4J6HA

Crystal structure of staphylococcal nuclease variant delta+phs h121q at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTQEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS H121Q at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4j6hA00
4B9XA 1EY4A 1EZ6A 4ZUIA 2HQEA 3QB3A 1EQVA 5CV8A 1AEXA 2F0HA 2OXPA 3NQTA 4KY6A 2EYHA 4DU9A 5C4HA 3SK8A 3MXPA 1STBA 3TP5A 1ENAA 1NUCA 1KDAA 3R3OA 4H7BA 4KJOA 4KJNA 5HGTA 5IGEA 2F0LA 2F0OA 5IGGA 3P1HA 1JOQA 2SNSA 1A3UA 1EY7A 1SNMA 2EYFA 3QOLA 4N9PA 4RKLA 3SXHA 2EYLA 4EQNA 2NUCA 4R8NA 5C6AA 5EGTA 3MVVA 4K8JA 4F7XA 1JOKA 1KABA 4J6HA 4K5WA 5IGFA 2F0FA 2EYJA 3MZ5A 4ODGA 3OMGA 1II3A 1SYEA 3DHQA 5CV9A 1JOOA 4DFAA 3NP8A 4KTAA 4EVOA 5I9PA 5JAVA 4I65A 2RBMA 1IHZA 2M00A 5C3XA 2F0DA 3D8GA 1EY5A 1EYCA 5IGCA 5KRUA 2PW7A 3TMEA 2EY1A 1SNDA 5KGUA 2PZUA 4S3SA 5K5PA 3EJIA 4IALA 1EYAA 3C1FA 4NMZA 4ID6A 2OF1A 2OEOA 1STHA 4WRDA 3SK6A 3LX0A 4QF4A 3C1EA 4EQOA 1SYGA 2PQEA 2EY6A 5IODA 5CV5A 5IIFA 4IZ8A 2EYMA 2F3VA 4PNYA 3OMCA 3NK9A 2RKSA 4HMIA 4LAAA 5C3WA 2KHSA 2PYKA 5KYIA 1A2UA 1SNOA 1NSNS 5KYLA 2ENBA 2SOBA 1TR5A 4IUNA 1ENCA 2PZTA 3ERQA 4K8IA 3EVQA 5EKKA 5KEEA 3D6CA 3RUZA 4RKBA 4J1MA 4QMGA 5E1FA 1KAAA 3SHLA 3DMUA 2EY5A 4KY7A 5EKLA 5M9OA 5J1ZA 4KY5A 4EQPA 5J22A 1EY6A 5I6YA 4MIUA 1A3VA 3BDCA 5I6WA 1SYDA 2EY2A 4DGZA 1EY8A 4G57A 3NUCA 4K2LA 5NUCA 4TRDA 2O4XA 2EXZA 1SYCA 5CGKA 3NHHA 3T13A 1STNA 1EY9A 5F2DA 2PZWA 3MHBA 4KD3A 1F2ZA 4KHVA 3S9WA 2F0VA 5CC4A 3MEHA 5J39A 2F3WA 3V2TA 2PW5A 4NKLA 2EYPA 3SK5A 2F0GA 5CV7A 3PMFA 4KD4A 2F0WA 2F0PA 3T16A 1SNQA 1SYFA 5CR3A 2F0IA 4F8MA 1JORA 1A2TA 1EZ8A 4K6DA 4ME5A 3TP8A 4OL7A 2LKVA 5C4ZA 1U9RA 4YIJA 2F0KA 4KV6A 4ZUJA 4NDXA 4E6IA 1SYBA 5CV4A 1EYDA 1RKNA 1SNPA 3TP6A 5E3FA 3U9OA 2F0NA 2RDFA 1TQOA 3NXWA 3SK4A 3OWFA 5HURA 3OSOA 5IOCA 4HMJA 3HZXA 1STYA 4K5VA 2QDBA 1A3TA 5KIXA 4ZQ3A 3VA5A 2F0EA 3TP7A 2F0MA 2WACA 5CV6A 5C5LA 3E5SA 4K2KA 2EYOA 3ITPA 1SNCA 1KDBA 2F0TA 1F2MA 3BDLA 3EROA 3H6MA 4NP5A 5IGBA 4PMCA 4B9WA 5DAUA 2F0JA 3SR1A 4PMBA 1F2YA 1KDCA 5ISRA 3HEJA 4N9TA 5IGDA 4DF7A 5DEHA 1EY0A 4K5XA 1STGA 2F0SA 5JOBA 2SNMA 5C5MA 5I9OA 3D4DA 3QOJA 4WORA 2KQ3A 4K14A 3D4WA 2F0UA 4QB4A 1TT2A 3P75A 1STAA 4HTHA 2F0QA
chains in the Genus database with same CATH superfamily
1HPCA 3QB3A 2G9DA 1QNKA 2JSOA 5DNFA 1DD2A 2WB1B 5KNBA 3T1HQ 2R93B 3TBIB 5IGEA 4FDBA 5KNCA 1VQOA 3KLSA 3QOLA 4EQNA 4FXGC 3DXJC 5EGTA 4XT3B 3J7A5 2F0FA 4JI0Q 4LUVA 1JOOA 3OIQA 4HIMA 5JVG3 2H4OA 1UWVA 2Q2UA 3D8GA 1EYCA 3MXUA 4BY1H 4CKCA 3VR2A 3DEOA 3DEPA 4S3SA 4JI3L 2UUCQ 2QF7A 1YBYA 4NMZA 5IY0A 1PRTC 2L9HA 4K0KL 1OXVA 1HZ9A 1ASYA 2IX0A 3PSIA 1KD1C 1J6QA 2JP1A 3I91A 3MTSA 2E8GA 1HH2P 4BWGB 5KEEA 3ERQA 4TVAB 1VQ4A 2DGYA 1VQ7A 1KAAA 3DMUA 2HHHL 3S2DH 5D14A 3K58A 2QA4A 4V0BA 5I6YA 4OIJA 5I6WA 2EY2A 3Q23A 4DGZA 1TWFH 3HP3A 5M3MH 1XNRL 1CHQD 2Y0SG 5HY6A 3S1NB 3T13A 1GVPA 5LMUQ 4Y7NB 2BH2A 3S14B 1KNEA 4BBRG 4OHJA 2WB1G 2M2LA 1O7LA 4DK3C 5GAHC 2L4NA 3D0FA 1N33Q 1Q81C 5D3IB 2A6HC 3WOEA 1KNAA 2D0PA 4QIWB 1SJED 3KDFB 5GAEC 1PRTD 1C9OA 1SMXA 4H0LC 1WOCA 2KOLA 1V8QA 5LL6X 2MO0A 3NEMA 4JOIA 2UXDQ 3JAMc 2R7ZB 1X3GA 5K36G 2B2YC 1B8AA 5C44B 1HNXL 1JT8A 5C3EH 1XMQQ 3I3CA 1EY0A 2F0SA 1FJGL 3PV0A 1HZAA 1X6OA 3I72A 4IPCA 5EKLA 1EY4A 5EPLA 5EQ0A 4A3EH 2K03A 1KRTA 4OO1I 1Q12A 2AQ3B 1RL2A 4JI8Q 4A3MH 2HCIA 4KJOA 3OW2A 2JA9A 2P5ZX 5FO8B 5CYUA 1B50A 1A3UA 4A3BG 2J4XA 5ELFA 1PTOF 4DV0L 4F7XA 4DAVA 1EU3A 4QGUA 1G2SA 2BA1A 4ZRZA 4ZKBB 5CBAE 4WJ3M 1SFOB 2AMCB 1HFGA 1VQ9A 2A6HD 2PZUA 1IXRA 2B63G 2XTIA 2N55A 1SRUA 3C1FA 2ATWA 5LL6S 1Y1WH 2VQEQ 1I3QH 3HOXG 3HOUB 4A3GB 3AYHB 2E5LL 1PDQA 2RQXA 4JI3Q 2HQLA 1JWUD 1H9KA 1PFBA 5EKKA 4UP9A 5BN5A 3M7GA 4RKBA 2Q8TA 1CZWA 2A68D 3J81j 4K0KQ 1E3PA 5E4WC 3N6RA 3UDIA 3VR6A 1HCZA 3J80c 3G4SA 4G57A 3G6JB 1XNQL 3J7ZC 1VQ6A 4RWSC 4XXEA 3PUZA 2QEXA 4X62L 2MNAA 4DAYB 3CRLC 5BN4A 5F2DA 4OONA 4DA2A 2LXKA 4CBVA 3S9WA 4HSPA 5CBEE 3K6OA 3T16A 2YTVA 3M4YA 2J7ZA 3DUZA 3H0GH 2Q8RE 4R1JA 2JA7H 1GUNA 2SDFA 5DM73 2B29A 3BZKA 3TEHB 4LNQA 1RHPA 4LF5L 3K7AB 3HZXA 3PIP3 3RZOB 3CRKC 1AE2A 3QG1A 4ZQ3A 2I5LX 2NB0A 4U673 1WFQA 3K81C 4DR7L 2Z9HA 3M3YH 5IGBA 3MAQA 1L2FA 5IGDA 5C0XH 4I7ZC 5DEHA 1GOZA 4A3GG 1TY0A 3U9SA 3D4WA 3TSSA 3RN5A 4GLAC 2KCMA 2UUBQ 4KHPQ 3I73A 2HQEA 3HS0C 1G291 4X65Q 2KCCA 1IW7C 3H15A 1HNXQ 4H7BA 2VY3A 4KJNA 2ZTDA 1JOQA 1FJGQ 1AW7A 1CA5A 1S3OA 3I8ZA 2PMZE 4DV1L 2RA4A 4X66L 3NP8A 3K0YA 2K04A 2NBFA 1EY5A 4IN3A 4ABNA 1PYSB 2QEJC 4BXXG 5KGUA 3K0XA 3VR4A 1MKHA 1I6VC 3EJIA 2EQSA 1S5BD 3K5OA 1WCMH 3MFYA 2EY6A 3U50C 1VQPA 3OHXC 2JA8B 4PG3A 4DUYL 2X6GA 3H94A 4LAAA 3DLLA 2XIWA 4FYDA 1H9SA 2B39A 1C48A 3NELA 4IUQA 1LACA 1RDPD 4A4IA 2IW3A 2K5DA 1ZEQX 4DV4L 5J22A 4MIUA 1XPUA 2JA6B 1Q8KA 5IWAQ 1IW7D 3PO2G 3ND8A 1Y1VB 2HDMA 1LTBD 1BNZA 1O7ZA 2JA5G 3S15B 2EJGC 3GTKB 4OX9L 3LNNA 1S5DD 2IHEA 4DV3L 2E2IB 3D31A 4YWKA 4KD4A 2LY7A 3TZUA 1XNQQ 3BVMA 5I4DA 1GXDC 2E2DC 2OT2A 3BZDB 4C2MH 1QUQB 2L0CA 1G91A 3AFQA 1UEBA 4RFBA 4R4TA 5HURA 2CCZA 2IPKD 5IYBH 4BY7H 1N32Q 4A93H 3J7AF 4QCLA 3NBHA 1BBWA 3TP7A 1BOSA 1I94Q 4IUPA 1KAWA 3BVGA 4JI7L 1L1OC 4HN7A 1FGBD 2Z1CA 2A8VA 1T5EA 2DN8A 4LF5Q 2SNMA 2TMPA 4JI6L 2FJ2A 4RG1A 4O2DA 4IO9A 2R61A 2FXQA 2A1AA 4ZUIA 5FJ8H 3CCUA 3UE0A 1D7QA 3K80C 3PO3G 5A2QL 4IJLA 2F1MA 1U4LA 3A8JE 3HKZB 1DOMA 5JPMC 3UDGA 1PTOC 5EBCA 3WDNA 3OMGA 4A3JG 4DPGA 1A63A 2CFMA 2PO4A 5I9PA 2XRQD 4X3TA 4YWLA 1I6HB 5KRUA 3LWUA 1QOHA 2K75A 4ME3A 2K01A 3I4MB 1IBKL 1E1OA 4IALA 4ZLTF 1CTMA 3KF8B 4ID6A 5CMDA 1HQMC 2CH4W 2A74C 1VS0A 4X66Q 4QUFA 2NWGA 1SSOA 1Z6HA 2PMZB 1EOVA 3PUWA 4RHRA 5I2XA 2RKSA 4HMIA 5C3WA 2C9OA 1FVIA 1LYLA 1LT5D 4ZCKA 2PZTA 3KLSX 4X6AH 4R4OA 1HTPA 4C3JB 4JBKA 1I50B 3DWQA 2K28A 1EIHA 3I4NB 1MSHA 4DUYQ 1EY8A 3MEFA 4AYBE 4LF6L 2LMCB 3CP0A 4K2LA 5CGKA 2E2JH 4UY8C 4A3KB 2VUMB 3RZDH 1T5XD 1SROA 4DV4Q 5IYCG 1PTOD 4KHVA 1C0AA 2RVLA 4LF9Q 2YU9H 4DNRB 4GKKL 2EYPA 1BQQT 1YJ9A 4OELB 5JJLA 4JPBW 2KEEA 2X6LA 3ER0A 4RA8A 3T53B 2L15A 1MIUA 2NVYB 1VQCA 2AWOA 4L63B 3F2UA 4Q5VA 3A8IE 4DV3Q 4KK7A 1N34Q 1WTQA 2NZHA 3I4LA 4DV7L 1F2MA 1JWSD 4PMCA 5C4XB 5LMNL 1YIJA 4N9TA 3A7LA 1NAPA 1CKNB 4GOPC 3HKSA 1N8RC 2UUAL 5EKIA 2K14A 1JWMD 3BJUA 1TS2A 3NTHA 1XX8A 1JJCB 1KL9A 1LTID 1K9MC 4JI7Q 3R3OA 3UI2A 2DJGC 4IFDG 4ALPA 2KCTA 4RKLA 4YCVA 3I4NG 4JBWA 1YZ6A 2A69C 1GHKA 4KI0A 3BS1A 4RGNA 3S16B 1I4PA 2EZVA 1WTRA 2IX1A 3CF5A 4UAIA 4DK0A 1OXTA 3L0OA 2B2TC 4FVMA 2L11A 1PMRA 4PZ8A 4JI0L 1X9NA 1L1OA 2OF1A 3SK6A 3TN2A 1VQFA 2YTYA 1FYCA 3KLRA 4C3IH 1H95A 3CAMA 1MJCA 3HOYH 1TXYA 2BA0A 1H9MA 2PYKA 2X69A 3FKIH 4P71A 2G5DA 4Y52H 2L12A 1IBKQ 4DK1A 1K83H 3RUZA 4J1MA 4LFAL 5JPNC 1YHBA 1S72A 3NWSA 1NTGA 2EY5A 1BUVT 2VZAA 4KN7C 3CCVA 4TKOB 3C2PA 1CSPA 2IT1A 3I7FA 1LT4D 1UE6A 4TSSA 3GTOB 1P8LA 3AFPA 4GS3A 3CCJA 4RMFA 2ZM6L 1F2ZA 1TWGB 5C4XH 2AUJD 3HOWH 3ZJYC 2AQ2B 1QCBD 3R2TA 2JEAI 4LF6Q 1PTOH 1EZ8A 3GTQB 3L9AX 3R8BA 1WTWA 2F0NA 5M3FH 3OSOA 3H3VC 1U0LA 4LFCQ 4L5QA 2K33A 4GN4B 4GKKQ 4A3DG 5IP7H 2K50A 3A74A 4X64L 3A7AB 5C4JB 3F2BA 1BF4A 1LTTD 1S5CD 3MXNA 3AB9A 4P74A 3QOJA 1EWIA 1NY4A 2KQ3A 4XYOA 3MXGA 4JC0A 1HUMA 2F0HA 4DV7Q 2QCPX 2EYHA 2JYOA 1K8OA 3MXPA 5LMNW 5LMNQ 2F0OA 2DJFC 1B9MA 2R92G 4JW0A 2BDOA 3EN2A 3Q6SA 2UUAQ 1Y14B 2UXCL 1WD0A 1E2WA 5T1GA 2EYJA 1DCZA 1I4QA 4GKJQ 1TWAB 4RAUC 4RCNA 2HIXA 1VQEA 1PHJA 2K32A 2CVRA 1VQGA 2Y0SB 1M8AA 1VMPA 2Z4HA 3HRZC 1SNDA 1HA5A 5M5XB 1CHPD 1ILPA 2NVQH 4YHHQ 2B2UC 5FLXc 4BBRB 4GOPA 2K05A 4R4QA 1SYGA 3GTJH 4ULLA 4DAPA 2IY5B 4IZ8A 3M9BA 2A5HA 1EEID 3HOZH 2K6AA 3S1QH 4AYBG 4A3FH 2E2HB 3GP7A 1BVSA 1RIPA 2N49A 1HRJA 1NSNS 2HCCA 1O78A 2ES2A 2VQEL 4K8IA 3E0EA 2D62A 4EX5A 1VQNA 1MHWC 1M1KC 4BY1G 4A3CH 2GVAA 4OXPA 2EPBA 1KQSA 4I7AA 3VR3A 2JQOA 1FR3A 2B2TA 1YNXA 2JEBI 2B8FA 4LFAQ 3VYUA 1PH4A 3GTMB 4A3IH 3A5UA 1FNVA 5J39A 1TWCH 2BE5C 3GV6A 4DK6C 3IFDA 5GROA 1W3SA 1JORA 2F0IA 2LSSA 3T56B 4ME5A 1PFMA 1WTVA 3NTIA 4KV6A 4ZUJA 5BR8Q 5IP9H 4A3MB 4A3BB 1DONA 2K5NA 2ZM6Q 2NVTB 1BXTA 1DOKA 2CW0C 3TRZA 3EIVA 1AN8A 1X3PA 5M3MG 4BBSH 3IKJA 3E5SA 3DWAA 1LUZA 1WTXA 2B63B 1QG7A 1ML0D 5ISRA 1EIGA 3RD4A 1TVXA 3S1RB 3GO5A 1STGA 4K5XA 4FXDA 3F8TA 2JN4A 4YCUA 1JQYD 5D65A 2EIFA 3P75A 3ZYYX 3CQZH 3HOXB 1Z7TA 4DR5Q 5IYDH 1NMFA 1IKLA 4X64Q 1ZYRC 1C7YA 4C3HH 1G6ZA 2JE6I 2N78A 3TP5A 1NUCA 1TS3A 2ZT9C 4O0AA 5E7NA 3EQLC 2UUBL 4LUOA 4KHPL 2R93H 4RCOA 4J6HA 4X65L 1IBLL 1TU2B 1MD2D 2R3ZA 3EA6A 5C3EG 5EBDA 4YWMA 3U4VA 1E2VA 1Y8OB 3CCRA 4NXML 2L5TA 4IUUA 2UXCQ 4WRDA 4Q0FA 5D3DA 4CJ0B 4A3EG 2CW0D 2GA4B 2RHQB 1OXSC 2NN6H 4A3MG 4PZ6A 4MNOA 3J80E 4XDXA 3H3VH 1X55A 1Q46A 1SE2A 2EJFC 1PYBA 3W5OA 2FMCA 4X3UA 4FF3A 3K57A 3S17B 3M4OB 2E76C 1SJHD 1PH8A 3KK7A 1Y8NB 5IT9E 3J7YW 3BYYB 1ZYRD 4R4IA 3BYTB 4DV5L 4QL5A 3X3NA 1F9PA 3UDFA 4BA1I 1ENFA 1Y1WG 1STNA 3KDFA 1LV9A 1STEA 4JI1L 1QVCA 5CC4A 3OIPA 4Y7NH 2B2UA 5IWAL 2PW5A 1V1OA 4NKLA 1N36L 3CC2A 2F0GA 4X3KA 5CV7A 3J81E 4JBMA 3S14H 5CR3A 2YTXA 4ZKCB 4IUVA 2PQAB 3A8KE 1MSGA 4JV5L 1I4GA 2Q2HA 3OWFA 3M7NA 4DNIA 4K5VA 1A3TA 1QZHA 3KF6B 1SDFA 2FHTA 3A5ZB 4AQYQ 4JYAQ 1EFWA 4LF7L 3MWYW 1WTOA 1YNNC 2B2VC 1Z47A 3N52A 1PA6A 1EUJA 2R7ZH 4IPGA 4IUTA 4RGOS 1VQBA 5C44H 1RCVD 1N32L 1X3QA 5C5MA 1IKMA 4GN5A 3NSWA 1I94L 4PQXA 2OTLA 1LLRD 4J8QA 3H0GG 1EQVA 2JA7G 3NQTA 2OXPA 1IBML 1PFSA 1EFID 1ENAA 4L8JA 5EPKA 1D1IA 1TWHB 3KJPA 3CKIB 1U4RA 3S2HB 1B7YB 3CU7A 4KKUA 4DXGA 1JOKA 2IX3A 5IGFA 3V05A 3DHQA 3G48A 5CV9A 1K3RA 1OXUA 2ZJQA 5C0XG 3PO2B 1MJEA 3A55A 1ICFB 2JA5B 2E74C 1J5EQ 1SAPA 1IBLQ 2WKCA 1SMYC 2DY8A 1VQDA 2F3VA 1WTPA 1ASZA 2D2CC 1B3AA 2R7FA 1YNND 2VQFQ 2K7VA 2O5JC 3L2PA 4HCEA 3HOUH 4A3GH 1SNOA 4GNXB 1WD1A 4NXMQ 1GD7A 4DAYA 1TR5A 4FNFA 1YJNA 2XVSA 3B6YA 1HTLD 1CUKA 4JK1C 3SGIA 3TDQA 2YV5A 5J1ZA 3BDCA 1EOTA 4DUZQ 4A93B 1F77A 4N8FA 2K5QA 1WCMG 2PI2A 1CT1D 2UXBL 1X3FA 5FO7B 1KLUD 1NR2A 4O1NA 1ZXTA 4OO1H 4LK1C 3X3MA 1GKHA 3PF4A 1I4XA 1IL2A 3PO3B 4FF4A 1D5ZC 4DV5Q 1BBUA 4IOCA 2ICIA 1G6PA 1FNWA 4E6IA 1SYBA 3U9OA 4LF9L 5ELEA 4JI1Q 1A0IA 4A3JB 5ELNA 4UP7A 1ET9A 1PLFA 1N36Q 5M5WB 1SMYD 2GVBA 3K7AH 3RZOH 4MHEA 3NQIA 4LW1A 3ITPA 4HR7B 4POFA 4JV5Q 4CJ1B 3K5MA 1VQMA 2A6EC 1YI2A 2A19A 3DM3A 2VB2X 1HZBA 4U68A 4AH6A 4DR2Q 2ZJPA 1N34L 2RSOA 1FGUA 4LF7Q 3E9IA 4L5RC 1STAA 4HTHA 4HIOA 2TSSA 2MQHA 4A3LG 1NCVA 1E2ZA 3P1HA 5IYBG 3UDXA 2XNAC 3Q22A 4BY7G 2C35B 1RTOA 4R8NA 4A93G 4UHVA 3F2CA 3OPOA 4XQJA 4DR1Q 1BCPB 4IFDI 1D6EC 3BG3A 1IBMQ 1HNWQ 1GUTA 5G3LF 1VQ8A 3BDOA 1D1KA 4XT1B 3VDYA 2B2VA 2GN5A 4NPSA 1HA6A 5BN3A 1LTSD 1VQAA 2FMMA 2PNRC 4OGQC 3GTLB 2E2JB 2OEOA 1STHA 2Z4IA 5FJ8G 1V9PA 5IIFA 4H13C 4OWWB 1NNXA 2AQ1B 3GV3A 3P20A 2JA8H 2ENBA 4IUNA 3HOVH 1GM5A 1AE3A 2A6ED 5FLMH 4MN3A 3D6CA 5E1FA 1LABA 5M9OA 3CCMA 2RDGA 4WFN3 3VYTA 3QIAA 2ZTCA 2KA7A 1HHVA 1W2BA 1QUQA 5FLXL 2Q8IB 3NHHA 3T1YQ 2JA6H 4H02A 1EY9A 4IQZA 3RMHA 1V1PB 1Y1VH 5HGQA 2O2LD 2F3WA 2EE1A 3S15H 2AHOB 1O7YA 2KHIA 5AFWA 2NVXB 1K8MA 4P73A 3CPFA 2UXBQ 4ZYSA 1SNPA 3CW2C 2RDFA 4IURA 4QJFA 5IOCA 3LGJA 1A8VA 1UEAB 2PCFB 1GJXA 2K1BA 4IPDA 1LTLA 4HSVA 3PCOB 2VS1A 4MZ9A 1JJGA 4LFCL 1RF2D 2F0JA 4FF2A 1F2YA 1SR3A 3HEJA 1PH3A 3QR8A 2WKDA 3PUYA 1UE7A 1VQ5A 1QE6A 4C3IB 5CV8A 4B3ML 4DV6Q 1I4HA 3KBGA 1GHJA 5HGTA 2VNUD 1KDAA 3LWEA 3G71A 2FFKB 4B08A 5IGGA 2WV6D 2JK8A 2EVBA 3KF8A 1PZJD 2E75C 1CK1A 3MA2B 1SYEA 1F9RA 4DFAA 3QWNA 2RCNA 2RBMA 2F0DA 1IZ6A 4DR3Q 2BDNA 5K5PA 1S5FD 4R4CA 1I6HH 3I2ZA 4GKJL 1LTGD 3I4MH 1U4PA 3LX0A 1D5XC 1EU4A 3S1MB 1K8AC 1VQHA 5IODA 4FO2A 4GZYC 2ALYB 1DOLA 3M85A 5EJWA 2XWBB 4LF4L 4LUZA 3NENA 3A54A 2WAQE 4YHHL 3A56A 2F4VL 3GTGH 5DLQE 3T51B 1WJJA 2NTSA 3IRBA 3I4OA 1CKMA 4GLXA 1RTNA 1EIFA 4A3DB 4MTNA 3CXCA 4XIGS 2Q2IA 4C3JH 1R9TB 1I50H 2IWHA 3F1ZA 3I4NH 1D5MC 4IOAA 1Y69U 3RN2A 2O4XA 3STBC 3PF5A 3W1BA 4C3IG 2VUMH 4WJ4A 4A3KH 2MP1A 4HJAA 5JEAG 3HOYG 1C4QA 1S5ED 4P72A 1E24A 1A2TA 3FKIG 1PH5A 3GTPB 2LKVA 3MC0B 1SE8A 1CM9A 2WINB 4HJ8A 3DWPA 4ZK9B 3NTKA 1O80A 4NDXA 5ELBA 2R92B 2DUDA 2XGTA 2VL6A 5M5YB 1VMCA 1Q90A 1JC7A 2NVYH 1JCKB 4M8AA 4OEMB 1YHQA 4L6TB 3RLOA 2B3GA 1TS5A 2F0EA 2QGQA 5BR8L 1B2TA 1YNJC 2A69D 1EL0A 3I70A 1I5FA 1JE4A 5A2QE 1FD7D 5C4XG 2L55A 3HOWG 4DV2L 5I9OA 2ICEC 1HUNA 1CZGA 2F3IA 5GADC 1S4ZA 1EYAA 3PQIA 4AYBB 4B3TL 1UUPA 1VDZA 1KC8C 5AJ3L 5M3FG 2SNSA 4CJ2C 1SNMA 2EYFA 3A0JA 4DR5L 4JCVE 1DYQA 1UE1A 2HT1A 5GQOA 1IYVA 5KNDA 4BY1B 4B3MQ 4I65A 2QW7A 3S16H 4HIDA 3VYSA 4IJHA 4DR6L 1I4RA 2RCFA 3T4AC 4QIWE 1VQJA 2KUMA 3OTOQ 1OTCA 4EQOA 1WI5A 2HDLA 1BKBA 2RDHA 5GAGC 5IT9L 2ZJRA 2ZXOA 1YNJD 3PUXA 5KYIA 1WVLA 1A2UA 5JJKA 4FF1A 2EJMA 5JVH3 3IL8A 3S2DB 2V4DA 1GUWA 4RGMA 1BDOA 3VYRA 3SHLA 2LS01 1TWFB 1PYWD 5M3MB 4PMWA 4LF4Q 1MBYA 1SYDA 3EBEA 1B53A 3J81i 4ILWA 3JC66 4YCWA 2MHVA 4RHSA 5NUCA 3PIOA 3J81L 2F4VQ 1GUOA 3D4RA 2XSCA 2CH4A 2UU9L 1X56A 4NB3A 3TQYA 1BCPF 4KD3A 3GTOH 3ND9A 1Q8IA 5EPJA 3HOZG 4A3FG 5COYA 3AMUA 1BR9A 4POGA 4F8MA 1TWGH 1KIXA 2F0PA 3BVZA 1HFNA 2KVMA 3RLFA 4K6DA 1CSQA 2MPMA 4YY3Q 1R4PB 3NPPA 2MGSA 3TP6A 3TZDA 1VQIA 1ET6A 3SK4A 3E6ZX 3ULJA 4M1UB 2F52A 3QO2A 1TIID 1QVGA 2EXDA 3GTQH 4A3CG 5JJIA 3C3LA 2SEBD 2JJQA 1HR0L 1XMOL 2F0MA 4F88A 1LTAD 3KLWA 4K2KA 5C3EB 5LHY1 3BDLA 2Z0SA 2IHFA 4A75A 4A3IG 1ESFA 4JYAL 4AQYL 1QB5D 5C4JH 2WFWA 4MTKA 1ZKOA 4DR4Q 1XXGA 4A3EB 1RD9D 2F0UA 3JAME 1JR0D 3K5LA 1CKOA 1EZ6A 3H09A 4UP8A 5IP9G 2JXMB 3FDTA 1STBA 2R7DA 1XTCD 2XN9C 3C46A 2F0LA 3I56A 3SXHA 4DV2Q 2RSNA 1K28A 2OWOA 2KEDA 1EIYB 1KABA 4BBSG 2D0OA 3MZ5A 4KTAA 2HIVA 5JAVA 1EYGA 4B3TQ 1K0SA 1IHZA 2D9UA 3KBXA 5FK9C 2WAQG 5C3XA 3CMEA 3IAYA 3TMEA 1TWAH 2EY1A 5AJ3Q 3E3XA 1HZCA 3K8AA 1Y1WB 1YITA 3L3OC 2PI2E 3FPUB 3Q0AA 1I3QB 5M5XH 1KHIA 2Z6KA 3C1EA 5IYDG 1RJTA 2PQEA 5C0XI 1PH7A 4HJ9A 1R4QB 4C3HG 2EYMA 5DM63 4BBRH 1PH2A 2G9HD 1VQLA 2KHSA 4DR6Q 1J5EL 2E2HH 2R93G 3BU2A 1F9QA 2BE5D 4XTCS 1K3BC 2VQFL 4J15A 4KY5A 4EQPA 1BO0A 1F2LA 3ERSX 5K36H 4TRDA 4IPHA 2H5XA 2EXZA 3U58A 2I46A 3MFGA 1CQVA 4DUZL 3RR5A 2NN6G 3H0GB 3V2TA 3NE5B 4JI4L 3GTMH 2JA7B 1E1TA 2CQOA 2A68C 3Q8DA 4FXKC 1WTHA 2AWNA 4P75A 4CDCC 5C4ZA 2UU9Q 4XYQA 4PV1C 2BCOA 1HXYD 4LF8Q 4F87A 2QDBA 2WIIB 4A3BH 1PRTB 4G7OC 3HGBA 3M3YB 4RGTA 3HG9A 1A15A 2NVTH 1G51A 2KJXA 2QKIC 4GNXC 1SNCA 3R93A 3S1NH 4N8X1 1LM0A 5DAUA 1AZQA 1KDCA 2N3SA 4DF7A 2F4IA 1GUSA 2B63H 3S1RH 1HR0W 1QVFA 1HR0Q 4JI2L 4G4KA 2F0QA 1XMOQ 3EFXD 3E0JA 2QDLA 1YHAA 3GD7A 1U4MA 2CWPA 1YJWA 3HOXH 4DR2L 3AEVA 5JJZA 2EDGA 2OQ0A 3W3AA 4GLVB 3E9HA 5C6AA 2K5WA 1V1QA 4DAMA 1F9SA 4ODGA 3FMCA 4CKEA 3CCSA 4CDEC 1HNZL 2R7ZG 4CGYB 4H44C 5C44G 1Z9FA 3U4ZA 1TKWB 2OCEA 1PXUA 1WCMB 4DR1L 4C1NK 4EQ5A 2DNCA 5H1SE 1HNWL 1K8GA 2OTJA 2N8NA 3OOCA 4HEDA 3SVMA 1DXMA 4LMQD 5IT9c 3CC4A 2HHHQ 1L0WA 5IE8A 2L1BA 4C56C 4AIMA 4UPAA 1C8CA 1JB7A 4JG2A 3SEBA 1XNRQ 4HAEA 3V96A 4G7HC 1Y8PB 1JMCA 3S17H 3M4OH 4IFDJ 1EY6A 5L37A 3RNUA 1NBWA 2KHJA 1SFOH 3J81c 1B70B 2FINB 2PQAA 1H9SB 2O5IC 2ZXPA 2CQAA 1PVOA 4R8IA 2PZWA 3HKZE 3ICEA 1BCPC 4CKBA 3KF6A 3M4QA 5FKAC 2MFIA 4C2MB 3HOUG 1LTRD 1M4VA 3T1YL 4FP5D 1BBXC 1VQKA 2I0QA 5CV4A 4BY7B 1RKNA 3DM1A 1TQOA 2Z8LA 1EQQA 5JEAJ 3PIO3 3HFZB 3Q24A 4JI4Q 3TS0A 1QILA 2VB3X 5C5LA 1B3QA 2EYOA 4PZ7A 3UE1A 1KDBA 2LXJA 3H6MA 3H91A 4NP5A 2KCNA 3OW7A 4B9WA 1Q7YC 2B8GA 1PH9A 1UNSA 2XWJB 4BXXH 3I55A 4OWTB 4DN4M 4V190 4OO1G 3K5NA 1ONLA 3D4DA 3WOFA 2B2YA 1OXXK 5A35A 1Q1BA 3NBHB 4DV0Q 3KJOA 1AEXA 5TSSA 3D3RA 4HJ5A 5C4HA 1CFMA 1EY7A 3AQQA 3HOVB 2NUCA 2ZTEA 2ASBA 3MVVA 4DV6L 4JI2Q 1TWHH 1BCPD 4QY7A 3S2HH 3W2DA 4NXNL 2DY7A 1SLJA 5IGCA 5ELOA 2PW7A 1XTDA 1X65A 4HCSA 4GNXA 3CC7A 2E5LQ 1P16A 3FRPB 3PO2H 1YEZA 1O7IA 3CHBD 2K5HA 1KTKA 2JA5H 3KOJA 2KENA 4DR3L 2KECA 3AU7A 1HNZQ 4JBJA 3TS2A 2V1CC 3P7JA 2IJ0A 4PNYA 1TY2A 3CCQA 4JVZA 2I07B 1AFPA 1CA6A 3O13A 1Q3LA 4L5TA 4KN4C 3EVQA 1E0BA 4QMGA 1JE5A 4A3LH 4X62Q 4OWXB 1LT6D 1A3VA 5EAYA 3BZCA 2MUYA 1OO9B 1MGSA 3KUPA 3RZDB 4QQBX 1DGSA 1QZGA 1HQRD 4APVA 4NW2A 2YU9B 3MHBA 3G7LA 1ILQA 2F0VA 3GDEA 1D8LA 3SK5A 3S24A 5ELCA 1PH1A 3PMFA 2F0WA 3CCLA 2JA8G 2EOTA 3HOVG 1HJPA 5FLMG 1MI2A 1U9RA 4DR7Q 1A62A 3PO3H 4BA2I 2K4KA 4Z9CB 3NXWA 4HMJA 5KIXA 1CI3M 2R6GA 3VA5A 4B3RL 2VW9A 1B4OA 4A3JH 5M5WH 2JA6G 3EROA 1RODA 1NE3A 2K52A 4PMBA 3ULLA 1QNUA 1Y1VG 2NZ1D 1Q1EA 3GTKH 1KLGD 4RH6A 3R2IA 4WORA 4K14A 2NZOA 1D2BA 2E2IH 4KLKA 4B9XA 1KRSA 5FOBB 4KY6A 3I90A 4DU9A 3SE0A 3KFUA 4DV1Q 1X54A 1PZID 2PNHA 4UDUC 3ULPA 1Q86C 4N9PA 1Q82C 3CD6A 3GTGB 1YVCA 3GQBA 4KHZA 4K5WA 1XYIA 1E7ZA 2M00A 3ONAB 1DJRD 1PZKD 2N88A 1W6JA 4LJZC 2C5CA 1PV4A 2J0TD 1PRTF 4OIKA 1JB3A 1ESRA 3FP9A 1W6KA 4B3SL 3NBIA 1JICA 4QF4A 3HOYB 3FHWA 2B2WC 3GTLH 1IYJB 5IYCH 1B44D 4NXNQ 1QJOA 2I5MX 3NWTA 3FKIB 2F03A 4CHTB 1DZ1A 2Q2TA 2NTTA 1K83B 1EQRA 1L0XB 4TQUS 2I5HA 3OTOL 4O42A 1ENCA 3HKZG 1L1OB 1S40A 4G7ZC 4LFBL 1V1PA 4XQNA 2MJ8A 1XWEA 2OQKA 5T1IA 4OX9Q 1FNUA 1N9WA 1SBBB 1NR4A 1M90C 1SYCA 2D5DA 4BS9A 2PPBC 1EEFD 3I4MG 2DNEA 4KMUC 3HOWB 1SXTA 5E4XA 2ID0A 1WYDA 1SE3A 1K0RA 3MEHA 1PTOB 2ZXRA 1XJVA 4JI5L 1SNQA 1SYFA 2LFNA 1J9OA 3TP8A 3WWVA 4OL7A 3IFTA 5M3FB 2Y0SE 1QWYA 3K7UC 5E3FA 2NVXH 4IFDH 1TS4A 5I2YA 1L0YB 2CHBD 2QILA 4C3JG 4LWCA 3JAMi 4L5SA 1AP0A 2WB1E 4YY3L 4JI6Q 1LT3D 3JAML 1PH6A 1SE4A 3VA7A 3T1HL 4K6LA 3M4PA 1K73C 3CMAA 1LO5D 5J3BA 1E22A 2VUMG 4A3KG 1B1ZA 3KYHC 1U5KA 2A73B 3URYA 4QB4A 4B3RQ 1SEBD 1T9HA 3PUVA 3CCEA 3FVQA 3VR5A 1X32A 1CKNA 2K5VA 3SK8A 2WP8J 4DR4L 1UE5A 4XQQA 2UUCL 5JEAH 2AUKA 3MXNB 2EYLA 3J7AV 1KXLA 4HIKA 4K8JA 2BH8A 2M9VA 3RLNA 2YYZA 3K59A 3SDZA 1II3A 3G6EA 4EVOA 4DNTB 4CDFC 1H9JA 2Z6KC 2NVQB 3W1GA 1FL0A 1DM0B 1EWCA 4QUCA 3GTJB 5FO9B 5CORA 3QJYA 3HOZB 3S1QB 4EGVA 4A3FB 1J8IA 5CV5A 1EWHA 4ZAIA 3L7ZC 3S1MH 3STBD 1XPOA 3OMCA 2XRSD 3NK9A 2AKWB 5IP7G 5KYLA 1A6XA 2SOBA 5ELDA 5FLXE 5LMUL 4B3SQ 3F2DA 1G2TA 4GOPB 3J80i 4JOIC 2RF4A 4KY7A 1G8ZD 3PGZA 3J80L 1CQFA 1JJ2A 1AZPA 1N33L 4P2CB 4A3DH 3NUCA 2HD3A 4WJWA 3PIPA 3FEWX 4A3IB 1R9TH 1H9RA 1ICWA 1TWCB 1V43A 2BOSA 3OWEB 4LFBQ 5C0XJ 4KKSA 1B9NA 2MO1A 4HJ7A 4CDDC 2CKZB 2B2WA 1VF5C 2UXDL 2IL8A 2RHSB 2NN6I 4X3SA 4YIJA 4A76A 2F0KA 1NJIC 2HUGA 3H3VI 1AH9A 1EYDA 4DXFA 3GTPH 1XMQL 1X3EA 2CWAA 1STYA 3TREA 1EQTA 2R92H 4BBSB 1NMGA 1SN8A 4GN3B 2KBNA 5M5YH 1GUGA 3D6WA 4R9WA 3CPWA 1IYUA 2WACA 4JI5Q 5CV6A 2WAQB 4C1NI 4LF8L 1XPRA 1VF7A 2F0TA 2Z6BA 4JI8L 4KKTA 3SR1A 1UAPA 2H1EA 2VXWA 1IL8A 3OYYA 2NYZD 1VCIA 5JOBA 1PFNA 3CQZB 4DKAC 1GO3E 3FPPA 4C3HB 1TT2A 5G3LD
chains in the Genus database with same CATH topology
1HPCA 3QB3A 2G9DA 1QNKA 2JSOA 5DNFA 1DD2A 2WB1B 5KNBA 2R93B 3TBIB 5IGEA 5KNCA 3KLSA 3QOLA 4EQNA 4FXGC 3DXJC 5EGTA 4XT3B 2F0FA 1JOOA 3OIQA 5JVG3 2H4OA 3D8GA 1EYCA 3MXUA 4CKCA 3VR2A 3DEOA 3DEPA 4S3SA 2QF7A 4NMZA 1PRTC 2L9HA 1OXVA 2IX0A 2JP1A 3I91A 3MTSA 4BWGB 5KEEA 3ERQA 1KAAA 3DMUA 5D14A 3K58A 4V0BA 5I6YA 4OIJA 5I6WA 2EY2A 3Q23A 4DGZA 3HP3A 1CHQD 3S1NB 3T13A 4Y7NB 3S14B 1KNEA 4OHJA 2M2LA 1O7LA 2L4NA 5D3IB 2A6HC 3WOEA 1KNAA 4QIWB 1SJED 1PRTD 4H0LC 2KOLA 1V8QA 5LL6X 2R7ZB 5K36G 2B2YC 5C44B 3I3CA 1EY0A 2F0SA 3PV0A 3I72A 5EKLA 1EY4A 5EPLA 5EQ0A 2K03A 4OO1I 1Q12A 2AQ3B 2HCIA 4KJOA 5FO8B 5CYUA 1B50A 1A3UA 2J4XA 5ELFA 1PTOF 4F7XA 4DAVA 1EU3A 1G2SA 2BA1A 4ZRZA 4ZKBB 5CBAE 1SFOB 1HFGA 2A6HD 2PZUA 2N55A 3C1FA 5LL6S 3HOUB 4A3GB 1PDQA 2RQXA 1JWUD 1H9KA 1PFBA 5EKKA 5BN5A 3M7GA 4RKBA 2Q8TA 1CZWA 2A68D 5E4WC 3N6RA 3VR6A 1HCZA 4G57A 3G6JB 4RWSC 4XXEA 3PUZA 3CRLC 5BN4A 5F2DA 4DA2A 4CBVA 3S9WA 4HSPA 5CBEE 3K6OA 3T16A 3M4YA 2J7ZA 3DUZA 2Q8RE 1GUNA 2SDFA 5DM73 1RHPA 3K7AB 3HZXA 3PIP3 3RZOB 3CRKC 3QG1A 4ZQ3A 2NB0A 4U673 5IGBA 3MAQA 5IGDA 5C0XH 5DEHA 4I7ZC 1GOZA 1TY0A 3U9SA 3D4WA 3TSSA 3I73A 2HQEA 3HS0C 1G291 2KCCA 1IW7C 4H7BA 4KJNA 1JOQA 1AW7A 1CA5A 3I8ZA 2RA4A 3NP8A 3K0YA 2K04A 2NBFA 1EY5A 4IN3A 4ABNA 2QEJC 5KGUA 3VR4A 1I6VC 3EJIA 1S5BD 3K5OA 3MFYA 2EY6A 3OHXC 2JA8B 2X6GA 3H94A 4LAAA 2XIWA 4FYDA 1H9SA 2B39A 1C48A 4IUQA 1LACA 1RDPD 2IW3A 2K5DA 1ZEQX 5J22A 4MIUA 2JA6B 1IW7D 3ND8A 1Y1VB 2HDMA 1LTBD 1BNZA 1O7ZA 3S15B 2EJGC 3GTKB 3LNNA 1S5DD 2E2IB 3D31A 4KD4A 2LY7A 3TZUA 5I4DA 3BVMA 1GXDC 2E2DC 2OT2A 3BZDB 2L0CA 1G91A 4RFBA 5HURA 2IPKD 3J7AF 4QCLA 3NBHA 3TP7A 1BOSA 4IUPA 3BVGA 4HN7A 1FGBD 2Z1CA 1T5EA 2DN8A 2SNMA 2TMPA 2FJ2A 2R61A 4ZUIA 5A2QL 2F1MA 1U4LA 3A8JE 3HKZB 1DOMA 5JPMC 1PTOC 5EBCA 3WDNA 3OMGA 2PO4A 5I9PA 2XRQD 4X3TA 1I6HB 5KRUA 3LWUA 1QOHA 2K01A 3I4MB 4IALA 4ZLTF 1CTMA 4ID6A 5CMDA 1HQMC 2A74C 4QUFA 2NWGA 1SSOA 1Z6HA 2PMZB 3PUWA 4RHRA 5I2XA 2RKSA 4HMIA 5C3WA 2C9OA 1LT5D 2PZTA 3KLSX 1HTPA 4C3JB 1I50B 3DWQA 2K28A 1EIHA 3I4NB 1MSHA 1EY8A 2LMCB 4K2LA 5CGKA 2VUMB 4A3KB 1T5XD 1PTOD 4KHVA 2RVLA 4DNRB 2EYPA 1BQQT 2KEEA 2X6LA 4RA8A 3T53B 2NVYB 2AWOA 4L63B 3F2UA 4Q5VA 3A8IE 4KK7A 1WTQA 3I4LA 1F2MA 1JWSD 4PMCA 4N9TA 1NAPA 3A7LA 5EKIA 1JWMD 1TS2A 3NTHA 1XX8A 1LTID 3R3OA 3UI2A 4IFDG 4RKLA 4JBWA 2A69C 1GHKA 4KI0A 3BS1A 4RGNA 3S16B 1I4PA 2EZVA 1WTRA 2IX1A 4UAIA 4DK0A 1OXTA 2B2TC 4FVMA 2L11A 1PMRA 2OF1A 3SK6A 3TN2A 1FYCA 3KLRA 2BA0A 1H9MA 2PYKA 2X69A 2L12A 4DK1A 3RUZA 4J1MA 5JPNC 3NWSA 2EY5A 1BUVT 4KN7C 4TKOB 3C2PA 2IT1A 1LT4D 4TSSA 3GTOB 1F2ZA 1TWGB 2AUJD 2AQ2B 1QCBD 3R2TA 2JEAI 1PTOH 1EZ8A 3GTQB 3L9AX 3R8BA 1WTWA 2F0NA 3OSOA 3H3VC 2K33A 3A7AB 5C4JB 1BF4A 1LTTD 1S5CD 3MXNA 3AB9A 3QOJA 2KQ3A 4XYOA 3MXGA 1HUMA 2F0HA 2QCPX 2EYHA 2JYOA 1K8OA 3MXPA 2F0OA 1B9MA 2BDOA 3Q6SA 1WD0A 1E2WA 5T1GA 2EYJA 1DCZA 1I4QA 1TWAB 4RAUC 4RCNA 2K32A 2CVRA 2Y0SB 1M8AA 1VMPA 2Z4HA 3HRZC 1SNDA 1HA5A 5M5XB 1CHPD 1ILPA 2B2UC 4BBRB 2K05A 1SYGA 4ULLA 4DAPA 4IZ8A 2A5HA 1EEID 2E2HB 2K6AA 3GP7A 1HRJA 1NSNS 2HCCA 1O78A 4K8IA 2D62A 2EPBA 3VR3A 1FR3A 2B2TA 2JEBI 2B8FA 3VYUA 3GTMB 1FNVA 5J39A 2BE5C 3GV6A 3IFDA 1JORA 2F0IA 3T56B 4ME5A 1PFMA 1WTVA 3NTIA 4KV6A 4ZUJA 4A3MB 1DONA 4A3BB 2NVTB 1BXTA 1DOKA 2CW0C 1AN8A 1X3PA 3IKJA 3E5SA 3DWAA 1WTXA 2B63B 1QG7A 1ML0D 5ISRA 1EIGA 3RD4A 1TVXA 3S1RB 3GO5A 1STGA 4K5XA 4FXDA 1JQYD 5D65A 3P75A 3ZYYX 3HOXB 1Z7TA 1IKLA 1ZYRC 1G6ZA 2JE6I 3TP5A 1NUCA 1TS3A 2ZT9C 3EQLC 4RCOA 4J6HA 1TU2B 1MD2D 2R3ZA 3EA6A 5EBDA 1E2VA 1Y8OB 2L5TA 4IUUA 4WRDA 4Q0FA 5D3DA 4CJ0B 2CW0D 2GA4B 1OXSC 2NN6H 3J80E 4XDXA 1SE2A 2EJFC 2FMCA 4X3UA 4FF3A 3K57A 3S17B 3M4OB 2E76C 1SJHD 3KK7A 1Y8NB 5IT9E 3J7YW 3BYYB 1ZYRD 3BYTB 3X3NA 1F9PA 4BA1I 1ENFA 1STNA 1LV9A 1STEA 5CC4A 3OIPA 2B2UA 2PW5A 1V1OA 4NKLA 4X3KA 5CV7A 2F0GA 3J81E 5CR3A 4ZKCB 4IUVA 3A8KE 1MSGA 1I4GA 3OWFA 3M7NA 4K5VA 1A3TA 1SDFA 2FHTA 3MWYW 1WTOA 1YNNC 2B2VC 1Z47A 3N52A 4IUTA 4RGOS 1RCVD 1X3QA 5C5MA 1IKMA 3NSWA 4PQXA 1LLRD 4J8QA 1EQVA 3NQTA 2OXPA 1EFID 1ENAA 4L8JA 5EPKA 1D1IA 1TWHB 3CKIB 1U4RA 3S2HB 3CU7A 4KKUA 4DXGA 1JOKA 2IX3A 5IGFA 3V05A 3DHQA 5CV9A 1OXUA 5C0XG 3PO2B 3A55A 2JA5B 2E74C 1SAPA 2WKCA 1SMYC 2DY8A 2F3VA 1WTPA 2D2CC 1B3AA 1YNND 2K7VA 2O5JC 4HCEA 1SNOA 1WD1A 4DAYA 1TR5A 4FNFA 2XVSA 1HTLD 4JK1C 3TDQA 5J1ZA 3BDCA 1EOTA 4A93B 1F77A 2K5QA 1CT1D 5FO7B 1KLUD 1NR2A 4O1NA 1ZXTA 4OO1H 4LK1C 3X3MA 1I4XA 3PO3B 4FF4A 1D5ZC 2ICIA 4E6IA 1FNWA 1SYBA 3U9OA 5ELEA 4A3JB 1ET9A 1PLFA 5M5WB 1SMYD 4MHEA 3NQIA 3ITPA 4HR7B 4CJ1B 3K5MA 2A6EC 2VB2X 4U68A 2RSOA 1STAA 4HTHA 2TSSA 1NCVA 1E2ZA 3P1HA 2XNAC 3Q22A 1RTOA 4R8NA 3OPOA 4XQJA 1BCPB 4IFDI 1D6EC 3BG3A 1GUTA 5G3LF 3BDOA 1D1KA 4XT1B 2B2VA 1HA6A 5BN3A 1LTSD 4OGQC 2FMMA 2PNRC 3GTLB 2E2JB 2OEOA 1STHA 2Z4IA 5IIFA 4H13C 2AQ1B 3GV3A 3P20A 2ENBA 4IUNA 2A6ED 4MN3A 3D6CA 5E1FA 1LABA 5M9OA 2RDGA 4WFN3 3VYTA 3QIAA 2KA7A 1HHVA 5FLXL 2Q8IB 3NHHA 1EY9A 4IQZA 3RMHA 1V1PB 2O2LD 2F3WA 2EE1A 1O7YA 5AFWA 2NVXB 1K8MA 4ZYSA 1SNPA 2RDFA 4IURA 5IOCA 1UEAB 2PCFB 1GJXA 2K1BA 4HSVA 1RF2D 2F0JA 4FF2A 1F2YA 3HEJA 2WKDA 3PUYA 1QE6A 4C3IB 5CV8A 1I4HA 3KBGA 1GHJA 5HGTA 2VNUD 1KDAA 3LWEA 2FFKB 4B08A 5IGGA 2WV6D 2EVBA 3KF8A 1PZJD 2E75C 1CK1A 3MA2B 1SYEA 1F9RA 4DFAA 3QWNA 2RBMA 2F0DA 2BDNA 5K5PA 1S5FD 1LTGD 1U4PA 3LX0A 1D5XC 1EU4A 3S1MB 5IODA 4FO2A 4GZYC 1DOLA 3M85A 5EJWA 2XWBB 3A54A 3A56A 3T51B 2NTSA 1RTNA 4A3DB 4XIGS 1R9TB 2IWHA 1D5MC 1Y69U 2O4XA 4C3IG 2MP1A 5JEAG 1C4QA 1S5ED 1A2TA 3GTPB 2LKVA 3MC0B 1CM9A 2WINB 3DWPA 4ZK9B 3NTKA 1O80A 4NDXA 5ELBA 2R92B 5M5YB 1VMCA 1Q90A 1JC7A 1JCKB 4M8AA 4L6TB 1TS5A 2F0EA 1B2TA 1YNJC 2A69D 1EL0A 3I70A 5A2QE 1JE4A 1FD7D 2L55A 5I9OA 2ICEC 1HUNA 1CZGA 1S4ZA 1EYAA 4AYBB 1UUPA 1VDZA 2SNSA 4CJ2C 1SNMA 2EYFA 1DYQA 1IYVA 5KNDA 4BY1B 4I65A 3VYSA 1I4RA 3T4AC 2KUMA 4EQOA 2HDLA 2RDHA 5IT9L 2ZXOA 1YNJD 3PUXA 5KYIA 1WVLA 1A2UA 4FF1A 2EJMA 5JVH3 3IL8A 3S2DB 2V4DA 1GUWA 4RGMA 1BDOA 3VYRA 3SHLA 2LS01 1TWFB 1PYWD 5M3MB 4PMWA 1MBYA 1SYDA 1B53A 4ILWA 2MHVA 4RHSA 5NUCA 3J81L 1GUOA 3D4RA 2XSCA 1BCPF 4KD3A 3ND9A 1Q8IA 5EPJA 5COYA 3AMUA 1BR9A 4F8MA 1HFNA 2F0PA 3BVZA 2KVMA 3RLFA 4K6DA 2MPMA 1R4PB 3NPPA 2MGSA 3TP6A 3TZDA 1ET6A 3SK4A 3E6ZX 4M1UB 3QO2A 1TIID 3C3LA 2SEBD 2F0MA 4F88A 1LTAD 4K2KA 5C3EB 5LHY1 3BDLA 1ESFA 1QB5D 1ZKOA 1XXGA 4A3EB 1RD9D 2F0UA 3JAME 1JR0D 3K5LA 1EZ6A 3H09A 2JXMB 3FDTA 1STBA 2XN9C 1XTCD 3C46A 2F0LA 3SXHA 2RSNA 2KEDA 1KABA 3MZ5A 4KTAA 5JAVA 1IHZA 2D9UA 3KBXA 5FK9C 5C3XA 3IAYA 3TMEA 2EY1A 1Y1WB 3L3OC 3FPUB 3Q0AA 1I3QB 3C1EA 1RJTA 2PQEA 5C0XI 1R4QB 4C3HG 2EYMA 5DM63 2G9HD 2KHSA 1F9QA 2BE5D 4XTCS 4KY5A 4EQPA 1BO0A 1F2LA 5K36H 4TRDA 2EXZA 2I46A 3MFGA 1CQVA 2NN6G 3H0GB 3V2TA 3NE5B 2JA7B 2A68C 4FXKC 2AWNA 5C4ZA 4XYQA 4PV1C 2BCOA 1HXYD 4F87A 2QDBA 2WIIB 1PRTB 4G7OC 3HGBA 3M3YB 4RGTA 3HG9A 1A15A 2KJXA 2QKIC 1SNCA 3R93A 5DAUA 1AZQA 1KDCA 4DF7A 2F4IA 1GUSA 4G4KA 2F0QA 3EFXD 3E0JA 3GD7A 1U4MA 5JJZA 2EDGA 3W3AA 5C6AA 2K5WA 1F9SA 4ODGA 3FMCA 4CKEA 4CGYB 4H44C 1TKWB 1PXUA 1WCMB 4C1NK 2DNCA 4HEDA 3OOCA 3SVMA 1DXMA 4LMQD 2L1BA 4C56C 1C8CA 3SEBA 4HAEA 3V96A 4G7HC 1Y8PB 4IFDJ 1EY6A 2FINB 1H9SB 2O5IC 2ZXPA 2CQAA 4R8IA 2PZWA 1BCPC 4CKBA 5FKAC 4C2MB 1LTRD 1M4VA 4FP5D 1BBXC 5CV4A 4BY7B 1RKNA 3DM1A 1TQOA 2Z8LA 5JEAJ 3PIO3 3Q24A 1QILA 2VB3X 5C5LA 2EYOA 1KDBA 3H6MA 3H91A 4NP5A 2KCNA 3OW7A 4B9WA 2B8GA 1UNSA 2XWJB 4DN4M 4V190 4OO1G 3K5NA 1ONLA 3D4DA 3WOFA 2B2YA 1OXXK 5A35A 1Q1BA 1AEXA 5TSSA 3D3RA 5C4HA 1CFMA 1EY7A 3HOVB 2NUCA 3MVVA 1BCPD 3W2DA 2DY7A 5IGCA 2PW7A 4HCSA 3FRPB 3CHBD 1KTKA 2KECA 3AU7A 3P7JA 2IJ0A 4PNYA 1TY2A 2I07B 1AFPA 1CA6A 3O13A 1Q3LA 4KN4C 3EVQA 1E0BA 4QMGA 1LT6D 1A3VA 2MUYA 1OO9B 1MGSA 3KUPA 3RZDB 1HQRD 4NW2A 2YU9B 3MHBA 3G7LA 1ILQA 2F0VA 3SK5A 5ELCA 3PMFA 2F0WA 2EOTA 1MI2A 1U9RA 4BA2I 4Z9CB 3NXWA 4HMJA 5KIXA 1CI3M 2R6GA 3VA5A 1B4OA 3EROA 1RODA 4PMBA 1QNUA 2NZ1D 1Q1EA 1KLGD 4RH6A 3R2IA 4WORA 4K14A 1D2BA 4B9XA 5FOBB 4KY6A 3I90A 4DU9A 3SE0A 1PZID 4UDUC 4N9PA 3GTGB 3GQBA 4KHZA 4K5WA 1XYIA 2M00A 3ONAB 1DJRD 1PZKD 2N88A 1W6JA 4LJZC 2C5CA 2J0TD 1PRTF 4OIKA 1JB3A 1ESRA 1W6KA 3NBIA 1JICA 4QF4A 3HOYB 2B2WC 1B44D 1QJOA 3NWTA 3FKIB 2F03A 4CHTB 1DZ1A 2NTTA 1K83B 1L0XB 4TQUS 4O42A 1ENCA 4G7ZC 1V1PA 4XQNA 2MJ8A 1XWEA 5T1IA 1FNUA 1SBBB 1NR4A 1SYCA 2D5DA 4BS9A 2PPBC 1EEFD 3HOWB 2DNEA 4KMUC 5C4XB 1SXTA 5E4XA 2ID0A 1SE3A 3MEHA 1PTOB 2ZXRA 1SNQA 1SYFA 2LFNA 1J9OA 3TP8A 4OL7A 3IFTA 5M3FB 1QWYA 5E3FA 4IFDH 1TS4A 5I2YA 1L0YB 2CHBD 2QILA 4C3JG 1AP0A 1LT3D 3JAML 1SE4A 3VA7A 4K6LA 1LO5D 1B1ZA 2A73B 3URYA 4QB4A 1SEBD 3PUVA 3FVQA 3VR5A 1X32A 3SK8A 2WP8J 4XQQA 5JEAH 2AUKA 2EYLA 3J7AV 4K8JA 2M9VA 2YYZA 3K59A 3SDZA 1II3A 4EVOA 4DNTB 1H9JA 2NVQB 1DM0B 1EWCA 4QUCA 3GTJB 5FO9B 5CORA 3QJYA 3HOZB 3S1QB 4EGVA 4A3FB 1J8IA 5CV5A 1EWHA 4ZAIA 3L7ZC 3OMCA 2XRSD 3NK9A 5KYLA 1A6XA 2SOBA 5ELDA 5FLXE 1G2TA 4KY7A 1G8ZD 3J80L 1CQFA 1AZPA 4P2CB 3NUCA 4WJWA 3FEWX 4A3IB 1H9RA 1ICWA 1TWCB 1V43A 2BOSA 3OWEB 5C0XJ 4KKSA 1B9NA 2B2WA 1VF5C 2IL8A 2NN6I 4X3SA 4YIJA 2F0KA 2HUGA 1EYDA 4DXFA 1STYA 1EQTA 4BBSB 1GUGA 3D6WA 4R9WA 1IYUA 2WACA 5CV6A 2WAQB 4C1NI 1VF7A 2F0TA 4KKTA 3SR1A 1UAPA 2H1EA 2VXWA 1IL8A 2NYZD 1VCIA 5JOBA 1PFNA 3CQZB 3FPPA 4C3HB 1TT2A 5G3LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9X A;  1EY4 A;  1EZ6 A;  4ZUI A;  2HQE A;  3QB3 A;  1EQV A;  5CV8 A;  1AEX A;  2F0H A;  2OXP A;  3NQT A;  4KY6 A;  2EYH A;  4DU9 A;  5C4H A;  3SK8 A;  3MXP A;  1STB A;  3TP5 A;  1ENA A;  1NUC A;  1KDA A;  3R3O A;  4H7B A;  4KJO A;  4KJN A;  5HGT A;  5IGE A;  2F0L A;  2F0O A;  5IGG A;  3P1H A;  1JOQ A;  2SNS A;  1A3U A;  1EY7 A;  1SNM A;  2EYF A;  3QOL A;  4N9P A;  4RKL A;  3SXH A;  2EYL A;  4EQN A;  2NUC A;  4R8N A;  5C6A A;  5EGT A;  3MVV A;  4K8J A;  4F7X A;  1JOK A;  1KAB A;  4J6H A;  4K5W A;  5IGF A;  2F0F A;  2EYJ A;  3MZ5 A;  4ODG A;  3OMG A;  1II3 A;  1SYE A;  3DHQ A;  5CV9 A;  1JOO A;  4DFA A;  3NP8 A;  4KTA A;  4EVO A;  5I9P A;  5JAV A;  4I65 A;  2RBM A;  1IHZ A;  2M00 A;  5C3X A;  2F0D A;  3D8G A;  1EY5 A;  1EYC A;  5IGC A;  5KRU A;  2PW7 A;  3TME A;  2EY1 A;  1SND A;  5KGU A;  2PZU A;  4S3S A;  5K5P A;  3EJI A;  4IAL A;  1EYA A;  3C1F A;  4NMZ A;  4ID6 A;  2OF1 A;  2OEO A;  1STH A;  4WRD A;  3SK6 A;  3LX0 A;  4QF4 A;  3C1E A;  4EQO A;  1SYG A;  2PQE A;  2EY6 A;  5IOD A;  5CV5 A;  5IIF A;  4IZ8 A;  2EYM A;  2F3V A;  4PNY A;  3OMC A;  3NK9 A;  2RKS A;  4HMI A;  4LAA A;  5C3W A;  2KHS A;  2PYK A;  5KYI A;  1A2U A;  1SNO A;  1NSN S;  5KYL A;  2ENB A;  2SOB A;  1TR5 A;  4IUN A;  1ENC A;  2PZT A;  3ERQ A;  4K8I A;  3EVQ A;  5EKK A;  5KEE A;  3D6C A;  3RUZ A;  4RKB A;  4J1M A;  4QMG A;  5E1F A;  1KAA A;  3SHL A;  3DMU A;  2EY5 A;  4KY7 A;  5EKL A;  5M9O A;  5J1Z A;  4KY5 A;  4EQP A;  5J22 A;  1EY6 A;  5I6Y A;  4MIU A;  1A3V A;  3BDC A;  5I6W A;  1SYD A;  2EY2 A;  4DGZ A;  1EY8 A;  4G57 A;  3NUC A;  4K2L A;  5NUC A;  4TRD A;  2O4X A;  2EXZ A;  1SYC A;  5CGK A;  3NHH A;  3T13 A;  1STN A;  1EY9 A;  5F2D A;  2PZW A;  3MHB A;  4KD3 A;  1F2Z A;  4KHV A;  3S9W A;  2F0V A;  5CC4 A;  3MEH A;  5J39 A;  2F3W A;  3V2T A;  2PW5 A;  4NKL A;  2EYP A;  3SK5 A;  2F0G A;  5CV7 A;  3PMF A;  4KD4 A;  2F0W A;  2F0P A;  3T16 A;  1SNQ A;  1SYF A;  5CR3 A;  2F0I A;  4F8M A;  1JOR A;  1A2T A;  1EZ8 A;  4K6D A;  4ME5 A;  3TP8 A;  4OL7 A;  2LKV A;  5C4Z A;  1U9R A;  4YIJ A;  2F0K A;  4KV6 A;  4ZUJ A;  4NDX A;  4E6I A;  1SYB A;  5CV4 A;  1EYD A;  1RKN A;  1SNP A;  3TP6 A;  5E3F A;  3U9O A;  2F0N A;  2RDF A;  1TQO A;  3NXW A;  3SK4 A;  3OWF A;  5HUR A;  3OSO A;  5IOC A;  4HMJ A;  3HZX A;  1STY A;  4K5V A;  2QDB A;  1A3T A;  5KIX A;  4ZQ3 A;  3VA5 A;  2F0E A;  3TP7 A;  2F0M A;  2WAC A;  5CV6 A;  5C5L A;  3E5S A;  4K2K A;  2EYO A;  3ITP A;  1SNC A;  1KDB A;  2F0T A;  1F2M A;  3BDL A;  3ERO A;  3H6M A;  4NP5 A;  5IGB A;  4PMC A;  4B9W A;  5DAU A;  2F0J A;  3SR1 A;  4PMB A;  1F2Y A;  1KDC A;  5ISR A;  3HEJ A;  4N9T A;  5IGD A;  4DF7 A;  5DEH A;  1EY0 A;  4K5X A;  1STG A;  2F0S A;  5JOB A;  2SNM A;  5C5M A;  5I9O A;  3D4D A;  3QOJ A;  4WOR A;  2KQ3 A;  4K14 A;  3D4W A;  2F0U A;  4QB4 A;  1TT2 A;  3P75 A;  1STA A;  4HTH A;  2F0Q A; 
#chains in the Genus database with same CATH topology
 1HPC A;  3QB3 A;  2G9D A;  1QNK A;  2JSO A;  5DNF A;  1DD2 A;  2WB1 B;  5KNB A;  3T1H Q;  2R93 B;  3TBI B;  5IGE A;  4FDB A;  5KNC A;  1VQO A;  3KLS A;  3QOL A;  4EQN A;  4FXG C;  3DXJ C;  5EGT A;  4XT3 B;  3J7A 5;  2F0F A;  4JI0 Q;  4LUV A;  1JOO A;  3OIQ A;  4HIM A;  5JVG 3;  2H4O A;  1UWV A;  2Q2U A;  3D8G A;  1EYC A;  3MXU A;  4BY1 H;  4CKC A;  3VR2 A;  3DEO A;  3DEP A;  4S3S A;  4JI3 L;  2UUC Q;  2QF7 A;  1YBY A;  4NMZ A;  5IY0 A;  1PRT C;  2L9H A;  4K0K L;  1OXV A;  1HZ9 A;  1ASY A;  2IX0 A;  3PSI A;  1KD1 C;  1J6Q A;  2JP1 A;  3I91 A;  3MTS A;  2E8G A;  1HH2 P;  4BWG B;  5KEE A;  3ERQ A;  4TVA B;  1VQ4 A;  2DGY A;  1VQ7 A;  1KAA A;  3DMU A;  2HHH L;  3S2D H;  5D14 A;  3K58 A;  2QA4 A;  4V0B A;  5I6Y A;  4OIJ A;  5I6W A;  2EY2 A;  3Q23 A;  4DGZ A;  1TWF H;  3HP3 A;  5M3M H;  1XNR L;  1CHQ D;  2Y0S G;  5HY6 A;  3S1N B;  3T13 A;  1GVP A;  5LMU Q;  4Y7N B;  2BH2 A;  3S14 B;  1KNE A;  4BBR G;  4OHJ A;  2WB1 G;  2M2L A;  1O7L A;  4DK3 C;  5GAH C;  2L4N A;  3D0F A;  1N33 Q;  1Q81 C;  5D3I B;  2A6H C;  3WOE A;  1KNA A;  2D0P A;  4QIW B;  1SJE D;  3KDF B;  5GAE C;  1PRT D;  1C9O A;  1SMX A;  4H0L C;  1WOC A;  2KOL A;  1V8Q A;  5LL6 X;  2MO0 A;  3NEM A;  4JOI A;  2UXD Q;  3JAM c;  2R7Z B;  1X3G A;  5K36 G;  2B2Y C;  1B8A A;  5C44 B;  1HNX L;  1JT8 A;  5C3E H;  1XMQ Q;  3I3C A;  1EY0 A;  2F0S A;  1FJG L;  3PV0 A;  1HZA A;  1X6O A;  3I72 A;  4IPC A;  5EKL A;  1EY4 A;  5EPL A;  5EQ0 A;  4A3E H;  2K03 A;  1KRT A;  4OO1 I;  1Q12 A;  2AQ3 B;  1RL2 A;  4JI8 Q;  4A3M H;  2HCI A;  4KJO A;  3OW2 A;  2JA9 A;  2P5Z X;  5FO8 B;  5CYU A;  1B50 A;  1A3U A;  4A3B G;  2J4X A;  5ELF A;  1PTO F;  4DV0 L;  4F7X A;  4DAV A;  1EU3 A;  4QGU A;  1G2S A;  2BA1 A;  4ZRZ A;  4ZKB B;  5CBA E;  4WJ3 M;  1SFO B;  2AMC B;  1HFG A;  1VQ9 A;  2A6H D;  2PZU A;  1IXR A;  2B63 G;  2XTI A;  2N55 A;  1SRU A;  3C1F A;  2ATW A;  5LL6 S;  1Y1W H;  2VQE Q;  1I3Q H;  3HOX G;  3HOU B;  4A3G B;  3AYH B;  2E5L L;  1PDQ A;  2RQX A;  4JI3 Q;  2HQL A;  1JWU D;  1H9K A;  1PFB A;  5EKK A;  4UP9 A;  5BN5 A;  3M7G A;  4RKB A;  2Q8T A;  1CZW A;  2A68 D;  3J81 j;  4K0K Q;  1E3P A;  5E4W C;  3N6R A;  3UDI A;  3VR6 A;  1HCZ A;  3J80 c;  3G4S A;  4G57 A;  3G6J B;  1XNQ L;  3J7Z C;  1VQ6 A;  4RWS C;  4XXE A;  3PUZ A;  2QEX A;  4X62 L;  2MNA A;  4DAY B;  3CRL C;  5BN4 A;  5F2D A;  4OON A;  4DA2 A;  2LXK A;  4CBV A;  3S9W A;  4HSP A;  5CBE E;  3K6O A;  3T16 A;  2YTV A;  3M4Y A;  2J7Z A;  3DUZ A;  3H0G H;  2Q8R E;  4R1J A;  2JA7 H;  1GUN A;  2SDF A;  5DM7 3;  2B29 A;  3BZK A;  3TEH B;  4LNQ A;  1RHP A;  4LF5 L;  3K7A B;  3HZX A;  3PIP 3;  3RZO B;  3CRK C;  1AE2 A;  3QG1 A;  4ZQ3 A;  2I5L X;  2NB0 A;  4U67 3;  1WFQ A;  3K81 C;  4DR7 L;  2Z9H A;  3M3Y H;  5IGB A;  3MAQ A;  1L2F A;  5IGD A;  5C0X H;  4I7Z C;  5DEH A;  1GOZ A;  4A3G G;  1TY0 A;  3U9S A;  3D4W A;  3TSS A;  3RN5 A;  4GLA C;  2KCM A;  2UUB Q;  4KHP Q;  3I73 A;  2HQE A;  3HS0 C;  1G29 1;  4X65 Q;  2KCC A;  1IW7 C;  3H15 A;  1HNX Q;  4H7B A;  2VY3 A;  4KJN A;  2ZTD A;  1JOQ A;  1FJG Q;  1AW7 A;  1CA5 A;  1S3O A;  3I8Z A;  2PMZ E;  4DV1 L;  2RA4 A;  4X66 L;  3NP8 A;  3K0Y A;  2K04 A;  2NBF A;  1EY5 A;  4IN3 A;  4ABN A;  1PYS B;  2QEJ C;  4BXX G;  5KGU A;  3K0X A;  3VR4 A;  1MKH A;  1I6V C;  3EJI A;  2EQS A;  1S5B D;  3K5O A;  1WCM H;  3MFY A;  2EY6 A;  3U50 C;  1VQP A;  3OHX C;  2JA8 B;  4PG3 A;  4DUY L;  2X6G A;  3H94 A;  4LAA A;  3DLL A;  2XIW A;  4FYD A;  1H9S A;  2B39 A;  1C48 A;  3NEL A;  4IUQ A;  1LAC A;  1RDP D;  4A4I A;  2IW3 A;  2K5D A;  1ZEQ X;  4DV4 L;  5J22 A;  4MIU A;  1XPU A;  2JA6 B;  1Q8K A;  5IWA Q;  1IW7 D;  3PO2 G;  3ND8 A;  1Y1V B;  2HDM A;  1LTB D;  1BNZ A;  1O7Z A;  2JA5 G;  3S15 B;  2EJG C;  3GTK B;  4OX9 L;  3LNN A;  1S5D D;  2IHE A;  4DV3 L;  2E2I B;  3D31 A;  4YWK A;  4KD4 A;  2LY7 A;  3TZU A;  1XNQ Q;  3BVM A;  5I4D A;  1GXD C;  2E2D C;  2OT2 A;  3BZD B;  4C2M H;  1QUQ B;  2L0C A;  1G91 A;  3AFQ A;  1UEB A;  4RFB A;  4R4T A;  5HUR A;  2CCZ A;  2IPK D;  5IYB H;  4BY7 H;  1N32 Q;  4A93 H;  3J7A F;  4QCL A;  3NBH A;  1BBW A;  3TP7 A;  1BOS A;  1I94 Q;  4IUP A;  1KAW A;  3BVG A;  4JI7 L;  1L1O C;  4HN7 A;  1FGB D;  2Z1C A;  2A8V A;  1T5E A;  2DN8 A;  4LF5 Q;  2SNM A;  2TMP A;  4JI6 L;  2FJ2 A;  4RG1 A;  4O2D A;  4IO9 A;  2R61 A;  2FXQ A;  2A1A A;  4ZUI A;  5FJ8 H;  3CCU A;  3UE0 A;  1D7Q A;  3K80 C;  3PO3 G;  5A2Q L;  4IJL A;  2F1M A;  1U4L A;  3A8J E;  3HKZ B;  1DOM A;  5JPM C;  3UDG A;  1PTO C;  5EBC A;  3WDN A;  3OMG A;  4A3J G;  4DPG A;  1A63 A;  2CFM A;  2PO4 A;  5I9P A;  2XRQ D;  4X3T A;  4YWL A;  1I6H B;  5KRU A;  3LWU A;  1QOH A;  2K75 A;  4ME3 A;  2K01 A;  3I4M B;  1IBK L;  1E1O A;  4IAL A;  4ZLT F;  1CTM A;  3KF8 B;  4ID6 A;  5CMD A;  1HQM C;  2CH4 W;  2A74 C;  1VS0 A;  4X66 Q;  4QUF A;  2NWG A;  1SSO A;  1Z6H A;  2PMZ B;  1EOV A;  3PUW A;  4RHR A;  5I2X A;  2RKS A;  4HMI A;  5C3W A;  2C9O A;  1FVI A;  1LYL A;  1LT5 D;  4ZCK A;  2PZT A;  3KLS X;  4X6A H;  4R4O A;  1HTP A;  4C3J B;  4JBK A;  1I50 B;  3DWQ A;  2K28 A;  1EIH A;  3I4N B;  1MSH A;  4DUY Q;  1EY8 A;  3MEF A;  4AYB E;  4LF6 L;  2LMC B;  3CP0 A;  4K2L A;  5CGK A;  2E2J H;  4UY8 C;  4A3K B;  2VUM B;  3RZD H;  1T5X D;  1SRO A;  4DV4 Q;  5IYC G;  1PTO D;  4KHV A;  1C0A A;  2RVL A;  4LF9 Q;  2YU9 H;  4DNR B;  4GKK L;  2EYP A;  1BQQ T;  1YJ9 A;  4OEL B;  5JJL A;  4JPB W;  2KEE A;  2X6L A;  3ER0 A;  4RA8 A;  3T53 B;  2L15 A;  1MIU A;  2NVY B;  1VQC A;  2AWO A;  4L63 B;  3F2U A;  4Q5V A;  3A8I E;  4DV3 Q;  4KK7 A;  1N34 Q;  1WTQ A;  2NZH A;  3I4L A;  4DV7 L;  1F2M A;  1JWS D;  4PMC A;  5C4X B;  5LMN L;  1YIJ A;  4N9T A;  3A7L A;  1NAP A;  1CKN B;  4GOP C;  3HKS A;  1N8R C;  2UUA L;  5EKI A;  2K14 A;  1JWM D;  3BJU A;  1TS2 A;  3NTH A;  1XX8 A;  1JJC B;  1KL9 A;  1LTI D;  1K9M C;  4JI7 Q;  3R3O A;  3UI2 A;  2DJG C;  4IFD G;  4ALP A;  2KCT A;  4RKL A;  4YCV A;  3I4N G;  4JBW A;  1YZ6 A;  2A69 C;  1GHK A;  4KI0 A;  3BS1 A;  4RGN A;  3S16 B;  1I4P A;  2EZV A;  1WTR A;  2IX1 A;  3CF5 A;  4UAI A;  4DK0 A;  1OXT A;  3L0O A;  2B2T C;  4FVM A;  2L11 A;  1PMR A;  4PZ8 A;  4JI0 L;  1X9N A;  1L1O A;  2OF1 A;  3SK6 A;  3TN2 A;  1VQF A;  2YTY A;  1FYC A;  3KLR A;  4C3I H;  1H95 A;  3CAM A;  1MJC A;  3HOY H;  1TXY A;  2BA0 A;  1H9M A;  2PYK A;  2X69 A;  3FKI H;  4P71 A;  2G5D A;  4Y52 H;  2L12 A;  1IBK Q;  4DK1 A;  1K83 H;  3RUZ A;  4J1M A;  4LFA L;  5JPN C;  1YHB A;  1S72 A;  3NWS A;  1NTG A;  2EY5 A;  1BUV T;  2VZA A;  4KN7 C;  3CCV A;  4TKO B;  3C2P A;  1CSP A;  2IT1 A;  3I7F A;  1LT4 D;  1UE6 A;  4TSS A;  3GTO B;  1P8L A;  3AFP A;  4GS3 A;  3CCJ A;  4RMF A;  2ZM6 L;  1F2Z A;  1TWG B;  5C4X H;  2AUJ D;  3HOW H;  3ZJY C;  2AQ2 B;  1QCB D;  3R2T A;  2JEA I;  4LF6 Q;  1PTO H;  1EZ8 A;  3GTQ B;  3L9A X;  3R8B A;  1WTW A;  2F0N A;  5M3F H;  3OSO A;  3H3V C;  1U0L A;  4LFC Q;  4L5Q A;  2K33 A;  4GN4 B;  4GKK Q;  4A3D G;  5IP7 H;  2K50 A;  3A74 A;  4X64 L;  3A7A B;  5C4J B;  3F2B A;  1BF4 A;  1LTT D;  1S5C D;  3MXN A;  3AB9 A;  4P74 A;  3QOJ A;  1EWI A;  1NY4 A;  2KQ3 A;  4XYO A;  3MXG A;  4JC0 A;  1HUM A;  2F0H A;  4DV7 Q;  2QCP X;  2EYH A;  2JYO A;  1K8O A;  3MXP A;  5LMN W;  5LMN Q;  2F0O A;  2DJF C;  1B9M A;  2R92 G;  4JW0 A;  2BDO A;  3EN2 A;  3Q6S A;  2UUA Q;  1Y14 B;  2UXC L;  1WD0 A;  1E2W A;  5T1G A;  2EYJ A;  1DCZ A;  1I4Q A;  4GKJ Q;  1TWA B;  4RAU C;  4RCN A;  2HIX A;  1VQE A;  1PHJ A;  2K32 A;  2CVR A;  1VQG A;  2Y0S B;  1M8A A;  1VMP A;  2Z4H A;  3HRZ C;  1SND A;  1HA5 A;  5M5X B;  1CHP D;  1ILP A;  2NVQ H;  4YHH Q;  2B2U C;  5FLX c;  4BBR B;  4GOP A;  2K05 A;  4R4Q A;  1SYG A;  3GTJ H;  4ULL A;  4DAP A;  2IY5 B;  4IZ8 A;  3M9B A;  2A5H A;  1EEI D;  3HOZ H;  2K6A A;  3S1Q H;  4AYB G;  4A3F H;  2E2H B;  3GP7 A;  1BVS A;  1RIP A;  2N49 A;  1HRJ A;  1NSN S;  2HCC A;  1O78 A;  2ES2 A;  2VQE L;  4K8I A;  3E0E A;  2D62 A;  4EX5 A;  1VQN A;  1MHW C;  1M1K C;  4BY1 G;  4A3C H;  2GVA A;  4OXP A;  2EPB A;  1KQS A;  4I7A A;  3VR3 A;  2JQO A;  1FR3 A;  2B2T A;  1YNX A;  2JEB I;  2B8F A;  4LFA Q;  3VYU A;  1PH4 A;  3GTM B;  4A3I H;  3A5U A;  1FNV A;  5J39 A;  1TWC H;  2BE5 C;  3GV6 A;  4DK6 C;  3IFD A;  5GRO A;  1W3S A;  1JOR A;  2F0I A;  2LSS A;  3T56 B;  4ME5 A;  1PFM A;  1WTV A;  3NTI A;  4KV6 A;  4ZUJ A;  5BR8 Q;  5IP9 H;  4A3M B;  4A3B B;  1DON A;  2K5N A;  2ZM6 Q;  2NVT B;  1BXT A;  1DOK A;  2CW0 C;  3TRZ A;  3EIV A;  1AN8 A;  1X3P A;  5M3M G;  4BBS H;  3IKJ A;  3E5S A;  3DWA A;  1LUZ A;  1WTX A;  2B63 B;  1QG7 A;  1ML0 D;  5ISR A;  1EIG A;  3RD4 A;  1TVX A;  3S1R B;  3GO5 A;  1STG A;  4K5X A;  4FXD A;  3F8T A;  2JN4 A;  4YCU A;  1JQY D;  5D65 A;  2EIF A;  3P75 A;  3ZYY X;  3CQZ H;  3HOX B;  1Z7T A;  4DR5 Q;  5IYD H;  1NMF A;  1IKL A;  4X64 Q;  1ZYR C;  1C7Y A;  4C3H H;  1G6Z A;  2JE6 I;  2N78 A;  3TP5 A;  1NUC A;  1TS3 A;  2ZT9 C;  4O0A A;  5E7N A;  3EQL C;  2UUB L;  4LUO A;  4KHP L;  2R93 H;  4RCO A;  4J6H A;  4X65 L;  1IBL L;  1TU2 B;  1MD2 D;  2R3Z A;  3EA6 A;  5C3E G;  5EBD A;  4YWM A;  3U4V A;  1E2V A;  1Y8O B;  3CCR A;  4NXM L;  2L5T A;  4IUU A;  2UXC Q;  4WRD A;  4Q0F A;  5D3D A;  4CJ0 B;  4A3E G;  2CW0 D;  2GA4 B;  2RHQ B;  1OXS C;  2NN6 H;  4A3M G;  4PZ6 A;  4MNO A;  3J80 E;  4XDX A;  3H3V H;  1X55 A;  1Q46 A;  1SE2 A;  2EJF C;  1PYB A;  3W5O A;  2FMC A;  4X3U A;  4FF3 A;  3K57 A;  3S17 B;  3M4O B;  2E76 C;  1SJH D;  1PH8 A;  3KK7 A;  1Y8N B;  5IT9 E;  3J7Y W;  3BYY B;  1ZYR D;  4R4I A;  3BYT B;  4DV5 L;  4QL5 A;  3X3N A;  1F9P A;  3UDF A;  4BA1 I;  1ENF A;  1Y1W G;  1STN A;  3KDF A;  1LV9 A;  1STE A;  4JI1 L;  1QVC A;  5CC4 A;  3OIP A;  4Y7N H;  2B2U A;  5IWA L;  2PW5 A;  1V1O A;  4NKL A;  1N36 L;  3CC2 A;  2F0G A;  4X3K A;  5CV7 A;  3J81 E;  4JBM A;  3S14 H;  5CR3 A;  2YTX A;  4ZKC B;  4IUV A;  2PQA B;  3A8K E;  1MSG A;  4JV5 L;  1I4G A;  2Q2H A;  3OWF A;  3M7N A;  4DNI A;  4K5V A;  1A3T A;  1QZH A;  3KF6 B;  1SDF A;  2FHT A;  3A5Z B;  4AQY Q;  4JYA Q;  1EFW A;  4LF7 L;  3MWY W;  1WTO A;  1YNN C;  2B2V C;  1Z47 A;  3N52 A;  1PA6 A;  1EUJ A;  2R7Z H;  4IPG A;  4IUT A;  4RGO S;  1VQB A;  5C44 H;  1RCV D;  1N32 L;  1X3Q A;  5C5M A;  1IKM A;  4GN5 A;  3NSW A;  1I94 L;  4PQX A;  2OTL A;  1LLR D;  4J8Q A;  3H0G G;  1EQV A;  2JA7 G;  3NQT A;  2OXP A;  1IBM L;  1PFS A;  1EFI D;  1ENA A;  4L8J A;  5EPK A;  1D1I A;  1TWH B;  3KJP A;  3CKI B;  1U4R A;  3S2H B;  1B7Y B;  3CU7 A;  4KKU A;  4DXG A;  1JOK A;  2IX3 A;  5IGF A;  3V05 A;  3DHQ A;  3G48 A;  5CV9 A;  1K3R A;  1OXU A;  2ZJQ A;  5C0X G;  3PO2 B;  1MJE A;  3A55 A;  1ICF B;  2JA5 B;  2E74 C;  1J5E Q;  1SAP A;  1IBL Q;  2WKC A;  1SMY C;  2DY8 A;  1VQD A;  2F3V A;  1WTP A;  1ASZ A;  2D2C C;  1B3A A;  2R7F A;  1YNN D;  2VQF Q;  2K7V A;  2O5J C;  3L2P A;  4HCE A;  3HOU H;  4A3G H;  1SNO A;  4GNX B;  1WD1 A;  4NXM Q;  1GD7 A;  4DAY A;  1TR5 A;  4FNF A;  1YJN A;  2XVS A;  3B6Y A;  1HTL D;  1CUK A;  4JK1 C;  3SGI A;  3TDQ A;  2YV5 A;  5J1Z A;  3BDC A;  1EOT A;  4DUZ Q;  4A93 B;  1F77 A;  4N8F A;  2K5Q A;  1WCM G;  2PI2 A;  1CT1 D;  2UXB L;  1X3F A;  5FO7 B;  1KLU D;  1NR2 A;  4O1N A;  1ZXT A;  4OO1 H;  4LK1 C;  3X3M A;  1GKH A;  3PF4 A;  1I4X A;  1IL2 A;  3PO3 B;  4FF4 A;  1D5Z C;  4DV5 Q;  1BBU A;  4IOC A;  2ICI A;  1G6P A;  1FNW A;  4E6I A;  1SYB A;  3U9O A;  4LF9 L;  5ELE A;  4JI1 Q;  1A0I A;  4A3J B;  5ELN A;  4UP7 A;  1ET9 A;  1PLF A;  1N36 Q;  5M5W B;  1SMY D;  2GVB A;  3K7A H;  3RZO H;  4MHE A;  3NQI A;  4LW1 A;  3ITP A;  4HR7 B;  4POF A;  4JV5 Q;  4CJ1 B;  3K5M A;  1VQM A;  2A6E C;  1YI2 A;  2A19 A;  3DM3 A;  2VB2 X;  1HZB A;  4U68 A;  4AH6 A;  4DR2 Q;  2ZJP A;  1N34 L;  2RSO A;  1FGU A;  4LF7 Q;  3E9I A;  4L5R C;  1STA A;  4HTH A;  4HIO A;  2TSS A;  2MQH A;  4A3L G;  1NCV A;  1E2Z A;  3P1H A;  5IYB G;  3UDX A;  2XNA C;  3Q22 A;  4BY7 G;  2C35 B;  1RTO A;  4R8N A;  4A93 G;  4UHV A;  3F2C A;  3OPO A;  4XQJ A;  4DR1 Q;  1BCP B;  4IFD I;  1D6E C;  3BG3 A;  1IBM Q;  1HNW Q;  1GUT A;  5G3L F;  1VQ8 A;  3BDO A;  1D1K A;  4XT1 B;  3VDY A;  2B2V A;  2GN5 A;  4NPS A;  1HA6 A;  5BN3 A;  1LTS D;  1VQA A;  2FMM A;  2PNR C;  4OGQ C;  3GTL B;  2E2J B;  2OEO A;  1STH A;  2Z4I A;  5FJ8 G;  1V9P A;  5IIF A;  4H13 C;  4OWW B;  1NNX A;  2AQ1 B;  3GV3 A;  3P20 A;  2JA8 H;  2ENB A;  4IUN A;  3HOV H;  1GM5 A;  1AE3 A;  2A6E D;  5FLM H;  4MN3 A;  3D6C A;  5E1F A;  1LAB A;  5M9O A;  3CCM A;  2RDG A;  4WFN 3;  3VYT A;  3QIA A;  2ZTC A;  2KA7 A;  1HHV A;  1W2B A;  1QUQ A;  5FLX L;  2Q8I B;  3NHH A;  3T1Y Q;  2JA6 H;  4H02 A;  1EY9 A;  4IQZ A;  3RMH A;  1V1P B;  1Y1V H;  5HGQ A;  2O2L D;  2F3W A;  2EE1 A;  3S15 H;  2AHO B;  1O7Y A;  2KHI A;  5AFW A;  2NVX B;  1K8M A;  4P73 A;  3CPF A;  2UXB Q;  4ZYS A;  1SNP A;  3CW2 C;  2RDF A;  4IUR A;  4QJF A;  5IOC A;  3LGJ A;  1A8V A;  1UEA B;  2PCF B;  1GJX A;  2K1B A;  4IPD A;  1LTL A;  4HSV A;  3PCO B;  2VS1 A;  4MZ9 A;  1JJG A;  4LFC L;  1RF2 D;  2F0J A;  4FF2 A;  1F2Y A;  1SR3 A;  3HEJ A;  1PH3 A;  3QR8 A;  2WKD A;  3PUY A;  1UE7 A;  1VQ5 A;  1QE6 A;  4C3I B;  5CV8 A;  4B3M L;  4DV6 Q;  1I4H A;  3KBG A;  1GHJ A;  5HGT A;  2VNU D;  1KDA A;  3LWE A;  3G71 A;  2FFK B;  4B08 A;  5IGG A;  2WV6 D;  2JK8 A;  2EVB A;  3KF8 A;  1PZJ D;  2E75 C;  1CK1 A;  3MA2 B;  1SYE A;  1F9R A;  4DFA A;  3QWN A;  2RCN A;  2RBM A;  2F0D A;  1IZ6 A;  4DR3 Q;  2BDN A;  5K5P A;  1S5F D;  4R4C A;  1I6H H;  3I2Z A;  4GKJ L;  1LTG D;  3I4M H;  1U4P A;  3LX0 A;  1D5X C;  1EU4 A;  3S1M B;  1K8A C;  1VQH A;  5IOD A;  4FO2 A;  4GZY C;  2ALY B;  1DOL A;  3M85 A;  5EJW A;  2XWB B;  4LF4 L;  4LUZ A;  3NEN A;  3A54 A;  2WAQ E;  4YHH L;  3A56 A;  2F4V L;  3GTG H;  5DLQ E;  3T51 B;  1WJJ A;  2NTS A;  3IRB A;  3I4O A;  1CKM A;  4GLX A;  1RTN A;  1EIF A;  4A3D B;  4MTN A;  3CXC A;  4XIG S;  2Q2I A;  4C3J H;  1R9T B;  1I50 H;  2IWH A;  3F1Z A;  3I4N H;  1D5M C;  4IOA A;  1Y69 U;  3RN2 A;  2O4X A;  3STB C;  3PF5 A;  3W1B A;  4C3I G;  2VUM H;  4WJ4 A;  4A3K H;  2MP1 A;  4HJA A;  5JEA G;  3HOY G;  1C4Q A;  1S5E D;  4P72 A;  1E24 A;  1A2T A;  3FKI G;  1PH5 A;  3GTP B;  2LKV A;  3MC0 B;  1SE8 A;  1CM9 A;  2WIN B;  4HJ8 A;  3DWP A;  4ZK9 B;  3NTK A;  1O80 A;  4NDX A;  5ELB A;  2R92 B;  2DUD A;  2XGT A;  2VL6 A;  5M5Y B;  1VMC A;  1Q90 A;  1JC7 A;  2NVY H;  1JCK B;  4M8A A;  4OEM B;  1YHQ A;  4L6T B;  3RLO A;  2B3G A;  1TS5 A;  2F0E A;  2QGQ A;  5BR8 L;  1B2T A;  1YNJ C;  2A69 D;  1EL0 A;  3I70 A;  1I5F A;  1JE4 A;  5A2Q E;  1FD7 D;  5C4X G;  2L55 A;  3HOW G;  4DV2 L;  5I9O A;  2ICE C;  1HUN A;  1CZG A;  2F3I A;  5GAD C;  1S4Z A;  1EYA A;  3PQI A;  4AYB B;  4B3T L;  1UUP A;  1VDZ A;  1KC8 C;  5AJ3 L;  5M3F G;  2SNS A;  4CJ2 C;  1SNM A;  2EYF A;  3A0J A;  4DR5 L;  4JCV E;  1DYQ A;  1UE1 A;  2HT1 A;  5GQO A;  1IYV A;  5KND A;  4BY1 B;  4B3M Q;  4I65 A;  2QW7 A;  3S16 H;  4HID A;  3VYS A;  4IJH A;  4DR6 L;  1I4R A;  2RCF A;  3T4A C;  4QIW E;  1VQJ A;  2KUM A;  3OTO Q;  1OTC A;  4EQO A;  1WI5 A;  2HDL A;  1BKB A;  2RDH A;  5GAG C;  5IT9 L;  2ZJR A;  2ZXO A;  1YNJ D;  3PUX A;  5KYI A;  1WVL A;  1A2U A;  5JJK A;  4FF1 A;  2EJM A;  5JVH 3;  3IL8 A;  3S2D B;  2V4D A;  1GUW A;  4RGM A;  1BDO A;  3VYR A;  3SHL A;  2LS0 1;  1TWF B;  1PYW D;  5M3M B;  4PMW A;  4LF4 Q;  1MBY A;  1SYD A;  3EBE A;  1B53 A;  3J81 i;  4ILW A;  3JC6 6;  4YCW A;  2MHV A;  4RHS A;  5NUC A;  3PIO A;  3J81 L;  2F4V Q;  1GUO A;  3D4R A;  2XSC A;  2CH4 A;  2UU9 L;  1X56 A;  4NB3 A;  3TQY A;  1BCP F;  4KD3 A;  3GTO H;  3ND9 A;  1Q8I A;  5EPJ A;  3HOZ G;  4A3F G;  5COY A;  3AMU A;  1BR9 A;  4POG A;  4F8M A;  1TWG H;  1KIX A;  2F0P A;  3BVZ A;  1HFN A;  2KVM A;  3RLF A;  4K6D A;  1CSQ A;  2MPM A;  4YY3 Q;  1R4P B;  3NPP A;  2MGS A;  3TP6 A;  3TZD A;  1VQI A;  1ET6 A;  3SK4 A;  3E6Z X;  3ULJ A;  4M1U B;  2F52 A;  3QO2 A;  1TII D;  1QVG A;  2EXD A;  3GTQ H;  4A3C G;  5JJI A;  3C3L A;  2SEB D;  2JJQ A;  1HR0 L;  1XMO L;  2F0M A;  4F88 A;  1LTA D;  3KLW A;  4K2K A;  5C3E B;  5LHY 1;  3BDL A;  2Z0S A;  2IHF A;  4A75 A;  4A3I G;  1ESF A;  4JYA L;  4AQY L;  1QB5 D;  5C4J H;  2WFW A;  4MTK A;  1ZKO A;  4DR4 Q;  1XXG A;  4A3E B;  1RD9 D;  2F0U A;  3JAM E;  1JR0 D;  3K5L A;  1CKO A;  1EZ6 A;  3H09 A;  4UP8 A;  5IP9 G;  2JXM B;  3FDT A;  1STB A;  2R7D A;  1XTC D;  2XN9 C;  3C46 A;  2F0L A;  3I56 A;  3SXH A;  4DV2 Q;  2RSN A;  1K28 A;  2OWO A;  2KED A;  1EIY B;  1KAB A;  4BBS G;  2D0O A;  3MZ5 A;  4KTA A;  2HIV A;  5JAV A;  1EYG A;  4B3T Q;  1K0S A;  1IHZ A;  2D9U A;  3KBX A;  5FK9 C;  2WAQ G;  5C3X A;  3CME A;  3IAY A;  3TME A;  1TWA H;  2EY1 A;  5AJ3 Q;  3E3X A;  1HZC A;  3K8A A;  1Y1W B;  1YIT A;  3L3O C;  2PI2 E;  3FPU B;  3Q0A A;  1I3Q B;  5M5X H;  1KHI A;  2Z6K A;  3C1E A;  5IYD G;  1RJT A;  2PQE A;  5C0X I;  1PH7 A;  4HJ9 A;  1R4Q B;  4C3H G;  2EYM A;  5DM6 3;  4BBR H;  1PH2 A;  2G9H D;  1VQL A;  2KHS A;  4DR6 Q;  1J5E L;  2E2H H;  2R93 G;  3BU2 A;  1F9Q A;  2BE5 D;  4XTC S;  1K3B C;  2VQF L;  4J15 A;  4KY5 A;  4EQP A;  1BO0 A;  1F2L A;  3ERS X;  5K36 H;  4TRD A;  4IPH A;  2H5X A;  2EXZ A;  3U58 A;  2I46 A;  3MFG A;  1CQV A;  4DUZ L;  3RR5 A;  2NN6 G;  3H0G B;  3V2T A;  3NE5 B;  4JI4 L;  3GTM H;  2JA7 B;  1E1T A;  2CQO A;  2A68 C;  3Q8D A;  4FXK C;  1WTH A;  2AWN A;  4P75 A;  4CDC C;  5C4Z A;  2UU9 Q;  4XYQ A;  4PV1 C;  2BCO A;  1HXY D;  4LF8 Q;  4F87 A;  2QDB A;  2WII B;  4A3B H;  1PRT B;  4G7O C;  3HGB A;  3M3Y B;  4RGT A;  3HG9 A;  1A15 A;  2NVT H;  1G51 A;  2KJX A;  2QKI C;  4GNX C;  1SNC A;  3R93 A;  3S1N H;  4N8X 1;  1LM0 A;  5DAU A;  1AZQ A;  1KDC A;  2N3S A;  4DF7 A;  2F4I A;  1GUS A;  2B63 H;  3S1R H;  1HR0 W;  1QVF A;  1HR0 Q;  4JI2 L;  4G4K A;  2F0Q A;  1XMO Q;  3EFX D;  3E0J A;  2QDL A;  1YHA A;  3GD7 A;  1U4M A;  2CWP A;  1YJW A;  3HOX H;  4DR2 L;  3AEV A;  5JJZ A;  2EDG A;  2OQ0 A;  3W3A A;  4GLV B;  3E9H A;  5C6A A;  2K5W A;  1V1Q A;  4DAM A;  1F9S A;  4ODG A;  3FMC A;  4CKE A;  3CCS A;  4CDE C;  1HNZ L;  2R7Z G;  4CGY B;  4H44 C;  5C44 G;  1Z9F A;  3U4Z A;  1TKW B;  2OCE A;  1PXU A;  1WCM B;  4DR1 L;  4C1N K;  4EQ5 A;  2DNC A;  5H1S E;  1HNW L;  1K8G A;  2OTJ A;  2N8N A;  3OOC A;  4HED A;  3SVM A;  1DXM A;  4LMQ D;  5IT9 c;  3CC4 A;  2HHH Q;  1L0W A;  5IE8 A;  2L1B A;  4C56 C;  4AIM A;  4UPA A;  1C8C A;  1JB7 A;  4JG2 A;  3SEB A;  1XNR Q;  4HAE A;  3V96 A;  4G7H C;  1Y8P B;  1JMC A;  3S17 H;  3M4O H;  4IFD J;  1EY6 A;  5L37 A;  3RNU A;  1NBW A;  2KHJ A;  1SFO H;  3J81 c;  1B70 B;  2FIN B;  2PQA A;  1H9S B;  2O5I C;  2ZXP A;  2CQA A;  1PVO A;  4R8I A;  2PZW A;  3HKZ E;  3ICE A;  1BCP C;  4CKB A;  3KF6 A;  3M4Q A;  5FKA C;  2MFI A;  4C2M B;  3HOU G;  1LTR D;  1M4V A;  3T1Y L;  4FP5 D;  1BBX C;  1VQK A;  2I0Q A;  5CV4 A;  4BY7 B;  1RKN A;  3DM1 A;  1TQO A;  2Z8L A;  1EQQ A;  5JEA J;  3PIO 3;  3HFZ B;  3Q24 A;  4JI4 Q;  3TS0 A;  1QIL A;  2VB3 X;  5C5L A;  1B3Q A;  2EYO A;  4PZ7 A;  3UE1 A;  1KDB A;  2LXJ A;  3H6M A;  3H91 A;  4NP5 A;  2KCN A;  3OW7 A;  4B9W A;  1Q7Y C;  2B8G A;  1PH9 A;  1UNS A;  2XWJ B;  4BXX H;  3I55 A;  4OWT B;  4DN4 M;  4V19 0;  4OO1 G;  3K5N A;  1ONL A;  3D4D A;  3WOF A;  2B2Y A;  1OXX K;  5A35 A;  1Q1B A;  3NBH B;  4DV0 Q;  3KJO A;  1AEX A;  5TSS A;  3D3R A;  4HJ5 A;  5C4H A;  1CFM A;  1EY7 A;  3AQQ A;  3HOV B;  2NUC A;  2ZTE A;  2ASB A;  3MVV A;  4DV6 L;  4JI2 Q;  1TWH H;  1BCP D;  4QY7 A;  3S2H H;  3W2D A;  4NXN L;  2DY7 A;  1SLJ A;  5IGC A;  5ELO A;  2PW7 A;  1XTD A;  1X65 A;  4HCS A;  4GNX A;  3CC7 A;  2E5L Q;  1P16 A;  3FRP B;  3PO2 H;  1YEZ A;  1O7I A;  3CHB D;  2K5H A;  1KTK A;  2JA5 H;  3KOJ A;  2KEN A;  4DR3 L;  2KEC A;  3AU7 A;  1HNZ Q;  4JBJ A;  3TS2 A;  2V1C C;  3P7J A;  2IJ0 A;  4PNY A;  1TY2 A;  3CCQ A;  4JVZ A;  2I07 B;  1AFP A;  1CA6 A;  3O13 A;  1Q3L A;  4L5T A;  4KN4 C;  3EVQ A;  1E0B A;  4QMG A;  1JE5 A;  4A3L H;  4X62 Q;  4OWX B;  1LT6 D;  1A3V A;  5EAY A;  3BZC A;  2MUY A;  1OO9 B;  1MGS A;  3KUP A;  3RZD B;  4QQB X;  1DGS A;  1QZG A;  1HQR D;  4APV A;  4NW2 A;  2YU9 B;  3MHB A;  3G7L A;  1ILQ A;  2F0V A;  3GDE A;  1D8L A;  3SK5 A;  3S24 A;  5ELC A;  1PH1 A;  3PMF A;  2F0W A;  3CCL A;  2JA8 G;  2EOT A;  3HOV G;  1HJP A;  5FLM G;  1MI2 A;  1U9R A;  4DR7 Q;  1A62 A;  3PO3 H;  4BA2 I;  2K4K A;  4Z9C B;  3NXW A;  4HMJ A;  5KIX A;  1CI3 M;  2R6G A;  3VA5 A;  4B3R L;  2VW9 A;  1B4O A;  4A3J H;  5M5W H;  2JA6 G;  3ERO A;  1ROD A;  1NE3 A;  2K52 A;  4PMB A;  3ULL A;  1QNU A;  1Y1V G;  2NZ1 D;  1Q1E A;  3GTK H;  1KLG D;  4RH6 A;  3R2I A;  4WOR A;  4K14 A;  2NZO A;  1D2B A;  2E2I H;  4KLK A;  4B9X A;  1KRS A;  5FOB B;  4KY6 A;  3I90 A;  4DU9 A;  3SE0 A;  3KFU A;  4DV1 Q;  1X54 A;  1PZI D;  2PNH A;  4UDU C;  3ULP A;  1Q86 C;  4N9P A;  1Q82 C;  3CD6 A;  3GTG B;  1YVC A;  3GQB A;  4KHZ A;  4K5W A;  1XYI A;  1E7Z A;  2M00 A;  3ONA B;  1DJR D;  1PZK D;  2N88 A;  1W6J A;  4LJZ C;  2C5C A;  1PV4 A;  2J0T D;  1PRT F;  4OIK A;  1JB3 A;  1ESR A;  3FP9 A;  1W6K A;  4B3S L;  3NBI A;  1JIC A;  4QF4 A;  3HOY B;  3FHW A;  2B2W C;  3GTL H;  1IYJ B;  5IYC H;  1B44 D;  4NXN Q;  1QJO A;  2I5M X;  3NWT A;  3FKI B;  2F03 A;  4CHT B;  1DZ1 A;  2Q2T A;  2NTT A;  1K83 B;  1EQR A;  1L0X B;  4TQU S;  2I5H A;  3OTO L;  4O42 A;  1ENC A;  3HKZ G;  1L1O B;  1S40 A;  4G7Z C;  4LFB L;  1V1P A;  4XQN A;  2MJ8 A;  1XWE A;  2OQK A;  5T1I A;  4OX9 Q;  1FNU A;  1N9W A;  1SBB B;  1NR4 A;  1M90 C;  1SYC A;  2D5D A;  4BS9 A;  2PPB C;  1EEF D;  3I4M G;  2DNE A;  4KMU C;  3HOW B;  1SXT A;  5E4X A;  2ID0 A;  1WYD A;  1SE3 A;  1K0R A;  3MEH A;  1PTO B;  2ZXR A;  1XJV A;  4JI5 L;  1SNQ A;  1SYF A;  2LFN A;  1J9O A;  3TP8 A;  3WWV A;  4OL7 A;  3IFT A;  5M3F B;  2Y0S E;  1QWY A;  3K7U C;  5E3F A;  2NVX H;  4IFD H;  1TS4 A;  5I2Y A;  1L0Y B;  2CHB D;  2QIL A;  4C3J G;  4LWC A;  3JAM i;  4L5S A;  1AP0 A;  2WB1 E;  4YY3 L;  4JI6 Q;  1LT3 D;  3JAM L;  1PH6 A;  1SE4 A;  3VA7 A;  3T1H L;  4K6L A;  3M4P A;  1K73 C;  3CMA A;  1LO5 D;  5J3B A;  1E22 A;  2VUM G;  4A3K G;  1B1Z A;  3KYH C;  1U5K A;  2A73 B;  3URY A;  4QB4 A;  4B3R Q;  1SEB D;  1T9H A;  3PUV A;  3CCE A;  3FVQ A;  3VR5 A;  1X32 A;  1CKN A;  2K5V A;  3SK8 A;  2WP8 J;  4DR4 L;  1UE5 A;  4XQQ A;  2UUC L;  5JEA H;  2AUK A;  3MXN B;  2EYL A;  3J7A V;  1KXL A;  4HIK A;  4K8J A;  2BH8 A;  2M9V A;  3RLN A;  2YYZ A;  3K59 A;  3SDZ A;  1II3 A;  3G6E A;  4EVO A;  4DNT B;  4CDF C;  1H9J A;  2Z6K C;  2NVQ B;  3W1G A;  1FL0 A;  1DM0 B;  1EWC A;  4QUC A;  3GTJ B;  5FO9 B;  5COR A;  3QJY A;  3HOZ B;  3S1Q B;  4EGV A;  4A3F B;  1J8I A;  5CV5 A;  1EWH A;  4ZAI A;  3L7Z C;  3S1M H;  3STB D;  1XPO A;  3OMC A;  2XRS D;  3NK9 A;  2AKW B;  5IP7 G;  5KYL A;  1A6X A;  2SOB A;  5ELD A;  5FLX E;  5LMU L;  4B3S Q;  3F2D A;  1G2T A;  4GOP B;  3J80 i;  4JOI C;  2RF4 A;  4KY7 A;  1G8Z D;  3PGZ A;  3J80 L;  1CQF A;  1JJ2 A;  1AZP A;  1N33 L;  4P2C B;  4A3D H;  3NUC A;  2HD3 A;  4WJW A;  3PIP A;  3FEW X;  4A3I B;  1R9T H;  1H9R A;  1ICW A;  1TWC B;  1V43 A;  2BOS A;  3OWE B;  4LFB Q;  5C0X J;  4KKS A;  1B9N A;  2MO1 A;  4HJ7 A;  4CDD C;  2CKZ B;  2B2W A;  1VF5 C;  2UXD L;  2IL8 A;  2RHS B;  2NN6 I;  4X3S A;  4YIJ A;  4A76 A;  2F0K A;  1NJI C;  2HUG A;  3H3V I;  1AH9 A;  1EYD A;  4DXF A;  3GTP H;  1XMQ L;  1X3E A;  2CWA A;  1STY A;  3TRE A;  1EQT A;  2R92 H;  4BBS B;  1NMG A;  1SN8 A;  4GN3 B;  2KBN A;  5M5Y H;  1GUG A;  3D6W A;  4R9W A;  3CPW A;  1IYU A;  2WAC A;  4JI5 Q;  5CV6 A;  2WAQ B;  4C1N I;  4LF8 L;  1XPR A;  1VF7 A;  2F0T A;  2Z6B A;  4JI8 L;  4KKT A;  3SR1 A;  1UAP A;  2H1E A;  2VXW A;  1IL8 A;  3OYY A;  2NYZ D;  1VCI A;  5JOB A;  1PFN A;  3CQZ B;  4DKA C;  1GO3 E;  3FPP A;  4C3H B;  1TT2 A;  5G3L D; 
#chains in the Genus database with same CATH homology
 1HPC A;  3QB3 A;  2G9D A;  1QNK A;  2JSO A;  5DNF A;  1DD2 A;  2WB1 B;  5KNB A;  2R93 B;  3TBI B;  5IGE A;  5KNC A;  3KLS A;  3QOL A;  4EQN A;  4FXG C;  3DXJ C;  5EGT A;  4XT3 B;  2F0F A;  1JOO A;  3OIQ A;  5JVG 3;  2H4O A;  3D8G A;  1EYC A;  3MXU A;  4CKC A;  3VR2 A;  3DEO A;  3DEP A;  4S3S A;  2QF7 A;  4NMZ A;  1PRT C;  2L9H A;  1OXV A;  2IX0 A;  2JP1 A;  3I91 A;  3MTS A;  4BWG B;  5KEE A;  3ERQ A;  1KAA A;  3DMU A;  5D14 A;  3K58 A;  4V0B A;  5I6Y A;  4OIJ A;  5I6W A;  2EY2 A;  3Q23 A;  4DGZ A;  3HP3 A;  1CHQ D;  3S1N B;  3T13 A;  4Y7N B;  3S14 B;  1KNE A;  4OHJ A;  2M2L A;  1O7L A;  2L4N A;  5D3I B;  2A6H C;  3WOE A;  1KNA A;  4QIW B;  1SJE D;  1PRT D;  4H0L C;  2KOL A;  1V8Q A;  5LL6 X;  2R7Z B;  5K36 G;  2B2Y C;  5C44 B;  3I3C A;  1EY0 A;  2F0S A;  3PV0 A;  3I72 A;  5EKL A;  1EY4 A;  5EPL A;  5EQ0 A;  2K03 A;  4OO1 I;  1Q12 A;  2AQ3 B;  2HCI A;  4KJO A;  5FO8 B;  5CYU A;  1B50 A;  1A3U A;  2J4X A;  5ELF A;  1PTO F;  4F7X A;  4DAV A;  1EU3 A;  1G2S A;  2BA1 A;  4ZRZ A;  4ZKB B;  5CBA E;  1SFO B;  1HFG A;  2A6H D;  2PZU A;  2N55 A;  3C1F A;  5LL6 S;  3HOU B;  4A3G B;  1PDQ A;  2RQX A;  1JWU D;  1H9K A;  1PFB A;  5EKK A;  5BN5 A;  3M7G A;  4RKB A;  2Q8T A;  1CZW A;  2A68 D;  5E4W C;  3N6R A;  3VR6 A;  1HCZ A;  4G57 A;  3G6J B;  4RWS C;  4XXE A;  3PUZ A;  3CRL C;  5BN4 A;  5F2D A;  4DA2 A;  4CBV A;  3S9W A;  4HSP A;  5CBE E;  3K6O A;  3T16 A;  3M4Y A;  2J7Z A;  3DUZ A;  2Q8R E;  1GUN A;  2SDF A;  5DM7 3;  1RHP A;  3K7A B;  3HZX A;  3PIP 3;  3RZO B;  3CRK C;  3QG1 A;  4ZQ3 A;  2NB0 A;  4U67 3;  5IGB A;  3MAQ A;  5IGD A;  5C0X H;  5DEH A;  4I7Z C;  1GOZ A;  1TY0 A;  3U9S A;  3D4W A;  3TSS A;  3I73 A;  2HQE A;  3HS0 C;  1G29 1;  2KCC A;  1IW7 C;  4H7B A;  4KJN A;  1JOQ A;  1AW7 A;  1CA5 A;  3I8Z A;  2RA4 A;  3NP8 A;  3K0Y A;  2K04 A;  2NBF A;  1EY5 A;  4IN3 A;  4ABN A;  2QEJ C;  5KGU A;  3VR4 A;  1I6V C;  3EJI A;  1S5B D;  3K5O A;  3MFY A;  2EY6 A;  3OHX C;  2JA8 B;  2X6G A;  3H94 A;  4LAA A;  2XIW A;  4FYD A;  1H9S A;  2B39 A;  1C48 A;  4IUQ A;  1LAC A;  1RDP D;  2IW3 A;  2K5D A;  1ZEQ X;  5J22 A;  4MIU A;  2JA6 B;  1IW7 D;  3ND8 A;  1Y1V B;  2HDM A;  1LTB D;  1BNZ A;  1O7Z A;  3S15 B;  2EJG C;  3GTK B;  3LNN A;  1S5D D;  2E2I B;  3D31 A;  4KD4 A;  2LY7 A;  3TZU A;  5I4D A;  3BVM A;  1GXD C;  2E2D C;  2OT2 A;  3BZD B;  2L0C A;  1G91 A;  4RFB A;  5HUR A;  2IPK D;  3J7A F;  4QCL A;  3NBH A;  3TP7 A;  1BOS A;  4IUP A;  3BVG A;  4HN7 A;  1FGB D;  2Z1C A;  1T5E A;  2DN8 A;  2SNM A;  2TMP A;  2FJ2 A;  2R61 A;  4ZUI A;  5A2Q L;  2F1M A;  1U4L A;  3A8J E;  3HKZ B;  1DOM A;  5JPM C;  1PTO C;  5EBC A;  3WDN A;  3OMG A;  2PO4 A;  5I9P A;  2XRQ D;  4X3T A;  1I6H B;  5KRU A;  3LWU A;  1QOH A;  2K01 A;  3I4M B;  4IAL A;  4ZLT F;  1CTM A;  4ID6 A;  5CMD A;  1HQM C;  2A74 C;  4QUF A;  2NWG A;  1SSO A;  1Z6H A;  2PMZ B;  3PUW A;  4RHR A;  5I2X A;  2RKS A;  4HMI A;  5C3W A;  2C9O A;  1LT5 D;  2PZT A;  3KLS X;  1HTP A;  4C3J B;  1I50 B;  3DWQ A;  2K28 A;  1EIH A;  3I4N B;  1MSH A;  1EY8 A;  2LMC B;  4K2L A;  5CGK A;  2VUM B;  4A3K B;  1T5X D;  1PTO D;  4KHV A;  2RVL A;  4DNR B;  2EYP A;  1BQQ T;  2KEE A;  2X6L A;  4RA8 A;  3T53 B;  2NVY B;  2AWO A;  4L63 B;  3F2U A;  4Q5V A;  3A8I E;  4KK7 A;  1WTQ A;  3I4L A;  1F2M A;  1JWS D;  4PMC A;  4N9T A;  1NAP A;  3A7L A;  5EKI A;  1JWM D;  1TS2 A;  3NTH A;  1XX8 A;  1LTI D;  3R3O A;  3UI2 A;  4IFD G;  4RKL A;  4JBW A;  2A69 C;  1GHK A;  4KI0 A;  3BS1 A;  4RGN A;  3S16 B;  1I4P A;  2EZV A;  1WTR A;  2IX1 A;  4UAI A;  4DK0 A;  1OXT A;  2B2T C;  4FVM A;  2L11 A;  1PMR A;  2OF1 A;  3SK6 A;  3TN2 A;  1FYC A;  3KLR A;  2BA0 A;  1H9M A;  2PYK A;  2X69 A;  2L12 A;  4DK1 A;  3RUZ A;  4J1M A;  5JPN C;  3NWS A;  2EY5 A;  1BUV T;  4KN7 C;  4TKO B;  3C2P A;  2IT1 A;  1LT4 D;  4TSS A;  3GTO B;  1F2Z A;  1TWG B;  2AUJ D;  2AQ2 B;  1QCB D;  3R2T A;  2JEA I;  1PTO H;  1EZ8 A;  3GTQ B;  3L9A X;  3R8B A;  1WTW A;  2F0N A;  3OSO A;  3H3V C;  2K33 A;  3A7A B;  5C4J B;  1BF4 A;  1LTT D;  1S5C D;  3MXN A;  3AB9 A;  3QOJ A;  2KQ3 A;  4XYO A;  3MXG A;  1HUM A;  2F0H A;  2QCP X;  2EYH A;  2JYO A;  1K8O A;  3MXP A;  2F0O A;  1B9M A;  2BDO A;  3Q6S A;  1WD0 A;  1E2W A;  5T1G A;  2EYJ A;  1DCZ A;  1I4Q A;  1TWA B;  4RAU C;  4RCN A;  2K32 A;  2CVR A;  2Y0S B;  1M8A A;  1VMP A;  2Z4H A;  3HRZ C;  1SND A;  1HA5 A;  5M5X B;  1CHP D;  1ILP A;  2B2U C;  4BBR B;  2K05 A;  1SYG A;  4ULL A;  4DAP A;  4IZ8 A;  2A5H A;  1EEI D;  2E2H B;  2K6A A;  3GP7 A;  1HRJ A;  1NSN S;  2HCC A;  1O78 A;  4K8I A;  2D62 A;  2EPB A;  3VR3 A;  1FR3 A;  2B2T A;  2JEB I;  2B8F A;  3VYU A;  3GTM B;  1FNV A;  5J39 A;  2BE5 C;  3GV6 A;  3IFD A;  1JOR A;  2F0I A;  3T56 B;  4ME5 A;  1PFM A;  1WTV A;  3NTI A;  4KV6 A;  4ZUJ A;  4A3M B;  1DON A;  4A3B B;  2NVT B;  1BXT A;  1DOK A;  2CW0 C;  1AN8 A;  1X3P A;  3IKJ A;  3E5S A;  3DWA A;  1WTX A;  2B63 B;  1QG7 A;  1ML0 D;  5ISR A;  1EIG A;  3RD4 A;  1TVX A;  3S1R B;  3GO5 A;  1STG A;  4K5X A;  4FXD A;  1JQY D;  5D65 A;  3P75 A;  3ZYY X;  3HOX B;  1Z7T A;  1IKL A;  1ZYR C;  1G6Z A;  2JE6 I;  3TP5 A;  1NUC A;  1TS3 A;  2ZT9 C;  3EQL C;  4RCO A;  4J6H A;  1TU2 B;  1MD2 D;  2R3Z A;  3EA6 A;  5EBD A;  1E2V A;  1Y8O B;  2L5T A;  4IUU A;  4WRD A;  4Q0F A;  5D3D A;  4CJ0 B;  2CW0 D;  2GA4 B;  1OXS C;  2NN6 H;  3J80 E;  4XDX A;  1SE2 A;  2EJF C;  2FMC A;  4X3U A;  4FF3 A;  3K57 A;  3S17 B;  3M4O B;  2E76 C;  1SJH D;  3KK7 A;  1Y8N B;  5IT9 E;  3J7Y W;  3BYY B;  1ZYR D;  3BYT B;  3X3N A;  1F9P A;  4BA1 I;  1ENF A;  1STN A;  1LV9 A;  1STE A;  5CC4 A;  3OIP A;  2B2U A;  2PW5 A;  1V1O A;  4NKL A;  4X3K A;  5CV7 A;  2F0G A;  3J81 E;  5CR3 A;  4ZKC B;  4IUV A;  3A8K E;  1MSG A;  1I4G A;  3OWF A;  3M7N A;  4K5V A;  1A3T A;  1SDF A;  2FHT A;  3MWY W;  1WTO A;  1YNN C;  2B2V C;  1Z47 A;  3N52 A;  4IUT A;  4RGO S;  1RCV D;  1X3Q A;  5C5M A;  1IKM A;  3NSW A;  4PQX A;  1LLR D;  4J8Q A;  1EQV A;  3NQT A;  2OXP A;  1EFI D;  1ENA A;  4L8J A;  5EPK A;  1D1I A;  1TWH B;  3CKI B;  1U4R A;  3S2H B;  3CU7 A;  4KKU A;  4DXG A;  1JOK A;  2IX3 A;  5IGF A;  3V05 A;  3DHQ A;  5CV9 A;  1OXU A;  5C0X G;  3PO2 B;  3A55 A;  2JA5 B;  2E74 C;  1SAP A;  2WKC A;  1SMY C;  2DY8 A;  2F3V A;  1WTP A;  2D2C C;  1B3A A;  1YNN D;  2K7V A;  2O5J C;  4HCE A;  1SNO A;  1WD1 A;  4DAY A;  1TR5 A;  4FNF A;  2XVS A;  1HTL D;  4JK1 C;  3TDQ A;  5J1Z A;  3BDC A;  1EOT A;  4A93 B;  1F77 A;  2K5Q A;  1CT1 D;  5FO7 B;  1KLU D;  1NR2 A;  4O1N A;  1ZXT A;  4OO1 H;  4LK1 C;  3X3M A;  1I4X A;  3PO3 B;  4FF4 A;  1D5Z C;  2ICI A;  4E6I A;  1FNW A;  1SYB A;  3U9O A;  5ELE A;  4A3J B;  1ET9 A;  1PLF A;  5M5W B;  1SMY D;  4MHE A;  3NQI A;  3ITP A;  4HR7 B;  4CJ1 B;  3K5M A;  2A6E C;  2VB2 X;  4U68 A;  2RSO A;  1STA A;  4HTH A;  2TSS A;  1NCV A;  1E2Z A;  3P1H A;  2XNA C;  3Q22 A;  1RTO A;  4R8N A;  3OPO A;  4XQJ A;  1BCP B;  4IFD I;  1D6E C;  3BG3 A;  1GUT A;  5G3L F;  3BDO A;  1D1K A;  4XT1 B;  2B2V A;  1HA6 A;  5BN3 A;  1LTS D;  4OGQ C;  2FMM A;  2PNR C;  3GTL B;  2E2J B;  2OEO A;  1STH A;  2Z4I A;  5IIF A;  4H13 C;  2AQ1 B;  3GV3 A;  3P20 A;  2ENB A;  4IUN A;  2A6E D;  4MN3 A;  3D6C A;  5E1F A;  1LAB A;  5M9O A;  2RDG A;  4WFN 3;  3VYT A;  3QIA A;  2KA7 A;  1HHV A;  5FLX L;  2Q8I B;  3NHH A;  1EY9 A;  4IQZ A;  3RMH A;  1V1P B;  2O2L D;  2F3W A;  2EE1 A;  1O7Y A;  5AFW A;  2NVX B;  1K8M A;  4ZYS A;  1SNP A;  2RDF A;  4IUR A;  5IOC A;  1UEA B;  2PCF B;  1GJX A;  2K1B A;  4HSV A;  1RF2 D;  2F0J A;  4FF2 A;  1F2Y A;  3HEJ A;  2WKD A;  3PUY A;  1QE6 A;  4C3I B;  5CV8 A;  1I4H A;  3KBG A;  1GHJ A;  5HGT A;  2VNU D;  1KDA A;  3LWE A;  2FFK B;  4B08 A;  5IGG A;  2WV6 D;  2EVB A;  3KF8 A;  1PZJ D;  2E75 C;  1CK1 A;  3MA2 B;  1SYE A;  1F9R A;  4DFA A;  3QWN A;  2RBM A;  2F0D A;  2BDN A;  5K5P A;  1S5F D;  1LTG D;  1U4P A;  3LX0 A;  1D5X C;  1EU4 A;  3S1M B;  5IOD A;  4FO2 A;  4GZY C;  1DOL A;  3M85 A;  5EJW A;  2XWB B;  3A54 A;  3A56 A;  3T51 B;  2NTS A;  1RTN A;  4A3D B;  4XIG S;  1R9T B;  2IWH A;  1D5M C;  1Y69 U;  2O4X A;  4C3I G;  2MP1 A;  5JEA G;  1C4Q A;  1S5E D;  1A2T A;  3GTP B;  2LKV A;  3MC0 B;  1CM9 A;  2WIN B;  3DWP A;  4ZK9 B;  3NTK A;  1O80 A;  4NDX A;  5ELB A;  2R92 B;  5M5Y B;  1VMC A;  1Q90 A;  1JC7 A;  1JCK B;  4M8A A;  4L6T B;  1TS5 A;  2F0E A;  1B2T A;  1YNJ C;  2A69 D;  1EL0 A;  3I70 A;  5A2Q E;  1JE4 A;  1FD7 D;  2L55 A;  5I9O A;  2ICE C;  1HUN A;  1CZG A;  1S4Z A;  1EYA A;  4AYB B;  1UUP A;  1VDZ A;  2SNS A;  4CJ2 C;  1SNM A;  2EYF A;  1DYQ A;  1IYV A;  5KND A;  4BY1 B;  4I65 A;  3VYS A;  1I4R A;  3T4A C;  2KUM A;  4EQO A;  2HDL A;  2RDH A;  5IT9 L;  2ZXO A;  1YNJ D;  3PUX A;  5KYI A;  1WVL A;  1A2U A;  4FF1 A;  2EJM A;  5JVH 3;  3IL8 A;  3S2D B;  2V4D A;  1GUW A;  4RGM A;  1BDO A;  3VYR A;  3SHL A;  2LS0 1;  1TWF B;  1PYW D;  5M3M B;  4PMW A;  1MBY A;  1SYD A;  1B53 A;  4ILW A;  2MHV A;  4RHS A;  5NUC A;  3J81 L;  1GUO A;  3D4R A;  2XSC A;  1BCP F;  4KD3 A;  3ND9 A;  1Q8I A;  5EPJ A;  5COY A;  3AMU A;  1BR9 A;  4F8M A;  1HFN A;  2F0P A;  3BVZ A;  2KVM A;  3RLF A;  4K6D A;  2MPM A;  1R4P B;  3NPP A;  2MGS A;  3TP6 A;  3TZD A;  1ET6 A;  3SK4 A;  3E6Z X;  4M1U B;  3QO2 A;  1TII D;  3C3L A;  2SEB D;  2F0M A;  4F88 A;  1LTA D;  4K2K A;  5C3E B;  5LHY 1;  3BDL A;  1ESF A;  1QB5 D;  1ZKO A;  1XXG A;  4A3E B;  1RD9 D;  2F0U A;  3JAM E;  1JR0 D;  3K5L A;  1EZ6 A;  3H09 A;  2JXM B;  3FDT A;  1STB A;  2XN9 C;  1XTC D;  3C46 A;  2F0L A;  3SXH A;  2RSN A;  2KED A;  1KAB A;  3MZ5 A;  4KTA A;  5JAV A;  1IHZ A;  2D9U A;  3KBX A;  5FK9 C;  5C3X A;  3IAY A;  3TME A;  2EY1 A;  1Y1W B;  3L3O C;  3FPU B;  3Q0A A;  1I3Q B;  3C1E A;  1RJT A;  2PQE A;  5C0X I;  1R4Q B;  4C3H G;  2EYM A;  5DM6 3;  2G9H D;  2KHS A;  1F9Q A;  2BE5 D;  4XTC S;  4KY5 A;  4EQP A;  1BO0 A;  1F2L A;  5K36 H;  4TRD A;  2EXZ A;  2I46 A;  3MFG A;  1CQV A;  2NN6 G;  3H0G B;  3V2T A;  3NE5 B;  2JA7 B;  2A68 C;  4FXK C;  2AWN A;  5C4Z A;  4XYQ A;  4PV1 C;  2BCO A;  1HXY D;  4F87 A;  2QDB A;  2WII B;  1PRT B;  4G7O C;  3HGB A;  3M3Y B;  4RGT A;  3HG9 A;  1A15 A;  2KJX A;  2QKI C;  1SNC A;  3R93 A;  5DAU A;  1AZQ A;  1KDC A;  4DF7 A;  2F4I A;  1GUS A;  4G4K A;  2F0Q A;  3EFX D;  3E0J A;  3GD7 A;  1U4M A;  5JJZ A;  2EDG A;  3W3A A;  5C6A A;  2K5W A;  1F9S A;  4ODG A;  3FMC A;  4CKE A;  4CGY B;  4H44 C;  1TKW B;  1PXU A;  1WCM B;  4C1N K;  2DNC A;  4HED A;  3OOC A;  3SVM A;  1DXM A;  4LMQ D;  2L1B A;  4C56 C;  1C8C A;  3SEB A;  4HAE A;  3V96 A;  4G7H C;  1Y8P B;  4IFD J;  1EY6 A;  2FIN B;  1H9S B;  2O5I C;  2ZXP A;  2CQA A;  4R8I A;  2PZW A;  1BCP C;  4CKB A;  5FKA C;  4C2M B;  1LTR D;  1M4V A;  4FP5 D;  1BBX C;  5CV4 A;  4BY7 B;  1RKN A;  3DM1 A;  1TQO A;  2Z8L A;  5JEA J;  3PIO 3;  3Q24 A;  1QIL A;  2VB3 X;  5C5L A;  2EYO A;  1KDB A;  3H6M A;  3H91 A;  4NP5 A;  2KCN A;  3OW7 A;  4B9W A;  2B8G A;  1UNS A;  2XWJ B;  4DN4 M;  4V19 0;  4OO1 G;  3K5N A;  1ONL A;  3D4D A;  3WOF A;  2B2Y A;  1OXX K;  5A35 A;  1Q1B A;  1AEX A;  5TSS A;  3D3R A;  5C4H A;  1CFM A;  1EY7 A;  3HOV B;  2NUC A;  3MVV A;  1BCP D;  3W2D A;  2DY7 A;  5IGC A;  2PW7 A;  4HCS A;  3FRP B;  3CHB D;  1KTK A;  2KEC A;  3AU7 A;  3P7J A;  2IJ0 A;  4PNY A;  1TY2 A;  2I07 B;  1AFP A;  1CA6 A;  3O13 A;  1Q3L A;  4KN4 C;  3EVQ A;  1E0B A;  4QMG A;  1LT6 D;  1A3V A;  2MUY A;  1OO9 B;  1MGS A;  3KUP A;  3RZD B;  1HQR D;  4NW2 A;  2YU9 B;  3MHB A;  3G7L A;  1ILQ A;  2F0V A;  3SK5 A;  5ELC A;  3PMF A;  2F0W A;  2EOT A;  1MI2 A;  1U9R A;  4BA2 I;  4Z9C B;  3NXW A;  4HMJ A;  5KIX A;  1CI3 M;  2R6G A;  3VA5 A;  1B4O A;  3ERO A;  1ROD A;  4PMB A;  1QNU A;  2NZ1 D;  1Q1E A;  1KLG D;  4RH6 A;  3R2I A;  4WOR A;  4K14 A;  1D2B A;  4B9X A;  5FOB B;  4KY6 A;  3I90 A;  4DU9 A;  3SE0 A;  1PZI D;  4UDU C;  4N9P A;  3GTG B;  3GQB A;  4KHZ A;  4K5W A;  1XYI A;  2M00 A;  3ONA B;  1DJR D;  1PZK D;  2N88 A;  1W6J A;  4LJZ C;  2C5C A;  2J0T D;  1PRT F;  4OIK A;  1JB3 A;  1ESR A;  1W6K A;  3NBI A;  1JIC A;  4QF4 A;  3HOY B;  2B2W C;  1B44 D;  1QJO A;  3NWT A;  3FKI B;  2F03 A;  4CHT B;  1DZ1 A;  2NTT A;  1K83 B;  1L0X B;  4TQU S;  4O42 A;  1ENC A;  4G7Z C;  1V1P A;  4XQN A;  2MJ8 A;  1XWE A;  5T1I A;  1FNU A;  1SBB B;  1NR4 A;  1SYC A;  2D5D A;  4BS9 A;  2PPB C;  1EEF D;  3HOW B;  2DNE A;  4KMU C;  5C4X B;  1SXT A;  5E4X A;  2ID0 A;  1SE3 A;  3MEH A;  1PTO B;  2ZXR A;  1SNQ A;  1SYF A;  2LFN A;  1J9O A;  3TP8 A;  4OL7 A;  3IFT A;  5M3F B;  1QWY A;  5E3F A;  4IFD H;  1TS4 A;  5I2Y A;  1L0Y B;  2CHB D;  2QIL A;  4C3J G;  1AP0 A;  1LT3 D;  3JAM L;  1SE4 A;  3VA7 A;  4K6L A;  1LO5 D;  1B1Z A;  2A73 B;  3URY A;  4QB4 A;  1SEB D;  3PUV A;  3FVQ A;  3VR5 A;  1X32 A;  3SK8 A;  2WP8 J;  4XQQ A;  5JEA H;  2AUK A;  2EYL A;  3J7A V;  4K8J A;  2M9V A;  2YYZ A;  3K59 A;  3SDZ A;  1II3 A;  4EVO A;  4DNT B;  1H9J A;  2NVQ B;  1DM0 B;  1EWC A;  4QUC A;  3GTJ B;  5FO9 B;  5COR A;  3QJY A;  3HOZ B;  3S1Q B;  4EGV A;  4A3F B;  1J8I A;  5CV5 A;  1EWH A;  4ZAI A;  3L7Z C;  3OMC A;  2XRS D;  3NK9 A;  5KYL A;  1A6X A;  2SOB A;  5ELD A;  5FLX E;  1G2T A;  4KY7 A;  1G8Z D;  3J80 L;  1CQF A;  1AZP A;  4P2C B;  3NUC A;  4WJW A;  3FEW X;  4A3I B;  1H9R A;  1ICW A;  1TWC B;  1V43 A;  2BOS A;  3OWE B;  5C0X J;  4KKS A;  1B9N A;  2B2W A;  1VF5 C;  2IL8 A;  2NN6 I;  4X3S A;  4YIJ A;  2F0K A;  2HUG A;  1EYD A;  4DXF A;  1STY A;  1EQT A;  4BBS B;  1GUG A;  3D6W A;  4R9W A;  1IYU A;  2WAC A;  5CV6 A;  2WAQ B;  4C1N I;  1VF7 A;  2F0T A;  4KKT A;  3SR1 A;  1UAP A;  2H1E A;  2VXW A;  1IL8 A;  2NYZ D;  1VCI A;  5JOB A;  1PFN A;  3CQZ B;  3FPP A;  4C3H B;  1TT2 A;  5G3L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...