;  4XXE A;  3FDT A;  3Q23 A;  4C2M H;  2PQA A;  2WKC A;  2Q2H A;  3CME A;  3LX0 A;  2VB3 X;  5DAU A;  4A93 B;  4JI0 L;  3K5L A;  4F88 A;  1I4R A;  2HCC A;  3EIV A;  2FFK B;  3KJP A;  2UUC L;  3CQZ B;  1PFS A;  5C0X H;  4LFB Q;  5EAY A;  3VR2 A;  1QZG A;  4FXG C;  3UDG A;  1FJG Q;  4K0K Q;  1JOO A;  2DY7 A;  2CKZ B;  1U0L A;  4PMB A;  3JAM i;  1I4G A;  5J1Z A;  4FDB A;  2HQE A;  1NR4 A;  1VS0 A;  1L0X B;  3R93 A;  2JA7 G;  3CMA A;  3E9I A;  4A3G B;  4KY6 A;  1VQK A;  1C0A A;  2MJ8 A;  1SJH D;  3RZD H;  2F0I A;  2PZW A;  4POG A;  4A3D H;  3TS2 A;  4A3L H;  3J80 c;  4OX9 L;  3PF5 A;  1PYB A;  2PPB C;  4B3R Q;  2B63 B;  2WP8 J;  4ZQ3 A;  2WV6 D;  5BN4 A;  4X66 Q;  1SN8 A;  3RMH A;  2VQE L;  3ONA B;  2JA6 G;  2N78 A;  4KY5 A;  1AZP A;  3AFQ A;  4KV6 A;  2JP1 A;  5ELE A;  1SFO B;  3EFX D;  1HNW Q;  1Q8I A;  2F4V L;  3I90 A;  1S4Z A;  5C4Z A;  1B70 B;  3T56 B;  5LMN W;  4XYQ A;  1OO9 B;  2M2L A;  4YCW A;  2EYO A;  3DM3 A;  2IPK D;  2EJM A;  3HOW H;  1X3E A;  4DV6 Q;  2JA7 B;  4X65 Q;  3NHH A;  1L0W A;  4JI5 Q;  2MFI A;  1STE A;  4DR3 L;  5EBD A;  3MA2 B;  1GM5 A;  1ML0 D;  1ONL A;  3Q24 A;  2OT2 A;  2CH4 W;  4PQX A;  1SE2 A;  3WOF A;  2QEX A;  1M8A A;  4RGO S;  2JA6 B;  4RMF A; 
#chains in the Genus database with same CATH homology
 3WDN A;  1SNQ A;  1U4R A;  4HSP A;  5JOB A;  3OMC A;  3W2D A;  2IW3 A;  1AEX A;  1UUP A;  4LK1 C;  2O5J C;  4I65 A;  4IUP A;  2L9H A;  3OSO A;  1X32 A;  1HXY D;  3NWS A;  3SXH A;  2F3V A;  5C0X J;  4ZUJ A;  3GTP B;  2E2H B;  5KNC A;  2RKS A;  4IUR A;  4CJ2 C;  1EEI D;  1S5E D;  1TQO A;  4KKT A;  4ZAI A;  1SYG A;  2K32 A;  2ICI A;  2K05 A;  2R93 B;  1RTN A;  5ISR A;  1CFM A;  1CA5 A;  4CJ1 B;  1NUC A;  5JAV A;  2NN6 H;  1VMP A;  4ZK9 B;  1BOS A;  3GV6 A;  1LTA D;  5CV6 A;  1BNZ A;  1KTK A;  2J7Z A;  1AP0 A;  3L7Z C;  4IN3 A;  3KF8 A;  2EOT A;  4KJN A;  2EYP A;  1TS4 A;  2BA0 A;  2EYH A;  2XIW A;  4HR7 B;  3C2P A;  2MUY A;  4A3I B;  4B08 A;  4IUN A;  2LS0 1;  5CGK A;  1PRT F;  3SR1 A;  1TR5 A;  1Y8O B;  4Y7N B;  5FO8 B;  1B50 A;  5G3L D;  5JVH 3;  4C56 C;  2BE5 D;  1XX8 A;  2PNR C;  5I9P A;  2ZXO A;  3ZYY X;  3E6Z X;  4LJZ C;  2KCN A;  2PZU A;  2WAQ B;  2A68 D;  3ND9 A;  2AUK A;  4ID6 A;  3GTK B;  3BDC A;  1BDO A;  5JEA H;  1TS2 A;  4QCL A;  3TZU A;  2A5H A;  3I3C A;  1SND A;  4H44 C;  3VYR A;  1KDC A;  4EQO A;  3D6C A;  1GOZ A;  3K59 A;  4K5W A;  3O13 A;  5CV8 A;  3V05 A;  3SDZ A;  2F0M A;  3DMU A;  1KLU D;  4FP5 D;  4FNF A;  3WOE A;  5EQ0 A;  3P7J A;  3KLS A;  3S17 B;  4DK1 A;  1CK1 A;  2KEC A;  2M00 A;  2DN8 A;  4WJW A;  3M7N A;  1JE4 A;  2Z4H A;  2BDN A;  1QOH A;  1SJE D;  3I91 A;  3X3N A;  2ICE C;  1J9O A;  4K8I A;  2JE6 I;  2RSO A;  1QE6 A;  3HGB A;  2OXP A;  2FMM A;  4QMG A;  2L5T A;  2RDH A;  5E4X A;  2N88 A;  2YYZ A;  4R8I A;  2K33 A;  2L12 A;  5J39 A;  2K1B A;  2V4D A;  1G2S A;  5CMD A;  4OO1 G;  5C4H A;  2LKV A;  1X3P A;  4ZYS A;  3RUZ A;  1SNC A;  3J81 L;  1G2T A;  1WD1 A;  2X6L A;  4DFA A;  5ELD A;  2F4I A;  3PUV A;  5JEA J;  2IX3 A;  1SE4 A;  2K5W A;  4PMC A;  2F0F A;  3N6R A;  1V8Q A;  4XYO A;  3FEW X;  2NVT B;  5I4D A;  4BWG B;  2EDG A;  3PIP 3;  2EVB A;  2R6G A;  4C3J B;  1VF5 C;  1ROD A;  1AN8 A;  3QOL A;  2VNU D;  4ME5 A;  4RAU C;  2WB1 B;  2XWB B;  4LAA A;  4BA2 I;  4F87 A;  4DXG A;  3BDL A;  1EY0 A;  1R9T B;  2B39 A;  1LLR D;  1HA5 A;  4K6D A;  5EGT A;  1JR0 D;  4IFD G;  2A69 C;  5KND A;  5IOD A;  1SNP A;  4XIG S;  1SMY D;  1YNJ D;  5F2D A;  1T5E A;  1B9N A;  2K28 A;  1CA6 A;  2EY5 A;  4RKB A;  2F0P A;  2IT1 A;  5FKA C;  4OL7 A;  2K5D A;  4O1N A;  4IAL A;  5DM7 3;  4JBW A;  2Y0S B;  2JEB I;  3FKI B;  2L1B A;  4Q0F A;  5TSS A;  4MIU A;  2VXW A;  1MBY A;  4DN4 M;  4K8J A;  1H9M A;  4P2C B;  1EY6 A;  2GA4 B;  5T1I A;  3BZD B;  3TME A;  4F7X A;  3L9A X;  4OIJ A;  1LTR D;  3S15 B;  1TWG B;  2IWH A;  1HTL D;  3FPP A;  3G7L A;  1D1I A;  4TSS A;  5HUR A;  4IUV A;  1ICW A;  4BBR B;  2JSO A;  3EQL C;  1O7L A;  3AB9 A;  2A6E C;  1T5X D;  4XQN A;  2FIN B;  3GTO B;  1IW7 D;  3NBI A;  2HDL A;  2AQ2 B;  4TKO B;  2QCP X;  2D9U A;  3N52 A;  1OXX K;  2OF1 A;  2EYF A;  1MSH A;  1CTM A;  2E74 C;  4XDX A;  5CV4 A;  3NE5 B;  1ET6 A;  1HQM C;  5K5P A;  4MHE A;  4G57 A;  5FLX L;  2E75 C;  3NQT A;  1CZW A;  1TT2 A;  5KRU A;  1A3U A;  4M1U B;  2PW7 A;  3HS0 C;  1D2B A;  4C3H G;  2NTS A;  2KCC A;  1QG7 A;  3DEO A;  4DNT B;  2R7Z B;  5FO9 B;  3S2H B;  3EA6 A;  2SNM A;  1EQV A;  3K7A B;  3K5M A;  4G4K A;  3TDQ A;  3R3O A;  1SYF A;  1Q1E A;  4V0B A;  1LV9 A;  1B44 D;  1TWC B;  4HTH A;  2BDO A;  3FMC A;  1DOL A;  1PRT D;  1LO5 D;  1DOM A;  1GJX A;  5M5X B;  3NTI A;  5M9O A;  1LTS D;  3D31 A;  1RDP D;  3HG9 A;  3W3A A;  1TS3 A;  2FMC A;  1F2Z A;  3BVM A;  4C3H B;  1SAP A;  2NUC A;  5M3M B;  1LTI D;  5I6Y A;  1ILQ A;  4FVM A;  2EE1 A;  3KK7 A;  2O4X A;  2TMP A;  4HAE A;  5AFW A;  1DXM A;  3IKJ A;  2K04 A;  3BDO A;  3J81 E;  3S2D B;  2IL8 A;  4H13 C;  2NVX B;  3GTQ B;  5I2X A;  1CI3 M;  5IGE A;  5DM6 3;  4BBS B;  4G7O C;  4A3B B;  3C1F A;  1PTO C;  4QIW B;  2K03 A;  2MP1 A;  2SNS A;  5CYU A;  1ENA A;  5KEE A;  4BY7 B;  2ENB A;  4KD4 A;  1TS5 A;  4HCE A;  1QJO A;  5KYL A;  2NN6 I;  5C4J B;  1F2L A;  4OO1 H;  1A15 A;  1PZJ D;  4B9W A;  1S5D D;  2KHS A;  1GUS A;  3J80 L;  2AQ3 B;  1AZQ A;  5KIX A;  3A8K E;  2EZV A;  3MVV A;  1TII D;  4R9W A;  4ZUI A;  1BO0 A;  1GUO A;  2IX0 A;  2NZ1 D;  4HSV A;  2F0D A;  5EPJ A;  1EY4 A;  5ELC A;  3R2I A;  4ZKB B;  1PTO H;  4O42 A;  3DWQ A;  2J0T D;  3T13 A;  3ERO A;  1TY2 A;  1DYQ A;  4RCN A;  1Y1W B;  1HTP A;  3Q0A A;  4IUT A;  1EY8 A;  5HGT A;  3S1M B;  1YNN D;  5EKK A;  4IZ8 A;  1FYC A;  4H0L C;  2BOS A;  4IFD H;  1VDZ A;  3QG1 A;  2KUM A;  1DON A;  3I72 A;  5C44 B;  2NB0 A;  3DM1 A;  2F0L A;  5E3F A;  4XT1 B;  1BCP F;  5LL6 X;  2BCO A;  1STN A;  3GO5 A;  4OGQ C;  4RGT A;  1TWF B;  3G6J B;  1OXV A;  2VUM B;  5IGF A;  1L0Y B;  3TP8 A;  3L3O C;  1H9K A;  2Q8T A;  2AUJ D;  1W6K A;  3NQI A;  2PCF B;  4KHZ A;  1JWS D;  3I4L A;  2XVS A;  1EZ6 A;  5FLX E;  1JOR A;  3MXP A;  3P20 A;  2RQX A;  1EOT A;  1EIH A;  3DEP A;  1SNM A;  4HED A;  3V2T A;  4LMQ D;  4IQZ A;  1F9P A;  1PMR A;  2A6H D;  5JPN C;  4B9X A;  1I6H B;  4UDU C;  4NMZ A;  2RBM A;  3LWU A;  2KED A;  1EZ8 A;  2NVY B;  2B2V A;  3M4Y A;  5FOB B;  2YU9 B;  1JOQ A;  4N9T A;  1Y1V B;  5FO7 B;  3PIO 3;  2JXM B;  1XWE A;  4HMI A;  3BYY B;  1A2U A;  2BE5 C;  4IFD J;  3SK5 A;  5KNB A;  5ELF A;  1TKW B;  3T51 B;  3CRK C;  1CQF A;  2F0Q A;  4RH6 A;  1WD0 A;  3MZ5 A;  2K7V A;  1CM9 A;  4Q5V A;  1Q90 A;  2XSC A;  2RA4 A;  4C3I G;  1Y69 U;  3HOX B;  3HOV B;  5CV9 A;  3NK9 A;  2IX1 A;  1H9J A;  1Z47 A;  3URY A;  2KQ3 A;  1MD2 D;  4KK7 A;  4WOR A;  1GUW A;  4Z9C B;  4K2L A;  1G29 1;  1KDA A;  1TWH B;  2B2T A;  3DHQ A;  1FNU A;  2DNC A;  1SYD A;  2ZXR A;  3J80 E;  3F2U A;  3NBH A;  1BCP B;  1EY5 A;  4TRD A;  1A3V A;  3MFG A;  1DD2 A;  1E2W A;  5CBA E;  3RZO B;  4KKS A;  4GZY C;  3H0G B;  3BG3 A;  3KLR A;  4C3I B;  1RJT A;  4FXK C;  2SDF A;  2EYL A;  2H1E A;  4FO2 A;  4DA2 A;  3NP8 A;  1DOK A;  2TSS A;  3R2T A;  2R61 A;  2F0T A;  1ZYR D;  1WTQ A;  3FRP B;  4C3J G;  3HOY B;  1NSN S;  3V96 A;  5EJW A;  2DY8 A;  2SEB D;  5D14 A;  3ITP A;  1D6E C;  2R3Z A;  1LT5 D;  3KUP A;  5C0X G;  1EIG A;  2E2J B;  2PW5 A;  4XQJ A;  1I4H A;  1BR9 A;  2Z8L A;  4KN4 C;  1HPC A;  2C5C A;  5IGC A;  4KN7 C;  4FF2 A;  1ILP A;  5T1G A;  4JK1 C;  4IUQ A;  2PQE A;  4J6H A;  4A3M B;  3OOC A;  2B2Y A;  1IKM A;  3M3Y B;  1PRT B;  1DZ1 A;  3VR4 A;  4DNR B;  3HOZ B;  1HRJ A;  5IOC A;  1UEA B;  3TSS A;  1EY9 A;  1UNS A;  1FR3 A;  1Y8P B;  4DAP A;  5EPK A;  3GTJ B;  4HCS A;  3VR6 A;  4HMJ A;  1B1Z A;  1B9M A;  1RKN A;  5BN3 A;  3D8G A;  1H9S A;  3MWY W;  1HFG A;  4DK0 A;  5CR3 A;  3ND8 A;  3K5O A;  2QEJ C;  1PFM A;  3Q6S A;  2O2L D;  1VCI A;  3RZD B;  1JWM D;  1E0B A;  1D5Z C;  2DNE A;  5COY A;  2CW0 C;  3X3M A;  3SHL A;  4MN3 A;  1SMY C;  2KVM A;  1GUN A;  1C4Q A;  2I07 B;  1NCV A;  1WTX A;  1E2Z A;  4RHR A;  3A54 A;  2NTT A;  1C8C A;  1HQR D;  1W6J A;  1Q1B A;  1Q12 A;  1SNO A;  1EL0 A;  4FXD A;  2F0N A;  3I70 A;  3HOW B;  1ESF A;  1ENF A;  3C3L A;  2L11 A;  2MPM A;  1KAA A;  2KEE A;  3VR3 A;  1HFN A;  4ABN A;  2ZXP A;  1ET9 A;  1GXD C;  3SK4 A;  2F0U A;  3H91 A;  2NWG A;  4A3E B;  1V1O A;  1LT3 D;  1G8Z D;  1BCP D;  5C0X I;  2K5Q A;  5M5Y B;  3HEJ A;  3TN2 A;  1IW7 C;  3OIP A;  5I6W A;  1LAC A;  2NN6 G;  3OIQ A;  2B8G A;  1LTB D;  3A8I E;  5KYI A;  4PV1 C;  5C5M A;  4QF4 A;  3D6W A;  1U4M A;  4K2K A;  1B53 A;  2B2U A;  2JA5 B;  3TBI B;  3S14 B;  4L6T B;  1CQV A;  5A35 A;  2M9V A;  3TP5 A;  2QKI C;  2MGS A;  1H9S B;  2B2V C;  4KMU C;  2RDF A;  3T4A C;  1ZEQ X;  5EPL A;  3S9W A;  3NPP A;  1FNW A;  3H3V C;  4A3J B;  4KHV A;  3MAQ A;  3BYT B;  1LT4 D;  4OHJ A;  1Y8N B;  5JEA G;  2MHV A;  3KBG A;  3UI2 A;  5D3D A;  1IKL A;  1O78 A;  3PO2 B;  1SSO A;  4XT3 B;  1EYC A;  4CJ0 B;  1U4P A;  1DCZ A;  3VYT A;  2X6G A;  1ENC A;  1XYI A;  1EU4 A;  3A56 A;  5COR A;  4RGN A;  1KNE A;  1SBB B;  1GUG A;  4DAV A;  4DGZ A;  1J8I A;  2H4O A;  3I73 A;  1WTV A;  2Z1C A;  2HUG A;  2QF7 A;  4U67 3;  4KD3 A;  3GQB A;  1HHV A;  3QB3 A;  1PYW D;  2PZT A;  3E5S A;  4ZLT F;  2B2T C;  4ZRZ A;  1LT6 D;  4U68 A;  3PUW A;  3NXW A;  5LL6 S;  1EYD A;  4NW2 A;  1QNU A;  1PFN A;  3H94 A;  1V1P A;  4NP5 A;  1TU2 B;  3NSW A;  1BXT A;  1IYU A;  2FHT A;  1PLF A;  3DWA A;  3D3R A;  1WCM B;  3J7Y W;  5DEH A;  2AWO A;  1STA A;  1H9R A;  3H09 A;  4BS9 A;  3KBX A;  4ODG A;  1I4P A;  5I2Y A;  2F0S A;  5J22 A;  3SK6 A;  4CKC A;  2WKD A;  3PUX A;  3DUZ A;  4X3S A;  2E76 C;  3HZX A;  5CV7 A;  4A3F B;  4DXF A;  2F0O A;  5A2Q L;  2Q8R E;  2D62 A;  3OWF A;  1CHQ D;  4TQU S;  3DXJ C;  3QWN A;  3S1Q B;  1PZK D;  4E6I A;  3OW7 A;  3ERQ A;  2EYJ A;  2EYM A;  4KKU A;  4J1M A;  2B2Y C;  3GTG B;  1V43 A;  1EEF D;  1U9R A;  3LNN A;  1KNA A;  4K6L A;  5M5W B;  1II3 A;  3CRL C;  3TP6 A;  3SE0 A;  1YNN C;  1PFB A;  3MXU A;  3JAM L;  2FJ2 A;  4NDX A;  2F0G A;  1F9S A;  4X3T A;  4X3U A;  2B2W A;  1WTR A;  3QJY A;  3D4R A;  3P1H A;  5EKI A;  1K8M A;  5LHY 1;  3FVQ A;  4CKB A;  3J7A F;  3R8B A;  1OXU A;  5M3F B;  5C4X B;  1LTG D;  1TY0 A;  4EVO A;  4I7Z C;  3HRZ C;  1KDB A;  1FD7 D;  5IT9 L;  4KY7 A;  4EQN A;  1V1P B;  1ZKO A;  5CBE E;  3AU7 A;  3MHB A;  1NAP A;  3M4O B;  3TP7 A;  5K36 G;  3K6O A;  1EWH A;  2NVQ B;  4YIJ A;  3I4N B;  2HCI A;  4C1N K;  3MC0 B;  2G9D A;  4F8M A;  1EFI D;  2G9H D;  4H7B A;  1VF7 A;  1O80 A;  3CU7 A;  5C3E B;  2L0C A;  3QIA A;  1RTO A;  2AQ1 B;  1JB3 A;  3U9O A;  1QIL A;  3S1R B;  3D4D A;  1D5X C;  2A6H C;  1PXU A;  4UAI A;  2CHB D;  2F0W A;  2HDM A;  1F9Q A;  5CV5 A;  1I4X A;  3K0Y A;  2E2D C;  3GD7 A;  1JC7 A;  2NYZ D;  2BA1 A;  5D3I B;  1R4Q B;  1SE3 A;  2QIL A;  1D1K A;  3PUZ A;  1I4Q A;  3PV0 A;  3J7A V;  4RA8 A;  5EKL A;  4KI0 A;  2B2U C;  3C46 A;  2IJ0 A;  3SEB A;  2A68 C;  3MEH A;  2CQA A;  1I3Q B;  4K5X A;  2F0K A;  5C3W A;  3VR5 A;  3MXN A;  1I6V C;  1STB A;  4RCO A;  1U4L A;  5CC4 A;  1FGB D;  2B8F A;  4CKE A;  3NTK A;  3EJI A;  4DAY A;  4WRD A;  5EBC A;  2L4N A;  1GHJ A;  2EXZ A;  1O7Z A;  1S5B D;  3BVZ A;  2ID0 A;  5JPM C;  1DJR D;  4RWS C;  1PTO F;  3OMG A;  2D5D A;  3SK8 A;  1FNV A;  3OWE B;  1O7Y A;  4KTA A;  2K01 A;  3RD4 A;  4G7H C;  2XWJ B;  4RGM A;  1Q3L A;  3BS1 A;  3MFY A;  2JA8 B;  3LWE A;  3M7G A;  1XXG A;  3Q22 A;  2VB2 X;  4FF3 A;  3PO3 B;  2F3W A;  2PO4 A;  1EQT A;  3A7A B;  1AFP A;  1HUN A;  1SYE A;  1SDF A;  4QUF A;  1JCK B;  2A73 B;  4BY1 B;  3EVQ A;  4FF4 A;  2KJX A;  5A2Q E;  1AW7 A;  3IL8 A;  3TZD A;  1G6Z A;  3GP7 A;  3QOJ A;  1K83 B;  3GTM B;  1B4O A;  1B3A A;  1BF4 A;  2F0H A;  5C3X A;  1CT1 D;  2LFN A;  2RDG A;  3GTL B;  2K6A A;  1ZYR C;  2N55 A;  4KJO A;  3VYU A;  2XRS D;  2WAC A;  2KA7 A;  5NUC A;  1DM0 B;  3H6M A;  1LTT D;  1D5M C;  4PMW A;  3JAM E;  5BN5 A;  4S3S A;  1RD9 D;  1JWU D;  4QB4 A;  1F77 A;  1HCZ A;  1F9R A;  2F1M A;  4OIK A;  5JJZ A;  2KOL A;  4C2M B;  3M85 A;  2LMC B;  2EY2 A;  4A3K B;  1SYB A;  3A7L A;  1RCV D;  4IUU A;  1WTP A;  3VYS A;  2JEA I;  1X3Q A;  4FF1 A;  2XRQ D;  5E1F A;  1IYV A;  1MSG A;  3S16 B;  3CHB D;  1NR2 A;  4XQQ A;  2QDB A;  5IIF A;  1A2T A;  3AMU A;  1JQY D;  5IT9 E;  1EWC A;  1CHP D;  4J8Q A;  1PDQ A;  3P75 A;  2Q8I B;  5ELB A;  4A3D B;  4QUC A;  1VMC A;  1Z7T A;  3IFD A;  3FPU B;  1HUM A;  1S5C D;  4PNY A;  4R8N A;  3NTH A;  1YNJ C;  2A69 D;  5IGG A;  1OXS C;  4AYB B;  2PYK A;  3E0J A;  2EY6 A;  2F03 A;  1EY7 A;  1SYC A;  1XTC D;  1STG A;  2CW0 D;  1JIC A;  2B2W C;  1UAP A;  1Z6H A;  1EU3 A;  1STH A;  1A6X A;  3T53 B;  1BUV T;  4RHS A;  1CZG A;  1PTO B;  4L63 B;  4L8J A;  1TWA B;  3D4W A;  2O5I C;  3HP3 A;  4RKL A;  4EQP A;  3RLF A;  4RFB A;  4N9P A;  1HA6 A;  4DU9 A;  5K36 H;  2WII B;  2EJG C;  1WTO A;  4HN7 A;  5G3L F;  4G7Z C;  3MTS A;  4NKL A;  2J4X A;  1SEB D;  3IFT A;  1SXT A;  2L55 A;  1BCP C;  2SOB A;  3NUC A;  1ESR A;  2A6E D;  2F0V A;  4M8A A;  4XTC S;  1GUT A;  1E2V A;  3GV3 A;  4OO1 I;  3K57 A;  2A74 C;  1EYA A;  3QO2 A;  4EGV A;  3SVM A;  3A8J E;  3C1E A;  3K5N A;  1M4V A;  4K14 A;  1MGS A;  4WFN 3;  4ULL A;  1WTW A;  4C1N I;  1IL8 A;  1F2Y A;  3K58 A;  2R92 B;  2EPB A;  3HKZ B;  4ZKC B;  1I50 B;  3OPO A;  1KLG D;  2F0E A;  3VA5 A;  1KAB A;  5C5L A;  3U9S A;  4CHT B;  3KLS X;  1ZXT A;  4X3K A;  4V19 0;  2CVR A;  4ILW A;  2X69 A;  2Z4I A;  5FK9 C;  1LAB A;  1GHK A;  1QB5 D;  3BVG A;  1QWY A;  3CKI B;  2I46 A;  1PRT C;  4DF7 A;  4FYD A;  2F0J A;  5KGU A;  5I9O A;  1RF2 D;  4IFD I;  1WVL A;  2E2I B;  2EJF C;  1JOK A;  3I8Z A;  4CBV A;  2WIN B;  4K5V A;  4CGY B;  1F2M A;  2LY7 A;  5E4W C;  1B2T A;  2AWN A;  1QNK A;  3HOU B;  1G91 A;  2RSN A;  2XNA C;  5DNF A;  2PMZ B;  4BA1 I;  2NBF A;  3MXG A;  1A3T A;  1OXT A;  1RHP A;  2OEO A;  3T16 A;  5IGB A;  1R4P B;  1C48 A;  2C9O A;  2XN9 C;  1K8O A;  3PMF A;  3VA7 A;  3DWP A;  5JVG 3;  5C6A A;  2ZT9 C;  2RVL A;  1TVX A;  1PZI D;  3S1N B;  1MI2 A;  1IHZ A;  1STY A;  3OHX C;  1BQQ T;  1BBX C;  3I4M B;  1PTO D;  1QCB D;  3PUY A;  5IGD A;  1S5F D;  2JYO A;  3NWT A;  2EY1 A;  3IAY A;  3A55 A;  5D65 A;  2D2C C;  4XXE A;  3FDT A;  3Q23 A;  2WKC A;  3LX0 A;  2VB3 X;  5DAU A;  4A93 B;  3K5L A;  4F88 A;  1I4R A;  2HCC A;  2FFK B;  3CQZ B;  5C0X H;  3VR2 A;  4FXG C;  1JOO A;  2DY7 A;  4PMB A;  1I4G A;  5J1Z A;  2HQE A;  1NR4 A;  1L0X B;  3R93 A;  4A3G B;  4KY6 A;  2MJ8 A;  1SJH D;  2F0I A;  2PZW A;  2PPB C;  2B63 B;  2WP8 J;  4ZQ3 A;  2WV6 D;  5BN4 A;  3RMH A;  3ONA B;  4KY5 A;  1AZP A;  4KV6 A;  2JP1 A;  5ELE A;  1SFO B;  3EFX D;  1Q8I A;  3I90 A;  1S4Z A;  5C4Z A;  3T56 B;  4XYQ A;  1OO9 B;  2M2L A;  2EYO A;  2IPK D;  2EJM A;  2JA7 B;  3NHH A;  1STE A;  5EBD A;  3MA2 B;  1ML0 D;  1ONL A;  3Q24 A;  2OT2 A;  4PQX A;  1SE2 A;  3WOF A;  1M8A A;  4RGO S;  2JA6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...