5CORA

X-ray structure of macrophage inflammatory protein-1 alpha (ccl3) n-terminal-switch polymer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords C-C motif chemokine 3
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5corA00
1ESRA 4QUFA 2H1EA 2HDMA 1IKLA 1ICWA 4RWSC 1VMPA 1PFMA 2L1BA 4NW2A 1J9OA 3H91A 4MHEA 1DOMA 3HP3A 4IURA 2KUMA 3QO2A 1PLFA 1C8CA 3FPUB 2HCIA 2JYOA 2L12A 2D9UA 2B2VA 1U4LA 2HDLA 2KECA 2B2YA 4U68A 5T1IA 2EE1A 2N88A 1HRJA 4IUTA 4ZKCB 2NWGA 4XDXA 3IFDA 1JICA 2CVRA 1HFGA 1B4OA 1B3AA 1HUMA 1X32A 2BDNA 2K04A 1X3QA 3D6WA 1O7YA 2K03A 3F2UA 1NR4A 1PDQA 1HFNA 2B2VC 1J8IA 1MGSA 5E4XA 2EOTA 1BO0A 2X69A 2X6GA 5CBEE 1G2SA 1F9QA 2N55A 1CM9A 1LV9A 1MSHA 1DONA 4ZAIA 2KOLA 5EQ0A 3KUPA 2IL8A 1HA6A 3SVMA 5CBAE 2FINB 1WTOA 1DOLA 1A15A 1E0BA 2K1BA 2X6LA 1RJTA 1DOKA 2KEDA 1O7ZA 3ONAB 2FFKB 5EPKA 3R93A 2NZ1D 4CJ0B 1BBXC 4IUQA 5EPLA 2RVLA 5CORA 1RTOA 2B2TA 4UAIA 3I91A 5EPJA 3I3CA 1WD1A 1RHPA 2RA4A 4X3KA 1ML0D 2JP1A 1ILQA 4X3TA 3TN2A 1XX8A 2MPMA 1U4RA 3DEOA 1BF4A 1O80A 3DM1A 1EOTA 1B50A 1F9RA 4LMQD 3GV3A 2EPBA 2DY7A 2B2WA 1CA5A 2B2YC 2K05A 3TZDA 4CJ1B 4HSVA 5COYA 2HUGA 4HEDA 4XT1B 1G6ZA 4ZKBB 3I8ZA 1HUNA 4DN4M 1M8AA 2B2WC 2L4NA 1U4MA 1EL0A 1TVXA 1NCVA 1MI2A 1WTRA 1QG7A 2FMMA 4OIKA 1X3PA 5EKIA 2VXWA 1GUWA 1NR2A 4HCSA 4IUPA 1EIHA 1PFBA 1RTNA 2K01A 3I90A 4IUVA 4RA8A 4ZK9B 3N52A 1DZ1A 2Q8TA 1AP0A 1U4PA 1F9PA 2MJ8A 1SDFA 2KEEA 3GV6A 2Q8RE 1IL8A 1Q3LA 1F9SA 2B2TC 3UI2A 2RSOA 2FJ2A 1WTQA 4IUUA 4O42A 1WTPA 4R9WA 5D14A 5DNFA 2J7ZA 3IL8A 4ZLTF 3DEPA 2FHTA 1VMCA 1HHVA 1WVLA 3P7JA 1AZQA 1ILPA 1EQTA 4HAEA 1B53A 2K28A 1CA6A 3Q6SA 1KNEA 2MP1A 1QE6A 2SDFA 3LWEA 1G91A 5E4WC 2MGSA 5D65A 1SAPA 2R3ZA 2DY8A 1RODA 1QNKA 2B2UA 1B2TA 1XYIA 1F2LA 3FDTA 2RSNA 4RAUC 1EIGA 1SSOA 5T1GA 1PFNA 4OIJA 4X3UA 1WTWA 2M2LA 1NAPA 1IKMA 5AFWA 1MSGA 2KVMA 4MN3A 2HCCA 1KNAA 2B2UC 3MTSA 1WTVA 1WTXA 2L11A 4QUCA 5CMDA 1AZPA 1BNZA 1WD0A 2L9HA 1S4ZA 1JE4A 4R8IA 5EJWA 3MWYW 4XT3B 4X3SA 5JJZA 2XIWA 3G7LA 1G2TA 4CJ2C 2NYZD 3KBXA 1ZXTA
chains in the Genus database with same CATH superfamily
4QUFA 3F2DA 3PIPA 1I6HB 1IL2A 3MXUA 1YNNC 3KF8A 4P75A 3MXPA 1FR3A 4JW0A 4OO1I 4BA2I 4JI0L 3VYSA 1PZKD 2EJMA 2A68D 4OHJA 3AMUA 4PZ6A 2NVTB 1EYAA 1G2SA 1JJCB 1YITA 1XTDA 2ZM6L 4A3JB 3KUPA 2IL8A 2R7ZB 3A0JA 3S24A 2LXKA 1LYLA 2F0GA 4WFN3 1RJTA 1SR3A 4FDBA 5M9OA 3J80c 2WFWA 1VQBA 1VQHA 3I4NH 2R93B 5D3IB 1MBYA 1PA6A 1TR5A 3HOUH 1UAPA 4H13C 4DNRB 5M5YH 3EN2A 3LWUA 1YBYA 1E1TA 4HTHA 3HOVB 1MIUA 2B2YC 1UEAB 4LF4L 2EY2A 1Q90A 4XT1B 4B3TQ 3I8ZA 3LNNA 3BVZA 4DN4M 1S5ED 5IYCG 2L4NA 2A19A 5IP7H 2EXDA 3PGZA 1OXUA 3EFXD 3NEMA 1EEID 1C0AA 3E9IA 5ELCA 1K8GA 3WOEA 1QB5D 1BCPC 1HNWQ 3KF8B 4LF9Q 2EQSA 3JAME 2HIXA 2OWOA 2FJ2A 4JBKA 2NN6G 2LSSA 4KLKA 4R9WA 4JI5Q 3VR4A 4K0KL 1HTPA 1SE2A 3KLSA 1JWUD 3ERSX 1EQRA 3DWAA 4GNXC 2BH2A 3HOWH 2R93G 1G6PA 2R3ZA 2DY8A 3A56A 1QOHA 1ET9A 4YHHQ 2AKWB 1SSOA 5BR8Q 4C2MH 2YU9H 4DV7Q 1YNND 4IZ8A 5ISRA 4KV6A 3H15A 1MSGA 4FP5D 2WB1E 5FLXE 1N36L 4J6HA 1WTXA 3MXGA 3CMEA 2CWAA 4A3BH 2WIIB 1VQOA 1XJVA 1ESRA 4P74A 3JC66 3OMGA 2CW0C 1UNSA 3K7UC 3H91A 4AYBE 1L1OC 1DCZA 3FVQA 4J1MA 1I3QB 1CKOA 3CMAA 5T1IA 2CH4A 2N88A 3X3NA 3GTJH 3QWNA 1KIXA 1Y8PB 4GN3B 3W1GA 1QZHA 5JAVA 2UUAL 4POGA 1HA6A 1L0WA 1FGBD 5EGTA 2EYLA 1R9TH 1I94L 2RA4A 1GD7A 4ABNA 1FD7D 3D4WA 1ASZA 4KY5A 2ID0A 4B3ML 2FMCA 1MHWC 3PQIA 3CC4A 1W6KA 4DV5Q 3TZDA 1LTLA 4JC0A 1KC8C 2PPBC 4I7ZC 4C3JB 4QF4A 1HZBA 2A1AA 4DR6L 2NVYB 3H0GH 3I72A 3FKIB 1Z6HA 1KD1C 1T5XD 5JPMC 4UPAA 5GQOA 1HR0L 4NDXA 1H9KA 4DKAC 4CKEA 3M4OH 2ENBA 2Q2HA 1F2MA 1D5MC 5M5XB 1CKMA 4CDFC 4RFBA 4RCNA 4DU9A 3DWQA 1SYDA 3V05A 1YJWA 1VQAA 1SYGA 2MO1A 4HMIA 4BY7G 1HZ9A 3LWEA 3BVMA 5E4WC 2Z1CA 1WCMB 1JB3A 2K75A 4IPDA 2B8GA 2H5XA 5ELDA 1JJ2A 3HKZG 1Y1VH 1YNXA 3K8AA 4FXGC 4LNQA 1SYCA 3HOYG 5DM73 2K50A 1WD0A 3MWYW 1I4PA 1JOOA 1MD2D 1YHQA 4LUOA 5C0XI 3I56A 4KN4C 2GVBA 5E7NA 1D6EC 1PFMA 2E5LQ 2HHHL 4DV2Q 2SNSA 2MNAA 1B7YB 2XSCA 1HRJA 4C3HG 3R2TA 1Q81C 1HPCA 1X3QA 5CV9A 5C4JH 1N33Q 2DGYA 1LT6D 4DR4Q 2P5ZX 4A93G 2N55A 3P20A 1XMQL 3J7AV 4X62L 3J81j 3RLNA 2JA5G 4FYDA 3J80E 2X6LA 2KEDA 3PO2H 4OWWB 1N9WA 2UU9L 2RDFA 4ULLA 1EQQA 5C44H 1K73C 4L8JA 1BCPF 2IW3A 1RHPA 1PYWD 4JV5Q 5GAGC 2K4KA 3KFUA 2BH8A 2EYJA 3M7NA 1K0RA 3E6ZX 5I2YA 1S5BD 1YNJD 4RGTA 1HA5A 5COYA 2Z0SA 2SNMA 3ND8A 1B9MA 4ZQ3A 3CC2A 4BWGB 3CCEA 3J7YW 2FXQA 1HUNA 2IPKD 3H94A 4DNIA 1PH5A 3RZOH 1HCZA 3ULJA 4KHVA 3TZUA 2KCNA 4BBRG 2F0TA 1JWSD 2AUKA 4HR7B 1KAWA 4DF7A 4HIOA 2N49A 1SYFA 1EU3A 4F87A 1CSPA 1PZJD 2KEEA 3TRZA 4C3IB 2I5HA 4C56C 4ILWA 4PMCA 2JXMB 1VMCA 2KJXA 4GLXA 3H3VH 1I6HH 1TWGB 1ILPA 3Q6SA 1QE6A 1UE5A 5HGTA 1JC7A 1O7IA 4B3SQ 5AJ3Q 1BUVT 1QUQA 4Y7NB 1EEFD 2VNUD 4HJ7A 1PFNA 5IYCH 4A3CG 1D8LA 5LMNW 3H3VI 3GTGB 4DUZQ 3QB3A 3ZJYC 1FNWA 1STNA 2JA8B 1N32Q 3S1MB 1Q82C 2NVQB 2A6EC 2NVTH 4OO1G 2JEAI 4R4IA 2A8VA 3KOJA 4A3JH 2JA6G 2NN6H 1I5FA 4GLVB 1ICWA 3BS1A 2IY5B 4PMWA 1D1IA 2Z6KC 5I4DA 3W3AA 2R93H 1Z7TA 3SDZA 1PH4A 5J3BA 1EFID 2NN6I 2Q2IA 2UUCQ 3WOFA 1X32A 2QDBA 5FLXL 2BDNA 3D6WA 4KY6A 3GTOB 1EZ6A 3F2UA 1PV4A 2XWJB 3NTHA 4IUNA 3GTMB 4A3DB 3HOVH 2EOTA 1M90C 4R4TA 1DONA 1G8ZD 4N9PA 1VQFA 2F3IA 4DV0Q 3S2DH 5EBCA 1A15A 1DOKA 3G48A 2D0PA 4JBMA 2C35B 3HOUG 1FJGL 1GVPA 4KY7A 1C48A 4LFCQ 2MPMA 4KI0A 2F1MA 2EDGA 2XVSA 1QUQB 1G51A 3NXWA 3GV3A 1XPRA 1LABA 3OW2A 1U0LA 4IOAA 1VF7A 4LFBQ 1LT3D 3H3VC 2Z6BA 3GDEA 1A8VA 2CH4W 3M4YA 5IY0A 1PH6A 1Z47A 2B2WC 1A62A 3L2PA 4Q5VA 2LY7A 2HIVA 4XTCS 3ITPA 3S1QB 2BCOA 1SJED 4HCSA 1GUTA 4L5QA 5H1SE 1PFBA 1SNCA 4BXXG 5IGEA 1YHBA 1XNRL 3KLRA 1JOKA 1XXGA 4P73A 2K32A 1PTOD 3E9HA 3NE5B 4RGNA 4OONA 1B3QA 4MIUA 4A3EB 3OYYA 4A3KG 2VL6A 2JA9A 3HOWG 4K5XA 1G91A 1KNEA 1M4VA 4DUYQ 3BDOA 3D8GA 5JJKA 2XNAC 1OXSC 3STBC 1QJOA 1Y69U 5IE8A 1I3QH 1XPOA 1CQVA 3TS0A 4RMFA 3D31A 1HQRD 4P72A 1WTWA 4ZCKA 2QKIC 3A8JE 4B3RQ 4HJ9A 2D0OA 4LWCA 1B8AA 3RD4A 3ZYYX 1S5FD 4JI8Q 3T13A 4I7AA 4A3BG 2ZXRA 3F2CA 1YJ9A 5JJZA 5CV5A 3G7LA 1BOSA 3T56B 4MZ9A 4HMJA 5G3LF 5CYUA 2IWHA 4O2DA 4JI6L 2L15A 4IURA 5K5PA 4DV3Q 2CKZB 4DR5Q 2K5VA 2ZJPA 4UP7A 4A76A 5K36G 4HJAA 3L3OC 3A7AB 4HIMA 2RKSA 3T51B 2VB2X 5M3FB 3SK5A 1K3RA 1YZ6A 2Q2UA 1B1ZA 1TWHH 3OIQA 2UUBQ 4QGUA 4DK3C 3K59A 2F3VA 1TU2B 4LW1A 3DM3A 4JI2L 3FKIH 1X9NA 1N34Q 1HJPA 1JR0D 1OXVA 1BBXC 2HD3A 2XGTA 3GTQB 4AQYQ 1XX8A 1SNPA 1BF4A 5M5XH 4FF2A 2QA4A 3ERQA 4C3HH 4K2KA 1SMYD 4CGYB 2EPBA 4IOCA 1EU4A 4DR1Q 3D0FA 4N9TA 2LS01 1VQLA 3OTOL 1L0YB 1BDOA 1J5EL 2JJQA 2UXDQ 1WJJA 4FXKC 2AQ2B 3WWVA 3HOXB 3BZDB 4DK1A 3DXJC 3KLSX 2YTYA 3J80L 1P16A 1MI2A 2F0HA 4BBSG 3Q24A 1T5EA 2WB1B 1YJNA 3OWEB 4XQJA 3AQQA 3BZKA 2F4IA 3X3MA 4ZK9B 2L55A 2VUMB 4L63B 4X64Q 1E7ZA 2E76C 1IZ6A 2LMCB 3GV6A 5KRUA 3N6RA 1HNXQ 2B2TC 4LFAL 5IWAQ 5ELBA 3ULPA 4GKKQ 1B53A 2EY1A 5D65A 1RODA 1QNKA 3NELA 4E6IA 1EYGA 1F2LA 3FDTA 2NVXB 4EQ5A 5C0XJ 1ZYRD 1X65A 2V1CC 5HY6A 5C0XG 4N8FA 5AFWA 3Q8DA 3QOLA 1LTAD 1NMFA 1QNUA 1BNZA 4QUCA 1JWMD 4QCLA 1BQQT 2EY6A 4ZRZA 1SYEA 4DGZA 1SRUA 3C46A 3J7A5 2ICIA 4L6TB 2AHOB 5C3EB 4A3GG 1X3GA 1PH2A 4JI3Q 4A3MB 2HDMA 2Z9HA 3TP8A 2WB1G 3PCOB 1VMPA 4RWSC 3AU7A 3RZDB 1J9OA 1DOMA 4ME3A 1PH9A 4C1NK 2RBMA 5BN5A 4A3IG 1PRTB 5DEHA 2RQXA 2TSSA 2KQ3A 2F0EA 3VR6A 2F0QA 5LHY1 1XMOQ 1OXXK 4YCUA 1PH3A 1AH9A 4AYBG 2X6GA 1IBLQ 2E2JB 5I6WA 1MSHA 3J81c 3J7AF 3K0YA 3PO2G 1XNQQ 2EYFA 3HZXA 1CTMA 3S15H 2JA6H 5C44G 3KF6A 1YIJA 1GKHA 5CORA 5J39A 3TS2A 3T53B 2MFIA 3CRLC 1IBMQ 1U4RA 2OTJA 2CQOA 1TT2A 4JPBW 2E2DC 4LMQD 3VA7A 4C3IH 2K5QA 3BYYB 3HOZB 3E3XA 1TWFB 4KHZA 2E75C 4B3TL 2HUGA 1TWGH 4LF7Q 1SNOA 2D5DA 4B9WA 5IGFA 2K6AA 2QILA 4Y7NH 3DUZA 1NCVA 4R8NA 5KEEA 1D7QA 5EKIA 3RNUA 1BXTA 3GTGH 4YWKA 1HNWL 2JA8H 1QVFA 1LO5D 4LF9L 3S1MH 2KA7A 1D1KA 2MJ8A 2NVQH 2F0OA 3RLFA 4OXPA 1ENCA 5D14A 2IX1A 3KJPA 4IJLA 2WAQE 1ONLA 2O2LD 4JI1Q 4R4OA 1KDAA 2LFNA 5IYDG 4YHHL 5ELOA 4JOIC 5BR8L 4DV1Q 2E74C 4GN5A 4DV7L 4X3UA 5J22A 3W2DA 5CC4A 3FEWX 5FO8B 1LTSD 4X65Q 5IODA 1SE8A 2HCCA 4BXXH 4I65A 2OQKA 3KF6B 2SOBA 1GJXA 1ENAA 3G4SA 2KCCA 5I6YA 4A3JG 2R7ZG 1G2TA 1D5XC 3KBXA 4GS3A 2AQ1B 4RGOS 4YWMA 1QZGA 3P75A 5IGDA 1CKNA 4HIKA 2BE5D 3K7AB 4K6DA 4A3KH 2ZT9C 2IT1A 1PLFA 3FPUB 3M3YB 3U50C 4TSSA 3BVGA 2XRQD 3I70A 1HFGA 1C4QA 1QVCA 1EQVA 2ZJRA 3HOVG 1B70B 2K03A 1Y1WB 1MGSA 4XIGS 3NTIA 5CBEE 1RCVD 1U9RA 1CM9A 2JA7B 3C3LA 2NB0A 1RIPA 2M9VA 4IQZA 4NXNQ 3R93A 3CU7A 5KGUA 3CCLA 2KENA 2NZ1D 1R4QB 2RVLA 3F1ZA 3S1QH 3HKSA 1K8OA 5TSSA 4JVZA 1LT4D 1UE6A 3IRBA 2RCFA 3P1HA 5K36H 4DV5L 1IXRA 4CKBA 2O4XA 4CJ1B 2PZWA 5KNCA 4ZYSA 1CT1D 5IOCA 2CFMA 4NXMQ 3S1NH 1A2UA 4DR7L 1IW7D 2B8FA 4UP8A 5C5LA 3DWPA 1CUKA 3RUZA 5CR3A 1NR2A 1RTNA 3MAQA 4IUVA 3Q22A 2BA1A 2Q8TA 1CKNB 1Q12A 5C3XA 5IP9G 1F9PA 1SDFA 1BKBA 4KN7C 2Q8RE 1F9SA 3UI2A 3FP9A 3B6YA 4KTAA 4IUUA 1LACA 5HURA 2AWOA 5DNFA 3PF5A 4ZLTF 2FHTA 3T1HQ 2E8GA 2MP1A 1H9SA 1CFMA 2F0SA 1B44D 4RKLA 5FOBB 1O78A 2RSNA 4RKBA 3CRKC 4BBSH 5EAYA 1TWAB 2J0TD 2KVMA 2A73B 1A63A 3T1YQ 3NBIA 2XWBB 1YNJC 3A74A 1AZPA 2NZOA 1NY4A 2UUAQ 4IPCA 2E5LL 1SN8A 1HNZQ 2SEBD 1VQ5A 2KUMA 2L12A 3KLWA 3GTQH 1NTGA 4DV4L 1U4LA 2B2YA 1I94Q 1FNUA 2E2IH 1EY8A 1K8AC 4DR4L 1VQ9A 5C0XH 1NR4A 2PO4A 1NNXA 3NHHA 4EVOA 4C3JG 3J81E 3AB9A 3GTKH 3C2PA 4CBVA 3FKIG 2I07B 4LUZA 5CBAE 3S1RH 5M3MB 4A3GH 2FFKB 4A3FB 4MTKA 3F8TA 3CCQA 4JV5L 4J15A 1WD1A 3GTPH 3I55A 5CV7A 2F0DA 2JP1A 4A3IH 3DEOA 2VUMH 2JEBI 1PTOH 3BYTB 4RH6A 1H9SB 1B50A 4GNXA 4JI4Q 1Q8KA 4F8MA 5CV8A 4PQXA 3Q23A 3U4VA 3KJOA 1I50B 4P2CB 5GADC 1WCMG 4HEDA 2F0KA 2EY5A 3T4AC 1VDZA 3HS0C 1FNVA 3EJIA 3OW7A 4OWXB 3TQYA 3K57A 1A3UA 3GTLH 5M5WB 3I4MB 1EL0A 5IYBG 3UDXA 2FMMA 4PG3A 1K8MA 2NVXH 2OTLA 4WJ3M 3D4RA 3PO3B 2K01A 3D6CA 1EOVA 1Y8NB 2PQEA 1DZ1A 1TY2A 1LUZA 1I4HA 1U4PA 1CSQA 3NK9A 1W2BA 4BS9A 4O42A 3PF4A 1V8QA 3C1FA 4A3MH 1AZQA 5FJ8G 5AJ3L 4DR3Q 3RZDH 1V9PA 4QQBX 2EJFC 2VB3X 4RAUC 3PIO3 2M2LA 4H7BA 1N32L 3CCJA 4GKJQ 1KNAA 2L9HA 1HXYD 2QEXA 3S14B 1PHJA 5EJWA 5JJLA 2Z4IA 2E2JH 3I7FA 4IPHA 2GA4B 1LT5D 1CI3M 2Q8IB 2NZHA 3K58A 4GNXB 1F2ZA 1EFWA 3QO2A 1GXDC 2F0NA 3CHBD 2KECA 2DN8A 3ULLA 1DGSA 1IBKQ 5IYDH 2UUCL 3AEVA 1PTOC 3BZCA 4IFDH 3PUXA 3UE1A 2ICEC 3K80C 5KIXA 4YIJA 4EQPA 3NQIA 1PDQA 1I4XA 3G6EA 1J8IA 4XQNA 3K0XA 1LLRD 4QB4A 3CW2C 5LL6S 1VQIA 1H95A 3NUCA 4DV0L 4IFDI 2Z8LA 3VYUA 3SVMA 2R7ZH 3PIP3 3K6OA 1LTTD 3NWTA 3RLOA 2AMCB 3I4NB 2M00A 4IN3A 4XXEA 1L2FA 4LFCL 2YV5A 1EY9A 4CDEC 3JAMi 2PI2E 4JCVE 4BY1B 1A2TA 3DLLA 4C3IG 3BG3A 5M5YB 4AH6A 3K5MA 1X3EA 5C6AA 4G4KA 4FXDA 5EKLA 5EBDA 2PZTA 3TMEA 2E2HB 2OF1A 3CXCA 1QILA 3VYTA 3CKIB 2JA8G 4TVAB 1D2BA 1EIHA 3EIVA 4F88A 3OWFA 1AP0A 1SMXA 4OL7A 1Q86C 2RSOA 2N3SA 3PUWA 2MQHA 1VS0A 3TBIB 4ZUJA 3TEHB 3DEPA 3MA2B 1K0SA 3P7JA 4DUYL 2F0MA 4G7OC 1EY0A 2JSOA 1OTCA 4UY8C 4PV1C 4JBJA 4K14A 1F77A 2KBNA 4FO2A 3K5LA 1XYIA 4BY1G 4LF5L 1NSNS 4GOPA 3U4ZA 4C2MB 1RL2A 3M3YH 4B3RL 1VCIA 2RF4A 1SMYC 1NAPA 1AFPA 2G5DA 2OCEA 3L0OA 4A3DG 4JI8L 3MTSA 1Y1WH 5CV4A 4XT3B 4HIDA 4R1JA 5IP9H 4R4CA 1EY5A 2JA7H 3DMUA 4ID6A 2H1EA 4KHPQ 3OMCA 1PH8A 1DM0B 4DV3L 4NW2A 4DR5L 4QY7A 5JOBA 3NQTA 1V1PA 2MO0A 4U68A 3M7GA 3GTJB 3HG9A 2F0LA 1YVCA 3SR1A 1E1OA 1UWVA 2K33A 4HJ5A 4DAPA 1X3FA 4GLAC 4J8QA 1NBWA 1O7YA 1CQFA 1TWCB 3MVVA 4OEMB 3BU2A 2UXCQ 2L0CA 1E2VA 2UUBL 1BO0A 2LXJA 3URYA 1HQMC 1Q46A 3GQBA 4ZAIA 3UE0A 1VQNA 1EWHA 1N34L 2KHSA 1ZYRC 2DNCA 2V4DA 2PYKA 4EQNA 4AQYL 5GAHC 5C3WA 2QDLA 3M9BA 2CHBD 1VQ4A 2LKVA 1KLUD 1A0IA 3HRZC 3BDCA 1PRTD 3QOJA 4G7HC 2R61A 1XNRQ 4A3EG 2DY7A 3HFZB 4DV6Q 3NBHA 5C4HA 3R3OA 2WAQB 4GOPB 2HQEA 2UXDL 3S17B 3MFGA 3J81L 2GVAA 1WFQA 4BA1I 4C3JH 1G6ZA 3H0GB 2NVYH 1E24A 5CGKA 1VQ8A 2WKDA 4JBWA 3TSSA 2VXWA 2VQEQ 4UDUC 4YCVA 1TWAH 1VQGA 3QIAA 3S9WA 1PXUA 3OSOA 1CK1A 3CAMA 1QVGA 4QJFA 2WP8J 1HNXL 3U9SA 1E3PA 5IWAL 2F3WA 1V1PB 1V1QA 1U5KA 4XQQA 1PH1A 4GKKL 2HQLA 2I46A 4G57A 1EQTA 4HAEA 2SDFA 2YYZA 1FGUA 1ZEQX 4V190 3WDNA 1WCMH 4LF6L 3TP5A 2R92B 1PTOF 4JI7Q 1GHKA 2Q2TA 5T1GA 4APVA 1Y1VB 5FK9C 5IYBH 3A5ZB 2YTXA 1IKMA 1EYCA 1Q8IA 1SE3A 5M3FG 1VQKA 3S16B 4WJWA 1LTGD 2QW7A 2B63B 3J80i 4YY3Q 1JQYD 4JK1C 4JI3L 3K81C 1SFOB 1E2ZA 2D62A 2VQFQ 5IGCA 5LL6X 1S5DD 3A5UA 2N8NA 5M3MH 3OPOA 5FJ8H 1C8CA 1HR0W 1FL0A 3NBHB 1TS3A 5JEAH 2KHIA 4RG1A 2UXBQ 2EE1A 4TRDA 5JVG3 2NWGA 4XDXA 1VQMA 1KDCA 4GZYC 2CVRA 2K04A 2DJGC 2EYMA 4X66Q 3CQZB 1IBLL 1KHIA 1I6VC 2CWPA 3PSIA 2Y0SB 1I50H 3HOXG 3ICEA 1QWYA 4M8AA 4JYAQ 2QCPX 4QMGA 2FINB 1I4GA 2RDGA 3LX0A 3I4MH 5M5WH 5EPKA 1LTBD 3CCRA 4KKSA 3SE0A 2PQAA 3SK6A 2F4VQ 2GN5A 5FO9B 2RHSB 4OX9Q 1L0XB 2DUDA 1IBML 2VUMG 3A54A 5EPJA 4DK6C 3SK8A 1X54A 2B63G 3K5OA 3EQLC 5D3DA 3QR8A 1ENFA 4F7XA 2BE5C 2NBFA 2JE6I 1ICFB 4G7ZC 3PUZA 5KYLA 1NUCA 1QG7A 2XN9C 1IYJB 1KDBA 4FNFA 4KD3A 1HZAA 4DNTB 4XYQA 4GN4B 1AE3A 4RA8A 3LGJA 5C4ZA 1K3BC 4TQUS 2JK8A 4S3SA 1SNMA 3MEHA 5LMNQ 3I4LA 3NPPA 5C3EG 2IX3A 4A3MG 5C4XB 4LF8Q 1JMCA 4JI1L 2PNRC 4OWTB 1VQCA 4DV1L 2B2UA 1B9NA 2PMZE 5C5MA 1JOQA 4L5TA 3SEBA 1SYBA 4X65L 2B3GA 1VQEA 2PCFB 3FMCA 1CZGA 3BJUA 4DR2Q 3U58A 5LMUQ 4HJ8A 1ASYA 2AWNA 2PQAB 4LJZC 3AFQA 5DLQE 2K14A 4JI5L 1IW7C 4OGQC 1ZXTA 1GUOA 1UE1A 4DXFA 4PNYA 4EQOA 2DNEA 4TKOB 1TY0A 3TREA 5ELFA 1VQJA 4IFDJ 2HCIA 1H9JA 2B2VA 2HDLA 2R7DA 4IFDG 4H44C 4BY1H 3IFDA 1TS4A 2EYOA 4JI0Q 5C4XG 3HOZG 2I0QA 1HH2P 3GTOH 1T9HA 1KL9A 4DXGA 3GTMH 4A3DH 5E4XA 2X69A 4CHTB 4DAYA 4NXNL 1SROA 3FRPB 2ZM6Q 3S2DB 2E2HH 3L7ZC 5DAUA 1O7ZA 1KABA 3R8BA 2I5MX 3M4QA 2B2TA 1EY6A 4L5SA 2RHQB 3M4PA 4QIWE 1OO9B 3CCSA 1J6QA 2BA0A 4XYOA 5ELEA 1DJRD 1PMRA 5BN3A 2KCMA 3MEFA 5J1ZA 1GO3E 1LTRD 4KD4A 4O0AA 1CA5A 2F0UA 2PI2A 2K5NA 2EIFA 4DK0A 4B08A 4L5RC 2IX0A 4NXML 4LF4Q 2C9OA 1SNDA 1DD2A 4ZKBB 4H02A 1AW7A 3RN5A 3EBEA 1M8AA 2ALYB 4UHVA 2K52A 2AUJD 1AE2A 2PZUA 1MJCA 3KYHC 4FVMA 4CDCC 1GUWA 3I90A 1RKNA 3MXNA 1EWIA 1E22A 5KYIA 2ZTDA 1I4QA 1IL8A 4WRDA 1WTQA 1WTPA 3T1HL 1HHVA 4A3EH 1KQSA 1S5CD 3T16A 1RDPD 4K0KQ 1VQ6A 2WKCA 5FLMG 3RR5A 3A8IE 2Y0SE 3IKJA 3CC7A 1IYUA 4PZ7A 3F2BA 1D5ZC 4DPGA 1EIGA 2L5TA 3KK7A 4DAYB 1K83B 3T1YL 1DYQA 1Y1WG 2WINB 1VQDA 1X6OA 4MN3A 5I2XA 1DXMA 1TWCH 2L11A 4Q0FA 1N36Q 2JA7G 4R8IA 2F52A 4RHRA 5A2QE 1KAAA 5JJIA 1BBUA 3L9AX 4WJ4A 1QCBD 1HNZL 4K8JA 2OXPA 4BY7B 1TS2A 4NB3A 1STBA 1A6XA 3ND9A 1W3SA 2JN4A 3HKZB 3KBGA 2VZAA 3HOYB 1PYBA 3PUVA 2IJ0A 5M3FH 1BCPD 1TWHB 3S17H 4UP9A 1E2WA 3HEJA 3J7ZC 3MXNB 3D4DA 4KKTA 1CHQD 1XPUA 1DOLA 2K1BA 4DR7Q 3ONAB 2WV6D 1UUPA 1SJHD 2MHVA 4DV2L 1RTOA 2DJFC 3NSWA 1ILQA 1HZCA 2EYPA 4O1NA 1YI2A 1FYCA 4JI4L 2PNHA 1EOTA 4C3HB 1N33L 4B3MQ 1VQPA 2PW7A 4JOIA 1IHZA 2K05A 2K5HA 3S2HB 1PVOA 1EWCA 2EZVA 1VQ7A 4A93B 3HOXH 2VY3A 4DR6Q 2JA5B 3KDFA 1U4MA 4K5WA 1WTRA 2R92H 2VS1A 2MUYA 2CW0D 1EIFA 1I4RA 3RN2A 1HR0Q 1STYA 1AN8A 3UDIA 4A3LG 2F0IA 4YWLA 3S16H 4PZ8A 2ZJQA 1V43A 2B63H 2YTVA 1SFOH 2KHJA 2WACA 3MZ5A 3G6JB 3C1EA 3D3RA 3FHWA 4DR3L 1CA6A 2NUCA 1Q1BA 1VF5C 1WTHA 4DAMA 3PMFA 1B2TA 3CCUA 4OIJA 1CHPD 5JVH3 4DV4Q 4BBRB 2I5LX 4GKJL 4IJHA 1H9MA 2ASBA 5IT9L 2BOSA 5KNDA 3CQZH 1S4ZA 4GOPC 4FF3A 3O13A 4H0LC 1L1OA 1EY4A 1PH7A 4KKUA 1S3OA 1H9RA 5M3MG 5C3EH 2QGQA 4A3FG 4B3SL 5JEAJ 1STEA 1C9OA 2L1BA 5IGBA 5JEAG 4NPSA 1Y8OB 2HHHQ 3CD6A 1IBKL 1SXTA 3A7LA 3K5NA 3RMHA 3AFPA 1S72A 1YEZA 4DUZL 2QEJC 1NJIC 4CKCA 2EYHA 5I9OA 3KDFB 1BCPB 3EVQA 4JG2A 4FF4A 1K28A 3G71A 1F9QA 2A6HC 5HGQA 5L37A 2KOLA 1XMQQ 3I4MG 4X62Q 3VR2A 2Z4HA 3SGIA 4ODGA 1E0BA 3S15B 2JA6B 3TN2A 2B29A 3I4OA 2A69C 3PO3G 2EVBA 2ATWA 3I73A 2UU9Q 3I91A 1ESFA 1ML0D 4KJOA 1EZ8A 3MFYA 2XRSD 1TIID 1JJGA 3DM1A 2RCNA 3VA5A 2BDOA 3PV0A 3BDLA 5C4XH 3HOZH 5E3FA 1TWFH 2B39A 4DAVA 4K8IA 1X56A 1O7LA 1KLGD 3IAYA 2PW5A 3ER0A 3SXHA 1IYVA 4Z9CB 4A4IA 2N78A 4M1UB 1Q1EA 1L1OB 4ZUIA 4IUPA 4RHSA 2XTIA 5E1FA 3HOUB 2NTTA 1TXYA 1TKWB 5FKAC 4B9XA 3QG1A 3AYHB 1LM0A 1A3VA 2H4OA 1ZKOA 3JAML 4LFBL 4MNOA 3HKZE 4KMUC 2J7ZA 2OEOA 4V0BA 1PFSA 4ME5A 2IHFA 2K28A 3TP7A 1GUNA 2G9DA 1TQOA 4K6LA 2F0VA 1CZWA 1GM5A 3CCMA 4U673 1PRTC 4CDDC 5G3LD 3SHLA 4DFAA 2CQAA 3OIPA 2AQ3B 4HN7A 1FVIA 5CMDA 5IT9c 3W5OA 1TS5A 2QF7A 4KHPL 4OELB 4A75A 2A74C 1IKLA 5I9PA 4A3KB 1JCKB 3K7AH 4POFA 2A6HD 3I4NG 3HOWB 1JORA 4MHEA 3HP3A 4NMZA 5FLMH 3V96A 2JYOA 4LAAA 2D9UA 4RCOA 2YU9B 4IUTA 1UEBA 3I2ZA 2A69D 1JICA 2A5HA 2G9HD 2UXCL 2O5JC 5BN4A 1HFNA 2ES2A 1LV9A 2KCTA 1KRTA 5A2QL 4A3BB 2F03A 4R4QA 4IO9A 5IP7G 2RDHA 1JB7A 1WTOA 2EJGC 3UDFA 1WOCA 3CF5A 2O5IC 1FJGQ 4X3KA 4X3TA 1JT8A 5DM63 4IALA 2ZXPA 5F2DA 3H09A 1F9RA 2ZXOA 4K2LA 3H6MA 4DV6L 1GOZA 3GO5A 2A6ED 3QJYA 1KTKA 5CV6A 3S1NB 3U9OA 4C1NI 2PMZB 3GD7A 2VW9A 3E0EA 1TVXA 1R9TB 2ZTEA 4NKLA 4ALPA 3DHQA 1X3PA 2VQEL 4LF5Q 1II3A 1K83H 1PZID 4QL5A 1JE5A 3N52A 4KK7A 2K5DA 1X55A 4WORA 1A3TA 4DR1L 4MTNA 2R6GA 3PUYA 3V2TA 1V1OA 3JAMc 1SBBB 5ELNA 4DA2A 1XWEA 3CPWA 1NE3A 1WVLA 1GHJA 3VR5A 4KJNA 1EYDA 1P8LA 2MGSA 1SAPA 3VYRA 4LK1C 4BY7H 2ZTCA 4JI7L 4LUVA 3EA6A 1GUGA 2F0WA 3A55A 1K9MC 1N8RC 4BBSB 1EIYB 1OXTA 3SK4A 5KNBA 3M4OB 2OQ0A 4X64L 3A8KE 3J81i 5FLXc 4Y52H 2B2UC 3OHXC 1WTVA 1S40A 3HOYH 2K5WA 1R4PB 4YCWA 4YY3L 4EGVA 1RF2D 4A3LH 2XIWA 2TMPA 3HGBA 2VQFL 4CJ2C 2NYZD 2Z6KA 1HTLD 1SE4A 1Y14B 3M85A 3E5SA 1Z9FA 4JI6Q 3NWSA 1KRSA 4P71A 2UXBL 4QIWB 1LTID 1STGA 2E2IB 1KXLA 4ZKCB 1SLJA 3Q0AA 4HSPA 2D2CC 4X66L 1B4OA 1B3AA 1HUMA 4EX5A 2WAQG 2B2VC 1XTCD 2F0FA 4FF1A 3W1BA 3GTKB 3TDQA 4JYAL 1MKHA 3S2HH 3H0GG 2C5CA 3MC0B 5EQ0A 4A93H 3S1RB 2F4VL 1AEXA 2JA5H 4A3GB 1SEBD 4CJ0B 4JI2Q 2K7VA 5JPNC 4A3FH 2A68C 4OX9L 4IUQA 5EPLA 1C7YA 4UAIA 2F0JA 3GTPB 3CP0A 3I3CA 1STHA 4K5VA 3STBD 4A3IB 4HCEA 1PTOB 1O80A 3NTKA 5GROA 1UE7A 4PMBA 4AIMA 1XMOL 2R7FA 5C4JB 3FPPA 3UDGA 2B2WA 4X6AH 2JQOA 4HSVA 5IIFA 3OTOQ 4AYBB 3VDYA 1RD9D 1XNQL 3IFTA 1J5EQ 4IPGA 2R92G 3NENA 1PRTF 3OOCA 1GUSA 3PIOA 3GTLB 3PO2B 2J4XA 1Y1VG 3GP7A 4LF6Q 2NTSA 2OT2A 4OIKA 3R2IA 5C44B 1EY7A 1W6JA 4BBRH 5NUCA 3PO3H 1STAA 5GAEC 5A35A 5LMNL 1YHAA 1SNQA 1Q3LA 2IHEA 1PYSB 4LF8L 3E0JA 4LFAQ 1WI5A 3IL8A 4LF7L 1ET6A 2HT1A 5EKKA 3RZOB 1G291 3MHBA 3NP8A 4RGMA 5FO7B 3TP6A 1BVSA 4N8X1 3VR3A 4DR2L 4NP5A 1Q7YC 1BBWA 1MJEA 2F0PA 1WYDA 5LMUL 1M1KC 4A3CH 5IT9E 3CPFA 2Y0SG 1JE4A 1BR9A 3S14H 3CCVA 1F2YA 3EROA 4X3SA 2CCZA 5IGGA 1NMGA 1EUJA 2EXZA 4OO1H
chains in the Genus database with same CATH topology
4QUFA 1I6HB 3MXUA 1YNNC 3KF8A 3MXPA 1FR3A 4OO1I 4BA2I 3VYSA 1PZKD 2EJMA 2A68D 4OHJA 3AMUA 2NVTB 1EYAA 1G2SA 4A3JB 3KUPA 2IL8A 2R7ZB 2F0GA 4WFN3 1RJTA 5M9OA 2R93B 5D3IB 1MBYA 1TR5A 1UAPA 4H13C 4DNRB 3LWUA 4HTHA 3HOVB 2B2YC 1UEAB 2EY2A 1Q90A 4XT1B 3I8ZA 3LNNA 3BVZA 4DN4M 1S5ED 2L4NA 1OXUA 3EFXD 1EEID 5ELCA 3WOEA 1QB5D 1BCPC 3JAME 2FJ2A 2NN6G 4R9WA 3VR4A 1HTPA 1SE2A 3KLSA 1JWUD 3DWAA 2R3ZA 2DY8A 3A56A 1QOHA 1ET9A 1SSOA 1YNND 4IZ8A 5ISRA 4KV6A 1MSGA 4FP5D 5FLXE 4J6HA 1WTXA 3MXGA 2WIIB 1ESRA 3OMGA 2CW0C 1UNSA 3H91A 1DCZA 3FVQA 4J1MA 1I3QB 5T1IA 3X3NA 2N88A 3QWNA 1Y8PB 5JAVA 1HA6A 1FGBD 5EGTA 2EYLA 2RA4A 4ABNA 1FD7D 3D4WA 4KY5A 2ID0A 2FMCA 1W6KA 3TZDA 2PPBC 4I7ZC 4C3JB 4QF4A 2NVYB 3I72A 3FKIB 1Z6HA 1T5XD 5JPMC 4NDXA 1H9KA 4CKEA 2ENBA 1F2MA 1D5MC 5M5XB 4RFBA 4RCNA 4DU9A 3DWQA 1SYDA 3V05A 1SYGA 4HMIA 3LWEA 3BVMA 5E4WC 2Z1CA 1WCMB 1JB3A 2B8GA 5ELDA 4FXGC 1SYCA 5DM73 1WD0A 3MWYW 1I4PA 1JOOA 1MD2D 5C0XI 4KN4C 1D6EC 1PFMA 2SNSA 2XSCA 1HRJA 4C3HG 3R2TA 1HPCA 1X3QA 5CV9A 1LT6D 2N55A 3P20A 3J7AV 4FYDA 3J80E 2X6LA 2KEDA 2RDFA 4ULLA 4L8JA 1BCPF 2IW3A 1RHPA 1PYWD 2EYJA 3M7NA 3E6ZX 5I2YA 1S5BD 1YNJD 4RGTA 1HA5A 5COYA 2SNMA 3ND8A 1B9MA 4ZQ3A 4BWGB 3J7YW 1HUNA 2IPKD 3H94A 1HCZA 4KHVA 3TZUA 2KCNA 2F0TA 1JWSD 2AUKA 4HR7B 4DF7A 1SYFA 1EU3A 4F87A 1PZJD 2KEEA 4C3IB 4C56C 4ILWA 4PMCA 2JXMB 1VMCA 2KJXA 1ILPA 1TWGB 3Q6SA 1QE6A 5HGTA 1JC7A 1BUVT 4Y7NB 1EEFD 2VNUD 1PFNA 3GTGB 3QB3A 1FNWA 1STNA 2JA8B 3S1MB 2NVQB 2A6EC 4OO1G 2JEAI 2NN6H 1ICWA 3BS1A 4PMWA 1D1IA 5I4DA 3W3AA 1Z7TA 3SDZA 1EFID 2NN6I 3WOFA 1X32A 2QDBA 5FLXL 2BDNA 3D6WA 4KY6A 3GTOB 1EZ6A 3F2UA 2XWJB 3NTHA 4IUNA 3GTMB 4A3DB 2EOTA 1DONA 1G8ZD 4N9PA 5EBCA 1A15A 1DOKA 4KY7A 1C48A 2MPMA 4KI0A 2F1MA 2EDGA 2XVSA 3NXWA 3GV3A 1LABA 1VF7A 1LT3D 3H3VC 3M4YA 1Z47A 2B2WC 4Q5VA 2LY7A 4XTCS 3ITPA 3S1QB 2BCOA 1SJED 4HCSA 1GUTA 1PFBA 1SNCA 5IGEA 3KLRA 1JOKA 1XXGA 2K32A 1PTOD 3NE5B 4RGNA 4MIUA 4A3EB 4K5XA 1G91A 1KNEA 1M4VA 3BDOA 3D8GA 2XNAC 1OXSC 1QJOA 1Y69U 1CQVA 1WTWA 3D31A 1HQRD 2QKIC 3A8JE 3RD4A 3ZYYX 1S5FD 3T13A 2ZXRA 5JJZA 5CV5A 3G7LA 1BOSA 3T56B 4HMJA 5G3LF 5CYUA 2IWHA 4IURA 5K5PA 5K36G 3L3OC 3A7AB 2RKSA 3T51B 2VB2X 5M3FB 3SK5A 1B1ZA 3OIQA 3K59A 2F3VA 1TU2B 1JR0D 1OXVA 1BBXC 3GTQB 1XX8A 1SNPA 1BF4A 4FF2A 3ERQA 4K2KA 1SMYD 4CGYB 2EPBA 1EU4A 4N9TA 2LS01 1L0YB 1BDOA 4FXKC 2AQ2B 3HOXB 3BZDB 4DK1A 3DXJC 3KLSX 3J80L 1MI2A 2F0HA 3Q24A 1T5EA 2WB1B 3OWEB 4XQJA 2F4IA 3X3MA 4ZK9B 2L55A 2VUMB 4L63B 2E76C 2LMCB 3GV6A 5KRUA 3N6RA 2B2TC 5ELBA 1B53A 2EY1A 5D65A 1RODA 1QNKA 4E6IA 1F2LA 3FDTA 2NVXB 5C0XJ 1ZYRD 5C0XG 5AFWA 3QOLA 1LTAD 1QNUA 1BNZA 4QUCA 1JWMD 4QCLA 1BQQT 2EY6A 4ZRZA 1SYEA 4DGZA 3C46A 2ICIA 4L6TB 5C3EB 4A3MB 2HDMA 3TP8A 4RWSC 1VMPA 3AU7A 3RZDB 1J9OA 1DOMA 4C1NK 2RBMA 5BN5A 1PRTB 5DEHA 2RQXA 2TSSA 2KQ3A 2F0EA 3VR6A 2F0QA 5LHY1 1OXXK 2X6GA 2E2JB 5I6WA 1MSHA 3J7AF 3K0YA 2EYFA 3HZXA 1CTMA 5CORA 5J39A 3T53B 3CRLC 1U4RA 1TT2A 2E2DC 4LMQD 3VA7A 2K5QA 3BYYB 3HOZB 1TWFB 4KHZA 2E75C 2HUGA 1SNOA 2D5DA 4B9WA 5IGFA 2K6AA 2QILA 3DUZA 1NCVA 4R8NA 5KEEA 5EKIA 1BXTA 1LO5D 2KA7A 1D1KA 2MJ8A 2F0OA 3RLFA 1ENCA 5D14A 2IX1A 1ONLA 2O2LD 1KDAA 2LFNA 2E74C 4X3UA 5J22A 3W2DA 5CC4A 3FEWX 5FO8B 1LTSD 5IODA 2HCCA 4I65A 2SOBA 1GJXA 1ENAA 2KCCA 5I6YA 1G2TA 1D5XC 3KBXA 2AQ1B 4RGOS 3P75A 5IGDA 2BE5D 3K7AB 4K6DA 2ZT9C 2IT1A 1PLFA 3FPUB 3M3YB 4TSSA 3BVGA 2XRQD 3I70A 1HFGA 1C4QA 1EQVA 2K03A 1Y1WB 1MGSA 4XIGS 3NTIA 5CBEE 1RCVD 1U9RA 1CM9A 2JA7B 3C3LA 2NB0A 2M9VA 4IQZA 3R93A 3CU7A 5KGUA 2NZ1D 1R4QB 2RVLA 1K8OA 5TSSA 1LT4D 3P1HA 5K36H 4CKBA 2O4XA 4CJ1B 2PZWA 5KNCA 4ZYSA 1CT1D 5IOCA 1A2UA 1IW7D 2B8FA 5C5LA 3DWPA 3RUZA 5CR3A 1NR2A 1RTNA 3MAQA 4IUVA 3Q22A 2BA1A 2Q8TA 5C3XA 1Q12A 1F9PA 1SDFA 4KN7C 2Q8RE 1F9SA 3UI2A 4KTAA 4IUUA 1LACA 5HURA 2AWOA 5DNFA 4ZLTF 2FHTA 2MP1A 1H9SA 1CFMA 2F0SA 1B44D 4RKLA 5FOBB 1O78A 2RSNA 4RKBA 3CRKC 1TWAB 2J0TD 2KVMA 2A73B 3NBIA 2XWBB 1YNJC 1AZPA 2SEBD 2KUMA 2L12A 1U4LA 2B2YA 1FNUA 1EY8A 5C0XH 1NR4A 2PO4A 3NHHA 4EVOA 4C3JG 3J81E 3AB9A 3C2PA 4CBVA 2I07B 5CBAE 5M3MB 2FFKB 4A3FB 1WD1A 5CV7A 2F0DA 2JP1A 3DEOA 2JEBI 1PTOH 3BYTB 4RH6A 1H9SB 1B50A 4F8MA 5CV8A 4PQXA 3Q23A 1I50B 4P2CB 4HEDA 2F0KA 2EY5A 3T4AC 1VDZA 3HS0C 1FNVA 3EJIA 3OW7A 3K57A 1EL0A 1A3UA 3I4MB 5M5WB 2FMMA 1K8MA 3D4RA 3PO3B 2K01A 3D6CA 1Y8NB 2PQEA 1DZ1A 1TY2A 1I4HA 1U4PA 3NK9A 4BS9A 4O42A 1V8QA 3C1FA 1AZQA 2EJFC 2VB3X 4RAUC 3PIO3 2M2LA 4H7BA 1KNAA 2L9HA 1HXYD 3S14B 5EJWA 2Z4IA 2GA4B 1LT5D 1CI3M 2Q8IB 3K58A 1F2ZA 3QO2A 1GXDC 2F0NA 3CHBD 2KECA 2DN8A 1PTOC 4IFDH 3PUXA 2ICEC 5KIXA 4YIJA 4EQPA 3NQIA 1PDQA 1I4XA 1J8IA 4XQNA 1LLRD 4QB4A 5LL6S 3NUCA 4IFDI 2Z8LA 3VYUA 3SVMA 3PIP3 3K6OA 1LTTD 3NWTA 3I4NB 2M00A 4IN3A 4XXEA 1EY9A 4BY1B 1A2TA 4C3IG 3BG3A 5M5YB 3K5MA 5C6AA 4G4KA 4FXDA 5EKLA 5EBDA 2PZTA 3TMEA 2E2HB 2OF1A 1QILA 3VYTA 3CKIB 1D2BA 1EIHA 4F88A 3OWFA 1AP0A 4OL7A 2RSOA 3PUWA 3TBIB 4ZUJA 3DEPA 3MA2B 3P7JA 2F0MA 4G7OC 1EY0A 2JSOA 4PV1C 4K14A 1F77A 4FO2A 3K5LA 1XYIA 1NSNS 4C2MB 1VCIA 1SMYC 1NAPA 1AFPA 3MTSA 5CV4A 4XT3B 1EY5A 3DMUA 4ID6A 2H1EA 3OMCA 1DM0B 4NW2A 5JOBA 3NQTA 1V1PA 4U68A 3M7GA 3GTJB 3HG9A 2F0LA 3SR1A 2K33A 4DAPA 4J8QA 1O7YA 1CQFA 1TWCB 3MVVA 2L0CA 1E2VA 1BO0A 3URYA 1HQMC 3GQBA 4ZAIA 1EWHA 2KHSA 1ZYRC 2DNCA 2V4DA 2PYKA 4EQNA 5C3WA 2CHBD 2LKVA 1KLUD 3HRZC 3BDCA 1PRTD 3QOJA 4G7HC 2R61A 2DY7A 3NBHA 5C4HA 3R3OA 2WAQB 2HQEA 3S17B 3MFGA 3J81L 4BA1I 1G6ZA 3H0GB 5CGKA 2WKDA 4JBWA 3TSSA 2VXWA 4UDUC 3QIAA 3S9WA 1PXUA 3OSOA 1CK1A 2WP8J 3U9SA 2F3WA 1V1PB 4XQQA 2I46A 4G57A 1EQTA 4HAEA 2SDFA 2YYZA 1ZEQX 4V190 3WDNA 3TP5A 2R92B 1PTOF 1GHKA 5T1GA 1Y1VB 5FK9C 1IKMA 1EYCA 1Q8IA 1SE3A 3S16B 4WJWA 1LTGD 2B63B 1JQYD 4JK1C 1SFOB 1E2ZA 2D62A 5IGCA 5LL6X 1S5DD 3OPOA 1C8CA 1TS3A 5JEAH 2EE1A 4TRDA 5JVG3 4XDXA 2NWGA 4GZYC 1KDCA 2CVRA 2K04A 2EYMA 3CQZB 1I6VC 2Y0SB 1QWYA 4M8AA 2QCPX 4QMGA 2FINB 1I4GA 2RDGA 3LX0A 5EPKA 1LTBD 4KKSA 3SE0A 3SK6A 5FO9B 1L0XB 3A54A 5EPJA 3SK8A 3K5OA 3EQLC 5D3DA 4F7XA 1ENFA 2BE5C 2NBFA 2JE6I 4G7ZC 3PUZA 5KYLA 1NUCA 1QG7A 2XN9C 1KDBA 4FNFA 4KD3A 4DNTB 4XYQA 4RA8A 5C4ZA 4TQUS 4S3SA 1SNMA 3MEHA 3I4LA 3NPPA 2IX3A 5C4XB 2PNRC 2B2UA 1B9NA 5C5MA 1JOQA 3SEBA 1SYBA 2PCFB 3FMCA 1CZGA 2AWNA 4LJZC 1IW7C 4OGQC 1ZXTA 1GUOA 4DXFA 4PNYA 4EQOA 2DNEA 4TKOB 1TY0A 5ELFA 4IFDJ 2HCIA 1H9JA 2B2VA 2HDLA 4IFDG 4H44C 3IFDA 1TS4A 2EYOA 4DXGA 5E4XA 2X69A 4CHTB 4DAYA 3FRPB 3S2DB 3L7ZC 5DAUA 1O7ZA 1KABA 3R8BA 2B2TA 1EY6A 1OO9B 2BA0A 4XYOA 5ELEA 1DJRD 1PMRA 5BN3A 5J1ZA 1LTRD 4KD4A 1CA5A 2F0UA 4DK0A 4B08A 2IX0A 2C9OA 1SNDA 1DD2A 4ZKBB 1AW7A 1M8AA 2AUJD 2PZUA 4FVMA 1GUWA 3I90A 1RKNA 3MXNA 5KYIA 1I4QA 1IL8A 4WRDA 1WTQA 1WTPA 1HHVA 1S5CD 3T16A 1RDPD 2WKCA 3A8IE 3IKJA 1IYUA 1D5ZC 1EIGA 2L5TA 3KK7A 1K83B 1DYQA 2WINB 4MN3A 5I2XA 1DXMA 2L11A 4Q0FA 4R8IA 4RHRA 5A2QE 1KAAA 3L9AX 1QCBD 4K8JA 2OXPA 4BY7B 1TS2A 1STBA 1A6XA 3ND9A 3HKZB 3KBGA 3HOYB 3PUVA 2IJ0A 1BCPD 1TWHB 1E2WA 3HEJA 3D4DA 4KKTA 1CHQD 1DOLA 2K1BA 3ONAB 2WV6D 1UUPA 1SJHD 2MHVA 1RTOA 3NSWA 1ILQA 2EYPA 4O1NA 1FYCA 1EOTA 4C3HB 2PW7A 1IHZA 2K05A 3S2HB 1EWCA 2EZVA 4A93B 2JA5B 1U4MA 4K5WA 1WTRA 2MUYA 2CW0D 1I4RA 1STYA 1AN8A 2F0IA 1V43A 2WACA 3MZ5A 3G6JB 3C1EA 3D3RA 1CA6A 2NUCA 1Q1BA 1VF5C 3PMFA 1B2TA 4OIJA 1CHPD 5JVH3 4BBRB 1H9MA 5IT9L 2BOSA 5KNDA 1S4ZA 4FF3A 3O13A 4H0LC 1EY4A 4KKUA 1H9RA 5JEAJ 1STEA 2L1BA 5IGBA 5JEAG 1Y8OB 1SXTA 3A7LA 3K5NA 3RMHA 2QEJC 4CKCA 2EYHA 5I9OA 1BCPB 3EVQA 4FF4A 1F9QA 2A6HC 2KOLA 3VR2A 2Z4HA 4ODGA 1E0BA 3S15B 2JA6B 3TN2A 2A69C 2EVBA 3I73A 3I91A 1ESFA 1ML0D 4KJOA 1EZ8A 3MFYA 2XRSD 1TIID 3DM1A 3VA5A 2BDOA 3PV0A 3BDLA 5E3FA 4DAVA 2B39A 4K8IA 1O7LA 1KLGD 3IAYA 2PW5A 3SXHA 1IYVA 4Z9CB 4M1UB 1Q1EA 4ZUIA 4IUPA 4RHSA 5E1FA 3HOUB 2NTTA 1TKWB 5FKAC 4B9XA 3QG1A 1A3VA 2H4OA 1ZKOA 3JAML 4KMUC 2J7ZA 2OEOA 4V0BA 4ME5A 2K28A 3TP7A 1GUNA 2G9DA 1TQOA 4K6LA 2F0VA 1CZWA 4U673 1PRTC 5G3LD 3SHLA 4DFAA 2CQAA 3OIPA 2AQ3B 4HN7A 5CMDA 1TS5A 2QF7A 2A74C 1IKLA 5I9PA 4A3KB 1JCKB 3HOWB 2A6HD 1JORA 4MHEA 3HP3A 4NMZA 3V96A 2JYOA 4LAAA 2D9UA 4RCOA 2YU9B 4IUTA 2A69D 1JICA 2A5HA 2G9HD 2O5JC 5BN4A 1HFNA 1LV9A 5A2QL 4A3BB 2F03A 2RDHA 1WTOA 2EJGC 2O5IC 4X3KA 4X3TA 5DM63 4IALA 2ZXPA 5F2DA 3H09A 1F9RA 2ZXOA 4K2LA 3H6MA 1GOZA 3GO5A 2A6ED 3QJYA 1KTKA 5CV6A 3S1NB 3U9OA 4C1NI 2PMZB 3GD7A 1TVXA 1R9TB 4NKLA 3DHQA 1X3PA 1II3A 1PZID 3N52A 4KK7A 2K5DA 4WORA 1A3TA 2R6GA 3PUYA 3V2TA 1V1OA 1SBBB 4DA2A 1XWEA 1WVLA 1GHJA 3VR5A 4KJNA 1EYDA 2MGSA 1SAPA 3VYRA 4LK1C 3EA6A 1GUGA 2F0WA 3A55A 4BBSB 1OXTA 3SK4A 5KNBA 3M4OB 3A8KE 2B2UC 3OHXC 1WTVA 2K5WA 1R4PB 4EGVA 1RF2D 2XIWA 2TMPA 3HGBA 4CJ2C 2NYZD 1HTLD 1SE4A 3M85A 3E5SA 3NWSA 4QIWB 1LTID 1STGA 2E2IB 4ZKCB 3Q0AA 4HSPA 2D2CC 1B4OA 1B3AA 1HUMA 2B2VC 1XTCD 2F0FA 4FF1A 3GTKB 3TDQA 2C5CA 3MC0B 5EQ0A 3S1RB 1AEXA 4A3GB 1SEBD 4CJ0B 2K7VA 5JPNC 2A68C 4IUQA 5EPLA 4UAIA 2F0JA 3GTPB 3I3CA 1STHA 4K5VA 4A3IB 4HCEA 1PTOB 1O80A 3NTKA 4PMBA 5C4JB 3FPPA 2B2WA 4HSVA 5IIFA 4AYBB 1RD9D 3IFTA 1PRTF 3OOCA 1GUSA 3GTLB 3PO2B 2J4XA 3GP7A 2NTSA 2OT2A 4OIKA 3R2IA 5C44B 1EY7A 1W6JA 5NUCA 1STAA 5A35A 1SNQA 1Q3LA 3E0JA 3IL8A 1ET6A 5EKKA 3RZOB 1G291 3MHBA 3NP8A 4RGMA 5FO7B 3TP6A 3VR3A 4NP5A 2F0PA 5IT9E 1JE4A 1BR9A 1F2YA 3EROA 4X3SA 5IGGA 2EXZA 4OO1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ESR A;  4QUF A;  2H1E A;  2HDM A;  1IKL A;  1ICW A;  4RWS C;  1VMP A;  1PFM A;  2L1B A;  4NW2 A;  1J9O A;  3H91 A;  4MHE A;  1DOM A;  3HP3 A;  4IUR A;  2KUM A;  3QO2 A;  1PLF A;  1C8C A;  3FPU B;  2HCI A;  2JYO A;  2L12 A;  2D9U A;  2B2V A;  1U4L A;  2HDL A;  2KEC A;  2B2Y A;  4U68 A;  5T1I A;  2EE1 A;  2N88 A;  1HRJ A;  4IUT A;  4ZKC B;  2NWG A;  4XDX A;  3IFD A;  1JIC A;  2CVR A;  1HFG A;  1B4O A;  1B3A A;  1HUM A;  1X32 A;  2BDN A;  2K04 A;  1X3Q A;  3D6W A;  1O7Y A;  2K03 A;  3F2U A;  1NR4 A;  1PDQ A;  1HFN A;  2B2V C;  1J8I A;  1MGS A;  5E4X A;  2EOT A;  1BO0 A;  2X69 A;  2X6G A;  5CBE E;  1G2S A;  1F9Q A;  2N55 A;  1CM9 A;  1LV9 A;  1MSH A;  1DON A;  4ZAI A;  2KOL A;  5EQ0 A;  3KUP A;  2IL8 A;  1HA6 A;  3SVM A;  5CBA E;  2FIN B;  1WTO A;  1DOL A;  1A15 A;  1E0B A;  2K1B A;  2X6L A;  1RJT A;  1DOK A;  2KED A;  1O7Z A;  3ONA B;  2FFK B;  5EPK A;  3R93 A;  2NZ1 D;  4CJ0 B;  1BBX C;  4IUQ A;  5EPL A;  2RVL A;  5COR A;  1RTO A;  2B2T A;  4UAI A;  3I91 A;  5EPJ A;  3I3C A;  1WD1 A;  1RHP A;  2RA4 A;  4X3K A;  1ML0 D;  2JP1 A;  1ILQ A;  4X3T A;  3TN2 A;  1XX8 A;  2MPM A;  1U4R A;  3DEO A;  1BF4 A;  1O80 A;  3DM1 A;  1EOT A;  1B50 A;  1F9R A;  4LMQ D;  3GV3 A;  2EPB A;  2DY7 A;  2B2W A;  1CA5 A;  2B2Y C;  2K05 A;  3TZD A;  4CJ1 B;  4HSV A;  5COY A;  2HUG A;  4HED A;  4XT1 B;  1G6Z A;  4ZKB B;  3I8Z A;  1HUN A;  4DN4 M;  1M8A A;  2B2W C;  2L4N A;  1U4M A;  1EL0 A;  1TVX A;  1NCV A;  1MI2 A;  1WTR A;  1QG7 A;  2FMM A;  4OIK A;  1X3P A;  5EKI A;  2VXW A;  1GUW A;  1NR2 A;  4HCS A;  4IUP A;  1EIH A;  1PFB A;  1RTN A;  2K01 A;  3I90 A;  4IUV A;  4RA8 A;  4ZK9 B;  3N52 A;  1DZ1 A;  2Q8T A;  1AP0 A;  1U4P A;  1F9P A;  2MJ8 A;  1SDF A;  2KEE A;  3GV6 A;  2Q8R E;  1IL8 A;  1Q3L A;  1F9S A;  2B2T C;  3UI2 A;  2RSO A;  2FJ2 A;  1WTQ A;  4IUU A;  4O42 A;  1WTP A;  4R9W A;  5D14 A;  5DNF A;  2J7Z A;  3IL8 A;  4ZLT F;  3DEP A;  2FHT A;  1VMC A;  1HHV A;  1WVL A;  3P7J A;  1AZQ A;  1ILP A;  1EQT A;  4HAE A;  1B53 A;  2K28 A;  1CA6 A;  3Q6S A;  1KNE A;  2MP1 A;  1QE6 A;  2SDF A;  3LWE A;  1G91 A;  5E4W C;  2MGS A;  5D65 A;  1SAP A;  2R3Z A;  2DY8 A;  1ROD A;  1QNK A;  2B2U A;  1B2T A;  1XYI A;  1F2L A;  3FDT A;  2RSN A;  4RAU C;  1EIG A;  1SSO A;  5T1G A;  1PFN A;  4OIJ A;  4X3U A;  1WTW A;  2M2L A;  1NAP A;  1IKM A;  5AFW A;  1MSG A;  2KVM A;  4MN3 A;  2HCC A;  1KNA A;  2B2U C;  3MTS A;  1WTV A;  1WTX A;  2L11 A;  4QUC A;  5CMD A;  1AZP A;  1BNZ A;  1WD0 A;  2L9H A;  1S4Z A;  1JE4 A;  4R8I A;  5EJW A;  3MWY W;  4XT3 B;  4X3S A;  5JJZ A;  2XIW A;  3G7L A;  1G2T A;  4CJ2 C;  2NYZ D;  3KBX A;  1ZXT A; 
#chains in the Genus database with same CATH topology
 4QUF A;  3F2D A;  3PIP A;  1I6H B;  1IL2 A;  3MXU A;  1YNN C;  3KF8 A;  4P75 A;  3MXP A;  1FR3 A;  4JW0 A;  4OO1 I;  4BA2 I;  4JI0 L;  3VYS A;  1PZK D;  2EJM A;  2A68 D;  4OHJ A;  3AMU A;  4PZ6 A;  2NVT B;  1EYA A;  1G2S A;  1JJC B;  1YIT A;  1XTD A;  2ZM6 L;  4A3J B;  3KUP A;  2IL8 A;  2R7Z B;  3A0J A;  3S24 A;  2LXK A;  1LYL A;  2F0G A;  4WFN 3;  1RJT A;  1SR3 A;  4FDB A;  5M9O A;  3J80 c;  2WFW A;  1VQB A;  1VQH A;  3I4N H;  2R93 B;  5D3I B;  1MBY A;  1PA6 A;  1TR5 A;  3HOU H;  1UAP A;  4H13 C;  4DNR B;  5M5Y H;  3EN2 A;  3LWU A;  1YBY A;  1E1T A;  4HTH A;  3HOV B;  1MIU A;  2B2Y C;  1UEA B;  4LF4 L;  2EY2 A;  1Q90 A;  4XT1 B;  4B3T Q;  3I8Z A;  3LNN A;  3BVZ A;  4DN4 M;  1S5E D;  5IYC G;  2L4N A;  2A19 A;  5IP7 H;  2EXD A;  3PGZ A;  1OXU A;  3EFX D;  3NEM A;  1EEI D;  1C0A A;  3E9I A;  5ELC A;  1K8G A;  3WOE A;  1QB5 D;  1BCP C;  1HNW Q;  3KF8 B;  4LF9 Q;  2EQS A;  3JAM E;  2HIX A;  2OWO A;  2FJ2 A;  4JBK A;  2NN6 G;  2LSS A;  4KLK A;  4R9W A;  4JI5 Q;  3VR4 A;  4K0K L;  1HTP A;  1SE2 A;  3KLS A;  1JWU D;  3ERS X;  1EQR A;  3DWA A;  4GNX C;  2BH2 A;  3HOW H;  2R93 G;  1G6P A;  2R3Z A;  2DY8 A;  3A56 A;  1QOH A;  1ET9 A;  4YHH Q;  2AKW B;  1SSO A;  5BR8 Q;  4C2M H;  2YU9 H;  4DV7 Q;  1YNN D;  4IZ8 A;  5ISR A;  4KV6 A;  3H15 A;  1MSG A;  4FP5 D;  2WB1 E;  5FLX E;  1N36 L;  4J6H A;  1WTX A;  3MXG A;  3CME A;  2CWA A;  4A3B H;  2WII B;  1VQO A;  1XJV A;  1ESR A;  4P74 A;  3JC6 6;  3OMG A;  2CW0 C;  1UNS A;  3K7U C;  3H91 A;  4AYB E;  1L1O C;  1DCZ A;  3FVQ A;  4J1M A;  1I3Q B;  1CKO A;  3CMA A;  5T1I A;  2CH4 A;  2N88 A;  3X3N A;  3GTJ H;  3QWN A;  1KIX A;  1Y8P B;  4GN3 B;  3W1G A;  1QZH A;  5JAV A;  2UUA L;  4POG A;  1HA6 A;  1L0W A;  1FGB D;  5EGT A;  2EYL A;  1R9T H;  1I94 L;  2RA4 A;  1GD7 A;  4ABN A;  1FD7 D;  3D4W A;  1ASZ A;  4KY5 A;  2ID0 A;  4B3M L;  2FMC A;  1MHW C;  3PQI A;  3CC4 A;  1W6K A;  4DV5 Q;  3TZD A;  1LTL A;  4JC0 A;  1KC8 C;  2PPB C;  4I7Z C;  4C3J B;  4QF4 A;  1HZB A;  2A1A A;  4DR6 L;  2NVY B;  3H0G H;  3I72 A;  3FKI B;  1Z6H A;  1KD1 C;  1T5X D;  5JPM C;  4UPA A;  5GQO A;  1HR0 L;  4NDX A;  1H9K A;  4DKA C;  4CKE A;  3M4O H;  2ENB A;  2Q2H A;  1F2M A;  1D5M C;  5M5X B;  1CKM A;  4CDF C;  4RFB A;  4RCN A;  4DU9 A;  3DWQ A;  1SYD A;  3V05 A;  1YJW A;  1VQA A;  1SYG A;  2MO1 A;  4HMI A;  4BY7 G;  1HZ9 A;  3LWE A;  3BVM A;  5E4W C;  2Z1C A;  1WCM B;  1JB3 A;  2K75 A;  4IPD A;  2B8G A;  2H5X A;  5ELD A;  1JJ2 A;  3HKZ G;  1Y1V H;  1YNX A;  3K8A A;  4FXG C;  4LNQ A;  1SYC A;  3HOY G;  5DM7 3;  2K50 A;  1WD0 A;  3MWY W;  1I4P A;  1JOO A;  1MD2 D;  1YHQ A;  4LUO A;  5C0X I;  3I56 A;  4KN4 C;  2GVB A;  5E7N A;  1D6E C;  1PFM A;  2E5L Q;  2HHH L;  4DV2 Q;  2SNS A;  2MNA A;  1B7Y B;  2XSC A;  1HRJ A;  4C3H G;  3R2T A;  1Q81 C;  1HPC A;  1X3Q A;  5CV9 A;  5C4J H;  1N33 Q;  2DGY A;  1LT6 D;  4DR4 Q;  2P5Z X;  4A93 G;  2N55 A;  3P20 A;  1XMQ L;  3J7A V;  4X62 L;  3J81 j;  3RLN A;  2JA5 G;  4FYD A;  3J80 E;  2X6L A;  2KED A;  3PO2 H;  4OWW B;  1N9W A;  2UU9 L;  2RDF A;  4ULL A;  1EQQ A;  5C44 H;  1K73 C;  4L8J A;  1BCP F;  2IW3 A;  1RHP A;  1PYW D;  4JV5 Q;  5GAG C;  2K4K A;  3KFU A;  2BH8 A;  2EYJ A;  3M7N A;  1K0R A;  3E6Z X;  5I2Y A;  1S5B D;  1YNJ D;  4RGT A;  1HA5 A;  5COY A;  2Z0S A;  2SNM A;  3ND8 A;  1B9M A;  4ZQ3 A;  3CC2 A;  4BWG B;  3CCE A;  3J7Y W;  2FXQ A;  1HUN A;  2IPK D;  3H94 A;  4DNI A;  1PH5 A;  3RZO H;  1HCZ A;  3ULJ A;  4KHV A;  3TZU A;  2KCN A;  4BBR G;  2F0T A;  1JWS D;  2AUK A;  4HR7 B;  1KAW A;  4DF7 A;  4HIO A;  2N49 A;  1SYF A;  1EU3 A;  4F87 A;  1CSP A;  1PZJ D;  2KEE A;  3TRZ A;  4C3I B;  2I5H A;  4C56 C;  4ILW A;  4PMC A;  2JXM B;  1VMC A;  2KJX A;  4GLX A;  3H3V H;  1I6H H;  1TWG B;  1ILP A;  3Q6S A;  1QE6 A;  1UE5 A;  5HGT A;  1JC7 A;  1O7I A;  4B3S Q;  5AJ3 Q;  1BUV T;  1QUQ A;  4Y7N B;  1EEF D;  2VNU D;  4HJ7 A;  1PFN A;  5IYC H;  4A3C G;  1D8L A;  5LMN W;  3H3V I;  3GTG B;  4DUZ Q;  3QB3 A;  3ZJY C;  1FNW A;  1STN A;  2JA8 B;  1N32 Q;  3S1M B;  1Q82 C;  2NVQ B;  2A6E C;  2NVT H;  4OO1 G;  2JEA I;  4R4I A;  2A8V A;  3KOJ A;  4A3J H;  2JA6 G;  2NN6 H;  1I5F A;  4GLV B;  1ICW A;  3BS1 A;  2IY5 B;  4PMW A;  1D1I A;  2Z6K C;  5I4D A;  3W3A A;  2R93 H;  1Z7T A;  3SDZ A;  1PH4 A;  5J3B A;  1EFI D;  2NN6 I;  2Q2I A;  2UUC Q;  3WOF A;  1X32 A;  2QDB A;  5FLX L;  2BDN A;  3D6W A;  4KY6 A;  3GTO B;  1EZ6 A;  3F2U A;  1PV4 A;  2XWJ B;  3NTH A;  4IUN A;  3GTM B;  4A3D B;  3HOV H;  2EOT A;  1M90 C;  4R4T A;  1DON A;  1G8Z D;  4N9P A;  1VQF A;  2F3I A;  4DV0 Q;  3S2D H;  5EBC A;  1A15 A;  1DOK A;  3G48 A;  2D0P A;  4JBM A;  2C35 B;  3HOU G;  1FJG L;  1GVP A;  4KY7 A;  1C48 A;  4LFC Q;  2MPM A;  4KI0 A;  2F1M A;  2EDG A;  2XVS A;  1QUQ B;  1G51 A;  3NXW A;  3GV3 A;  1XPR A;  1LAB A;  3OW2 A;  1U0L A;  4IOA A;  1VF7 A;  4LFB Q;  1LT3 D;  3H3V C;  2Z6B A;  3GDE A;  1A8V A;  2CH4 W;  3M4Y A;  5IY0 A;  1PH6 A;  1Z47 A;  2B2W C;  1A62 A;  3L2P A;  4Q5V A;  2LY7 A;  2HIV A;  4XTC S;  3ITP A;  3S1Q B;  2BCO A;  1SJE D;  4HCS A;  1GUT A;  4L5Q A;  5H1S E;  1PFB A;  1SNC A;  4BXX G;  5IGE A;  1YHB A;  1XNR L;  3KLR A;  1JOK A;  1XXG A;  4P73 A;  2K32 A;  1PTO D;  3E9H A;  3NE5 B;  4RGN A;  4OON A;  1B3Q A;  4MIU A;  4A3E B;  3OYY A;  4A3K G;  2VL6 A;  2JA9 A;  3HOW G;  4K5X A;  1G91 A;  1KNE A;  1M4V A;  4DUY Q;  3BDO A;  3D8G A;  5JJK A;  2XNA C;  1OXS C;  3STB C;  1QJO A;  1Y69 U;  5IE8 A;  1I3Q H;  1XPO A;  1CQV A;  3TS0 A;  4RMF A;  3D31 A;  1HQR D;  4P72 A;  1WTW A;  4ZCK A;  2QKI C;  3A8J E;  4B3R Q;  4HJ9 A;  2D0O A;  4LWC A;  1B8A A;  3RD4 A;  3ZYY X;  1S5F D;  4JI8 Q;  3T13 A;  4I7A A;  4A3B G;  2ZXR A;  3F2C A;  1YJ9 A;  5JJZ A;  5CV5 A;  3G7L A;  1BOS A;  3T56 B;  4MZ9 A;  4HMJ A;  5G3L F;  5CYU A;  2IWH A;  4O2D A;  4JI6 L;  2L15 A;  4IUR A;  5K5P A;  4DV3 Q;  2CKZ B;  4DR5 Q;  2K5V A;  2ZJP A;  4UP7 A;  4A76 A;  5K36 G;  4HJA A;  3L3O C;  3A7A B;  4HIM A;  2RKS A;  3T51 B;  2VB2 X;  5M3F B;  3SK5 A;  1K3R A;  1YZ6 A;  2Q2U A;  1B1Z A;  1TWH H;  3OIQ A;  2UUB Q;  4QGU A;  4DK3 C;  3K59 A;  2F3V A;  1TU2 B;  4LW1 A;  3DM3 A;  4JI2 L;  3FKI H;  1X9N A;  1N34 Q;  1HJP A;  1JR0 D;  1OXV A;  1BBX C;  2HD3 A;  2XGT A;  3GTQ B;  4AQY Q;  1XX8 A;  1SNP A;  1BF4 A;  5M5X H;  4FF2 A;  2QA4 A;  3ERQ A;  4C3H H;  4K2K A;  1SMY D;  4CGY B;  2EPB A;  4IOC A;  1EU4 A;  4DR1 Q;  3D0F A;  4N9T A;  2LS0 1;  1VQL A;  3OTO L;  1L0Y B;  1BDO A;  1J5E L;  2JJQ A;  2UXD Q;  1WJJ A;  4FXK C;  2AQ2 B;  3WWV A;  3HOX B;  3BZD B;  4DK1 A;  3DXJ C;  3KLS X;  2YTY A;  3J80 L;  1P16 A;  1MI2 A;  2F0H A;  4BBS G;  3Q24 A;  1T5E A;  2WB1 B;  1YJN A;  3OWE B;  4XQJ A;  3AQQ A;  3BZK A;  2F4I A;  3X3M A;  4ZK9 B;  2L55 A;  2VUM B;  4L63 B;  4X64 Q;  1E7Z A;  2E76 C;  1IZ6 A;  2LMC B;  3GV6 A;  5KRU A;  3N6R A;  1HNX Q;  2B2T C;  4LFA L;  5IWA Q;  5ELB A;  3ULP A;  4GKK Q;  1B53 A;  2EY1 A;  5D65 A;  1ROD A;  1QNK A;  3NEL A;  4E6I A;  1EYG A;  1F2L A;  3FDT A;  2NVX B;  4EQ5 A;  5C0X J;  1ZYR D;  1X65 A;  2V1C C;  5HY6 A;  5C0X G;  4N8F A;  5AFW A;  3Q8D A;  3QOL A;  1LTA D;  1NMF A;  1QNU A;  1BNZ A;  4QUC A;  1JWM D;  4QCL A;  1BQQ T;  2EY6 A;  4ZRZ A;  1SYE A;  4DGZ A;  1SRU A;  3C46 A;  3J7A 5;  2ICI A;  4L6T B;  2AHO B;  5C3E B;  4A3G G;  1X3G A;  1PH2 A;  4JI3 Q;  4A3M B;  2HDM A;  2Z9H A;  3TP8 A;  2WB1 G;  3PCO B;  1VMP A;  4RWS C;  3AU7 A;  3RZD B;  1J9O A;  1DOM A;  4ME3 A;  1PH9 A;  4C1N K;  2RBM A;  5BN5 A;  4A3I G;  1PRT B;  5DEH A;  2RQX A;  2TSS A;  2KQ3 A;  2F0E A;  3VR6 A;  2F0Q A;  5LHY 1;  1XMO Q;  1OXX K;  4YCU A;  1PH3 A;  1AH9 A;  4AYB G;  2X6G A;  1IBL Q;  2E2J B;  5I6W A;  1MSH A;  3J81 c;  3J7A F;  3K0Y A;  3PO2 G;  1XNQ Q;  2EYF A;  3HZX A;  1CTM A;  3S15 H;  2JA6 H;  5C44 G;  3KF6 A;  1YIJ A;  1GKH A;  5COR A;  5J39 A;  3TS2 A;  3T53 B;  2MFI A;  3CRL C;  1IBM Q;  1U4R A;  2OTJ A;  2CQO A;  1TT2 A;  4JPB W;  2E2D C;  4LMQ D;  3VA7 A;  4C3I H;  2K5Q A;  3BYY B;  3HOZ B;  3E3X A;  1TWF B;  4KHZ A;  2E75 C;  4B3T L;  2HUG A;  1TWG H;  4LF7 Q;  1SNO A;  2D5D A;  4B9W A;  5IGF A;  2K6A A;  2QIL A;  4Y7N H;  3DUZ A;  1NCV A;  4R8N A;  5KEE A;  1D7Q A;  5EKI A;  3RNU A;  1BXT A;  3GTG H;  4YWK A;  1HNW L;  2JA8 H;  1QVF A;  1LO5 D;  4LF9 L;  3S1M H;  2KA7 A;  1D1K A;  2MJ8 A;  2NVQ H;  2F0O A;  3RLF A;  4OXP A;  1ENC A;  5D14 A;  2IX1 A;  3KJP A;  4IJL A;  2WAQ E;  1ONL A;  2O2L D;  4JI1 Q;  4R4O A;  1KDA A;  2LFN A;  5IYD G;  4YHH L;  5ELO A;  4JOI C;  5BR8 L;  4DV1 Q;  2E74 C;  4GN5 A;  4DV7 L;  4X3U A;  5J22 A;  3W2D A;  5CC4 A;  3FEW X;  5FO8 B;  1LTS D;  4X65 Q;  5IOD A;  1SE8 A;  2HCC A;  4BXX H;  4I65 A;  2OQK A;  3KF6 B;  2SOB A;  1GJX A;  1ENA A;  3G4S A;  2KCC A;  5I6Y A;  4A3J G;  2R7Z G;  1G2T A;  1D5X C;  3KBX A;  4GS3 A;  2AQ1 B;  4RGO S;  4YWM A;  1QZG A;  3P75 A;  5IGD A;  1CKN A;  4HIK A;  2BE5 D;  3K7A B;  4K6D A;  4A3K H;  2ZT9 C;  2IT1 A;  1PLF A;  3FPU B;  3M3Y B;  3U50 C;  4TSS A;  3BVG A;  2XRQ D;  3I70 A;  1HFG A;  1C4Q A;  1QVC A;  1EQV A;  2ZJR A;  3HOV G;  1B70 B;  2K03 A;  1Y1W B;  1MGS A;  4XIG S;  3NTI A;  5CBE E;  1RCV D;  1U9R A;  1CM9 A;  2JA7 B;  3C3L A;  2NB0 A;  1RIP A;  2M9V A;  4IQZ A;  4NXN Q;  3R93 A;  3CU7 A;  5KGU A;  3CCL A;  2KEN A;  2NZ1 D;  1R4Q B;  2RVL A;  3F1Z A;  3S1Q H;  3HKS A;  1K8O A;  5TSS A;  4JVZ A;  1LT4 D;  1UE6 A;  3IRB A;  2RCF A;  3P1H A;  5K36 H;  4DV5 L;  1IXR A;  4CKB A;  2O4X A;  4CJ1 B;  2PZW A;  5KNC A;  4ZYS A;  1CT1 D;  5IOC A;  2CFM A;  4NXM Q;  3S1N H;  1A2U A;  4DR7 L;  1IW7 D;  2B8F A;  4UP8 A;  5C5L A;  3DWP A;  1CUK A;  3RUZ A;  5CR3 A;  1NR2 A;  1RTN A;  3MAQ A;  4IUV A;  3Q22 A;  2BA1 A;  2Q8T A;  1CKN B;  1Q12 A;  5C3X A;  5IP9 G;  1F9P A;  1SDF A;  1BKB A;  4KN7 C;  2Q8R E;  1F9S A;  3UI2 A;  3FP9 A;  3B6Y A;  4KTA A;  4IUU A;  1LAC A;  5HUR A;  2AWO A;  5DNF A;  3PF5 A;  4ZLT F;  2FHT A;  3T1H Q;  2E8G A;  2MP1 A;  1H9S A;  1CFM A;  2F0S A;  1B44 D;  4RKL A;  5FOB B;  1O78 A;  2RSN A;  4RKB A;  3CRK C;  4BBS H;  5EAY A;  1TWA B;  2J0T D;  2KVM A;  2A73 B;  1A63 A;  3T1Y Q;  3NBI A;  2XWB B;  1YNJ C;  3A74 A;  1AZP A;  2NZO A;  1NY4 A;  2UUA Q;  4IPC A;  2E5L L;  1SN8 A;  1HNZ Q;  2SEB D;  1VQ5 A;  2KUM A;  2L12 A;  3KLW A;  3GTQ H;  1NTG A;  4DV4 L;  1U4L A;  2B2Y A;  1I94 Q;  1FNU A;  2E2I H;  1EY8 A;  1K8A C;  4DR4 L;  1VQ9 A;  5C0X H;  1NR4 A;  2PO4 A;  1NNX A;  3NHH A;  4EVO A;  4C3J G;  3J81 E;  3AB9 A;  3GTK H;  3C2P A;  4CBV A;  3FKI G;  2I07 B;  4LUZ A;  5CBA E;  3S1R H;  5M3M B;  4A3G H;  2FFK B;  4A3F B;  4MTK A;  3F8T A;  3CCQ A;  4JV5 L;  4J15 A;  1WD1 A;  3GTP H;  3I55 A;  5CV7 A;  2F0D A;  2JP1 A;  4A3I H;  3DEO A;  2VUM H;  2JEB I;  1PTO H;  3BYT B;  4RH6 A;  1H9S B;  1B50 A;  4GNX A;  4JI4 Q;  1Q8K A;  4F8M A;  5CV8 A;  4PQX A;  3Q23 A;  3U4V A;  3KJO A;  1I50 B;  4P2C B;  5GAD C;  1WCM G;  4HED A;  2F0K A;  2EY5 A;  3T4A C;  1VDZ A;  3HS0 C;  1FNV A;  3EJI A;  3OW7 A;  4OWX B;  3TQY A;  3K57 A;  1A3U A;  3GTL H;  5M5W B;  3I4M B;  1EL0 A;  5IYB G;  3UDX A;  2FMM A;  4PG3 A;  1K8M A;  2NVX H;  2OTL A;  4WJ3 M;  3D4R A;  3PO3 B;  2K01 A;  3D6C A;  1EOV A;  1Y8N B;  2PQE A;  1DZ1 A;  1TY2 A;  1LUZ A;  1I4H A;  1U4P A;  1CSQ A;  3NK9 A;  1W2B A;  4BS9 A;  4O42 A;  3PF4 A;  1V8Q A;  3C1F A;  4A3M H;  1AZQ A;  5FJ8 G;  5AJ3 L;  4DR3 Q;  3RZD H;  1V9P A;  4QQB X;  2EJF C;  2VB3 X;  4RAU C;  3PIO 3;  2M2L A;  4H7B A;  1N32 L;  3CCJ A;  4GKJ Q;  1KNA A;  2L9H A;  1HXY D;  2QEX A;  3S14 B;  1PHJ A;  5EJW A;  5JJL A;  2Z4I A;  2E2J H;  3I7F A;  4IPH A;  2GA4 B;  1LT5 D;  1CI3 M;  2Q8I B;  2NZH A;  3K58 A;  4GNX B;  1F2Z A;  1EFW A;  3QO2 A;  1GXD C;  2F0N A;  3CHB D;  2KEC A;  2DN8 A;  3ULL A;  1DGS A;  1IBK Q;  5IYD H;  2UUC L;  3AEV A;  1PTO C;  3BZC A;  4IFD H;  3PUX A;  3UE1 A;  2ICE C;  3K80 C;  5KIX A;  4YIJ A;  4EQP A;  3NQI A;  1PDQ A;  1I4X A;  3G6E A;  1J8I A;  4XQN A;  3K0X A;  1LLR D;  4QB4 A;  3CW2 C;  5LL6 S;  1VQI A;  1H95 A;  3NUC A;  4DV0 L;  4IFD I;  2Z8L A;  3VYU A;  3SVM A;  2R7Z H;  3PIP 3;  3K6O A;  1LTT D;  3NWT A;  3RLO A;  2AMC B;  3I4N B;  2M00 A;  4IN3 A;  4XXE A;  1L2F A;  4LFC L;  2YV5 A;  1EY9 A;  4CDE C;  3JAM i;  2PI2 E;  4JCV E;  4BY1 B;  1A2T A;  3DLL A;  4C3I G;  3BG3 A;  5M5Y B;  4AH6 A;  3K5M A;  1X3E A;  5C6A A;  4G4K A;  4FXD A;  5EKL A;  5EBD A;  2PZT A;  3TME A;  2E2H B;  2OF1 A;  3CXC A;  1QIL A;  3VYT A;  3CKI B;  2JA8 G;  4TVA B;  1D2B A;  1EIH A;  3EIV A;  4F88 A;  3OWF A;  1AP0 A;  1SMX A;  4OL7 A;  1Q86 C;  2RSO A;  2N3S A;  3PUW A;  2MQH A;  1VS0 A;  3TBI B;  4ZUJ A;  3TEH B;  3DEP A;  3MA2 B;  1K0S A;  3P7J A;  4DUY L;  2F0M A;  4G7O C;  1EY0 A;  2JSO A;  1OTC A;  4UY8 C;  4PV1 C;  4JBJ A;  4K14 A;  1F77 A;  2KBN A;  4FO2 A;  3K5L A;  1XYI A;  4BY1 G;  4LF5 L;  1NSN S;  4GOP A;  3U4Z A;  4C2M B;  1RL2 A;  3M3Y H;  4B3R L;  1VCI A;  2RF4 A;  1SMY C;  1NAP A;  1AFP A;  2G5D A;  2OCE A;  3L0O A;  4A3D G;  4JI8 L;  3MTS A;  1Y1W H;  5CV4 A;  4XT3 B;  4HID A;  4R1J A;  5IP9 H;  4R4C A;  1EY5 A;  2JA7 H;  3DMU A;  4ID6 A;  2H1E A;  4KHP Q;  3OMC A;  1PH8 A;  1DM0 B;  4DV3 L;  4NW2 A;  4DR5 L;  4QY7 A;  5JOB A;  3NQT A;  1V1P A;  2MO0 A;  4U68 A;  3M7G A;  3GTJ B;  3HG9 A;  2F0L A;  1YVC A;  3SR1 A;  1E1O A;  1UWV A;  2K33 A;  4HJ5 A;  4DAP A;  1X3F A;  4GLA C;  4J8Q A;  1NBW A;  1O7Y A;  1CQF A;  1TWC B;  3MVV A;  4OEM B;  3BU2 A;  2UXC Q;  2L0C A;  1E2V A;  2UUB L;  1BO0 A;  2LXJ A;  3URY A;  1HQM C;  1Q46 A;  3GQB A;  4ZAI A;  3UE0 A;  1VQN A;  1EWH A;  1N34 L;  2KHS A;  1ZYR C;  2DNC A;  2V4D A;  2PYK A;  4EQN A;  4AQY L;  5GAH C;  5C3W A;  2QDL A;  3M9B A;  2CHB D;  1VQ4 A;  2LKV A;  1KLU D;  1A0I A;  3HRZ C;  3BDC A;  1PRT D;  3QOJ A;  4G7H C;  2R61 A;  1XNR Q;  4A3E G;  2DY7 A;  3HFZ B;  4DV6 Q;  3NBH A;  5C4H A;  3R3O A;  2WAQ B;  4GOP B;  2HQE A;  2UXD L;  3S17 B;  3MFG A;  3J81 L;  2GVA A;  1WFQ A;  4BA1 I;  4C3J H;  1G6Z A;  3H0G B;  2NVY H;  1E24 A;  5CGK A;  1VQ8 A;  2WKD A;  4JBW A;  3TSS A;  2VXW A;  2VQE Q;  4UDU C;  4YCV A;  1TWA H;  1VQG A;  3QIA A;  3S9W A;  1PXU A;  3OSO A;  1CK1 A;  3CAM A;  1QVG A;  4QJF A;  2WP8 J;  1HNX L;  3U9S A;  1E3P A;  5IWA L;  2F3W A;  1V1P B;  1V1Q A;  1U5K A;  4XQQ A;  1PH1 A;  4GKK L;  2HQL A;  2I46 A;  4G57 A;  1EQT A;  4HAE A;  2SDF A;  2YYZ A;  1FGU A;  1ZEQ X;  4V19 0;  3WDN A;  1WCM H;  4LF6 L;  3TP5 A;  2R92 B;  1PTO F;  4JI7 Q;  1GHK A;  2Q2T A;  5T1G A;  4APV A;  1Y1V B;  5FK9 C;  5IYB H;  3A5Z B;  2YTX A;  1IKM A;  1EYC A;  1Q8I A;  1SE3 A;  5M3F G;  1VQK A;  3S16 B;  4WJW A;  1LTG D;  2QW7 A;  2B63 B;  3J80 i;  4YY3 Q;  1JQY D;  4JK1 C;  4JI3 L;  3K81 C;  1SFO B;  1E2Z A;  2D62 A;  2VQF Q;  5IGC A;  5LL6 X;  1S5D D;  3A5U A;  2N8N A;  5M3M H;  3OPO A;  5FJ8 H;  1C8C A;  1HR0 W;  1FL0 A;  3NBH B;  1TS3 A;  5JEA H;  2KHI A;  4RG1 A;  2UXB Q;  2EE1 A;  4TRD A;  5JVG 3;  2NWG A;  4XDX A;  1VQM A;  1KDC A;  4GZY C;  2CVR A;  2K04 A;  2DJG C;  2EYM A;  4X66 Q;  3CQZ B;  1IBL L;  1KHI A;  1I6V C;  2CWP A;  3PSI A;  2Y0S B;  1I50 H;  3HOX G;  3ICE A;  1QWY A;  4M8A A;  4JYA Q;  2QCP X;  4QMG A;  2FIN B;  1I4G A;  2RDG A;  3LX0 A;  3I4M H;  5M5W H;  5EPK A;  1LTB D;  3CCR A;  4KKS A;  3SE0 A;  2PQA A;  3SK6 A;  2F4V Q;  2GN5 A;  5FO9 B;  2RHS B;  4OX9 Q;  1L0X B;  2DUD A;  1IBM L;  2VUM G;  3A54 A;  5EPJ A;  4DK6 C;  3SK8 A;  1X54 A;  2B63 G;  3K5O A;  3EQL C;  5D3D A;  3QR8 A;  1ENF A;  4F7X A;  2BE5 C;  2NBF A;  2JE6 I;  1ICF B;  4G7Z C;  3PUZ A;  5KYL A;  1NUC A;  1QG7 A;  2XN9 C;  1IYJ B;  1KDB A;  4FNF A;  4KD3 A;  1HZA A;  4DNT B;  4XYQ A;  4GN4 B;  1AE3 A;  4RA8 A;  3LGJ A;  5C4Z A;  1K3B C;  4TQU S;  2JK8 A;  4S3S A;  1SNM A;  3MEH A;  5LMN Q;  3I4L A;  3NPP A;  5C3E G;  2IX3 A;  4A3M G;  5C4X B;  4LF8 Q;  1JMC A;  4JI1 L;  2PNR C;  4OWT B;  1VQC A;  4DV1 L;  2B2U A;  1B9N A;  2PMZ E;  5C5M A;  1JOQ A;  4L5T A;  3SEB A;  1SYB A;  4X65 L;  2B3G A;  1VQE A;  2PCF B;  3FMC A;  1CZG A;  3BJU A;  4DR2 Q;  3U58 A;  5LMU Q;  4HJ8 A;  1ASY A;  2AWN A;  2PQA B;  4LJZ C;  3AFQ A;  5DLQ E;  2K14 A;  4JI5 L;  1IW7 C;  4OGQ C;  1ZXT A;  1GUO A;  1UE1 A;  4DXF A;  4PNY A;  4EQO A;  2DNE A;  4TKO B;  1TY0 A;  3TRE A;  5ELF A;  1VQJ A;  4IFD J;  2HCI A;  1H9J A;  2B2V A;  2HDL A;  2R7D A;  4IFD G;  4H44 C;  4BY1 H;  3IFD A;  1TS4 A;  2EYO A;  4JI0 Q;  5C4X G;  3HOZ G;  2I0Q A;  1HH2 P;  3GTO H;  1T9H A;  1KL9 A;  4DXG A;  3GTM H;  4A3D H;  5E4X A;  2X69 A;  4CHT B;  4DAY A;  4NXN L;  1SRO A;  3FRP B;  2ZM6 Q;  3S2D B;  2E2H H;  3L7Z C;  5DAU A;  1O7Z A;  1KAB A;  3R8B A;  2I5M X;  3M4Q A;  2B2T A;  1EY6 A;  4L5S A;  2RHQ B;  3M4P A;  4QIW E;  1OO9 B;  3CCS A;  1J6Q A;  2BA0 A;  4XYO A;  5ELE A;  1DJR D;  1PMR A;  5BN3 A;  2KCM A;  3MEF A;  5J1Z A;  1GO3 E;  1LTR D;  4KD4 A;  4O0A A;  1CA5 A;  2F0U A;  2PI2 A;  2K5N A;  2EIF A;  4DK0 A;  4B08 A;  4L5R C;  2IX0 A;  4NXM L;  4LF4 Q;  2C9O A;  1SND A;  1DD2 A;  4ZKB B;  4H02 A;  1AW7 A;  3RN5 A;  3EBE A;  1M8A A;  2ALY B;  4UHV A;  2K52 A;  2AUJ D;  1AE2 A;  2PZU A;  1MJC A;  3KYH C;  4FVM A;  4CDC C;  1GUW A;  3I90 A;  1RKN A;  3MXN A;  1EWI A;  1E22 A;  5KYI A;  2ZTD A;  1I4Q A;  1IL8 A;  4WRD A;  1WTQ A;  1WTP A;  3T1H L;  1HHV A;  4A3E H;  1KQS A;  1S5C D;  3T16 A;  1RDP D;  4K0K Q;  1VQ6 A;  2WKC A;  5FLM G;  3RR5 A;  3A8I E;  2Y0S E;  3IKJ A;  3CC7 A;  1IYU A;  4PZ7 A;  3F2B A;  1D5Z C;  4DPG A;  1EIG A;  2L5T A;  3KK7 A;  4DAY B;  1K83 B;  3T1Y L;  1DYQ A;  1Y1W G;  2WIN B;  1VQD A;  1X6O A;  4MN3 A;  5I2X A;  1DXM A;  1TWC H;  2L11 A;  4Q0F A;  1N36 Q;  2JA7 G;  4R8I A;  2F52 A;  4RHR A;  5A2Q E;  1KAA A;  5JJI A;  1BBU A;  3L9A X;  4WJ4 A;  1QCB D;  1HNZ L;  4K8J A;  2OXP A;  4BY7 B;  1TS2 A;  4NB3 A;  1STB A;  1A6X A;  3ND9 A;  1W3S A;  2JN4 A;  3HKZ B;  3KBG A;  2VZA A;  3HOY B;  1PYB A;  3PUV A;  2IJ0 A;  5M3F H;  1BCP D;  1TWH B;  3S17 H;  4UP9 A;  1E2W A;  3HEJ A;  3J7Z C;  3MXN B;  3D4D A;  4KKT A;  1CHQ D;  1XPU A;  1DOL A;  2K1B A;  4DR7 Q;  3ONA B;  2WV6 D;  1UUP A;  1SJH D;  2MHV A;  4DV2 L;  1RTO A;  2DJF C;  3NSW A;  1ILQ A;  1HZC A;  2EYP A;  4O1N A;  1YI2 A;  1FYC A;  4JI4 L;  2PNH A;  1EOT A;  4C3H B;  1N33 L;  4B3M Q;  1VQP A;  2PW7 A;  4JOI A;  1IHZ A;  2K05 A;  2K5H A;  3S2H B;  1PVO A;  1EWC A;  2EZV A;  1VQ7 A;  4A93 B;  3HOX H;  2VY3 A;  4DR6 Q;  2JA5 B;  3KDF A;  1U4M A;  4K5W A;  1WTR A;  2R92 H;  2VS1 A;  2MUY A;  2CW0 D;  1EIF A;  1I4R A;  3RN2 A;  1HR0 Q;  1STY A;  1AN8 A;  3UDI A;  4A3L G;  2F0I A;  4YWL A;  3S16 H;  4PZ8 A;  2ZJQ A;  1V43 A;  2B63 H;  2YTV A;  1SFO H;  2KHJ A;  2WAC A;  3MZ5 A;  3G6J B;  3C1E A;  3D3R A;  3FHW A;  4DR3 L;  1CA6 A;  2NUC A;  1Q1B A;  1VF5 C;  1WTH A;  4DAM A;  3PMF A;  1B2T A;  3CCU A;  4OIJ A;  1CHP D;  5JVH 3;  4DV4 Q;  4BBR B;  2I5L X;  4GKJ L;  4IJH A;  1H9M A;  2ASB A;  5IT9 L;  2BOS A;  5KND A;  3CQZ H;  1S4Z A;  4GOP C;  4FF3 A;  3O13 A;  4H0L C;  1L1O A;  1EY4 A;  1PH7 A;  4KKU A;  1S3O A;  1H9R A;  5M3M G;  5C3E H;  2QGQ A;  4A3F G;  4B3S L;  5JEA J;  1STE A;  1C9O A;  2L1B A;  5IGB A;  5JEA G;  4NPS A;  1Y8O B;  2HHH Q;  3CD6 A;  1IBK L;  1SXT A;  3A7L A;  3K5N A;  3RMH A;  3AFP A;  1S72 A;  1YEZ A;  4DUZ L;  2QEJ C;  1NJI C;  4CKC A;  2EYH A;  5I9O A;  3KDF B;  1BCP B;  3EVQ A;  4JG2 A;  4FF4 A;  1K28 A;  3G71 A;  1F9Q A;  2A6H C;  5HGQ A;  5L37 A;  2KOL A;  1XMQ Q;  3I4M G;  4X62 Q;  3VR2 A;  2Z4H A;  3SGI A;  4ODG A;  1E0B A;  3S15 B;  2JA6 B;  3TN2 A;  2B29 A;  3I4O A;  2A69 C;  3PO3 G;  2EVB A;  2ATW A;  3I73 A;  2UU9 Q;  3I91 A;  1ESF A;  1ML0 D;  4KJO A;  1EZ8 A;  3MFY A;  2XRS D;  1TII D;  1JJG A;  3DM1 A;  2RCN A;  3VA5 A;  2BDO A;  3PV0 A;  3BDL A;  5C4X H;  3HOZ H;  5E3F A;  1TWF H;  2B39 A;  4DAV A;  4K8I A;  1X56 A;  1O7L A;  1KLG D;  3IAY A;  2PW5 A;  3ER0 A;  3SXH A;  1IYV A;  4Z9C B;  4A4I A;  2N78 A;  4M1U B;  1Q1E A;  1L1O B;  4ZUI A;  4IUP A;  4RHS A;  2XTI A;  5E1F A;  3HOU B;  2NTT A;  1TXY A;  1TKW B;  5FKA C;  4B9X A;  3QG1 A;  3AYH B;  1LM0 A;  1A3V A;  2H4O A;  1ZKO A;  3JAM L;  4LFB L;  4MNO A;  3HKZ E;  4KMU C;  2J7Z A;  2OEO A;  4V0B A;  1PFS A;  4ME5 A;  2IHF A;  2K28 A;  3TP7 A;  1GUN A;  2G9D A;  1TQO A;  4K6L A;  2F0V A;  1CZW A;  1GM5 A;  3CCM A;  4U67 3;  1PRT C;  4CDD C;  5G3L D;  3SHL A;  4DFA A;  2CQA A;  3OIP A;  2AQ3 B;  4HN7 A;  1FVI A;  5CMD A;  5IT9 c;  3W5O A;  1TS5 A;  2QF7 A;  4KHP L;  4OEL B;  4A75 A;  2A74 C;  1IKL A;  5I9P A;  4A3K B;  1JCK B;  3K7A H;  4POF A;  2A6H D;  3I4N G;  3HOW B;  1JOR A;  4MHE A;  3HP3 A;  4NMZ A;  5FLM H;  3V96 A;  2JYO A;  4LAA A;  2D9U A;  4RCO A;  2YU9 B;  4IUT A;  1UEB A;  3I2Z A;  2A69 D;  1JIC A;  2A5H A;  2G9H D;  2UXC L;  2O5J C;  5BN4 A;  1HFN A;  2ES2 A;  1LV9 A;  2KCT A;  1KRT A;  5A2Q L;  4A3B B;  2F03 A;  4R4Q A;  4IO9 A;  5IP7 G;  2RDH A;  1JB7 A;  1WTO A;  2EJG C;  3UDF A;  1WOC A;  3CF5 A;  2O5I C;  1FJG Q;  4X3K A;  4X3T A;  1JT8 A;  5DM6 3;  4IAL A;  2ZXP A;  5F2D A;  3H09 A;  1F9R A;  2ZXO A;  4K2L A;  3H6M A;  4DV6 L;  1GOZ A;  3GO5 A;  2A6E D;  3QJY A;  1KTK A;  5CV6 A;  3S1N B;  3U9O A;  4C1N I;  2PMZ B;  3GD7 A;  2VW9 A;  3E0E A;  1TVX A;  1R9T B;  2ZTE A;  4NKL A;  4ALP A;  3DHQ A;  1X3P A;  2VQE L;  4LF5 Q;  1II3 A;  1K83 H;  1PZI D;  4QL5 A;  1JE5 A;  3N52 A;  4KK7 A;  2K5D A;  1X55 A;  4WOR A;  1A3T A;  4DR1 L;  4MTN A;  2R6G A;  3PUY A;  3V2T A;  1V1O A;  3JAM c;  1SBB B;  5ELN A;  4DA2 A;  1XWE A;  3CPW A;  1NE3 A;  1WVL A;  1GHJ A;  3VR5 A;  4KJN A;  1EYD A;  1P8L A;  2MGS A;  1SAP A;  3VYR A;  4LK1 C;  4BY7 H;  2ZTC A;  4JI7 L;  4LUV A;  3EA6 A;  1GUG A;  2F0W A;  3A55 A;  1K9M C;  1N8R C;  4BBS B;  1EIY B;  1OXT A;  3SK4 A;  5KNB A;  3M4O B;  2OQ0 A;  4X64 L;  3A8K E;  3J81 i;  5FLX c;  4Y52 H;  2B2U C;  3OHX C;  1WTV A;  1S40 A;  3HOY H;  2K5W A;  1R4P B;  4YCW A;  4YY3 L;  4EGV A;  1RF2 D;  4A3L H;  2XIW A;  2TMP A;  3HGB A;  2VQF L;  4CJ2 C;  2NYZ D;  2Z6K A;  1HTL D;  1SE4 A;  1Y14 B;  3M85 A;  3E5S A;  1Z9F A;  4JI6 Q;  3NWS A;  1KRS A;  4P71 A;  2UXB L;  4QIW B;  1LTI D;  1STG A;  2E2I B;  1KXL A;  4ZKC B;  1SLJ A;  3Q0A A;  4HSP A;  2D2C C;  4X66 L;  1B4O A;  1B3A A;  1HUM A;  4EX5 A;  2WAQ G;  2B2V C;  1XTC D;  2F0F A;  4FF1 A;  3W1B A;  3GTK B;  3TDQ A;  4JYA L;  1MKH A;  3S2H H;  3H0G G;  2C5C A;  3MC0 B;  5EQ0 A;  4A93 H;  3S1R B;  2F4V L;  1AEX A;  2JA5 H;  4A3G B;  1SEB D;  4CJ0 B;  4JI2 Q;  2K7V A;  5JPN C;  4A3F H;  2A68 C;  4OX9 L;  4IUQ A;  5EPL A;  1C7Y A;  4UAI A;  2F0J A;  3GTP B;  3CP0 A;  3I3C A;  1STH A;  4K5V A;  3STB D;  4A3I B;  4HCE A;  1PTO B;  1O80 A;  3NTK A;  5GRO A;  1UE7 A;  4PMB A;  4AIM A;  1XMO L;  2R7F A;  5C4J B;  3FPP A;  3UDG A;  2B2W A;  4X6A H;  2JQO A;  4HSV A;  5IIF A;  3OTO Q;  4AYB B;  3VDY A;  1RD9 D;  1XNQ L;  3IFT A;  1J5E Q;  4IPG A;  2R92 G;  3NEN A;  1PRT F;  3OOC A;  1GUS A;  3PIO A;  3GTL B;  3PO2 B;  2J4X A;  1Y1V G;  3GP7 A;  4LF6 Q;  2NTS A;  2OT2 A;  4OIK A;  3R2I A;  5C44 B;  1EY7 A;  1W6J A;  4BBR H;  5NUC A;  3PO3 H;  1STA A;  5GAE C;  5A35 A;  5LMN L;  1YHA A;  1SNQ A;  1Q3L A;  2IHE A;  1PYS B;  4LF8 L;  3E0J A;  4LFA Q;  1WI5 A;  3IL8 A;  4LF7 L;  1ET6 A;  2HT1 A;  5EKK A;  3RZO B;  1G29 1;  3MHB A;  3NP8 A;  4RGM A;  5FO7 B;  3TP6 A;  1BVS A;  4N8X 1;  3VR3 A;  4DR2 L;  4NP5 A;  1Q7Y C;  1BBW A;  1MJE A;  2F0P A;  1WYD A;  5LMU L;  1M1K C;  4A3C H;  5IT9 E;  3CPF A;  2Y0S G;  1JE4 A;  1BR9 A;  3S14 H;  3CCV A;  1F2Y A;  3ERO A;  4X3S A;  2CCZ A;  5IGG A;  1NMG A;  1EUJ A;  2EXZ A;  4OO1 H; 
#chains in the Genus database with same CATH homology
 4QUF A;  1I6H B;  3MXU A;  1YNN C;  3KF8 A;  3MXP A;  1FR3 A;  4OO1 I;  4BA2 I;  3VYS A;  1PZK D;  2EJM A;  2A68 D;  4OHJ A;  3AMU A;  2NVT B;  1EYA A;  1G2S A;  4A3J B;  3KUP A;  2IL8 A;  2R7Z B;  2F0G A;  4WFN 3;  1RJT A;  5M9O A;  2R93 B;  5D3I B;  1MBY A;  1TR5 A;  1UAP A;  4H13 C;  4DNR B;  3LWU A;  4HTH A;  3HOV B;  2B2Y C;  1UEA B;  2EY2 A;  1Q90 A;  4XT1 B;  3I8Z A;  3LNN A;  3BVZ A;  4DN4 M;  1S5E D;  2L4N A;  1OXU A;  3EFX D;  1EEI D;  5ELC A;  3WOE A;  1QB5 D;  1BCP C;  3JAM E;  2FJ2 A;  2NN6 G;  4R9W A;  3VR4 A;  1HTP A;  1SE2 A;  3KLS A;  1JWU D;  3DWA A;  2R3Z A;  2DY8 A;  3A56 A;  1QOH A;  1ET9 A;  1SSO A;  1YNN D;  4IZ8 A;  5ISR A;  4KV6 A;  1MSG A;  4FP5 D;  5FLX E;  4J6H A;  1WTX A;  3MXG A;  2WII B;  1ESR A;  3OMG A;  2CW0 C;  1UNS A;  3H91 A;  1DCZ A;  3FVQ A;  4J1M A;  1I3Q B;  5T1I A;  3X3N A;  2N88 A;  3QWN A;  1Y8P B;  5JAV A;  1HA6 A;  1FGB D;  5EGT A;  2EYL A;  2RA4 A;  4ABN A;  1FD7 D;  3D4W A;  4KY5 A;  2ID0 A;  2FMC A;  1W6K A;  3TZD A;  2PPB C;  4I7Z C;  4C3J B;  4QF4 A;  2NVY B;  3I72 A;  3FKI B;  1Z6H A;  1T5X D;  5JPM C;  4NDX A;  1H9K A;  4CKE A;  2ENB A;  1F2M A;  1D5M C;  5M5X B;  4RFB A;  4RCN A;  4DU9 A;  3DWQ A;  1SYD A;  3V05 A;  1SYG A;  4HMI A;  3LWE A;  3BVM A;  5E4W C;  2Z1C A;  1WCM B;  1JB3 A;  2B8G A;  5ELD A;  4FXG C;  1SYC A;  5DM7 3;  1WD0 A;  3MWY W;  1I4P A;  1JOO A;  1MD2 D;  5C0X I;  4KN4 C;  1D6E C;  1PFM A;  2SNS A;  2XSC A;  1HRJ A;  4C3H G;  3R2T A;  1HPC A;  1X3Q A;  5CV9 A;  1LT6 D;  2N55 A;  3P20 A;  3J7A V;  4FYD A;  3J80 E;  2X6L A;  2KED A;  2RDF A;  4ULL A;  4L8J A;  1BCP F;  2IW3 A;  1RHP A;  1PYW D;  2EYJ A;  3M7N A;  3E6Z X;  5I2Y A;  1S5B D;  1YNJ D;  4RGT A;  1HA5 A;  5COY A;  2SNM A;  3ND8 A;  1B9M A;  4ZQ3 A;  4BWG B;  3J7Y W;  1HUN A;  2IPK D;  3H94 A;  1HCZ A;  4KHV A;  3TZU A;  2KCN A;  2F0T A;  1JWS D;  2AUK A;  4HR7 B;  4DF7 A;  1SYF A;  1EU3 A;  4F87 A;  1PZJ D;  2KEE A;  4C3I B;  4C56 C;  4ILW A;  4PMC A;  2JXM B;  1VMC A;  2KJX A;  1ILP A;  1TWG B;  3Q6S A;  1QE6 A;  5HGT A;  1JC7 A;  1BUV T;  4Y7N B;  1EEF D;  2VNU D;  1PFN A;  3GTG B;  3QB3 A;  1FNW A;  1STN A;  2JA8 B;  3S1M B;  2NVQ B;  2A6E C;  4OO1 G;  2JEA I;  2NN6 H;  1ICW A;  3BS1 A;  4PMW A;  1D1I A;  5I4D A;  3W3A A;  1Z7T A;  3SDZ A;  1EFI D;  2NN6 I;  3WOF A;  1X32 A;  2QDB A;  5FLX L;  2BDN A;  3D6W A;  4KY6 A;  3GTO B;  1EZ6 A;  3F2U A;  2XWJ B;  3NTH A;  4IUN A;  3GTM B;  4A3D B;  2EOT A;  1DON A;  1G8Z D;  4N9P A;  5EBC A;  1A15 A;  1DOK A;  4KY7 A;  1C48 A;  2MPM A;  4KI0 A;  2F1M A;  2EDG A;  2XVS A;  3NXW A;  3GV3 A;  1LAB A;  1VF7 A;  1LT3 D;  3H3V C;  3M4Y A;  1Z47 A;  2B2W C;  4Q5V A;  2LY7 A;  4XTC S;  3ITP A;  3S1Q B;  2BCO A;  1SJE D;  4HCS A;  1GUT A;  1PFB A;  1SNC A;  5IGE A;  3KLR A;  1JOK A;  1XXG A;  2K32 A;  1PTO D;  3NE5 B;  4RGN A;  4MIU A;  4A3E B;  4K5X A;  1G91 A;  1KNE A;  1M4V A;  3BDO A;  3D8G A;  2XNA C;  1OXS C;  1QJO A;  1Y69 U;  1CQV A;  1WTW A;  3D31 A;  1HQR D;  2QKI C;  3A8J E;  3RD4 A;  3ZYY X;  1S5F D;  3T13 A;  2ZXR A;  5JJZ A;  5CV5 A;  3G7L A;  1BOS A;  3T56 B;  4HMJ A;  5G3L F;  5CYU A;  2IWH A;  4IUR A;  5K5P A;  5K36 G;  3L3O C;  3A7A B;  2RKS A;  3T51 B;  2VB2 X;  5M3F B;  3SK5 A;  1B1Z A;  3OIQ A;  3K59 A;  2F3V A;  1TU2 B;  1JR0 D;  1OXV A;  1BBX C;  3GTQ B;  1XX8 A;  1SNP A;  1BF4 A;  4FF2 A;  3ERQ A;  4K2K A;  1SMY D;  4CGY B;  2EPB A;  1EU4 A;  4N9T A;  2LS0 1;  1L0Y B;  1BDO A;  4FXK C;  2AQ2 B;  3HOX B;  3BZD B;  4DK1 A;  3DXJ C;  3KLS X;  3J80 L;  1MI2 A;  2F0H A;  3Q24 A;  1T5E A;  2WB1 B;  3OWE B;  4XQJ A;  2F4I A;  3X3M A;  4ZK9 B;  2L55 A;  2VUM B;  4L63 B;  2E76 C;  2LMC B;  3GV6 A;  5KRU A;  3N6R A;  2B2T C;  5ELB A;  1B53 A;  2EY1 A;  5D65 A;  1ROD A;  1QNK A;  4E6I A;  1F2L A;  3FDT A;  2NVX B;  5C0X J;  1ZYR D;  5C0X G;  5AFW A;  3QOL A;  1LTA D;  1QNU A;  1BNZ A;  4QUC A;  1JWM D;  4QCL A;  1BQQ T;  2EY6 A;  4ZRZ A;  1SYE A;  4DGZ A;  3C46 A;  2ICI A;  4L6T B;  5C3E B;  4A3M B;  2HDM A;  3TP8 A;  4RWS C;  1VMP A;  3AU7 A;  3RZD B;  1J9O A;  1DOM A;  4C1N K;  2RBM A;  5BN5 A;  1PRT B;  5DEH A;  2RQX A;  2TSS A;  2KQ3 A;  2F0E A;  3VR6 A;  2F0Q A;  5LHY 1;  1OXX K;  2X6G A;  2E2J B;  5I6W A;  1MSH A;  3J7A F;  3K0Y A;  2EYF A;  3HZX A;  1CTM A;  5COR A;  5J39 A;  3T53 B;  3CRL C;  1U4R A;  1TT2 A;  2E2D C;  4LMQ D;  3VA7 A;  2K5Q A;  3BYY B;  3HOZ B;  1TWF B;  4KHZ A;  2E75 C;  2HUG A;  1SNO A;  2D5D A;  4B9W A;  5IGF A;  2K6A A;  2QIL A;  3DUZ A;  1NCV A;  4R8N A;  5KEE A;  5EKI A;  1BXT A;  1LO5 D;  2KA7 A;  1D1K A;  2MJ8 A;  2F0O A;  3RLF A;  1ENC A;  5D14 A;  2IX1 A;  1ONL A;  2O2L D;  1KDA A;  2LFN A;  2E74 C;  4X3U A;  5J22 A;  3W2D A;  5CC4 A;  3FEW X;  5FO8 B;  1LTS D;  5IOD A;  2HCC A;  4I65 A;  2SOB A;  1GJX A;  1ENA A;  2KCC A;  5I6Y A;  1G2T A;  1D5X C;  3KBX A;  2AQ1 B;  4RGO S;  3P75 A;  5IGD A;  2BE5 D;  3K7A B;  4K6D A;  2ZT9 C;  2IT1 A;  1PLF A;  3FPU B;  3M3Y B;  4TSS A;  3BVG A;  2XRQ D;  3I70 A;  1HFG A;  1C4Q A;  1EQV A;  2K03 A;  1Y1W B;  1MGS A;  4XIG S;  3NTI A;  5CBE E;  1RCV D;  1U9R A;  1CM9 A;  2JA7 B;  3C3L A;  2NB0 A;  2M9V A;  4IQZ A;  3R93 A;  3CU7 A;  5KGU A;  2NZ1 D;  1R4Q B;  2RVL A;  1K8O A;  5TSS A;  1LT4 D;  3P1H A;  5K36 H;  4CKB A;  2O4X A;  4CJ1 B;  2PZW A;  5KNC A;  4ZYS A;  1CT1 D;  5IOC A;  1A2U A;  1IW7 D;  2B8F A;  5C5L A;  3DWP A;  3RUZ A;  5CR3 A;  1NR2 A;  1RTN A;  3MAQ A;  4IUV A;  3Q22 A;  2BA1 A;  2Q8T A;  5C3X A;  1Q12 A;  1F9P A;  1SDF A;  4KN7 C;  2Q8R E;  1F9S A;  3UI2 A;  4KTA A;  4IUU A;  1LAC A;  5HUR A;  2AWO A;  5DNF A;  4ZLT F;  2FHT A;  2MP1 A;  1H9S A;  1CFM A;  2F0S A;  1B44 D;  4RKL A;  5FOB B;  1O78 A;  2RSN A;  4RKB A;  3CRK C;  1TWA B;  2J0T D;  2KVM A;  2A73 B;  3NBI A;  2XWB B;  1YNJ C;  1AZP A;  2SEB D;  2KUM A;  2L12 A;  1U4L A;  2B2Y A;  1FNU A;  1EY8 A;  5C0X H;  1NR4 A;  2PO4 A;  3NHH A;  4EVO A;  4C3J G;  3J81 E;  3AB9 A;  3C2P A;  4CBV A;  2I07 B;  5CBA E;  5M3M B;  2FFK B;  4A3F B;  1WD1 A;  5CV7 A;  2F0D A;  2JP1 A;  3DEO A;  2JEB I;  1PTO H;  3BYT B;  4RH6 A;  1H9S B;  1B50 A;  4F8M A;  5CV8 A;  4PQX A;  3Q23 A;  1I50 B;  4P2C B;  4HED A;  2F0K A;  2EY5 A;  3T4A C;  1VDZ A;  3HS0 C;  1FNV A;  3EJI A;  3OW7 A;  3K57 A;  1EL0 A;  1A3U A;  3I4M B;  5M5W B;  2FMM A;  1K8M A;  3D4R A;  3PO3 B;  2K01 A;  3D6C A;  1Y8N B;  2PQE A;  1DZ1 A;  1TY2 A;  1I4H A;  1U4P A;  3NK9 A;  4BS9 A;  4O42 A;  1V8Q A;  3C1F A;  1AZQ A;  2EJF C;  2VB3 X;  4RAU C;  3PIO 3;  2M2L A;  4H7B A;  1KNA A;  2L9H A;  1HXY D;  3S14 B;  5EJW A;  2Z4I A;  2GA4 B;  1LT5 D;  1CI3 M;  2Q8I B;  3K58 A;  1F2Z A;  3QO2 A;  1GXD C;  2F0N A;  3CHB D;  2KEC A;  2DN8 A;  1PTO C;  4IFD H;  3PUX A;  2ICE C;  5KIX A;  4YIJ A;  4EQP A;  3NQI A;  1PDQ A;  1I4X A;  1J8I A;  4XQN A;  1LLR D;  4QB4 A;  5LL6 S;  3NUC A;  4IFD I;  2Z8L A;  3VYU A;  3SVM A;  3PIP 3;  3K6O A;  1LTT D;  3NWT A;  3I4N B;  2M00 A;  4IN3 A;  4XXE A;  1EY9 A;  4BY1 B;  1A2T A;  4C3I G;  3BG3 A;  5M5Y B;  3K5M A;  5C6A A;  4G4K A;  4FXD A;  5EKL A;  5EBD A;  2PZT A;  3TME A;  2E2H B;  2OF1 A;  1QIL A;  3VYT A;  3CKI B;  1D2B A;  1EIH A;  4F88 A;  3OWF A;  1AP0 A;  4OL7 A;  2RSO A;  3PUW A;  3TBI B;  4ZUJ A;  3DEP A;  3MA2 B;  3P7J A;  2F0M A;  4G7O C;  1EY0 A;  2JSO A;  4PV1 C;  4K14 A;  1F77 A;  4FO2 A;  3K5L A;  1XYI A;  1NSN S;  4C2M B;  1VCI A;  1SMY C;  1NAP A;  1AFP A;  3MTS A;  5CV4 A;  4XT3 B;  1EY5 A;  3DMU A;  4ID6 A;  2H1E A;  3OMC A;  1DM0 B;  4NW2 A;  5JOB A;  3NQT A;  1V1P A;  4U68 A;  3M7G A;  3GTJ B;  3HG9 A;  2F0L A;  3SR1 A;  2K33 A;  4DAP A;  4J8Q A;  1O7Y A;  1CQF A;  1TWC B;  3MVV A;  2L0C A;  1E2V A;  1BO0 A;  3URY A;  1HQM C;  3GQB A;  4ZAI A;  1EWH A;  2KHS A;  1ZYR C;  2DNC A;  2V4D A;  2PYK A;  4EQN A;  5C3W A;  2CHB D;  2LKV A;  1KLU D;  3HRZ C;  3BDC A;  1PRT D;  3QOJ A;  4G7H C;  2R61 A;  2DY7 A;  3NBH A;  5C4H A;  3R3O A;  2WAQ B;  2HQE A;  3S17 B;  3MFG A;  3J81 L;  4BA1 I;  1G6Z A;  3H0G B;  5CGK A;  2WKD A;  4JBW A;  3TSS A;  2VXW A;  4UDU C;  3QIA A;  3S9W A;  1PXU A;  3OSO A;  1CK1 A;  2WP8 J;  3U9S A;  2F3W A;  1V1P B;  4XQQ A;  2I46 A;  4G57 A;  1EQT A;  4HAE A;  2SDF A;  2YYZ A;  1ZEQ X;  4V19 0;  3WDN A;  3TP5 A;  2R92 B;  1PTO F;  1GHK A;  5T1G A;  1Y1V B;  5FK9 C;  1IKM A;  1EYC A;  1Q8I A;  1SE3 A;  3S16 B;  4WJW A;  1LTG D;  2B63 B;  1JQY D;  4JK1 C;  1SFO B;  1E2Z A;  2D62 A;  5IGC A;  5LL6 X;  1S5D D;  3OPO A;  1C8C A;  1TS3 A;  5JEA H;  2EE1 A;  4TRD A;  5JVG 3;  4XDX A;  2NWG A;  4GZY C;  1KDC A;  2CVR A;  2K04 A;  2EYM A;  3CQZ B;  1I6V C;  2Y0S B;  1QWY A;  4M8A A;  2QCP X;  4QMG A;  2FIN B;  1I4G A;  2RDG A;  3LX0 A;  5EPK A;  1LTB D;  4KKS A;  3SE0 A;  3SK6 A;  5FO9 B;  1L0X B;  3A54 A;  5EPJ A;  3SK8 A;  3K5O A;  3EQL C;  5D3D A;  4F7X A;  1ENF A;  2BE5 C;  2NBF A;  2JE6 I;  4G7Z C;  3PUZ A;  5KYL A;  1NUC A;  1QG7 A;  2XN9 C;  1KDB A;  4FNF A;  4KD3 A;  4DNT B;  4XYQ A;  4RA8 A;  5C4Z A;  4TQU S;  4S3S A;  1SNM A;  3MEH A;  3I4L A;  3NPP A;  2IX3 A;  5C4X B;  2PNR C;  2B2U A;  1B9N A;  5C5M A;  1JOQ A;  3SEB A;  1SYB A;  2PCF B;  3FMC A;  1CZG A;  2AWN A;  4LJZ C;  1IW7 C;  4OGQ C;  1ZXT A;  1GUO A;  4DXF A;  4PNY A;  4EQO A;  2DNE A;  4TKO B;  1TY0 A;  5ELF A;  4IFD J;  2HCI A;  1H9J A;  2B2V A;  2HDL A;  4IFD G;  4H44 C;  3IFD A;  1TS4 A;  2EYO A;  4DXG A;  5E4X A;  2X69 A;  4CHT B;  4DAY A;  3FRP B;  3S2D B;  3L7Z C;  5DAU A;  1O7Z A;  1KAB A;  3R8B A;  2B2T A;  1EY6 A;  1OO9 B;  2BA0 A;  4XYO A;  5ELE A;  1DJR D;  1PMR A;  5BN3 A;  5J1Z A;  1LTR D;  4KD4 A;  1CA5 A;  2F0U A;  4DK0 A;  4B08 A;  2IX0 A;  2C9O A;  1SND A;  1DD2 A;  4ZKB B;  1AW7 A;  1M8A A;  2AUJ D;  2PZU A;  4FVM A;  1GUW A;  3I90 A;  1RKN A;  3MXN A;  5KYI A;  1I4Q A;  1IL8 A;  4WRD A;  1WTQ A;  1WTP A;  1HHV A;  1S5C D;  3T16 A;  1RDP D;  2WKC A;  3A8I E;  3IKJ A;  1IYU A;  1D5Z C;  1EIG A;  2L5T A;  3KK7 A;  1K83 B;  1DYQ A;  2WIN B;  4MN3 A;  5I2X A;  1DXM A;  2L11 A;  4Q0F A;  4R8I A;  4RHR A;  5A2Q E;  1KAA A;  3L9A X;  1QCB D;  4K8J A;  2OXP A;  4BY7 B;  1TS2 A;  1STB A;  1A6X A;  3ND9 A;  3HKZ B;  3KBG A;  3HOY B;  3PUV A;  2IJ0 A;  1BCP D;  1TWH B;  1E2W A;  3HEJ A;  3D4D A;  4KKT A;  1CHQ D;  1DOL A;  2K1B A;  3ONA B;  2WV6 D;  1UUP A;  1SJH D;  2MHV A;  1RTO A;  3NSW A;  1ILQ A;  2EYP A;  4O1N A;  1FYC A;  1EOT A;  4C3H B;  2PW7 A;  1IHZ A;  2K05 A;  3S2H B;  1EWC A;  2EZV A;  4A93 B;  2JA5 B;  1U4M A;  4K5W A;  1WTR A;  2MUY A;  2CW0 D;  1I4R A;  1STY A;  1AN8 A;  2F0I A;  1V43 A;  2WAC A;  3MZ5 A;  3G6J B;  3C1E A;  3D3R A;  1CA6 A;  2NUC A;  1Q1B A;  1VF5 C;  3PMF A;  1B2T A;  4OIJ A;  1CHP D;  5JVH 3;  4BBR B;  1H9M A;  5IT9 L;  2BOS A;  5KND A;  1S4Z A;  4FF3 A;  3O13 A;  4H0L C;  1EY4 A;  4KKU A;  1H9R A;  5JEA J;  1STE A;  2L1B A;  5IGB A;  5JEA G;  1Y8O B;  1SXT A;  3A7L A;  3K5N A;  3RMH A;  2QEJ C;  4CKC A;  2EYH A;  5I9O A;  1BCP B;  3EVQ A;  4FF4 A;  1F9Q A;  2A6H C;  2KOL A;  3VR2 A;  2Z4H A;  4ODG A;  1E0B A;  3S15 B;  2JA6 B;  3TN2 A;  2A69 C;  2EVB A;  3I73 A;  3I91 A;  1ESF A;  1ML0 D;  4KJO A;  1EZ8 A;  3MFY A;  2XRS D;  1TII D;  3DM1 A;  3VA5 A;  2BDO A;  3PV0 A;  3BDL A;  5E3F A;  4DAV A;  2B39 A;  4K8I A;  1O7L A;  1KLG D;  3IAY A;  2PW5 A;  3SXH A;  1IYV A;  4Z9C B;  4M1U B;  1Q1E A;  4ZUI A;  4IUP A;  4RHS A;  5E1F A;  3HOU B;  2NTT A;  1TKW B;  5FKA C;  4B9X A;  3QG1 A;  1A3V A;  2H4O A;  1ZKO A;  3JAM L;  4KMU C;  2J7Z A;  2OEO A;  4V0B A;  4ME5 A;  2K28 A;  3TP7 A;  1GUN A;  2G9D A;  1TQO A;  4K6L A;  2F0V A;  1CZW A;  4U67 3;  1PRT C;  5G3L D;  3SHL A;  4DFA A;  2CQA A;  3OIP A;  2AQ3 B;  4HN7 A;  5CMD A;  1TS5 A;  2QF7 A;  2A74 C;  1IKL A;  5I9P A;  4A3K B;  1JCK B;  3HOW B;  2A6H D;  1JOR A;  4MHE A;  3HP3 A;  4NMZ A;  3V96 A;  2JYO A;  4LAA A;  2D9U A;  4RCO A;  2YU9 B;  4IUT A;  2A69 D;  1JIC A;  2A5H A;  2G9H D;  2O5J C;  5BN4 A;  1HFN A;  1LV9 A;  5A2Q L;  4A3B B;  2F03 A;  2RDH A;  1WTO A;  2EJG C;  2O5I C;  4X3K A;  4X3T A;  5DM6 3;  4IAL A;  2ZXP A;  5F2D A;  3H09 A;  1F9R A;  2ZXO A;  4K2L A;  3H6M A;  1GOZ A;  3GO5 A;  2A6E D;  3QJY A;  1KTK A;  5CV6 A;  3S1N B;  3U9O A;  4C1N I;  2PMZ B;  3GD7 A;  1TVX A;  1R9T B;  4NKL A;  3DHQ A;  1X3P A;  1II3 A;  1PZI D;  3N52 A;  4KK7 A;  2K5D A;  4WOR A;  1A3T A;  2R6G A;  3PUY A;  3V2T A;  1V1O A;  1SBB B;  4DA2 A;  1XWE A;  1WVL A;  1GHJ A;  3VR5 A;  4KJN A;  1EYD A;  2MGS A;  1SAP A;  3VYR A;  4LK1 C;  3EA6 A;  1GUG A;  2F0W A;  3A55 A;  4BBS B;  1OXT A;  3SK4 A;  5KNB A;  3M4O B;  3A8K E;  2B2U C;  3OHX C;  1WTV A;  2K5W A;  1R4P B;  4EGV A;  1RF2 D;  2XIW A;  2TMP A;  3HGB A;  4CJ2 C;  2NYZ D;  1HTL D;  1SE4 A;  3M85 A;  3E5S A;  3NWS A;  4QIW B;  1LTI D;  1STG A;  2E2I B;  4ZKC B;  3Q0A A;  4HSP A;  2D2C C;  1B4O A;  1B3A A;  1HUM A;  2B2V C;  1XTC D;  2F0F A;  4FF1 A;  3GTK B;  3TDQ A;  2C5C A;  3MC0 B;  5EQ0 A;  3S1R B;  1AEX A;  4A3G B;  1SEB D;  4CJ0 B;  2K7V A;  5JPN C;  2A68 C;  4IUQ A;  5EPL A;  4UAI A;  2F0J A;  3GTP B;  3I3C A;  1STH A;  4K5V A;  4A3I B;  4HCE A;  1PTO B;  1O80 A;  3NTK A;  4PMB A;  5C4J B;  3FPP A;  2B2W A;  4HSV A;  5IIF A;  4AYB B;  1RD9 D;  3IFT A;  1PRT F;  3OOC A;  1GUS A;  3GTL B;  3PO2 B;  2J4X A;  3GP7 A;  2NTS A;  2OT2 A;  4OIK A;  3R2I A;  5C44 B;  1EY7 A;  1W6J A;  5NUC A;  1STA A;  5A35 A;  1SNQ A;  1Q3L A;  3E0J A;  3IL8 A;  1ET6 A;  5EKK A;  3RZO B;  1G29 1;  3MHB A;  3NP8 A;  4RGM A;  5FO7 B;  3TP6 A;  3VR3 A;  4NP5 A;  2F0P A;  5IT9 E;  1JE4 A;  1BR9 A;  1F2Y A;  3ERO A;  4X3S A;  5IGG A;  2EXZ A;  4OO1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...