5CORA

X-ray structure of macrophage inflammatory protein-1 alpha (ccl3) n-terminal-switch polymer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
b'ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 3
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 16
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5corA00
1NR4A 1X3QA 4DN4M 1B3AA 2NZ1D 4IUVA 2KEDA 1O80A 5DNFA 4R8IA 1RJTA 1HHVA 4RA8A 2BDNA 3H91A 2NWGA 1F9SA 1F9RA 2K1BA 3D6WA 1F2LA 2SDFA 5EQ0A 1EIHA 2B2UC 2XIWA 1MGSA 1RHPA 2IL8A 1MSGA 1G2TA 1VMPA 1G2SA 4HSVA 3MTSA 4HCSA 4X3UA 2X69A 1WTQA 1B50A 1F9QA 5AFWA 1AP0A 3FPUB 1SSOA 3UI2A 2R3ZA 5T1GA 1WD1A 1NR2A 1WVLA 3KUPA 2X6LA 3I91A 4RWSC 1RODA 1KNAA 3ONAB 2K04A 1X3PA 1C8CA 1G91A 3QO2A 4X3KA 5E4WC 1A15A 4O42A 1G6ZA 2B2TC 1B53A 1WTRA 1ICWA 2B2WC 2H1EA 2EPBA 1B2TA 1PDQA 1U4MA 4U68A 2MJ8A 5E4XA 2HCIA 1BO0A 1EIGA 4HAEA 2EE1A 3TN2A 1O7YA 5CORA 4NW2A 4RAUC 3R93A 4ZK9B 1RTOA 2JYOA 2B2UA 1M8AA 1HA6A 1QG7A 1WTPA 2KVMA 1HUMA 2KEEA 4HEDA 2RSNA 1VMCA 2NYZD 5JJZA 1CA6A 2HDMA 1RTNA 3HP3A 3IFDA 1QNKA 1XX8A 3G7LA 4MN3A 1DZ1A 1HFNA 4CJ2C 3LWEA 2K03A 2B2VC 3FDTA 5D14A 2VXWA 2DY7A 4CJ1B 1DONA 4OIKA 1WTVA 3I3CA 4XT1B 5D65A 4XT3B 5CBEE 1ML0D 2L11A 2RA4A 2RVLA 1EL0A 2HCCA 2K05A 1WTWA 3DEPA 2B2TA 3KBXA 1Q3LA 2B2WA 1PLFA 1KNEA 1WD0A 4QUCA 1J9OA 3MWYW 1GUWA 1BF4A 4CJ0B 2K01A 1EOTA 1TVXA 1U4PA 2MP1A 1U4LA 4IUPA 1J8IA 1MI2A 1QE6A 2FJ2A 3I8ZA 2MPMA 4OIJA 2FFKB 3DM1A 2FMMA 3TZDA 1MSHA 1PFBA 4UAIA 1U4RA 4X3SA 5EPKA 5CBAE 1HRJA 2DY8A 1F9PA 2B2YC 2M2LA 2KOLA 3Q6SA 2CVRA 3SVMA 1HUNA 1DOMA 1BBXC 1PFNA 1ILQA 2FINB 4IUUA 2B2VA 2KECA 3GV6A 1PFMA 3IL8A 1LV9A 2L1BA 1IKLA 1DOLA 1CA5A 1AZQA 2MGSA 1EQTA 4ZKBB 4R9WA 2X6GA 3N52A 1O7ZA 1E0BA 2L4NA 1ILPA 2HUGA 3P7JA 5EPLA 2KUMA 3DEOA 3I90A 2L9HA 2Q8TA 5EPJA 1JE4A 5CMDA 1BNZA 1DOKA 1NCVA 5T1IA 2D9UA 2JP1A 4ZAIA 2RSOA 1HFGA 4XDXA 1NAPA 1IKMA 3F2UA 4ZKCB 4LMQD 1X32A 4X3TA 1WTXA 1ZXTA 1CM9A 2J7ZA 1IL8A 4IUTA 4IURA 4MHEA 1SDFA 5COYA 2FHTA 5EKIA 1WTOA 1JICA 4ZLTF 1ESRA 4QUFA 1SAPA 2EOTA 2HDLA 2N55A 1B4OA 1S4ZA 2B2YA 4IUQA 3GV3A 2L12A 2K28A 1XYIA 2N88A 1AZPA 5EJWA 2Q8RE
chains in the Genus database with same CATH superfamily
3VR4A 1RD9D 3ZYYX 4R8IA 1VQPA 1E2WA 4YY3L 2Z1CA 3I4NB 2F3WA 1VQIA 1Q8KA 2F1MA 3ND9A 3Q22A 3H3VC 1MGSA 2HHHQ 3PCOB 4JI8L 4B9XA 5JAVA 3G71A 4KN4C 2IW3A 1CQFA 1SYGA 2RDHA 2JJQA 3S16H 5M3MG 3A0JA 3I4MB 3W5OA 3U9SA 1B53A 3EN2A 5A35A 1VQ9A 1DGSA 2H5XA 3J81i 1IYJB 3MHBA 3LWUA 2EZVA 1KQSA 2YTVA 4LFAQ 3MC0B 4KHVA 2F0JA 3GTJH 2UXDL 4NKLA 1MKHA 3URYA 2RBMA 4B3RQ 2RF4A 3T13A 2B2VC 3VR2A 4A3BH 1YIJA 3J7AV 4GN5A 4DXGA 2ID0A 2JA7G 4HMIA 2RVLA 4C3IH 1KABA 3KBXA 3J80i 4A3LH 4LF4L 2ASBA 3WOEA 1XMQL 1YHBA 1RDPD 4DAPA 3PIP3 4JOIA 4LF8Q 1J8IA 3FKIB 5J22A 2AUJD 2DGYA 4GKKQ 3GTGB 2B39A 1K8MA 2QW7A 3AB9A 1F77A 2A69C 2A19A 2KOLA 2A8VA 3S1MB 2K75A 1QUQA 4G7ZC 1KDAA 4KI0A 3M3YH 2Q2IA 2JXMB 4LUVA 3Q0AA 1DOLA 1IBMQ 3PUWA 1K0SA 2MGSA 3ULPA 2AWOA 5C4XB 1AFPA 3P7JA 3RZOH 1EQVA 2B63B 2CQOA 4JPBW 2CW0D 1H9MA 1SE3A 4A93H 1HFGA 4G57A 5J39A 2VY3A 1B7YB 3KLSX 5BN4A 5C0XH 3GTQH 4L8JA 3PUVA 4I7AA 3H0GH 1S4ZA 5FOBB 4RCOA 4IPDA 1QNUA 2Q8RE 3KF8B 4OWWB 3P1HA 5IP9G 1B3AA 3TDQA 3OIPA 1KLUD 4A3IB 3A5UA 2OWOA 1SBBB 1CKNB 1UWVA 1EQQA 3F2DA 2VQEL 2F0HA 5K5PA 2HIVA 2KBNA 1WVLA 3V05A 4XYQA 4R4TA 1KNAA 2D2CC 1JCKB 1KL9A 4EGVA 4A3BG 4K6DA 4LF7Q 1I50B 3DXJC 4C3IG 1YNNC 1JB7A 3JAMc 1Q1EA 2HD3A 3CKIB 5BR8Q 4H0LC 3MEHA 1PTOH 3K80C 1IL2A 4DR6L 4JI2Q 1IXRA 1CSPA 4CDDC 3CCMA 3R3OA 2KVMA 3VYTA 3KJPA 2EY6A 2NYZD 5AJ3L 1DZ1A 1X54A 1QNKA 1XX8A 5FLMH 2F0WA 4DV3Q 1EY5A 1PRTD 4JG2A 2XTIA 3E9IA 1LABA 2E2IH 1LACA 1TWFB 4Q5VA 4F87A 2F0MA 3D4WA 3I3CA 2VQFQ 1JOKA 2L11A 3T56B 2ICEC 1BVSA 2B2WA 1K73C 1WD0A 1E22A 1BF4A 1X55A 4UP7A 1SYBA 2K01A 1B1ZA 4FP5D 2A5HA 3I56A 3I4NH 4GKJQ 2F4VL 3RR5A 1MI2A 4JI4Q 4OIJA 2FFKB 3HOYB 4B3MQ 3J7AF 4A93G 1N33Q 5C0XG 1VQ5A 3ND8A 1EWCA 4HSPA 1UUPA 3VA7A 3MXGA 1Q7YC 4DA2A 4GOPA 1X9NA 1TT2A 4N8X1 3SK4A 3NBIA 3EVQA 4AQYQ 1CA5A 1LTSD 3AFPA 1STEA 2WKDA 5IP7G 5GAHC 3I4MH 2HUGA 3SE0A 4JC0A 3QWNA 3E3XA 1XNRL 1GHKA 1A2UA 2QDLA 1NAPA 4DV0Q 4YWMA 1I3QH 3M4QA 1ZXTA 2A68C 4HN7A 4LF5L 1STBA 2N3SA 1VQJA 4X65L 1LT4D 3CPFA 4R8NA 2WACA 1OXUA 1A3UA 3AEVA 3J7YW 3M85A 3S2HH 3U4ZA 1DXMA 4IUNA 4XT3B 4AIMA 4BBSB 3K5NA 3S17H 1HHVA 2M00A 4JI5L 2UUCL 1EYDA 1B70B 5C0XJ 4Z9CB 1K3BC 2MO1A 1TWCB 1K8AC 1P8LA 4XYOA 3OWEB 4IFDI 2C9OA 1NJIC 3MAQA 4RWSC 2ATWA 3GTGH 1BOSA 3J81c 1Y14B 2PW7A 4YCWA 5FLMG 4RHSA 1GXDC 3S1MH 1STHA 3TS0A 3T1HQ 4L6TB 3K5OA 4QCLA 2H1EA 4DUYQ 4G7HC 4AYBE 3X3MA 1Z47A 5JVH3 2HCIA 2Z0SA 2UU9Q 1O7YA 1HNWQ 3VYUA 1K0RA 4ZK9B 3I4NG 1RKNA 2B63H 4P75A 2KEEA 2RSNA 4K5VA 4QL5A 1N8RC 1CA6A 4X64L 5IIFA 4NXNQ 4WJ4A 4YY3Q 3J80c 4BY1B 4CKEA 1J6QA 3K0YA 3A54A 1W2BA 1JORA 4DV2L 2KCTA 5FK9C 1G6PA 5ISRA 4ALPA 4JI8Q 5HURA 1V43A 1Q3LA 1EYGA 1HR0L 4M1UB 3I4MG 1NNXA 3ULJA 1JJCB 3A8KE 4A3IH 3FPPA 4HCEA 3UDIA 2FMMA 3IFTA 3MVVA 2A73B 1F9PA 1I4HA 5ELOA 1PV4A 1PFMA 1BUVT 1A0IA 3F8TA 3EFXD 2K5VA 4KTAA 2AKWB 5M5YB 2RDGA 2BE5C 2UXDQ 2BDOA 1D5MC 1TS2A 3K7AB 3NE5B 4KY6A 4RCNA 3GTMB 1V1QA 4A3CH 2E2DC 4RFBA 2MFIA 4QIWE 4IUTA 1H9RA 4IURA 1Y8NB 2Z9HA 4JBJA 3Q24A 3S14B 3FKIG 3RUZA 3KFUA 2B2YA 1GD7A 4FF2A 5KNBA 5ELNA 1TWFH 2NZ1D 5A2QL 3KK7A 4RA8A 2BDNA 2RHQB 2NWGA 4NP5A 2XVSA 1O7IA 1EZ8A 2UXBL 4DAYA 5C4XG 1EIHA 1CKMA 3HFZB 4PMBA 1PH5A 3RZDB 4DV4L 1LUZA 3NP8A 1SJHD 2B63G 1I6HH 2E5LL 2PQEA 3A5ZB 4X66L 1RODA 4RG1A 2ZJQA 1A62A 1HNXQ 2PNHA 4RGOS 1C8CA 4A76A 4L5TA 5C44B 1ICWA 1TWGH 2E2JB 3K6OA 3QR8A 2R92B 1A6XA 1VQMA 3CRLC 3S24A 2EE1A 2R7ZB 3TN2A 5CORA 5LMNW 3UDXA 1E3PA 3ER0A 4BXXH 1WYDA 3JAML 1SNQA 4MIUA 3VYRA 3IFDA 1XWEA 3G7LA 1D8LA 4CJ2C 3W1BA 1LLRD 1YNXA 2F0VA 1PMRA 4C1NK 5IWAL 2VQEQ 1BDOA 4KY7A 2V1CC 3F1ZA 4BBSH 1LTLA 1KRTA 1U4PA 2MP1A 2KHJA 3IRBA 3B6YA 1LTTD 3DM1A 4L5QA 4FXKC 4X3SA 1GVPA 3KLSA 1TWCH 3W2DA 1XXGA 2JA6H 3DMUA 1K28A 1P16A 1Z7TA 2FINB 5KYLA 3F2BA 2CH4W 2G9DA 1LV9A 3CCLA 3NELA 5IYDH 2PZTA 1YZ6A 1D5ZC 1BKBA 1R9TB 5JEAJ 2KENA 2V4DA 3H94A 2PW5A 2NVTB 1GUSA 4FF3A 1NY4A 1NCVA 3VA5A 5T1IA 2D9UA 2ENBA 2F0EA 2L0CA 1NUCA 3F2UA 4LMQD 3G6JB 4ZQ3A 4J15A 4QY7A 2R7FA 3HOYG 1EQRA 2EOTA 2HDLA 1EEID 2DN8A 5C5LA 3K5MA 4IQZA 4BY1H 1KLGD 1EFWA 1VQ7A 2K6AA 4LUZA 3M4YA 4DV6L 1TKWB 2Z6BA 3D6WA 1E2VA 4CKBA 1CKOA 1SJED 5ELEA 2WFWA 4IPCA 1SYCA 3O13A 1TU2B 2PCFB 5CR3A 1R4PB 3CRKC 2UUBQ 2QEXA 1SN8A 3CQZB 3SEBA 3KOJA 3QO2A 4B9WA 2UXCL 1Q8IA 2EJGC 1PVOA 1V1OA 2UUAL 4I65A 2WB1E 1EEFD 5K36H 3J81L 1VQ8A 4LF5Q 3CCRA 5M5YH 2AUKA 4X65Q 5IYCH 2JA8B 1SNMA 1ZEQX 1I4RA 3K7AH 2FXQA 5JVG3 4HIDA 2E2HB 3OMGA 3DWQA 1D6EC 2IHFA 3GTMH 2F0UA 1QG7A 3TEHB 4H02A 1VMCA 1PH7A 3SXHA 4GNXB 1V9PA 2PZUA 3U50C 3F2CA 2AMCB 1T5XD 2Y0SE 4JI5Q 2UUCQ 3K58A 4DR4L 3P20A 1GUNA 1A3TA 4RKBA 4YCUA 4B3SL 5IYDG 4OONA 5F2DA 3HOWH 3J80L 3WDNA 3RZOB 3EA6A 3BDCA 4WFN3 4DKAC 4UPAA 1XNQL 4L63B 3GTPB 4IOCA 3A8JE 5ELCA 5I4DA 3H09A 3H0GB 2F0NA 1I4QA 3RZDH 4KHPL 1L0XB 1WOCA 2E74C 1PHJA 3M7GA 2RCNA 3BDOA 1VCIA 2B2VA 2K5QA 1FVIA 3IL8A 3LNNA 4BY1G 4PNYA 1TS3A 3KF8A 5C44H 3AMUA 2PQAA 2ZXOA 3D0FA 5EPLA 3K7UC 1EY7A 5IT9c 3I73A 1VDZA 2E2JH 4X64Q 4DUZL 1CKNA 4ZAIA 4I7ZC 5EBDA 1S5BD 4K6LA 3PF4A 2R7ZH 4X3TA 1WTXA 2WV6D 1SDFA 2O5IC 5IYBG 1HR0Q 1E1TA 4EQ5A 1SAPA 4J8QA 3X3NA 5CV8A 3L9AX 3OPOA 2M9VA 3E0EA 1PRTB 4A3MB 4KD4A 1X3QA 2IX3A 4JK1C 1QVCA 5DNFA 3H91A 3C2PA 1LTBD 1F9RA 1N9WA 1SRUA 3HOZH 1EZ6A 1K3RA 3PO2H 2IPKD 2IL8A 4K14A 5LL6S 4RMFA 4X3UA 1TIID 5I9PA 1F9QA 3S1QB 3FPUB 4IFDH 3TREA 2X6LA 2E2IB 1B8AA 1X3PA 4TKOB 4FXDA 2MO0A 1VQLA 2B2TC 1JJ2A 2OF1A 2O4XA 4BA1I 3VR5A 3CCJA 1PDQA 1PYBA 4HTHA 1VQEA 4XIGS 1R9TH 1I5FA 2NVTH 1RL2A 1WCMB 1VQNA 4ME3A 2EDGA 5C4HA 5D3DA 3EBEA 3NUCA 4KKTA 3WWVA 5D14A 1B9NA 1ZYRC 1DONA 5ELDA 5G3LD 2UXBQ 3NTIA 1KHIA 3NK9A 4NMZA 3A74A 4DV4Q 1LT3D 1EIYB 3PUYA 5C44G 3HOVB 2N49A 2QDBA 1MD2D 4X66Q 1I3QB 1QE6A 3BVZA 5C3WA 4DNRB 3T1YQ 3K59A 2R92G 1YVCA 3FEWX 2R7ZG 1U4RA 4QQBX 1TWHB 4OX9Q 1SNCA 4K5WA 3S2HB 1DCZA 3PGZA 4C3HB 3KDFB 5KYIA 1BBXC 4K2LA 2A6EC 1XPUA 5GROA 3CQZH 1WFQA 3N6RA 4DV1L 1FJGQ 3S17B 1AZQA 3AU7A 2JSOA 5DLQE 2Q8TA 1C48A 1V1PA 4AYBB 3CPWA 1IKMA 4PMWA 2JA8H 4ZKCB 2E2HH 3L2PA 3CD6A 3VYSA 5IWAQ 3SGIA 4RGNA 2PZWA 1WI5A 2AQ3B 3TSSA 4IFDG 3KYHC 1B44D 1YEZA 1PH9A 4UY8C 4S3SA 5KRUA 1HCZA 1BBWA 5L37A 4IUVA 2ZXRA 2EYHA 3BS1A 1F9SA 1SNPA 1F2LA 1HZ9A 1CSQA 4YWLA 4RHRA 3OWFA 4FO2A 4K0KL 1HA5A 2WIIB 3GTPH 1HZCA 4FVMA 3CCEA 1PH2A 3QJYA 5E7NA 3C46A 4FXGC 3E5SA 2XGTA 2CQAA 3NENA 4A3DH 5E4WC 1H9SB 4JVZA 3KF6A 2EY1A 2MQHA 2AQ2B 2BOSA 3MZ5A 2MJ8A 2BH8A 1EY6A 1EIGA 1AH9A 2ALYB 4FNFA 5HGTA 2JYOA 4O1NA 4HJ8A 4IFDJ 1KTKA 2HDMA 4DV6Q 5FLXE 3RN5A 2VUMB 4DK0A 4JI6L 4XT1B 1B3QA 4DFAA 1PZID 2YU9H 3ERQA 3CC7A 5IGEA 1ET9A 4A3MH 4QUCA 4IJHA 3J7A5 1HPCA 3TRZA 1VF5C 4A3LG 2Q2UA 5C6AA 5IOCA 2LKVA 2DJGC 2FJ2A 2ZTDA 4CKCA 2UXCQ 4BBRH 2JA8G 4CHTB 2UUAQ 1VQ6A 3SVMA 3S1QH 1KXLA 2Z6KC 4OL7A 1QOHA 1HNZQ 4M8AA 3HOUB 3L0OA 1NSNS 1E0BA 2DNCA 1A63A 1QB5D 3LGJA 1QVFA 3DEOA 4HIKA 5EPJA 3P75A 1Y1VB 1GHJA 2NVYB 1PH1A 5EKKA 3RN2A 3D31A 1O78A 1I6HB 2XN9C 2NZHA 1WCMH 5IT9L 1LO5D 5DAUA 2KA7A 2O2LD 1U9RA 4LAAA 3H0GG 3K81C 2L55A 4DNIA 4CGYB 4A3KB 1MHWC 1XNQQ 3J81j 2OXPA 1SMYD 5CV6A 1TWGB 4QJFA 4POGA 2KEDA 4YHHL 4A4IA 2VW9A 3G48A 2R93B 1SR3A 5GQOA 1BCPF 3K0XA 3HOXH 4KHPQ 1A2TA 3HOVH 1ONLA 2SDFA 5E3FA 5FO9B 1EIFA 2NN6H 2XIWA 3RLOA 3TP6A 4XQJA 1S3OA 4LUOA 5GADC 4E6IA 5IGGA 2PO4A 1TWHH 4DR1L 4JI7L 5LMNL 2D5DA 1DD2A 2CKZB 4C3HH 4O42A 5JJIA 4R4QA 4UHVA 1OXVA 4OWTB 2K14A 3KJOA 2EPBA 3OYYA 2LY7A 4JI0Q 3ICEA 3MFGA 2LSSA 1MBYA 4A3MG 1C4QA 1W3SA 3BG3A 1PXUA 4LF6L 3UDFA 5EGTA 1S5CD 1AW7A 2JA6B 2Q2HA 3CCQA 2FMCA 4MN3A 1L0WA 3DHQA 3SR1A 1BCPC 1KDBA 1K9MC 2IHEA 4LFCQ 5KNCA 4DR2L 1PH3A 3IAYA 3GTOB 4B08A 5C4ZA 2KQ3A 1Q81C 2HCCA 4KMUC 4DR7Q 2VNUD 3CU7A 2J0TD 1IW7C 2K5NA 2LS01 3OTOQ 1BQQT 3STBC 4JBMA 1UE5A 1GO3E 3S1NB 1QWYA 3C3LA 2YTYA 3I4OA 1N34Q 1SFOB 2F0IA 5EPKA 3NEMA 4IPHA 2K5HA 1QUQB 3CMEA 2DY8A 1WCMG 1X65A 1IZ6A 4N9PA 2ZM6L 3VDYA 4C3JB 1E2ZA 1HZBA 4IUUA 4PV1C 1J5EL 4CBVA 2L1BA 1EYCA 1QILA 4ZRZA 3A8IE 5JEAH 5M3FB 2WB1B 1TY0A 3D8GA 4K8JA 1X3FA 2FHTA 3LX0A 3NBHB 5EKLA 4IUQA 1A3VA 1BCPB 2BA1A 2ZTCA 3PO3B 2CFMA 4CDFC 3BVGA 5M5WB 4JI1L 2VUMH 5IGFA 2R61A 2XWBB 5IGBA 5DM63 1YI2A 4C3HG 1M1KC 1TS5A 4EVOA 1ASZA 5CV5A 3C1FA 1K83H 4GS3A 2A6HC 5CYUA 2X69A 4C2MB 2TSSA 1IBLL 4A3JH 4HIOA 4AYBG 3FMCA 5AFWA 2WAQE 2DUDA 3ONAB 4LF4Q 1XMQQ 1JJGA 1G6ZA 3HOWB 2NVXB 4P2CB 1G291 3CMAA 3HZXA 5JJLA 1HQRD 1S5DD 1U4MA 3NWTA 3HOUH 4OWXB 5FKAC 4JBWA 2GVBA 1VS0A 2RQXA 4NW2A 3I72A 3MEFA 4DPGA 1EWIA 4DAVA 3I55A 3CF5A 2A69D 3HKSA 1Y1VH 4LWCA 1JMCA 2NVYH 5JJZA 3OSOA 2I5HA 1QJOA 3M4PA 1STGA 3NQIA 3PSIA 4OIKA 5EBCA 5H1SE 1KIXA 4A3KH 1L1OC 2OEOA 4HJ7A 1JR0D 2D0PA 3J7ZC 4K0KQ 4OO1I 1E24A 2R93H 1S40A 4GLAC 5JEAG 1NMFA 2Z4HA 1VQ4A 2F0KA 2EXZA 4A3IG 4GOPB 3G4SA 5M3MB 1CUKA 1A8VA 5CBAE 2F52A 3MXNA 3Q6SA 5M5XH 2O5JC 1LTGD 1PFNA 2VS1A 4FF1A 1SE2A 3BZCA 3BDLA 2EY2A 4NB3A 2XRQD 4ZKBB 2VUMG 4R9WA 2A1AA 1ICFB 3HRZC 1SE8A 3TZUA 2KUMA 1Q12A 4DR5L 3HOZB 3PO2B 1BNZA 4DV7L 2PNRC 4L5RC 5CGKA 4L5SA 2F3IA 4XDXA 1BBUA 4JI6Q 4A3CG 4MHEA 4NXML 4BS9A 4FDBA 3NWSA 4CDEC 3V2TA 1AZPA 4GKKL 3S2DB 1YNND 5J3BA 2F03A 1L1OB 4DR6Q 1PYWD 3IKJA 1STNA 1RJTA 3BVMA 3GTOH 4WORA 2DNEA 3DUZA 2K1BA 3HOUG 4GLVB 1BXTA 5AJ3Q 1C0AA 1IBML 3HKZE 5M9OA 2B2UC 2F0LA 2K5WA 3FVQA 4HSVA 1WTQA 3TS2A 3S1NH 2VL6A 1SNOA 4KLKA 2CW0C 1Q82C 2R3ZA 1SYEA 1WJJA 1Y1VG 5T1GA 3UE1A 4GNXC 1SFOH 4ID6A 1XTDA 1OXXK 1HH2P 3E9HA 1A15A 3DM3A 4C3JH 5C4JB 5ELBA 3TQYA 5LL6X 2F4VQ 4A3KG 1QZHA 4LF9L 3QG1A 4QB4A 3V96A 2AQ1B 2ZJRA 2CCZA 4P72A 2WINB 4B3TL 3R93A 2R93G 2NN6I 1KRSA 3RNUA 2QGQA 1PRTF 5M3FH 2EY5A 4LFBL 1QVGA 1GKHA 4C56C 1HUMA 4HEDA 3RD4A 4BXXG 1RTNA 4YHHQ 1E1OA 3LWEA 4CJ1B 2CWPA 3I2ZA 5D65A 1XNRQ 3PO3H 1EL0A 2K05A 5M5WH 2B2TA 3AYHB 4DU9A 1GUWA 1J9OA 1TVXA 5FLXc 2IX1A 4DK3C 4BBSG 1R4QB 2A68D 4LF7L 1IYUA 4DR1Q 3CHBD 5LMNQ 2K4KA 1PFBA 1JWUD 1TY2A 5JOBA 4NDXA 3L7ZC 4C1NI 4C2MH 1K8OA 2CVRA 2JA6G 1F2YA 1X6OA 4IN3A 3CCUA 1D1IA 2KECA 5CC4A 2EYOA 4A75A 1PRTC 2JN4A 1O7LA 1O7ZA 1ILPA 3WOFA 2NVXH 3J81E 3UDGA 2SNMA 3TP5A 2L9HA 1EU3A 1YNJD 2VQFL 1PFSA 3H3VI 1W6KA 4R4OA 4DR2Q 2J7ZA 1IL8A 2B29A 2EYPA 5COYA 5EKIA 2RHSB 3CAMA 4GKJL 3NXWA 4A3DB 2EIFA 2L12A 4DXFA 1CTMA 2B3GA 3I4LA 1N33L 1W6JA 3ERSX 1NE3A 2H4OA 5CV9A 5KNDA 4C3JG 1SMYC 3FRPB 3J80E 1ENFA 4KJOA 4DAYB 5C3XA 4AQYL 5DM73 1XMOL 2IT1A 2ZM6Q 2F3VA 1G2SA 5J1ZA 1B50A 2EJMA 2LXKA 3D3RA 5M3FG 4DV2Q 1KC8C 2WB1G 1PH8A 1X56A 4HIMA 2OT2A 3SK6A 5M3MH 2F0GA 4XQNA 1TQOA 2YU9B 1NBWA 3NTHA 2QEJC 1WTRA 2EJFC 5IY0A 1X3EA 3PO3G 1Q90A 1KDCA 2PPBC 3GD7A 2HIXA 1SYFA 1N36L 1VQKA 5K36G 4HJAA 4RAUC 4BBRB 5IYCG 2VB3X 4R4IA 2XNAC 1YHAA 2EQSA 2ZTEA 1SNDA 1HXYD 5FJ8H 2IWHA 2Q2TA 1WTVA 1LTRD 5CBEE 5JPNC 5C5MA 2K33A 3S2DH 3OMCA 1IBLQ 4H7BA 4QMGA 3HOWG 1S5FD 1EOTA 2IY5B 2F0SA 3A7LA 4G4KA 3T1HL 1DYQA 3T4AC 4BY7B 4DNTB 1Q1BA 3GQBA 2E75C 1PYSB 3D4RA 2P5ZX 1YBYA 1RCVD 2UU9L 2KCMA 2PI2A 4UP9A 1HUNA 4ME5A 3GV6A 4P71A 1G8ZD 1KAAA 4NXNL 5C4JH 3HOXB 2HQEA 4EQOA 3PMFA 4ZUIA 2OQKA 3K5LA 3CCVA 2E5LQ 4JV5L 1DOKA 1SLJA 2Z4IA 3CCSA 3T51B 1JWSD 4O0AA 4LJZC 2YTXA 2JQOA 2F0QA 1SEBD 1JICA 1I6VC 4JI3L 2L5TA 1F2MA 3EROA 1NMGA 3Q8DA 5IP9H 1XYIA 1LTID 1UEAB 3I7FA 2Z6KA 1GUTA 2I07B 5IGCA 1H9KA 2OTJA 4JW0A 4DN4M 2SEBD 1O80A 1Z9FA 4KKSA 3FP9A 1GUOA 2B8FA 2C35B 3S9WA 1Y1WB 4KY5A 3HOZG 2ZJPA 4K2KA 3PO2G 3PV0A 1YJNA 3I91A 1CQVA 2NTTA 5TSSA 4X6AH 2XRSD 1G91A 4DR5Q 1VQBA 2F0PA 4BA2I 5FJ8G 4X3KA 4DV7Q 3C1EA 2XSCA 2K7VA 5E4XA 1ASYA 4NXMQ 1KD1C 1GJXA 1XPOA 1TR5A 4GN3B 4TSSA 1FNVA 3QOLA 2QCPX 1T9HA 1UNSA 4F7XA 1PH4A 1ENCA 3FDTA 1GUGA 1UE7A 4FYDA 1U0LA 1EY8A 4DV5L 2G5DA 2RA4A 1IBKL 1HNXL 2Q8IB 2AHOB 1PLFA 4OO1H 2R6GA 4DF7A 4LNQA 5KGUA 3A56A 1HTPA 2MUYA 1JOOA 4UAIA 2EVBA 3M7NA 5I2YA 5FLXL 1EOVA 2SNSA 4LF9Q 2F4IA 1PZJD 3NBHA 2M2LA 2NTSA 3TP7A 4Y52H 4QIWB 1Q86C 4A3GB 1CHQD 3KLWA 2WAQB 3DLLA 5IP7H 4B3TQ 2EYMA 2OCEA 3SDZA 3OIQA 2HT1A 3G6EA 4APVA 2PQAB 4LFBQ 4KN7C 3NSWA 3TBIB 1K83B 1CHPD 2E8GA 1ESFA 1SROA 4ZCKA 1SYDA 4A3JB 1CM9A 4UP8A 1AE2A 2N8NA 3PIOA 3GO5A 2K32A 1L2FA 1X3GA 4IPGA 1YJ9A 3GTLH 4A3FB 2F0DA 1TWAB 5CV7A 1NR4A 2ZXPA 3CC4A 4ABNA 1Y69U 1MIUA 3VR3A 1FR3A 3KBGA 2BA0A 4O2DA 3OOCA 3NTKA 2I5MX 2B8GA 1G2TA 3NPPA 4MNOA 2D62A 4DR4Q 4BY7H 2IX0A 4PZ7A 1NR2A 1PA6A 3A55A 3KUPA 4B3SQ 4RGMA 3ZJYC 4Y7NB 2E76C 2TMPA 3ULLA 1PTOD 4XTCS 5DEHA 3BYTB 1LM0A 4A3DG 4JBKA 4IJLA 4IOAA 4DK6C 2KCCA 3PQIA 1BO0A 2Z8LA 4JOIC 1XPRA 3PUZA 3D4DA 4OO1G 5C3EB 2DJFC 2MNAA 1I4PA 1XTCD 3MXPA 1HTLD 1RTOA 1M8AA 4KV6A 4ZUJA 2NVQB 2PMZE 3ITPA 5M5XB 5IT9E 1IHZA 1VQFA 3R2IA 4DR3L 1FNWA 1FL0A 1XMOQ 3MFYA 4ODGA 1AEXA 3VR6A 2UUBL 4DUZQ 1VQAA 1UAPA 3DWAA 2JA5B 3MA2B 1KNEA 1U5KA 4HMJA 4QF4A 2BH2A 1U4LA 5I6WA 1EYAA 1F2ZA 2JK8A 5I2XA 3HKZB 1I94L 1Y1WH 1AE3A 1MSHA 5CV4A 4BBRG 1CZGA 4JCVE 1HZAA 2GVAA 1VQOA 3CP0A 3OW2A 1N36Q 1IKLA 1JOQA 1EQTA 1EY4A 1L1OA 5NUCA 2AWNA 3W1GA 1OO9B 1UE6A 1V1PB 5I6YA 1N32L 1CI3M 4V0BA 1PZKD 5GAGC 1FNUA 1YNJC 2PYKA 4A3EB 3FKIH 3H3VH 4KKUA 4BY7G 2I46A 5KEEA 1TXYA 1VQHA 1JE5A 1I4XA 1D5XC 3HEJA 3HS0C 1LT5D 4N9TA 5LMUL 5FO7B 1YITA 3S15B 5E1FA 2VB2X 4RH6A 5FO8B 3GTKB 3A7AB 2WKCA 4HJ5A 5C4XH 3AFQA 1VQDA 1NTGA 3HOXG 1EU4A 1VMPA 3HOVG 4HCSA 2ES2A 2NN6G 3BU2A 1ZYRD 3RLFA 1AP0A 2F0OA 2I5LX 3UI2A 1WD1A 3T53B 1C7YA 3KF6B 4EQPA 3M4OB 4JV5Q 4A3GH 2ICIA 4JYAL 2B2WC 2Y0SB 5D3IB 1JT8A 3RMHA 1GOZA 4WJ3M 1MJEA 1JQYD 4HAEA 5ELFA 4JI3Q 1WTHA 3BZDB 3K8AA 1XJVA 2B2UA 2QA4A 1JB3A 1V8QA 5G3LF 4DV1Q 2A6ED 4J1MA 4GOPC 1Y1WG 3HP3A 3D6CA 4OXPA 4GNXA 2IJ0A 4X62L 3U9OA 2YYZA 3CXCA 2NUCA 1VQGA 3T16A 1JC7A 4A3FH 1WTWA 1TWAH 1VF7A 1H9JA 2EYFA 4EQNA 1I50H 4YIJA 3U58A 1EY0A 1D2BA 3EIVA 1G51A 4IUPA 1S5ED 2GN5A 5BN3A 1AN8A 1HRJA 4EX5A 1DOMA 2EYJA 2YV5A 2HHHL 1ET6A 3UE0A 1EWHA 4Y7NH 5JJKA 3N52A 1OXSC 5A2QE 3OW7A 4PG3A 5CMDA 4HJ9A 5C0XI 2JE6I 2JP1A 2K50A 1E7ZA 4PZ6A 3PUXA 5C3EH 4DV5Q 4G7OC 3HOYH 4LK1C 3M9BA 1M4VA 4P73A 2NVQH 1IBKQ 4LFAL 2N55A 3T1YL 1UE1A 3GV3A 1H95A 1QZGA 4OX9L 2JA9A 4B3RL 3BYYB 4A3GG 2WAQG 2KHIA 2LMCB 3S1RB 4V190 3PIO3 5LHY1 1SE4A 2G9HD 3OHXC 2JA5H 2LFNA 4K8IA 1FJGL 2PI2E 1L0YB 4F8MA 4K5XA 1EY9A 4WRDA 1MSGA 4MTKA 2L15A 1VQCA 2I0QA 4J6HA 3Q23A 1DM0B 3BJUA 3JAME 2JA7B 4A3JG 1CFMA 4LF8L 3EJIA 4IZ8A 4HR7B 4LW1A 5I9OA 1STAA 5IGDA 4MTNA 4A3FG 1JWMD 1QCBD 2WP8J 4GZYC 1B9MA 3TMEA 4H44C 4ILWA 4XQQA 5EAYA 4IALA 4MZ9A 1HA6A 3QIAA 3MXUA 1Z6HA 1TS4A 4FF4A 4A3EH 1CZWA 3U4VA 1PH6A 3PIPA 2K03A 2VXWA 1HQMC 2DY7A 1SXTA 4YWKA 1STYA 5HGQA 5JPMC 3DEPA 2HQLA 1D1KA 2XWJB 4ULLA 3FHWA 3MWYW 3S15H 1GM5A 2R7DA 3GTKH 3I8ZA 2MPMA 5IODA 3TZDA 4DGZA 4OHJA 1HR0W 2QILA 5C3EG 3S16B 1Y8OB 2B2YC 1D7QA 4OELB 4TQUS 1ILQA 2ZT9C 4ZYSA 3R8BA 3E0JA 3KDFA 1ZKOA 3I70A 4PZ8A 2EXDA 1FGBD 3M4OH 2X6GA 3CC2A 3KLRA 1FD7D 2L4NA 4KD3A 4XXEA 4N8FA 2LXJA 4IO9A 1SMXA 1FGUA 5GAEC 1JE4A 3EQLC 3SHLA 4DK1A 4F88A 1BR9A 3GTJB 3E6ZX 1EUJA 4DR3Q 1YJWA 2C5CA 2JA5G 4JI7Q 5IYBH 1PTOF 4H13C 1I4GA 3HGBA 2CHBD 5BR8L 3GDEA 4A3BB 1ESRA 2F0TA 4GN4B 3R2TA 1B4OA 3HG9A 3HKZG 2CH4A 4JI2L 2CWAA 2K28A 3JC66 4POFA 5EJWA 2N78A 1Y8PB 3BZKA 4C3IB 1C9OA 3H15A 4LF6Q 4OGQC 4PQXA 1EFID 1I94Q 4DV3L 3SK8A 1IYVA 2OQ0A 2NZOA 3SK5A 2J4XA 3PF5A 1HNZL 5EQ0A 3QB3A 1RHPA 1MJCA 4BWGB 3MTSA 3QOJA 2RDFA 4R4CA 1BCPD 1LTAD 1SSOA 2VZAA 3TP8A 4RKLA 3M3YB 4NPSA 3S14H 4A3EG 4GLXA 2K04A 1N32Q 4JI4L 4B3ML 1IW7D 2EYLA 3STBD 3NHHA 1H9SA 1B2TA 1ENAA 4U68A 2QF7A 1PTOC 3GP7A 1II3A 2KCNA 3W3AA 4A93B 1LT6D 3GTQB 3NQTA 2NBFA 4CDCC 2D0OA 1FYCA 4KK7A 1UEBA 4R1JA 2JEAI 1J5EQ 1WTPA 4TVAB 3JAMi 5LMUQ 4WJWA 1HFNA 5KIXA 4DV0L 1LYLA 4TRDA 1YHQA 2K5DA 1ML0D 2KHSA 3AQQA 4UDUC 4YCVA 1DJRD 2MHVA 4AH6A 2BCOA 4CJ0B 1HJPA 3L3OC 2QKIC 2Y0SG 3RLNA 2RCFA 3S1RH 2R92H 1CT1D 5BN5A 1CK1A 2KJXA 4JI0L 1RIPA 4OEMB 5IE8A 3MXNB 4JYAQ 4JI1Q 4KHZA 2JEBI 2RKSA 3GTLB 4P74A 4KJNA 1KAWA 2JA7H 1M90C 1OTCA 2BE5D 2A6HD 3K57A 1PTOB 3I90A 4PMCA 4LFCL 2GA4B 4DAMA 1RF2D 1K8GA 4QGUA 4X62Q 2OTLA 4DR7L 2K52A 2RSOA 2SOBA 4U673 3DWPA 4RGTA 1X32A 5HY6A 4DUYL 2NB0A 1OXTA 2A74C 3OTOL 1S72A 1T5EA 1WTOA 4ZLTF 4QUFA 1HNWL 3CW2C 4Q0FA 3H6MA 2PMZB 1N34L 2N88A 2F0FA 1Q46A
chains in the Genus database with same CATH topology
3VR4A 1RD9D 3ZYYX 4R8IA 1E2WA 2Z1CA 3I4NB 2F3WA 3ND9A 2F1MA 3Q22A 3H3VC 1MGSA 4B9XA 5JAVA 4KN4C 2IW3A 1CQFA 1SYGA 2RDHA 3I4MB 3U9SA 1B53A 5A35A 3MHBA 3LWUA 2EZVA 3MC0B 4KHVA 2F0JA 4NKLA 3URYA 2RBMA 3T13A 2B2VC 3VR2A 3J7AV 4DXGA 2ID0A 4HMIA 2RVLA 1KABA 3KBXA 3WOEA 1RDPD 4DAPA 3PIP3 1J8IA 3FKIB 5J22A 2AUJD 3GTGB 2B39A 1K8MA 3AB9A 1F77A 2A69C 2KOLA 3S1MB 4G7ZC 1KDAA 4KI0A 2JXMB 3Q0AA 1DOLA 3PUWA 2MGSA 2AWOA 5C4XB 1AFPA 3P7JA 1EQVA 2B63B 2CW0D 1H9MA 1SE3A 1HFGA 4G57A 5J39A 5BN4A 3KLSX 5C0XH 4L8JA 3PUVA 5FOBB 1S4ZA 4RCOA 1QNUA 2Q8RE 3P1HA 1B3AA 3TDQA 3OIPA 1KLUD 4A3IB 1SBBB 2F0HA 5K5PA 1WVLA 3V05A 4XYQA 1KNAA 2D2CC 1JCKB 4EGVA 4K6DA 1I50B 3DXJC 4C3IG 1YNNC 1Q1EA 3CKIB 4H0LC 3MEHA 1PTOH 3R3OA 2KVMA 3VYTA 2EY6A 2NYZD 1DZ1A 1QNKA 1XX8A 2F0WA 1EY5A 1PRTD 1LABA 1LACA 1TWFB 4Q5VA 4F87A 2F0MA 3D4WA 3I3CA 1JOKA 2L11A 3T56B 2ICEC 2B2WA 1WD0A 1BF4A 1SYBA 2K01A 1B1ZA 4FP5D 2A5HA 1MI2A 4OIJA 2FFKB 3HOYB 3J7AF 5C0XG 3ND8A 1EWCA 4HSPA 1UUPA 3VA7A 3MXGA 4DA2A 1TT2A 3SK4A 3NBIA 3EVQA 1CA5A 1LTSD 1STEA 2WKDA 2HUGA 3SE0A 3QWNA 1GHKA 1A2UA 1NAPA 1ZXTA 2A68C 4HN7A 1STBA 1LT4D 4R8NA 2WACA 1OXUA 1A3UA 3J7YW 3M85A 1DXMA 4IUNA 4XT3B 4BBSB 3K5NA 1HHVA 2M00A 1EYDA 5C0XJ 4Z9CB 1TWCB 4XYOA 3OWEB 4IFDI 2C9OA 3MAQA 4RWSC 1BOSA 2PW7A 4RHSA 1GXDC 1STHA 4L6TB 3K5OA 4QCLA 2H1EA 4G7HC 3X3MA 1Z47A 5JVH3 2HCIA 1O7YA 3VYUA 4ZK9B 1RKNA 2KEEA 2RSNA 4K5VA 1CA6A 5IIFA 4BY1B 4CKEA 3K0YA 3A54A 1JORA 5FK9C 5ISRA 5HURA 1V43A 1Q3LA 4M1UB 3A8KE 3FPPA 4HCEA 2FMMA 3IFTA 3MVVA 2A73B 1F9PA 1I4HA 1PFMA 1BUVT 3EFXD 4KTAA 5M5YB 2RDGA 2BE5C 2BDOA 1D5MC 1TS2A 3K7AB 3NE5B 4KY6A 4RCNA 3GTMB 2E2DC 4RFBA 4IUTA 1H9RA 4IURA 1Y8NB 3Q24A 3S14B 3RUZA 2B2YA 4FF2A 5KNBA 2NZ1D 5A2QL 3KK7A 4RA8A 2BDNA 2NWGA 4NP5A 2XVSA 1EZ8A 4DAYA 1EIHA 4PMBA 3RZDB 3NP8A 1SJHD 2PQEA 1RODA 4RGOS 1C8CA 5C44B 1ICWA 2E2JB 3K6OA 2R92B 1A6XA 3CRLC 2EE1A 2R7ZB 3TN2A 5CORA 3JAML 1SNQA 4MIUA 3VYRA 3IFDA 1XWEA 3G7LA 4CJ2C 1LLRD 2F0VA 1PMRA 4C1NK 1BDOA 4KY7A 1U4PA 2MP1A 1LTTD 3DM1A 4FXKC 4X3SA 3KLSA 3W2DA 1XXGA 3DMUA 1Z7TA 2FINB 5KYLA 2G9DA 1LV9A 2PZTA 1D5ZC 1R9TB 5JEAJ 2V4DA 3H94A 2PW5A 2NVTB 1GUSA 4FF3A 1NCVA 3VA5A 5T1IA 2D9UA 2ENBA 2F0EA 2L0CA 1NUCA 3F2UA 4LMQD 3G6JB 4ZQ3A 2EOTA 2HDLA 1EEID 2DN8A 5C5LA 3K5MA 4IQZA 1KLGD 2K6AA 3M4YA 1TKWB 3D6WA 1E2VA 4CKBA 1SJED 5ELEA 1SYCA 3O13A 1TU2B 2PCFB 5CR3A 1R4PB 3CRKC 3CQZB 3SEBA 3QO2A 4B9WA 1Q8IA 2EJGC 1V1OA 4I65A 5K36H 1EEFD 3J81L 2AUKA 2JA8B 1SNMA 1ZEQX 1I4RA 2E2HB 5JVG3 3OMGA 3DWQA 1D6EC 2F0UA 1QG7A 1VMCA 3SXHA 2PZUA 1T5XD 3K58A 3P20A 1GUNA 1A3TA 4RKBA 5F2DA 3J80L 3WDNA 3RZOB 3EA6A 3BDCA 4WFN3 4L63B 3GTPB 3A8JE 5ELCA 5I4DA 3H09A 3H0GB 2F0NA 1I4QA 1L0XB 2E74C 3M7GA 3BDOA 1VCIA 2B2VA 2K5QA 3IL8A 3LNNA 4PNYA 1TS3A 3KF8A 3AMUA 2ZXOA 5EPLA 1EY7A 3I73A 1VDZA 4ZAIA 4I7ZC 5EBDA 1S5BD 4K6LA 4X3TA 1WTXA 2WV6D 1SDFA 2O5IC 1SAPA 4J8QA 3X3NA 5CV8A 3L9AX 3OPOA 2M9VA 1PRTB 4A3MB 4KD4A 1X3QA 2IX3A 4JK1C 5DNFA 3H91A 3C2PA 1LTBD 1F9RA 1EZ6A 2IPKD 2IL8A 4K14A 5LL6S 4X3UA 1TIID 5I9PA 1F9QA 3S1QB 3FPUB 4IFDH 2X6LA 2E2IB 1X3PA 4TKOB 4FXDA 2B2TC 2OF1A 2O4XA 4BA1I 3VR5A 1PDQA 4HTHA 4XIGS 1WCMB 2EDGA 5C4HA 5D3DA 3NUCA 4KKTA 5D14A 1B9NA 1ZYRC 1DONA 5ELDA 5G3LD 3NTIA 3NK9A 4NMZA 1LT3D 3PUYA 3HOVB 2QDBA 1MD2D 1I3QB 1QE6A 3BVZA 5C3WA 4DNRB 3K59A 3FEWX 1U4RA 1TWHB 1SNCA 4K5WA 3S2HB 1DCZA 4C3HB 5KYIA 1BBXC 4K2LA 2A6EC 3N6RA 3S17B 1AZQA 3AU7A 2JSOA 2Q8TA 1C48A 1V1PA 4AYBB 1IKMA 4PMWA 4ZKCB 3VYSA 4RGNA 2PZWA 2AQ3B 3TSSA 4IFDG 1B44D 4S3SA 5KRUA 1HCZA 4IUVA 2ZXRA 2EYHA 3BS1A 1F9SA 1SNPA 1F2LA 4RHRA 3OWFA 4FO2A 1HA5A 2WIIB 4FVMA 3QJYA 3C46A 4FXGC 3E5SA 2CQAA 5E4WC 1H9SB 2EY1A 2AQ2B 2BOSA 3MZ5A 2MJ8A 1EY6A 1EIGA 4FNFA 5HGTA 2JYOA 4O1NA 4IFDJ 1KTKA 2HDMA 5FLXE 2VUMB 4DK0A 4XT1B 4DFAA 1PZID 3ERQA 5IGEA 1ET9A 4QUCA 1HPCA 1VF5C 5C6AA 5IOCA 2LKVA 2FJ2A 4CKCA 4CHTB 3SVMA 4OL7A 1QOHA 3HOUB 4M8AA 1NSNS 1E0BA 2DNCA 1QB5D 3DEOA 5EPJA 3P75A 1Y1VB 1GHJA 2NVYB 5EKKA 3D31A 1O78A 1I6HB 2XN9C 5IT9L 1LO5D 5DAUA 2KA7A 2O2LD 1U9RA 4LAAA 4A3KB 2L55A 4CGYB 2OXPA 1SMYD 5CV6A 1TWGB 2KEDA 2R93B 1BCPF 1A2TA 1ONLA 2SDFA 5E3FA 5FO9B 2NN6H 2XIWA 3TP6A 4XQJA 4E6IA 5IGGA 2PO4A 2D5DA 1DD2A 4O42A 1OXVA 2EPBA 2LY7A 3MFGA 1MBYA 1C4QA 3BG3A 1PXUA 5EGTA 1S5CD 1AW7A 2JA6B 2FMCA 4MN3A 3DHQA 3SR1A 1BCPC 1KDBA 5KNCA 3IAYA 3GTOB 4B08A 5C4ZA 2KQ3A 2HCCA 4KMUC 2VNUD 3CU7A 2J0TD 1IW7C 2LS01 1BQQT 3S1NB 1QWYA 3C3LA 1SFOB 2F0IA 5EPKA 2DY8A 4N9PA 4C3JB 1E2ZA 4IUUA 4PV1C 4CBVA 2L1BA 1EYCA 1QILA 4ZRZA 3A8IE 5JEAH 5M3FB 2WB1B 1TY0A 3D8GA 4K8JA 2FHTA 3LX0A 5EKLA 4IUQA 1A3VA 1BCPB 2BA1A 3PO3B 3BVGA 5M5WB 5IGFA 2R61A 2XWBB 5IGBA 5DM63 4C3HG 1TS5A 4EVOA 5CV5A 3C1FA 2A6HC 5CYUA 2X69A 4C2MB 2TSSA 3FMCA 5AFWA 3ONAB 1G6ZA 3HOWB 2NVXB 4P2CB 1G291 3HZXA 1HQRD 1S5DD 1U4MA 3NWTA 5FKAC 4JBWA 2RQXA 4NW2A 3I72A 4DAVA 2A69D 5JJZA 3OSOA 1QJOA 1STGA 3NQIA 4OIKA 5EBCA 2OEOA 1JR0D 4OO1I 5JEAG 2Z4HA 2F0KA 2EXZA 5M3MB 5CBAE 3MXNA 3Q6SA 2O5JC 1LTGD 1PFNA 4FF1A 1SE2A 3BDLA 2EY2A 2XRQD 4ZKBB 4R9WA 3HRZC 3TZUA 2KUMA 1Q12A 3HOZB 3PO2B 1BNZA 2PNRC 5CGKA 4XDXA 4MHEA 4BS9A 3NWSA 3V2TA 1AZPA 3S2DB 1YNND 2F03A 1PYWD 3IKJA 1STNA 1RJTA 3BVMA 4WORA 2DNEA 3DUZA 2K1BA 1BXTA 5M9OA 2B2UC 2F0LA 2K5WA 3FVQA 4HSVA 1WTQA 1SNOA 2CW0C 2R3ZA 1SYEA 5T1GA 4ID6A 1OXXK 1A15A 5C4JB 5ELBA 5LL6X 3QG1A 4QB4A 3V96A 2AQ1B 2WINB 3R93A 2NN6I 1PRTF 2EY5A 4C56C 1HUMA 4HEDA 3RD4A 1RTNA 3LWEA 4CJ1B 5D65A 1EL0A 2K05A 2B2TA 4DU9A 1GUWA 1J9OA 1TVXA 2IX1A 1R4QB 2A68D 1IYUA 3CHBD 1PFBA 1JWUD 1TY2A 5JOBA 4NDXA 3L7ZC 4C1NI 1K8OA 2CVRA 1F2YA 4IN3A 1D1IA 2KECA 5CC4A 2EYOA 1PRTC 1O7LA 1O7ZA 1ILPA 3WOFA 3J81E 2SNMA 3TP5A 2L9HA 1EU3A 1YNJD 1W6KA 2J7ZA 1IL8A 2EYPA 5COYA 5EKIA 3NXWA 4A3DB 4DXFA 2L12A 1CTMA 3I4LA 1W6JA 2H4OA 5CV9A 5KNDA 4C3JG 1SMYC 3FRPB 3J80E 1ENFA 4KJOA 5C3XA 5DM73 2IT1A 2F3VA 1G2SA 5J1ZA 1B50A 2EJMA 3D3RA 2OT2A 3SK6A 2F0GA 4XQNA 1TQOA 2YU9B 3NTHA 2QEJC 1WTRA 2EJFC 1Q90A 1KDCA 2PPBC 3GD7A 1SYFA 5K36G 4RAUC 4BBRB 2VB3X 2XNAC 1SNDA 1HXYD 2IWHA 1WTVA 1LTRD 5CBEE 5JPNC 5C5MA 2K33A 3OMCA 4H7BA 4QMGA 1S5FD 1EOTA 2F0SA 3A7LA 4G4KA 1DYQA 3T4AC 4BY7B 4DNTB 1Q1BA 3GQBA 2E75C 3D4RA 1RCVD 1HUNA 4ME5A 3GV6A 1G8ZD 1KAAA 3HOXB 4EQOA 2HQEA 3PMFA 4ZUIA 3K5LA 1DOKA 2Z4IA 3T51B 1JWSD 4LJZC 2F0QA 1SEBD 1JICA 1I6VC 2L5TA 1F2MA 3EROA 1XYIA 1LTID 1UEAB 1GUTA 2I07B 5IGCA 1H9KA 4DN4M 2SEBD 1O80A 4KKSA 1GUOA 2B8FA 3S9WA 1Y1WB 4KY5A 4K2KA 3PV0A 3I91A 1CQVA 2NTTA 5TSSA 2XRSD 1G91A 2F0PA 4BA2I 4X3KA 3C1EA 2XSCA 2K7VA 5E4XA 1GJXA 1TR5A 4TSSA 1FNVA 3QOLA 2QCPX 1UNSA 4F7XA 1ENCA 3FDTA 1GUGA 4FYDA 1EY8A 2RA4A 2Q8IB 1PLFA 4OO1H 2R6GA 4DF7A 5KGUA 3A56A 1HTPA 2MUYA 1JOOA 4UAIA 2EVBA 3M7NA 5I2YA 5FLXL 2SNSA 2F4IA 1PZJD 2M2LA 3NBHA 2NTSA 3TP7A 4QIWB 4A3GB 1CHQD 2WAQB 2EYMA 3SDZA 3OIQA 4KN7C 3NSWA 3TBIB 1K83B 1CHPD 1ESFA 1SYDA 4A3JB 1CM9A 3GO5A 2K32A 4A3FB 2F0DA 1TWAB 5CV7A 1NR4A 2ZXPA 4ABNA 1Y69U 3VR3A 1FR3A 3KBGA 2BA0A 3OOCA 3NTKA 2B8GA 1G2TA 3NPPA 2D62A 2IX0A 1NR2A 3A55A 3KUPA 4RGMA 4Y7NB 2E76C 2TMPA 1PTOD 4XTCS 5DEHA 3BYTB 2KCCA 1BO0A 2Z8LA 3PUZA 3D4DA 4OO1G 5C3EB 1I4PA 1XTCD 3MXPA 1HTLD 1RTOA 1M8AA 4KV6A 4ZUJA 2NVQB 3ITPA 5M5XB 5IT9E 1IHZA 3R2IA 1FNWA 3MFYA 4ODGA 1AEXA 3VR6A 1UAPA 3DWAA 2JA5B 3MA2B 1KNEA 4HMJA 4QF4A 1U4LA 5I6WA 1EYAA 1F2ZA 5I2XA 3HKZB 1MSHA 5CV4A 1CZGA 1IKLA 1JOQA 1EQTA 1EY4A 5NUCA 2AWNA 1OO9B 1V1PB 5I6YA 1CI3M 4V0BA 1PZKD 1FNUA 1YNJC 2PYKA 4A3EB 4KKUA 2I46A 5KEEA 1I4XA 1D5XC 3HEJA 3HS0C 1LT5D 4N9TA 5FO7B 3S15B 5E1FA 2VB2X 4RH6A 5FO8B 3GTKB 3A7AB 2WKCA 1EU4A 1VMPA 4HCSA 2NN6G 1ZYRD 3RLFA 1AP0A 2F0OA 1WD1A 3UI2A 3T53B 4EQPA 3M4OB 2ICIA 2B2WC 2Y0SB 5D3IB 3RMHA 1GOZA 1JQYD 4HAEA 5ELFA 3BZDB 2B2UA 1JB3A 1V8QA 5G3LF 2A6ED 4J1MA 3HP3A 3D6CA 2IJ0A 3U9OA 2YYZA 2NUCA 3T16A 1JC7A 1WTWA 1VF7A 1H9JA 2EYFA 4EQNA 4YIJA 1EY0A 1D2BA 4IUPA 1S5ED 5BN3A 1AN8A 1HRJA 1DOMA 2EYJA 1ET6A 1EWHA 3N52A 1OXSC 5A2QE 3OW7A 5CMDA 5C0XI 2JE6I 2JP1A 3PUXA 4G7OC 4LK1C 1M4VA 2N55A 3GV3A 3BYYB 2LMCB 3S1RB 4V190 3PIO3 5LHY1 1SE4A 2G9HD 3OHXC 2LFNA 4K8IA 4F8MA 1L0YB 4K5XA 1EY9A 4WRDA 1MSGA 4J6HA 3Q23A 1DM0B 3JAME 2JA7B 1CFMA 3EJIA 4IZ8A 4HR7B 5I9OA 1STAA 5IGDA 1JWMD 1QCBD 2WP8J 4GZYC 1B9MA 3TMEA 4H44C 4ILWA 4XQQA 4IALA 1HA6A 3QIAA 3MXUA 1Z6HA 1TS4A 4FF4A 1CZWA 2K03A 2VXWA 1HQMC 2DY7A 1SXTA 1STYA 5JPMC 3DEPA 1D1KA 2XWJB 4ULLA 3MWYW 3I8ZA 2MPMA 5IODA 3TZDA 4DGZA 4OHJA 2QILA 3S16B 1Y8OB 2B2YC 4TQUS 1ILQA 2ZT9C 4ZYSA 3R8BA 3E0JA 1ZKOA 3I70A 1FGBD 2X6GA 1FD7D 4XXEA 4KD3A 2L4NA 3KLRA 1JE4A 3EQLC 3SHLA 4DK1A 4F88A 1BR9A 3GTJB 3E6ZX 2C5CA 1PTOF 4H13C 1I4GA 3HGBA 2CHBD 4A3BB 1ESRA 2F0TA 3R2TA 1B4OA 3HG9A 2K28A 5EJWA 4C3IB 1Y8PB 4OGQC 4PQXA 1EFID 3SK8A 1IYVA 3SK5A 2J4XA 5EQ0A 3QB3A 1RHPA 4BWGB 3MTSA 3QOJA 2RDFA 1BCPD 1LTAD 1SSOA 3TP8A 4RKLA 3M3YB 2K04A 1IW7D 2EYLA 3NHHA 1H9SA 1B2TA 1ENAA 4U68A 2QF7A 1PTOC 3GP7A 1II3A 2KCNA 3W3AA 4A93B 1LT6D 3GTQB 3NQTA 2NBFA 1FYCA 4KK7A 2JEAI 1WTPA 4WJWA 1HFNA 5KIXA 4TRDA 2K5DA 1ML0D 2KHSA 4UDUC 1DJRD 2MHVA 2BCOA 4CJ0B 3L3OC 2QKIC 1CT1D 5BN5A 1CK1A 2KJXA 4KHZA 2JEBI 2RKSA 3GTLB 4KJNA 2BE5D 2A6HD 3K57A 1PTOB 3I90A 4PMCA 2GA4B 1RF2D 2RSOA 2SOBA 4U673 3DWPA 4RGTA 1X32A 2NB0A 1OXTA 2A74C 1T5EA 1WTOA 4ZLTF 4QUFA 4Q0FA 3H6MA 2PMZB 2N88A 2F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR4 A;  1X3Q A;  4DN4 M;  1B3A A;  2NZ1 D;  4IUV A;  2KED A;  1O80 A;  5DNF A;  4R8I A;  1RJT A;  1HHV A;  4RA8 A;  2BDN A;  3H91 A;  2NWG A;  1F9S A;  1F9R A;  2K1B A;  3D6W A;  1F2L A;  2SDF A;  5EQ0 A;  1EIH A;  2B2U C;  2XIW A;  1MGS A;  1RHP A;  2IL8 A;  1MSG A;  1G2T A;  1VMP A;  1G2S A;  4HSV A;  3MTS A;  4HCS A;  4X3U A;  2X69 A;  1WTQ A;  1B50 A;  1F9Q A;  5AFW A;  1AP0 A;  3FPU B;  1SSO A;  3UI2 A;  2R3Z A;  5T1G A;  1WD1 A;  1NR2 A;  1WVL A;  3KUP A;  2X6L A;  3I91 A;  4RWS C;  1ROD A;  1KNA A;  3ONA B;  2K04 A;  1X3P A;  1C8C A;  1G91 A;  3QO2 A;  4X3K A;  5E4W C;  1A15 A;  4O42 A;  1G6Z A;  2B2T C;  1B53 A;  1WTR A;  1ICW A;  2B2W C;  2H1E A;  2EPB A;  1B2T A;  1PDQ A;  1U4M A;  4U68 A;  2MJ8 A;  5E4X A;  2HCI A;  1BO0 A;  1EIG A;  4HAE A;  2EE1 A;  3TN2 A;  1O7Y A;  5COR A;  4NW2 A;  4RAU C;  3R93 A;  4ZK9 B;  1RTO A;  2JYO A;  2B2U A;  1M8A A;  1HA6 A;  1QG7 A;  1WTP A;  2KVM A;  1HUM A;  2KEE A;  4HED A;  2RSN A;  1VMC A;  2NYZ D;  5JJZ A;  1CA6 A;  2HDM A;  1RTN A;  3HP3 A;  3IFD A;  1QNK A;  1XX8 A;  3G7L A;  4MN3 A;  1DZ1 A;  1HFN A;  4CJ2 C;  3LWE A;  2K03 A;  2B2V C;  3FDT A;  5D14 A;  2VXW A;  2DY7 A;  4CJ1 B;  1DON A;  4OIK A;  1WTV A;  3I3C A;  4XT1 B;  5D65 A;  4XT3 B;  5CBE E;  1ML0 D;  2L11 A;  2RA4 A;  2RVL A;  1EL0 A;  2HCC A;  2K05 A;  1WTW A;  3DEP A;  2B2T A;  3KBX A;  1Q3L A;  2B2W A;  1PLF A;  1KNE A;  1WD0 A;  4QUC A;  1J9O A;  3MWY W;  1GUW A;  1BF4 A;  4CJ0 B;  2K01 A;  1EOT A;  1TVX A;  1U4P A;  2MP1 A;  1U4L A;  4IUP A;  1J8I A;  1MI2 A;  1QE6 A;  2FJ2 A;  3I8Z A;  2MPM A;  4OIJ A;  2FFK B;  3DM1 A;  2FMM A;  3TZD A;  1MSH A;  1PFB A;  4UAI A;  1U4R A;  4X3S A;  5EPK A;  5CBA E;  1HRJ A;  2DY8 A;  1F9P A;  2B2Y C;  2M2L A;  2KOL A;  3Q6S A;  2CVR A;  3SVM A;  1HUN A;  1DOM A;  1BBX C;  1PFN A;  1ILQ A;  2FIN B;  4IUU A;  2B2V A;  2KEC A;  3GV6 A;  1PFM A;  3IL8 A;  1LV9 A;  2L1B A;  1IKL A;  1DOL A;  1CA5 A;  1AZQ A;  2MGS A;  1EQT A;  4ZKB B;  4R9W A;  2X6G A;  3N52 A;  1O7Z A;  1E0B A;  2L4N A;  1ILP A;  2HUG A;  3P7J A;  5EPL A;  2KUM A;  3DEO A;  3I90 A;  2L9H A;  2Q8T A;  5EPJ A;  1JE4 A;  5CMD A;  1BNZ A;  1DOK A;  1NCV A;  5T1I A;  2D9U A;  2JP1 A;  4ZAI A;  2RSO A;  1HFG A;  4XDX A;  1NAP A;  1IKM A;  3F2U A;  4ZKC B;  4LMQ D;  1X32 A;  4X3T A;  1WTX A;  1ZXT A;  1CM9 A;  2J7Z A;  1IL8 A;  4IUT A;  4IUR A;  4MHE A;  1SDF A;  5COY A;  2FHT A;  5EKI A;  1WTO A;  1JIC A;  4ZLT F;  1ESR A;  4QUF A;  1SAP A;  2EOT A;  2HDL A;  2N55 A;  1B4O A;  1S4Z A;  2B2Y A;  4IUQ A;  3GV3 A;  2L12 A;  2K28 A;  1XYI A;  2N88 A;  1AZP A;  5EJW A;  2Q8R E; 
#chains in the Genus database with same CATH topology
 3VR4 A;  1RD9 D;  3ZYY X;  4R8I A;  1VQP A;  1E2W A;  4YY3 L;  2Z1C A;  3I4N B;  2F3W A;  1VQI A;  1Q8K A;  2F1M A;  3ND9 A;  3Q22 A;  3H3V C;  1MGS A;  2HHH Q;  3PCO B;  4JI8 L;  4B9X A;  5JAV A;  3G71 A;  4KN4 C;  2IW3 A;  1CQF A;  1SYG A;  2RDH A;  2JJQ A;  3S16 H;  5M3M G;  3A0J A;  3I4M B;  3W5O A;  3U9S A;  1B53 A;  3EN2 A;  5A35 A;  1VQ9 A;  1DGS A;  2H5X A;  3J81 i;  1IYJ B;  3MHB A;  3LWU A;  2EZV A;  1KQS A;  2YTV A;  4LFA Q;  3MC0 B;  4KHV A;  2F0J A;  3GTJ H;  2UXD L;  4NKL A;  1MKH A;  3URY A;  2RBM A;  4B3R Q;  2RF4 A;  3T13 A;  2B2V C;  3VR2 A;  4A3B H;  1YIJ A;  3J7A V;  4GN5 A;  4DXG A;  2ID0 A;  2JA7 G;  4HMI A;  2RVL A;  4C3I H;  1KAB A;  3KBX A;  3J80 i;  4A3L H;  4LF4 L;  2ASB A;  3WOE A;  1XMQ L;  1YHB A;  1RDP D;  4DAP A;  3PIP 3;  4JOI A;  4LF8 Q;  1J8I A;  3FKI B;  5J22 A;  2AUJ D;  2DGY A;  4GKK Q;  3GTG B;  2B39 A;  1K8M A;  2QW7 A;  3AB9 A;  1F77 A;  2A69 C;  2A19 A;  2KOL A;  2A8V A;  3S1M B;  2K75 A;  1QUQ A;  4G7Z C;  1KDA A;  4KI0 A;  3M3Y H;  2Q2I A;  2JXM B;  4LUV A;  3Q0A A;  1DOL A;  1IBM Q;  3PUW A;  1K0S A;  2MGS A;  3ULP A;  2AWO A;  5C4X B;  1AFP A;  3P7J A;  3RZO H;  1EQV A;  2B63 B;  2CQO A;  4JPB W;  2CW0 D;  1H9M A;  1SE3 A;  4A93 H;  1HFG A;  4G57 A;  5J39 A;  2VY3 A;  1B7Y B;  3KLS X;  5BN4 A;  5C0X H;  3GTQ H;  4L8J A;  3PUV A;  4I7A A;  3H0G H;  1S4Z A;  5FOB B;  4RCO A;  4IPD A;  1QNU A;  2Q8R E;  3KF8 B;  4OWW B;  3P1H A;  5IP9 G;  1B3A A;  3TDQ A;  3OIP A;  1KLU D;  4A3I B;  3A5U A;  2OWO A;  1SBB B;  1CKN B;  1UWV A;  1EQQ A;  3F2D A;  2VQE L;  2F0H A;  5K5P A;  2HIV A;  2KBN A;  1WVL A;  3V05 A;  4XYQ A;  4R4T A;  1KNA A;  2D2C C;  1JCK B;  1KL9 A;  4EGV A;  4A3B G;  4K6D A;  4LF7 Q;  1I50 B;  3DXJ C;  4C3I G;  1YNN C;  1JB7 A;  3JAM c;  1Q1E A;  2HD3 A;  3CKI B;  5BR8 Q;  4H0L C;  3MEH A;  1PTO H;  3K80 C;  1IL2 A;  4DR6 L;  4JI2 Q;  1IXR A;  1CSP A;  4CDD C;  3CCM A;  3R3O A;  2KVM A;  3VYT A;  3KJP A;  2EY6 A;  2NYZ D;  5AJ3 L;  1DZ1 A;  1X54 A;  1QNK A;  1XX8 A;  5FLM H;  2F0W A;  4DV3 Q;  1EY5 A;  1PRT D;  4JG2 A;  2XTI A;  3E9I A;  1LAB A;  2E2I H;  1LAC A;  1TWF B;  4Q5V A;  4F87 A;  2F0M A;  3D4W A;  3I3C A;  2VQF Q;  1JOK A;  2L11 A;  3T56 B;  2ICE C;  1BVS A;  2B2W A;  1K73 C;  1WD0 A;  1E22 A;  1BF4 A;  1X55 A;  4UP7 A;  1SYB A;  2K01 A;  1B1Z A;  4FP5 D;  2A5H A;  3I56 A;  3I4N H;  4GKJ Q;  2F4V L;  3RR5 A;  1MI2 A;  4JI4 Q;  4OIJ A;  2FFK B;  3HOY B;  4B3M Q;  3J7A F;  4A93 G;  1N33 Q;  5C0X G;  1VQ5 A;  3ND8 A;  1EWC A;  4HSP A;  1UUP A;  3VA7 A;  3MXG A;  1Q7Y C;  4DA2 A;  4GOP A;  1X9N A;  1TT2 A;  4N8X 1;  3SK4 A;  3NBI A;  3EVQ A;  4AQY Q;  1CA5 A;  1LTS D;  3AFP A;  1STE A;  2WKD A;  5IP7 G;  5GAH C;  3I4M H;  2HUG A;  3SE0 A;  4JC0 A;  3QWN A;  3E3X A;  1XNR L;  1GHK A;  1A2U A;  2QDL A;  1NAP A;  4DV0 Q;  4YWM A;  1I3Q H;  3M4Q A;  1ZXT A;  2A68 C;  4HN7 A;  4LF5 L;  1STB A;  2N3S A;  1VQJ A;  4X65 L;  1LT4 D;  3CPF A;  4R8N A;  2WAC A;  1OXU A;  1A3U A;  3AEV A;  3J7Y W;  3M85 A;  3S2H H;  3U4Z A;  1DXM A;  4IUN A;  4XT3 B;  4AIM A;  4BBS B;  3K5N A;  3S17 H;  1HHV A;  2M00 A;  4JI5 L;  2UUC L;  1EYD A;  1B70 B;  5C0X J;  4Z9C B;  1K3B C;  2MO1 A;  1TWC B;  1K8A C;  1P8L A;  4XYO A;  3OWE B;  4IFD I;  2C9O A;  1NJI C;  3MAQ A;  4RWS C;  2ATW A;  3GTG H;  1BOS A;  3J81 c;  1Y14 B;  2PW7 A;  4YCW A;  5FLM G;  4RHS A;  1GXD C;  3S1M H;  1STH A;  3TS0 A;  3T1H Q;  4L6T B;  3K5O A;  4QCL A;  2H1E A;  4DUY Q;  4G7H C;  4AYB E;  3X3M A;  1Z47 A;  5JVH 3;  2HCI A;  2Z0S A;  2UU9 Q;  1O7Y A;  1HNW Q;  3VYU A;  1K0R A;  4ZK9 B;  3I4N G;  1RKN A;  2B63 H;  4P75 A;  2KEE A;  2RSN A;  4K5V A;  4QL5 A;  1N8R C;  1CA6 A;  4X64 L;  5IIF A;  4NXN Q;  4WJ4 A;  4YY3 Q;  3J80 c;  4BY1 B;  4CKE A;  1J6Q A;  3K0Y A;  3A54 A;  1W2B A;  1JOR A;  4DV2 L;  2KCT A;  5FK9 C;  1G6P A;  5ISR A;  4ALP A;  4JI8 Q;  5HUR A;  1V43 A;  1Q3L A;  1EYG A;  1HR0 L;  4M1U B;  3I4M G;  1NNX A;  3ULJ A;  1JJC B;  3A8K E;  4A3I H;  3FPP A;  4HCE A;  3UDI A;  2FMM A;  3IFT A;  3MVV A;  2A73 B;  1F9P A;  1I4H A;  5ELO A;  1PV4 A;  1PFM A;  1BUV T;  1A0I A;  3F8T A;  3EFX D;  2K5V A;  4KTA A;  2AKW B;  5M5Y B;  2RDG A;  2BE5 C;  2UXD Q;  2BDO A;  1D5M C;  1TS2 A;  3K7A B;  3NE5 B;  4KY6 A;  4RCN A;  3GTM B;  1V1Q A;  4A3C H;  2E2D C;  4RFB A;  2MFI A;  4QIW E;  4IUT A;  1H9R A;  4IUR A;  1Y8N B;  2Z9H A;  4JBJ A;  3Q24 A;  3S14 B;  3FKI G;  3RUZ A;  3KFU A;  2B2Y A;  1GD7 A;  4FF2 A;  5KNB A;  5ELN A;  1TWF H;  2NZ1 D;  5A2Q L;  3KK7 A;  4RA8 A;  2BDN A;  2RHQ B;  2NWG A;  4NP5 A;  2XVS A;  1O7I A;  1EZ8 A;  2UXB L;  4DAY A;  5C4X G;  1EIH A;  1CKM A;  3HFZ B;  4PMB A;  1PH5 A;  3RZD B;  4DV4 L;  1LUZ A;  3NP8 A;  1SJH D;  2B63 G;  1I6H H;  2E5L L;  2PQE A;  3A5Z B;  4X66 L;  1ROD A;  4RG1 A;  2ZJQ A;  1A62 A;  1HNX Q;  2PNH A;  4RGO S;  1C8C A;  4A76 A;  4L5T A;  5C44 B;  1ICW A;  1TWG H;  2E2J B;  3K6O A;  3QR8 A;  2R92 B;  1A6X A;  1VQM A;  3CRL C;  3S24 A;  2EE1 A;  2R7Z B;  3TN2 A;  5COR A;  5LMN W;  3UDX A;  1E3P A;  3ER0 A;  4BXX H;  1WYD A;  3JAM L;  1SNQ A;  4MIU A;  3VYR A;  3IFD A;  1XWE A;  3G7L A;  1D8L A;  4CJ2 C;  3W1B A;  1LLR D;  1YNX A;  2F0V A;  1PMR A;  4C1N K;  5IWA L;  2VQE Q;  1BDO A;  4KY7 A;  2V1C C;  3F1Z A;  4BBS H;  1LTL A;  1KRT A;  1U4P A;  2MP1 A;  2KHJ A;  3IRB A;  3B6Y A;  1LTT D;  3DM1 A;  4L5Q A;  4FXK C;  4X3S A;  1GVP A;  3KLS A;  1TWC H;  3W2D A;  1XXG A;  2JA6 H;  3DMU A;  1K28 A;  1P16 A;  1Z7T A;  2FIN B;  5KYL A;  3F2B A;  2CH4 W;  2G9D A;  1LV9 A;  3CCL A;  3NEL A;  5IYD H;  2PZT A;  1YZ6 A;  1D5Z C;  1BKB A;  1R9T B;  5JEA J;  2KEN A;  2V4D A;  3H94 A;  2PW5 A;  2NVT B;  1GUS A;  4FF3 A;  1NY4 A;  1NCV A;  3VA5 A;  5T1I A;  2D9U A;  2ENB A;  2F0E A;  2L0C A;  1NUC A;  3F2U A;  4LMQ D;  3G6J B;  4ZQ3 A;  4J15 A;  4QY7 A;  2R7F A;  3HOY G;  1EQR A;  2EOT A;  2HDL A;  1EEI D;  2DN8 A;  5C5L A;  3K5M A;  4IQZ A;  4BY1 H;  1KLG D;  1EFW A;  1VQ7 A;  2K6A A;  4LUZ A;  3M4Y A;  4DV6 L;  1TKW B;  2Z6B A;  3D6W A;  1E2V A;  4CKB A;  1CKO A;  1SJE D;  5ELE A;  2WFW A;  4IPC A;  1SYC A;  3O13 A;  1TU2 B;  2PCF B;  5CR3 A;  1R4P B;  3CRK C;  2UUB Q;  2QEX A;  1SN8 A;  3CQZ B;  3SEB A;  3KOJ A;  3QO2 A;  4B9W A;  2UXC L;  1Q8I A;  2EJG C;  1PVO A;  1V1O A;  2UUA L;  4I65 A;  2WB1 E;  1EEF D;  5K36 H;  3J81 L;  1VQ8 A;  4LF5 Q;  3CCR A;  5M5Y H;  2AUK A;  4X65 Q;  5IYC H;  2JA8 B;  1SNM A;  1ZEQ X;  1I4R A;  3K7A H;  2FXQ A;  5JVG 3;  4HID A;  2E2H B;  3OMG A;  3DWQ A;  1D6E C;  2IHF A;  3GTM H;  2F0U A;  1QG7 A;  3TEH B;  4H02 A;  1VMC A;  1PH7 A;  3SXH A;  4GNX B;  1V9P A;  2PZU A;  3U50 C;  3F2C A;  2AMC B;  1T5X D;  2Y0S E;  4JI5 Q;  2UUC Q;  3K58 A;  4DR4 L;  3P20 A;  1GUN A;  1A3T A;  4RKB A;  4YCU A;  4B3S L;  5IYD G;  4OON A;  5F2D A;  3HOW H;  3J80 L;  3WDN A;  3RZO B;  3EA6 A;  3BDC A;  4WFN 3;  4DKA C;  4UPA A;  1XNQ L;  4L63 B;  3GTP B;  4IOC A;  3A8J E;  5ELC A;  5I4D A;  3H09 A;  3H0G B;  2F0N A;  1I4Q A;  3RZD H;  4KHP L;  1L0X B;  1WOC A;  2E74 C;  1PHJ A;  3M7G A;  2RCN A;  3BDO A;  1VCI A;  2B2V A;  2K5Q A;  1FVI A;  3IL8 A;  3LNN A;  4BY1 G;  4PNY A;  1TS3 A;  3KF8 A;  5C44 H;  3AMU A;  2PQA A;  2ZXO A;  3D0F A;  5EPL A;  3K7U C;  1EY7 A;  5IT9 c;  3I73 A;  1VDZ A;  2E2J H;  4X64 Q;  4DUZ L;  1CKN A;  4ZAI A;  4I7Z C;  5EBD A;  1S5B D;  4K6L A;  3PF4 A;  2R7Z H;  4X3T A;  1WTX A;  2WV6 D;  1SDF A;  2O5I C;  5IYB G;  1HR0 Q;  1E1T A;  4EQ5 A;  1SAP A;  4J8Q A;  3X3N A;  5CV8 A;  3L9A X;  3OPO A;  2M9V A;  3E0E A;  1PRT B;  4A3M B;  4KD4 A;  1X3Q A;  2IX3 A;  4JK1 C;  1QVC A;  5DNF A;  3H91 A;  3C2P A;  1LTB D;  1F9R A;  1N9W A;  1SRU A;  3HOZ H;  1EZ6 A;  1K3R A;  3PO2 H;  2IPK D;  2IL8 A;  4K14 A;  5LL6 S;  4RMF A;  4X3U A;  1TII D;  5I9P A;  1F9Q A;  3S1Q B;  3FPU B;  4IFD H;  3TRE A;  2X6L A;  2E2I B;  1B8A A;  1X3P A;  4TKO B;  4FXD A;  2MO0 A;  1VQL A;  2B2T C;  1JJ2 A;  2OF1 A;  2O4X A;  4BA1 I;  3VR5 A;  3CCJ A;  1PDQ A;  1PYB A;  4HTH A;  1VQE A;  4XIG S;  1R9T H;  1I5F A;  2NVT H;  1RL2 A;  1WCM B;  1VQN A;  4ME3 A;  2EDG A;  5C4H A;  5D3D A;  3EBE A;  3NUC A;  4KKT A;  3WWV A;  5D14 A;  1B9N A;  1ZYR C;  1DON A;  5ELD A;  5G3L D;  2UXB Q;  3NTI A;  1KHI A;  3NK9 A;  4NMZ A;  3A74 A;  4DV4 Q;  1LT3 D;  1EIY B;  3PUY A;  5C44 G;  3HOV B;  2N49 A;  2QDB A;  1MD2 D;  4X66 Q;  1I3Q B;  1QE6 A;  3BVZ A;  5C3W A;  4DNR B;  3T1Y Q;  3K59 A;  2R92 G;  1YVC A;  3FEW X;  2R7Z G;  1U4R A;  4QQB X;  1TWH B;  4OX9 Q;  1SNC A;  4K5W A;  3S2H B;  1DCZ A;  3PGZ A;  4C3H B;  3KDF B;  5KYI A;  1BBX C;  4K2L A;  2A6E C;  1XPU A;  5GRO A;  3CQZ H;  1WFQ A;  3N6R A;  4DV1 L;  1FJG Q;  3S17 B;  1AZQ A;  3AU7 A;  2JSO A;  5DLQ E;  2Q8T A;  1C48 A;  1V1P A;  4AYB B;  3CPW A;  1IKM A;  4PMW A;  2JA8 H;  4ZKC B;  2E2H H;  3L2P A;  3CD6 A;  3VYS A;  5IWA Q;  3SGI A;  4RGN A;  2PZW A;  1WI5 A;  2AQ3 B;  3TSS A;  4IFD G;  3KYH C;  1B44 D;  1YEZ A;  1PH9 A;  4UY8 C;  4S3S A;  5KRU A;  1HCZ A;  1BBW A;  5L37 A;  4IUV A;  2ZXR A;  2EYH A;  3BS1 A;  1F9S A;  1SNP A;  1F2L A;  1HZ9 A;  1CSQ A;  4YWL A;  4RHR A;  3OWF A;  4FO2 A;  4K0K L;  1HA5 A;  2WII B;  3GTP H;  1HZC A;  4FVM A;  3CCE A;  1PH2 A;  3QJY A;  5E7N A;  3C46 A;  4FXG C;  3E5S A;  2XGT A;  2CQA A;  3NEN A;  4A3D H;  5E4W C;  1H9S B;  4JVZ A;  3KF6 A;  2EY1 A;  2MQH A;  2AQ2 B;  2BOS A;  3MZ5 A;  2MJ8 A;  2BH8 A;  1EY6 A;  1EIG A;  1AH9 A;  2ALY B;  4FNF A;  5HGT A;  2JYO A;  4O1N A;  4HJ8 A;  4IFD J;  1KTK A;  2HDM A;  4DV6 Q;  5FLX E;  3RN5 A;  2VUM B;  4DK0 A;  4JI6 L;  4XT1 B;  1B3Q A;  4DFA A;  1PZI D;  2YU9 H;  3ERQ A;  3CC7 A;  5IGE A;  1ET9 A;  4A3M H;  4QUC A;  4IJH A;  3J7A 5;  1HPC A;  3TRZ A;  1VF5 C;  4A3L G;  2Q2U A;  5C6A A;  5IOC A;  2LKV A;  2DJG C;  2FJ2 A;  2ZTD A;  4CKC A;  2UXC Q;  4BBR H;  2JA8 G;  4CHT B;  2UUA Q;  1VQ6 A;  3SVM A;  3S1Q H;  1KXL A;  2Z6K C;  4OL7 A;  1QOH A;  1HNZ Q;  4M8A A;  3HOU B;  3L0O A;  1NSN S;  1E0B A;  2DNC A;  1A63 A;  1QB5 D;  3LGJ A;  1QVF A;  3DEO A;  4HIK A;  5EPJ A;  3P75 A;  1Y1V B;  1GHJ A;  2NVY B;  1PH1 A;  5EKK A;  3RN2 A;  3D31 A;  1O78 A;  1I6H B;  2XN9 C;  2NZH A;  1WCM H;  5IT9 L;  1LO5 D;  5DAU A;  2KA7 A;  2O2L D;  1U9R A;  4LAA A;  3H0G G;  3K81 C;  2L55 A;  4DNI A;  4CGY B;  4A3K B;  1MHW C;  1XNQ Q;  3J81 j;  2OXP A;  1SMY D;  5CV6 A;  1TWG B;  4QJF A;  4POG A;  2KED A;  4YHH L;  4A4I A;  2VW9 A;  3G48 A;  2R93 B;  1SR3 A;  5GQO A;  1BCP F;  3K0X A;  3HOX H;  4KHP Q;  1A2T A;  3HOV H;  1ONL A;  2SDF A;  5E3F A;  5FO9 B;  1EIF A;  2NN6 H;  2XIW A;  3RLO A;  3TP6 A;  4XQJ A;  1S3O A;  4LUO A;  5GAD C;  4E6I A;  5IGG A;  2PO4 A;  1TWH H;  4DR1 L;  4JI7 L;  5LMN L;  2D5D A;  1DD2 A;  2CKZ B;  4C3H H;  4O42 A;  5JJI A;  4R4Q A;  4UHV A;  1OXV A;  4OWT B;  2K14 A;  3KJO A;  2EPB A;  3OYY A;  2LY7 A;  4JI0 Q;  3ICE A;  3MFG A;  2LSS A;  1MBY A;  4A3M G;  1C4Q A;  1W3S A;  3BG3 A;  1PXU A;  4LF6 L;  3UDF A;  5EGT A;  1S5C D;  1AW7 A;  2JA6 B;  2Q2H A;  3CCQ A;  2FMC A;  4MN3 A;  1L0W A;  3DHQ A;  3SR1 A;  1BCP C;  1KDB A;  1K9M C;  2IHE A;  4LFC Q;  5KNC A;  4DR2 L;  1PH3 A;  3IAY A;  3GTO B;  4B08 A;  5C4Z A;  2KQ3 A;  1Q81 C;  2HCC A;  4KMU C;  4DR7 Q;  2VNU D;  3CU7 A;  2J0T D;  1IW7 C;  2K5N A;  2LS0 1;  3OTO Q;  1BQQ T;  3STB C;  4JBM A;  1UE5 A;  1GO3 E;  3S1N B;  1QWY A;  3C3L A;  2YTY A;  3I4O A;  1N34 Q;  1SFO B;  2F0I A;  5EPK A;  3NEM A;  4IPH A;  2K5H A;  1QUQ B;  3CME A;  2DY8 A;  1WCM G;  1X65 A;  1IZ6 A;  4N9P A;  2ZM6 L;  3VDY A;  4C3J B;  1E2Z A;  1HZB A;  4IUU A;  4PV1 C;  1J5E L;  4CBV A;  2L1B A;  1EYC A;  1QIL A;  4ZRZ A;  3A8I E;  5JEA H;  5M3F B;  2WB1 B;  1TY0 A;  3D8G A;  4K8J A;  1X3F A;  2FHT A;  3LX0 A;  3NBH B;  5EKL A;  4IUQ A;  1A3V A;  1BCP B;  2BA1 A;  2ZTC A;  3PO3 B;  2CFM A;  4CDF C;  3BVG A;  5M5W B;  4JI1 L;  2VUM H;  5IGF A;  2R61 A;  2XWB B;  5IGB A;  5DM6 3;  1YI2 A;  4C3H G;  1M1K C;  1TS5 A;  4EVO A;  1ASZ A;  5CV5 A;  3C1F A;  1K83 H;  4GS3 A;  2A6H C;  5CYU A;  2X69 A;  4C2M B;  2TSS A;  1IBL L;  4A3J H;  4HIO A;  4AYB G;  3FMC A;  5AFW A;  2WAQ E;  2DUD A;  3ONA B;  4LF4 Q;  1XMQ Q;  1JJG A;  1G6Z A;  3HOW B;  2NVX B;  4P2C B;  1G29 1;  3CMA A;  3HZX A;  5JJL A;  1HQR D;  1S5D D;  1U4M A;  3NWT A;  3HOU H;  4OWX B;  5FKA C;  4JBW A;  2GVB A;  1VS0 A;  2RQX A;  4NW2 A;  3I72 A;  3MEF A;  4DPG A;  1EWI A;  4DAV A;  3I55 A;  3CF5 A;  2A69 D;  3HKS A;  1Y1V H;  4LWC A;  1JMC A;  2NVY H;  5JJZ A;  3OSO A;  2I5H A;  1QJO A;  3M4P A;  1STG A;  3NQI A;  3PSI A;  4OIK A;  5EBC A;  5H1S E;  1KIX A;  4A3K H;  1L1O C;  2OEO A;  4HJ7 A;  1JR0 D;  2D0P A;  3J7Z C;  4K0K Q;  4OO1 I;  1E24 A;  2R93 H;  1S40 A;  4GLA C;  5JEA G;  1NMF A;  2Z4H A;  1VQ4 A;  2F0K A;  2EXZ A;  4A3I G;  4GOP B;  3G4S A;  5M3M B;  1CUK A;  1A8V A;  5CBA E;  2F52 A;  3MXN A;  3Q6S A;  5M5X H;  2O5J C;  1LTG D;  1PFN A;  2VS1 A;  4FF1 A;  1SE2 A;  3BZC A;  3BDL A;  2EY2 A;  4NB3 A;  2XRQ D;  4ZKB B;  2VUM G;  4R9W A;  2A1A A;  1ICF B;  3HRZ C;  1SE8 A;  3TZU A;  2KUM A;  1Q12 A;  4DR5 L;  3HOZ B;  3PO2 B;  1BNZ A;  4DV7 L;  2PNR C;  4L5R C;  5CGK A;  4L5S A;  2F3I A;  4XDX A;  1BBU A;  4JI6 Q;  4A3C G;  4MHE A;  4NXM L;  4BS9 A;  4FDB A;  3NWS A;  4CDE C;  3V2T A;  1AZP A;  4GKK L;  3S2D B;  1YNN D;  5J3B A;  2F03 A;  1L1O B;  4DR6 Q;  1PYW D;  3IKJ A;  1STN A;  1RJT A;  3BVM A;  3GTO H;  4WOR A;  2DNE A;  3DUZ A;  2K1B A;  3HOU G;  4GLV B;  1BXT A;  5AJ3 Q;  1C0A A;  1IBM L;  3HKZ E;  5M9O A;  2B2U C;  2F0L A;  2K5W A;  3FVQ A;  4HSV A;  1WTQ A;  3TS2 A;  3S1N H;  2VL6 A;  1SNO A;  4KLK A;  2CW0 C;  1Q82 C;  2R3Z A;  1SYE A;  1WJJ A;  1Y1V G;  5T1G A;  3UE1 A;  4GNX C;  1SFO H;  4ID6 A;  1XTD A;  1OXX K;  1HH2 P;  3E9H A;  1A15 A;  3DM3 A;  4C3J H;  5C4J B;  5ELB A;  3TQY A;  5LL6 X;  2F4V Q;  4A3K G;  1QZH A;  4LF9 L;  3QG1 A;  4QB4 A;  3V96 A;  2AQ1 B;  2ZJR A;  2CCZ A;  4P72 A;  2WIN B;  4B3T L;  3R93 A;  2R93 G;  2NN6 I;  1KRS A;  3RNU A;  2QGQ A;  1PRT F;  5M3F H;  2EY5 A;  4LFB L;  1QVG A;  1GKH A;  4C56 C;  1HUM A;  4HED A;  3RD4 A;  4BXX G;  1RTN A;  4YHH Q;  1E1O A;  3LWE A;  4CJ1 B;  2CWP A;  3I2Z A;  5D65 A;  1XNR Q;  3PO3 H;  1EL0 A;  2K05 A;  5M5W H;  2B2T A;  3AYH B;  4DU9 A;  1GUW A;  1J9O A;  1TVX A;  5FLX c;  2IX1 A;  4DK3 C;  4BBS G;  1R4Q B;  2A68 D;  4LF7 L;  1IYU A;  4DR1 Q;  3CHB D;  5LMN Q;  2K4K A;  1PFB A;  1JWU D;  1TY2 A;  5JOB A;  4NDX A;  3L7Z C;  4C1N I;  4C2M H;  1K8O A;  2CVR A;  2JA6 G;  1F2Y A;  1X6O A;  4IN3 A;  3CCU A;  1D1I A;  2KEC A;  5CC4 A;  2EYO A;  4A75 A;  1PRT C;  2JN4 A;  1O7L A;  1O7Z A;  1ILP A;  3WOF A;  2NVX H;  3J81 E;  3UDG A;  2SNM A;  3TP5 A;  2L9H A;  1EU3 A;  1YNJ D;  2VQF L;  1PFS A;  3H3V I;  1W6K A;  4R4O A;  4DR2 Q;  2J7Z A;  1IL8 A;  2B29 A;  2EYP A;  5COY A;  5EKI A;  2RHS B;  3CAM A;  4GKJ L;  3NXW A;  4A3D B;  2EIF A;  2L12 A;  4DXF A;  1CTM A;  2B3G A;  3I4L A;  1N33 L;  1W6J A;  3ERS X;  1NE3 A;  2H4O A;  5CV9 A;  5KND A;  4C3J G;  1SMY C;  3FRP B;  3J80 E;  1ENF A;  4KJO A;  4DAY B;  5C3X A;  4AQY L;  5DM7 3;  1XMO L;  2IT1 A;  2ZM6 Q;  2F3V A;  1G2S A;  5J1Z A;  1B50 A;  2EJM A;  2LXK A;  3D3R A;  5M3F G;  4DV2 Q;  1KC8 C;  2WB1 G;  1PH8 A;  1X56 A;  4HIM A;  2OT2 A;  3SK6 A;  5M3M H;  2F0G A;  4XQN A;  1TQO A;  2YU9 B;  1NBW A;  3NTH A;  2QEJ C;  1WTR A;  2EJF C;  5IY0 A;  1X3E A;  3PO3 G;  1Q90 A;  1KDC A;  2PPB C;  3GD7 A;  2HIX A;  1SYF A;  1N36 L;  1VQK A;  5K36 G;  4HJA A;  4RAU C;  4BBR B;  5IYC G;  2VB3 X;  4R4I A;  2XNA C;  1YHA A;  2EQS A;  2ZTE A;  1SND A;  1HXY D;  5FJ8 H;  2IWH A;  2Q2T A;  1WTV A;  1LTR D;  5CBE E;  5JPN C;  5C5M A;  2K33 A;  3S2D H;  3OMC A;  1IBL Q;  4H7B A;  4QMG A;  3HOW G;  1S5F D;  1EOT A;  2IY5 B;  2F0S A;  3A7L A;  4G4K A;  3T1H L;  1DYQ A;  3T4A C;  4BY7 B;  4DNT B;  1Q1B A;  3GQB A;  2E75 C;  1PYS B;  3D4R A;  2P5Z X;  1YBY A;  1RCV D;  2UU9 L;  2KCM A;  2PI2 A;  4UP9 A;  1HUN A;  4ME5 A;  3GV6 A;  4P71 A;  1G8Z D;  1KAA A;  4NXN L;  5C4J H;  3HOX B;  2HQE A;  4EQO A;  3PMF A;  4ZUI A;  2OQK A;  3K5L A;  3CCV A;  2E5L Q;  4JV5 L;  1DOK A;  1SLJ A;  2Z4I A;  3CCS A;  3T51 B;  1JWS D;  4O0A A;  4LJZ C;  2YTX A;  2JQO A;  2F0Q A;  1SEB D;  1JIC A;  1I6V C;  4JI3 L;  2L5T A;  1F2M A;  3ERO A;  1NMG A;  3Q8D A;  5IP9 H;  1XYI A;  1LTI D;  1UEA B;  3I7F A;  2Z6K A;  1GUT A;  2I07 B;  5IGC A;  1H9K A;  2OTJ A;  4JW0 A;  4DN4 M;  2SEB D;  1O80 A;  1Z9F A;  4KKS A;  3FP9 A;  1GUO A;  2B8F A;  2C35 B;  3S9W A;  1Y1W B;  4KY5 A;  3HOZ G;  2ZJP A;  4K2K A;  3PO2 G;  3PV0 A;  1YJN A;  3I91 A;  1CQV A;  2NTT A;  5TSS A;  4X6A H;  2XRS D;  1G91 A;  4DR5 Q;  1VQB A;  2F0P A;  4BA2 I;  5FJ8 G;  4X3K A;  4DV7 Q;  3C1E A;  2XSC A;  2K7V A;  5E4X A;  1ASY A;  4NXM Q;  1KD1 C;  1GJX A;  1XPO A;  1TR5 A;  4GN3 B;  4TSS A;  1FNV A;  3QOL A;  2QCP X;  1T9H A;  1UNS A;  4F7X A;  1PH4 A;  1ENC A;  3FDT A;  1GUG A;  1UE7 A;  4FYD A;  1U0L A;  1EY8 A;  4DV5 L;  2G5D A;  2RA4 A;  1IBK L;  1HNX L;  2Q8I B;  2AHO B;  1PLF A;  4OO1 H;  2R6G A;  4DF7 A;  4LNQ A;  5KGU A;  3A56 A;  1HTP A;  2MUY A;  1JOO A;  4UAI A;  2EVB A;  3M7N A;  5I2Y A;  5FLX L;  1EOV A;  2SNS A;  4LF9 Q;  2F4I A;  1PZJ D;  3NBH A;  2M2L A;  2NTS A;  3TP7 A;  4Y52 H;  4QIW B;  1Q86 C;  4A3G B;  1CHQ D;  3KLW A;  2WAQ B;  3DLL A;  5IP7 H;  4B3T Q;  2EYM A;  2OCE A;  3SDZ A;  3OIQ A;  2HT1 A;  3G6E A;  4APV A;  2PQA B;  4LFB Q;  4KN7 C;  3NSW A;  3TBI B;  1K83 B;  1CHP D;  2E8G A;  1ESF A;  1SRO A;  4ZCK A;  1SYD A;  4A3J B;  1CM9 A;  4UP8 A;  1AE2 A;  2N8N A;  3PIO A;  3GO5 A;  2K32 A;  1L2F A;  1X3G A;  4IPG A;  1YJ9 A;  3GTL H;  4A3F B;  2F0D A;  1TWA B;  5CV7 A;  1NR4 A;  2ZXP A;  3CC4 A;  4ABN A;  1Y69 U;  1MIU A;  3VR3 A;  1FR3 A;  3KBG A;  2BA0 A;  4O2D A;  3OOC A;  3NTK A;  2I5M X;  2B8G A;  1G2T A;  3NPP A;  4MNO A;  2D62 A;  4DR4 Q;  4BY7 H;  2IX0 A;  4PZ7 A;  1NR2 A;  1PA6 A;  3A55 A;  3KUP A;  4B3S Q;  4RGM A;  3ZJY C;  4Y7N B;  2E76 C;  2TMP A;  3ULL A;  1PTO D;  4XTC S;  5DEH A;  3BYT B;  1LM0 A;  4A3D G;  4JBK A;  4IJL A;  4IOA A;  4DK6 C;  2KCC A;  3PQI A;  1BO0 A;  2Z8L A;  4JOI C;  1XPR A;  3PUZ A;  3D4D A;  4OO1 G;  5C3E B;  2DJF C;  2MNA A;  1I4P A;  1XTC D;  3MXP A;  1HTL D;  1RTO A;  1M8A A;  4KV6 A;  4ZUJ A;  2NVQ B;  2PMZ E;  3ITP A;  5M5X B;  5IT9 E;  1IHZ A;  1VQF A;  3R2I A;  4DR3 L;  1FNW A;  1FL0 A;  1XMO Q;  3MFY A;  4ODG A;  1AEX A;  3VR6 A;  2UUB L;  4DUZ Q;  1VQA A;  1UAP A;  3DWA A;  2JA5 B;  3MA2 B;  1KNE A;  1U5K A;  4HMJ A;  4QF4 A;  2BH2 A;  1U4L A;  5I6W A;  1EYA A;  1F2Z A;  2JK8 A;  5I2X A;  3HKZ B;  1I94 L;  1Y1W H;  1AE3 A;  1MSH A;  5CV4 A;  4BBR G;  1CZG A;  4JCV E;  1HZA A;  2GVA A;  1VQO A;  3CP0 A;  3OW2 A;  1N36 Q;  1IKL A;  1JOQ A;  1EQT A;  1EY4 A;  1L1O A;  5NUC A;  2AWN A;  3W1G A;  1OO9 B;  1UE6 A;  1V1P B;  5I6Y A;  1N32 L;  1CI3 M;  4V0B A;  1PZK D;  5GAG C;  1FNU A;  1YNJ C;  2PYK A;  4A3E B;  3FKI H;  3H3V H;  4KKU A;  4BY7 G;  2I46 A;  5KEE A;  1TXY A;  1VQH A;  1JE5 A;  1I4X A;  1D5X C;  3HEJ A;  3HS0 C;  1LT5 D;  4N9T A;  5LMU L;  5FO7 B;  1YIT A;  3S15 B;  5E1F A;  2VB2 X;  4RH6 A;  5FO8 B;  3GTK B;  3A7A B;  2WKC A;  4HJ5 A;  5C4X H;  3AFQ A;  1VQD A;  1NTG A;  3HOX G;  1EU4 A;  1VMP A;  3HOV G;  4HCS A;  2ES2 A;  2NN6 G;  3BU2 A;  1ZYR D;  3RLF A;  1AP0 A;  2F0O A;  2I5L X;  3UI2 A;  1WD1 A;  3T53 B;  1C7Y A;  3KF6 B;  4EQP A;  3M4O B;  4JV5 Q;  4A3G H;  2ICI A;  4JYA L;  2B2W C;  2Y0S B;  5D3I B;  1JT8 A;  3RMH A;  1GOZ A;  4WJ3 M;  1MJE A;  1JQY D;  4HAE A;  5ELF A;  4JI3 Q;  1WTH A;  3BZD B;  3K8A A;  1XJV A;  2B2U A;  2QA4 A;  1JB3 A;  1V8Q A;  5G3L F;  4DV1 Q;  2A6E D;  4J1M A;  4GOP C;  1Y1W G;  3HP3 A;  3D6C A;  4OXP A;  4GNX A;  2IJ0 A;  4X62 L;  3U9O A;  2YYZ A;  3CXC A;  2NUC A;  1VQG A;  3T16 A;  1JC7 A;  4A3F H;  1WTW A;  1TWA H;  1VF7 A;  1H9J A;  2EYF A;  4EQN A;  1I50 H;  4YIJ A;  3U58 A;  1EY0 A;  1D2B A;  3EIV A;  1G51 A;  4IUP A;  1S5E D;  2GN5 A;  5BN3 A;  1AN8 A;  1HRJ A;  4EX5 A;  1DOM A;  2EYJ A;  2YV5 A;  2HHH L;  1ET6 A;  3UE0 A;  1EWH A;  4Y7N H;  5JJK A;  3N52 A;  1OXS C;  5A2Q E;  3OW7 A;  4PG3 A;  5CMD A;  4HJ9 A;  5C0X I;  2JE6 I;  2JP1 A;  2K50 A;  1E7Z A;  4PZ6 A;  3PUX A;  5C3E H;  4DV5 Q;  4G7O C;  3HOY H;  4LK1 C;  3M9B A;  1M4V A;  4P73 A;  2NVQ H;  1IBK Q;  4LFA L;  2N55 A;  3T1Y L;  1UE1 A;  3GV3 A;  1H95 A;  1QZG A;  4OX9 L;  2JA9 A;  4B3R L;  3BYY B;  4A3G G;  2WAQ G;  2KHI A;  2LMC B;  3S1R B;  4V19 0;  3PIO 3;  5LHY 1;  1SE4 A;  2G9H D;  3OHX C;  2JA5 H;  2LFN A;  4K8I A;  1FJG L;  2PI2 E;  1L0Y B;  4F8M A;  4K5X A;  1EY9 A;  4WRD A;  1MSG A;  4MTK A;  2L15 A;  1VQC A;  2I0Q A;  4J6H A;  3Q23 A;  1DM0 B;  3BJU A;  3JAM E;  2JA7 B;  4A3J G;  1CFM A;  4LF8 L;  3EJI A;  4IZ8 A;  4HR7 B;  4LW1 A;  5I9O A;  1STA A;  5IGD A;  4MTN A;  4A3F G;  1JWM D;  1QCB D;  2WP8 J;  4GZY C;  1B9M A;  3TME A;  4H44 C;  4ILW A;  4XQQ A;  5EAY A;  4IAL A;  4MZ9 A;  1HA6 A;  3QIA A;  3MXU A;  1Z6H A;  1TS4 A;  4FF4 A;  4A3E H;  1CZW A;  3U4V A;  1PH6 A;  3PIP A;  2K03 A;  2VXW A;  1HQM C;  2DY7 A;  1SXT A;  4YWK A;  1STY A;  5HGQ A;  5JPM C;  3DEP A;  2HQL A;  1D1K A;  2XWJ B;  4ULL A;  3FHW A;  3MWY W;  3S15 H;  1GM5 A;  2R7D A;  3GTK H;  3I8Z A;  2MPM A;  5IOD A;  3TZD A;  4DGZ A;  4OHJ A;  1HR0 W;  2QIL A;  5C3E G;  3S16 B;  1Y8O B;  2B2Y C;  1D7Q A;  4OEL B;  4TQU S;  1ILQ A;  2ZT9 C;  4ZYS A;  3R8B A;  3E0J A;  3KDF A;  1ZKO A;  3I70 A;  4PZ8 A;  2EXD A;  1FGB D;  3M4O H;  2X6G A;  3CC2 A;  3KLR A;  1FD7 D;  2L4N A;  4KD3 A;  4XXE A;  4N8F A;  2LXJ A;  4IO9 A;  1SMX A;  1FGU A;  5GAE C;  1JE4 A;  3EQL C;  3SHL A;  4DK1 A;  4F88 A;  1BR9 A;  3GTJ B;  3E6Z X;  1EUJ A;  4DR3 Q;  1YJW A;  2C5C A;  2JA5 G;  4JI7 Q;  5IYB H;  1PTO F;  4H13 C;  1I4G A;  3HGB A;  2CHB D;  5BR8 L;  3GDE A;  4A3B B;  1ESR A;  2F0T A;  4GN4 B;  3R2T A;  1B4O A;  3HG9 A;  3HKZ G;  2CH4 A;  4JI2 L;  2CWA A;  2K28 A;  3JC6 6;  4POF A;  5EJW A;  2N78 A;  1Y8P B;  3BZK A;  4C3I B;  1C9O A;  3H15 A;  4LF6 Q;  4OGQ C;  4PQX A;  1EFI D;  1I94 Q;  4DV3 L;  3SK8 A;  1IYV A;  2OQ0 A;  2NZO A;  3SK5 A;  2J4X A;  3PF5 A;  1HNZ L;  5EQ0 A;  3QB3 A;  1RHP A;  1MJC A;  4BWG B;  3MTS A;  3QOJ A;  2RDF A;  4R4C A;  1BCP D;  1LTA D;  1SSO A;  2VZA A;  3TP8 A;  4RKL A;  3M3Y B;  4NPS A;  3S14 H;  4A3E G;  4GLX A;  2K04 A;  1N32 Q;  4JI4 L;  4B3M L;  1IW7 D;  2EYL A;  3STB D;  3NHH A;  1H9S A;  1B2T A;  1ENA A;  4U68 A;  2QF7 A;  1PTO C;  3GP7 A;  1II3 A;  2KCN A;  3W3A A;  4A93 B;  1LT6 D;  3GTQ B;  3NQT A;  2NBF A;  4CDC C;  2D0O A;  1FYC A;  4KK7 A;  1UEB A;  4R1J A;  2JEA I;  1J5E Q;  1WTP A;  4TVA B;  3JAM i;  5LMU Q;  4WJW A;  1HFN A;  5KIX A;  4DV0 L;  1LYL A;  4TRD A;  1YHQ A;  2K5D A;  1ML0 D;  2KHS A;  3AQQ A;  4UDU C;  4YCV A;  1DJR D;  2MHV A;  4AH6 A;  2BCO A;  4CJ0 B;  1HJP A;  3L3O C;  2QKI C;  2Y0S G;  3RLN A;  2RCF A;  3S1R H;  2R92 H;  1CT1 D;  5BN5 A;  1CK1 A;  2KJX A;  4JI0 L;  1RIP A;  4OEM B;  5IE8 A;  3MXN B;  4JYA Q;  4JI1 Q;  4KHZ A;  2JEB I;  2RKS A;  3GTL B;  4P74 A;  4KJN A;  1KAW A;  2JA7 H;  1M90 C;  1OTC A;  2BE5 D;  2A6H D;  3K57 A;  1PTO B;  3I90 A;  4PMC A;  4LFC L;  2GA4 B;  4DAM A;  1RF2 D;  1K8G A;  4QGU A;  4X62 Q;  2OTL A;  4DR7 L;  2K52 A;  2RSO A;  2SOB A;  4U67 3;  3DWP A;  4RGT A;  1X32 A;  5HY6 A;  4DUY L;  2NB0 A;  1OXT A;  2A74 C;  3OTO L;  1S72 A;  1T5E A;  1WTO A;  4ZLT F;  4QUF A;  1HNW L;  3CW2 C;  4Q0F A;  3H6M A;  2PMZ B;  1N34 L;  2N88 A;  2F0F A;  1Q46 A; 
#chains in the Genus database with same CATH homology
 3VR4 A;  1RD9 D;  3ZYY X;  4R8I A;  1E2W A;  2Z1C A;  3I4N B;  2F3W A;  3ND9 A;  2F1M A;  3Q22 A;  3H3V C;  1MGS A;  4B9X A;  5JAV A;  4KN4 C;  2IW3 A;  1CQF A;  1SYG A;  2RDH A;  3I4M B;  3U9S A;  1B53 A;  5A35 A;  3MHB A;  3LWU A;  2EZV A;  3MC0 B;  4KHV A;  2F0J A;  4NKL A;  3URY A;  2RBM A;  3T13 A;  2B2V C;  3VR2 A;  3J7A V;  4DXG A;  2ID0 A;  4HMI A;  2RVL A;  1KAB A;  3KBX A;  3WOE A;  1RDP D;  4DAP A;  3PIP 3;  1J8I A;  3FKI B;  5J22 A;  2AUJ D;  3GTG B;  2B39 A;  1K8M A;  3AB9 A;  1F77 A;  2A69 C;  2KOL A;  3S1M B;  4G7Z C;  1KDA A;  4KI0 A;  2JXM B;  3Q0A A;  1DOL A;  3PUW A;  2MGS A;  2AWO A;  5C4X B;  1AFP A;  3P7J A;  1EQV A;  2B63 B;  2CW0 D;  1H9M A;  1SE3 A;  1HFG A;  4G57 A;  5J39 A;  5BN4 A;  3KLS X;  5C0X H;  4L8J A;  3PUV A;  5FOB B;  1S4Z A;  4RCO A;  1QNU A;  2Q8R E;  3P1H A;  1B3A A;  3TDQ A;  3OIP A;  1KLU D;  4A3I B;  1SBB B;  2F0H A;  5K5P A;  1WVL A;  3V05 A;  4XYQ A;  1KNA A;  2D2C C;  1JCK B;  4EGV A;  4K6D A;  1I50 B;  3DXJ C;  4C3I G;  1YNN C;  1Q1E A;  3CKI B;  4H0L C;  3MEH A;  1PTO H;  3R3O A;  2KVM A;  3VYT A;  2EY6 A;  2NYZ D;  1DZ1 A;  1QNK A;  1XX8 A;  2F0W A;  1EY5 A;  1PRT D;  1LAB A;  1LAC A;  1TWF B;  4Q5V A;  4F87 A;  2F0M A;  3D4W A;  3I3C A;  1JOK A;  2L11 A;  3T56 B;  2ICE C;  2B2W A;  1WD0 A;  1BF4 A;  1SYB A;  2K01 A;  1B1Z A;  4FP5 D;  2A5H A;  1MI2 A;  4OIJ A;  2FFK B;  3HOY B;  3J7A F;  5C0X G;  3ND8 A;  1EWC A;  4HSP A;  1UUP A;  3VA7 A;  3MXG A;  4DA2 A;  1TT2 A;  3SK4 A;  3NBI A;  3EVQ A;  1CA5 A;  1LTS D;  1STE A;  2WKD A;  2HUG A;  3SE0 A;  3QWN A;  1GHK A;  1A2U A;  1NAP A;  1ZXT A;  2A68 C;  4HN7 A;  1STB A;  1LT4 D;  4R8N A;  2WAC A;  1OXU A;  1A3U A;  3J7Y W;  3M85 A;  1DXM A;  4IUN A;  4XT3 B;  4BBS B;  3K5N A;  1HHV A;  2M00 A;  1EYD A;  5C0X J;  4Z9C B;  1TWC B;  4XYO A;  3OWE B;  4IFD I;  2C9O A;  3MAQ A;  4RWS C;  1BOS A;  2PW7 A;  4RHS A;  1GXD C;  1STH A;  4L6T B;  3K5O A;  4QCL A;  2H1E A;  4G7H C;  3X3M A;  1Z47 A;  5JVH 3;  2HCI A;  1O7Y A;  3VYU A;  4ZK9 B;  1RKN A;  2KEE A;  2RSN A;  4K5V A;  1CA6 A;  5IIF A;  4BY1 B;  4CKE A;  3K0Y A;  3A54 A;  1JOR A;  5FK9 C;  5ISR A;  5HUR A;  1V43 A;  1Q3L A;  4M1U B;  3A8K E;  3FPP A;  4HCE A;  2FMM A;  3IFT A;  3MVV A;  2A73 B;  1F9P A;  1I4H A;  1PFM A;  1BUV T;  3EFX D;  4KTA A;  5M5Y B;  2RDG A;  2BE5 C;  2BDO A;  1D5M C;  1TS2 A;  3K7A B;  3NE5 B;  4KY6 A;  4RCN A;  3GTM B;  2E2D C;  4RFB A;  4IUT A;  1H9R A;  4IUR A;  1Y8N B;  3Q24 A;  3S14 B;  3RUZ A;  2B2Y A;  4FF2 A;  5KNB A;  2NZ1 D;  5A2Q L;  3KK7 A;  4RA8 A;  2BDN A;  2NWG A;  4NP5 A;  2XVS A;  1EZ8 A;  4DAY A;  1EIH A;  4PMB A;  3RZD B;  3NP8 A;  1SJH D;  2PQE A;  1ROD A;  4RGO S;  1C8C A;  5C44 B;  1ICW A;  2E2J B;  3K6O A;  2R92 B;  1A6X A;  3CRL C;  2EE1 A;  2R7Z B;  3TN2 A;  5COR A;  3JAM L;  1SNQ A;  4MIU A;  3VYR A;  3IFD A;  1XWE A;  3G7L A;  4CJ2 C;  1LLR D;  2F0V A;  1PMR A;  4C1N K;  1BDO A;  4KY7 A;  1U4P A;  2MP1 A;  1LTT D;  3DM1 A;  4FXK C;  4X3S A;  3KLS A;  3W2D A;  1XXG A;  3DMU A;  1Z7T A;  2FIN B;  5KYL A;  2G9D A;  1LV9 A;  2PZT A;  1D5Z C;  1R9T B;  5JEA J;  2V4D A;  3H94 A;  2PW5 A;  2NVT B;  1GUS A;  4FF3 A;  1NCV A;  3VA5 A;  5T1I A;  2D9U A;  2ENB A;  2F0E A;  2L0C A;  1NUC A;  3F2U A;  4LMQ D;  3G6J B;  4ZQ3 A;  2EOT A;  2HDL A;  1EEI D;  2DN8 A;  5C5L A;  3K5M A;  4IQZ A;  1KLG D;  2K6A A;  3M4Y A;  1TKW B;  3D6W A;  1E2V A;  4CKB A;  1SJE D;  5ELE A;  1SYC A;  3O13 A;  1TU2 B;  2PCF B;  5CR3 A;  1R4P B;  3CRK C;  3CQZ B;  3SEB A;  3QO2 A;  4B9W A;  1Q8I A;  2EJG C;  1V1O A;  4I65 A;  5K36 H;  1EEF D;  3J81 L;  2AUK A;  2JA8 B;  1SNM A;  1ZEQ X;  1I4R A;  2E2H B;  5JVG 3;  3OMG A;  3DWQ A;  1D6E C;  2F0U A;  1QG7 A;  1VMC A;  3SXH A;  2PZU A;  1T5X D;  3K58 A;  3P20 A;  1GUN A;  1A3T A;  4RKB A;  5F2D A;  3J80 L;  3WDN A;  3RZO B;  3EA6 A;  3BDC A;  4WFN 3;  4L63 B;  3GTP B;  3A8J E;  5ELC A;  5I4D A;  3H09 A;  3H0G B;  2F0N A;  1I4Q A;  1L0X B;  2E74 C;  3M7G A;  3BDO A;  1VCI A;  2B2V A;  2K5Q A;  3IL8 A;  3LNN A;  4PNY A;  1TS3 A;  3KF8 A;  3AMU A;  2ZXO A;  5EPL A;  1EY7 A;  3I73 A;  1VDZ A;  4ZAI A;  4I7Z C;  5EBD A;  1S5B D;  4K6L A;  4X3T A;  1WTX A;  2WV6 D;  1SDF A;  2O5I C;  1SAP A;  4J8Q A;  3X3N A;  5CV8 A;  3L9A X;  3OPO A;  2M9V A;  1PRT B;  4A3M B;  4KD4 A;  1X3Q A;  2IX3 A;  4JK1 C;  5DNF A;  3H91 A;  3C2P A;  1LTB D;  1F9R A;  1EZ6 A;  2IPK D;  2IL8 A;  4K14 A;  5LL6 S;  4X3U A;  1TII D;  5I9P A;  1F9Q A;  3S1Q B;  3FPU B;  4IFD H;  2X6L A;  2E2I B;  1X3P A;  4TKO B;  4FXD A;  2B2T C;  2OF1 A;  2O4X A;  4BA1 I;  3VR5 A;  1PDQ A;  4HTH A;  4XIG S;  1WCM B;  2EDG A;  5C4H A;  5D3D A;  3NUC A;  4KKT A;  5D14 A;  1B9N A;  1ZYR C;  1DON A;  5ELD A;  5G3L D;  3NTI A;  3NK9 A;  4NMZ A;  1LT3 D;  3PUY A;  3HOV B;  2QDB A;  1MD2 D;  1I3Q B;  1QE6 A;  3BVZ A;  5C3W A;  4DNR B;  3K59 A;  3FEW X;  1U4R A;  1TWH B;  1SNC A;  4K5W A;  3S2H B;  1DCZ A;  4C3H B;  5KYI A;  1BBX C;  4K2L A;  2A6E C;  3N6R A;  3S17 B;  1AZQ A;  3AU7 A;  2JSO A;  2Q8T A;  1C48 A;  1V1P A;  4AYB B;  1IKM A;  4PMW A;  4ZKC B;  3VYS A;  4RGN A;  2PZW A;  2AQ3 B;  3TSS A;  4IFD G;  1B44 D;  4S3S A;  5KRU A;  1HCZ A;  4IUV A;  2ZXR A;  2EYH A;  3BS1 A;  1F9S A;  1SNP A;  1F2L A;  4RHR A;  3OWF A;  4FO2 A;  1HA5 A;  2WII B;  4FVM A;  3QJY A;  3C46 A;  4FXG C;  3E5S A;  2CQA A;  5E4W C;  1H9S B;  2EY1 A;  2AQ2 B;  2BOS A;  3MZ5 A;  2MJ8 A;  1EY6 A;  1EIG A;  4FNF A;  5HGT A;  2JYO A;  4O1N A;  4IFD J;  1KTK A;  2HDM A;  5FLX E;  2VUM B;  4DK0 A;  4XT1 B;  4DFA A;  1PZI D;  3ERQ A;  5IGE A;  1ET9 A;  4QUC A;  1HPC A;  1VF5 C;  5C6A A;  5IOC A;  2LKV A;  2FJ2 A;  4CKC A;  4CHT B;  3SVM A;  4OL7 A;  1QOH A;  3HOU B;  4M8A A;  1NSN S;  1E0B A;  2DNC A;  1QB5 D;  3DEO A;  5EPJ A;  3P75 A;  1Y1V B;  1GHJ A;  2NVY B;  5EKK A;  3D31 A;  1O78 A;  1I6H B;  2XN9 C;  5IT9 L;  1LO5 D;  5DAU A;  2KA7 A;  2O2L D;  1U9R A;  4LAA A;  4A3K B;  2L55 A;  4CGY B;  2OXP A;  1SMY D;  5CV6 A;  1TWG B;  2KED A;  2R93 B;  1BCP F;  1A2T A;  1ONL A;  2SDF A;  5E3F A;  5FO9 B;  2NN6 H;  2XIW A;  3TP6 A;  4XQJ A;  4E6I A;  5IGG A;  2PO4 A;  2D5D A;  1DD2 A;  4O42 A;  1OXV A;  2EPB A;  2LY7 A;  3MFG A;  1MBY A;  1C4Q A;  3BG3 A;  1PXU A;  5EGT A;  1S5C D;  1AW7 A;  2JA6 B;  2FMC A;  4MN3 A;  3DHQ A;  3SR1 A;  1BCP C;  1KDB A;  5KNC A;  3IAY A;  3GTO B;  4B08 A;  5C4Z A;  2KQ3 A;  2HCC A;  4KMU C;  2VNU D;  3CU7 A;  2J0T D;  1IW7 C;  2LS0 1;  1BQQ T;  3S1N B;  1QWY A;  3C3L A;  1SFO B;  2F0I A;  5EPK A;  2DY8 A;  4N9P A;  4C3J B;  1E2Z A;  4IUU A;  4PV1 C;  4CBV A;  2L1B A;  1EYC A;  1QIL A;  4ZRZ A;  3A8I E;  5JEA H;  5M3F B;  2WB1 B;  1TY0 A;  3D8G A;  4K8J A;  2FHT A;  3LX0 A;  5EKL A;  4IUQ A;  1A3V A;  1BCP B;  2BA1 A;  3PO3 B;  3BVG A;  5M5W B;  5IGF A;  2R61 A;  2XWB B;  5IGB A;  5DM6 3;  4C3H G;  1TS5 A;  4EVO A;  5CV5 A;  3C1F A;  2A6H C;  5CYU A;  2X69 A;  4C2M B;  2TSS A;  3FMC A;  5AFW A;  3ONA B;  1G6Z A;  3HOW B;  2NVX B;  4P2C B;  1G29 1;  3HZX A;  1HQR D;  1S5D D;  1U4M A;  3NWT A;  5FKA C;  4JBW A;  2RQX A;  4NW2 A;  3I72 A;  4DAV A;  2A69 D;  5JJZ A;  3OSO A;  1QJO A;  1STG A;  3NQI A;  4OIK A;  5EBC A;  2OEO A;  1JR0 D;  4OO1 I;  5JEA G;  2Z4H A;  2F0K A;  2EXZ A;  5M3M B;  5CBA E;  3MXN A;  3Q6S A;  2O5J C;  1LTG D;  1PFN A;  4FF1 A;  1SE2 A;  3BDL A;  2EY2 A;  2XRQ D;  4ZKB B;  4R9W A;  3HRZ C;  3TZU A;  2KUM A;  1Q12 A;  3HOZ B;  3PO2 B;  1BNZ A;  2PNR C;  5CGK A;  4XDX A;  4MHE A;  4BS9 A;  3NWS A;  3V2T A;  1AZP A;  3S2D B;  1YNN D;  2F03 A;  1PYW D;  3IKJ A;  1STN A;  1RJT A;  3BVM A;  4WOR A;  2DNE A;  3DUZ A;  2K1B A;  1BXT A;  5M9O A;  2B2U C;  2F0L A;  2K5W A;  3FVQ A;  4HSV A;  1WTQ A;  1SNO A;  2CW0 C;  2R3Z A;  1SYE A;  5T1G A;  4ID6 A;  1OXX K;  1A15 A;  5C4J B;  5ELB A;  5LL6 X;  3QG1 A;  4QB4 A;  3V96 A;  2AQ1 B;  2WIN B;  3R93 A;  2NN6 I;  1PRT F;  2EY5 A;  4C56 C;  1HUM A;  4HED A;  3RD4 A;  1RTN A;  3LWE A;  4CJ1 B;  5D65 A;  1EL0 A;  2K05 A;  2B2T A;  4DU9 A;  1GUW A;  1J9O A;  1TVX A;  2IX1 A;  1R4Q B;  2A68 D;  1IYU A;  3CHB D;  1PFB A;  1JWU D;  1TY2 A;  5JOB A;  4NDX A;  3L7Z C;  4C1N I;  1K8O A;  2CVR A;  1F2Y A;  4IN3 A;  1D1I A;  2KEC A;  5CC4 A;  2EYO A;  1PRT C;  1O7L A;  1O7Z A;  1ILP A;  3WOF A;  3J81 E;  2SNM A;  3TP5 A;  2L9H A;  1EU3 A;  1YNJ D;  1W6K A;  2J7Z A;  1IL8 A;  2EYP A;  5COY A;  5EKI A;  3NXW A;  4A3D B;  4DXF A;  2L12 A;  1CTM A;  3I4L A;  1W6J A;  2H4O A;  5CV9 A;  5KND A;  4C3J G;  1SMY C;  3FRP B;  3J80 E;  1ENF A;  4KJO A;  5C3X A;  5DM7 3;  2IT1 A;  2F3V A;  1G2S A;  5J1Z A;  1B50 A;  2EJM A;  3D3R A;  2OT2 A;  3SK6 A;  2F0G A;  4XQN A;  1TQO A;  2YU9 B;  3NTH A;  2QEJ C;  1WTR A;  2EJF C;  1Q90 A;  1KDC A;  2PPB C;  3GD7 A;  1SYF A;  5K36 G;  4RAU C;  4BBR B;  2VB3 X;  2XNA C;  1SND A;  1HXY D;  2IWH A;  1WTV A;  1LTR D;  5CBE E;  5JPN C;  5C5M A;  2K33 A;  3OMC A;  4H7B A;  4QMG A;  1S5F D;  1EOT A;  2F0S A;  3A7L A;  4G4K A;  1DYQ A;  3T4A C;  4BY7 B;  4DNT B;  1Q1B A;  3GQB A;  2E75 C;  3D4R A;  1RCV D;  1HUN A;  4ME5 A;  3GV6 A;  1G8Z D;  1KAA A;  3HOX B;  4EQO A;  2HQE A;  3PMF A;  4ZUI A;  3K5L A;  1DOK A;  2Z4I A;  3T51 B;  1JWS D;  4LJZ C;  2F0Q A;  1SEB D;  1JIC A;  1I6V C;  2L5T A;  1F2M A;  3ERO A;  1XYI A;  1LTI D;  1UEA B;  1GUT A;  2I07 B;  5IGC A;  1H9K A;  4DN4 M;  2SEB D;  1O80 A;  4KKS A;  1GUO A;  2B8F A;  3S9W A;  1Y1W B;  4KY5 A;  4K2K A;  3PV0 A;  3I91 A;  1CQV A;  2NTT A;  5TSS A;  2XRS D;  1G91 A;  2F0P A;  4BA2 I;  4X3K A;  3C1E A;  2XSC A;  2K7V A;  5E4X A;  1GJX A;  1TR5 A;  4TSS A;  1FNV A;  3QOL A;  2QCP X;  1UNS A;  4F7X A;  1ENC A;  3FDT A;  1GUG A;  4FYD A;  1EY8 A;  2RA4 A;  2Q8I B;  1PLF A;  4OO1 H;  2R6G A;  4DF7 A;  5KGU A;  3A56 A;  1HTP A;  2MUY A;  1JOO A;  4UAI A;  2EVB A;  3M7N A;  5I2Y A;  5FLX L;  2SNS A;  2F4I A;  1PZJ D;  2M2L A;  3NBH A;  2NTS A;  3TP7 A;  4QIW B;  4A3G B;  1CHQ D;  2WAQ B;  2EYM A;  3SDZ A;  3OIQ A;  4KN7 C;  3NSW A;  3TBI B;  1K83 B;  1CHP D;  1ESF A;  1SYD A;  4A3J B;  1CM9 A;  3GO5 A;  2K32 A;  4A3F B;  2F0D A;  1TWA B;  5CV7 A;  1NR4 A;  2ZXP A;  4ABN A;  1Y69 U;  3VR3 A;  1FR3 A;  3KBG A;  2BA0 A;  3OOC A;  3NTK A;  2B8G A;  1G2T A;  3NPP A;  2D62 A;  2IX0 A;  1NR2 A;  3A55 A;  3KUP A;  4RGM A;  4Y7N B;  2E76 C;  2TMP A;  1PTO D;  4XTC S;  5DEH A;  3BYT B;  2KCC A;  1BO0 A;  2Z8L A;  3PUZ A;  3D4D A;  4OO1 G;  5C3E B;  1I4P A;  1XTC D;  3MXP A;  1HTL D;  1RTO A;  1M8A A;  4KV6 A;  4ZUJ A;  2NVQ B;  3ITP A;  5M5X B;  5IT9 E;  1IHZ A;  3R2I A;  1FNW A;  3MFY A;  4ODG A;  1AEX A;  3VR6 A;  1UAP A;  3DWA A;  2JA5 B;  3MA2 B;  1KNE A;  4HMJ A;  4QF4 A;  1U4L A;  5I6W A;  1EYA A;  1F2Z A;  5I2X A;  3HKZ B;  1MSH A;  5CV4 A;  1CZG A;  1IKL A;  1JOQ A;  1EQT A;  1EY4 A;  5NUC A;  2AWN A;  1OO9 B;  1V1P B;  5I6Y A;  1CI3 M;  4V0B A;  1PZK D;  1FNU A;  1YNJ C;  2PYK A;  4A3E B;  4KKU A;  2I46 A;  5KEE A;  1I4X A;  1D5X C;  3HEJ A;  3HS0 C;  1LT5 D;  4N9T A;  5FO7 B;  3S15 B;  5E1F A;  2VB2 X;  4RH6 A;  5FO8 B;  3GTK B;  3A7A B;  2WKC A;  1EU4 A;  1VMP A;  4HCS A;  2NN6 G;  1ZYR D;  3RLF A;  1AP0 A;  2F0O A;  1WD1 A;  3UI2 A;  3T53 B;  4EQP A;  3M4O B;  2ICI A;  2B2W C;  2Y0S B;  5D3I B;  3RMH A;  1GOZ A;  1JQY D;  4HAE A;  5ELF A;  3BZD B;  2B2U A;  1JB3 A;  1V8Q A;  5G3L F;  2A6E D;  4J1M A;  3HP3 A;  3D6C A;  2IJ0 A;  3U9O A;  2YYZ A;  2NUC A;  3T16 A;  1JC7 A;  1WTW A;  1VF7 A;  1H9J A;  2EYF A;  4EQN A;  4YIJ A;  1EY0 A;  1D2B A;  4IUP A;  1S5E D;  5BN3 A;  1AN8 A;  1HRJ A;  1DOM A;  2EYJ A;  1ET6 A;  1EWH A;  3N52 A;  1OXS C;  5A2Q E;  3OW7 A;  5CMD A;  5C0X I;  2JE6 I;  2JP1 A;  3PUX A;  4G7O C;  4LK1 C;  1M4V A;  2N55 A;  3GV3 A;  3BYY B;  2LMC B;  3S1R B;  4V19 0;  3PIO 3;  5LHY 1;  1SE4 A;  2G9H D;  3OHX C;  2LFN A;  4K8I A;  4F8M A;  1L0Y B;  4K5X A;  1EY9 A;  4WRD A;  1MSG A;  4J6H A;  3Q23 A;  1DM0 B;  3JAM E;  2JA7 B;  1CFM A;  3EJI A;  4IZ8 A;  4HR7 B;  5I9O A;  1STA A;  5IGD A;  1JWM D;  1QCB D;  2WP8 J;  4GZY C;  1B9M A;  3TME A;  4H44 C;  4ILW A;  4XQQ A;  4IAL A;  1HA6 A;  3QIA A;  3MXU A;  1Z6H A;  1TS4 A;  4FF4 A;  1CZW A;  2K03 A;  2VXW A;  1HQM C;  2DY7 A;  1SXT A;  1STY A;  5JPM C;  3DEP A;  1D1K A;  2XWJ B;  4ULL A;  3MWY W;  3I8Z A;  2MPM A;  5IOD A;  3TZD A;  4DGZ A;  4OHJ A;  2QIL A;  3S16 B;  1Y8O B;  2B2Y C;  4TQU S;  1ILQ A;  2ZT9 C;  4ZYS A;  3R8B A;  3E0J A;  1ZKO A;  3I70 A;  1FGB D;  2X6G A;  1FD7 D;  4XXE A;  4KD3 A;  2L4N A;  3KLR A;  1JE4 A;  3EQL C;  3SHL A;  4DK1 A;  4F88 A;  1BR9 A;  3GTJ B;  3E6Z X;  2C5C A;  1PTO F;  4H13 C;  1I4G A;  3HGB A;  2CHB D;  4A3B B;  1ESR A;  2F0T A;  3R2T A;  1B4O A;  3HG9 A;  2K28 A;  5EJW A;  4C3I B;  1Y8P B;  4OGQ C;  4PQX A;  1EFI D;  3SK8 A;  1IYV A;  3SK5 A;  2J4X A;  5EQ0 A;  3QB3 A;  1RHP A;  4BWG B;  3MTS A;  3QOJ A;  2RDF A;  1BCP D;  1LTA D;  1SSO A;  3TP8 A;  4RKL A;  3M3Y B;  2K04 A;  1IW7 D;  2EYL A;  3NHH A;  1H9S A;  1B2T A;  1ENA A;  4U68 A;  2QF7 A;  1PTO C;  3GP7 A;  1II3 A;  2KCN A;  3W3A A;  4A93 B;  1LT6 D;  3GTQ B;  3NQT A;  2NBF A;  1FYC A;  4KK7 A;  2JEA I;  1WTP A;  4WJW A;  1HFN A;  5KIX A;  4TRD A;  2K5D A;  1ML0 D;  2KHS A;  4UDU C;  1DJR D;  2MHV A;  2BCO A;  4CJ0 B;  3L3O C;  2QKI C;  1CT1 D;  5BN5 A;  1CK1 A;  2KJX A;  4KHZ A;  2JEB I;  2RKS A;  3GTL B;  4KJN A;  2BE5 D;  2A6H D;  3K57 A;  1PTO B;  3I90 A;  4PMC A;  2GA4 B;  1RF2 D;  2RSO A;  2SOB A;  4U67 3;  3DWP A;  4RGT A;  1X32 A;  2NB0 A;  1OXT A;  2A74 C;  1T5E A;  1WTO A;  4ZLT F;  4QUF A;  4Q0F A;  3H6M A;  2PMZ B;  2N88 A;  2F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...