4JI7L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7L00
2I0QA 3W1GA 4NB3A 4OWXB 1JJGA 4XTCS 4DV2Q 3GDEA 5M5WH 3HOVH 1A8VA 1EUJA 1X56A 3HOZH 4JYAQ 1PYSB 1IL2A 1N32Q 4JC0A 4GNXC 1U0LA 2Y0SE 3E0EA 2D62A 4NPSA 1CKMA 3K0XA 2ZTEA 2EIFA 2K5VA 3S14H 4A3BH 5IWAL 2AWNA 4C3HH 1HNZL 4A93H 1N36Q 4MNOA 3F1ZA 3SGIA 4IFDJ 1Q86C 1AH9A 4DV5Q 4GNXA 2VQFL 4DK3C 1VQAA 2JEBI 2JA8G 4BBSH 1XTDA 2LXKA 3CCMA 3BZKA 1PH8A 3I4MH 1G6PA 2I5LX 2DUDA 3HKZE 2OQKA 1H95A 3G6EA 2NZOA 5LMUL 2HHHL 1XNQQ 4A3DG 1WCMH 1LTLA 3I7FA 1L2FA 1K0RA 3HOYH 4X62Q 4LF4L 4DR2L 4LF9L 2VQEL 4YY3Q 1FGUA 1BKBA 1PYBA 4DV1Q 4LFCQ 5E7NA 3JAMc 2CWPA 3OYYA 2NVXH 3A0JA 2KBNA 4BBRG 4KHPL 3S1NH 5C3EG 1EWIA 1SE8A 2RF4A 4APVA 3CD6A 4KLKA 2RHQB 5K36G 1VS0A 1DGSA 1B7YB 4ME3A 4JI1L 2PQAA 1KIXA 1E1OA 4JI8L 5IYBG 4PZ8A 1LUZA 4A3CG 2A8VA 1Y1VH 2IX0A 1S3OA 4YWLA 2E8GA 3CPWA 3F2DA 4BA1I 4B3TL 2CWAA 3HOUG 1Q1EA 4OX9Q 4YCVA 4DV0Q 2JK8A 1YZ6A 4JV5L 1KRSA 4RMFA 3GTLH 1GM5A 2JA5H 4AYBE 3U58A 4LFBQ 1V1QA 3UDIA 3ULLA 1CUKA 1SROA 1ASYA 1QVGA 2UUCL 3CQZH 4IPHA 1JE5A 3OW2A 4X64L 3K7AH 1VQKA 1YITA 1LYLA 3GD7A 4BA2I 2IT1A 1VQBA 2YYZA 3I2ZA 2F52A 5C44H 3UE0A 3J81c 4A3LG 5IWAQ 2JE6I 1HNZQ 4B3RL 4MZ9A 3STBD 1HR0L 4GOPC 4DV2L 4PG3A 2VQFQ 3EIVA 4HJ8A 4B3ML 2F4VL 3GO5A 3FHWA 1B70B 1W2BA 1BBWA 1P16A 1QVFA 1JT8A 2C35B 1UE5A 1EFWA 5LMUQ 2Y0SG 3DLLA 2HHHQ 4GOPA 1QUQA 1E24A 4AQYL 1B8AA 4QJFA 3TS2A 2HIXA 4LF9Q 4LF4Q 4DR2Q 2VQEQ 3M7NA 1X3GA 2WFWA 4O0AA 3H0GG 1A0IA 2NZHA 3OTOL 4TQUS 4DK6C 4YHHL 1EQQA 1FVIA 3MEFA 4POGA 5FLMH 1X6OA 3A5UA 1I94L 4BY1G 1OTCA 3I4NH 3HKZG 4KHPQ 2JA9A 4DV4L 1IZ6A 3U50C 2BA1A 3UE1A 4NXML 4A3IG 1UE6A 4HIDA 1PVOA 5GAHC 4A3KG 1BVSA 4YY3L 2K4KA 4JBMA 2WAQE 1YHAA 1TWHH 3CCLA 3A74A 1KXLA 3CCEA 2K75A 4JI8Q 1C0AA 4JOIC 1YJWA 2KCTA 4MTNA 1M90C 1YVCA 3CCJA 3J80i 4Y7NH 4DAYB 4B3TQ 2K5HA 1OXTA 3HOXG 2R92G 1ASZA 1NE3A 3KF8B 4JV5Q 4X6AH 4JOIA 4LUZA 5JJLA 2Z6KC 4JG2A 5LMNW 1M1KC 2UUCQ 3CC2A 3CPFA 4LF7Q 3CP0A 2EXDA 3KLWA 4X64Q 2H5XA 4R1JA 4UP7A 1VQDA 4A3EH 4GN3B 2Z6KA 1KL9A 4A3JH 2N78A 2IHFA 1KAWA 4A3BG 3CMEA 1XNRL 4GKJL 4AYBG 2VZAA 3KF6B 1J5EL 1SN8A 2GVBA 4B3RQ 1HZAA 4JCVE 1HR0Q 2YU9H 2V1CC 4OO1I 1HNXL 2IY5B 1NY4A 1Q81C 4B3SL 1GD7A 1Q8KA 1UEBA 4B3MQ 2FXQA 2F4VQ 4A3GH 2BA0A 2A19A 2OWOA 3UDGA 2ZJPA 4IOCA 4IPGA 2IX1A 2UU9L 4DR5L 1IBKL 4AQYQ 4HJAA 3HOYG 5M3FH 4L5SA 3GTOH 3S2DH 2NVQH 1HNWL 1J6QA 3L2PA 3E9IA 3OTOQ 4JBJA 4YHHQ 2UXDQ 1S72A 2ZJQA 1I94Q 2A1AA 1K9MC 1UE7A 1QVCA 4J15A 4DV4Q 4NXMQ 3I4OA 4DUZL 2XTIA 1N34L 2VUMH 2DGYA 1SLJA 2R93G 2HQLA 1MJCA 1MIUA 1Z9FA 5HGQA 2UXBL 4BY7G 1U5KA 1BBUA 1L1OB 1CKOA 3U4VA 4QY7A 2MFIA 3F2BA 2CQOA 5IP9H 1PV4A 4DR6L 2KCMA 1X3FA 4GKKL 5IP7G 4IOAA 1O7IA 4IJHA 2VL6A 1CSQA 3PSIA 1NTGA 2HT1A 3S2HH 4IFDI 4Y52H 3PIPA 1TWFH 1L0WA 3IRBA 3A5ZB 1N9WA 3T1YQ 2NVTH 3AYHB 4QQBX 3RNUA 1Q12A 4GLAC 4DKAC 4JI4L 4LF6L 4HJ9A 2JA7H 3PF5A 1CKNA 2WAQG 1W3SA 4HIMA 4PZ6A 3F2CA 5EAYA 2VS1A 3S1MH 3I55A 2JJQA 4L5TA 2JA6G 4DR4L 1OXUA 2BH2A 1VQ5A 3KDFB 3CC7A 1OXSC 3M4OH 4K0KL 1XNRQ 2LSSA 4GKJQ 2R7DA 4R4QA 2I5MX 3PCOB 1J5EQ 3PUVA 3DM3A 2CKZB 4LF7L 1Y1WH 1UE1A 4C3IH 5AJ3L 1HNXQ 5FLXc 2Q2UA 3J81j 4A76A 4B3SQ 5C0XI 1TWCH 2K52A 1EOVA 2ASBA 1VQOA 2GN5A 4AIMA 1NJIC 3UDFA 4IO9A 3JAMi 1R9TH 3RN5A 4DUYL 2UU9Q 4DR5Q 1XMOL 1K3RA 1IBKQ 1NMFA 2GVAA 1WFQA 4NXNL 3AFQA 2QEXA 3ULJA 5C3EH 2PI2A 4A3FH 1HNWQ 3G71A 1D7QA 4LWCA 2CCZA 2D0PA 4A3MG 3CMAA 4GS3A 4IJLA 1WOCA 1TWGH 3HOWH 2YV5A 1I6HH 1HH2P 1RIPA 5IYBH 1HJPA 4C3JH 4P72A 4DUZQ 1PH5A 3PUXA 1N34Q 4JI6L 3FKIG 3K8AA 4LF8Q 4A3CH 3PIOA 1VQIA 2UXBQ 5IYCG 2RCNA 4JI2L 4UP8A 4DV3L 3HOUH 1VQCA 3S15H 1VQJA 3G4SA 4DR6Q 2UXDL 1HZ9A 4GKKQ 3PUZA 3KYHC 2ZTDA 4PZ7A 1VQLA 1PFSA 3BU2A 3LGJA 4FDBA 3J80c 5LMNL 3H3VH 3GTKH 2Q2IA 1PH9A 3I56A 3CAMA 3KF6A 4DV6L 2MQHA 4P71A 2R7ZH 1I3QH 4JI0L 1VQ6A 5C4XG 5M3MH 4H02A 4P73A 1FJGL 5BR8L 2I5HA 4JI4Q 4L5RC 3M4PA 4LF6Q 2Q2HA 1XMQQ 2B3GA 2YTVA 2B63H 4OO1G 2NVYH 3J7ZC 4TVAB 4P75A 2E2HH 3HFZB 1Y14B 4QIWE 3PO2G 3S1QH 1WYDA 2Z0SA 4C2MH 4A3EG 4DR4Q 4KI0A 3L0OA 3T1YL 2R6GA 1MJEA 1X65A 2ID0A 3GTQH 4K0KQ 1NBWA 1GVPA 1XPOA 3MXNB 4LW1A 3WWVA 2KHJA 4QL5A 4DAMA 1EIYB 1L1OC 3HOVG 2CFMA 1HZCA 5AJ3Q 2NN6I 4A75A 1X54A 4X66Q 4DPGA 3M85A 1N33L 1XJVA 2E2JH 1JB7A 4GLXA 1WJJA 4DNIA 4JI3L 3H0GH 2PNHA 2K5NA 1JJCB 1KHIA 3FP9A 2AWOA 1FL0A 4DUYQ 1OXVA 3S1RH 3H15A 1K83H 1YJNA 4A93G 3PO3H 4BY1H 1SRUA 5M3FG 5M5XH 1VQ4A 1XMOQ 1KC8C 1IXRA 4NXNQ 2Q2TA 2PI2E 4JBWA 3TS0A 1YHQA 1TWAH 3KOJA 4BBSG 1SR3A 5GAEC 4QGUA 2XGTA 3I4MG 3U4ZA 3PF4A 4A3KH 4WJ3M 4GOPB 1QUQB 4AH6A 1X9NA 1KQSA 3GTPH 3NBHB 2OQ0A 3CCVA 2WB1E 3PV0A 1PH7A 1SFOH 1E1TA 2L15A 2ZTCA 1WCMG 1V43A 1QZHA 1Q82C 4GN5A 5IE8A 2VUMG 1IBML 4JI6Q 4EQ5A 3S16H 3PGZA 3T1HQ 2YTXA 4HIOA 3GTGH 3S17H 2AHOB 4POFA 4JI5L 1PA6A 3JC66 2RHSB 1K8AC 1D8LA 2OCEA 4KHZA 1CSPA 1TXYA 2N8NA 4JI2Q 5IP9G 3HOXH 4DV3Q 2R92H 4RG1A 2K14A 5JJIA 1PH3A 2ZJRA 1P8LA 4UP9A 5LMNQ 5J3BA 4YCUA 3RLNA 4R4OA 4L5QA 3KFUA 4DV6Q 4JBKA 1A63A 4LF8L 1SMXA 4JI0Q 2KENA 4OXPA 5GROA 3W5OA 1FJGQ 5BR8Q 2JA7G 2B29A 3AFPA 1KD1C 1VQ7A 3ICEA 3M3YH 1V9PA 1YHBA 1NMGA 5FJ8H 5IT9c 4ALPA 2YTYA 1IBLQ 3RR5A 3B6YA 4LF5L 1Y1VG 5C0XG 4X65Q 5IYDG 3HOZG 5JEAG 1VQ9A 1UWVA 4DV7L 2JA5G 2AKWB 1X55A 4WJ4A 4DR1L 1XMQL 1Q7YC 1VQEA 2K50A 3CCSA 1Y1WG 5GADC 2E2IH 2E5LL 1Z47A 4HJ5A 1YEZA 4LUOA 1N33Q 1T9HA 4R4TA 1X3EA 3RZDH 1OXXK 2MO0A 4JI7L 1I5FA 5C44G 1Q46A 2ZM6L 4JI3Q 2JA8H 4IPDA 3D31A 3RZOH 1VQNA 3CC4A 4OWWB 4PMWA 1PH4A 4A3FG 1G51A 1E7ZA 4A3DH 1VQMA 4YWKA 3CCRA 4X66L 2R93H 1YI2A 2N3SA 3STBC 3CCUA 5M5YH 5C0XJ 3HKSA 5GAGC 1PH2A 4LUVA 4BY7H 2UUBL 3HOWG 5JJKA 4P74A 5IY0A 2VW9A 5JEAJ 1EQRA 1G291 3NENA 4DR3L 5IP7H 2LXJA 5DLQE 4BBRH 4GNXB 1IBMQ 3TREA 4OONA 4JI5Q 2HIVA 1XPRA 4IPCA 3PUWA 1EYGA 2UUAL 5FLMG 2UXCL 1MKHA 3TQYA 3E9HA 3RN2A 3I4NG 1EIFA 2QGQA 3F8TA 3NELA 5HY6A 4UY8C 2WB1G 2JQOA 2EQSA 1E22A 1WI5A 4HJ7A 2R7ZG 5M3MG 2BH8A 3T1HL 3GTJH 2KHIA 4LFAL 2JA6H 5GQOA 3EN2A 4DR7L 1XPUA 2B63G 3KJPA 1PHJA 1VQFA 4R4IA 2NN6G 3RLFA 4A4IA 4YCWA 4LF5Q 1JMCA 2ES2A 3ERSX 2VNUD 1CKNB 2PQAB 3CW2C 4JYAL 5ELNA 4DV7Q 1N32L 1N8RC 2R7FA 2WP8J 3PUYA 3TEHB 4DR1Q 2AMCB 1VQPA 3KJOA 1VCIA 3TRZA 3J81i 3VDYA 2UUBQ 2MO1A 1YIJA 2E5LQ 4A3LH 1IBLL 1AE3A 1N36L 3G48A 4X65L 3H3VI 2N49A 3ER0A 3K7UC 4DV5L 4A3JG 4JI7Q 3BZCA 3CXCA 2ZM6Q 1YBYA 2JEAI 4A3MH 3PO3G 3AEVA 3NEMA 2QA4A 1GKHA 1HR0W 3Q8DA 1Q1BA 1XNQL 3ULPA 4YWMA 4BXXG 3S24A 5IYDH 4UPAA 4BXXH 1GO3E 3FKIH 3AQQA 1LM0A 3L7ZC 4X62L 4A3GG 4JI1Q 1VQGA 1PH1A 5IYCH 1IYJB 2PMZE 4LFCL 1RL2A 1HZBA 3M9BA 4DV1L 3BJUA 1K8GA 2IHEA 1VQ8A 2ALYB 2ATWA 1L1OA 1VQHA 1YNXA 5C4JH 4DR3Q 5ELOA 2OTJA 3J7A5 1KRTA 3W1BA 3EBEA 3K81C 4GN4B 4OWTB 3RLOA 1C9OA 4HIKA 4A3IH 3GTMH 3K80C 5C4XH 2UUAQ 4R4CA 1PH6A 2UXCQ 1A62A 1AE2A 2F3IA 1S40A 4IFDG 2OTLA 3M4QA 3CF5A 4LNQA 1E3PA 1K73C 3CCQA 1I50H 3PO2H 1YJ9A 3D0FA 1JJ2A 4O2DA 4LFAQ 2VY3A 4DR7Q 5H1SE 2MNAA 1C7YA 4DV0L 4EX5A 5FJ8G 4OX9L 2D0OA 4GLVB 4LFBL 3KDFA 4XIGS 3ZJYC 1QZGA 3UDXA
chains in the Genus database with same CATH superfamily
2I0QA 4FO2A 1JJGA 5C6AA 5M5WH 1B4OA 2RDFA 1A3TA 1X56A 2PNRC 1EYCA 4GNXC 1ENFA 2X6LA 3T56B 3NUCA 4NPSA 2EIFA 4NP5A 2K5VA 1B3AA 2GA4B 5IWAL 5JPMC 2A6ED 2G5DA 4MNOA 1Q86C 2Q8TA 3QIAA 2F0OA 1RTNA 4ID6A 2VQFL 2JA8G 3OMGA 5FO7B 2EJFC 1G6PA 4DFAA 3G6EA 1EYDA 1JCKB 2HHHL 4A3GB 2KOLA 1LTLA 3NQIA 1ESFA 1BKBA 5CV4A 4LFCQ 2KECA 2CWPA 4PNYA 2NVXH 5CV6A 3S2DB 1LT5D 1L0YB 1STYA 1D2BA 4C56C 4FYDA 2F0SA 3NWSA 2PZWA 4ZYSA 3QO2A 1PRTF 1DGSA 1B7YB 4JI1L 4RGNA 4U673 5IYBG 4C3JG 3I70A 2A8VA 1Y1VH 2IX0A 3HOZH 3HOUG 4YCVA 2JK8A 1GM5A 3UDIA 3GV6A 3ULLA 1QVGA 2QKIC 3CQZH 3K7AH 1JOOA 2XVSA 2YYZA 2F52A 4HMJA 2L0CA 4A3LG 2CW0C 2JA8B 3M4OB 1GUWA 3STBD 2EZVA 4DV2L 2NZ1D 2EE1A 4IUTA 2F4VL 4WFN3 1B70B 1UE5A 1BUVT 1L0XB 5LMUQ 2Y0SG 3DLLA 1QUQA 1XXGA 2KJXA 3S9WA 1EY0A 1B8AA 2F0MA 3ND9A 1HPCA 3MXUA 4YIJA 3M7NA 2WFWA 3MVVA 1D5ZC 2NZHA 4DA2A 2L1BA 5FOBB 1X6OA 1OTCA 3BVMA 1I94L 3HKZG 1SE2A 4KHPQ 1G8ZD 1I4PA 4H7BA 1TWGB 2K7VA 4A3KG 1O7LA 1BVSA 1SE3A 2SNMA 4C3JB 4Q5VA 1A15A 1LABA 2WAQE 2F0TA 3A8KE 1KXLA 3CCEA 2K75A 4X3SA 1WTOA 2KCTA 3SE0A 3HOUB 2K5DA 3GP7A 5EPJA 4DAYB 3BYYB 1NR2A 2K5HA 1OXTA 1SEBD 1ASZA 4FXDA 1BCPD 5JJLA 5D65A 4OO1H 3CP0A 2EXDA 4X64Q 1MGSA 4C1NK 2QDBA 1VQDA 1X3QA 5KEEA 4XYOA 1JICA 3S1QB 2IHFA 1KAWA 4C2MB 2F03A 1XNRL 2DNEA 2EXZA 2N88A 3GTQB 4OO1I 1V1PB 1FD7D 1Q81C 2Y0SB 1Q8KA 1UEBA 4B3MQ 4G7ZC 4A3GH 5T1GA 2BA0A 1HTPA 3D4WA 2OWOA 3UDGA 3TP7A 1ONLA 2PO4A 4IOCA 2IX1A 4DR5L 3HOYG 3S2DH 2NTSA 3L2PA 5M5XB 1BCPB 3HKZB 1SJHD 2LMCB 1B3QA 5AFWA 3SK8A 2LS01 4A3KB 1I4QA 2XNAC 1SLJA 1CI3M 3WOFA 1R4PB 3QG1A 4BY7G 5IGFA 2CQOA 4DR6L 1X3FA 4IOAA 1CSQA 1H9JA 3MXPA 3NTIA 3T1YQ 2NVTH 4GLAC 2JA7H 4B9WA 5EGTA 4KD4A 4DXGA 3I3CA 2L5TA 5EAYA 2JJQA 3VR3A 1LLRD 4DR4L 2BH2A 3KDFB 3KUPA 3M4OH 3ERQA 4GKJQ 4R4QA 3PCOB 2L4NA 4HCSA 1STBA 2CKZB 4LF7L 5EKKA 5FLXc 2Q2UA 3J81j 1D1KA 3VR4A 2CH4W 2K52A 2EYHA 4RHRA 3CHBD 1VQOA 3HOYB 1DXMA 3JAMi 4OIJA 3EJIA 1XMOL 3L9AX 1NMFA 3RZOB 2B8FA 2FHTA 2PI2A 4A3FH 3G71A 2CCZA 1UNSA 2NTTA 4A3MG 2P5ZX 4IJLA 1STHA 1TWGH 3HOWH 5M5YB 3OIPA 4RGTA 3TZUA 3R3OA 5IYBH 1HJPA 4C3JH 4P72A 4BY7B 5IT9E 1N34Q 3K8AA 5DM73 1HUNA 5CV9A 4EQOA 2UXBQ 4NDXA 5IYCG 4JI2L 3HOUH 2OF1A 3LWUA 5BN3A 1VQJA 2UXDL 3PUZA 3KYHC 2QILA 2CQAA 1EZ8A 2Z9HA 4JI4Q 4L5RC 2Q2HA 4KHVA 4I7AA 2KA7A 1PZKD 4TVAB 1ENAA 4H0LC 2A69C 4KJOA 2K6AA 3PO2G 3S1QH 3ONAB 4C2MH 2LY7A 1SBBB 3GTQH 4K0KQ 1XPOA 5FLXE 1ILQA 4LW1A 3DXJC 2KHJA 3EQLC 4QL5A 1EIYB 5J39A 4FF3A 4E6IA 3EFXD 4OEMB 1N33L 3HP3A 4UDUC 1XJVA 5ELDA 1B53A 4RGOS 1JB7A 3MFYA 4CKBA 4DNIA 1Y69U 1F9PA 3QOJA 2K5NA 1ET6A 1EY6A 4DUYQ 1EZ6A 1YJNA 1SRUA 5M3FG 5M5XH 1HRJA 4A3MB 2O4XA 1U4PA 1HCZA 5EPLA 4QGUA 1S5DD 4ZLTF 4A3KH 1U4LA 4RFBA 4AH6A 1Q82C 1JQYD 2VUMG 1IBML 4EQ5A 5KGUA 1D8LA 2OCEA 2N8NA 5IP9G 1ILPA 5TSSA 3GTMB 2QDLA 2ZJRA 2TSSA 5J3BA 4YCUA 5LMNQ 1X3PA 3KFUA 3A55A 3MFGA 3TBIB 5GROA 3W5OA 2B29A 1VQ7A 1I50B 3K0YA 3PO2B 4CJ0B 1IBLQ 3RR5A 3B6YA 1CQFA 5IYDG 3TP6A 5JJZA 1HXYD 2JA5G 1VF5C 2QCPX 1SYDA 1Y8OB 2K5WA 3FEWX 1ZYRC 1XMQL 3R8BA 3VYUA 4ZUJA 5GADC 2NWGA 2E5LL 5ELBA 1OXXK 4J6HA 3OIQA 1SNPA 5M3FB 1I5FA 5C44G 4JI3Q 1PMRA 1V1OA 3D31A 3RZOH 1ET9A 1G51A 3SEBA 1BBXC 1VQMA 3CCRA 2N3SA 3FPUB 5M5YH 1U4RA 2VUMB 1KDAA 4BY7H 1F2YA 1U9RA 3I72A 3QB3A 3C46A 4RKLA 4JI5Q 2G9HD 1ZYRD 1XPRA 3PUWA 2DJGC 4DAYA 5FLMG 2UXCL 3RN2A 3I4NG 5I2YA 4XQQA 3NELA 5HY6A 2X69A 5LL6X 1S5BD 2L9HA 3T1HL 4CGYB 3A54A 4ODGA 4LFAL 1XPUA 2B63G 1VQFA 4R4IA 3RLFA 5E4WC 1Q90A 2ES2A 3ERSX 2JA5B 1Q8IA 5CBEE 5ELNA 4DU9A 5CC4A 2R7FA 1VQPA 3KJOA 3TRZA 1JC7A 3VDYA 1AE3A 5C44B 4A3JG 3W3AA 2FFKB 4EQNA 1YBYA 2NUCA 4FP5D 4A3MH 2XN9C 1GKHA 4PQXA 3RUZA 4YWMA 1EQVA 1TY0A 4UPAA 1FYCA 1Z6HA 3AQQA 3L7ZC 2PCFB 1VQGA 5IYCH 4LFCL 3M9BA 1RL2A 1VQ8A 2RSNA 4OL7A 1YNXA 1AZQA 4DR3Q 1KRTA 3EBEA 1QILA 4GN4B 4HIKA 3I4NB 3GTMH 4IUQA 3IL8A 3W2DA 4IFDG 3NQTA 2PPBC 4KTAA 1I50H 3PO2H 1YJ9A 1JJ2A 5I2XA 3I90A 4Y7NB 2D0OA 3KDFA 4QY7A 3UDXA 3D3RA 3W1GA 4NB3A 4R9WA 4B9XA 1NAPA 1A2UA 3GDEA 1KABA 1N32Q 1IL2A 4JC0A 2JN4A 1AN8A 1WTWA 2LKVA 2ZTEA 3P7JA 4A3EB 4A3JB 4A3BH 2AWNA 4C3HH 1N36Q 4IFDJ 4K8IA 2MP1A 3A7AB 1VQAA 2Q8IB 1FGBD 2AQ3B 3CCMA 3BZKA 1OO9B 2OQKA 1LACA 2NZOA 2AUJD 5LMUL 4N9PA 4C3IG 4X62Q 2PW7A 1PYBA 2IL8A 3SXHA 3JAMc 3GTOB 3A0JA 2A73B 4KHPL 5C3EG 2B2VA 4EQPA 4ME3A 5CORA 1BDOA 1DJRD 1CT1D 4X3UA 1TIID 1E2VA 1QB5D 1S3OA 5IYDH 2E8GA 1SNDA 4BA1I 2J0TD 2CWAA 3KBGA 1Q1EA 1LTBD 3FRPB 3D4RA 1STGA 3HRZC 4RMFA 5C5LA 3VYRA 4AYBE 2JA5H 3GTLH 4LFBQ 1SROA 4XT3B 1MSHA 2RQXA 2WIIB 2PYKA 3OW2A 4X64L 1YITA 1LYLA 2ICIA 2IT1A 1RJTA 2EYMA 5C44H 3J81c 4TKOB 1EWCA 5NUCA 1WVLA 2EYJA 4GOPC 1ICWA 2KQ3A 4B3ML 1Y1WB 4C3IB 5CMDA 1QVFA 1PTOD 3EROA 4BWGB 2WKCA 4QJFA 2VQEQ 1X3GA 1EQQA 3SDZA 2AUKA 5C3EB 1TY2A 3MEHA 5EBDA 5FLMH 3I4NH 4KY7A 5K5PA 3ND8A 4FF1A 3UE1A 4A3IG 4HIDA 1XYIA 1Q3LA 1PVOA 1C8CA 4CJ1B 3NK9A 4YY3L 4JBMA 1TWHH 2N55A 2QF7A 4JOIC 1YJWA 3S15B 5FLXL 1YVCA 3MWYW 4Y7NH 1EFID 1ENCA 3HOXG 1VMCA 3KF8B 4IUVA 4X6AH 1TT2A 4LUZA 2Z6KC 2R7ZB 5LMNW 2EJMA 4K6DA 4HR7B 3CC2A 3CPFA 1PLFA 2XIWA 3J81E 2O2LD 3MHBA 4ZQ3A 1LTID 2K32A 1I4HA 3NWTA 3Q0AA 4XQNA 4A3EH 4A3JH 1KL9A 4OHJA 3CMEA 3O13A 3I73A 4HSVA 4GKJL 4B3RQ 2EYFA 2V1CC 3GV3A 3CRKC 3R93A 2D5DA 2IY5B 3K5OA 2RCFA 1BQQT 2A19A 3KBXA 1TS4A 1BNZA 2E76C 3GTOH 3S1RB 1K83B 3PO3B 3E9IA 5KNBA 2B2WC 4JBJA 1S72A 4A3IB 2ZJQA 1IYVA 4IFDH 1UE7A 1QVCA 1B9NA 4DV4Q 3I4OA 4QUFA 2F0GA 3GTPB 1N34L 2BDNA 5BN4A 2HQLA 2K05A 1SFOB 1Z9FA 4H13C 2M2LA 2MPMA 4QMGA 2UXBL 1U5KA 3S16B 3H91A 3GTGB 1SMYC 1YNJC 3MC0B 2Z4IA 5IP7G 3HOXB 1KTKA 1A3UA 2HT1A 4IFDI 3TN2A 3S2HH 2O5IC 3IRBA 3KLRA 1TS5A 1D5XC 4QQBX 4G57A 4RKBA 3RNUA 1Q12A 1EIGA 4ZUIA 4JI4L 2B2YA 1F2ZA 4JPBW 5IIFA 4DK1A 4F7XA 4PZ6A 4MHEA 5CBAE 3M3YB 2VS1A 4TSSA 1Y8PB 2JA6G 1OXUA 3CC7A 4K0KL 2B8GA 2LSSA 2R7DA 2I5MX 2ZT9C 3PUVA 4IQZA 1Y1WH 1UE1A 3DM1A 4C3IH 1ML0D 2DJFC 5DEHA 1SMYD 1ESRA 4IN3A 2OT2A 4B3SQ 3EA6A 1XX8A 2E2IB 1TWCH 5CV7A 1CQVA 2GN5A 4K2LA 4AIMA 3UDFA 1NJIC 4IO9A 3ZYYX 4DUYL 1I4XA 4XYQA 1IBKQ 2UU9Q 1FNVA 5C3EH 1WTRA 3V96A 1D7QA 1F2MA 5G3LF 2Q8RE 3IFDA 4GS3A 1WOCA 1HH2P 4DUZQ 3PUXA 3FKIG 4LF8Q 1KDCA 2RKSA 5EPKA 3PIOA 3D8GA 1STNA 3HG9A 4CKCA 2RCNA 2F3VA 4HMIA 4LMQD 3S15H 1PYWD 3BDLA 1HZ9A 5JPNC 4GKKQ 2J7ZA 4PZ7A 1PFSA 3BU2A 3LGJA 3SK4A 3I91A 3J80c 5LMNL 3H3VH 1EU4A 3I56A 3CAMA 1B9MA 2HDLA 3KF6A 2MQHA 4QUCA 3P1HA 4NKLA 1VQ6A 2R7ZH 2F0PA 5M3MH 3FMCA 4P73A 2CW0D 4LF6Q 2I46A 3NXWA 4RAUC 2JA6B 3GQBA 5C4HA 3J7ZC 4P75A 2E2HH 1Y14B 4QIWE 5JVH3 1JR0D 4KY6A 1BR9A 1QNKA 1MD2D 1WTPA 1GVPA 2KCCA 3RD4A 2RDHA 5C3WA 3HOVG 5AJ3Q 1KAAA 4X66Q 4DNRB 1D6EC 4GLXA 1HTLD 4JI3L 2PNHA 4WJWA 1JJCB 3FP9A 2AWOA 1FL0A 3S1RH 1K83H 3PO3H 1VQ4A 1KC8C 1IXRA 1SNOA 4ME5A 5I4DA 4NXNQ 2PI2E 4JBWA 1DD2A 3KOJA 3D6WA 1SR3A 5GAEC 2XGTA 4ZCKA 1X9NA 1SAPA 2EY2A 1SNCA 3FKIB 3GTPH 2WB1E 1SFOH 1E1TA 2L15A 1KNEA 1WCMG 3K58A 3S16H 3PGZA 5HURA 2YTXA 3GTGH 2XRSD 4POFA 4JI5L 1PA6A 5C4JB 3J80E 2RHSB 4KHZA 3HOXH 4DV3Q 1CSPA 4OELB 4RG1A 1PH3A 5I6YA 5BN5A 5J22A 3VR2A 4DV6Q 1CZGA 4MTKA 1FJGQ 3M3YH 5FJ8H 5IT9c 5C0XG 4WORA 4CDFC 3H94A 5JEAG 1VQ9A 5T1IA 1JOQA 1SNQA 3HOVB 2EPBA 1X55A 5I6WA 5C3XA 4XXEA 2E2IH 5KRUA 2F0FA 3I4LA 2B2VC 1TVXA 3URYA 2JA8H 1VQNA 4OWWB 1PH4A 2FINB 3J7AV 3OPOA 5HGTA 3CCUA 3AMUA 5C0XJ 1WCMB 3HKSA 5GAGC 5JJKA 1I4GA 4LK1C 5JEAJ 4DR3L 5IP7H 5DLQE 1CFMA 2WV6D 5CGKA 1EYGA 3SHLA 3NTKA 5KNDA 4CHTB 1WTXA 1EIFA 3F8TA 3KF8A 4UY8C 1XTCD 4P2CB 3MXGA 4RHSA 1BCPF 2B2UA 3DMUA 2JA6H 3EN2A 3KJPA 3PIO3 1LTRD 2NN6G 3J7YW 4K5WA 1JMCA 2F0KA 5FO8B 2AQ2B 3JAML 1D5MC 4DV7Q 1N32L 5IOCA 4DR1Q 1WTQA 1RCVD 2AMCB 3J81i 5ELEA 2MO1A 4A3LH 3NBHA 3NTHA 4TRDA 2D9UA 2CVRA 3K6OA 1N36L 4X65L 1NUCA 5EJWA 2E2DC 5IGEA 1SYBA 1G2TA 1O7YA 3AEVA 2QA4A 4FNFA 2QEJC 3ITPA 1I6HB 3FKIH 1LM0A 4X62L 4JI1Q 1EL0A 1PH1A 1IYJB 3BJUA 4K5XA 2ZXPA 3KLSX 1V8QA 5C4JH 1S5FD 1FNUA 2SNSA 3EVQA 4DNTB 4R4CA 2JYOA 1C4QA 3J81L 2A69D 1S40A 1EY4A 2G9DA 3M4QA 2B39A 3CF5A 2L11A 1KNAA 1E3PA 2WKDA 2NVYB 1K73C 3PMFA 2MHVA 3D0FA 3T13A 1EEFD 1SYFA 5DM63 1SYCA 5H1SE 4DR7Q 3C2PA 4F8MA 4LFBL 4XIGS 1QZGA 4ABNA 4OWXB 4XTCS 4DV2Q 3HOVH 4JYAQ 1PYSB 1U0LA 2Y0SE 2A68C 1UEAB 3E0EA 1CKMA 3K0XA 2F4IA 2DNCA 2F0VA 3P20A 3J7AF 3F1ZA 1AH9A 2CHBD 2HQEA 2PZUA 1PDQA 4GNXA 1RODA 2YU9B 2LXKA 2RVLA 2A6HC 2DUDA 3HKZE 5ELCA 2ICEC 1H95A 4A3DG 4MIUA 1WCMH 3I7FA 1L2FA 2XWJB 1K0RA 4PV1C 3HOYH 3OW7A 3VYSA 2VQEL 4H44C 2VXWA 4X3KA 3T16A 2A5HA 1W6JA 2DY7A 2KBNA 4CKEA 2NVQB 4BBRG 4O42A 2ZXRA 5E1FA 1SE8A 2A68D 4APVA 1EY8A 4KLKA 3LNNA 2AQ1B 3A8JE 2PQAA 3DWQA 1KIXA 1TKWB 3N6RA 5COYA 4A3CG 3F2DA 2EY5A 4YWLA 3CPWA 3TS2A 4OX9Q 1YZ6A 1UUPA 1KRSA 1CUKA 1LTTD 2FJ2A 4S3SA 4IPHA 4ZRZA 1JE5A 1VQKA 4DN4M 4BA2I 4KMUC 1Z7TA 3S1MB 1J9OA 3UE0A 1IW7C 2JE6I 1HNZQ 4B3RL 4MZ9A 2VB2X 1IKLA 1YNNC 3SR1A 4PG3A 1O78A 3EIVA 3GO5A 2EYOA 4A3DB 3FDTA 1BBWA 1P16A 2JP1A 1IHZA 4LF9Q 4LF4Q 4DR2Q 4PMCA 4O0AA 3H0GG 4TQUS 4DK6C 1FVIA 3MEFA 1PXUA 2FMMA 4DV4L 1IZ6A 2BA1A 3OOCA 4C1NI 1UE6A 4N8X1 2PMZB 1IW7D 5GAHC 1PZJD 3K5MA 3CCLA 3A74A 4ZKCB 1YNND 4JI8Q 4MTNA 1QE6A 3J80i 3IFTA 4B3TQ 1K8OA 1S4ZA 4K5VA 1IL8A 4JV5Q 2R61A 3C1EA 1RDPD 2UUCQ 4LF7Q 2Z8LA 4HTHA 2H5XA 2B63B 3SVMA 4UP7A 3V2TA 4GN3B 4X3TA 3NE5B 1B50A 2MGSA 3CU7A 1EWHA 2VZAA 3KF6B 2GVBA 1HZAA 4JCVE 1HR0Q 2YU9H 1NSNS 5JAVA 1NY4A 4B3SL 2FXQA 5DNFA 2HUGA 3J80L 1HQRD 5KNCA 4IPGA 2UU9L 3H0GB 1IBKL 4AQYQ 4HJAA 1CA5A 5M3FH 4L5SA 2NVQH 1J6QA 5EQ0A 3OTOQ 4YHHQ 2UXDQ 1TWAB 1STAA 2A1AA 1K9MC 4J15A 4NXMQ 4DUZL 2XTIA 1Y8NB 2VUMH 4QCLA 2R93G 2E2JB 1EEID 1MJCA 1MIUA 4WRDA 5IODA 3PQIA 4XQJA 4U68A 4J8QA 1BBUA 1L1OB 3NHHA 3U4VA 3S17B 2F0DA 5IP9H 1QG7A 4GKKL 4HN7A 4N8FA 1H9SA 1NTGA 3BVGA 3DEPA 1L0WA 3A5ZB 1N9WA 5M5WB 1X32A 4DKAC 1ICFB 4K6LA 4LF6L 2WAQG 5EKLA 1W3SA 3MTSA 4HIMA 3S1MH 3T53B 4L5TA 1VQ5A 3E3XA 4KK7A 3WOEA 5F2DA 1EU3A 1J5EQ 2F0IA 5AJ3L 1HNXQ 1PRTC 2H4OA 4A76A 3R2IA 3U9OA 2SDFA 3RZDB 4ZAIA 1TU2B 3F2UA 3H3VC 1B2TA 1E0BA 5I9PA 1F9QA 1WFQA 4NXNL 3AFQA 2QEXA 2KEDA 1HNWQ 4LWCA 4IURA 3MA2B 2DY8A 1BF4A 2D0PA 5IT9L 3CMAA 2O5JC 2R93B 1MI2A 2YV5A 1RIPA 4RWSC 2BE5C 4BXXG 4A3CH 4KD3A 5LHY1 5E3FA 1VQIA 3VR5A 1SJED 1S5ED 4ZK9B 4UP8A 4DV3L 2F0JA 3G4SA 1PRTD 1GUSA 2NBFA 1VQLA 4DGZA 3K5LA 4KKUA 4DK0A 4DV6L 3U9SA 2WAQB 5C4XG 3CQZB 4KN7C 1FJGL 3K7AB 3AB9A 1XMQQ 3GTJB 2B3GA 4OO1G 2B63H 1HA6A 1F9RA 3DEOA 3HFZB 5CYUA 1NNXA 1T5XD 2PW5A 1WYDA 5CV5A 4CJ2C 3BS1A 3C1FA 4ULLA 1O7ZA 3T1YL 2ID0A 3P75A 1PTOB 1GHJA 2F0UA 3MXNB 3WWVA 3E0JA 2JSOA 4CDEC 2KVMA 2EYLA 1HZCA 4A75A 1QWYA 4DPGA 4HSPA 1WJJA 3H0GH 1KHIA 1QJOA 5G3LD 4HCEA 3H15A 4A93G 1R4QB 1DONA 1YHQA 1TWAH 4RCNA 4BBSG 2A6EC 3I4MG 3PF4A 4GOPB 3D6CA 4CBVA 3NBHB 2OQ0A 3CCVA 3PV0A 3IAYA 2E2JH 3LWEA 4GN5A 5IE8A 4JI6Q 1TS2A 4RCOA 3T1HQ 3S17H 4N9TA 2AHOB 1ZXTA 2F0EA 5L37A 3JC66 1K8AC 3KLSA 2K14A 2XWBB 5C4XB 1VMPA 1JE4A 2IWHA 1ZEQX 4R4OA 4L5QA 1A63A 4JI0Q 2HCCA 2JA7G 5BR8Q 3ICEA 3AFPA 4KJNA 4JK1C 3SK6A 1V9PA 1NMGA 4ALPA 1E2WA 5FKAC 1AP0A 4K14A 2PQEA 1H9RA 4RA8A 5E4XA 4KKSA 1UWVA 4DV7L 1LV9A 4WJ4A 5J1ZA 2M9VA 4DR1L 1PFBA 5IGGA 1VQEA 1SYEA 5IGBA 4HJ5A 1YEZA 4LUOA 3S14B 4J1MA 4R4TA 1PTOF 3RZDH 1LT4D 3DWPA 3NSWA 2MO0A 2C5CA 2WINB 4A93B 1Q46A 4BBSB 4CDDC 4PMWA 3I4MB 4A3FG 2SEBD 2R93H 1YNJD 2IPKD 3M4YA 3STBC 3L3OC 3HOWG 1EQRA 1G291 3NENA 2LXJA 4GNXB 3I8ZA 3OWEB 3Q6SA 3TREA 4OONA 3T4AC 2R3ZA 2HIVA 3FVQA 1PZID 4IPCA 4NMZA 3S1NB 1SSOA 2HDMA 3TQYA 2NVTB 2NYZD 1B1ZA 2JQOA 2JA7B 3KK7A 2EQSA 1E22A 1I4RA 4HJ7A 3GTJH 3VYTA 1LT6D 5D3DA 4DR7L 2JXMB 3H09A 3BZDB 4A4IA 4QF4A 4YCWA 2SOBA 4LF5Q 4L6TB 1PTOH 2F0QA 1CKNB 2PQAB 3AU7A 4JYAL 5IGDA 1N8RC 3PUYA 3TEHB 1JOKA 3A56A 1VCIA 1YIJA 1BCPC 4GZYC 1IBLL 3H3VI 3ER0A 5A2QE 4JI7Q 3BZCA 3CXCA 2ZM6Q 4A3FB 3NEMA 2IW3A 1HR0W 3Q8DA 1W6KA 1Q1BA 3ULPA 3TP5A 3S24A 4BXXH 5EKIA 3HOWB 2CH4A 4FF2A 2UUBQ 1K8GA 1SYGA 2L12A 2IHEA 4ILWA 2ATWA 1L1OA 4FXGC 1LTSD 2OTJA 3J7A5 3W1BA 3K81C 3QJYA 3BYTB 4OWTB 3RLOA 1C9OA 2C9OA 3HEJA 4A3IH 4G4KA 5C4XH 2UUAQ 1DOMA 1LO5D 2F3IA 2OTLA 4LNQA 5FO9B 2BCOA 5FK9C 2KCNA 2HCIA 4OX9L 1HFNA 4HAEA 2K5QA 1A8VA 1WD1A 1K28A 1BOSA 1EUJA 4UAIA 2D62A 3S14H 2F0WA 3T51B 1HNZL 3HS0C 4A93H 3SGIA 4DV5Q 1JB3A 3HGBA 1G2SA 4DK3C 2JEBI 4BBSH 1XTDA 3Q24A 1PH8A 3I4MH 1EY9A 1EY7A 3D4DA 2I5LX 3NP8A 4PMBA 1XNQQ 3BDCA 4NW2A 4JW0A 2MJ8A 1HHVA 5DAUA 4LF4L 4R8NA 4DR2L 2F1MA 4YY3Q 4LF9L 1FGUA 4DV1Q 5E7NA 3OYYA 4KN4C 4IALA 3S1NH 1EWIA 2RF4A 1KLGD 3CD6A 2EOTA 2RHQB 3BG3A 5K36G 1VS0A 2B2TA 4M8AA 1E1OA 4JI8L 3VA7A 4EVOA 4PZ8A 1LUZA 1RD9D 1S5CD 4LJZC 3DWAA 4B3TL 2TMPA 4DV0Q 2F3WA 5D3IB 4JV5L 3A7LA 1TWFB 2I07B 3U58A 1V1QA 2IJ0A 1ASYA 3MXNA 2UUCL 1KLUD 1K8MA 4G7HC 3GD7A 1M8AA 1VDZA 1FR3A 1J8IA 1VQBA 3I2ZA 3WDNA 2K01A 1RKNA 4Q0FA 4K8JA 1H9SB 4FF4A 5IWAQ 1JWMD 1HR0L 3NPPA 2VQFQ 4HJ8A 1II3A 3FPPA 3FHWA 1W2BA 1DZ1A 1JT8A 2C35B 1SXTA 1EFWA 2HHHQ 2EJGC 2F0NA 2K1BA 4GOPA 1E24A 4AQYL 4DF7A 1SNMA 2HIXA 1R9TB 1EQTA 1A0IA 3OTOL 3M7GA 2BOSA 4YHHL 4POGA 4IZ8A 3A5UA 2EVBA 4BY1G 1DOKA 2JA9A 1CM9A 2K03A 3U50C 4NXML 2XSCA 1NR4A 1JWUD 4LAAA 3H6MA 3HZXA 4DAPA 4RH6A 2K4KA 1YHAA 4B08A 1C0AA 5KIXA 4K2KA 1M90C 3CCJA 3K57A 2NB0A 1I6VC 2DN8A 4OGQC 2Z6BA 2R92G 1FNWA 1AW7A 1NE3A 3GTKB 4JOIA 1RHPA 2QW7A 1I3QB 1NCVA 4JG2A 4L8JA 1H9KA 3CKIB 1IYUA 1M1KC 2LFNA 1PFMA 4V0BA 2X6GA 3KLWA 4R1JA 3IKJA 2Z6KA 2N78A 1A6XA 4A3BG 1H9MA 4C3HG 1TQOA 3N52A 4AYBG 1J5EL 1SN8A 1KDBA 3OMCA 4DAVA 3DUZA 5JVG3 1HNXL 1GD7A 2F4VQ 2WACA 2K04A 2Z4HA 4EGVA 2ZJPA 2MUYA 2BDOA 1QNUA 3CRLC 1K3BC 1HNWL 4BY1B 2RA4A 1IKMA 1JWSD 1DM0B 1I94Q 5IGCA 4V190 1SDFA 2DGYA 2KEEA 2B2WA 1GUNA 5HGQA 1LT3D 1O80A 1CKOA 2MFIA 1EOTA 3F2BA 1HA5A 3OHXC 1PV4A 2KCMA 1O7IA 2B2YC 4IJHA 2R92B 2VL6A 3PSIA 4Y52H 1BXTA 3PIPA 1TWFH 5CV8A 4RGMA 1CA6A 3AYHB 4XDXA 1K0SA 2EY1A 4HJ9A 3PF5A 1CKNA 4IUUA 2E74C 3QR8A 3F2CA 2HD3A 3I55A 3TMEA 1GXDC 4A3BB 5C0XH 4C3HB 1U4MA 2A6HD 4AYBB 1OXSC 5JEAH 1XNRQ 3UI2A 1G6ZA 3BVZA 3DM3A 2KHSA 5C0XI 4ZKBB 1EOVA 2ASBA 1R9TH 3RN5A 4DR5Q 1TR5A 1K3RA 2GVAA 1DOLA 3ULJA 4I65A 3K5NA 1QCBD 1ZKOA 1HQMC 3OSOA 5K36H 4QB4A 3Q22A 4OIKA 1I6HH 3SK5A 1PH5A 4JI6L 4FXKC 4BBRB 1UAPA 1VQCA 4DR6Q 1MHWC 2ZTDA 1GJXA 4FDBA 3GTLB 3GTKH 1F77A 2Q2IA 1PH9A 4P71A 1I3QH 4JI0L 4H02A 1V1PA 2A74C 5BR8L 2I5HA 3M4PA 1CTMA 3TDQA 2YTVA 2NVYH 5A2QL 3BDOA 3C3LA 2NN6H 4MN3A 2Z0SA 5KYIA 4A3EG 4DR4Q 4KI0A 3L0OA 2R6GA 1MJEA 5ELFA 1X65A 1NBWA 2M00A 1T5EA 2K33A 4DAMA 1F9SA 4JVZA 1L1OC 1AFPA 2CFMA 2NN6I 1XWEA 1X54A 2IX3A 3M85A 1MBYA 1SE4A 2OEOA 4G7OC 1OXVA 4BY1H 1XMOQ 2Q2TA 3TS0A 1WTHA 5KYLA 4WJ3M 3U4ZA 1QUQB 1KQSA 1CK1A 1PH7A 1AEXA 3VR6A 2ZTCA 1QZHA 1V43A 1TWHB 3E5SA 1GUGA 1LTAD 4HIOA 3QOLA 2EY6A 4JI2Q 1CHQD 1TXYA 2R92H 5JJIA 1DCZA 1P8LA 4UP9A 4KKTA 3RLNA 3TP8A 1RTOA 1DYQA 4JBKA 4LF8L 1SMXA 2KENA 4OXPA 1KD1C 4O1NA 1GUOA 1YHBA 5C5MA 2YTYA 3TSSA 4LF5L 1Y1VG 4X65Q 1MSGA 3HOZG 4HEDA 5EBCA 1E2ZA 4F87A 3PIP3 1B44D 1JORA 2AKWB 3Q23A 3NBIA 1Q7YC 1QOHA 1HUMA 2K50A 3CCSA 1Y1WG 5C4ZA 1Z47A 4DXFA 5A35A 2EDGA 1N33Q 1T9HA 1X3EA 4JI7L 2ZM6L 1STEA 4IPDA 2EYPA 2B2TC 3X3MA 1WTVA 3CC4A 3TZDA 1E7ZA 4A3DH 4YWKA 4X66L 3K59A 1YI2A 3LX0A 1PH2A 4LUVA 1EYAA 2K28A 2UUBL 4P74A 5IY0A 2VW9A 4KV6A 1PTOC 4BBRH 1IBMQ 2NVXB 1M4VA 2FMCA 4R8IA 4CDCC 4FVMA 3MZ5A 3S2HB 1A3VA 4M1UB 1VF7A 1EY5A 2B2UC 2UUAL 2J4XA 1MKHA 1WD0A 3E9HA 2QGQA 1GUTA 1RF2D 2PZTA 3E6ZX 2WB1G 1WI5A 2R7ZG 5I9OA 1F2LA 2BH8A 2H1EA 5M3MG 3X3NA 1AZPA 3G7LA 2KHIA 5GQOA 1Y1VB 1PHJA 3HOZB 1TS3A 2VB3X 2VNUD 3V05A 4BS9A 1D1IA 1CHPD 3CW2C 3QWNA 2F0LA 2WP8J 3R2TA 2E75C 4Z9CB 4QIWB 1TWCB 3JAME 2RBMA 2E5LQ 3G48A 2RSOA 3A8IE 2N49A 3VA5A 4DV5L 3K7UC 4F88A 1CZWA 2JEAI 2BE5D 2V4DA 3PO3G 4L63B 1XNQL 4IUPA 5M9OA 5CR3A 2XRQD 2OXPA 3RMHA 1GO3E 5LL6S 4A3GG 1EIHA 2PMZE 1PFNA 4DV1L 1HZBA 1PRTB 1A2TA 2L55A 2ALYB 4KY5A 1VQHA 4IUNA 3MAQA 5ELOA 1G91A 2ZXOA 1GHKA 2D2CC 2KUMA 4XT1B 1LTGD 5ISRA 3OWFA 3K80C 2WB1B 1HFGA 1PH6A 4I7ZC 2UXCQ 1A62A 1AE2A 1BO0A 5M3MB 1GOZA 1C48A 5JOBA 3CCQA 2RDGA 3G6JB 4O2DA 4LFAQ 2E2HB 2VY3A 2MNAA 1C7YA 4DV0L 4EX5A 5FJ8G 5D14A 2ENBA 4GLVB 4UHVA 2F0HA 2Z1CA 3ZJYC 3DHQA
chains in the Genus database with same CATH topology
2I0QA 3W1GA 4NB3A 4OWXB 1JJGA 4XTCS 4DV2Q 3GDEA 5M5WH 3HOVH 1A8VA 1EUJA 1X56A 3HOZH 4JYAQ 1PYSB 1IL2A 1N32Q 4JC0A 4GNXC 1U0LA 2Y0SE 3E0EA 2D62A 4NPSA 1CKMA 3K0XA 2ZTEA 2EIFA 2K5VA 3S14H 4A3BH 5IWAL 2AWNA 4C3HH 1HNZL 4A93H 1N36Q 4MNOA 3F1ZA 3SGIA 4IFDJ 1Q86C 1AH9A 4DV5Q 4GNXA 2VQFL 4DK3C 1VQAA 2JEBI 2JA8G 4BBSH 1XTDA 2LXKA 3CCMA 3BZKA 1PH8A 3I4MH 1G6PA 2I5LX 2DUDA 3HKZE 2OQKA 1H95A 3G6EA 2NZOA 5LMUL 2HHHL 1XNQQ 4A3DG 1WCMH 1LTLA 3I7FA 1L2FA 1K0RA 3HOYH 4X62Q 4LF4L 4DR2L 4LF9L 2VQEL 4YY3Q 1FGUA 1BKBA 1PYBA 4DV1Q 4LFCQ 5E7NA 3JAMc 2CWPA 3OYYA 2NVXH 3A0JA 2KBNA 4BBRG 4KHPL 3S1NH 5C3EG 1EWIA 1SE8A 2RF4A 4APVA 3CD6A 4KLKA 2RHQB 5K36G 1VS0A 1DGSA 1B7YB 4ME3A 4JI1L 2PQAA 1KIXA 1E1OA 4JI8L 5IYBG 4PZ8A 1LUZA 4A3CG 2A8VA 1Y1VH 2IX0A 1S3OA 4YWLA 2E8GA 3CPWA 3F2DA 4BA1I 4B3TL 2CWAA 3HOUG 1Q1EA 4OX9Q 4YCVA 4DV0Q 2JK8A 1YZ6A 4JV5L 1KRSA 4RMFA 3GTLH 1GM5A 2JA5H 4AYBE 3U58A 4LFBQ 1V1QA 3UDIA 3ULLA 1CUKA 1SROA 1ASYA 1QVGA 2UUCL 3CQZH 4IPHA 1JE5A 3OW2A 4X64L 3K7AH 1VQKA 1YITA 1LYLA 3GD7A 4BA2I 2IT1A 1VQBA 2YYZA 3I2ZA 2F52A 5C44H 3UE0A 3J81c 4A3LG 5IWAQ 2JE6I 1HNZQ 4B3RL 4MZ9A 3STBD 1HR0L 4GOPC 4DV2L 4PG3A 2VQFQ 3EIVA 4HJ8A 4B3ML 2F4VL 3GO5A 3FHWA 1B70B 1W2BA 1BBWA 1P16A 1QVFA 1JT8A 2C35B 1UE5A 1EFWA 5LMUQ 2Y0SG 3DLLA 2HHHQ 4GOPA 1QUQA 1E24A 4AQYL 1B8AA 4QJFA 3TS2A 2HIXA 4LF9Q 4LF4Q 4DR2Q 2VQEQ 3M7NA 1X3GA 2WFWA 4O0AA 3H0GG 1A0IA 2NZHA 3OTOL 4TQUS 4DK6C 4YHHL 1EQQA 1FVIA 3MEFA 4POGA 5FLMH 1X6OA 3A5UA 1I94L 4BY1G 1OTCA 3I4NH 3HKZG 4KHPQ 2JA9A 4DV4L 1IZ6A 3U50C 2BA1A 3UE1A 4NXML 4A3IG 1UE6A 4HIDA 1PVOA 5GAHC 4A3KG 1BVSA 4YY3L 2K4KA 4JBMA 2WAQE 1YHAA 1TWHH 3CCLA 3A74A 1KXLA 3CCEA 2K75A 4JI8Q 1C0AA 4JOIC 1YJWA 2KCTA 4MTNA 1M90C 1YVCA 3CCJA 3J80i 4Y7NH 4DAYB 4B3TQ 2K5HA 1OXTA 3HOXG 2R92G 1ASZA 1NE3A 3KF8B 4JV5Q 4X6AH 4JOIA 4LUZA 5JJLA 2Z6KC 4JG2A 5LMNW 1M1KC 2UUCQ 3CC2A 3CPFA 4LF7Q 3CP0A 2EXDA 3KLWA 4X64Q 2H5XA 4R1JA 4UP7A 1VQDA 4A3EH 4GN3B 2Z6KA 1KL9A 4A3JH 2N78A 2IHFA 1KAWA 4A3BG 3CMEA 1XNRL 4GKJL 4AYBG 2VZAA 3KF6B 1J5EL 1SN8A 2GVBA 4B3RQ 1HZAA 4JCVE 1HR0Q 2YU9H 2V1CC 4OO1I 1HNXL 2IY5B 1NY4A 1Q81C 4B3SL 1GD7A 1Q8KA 1UEBA 4B3MQ 2FXQA 2F4VQ 4A3GH 2BA0A 2A19A 2OWOA 3UDGA 2ZJPA 4IOCA 4IPGA 2IX1A 2UU9L 4DR5L 1IBKL 4AQYQ 4HJAA 3HOYG 5M3FH 4L5SA 3GTOH 3S2DH 2NVQH 1HNWL 1J6QA 3L2PA 3E9IA 3OTOQ 4JBJA 4YHHQ 2UXDQ 1S72A 2ZJQA 1I94Q 2A1AA 1K9MC 1UE7A 1QVCA 4J15A 4DV4Q 4NXMQ 3I4OA 4DUZL 2XTIA 1N34L 2VUMH 2DGYA 1SLJA 2R93G 2HQLA 1MJCA 1MIUA 1Z9FA 5HGQA 2UXBL 4BY7G 1U5KA 1BBUA 1L1OB 1CKOA 3U4VA 4QY7A 2MFIA 3F2BA 2CQOA 5IP9H 1PV4A 4DR6L 2KCMA 1X3FA 4GKKL 5IP7G 4IOAA 1O7IA 4IJHA 2VL6A 1CSQA 3PSIA 1NTGA 2HT1A 3S2HH 4IFDI 4Y52H 3PIPA 1TWFH 1L0WA 3IRBA 3A5ZB 1N9WA 3T1YQ 2NVTH 3AYHB 4QQBX 3RNUA 1Q12A 4GLAC 4DKAC 4JI4L 4LF6L 4HJ9A 2JA7H 3PF5A 1CKNA 2WAQG 1W3SA 4HIMA 4PZ6A 3F2CA 5EAYA 2VS1A 3S1MH 3I55A 2JJQA 4L5TA 2JA6G 4DR4L 1OXUA 2BH2A 1VQ5A 3KDFB 3CC7A 1OXSC 3M4OH 4K0KL 1XNRQ 2LSSA 4GKJQ 2R7DA 4R4QA 2I5MX 3PCOB 1J5EQ 3PUVA 3DM3A 2CKZB 4LF7L 1Y1WH 1UE1A 4C3IH 5AJ3L 1HNXQ 5FLXc 2Q2UA 3J81j 4A76A 4B3SQ 5C0XI 1TWCH 2K52A 1EOVA 2ASBA 1VQOA 2GN5A 4AIMA 1NJIC 3UDFA 4IO9A 3JAMi 1R9TH 3RN5A 4DUYL 2UU9Q 4DR5Q 1XMOL 1K3RA 1IBKQ 1NMFA 2GVAA 1WFQA 4NXNL 3AFQA 2QEXA 3ULJA 5C3EH 2PI2A 4A3FH 1HNWQ 3G71A 1D7QA 4LWCA 2CCZA 2D0PA 4A3MG 3CMAA 4GS3A 4IJLA 1WOCA 1TWGH 3HOWH 2YV5A 1I6HH 1HH2P 1RIPA 5IYBH 1HJPA 4C3JH 4P72A 4DUZQ 1PH5A 3PUXA 1N34Q 4JI6L 3FKIG 3K8AA 4LF8Q 4A3CH 3PIOA 1VQIA 2UXBQ 5IYCG 2RCNA 4JI2L 4UP8A 4DV3L 3HOUH 1VQCA 3S15H 1VQJA 3G4SA 4DR6Q 2UXDL 1HZ9A 4GKKQ 3PUZA 3KYHC 2ZTDA 4PZ7A 1VQLA 1PFSA 3BU2A 3LGJA 4FDBA 3J80c 5LMNL 3H3VH 3GTKH 2Q2IA 1PH9A 3I56A 3CAMA 3KF6A 4DV6L 2MQHA 4P71A 2R7ZH 1I3QH 4JI0L 1VQ6A 5C4XG 5M3MH 4H02A 4P73A 1FJGL 5BR8L 2I5HA 4JI4Q 4L5RC 3M4PA 4LF6Q 2Q2HA 1XMQQ 2B3GA 2YTVA 2B63H 4OO1G 2NVYH 3J7ZC 4TVAB 4P75A 2E2HH 3HFZB 1Y14B 4QIWE 3PO2G 3S1QH 1WYDA 2Z0SA 4C2MH 4A3EG 4DR4Q 4KI0A 3L0OA 3T1YL 2R6GA 1MJEA 1X65A 2ID0A 3GTQH 4K0KQ 1NBWA 1GVPA 1XPOA 3MXNB 4LW1A 3WWVA 2KHJA 4QL5A 4DAMA 1EIYB 1L1OC 3HOVG 2CFMA 1HZCA 5AJ3Q 2NN6I 4A75A 1X54A 4X66Q 4DPGA 3M85A 1N33L 1XJVA 2E2JH 1JB7A 4GLXA 1WJJA 4DNIA 4JI3L 3H0GH 2PNHA 2K5NA 1JJCB 1KHIA 3FP9A 2AWOA 1FL0A 4DUYQ 1OXVA 3S1RH 3H15A 1K83H 1YJNA 4A93G 3PO3H 4BY1H 1SRUA 5M3FG 5M5XH 1VQ4A 1XMOQ 1KC8C 1IXRA 4NXNQ 2Q2TA 2PI2E 4JBWA 3TS0A 1YHQA 1TWAH 3KOJA 4BBSG 1SR3A 5GAEC 4QGUA 2XGTA 3I4MG 3U4ZA 3PF4A 4A3KH 4WJ3M 4GOPB 1QUQB 4AH6A 1X9NA 1KQSA 3GTPH 3NBHB 2OQ0A 3CCVA 2WB1E 3PV0A 1PH7A 1SFOH 1E1TA 2L15A 2ZTCA 1WCMG 1V43A 1QZHA 1Q82C 4GN5A 5IE8A 2VUMG 1IBML 4JI6Q 4EQ5A 3S16H 3PGZA 3T1HQ 2YTXA 4HIOA 3GTGH 3S17H 2AHOB 4POFA 4JI5L 1PA6A 3JC66 2RHSB 1K8AC 1D8LA 2OCEA 4KHZA 1CSPA 1TXYA 2N8NA 4JI2Q 5IP9G 3HOXH 4DV3Q 2R92H 4RG1A 2K14A 5JJIA 1PH3A 2ZJRA 1P8LA 4UP9A 5LMNQ 5J3BA 4YCUA 3RLNA 4R4OA 4L5QA 3KFUA 4DV6Q 4JBKA 1A63A 4LF8L 1SMXA 4JI0Q 2KENA 4OXPA 5GROA 3W5OA 1FJGQ 5BR8Q 2JA7G 2B29A 3AFPA 1KD1C 1VQ7A 3ICEA 3M3YH 1V9PA 1YHBA 1NMGA 5FJ8H 5IT9c 4ALPA 2YTYA 1IBLQ 3RR5A 3B6YA 4LF5L 1Y1VG 5C0XG 4X65Q 5IYDG 3HOZG 5JEAG 1VQ9A 1UWVA 4DV7L 2JA5G 2AKWB 1X55A 4WJ4A 4DR1L 1XMQL 1Q7YC 1VQEA 2K50A 3CCSA 1Y1WG 5GADC 2E2IH 2E5LL 1Z47A 4HJ5A 1YEZA 4LUOA 1N33Q 1T9HA 4R4TA 1X3EA 3RZDH 1OXXK 2MO0A 4JI7L 1I5FA 5C44G 1Q46A 2ZM6L 4JI3Q 2JA8H 4IPDA 3D31A 3RZOH 1VQNA 3CC4A 4OWWB 4PMWA 1PH4A 4A3FG 1G51A 1E7ZA 4A3DH 1VQMA 4YWKA 3CCRA 4X66L 2R93H 1YI2A 2N3SA 3STBC 3CCUA 5M5YH 5C0XJ 3HKSA 5GAGC 1PH2A 4LUVA 4BY7H 2UUBL 3HOWG 5JJKA 4P74A 5IY0A 2VW9A 5JEAJ 1EQRA 1G291 3NENA 4DR3L 5IP7H 2LXJA 5DLQE 4BBRH 4GNXB 1IBMQ 3TREA 4OONA 4JI5Q 2HIVA 1XPRA 4IPCA 3PUWA 1EYGA 2UUAL 5FLMG 2UXCL 1MKHA 3TQYA 3E9HA 3RN2A 3I4NG 1EIFA 2QGQA 3F8TA 3NELA 5HY6A 4UY8C 2WB1G 2JQOA 2EQSA 1E22A 1WI5A 4HJ7A 2R7ZG 5M3MG 2BH8A 3T1HL 3GTJH 2KHIA 4LFAL 2JA6H 5GQOA 3EN2A 4DR7L 1XPUA 2B63G 3KJPA 1PHJA 1VQFA 4R4IA 2NN6G 3RLFA 4A4IA 4YCWA 4LF5Q 1JMCA 2ES2A 3ERSX 2VNUD 1CKNB 2PQAB 3CW2C 4JYAL 5ELNA 4DV7Q 1N32L 1N8RC 2R7FA 2WP8J 3PUYA 3TEHB 4DR1Q 2AMCB 1VQPA 3KJOA 1VCIA 3TRZA 3J81i 3VDYA 2UUBQ 2MO1A 1YIJA 2E5LQ 4A3LH 1IBLL 1AE3A 1N36L 3G48A 4X65L 3H3VI 2N49A 3ER0A 3K7UC 4DV5L 4A3JG 4JI7Q 3BZCA 3CXCA 2ZM6Q 1YBYA 2JEAI 4A3MH 3PO3G 3AEVA 3NEMA 2QA4A 1GKHA 1HR0W 3Q8DA 1Q1BA 1XNQL 3ULPA 4YWMA 4BXXG 3S24A 5IYDH 4UPAA 4BXXH 1GO3E 3FKIH 3AQQA 1LM0A 3L7ZC 4X62L 4A3GG 4JI1Q 1VQGA 1PH1A 5IYCH 1IYJB 2PMZE 4LFCL 1RL2A 1HZBA 3M9BA 4DV1L 3BJUA 1K8GA 2IHEA 1VQ8A 2ALYB 2ATWA 1L1OA 1VQHA 1YNXA 5C4JH 4DR3Q 5ELOA 2OTJA 3J7A5 1KRTA 3W1BA 3EBEA 3K81C 4GN4B 4OWTB 3RLOA 1C9OA 4HIKA 4A3IH 3GTMH 3K80C 5C4XH 2UUAQ 4R4CA 1PH6A 2UXCQ 1A62A 1AE2A 2F3IA 1S40A 4IFDG 2OTLA 3M4QA 3CF5A 4LNQA 1E3PA 1K73C 3CCQA 1I50H 3PO2H 1YJ9A 3D0FA 1JJ2A 4O2DA 4LFAQ 2VY3A 4DR7Q 5H1SE 2MNAA 1C7YA 4DV0L 4EX5A 5FJ8G 4OX9L 2D0OA 4GLVB 4LFBL 3KDFA 4XIGS 3ZJYC 1QZGA 3UDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0Q A;  3W1G A;  4NB3 A;  4OWX B;  1JJG A;  4XTC S;  4DV2 Q;  3GDE A;  5M5W H;  3HOV H;  1A8V A;  1EUJ A;  1X56 A;  3HOZ H;  4JYA Q;  1PYS B;  1IL2 A;  1N32 Q;  4JC0 A;  4GNX C;  1U0L A;  2Y0S E;  3E0E A;  2D62 A;  4NPS A;  1CKM A;  3K0X A;  2ZTE A;  2EIF A;  2K5V A;  3S14 H;  4A3B H;  5IWA L;  2AWN A;  4C3H H;  1HNZ L;  4A93 H;  1N36 Q;  4MNO A;  3F1Z A;  3SGI A;  4IFD J;  1Q86 C;  1AH9 A;  4DV5 Q;  4GNX A;  2VQF L;  4DK3 C;  1VQA A;  2JEB I;  2JA8 G;  4BBS H;  1XTD A;  2LXK A;  3CCM A;  3BZK A;  1PH8 A;  3I4M H;  1G6P A;  2I5L X;  2DUD A;  3HKZ E;  2OQK A;  1H95 A;  3G6E A;  2NZO A;  5LMU L;  2HHH L;  1XNQ Q;  4A3D G;  1WCM H;  1LTL A;  3I7F A;  1L2F A;  1K0R A;  3HOY H;  4X62 Q;  4LF4 L;  4DR2 L;  4LF9 L;  2VQE L;  4YY3 Q;  1FGU A;  1BKB A;  1PYB A;  4DV1 Q;  4LFC Q;  5E7N A;  3JAM c;  2CWP A;  3OYY A;  2NVX H;  3A0J A;  2KBN A;  4BBR G;  4KHP L;  3S1N H;  5C3E G;  1EWI A;  1SE8 A;  2RF4 A;  4APV A;  3CD6 A;  4KLK A;  2RHQ B;  5K36 G;  1VS0 A;  1DGS A;  1B7Y B;  4ME3 A;  4JI1 L;  2PQA A;  1KIX A;  1E1O A;  4JI8 L;  5IYB G;  4PZ8 A;  1LUZ A;  4A3C G;  2A8V A;  1Y1V H;  2IX0 A;  1S3O A;  4YWL A;  2E8G A;  3CPW A;  3F2D A;  4BA1 I;  4B3T L;  2CWA A;  3HOU G;  1Q1E A;  4OX9 Q;  4YCV A;  4DV0 Q;  2JK8 A;  1YZ6 A;  4JV5 L;  1KRS A;  4RMF A;  3GTL H;  1GM5 A;  2JA5 H;  4AYB E;  3U58 A;  4LFB Q;  1V1Q A;  3UDI A;  3ULL A;  1CUK A;  1SRO A;  1ASY A;  1QVG A;  2UUC L;  3CQZ H;  4IPH A;  1JE5 A;  3OW2 A;  4X64 L;  3K7A H;  1VQK A;  1YIT A;  1LYL A;  3GD7 A;  4BA2 I;  2IT1 A;  1VQB A;  2YYZ A;  3I2Z A;  2F52 A;  5C44 H;  3UE0 A;  3J81 c;  4A3L G;  5IWA Q;  2JE6 I;  1HNZ Q;  4B3R L;  4MZ9 A;  3STB D;  1HR0 L;  4GOP C;  4DV2 L;  4PG3 A;  2VQF Q;  3EIV A;  4HJ8 A;  4B3M L;  2F4V L;  3GO5 A;  3FHW A;  1B70 B;  1W2B A;  1BBW A;  1P16 A;  1QVF A;  1JT8 A;  2C35 B;  1UE5 A;  1EFW A;  5LMU Q;  2Y0S G;  3DLL A;  2HHH Q;  4GOP A;  1QUQ A;  1E24 A;  4AQY L;  1B8A A;  4QJF A;  3TS2 A;  2HIX A;  4LF9 Q;  4LF4 Q;  4DR2 Q;  2VQE Q;  3M7N A;  1X3G A;  2WFW A;  4O0A A;  3H0G G;  1A0I A;  2NZH A;  3OTO L;  4TQU S;  4DK6 C;  4YHH L;  1EQQ A;  1FVI A;  3MEF A;  4POG A;  5FLM H;  1X6O A;  3A5U A;  1I94 L;  4BY1 G;  1OTC A;  3I4N H;  3HKZ G;  4KHP Q;  2JA9 A;  4DV4 L;  1IZ6 A;  3U50 C;  2BA1 A;  3UE1 A;  4NXM L;  4A3I G;  1UE6 A;  4HID A;  1PVO A;  5GAH C;  4A3K G;  1BVS A;  4YY3 L;  2K4K A;  4JBM A;  2WAQ E;  1YHA A;  1TWH H;  3CCL A;  3A74 A;  1KXL A;  3CCE A;  2K75 A;  4JI8 Q;  1C0A A;  4JOI C;  1YJW A;  2KCT A;  4MTN A;  1M90 C;  1YVC A;  3CCJ A;  3J80 i;  4Y7N H;  4DAY B;  4B3T Q;  2K5H A;  1OXT A;  3HOX G;  2R92 G;  1ASZ A;  1NE3 A;  3KF8 B;  4JV5 Q;  4X6A H;  4JOI A;  4LUZ A;  5JJL A;  2Z6K C;  4JG2 A;  5LMN W;  1M1K C;  2UUC Q;  3CC2 A;  3CPF A;  4LF7 Q;  3CP0 A;  2EXD A;  3KLW A;  4X64 Q;  2H5X A;  4R1J A;  4UP7 A;  1VQD A;  4A3E H;  4GN3 B;  2Z6K A;  1KL9 A;  4A3J H;  2N78 A;  2IHF A;  1KAW A;  4A3B G;  3CME A;  1XNR L;  4GKJ L;  4AYB G;  2VZA A;  3KF6 B;  1J5E L;  1SN8 A;  2GVB A;  4B3R Q;  1HZA A;  4JCV E;  1HR0 Q;  2YU9 H;  2V1C C;  4OO1 I;  1HNX L;  2IY5 B;  1NY4 A;  1Q81 C;  4B3S L;  1GD7 A;  1Q8K A;  1UEB A;  4B3M Q;  2FXQ A;  2F4V Q;  4A3G H;  2BA0 A;  2A19 A;  2OWO A;  3UDG A;  2ZJP A;  4IOC A;  4IPG A;  2IX1 A;  2UU9 L;  4DR5 L;  1IBK L;  4AQY Q;  4HJA A;  3HOY G;  5M3F H;  4L5S A;  3GTO H;  3S2D H;  2NVQ H;  1HNW L;  1J6Q A;  3L2P A;  3E9I A;  3OTO Q;  4JBJ A;  4YHH Q;  2UXD Q;  1S72 A;  2ZJQ A;  1I94 Q;  2A1A A;  1K9M C;  1UE7 A;  1QVC A;  4J15 A;  4DV4 Q;  4NXM Q;  3I4O A;  4DUZ L;  2XTI A;  1N34 L;  2VUM H;  2DGY A;  1SLJ A;  2R93 G;  2HQL A;  1MJC A;  1MIU A;  1Z9F A;  5HGQ A;  2UXB L;  4BY7 G;  1U5K A;  1BBU A;  1L1O B;  1CKO A;  3U4V A;  4QY7 A;  2MFI A;  3F2B A;  2CQO A;  5IP9 H;  1PV4 A;  4DR6 L;  2KCM A;  1X3F A;  4GKK L;  5IP7 G;  4IOA A;  1O7I A;  4IJH A;  2VL6 A;  1CSQ A;  3PSI A;  1NTG A;  2HT1 A;  3S2H H;  4IFD I;  4Y52 H;  3PIP A;  1TWF H;  1L0W A;  3IRB A;  3A5Z B;  1N9W A;  3T1Y Q;  2NVT H;  3AYH B;  4QQB X;  3RNU A;  1Q12 A;  4GLA C;  4DKA C;  4JI4 L;  4LF6 L;  4HJ9 A;  2JA7 H;  3PF5 A;  1CKN A;  2WAQ G;  1W3S A;  4HIM A;  4PZ6 A;  3F2C A;  5EAY A;  2VS1 A;  3S1M H;  3I55 A;  2JJQ A;  4L5T A;  2JA6 G;  4DR4 L;  1OXU A;  2BH2 A;  1VQ5 A;  3KDF B;  3CC7 A;  1OXS C;  3M4O H;  4K0K L;  1XNR Q;  2LSS A;  4GKJ Q;  2R7D A;  4R4Q A;  2I5M X;  3PCO B;  1J5E Q;  3PUV A;  3DM3 A;  2CKZ B;  4LF7 L;  1Y1W H;  1UE1 A;  4C3I H;  5AJ3 L;  1HNX Q;  5FLX c;  2Q2U A;  3J81 j;  4A76 A;  4B3S Q;  5C0X I;  1TWC H;  2K52 A;  1EOV A;  2ASB A;  1VQO A;  2GN5 A;  4AIM A;  1NJI C;  3UDF A;  4IO9 A;  3JAM i;  1R9T H;  3RN5 A;  4DUY L;  2UU9 Q;  4DR5 Q;  1XMO L;  1K3R A;  1IBK Q;  1NMF A;  2GVA A;  1WFQ A;  4NXN L;  3AFQ A;  2QEX A;  3ULJ A;  5C3E H;  2PI2 A;  4A3F H;  1HNW Q;  3G71 A;  1D7Q A;  4LWC A;  2CCZ A;  2D0P A;  4A3M G;  3CMA A;  4GS3 A;  4IJL A;  1WOC A;  1TWG H;  3HOW H;  2YV5 A;  1I6H H;  1HH2 P;  1RIP A;  5IYB H;  1HJP A;  4C3J H;  4P72 A;  4DUZ Q;  1PH5 A;  3PUX A;  1N34 Q;  4JI6 L;  3FKI G;  3K8A A;  4LF8 Q;  4A3C H;  3PIO A;  1VQI A;  2UXB Q;  5IYC G;  2RCN A;  4JI2 L;  4UP8 A;  4DV3 L;  3HOU H;  1VQC A;  3S15 H;  1VQJ A;  3G4S A;  4DR6 Q;  2UXD L;  1HZ9 A;  4GKK Q;  3PUZ A;  3KYH C;  2ZTD A;  4PZ7 A;  1VQL A;  1PFS A;  3BU2 A;  3LGJ A;  4FDB A;  3J80 c;  5LMN L;  3H3V H;  3GTK H;  2Q2I A;  1PH9 A;  3I56 A;  3CAM A;  3KF6 A;  4DV6 L;  2MQH A;  4P71 A;  2R7Z H;  1I3Q H;  4JI0 L;  1VQ6 A;  5C4X G;  5M3M H;  4H02 A;  4P73 A;  1FJG L;  5BR8 L;  2I5H A;  4JI4 Q;  4L5R C;  3M4P A;  4LF6 Q;  2Q2H A;  1XMQ Q;  2B3G A;  2YTV A;  2B63 H;  4OO1 G;  2NVY H;  3J7Z C;  4TVA B;  4P75 A;  2E2H H;  3HFZ B;  1Y14 B;  4QIW E;  3PO2 G;  3S1Q H;  1WYD A;  2Z0S A;  4C2M H;  4A3E G;  4DR4 Q;  4KI0 A;  3L0O A;  3T1Y L;  2R6G A;  1MJE A;  1X65 A;  2ID0 A;  3GTQ H;  4K0K Q;  1NBW A;  1GVP A;  1XPO A;  3MXN B;  4LW1 A;  3WWV A;  2KHJ A;  4QL5 A;  4DAM A;  1EIY B;  1L1O C;  3HOV G;  2CFM A;  1HZC A;  5AJ3 Q;  2NN6 I;  4A75 A;  1X54 A;  4X66 Q;  4DPG A;  3M85 A;  1N33 L;  1XJV A;  2E2J H;  1JB7 A;  4GLX A;  1WJJ A;  4DNI A;  4JI3 L;  3H0G H;  2PNH A;  2K5N A;  1JJC B;  1KHI A;  3FP9 A;  2AWO A;  1FL0 A;  4DUY Q;  1OXV A;  3S1R H;  3H15 A;  1K83 H;  1YJN A;  4A93 G;  3PO3 H;  4BY1 H;  1SRU A;  5M3F G;  5M5X H;  1VQ4 A;  1XMO Q;  1KC8 C;  1IXR A;  4NXN Q;  2Q2T A;  2PI2 E;  4JBW A;  3TS0 A;  1YHQ A;  1TWA H;  3KOJ A;  4BBS G;  1SR3 A;  5GAE C;  4QGU A;  2XGT A;  3I4M G;  3U4Z A;  3PF4 A;  4A3K H;  4WJ3 M;  4GOP B;  1QUQ B;  4AH6 A;  1X9N A;  1KQS A;  3GTP H;  3NBH B;  2OQ0 A;  3CCV A;  2WB1 E;  3PV0 A;  1PH7 A;  1SFO H;  1E1T A;  2L15 A;  2ZTC A;  1WCM G;  1V43 A;  1QZH A;  1Q82 C;  4GN5 A;  5IE8 A;  2VUM G;  1IBM L;  4JI6 Q;  4EQ5 A;  3S16 H;  3PGZ A;  3T1H Q;  2YTX A;  4HIO A;  3GTG H;  3S17 H;  2AHO B;  4POF A;  4JI5 L;  1PA6 A;  3JC6 6;  2RHS B;  1K8A C;  1D8L A;  2OCE A;  4KHZ A;  1CSP A;  1TXY A;  2N8N A;  4JI2 Q;  5IP9 G;  3HOX H;  4DV3 Q;  2R92 H;  4RG1 A;  2K14 A;  5JJI A;  1PH3 A;  2ZJR A;  1P8L A;  4UP9 A;  5LMN Q;  5J3B A;  4YCU A;  3RLN A;  4R4O A;  4L5Q A;  3KFU A;  4DV6 Q;  4JBK A;  1A63 A;  4LF8 L;  1SMX A;  4JI0 Q;  2KEN A;  4OXP A;  5GRO A;  3W5O A;  1FJG Q;  5BR8 Q;  2JA7 G;  2B29 A;  3AFP A;  1KD1 C;  1VQ7 A;  3ICE A;  3M3Y H;  1V9P A;  1YHB A;  1NMG A;  5FJ8 H;  5IT9 c;  4ALP A;  2YTY A;  1IBL Q;  3RR5 A;  3B6Y A;  4LF5 L;  1Y1V G;  5C0X G;  4X65 Q;  5IYD G;  3HOZ G;  5JEA G;  1VQ9 A;  1UWV A;  4DV7 L;  2JA5 G;  2AKW B;  1X55 A;  4WJ4 A;  4DR1 L;  1XMQ L;  1Q7Y C;  1VQE A;  2K50 A;  3CCS A;  1Y1W G;  5GAD C;  2E2I H;  2E5L L;  1Z47 A;  4HJ5 A;  1YEZ A;  4LUO A;  1N33 Q;  1T9H A;  4R4T A;  1X3E A;  3RZD H;  1OXX K;  2MO0 A;  4JI7 L;  1I5F A;  5C44 G;  1Q46 A;  2ZM6 L;  4JI3 Q;  2JA8 H;  4IPD A;  3D31 A;  3RZO H;  1VQN A;  3CC4 A;  4OWW B;  4PMW A;  1PH4 A;  4A3F G;  1G51 A;  1E7Z A;  4A3D H;  1VQM A;  4YWK A;  3CCR A;  4X66 L;  2R93 H;  1YI2 A;  2N3S A;  3STB C;  3CCU A;  5M5Y H;  5C0X J;  3HKS A;  5GAG C;  1PH2 A;  4LUV A;  4BY7 H;  2UUB L;  3HOW G;  5JJK A;  4P74 A;  5IY0 A;  2VW9 A;  5JEA J;  1EQR A;  1G29 1;  3NEN A;  4DR3 L;  5IP7 H;  2LXJ A;  5DLQ E;  4BBR H;  4GNX B;  1IBM Q;  3TRE A;  4OON A;  4JI5 Q;  2HIV A;  1XPR A;  4IPC A;  3PUW A;  1EYG A;  2UUA L;  5FLM G;  2UXC L;  1MKH A;  3TQY A;  3E9H A;  3RN2 A;  3I4N G;  1EIF A;  2QGQ A;  3F8T A;  3NEL A;  5HY6 A;  4UY8 C;  2WB1 G;  2JQO A;  2EQS A;  1E22 A;  1WI5 A;  4HJ7 A;  2R7Z G;  5M3M G;  2BH8 A;  3T1H L;  3GTJ H;  2KHI A;  4LFA L;  2JA6 H;  5GQO A;  3EN2 A;  4DR7 L;  1XPU A;  2B63 G;  3KJP A;  1PHJ A;  1VQF A;  4R4I A;  2NN6 G;  3RLF A;  4A4I A;  4YCW A;  4LF5 Q;  1JMC A;  2ES2 A;  3ERS X;  2VNU D;  1CKN B;  2PQA B;  3CW2 C;  4JYA L;  5ELN A;  4DV7 Q;  1N32 L;  1N8R C;  2R7F A;  2WP8 J;  3PUY A;  3TEH B;  4DR1 Q;  2AMC B;  1VQP A;  3KJO A;  1VCI A;  3TRZ A;  3J81 i;  3VDY A;  2UUB Q;  2MO1 A;  1YIJ A;  2E5L Q;  4A3L H;  1IBL L;  1AE3 A;  1N36 L;  3G48 A;  4X65 L;  3H3V I;  2N49 A;  3ER0 A;  3K7U C;  4DV5 L;  4A3J G;  4JI7 Q;  3BZC A;  3CXC A;  2ZM6 Q;  1YBY A;  2JEA I;  4A3M H;  3PO3 G;  3AEV A;  3NEM A;  2QA4 A;  1GKH A;  1HR0 W;  3Q8D A;  1Q1B A;  1XNQ L;  3ULP A;  4YWM A;  4BXX G;  3S24 A;  5IYD H;  4UPA A;  4BXX H;  1GO3 E;  3FKI H;  3AQQ A;  1LM0 A;  3L7Z C;  4X62 L;  4A3G G;  4JI1 Q;  1VQG A;  1PH1 A;  5IYC H;  1IYJ B;  2PMZ E;  4LFC L;  1RL2 A;  1HZB A;  3M9B A;  4DV1 L;  3BJU A;  1K8G A;  2IHE A;  1VQ8 A;  2ALY B;  2ATW A;  1L1O A;  1VQH A;  1YNX A;  5C4J H;  4DR3 Q;  5ELO A;  2OTJ A;  3J7A 5;  1KRT A;  3W1B A;  3EBE A;  3K81 C;  4GN4 B;  4OWT B;  3RLO A;  1C9O A;  4HIK A;  4A3I H;  3GTM H;  3K80 C;  5C4X H;  2UUA Q;  4R4C A;  1PH6 A;  2UXC Q;  1A62 A;  1AE2 A;  2F3I A;  1S40 A;  4IFD G;  2OTL A;  3M4Q A;  3CF5 A;  4LNQ A;  1E3P A;  1K73 C;  3CCQ A;  1I50 H;  3PO2 H;  1YJ9 A;  3D0F A;  1JJ2 A;  4O2D A;  4LFA Q;  2VY3 A;  4DR7 Q;  5H1S E;  2MNA A;  1C7Y A;  4DV0 L;  4EX5 A;  5FJ8 G;  4OX9 L;  2D0O A;  4GLV B;  4LFB L;  3KDF A;  4XIG S;  3ZJY C;  1QZG A;  3UDX A; 
#chains in the Genus database with same CATH topology
 2I0Q A;  4FO2 A;  1JJG A;  5C6A A;  5M5W H;  1B4O A;  2RDF A;  1A3T A;  1X56 A;  2PNR C;  1EYC A;  4GNX C;  1ENF A;  2X6L A;  3T56 B;  3NUC A;  4NPS A;  2EIF A;  4NP5 A;  2K5V A;  1B3A A;  2GA4 B;  5IWA L;  5JPM C;  2A6E D;  2G5D A;  4MNO A;  1Q86 C;  2Q8T A;  3QIA A;  2F0O A;  1RTN A;  4ID6 A;  2VQF L;  2JA8 G;  3OMG A;  5FO7 B;  2EJF C;  1G6P A;  4DFA A;  3G6E A;  1EYD A;  1JCK B;  2HHH L;  4A3G B;  2KOL A;  1LTL A;  3NQI A;  1ESF A;  1BKB A;  5CV4 A;  4LFC Q;  2KEC A;  2CWP A;  4PNY A;  2NVX H;  5CV6 A;  3S2D B;  1LT5 D;  1L0Y B;  1STY A;  1D2B A;  4C56 C;  4FYD A;  2F0S A;  3NWS A;  2PZW A;  4ZYS A;  3QO2 A;  1PRT F;  1DGS A;  1B7Y B;  4JI1 L;  4RGN A;  4U67 3;  5IYB G;  4C3J G;  3I70 A;  2A8V A;  1Y1V H;  2IX0 A;  3HOZ H;  3HOU G;  4YCV A;  2JK8 A;  1GM5 A;  3UDI A;  3GV6 A;  3ULL A;  1QVG A;  2QKI C;  3CQZ H;  3K7A H;  1JOO A;  2XVS A;  2YYZ A;  2F52 A;  4HMJ A;  2L0C A;  4A3L G;  2CW0 C;  2JA8 B;  3M4O B;  1GUW A;  3STB D;  2EZV A;  4DV2 L;  2NZ1 D;  2EE1 A;  4IUT A;  2F4V L;  4WFN 3;  1B70 B;  1UE5 A;  1BUV T;  1L0X B;  5LMU Q;  2Y0S G;  3DLL A;  1QUQ A;  1XXG A;  2KJX A;  3S9W A;  1EY0 A;  1B8A A;  2F0M A;  3ND9 A;  1HPC A;  3MXU A;  4YIJ A;  3M7N A;  2WFW A;  3MVV A;  1D5Z C;  2NZH A;  4DA2 A;  2L1B A;  5FOB B;  1X6O A;  1OTC A;  3BVM A;  1I94 L;  3HKZ G;  1SE2 A;  4KHP Q;  1G8Z D;  1I4P A;  4H7B A;  1TWG B;  2K7V A;  4A3K G;  1O7L A;  1BVS A;  1SE3 A;  2SNM A;  4C3J B;  4Q5V A;  1A15 A;  1LAB A;  2WAQ E;  2F0T A;  3A8K E;  1KXL A;  3CCE A;  2K75 A;  4X3S A;  1WTO A;  2KCT A;  3SE0 A;  3HOU B;  2K5D A;  3GP7 A;  5EPJ A;  4DAY B;  3BYY B;  1NR2 A;  2K5H A;  1OXT A;  1SEB D;  1ASZ A;  4FXD A;  1BCP D;  5JJL A;  5D65 A;  4OO1 H;  3CP0 A;  2EXD A;  4X64 Q;  1MGS A;  4C1N K;  2QDB A;  1VQD A;  1X3Q A;  5KEE A;  4XYO A;  1JIC A;  3S1Q B;  2IHF A;  1KAW A;  4C2M B;  2F03 A;  1XNR L;  2DNE A;  2EXZ A;  2N88 A;  3GTQ B;  4OO1 I;  1V1P B;  1FD7 D;  1Q81 C;  2Y0S B;  1Q8K A;  1UEB A;  4B3M Q;  4G7Z C;  4A3G H;  5T1G A;  2BA0 A;  1HTP A;  3D4W A;  2OWO A;  3UDG A;  3TP7 A;  1ONL A;  2PO4 A;  4IOC A;  2IX1 A;  4DR5 L;  3HOY G;  3S2D H;  2NTS A;  3L2P A;  5M5X B;  1BCP B;  3HKZ B;  1SJH D;  2LMC B;  1B3Q A;  5AFW A;  3SK8 A;  2LS0 1;  4A3K B;  1I4Q A;  2XNA C;  1SLJ A;  1CI3 M;  3WOF A;  1R4P B;  3QG1 A;  4BY7 G;  5IGF A;  2CQO A;  4DR6 L;  1X3F A;  4IOA A;  1CSQ A;  1H9J A;  3MXP A;  3NTI A;  3T1Y Q;  2NVT H;  4GLA C;  2JA7 H;  4B9W A;  5EGT A;  4KD4 A;  4DXG A;  3I3C A;  2L5T A;  5EAY A;  2JJQ A;  3VR3 A;  1LLR D;  4DR4 L;  2BH2 A;  3KDF B;  3KUP A;  3M4O H;  3ERQ A;  4GKJ Q;  4R4Q A;  3PCO B;  2L4N A;  4HCS A;  1STB A;  2CKZ B;  4LF7 L;  5EKK A;  5FLX c;  2Q2U A;  3J81 j;  1D1K A;  3VR4 A;  2CH4 W;  2K52 A;  2EYH A;  4RHR A;  3CHB D;  1VQO A;  3HOY B;  1DXM A;  3JAM i;  4OIJ A;  3EJI A;  1XMO L;  3L9A X;  1NMF A;  3RZO B;  2B8F A;  2FHT A;  2PI2 A;  4A3F H;  3G71 A;  2CCZ A;  1UNS A;  2NTT A;  4A3M G;  2P5Z X;  4IJL A;  1STH A;  1TWG H;  3HOW H;  5M5Y B;  3OIP A;  4RGT A;  3TZU A;  3R3O A;  5IYB H;  1HJP A;  4C3J H;  4P72 A;  4BY7 B;  5IT9 E;  1N34 Q;  3K8A A;  5DM7 3;  1HUN A;  5CV9 A;  4EQO A;  2UXB Q;  4NDX A;  5IYC G;  4JI2 L;  3HOU H;  2OF1 A;  3LWU A;  5BN3 A;  1VQJ A;  2UXD L;  3PUZ A;  3KYH C;  2QIL A;  2CQA A;  1EZ8 A;  2Z9H A;  4JI4 Q;  4L5R C;  2Q2H A;  4KHV A;  4I7A A;  2KA7 A;  1PZK D;  4TVA B;  1ENA A;  4H0L C;  2A69 C;  4KJO A;  2K6A A;  3PO2 G;  3S1Q H;  3ONA B;  4C2M H;  2LY7 A;  1SBB B;  3GTQ H;  4K0K Q;  1XPO A;  5FLX E;  1ILQ A;  4LW1 A;  3DXJ C;  2KHJ A;  3EQL C;  4QL5 A;  1EIY B;  5J39 A;  4FF3 A;  4E6I A;  3EFX D;  4OEM B;  1N33 L;  3HP3 A;  4UDU C;  1XJV A;  5ELD A;  1B53 A;  4RGO S;  1JB7 A;  3MFY A;  4CKB A;  4DNI A;  1Y69 U;  1F9P A;  3QOJ A;  2K5N A;  1ET6 A;  1EY6 A;  4DUY Q;  1EZ6 A;  1YJN A;  1SRU A;  5M3F G;  5M5X H;  1HRJ A;  4A3M B;  2O4X A;  1U4P A;  1HCZ A;  5EPL A;  4QGU A;  1S5D D;  4ZLT F;  4A3K H;  1U4L A;  4RFB A;  4AH6 A;  1Q82 C;  1JQY D;  2VUM G;  1IBM L;  4EQ5 A;  5KGU A;  1D8L A;  2OCE A;  2N8N A;  5IP9 G;  1ILP A;  5TSS A;  3GTM B;  2QDL A;  2ZJR A;  2TSS A;  5J3B A;  4YCU A;  5LMN Q;  1X3P A;  3KFU A;  3A55 A;  3MFG A;  3TBI B;  5GRO A;  3W5O A;  2B29 A;  1VQ7 A;  1I50 B;  3K0Y A;  3PO2 B;  4CJ0 B;  1IBL Q;  3RR5 A;  3B6Y A;  1CQF A;  5IYD G;  3TP6 A;  5JJZ A;  1HXY D;  2JA5 G;  1VF5 C;  2QCP X;  1SYD A;  1Y8O B;  2K5W A;  3FEW X;  1ZYR C;  1XMQ L;  3R8B A;  3VYU A;  4ZUJ A;  5GAD C;  2NWG A;  2E5L L;  5ELB A;  1OXX K;  4J6H A;  3OIQ A;  1SNP A;  5M3F B;  1I5F A;  5C44 G;  4JI3 Q;  1PMR A;  1V1O A;  3D31 A;  3RZO H;  1ET9 A;  1G51 A;  3SEB A;  1BBX C;  1VQM A;  3CCR A;  2N3S A;  3FPU B;  5M5Y H;  1U4R A;  2VUM B;  1KDA A;  4BY7 H;  1F2Y A;  1U9R A;  3I72 A;  3QB3 A;  3C46 A;  4RKL A;  4JI5 Q;  2G9H D;  1ZYR D;  1XPR A;  3PUW A;  2DJG C;  4DAY A;  5FLM G;  2UXC L;  3RN2 A;  3I4N G;  5I2Y A;  4XQQ A;  3NEL A;  5HY6 A;  2X69 A;  5LL6 X;  1S5B D;  2L9H A;  3T1H L;  4CGY B;  3A54 A;  4ODG A;  4LFA L;  1XPU A;  2B63 G;  1VQF A;  4R4I A;  3RLF A;  5E4W C;  1Q90 A;  2ES2 A;  3ERS X;  2JA5 B;  1Q8I A;  5CBE E;  5ELN A;  4DU9 A;  5CC4 A;  2R7F A;  1VQP A;  3KJO A;  3TRZ A;  1JC7 A;  3VDY A;  1AE3 A;  5C44 B;  4A3J G;  3W3A A;  2FFK B;  4EQN A;  1YBY A;  2NUC A;  4FP5 D;  4A3M H;  2XN9 C;  1GKH A;  4PQX A;  3RUZ A;  4YWM A;  1EQV A;  1TY0 A;  4UPA A;  1FYC A;  1Z6H A;  3AQQ A;  3L7Z C;  2PCF B;  1VQG A;  5IYC H;  4LFC L;  3M9B A;  1RL2 A;  1VQ8 A;  2RSN A;  4OL7 A;  1YNX A;  1AZQ A;  4DR3 Q;  1KRT A;  3EBE A;  1QIL A;  4GN4 B;  4HIK A;  3I4N B;  3GTM H;  4IUQ A;  3IL8 A;  3W2D A;  4IFD G;  3NQT A;  2PPB C;  4KTA A;  1I50 H;  3PO2 H;  1YJ9 A;  1JJ2 A;  5I2X A;  3I90 A;  4Y7N B;  2D0O A;  3KDF A;  4QY7 A;  3UDX A;  3D3R A;  3W1G A;  4NB3 A;  4R9W A;  4B9X A;  1NAP A;  1A2U A;  3GDE A;  1KAB A;  1N32 Q;  1IL2 A;  4JC0 A;  2JN4 A;  1AN8 A;  1WTW A;  2LKV A;  2ZTE A;  3P7J A;  4A3E B;  4A3J B;  4A3B H;  2AWN A;  4C3H H;  1N36 Q;  4IFD J;  4K8I A;  2MP1 A;  3A7A B;  1VQA A;  2Q8I B;  1FGB D;  2AQ3 B;  3CCM A;  3BZK A;  1OO9 B;  2OQK A;  1LAC A;  2NZO A;  2AUJ D;  5LMU L;  4N9P A;  4C3I G;  4X62 Q;  2PW7 A;  1PYB A;  2IL8 A;  3SXH A;  3JAM c;  3GTO B;  3A0J A;  2A73 B;  4KHP L;  5C3E G;  2B2V A;  4EQP A;  4ME3 A;  5COR A;  1BDO A;  1DJR D;  1CT1 D;  4X3U A;  1TII D;  1E2V A;  1QB5 D;  1S3O A;  5IYD H;  2E8G A;  1SND A;  4BA1 I;  2J0T D;  2CWA A;  3KBG A;  1Q1E A;  1LTB D;  3FRP B;  3D4R A;  1STG A;  3HRZ C;  4RMF A;  5C5L A;  3VYR A;  4AYB E;  2JA5 H;  3GTL H;  4LFB Q;  1SRO A;  4XT3 B;  1MSH A;  2RQX A;  2WII B;  2PYK A;  3OW2 A;  4X64 L;  1YIT A;  1LYL A;  2ICI A;  2IT1 A;  1RJT A;  2EYM A;  5C44 H;  3J81 c;  4TKO B;  1EWC A;  5NUC A;  1WVL A;  2EYJ A;  4GOP C;  1ICW A;  2KQ3 A;  4B3M L;  1Y1W B;  4C3I B;  5CMD A;  1QVF A;  1PTO D;  3ERO A;  4BWG B;  2WKC A;  4QJF A;  2VQE Q;  1X3G A;  1EQQ A;  3SDZ A;  2AUK A;  5C3E B;  1TY2 A;  3MEH A;  5EBD A;  5FLM H;  3I4N H;  4KY7 A;  5K5P A;  3ND8 A;  4FF1 A;  3UE1 A;  4A3I G;  4HID A;  1XYI A;  1Q3L A;  1PVO A;  1C8C A;  4CJ1 B;  3NK9 A;  4YY3 L;  4JBM A;  1TWH H;  2N55 A;  2QF7 A;  4JOI C;  1YJW A;  3S15 B;  5FLX L;  1YVC A;  3MWY W;  4Y7N H;  1EFI D;  1ENC A;  3HOX G;  1VMC A;  3KF8 B;  4IUV A;  4X6A H;  1TT2 A;  4LUZ A;  2Z6K C;  2R7Z B;  5LMN W;  2EJM A;  4K6D A;  4HR7 B;  3CC2 A;  3CPF A;  1PLF A;  2XIW A;  3J81 E;  2O2L D;  3MHB A;  4ZQ3 A;  1LTI D;  2K32 A;  1I4H A;  3NWT A;  3Q0A A;  4XQN A;  4A3E H;  4A3J H;  1KL9 A;  4OHJ A;  3CME A;  3O13 A;  3I73 A;  4HSV A;  4GKJ L;  4B3R Q;  2EYF A;  2V1C C;  3GV3 A;  3CRK C;  3R93 A;  2D5D A;  2IY5 B;  3K5O A;  2RCF A;  1BQQ T;  2A19 A;  3KBX A;  1TS4 A;  1BNZ A;  2E76 C;  3GTO H;  3S1R B;  1K83 B;  3PO3 B;  3E9I A;  5KNB A;  2B2W C;  4JBJ A;  1S72 A;  4A3I B;  2ZJQ A;  1IYV A;  4IFD H;  1UE7 A;  1QVC A;  1B9N A;  4DV4 Q;  3I4O A;  4QUF A;  2F0G A;  3GTP B;  1N34 L;  2BDN A;  5BN4 A;  2HQL A;  2K05 A;  1SFO B;  1Z9F A;  4H13 C;  2M2L A;  2MPM A;  4QMG A;  2UXB L;  1U5K A;  3S16 B;  3H91 A;  3GTG B;  1SMY C;  1YNJ C;  3MC0 B;  2Z4I A;  5IP7 G;  3HOX B;  1KTK A;  1A3U A;  2HT1 A;  4IFD I;  3TN2 A;  3S2H H;  2O5I C;  3IRB A;  3KLR A;  1TS5 A;  1D5X C;  4QQB X;  4G57 A;  4RKB A;  3RNU A;  1Q12 A;  1EIG A;  4ZUI A;  4JI4 L;  2B2Y A;  1F2Z A;  4JPB W;  5IIF A;  4DK1 A;  4F7X A;  4PZ6 A;  4MHE A;  5CBA E;  3M3Y B;  2VS1 A;  4TSS A;  1Y8P B;  2JA6 G;  1OXU A;  3CC7 A;  4K0K L;  2B8G A;  2LSS A;  2R7D A;  2I5M X;  2ZT9 C;  3PUV A;  4IQZ A;  1Y1W H;  1UE1 A;  3DM1 A;  4C3I H;  1ML0 D;  2DJF C;  5DEH A;  1SMY D;  1ESR A;  4IN3 A;  2OT2 A;  4B3S Q;  3EA6 A;  1XX8 A;  2E2I B;  1TWC H;  5CV7 A;  1CQV A;  2GN5 A;  4K2L A;  4AIM A;  3UDF A;  1NJI C;  4IO9 A;  3ZYY X;  4DUY L;  1I4X A;  4XYQ A;  1IBK Q;  2UU9 Q;  1FNV A;  5C3E H;  1WTR A;  3V96 A;  1D7Q A;  1F2M A;  5G3L F;  2Q8R E;  3IFD A;  4GS3 A;  1WOC A;  1HH2 P;  4DUZ Q;  3PUX A;  3FKI G;  4LF8 Q;  1KDC A;  2RKS A;  5EPK A;  3PIO A;  3D8G A;  1STN A;  3HG9 A;  4CKC A;  2RCN A;  2F3V A;  4HMI A;  4LMQ D;  3S15 H;  1PYW D;  3BDL A;  1HZ9 A;  5JPN C;  4GKK Q;  2J7Z A;  4PZ7 A;  1PFS A;  3BU2 A;  3LGJ A;  3SK4 A;  3I91 A;  3J80 c;  5LMN L;  3H3V H;  1EU4 A;  3I56 A;  3CAM A;  1B9M A;  2HDL A;  3KF6 A;  2MQH A;  4QUC A;  3P1H A;  4NKL A;  1VQ6 A;  2R7Z H;  2F0P A;  5M3M H;  3FMC A;  4P73 A;  2CW0 D;  4LF6 Q;  2I46 A;  3NXW A;  4RAU C;  2JA6 B;  3GQB A;  5C4H A;  3J7Z C;  4P75 A;  2E2H H;  1Y14 B;  4QIW E;  5JVH 3;  1JR0 D;  4KY6 A;  1BR9 A;  1QNK A;  1MD2 D;  1WTP A;  1GVP A;  2KCC A;  3RD4 A;  2RDH A;  5C3W A;  3HOV G;  5AJ3 Q;  1KAA A;  4X66 Q;  4DNR B;  1D6E C;  4GLX A;  1HTL D;  4JI3 L;  2PNH A;  4WJW A;  1JJC B;  3FP9 A;  2AWO A;  1FL0 A;  3S1R H;  1K83 H;  3PO3 H;  1VQ4 A;  1KC8 C;  1IXR A;  1SNO A;  4ME5 A;  5I4D A;  4NXN Q;  2PI2 E;  4JBW A;  1DD2 A;  3KOJ A;  3D6W A;  1SR3 A;  5GAE C;  2XGT A;  4ZCK A;  1X9N A;  1SAP A;  2EY2 A;  1SNC A;  3FKI B;  3GTP H;  2WB1 E;  1SFO H;  1E1T A;  2L15 A;  1KNE A;  1WCM G;  3K58 A;  3S16 H;  3PGZ A;  5HUR A;  2YTX A;  3GTG H;  2XRS D;  4POF A;  4JI5 L;  1PA6 A;  5C4J B;  3J80 E;  2RHS B;  4KHZ A;  3HOX H;  4DV3 Q;  1CSP A;  4OEL B;  4RG1 A;  1PH3 A;  5I6Y A;  5BN5 A;  5J22 A;  3VR2 A;  4DV6 Q;  1CZG A;  4MTK A;  1FJG Q;  3M3Y H;  5FJ8 H;  5IT9 c;  5C0X G;  4WOR A;  4CDF C;  3H94 A;  5JEA G;  1VQ9 A;  5T1I A;  1JOQ A;  1SNQ A;  3HOV B;  2EPB A;  1X55 A;  5I6W A;  5C3X A;  4XXE A;  2E2I H;  5KRU A;  2F0F A;  3I4L A;  2B2V C;  1TVX A;  3URY A;  2JA8 H;  1VQN A;  4OWW B;  1PH4 A;  2FIN B;  3J7A V;  3OPO A;  5HGT A;  3CCU A;  3AMU A;  5C0X J;  1WCM B;  3HKS A;  5GAG C;  5JJK A;  1I4G A;  4LK1 C;  5JEA J;  4DR3 L;  5IP7 H;  5DLQ E;  1CFM A;  2WV6 D;  5CGK A;  1EYG A;  3SHL A;  3NTK A;  5KND A;  4CHT B;  1WTX A;  1EIF A;  3F8T A;  3KF8 A;  4UY8 C;  1XTC D;  4P2C B;  3MXG A;  4RHS A;  1BCP F;  2B2U A;  3DMU A;  2JA6 H;  3EN2 A;  3KJP A;  3PIO 3;  1LTR D;  2NN6 G;  3J7Y W;  4K5W A;  1JMC A;  2F0K A;  5FO8 B;  2AQ2 B;  3JAM L;  1D5M C;  4DV7 Q;  1N32 L;  5IOC A;  4DR1 Q;  1WTQ A;  1RCV D;  2AMC B;  3J81 i;  5ELE A;  2MO1 A;  4A3L H;  3NBH A;  3NTH A;  4TRD A;  2D9U A;  2CVR A;  3K6O A;  1N36 L;  4X65 L;  1NUC A;  5EJW A;  2E2D C;  5IGE A;  1SYB A;  1G2T A;  1O7Y A;  3AEV A;  2QA4 A;  4FNF A;  2QEJ C;  3ITP A;  1I6H B;  3FKI H;  1LM0 A;  4X62 L;  4JI1 Q;  1EL0 A;  1PH1 A;  1IYJ B;  3BJU A;  4K5X A;  2ZXP A;  3KLS X;  1V8Q A;  5C4J H;  1S5F D;  1FNU A;  2SNS A;  3EVQ A;  4DNT B;  4R4C A;  2JYO A;  1C4Q A;  3J81 L;  2A69 D;  1S40 A;  1EY4 A;  2G9D A;  3M4Q A;  2B39 A;  3CF5 A;  2L11 A;  1KNA A;  1E3P A;  2WKD A;  2NVY B;  1K73 C;  3PMF A;  2MHV A;  3D0F A;  3T13 A;  1EEF D;  1SYF A;  5DM6 3;  1SYC A;  5H1S E;  4DR7 Q;  3C2P A;  4F8M A;  4LFB L;  4XIG S;  1QZG A;  4ABN A;  4OWX B;  4XTC S;  4DV2 Q;  3HOV H;  4JYA Q;  1PYS B;  1U0L A;  2Y0S E;  2A68 C;  1UEA B;  3E0E A;  1CKM A;  3K0X A;  2F4I A;  2DNC A;  2F0V A;  3P20 A;  3J7A F;  3F1Z A;  1AH9 A;  2CHB D;  2HQE A;  2PZU A;  1PDQ A;  4GNX A;  1ROD A;  2YU9 B;  2LXK A;  2RVL A;  2A6H C;  2DUD A;  3HKZ E;  5ELC A;  2ICE C;  1H95 A;  4A3D G;  4MIU A;  1WCM H;  3I7F A;  1L2F A;  2XWJ B;  1K0R A;  4PV1 C;  3HOY H;  3OW7 A;  3VYS A;  2VQE L;  4H44 C;  2VXW A;  4X3K A;  3T16 A;  2A5H A;  1W6J A;  2DY7 A;  2KBN A;  4CKE A;  2NVQ B;  4BBR G;  4O42 A;  2ZXR A;  5E1F A;  1SE8 A;  2A68 D;  4APV A;  1EY8 A;  4KLK A;  3LNN A;  2AQ1 B;  3A8J E;  2PQA A;  3DWQ A;  1KIX A;  1TKW B;  3N6R A;  5COY A;  4A3C G;  3F2D A;  2EY5 A;  4YWL A;  3CPW A;  3TS2 A;  4OX9 Q;  1YZ6 A;  1UUP A;  1KRS A;  1CUK A;  1LTT D;  2FJ2 A;  4S3S A;  4IPH A;  4ZRZ A;  1JE5 A;  1VQK A;  4DN4 M;  4BA2 I;  4KMU C;  1Z7T A;  3S1M B;  1J9O A;  3UE0 A;  1IW7 C;  2JE6 I;  1HNZ Q;  4B3R L;  4MZ9 A;  2VB2 X;  1IKL A;  1YNN C;  3SR1 A;  4PG3 A;  1O78 A;  3EIV A;  3GO5 A;  2EYO A;  4A3D B;  3FDT A;  1BBW A;  1P16 A;  2JP1 A;  1IHZ A;  4LF9 Q;  4LF4 Q;  4DR2 Q;  4PMC A;  4O0A A;  3H0G G;  4TQU S;  4DK6 C;  1FVI A;  3MEF A;  1PXU A;  2FMM A;  4DV4 L;  1IZ6 A;  2BA1 A;  3OOC A;  4C1N I;  1UE6 A;  4N8X 1;  2PMZ B;  1IW7 D;  5GAH C;  1PZJ D;  3K5M A;  3CCL A;  3A74 A;  4ZKC B;  1YNN D;  4JI8 Q;  4MTN A;  1QE6 A;  3J80 i;  3IFT A;  4B3T Q;  1K8O A;  1S4Z A;  4K5V A;  1IL8 A;  4JV5 Q;  2R61 A;  3C1E A;  1RDP D;  2UUC Q;  4LF7 Q;  2Z8L A;  4HTH A;  2H5X A;  2B63 B;  3SVM A;  4UP7 A;  3V2T A;  4GN3 B;  4X3T A;  3NE5 B;  1B50 A;  2MGS A;  3CU7 A;  1EWH A;  2VZA A;  3KF6 B;  2GVB A;  1HZA A;  4JCV E;  1HR0 Q;  2YU9 H;  1NSN S;  5JAV A;  1NY4 A;  4B3S L;  2FXQ A;  5DNF A;  2HUG A;  3J80 L;  1HQR D;  5KNC A;  4IPG A;  2UU9 L;  3H0G B;  1IBK L;  4AQY Q;  4HJA A;  1CA5 A;  5M3F H;  4L5S A;  2NVQ H;  1J6Q A;  5EQ0 A;  3OTO Q;  4YHH Q;  2UXD Q;  1TWA B;  1STA A;  2A1A A;  1K9M C;  4J15 A;  4NXM Q;  4DUZ L;  2XTI A;  1Y8N B;  2VUM H;  4QCL A;  2R93 G;  2E2J B;  1EEI D;  1MJC A;  1MIU A;  4WRD A;  5IOD A;  3PQI A;  4XQJ A;  4U68 A;  4J8Q A;  1BBU A;  1L1O B;  3NHH A;  3U4V A;  3S17 B;  2F0D A;  5IP9 H;  1QG7 A;  4GKK L;  4HN7 A;  4N8F A;  1H9S A;  1NTG A;  3BVG A;  3DEP A;  1L0W A;  3A5Z B;  1N9W A;  5M5W B;  1X32 A;  4DKA C;  1ICF B;  4K6L A;  4LF6 L;  2WAQ G;  5EKL A;  1W3S A;  3MTS A;  4HIM A;  3S1M H;  3T53 B;  4L5T A;  1VQ5 A;  3E3X A;  4KK7 A;  3WOE A;  5F2D A;  1EU3 A;  1J5E Q;  2F0I A;  5AJ3 L;  1HNX Q;  1PRT C;  2H4O A;  4A76 A;  3R2I A;  3U9O A;  2SDF A;  3RZD B;  4ZAI A;  1TU2 B;  3F2U A;  3H3V C;  1B2T A;  1E0B A;  5I9P A;  1F9Q A;  1WFQ A;  4NXN L;  3AFQ A;  2QEX A;  2KED A;  1HNW Q;  4LWC A;  4IUR A;  3MA2 B;  2DY8 A;  1BF4 A;  2D0P A;  5IT9 L;  3CMA A;  2O5J C;  2R93 B;  1MI2 A;  2YV5 A;  1RIP A;  4RWS C;  2BE5 C;  4BXX G;  4A3C H;  4KD3 A;  5LHY 1;  5E3F A;  1VQI A;  3VR5 A;  1SJE D;  1S5E D;  4ZK9 B;  4UP8 A;  4DV3 L;  2F0J A;  3G4S A;  1PRT D;  1GUS A;  2NBF A;  1VQL A;  4DGZ A;  3K5L A;  4KKU A;  4DK0 A;  4DV6 L;  3U9S A;  2WAQ B;  5C4X G;  3CQZ B;  4KN7 C;  1FJG L;  3K7A B;  3AB9 A;  1XMQ Q;  3GTJ B;  2B3G A;  4OO1 G;  2B63 H;  1HA6 A;  1F9R A;  3DEO A;  3HFZ B;  5CYU A;  1NNX A;  1T5X D;  2PW5 A;  1WYD A;  5CV5 A;  4CJ2 C;  3BS1 A;  3C1F A;  4ULL A;  1O7Z A;  3T1Y L;  2ID0 A;  3P75 A;  1PTO B;  1GHJ A;  2F0U A;  3MXN B;  3WWV A;  3E0J A;  2JSO A;  4CDE C;  2KVM A;  2EYL A;  1HZC A;  4A75 A;  1QWY A;  4DPG A;  4HSP A;  1WJJ A;  3H0G H;  1KHI A;  1QJO A;  5G3L D;  4HCE A;  3H15 A;  4A93 G;  1R4Q B;  1DON A;  1YHQ A;  1TWA H;  4RCN A;  4BBS G;  2A6E C;  3I4M G;  3PF4 A;  4GOP B;  3D6C A;  4CBV A;  3NBH B;  2OQ0 A;  3CCV A;  3PV0 A;  3IAY A;  2E2J H;  3LWE A;  4GN5 A;  5IE8 A;  4JI6 Q;  1TS2 A;  4RCO A;  3T1H Q;  3S17 H;  4N9T A;  2AHO B;  1ZXT A;  2F0E A;  5L37 A;  3JC6 6;  1K8A C;  3KLS A;  2K14 A;  2XWB B;  5C4X B;  1VMP A;  1JE4 A;  2IWH A;  1ZEQ X;  4R4O A;  4L5Q A;  1A63 A;  4JI0 Q;  2HCC A;  2JA7 G;  5BR8 Q;  3ICE A;  3AFP A;  4KJN A;  4JK1 C;  3SK6 A;  1V9P A;  1NMG A;  4ALP A;  1E2W A;  5FKA C;  1AP0 A;  4K14 A;  2PQE A;  1H9R A;  4RA8 A;  5E4X A;  4KKS A;  1UWV A;  4DV7 L;  1LV9 A;  4WJ4 A;  5J1Z A;  2M9V A;  4DR1 L;  1PFB A;  5IGG A;  1VQE A;  1SYE A;  5IGB A;  4HJ5 A;  1YEZ A;  4LUO A;  3S14 B;  4J1M A;  4R4T A;  1PTO F;  3RZD H;  1LT4 D;  3DWP A;  3NSW A;  2MO0 A;  2C5C A;  2WIN B;  4A93 B;  1Q46 A;  4BBS B;  4CDD C;  4PMW A;  3I4M B;  4A3F G;  2SEB D;  2R93 H;  1YNJ D;  2IPK D;  3M4Y A;  3STB C;  3L3O C;  3HOW G;  1EQR A;  1G29 1;  3NEN A;  2LXJ A;  4GNX B;  3I8Z A;  3OWE B;  3Q6S A;  3TRE A;  4OON A;  3T4A C;  2R3Z A;  2HIV A;  3FVQ A;  1PZI D;  4IPC A;  4NMZ A;  3S1N B;  1SSO A;  2HDM A;  3TQY A;  2NVT B;  2NYZ D;  1B1Z A;  2JQO A;  2JA7 B;  3KK7 A;  2EQS A;  1E22 A;  1I4R A;  4HJ7 A;  3GTJ H;  3VYT A;  1LT6 D;  5D3D A;  4DR7 L;  2JXM B;  3H09 A;  3BZD B;  4A4I A;  4QF4 A;  4YCW A;  2SOB A;  4LF5 Q;  4L6T B;  1PTO H;  2F0Q A;  1CKN B;  2PQA B;  3AU7 A;  4JYA L;  5IGD A;  1N8R C;  3PUY A;  3TEH B;  1JOK A;  3A56 A;  1VCI A;  1YIJ A;  1BCP C;  4GZY C;  1IBL L;  3H3V I;  3ER0 A;  5A2Q E;  4JI7 Q;  3BZC A;  3CXC A;  2ZM6 Q;  4A3F B;  3NEM A;  2IW3 A;  1HR0 W;  3Q8D A;  1W6K A;  1Q1B A;  3ULP A;  3TP5 A;  3S24 A;  4BXX H;  5EKI A;  3HOW B;  2CH4 A;  4FF2 A;  2UUB Q;  1K8G A;  1SYG A;  2L12 A;  2IHE A;  4ILW A;  2ATW A;  1L1O A;  4FXG C;  1LTS D;  2OTJ A;  3J7A 5;  3W1B A;  3K81 C;  3QJY A;  3BYT B;  4OWT B;  3RLO A;  1C9O A;  2C9O A;  3HEJ A;  4A3I H;  4G4K A;  5C4X H;  2UUA Q;  1DOM A;  1LO5 D;  2F3I A;  2OTL A;  4LNQ A;  5FO9 B;  2BCO A;  5FK9 C;  2KCN A;  2HCI A;  4OX9 L;  1HFN A;  4HAE A;  2K5Q A;  1A8V A;  1WD1 A;  1K28 A;  1BOS A;  1EUJ A;  4UAI A;  2D62 A;  3S14 H;  2F0W A;  3T51 B;  1HNZ L;  3HS0 C;  4A93 H;  3SGI A;  4DV5 Q;  1JB3 A;  3HGB A;  1G2S A;  4DK3 C;  2JEB I;  4BBS H;  1XTD A;  3Q24 A;  1PH8 A;  3I4M H;  1EY9 A;  1EY7 A;  3D4D A;  2I5L X;  3NP8 A;  4PMB A;  1XNQ Q;  3BDC A;  4NW2 A;  4JW0 A;  2MJ8 A;  1HHV A;  5DAU A;  4LF4 L;  4R8N A;  4DR2 L;  2F1M A;  4YY3 Q;  4LF9 L;  1FGU A;  4DV1 Q;  5E7N A;  3OYY A;  4KN4 C;  4IAL A;  3S1N H;  1EWI A;  2RF4 A;  1KLG D;  3CD6 A;  2EOT A;  2RHQ B;  3BG3 A;  5K36 G;  1VS0 A;  2B2T A;  4M8A A;  1E1O A;  4JI8 L;  3VA7 A;  4EVO A;  4PZ8 A;  1LUZ A;  1RD9 D;  1S5C D;  4LJZ C;  3DWA A;  4B3T L;  2TMP A;  4DV0 Q;  2F3W A;  5D3I B;  4JV5 L;  3A7L A;  1TWF B;  2I07 B;  3U58 A;  1V1Q A;  2IJ0 A;  1ASY A;  3MXN A;  2UUC L;  1KLU D;  1K8M A;  4G7H C;  3GD7 A;  1M8A A;  1VDZ A;  1FR3 A;  1J8I A;  1VQB A;  3I2Z A;  3WDN A;  2K01 A;  1RKN A;  4Q0F A;  4K8J A;  1H9S B;  4FF4 A;  5IWA Q;  1JWM D;  1HR0 L;  3NPP A;  2VQF Q;  4HJ8 A;  1II3 A;  3FPP A;  3FHW A;  1W2B A;  1DZ1 A;  1JT8 A;  2C35 B;  1SXT A;  1EFW A;  2HHH Q;  2EJG C;  2F0N A;  2K1B A;  4GOP A;  1E24 A;  4AQY L;  4DF7 A;  1SNM A;  2HIX A;  1R9T B;  1EQT A;  1A0I A;  3OTO L;  3M7G A;  2BOS A;  4YHH L;  4POG A;  4IZ8 A;  3A5U A;  2EVB A;  4BY1 G;  1DOK A;  2JA9 A;  1CM9 A;  2K03 A;  3U50 C;  4NXM L;  2XSC A;  1NR4 A;  1JWU D;  4LAA A;  3H6M A;  3HZX A;  4DAP A;  4RH6 A;  2K4K A;  1YHA A;  4B08 A;  1C0A A;  5KIX A;  4K2K A;  1M90 C;  3CCJ A;  3K57 A;  2NB0 A;  1I6V C;  2DN8 A;  4OGQ C;  2Z6B A;  2R92 G;  1FNW A;  1AW7 A;  1NE3 A;  3GTK B;  4JOI A;  1RHP A;  2QW7 A;  1I3Q B;  1NCV A;  4JG2 A;  4L8J A;  1H9K A;  3CKI B;  1IYU A;  1M1K C;  2LFN A;  1PFM A;  4V0B A;  2X6G A;  3KLW A;  4R1J A;  3IKJ A;  2Z6K A;  2N78 A;  1A6X A;  4A3B G;  1H9M A;  4C3H G;  1TQO A;  3N52 A;  4AYB G;  1J5E L;  1SN8 A;  1KDB A;  3OMC A;  4DAV A;  3DUZ A;  5JVG 3;  1HNX L;  1GD7 A;  2F4V Q;  2WAC A;  2K04 A;  2Z4H A;  4EGV A;  2ZJP A;  2MUY A;  2BDO A;  1QNU A;  3CRL C;  1K3B C;  1HNW L;  4BY1 B;  2RA4 A;  1IKM A;  1JWS D;  1DM0 B;  1I94 Q;  5IGC A;  4V19 0;  1SDF A;  2DGY A;  2KEE A;  2B2W A;  1GUN A;  5HGQ A;  1LT3 D;  1O80 A;  1CKO A;  2MFI A;  1EOT A;  3F2B A;  1HA5 A;  3OHX C;  1PV4 A;  2KCM A;  1O7I A;  2B2Y C;  4IJH A;  2R92 B;  2VL6 A;  3PSI A;  4Y52 H;  1BXT A;  3PIP A;  1TWF H;  5CV8 A;  4RGM A;  1CA6 A;  3AYH B;  4XDX A;  1K0S A;  2EY1 A;  4HJ9 A;  3PF5 A;  1CKN A;  4IUU A;  2E74 C;  3QR8 A;  3F2C A;  2HD3 A;  3I55 A;  3TME A;  1GXD C;  4A3B B;  5C0X H;  4C3H B;  1U4M A;  2A6H D;  4AYB B;  1OXS C;  5JEA H;  1XNR Q;  3UI2 A;  1G6Z A;  3BVZ A;  3DM3 A;  2KHS A;  5C0X I;  4ZKB B;  1EOV A;  2ASB A;  1R9T H;  3RN5 A;  4DR5 Q;  1TR5 A;  1K3R A;  2GVA A;  1DOL A;  3ULJ A;  4I65 A;  3K5N A;  1QCB D;  1ZKO A;  1HQM C;  3OSO A;  5K36 H;  4QB4 A;  3Q22 A;  4OIK A;  1I6H H;  3SK5 A;  1PH5 A;  4JI6 L;  4FXK C;  4BBR B;  1UAP A;  1VQC A;  4DR6 Q;  1MHW C;  2ZTD A;  1GJX A;  4FDB A;  3GTL B;  3GTK H;  1F77 A;  2Q2I A;  1PH9 A;  4P71 A;  1I3Q H;  4JI0 L;  4H02 A;  1V1P A;  2A74 C;  5BR8 L;  2I5H A;  3M4P A;  1CTM A;  3TDQ A;  2YTV A;  2NVY H;  5A2Q L;  3BDO A;  3C3L A;  2NN6 H;  4MN3 A;  2Z0S A;  5KYI A;  4A3E G;  4DR4 Q;  4KI0 A;  3L0O A;  2R6G A;  1MJE A;  5ELF A;  1X65 A;  1NBW A;  2M00 A;  1T5E A;  2K33 A;  4DAM A;  1F9S A;  4JVZ A;  1L1O C;  1AFP A;  2CFM A;  2NN6 I;  1XWE A;  1X54 A;  2IX3 A;  3M85 A;  1MBY A;  1SE4 A;  2OEO A;  4G7O C;  1OXV A;  4BY1 H;  1XMO Q;  2Q2T A;  3TS0 A;  1WTH A;  5KYL A;  4WJ3 M;  3U4Z A;  1QUQ B;  1KQS A;  1CK1 A;  1PH7 A;  1AEX A;  3VR6 A;  2ZTC A;  1QZH A;  1V43 A;  1TWH B;  3E5S A;  1GUG A;  1LTA D;  4HIO A;  3QOL A;  2EY6 A;  4JI2 Q;  1CHQ D;  1TXY A;  2R92 H;  5JJI A;  1DCZ A;  1P8L A;  4UP9 A;  4KKT A;  3RLN A;  3TP8 A;  1RTO A;  1DYQ A;  4JBK A;  4LF8 L;  1SMX A;  2KEN A;  4OXP A;  1KD1 C;  4O1N A;  1GUO A;  1YHB A;  5C5M A;  2YTY A;  3TSS A;  4LF5 L;  1Y1V G;  4X65 Q;  1MSG A;  3HOZ G;  4HED A;  5EBC A;  1E2Z A;  4F87 A;  3PIP 3;  1B44 D;  1JOR A;  2AKW B;  3Q23 A;  3NBI A;  1Q7Y C;  1QOH A;  1HUM A;  2K50 A;  3CCS A;  1Y1W G;  5C4Z A;  1Z47 A;  4DXF A;  5A35 A;  2EDG A;  1N33 Q;  1T9H A;  1X3E A;  4JI7 L;  2ZM6 L;  1STE A;  4IPD A;  2EYP A;  2B2T C;  3X3M A;  1WTV A;  3CC4 A;  3TZD A;  1E7Z A;  4A3D H;  4YWK A;  4X66 L;  3K59 A;  1YI2 A;  3LX0 A;  1PH2 A;  4LUV A;  1EYA A;  2K28 A;  2UUB L;  4P74 A;  5IY0 A;  2VW9 A;  4KV6 A;  1PTO C;  4BBR H;  1IBM Q;  2NVX B;  1M4V A;  2FMC A;  4R8I A;  4CDC C;  4FVM A;  3MZ5 A;  3S2H B;  1A3V A;  4M1U B;  1VF7 A;  1EY5 A;  2B2U C;  2UUA L;  2J4X A;  1MKH A;  1WD0 A;  3E9H A;  2QGQ A;  1GUT A;  1RF2 D;  2PZT A;  3E6Z X;  2WB1 G;  1WI5 A;  2R7Z G;  5I9O A;  1F2L A;  2BH8 A;  2H1E A;  5M3M G;  3X3N A;  1AZP A;  3G7L A;  2KHI A;  5GQO A;  1Y1V B;  1PHJ A;  3HOZ B;  1TS3 A;  2VB3 X;  2VNU D;  3V05 A;  4BS9 A;  1D1I A;  1CHP D;  3CW2 C;  3QWN A;  2F0L A;  2WP8 J;  3R2T A;  2E75 C;  4Z9C B;  4QIW B;  1TWC B;  3JAM E;  2RBM A;  2E5L Q;  3G48 A;  2RSO A;  3A8I E;  2N49 A;  3VA5 A;  4DV5 L;  3K7U C;  4F88 A;  1CZW A;  2JEA I;  2BE5 D;  2V4D A;  3PO3 G;  4L63 B;  1XNQ L;  4IUP A;  5M9O A;  5CR3 A;  2XRQ D;  2OXP A;  3RMH A;  1GO3 E;  5LL6 S;  4A3G G;  1EIH A;  2PMZ E;  1PFN A;  4DV1 L;  1HZB A;  1PRT B;  1A2T A;  2L55 A;  2ALY B;  4KY5 A;  1VQH A;  4IUN A;  3MAQ A;  5ELO A;  1G91 A;  2ZXO A;  1GHK A;  2D2C C;  2KUM A;  4XT1 B;  1LTG D;  5ISR A;  3OWF A;  3K80 C;  2WB1 B;  1HFG A;  1PH6 A;  4I7Z C;  2UXC Q;  1A62 A;  1AE2 A;  1BO0 A;  5M3M B;  1GOZ A;  1C48 A;  5JOB A;  3CCQ A;  2RDG A;  3G6J B;  4O2D A;  4LFA Q;  2E2H B;  2VY3 A;  2MNA A;  1C7Y A;  4DV0 L;  4EX5 A;  5FJ8 G;  5D14 A;  2ENB A;  4GLV B;  4UHV A;  2F0H A;  2Z1C A;  3ZJY C;  3DHQ A; 
#chains in the Genus database with same CATH homology
 2I0Q A;  3W1G A;  4NB3 A;  4OWX B;  1JJG A;  4XTC S;  4DV2 Q;  3GDE A;  5M5W H;  3HOV H;  1A8V A;  1EUJ A;  1X56 A;  3HOZ H;  4JYA Q;  1PYS B;  1IL2 A;  1N32 Q;  4JC0 A;  4GNX C;  1U0L A;  2Y0S E;  3E0E A;  2D62 A;  4NPS A;  1CKM A;  3K0X A;  2ZTE A;  2EIF A;  2K5V A;  3S14 H;  4A3B H;  5IWA L;  2AWN A;  4C3H H;  1HNZ L;  4A93 H;  1N36 Q;  4MNO A;  3F1Z A;  3SGI A;  4IFD J;  1Q86 C;  1AH9 A;  4DV5 Q;  4GNX A;  2VQF L;  4DK3 C;  1VQA A;  2JEB I;  2JA8 G;  4BBS H;  1XTD A;  2LXK A;  3CCM A;  3BZK A;  1PH8 A;  3I4M H;  1G6P A;  2I5L X;  2DUD A;  3HKZ E;  2OQK A;  1H95 A;  3G6E A;  2NZO A;  5LMU L;  2HHH L;  1XNQ Q;  4A3D G;  1WCM H;  1LTL A;  3I7F A;  1L2F A;  1K0R A;  3HOY H;  4X62 Q;  4LF4 L;  4DR2 L;  4LF9 L;  2VQE L;  4YY3 Q;  1FGU A;  1BKB A;  1PYB A;  4DV1 Q;  4LFC Q;  5E7N A;  3JAM c;  2CWP A;  3OYY A;  2NVX H;  3A0J A;  2KBN A;  4BBR G;  4KHP L;  3S1N H;  5C3E G;  1EWI A;  1SE8 A;  2RF4 A;  4APV A;  3CD6 A;  4KLK A;  2RHQ B;  5K36 G;  1VS0 A;  1DGS A;  1B7Y B;  4ME3 A;  4JI1 L;  2PQA A;  1KIX A;  1E1O A;  4JI8 L;  5IYB G;  4PZ8 A;  1LUZ A;  4A3C G;  2A8V A;  1Y1V H;  2IX0 A;  1S3O A;  4YWL A;  2E8G A;  3CPW A;  3F2D A;  4BA1 I;  4B3T L;  2CWA A;  3HOU G;  1Q1E A;  4OX9 Q;  4YCV A;  4DV0 Q;  2JK8 A;  1YZ6 A;  4JV5 L;  1KRS A;  4RMF A;  3GTL H;  1GM5 A;  2JA5 H;  4AYB E;  3U58 A;  4LFB Q;  1V1Q A;  3UDI A;  3ULL A;  1CUK A;  1SRO A;  1ASY A;  1QVG A;  2UUC L;  3CQZ H;  4IPH A;  1JE5 A;  3OW2 A;  4X64 L;  3K7A H;  1VQK A;  1YIT A;  1LYL A;  3GD7 A;  4BA2 I;  2IT1 A;  1VQB A;  2YYZ A;  3I2Z A;  2F52 A;  5C44 H;  3UE0 A;  3J81 c;  4A3L G;  5IWA Q;  2JE6 I;  1HNZ Q;  4B3R L;  4MZ9 A;  3STB D;  1HR0 L;  4GOP C;  4DV2 L;  4PG3 A;  2VQF Q;  3EIV A;  4HJ8 A;  4B3M L;  2F4V L;  3GO5 A;  3FHW A;  1B70 B;  1W2B A;  1BBW A;  1P16 A;  1QVF A;  1JT8 A;  2C35 B;  1UE5 A;  1EFW A;  5LMU Q;  2Y0S G;  3DLL A;  2HHH Q;  4GOP A;  1QUQ A;  1E24 A;  4AQY L;  1B8A A;  4QJF A;  3TS2 A;  2HIX A;  4LF9 Q;  4LF4 Q;  4DR2 Q;  2VQE Q;  3M7N A;  1X3G A;  2WFW A;  4O0A A;  3H0G G;  1A0I A;  2NZH A;  3OTO L;  4TQU S;  4DK6 C;  4YHH L;  1EQQ A;  1FVI A;  3MEF A;  4POG A;  5FLM H;  1X6O A;  3A5U A;  1I94 L;  4BY1 G;  1OTC A;  3I4N H;  3HKZ G;  4KHP Q;  2JA9 A;  4DV4 L;  1IZ6 A;  3U50 C;  2BA1 A;  3UE1 A;  4NXM L;  4A3I G;  1UE6 A;  4HID A;  1PVO A;  5GAH C;  4A3K G;  1BVS A;  4YY3 L;  2K4K A;  4JBM A;  2WAQ E;  1YHA A;  1TWH H;  3CCL A;  3A74 A;  1KXL A;  3CCE A;  2K75 A;  4JI8 Q;  1C0A A;  4JOI C;  1YJW A;  2KCT A;  4MTN A;  1M90 C;  1YVC A;  3CCJ A;  3J80 i;  4Y7N H;  4DAY B;  4B3T Q;  2K5H A;  1OXT A;  3HOX G;  2R92 G;  1ASZ A;  1NE3 A;  3KF8 B;  4JV5 Q;  4X6A H;  4JOI A;  4LUZ A;  5JJL A;  2Z6K C;  4JG2 A;  5LMN W;  1M1K C;  2UUC Q;  3CC2 A;  3CPF A;  4LF7 Q;  3CP0 A;  2EXD A;  3KLW A;  4X64 Q;  2H5X A;  4R1J A;  4UP7 A;  1VQD A;  4A3E H;  4GN3 B;  2Z6K A;  1KL9 A;  4A3J H;  2N78 A;  2IHF A;  1KAW A;  4A3B G;  3CME A;  1XNR L;  4GKJ L;  4AYB G;  2VZA A;  3KF6 B;  1J5E L;  1SN8 A;  2GVB A;  4B3R Q;  1HZA A;  4JCV E;  1HR0 Q;  2YU9 H;  2V1C C;  4OO1 I;  1HNX L;  2IY5 B;  1NY4 A;  1Q81 C;  4B3S L;  1GD7 A;  1Q8K A;  1UEB A;  4B3M Q;  2FXQ A;  2F4V Q;  4A3G H;  2BA0 A;  2A19 A;  2OWO A;  3UDG A;  2ZJP A;  4IOC A;  4IPG A;  2IX1 A;  2UU9 L;  4DR5 L;  1IBK L;  4AQY Q;  4HJA A;  3HOY G;  5M3F H;  4L5S A;  3GTO H;  3S2D H;  2NVQ H;  1HNW L;  1J6Q A;  3L2P A;  3E9I A;  3OTO Q;  4JBJ A;  4YHH Q;  2UXD Q;  1S72 A;  2ZJQ A;  1I94 Q;  2A1A A;  1K9M C;  1UE7 A;  1QVC A;  4J15 A;  4DV4 Q;  4NXM Q;  3I4O A;  4DUZ L;  2XTI A;  1N34 L;  2VUM H;  2DGY A;  1SLJ A;  2R93 G;  2HQL A;  1MJC A;  1MIU A;  1Z9F A;  5HGQ A;  2UXB L;  4BY7 G;  1U5K A;  1BBU A;  1L1O B;  1CKO A;  3U4V A;  4QY7 A;  2MFI A;  3F2B A;  2CQO A;  5IP9 H;  1PV4 A;  4DR6 L;  2KCM A;  1X3F A;  4GKK L;  5IP7 G;  4IOA A;  1O7I A;  4IJH A;  2VL6 A;  1CSQ A;  3PSI A;  1NTG A;  2HT1 A;  3S2H H;  4IFD I;  4Y52 H;  3PIP A;  1TWF H;  1L0W A;  3IRB A;  3A5Z B;  1N9W A;  3T1Y Q;  2NVT H;  3AYH B;  4QQB X;  3RNU A;  1Q12 A;  4GLA C;  4DKA C;  4JI4 L;  4LF6 L;  4HJ9 A;  2JA7 H;  3PF5 A;  1CKN A;  2WAQ G;  1W3S A;  4HIM A;  4PZ6 A;  3F2C A;  5EAY A;  2VS1 A;  3S1M H;  3I55 A;  2JJQ A;  4L5T A;  2JA6 G;  4DR4 L;  1OXU A;  2BH2 A;  1VQ5 A;  3KDF B;  3CC7 A;  1OXS C;  3M4O H;  4K0K L;  1XNR Q;  2LSS A;  4GKJ Q;  2R7D A;  4R4Q A;  2I5M X;  3PCO B;  1J5E Q;  3PUV A;  3DM3 A;  2CKZ B;  4LF7 L;  1Y1W H;  1UE1 A;  4C3I H;  5AJ3 L;  1HNX Q;  5FLX c;  2Q2U A;  3J81 j;  4A76 A;  4B3S Q;  5C0X I;  1TWC H;  2K52 A;  1EOV A;  2ASB A;  1VQO A;  2GN5 A;  4AIM A;  1NJI C;  3UDF A;  4IO9 A;  3JAM i;  1R9T H;  3RN5 A;  4DUY L;  2UU9 Q;  4DR5 Q;  1XMO L;  1K3R A;  1IBK Q;  1NMF A;  2GVA A;  1WFQ A;  4NXN L;  3AFQ A;  2QEX A;  3ULJ A;  5C3E H;  2PI2 A;  4A3F H;  1HNW Q;  3G71 A;  1D7Q A;  4LWC A;  2CCZ A;  2D0P A;  4A3M G;  3CMA A;  4GS3 A;  4IJL A;  1WOC A;  1TWG H;  3HOW H;  2YV5 A;  1I6H H;  1HH2 P;  1RIP A;  5IYB H;  1HJP A;  4C3J H;  4P72 A;  4DUZ Q;  1PH5 A;  3PUX A;  1N34 Q;  4JI6 L;  3FKI G;  3K8A A;  4LF8 Q;  4A3C H;  3PIO A;  1VQI A;  2UXB Q;  5IYC G;  2RCN A;  4JI2 L;  4UP8 A;  4DV3 L;  3HOU H;  1VQC A;  3S15 H;  1VQJ A;  3G4S A;  4DR6 Q;  2UXD L;  1HZ9 A;  4GKK Q;  3PUZ A;  3KYH C;  2ZTD A;  4PZ7 A;  1VQL A;  1PFS A;  3BU2 A;  3LGJ A;  4FDB A;  3J80 c;  5LMN L;  3H3V H;  3GTK H;  2Q2I A;  1PH9 A;  3I56 A;  3CAM A;  3KF6 A;  4DV6 L;  2MQH A;  4P71 A;  2R7Z H;  1I3Q H;  4JI0 L;  1VQ6 A;  5C4X G;  5M3M H;  4H02 A;  4P73 A;  1FJG L;  5BR8 L;  2I5H A;  4JI4 Q;  4L5R C;  3M4P A;  4LF6 Q;  2Q2H A;  1XMQ Q;  2B3G A;  2YTV A;  2B63 H;  4OO1 G;  2NVY H;  3J7Z C;  4TVA B;  4P75 A;  2E2H H;  3HFZ B;  1Y14 B;  4QIW E;  3PO2 G;  3S1Q H;  1WYD A;  2Z0S A;  4C2M H;  4A3E G;  4DR4 Q;  4KI0 A;  3L0O A;  3T1Y L;  2R6G A;  1MJE A;  1X65 A;  2ID0 A;  3GTQ H;  4K0K Q;  1NBW A;  1GVP A;  1XPO A;  3MXN B;  4LW1 A;  3WWV A;  2KHJ A;  4QL5 A;  4DAM A;  1EIY B;  1L1O C;  3HOV G;  2CFM A;  1HZC A;  5AJ3 Q;  2NN6 I;  4A75 A;  1X54 A;  4X66 Q;  4DPG A;  3M85 A;  1N33 L;  1XJV A;  2E2J H;  1JB7 A;  4GLX A;  1WJJ A;  4DNI A;  4JI3 L;  3H0G H;  2PNH A;  2K5N A;  1JJC B;  1KHI A;  3FP9 A;  2AWO A;  1FL0 A;  4DUY Q;  1OXV A;  3S1R H;  3H15 A;  1K83 H;  1YJN A;  4A93 G;  3PO3 H;  4BY1 H;  1SRU A;  5M3F G;  5M5X H;  1VQ4 A;  1XMO Q;  1KC8 C;  1IXR A;  4NXN Q;  2Q2T A;  2PI2 E;  4JBW A;  3TS0 A;  1YHQ A;  1TWA H;  3KOJ A;  4BBS G;  1SR3 A;  5GAE C;  4QGU A;  2XGT A;  3I4M G;  3U4Z A;  3PF4 A;  4A3K H;  4WJ3 M;  4GOP B;  1QUQ B;  4AH6 A;  1X9N A;  1KQS A;  3GTP H;  3NBH B;  2OQ0 A;  3CCV A;  2WB1 E;  3PV0 A;  1PH7 A;  1SFO H;  1E1T A;  2L15 A;  2ZTC A;  1WCM G;  1V43 A;  1QZH A;  1Q82 C;  4GN5 A;  5IE8 A;  2VUM G;  1IBM L;  4JI6 Q;  4EQ5 A;  3S16 H;  3PGZ A;  3T1H Q;  2YTX A;  4HIO A;  3GTG H;  3S17 H;  2AHO B;  4POF A;  4JI5 L;  1PA6 A;  3JC6 6;  2RHS B;  1K8A C;  1D8L A;  2OCE A;  4KHZ A;  1CSP A;  1TXY A;  2N8N A;  4JI2 Q;  5IP9 G;  3HOX H;  4DV3 Q;  2R92 H;  4RG1 A;  2K14 A;  5JJI A;  1PH3 A;  2ZJR A;  1P8L A;  4UP9 A;  5LMN Q;  5J3B A;  4YCU A;  3RLN A;  4R4O A;  4L5Q A;  3KFU A;  4DV6 Q;  4JBK A;  1A63 A;  4LF8 L;  1SMX A;  4JI0 Q;  2KEN A;  4OXP A;  5GRO A;  3W5O A;  1FJG Q;  5BR8 Q;  2JA7 G;  2B29 A;  3AFP A;  1KD1 C;  1VQ7 A;  3ICE A;  3M3Y H;  1V9P A;  1YHB A;  1NMG A;  5FJ8 H;  5IT9 c;  4ALP A;  2YTY A;  1IBL Q;  3RR5 A;  3B6Y A;  4LF5 L;  1Y1V G;  5C0X G;  4X65 Q;  5IYD G;  3HOZ G;  5JEA G;  1VQ9 A;  1UWV A;  4DV7 L;  2JA5 G;  2AKW B;  1X55 A;  4WJ4 A;  4DR1 L;  1XMQ L;  1Q7Y C;  1VQE A;  2K50 A;  3CCS A;  1Y1W G;  5GAD C;  2E2I H;  2E5L L;  1Z47 A;  4HJ5 A;  1YEZ A;  4LUO A;  1N33 Q;  1T9H A;  4R4T A;  1X3E A;  3RZD H;  1OXX K;  2MO0 A;  4JI7 L;  1I5F A;  5C44 G;  1Q46 A;  2ZM6 L;  4JI3 Q;  2JA8 H;  4IPD A;  3D31 A;  3RZO H;  1VQN A;  3CC4 A;  4OWW B;  4PMW A;  1PH4 A;  4A3F G;  1G51 A;  1E7Z A;  4A3D H;  1VQM A;  4YWK A;  3CCR A;  4X66 L;  2R93 H;  1YI2 A;  2N3S A;  3STB C;  3CCU A;  5M5Y H;  5C0X J;  3HKS A;  5GAG C;  1PH2 A;  4LUV A;  4BY7 H;  2UUB L;  3HOW G;  5JJK A;  4P74 A;  5IY0 A;  2VW9 A;  5JEA J;  1EQR A;  1G29 1;  3NEN A;  4DR3 L;  5IP7 H;  2LXJ A;  5DLQ E;  4BBR H;  4GNX B;  1IBM Q;  3TRE A;  4OON A;  4JI5 Q;  2HIV A;  1XPR A;  4IPC A;  3PUW A;  1EYG A;  2UUA L;  5FLM G;  2UXC L;  1MKH A;  3TQY A;  3E9H A;  3RN2 A;  3I4N G;  1EIF A;  2QGQ A;  3F8T A;  3NEL A;  5HY6 A;  4UY8 C;  2WB1 G;  2JQO A;  2EQS A;  1E22 A;  1WI5 A;  4HJ7 A;  2R7Z G;  5M3M G;  2BH8 A;  3T1H L;  3GTJ H;  2KHI A;  4LFA L;  2JA6 H;  5GQO A;  3EN2 A;  4DR7 L;  1XPU A;  2B63 G;  3KJP A;  1PHJ A;  1VQF A;  4R4I A;  2NN6 G;  3RLF A;  4A4I A;  4YCW A;  4LF5 Q;  1JMC A;  2ES2 A;  3ERS X;  2VNU D;  1CKN B;  2PQA B;  3CW2 C;  4JYA L;  5ELN A;  4DV7 Q;  1N32 L;  1N8R C;  2R7F A;  2WP8 J;  3PUY A;  3TEH B;  4DR1 Q;  2AMC B;  1VQP A;  3KJO A;  1VCI A;  3TRZ A;  3J81 i;  3VDY A;  2UUB Q;  2MO1 A;  1YIJ A;  2E5L Q;  4A3L H;  1IBL L;  1AE3 A;  1N36 L;  3G48 A;  4X65 L;  3H3V I;  2N49 A;  3ER0 A;  3K7U C;  4DV5 L;  4A3J G;  4JI7 Q;  3BZC A;  3CXC A;  2ZM6 Q;  1YBY A;  2JEA I;  4A3M H;  3PO3 G;  3AEV A;  3NEM A;  2QA4 A;  1GKH A;  1HR0 W;  3Q8D A;  1Q1B A;  1XNQ L;  3ULP A;  4YWM A;  4BXX G;  3S24 A;  5IYD H;  4UPA A;  4BXX H;  1GO3 E;  3FKI H;  3AQQ A;  1LM0 A;  3L7Z C;  4X62 L;  4A3G G;  4JI1 Q;  1VQG A;  1PH1 A;  5IYC H;  1IYJ B;  2PMZ E;  4LFC L;  1RL2 A;  1HZB A;  3M9B A;  4DV1 L;  3BJU A;  1K8G A;  2IHE A;  1VQ8 A;  2ALY B;  2ATW A;  1L1O A;  1VQH A;  1YNX A;  5C4J H;  4DR3 Q;  5ELO A;  2OTJ A;  3J7A 5;  1KRT A;  3W1B A;  3EBE A;  3K81 C;  4GN4 B;  4OWT B;  3RLO A;  1C9O A;  4HIK A;  4A3I H;  3GTM H;  3K80 C;  5C4X H;  2UUA Q;  4R4C A;  1PH6 A;  2UXC Q;  1A62 A;  1AE2 A;  2F3I A;  1S40 A;  4IFD G;  2OTL A;  3M4Q A;  3CF5 A;  4LNQ A;  1E3P A;  1K73 C;  3CCQ A;  1I50 H;  3PO2 H;  1YJ9 A;  3D0F A;  1JJ2 A;  4O2D A;  4LFA Q;  2VY3 A;  4DR7 Q;  5H1S E;  2MNA A;  1C7Y A;  4DV0 L;  4EX5 A;  5FJ8 G;  4OX9 L;  2D0O A;  4GLV B;  4LFB L;  3KDF A;  4XIG S;  3ZJY C;  1QZG A;  3UDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...