4JI7L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7L00
2ZTDA 3S15H 4QQBX 2ZTEA 4IPGA 3BU2A 4BBSG 1TXYA 5GQOA 2PI2E 3PO3G 4DV3L 4APVA 4GN3B 4JI5Q 3CAMA 1IBLQ 1WOCA 2I5HA 3K7AH 3CC2A 2BH2A 3CCQA 3PUYA 5LMUQ 2JEAI 4BXXH 2XTIA 4R4CA 5ELOA 3HOUG 1VCIA 4A93G 1IBKL 1PH7A 1EUJA 4L5RC 4A3DG 1IZ6A 3MEFA 2BA1A 5C4XG 1HH2P 4JI8L 1CKMA 2B63H 5M5WH 1K8GA 3M85A 4OX9Q 4LFAL 4A3LG 1E24A 3AYHB 4L5TA 1X54A 4JI7Q 4DR4Q 4KLKA 2E5LQ 4HJ5A 3H3VH 3GTLH 1A8VA 3OTOQ 1AE2A 5JJIA 3E0EA 5K36G 2Q2IA 2QGQA 3GTMH 4JI8Q 2PI2A 1VQBA 5ELNA 4JCVE 3L2PA 4MTNA 3CMEA 4DV6L 3RN5A 4A93H 3J81i 3RZOH 4C3IH 3GTOH 4JYAL 1EQRA 4LF4Q 2B63G 1EWIA 4A3EH 2NVXH 1UEBA 2JJQA 2YTVA 1SE8A 1Y1VG 3M7NA 1N32Q 2K5HA 3I4OA 2Z0SA 2GN5A 1HZ9A 4DK3C 1C0AA 1CSPA 5HY6A 5IP7G 2UU9Q 4IPHA 4DNIA 1YVCA 4GKKQ 1IYJB 2HIXA 2CCZA 4OO1I 1GVPA 5J3BA 3W1GA 2XGTA 4LWCA 4A3FH 4X65Q 1VQ5A 2Q2TA 4WJ4A 3GDEA 4EQ5A 4GNXC 1OXVA 3J80c 2NZHA 3KOJA 1PV4A 2RF4A 4B3ML 2VL6A 4A4IA 2A8VA 3STBD 3PF4A 1E7ZA 3LGJA 2N8NA 1N9WA 1V9PA 5EAYA 1XPUA 4DV0L 2MO0A 1TWHH 2KBNA 1TWFH 3G48A 4GOPB 3E9IA 1XNRQ 1YHAA 1SR3A 1UE5A 1YNXA 4KHPL 3Q8DA 4O2DA 4YCVA 1LYLA 3K80C 4R4QA 5LMUL 5DLQE 3S1RH 3TRZA 4JI4Q 5C4JH 2VQEL 2YTYA 2F52A 1XPOA 2N3SA 1XNRL 3KYHC 4NXMQ 4X64Q 3H15A 5IYCH 4DV7Q 2B3GA 4BY1H 2F4VQ 1PYBA 3RNUA 1MIUA 1FJGQ 3RZDH 2R92H 1TWGH 1UE6A 5JEAJ 3UDIA 4OX9L 4IFDI 3RLOA 4NPSA 2VQEQ 4YHHQ 3J81j 2K14A 4PG3A 1VQNA 4R1JA 2AKWB 4B3SL 4DR3L 2HHHL 2NN6I 4A3JG 3D31A 1B8AA 3JC66 4DUYQ 1Q12A 3RLFA 4DV1L 3PO3H 4RG1A 3A0JA 2JA8H 4YY3L 4DV0Q 2R92G 1U0LA 1P16A 2QEXA 4BXXG 5IYDH 3NEMA 1DGSA 4DR3Q 2UU9L 2AWOA 1KXLA 1I50H 1L1OB 2ZM6L 3CW2C 3GTPH 4GOPA 1KC8C 2UXBQ 3RLNA 1EIYB 2R93G 4A3LH 4P71A 3AEVA 1XMOL 1JJ2A 4DR7Q 3K0XA 4QY7A 3PIOA 1L1OA 4JBMA 3T1HQ 2JA8G 3CPFA 3SGIA 3I4NH 5C44G 2Z6KC 3PUVA 1BKBA 1K73C 2CWPA 1PFSA 2UUCL 2UXCL 1V43A 4GLVB 2A1AA 5E7NA 5BR8Q 1N32L 3KJPA 2VUMG 4UP9A 4DR7L 5AJ3Q 4A3EG 1K8AC 2LSSA 2R7FA 2R93H 1EIFA 3EBEA 4UP8A 3G4SA 4JBWA 4MNOA 3CF5A 1OTCA 2UXDL 5IP7H 3NENA 3I4NG 1HZAA 4YWMA 1PH5A 1VQ6A 1HJPA 4DV3Q 3ULLA 5H1SE 4DR1Q 2MNAA 1IBLL 2A19A 4NXML 1M1KC 2VUMH 4A3FG 3TEHB 3FHWA 4MZ9A 2F3IA 1I3QH 1HZCA 4XIGS 5M5YH 4HIMA 2JA5H 4B3SQ 5M3FH 2GVBA 1B7YB 4NXNL 1K0RA 3AFPA 4JOIC 3L7ZC 4DR1L 1PH2A 1PH4A 2K4KA 1K83H 3CCRA 3S17H 1PVOA 1CKNA 4AQYQ 3KLWA 1N8RC 5GROA 1X55A 2D0OA 1HNWQ 1XNQL 2YU9H 3CCEA 4DV1Q 4H02A 1OXTA 3I55A 4A3IH 2VQFQ 3PUXA 4HIOA 3UE1A 2JEBI 2K75A 4YY3Q 4OO1G 4DUZL 1Q86C 5FLXc 4A3CH 1X3GA 2WAQE 3CMAA 1QVCA 2B29A 3J7A5 2JA5G 1NMFA 3G6EA 4X66L 1H95A 1BBUA 4UP7A 1PH1A 1X3FA 2VQFL 3HKSA 2OTJA 1SLJA 2RHSB 5C3EH 1HNZL 2ZJRA 1IBMQ 3WWVA 1QVFA 4A3IG 3EIVA 2IX0A 4IJLA 1AH9A 4LF5Q 1Y14B 4A3CG 1D7QA 4B3RQ 2R7ZG 3L0OA 2PQAA 5LMNW 4A3JH 3NBHB 4JBKA 3KFUA 3ERSX 2RCNA 1KHIA 1E22A 1X65A 1Z9FA 1CKNB 4GN4B 3U4ZA 4DV4Q 1X9NA 4DPGA 2YV5A 5C3EG 2CWAA 4DR5Q 4C3HH 3CCUA 2WAQG 3AQQA 5C0XG 4JI2Q 5IYDG 5C0XI 3CCMA 2N49A 1KRSA 4JI0L 4LFAQ 4DV4L 1HR0L 1G51A 1KQSA 1IXRA 1CUKA 3T1YQ 2R7ZH 4IOAA 3H0GH 5FJ8G 1EFWA 2HQLA 5C0XJ 1I6HH 1VQFA 3PF5A 2HIVA 4LW1A 2WFWA 2UXCQ 4TQUS 1Q46A 2I5MX 5C44H 2IHFA 4JI3Q 1BVSA 4GKJL 1EYGA 3H3VI 4JC0A 3HOWG 2HT1A 4GOPC 1FJGL 1B70B 3GO5A 2MO1A 3CCSA 4DV5Q 4LFCL 2OWOA 1L1OC 2K50A 2WB1G 4JYAQ 4LF8Q 2NN6G 3B6YA 3H0GG 5FJ8H 5M3MG 3CCVA 1N36L 1KAWA 3S16H 1YITA 3S24A 1MKHA 1VQMA 2EXDA 1UE1A 1VQCA 4LUVA 1TWAH 4LFCQ 1QUQB 4QIWE 4AYBE 5JJLA 2E5LL 4A3GH 2EIFA 3PCOB 3S2DH 1UE7A 1HZBA 3OTOL 1ASZA 1OXSC 3ULPA 4BA2I 2E2IH 2DUDA 4KHZA 3TS2A 1FL0A 3DM3A 1WCMH 4OWXB 1XMQQ 1SRUA 4B3RL 1VQHA 5M3FG 1Q1BA 1PH9A 4XTCS 4YCWA 3K81C 5FLMH 4YHHL 1XNQQ 2MQHA 2K5VA 1IBKQ 4JI1L 1S3OA 3UDXA 2WB1E 4BBRG 4X62Q 1WFQA 1OXUA 4GS3A 4A3GG 4LUZA 4GKKL 1NTGA 3I7FA 4BY7G 1Z47A 1YI2A 1HNXL 4JOIA 4K0KL 3A5UA 4QJFA 1WCMG 4AYBG 1N36Q 1QZGA 1D8LA 2FXQA 4X65L 2UUAL 1IL2A 1OXXK 4YCUA 4PZ6A 4DV6Q 1PHJA 1JMCA 1GD7A 1VQIA 1RIPA 3CD6A 2ID0A 2WP8J 1VQOA 4P75A 1W3SA 2VS1A 4UPAA 4A3BH 4DR2L 3G71A 1QZHA 4PZ7A 5IE8A 1ASYA 2UUAQ 4HJ7A 1X6OA 2VW9A 3F1ZA 1EOVA 3GTJH 4DV5L 4DR4L 4JI7L 2MFIA 3PV0A 1N33Q 4JV5L 2N78A 3ER0A 4LF8L 2KHJA 3GTQH 5BR8L 4HJ9A 4LF9Q 2PQAB 4IO9A 1SMXA 1VQAA 3U4VA 4X62L 4J15A 4HJAA 1SFOH 1L2FA 2VY3A 2JK8A 4BA1I 2R6GA 4LF7Q 4IPCA 2YYZA 3PSIA 3PUZA 2UXDQ 5GAGC 3BZCA 1KL9A 2KCTA 3M3YH 3W1BA 2ZM6Q 1PA6A 1C7YA 1BBWA 1VQKA 2UXBL 2UUBQ 3OW2A 4LFBQ 1SN8A 4QL5A 5GAHC 1YJNA 4DAMA 2E2JH 4LF4L 2LXKA 3J81c 1VS0A 4AH6A 3RN2A 1LM0A 3BZKA 3KF6A 2CFMA 1L0WA 1IBML 4JI2L 2JA6G 3HOWH 4JI4L 2H5XA 4ME3A 2JQOA 4X64L 1X3EA 4JG2A 4JV5Q 1KD1C 1Q8KA 5M3MH 2OQKA 3UDFA 1YHBA 3CC7A 4HIKA 2Z6KA 4A76A 4POGA 1PH8A 1FGUA 4IFDJ 1K9MC 4LUOA 1PH6A 3MXNB 1NY4A 1YEZA 1VQJA 3STBC 1GO3E 4POFA 2ES2A 4GKJQ 2I0QA 4JI3L 4JI6L 3GTKH 2AHOB 2ALYB 2KCMA 2JA6H 1A62A 4X66Q 1VQ7A 1G6PA 3J80i 1YIJA 4WJ3M 4JBJA 1V1QA 1S40A 1Q82C 1HR0W 1XPRA 3S1MH 4YWLA 2UUBL 1HR0Q 1JT8A 3PUWA 3M9BA 1YJ9A 3FKIG 4PZ8A 1PH3A 1YBYA 1KIXA 5FLMG 2V1CC 4JI5L 2JE6I 3K7UC 3M4PA 2D62A 2KHIA 3U50C 1AE3A 4A75A 4BBRH 4DAYB 1KRTA 1N34L 1HNXQ 1JJCB 1WJJA 3F2BA 1W2BA 4K0KQ 2ZTCA 3CQZH 4P73A 2ZJPA 2C35B 4LF7L 4BY7H 2PNHA 3HFZB 4DUYL 4DR5L 5JJKA 1I94Q 1Y1WH 1S72A 3S1NH 3TS0A 3KJOA 1YZ6A 4OWTB 2E8GA 4P72A 4R4IA 3K8AA 2BH8A 3KDFB 3KF6B 1QUQA 4IJHA 1HNZQ 2K52A 1NMGA 4KI0A 5JEAG 1VQ8A 2BA0A 4RMFA 1X56A 4A3BG 2KENA 2D0PA 3HOVG 4C3JH 3CP0A 4B3MQ 5LMNQ 1A0IA 2EQSA 1MJCA 3HOXH 2VNUD 5IP9H 1K3RA 1J5EQ 1GM5A 3UE0A 3IRBA 3KF8B 3J7ZC 4AIMA 1YJWA 1GKHA 1XJVA 3ICEA 3FP9A 1A63A 4YWKA 3JAMi 3S14H 3PO2G 4IFDG 3DLLA 4Y52H 2CQOA 3D0FA 4A3MG 5IWAQ 1PYSB 4DKAC 3I4MG 4DK6C 4EX5A 4Y7NH 2AWNA 1O7IA 2I5LX 2NZOA 4B3TL 2JA7G 3PGZA 1J6QA 4GLAC 3JAMc 5IYBG 1G291 3HOXG 1SROA 2E2HH 4DV2Q 2PMZE 2ZJQA 4OXPA 2K5NA 1JE5A 2OTLA 3F2CA 2GVAA 1EQQA 4DUZQ 1VQ9A 5IWAL 4BBSH 4OWWB 3HKZG 3ULJA 1P8LA 2L15A 1N34Q 4B3TQ 4GN5A 4P74A 3PO2H 5M5XH 4JI1Q 3AFQA 2OQ0A 4LNQA 2JA7H 1E1OA 5AJ3L 3S2HH 4UY8C 1VQ4A 4NXNQ 1J5EL 3EN2A 3HOUH 1JB7A 5GAEC 4LFBL 1VQGA 3UDGA 5C4XH 4LF5L 2NVQH 1YHQA 2R7DA 3W5OA 2IT1A 1C9OA 1E1TA 1NE3A 3CXCA 3CCJA 3TQYA 4ALPA 1XTDA 1R9TH 1LUZA 3HOYH 3OYYA 3T1HL 3NELA 4FDBA 4A3KG 2ATWA 4KHPQ 2YTXA 1LTLA 3I56A 3TREA 3HOZH 3HKZE 3M4OH 3FKIH 3KDFA 4LF6L 4HJ8A 2RHQB 1Y1VH 4IPDA 2QA4A 2IHEA 3GD7A 2Q2HA 4R4OA 4JI0Q 1Q7YC 5HGQA 4AQYL 1HNWL 4OONA 4QGUA 1T9HA 4TVAB 4GNXA 1I5FA 1UWVA 2AMCB 3A5ZB 3HOYG 3CC4A 2IX1A 4PMWA 4A3KH 4LF6Q 1Y1WG 2Y0SE 2DGYA 1JJGA 3HOZG 1XMOQ 2CKZB 3RR5A 4HIDA 4IOCA 2HHHQ 1VQLA 4O0AA 4DV2L 3S1QH 1XMQL 4NB3A 2IY5B 4DR2Q 4L5SA 2VZAA 5LMNL 3U58A 1CKOA 3I2ZA 1RL2A 5IY0A 3GTGH 4JI6Q 3HOVH 2NVYH 1CSQA 3VDYA 1M90C 2ASBA 3F8TA 2F4VL 4X6AH 2NVTH 4C2MH 2Y0SG 4R4TA 1TWCH 1VQPA 3CPWA 1VQEA 4L5QA 3BJUA 5IP9G 1N33L 4DR6Q 3A74A 1NJIC 4LF9L 3E9HA 5GADC 3M4QA 4GNXB 1Q81C 2JA9A 1NBWA 1QVGA 4GLXA 3CCLA 1E3PA 5IYCG 4BY1G 1Q1EA 2UUCQ 4DR6L 1U5KA 1WI5A 4A3MH 1WYDA 3F2DA 3I4MH 3ZJYC 4DV7L 1VQDA 3T1YL 1MJEA 5IT9c 5IYBH 2LXJA 2Q2UA 3PIPA 1I94L 4A3DH 2OCEA 1FVIA
chains in the Genus database with same CATH superfamily
1SYCA 1XTCD 3S1RB 4IPGA 5M5YB 2OF1A 4BBSG 1VMCA 2EOTA 3PO3G 1U4RA 3K7AH 3CCQA 5LMUQ 4F7XA 2M2LA 1IZ6A 3MEFA 4KKTA 3OWEB 4JI8L 1CKMA 2EZVA 3SR1A 1LACA 4KY6A 1E24A 1X54A 1DJRD 4KLKA 1JB3A 1ENAA 4ZRZA 3MAQA 3E0EA 1JE4A 3MHBA 1DZ1A 2NVTH 2PI2A 1VQBA 5ELNA 5I6WA 1WCMB 3J81i 3RZOH 4HMJA 3GTOH 3D6WA 1CQVA 1EWIA 1UEBA 1SE8A 2YU9B 1N32Q 2GN5A 5KEEA 3R3OA 4C3IB 3S2HB 1C0AA 3T51B 5IP7G 4A93B 1YVCA 2CCZA 1JWMD 3GTKB 2ICEC 3I72A 1VQ5A 4WJ4A 2KA7A 3WOFA 4EQ5A 2M9VA 3J80c 2NZHA 4CJ0B 3HP3A 3A8JE 2K5WA 2VL6A 2XWBB 3LGJA 3TP7A 1N9WA 3OIQA 3TP8A 1TWFH 3QIAA 5FK9C 1AP0A 3LX0A 3Q8DA 4YCVA 1F2YA 2VB2X 5LMUL 2YTYA 3KYHC 4HMIA 1GUWA 2B3GA 4BY1H 1LABA 2KUMA 5KNBA 1FJGQ 4IFDI 5JPNC 3D3RA 2L1BA 3NBIA 4OX9L 4N9PA 2VQEQ 2JA7B 1EWHA 2F4IA 5CR3A 4QMGA 4DR3L 5JAVA 3JC66 3EJIA 2JA8H 2F3WA 3VA5A 1BBXC 4DV0Q 4BBSB 1QNUA 4BXXG 3NEMA 2SNMA 1LTGD 5C4HA 2E2HB 2B2YA 1EY6A 3VYSA 3CW2C 2F0SA 1T5EA 2DJGC 2R93G 1EFID 5E1FA 1JJ2A 1L1OA 3T1HQ 1BR9A 1JR0D 3SGIA 5HURA 3GTMB 1SXTA 3RMHA 2UUCL 2A1AA 3KJPA 2AUKA 2IJ0A 4MN3A 1PFNA 2UXDL 1HZAA 2PYKA 4YWMA 1HA6A 1Z7TA 1SYBA 1FNUA 4NXML 1CQFA 2F0EA 3TP6A 1HZCA 2K32A 5ISRA 4B3SQ 5LL6X 3PIO3 1F9RA 1G91A 1EY4A 3I4NB 1LO5D 2WINB 3CCRA 1PVOA 1CKNA 4AQYQ 3I4MB 4PMCA 3CCEA 1EY5A 4DV1Q 5EKLA 1GUTA 2VQFQ 3UE1A 2WACA 4K6LA 3PO2B 2O5IC 5FLXc 4A3CH 1MGSA 1SSOA 1VF7A 2K01A 2F0HA 4IALA 1QB5D 4X66L 1BBUA 1I4PA 1HNZL 1C48A 4A3IG 2IX0A 2KOLA 1Y14B 4C3HB 1KDBA 4RAUC 2R7ZG 2PQAA 1KABA 4JBKA 1RODA 1KHIA 1X65A 3BDLA 3S14B 3BS1A 2YV5A 5C3EG 3CCUA 3I90A 3AQQA 5C0XI 1BCPD 2C5CA 3HOXB 4KTAA 1IXRA 1AEXA 5I4DA 4ODGA 5FJ8G 2HQLA 1FD7D 1LTRD 4LW1A 1ICFB 2WFWA 4N8FA 4M1UB 2IHFA 3K6OA 3H3VI 1D5XC 2BDNA 4GOPC 2F0TA 3GO5A 2OWOA 4DV5Q 4LFCL 4L63B 2NN6G 1R4PB 2IWHA 2RVLA 1N36L 1KAWA 1PZKD 3S24A 1VQMA 2SNSA 4L8JA 1ZEQX 5CBEE 4QIWE 4P2CB 4FO2A 2E5LL 4A3GH 2K05A 4KY7A 4HCSA 4CHTB 2MGSA 3A56A 4KHZA 4K8JA 3TS2A 1MD2D 4OWXB 3V2TA 1WD1A 1Q1BA 4ZKBB 1XNQQ 2MQHA 2K5VA 4CDDC 1LTID 4X62Q 1NR2A 4GKKL 4G4KA 1TT2A 4K0KL 3J80E 2EJFC 3BDOA 5EPLA 3NUCA 3SDZA 2PNRC 1OXXK 4YCUA 4PZ6A 4DV6Q 1KAAA 2Q8TA 1RIPA 4LK1C 2ID0A 1DXMA 4P75A 4DNRB 3MXPA 3JAML 5CV7A 4ZK9B 5E4WC 5A2QE 2MFIA 3PV0A 1EIHA 3ER0A 5BN4A 1U4MA 4IO9A 1VQAA 4RCOA 2RQXA 4BA1I 3KK7A 4EQPA 2F0PA 2UXBL 2UUBQ 3OSOA 3K5NA 2N88A 1SN8A 2E2JH 3OOCA 4FXKC 1GUNA 3QO2A 5A2QL 3GP7A 3KF6A 3HOWH 2H5XA 5C3WA 1BF4A 4X64L 4JV5Q 1KD1C 3HEJA 2NN6H 4DAVA 4POGA 1JOQA 1YNND 3AB9A 4LUOA 1PH6A 3MXNB 3P7JA 5D14A 3STBC 4GKJQ 2H4OA 2KCMA 2JXMB 2XSCA 1CA6A 5A35A 4JBJA 4H44C 5KRUA 1ILPA 3G6JB 3S1MH 2NTTA 4YWLA 4PZ8A 2O5JC 1KIXA 5JVH3 2NVXB 2V1CC 2JE6I 1ZYRC 3R2IA 3TSSA 3U50C 3IFDA 4BBRH 4DAYB 1LLRD 1N34L 5AFWA 1AZPA 4G7OC 2C35B 4LF7L 3HFZB 4DR5L 1FR3A 5JJKA 1I94Q 4QUFA 2J0TD 3TS0A 3D4WA 4P72A 1BO0A 4OIJA 2L55A 3NQIA 1QUQA 5DNFA 3C1EA 1HTLD 1NMGA 1MSHA 5FLXE 1CK1A 2D0PA 3CP0A 2JYOA 2A6ED 2EQSA 3OMCA 1MJCA 2Z9HA 5EKIA 2VNUD 3NQTA 5IP9H 1J5EQ 4FF2A 3P75A 1PTOC 1B3AA 3J7ZC 1A63A 3FP9A 5FOBB 3PO2G 2EYLA 4RCNA 4DKAC 2EPBA 3I4MG 2A6EC 4Y7NH 2AWNA 2JA7G 1G291 1SROA 4EQOA 3C3LA 1STBA 2CH4W 1VDZA 1VMPA 1EQQA 1NNXA 1VQ9A 2F0JA 4QF4A 4OWWB 1BDOA 1OO9B 4RH6A 2L15A 3ULJA 1N34Q 5M5XH 1O80A 4JI1Q 3EA6A 1I4XA 3GTGB 2KJXA 5AJ3L 1C8CA 1VQ4A 3S1NB 1JB7A 5GAEC 4LFBL 2EY5A 4XDXA 3UDGA 3TMEA 2IT1A 4RGMA 1C9OA 1E2WA 1PTOD 2MUYA 2VUMB 1IYUA 4EQNA 5C4JB 2JA5B 3LWEA 5T1IA 4FDBA 3TZDA 3OIPA 3TREA 3KDFA 4WRDA 5EJWA 3X3MA 2CVRA 1F9SA 2IHEA 2GA4B 5HGQA 4R8IA 4OONA 4B08A 2SEBD 1I5FA 3HOYG 4PMWA 1Y1WG 1ET9A 2DGYA 2CKZB 3RR5A 4HIDA 4IOCA 1LT5D 4NB3A 2A68C 2IY5B 1HPCA 4ILWA 2CW0C 2J4XA 2N55A 3U58A 5JEAH 1CKOA 5D65A 4JI6Q 4H13C 2ASBA 1SNMA 3GTPB 4C2MH 3CPWA 1VQEA 5IP9G 2IW3A 3E9HA 1VF5C 2K6AA 3VYUA 1G6ZA 2EXZA 1NBWA 2WAQB 4GLXA 1SFOB 3SVMA 1WYDA 3FPPA 5IT9c 2LXJA 2F0WA 2MJ8A 3E3XA 3S15H 4QQBX 3L9AX 1O7ZA 3H91A 2L9HA 4Q5VA 2Y0SB 4APVA 4GN3B 1IBLQ 2B2UA 2I5HA 2JEAI 4FXGC 3RUZA 2XTIA 5EPJA 1QILA 4R4CA 1SBBB 3HOUG 4A93G 1IBKL 1B53A 2FFKB 4L5RC 4HR7B 2BA1A 3I3CA 1EYDA 3ND8A 5M5WH 1K8GA 3UI2A 3M85A 3M4OB 2FMCA 4FP5D 2E5LQ 3A8KE 3OTOQ 1J8IA 2Q2IA 2QGQA 3E0JA 4JCVE 3L2PA 3DWAA 1EQRA 5TSSA 4A3EH 4B9XA 2JJQA 3BYYB 2K5HA 1B2TA 3I4OA 1FGBD 1FYCA 4DK3C 1CSPA 2XN9C 4DNIA 4GKKQ 2EJMA 3AU7A 2HIXA 5IODA 5J3BA 2XGTA 2AQ2B 4LWCA 2Q2TA 5G3LD 3URYA 3GDEA 1PV4A 4KN7C 4CBVA 4A4IA 4OEMB 3PF4A 2N8NA 2QW7A 1V9PA 4IUQA 1BCPC 5EAYA 1XPUA 2KBNA 1I6HB 1TWGB 3G48A 3H0GB 1YHAA 3T4AC 1YNXA 2Z6BA 2B2TA 4KD3A 1LYLA 4HCEA 4J8QA 5DLQE 3S15B 4JI4Q 5C4JH 2CW0D 2F52A 1KNEA 3OWFA 5DM73 3H15A 3FRPB 5L37A 1Z6HA 1MIUA 2JSOA 3RNUA 1EY7A 2R92H 2A74C 3UDIA 1K8MA 3R8BA 1AFPA 4ZYSA 2K14A 1RTOA 1VQNA 2EYMA 1ZXTA 4B3SL 1PXUA 2NN6I 4A3JG 3D31A 4HN7A 1Q12A 4DV1L 5C3EB 3A0JA 4O42A 3T53B 1SJED 4HSVA 4HEDA 4C2MB 3GV6A 2QEXA 1DGSA 4DR3Q 2UU9L 1NR4A 4Y7NB 2MPMA 2O2LD 4FF4A 3RLNA 1XMOL 4QY7A 4JBMA 2JA8G 4KKSA 5C44G 1SYGA 2Z6KC 3PUVA 2BCOA 3FMCA 1NUCA 1GUGA 4RGNA 1S5ED 2EYHA 2E75C 4ME5A 4A3EG 1SYDA 1K8AC 1DYQA 3G4SA 4TRDA 2F0MA 4ZKCB 1OTCA 3NTKA 3NENA 4V0BA 1W6KA 1VQ6A 4WFN3 1RF2D 1M1KC 2VUMH 3TEHB 3FHWA 3VR5A 4OO1H 2A73B 2F3IA 1I3QH 1FNWA 1CM9A 4XIGS 1R9TB 1SYFA 2GVBA 1B7YB 1PZJD 1PH4A 3VR2A 2K33A 1N8RC 1HNWQ 4QCLA 1HHVA 1ICWA 2YU9H 4H02A 4A3IH 4A3MB 2NWGA 4YY3Q 3GTOB 4DUZL 3OW7A 4ZQ3A 2NBFA 2WAQE 3CMAA 1QVCA 2NVTB 4NMZA 1NMFA 4UP7A 1PH1A 1X3FA 2OTJA 5C3EH 5CMDA 4C3HG 1QVFA 5IT9L 3HOVB 4E6IA 1BCPB 1AH9A 3L0OA 4A3JH 3ERSX 3L3OC 1Z9FA 4NKLA 2C9OA 4DR5Q 2CWAA 2WAQG 3CCMA 4HSPA 4ZUIA 4JI0L 1ET6A 3BVZA 4LFAQ 4DV4L 5COYA 1KQSA 3T1YQ 5J22A 3H0GH 3HRZC 5C0XJ 1I6HH 1F2ZA 1VQFA 1S5CD 3PF5A 2UXCQ 3HOZB 1Q46A 5C44H 4JI3Q 1EEID 3KF8A 4JC0A 3S2DB 1X3QA 1FJGL 1B70B 3KUPA 4IUPA 3T13A 1UEAB 2K50A 1WTWA 2ZT9C 3DEPA 4IN3A 4JW0A 4C1NK 3CCVA 1XWEA 1B44D 1QE6A 3P20A 5IGDA 2NVYB 3VYRA 2K5DA 1LTBD 1UE1A 2EXDA 4IQZA 1QUQB 3S1MB 2RCFA 1OXSC 3ULPA 5IOCA 3SHLA 1XMQQ 1SRUA 2XRSD 1PRTD 5I9PA 1H9KA 5M3FG 4YCWA 3K81C 4YHHL 2IX3A 1TS4A 1LTTD 1WFQA 1F2MA 4A3GG 2HDMA 5M5WB 4RHSA 1E2ZA 4H7BA 1J9OA 4JOIA 3A5UA 1WCMG 1N36Q 1D8LA 1PHJA 1W3SA 4UPAA 4A3BH 4U68A 1K3BC 4DV5L 1I4RA 4DGZA 5BR8L 4C56C 4LF9Q 3K58A 2PQAB 4DA2A 4HJAA 1L2FA 3DXJC 1SFOH 1STEA 4IPCA 2YYZA 3PSIA 2F1MA 1GUOA 3PUZA 5ELEA 5G3LF 5GAGC 2KCTA 3ND9A 1B9NA 2ZM6Q 1PA6A 1K28A 2B39A 2WKCA 5GAHC 1PFMA 2EYPA 3M7GA 3T16A 2XIWA 2LXKA 1VS0A 4AH6A 1L0WA 1F9PA 2E2DC 1G2TA 1F77A 2JQOA 2KQ3A 1F9QA 4JG2A 4KKUA 5M3MH 2OQKA 1YHBA 4HIKA 3C1FA 4G7HC 1WTOA 4IFDJ 2A5HA 1D6EC 1VQJA 4POFA 2WKDA 2F0OA 5M3MB 2JP1A 2SOBA 5D3DA 4JI3L 2I0QA 4JI6L 5CV6A 2AHOB 2ALYB 2EY6A 2JA6H 1A62A 4X66Q 1YIJA 1S40A 1XPRA 1QCBD 1BOSA 4WJWA 4IURA 1YBYA 5FLMG 4A3EB 4JI5L 4FXDA 3K7UC 3M4PA 3IAYA 1I50B 2Z1CA 1JWUD 1KRTA 5FKAC 4K0KQ 3NE5B 3F2BA 4P73A 1ESRA 1S72A 3S1NH 1HRJA 1WTXA 3PO3B 3KJOA 1ESFA 1YZ6A 2E8GA 3TBIB 4DK0A 3S9WA 4J1MA 3KDFB 4FF1A 1LTAD 5C44B 4IJHA 1SMYD 2F0DA 2HCCA 2BA0A 5T1GA 3RZDB 1QOHA 2QF7A 1R4QB 5LMNQ 1A0IA 5C3XA 3BZDB 2X6LA 2F03A 1K3RA 1GM5A 3DMUA 1C4QA 1IW7D 2MP1A 4AIMA 4G7ZC 1YJWA 1XJVA 4YWKA 1JWSD 4Y52H 5M9OA 3D0FA 4KY5A 1TWHB 4A3MG 1PYSB 2EY1A 4JVZA 4EX5A 5BN3A 1O7IA 2NZOA 4GLAC 3JAMc 2E2HH 4OXPA 2K5NA 3TZUA 3NWTA 1JE5A 3F2CA 1ML0D 4BBSH 1EEFD 3HKZG 3PO2H 3K0YA 1JICA 2EJGC 2NB0A 2JA7H 2OEOA 3M4YA 4NXNQ 1BCPF 4AYBB 2K28A 2PW7A 4HTHA 1J5EL 1EY8A 4UY8C 1VQGA 3OPOA 2R7DA 1CA5A 3CCJA 3CXCA 3ONAB 2F0UA 1EY0A 3TQYA 4Z9CB 1R9TH 5K36H 3OYYA 1I3QB 2IPKD 3U9OA 5EBCA 5JJZA 4OL7A 2YTXA 1LTLA 3T1HL 3HOZH 3H94A 2F0IA 4IPDA 2QA4A 3GD7A 2Q2HA 4R4OA 5DM63 4FNFA 4UHVA 4EGVA 1HNWL 1PZID 1U4PA 1GHJA 3A5ZB 1X3PA 3CC4A 2DY7A 1SE2A 1Y8PB 4LF6Q 5CYUA 2LFNA 1JOKA 4O0AA 3HOWB 1EL0A 5LMNL 3I2ZA 1RL2A 5IY0A 3GTGH 3HOVH 3VDYA 1QWYA 3F8TA 2Y0SG 2CQAA 3I73A 4F8MA 1EWCA 4R8NA 2NTSA 4DR6Q 3MWYW 1EU4A 3A74A 4K8IA 3MFGA 5GADC 3M4QA 1ZKOA 3NTIA 2JA9A 3C2PA 4ULLA 1SMYC 3V96A 3CCLA 1LT6D 2UUCQ 3NWSA 5KNDA 4A3MH 4A3IB 1HQMC 1VQDA 1MJEA 1BNZA 3FPUB 2DJFC 1Q3LA 1STYA 4KD4A 4X3SA 2ZTDA 1E0BA 4FYDA 3BU2A 1TXYA 2K7VA 4DV3L 1S5FD 4JI5Q 3CAMA 5I2XA 1TWFB 1WOCA 2BH2A 3KBGA 3CC2A 4BXXH 3PUYA 3QOLA 2VB3X 1VCIA 3Q0AA 1HFGA 1EUJA 1PH7A 5C4XG 5BN5A 2HD3A 2F0LA 2HCIA 2DN8A 1UAPA 1SEBD 4LFAL 4A3LG 4L5TA 4DR4Q 1SAPA 1V1OA 2XVSA 4HJ5A 3H3VH 1A8VA 1DOMA 1AE2A 5JJIA 5K36G 1D2BA 4MTNA 4DV6L 4A93H 4MIUA 4C3IH 4K5XA 4JYAL 4LF4Q 2B63G 2NVXH 3M7NA 1Y1VG 2Z0SA 5IIFA 4UAIA 4K6DA 5HY6A 2UU9Q 2L4NA 1Y8NB 3W1GA 3Q23A 1RTNA 4X65Q 4A3KB 3DEOA 1OXVA 2RF4A 2PMZB 4B3ML 4Q0FA 4KV6A 3STBD 5IGEA 2LMCB 2MHVA 1Y1VB 1TWHH 4K2LA 5HGTA 1XNRQ 3I91A 3FEWX 2SDFA 4KHVA 4MHEA 2B2WC 4KHPL 1II3A 4O2DA 3K80C 3P1HA 1XX8A 4ID6A 4R4QA 3S1RH 3TRZA 2FMMA 4J6HA 1XPOA 2CHBD 1XNRL 5IYCH 4DV7Q 2F4VQ 3V05A 1LV9A 3D6CA 1UUPA 3RZDH 1TWGH 1UE6A 1B9MA 1NAPA 4NPSA 2KECA 2EE1A 3SK8A 4YHHQ 4ZUJA 3KLRA 2PZUA 4R1JA 2G9HD 2HHHL 3NXWA 1B8AA 2DY8A 3CRLC 2BE5C 3H6MA 4DUYQ 4V190 2R61A 3PO3H 4RG1A 5JOBA 5C4ZA 1TS2A 2HUGA 4DN4M 2R92G 4K2KA 2ENBA 4KK7A 3PQIA 4FVMA 2J7ZA 1I50H 1D5MC 2ZM6L 3GTPH 4GOPA 1KC8C 1EZ6A 1S5DD 2UXBQ 5I2YA 3AEVA 4A3LH 1S4ZA 2K5QA 3I4NH 4X3UA 1F2LA 1STHA 1BKBA 2UXCL 5BR8Q 5E7NA 2VUMG 4DR7L 5AJ3Q 4X3TA 2LSSA 2R7FA 3EBEA 4UP8A 4JBWA 2HQEA 4MNOA 3CF5A 1PMRA 5IP7H 5CC4A 5CV8A 5KYLA 4DV3Q 1Q8IA 1EQTA 2MNAA 1HXYD 1IBLL 2A19A 3A7LA 4QUCA 5DAUA 3ERQA 4MZ9A 2K04A 4HIMA 2JA5H 1G2SA 3AFPA 2K4KA 4CKCA 2ZXRA 3D4DA 1M8AA 5IGGA 1X55A 1DD2A 2H1EA 1OXTA 3NBHA 5CV4A 3PUXA 4HIOA 2JEBI 4OO1G 1X3GA 3J7A5 3G6EA 5M5XB 3EVQA 3HKSA 2JA8B 1IBMQ 3WWVA 4B9WA 3EIVA 4IJLA 5LL6S 4B3RQ 1YNNC 2Z4HA 5LMNW 1RCVD 3NBHB 3KFUA 1E22A 2A68D 1CKNB 1D5ZC 1D1IA 1MHWC 4DV4Q 4C3HH 5FO9B 3C46A 4JI2Q 5ELDA 2N49A 1KRSA 1MI2A 1CUKA 3BVGA 3TP5A 3E5SA 5F2DA 2KCCA 4I65A 1IYVA 3E6ZX 2EYFA 2I5MX 1I4GA 5C0XH 4GKJL 2FHTA 3HOWG 1PLFA 2MO1A 3CCSA 1L1OC 2WB1G 1ONLA 4LF8Q 3B6YA 3H0GG 2B8GA 1CHPD 2ICIA 1YITA 1MKHA 4KJOA 1VQCA 4LUVA 3NP8A 1Q90A 4AYBE 2EIFA 4CGYB 3S2DH 2XRQD 1ASZA 4BA2I 1SJHD 2DUDA 4M8AA 5FO8B 1FL0A 1WCMH 3DM3A 1Y69U 1PH9A 4RKBA 3AMUA 2WB1B 4JI1L 1S3OA 2WB1E 3K5LA 4BBRG 1OXUA 2L0CA 3SE0A 3IFTA 3D8GA 1QJOA 1NTGA 3I7FA 1H9SB 1SDFA 3HKZB 1YI2A 1HNXL 4QJFA 5JVG3 4AYBG 3BVMA 1QZGA 2I07B 2FXQA 3K7AB 3WDNA 4A3JB 1JMCA 4O1NA 3VR4A 3SEBA 4R9WA 1TWAB 1VQIA 2E2JB 2VS1A 2L12A 3G71A 1STAA 5IE8A 1ASYA 4HJ7A 4A3DB 4NDXA 2VW9A 1EOVA 4JI7L 1N33Q 4JV5L 4LF8L 2KHJA 4ZCKA 3R93A 3ZYYX 1SMXA 4X62L 1H9SA 2E76C 1GUSA 1PRTB 1RKNA 4LF7Q 2NZ1D 2NUCA 3BZCA 1KL9A 3M3YH 2R7ZB 3W1BA 3A55A 1VQKA 1BXTA 4RFBA 5DEHA 5ELCA 4LFBQ 1EU3A 4CDEC 4QL5A 4KMUC 4DAMA 4JI2L 2F0GA 2JA6G 4CJ1B 5FLXL 2QDLA 3KLSX 4ME3A 1TY2A 1Q8KA 3UDFA 5I6YA 4A76A 1FGUA 1K9MC 1YEZA 1GO3E 5IGBA 5CV5A 4RGOS 4DAYA 1JORA 3GTKH 2LY7A 3J80i 1E2VA 1HUMA 1Q82C 1HR0W 2L11A 3FKIG 1PH3A 4A3GB 1DOLA 2KHIA 4XT1B 3MEHA 4BS9A 2ZTCA 2ZJPA 2PNHA 5KGUA 4DUYL 5E4XA 4DF7A 1Y1WH 1CTMA 2X6GA 5ELBA 3BDCA 4R4IA 3K8AA 5JPMC 2AUJD 3KF6B 4IUVA 1ENCA 4OGQC 1HNZQ 2K52A 4KI0A 5JEAG 4RKLA 2K1BA 4RMFA 1X56A 4PMBA 5J1ZA 2R92B 1SYEA 4F88A 3K5MA 2EYJA 1M4VA 2DNCA 4IUTA 4DFAA 3HOXH 4CDFC 3SK4A 3UE0A 3IRBA 4N9TA 3KF8B 1V1PB 1GKHA 2PZTA 1TQOA 5KIXA 3S14H 3DLLA 2CQOA 4HAEA 1JOOA 1H9MA 1PTOF 3I70A 3BG3A 4RHRA 4C3JG 5IWAQ 1I4QA 4DK6C 4B3TL 2I5LX 1QG7A 1J6QA 1LT3D 3KLSA 5IYBG 4DV2Q 2PMZE 4X3KA 4S3SA 4C3JB 4JPBW 2OTLA 2QDBA 4NP5A 4B3TQ 3W3AA 2ZXOA 2OT2A 4LMQD 2OQ0A 4LNQA 1B50A 2RKSA 4KJNA 3HOUH 3NTHA 2NVQH 5EQ0A 4UDUC 3I8ZA 3J80L 1NE3A 1EYCA 2BDOA 1CHQD 4BWGB 1LUZA 1EQVA 1IKLA 1FVIA 4A3KG 3NELA 3I56A 1RD9D 3H09A 2FINB 3HKZE 3M4OH 3FKIH 1EZ8A 4WORA 4LF6L 5EKKA 2R93B 2RHQB 4JI0Q 2F0KA 2A6HC 4AQYL 4QGUA 1T9HA 3DM1A 4TVAB 3VA7A 4GNXA 2LKVA 1UWVA 2EYOA 1A2UA 1PRTF 2IX1A 2PZWA 4H0LC 2Y0SE 2PO4A 3HOZG 1JCKB 1ZYRD 1VQLA 1XMQL 5CGKA 5C4XB 2F3VA 4DR2Q 4L5SA 1PTOH 3DUZA 5CV9A 4CJ2C 1SNDA 2AQ1B 1M90C 4XQJA 3SK5A 3O13A 4R4TA 1TWCH 4XXEA 4L5QA 3BJUA 1N33L 3ITPA 1EOTA 1NJIC 4LF9L 5IGCA 1TS5A 4GNXB 1AW7A 4ZLTF 3GTLB 5FO7B 1E3PA 2A6HD 2OXPA 1A6XA 2RBMA 1HUNA 2FJ2A 1U5KA 1WI5A 3EQLC 1U9RA 3I4MH 4ZAIA 4DV7L 1TKWB 5IYBH 3GTJB 4DXFA 3PIPA 1I94L 2ZTEA 4PQXA 5GQOA 1UNSA 2PI2E 3TDQA 1BQQT 1A3TA 2G9DA 4TSSA 2KEDA 4U673 5ELOA 4A3DG 4C3IG 1GOZA 1STGA 1HH2P 4PV1C 2B63H 4K5WA 1B4OA 3K57A 4OX9Q 3AYHB 4JI7Q 2F0NA 2M00A 3K5OA 3GTLH 1O7YA 1K0SA 3GTMH 4JI8Q 1O78A 3CMEA 3RN5A 1CT1D 4OELB 1TWCB 3X3NA 4DR6L 2YTVA 5IT9E 4N8X1 1HZ9A 2KCNA 3EROA 1Y8OB 2HDLA 4IPHA 3W2DA 1SNOA 5I9OA 1IYJB 4OO1I 1GVPA 1RHPA 2VXWA 4IUNA 3RZOB 4A3FH 3MA2B 4EVOA 4GNXC 3KOJA 1KNAA 2A8VA 1EY9A 1E7ZA 2B2VC 2TSSA 4QB4A 1PFBA 1YNJC 4DV0L 2MO0A 5C6AA 4GOPB 3E9IA 1SR3A 4BY1B 1UE5A 2EDGA 2ZXPA 1K8OA 4F87A 3MC0B 1SNPA 2VQEL 2N3SA 3OHXC 4NXMQ 4X64Q 2QILA 1TY0A 1YNJD 4XYQA 1PYBA 5JEAJ 4ABNA 3RLOA 5KYIA 3SXHA 2D5DA 2F0FA 3J81j 4DNTB 4PG3A 3U9SA 2AKWB 1A3VA 4MTKA 3RLFA 1QNKA 2NYZD 4YY3L 1ENFA 4CKEA 1U0LA 1P16A 1XXGA 5IYDH 4BBRB 2AWOA 1KXLA 1LT4D 3NSWA 1L1OB 3QJYA 1PTOB 5EPKA 1DOKA 2K03A 2F0QA 3MFYA 1EIYB 4P71A 1TR5A 4DR7Q 3K0XA 3PIOA 1IW7C 4OIKA 1K83B 3CPFA 3S17B 2RA4A 1S5BD 1A2TA 3EFXD 1H9JA 3S1QB 1K73C 2CWPA 1PFSA 1V43A 4GLVB 3VR6A 1JC7A 1N32L 4UP9A 1EIGA 1W6JA 2R93H 3VYTA 1EIFA 5CBAE 3MVVA 1CFMA 3I4NG 2E2IB 1PH5A 2CH4A 1HJPA 1WVLA 3ULLA 3Q22A 3D4RA 3J81E 5J39A 5H1SE 4DR1Q 1I4HA 2G5DA 5C5LA 4A3FG 1SNCA 3J7AF 2E74C 3HOYB 5M5YH 3MXNA 3IL8A 5M3FH 1SNQA 3TN2A 2AQ3B 3BYTB 4NXNL 1K0RA 4JOIC 4DR1L 3L7ZC 1PH2A 3HOUB 1K83H 2WV6D 3S17H 4RA8A 1EYAA 3NPPA 3KLWA 5GROA 2D0OA 1XNQL 5C5MA 3I55A 4I7AA 1TIID 2K75A 3VR3A 1Q86C 2B2VA 2KEEA 2LS01 2B29A 3N6RA 3J81L 2JA5G 1H95A 2VQFL 1IKMA 1SLJA 2RHSB 3MXGA 1D1KA 2ZJRA 3DWPA 1TS3A 4LF5Q 1STNA 4A3CG 1D7QA 3A8IE 4XQNA 4LJZC 1T5XD 1HCZA 2RCNA 3HZXA 4GN4B 3U4ZA 1X9NA 4DPGA 1MBYA 2P5ZX 5C0XG 1KLUD 5IYDG 3K59A 4L6TB 4XYOA 1HR0L 1KDAA 1G51A 2R7ZH 4IOAA 4JK1C 1X32A 2B2UC 2X69A 2XNAC 3A7AB 3MXUA 3QG1A 1EFWA 5CORA 2HIVA 2RDGA 4TQUS 3PMFA 1BVSA 1Y1WB 1EYGA 1WTHA 2TMPA 3QB3A 4PNYA 2HT1A 2V4DA 4IUUA 3G7LA 4JYAQ 5M3MG 2QKIC 5FJ8H 2BOSA 5M3FB 1DONA 3S16H 1BUVT 1KDCA 1TWAH 4LFCQ 5JJLA 1O7LA 4FF3A 3PCOB 1UE7A 1HZBA 3OTOL 2E2IH 1HFNA 4B3RL 1VQHA 4GZYC 4C1NI 4XTCS 3RD4A 5FLMH 1IBKQ 2RDHA 3UDXA 4GS3A 2B63B 1FNVA 4LUZA 2JN4A 1AN8A 4BY7G 1CZWA 1Z47A 3NHHA 1WD0A 4X65L 2UUAL 1IL2A 3GQBA 4DK1A 1GD7A 2B2TC 3CD6A 2WP8J 1VQOA 1G8ZD 1H9RA 3A54A 4DXGA 1RDPD 4YIJA 4DR2L 2RDFA 1QZHA 4PZ7A 2UUAQ 2PPBC 1X6OA 3F1ZA 1GHKA 3GTJH 4CKBA 4DR4L 2N78A 3JAME 3GTQH 4HJ9A 1XYIA 5K5PA 3U4VA 3QOJA 2Z4IA 4J15A 1B1ZA 2VY3A 3MTSA 2JK8A 3KBXA 2R6GA 4BY7B 1AZQA 3CQZB 5NUCA 4CDCC 1C7YA 1U4LA 3QR8A 1BBWA 2O4XA 3OW2A 3Q24A 3MZ5A 1YJNA 2WIIB 1DCZA 3J81c 1TVXA 3CKIB 1CI3M 3RN2A 1LM0A 2R3ZA 3BZKA 2CFMA 1IBML 4JI4L 1JQYD 1X3EA 4G57A 2UXDQ 3CC7A 2Z6KA 1A3UA 3R2TA 1PH8A 1WTQA 1NY4A 5EGTA 2ES2A 2B8FA 4A3FB 2D9UA 1GJXA 3HGBA 1VQ7A 1G6PA 1WTVA 4WJ3M 1L0XB 3FKIB 1V1QA 3FDTA 4TKOB 2UUBL 1HR0Q 1JT8A 1HTPA 3PUWA 3M9BA 1YJ9A 4RWSC 2D62A 1AE3A 1HQRD 4A75A 1HNXQ 1JJCB 1WJJA 1W2BA 2Q8RE 5ELFA 3DWQA 3CQZH 2D2CC 4BY7H 3HS0C 4NW2A 3N52A 4OWTB 2RSOA 4K14A 2BH8A 1SE3A 3GTQB 3OMGA 1V8QA 3J7AV 3QWNA 2JA6B 1VQ8A 3CRKC 3CU7A 4A3BG 2KENA 3HOVG 4C3JH 4B3MQ 5D3IB 2L5TA 3PIP3 1B3QA 1HA5A 2PCFB 1PRTC 4DU9A 1A15A 3ICEA 1PYWD 1KLGD 3JAMi 4IFDG 2I46A 4IZ8A 5IGFA 3FVQA 3PGZA 1GXDC 3HOXG 4LF4L 2ATWA 2PW5A 3SK6A 1MSGA 2ZJQA 3DHQA 2GVAA 1LTSD 3J7YW 2XWJB 4XQQA 4DUZQ 5IWAL 4I7ZC 2B2YC 1P8LA 3CHBD 2F0VA 4GN5A 4P74A 5KNCA 1IL8A 2RSNA 3AFQA 2EVBA 3F2UA 1E1OA 3S2HH 4QIWB 3EN2A 3I4LA 1SE4A 3S16B 5C4XH 4LF5L 4A3BB 1YHQA 3W5OA 1E1TA 1TU2B 1NCVA 5E3FA 4ALPA 2Z8LA 1XTDA 3HOYH 4KHPQ 2QEJC 1IHZA 1L0YB 1WTPA 2KHSA 1CZGA 4DAPA 4HJ8A 5LHY1 3Q6SA 1Y1VH 1ILQA 2KVMA 1NSNS 1Q7YC 2PQEA 3H3VC 2A69C 2AMCB 3T56B 4KN4C 4A3KH 1JJGA 1XMOQ 3LWUA 4OHJA 2Q8IB 2HHHQ 4DV2L 3S1QH 2NVQB 3NK9A 1DM0B 2B2WA 2VZAA 4LAAA 1V1PA 1I6VC 2NVYH 1CSQA 2F4VL 5EBDA 4X6AH 2DNEA 1VQPA 1KTKA 3LNNA 4K5VA 2QCPX 3M3YB 1PDQA 1RJTA 1WTRA 2EY2A 2IL8A 1Q81C 1QVGA 2BE5D 4IFDH 5IYCG 3GV3A 4BY1G 1Q1EA 4XT3B 4RGTA 2A69D 3F2DA 3ZJYC 3WOEA 3T1YL 2Q2UA 4A3DH 2OCEA 3HG9A 3IKJA
chains in the Genus database with same CATH topology
2ZTDA 3S15H 4QQBX 2ZTEA 4IPGA 3BU2A 4BBSG 1TXYA 5GQOA 2PI2E 3PO3G 4DV3L 4APVA 4GN3B 4JI5Q 3CAMA 1IBLQ 1WOCA 2I5HA 3K7AH 3CC2A 2BH2A 3CCQA 3PUYA 5LMUQ 2JEAI 4BXXH 2XTIA 4R4CA 5ELOA 3HOUG 1VCIA 4A93G 1IBKL 1PH7A 1EUJA 4L5RC 4A3DG 1IZ6A 3MEFA 2BA1A 5C4XG 1HH2P 4JI8L 1CKMA 2B63H 5M5WH 1K8GA 3M85A 4OX9Q 4LFAL 4A3LG 1E24A 3AYHB 4L5TA 1X54A 4JI7Q 4DR4Q 4KLKA 2E5LQ 4HJ5A 3H3VH 3GTLH 1A8VA 3OTOQ 1AE2A 5JJIA 3E0EA 5K36G 2Q2IA 2QGQA 3GTMH 4JI8Q 2PI2A 1VQBA 5ELNA 4JCVE 3L2PA 4MTNA 3CMEA 4DV6L 3RN5A 4A93H 3J81i 3RZOH 4C3IH 3GTOH 4JYAL 1EQRA 4LF4Q 2B63G 1EWIA 4A3EH 2NVXH 1UEBA 2JJQA 2YTVA 1SE8A 1Y1VG 3M7NA 1N32Q 2K5HA 3I4OA 2Z0SA 2GN5A 1HZ9A 4DK3C 1C0AA 1CSPA 5HY6A 5IP7G 2UU9Q 4IPHA 4DNIA 1YVCA 4GKKQ 1IYJB 2HIXA 2CCZA 4OO1I 1GVPA 5J3BA 3W1GA 2XGTA 4LWCA 4A3FH 4X65Q 1VQ5A 2Q2TA 4WJ4A 3GDEA 4EQ5A 4GNXC 1OXVA 3J80c 2NZHA 3KOJA 1PV4A 2RF4A 4B3ML 2VL6A 4A4IA 2A8VA 3STBD 3PF4A 1E7ZA 3LGJA 2N8NA 1N9WA 1V9PA 5EAYA 1XPUA 4DV0L 2MO0A 1TWHH 2KBNA 1TWFH 3G48A 4GOPB 3E9IA 1XNRQ 1YHAA 1SR3A 1UE5A 1YNXA 4KHPL 3Q8DA 4O2DA 4YCVA 1LYLA 3K80C 4R4QA 5LMUL 5DLQE 3S1RH 3TRZA 4JI4Q 5C4JH 2VQEL 2YTYA 2F52A 1XPOA 2N3SA 1XNRL 3KYHC 4NXMQ 4X64Q 3H15A 5IYCH 4DV7Q 2B3GA 4BY1H 2F4VQ 1PYBA 3RNUA 1MIUA 1FJGQ 3RZDH 2R92H 1TWGH 1UE6A 5JEAJ 3UDIA 4OX9L 4IFDI 3RLOA 4NPSA 2VQEQ 4YHHQ 3J81j 2K14A 4PG3A 1VQNA 4R1JA 2AKWB 4B3SL 4DR3L 2HHHL 2NN6I 4A3JG 3D31A 1B8AA 3JC66 4DUYQ 1Q12A 3RLFA 4DV1L 3PO3H 4RG1A 3A0JA 2JA8H 4YY3L 4DV0Q 2R92G 1U0LA 1P16A 2QEXA 4BXXG 5IYDH 3NEMA 1DGSA 4DR3Q 2UU9L 2AWOA 1KXLA 1I50H 1L1OB 2ZM6L 3CW2C 3GTPH 4GOPA 1KC8C 2UXBQ 3RLNA 1EIYB 2R93G 4A3LH 4P71A 3AEVA 1XMOL 1JJ2A 4DR7Q 3K0XA 4QY7A 3PIOA 1L1OA 4JBMA 3T1HQ 2JA8G 3CPFA 3SGIA 3I4NH 5C44G 2Z6KC 3PUVA 1BKBA 1K73C 2CWPA 1PFSA 2UUCL 2UXCL 1V43A 4GLVB 2A1AA 5E7NA 5BR8Q 1N32L 3KJPA 2VUMG 4UP9A 4DR7L 5AJ3Q 4A3EG 1K8AC 2LSSA 2R7FA 2R93H 1EIFA 3EBEA 4UP8A 3G4SA 4JBWA 4MNOA 3CF5A 1OTCA 2UXDL 5IP7H 3NENA 3I4NG 1HZAA 4YWMA 1PH5A 1VQ6A 1HJPA 4DV3Q 3ULLA 5H1SE 4DR1Q 2MNAA 1IBLL 2A19A 4NXML 1M1KC 2VUMH 4A3FG 3TEHB 3FHWA 4MZ9A 2F3IA 1I3QH 1HZCA 4XIGS 5M5YH 4HIMA 2JA5H 4B3SQ 5M3FH 2GVBA 1B7YB 4NXNL 1K0RA 3AFPA 4JOIC 3L7ZC 4DR1L 1PH2A 1PH4A 2K4KA 1K83H 3CCRA 3S17H 1PVOA 1CKNA 4AQYQ 3KLWA 1N8RC 5GROA 1X55A 2D0OA 1HNWQ 1XNQL 2YU9H 3CCEA 4DV1Q 4H02A 1OXTA 3I55A 4A3IH 2VQFQ 3PUXA 4HIOA 3UE1A 2JEBI 2K75A 4YY3Q 4OO1G 4DUZL 1Q86C 5FLXc 4A3CH 1X3GA 2WAQE 3CMAA 1QVCA 2B29A 3J7A5 2JA5G 1NMFA 3G6EA 4X66L 1H95A 1BBUA 4UP7A 1PH1A 1X3FA 2VQFL 3HKSA 2OTJA 1SLJA 2RHSB 5C3EH 1HNZL 2ZJRA 1IBMQ 3WWVA 1QVFA 4A3IG 3EIVA 2IX0A 4IJLA 1AH9A 4LF5Q 1Y14B 4A3CG 1D7QA 4B3RQ 2R7ZG 3L0OA 2PQAA 5LMNW 4A3JH 3NBHB 4JBKA 3KFUA 3ERSX 2RCNA 1KHIA 1E22A 1X65A 1Z9FA 1CKNB 4GN4B 3U4ZA 4DV4Q 1X9NA 4DPGA 2YV5A 5C3EG 2CWAA 4DR5Q 4C3HH 3CCUA 2WAQG 3AQQA 5C0XG 4JI2Q 5IYDG 5C0XI 3CCMA 2N49A 1KRSA 4JI0L 4LFAQ 4DV4L 1HR0L 1G51A 1KQSA 1IXRA 1CUKA 3T1YQ 2R7ZH 4IOAA 3H0GH 5FJ8G 1EFWA 2HQLA 5C0XJ 1I6HH 1VQFA 3PF5A 2HIVA 4LW1A 2WFWA 2UXCQ 4TQUS 1Q46A 2I5MX 5C44H 2IHFA 4JI3Q 1BVSA 4GKJL 1EYGA 3H3VI 4JC0A 3HOWG 2HT1A 4GOPC 1FJGL 1B70B 3GO5A 2MO1A 3CCSA 4DV5Q 4LFCL 2OWOA 1L1OC 2K50A 2WB1G 4JYAQ 4LF8Q 2NN6G 3B6YA 3H0GG 5FJ8H 5M3MG 3CCVA 1N36L 1KAWA 3S16H 1YITA 3S24A 1MKHA 1VQMA 2EXDA 1UE1A 1VQCA 4LUVA 1TWAH 4LFCQ 1QUQB 4QIWE 4AYBE 5JJLA 2E5LL 4A3GH 2EIFA 3PCOB 3S2DH 1UE7A 1HZBA 3OTOL 1ASZA 1OXSC 3ULPA 4BA2I 2E2IH 2DUDA 4KHZA 3TS2A 1FL0A 3DM3A 1WCMH 4OWXB 1XMQQ 1SRUA 4B3RL 1VQHA 5M3FG 1Q1BA 1PH9A 4XTCS 4YCWA 3K81C 5FLMH 4YHHL 1XNQQ 2MQHA 2K5VA 1IBKQ 4JI1L 1S3OA 3UDXA 2WB1E 4BBRG 4X62Q 1WFQA 1OXUA 4GS3A 4A3GG 4LUZA 4GKKL 1NTGA 3I7FA 4BY7G 1Z47A 1YI2A 1HNXL 4JOIA 4K0KL 3A5UA 4QJFA 1WCMG 4AYBG 1N36Q 1QZGA 1D8LA 2FXQA 4X65L 2UUAL 1IL2A 1OXXK 4YCUA 4PZ6A 4DV6Q 1PHJA 1JMCA 1GD7A 1VQIA 1RIPA 3CD6A 2ID0A 2WP8J 1VQOA 4P75A 1W3SA 2VS1A 4UPAA 4A3BH 4DR2L 3G71A 1QZHA 4PZ7A 5IE8A 1ASYA 2UUAQ 4HJ7A 1X6OA 2VW9A 3F1ZA 1EOVA 3GTJH 4DV5L 4DR4L 4JI7L 2MFIA 3PV0A 1N33Q 4JV5L 2N78A 3ER0A 4LF8L 2KHJA 3GTQH 5BR8L 4HJ9A 4LF9Q 2PQAB 4IO9A 1SMXA 1VQAA 3U4VA 4X62L 4J15A 4HJAA 1SFOH 1L2FA 2VY3A 2JK8A 4BA1I 2R6GA 4LF7Q 4IPCA 2YYZA 3PSIA 3PUZA 2UXDQ 5GAGC 3BZCA 1KL9A 2KCTA 3M3YH 3W1BA 2ZM6Q 1PA6A 1C7YA 1BBWA 1VQKA 2UXBL 2UUBQ 3OW2A 4LFBQ 1SN8A 4QL5A 5GAHC 1YJNA 4DAMA 2E2JH 4LF4L 2LXKA 3J81c 1VS0A 4AH6A 3RN2A 1LM0A 3BZKA 3KF6A 2CFMA 1L0WA 1IBML 4JI2L 2JA6G 3HOWH 4JI4L 2H5XA 4ME3A 2JQOA 4X64L 1X3EA 4JG2A 4JV5Q 1KD1C 1Q8KA 5M3MH 2OQKA 3UDFA 1YHBA 3CC7A 4HIKA 2Z6KA 4A76A 4POGA 1PH8A 1FGUA 4IFDJ 1K9MC 4LUOA 1PH6A 3MXNB 1NY4A 1YEZA 1VQJA 3STBC 1GO3E 4POFA 2ES2A 4GKJQ 2I0QA 4JI3L 4JI6L 3GTKH 2AHOB 2ALYB 2KCMA 2JA6H 1A62A 4X66Q 1VQ7A 1G6PA 3J80i 1YIJA 4WJ3M 4JBJA 1V1QA 1S40A 1Q82C 1HR0W 1XPRA 3S1MH 4YWLA 2UUBL 1HR0Q 1JT8A 3PUWA 3M9BA 1YJ9A 3FKIG 4PZ8A 1PH3A 1YBYA 1KIXA 5FLMG 2V1CC 4JI5L 2JE6I 3K7UC 3M4PA 2D62A 2KHIA 3U50C 1AE3A 4A75A 4BBRH 4DAYB 1KRTA 1N34L 1HNXQ 1JJCB 1WJJA 3F2BA 1W2BA 4K0KQ 2ZTCA 3CQZH 4P73A 2ZJPA 2C35B 4LF7L 4BY7H 2PNHA 3HFZB 4DUYL 4DR5L 5JJKA 1I94Q 1Y1WH 1S72A 3S1NH 3TS0A 3KJOA 1YZ6A 4OWTB 2E8GA 4P72A 4R4IA 3K8AA 2BH8A 3KDFB 3KF6B 1QUQA 4IJHA 1HNZQ 2K52A 1NMGA 4KI0A 5JEAG 1VQ8A 2BA0A 4RMFA 1X56A 4A3BG 2KENA 2D0PA 3HOVG 4C3JH 3CP0A 4B3MQ 5LMNQ 1A0IA 2EQSA 1MJCA 3HOXH 2VNUD 5IP9H 1K3RA 1J5EQ 1GM5A 3UE0A 3IRBA 3KF8B 3J7ZC 4AIMA 1YJWA 1GKHA 1XJVA 3ICEA 3FP9A 1A63A 4YWKA 3JAMi 3S14H 3PO2G 4IFDG 3DLLA 4Y52H 2CQOA 3D0FA 4A3MG 5IWAQ 1PYSB 4DKAC 3I4MG 4DK6C 4EX5A 4Y7NH 2AWNA 1O7IA 2I5LX 2NZOA 4B3TL 2JA7G 3PGZA 1J6QA 4GLAC 3JAMc 5IYBG 1G291 3HOXG 1SROA 2E2HH 4DV2Q 2PMZE 2ZJQA 4OXPA 2K5NA 1JE5A 2OTLA 3F2CA 2GVAA 1EQQA 4DUZQ 1VQ9A 5IWAL 4BBSH 4OWWB 3HKZG 3ULJA 1P8LA 2L15A 1N34Q 4B3TQ 4GN5A 4P74A 3PO2H 5M5XH 4JI1Q 3AFQA 2OQ0A 4LNQA 2JA7H 1E1OA 5AJ3L 3S2HH 4UY8C 1VQ4A 4NXNQ 1J5EL 3EN2A 3HOUH 1JB7A 5GAEC 4LFBL 1VQGA 3UDGA 5C4XH 4LF5L 2NVQH 1YHQA 2R7DA 3W5OA 2IT1A 1C9OA 1E1TA 1NE3A 3CXCA 3CCJA 3TQYA 4ALPA 1XTDA 1R9TH 1LUZA 3HOYH 3OYYA 3T1HL 3NELA 4FDBA 4A3KG 2ATWA 4KHPQ 2YTXA 1LTLA 3I56A 3TREA 3HOZH 3HKZE 3M4OH 3FKIH 3KDFA 4LF6L 4HJ8A 2RHQB 1Y1VH 4IPDA 2QA4A 2IHEA 3GD7A 2Q2HA 4R4OA 4JI0Q 1Q7YC 5HGQA 4AQYL 1HNWL 4OONA 4QGUA 1T9HA 4TVAB 4GNXA 1I5FA 1UWVA 2AMCB 3A5ZB 3HOYG 3CC4A 2IX1A 4PMWA 4A3KH 4LF6Q 1Y1WG 2Y0SE 2DGYA 1JJGA 3HOZG 1XMOQ 2CKZB 3RR5A 4HIDA 4IOCA 2HHHQ 1VQLA 4O0AA 4DV2L 3S1QH 1XMQL 4NB3A 2IY5B 4DR2Q 4L5SA 2VZAA 5LMNL 3U58A 1CKOA 3I2ZA 1RL2A 5IY0A 3GTGH 4JI6Q 3HOVH 2NVYH 1CSQA 3VDYA 1M90C 2ASBA 3F8TA 2F4VL 4X6AH 2NVTH 4C2MH 2Y0SG 4R4TA 1TWCH 1VQPA 3CPWA 1VQEA 4L5QA 3BJUA 5IP9G 1N33L 4DR6Q 3A74A 1NJIC 4LF9L 3E9HA 5GADC 3M4QA 4GNXB 1Q81C 2JA9A 1NBWA 1QVGA 4GLXA 3CCLA 1E3PA 5IYCG 4BY1G 1Q1EA 2UUCQ 4DR6L 1U5KA 1WI5A 4A3MH 1WYDA 3F2DA 3I4MH 3ZJYC 4DV7L 1VQDA 3T1YL 1MJEA 5IT9c 5IYBH 2LXJA 2Q2UA 3PIPA 1I94L 4A3DH 2OCEA 1FVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTD A;  3S15 H;  4QQB X;  2ZTE A;  4IPG A;  3BU2 A;  4BBS G;  1TXY A;  5GQO A;  2PI2 E;  3PO3 G;  4DV3 L;  4APV A;  4GN3 B;  4JI5 Q;  3CAM A;  1IBL Q;  1WOC A;  2I5H A;  3K7A H;  3CC2 A;  2BH2 A;  3CCQ A;  3PUY A;  5LMU Q;  2JEA I;  4BXX H;  2XTI A;  4R4C A;  5ELO A;  3HOU G;  1VCI A;  4A93 G;  1IBK L;  1PH7 A;  1EUJ A;  4L5R C;  4A3D G;  1IZ6 A;  3MEF A;  2BA1 A;  5C4X G;  1HH2 P;  4JI8 L;  1CKM A;  2B63 H;  5M5W H;  1K8G A;  3M85 A;  4OX9 Q;  4LFA L;  4A3L G;  1E24 A;  3AYH B;  4L5T A;  1X54 A;  4JI7 Q;  4DR4 Q;  4KLK A;  2E5L Q;  4HJ5 A;  3H3V H;  3GTL H;  1A8V A;  3OTO Q;  1AE2 A;  5JJI A;  3E0E A;  5K36 G;  2Q2I A;  2QGQ A;  3GTM H;  4JI8 Q;  2PI2 A;  1VQB A;  5ELN A;  4JCV E;  3L2P A;  4MTN A;  3CME A;  4DV6 L;  3RN5 A;  4A93 H;  3J81 i;  3RZO H;  4C3I H;  3GTO H;  4JYA L;  1EQR A;  4LF4 Q;  2B63 G;  1EWI A;  4A3E H;  2NVX H;  1UEB A;  2JJQ A;  2YTV A;  1SE8 A;  1Y1V G;  3M7N A;  1N32 Q;  2K5H A;  3I4O A;  2Z0S A;  2GN5 A;  1HZ9 A;  4DK3 C;  1C0A A;  1CSP A;  5HY6 A;  5IP7 G;  2UU9 Q;  4IPH A;  4DNI A;  1YVC A;  4GKK Q;  1IYJ B;  2HIX A;  2CCZ A;  4OO1 I;  1GVP A;  5J3B A;  3W1G A;  2XGT A;  4LWC A;  4A3F H;  4X65 Q;  1VQ5 A;  2Q2T A;  4WJ4 A;  3GDE A;  4EQ5 A;  4GNX C;  1OXV A;  3J80 c;  2NZH A;  3KOJ A;  1PV4 A;  2RF4 A;  4B3M L;  2VL6 A;  4A4I A;  2A8V A;  3STB D;  3PF4 A;  1E7Z A;  3LGJ A;  2N8N A;  1N9W A;  1V9P A;  5EAY A;  1XPU A;  4DV0 L;  2MO0 A;  1TWH H;  2KBN A;  1TWF H;  3G48 A;  4GOP B;  3E9I A;  1XNR Q;  1YHA A;  1SR3 A;  1UE5 A;  1YNX A;  4KHP L;  3Q8D A;  4O2D A;  4YCV A;  1LYL A;  3K80 C;  4R4Q A;  5LMU L;  5DLQ E;  3S1R H;  3TRZ A;  4JI4 Q;  5C4J H;  2VQE L;  2YTY A;  2F52 A;  1XPO A;  2N3S A;  1XNR L;  3KYH C;  4NXM Q;  4X64 Q;  3H15 A;  5IYC H;  4DV7 Q;  2B3G A;  4BY1 H;  2F4V Q;  1PYB A;  3RNU A;  1MIU A;  1FJG Q;  3RZD H;  2R92 H;  1TWG H;  1UE6 A;  5JEA J;  3UDI A;  4OX9 L;  4IFD I;  3RLO A;  4NPS A;  2VQE Q;  4YHH Q;  3J81 j;  2K14 A;  4PG3 A;  1VQN A;  4R1J A;  2AKW B;  4B3S L;  4DR3 L;  2HHH L;  2NN6 I;  4A3J G;  3D31 A;  1B8A A;  3JC6 6;  4DUY Q;  1Q12 A;  3RLF A;  4DV1 L;  3PO3 H;  4RG1 A;  3A0J A;  2JA8 H;  4YY3 L;  4DV0 Q;  2R92 G;  1U0L A;  1P16 A;  2QEX A;  4BXX G;  5IYD H;  3NEM A;  1DGS A;  4DR3 Q;  2UU9 L;  2AWO A;  1KXL A;  1I50 H;  1L1O B;  2ZM6 L;  3CW2 C;  3GTP H;  4GOP A;  1KC8 C;  2UXB Q;  3RLN A;  1EIY B;  2R93 G;  4A3L H;  4P71 A;  3AEV A;  1XMO L;  1JJ2 A;  4DR7 Q;  3K0X A;  4QY7 A;  3PIO A;  1L1O A;  4JBM A;  3T1H Q;  2JA8 G;  3CPF A;  3SGI A;  3I4N H;  5C44 G;  2Z6K C;  3PUV A;  1BKB A;  1K73 C;  2CWP A;  1PFS A;  2UUC L;  2UXC L;  1V43 A;  4GLV B;  2A1A A;  5E7N A;  5BR8 Q;  1N32 L;  3KJP A;  2VUM G;  4UP9 A;  4DR7 L;  5AJ3 Q;  4A3E G;  1K8A C;  2LSS A;  2R7F A;  2R93 H;  1EIF A;  3EBE A;  4UP8 A;  3G4S A;  4JBW A;  4MNO A;  3CF5 A;  1OTC A;  2UXD L;  5IP7 H;  3NEN A;  3I4N G;  1HZA A;  4YWM A;  1PH5 A;  1VQ6 A;  1HJP A;  4DV3 Q;  3ULL A;  5H1S E;  4DR1 Q;  2MNA A;  1IBL L;  2A19 A;  4NXM L;  1M1K C;  2VUM H;  4A3F G;  3TEH B;  3FHW A;  4MZ9 A;  2F3I A;  1I3Q H;  1HZC A;  4XIG S;  5M5Y H;  4HIM A;  2JA5 H;  4B3S Q;  5M3F H;  2GVB A;  1B7Y B;  4NXN L;  1K0R A;  3AFP A;  4JOI C;  3L7Z C;  4DR1 L;  1PH2 A;  1PH4 A;  2K4K A;  1K83 H;  3CCR A;  3S17 H;  1PVO A;  1CKN A;  4AQY Q;  3KLW A;  1N8R C;  5GRO A;  1X55 A;  2D0O A;  1HNW Q;  1XNQ L;  2YU9 H;  3CCE A;  4DV1 Q;  4H02 A;  1OXT A;  3I55 A;  4A3I H;  2VQF Q;  3PUX A;  4HIO A;  3UE1 A;  2JEB I;  2K75 A;  4YY3 Q;  4OO1 G;  4DUZ L;  1Q86 C;  5FLX c;  4A3C H;  1X3G A;  2WAQ E;  3CMA A;  1QVC A;  2B29 A;  3J7A 5;  2JA5 G;  1NMF A;  3G6E A;  4X66 L;  1H95 A;  1BBU A;  4UP7 A;  1PH1 A;  1X3F A;  2VQF L;  3HKS A;  2OTJ A;  1SLJ A;  2RHS B;  5C3E H;  1HNZ L;  2ZJR A;  1IBM Q;  3WWV A;  1QVF A;  4A3I G;  3EIV A;  2IX0 A;  4IJL A;  1AH9 A;  4LF5 Q;  1Y14 B;  4A3C G;  1D7Q A;  4B3R Q;  2R7Z G;  3L0O A;  2PQA A;  5LMN W;  4A3J H;  3NBH B;  4JBK A;  3KFU A;  3ERS X;  2RCN A;  1KHI A;  1E22 A;  1X65 A;  1Z9F A;  1CKN B;  4GN4 B;  3U4Z A;  4DV4 Q;  1X9N A;  4DPG A;  2YV5 A;  5C3E G;  2CWA A;  4DR5 Q;  4C3H H;  3CCU A;  2WAQ G;  3AQQ A;  5C0X G;  4JI2 Q;  5IYD G;  5C0X I;  3CCM A;  2N49 A;  1KRS A;  4JI0 L;  4LFA Q;  4DV4 L;  1HR0 L;  1G51 A;  1KQS A;  1IXR A;  1CUK A;  3T1Y Q;  2R7Z H;  4IOA A;  3H0G H;  5FJ8 G;  1EFW A;  2HQL A;  5C0X J;  1I6H H;  1VQF A;  3PF5 A;  2HIV A;  4LW1 A;  2WFW A;  2UXC Q;  4TQU S;  1Q46 A;  2I5M X;  5C44 H;  2IHF A;  4JI3 Q;  1BVS A;  4GKJ L;  1EYG A;  3H3V I;  4JC0 A;  3HOW G;  2HT1 A;  4GOP C;  1FJG L;  1B70 B;  3GO5 A;  2MO1 A;  3CCS A;  4DV5 Q;  4LFC L;  2OWO A;  1L1O C;  2K50 A;  2WB1 G;  4JYA Q;  4LF8 Q;  2NN6 G;  3B6Y A;  3H0G G;  5FJ8 H;  5M3M G;  3CCV A;  1N36 L;  1KAW A;  3S16 H;  1YIT A;  3S24 A;  1MKH A;  1VQM A;  2EXD A;  1UE1 A;  1VQC A;  4LUV A;  1TWA H;  4LFC Q;  1QUQ B;  4QIW E;  4AYB E;  5JJL A;  2E5L L;  4A3G H;  2EIF A;  3PCO B;  3S2D H;  1UE7 A;  1HZB A;  3OTO L;  1ASZ A;  1OXS C;  3ULP A;  4BA2 I;  2E2I H;  2DUD A;  4KHZ A;  3TS2 A;  1FL0 A;  3DM3 A;  1WCM H;  4OWX B;  1XMQ Q;  1SRU A;  4B3R L;  1VQH A;  5M3F G;  1Q1B A;  1PH9 A;  4XTC S;  4YCW A;  3K81 C;  5FLM H;  4YHH L;  1XNQ Q;  2MQH A;  2K5V A;  1IBK Q;  4JI1 L;  1S3O A;  3UDX A;  2WB1 E;  4BBR G;  4X62 Q;  1WFQ A;  1OXU A;  4GS3 A;  4A3G G;  4LUZ A;  4GKK L;  1NTG A;  3I7F A;  4BY7 G;  1Z47 A;  1YI2 A;  1HNX L;  4JOI A;  4K0K L;  3A5U A;  4QJF A;  1WCM G;  4AYB G;  1N36 Q;  1QZG A;  1D8L A;  2FXQ A;  4X65 L;  2UUA L;  1IL2 A;  1OXX K;  4YCU A;  4PZ6 A;  4DV6 Q;  1PHJ A;  1JMC A;  1GD7 A;  1VQI A;  1RIP A;  3CD6 A;  2ID0 A;  2WP8 J;  1VQO A;  4P75 A;  1W3S A;  2VS1 A;  4UPA A;  4A3B H;  4DR2 L;  3G71 A;  1QZH A;  4PZ7 A;  5IE8 A;  1ASY A;  2UUA Q;  4HJ7 A;  1X6O A;  2VW9 A;  3F1Z A;  1EOV A;  3GTJ H;  4DV5 L;  4DR4 L;  4JI7 L;  2MFI A;  3PV0 A;  1N33 Q;  4JV5 L;  2N78 A;  3ER0 A;  4LF8 L;  2KHJ A;  3GTQ H;  5BR8 L;  4HJ9 A;  4LF9 Q;  2PQA B;  4IO9 A;  1SMX A;  1VQA A;  3U4V A;  4X62 L;  4J15 A;  4HJA A;  1SFO H;  1L2F A;  2VY3 A;  2JK8 A;  4BA1 I;  2R6G A;  4LF7 Q;  4IPC A;  2YYZ A;  3PSI A;  3PUZ A;  2UXD Q;  5GAG C;  3BZC A;  1KL9 A;  2KCT A;  3M3Y H;  3W1B A;  2ZM6 Q;  1PA6 A;  1C7Y A;  1BBW A;  1VQK A;  2UXB L;  2UUB Q;  3OW2 A;  4LFB Q;  1SN8 A;  4QL5 A;  5GAH C;  1YJN A;  4DAM A;  2E2J H;  4LF4 L;  2LXK A;  3J81 c;  1VS0 A;  4AH6 A;  3RN2 A;  1LM0 A;  3BZK A;  3KF6 A;  2CFM A;  1L0W A;  1IBM L;  4JI2 L;  2JA6 G;  3HOW H;  4JI4 L;  2H5X A;  4ME3 A;  2JQO A;  4X64 L;  1X3E A;  4JG2 A;  4JV5 Q;  1KD1 C;  1Q8K A;  5M3M H;  2OQK A;  3UDF A;  1YHB A;  3CC7 A;  4HIK A;  2Z6K A;  4A76 A;  4POG A;  1PH8 A;  1FGU A;  4IFD J;  1K9M C;  4LUO A;  1PH6 A;  3MXN B;  1NY4 A;  1YEZ A;  1VQJ A;  3STB C;  1GO3 E;  4POF A;  2ES2 A;  4GKJ Q;  2I0Q A;  4JI3 L;  4JI6 L;  3GTK H;  2AHO B;  2ALY B;  2KCM A;  2JA6 H;  1A62 A;  4X66 Q;  1VQ7 A;  1G6P A;  3J80 i;  1YIJ A;  4WJ3 M;  4JBJ A;  1V1Q A;  1S40 A;  1Q82 C;  1HR0 W;  1XPR A;  3S1M H;  4YWL A;  2UUB L;  1HR0 Q;  1JT8 A;  3PUW A;  3M9B A;  1YJ9 A;  3FKI G;  4PZ8 A;  1PH3 A;  1YBY A;  1KIX A;  5FLM G;  2V1C C;  4JI5 L;  2JE6 I;  3K7U C;  3M4P A;  2D62 A;  2KHI A;  3U50 C;  1AE3 A;  4A75 A;  4BBR H;  4DAY B;  1KRT A;  1N34 L;  1HNX Q;  1JJC B;  1WJJ A;  3F2B A;  1W2B A;  4K0K Q;  2ZTC A;  3CQZ H;  4P73 A;  2ZJP A;  2C35 B;  4LF7 L;  4BY7 H;  2PNH A;  3HFZ B;  4DUY L;  4DR5 L;  5JJK A;  1I94 Q;  1Y1W H;  1S72 A;  3S1N H;  3TS0 A;  3KJO A;  1YZ6 A;  4OWT B;  2E8G A;  4P72 A;  4R4I A;  3K8A A;  2BH8 A;  3KDF B;  3KF6 B;  1QUQ A;  4IJH A;  1HNZ Q;  2K52 A;  1NMG A;  4KI0 A;  5JEA G;  1VQ8 A;  2BA0 A;  4RMF A;  1X56 A;  4A3B G;  2KEN A;  2D0P A;  3HOV G;  4C3J H;  3CP0 A;  4B3M Q;  5LMN Q;  1A0I A;  2EQS A;  1MJC A;  3HOX H;  2VNU D;  5IP9 H;  1K3R A;  1J5E Q;  1GM5 A;  3UE0 A;  3IRB A;  3KF8 B;  3J7Z C;  4AIM A;  1YJW A;  1GKH A;  1XJV A;  3ICE A;  3FP9 A;  1A63 A;  4YWK A;  3JAM i;  3S14 H;  3PO2 G;  4IFD G;  3DLL A;  4Y52 H;  2CQO A;  3D0F A;  4A3M G;  5IWA Q;  1PYS B;  4DKA C;  3I4M G;  4DK6 C;  4EX5 A;  4Y7N H;  2AWN A;  1O7I A;  2I5L X;  2NZO A;  4B3T L;  2JA7 G;  3PGZ A;  1J6Q A;  4GLA C;  3JAM c;  5IYB G;  1G29 1;  3HOX G;  1SRO A;  2E2H H;  4DV2 Q;  2PMZ E;  2ZJQ A;  4OXP A;  2K5N A;  1JE5 A;  2OTL A;  3F2C A;  2GVA A;  1EQQ A;  4DUZ Q;  1VQ9 A;  5IWA L;  4BBS H;  4OWW B;  3HKZ G;  3ULJ A;  1P8L A;  2L15 A;  1N34 Q;  4B3T Q;  4GN5 A;  4P74 A;  3PO2 H;  5M5X H;  4JI1 Q;  3AFQ A;  2OQ0 A;  4LNQ A;  2JA7 H;  1E1O A;  5AJ3 L;  3S2H H;  4UY8 C;  1VQ4 A;  4NXN Q;  1J5E L;  3EN2 A;  3HOU H;  1JB7 A;  5GAE C;  4LFB L;  1VQG A;  3UDG A;  5C4X H;  4LF5 L;  2NVQ H;  1YHQ A;  2R7D A;  3W5O A;  2IT1 A;  1C9O A;  1E1T A;  1NE3 A;  3CXC A;  3CCJ A;  3TQY A;  4ALP A;  1XTD A;  1R9T H;  1LUZ A;  3HOY H;  3OYY A;  3T1H L;  3NEL A;  4FDB A;  4A3K G;  2ATW A;  4KHP Q;  2YTX A;  1LTL A;  3I56 A;  3TRE A;  3HOZ H;  3HKZ E;  3M4O H;  3FKI H;  3KDF A;  4LF6 L;  4HJ8 A;  2RHQ B;  1Y1V H;  4IPD A;  2QA4 A;  2IHE A;  3GD7 A;  2Q2H A;  4R4O A;  4JI0 Q;  1Q7Y C;  5HGQ A;  4AQY L;  1HNW L;  4OON A;  4QGU A;  1T9H A;  4TVA B;  4GNX A;  1I5F A;  1UWV A;  2AMC B;  3A5Z B;  3HOY G;  3CC4 A;  2IX1 A;  4PMW A;  4A3K H;  4LF6 Q;  1Y1W G;  2Y0S E;  2DGY A;  1JJG A;  3HOZ G;  1XMO Q;  2CKZ B;  3RR5 A;  4HID A;  4IOC A;  2HHH Q;  1VQL A;  4O0A A;  4DV2 L;  3S1Q H;  1XMQ L;  4NB3 A;  2IY5 B;  4DR2 Q;  4L5S A;  2VZA A;  5LMN L;  3U58 A;  1CKO A;  3I2Z A;  1RL2 A;  5IY0 A;  3GTG H;  4JI6 Q;  3HOV H;  2NVY H;  1CSQ A;  3VDY A;  1M90 C;  2ASB A;  3F8T A;  2F4V L;  4X6A H;  2NVT H;  4C2M H;  2Y0S G;  4R4T A;  1TWC H;  1VQP A;  3CPW A;  1VQE A;  4L5Q A;  3BJU A;  5IP9 G;  1N33 L;  4DR6 Q;  3A74 A;  1NJI C;  4LF9 L;  3E9H A;  5GAD C;  3M4Q A;  4GNX B;  1Q81 C;  2JA9 A;  1NBW A;  1QVG A;  4GLX A;  3CCL A;  1E3P A;  5IYC G;  4BY1 G;  1Q1E A;  2UUC Q;  4DR6 L;  1U5K A;  1WI5 A;  4A3M H;  1WYD A;  3F2D A;  3I4M H;  3ZJY C;  4DV7 L;  1VQD A;  3T1Y L;  1MJE A;  5IT9 c;  5IYB H;  2LXJ A;  2Q2U A;  3PIP A;  1I94 L;  4A3D H;  2OCE A;  1FVI A; 
#chains in the Genus database with same CATH topology
 1SYC A;  1XTC D;  3S1R B;  4IPG A;  5M5Y B;  2OF1 A;  4BBS G;  1VMC A;  2EOT A;  3PO3 G;  1U4R A;  3K7A H;  3CCQ A;  5LMU Q;  4F7X A;  2M2L A;  1IZ6 A;  3MEF A;  4KKT A;  3OWE B;  4JI8 L;  1CKM A;  2EZV A;  3SR1 A;  1LAC A;  4KY6 A;  1E24 A;  1X54 A;  1DJR D;  4KLK A;  1JB3 A;  1ENA A;  4ZRZ A;  3MAQ A;  3E0E A;  1JE4 A;  3MHB A;  1DZ1 A;  2NVT H;  2PI2 A;  1VQB A;  5ELN A;  5I6W A;  1WCM B;  3J81 i;  3RZO H;  4HMJ A;  3GTO H;  3D6W A;  1CQV A;  1EWI A;  1UEB A;  1SE8 A;  2YU9 B;  1N32 Q;  2GN5 A;  5KEE A;  3R3O A;  4C3I B;  3S2H B;  1C0A A;  3T51 B;  5IP7 G;  4A93 B;  1YVC A;  2CCZ A;  1JWM D;  3GTK B;  2ICE C;  3I72 A;  1VQ5 A;  4WJ4 A;  2KA7 A;  3WOF A;  4EQ5 A;  2M9V A;  3J80 c;  2NZH A;  4CJ0 B;  3HP3 A;  3A8J E;  2K5W A;  2VL6 A;  2XWB B;  3LGJ A;  3TP7 A;  1N9W A;  3OIQ A;  3TP8 A;  1TWF H;  3QIA A;  5FK9 C;  1AP0 A;  3LX0 A;  3Q8D A;  4YCV A;  1F2Y A;  2VB2 X;  5LMU L;  2YTY A;  3KYH C;  4HMI A;  1GUW A;  2B3G A;  4BY1 H;  1LAB A;  2KUM A;  5KNB A;  1FJG Q;  4IFD I;  5JPN C;  3D3R A;  2L1B A;  3NBI A;  4OX9 L;  4N9P A;  2VQE Q;  2JA7 B;  1EWH A;  2F4I A;  5CR3 A;  4QMG A;  4DR3 L;  5JAV A;  3JC6 6;  3EJI A;  2JA8 H;  2F3W A;  3VA5 A;  1BBX C;  4DV0 Q;  4BBS B;  1QNU A;  4BXX G;  3NEM A;  2SNM A;  1LTG D;  5C4H A;  2E2H B;  2B2Y A;  1EY6 A;  3VYS A;  3CW2 C;  2F0S A;  1T5E A;  2DJG C;  2R93 G;  1EFI D;  5E1F A;  1JJ2 A;  1L1O A;  3T1H Q;  1BR9 A;  1JR0 D;  3SGI A;  5HUR A;  3GTM B;  1SXT A;  3RMH A;  2UUC L;  2A1A A;  3KJP A;  2AUK A;  2IJ0 A;  4MN3 A;  1PFN A;  2UXD L;  1HZA A;  2PYK A;  4YWM A;  1HA6 A;  1Z7T A;  1SYB A;  1FNU A;  4NXM L;  1CQF A;  2F0E A;  3TP6 A;  1HZC A;  2K32 A;  5ISR A;  4B3S Q;  5LL6 X;  3PIO 3;  1F9R A;  1G91 A;  1EY4 A;  3I4N B;  1LO5 D;  2WIN B;  3CCR A;  1PVO A;  1CKN A;  4AQY Q;  3I4M B;  4PMC A;  3CCE A;  1EY5 A;  4DV1 Q;  5EKL A;  1GUT A;  2VQF Q;  3UE1 A;  2WAC A;  4K6L A;  3PO2 B;  2O5I C;  5FLX c;  4A3C H;  1MGS A;  1SSO A;  1VF7 A;  2K01 A;  2F0H A;  4IAL A;  1QB5 D;  4X66 L;  1BBU A;  1I4P A;  1HNZ L;  1C48 A;  4A3I G;  2IX0 A;  2KOL A;  1Y14 B;  4C3H B;  1KDB A;  4RAU C;  2R7Z G;  2PQA A;  1KAB A;  4JBK A;  1ROD A;  1KHI A;  1X65 A;  3BDL A;  3S14 B;  3BS1 A;  2YV5 A;  5C3E G;  3CCU A;  3I90 A;  3AQQ A;  5C0X I;  1BCP D;  2C5C A;  3HOX B;  4KTA A;  1IXR A;  1AEX A;  5I4D A;  4ODG A;  5FJ8 G;  2HQL A;  1FD7 D;  1LTR D;  4LW1 A;  1ICF B;  2WFW A;  4N8F A;  4M1U B;  2IHF A;  3K6O A;  3H3V I;  1D5X C;  2BDN A;  4GOP C;  2F0T A;  3GO5 A;  2OWO A;  4DV5 Q;  4LFC L;  4L63 B;  2NN6 G;  1R4P B;  2IWH A;  2RVL A;  1N36 L;  1KAW A;  1PZK D;  3S24 A;  1VQM A;  2SNS A;  4L8J A;  1ZEQ X;  5CBE E;  4QIW E;  4P2C B;  4FO2 A;  2E5L L;  4A3G H;  2K05 A;  4KY7 A;  4HCS A;  4CHT B;  2MGS A;  3A56 A;  4KHZ A;  4K8J A;  3TS2 A;  1MD2 D;  4OWX B;  3V2T A;  1WD1 A;  1Q1B A;  4ZKB B;  1XNQ Q;  2MQH A;  2K5V A;  4CDD C;  1LTI D;  4X62 Q;  1NR2 A;  4GKK L;  4G4K A;  1TT2 A;  4K0K L;  3J80 E;  2EJF C;  3BDO A;  5EPL A;  3NUC A;  3SDZ A;  2PNR C;  1OXX K;  4YCU A;  4PZ6 A;  4DV6 Q;  1KAA A;  2Q8T A;  1RIP A;  4LK1 C;  2ID0 A;  1DXM A;  4P75 A;  4DNR B;  3MXP A;  3JAM L;  5CV7 A;  4ZK9 B;  5E4W C;  5A2Q E;  2MFI A;  3PV0 A;  1EIH A;  3ER0 A;  5BN4 A;  1U4M A;  4IO9 A;  1VQA A;  4RCO A;  2RQX A;  4BA1 I;  3KK7 A;  4EQP A;  2F0P A;  2UXB L;  2UUB Q;  3OSO A;  3K5N A;  2N88 A;  1SN8 A;  2E2J H;  3OOC A;  4FXK C;  1GUN A;  3QO2 A;  5A2Q L;  3GP7 A;  3KF6 A;  3HOW H;  2H5X A;  5C3W A;  1BF4 A;  4X64 L;  4JV5 Q;  1KD1 C;  3HEJ A;  2NN6 H;  4DAV A;  4POG A;  1JOQ A;  1YNN D;  3AB9 A;  4LUO A;  1PH6 A;  3MXN B;  3P7J A;  5D14 A;  3STB C;  4GKJ Q;  2H4O A;  2KCM A;  2JXM B;  2XSC A;  1CA6 A;  5A35 A;  4JBJ A;  4H44 C;  5KRU A;  1ILP A;  3G6J B;  3S1M H;  2NTT A;  4YWL A;  4PZ8 A;  2O5J C;  1KIX A;  5JVH 3;  2NVX B;  2V1C C;  2JE6 I;  1ZYR C;  3R2I A;  3TSS A;  3U50 C;  3IFD A;  4BBR H;  4DAY B;  1LLR D;  1N34 L;  5AFW A;  1AZP A;  4G7O C;  2C35 B;  4LF7 L;  3HFZ B;  4DR5 L;  1FR3 A;  5JJK A;  1I94 Q;  4QUF A;  2J0T D;  3TS0 A;  3D4W A;  4P72 A;  1BO0 A;  4OIJ A;  2L55 A;  3NQI A;  1QUQ A;  5DNF A;  3C1E A;  1HTL D;  1NMG A;  1MSH A;  5FLX E;  1CK1 A;  2D0P A;  3CP0 A;  2JYO A;  2A6E D;  2EQS A;  3OMC A;  1MJC A;  2Z9H A;  5EKI A;  2VNU D;  3NQT A;  5IP9 H;  1J5E Q;  4FF2 A;  3P75 A;  1PTO C;  1B3A A;  3J7Z C;  1A63 A;  3FP9 A;  5FOB B;  3PO2 G;  2EYL A;  4RCN A;  4DKA C;  2EPB A;  3I4M G;  2A6E C;  4Y7N H;  2AWN A;  2JA7 G;  1G29 1;  1SRO A;  4EQO A;  3C3L A;  1STB A;  2CH4 W;  1VDZ A;  1VMP A;  1EQQ A;  1NNX A;  1VQ9 A;  2F0J A;  4QF4 A;  4OWW B;  1BDO A;  1OO9 B;  4RH6 A;  2L15 A;  3ULJ A;  1N34 Q;  5M5X H;  1O80 A;  4JI1 Q;  3EA6 A;  1I4X A;  3GTG B;  2KJX A;  5AJ3 L;  1C8C A;  1VQ4 A;  3S1N B;  1JB7 A;  5GAE C;  4LFB L;  2EY5 A;  4XDX A;  3UDG A;  3TME A;  2IT1 A;  4RGM A;  1C9O A;  1E2W A;  1PTO D;  2MUY A;  2VUM B;  1IYU A;  4EQN A;  5C4J B;  2JA5 B;  3LWE A;  5T1I A;  4FDB A;  3TZD A;  3OIP A;  3TRE A;  3KDF A;  4WRD A;  5EJW A;  3X3M A;  2CVR A;  1F9S A;  2IHE A;  2GA4 B;  5HGQ A;  4R8I A;  4OON A;  4B08 A;  2SEB D;  1I5F A;  3HOY G;  4PMW A;  1Y1W G;  1ET9 A;  2DGY A;  2CKZ B;  3RR5 A;  4HID A;  4IOC A;  1LT5 D;  4NB3 A;  2A68 C;  2IY5 B;  1HPC A;  4ILW A;  2CW0 C;  2J4X A;  2N55 A;  3U58 A;  5JEA H;  1CKO A;  5D65 A;  4JI6 Q;  4H13 C;  2ASB A;  1SNM A;  3GTP B;  4C2M H;  3CPW A;  1VQE A;  5IP9 G;  2IW3 A;  3E9H A;  1VF5 C;  2K6A A;  3VYU A;  1G6Z A;  2EXZ A;  1NBW A;  2WAQ B;  4GLX A;  1SFO B;  3SVM A;  1WYD A;  3FPP A;  5IT9 c;  2LXJ A;  2F0W A;  2MJ8 A;  3E3X A;  3S15 H;  4QQB X;  3L9A X;  1O7Z A;  3H91 A;  2L9H A;  4Q5V A;  2Y0S B;  4APV A;  4GN3 B;  1IBL Q;  2B2U A;  2I5H A;  2JEA I;  4FXG C;  3RUZ A;  2XTI A;  5EPJ A;  1QIL A;  4R4C A;  1SBB B;  3HOU G;  4A93 G;  1IBK L;  1B53 A;  2FFK B;  4L5R C;  4HR7 B;  2BA1 A;  3I3C A;  1EYD A;  3ND8 A;  5M5W H;  1K8G A;  3UI2 A;  3M85 A;  3M4O B;  2FMC A;  4FP5 D;  2E5L Q;  3A8K E;  3OTO Q;  1J8I A;  2Q2I A;  2QGQ A;  3E0J A;  4JCV E;  3L2P A;  3DWA A;  1EQR A;  5TSS A;  4A3E H;  4B9X A;  2JJQ A;  3BYY B;  2K5H A;  1B2T A;  3I4O A;  1FGB D;  1FYC A;  4DK3 C;  1CSP A;  2XN9 C;  4DNI A;  4GKK Q;  2EJM A;  3AU7 A;  2HIX A;  5IOD A;  5J3B A;  2XGT A;  2AQ2 B;  4LWC A;  2Q2T A;  5G3L D;  3URY A;  3GDE A;  1PV4 A;  4KN7 C;  4CBV A;  4A4I A;  4OEM B;  3PF4 A;  2N8N A;  2QW7 A;  1V9P A;  4IUQ A;  1BCP C;  5EAY A;  1XPU A;  2KBN A;  1I6H B;  1TWG B;  3G48 A;  3H0G B;  1YHA A;  3T4A C;  1YNX A;  2Z6B A;  2B2T A;  4KD3 A;  1LYL A;  4HCE A;  4J8Q A;  5DLQ E;  3S15 B;  4JI4 Q;  5C4J H;  2CW0 D;  2F52 A;  1KNE A;  3OWF A;  5DM7 3;  3H15 A;  3FRP B;  5L37 A;  1Z6H A;  1MIU A;  2JSO A;  3RNU A;  1EY7 A;  2R92 H;  2A74 C;  3UDI A;  1K8M A;  3R8B A;  1AFP A;  4ZYS A;  2K14 A;  1RTO A;  1VQN A;  2EYM A;  1ZXT A;  4B3S L;  1PXU A;  2NN6 I;  4A3J G;  3D31 A;  4HN7 A;  1Q12 A;  4DV1 L;  5C3E B;  3A0J A;  4O42 A;  3T53 B;  1SJE D;  4HSV A;  4HED A;  4C2M B;  3GV6 A;  2QEX A;  1DGS A;  4DR3 Q;  2UU9 L;  1NR4 A;  4Y7N B;  2MPM A;  2O2L D;  4FF4 A;  3RLN A;  1XMO L;  4QY7 A;  4JBM A;  2JA8 G;  4KKS A;  5C44 G;  1SYG A;  2Z6K C;  3PUV A;  2BCO A;  3FMC A;  1NUC A;  1GUG A;  4RGN A;  1S5E D;  2EYH A;  2E75 C;  4ME5 A;  4A3E G;  1SYD A;  1K8A C;  1DYQ A;  3G4S A;  4TRD A;  2F0M A;  4ZKC B;  1OTC A;  3NTK A;  3NEN A;  4V0B A;  1W6K A;  1VQ6 A;  4WFN 3;  1RF2 D;  1M1K C;  2VUM H;  3TEH B;  3FHW A;  3VR5 A;  4OO1 H;  2A73 B;  2F3I A;  1I3Q H;  1FNW A;  1CM9 A;  4XIG S;  1R9T B;  1SYF A;  2GVB A;  1B7Y B;  1PZJ D;  1PH4 A;  3VR2 A;  2K33 A;  1N8R C;  1HNW Q;  4QCL A;  1HHV A;  1ICW A;  2YU9 H;  4H02 A;  4A3I H;  4A3M B;  2NWG A;  4YY3 Q;  3GTO B;  4DUZ L;  3OW7 A;  4ZQ3 A;  2NBF A;  2WAQ E;  3CMA A;  1QVC A;  2NVT B;  4NMZ A;  1NMF A;  4UP7 A;  1PH1 A;  1X3F A;  2OTJ A;  5C3E H;  5CMD A;  4C3H G;  1QVF A;  5IT9 L;  3HOV B;  4E6I A;  1BCP B;  1AH9 A;  3L0O A;  4A3J H;  3ERS X;  3L3O C;  1Z9F A;  4NKL A;  2C9O A;  4DR5 Q;  2CWA A;  2WAQ G;  3CCM A;  4HSP A;  4ZUI A;  4JI0 L;  1ET6 A;  3BVZ A;  4LFA Q;  4DV4 L;  5COY A;  1KQS A;  3T1Y Q;  5J22 A;  3H0G H;  3HRZ C;  5C0X J;  1I6H H;  1F2Z A;  1VQF A;  1S5C D;  3PF5 A;  2UXC Q;  3HOZ B;  1Q46 A;  5C44 H;  4JI3 Q;  1EEI D;  3KF8 A;  4JC0 A;  3S2D B;  1X3Q A;  1FJG L;  1B70 B;  3KUP A;  4IUP A;  3T13 A;  1UEA B;  2K50 A;  1WTW A;  2ZT9 C;  3DEP A;  4IN3 A;  4JW0 A;  4C1N K;  3CCV A;  1XWE A;  1B44 D;  1QE6 A;  3P20 A;  5IGD A;  2NVY B;  3VYR A;  2K5D A;  1LTB D;  1UE1 A;  2EXD A;  4IQZ A;  1QUQ B;  3S1M B;  2RCF A;  1OXS C;  3ULP A;  5IOC A;  3SHL A;  1XMQ Q;  1SRU A;  2XRS D;  1PRT D;  5I9P A;  1H9K A;  5M3F G;  4YCW A;  3K81 C;  4YHH L;  2IX3 A;  1TS4 A;  1LTT D;  1WFQ A;  1F2M A;  4A3G G;  2HDM A;  5M5W B;  4RHS A;  1E2Z A;  4H7B A;  1J9O A;  4JOI A;  3A5U A;  1WCM G;  1N36 Q;  1D8L A;  1PHJ A;  1W3S A;  4UPA A;  4A3B H;  4U68 A;  1K3B C;  4DV5 L;  1I4R A;  4DGZ A;  5BR8 L;  4C56 C;  4LF9 Q;  3K58 A;  2PQA B;  4DA2 A;  4HJA A;  1L2F A;  3DXJ C;  1SFO H;  1STE A;  4IPC A;  2YYZ A;  3PSI A;  2F1M A;  1GUO A;  3PUZ A;  5ELE A;  5G3L F;  5GAG C;  2KCT A;  3ND9 A;  1B9N A;  2ZM6 Q;  1PA6 A;  1K28 A;  2B39 A;  2WKC A;  5GAH C;  1PFM A;  2EYP A;  3M7G A;  3T16 A;  2XIW A;  2LXK A;  1VS0 A;  4AH6 A;  1L0W A;  1F9P A;  2E2D C;  1G2T A;  1F77 A;  2JQO A;  2KQ3 A;  1F9Q A;  4JG2 A;  4KKU A;  5M3M H;  2OQK A;  1YHB A;  4HIK A;  3C1F A;  4G7H C;  1WTO A;  4IFD J;  2A5H A;  1D6E C;  1VQJ A;  4POF A;  2WKD A;  2F0O A;  5M3M B;  2JP1 A;  2SOB A;  5D3D A;  4JI3 L;  2I0Q A;  4JI6 L;  5CV6 A;  2AHO B;  2ALY B;  2EY6 A;  2JA6 H;  1A62 A;  4X66 Q;  1YIJ A;  1S40 A;  1XPR A;  1QCB D;  1BOS A;  4WJW A;  4IUR A;  1YBY A;  5FLM G;  4A3E B;  4JI5 L;  4FXD A;  3K7U C;  3M4P A;  3IAY A;  1I50 B;  2Z1C A;  1JWU D;  1KRT A;  5FKA C;  4K0K Q;  3NE5 B;  3F2B A;  4P73 A;  1ESR A;  1S72 A;  3S1N H;  1HRJ A;  1WTX A;  3PO3 B;  3KJO A;  1ESF A;  1YZ6 A;  2E8G A;  3TBI B;  4DK0 A;  3S9W A;  4J1M A;  3KDF B;  4FF1 A;  1LTA D;  5C44 B;  4IJH A;  1SMY D;  2F0D A;  2HCC A;  2BA0 A;  5T1G A;  3RZD B;  1QOH A;  2QF7 A;  1R4Q B;  5LMN Q;  1A0I A;  5C3X A;  3BZD B;  2X6L A;  2F03 A;  1K3R A;  1GM5 A;  3DMU A;  1C4Q A;  1IW7 D;  2MP1 A;  4AIM A;  4G7Z C;  1YJW A;  1XJV A;  4YWK A;  1JWS D;  4Y52 H;  5M9O A;  3D0F A;  4KY5 A;  1TWH B;  4A3M G;  1PYS B;  2EY1 A;  4JVZ A;  4EX5 A;  5BN3 A;  1O7I A;  2NZO A;  4GLA C;  3JAM c;  2E2H H;  4OXP A;  2K5N A;  3TZU A;  3NWT A;  1JE5 A;  3F2C A;  1ML0 D;  4BBS H;  1EEF D;  3HKZ G;  3PO2 H;  3K0Y A;  1JIC A;  2EJG C;  2NB0 A;  2JA7 H;  2OEO A;  3M4Y A;  4NXN Q;  1BCP F;  4AYB B;  2K28 A;  2PW7 A;  4HTH A;  1J5E L;  1EY8 A;  4UY8 C;  1VQG A;  3OPO A;  2R7D A;  1CA5 A;  3CCJ A;  3CXC A;  3ONA B;  2F0U A;  1EY0 A;  3TQY A;  4Z9C B;  1R9T H;  5K36 H;  3OYY A;  1I3Q B;  2IPK D;  3U9O A;  5EBC A;  5JJZ A;  4OL7 A;  2YTX A;  1LTL A;  3T1H L;  3HOZ H;  3H94 A;  2F0I A;  4IPD A;  2QA4 A;  3GD7 A;  2Q2H A;  4R4O A;  5DM6 3;  4FNF A;  4UHV A;  4EGV A;  1HNW L;  1PZI D;  1U4P A;  1GHJ A;  3A5Z B;  1X3P A;  3CC4 A;  2DY7 A;  1SE2 A;  1Y8P B;  4LF6 Q;  5CYU A;  2LFN A;  1JOK A;  4O0A A;  3HOW B;  1EL0 A;  5LMN L;  3I2Z A;  1RL2 A;  5IY0 A;  3GTG H;  3HOV H;  3VDY A;  1QWY A;  3F8T A;  2Y0S G;  2CQA A;  3I73 A;  4F8M A;  1EWC A;  4R8N A;  2NTS A;  4DR6 Q;  3MWY W;  1EU4 A;  3A74 A;  4K8I A;  3MFG A;  5GAD C;  3M4Q A;  1ZKO A;  3NTI A;  2JA9 A;  3C2P A;  4ULL A;  1SMY C;  3V96 A;  3CCL A;  1LT6 D;  2UUC Q;  3NWS A;  5KND A;  4A3M H;  4A3I B;  1HQM C;  1VQD A;  1MJE A;  1BNZ A;  3FPU B;  2DJF C;  1Q3L A;  1STY A;  4KD4 A;  4X3S A;  2ZTD A;  1E0B A;  4FYD A;  3BU2 A;  1TXY A;  2K7V A;  4DV3 L;  1S5F D;  4JI5 Q;  3CAM A;  5I2X A;  1TWF B;  1WOC A;  2BH2 A;  3KBG A;  3CC2 A;  4BXX H;  3PUY A;  3QOL A;  2VB3 X;  1VCI A;  3Q0A A;  1HFG A;  1EUJ A;  1PH7 A;  5C4X G;  5BN5 A;  2HD3 A;  2F0L A;  2HCI A;  2DN8 A;  1UAP A;  1SEB D;  4LFA L;  4A3L G;  4L5T A;  4DR4 Q;  1SAP A;  1V1O A;  2XVS A;  4HJ5 A;  3H3V H;  1A8V A;  1DOM A;  1AE2 A;  5JJI A;  5K36 G;  1D2B A;  4MTN A;  4DV6 L;  4A93 H;  4MIU A;  4C3I H;  4K5X A;  4JYA L;  4LF4 Q;  2B63 G;  2NVX H;  3M7N A;  1Y1V G;  2Z0S A;  5IIF A;  4UAI A;  4K6D A;  5HY6 A;  2UU9 Q;  2L4N A;  1Y8N B;  3W1G A;  3Q23 A;  1RTN A;  4X65 Q;  4A3K B;  3DEO A;  1OXV A;  2RF4 A;  2PMZ B;  4B3M L;  4Q0F A;  4KV6 A;  3STB D;  5IGE A;  2LMC B;  2MHV A;  1Y1V B;  1TWH H;  4K2L A;  5HGT A;  1XNR Q;  3I91 A;  3FEW X;  2SDF A;  4KHV A;  4MHE A;  2B2W C;  4KHP L;  1II3 A;  4O2D A;  3K80 C;  3P1H A;  1XX8 A;  4ID6 A;  4R4Q A;  3S1R H;  3TRZ A;  2FMM A;  4J6H A;  1XPO A;  2CHB D;  1XNR L;  5IYC H;  4DV7 Q;  2F4V Q;  3V05 A;  1LV9 A;  3D6C A;  1UUP A;  3RZD H;  1TWG H;  1UE6 A;  1B9M A;  1NAP A;  4NPS A;  2KEC A;  2EE1 A;  3SK8 A;  4YHH Q;  4ZUJ A;  3KLR A;  2PZU A;  4R1J A;  2G9H D;  2HHH L;  3NXW A;  1B8A A;  2DY8 A;  3CRL C;  2BE5 C;  3H6M A;  4DUY Q;  4V19 0;  2R61 A;  3PO3 H;  4RG1 A;  5JOB A;  5C4Z A;  1TS2 A;  2HUG A;  4DN4 M;  2R92 G;  4K2K A;  2ENB A;  4KK7 A;  3PQI A;  4FVM A;  2J7Z A;  1I50 H;  1D5M C;  2ZM6 L;  3GTP H;  4GOP A;  1KC8 C;  1EZ6 A;  1S5D D;  2UXB Q;  5I2Y A;  3AEV A;  4A3L H;  1S4Z A;  2K5Q A;  3I4N H;  4X3U A;  1F2L A;  1STH A;  1BKB A;  2UXC L;  5BR8 Q;  5E7N A;  2VUM G;  4DR7 L;  5AJ3 Q;  4X3T A;  2LSS A;  2R7F A;  3EBE A;  4UP8 A;  4JBW A;  2HQE A;  4MNO A;  3CF5 A;  1PMR A;  5IP7 H;  5CC4 A;  5CV8 A;  5KYL A;  4DV3 Q;  1Q8I A;  1EQT A;  2MNA A;  1HXY D;  1IBL L;  2A19 A;  3A7L A;  4QUC A;  5DAU A;  3ERQ A;  4MZ9 A;  2K04 A;  4HIM A;  2JA5 H;  1G2S A;  3AFP A;  2K4K A;  4CKC A;  2ZXR A;  3D4D A;  1M8A A;  5IGG A;  1X55 A;  1DD2 A;  2H1E A;  1OXT A;  3NBH A;  5CV4 A;  3PUX A;  4HIO A;  2JEB I;  4OO1 G;  1X3G A;  3J7A 5;  3G6E A;  5M5X B;  3EVQ A;  3HKS A;  2JA8 B;  1IBM Q;  3WWV A;  4B9W A;  3EIV A;  4IJL A;  5LL6 S;  4B3R Q;  1YNN C;  2Z4H A;  5LMN W;  1RCV D;  3NBH B;  3KFU A;  1E22 A;  2A68 D;  1CKN B;  1D5Z C;  1D1I A;  1MHW C;  4DV4 Q;  4C3H H;  5FO9 B;  3C46 A;  4JI2 Q;  5ELD A;  2N49 A;  1KRS A;  1MI2 A;  1CUK A;  3BVG A;  3TP5 A;  3E5S A;  5F2D A;  2KCC A;  4I65 A;  1IYV A;  3E6Z X;  2EYF A;  2I5M X;  1I4G A;  5C0X H;  4GKJ L;  2FHT A;  3HOW G;  1PLF A;  2MO1 A;  3CCS A;  1L1O C;  2WB1 G;  1ONL A;  4LF8 Q;  3B6Y A;  3H0G G;  2B8G A;  1CHP D;  2ICI A;  1YIT A;  1MKH A;  4KJO A;  1VQC A;  4LUV A;  3NP8 A;  1Q90 A;  4AYB E;  2EIF A;  4CGY B;  3S2D H;  2XRQ D;  1ASZ A;  4BA2 I;  1SJH D;  2DUD A;  4M8A A;  5FO8 B;  1FL0 A;  1WCM H;  3DM3 A;  1Y69 U;  1PH9 A;  4RKB A;  3AMU A;  2WB1 B;  4JI1 L;  1S3O A;  2WB1 E;  3K5L A;  4BBR G;  1OXU A;  2L0C A;  3SE0 A;  3IFT A;  3D8G A;  1QJO A;  1NTG A;  3I7F A;  1H9S B;  1SDF A;  3HKZ B;  1YI2 A;  1HNX L;  4QJF A;  5JVG 3;  4AYB G;  3BVM A;  1QZG A;  2I07 B;  2FXQ A;  3K7A B;  3WDN A;  4A3J B;  1JMC A;  4O1N A;  3VR4 A;  3SEB A;  4R9W A;  1TWA B;  1VQI A;  2E2J B;  2VS1 A;  2L12 A;  3G71 A;  1STA A;  5IE8 A;  1ASY A;  4HJ7 A;  4A3D B;  4NDX A;  2VW9 A;  1EOV A;  4JI7 L;  1N33 Q;  4JV5 L;  4LF8 L;  2KHJ A;  4ZCK A;  3R93 A;  3ZYY X;  1SMX A;  4X62 L;  1H9S A;  2E76 C;  1GUS A;  1PRT B;  1RKN A;  4LF7 Q;  2NZ1 D;  2NUC A;  3BZC A;  1KL9 A;  3M3Y H;  2R7Z B;  3W1B A;  3A55 A;  1VQK A;  1BXT A;  4RFB A;  5DEH A;  5ELC A;  4LFB Q;  1EU3 A;  4CDE C;  4QL5 A;  4KMU C;  4DAM A;  4JI2 L;  2F0G A;  2JA6 G;  4CJ1 B;  5FLX L;  2QDL A;  3KLS X;  4ME3 A;  1TY2 A;  1Q8K A;  3UDF A;  5I6Y A;  4A76 A;  1FGU A;  1K9M C;  1YEZ A;  1GO3 E;  5IGB A;  5CV5 A;  4RGO S;  4DAY A;  1JOR A;  3GTK H;  2LY7 A;  3J80 i;  1E2V A;  1HUM A;  1Q82 C;  1HR0 W;  2L11 A;  3FKI G;  1PH3 A;  4A3G B;  1DOL A;  2KHI A;  4XT1 B;  3MEH A;  4BS9 A;  2ZTC A;  2ZJP A;  2PNH A;  5KGU A;  4DUY L;  5E4X A;  4DF7 A;  1Y1W H;  1CTM A;  2X6G A;  5ELB A;  3BDC A;  4R4I A;  3K8A A;  5JPM C;  2AUJ D;  3KF6 B;  4IUV A;  1ENC A;  4OGQ C;  1HNZ Q;  2K52 A;  4KI0 A;  5JEA G;  4RKL A;  2K1B A;  4RMF A;  1X56 A;  4PMB A;  5J1Z A;  2R92 B;  1SYE A;  4F88 A;  3K5M A;  2EYJ A;  1M4V A;  2DNC A;  4IUT A;  4DFA A;  3HOX H;  4CDF C;  3SK4 A;  3UE0 A;  3IRB A;  4N9T A;  3KF8 B;  1V1P B;  1GKH A;  2PZT A;  1TQO A;  5KIX A;  3S14 H;  3DLL A;  2CQO A;  4HAE A;  1JOO A;  1H9M A;  1PTO F;  3I70 A;  3BG3 A;  4RHR A;  4C3J G;  5IWA Q;  1I4Q A;  4DK6 C;  4B3T L;  2I5L X;  1QG7 A;  1J6Q A;  1LT3 D;  3KLS A;  5IYB G;  4DV2 Q;  2PMZ E;  4X3K A;  4S3S A;  4C3J B;  4JPB W;  2OTL A;  2QDB A;  4NP5 A;  4B3T Q;  3W3A A;  2ZXO A;  2OT2 A;  4LMQ D;  2OQ0 A;  4LNQ A;  1B50 A;  2RKS A;  4KJN A;  3HOU H;  3NTH A;  2NVQ H;  5EQ0 A;  4UDU C;  3I8Z A;  3J80 L;  1NE3 A;  1EYC A;  2BDO A;  1CHQ D;  4BWG B;  1LUZ A;  1EQV A;  1IKL A;  1FVI A;  4A3K G;  3NEL A;  3I56 A;  1RD9 D;  3H09 A;  2FIN B;  3HKZ E;  3M4O H;  3FKI H;  1EZ8 A;  4WOR A;  4LF6 L;  5EKK A;  2R93 B;  2RHQ B;  4JI0 Q;  2F0K A;  2A6H C;  4AQY L;  4QGU A;  1T9H A;  3DM1 A;  4TVA B;  3VA7 A;  4GNX A;  2LKV A;  1UWV A;  2EYO A;  1A2U A;  1PRT F;  2IX1 A;  2PZW A;  4H0L C;  2Y0S E;  2PO4 A;  3HOZ G;  1JCK B;  1ZYR D;  1VQL A;  1XMQ L;  5CGK A;  5C4X B;  2F3V A;  4DR2 Q;  4L5S A;  1PTO H;  3DUZ A;  5CV9 A;  4CJ2 C;  1SND A;  2AQ1 B;  1M90 C;  4XQJ A;  3SK5 A;  3O13 A;  4R4T A;  1TWC H;  4XXE A;  4L5Q A;  3BJU A;  1N33 L;  3ITP A;  1EOT A;  1NJI C;  4LF9 L;  5IGC A;  1TS5 A;  4GNX B;  1AW7 A;  4ZLT F;  3GTL B;  5FO7 B;  1E3P A;  2A6H D;  2OXP A;  1A6X A;  2RBM A;  1HUN A;  2FJ2 A;  1U5K A;  1WI5 A;  3EQL C;  1U9R A;  3I4M H;  4ZAI A;  4DV7 L;  1TKW B;  5IYB H;  3GTJ B;  4DXF A;  3PIP A;  1I94 L;  2ZTE A;  4PQX A;  5GQO A;  1UNS A;  2PI2 E;  3TDQ A;  1BQQ T;  1A3T A;  2G9D A;  4TSS A;  2KED A;  4U67 3;  5ELO A;  4A3D G;  4C3I G;  1GOZ A;  1STG A;  1HH2 P;  4PV1 C;  2B63 H;  4K5W A;  1B4O A;  3K57 A;  4OX9 Q;  3AYH B;  4JI7 Q;  2F0N A;  2M00 A;  3K5O A;  3GTL H;  1O7Y A;  1K0S A;  3GTM H;  4JI8 Q;  1O78 A;  3CME A;  3RN5 A;  1CT1 D;  4OEL B;  1TWC B;  3X3N A;  4DR6 L;  2YTV A;  5IT9 E;  4N8X 1;  1HZ9 A;  2KCN A;  3ERO A;  1Y8O B;  2HDL A;  4IPH A;  3W2D A;  1SNO A;  5I9O A;  1IYJ B;  4OO1 I;  1GVP A;  1RHP A;  2VXW A;  4IUN A;  3RZO B;  4A3F H;  3MA2 B;  4EVO A;  4GNX C;  3KOJ A;  1KNA A;  2A8V A;  1EY9 A;  1E7Z A;  2B2V C;  2TSS A;  4QB4 A;  1PFB A;  1YNJ C;  4DV0 L;  2MO0 A;  5C6A A;  4GOP B;  3E9I A;  1SR3 A;  4BY1 B;  1UE5 A;  2EDG A;  2ZXP A;  1K8O A;  4F87 A;  3MC0 B;  1SNP A;  2VQE L;  2N3S A;  3OHX C;  4NXM Q;  4X64 Q;  2QIL A;  1TY0 A;  1YNJ D;  4XYQ A;  1PYB A;  5JEA J;  4ABN A;  3RLO A;  5KYI A;  3SXH A;  2D5D A;  2F0F A;  3J81 j;  4DNT B;  4PG3 A;  3U9S A;  2AKW B;  1A3V A;  4MTK A;  3RLF A;  1QNK A;  2NYZ D;  4YY3 L;  1ENF A;  4CKE A;  1U0L A;  1P16 A;  1XXG A;  5IYD H;  4BBR B;  2AWO A;  1KXL A;  1LT4 D;  3NSW A;  1L1O B;  3QJY A;  1PTO B;  5EPK A;  1DOK A;  2K03 A;  2F0Q A;  3MFY A;  1EIY B;  4P71 A;  1TR5 A;  4DR7 Q;  3K0X A;  3PIO A;  1IW7 C;  4OIK A;  1K83 B;  3CPF A;  3S17 B;  2RA4 A;  1S5B D;  1A2T A;  3EFX D;  1H9J A;  3S1Q B;  1K73 C;  2CWP A;  1PFS A;  1V43 A;  4GLV B;  3VR6 A;  1JC7 A;  1N32 L;  4UP9 A;  1EIG A;  1W6J A;  2R93 H;  3VYT A;  1EIF A;  5CBA E;  3MVV A;  1CFM A;  3I4N G;  2E2I B;  1PH5 A;  2CH4 A;  1HJP A;  1WVL A;  3ULL A;  3Q22 A;  3D4R A;  3J81 E;  5J39 A;  5H1S E;  4DR1 Q;  1I4H A;  2G5D A;  5C5L A;  4A3F G;  1SNC A;  3J7A F;  2E74 C;  3HOY B;  5M5Y H;  3MXN A;  3IL8 A;  5M3F H;  1SNQ A;  3TN2 A;  2AQ3 B;  3BYT B;  4NXN L;  1K0R A;  4JOI C;  4DR1 L;  3L7Z C;  1PH2 A;  3HOU B;  1K83 H;  2WV6 D;  3S17 H;  4RA8 A;  1EYA A;  3NPP A;  3KLW A;  5GRO A;  2D0O A;  1XNQ L;  5C5M A;  3I55 A;  4I7A A;  1TII D;  2K75 A;  3VR3 A;  1Q86 C;  2B2V A;  2KEE A;  2LS0 1;  2B29 A;  3N6R A;  3J81 L;  2JA5 G;  1H95 A;  2VQF L;  1IKM A;  1SLJ A;  2RHS B;  3MXG A;  1D1K A;  2ZJR A;  3DWP A;  1TS3 A;  4LF5 Q;  1STN A;  4A3C G;  1D7Q A;  3A8I E;  4XQN A;  4LJZ C;  1T5X D;  1HCZ A;  2RCN A;  3HZX A;  4GN4 B;  3U4Z A;  1X9N A;  4DPG A;  1MBY A;  2P5Z X;  5C0X G;  1KLU D;  5IYD G;  3K59 A;  4L6T B;  4XYO A;  1HR0 L;  1KDA A;  1G51 A;  2R7Z H;  4IOA A;  4JK1 C;  1X32 A;  2B2U C;  2X69 A;  2XNA C;  3A7A B;  3MXU A;  3QG1 A;  1EFW A;  5COR A;  2HIV A;  2RDG A;  4TQU S;  3PMF A;  1BVS A;  1Y1W B;  1EYG A;  1WTH A;  2TMP A;  3QB3 A;  4PNY A;  2HT1 A;  2V4D A;  4IUU A;  3G7L A;  4JYA Q;  5M3M G;  2QKI C;  5FJ8 H;  2BOS A;  5M3F B;  1DON A;  3S16 H;  1BUV T;  1KDC A;  1TWA H;  4LFC Q;  5JJL A;  1O7L A;  4FF3 A;  3PCO B;  1UE7 A;  1HZB A;  3OTO L;  2E2I H;  1HFN A;  4B3R L;  1VQH A;  4GZY C;  4C1N I;  4XTC S;  3RD4 A;  5FLM H;  1IBK Q;  2RDH A;  3UDX A;  4GS3 A;  2B63 B;  1FNV A;  4LUZ A;  2JN4 A;  1AN8 A;  4BY7 G;  1CZW A;  1Z47 A;  3NHH A;  1WD0 A;  4X65 L;  2UUA L;  1IL2 A;  3GQB A;  4DK1 A;  1GD7 A;  2B2T C;  3CD6 A;  2WP8 J;  1VQO A;  1G8Z D;  1H9R A;  3A54 A;  4DXG A;  1RDP D;  4YIJ A;  4DR2 L;  2RDF A;  1QZH A;  4PZ7 A;  2UUA Q;  2PPB C;  1X6O A;  3F1Z A;  1GHK A;  3GTJ H;  4CKB A;  4DR4 L;  2N78 A;  3JAM E;  3GTQ H;  4HJ9 A;  1XYI A;  5K5P A;  3U4V A;  3QOJ A;  2Z4I A;  4J15 A;  1B1Z A;  2VY3 A;  3MTS A;  2JK8 A;  3KBX A;  2R6G A;  4BY7 B;  1AZQ A;  3CQZ B;  5NUC A;  4CDC C;  1C7Y A;  1U4L A;  3QR8 A;  1BBW A;  2O4X A;  3OW2 A;  3Q24 A;  3MZ5 A;  1YJN A;  2WII B;  1DCZ A;  3J81 c;  1TVX A;  3CKI B;  1CI3 M;  3RN2 A;  1LM0 A;  2R3Z A;  3BZK A;  2CFM A;  1IBM L;  4JI4 L;  1JQY D;  1X3E A;  4G57 A;  2UXD Q;  3CC7 A;  2Z6K A;  1A3U A;  3R2T A;  1PH8 A;  1WTQ A;  1NY4 A;  5EGT A;  2ES2 A;  2B8F A;  4A3F B;  2D9U A;  1GJX A;  3HGB A;  1VQ7 A;  1G6P A;  1WTV A;  4WJ3 M;  1L0X B;  3FKI B;  1V1Q A;  3FDT A;  4TKO B;  2UUB L;  1HR0 Q;  1JT8 A;  1HTP A;  3PUW A;  3M9B A;  1YJ9 A;  4RWS C;  2D62 A;  1AE3 A;  1HQR D;  4A75 A;  1HNX Q;  1JJC B;  1WJJ A;  1W2B A;  2Q8R E;  5ELF A;  3DWQ A;  3CQZ H;  2D2C C;  4BY7 H;  3HS0 C;  4NW2 A;  3N52 A;  4OWT B;  2RSO A;  4K14 A;  2BH8 A;  1SE3 A;  3GTQ B;  3OMG A;  1V8Q A;  3J7A V;  3QWN A;  2JA6 B;  1VQ8 A;  3CRK C;  3CU7 A;  4A3B G;  2KEN A;  3HOV G;  4C3J H;  4B3M Q;  5D3I B;  2L5T A;  3PIP 3;  1B3Q A;  1HA5 A;  2PCF B;  1PRT C;  4DU9 A;  1A15 A;  3ICE A;  1PYW D;  1KLG D;  3JAM i;  4IFD G;  2I46 A;  4IZ8 A;  5IGF A;  3FVQ A;  3PGZ A;  1GXD C;  3HOX G;  4LF4 L;  2ATW A;  2PW5 A;  3SK6 A;  1MSG A;  2ZJQ A;  3DHQ A;  2GVA A;  1LTS D;  3J7Y W;  2XWJ B;  4XQQ A;  4DUZ Q;  5IWA L;  4I7Z C;  2B2Y C;  1P8L A;  3CHB D;  2F0V A;  4GN5 A;  4P74 A;  5KNC A;  1IL8 A;  2RSN A;  3AFQ A;  2EVB A;  3F2U A;  1E1O A;  3S2H H;  4QIW B;  3EN2 A;  3I4L A;  1SE4 A;  3S16 B;  5C4X H;  4LF5 L;  4A3B B;  1YHQ A;  3W5O A;  1E1T A;  1TU2 B;  1NCV A;  5E3F A;  4ALP A;  2Z8L A;  1XTD A;  3HOY H;  4KHP Q;  2QEJ C;  1IHZ A;  1L0Y B;  1WTP A;  2KHS A;  1CZG A;  4DAP A;  4HJ8 A;  5LHY 1;  3Q6S A;  1Y1V H;  1ILQ A;  2KVM A;  1NSN S;  1Q7Y C;  2PQE A;  3H3V C;  2A69 C;  2AMC B;  3T56 B;  4KN4 C;  4A3K H;  1JJG A;  1XMO Q;  3LWU A;  4OHJ A;  2Q8I B;  2HHH Q;  4DV2 L;  3S1Q H;  2NVQ B;  3NK9 A;  1DM0 B;  2B2W A;  2VZA A;  4LAA A;  1V1P A;  1I6V C;  2NVY H;  1CSQ A;  2F4V L;  5EBD A;  4X6A H;  2DNE A;  1VQP A;  1KTK A;  3LNN A;  4K5V A;  2QCP X;  3M3Y B;  1PDQ A;  1RJT A;  1WTR A;  2EY2 A;  2IL8 A;  1Q81 C;  1QVG A;  2BE5 D;  4IFD H;  5IYC G;  3GV3 A;  4BY1 G;  1Q1E A;  4XT3 B;  4RGT A;  2A69 D;  3F2D A;  3ZJY C;  3WOE A;  3T1Y L;  2Q2U A;  4A3D H;  2OCE A;  3HG9 A;  3IKJ A; 
#chains in the Genus database with same CATH homology
 2ZTD A;  3S15 H;  4QQB X;  2ZTE A;  4IPG A;  3BU2 A;  4BBS G;  1TXY A;  5GQO A;  2PI2 E;  3PO3 G;  4DV3 L;  4APV A;  4GN3 B;  4JI5 Q;  3CAM A;  1IBL Q;  1WOC A;  2I5H A;  3K7A H;  3CC2 A;  2BH2 A;  3CCQ A;  3PUY A;  5LMU Q;  2JEA I;  4BXX H;  2XTI A;  4R4C A;  5ELO A;  3HOU G;  1VCI A;  4A93 G;  1IBK L;  1PH7 A;  1EUJ A;  4L5R C;  4A3D G;  1IZ6 A;  3MEF A;  2BA1 A;  5C4X G;  1HH2 P;  4JI8 L;  1CKM A;  2B63 H;  5M5W H;  1K8G A;  3M85 A;  4OX9 Q;  4LFA L;  4A3L G;  1E24 A;  3AYH B;  4L5T A;  1X54 A;  4JI7 Q;  4DR4 Q;  4KLK A;  2E5L Q;  4HJ5 A;  3H3V H;  3GTL H;  1A8V A;  3OTO Q;  1AE2 A;  5JJI A;  3E0E A;  5K36 G;  2Q2I A;  2QGQ A;  3GTM H;  4JI8 Q;  2PI2 A;  1VQB A;  5ELN A;  4JCV E;  3L2P A;  4MTN A;  3CME A;  4DV6 L;  3RN5 A;  4A93 H;  3J81 i;  3RZO H;  4C3I H;  3GTO H;  4JYA L;  1EQR A;  4LF4 Q;  2B63 G;  1EWI A;  4A3E H;  2NVX H;  1UEB A;  2JJQ A;  2YTV A;  1SE8 A;  1Y1V G;  3M7N A;  1N32 Q;  2K5H A;  3I4O A;  2Z0S A;  2GN5 A;  1HZ9 A;  4DK3 C;  1C0A A;  1CSP A;  5HY6 A;  5IP7 G;  2UU9 Q;  4IPH A;  4DNI A;  1YVC A;  4GKK Q;  1IYJ B;  2HIX A;  2CCZ A;  4OO1 I;  1GVP A;  5J3B A;  3W1G A;  2XGT A;  4LWC A;  4A3F H;  4X65 Q;  1VQ5 A;  2Q2T A;  4WJ4 A;  3GDE A;  4EQ5 A;  4GNX C;  1OXV A;  3J80 c;  2NZH A;  3KOJ A;  1PV4 A;  2RF4 A;  4B3M L;  2VL6 A;  4A4I A;  2A8V A;  3STB D;  3PF4 A;  1E7Z A;  3LGJ A;  2N8N A;  1N9W A;  1V9P A;  5EAY A;  1XPU A;  4DV0 L;  2MO0 A;  1TWH H;  2KBN A;  1TWF H;  3G48 A;  4GOP B;  3E9I A;  1XNR Q;  1YHA A;  1SR3 A;  1UE5 A;  1YNX A;  4KHP L;  3Q8D A;  4O2D A;  4YCV A;  1LYL A;  3K80 C;  4R4Q A;  5LMU L;  5DLQ E;  3S1R H;  3TRZ A;  4JI4 Q;  5C4J H;  2VQE L;  2YTY A;  2F52 A;  1XPO A;  2N3S A;  1XNR L;  3KYH C;  4NXM Q;  4X64 Q;  3H15 A;  5IYC H;  4DV7 Q;  2B3G A;  4BY1 H;  2F4V Q;  1PYB A;  3RNU A;  1MIU A;  1FJG Q;  3RZD H;  2R92 H;  1TWG H;  1UE6 A;  5JEA J;  3UDI A;  4OX9 L;  4IFD I;  3RLO A;  4NPS A;  2VQE Q;  4YHH Q;  3J81 j;  2K14 A;  4PG3 A;  1VQN A;  4R1J A;  2AKW B;  4B3S L;  4DR3 L;  2HHH L;  2NN6 I;  4A3J G;  3D31 A;  1B8A A;  3JC6 6;  4DUY Q;  1Q12 A;  3RLF A;  4DV1 L;  3PO3 H;  4RG1 A;  3A0J A;  2JA8 H;  4YY3 L;  4DV0 Q;  2R92 G;  1U0L A;  1P16 A;  2QEX A;  4BXX G;  5IYD H;  3NEM A;  1DGS A;  4DR3 Q;  2UU9 L;  2AWO A;  1KXL A;  1I50 H;  1L1O B;  2ZM6 L;  3CW2 C;  3GTP H;  4GOP A;  1KC8 C;  2UXB Q;  3RLN A;  1EIY B;  2R93 G;  4A3L H;  4P71 A;  3AEV A;  1XMO L;  1JJ2 A;  4DR7 Q;  3K0X A;  4QY7 A;  3PIO A;  1L1O A;  4JBM A;  3T1H Q;  2JA8 G;  3CPF A;  3SGI A;  3I4N H;  5C44 G;  2Z6K C;  3PUV A;  1BKB A;  1K73 C;  2CWP A;  1PFS A;  2UUC L;  2UXC L;  1V43 A;  4GLV B;  2A1A A;  5E7N A;  5BR8 Q;  1N32 L;  3KJP A;  2VUM G;  4UP9 A;  4DR7 L;  5AJ3 Q;  4A3E G;  1K8A C;  2LSS A;  2R7F A;  2R93 H;  1EIF A;  3EBE A;  4UP8 A;  3G4S A;  4JBW A;  4MNO A;  3CF5 A;  1OTC A;  2UXD L;  5IP7 H;  3NEN A;  3I4N G;  1HZA A;  4YWM A;  1PH5 A;  1VQ6 A;  1HJP A;  4DV3 Q;  3ULL A;  5H1S E;  4DR1 Q;  2MNA A;  1IBL L;  2A19 A;  4NXM L;  1M1K C;  2VUM H;  4A3F G;  3TEH B;  3FHW A;  4MZ9 A;  2F3I A;  1I3Q H;  1HZC A;  4XIG S;  5M5Y H;  4HIM A;  2JA5 H;  4B3S Q;  5M3F H;  2GVB A;  1B7Y B;  4NXN L;  1K0R A;  3AFP A;  4JOI C;  3L7Z C;  4DR1 L;  1PH2 A;  1PH4 A;  2K4K A;  1K83 H;  3CCR A;  3S17 H;  1PVO A;  1CKN A;  4AQY Q;  3KLW A;  1N8R C;  5GRO A;  1X55 A;  2D0O A;  1HNW Q;  1XNQ L;  2YU9 H;  3CCE A;  4DV1 Q;  4H02 A;  1OXT A;  3I55 A;  4A3I H;  2VQF Q;  3PUX A;  4HIO A;  3UE1 A;  2JEB I;  2K75 A;  4YY3 Q;  4OO1 G;  4DUZ L;  1Q86 C;  5FLX c;  4A3C H;  1X3G A;  2WAQ E;  3CMA A;  1QVC A;  2B29 A;  3J7A 5;  2JA5 G;  1NMF A;  3G6E A;  4X66 L;  1H95 A;  1BBU A;  4UP7 A;  1PH1 A;  1X3F A;  2VQF L;  3HKS A;  2OTJ A;  1SLJ A;  2RHS B;  5C3E H;  1HNZ L;  2ZJR A;  1IBM Q;  3WWV A;  1QVF A;  4A3I G;  3EIV A;  2IX0 A;  4IJL A;  1AH9 A;  4LF5 Q;  1Y14 B;  4A3C G;  1D7Q A;  4B3R Q;  2R7Z G;  3L0O A;  2PQA A;  5LMN W;  4A3J H;  3NBH B;  4JBK A;  3KFU A;  3ERS X;  2RCN A;  1KHI A;  1E22 A;  1X65 A;  1Z9F A;  1CKN B;  4GN4 B;  3U4Z A;  4DV4 Q;  1X9N A;  4DPG A;  2YV5 A;  5C3E G;  2CWA A;  4DR5 Q;  4C3H H;  3CCU A;  2WAQ G;  3AQQ A;  5C0X G;  4JI2 Q;  5IYD G;  5C0X I;  3CCM A;  2N49 A;  1KRS A;  4JI0 L;  4LFA Q;  4DV4 L;  1HR0 L;  1G51 A;  1KQS A;  1IXR A;  1CUK A;  3T1Y Q;  2R7Z H;  4IOA A;  3H0G H;  5FJ8 G;  1EFW A;  2HQL A;  5C0X J;  1I6H H;  1VQF A;  3PF5 A;  2HIV A;  4LW1 A;  2WFW A;  2UXC Q;  4TQU S;  1Q46 A;  2I5M X;  5C44 H;  2IHF A;  4JI3 Q;  1BVS A;  4GKJ L;  1EYG A;  3H3V I;  4JC0 A;  3HOW G;  2HT1 A;  4GOP C;  1FJG L;  1B70 B;  3GO5 A;  2MO1 A;  3CCS A;  4DV5 Q;  4LFC L;  2OWO A;  1L1O C;  2K50 A;  2WB1 G;  4JYA Q;  4LF8 Q;  2NN6 G;  3B6Y A;  3H0G G;  5FJ8 H;  5M3M G;  3CCV A;  1N36 L;  1KAW A;  3S16 H;  1YIT A;  3S24 A;  1MKH A;  1VQM A;  2EXD A;  1UE1 A;  1VQC A;  4LUV A;  1TWA H;  4LFC Q;  1QUQ B;  4QIW E;  4AYB E;  5JJL A;  2E5L L;  4A3G H;  2EIF A;  3PCO B;  3S2D H;  1UE7 A;  1HZB A;  3OTO L;  1ASZ A;  1OXS C;  3ULP A;  4BA2 I;  2E2I H;  2DUD A;  4KHZ A;  3TS2 A;  1FL0 A;  3DM3 A;  1WCM H;  4OWX B;  1XMQ Q;  1SRU A;  4B3R L;  1VQH A;  5M3F G;  1Q1B A;  1PH9 A;  4XTC S;  4YCW A;  3K81 C;  5FLM H;  4YHH L;  1XNQ Q;  2MQH A;  2K5V A;  1IBK Q;  4JI1 L;  1S3O A;  3UDX A;  2WB1 E;  4BBR G;  4X62 Q;  1WFQ A;  1OXU A;  4GS3 A;  4A3G G;  4LUZ A;  4GKK L;  1NTG A;  3I7F A;  4BY7 G;  1Z47 A;  1YI2 A;  1HNX L;  4JOI A;  4K0K L;  3A5U A;  4QJF A;  1WCM G;  4AYB G;  1N36 Q;  1QZG A;  1D8L A;  2FXQ A;  4X65 L;  2UUA L;  1IL2 A;  1OXX K;  4YCU A;  4PZ6 A;  4DV6 Q;  1PHJ A;  1JMC A;  1GD7 A;  1VQI A;  1RIP A;  3CD6 A;  2ID0 A;  2WP8 J;  1VQO A;  4P75 A;  1W3S A;  2VS1 A;  4UPA A;  4A3B H;  4DR2 L;  3G71 A;  1QZH A;  4PZ7 A;  5IE8 A;  1ASY A;  2UUA Q;  4HJ7 A;  1X6O A;  2VW9 A;  3F1Z A;  1EOV A;  3GTJ H;  4DV5 L;  4DR4 L;  4JI7 L;  2MFI A;  3PV0 A;  1N33 Q;  4JV5 L;  2N78 A;  3ER0 A;  4LF8 L;  2KHJ A;  3GTQ H;  5BR8 L;  4HJ9 A;  4LF9 Q;  2PQA B;  4IO9 A;  1SMX A;  1VQA A;  3U4V A;  4X62 L;  4J15 A;  4HJA A;  1SFO H;  1L2F A;  2VY3 A;  2JK8 A;  4BA1 I;  2R6G A;  4LF7 Q;  4IPC A;  2YYZ A;  3PSI A;  3PUZ A;  2UXD Q;  5GAG C;  3BZC A;  1KL9 A;  2KCT A;  3M3Y H;  3W1B A;  2ZM6 Q;  1PA6 A;  1C7Y A;  1BBW A;  1VQK A;  2UXB L;  2UUB Q;  3OW2 A;  4LFB Q;  1SN8 A;  4QL5 A;  5GAH C;  1YJN A;  4DAM A;  2E2J H;  4LF4 L;  2LXK A;  3J81 c;  1VS0 A;  4AH6 A;  3RN2 A;  1LM0 A;  3BZK A;  3KF6 A;  2CFM A;  1L0W A;  1IBM L;  4JI2 L;  2JA6 G;  3HOW H;  4JI4 L;  2H5X A;  4ME3 A;  2JQO A;  4X64 L;  1X3E A;  4JG2 A;  4JV5 Q;  1KD1 C;  1Q8K A;  5M3M H;  2OQK A;  3UDF A;  1YHB A;  3CC7 A;  4HIK A;  2Z6K A;  4A76 A;  4POG A;  1PH8 A;  1FGU A;  4IFD J;  1K9M C;  4LUO A;  1PH6 A;  3MXN B;  1NY4 A;  1YEZ A;  1VQJ A;  3STB C;  1GO3 E;  4POF A;  2ES2 A;  4GKJ Q;  2I0Q A;  4JI3 L;  4JI6 L;  3GTK H;  2AHO B;  2ALY B;  2KCM A;  2JA6 H;  1A62 A;  4X66 Q;  1VQ7 A;  1G6P A;  3J80 i;  1YIJ A;  4WJ3 M;  4JBJ A;  1V1Q A;  1S40 A;  1Q82 C;  1HR0 W;  1XPR A;  3S1M H;  4YWL A;  2UUB L;  1HR0 Q;  1JT8 A;  3PUW A;  3M9B A;  1YJ9 A;  3FKI G;  4PZ8 A;  1PH3 A;  1YBY A;  1KIX A;  5FLM G;  2V1C C;  4JI5 L;  2JE6 I;  3K7U C;  3M4P A;  2D62 A;  2KHI A;  3U50 C;  1AE3 A;  4A75 A;  4BBR H;  4DAY B;  1KRT A;  1N34 L;  1HNX Q;  1JJC B;  1WJJ A;  3F2B A;  1W2B A;  4K0K Q;  2ZTC A;  3CQZ H;  4P73 A;  2ZJP A;  2C35 B;  4LF7 L;  4BY7 H;  2PNH A;  3HFZ B;  4DUY L;  4DR5 L;  5JJK A;  1I94 Q;  1Y1W H;  1S72 A;  3S1N H;  3TS0 A;  3KJO A;  1YZ6 A;  4OWT B;  2E8G A;  4P72 A;  4R4I A;  3K8A A;  2BH8 A;  3KDF B;  3KF6 B;  1QUQ A;  4IJH A;  1HNZ Q;  2K52 A;  1NMG A;  4KI0 A;  5JEA G;  1VQ8 A;  2BA0 A;  4RMF A;  1X56 A;  4A3B G;  2KEN A;  2D0P A;  3HOV G;  4C3J H;  3CP0 A;  4B3M Q;  5LMN Q;  1A0I A;  2EQS A;  1MJC A;  3HOX H;  2VNU D;  5IP9 H;  1K3R A;  1J5E Q;  1GM5 A;  3UE0 A;  3IRB A;  3KF8 B;  3J7Z C;  4AIM A;  1YJW A;  1GKH A;  1XJV A;  3ICE A;  3FP9 A;  1A63 A;  4YWK A;  3JAM i;  3S14 H;  3PO2 G;  4IFD G;  3DLL A;  4Y52 H;  2CQO A;  3D0F A;  4A3M G;  5IWA Q;  1PYS B;  4DKA C;  3I4M G;  4DK6 C;  4EX5 A;  4Y7N H;  2AWN A;  1O7I A;  2I5L X;  2NZO A;  4B3T L;  2JA7 G;  3PGZ A;  1J6Q A;  4GLA C;  3JAM c;  5IYB G;  1G29 1;  3HOX G;  1SRO A;  2E2H H;  4DV2 Q;  2PMZ E;  2ZJQ A;  4OXP A;  2K5N A;  1JE5 A;  2OTL A;  3F2C A;  2GVA A;  1EQQ A;  4DUZ Q;  1VQ9 A;  5IWA L;  4BBS H;  4OWW B;  3HKZ G;  3ULJ A;  1P8L A;  2L15 A;  1N34 Q;  4B3T Q;  4GN5 A;  4P74 A;  3PO2 H;  5M5X H;  4JI1 Q;  3AFQ A;  2OQ0 A;  4LNQ A;  2JA7 H;  1E1O A;  5AJ3 L;  3S2H H;  4UY8 C;  1VQ4 A;  4NXN Q;  1J5E L;  3EN2 A;  3HOU H;  1JB7 A;  5GAE C;  4LFB L;  1VQG A;  3UDG A;  5C4X H;  4LF5 L;  2NVQ H;  1YHQ A;  2R7D A;  3W5O A;  2IT1 A;  1C9O A;  1E1T A;  1NE3 A;  3CXC A;  3CCJ A;  3TQY A;  4ALP A;  1XTD A;  1R9T H;  1LUZ A;  3HOY H;  3OYY A;  3T1H L;  3NEL A;  4FDB A;  4A3K G;  2ATW A;  4KHP Q;  2YTX A;  1LTL A;  3I56 A;  3TRE A;  3HOZ H;  3HKZ E;  3M4O H;  3FKI H;  3KDF A;  4LF6 L;  4HJ8 A;  2RHQ B;  1Y1V H;  4IPD A;  2QA4 A;  2IHE A;  3GD7 A;  2Q2H A;  4R4O A;  4JI0 Q;  1Q7Y C;  5HGQ A;  4AQY L;  1HNW L;  4OON A;  4QGU A;  1T9H A;  4TVA B;  4GNX A;  1I5F A;  1UWV A;  2AMC B;  3A5Z B;  3HOY G;  3CC4 A;  2IX1 A;  4PMW A;  4A3K H;  4LF6 Q;  1Y1W G;  2Y0S E;  2DGY A;  1JJG A;  3HOZ G;  1XMO Q;  2CKZ B;  3RR5 A;  4HID A;  4IOC A;  2HHH Q;  1VQL A;  4O0A A;  4DV2 L;  3S1Q H;  1XMQ L;  4NB3 A;  2IY5 B;  4DR2 Q;  4L5S A;  2VZA A;  5LMN L;  3U58 A;  1CKO A;  3I2Z A;  1RL2 A;  5IY0 A;  3GTG H;  4JI6 Q;  3HOV H;  2NVY H;  1CSQ A;  3VDY A;  1M90 C;  2ASB A;  3F8T A;  2F4V L;  4X6A H;  2NVT H;  4C2M H;  2Y0S G;  4R4T A;  1TWC H;  1VQP A;  3CPW A;  1VQE A;  4L5Q A;  3BJU A;  5IP9 G;  1N33 L;  4DR6 Q;  3A74 A;  1NJI C;  4LF9 L;  3E9H A;  5GAD C;  3M4Q A;  4GNX B;  1Q81 C;  2JA9 A;  1NBW A;  1QVG A;  4GLX A;  3CCL A;  1E3P A;  5IYC G;  4BY1 G;  1Q1E A;  2UUC Q;  4DR6 L;  1U5K A;  1WI5 A;  4A3M H;  1WYD A;  3F2D A;  3I4M H;  3ZJY C;  4DV7 L;  1VQD A;  3T1Y L;  1MJE A;  5IT9 c;  5IYB H;  2LXJ A;  2Q2U A;  3PIP A;  1I94 L;  4A3D H;  2OCE A;  1FVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...