4J6HA

Crystal structure of staphylococcal nuclease variant delta+phs h121q at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTQEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS H121Q at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4j6hA00
2F3WA 2HQEA 1EY6A 4RKLA 4K2KA 4PNYA 5JOBA 1KDAA 3SXHA 2EYPA 5HGTA 1NSNS 1EYCA 4NP5A 2RBMA 4F8MA 2NUCA 4N9TA 5CC4A 4KHVA 4H7BA 1KDCA 4HMJA 5C3WA 2F0SA 2F0EA 4EVOA 4K8JA 4MIUA 3SHLA 4DF7A 5IODA 5J22A 2PW7A 5I6WA 1JOOA 2EYFA 1STNA 3OMGA 4EQPA 4DFAA 3HZXA 1SYGA 5C6AA 5CV8A 1A2UA 4KD3A 4KJOA 4QB4A 3VA5A 3EVQA 1KDBA 1STGA 5K5PA 1SNPA 5KIXA 1JORA 1F2YA 4S3SA 4K5WA 1A3TA 4ME5A 5CV9A 2F0JA 4OL7A 2EY2A 1SNCA 2PW5A 4K6DA 3EROA 4TRDA 3TMEA 3BDCA 4G57A 3S9WA 3ITPA 1EYAA 2F0LA 5C5LA 2SOBA 5J39A 5IGCA 2F0TA 5I9OA 5C3XA 5CV4A 1IHZA 3MXPA 2OF1A 4IUNA 3P75A 4R8NA 3SK4A 1AEXA 3MVVA 4NKLA 3SK5A 4DGZA 5C5MA 2F0OA 4NDXA 5CR3A 5IGGA 1EQVA 2KQ3A 5IGFA 3H6MA 1EY4A 2F0UA 2EYLA 3MEHA 1SYDA 3LX0A 2WACA 3HEJA 5E3FA 1TR5A 4KTAA 2F0GA 3ERQA 5CV5A 3D8GA 3EJIA 5IOCA 5ISRA 1SYEA 3P1HA 1JOQA 5C4ZA 2EYJA 1KAAA 3DMUA 4KY7A 1EZ6A 2OEOA 2PQEA 2LKVA 2F0KA 4ODGA 1ENAA 2RDFA 1TQOA 2F0PA 5JAVA 5M9OA 3TP6A 3SK8A 4YIJA 2EXZA 4KV6A 4PMBA 3R3OA 5CV6A 5DEHA 2RKSA 1EY8A 2ENBA 3NHHA 3QOLA 5F2DA 5KGUA 3OWFA 2QDBA 4KD4A 2M00A 5I9PA 1STAA 5KYIA 4E6IA 3RUZA 4B9XA 4ZQ3A 4K14A 2PYKA 4IZ8A 4I65A 4IALA 3MZ5A 2F0HA 1A2TA 1STYA 4KY6A 5EKLA 1SYCA 2EYMA 2EY6A 2F0WA 4PMCA 4QF4A 3DHQA 3E5SA 5CGKA 3NK9A 5IGEA 3OSOA 4K2LA 1RKNA 4ID6A 1F2ZA 3OMCA 5CV7A 1SNOA 5EGTA 3QOJA 3MHBA 3TP7A 4KY5A 3D4DA 1A3UA 3T16A 4K8IA 3TP5A 1F2MA 5IIFA 1EY9A 2SNMA 4HTHA 4NMZA 1STBA 1SYBA 1EZ8A 2F0NA 4J1MA 3T13A 4B9WA 3NXWA 3SR1A 2O4XA 2OXPA 1TT2A 1JOKA 5I6YA 2PZUA 2F0VA 3TP8A 3BDLA 3NP8A 4N9PA 4ZUIA 1EY7A 1SYFA 4RKBA 5DAUA 4LAAA 2F0IA 4K5XA 1EY0A 2F0MA 4EQNA 1II3A 2KHSA 5KYLA 2EYOA 4J6HA 4KJNA 5EKKA 3D6CA 5J1ZA 5IGBA 2EYHA 4QMGA 3SK6A 1EY5A 1KABA 1STHA 4WORA 5IGDA 1SNQA 1A3VA 5C4HA 1U9RA 3C1EA 2SNSA 4WRDA 4ZUJA 4K5VA 3C1FA 2EY1A 2F0DA 3QB3A 1SNDA 4F7XA 2PZTA 5KEEA 1NUCA 2EY5A 2F0FA 2F3VA 5NUCA 3NUCA 4HMIA 3PMFA 2F0QA 2PZWA 3U9OA 5E1FA 4DU9A 5HURA 3NQTA 1EYDA 4EQOA 3D4WA 5KRUA 1ENCA 3V2TA 1SNMA
chains in the Genus database with same CATH superfamily
2LFNA 3GDEA 4K2KA 1LT4D 4P74A 3SE0A 2JK8A 2HT1A 3QO2A 3PF4A 4XT3B 3PIO3 1PTOB 3NTKA 1SYGA 4JI7L 2AWOA 4DAYA 1HTLD 4K6LA 4M1UB 1PMRA 2J7ZA 2UUAL 2Z6KA 4H02A 4A3GG 1F2YA 2CCZA 1PHJA 4A93H 4PQXA 2ES2A 1H9MA 4TRDA 1BVSA 4G57A 1TWGB 2MGSA 2F0TA 3S1RH 5LL6X 1NCVA 4O42A 3M3YH 4R8NA 1RL2A 1AEXA 3SK5A 4A3KH 5C5MA 3ULPA 3JAME 4L5RC 2I5LX 1LTID 3GTMB 4KTAA 3VYRA 4OHJA 1MJEA 4IPDA 2L9HA 2WAQG 1RD9D 3J80c 4ZYSA 3R93A 1BDOA 4B3MQ 1EZ6A 1MIUA 4XQQA 1WI5A 1KLUD 4JI5L 5JJLA 1YHQA 2UU9Q 3I4LA 1ET6A 2JA7H 4ZKBB 2UXDQ 4ULLA 5KYIA 1GKHA 1SRUA 3AU7A 5FKAC 4KI0A 3KK7A 2WINB 1OXXK 4F88A 1LO5D 1YJWA 5CBEE 3E5SA 2EDGA 3TZDA 4DV7L 1C7YA 4IFDJ 2SDFA 5CV7A 4JYAQ 4C3HB 2B63H 1YZ6A 3HOUH 3RLNA 4LUOA 2F52A 5C0XG 4GOPA 3TP5A 5GAEC 4Y52H 1GHKA 2R93B 4CKEA 4QUCA 3KBGA 1HJPA 1VF5C 3V96A 2C5CA 2V4DA 4RGTA 3B6YA 5A2QE 4DR5Q 4BY1H 5I6YA 3RNUA 1C9OA 4LFAL 4XIGS 1SMXA 1HFGA 4HSVA 2F0MA 3G71A 4BY7G 3UE0A 1KABA 3HP3A 1T9HA 1S3OA 5JPMC 1FGBD 2SNSA 3FVQA 1PH5A 4UAIA 4KKSA 5C4XG 2EY5A 4XYOA 2F3VA 3NUCA 3I2ZA 5M5YB 2F0QA 5E1FA 3RLOA 1K83B 1DXMA 1PLFA 1ICFB 4DA2A 3D4WA 1MSGA 4ZKCB 2MJ8A 1HZ9A 4PNYA 4BWGB 1J5EQ 4DK1A 4A3EH 1N8RC 2BOSA 2B3GA 4DUZL 4H7BA 1KDCA 3U4VA 4R8IA 3BZKA 3CMEA 3J81E 2PO4A 3AB9A 3K58A 1R4PB 2QW7A 3H91A 1E2ZA 1SE2A 2A68C 3WOEA 1VQBA 1L1OB 1QILA 2JA6H 1EU3A 1CSPA 3I4NH 2ZJRA 1EFWA 1SNPA 3N6RA 4CJ2C 5IY0A 4A3FH 2XVSA 1Q86C 4RWSC 4ME5A 3PO3B 1VQOA 1EEFD 3TMEA 3QG1A 4ALPA 3I8ZA 1YJ9A 1W3SA 2K5HA 5I9OA 1M4VA 5I2YA 1SFOB 1I4PA 1N33L 4JBJA 3TREA 1X3GA 1HR0Q 3H6MA 2K75A 4RFBA 4RHRA 1PDQA 2ZM6Q 1QZHA 1FNUA 1TY0A 4IJLA 1HHVA 3S15H 2B8FA 2D0OA 1I6HH 4H44C 4GS3A 3H3VC 3R3OA 3AQQA 5A2QL 2WFWA 4LNQA 3K59A 3ICEA 4GLXA 3KLWA 4HEDA 1CK1A 3A74A 1VQNA 1HCZA 3NTHA 1B3QA 1QCBD 1YI2A 3MHBA 4YWKA 1HNXQ 3HGBA 3OYYA 1UE7A 2BDNA 5C44H 2F0NA 4QIWE 4XQJA 5EPLA 3K5LA 4U68A 3W1GA 5LL6S 2AHOB 4IOAA 4HJ7A 3EBEA 1XMQQ 2KHSA 3NELA 2A6EC 2IWHA 4POFA 2M9VA 5HGQA 2Y0SG 4K5VA 1CFMA 5JVG3 5IWAL 1TIID 3QB3A 1G91A 4HIKA 4KHZA 3AMUA 5HURA 3W1BA 3GTGH 2NBFA 4A3GH 5KRUA 2OWOA 1DJRD 4EX5A 4WJWA 2YYZA 2RDHA 2JA8G 1I6VC 2H4OA 2R7ZH 3HS0C 4F8MA 1PH7A 1S40A 2B8GA 4OGQC 4BBRB 3M85A 3GTPB 4GKJL 1JB3A 1I50B 2EYFA 3CD6A 4OWXB 4IUUA 4GNXB 4GN4B 1LACA 1WCMG 5K5PA 4WJ4A 4EGVA 1O7YA 3K80C 3HOXH 3CMAA 1FNWA 5CV9A 2F0JA 2Z6BA 1YNJD 2IHFA 4RAUC 1GUTA 3S9WA 3OW7A 1QVCA 3S14B 3CRKC 3V05A 2OF1A 3P75A 1JMCA 3E9IA 4JI7Q 2A8VA 1K28A 2UUAQ 1C8CA 2WACA 3NSWA 2L12A 3MXNB 5FK9C 1ENFA 2OQKA 5CV5A 2MO0A 2A6HD 3M4YA 3ONAB 3T51B 1ONLA 4JI2L 4B3TL 2K7VA 2PQEA 1K0RA 2OCEA 2R7FA 5C0XH 4YIJA 5IP7G 4BBSG 4XQNA 4A3BB 3UI2A 3NHHA 3FKIG 1F9PA 1N32L 2QDBA 4X64L 3AFPA 3S2DH 2WB1E 1SYCA 5TSSA 4FF4A 1SAPA 3LNNA 3S16H 3TRZA 1KNAA 3NK9A 4IFDI 4A3DB 2Z6KC 4K2LA 1GHJA 3TEHB 2GN5A 4JPBW 1LM0A 4K8IA 3DEOA 4HTHA 4ILWA 3IFDA 1EIHA 3QWNA 3FMCA 3QJYA 2PQAB 2QEXA 4FF2A 4HIOA 1WVLA 2A5HA 4EQNA 4DV7Q 1LT5D 4J6HA 5IYCG 4C3HG 3UDFA 1IBKL 3RD4A 2E76C 2X6LA 5IP9G 1VCIA 4PMWA 2AKWB 2KJXA 3BG3A 1K0SA 5M5XH 4AQYL 2R3ZA 1SLJA 1HA6A 2E2HH 2KEEA 1CKNA 2KHIA 2PZWA 4DU9A 3GP7A 1AW7A 1BF4A 4NXNL 4LFAQ 4IURA 2R92B 2VB3X 1IL2A 3K8AA 1KC8C 4NP5A 3IAYA 2NUCA 2B2TA 2KCNA 2HHHL 1U4LA 3L3OC 5IODA 1E3PA 4EVOA 2HDLA 1NAPA 1B70B 3BDOA 2C35B 4LF9L 1STNA 1UE6A 4EQPA 1PRTC 3GTQH 1LTSD 1W6KA 4IJHA 1EWHA 1U0LA 3GD7A 3JAMc 3GQBA 4L6TB 2DGYA 5GADC 1EIYB 1IL8A 1DCZA 1PYBA 5FLXE 3KDFA 1N9WA 1G6ZA 1L0WA 5L37A 3SK4A 1L2FA 2EQSA 1HTPA 5LHY1 2EVBA 2F0OA 3OOCA 4HJ5A 2D0PA 1EYGA 3RN5A 4I7ZC 3SGIA 3EIVA 3ERQA 5IOCA 3D8GA 4DK3C 3PO3G 1F9SA 3F2UA 3VYUA 1V1OA 4FVMA 1X9NA 4MTNA 2BA0A 5ELOA 3JC66 1N33Q 2N55A 3I4OA 3NE5B 2M00A 3DLLA 3FHWA 3SEBA 4APVA 3STBC 3RUZA 4B9XA 3ZYYX 1VQ4A 1U4RA 2WV6D 1X32A 3NBHA 1Y14B 3CCEA 2VY3A 3GTJH 1KD1C 1JE5A 3BVGA 3OWEB 2Q8TA 2Q8IB 3OMCA 4HJAA 2JA5B 2RCFA 1JC7A 1F2MA 1EY9A 1SYBA 1LYLA 1HNWL 3H0GG 4DR3L 5M5WB 1XNRL 1I4RA 3GO5A 1Z47A 4DV2L 1L0YB 3PUXA 1DYQA 3I4MH 1Y8OB 1VQ7A 2FMMA 1B50A 4LF4L 3J81c 2EY1A 1O7LA 1WCMH 4R4IA 1JT8A 2K5NA 2CH4A 2OQ0A 3H3VI 3PIOA 1RJTA 3RLFA 1V8QA 4KN7C 4HIDA 1LLRD 3I70A 4OX9L 2NB0A 1PTOH 2A19A 2A68D 3HZXA 4OONA 1PTOF 2BE5C 1MJCA 2ZXRA 1WOCA 1B2TA 4K6DA 1SBBB 4JW0A 4TKOB 4XYQA 3F2DA 1TWGH 3CU7A 4P71A 3J80i 5CV4A 3S24A 3MXPA 4BBSH 5IP7H 3PF5A 1GUGA 2NZ1D 4GKJQ 2K32A 5M3MB 1LTLA 1A62A 3FKIH 1G2TA 5IGGA 1T5EA 1CA5A 3GTLB 1QWYA 4HCEA 1SYDA 3T53B 3VYSA 2RHSB 4DAPA 1NR4A 1KLGD 5EBDA 3K5MA 2ALYB 1A8VA 4O1NA 4JV5L 2VL6A 4BXXG 2A69C 3OWFA 4FXKC 1Y1VG 3F2CA 3S1NB 1KRTA 4GKKQ 1SN8A 2K52A 2NVXB 1STYA 3KLSA 2E5LL 2DJGC 4QF4A 2EE1A 5CGKA 3OSOA 1A63A 3WOFA 4JI2Q 5IYCH 4C3HH 4B3TQ 4X62L 2E2IH 2D62A 3T16A 5M3FH 3HKZB 4NMZA 1I3QH 3J7AV 2L15A 1N32Q 4MNOA 2PI2E 2K4KA 5JJKA 1TWAB 1Q8KA 4X64Q 5D14A 4C3JB 4L5TA 5T1GA 1EY7A 4A3DG 2F4IA 1VQ5A 2NN6H 2EYOA 2A6ED 1HRJA 1HZCA 5AFWA 3D6CA 3CC2A 1STHA 2NTSA 5IGDA 5C4HA 2IT1A 5C4JB 5KEEA 1AE2A 2KCTA 1Y1WH 4OXPA 4OIJA 2HQEA 4A3IG 4O2DA 1EYCA 1QVFA 4CBVA 3VDYA 1C0AA 4L5QA 4HMJA 1IBKQ 2F0EA 2ICEC 1WTOA 5GAHC 4L5SA 3TQYA 4AQYQ 2KCMA 4DR7L 1CT1D 2B2UA 1WTHA 3A56A 4RGNA 3CCMA 4XDXA 1XJVA 1HFNA 3CRLC 2IL8A 2FMCA 4ZAIA 3QR8A 4JI4L 4NXNQ 3PO2H 3KJOA 5JEAG 2R92G 3PO3H 4NB3A 3EROA 2K33A 4LF6L 2CQOA 3ERSX 1NJIC 1JQYD 2HHHQ 1I5FA 3MFYA 1IHZA 4LF9Q 4NKLA 3J7YW 4V190 1UAPA 2XSCA 3S2HB 1TR5A 2F0GA 4HAEA 4IO9A 3K81C 5ELCA 3OW2A 1GUWA 2LY7A 1ENAA 4A3CG 1M8AA 1U5KA 1VQHA 1CHQD 1QJOA 3QOLA 1EIFA 5F2DA 3G6EA 1Y69U 2YU9H 2B2TC 1N36L 3H0GH 1VQMA 1V1QA 1H9JA 1L1OA 1BBWA 4NXML 1SE4A 2I46A 4Q5VA 4FXDA 1CA6A 1AH9A 2XN9C 5EKIA 2VXWA 1PH1A 4QGUA 3S17B 3MFGA 1GJXA 4RGMA 1EZ8A 1SMYC 2ZXPA 1ASYA 3PUYA 1LTAD 2WAQE 2RHQB 1IKLA 1QVGA 1S5FD 1STEA 4RCOA 3T4AC 3K7UC 3M4OB 3A8KE 2JA5G 1KNEA 5ELDA 1V1PA 5EPJA 1PFMA 4Z9CB 4JBWA 5C0XJ 4DV4L 3KLSX 4LMQD 4RCNA 1HNWQ 1RF2D 3NBIA 4DR3Q 2CWPA 3A0JA 2PW7A 4EQOA 3TS2A 3I91A 2R7DA 2L11A 1XNRQ 4YWMA 4DV2Q 4A3MG 3SXHA 1FYCA 1O7IA 3KYHC 4AYBB 4C1NK 5FLXc 4TVAB 3A5UA 5AJ3L 3CC7A 1PH6A 2F0SA 1Q8IA 2HUGA 1GO3E 3CP0A 4DNRB 4JI6L 3NWTA 2X69A 1XPRA 1PA6A 4LF4Q 2ZJQA 4IFDG 1PRTD 5CV8A 1A0IA 2NZOA 3G4SA 3CHBD 5K36G 1KDBA 2K04A 1Z9FA 3AYHB 2CW0D 4S3SA 2Z1CA 4HJ8A 1A3TA 5LMNW 1HZBA 4QCLA 5G3LF 1D8LA 2AQ2B 3S14H 5IT9L 2XWBB 2EZVA 4OX9Q 1D5XC 1X65A 4BXXH 1MI2A 1EL0A 1Y1VH 3R2TA 1KL9A 2H5XA 2KECA 1D7QA 3HFZB 5LMNL 1WD0A 4KY7A 4HN7A 3MXGA 1QUQA 4A3JG 1M90C 1V9PA 2F0PA 4JVZA 1WYDA 3FEWX 1GVPA 1KHIA 4O0AA 1VQLA 1D1IA 3SDZA 1SJHD 2UXBL 2RSNA 3HOVG 1JWSD 4DUYL 2PPBC 3STBD 2NVYB 4IALA 3WDNA 4UY8C 3MZ5A 3U4ZA 3GV6A 3KF8A 4R4CA 4GNXA 4H13C 1X3QA 4X65L 2PCFB 1LTGD 5E4WC 3TBIB 4A3DH 1S5DD 2BH2A 3TP7A 3GTOB 1LT3D 2I0QA 4JV5Q 1D1KA 3HKSA 3MC0B 4RGOS 3HOYH 3TP8A 2E5LQ 5KNBA 4A3IH 3D6WA 1I4XA 1II3A 3MXNA 1X3PA 4X62Q 2NTTA 1XNQL 2O5JC 1NBWA 3IL8A 1ML0D 1PRTB 1PH3A 4A93B 1ZKOA 3OIQA 4JC0A 2IPKD 4HMIA 1J9OA 2PI2A 1JWMD 4C3JG 1Q1BA 1BOSA 3FPUB 2A73B 3JAMi 3S1MH 3AEVA 2F3WA 3M3YB 4OEMB 3VA7A 5JEAH 2B2YA 2R92H 2E74C 4B08A 1TWCH 2L5TA 1NNXA 1PTOC 4C2MB 3HOZG 1G51A 3K7AH 4BA1I 2H1EA 4KKUA 1Y8PB 4C3IB 2ZT9C 3L7ZC 5FO8B 1Z7TA 4IOCA 1MSHA 1AE3A 5DNFA 1BO0A 4FP5D 2JEAI 4Y7NH 3Q24A 4LJZC 4KHPL 2Y0SE 2JA7B 4LFCL 3IKJA 4DXFA 2LXKA 5FLMG 1ZEQX 2E75C 4DR1L 3VR5A 3EQLC 2KENA 4NDXA 4DR7Q 3PUZA 2F0UA 2OTLA 3LX0A 1D5ZC 3FDTA 2B63B 3HOUB 3ZJYC 4JI4Q 2YTXA 2EYJA 3TS0A 1OXVA 3KF6A 4ZLTF 4LF6Q 4OWTB 2Z0SA 3VYTA 4PMBA 1MHWC 1ZYRC 5DEHA 5FO9B 3OIPA 2B2WA 3TSSA 2BDOA 5KGUA 2A69D 5I9PA 1STAA 4E6IA 2JP1A 1NTGA 3CC4A 2ZJPA 3I56A 1AZQA 1L0XB 1G291 2B2UC 4GKKL 2IJ0A 5EGTA 3QOJA 1TU2B 1VQIA 1F77A 5ELBA 3CCRA 4DNTB 1DOMA 4J1MA 5D3DA 1WTXA 3J81i 5CORA 3WWVA 1N36Q 2VB2X 1PYWD 1TT2A 4L8JA 3RZOH 2XIWA 2N8NA 1W2BA 5M5WH 1E22A 4RHSA 1JB7A 1BCPF 4TSSA 4NXMQ 1EY0A 1K3BC 1OXSC 4A3MH 2HCCA 1X55A 4RMFA 2JA6B 3QIAA 1TY2A 2EJFC 4A3FB 1GOZA 3C1EA 4DV6Q 3VR4A 4BY7H 3A5ZB 2F0DA 4CDCC 4R1JA 5BN5A 1F9RA 3PUWA 5C0XI 2XTIA 3GTKH 5K36H 3KUPA 3Q22A 4HJ9A 3ULLA 2EPBA 5C4XH 3J7A5 4DR6L 4K0KL 3A8JE 3LGJA 4NW2A 1B3AA 4JI0L 1VQPA 1L1OC 3L9AX 1IKMA 2F4VL 4DFAA 2K03A 4DV4Q 5DM63 4JI3L 1LABA 1TWFH 1A15A 2R93G 1WJJA 5KIXA 3S15B 2UXCL 1PVOA 1I6HB 1NMGA 1SNCA 5IYBG 4AYBG 5C5LA 2KCCA 5AJ3Q 4BS9A 4A3JH 1JR0D 4QQBX 4JI6Q 1IYJB 1BXTA 2PMZB 1DM0B 3HOVH 5CR3A 1XTDA 2VW9A 1S72A 1CM9A 4Q0FA 1ASZA 4GOPC 5C4ZA 3NPPA 1JJ2A 4JOIA 5C44B 3EA6A 2TSSA 1WTQA 4RA8A 1BKBA 3DWAA 3M4PA 4H0LC 4DXGA 4QUFA 2OTJA 4WFN3 1G6PA 3E0JA 1YNXA 3M7NA 1HQRD 2NVXH 4KY6A 5C3EB 2EY6A 3OHXC 1HXYD 3NEMA 5IGEA 5LMNQ 4G4KA 1J8IA 4OIKA 5H1SE 3GTGB 3PIPA 1TVXA 1SMYD 2UXBQ 4F87A 1PFNA 4DUYQ 1K3RA 2R7ZB 1VQGA 2OXPA 1PYSB 1P16A 1RIPA 3M9BA 2L1BA 3HRZC 1KRSA 2VQFL 1SYFA 4HIMA 2F0IA 4X65Q 1YHAA 4KKTA 1CUKA 3PCOB 4N8FA 4DV0L 5ELNA 1TWHH 3DEPA 3HOZH 1JJGA 4WORA 1WTPA 1A3VA 3F2BA 3E0EA 5I2XA 4BA2I 3HOXB 4F7XA 2DUDA 2PZTA 2WKDA 2AQ1B 3CAMA 5BR8L 4R9WA 2D9UA 3V2TA 1H9SA 1KTKA 4RKLA 3W5OA 3RZDH 1R9TB 4FXGC 4LWCA 4K8JA 5JJZA 1XNQQ 1XPUA 3J80L 3R2IA 2JA8H 1XWEA 2VZAA 1QB5D 1XXGA 2X6GA 1SROA 3D4RA 2K5QA 3UDXA 1U4PA 1Q3LA 4CGYB 2EY2A 2SEBD 3NQIA 4CKBA 2Q8RE 3FRPB 5IE8A 5J39A 2SOBA 3MTSA 2IHEA 4AH6A 2JSOA 4C3IG 1YEZA 3S2DB 3UDGA 5DM73 1SJED 2IY5B 3S16B 1EY4A 2I07B 1EWIA 2TMPA 3DM3A 4U673 1O78A 2FFKB 4KHPQ 1T5XD 3P1HA 4DPGA 2LS01 3T56B 2JA7G 4LFCQ 3CCSA 2RQXA 1K8OA 5JAVA 2K28A 3K57A 2B2YC 4DR1Q 4QL5A 4YHHL 2WIIB 4BBRG 4IPHA 3BVMA 1MBYA 3BVZA 1ICWA 2B63G 3HOUG 1EQRA 1K8AC 1XTCD 4WJ3M 3BYTB 3SVMA 4CKCA 3Q23A 2KHJA 1IW7C 5J3BA 3GTMH 2LMCB 4I7AA 3CCLA 2FXQA 2E2HB 1Y8NB 4KY5A 1IZ6A 3CPFA 4MN3A 4FF3A 3I90A 3H94A 5IIFA 1PH2A 3TZUA 1V43A 2VUMB 1SXTA 2JJQA 1M1KC 3PGZA 3RMHA 3J81j 3SR1A 1DOKA 1X3FA 2PZUA 1LTRD 1B1ZA 2E2DC 4ZRZA 4RKBA 1E7ZA 2IX3A 4DR4L 3GTQB 1ET9A 1CHPD 3VR6A 2I5HA 4TQUS 4QMGA 2Q2HA 2K01A 1Q1EA 2K14A 4LF5L 3S1QB 2P5ZX 1ESFA 1D5MC 3J7AF 5IP9H 3F8TA 4YY3L 4A3BG 2R93H 3C46A 2B2WC 3LWEA 1MD2D 3HOWB 5EPKA 5HGTA 1WD1A 2MNAA 2AUKA 1EU4A 5CC4A 5IYBH 3RR5A 4PV1C 1JICA 3PIP3 1JORA 5C3WA 3NTIA 4X3KA 2KA7A 5FOBB 4A3FG 1K8GA 2MQHA 3J7ZC 1CZGA 3I3CA 2YTVA 1Q46A 1A2UA 4KD3A 1S4ZA 1GUOA 2JN4A 3E3XA 1OTCA 5BN3A 1S5BD 4N8X1 1ILQA 4QIWB 4K0KQ 2MFIA 4DR6Q 5M5YH 2UUBL 1ZXTA 3BDCA 1K83H 4KMUC 4JI0Q 5IGCA 2E2JB 5C3XA 4P75A 2NN6I 3CCJA 1B4OA 1VS0A 2F4VQ 4DKAC 2K1BA 1RTOA 1QNUA 3W3AA 1AN8A 3GTJB 2KEDA 4JI3Q 2NVQB 4IQZA 3HEJA 4JI8L 3G7LA 4X6AH 3K0XA 3C3LA 2UXCQ 3GV3A 5FJ8G 1IBMQ 3DMUA 4ODGA 2F0KA 2RDFA 4ZCKA 2B39A 1TQOA 1W6JA 4CDDC 2EIFA 2RKSA 1ZYRD 1GUNA 2R61A 2K5DA 4HSPA 1TS3A 3CPWA 1SFOH 1YITA 2QKIC 4FF1A 1PZID 2CQAA 2NVYH 3I4MB 4OO1I 5EKLA 2RF4A 4PMCA 1KQSA 3W2DA 5C44G 2BCOA 2EXDA 2KVMA 1WCMB 3C2PA 3D4DA 4DR2L 1BCPC 3T13A 1OO9B 3NWSA 3H15A 4JG2A 5IT9E 1B53A 2A74C 4ME3A 4LAAA 5C3EG 3FP9A 5EJWA 2BH8A 2ZTCA 1WTVA 4X66Q 1XPOA 2RSOA 3ER0A 2HQLA 5CYUA 2NWGA 3UE1A 1U9RA 4JOIC 2K5WA 1SNDA 1UEAB 1PRTF 4XT1B 3U58A 3PMFA 2IX0A 1U4MA 4DV6L 4FDBA 2R7ZG 5DLQE 1B8AA 4JI1L 1N34Q 1EY6A 4PZ8A 4PG3A 2VQFQ 4BBSB 1PZKD 2EYPA 1NSNS 4MTKA 1VQCA 5EAYA 1CQVA 4DV0Q 2QA4A 2DNCA 3FKIB 4C2MH 2WB1B 1H95A 1QZGA 1K9MC 1JOOA 4C3IH 3OMGA 1O80A 2B2VA 4J15A 4UP9A 4A75A 1GXDC 4IUTA 3HOXG 1K73C 5BR8Q 1SR3A 5ELEA 1TS4A 1IBLL 4IUVA 3K6OA 3G48A 1EFID 2EJGC 3ITPA 1EYAA 2F0LA 3X3MA 2XGTA 2DY8A 3MWYW 4IUNA 1PZJD 4UPAA 4KLKA 4BBRH 2KQ3A 2MHVA 4LUVA 3GTPH 1F9QA 1AP0A 3MEHA 1I4HA 5E3FA 5HY6A 1I50H 2Z9HA 4DV3Q 1Q82C 2E2IB 2Z4HA 5M3FB 1JJCB 5EQ0A 1I3QB 2XRSD 4ABNA 1B7YB 3DM1A 2IW3A 1KAWA 3TP6A 1YNNC 4JBKA 5JJIA 2CHBD 4DV5L 4A3LG 2PYKA 4I65A 1IYVA 2F3IA 1XMOL 4RG1A 2D2CC 4R4QA 1MGSA 2AMCB 3DHQA 3CQZB 4AIMA 1VQAA 4DAYB 4P2CB 2VQEL 1P8LA 1Y1WB 1FJGL 4UHVA 2HD3A 3O13A 4YHHQ 1A6XA 1B9MA 4A3BH 1ILPA 5M3MG 4B3RQ 1VMCA 3URYA 2E8GA 1CKOA 1C48A 4KN4C 5I4DA 3JAML 2V1CC 5COYA 2DN8A 1O7ZA 3D0FA 3SK6A 3CW2C 1QE6A 1YJNA 4GZYC 2VUMG 3PO2B 1NUCA 1CKMA 1PH4A 1FD7D 1B44D 3HG9A 2NVTB 2YTYA 4P73A 1OXUA 1X56A 1SNMA 3DWPA 1S5CD 1LT6D 3A7AB 4MHEA 2RBMA 4DR4Q 4N9TA 4KHVA 4JBMA 2NYZD 3BJUA 4LF8Q 4CDFC 1EWCA 4MIUA 3SHLA 5IYDG 4J8QA 1RTNA 2AQ3B 3OPOA 3L2PA 4FNFA 1FVIA 2UUCL 4LF5Q 4KJOA 5G3LD 4DV1L 2GVBA 1CSQA 1V1PB 3UDIA 3HKZG 4YY3Q 2B29A 2CKZB 1E1OA 1JCKB 4K5WA 3A55A 5CMDA 4GOPB 1PV4A 4XXEA 3HKZE 1JE4A 3HOWG 4LFBL 4IUPA 1VQEA 4X3UA 5FJ8H 1PH8A 4PZ7A 3E6ZX 2YU9B 3S1RB 1VQKA 3I73A 1DGSA 3H0GB 2ZXOA 2ATWA 3T1YL 4A3KB 2YV5A 1IXRA 4JCVE 5IGFA 2EYLA 2KBNA 2G9DA 4G7OC 1QNKA 1JOQA 3KFUA 4LW1A 2XNAC 4CJ1B 2K05A 2BE5D 4LK1C 3OTOQ 2K6AA 2UUBQ 1TXYA 3K5NA 1NE3A 1LTBD 2EXZA 4KV6A 3PV0A 4DN4M 1CQFA 2I5MX 2PQAA 4KD4A 1GUSA 1RHPA 2WKCA 4X3TA 4A3CH 2A1AA 3J81L 2MPMA 1VQDA 4IZ8A 2F0HA 3T1HL 3DUZA 1E2VA 4JI8Q 4IPCA 2EYMA 2F0WA 2ASBA 5C3EH 5E4XA 1IW7D 1SNOA 3LWUA 1SEBD 4GN5A 3MXUA 1GM5A 4UDUC 2RVLA 1EQTA 2VNUD 1QUQB 3U50C 2G9HD 4B3SL 4BY1B 3I55A 4FO2A 1NY4A 3K5OA 3I4MG 1UE1A 1TKWB 2JQOA 3BDLA 1AFPA 1WTWA 1DONA 5DAUA 3BU2A 3KBXA 5KYLA 5J1ZA 3KF8B 2EYHA 3Q8DA 4GLAC 1YBYA 4DR2Q 1HUNA 4ZK9B 5A35A 4WRDA 4ZUJA 1EEID 4YCUA 4CHTB 2JA5H 3KOJA 1X54A 1FGUA 3PQIA 4X3SA 1VDZA 3K0YA 2QGQA 2JE6I 5IGBA 3PSIA 2RA4A 1G8ZD 4A3EB 1I94L 1R9TH 1YHBA 4DNIA 1CTMA 1PXUA 4P72A 2CH4W 1SE8A 4LF7L 1Y1VB 5I6WA 1YIJA 1E0BA 3MA2B 1FR3A 2HIVA 3I4NB 3EVQA 2Q2UA 1WTRA 2L4NA 3EN2A 1VF7A 1HUMA 4IFDH 3CKIB 1I4GA 4JI1Q 1WFQA 2L0CA 2EOTA 5JPNC 3A54A 4MZ9A 1G2SA 3TN2A 5T1IA 1LTTD 2C9OA 2HDMA 3P20A 2WB1G 2PNRC 1Q90A 1UEBA 2BA1A 4HR7B 3MVVA 5GROA 1VQFA 2CFMA 4A3LH 1EQVA 4M8AA 3D31A 3PUVA 3EJIA 4IUQA 1IBLQ 5ISRA 1SYEA 4G7ZC 4JI5Q 3I72A 1KAAA 4EQ5A 4UP8A 2LKVA 2G5DA 3DWQA 4C56C 3E9HA 3SK8A 1TS2A 2MO1A 5CV6A 3Q6SA 1IBML 1H9KA 3HOYB 3VR3A 1I4QA 1BR9A 1VMPA 4ZQ3A 4AYBE 4A3IB 4K14A 1BBUA 5M3MH 1ESRA 2B2VC 1BUVT 1DD2A 2IX1A 3J80E 1HNZL 5M3FG 5IT9c 3GTLH 2LSSA 5E7NA 2NZHA 1RKNA 4ID6A 1F2ZA 1UE5A 5FO7B 4GLVB 3KF6B 4KK7A 1VQ9A 2PNHA 5LMUL 2DJFC 2MUYA 3S1MB 1BCPD 2VUMH 2RDGA 1HPCA 4B9WA 4DV5Q 2HCIA 3RN2A 2QILA 4JK1C 1TWCB 3IFTA 1D6EC 2NN6G 1XMOQ 2F0VA 2K5VA 3K7AB 4DK0A 1CI3M 1XYIA 3S1NH 3CF5A 5EKKA 2FHTA 2KUMA 5CBAE 1E1TA 1C4QA 1EY5A 2VQEQ 5IYDH 4Y7NB 1SNQA 1Y1WG 3Q0AA 1FJGQ 2CW0C 4X66L 2RCNA 1EOVA 1F2LA 3S1QH 3MAQA 5NUCA 2FINB 1SDFA 3M7GA 4A3GB 4XTCS 3R8BA 2VS1A 4DUZQ 5EBCA 5JOBA 1FL0A 3HOWH 1KDAA 1TWAH 1BBXC 4C3JH 4UP7A 1HQMC 1B9NA 1N34L 2OT2A 3A7LA 4OO1G 2ICIA 4CDEC 3PO2G 5C6AA 1XX8A 2N49A 2XRQD 2F1MA 4GN3B 5C4JH 1TS5A 5D3IB 3DXJC 1PH9A 2WAQB 4C1NI 3I7FA 4B3ML 4POGA 4RH6A 2E2JH 2UU9L 1Q12A 2UXDL 3H09A 4GNXC 2UUCQ 5FLMH 4DV1Q 3AFQA 2L55A 4NPSA 2NVQH 4A93G 4LFBQ 1PFSA 1R4QB 3D3RA 4IN3A 4JYAL 1YVCA 4DV3L 1VQJA 3ND8A 2OEOA 2R6GA 2WP8J 1LV9A 2ZTDA 1X3EA 1CKNB 2CWAA 2EJMA 2N78A 1BCPB 1YNND 2ENBA 4V0BA 3RZOB 3T1YQ 4A3KG 3F1ZA 4DR5L 4A3MB 3H3VH 4DK6C 3BYYB 1QG7A 2Z4IA 2ID0A 5D65A 4QJFA 1MKHA 2GVAA 4YWLA 3S2HH 4R4TA 4BY7B 2FJ2A 1BQQT 1DOLA 2QEJC 3GTKB 1A3UA 4G7HC 2SNMA 5FLXL 1STBA 1H9RA 3MEFA 4FYDA 1OXTA 2GA4B 3U9SA 5C4XB 1JOKA 3T1HQ 3NP8A 3KDFB 5KNCA 3BS1A 1J5EL 4K5XA 5JVH3 3ND9A 4B3RL 2J4XA 4KJNA 1SE3A 1IYUA 2DNEA 3BZCA 5IWAQ 1UNSA 4LUZA 1TWFB 2N3SA 3M4QA 5M5XB 1DZ1A 1HA5A 1HR0W 2F0FA 3U9OA 4CJ0B 3CCVA 4BY1G 4B3SQ 3S17H 2J0TD 1EYDA 4A3JB 1BNZA 3ULJA 4HCSA 1KXLA 2K50A 1EQQA 2QF7A 3EFXD 1GD7A 3HOVB 1E24A 1EUJA 1KIXA 1EOTA 3TDQA 4DF7A 5J22A 3L0OA 1LUZA 3NBHB 2Z8LA 1Q7YC 5ELFA 4LF8L 3M4OH 2JYOA 3VA5A 1HR0L 2N88A 2QCPX 4QB4A 2M2LA 2D5DA 1STGA 2XWJB 4IPGA 3CXCA 2ZM6L 1YNJC 2LXJA 4OL7A 2F03A 4A4IA 2PW5A 4A3EG 1I94Q 1FNVA 1AZPA 4QY7A 1EIGA 4DAVA 1SSOA 1Z6HA 1VQ6A 2ZTEA 1H9SB 4LF7Q 2JA9A 1Q81C 4DGZA 1K8MA 1PTOD 2QDLA 4DAMA 2JA6G 1HH2P 2AWNA 3I4NG 4A76A 4OWWB 1UUPA 5BN4A 5GAGC 2HIXA 2A6HC 1RODA 3G6JB 2JXMB 4R4OA 1S5ED 3CCQA 2DY7A 1HNXL 3X3NA 5M9OA 3BZDB 3OTOL 3IRBA 1EY8A 4YCVA 2O2LD 4PZ6A 1NR2A 1A2TA 1TWHB 3HOZB 4OELB 1HZAA 3P7JA 3N52A 1XMQL 1RCVD 3FPPA 3CQZH 2MP1A 2Q2TA 2KOLA 2Y0SB 5GQOA 3VR2A 2CVRA 1UWVA 3HOYG 2O5IC 1D2BA 3KLRA 5JEAJ 3RZDB 3NXWA 2AUJD 2O4XA 1NMFA 3A8IE 4N9PA 4ZUIA 1PFBA 1JWUD 1HNZQ 2JA8B 1J6QA 2PMZE 4YCWA 1CZWA 1E2WA 1RDPD 4OO1H 5KNDA 5LMUQ 3C1FA 1QOHA 2JEBI 3KJPA 3GTOH 1VQ8A 2Q2IA 1X6OA 3CCUA 2NVTH 4L63B 1ENCA 3NQTA 3NENA
chains in the Genus database with same CATH topology
2LFNA 4K2KA 1LT4D 3SE0A 3QO2A 4XT3B 3PIO3 1PTOB 3NTKA 1SYGA 2AWOA 4DAYA 1HTLD 4K6LA 4M1UB 1PMRA 2J7ZA 1F2YA 4PQXA 1H9MA 4TRDA 4G57A 1TWGB 2MGSA 2F0TA 5LL6X 1NCVA 4O42A 4R8NA 1AEXA 3SK5A 5C5MA 3JAME 1LTID 3GTMB 4KTAA 3VYRA 4OHJA 2L9HA 1RD9D 4ZYSA 3R93A 1BDOA 1EZ6A 4XQQA 1KLUD 3I4LA 1ET6A 4ZKBB 4ULLA 5KYIA 3AU7A 5FKAC 4KI0A 3KK7A 2WINB 1OXXK 4F88A 1LO5D 5CBEE 3E5SA 2EDGA 3TZDA 4IFDJ 2SDFA 5CV7A 4C3HB 5C0XG 3TP5A 1GHKA 2R93B 4CKEA 4QUCA 3KBGA 1VF5C 3V96A 2C5CA 2V4DA 4RGTA 5A2QE 5I6YA 4XIGS 1HFGA 4HSVA 2F0MA 1KABA 3HP3A 5JPMC 1FGBD 2SNSA 3FVQA 4UAIA 4KKSA 2EY5A 4XYOA 2F3VA 3NUCA 5M5YB 2F0QA 5E1FA 1K83B 1DXMA 1PLFA 4DA2A 3D4WA 1MSGA 4ZKCB 2MJ8A 4PNYA 4BWGB 4DK1A 2BOSA 4H7BA 1KDCA 4R8IA 3J81E 2PO4A 3AB9A 3K58A 1R4PB 3H91A 1E2ZA 1SE2A 2A68C 3WOEA 1QILA 1EU3A 1SNPA 3N6RA 4CJ2C 2XVSA 4RWSC 4ME5A 3PO3B 1EEFD 3TMEA 3QG1A 3I8ZA 5I9OA 1M4VA 5I2YA 1SFOB 1I4PA 3H6MA 4RFBA 4RHRA 1PDQA 1FNUA 1TY0A 1HHVA 2B8FA 4H44C 3H3VC 3R3OA 5A2QL 3K59A 4HEDA 1CK1A 1HCZA 3NTHA 1QCBD 3MHBA 3HGBA 2BDNA 2F0NA 4XQJA 5EPLA 3K5LA 4U68A 5LL6S 2KHSA 2A6EC 2IWHA 2M9VA 4K5VA 1CFMA 5JVG3 1TIID 3QB3A 1G91A 4KHZA 3AMUA 5HURA 2NBFA 5KRUA 1DJRD 4WJWA 2YYZA 2RDHA 1I6VC 2H4OA 3HS0C 4F8MA 2B8GA 4OGQC 4BBRB 3M85A 3GTPB 1JB3A 1I50B 2EYFA 4IUUA 1LACA 5K5PA 4EGVA 1O7YA 1FNWA 5CV9A 2F0JA 1YNJD 4RAUC 1GUTA 3S9WA 3OW7A 3S14B 3CRKC 3V05A 2OF1A 3P75A 1C8CA 2WACA 3NSWA 2L12A 5FK9C 1ENFA 5CV5A 2A6HD 3M4YA 3ONAB 3T51B 1ONLA 2K7VA 2PQEA 5C0XH 4YIJA 4XQNA 4A3BB 3UI2A 3NHHA 1F9PA 2QDBA 1SYCA 5TSSA 4FF4A 1SAPA 3LNNA 4A3DB 1KNAA 3NK9A 4IFDI 4K2LA 1GHJA 4K8IA 3DEOA 4HTHA 4ILWA 3IFDA 1EIHA 3QWNA 3FMCA 3QJYA 4FF2A 1WVLA 2A5HA 4EQNA 1LT5D 4J6HA 4C3HG 3RD4A 2E76C 2X6LA 1VCIA 4PMWA 2KJXA 3BG3A 2R3ZA 1HA6A 2KEEA 4DU9A 2PZWA 3GP7A 1AW7A 1BF4A 4IURA 2R92B 2VB3X 4NP5A 3IAYA 2NUCA 2B2TA 2KCNA 1U4LA 3L3OC 5IODA 4EVOA 2HDLA 1NAPA 3BDOA 1STNA 4EQPA 1PRTC 1LTSD 1W6KA 1EWHA 3GD7A 3GQBA 4L6TB 1IL8A 1DCZA 5FLXE 1G6ZA 3SK4A 1HTPA 5LHY1 2EVBA 2F0OA 3OOCA 4I7ZC 3ERQA 5IOCA 3D8GA 1F9SA 3F2UA 3VYUA 1V1OA 4FVMA 2BA0A 2N55A 3NE5B 2M00A 3SEBA 3RUZA 4B9XA 3ZYYX 1U4RA 2WV6D 1X32A 3NBHA 3BVGA 3OWEB 2Q8TA 2Q8IB 3OMCA 2JA5B 1JC7A 1F2MA 1EY9A 1SYBA 5M5WB 1I4RA 3GO5A 1Z47A 1L0YB 3PUXA 1DYQA 1Y8OB 2FMMA 1B50A 2EY1A 1O7LA 1RJTA 3RLFA 1V8QA 4KN7C 1LLRD 3I70A 2NB0A 1PTOH 2A68D 3HZXA 1PTOF 2BE5C 2ZXRA 1B2TA 4K6DA 1SBBB 4XYQA 4TKOB 3CU7A 5CV4A 3MXPA 1GUGA 2NZ1D 2K32A 5M3MB 1G2TA 5IGGA 1T5EA 1CA5A 3GTLB 1QWYA 4HCEA 1SYDA 3T53B 3VYSA 4DAPA 1NR4A 1KLGD 5EBDA 3K5MA 4O1NA 2A69C 3OWFA 4FXKC 3S1NB 2NVXB 1STYA 3KLSA 4QF4A 2EE1A 5CGKA 3OSOA 3WOFA 2D62A 3T16A 3HKZB 4NMZA 3J7AV 1TWAB 5D14A 4C3JB 5T1GA 1EY7A 2F4IA 2NN6H 2EYOA 2A6ED 1HRJA 5AFWA 3D6CA 1STHA 2NTSA 5IGDA 5C4HA 2IT1A 5C4JB 5KEEA 4OIJA 2HQEA 1EYCA 4CBVA 4HMJA 2F0EA 2ICEC 1WTOA 1CT1D 2B2UA 3A56A 4RGNA 1HFNA 4XDXA 3CRLC 2IL8A 2FMCA 4ZAIA 5JEAG 3EROA 2K33A 1JQYD 3MFYA 1IHZA 4NKLA 3J7YW 4V190 1UAPA 2XSCA 3S2HB 1TR5A 2F0GA 4HAEA 5ELCA 1GUWA 2LY7A 1ENAA 1M8AA 1CHQD 1QJOA 3QOLA 5F2DA 1Y69U 2B2TC 1H9JA 1SE4A 2I46A 4Q5VA 4FXDA 1CA6A 2XN9C 5EKIA 2VXWA 3S17B 3MFGA 1GJXA 4RGMA 1EZ8A 1SMYC 2ZXPA 3PUYA 1LTAD 1IKLA 1S5FD 1STEA 4RCOA 3T4AC 3M4OB 3A8KE 1KNEA 5ELDA 1V1PA 5EPJA 1PFMA 4Z9CB 4JBWA 5C0XJ 3KLSX 4LMQD 4RCNA 1RF2D 3NBIA 2PW7A 4EQOA 3I91A 2L11A 3SXHA 1FYCA 4AYBB 4C1NK 2F0SA 1Q8IA 2HUGA 4DNRB 3NWTA 2X69A 4IFDG 1PRTD 5CV8A 3CHBD 5K36G 1KDBA 2K04A 2CW0D 4S3SA 2Z1CA 1A3TA 4QCLA 5G3LF 2AQ2B 5IT9L 2XWBB 2EZVA 1D5XC 1MI2A 1EL0A 3R2TA 2KECA 1WD0A 4KY7A 4HN7A 3MXGA 2F0PA 3FEWX 1D1IA 3SDZA 1SJHD 2RSNA 1JWSD 2PPBC 2NVYB 4IALA 3WDNA 3MZ5A 3GV6A 3KF8A 4H13C 1X3QA 2PCFB 1LTGD 5E4WC 3TBIB 1S5DD 3TP7A 3GTOB 1LT3D 1D1KA 3MC0B 4RGOS 3TP8A 5KNBA 3D6WA 1I4XA 1II3A 3MXNA 1X3PA 2O5JC 2NTTA 3IL8A 1ML0D 1PRTB 4A93B 1ZKOA 3OIQA 2IPKD 4HMIA 1J9OA 1JWMD 4C3JG 1Q1BA 1BOSA 3FPUB 2A73B 3M3YB 2F3WA 3VA7A 5JEAH 2B2YA 2E74C 4B08A 2L5TA 1PTOC 4C2MB 4BA1I 2H1EA 4KKUA 1Y8PB 4C3IB 2ZT9C 3L7ZC 5FO8B 1Z7TA 1MSHA 5DNFA 1BO0A 4FP5D 2JEAI 3Q24A 4LJZC 2JA7B 3IKJA 4DXFA 1ZEQX 2E75C 3VR5A 3EQLC 4NDXA 3PUZA 2F0UA 3LX0A 1D5ZC 3FDTA 2B63B 3HOUB 2EYJA 1OXVA 4ZLTF 3VYTA 4PMBA 1ZYRC 5DEHA 5FO9B 3OIPA 2B2WA 3TSSA 2BDOA 5KGUA 2A69D 5I9PA 1STAA 4E6IA 2JP1A 1AZQA 1L0XB 1G291 2B2UC 2IJ0A 5EGTA 3QOJA 1TU2B 1F77A 5ELBA 4DNTB 1DOMA 4J1MA 5D3DA 1WTXA 5CORA 2VB2X 1PYWD 1TT2A 4L8JA 2XIWA 4RHSA 1BCPF 4TSSA 1EY0A 1OXSC 2HCCA 2JA6B 3QIAA 1TY2A 2EJFC 4A3FB 1GOZA 3C1EA 3VR4A 2F0DA 5C0XI 5BN5A 1F9RA 3PUWA 5K36H 3KUPA 3Q22A 2EPBA 3A8JE 4NW2A 1B3AA 3L9AX 1IKMA 4DFAA 2K03A 5DM63 1LABA 1A15A 5KIXA 3S15B 1I6HB 1SNCA 5C5LA 2KCCA 4BS9A 1JR0D 1BXTA 2PMZB 1DM0B 5CR3A 1CM9A 4Q0FA 5C4ZA 3NPPA 5C44B 3EA6A 2TSSA 1WTQA 4RA8A 3DWAA 4H0LC 4DXGA 4QUFA 4WFN3 3E0JA 3M7NA 1HQRD 4KY6A 5C3EB 2EY6A 3OHXC 1HXYD 5IGEA 4G4KA 1J8IA 4OIKA 3GTGB 1TVXA 1SMYD 4F87A 1PFNA 2R7ZB 2OXPA 2L1BA 3HRZC 1SYFA 2F0IA 4KKTA 3DEPA 4WORA 1WTPA 1A3VA 5I2XA 4BA2I 3HOXB 4F7XA 2PZTA 2WKDA 2AQ1B 4R9WA 2D9UA 3V2TA 1H9SA 1KTKA 4RKLA 1R9TB 4FXGC 4K8JA 5JJZA 3J80L 3R2IA 1XWEA 1QB5D 1XXGA 2X6GA 3D4RA 2K5QA 1U4PA 1Q3LA 4CGYB 2EY2A 2SEBD 3NQIA 4CKBA 2Q8RE 3FRPB 5J39A 2SOBA 3MTSA 2JSOA 4C3IG 3S2DB 5DM73 1SJED 3S16B 1EY4A 2I07B 2TMPA 4U673 1O78A 2FFKB 1T5XD 3P1HA 2LS01 3T56B 1K8OA 2RQXA 5JAVA 2K28A 3K57A 2B2YC 2WIIB 3BVMA 1MBYA 3BVZA 1ICWA 1XTCD 3BYTB 3SVMA 4CKCA 3Q23A 1IW7C 2LMCB 2E2HB 1Y8NB 4KY5A 4MN3A 4FF3A 3I90A 3H94A 5IIFA 3TZUA 1V43A 2VUMB 1SXTA 3RMHA 3SR1A 1DOKA 2PZUA 1LTRD 1B1ZA 2E2DC 4ZRZA 4RKBA 2IX3A 3GTQB 1ET9A 1CHPD 3VR6A 4TQUS 4QMGA 2K01A 1Q1EA 3S1QB 1ESFA 1D5MC 3J7AF 3C46A 2B2WC 3LWEA 1MD2D 3HOWB 5EPKA 5HGTA 1WD1A 2AUKA 1EU4A 5CC4A 4PV1C 1JICA 3PIP3 1JORA 5C3WA 3NTIA 4X3KA 2KA7A 5FOBB 1CZGA 3I3CA 1A2UA 4KD3A 1S4ZA 1GUOA 5BN3A 1S5BD 1ILQA 4QIWB 1ZXTA 3BDCA 4KMUC 5IGCA 2E2JB 5C3XA 2NN6I 1B4OA 2K1BA 1RTOA 1QNUA 3W3AA 1AN8A 3GTJB 2KEDA 2NVQB 4IQZA 3HEJA 3G7LA 3C3LA 3GV3A 3DMUA 4ODGA 2F0KA 2RDFA 2B39A 1TQOA 1W6JA 2RKSA 1ZYRD 1GUNA 2R61A 2K5DA 4HSPA 1TS3A 2QKIC 4FF1A 1PZID 2CQAA 3I4MB 4OO1I 5EKLA 4PMCA 3W2DA 2BCOA 2KVMA 1WCMB 3C2PA 3D4DA 1BCPC 3T13A 1OO9B 3NWSA 5IT9E 1B53A 2A74C 4LAAA 5EJWA 1WTVA 2RSOA 5CYUA 2NWGA 1U9RA 2K5WA 1SNDA 1UEAB 1PRTF 4XT1B 3PMFA 2IX0A 1U4MA 1EY6A 4BBSB 1PZKD 2EYPA 1NSNS 1CQVA 2DNCA 3FKIB 2WB1B 1JOOA 3OMGA 1O80A 2B2VA 1GXDC 4IUTA 5ELEA 1TS4A 4IUVA 3K6OA 1EFID 2EJGC 3ITPA 1EYAA 2F0LA 3X3MA 2DY8A 3MWYW 4IUNA 1PZJD 2KQ3A 2MHVA 1F9QA 1AP0A 3MEHA 1I4HA 5E3FA 2E2IB 2Z4HA 5M3FB 5EQ0A 1I3QB 2XRSD 4ABNA 3DM1A 2IW3A 3TP6A 1YNNC 2CHBD 2PYKA 4I65A 1IYVA 2D2CC 1MGSA 3DHQA 3CQZB 4P2CB 1Y1WB 3O13A 1A6XA 1B9MA 1ILPA 1VMCA 3URYA 1C48A 4KN4C 5I4DA 3JAML 5COYA 2DN8A 1O7ZA 3SK6A 1QE6A 4GZYC 3PO2B 1NUCA 1FD7D 1B44D 3HG9A 2NVTB 1OXUA 1SNMA 3DWPA 1S5CD 1LT6D 3A7AB 4MHEA 2RBMA 4N9TA 4KHVA 2NYZD 1EWCA 4MIUA 3SHLA 4J8QA 1RTNA 2AQ3B 3OPOA 4FNFA 4KJOA 5G3LD 1V1PB 1JCKB 4K5WA 3A55A 5CMDA 4XXEA 1JE4A 4IUPA 4X3UA 3E6ZX 2YU9B 3S1RB 3I73A 3H0GB 2ZXOA 4A3KB 5IGFA 2EYLA 2G9DA 4G7OC 1QNKA 1JOQA 2XNAC 4CJ1B 2K05A 2BE5D 4LK1C 2K6AA 3K5NA 1LTBD 2EXZA 4KV6A 3PV0A 4DN4M 1CQFA 4KD4A 1GUSA 1RHPA 2WKCA 4X3TA 3J81L 2MPMA 4IZ8A 2F0HA 3DUZA 1E2VA 2EYMA 2F0WA 5E4XA 1IW7D 1SNOA 3LWUA 1SEBD 3MXUA 4UDUC 2RVLA 1EQTA 2VNUD 2G9HD 4BY1B 4FO2A 3K5OA 1TKWB 1DONA 3BDLA 1AFPA 1WTWA 5DAUA 3KBXA 5KYLA 5J1ZA 2EYHA 1HUNA 4ZK9B 5A35A 4WRDA 4ZUJA 1EEID 4CHTB 4X3SA 1VDZA 3K0YA 2JE6I 5IGBA 2RA4A 1G8ZD 4A3EB 1CTMA 1PXUA 1Y1VB 5I6WA 1E0BA 3MA2B 1FR3A 3I4NB 3EVQA 1WTRA 2L4NA 1VF7A 1HUMA 4IFDH 3CKIB 1I4GA 2L0CA 2EOTA 5JPNC 3A54A 3TN2A 1G2SA 5T1IA 1LTTD 2C9OA 2HDMA 3P20A 2PNRC 1Q90A 2BA1A 4HR7B 3MVVA 1EQVA 4M8AA 3D31A 3PUVA 3EJIA 4IUQA 5ISRA 1SYEA 4G7ZC 3I72A 1KAAA 2LKVA 3DWQA 4C56C 3SK8A 1TS2A 5CV6A 3Q6SA 1H9KA 3HOYB 3VR3A 1I4QA 1BR9A 1VMPA 4ZQ3A 4A3IB 4K14A 1ESRA 2B2VC 1BUVT 1DD2A 2IX1A 3J80E 1RKNA 4ID6A 1F2ZA 5FO7B 4KK7A 2MUYA 3S1MB 1BCPD 2RDGA 1HPCA 4B9WA 2HCIA 2QILA 4JK1C 1TWCB 3IFTA 1D6EC 2NN6G 2F0VA 3K7AB 4DK0A 1CI3M 1XYIA 5EKKA 2FHTA 2KUMA 5CBAE 1C4QA 1EY5A 4Y7NB 1SNQA 3Q0AA 2CW0C 1F2LA 3MAQA 5NUCA 2FINB 1SDFA 3M7GA 4A3GB 4XTCS 3R8BA 5EBCA 5JOBA 1KDAA 1BBXC 1HQMC 1B9NA 2OT2A 3A7LA 4OO1G 2ICIA 5C6AA 1XX8A 2XRQD 2F1MA 1TS5A 5D3IB 3DXJC 2WAQB 4C1NI 4RH6A 1Q12A 3H09A 2L55A 1R4QB 3D3RA 4IN3A 3ND8A 2OEOA 2R6GA 2WP8J 1LV9A 2EJMA 1BCPB 1YNND 2ENBA 4V0BA 3RZOB 4A3MB 3BYYB 1QG7A 2Z4IA 2ID0A 5D65A 4BY7B 2FJ2A 1BQQT 1DOLA 2QEJC 3GTKB 1A3UA 4G7HC 2SNMA 5FLXL 1STBA 1H9RA 4FYDA 1OXTA 2GA4B 3U9SA 5C4XB 1JOKA 3NP8A 5KNCA 3BS1A 4K5XA 5JVH3 3ND9A 2J4XA 4KJNA 1SE3A 1IYUA 2DNEA 1UNSA 1TWFB 5M5XB 1DZ1A 1HA5A 2F0FA 3U9OA 4CJ0B 2J0TD 1EYDA 4A3JB 1BNZA 4HCSA 2QF7A 3EFXD 3HOVB 1EOTA 3TDQA 4DF7A 5J22A 2Z8LA 5ELFA 2JYOA 3VA5A 4QB4A 2N88A 2QCPX 2M2LA 2D5DA 1STGA 2XWJB 1YNJC 2F03A 4OL7A 2PW5A 1FNVA 1AZPA 1EIGA 4DAVA 1SSOA 1Z6HA 1H9SB 4DGZA 1K8MA 1PTOD 2AWNA 1UUPA 5BN4A 2A6HC 1RODA 3G6JB 2JXMB 1S5ED 2DY7A 3X3NA 5M9OA 3BZDB 1EY8A 2O2LD 1NR2A 1A2TA 1TWHB 3HOZB 3P7JA 3N52A 1RCVD 3FPPA 2MP1A 2KOLA 2Y0SB 3VR2A 2CVRA 2O5IC 1D2BA 3KLRA 5JEAJ 3RZDB 3NXWA 2AUJD 2O4XA 3A8IE 4N9PA 4ZUIA 1PFBA 1JWUD 2JA8B 1CZWA 1E2WA 1RDPD 4OO1H 5KNDA 3C1FA 1QOHA 2JEBI 4L63B 1ENCA 3NQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3W A;  2HQE A;  1EY6 A;  4RKL A;  4K2K A;  4PNY A;  5JOB A;  1KDA A;  3SXH A;  2EYP A;  5HGT A;  1NSN S;  1EYC A;  4NP5 A;  2RBM A;  4F8M A;  2NUC A;  4N9T A;  5CC4 A;  4KHV A;  4H7B A;  1KDC A;  4HMJ A;  5C3W A;  2F0S A;  2F0E A;  4EVO A;  4K8J A;  4MIU A;  3SHL A;  4DF7 A;  5IOD A;  5J22 A;  2PW7 A;  5I6W A;  1JOO A;  2EYF A;  1STN A;  3OMG A;  4EQP A;  4DFA A;  3HZX A;  1SYG A;  5C6A A;  5CV8 A;  1A2U A;  4KD3 A;  4KJO A;  4QB4 A;  3VA5 A;  3EVQ A;  1KDB A;  1STG A;  5K5P A;  1SNP A;  5KIX A;  1JOR A;  1F2Y A;  4S3S A;  4K5W A;  1A3T A;  4ME5 A;  5CV9 A;  2F0J A;  4OL7 A;  2EY2 A;  1SNC A;  2PW5 A;  4K6D A;  3ERO A;  4TRD A;  3TME A;  3BDC A;  4G57 A;  3S9W A;  3ITP A;  1EYA A;  2F0L A;  5C5L A;  2SOB A;  5J39 A;  5IGC A;  2F0T A;  5I9O A;  5C3X A;  5CV4 A;  1IHZ A;  3MXP A;  2OF1 A;  4IUN A;  3P75 A;  4R8N A;  3SK4 A;  1AEX A;  3MVV A;  4NKL A;  3SK5 A;  4DGZ A;  5C5M A;  2F0O A;  4NDX A;  5CR3 A;  5IGG A;  1EQV A;  2KQ3 A;  5IGF A;  3H6M A;  1EY4 A;  2F0U A;  2EYL A;  3MEH A;  1SYD A;  3LX0 A;  2WAC A;  3HEJ A;  5E3F A;  1TR5 A;  4KTA A;  2F0G A;  3ERQ A;  5CV5 A;  3D8G A;  3EJI A;  5IOC A;  5ISR A;  1SYE A;  3P1H A;  1JOQ A;  5C4Z A;  2EYJ A;  1KAA A;  3DMU A;  4KY7 A;  1EZ6 A;  2OEO A;  2PQE A;  2LKV A;  2F0K A;  4ODG A;  1ENA A;  2RDF A;  1TQO A;  2F0P A;  5JAV A;  5M9O A;  3TP6 A;  3SK8 A;  4YIJ A;  2EXZ A;  4KV6 A;  4PMB A;  3R3O A;  5CV6 A;  5DEH A;  2RKS A;  1EY8 A;  2ENB A;  3NHH A;  3QOL A;  5F2D A;  5KGU A;  3OWF A;  2QDB A;  4KD4 A;  2M00 A;  5I9P A;  1STA A;  5KYI A;  4E6I A;  3RUZ A;  4B9X A;  4ZQ3 A;  4K14 A;  2PYK A;  4IZ8 A;  4I65 A;  4IAL A;  3MZ5 A;  2F0H A;  1A2T A;  1STY A;  4KY6 A;  5EKL A;  1SYC A;  2EYM A;  2EY6 A;  2F0W A;  4PMC A;  4QF4 A;  3DHQ A;  3E5S A;  5CGK A;  3NK9 A;  5IGE A;  3OSO A;  4K2L A;  1RKN A;  4ID6 A;  1F2Z A;  3OMC A;  5CV7 A;  1SNO A;  5EGT A;  3QOJ A;  3MHB A;  3TP7 A;  4KY5 A;  3D4D A;  1A3U A;  3T16 A;  4K8I A;  3TP5 A;  1F2M A;  5IIF A;  1EY9 A;  2SNM A;  4HTH A;  4NMZ A;  1STB A;  1SYB A;  1EZ8 A;  2F0N A;  4J1M A;  3T13 A;  4B9W A;  3NXW A;  3SR1 A;  2O4X A;  2OXP A;  1TT2 A;  1JOK A;  5I6Y A;  2PZU A;  2F0V A;  3TP8 A;  3BDL A;  3NP8 A;  4N9P A;  4ZUI A;  1EY7 A;  1SYF A;  4RKB A;  5DAU A;  4LAA A;  2F0I A;  4K5X A;  1EY0 A;  2F0M A;  4EQN A;  1II3 A;  2KHS A;  5KYL A;  2EYO A;  4J6H A;  4KJN A;  5EKK A;  3D6C A;  5J1Z A;  5IGB A;  2EYH A;  4QMG A;  3SK6 A;  1EY5 A;  1KAB A;  1STH A;  4WOR A;  5IGD A;  1SNQ A;  1A3V A;  5C4H A;  1U9R A;  3C1E A;  2SNS A;  4WRD A;  4ZUJ A;  4K5V A;  3C1F A;  2EY1 A;  2F0D A;  3QB3 A;  1SND A;  4F7X A;  2PZT A;  5KEE A;  1NUC A;  2EY5 A;  2F0F A;  2F3V A;  5NUC A;  3NUC A;  4HMI A;  3PMF A;  2F0Q A;  2PZW A;  3U9O A;  5E1F A;  4DU9 A;  5HUR A;  3NQT A;  1EYD A;  4EQO A;  3D4W A;  5KRU A;  1ENC A;  3V2T A;  1SNM A; 
#chains in the Genus database with same CATH topology
 2LFN A;  3GDE A;  4K2K A;  1LT4 D;  4P74 A;  3SE0 A;  2JK8 A;  2HT1 A;  3QO2 A;  3PF4 A;  4XT3 B;  3PIO 3;  1PTO B;  3NTK A;  1SYG A;  4JI7 L;  2AWO A;  4DAY A;  1HTL D;  4K6L A;  4M1U B;  1PMR A;  2J7Z A;  2UUA L;  2Z6K A;  4H02 A;  4A3G G;  1F2Y A;  2CCZ A;  1PHJ A;  4A93 H;  4PQX A;  2ES2 A;  1H9M A;  4TRD A;  1BVS A;  4G57 A;  1TWG B;  2MGS A;  2F0T A;  3S1R H;  5LL6 X;  1NCV A;  4O42 A;  3M3Y H;  4R8N A;  1RL2 A;  1AEX A;  3SK5 A;  4A3K H;  5C5M A;  3ULP A;  3JAM E;  4L5R C;  2I5L X;  1LTI D;  3GTM B;  4KTA A;  3VYR A;  4OHJ A;  1MJE A;  4IPD A;  2L9H A;  2WAQ G;  1RD9 D;  3J80 c;  4ZYS A;  3R93 A;  1BDO A;  4B3M Q;  1EZ6 A;  1MIU A;  4XQQ A;  1WI5 A;  1KLU D;  4JI5 L;  5JJL A;  1YHQ A;  2UU9 Q;  3I4L A;  1ET6 A;  2JA7 H;  4ZKB B;  2UXD Q;  4ULL A;  5KYI A;  1GKH A;  1SRU A;  3AU7 A;  5FKA C;  4KI0 A;  3KK7 A;  2WIN B;  1OXX K;  4F88 A;  1LO5 D;  1YJW A;  5CBE E;  3E5S A;  2EDG A;  3TZD A;  4DV7 L;  1C7Y A;  4IFD J;  2SDF A;  5CV7 A;  4JYA Q;  4C3H B;  2B63 H;  1YZ6 A;  3HOU H;  3RLN A;  4LUO A;  2F52 A;  5C0X G;  4GOP A;  3TP5 A;  5GAE C;  4Y52 H;  1GHK A;  2R93 B;  4CKE A;  4QUC A;  3KBG A;  1HJP A;  1VF5 C;  3V96 A;  2C5C A;  2V4D A;  4RGT A;  3B6Y A;  5A2Q E;  4DR5 Q;  4BY1 H;  5I6Y A;  3RNU A;  1C9O A;  4LFA L;  4XIG S;  1SMX A;  1HFG A;  4HSV A;  2F0M A;  3G71 A;  4BY7 G;  3UE0 A;  1KAB A;  3HP3 A;  1T9H A;  1S3O A;  5JPM C;  1FGB D;  2SNS A;  3FVQ A;  1PH5 A;  4UAI A;  4KKS A;  5C4X G;  2EY5 A;  4XYO A;  2F3V A;  3NUC A;  3I2Z A;  5M5Y B;  2F0Q A;  5E1F A;  3RLO A;  1K83 B;  1DXM A;  1PLF A;  1ICF B;  4DA2 A;  3D4W A;  1MSG A;  4ZKC B;  2MJ8 A;  1HZ9 A;  4PNY A;  4BWG B;  1J5E Q;  4DK1 A;  4A3E H;  1N8R C;  2BOS A;  2B3G A;  4DUZ L;  4H7B A;  1KDC A;  3U4V A;  4R8I A;  3BZK A;  3CME A;  3J81 E;  2PO4 A;  3AB9 A;  3K58 A;  1R4P B;  2QW7 A;  3H91 A;  1E2Z A;  1SE2 A;  2A68 C;  3WOE A;  1VQB A;  1L1O B;  1QIL A;  2JA6 H;  1EU3 A;  1CSP A;  3I4N H;  2ZJR A;  1EFW A;  1SNP A;  3N6R A;  4CJ2 C;  5IY0 A;  4A3F H;  2XVS A;  1Q86 C;  4RWS C;  4ME5 A;  3PO3 B;  1VQO A;  1EEF D;  3TME A;  3QG1 A;  4ALP A;  3I8Z A;  1YJ9 A;  1W3S A;  2K5H A;  5I9O A;  1M4V A;  5I2Y A;  1SFO B;  1I4P A;  1N33 L;  4JBJ A;  3TRE A;  1X3G A;  1HR0 Q;  3H6M A;  2K75 A;  4RFB A;  4RHR A;  1PDQ A;  2ZM6 Q;  1QZH A;  1FNU A;  1TY0 A;  4IJL A;  1HHV A;  3S15 H;  2B8F A;  2D0O A;  1I6H H;  4H44 C;  4GS3 A;  3H3V C;  3R3O A;  3AQQ A;  5A2Q L;  2WFW A;  4LNQ A;  3K59 A;  3ICE A;  4GLX A;  3KLW A;  4HED A;  1CK1 A;  3A74 A;  1VQN A;  1HCZ A;  3NTH A;  1B3Q A;  1QCB D;  1YI2 A;  3MHB A;  4YWK A;  1HNX Q;  3HGB A;  3OYY A;  1UE7 A;  2BDN A;  5C44 H;  2F0N A;  4QIW E;  4XQJ A;  5EPL A;  3K5L A;  4U68 A;  3W1G A;  5LL6 S;  2AHO B;  4IOA A;  4HJ7 A;  3EBE A;  1XMQ Q;  2KHS A;  3NEL A;  2A6E C;  2IWH A;  4POF A;  2M9V A;  5HGQ A;  2Y0S G;  4K5V A;  1CFM A;  5JVG 3;  5IWA L;  1TII D;  3QB3 A;  1G91 A;  4HIK A;  4KHZ A;  3AMU A;  5HUR A;  3W1B A;  3GTG H;  2NBF A;  4A3G H;  5KRU A;  2OWO A;  1DJR D;  4EX5 A;  4WJW A;  2YYZ A;  2RDH A;  2JA8 G;  1I6V C;  2H4O A;  2R7Z H;  3HS0 C;  4F8M A;  1PH7 A;  1S40 A;  2B8G A;  4OGQ C;  4BBR B;  3M85 A;  3GTP B;  4GKJ L;  1JB3 A;  1I50 B;  2EYF A;  3CD6 A;  4OWX B;  4IUU A;  4GNX B;  4GN4 B;  1LAC A;  1WCM G;  5K5P A;  4WJ4 A;  4EGV A;  1O7Y A;  3K80 C;  3HOX H;  3CMA A;  1FNW A;  5CV9 A;  2F0J A;  2Z6B A;  1YNJ D;  2IHF A;  4RAU C;  1GUT A;  3S9W A;  3OW7 A;  1QVC A;  3S14 B;  3CRK C;  3V05 A;  2OF1 A;  3P75 A;  1JMC A;  3E9I A;  4JI7 Q;  2A8V A;  1K28 A;  2UUA Q;  1C8C A;  2WAC A;  3NSW A;  2L12 A;  3MXN B;  5FK9 C;  1ENF A;  2OQK A;  5CV5 A;  2MO0 A;  2A6H D;  3M4Y A;  3ONA B;  3T51 B;  1ONL A;  4JI2 L;  4B3T L;  2K7V A;  2PQE A;  1K0R A;  2OCE A;  2R7F A;  5C0X H;  4YIJ A;  5IP7 G;  4BBS G;  4XQN A;  4A3B B;  3UI2 A;  3NHH A;  3FKI G;  1F9P A;  1N32 L;  2QDB A;  4X64 L;  3AFP A;  3S2D H;  2WB1 E;  1SYC A;  5TSS A;  4FF4 A;  1SAP A;  3LNN A;  3S16 H;  3TRZ A;  1KNA A;  3NK9 A;  4IFD I;  4A3D B;  2Z6K C;  4K2L A;  1GHJ A;  3TEH B;  2GN5 A;  4JPB W;  1LM0 A;  4K8I A;  3DEO A;  4HTH A;  4ILW A;  3IFD A;  1EIH A;  3QWN A;  3FMC A;  3QJY A;  2PQA B;  2QEX A;  4FF2 A;  4HIO A;  1WVL A;  2A5H A;  4EQN A;  4DV7 Q;  1LT5 D;  4J6H A;  5IYC G;  4C3H G;  3UDF A;  1IBK L;  3RD4 A;  2E76 C;  2X6L A;  5IP9 G;  1VCI A;  4PMW A;  2AKW B;  2KJX A;  3BG3 A;  1K0S A;  5M5X H;  4AQY L;  2R3Z A;  1SLJ A;  1HA6 A;  2E2H H;  2KEE A;  1CKN A;  2KHI A;  2PZW A;  4DU9 A;  3GP7 A;  1AW7 A;  1BF4 A;  4NXN L;  4LFA Q;  4IUR A;  2R92 B;  2VB3 X;  1IL2 A;  3K8A A;  1KC8 C;  4NP5 A;  3IAY A;  2NUC A;  2B2T A;  2KCN A;  2HHH L;  1U4L A;  3L3O C;  5IOD A;  1E3P A;  4EVO A;  2HDL A;  1NAP A;  1B70 B;  3BDO A;  2C35 B;  4LF9 L;  1STN A;  1UE6 A;  4EQP A;  1PRT C;  3GTQ H;  1LTS D;  1W6K A;  4IJH A;  1EWH A;  1U0L A;  3GD7 A;  3JAM c;  3GQB A;  4L6T B;  2DGY A;  5GAD C;  1EIY B;  1IL8 A;  1DCZ A;  1PYB A;  5FLX E;  3KDF A;  1N9W A;  1G6Z A;  1L0W A;  5L37 A;  3SK4 A;  1L2F A;  2EQS A;  1HTP A;  5LHY 1;  2EVB A;  2F0O A;  3OOC A;  4HJ5 A;  2D0P A;  1EYG A;  3RN5 A;  4I7Z C;  3SGI A;  3EIV A;  3ERQ A;  5IOC A;  3D8G A;  4DK3 C;  3PO3 G;  1F9S A;  3F2U A;  3VYU A;  1V1O A;  4FVM A;  1X9N A;  4MTN A;  2BA0 A;  5ELO A;  3JC6 6;  1N33 Q;  2N55 A;  3I4O A;  3NE5 B;  2M00 A;  3DLL A;  3FHW A;  3SEB A;  4APV A;  3STB C;  3RUZ A;  4B9X A;  3ZYY X;  1VQ4 A;  1U4R A;  2WV6 D;  1X32 A;  3NBH A;  1Y14 B;  3CCE A;  2VY3 A;  3GTJ H;  1KD1 C;  1JE5 A;  3BVG A;  3OWE B;  2Q8T A;  2Q8I B;  3OMC A;  4HJA A;  2JA5 B;  2RCF A;  1JC7 A;  1F2M A;  1EY9 A;  1SYB A;  1LYL A;  1HNW L;  3H0G G;  4DR3 L;  5M5W B;  1XNR L;  1I4R A;  3GO5 A;  1Z47 A;  4DV2 L;  1L0Y B;  3PUX A;  1DYQ A;  3I4M H;  1Y8O B;  1VQ7 A;  2FMM A;  1B50 A;  4LF4 L;  3J81 c;  2EY1 A;  1O7L A;  1WCM H;  4R4I A;  1JT8 A;  2K5N A;  2CH4 A;  2OQ0 A;  3H3V I;  3PIO A;  1RJT A;  3RLF A;  1V8Q A;  4KN7 C;  4HID A;  1LLR D;  3I70 A;  4OX9 L;  2NB0 A;  1PTO H;  2A19 A;  2A68 D;  3HZX A;  4OON A;  1PTO F;  2BE5 C;  1MJC A;  2ZXR A;  1WOC A;  1B2T A;  4K6D A;  1SBB B;  4JW0 A;  4TKO B;  4XYQ A;  3F2D A;  1TWG H;  3CU7 A;  4P71 A;  3J80 i;  5CV4 A;  3S24 A;  3MXP A;  4BBS H;  5IP7 H;  3PF5 A;  1GUG A;  2NZ1 D;  4GKJ Q;  2K32 A;  5M3M B;  1LTL A;  1A62 A;  3FKI H;  1G2T A;  5IGG A;  1T5E A;  1CA5 A;  3GTL B;  1QWY A;  4HCE A;  1SYD A;  3T53 B;  3VYS A;  2RHS B;  4DAP A;  1NR4 A;  1KLG D;  5EBD A;  3K5M A;  2ALY B;  1A8V A;  4O1N A;  4JV5 L;  2VL6 A;  4BXX G;  2A69 C;  3OWF A;  4FXK C;  1Y1V G;  3F2C A;  3S1N B;  1KRT A;  4GKK Q;  1SN8 A;  2K52 A;  2NVX B;  1STY A;  3KLS A;  2E5L L;  2DJG C;  4QF4 A;  2EE1 A;  5CGK A;  3OSO A;  1A63 A;  3WOF A;  4JI2 Q;  5IYC H;  4C3H H;  4B3T Q;  4X62 L;  2E2I H;  2D62 A;  3T16 A;  5M3F H;  3HKZ B;  4NMZ A;  1I3Q H;  3J7A V;  2L15 A;  1N32 Q;  4MNO A;  2PI2 E;  2K4K A;  5JJK A;  1TWA B;  1Q8K A;  4X64 Q;  5D14 A;  4C3J B;  4L5T A;  5T1G A;  1EY7 A;  4A3D G;  2F4I A;  1VQ5 A;  2NN6 H;  2EYO A;  2A6E D;  1HRJ A;  1HZC A;  5AFW A;  3D6C A;  3CC2 A;  1STH A;  2NTS A;  5IGD A;  5C4H A;  2IT1 A;  5C4J B;  5KEE A;  1AE2 A;  2KCT A;  1Y1W H;  4OXP A;  4OIJ A;  2HQE A;  4A3I G;  4O2D A;  1EYC A;  1QVF A;  4CBV A;  3VDY A;  1C0A A;  4L5Q A;  4HMJ A;  1IBK Q;  2F0E A;  2ICE C;  1WTO A;  5GAH C;  4L5S A;  3TQY A;  4AQY Q;  2KCM A;  4DR7 L;  1CT1 D;  2B2U A;  1WTH A;  3A56 A;  4RGN A;  3CCM A;  4XDX A;  1XJV A;  1HFN A;  3CRL C;  2IL8 A;  2FMC A;  4ZAI A;  3QR8 A;  4JI4 L;  4NXN Q;  3PO2 H;  3KJO A;  5JEA G;  2R92 G;  3PO3 H;  4NB3 A;  3ERO A;  2K33 A;  4LF6 L;  2CQO A;  3ERS X;  1NJI C;  1JQY D;  2HHH Q;  1I5F A;  3MFY A;  1IHZ A;  4LF9 Q;  4NKL A;  3J7Y W;  4V19 0;  1UAP A;  2XSC A;  3S2H B;  1TR5 A;  2F0G A;  4HAE A;  4IO9 A;  3K81 C;  5ELC A;  3OW2 A;  1GUW A;  2LY7 A;  1ENA A;  4A3C G;  1M8A A;  1U5K A;  1VQH A;  1CHQ D;  1QJO A;  3QOL A;  1EIF A;  5F2D A;  3G6E A;  1Y69 U;  2YU9 H;  2B2T C;  1N36 L;  3H0G H;  1VQM A;  1V1Q A;  1H9J A;  1L1O A;  1BBW A;  4NXM L;  1SE4 A;  2I46 A;  4Q5V A;  4FXD A;  1CA6 A;  1AH9 A;  2XN9 C;  5EKI A;  2VXW A;  1PH1 A;  4QGU A;  3S17 B;  3MFG A;  1GJX A;  4RGM A;  1EZ8 A;  1SMY C;  2ZXP A;  1ASY A;  3PUY A;  1LTA D;  2WAQ E;  2RHQ B;  1IKL A;  1QVG A;  1S5F D;  1STE A;  4RCO A;  3T4A C;  3K7U C;  3M4O B;  3A8K E;  2JA5 G;  1KNE A;  5ELD A;  1V1P A;  5EPJ A;  1PFM A;  4Z9C B;  4JBW A;  5C0X J;  4DV4 L;  3KLS X;  4LMQ D;  4RCN A;  1HNW Q;  1RF2 D;  3NBI A;  4DR3 Q;  2CWP A;  3A0J A;  2PW7 A;  4EQO A;  3TS2 A;  3I91 A;  2R7D A;  2L11 A;  1XNR Q;  4YWM A;  4DV2 Q;  4A3M G;  3SXH A;  1FYC A;  1O7I A;  3KYH C;  4AYB B;  4C1N K;  5FLX c;  4TVA B;  3A5U A;  5AJ3 L;  3CC7 A;  1PH6 A;  2F0S A;  1Q8I A;  2HUG A;  1GO3 E;  3CP0 A;  4DNR B;  4JI6 L;  3NWT A;  2X69 A;  1XPR A;  1PA6 A;  4LF4 Q;  2ZJQ A;  4IFD G;  1PRT D;  5CV8 A;  1A0I A;  2NZO A;  3G4S A;  3CHB D;  5K36 G;  1KDB A;  2K04 A;  1Z9F A;  3AYH B;  2CW0 D;  4S3S A;  2Z1C A;  4HJ8 A;  1A3T A;  5LMN W;  1HZB A;  4QCL A;  5G3L F;  1D8L A;  2AQ2 B;  3S14 H;  5IT9 L;  2XWB B;  2EZV A;  4OX9 Q;  1D5X C;  1X65 A;  4BXX H;  1MI2 A;  1EL0 A;  1Y1V H;  3R2T A;  1KL9 A;  2H5X A;  2KEC A;  1D7Q A;  3HFZ B;  5LMN L;  1WD0 A;  4KY7 A;  4HN7 A;  3MXG A;  1QUQ A;  4A3J G;  1M90 C;  1V9P A;  2F0P A;  4JVZ A;  1WYD A;  3FEW X;  1GVP A;  1KHI A;  4O0A A;  1VQL A;  1D1I A;  3SDZ A;  1SJH D;  2UXB L;  2RSN A;  3HOV G;  1JWS D;  4DUY L;  2PPB C;  3STB D;  2NVY B;  4IAL A;  3WDN A;  4UY8 C;  3MZ5 A;  3U4Z A;  3GV6 A;  3KF8 A;  4R4C A;  4GNX A;  4H13 C;  1X3Q A;  4X65 L;  2PCF B;  1LTG D;  5E4W C;  3TBI B;  4A3D H;  1S5D D;  2BH2 A;  3TP7 A;  3GTO B;  1LT3 D;  2I0Q A;  4JV5 Q;  1D1K A;  3HKS A;  3MC0 B;  4RGO S;  3HOY H;  3TP8 A;  2E5L Q;  5KNB A;  4A3I H;  3D6W A;  1I4X A;  1II3 A;  3MXN A;  1X3P A;  4X62 Q;  2NTT A;  1XNQ L;  2O5J C;  1NBW A;  3IL8 A;  1ML0 D;  1PRT B;  1PH3 A;  4A93 B;  1ZKO A;  3OIQ A;  4JC0 A;  2IPK D;  4HMI A;  1J9O A;  2PI2 A;  1JWM D;  4C3J G;  1Q1B A;  1BOS A;  3FPU B;  2A73 B;  3JAM i;  3S1M H;  3AEV A;  2F3W A;  3M3Y B;  4OEM B;  3VA7 A;  5JEA H;  2B2Y A;  2R92 H;  2E74 C;  4B08 A;  1TWC H;  2L5T A;  1NNX A;  1PTO C;  4C2M B;  3HOZ G;  1G51 A;  3K7A H;  4BA1 I;  2H1E A;  4KKU A;  1Y8P B;  4C3I B;  2ZT9 C;  3L7Z C;  5FO8 B;  1Z7T A;  4IOC A;  1MSH A;  1AE3 A;  5DNF A;  1BO0 A;  4FP5 D;  2JEA I;  4Y7N H;  3Q24 A;  4LJZ C;  4KHP L;  2Y0S E;  2JA7 B;  4LFC L;  3IKJ A;  4DXF A;  2LXK A;  5FLM G;  1ZEQ X;  2E75 C;  4DR1 L;  3VR5 A;  3EQL C;  2KEN A;  4NDX A;  4DR7 Q;  3PUZ A;  2F0U A;  2OTL A;  3LX0 A;  1D5Z C;  3FDT A;  2B63 B;  3HOU B;  3ZJY C;  4JI4 Q;  2YTX A;  2EYJ A;  3TS0 A;  1OXV A;  3KF6 A;  4ZLT F;  4LF6 Q;  4OWT B;  2Z0S A;  3VYT A;  4PMB A;  1MHW C;  1ZYR C;  5DEH A;  5FO9 B;  3OIP A;  2B2W A;  3TSS A;  2BDO A;  5KGU A;  2A69 D;  5I9P A;  1STA A;  4E6I A;  2JP1 A;  1NTG A;  3CC4 A;  2ZJP A;  3I56 A;  1AZQ A;  1L0X B;  1G29 1;  2B2U C;  4GKK L;  2IJ0 A;  5EGT A;  3QOJ A;  1TU2 B;  1VQI A;  1F77 A;  5ELB A;  3CCR A;  4DNT B;  1DOM A;  4J1M A;  5D3D A;  1WTX A;  3J81 i;  5COR A;  3WWV A;  1N36 Q;  2VB2 X;  1PYW D;  1TT2 A;  4L8J A;  3RZO H;  2XIW A;  2N8N A;  1W2B A;  5M5W H;  1E22 A;  4RHS A;  1JB7 A;  1BCP F;  4TSS A;  4NXM Q;  1EY0 A;  1K3B C;  1OXS C;  4A3M H;  2HCC A;  1X55 A;  4RMF A;  2JA6 B;  3QIA A;  1TY2 A;  2EJF C;  4A3F B;  1GOZ A;  3C1E A;  4DV6 Q;  3VR4 A;  4BY7 H;  3A5Z B;  2F0D A;  4CDC C;  4R1J A;  5BN5 A;  1F9R A;  3PUW A;  5C0X I;  2XTI A;  3GTK H;  5K36 H;  3KUP A;  3Q22 A;  4HJ9 A;  3ULL A;  2EPB A;  5C4X H;  3J7A 5;  4DR6 L;  4K0K L;  3A8J E;  3LGJ A;  4NW2 A;  1B3A A;  4JI0 L;  1VQP A;  1L1O C;  3L9A X;  1IKM A;  2F4V L;  4DFA A;  2K03 A;  4DV4 Q;  5DM6 3;  4JI3 L;  1LAB A;  1TWF H;  1A15 A;  2R93 G;  1WJJ A;  5KIX A;  3S15 B;  2UXC L;  1PVO A;  1I6H B;  1NMG A;  1SNC A;  5IYB G;  4AYB G;  5C5L A;  2KCC A;  5AJ3 Q;  4BS9 A;  4A3J H;  1JR0 D;  4QQB X;  4JI6 Q;  1IYJ B;  1BXT A;  2PMZ B;  1DM0 B;  3HOV H;  5CR3 A;  1XTD A;  2VW9 A;  1S72 A;  1CM9 A;  4Q0F A;  1ASZ A;  4GOP C;  5C4Z A;  3NPP A;  1JJ2 A;  4JOI A;  5C44 B;  3EA6 A;  2TSS A;  1WTQ A;  4RA8 A;  1BKB A;  3DWA A;  3M4P A;  4H0L C;  4DXG A;  4QUF A;  2OTJ A;  4WFN 3;  1G6P A;  3E0J A;  1YNX A;  3M7N A;  1HQR D;  2NVX H;  4KY6 A;  5C3E B;  2EY6 A;  3OHX C;  1HXY D;  3NEM A;  5IGE A;  5LMN Q;  4G4K A;  1J8I A;  4OIK A;  5H1S E;  3GTG B;  3PIP A;  1TVX A;  1SMY D;  2UXB Q;  4F87 A;  1PFN A;  4DUY Q;  1K3R A;  2R7Z B;  1VQG A;  2OXP A;  1PYS B;  1P16 A;  1RIP A;  3M9B A;  2L1B A;  3HRZ C;  1KRS A;  2VQF L;  1SYF A;  4HIM A;  2F0I A;  4X65 Q;  1YHA A;  4KKT A;  1CUK A;  3PCO B;  4N8F A;  4DV0 L;  5ELN A;  1TWH H;  3DEP A;  3HOZ H;  1JJG A;  4WOR A;  1WTP A;  1A3V A;  3F2B A;  3E0E A;  5I2X A;  4BA2 I;  3HOX B;  4F7X A;  2DUD A;  2PZT A;  2WKD A;  2AQ1 B;  3CAM A;  5BR8 L;  4R9W A;  2D9U A;  3V2T A;  1H9S A;  1KTK A;  4RKL A;  3W5O A;  3RZD H;  1R9T B;  4FXG C;  4LWC A;  4K8J A;  5JJZ A;  1XNQ Q;  1XPU A;  3J80 L;  3R2I A;  2JA8 H;  1XWE A;  2VZA A;  1QB5 D;  1XXG A;  2X6G A;  1SRO A;  3D4R A;  2K5Q A;  3UDX A;  1U4P A;  1Q3L A;  4CGY B;  2EY2 A;  2SEB D;  3NQI A;  4CKB A;  2Q8R E;  3FRP B;  5IE8 A;  5J39 A;  2SOB A;  3MTS A;  2IHE A;  4AH6 A;  2JSO A;  4C3I G;  1YEZ A;  3S2D B;  3UDG A;  5DM7 3;  1SJE D;  2IY5 B;  3S16 B;  1EY4 A;  2I07 B;  1EWI A;  2TMP A;  3DM3 A;  4U67 3;  1O78 A;  2FFK B;  4KHP Q;  1T5X D;  3P1H A;  4DPG A;  2LS0 1;  3T56 B;  2JA7 G;  4LFC Q;  3CCS A;  2RQX A;  1K8O A;  5JAV A;  2K28 A;  3K57 A;  2B2Y C;  4DR1 Q;  4QL5 A;  4YHH L;  2WII B;  4BBR G;  4IPH A;  3BVM A;  1MBY A;  3BVZ A;  1ICW A;  2B63 G;  3HOU G;  1EQR A;  1K8A C;  1XTC D;  4WJ3 M;  3BYT B;  3SVM A;  4CKC A;  3Q23 A;  2KHJ A;  1IW7 C;  5J3B A;  3GTM H;  2LMC B;  4I7A A;  3CCL A;  2FXQ A;  2E2H B;  1Y8N B;  4KY5 A;  1IZ6 A;  3CPF A;  4MN3 A;  4FF3 A;  3I90 A;  3H94 A;  5IIF A;  1PH2 A;  3TZU A;  1V43 A;  2VUM B;  1SXT A;  2JJQ A;  1M1K C;  3PGZ A;  3RMH A;  3J81 j;  3SR1 A;  1DOK A;  1X3F A;  2PZU A;  1LTR D;  1B1Z A;  2E2D C;  4ZRZ A;  4RKB A;  1E7Z A;  2IX3 A;  4DR4 L;  3GTQ B;  1ET9 A;  1CHP D;  3VR6 A;  2I5H A;  4TQU S;  4QMG A;  2Q2H A;  2K01 A;  1Q1E A;  2K14 A;  4LF5 L;  3S1Q B;  2P5Z X;  1ESF A;  1D5M C;  3J7A F;  5IP9 H;  3F8T A;  4YY3 L;  4A3B G;  2R93 H;  3C46 A;  2B2W C;  3LWE A;  1MD2 D;  3HOW B;  5EPK A;  5HGT A;  1WD1 A;  2MNA A;  2AUK A;  1EU4 A;  5CC4 A;  5IYB H;  3RR5 A;  4PV1 C;  1JIC A;  3PIP 3;  1JOR A;  5C3W A;  3NTI A;  4X3K A;  2KA7 A;  5FOB B;  4A3F G;  1K8G A;  2MQH A;  3J7Z C;  1CZG A;  3I3C A;  2YTV A;  1Q46 A;  1A2U A;  4KD3 A;  1S4Z A;  1GUO A;  2JN4 A;  3E3X A;  1OTC A;  5BN3 A;  1S5B D;  4N8X 1;  1ILQ A;  4QIW B;  4K0K Q;  2MFI A;  4DR6 Q;  5M5Y H;  2UUB L;  1ZXT A;  3BDC A;  1K83 H;  4KMU C;  4JI0 Q;  5IGC A;  2E2J B;  5C3X A;  4P75 A;  2NN6 I;  3CCJ A;  1B4O A;  1VS0 A;  2F4V Q;  4DKA C;  2K1B A;  1RTO A;  1QNU A;  3W3A A;  1AN8 A;  3GTJ B;  2KED A;  4JI3 Q;  2NVQ B;  4IQZ A;  3HEJ A;  4JI8 L;  3G7L A;  4X6A H;  3K0X A;  3C3L A;  2UXC Q;  3GV3 A;  5FJ8 G;  1IBM Q;  3DMU A;  4ODG A;  2F0K A;  2RDF A;  4ZCK A;  2B39 A;  1TQO A;  1W6J A;  4CDD C;  2EIF A;  2RKS A;  1ZYR D;  1GUN A;  2R61 A;  2K5D A;  4HSP A;  1TS3 A;  3CPW A;  1SFO H;  1YIT A;  2QKI C;  4FF1 A;  1PZI D;  2CQA A;  2NVY H;  3I4M B;  4OO1 I;  5EKL A;  2RF4 A;  4PMC A;  1KQS A;  3W2D A;  5C44 G;  2BCO A;  2EXD A;  2KVM A;  1WCM B;  3C2P A;  3D4D A;  4DR2 L;  1BCP C;  3T13 A;  1OO9 B;  3NWS A;  3H15 A;  4JG2 A;  5IT9 E;  1B53 A;  2A74 C;  4ME3 A;  4LAA A;  5C3E G;  3FP9 A;  5EJW A;  2BH8 A;  2ZTC A;  1WTV A;  4X66 Q;  1XPO A;  2RSO A;  3ER0 A;  2HQL A;  5CYU A;  2NWG A;  3UE1 A;  1U9R A;  4JOI C;  2K5W A;  1SND A;  1UEA B;  1PRT F;  4XT1 B;  3U58 A;  3PMF A;  2IX0 A;  1U4M A;  4DV6 L;  4FDB A;  2R7Z G;  5DLQ E;  1B8A A;  4JI1 L;  1N34 Q;  1EY6 A;  4PZ8 A;  4PG3 A;  2VQF Q;  4BBS B;  1PZK D;  2EYP A;  1NSN S;  4MTK A;  1VQC A;  5EAY A;  1CQV A;  4DV0 Q;  2QA4 A;  2DNC A;  3FKI B;  4C2M H;  2WB1 B;  1H95 A;  1QZG A;  1K9M C;  1JOO A;  4C3I H;  3OMG A;  1O80 A;  2B2V A;  4J15 A;  4UP9 A;  4A75 A;  1GXD C;  4IUT A;  3HOX G;  1K73 C;  5BR8 Q;  1SR3 A;  5ELE A;  1TS4 A;  1IBL L;  4IUV A;  3K6O A;  3G48 A;  1EFI D;  2EJG C;  3ITP A;  1EYA A;  2F0L A;  3X3M A;  2XGT A;  2DY8 A;  3MWY W;  4IUN A;  1PZJ D;  4UPA A;  4KLK A;  4BBR H;  2KQ3 A;  2MHV A;  4LUV A;  3GTP H;  1F9Q A;  1AP0 A;  3MEH A;  1I4H A;  5E3F A;  5HY6 A;  1I50 H;  2Z9H A;  4DV3 Q;  1Q82 C;  2E2I B;  2Z4H A;  5M3F B;  1JJC B;  5EQ0 A;  1I3Q B;  2XRS D;  4ABN A;  1B7Y B;  3DM1 A;  2IW3 A;  1KAW A;  3TP6 A;  1YNN C;  4JBK A;  5JJI A;  2CHB D;  4DV5 L;  4A3L G;  2PYK A;  4I65 A;  1IYV A;  2F3I A;  1XMO L;  4RG1 A;  2D2C C;  4R4Q A;  1MGS A;  2AMC B;  3DHQ A;  3CQZ B;  4AIM A;  1VQA A;  4DAY B;  4P2C B;  2VQE L;  1P8L A;  1Y1W B;  1FJG L;  4UHV A;  2HD3 A;  3O13 A;  4YHH Q;  1A6X A;  1B9M A;  4A3B H;  1ILP A;  5M3M G;  4B3R Q;  1VMC A;  3URY A;  2E8G A;  1CKO A;  1C48 A;  4KN4 C;  5I4D A;  3JAM L;  2V1C C;  5COY A;  2DN8 A;  1O7Z A;  3D0F A;  3SK6 A;  3CW2 C;  1QE6 A;  1YJN A;  4GZY C;  2VUM G;  3PO2 B;  1NUC A;  1CKM A;  1PH4 A;  1FD7 D;  1B44 D;  3HG9 A;  2NVT B;  2YTY A;  4P73 A;  1OXU A;  1X56 A;  1SNM A;  3DWP A;  1S5C D;  1LT6 D;  3A7A B;  4MHE A;  2RBM A;  4DR4 Q;  4N9T A;  4KHV A;  4JBM A;  2NYZ D;  3BJU A;  4LF8 Q;  4CDF C;  1EWC A;  4MIU A;  3SHL A;  5IYD G;  4J8Q A;  1RTN A;  2AQ3 B;  3OPO A;  3L2P A;  4FNF A;  1FVI A;  2UUC L;  4LF5 Q;  4KJO A;  5G3L D;  4DV1 L;  2GVB A;  1CSQ A;  1V1P B;  3UDI A;  3HKZ G;  4YY3 Q;  2B29 A;  2CKZ B;  1E1O A;  1JCK B;  4K5W A;  3A55 A;  5CMD A;  4GOP B;  1PV4 A;  4XXE A;  3HKZ E;  1JE4 A;  3HOW G;  4LFB L;  4IUP A;  1VQE A;  4X3U A;  5FJ8 H;  1PH8 A;  4PZ7 A;  3E6Z X;  2YU9 B;  3S1R B;  1VQK A;  3I73 A;  1DGS A;  3H0G B;  2ZXO A;  2ATW A;  3T1Y L;  4A3K B;  2YV5 A;  1IXR A;  4JCV E;  5IGF A;  2EYL A;  2KBN A;  2G9D A;  4G7O C;  1QNK A;  1JOQ A;  3KFU A;  4LW1 A;  2XNA C;  4CJ1 B;  2K05 A;  2BE5 D;  4LK1 C;  3OTO Q;  2K6A A;  2UUB Q;  1TXY A;  3K5N A;  1NE3 A;  1LTB D;  2EXZ A;  4KV6 A;  3PV0 A;  4DN4 M;  1CQF A;  2I5M X;  2PQA A;  4KD4 A;  1GUS A;  1RHP A;  2WKC A;  4X3T A;  4A3C H;  2A1A A;  3J81 L;  2MPM A;  1VQD A;  4IZ8 A;  2F0H A;  3T1H L;  3DUZ A;  1E2V A;  4JI8 Q;  4IPC A;  2EYM A;  2F0W A;  2ASB A;  5C3E H;  5E4X A;  1IW7 D;  1SNO A;  3LWU A;  1SEB D;  4GN5 A;  3MXU A;  1GM5 A;  4UDU C;  2RVL A;  1EQT A;  2VNU D;  1QUQ B;  3U50 C;  2G9H D;  4B3S L;  4BY1 B;  3I55 A;  4FO2 A;  1NY4 A;  3K5O A;  3I4M G;  1UE1 A;  1TKW B;  2JQO A;  3BDL A;  1AFP A;  1WTW A;  1DON A;  5DAU A;  3BU2 A;  3KBX A;  5KYL A;  5J1Z A;  3KF8 B;  2EYH A;  3Q8D A;  4GLA C;  1YBY A;  4DR2 Q;  1HUN A;  4ZK9 B;  5A35 A;  4WRD A;  4ZUJ A;  1EEI D;  4YCU A;  4CHT B;  2JA5 H;  3KOJ A;  1X54 A;  1FGU A;  3PQI A;  4X3S A;  1VDZ A;  3K0Y A;  2QGQ A;  2JE6 I;  5IGB A;  3PSI A;  2RA4 A;  1G8Z D;  4A3E B;  1I94 L;  1R9T H;  1YHB A;  4DNI A;  1CTM A;  1PXU A;  4P72 A;  2CH4 W;  1SE8 A;  4LF7 L;  1Y1V B;  5I6W A;  1YIJ A;  1E0B A;  3MA2 B;  1FR3 A;  2HIV A;  3I4N B;  3EVQ A;  2Q2U A;  1WTR A;  2L4N A;  3EN2 A;  1VF7 A;  1HUM A;  4IFD H;  3CKI B;  1I4G A;  4JI1 Q;  1WFQ A;  2L0C A;  2EOT A;  5JPN C;  3A54 A;  4MZ9 A;  1G2S A;  3TN2 A;  5T1I A;  1LTT D;  2C9O A;  2HDM A;  3P20 A;  2WB1 G;  2PNR C;  1Q90 A;  1UEB A;  2BA1 A;  4HR7 B;  3MVV A;  5GRO A;  1VQF A;  2CFM A;  4A3L H;  1EQV A;  4M8A A;  3D31 A;  3PUV A;  3EJI A;  4IUQ A;  1IBL Q;  5ISR A;  1SYE A;  4G7Z C;  4JI5 Q;  3I72 A;  1KAA A;  4EQ5 A;  4UP8 A;  2LKV A;  2G5D A;  3DWQ A;  4C56 C;  3E9H A;  3SK8 A;  1TS2 A;  2MO1 A;  5CV6 A;  3Q6S A;  1IBM L;  1H9K A;  3HOY B;  3VR3 A;  1I4Q A;  1BR9 A;  1VMP A;  4ZQ3 A;  4AYB E;  4A3I B;  4K14 A;  1BBU A;  5M3M H;  1ESR A;  2B2V C;  1BUV T;  1DD2 A;  2IX1 A;  3J80 E;  1HNZ L;  5M3F G;  5IT9 c;  3GTL H;  2LSS A;  5E7N A;  2NZH A;  1RKN A;  4ID6 A;  1F2Z A;  1UE5 A;  5FO7 B;  4GLV B;  3KF6 B;  4KK7 A;  1VQ9 A;  2PNH A;  5LMU L;  2DJF C;  2MUY A;  3S1M B;  1BCP D;  2VUM H;  2RDG A;  1HPC A;  4B9W A;  4DV5 Q;  2HCI A;  3RN2 A;  2QIL A;  4JK1 C;  1TWC B;  3IFT A;  1D6E C;  2NN6 G;  1XMO Q;  2F0V A;  2K5V A;  3K7A B;  4DK0 A;  1CI3 M;  1XYI A;  3S1N H;  3CF5 A;  5EKK A;  2FHT A;  2KUM A;  5CBA E;  1E1T A;  1C4Q A;  1EY5 A;  2VQE Q;  5IYD H;  4Y7N B;  1SNQ A;  1Y1W G;  3Q0A A;  1FJG Q;  2CW0 C;  4X66 L;  2RCN A;  1EOV A;  1F2L A;  3S1Q H;  3MAQ A;  5NUC A;  2FIN B;  1SDF A;  3M7G A;  4A3G B;  4XTC S;  3R8B A;  2VS1 A;  4DUZ Q;  5EBC A;  5JOB A;  1FL0 A;  3HOW H;  1KDA A;  1TWA H;  1BBX C;  4C3J H;  4UP7 A;  1HQM C;  1B9N A;  1N34 L;  2OT2 A;  3A7L A;  4OO1 G;  2ICI A;  4CDE C;  3PO2 G;  5C6A A;  1XX8 A;  2N49 A;  2XRQ D;  2F1M A;  4GN3 B;  5C4J H;  1TS5 A;  5D3I B;  3DXJ C;  1PH9 A;  2WAQ B;  4C1N I;  3I7F A;  4B3M L;  4POG A;  4RH6 A;  2E2J H;  2UU9 L;  1Q12 A;  2UXD L;  3H09 A;  4GNX C;  2UUC Q;  5FLM H;  4DV1 Q;  3AFQ A;  2L55 A;  4NPS A;  2NVQ H;  4A93 G;  4LFB Q;  1PFS A;  1R4Q B;  3D3R A;  4IN3 A;  4JYA L;  1YVC A;  4DV3 L;  1VQJ A;  3ND8 A;  2OEO A;  2R6G A;  2WP8 J;  1LV9 A;  2ZTD A;  1X3E A;  1CKN B;  2CWA A;  2EJM A;  2N78 A;  1BCP B;  1YNN D;  2ENB A;  4V0B A;  3RZO B;  3T1Y Q;  4A3K G;  3F1Z A;  4DR5 L;  4A3M B;  3H3V H;  4DK6 C;  3BYY B;  1QG7 A;  2Z4I A;  2ID0 A;  5D65 A;  4QJF A;  1MKH A;  2GVA A;  4YWL A;  3S2H H;  4R4T A;  4BY7 B;  2FJ2 A;  1BQQ T;  1DOL A;  2QEJ C;  3GTK B;  1A3U A;  4G7H C;  2SNM A;  5FLX L;  1STB A;  1H9R A;  3MEF A;  4FYD A;  1OXT A;  2GA4 B;  3U9S A;  5C4X B;  1JOK A;  3T1H Q;  3NP8 A;  3KDF B;  5KNC A;  3BS1 A;  1J5E L;  4K5X A;  5JVH 3;  3ND9 A;  4B3R L;  2J4X A;  4KJN A;  1SE3 A;  1IYU A;  2DNE A;  3BZC A;  5IWA Q;  1UNS A;  4LUZ A;  1TWF B;  2N3S A;  3M4Q A;  5M5X B;  1DZ1 A;  1HA5 A;  1HR0 W;  2F0F A;  3U9O A;  4CJ0 B;  3CCV A;  4BY1 G;  4B3S Q;  3S17 H;  2J0T D;  1EYD A;  4A3J B;  1BNZ A;  3ULJ A;  4HCS A;  1KXL A;  2K50 A;  1EQQ A;  2QF7 A;  3EFX D;  1GD7 A;  3HOV B;  1E24 A;  1EUJ A;  1KIX A;  1EOT A;  3TDQ A;  4DF7 A;  5J22 A;  3L0O A;  1LUZ A;  3NBH B;  2Z8L A;  1Q7Y C;  5ELF A;  4LF8 L;  3M4O H;  2JYO A;  3VA5 A;  1HR0 L;  2N88 A;  2QCP X;  4QB4 A;  2M2L A;  2D5D A;  1STG A;  2XWJ B;  4IPG A;  3CXC A;  2ZM6 L;  1YNJ C;  2LXJ A;  4OL7 A;  2F03 A;  4A4I A;  2PW5 A;  4A3E G;  1I94 Q;  1FNV A;  1AZP A;  4QY7 A;  1EIG A;  4DAV A;  1SSO A;  1Z6H A;  1VQ6 A;  2ZTE A;  1H9S B;  4LF7 Q;  2JA9 A;  1Q81 C;  4DGZ A;  1K8M A;  1PTO D;  2QDL A;  4DAM A;  2JA6 G;  1HH2 P;  2AWN A;  3I4N G;  4A76 A;  4OWW B;  1UUP A;  5BN4 A;  5GAG C;  2HIX A;  2A6H C;  1ROD A;  3G6J B;  2JXM B;  4R4O A;  1S5E D;  3CCQ A;  2DY7 A;  1HNX L;  3X3N A;  5M9O A;  3BZD B;  3OTO L;  3IRB A;  1EY8 A;  4YCV A;  2O2L D;  4PZ6 A;  1NR2 A;  1A2T A;  1TWH B;  3HOZ B;  4OEL B;  1HZA A;  3P7J A;  3N52 A;  1XMQ L;  1RCV D;  3FPP A;  3CQZ H;  2MP1 A;  2Q2T A;  2KOL A;  2Y0S B;  5GQO A;  3VR2 A;  2CVR A;  1UWV A;  3HOY G;  2O5I C;  1D2B A;  3KLR A;  5JEA J;  3RZD B;  3NXW A;  2AUJ D;  2O4X A;  1NMF A;  3A8I E;  4N9P A;  4ZUI A;  1PFB A;  1JWU D;  1HNZ Q;  2JA8 B;  1J6Q A;  2PMZ E;  4YCW A;  1CZW A;  1E2W A;  1RDP D;  4OO1 H;  5KND A;  5LMU Q;  3C1F A;  1QOH A;  2JEB I;  3KJP A;  3GTO H;  1VQ8 A;  2Q2I A;  1X6O A;  3CCU A;  2NVT H;  4L63 B;  1ENC A;  3NQT A;  3NEN A; 
#chains in the Genus database with same CATH homology
 2LFN A;  4K2K A;  1LT4 D;  3SE0 A;  3QO2 A;  4XT3 B;  3PIO 3;  1PTO B;  3NTK A;  1SYG A;  2AWO A;  4DAY A;  1HTL D;  4K6L A;  4M1U B;  1PMR A;  2J7Z A;  1F2Y A;  4PQX A;  1H9M A;  4TRD A;  4G57 A;  1TWG B;  2MGS A;  2F0T A;  5LL6 X;  1NCV A;  4O42 A;  4R8N A;  1AEX A;  3SK5 A;  5C5M A;  3JAM E;  1LTI D;  3GTM B;  4KTA A;  3VYR A;  4OHJ A;  2L9H A;  1RD9 D;  4ZYS A;  3R93 A;  1BDO A;  1EZ6 A;  4XQQ A;  1KLU D;  3I4L A;  1ET6 A;  4ZKB B;  4ULL A;  5KYI A;  3AU7 A;  5FKA C;  4KI0 A;  3KK7 A;  2WIN B;  1OXX K;  4F88 A;  1LO5 D;  5CBE E;  3E5S A;  2EDG A;  3TZD A;  4IFD J;  2SDF A;  5CV7 A;  4C3H B;  5C0X G;  3TP5 A;  1GHK A;  2R93 B;  4CKE A;  4QUC A;  3KBG A;  1VF5 C;  3V96 A;  2C5C A;  2V4D A;  4RGT A;  5A2Q E;  5I6Y A;  4XIG S;  1HFG A;  4HSV A;  2F0M A;  1KAB A;  3HP3 A;  5JPM C;  1FGB D;  2SNS A;  3FVQ A;  4UAI A;  4KKS A;  2EY5 A;  4XYO A;  2F3V A;  3NUC A;  5M5Y B;  2F0Q A;  5E1F A;  1K83 B;  1DXM A;  1PLF A;  4DA2 A;  3D4W A;  1MSG A;  4ZKC B;  2MJ8 A;  4PNY A;  4BWG B;  4DK1 A;  2BOS A;  4H7B A;  1KDC A;  4R8I A;  3J81 E;  2PO4 A;  3AB9 A;  3K58 A;  1R4P B;  3H91 A;  1E2Z A;  1SE2 A;  2A68 C;  3WOE A;  1QIL A;  1EU3 A;  1SNP A;  3N6R A;  4CJ2 C;  2XVS A;  4RWS C;  4ME5 A;  3PO3 B;  1EEF D;  3TME A;  3QG1 A;  3I8Z A;  5I9O A;  1M4V A;  5I2Y A;  1SFO B;  1I4P A;  3H6M A;  4RFB A;  4RHR A;  1PDQ A;  1FNU A;  1TY0 A;  1HHV A;  2B8F A;  4H44 C;  3H3V C;  3R3O A;  5A2Q L;  3K59 A;  4HED A;  1CK1 A;  1HCZ A;  3NTH A;  1QCB D;  3MHB A;  3HGB A;  2BDN A;  2F0N A;  4XQJ A;  5EPL A;  3K5L A;  4U68 A;  5LL6 S;  2KHS A;  2A6E C;  2IWH A;  2M9V A;  4K5V A;  1CFM A;  5JVG 3;  1TII D;  3QB3 A;  1G91 A;  4KHZ A;  3AMU A;  5HUR A;  2NBF A;  5KRU A;  1DJR D;  4WJW A;  2YYZ A;  2RDH A;  1I6V C;  2H4O A;  3HS0 C;  4F8M A;  2B8G A;  4OGQ C;  4BBR B;  3M85 A;  3GTP B;  1JB3 A;  1I50 B;  2EYF A;  4IUU A;  1LAC A;  5K5P A;  4EGV A;  1O7Y A;  1FNW A;  5CV9 A;  2F0J A;  1YNJ D;  4RAU C;  1GUT A;  3S9W A;  3OW7 A;  3S14 B;  3CRK C;  3V05 A;  2OF1 A;  3P75 A;  1C8C A;  2WAC A;  3NSW A;  2L12 A;  5FK9 C;  1ENF A;  5CV5 A;  2A6H D;  3M4Y A;  3ONA B;  3T51 B;  1ONL A;  2K7V A;  2PQE A;  5C0X H;  4YIJ A;  4XQN A;  4A3B B;  3UI2 A;  3NHH A;  1F9P A;  2QDB A;  1SYC A;  5TSS A;  4FF4 A;  1SAP A;  3LNN A;  4A3D B;  1KNA A;  3NK9 A;  4IFD I;  4K2L A;  1GHJ A;  4K8I A;  3DEO A;  4HTH A;  4ILW A;  3IFD A;  1EIH A;  3QWN A;  3FMC A;  3QJY A;  4FF2 A;  1WVL A;  2A5H A;  4EQN A;  1LT5 D;  4J6H A;  4C3H G;  3RD4 A;  2E76 C;  2X6L A;  1VCI A;  4PMW A;  2KJX A;  3BG3 A;  2R3Z A;  1HA6 A;  2KEE A;  4DU9 A;  2PZW A;  3GP7 A;  1AW7 A;  1BF4 A;  4IUR A;  2R92 B;  2VB3 X;  4NP5 A;  3IAY A;  2NUC A;  2B2T A;  2KCN A;  1U4L A;  3L3O C;  5IOD A;  4EVO A;  2HDL A;  1NAP A;  3BDO A;  1STN A;  4EQP A;  1PRT C;  1LTS D;  1W6K A;  1EWH A;  3GD7 A;  3GQB A;  4L6T B;  1IL8 A;  1DCZ A;  5FLX E;  1G6Z A;  3SK4 A;  1HTP A;  5LHY 1;  2EVB A;  2F0O A;  3OOC A;  4I7Z C;  3ERQ A;  5IOC A;  3D8G A;  1F9S A;  3F2U A;  3VYU A;  1V1O A;  4FVM A;  2BA0 A;  2N55 A;  3NE5 B;  2M00 A;  3SEB A;  3RUZ A;  4B9X A;  3ZYY X;  1U4R A;  2WV6 D;  1X32 A;  3NBH A;  3BVG A;  3OWE B;  2Q8T A;  2Q8I B;  3OMC A;  2JA5 B;  1JC7 A;  1F2M A;  1EY9 A;  1SYB A;  5M5W B;  1I4R A;  3GO5 A;  1Z47 A;  1L0Y B;  3PUX A;  1DYQ A;  1Y8O B;  2FMM A;  1B50 A;  2EY1 A;  1O7L A;  1RJT A;  3RLF A;  1V8Q A;  4KN7 C;  1LLR D;  3I70 A;  2NB0 A;  1PTO H;  2A68 D;  3HZX A;  1PTO F;  2BE5 C;  2ZXR A;  1B2T A;  4K6D A;  1SBB B;  4XYQ A;  4TKO B;  3CU7 A;  5CV4 A;  3MXP A;  1GUG A;  2NZ1 D;  2K32 A;  5M3M B;  1G2T A;  5IGG A;  1T5E A;  1CA5 A;  3GTL B;  1QWY A;  4HCE A;  1SYD A;  3T53 B;  3VYS A;  4DAP A;  1NR4 A;  1KLG D;  5EBD A;  3K5M A;  4O1N A;  2A69 C;  3OWF A;  4FXK C;  3S1N B;  2NVX B;  1STY A;  3KLS A;  4QF4 A;  2EE1 A;  5CGK A;  3OSO A;  3WOF A;  2D62 A;  3T16 A;  3HKZ B;  4NMZ A;  3J7A V;  1TWA B;  5D14 A;  4C3J B;  5T1G A;  1EY7 A;  2F4I A;  2NN6 H;  2EYO A;  2A6E D;  1HRJ A;  5AFW A;  3D6C A;  1STH A;  2NTS A;  5IGD A;  5C4H A;  2IT1 A;  5C4J B;  5KEE A;  4OIJ A;  2HQE A;  1EYC A;  4CBV A;  4HMJ A;  2F0E A;  2ICE C;  1WTO A;  1CT1 D;  2B2U A;  3A56 A;  4RGN A;  1HFN A;  4XDX A;  3CRL C;  2IL8 A;  2FMC A;  4ZAI A;  5JEA G;  3ERO A;  2K33 A;  1JQY D;  3MFY A;  1IHZ A;  4NKL A;  3J7Y W;  4V19 0;  1UAP A;  2XSC A;  3S2H B;  1TR5 A;  2F0G A;  4HAE A;  5ELC A;  1GUW A;  2LY7 A;  1ENA A;  1M8A A;  1CHQ D;  1QJO A;  3QOL A;  5F2D A;  1Y69 U;  2B2T C;  1H9J A;  1SE4 A;  2I46 A;  4Q5V A;  4FXD A;  1CA6 A;  2XN9 C;  5EKI A;  2VXW A;  3S17 B;  3MFG A;  1GJX A;  4RGM A;  1EZ8 A;  1SMY C;  2ZXP A;  3PUY A;  1LTA D;  1IKL A;  1S5F D;  1STE A;  4RCO A;  3T4A C;  3M4O B;  3A8K E;  1KNE A;  5ELD A;  1V1P A;  5EPJ A;  1PFM A;  4Z9C B;  4JBW A;  5C0X J;  3KLS X;  4LMQ D;  4RCN A;  1RF2 D;  3NBI A;  2PW7 A;  4EQO A;  3I91 A;  2L11 A;  3SXH A;  1FYC A;  4AYB B;  4C1N K;  2F0S A;  1Q8I A;  2HUG A;  4DNR B;  3NWT A;  2X69 A;  4IFD G;  1PRT D;  5CV8 A;  3CHB D;  5K36 G;  1KDB A;  2K04 A;  2CW0 D;  4S3S A;  2Z1C A;  1A3T A;  4QCL A;  5G3L F;  2AQ2 B;  5IT9 L;  2XWB B;  2EZV A;  1D5X C;  1MI2 A;  1EL0 A;  3R2T A;  2KEC A;  1WD0 A;  4KY7 A;  4HN7 A;  3MXG A;  2F0P A;  3FEW X;  1D1I A;  3SDZ A;  1SJH D;  2RSN A;  1JWS D;  2PPB C;  2NVY B;  4IAL A;  3WDN A;  3MZ5 A;  3GV6 A;  3KF8 A;  4H13 C;  1X3Q A;  2PCF B;  1LTG D;  5E4W C;  3TBI B;  1S5D D;  3TP7 A;  3GTO B;  1LT3 D;  1D1K A;  3MC0 B;  4RGO S;  3TP8 A;  5KNB A;  3D6W A;  1I4X A;  1II3 A;  3MXN A;  1X3P A;  2O5J C;  2NTT A;  3IL8 A;  1ML0 D;  1PRT B;  4A93 B;  1ZKO A;  3OIQ A;  2IPK D;  4HMI A;  1J9O A;  1JWM D;  4C3J G;  1Q1B A;  1BOS A;  3FPU B;  2A73 B;  3M3Y B;  2F3W A;  3VA7 A;  5JEA H;  2B2Y A;  2E74 C;  4B08 A;  2L5T A;  1PTO C;  4C2M B;  4BA1 I;  2H1E A;  4KKU A;  1Y8P B;  4C3I B;  2ZT9 C;  3L7Z C;  5FO8 B;  1Z7T A;  1MSH A;  5DNF A;  1BO0 A;  4FP5 D;  2JEA I;  3Q24 A;  4LJZ C;  2JA7 B;  3IKJ A;  4DXF A;  1ZEQ X;  2E75 C;  3VR5 A;  3EQL C;  4NDX A;  3PUZ A;  2F0U A;  3LX0 A;  1D5Z C;  3FDT A;  2B63 B;  3HOU B;  2EYJ A;  1OXV A;  4ZLT F;  3VYT A;  4PMB A;  1ZYR C;  5DEH A;  5FO9 B;  3OIP A;  2B2W A;  3TSS A;  2BDO A;  5KGU A;  2A69 D;  5I9P A;  1STA A;  4E6I A;  2JP1 A;  1AZQ A;  1L0X B;  1G29 1;  2B2U C;  2IJ0 A;  5EGT A;  3QOJ A;  1TU2 B;  1F77 A;  5ELB A;  4DNT B;  1DOM A;  4J1M A;  5D3D A;  1WTX A;  5COR A;  2VB2 X;  1PYW D;  1TT2 A;  4L8J A;  2XIW A;  4RHS A;  1BCP F;  4TSS A;  1EY0 A;  1OXS C;  2HCC A;  2JA6 B;  3QIA A;  1TY2 A;  2EJF C;  4A3F B;  1GOZ A;  3C1E A;  3VR4 A;  2F0D A;  5C0X I;  5BN5 A;  1F9R A;  3PUW A;  5K36 H;  3KUP A;  3Q22 A;  2EPB A;  3A8J E;  4NW2 A;  1B3A A;  3L9A X;  1IKM A;  4DFA A;  2K03 A;  5DM6 3;  1LAB A;  1A15 A;  5KIX A;  3S15 B;  1I6H B;  1SNC A;  5C5L A;  2KCC A;  4BS9 A;  1JR0 D;  1BXT A;  2PMZ B;  1DM0 B;  5CR3 A;  1CM9 A;  4Q0F A;  5C4Z A;  3NPP A;  5C44 B;  3EA6 A;  2TSS A;  1WTQ A;  4RA8 A;  3DWA A;  4H0L C;  4DXG A;  4QUF A;  4WFN 3;  3E0J A;  3M7N A;  1HQR D;  4KY6 A;  5C3E B;  2EY6 A;  3OHX C;  1HXY D;  5IGE A;  4G4K A;  1J8I A;  4OIK A;  3GTG B;  1TVX A;  1SMY D;  4F87 A;  1PFN A;  2R7Z B;  2OXP A;  2L1B A;  3HRZ C;  1SYF A;  2F0I A;  4KKT A;  3DEP A;  4WOR A;  1WTP A;  1A3V A;  5I2X A;  4BA2 I;  3HOX B;  4F7X A;  2PZT A;  2WKD A;  2AQ1 B;  4R9W A;  2D9U A;  3V2T A;  1H9S A;  1KTK A;  4RKL A;  1R9T B;  4FXG C;  4K8J A;  5JJZ A;  3J80 L;  3R2I A;  1XWE A;  1QB5 D;  1XXG A;  2X6G A;  3D4R A;  2K5Q A;  1U4P A;  1Q3L A;  4CGY B;  2EY2 A;  2SEB D;  3NQI A;  4CKB A;  2Q8R E;  3FRP B;  5J39 A;  2SOB A;  3MTS A;  2JSO A;  4C3I G;  3S2D B;  5DM7 3;  1SJE D;  3S16 B;  1EY4 A;  2I07 B;  2TMP A;  4U67 3;  1O78 A;  2FFK B;  1T5X D;  3P1H A;  2LS0 1;  3T56 B;  1K8O A;  2RQX A;  5JAV A;  2K28 A;  3K57 A;  2B2Y C;  2WII B;  3BVM A;  1MBY A;  3BVZ A;  1ICW A;  1XTC D;  3BYT B;  3SVM A;  4CKC A;  3Q23 A;  1IW7 C;  2LMC B;  2E2H B;  1Y8N B;  4KY5 A;  4MN3 A;  4FF3 A;  3I90 A;  3H94 A;  5IIF A;  3TZU A;  1V43 A;  2VUM B;  1SXT A;  3RMH A;  3SR1 A;  1DOK A;  2PZU A;  1LTR D;  1B1Z A;  2E2D C;  4ZRZ A;  4RKB A;  2IX3 A;  3GTQ B;  1ET9 A;  1CHP D;  3VR6 A;  4TQU S;  4QMG A;  2K01 A;  1Q1E A;  3S1Q B;  1ESF A;  1D5M C;  3J7A F;  3C46 A;  2B2W C;  3LWE A;  1MD2 D;  3HOW B;  5EPK A;  5HGT A;  1WD1 A;  2AUK A;  1EU4 A;  5CC4 A;  4PV1 C;  1JIC A;  3PIP 3;  1JOR A;  5C3W A;  3NTI A;  4X3K A;  2KA7 A;  5FOB B;  1CZG A;  3I3C A;  1A2U A;  4KD3 A;  1S4Z A;  1GUO A;  5BN3 A;  1S5B D;  1ILQ A;  4QIW B;  1ZXT A;  3BDC A;  4KMU C;  5IGC A;  2E2J B;  5C3X A;  2NN6 I;  1B4O A;  2K1B A;  1RTO A;  1QNU A;  3W3A A;  1AN8 A;  3GTJ B;  2KED A;  2NVQ B;  4IQZ A;  3HEJ A;  3G7L A;  3C3L A;  3GV3 A;  3DMU A;  4ODG A;  2F0K A;  2RDF A;  2B39 A;  1TQO A;  1W6J A;  2RKS A;  1ZYR D;  1GUN A;  2R61 A;  2K5D A;  4HSP A;  1TS3 A;  2QKI C;  4FF1 A;  1PZI D;  2CQA A;  3I4M B;  4OO1 I;  5EKL A;  4PMC A;  3W2D A;  2BCO A;  2KVM A;  1WCM B;  3C2P A;  3D4D A;  1BCP C;  3T13 A;  1OO9 B;  3NWS A;  5IT9 E;  1B53 A;  2A74 C;  4LAA A;  5EJW A;  1WTV A;  2RSO A;  5CYU A;  2NWG A;  1U9R A;  2K5W A;  1SND A;  1UEA B;  1PRT F;  4XT1 B;  3PMF A;  2IX0 A;  1U4M A;  1EY6 A;  4BBS B;  1PZK D;  2EYP A;  1NSN S;  1CQV A;  2DNC A;  3FKI B;  2WB1 B;  1JOO A;  3OMG A;  1O80 A;  2B2V A;  1GXD C;  4IUT A;  5ELE A;  1TS4 A;  4IUV A;  3K6O A;  1EFI D;  2EJG C;  3ITP A;  1EYA A;  2F0L A;  3X3M A;  2DY8 A;  3MWY W;  4IUN A;  1PZJ D;  2KQ3 A;  2MHV A;  1F9Q A;  1AP0 A;  3MEH A;  1I4H A;  5E3F A;  2E2I B;  2Z4H A;  5M3F B;  5EQ0 A;  1I3Q B;  2XRS D;  4ABN A;  3DM1 A;  2IW3 A;  3TP6 A;  1YNN C;  2CHB D;  2PYK A;  4I65 A;  1IYV A;  2D2C C;  1MGS A;  3DHQ A;  3CQZ B;  4P2C B;  1Y1W B;  3O13 A;  1A6X A;  1B9M A;  1ILP A;  1VMC A;  3URY A;  1C48 A;  4KN4 C;  5I4D A;  3JAM L;  5COY A;  2DN8 A;  1O7Z A;  3SK6 A;  1QE6 A;  4GZY C;  3PO2 B;  1NUC A;  1FD7 D;  1B44 D;  3HG9 A;  2NVT B;  1OXU A;  1SNM A;  3DWP A;  1S5C D;  1LT6 D;  3A7A B;  4MHE A;  2RBM A;  4N9T A;  4KHV A;  2NYZ D;  1EWC A;  4MIU A;  3SHL A;  4J8Q A;  1RTN A;  2AQ3 B;  3OPO A;  4FNF A;  4KJO A;  5G3L D;  1V1P B;  1JCK B;  4K5W A;  3A55 A;  5CMD A;  4XXE A;  1JE4 A;  4IUP A;  4X3U A;  3E6Z X;  2YU9 B;  3S1R B;  3I73 A;  3H0G B;  2ZXO A;  4A3K B;  5IGF A;  2EYL A;  2G9D A;  4G7O C;  1QNK A;  1JOQ A;  2XNA C;  4CJ1 B;  2K05 A;  2BE5 D;  4LK1 C;  2K6A A;  3K5N A;  1LTB D;  2EXZ A;  4KV6 A;  3PV0 A;  4DN4 M;  1CQF A;  4KD4 A;  1GUS A;  1RHP A;  2WKC A;  4X3T A;  3J81 L;  2MPM A;  4IZ8 A;  2F0H A;  3DUZ A;  1E2V A;  2EYM A;  2F0W A;  5E4X A;  1IW7 D;  1SNO A;  3LWU A;  1SEB D;  3MXU A;  4UDU C;  2RVL A;  1EQT A;  2VNU D;  2G9H D;  4BY1 B;  4FO2 A;  3K5O A;  1TKW B;  1DON A;  3BDL A;  1AFP A;  1WTW A;  5DAU A;  3KBX A;  5KYL A;  5J1Z A;  2EYH A;  1HUN A;  4ZK9 B;  5A35 A;  4WRD A;  4ZUJ A;  1EEI D;  4CHT B;  4X3S A;  1VDZ A;  3K0Y A;  2JE6 I;  5IGB A;  2RA4 A;  1G8Z D;  4A3E B;  1CTM A;  1PXU A;  1Y1V B;  5I6W A;  1E0B A;  3MA2 B;  1FR3 A;  3I4N B;  3EVQ A;  1WTR A;  2L4N A;  1VF7 A;  1HUM A;  4IFD H;  3CKI B;  1I4G A;  2L0C A;  2EOT A;  5JPN C;  3A54 A;  3TN2 A;  1G2S A;  5T1I A;  1LTT D;  2C9O A;  2HDM A;  3P20 A;  2PNR C;  1Q90 A;  2BA1 A;  4HR7 B;  3MVV A;  1EQV A;  4M8A A;  3D31 A;  3PUV A;  3EJI A;  4IUQ A;  5ISR A;  1SYE A;  4G7Z C;  3I72 A;  1KAA A;  2LKV A;  3DWQ A;  4C56 C;  3SK8 A;  1TS2 A;  5CV6 A;  3Q6S A;  1H9K A;  3HOY B;  3VR3 A;  1I4Q A;  1BR9 A;  1VMP A;  4ZQ3 A;  4A3I B;  4K14 A;  1ESR A;  2B2V C;  1BUV T;  1DD2 A;  2IX1 A;  3J80 E;  1RKN A;  4ID6 A;  1F2Z A;  5FO7 B;  4KK7 A;  2MUY A;  3S1M B;  1BCP D;  2RDG A;  1HPC A;  4B9W A;  2HCI A;  2QIL A;  4JK1 C;  1TWC B;  3IFT A;  1D6E C;  2NN6 G;  2F0V A;  3K7A B;  4DK0 A;  1CI3 M;  1XYI A;  5EKK A;  2FHT A;  2KUM A;  5CBA E;  1C4Q A;  1EY5 A;  4Y7N B;  1SNQ A;  3Q0A A;  2CW0 C;  1F2L A;  3MAQ A;  5NUC A;  2FIN B;  1SDF A;  3M7G A;  4A3G B;  4XTC S;  3R8B A;  5EBC A;  5JOB A;  1KDA A;  1BBX C;  1HQM C;  1B9N A;  2OT2 A;  3A7L A;  4OO1 G;  2ICI A;  5C6A A;  1XX8 A;  2XRQ D;  2F1M A;  1TS5 A;  5D3I B;  3DXJ C;  2WAQ B;  4C1N I;  4RH6 A;  1Q12 A;  3H09 A;  2L55 A;  1R4Q B;  3D3R A;  4IN3 A;  3ND8 A;  2OEO A;  2R6G A;  2WP8 J;  1LV9 A;  2EJM A;  1BCP B;  1YNN D;  2ENB A;  4V0B A;  3RZO B;  4A3M B;  3BYY B;  1QG7 A;  2Z4I A;  2ID0 A;  5D65 A;  4BY7 B;  2FJ2 A;  1BQQ T;  1DOL A;  2QEJ C;  3GTK B;  1A3U A;  4G7H C;  2SNM A;  5FLX L;  1STB A;  1H9R A;  4FYD A;  1OXT A;  2GA4 B;  3U9S A;  5C4X B;  1JOK A;  3NP8 A;  5KNC A;  3BS1 A;  4K5X A;  5JVH 3;  3ND9 A;  2J4X A;  4KJN A;  1SE3 A;  1IYU A;  2DNE A;  1UNS A;  1TWF B;  5M5X B;  1DZ1 A;  1HA5 A;  2F0F A;  3U9O A;  4CJ0 B;  2J0T D;  1EYD A;  4A3J B;  1BNZ A;  4HCS A;  2QF7 A;  3EFX D;  3HOV B;  1EOT A;  3TDQ A;  4DF7 A;  5J22 A;  2Z8L A;  5ELF A;  2JYO A;  3VA5 A;  4QB4 A;  2N88 A;  2QCP X;  2M2L A;  2D5D A;  1STG A;  2XWJ B;  1YNJ C;  2F03 A;  4OL7 A;  2PW5 A;  1FNV A;  1AZP A;  1EIG A;  4DAV A;  1SSO A;  1Z6H A;  1H9S B;  4DGZ A;  1K8M A;  1PTO D;  2AWN A;  1UUP A;  5BN4 A;  2A6H C;  1ROD A;  3G6J B;  2JXM B;  1S5E D;  2DY7 A;  3X3N A;  5M9O A;  3BZD B;  1EY8 A;  2O2L D;  1NR2 A;  1A2T A;  1TWH B;  3HOZ B;  3P7J A;  3N52 A;  1RCV D;  3FPP A;  2MP1 A;  2KOL A;  2Y0S B;  3VR2 A;  2CVR A;  2O5I C;  1D2B A;  3KLR A;  5JEA J;  3RZD B;  3NXW A;  2AUJ D;  2O4X A;  3A8I E;  4N9P A;  4ZUI A;  1PFB A;  1JWU D;  2JA8 B;  1CZW A;  1E2W A;  1RDP D;  4OO1 H;  5KND A;  3C1F A;  1QOH A;  2JEB I;  4L63 B;  1ENC A;  3NQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...