5CORA

X-ray structure of macrophage inflammatory protein-1 alpha (ccl3) n-terminal-switch polymer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 3
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 16
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5corA00
1WTVA 1B2TA 4ZK9B 2B2TA 3QO2A 1RTOA 5EKIA 3LWEA 3ONAB 5T1IA 1WTOA 2FHTA 2M2LA 5EQ0A 2HUGA 5EPLA 1SSOA 1U4PA 1B4OA 2R3ZA 2HCIA 3KBXA 1BNZA 1RJTA 1GUWA 3P7JA 2N55A 1VMPA 1M8AA 4RAUC 1C8CA 2X69A 4ZKBB 2L9HA 5E4WC 4IUVA 4O42A 2NZ1D 5E4XA 3TN2A 1VMCA 2CVRA 1Q3LA 1CM9A 1S4ZA 2B2VA 1TVXA 2FINB 2J7ZA 5D14A 2NWGA 5EJWA 4ZAIA 1WTQA 1AP0A 3FPUB 1AZQA 3HP3A 1X3QA 3R93A 2B2UC 1IKMA 1U4RA 3D6WA 1HFGA 1DOLA 2B2WA 1B50A 4IUPA 1RTNA 2MGSA 1HFNA 1MGSA 4HCSA 5CBAE 1O80A 1F2LA 1JICA 4OIJA 3UI2A 5CMDA 2MPMA 2BDNA 4HSVA 1G6ZA 2B2TC 1HRJA 2B2YA 3I8ZA 1PFNA 3IL8A 3G7LA 5EPJA 1BBXC 5AFWA 5CORA 4HEDA 2K1BA 1ML0D 1O7YA 5T1GA 1ICWA 1HUNA 2VXWA 1XYIA 1PLFA 5D65A 1X32A 4ZKCB 4RA8A 2K04A 4CJ0B 2DY8A 1NAPA 4R9WA 1NCVA 2D9UA 4IUUA 2Q8RE 4CJ1B 1EIHA 1XX8A 2L1BA 2KEEA 1KNAA 1MI2A 4HAEA 1HA6A 2XIWA 1X3PA 1WD1A 4X3UA 3DEPA 4QUCA 1DZ1A 1F9SA 2H1EA 2X6GA 3I90A 1E0BA 3TZDA 2HDMA 1WVLA 4CJ2C 5JJZA 4R8IA 4X3TA 1NR4A 2Q8TA 2RSOA 5COYA 1RHPA 3F2UA 2RSNA 4MN3A 3DEOA 1F9PA 4XT1B 4QUFA 2B2YC 1EIGA 1G2SA 1WD0A 3I91A 4IUQA 5DNFA 1DONA 3Q6SA 2HCCA 2N88A 2KECA 3I3CA 1BF4A 1LV9A 1WTRA 1WTPA 3N52A 1B53A 4UAIA 1SAPA 1RODA 2SDFA 2JYOA 1HUMA 1F9RA 1PDQA 2HDLA 2L11A 2L4NA 4NW2A 1ESRA 4X3SA 4MHEA 1JE4A 2B2VC 3GV3A 2KUMA 2RVLA 2EE1A 1J9OA 1U4MA 4OIKA 4XDXA 1QNKA 2X6LA 1CA6A 2KVMA 1AZPA 1O7ZA 1QE6A 2K01A 2KOLA 2L12A 2K28A 3IFDA 1PFBA 2MJ8A 5CBEE 4LMQD 2JP1A 1A15A 2B2WC 2K03A 2FFKB 1HHVA 1B3AA 2IL8A 1ZXTA 1ILPA 3H91A 2RA4A 1ILQA 1G2TA 1EOTA 3GV6A 3MTSA 4IURA 4X3KA 1G91A 1IKLA 1MSGA 1WTXA 1BO0A 3DM1A 1DOKA 3FDTA 2FMMA 1J8IA 2K05A 1EL0A 1KNEA 2EOTA 1PFMA 2KEDA 1SDFA 3SVMA 4XT3B 1CA5A 1F9QA 4RWSC 2NYZD 4U68A 4DN4M 1WTWA 1DOMA 1U4LA 2EPBA 5EPKA 3KUPA 2MP1A 3MWYW 1IL8A 2B2UA 2DY7A 1NR2A 1QG7A 4ZLTF 1EQTA 4IUTA 2FJ2A 1MSHA
chains in the Genus database with same CATH superfamily
1R4QB 1TWFH 4B3MQ 1JT8A 3PIOA 2QKIC 2A6HC 1SNCA 4GLXA 3DWQA 2YU9B 2OXPA 3BS1A 3I2ZA 3GQBA 3CPFA 5JOBA 3KLSA 4KY7A 5IGBA 3UDXA 5CBAE 2NZ1D 3HOUH 1IBML 2J7ZA 3I72A 5BN4A 2KCTA 3URYA 2YTYA 4B08A 1HR0Q 1HFGA 4JOIA 4X65L 3BVMA 1F2LA 2B39A 3I4MB 5IT9c 3A56A 3CKIB 1PTOF 2F0HA 3I8ZA 4FNFA 2KJXA 3AEVA 5ELNA 1JR0D 1KDBA 3O13A 2DJGC 1CKOA 4P73A 1IL2A 3S17H 1AH9A 2UXCL 1SE2A 1NAPA 3WDNA 1HH2P 3S15B 3CC2A 2CHBD 4JI6L 2RDHA 4KV6A 3K80C 1OXTA 2F0NA 1D5XC 3G6JB 2O2LD 3JAME 1Y1WB 1QZGA 1SNDA 4UY8C 3V05A 1GM5A 4IQZA 3DEOA 3D6CA 4LWCA 4YCWA 1SNPA 4Z9CB 1BCPC 2QF7A 5DNFA 2K5WA 4DGZA 3I3CA 1KLUD 3H3VH 2SEBD 3BZCA 3IKJA 3I4MG 4K0KQ 1HUMA 3D0FA 3W1BA 3GV3A 1ET9A 4ZYSA 5IP7H 2L12A 4AQYL 2ZT9C 4IJLA 3GTJH 1LT3D 2LXKA 3J81i 3A5ZB 3CMEA 5KRUA 5JPNC 1AE2A 2IHEA 2WV6D 3CCEA 3I4OA 2PQEA 2PW7A 4LFAQ 1BXTA 2F0QA 2HQEA 1SR3A 4PMCA 1CQFA 1Y1WG 1V1PA 3PUWA 3S1RB 4EVOA 4RGMA 3RMHA 4EQNA 2AQ3B 1L0YB 3WOFA 1EYGA 1PRTD 1FNUA 1A8VA 1G8ZD 1MKHA 2DY7A 1KIXA 1OO9B 2LKVA 4RGNA 3GTLB 2IW3A 3VYSA 2F3VA 3HKSA 3E9HA 4ZK9B 1IBLQ 4B3RL 2RCFA 3ONAB 3RR5A 1S5FD 4KKSA 3SHLA 4DV0Q 2HUGA 5EPLA 3J7ZC 1BR9A 3C46A 1HZ9A 1K8MA 3VYUA 2XVSA 2JA6H 1EY5A 5C44H 5GAHC 3T1YL 2NZHA 1OTCA 4A3LG 4C3IB 3TRZA 3CCRA 3M4OH 2DNCA 3GTGH 5JJLA 4DXGA 5AJ3L 3PMFA 3W3AA 2F4IA 2PI2A 5EPJA 3E0EA 5AFWA 3PUZA 3PIPA 3EBEA 4OO1I 5LMNQ 1EY4A 3RZOH 4FYDA 3M4QA 3Q24A 3GTMB 3J81E 4ALPA 2F0EA 2KEEA 4HAEA 1STYA 1XNRQ 5FJ8G 4NXNQ 2PMZB 1U0LA 3NK9A 4KHZA 4R8IA 1HNXL 1XTCD 1I50B 5L37A 2A8VA 4DNIA 4XT1B 2PZUA 4MNOA 1EIGA 1G2SA 4C3IG 1STAA 2NVYB 1NJIC 5IYCH 1N32L 4UAIA 3X3NA 2SDFA 2UUAL 2JYOA 1F9RA 1LO5D 4NW2A 4XTCS 4LF8Q 1AN8A 1GUWA 3J7AV 4DUYL 3A8KE 4G7ZC 4HIDA 4FO2A 2ZM6L 1EWIA 4K5XA 4TVAB 1IBKQ 1A3VA 5IP9H 4KD3A 2JA9A 3KDFA 4JK1C 3FKIH 2RBMA 4OO1H 1DOKA 3FDTA 1E7ZA 4HCEA 5FLMH 4JI1L 1TWHB 1X65A 1KHIA 3G6EA 3Q8DA 3U58A 2KCMA 1HTPA 1VQDA 2B2UA 2K5NA 2R92B 1XNQL 1S3OA 4C3JH 2FJ2A 3AMUA 1A3UA 3IAYA 1C0AA 1VQ9A 4BBSH 2A69D 2JA8H 3HOVH 3HGBA 4DV4Q 1X56A 4L6TB 4GN3B 1B4OA 3ULJA 3M9BA 1N36Q 1VQ4A 2RKSA 3NWSA 3DWAA 1TVXA 1EUJA 2N8NA 3KYHC 3S9WA 3HP3A 4A3KH 4G4KA 4KI0A 4QGUA 4LK1C 3VDYA 1VDZA 1HQMC 3CU7A 4ULLA 5C0XG 2Q2UA 2R92G 5FKAC 3VR5A 2K1BA 1FD7D 4DNRB 2JA5B 2A69C 3SDZA 1E24A 2D9UA 4DR5L 1QVGA 1SFOB 2I5LX 3Q23A 3S1QH 2D62A 4A3FH 1LM0A 1CFMA 1AW7A 3J80i 5A2QE 4JI0L 4G57A 4JOIC 4R4IA 4X3TA 4M8AA 4LF9L 1RHPA 2FMCA 5FLXc 1AFPA 3BU2A 2R7ZB 2NVXB 3PIO3 1SE8A 4K6LA 1SMYC 3HRZC 2F03A 4PG3A 3AFPA 1EY0A 1PZKD 2QDLA 3N6RA 1C7YA 2AQ1B 5CV4A 1YIJA 4OL7A 4XIGS 4ME5A 5M5YH 3E9IA 4DAPA 1XPUA 2B2VC 4QUFA 3CQZB 1DONA 1C4QA 3DUZA 4JVZA 1LTRD 5ELFA 2JA5G 4M1UB 3EQLC 3NTHA 2IL8A 2EYPA 4DUZQ 1EQQA 1YNNC 3PUYA 1L1OB 4XQQA 1IZ6A 1FL0A 2P5ZX 1ZYRD 1J8IA 1EY9A 1W2BA 1FGUA 4PQXA 3TBIB 2WFWA 1OXXK 2LY7A 3OYYA 2F0SA 1XXGA 1Q7YC 2R7ZG 3K8AA 4ZLTF 2QW7A 2QGQA 1VS0A 4HMIA 2PNRC 4BWGB 4KN7C 2F4VL 1WTVA 5HY6A 1M4VA 1TY0A 3QO2A 1Q86C 3GTKH 1BCPF 5IODA 1OXSC 4H7BA 5C0XJ 5EQ0A 1QUQB 4KTAA 1E1TA 4F88A 1FR3A 4A3GB 3A55A 1VQOA 1PTOC 3J80E 1HNWL 3BZKA 4RFBA 2E2JH 5AJ3Q 2VB2X 3PUVA 4LF5L 2R6GA 3K81C 3QB3A 3HOYH 3P1HA 1L1OA 3PO2B 3OMGA 3VR6A 5JEAG 1EYAA 1TR5A 1SLJA 4HCSA 3TP8A 1TQOA 1Q46A 2PW5A 1JMCA 3NEMA 1EOVA 1PYBA 1K8OA 1I4HA 2B2YA 3A0JA 1Z47A 3MXPA 4YY3L 3CCVA 2UU9L 1HUNA 1HNXQ 3S24A 1D2BA 1K9MC 1VQ8A 1X32A 1VQBA 1TIID 5KNCA 1EU3A 1H9JA 1K0RA 1EIHA 4UPAA 1WCMB 1EZ8A 4A3GG 4IPCA 1F9SA 2EYOA 3AQQA 1B3QA 1WVLA 1QB5D 1SE4A 3R2IA 5FK9C 1GHJA 1A62A 1TS3A 4R4OA 1QVFA 3EN2A 4YIJA 3PO2G 1JWMD 2SOBA 4HJAA 2O5JC 2TMPA 2ZM6Q 2YU9H 1UUPA 1ZKOA 2KHIA 3GTQB 2EYLA 4RKLA 1XJVA 1BUVT 3U4ZA 1ESRA 3PF5A 1WD0A 1F77A 1U4MA 1X3EA 5D3IB 1A63A 4LMQD 1I3QH 2FXQA 1HHVA 3CCQA 4RKBA 4P75A 3TEHB 4P2CB 1DCZA 2NTTA 4RGTA 2VQFQ 1WCMG 4JW0A 2E2DC 3CPWA 1PMRA 1PH8A 3EJIA 4JI7Q 2N3SA 3PCOB 1GVPA 1TWGH 3J81L 1PH1A 5ELBA 1LYLA 4CDEC 3Q22A 2QEXA 5EPKA 3QWNA 3NXWA 2F0MA 1RIPA 1KL9A 1CSQA 4JG2A 5JEAJ 5IY0A 3C2PA 1KRSA 4IZ8A 2J4XA 3KK7A 4AH6A 5IT9E 5F2DA 4MTKA 2CCZA 1QVCA 4FF3A 1S5BD 4DV3Q 4S3SA 4K0KL 1RF2D 2M2LA 1PRTB 3NBIA 1C8CA 5LL6X 3H6MA 4IUVA 1R4PB 2CVRA 3BDCA 5I4DA 2DGYA 1IW7D 2B2UC 3HOZB 1PYSB 4ODGA 1YEZA 4KJOA 4LFAL 1O80A 4X6AH 3LNNA 2KQ3A 4XQNA 3K0YA 4HSVA 4V190 1DM0B 2JK8A 1PFNA 4WRDA 2R7DA 4HEDA 4A3LH 2EJFC 1ICWA 1W6KA 4WJ4A 1D6EC 4LF9Q 5DM73 3S1RH 3HOWB 4R4TA 2L1BA 1KNAA 4DV5Q 2XIWA 5KYIA 3DEPA 3STBC 3A8JE 4DV0L 2X6GA 1LT4D 4DV7Q 3GTLH 3QG1A 5C4JB 2F0WA 2F0DA 1TWCB 1T5XD 3K6OA 4KKTA 1Q82C 1A2TA 4DR3L 4K5VA 4DPGA 3I91A 3HOZG 5FJ8H 4P74A 2KECA 4OGQC 3S2HB 5ISRA 3CRKC 4DK1A 2IX1A 2AWOA 3S1NB 4A3EB 2F0JA 3MXNB 1E22A 1H9SA 2K28A 4C3IH 2K5HA 1Y14B 1UAPA 5LMNL 1W6JA 3TP5A 3Q0AA 1B3AA 4NP5A 4J1MA 3H91A 2RCNA 3HOWG 4C3HG 3OIQA 2OTJA 5HGTA 1YNJC 4LF4Q 4BXXH 1SN8A 1XNRL 1GJXA 2F4VQ 1SYCA 4NXNL 1EL0A 3KOJA 2EY2A 4DK0A 2ZXPA 4GN5A 4NDXA 2A5HA 1EQTA 1SEBD 4TQUS 3H3VC 4R8NA 5IGGA 1WI5A 2A6HD 1EWHA 4LF5Q 4YHHQ 3OIPA 2VZAA 2PZWA 2ICEC 3MXNA 4A3EG 1SRUA 3OSOA 2BH8A 4BBRB 2PYKA 3VR4A 4LF7Q 2NVYH 4HIKA 3W1GA 4GOPB 1XWEA 1IBKL 3RZDH 2OF1A 1U4RA 2UU9Q 3T53B 4F7XA 2B3GA 4PMWA 1G6ZA 1XTDA 1EY8A 4A3IB 2IX0A 2NN6G 4WFN3 3ITPA 2KCNA 4GKKL 3H3VI 4R9WA 3F2BA 4HJ8A 1LT5D 1X3PA 4HJ7A 5I2YA 1L1OC 1NTGA 2NTSA 2R92H 4DV4L 3F1ZA 1E0BA 4BBRG 4OWXB 4CJ2C 1ESFA 3MZ5A 1N36L 1VQLA 1BCPD 5IWAQ 1DJRD 1GXDC 4GOPA 1VQEA 2F52A 4JI3Q 1E3PA 4MN3A 2J0TD 3V2TA 4DV1Q 1YBYA 1PZID 2B2YC 3J80L 1JB7A 2XWBB 2QDBA 4JI8L 1U5KA 1FJGQ 4X3SA 4A3IG 5CV8A 2E5LQ 2KOLA 1GUGA 1PV4A 2FFKB 1N33Q 3DXJC 3L2PA 1S5DD 1EFID 2RA4A 2KBNA 4X3KA 3P75A 4BA1I 1SYGA 4UP9A 4KHPQ 2Z4IA 4X62L 1NMGA 1WTWA 2JA5H 1GHKA 3EFXD 2MP1A 4KD4A 3R3OA 2Z6BA 3ICEA 2L55A 1PH2A 4C2MB 1CTMA 5M3MB 4L5TA 5IGFA 4QQBX 3J7YW 1VCIA 1YNXA 3GTPB 2RHSB 2WINB 2R7ZH 2D2CC 4HIOA 1M8AA 2C35B 3W2DA 3TZDA 2E2IH 1K73C 1Z9FA 3T13A 4JV5Q 4P71A 1DXMA 1JOKA 1PYWD 1QWYA 2ID0A 3NTKA 4NPSA 4DUZL 2HT1A 2B2WA 5JVG3 3T1HL 5FLXE 1MGSA 1GUNA 1Q8IA 1HPCA 1AE3A 3NHHA 5G3LF 5CC4A 1HRJA 3UE0A 2AHOB 2ENBA 4IFDI 2A68C 4BY7H 5M3MG 1TKWB 2VXWA 5JEAH 4JI2Q 1UWVA 3MC0B 4K2LA 1E2VA 4CJ1B 4HIMA 4DR3Q 4GNXB 3U4VA 4FF1A 4GN4B 2B29A 3BYYB 2XSCA 4DR1L 1KD1C 4CKCA 1IYUA 3RNUA 4BA2I 1BBUA 4A3GH 4MZ9A 3N52A 2F0KA 2Z9HA 4J15A 3S14B 1T5EA 3PUXA 2KUMA 5I2XA 1PFBA 1OXUA 2K14A 5C4XB 2JJQA 1R9TB 1E1OA 3NE5B 1EOTA 2F0UA 3MVVA 1B9MA 4A3MH 5I9OA 4IFDH 4A3DB 1MSGA 3DM1A 3ZJYC 2K05A 5M9OA 3J7A5 5A35A 4B9XA 4DV2Q 5BR8Q 4DFAA 3RLOA 1WCMH 4NMZA 2NVTB 3NP8A 4H02A 2I07B 4QY7A 1WTOA 4OELB 2B8GA 1IYJB 1BNZA 2HCIA 1RJTA 4A76A 5C4XG 1VQNA 3GTQH 4A3BB 1V1OA 2NWGA 4HSPA 2ICIA 1TS5A 1SNOA 4A3DG 4L63B 5M5WB 5IYDH 1Q12A 4HN7A 1DOLA 1HZBA 2VQFL 1LTBD 1RTNA 4IPHA 3TSSA 3C1FA 4GKKQ 2ES2A 4JI7L 2JA7B 4A3CG 1PH7A 3TS2A 1LTLA 1KAWA 5JVH3 3SXHA 3ULLA 1ICFB 2JE6I 1ML0D 2NBFA 4XYQA 1PLFA 3S16B 2O5IC 1ENFA 2DY8A 3M7NA 3HG9A 1J5EQ 1D7QA 2QILA 2MHVA 4DV3L 4YCUA 3RLFA 4JI8Q 3CAMA 1JORA 3M7GA 3VA5A 1S5CD 4ME3A 2RSOA 2ZXRA 1JJCB 3H0GB 3F2UA 1SMYD 2RSNA 4L8JA 4A3BG 2OEOA 3D4WA 1MHWC 2BOSA 3DHQA 2VY3A 1Q1BA 1QNUA 4X64Q 1PHJA 4A93H 5KNDA 4C56C 2JA7G 1STHA 4TRDA 1K8AC 3K5MA 2L11A 3MXUA 3OW2A 1Y8NB 4FXKC 1BKBA 4WORA 1QNKA 1O7ZA 3GTOB 1K28A 4X62Q 3HOZH 1YNND 1YJNA 5C3XA 5IGCA 2I46A 2CFMA 4GOPC 4A3JB 1V9PA 4IURA 2N49A 2PI2E 1F2YA 3OPOA 4DV5L 3A5UA 3C1EA 1LTGD 4ZCKA 4G7OC 2RQXA 4XT3B 1CA5A 3SK8A 1LTTD 4I7ZC 4DV7L 2F1MA 4L5RC 3KJPA 3H0GG 4CGYB 1VQJA 1I4GA 2KA7A 1STNA 3HOWH 5CV5A 4IUTA 3MA2B 4J8QA 5M5XB 4FF4A 2EXDA 1PTOD 2CQOA 1XPOA 5K36H 1TWCH 2EY6A 5FO8B 2DNEA 3PO3H 1KC8C 1CZWA 2R3ZA 1GO3E 3T1HQ 5ELEA 1WOCA 2N55A 4N8FA 4DAYB 3E6ZX 3AFQA 4G7HC 1KQSA 4A3JG 4J6HA 1WTQA 2OQKA 4RHSA 3JAML 3PSIA 2Q8IB 4A3EH 3D6WA 3E0JA 3NELA 2Z1CA 4LF4L 2VQEQ 3RN5A 3U50C 2MPMA 5KIXA 1UEAB 1PA6A 5IP7G 2EXZA 4FF2A 3RD4A 1SYBA 2Q2TA 5DLQE 4DR1Q 1XYIA 2BA1A 2I5HA 3R2TA 2VUMB 1HZAA 1MJCA 2EY5A 1FNVA 1KAAA 2MQHA 1SYDA 2NUCA 3MFGA 4HJ5A 4YHHL 1DD2A 1Q90A 1UNSA 5E1FA 1KABA 2EYJA 4DR4Q 4MTNA 1EY7A 2NN6H 4B3TQ 2A6EC 4BY1B 2HDMA 2AUJD 3H09A 4LF7L 4UHVA 3KLWA 1Q81C 2HIVA 1GUOA 4YWMA 4Y7NH 2SNSA 5FO7B 4OX9Q 1BF4A 2RDFA 4A75A 4BBRH 4ZUJA 2F0OA 4JBJA 4RCOA 1JE4A 4GLAC 3M3YH 1J9OA 4GS3A 1QUQA 3L7ZC 2WB1B 1CI3M 1A2UA 2KVMA 4JC0A 5FLXL 2RDGA 2V4DA 3NQTA 3IFDA 2MJ8A 3BDLA 3L9AX 2VUMG 1NNXA 2ZJPA 3CCSA 4IOCA 5G3LD 3CMAA 1ILPA 5LMUQ 1G91A 1JCKB 3E3XA 4CDDC 4QCLA 4A3IH 2F0IA 3NQIA 1WTXA 1PH9A 4BY1G 5J39A 1HZCA 2E8GA 2NYZD 1U4LA 3FEWX 4XXEA 5IWAL 1EEID 4JI3L 1D1KA 4DV1L 2YTXA 4LUOA 1ET6A 1YVCA 1Y8PB 5TSSA 2K75A 5CV6A 4LNQA 3KF6B 1JJGA 1E2WA 2B2TA 4NXML 1RTOA 4K6DA 1FJGL 2R7FA 3I4MH 4F87A 1QOHA 2OQ0A 4EQ5A 1UE1A 3OTOL 2WB1G 1SYEA 3NPPA 2E5LL 2OTLA 1VMPA 3K7AB 3S2DB 3I4LA 1B1ZA 3PIP3 2IY5B 1ZEQX 2K5VA 3TN2A 4V0BA 4JBMA 2FINB 3SE0A 3K0XA 1ONLA 3TREA 4X66Q 1N33L 5KYLA 4C3JB 3GO5A 2IPKD 3FPUB 5IYCG 3S15H 3ERQA 4OWTB 3OWFA 4KHPL 2PQAB 3D31A 4BBSB 2BE5C 1CHQD 1T9HA 1Y1WH 2JA8B 3K5OA 1Y69U 2Z6KA 5IYBG 4YCVA 4AYBE 2Z4HA 5LHY1 1HNZL 1BBWA 5T1GA 5IOCA 3NBHB 1G51A 5D65A 2NVQB 3W5OA 2E74C 2UUBQ 3OMCA 1K83B 4DU9A 5IP9G 3STBD 3AYHB 4O0AA 4OO1G 1NY4A 1YHQA 1JOOA 2CH4A 2IHFA 5CGKA 1YHAA 5J3BA 1SXTA 2EZVA 5JJZA 5M3MH 1D8LA 3VR3A 4NKLA 1G291 5HGQA 2K5DA 2A73B 4C3JG 2CWAA 3HFZB 3TP6A 4DR6Q 1GOZA 1VF7A 3D3RA 4JV5L 4IJHA 1CKMA 1WTHA 3GTPH 4H0LC 3CC4A 1WTRA 2UUCQ 5DAUA 4BBSG 2L0CA 3D4DA 2JA8G 3S1QB 1V43A 1PDQA 2HDLA 2ASBA 1O7LA 4R4QA 2XGTA 4C3HB 4XDXA 1QCBD 1AZPA 3S1MB 4LJZC 4WJ3M 3KJOA 1CZGA 1YNJD 4DK6C 4JI2L 1V8QA 3T56B 2JQOA 3FRPB 3M85A 4POFA 1ILQA 3OOCA 1G2TA 2R61A 4ZRZA 3A74A 4IUNA 4BS9A 2WKCA 2EIFA 4ID6A 1Q1EA 2EOTA 2PO4A 2KEDA 3CHBD 4K8IA 3RUZA 4RWSC 1EQRA 4TKOB 1JOQA 4O2DA 5EKKA 2EPBA 1I4XA 2F0FA 3FVQA 3TS0A 2N78A 1CUKA 1IL8A 1D5MC 1NR2A 2C5CA 1QG7A 1IHZA 1AEXA 3UDFA 1B8AA 3ZYYX 3K5LA 2K03A 3R8BA 1STEA 4KKUA 4LW1A 1K8GA 2Q2IA 3J7AF 1D5ZC 4Q0FA 5JJKA 4DV6Q 2OCEA 4EQOA 3M4YA 2BA0A 1WFQA 3SEBA 4JI4Q 2WB1E 4RAUC 5I9PA 1MIUA 2PCFB 5E4WC 1M90C 5EKLA 4B3SQ 5E4XA 3I4NB 2WACA 2VB3X 3S14H 1D1IA 1AP0A 3GTMH 2AQ2B 1YI2A 5A2QL 1B50A 1SE3A 5C0XI 3GTKB 4TSSA 4RGOS 2F3IA 4R1JA 5C4XH 2A19A 2Z8LA 1CQVA 4LUVA 1R9TH 1I50H 3KBGA 4DV2L 2BCOA 5BR8L 4A3DH 1O7YA 3LWUA 4FDBA 5CV9A 5EBDA 4POGA 1HCZA 2LXJA 3HOYB 3CCMA 4C1NI 4A3CH 3I56A 1WD1A 4RH6A 1J6QA 1H9MA 3ND9A 4OXPA 1X6OA 4QUCA 4B9WA 3ULPA 2H1EA 1KRTA 1NR4A 5M3FB 4CKBA 3CCLA 4IO9A 4DKAC 3I4NG 3SK5A 1F9PA 2NVTH 1GD7A 3MEFA 1MD2D 1E2ZA 1CKNB 2A74C 2GN5A 1I6VC 3EVQA 1RODA 2NZOA 4KHVA 2BDOA 4PZ8A 4UP7A 2MO0A 1TWHH 1QJOA 1EIFA 2EYFA 5M5WH 5C0XH 2K32A 5CBEE 5I6YA 1A15A 1N9WA 2E75C 3HOYG 5EAYA 4JPBW 2CWPA 2WAQE 2JA7H 3MTSA 1VQFA 1J5EL 4DA2A 4DNTB 2HIXA 4QMGA 3H15A 2VNUD 4RG1A 1BO0A 1K3RA 1HR0W 1QILA 2FMMA 3HKZE 2EJGC 5DEHA 3SVMA 2LFNA 3A54A 1F9QA 4NXMQ 5M3FG 1EYDA 3TQYA 5FOBB 3S16H 1EZ6A 2G9HD 1SNQA 2K52A 1UE5A 3F2DA 3OTOQ 4FXDA 3TZUA 1I3QB 1KDCA 3FMCA 4DF7A 1CKNA 2QEJC 3MEHA 3NWTA 1L0XB 1YHBA 1IYVA 1SJHD 4X64L 1O78A 1RD9D 2F0TA 2MFIA 3H0GH 1TY2A 1TWGB 1V1QA 3KBXA 4RHRA 1PXUA 4O42A 2B2VA 5EJWA 5C3EB 1I94Q 5IGDA 1X3FA 1HNZQ 1X3QA 1PTOB 1VQIA 1SFOH 1LACA 5GADC 3TDQA 3GDEA 1V1PB 2MGSA 4H13C 1LT6D 1GUTA 3GTOH 5E7NA 4OIJA 4QB4A 1DYQA 4JYAL 4I7AA 2A68D 2B2TC 3IL8A 3G7LA 3JC66 4A3JH 3G48A 1M1KC 1I6HB 3KF8B 2F3WA 2NVXH 5E3FA 1XMQQ 3KLRA 3DWPA 3BZDB 2Q8RE 4O1NA 3HOXB 4X3UA 2M9VA 1S5ED 2WIIB 3I90A 3CQZH 2UXBQ 1HXYD 2B63B 3NENA 2LS01 3HS0C 5M5XH 3AU7A 5COYA 1ASZA 4LFCQ 5C3EG 2Z6KC 3QR8A 3P20A 1N8RC 4IUQA 4YWKA 4Q5VA 2HCCA 4GKJL 2N88A 1VQAA 1B53A 2VQEL 4OONA 5CV7A 1PVOA 1EEFD 3KF8A 5IT9L 2K01A 5D3DA 1UE6A 3TMEA 1I4PA 4KLKA 2R93B 3M4PA 3UE1A 2Y0SB 4K2KA 3HOXG 1IKLA 1LLRD 2DN8A 4LF6Q 2RF4A 4DR4L 1GKHA 4EX5A 4B3TL 2B63G 2AKWB 1Z7TA 1L2FA 3B6YA 2YV5A 2VUMH 4LFBQ 2IX3A 3KUPA 4P72A 1SYFA 3CP0A 1Y1VB 4DR2Q 4FXGC 1PRTC 1MSHA 3PO2H 5LMNW 1N34Q 4UP8A 4OX9L 4BY1H 2E2HB 1B2TA 5H1SE 1BOSA 4QF4A 1WYDA 3T51B 2FHTA 4GNXA 1XMOQ 3VR2A 4U673 1JC7A 2H4OA 1SROA 5C5MA 4LUZA 2K6AA 1EY6A 2UXDL 1CM9A 4ZAIA 1HA5A 2R93G 4GZYC 1TT2A 3KDFB 2Y0SG 5LMUL 4IPDA 1FYCA 2XN9C 3D8GA 3VYTA 1VQ5A 3GP7A 1JB3A 1UEBA 4KJNA 1EIYB 2LSSA 2EYMA 1CSPA 1Y8OB 2HHHQ 2PNHA 3I55A 5CORA 3DLLA 1CT1D 4QIWB 1VQMA 3F2CA 1Y1VG 3K59A 5CYUA 1ASYA 3TP7A 3IRBA 3PQIA 1TWAB 1ENAA 1O7IA 3RZDB 3V96A 4E6IA 4BXXG 1NSNS 2EYHA 3NSWA 5IYBH 2KHSA 3T4AC 5EGTA 1TWFB 4QL5A 3QJYA 3QIAA 5BN5A 4PZ7A 1WJJA 2ZTEA 3FHWA 2KCCA 4X66L 1X54A 1BDOA 4ZUIA 1SNMA 2OWOA 3HOUB 4H44C 1LV9A 2YTVA 2EY1A 3K7AH 3S2DH 5IE8A 1FNWA 2L4NA 1K0SA 4WJWA 1P8LA 2F0PA 2RVLA 1NUCA 4DR7L 4EGVA 2X6LA 2F0LA 4AIMA 3HZXA 1QE6A 1B9NA 3T16A 1A6XA 1IBMQ 2EQSA 3JAMc 2ZTCA 4PNYA 2UUBL 3ER0A 4KK7A 3DMUA 3J81j 4X65Q 3S17B 2L5TA 3K57A 1VQ6A 1PFMA 2HD3A 3MFYA 4NB3A 3X3MA 1P16A 4U68A 4YWLA 2NVQH 1YITA 2EVBA 1BVSA 1NBWA 2E76C 1K83H 4EQPA 1STGA 2F0VA 3D4RA 1PZJD 4DR6L 3IFTA 3SK4A 2UXCQ 3HOUG 2MNAA 2UUCL 4JI6Q 4KY5A 5EKIA 5EBCA 4CDFC 3G4SA 3FP9A 5GROA 3ND8A 5C4ZA 2L9HA 4JYAQ 1VQCA 2XNAC 1AZQA 4JBKA 4AYBB 4N9TA 1Z6HA 1JWSD 2M00A 2Y0SE 4ABNA 4JI5L 4C3HH 3GTJB 4IOAA 2NN6I 3S1MH 4Y52H 2K5QA 2PZTA 1JICA 1C48A 1RKNA 3K5NA 5C4JH 4IN3A 3E5SA 3CXCA 2DUDA 4C1NK 5IGEA 4AQYQ 1H9RA 2ATWA 3EROA 4JCVE 1LTAD 2E2IB 4ZKCB 2K04A 3I70A 2G5DA 3S2HH 2JEBI 1XX8A 2A6ED 1MI2A 2XWJB 2CKZB 1MBYA 2CQAA 2GA4B 4DV6L 3CC7A 4GKJQ 2QCPX 1LABA 3S1NH 4CBVA 1NE3A 2HQLA 1JQYD 4JI4L 2IT1A 5I6WA 3KLSX 5GQOA 4RCNA 4B3SL 4AYBG 1PH5A 3BYTB 1EWCA 4BY7B 1VQGA 1EU4A 2MUYA 1S40A 3Q6SA 2JA6B 2ZJQA 2ZXOA 2PMZE 4B3RQ 1U9RA 1VQKA 5C44B 1SAPA 3BJUA 5LL6S 1B7YB 2AUKA 1TS2A 3I4NH 3J81c 3A8IE 5FO9B 4QIWE 3M4OB 3FPPA 4DAYA 3GTGB 2JP1A 2B2WC 3AB9A 4KMUC 3T1YQ 2MO1A 4KN4C 3NUCA 3GV6A 1KLGD 2JEAI 3VYRA 3RZOB 2AMCB 1VQ7A 2G9DA 5IIFA 4XQJA 2D5DA 1ENCA 1ZYRC 4OEMB 3F8TA 1TS4A 4BY7G 1BCPB 3LGJA 1L0WA 4L5SA 1TXYA 2ZJRA 2JA6G 2I5MX 4OWWB 4L5QA 4ILWA 4APVA 2LMCB 2UXDQ 5C44G 3CCUA 4A3MB 3UDIA 5ELCA 1TU2B 5M3FH 2F0GA 4IALA 1MJEA 3OWEB 3PGZA 1FGBD 1SSOA 1U4PA 3KFUA 1YJWA 3P7JA 2K7VA 4CHTB 4ZKBB 5NUCA 4R4CA 1VF5C 4A4IA 2KENA 5KNBA 2XTIA 1VMCA 2PPBC 1S4ZA 3EIVA 4N9PA 2K33A 5DM63 5D14A 4B3ML 2VL6A 4LAAA 2SNMA 2BE5D 1FVIA 1IKMA 1X3GA 1LTID 2C9OA 4UDUC 1N32Q 1KTKA 1HFNA 5JAVA 1YJ9A 2UUAQ 3UI2A 2V1CC 2BDNA 1KDAA 4K14A 5HURA 2Z0SA 3FKIB 4HR7B 3SGIA 4DUYQ 1STBA 3K7UC 2JN4A 1G6PA 1CK1A 3BVGA 4GNXC 3PF4A 1HR0L 4XYOA 4RA8A 2ZTDA 4CJ0B 3VA7A 5BN3A 5C4HA 4A3MG 4IFDG 2BH2A 4KY6A 1HA6A 1A0IA 1PRTF 3SK6A 4F8MA 4JI1Q 3U9SA 1S72A 1XPRA 3HOVB 2XRQD 1H95A 1XNQQ 2OT2A 1Q8KA 4DR7Q 5GAEC 4FVMA 1I94L 2JSOA 2D0OA 1DGSA 5ELOA 1IXRA 3A7LA 1WTPA 1RDPD 1VQHA 1LUZA 1I5FA 3KF6A 2L15A 2WAQB 1B44D 4A3KB 4CDCC 3FKIG 4QJFA 2EDGA 4OIKA 5C3EH 1CA6A 1DZ1A 1VQPA 4MIUA 2JXMB 1PTOH 3HKZB 5FLMG 1X55A 2EJMA 1H9KA 4C2MH 1ZXTA 1JWUD 1PFSA 5IYDG 1XMQL 4CKEA 2IWHA 3CF5A 3OW7A 1X9NA 5C5LA 2VW9A 3DM3A 1KXLA 2WP8J 4A93B 1I4RA 2CW0D 2PQAA 2Q2HA 1I6HH 3BG3A 1SDFA 2K4KA 1UE7A 3L3OC 3SR1A 2UXBL 3HOVG 5J22A 4A3FB 1II3A 3MWYW 2CH4W 4LFCL 1JJ2A 2GVAA 1EQVA 3HOXH 3NBHA 2XRSD 4DAVA 3CRLC 4DR5Q 4K8JA 2B63H 1I4QA 2WAQG 4DAMA 4A3KG 3LWEA 1EYCA 1HQRD 3I73A 2NB0A 4JBWA 5T1IA 1BQQT 3I7FA 4I65A 4JI0Q 5J1ZA 2IJ0A 3C3LA 1SBBB 4JI5Q 1H9SB 1EFWA 3HKZG 4RMFA 2B8FA 3H94A 5GAGC 3GD7A 1RCVD 2RHQB 2X69A 3NTIA 3WWVA 5M5YB 4IFDJ 1Q3LA 1IBLL 4DXFA 2WKDA 3G71A 5C6AA 2CW0C 3HEJA 3R93A 2GVBA 2VS1A 4ZQ3A 4A93G 3BVZA 4N8X1 3BDOA 4IUPA 4LF6L 1HJPA 1IW7C 3QOLA 5CMDA 4HMJA 1HTLD 3PO3B 3OHXC 4GLVB 3LX0A 1W3SA 4A3FG 4LFBL 2ALYB 1BBXC 1JE5A 4DK3C 3MHBA 2R93H 3QOJA 3PV0A 1F2MA 4HJ9A 4DR2L 3K58A 1K3BC 3J80c 1NCVA 1N34L 2YYZA 4IUUA 4PMBA 1YZ6A 2H5XA 2AWNA 1XMOL 3UDGA 5JPMC 1A3TA 2O4XA 1Y1VH 1QZHA 1B70B 2Q8TA 2K50A 5CR3A 1OXVA 2DJFC 2E2HH 2D0PA 1CHPD 3RLNA 2E2JB 4FP5D 4HTHA 5K36G 4IPGA 3CW2C 5K5PA 3PO3G 3CD6A 1F2ZA 4MHEA 5JJIA 3RN2A 1C9OA 1GUSA 2EE1A 2I0QA 1LTSD 2HHHL 1HNWQ 3WOEA 1SMXA 4PV1C 2TSSA 1NMFA 2KHJA 3MXGA 3A7AB 4Y7NB 4LF8L 3ERSX 3U9OA 3MAQA 3JAMi 1PH3A 5ELDA 1KNEA 5KGUA 5KEEA 4DN4M 1SJED 3CCJA 1DOMA 1PH6A 3M3YB 1TWAH 4OHJA 4YY3Q 4PZ6A 3L0OA 4A3BH 2A1AA 4K5WA 2QA4A 1RL2A 1PH4A 3EA6A 5C3WA
chains in the Genus database with same CATH topology
1R4QB 2QKIC 2A6HC 1SNCA 3DWQA 2YU9B 2OXPA 3BS1A 3GQBA 5JOBA 3KLSA 4KY7A 5IGBA 5CBAE 2NZ1D 2J7ZA 3I72A 5BN4A 3URYA 4B08A 1HFGA 3BVMA 1F2LA 2B39A 3I4MB 3A56A 3CKIB 1PTOF 2F0HA 3I8ZA 4FNFA 2KJXA 1JR0D 1KDBA 3O13A 1SE2A 1NAPA 3WDNA 3S15B 2CHBD 2RDHA 4KV6A 1OXTA 2F0NA 1D5XC 3G6JB 2O2LD 3JAME 1Y1WB 1SNDA 3V05A 4IQZA 3DEOA 3D6CA 1SNPA 4Z9CB 1BCPC 2QF7A 5DNFA 2K5WA 4DGZA 3I3CA 1KLUD 2SEBD 3IKJA 1HUMA 3GV3A 1ET9A 4ZYSA 2L12A 2ZT9C 1LT3D 5KRUA 5JPNC 2WV6D 2PQEA 2PW7A 1BXTA 2F0QA 2HQEA 4PMCA 1CQFA 1V1PA 3PUWA 3S1RB 4EVOA 4RGMA 3RMHA 4EQNA 2AQ3B 1L0YB 3WOFA 1PRTD 1FNUA 1G8ZD 2DY7A 1OO9B 2LKVA 4RGNA 3GTLB 2IW3A 3VYSA 2F3VA 4ZK9B 3ONAB 1S5FD 4KKSA 3SHLA 2HUGA 5EPLA 1BR9A 3C46A 1K8MA 3VYUA 2XVSA 1EY5A 4C3IB 2DNCA 4DXGA 3PMFA 3W3AA 2F4IA 5EPJA 5AFWA 3PUZA 4OO1I 1EY4A 4FYDA 3Q24A 3GTMB 3J81E 2F0EA 2KEEA 4HAEA 1STYA 2PMZB 3NK9A 4KHZA 4R8IA 1XTCD 1I50B 4XT1B 2PZUA 1EIGA 1G2SA 4C3IG 1STAA 2NVYB 4UAIA 3X3NA 2SDFA 2JYOA 1F9RA 1LO5D 4NW2A 4XTCS 1AN8A 1GUWA 3J7AV 3A8KE 4G7ZC 4FO2A 4K5XA 1A3VA 4KD3A 4JK1C 2RBMA 4OO1H 1DOKA 3FDTA 4HCEA 1TWHB 1HTPA 2B2UA 2R92B 2FJ2A 3AMUA 1A3UA 3IAYA 2A69D 3HGBA 4L6TB 1B4OA 2RKSA 3NWSA 3DWAA 1TVXA 3S9WA 3HP3A 4G4KA 4KI0A 4LK1C 1VDZA 1HQMC 3CU7A 4ULLA 5C0XG 5FKAC 3VR5A 2K1BA 1FD7D 4DNRB 2JA5B 2A69C 3SDZA 2D9UA 1SFOB 3Q23A 2D62A 1CFMA 1AW7A 5A2QE 4G57A 4X3TA 4M8AA 1RHPA 2FMCA 1AFPA 2R7ZB 2NVXB 3PIO3 4K6LA 1SMYC 3HRZC 2F03A 1EY0A 1PZKD 3N6RA 2AQ1B 5CV4A 4OL7A 4XIGS 4ME5A 4DAPA 2B2VC 4QUFA 3CQZB 1DONA 1C4QA 3DUZA 1LTRD 5ELFA 4M1UB 3EQLC 3NTHA 2IL8A 2EYPA 1YNNC 3PUYA 4XQQA 1ZYRD 1J8IA 1EY9A 4PQXA 3TBIB 1OXXK 2LY7A 2F0SA 1XXGA 4ZLTF 4HMIA 2PNRC 4BWGB 4KN7C 1WTVA 1M4VA 1TY0A 3QO2A 1BCPF 5IODA 1OXSC 4H7BA 5C0XJ 5EQ0A 4F88A 4KTAA 4A3GB 1FR3A 3A55A 1PTOC 3J80E 4RFBA 2VB2X 3PUVA 2R6GA 3QB3A 3P1HA 3PO2B 3OMGA 3VR6A 5JEAG 1EYAA 1TR5A 4HCSA 3TP8A 1TQOA 2PW5A 1K8OA 1I4HA 2B2YA 1Z47A 3MXPA 1HUNA 1D2BA 1X32A 1TIID 5KNCA 1EU3A 1H9JA 1EIHA 1WCMB 1EZ8A 1F9SA 2EYOA 1WVLA 1QB5D 1SE4A 3R2IA 5FK9C 1GHJA 1TS3A 4YIJA 1JWMD 2SOBA 2O5JC 2TMPA 1UUPA 1ZKOA 3GTQB 2EYLA 4RKLA 1BUVT 1ESRA 1WD0A 1F77A 1U4MA 5D3IB 4LMQD 1HHVA 4RKBA 4P2CB 1DCZA 2NTTA 4RGTA 2E2DC 1PMRA 3EJIA 3J81L 5ELBA 3Q22A 5EPKA 3QWNA 3NXWA 2F0MA 5JEAJ 3C2PA 4IZ8A 2J4XA 3KK7A 5IT9E 5F2DA 4FF3A 1S5BD 4S3SA 1RF2D 2M2LA 1PRTB 3NBIA 1C8CA 5LL6X 3H6MA 4IUVA 1R4PB 2CVRA 3BDCA 5I4DA 1IW7D 2B2UC 3HOZB 4ODGA 4KJOA 1O80A 3LNNA 2KQ3A 4XQNA 3K0YA 4HSVA 4V190 1DM0B 1PFNA 4WRDA 4HEDA 2EJFC 1ICWA 1W6KA 1D6EC 5DM73 3HOWB 2L1BA 1KNAA 2XIWA 5KYIA 3DEPA 3A8JE 2X6GA 1LT4D 3QG1A 5C4JB 2F0WA 2F0DA 1TWCB 1T5XD 3K6OA 4KKTA 1A2TA 4K5VA 3I91A 2KECA 4OGQC 3S2HB 5ISRA 3CRKC 4DK1A 2IX1A 2AWOA 3S1NB 4A3EB 2F0JA 1H9SA 2K28A 1UAPA 1W6JA 3TP5A 3Q0AA 1B3AA 4NP5A 4J1MA 3H91A 4C3HG 3OIQA 5HGTA 1YNJC 1GJXA 1SYCA 1EL0A 2EY2A 4DK0A 2ZXPA 4NDXA 2A5HA 1EQTA 1SEBD 4TQUS 3H3VC 4R8NA 5IGGA 2A6HD 1EWHA 3OIPA 2PZWA 2ICEC 3MXNA 3OSOA 4BBRB 2PYKA 3VR4A 1XWEA 2OF1A 1U4RA 3T53B 4F7XA 4PMWA 1G6ZA 1EY8A 4A3IB 2IX0A 2NN6G 4WFN3 3ITPA 2KCNA 4R9WA 1LT5D 1X3PA 5I2YA 2NTSA 1E0BA 4CJ2C 1ESFA 3MZ5A 1BCPD 1DJRD 1GXDC 4MN3A 2J0TD 3V2TA 1PZID 2B2YC 3J80L 2XWBB 2QDBA 4X3SA 5CV8A 2KOLA 1GUGA 2FFKB 3DXJC 1S5DD 1EFID 2RA4A 4X3KA 3P75A 4BA1I 1SYGA 2Z4IA 1WTWA 1GHKA 3EFXD 2MP1A 4KD4A 3R3OA 2L55A 4C2MB 1CTMA 5M3MB 5IGFA 3J7YW 1VCIA 3GTPB 2WINB 2D2CC 1M8AA 3W2DA 3TZDA 3T13A 1DXMA 1JOKA 1PYWD 1QWYA 2ID0A 3NTKA 2B2WA 5JVG3 5FLXE 1MGSA 1GUNA 1Q8IA 1HPCA 3NHHA 5G3LF 5CC4A 1HRJA 2ENBA 4IFDI 2A68C 5JEAH 1TKWB 2VXWA 3MC0B 4K2LA 1E2VA 4CJ1B 4FF1A 3BYYB 2XSCA 4CKCA 1IYUA 4BA2I 3N52A 2F0KA 3S14B 1T5EA 3PUXA 2KUMA 5I2XA 1PFBA 1OXUA 5C4XB 1R9TB 3NE5B 1EOTA 2F0UA 3MVVA 1B9MA 4IFDH 5I9OA 4A3DB 1MSGA 3DM1A 2K05A 5M9OA 5A35A 4B9XA 4DFAA 4NMZA 2NVTB 3NP8A 2I07B 1WTOA 2B8GA 1BNZA 2HCIA 1RJTA 4A3BB 1V1OA 2NWGA 4HSPA 2ICIA 1TS5A 1SNOA 4L63B 5M5WB 1Q12A 4HN7A 1DOLA 1LTBD 1RTNA 3TSSA 3C1FA 2JA7B 5JVH3 3SXHA 2JE6I 1ML0D 2NBFA 4XYQA 1PLFA 3S16B 2O5IC 1ENFA 2DY8A 3M7NA 3HG9A 2QILA 2MHVA 3RLFA 1JORA 3M7GA 3VA5A 1S5CD 2RSOA 2ZXRA 3H0GB 3F2UA 1SMYD 2RSNA 4L8JA 2OEOA 3D4WA 2BOSA 3DHQA 1Q1BA 1QNUA 5KNDA 4C56C 1STHA 4TRDA 3K5MA 2L11A 3MXUA 1Y8NB 4FXKC 4WORA 1QNKA 1O7ZA 3GTOB 1YNND 5C3XA 5IGCA 2I46A 4A3JB 4IURA 1F2YA 3OPOA 3C1EA 1LTGD 4G7OC 2RQXA 4XT3B 1CA5A 3SK8A 1LTTD 4I7ZC 2F1MA 4CGYB 1I4GA 2KA7A 1STNA 5CV5A 4IUTA 3MA2B 4J8QA 5M5XB 4FF4A 1PTOD 5K36H 2EY6A 5FO8B 2DNEA 1CZWA 2R3ZA 5ELEA 2N55A 3E6ZX 4G7HC 4J6HA 1WTQA 4RHSA 3JAML 2Q8IB 3D6WA 3E0JA 2Z1CA 2MPMA 5KIXA 1UEAB 2EXZA 4FF2A 3RD4A 1SYBA 1XYIA 2BA1A 3R2TA 2VUMB 2EY5A 1FNVA 1KAAA 1SYDA 2NUCA 3MFGA 1DD2A 1Q90A 1UNSA 5E1FA 1KABA 2EYJA 1EY7A 2NN6H 2A6EC 4BY1B 2HDMA 2AUJD 3H09A 1GUOA 2SNSA 5FO7B 1BF4A 2RDFA 4ZUJA 2F0OA 4RCOA 1JE4A 1J9OA 3L7ZC 2WB1B 1CI3M 1A2UA 2KVMA 5FLXL 2RDGA 2V4DA 3NQTA 3IFDA 2MJ8A 3BDLA 3L9AX 5G3LD 1ILPA 1G91A 1JCKB 4QCLA 2F0IA 3NQIA 1WTXA 5J39A 2NYZD 1U4LA 3FEWX 4XXEA 1EEID 1D1KA 1ET6A 1Y8PB 5TSSA 5CV6A 1E2WA 2B2TA 1RTOA 4K6DA 4F87A 1QOHA 1SYEA 3NPPA 1VMPA 3K7AB 3S2DB 3I4LA 1B1ZA 3PIP3 1ZEQX 3TN2A 4V0BA 2FINB 3SE0A 1ONLA 5KYLA 4C3JB 3GO5A 2IPKD 3FPUB 3ERQA 3OWFA 3D31A 4BBSB 2BE5C 1CHQD 2JA8B 3K5OA 1Y69U 2Z4HA 5LHY1 5T1GA 5IOCA 5D65A 2NVQB 2E74C 3OMCA 1K83B 4DU9A 4OO1G 1JOOA 5CGKA 1SXTA 2EZVA 5JJZA 3VR3A 4NKLA 1G291 2K5DA 2A73B 4C3JG 3TP6A 1GOZA 1VF7A 3D3RA 4H0LC 1WTRA 5DAUA 2L0CA 3D4DA 3S1QB 1V43A 1PDQA 2HDLA 1O7LA 4C3HB 4XDXA 1QCBD 1AZPA 3S1MB 4LJZC 1CZGA 1YNJD 1V8QA 3T56B 3FRPB 3M85A 1ILQA 3OOCA 1G2TA 2R61A 4ZRZA 4IUNA 4BS9A 2WKCA 4ID6A 1Q1EA 2EOTA 2PO4A 2KEDA 3CHBD 4K8IA 3RUZA 4RWSC 1JOQA 4TKOB 5EKKA 2EPBA 1I4XA 2F0FA 3FVQA 1IL8A 1D5MC 1NR2A 2C5CA 1QG7A 1IHZA 1AEXA 3ZYYX 3K5LA 2K03A 3R8BA 1STEA 4KKUA 3J7AF 1D5ZC 4Q0FA 4EQOA 3M4YA 2BA0A 3SEBA 4RAUC 5I9PA 2PCFB 5E4WC 5EKLA 5E4XA 3I4NB 2WACA 2VB3X 1D1IA 1AP0A 2AQ2B 5A2QL 1B50A 1SE3A 5C0XI 3GTKB 4TSSA 4RGOS 2Z8LA 1CQVA 3KBGA 2BCOA 1O7YA 3LWUA 5CV9A 5EBDA 1HCZA 3HOYB 4C1NI 1WD1A 4RH6A 1H9MA 3ND9A 4B9WA 4QUCA 2H1EA 1NR4A 5M3FB 4CKBA 3SK5A 1F9PA 1MD2D 1E2ZA 2A74C 1I6VC 3EVQA 1RODA 4KHVA 2BDOA 1QJOA 2EYFA 5C0XH 2K32A 5CBEE 5I6YA 1A15A 2E75C 3MTSA 4DA2A 4DNTB 4QMGA 2VNUD 1BO0A 1QILA 2FMMA 2EJGC 5DEHA 3SVMA 2LFNA 3A54A 1F9QA 1EYDA 5FOBB 1EZ6A 2G9HD 1SNQA 4FXDA 3TZUA 1I3QB 1KDCA 3FMCA 4DF7A 2QEJC 3MEHA 3NWTA 1L0XB 1IYVA 1SJHD 1O78A 1RD9D 2F0TA 1TY2A 1TWGB 3KBXA 4RHRA 1PXUA 4O42A 2B2VA 5EJWA 5C3EB 5IGDA 1X3QA 1PTOB 1LACA 3TDQA 1V1PB 2MGSA 4H13C 1LT6D 1GUTA 4OIJA 4QB4A 1DYQA 2A68D 2B2TC 3IL8A 3G7LA 1I6HB 2F3WA 5E3FA 3KLRA 3DWPA 3BZDB 2Q8RE 4O1NA 3HOXB 4X3UA 2M9VA 1S5ED 2WIIB 3I90A 1HXYD 2B63B 2LS01 3HS0C 3AU7A 5COYA 3P20A 4IUQA 4Q5VA 2HCCA 2N88A 1B53A 5CV7A 1EEFD 3KF8A 5IT9L 2K01A 5D3DA 3TMEA 1I4PA 2R93B 2Y0SB 4K2KA 1IKLA 1LLRD 2DN8A 1Z7TA 2IX3A 3KUPA 1SYFA 1Y1VB 4FXGC 1PRTC 1MSHA 2E2HB 1B2TA 1BOSA 4QF4A 3T51B 2FHTA 3VR2A 4U673 1JC7A 2H4OA 5C5MA 2K6AA 1EY6A 1CM9A 4ZAIA 1HA5A 4GZYC 1TT2A 1FYCA 2XN9C 3D8GA 3VYTA 3GP7A 1JB3A 4KJNA 2EYMA 1Y8OB 5CORA 1CT1D 4QIWB 3K59A 5CYUA 3TP7A 1TWAB 1ENAA 3RZDB 3V96A 4E6IA 1NSNS 2EYHA 3NSWA 2KHSA 3T4AC 5EGTA 1TWFB 3QJYA 3QIAA 5BN5A 2KCCA 1BDOA 4ZUIA 1SNMA 3HOUB 4H44C 1LV9A 2EY1A 1FNWA 2L4NA 4WJWA 2F0PA 2RVLA 1NUCA 4EGVA 2X6LA 2F0LA 1QE6A 3HZXA 1B9NA 3T16A 1A6XA 4PNYA 4KK7A 3DMUA 3S17B 2L5TA 3K57A 1PFMA 3MFYA 3X3MA 4U68A 2EVBA 2E76C 4EQPA 1STGA 2F0VA 3D4RA 1PZJD 3IFTA 3SK4A 4KY5A 5EKIA 5EBCA 3ND8A 5C4ZA 2L9HA 2XNAC 1AZQA 4AYBB 4N9TA 1Z6HA 1JWSD 2M00A 4ABNA 3GTJB 2NN6I 2K5QA 2PZTA 1JICA 1C48A 1RKNA 3K5NA 4IN3A 3E5SA 4C1NK 5IGEA 1H9RA 3EROA 2E2IB 1LTAD 4ZKCB 2K04A 3I70A 2JEBI 1XX8A 2A6ED 1MI2A 2XWJB 2GA4B 1MBYA 2CQAA 2QCPX 1LABA 4CBVA 1JQYD 2IT1A 5I6WA 3KLSX 4RCNA 3BYTB 1EWCA 4BY7B 1EU4A 2MUYA 3Q6SA 2JA6B 2ZXOA 1U9RA 5C44B 1SAPA 5LL6S 2AUKA 1TS2A 3A8IE 5FO9B 3M4OB 3FPPA 4DAYA 3GTGB 2JP1A 2B2WC 3AB9A 4KMUC 4KN4C 3NUCA 3GV6A 1KLGD 2JEAI 3VYRA 3RZOB 2G9DA 5IIFA 4XQJA 2D5DA 1ENCA 1ZYRC 1TS4A 1BCPB 4ILWA 2LMCB 4A3MB 5ELCA 1TU2B 2F0GA 4IALA 3OWEB 1FGBD 1SSOA 1U4PA 3P7JA 2K7VA 4CHTB 4ZKBB 5NUCA 1VF5C 5KNBA 1VMCA 2PPBC 1S4ZA 4N9PA 2K33A 5DM63 5D14A 4LAAA 2SNMA 2BE5D 1IKMA 1LTID 2C9OA 4UDUC 1KTKA 1HFNA 5JAVA 3UI2A 2BDNA 1KDAA 4K14A 5HURA 3FKIB 4HR7B 1STBA 1CK1A 3BVGA 4XYOA 4RA8A 4CJ0B 3VA7A 5BN3A 5C4HA 4IFDG 4KY6A 1HA6A 1PRTF 3SK6A 4F8MA 3U9SA 3HOVB 2XRQD 2OT2A 4FVMA 2JSOA 3A7LA 1WTPA 1RDPD 2WAQB 1B44D 4A3KB 2EDGA 4OIKA 1CA6A 1DZ1A 4MIUA 2JXMB 1PTOH 3HKZB 2EJMA 1H9KA 1ZXTA 1JWUD 4CKEA 2IWHA 3OW7A 5C5LA 2WP8J 4A93B 1I4RA 2CW0D 3BG3A 1SDFA 3L3OC 3SR1A 5J22A 4A3FB 1II3A 3MWYW 1EQVA 3NBHA 2XRSD 4DAVA 3CRLC 4K8JA 1I4QA 4JBWA 1EYCA 1HQRD 2NB0A 3I73A 3LWEA 5T1IA 1BQQT 4I65A 5J1ZA 2IJ0A 3C3LA 1SBBB 1H9SB 2B8FA 3H94A 3GD7A 1RCVD 2X69A 3NTIA 5M5YB 4IFDJ 1Q3LA 4DXFA 2WKDA 5C6AA 2CW0C 3HEJA 3R93A 4ZQ3A 3BVZA 3BDOA 4IUPA 1IW7C 3QOLA 5CMDA 4HMJA 1HTLD 3PO3B 3OHXC 3LX0A 1BBXC 3MHBA 3QOJA 3PV0A 1F2MA 3K58A 1NCVA 2YYZA 4IUUA 4PMBA 2AWNA 5JPMC 1A3TA 2O4XA 2Q8TA 5CR3A 1OXVA 1CHPD 2E2JB 4FP5D 4HTHA 5K36G 5K5PA 1F2ZA 4MHEA 1GUSA 2EE1A 1LTSD 3WOEA 4PV1C 2TSSA 3MXGA 3A7AB 4Y7NB 3U9OA 3MAQA 5ELDA 1KNEA 5KGUA 5KEEA 4DN4M 1SJED 1DOMA 3M3YB 4OHJA 4K5WA 3EA6A 5C3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTV A;  1B2T A;  4ZK9 B;  2B2T A;  3QO2 A;  1RTO A;  5EKI A;  3LWE A;  3ONA B;  5T1I A;  1WTO A;  2FHT A;  2M2L A;  5EQ0 A;  2HUG A;  5EPL A;  1SSO A;  1U4P A;  1B4O A;  2R3Z A;  2HCI A;  3KBX A;  1BNZ A;  1RJT A;  1GUW A;  3P7J A;  2N55 A;  1VMP A;  1M8A A;  4RAU C;  1C8C A;  2X69 A;  4ZKB B;  2L9H A;  5E4W C;  4IUV A;  4O42 A;  2NZ1 D;  5E4X A;  3TN2 A;  1VMC A;  2CVR A;  1Q3L A;  1CM9 A;  1S4Z A;  2B2V A;  1TVX A;  2FIN B;  2J7Z A;  5D14 A;  2NWG A;  5EJW A;  4ZAI A;  1WTQ A;  1AP0 A;  3FPU B;  1AZQ A;  3HP3 A;  1X3Q A;  3R93 A;  2B2U C;  1IKM A;  1U4R A;  3D6W A;  1HFG A;  1DOL A;  2B2W A;  1B50 A;  4IUP A;  1RTN A;  2MGS A;  1HFN A;  1MGS A;  4HCS A;  5CBA E;  1O80 A;  1F2L A;  1JIC A;  4OIJ A;  3UI2 A;  5CMD A;  2MPM A;  2BDN A;  4HSV A;  1G6Z A;  2B2T C;  1HRJ A;  2B2Y A;  3I8Z A;  1PFN A;  3IL8 A;  3G7L A;  5EPJ A;  1BBX C;  5AFW A;  5COR A;  4HED A;  2K1B A;  1ML0 D;  1O7Y A;  5T1G A;  1ICW A;  1HUN A;  2VXW A;  1XYI A;  1PLF A;  5D65 A;  1X32 A;  4ZKC B;  4RA8 A;  2K04 A;  4CJ0 B;  2DY8 A;  1NAP A;  4R9W A;  1NCV A;  2D9U A;  4IUU A;  2Q8R E;  4CJ1 B;  1EIH A;  1XX8 A;  2L1B A;  2KEE A;  1KNA A;  1MI2 A;  4HAE A;  1HA6 A;  2XIW A;  1X3P A;  1WD1 A;  4X3U A;  3DEP A;  4QUC A;  1DZ1 A;  1F9S A;  2H1E A;  2X6G A;  3I90 A;  1E0B A;  3TZD A;  2HDM A;  1WVL A;  4CJ2 C;  5JJZ A;  4R8I A;  4X3T A;  1NR4 A;  2Q8T A;  2RSO A;  5COY A;  1RHP A;  3F2U A;  2RSN A;  4MN3 A;  3DEO A;  1F9P A;  4XT1 B;  4QUF A;  2B2Y C;  1EIG A;  1G2S A;  1WD0 A;  3I91 A;  4IUQ A;  5DNF A;  1DON A;  3Q6S A;  2HCC A;  2N88 A;  2KEC A;  3I3C A;  1BF4 A;  1LV9 A;  1WTR A;  1WTP A;  3N52 A;  1B53 A;  4UAI A;  1SAP A;  1ROD A;  2SDF A;  2JYO A;  1HUM A;  1F9R A;  1PDQ A;  2HDL A;  2L11 A;  2L4N A;  4NW2 A;  1ESR A;  4X3S A;  4MHE A;  1JE4 A;  2B2V C;  3GV3 A;  2KUM A;  2RVL A;  2EE1 A;  1J9O A;  1U4M A;  4OIK A;  4XDX A;  1QNK A;  2X6L A;  1CA6 A;  2KVM A;  1AZP A;  1O7Z A;  1QE6 A;  2K01 A;  2KOL A;  2L12 A;  2K28 A;  3IFD A;  1PFB A;  2MJ8 A;  5CBE E;  4LMQ D;  2JP1 A;  1A15 A;  2B2W C;  2K03 A;  2FFK B;  1HHV A;  1B3A A;  2IL8 A;  1ZXT A;  1ILP A;  3H91 A;  2RA4 A;  1ILQ A;  1G2T A;  1EOT A;  3GV6 A;  3MTS A;  4IUR A;  4X3K A;  1G91 A;  1IKL A;  1MSG A;  1WTX A;  1BO0 A;  3DM1 A;  1DOK A;  3FDT A;  2FMM A;  1J8I A;  2K05 A;  1EL0 A;  1KNE A;  2EOT A;  1PFM A;  2KED A;  1SDF A;  3SVM A;  4XT3 B;  1CA5 A;  1F9Q A;  4RWS C;  2NYZ D;  4U68 A;  4DN4 M;  1WTW A;  1DOM A;  1U4L A;  2EPB A;  5EPK A;  3KUP A;  2MP1 A;  3MWY W;  1IL8 A;  2B2U A;  2DY7 A;  1NR2 A;  1QG7 A;  4ZLT F;  1EQT A;  4IUT A;  2FJ2 A;  1MSH A; 
#chains in the Genus database with same CATH topology
 1R4Q B;  1TWF H;  4B3M Q;  1JT8 A;  3PIO A;  2QKI C;  2A6H C;  1SNC A;  4GLX A;  3DWQ A;  2YU9 B;  2OXP A;  3BS1 A;  3I2Z A;  3GQB A;  3CPF A;  5JOB A;  3KLS A;  4KY7 A;  5IGB A;  3UDX A;  5CBA E;  2NZ1 D;  3HOU H;  1IBM L;  2J7Z A;  3I72 A;  5BN4 A;  2KCT A;  3URY A;  2YTY A;  4B08 A;  1HR0 Q;  1HFG A;  4JOI A;  4X65 L;  3BVM A;  1F2L A;  2B39 A;  3I4M B;  5IT9 c;  3A56 A;  3CKI B;  1PTO F;  2F0H A;  3I8Z A;  4FNF A;  2KJX A;  3AEV A;  5ELN A;  1JR0 D;  1KDB A;  3O13 A;  2DJG C;  1CKO A;  4P73 A;  1IL2 A;  3S17 H;  1AH9 A;  2UXC L;  1SE2 A;  1NAP A;  3WDN A;  1HH2 P;  3S15 B;  3CC2 A;  2CHB D;  4JI6 L;  2RDH A;  4KV6 A;  3K80 C;  1OXT A;  2F0N A;  1D5X C;  3G6J B;  2O2L D;  3JAM E;  1Y1W B;  1QZG A;  1SND A;  4UY8 C;  3V05 A;  1GM5 A;  4IQZ A;  3DEO A;  3D6C A;  4LWC A;  4YCW A;  1SNP A;  4Z9C B;  1BCP C;  2QF7 A;  5DNF A;  2K5W A;  4DGZ A;  3I3C A;  1KLU D;  3H3V H;  2SEB D;  3BZC A;  3IKJ A;  3I4M G;  4K0K Q;  1HUM A;  3D0F A;  3W1B A;  3GV3 A;  1ET9 A;  4ZYS A;  5IP7 H;  2L12 A;  4AQY L;  2ZT9 C;  4IJL A;  3GTJ H;  1LT3 D;  2LXK A;  3J81 i;  3A5Z B;  3CME A;  5KRU A;  5JPN C;  1AE2 A;  2IHE A;  2WV6 D;  3CCE A;  3I4O A;  2PQE A;  2PW7 A;  4LFA Q;  1BXT A;  2F0Q A;  2HQE A;  1SR3 A;  4PMC A;  1CQF A;  1Y1W G;  1V1P A;  3PUW A;  3S1R B;  4EVO A;  4RGM A;  3RMH A;  4EQN A;  2AQ3 B;  1L0Y B;  3WOF A;  1EYG A;  1PRT D;  1FNU A;  1A8V A;  1G8Z D;  1MKH A;  2DY7 A;  1KIX A;  1OO9 B;  2LKV A;  4RGN A;  3GTL B;  2IW3 A;  3VYS A;  2F3V A;  3HKS A;  3E9H A;  4ZK9 B;  1IBL Q;  4B3R L;  2RCF A;  3ONA B;  3RR5 A;  1S5F D;  4KKS A;  3SHL A;  4DV0 Q;  2HUG A;  5EPL A;  3J7Z C;  1BR9 A;  3C46 A;  1HZ9 A;  1K8M A;  3VYU A;  2XVS A;  2JA6 H;  1EY5 A;  5C44 H;  5GAH C;  3T1Y L;  2NZH A;  1OTC A;  4A3L G;  4C3I B;  3TRZ A;  3CCR A;  3M4O H;  2DNC A;  3GTG H;  5JJL A;  4DXG A;  5AJ3 L;  3PMF A;  3W3A A;  2F4I A;  2PI2 A;  5EPJ A;  3E0E A;  5AFW A;  3PUZ A;  3PIP A;  3EBE A;  4OO1 I;  5LMN Q;  1EY4 A;  3RZO H;  4FYD A;  3M4Q A;  3Q24 A;  3GTM B;  3J81 E;  4ALP A;  2F0E A;  2KEE A;  4HAE A;  1STY A;  1XNR Q;  5FJ8 G;  4NXN Q;  2PMZ B;  1U0L A;  3NK9 A;  4KHZ A;  4R8I A;  1HNX L;  1XTC D;  1I50 B;  5L37 A;  2A8V A;  4DNI A;  4XT1 B;  2PZU A;  4MNO A;  1EIG A;  1G2S A;  4C3I G;  1STA A;  2NVY B;  1NJI C;  5IYC H;  1N32 L;  4UAI A;  3X3N A;  2SDF A;  2UUA L;  2JYO A;  1F9R A;  1LO5 D;  4NW2 A;  4XTC S;  4LF8 Q;  1AN8 A;  1GUW A;  3J7A V;  4DUY L;  3A8K E;  4G7Z C;  4HID A;  4FO2 A;  2ZM6 L;  1EWI A;  4K5X A;  4TVA B;  1IBK Q;  1A3V A;  5IP9 H;  4KD3 A;  2JA9 A;  3KDF A;  4JK1 C;  3FKI H;  2RBM A;  4OO1 H;  1DOK A;  3FDT A;  1E7Z A;  4HCE A;  5FLM H;  4JI1 L;  1TWH B;  1X65 A;  1KHI A;  3G6E A;  3Q8D A;  3U58 A;  2KCM A;  1HTP A;  1VQD A;  2B2U A;  2K5N A;  2R92 B;  1XNQ L;  1S3O A;  4C3J H;  2FJ2 A;  3AMU A;  1A3U A;  3IAY A;  1C0A A;  1VQ9 A;  4BBS H;  2A69 D;  2JA8 H;  3HOV H;  3HGB A;  4DV4 Q;  1X56 A;  4L6T B;  4GN3 B;  1B4O A;  3ULJ A;  3M9B A;  1N36 Q;  1VQ4 A;  2RKS A;  3NWS A;  3DWA A;  1TVX A;  1EUJ A;  2N8N A;  3KYH C;  3S9W A;  3HP3 A;  4A3K H;  4G4K A;  4KI0 A;  4QGU A;  4LK1 C;  3VDY A;  1VDZ A;  1HQM C;  3CU7 A;  4ULL A;  5C0X G;  2Q2U A;  2R92 G;  5FKA C;  3VR5 A;  2K1B A;  1FD7 D;  4DNR B;  2JA5 B;  2A69 C;  3SDZ A;  1E24 A;  2D9U A;  4DR5 L;  1QVG A;  1SFO B;  2I5L X;  3Q23 A;  3S1Q H;  2D62 A;  4A3F H;  1LM0 A;  1CFM A;  1AW7 A;  3J80 i;  5A2Q E;  4JI0 L;  4G57 A;  4JOI C;  4R4I A;  4X3T A;  4M8A A;  4LF9 L;  1RHP A;  2FMC A;  5FLX c;  1AFP A;  3BU2 A;  2R7Z B;  2NVX B;  3PIO 3;  1SE8 A;  4K6L A;  1SMY C;  3HRZ C;  2F03 A;  4PG3 A;  3AFP A;  1EY0 A;  1PZK D;  2QDL A;  3N6R A;  1C7Y A;  2AQ1 B;  5CV4 A;  1YIJ A;  4OL7 A;  4XIG S;  4ME5 A;  5M5Y H;  3E9I A;  4DAP A;  1XPU A;  2B2V C;  4QUF A;  3CQZ B;  1DON A;  1C4Q A;  3DUZ A;  4JVZ A;  1LTR D;  5ELF A;  2JA5 G;  4M1U B;  3EQL C;  3NTH A;  2IL8 A;  2EYP A;  4DUZ Q;  1EQQ A;  1YNN C;  3PUY A;  1L1O B;  4XQQ A;  1IZ6 A;  1FL0 A;  2P5Z X;  1ZYR D;  1J8I A;  1EY9 A;  1W2B A;  1FGU A;  4PQX A;  3TBI B;  2WFW A;  1OXX K;  2LY7 A;  3OYY A;  2F0S A;  1XXG A;  1Q7Y C;  2R7Z G;  3K8A A;  4ZLT F;  2QW7 A;  2QGQ A;  1VS0 A;  4HMI A;  2PNR C;  4BWG B;  4KN7 C;  2F4V L;  1WTV A;  5HY6 A;  1M4V A;  1TY0 A;  3QO2 A;  1Q86 C;  3GTK H;  1BCP F;  5IOD A;  1OXS C;  4H7B A;  5C0X J;  5EQ0 A;  1QUQ B;  4KTA A;  1E1T A;  4F88 A;  1FR3 A;  4A3G B;  3A55 A;  1VQO A;  1PTO C;  3J80 E;  1HNW L;  3BZK A;  4RFB A;  2E2J H;  5AJ3 Q;  2VB2 X;  3PUV A;  4LF5 L;  2R6G A;  3K81 C;  3QB3 A;  3HOY H;  3P1H A;  1L1O A;  3PO2 B;  3OMG A;  3VR6 A;  5JEA G;  1EYA A;  1TR5 A;  1SLJ A;  4HCS A;  3TP8 A;  1TQO A;  1Q46 A;  2PW5 A;  1JMC A;  3NEM A;  1EOV A;  1PYB A;  1K8O A;  1I4H A;  2B2Y A;  3A0J A;  1Z47 A;  3MXP A;  4YY3 L;  3CCV A;  2UU9 L;  1HUN A;  1HNX Q;  3S24 A;  1D2B A;  1K9M C;  1VQ8 A;  1X32 A;  1VQB A;  1TII D;  5KNC A;  1EU3 A;  1H9J A;  1K0R A;  1EIH A;  4UPA A;  1WCM B;  1EZ8 A;  4A3G G;  4IPC A;  1F9S A;  2EYO A;  3AQQ A;  1B3Q A;  1WVL A;  1QB5 D;  1SE4 A;  3R2I A;  5FK9 C;  1GHJ A;  1A62 A;  1TS3 A;  4R4O A;  1QVF A;  3EN2 A;  4YIJ A;  3PO2 G;  1JWM D;  2SOB A;  4HJA A;  2O5J C;  2TMP A;  2ZM6 Q;  2YU9 H;  1UUP A;  1ZKO A;  2KHI A;  3GTQ B;  2EYL A;  4RKL A;  1XJV A;  1BUV T;  3U4Z A;  1ESR A;  3PF5 A;  1WD0 A;  1F77 A;  1U4M A;  1X3E A;  5D3I B;  1A63 A;  4LMQ D;  1I3Q H;  2FXQ A;  1HHV A;  3CCQ A;  4RKB A;  4P75 A;  3TEH B;  4P2C B;  1DCZ A;  2NTT A;  4RGT A;  2VQF Q;  1WCM G;  4JW0 A;  2E2D C;  3CPW A;  1PMR A;  1PH8 A;  3EJI A;  4JI7 Q;  2N3S A;  3PCO B;  1GVP A;  1TWG H;  3J81 L;  1PH1 A;  5ELB A;  1LYL A;  4CDE C;  3Q22 A;  2QEX A;  5EPK A;  3QWN A;  3NXW A;  2F0M A;  1RIP A;  1KL9 A;  1CSQ A;  4JG2 A;  5JEA J;  5IY0 A;  3C2P A;  1KRS A;  4IZ8 A;  2J4X A;  3KK7 A;  4AH6 A;  5IT9 E;  5F2D A;  4MTK A;  2CCZ A;  1QVC A;  4FF3 A;  1S5B D;  4DV3 Q;  4S3S A;  4K0K L;  1RF2 D;  2M2L A;  1PRT B;  3NBI A;  1C8C A;  5LL6 X;  3H6M A;  4IUV A;  1R4P B;  2CVR A;  3BDC A;  5I4D A;  2DGY A;  1IW7 D;  2B2U C;  3HOZ B;  1PYS B;  4ODG A;  1YEZ A;  4KJO A;  4LFA L;  1O80 A;  4X6A H;  3LNN A;  2KQ3 A;  4XQN A;  3K0Y A;  4HSV A;  4V19 0;  1DM0 B;  2JK8 A;  1PFN A;  4WRD A;  2R7D A;  4HED A;  4A3L H;  2EJF C;  1ICW A;  1W6K A;  4WJ4 A;  1D6E C;  4LF9 Q;  5DM7 3;  3S1R H;  3HOW B;  4R4T A;  2L1B A;  1KNA A;  4DV5 Q;  2XIW A;  5KYI A;  3DEP A;  3STB C;  3A8J E;  4DV0 L;  2X6G A;  1LT4 D;  4DV7 Q;  3GTL H;  3QG1 A;  5C4J B;  2F0W A;  2F0D A;  1TWC B;  1T5X D;  3K6O A;  4KKT A;  1Q82 C;  1A2T A;  4DR3 L;  4K5V A;  4DPG A;  3I91 A;  3HOZ G;  5FJ8 H;  4P74 A;  2KEC A;  4OGQ C;  3S2H B;  5ISR A;  3CRK C;  4DK1 A;  2IX1 A;  2AWO A;  3S1N B;  4A3E B;  2F0J A;  3MXN B;  1E22 A;  1H9S A;  2K28 A;  4C3I H;  2K5H A;  1Y14 B;  1UAP A;  5LMN L;  1W6J A;  3TP5 A;  3Q0A A;  1B3A A;  4NP5 A;  4J1M A;  3H91 A;  2RCN A;  3HOW G;  4C3H G;  3OIQ A;  2OTJ A;  5HGT A;  1YNJ C;  4LF4 Q;  4BXX H;  1SN8 A;  1XNR L;  1GJX A;  2F4V Q;  1SYC A;  4NXN L;  1EL0 A;  3KOJ A;  2EY2 A;  4DK0 A;  2ZXP A;  4GN5 A;  4NDX A;  2A5H A;  1EQT A;  1SEB D;  4TQU S;  3H3V C;  4R8N A;  5IGG A;  1WI5 A;  2A6H D;  1EWH A;  4LF5 Q;  4YHH Q;  3OIP A;  2VZA A;  2PZW A;  2ICE C;  3MXN A;  4A3E G;  1SRU A;  3OSO A;  2BH8 A;  4BBR B;  2PYK A;  3VR4 A;  4LF7 Q;  2NVY H;  4HIK A;  3W1G A;  4GOP B;  1XWE A;  1IBK L;  3RZD H;  2OF1 A;  1U4R A;  2UU9 Q;  3T53 B;  4F7X A;  2B3G A;  4PMW A;  1G6Z A;  1XTD A;  1EY8 A;  4A3I B;  2IX0 A;  2NN6 G;  4WFN 3;  3ITP A;  2KCN A;  4GKK L;  3H3V I;  4R9W A;  3F2B A;  4HJ8 A;  1LT5 D;  1X3P A;  4HJ7 A;  5I2Y A;  1L1O C;  1NTG A;  2NTS A;  2R92 H;  4DV4 L;  3F1Z A;  1E0B A;  4BBR G;  4OWX B;  4CJ2 C;  1ESF A;  3MZ5 A;  1N36 L;  1VQL A;  1BCP D;  5IWA Q;  1DJR D;  1GXD C;  4GOP A;  1VQE A;  2F52 A;  4JI3 Q;  1E3P A;  4MN3 A;  2J0T D;  3V2T A;  4DV1 Q;  1YBY A;  1PZI D;  2B2Y C;  3J80 L;  1JB7 A;  2XWB B;  2QDB A;  4JI8 L;  1U5K A;  1FJG Q;  4X3S A;  4A3I G;  5CV8 A;  2E5L Q;  2KOL A;  1GUG A;  1PV4 A;  2FFK B;  1N33 Q;  3DXJ C;  3L2P A;  1S5D D;  1EFI D;  2RA4 A;  2KBN A;  4X3K A;  3P75 A;  4BA1 I;  1SYG A;  4UP9 A;  4KHP Q;  2Z4I A;  4X62 L;  1NMG A;  1WTW A;  2JA5 H;  1GHK A;  3EFX D;  2MP1 A;  4KD4 A;  3R3O A;  2Z6B A;  3ICE A;  2L55 A;  1PH2 A;  4C2M B;  1CTM A;  5M3M B;  4L5T A;  5IGF A;  4QQB X;  3J7Y W;  1VCI A;  1YNX A;  3GTP B;  2RHS B;  2WIN B;  2R7Z H;  2D2C C;  4HIO A;  1M8A A;  2C35 B;  3W2D A;  3TZD A;  2E2I H;  1K73 C;  1Z9F A;  3T13 A;  4JV5 Q;  4P71 A;  1DXM A;  1JOK A;  1PYW D;  1QWY A;  2ID0 A;  3NTK A;  4NPS A;  4DUZ L;  2HT1 A;  2B2W A;  5JVG 3;  3T1H L;  5FLX E;  1MGS A;  1GUN A;  1Q8I A;  1HPC A;  1AE3 A;  3NHH A;  5G3L F;  5CC4 A;  1HRJ A;  3UE0 A;  2AHO B;  2ENB A;  4IFD I;  2A68 C;  4BY7 H;  5M3M G;  1TKW B;  2VXW A;  5JEA H;  4JI2 Q;  1UWV A;  3MC0 B;  4K2L A;  1E2V A;  4CJ1 B;  4HIM A;  4DR3 Q;  4GNX B;  3U4V A;  4FF1 A;  4GN4 B;  2B29 A;  3BYY B;  2XSC A;  4DR1 L;  1KD1 C;  4CKC A;  1IYU A;  3RNU A;  4BA2 I;  1BBU A;  4A3G H;  4MZ9 A;  3N52 A;  2F0K A;  2Z9H A;  4J15 A;  3S14 B;  1T5E A;  3PUX A;  2KUM A;  5I2X A;  1PFB A;  1OXU A;  2K14 A;  5C4X B;  2JJQ A;  1R9T B;  1E1O A;  3NE5 B;  1EOT A;  2F0U A;  3MVV A;  1B9M A;  4A3M H;  5I9O A;  4IFD H;  4A3D B;  1MSG A;  3DM1 A;  3ZJY C;  2K05 A;  5M9O A;  3J7A 5;  5A35 A;  4B9X A;  4DV2 Q;  5BR8 Q;  4DFA A;  3RLO A;  1WCM H;  4NMZ A;  2NVT B;  3NP8 A;  4H02 A;  2I07 B;  4QY7 A;  1WTO A;  4OEL B;  2B8G A;  1IYJ B;  1BNZ A;  2HCI A;  1RJT A;  4A76 A;  5C4X G;  1VQN A;  3GTQ H;  4A3B B;  1V1O A;  2NWG A;  4HSP A;  2ICI A;  1TS5 A;  1SNO A;  4A3D G;  4L63 B;  5M5W B;  5IYD H;  1Q12 A;  4HN7 A;  1DOL A;  1HZB A;  2VQF L;  1LTB D;  1RTN A;  4IPH A;  3TSS A;  3C1F A;  4GKK Q;  2ES2 A;  4JI7 L;  2JA7 B;  4A3C G;  1PH7 A;  3TS2 A;  1LTL A;  1KAW A;  5JVH 3;  3SXH A;  3ULL A;  1ICF B;  2JE6 I;  1ML0 D;  2NBF A;  4XYQ A;  1PLF A;  3S16 B;  2O5I C;  1ENF A;  2DY8 A;  3M7N A;  3HG9 A;  1J5E Q;  1D7Q A;  2QIL A;  2MHV A;  4DV3 L;  4YCU A;  3RLF A;  4JI8 Q;  3CAM A;  1JOR A;  3M7G A;  3VA5 A;  1S5C D;  4ME3 A;  2RSO A;  2ZXR A;  1JJC B;  3H0G B;  3F2U A;  1SMY D;  2RSN A;  4L8J A;  4A3B G;  2OEO A;  3D4W A;  1MHW C;  2BOS A;  3DHQ A;  2VY3 A;  1Q1B A;  1QNU A;  4X64 Q;  1PHJ A;  4A93 H;  5KND A;  4C56 C;  2JA7 G;  1STH A;  4TRD A;  1K8A C;  3K5M A;  2L11 A;  3MXU A;  3OW2 A;  1Y8N B;  4FXK C;  1BKB A;  4WOR A;  1QNK A;  1O7Z A;  3GTO B;  1K28 A;  4X62 Q;  3HOZ H;  1YNN D;  1YJN A;  5C3X A;  5IGC A;  2I46 A;  2CFM A;  4GOP C;  4A3J B;  1V9P A;  4IUR A;  2N49 A;  2PI2 E;  1F2Y A;  3OPO A;  4DV5 L;  3A5U A;  3C1E A;  1LTG D;  4ZCK A;  4G7O C;  2RQX A;  4XT3 B;  1CA5 A;  3SK8 A;  1LTT D;  4I7Z C;  4DV7 L;  2F1M A;  4L5R C;  3KJP A;  3H0G G;  4CGY B;  1VQJ A;  1I4G A;  2KA7 A;  1STN A;  3HOW H;  5CV5 A;  4IUT A;  3MA2 B;  4J8Q A;  5M5X B;  4FF4 A;  2EXD A;  1PTO D;  2CQO A;  1XPO A;  5K36 H;  1TWC H;  2EY6 A;  5FO8 B;  2DNE A;  3PO3 H;  1KC8 C;  1CZW A;  2R3Z A;  1GO3 E;  3T1H Q;  5ELE A;  1WOC A;  2N55 A;  4N8F A;  4DAY B;  3E6Z X;  3AFQ A;  4G7H C;  1KQS A;  4A3J G;  4J6H A;  1WTQ A;  2OQK A;  4RHS A;  3JAM L;  3PSI A;  2Q8I B;  4A3E H;  3D6W A;  3E0J A;  3NEL A;  2Z1C A;  4LF4 L;  2VQE Q;  3RN5 A;  3U50 C;  2MPM A;  5KIX A;  1UEA B;  1PA6 A;  5IP7 G;  2EXZ A;  4FF2 A;  3RD4 A;  1SYB A;  2Q2T A;  5DLQ E;  4DR1 Q;  1XYI A;  2BA1 A;  2I5H A;  3R2T A;  2VUM B;  1HZA A;  1MJC A;  2EY5 A;  1FNV A;  1KAA A;  2MQH A;  1SYD A;  2NUC A;  3MFG A;  4HJ5 A;  4YHH L;  1DD2 A;  1Q90 A;  1UNS A;  5E1F A;  1KAB A;  2EYJ A;  4DR4 Q;  4MTN A;  1EY7 A;  2NN6 H;  4B3T Q;  2A6E C;  4BY1 B;  2HDM A;  2AUJ D;  3H09 A;  4LF7 L;  4UHV A;  3KLW A;  1Q81 C;  2HIV A;  1GUO A;  4YWM A;  4Y7N H;  2SNS A;  5FO7 B;  4OX9 Q;  1BF4 A;  2RDF A;  4A75 A;  4BBR H;  4ZUJ A;  2F0O A;  4JBJ A;  4RCO A;  1JE4 A;  4GLA C;  3M3Y H;  1J9O A;  4GS3 A;  1QUQ A;  3L7Z C;  2WB1 B;  1CI3 M;  1A2U A;  2KVM A;  4JC0 A;  5FLX L;  2RDG A;  2V4D A;  3NQT A;  3IFD A;  2MJ8 A;  3BDL A;  3L9A X;  2VUM G;  1NNX A;  2ZJP A;  3CCS A;  4IOC A;  5G3L D;  3CMA A;  1ILP A;  5LMU Q;  1G91 A;  1JCK B;  3E3X A;  4CDD C;  4QCL A;  4A3I H;  2F0I A;  3NQI A;  1WTX A;  1PH9 A;  4BY1 G;  5J39 A;  1HZC A;  2E8G A;  2NYZ D;  1U4L A;  3FEW X;  4XXE A;  5IWA L;  1EEI D;  4JI3 L;  1D1K A;  4DV1 L;  2YTX A;  4LUO A;  1ET6 A;  1YVC A;  1Y8P B;  5TSS A;  2K75 A;  5CV6 A;  4LNQ A;  3KF6 B;  1JJG A;  1E2W A;  2B2T A;  4NXM L;  1RTO A;  4K6D A;  1FJG L;  2R7F A;  3I4M H;  4F87 A;  1QOH A;  2OQ0 A;  4EQ5 A;  1UE1 A;  3OTO L;  2WB1 G;  1SYE A;  3NPP A;  2E5L L;  2OTL A;  1VMP A;  3K7A B;  3S2D B;  3I4L A;  1B1Z A;  3PIP 3;  2IY5 B;  1ZEQ X;  2K5V A;  3TN2 A;  4V0B A;  4JBM A;  2FIN B;  3SE0 A;  3K0X A;  1ONL A;  3TRE A;  4X66 Q;  1N33 L;  5KYL A;  4C3J B;  3GO5 A;  2IPK D;  3FPU B;  5IYC G;  3S15 H;  3ERQ A;  4OWT B;  3OWF A;  4KHP L;  2PQA B;  3D31 A;  4BBS B;  2BE5 C;  1CHQ D;  1T9H A;  1Y1W H;  2JA8 B;  3K5O A;  1Y69 U;  2Z6K A;  5IYB G;  4YCV A;  4AYB E;  2Z4H A;  5LHY 1;  1HNZ L;  1BBW A;  5T1G A;  5IOC A;  3NBH B;  1G51 A;  5D65 A;  2NVQ B;  3W5O A;  2E74 C;  2UUB Q;  3OMC A;  1K83 B;  4DU9 A;  5IP9 G;  3STB D;  3AYH B;  4O0A A;  4OO1 G;  1NY4 A;  1YHQ A;  1JOO A;  2CH4 A;  2IHF A;  5CGK A;  1YHA A;  5J3B A;  1SXT A;  2EZV A;  5JJZ A;  5M3M H;  1D8L A;  3VR3 A;  4NKL A;  1G29 1;  5HGQ A;  2K5D A;  2A73 B;  4C3J G;  2CWA A;  3HFZ B;  3TP6 A;  4DR6 Q;  1GOZ A;  1VF7 A;  3D3R A;  4JV5 L;  4IJH A;  1CKM A;  1WTH A;  3GTP H;  4H0L C;  3CC4 A;  1WTR A;  2UUC Q;  5DAU A;  4BBS G;  2L0C A;  3D4D A;  2JA8 G;  3S1Q B;  1V43 A;  1PDQ A;  2HDL A;  2ASB A;  1O7L A;  4R4Q A;  2XGT A;  4C3H B;  4XDX A;  1QCB D;  1AZP A;  3S1M B;  4LJZ C;  4WJ3 M;  3KJO A;  1CZG A;  1YNJ D;  4DK6 C;  4JI2 L;  1V8Q A;  3T56 B;  2JQO A;  3FRP B;  3M85 A;  4POF A;  1ILQ A;  3OOC A;  1G2T A;  2R61 A;  4ZRZ A;  3A74 A;  4IUN A;  4BS9 A;  2WKC A;  2EIF A;  4ID6 A;  1Q1E A;  2EOT A;  2PO4 A;  2KED A;  3CHB D;  4K8I A;  3RUZ A;  4RWS C;  1EQR A;  4TKO B;  1JOQ A;  4O2D A;  5EKK A;  2EPB A;  1I4X A;  2F0F A;  3FVQ A;  3TS0 A;  2N78 A;  1CUK A;  1IL8 A;  1D5M C;  1NR2 A;  2C5C A;  1QG7 A;  1IHZ A;  1AEX A;  3UDF A;  1B8A A;  3ZYY X;  3K5L A;  2K03 A;  3R8B A;  1STE A;  4KKU A;  4LW1 A;  1K8G A;  2Q2I A;  3J7A F;  1D5Z C;  4Q0F A;  5JJK A;  4DV6 Q;  2OCE A;  4EQO A;  3M4Y A;  2BA0 A;  1WFQ A;  3SEB A;  4JI4 Q;  2WB1 E;  4RAU C;  5I9P A;  1MIU A;  2PCF B;  5E4W C;  1M90 C;  5EKL A;  4B3S Q;  5E4X A;  3I4N B;  2WAC A;  2VB3 X;  3S14 H;  1D1I A;  1AP0 A;  3GTM H;  2AQ2 B;  1YI2 A;  5A2Q L;  1B50 A;  1SE3 A;  5C0X I;  3GTK B;  4TSS A;  4RGO S;  2F3I A;  4R1J A;  5C4X H;  2A19 A;  2Z8L A;  1CQV A;  4LUV A;  1R9T H;  1I50 H;  3KBG A;  4DV2 L;  2BCO A;  5BR8 L;  4A3D H;  1O7Y A;  3LWU A;  4FDB A;  5CV9 A;  5EBD A;  4POG A;  1HCZ A;  2LXJ A;  3HOY B;  3CCM A;  4C1N I;  4A3C H;  3I56 A;  1WD1 A;  4RH6 A;  1J6Q A;  1H9M A;  3ND9 A;  4OXP A;  1X6O A;  4QUC A;  4B9W A;  3ULP A;  2H1E A;  1KRT A;  1NR4 A;  5M3F B;  4CKB A;  3CCL A;  4IO9 A;  4DKA C;  3I4N G;  3SK5 A;  1F9P A;  2NVT H;  1GD7 A;  3MEF A;  1MD2 D;  1E2Z A;  1CKN B;  2A74 C;  2GN5 A;  1I6V C;  3EVQ A;  1ROD A;  2NZO A;  4KHV A;  2BDO A;  4PZ8 A;  4UP7 A;  2MO0 A;  1TWH H;  1QJO A;  1EIF A;  2EYF A;  5M5W H;  5C0X H;  2K32 A;  5CBE E;  5I6Y A;  1A15 A;  1N9W A;  2E75 C;  3HOY G;  5EAY A;  4JPB W;  2CWP A;  2WAQ E;  2JA7 H;  3MTS A;  1VQF A;  1J5E L;  4DA2 A;  4DNT B;  2HIX A;  4QMG A;  3H15 A;  2VNU D;  4RG1 A;  1BO0 A;  1K3R A;  1HR0 W;  1QIL A;  2FMM A;  3HKZ E;  2EJG C;  5DEH A;  3SVM A;  2LFN A;  3A54 A;  1F9Q A;  4NXM Q;  5M3F G;  1EYD A;  3TQY A;  5FOB B;  3S16 H;  1EZ6 A;  2G9H D;  1SNQ A;  2K52 A;  1UE5 A;  3F2D A;  3OTO Q;  4FXD A;  3TZU A;  1I3Q B;  1KDC A;  3FMC A;  4DF7 A;  1CKN A;  2QEJ C;  3MEH A;  3NWT A;  1L0X B;  1YHB A;  1IYV A;  1SJH D;  4X64 L;  1O78 A;  1RD9 D;  2F0T A;  2MFI A;  3H0G H;  1TY2 A;  1TWG B;  1V1Q A;  3KBX A;  4RHR A;  1PXU A;  4O42 A;  2B2V A;  5EJW A;  5C3E B;  1I94 Q;  5IGD A;  1X3F A;  1HNZ Q;  1X3Q A;  1PTO B;  1VQI A;  1SFO H;  1LAC A;  5GAD C;  3TDQ A;  3GDE A;  1V1P B;  2MGS A;  4H13 C;  1LT6 D;  1GUT A;  3GTO H;  5E7N A;  4OIJ A;  4QB4 A;  1DYQ A;  4JYA L;  4I7A A;  2A68 D;  2B2T C;  3IL8 A;  3G7L A;  3JC6 6;  4A3J H;  3G48 A;  1M1K C;  1I6H B;  3KF8 B;  2F3W A;  2NVX H;  5E3F A;  1XMQ Q;  3KLR A;  3DWP A;  3BZD B;  2Q8R E;  4O1N A;  3HOX B;  4X3U A;  2M9V A;  1S5E D;  2WII B;  3I90 A;  3CQZ H;  2UXB Q;  1HXY D;  2B63 B;  3NEN A;  2LS0 1;  3HS0 C;  5M5X H;  3AU7 A;  5COY A;  1ASZ A;  4LFC Q;  5C3E G;  2Z6K C;  3QR8 A;  3P20 A;  1N8R C;  4IUQ A;  4YWK A;  4Q5V A;  2HCC A;  4GKJ L;  2N88 A;  1VQA A;  1B53 A;  2VQE L;  4OON A;  5CV7 A;  1PVO A;  1EEF D;  3KF8 A;  5IT9 L;  2K01 A;  5D3D A;  1UE6 A;  3TME A;  1I4P A;  4KLK A;  2R93 B;  3M4P A;  3UE1 A;  2Y0S B;  4K2K A;  3HOX G;  1IKL A;  1LLR D;  2DN8 A;  4LF6 Q;  2RF4 A;  4DR4 L;  1GKH A;  4EX5 A;  4B3T L;  2B63 G;  2AKW B;  1Z7T A;  1L2F A;  3B6Y A;  2YV5 A;  2VUM H;  4LFB Q;  2IX3 A;  3KUP A;  4P72 A;  1SYF A;  3CP0 A;  1Y1V B;  4DR2 Q;  4FXG C;  1PRT C;  1MSH A;  3PO2 H;  5LMN W;  1N34 Q;  4UP8 A;  4OX9 L;  4BY1 H;  2E2H B;  1B2T A;  5H1S E;  1BOS A;  4QF4 A;  1WYD A;  3T51 B;  2FHT A;  4GNX A;  1XMO Q;  3VR2 A;  4U67 3;  1JC7 A;  2H4O A;  1SRO A;  5C5M A;  4LUZ A;  2K6A A;  1EY6 A;  2UXD L;  1CM9 A;  4ZAI A;  1HA5 A;  2R93 G;  4GZY C;  1TT2 A;  3KDF B;  2Y0S G;  5LMU L;  4IPD A;  1FYC A;  2XN9 C;  3D8G A;  3VYT A;  1VQ5 A;  3GP7 A;  1JB3 A;  1UEB A;  4KJN A;  1EIY B;  2LSS A;  2EYM A;  1CSP A;  1Y8O B;  2HHH Q;  2PNH A;  3I55 A;  5COR A;  3DLL A;  1CT1 D;  4QIW B;  1VQM A;  3F2C A;  1Y1V G;  3K59 A;  5CYU A;  1ASY A;  3TP7 A;  3IRB A;  3PQI A;  1TWA B;  1ENA A;  1O7I A;  3RZD B;  3V96 A;  4E6I A;  4BXX G;  1NSN S;  2EYH A;  3NSW A;  5IYB H;  2KHS A;  3T4A C;  5EGT A;  1TWF B;  4QL5 A;  3QJY A;  3QIA A;  5BN5 A;  4PZ7 A;  1WJJ A;  2ZTE A;  3FHW A;  2KCC A;  4X66 L;  1X54 A;  1BDO A;  4ZUI A;  1SNM A;  2OWO A;  3HOU B;  4H44 C;  1LV9 A;  2YTV A;  2EY1 A;  3K7A H;  3S2D H;  5IE8 A;  1FNW A;  2L4N A;  1K0S A;  4WJW A;  1P8L A;  2F0P A;  2RVL A;  1NUC A;  4DR7 L;  4EGV A;  2X6L A;  2F0L A;  4AIM A;  3HZX A;  1QE6 A;  1B9N A;  3T16 A;  1A6X A;  1IBM Q;  2EQS A;  3JAM c;  2ZTC A;  4PNY A;  2UUB L;  3ER0 A;  4KK7 A;  3DMU A;  3J81 j;  4X65 Q;  3S17 B;  2L5T A;  3K57 A;  1VQ6 A;  1PFM A;  2HD3 A;  3MFY A;  4NB3 A;  3X3M A;  1P16 A;  4U68 A;  4YWL A;  2NVQ H;  1YIT A;  2EVB A;  1BVS A;  1NBW A;  2E76 C;  1K83 H;  4EQP A;  1STG A;  2F0V A;  3D4R A;  1PZJ D;  4DR6 L;  3IFT A;  3SK4 A;  2UXC Q;  3HOU G;  2MNA A;  2UUC L;  4JI6 Q;  4KY5 A;  5EKI A;  5EBC A;  4CDF C;  3G4S A;  3FP9 A;  5GRO A;  3ND8 A;  5C4Z A;  2L9H A;  4JYA Q;  1VQC A;  2XNA C;  1AZQ A;  4JBK A;  4AYB B;  4N9T A;  1Z6H A;  1JWS D;  2M00 A;  2Y0S E;  4ABN A;  4JI5 L;  4C3H H;  3GTJ B;  4IOA A;  2NN6 I;  3S1M H;  4Y52 H;  2K5Q A;  2PZT A;  1JIC A;  1C48 A;  1RKN A;  3K5N A;  5C4J H;  4IN3 A;  3E5S A;  3CXC A;  2DUD A;  4C1N K;  5IGE A;  4AQY Q;  1H9R A;  2ATW A;  3ERO A;  4JCV E;  1LTA D;  2E2I B;  4ZKC B;  2K04 A;  3I70 A;  2G5D A;  3S2H H;  2JEB I;  1XX8 A;  2A6E D;  1MI2 A;  2XWJ B;  2CKZ B;  1MBY A;  2CQA A;  2GA4 B;  4DV6 L;  3CC7 A;  4GKJ Q;  2QCP X;  1LAB A;  3S1N H;  4CBV A;  1NE3 A;  2HQL A;  1JQY D;  4JI4 L;  2IT1 A;  5I6W A;  3KLS X;  5GQO A;  4RCN A;  4B3S L;  4AYB G;  1PH5 A;  3BYT B;  1EWC A;  4BY7 B;  1VQG A;  1EU4 A;  2MUY A;  1S40 A;  3Q6S A;  2JA6 B;  2ZJQ A;  2ZXO A;  2PMZ E;  4B3R Q;  1U9R A;  1VQK A;  5C44 B;  1SAP A;  3BJU A;  5LL6 S;  1B7Y B;  2AUK A;  1TS2 A;  3I4N H;  3J81 c;  3A8I E;  5FO9 B;  4QIW E;  3M4O B;  3FPP A;  4DAY A;  3GTG B;  2JP1 A;  2B2W C;  3AB9 A;  4KMU C;  3T1Y Q;  2MO1 A;  4KN4 C;  3NUC A;  3GV6 A;  1KLG D;  2JEA I;  3VYR A;  3RZO B;  2AMC B;  1VQ7 A;  2G9D A;  5IIF A;  4XQJ A;  2D5D A;  1ENC A;  1ZYR C;  4OEM B;  3F8T A;  1TS4 A;  4BY7 G;  1BCP B;  3LGJ A;  1L0W A;  4L5S A;  1TXY A;  2ZJR A;  2JA6 G;  2I5M X;  4OWW B;  4L5Q A;  4ILW A;  4APV A;  2LMC B;  2UXD Q;  5C44 G;  3CCU A;  4A3M B;  3UDI A;  5ELC A;  1TU2 B;  5M3F H;  2F0G A;  4IAL A;  1MJE A;  3OWE B;  3PGZ A;  1FGB D;  1SSO A;  1U4P A;  3KFU A;  1YJW A;  3P7J A;  2K7V A;  4CHT B;  4ZKB B;  5NUC A;  4R4C A;  1VF5 C;  4A4I A;  2KEN A;  5KNB A;  2XTI A;  1VMC A;  2PPB C;  1S4Z A;  3EIV A;  4N9P A;  2K33 A;  5DM6 3;  5D14 A;  4B3M L;  2VL6 A;  4LAA A;  2SNM A;  2BE5 D;  1FVI A;  1IKM A;  1X3G A;  1LTI D;  2C9O A;  4UDU C;  1N32 Q;  1KTK A;  1HFN A;  5JAV A;  1YJ9 A;  2UUA Q;  3UI2 A;  2V1C C;  2BDN A;  1KDA A;  4K14 A;  5HUR A;  2Z0S A;  3FKI B;  4HR7 B;  3SGI A;  4DUY Q;  1STB A;  3K7U C;  2JN4 A;  1G6P A;  1CK1 A;  3BVG A;  4GNX C;  3PF4 A;  1HR0 L;  4XYO A;  4RA8 A;  2ZTD A;  4CJ0 B;  3VA7 A;  5BN3 A;  5C4H A;  4A3M G;  4IFD G;  2BH2 A;  4KY6 A;  1HA6 A;  1A0I A;  1PRT F;  3SK6 A;  4F8M A;  4JI1 Q;  3U9S A;  1S72 A;  1XPR A;  3HOV B;  2XRQ D;  1H95 A;  1XNQ Q;  2OT2 A;  1Q8K A;  4DR7 Q;  5GAE C;  4FVM A;  1I94 L;  2JSO A;  2D0O A;  1DGS A;  5ELO A;  1IXR A;  3A7L A;  1WTP A;  1RDP D;  1VQH A;  1LUZ A;  1I5F A;  3KF6 A;  2L15 A;  2WAQ B;  1B44 D;  4A3K B;  4CDC C;  3FKI G;  4QJF A;  2EDG A;  4OIK A;  5C3E H;  1CA6 A;  1DZ1 A;  1VQP A;  4MIU A;  2JXM B;  1PTO H;  3HKZ B;  5FLM G;  1X55 A;  2EJM A;  1H9K A;  4C2M H;  1ZXT A;  1JWU D;  1PFS A;  5IYD G;  1XMQ L;  4CKE A;  2IWH A;  3CF5 A;  3OW7 A;  1X9N A;  5C5L A;  2VW9 A;  3DM3 A;  1KXL A;  2WP8 J;  4A93 B;  1I4R A;  2CW0 D;  2PQA A;  2Q2H A;  1I6H H;  3BG3 A;  1SDF A;  2K4K A;  1UE7 A;  3L3O C;  3SR1 A;  2UXB L;  3HOV G;  5J22 A;  4A3F B;  1II3 A;  3MWY W;  2CH4 W;  4LFC L;  1JJ2 A;  2GVA A;  1EQV A;  3HOX H;  3NBH A;  2XRS D;  4DAV A;  3CRL C;  4DR5 Q;  4K8J A;  2B63 H;  1I4Q A;  2WAQ G;  4DAM A;  4A3K G;  3LWE A;  1EYC A;  1HQR D;  3I73 A;  2NB0 A;  4JBW A;  5T1I A;  1BQQ T;  3I7F A;  4I65 A;  4JI0 Q;  5J1Z A;  2IJ0 A;  3C3L A;  1SBB B;  4JI5 Q;  1H9S B;  1EFW A;  3HKZ G;  4RMF A;  2B8F A;  3H94 A;  5GAG C;  3GD7 A;  1RCV D;  2RHQ B;  2X69 A;  3NTI A;  3WWV A;  5M5Y B;  4IFD J;  1Q3L A;  1IBL L;  4DXF A;  2WKD A;  3G71 A;  5C6A A;  2CW0 C;  3HEJ A;  3R93 A;  2GVB A;  2VS1 A;  4ZQ3 A;  4A93 G;  3BVZ A;  4N8X 1;  3BDO A;  4IUP A;  4LF6 L;  1HJP A;  1IW7 C;  3QOL A;  5CMD A;  4HMJ A;  1HTL D;  3PO3 B;  3OHX C;  4GLV B;  3LX0 A;  1W3S A;  4A3F G;  4LFB L;  2ALY B;  1BBX C;  1JE5 A;  4DK3 C;  3MHB A;  2R93 H;  3QOJ A;  3PV0 A;  1F2M A;  4HJ9 A;  4DR2 L;  3K58 A;  1K3B C;  3J80 c;  1NCV A;  1N34 L;  2YYZ A;  4IUU A;  4PMB A;  1YZ6 A;  2H5X A;  2AWN A;  1XMO L;  3UDG A;  5JPM C;  1A3T A;  2O4X A;  1Y1V H;  1QZH A;  1B70 B;  2Q8T A;  2K50 A;  5CR3 A;  1OXV A;  2DJF C;  2E2H H;  2D0P A;  1CHP D;  3RLN A;  2E2J B;  4FP5 D;  4HTH A;  5K36 G;  4IPG A;  3CW2 C;  5K5P A;  3PO3 G;  3CD6 A;  1F2Z A;  4MHE A;  5JJI A;  3RN2 A;  1C9O A;  1GUS A;  2EE1 A;  2I0Q A;  1LTS D;  2HHH L;  1HNW Q;  3WOE A;  1SMX A;  4PV1 C;  2TSS A;  1NMF A;  2KHJ A;  3MXG A;  3A7A B;  4Y7N B;  4LF8 L;  3ERS X;  3U9O A;  3MAQ A;  3JAM i;  1PH3 A;  5ELD A;  1KNE A;  5KGU A;  5KEE A;  4DN4 M;  1SJE D;  3CCJ A;  1DOM A;  1PH6 A;  3M3Y B;  1TWA H;  4OHJ A;  4YY3 Q;  4PZ6 A;  3L0O A;  4A3B H;  2A1A A;  4K5W A;  2QA4 A;  1RL2 A;  1PH4 A;  3EA6 A;  5C3W A; 
#chains in the Genus database with same CATH homology
 1R4Q B;  2QKI C;  2A6H C;  1SNC A;  3DWQ A;  2YU9 B;  2OXP A;  3BS1 A;  3GQB A;  5JOB A;  3KLS A;  4KY7 A;  5IGB A;  5CBA E;  2NZ1 D;  2J7Z A;  3I72 A;  5BN4 A;  3URY A;  4B08 A;  1HFG A;  3BVM A;  1F2L A;  2B39 A;  3I4M B;  3A56 A;  3CKI B;  1PTO F;  2F0H A;  3I8Z A;  4FNF A;  2KJX A;  1JR0 D;  1KDB A;  3O13 A;  1SE2 A;  1NAP A;  3WDN A;  3S15 B;  2CHB D;  2RDH A;  4KV6 A;  1OXT A;  2F0N A;  1D5X C;  3G6J B;  2O2L D;  3JAM E;  1Y1W B;  1SND A;  3V05 A;  4IQZ A;  3DEO A;  3D6C A;  1SNP A;  4Z9C B;  1BCP C;  2QF7 A;  5DNF A;  2K5W A;  4DGZ A;  3I3C A;  1KLU D;  2SEB D;  3IKJ A;  1HUM A;  3GV3 A;  1ET9 A;  4ZYS A;  2L12 A;  2ZT9 C;  1LT3 D;  5KRU A;  5JPN C;  2WV6 D;  2PQE A;  2PW7 A;  1BXT A;  2F0Q A;  2HQE A;  4PMC A;  1CQF A;  1V1P A;  3PUW A;  3S1R B;  4EVO A;  4RGM A;  3RMH A;  4EQN A;  2AQ3 B;  1L0Y B;  3WOF A;  1PRT D;  1FNU A;  1G8Z D;  2DY7 A;  1OO9 B;  2LKV A;  4RGN A;  3GTL B;  2IW3 A;  3VYS A;  2F3V A;  4ZK9 B;  3ONA B;  1S5F D;  4KKS A;  3SHL A;  2HUG A;  5EPL A;  1BR9 A;  3C46 A;  1K8M A;  3VYU A;  2XVS A;  1EY5 A;  4C3I B;  2DNC A;  4DXG A;  3PMF A;  3W3A A;  2F4I A;  5EPJ A;  5AFW A;  3PUZ A;  4OO1 I;  1EY4 A;  4FYD A;  3Q24 A;  3GTM B;  3J81 E;  2F0E A;  2KEE A;  4HAE A;  1STY A;  2PMZ B;  3NK9 A;  4KHZ A;  4R8I A;  1XTC D;  1I50 B;  4XT1 B;  2PZU A;  1EIG A;  1G2S A;  4C3I G;  1STA A;  2NVY B;  4UAI A;  3X3N A;  2SDF A;  2JYO A;  1F9R A;  1LO5 D;  4NW2 A;  4XTC S;  1AN8 A;  1GUW A;  3J7A V;  3A8K E;  4G7Z C;  4FO2 A;  4K5X A;  1A3V A;  4KD3 A;  4JK1 C;  2RBM A;  4OO1 H;  1DOK A;  3FDT A;  4HCE A;  1TWH B;  1HTP A;  2B2U A;  2R92 B;  2FJ2 A;  3AMU A;  1A3U A;  3IAY A;  2A69 D;  3HGB A;  4L6T B;  1B4O A;  2RKS A;  3NWS A;  3DWA A;  1TVX A;  3S9W A;  3HP3 A;  4G4K A;  4KI0 A;  4LK1 C;  1VDZ A;  1HQM C;  3CU7 A;  4ULL A;  5C0X G;  5FKA C;  3VR5 A;  2K1B A;  1FD7 D;  4DNR B;  2JA5 B;  2A69 C;  3SDZ A;  2D9U A;  1SFO B;  3Q23 A;  2D62 A;  1CFM A;  1AW7 A;  5A2Q E;  4G57 A;  4X3T A;  4M8A A;  1RHP A;  2FMC A;  1AFP A;  2R7Z B;  2NVX B;  3PIO 3;  4K6L A;  1SMY C;  3HRZ C;  2F03 A;  1EY0 A;  1PZK D;  3N6R A;  2AQ1 B;  5CV4 A;  4OL7 A;  4XIG S;  4ME5 A;  4DAP A;  2B2V C;  4QUF A;  3CQZ B;  1DON A;  1C4Q A;  3DUZ A;  1LTR D;  5ELF A;  4M1U B;  3EQL C;  3NTH A;  2IL8 A;  2EYP A;  1YNN C;  3PUY A;  4XQQ A;  1ZYR D;  1J8I A;  1EY9 A;  4PQX A;  3TBI B;  1OXX K;  2LY7 A;  2F0S A;  1XXG A;  4ZLT F;  4HMI A;  2PNR C;  4BWG B;  4KN7 C;  1WTV A;  1M4V A;  1TY0 A;  3QO2 A;  1BCP F;  5IOD A;  1OXS C;  4H7B A;  5C0X J;  5EQ0 A;  4F88 A;  4KTA A;  4A3G B;  1FR3 A;  3A55 A;  1PTO C;  3J80 E;  4RFB A;  2VB2 X;  3PUV A;  2R6G A;  3QB3 A;  3P1H A;  3PO2 B;  3OMG A;  3VR6 A;  5JEA G;  1EYA A;  1TR5 A;  4HCS A;  3TP8 A;  1TQO A;  2PW5 A;  1K8O A;  1I4H A;  2B2Y A;  1Z47 A;  3MXP A;  1HUN A;  1D2B A;  1X32 A;  1TII D;  5KNC A;  1EU3 A;  1H9J A;  1EIH A;  1WCM B;  1EZ8 A;  1F9S A;  2EYO A;  1WVL A;  1QB5 D;  1SE4 A;  3R2I A;  5FK9 C;  1GHJ A;  1TS3 A;  4YIJ A;  1JWM D;  2SOB A;  2O5J C;  2TMP A;  1UUP A;  1ZKO A;  3GTQ B;  2EYL A;  4RKL A;  1BUV T;  1ESR A;  1WD0 A;  1F77 A;  1U4M A;  5D3I B;  4LMQ D;  1HHV A;  4RKB A;  4P2C B;  1DCZ A;  2NTT A;  4RGT A;  2E2D C;  1PMR A;  3EJI A;  3J81 L;  5ELB A;  3Q22 A;  5EPK A;  3QWN A;  3NXW A;  2F0M A;  5JEA J;  3C2P A;  4IZ8 A;  2J4X A;  3KK7 A;  5IT9 E;  5F2D A;  4FF3 A;  1S5B D;  4S3S A;  1RF2 D;  2M2L A;  1PRT B;  3NBI A;  1C8C A;  5LL6 X;  3H6M A;  4IUV A;  1R4P B;  2CVR A;  3BDC A;  5I4D A;  1IW7 D;  2B2U C;  3HOZ B;  4ODG A;  4KJO A;  1O80 A;  3LNN A;  2KQ3 A;  4XQN A;  3K0Y A;  4HSV A;  4V19 0;  1DM0 B;  1PFN A;  4WRD A;  4HED A;  2EJF C;  1ICW A;  1W6K A;  1D6E C;  5DM7 3;  3HOW B;  2L1B A;  1KNA A;  2XIW A;  5KYI A;  3DEP A;  3A8J E;  2X6G A;  1LT4 D;  3QG1 A;  5C4J B;  2F0W A;  2F0D A;  1TWC B;  1T5X D;  3K6O A;  4KKT A;  1A2T A;  4K5V A;  3I91 A;  2KEC A;  4OGQ C;  3S2H B;  5ISR A;  3CRK C;  4DK1 A;  2IX1 A;  2AWO A;  3S1N B;  4A3E B;  2F0J A;  1H9S A;  2K28 A;  1UAP A;  1W6J A;  3TP5 A;  3Q0A A;  1B3A A;  4NP5 A;  4J1M A;  3H91 A;  4C3H G;  3OIQ A;  5HGT A;  1YNJ C;  1GJX A;  1SYC A;  1EL0 A;  2EY2 A;  4DK0 A;  2ZXP A;  4NDX A;  2A5H A;  1EQT A;  1SEB D;  4TQU S;  3H3V C;  4R8N A;  5IGG A;  2A6H D;  1EWH A;  3OIP A;  2PZW A;  2ICE C;  3MXN A;  3OSO A;  4BBR B;  2PYK A;  3VR4 A;  1XWE A;  2OF1 A;  1U4R A;  3T53 B;  4F7X A;  4PMW A;  1G6Z A;  1EY8 A;  4A3I B;  2IX0 A;  2NN6 G;  4WFN 3;  3ITP A;  2KCN A;  4R9W A;  1LT5 D;  1X3P A;  5I2Y A;  2NTS A;  1E0B A;  4CJ2 C;  1ESF A;  3MZ5 A;  1BCP D;  1DJR D;  1GXD C;  4MN3 A;  2J0T D;  3V2T A;  1PZI D;  2B2Y C;  3J80 L;  2XWB B;  2QDB A;  4X3S A;  5CV8 A;  2KOL A;  1GUG A;  2FFK B;  3DXJ C;  1S5D D;  1EFI D;  2RA4 A;  4X3K A;  3P75 A;  4BA1 I;  1SYG A;  2Z4I A;  1WTW A;  1GHK A;  3EFX D;  2MP1 A;  4KD4 A;  3R3O A;  2L55 A;  4C2M B;  1CTM A;  5M3M B;  5IGF A;  3J7Y W;  1VCI A;  3GTP B;  2WIN B;  2D2C C;  1M8A A;  3W2D A;  3TZD A;  3T13 A;  1DXM A;  1JOK A;  1PYW D;  1QWY A;  2ID0 A;  3NTK A;  2B2W A;  5JVG 3;  5FLX E;  1MGS A;  1GUN A;  1Q8I A;  1HPC A;  3NHH A;  5G3L F;  5CC4 A;  1HRJ A;  2ENB A;  4IFD I;  2A68 C;  5JEA H;  1TKW B;  2VXW A;  3MC0 B;  4K2L A;  1E2V A;  4CJ1 B;  4FF1 A;  3BYY B;  2XSC A;  4CKC A;  1IYU A;  4BA2 I;  3N52 A;  2F0K A;  3S14 B;  1T5E A;  3PUX A;  2KUM A;  5I2X A;  1PFB A;  1OXU A;  5C4X B;  1R9T B;  3NE5 B;  1EOT A;  2F0U A;  3MVV A;  1B9M A;  4IFD H;  5I9O A;  4A3D B;  1MSG A;  3DM1 A;  2K05 A;  5M9O A;  5A35 A;  4B9X A;  4DFA A;  4NMZ A;  2NVT B;  3NP8 A;  2I07 B;  1WTO A;  2B8G A;  1BNZ A;  2HCI A;  1RJT A;  4A3B B;  1V1O A;  2NWG A;  4HSP A;  2ICI A;  1TS5 A;  1SNO A;  4L63 B;  5M5W B;  1Q12 A;  4HN7 A;  1DOL A;  1LTB D;  1RTN A;  3TSS A;  3C1F A;  2JA7 B;  5JVH 3;  3SXH A;  2JE6 I;  1ML0 D;  2NBF A;  4XYQ A;  1PLF A;  3S16 B;  2O5I C;  1ENF A;  2DY8 A;  3M7N A;  3HG9 A;  2QIL A;  2MHV A;  3RLF A;  1JOR A;  3M7G A;  3VA5 A;  1S5C D;  2RSO A;  2ZXR A;  3H0G B;  3F2U A;  1SMY D;  2RSN A;  4L8J A;  2OEO A;  3D4W A;  2BOS A;  3DHQ A;  1Q1B A;  1QNU A;  5KND A;  4C56 C;  1STH A;  4TRD A;  3K5M A;  2L11 A;  3MXU A;  1Y8N B;  4FXK C;  4WOR A;  1QNK A;  1O7Z A;  3GTO B;  1YNN D;  5C3X A;  5IGC A;  2I46 A;  4A3J B;  4IUR A;  1F2Y A;  3OPO A;  3C1E A;  1LTG D;  4G7O C;  2RQX A;  4XT3 B;  1CA5 A;  3SK8 A;  1LTT D;  4I7Z C;  2F1M A;  4CGY B;  1I4G A;  2KA7 A;  1STN A;  5CV5 A;  4IUT A;  3MA2 B;  4J8Q A;  5M5X B;  4FF4 A;  1PTO D;  5K36 H;  2EY6 A;  5FO8 B;  2DNE A;  1CZW A;  2R3Z A;  5ELE A;  2N55 A;  3E6Z X;  4G7H C;  4J6H A;  1WTQ A;  4RHS A;  3JAM L;  2Q8I B;  3D6W A;  3E0J A;  2Z1C A;  2MPM A;  5KIX A;  1UEA B;  2EXZ A;  4FF2 A;  3RD4 A;  1SYB A;  1XYI A;  2BA1 A;  3R2T A;  2VUM B;  2EY5 A;  1FNV A;  1KAA A;  1SYD A;  2NUC A;  3MFG A;  1DD2 A;  1Q90 A;  1UNS A;  5E1F A;  1KAB A;  2EYJ A;  1EY7 A;  2NN6 H;  2A6E C;  4BY1 B;  2HDM A;  2AUJ D;  3H09 A;  1GUO A;  2SNS A;  5FO7 B;  1BF4 A;  2RDF A;  4ZUJ A;  2F0O A;  4RCO A;  1JE4 A;  1J9O A;  3L7Z C;  2WB1 B;  1CI3 M;  1A2U A;  2KVM A;  5FLX L;  2RDG A;  2V4D A;  3NQT A;  3IFD A;  2MJ8 A;  3BDL A;  3L9A X;  5G3L D;  1ILP A;  1G91 A;  1JCK B;  4QCL A;  2F0I A;  3NQI A;  1WTX A;  5J39 A;  2NYZ D;  1U4L A;  3FEW X;  4XXE A;  1EEI D;  1D1K A;  1ET6 A;  1Y8P B;  5TSS A;  5CV6 A;  1E2W A;  2B2T A;  1RTO A;  4K6D A;  4F87 A;  1QOH A;  1SYE A;  3NPP A;  1VMP A;  3K7A B;  3S2D B;  3I4L A;  1B1Z A;  3PIP 3;  1ZEQ X;  3TN2 A;  4V0B A;  2FIN B;  3SE0 A;  1ONL A;  5KYL A;  4C3J B;  3GO5 A;  2IPK D;  3FPU B;  3ERQ A;  3OWF A;  3D31 A;  4BBS B;  2BE5 C;  1CHQ D;  2JA8 B;  3K5O A;  1Y69 U;  2Z4H A;  5LHY 1;  5T1G A;  5IOC A;  5D65 A;  2NVQ B;  2E74 C;  3OMC A;  1K83 B;  4DU9 A;  4OO1 G;  1JOO A;  5CGK A;  1SXT A;  2EZV A;  5JJZ A;  3VR3 A;  4NKL A;  1G29 1;  2K5D A;  2A73 B;  4C3J G;  3TP6 A;  1GOZ A;  1VF7 A;  3D3R A;  4H0L C;  1WTR A;  5DAU A;  2L0C A;  3D4D A;  3S1Q B;  1V43 A;  1PDQ A;  2HDL A;  1O7L A;  4C3H B;  4XDX A;  1QCB D;  1AZP A;  3S1M B;  4LJZ C;  1CZG A;  1YNJ D;  1V8Q A;  3T56 B;  3FRP B;  3M85 A;  1ILQ A;  3OOC A;  1G2T A;  2R61 A;  4ZRZ A;  4IUN A;  4BS9 A;  2WKC A;  4ID6 A;  1Q1E A;  2EOT A;  2PO4 A;  2KED A;  3CHB D;  4K8I A;  3RUZ A;  4RWS C;  1JOQ A;  4TKO B;  5EKK A;  2EPB A;  1I4X A;  2F0F A;  3FVQ A;  1IL8 A;  1D5M C;  1NR2 A;  2C5C A;  1QG7 A;  1IHZ A;  1AEX A;  3ZYY X;  3K5L A;  2K03 A;  3R8B A;  1STE A;  4KKU A;  3J7A F;  1D5Z C;  4Q0F A;  4EQO A;  3M4Y A;  2BA0 A;  3SEB A;  4RAU C;  5I9P A;  2PCF B;  5E4W C;  5EKL A;  5E4X A;  3I4N B;  2WAC A;  2VB3 X;  1D1I A;  1AP0 A;  2AQ2 B;  5A2Q L;  1B50 A;  1SE3 A;  5C0X I;  3GTK B;  4TSS A;  4RGO S;  2Z8L A;  1CQV A;  3KBG A;  2BCO A;  1O7Y A;  3LWU A;  5CV9 A;  5EBD A;  1HCZ A;  3HOY B;  4C1N I;  1WD1 A;  4RH6 A;  1H9M A;  3ND9 A;  4B9W A;  4QUC A;  2H1E A;  1NR4 A;  5M3F B;  4CKB A;  3SK5 A;  1F9P A;  1MD2 D;  1E2Z A;  2A74 C;  1I6V C;  3EVQ A;  1ROD A;  4KHV A;  2BDO A;  1QJO A;  2EYF A;  5C0X H;  2K32 A;  5CBE E;  5I6Y A;  1A15 A;  2E75 C;  3MTS A;  4DA2 A;  4DNT B;  4QMG A;  2VNU D;  1BO0 A;  1QIL A;  2FMM A;  2EJG C;  5DEH A;  3SVM A;  2LFN A;  3A54 A;  1F9Q A;  1EYD A;  5FOB B;  1EZ6 A;  2G9H D;  1SNQ A;  4FXD A;  3TZU A;  1I3Q B;  1KDC A;  3FMC A;  4DF7 A;  2QEJ C;  3MEH A;  3NWT A;  1L0X B;  1IYV A;  1SJH D;  1O78 A;  1RD9 D;  2F0T A;  1TY2 A;  1TWG B;  3KBX A;  4RHR A;  1PXU A;  4O42 A;  2B2V A;  5EJW A;  5C3E B;  5IGD A;  1X3Q A;  1PTO B;  1LAC A;  3TDQ A;  1V1P B;  2MGS A;  4H13 C;  1LT6 D;  1GUT A;  4OIJ A;  4QB4 A;  1DYQ A;  2A68 D;  2B2T C;  3IL8 A;  3G7L A;  1I6H B;  2F3W A;  5E3F A;  3KLR A;  3DWP A;  3BZD B;  2Q8R E;  4O1N A;  3HOX B;  4X3U A;  2M9V A;  1S5E D;  2WII B;  3I90 A;  1HXY D;  2B63 B;  2LS0 1;  3HS0 C;  3AU7 A;  5COY A;  3P20 A;  4IUQ A;  4Q5V A;  2HCC A;  2N88 A;  1B53 A;  5CV7 A;  1EEF D;  3KF8 A;  5IT9 L;  2K01 A;  5D3D A;  3TME A;  1I4P A;  2R93 B;  2Y0S B;  4K2K A;  1IKL A;  1LLR D;  2DN8 A;  1Z7T A;  2IX3 A;  3KUP A;  1SYF A;  1Y1V B;  4FXG C;  1PRT C;  1MSH A;  2E2H B;  1B2T A;  1BOS A;  4QF4 A;  3T51 B;  2FHT A;  3VR2 A;  4U67 3;  1JC7 A;  2H4O A;  5C5M A;  2K6A A;  1EY6 A;  1CM9 A;  4ZAI A;  1HA5 A;  4GZY C;  1TT2 A;  1FYC A;  2XN9 C;  3D8G A;  3VYT A;  3GP7 A;  1JB3 A;  4KJN A;  2EYM A;  1Y8O B;  5COR A;  1CT1 D;  4QIW B;  3K59 A;  5CYU A;  3TP7 A;  1TWA B;  1ENA A;  3RZD B;  3V96 A;  4E6I A;  1NSN S;  2EYH A;  3NSW A;  2KHS A;  3T4A C;  5EGT A;  1TWF B;  3QJY A;  3QIA A;  5BN5 A;  2KCC A;  1BDO A;  4ZUI A;  1SNM A;  3HOU B;  4H44 C;  1LV9 A;  2EY1 A;  1FNW A;  2L4N A;  4WJW A;  2F0P A;  2RVL A;  1NUC A;  4EGV A;  2X6L A;  2F0L A;  1QE6 A;  3HZX A;  1B9N A;  3T16 A;  1A6X A;  4PNY A;  4KK7 A;  3DMU A;  3S17 B;  2L5T A;  3K57 A;  1PFM A;  3MFY A;  3X3M A;  4U68 A;  2EVB A;  2E76 C;  4EQP A;  1STG A;  2F0V A;  3D4R A;  1PZJ D;  3IFT A;  3SK4 A;  4KY5 A;  5EKI A;  5EBC A;  3ND8 A;  5C4Z A;  2L9H A;  2XNA C;  1AZQ A;  4AYB B;  4N9T A;  1Z6H A;  1JWS D;  2M00 A;  4ABN A;  3GTJ B;  2NN6 I;  2K5Q A;  2PZT A;  1JIC A;  1C48 A;  1RKN A;  3K5N A;  4IN3 A;  3E5S A;  4C1N K;  5IGE A;  1H9R A;  3ERO A;  2E2I B;  1LTA D;  4ZKC B;  2K04 A;  3I70 A;  2JEB I;  1XX8 A;  2A6E D;  1MI2 A;  2XWJ B;  2GA4 B;  1MBY A;  2CQA A;  2QCP X;  1LAB A;  4CBV A;  1JQY D;  2IT1 A;  5I6W A;  3KLS X;  4RCN A;  3BYT B;  1EWC A;  4BY7 B;  1EU4 A;  2MUY A;  3Q6S A;  2JA6 B;  2ZXO A;  1U9R A;  5C44 B;  1SAP A;  5LL6 S;  2AUK A;  1TS2 A;  3A8I E;  5FO9 B;  3M4O B;  3FPP A;  4DAY A;  3GTG B;  2JP1 A;  2B2W C;  3AB9 A;  4KMU C;  4KN4 C;  3NUC A;  3GV6 A;  1KLG D;  2JEA I;  3VYR A;  3RZO B;  2G9D A;  5IIF A;  4XQJ A;  2D5D A;  1ENC A;  1ZYR C;  1TS4 A;  1BCP B;  4ILW A;  2LMC B;  4A3M B;  5ELC A;  1TU2 B;  2F0G A;  4IAL A;  3OWE B;  1FGB D;  1SSO A;  1U4P A;  3P7J A;  2K7V A;  4CHT B;  4ZKB B;  5NUC A;  1VF5 C;  5KNB A;  1VMC A;  2PPB C;  1S4Z A;  4N9P A;  2K33 A;  5DM6 3;  5D14 A;  4LAA A;  2SNM A;  2BE5 D;  1IKM A;  1LTI D;  2C9O A;  4UDU C;  1KTK A;  1HFN A;  5JAV A;  3UI2 A;  2BDN A;  1KDA A;  4K14 A;  5HUR A;  3FKI B;  4HR7 B;  1STB A;  1CK1 A;  3BVG A;  4XYO A;  4RA8 A;  4CJ0 B;  3VA7 A;  5BN3 A;  5C4H A;  4IFD G;  4KY6 A;  1HA6 A;  1PRT F;  3SK6 A;  4F8M A;  3U9S A;  3HOV B;  2XRQ D;  2OT2 A;  4FVM A;  2JSO A;  3A7L A;  1WTP A;  1RDP D;  2WAQ B;  1B44 D;  4A3K B;  2EDG A;  4OIK A;  1CA6 A;  1DZ1 A;  4MIU A;  2JXM B;  1PTO H;  3HKZ B;  2EJM A;  1H9K A;  1ZXT A;  1JWU D;  4CKE A;  2IWH A;  3OW7 A;  5C5L A;  2WP8 J;  4A93 B;  1I4R A;  2CW0 D;  3BG3 A;  1SDF A;  3L3O C;  3SR1 A;  5J22 A;  4A3F B;  1II3 A;  3MWY W;  1EQV A;  3NBH A;  2XRS D;  4DAV A;  3CRL C;  4K8J A;  1I4Q A;  4JBW A;  1EYC A;  1HQR D;  2NB0 A;  3I73 A;  3LWE A;  5T1I A;  1BQQ T;  4I65 A;  5J1Z A;  2IJ0 A;  3C3L A;  1SBB B;  1H9S B;  2B8F A;  3H94 A;  3GD7 A;  1RCV D;  2X69 A;  3NTI A;  5M5Y B;  4IFD J;  1Q3L A;  4DXF A;  2WKD A;  5C6A A;  2CW0 C;  3HEJ A;  3R93 A;  4ZQ3 A;  3BVZ A;  3BDO A;  4IUP A;  1IW7 C;  3QOL A;  5CMD A;  4HMJ A;  1HTL D;  3PO3 B;  3OHX C;  3LX0 A;  1BBX C;  3MHB A;  3QOJ A;  3PV0 A;  1F2M A;  3K58 A;  1NCV A;  2YYZ A;  4IUU A;  4PMB A;  2AWN A;  5JPM C;  1A3T A;  2O4X A;  2Q8T A;  5CR3 A;  1OXV A;  1CHP D;  2E2J B;  4FP5 D;  4HTH A;  5K36 G;  5K5P A;  1F2Z A;  4MHE A;  1GUS A;  2EE1 A;  1LTS D;  3WOE A;  4PV1 C;  2TSS A;  3MXG A;  3A7A B;  4Y7N B;  3U9O A;  3MAQ A;  5ELD A;  1KNE A;  5KGU A;  5KEE A;  4DN4 M;  1SJE D;  1DOM A;  3M3Y B;  4OHJ A;  4K5W A;  3EA6 A;  5C3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...