4JI7L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7L00
4H02A 4PG3A 1WFQA 2KHJA 4DR4L 4HIOA 3G4SA 1PH9A 1WOCA 4AYBE 1JMCA 4GN4B 4HIKA 1Q81C 4A3GG 4L5RC 4P75A 1VQHA 3A0JA 4GOPA 3HOUG 4IFDG 2KHIA 3CQZH 1BKBA 4DV0Q 1BBWA 3H3VH 1EQQA 2UXDQ 2JA6H 2KCTA 4YY3L 5JJKA 4DNIA 4DV6Q 5GROA 2E5LQ 3NBHB 4IJLA 2NVXH 1XNRQ 3CC7A 2CWPA 2N8NA 1YI2A 1QVGA 4GS3A 4DV4L 2PI2A 5IWAQ 1YITA 2R92G 1YZ6A 3GTMH 4LUOA 1Q1EA 4LF4Q 4AH6A 2R92H 3VDYA 3DLLA 1AE2A 2VS1A 4QIWE 4LW1A 2JA8H 2LXJA 3U4ZA 1N33L 2K5NA 4GLVB 3GDEA 4GKKL 4WJ4A 1N34L 1I94L 3TS2A 1V9PA 4HJ9A 5FLMH 1UWVA 1IBKL 4A3BG 1PH3A 4ME3A 2JA5H 3U58A 1X6OA 1XPUA 2R93G 5C4JH 2VQFQ 3S1RH 2F52A 2YTYA 1PH6A 4DV7Q 3CD6A 1JJCB 2I5HA 1WI5A 4X66L 4DR7Q 4DV2L 3KF8B 4GOPC 4C3HH 2GVAA 5IE8A 5IP7H 4JI4Q 4L5SA 1C0AA 3ER0A 2UU9L 3PSIA 2WFWA 1B70B 3J80c 1CUKA 1PH1A 4LF8L 2ZJQA 2R6GA 1JJ2A 2R7DA 3HOZG 3KFUA 3PV0A 4JI7L 1C7YA 1HNWL 4B3TL 4LFAL 1XTDA 3KF6B 3K81C 1KRSA 4HJ5A 4A3CH 1FGUA 2OCEA 4BY7H 4A3DH 1Q7YC 1M90C 1N32L 3F1ZA 2UUBQ 3SGIA 4JI0L 1PYSB 1CSQA 2K4KA 1P16A 4A3MG 3S1MH 1Q12A 4C3IH 1HZAA 1EUJA 4JI2L 1H95A 4A3JH 1WJJA 1SMXA 3KDFB 3KJOA 1JJGA 5LMUL 4B3SL 4LFBQ 3J81j 3S24A 2AWOA 4GKJL 3JC66 3PUWA 2V1CC 5EAYA 4JYAQ 3CCVA 4LF7L 1VQPA 1HNXQ 1Y1WH 2N49A 1QUQA 1MIUA 4AYBG 4UP7A 1AE3A 4X65L 3D31A 1K8GA 2CCZA 2AHOB 1LTLA 2EIFA 1BVSA 1O7IA 4RG1A 4BY1G 3CCJA 3CAMA 1X3FA 3W1GA 1E22A 2E2HH 2R7FA 1YHQA 4BA1I 5C44G 2LSSA 1VQIA 1NBWA 2JA9A 4EX5A 4UP8A 4LWCA 1E1TA 1E24A 1YIJA 2N3SA 1SFOH 2L15A 2MQHA 4POGA 4P72A 3L2PA 4A3KG 1IBML 4JV5Q 2I0QA 4BA2I 1X55A 3L7ZC 4DV5Q 4O0AA 1T9HA 4YCWA 4A3KH 2OTLA 2JA7G 3IRBA 1PH4A 4DUZQ 2K5HA 4DV1Q 1LYLA 1VQ9A 4B3TQ 1G291 1ASZA 3ZJYC 1QZHA 2JA8G 4OX9L 3AEVA 5IY0A 3FHWA 4O2DA 1VQEA 1IBLQ 4JI1L 3E0EA 3KYHC 2ZJRA 4JI6L 3J81c 3RNUA 3GTQH 4TQUS 3G48A 5GADC 4JI3L 4PZ7A 1TWAH 5C4XH 2DGYA 5M3MG 3KF6A 1X9NA 3E9IA 4YCVA 5JEAG 3PUZA 5C0XI 5IT9c 4DR5L 4DAMA 2WP8J 1XMOQ 2HHHQ 4HIDA 1QZGA 3HOZH 2PNHA 3I56A 5JJLA 4PZ8A 2JK8A 4GN5A 4A3LG 1OXVA 2BA0A 3TRZA 4A3EG 4KI0A 4B3RL 4BBRH 2RHSB 4GOPB 1A63A 1WYDA 1JE5A 2QEXA 3I7FA 1I5FA 2HQLA 2HIXA 1KAWA 1MKHA 4QL5A 2ID0A 4IO9A 2UXCQ 1SLJA 2A19A 3S1NH 4A3CG 1KC8C 4NXML 4LF5L 1EOVA 1UE7A 1TXYA 1L1OB 1VS0A 3CC4A 2VL6A 3GTJH 4DV0L 2F4VQ 4Y7NH 1A8VA 3H0GH 1K73C 3GTLH 4KHPL 3UE1A 3T1YQ 2A1AA 4A75A 4AQYQ 4JI5Q 1MJEA 2B63H 5AJ3Q 1VCIA 1L1OC 1YJ9A 1GM5A 1YHBA 2PQAB 1XNRL 2K52A 4X62Q 1SR3A 3PUXA 4GN3B 5ELNA 2EXDA 1JB7A 2HT1A 4BY1H 1Y1WG 1VQLA 1KXLA 2IHEA 3B6YA 1NMFA 1HZ9A 2C35B 1X3GA 2VY3A 1X56A 4IFDJ 2A8VA 4GKKQ 1N34Q 4IOAA 1IBKQ 4DR3Q 2AWNA 1D7QA 3I4MH 1HNZQ 2VQFL 3M4PA 3HOVG 1I6HH 2CQOA 4FDBA 4DV7L 1Q46A 4K0KQ 3OYYA 4R4QA 4DV2Q 3K7AH 5LMNW 2IT1A 5M5XH 1XMQQ 2PQAA 1VQ5A 1G51A 4YWMA 2JA5G 4A76A 2BH8A 4JI4L 2R7ZG 2E2IH 1TWCH 3DM3A 3J7ZC 4JG2A 1HR0Q 4YHHL 4OWWB 1L1OA 3ICEA 3NEMA 4JI7Q 3HOYG 1HNWQ 2ZM6Q 4LFAQ 5IP9H 1CKNA 2D0OA 1Q8KA 4OO1I 1ASYA 2Z6KA 1CKMA 2WAQG 4IFDI 1N32Q 3CXCA 2UUBL 3RN5A 2UUCQ 4JI0Q 4GLAC 1Z47A 5BR8Q 1VQFA 1VQCA 4A93G 3A74A 2VZAA 2XTIA 4BXXH 4BBSH 1TWHH 1VQGA 3PUYA 3G71A 1YJNA 3TEHB 4B3SQ 4BY7G 1FJGQ 3J7A5 3FP9A 1HNXL 4B3ML 3CMAA 3CCRA 1YNXA 3CCUA 5FJ8G 3WWVA 3PGZA 4X65Q 3T1HQ 4X64L 4JBWA 2QA4A 1K0RA 2CKZB 1K8AC 5H1SE 1VQ8A 4GLXA 1KIXA 3I4NH 2Y0SE 4NB3A 1XNQL 4LUVA 4P71A 3CPFA 3TREA 3M9BA 1CSPA 3HOUH 3UDXA 3M85A 2Z6KC 3PCOB 4DR2L 3CC2A 2KBNA 4PZ6A 1DGSA 5HGQA 4DV5L 4L5QA 3KLWA 3MEFA 4NPSA 4AIMA 4C2MH 3CCEA 3I2ZA 5C0XJ 4DUZL 1K83H 4DV1L 1LM0A 3AYHB 1W2BA 3BZKA 3EIVA 1N8RC 1NJIC 2WB1E 4JI8L 2PMZE 4IJHA 3RR5A 2ALYB 4JCVE 4J15A 1PV4A 4LFCQ 4OX9Q 1V43A 2OTJA 1SROA 2ZTEA 2JEAI 3EN2A 4BXXG 1YVCA 2QGQA 2UUAQ 4Y52H 4LF6L 3ULPA 1OXTA 2JA7H 1QUQB 3I4MG 3CF5A 5IYCG 1PH7A 4R4IA 4OXPA 4IPDA 5IYDG 3BZCA 3RLOA 1JT8A 3HKZG 3HOWH 5IYCH 4LF9Q 2YU9H 1EQRA 3A5UA 1XMOL 2HHHL 4DR1L 3U4VA 1OXXK 2HIVA 1HH2P 1WCMG 2NZHA 3GO5A 1KRTA 5M5WH 2LXKA 1J5EQ 1XPOA 4A3JG 3GD7A 4B3RQ 2JJQA 2NZOA 5ELOA 1PYBA 5GAHC 2FXQA 4ALPA 1Q1BA 3OTOQ 2JEBI 2K50A 2MFIA 2UXCL 2YYZA 5E7NA 4HIMA 3EBEA 1PH8A 1E7ZA 1SRUA 2Q2TA 4LF5Q 4NXMQ 3LGJA 1GKHA 2AKWB 2RF4A 3ERSX 3Q8DA 4OWXB 5LMNQ 3GTKH 4LNQA 4R4TA 2E2JH 2F4VL 1IZ6A 4KHPQ 3T1YL 4BBSG 4AQYL 1EIFA 4JI5L 1NMGA 5C44H 5AJ3L 3S2HH 1EIYB 1HZCA 3AQQA 3HFZB 3BJUA 4X62L 4DUYQ 4DR6Q 1CKOA 4JOIA 3RZDH 3HOVH 2MO0A 2D62A 1MJCA 3H0GG 1UE1A 4UPAA 3TQYA 1U0LA 3CCMA 3S15H 1PHJA 3S17H 3AFPA 1YEZA 3PF4A 1U5KA 1FVIA 2JQOA 2MNAA 2R7ZH 4DR3L 2ZTCA 1KQSA 4NXNL 1YBYA 1HNZL 1J6QA 1VQBA 1KL9A 4YWLA 4K0KL 2K5VA 1UEBA 1SN8A 5FLXc 4OO1G 1XMQL 4GNXB 2RCNA 1L0WA 1EYGA 1QVCA 4GNXA 5M3FH 2YTVA 1A0IA 1KHIA 2CFMA 3K8AA 3STBD 1S40A 3PO3G 3PO2G 1HR0L 3RZOH 4A3LH 4QJFA 4YWKA 1A62A 4YHHQ 5IYDH 3HKZE 1PVOA 4QY7A 4POFA 3M4QA 2ZM6L 4JBKA 4P74A 4DK3C 3HOWG 3S2DH 2BH2A 4L5TA 1XJVA 1K3RA 2OQ0A 4JOIC 3L0OA 3F2BA 2GVBA 2UUCL 3HKSA 3MXNB 3UDGA 1B7YB 5GAGC 3AFQA 2IX0A 2I5MX 1LUZA 5BR8L 4QGUA 1HJPA 2NN6G 1M1KC 2K75A 2WB1G 4HJAA 5IP9G 4DKAC 2ATWA 3I4NG 5J3BA 1AH9A 1S3OA 2B29A 4DV3Q 4A3IH 4APVA 1FJGL 1C9OA 2PI2E 4JC0A 1N36L 5JJIA 3BU2A 4XTCS 4B3MQ 3D0FA 3K80C 5GQOA 2VQEQ 3M3YH 4IPCA 2UXBL 1X65A 3I55A 3T1HL 1NTGA 1YHAA 4X64Q 2BA1A 2Y0SG 3CCQA 1PA6A 1W3SA 4GNXC 3CCLA 2IX1A 1VQDA 1OXSC 1XNQQ 2RHQB 4JBJA 4R4OA 4DR4Q 2Z0SA 1HR0W 3PIPA 2NVTH 5FJ8H 4KHZA 1Y1VG 5IYBH 3PF5A 3HOXH 1VQOA 4DR2Q 1OXUA 2E8GA 1RIPA 1L2FA 1Y1VH 5IYBG 4OONA 3RLFA 2UXDL 2Q2UA 2OWOA 2ZJPA 4YY3Q 4DV6L 5M5YH 2E5LL 3CPWA 4P73A 4A3FH 4JI8Q 4IOCA 2ZTDA 4LFCL 3KOJA 4DV4Q 5IWAL 4A3FG 2EQSA 3I4OA 1WCMH 4HJ8A 1TWFH 4KLKA 4LF4L 4X6AH 2WAQE 1Q82C 3GTOH 2UUAL 2R93H 4XIGS 3J81i 3CCSA 4LF6Q 3M7NA 3W1BA 3HOYH 1GVPA 1N33Q 4A3IG 1PH5A 1IL2A 2JA6G 1YJWA 5M3FG 4HJ7A 2KENA 2CWAA 1X3EA 5M3MH 1I94Q 4LF9L 2B3GA 4IPHA 1EWIA 3PO2H 1I50H 2DUDA 5IP7G 4RMFA 4DR1Q 5C0XG 4MTNA 2F3IA 1J5EL 3GTGH 4X66Q 4PMWA 4DR7L 2ES2A 4BBRG 2JE6I 1GO3E 3PUVA 1NE3A 2ASBA 1N9WA 1B8AA 1UE6A 1UE5A 1D8LA 3OTOL 5DLQE 1P8LA 4MZ9A 5FLMG 2H5XA 3PIOA 3H15A 2NVYH 2N78A 2UU9Q 1OTCA 1VQMA 1GD7A 4LF8Q 3K0XA 4LUZA 5LMNL 1HZBA 3F8TA 1VQJA 1BBUA 3KJPA 4TVAB 3RLNA 2AMCB 5C4XG 3STBC 2YTXA 1E3PA 3FKIH 1PH2A 4A93H 4DUYL 3GTPH 3F2DA 2XGTA 1TWGH 4EQ5A 4DR6L 3FKIG 3UDFA 1QVFA 3S16H 2VNUD 2VUMG 4JI2Q 3OW2A 3G6EA 4A3EH 1FL0A 4R4CA 3NENA 2K14A 2Q2IA 5LMUQ 3ULJA 1XPRA 1IYJB 1SE8A 4LFBL 4GKJQ 4JBMA 1VQ6A 3JAMi 3ULLA 3UE0A 4A4IA 2Q2HA 1Z9FA 4LF7Q 4JYAL 3HOXG 2NN6I 1VQ4A 3F2CA 4UP9A 3PO3H 1KD1C 1VQ7A 4NXNQ 1PFSA 2NVQH 2MO1A 3CP0A 3TS0A 5C3EH 2B63G 1EFWA 4QQBX 3CW2C 5C3EG 3M4OH 3E9HA 1V1QA 4OWTB 2YV5A 3KDFA 1IXRA 4A3GH 4JV5L 1IBMQ 1RL2A 4MNOA 4A3BH 2KCMA 5JEAJ 1K9MC 4DK6C 3S14H 1VQAA 3CMEA 3H3VI 3W5OA 2I5LX 1VQKA 5K36G 1Q86C 1VQNA 3U50C 2VUMH 1X54A 1IBLL 4JI1Q 4JI6Q 3S1QH 2IY5B 1NY4A 4IPGA 4C3JH 5GAEC 4A3DG 1Y14B 1G6PA 2D0PA 4JI3Q 4DV3L 2VW9A 4R1JA 1N36Q 5HY6A 4DR5Q 3UDIA 3K7UC 4DPGA 1CKNB 2GN5A 2VQEL 3NELA 1R9TH 3A5ZB 2UXBQ 1I3QH 4WJ3M 4UY8C 2IHFA 3JAMc 4A3MH 1E1OA 1S72A 3RN2A 4DAYB 4YCUA 3J80i 2OQKA
chains in the Genus database with same CATH superfamily
4H02A 4HCSA 4XT1B 5EBCA 2JXMB 4HIOA 4GN4B 1Q81C 1GUGA 1CA5A 1R9TB 3I70A 3H3VH 4ABNA 1U4MA 2JA6H 4HSVA 2KCTA 5JJKA 4DV6Q 5F2DA 5GROA 2NVXH 3CC7A 2CWPA 3AU7A 2DY8A 2B63B 5IIFA 4DXFA 4AH6A 2R92H 3VDYA 4XQJA 3DLLA 1F2LA 1EY8A 2LXJA 5JPNC 4FXDA 1KLUD 3RZOB 2B8GA 3GTGB 1UWVA 1PH3A 4MHEA 4CDFC 1X6OA 2YTYA 1UEAB 1EYCA 3QIAA 4XQNA 4C3HH 1CT1D 4NMZA 2GVAA 3GTPB 1GUTA 2JSOA 4F88A 3OHXC 5BN4A 3ER0A 5L37A 3OWEB 3J80c 2R6GA 1JJ2A 2R7DA 3HOZG 5KRUA 1Y8OB 5D14A 4HJ5A 2B2UC 2F0TA 3KBXA 1FGUA 4OIJA 4X3UA 3CKIB 4C3JG 1Q7YC 1O80A 1N32L 4C3IG 4JI0L 2K4KA 5FLXL 1HZAA 4A3JH 3KDFB 3U9SA 3KJOA 2PZUA 3EROA 3S24A 4GKJL 2V1CC 2Z1CA 3I8ZA 5EAYA 3SE0A 4LF7L 1HNXQ 3FKIB 1QUQA 3MVVA 4AYBG 2NWGA 1BCPD 5DM63 1LTLA 2F0JA 4MN3A 1X3PA 4J1MA 3CAMA 3E3XA 2E2HH 2ENBA 1VMCA 3I73A 4BA1I 5C44G 5E3FA 3EA6A 4KKSA 1NBWA 4U673 1F9PA 2N3SA 3L2PA 2I0QA 4C3JB 1X55A 2IL8A 1PH4A 4DUZQ 2K5HA 1JOOA 1HUMA 2Z4IA 4CBVA 5IY0A 4I7ZC 3SK4A 2O5IC 4JI1L 2ZJRA 3K59A 1BO0A 2F3WA 5GADC 4JI3L 2MPMA 2O2LD 3E5SA 1X9NA 3K57A 1QJOA 4DAMA 2WP8J 4DR5L 1XMOQ 2VB3X 4A3FB 2HHHQ 1HHVA 4GN5A 1OXVA 4HMIA 4A3EG 1YNJC 1A63A 2GA4B 4GOPB 1WYDA 1A6XA 1I5FA 3E6ZX 1KAWA 2NVTB 4IO9A 1SLJA 2A19A 1K28A 3FDTA 4ZCKA 1EOVA 1TVXA 2KHSA 1L1OB 4Z9CB 2VL6A 4CDDC 4DV0L 3UE1A 1CHPD 3T1YQ 4JI5Q 3V96A 1VCIA 4FNFA 5EPLA 2PQAB 4DU9A 2HT1A 2IHEA 3B6YA 2PNRC 1X3GA 2VY3A 2L9HA 2OF1A 4X3TA 4F8MA 1HRJA 1IBKQ 1HNZQ 3M4PA 4FDBA 2X6LA 5ISRA 1RD9D 3K7AH 5LMNW 1H9KA 2X6GA 1VQ5A 3PMFA 4NP5A 1TWCH 2RKSA 3J81E 2NZ1D 2TMPA 2RDGA 1DXMA 4OWWB 3ICEA 3NEMA 1LTRD 2F0FA 2ZM6Q 3MC0B 4G7HC 3CXCA 2UUBL 3C1EA 1IW7D 1Z47A 5BR8Q 1VQCA 2F0OA 1UUPA 2EY6A 5FO8B 1Q90A 4N8FA 1SNQA 3PUYA 3URYA 4JPBW 3G71A 4BY7G 1FJGQ 2BE5D 3KK7A 3ND9A 2F3VA 4CJ2C 2L4NA 3H3VC 1ESRA 5COYA 5J1ZA 1YNXA 3R2IA 2L11A 4JBWA 3MFYA 2QA4A 1K8AC 2B2TC 3A8KE 1XNQL 4LUVA 4P71A 1EWHA 1RTNA 1U4RA 2VUMB 2EZVA 3M9BA 1S4ZA 2WACA 3HOUH 3M85A 4K8IA 2XRQD 4DV5L 4LAAA 4L5QA 2A6HD 3CCEA 3GTMH 1DONA 1N8RC 3EIVA 4JI8L 3RR5A 1PV4A 2WB1B 2A73B 3A54A 4B9XA 2OTJA 1BXTA 2F0UA 4BXXG 1C48A 1OXTA 1QUQB 2R92B 2N88A 3PQIA 4R4IA 5IYCG 3BZCA 1PTOD 1EOTA 3A7AB 3A5UA 4CKCA 2B2TA 2NZHA 1HH2P 1KNEA 5M5WH 1W6KA 2JP1A 3GD7A 1PZJD 4B3RQ 1DOMA 1PYBA 1O78A 2BDOA 2H1EA 5JVH3 1Q1BA 1Z7TA 2MFIA 2K03A 4HIMA 4NXMQ 4LF5Q 2ZXPA 1E7ZA 1CQVA 3S15B 3G7LA 3ERSX 5TSSA 1SMYC 5LMNQ 3GTKH 4IFDH 1QE6A 2F4VL 2NVYB 4DNRB 2K7VA 5AJ3L 3S2HH 5ELDA 3AQQA 1B4OA 2PYKA 4X62L 1Y8NB 3RZDH 3HOVH 3K5OA 1UE1A 4UPAA 3S15H 2H4OA 5I4DA 1S5BD 4B9WA 5D3DA 4DR3L 5JPMC 1YBYA 4ILWA 1VQBA 4G7OC 3MXGA 3MEHA 3Q24A 3T51B 4OO1G 5EJWA 2EYMA 3S9WA 4GNXB 1EQVA 1PFMA 2RCNA 1L0WA 5LHY1 1H9JA 1CZGA 1VF5C 2Q8TA 1KABA 4O1NA 1EY7A 3PO3G 4A3LH 4QJFA 4YWKA 1LLRD 2RSOA 1SYBA 3C1FA 4P74A 3TBIB 2NTTA 1ZYRD 3DEPA 3P1HA 3L0OA 1B9NA 3K0YA 5GAGC 1PTOF 1EQTA 2IX0A 1HJPA 1M1KC 2K75A 5KGUA 4BS9A 3TP7A 1S3OA 5J22A 4JC0A 1ZXTA 1RTOA 4K14A 5JJIA 3BU2A 5C4XB 3K80C 5GQOA 3M3YH 1SYFA 5CV4A 1SYGA 3T1HL 1PA6A 1NTGA 4X64Q 3CCQA 1CK1A 1W3SA 2IX1A 2WV6D 1V8QA 4DFAA 2O4XA 3K5MA 3VR5A 4RFBA 4JBJA 4R4OA 4RHRA 3PIPA 2PQEA 5G3LD 5IYBH 1RKNA 3PO3B 3I90A 5CV5A 1JQYD 1Y1VH 3S2DB 4UAIA 3IFDA 2Q2UA 2ZJPA 4DV6L 5IWAL 4A3FG 2EQSA 3I4OA 1S5CD 1IL2A 1JOQA 5M3FG 1X3EA 4LF9L 1EWIA 3PO2H 2LFNA 4OO1H 5A35A 1CTMA 3HP3A 3CHBD 2PZTA 1AN8A 1D8LA 3OTOL 5DAUA 4MZ9A 5FLMG 3PIOA 2NVYH 3SHLA 1VQMA 2DN8A 4LUZA 1BBUA 3RLNA 5CMDA 2PW5A 5C3WA 1E3PA 2F0KA 5AFWA 5EPKA 3V2TA 4DR6L 2SNMA 3FKIG 3UDFA 2VUMG 2XIWA 4HSPA 2K5QA 2BCOA 1F9RA 1FGBD 1VDZA 2R93B 5D3IB 4A4IA 5IOCA 1Z9FA 4LF7Q 2NN6I 1VQ4A 1SFOB 4UP9A 1SYEA 3PO3H 1KD1C 2ICEC 4NXNQ 4TKOB 1PFSA 2NVQH 3CP0A 3TS0A 1B1ZA 5EKKA 2K5DA 1S5ED 4QQBX 2NTSA 1C8CA 2YV5A 3KDFA 3OIQA 3C46A 2KCMA 2A6EC 1K9MC 3BDOA 4DK6C 3LWEA 1KDBA 4G4KA 4DGZA 1JORA 1GUNA 2I5LX 2QF7A 1JICA 5K36G 3T16A 1IBLL 4JI1Q 4IPGA 3D4DA 4C3JH 1G6PA 3Q22A 5IGCA 4DV3L 1RJTA 2VW9A 4R1JA 1PYWD 4DR5Q 1SNDA 5KYIA 1CKNB 1L0XB 1XTCD 4K6DA 2UXBQ 1S72A 1E1OA 1HA6A 3P75A 2P5ZX 5C44B 4TSSA 5EQ0A 4OGQC 3HS0C 3R2TA 1EWCA 1GOZA 5ELCA 1WOCA 4AYBE 1QNUA 4IUTA 1VQHA 4R8NA 2M9VA 1HTLD 2F0EA 4J6HA 4KTAA 4YY3L 3NBHB 3D6WA 2N8NA 1QVGA 2HCIA 4DV4L 2R92G 4OL7A 1D5MC 1WTOA 4LF4Q 1WTRA 1AE2A 1L0YB 1EIHA 4X3SA 1N33L 4XDXA 4V190 4GKKL 5I9PA 3TZDA 1IBKL 1JOKA 4A3BG 4ME3A 5C3XA 2NN6H 2Y0SB 2VQFQ 2BE5C 1A15A 3D3RA 1PH6A 3CD6A 4DV7Q 1CHQD 3DMUA 4DR7Q 5IP7H 1TS2A 4L5SA 4I65A 1C0AA 3TMEA 3IKJA 3NQIA 3OW7A 3W3AA 2WFWA 1B70B 2YU9B 1PH1A 4LF8L 2ZJQA 2SNSA 1C7YA 1XTDA 3KF6B 3VA7A 4A3DH 4BY7H 3U9OA 2UUBQ 4BY7B 4A3MG 4FVMA 1LABA 3ITPA 1FR3A 3BVGA 4MIUA 2AWOA 1D5ZC 3JC66 3HRZC 4JYAQ 1EY5A 1JWMD 4PMCA 4AYBB 1O7LA 2F0WA 2VXWA 2CCZA 2EIFA 1O7IA 4H44C 1E22A 2R7FA 1YHQA 1DM0B 1VQIA 5ELFA 1RODA 2JA9A 4LWCA 2L15A 2MQHA 4ZKCB 1IBML 4BA2I 3L7ZC 4O0AA 2OTLA 2Z6BA 4QCLA 3IRBA 1LYLA 3HOZB 1XX8A 1QZHA 2JA8G 2K6AA 4N9PA 2E2HB 5JJZA 2D9UA 4NW2A 1QB5D 3FHWA 4O2DA 4KD4A 4M1UB 1STGA 4JI6L 2NVXB 2DJFC 4A3IB 4TQUS 3G48A 5E1FA 5JOBA 2DGYA 5M3MG 3CU7A 4KD3A 3KF6A 5C4HA 4U68A 5IT9c 1ZKOA 2G9DA 4HIDA 3ERQA 2PNHA 5C3EB 3GTLB 4KI0A 1SYCA 1WCMB 1JE5A 3H94A 3I7FA 4DAVA 1MKHA 4QL5A 4A3CG 3HOXB 1WD1A 4LF5L 4NXML 1JWUD 3PIO3 1WD0A 3GTJH 2F4VQ 1A8VA 4KHPL 2KCNA 3MXNA 3GQBA 4K5WA 5AJ3Q 2WKCA 2G5DA 5I9OA 1H9MA 1SSOA 1YHBA 2AUKA 3Q0AA 1GM5A 1XNRL 1SR3A 3PUXA 1LTBD 3VYSA 3L9AX 1JB7A 2XWBB 4BY1H 1Y1WG 4ZRZA 2FJ2A 1HZ9A 5JAVA 2B2VA 3TDQA 3VR2A 1N34Q 4IOAA 5BN3A 4DR3Q 1JE4A 4KY5A 1PXUA 1Z6HA 1I6HH 3H0GB 4HTHA 3D4WA 4R4QA 4DV2Q 3X3MA 5M5XH 1BDOA 1F2ZA 5I2XA 2BH8A 1I4XA 4BBSB 2R7ZG 2E2IH 1WTPA 4K8JA 1HR0Q 4YHHL 1L1OA 4ID6A 1I50B 4JI7Q 1J9OA 3HOYG 1HNWQ 2D0OA 1Q8KA 1YNNC 3K5LA 5CV6A 1MBYA 3GTMB 4IFDI 1DCZA 4LJZC 3RN5A 4GLAC 3TN2A 4A93G 5C0XH 3NTHA 4BXXH 2C5CA 1VQGA 3DUZA 3M4OB 4QF4A 2R7ZB 3CMAA 3S2HB 1Y69U 3CCUA 2RQXA 3BVMA 3T13A 3SK6A 4X65Q 3T1HQ 2EVBA 3OPOA 3UI2A 1BUVT 1EEFD 4ZK9B 1VQ8A 1YNND 1GHJA 1PRTB 2DY7A 2QILA 2EY1A 1SYDA 2Z6KC 4RGTA 1CA6A 5HGQA 3WOEA 3KLWA 4NPSA 1R4PB 3P7JA 1VQKA 2XSCA 5C0XJ 4DV1L 1LM0A 3AYHB 4XXEA 1AFPA 3R8BA 1NJIC 2B2YA 4OX9Q 1V43A 1HXYD 1SROA 2J0TD 1D1IA 1DYQA 1YVCA 2QGQA 3QG1A 2UUAQ 3ULPA 4FXGC 3CRKC 1PH7A 2EXZA 5IYDG 2Q8RE 2RVLA 2F0LA 4LF9Q 2KUMA 4XQQA 2K33A 2YU9H 3KLSX 5CC4A 1EQRA 1S5DD 3U4VA 4RWSC 1XPOA 4A3JG 1BOSA 4EQPA 2JJQA 2K28A 3TP5A 4CJ1B 1STBA 3DEOA 2MP1A 2JEBI 2YYZA 3E0JA 3Q8DA 2B2YC 2DJGC 1IZ6A 4N9TA 4XYQA 1EIFA 1F2YA 1GUOA 1YNJD 3Q23A 1EIYB 1HZCA 3KF8A 4DR6Q 1QCBD 1CKOA 2IX3A 4JOIA 2L0CA 1MJCA 3TQYA 3CCMA 3HEJA 3S17H 2HQEA 3AFPA 3F2UA 2JA6B 1HFNA 2LKVA 4FP5D 4DN4M 3FPPA 5CYUA 4K0KL 1SN8A 4A3JB 2NBFA 1XMQL 1O7YA 1QVCA 2A69D 2YTVA 1A0IA 4WJWA 1KHIA 2RDHA 3STBD 1S40A 3PO2G 4N8X1 3HKZB 2KJXA 4QY7A 4POFA 3M4QA 3MA2B 3HOWG 4HAEA 2BH2A 4JOIC 4FF2A 5CBAE 2GVBA 2UUCL 1LV9A 1B7YB 1LUZA 4QGUA 1EEID 2WB1G 5BN5A 5IP9G 4KY7A 1AH9A 2B29A 2PI2E 4XTCS 1TWAB 2F0VA 4B3MQ 1BNZA 2MJ8A 3I55A 1YHAA 2E2DC 3CCLA 1VQDA 1OXSC 1IKLA 2RHQB 4JK1C 1HR0W 3N6RA 2NVTH 4XYOA 1ILQA 1U9RA 4DR2Q 2E8GA 3BZDB 1L2FA 1BBXC 5JVG3 2OWOA 2SDFA 4YY3Q 3BDCA 1Y8PB 1D2BA 4A3FH 4IOCA 3T4AC 2EYLA 4LFCL 4DV4Q 4X6AH 4LF4L 2WAQE 4IN3A 1TT2A 4XIGS 3CCSA 2F0QA 4LF6Q 3W1BA 3VR4A 4HJ7A 2KENA 2FMCA 2I46A 2B3GA 2IJ0A 3L3OC 4ZLTF 5IP7G 1I4QA 1J5EL 3GTGH 4QUCA 4PMWA 2JA7B 2ES2A 4KKUA 4BBRG 3PUVA 1IL8A 1UE6A 1PLFA 2AQ1B 3EQLC 3H15A 1PTOC 2C9OA 3K0XA 5KNDA 3LWUA 2AMCB 5C4XG 4EQNA 3FKIH 2CW0D 2XGTA 1TWGH 3OW2A 4A3EH 3NENA 2XRSD 3K5NA 3GTOB 1NCVA 4GKJQ 3DXJC 3ULLA 3UE0A 3S1NB 1STHA 3A56A 2MO1A 2Z4HA 1KDAA 1SJHD 2EJMA 2KCCA 3OMCA 1WTQA 3M4OH 1V1QA 5KNCA 2VB2X 1T5EA 1HQMC 1IBMQ 4MNOA 5JEAJ 1QOHA 3S14H 1VQAA 4RCNA 3H3VI 4JW0A 1G91A 2RSNA 1OO9B 2A5HA 4JI6Q 1FNVA 1GXDC 1NY4A 4A3DG 5GAEC 2NUCA 1ENCA 4GZYC 2D0PA 4JI3Q 2PW7A 1SDFA 5HY6A 3UDIA 2GN5A 2VQEL 4DK1A 4HN7A 1V1PA 4DAYA 3OIPA 5CGKA 3VYRA 4WRDA 4PG3A 1WFQA 2KHJA 2KQ3A 3VYTA 4DR4L 3QOJA 3G4SA 2RCFA 1KNAA 4A3GB 3BVZA 3M3YB 1TWFB 2HDLA 1LACA 2EYJA 4IFDG 5M5YB 2KHIA 3CQZH 1BKBA 4DV0Q 2B2WA 4L8JA 5IGEA 1STNA 4LK1C 3I4LA 4DNIA 2F03A 4IJLA 1XNRQ 3GTJB 3GV3A 1YI2A 5EGTA 2PI2A 1YITA 1IKMA 5IODA 4LUOA 4C3IB 1HCZA 2VS1A 4QIWE 1RF2D 4LW1A 5IGFA 2JA8H 4CKEA 4ZYSA 3U4ZA 4IALA 4PNYA 5CR3A 3CQZB 2A6ED 4WJ4A 1N34L 1V9PA 3QOLA 5FLMH 4DF7A 1HUNA 4CKBA 2JA5H 4IUPA 1SE2A 1TS5A 2F52A 3OOCA 2CH4A 4C3HG 3S1RB 4X66L 3GTQB 5KYLA 4DV2L 3KF8B 1QNKA 5IE8A 4BWGB 1IW7C 2UU9L 3PSIA 3SVMA 1CUKA 3KFUA 1R4QB 3PV0A 4JI7L 2N55A 4C1NI 3K81C 2ZXRA 4A3CH 2OCEA 1M90C 3GP7A 1K0SA 3EFXD 3SGIA 1PYSB 1CSQA 1P16A 3S1MH 1Q12A 4C3IH 1EUJA 4JI2L 1H95A 4ZAIA 5LMUL 1JJGA 4LFBQ 1ICWA 1TS3A 3GTKB 3CCVA 1VQPA 1H9SA 3J7AV 3SK8A 1Y1WH 3HOUB 2F0HA 3G6JB 1AE3A 2QKIC 4X65L 1I3QB 1X3FA 3I91A 2CHBD 1D1KA 2LSSA 1GJXA 4JV5Q 4POGA 4K6LA 4DV5Q 4A3KH 1Y1VB 5J39A 2JA7G 4A3DB 4DV1Q 1G291 1ASZA 1F2MA 3ZJYC 2KECA 4OX9L 3AEVA 1MSGA 1VQEA 1ML0D 3KYHC 1PMRA 4OEMB 3J81c 3GTQH 2DNCA 1ILPA 4PZ7A 1CI3M 1TWAH 1FYCA 2ICIA 4K2KA 4YCVA 3PUZA 5C0XI 3HOZH 4PZ8A 2JK8A 3ND8A 2BA0A 4V0BA 4L6TB 4B3RL 1SNCA 3A8JE 2QEXA 3AB9A 2HQLA 2HIXA 4QIWB 2ID0A 3FPUB 3R93A 3BS1A 1UE7A 3QR8A 1TXYA 4M8AA 4Y7NH 1MGSA 1K73C 2B63H 2A1AA 4A75A 1L1OC 2E2JB 2K52A 3C2PA 4X62Q 5EPJA 4GN3B 2EXDA 1WTVA 1VQLA 2E75C 3TZUA 1ONLA 3DWQA 4FF3A 4HCEA 2AWNA 1D7QA 4WORA 1VF7A 4K5VA 1SAPA 2CQOA 4A3KB 4ZUJA 1Q46A 4K0KQ 1WTXA 1T5XD 1CQFA 5I2YA 3OYYA 1TWHB 1AP0A 2LMCB 1EIGA 2EJFC 1GUSA 2PQAA 3A8IE 4I7AA 1G51A 4YWMA 2JA5G 4JI4L 2Q8IB 1PRTF 5CORA 3DM3A 3J7ZC 4JG2A 2QDBA 2XWJB 4RHSA 1ET6A 1LT4D 1J8IA 4LFAQ 5IP9H 1CKNA 4OO1I 2L5TA 2Z6KA 1PZKD 5IT9E 1ASYA 5DEHA 2UUCQ 1N32Q 4JI0Q 1QILA 1VQFA 2XN9C 3A74A 1LTAD 3D8GA 3KLSA 1RCVD 3RD4A 1QG7A 3TEHB 4B3SQ 3J7A5 1O7ZA 2CVRA 3FP9A 4OHJA 3CCRA 2L1BA 3BG3A 3KLRA 3PGZA 4EGVA 4NDXA 4X64L 1K0RA 2CKZB 3I4NH 5H1SE 1IYVA 4KJOA 4GLXA 2HD3A 2Y0SE 4NB3A 2PCFB 3CPFA 3TREA 4G7ZC 3NHHA 1CSPA 2RDFA 3C3LA 1CFMA 2KBNA 2EYOA 3NTIA 4PZ6A 1U4LA 2M00A 4CDCC 1U4PA 1TKWB 4C2MH 3I2ZA 4B3TL 1K83H 1W2BA 2KEDA 2PMZE 4IJHA 4JCVE 4J15A 4LFCQ 4P2CB 1HTPA 4PV1C 1UAPA 3AMUA 4Y52H 4LF6L 2JA7H 4BBRB 1KXLA 3I4MG 3CF5A 1G2SA 3HOWB 4IPDA 1JT8A 3RLOA 1LT6D 4CJ0B 3HKZG 2G9HD 3HOWH 1VMPA 4K2LA 5IYCH 1EY0A 2E74C 1CM9A 1XMOL 2HHHL 3OSOA 1OXXK 2HIVA 1WCMG 2K5WA 1KRTA 2LXKA 1J5EQ 1PZID 1NR2A 1EU3A 2FXQA 4ALPA 3OTOQ 5M3MB 2UXCL 2K50A 1PH8A 2Q2TA 3LGJA 3V05A 2RF4A 1E2WA 3W2DA 4R4TA 3O13A 4DNTB 1NAPA 3P20A 3T1YL 1ICFB 4AQYL 4BBSG 4JI5L 2JA5B 5C44H 3RUZA 3MZ5A 3SDZA 4RAUC 3BJUA 1EYDA 2WINB 2MO0A 3NWSA 2IPKD 1SNOA 1U0LA 1PHJA 1PTOB 5CV8A 2JQOA 1FVIA 4RKLA 4KHVA 4KN4C 2MNAA 1TR5A 2R7ZH 2FMMA 4NXNL 1HNZL 1J6QA 1KL9A 3IFTA 5HGTA 3D6CA 4IUVA 1WVLA 1UEBA 1DZ1A 5FLXc 2PMZB 1B3AA 4GNXA 2F0MA 5K5PA 5M3FH 2CW0C 3K8AA 1BR9A 3RZOH 1A62A 3HKZE 3KBGA 3M7GA 1F77A 4RA8A 2ZM6L 4JBKA 1X3QA 1K3RA 2OQ0A 1AZQA 4KJNA 3F2BA 5IT9L 5M5XB 3AFQA 2NN6G 4IZ8A 4HJAA 4DKAC 2ATWA 3I4NG 4HMJA 5J3BA 4DV3Q 1XWEA 3WOFA 1CZWA 4J8QA 5IGGA 1ZEQX 3D0FA 1LTTD 2VQEQ 4HEDA 4IPCA 2UXBL 2ZT9C 1X65A 2F1MA 1PVOA 2BA1A 2Y0SG 3N52A 4GNXC 3NBIA 4S3SA 2RA4A 3NQTA 1XNQQ 4DR4Q 1LTGD 3H91A 5FJ8H 3NWTA 1Y1VG 2XVSA 3QB3A 1LTID 1OXUA 1RIPA 2L12A 5IYBG 3J80E 3RLFA 4LMQD 4UDUC 4CGYB 3CPWA 3A7LA 4JI8Q 2F0DA 2ZTDA 5M9OA 1WCMH 3MWYW 1TWFH 1NSNS 3GTOH 4IQZA 4CDEC 3J81i 3M7NA 1N33Q 1K8MA 3FEWX 4IUQA 5E4XA 1YJWA 2EE1A 3DHQA 1I50H 1S5FD 1JCKB 4RMFA 5C0XG 4DR1Q 4MTNA 1Q3LA 4X66Q 4DR7L 4R8IA 2JE6I 1GO3E 1H9SB 1NE3A 2ASBA 1N9WA 1UE5A 1EY4A 5IGBA 5DLQE 1P8LA 1RDPD 1TQOA 2H5XA 2EYHA 2N78A 2UU9Q 2QDLA 1G2TA 1GD7A 1A3TA 4LF8Q 1DD2A 5LMNL 1HZBA 1PRTC 3F8TA 1VQJA 1AEXA 2YTXA 1PH2A 3MTSA 3S16B 4A93H 1LO5D 2A69C 4ZUIA 4DUYL 3GTPH 4EQ5A 3I4NB 1HQRD 2VNUD 4JI2Q 3G6EA 1FL0A 3JAME 2KOLA 5LMUQ 1XPRA 3ULJA 1IYJB 1SE8A 3NBHA 4JBMA 1VQ6A 2PO4A 1EY9A 2Q2HA 4JYAL 1KTKA 1RHPA 2J7ZA 4KV6A 3HOXG 2TSSA 3SXHA 4A3MB 3VR6A 1B44D 1VQ7A 5CV9A 2AQ2B 4H0LC 4ME5A 1A2TA 1ENFA 1KLGD 3CW2C 5C3EG 1BCPB 4OWTB 2A68D 4A3GH 4JV5L 3VA5A 4A3BH 2PPBC 2B2WC 1Q86C 3U50C 2SOBA 1HA5A 2IY5B 3J7AF 4C1NK 1TY0A 4FF1A 2EY5A 1N36Q 2EOTA 4DPGA 1BF4A 1R9TH 3NELA 1ET9A 2AQ3B 4UHVA 1I3QH 4WJ3M 5IGDA 4UY8C 2IHFA 4A3MH 4JVZA 3RN2A 1XYIA 2B8FA 4YCUA 2BDNA 2LY7A 1I6VC 2OQKA 5JEAH 3NSWA 1PH9A 1JMCA 4HIKA 4A3GG 4QB4A 4L5RC 4P75A 3A0JA 4GOPA 3HOUG 1D6EC 1BBWA 1ZYRC 1EQQA 3IL8A 2UXDQ 4MTKA 2E5LQ 4RCOA 5M5WB 1PFNA 4GS3A 3I4MB 5IWAQ 1YZ6A 3S1QB 2NVQB 1Q1EA 3NXWA 3T53B 2Z9HA 5FO9B 2F0NA 1AW7A 2A6HC 2HDMA 2K5NA 4GLVB 3GDEA 5C5LA 1I94L 3TS2A 3NE5B 4HJ9A 5FOBB 2OEOA 3U58A 2R93G 1XPUA 5C4JH 3S1RH 5EKIA 3KUPA 4WFN3 3K58A 1JJCB 4OIKA 2I5HA 1WI5A 3PIP3 3EVQA 4GOPC 1I4HA 5FKAC 1NNXA 4JI4Q 1HPCA 2KA7A 4Y7NB 2PZWA 2JA8B 1HNWL 4LFAL 2WIIB 1KRSA 1I4RA 1DOLA 1EY6A 1B9MA 3F1ZA 2D2CC 5DM73 2NYZD 2K1BA 1E0BA 2IW3A 1WJJA 1SMXA 2K04A 3WDNA 4B3SL 2SEBD 3J81j 3PUWA 2WAQB 3QO2A 2DNEA 2M2LA 2N49A 1MIUA 5T1GA 4UP7A 3R3OA 3D31A 1K8GA 2AHOB 1BVSA 4RG1A 4BY1G 3CCJA 3DM1A 3W1GA 1MD2D 1TU2B 2F4IA 4EX5A 4UP8A 4RGMA 1E1TA 1E24A 2B2UA 3EJIA 1YIJA 1SFOH 4P72A 4A3KG 4YCWA 1T9HA 5ELEA 1F9SA 1VQ9A 4B3TQ 1V1OA 4O42A 3DWAA 3J80L 1IBLQ 3E0EA 3LNNA 2FFKB 5M3FB 1SNPA 3RNUA 1MSHA 4C3HB 4DK0A 5C4XH 1SEBD 4EQOA 3E9IA 5JEAG 1QZGA 2B2VC 3I56A 5JJLA 4A3LG 3TRZA 3OWFA 2F0PA 1LT3D 4BBRH 2RHSB 2KEEA 2D5DA 1B50A 3K6OA 2E2IB 1G8ZD 1SMYD 2UXCQ 1A3VA 3S1NH 1KC8C 1SE4A 1K83B 1VS0A 3CC4A 1I4GA 3H0GH 5D65A 3GTLH 2KVMA 1E2VA 3I3CA 1STAA 4AQYQ 1MJEA 3TSSA 1YJ9A 3SK5A 4RKBA 1B2TA 5ELNA 3HZXA 1B53A 3RMHA 4A3BB 5A2QL 1NMFA 2C35B 4L63B 1X56A 4IFDJ 2A8VA 4HR7B 4CHTB 4GKKQ 1IYUA 3JAML 1I6HB 3J81L 3I4MH 2EJGC 2VQFL 3HOVG 4FF4A 2EDGA 3FMCA 4DV7L 4R9WA 1E2ZA 2IT1A 1XMQQ 4ULLA 4A76A 4BY1B 3HGBA 2L55A 4DAPA 2X69A 5KIXA 4C2MB 2ZXOA 4YIJA 1CKMA 2WAQG 4KN7C 1UNSA 1JWSD 2VZAA 3MXPA 1PTOH 2XTIA 4BBSH 1TWHH 4KK7A 3Q6SA 1YJNA 5T1IA 2F0SA 1HNXL 4B3ML 1FNWA 4EVOA 1MHWC 5FJ8G 3WWVA 2AUJD 3RZDB 3HOVB 1G6ZA 1TWGB 3MAQA 4FXKC 1KIXA 2JYOA 4QUFA 1M4VA 1NUCA 1SE3A 3UDXA 3PCOB 4DR2L 5KNBA 1NR4A 2K01A 3CC2A 1DGSA 1ENAA 1QWYA 3MEFA 4AIMA 3NP8A 4DUZL 3BZKA 4RH6A 2WB1E 3BYTB 2ALYB 3NPPA 2ZTEA 2JEAI 3EN2A 1TS4A 3X3NA 3J7YW 4OXPA 1EZ8A 1X32A 3OMGA 1ESFA 1MI2A 4DR1L 3GO5A 1C4QA 2K32A 4OELB 1KAAA 2NZOA 1JR0D 5ELOA 5GAHC 4F7XA 4G57A 2K05A 5K36H 1EZ6A 5E7NA 4FYDA 3EBEA 1SRUA 3T56B 4E6IA 2RBMA 1GKHA 2AKWB 4OWXB 4LNQA 2E2JH 1H9RA 1TWCB 4KHPQ 1NMGA 3MXUA 3NK9A 4DA2A 4DUYQ 3HFZB 3LX0A 3NTKA 1BQQT 2D62A 2QCPX 3H0GG 5NUCA 2F0IA 1EU4A 5I6YA 5A2QE 1YEZA 3PF4A 1U5KA 3DWPA 2V4DA 4RGNA 1BCPF 2ZTCA 2FHTA 1KQSA 2EY2A 4YWLA 5FK9C 2K5VA 3IAYA 3BYYB 2R61A 3CRLC 3S1MB 1EYGA 5C5MA 4IUUA 2CFMA 2MHVA 1HR0L 4YHHQ 5IYDH 2R3ZA 3SEBA 5E4WC 4X3KA 4DK3C 4H7BA 3S2DH 1EL0A 2E76C 4L5TA 1B3QA 2LS01 1XJVA 1I4PA 4Q5VA 3HKSA 3MXNB 3ONAB 3UDGA 4KY6A 5I6WA 2I5MX 5BR8L 1PDQA 2O5JC 4DXGA 5HURA 3D4RA 1FJGL 4A3IH 4APVA 1C9OA 2HCCA 1N36L 3TP8A 3S17B 4PQXA 4C56C 2HUGA 1DOKA 3MFGA 1DJRD 3A55A 5FO7B 4ODGA 1SNMA 3MHBA 1WTHA 2A68C 2Z0SA 4H13C 4KHZA 1WTWA 3PF5A 3HOXH 1VQOA 4FO2A 4OONA 1TIID 2UXDL 4RGOS 2BOSA 5M5YH 3VYUA 2E5LL 4P73A 4ZKBB 2MUYA 1GHKA 3KOJA 4A93B 4HJ8A 2NB0A 4KLKA 1Q82C 2R93H 2UUAL 2OT2A 5CV7A 1W6JA 3HOYH 1GVPA 2JA6G 4A3IG 1PH5A 3HOYB 1LTSD 5G3LF 2CWAA 5M3MH 1I94Q 4IPHA 1D5XC 2DUDA 1IHZA 4Q0FA 2EYPA 4IUNA 5DNFA 2F3IA 2OXPA 2XNAC 1LT5D 2CH4W 1FNUA 1B8AA 3K7AB 3QJYA 3ZYYX 1BCPC 3SR1A 1OTCA 1GUWA 2QEJC 4K5XA 3M4YA 5LL6X 3S14B 3KJPA 4TVAB 2Z8LA 3GV6A 3FVQA 3STBC 1PFBA 1Y1WB 1A3UA 5FLXE 2I07B 5C6AA 3F2DA 1HFGA 1QVFA 5LL6S 3S16H 1F9QA 2FINB 5CBEE 1K8OA 1Q8IA 1JC7A 1STEA 1K3BC 2A74C 4R4CA 2K14A 2Q2IA 4LFBL 2F0GA 1EYAA 3FRPB 4QMGA 2EPBA 3JAMi 5C4JB 1TY2A 2WKDA 3NUCA 3F2CA 3PO2B 1SJED 3VR3A 5KEEA 1XXGA 5C3EH 2B63G 1EFID 4A3EB 2JN4A 1EFWA 1M8AA 1STYA 3E9HA 4XT3B 1JB3A 5EKLA 1IXRA 4IURA 1RL2A 4B08A 3H09A 3QWNA 4PMBA 5ELBA 1KDCA 4KMUC 3CMEA 2EYFA 2B39A 3W5OA 4TRDA 1VQNA 3BDLA 2MGSA 4KKTA 5C4ZA 1X54A 2VUMH 1SXTA 3S1QH 4NKLA 2J4XA 1SBBB 1Y14B 4F87A 3H6MA 3HG9A 3I72A 3TP6A 4ZQ3A 5EBDA 1PRTD 1A2UA 2CQAA 2QW7A 3K7UC 3A5ZB 1II3A 1FD7D 1AZPA 3JAMc 1V1PB 2IWHA 4DAYB 3J80i
chains in the Genus database with same CATH topology
4H02A 4PG3A 1WFQA 2KHJA 4DR4L 4HIOA 3G4SA 1PH9A 1WOCA 4AYBE 1JMCA 4GN4B 4HIKA 1Q81C 4A3GG 4L5RC 4P75A 1VQHA 3A0JA 4GOPA 3HOUG 4IFDG 2KHIA 3CQZH 1BKBA 4DV0Q 1BBWA 3H3VH 1EQQA 2UXDQ 2JA6H 2KCTA 4YY3L 5JJKA 4DNIA 4DV6Q 5GROA 2E5LQ 3NBHB 4IJLA 2NVXH 1XNRQ 3CC7A 2CWPA 2N8NA 1YI2A 1QVGA 4GS3A 4DV4L 2PI2A 5IWAQ 1YITA 2R92G 1YZ6A 3GTMH 4LUOA 1Q1EA 4LF4Q 4AH6A 2R92H 3VDYA 3DLLA 1AE2A 2VS1A 4QIWE 4LW1A 2JA8H 2LXJA 3U4ZA 1N33L 2K5NA 4GLVB 3GDEA 4GKKL 4WJ4A 1N34L 1I94L 3TS2A 1V9PA 4HJ9A 5FLMH 1UWVA 1IBKL 4A3BG 1PH3A 4ME3A 2JA5H 3U58A 1X6OA 1XPUA 2R93G 5C4JH 2VQFQ 3S1RH 2F52A 2YTYA 1PH6A 4DV7Q 3CD6A 1JJCB 2I5HA 1WI5A 4X66L 4DR7Q 4DV2L 3KF8B 4GOPC 4C3HH 2GVAA 5IE8A 5IP7H 4JI4Q 4L5SA 1C0AA 3ER0A 2UU9L 3PSIA 2WFWA 1B70B 3J80c 1CUKA 1PH1A 4LF8L 2ZJQA 2R6GA 1JJ2A 2R7DA 3HOZG 3KFUA 3PV0A 4JI7L 1C7YA 1HNWL 4B3TL 4LFAL 1XTDA 3KF6B 3K81C 1KRSA 4HJ5A 4A3CH 1FGUA 2OCEA 4BY7H 4A3DH 1Q7YC 1M90C 1N32L 3F1ZA 2UUBQ 3SGIA 4JI0L 1PYSB 1CSQA 2K4KA 1P16A 4A3MG 3S1MH 1Q12A 4C3IH 1HZAA 1EUJA 4JI2L 1H95A 4A3JH 1WJJA 1SMXA 3KDFB 3KJOA 1JJGA 5LMUL 4B3SL 4LFBQ 3J81j 3S24A 2AWOA 4GKJL 3JC66 3PUWA 2V1CC 5EAYA 4JYAQ 3CCVA 4LF7L 1VQPA 1HNXQ 1Y1WH 2N49A 1QUQA 1MIUA 4AYBG 4UP7A 1AE3A 4X65L 3D31A 1K8GA 2CCZA 2AHOB 1LTLA 2EIFA 1BVSA 1O7IA 4RG1A 4BY1G 3CCJA 3CAMA 1X3FA 3W1GA 1E22A 2E2HH 2R7FA 1YHQA 4BA1I 5C44G 2LSSA 1VQIA 1NBWA 2JA9A 4EX5A 4UP8A 4LWCA 1E1TA 1E24A 1YIJA 2N3SA 1SFOH 2L15A 2MQHA 4POGA 4P72A 3L2PA 4A3KG 1IBML 4JV5Q 2I0QA 4BA2I 1X55A 3L7ZC 4DV5Q 4O0AA 1T9HA 4YCWA 4A3KH 2OTLA 2JA7G 3IRBA 1PH4A 4DUZQ 2K5HA 4DV1Q 1LYLA 1VQ9A 4B3TQ 1G291 1ASZA 3ZJYC 1QZHA 2JA8G 4OX9L 3AEVA 5IY0A 3FHWA 4O2DA 1VQEA 1IBLQ 4JI1L 3E0EA 3KYHC 2ZJRA 4JI6L 3J81c 3RNUA 3GTQH 4TQUS 3G48A 5GADC 4JI3L 4PZ7A 1TWAH 5C4XH 2DGYA 5M3MG 3KF6A 1X9NA 3E9IA 4YCVA 5JEAG 3PUZA 5C0XI 5IT9c 4DR5L 4DAMA 2WP8J 1XMOQ 2HHHQ 4HIDA 1QZGA 3HOZH 2PNHA 3I56A 5JJLA 4PZ8A 2JK8A 4GN5A 4A3LG 1OXVA 2BA0A 3TRZA 4A3EG 4KI0A 4B3RL 4BBRH 2RHSB 4GOPB 1A63A 1WYDA 1JE5A 2QEXA 3I7FA 1I5FA 2HQLA 2HIXA 1KAWA 1MKHA 4QL5A 2ID0A 4IO9A 2UXCQ 1SLJA 2A19A 3S1NH 4A3CG 1KC8C 4NXML 4LF5L 1EOVA 1UE7A 1TXYA 1L1OB 1VS0A 3CC4A 2VL6A 3GTJH 4DV0L 2F4VQ 4Y7NH 1A8VA 3H0GH 1K73C 3GTLH 4KHPL 3UE1A 3T1YQ 2A1AA 4A75A 4AQYQ 4JI5Q 1MJEA 2B63H 5AJ3Q 1VCIA 1L1OC 1YJ9A 1GM5A 1YHBA 2PQAB 1XNRL 2K52A 4X62Q 1SR3A 3PUXA 4GN3B 5ELNA 2EXDA 1JB7A 2HT1A 4BY1H 1Y1WG 1VQLA 1KXLA 2IHEA 3B6YA 1NMFA 1HZ9A 2C35B 1X3GA 2VY3A 1X56A 4IFDJ 2A8VA 4GKKQ 1N34Q 4IOAA 1IBKQ 4DR3Q 2AWNA 1D7QA 3I4MH 1HNZQ 2VQFL 3M4PA 3HOVG 1I6HH 2CQOA 4FDBA 4DV7L 1Q46A 4K0KQ 3OYYA 4R4QA 4DV2Q 3K7AH 5LMNW 2IT1A 5M5XH 1XMQQ 2PQAA 1VQ5A 1G51A 4YWMA 2JA5G 4A76A 2BH8A 4JI4L 2R7ZG 2E2IH 1TWCH 3DM3A 3J7ZC 4JG2A 1HR0Q 4YHHL 4OWWB 1L1OA 3ICEA 3NEMA 4JI7Q 3HOYG 1HNWQ 2ZM6Q 4LFAQ 5IP9H 1CKNA 2D0OA 1Q8KA 4OO1I 1ASYA 2Z6KA 1CKMA 2WAQG 4IFDI 1N32Q 3CXCA 2UUBL 3RN5A 2UUCQ 4JI0Q 4GLAC 1Z47A 5BR8Q 1VQFA 1VQCA 4A93G 3A74A 2VZAA 2XTIA 4BXXH 4BBSH 1TWHH 1VQGA 3PUYA 3G71A 1YJNA 3TEHB 4B3SQ 4BY7G 1FJGQ 3J7A5 3FP9A 1HNXL 4B3ML 3CMAA 3CCRA 1YNXA 3CCUA 5FJ8G 3WWVA 3PGZA 4X65Q 3T1HQ 4X64L 4JBWA 2QA4A 1K0RA 2CKZB 1K8AC 5H1SE 1VQ8A 4GLXA 1KIXA 3I4NH 2Y0SE 4NB3A 1XNQL 4LUVA 4P71A 3CPFA 3TREA 3M9BA 1CSPA 3HOUH 3UDXA 3M85A 2Z6KC 3PCOB 4DR2L 3CC2A 2KBNA 4PZ6A 1DGSA 5HGQA 4DV5L 4L5QA 3KLWA 3MEFA 4NPSA 4AIMA 4C2MH 3CCEA 3I2ZA 5C0XJ 4DUZL 1K83H 4DV1L 1LM0A 3AYHB 1W2BA 3BZKA 3EIVA 1N8RC 1NJIC 2WB1E 4JI8L 2PMZE 4IJHA 3RR5A 2ALYB 4JCVE 4J15A 1PV4A 4LFCQ 4OX9Q 1V43A 2OTJA 1SROA 2ZTEA 2JEAI 3EN2A 4BXXG 1YVCA 2QGQA 2UUAQ 4Y52H 4LF6L 3ULPA 1OXTA 2JA7H 1QUQB 3I4MG 3CF5A 5IYCG 1PH7A 4R4IA 4OXPA 4IPDA 5IYDG 3BZCA 3RLOA 1JT8A 3HKZG 3HOWH 5IYCH 4LF9Q 2YU9H 1EQRA 3A5UA 1XMOL 2HHHL 4DR1L 3U4VA 1OXXK 2HIVA 1HH2P 1WCMG 2NZHA 3GO5A 1KRTA 5M5WH 2LXKA 1J5EQ 1XPOA 4A3JG 3GD7A 4B3RQ 2JJQA 2NZOA 5ELOA 1PYBA 5GAHC 2FXQA 4ALPA 1Q1BA 3OTOQ 2JEBI 2K50A 2MFIA 2UXCL 2YYZA 5E7NA 4HIMA 3EBEA 1PH8A 1E7ZA 1SRUA 2Q2TA 4LF5Q 4NXMQ 3LGJA 1GKHA 2AKWB 2RF4A 3ERSX 3Q8DA 4OWXB 5LMNQ 3GTKH 4LNQA 4R4TA 2E2JH 2F4VL 1IZ6A 4KHPQ 3T1YL 4BBSG 4AQYL 1EIFA 4JI5L 1NMGA 5C44H 5AJ3L 3S2HH 1EIYB 1HZCA 3AQQA 3HFZB 3BJUA 4X62L 4DUYQ 4DR6Q 1CKOA 4JOIA 3RZDH 3HOVH 2MO0A 2D62A 1MJCA 3H0GG 1UE1A 4UPAA 3TQYA 1U0LA 3CCMA 3S15H 1PHJA 3S17H 3AFPA 1YEZA 3PF4A 1U5KA 1FVIA 2JQOA 2MNAA 2R7ZH 4DR3L 2ZTCA 1KQSA 4NXNL 1YBYA 1HNZL 1J6QA 1VQBA 1KL9A 4YWLA 4K0KL 2K5VA 1UEBA 1SN8A 5FLXc 4OO1G 1XMQL 4GNXB 2RCNA 1L0WA 1EYGA 1QVCA 4GNXA 5M3FH 2YTVA 1A0IA 1KHIA 2CFMA 3K8AA 3STBD 1S40A 3PO3G 3PO2G 1HR0L 3RZOH 4A3LH 4QJFA 4YWKA 1A62A 4YHHQ 5IYDH 3HKZE 1PVOA 4QY7A 4POFA 3M4QA 2ZM6L 4JBKA 4P74A 4DK3C 3HOWG 3S2DH 2BH2A 4L5TA 1XJVA 1K3RA 2OQ0A 4JOIC 3L0OA 3F2BA 2GVBA 2UUCL 3HKSA 3MXNB 3UDGA 1B7YB 5GAGC 3AFQA 2IX0A 2I5MX 1LUZA 5BR8L 4QGUA 1HJPA 2NN6G 1M1KC 2K75A 2WB1G 4HJAA 5IP9G 4DKAC 2ATWA 3I4NG 5J3BA 1AH9A 1S3OA 2B29A 4DV3Q 4A3IH 4APVA 1FJGL 1C9OA 2PI2E 4JC0A 1N36L 5JJIA 3BU2A 4XTCS 4B3MQ 3D0FA 3K80C 5GQOA 2VQEQ 3M3YH 4IPCA 2UXBL 1X65A 3I55A 3T1HL 1NTGA 1YHAA 4X64Q 2BA1A 2Y0SG 3CCQA 1PA6A 1W3SA 4GNXC 3CCLA 2IX1A 1VQDA 1OXSC 1XNQQ 2RHQB 4JBJA 4R4OA 4DR4Q 2Z0SA 1HR0W 3PIPA 2NVTH 5FJ8H 4KHZA 1Y1VG 5IYBH 3PF5A 3HOXH 1VQOA 4DR2Q 1OXUA 2E8GA 1RIPA 1L2FA 1Y1VH 5IYBG 4OONA 3RLFA 2UXDL 2Q2UA 2OWOA 2ZJPA 4YY3Q 4DV6L 5M5YH 2E5LL 3CPWA 4P73A 4A3FH 4JI8Q 4IOCA 2ZTDA 4LFCL 3KOJA 4DV4Q 5IWAL 4A3FG 2EQSA 3I4OA 1WCMH 4HJ8A 1TWFH 4KLKA 4LF4L 4X6AH 2WAQE 1Q82C 3GTOH 2UUAL 2R93H 4XIGS 3J81i 3CCSA 4LF6Q 3M7NA 3W1BA 3HOYH 1GVPA 1N33Q 4A3IG 1PH5A 1IL2A 2JA6G 1YJWA 5M3FG 4HJ7A 2KENA 2CWAA 1X3EA 5M3MH 1I94Q 4LF9L 2B3GA 4IPHA 1EWIA 3PO2H 1I50H 2DUDA 5IP7G 4RMFA 4DR1Q 5C0XG 4MTNA 2F3IA 1J5EL 3GTGH 4X66Q 4PMWA 4DR7L 2ES2A 4BBRG 2JE6I 1GO3E 3PUVA 1NE3A 2ASBA 1N9WA 1B8AA 1UE6A 1UE5A 1D8LA 3OTOL 5DLQE 1P8LA 4MZ9A 5FLMG 2H5XA 3PIOA 3H15A 2NVYH 2N78A 2UU9Q 1OTCA 1VQMA 1GD7A 4LF8Q 3K0XA 4LUZA 5LMNL 1HZBA 3F8TA 1VQJA 1BBUA 3KJPA 4TVAB 3RLNA 2AMCB 5C4XG 3STBC 2YTXA 1E3PA 3FKIH 1PH2A 4A93H 4DUYL 3GTPH 3F2DA 2XGTA 1TWGH 4EQ5A 4DR6L 3FKIG 3UDFA 1QVFA 3S16H 2VNUD 2VUMG 4JI2Q 3OW2A 3G6EA 4A3EH 1FL0A 4R4CA 3NENA 2K14A 2Q2IA 5LMUQ 3ULJA 1XPRA 1IYJB 1SE8A 4LFBL 4GKJQ 4JBMA 1VQ6A 3JAMi 3ULLA 3UE0A 4A4IA 2Q2HA 1Z9FA 4LF7Q 4JYAL 3HOXG 2NN6I 1VQ4A 3F2CA 4UP9A 3PO3H 1KD1C 1VQ7A 4NXNQ 1PFSA 2NVQH 2MO1A 3CP0A 3TS0A 5C3EH 2B63G 1EFWA 4QQBX 3CW2C 5C3EG 3M4OH 3E9HA 1V1QA 4OWTB 2YV5A 3KDFA 1IXRA 4A3GH 4JV5L 1IBMQ 1RL2A 4MNOA 4A3BH 2KCMA 5JEAJ 1K9MC 4DK6C 3S14H 1VQAA 3CMEA 3H3VI 3W5OA 2I5LX 1VQKA 5K36G 1Q86C 1VQNA 3U50C 2VUMH 1X54A 1IBLL 4JI1Q 4JI6Q 3S1QH 2IY5B 1NY4A 4IPGA 4C3JH 5GAEC 4A3DG 1Y14B 1G6PA 2D0PA 4JI3Q 4DV3L 2VW9A 4R1JA 1N36Q 5HY6A 4DR5Q 3UDIA 3K7UC 4DPGA 1CKNB 2GN5A 2VQEL 3NELA 1R9TH 3A5ZB 2UXBQ 1I3QH 4WJ3M 4UY8C 2IHFA 3JAMc 4A3MH 1E1OA 1S72A 3RN2A 4DAYB 4YCUA 3J80i 2OQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H02 A;  4PG3 A;  1WFQ A;  2KHJ A;  4DR4 L;  4HIO A;  3G4S A;  1PH9 A;  1WOC A;  4AYB E;  1JMC A;  4GN4 B;  4HIK A;  1Q81 C;  4A3G G;  4L5R C;  4P75 A;  1VQH A;  3A0J A;  4GOP A;  3HOU G;  4IFD G;  2KHI A;  3CQZ H;  1BKB A;  4DV0 Q;  1BBW A;  3H3V H;  1EQQ A;  2UXD Q;  2JA6 H;  2KCT A;  4YY3 L;  5JJK A;  4DNI A;  4DV6 Q;  5GRO A;  2E5L Q;  3NBH B;  4IJL A;  2NVX H;  1XNR Q;  3CC7 A;  2CWP A;  2N8N A;  1YI2 A;  1QVG A;  4GS3 A;  4DV4 L;  2PI2 A;  5IWA Q;  1YIT A;  2R92 G;  1YZ6 A;  3GTM H;  4LUO A;  1Q1E A;  4LF4 Q;  4AH6 A;  2R92 H;  3VDY A;  3DLL A;  1AE2 A;  2VS1 A;  4QIW E;  4LW1 A;  2JA8 H;  2LXJ A;  3U4Z A;  1N33 L;  2K5N A;  4GLV B;  3GDE A;  4GKK L;  4WJ4 A;  1N34 L;  1I94 L;  3TS2 A;  1V9P A;  4HJ9 A;  5FLM H;  1UWV A;  1IBK L;  4A3B G;  1PH3 A;  4ME3 A;  2JA5 H;  3U58 A;  1X6O A;  1XPU A;  2R93 G;  5C4J H;  2VQF Q;  3S1R H;  2F52 A;  2YTY A;  1PH6 A;  4DV7 Q;  3CD6 A;  1JJC B;  2I5H A;  1WI5 A;  4X66 L;  4DR7 Q;  4DV2 L;  3KF8 B;  4GOP C;  4C3H H;  2GVA A;  5IE8 A;  5IP7 H;  4JI4 Q;  4L5S A;  1C0A A;  3ER0 A;  2UU9 L;  3PSI A;  2WFW A;  1B70 B;  3J80 c;  1CUK A;  1PH1 A;  4LF8 L;  2ZJQ A;  2R6G A;  1JJ2 A;  2R7D A;  3HOZ G;  3KFU A;  3PV0 A;  4JI7 L;  1C7Y A;  1HNW L;  4B3T L;  4LFA L;  1XTD A;  3KF6 B;  3K81 C;  1KRS A;  4HJ5 A;  4A3C H;  1FGU A;  2OCE A;  4BY7 H;  4A3D H;  1Q7Y C;  1M90 C;  1N32 L;  3F1Z A;  2UUB Q;  3SGI A;  4JI0 L;  1PYS B;  1CSQ A;  2K4K A;  1P16 A;  4A3M G;  3S1M H;  1Q12 A;  4C3I H;  1HZA A;  1EUJ A;  4JI2 L;  1H95 A;  4A3J H;  1WJJ A;  1SMX A;  3KDF B;  3KJO A;  1JJG A;  5LMU L;  4B3S L;  4LFB Q;  3J81 j;  3S24 A;  2AWO A;  4GKJ L;  3JC6 6;  3PUW A;  2V1C C;  5EAY A;  4JYA Q;  3CCV A;  4LF7 L;  1VQP A;  1HNX Q;  1Y1W H;  2N49 A;  1QUQ A;  1MIU A;  4AYB G;  4UP7 A;  1AE3 A;  4X65 L;  3D31 A;  1K8G A;  2CCZ A;  2AHO B;  1LTL A;  2EIF A;  1BVS A;  1O7I A;  4RG1 A;  4BY1 G;  3CCJ A;  3CAM A;  1X3F A;  3W1G A;  1E22 A;  2E2H H;  2R7F A;  1YHQ A;  4BA1 I;  5C44 G;  2LSS A;  1VQI A;  1NBW A;  2JA9 A;  4EX5 A;  4UP8 A;  4LWC A;  1E1T A;  1E24 A;  1YIJ A;  2N3S A;  1SFO H;  2L15 A;  2MQH A;  4POG A;  4P72 A;  3L2P A;  4A3K G;  1IBM L;  4JV5 Q;  2I0Q A;  4BA2 I;  1X55 A;  3L7Z C;  4DV5 Q;  4O0A A;  1T9H A;  4YCW A;  4A3K H;  2OTL A;  2JA7 G;  3IRB A;  1PH4 A;  4DUZ Q;  2K5H A;  4DV1 Q;  1LYL A;  1VQ9 A;  4B3T Q;  1G29 1;  1ASZ A;  3ZJY C;  1QZH A;  2JA8 G;  4OX9 L;  3AEV A;  5IY0 A;  3FHW A;  4O2D A;  1VQE A;  1IBL Q;  4JI1 L;  3E0E A;  3KYH C;  2ZJR A;  4JI6 L;  3J81 c;  3RNU A;  3GTQ H;  4TQU S;  3G48 A;  5GAD C;  4JI3 L;  4PZ7 A;  1TWA H;  5C4X H;  2DGY A;  5M3M G;  3KF6 A;  1X9N A;  3E9I A;  4YCV A;  5JEA G;  3PUZ A;  5C0X I;  5IT9 c;  4DR5 L;  4DAM A;  2WP8 J;  1XMO Q;  2HHH Q;  4HID A;  1QZG A;  3HOZ H;  2PNH A;  3I56 A;  5JJL A;  4PZ8 A;  2JK8 A;  4GN5 A;  4A3L G;  1OXV A;  2BA0 A;  3TRZ A;  4A3E G;  4KI0 A;  4B3R L;  4BBR H;  2RHS B;  4GOP B;  1A63 A;  1WYD A;  1JE5 A;  2QEX A;  3I7F A;  1I5F A;  2HQL A;  2HIX A;  1KAW A;  1MKH A;  4QL5 A;  2ID0 A;  4IO9 A;  2UXC Q;  1SLJ A;  2A19 A;  3S1N H;  4A3C G;  1KC8 C;  4NXM L;  4LF5 L;  1EOV A;  1UE7 A;  1TXY A;  1L1O B;  1VS0 A;  3CC4 A;  2VL6 A;  3GTJ H;  4DV0 L;  2F4V Q;  4Y7N H;  1A8V A;  3H0G H;  1K73 C;  3GTL H;  4KHP L;  3UE1 A;  3T1Y Q;  2A1A A;  4A75 A;  4AQY Q;  4JI5 Q;  1MJE A;  2B63 H;  5AJ3 Q;  1VCI A;  1L1O C;  1YJ9 A;  1GM5 A;  1YHB A;  2PQA B;  1XNR L;  2K52 A;  4X62 Q;  1SR3 A;  3PUX A;  4GN3 B;  5ELN A;  2EXD A;  1JB7 A;  2HT1 A;  4BY1 H;  1Y1W G;  1VQL A;  1KXL A;  2IHE A;  3B6Y A;  1NMF A;  1HZ9 A;  2C35 B;  1X3G A;  2VY3 A;  1X56 A;  4IFD J;  2A8V A;  4GKK Q;  1N34 Q;  4IOA A;  1IBK Q;  4DR3 Q;  2AWN A;  1D7Q A;  3I4M H;  1HNZ Q;  2VQF L;  3M4P A;  3HOV G;  1I6H H;  2CQO A;  4FDB A;  4DV7 L;  1Q46 A;  4K0K Q;  3OYY A;  4R4Q A;  4DV2 Q;  3K7A H;  5LMN W;  2IT1 A;  5M5X H;  1XMQ Q;  2PQA A;  1VQ5 A;  1G51 A;  4YWM A;  2JA5 G;  4A76 A;  2BH8 A;  4JI4 L;  2R7Z G;  2E2I H;  1TWC H;  3DM3 A;  3J7Z C;  4JG2 A;  1HR0 Q;  4YHH L;  4OWW B;  1L1O A;  3ICE A;  3NEM A;  4JI7 Q;  3HOY G;  1HNW Q;  2ZM6 Q;  4LFA Q;  5IP9 H;  1CKN A;  2D0O A;  1Q8K A;  4OO1 I;  1ASY A;  2Z6K A;  1CKM A;  2WAQ G;  4IFD I;  1N32 Q;  3CXC A;  2UUB L;  3RN5 A;  2UUC Q;  4JI0 Q;  4GLA C;  1Z47 A;  5BR8 Q;  1VQF A;  1VQC A;  4A93 G;  3A74 A;  2VZA A;  2XTI A;  4BXX H;  4BBS H;  1TWH H;  1VQG A;  3PUY A;  3G71 A;  1YJN A;  3TEH B;  4B3S Q;  4BY7 G;  1FJG Q;  3J7A 5;  3FP9 A;  1HNX L;  4B3M L;  3CMA A;  3CCR A;  1YNX A;  3CCU A;  5FJ8 G;  3WWV A;  3PGZ A;  4X65 Q;  3T1H Q;  4X64 L;  4JBW A;  2QA4 A;  1K0R A;  2CKZ B;  1K8A C;  5H1S E;  1VQ8 A;  4GLX A;  1KIX A;  3I4N H;  2Y0S E;  4NB3 A;  1XNQ L;  4LUV A;  4P71 A;  3CPF A;  3TRE A;  3M9B A;  1CSP A;  3HOU H;  3UDX A;  3M85 A;  2Z6K C;  3PCO B;  4DR2 L;  3CC2 A;  2KBN A;  4PZ6 A;  1DGS A;  5HGQ A;  4DV5 L;  4L5Q A;  3KLW A;  3MEF A;  4NPS A;  4AIM A;  4C2M H;  3CCE A;  3I2Z A;  5C0X J;  4DUZ L;  1K83 H;  4DV1 L;  1LM0 A;  3AYH B;  1W2B A;  3BZK A;  3EIV A;  1N8R C;  1NJI C;  2WB1 E;  4JI8 L;  2PMZ E;  4IJH A;  3RR5 A;  2ALY B;  4JCV E;  4J15 A;  1PV4 A;  4LFC Q;  4OX9 Q;  1V43 A;  2OTJ A;  1SRO A;  2ZTE A;  2JEA I;  3EN2 A;  4BXX G;  1YVC A;  2QGQ A;  2UUA Q;  4Y52 H;  4LF6 L;  3ULP A;  1OXT A;  2JA7 H;  1QUQ B;  3I4M G;  3CF5 A;  5IYC G;  1PH7 A;  4R4I A;  4OXP A;  4IPD A;  5IYD G;  3BZC A;  3RLO A;  1JT8 A;  3HKZ G;  3HOW H;  5IYC H;  4LF9 Q;  2YU9 H;  1EQR A;  3A5U A;  1XMO L;  2HHH L;  4DR1 L;  3U4V A;  1OXX K;  2HIV A;  1HH2 P;  1WCM G;  2NZH A;  3GO5 A;  1KRT A;  5M5W H;  2LXK A;  1J5E Q;  1XPO A;  4A3J G;  3GD7 A;  4B3R Q;  2JJQ A;  2NZO A;  5ELO A;  1PYB A;  5GAH C;  2FXQ A;  4ALP A;  1Q1B A;  3OTO Q;  2JEB I;  2K50 A;  2MFI A;  2UXC L;  2YYZ A;  5E7N A;  4HIM A;  3EBE A;  1PH8 A;  1E7Z A;  1SRU A;  2Q2T A;  4LF5 Q;  4NXM Q;  3LGJ A;  1GKH A;  2AKW B;  2RF4 A;  3ERS X;  3Q8D A;  4OWX B;  5LMN Q;  3GTK H;  4LNQ A;  4R4T A;  2E2J H;  2F4V L;  1IZ6 A;  4KHP Q;  3T1Y L;  4BBS G;  4AQY L;  1EIF A;  4JI5 L;  1NMG A;  5C44 H;  5AJ3 L;  3S2H H;  1EIY B;  1HZC A;  3AQQ A;  3HFZ B;  3BJU A;  4X62 L;  4DUY Q;  4DR6 Q;  1CKO A;  4JOI A;  3RZD H;  3HOV H;  2MO0 A;  2D62 A;  1MJC A;  3H0G G;  1UE1 A;  4UPA A;  3TQY A;  1U0L A;  3CCM A;  3S15 H;  1PHJ A;  3S17 H;  3AFP A;  1YEZ A;  3PF4 A;  1U5K A;  1FVI A;  2JQO A;  2MNA A;  2R7Z H;  4DR3 L;  2ZTC A;  1KQS A;  4NXN L;  1YBY A;  1HNZ L;  1J6Q A;  1VQB A;  1KL9 A;  4YWL A;  4K0K L;  2K5V A;  1UEB A;  1SN8 A;  5FLX c;  4OO1 G;  1XMQ L;  4GNX B;  2RCN A;  1L0W A;  1EYG A;  1QVC A;  4GNX A;  5M3F H;  2YTV A;  1A0I A;  1KHI A;  2CFM A;  3K8A A;  3STB D;  1S40 A;  3PO3 G;  3PO2 G;  1HR0 L;  3RZO H;  4A3L H;  4QJF A;  4YWK A;  1A62 A;  4YHH Q;  5IYD H;  3HKZ E;  1PVO A;  4QY7 A;  4POF A;  3M4Q A;  2ZM6 L;  4JBK A;  4P74 A;  4DK3 C;  3HOW G;  3S2D H;  2BH2 A;  4L5T A;  1XJV A;  1K3R A;  2OQ0 A;  4JOI C;  3L0O A;  3F2B A;  2GVB A;  2UUC L;  3HKS A;  3MXN B;  3UDG A;  1B7Y B;  5GAG C;  3AFQ A;  2IX0 A;  2I5M X;  1LUZ A;  5BR8 L;  4QGU A;  1HJP A;  2NN6 G;  1M1K C;  2K75 A;  2WB1 G;  4HJA A;  5IP9 G;  4DKA C;  2ATW A;  3I4N G;  5J3B A;  1AH9 A;  1S3O A;  2B29 A;  4DV3 Q;  4A3I H;  4APV A;  1FJG L;  1C9O A;  2PI2 E;  4JC0 A;  1N36 L;  5JJI A;  3BU2 A;  4XTC S;  4B3M Q;  3D0F A;  3K80 C;  5GQO A;  2VQE Q;  3M3Y H;  4IPC A;  2UXB L;  1X65 A;  3I55 A;  3T1H L;  1NTG A;  1YHA A;  4X64 Q;  2BA1 A;  2Y0S G;  3CCQ A;  1PA6 A;  1W3S A;  4GNX C;  3CCL A;  2IX1 A;  1VQD A;  1OXS C;  1XNQ Q;  2RHQ B;  4JBJ A;  4R4O A;  4DR4 Q;  2Z0S A;  1HR0 W;  3PIP A;  2NVT H;  5FJ8 H;  4KHZ A;  1Y1V G;  5IYB H;  3PF5 A;  3HOX H;  1VQO A;  4DR2 Q;  1OXU A;  2E8G A;  1RIP A;  1L2F A;  1Y1V H;  5IYB G;  4OON A;  3RLF A;  2UXD L;  2Q2U A;  2OWO A;  2ZJP A;  4YY3 Q;  4DV6 L;  5M5Y H;  2E5L L;  3CPW A;  4P73 A;  4A3F H;  4JI8 Q;  4IOC A;  2ZTD A;  4LFC L;  3KOJ A;  4DV4 Q;  5IWA L;  4A3F G;  2EQS A;  3I4O A;  1WCM H;  4HJ8 A;  1TWF H;  4KLK A;  4LF4 L;  4X6A H;  2WAQ E;  1Q82 C;  3GTO H;  2UUA L;  2R93 H;  4XIG S;  3J81 i;  3CCS A;  4LF6 Q;  3M7N A;  3W1B A;  3HOY H;  1GVP A;  1N33 Q;  4A3I G;  1PH5 A;  1IL2 A;  2JA6 G;  1YJW A;  5M3F G;  4HJ7 A;  2KEN A;  2CWA A;  1X3E A;  5M3M H;  1I94 Q;  4LF9 L;  2B3G A;  4IPH A;  1EWI A;  3PO2 H;  1I50 H;  2DUD A;  5IP7 G;  4RMF A;  4DR1 Q;  5C0X G;  4MTN A;  2F3I A;  1J5E L;  3GTG H;  4X66 Q;  4PMW A;  4DR7 L;  2ES2 A;  4BBR G;  2JE6 I;  1GO3 E;  3PUV A;  1NE3 A;  2ASB A;  1N9W A;  1B8A A;  1UE6 A;  1UE5 A;  1D8L A;  3OTO L;  5DLQ E;  1P8L A;  4MZ9 A;  5FLM G;  2H5X A;  3PIO A;  3H15 A;  2NVY H;  2N78 A;  2UU9 Q;  1OTC A;  1VQM A;  1GD7 A;  4LF8 Q;  3K0X A;  4LUZ A;  5LMN L;  1HZB A;  3F8T A;  1VQJ A;  1BBU A;  3KJP A;  4TVA B;  3RLN A;  2AMC B;  5C4X G;  3STB C;  2YTX A;  1E3P A;  3FKI H;  1PH2 A;  4A93 H;  4DUY L;  3GTP H;  3F2D A;  2XGT A;  1TWG H;  4EQ5 A;  4DR6 L;  3FKI G;  3UDF A;  1QVF A;  3S16 H;  2VNU D;  2VUM G;  4JI2 Q;  3OW2 A;  3G6E A;  4A3E H;  1FL0 A;  4R4C A;  3NEN A;  2K14 A;  2Q2I A;  5LMU Q;  3ULJ A;  1XPR A;  1IYJ B;  1SE8 A;  4LFB L;  4GKJ Q;  4JBM A;  1VQ6 A;  3JAM i;  3ULL A;  3UE0 A;  4A4I A;  2Q2H A;  1Z9F A;  4LF7 Q;  4JYA L;  3HOX G;  2NN6 I;  1VQ4 A;  3F2C A;  4UP9 A;  3PO3 H;  1KD1 C;  1VQ7 A;  4NXN Q;  1PFS A;  2NVQ H;  2MO1 A;  3CP0 A;  3TS0 A;  5C3E H;  2B63 G;  1EFW A;  4QQB X;  3CW2 C;  5C3E G;  3M4O H;  3E9H A;  1V1Q A;  4OWT B;  2YV5 A;  3KDF A;  1IXR A;  4A3G H;  4JV5 L;  1IBM Q;  1RL2 A;  4MNO A;  4A3B H;  2KCM A;  5JEA J;  1K9M C;  4DK6 C;  3S14 H;  1VQA A;  3CME A;  3H3V I;  3W5O A;  2I5L X;  1VQK A;  5K36 G;  1Q86 C;  1VQN A;  3U50 C;  2VUM H;  1X54 A;  1IBL L;  4JI1 Q;  4JI6 Q;  3S1Q H;  2IY5 B;  1NY4 A;  4IPG A;  4C3J H;  5GAE C;  4A3D G;  1Y14 B;  1G6P A;  2D0P A;  4JI3 Q;  4DV3 L;  2VW9 A;  4R1J A;  1N36 Q;  5HY6 A;  4DR5 Q;  3UDI A;  3K7U C;  4DPG A;  1CKN B;  2GN5 A;  2VQE L;  3NEL A;  1R9T H;  3A5Z B;  2UXB Q;  1I3Q H;  4WJ3 M;  4UY8 C;  2IHF A;  3JAM c;  4A3M H;  1E1O A;  1S72 A;  3RN2 A;  4DAY B;  4YCU A;  3J80 i;  2OQK A; 
#chains in the Genus database with same CATH topology
 4H02 A;  4HCS A;  4XT1 B;  5EBC A;  2JXM B;  4HIO A;  4GN4 B;  1Q81 C;  1GUG A;  1CA5 A;  1R9T B;  3I70 A;  3H3V H;  4ABN A;  1U4M A;  2JA6 H;  4HSV A;  2KCT A;  5JJK A;  4DV6 Q;  5F2D A;  5GRO A;  2NVX H;  3CC7 A;  2CWP A;  3AU7 A;  2DY8 A;  2B63 B;  5IIF A;  4DXF A;  4AH6 A;  2R92 H;  3VDY A;  4XQJ A;  3DLL A;  1F2L A;  1EY8 A;  2LXJ A;  5JPN C;  4FXD A;  1KLU D;  3RZO B;  2B8G A;  3GTG B;  1UWV A;  1PH3 A;  4MHE A;  4CDF C;  1X6O A;  2YTY A;  1UEA B;  1EYC A;  3QIA A;  4XQN A;  4C3H H;  1CT1 D;  4NMZ A;  2GVA A;  3GTP B;  1GUT A;  2JSO A;  4F88 A;  3OHX C;  5BN4 A;  3ER0 A;  5L37 A;  3OWE B;  3J80 c;  2R6G A;  1JJ2 A;  2R7D A;  3HOZ G;  5KRU A;  1Y8O B;  5D14 A;  4HJ5 A;  2B2U C;  2F0T A;  3KBX A;  1FGU A;  4OIJ A;  4X3U A;  3CKI B;  4C3J G;  1Q7Y C;  1O80 A;  1N32 L;  4C3I G;  4JI0 L;  2K4K A;  5FLX L;  1HZA A;  4A3J H;  3KDF B;  3U9S A;  3KJO A;  2PZU A;  3ERO A;  3S24 A;  4GKJ L;  2V1C C;  2Z1C A;  3I8Z A;  5EAY A;  3SE0 A;  4LF7 L;  1HNX Q;  3FKI B;  1QUQ A;  3MVV A;  4AYB G;  2NWG A;  1BCP D;  5DM6 3;  1LTL A;  2F0J A;  4MN3 A;  1X3P A;  4J1M A;  3CAM A;  3E3X A;  2E2H H;  2ENB A;  1VMC A;  3I73 A;  4BA1 I;  5C44 G;  5E3F A;  3EA6 A;  4KKS A;  1NBW A;  4U67 3;  1F9P A;  2N3S A;  3L2P A;  2I0Q A;  4C3J B;  1X55 A;  2IL8 A;  1PH4 A;  4DUZ Q;  2K5H A;  1JOO A;  1HUM A;  2Z4I A;  4CBV A;  5IY0 A;  4I7Z C;  3SK4 A;  2O5I C;  4JI1 L;  2ZJR A;  3K59 A;  1BO0 A;  2F3W A;  5GAD C;  4JI3 L;  2MPM A;  2O2L D;  3E5S A;  1X9N A;  3K57 A;  1QJO A;  4DAM A;  2WP8 J;  4DR5 L;  1XMO Q;  2VB3 X;  4A3F B;  2HHH Q;  1HHV A;  4GN5 A;  1OXV A;  4HMI A;  4A3E G;  1YNJ C;  1A63 A;  2GA4 B;  4GOP B;  1WYD A;  1A6X A;  1I5F A;  3E6Z X;  1KAW A;  2NVT B;  4IO9 A;  1SLJ A;  2A19 A;  1K28 A;  3FDT A;  4ZCK A;  1EOV A;  1TVX A;  2KHS A;  1L1O B;  4Z9C B;  2VL6 A;  4CDD C;  4DV0 L;  3UE1 A;  1CHP D;  3T1Y Q;  4JI5 Q;  3V96 A;  1VCI A;  4FNF A;  5EPL A;  2PQA B;  4DU9 A;  2HT1 A;  2IHE A;  3B6Y A;  2PNR C;  1X3G A;  2VY3 A;  2L9H A;  2OF1 A;  4X3T A;  4F8M A;  1HRJ A;  1IBK Q;  1HNZ Q;  3M4P A;  4FDB A;  2X6L A;  5ISR A;  1RD9 D;  3K7A H;  5LMN W;  1H9K A;  2X6G A;  1VQ5 A;  3PMF A;  4NP5 A;  1TWC H;  2RKS A;  3J81 E;  2NZ1 D;  2TMP A;  2RDG A;  1DXM A;  4OWW B;  3ICE A;  3NEM A;  1LTR D;  2F0F A;  2ZM6 Q;  3MC0 B;  4G7H C;  3CXC A;  2UUB L;  3C1E A;  1IW7 D;  1Z47 A;  5BR8 Q;  1VQC A;  2F0O A;  1UUP A;  2EY6 A;  5FO8 B;  1Q90 A;  4N8F A;  1SNQ A;  3PUY A;  3URY A;  4JPB W;  3G71 A;  4BY7 G;  1FJG Q;  2BE5 D;  3KK7 A;  3ND9 A;  2F3V A;  4CJ2 C;  2L4N A;  3H3V C;  1ESR A;  5COY A;  5J1Z A;  1YNX A;  3R2I A;  2L11 A;  4JBW A;  3MFY A;  2QA4 A;  1K8A C;  2B2T C;  3A8K E;  1XNQ L;  4LUV A;  4P71 A;  1EWH A;  1RTN A;  1U4R A;  2VUM B;  2EZV A;  3M9B A;  1S4Z A;  2WAC A;  3HOU H;  3M85 A;  4K8I A;  2XRQ D;  4DV5 L;  4LAA A;  4L5Q A;  2A6H D;  3CCE A;  3GTM H;  1DON A;  1N8R C;  3EIV A;  4JI8 L;  3RR5 A;  1PV4 A;  2WB1 B;  2A73 B;  3A54 A;  4B9X A;  2OTJ A;  1BXT A;  2F0U A;  4BXX G;  1C48 A;  1OXT A;  1QUQ B;  2R92 B;  2N88 A;  3PQI A;  4R4I A;  5IYC G;  3BZC A;  1PTO D;  1EOT A;  3A7A B;  3A5U A;  4CKC A;  2B2T A;  2NZH A;  1HH2 P;  1KNE A;  5M5W H;  1W6K A;  2JP1 A;  3GD7 A;  1PZJ D;  4B3R Q;  1DOM A;  1PYB A;  1O78 A;  2BDO A;  2H1E A;  5JVH 3;  1Q1B A;  1Z7T A;  2MFI A;  2K03 A;  4HIM A;  4NXM Q;  4LF5 Q;  2ZXP A;  1E7Z A;  1CQV A;  3S15 B;  3G7L A;  3ERS X;  5TSS A;  1SMY C;  5LMN Q;  3GTK H;  4IFD H;  1QE6 A;  2F4V L;  2NVY B;  4DNR B;  2K7V A;  5AJ3 L;  3S2H H;  5ELD A;  3AQQ A;  1B4O A;  2PYK A;  4X62 L;  1Y8N B;  3RZD H;  3HOV H;  3K5O A;  1UE1 A;  4UPA A;  3S15 H;  2H4O A;  5I4D A;  1S5B D;  4B9W A;  5D3D A;  4DR3 L;  5JPM C;  1YBY A;  4ILW A;  1VQB A;  4G7O C;  3MXG A;  3MEH A;  3Q24 A;  3T51 B;  4OO1 G;  5EJW A;  2EYM A;  3S9W A;  4GNX B;  1EQV A;  1PFM A;  2RCN A;  1L0W A;  5LHY 1;  1H9J A;  1CZG A;  1VF5 C;  2Q8T A;  1KAB A;  4O1N A;  1EY7 A;  3PO3 G;  4A3L H;  4QJF A;  4YWK A;  1LLR D;  2RSO A;  1SYB A;  3C1F A;  4P74 A;  3TBI B;  2NTT A;  1ZYR D;  3DEP A;  3P1H A;  3L0O A;  1B9N A;  3K0Y A;  5GAG C;  1PTO F;  1EQT A;  2IX0 A;  1HJP A;  1M1K C;  2K75 A;  5KGU A;  4BS9 A;  3TP7 A;  1S3O A;  5J22 A;  4JC0 A;  1ZXT A;  1RTO A;  4K14 A;  5JJI A;  3BU2 A;  5C4X B;  3K80 C;  5GQO A;  3M3Y H;  1SYF A;  5CV4 A;  1SYG A;  3T1H L;  1PA6 A;  1NTG A;  4X64 Q;  3CCQ A;  1CK1 A;  1W3S A;  2IX1 A;  2WV6 D;  1V8Q A;  4DFA A;  2O4X A;  3K5M A;  3VR5 A;  4RFB A;  4JBJ A;  4R4O A;  4RHR A;  3PIP A;  2PQE A;  5G3L D;  5IYB H;  1RKN A;  3PO3 B;  3I90 A;  5CV5 A;  1JQY D;  1Y1V H;  3S2D B;  4UAI A;  3IFD A;  2Q2U A;  2ZJP A;  4DV6 L;  5IWA L;  4A3F G;  2EQS A;  3I4O A;  1S5C D;  1IL2 A;  1JOQ A;  5M3F G;  1X3E A;  4LF9 L;  1EWI A;  3PO2 H;  2LFN A;  4OO1 H;  5A35 A;  1CTM A;  3HP3 A;  3CHB D;  2PZT A;  1AN8 A;  1D8L A;  3OTO L;  5DAU A;  4MZ9 A;  5FLM G;  3PIO A;  2NVY H;  3SHL A;  1VQM A;  2DN8 A;  4LUZ A;  1BBU A;  3RLN A;  5CMD A;  2PW5 A;  5C3W A;  1E3P A;  2F0K A;  5AFW A;  5EPK A;  3V2T A;  4DR6 L;  2SNM A;  3FKI G;  3UDF A;  2VUM G;  2XIW A;  4HSP A;  2K5Q A;  2BCO A;  1F9R A;  1FGB D;  1VDZ A;  2R93 B;  5D3I B;  4A4I A;  5IOC A;  1Z9F A;  4LF7 Q;  2NN6 I;  1VQ4 A;  1SFO B;  4UP9 A;  1SYE A;  3PO3 H;  1KD1 C;  2ICE C;  4NXN Q;  4TKO B;  1PFS A;  2NVQ H;  3CP0 A;  3TS0 A;  1B1Z A;  5EKK A;  2K5D A;  1S5E D;  4QQB X;  2NTS A;  1C8C A;  2YV5 A;  3KDF A;  3OIQ A;  3C46 A;  2KCM A;  2A6E C;  1K9M C;  3BDO A;  4DK6 C;  3LWE A;  1KDB A;  4G4K A;  4DGZ A;  1JOR A;  1GUN A;  2I5L X;  2QF7 A;  1JIC A;  5K36 G;  3T16 A;  1IBL L;  4JI1 Q;  4IPG A;  3D4D A;  4C3J H;  1G6P A;  3Q22 A;  5IGC A;  4DV3 L;  1RJT A;  2VW9 A;  4R1J A;  1PYW D;  4DR5 Q;  1SND A;  5KYI A;  1CKN B;  1L0X B;  1XTC D;  4K6D A;  2UXB Q;  1S72 A;  1E1O A;  1HA6 A;  3P75 A;  2P5Z X;  5C44 B;  4TSS A;  5EQ0 A;  4OGQ C;  3HS0 C;  3R2T A;  1EWC A;  1GOZ A;  5ELC A;  1WOC A;  4AYB E;  1QNU A;  4IUT A;  1VQH A;  4R8N A;  2M9V A;  1HTL D;  2F0E A;  4J6H A;  4KTA A;  4YY3 L;  3NBH B;  3D6W A;  2N8N A;  1QVG A;  2HCI A;  4DV4 L;  2R92 G;  4OL7 A;  1D5M C;  1WTO A;  4LF4 Q;  1WTR A;  1AE2 A;  1L0Y B;  1EIH A;  4X3S A;  1N33 L;  4XDX A;  4V19 0;  4GKK L;  5I9P A;  3TZD A;  1IBK L;  1JOK A;  4A3B G;  4ME3 A;  5C3X A;  2NN6 H;  2Y0S B;  2VQF Q;  2BE5 C;  1A15 A;  3D3R A;  1PH6 A;  3CD6 A;  4DV7 Q;  1CHQ D;  3DMU A;  4DR7 Q;  5IP7 H;  1TS2 A;  4L5S A;  4I65 A;  1C0A A;  3TME A;  3IKJ A;  3NQI A;  3OW7 A;  3W3A A;  2WFW A;  1B70 B;  2YU9 B;  1PH1 A;  4LF8 L;  2ZJQ A;  2SNS A;  1C7Y A;  1XTD A;  3KF6 B;  3VA7 A;  4A3D H;  4BY7 H;  3U9O A;  2UUB Q;  4BY7 B;  4A3M G;  4FVM A;  1LAB A;  3ITP A;  1FR3 A;  3BVG A;  4MIU A;  2AWO A;  1D5Z C;  3JC6 6;  3HRZ C;  4JYA Q;  1EY5 A;  1JWM D;  4PMC A;  4AYB B;  1O7L A;  2F0W A;  2VXW A;  2CCZ A;  2EIF A;  1O7I A;  4H44 C;  1E22 A;  2R7F A;  1YHQ A;  1DM0 B;  1VQI A;  5ELF A;  1ROD A;  2JA9 A;  4LWC A;  2L15 A;  2MQH A;  4ZKC B;  1IBM L;  4BA2 I;  3L7Z C;  4O0A A;  2OTL A;  2Z6B A;  4QCL A;  3IRB A;  1LYL A;  3HOZ B;  1XX8 A;  1QZH A;  2JA8 G;  2K6A A;  4N9P A;  2E2H B;  5JJZ A;  2D9U A;  4NW2 A;  1QB5 D;  3FHW A;  4O2D A;  4KD4 A;  4M1U B;  1STG A;  4JI6 L;  2NVX B;  2DJF C;  4A3I B;  4TQU S;  3G48 A;  5E1F A;  5JOB A;  2DGY A;  5M3M G;  3CU7 A;  4KD3 A;  3KF6 A;  5C4H A;  4U68 A;  5IT9 c;  1ZKO A;  2G9D A;  4HID A;  3ERQ A;  2PNH A;  5C3E B;  3GTL B;  4KI0 A;  1SYC A;  1WCM B;  1JE5 A;  3H94 A;  3I7F A;  4DAV A;  1MKH A;  4QL5 A;  4A3C G;  3HOX B;  1WD1 A;  4LF5 L;  4NXM L;  1JWU D;  3PIO 3;  1WD0 A;  3GTJ H;  2F4V Q;  1A8V A;  4KHP L;  2KCN A;  3MXN A;  3GQB A;  4K5W A;  5AJ3 Q;  2WKC A;  2G5D A;  5I9O A;  1H9M A;  1SSO A;  1YHB A;  2AUK A;  3Q0A A;  1GM5 A;  1XNR L;  1SR3 A;  3PUX A;  1LTB D;  3VYS A;  3L9A X;  1JB7 A;  2XWB B;  4BY1 H;  1Y1W G;  4ZRZ A;  2FJ2 A;  1HZ9 A;  5JAV A;  2B2V A;  3TDQ A;  3VR2 A;  1N34 Q;  4IOA A;  5BN3 A;  4DR3 Q;  1JE4 A;  4KY5 A;  1PXU A;  1Z6H A;  1I6H H;  3H0G B;  4HTH A;  3D4W A;  4R4Q A;  4DV2 Q;  3X3M A;  5M5X H;  1BDO A;  1F2Z A;  5I2X A;  2BH8 A;  1I4X A;  4BBS B;  2R7Z G;  2E2I H;  1WTP A;  4K8J A;  1HR0 Q;  4YHH L;  1L1O A;  4ID6 A;  1I50 B;  4JI7 Q;  1J9O A;  3HOY G;  1HNW Q;  2D0O A;  1Q8K A;  1YNN C;  3K5L A;  5CV6 A;  1MBY A;  3GTM B;  4IFD I;  1DCZ A;  4LJZ C;  3RN5 A;  4GLA C;  3TN2 A;  4A93 G;  5C0X H;  3NTH A;  4BXX H;  2C5C A;  1VQG A;  3DUZ A;  3M4O B;  4QF4 A;  2R7Z B;  3CMA A;  3S2H B;  1Y69 U;  3CCU A;  2RQX A;  3BVM A;  3T13 A;  3SK6 A;  4X65 Q;  3T1H Q;  2EVB A;  3OPO A;  3UI2 A;  1BUV T;  1EEF D;  4ZK9 B;  1VQ8 A;  1YNN D;  1GHJ A;  1PRT B;  2DY7 A;  2QIL A;  2EY1 A;  1SYD A;  2Z6K C;  4RGT A;  1CA6 A;  5HGQ A;  3WOE A;  3KLW A;  4NPS A;  1R4P B;  3P7J A;  1VQK A;  2XSC A;  5C0X J;  4DV1 L;  1LM0 A;  3AYH B;  4XXE A;  1AFP A;  3R8B A;  1NJI C;  2B2Y A;  4OX9 Q;  1V43 A;  1HXY D;  1SRO A;  2J0T D;  1D1I A;  1DYQ A;  1YVC A;  2QGQ A;  3QG1 A;  2UUA Q;  3ULP A;  4FXG C;  3CRK C;  1PH7 A;  2EXZ A;  5IYD G;  2Q8R E;  2RVL A;  2F0L A;  4LF9 Q;  2KUM A;  4XQQ A;  2K33 A;  2YU9 H;  3KLS X;  5CC4 A;  1EQR A;  1S5D D;  3U4V A;  4RWS C;  1XPO A;  4A3J G;  1BOS A;  4EQP A;  2JJQ A;  2K28 A;  3TP5 A;  4CJ1 B;  1STB A;  3DEO A;  2MP1 A;  2JEB I;  2YYZ A;  3E0J A;  3Q8D A;  2B2Y C;  2DJG C;  1IZ6 A;  4N9T A;  4XYQ A;  1EIF A;  1F2Y A;  1GUO A;  1YNJ D;  3Q23 A;  1EIY B;  1HZC A;  3KF8 A;  4DR6 Q;  1QCB D;  1CKO A;  2IX3 A;  4JOI A;  2L0C A;  1MJC A;  3TQY A;  3CCM A;  3HEJ A;  3S17 H;  2HQE A;  3AFP A;  3F2U A;  2JA6 B;  1HFN A;  2LKV A;  4FP5 D;  4DN4 M;  3FPP A;  5CYU A;  4K0K L;  1SN8 A;  4A3J B;  2NBF A;  1XMQ L;  1O7Y A;  1QVC A;  2A69 D;  2YTV A;  1A0I A;  4WJW A;  1KHI A;  2RDH A;  3STB D;  1S40 A;  3PO2 G;  4N8X 1;  3HKZ B;  2KJX A;  4QY7 A;  4POF A;  3M4Q A;  3MA2 B;  3HOW G;  4HAE A;  2BH2 A;  4JOI C;  4FF2 A;  5CBA E;  2GVB A;  2UUC L;  1LV9 A;  1B7Y B;  1LUZ A;  4QGU A;  1EEI D;  2WB1 G;  5BN5 A;  5IP9 G;  4KY7 A;  1AH9 A;  2B29 A;  2PI2 E;  4XTC S;  1TWA B;  2F0V A;  4B3M Q;  1BNZ A;  2MJ8 A;  3I55 A;  1YHA A;  2E2D C;  3CCL A;  1VQD A;  1OXS C;  1IKL A;  2RHQ B;  4JK1 C;  1HR0 W;  3N6R A;  2NVT H;  4XYO A;  1ILQ A;  1U9R A;  4DR2 Q;  2E8G A;  3BZD B;  1L2F A;  1BBX C;  5JVG 3;  2OWO A;  2SDF A;  4YY3 Q;  3BDC A;  1Y8P B;  1D2B A;  4A3F H;  4IOC A;  3T4A C;  2EYL A;  4LFC L;  4DV4 Q;  4X6A H;  4LF4 L;  2WAQ E;  4IN3 A;  1TT2 A;  4XIG S;  3CCS A;  2F0Q A;  4LF6 Q;  3W1B A;  3VR4 A;  4HJ7 A;  2KEN A;  2FMC A;  2I46 A;  2B3G A;  2IJ0 A;  3L3O C;  4ZLT F;  5IP7 G;  1I4Q A;  1J5E L;  3GTG H;  4QUC A;  4PMW A;  2JA7 B;  2ES2 A;  4KKU A;  4BBR G;  3PUV A;  1IL8 A;  1UE6 A;  1PLF A;  2AQ1 B;  3EQL C;  3H15 A;  1PTO C;  2C9O A;  3K0X A;  5KND A;  3LWU A;  2AMC B;  5C4X G;  4EQN A;  3FKI H;  2CW0 D;  2XGT A;  1TWG H;  3OW2 A;  4A3E H;  3NEN A;  2XRS D;  3K5N A;  3GTO B;  1NCV A;  4GKJ Q;  3DXJ C;  3ULL A;  3UE0 A;  3S1N B;  1STH A;  3A56 A;  2MO1 A;  2Z4H A;  1KDA A;  1SJH D;  2EJM A;  2KCC A;  3OMC A;  1WTQ A;  3M4O H;  1V1Q A;  5KNC A;  2VB2 X;  1T5E A;  1HQM C;  1IBM Q;  4MNO A;  5JEA J;  1QOH A;  3S14 H;  1VQA A;  4RCN A;  3H3V I;  4JW0 A;  1G91 A;  2RSN A;  1OO9 B;  2A5H A;  4JI6 Q;  1FNV A;  1GXD C;  1NY4 A;  4A3D G;  5GAE C;  2NUC A;  1ENC A;  4GZY C;  2D0P A;  4JI3 Q;  2PW7 A;  1SDF A;  5HY6 A;  3UDI A;  2GN5 A;  2VQE L;  4DK1 A;  4HN7 A;  1V1P A;  4DAY A;  3OIP A;  5CGK A;  3VYR A;  4WRD A;  4PG3 A;  1WFQ A;  2KHJ A;  2KQ3 A;  3VYT A;  4DR4 L;  3QOJ A;  3G4S A;  2RCF A;  1KNA A;  4A3G B;  3BVZ A;  3M3Y B;  1TWF B;  2HDL A;  1LAC A;  2EYJ A;  4IFD G;  5M5Y B;  2KHI A;  3CQZ H;  1BKB A;  4DV0 Q;  2B2W A;  4L8J A;  5IGE A;  1STN A;  4LK1 C;  3I4L A;  4DNI A;  2F03 A;  4IJL A;  1XNR Q;  3GTJ B;  3GV3 A;  1YI2 A;  5EGT A;  2PI2 A;  1YIT A;  1IKM A;  5IOD A;  4LUO A;  4C3I B;  1HCZ A;  2VS1 A;  4QIW E;  1RF2 D;  4LW1 A;  5IGF A;  2JA8 H;  4CKE A;  4ZYS A;  3U4Z A;  4IAL A;  4PNY A;  5CR3 A;  3CQZ B;  2A6E D;  4WJ4 A;  1N34 L;  1V9P A;  3QOL A;  5FLM H;  4DF7 A;  1HUN A;  4CKB A;  2JA5 H;  4IUP A;  1SE2 A;  1TS5 A;  2F52 A;  3OOC A;  2CH4 A;  4C3H G;  3S1R B;  4X66 L;  3GTQ B;  5KYL A;  4DV2 L;  3KF8 B;  1QNK A;  5IE8 A;  4BWG B;  1IW7 C;  2UU9 L;  3PSI A;  3SVM A;  1CUK A;  3KFU A;  1R4Q B;  3PV0 A;  4JI7 L;  2N55 A;  4C1N I;  3K81 C;  2ZXR A;  4A3C H;  2OCE A;  1M90 C;  3GP7 A;  1K0S A;  3EFX D;  3SGI A;  1PYS B;  1CSQ A;  1P16 A;  3S1M H;  1Q12 A;  4C3I H;  1EUJ A;  4JI2 L;  1H95 A;  4ZAI A;  5LMU L;  1JJG A;  4LFB Q;  1ICW A;  1TS3 A;  3GTK B;  3CCV A;  1VQP A;  1H9S A;  3J7A V;  3SK8 A;  1Y1W H;  3HOU B;  2F0H A;  3G6J B;  1AE3 A;  2QKI C;  4X65 L;  1I3Q B;  1X3F A;  3I91 A;  2CHB D;  1D1K A;  2LSS A;  1GJX A;  4JV5 Q;  4POG A;  4K6L A;  4DV5 Q;  4A3K H;  1Y1V B;  5J39 A;  2JA7 G;  4A3D B;  4DV1 Q;  1G29 1;  1ASZ A;  1F2M A;  3ZJY C;  2KEC A;  4OX9 L;  3AEV A;  1MSG A;  1VQE A;  1ML0 D;  3KYH C;  1PMR A;  4OEM B;  3J81 c;  3GTQ H;  2DNC A;  1ILP A;  4PZ7 A;  1CI3 M;  1TWA H;  1FYC A;  2ICI A;  4K2K A;  4YCV A;  3PUZ A;  5C0X I;  3HOZ H;  4PZ8 A;  2JK8 A;  3ND8 A;  2BA0 A;  4V0B A;  4L6T B;  4B3R L;  1SNC A;  3A8J E;  2QEX A;  3AB9 A;  2HQL A;  2HIX A;  4QIW B;  2ID0 A;  3FPU B;  3R93 A;  3BS1 A;  1UE7 A;  3QR8 A;  1TXY A;  4M8A A;  4Y7N H;  1MGS A;  1K73 C;  2B63 H;  2A1A A;  4A75 A;  1L1O C;  2E2J B;  2K52 A;  3C2P A;  4X62 Q;  5EPJ A;  4GN3 B;  2EXD A;  1WTV A;  1VQL A;  2E75 C;  3TZU A;  1ONL A;  3DWQ A;  4FF3 A;  4HCE A;  2AWN A;  1D7Q A;  4WOR A;  1VF7 A;  4K5V A;  1SAP A;  2CQO A;  4A3K B;  4ZUJ A;  1Q46 A;  4K0K Q;  1WTX A;  1T5X D;  1CQF A;  5I2Y A;  3OYY A;  1TWH B;  1AP0 A;  2LMC B;  1EIG A;  2EJF C;  1GUS A;  2PQA A;  3A8I E;  4I7A A;  1G51 A;  4YWM A;  2JA5 G;  4JI4 L;  2Q8I B;  1PRT F;  5COR A;  3DM3 A;  3J7Z C;  4JG2 A;  2QDB A;  2XWJ B;  4RHS A;  1ET6 A;  1LT4 D;  1J8I A;  4LFA Q;  5IP9 H;  1CKN A;  4OO1 I;  2L5T A;  2Z6K A;  1PZK D;  5IT9 E;  1ASY A;  5DEH A;  2UUC Q;  1N32 Q;  4JI0 Q;  1QIL A;  1VQF A;  2XN9 C;  3A74 A;  1LTA D;  3D8G A;  3KLS A;  1RCV D;  3RD4 A;  1QG7 A;  3TEH B;  4B3S Q;  3J7A 5;  1O7Z A;  2CVR A;  3FP9 A;  4OHJ A;  3CCR A;  2L1B A;  3BG3 A;  3KLR A;  3PGZ A;  4EGV A;  4NDX A;  4X64 L;  1K0R A;  2CKZ B;  3I4N H;  5H1S E;  1IYV A;  4KJO A;  4GLX A;  2HD3 A;  2Y0S E;  4NB3 A;  2PCF B;  3CPF A;  3TRE A;  4G7Z C;  3NHH A;  1CSP A;  2RDF A;  3C3L A;  1CFM A;  2KBN A;  2EYO A;  3NTI A;  4PZ6 A;  1U4L A;  2M00 A;  4CDC C;  1U4P A;  1TKW B;  4C2M H;  3I2Z A;  4B3T L;  1K83 H;  1W2B A;  2KED A;  2PMZ E;  4IJH A;  4JCV E;  4J15 A;  4LFC Q;  4P2C B;  1HTP A;  4PV1 C;  1UAP A;  3AMU A;  4Y52 H;  4LF6 L;  2JA7 H;  4BBR B;  1KXL A;  3I4M G;  3CF5 A;  1G2S A;  3HOW B;  4IPD A;  1JT8 A;  3RLO A;  1LT6 D;  4CJ0 B;  3HKZ G;  2G9H D;  3HOW H;  1VMP A;  4K2L A;  5IYC H;  1EY0 A;  2E74 C;  1CM9 A;  1XMO L;  2HHH L;  3OSO A;  1OXX K;  2HIV A;  1WCM G;  2K5W A;  1KRT A;  2LXK A;  1J5E Q;  1PZI D;  1NR2 A;  1EU3 A;  2FXQ A;  4ALP A;  3OTO Q;  5M3M B;  2UXC L;  2K50 A;  1PH8 A;  2Q2T A;  3LGJ A;  3V05 A;  2RF4 A;  1E2W A;  3W2D A;  4R4T A;  3O13 A;  4DNT B;  1NAP A;  3P20 A;  3T1Y L;  1ICF B;  4AQY L;  4BBS G;  4JI5 L;  2JA5 B;  5C44 H;  3RUZ A;  3MZ5 A;  3SDZ A;  4RAU C;  3BJU A;  1EYD A;  2WIN B;  2MO0 A;  3NWS A;  2IPK D;  1SNO A;  1U0L A;  1PHJ A;  1PTO B;  5CV8 A;  2JQO A;  1FVI A;  4RKL A;  4KHV A;  4KN4 C;  2MNA A;  1TR5 A;  2R7Z H;  2FMM A;  4NXN L;  1HNZ L;  1J6Q A;  1KL9 A;  3IFT A;  5HGT A;  3D6C A;  4IUV A;  1WVL A;  1UEB A;  1DZ1 A;  5FLX c;  2PMZ B;  1B3A A;  4GNX A;  2F0M A;  5K5P A;  5M3F H;  2CW0 C;  3K8A A;  1BR9 A;  3RZO H;  1A62 A;  3HKZ E;  3KBG A;  3M7G A;  1F77 A;  4RA8 A;  2ZM6 L;  4JBK A;  1X3Q A;  1K3R A;  2OQ0 A;  1AZQ A;  4KJN A;  3F2B A;  5IT9 L;  5M5X B;  3AFQ A;  2NN6 G;  4IZ8 A;  4HJA A;  4DKA C;  2ATW A;  3I4N G;  4HMJ A;  5J3B A;  4DV3 Q;  1XWE A;  3WOF A;  1CZW A;  4J8Q A;  5IGG A;  1ZEQ X;  3D0F A;  1LTT D;  2VQE Q;  4HED A;  4IPC A;  2UXB L;  2ZT9 C;  1X65 A;  2F1M A;  1PVO A;  2BA1 A;  2Y0S G;  3N52 A;  4GNX C;  3NBI A;  4S3S A;  2RA4 A;  3NQT A;  1XNQ Q;  4DR4 Q;  1LTG D;  3H91 A;  5FJ8 H;  3NWT A;  1Y1V G;  2XVS A;  3QB3 A;  1LTI D;  1OXU A;  1RIP A;  2L12 A;  5IYB G;  3J80 E;  3RLF A;  4LMQ D;  4UDU C;  4CGY B;  3CPW A;  3A7L A;  4JI8 Q;  2F0D A;  2ZTD A;  5M9O A;  1WCM H;  3MWY W;  1TWF H;  1NSN S;  3GTO H;  4IQZ A;  4CDE C;  3J81 i;  3M7N A;  1N33 Q;  1K8M A;  3FEW X;  4IUQ A;  5E4X A;  1YJW A;  2EE1 A;  3DHQ A;  1I50 H;  1S5F D;  1JCK B;  4RMF A;  5C0X G;  4DR1 Q;  4MTN A;  1Q3L A;  4X66 Q;  4DR7 L;  4R8I A;  2JE6 I;  1GO3 E;  1H9S B;  1NE3 A;  2ASB A;  1N9W A;  1UE5 A;  1EY4 A;  5IGB A;  5DLQ E;  1P8L A;  1RDP D;  1TQO A;  2H5X A;  2EYH A;  2N78 A;  2UU9 Q;  2QDL A;  1G2T A;  1GD7 A;  1A3T A;  4LF8 Q;  1DD2 A;  5LMN L;  1HZB A;  1PRT C;  3F8T A;  1VQJ A;  1AEX A;  2YTX A;  1PH2 A;  3MTS A;  3S16 B;  4A93 H;  1LO5 D;  2A69 C;  4ZUI A;  4DUY L;  3GTP H;  4EQ5 A;  3I4N B;  1HQR D;  2VNU D;  4JI2 Q;  3G6E A;  1FL0 A;  3JAM E;  2KOL A;  5LMU Q;  1XPR A;  3ULJ A;  1IYJ B;  1SE8 A;  3NBH A;  4JBM A;  1VQ6 A;  2PO4 A;  1EY9 A;  2Q2H A;  4JYA L;  1KTK A;  1RHP A;  2J7Z A;  4KV6 A;  3HOX G;  2TSS A;  3SXH A;  4A3M B;  3VR6 A;  1B44 D;  1VQ7 A;  5CV9 A;  2AQ2 B;  4H0L C;  4ME5 A;  1A2T A;  1ENF A;  1KLG D;  3CW2 C;  5C3E G;  1BCP B;  4OWT B;  2A68 D;  4A3G H;  4JV5 L;  3VA5 A;  4A3B H;  2PPB C;  2B2W C;  1Q86 C;  3U50 C;  2SOB A;  1HA5 A;  2IY5 B;  3J7A F;  4C1N K;  1TY0 A;  4FF1 A;  2EY5 A;  1N36 Q;  2EOT A;  4DPG A;  1BF4 A;  1R9T H;  3NEL A;  1ET9 A;  2AQ3 B;  4UHV A;  1I3Q H;  4WJ3 M;  5IGD A;  4UY8 C;  2IHF A;  4A3M H;  4JVZ A;  3RN2 A;  1XYI A;  2B8F A;  4YCU A;  2BDN A;  2LY7 A;  1I6V C;  2OQK A;  5JEA H;  3NSW A;  1PH9 A;  1JMC A;  4HIK A;  4A3G G;  4QB4 A;  4L5R C;  4P75 A;  3A0J A;  4GOP A;  3HOU G;  1D6E C;  1BBW A;  1ZYR C;  1EQQ A;  3IL8 A;  2UXD Q;  4MTK A;  2E5L Q;  4RCO A;  5M5W B;  1PFN A;  4GS3 A;  3I4M B;  5IWA Q;  1YZ6 A;  3S1Q B;  2NVQ B;  1Q1E A;  3NXW A;  3T53 B;  2Z9H A;  5FO9 B;  2F0N A;  1AW7 A;  2A6H C;  2HDM A;  2K5N A;  4GLV B;  3GDE A;  5C5L A;  1I94 L;  3TS2 A;  3NE5 B;  4HJ9 A;  5FOB B;  2OEO A;  3U58 A;  2R93 G;  1XPU A;  5C4J H;  3S1R H;  5EKI A;  3KUP A;  4WFN 3;  3K58 A;  1JJC B;  4OIK A;  2I5H A;  1WI5 A;  3PIP 3;  3EVQ A;  4GOP C;  1I4H A;  5FKA C;  1NNX A;  4JI4 Q;  1HPC A;  2KA7 A;  4Y7N B;  2PZW A;  2JA8 B;  1HNW L;  4LFA L;  2WII B;  1KRS A;  1I4R A;  1DOL A;  1EY6 A;  1B9M A;  3F1Z A;  2D2C C;  5DM7 3;  2NYZ D;  2K1B A;  1E0B A;  2IW3 A;  1WJJ A;  1SMX A;  2K04 A;  3WDN A;  4B3S L;  2SEB D;  3J81 j;  3PUW A;  2WAQ B;  3QO2 A;  2DNE A;  2M2L A;  2N49 A;  1MIU A;  5T1G A;  4UP7 A;  3R3O A;  3D31 A;  1K8G A;  2AHO B;  1BVS A;  4RG1 A;  4BY1 G;  3CCJ A;  3DM1 A;  3W1G A;  1MD2 D;  1TU2 B;  2F4I A;  4EX5 A;  4UP8 A;  4RGM A;  1E1T A;  1E24 A;  2B2U A;  3EJI A;  1YIJ A;  1SFO H;  4P72 A;  4A3K G;  4YCW A;  1T9H A;  5ELE A;  1F9S A;  1VQ9 A;  4B3T Q;  1V1O A;  4O42 A;  3DWA A;  3J80 L;  1IBL Q;  3E0E A;  3LNN A;  2FFK B;  5M3F B;  1SNP A;  3RNU A;  1MSH A;  4C3H B;  4DK0 A;  5C4X H;  1SEB D;  4EQO A;  3E9I A;  5JEA G;  1QZG A;  2B2V C;  3I56 A;  5JJL A;  4A3L G;  3TRZ A;  3OWF A;  2F0P A;  1LT3 D;  4BBR H;  2RHS B;  2KEE A;  2D5D A;  1B50 A;  3K6O A;  2E2I B;  1G8Z D;  1SMY D;  2UXC Q;  1A3V A;  3S1N H;  1KC8 C;  1SE4 A;  1K83 B;  1VS0 A;  3CC4 A;  1I4G A;  3H0G H;  5D65 A;  3GTL H;  2KVM A;  1E2V A;  3I3C A;  1STA A;  4AQY Q;  1MJE A;  3TSS A;  1YJ9 A;  3SK5 A;  4RKB A;  1B2T A;  5ELN A;  3HZX A;  1B53 A;  3RMH A;  4A3B B;  5A2Q L;  1NMF A;  2C35 B;  4L63 B;  1X56 A;  4IFD J;  2A8V A;  4HR7 B;  4CHT B;  4GKK Q;  1IYU A;  3JAM L;  1I6H B;  3J81 L;  3I4M H;  2EJG C;  2VQF L;  3HOV G;  4FF4 A;  2EDG A;  3FMC A;  4DV7 L;  4R9W A;  1E2Z A;  2IT1 A;  1XMQ Q;  4ULL A;  4A76 A;  4BY1 B;  3HGB A;  2L55 A;  4DAP A;  2X69 A;  5KIX A;  4C2M B;  2ZXO A;  4YIJ A;  1CKM A;  2WAQ G;  4KN7 C;  1UNS A;  1JWS D;  2VZA A;  3MXP A;  1PTO H;  2XTI A;  4BBS H;  1TWH H;  4KK7 A;  3Q6S A;  1YJN A;  5T1I A;  2F0S A;  1HNX L;  4B3M L;  1FNW A;  4EVO A;  1MHW C;  5FJ8 G;  3WWV A;  2AUJ D;  3RZD B;  3HOV B;  1G6Z A;  1TWG B;  3MAQ A;  4FXK C;  1KIX A;  2JYO A;  4QUF A;  1M4V A;  1NUC A;  1SE3 A;  3UDX A;  3PCO B;  4DR2 L;  5KNB A;  1NR4 A;  2K01 A;  3CC2 A;  1DGS A;  1ENA A;  1QWY A;  3MEF A;  4AIM A;  3NP8 A;  4DUZ L;  3BZK A;  4RH6 A;  2WB1 E;  3BYT B;  2ALY B;  3NPP A;  2ZTE A;  2JEA I;  3EN2 A;  1TS4 A;  3X3N A;  3J7Y W;  4OXP A;  1EZ8 A;  1X32 A;  3OMG A;  1ESF A;  1MI2 A;  4DR1 L;  3GO5 A;  1C4Q A;  2K32 A;  4OEL B;  1KAA A;  2NZO A;  1JR0 D;  5ELO A;  5GAH C;  4F7X A;  4G57 A;  2K05 A;  5K36 H;  1EZ6 A;  5E7N A;  4FYD A;  3EBE A;  1SRU A;  3T56 B;  4E6I A;  2RBM A;  1GKH A;  2AKW B;  4OWX B;  4LNQ A;  2E2J H;  1H9R A;  1TWC B;  4KHP Q;  1NMG A;  3MXU A;  3NK9 A;  4DA2 A;  4DUY Q;  3HFZ B;  3LX0 A;  3NTK A;  1BQQ T;  2D62 A;  2QCP X;  3H0G G;  5NUC A;  2F0I A;  1EU4 A;  5I6Y A;  5A2Q E;  1YEZ A;  3PF4 A;  1U5K A;  3DWP A;  2V4D A;  4RGN A;  1BCP F;  2ZTC A;  2FHT A;  1KQS A;  2EY2 A;  4YWL A;  5FK9 C;  2K5V A;  3IAY A;  3BYY B;  2R61 A;  3CRL C;  3S1M B;  1EYG A;  5C5M A;  4IUU A;  2CFM A;  2MHV A;  1HR0 L;  4YHH Q;  5IYD H;  2R3Z A;  3SEB A;  5E4W C;  4X3K A;  4DK3 C;  4H7B A;  3S2D H;  1EL0 A;  2E76 C;  4L5T A;  1B3Q A;  2LS0 1;  1XJV A;  1I4P A;  4Q5V A;  3HKS A;  3MXN B;  3ONA B;  3UDG A;  4KY6 A;  5I6W A;  2I5M X;  5BR8 L;  1PDQ A;  2O5J C;  4DXG A;  5HUR A;  3D4R A;  1FJG L;  4A3I H;  4APV A;  1C9O A;  2HCC A;  1N36 L;  3TP8 A;  3S17 B;  4PQX A;  4C56 C;  2HUG A;  1DOK A;  3MFG A;  1DJR D;  3A55 A;  5FO7 B;  4ODG A;  1SNM A;  3MHB A;  1WTH A;  2A68 C;  2Z0S A;  4H13 C;  4KHZ A;  1WTW A;  3PF5 A;  3HOX H;  1VQO A;  4FO2 A;  4OON A;  1TII D;  2UXD L;  4RGO S;  2BOS A;  5M5Y H;  3VYU A;  2E5L L;  4P73 A;  4ZKB B;  2MUY A;  1GHK A;  3KOJ A;  4A93 B;  4HJ8 A;  2NB0 A;  4KLK A;  1Q82 C;  2R93 H;  2UUA L;  2OT2 A;  5CV7 A;  1W6J A;  3HOY H;  1GVP A;  2JA6 G;  4A3I G;  1PH5 A;  3HOY B;  1LTS D;  5G3L F;  2CWA A;  5M3M H;  1I94 Q;  4IPH A;  1D5X C;  2DUD A;  1IHZ A;  4Q0F A;  2EYP A;  4IUN A;  5DNF A;  2F3I A;  2OXP A;  2XNA C;  1LT5 D;  2CH4 W;  1FNU A;  1B8A A;  3K7A B;  3QJY A;  3ZYY X;  1BCP C;  3SR1 A;  1OTC A;  1GUW A;  2QEJ C;  4K5X A;  3M4Y A;  5LL6 X;  3S14 B;  3KJP A;  4TVA B;  2Z8L A;  3GV6 A;  3FVQ A;  3STB C;  1PFB A;  1Y1W B;  1A3U A;  5FLX E;  2I07 B;  5C6A A;  3F2D A;  1HFG A;  1QVF A;  5LL6 S;  3S16 H;  1F9Q A;  2FIN B;  5CBE E;  1K8O A;  1Q8I A;  1JC7 A;  1STE A;  1K3B C;  2A74 C;  4R4C A;  2K14 A;  2Q2I A;  4LFB L;  2F0G A;  1EYA A;  3FRP B;  4QMG A;  2EPB A;  3JAM i;  5C4J B;  1TY2 A;  2WKD A;  3NUC A;  3F2C A;  3PO2 B;  1SJE D;  3VR3 A;  5KEE A;  1XXG A;  5C3E H;  2B63 G;  1EFI D;  4A3E B;  2JN4 A;  1EFW A;  1M8A A;  1STY A;  3E9H A;  4XT3 B;  1JB3 A;  5EKL A;  1IXR A;  4IUR A;  1RL2 A;  4B08 A;  3H09 A;  3QWN A;  4PMB A;  5ELB A;  1KDC A;  4KMU C;  3CME A;  2EYF A;  2B39 A;  3W5O A;  4TRD A;  1VQN A;  3BDL A;  2MGS A;  4KKT A;  5C4Z A;  1X54 A;  2VUM H;  1SXT A;  3S1Q H;  4NKL A;  2J4X A;  1SBB B;  1Y14 B;  4F87 A;  3H6M A;  3HG9 A;  3I72 A;  3TP6 A;  4ZQ3 A;  5EBD A;  1PRT D;  1A2U A;  2CQA A;  2QW7 A;  3K7U C;  3A5Z B;  1II3 A;  1FD7 D;  1AZP A;  3JAM c;  1V1P B;  2IWH A;  4DAY B;  3J80 i; 
#chains in the Genus database with same CATH homology
 4H02 A;  4PG3 A;  1WFQ A;  2KHJ A;  4DR4 L;  4HIO A;  3G4S A;  1PH9 A;  1WOC A;  4AYB E;  1JMC A;  4GN4 B;  4HIK A;  1Q81 C;  4A3G G;  4L5R C;  4P75 A;  1VQH A;  3A0J A;  4GOP A;  3HOU G;  4IFD G;  2KHI A;  3CQZ H;  1BKB A;  4DV0 Q;  1BBW A;  3H3V H;  1EQQ A;  2UXD Q;  2JA6 H;  2KCT A;  4YY3 L;  5JJK A;  4DNI A;  4DV6 Q;  5GRO A;  2E5L Q;  3NBH B;  4IJL A;  2NVX H;  1XNR Q;  3CC7 A;  2CWP A;  2N8N A;  1YI2 A;  1QVG A;  4GS3 A;  4DV4 L;  2PI2 A;  5IWA Q;  1YIT A;  2R92 G;  1YZ6 A;  3GTM H;  4LUO A;  1Q1E A;  4LF4 Q;  4AH6 A;  2R92 H;  3VDY A;  3DLL A;  1AE2 A;  2VS1 A;  4QIW E;  4LW1 A;  2JA8 H;  2LXJ A;  3U4Z A;  1N33 L;  2K5N A;  4GLV B;  3GDE A;  4GKK L;  4WJ4 A;  1N34 L;  1I94 L;  3TS2 A;  1V9P A;  4HJ9 A;  5FLM H;  1UWV A;  1IBK L;  4A3B G;  1PH3 A;  4ME3 A;  2JA5 H;  3U58 A;  1X6O A;  1XPU A;  2R93 G;  5C4J H;  2VQF Q;  3S1R H;  2F52 A;  2YTY A;  1PH6 A;  4DV7 Q;  3CD6 A;  1JJC B;  2I5H A;  1WI5 A;  4X66 L;  4DR7 Q;  4DV2 L;  3KF8 B;  4GOP C;  4C3H H;  2GVA A;  5IE8 A;  5IP7 H;  4JI4 Q;  4L5S A;  1C0A A;  3ER0 A;  2UU9 L;  3PSI A;  2WFW A;  1B70 B;  3J80 c;  1CUK A;  1PH1 A;  4LF8 L;  2ZJQ A;  2R6G A;  1JJ2 A;  2R7D A;  3HOZ G;  3KFU A;  3PV0 A;  4JI7 L;  1C7Y A;  1HNW L;  4B3T L;  4LFA L;  1XTD A;  3KF6 B;  3K81 C;  1KRS A;  4HJ5 A;  4A3C H;  1FGU A;  2OCE A;  4BY7 H;  4A3D H;  1Q7Y C;  1M90 C;  1N32 L;  3F1Z A;  2UUB Q;  3SGI A;  4JI0 L;  1PYS B;  1CSQ A;  2K4K A;  1P16 A;  4A3M G;  3S1M H;  1Q12 A;  4C3I H;  1HZA A;  1EUJ A;  4JI2 L;  1H95 A;  4A3J H;  1WJJ A;  1SMX A;  3KDF B;  3KJO A;  1JJG A;  5LMU L;  4B3S L;  4LFB Q;  3J81 j;  3S24 A;  2AWO A;  4GKJ L;  3JC6 6;  3PUW A;  2V1C C;  5EAY A;  4JYA Q;  3CCV A;  4LF7 L;  1VQP A;  1HNX Q;  1Y1W H;  2N49 A;  1QUQ A;  1MIU A;  4AYB G;  4UP7 A;  1AE3 A;  4X65 L;  3D31 A;  1K8G A;  2CCZ A;  2AHO B;  1LTL A;  2EIF A;  1BVS A;  1O7I A;  4RG1 A;  4BY1 G;  3CCJ A;  3CAM A;  1X3F A;  3W1G A;  1E22 A;  2E2H H;  2R7F A;  1YHQ A;  4BA1 I;  5C44 G;  2LSS A;  1VQI A;  1NBW A;  2JA9 A;  4EX5 A;  4UP8 A;  4LWC A;  1E1T A;  1E24 A;  1YIJ A;  2N3S A;  1SFO H;  2L15 A;  2MQH A;  4POG A;  4P72 A;  3L2P A;  4A3K G;  1IBM L;  4JV5 Q;  2I0Q A;  4BA2 I;  1X55 A;  3L7Z C;  4DV5 Q;  4O0A A;  1T9H A;  4YCW A;  4A3K H;  2OTL A;  2JA7 G;  3IRB A;  1PH4 A;  4DUZ Q;  2K5H A;  4DV1 Q;  1LYL A;  1VQ9 A;  4B3T Q;  1G29 1;  1ASZ A;  3ZJY C;  1QZH A;  2JA8 G;  4OX9 L;  3AEV A;  5IY0 A;  3FHW A;  4O2D A;  1VQE A;  1IBL Q;  4JI1 L;  3E0E A;  3KYH C;  2ZJR A;  4JI6 L;  3J81 c;  3RNU A;  3GTQ H;  4TQU S;  3G48 A;  5GAD C;  4JI3 L;  4PZ7 A;  1TWA H;  5C4X H;  2DGY A;  5M3M G;  3KF6 A;  1X9N A;  3E9I A;  4YCV A;  5JEA G;  3PUZ A;  5C0X I;  5IT9 c;  4DR5 L;  4DAM A;  2WP8 J;  1XMO Q;  2HHH Q;  4HID A;  1QZG A;  3HOZ H;  2PNH A;  3I56 A;  5JJL A;  4PZ8 A;  2JK8 A;  4GN5 A;  4A3L G;  1OXV A;  2BA0 A;  3TRZ A;  4A3E G;  4KI0 A;  4B3R L;  4BBR H;  2RHS B;  4GOP B;  1A63 A;  1WYD A;  1JE5 A;  2QEX A;  3I7F A;  1I5F A;  2HQL A;  2HIX A;  1KAW A;  1MKH A;  4QL5 A;  2ID0 A;  4IO9 A;  2UXC Q;  1SLJ A;  2A19 A;  3S1N H;  4A3C G;  1KC8 C;  4NXM L;  4LF5 L;  1EOV A;  1UE7 A;  1TXY A;  1L1O B;  1VS0 A;  3CC4 A;  2VL6 A;  3GTJ H;  4DV0 L;  2F4V Q;  4Y7N H;  1A8V A;  3H0G H;  1K73 C;  3GTL H;  4KHP L;  3UE1 A;  3T1Y Q;  2A1A A;  4A75 A;  4AQY Q;  4JI5 Q;  1MJE A;  2B63 H;  5AJ3 Q;  1VCI A;  1L1O C;  1YJ9 A;  1GM5 A;  1YHB A;  2PQA B;  1XNR L;  2K52 A;  4X62 Q;  1SR3 A;  3PUX A;  4GN3 B;  5ELN A;  2EXD A;  1JB7 A;  2HT1 A;  4BY1 H;  1Y1W G;  1VQL A;  1KXL A;  2IHE A;  3B6Y A;  1NMF A;  1HZ9 A;  2C35 B;  1X3G A;  2VY3 A;  1X56 A;  4IFD J;  2A8V A;  4GKK Q;  1N34 Q;  4IOA A;  1IBK Q;  4DR3 Q;  2AWN A;  1D7Q A;  3I4M H;  1HNZ Q;  2VQF L;  3M4P A;  3HOV G;  1I6H H;  2CQO A;  4FDB A;  4DV7 L;  1Q46 A;  4K0K Q;  3OYY A;  4R4Q A;  4DV2 Q;  3K7A H;  5LMN W;  2IT1 A;  5M5X H;  1XMQ Q;  2PQA A;  1VQ5 A;  1G51 A;  4YWM A;  2JA5 G;  4A76 A;  2BH8 A;  4JI4 L;  2R7Z G;  2E2I H;  1TWC H;  3DM3 A;  3J7Z C;  4JG2 A;  1HR0 Q;  4YHH L;  4OWW B;  1L1O A;  3ICE A;  3NEM A;  4JI7 Q;  3HOY G;  1HNW Q;  2ZM6 Q;  4LFA Q;  5IP9 H;  1CKN A;  2D0O A;  1Q8K A;  4OO1 I;  1ASY A;  2Z6K A;  1CKM A;  2WAQ G;  4IFD I;  1N32 Q;  3CXC A;  2UUB L;  3RN5 A;  2UUC Q;  4JI0 Q;  4GLA C;  1Z47 A;  5BR8 Q;  1VQF A;  1VQC A;  4A93 G;  3A74 A;  2VZA A;  2XTI A;  4BXX H;  4BBS H;  1TWH H;  1VQG A;  3PUY A;  3G71 A;  1YJN A;  3TEH B;  4B3S Q;  4BY7 G;  1FJG Q;  3J7A 5;  3FP9 A;  1HNX L;  4B3M L;  3CMA A;  3CCR A;  1YNX A;  3CCU A;  5FJ8 G;  3WWV A;  3PGZ A;  4X65 Q;  3T1H Q;  4X64 L;  4JBW A;  2QA4 A;  1K0R A;  2CKZ B;  1K8A C;  5H1S E;  1VQ8 A;  4GLX A;  1KIX A;  3I4N H;  2Y0S E;  4NB3 A;  1XNQ L;  4LUV A;  4P71 A;  3CPF A;  3TRE A;  3M9B A;  1CSP A;  3HOU H;  3UDX A;  3M85 A;  2Z6K C;  3PCO B;  4DR2 L;  3CC2 A;  2KBN A;  4PZ6 A;  1DGS A;  5HGQ A;  4DV5 L;  4L5Q A;  3KLW A;  3MEF A;  4NPS A;  4AIM A;  4C2M H;  3CCE A;  3I2Z A;  5C0X J;  4DUZ L;  1K83 H;  4DV1 L;  1LM0 A;  3AYH B;  1W2B A;  3BZK A;  3EIV A;  1N8R C;  1NJI C;  2WB1 E;  4JI8 L;  2PMZ E;  4IJH A;  3RR5 A;  2ALY B;  4JCV E;  4J15 A;  1PV4 A;  4LFC Q;  4OX9 Q;  1V43 A;  2OTJ A;  1SRO A;  2ZTE A;  2JEA I;  3EN2 A;  4BXX G;  1YVC A;  2QGQ A;  2UUA Q;  4Y52 H;  4LF6 L;  3ULP A;  1OXT A;  2JA7 H;  1QUQ B;  3I4M G;  3CF5 A;  5IYC G;  1PH7 A;  4R4I A;  4OXP A;  4IPD A;  5IYD G;  3BZC A;  3RLO A;  1JT8 A;  3HKZ G;  3HOW H;  5IYC H;  4LF9 Q;  2YU9 H;  1EQR A;  3A5U A;  1XMO L;  2HHH L;  4DR1 L;  3U4V A;  1OXX K;  2HIV A;  1HH2 P;  1WCM G;  2NZH A;  3GO5 A;  1KRT A;  5M5W H;  2LXK A;  1J5E Q;  1XPO A;  4A3J G;  3GD7 A;  4B3R Q;  2JJQ A;  2NZO A;  5ELO A;  1PYB A;  5GAH C;  2FXQ A;  4ALP A;  1Q1B A;  3OTO Q;  2JEB I;  2K50 A;  2MFI A;  2UXC L;  2YYZ A;  5E7N A;  4HIM A;  3EBE A;  1PH8 A;  1E7Z A;  1SRU A;  2Q2T A;  4LF5 Q;  4NXM Q;  3LGJ A;  1GKH A;  2AKW B;  2RF4 A;  3ERS X;  3Q8D A;  4OWX B;  5LMN Q;  3GTK H;  4LNQ A;  4R4T A;  2E2J H;  2F4V L;  1IZ6 A;  4KHP Q;  3T1Y L;  4BBS G;  4AQY L;  1EIF A;  4JI5 L;  1NMG A;  5C44 H;  5AJ3 L;  3S2H H;  1EIY B;  1HZC A;  3AQQ A;  3HFZ B;  3BJU A;  4X62 L;  4DUY Q;  4DR6 Q;  1CKO A;  4JOI A;  3RZD H;  3HOV H;  2MO0 A;  2D62 A;  1MJC A;  3H0G G;  1UE1 A;  4UPA A;  3TQY A;  1U0L A;  3CCM A;  3S15 H;  1PHJ A;  3S17 H;  3AFP A;  1YEZ A;  3PF4 A;  1U5K A;  1FVI A;  2JQO A;  2MNA A;  2R7Z H;  4DR3 L;  2ZTC A;  1KQS A;  4NXN L;  1YBY A;  1HNZ L;  1J6Q A;  1VQB A;  1KL9 A;  4YWL A;  4K0K L;  2K5V A;  1UEB A;  1SN8 A;  5FLX c;  4OO1 G;  1XMQ L;  4GNX B;  2RCN A;  1L0W A;  1EYG A;  1QVC A;  4GNX A;  5M3F H;  2YTV A;  1A0I A;  1KHI A;  2CFM A;  3K8A A;  3STB D;  1S40 A;  3PO3 G;  3PO2 G;  1HR0 L;  3RZO H;  4A3L H;  4QJF A;  4YWK A;  1A62 A;  4YHH Q;  5IYD H;  3HKZ E;  1PVO A;  4QY7 A;  4POF A;  3M4Q A;  2ZM6 L;  4JBK A;  4P74 A;  4DK3 C;  3HOW G;  3S2D H;  2BH2 A;  4L5T A;  1XJV A;  1K3R A;  2OQ0 A;  4JOI C;  3L0O A;  3F2B A;  2GVB A;  2UUC L;  3HKS A;  3MXN B;  3UDG A;  1B7Y B;  5GAG C;  3AFQ A;  2IX0 A;  2I5M X;  1LUZ A;  5BR8 L;  4QGU A;  1HJP A;  2NN6 G;  1M1K C;  2K75 A;  2WB1 G;  4HJA A;  5IP9 G;  4DKA C;  2ATW A;  3I4N G;  5J3B A;  1AH9 A;  1S3O A;  2B29 A;  4DV3 Q;  4A3I H;  4APV A;  1FJG L;  1C9O A;  2PI2 E;  4JC0 A;  1N36 L;  5JJI A;  3BU2 A;  4XTC S;  4B3M Q;  3D0F A;  3K80 C;  5GQO A;  2VQE Q;  3M3Y H;  4IPC A;  2UXB L;  1X65 A;  3I55 A;  3T1H L;  1NTG A;  1YHA A;  4X64 Q;  2BA1 A;  2Y0S G;  3CCQ A;  1PA6 A;  1W3S A;  4GNX C;  3CCL A;  2IX1 A;  1VQD A;  1OXS C;  1XNQ Q;  2RHQ B;  4JBJ A;  4R4O A;  4DR4 Q;  2Z0S A;  1HR0 W;  3PIP A;  2NVT H;  5FJ8 H;  4KHZ A;  1Y1V G;  5IYB H;  3PF5 A;  3HOX H;  1VQO A;  4DR2 Q;  1OXU A;  2E8G A;  1RIP A;  1L2F A;  1Y1V H;  5IYB G;  4OON A;  3RLF A;  2UXD L;  2Q2U A;  2OWO A;  2ZJP A;  4YY3 Q;  4DV6 L;  5M5Y H;  2E5L L;  3CPW A;  4P73 A;  4A3F H;  4JI8 Q;  4IOC A;  2ZTD A;  4LFC L;  3KOJ A;  4DV4 Q;  5IWA L;  4A3F G;  2EQS A;  3I4O A;  1WCM H;  4HJ8 A;  1TWF H;  4KLK A;  4LF4 L;  4X6A H;  2WAQ E;  1Q82 C;  3GTO H;  2UUA L;  2R93 H;  4XIG S;  3J81 i;  3CCS A;  4LF6 Q;  3M7N A;  3W1B A;  3HOY H;  1GVP A;  1N33 Q;  4A3I G;  1PH5 A;  1IL2 A;  2JA6 G;  1YJW A;  5M3F G;  4HJ7 A;  2KEN A;  2CWA A;  1X3E A;  5M3M H;  1I94 Q;  4LF9 L;  2B3G A;  4IPH A;  1EWI A;  3PO2 H;  1I50 H;  2DUD A;  5IP7 G;  4RMF A;  4DR1 Q;  5C0X G;  4MTN A;  2F3I A;  1J5E L;  3GTG H;  4X66 Q;  4PMW A;  4DR7 L;  2ES2 A;  4BBR G;  2JE6 I;  1GO3 E;  3PUV A;  1NE3 A;  2ASB A;  1N9W A;  1B8A A;  1UE6 A;  1UE5 A;  1D8L A;  3OTO L;  5DLQ E;  1P8L A;  4MZ9 A;  5FLM G;  2H5X A;  3PIO A;  3H15 A;  2NVY H;  2N78 A;  2UU9 Q;  1OTC A;  1VQM A;  1GD7 A;  4LF8 Q;  3K0X A;  4LUZ A;  5LMN L;  1HZB A;  3F8T A;  1VQJ A;  1BBU A;  3KJP A;  4TVA B;  3RLN A;  2AMC B;  5C4X G;  3STB C;  2YTX A;  1E3P A;  3FKI H;  1PH2 A;  4A93 H;  4DUY L;  3GTP H;  3F2D A;  2XGT A;  1TWG H;  4EQ5 A;  4DR6 L;  3FKI G;  3UDF A;  1QVF A;  3S16 H;  2VNU D;  2VUM G;  4JI2 Q;  3OW2 A;  3G6E A;  4A3E H;  1FL0 A;  4R4C A;  3NEN A;  2K14 A;  2Q2I A;  5LMU Q;  3ULJ A;  1XPR A;  1IYJ B;  1SE8 A;  4LFB L;  4GKJ Q;  4JBM A;  1VQ6 A;  3JAM i;  3ULL A;  3UE0 A;  4A4I A;  2Q2H A;  1Z9F A;  4LF7 Q;  4JYA L;  3HOX G;  2NN6 I;  1VQ4 A;  3F2C A;  4UP9 A;  3PO3 H;  1KD1 C;  1VQ7 A;  4NXN Q;  1PFS A;  2NVQ H;  2MO1 A;  3CP0 A;  3TS0 A;  5C3E H;  2B63 G;  1EFW A;  4QQB X;  3CW2 C;  5C3E G;  3M4O H;  3E9H A;  1V1Q A;  4OWT B;  2YV5 A;  3KDF A;  1IXR A;  4A3G H;  4JV5 L;  1IBM Q;  1RL2 A;  4MNO A;  4A3B H;  2KCM A;  5JEA J;  1K9M C;  4DK6 C;  3S14 H;  1VQA A;  3CME A;  3H3V I;  3W5O A;  2I5L X;  1VQK A;  5K36 G;  1Q86 C;  1VQN A;  3U50 C;  2VUM H;  1X54 A;  1IBL L;  4JI1 Q;  4JI6 Q;  3S1Q H;  2IY5 B;  1NY4 A;  4IPG A;  4C3J H;  5GAE C;  4A3D G;  1Y14 B;  1G6P A;  2D0P A;  4JI3 Q;  4DV3 L;  2VW9 A;  4R1J A;  1N36 Q;  5HY6 A;  4DR5 Q;  3UDI A;  3K7U C;  4DPG A;  1CKN B;  2GN5 A;  2VQE L;  3NEL A;  1R9T H;  3A5Z B;  2UXB Q;  1I3Q H;  4WJ3 M;  4UY8 C;  2IHF A;  3JAM c;  4A3M H;  1E1O A;  1S72 A;  3RN2 A;  4DAY B;  4YCU A;  3J80 i;  2OQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...