1J8IA

Solution structure of human lymphotactin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
93
structure length
93
Chain Sequence
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lymphotactin
publication title Monomeric solution structure of the prototypical 'C' chemokine lymphotactin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 10
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1j8iA00
2B2TA 1WTRA 2B2WC 4XDXA 1WTVA 1BF4A 3F2UA 4MN3A 1ML0D 1X3PA 4U68A 3MTSA 1EL0A 2DY7A 1F9PA 2KVMA 2VXWA 1O7ZA 1QE6A 2B2TC 2K05A 3I90A 3MWYW 4X3UA 5CMDA 5JJZA 1B3AA 2B2VC 1PDQA 1KNAA 1Q3LA 1WTQA 4O42A 2Q8TA 1IKMA 2RSNA 1J8IA 1DOKA 1PFBA 1EOTA 1S4ZA 2D9UA 2FFKB 2NYZD 2R3ZA 4IUUA 1WTWA 4HCSA 5CBAE 1U4RA 1BBXC 1HUNA 1ZXTA 2B2UA 1MGSA 3TN2A 2L1BA 2XIWA 4R8IA 1NAPA 2HDMA 1WTPA 1AZQA 1DOMA 4RAUC 3HP3A 3UI2A 1SAPA 3DM1A 1HFGA 4R9WA 3ONAB 3GV6A 5CORA 3R93A 4CJ0B 1MSGA 2EOTA 5EPLA 3IL8A 5EPKA 1J9OA 1WTXA 3I8ZA 1BO0A 2NZ1D 4RWSC 1CM9A 1HHVA 2B2VA 4NW2A 3SVMA 3G7LA 1G6ZA 1KNEA 1EIHA 1A15A 1U4MA 2EPBA 1O7YA 1CA6A 2JP1A 2N88A 4IUVA 2IL8A 4IUPA 4ZAIA 2K01A 2FHTA 1XX8A 5D65A 1VMCA 1DOLA 1MI2A 1SSOA 4XT3B 1ILPA 1U4PA 2H1EA 4XT1B 1B50A 4LMQD 1G2SA 2B2YA 1B4OA 1MSHA 3FDTA 2K04A 4UAIA 4QUFA 1G2TA 1IKLA 1SDFA 1WVLA 3H91A 1HA6A 3KBXA 2B2YC 1RHPA 1G91A 2KECA 4X3TA 2KOLA 1HUMA 1F9SA 2MJ8A 5CBEE 1HFNA 1PFNA 2L12A 2X6LA 5EJWA 1RTNA 1O80A 1PFMA 2Q8RE 4OIKA 1EIGA 1QG7A 2KUMA 5EQ0A 5EPJA 3DEOA 3GV3A 4HEDA 3TZDA 2CVRA 1JICA 2RSOA 2M2LA 2FJ2A 5T1IA 5D14A 2FMMA 2RA4A 1IL8A 3P7JA 2SDFA 1CA5A 1AP0A 1RODA 2N55A 4RA8A 1NCVA 4OIJA 4X3KA 2HCIA 5COYA 1DONA 1LV9A 2NWGA 1C8CA 1NR4A 2X6GA 2EE1A 1RTOA 1BNZA 2DY8A 1XYIA 4CJ1B 1F9RA 4ZLTF 1VMPA 2J7ZA 4IUQA 1X3QA 1NR2A 2K28A 3IFDA 1AZPA 1QNKA 2BDNA 5T1GA 4ZK9B 1F2LA 1PLFA 2K1BA 4HSVA 4IUTA 2HUGA 1B2TA 2JYOA 4DN4M 3QO2A 4X3SA 3N52A 3Q6SA 5DNFA 5EKIA 2KEDA 2X69A 4MHEA 1ESRA 2L9HA 3D6WA 5E4XA 2L4NA 2MPMA 1X32A 2KEEA 1JE4A 1M8AA 3FPUB 1E0BA 3LWEA 2MGSA 2HCCA 1WTOA 1B53A 1ICWA 1TVXA 3I3CA 1F9QA 2B2UC 1RJTA 2L11A 2MP1A 3KUPA 1WD1A 4ZKCB 1HRJA 5AFWA 2FINB 4QUCA 2B2WA 2HDLA 2K03A 1U4LA 2RVLA 1EQTA 4IURA 5E4WC 4CJ2C 1GUWA 1WD0A 1DZ1A 4ZKBB 3DEPA 4HAEA 1ILQA 3I91A
chains in the Genus database with same CATH superfamily
4JBMA 1S5BD 3RZDH 2PNHA 4XYQA 3PSIA 2AQ1B 3KDFB 1Q1EA 1N34L 1SFOB 3Q0AA 1KC8C 3HOXG 1DD2A 1HPCA 4DV6Q 2PCFB 1JMCA 4EX5A 5GROA 2Z4IA 1JCKB 1RL2A 2NYZD 3MXPA 2B2UA 3H0GH 1YNND 1NAPA 1AZQA 4DR1Q 2CCZA 5CGKA 3W1GA 4ME5A 1TXYA 1JWMD 2ID0A 2B63B 1SNMA 1EQRA 3EBEA 4FP5D 2JXMB 4BWGB 2O2LD 1BO0A 5C4ZA 3Q22A 3UE0A 2A6ED 2XNAC 3NQTA 3SVMA 1KNEA 1LT4D 1A15A 1OXTA 5FJ8G 5H1SE 3PF4A 4KKTA 4V0BA 2XRSD 3FKIB 2K01A 3CQZH 2LSSA 1CK1A 4YCVA 1CFMA 2BE5C 3FDTA 2HIVA 4UAIA 5CV7A 3A7AB 2PMZE 1PTOF 1YNJD 1HA6A 2A5HA 2F3VA 3NHHA 3E9IA 1J5EL 4S3SA 1K0SA 5C3EB 4R4TA 1SNPA 2Q2TA 2VUMB 3KK7A 3KLSA 2JA6B 1JJCB 1D7QA 4IUNA 1PHJA 4I7ZC 1YHBA 2PQAA 4LJZC 5J22A 1GM5A 2AUKA 2VL6A 3QOLA 4LFAL 1TWHH 3G71A 1Q46A 4X6AH 4X62L 1JC7A 5I6WA 2K6AA 4HIMA 1X9NA 2VZAA 1AZPA 2TMPA 2BH2A 4HSVA 5C4XG 3F2DA 1KD1C 3VYRA 3L0OA 2MHVA 4CBVA 4FXDA 2NVYH 2L15A 1X55A 2A69C 5ELCA 2XWJB 3I3CA 3PIO3 3S14H 4A3GG 4MNOA 3J7YW 1IBMQ 1P16A 2QEXA 3RZOH 5M3FB 2F0EA 3S17H 4R8NA 2I0QA 1X3EA 3S2DB 4RGOS 3J80L 4HSPA 4POGA 4DR3Q 3HOWB 3F2UA 3GTKB 2K5WA 4A3BH 1SNDA 4C2MH 4L5SA 3U50C 2YYZA 3OSOA 1BBWA 1KNAA 1Q82C 3FEWX 1HQMC 2I5LX 3KOJA 4LWCA 2C9OA 2DNEA 2I07B 2D9UA 3TS0A 1S4ZA 4OWXB 4BBSH 4R8IA 2FXQA 5C0XI 4LF7L 3D0FA 1IL2A 2L5TA 1X3FA 3W3AA 4OWWB 2O5JC 3EIVA 3ERSX 2C5CA 3UE1A 4P72A 1X65A 1YIJA 1Q1BA 1Y1VH 2PQAB 5ELFA 1KDBA 4ZAIA 1QZHA 2Z6KA 4XQQA 1NSNS 3M85A 1VMCA 1GO3E 3TP5A 3DUZA 2B2YA 3OYYA 3NQIA 4TQUS 2K5NA 5FLMG 5IGEA 3GDEA 1L0YB 3CMEA 1BUVT 2UUCL 5AJ3Q 3OIPA 4IN3A 2F03A 4QY7A 1Q90A 1H9KA 4QCLA 1PZJD 1O80A 1MD2D 4JI2Q 2ZT9C 4JCVE 4L5TA 4C3JB 4HJAA 2EXZA 4X64L 3I4LA 1H9JA 3OOCA 1PRTD 2RSOA 3MZ5A 4HJ5A 4A93H 2RA4A 5M5XB 4IJHA 2XGTA 1A0IA 1Y8PB 1XPOA 4QQBX 5COYA 3C1EA 5DEHA 4Q5VA 1IYUA 4GLAC 5IP9H 4DR6Q 1WJJA 1LT3D 1RF2D 3KFUA 2XVSA 1Q12A 1HA5A 2D5DA 4YCUA 1PLFA 3CCEA 4A3EG 5M3FG 5DNFA 1II3A 4IPGA 2WKCA 4OWTB 4IFDG 1F2MA 1NMFA 3HOYH 3EA6A 2NVTH 3BVMA 2ZXPA 3H3VH 4J8QA 4DK3C 2I5MX 4LW1A 4NMZA 1E24A 1ESFA 3OWEB 4OGQC 4B3SQ 2ATWA 4K6LA 4CDDC 1WI5A 5JPNC 1ZEQX 5IYBH 3CXCA 2QDLA 3I4NG 2QCPX 3VR6A 1D8LA 5DM63 1K0RA 5BN3A 4JG2A 1JB7A 5CMDA 2K05A 4QIWB 1QZGA 3VR5A 3L3OC 1LTID 1DXMA 4AIMA 4HIDA 4J6HA 5HGQA 2JN4A 5IGCA 2B8FA 4H7BA 4PG3A 2R93G 3M4YA 4PZ7A 3DWAA 2L0CA 2LXKA 3D8GA 2K5QA 1BXTA 3MEHA 1TWAB 2ICEC 4FNFA 1X56A 4TVAB 4GZYC 1LTTD 3CCSA 4L6TB 1N36L 3J81i 3U9SA 4G7OC 1PH9A 2DGYA 2IL8A 2Y0SB 1C48A 4IUPA 4P74A 3CC4A 1XXGA 3OW7A 4RCNA 2YV5A 2F0HA 4G7ZC 1YJNA 4LUZA 1VQNA 1STAA 1IBLL 3S1QH 4LFCQ 1BCPB 5C0XJ 4IFDI 1B9MA 1Q81C 1YHQA 3SXHA 3HOUH 2CWPA 1EY8A 1IYVA 4A76A 5LMNL 1KDAA 4KLKA 2HQLA 2NTTA 2ZTEA 1CTMA 3M3YH 2F0LA 1I4HA 5EAYA 1CKOA 2L55A 2K50A 1V8QA 2VQFQ 2ENBA 4JOIC 1W2BA 4CGYB 1HNWL 2RHSB 4JC0A 3Q6SA 1CQFA 1TT2A 2KHIA 1ESRA 1EY6A 1XPRA 1GOZA 1PZKD 1R4PB 2CW0D 1HH2P 3URYA 1ICWA 1EZ6A 1ZKOA 2E76C 1LO5D 1VQOA 3S9WA 1HRJA 2K03A 3JC66 4IURA 5E4WC 2EJGC 2NBFA 2R7FA 3HOVB 4HJ7A 1WTRA 4QB4A 4P73A 4DV7Q 1FGUA 2JA5B 4GOPC 2JSOA 1T9HA 1O7ZA 4K0KQ 2C35B 1LTGD 1B3AA 3J7ZC 4C3IG 3GTJB 1JT8A 1EWIA 4KKUA 4QL5A 2R7ZB 4DV0L 2D0OA 3DMUA 3HKZB 2PO4A 4A3MG 3QIAA 1ZXTA 3A7LA 2UXBQ 4JI8L 1TY2A 4GKKL 4KN7C 4HIKA 3RLFA 1A3UA 3OPOA 3M4QA 4KY6A 4O1NA 1LTRD 3K0XA 1YITA 2UXCQ 1IHZA 1B3QA 2EYOA 4R1JA 4JI3L 4A3JH 5I9PA 1U4MA 1PYWD 5KYLA 2JK8A 3TZUA 3SEBA 5IOCA 4BA1I 1EU4A 1PH3A 1S40A 1SDFA 4GN5A 1VQLA 1K83H 4JK1C 4HIOA 4RG1A 1Z6HA 3J81j 3I4MG 5TSSA 2JA8H 2AUJD 1DCZA 2X6LA 5FOBB 3E3XA 3CCQA 3S24A 1TWFH 4HEDA 1CT1D 2ZJPA 3HOZH 2M2LA 1QJOA 2R6GA 4RGMA 4YCWA 5D14A 1A2UA 1LT5D 1Z7TA 4BXXG 3KLRA 4TRDA 2E2HB 3T1HL 4XTCS 3C46A 3GTQB 2I46A 3GQBA 2R7DA 1XMOQ 4KHVA 1RTOA 4HJ8A 1VMPA 2KCTA 4A3CH 2IW3A 2A1AA 5IYDG 1EOVA 2LY7A 2RQXA 3X3MA 1LACA 3GTLB 5IT9L 4IFDJ 1J8IA 1SMYC 5EKIA 5J3BA 3DHQA 4YWLA 1Z9FA 3CCLA 2K5DA 3PO2B 2EDGA 3W1BA 4R4CA 4LF9L 1KL9A 1WD1A 3KUPA 1SEBD 4DXGA 3OMCA 4HN7A 3K0YA 4KJOA 3EQLC 1Y1WB 2UU9Q 1CZWA 2E8GA 3NBIA 1DM0B 1PMRA 2VS1A 1E1OA 4WFN3 1QNUA 2DY7A 3MWYW 3J80i 1B50A 4OONA 1VQ6A 5IWAQ 1PDQA 3PQIA 4C1NI 4A3DG 4ZCKA 5C6AA 1WTWA 2NB0A 1R9TH 2K52A 4OO1H 2E2IH 3MC0B 2L1BA 1S5DD 3PUXA 1IBKL 4JI4Q 2HT1A 3ONAB 1RDPD 2EOTA 4XQJA 4K8JA 5EPLA 3GTMH 1EUJA 1VQGA 2UUBQ 1ENAA 1HHVA 3SK6A 2O4XA 1I6VC 4IZ8A 1TIID 3S16H 3A5ZB 1CSQA 4FVMA 3GO5A 1VQ9A 2CHBD 2AKWB 2F3WA 5A2QE 4GKJQ 1VQPA 2RDHA 3HG9A 1D6EC 1W3SA 4I7AA 2MQHA 3HEJA 1I4XA 3V96A 3CRKC 2Q8IB 1HZBA 4RGNA 5CBEE 1NY4A 2L12A 1FD7D 1I6HB 3IKJA 3WOEA 1EYAA 2A68C 2N3SA 4BBRG 4LF5L 3KLSX 1DJRD 1TR5A 5IGDA 4LF8Q 4NKLA 2DN8A 3STBC 1HR0L 2NZOA 4JI7L 1EWHA 2JA9A 2NWGA 1NR4A 3G6EA 1XYIA 3VA7A 2OWOA 2OXPA 1GUTA 3K5LA 1K3BC 1KHIA 4IUTA 3S2HH 4KN4C 2XRQD 4X65Q 1SNCA 4K6DA 4MHEA 4KHZA 3H0GG 4DNTB 4DV1Q 4IPCA 5KYIA 1GHJA 3NEMA 5BN5A 3S17B 1JWSD 4DUZL 4A4IA 2HHHL 1Q86C 5ELBA 3ULLA 1F9QA 2L11A 4FO2A 4JI1L 2VQEQ 4B9XA 1D5ZC 2AMCB 3EROA 4Z9CB 4OX9L 1SRUA 1STHA 1WTVA 1XNQQ 3A74A 2F4IA 1KIXA 2EYMA 5M5YH 5K5PA 1HNZL 1Q3LA 3M4OB 2NVXH 4YWMA 3BVGA 1NNXA 1HZAA 1U4RA 3PUWA 3T1YQ 3EJIA 2WAQG 4ID6A 1JJ2A 4A75A 1PXUA 5C5MA 5JAVA 1YI2A 3QJYA 1EY0A 3UI2A 1EQQA 5J1ZA 3TSSA 3CCUA 3L7ZC 3PO3H 1VS0A 1BCPF 2DJFC 4CJ0B 1TWCB 4LF6L 4DUYQ 5C4XB 3K57A 5CV6A 4DR4Q 1LTAD 3D4DA 3HZXA 1F2YA 1KDCA 3I4OA 3NP8A 1EIHA 1O7YA 2RDFA 2D2CC 1X54A 1EU3A 1SJHD 1BKBA 4A3GB 2H1EA 1EY5A 3PMFA 1G2SA 3L2PA 1B4OA 4QUFA 1WTHA 2Z6KC 3S15B 2F0KA 1ASYA 3KBXA 1WCMH 2B2YC 4IOCA 4BY7H 2KOLA 3JAMc 5HY6A 3UDXA 3K7AH 1HTLD 2MJ8A 4A93B 5BR8Q 4BY1H 1L1OB 2ZM6Q 2E2JB 1PTOD 2Q8RE 3R2IA 5FO8B 1V1QA 2UXDQ 1PVOA 2QILA 4GS3A 1ENFA 5T1IA 4QMGA 1AP0A 3N6RA 4N9TA 2LFNA 4QIWE 4F87A 4DR2L 3F8TA 2DY8A 1BCPC 5M5WB 2E75C 5KNDA 2EY2A 4A3BG 2XSCA 1PFSA 4AQYQ 4IUQA 3CMAA 2BDNA 4R4IA 5C44H 1A3TA 4H0LC 3GTOH 4O2DA 1BBUA 4BBSG 1SYBA 1X32A 1JE4A 2MGSA 1N32L 1I3QH 4HR7B 1UEAB 3I2ZA 1LM0A 3L9AX 3SR1A 1U9RA 4DV4L 1YZ6A 1E3PA 2FINB 2Y0SE 4M1UB 2EY1A 3IRBA 4JV5Q 3KJOA 3NXWA 1C9OA 2YU9B 1HNXL 1XTCD 4XDXA 2J0TD 2IX0A 3C2PA 1Y1VG 1WTQA 3GTPH 2F0TA 3SDZA 1N34Q 4HCSA 3I70A 2ZXOA 2HDMA 2IWHA 5K36H 4RMFA 4LAAA 2Z8LA 1SBBB 4C3HH 4FF1A 1TWGH 5CORA 1SMXA 3M7NA 2PI2E 2A6HD 2MO0A 4A3EB 3RN5A 1T5XD 2QDBA 1X6OA 1PH5A 2KCNA 3I8ZA 5HURA 5FLXL 3JAME 4KHPL 1D5XC 3TP7A 1YNNC 1K9MC 4KD4A 3RN2A 2PPBC 5EKKA 4A93G 2E5LL 2EYJA 4PQXA 2KA7A 4DR6L 4A3FH 5D65A 1MI2A 4JI5L 5IP9G 3MXUA 2A6EC 4LF4L 1G2TA 3BS1A 5NUCA 3I4NB 2WINB 1PFNA 3IFTA 1J5EQ 1SYGA 5LMUL 4OIKA 3M3YB 4AYBG 5EPJA 3HOYG 4UP8A 5C0XH 3F1ZA 1YNJC 4RFBA 2FJ2A 2OF1A 1I50B 3TRZA 2R93B 4MZ9A 1NE3A 4CDFC 2N55A 1G8ZD 5KNCA 1ZYRC 2VY3A 5EBDA 1PH1A 5IYBG 2R61A 3HKZE 5GQOA 4LFAQ 4XQNA 1IYJB 4CJ1B 1IXRA 1M1KC 4B3TL 4G4KA 2AWOA 1VQAA 2WB1B 4X62Q 2K1BA 2KHSA 2JYOA 4EGVA 3QO2A 4X3SA 1HR0W 3G6JB 5CR3A 1MJEA 1KLGD 2K4KA 5FK9C 2ASBA 5E4XA 3FHWA 3C3LA 4NPSA 5IYCH 1Z47A 4HJ9A 3LWEA 1WTOA 1SFOH 1BOSA 4KI0A 1NMGA 4JBJA 1EQTA 4CDEC 4DNIA 3MEFA 4DXFA 4ZKBB 5G3LF 5HGTA 4DR5L 1I94L 3RNUA 3CHBD 5IGGA 1O78A 4IPDA 3QOJA 1HJPA 2B63H 2B2VC 4B3RL 1IKMA 4LK1C 3P1HA 2VNUD 4MIUA 2PI2A 4OXPA 2G9HD 3PUYA 4G57A 4IALA 1VQBA 2K75A 3GD7A 3DM1A 1WOCA 4LNQA 1AE2A 1KABA 3DWQA 3FKIH 3H3VI 3DLLA 3NK9A 4LF7Q 4A3IH 4Y7NB 4P75A 3HOUG 1JE5A 1HCZA 1YBYA 4PV1C 5EKLA 4OHJA 4FF3A 3SHLA 5DAUA 3CPFA 5M9OA 2E2DC 5C3EH 2VUMH 3HFZB 2A8VA 5JEAH 2JA6H 2JA8B 4WRDA 2QGQA 1STBA 3DXJC 1Q8IA 1MBYA 1WVLA 4B3ML 1YJ9A 3OTOL 5I2YA 1JJGA 2SNMA 2EYHA 4C3IB 1QOHA 2UUCQ 1XNRL 2F4VL 3CRLC 4QJFA 4A3MB 3D4RA 1TU2B 3C1FA 3EFXD 2WB1G 1JICA 4YWKA 4DK1A 1K73C 2FMMA 4JI0L 4X64Q 1CA5A 4R4QA 1UE7A 3W5OA 5CYUA 4YHHL 2F0FA 3K8AA 1CUKA 5ELOA 3MA2B 5ELNA 1CSPA 2QEJC 1BNZA 2KQ3A 5DLQE 1VQ8A 4ULLA 4XIGS 4DAPA 1UNSA 4HMJA 1HZ9A 2HUGA 2P5ZX 3I72A 1B2TA 1STYA 3D3RA 5CV4A 2MPMA 1QUQA 3S2DH 1SE3A 3HOWH 1E0BA 3GTKH 4UHVA 2IHEA 2Q2IA 4BA2I 3ZYYX 4ALPA 3NBHA 1RIPA 1TVXA 2CWAA 4DK6C 3I4MB 2B2WA 4KTAA 2RDGA 2F0IA 2B2TA 3JAML 3OW2A 2OTLA 4A3JG 2VXWA 4H44C 4LUOA 2ICIA 2IY5B 3NTKA 5FO9B 1BBXC 2AQ3B 3T13A 4UP9A 1IW7C 2E74C 1EEID 4DF7A 1TS4A 2JEBI 1KQSA 1K8MA 2JA8G 3GTGB 3CP0A 2KBNA 3DWPA 1F2ZA 4K14A 2NZ1D 1BVSA 4RWSC 2B2VA 1SYEA 1SYDA 3MXNA 3U4ZA 3S1RB 1QVCA 3HOZG 3I56A 3Q8DA 4RKLA 2JP1A 4TSSA 2EY6A 1XX8A 1N36Q 1T5EA 4NXML 1A3VA 1MSHA 1PTOB 4C3JH 3F2CA 2VW9A 4A3CG 3K7UC 3TBIB 3BU2A 2KECA 5M5XH 1IBLQ 1N33Q 1XMQL 5C4JB 4GLVB 4A3DB 2D62A 1TY0A 1PH2A 4MTKA 2K33A 2KUMA 4YY3Q 4KK7A 4E6IA 3S1MB 2B39A 3BYYB 3GV3A 4C1NK 4FF4A 2IX1A 3HKSA 4DV3L 1UWVA 2K5VA 4KD3A 3VYUA 3QR8A 1QUQB 5KRUA 5LMNQ 3S1NB 1NCVA 3S2HB 3RLOA 1UAPA 3E5SA 2PZWA 3NBHB 1I4QA 1LLRD 1KAAA 1F9RA 2HD3A 3NPPA 4JI6L 1CKNB 1HQRD 3FP9A 1EQVA 1QNKA 1L1OC 5IE8A 1A8VA 3RMHA 2CKZB 2NVQB 2ALYB 4OO1G 1EWCA 2F0UA 1HNWQ 2WKDA 4DR7L 2XTIA 1M8AA 5CV8A 1HXYD 2EY5A 4DK0A 5IY0A 3M9BA 4JYAL 1B7YB 3NTHA 4M8AA 3VDYA 1EZ8A 2B3GA 1Y14B 3LGJA 3DEPA 4R9WA 3CU7A 2J4XA 2YTVA 2SEBD 1BF4A 4BBRB 4DV5L 2CW0C 1CZGA 2IX3A 1BR9A 2IHFA 4X66L 1EL0A 3H3VC 3ND8A 5I9OA 1PYSB 4KY7A 4P71A 3MXNB 3PO3B 1RD9D 1ONLA 1PFBA 1C7YA 1TWAH 1ET9A 4R4OA 2ZTDA 3A8JE 1V1OA 5IODA 3CCVA 4DV0Q 3CD6A 1P8LA 3RZDB 3KJPA 2ES2A 1SAPA 4ZYSA 4NXNL 3FRPB 1U5KA 1PA6A 4JI8Q 3SGIA 1FJGL 4GKKQ 3K80C 2EIFA 1J9OA 1WTXA 3H0GB 1KRTA 3AFPA 2MNAA 2JA7H 4L5QA 4QF4A 4DV2L 2EQSA 4K2KA 4C56C 2N88A 1D2BA 4OELB 4JI3Q 3I73A 1DOLA 2H5XA 3E0EA 1LABA 5JPMC 1PZID 2PNRC 3AEVA 3TEHB 2PZUA 1JWUD 3W2DA 2O5IC 4OO1I 2K7VA 1PH6A 1F9SA 1MKHA 3BYTB 3CQZB 1EIYB 1RTNA 4K5XA 1OXSC 4PMBA 1RCVD 2F0WA 1J6QA 5EQ0A 1CHQD 2WAQB 3DM3A 3TZDA 1H9RA 4CDCC 1AW7A 2KJXA 4KJNA 3MAQA 2V1CC 4KY5A 2UUAL 2X6GA 2F0JA 3T1HQ 4CKCA 1NTGA 1PRTB 2NN6H 3OIQA 4RGTA 3BZDB 1UE1A 3KF8B 1TWHB 3O13A 4PMWA 2QF7A 4KKSA 3HOVH 1G291 3K6OA 5E3FA 4EQOA 3FPUB 2JA5H 2WIIB 3PO3G 4DUYL 3NWSA 1N9WA 2IT1A 4LFBL 3GTJH 2PZTA 2R7ZH 4DAYB 2D0PA 1GUSA 4LF9Q 1I4PA 1WYDA 1QB5D 5M3MH 4HAEA 4ME3A 1ILQA 1L1OA 4K8IA 2Q2UA 2NVYB 4DV6L 4FDBA 4MN3A 5LMNW 4IO9A 1QVGA 4U68A 3VR2A 1F9PA 2KVMA 5DM73 4ZQ3A 4L5RC 1SJED 2F0QA 4O42A 3S14B 2R92H 4A3LH 3QG1A 3BDCA 4DR1L 4IUUA 3RZOB 1YJWA 4ZUIA 5CBAE 2HIXA 4UP7A 3TP6A 1WCMG 4L63B 1SYFA 4RAUC 4BY7G 4A3BB 3HP3A 4L8JA 3R8BA 4C2MB 1DYQA 4J15A 4PZ8A 3GV6A 4Y52H 4BY1G 3G4SA 1IBKQ 4KV6A 4F7XA 2JEAI 3D6CA 3ND9A 2JQOA 2BE5D 1A2TA 4BBSB 1VQHA 3UDFA 3AQQA 1BCPD 1SYCA 4G7HC 3A8KE 2WB1E 3A0JA 2EYFA 2PQEA 3ULPA 1GUGA 4A3KH 1SSOA 1ILPA 2WFWA 1U4PA 4XT1B 2KCCA 3HGBA 4AQYL 4QGUA 2K04A 2F0PA 1IKLA 5I4DA 1YVCA 4HCEA 1GVPA 2N49A 4IQZA 2BA1A 3WDNA 5C44G 1Y1VB 1HFNA 3FMCA 2E2HH 3ER0A 5KGUA 3KF6B 1VQIA 3H09A 2LS01 5GAHC 3RD4A 3K5MA 1QG7A 2F0DA 1ASZA 3TDQA 1JQYD 4IOAA 3P7JA 3M7GA 3GTLH 2RF4A 4LF5Q 1KAWA 1EY9A 4RA8A 4X3KA 2BDOA 2Z0SA 1JB3A 4GNXA 1C8CA 2MUYA 1HR0Q 1VQ5A 3PO2H 4HMIA 1BQQT 1E22A 5IP7H 4JI7Q 1LTLA 1KRSA 3SK4A 1VQ7A 2A69D 2K28A 3J7AV 4NDXA 2I5HA 1RKNA 1F2LA 1TKWB 2VB3X 4UDUC 3LWUA 2LKVA 3BZCA 2L9HA 1D1IA 2L4NA 1Y1WH 1GD7A 2NZHA 3VYSA 5K36G 1YNXA 5ELDA 1VQDA 2HCCA 1IBML 4C3HG 1B53A 2F0VA 3K81C 4N8X1 1BDOA 4DFAA 2RCNA 4DUZQ 1LTSD 3NE5B 4DR3L 2HHHQ 1HTPA 2V4DA 4JI1Q 2DJGC 2K32A 4HTHA 4AYBB 3HOYB 1QCBD 4OX9Q 3MTSA 2NVTB 3FVQA 3JAMi 3I90A 4A3FG 1M90C 2ZJQA 2R3ZA 3IAYA 1VQFA 4A3IB 1HNZQ 5L37A 1GUNA 2XIWA 1YHAA 4JPBW 1DOMA 1W6JA 3PIOA 4B08A 1NUCA 3ICEA 3EN2A 2M9VA 3AU7A 2K5HA 4ABNA 1CKMA 2A19A 1ZYRD 2ZJRA 4PMCA 4LF6Q 2SOBA 5LL6S 5C0XG 3MFGA 2N78A 3KLWA 2VB2X 4F8MA 3R2TA 4JBWA 1CA6A 1FNWA 1W6KA 3HOXH 1NJIC 4WJ3M 3I55A 1OXXK 2EYPA 2G5DA 2LMCB 3LX0A 4LMQD 1I6HH 4IJLA 5AJ3L 3CC7A 1XPUA 3E9HA 5A2QL 3TS2A 1JOQA 1R4QB 2F0GA 3MHBA 4GNXB 5LL6X 1N8RC 4JI2L 5J39A 1K28A 2OQ0A 5IYCG 3S1QB 3T16A 1K8GA 1HZCA 3UDGA 3T4AC 1B44D 5FJ8H 3NELA 1MJCA 5IGFA 3OHXC 3NUCA 4CKEA 1UUPA 1PTOC 3ULJA 1OXUA 3NSWA 2HQEA 2EE1A 3PGZA 3HOUB 3NENA 2Z1CA 2F52A 2J7ZA 4DR2Q 5GADC 2B63G 1O7LA 3A55A 3TREA 4GLXA 3MXGA 4ZK9B 1GJXA 4DN4M 2X69A 4JVZA 1EYDA 4RH6A 2LXJA 2IPKD 2NTSA 1VQ4A 1SN8A 2F1MA 1VQCA 2TSSA 2ZXRA 1NBWA 3D31A 4B3SL 3FKIG 1RJTA 5ELEA 1EEFD 2BOSA 3SE0A 3M4OH 1N32Q 4A3IG 2RVLA 4FYDA 1U4LA 5JJIA 3H94A 4P2CB 1WD0A 4DV4Q 3M4PA 5IT9c 1SE2A 2B2WC 5D3IB 2EXDA 1FNVA 2CH4W 1X3PA 2PYKA 2Z9HA 5C3EG 2B2TC 1HNXQ 2VUMG 3T53B 3QB3A 1TWCH 5C5LA 1PYBA 5G3LD 5C4XH 5JEAG 2JA6G 1DOKA 1EOTA 2G9DA 4Q0FA 1PH4A 5IIFA 4PZ6A 3R93A 5A35A 3BJUA 4A3GH 5EPKA 2M00A 2BA0A 3HS0C 1E7ZA 1KTKA 3TP8A 4JBKA 3S15H 2K14A 5I6YA 5JJLA 4KHPQ 1SROA 1ET6A 1Y69U 2WACA 2A6HC 4LFCL 2E2JH 2E5LQ 4RKBA 1I4GA 4AH6A 1TS5A 3SK5A 1A6XA 3GP7A 5FO7B 4JI5Q 1H9MA 4A3JB 1DGSA 5KNBA 4LF4Q 1PRTF 1FYCA 2KCMA 3VR3A 4NB3A 3AYHB 4DAVA 1QILA 1K3RA 3CCJA 1E2WA 2WV6D 3RUZA 3HOWG 4BS9A 5M5WH 1TS2A 3DEOA 1SE4A 2CVRA 1K83B 4WJ4A 5LMUQ 5JVH3 3K58A 2A73B 3V05A 2SDFA 3PIPA 4IPHA 1B1ZA 3F2BA 2VQFL 2GA4B 2RKSA 1TWFB 1H9SA 5FLMH 3HOZB 1IW7D 2CQOA 3J81c 1EY4A 5T1GA 5IT9E 2OTJA 2B8GA 3I7FA 1I5FA 4B3TQ 4OL7A 5ISRA 1E1TA 2EJMA 3U58A 2PMZB 2YU9H 2BH8A 3Q24A 1LYLA 5I2XA 3Q23A 1G51A 1PH7A 3KBGA 4F88A 3VYTA 4QUCA 4DV7L 2PW7A 3CW2C 4K0KL 3EVQA 2WP8J 3BVZA 1PRTC 4N8FA 4ZRZA 1A62A 4DR5Q 1I94Q 3A54A 2UXBL 4A3EH 2Q8TA 2KENA 4DGZA 4DU9A 5M3FH 3WOFA 2FFKB 3PIP3 4C3JG 1TQOA 3D4WA 4B3RQ 1MGSA 1WTPA 4IFDH 1VQKA 4H02A 1N33L 3B6YA 2WAQE 3TMEA 2JA7B 4CKBA 1X3GA 3MVVA 3PUZA 4CHTB 2UXCL 1CKNA 5E7NA 1MSGA 3IL8A 4YY3L 3ITPA 1R9TB 2E2IB 1S5FD 4NW2A 3G7LA 1G6ZA 1YEZA 3I4NH 2NUCA 1A63A 2H4OA 4IUVA 3FPPA 1OO9B 3A56A 3T51B 3TQYA 5IGBA 2QA4A 3BZKA 3GTMB 3V2TA 2Z6BA 3K5NA 3BDOA 4EVOA 4YIJA 4DA2A 2RBMA 3E0JA 2EYLA 4K5WA 1S5CD 1I50H 3P20A 1G91A 2R93H 5JOBA 1B70B 3AB9A 4B3MQ 3S16B 2JJQA 3OTOQ 3CF5A 5EJWA 1GXDC 1H9SB 2FMCA 2QKIC 3J81E 2F3IA 1FR3A 1EIGA 1XWEA 1OXVA 5C3XA 1XNRQ 2F4VQ 4WJWA 1ICFB 4RCOA 1IL8A 1XMOL 1XTDA 1RODA 3RR5A 1IZ6A 1SMYD 4UY8C 1DONA 2F0OA 3K59A 1LV9A 4JI0Q 2GN5A 1SR3A 1L2FA 2DUDA 1V1PA 4ZLTF 4XXEA 4YHHQ 4XYOA 3IFDA 3A5UA 5EGTA 2OQKA 2F0SA 2XWBB 2Q2HA 1EY7A 3X3NA 1FNUA 1O7IA 3UDIA 3G48A 5M3MB 4I65A 1H95A 2AQ2B 1EFID 3PUVA 2Y0SG 1GKHA 1JOOA 2UU9L 4PNYA 1EIFA 3WWVA 4FXGC 2R92B 1L0XB 2EJFC 2JA7G 2EVBA 3I91A 2AHOB 1AEXA 5IWAL 5JEAJ 1E2ZA 1SNQA 5JJZA 1QE6A 3PCOB 1K8AC 1AE3A 4ZUJA 2RSNA 1DZ1A 2IJ0A 3K5OA 5C4HA 4ILWA 1MIUA 4Y7NH 1U0LA 4JI4L 1HUNA 1B9NA 4POFA 4O0AA 1AH9A 1B8AA 1HFGA 3CCRA 5M5YB 5EBCA 2MFIA 2UUBL 1S5ED 2NVXB 4EQNA 4A3KB 1C4QA 3KF8A 4GN3B 4N9PA 4APVA 2MO1A 3J7AF 2Z4HA 4TKOB 4LUVA 4DKAC 3H15A 3AFQA 4H13C 2BCOA 1JORA 1LT6D 4C3IH 4GKJL 3U9OA 3MFYA 4A3MH 2A68D 4V190 2QW7A 4DAYA 4FXKC 1VCIA 2NN6G 1K8OA 2OEOA 1RHPA 1WFQA 2CH4A 2CFMA 4X3TA 4NXMQ 3J80c 5FLXc 1HUMA 3STBD 3PF5A 3NTIA 1I4RA 1PFMA 1V1PB 3HOVG 1M4VA 1Y8OB 1TS3A 1E2VA 1XMQQ 1OTCA 1STGA 1VQEA 1XJVA 4LF8L 3J7A5 2JA5G 1D5MC 4AYBE 2DNCA 1WCMB 3CC2A 4BY7B 3QWNA 1GUOA 4MTNA 3K7AB 1Q7YC 2R7ZG 4BY1B 4DV3Q 3HKZG 4OIJA 2HCIA 5M3MG 2KHJA 4JOIA 3LNNA 1D1KA 4B9WA 1X3QA 4GNXC 1STEA 1UE5A 4X65L 4DV1L 3I4MH 4A3LG 1F77A 4RHSA 2R92G 3A8IE 1AN8A 4JI6Q 3N52A 5LHY1 1VQMA 1S72A 1VF5C 4WORA 5C3WA 2KEEA 3CAMA 1UE6A 2VQEL 3KYHC 5CC4A 3CPWA 4DR7Q 1LTBD 4ODGA 2B2UC 3ERQA 2F0NA 1Q8KA 4ZKCB 1EYCA 5C44B 4BXXH 1XNQL 3GTOB 4JYAQ 1STNA 1UEBA 4GOPA 2MP1A 4CJ2C 5D3DA 1KLUD 4FF2A 3KF6A 1ML0D 4NP5A 1I3QB 1SE8A 3OMGA 1FGBD 3CCMA 5IYDH 4X3UA 3GTGH 4DV5Q 2NN6I 3T1YL 4A3KG 4X66Q 4K2LA 1S3OA 2CQAA 4J1MA 3S1RH 3TN2A 2EZVA 5BN4A 1ENCA 4UPAA 1KXLA 1V9PA 4DR4L 4KMUC 1VF7A 2F0MA 3CKIB 3PV0A 1JR0D 3R3OA 3RLNA 3GTPB 1EYGA 3HOXB 3VA5A 4NXNQ 5JJKA 3KDFA 1JOKA 2OT2A 5FLXE 3J80E 1CM9A 3J81L 1PTOH 4OEMB 4JW0A 2YTYA 1FJGQ 3P75A 3ZJYC 1CI3M 4DNRB 2PW5A 2EPBA 1SNOA 4K5VA 1GHKA 1Y8NB 4C3HB 2JE6I 1TWGB 1SXTA 1QWYA 2N8NA 3OWFA 2RCFA 5C4JH 2FHTA 4DV2Q 4A3DH 4XT3B 5GAEC 4EQ5A 3E6ZX 3U4VA 1V43A 5FKAC 3PO2G 5IP7G 4DPGA 1FVIA 2RHQB 3S1MH 2GVBA 3H6MA 3H91A 5BR8L 5E1FA 2ZM6L 2YTXA 1FL0A 3T56B 1MHWC 1PV4A 4DAMA 3S1NH 2UXDL 5GAGC 4A3FB 1Y1WG 2GVAA 2OCEA 1C0AA 1CQVA 1VDZA 4EQPA 5KIXA 2SNSA 1AFPA 5JVG3 3VR4A 5KEEA 2AWNA 1PH8A 1L0WA 3SK8A 5F2DA 3BG3A 2NVQH 1LUZA 3AMUA 2UUAQ 1NR2A 4RHRA 2A74C 4GN4B 4GOPB 3GTQH 2KEDA 1VQJA 3D6WA 2B29A 4U673 1CHPD 4BBRH 3HRZC 3NWTA 1SLJA 5CV5A 4JV5L 2ZTCA 1G6PA 5AFWA 1EFWA 2HDLA 1GUWA 3BDLA 5CV9A 1QVFA 2XN9C 4LFBQ
chains in the Genus database with same CATH topology
1S5BD 4XYQA 2AQ1B 1SFOB 1Q1EA 3Q0AA 1DD2A 1HPCA 2PCFB 2Z4IA 1JCKB 2NYZD 3MXPA 2B2UA 1YNND 1NAPA 1AZQA 5CGKA 4ME5A 1JWMD 2ID0A 2B63B 1SNMA 4FP5D 2JXMB 4BWGB 2O2LD 1BO0A 5C4ZA 3Q22A 2A6ED 2XNAC 3NQTA 3SVMA 1KNEA 1LT4D 1A15A 1OXTA 4KKTA 4V0BA 2XRSD 3FKIB 2K01A 1CK1A 1CFMA 2BE5C 3FDTA 4UAIA 5CV7A 3A7AB 1PTOF 1YNJD 1HA6A 2A5HA 2F3VA 3NHHA 4S3SA 5C3EB 1SNPA 2VUMB 3KK7A 3KLSA 2JA6B 4IUNA 4I7ZC 4LJZC 5J22A 2AUKA 3QOLA 1JC7A 5I6WA 2K6AA 1AZPA 2TMPA 4HSVA 3VYRA 2MHVA 4CBVA 4FXDA 2A69C 5ELCA 2XWJB 3I3CA 3PIO3 3J7YW 5M3FB 2F0EA 4R8NA 3S2DB 4RGOS 3J80L 4HSPA 3HOWB 3F2UA 3GTKB 2K5WA 1SNDA 2YYZA 3OSOA 1KNAA 3FEWX 1HQMC 2C9OA 2DNEA 2I07B 2D9UA 1S4ZA 4R8IA 5C0XI 2L5TA 3W3AA 2O5JC 2C5CA 1Q1BA 5ELFA 1KDBA 4ZAIA 4XQQA 3M85A 1NSNS 1VMCA 3TP5A 3DUZA 2B2YA 4TQUS 3NQIA 5IGEA 1L0YB 1BUVT 3OIPA 4IN3A 2F03A 1Q90A 1H9KA 4QCLA 1PZJD 1O80A 1MD2D 2ZT9C 4C3JB 2EXZA 3I4LA 1H9JA 3OOCA 1PRTD 2RSOA 3MZ5A 2RA4A 5M5XB 1Y8PB 5COYA 3C1EA 5DEHA 4Q5VA 1IYUA 1LT3D 1RF2D 2XVSA 1Q12A 1HA5A 2D5DA 1PLFA 5DNFA 1II3A 2WKCA 4IFDG 1F2MA 3EA6A 3BVMA 2ZXPA 4J8QA 4NMZA 1ESFA 3OWEB 4OGQC 4K6LA 5JPNC 1ZEQX 2QCPX 3VR6A 5DM63 5BN3A 5CMDA 2K05A 4QIWB 3VR5A 3L3OC 1LTID 1DXMA 4J6HA 5IGCA 2B8FA 4H7BA 3M4YA 3DWAA 2L0CA 3D8GA 2K5QA 1BXTA 3MEHA 1TWAB 2ICEC 4FNFA 4GZYC 1LTTD 4L6TB 3U9SA 4G7OC 2IL8A 2Y0SB 1C48A 4IUPA 1XXGA 3OW7A 4RCNA 2F0HA 4G7ZC 1STAA 1BCPB 5C0XJ 4IFDI 1B9MA 3SXHA 1EY8A 1IYVA 1KDAA 2NTTA 1CTMA 2F0LA 1I4HA 2L55A 1V8QA 2ENBA 4CGYB 3Q6SA 1CQFA 1TT2A 1ESRA 1EY6A 1GOZA 1PZKD 1R4PB 2CW0D 3URYA 1ICWA 1EZ6A 1ZKOA 2E76C 1LO5D 3S9WA 1HRJA 2K03A 5E4WC 4IURA 2EJGC 2NBFA 3HOVB 1WTRA 4QB4A 2JA5B 2JSOA 1O7ZA 1LTGD 1B3AA 4C3IG 3GTJB 4KKUA 2R7ZB 3DMUA 3HKZB 2PO4A 3QIAA 1ZXTA 3A7LA 1TY2A 4KN7C 3RLFA 1A3UA 3OPOA 4KY6A 4O1NA 1LTRD 1IHZA 2EYOA 5I9PA 1U4MA 1PYWD 5KYLA 3TZUA 3SEBA 5IOCA 4BA1I 1EU4A 1SDFA 4JK1C 1Z6HA 5TSSA 2AUJD 1DCZA 2X6LA 5FOBB 4HEDA 1CT1D 2M2LA 1QJOA 2R6GA 4RGMA 5D14A 1A2UA 1LT5D 1Z7TA 3KLRA 4TRDA 2E2HB 4XTCS 3C46A 3GTQB 2I46A 3GQBA 4KHVA 1RTOA 1VMPA 2IW3A 2LY7A 2RQXA 3X3MA 1LACA 3GTLB 5IT9L 4IFDJ 1J8IA 1SMYC 5EKIA 3DHQA 2K5DA 3PO2B 2EDGA 1WD1A 3KUPA 1SEBD 4DXGA 3OMCA 4HN7A 3K0YA 4KJOA 3EQLC 1Y1WB 1CZWA 3NBIA 1DM0B 1PMRA 4WFN3 1QNUA 2DY7A 3MWYW 1B50A 1PDQA 4C1NI 5C6AA 1WTWA 2NB0A 4OO1H 3MC0B 2L1BA 1S5DD 3PUXA 3ONAB 1RDPD 2EOTA 4XQJA 4K8JA 5EPLA 1HHVA 1ENAA 3SK6A 2O4XA 1I6VC 4IZ8A 1TIID 4FVMA 3GO5A 2CHBD 2F3WA 5A2QE 2RDHA 3HG9A 1D6EC 3HEJA 1I4XA 3V96A 3CRKC 2Q8IB 4RGNA 5CBEE 2L12A 1FD7D 1I6HB 3IKJA 3WOEA 1EYAA 2A68C 3KLSX 1DJRD 1TR5A 5IGDA 4NKLA 2DN8A 1EWHA 2NWGA 1NR4A 1XYIA 3VA7A 2OXPA 1GUTA 3K5LA 4IUTA 4KN4C 2XRQD 1SNCA 4K6DA 4MHEA 4KHZA 4DNTB 5KYIA 1GHJA 5BN5A 3S17B 1JWSD 5ELBA 1F9QA 2L11A 4FO2A 4B9XA 1D5ZC 3EROA 4Z9CB 1STHA 1WTVA 2F4IA 2EYMA 5K5PA 1Q3LA 3M4OB 3BVGA 1U4RA 3PUWA 3EJIA 4ID6A 1PXUA 5C5MA 5JAVA 3QJYA 1EY0A 3UI2A 5J1ZA 3TSSA 3L7ZC 1BCPF 4CJ0B 1TWCB 5C4XB 3K57A 5CV6A 1LTAD 3D4DA 3HZXA 1F2YA 1KDCA 3NP8A 1EIHA 1O7YA 2RDFA 2D2CC 1EU3A 1SJHD 4A3GB 2H1EA 1EY5A 3PMFA 1G2SA 1B4OA 4QUFA 3S15B 2F0KA 3KBXA 2B2YC 2KOLA 1HTLD 2MJ8A 4A93B 2E2JB 1PTOD 2Q8RE 3R2IA 5FO8B 2QILA 1ENFA 5T1IA 4QMGA 1AP0A 3N6RA 4N9TA 2LFNA 4F87A 2DY8A 1BCPC 5M5WB 2E75C 5KNDA 2EY2A 2XSCA 4IUQA 2BDNA 1A3TA 4H0LC 1SYBA 1X32A 1JE4A 2MGSA 4HR7B 1UEAB 3L9AX 3SR1A 1U9RA 2FINB 4M1UB 2EY1A 3NXWA 2YU9B 1XTCD 4XDXA 2J0TD 2IX0A 3C2PA 1WTQA 2F0TA 3SDZA 4HCSA 3I70A 2ZXOA 2HDMA 2IWHA 5K36H 4LAAA 2Z8LA 1SBBB 4FF1A 5CORA 3M7NA 2A6HD 4A3EB 1T5XD 2QDBA 2KCNA 5HURA 3I8ZA 5FLXL 3JAME 1D5XC 3TP7A 1YNNC 4KD4A 2PPBC 5EKKA 2EYJA 4PQXA 2KA7A 5D65A 1MI2A 3MXUA 2A6EC 1G2TA 3BS1A 5NUCA 3I4NB 2WINB 1PFNA 3IFTA 1SYGA 3M3YB 4OIKA 5EPJA 5C0XH 1YNJC 4RFBA 2FJ2A 2OF1A 1I50B 2R93B 2N55A 1G8ZD 5KNCA 1ZYRC 5EBDA 2R61A 4XQNA 4CJ1B 4G4KA 2AWOA 2WB1B 2K1BA 2KHSA 4EGVA 2JYOA 4X3SA 3QO2A 3G6JB 5CR3A 5FK9C 1KLGD 5E4XA 3C3LA 1Z47A 3LWEA 1WTOA 1BOSA 4KI0A 1EQTA 4DXFA 4ZKBB 5G3LF 5HGTA 3CHBD 5IGGA 1O78A 3QOJA 2B2VC 1IKMA 4LK1C 3P1HA 2VNUD 4MIUA 2G9HD 3PUYA 4G57A 4IALA 3GD7A 3DM1A 1KABA 3DWQA 3NK9A 4Y7NB 1HCZA 4PV1C 5EKLA 4OHJA 4FF3A 3SHLA 5DAUA 5M9OA 2E2DC 5JEAH 2JA8B 4WRDA 1STBA 3DXJC 1Q8IA 1MBYA 1WVLA 5I2YA 2SNMA 2EYHA 4C3IB 1QOHA 3CRLC 4A3MB 3D4RA 1TU2B 3C1FA 3EFXD 1JICA 4DK1A 2FMMA 1CA5A 5CYUA 2F0FA 3MA2B 2QEJC 1BNZA 2KQ3A 4ULLA 4XIGS 4DAPA 1UNSA 4HMJA 1B2TA 2HUGA 3I72A 1STYA 3D3RA 5CV4A 2MPMA 1SE3A 1E0BA 4BA2I 3ZYYX 3NBHA 1TVXA 3I4MB 2B2WA 4KTAA 2RDGA 2F0IA 2B2TA 3JAML 2VXWA 4H44C 2ICIA 3NTKA 5FO9B 1BBXC 2AQ3B 3T13A 1IW7C 2E74C 1EEID 4DF7A 1TS4A 2JEBI 1K8MA 3GTGB 3DWPA 1F2ZA 4K14A 2NZ1D 4RWSC 2B2VA 1SYEA 1SYDA 3MXNA 3S1RB 4RKLA 2JP1A 4TSSA 2EY6A 1XX8A 1T5EA 1A3VA 1MSHA 1PTOB 3TBIB 2KECA 5C4JB 4A3DB 2D62A 1TY0A 2K33A 2KUMA 4KK7A 4E6IA 3S1MB 2B39A 3BYYB 3GV3A 4C1NK 4FF4A 2IX1A 4KD3A 3VYUA 5KRUA 3S1NB 1NCVA 3S2HB 1UAPA 3E5SA 2PZWA 1I4QA 1LLRD 1KAAA 1F9RA 3NPPA 1HQRD 1EQVA 1QNKA 3RMHA 2NVQB 4OO1G 1EWCA 2F0UA 2WKDA 1M8AA 5CV8A 1HXYD 2EY5A 4DK0A 3NTHA 4M8AA 1EZ8A 3DEPA 4R9WA 3CU7A 2J4XA 2SEBD 1BF4A 4BBRB 2CW0C 1CZGA 2IX3A 1BR9A 1EL0A 3H3VC 3ND8A 5I9OA 4KY7A 3PO3B 1RD9D 1ONLA 1PFBA 1ET9A 3A8JE 1V1OA 5IODA 3RZDB 1SAPA 4ZYSA 3FRPB 1J9OA 1WTXA 3H0GB 4QF4A 4K2KA 4C56C 2N88A 1D2BA 3I73A 1DOLA 1LABA 5JPMC 1PZID 2PNRC 2PZUA 1JWUD 3W2DA 2O5IC 4OO1I 2K7VA 1F9SA 3BYTB 3CQZB 1RTNA 4K5XA 1OXSC 4PMBA 1RCVD 2F0WA 5EQ0A 1CHQD 2WAQB 3TZDA 1H9RA 1AW7A 2KJXA 4KJNA 3MAQA 4KY5A 2X6GA 2F0JA 4CKCA 1PRTB 2NN6H 3OIQA 4RGTA 3BZDB 1TWHB 3O13A 4PMWA 2QF7A 4KKSA 1G291 3K6OA 5E3FA 4EQOA 3FPUB 2WIIB 3NWSA 2IT1A 2PZTA 1GUSA 1I4PA 1QB5D 4HAEA 1ILQA 4K8IA 2NVYB 4MN3A 4U68A 3VR2A 1F9PA 2KVMA 5DM73 4ZQ3A 1SJED 2F0QA 4O42A 3S14B 3QG1A 3BDCA 4IUUA 3RZOB 4ZUIA 5CBAE 3TP6A 4L63B 1SYFA 4RAUC 4A3BB 3HP3A 4L8JA 3R8BA 4C2MB 1DYQA 3GV6A 4KV6A 4F7XA 2JEAI 3D6CA 3ND9A 2BE5D 1A2TA 4BBSB 1BCPD 1SYCA 4G7HC 3A8KE 2EYFA 2PQEA 1GUGA 1SSOA 1ILPA 1U4PA 4XT1B 2KCCA 3HGBA 2K04A 2F0PA 1IKLA 5I4DA 4HCEA 4IQZA 2BA1A 3WDNA 1HFNA 1Y1VB 3FMCA 5KGUA 3H09A 2LS01 3RD4A 3K5MA 1QG7A 2F0DA 3TDQA 1JQYD 3P7JA 3M7GA 1EY9A 4RA8A 4X3KA 2BDOA 1JB3A 1C8CA 2MUYA 4HMIA 1BQQT 3SK4A 2A69D 2K28A 3J7AV 4NDXA 1RKNA 1F2LA 4UDUC 1TKWB 2VB3X 3LWUA 2LKVA 2L9HA 1D1IA 2L4NA 3VYSA 5K36G 5ELDA 2HCCA 4C3HG 1B53A 2F0VA 1BDOA 4DFAA 1LTSD 3NE5B 1HTPA 2V4DA 2K32A 4HTHA 4AYBB 3HOYB 1QCBD 3MTSA 2NVTB 3FVQA 3I90A 2R3ZA 3IAYA 4A3IB 1GUNA 2XIWA 1DOMA 1W6JA 4B08A 1NUCA 2M9VA 3AU7A 4ABNA 1ZYRD 4PMCA 2SOBA 5LL6S 5C0XG 3MFGA 2VB2X 4F8MA 3R2TA 4JBWA 1CA6A 1FNWA 1W6KA 1OXXK 2EYPA 3LX0A 2LMCB 4LMQD 5A2QL 1JOQA 1R4QB 2F0GA 3MHBA 5LL6X 5J39A 3S1QB 3T16A 3T4AC 1B44D 5IGFA 3OHXC 3NUCA 4CKEA 1UUPA 1PTOC 1OXUA 3NSWA 2HQEA 2EE1A 3HOUB 2Z1CA 2J7ZA 1O7LA 3A55A 3MXGA 4ZK9B 1GJXA 4DN4M 2X69A 1EYDA 4RH6A 2IPKD 2NTSA 2F1MA 2TSSA 2ZXRA 3D31A 1RJTA 5ELEA 1EEFD 2BOSA 3SE0A 2RVLA 4FYDA 1U4LA 3H94A 4P2CB 1WD0A 1SE2A 2B2WC 5D3IB 1FNVA 1X3PA 2PYKA 2B2TC 3T53B 3QB3A 5C5LA 5G3LD 5JEAG 1DOKA 1EOTA 2G9DA 4Q0FA 5IIFA 3R93A 5A35A 5EPKA 2M00A 2BA0A 3HS0C 1KTKA 3TP8A 5I6YA 1ET6A 1Y69U 2WACA 2A6HC 4RKBA 1I4GA 1TS5A 3SK5A 1A6XA 3GP7A 5FO7B 1H9MA 4A3JB 5KNBA 1PRTF 1FYCA 3VR3A 4DAVA 1QILA 1E2WA 2WV6D 3RUZA 4BS9A 1TS2A 3DEOA 1SE4A 2CVRA 1K83B 5JVH3 3K58A 2A73B 3V05A 2SDFA 1B1ZA 2GA4B 2RKSA 1TWFB 1H9SA 3HOZB 1IW7D 1EY4A 5T1GA 5IT9E 2B8GA 4OL7A 5ISRA 2EJMA 2PMZB 3Q24A 5I2XA 3Q23A 3KBGA 4F88A 3VYTA 4QUCA 2PW7A 3EVQA 2WP8J 3BVZA 1PRTC 4ZRZA 3A54A 2Q8TA 4DU9A 4DGZA 3WOFA 2FFKB 3PIP3 4C3JG 1TQOA 3D4WA 1MGSA 1WTPA 4IFDH 3TMEA 2JA7B 4CKBA 4CHTB 3MVVA 3PUZA 1MSGA 3IL8A 3ITPA 1R9TB 2E2IB 1S5FD 4NW2A 3G7LA 1G6ZA 2NUCA 2H4OA 4IUVA 3FPPA 1OO9B 3A56A 3T51B 5IGBA 3GTMB 3V2TA 3K5NA 3BDOA 4EVOA 4YIJA 4DA2A 2RBMA 3E0JA 2EYLA 4K5WA 1S5CD 3P20A 1G91A 5JOBA 3AB9A 3S16B 5EJWA 1GXDC 1H9SB 2FMCA 2QKIC 3J81E 1FR3A 1EIGA 1XWEA 1OXVA 5C3XA 4WJWA 4RCOA 1IL8A 1RODA 1SMYD 1DONA 2F0OA 3K59A 1LV9A 4ZLTF 1V1PA 4XXEA 4XYOA 3IFDA 5EGTA 2F0SA 2XWBB 1EY7A 3X3NA 1FNUA 5M3MB 4I65A 2AQ2B 1EFID 3PUVA 1JOOA 4PNYA 4FXGC 2R92B 1L0XB 2EJFC 2EVBA 3I91A 1AEXA 5JEAJ 1E2ZA 1SNQA 5JJZA 1QE6A 4ZUJA 2RSNA 1DZ1A 2IJ0A 3K5OA 5C4HA 4ILWA 1HUNA 1B9NA 1HFGA 5M5YB 5EBCA 1S5ED 2NVXB 4EQNA 4A3KB 1C4QA 3KF8A 4N9PA 3J7AF 2Z4HA 4TKOB 4H13C 2BCOA 1JORA 1LT6D 3U9OA 3MFYA 2A68D 4V190 4DAYA 4FXKC 1VCIA 2NN6G 1K8OA 2OEOA 1RHPA 4X3TA 1HUMA 3NTIA 1I4RA 1PFMA 1V1PB 1M4VA 1Y8OB 1TS3A 1E2VA 1STGA 1D5MC 2DNCA 1WCMB 4BY7B 3QWNA 1GUOA 3K7AB 4BY1B 4OIJA 2HCIA 3LNNA 1D1KA 4B9WA 1X3QA 1STEA 1F77A 4RHSA 3A8IE 1AN8A 3N52A 5LHY1 1VF5C 4WORA 5C3WA 2KEEA 5CC4A 1LTBD 4ODGA 2B2UC 3ERQA 2F0NA 4ZKCB 1EYCA 5C44B 3GTOB 1STNA 2MP1A 4CJ2C 5D3DA 1KLUD 4FF2A 1ML0D 4NP5A 1I3QB 3OMGA 1FGBD 4X3UA 2NN6I 4K2LA 2CQAA 4J1MA 3TN2A 2EZVA 5BN4A 1ENCA 4KMUC 1VF7A 2F0MA 3CKIB 3PV0A 1JR0D 3R3OA 3GTPB 3HOXB 3VA5A 3J80E 1JOKA 2OT2A 5FLXE 1CM9A 3J81L 1PTOH 3P75A 1CI3M 4DNRB 2PW5A 2EPBA 1SNOA 4K5VA 1GHKA 1Y8NB 4C3HB 2JE6I 1TWGB 1SXTA 1QWYA 3OWFA 2FHTA 4XT3B 3E6ZX 1V43A 5FKAC 3H6MA 3H91A 5E1FA 3T56B 4A3FB 1CQVA 1VDZA 4EQPA 5KIXA 2SNSA 1AFPA 5JVG3 3VR4A 5KEEA 2AWNA 3SK8A 5F2DA 3BG3A 3AMUA 1NR2A 4RHRA 2A74C 2KEDA 3D6WA 4U673 1CHPD 3HRZC 3NWTA 5CV5A 5AFWA 2HDLA 1GUWA 3BDLA 5CV9A 2XN9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2T A;  1WTR A;  2B2W C;  4XDX A;  1WTV A;  1BF4 A;  3F2U A;  4MN3 A;  1ML0 D;  1X3P A;  4U68 A;  3MTS A;  1EL0 A;  2DY7 A;  1F9P A;  2KVM A;  2VXW A;  1O7Z A;  1QE6 A;  2B2T C;  2K05 A;  3I90 A;  3MWY W;  4X3U A;  5CMD A;  5JJZ A;  1B3A A;  2B2V C;  1PDQ A;  1KNA A;  1Q3L A;  1WTQ A;  4O42 A;  2Q8T A;  1IKM A;  2RSN A;  1J8I A;  1DOK A;  1PFB A;  1EOT A;  1S4Z A;  2D9U A;  2FFK B;  2NYZ D;  2R3Z A;  4IUU A;  1WTW A;  4HCS A;  5CBA E;  1U4R A;  1BBX C;  1HUN A;  1ZXT A;  2B2U A;  1MGS A;  3TN2 A;  2L1B A;  2XIW A;  4R8I A;  1NAP A;  2HDM A;  1WTP A;  1AZQ A;  1DOM A;  4RAU C;  3HP3 A;  3UI2 A;  1SAP A;  3DM1 A;  1HFG A;  4R9W A;  3ONA B;  3GV6 A;  5COR A;  3R93 A;  4CJ0 B;  1MSG A;  2EOT A;  5EPL A;  3IL8 A;  5EPK A;  1J9O A;  1WTX A;  3I8Z A;  1BO0 A;  2NZ1 D;  4RWS C;  1CM9 A;  1HHV A;  2B2V A;  4NW2 A;  3SVM A;  3G7L A;  1G6Z A;  1KNE A;  1EIH A;  1A15 A;  1U4M A;  2EPB A;  1O7Y A;  1CA6 A;  2JP1 A;  2N88 A;  4IUV A;  2IL8 A;  4IUP A;  4ZAI A;  2K01 A;  2FHT A;  1XX8 A;  5D65 A;  1VMC A;  1DOL A;  1MI2 A;  1SSO A;  4XT3 B;  1ILP A;  1U4P A;  2H1E A;  4XT1 B;  1B50 A;  4LMQ D;  1G2S A;  2B2Y A;  1B4O A;  1MSH A;  3FDT A;  2K04 A;  4UAI A;  4QUF A;  1G2T A;  1IKL A;  1SDF A;  1WVL A;  3H91 A;  1HA6 A;  3KBX A;  2B2Y C;  1RHP A;  1G91 A;  2KEC A;  4X3T A;  2KOL A;  1HUM A;  1F9S A;  2MJ8 A;  5CBE E;  1HFN A;  1PFN A;  2L12 A;  2X6L A;  5EJW A;  1RTN A;  1O80 A;  1PFM A;  2Q8R E;  4OIK A;  1EIG A;  1QG7 A;  2KUM A;  5EQ0 A;  5EPJ A;  3DEO A;  3GV3 A;  4HED A;  3TZD A;  2CVR A;  1JIC A;  2RSO A;  2M2L A;  2FJ2 A;  5T1I A;  5D14 A;  2FMM A;  2RA4 A;  1IL8 A;  3P7J A;  2SDF A;  1CA5 A;  1AP0 A;  1ROD A;  2N55 A;  4RA8 A;  1NCV A;  4OIJ A;  4X3K A;  2HCI A;  5COY A;  1DON A;  1LV9 A;  2NWG A;  1C8C A;  1NR4 A;  2X6G A;  2EE1 A;  1RTO A;  1BNZ A;  2DY8 A;  1XYI A;  4CJ1 B;  1F9R A;  4ZLT F;  1VMP A;  2J7Z A;  4IUQ A;  1X3Q A;  1NR2 A;  2K28 A;  3IFD A;  1AZP A;  1QNK A;  2BDN A;  5T1G A;  4ZK9 B;  1F2L A;  1PLF A;  2K1B A;  4HSV A;  4IUT A;  2HUG A;  1B2T A;  2JYO A;  4DN4 M;  3QO2 A;  4X3S A;  3N52 A;  3Q6S A;  5DNF A;  5EKI A;  2KED A;  2X69 A;  4MHE A;  1ESR A;  2L9H A;  3D6W A;  5E4X A;  2L4N A;  2MPM A;  1X32 A;  2KEE A;  1JE4 A;  1M8A A;  3FPU B;  1E0B A;  3LWE A;  2MGS A;  2HCC A;  1WTO A;  1B53 A;  1ICW A;  1TVX A;  3I3C A;  1F9Q A;  2B2U C;  1RJT A;  2L11 A;  2MP1 A;  3KUP A;  1WD1 A;  4ZKC B;  1HRJ A;  5AFW A;  2FIN B;  4QUC A;  2B2W A;  2HDL A;  2K03 A;  1U4L A;  2RVL A;  1EQT A;  4IUR A;  5E4W C;  4CJ2 C;  1GUW A;  1WD0 A;  1DZ1 A;  4ZKB B;  3DEP A;  4HAE A;  1ILQ A;  3I91 A; 
#chains in the Genus database with same CATH topology
 4JBM A;  1S5B D;  3RZD H;  2PNH A;  4XYQ A;  3PSI A;  2AQ1 B;  3KDF B;  1Q1E A;  1N34 L;  1SFO B;  3Q0A A;  1KC8 C;  3HOX G;  1DD2 A;  1HPC A;  4DV6 Q;  2PCF B;  1JMC A;  4EX5 A;  5GRO A;  2Z4I A;  1JCK B;  1RL2 A;  2NYZ D;  3MXP A;  2B2U A;  3H0G H;  1YNN D;  1NAP A;  1AZQ A;  4DR1 Q;  2CCZ A;  5CGK A;  3W1G A;  4ME5 A;  1TXY A;  1JWM D;  2ID0 A;  2B63 B;  1SNM A;  1EQR A;  3EBE A;  4FP5 D;  2JXM B;  4BWG B;  2O2L D;  1BO0 A;  5C4Z A;  3Q22 A;  3UE0 A;  2A6E D;  2XNA C;  3NQT A;  3SVM A;  1KNE A;  1LT4 D;  1A15 A;  1OXT A;  5FJ8 G;  5H1S E;  3PF4 A;  4KKT A;  4V0B A;  2XRS D;  3FKI B;  2K01 A;  3CQZ H;  2LSS A;  1CK1 A;  4YCV A;  1CFM A;  2BE5 C;  3FDT A;  2HIV A;  4UAI A;  5CV7 A;  3A7A B;  2PMZ E;  1PTO F;  1YNJ D;  1HA6 A;  2A5H A;  2F3V A;  3NHH A;  3E9I A;  1J5E L;  4S3S A;  1K0S A;  5C3E B;  4R4T A;  1SNP A;  2Q2T A;  2VUM B;  3KK7 A;  3KLS A;  2JA6 B;  1JJC B;  1D7Q A;  4IUN A;  1PHJ A;  4I7Z C;  1YHB A;  2PQA A;  4LJZ C;  5J22 A;  1GM5 A;  2AUK A;  2VL6 A;  3QOL A;  4LFA L;  1TWH H;  3G71 A;  1Q46 A;  4X6A H;  4X62 L;  1JC7 A;  5I6W A;  2K6A A;  4HIM A;  1X9N A;  2VZA A;  1AZP A;  2TMP A;  2BH2 A;  4HSV A;  5C4X G;  3F2D A;  1KD1 C;  3VYR A;  3L0O A;  2MHV A;  4CBV A;  4FXD A;  2NVY H;  2L15 A;  1X55 A;  2A69 C;  5ELC A;  2XWJ B;  3I3C A;  3PIO 3;  3S14 H;  4A3G G;  4MNO A;  3J7Y W;  1IBM Q;  1P16 A;  2QEX A;  3RZO H;  5M3F B;  2F0E A;  3S17 H;  4R8N A;  2I0Q A;  1X3E A;  3S2D B;  4RGO S;  3J80 L;  4HSP A;  4POG A;  4DR3 Q;  3HOW B;  3F2U A;  3GTK B;  2K5W A;  4A3B H;  1SND A;  4C2M H;  4L5S A;  3U50 C;  2YYZ A;  3OSO A;  1BBW A;  1KNA A;  1Q82 C;  3FEW X;  1HQM C;  2I5L X;  3KOJ A;  4LWC A;  2C9O A;  2DNE A;  2I07 B;  2D9U A;  3TS0 A;  1S4Z A;  4OWX B;  4BBS H;  4R8I A;  2FXQ A;  5C0X I;  4LF7 L;  3D0F A;  1IL2 A;  2L5T A;  1X3F A;  3W3A A;  4OWW B;  2O5J C;  3EIV A;  3ERS X;  2C5C A;  3UE1 A;  4P72 A;  1X65 A;  1YIJ A;  1Q1B A;  1Y1V H;  2PQA B;  5ELF A;  1KDB A;  4ZAI A;  1QZH A;  2Z6K A;  4XQQ A;  1NSN S;  3M85 A;  1VMC A;  1GO3 E;  3TP5 A;  3DUZ A;  2B2Y A;  3OYY A;  3NQI A;  4TQU S;  2K5N A;  5FLM G;  5IGE A;  3GDE A;  1L0Y B;  3CME A;  1BUV T;  2UUC L;  5AJ3 Q;  3OIP A;  4IN3 A;  2F03 A;  4QY7 A;  1Q90 A;  1H9K A;  4QCL A;  1PZJ D;  1O80 A;  1MD2 D;  4JI2 Q;  2ZT9 C;  4JCV E;  4L5T A;  4C3J B;  4HJA A;  2EXZ A;  4X64 L;  3I4L A;  1H9J A;  3OOC A;  1PRT D;  2RSO A;  3MZ5 A;  4HJ5 A;  4A93 H;  2RA4 A;  5M5X B;  4IJH A;  2XGT A;  1A0I A;  1Y8P B;  1XPO A;  4QQB X;  5COY A;  3C1E A;  5DEH A;  4Q5V A;  1IYU A;  4GLA C;  5IP9 H;  4DR6 Q;  1WJJ A;  1LT3 D;  1RF2 D;  3KFU A;  2XVS A;  1Q12 A;  1HA5 A;  2D5D A;  4YCU A;  1PLF A;  3CCE A;  4A3E G;  5M3F G;  5DNF A;  1II3 A;  4IPG A;  2WKC A;  4OWT B;  4IFD G;  1F2M A;  1NMF A;  3HOY H;  3EA6 A;  2NVT H;  3BVM A;  2ZXP A;  3H3V H;  4J8Q A;  4DK3 C;  2I5M X;  4LW1 A;  4NMZ A;  1E24 A;  1ESF A;  3OWE B;  4OGQ C;  4B3S Q;  2ATW A;  4K6L A;  4CDD C;  1WI5 A;  5JPN C;  1ZEQ X;  5IYB H;  3CXC A;  2QDL A;  3I4N G;  2QCP X;  3VR6 A;  1D8L A;  5DM6 3;  1K0R A;  5BN3 A;  4JG2 A;  1JB7 A;  5CMD A;  2K05 A;  4QIW B;  1QZG A;  3VR5 A;  3L3O C;  1LTI D;  1DXM A;  4AIM A;  4HID A;  4J6H A;  5HGQ A;  2JN4 A;  5IGC A;  2B8F A;  4H7B A;  4PG3 A;  2R93 G;  3M4Y A;  4PZ7 A;  3DWA A;  2L0C A;  2LXK A;  3D8G A;  2K5Q A;  1BXT A;  3MEH A;  1TWA B;  2ICE C;  4FNF A;  1X56 A;  4TVA B;  4GZY C;  1LTT D;  3CCS A;  4L6T B;  1N36 L;  3J81 i;  3U9S A;  4G7O C;  1PH9 A;  2DGY A;  2IL8 A;  2Y0S B;  1C48 A;  4IUP A;  4P74 A;  3CC4 A;  1XXG A;  3OW7 A;  4RCN A;  2YV5 A;  2F0H A;  4G7Z C;  1YJN A;  4LUZ A;  1VQN A;  1STA A;  1IBL L;  3S1Q H;  4LFC Q;  1BCP B;  5C0X J;  4IFD I;  1B9M A;  1Q81 C;  1YHQ A;  3SXH A;  3HOU H;  2CWP A;  1EY8 A;  1IYV A;  4A76 A;  5LMN L;  1KDA A;  4KLK A;  2HQL A;  2NTT A;  2ZTE A;  1CTM A;  3M3Y H;  2F0L A;  1I4H A;  5EAY A;  1CKO A;  2L55 A;  2K50 A;  1V8Q A;  2VQF Q;  2ENB A;  4JOI C;  1W2B A;  4CGY B;  1HNW L;  2RHS B;  4JC0 A;  3Q6S A;  1CQF A;  1TT2 A;  2KHI A;  1ESR A;  1EY6 A;  1XPR A;  1GOZ A;  1PZK D;  1R4P B;  2CW0 D;  1HH2 P;  3URY A;  1ICW A;  1EZ6 A;  1ZKO A;  2E76 C;  1LO5 D;  1VQO A;  3S9W A;  1HRJ A;  2K03 A;  3JC6 6;  4IUR A;  5E4W C;  2EJG C;  2NBF A;  2R7F A;  3HOV B;  4HJ7 A;  1WTR A;  4QB4 A;  4P73 A;  4DV7 Q;  1FGU A;  2JA5 B;  4GOP C;  2JSO A;  1T9H A;  1O7Z A;  4K0K Q;  2C35 B;  1LTG D;  1B3A A;  3J7Z C;  4C3I G;  3GTJ B;  1JT8 A;  1EWI A;  4KKU A;  4QL5 A;  2R7Z B;  4DV0 L;  2D0O A;  3DMU A;  3HKZ B;  2PO4 A;  4A3M G;  3QIA A;  1ZXT A;  3A7L A;  2UXB Q;  4JI8 L;  1TY2 A;  4GKK L;  4KN7 C;  4HIK A;  3RLF A;  1A3U A;  3OPO A;  3M4Q A;  4KY6 A;  4O1N A;  1LTR D;  3K0X A;  1YIT A;  2UXC Q;  1IHZ A;  1B3Q A;  2EYO A;  4R1J A;  4JI3 L;  4A3J H;  5I9P A;  1U4M A;  1PYW D;  5KYL A;  2JK8 A;  3TZU A;  3SEB A;  5IOC A;  4BA1 I;  1EU4 A;  1PH3 A;  1S40 A;  1SDF A;  4GN5 A;  1VQL A;  1K83 H;  4JK1 C;  4HIO A;  4RG1 A;  1Z6H A;  3J81 j;  3I4M G;  5TSS A;  2JA8 H;  2AUJ D;  1DCZ A;  2X6L A;  5FOB B;  3E3X A;  3CCQ A;  3S24 A;  1TWF H;  4HED A;  1CT1 D;  2ZJP A;  3HOZ H;  2M2L A;  1QJO A;  2R6G A;  4RGM A;  4YCW A;  5D14 A;  1A2U A;  1LT5 D;  1Z7T A;  4BXX G;  3KLR A;  4TRD A;  2E2H B;  3T1H L;  4XTC S;  3C46 A;  3GTQ B;  2I46 A;  3GQB A;  2R7D A;  1XMO Q;  4KHV A;  1RTO A;  4HJ8 A;  1VMP A;  2KCT A;  4A3C H;  2IW3 A;  2A1A A;  5IYD G;  1EOV A;  2LY7 A;  2RQX A;  3X3M A;  1LAC A;  3GTL B;  5IT9 L;  4IFD J;  1J8I A;  1SMY C;  5EKI A;  5J3B A;  3DHQ A;  4YWL A;  1Z9F A;  3CCL A;  2K5D A;  3PO2 B;  2EDG A;  3W1B A;  4R4C A;  4LF9 L;  1KL9 A;  1WD1 A;  3KUP A;  1SEB D;  4DXG A;  3OMC A;  4HN7 A;  3K0Y A;  4KJO A;  3EQL C;  1Y1W B;  2UU9 Q;  1CZW A;  2E8G A;  3NBI A;  1DM0 B;  1PMR A;  2VS1 A;  1E1O A;  4WFN 3;  1QNU A;  2DY7 A;  3MWY W;  3J80 i;  1B50 A;  4OON A;  1VQ6 A;  5IWA Q;  1PDQ A;  3PQI A;  4C1N I;  4A3D G;  4ZCK A;  5C6A A;  1WTW A;  2NB0 A;  1R9T H;  2K52 A;  4OO1 H;  2E2I H;  3MC0 B;  2L1B A;  1S5D D;  3PUX A;  1IBK L;  4JI4 Q;  2HT1 A;  3ONA B;  1RDP D;  2EOT A;  4XQJ A;  4K8J A;  5EPL A;  3GTM H;  1EUJ A;  1VQG A;  2UUB Q;  1ENA A;  1HHV A;  3SK6 A;  2O4X A;  1I6V C;  4IZ8 A;  1TII D;  3S16 H;  3A5Z B;  1CSQ A;  4FVM A;  3GO5 A;  1VQ9 A;  2CHB D;  2AKW B;  2F3W A;  5A2Q E;  4GKJ Q;  1VQP A;  2RDH A;  3HG9 A;  1D6E C;  1W3S A;  4I7A A;  2MQH A;  3HEJ A;  1I4X A;  3V96 A;  3CRK C;  2Q8I B;  1HZB A;  4RGN A;  5CBE E;  1NY4 A;  2L12 A;  1FD7 D;  1I6H B;  3IKJ A;  3WOE A;  1EYA A;  2A68 C;  2N3S A;  4BBR G;  4LF5 L;  3KLS X;  1DJR D;  1TR5 A;  5IGD A;  4LF8 Q;  4NKL A;  2DN8 A;  3STB C;  1HR0 L;  2NZO A;  4JI7 L;  1EWH A;  2JA9 A;  2NWG A;  1NR4 A;  3G6E A;  1XYI A;  3VA7 A;  2OWO A;  2OXP A;  1GUT A;  3K5L A;  1K3B C;  1KHI A;  4IUT A;  3S2H H;  4KN4 C;  2XRQ D;  4X65 Q;  1SNC A;  4K6D A;  4MHE A;  4KHZ A;  3H0G G;  4DNT B;  4DV1 Q;  4IPC A;  5KYI A;  1GHJ A;  3NEM A;  5BN5 A;  3S17 B;  1JWS D;  4DUZ L;  4A4I A;  2HHH L;  1Q86 C;  5ELB A;  3ULL A;  1F9Q A;  2L11 A;  4FO2 A;  4JI1 L;  2VQE Q;  4B9X A;  1D5Z C;  2AMC B;  3ERO A;  4Z9C B;  4OX9 L;  1SRU A;  1STH A;  1WTV A;  1XNQ Q;  3A74 A;  2F4I A;  1KIX A;  2EYM A;  5M5Y H;  5K5P A;  1HNZ L;  1Q3L A;  3M4O B;  2NVX H;  4YWM A;  3BVG A;  1NNX A;  1HZA A;  1U4R A;  3PUW A;  3T1Y Q;  3EJI A;  2WAQ G;  4ID6 A;  1JJ2 A;  4A75 A;  1PXU A;  5C5M A;  5JAV A;  1YI2 A;  3QJY A;  1EY0 A;  3UI2 A;  1EQQ A;  5J1Z A;  3TSS A;  3CCU A;  3L7Z C;  3PO3 H;  1VS0 A;  1BCP F;  2DJF C;  4CJ0 B;  1TWC B;  4LF6 L;  4DUY Q;  5C4X B;  3K57 A;  5CV6 A;  4DR4 Q;  1LTA D;  3D4D A;  3HZX A;  1F2Y A;  1KDC A;  3I4O A;  3NP8 A;  1EIH A;  1O7Y A;  2RDF A;  2D2C C;  1X54 A;  1EU3 A;  1SJH D;  1BKB A;  4A3G B;  2H1E A;  1EY5 A;  3PMF A;  1G2S A;  3L2P A;  1B4O A;  4QUF A;  1WTH A;  2Z6K C;  3S15 B;  2F0K A;  1ASY A;  3KBX A;  1WCM H;  2B2Y C;  4IOC A;  4BY7 H;  2KOL A;  3JAM c;  5HY6 A;  3UDX A;  3K7A H;  1HTL D;  2MJ8 A;  4A93 B;  5BR8 Q;  4BY1 H;  1L1O B;  2ZM6 Q;  2E2J B;  1PTO D;  2Q8R E;  3R2I A;  5FO8 B;  1V1Q A;  2UXD Q;  1PVO A;  2QIL A;  4GS3 A;  1ENF A;  5T1I A;  4QMG A;  1AP0 A;  3N6R A;  4N9T A;  2LFN A;  4QIW E;  4F87 A;  4DR2 L;  3F8T A;  2DY8 A;  1BCP C;  5M5W B;  2E75 C;  5KND A;  2EY2 A;  4A3B G;  2XSC A;  1PFS A;  4AQY Q;  4IUQ A;  3CMA A;  2BDN A;  4R4I A;  5C44 H;  1A3T A;  4H0L C;  3GTO H;  4O2D A;  1BBU A;  4BBS G;  1SYB A;  1X32 A;  1JE4 A;  2MGS A;  1N32 L;  1I3Q H;  4HR7 B;  1UEA B;  3I2Z A;  1LM0 A;  3L9A X;  3SR1 A;  1U9R A;  4DV4 L;  1YZ6 A;  1E3P A;  2FIN B;  2Y0S E;  4M1U B;  2EY1 A;  3IRB A;  4JV5 Q;  3KJO A;  3NXW A;  1C9O A;  2YU9 B;  1HNX L;  1XTC D;  4XDX A;  2J0T D;  2IX0 A;  3C2P A;  1Y1V G;  1WTQ A;  3GTP H;  2F0T A;  3SDZ A;  1N34 Q;  4HCS A;  3I70 A;  2ZXO A;  2HDM A;  2IWH A;  5K36 H;  4RMF A;  4LAA A;  2Z8L A;  1SBB B;  4C3H H;  4FF1 A;  1TWG H;  5COR A;  1SMX A;  3M7N A;  2PI2 E;  2A6H D;  2MO0 A;  4A3E B;  3RN5 A;  1T5X D;  2QDB A;  1X6O A;  1PH5 A;  2KCN A;  3I8Z A;  5HUR A;  5FLX L;  3JAM E;  4KHP L;  1D5X C;  3TP7 A;  1YNN C;  1K9M C;  4KD4 A;  3RN2 A;  2PPB C;  5EKK A;  4A93 G;  2E5L L;  2EYJ A;  4PQX A;  2KA7 A;  4DR6 L;  4A3F H;  5D65 A;  1MI2 A;  4JI5 L;  5IP9 G;  3MXU A;  2A6E C;  4LF4 L;  1G2T A;  3BS1 A;  5NUC A;  3I4N B;  2WIN B;  1PFN A;  3IFT A;  1J5E Q;  1SYG A;  5LMU L;  4OIK A;  3M3Y B;  4AYB G;  5EPJ A;  3HOY G;  4UP8 A;  5C0X H;  3F1Z A;  1YNJ C;  4RFB A;  2FJ2 A;  2OF1 A;  1I50 B;  3TRZ A;  2R93 B;  4MZ9 A;  1NE3 A;  4CDF C;  2N55 A;  1G8Z D;  5KNC A;  1ZYR C;  2VY3 A;  5EBD A;  1PH1 A;  5IYB G;  2R61 A;  3HKZ E;  5GQO A;  4LFA Q;  4XQN A;  1IYJ B;  4CJ1 B;  1IXR A;  1M1K C;  4B3T L;  4G4K A;  2AWO A;  1VQA A;  2WB1 B;  4X62 Q;  2K1B A;  2KHS A;  2JYO A;  4EGV A;  3QO2 A;  4X3S A;  1HR0 W;  3G6J B;  5CR3 A;  1MJE A;  1KLG D;  2K4K A;  5FK9 C;  2ASB A;  5E4X A;  3FHW A;  3C3L A;  4NPS A;  5IYC H;  1Z47 A;  4HJ9 A;  3LWE A;  1WTO A;  1SFO H;  1BOS A;  4KI0 A;  1NMG A;  4JBJ A;  1EQT A;  4CDE C;  4DNI A;  3MEF A;  4DXF A;  4ZKB B;  5G3L F;  5HGT A;  4DR5 L;  1I94 L;  3RNU A;  3CHB D;  5IGG A;  1O78 A;  4IPD A;  3QOJ A;  1HJP A;  2B63 H;  2B2V C;  4B3R L;  1IKM A;  4LK1 C;  3P1H A;  2VNU D;  4MIU A;  2PI2 A;  4OXP A;  2G9H D;  3PUY A;  4G57 A;  4IAL A;  1VQB A;  2K75 A;  3GD7 A;  3DM1 A;  1WOC A;  4LNQ A;  1AE2 A;  1KAB A;  3DWQ A;  3FKI H;  3H3V I;  3DLL A;  3NK9 A;  4LF7 Q;  4A3I H;  4Y7N B;  4P75 A;  3HOU G;  1JE5 A;  1HCZ A;  1YBY A;  4PV1 C;  5EKL A;  4OHJ A;  4FF3 A;  3SHL A;  5DAU A;  3CPF A;  5M9O A;  2E2D C;  5C3E H;  2VUM H;  3HFZ B;  2A8V A;  5JEA H;  2JA6 H;  2JA8 B;  4WRD A;  2QGQ A;  1STB A;  3DXJ C;  1Q8I A;  1MBY A;  1WVL A;  4B3M L;  1YJ9 A;  3OTO L;  5I2Y A;  1JJG A;  2SNM A;  2EYH A;  4C3I B;  1QOH A;  2UUC Q;  1XNR L;  2F4V L;  3CRL C;  4QJF A;  4A3M B;  3D4R A;  1TU2 B;  3C1F A;  3EFX D;  2WB1 G;  1JIC A;  4YWK A;  4DK1 A;  1K73 C;  2FMM A;  4JI0 L;  4X64 Q;  1CA5 A;  4R4Q A;  1UE7 A;  3W5O A;  5CYU A;  4YHH L;  2F0F A;  3K8A A;  1CUK A;  5ELO A;  3MA2 B;  5ELN A;  1CSP A;  2QEJ C;  1BNZ A;  2KQ3 A;  5DLQ E;  1VQ8 A;  4ULL A;  4XIG S;  4DAP A;  1UNS A;  4HMJ A;  1HZ9 A;  2HUG A;  2P5Z X;  3I72 A;  1B2T A;  1STY A;  3D3R A;  5CV4 A;  2MPM A;  1QUQ A;  3S2D H;  1SE3 A;  3HOW H;  1E0B A;  3GTK H;  4UHV A;  2IHE A;  2Q2I A;  4BA2 I;  3ZYY X;  4ALP A;  3NBH A;  1RIP A;  1TVX A;  2CWA A;  4DK6 C;  3I4M B;  2B2W A;  4KTA A;  2RDG A;  2F0I A;  2B2T A;  3JAM L;  3OW2 A;  2OTL A;  4A3J G;  2VXW A;  4H44 C;  4LUO A;  2ICI A;  2IY5 B;  3NTK A;  5FO9 B;  1BBX C;  2AQ3 B;  3T13 A;  4UP9 A;  1IW7 C;  2E74 C;  1EEI D;  4DF7 A;  1TS4 A;  2JEB I;  1KQS A;  1K8M A;  2JA8 G;  3GTG B;  3CP0 A;  2KBN A;  3DWP A;  1F2Z A;  4K14 A;  2NZ1 D;  1BVS A;  4RWS C;  2B2V A;  1SYE A;  1SYD A;  3MXN A;  3U4Z A;  3S1R B;  1QVC A;  3HOZ G;  3I56 A;  3Q8D A;  4RKL A;  2JP1 A;  4TSS A;  2EY6 A;  1XX8 A;  1N36 Q;  1T5E A;  4NXM L;  1A3V A;  1MSH A;  1PTO B;  4C3J H;  3F2C A;  2VW9 A;  4A3C G;  3K7U C;  3TBI B;  3BU2 A;  2KEC A;  5M5X H;  1IBL Q;  1N33 Q;  1XMQ L;  5C4J B;  4GLV B;  4A3D B;  2D62 A;  1TY0 A;  1PH2 A;  4MTK A;  2K33 A;  2KUM A;  4YY3 Q;  4KK7 A;  4E6I A;  3S1M B;  2B39 A;  3BYY B;  3GV3 A;  4C1N K;  4FF4 A;  2IX1 A;  3HKS A;  4DV3 L;  1UWV A;  2K5V A;  4KD3 A;  3VYU A;  3QR8 A;  1QUQ B;  5KRU A;  5LMN Q;  3S1N B;  1NCV A;  3S2H B;  3RLO A;  1UAP A;  3E5S A;  2PZW A;  3NBH B;  1I4Q A;  1LLR D;  1KAA A;  1F9R A;  2HD3 A;  3NPP A;  4JI6 L;  1CKN B;  1HQR D;  3FP9 A;  1EQV A;  1QNK A;  1L1O C;  5IE8 A;  1A8V A;  3RMH A;  2CKZ B;  2NVQ B;  2ALY B;  4OO1 G;  1EWC A;  2F0U A;  1HNW Q;  2WKD A;  4DR7 L;  2XTI A;  1M8A A;  5CV8 A;  1HXY D;  2EY5 A;  4DK0 A;  5IY0 A;  3M9B A;  4JYA L;  1B7Y B;  3NTH A;  4M8A A;  3VDY A;  1EZ8 A;  2B3G A;  1Y14 B;  3LGJ A;  3DEP A;  4R9W A;  3CU7 A;  2J4X A;  2YTV A;  2SEB D;  1BF4 A;  4BBR B;  4DV5 L;  2CW0 C;  1CZG A;  2IX3 A;  1BR9 A;  2IHF A;  4X66 L;  1EL0 A;  3H3V C;  3ND8 A;  5I9O A;  1PYS B;  4KY7 A;  4P71 A;  3MXN B;  3PO3 B;  1RD9 D;  1ONL A;  1PFB A;  1C7Y A;  1TWA H;  1ET9 A;  4R4O A;  2ZTD A;  3A8J E;  1V1O A;  5IOD A;  3CCV A;  4DV0 Q;  3CD6 A;  1P8L A;  3RZD B;  3KJP A;  2ES2 A;  1SAP A;  4ZYS A;  4NXN L;  3FRP B;  1U5K A;  1PA6 A;  4JI8 Q;  3SGI A;  1FJG L;  4GKK Q;  3K80 C;  2EIF A;  1J9O A;  1WTX A;  3H0G B;  1KRT A;  3AFP A;  2MNA A;  2JA7 H;  4L5Q A;  4QF4 A;  4DV2 L;  2EQS A;  4K2K A;  4C56 C;  2N88 A;  1D2B A;  4OEL B;  4JI3 Q;  3I73 A;  1DOL A;  2H5X A;  3E0E A;  1LAB A;  5JPM C;  1PZI D;  2PNR C;  3AEV A;  3TEH B;  2PZU A;  1JWU D;  3W2D A;  2O5I C;  4OO1 I;  2K7V A;  1PH6 A;  1F9S A;  1MKH A;  3BYT B;  3CQZ B;  1EIY B;  1RTN A;  4K5X A;  1OXS C;  4PMB A;  1RCV D;  2F0W A;  1J6Q A;  5EQ0 A;  1CHQ D;  2WAQ B;  3DM3 A;  3TZD A;  1H9R A;  4CDC C;  1AW7 A;  2KJX A;  4KJN A;  3MAQ A;  2V1C C;  4KY5 A;  2UUA L;  2X6G A;  2F0J A;  3T1H Q;  4CKC A;  1NTG A;  1PRT B;  2NN6 H;  3OIQ A;  4RGT A;  3BZD B;  1UE1 A;  3KF8 B;  1TWH B;  3O13 A;  4PMW A;  2QF7 A;  4KKS A;  3HOV H;  1G29 1;  3K6O A;  5E3F A;  4EQO A;  3FPU B;  2JA5 H;  2WII B;  3PO3 G;  4DUY L;  3NWS A;  1N9W A;  2IT1 A;  4LFB L;  3GTJ H;  2PZT A;  2R7Z H;  4DAY B;  2D0P A;  1GUS A;  4LF9 Q;  1I4P A;  1WYD A;  1QB5 D;  5M3M H;  4HAE A;  4ME3 A;  1ILQ A;  1L1O A;  4K8I A;  2Q2U A;  2NVY B;  4DV6 L;  4FDB A;  4MN3 A;  5LMN W;  4IO9 A;  1QVG A;  4U68 A;  3VR2 A;  1F9P A;  2KVM A;  5DM7 3;  4ZQ3 A;  4L5R C;  1SJE D;  2F0Q A;  4O42 A;  3S14 B;  2R92 H;  4A3L H;  3QG1 A;  3BDC A;  4DR1 L;  4IUU A;  3RZO B;  1YJW A;  4ZUI A;  5CBA E;  2HIX A;  4UP7 A;  3TP6 A;  1WCM G;  4L63 B;  1SYF A;  4RAU C;  4BY7 G;  4A3B B;  3HP3 A;  4L8J A;  3R8B A;  4C2M B;  1DYQ A;  4J15 A;  4PZ8 A;  3GV6 A;  4Y52 H;  4BY1 G;  3G4S A;  1IBK Q;  4KV6 A;  4F7X A;  2JEA I;  3D6C A;  3ND9 A;  2JQO A;  2BE5 D;  1A2T A;  4BBS B;  1VQH A;  3UDF A;  3AQQ A;  1BCP D;  1SYC A;  4G7H C;  3A8K E;  2WB1 E;  3A0J A;  2EYF A;  2PQE A;  3ULP A;  1GUG A;  4A3K H;  1SSO A;  1ILP A;  2WFW A;  1U4P A;  4XT1 B;  2KCC A;  3HGB A;  4AQY L;  4QGU A;  2K04 A;  2F0P A;  1IKL A;  5I4D A;  1YVC A;  4HCE A;  1GVP A;  2N49 A;  4IQZ A;  2BA1 A;  3WDN A;  5C44 G;  1Y1V B;  1HFN A;  3FMC A;  2E2H H;  3ER0 A;  5KGU A;  3KF6 B;  1VQI A;  3H09 A;  2LS0 1;  5GAH C;  3RD4 A;  3K5M A;  1QG7 A;  2F0D A;  1ASZ A;  3TDQ A;  1JQY D;  4IOA A;  3P7J A;  3M7G A;  3GTL H;  2RF4 A;  4LF5 Q;  1KAW A;  1EY9 A;  4RA8 A;  4X3K A;  2BDO A;  2Z0S A;  1JB3 A;  4GNX A;  1C8C A;  2MUY A;  1HR0 Q;  1VQ5 A;  3PO2 H;  4HMI A;  1BQQ T;  1E22 A;  5IP7 H;  4JI7 Q;  1LTL A;  1KRS A;  3SK4 A;  1VQ7 A;  2A69 D;  2K28 A;  3J7A V;  4NDX A;  2I5H A;  1RKN A;  1F2L A;  1TKW B;  2VB3 X;  4UDU C;  3LWU A;  2LKV A;  3BZC A;  2L9H A;  1D1I A;  2L4N A;  1Y1W H;  1GD7 A;  2NZH A;  3VYS A;  5K36 G;  1YNX A;  5ELD A;  1VQD A;  2HCC A;  1IBM L;  4C3H G;  1B53 A;  2F0V A;  3K81 C;  4N8X 1;  1BDO A;  4DFA A;  2RCN A;  4DUZ Q;  1LTS D;  3NE5 B;  4DR3 L;  2HHH Q;  1HTP A;  2V4D A;  4JI1 Q;  2DJG C;  2K32 A;  4HTH A;  4AYB B;  3HOY B;  1QCB D;  4OX9 Q;  3MTS A;  2NVT B;  3FVQ A;  3JAM i;  3I90 A;  4A3F G;  1M90 C;  2ZJQ A;  2R3Z A;  3IAY A;  1VQF A;  4A3I B;  1HNZ Q;  5L37 A;  1GUN A;  2XIW A;  1YHA A;  4JPB W;  1DOM A;  1W6J A;  3PIO A;  4B08 A;  1NUC A;  3ICE A;  3EN2 A;  2M9V A;  3AU7 A;  2K5H A;  4ABN A;  1CKM A;  2A19 A;  1ZYR D;  2ZJR A;  4PMC A;  4LF6 Q;  2SOB A;  5LL6 S;  5C0X G;  3MFG A;  2N78 A;  3KLW A;  2VB2 X;  4F8M A;  3R2T A;  4JBW A;  1CA6 A;  1FNW A;  1W6K A;  3HOX H;  1NJI C;  4WJ3 M;  3I55 A;  1OXX K;  2EYP A;  2G5D A;  2LMC B;  3LX0 A;  4LMQ D;  1I6H H;  4IJL A;  5AJ3 L;  3CC7 A;  1XPU A;  3E9H A;  5A2Q L;  3TS2 A;  1JOQ A;  1R4Q B;  2F0G A;  3MHB A;  4GNX B;  5LL6 X;  1N8R C;  4JI2 L;  5J39 A;  1K28 A;  2OQ0 A;  5IYC G;  3S1Q B;  3T16 A;  1K8G A;  1HZC A;  3UDG A;  3T4A C;  1B44 D;  5FJ8 H;  3NEL A;  1MJC A;  5IGF A;  3OHX C;  3NUC A;  4CKE A;  1UUP A;  1PTO C;  3ULJ A;  1OXU A;  3NSW A;  2HQE A;  2EE1 A;  3PGZ A;  3HOU B;  3NEN A;  2Z1C A;  2F52 A;  2J7Z A;  4DR2 Q;  5GAD C;  2B63 G;  1O7L A;  3A55 A;  3TRE A;  4GLX A;  3MXG A;  4ZK9 B;  1GJX A;  4DN4 M;  2X69 A;  4JVZ A;  1EYD A;  4RH6 A;  2LXJ A;  2IPK D;  2NTS A;  1VQ4 A;  1SN8 A;  2F1M A;  1VQC A;  2TSS A;  2ZXR A;  1NBW A;  3D31 A;  4B3S L;  3FKI G;  1RJT A;  5ELE A;  1EEF D;  2BOS A;  3SE0 A;  3M4O H;  1N32 Q;  4A3I G;  2RVL A;  4FYD A;  1U4L A;  5JJI A;  3H94 A;  4P2C B;  1WD0 A;  4DV4 Q;  3M4P A;  5IT9 c;  1SE2 A;  2B2W C;  5D3I B;  2EXD A;  1FNV A;  2CH4 W;  1X3P A;  2PYK A;  2Z9H A;  5C3E G;  2B2T C;  1HNX Q;  2VUM G;  3T53 B;  3QB3 A;  1TWC H;  5C5L A;  1PYB A;  5G3L D;  5C4X H;  5JEA G;  2JA6 G;  1DOK A;  1EOT A;  2G9D A;  4Q0F A;  1PH4 A;  5IIF A;  4PZ6 A;  3R93 A;  5A35 A;  3BJU A;  4A3G H;  5EPK A;  2M00 A;  2BA0 A;  3HS0 C;  1E7Z A;  1KTK A;  3TP8 A;  4JBK A;  3S15 H;  2K14 A;  5I6Y A;  5JJL A;  4KHP Q;  1SRO A;  1ET6 A;  1Y69 U;  2WAC A;  2A6H C;  4LFC L;  2E2J H;  2E5L Q;  4RKB A;  1I4G A;  4AH6 A;  1TS5 A;  3SK5 A;  1A6X A;  3GP7 A;  5FO7 B;  4JI5 Q;  1H9M A;  4A3J B;  1DGS A;  5KNB A;  4LF4 Q;  1PRT F;  1FYC A;  2KCM A;  3VR3 A;  4NB3 A;  3AYH B;  4DAV A;  1QIL A;  1K3R A;  3CCJ A;  1E2W A;  2WV6 D;  3RUZ A;  3HOW G;  4BS9 A;  5M5W H;  1TS2 A;  3DEO A;  1SE4 A;  2CVR A;  1K83 B;  4WJ4 A;  5LMU Q;  5JVH 3;  3K58 A;  2A73 B;  3V05 A;  2SDF A;  3PIP A;  4IPH A;  1B1Z A;  3F2B A;  2VQF L;  2GA4 B;  2RKS A;  1TWF B;  1H9S A;  5FLM H;  3HOZ B;  1IW7 D;  2CQO A;  3J81 c;  1EY4 A;  5T1G A;  5IT9 E;  2OTJ A;  2B8G A;  3I7F A;  1I5F A;  4B3T Q;  4OL7 A;  5ISR A;  1E1T A;  2EJM A;  3U58 A;  2PMZ B;  2YU9 H;  2BH8 A;  3Q24 A;  1LYL A;  5I2X A;  3Q23 A;  1G51 A;  1PH7 A;  3KBG A;  4F88 A;  3VYT A;  4QUC A;  4DV7 L;  2PW7 A;  3CW2 C;  4K0K L;  3EVQ A;  2WP8 J;  3BVZ A;  1PRT C;  4N8F A;  4ZRZ A;  1A62 A;  4DR5 Q;  1I94 Q;  3A54 A;  2UXB L;  4A3E H;  2Q8T A;  2KEN A;  4DGZ A;  4DU9 A;  5M3F H;  3WOF A;  2FFK B;  3PIP 3;  4C3J G;  1TQO A;  3D4W A;  4B3R Q;  1MGS A;  1WTP A;  4IFD H;  1VQK A;  4H02 A;  1N33 L;  3B6Y A;  2WAQ E;  3TME A;  2JA7 B;  4CKB A;  1X3G A;  3MVV A;  3PUZ A;  4CHT B;  2UXC L;  1CKN A;  5E7N A;  1MSG A;  3IL8 A;  4YY3 L;  3ITP A;  1R9T B;  2E2I B;  1S5F D;  4NW2 A;  3G7L A;  1G6Z A;  1YEZ A;  3I4N H;  2NUC A;  1A63 A;  2H4O A;  4IUV A;  3FPP A;  1OO9 B;  3A56 A;  3T51 B;  3TQY A;  5IGB A;  2QA4 A;  3BZK A;  3GTM B;  3V2T A;  2Z6B A;  3K5N A;  3BDO A;  4EVO A;  4YIJ A;  4DA2 A;  2RBM A;  3E0J A;  2EYL A;  4K5W A;  1S5C D;  1I50 H;  3P20 A;  1G91 A;  2R93 H;  5JOB A;  1B70 B;  3AB9 A;  4B3M Q;  3S16 B;  2JJQ A;  3OTO Q;  3CF5 A;  5EJW A;  1GXD C;  1H9S B;  2FMC A;  2QKI C;  3J81 E;  2F3I A;  1FR3 A;  1EIG A;  1XWE A;  1OXV A;  5C3X A;  1XNR Q;  2F4V Q;  4WJW A;  1ICF B;  4RCO A;  1IL8 A;  1XMO L;  1XTD A;  1ROD A;  3RR5 A;  1IZ6 A;  1SMY D;  4UY8 C;  1DON A;  2F0O A;  3K59 A;  1LV9 A;  4JI0 Q;  2GN5 A;  1SR3 A;  1L2F A;  2DUD A;  1V1P A;  4ZLT F;  4XXE A;  4YHH Q;  4XYO A;  3IFD A;  3A5U A;  5EGT A;  2OQK A;  2F0S A;  2XWB B;  2Q2H A;  1EY7 A;  3X3N A;  1FNU A;  1O7I A;  3UDI A;  3G48 A;  5M3M B;  4I65 A;  1H95 A;  2AQ2 B;  1EFI D;  3PUV A;  2Y0S G;  1GKH A;  1JOO A;  2UU9 L;  4PNY A;  1EIF A;  3WWV A;  4FXG C;  2R92 B;  1L0X B;  2EJF C;  2JA7 G;  2EVB A;  3I91 A;  2AHO B;  1AEX A;  5IWA L;  5JEA J;  1E2Z A;  1SNQ A;  5JJZ A;  1QE6 A;  3PCO B;  1K8A C;  1AE3 A;  4ZUJ A;  2RSN A;  1DZ1 A;  2IJ0 A;  3K5O A;  5C4H A;  4ILW A;  1MIU A;  4Y7N H;  1U0L A;  4JI4 L;  1HUN A;  1B9N A;  4POF A;  4O0A A;  1AH9 A;  1B8A A;  1HFG A;  3CCR A;  5M5Y B;  5EBC A;  2MFI A;  2UUB L;  1S5E D;  2NVX B;  4EQN A;  4A3K B;  1C4Q A;  3KF8 A;  4GN3 B;  4N9P A;  4APV A;  2MO1 A;  3J7A F;  2Z4H A;  4TKO B;  4LUV A;  4DKA C;  3H15 A;  3AFQ A;  4H13 C;  2BCO A;  1JOR A;  1LT6 D;  4C3I H;  4GKJ L;  3U9O A;  3MFY A;  4A3M H;  2A68 D;  4V19 0;  2QW7 A;  4DAY A;  4FXK C;  1VCI A;  2NN6 G;  1K8O A;  2OEO A;  1RHP A;  1WFQ A;  2CH4 A;  2CFM A;  4X3T A;  4NXM Q;  3J80 c;  5FLX c;  1HUM A;  3STB D;  3PF5 A;  3NTI A;  1I4R A;  1PFM A;  1V1P B;  3HOV G;  1M4V A;  1Y8O B;  1TS3 A;  1E2V A;  1XMQ Q;  1OTC A;  1STG A;  1VQE A;  1XJV A;  4LF8 L;  3J7A 5;  2JA5 G;  1D5M C;  4AYB E;  2DNC A;  1WCM B;  3CC2 A;  4BY7 B;  3QWN A;  1GUO A;  4MTN A;  3K7A B;  1Q7Y C;  2R7Z G;  4BY1 B;  4DV3 Q;  3HKZ G;  4OIJ A;  2HCI A;  5M3M G;  2KHJ A;  4JOI A;  3LNN A;  1D1K A;  4B9W A;  1X3Q A;  4GNX C;  1STE A;  1UE5 A;  4X65 L;  4DV1 L;  3I4M H;  4A3L G;  1F77 A;  4RHS A;  2R92 G;  3A8I E;  1AN8 A;  4JI6 Q;  3N52 A;  5LHY 1;  1VQM A;  1S72 A;  1VF5 C;  4WOR A;  5C3W A;  2KEE A;  3CAM A;  1UE6 A;  2VQE L;  3KYH C;  5CC4 A;  3CPW A;  4DR7 Q;  1LTB D;  4ODG A;  2B2U C;  3ERQ A;  2F0N A;  1Q8K A;  4ZKC B;  1EYC A;  5C44 B;  4BXX H;  1XNQ L;  3GTO B;  4JYA Q;  1STN A;  1UEB A;  4GOP A;  2MP1 A;  4CJ2 C;  5D3D A;  1KLU D;  4FF2 A;  3KF6 A;  1ML0 D;  4NP5 A;  1I3Q B;  1SE8 A;  3OMG A;  1FGB D;  3CCM A;  5IYD H;  4X3U A;  3GTG H;  4DV5 Q;  2NN6 I;  3T1Y L;  4A3K G;  4X66 Q;  4K2L A;  1S3O A;  2CQA A;  4J1M A;  3S1R H;  3TN2 A;  2EZV A;  5BN4 A;  1ENC A;  4UPA A;  1KXL A;  1V9P A;  4DR4 L;  4KMU C;  1VF7 A;  2F0M A;  3CKI B;  3PV0 A;  1JR0 D;  3R3O A;  3RLN A;  3GTP B;  1EYG A;  3HOX B;  3VA5 A;  4NXN Q;  5JJK A;  3KDF A;  1JOK A;  2OT2 A;  5FLX E;  3J80 E;  1CM9 A;  3J81 L;  1PTO H;  4OEM B;  4JW0 A;  2YTY A;  1FJG Q;  3P75 A;  3ZJY C;  1CI3 M;  4DNR B;  2PW5 A;  2EPB A;  1SNO A;  4K5V A;  1GHK A;  1Y8N B;  4C3H B;  2JE6 I;  1TWG B;  1SXT A;  1QWY A;  2N8N A;  3OWF A;  2RCF A;  5C4J H;  2FHT A;  4DV2 Q;  4A3D H;  4XT3 B;  5GAE C;  4EQ5 A;  3E6Z X;  3U4V A;  1V43 A;  5FKA C;  3PO2 G;  5IP7 G;  4DPG A;  1FVI A;  2RHQ B;  3S1M H;  2GVB A;  3H6M A;  3H91 A;  5BR8 L;  5E1F A;  2ZM6 L;  2YTX A;  1FL0 A;  3T56 B;  1MHW C;  1PV4 A;  4DAM A;  3S1N H;  2UXD L;  5GAG C;  4A3F B;  1Y1W G;  2GVA A;  2OCE A;  1C0A A;  1CQV A;  1VDZ A;  4EQP A;  5KIX A;  2SNS A;  1AFP A;  5JVG 3;  3VR4 A;  5KEE A;  2AWN A;  1PH8 A;  1L0W A;  3SK8 A;  5F2D A;  3BG3 A;  2NVQ H;  1LUZ A;  3AMU A;  2UUA Q;  1NR2 A;  4RHR A;  2A74 C;  4GN4 B;  4GOP B;  3GTQ H;  2KED A;  1VQJ A;  3D6W A;  2B29 A;  4U67 3;  1CHP D;  4BBR H;  3HRZ C;  3NWT A;  1SLJ A;  5CV5 A;  4JV5 L;  2ZTC A;  1G6P A;  5AFW A;  1EFW A;  2HDL A;  1GUW A;  3BDL A;  5CV9 A;  1QVF A;  2XN9 C;  4LFB Q; 
#chains in the Genus database with same CATH homology
 1S5B D;  4XYQ A;  2AQ1 B;  1SFO B;  1Q1E A;  3Q0A A;  1DD2 A;  1HPC A;  2PCF B;  2Z4I A;  1JCK B;  2NYZ D;  3MXP A;  2B2U A;  1YNN D;  1NAP A;  1AZQ A;  5CGK A;  4ME5 A;  1JWM D;  2ID0 A;  2B63 B;  1SNM A;  4FP5 D;  2JXM B;  4BWG B;  2O2L D;  1BO0 A;  5C4Z A;  3Q22 A;  2A6E D;  2XNA C;  3NQT A;  3SVM A;  1KNE A;  1LT4 D;  1A15 A;  1OXT A;  4KKT A;  4V0B A;  2XRS D;  3FKI B;  2K01 A;  1CK1 A;  1CFM A;  2BE5 C;  3FDT A;  4UAI A;  5CV7 A;  3A7A B;  1PTO F;  1YNJ D;  1HA6 A;  2A5H A;  2F3V A;  3NHH A;  4S3S A;  5C3E B;  1SNP A;  2VUM B;  3KK7 A;  3KLS A;  2JA6 B;  4IUN A;  4I7Z C;  4LJZ C;  5J22 A;  2AUK A;  3QOL A;  1JC7 A;  5I6W A;  2K6A A;  1AZP A;  2TMP A;  4HSV A;  3VYR A;  2MHV A;  4CBV A;  4FXD A;  2A69 C;  5ELC A;  2XWJ B;  3I3C A;  3PIO 3;  3J7Y W;  5M3F B;  2F0E A;  4R8N A;  3S2D B;  4RGO S;  3J80 L;  4HSP A;  3HOW B;  3F2U A;  3GTK B;  2K5W A;  1SND A;  2YYZ A;  3OSO A;  1KNA A;  3FEW X;  1HQM C;  2C9O A;  2DNE A;  2I07 B;  2D9U A;  1S4Z A;  4R8I A;  5C0X I;  2L5T A;  3W3A A;  2O5J C;  2C5C A;  1Q1B A;  5ELF A;  1KDB A;  4ZAI A;  4XQQ A;  3M85 A;  1NSN S;  1VMC A;  3TP5 A;  3DUZ A;  2B2Y A;  4TQU S;  3NQI A;  5IGE A;  1L0Y B;  1BUV T;  3OIP A;  4IN3 A;  2F03 A;  1Q90 A;  1H9K A;  4QCL A;  1PZJ D;  1O80 A;  1MD2 D;  2ZT9 C;  4C3J B;  2EXZ A;  3I4L A;  1H9J A;  3OOC A;  1PRT D;  2RSO A;  3MZ5 A;  2RA4 A;  5M5X B;  1Y8P B;  5COY A;  3C1E A;  5DEH A;  4Q5V A;  1IYU A;  1LT3 D;  1RF2 D;  2XVS A;  1Q12 A;  1HA5 A;  2D5D A;  1PLF A;  5DNF A;  1II3 A;  2WKC A;  4IFD G;  1F2M A;  3EA6 A;  3BVM A;  2ZXP A;  4J8Q A;  4NMZ A;  1ESF A;  3OWE B;  4OGQ C;  4K6L A;  5JPN C;  1ZEQ X;  2QCP X;  3VR6 A;  5DM6 3;  5BN3 A;  5CMD A;  2K05 A;  4QIW B;  3VR5 A;  3L3O C;  1LTI D;  1DXM A;  4J6H A;  5IGC A;  2B8F A;  4H7B A;  3M4Y A;  3DWA A;  2L0C A;  3D8G A;  2K5Q A;  1BXT A;  3MEH A;  1TWA B;  2ICE C;  4FNF A;  4GZY C;  1LTT D;  4L6T B;  3U9S A;  4G7O C;  2IL8 A;  2Y0S B;  1C48 A;  4IUP A;  1XXG A;  3OW7 A;  4RCN A;  2F0H A;  4G7Z C;  1STA A;  1BCP B;  5C0X J;  4IFD I;  1B9M A;  3SXH A;  1EY8 A;  1IYV A;  1KDA A;  2NTT A;  1CTM A;  2F0L A;  1I4H A;  2L55 A;  1V8Q A;  2ENB A;  4CGY B;  3Q6S A;  1CQF A;  1TT2 A;  1ESR A;  1EY6 A;  1GOZ A;  1PZK D;  1R4P B;  2CW0 D;  3URY A;  1ICW A;  1EZ6 A;  1ZKO A;  2E76 C;  1LO5 D;  3S9W A;  1HRJ A;  2K03 A;  5E4W C;  4IUR A;  2EJG C;  2NBF A;  3HOV B;  1WTR A;  4QB4 A;  2JA5 B;  2JSO A;  1O7Z A;  1LTG D;  1B3A A;  4C3I G;  3GTJ B;  4KKU A;  2R7Z B;  3DMU A;  3HKZ B;  2PO4 A;  3QIA A;  1ZXT A;  3A7L A;  1TY2 A;  4KN7 C;  3RLF A;  1A3U A;  3OPO A;  4KY6 A;  4O1N A;  1LTR D;  1IHZ A;  2EYO A;  5I9P A;  1U4M A;  1PYW D;  5KYL A;  3TZU A;  3SEB A;  5IOC A;  4BA1 I;  1EU4 A;  1SDF A;  4JK1 C;  1Z6H A;  5TSS A;  2AUJ D;  1DCZ A;  2X6L A;  5FOB B;  4HED A;  1CT1 D;  2M2L A;  1QJO A;  2R6G A;  4RGM A;  5D14 A;  1A2U A;  1LT5 D;  1Z7T A;  3KLR A;  4TRD A;  2E2H B;  4XTC S;  3C46 A;  3GTQ B;  2I46 A;  3GQB A;  4KHV A;  1RTO A;  1VMP A;  2IW3 A;  2LY7 A;  2RQX A;  3X3M A;  1LAC A;  3GTL B;  5IT9 L;  4IFD J;  1J8I A;  1SMY C;  5EKI A;  3DHQ A;  2K5D A;  3PO2 B;  2EDG A;  1WD1 A;  3KUP A;  1SEB D;  4DXG A;  3OMC A;  4HN7 A;  3K0Y A;  4KJO A;  3EQL C;  1Y1W B;  1CZW A;  3NBI A;  1DM0 B;  1PMR A;  4WFN 3;  1QNU A;  2DY7 A;  3MWY W;  1B50 A;  1PDQ A;  4C1N I;  5C6A A;  1WTW A;  2NB0 A;  4OO1 H;  3MC0 B;  2L1B A;  1S5D D;  3PUX A;  3ONA B;  1RDP D;  2EOT A;  4XQJ A;  4K8J A;  5EPL A;  1HHV A;  1ENA A;  3SK6 A;  2O4X A;  1I6V C;  4IZ8 A;  1TII D;  4FVM A;  3GO5 A;  2CHB D;  2F3W A;  5A2Q E;  2RDH A;  3HG9 A;  1D6E C;  3HEJ A;  1I4X A;  3V96 A;  3CRK C;  2Q8I B;  4RGN A;  5CBE E;  2L12 A;  1FD7 D;  1I6H B;  3IKJ A;  3WOE A;  1EYA A;  2A68 C;  3KLS X;  1DJR D;  1TR5 A;  5IGD A;  4NKL A;  2DN8 A;  1EWH A;  2NWG A;  1NR4 A;  1XYI A;  3VA7 A;  2OXP A;  1GUT A;  3K5L A;  4IUT A;  4KN4 C;  2XRQ D;  1SNC A;  4K6D A;  4MHE A;  4KHZ A;  4DNT B;  5KYI A;  1GHJ A;  5BN5 A;  3S17 B;  1JWS D;  5ELB A;  1F9Q A;  2L11 A;  4FO2 A;  4B9X A;  1D5Z C;  3ERO A;  4Z9C B;  1STH A;  1WTV A;  2F4I A;  2EYM A;  5K5P A;  1Q3L A;  3M4O B;  3BVG A;  1U4R A;  3PUW A;  3EJI A;  4ID6 A;  1PXU A;  5C5M A;  5JAV A;  3QJY A;  1EY0 A;  3UI2 A;  5J1Z A;  3TSS A;  3L7Z C;  1BCP F;  4CJ0 B;  1TWC B;  5C4X B;  3K57 A;  5CV6 A;  1LTA D;  3D4D A;  3HZX A;  1F2Y A;  1KDC A;  3NP8 A;  1EIH A;  1O7Y A;  2RDF A;  2D2C C;  1EU3 A;  1SJH D;  4A3G B;  2H1E A;  1EY5 A;  3PMF A;  1G2S A;  1B4O A;  4QUF A;  3S15 B;  2F0K A;  3KBX A;  2B2Y C;  2KOL A;  1HTL D;  2MJ8 A;  4A93 B;  2E2J B;  1PTO D;  2Q8R E;  3R2I A;  5FO8 B;  2QIL A;  1ENF A;  5T1I A;  4QMG A;  1AP0 A;  3N6R A;  4N9T A;  2LFN A;  4F87 A;  2DY8 A;  1BCP C;  5M5W B;  2E75 C;  5KND A;  2EY2 A;  2XSC A;  4IUQ A;  2BDN A;  1A3T A;  4H0L C;  1SYB A;  1X32 A;  1JE4 A;  2MGS A;  4HR7 B;  1UEA B;  3L9A X;  3SR1 A;  1U9R A;  2FIN B;  4M1U B;  2EY1 A;  3NXW A;  2YU9 B;  1XTC D;  4XDX A;  2J0T D;  2IX0 A;  3C2P A;  1WTQ A;  2F0T A;  3SDZ A;  4HCS A;  3I70 A;  2ZXO A;  2HDM A;  2IWH A;  5K36 H;  4LAA A;  2Z8L A;  1SBB B;  4FF1 A;  5COR A;  3M7N A;  2A6H D;  4A3E B;  1T5X D;  2QDB A;  2KCN A;  5HUR A;  3I8Z A;  5FLX L;  3JAM E;  1D5X C;  3TP7 A;  1YNN C;  4KD4 A;  2PPB C;  5EKK A;  2EYJ A;  4PQX A;  2KA7 A;  5D65 A;  1MI2 A;  3MXU A;  2A6E C;  1G2T A;  3BS1 A;  5NUC A;  3I4N B;  2WIN B;  1PFN A;  3IFT A;  1SYG A;  3M3Y B;  4OIK A;  5EPJ A;  5C0X H;  1YNJ C;  4RFB A;  2FJ2 A;  2OF1 A;  1I50 B;  2R93 B;  2N55 A;  1G8Z D;  5KNC A;  1ZYR C;  5EBD A;  2R61 A;  4XQN A;  4CJ1 B;  4G4K A;  2AWO A;  2WB1 B;  2K1B A;  2KHS A;  4EGV A;  2JYO A;  4X3S A;  3QO2 A;  3G6J B;  5CR3 A;  5FK9 C;  1KLG D;  5E4X A;  3C3L A;  1Z47 A;  3LWE A;  1WTO A;  1BOS A;  4KI0 A;  1EQT A;  4DXF A;  4ZKB B;  5G3L F;  5HGT A;  3CHB D;  5IGG A;  1O78 A;  3QOJ A;  2B2V C;  1IKM A;  4LK1 C;  3P1H A;  2VNU D;  4MIU A;  2G9H D;  3PUY A;  4G57 A;  4IAL A;  3GD7 A;  3DM1 A;  1KAB A;  3DWQ A;  3NK9 A;  4Y7N B;  1HCZ A;  4PV1 C;  5EKL A;  4OHJ A;  4FF3 A;  3SHL A;  5DAU A;  5M9O A;  2E2D C;  5JEA H;  2JA8 B;  4WRD A;  1STB A;  3DXJ C;  1Q8I A;  1MBY A;  1WVL A;  5I2Y A;  2SNM A;  2EYH A;  4C3I B;  1QOH A;  3CRL C;  4A3M B;  3D4R A;  1TU2 B;  3C1F A;  3EFX D;  1JIC A;  4DK1 A;  2FMM A;  1CA5 A;  5CYU A;  2F0F A;  3MA2 B;  2QEJ C;  1BNZ A;  2KQ3 A;  4ULL A;  4XIG S;  4DAP A;  1UNS A;  4HMJ A;  1B2T A;  2HUG A;  3I72 A;  1STY A;  3D3R A;  5CV4 A;  2MPM A;  1SE3 A;  1E0B A;  4BA2 I;  3ZYY X;  3NBH A;  1TVX A;  3I4M B;  2B2W A;  4KTA A;  2RDG A;  2F0I A;  2B2T A;  3JAM L;  2VXW A;  4H44 C;  2ICI A;  3NTK A;  5FO9 B;  1BBX C;  2AQ3 B;  3T13 A;  1IW7 C;  2E74 C;  1EEI D;  4DF7 A;  1TS4 A;  2JEB I;  1K8M A;  3GTG B;  3DWP A;  1F2Z A;  4K14 A;  2NZ1 D;  4RWS C;  2B2V A;  1SYE A;  1SYD A;  3MXN A;  3S1R B;  4RKL A;  2JP1 A;  4TSS A;  2EY6 A;  1XX8 A;  1T5E A;  1A3V A;  1MSH A;  1PTO B;  3TBI B;  2KEC A;  5C4J B;  4A3D B;  2D62 A;  1TY0 A;  2K33 A;  2KUM A;  4KK7 A;  4E6I A;  3S1M B;  2B39 A;  3BYY B;  3GV3 A;  4C1N K;  4FF4 A;  2IX1 A;  4KD3 A;  3VYU A;  5KRU A;  3S1N B;  1NCV A;  3S2H B;  1UAP A;  3E5S A;  2PZW A;  1I4Q A;  1LLR D;  1KAA A;  1F9R A;  3NPP A;  1HQR D;  1EQV A;  1QNK A;  3RMH A;  2NVQ B;  4OO1 G;  1EWC A;  2F0U A;  2WKD A;  1M8A A;  5CV8 A;  1HXY D;  2EY5 A;  4DK0 A;  3NTH A;  4M8A A;  1EZ8 A;  3DEP A;  4R9W A;  3CU7 A;  2J4X A;  2SEB D;  1BF4 A;  4BBR B;  2CW0 C;  1CZG A;  2IX3 A;  1BR9 A;  1EL0 A;  3H3V C;  3ND8 A;  5I9O A;  4KY7 A;  3PO3 B;  1RD9 D;  1ONL A;  1PFB A;  1ET9 A;  3A8J E;  1V1O A;  5IOD A;  3RZD B;  1SAP A;  4ZYS A;  3FRP B;  1J9O A;  1WTX A;  3H0G B;  4QF4 A;  4K2K A;  4C56 C;  2N88 A;  1D2B A;  3I73 A;  1DOL A;  1LAB A;  5JPM C;  1PZI D;  2PNR C;  2PZU A;  1JWU D;  3W2D A;  2O5I C;  4OO1 I;  2K7V A;  1F9S A;  3BYT B;  3CQZ B;  1RTN A;  4K5X A;  1OXS C;  4PMB A;  1RCV D;  2F0W A;  5EQ0 A;  1CHQ D;  2WAQ B;  3TZD A;  1H9R A;  1AW7 A;  2KJX A;  4KJN A;  3MAQ A;  4KY5 A;  2X6G A;  2F0J A;  4CKC A;  1PRT B;  2NN6 H;  3OIQ A;  4RGT A;  3BZD B;  1TWH B;  3O13 A;  4PMW A;  2QF7 A;  4KKS A;  1G29 1;  3K6O A;  5E3F A;  4EQO A;  3FPU B;  2WII B;  3NWS A;  2IT1 A;  2PZT A;  1GUS A;  1I4P A;  1QB5 D;  4HAE A;  1ILQ A;  4K8I A;  2NVY B;  4MN3 A;  4U68 A;  3VR2 A;  1F9P A;  2KVM A;  5DM7 3;  4ZQ3 A;  1SJE D;  2F0Q A;  4O42 A;  3S14 B;  3QG1 A;  3BDC A;  4IUU A;  3RZO B;  4ZUI A;  5CBA E;  3TP6 A;  4L63 B;  1SYF A;  4RAU C;  4A3B B;  3HP3 A;  4L8J A;  3R8B A;  4C2M B;  1DYQ A;  3GV6 A;  4KV6 A;  4F7X A;  2JEA I;  3D6C A;  3ND9 A;  2BE5 D;  1A2T A;  4BBS B;  1BCP D;  1SYC A;  4G7H C;  3A8K E;  2EYF A;  2PQE A;  1GUG A;  1SSO A;  1ILP A;  1U4P A;  4XT1 B;  2KCC A;  3HGB A;  2K04 A;  2F0P A;  1IKL A;  5I4D A;  4HCE A;  4IQZ A;  2BA1 A;  3WDN A;  1HFN A;  1Y1V B;  3FMC A;  5KGU A;  3H09 A;  2LS0 1;  3RD4 A;  3K5M A;  1QG7 A;  2F0D A;  3TDQ A;  1JQY D;  3P7J A;  3M7G A;  1EY9 A;  4RA8 A;  4X3K A;  2BDO A;  1JB3 A;  1C8C A;  2MUY A;  4HMI A;  1BQQ T;  3SK4 A;  2A69 D;  2K28 A;  3J7A V;  4NDX A;  1RKN A;  1F2L A;  4UDU C;  1TKW B;  2VB3 X;  3LWU A;  2LKV A;  2L9H A;  1D1I A;  2L4N A;  3VYS A;  5K36 G;  5ELD A;  2HCC A;  4C3H G;  1B53 A;  2F0V A;  1BDO A;  4DFA A;  1LTS D;  3NE5 B;  1HTP A;  2V4D A;  2K32 A;  4HTH A;  4AYB B;  3HOY B;  1QCB D;  3MTS A;  2NVT B;  3FVQ A;  3I90 A;  2R3Z A;  3IAY A;  4A3I B;  1GUN A;  2XIW A;  1DOM A;  1W6J A;  4B08 A;  1NUC A;  2M9V A;  3AU7 A;  4ABN A;  1ZYR D;  4PMC A;  2SOB A;  5LL6 S;  5C0X G;  3MFG A;  2VB2 X;  4F8M A;  3R2T A;  4JBW A;  1CA6 A;  1FNW A;  1W6K A;  1OXX K;  2EYP A;  3LX0 A;  2LMC B;  4LMQ D;  5A2Q L;  1JOQ A;  1R4Q B;  2F0G A;  3MHB A;  5LL6 X;  5J39 A;  3S1Q B;  3T16 A;  3T4A C;  1B44 D;  5IGF A;  3OHX C;  3NUC A;  4CKE A;  1UUP A;  1PTO C;  1OXU A;  3NSW A;  2HQE A;  2EE1 A;  3HOU B;  2Z1C A;  2J7Z A;  1O7L A;  3A55 A;  3MXG A;  4ZK9 B;  1GJX A;  4DN4 M;  2X69 A;  1EYD A;  4RH6 A;  2IPK D;  2NTS A;  2F1M A;  2TSS A;  2ZXR A;  3D31 A;  1RJT A;  5ELE A;  1EEF D;  2BOS A;  3SE0 A;  2RVL A;  4FYD A;  1U4L A;  3H94 A;  4P2C B;  1WD0 A;  1SE2 A;  2B2W C;  5D3I B;  1FNV A;  1X3P A;  2PYK A;  2B2T C;  3T53 B;  3QB3 A;  5C5L A;  5G3L D;  5JEA G;  1DOK A;  1EOT A;  2G9D A;  4Q0F A;  5IIF A;  3R93 A;  5A35 A;  5EPK A;  2M00 A;  2BA0 A;  3HS0 C;  1KTK A;  3TP8 A;  5I6Y A;  1ET6 A;  1Y69 U;  2WAC A;  2A6H C;  4RKB A;  1I4G A;  1TS5 A;  3SK5 A;  1A6X A;  3GP7 A;  5FO7 B;  1H9M A;  4A3J B;  5KNB A;  1PRT F;  1FYC A;  3VR3 A;  4DAV A;  1QIL A;  1E2W A;  2WV6 D;  3RUZ A;  4BS9 A;  1TS2 A;  3DEO A;  1SE4 A;  2CVR A;  1K83 B;  5JVH 3;  3K58 A;  2A73 B;  3V05 A;  2SDF A;  1B1Z A;  2GA4 B;  2RKS A;  1TWF B;  1H9S A;  3HOZ B;  1IW7 D;  1EY4 A;  5T1G A;  5IT9 E;  2B8G A;  4OL7 A;  5ISR A;  2EJM A;  2PMZ B;  3Q24 A;  5I2X A;  3Q23 A;  3KBG A;  4F88 A;  3VYT A;  4QUC A;  2PW7 A;  3EVQ A;  2WP8 J;  3BVZ A;  1PRT C;  4ZRZ A;  3A54 A;  2Q8T A;  4DU9 A;  4DGZ A;  3WOF A;  2FFK B;  3PIP 3;  4C3J G;  1TQO A;  3D4W A;  1MGS A;  1WTP A;  4IFD H;  3TME A;  2JA7 B;  4CKB A;  4CHT B;  3MVV A;  3PUZ A;  1MSG A;  3IL8 A;  3ITP A;  1R9T B;  2E2I B;  1S5F D;  4NW2 A;  3G7L A;  1G6Z A;  2NUC A;  2H4O A;  4IUV A;  3FPP A;  1OO9 B;  3A56 A;  3T51 B;  5IGB A;  3GTM B;  3V2T A;  3K5N A;  3BDO A;  4EVO A;  4YIJ A;  4DA2 A;  2RBM A;  3E0J A;  2EYL A;  4K5W A;  1S5C D;  3P20 A;  1G91 A;  5JOB A;  3AB9 A;  3S16 B;  5EJW A;  1GXD C;  1H9S B;  2FMC A;  2QKI C;  3J81 E;  1FR3 A;  1EIG A;  1XWE A;  1OXV A;  5C3X A;  4WJW A;  4RCO A;  1IL8 A;  1ROD A;  1SMY D;  1DON A;  2F0O A;  3K59 A;  1LV9 A;  4ZLT F;  1V1P A;  4XXE A;  4XYO A;  3IFD A;  5EGT A;  2F0S A;  2XWB B;  1EY7 A;  3X3N A;  1FNU A;  5M3M B;  4I65 A;  2AQ2 B;  1EFI D;  3PUV A;  1JOO A;  4PNY A;  4FXG C;  2R92 B;  1L0X B;  2EJF C;  2EVB A;  3I91 A;  1AEX A;  5JEA J;  1E2Z A;  1SNQ A;  5JJZ A;  1QE6 A;  4ZUJ A;  2RSN A;  1DZ1 A;  2IJ0 A;  3K5O A;  5C4H A;  4ILW A;  1HUN A;  1B9N A;  1HFG A;  5M5Y B;  5EBC A;  1S5E D;  2NVX B;  4EQN A;  4A3K B;  1C4Q A;  3KF8 A;  4N9P A;  3J7A F;  2Z4H A;  4TKO B;  4H13 C;  2BCO A;  1JOR A;  1LT6 D;  3U9O A;  3MFY A;  2A68 D;  4V19 0;  4DAY A;  4FXK C;  1VCI A;  2NN6 G;  1K8O A;  2OEO A;  1RHP A;  4X3T A;  1HUM A;  3NTI A;  1I4R A;  1PFM A;  1V1P B;  1M4V A;  1Y8O B;  1TS3 A;  1E2V A;  1STG A;  1D5M C;  2DNC A;  1WCM B;  4BY7 B;  3QWN A;  1GUO A;  3K7A B;  4BY1 B;  4OIJ A;  2HCI A;  3LNN A;  1D1K A;  4B9W A;  1X3Q A;  1STE A;  1F77 A;  4RHS A;  3A8I E;  1AN8 A;  3N52 A;  5LHY 1;  1VF5 C;  4WOR A;  5C3W A;  2KEE A;  5CC4 A;  1LTB D;  4ODG A;  2B2U C;  3ERQ A;  2F0N A;  4ZKC B;  1EYC A;  5C44 B;  3GTO B;  1STN A;  2MP1 A;  4CJ2 C;  5D3D A;  1KLU D;  4FF2 A;  1ML0 D;  4NP5 A;  1I3Q B;  3OMG A;  1FGB D;  4X3U A;  2NN6 I;  4K2L A;  2CQA A;  4J1M A;  3TN2 A;  2EZV A;  5BN4 A;  1ENC A;  4KMU C;  1VF7 A;  2F0M A;  3CKI B;  3PV0 A;  1JR0 D;  3R3O A;  3GTP B;  3HOX B;  3VA5 A;  3J80 E;  1JOK A;  2OT2 A;  5FLX E;  1CM9 A;  3J81 L;  1PTO H;  3P75 A;  1CI3 M;  4DNR B;  2PW5 A;  2EPB A;  1SNO A;  4K5V A;  1GHK A;  1Y8N B;  4C3H B;  2JE6 I;  1TWG B;  1SXT A;  1QWY A;  3OWF A;  2FHT A;  4XT3 B;  3E6Z X;  1V43 A;  5FKA C;  3H6M A;  3H91 A;  5E1F A;  3T56 B;  4A3F B;  1CQV A;  1VDZ A;  4EQP A;  5KIX A;  2SNS A;  1AFP A;  5JVG 3;  3VR4 A;  5KEE A;  2AWN A;  3SK8 A;  5F2D A;  3BG3 A;  3AMU A;  1NR2 A;  4RHR A;  2A74 C;  2KED A;  3D6W A;  4U67 3;  1CHP D;  3HRZ C;  3NWT A;  5CV5 A;  5AFW A;  2HDL A;  1GUW A;  3BDL A;  5CV9 A;  2XN9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...