4JI7L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7L00
1M90C 3I2ZA 3E9HA 3K7AH 5C3EG 2K75A 1VQMA 4DR2Q 3W1BA 1QZHA 2K14A 1CUKA 1X3FA 3M9BA 3W1GA 3TS0A 1GKHA 1WYDA 2KCMA 3JAMc 5IP7H 1TWFH 2GVBA 4YCVA 3UE0A 4BA1I 5GADC 3STBC 4C3JH 5LMNL 2N49A 1L1OA 3H15A 1PH2A 4C2MH 5M5WH 4NB3A 4A3EG 2IHFA 4PZ8A 4OWWB 1IL2A 4KHPQ 4A3CH 2EQSA 2NVYH 5FJ8G 1VQNA 1VQIA 3NBHB 1I94L 1QZGA 3H0GG 1OXTA 1OXVA 2K4KA 3LGJA 4R1JA 4TQUS 1Q8KA 4DR3L 1A8VA 4OWTB 5ELNA 1JJ2A 2HHHQ 3PUYA 3GTMH 1N9WA 5IT9c 5JJLA 1Y1WG 2GN5A 4MNOA 4GKJL 1EOVA 3UE1A 4JI1Q 2JA7H 4DUYQ 4DR7L 1LUZA 2QGQA 4K0KQ 5FJ8H 1OXSC 3S1QH 1W3SA 1JB7A 4JYAQ 1GD7A 1ASZA 1XNRQ 3BJUA 1V1QA 2VY3A 4A3FH 3RN5A 2ES2A 3JAMi 1VQOA 1N8RC 4LFCQ 1VQEA 2JE6I 5IWAL 1JMCA 2ZTEA 4LUOA 4C3IH 3KYHC 4X62Q 3L7ZC 4GNXC 2WAQG 3A0JA 5IYCH 2ALYB 2Z0SA 3KFUA 1C9OA 4EQ5A 3Q8DA 4C3HH 4A3KG 4JI8L 4EX5A 3PIOA 5HGQA 5ELOA 2UU9L 5JEAJ 1IBMQ 1U5KA 3M4PA 2YU9H 4JOIC 2AKWB 4QIWE 5HY6A 2D0OA 4DR3Q 3PO3G 4DR5L 2FXQA 3AFPA 4JI0Q 2VUMH 1U0LA 4X66Q 1XNQL 4HJ8A 1HR0Q 4BXXH 4IO9A 4A93H 1QUQB 3T1HL 4GN5A 5FLXc 4DV4L 4DUZQ 2GVAA 4UY8C 1N36L 4R4CA 4LF5Q 1KRSA 1NY4A 3ULLA 4LF4L 2R92G 2UUBQ 4JI6Q 4GOPA 1YEZA 2HIXA 4ALPA 1IBLL 3AEVA 2VQFL 4LFBQ 2OQ0A 4MTNA 2HT1A 3F1ZA 4QY7A 2VW9A 2KCTA 5JJKA 4X6AH 3HFZB 5LMUL 3MXNB 4LFAQ 3I4MH 3CCSA 3I4NG 5M3FG 1VQDA 1P16A 1EQRA 1WOCA 3GTOH 1L1OC 3H0GH 2NVQH 2K50A 1CSQA 1HZCA 4POFA 3F2BA 1K0RA 1CKMA 4DV5Q 2UUAL 2LSSA 1GM5A 1SR3A 3J7A5 4BBSH 1YJWA 5C0XG 2UUBL 4JBMA 3CMAA 4HIMA 3PIPA 4O0AA 1FGUA 2NZHA 4A3EH 3OW2A 1VQ7A 3TS2A 2RHSB 2XTIA 4JC0A 5GAEC 3CCEA 2WB1E 4P71A 4DAMA 3UDGA 2YTXA 3FKIG 2CWAA 1PHJA 4LF8L 1D7QA 5FLMG 1JJCB 2IY5B 2I5MX 3L2PA 3PSIA 1OXXK 4GN4B 4NXMQ 1Y1VH 4GLVB 5M3MG 4UP8A 5C4JH 3ZJYC 2BH8A 3PGZA 2I0QA 3CCMA 1Y1VG 5LMNQ 5H1SE 3S1MH 4MZ9A 1EIYB 1QVFA 3M7NA 4RG1A 5K36G 1UE1A 3I4OA 2ZJQA 1E24A 1PYBA 3B6YA 4PMWA 1RL2A 1VQPA 3D31A 3CPWA 2N78A 1SE8A 3FP9A 1ASYA 1WCMG 3G71A 3CF5A 2KHIA 1PH4A 1XTDA 2WAQE 3RLOA 2ZJPA 4DV7L 3H3VI 2PI2A 2A8VA 4A3LH 3FHWA 3U50C 3CQZH 3KDFB 1WCMH 1SLJA 4P72A 4LF9Q 2Q2UA 3AFQA 3UDIA 4JV5L 4OXPA 4JI5Q 3HOXH 2JEAI 4L5SA 1QVGA 1TWGH 1BBWA 1E1TA 4YWMA 1YHQA 2JA5G 2UXDQ 3KDFA 4IOCA 2VNUD 4LF4Q 3CC7A 2MFIA 4JI6L 4AYBG 1XMQL 2OQKA 5GROA 3CPFA 1CSPA 1NE3A 3CXCA 1N33Q 2JA6H 3HOUH 5IWAQ 3UDFA 3RLNA 1VQBA 3PUXA 1YJ9A 4A3GH 2ZTCA 4JI3L 4A3JH 1Q82C 4LFAL 1BKBA 2YTYA 1IBKL 1HH2P 4YWLA 1X3GA 1PH3A 5GQOA 4X64L 3J80i 1N34Q 2AWOA 4K0KL 4JCVE 2AWNA 3H3VH 4A3JG 3PO2H 1IZ6A 1PA6A 4DR6L 4Y52H 1X3EA 2BA0A 1L0WA 1LTLA 3STBD 4A4IA 3OTOL 3G48A 4QQBX 1UE6A 3M4QA 1YJNA 2E2HH 3ICEA 2JA6G 2MO0A 4DV3Q 4XTCS 3TREA 3CCUA 1AE2A 1VQHA 3J81j 3RNUA 1I5FA 1IBKQ 1I94Q 3S17H 1A63A 1P8LA 1UWVA 3PO2G 1J5EQ 1KAWA 4A3IG 4HJ5A 3KF6B 1J6QA 1LYLA 4P74A 1VQ6A 3HOZG 3PF4A 1PFSA 4GKKQ 4LFBL 1EIFA 2K52A 1N33L 1Z9FA 2C35B 3CCLA 2JA9A 5BR8L 5LMUQ 3S1NH 1Q81C 2R92H 3DM3A 1K73C 2NVTH 3J81c 4JI1L 1XMOQ 4JI4Q 2E5LQ 1NTGA 2RF4A 3TEHB 1E1OA 1HJPA 4J15A 3A5UA 4KI0A 2QEXA 4DUZL 3F2DA 1YI2A 2IHEA 4DR2L 3KF8B 4PZ7A 1S72A 4A3IH 5GAHC 1M1KC 2JA5H 3GTKH 2PNHA 2D62A 2UXBQ 4AH6A 1J5EL 2NVXH 2R7ZH 4BY7H 2IX1A 4JI7L 2Z6KC 2YYZA 4KHZA 1Q46A 4BBRG 3RZDH 1XJVA 2Y0SG 1SROA 2E8GA 1HNWQ 4A3BH 5IYCG 3ER0A 4LW1A 1XPRA 1PH7A 3CAMA 2R7DA 2VQEL 2E5LL 1Q1EA 1KL9A 5EAYA 1R9TH 1QUQA 4L5TA 2JJQA 3EIVA 5LMNW 1KHIA 2AHOB 2JK8A 1CKOA 4XIGS 5BR8Q 2CKZB 4QJFA 5E7NA 1KRTA 4DV2Q 3CCVA 4NXNQ 2HQLA 3HKZE 4OO1G 3UDXA 4HJ9A 4OONA 3NENA 3T1YQ 1HNXQ 2UUCQ 1E3PA 4HJAA 4AQYQ 3HOUG 1AH9A 4DR7Q 4GNXB 5DLQE 1RIPA 3DLLA 3HOWH 1YHBA 4LF8Q 5M5YH 1TWHH 3AQQA 4BY7G 4P75A 1L1OB 1UE5A 4B3SQ 1IXRA 3MEFA 4JI8Q 2HHHL 3F2CA 3S15H 5AJ3L 3OTOQ 3NEMA 3VDYA 4O2DA 3L0OA 4DK3C 2Q2IA 1YITA 1K8GA 3GTPH 1HZ9A 4WJ3M 3IRBA 1EWIA 4BY1G 1XMOL 4UP7A 4B3TQ 1H95A 1YNXA 3HKZG 2UUAQ 4QGUA 2Q2TA 4H02A 4GOPB 4UP9A 1VQKA 1AE3A 3BU2A 4DAYB 1G51A 2NZOA 3KLWA 4RMFA 3G6EA 4AQYL 3T1YL 1HNXL 2ATWA 2PI2E 2UXBL 3CD6A 1IBML 4IFDI 4PG3A 1X6OA 2OTLA 4X65L 1LM0A 2CFMA 4DR4L 2VZAA 1W2BA 2A19A 2VQFQ 4IOAA 3F8TA 4IPHA 5JEAG 4JI2L 4DK6C 2I5LX 2BA1A 3KOJA 4DV6Q 1FJGQ 3GDEA 4A3KH 4IPGA 4JBKA 5C0XJ 2CCZA 1X9NA 5C4XG 2UXCL 4A3LG 4DNIA 2VS1A 1N36Q 1SN8A 2RHQB 4FDBA 3RZOH 1FVIA 3RLFA 3CC4A 4A3DH 1KIXA 2OTJA 1XNQQ 1HR0L 4JI7Q 3FKIH 1OXUA 4Y7NH 1EYGA 2OWOA 1KXLA 1E7ZA 1BVSA 2OCEA 3K80C 5J3BA 3J80c 4A3FG 4JI3Q 3M4OH 4LUVA 3G4SA 2AMCB 3CCRA 4DV3L 1OTCA 1C0AA 3CCQA 3TQYA 4A3MH 5IYDG 4POGA 4OX9Q 4A3DG 1V9PA 2Y0SE 3KJPA 4BBSG 1CKNA 5C4XH 1FJGL 3K8AA 3WWVA 4DR1L 2R93H 1A62A 4LF5L 1N34L 4IPCA 1NMFA 4KLKA 2R7ZG 2WFWA 5M3FH 4NXNL 1JJGA 3W5OA 2RCNA 1XNRL 3D0FA 2PQAA 4LFCL 4JV5Q 3HOXG 1KQSA 1T9HA 1MJCA 1S40A 1I50H 4LF9L 4KHPL 1JT8A 4LF7L 4YHHL 1HZBA 1XPOA 1Q7YC 3BZKA 4DUYL 3CMEA 4TVAB 5C0XI 5IP9H 1C7YA 1HR0W 1TWCH 5AJ3Q 1YIJA 2UUCL 4A3BG 3GTJH 4BY1H 4LF6L 4L5RC 1VQCA 4GOPC 2JEBI 3KF6A 3SGIA 2E2JH 5IYBH 4WJ4A 3PV0A 3T1HQ 2LXJA 2KBNA 4DV4Q 2VUMG 1HNWL 4YHHQ 4X66L 2ZM6L 1YZ6A 1V43A 3U58A 3TRZA 2JA8H 3CC2A 3HOVH 4IFDJ 1I6HH 1QVCA 1X55A 5GAGC 3HOWG 4IFDG 1B8AA 4B3RL 4NXML 2KENA 1A0IA 1FL0A 3A74A 1K9MC 1YHAA 1VQGA 4R4IA 1K8AC 4LNQA 1PH9A 5IY0A 4A3MG 4A75A 3JC66 4HIDA 4JOIA 4DPGA 3CW2C 4X65Q 3EBEA 3PUZA 4BA2I 4DR4Q 4X62L 1SFOH 1VQ9A 4GLXA 1N32L 4YCUA 5JJIA 3HOZH 2HIVA 2R6GA 4PZ6A 3NELA 2ID0A 4A3GG 3I55A 1D8LA 1K3RA 4JYAL 1PVOA 2F3IA 1HNZL 2IX0A 2R93G 4DR5Q 4JI0L 1JE5A 4DV7Q 1Y1WH 1VQ4A 1VQJA 3S2DH 1YBYA 1X65A 2N8NA 4B3TL 1EUJA 5IYDH 5FLMH 1E22A 1MKHA 3RR5A 4DV1Q 3HOYG 2DUDA 3I4MG 3ULJA 4JI4L 3S1RH 2PMZE 5IYBG 4QL5A 1DGSA 4GS3A 2BH2A 3K7UC 2JQOA 2F4VL 1X54A 2B63H 1HNZQ 3S14H 2MQHA 3E9IA 5IE8A 2B29A 4R4TA 1S3OA 1PH1A 2K5HA 4LUZA 2MO1A 2N3SA 4GN3B 1NJIC 1UE7A 3E0EA 4R4QA 1L2FA 1SRUA 1N32Q 1NBWA 3GTGH 4JI2Q 4BXXG 1B7YB 1G6PA 4NPSA 1EFWA 4GKJQ 4DV1L 2I5HA 3PCOB 2VQEQ 2V1CC 1VQLA 3S24A 2K5VA 4ME3A 5C3EH 4AIMA 4DR6Q 3PUWA 4IPDA 4IJHA 1K83H 1VQ8A 3PUVA 2MNAA 1WFQA 1IYJB 1KC8C 1PH8A 3GD7A 1MJEA 2CWPA 3OYYA 1TWAH 3AYHB 2ZM6Q 1Z47A 2DGYA 4R4OA 1I3QH 1X56A 1WI5A 4B3ML 1WJJA 3EN2A 2CQOA 2LXKA 1PV4A 2UU9Q 4A93G 4L5QA 2UXCQ 3K81C 2F4VQ 2YV5A 1HZAA 3PO3H 1YVCA 4DKAC 4DR1Q 1XMQQ 1B70B 3HKSA 4A76A 2ASBA 4LWCA 2Z6KA 2ZJRA 1Q86C 2JA7G 1O7IA 1Y14B 3RN2A 3S2HH 1G291 2A1AA 2EXDA 4OWXB 4YY3Q 4OX9L 2JA8G 3HOVG 3S16H 4JI5L 4HIOA 1GO3E 1PYSB 4B3MQ 2R7FA 4IJLA 1MIUA 3I7FA 2F52A 1VQFA 3I4NH 4OO1I 2NN6I 3CCJA 3ERSX 3U4ZA 1VQAA 2D0PA 2WP8J 3A5ZB 4DV0Q 1PH6A 4APVA 1VS0A 2B3GA 2KHJA 3K0XA 1GVPA 4GLAC 4LF6Q 4YY3L 4A3CG 3CP0A 1EQQA 4DV6L 4HJ7A 1TXYA 4BBRH 4DV5L 3ULPA 1Q1BA 1NMGA 5C44G 4X64Q 2IT1A 5IP7G 3GTLH 1VQ5A 3HOYH 3GO5A 4GKKL 2L15A 5C44H 2YTVA 3J7ZC 2VL6A 1KD1C 3M3YH 3J81i 3M85A 4DV2L 2K5NA 1IBLQ 1SMXA 5M3MH 3PF5A 4YCWA 3U4VA 3BZCA 4JBWA 5IP9G 2B63G 2UXDL 1BBUA 4YWKA 2PQAB 2QA4A 2NN6G 1XPUA 4AYBE 2E2IH 4B3SL 3GTQH 4B3RQ 1VCIA 2H5XA 1UEBA 2EIFA 4P73A 3KJOA 4DV0L 4GNXA 4JBJA 5M5XH 2WB1G 1CKNB 2Q2HA 4JG2A 4HIKA 2ZTDA 3I56A 1PH5A 4LF7Q 1Q12A 4UPAA 2XGTA
chains in the Genus database with same CATH superfamily
4A3JB 1PFMA 1SNOA 3E9HA 3E5SA 3I90A 4PMBA 4QMGA 2K75A 5HURA 4RGOS 2KHSA 2KCMA 3GTPB 3I73A 4YCVA 3UE0A 4HMJA 4M8AA 1K8OA 5LMNL 1PH2A 2B2VC 4PZ8A 5E4WC 1TS2A 5C4HA 3HG9A 2KOLA 2A6ED 1V1PA 1RCVD 3A56A 3H0GG 1OXTA 5ELCA 1QJOA 1OXVA 3LGJA 1Q8KA 1S5DD 1E0BA 3PUYA 1IKMA 1A2UA 2GN5A 2C5CA 4MNOA 1K0SA 1B2TA 4DR7L 2AQ2B 1PFNA 1OXSC 2PZUA 3Q23A 3QG1A 3S1QH 4JYAQ 5A35A 1ASZA 3MAQA 2CQAA 3NWSA 1B4OA 4LFCQ 3RN5A 1S4ZA 3JAMi 1N8RC 3BVZA 3QIAA 2JE6I 5IWAL 2XN9C 2G5DA 3ONAB 1EY6A 4C3IH 4X62Q 3L7ZC 4GNXC 3Q8DA 3NTKA 1PTOH 4JI8L 5BN5A 5HGQA 2RBMA 4OL7A 5ELOA 5JEAJ 1IBMQ 1NSNS 4JOIC 2FXQA 4X66Q 1X32A 4HJ8A 1XNQL 1HR0Q 1WD1A 4A93H 2IJ0A 1N36L 3FEWX 4GOPA 1MI2A 1YEZA 5I6WA 2E2JB 2K32A 4OELB 4LFAQ 1P16A 2J7ZA 2UUAL 1HZCA 4DAVA 1K0RA 1VMPA 4LJZC 4MN3A 4BBSH 3V96A 4FO2A 4XT1B 3CMAA 5DEHA 2IPKD 5C4XB 3OW2A 2Z6BA 1VQ7A 2RHSB 3CCEA 3NPPA 3UDGA 2YTXA 3FKIG 5CBEE 2BOSA 3NBIA 2Z9HA 1ONLA 3PSIA 4GN4B 4UP8A 5C4JH 1A2TA 3PGZA 2KCCA 1DOKA 1TVXA 4MZ9A 1KAAA 3D31A 3CPWA 2DJGC 3Q0AA 2N78A 4FP5D 3FP9A 4X3TA 2O5IC 2EZVA 3G71A 4EQPA 2IX3A 1DM0B 1XTDA 2ZJPA 4DV7L 2PI2A 1M4VA 3SK8A 2L9HA 1SLJA 4OXPA 4ME5A 1YHQA 2JA5G 1TWHB 3GP7A 3AB9A 4JPBW 1CSPA 3R93A 1N33Q 3UDFA 1K83B 2JA5B 4A3GH 1SYFA 1B3AA 1KLUD 1HH2P 3VR2A 1X3GA 3J80i 3H3VH 4CJ0B 4DR6L 1LTLA 3M4QA 3ICEA 3UI2A 1HHVA 1TS4A 1AE2A 1VQHA 3HGBA 5TSSA 3SK6A 1I5FA 1SJHD 1TU2B 3CHBD 1A63A 1PMRA 1J5EQ 1PDQA 1TS5A 3KF6B 3HOZG 2Z8LA 1FD7D 5IGDA 1RD9D 4GKKQ 3BVMA 2C35B 3CCLA 3S1NH 3I91A 3SXHA 3KF8A 5C3EB 1TWCB 1PZJD 4JI4Q 2E5LQ 2EY1A 1HJPA 4KHVA 3C2PA 5IGBA 2B2YA 5DNFA 3OOCA 2RSOA 4JI7L 3RZDH 2JXMB 1XJVA 1SROA 4ZKBB 2F3VA 1AP0A 5CV8A 2VQEL 1CT1D 3TDQA 5EAYA 1R9TH 5LMNW 1KHIA 5BR8Q 2CKZB 5DM63 3HKZE 4HJ9A 2K6AA 4OONA 3NENA 3HOUG 3OPOA 1EZ6A 3DLLA 1YHBA 4BY7G 1TWHH 3AQQA 4P75A 1L1OB 2HHHL 2UUCQ 3OTOQ 3VDYA 3J7AF 3L0OA 1Y69U 1HZ9A 1CZGA 4WJ3M 1XMOL 2WAQB 5E4XA 1O7ZA 5G3LD 3J7AV 2Z4IA 2UUAQ 1Y8NB 2SNSA 2OF1A 5C44B 1AE3A 2NZOA 3T1YL 4RMFA 1HNXL 3PQIA 2UXBL 1WD0A 1LTID 3CD6A 1O80A 1IYVA 1SYBA 1Q3LA 2DY7A 2F0KA 1LM0A 4DR4L 4R9WA 1W2BA 2VQFQ 4K5VA 2TMPA 3N52A 3F8TA 4IPHA 3T56B 4IQZA 3KOJA 2QDBA 2WKCA 3GDEA 3NXWA 4UHVA 1X9NA 2VS1A 4RCOA 3RZOH 1JORA 1EL0A 3A7LA 3DWAA 1PRTC 4HN7A 1EYGA 2OWOA 3S9WA 5J3BA 4TRDA 2EYMA 4LUVA 1OTCA 5JPNC 2K5QA 5KGUA 4A3DG 4JK1C 3KJPA 1SNPA 1FJGL 3WWVA 4LF5L 4IPCA 4CJ1B 5COYA 4KLKA 4C3IG 3G6JB 2WFWA 1DD2A 3D0FA 4PV1C 4LFCL 2A73B 2QF7A 4YHHL 1HZBA 2Y0SB 3CMEA 1SJED 1NCVA 1YIJA 1ESRA 3GTJH 2PW7A 4BY1H 2JSOA 5JEAH 1C48A 3PV0A 1HA5A 3S1QB 2K1BA 4AYBB 3EJIA 5T1IA 4YHHQ 4X66L 1V43A 3HOVH 3CC2A 4IFDJ 1QVCA 3FDTA 1ENFA 2KENA 4RHRA 2L5TA 5E1FA 1K9MC 1YHAA 4R4IA 3VYSA 2EJGC 3JC66 4HIDA 4DPGA 3CW2C 4X65Q 1GJXA 2EPBA 5AFWA 1N32L 5JJIA 1KDBA 3TP7A 3HOZH 2ID0A 1PRTB 3I55A 1A15A 4JYAL 1F2LA 2NTTA 2F3IA 1CHQD 2A68D 4DR5Q 1Y1WH 1B50A 3S1MB 3S2DH 1YBYA 2F0OA 1H9KA 4B3TL 1LABA 4F87A 2D9UA 4KKSA 4LMQD 3ULJA 2N88A 2PMZE 4QL5A 3J7YW 1SAPA 4BS9A 2JQOA 1STAA 1RTOA 2EE1A 2F4VL 2B2WC 1ILPA 3OHXC 1JWSD 3E9IA 2J0TD 1PH1A 3DMUA 5EBDA 2MO1A 4GN3B 2JYOA 1D5XC 4BXXG 2FHTA 4K5XA 4GKJQ 4DV1L 1QCBD 4N8X1 4ME3A 4AIMA 2F0VA 4TSSA 2MNAA 3GD7A 2A74C 1TWAH 1PRTF 4QB4A 2ZM6Q 2RDFA 4Z9CB 1WI5A 3LNNA 3H0GB 1PV4A 3P7JA 5CMDA 2RKSA 1LV9A 4RGTA 5M3MB 5KYLA 1YVCA 1B70B 2QDLA 1BNZA 3NQIA 4ID6A 4A3EB 2L11A 4LWCA 2Z6KA 5FOBB 1O7IA 1Y14B 3RN2A 3QB3A 3K58A 4OX9L 2JA8G 5KNBA 2R7FA 1QNUA 4IJLA 3I7FA 2KVMA 3J80E 1DXMA 2NN6I 3CCJA 3OWFA 4O42A 2PMZB 3U4ZA 4A3GB 2QW7A 1VQAA 4ZUJA 4FXDA 2KHJA 4ZUIA 4BWGB 2J4XA 2MJ8A 5C5LA 1EQQA 4DV6L 4HJ7A 1XWEA 4BBRH 3SVMA 3ULPA 1Q1BA 2IT1A 4FNFA 4IURA 1WTWA 2EYFA 1DOMA 1I4GA 2L15A 3M3YH 3M85A 1PFBA 4DV2L 1G6ZA 2EY5A 3PF5A 3U4VA 3BZCA 5IP9G 1BBUA 5KRUA 3GTMB 5CV5A 4B3SL 1AEXA 2H5XA 2JA6B 2HQEA 3K5LA 5M5XH 2B2TC 2WB1G 4HIKA 4CKEA 4UPAA 3J81L 4ZKCB 2MP1A 2XGTA 2GVBA 1BUVT 3I2ZA 3IL8A 4OEMB 2WIIB 1VQMA 5NUCA 1QZHA 3M9BA 3W1GA 4NP5A 2MUYA 5IP7H 4C3JH 1R9TB 4FYDA 2N49A 3H15A 2E2DC 4A3EG 2YU9B 4NB3A 1FYCA 2NVYH 1LT3D 2JA8B 2L55A 1I94L 4N9PA 1QZGA 4IUNA 2K4KA 1TQOA 4PMCA 1JJ2A 2HHHQ 4KKUA 3HRZC 1JOKA 1N9WA 5IT9c 1EOVA 3V05A 2JA7H 4JI1Q 4K0KQ 1LUZA 5E3FA 1IW7D 5J22A 3P1HA 1W3SA 1JB7A 5I9PA 1X3QA 2FJ2A 2ES2A 1CM9A 1Y1WB 1VQEA 1TY2A 3S2DB 4HAEA 2E75C 1F2MA 1JMCA 3PO3B 2IWHA 3KFUA 3T53B 1CZWA 1A3VA 2VXWA 3PIOA 1U5KA 2BE5C 4NMZA 5HY6A 2D0OA 4DR3Q 5ISRA 1H9JA 3PO3G 3RZOB 1V8QA 2PZWA 1QUQB 4GN5A 1CI3M 3GV3A 4EVOA 3P75A 4KY7A 4UY8C 3MA2B 3K59A 1E2VA 1PRTD 4R4CA 4HTHA 3ULLA 1NY4A 2R92G 1ML0D 4JI6Q 1IBLL 3NBHA 1UUPA 1II3A 2OQ0A 4MTNA 3F1ZA 4QY7A 2VW9A 2KCTA 4LFBQ 4F88A 4NKLA 3H09A 2VB2X 3MXNB 4X6AH 1FGBD 5M3FG 3KLSA 4KJOA 3BDOA 1L1OC 2NVQH 2K50A 3F2BA 4POFA 1CKMA 2LSSA 1GM5A 1JCKB 3J7A5 1YJWA 1IHZA 4JBMA 1SBBB 1XXGA 3TS2A 2WB1E 1EQTA 2CWAA 3FPPA 5C3XA 4LF8L 5FLMG 3L2PA 1OXXK 5K36H 4NXMQ 4ZYSA 4A93B 4GLVB 4XDXA 1L0XB 3ZJYC 2ZT9C 3K5OA 2I0QA 3QJYA 5H1SE 5K36G 1EIYB 1QVFA 4RG1A 3I4OA 2ZJQA 1E24A 1PYBA 3G7LA 3GTJB 4PMWA 3LWEA 1R4QB 1KNAA 2B2UC 4K6LA 1SE8A 4YIJA 3KBXA 1CA6A 1PH4A 2KHIA 1EYCA 3PMFA 2WAQE 3CKIB 3FHWA 2F0DA 3CQZH 4JVZA 4V190 2K04A 1QWYA 3MXUA 4L5SA 4YWMA 2B2WA 5IOCA 3KDFA 5D14A 4IOCA 2UXDQ 3TN2A 4LF4Q 3CC7A 3S16B 4IUUA 5CR3A 1XMQL 5EGTA 3L3OC 1VQBA 1YJ9A 5M5XB 4NW2A 2NTSA 4JI3L 4A3JH 5CV6A 4LFAL 4KD3A 2YTYA 2FFKB 4K0KL 1O7LA 3MXNA 2AWNA 4IUVA 1BCPC 4A4IA 4FF2A 1YJNA 2E2HH 2MO0A 1V1PB 3HOYB 3AU7A 3J81j 5JPMC 3RNUA 1I94Q 2NVYB 1P8LA 3PO2G 2NVQB 1KAWA 4A3IG 4HJ5A 2K01A 5IT9E 1VQ6A 1SMYD 3VR6A 1D5MC 4CDCC 2K52A 5BR8L 5LMUQ 1Q81C 3DM3A 1K73C 1SNDA 4EQNA 2OEOA 2ZXOA 4JI1L 3TMEA 1XMOQ 3S15B 2RF4A 3TEHB 1E1OA 4J15A 2QEXA 3F2DA 2IHEA 4DXGA 4A3IH 2F0FA 5GAHC 1M1KC 2JA5H 2PNHA 2UXBQ 1FNVA 4AH6A 1UEAB 2PCFB 1EZ8A 1AZQA 2Z6KC 3PIP3 1HNWQ 2Y0SG 2D5DA 3GV6A 1BQQT 1ENCA 3CAMA 2R7DA 4H7BA 2BE5D 3T13A 1SE3A 4CDFC 2MHVA 3URYA 5E7NA 4NXNQ 2JN4A 3T1YQ 1HNXQ 1E3PA 4HJAA 5CGKA 3MXPA 1D1KA 1RIPA 5I2YA 2PQEA 4LF8Q 1FNUA 1AN8A 1UE5A 1ZYRD 4A3MB 2XSCA 5L37A 3R8BA 5A2QE 4ZLTF 3JAML 5AJ3L 4HEDA 3OMCA 1I4XA 3HKZG 1R4PB 5KYIA 5C6AA 3BU2A 2EYLA 2BH2A 2K5WA 2PI2E 2XWJB 3QOJA 3DWQA 1VDZA 4PG3A 1X6OA 2OTLA 1RKNA 1PXUA 1JE4A 2VZAA 5FK9C 5EJWA 2A19A 5JEAG 4JI2L 4DV6Q 1W6JA 2BA1A 2RQXA 1FJGQ 4IPGA 5EBCA 4X3UA 2RHQB 4L8JA 3NTHA 4FDBA 2LFNA 3KLSX 1KIXA 4OHJA 1JICA 1H9MA 3WOFA 4CJ2C 1W6KA 4RWSC 4H44C 4A3FG 3CCRA 2AMCB 5BN4A 3CCQA 2A6EC 2EY6A 3NQTA 1HTPA 1V9PA 1CKNA 1STHA 4DGZA 4C3JB 2R93H 4DR1L 3MC0B 5CYUA 1SFOB 1JQYD 5M3FH 1JJGA 5CBAE 1IKLA 3CQZB 3HOXG 1KQSA 1MJCA 1I50H 2A5HA 1MHWC 5J1ZA 4LF9L 2Q8TA 1IW7C 2TSSA 2B39A 4ZRZA 1SXTA 4TVAB 1AFPA 4H0LC 2NUCA 1XTCD 2LS01 2A69D 1RTNA 3QOLA 4L5RC 1STEA 5IYBH 2LXJA 5A2QL 3HP3A 2VUMG 3GTKB 1GHKA 1YZ6A 3U58A 3TRZA 1BR9A 4FXGC 4IFDG 1LO5D 1A0IA 1VQGA 1HUMA 3VR5A 4CBVA 1K8AC 2EJFC 3VR4A 4K14A 3NHHA 4JOIA 3KLRA 1WTRA 4BA2I 4DR4Q 4X62L 1VQ9A 4GLXA 4YCUA 1WVLA 1MSHA 2HIVA 2R6GA 1K3RA 3T4AC 1LLRD 1PVOA 2IX0A 3S1NB 1X65A 3R3OA 5IYDH 3RR5A 4DV1Q 3I4MG 1PTOF 5IYBG 1UAPA 5ELDA 3K7UC 3ITPA 3HS0C 2B63H 3P20A 2MQHA 2F4IA 1S3OA 4DXFA 1NJIC 3ERQA 4HMIA 1WTPA 1NBWA 3HOXB 3GTGH 1GUOA 1B7YB 4CDEC 1A3UA 3PCOB 2DN8A 3S24A 4CHTB 1SE4A 1Z7TA 3CU7A 4IPDA 1VQ8A 1WFQA 3OYYA 3SK5A 1I3QH 1WJJA 2LXKA 2UU9Q 4L5QA 2WKDA 2HCCA 4C3IB 4DKAC 3HKSA 5ELBA 1K3BC 1STGA 1DZ1A 5CV7A 5IODA 1PTOB 1EYAA 2KCNA 4R8NA 1G291 2A1AA 2EXDA 3S16H 4S3SA 5EPLA 1NUCA 1PYSB 2KA7A 4OO1I 1VQFA 4DFAA 3SR1A 2B8FA 2K5DA 1QOHA 1EY8A 1G8ZD 1LT6D 2L12A 3K0XA 4GLAC 3MEHA 1ICWA 4F7XA 4DV5L 3NSWA 5C44G 2CH4A 1KDCA 5D65A 1VQ5A 3HOYH 1I4RA 1TWAB 4GKKL 2D2CC 3SHLA 2N55A 3J7ZC 2VL6A 3J81i 3A7AB 1I4PA 1JOOA 5M3MH 2NYZD 1SMYC 4ZQ3A 1TWGB 2MPMA 2UXDL 1D1IA 2PQAB 1BBXC 1XPUA 1BO0A 2RDGA 2R93B 3GTQH 4DAPA 2OT2A 4DV0L 1UEBA 4P73A 3IFDA 3A55A 5M3FB 4I65A 1CKNB 2Q2HA 3I56A 1CFMA 1M90C 3NUCA 3PIO3 4K2KA 4PNYA 2F0WA 4G57A 2K14A 1X3FA 3TS0A 3JAMc 1TWFH 1E2WA 3STBC 4A3DB 1ILQA 1L1OA 4A3IB 2K28A 5IGCA 5M5WH 1QB5D 4KHPQ 4A3CH 3MVVA 2I46A 4RKBA 3HOVB 1VQIA 3NTIA 2X6LA 5FLXE 3K6OA 3QWNA 4DR3L 1A8VA 4OWTB 1LT4D 1PZID 3GTMH 4QIWB 4GKJL 2ICEC 3UE1A 4IUQA 2QGQA 3KUPA 4I7ZC 3E0JA 3M4YA 2SNMA 2NBFA 1TY0A 1NNXA 1SNMA 1VQOA 2BDNA 2NB0A 2HD3A 1JWUD 4KTAA 4X3SA 3X3MA 1AW7A 4NDXA 3KYHC 5JJZA 4ZK9B 1KLGD 2Z0SA 5IYCH 1C9OA 4EQ5A 4M1UB 4A3KG 2UU9L 3M4PA 2YU9H 3ND8A 1STBA 5ELFA 2VUMH 4JI0Q 3NP8A 1SEBD 4HSPA 3D6CA 3A8JE 3T1HL 3X3NA 2DJFC 4DV4L 1CQFA 1HTLD 3U9SA 1B9MA 2EYPA 2KJXA 4LF5Q 1EOTA 2F0QA 5JVG3 4ALPA 3EVQA 1JR0D 2VQFL 2F0PA 2LMCB 2HT1A 3HFZB 3CCSA 4MTKA 4L6TB 2EVBA 1EQRA 1WOCA 2EY2A 1H9RA 4J1MA 4KKTA 3GTOH 3H0GH 1CSQA 2RCFA 4DV5Q 1SR3A 1RF2D 5C0XG 4XYOA 4O0AA 3D4RA 1BXTA 4A3EH 1S5FD 1IL8A 2EYJA 4JC0A 5IGEA 5GAEC 5C4ZA 4XXEA 3S14B 3H6MA 3U9OA 1JJCB 2I5MX 1Y1VH 5M3MG 4KV6A 4C3HG 2BH8A 3CCMA 3FKIB 5LMNQ 1VMCA 3C1EA 3S1MH 3M7NA 3DM1A 1UE1A 2O2LD 3B6YA 1RL2A 3TP5A 1ASYA 1WCMG 2PPBC 1I4QA 3OIQA 3RLOA 3H3VI 3CRKC 4KD4A 3U50C 3KDFB 1WCMH 4LF9Q 3AFQA 4JV5L 4JI5Q 2L1BA 3BVGA 1M8AA 1TWGH 1QVGA 3A54A 3MXGA 3J81E 3IAYA 1MD2D 3CPFA 1NE3A 1SYGA 2A69C 2JA6H 5HGTA 5IWAQ 3RLNA 5DM73 1B53A 3OIPA 1G2TA 3FMCA 3I70A 1Q82C 1BKBA 3M7GA 1IBKL 2K03A 2SOBA 5KEEA 3SDZA 1PH3A 1H9SA 5GQOA 2AWOA 4JCVE 1GUTA 3RUZA 3VYRA 4FF4A 1X3EA 2BA0A 2XRQD 3STBD 3OTOL 3G48A 1UE6A 2JA6G 1LTSD 2OXPA 4DV3Q 1Q8IA 3MWYW 3CCUA 2B63B 1DJRD 2E2IB 4DK0A 2KEDA 5FLXL 1IBKQ 4QUCA 4B9WA 1UWVA 4E6IA 3I4NB 3MZ5A 1J6QA 1QNKA 4B08A 3PF4A 1J9OA 2ZXPA 1PFSA 5G3LF 4ULLA 1EIFA 4DA2A 2A6HC 3IKJA 2R92H 2JP1A 3OW7A 3FRPB 1NTGA 2JA7B 2VB3X 3A5UA 4DNTB 2NZ1D 4DR2L 2NVXH 2R7ZH 4L63B 4UAIA 1F9SA 3NE5B 2IX1A 4KHZA 3QR8A 4OIKA 2XRSD 2E8GA 3F2UA 4A3BH 5IYCG 1PH7A 2F1MA 3GQBA 2Q8RE 4CKBA 2HUGA 1Q1EA 1KL9A 4EGVA 3EIVA 1YNJD 2AHOB 2JK8A 5I2XA 1KRTA 4QJFA 2VUMB 1GHJA 1I4HA 3CCVA 4DV2Q 1WTVA 3K5MA 3A8IE 3TZUA 5LL6X 1DONA 2NWGA 4EQOA 1AH9A 5KIXA 1RDPD 5T1GA 5M5YH 4B3SQ 1IXRA 1F2YA 3MEFA 4JI8Q 3S15H 1YITA 3NEMA 3GTPH 5K5PA 2KUMA 3IRBA 1EWIA 4BY1G 3DEOA 4B3TQ 1H95A 1YNXA 2K05A 1L0YB 4QGUA 2Q2TA 3D6WA 4H02A 4UP9A 1VQKA 3G6EA 2EDGA 3KLWA 4K6DA 4AQYL 2F0HA 3K57A 4C1NK 4IFDI 2Q8IB 3D4WA 4CDDC 4FVMA 2I5LX 3GTQB 4A3KH 1BCPF 4JBKA 2UXCL 4DNIA 1SN8A 4A3DH 1FVIA 2B8GA 3RLFA 3CC4A 4GZYC 2OTJA 2PNRC 2HCIA 2PZTA 1LTRD 4JI7Q 2KQ3A 4Y7NH 1E7ZA 2AQ3B 2OCEA 1EY0A 4JI3Q 3C46A 3G4SA 1DYQA 3VYTA 1ET6A 4A3MH 1C0AA 4POGA 3VR3A 1G2SA 1B44D 4G7HC 1EIHA 1I6VC 2WV6D 1A62A 1SNQA 3D3RA 5EKIA 2RCNA 3K5NA 4JV5Q 4G4KA 4A3BB 1T9HA 3WOEA 3K7AB 3Q6SA 1CTMA 5C0XI 1A3TA 1C7YA 5LL6S 1TWCH 5D3IB 1HR0W 3W3AA 5LHY1 2UUCL 4A3BG 4BBRB 4K5WA 2RSNA 3MFGA 4LF6L 4GOPC 4WJ4A 3SGIA 3KF6A 4Q0FA 2E2JH 2KBNA 1HNWL 1KABA 2ZM6L 1JOQA 1TS3A 4G7OC 4CKCA 5GAGC 2F0NA 1B8AA 1SE2A 4TKOB 1FL0A 1ICFB 5J39A 4LNQA 4A3MG 4A75A 3VYUA 1H9SB 3EBEA 1SFOH 1WTOA 2ENBA 1ET9A 4IALA 4A3GG 1D8LA 4MIUA 3TP6A 5DAUA 1LTBD 1LTGD 3K0YA 2F3WA 2R93G 1JE5A 4DV7Q 2ICIA 2N8NA 1EUJA 4IN3A 1NR4A 1E22A 1MKHA 3HOYG 2B2UA 1AZPA 4HCSA 3S1RH 2R61A 1CK1A 1X54A 3S14H 2NVXB 3GTOB 5C0XH 4KK7A 4R4TA 4LK1C 2AUKA 2K5HA 2N3SA 1EEID 3E0EA 3PO2B 1Y1VB 2EJMA 4JI2Q 1GUGA 1G6PA 2V1CC 1VQLA 3BDLA 2K5VA 2DNCA 1Q90A 4DR6Q 2R3ZA 2WB1B 2AUJD 1A6XA 3EFXD 1K83H 2O5JC 3PUVA 5CC4A 1PH8A 1IYJB 1EY4A 4UDUC 1MJEA 3AYHB 1SYEA 2DGYA 3D8GA 1EU3A 4R4OA 3AMUA 1X56A 2WACA 1GUSA 2F0SA 1G91A 3EN2A 2CQOA 3HZXA 5FO7B 4RA8A 2UXCQ 3K81C 1HZAA 2RDHA 1U4RA 3PO3H 4DR1Q 1XMQQ 2PO4A 5IGGA 2F03A 1GXDC 1T5EA 4RKLA 2JA7G 1HRJA 4QUFA 4OWXB 4YY3Q 4XQNA 2XWBB 4JI5L 4HIOA 1SYCA 4O1NA 2K7VA 2F52A 4H13C 2BDOA 4DU9A 1HFGA 1SYDA 1T5XD 1U4LA 2F0UA 4DF7A 3ERSX 3A5ZB 4DV0Q 4FXKC 4CGYB 4A3CG 4YY3L 2QILA 2DNEA 1MGSA 4RCNA 1KTKA 4KY5A 5KNCA 4A3KB 4KN4C 1NMGA 5IP7G 1RODA 3GO5A 5ELEA 1QG7A 2IL8A 3FPUB 2L0CA 1IBLQ 2IW3A 2B63G 3C1FA 1E2ZA 2QA4A 2NN6G 5FO9B 2E2IH 4KN7C 1VCIA 2G9HD 2EIFA 3KJOA 4GNXA 3HOZB 4U673 4JBJA 3DHQA 2LKVA 1LTAD 3TZDA 5JJLA 3HOWG 2HDLA 4JBWA 2R7ZB 1TR5A 3K7AH 1JB3A 5C3EG 4DR2Q 3W1BA 4RFBA 1CUKA 1DCZA 1EYDA 1GKHA 1U9RA 1WYDA 3ZYYX 4N9TA 5EPJA 4Q5VA 4BA1I 5GADC 4XQJA 3SEBA 1EY9A 1O78A 4C2MH 2IHFA 4HR7B 4OWWB 1IL2A 2EYHA 2EQSA 5FJ8G 1VQNA 3NBHB 1YNJC 3M4OB 3TBIB 2B2TA 3BYYB 1PTOD 4R1JA 4TQUS 4RGNA 4I7AA 5ELNA 2A6HD 1YNNC 1Y1WG 2CH4W 1ZYRC 3H3VC 4DUYQ 5FJ8H 3I3CA 1GD7A 3LX0A 1WTXA 1XNRQ 3BJUA 1V1QA 2VY3A 3DEPA 4A3FH 4BY7B 3Q22A 2CW0D 3E3XA 1TKWB 1CQVA 2ZTEA 4LUOA 1XX8A 1S5ED 3S1RB 2WAQG 3A0JA 2ALYB 3DUZA 1MBYA 1HFNA 4C3HH 4QCLA 3EA6A 4EX5A 1HCZA 1CHPD 3MFYA 5M5WB 2AKWB 2L4NA 4QIWE 4K2LA 3HOUB 4DR5L 3AFPA 1RHPA 1U0LA 4BXXH 2EOTA 4IO9A 2PYKA 2F0MA 4C56C 5FLXc 4DUZQ 4V0BA 2BCOA 4XYQA 1Y8OB 2GVAA 3HOWB 2EXZA 1KRSA 4LF4L 2UUBQ 4JW0A 1TIID 4C3JG 1WTHA 2HIXA 3AEVA 5JJKA 2A68C 3T51B 5LMUL 3I4MH 1ZXTA 3JAME 3I4NG 4DN4M 3BS1A 1VQDA 5EKKA 2UUBL 1DOLA 4HIMA 1K28A 5FKAC 3PIPA 2QCPX 1FGUA 2NZHA 4RHSA 3I72A 4WJWA 2XTIA 5D3DA 3NK9A 4P71A 4DAMA 2X69A 1PHJA 2XIWA 1D7QA 1ENAA 1LACA 3DXJC 2IY5B 1BF4A 5FO8B 2WINB 2M9VA 1EQVA 3SE0A 3HEJA 1Y1VG 1TT2A 2F0IA 4OIJA 5F2DA 1SDFA 4R8IA 3O13A 1VQPA 2F0TA 1O7YA 1EIGA 2Z4HA 3CF5A 5M9OA 4FF3A 1D6EC 3DWPA 2A8VA 4A3LH 5C5MA 2I07B 5CV4A 3KK7A 4P72A 2FINB 2Q2UA 3SK4A 2M2LA 3UDIA 4KMUC 2F0JA 3J80L 3HOXH 2JEAI 3FVQA 3GTGB 1BBWA 1E1TA 1KDAA 2VNUD 2E74C 1SNCA 2MFIA 5JOBA 4JI6L 4AYBG 2E2HB 2OQKA 5GROA 4BY1B 4RH6A 3RD4A 3CXCA 3HOUH 1B9NA 3PUXA 3GTLB 2ZTCA 3NWTA 4RAUC 1S5CD 2P5ZX 1I6HB 4YWLA 4OGQC 4X64L 1N34Q 4A3JG 3PO2H 1IZ6A 4WORA 1PA6A 4U68A 4Y52H 1L0WA 3WDNA 5I9OA 3IFTA 4QQBX 4XTCS 3TREA 3Q24A 1KNEA 4F8MA 5I4DA 2H1EA 3S17H 3D4DA 5CORA 4KY6A 4P74A 1EY5A 1LYLA 3W2DA 1PLFA 1EU4A 2CHBD 4LFBL 1N33L 1Z9FA 2JA9A 1VF7A 1YNND 2NVTH 3J81c 3R2TA 3H91A 1EWCA 1Y8PB 5JAVA 2KEEA 4KI0A 2E76C 4DUZL 1YI2A 1BCPB 3KF8B 4PZ7A 1EEFD 4ABNA 1S72A 3GTKH 2D62A 2XVSA 1J5EL 1F77A 4A3FB 4BY7H 5EQ0A 1QE6A 2YYZA 4BBRG 1Q46A 5I6YA 1F2ZA 2QEJC 3ER0A 5CV9A 4LW1A 5EPKA 2K33A 1XPRA 2Z1CA 4DNRB 3TSSA 2E5LL 1QUQA 2HDMA 4L5TA 4C3HB 2JJQA 2NN6H 1CKOA 3EROA 4XIGS 2HQLA 5IT9L 3UDXA 4OO1G 4AQYQ 4DR7Q 4GNXB 5DLQE 3HOWH 4ODGA 1B1ZA 4IUTA 1PYWD 4FF1A 3F2CA 3OWEB 4O2DA 4DK3C 2Q2IA 1K8GA 1XYIA 1TWFB 2ZXRA 4UP7A 1QILA 2KECA 3BYTB 4GOPB 1PZKD 1G51A 4DAYB 2ATWA 4ZCKA 1C8CA 3V2TA 1IBML 4KJNA 4X65L 2CFMA 3HKZB 3N6RA 4LAAA 3R2IA 2LY7A 4IOAA 2B2YC 3EQLC 4DK6C 3BDCA 1WTQA 4XT3B 5C0XJ 3S17B 2CCZA 5C4XG 1ZEQX 3I8ZA 4A3LG 1N36Q 1VF5C 1STNA 4P2CB 3T16A 1OO9B 1I3QB 1XNQQ 1HR0L 1D5ZC 3FKIH 2MGSA 1OXUA 2DY8A 1KXLA 3M3YB 1BVSA 3K80C 3M4OH 5M5YB 3J80c 1LT5D 5IGFA 1UNSA 3L9AX 4DV3L 3TQYA 1C4QA 5IYDG 4OX9Q 4K8JA 3OSOA 2Y0SE 3A8KE 1HXYD 4BBSG 5C4XH 3K8AA 4C2MB 2V4DA 1JWMD 1N34L 1NMFA 2R7ZG 4NXNL 3RMHA 3W5OA 1WCMB 1CA5A 2PQAA 1XNRL 2M00A 1S40A 4BBSB 4KHPL 4XQQA 1JT8A 4LF7L 5C4JB 1XPOA 1Q7YC 3BZKA 4DUYL 4IUPA 5JVH3 2CVRA 2RA4A 4IZ8A 5BN3A 5IP9H 5AJ3Q 4IFDH 3KBGA 1VQCA 2JEBI 3S2HB 1F9PA 2O4XA 3T1HQ 4DV4Q 1ESFA 1D2BA 3BZDB 2JA8H 1I6HH 1X55A 1BDOA 4J8QA 5C3WA 4NXML 4B3RL 2F0EA 1HA6A 3A74A 4OO1H 1F9RA 1EFID 1PTOC 2H4OA 1PH9A 5IY0A 5IIFA 4DAYA 1B3QA 3PUZA 1HPCA 1K8MA 2GA4B 4ILWA 1EWHA 4PZ6A 3NELA 3TP8A 5EKLA 4WFN3 1NAPA 3I4MB 1HNZL 1F9QA 4JI0L 1VQ4A 1GUWA 1VQJA 2R92B 1GOZA 2CW0C 5FLMH 4QF4A 1X3PA 1FR3A 1STYA 2DUDA 2RVLA 4JI4L 1DGSA 1V1OA 4GS3A 1EY7A 2PW5A 2F0GA 1HNZQ 4N8FA 3QO2A 4G7ZC 5IE8A 4HSVA 2B29A 4LUZA 1BCPD 1UE7A 4R4QA 1L2FA 1SRUA 1N32Q 1HUNA 4K8IA 4NPSA 1EFWA 3VA7A 3LWUA 1IYUA 1SSOA 2I5HA 2VQEQ 3BG3A 5C3EH 4X3KA 3PUWA 4IJHA 4PQXA 2FMCA 4ZAIA 1Z6HA 3E6ZX 1S5BD 1KC8C 3C3LA 2CWPA 2SEBD 1Z47A 3OMGA 2QKIC 4B3ML 3H94A 3VA5A 4A93G 4DK1A 2XNAC 2F4VQ 2YV5A 4A76A 2ASBA 3S2HH 2ZJRA 1Q86C 4RGMA 3HOVG 1HQMC 4C1NI 1GO3E 4J6HA 1FNWA 4B3MQ 1MIUA 3I4NH 3RZDB 1U4PA 1ZKOA 1I50B 1RJTA 2X6GA 2D0PA 2WP8J 2EYOA 1PH6A 4APVA 1VS0A 1BOSA 2B3GA 1JC7A 1GVPA 4LF6Q 1GUNA 3CP0A 1TXYA 2C9OA 4X64Q 3GTLH 2AQ1B 1J8IA 4MHEA 5C44H 2YTVA 1KD1C 4Y7NB 2FMMA 4WRDA 3CRLC 1LTTD 2K5NA 1NR2A 1SMXA 1HQRD 4YCWA 2F0LA 3MTSA 4YWKA 4B9XA 2B2VA 2NVTB 2SDFA 4AYBE 1U4MA 4B3RQ 5KNDA 3I4LA 3MHBA 3ND9A 2G9DA 4JG2A 1PH5A 4LF7Q 2ZTDA 1Q12A 1MSGA 4HCEA
chains in the Genus database with same CATH topology
1M90C 3I2ZA 3E9HA 3K7AH 5C3EG 2K75A 1VQMA 4DR2Q 3W1BA 1QZHA 2K14A 1CUKA 1X3FA 3M9BA 3W1GA 3TS0A 1GKHA 1WYDA 2KCMA 3JAMc 5IP7H 1TWFH 2GVBA 4YCVA 3UE0A 4BA1I 5GADC 3STBC 4C3JH 5LMNL 2N49A 1L1OA 3H15A 1PH2A 4C2MH 5M5WH 4NB3A 4A3EG 2IHFA 4PZ8A 4OWWB 1IL2A 4KHPQ 4A3CH 2EQSA 2NVYH 5FJ8G 1VQNA 1VQIA 3NBHB 1I94L 1QZGA 3H0GG 1OXTA 1OXVA 2K4KA 3LGJA 4R1JA 4TQUS 1Q8KA 4DR3L 1A8VA 4OWTB 5ELNA 1JJ2A 2HHHQ 3PUYA 3GTMH 1N9WA 5IT9c 5JJLA 1Y1WG 2GN5A 4MNOA 4GKJL 1EOVA 3UE1A 4JI1Q 2JA7H 4DUYQ 4DR7L 1LUZA 2QGQA 4K0KQ 5FJ8H 1OXSC 3S1QH 1W3SA 1JB7A 4JYAQ 1GD7A 1ASZA 1XNRQ 3BJUA 1V1QA 2VY3A 4A3FH 3RN5A 2ES2A 3JAMi 1VQOA 1N8RC 4LFCQ 1VQEA 2JE6I 5IWAL 1JMCA 2ZTEA 4LUOA 4C3IH 3KYHC 4X62Q 3L7ZC 4GNXC 2WAQG 3A0JA 5IYCH 2ALYB 2Z0SA 3KFUA 1C9OA 4EQ5A 3Q8DA 4C3HH 4A3KG 4JI8L 4EX5A 3PIOA 5HGQA 5ELOA 2UU9L 5JEAJ 1IBMQ 1U5KA 3M4PA 2YU9H 4JOIC 2AKWB 4QIWE 5HY6A 2D0OA 4DR3Q 3PO3G 4DR5L 2FXQA 3AFPA 4JI0Q 2VUMH 1U0LA 4X66Q 1XNQL 4HJ8A 1HR0Q 4BXXH 4IO9A 4A93H 1QUQB 3T1HL 4GN5A 5FLXc 4DV4L 4DUZQ 2GVAA 4UY8C 1N36L 4R4CA 4LF5Q 1KRSA 1NY4A 3ULLA 4LF4L 2R92G 2UUBQ 4JI6Q 4GOPA 1YEZA 2HIXA 4ALPA 1IBLL 3AEVA 2VQFL 4LFBQ 2OQ0A 4MTNA 2HT1A 3F1ZA 4QY7A 2VW9A 2KCTA 5JJKA 4X6AH 3HFZB 5LMUL 3MXNB 4LFAQ 3I4MH 3CCSA 3I4NG 5M3FG 1VQDA 1P16A 1EQRA 1WOCA 3GTOH 1L1OC 3H0GH 2NVQH 2K50A 1CSQA 1HZCA 4POFA 3F2BA 1K0RA 1CKMA 4DV5Q 2UUAL 2LSSA 1GM5A 1SR3A 3J7A5 4BBSH 1YJWA 5C0XG 2UUBL 4JBMA 3CMAA 4HIMA 3PIPA 4O0AA 1FGUA 2NZHA 4A3EH 3OW2A 1VQ7A 3TS2A 2RHSB 2XTIA 4JC0A 5GAEC 3CCEA 2WB1E 4P71A 4DAMA 3UDGA 2YTXA 3FKIG 2CWAA 1PHJA 4LF8L 1D7QA 5FLMG 1JJCB 2IY5B 2I5MX 3L2PA 3PSIA 1OXXK 4GN4B 4NXMQ 1Y1VH 4GLVB 5M3MG 4UP8A 5C4JH 3ZJYC 2BH8A 3PGZA 2I0QA 3CCMA 1Y1VG 5LMNQ 5H1SE 3S1MH 4MZ9A 1EIYB 1QVFA 3M7NA 4RG1A 5K36G 1UE1A 3I4OA 2ZJQA 1E24A 1PYBA 3B6YA 4PMWA 1RL2A 1VQPA 3D31A 3CPWA 2N78A 1SE8A 3FP9A 1ASYA 1WCMG 3G71A 3CF5A 2KHIA 1PH4A 1XTDA 2WAQE 3RLOA 2ZJPA 4DV7L 3H3VI 2PI2A 2A8VA 4A3LH 3FHWA 3U50C 3CQZH 3KDFB 1WCMH 1SLJA 4P72A 4LF9Q 2Q2UA 3AFQA 3UDIA 4JV5L 4OXPA 4JI5Q 3HOXH 2JEAI 4L5SA 1QVGA 1TWGH 1BBWA 1E1TA 4YWMA 1YHQA 2JA5G 2UXDQ 3KDFA 4IOCA 2VNUD 4LF4Q 3CC7A 2MFIA 4JI6L 4AYBG 1XMQL 2OQKA 5GROA 3CPFA 1CSPA 1NE3A 3CXCA 1N33Q 2JA6H 3HOUH 5IWAQ 3UDFA 3RLNA 1VQBA 3PUXA 1YJ9A 4A3GH 2ZTCA 4JI3L 4A3JH 1Q82C 4LFAL 1BKBA 2YTYA 1IBKL 1HH2P 4YWLA 1X3GA 1PH3A 5GQOA 4X64L 3J80i 1N34Q 2AWOA 4K0KL 4JCVE 2AWNA 3H3VH 4A3JG 3PO2H 1IZ6A 1PA6A 4DR6L 4Y52H 1X3EA 2BA0A 1L0WA 1LTLA 3STBD 4A4IA 3OTOL 3G48A 4QQBX 1UE6A 3M4QA 1YJNA 2E2HH 3ICEA 2JA6G 2MO0A 4DV3Q 4XTCS 3TREA 3CCUA 1AE2A 1VQHA 3J81j 3RNUA 1I5FA 1IBKQ 1I94Q 3S17H 1A63A 1P8LA 1UWVA 3PO2G 1J5EQ 1KAWA 4A3IG 4HJ5A 3KF6B 1J6QA 1LYLA 4P74A 1VQ6A 3HOZG 3PF4A 1PFSA 4GKKQ 4LFBL 1EIFA 2K52A 1N33L 1Z9FA 2C35B 3CCLA 2JA9A 5BR8L 5LMUQ 3S1NH 1Q81C 2R92H 3DM3A 1K73C 2NVTH 3J81c 4JI1L 1XMOQ 4JI4Q 2E5LQ 1NTGA 2RF4A 3TEHB 1E1OA 1HJPA 4J15A 3A5UA 4KI0A 2QEXA 4DUZL 3F2DA 1YI2A 2IHEA 4DR2L 3KF8B 4PZ7A 1S72A 4A3IH 5GAHC 1M1KC 2JA5H 3GTKH 2PNHA 2D62A 2UXBQ 4AH6A 1J5EL 2NVXH 2R7ZH 4BY7H 2IX1A 4JI7L 2Z6KC 2YYZA 4KHZA 1Q46A 4BBRG 3RZDH 1XJVA 2Y0SG 1SROA 2E8GA 1HNWQ 4A3BH 5IYCG 3ER0A 4LW1A 1XPRA 1PH7A 3CAMA 2R7DA 2VQEL 2E5LL 1Q1EA 1KL9A 5EAYA 1R9TH 1QUQA 4L5TA 2JJQA 3EIVA 5LMNW 1KHIA 2AHOB 2JK8A 1CKOA 4XIGS 5BR8Q 2CKZB 4QJFA 5E7NA 1KRTA 4DV2Q 3CCVA 4NXNQ 2HQLA 3HKZE 4OO1G 3UDXA 4HJ9A 4OONA 3NENA 3T1YQ 1HNXQ 2UUCQ 1E3PA 4HJAA 4AQYQ 3HOUG 1AH9A 4DR7Q 4GNXB 5DLQE 1RIPA 3DLLA 3HOWH 1YHBA 4LF8Q 5M5YH 1TWHH 3AQQA 4BY7G 4P75A 1L1OB 1UE5A 4B3SQ 1IXRA 3MEFA 4JI8Q 2HHHL 3F2CA 3S15H 5AJ3L 3OTOQ 3NEMA 3VDYA 4O2DA 3L0OA 4DK3C 2Q2IA 1YITA 1K8GA 3GTPH 1HZ9A 4WJ3M 3IRBA 1EWIA 4BY1G 1XMOL 4UP7A 4B3TQ 1H95A 1YNXA 3HKZG 2UUAQ 4QGUA 2Q2TA 4H02A 4GOPB 4UP9A 1VQKA 1AE3A 3BU2A 4DAYB 1G51A 2NZOA 3KLWA 4RMFA 3G6EA 4AQYL 3T1YL 1HNXL 2ATWA 2PI2E 2UXBL 3CD6A 1IBML 4IFDI 4PG3A 1X6OA 2OTLA 4X65L 1LM0A 2CFMA 4DR4L 2VZAA 1W2BA 2A19A 2VQFQ 4IOAA 3F8TA 4IPHA 5JEAG 4JI2L 4DK6C 2I5LX 2BA1A 3KOJA 4DV6Q 1FJGQ 3GDEA 4A3KH 4IPGA 4JBKA 5C0XJ 2CCZA 1X9NA 5C4XG 2UXCL 4A3LG 4DNIA 2VS1A 1N36Q 1SN8A 2RHQB 4FDBA 3RZOH 1FVIA 3RLFA 3CC4A 4A3DH 1KIXA 2OTJA 1XNQQ 1HR0L 4JI7Q 3FKIH 1OXUA 4Y7NH 1EYGA 2OWOA 1KXLA 1E7ZA 1BVSA 2OCEA 3K80C 5J3BA 3J80c 4A3FG 4JI3Q 3M4OH 4LUVA 3G4SA 2AMCB 3CCRA 4DV3L 1OTCA 1C0AA 3CCQA 3TQYA 4A3MH 5IYDG 4POGA 4OX9Q 4A3DG 1V9PA 2Y0SE 3KJPA 4BBSG 1CKNA 5C4XH 1FJGL 3K8AA 3WWVA 4DR1L 2R93H 1A62A 4LF5L 1N34L 4IPCA 1NMFA 4KLKA 2R7ZG 2WFWA 5M3FH 4NXNL 1JJGA 3W5OA 2RCNA 1XNRL 3D0FA 2PQAA 4LFCL 4JV5Q 3HOXG 1KQSA 1T9HA 1MJCA 1S40A 1I50H 4LF9L 4KHPL 1JT8A 4LF7L 4YHHL 1HZBA 1XPOA 1Q7YC 3BZKA 4DUYL 3CMEA 4TVAB 5C0XI 5IP9H 1C7YA 1HR0W 1TWCH 5AJ3Q 1YIJA 2UUCL 4A3BG 3GTJH 4BY1H 4LF6L 4L5RC 1VQCA 4GOPC 2JEBI 3KF6A 3SGIA 2E2JH 5IYBH 4WJ4A 3PV0A 3T1HQ 2LXJA 2KBNA 4DV4Q 2VUMG 1HNWL 4YHHQ 4X66L 2ZM6L 1YZ6A 1V43A 3U58A 3TRZA 2JA8H 3CC2A 3HOVH 4IFDJ 1I6HH 1QVCA 1X55A 5GAGC 3HOWG 4IFDG 1B8AA 4B3RL 4NXML 2KENA 1A0IA 1FL0A 3A74A 1K9MC 1YHAA 1VQGA 4R4IA 1K8AC 4LNQA 1PH9A 5IY0A 4A3MG 4A75A 3JC66 4HIDA 4JOIA 4DPGA 3CW2C 4X65Q 3EBEA 3PUZA 4BA2I 4DR4Q 4X62L 1SFOH 1VQ9A 4GLXA 1N32L 4YCUA 5JJIA 3HOZH 2HIVA 2R6GA 4PZ6A 3NELA 2ID0A 4A3GG 3I55A 1D8LA 1K3RA 4JYAL 1PVOA 2F3IA 1HNZL 2IX0A 2R93G 4DR5Q 4JI0L 1JE5A 4DV7Q 1Y1WH 1VQ4A 1VQJA 3S2DH 1YBYA 1X65A 2N8NA 4B3TL 1EUJA 5IYDH 5FLMH 1E22A 1MKHA 3RR5A 4DV1Q 3HOYG 2DUDA 3I4MG 3ULJA 4JI4L 3S1RH 2PMZE 5IYBG 4QL5A 1DGSA 4GS3A 2BH2A 3K7UC 2JQOA 2F4VL 1X54A 2B63H 1HNZQ 3S14H 2MQHA 3E9IA 5IE8A 2B29A 4R4TA 1S3OA 1PH1A 2K5HA 4LUZA 2MO1A 2N3SA 4GN3B 1NJIC 1UE7A 3E0EA 4R4QA 1L2FA 1SRUA 1N32Q 1NBWA 3GTGH 4JI2Q 4BXXG 1B7YB 1G6PA 4NPSA 1EFWA 4GKJQ 4DV1L 2I5HA 3PCOB 2VQEQ 2V1CC 1VQLA 3S24A 2K5VA 4ME3A 5C3EH 4AIMA 4DR6Q 3PUWA 4IPDA 4IJHA 1K83H 1VQ8A 3PUVA 2MNAA 1WFQA 1IYJB 1KC8C 1PH8A 3GD7A 1MJEA 2CWPA 3OYYA 1TWAH 3AYHB 2ZM6Q 1Z47A 2DGYA 4R4OA 1I3QH 1X56A 1WI5A 4B3ML 1WJJA 3EN2A 2CQOA 2LXKA 1PV4A 2UU9Q 4A93G 4L5QA 2UXCQ 3K81C 2F4VQ 2YV5A 1HZAA 3PO3H 1YVCA 4DKAC 4DR1Q 1XMQQ 1B70B 3HKSA 4A76A 2ASBA 4LWCA 2Z6KA 2ZJRA 1Q86C 2JA7G 1O7IA 1Y14B 3RN2A 3S2HH 1G291 2A1AA 2EXDA 4OWXB 4YY3Q 4OX9L 2JA8G 3HOVG 3S16H 4JI5L 4HIOA 1GO3E 1PYSB 4B3MQ 2R7FA 4IJLA 1MIUA 3I7FA 2F52A 1VQFA 3I4NH 4OO1I 2NN6I 3CCJA 3ERSX 3U4ZA 1VQAA 2D0PA 2WP8J 3A5ZB 4DV0Q 1PH6A 4APVA 1VS0A 2B3GA 2KHJA 3K0XA 1GVPA 4GLAC 4LF6Q 4YY3L 4A3CG 3CP0A 1EQQA 4DV6L 4HJ7A 1TXYA 4BBRH 4DV5L 3ULPA 1Q1BA 1NMGA 5C44G 4X64Q 2IT1A 5IP7G 3GTLH 1VQ5A 3HOYH 3GO5A 4GKKL 2L15A 5C44H 2YTVA 3J7ZC 2VL6A 1KD1C 3M3YH 3J81i 3M85A 4DV2L 2K5NA 1IBLQ 1SMXA 5M3MH 3PF5A 4YCWA 3U4VA 3BZCA 4JBWA 5IP9G 2B63G 2UXDL 1BBUA 4YWKA 2PQAB 2QA4A 2NN6G 1XPUA 4AYBE 2E2IH 4B3SL 3GTQH 4B3RQ 1VCIA 2H5XA 1UEBA 2EIFA 4P73A 3KJOA 4DV0L 4GNXA 4JBJA 5M5XH 2WB1G 1CKNB 2Q2HA 4JG2A 4HIKA 2ZTDA 3I56A 1PH5A 4LF7Q 1Q12A 4UPAA 2XGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 C;  3I2Z A;  3E9H A;  3K7A H;  5C3E G;  2K75 A;  1VQM A;  4DR2 Q;  3W1B A;  1QZH A;  2K14 A;  1CUK A;  1X3F A;  3M9B A;  3W1G A;  3TS0 A;  1GKH A;  1WYD A;  2KCM A;  3JAM c;  5IP7 H;  1TWF H;  2GVB A;  4YCV A;  3UE0 A;  4BA1 I;  5GAD C;  3STB C;  4C3J H;  5LMN L;  2N49 A;  1L1O A;  3H15 A;  1PH2 A;  4C2M H;  5M5W H;  4NB3 A;  4A3E G;  2IHF A;  4PZ8 A;  4OWW B;  1IL2 A;  4KHP Q;  4A3C H;  2EQS A;  2NVY H;  5FJ8 G;  1VQN A;  1VQI A;  3NBH B;  1I94 L;  1QZG A;  3H0G G;  1OXT A;  1OXV A;  2K4K A;  3LGJ A;  4R1J A;  4TQU S;  1Q8K A;  4DR3 L;  1A8V A;  4OWT B;  5ELN A;  1JJ2 A;  2HHH Q;  3PUY A;  3GTM H;  1N9W A;  5IT9 c;  5JJL A;  1Y1W G;  2GN5 A;  4MNO A;  4GKJ L;  1EOV A;  3UE1 A;  4JI1 Q;  2JA7 H;  4DUY Q;  4DR7 L;  1LUZ A;  2QGQ A;  4K0K Q;  5FJ8 H;  1OXS C;  3S1Q H;  1W3S A;  1JB7 A;  4JYA Q;  1GD7 A;  1ASZ A;  1XNR Q;  3BJU A;  1V1Q A;  2VY3 A;  4A3F H;  3RN5 A;  2ES2 A;  3JAM i;  1VQO A;  1N8R C;  4LFC Q;  1VQE A;  2JE6 I;  5IWA L;  1JMC A;  2ZTE A;  4LUO A;  4C3I H;  3KYH C;  4X62 Q;  3L7Z C;  4GNX C;  2WAQ G;  3A0J A;  5IYC H;  2ALY B;  2Z0S A;  3KFU A;  1C9O A;  4EQ5 A;  3Q8D A;  4C3H H;  4A3K G;  4JI8 L;  4EX5 A;  3PIO A;  5HGQ A;  5ELO A;  2UU9 L;  5JEA J;  1IBM Q;  1U5K A;  3M4P A;  2YU9 H;  4JOI C;  2AKW B;  4QIW E;  5HY6 A;  2D0O A;  4DR3 Q;  3PO3 G;  4DR5 L;  2FXQ A;  3AFP A;  4JI0 Q;  2VUM H;  1U0L A;  4X66 Q;  1XNQ L;  4HJ8 A;  1HR0 Q;  4BXX H;  4IO9 A;  4A93 H;  1QUQ B;  3T1H L;  4GN5 A;  5FLX c;  4DV4 L;  4DUZ Q;  2GVA A;  4UY8 C;  1N36 L;  4R4C A;  4LF5 Q;  1KRS A;  1NY4 A;  3ULL A;  4LF4 L;  2R92 G;  2UUB Q;  4JI6 Q;  4GOP A;  1YEZ A;  2HIX A;  4ALP A;  1IBL L;  3AEV A;  2VQF L;  4LFB Q;  2OQ0 A;  4MTN A;  2HT1 A;  3F1Z A;  4QY7 A;  2VW9 A;  2KCT A;  5JJK A;  4X6A H;  3HFZ B;  5LMU L;  3MXN B;  4LFA Q;  3I4M H;  3CCS A;  3I4N G;  5M3F G;  1VQD A;  1P16 A;  1EQR A;  1WOC A;  3GTO H;  1L1O C;  3H0G H;  2NVQ H;  2K50 A;  1CSQ A;  1HZC A;  4POF A;  3F2B A;  1K0R A;  1CKM A;  4DV5 Q;  2UUA L;  2LSS A;  1GM5 A;  1SR3 A;  3J7A 5;  4BBS H;  1YJW A;  5C0X G;  2UUB L;  4JBM A;  3CMA A;  4HIM A;  3PIP A;  4O0A A;  1FGU A;  2NZH A;  4A3E H;  3OW2 A;  1VQ7 A;  3TS2 A;  2RHS B;  2XTI A;  4JC0 A;  5GAE C;  3CCE A;  2WB1 E;  4P71 A;  4DAM A;  3UDG A;  2YTX A;  3FKI G;  2CWA A;  1PHJ A;  4LF8 L;  1D7Q A;  5FLM G;  1JJC B;  2IY5 B;  2I5M X;  3L2P A;  3PSI A;  1OXX K;  4GN4 B;  4NXM Q;  1Y1V H;  4GLV B;  5M3M G;  4UP8 A;  5C4J H;  3ZJY C;  2BH8 A;  3PGZ A;  2I0Q A;  3CCM A;  1Y1V G;  5LMN Q;  5H1S E;  3S1M H;  4MZ9 A;  1EIY B;  1QVF A;  3M7N A;  4RG1 A;  5K36 G;  1UE1 A;  3I4O A;  2ZJQ A;  1E24 A;  1PYB A;  3B6Y A;  4PMW A;  1RL2 A;  1VQP A;  3D31 A;  3CPW A;  2N78 A;  1SE8 A;  3FP9 A;  1ASY A;  1WCM G;  3G71 A;  3CF5 A;  2KHI A;  1PH4 A;  1XTD A;  2WAQ E;  3RLO A;  2ZJP A;  4DV7 L;  3H3V I;  2PI2 A;  2A8V A;  4A3L H;  3FHW A;  3U50 C;  3CQZ H;  3KDF B;  1WCM H;  1SLJ A;  4P72 A;  4LF9 Q;  2Q2U A;  3AFQ A;  3UDI A;  4JV5 L;  4OXP A;  4JI5 Q;  3HOX H;  2JEA I;  4L5S A;  1QVG A;  1TWG H;  1BBW A;  1E1T A;  4YWM A;  1YHQ A;  2JA5 G;  2UXD Q;  3KDF A;  4IOC A;  2VNU D;  4LF4 Q;  3CC7 A;  2MFI A;  4JI6 L;  4AYB G;  1XMQ L;  2OQK A;  5GRO A;  3CPF A;  1CSP A;  1NE3 A;  3CXC A;  1N33 Q;  2JA6 H;  3HOU H;  5IWA Q;  3UDF A;  3RLN A;  1VQB A;  3PUX A;  1YJ9 A;  4A3G H;  2ZTC A;  4JI3 L;  4A3J H;  1Q82 C;  4LFA L;  1BKB A;  2YTY A;  1IBK L;  1HH2 P;  4YWL A;  1X3G A;  1PH3 A;  5GQO A;  4X64 L;  3J80 i;  1N34 Q;  2AWO A;  4K0K L;  4JCV E;  2AWN A;  3H3V H;  4A3J G;  3PO2 H;  1IZ6 A;  1PA6 A;  4DR6 L;  4Y52 H;  1X3E A;  2BA0 A;  1L0W A;  1LTL A;  3STB D;  4A4I A;  3OTO L;  3G48 A;  4QQB X;  1UE6 A;  3M4Q A;  1YJN A;  2E2H H;  3ICE A;  2JA6 G;  2MO0 A;  4DV3 Q;  4XTC S;  3TRE A;  3CCU A;  1AE2 A;  1VQH A;  3J81 j;  3RNU A;  1I5F A;  1IBK Q;  1I94 Q;  3S17 H;  1A63 A;  1P8L A;  1UWV A;  3PO2 G;  1J5E Q;  1KAW A;  4A3I G;  4HJ5 A;  3KF6 B;  1J6Q A;  1LYL A;  4P74 A;  1VQ6 A;  3HOZ G;  3PF4 A;  1PFS A;  4GKK Q;  4LFB L;  1EIF A;  2K52 A;  1N33 L;  1Z9F A;  2C35 B;  3CCL A;  2JA9 A;  5BR8 L;  5LMU Q;  3S1N H;  1Q81 C;  2R92 H;  3DM3 A;  1K73 C;  2NVT H;  3J81 c;  4JI1 L;  1XMO Q;  4JI4 Q;  2E5L Q;  1NTG A;  2RF4 A;  3TEH B;  1E1O A;  1HJP A;  4J15 A;  3A5U A;  4KI0 A;  2QEX A;  4DUZ L;  3F2D A;  1YI2 A;  2IHE A;  4DR2 L;  3KF8 B;  4PZ7 A;  1S72 A;  4A3I H;  5GAH C;  1M1K C;  2JA5 H;  3GTK H;  2PNH A;  2D62 A;  2UXB Q;  4AH6 A;  1J5E L;  2NVX H;  2R7Z H;  4BY7 H;  2IX1 A;  4JI7 L;  2Z6K C;  2YYZ A;  4KHZ A;  1Q46 A;  4BBR G;  3RZD H;  1XJV A;  2Y0S G;  1SRO A;  2E8G A;  1HNW Q;  4A3B H;  5IYC G;  3ER0 A;  4LW1 A;  1XPR A;  1PH7 A;  3CAM A;  2R7D A;  2VQE L;  2E5L L;  1Q1E A;  1KL9 A;  5EAY A;  1R9T H;  1QUQ A;  4L5T A;  2JJQ A;  3EIV A;  5LMN W;  1KHI A;  2AHO B;  2JK8 A;  1CKO A;  4XIG S;  5BR8 Q;  2CKZ B;  4QJF A;  5E7N A;  1KRT A;  4DV2 Q;  3CCV A;  4NXN Q;  2HQL A;  3HKZ E;  4OO1 G;  3UDX A;  4HJ9 A;  4OON A;  3NEN A;  3T1Y Q;  1HNX Q;  2UUC Q;  1E3P A;  4HJA A;  4AQY Q;  3HOU G;  1AH9 A;  4DR7 Q;  4GNX B;  5DLQ E;  1RIP A;  3DLL A;  3HOW H;  1YHB A;  4LF8 Q;  5M5Y H;  1TWH H;  3AQQ A;  4BY7 G;  4P75 A;  1L1O B;  1UE5 A;  4B3S Q;  1IXR A;  3MEF A;  4JI8 Q;  2HHH L;  3F2C A;  3S15 H;  5AJ3 L;  3OTO Q;  3NEM A;  3VDY A;  4O2D A;  3L0O A;  4DK3 C;  2Q2I A;  1YIT A;  1K8G A;  3GTP H;  1HZ9 A;  4WJ3 M;  3IRB A;  1EWI A;  4BY1 G;  1XMO L;  4UP7 A;  4B3T Q;  1H95 A;  1YNX A;  3HKZ G;  2UUA Q;  4QGU A;  2Q2T A;  4H02 A;  4GOP B;  4UP9 A;  1VQK A;  1AE3 A;  3BU2 A;  4DAY B;  1G51 A;  2NZO A;  3KLW A;  4RMF A;  3G6E A;  4AQY L;  3T1Y L;  1HNX L;  2ATW A;  2PI2 E;  2UXB L;  3CD6 A;  1IBM L;  4IFD I;  4PG3 A;  1X6O A;  2OTL A;  4X65 L;  1LM0 A;  2CFM A;  4DR4 L;  2VZA A;  1W2B A;  2A19 A;  2VQF Q;  4IOA A;  3F8T A;  4IPH A;  5JEA G;  4JI2 L;  4DK6 C;  2I5L X;  2BA1 A;  3KOJ A;  4DV6 Q;  1FJG Q;  3GDE A;  4A3K H;  4IPG A;  4JBK A;  5C0X J;  2CCZ A;  1X9N A;  5C4X G;  2UXC L;  4A3L G;  4DNI A;  2VS1 A;  1N36 Q;  1SN8 A;  2RHQ B;  4FDB A;  3RZO H;  1FVI A;  3RLF A;  3CC4 A;  4A3D H;  1KIX A;  2OTJ A;  1XNQ Q;  1HR0 L;  4JI7 Q;  3FKI H;  1OXU A;  4Y7N H;  1EYG A;  2OWO A;  1KXL A;  1E7Z A;  1BVS A;  2OCE A;  3K80 C;  5J3B A;  3J80 c;  4A3F G;  4JI3 Q;  3M4O H;  4LUV A;  3G4S A;  2AMC B;  3CCR A;  4DV3 L;  1OTC A;  1C0A A;  3CCQ A;  3TQY A;  4A3M H;  5IYD G;  4POG A;  4OX9 Q;  4A3D G;  1V9P A;  2Y0S E;  3KJP A;  4BBS G;  1CKN A;  5C4X H;  1FJG L;  3K8A A;  3WWV A;  4DR1 L;  2R93 H;  1A62 A;  4LF5 L;  1N34 L;  4IPC A;  1NMF A;  4KLK A;  2R7Z G;  2WFW A;  5M3F H;  4NXN L;  1JJG A;  3W5O A;  2RCN A;  1XNR L;  3D0F A;  2PQA A;  4LFC L;  4JV5 Q;  3HOX G;  1KQS A;  1T9H A;  1MJC A;  1S40 A;  1I50 H;  4LF9 L;  4KHP L;  1JT8 A;  4LF7 L;  4YHH L;  1HZB A;  1XPO A;  1Q7Y C;  3BZK A;  4DUY L;  3CME A;  4TVA B;  5C0X I;  5IP9 H;  1C7Y A;  1HR0 W;  1TWC H;  5AJ3 Q;  1YIJ A;  2UUC L;  4A3B G;  3GTJ H;  4BY1 H;  4LF6 L;  4L5R C;  1VQC A;  4GOP C;  2JEB I;  3KF6 A;  3SGI A;  2E2J H;  5IYB H;  4WJ4 A;  3PV0 A;  3T1H Q;  2LXJ A;  2KBN A;  4DV4 Q;  2VUM G;  1HNW L;  4YHH Q;  4X66 L;  2ZM6 L;  1YZ6 A;  1V43 A;  3U58 A;  3TRZ A;  2JA8 H;  3CC2 A;  3HOV H;  4IFD J;  1I6H H;  1QVC A;  1X55 A;  5GAG C;  3HOW G;  4IFD G;  1B8A A;  4B3R L;  4NXM L;  2KEN A;  1A0I A;  1FL0 A;  3A74 A;  1K9M C;  1YHA A;  1VQG A;  4R4I A;  1K8A C;  4LNQ A;  1PH9 A;  5IY0 A;  4A3M G;  4A75 A;  3JC6 6;  4HID A;  4JOI A;  4DPG A;  3CW2 C;  4X65 Q;  3EBE A;  3PUZ A;  4BA2 I;  4DR4 Q;  4X62 L;  1SFO H;  1VQ9 A;  4GLX A;  1N32 L;  4YCU A;  5JJI A;  3HOZ H;  2HIV A;  2R6G A;  4PZ6 A;  3NEL A;  2ID0 A;  4A3G G;  3I55 A;  1D8L A;  1K3R A;  4JYA L;  1PVO A;  2F3I A;  1HNZ L;  2IX0 A;  2R93 G;  4DR5 Q;  4JI0 L;  1JE5 A;  4DV7 Q;  1Y1W H;  1VQ4 A;  1VQJ A;  3S2D H;  1YBY A;  1X65 A;  2N8N A;  4B3T L;  1EUJ A;  5IYD H;  5FLM H;  1E22 A;  1MKH A;  3RR5 A;  4DV1 Q;  3HOY G;  2DUD A;  3I4M G;  3ULJ A;  4JI4 L;  3S1R H;  2PMZ E;  5IYB G;  4QL5 A;  1DGS A;  4GS3 A;  2BH2 A;  3K7U C;  2JQO A;  2F4V L;  1X54 A;  2B63 H;  1HNZ Q;  3S14 H;  2MQH A;  3E9I A;  5IE8 A;  2B29 A;  4R4T A;  1S3O A;  1PH1 A;  2K5H A;  4LUZ A;  2MO1 A;  2N3S A;  4GN3 B;  1NJI C;  1UE7 A;  3E0E A;  4R4Q A;  1L2F A;  1SRU A;  1N32 Q;  1NBW A;  3GTG H;  4JI2 Q;  4BXX G;  1B7Y B;  1G6P A;  4NPS A;  1EFW A;  4GKJ Q;  4DV1 L;  2I5H A;  3PCO B;  2VQE Q;  2V1C C;  1VQL A;  3S24 A;  2K5V A;  4ME3 A;  5C3E H;  4AIM A;  4DR6 Q;  3PUW A;  4IPD A;  4IJH A;  1K83 H;  1VQ8 A;  3PUV A;  2MNA A;  1WFQ A;  1IYJ B;  1KC8 C;  1PH8 A;  3GD7 A;  1MJE A;  2CWP A;  3OYY A;  1TWA H;  3AYH B;  2ZM6 Q;  1Z47 A;  2DGY A;  4R4O A;  1I3Q H;  1X56 A;  1WI5 A;  4B3M L;  1WJJ A;  3EN2 A;  2CQO A;  2LXK A;  1PV4 A;  2UU9 Q;  4A93 G;  4L5Q A;  2UXC Q;  3K81 C;  2F4V Q;  2YV5 A;  1HZA A;  3PO3 H;  1YVC A;  4DKA C;  4DR1 Q;  1XMQ Q;  1B70 B;  3HKS A;  4A76 A;  2ASB A;  4LWC A;  2Z6K A;  2ZJR A;  1Q86 C;  2JA7 G;  1O7I A;  1Y14 B;  3RN2 A;  3S2H H;  1G29 1;  2A1A A;  2EXD A;  4OWX B;  4YY3 Q;  4OX9 L;  2JA8 G;  3HOV G;  3S16 H;  4JI5 L;  4HIO A;  1GO3 E;  1PYS B;  4B3M Q;  2R7F A;  4IJL A;  1MIU A;  3I7F A;  2F52 A;  1VQF A;  3I4N H;  4OO1 I;  2NN6 I;  3CCJ A;  3ERS X;  3U4Z A;  1VQA A;  2D0P A;  2WP8 J;  3A5Z B;  4DV0 Q;  1PH6 A;  4APV A;  1VS0 A;  2B3G A;  2KHJ A;  3K0X A;  1GVP A;  4GLA C;  4LF6 Q;  4YY3 L;  4A3C G;  3CP0 A;  1EQQ A;  4DV6 L;  4HJ7 A;  1TXY A;  4BBR H;  4DV5 L;  3ULP A;  1Q1B A;  1NMG A;  5C44 G;  4X64 Q;  2IT1 A;  5IP7 G;  3GTL H;  1VQ5 A;  3HOY H;  3GO5 A;  4GKK L;  2L15 A;  5C44 H;  2YTV A;  3J7Z C;  2VL6 A;  1KD1 C;  3M3Y H;  3J81 i;  3M85 A;  4DV2 L;  2K5N A;  1IBL Q;  1SMX A;  5M3M H;  3PF5 A;  4YCW A;  3U4V A;  3BZC A;  4JBW A;  5IP9 G;  2B63 G;  2UXD L;  1BBU A;  4YWK A;  2PQA B;  2QA4 A;  2NN6 G;  1XPU A;  4AYB E;  2E2I H;  4B3S L;  3GTQ H;  4B3R Q;  1VCI A;  2H5X A;  1UEB A;  2EIF A;  4P73 A;  3KJO A;  4DV0 L;  4GNX A;  4JBJ A;  5M5X H;  2WB1 G;  1CKN B;  2Q2H A;  4JG2 A;  4HIK A;  2ZTD A;  3I56 A;  1PH5 A;  4LF7 Q;  1Q12 A;  4UPA A;  2XGT A; 
#chains in the Genus database with same CATH topology
 4A3J B;  1PFM A;  1SNO A;  3E9H A;  3E5S A;  3I90 A;  4PMB A;  4QMG A;  2K75 A;  5HUR A;  4RGO S;  2KHS A;  2KCM A;  3GTP B;  3I73 A;  4YCV A;  3UE0 A;  4HMJ A;  4M8A A;  1K8O A;  5LMN L;  1PH2 A;  2B2V C;  4PZ8 A;  5E4W C;  1TS2 A;  5C4H A;  3HG9 A;  2KOL A;  2A6E D;  1V1P A;  1RCV D;  3A56 A;  3H0G G;  1OXT A;  5ELC A;  1QJO A;  1OXV A;  3LGJ A;  1Q8K A;  1S5D D;  1E0B A;  3PUY A;  1IKM A;  1A2U A;  2GN5 A;  2C5C A;  4MNO A;  1K0S A;  1B2T A;  4DR7 L;  2AQ2 B;  1PFN A;  1OXS C;  2PZU A;  3Q23 A;  3QG1 A;  3S1Q H;  4JYA Q;  5A35 A;  1ASZ A;  3MAQ A;  2CQA A;  3NWS A;  1B4O A;  4LFC Q;  3RN5 A;  1S4Z A;  3JAM i;  1N8R C;  3BVZ A;  3QIA A;  2JE6 I;  5IWA L;  2XN9 C;  2G5D A;  3ONA B;  1EY6 A;  4C3I H;  4X62 Q;  3L7Z C;  4GNX C;  3Q8D A;  3NTK A;  1PTO H;  4JI8 L;  5BN5 A;  5HGQ A;  2RBM A;  4OL7 A;  5ELO A;  5JEA J;  1IBM Q;  1NSN S;  4JOI C;  2FXQ A;  4X66 Q;  1X32 A;  4HJ8 A;  1XNQ L;  1HR0 Q;  1WD1 A;  4A93 H;  2IJ0 A;  1N36 L;  3FEW X;  4GOP A;  1MI2 A;  1YEZ A;  5I6W A;  2E2J B;  2K32 A;  4OEL B;  4LFA Q;  1P16 A;  2J7Z A;  2UUA L;  1HZC A;  4DAV A;  1K0R A;  1VMP A;  4LJZ C;  4MN3 A;  4BBS H;  3V96 A;  4FO2 A;  4XT1 B;  3CMA A;  5DEH A;  2IPK D;  5C4X B;  3OW2 A;  2Z6B A;  1VQ7 A;  2RHS B;  3CCE A;  3NPP A;  3UDG A;  2YTX A;  3FKI G;  5CBE E;  2BOS A;  3NBI A;  2Z9H A;  1ONL A;  3PSI A;  4GN4 B;  4UP8 A;  5C4J H;  1A2T A;  3PGZ A;  2KCC A;  1DOK A;  1TVX A;  4MZ9 A;  1KAA A;  3D31 A;  3CPW A;  2DJG C;  3Q0A A;  2N78 A;  4FP5 D;  3FP9 A;  4X3T A;  2O5I C;  2EZV A;  3G71 A;  4EQP A;  2IX3 A;  1DM0 B;  1XTD A;  2ZJP A;  4DV7 L;  2PI2 A;  1M4V A;  3SK8 A;  2L9H A;  1SLJ A;  4OXP A;  4ME5 A;  1YHQ A;  2JA5 G;  1TWH B;  3GP7 A;  3AB9 A;  4JPB W;  1CSP A;  3R93 A;  1N33 Q;  3UDF A;  1K83 B;  2JA5 B;  4A3G H;  1SYF A;  1B3A A;  1KLU D;  1HH2 P;  3VR2 A;  1X3G A;  3J80 i;  3H3V H;  4CJ0 B;  4DR6 L;  1LTL A;  3M4Q A;  3ICE A;  3UI2 A;  1HHV A;  1TS4 A;  1AE2 A;  1VQH A;  3HGB A;  5TSS A;  3SK6 A;  1I5F A;  1SJH D;  1TU2 B;  3CHB D;  1A63 A;  1PMR A;  1J5E Q;  1PDQ A;  1TS5 A;  3KF6 B;  3HOZ G;  2Z8L A;  1FD7 D;  5IGD A;  1RD9 D;  4GKK Q;  3BVM A;  2C35 B;  3CCL A;  3S1N H;  3I91 A;  3SXH A;  3KF8 A;  5C3E B;  1TWC B;  1PZJ D;  4JI4 Q;  2E5L Q;  2EY1 A;  1HJP A;  4KHV A;  3C2P A;  5IGB A;  2B2Y A;  5DNF A;  3OOC A;  2RSO A;  4JI7 L;  3RZD H;  2JXM B;  1XJV A;  1SRO A;  4ZKB B;  2F3V A;  1AP0 A;  5CV8 A;  2VQE L;  1CT1 D;  3TDQ A;  5EAY A;  1R9T H;  5LMN W;  1KHI A;  5BR8 Q;  2CKZ B;  5DM6 3;  3HKZ E;  4HJ9 A;  2K6A A;  4OON A;  3NEN A;  3HOU G;  3OPO A;  1EZ6 A;  3DLL A;  1YHB A;  4BY7 G;  1TWH H;  3AQQ A;  4P75 A;  1L1O B;  2HHH L;  2UUC Q;  3OTO Q;  3VDY A;  3J7A F;  3L0O A;  1Y69 U;  1HZ9 A;  1CZG A;  4WJ3 M;  1XMO L;  2WAQ B;  5E4X A;  1O7Z A;  5G3L D;  3J7A V;  2Z4I A;  2UUA Q;  1Y8N B;  2SNS A;  2OF1 A;  5C44 B;  1AE3 A;  2NZO A;  3T1Y L;  4RMF A;  1HNX L;  3PQI A;  2UXB L;  1WD0 A;  1LTI D;  3CD6 A;  1O80 A;  1IYV A;  1SYB A;  1Q3L A;  2DY7 A;  2F0K A;  1LM0 A;  4DR4 L;  4R9W A;  1W2B A;  2VQF Q;  4K5V A;  2TMP A;  3N52 A;  3F8T A;  4IPH A;  3T56 B;  4IQZ A;  3KOJ A;  2QDB A;  2WKC A;  3GDE A;  3NXW A;  4UHV A;  1X9N A;  2VS1 A;  4RCO A;  3RZO H;  1JOR A;  1EL0 A;  3A7L A;  3DWA A;  1PRT C;  4HN7 A;  1EYG A;  2OWO A;  3S9W A;  5J3B A;  4TRD A;  2EYM A;  4LUV A;  1OTC A;  5JPN C;  2K5Q A;  5KGU A;  4A3D G;  4JK1 C;  3KJP A;  1SNP A;  1FJG L;  3WWV A;  4LF5 L;  4IPC A;  4CJ1 B;  5COY A;  4KLK A;  4C3I G;  3G6J B;  2WFW A;  1DD2 A;  3D0F A;  4PV1 C;  4LFC L;  2A73 B;  2QF7 A;  4YHH L;  1HZB A;  2Y0S B;  3CME A;  1SJE D;  1NCV A;  1YIJ A;  1ESR A;  3GTJ H;  2PW7 A;  4BY1 H;  2JSO A;  5JEA H;  1C48 A;  3PV0 A;  1HA5 A;  3S1Q B;  2K1B A;  4AYB B;  3EJI A;  5T1I A;  4YHH Q;  4X66 L;  1V43 A;  3HOV H;  3CC2 A;  4IFD J;  1QVC A;  3FDT A;  1ENF A;  2KEN A;  4RHR A;  2L5T A;  5E1F A;  1K9M C;  1YHA A;  4R4I A;  3VYS A;  2EJG C;  3JC6 6;  4HID A;  4DPG A;  3CW2 C;  4X65 Q;  1GJX A;  2EPB A;  5AFW A;  1N32 L;  5JJI A;  1KDB A;  3TP7 A;  3HOZ H;  2ID0 A;  1PRT B;  3I55 A;  1A15 A;  4JYA L;  1F2L A;  2NTT A;  2F3I A;  1CHQ D;  2A68 D;  4DR5 Q;  1Y1W H;  1B50 A;  3S1M B;  3S2D H;  1YBY A;  2F0O A;  1H9K A;  4B3T L;  1LAB A;  4F87 A;  2D9U A;  4KKS A;  4LMQ D;  3ULJ A;  2N88 A;  2PMZ E;  4QL5 A;  3J7Y W;  1SAP A;  4BS9 A;  2JQO A;  1STA A;  1RTO A;  2EE1 A;  2F4V L;  2B2W C;  1ILP A;  3OHX C;  1JWS D;  3E9I A;  2J0T D;  1PH1 A;  3DMU A;  5EBD A;  2MO1 A;  4GN3 B;  2JYO A;  1D5X C;  4BXX G;  2FHT A;  4K5X A;  4GKJ Q;  4DV1 L;  1QCB D;  4N8X 1;  4ME3 A;  4AIM A;  2F0V A;  4TSS A;  2MNA A;  3GD7 A;  2A74 C;  1TWA H;  1PRT F;  4QB4 A;  2ZM6 Q;  2RDF A;  4Z9C B;  1WI5 A;  3LNN A;  3H0G B;  1PV4 A;  3P7J A;  5CMD A;  2RKS A;  1LV9 A;  4RGT A;  5M3M B;  5KYL A;  1YVC A;  1B70 B;  2QDL A;  1BNZ A;  3NQI A;  4ID6 A;  4A3E B;  2L11 A;  4LWC A;  2Z6K A;  5FOB B;  1O7I A;  1Y14 B;  3RN2 A;  3QB3 A;  3K58 A;  4OX9 L;  2JA8 G;  5KNB A;  2R7F A;  1QNU A;  4IJL A;  3I7F A;  2KVM A;  3J80 E;  1DXM A;  2NN6 I;  3CCJ A;  3OWF A;  4O42 A;  2PMZ B;  3U4Z A;  4A3G B;  2QW7 A;  1VQA A;  4ZUJ A;  4FXD A;  2KHJ A;  4ZUI A;  4BWG B;  2J4X A;  2MJ8 A;  5C5L A;  1EQQ A;  4DV6 L;  4HJ7 A;  1XWE A;  4BBR H;  3SVM A;  3ULP A;  1Q1B A;  2IT1 A;  4FNF A;  4IUR A;  1WTW A;  2EYF A;  1DOM A;  1I4G A;  2L15 A;  3M3Y H;  3M85 A;  1PFB A;  4DV2 L;  1G6Z A;  2EY5 A;  3PF5 A;  3U4V A;  3BZC A;  5IP9 G;  1BBU A;  5KRU A;  3GTM B;  5CV5 A;  4B3S L;  1AEX A;  2H5X A;  2JA6 B;  2HQE A;  3K5L A;  5M5X H;  2B2T C;  2WB1 G;  4HIK A;  4CKE A;  4UPA A;  3J81 L;  4ZKC B;  2MP1 A;  2XGT A;  2GVB A;  1BUV T;  3I2Z A;  3IL8 A;  4OEM B;  2WII B;  1VQM A;  5NUC A;  1QZH A;  3M9B A;  3W1G A;  4NP5 A;  2MUY A;  5IP7 H;  4C3J H;  1R9T B;  4FYD A;  2N49 A;  3H15 A;  2E2D C;  4A3E G;  2YU9 B;  4NB3 A;  1FYC A;  2NVY H;  1LT3 D;  2JA8 B;  2L55 A;  1I94 L;  4N9P A;  1QZG A;  4IUN A;  2K4K A;  1TQO A;  4PMC A;  1JJ2 A;  2HHH Q;  4KKU A;  3HRZ C;  1JOK A;  1N9W A;  5IT9 c;  1EOV A;  3V05 A;  2JA7 H;  4JI1 Q;  4K0K Q;  1LUZ A;  5E3F A;  1IW7 D;  5J22 A;  3P1H A;  1W3S A;  1JB7 A;  5I9P A;  1X3Q A;  2FJ2 A;  2ES2 A;  1CM9 A;  1Y1W B;  1VQE A;  1TY2 A;  3S2D B;  4HAE A;  2E75 C;  1F2M A;  1JMC A;  3PO3 B;  2IWH A;  3KFU A;  3T53 B;  1CZW A;  1A3V A;  2VXW A;  3PIO A;  1U5K A;  2BE5 C;  4NMZ A;  5HY6 A;  2D0O A;  4DR3 Q;  5ISR A;  1H9J A;  3PO3 G;  3RZO B;  1V8Q A;  2PZW A;  1QUQ B;  4GN5 A;  1CI3 M;  3GV3 A;  4EVO A;  3P75 A;  4KY7 A;  4UY8 C;  3MA2 B;  3K59 A;  1E2V A;  1PRT D;  4R4C A;  4HTH A;  3ULL A;  1NY4 A;  2R92 G;  1ML0 D;  4JI6 Q;  1IBL L;  3NBH A;  1UUP A;  1II3 A;  2OQ0 A;  4MTN A;  3F1Z A;  4QY7 A;  2VW9 A;  2KCT A;  4LFB Q;  4F88 A;  4NKL A;  3H09 A;  2VB2 X;  3MXN B;  4X6A H;  1FGB D;  5M3F G;  3KLS A;  4KJO A;  3BDO A;  1L1O C;  2NVQ H;  2K50 A;  3F2B A;  4POF A;  1CKM A;  2LSS A;  1GM5 A;  1JCK B;  3J7A 5;  1YJW A;  1IHZ A;  4JBM A;  1SBB B;  1XXG A;  3TS2 A;  2WB1 E;  1EQT A;  2CWA A;  3FPP A;  5C3X A;  4LF8 L;  5FLM G;  3L2P A;  1OXX K;  5K36 H;  4NXM Q;  4ZYS A;  4A93 B;  4GLV B;  4XDX A;  1L0X B;  3ZJY C;  2ZT9 C;  3K5O A;  2I0Q A;  3QJY A;  5H1S E;  5K36 G;  1EIY B;  1QVF A;  4RG1 A;  3I4O A;  2ZJQ A;  1E24 A;  1PYB A;  3G7L A;  3GTJ B;  4PMW A;  3LWE A;  1R4Q B;  1KNA A;  2B2U C;  4K6L A;  1SE8 A;  4YIJ A;  3KBX A;  1CA6 A;  1PH4 A;  2KHI A;  1EYC A;  3PMF A;  2WAQ E;  3CKI B;  3FHW A;  2F0D A;  3CQZ H;  4JVZ A;  4V19 0;  2K04 A;  1QWY A;  3MXU A;  4L5S A;  4YWM A;  2B2W A;  5IOC A;  3KDF A;  5D14 A;  4IOC A;  2UXD Q;  3TN2 A;  4LF4 Q;  3CC7 A;  3S16 B;  4IUU A;  5CR3 A;  1XMQ L;  5EGT A;  3L3O C;  1VQB A;  1YJ9 A;  5M5X B;  4NW2 A;  2NTS A;  4JI3 L;  4A3J H;  5CV6 A;  4LFA L;  4KD3 A;  2YTY A;  2FFK B;  4K0K L;  1O7L A;  3MXN A;  2AWN A;  4IUV A;  1BCP C;  4A4I A;  4FF2 A;  1YJN A;  2E2H H;  2MO0 A;  1V1P B;  3HOY B;  3AU7 A;  3J81 j;  5JPM C;  3RNU A;  1I94 Q;  2NVY B;  1P8L A;  3PO2 G;  2NVQ B;  1KAW A;  4A3I G;  4HJ5 A;  2K01 A;  5IT9 E;  1VQ6 A;  1SMY D;  3VR6 A;  1D5M C;  4CDC C;  2K52 A;  5BR8 L;  5LMU Q;  1Q81 C;  3DM3 A;  1K73 C;  1SND A;  4EQN A;  2OEO A;  2ZXO A;  4JI1 L;  3TME A;  1XMO Q;  3S15 B;  2RF4 A;  3TEH B;  1E1O A;  4J15 A;  2QEX A;  3F2D A;  2IHE A;  4DXG A;  4A3I H;  2F0F A;  5GAH C;  1M1K C;  2JA5 H;  2PNH A;  2UXB Q;  1FNV A;  4AH6 A;  1UEA B;  2PCF B;  1EZ8 A;  1AZQ A;  2Z6K C;  3PIP 3;  1HNW Q;  2Y0S G;  2D5D A;  3GV6 A;  1BQQ T;  1ENC A;  3CAM A;  2R7D A;  4H7B A;  2BE5 D;  3T13 A;  1SE3 A;  4CDF C;  2MHV A;  3URY A;  5E7N A;  4NXN Q;  2JN4 A;  3T1Y Q;  1HNX Q;  1E3P A;  4HJA A;  5CGK A;  3MXP A;  1D1K A;  1RIP A;  5I2Y A;  2PQE A;  4LF8 Q;  1FNU A;  1AN8 A;  1UE5 A;  1ZYR D;  4A3M B;  2XSC A;  5L37 A;  3R8B A;  5A2Q E;  4ZLT F;  3JAM L;  5AJ3 L;  4HED A;  3OMC A;  1I4X A;  3HKZ G;  1R4P B;  5KYI A;  5C6A A;  3BU2 A;  2EYL A;  2BH2 A;  2K5W A;  2PI2 E;  2XWJ B;  3QOJ A;  3DWQ A;  1VDZ A;  4PG3 A;  1X6O A;  2OTL A;  1RKN A;  1PXU A;  1JE4 A;  2VZA A;  5FK9 C;  5EJW A;  2A19 A;  5JEA G;  4JI2 L;  4DV6 Q;  1W6J A;  2BA1 A;  2RQX A;  1FJG Q;  4IPG A;  5EBC A;  4X3U A;  2RHQ B;  4L8J A;  3NTH A;  4FDB A;  2LFN A;  3KLS X;  1KIX A;  4OHJ A;  1JIC A;  1H9M A;  3WOF A;  4CJ2 C;  1W6K A;  4RWS C;  4H44 C;  4A3F G;  3CCR A;  2AMC B;  5BN4 A;  3CCQ A;  2A6E C;  2EY6 A;  3NQT A;  1HTP A;  1V9P A;  1CKN A;  1STH A;  4DGZ A;  4C3J B;  2R93 H;  4DR1 L;  3MC0 B;  5CYU A;  1SFO B;  1JQY D;  5M3F H;  1JJG A;  5CBA E;  1IKL A;  3CQZ B;  3HOX G;  1KQS A;  1MJC A;  1I50 H;  2A5H A;  1MHW C;  5J1Z A;  4LF9 L;  2Q8T A;  1IW7 C;  2TSS A;  2B39 A;  4ZRZ A;  1SXT A;  4TVA B;  1AFP A;  4H0L C;  2NUC A;  1XTC D;  2LS0 1;  2A69 D;  1RTN A;  3QOL A;  4L5R C;  1STE A;  5IYB H;  2LXJ A;  5A2Q L;  3HP3 A;  2VUM G;  3GTK B;  1GHK A;  1YZ6 A;  3U58 A;  3TRZ A;  1BR9 A;  4FXG C;  4IFD G;  1LO5 D;  1A0I A;  1VQG A;  1HUM A;  3VR5 A;  4CBV A;  1K8A C;  2EJF C;  3VR4 A;  4K14 A;  3NHH A;  4JOI A;  3KLR A;  1WTR A;  4BA2 I;  4DR4 Q;  4X62 L;  1VQ9 A;  4GLX A;  4YCU A;  1WVL A;  1MSH A;  2HIV A;  2R6G A;  1K3R A;  3T4A C;  1LLR D;  1PVO A;  2IX0 A;  3S1N B;  1X65 A;  3R3O A;  5IYD H;  3RR5 A;  4DV1 Q;  3I4M G;  1PTO F;  5IYB G;  1UAP A;  5ELD A;  3K7U C;  3ITP A;  3HS0 C;  2B63 H;  3P20 A;  2MQH A;  2F4I A;  1S3O A;  4DXF A;  1NJI C;  3ERQ A;  4HMI A;  1WTP A;  1NBW A;  3HOX B;  3GTG H;  1GUO A;  1B7Y B;  4CDE C;  1A3U A;  3PCO B;  2DN8 A;  3S24 A;  4CHT B;  1SE4 A;  1Z7T A;  3CU7 A;  4IPD A;  1VQ8 A;  1WFQ A;  3OYY A;  3SK5 A;  1I3Q H;  1WJJ A;  2LXK A;  2UU9 Q;  4L5Q A;  2WKD A;  2HCC A;  4C3I B;  4DKA C;  3HKS A;  5ELB A;  1K3B C;  1STG A;  1DZ1 A;  5CV7 A;  5IOD A;  1PTO B;  1EYA A;  2KCN A;  4R8N A;  1G29 1;  2A1A A;  2EXD A;  3S16 H;  4S3S A;  5EPL A;  1NUC A;  1PYS B;  2KA7 A;  4OO1 I;  1VQF A;  4DFA A;  3SR1 A;  2B8F A;  2K5D A;  1QOH A;  1EY8 A;  1G8Z D;  1LT6 D;  2L12 A;  3K0X A;  4GLA C;  3MEH A;  1ICW A;  4F7X A;  4DV5 L;  3NSW A;  5C44 G;  2CH4 A;  1KDC A;  5D65 A;  1VQ5 A;  3HOY H;  1I4R A;  1TWA B;  4GKK L;  2D2C C;  3SHL A;  2N55 A;  3J7Z C;  2VL6 A;  3J81 i;  3A7A B;  1I4P A;  1JOO A;  5M3M H;  2NYZ D;  1SMY C;  4ZQ3 A;  1TWG B;  2MPM A;  2UXD L;  1D1I A;  2PQA B;  1BBX C;  1XPU A;  1BO0 A;  2RDG A;  2R93 B;  3GTQ H;  4DAP A;  2OT2 A;  4DV0 L;  1UEB A;  4P73 A;  3IFD A;  3A55 A;  5M3F B;  4I65 A;  1CKN B;  2Q2H A;  3I56 A;  1CFM A;  1M90 C;  3NUC A;  3PIO 3;  4K2K A;  4PNY A;  2F0W A;  4G57 A;  2K14 A;  1X3F A;  3TS0 A;  3JAM c;  1TWF H;  1E2W A;  3STB C;  4A3D B;  1ILQ A;  1L1O A;  4A3I B;  2K28 A;  5IGC A;  5M5W H;  1QB5 D;  4KHP Q;  4A3C H;  3MVV A;  2I46 A;  4RKB A;  3HOV B;  1VQI A;  3NTI A;  2X6L A;  5FLX E;  3K6O A;  3QWN A;  4DR3 L;  1A8V A;  4OWT B;  1LT4 D;  1PZI D;  3GTM H;  4QIW B;  4GKJ L;  2ICE C;  3UE1 A;  4IUQ A;  2QGQ A;  3KUP A;  4I7Z C;  3E0J A;  3M4Y A;  2SNM A;  2NBF A;  1TY0 A;  1NNX A;  1SNM A;  1VQO A;  2BDN A;  2NB0 A;  2HD3 A;  1JWU D;  4KTA A;  4X3S A;  3X3M A;  1AW7 A;  4NDX A;  3KYH C;  5JJZ A;  4ZK9 B;  1KLG D;  2Z0S A;  5IYC H;  1C9O A;  4EQ5 A;  4M1U B;  4A3K G;  2UU9 L;  3M4P A;  2YU9 H;  3ND8 A;  1STB A;  5ELF A;  2VUM H;  4JI0 Q;  3NP8 A;  1SEB D;  4HSP A;  3D6C A;  3A8J E;  3T1H L;  3X3N A;  2DJF C;  4DV4 L;  1CQF A;  1HTL D;  3U9S A;  1B9M A;  2EYP A;  2KJX A;  4LF5 Q;  1EOT A;  2F0Q A;  5JVG 3;  4ALP A;  3EVQ A;  1JR0 D;  2VQF L;  2F0P A;  2LMC B;  2HT1 A;  3HFZ B;  3CCS A;  4MTK A;  4L6T B;  2EVB A;  1EQR A;  1WOC A;  2EY2 A;  1H9R A;  4J1M A;  4KKT A;  3GTO H;  3H0G H;  1CSQ A;  2RCF A;  4DV5 Q;  1SR3 A;  1RF2 D;  5C0X G;  4XYO A;  4O0A A;  3D4R A;  1BXT A;  4A3E H;  1S5F D;  1IL8 A;  2EYJ A;  4JC0 A;  5IGE A;  5GAE C;  5C4Z A;  4XXE A;  3S14 B;  3H6M A;  3U9O A;  1JJC B;  2I5M X;  1Y1V H;  5M3M G;  4KV6 A;  4C3H G;  2BH8 A;  3CCM A;  3FKI B;  5LMN Q;  1VMC A;  3C1E A;  3S1M H;  3M7N A;  3DM1 A;  1UE1 A;  2O2L D;  3B6Y A;  1RL2 A;  3TP5 A;  1ASY A;  1WCM G;  2PPB C;  1I4Q A;  3OIQ A;  3RLO A;  3H3V I;  3CRK C;  4KD4 A;  3U50 C;  3KDF B;  1WCM H;  4LF9 Q;  3AFQ A;  4JV5 L;  4JI5 Q;  2L1B A;  3BVG A;  1M8A A;  1TWG H;  1QVG A;  3A54 A;  3MXG A;  3J81 E;  3IAY A;  1MD2 D;  3CPF A;  1NE3 A;  1SYG A;  2A69 C;  2JA6 H;  5HGT A;  5IWA Q;  3RLN A;  5DM7 3;  1B53 A;  3OIP A;  1G2T A;  3FMC A;  3I70 A;  1Q82 C;  1BKB A;  3M7G A;  1IBK L;  2K03 A;  2SOB A;  5KEE A;  3SDZ A;  1PH3 A;  1H9S A;  5GQO A;  2AWO A;  4JCV E;  1GUT A;  3RUZ A;  3VYR A;  4FF4 A;  1X3E A;  2BA0 A;  2XRQ D;  3STB D;  3OTO L;  3G48 A;  1UE6 A;  2JA6 G;  1LTS D;  2OXP A;  4DV3 Q;  1Q8I A;  3MWY W;  3CCU A;  2B63 B;  1DJR D;  2E2I B;  4DK0 A;  2KED A;  5FLX L;  1IBK Q;  4QUC A;  4B9W A;  1UWV A;  4E6I A;  3I4N B;  3MZ5 A;  1J6Q A;  1QNK A;  4B08 A;  3PF4 A;  1J9O A;  2ZXP A;  1PFS A;  5G3L F;  4ULL A;  1EIF A;  4DA2 A;  2A6H C;  3IKJ A;  2R92 H;  2JP1 A;  3OW7 A;  3FRP B;  1NTG A;  2JA7 B;  2VB3 X;  3A5U A;  4DNT B;  2NZ1 D;  4DR2 L;  2NVX H;  2R7Z H;  4L63 B;  4UAI A;  1F9S A;  3NE5 B;  2IX1 A;  4KHZ A;  3QR8 A;  4OIK A;  2XRS D;  2E8G A;  3F2U A;  4A3B H;  5IYC G;  1PH7 A;  2F1M A;  3GQB A;  2Q8R E;  4CKB A;  2HUG A;  1Q1E A;  1KL9 A;  4EGV A;  3EIV A;  1YNJ D;  2AHO B;  2JK8 A;  5I2X A;  1KRT A;  4QJF A;  2VUM B;  1GHJ A;  1I4H A;  3CCV A;  4DV2 Q;  1WTV A;  3K5M A;  3A8I E;  3TZU A;  5LL6 X;  1DON A;  2NWG A;  4EQO A;  1AH9 A;  5KIX A;  1RDP D;  5T1G A;  5M5Y H;  4B3S Q;  1IXR A;  1F2Y A;  3MEF A;  4JI8 Q;  3S15 H;  1YIT A;  3NEM A;  3GTP H;  5K5P A;  2KUM A;  3IRB A;  1EWI A;  4BY1 G;  3DEO A;  4B3T Q;  1H95 A;  1YNX A;  2K05 A;  1L0Y B;  4QGU A;  2Q2T A;  3D6W A;  4H02 A;  4UP9 A;  1VQK A;  3G6E A;  2EDG A;  3KLW A;  4K6D A;  4AQY L;  2F0H A;  3K57 A;  4C1N K;  4IFD I;  2Q8I B;  3D4W A;  4CDD C;  4FVM A;  2I5L X;  3GTQ B;  4A3K H;  1BCP F;  4JBK A;  2UXC L;  4DNI A;  1SN8 A;  4A3D H;  1FVI A;  2B8G A;  3RLF A;  3CC4 A;  4GZY C;  2OTJ A;  2PNR C;  2HCI A;  2PZT A;  1LTR D;  4JI7 Q;  2KQ3 A;  4Y7N H;  1E7Z A;  2AQ3 B;  2OCE A;  1EY0 A;  4JI3 Q;  3C46 A;  3G4S A;  1DYQ A;  3VYT A;  1ET6 A;  4A3M H;  1C0A A;  4POG A;  3VR3 A;  1G2S A;  1B44 D;  4G7H C;  1EIH A;  1I6V C;  2WV6 D;  1A62 A;  1SNQ A;  3D3R A;  5EKI A;  2RCN A;  3K5N A;  4JV5 Q;  4G4K A;  4A3B B;  1T9H A;  3WOE A;  3K7A B;  3Q6S A;  1CTM A;  5C0X I;  1A3T A;  1C7Y A;  5LL6 S;  1TWC H;  5D3I B;  1HR0 W;  3W3A A;  5LHY 1;  2UUC L;  4A3B G;  4BBR B;  4K5W A;  2RSN A;  3MFG A;  4LF6 L;  4GOP C;  4WJ4 A;  3SGI A;  3KF6 A;  4Q0F A;  2E2J H;  2KBN A;  1HNW L;  1KAB A;  2ZM6 L;  1JOQ A;  1TS3 A;  4G7O C;  4CKC A;  5GAG C;  2F0N A;  1B8A A;  1SE2 A;  4TKO B;  1FL0 A;  1ICF B;  5J39 A;  4LNQ A;  4A3M G;  4A75 A;  3VYU A;  1H9S B;  3EBE A;  1SFO H;  1WTO A;  2ENB A;  1ET9 A;  4IAL A;  4A3G G;  1D8L A;  4MIU A;  3TP6 A;  5DAU A;  1LTB D;  1LTG D;  3K0Y A;  2F3W A;  2R93 G;  1JE5 A;  4DV7 Q;  2ICI A;  2N8N A;  1EUJ A;  4IN3 A;  1NR4 A;  1E22 A;  1MKH A;  3HOY G;  2B2U A;  1AZP A;  4HCS A;  3S1R H;  2R61 A;  1CK1 A;  1X54 A;  3S14 H;  2NVX B;  3GTO B;  5C0X H;  4KK7 A;  4R4T A;  4LK1 C;  2AUK A;  2K5H A;  2N3S A;  1EEI D;  3E0E A;  3PO2 B;  1Y1V B;  2EJM A;  4JI2 Q;  1GUG A;  1G6P A;  2V1C C;  1VQL A;  3BDL A;  2K5V A;  2DNC A;  1Q90 A;  4DR6 Q;  2R3Z A;  2WB1 B;  2AUJ D;  1A6X A;  3EFX D;  1K83 H;  2O5J C;  3PUV A;  5CC4 A;  1PH8 A;  1IYJ B;  1EY4 A;  4UDU C;  1MJE A;  3AYH B;  1SYE A;  2DGY A;  3D8G A;  1EU3 A;  4R4O A;  3AMU A;  1X56 A;  2WAC A;  1GUS A;  2F0S A;  1G91 A;  3EN2 A;  2CQO A;  3HZX A;  5FO7 B;  4RA8 A;  2UXC Q;  3K81 C;  1HZA A;  2RDH A;  1U4R A;  3PO3 H;  4DR1 Q;  1XMQ Q;  2PO4 A;  5IGG A;  2F03 A;  1GXD C;  1T5E A;  4RKL A;  2JA7 G;  1HRJ A;  4QUF A;  4OWX B;  4YY3 Q;  4XQN A;  2XWB B;  4JI5 L;  4HIO A;  1SYC A;  4O1N A;  2K7V A;  2F52 A;  4H13 C;  2BDO A;  4DU9 A;  1HFG A;  1SYD A;  1T5X D;  1U4L A;  2F0U A;  4DF7 A;  3ERS X;  3A5Z B;  4DV0 Q;  4FXK C;  4CGY B;  4A3C G;  4YY3 L;  2QIL A;  2DNE A;  1MGS A;  4RCN A;  1KTK A;  4KY5 A;  5KNC A;  4A3K B;  4KN4 C;  1NMG A;  5IP7 G;  1ROD A;  3GO5 A;  5ELE A;  1QG7 A;  2IL8 A;  3FPU B;  2L0C A;  1IBL Q;  2IW3 A;  2B63 G;  3C1F A;  1E2Z A;  2QA4 A;  2NN6 G;  5FO9 B;  2E2I H;  4KN7 C;  1VCI A;  2G9H D;  2EIF A;  3KJO A;  4GNX A;  3HOZ B;  4U67 3;  4JBJ A;  3DHQ A;  2LKV A;  1LTA D;  3TZD A;  5JJL A;  3HOW G;  2HDL A;  4JBW A;  2R7Z B;  1TR5 A;  3K7A H;  1JB3 A;  5C3E G;  4DR2 Q;  3W1B A;  4RFB A;  1CUK A;  1DCZ A;  1EYD A;  1GKH A;  1U9R A;  1WYD A;  3ZYY X;  4N9T A;  5EPJ A;  4Q5V A;  4BA1 I;  5GAD C;  4XQJ A;  3SEB A;  1EY9 A;  1O78 A;  4C2M H;  2IHF A;  4HR7 B;  4OWW B;  1IL2 A;  2EYH A;  2EQS A;  5FJ8 G;  1VQN A;  3NBH B;  1YNJ C;  3M4O B;  3TBI B;  2B2T A;  3BYY B;  1PTO D;  4R1J A;  4TQU S;  4RGN A;  4I7A A;  5ELN A;  2A6H D;  1YNN C;  1Y1W G;  2CH4 W;  1ZYR C;  3H3V C;  4DUY Q;  5FJ8 H;  3I3C A;  1GD7 A;  3LX0 A;  1WTX A;  1XNR Q;  3BJU A;  1V1Q A;  2VY3 A;  3DEP A;  4A3F H;  4BY7 B;  3Q22 A;  2CW0 D;  3E3X A;  1TKW B;  1CQV A;  2ZTE A;  4LUO A;  1XX8 A;  1S5E D;  3S1R B;  2WAQ G;  3A0J A;  2ALY B;  3DUZ A;  1MBY A;  1HFN A;  4C3H H;  4QCL A;  3EA6 A;  4EX5 A;  1HCZ A;  1CHP D;  3MFY A;  5M5W B;  2AKW B;  2L4N A;  4QIW E;  4K2L A;  3HOU B;  4DR5 L;  3AFP A;  1RHP A;  1U0L A;  4BXX H;  2EOT A;  4IO9 A;  2PYK A;  2F0M A;  4C56 C;  5FLX c;  4DUZ Q;  4V0B A;  2BCO A;  4XYQ A;  1Y8O B;  2GVA A;  3HOW B;  2EXZ A;  1KRS A;  4LF4 L;  2UUB Q;  4JW0 A;  1TII D;  4C3J G;  1WTH A;  2HIX A;  3AEV A;  5JJK A;  2A68 C;  3T51 B;  5LMU L;  3I4M H;  1ZXT A;  3JAM E;  3I4N G;  4DN4 M;  3BS1 A;  1VQD A;  5EKK A;  2UUB L;  1DOL A;  4HIM A;  1K28 A;  5FKA C;  3PIP A;  2QCP X;  1FGU A;  2NZH A;  4RHS A;  3I72 A;  4WJW A;  2XTI A;  5D3D A;  3NK9 A;  4P71 A;  4DAM A;  2X69 A;  1PHJ A;  2XIW A;  1D7Q A;  1ENA A;  1LAC A;  3DXJ C;  2IY5 B;  1BF4 A;  5FO8 B;  2WIN B;  2M9V A;  1EQV A;  3SE0 A;  3HEJ A;  1Y1V G;  1TT2 A;  2F0I A;  4OIJ A;  5F2D A;  1SDF A;  4R8I A;  3O13 A;  1VQP A;  2F0T A;  1O7Y A;  1EIG A;  2Z4H A;  3CF5 A;  5M9O A;  4FF3 A;  1D6E C;  3DWP A;  2A8V A;  4A3L H;  5C5M A;  2I07 B;  5CV4 A;  3KK7 A;  4P72 A;  2FIN B;  2Q2U A;  3SK4 A;  2M2L A;  3UDI A;  4KMU C;  2F0J A;  3J80 L;  3HOX H;  2JEA I;  3FVQ A;  3GTG B;  1BBW A;  1E1T A;  1KDA A;  2VNU D;  2E74 C;  1SNC A;  2MFI A;  5JOB A;  4JI6 L;  4AYB G;  2E2H B;  2OQK A;  5GRO A;  4BY1 B;  4RH6 A;  3RD4 A;  3CXC A;  3HOU H;  1B9N A;  3PUX A;  3GTL B;  2ZTC A;  3NWT A;  4RAU C;  1S5C D;  2P5Z X;  1I6H B;  4YWL A;  4OGQ C;  4X64 L;  1N34 Q;  4A3J G;  3PO2 H;  1IZ6 A;  4WOR A;  1PA6 A;  4U68 A;  4Y52 H;  1L0W A;  3WDN A;  5I9O A;  3IFT A;  4QQB X;  4XTC S;  3TRE A;  3Q24 A;  1KNE A;  4F8M A;  5I4D A;  2H1E A;  3S17 H;  3D4D A;  5COR A;  4KY6 A;  4P74 A;  1EY5 A;  1LYL A;  3W2D A;  1PLF A;  1EU4 A;  2CHB D;  4LFB L;  1N33 L;  1Z9F A;  2JA9 A;  1VF7 A;  1YNN D;  2NVT H;  3J81 c;  3R2T A;  3H91 A;  1EWC A;  1Y8P B;  5JAV A;  2KEE A;  4KI0 A;  2E76 C;  4DUZ L;  1YI2 A;  1BCP B;  3KF8 B;  4PZ7 A;  1EEF D;  4ABN A;  1S72 A;  3GTK H;  2D62 A;  2XVS A;  1J5E L;  1F77 A;  4A3F B;  4BY7 H;  5EQ0 A;  1QE6 A;  2YYZ A;  4BBR G;  1Q46 A;  5I6Y A;  1F2Z A;  2QEJ C;  3ER0 A;  5CV9 A;  4LW1 A;  5EPK A;  2K33 A;  1XPR A;  2Z1C A;  4DNR B;  3TSS A;  2E5L L;  1QUQ A;  2HDM A;  4L5T A;  4C3H B;  2JJQ A;  2NN6 H;  1CKO A;  3ERO A;  4XIG S;  2HQL A;  5IT9 L;  3UDX A;  4OO1 G;  4AQY Q;  4DR7 Q;  4GNX B;  5DLQ E;  3HOW H;  4ODG A;  1B1Z A;  4IUT A;  1PYW D;  4FF1 A;  3F2C A;  3OWE B;  4O2D A;  4DK3 C;  2Q2I A;  1K8G A;  1XYI A;  1TWF B;  2ZXR A;  4UP7 A;  1QIL A;  2KEC A;  3BYT B;  4GOP B;  1PZK D;  1G51 A;  4DAY B;  2ATW A;  4ZCK A;  1C8C A;  3V2T A;  1IBM L;  4KJN A;  4X65 L;  2CFM A;  3HKZ B;  3N6R A;  4LAA A;  3R2I A;  2LY7 A;  4IOA A;  2B2Y C;  3EQL C;  4DK6 C;  3BDC A;  1WTQ A;  4XT3 B;  5C0X J;  3S17 B;  2CCZ A;  5C4X G;  1ZEQ X;  3I8Z A;  4A3L G;  1N36 Q;  1VF5 C;  1STN A;  4P2C B;  3T16 A;  1OO9 B;  1I3Q B;  1XNQ Q;  1HR0 L;  1D5Z C;  3FKI H;  2MGS A;  1OXU A;  2DY8 A;  1KXL A;  3M3Y B;  1BVS A;  3K80 C;  3M4O H;  5M5Y B;  3J80 c;  1LT5 D;  5IGF A;  1UNS A;  3L9A X;  4DV3 L;  3TQY A;  1C4Q A;  5IYD G;  4OX9 Q;  4K8J A;  3OSO A;  2Y0S E;  3A8K E;  1HXY D;  4BBS G;  5C4X H;  3K8A A;  4C2M B;  2V4D A;  1JWM D;  1N34 L;  1NMF A;  2R7Z G;  4NXN L;  3RMH A;  3W5O A;  1WCM B;  1CA5 A;  2PQA A;  1XNR L;  2M00 A;  1S40 A;  4BBS B;  4KHP L;  4XQQ A;  1JT8 A;  4LF7 L;  5C4J B;  1XPO A;  1Q7Y C;  3BZK A;  4DUY L;  4IUP A;  5JVH 3;  2CVR A;  2RA4 A;  4IZ8 A;  5BN3 A;  5IP9 H;  5AJ3 Q;  4IFD H;  3KBG A;  1VQC A;  2JEB I;  3S2H B;  1F9P A;  2O4X A;  3T1H Q;  4DV4 Q;  1ESF A;  1D2B A;  3BZD B;  2JA8 H;  1I6H H;  1X55 A;  1BDO A;  4J8Q A;  5C3W A;  4NXM L;  4B3R L;  2F0E A;  1HA6 A;  3A74 A;  4OO1 H;  1F9R A;  1EFI D;  1PTO C;  2H4O A;  1PH9 A;  5IY0 A;  5IIF A;  4DAY A;  1B3Q A;  3PUZ A;  1HPC A;  1K8M A;  2GA4 B;  4ILW A;  1EWH A;  4PZ6 A;  3NEL A;  3TP8 A;  5EKL A;  4WFN 3;  1NAP A;  3I4M B;  1HNZ L;  1F9Q A;  4JI0 L;  1VQ4 A;  1GUW A;  1VQJ A;  2R92 B;  1GOZ A;  2CW0 C;  5FLM H;  4QF4 A;  1X3P A;  1FR3 A;  1STY A;  2DUD A;  2RVL A;  4JI4 L;  1DGS A;  1V1O A;  4GS3 A;  1EY7 A;  2PW5 A;  2F0G A;  1HNZ Q;  4N8F A;  3QO2 A;  4G7Z C;  5IE8 A;  4HSV A;  2B29 A;  4LUZ A;  1BCP D;  1UE7 A;  4R4Q A;  1L2F A;  1SRU A;  1N32 Q;  1HUN A;  4K8I A;  4NPS A;  1EFW A;  3VA7 A;  3LWU A;  1IYU A;  1SSO A;  2I5H A;  2VQE Q;  3BG3 A;  5C3E H;  4X3K A;  3PUW A;  4IJH A;  4PQX A;  2FMC A;  4ZAI A;  1Z6H A;  3E6Z X;  1S5B D;  1KC8 C;  3C3L A;  2CWP A;  2SEB D;  1Z47 A;  3OMG A;  2QKI C;  4B3M L;  3H94 A;  3VA5 A;  4A93 G;  4DK1 A;  2XNA C;  2F4V Q;  2YV5 A;  4A76 A;  2ASB A;  3S2H H;  2ZJR A;  1Q86 C;  4RGM A;  3HOV G;  1HQM C;  4C1N I;  1GO3 E;  4J6H A;  1FNW A;  4B3M Q;  1MIU A;  3I4N H;  3RZD B;  1U4P A;  1ZKO A;  1I50 B;  1RJT A;  2X6G A;  2D0P A;  2WP8 J;  2EYO A;  1PH6 A;  4APV A;  1VS0 A;  1BOS A;  2B3G A;  1JC7 A;  1GVP A;  4LF6 Q;  1GUN A;  3CP0 A;  1TXY A;  2C9O A;  4X64 Q;  3GTL H;  2AQ1 B;  1J8I A;  4MHE A;  5C44 H;  2YTV A;  1KD1 C;  4Y7N B;  2FMM A;  4WRD A;  3CRL C;  1LTT D;  2K5N A;  1NR2 A;  1SMX A;  1HQR D;  4YCW A;  2F0L A;  3MTS A;  4YWK A;  4B9X A;  2B2V A;  2NVT B;  2SDF A;  4AYB E;  1U4M A;  4B3R Q;  5KND A;  3I4L A;  3MHB A;  3ND9 A;  2G9D A;  4JG2 A;  1PH5 A;  4LF7 Q;  2ZTD A;  1Q12 A;  1MSG A;  4HCE A; 
#chains in the Genus database with same CATH homology
 1M90 C;  3I2Z A;  3E9H A;  3K7A H;  5C3E G;  2K75 A;  1VQM A;  4DR2 Q;  3W1B A;  1QZH A;  2K14 A;  1CUK A;  1X3F A;  3M9B A;  3W1G A;  3TS0 A;  1GKH A;  1WYD A;  2KCM A;  3JAM c;  5IP7 H;  1TWF H;  2GVB A;  4YCV A;  3UE0 A;  4BA1 I;  5GAD C;  3STB C;  4C3J H;  5LMN L;  2N49 A;  1L1O A;  3H15 A;  1PH2 A;  4C2M H;  5M5W H;  4NB3 A;  4A3E G;  2IHF A;  4PZ8 A;  4OWW B;  1IL2 A;  4KHP Q;  4A3C H;  2EQS A;  2NVY H;  5FJ8 G;  1VQN A;  1VQI A;  3NBH B;  1I94 L;  1QZG A;  3H0G G;  1OXT A;  1OXV A;  2K4K A;  3LGJ A;  4R1J A;  4TQU S;  1Q8K A;  4DR3 L;  1A8V A;  4OWT B;  5ELN A;  1JJ2 A;  2HHH Q;  3PUY A;  3GTM H;  1N9W A;  5IT9 c;  5JJL A;  1Y1W G;  2GN5 A;  4MNO A;  4GKJ L;  1EOV A;  3UE1 A;  4JI1 Q;  2JA7 H;  4DUY Q;  4DR7 L;  1LUZ A;  2QGQ A;  4K0K Q;  5FJ8 H;  1OXS C;  3S1Q H;  1W3S A;  1JB7 A;  4JYA Q;  1GD7 A;  1ASZ A;  1XNR Q;  3BJU A;  1V1Q A;  2VY3 A;  4A3F H;  3RN5 A;  2ES2 A;  3JAM i;  1VQO A;  1N8R C;  4LFC Q;  1VQE A;  2JE6 I;  5IWA L;  1JMC A;  2ZTE A;  4LUO A;  4C3I H;  3KYH C;  4X62 Q;  3L7Z C;  4GNX C;  2WAQ G;  3A0J A;  5IYC H;  2ALY B;  2Z0S A;  3KFU A;  1C9O A;  4EQ5 A;  3Q8D A;  4C3H H;  4A3K G;  4JI8 L;  4EX5 A;  3PIO A;  5HGQ A;  5ELO A;  2UU9 L;  5JEA J;  1IBM Q;  1U5K A;  3M4P A;  2YU9 H;  4JOI C;  2AKW B;  4QIW E;  5HY6 A;  2D0O A;  4DR3 Q;  3PO3 G;  4DR5 L;  2FXQ A;  3AFP A;  4JI0 Q;  2VUM H;  1U0L A;  4X66 Q;  1XNQ L;  4HJ8 A;  1HR0 Q;  4BXX H;  4IO9 A;  4A93 H;  1QUQ B;  3T1H L;  4GN5 A;  5FLX c;  4DV4 L;  4DUZ Q;  2GVA A;  4UY8 C;  1N36 L;  4R4C A;  4LF5 Q;  1KRS A;  1NY4 A;  3ULL A;  4LF4 L;  2R92 G;  2UUB Q;  4JI6 Q;  4GOP A;  1YEZ A;  2HIX A;  4ALP A;  1IBL L;  3AEV A;  2VQF L;  4LFB Q;  2OQ0 A;  4MTN A;  2HT1 A;  3F1Z A;  4QY7 A;  2VW9 A;  2KCT A;  5JJK A;  4X6A H;  3HFZ B;  5LMU L;  3MXN B;  4LFA Q;  3I4M H;  3CCS A;  3I4N G;  5M3F G;  1VQD A;  1P16 A;  1EQR A;  1WOC A;  3GTO H;  1L1O C;  3H0G H;  2NVQ H;  2K50 A;  1CSQ A;  1HZC A;  4POF A;  3F2B A;  1K0R A;  1CKM A;  4DV5 Q;  2UUA L;  2LSS A;  1GM5 A;  1SR3 A;  3J7A 5;  4BBS H;  1YJW A;  5C0X G;  2UUB L;  4JBM A;  3CMA A;  4HIM A;  3PIP A;  4O0A A;  1FGU A;  2NZH A;  4A3E H;  3OW2 A;  1VQ7 A;  3TS2 A;  2RHS B;  2XTI A;  4JC0 A;  5GAE C;  3CCE A;  2WB1 E;  4P71 A;  4DAM A;  3UDG A;  2YTX A;  3FKI G;  2CWA A;  1PHJ A;  4LF8 L;  1D7Q A;  5FLM G;  1JJC B;  2IY5 B;  2I5M X;  3L2P A;  3PSI A;  1OXX K;  4GN4 B;  4NXM Q;  1Y1V H;  4GLV B;  5M3M G;  4UP8 A;  5C4J H;  3ZJY C;  2BH8 A;  3PGZ A;  2I0Q A;  3CCM A;  1Y1V G;  5LMN Q;  5H1S E;  3S1M H;  4MZ9 A;  1EIY B;  1QVF A;  3M7N A;  4RG1 A;  5K36 G;  1UE1 A;  3I4O A;  2ZJQ A;  1E24 A;  1PYB A;  3B6Y A;  4PMW A;  1RL2 A;  1VQP A;  3D31 A;  3CPW A;  2N78 A;  1SE8 A;  3FP9 A;  1ASY A;  1WCM G;  3G71 A;  3CF5 A;  2KHI A;  1PH4 A;  1XTD A;  2WAQ E;  3RLO A;  2ZJP A;  4DV7 L;  3H3V I;  2PI2 A;  2A8V A;  4A3L H;  3FHW A;  3U50 C;  3CQZ H;  3KDF B;  1WCM H;  1SLJ A;  4P72 A;  4LF9 Q;  2Q2U A;  3AFQ A;  3UDI A;  4JV5 L;  4OXP A;  4JI5 Q;  3HOX H;  2JEA I;  4L5S A;  1QVG A;  1TWG H;  1BBW A;  1E1T A;  4YWM A;  1YHQ A;  2JA5 G;  2UXD Q;  3KDF A;  4IOC A;  2VNU D;  4LF4 Q;  3CC7 A;  2MFI A;  4JI6 L;  4AYB G;  1XMQ L;  2OQK A;  5GRO A;  3CPF A;  1CSP A;  1NE3 A;  3CXC A;  1N33 Q;  2JA6 H;  3HOU H;  5IWA Q;  3UDF A;  3RLN A;  1VQB A;  3PUX A;  1YJ9 A;  4A3G H;  2ZTC A;  4JI3 L;  4A3J H;  1Q82 C;  4LFA L;  1BKB A;  2YTY A;  1IBK L;  1HH2 P;  4YWL A;  1X3G A;  1PH3 A;  5GQO A;  4X64 L;  3J80 i;  1N34 Q;  2AWO A;  4K0K L;  4JCV E;  2AWN A;  3H3V H;  4A3J G;  3PO2 H;  1IZ6 A;  1PA6 A;  4DR6 L;  4Y52 H;  1X3E A;  2BA0 A;  1L0W A;  1LTL A;  3STB D;  4A4I A;  3OTO L;  3G48 A;  4QQB X;  1UE6 A;  3M4Q A;  1YJN A;  2E2H H;  3ICE A;  2JA6 G;  2MO0 A;  4DV3 Q;  4XTC S;  3TRE A;  3CCU A;  1AE2 A;  1VQH A;  3J81 j;  3RNU A;  1I5F A;  1IBK Q;  1I94 Q;  3S17 H;  1A63 A;  1P8L A;  1UWV A;  3PO2 G;  1J5E Q;  1KAW A;  4A3I G;  4HJ5 A;  3KF6 B;  1J6Q A;  1LYL A;  4P74 A;  1VQ6 A;  3HOZ G;  3PF4 A;  1PFS A;  4GKK Q;  4LFB L;  1EIF A;  2K52 A;  1N33 L;  1Z9F A;  2C35 B;  3CCL A;  2JA9 A;  5BR8 L;  5LMU Q;  3S1N H;  1Q81 C;  2R92 H;  3DM3 A;  1K73 C;  2NVT H;  3J81 c;  4JI1 L;  1XMO Q;  4JI4 Q;  2E5L Q;  1NTG A;  2RF4 A;  3TEH B;  1E1O A;  1HJP A;  4J15 A;  3A5U A;  4KI0 A;  2QEX A;  4DUZ L;  3F2D A;  1YI2 A;  2IHE A;  4DR2 L;  3KF8 B;  4PZ7 A;  1S72 A;  4A3I H;  5GAH C;  1M1K C;  2JA5 H;  3GTK H;  2PNH A;  2D62 A;  2UXB Q;  4AH6 A;  1J5E L;  2NVX H;  2R7Z H;  4BY7 H;  2IX1 A;  4JI7 L;  2Z6K C;  2YYZ A;  4KHZ A;  1Q46 A;  4BBR G;  3RZD H;  1XJV A;  2Y0S G;  1SRO A;  2E8G A;  1HNW Q;  4A3B H;  5IYC G;  3ER0 A;  4LW1 A;  1XPR A;  1PH7 A;  3CAM A;  2R7D A;  2VQE L;  2E5L L;  1Q1E A;  1KL9 A;  5EAY A;  1R9T H;  1QUQ A;  4L5T A;  2JJQ A;  3EIV A;  5LMN W;  1KHI A;  2AHO B;  2JK8 A;  1CKO A;  4XIG S;  5BR8 Q;  2CKZ B;  4QJF A;  5E7N A;  1KRT A;  4DV2 Q;  3CCV A;  4NXN Q;  2HQL A;  3HKZ E;  4OO1 G;  3UDX A;  4HJ9 A;  4OON A;  3NEN A;  3T1Y Q;  1HNX Q;  2UUC Q;  1E3P A;  4HJA A;  4AQY Q;  3HOU G;  1AH9 A;  4DR7 Q;  4GNX B;  5DLQ E;  1RIP A;  3DLL A;  3HOW H;  1YHB A;  4LF8 Q;  5M5Y H;  1TWH H;  3AQQ A;  4BY7 G;  4P75 A;  1L1O B;  1UE5 A;  4B3S Q;  1IXR A;  3MEF A;  4JI8 Q;  2HHH L;  3F2C A;  3S15 H;  5AJ3 L;  3OTO Q;  3NEM A;  3VDY A;  4O2D A;  3L0O A;  4DK3 C;  2Q2I A;  1YIT A;  1K8G A;  3GTP H;  1HZ9 A;  4WJ3 M;  3IRB A;  1EWI A;  4BY1 G;  1XMO L;  4UP7 A;  4B3T Q;  1H95 A;  1YNX A;  3HKZ G;  2UUA Q;  4QGU A;  2Q2T A;  4H02 A;  4GOP B;  4UP9 A;  1VQK A;  1AE3 A;  3BU2 A;  4DAY B;  1G51 A;  2NZO A;  3KLW A;  4RMF A;  3G6E A;  4AQY L;  3T1Y L;  1HNX L;  2ATW A;  2PI2 E;  2UXB L;  3CD6 A;  1IBM L;  4IFD I;  4PG3 A;  1X6O A;  2OTL A;  4X65 L;  1LM0 A;  2CFM A;  4DR4 L;  2VZA A;  1W2B A;  2A19 A;  2VQF Q;  4IOA A;  3F8T A;  4IPH A;  5JEA G;  4JI2 L;  4DK6 C;  2I5L X;  2BA1 A;  3KOJ A;  4DV6 Q;  1FJG Q;  3GDE A;  4A3K H;  4IPG A;  4JBK A;  5C0X J;  2CCZ A;  1X9N A;  5C4X G;  2UXC L;  4A3L G;  4DNI A;  2VS1 A;  1N36 Q;  1SN8 A;  2RHQ B;  4FDB A;  3RZO H;  1FVI A;  3RLF A;  3CC4 A;  4A3D H;  1KIX A;  2OTJ A;  1XNQ Q;  1HR0 L;  4JI7 Q;  3FKI H;  1OXU A;  4Y7N H;  1EYG A;  2OWO A;  1KXL A;  1E7Z A;  1BVS A;  2OCE A;  3K80 C;  5J3B A;  3J80 c;  4A3F G;  4JI3 Q;  3M4O H;  4LUV A;  3G4S A;  2AMC B;  3CCR A;  4DV3 L;  1OTC A;  1C0A A;  3CCQ A;  3TQY A;  4A3M H;  5IYD G;  4POG A;  4OX9 Q;  4A3D G;  1V9P A;  2Y0S E;  3KJP A;  4BBS G;  1CKN A;  5C4X H;  1FJG L;  3K8A A;  3WWV A;  4DR1 L;  2R93 H;  1A62 A;  4LF5 L;  1N34 L;  4IPC A;  1NMF A;  4KLK A;  2R7Z G;  2WFW A;  5M3F H;  4NXN L;  1JJG A;  3W5O A;  2RCN A;  1XNR L;  3D0F A;  2PQA A;  4LFC L;  4JV5 Q;  3HOX G;  1KQS A;  1T9H A;  1MJC A;  1S40 A;  1I50 H;  4LF9 L;  4KHP L;  1JT8 A;  4LF7 L;  4YHH L;  1HZB A;  1XPO A;  1Q7Y C;  3BZK A;  4DUY L;  3CME A;  4TVA B;  5C0X I;  5IP9 H;  1C7Y A;  1HR0 W;  1TWC H;  5AJ3 Q;  1YIJ A;  2UUC L;  4A3B G;  3GTJ H;  4BY1 H;  4LF6 L;  4L5R C;  1VQC A;  4GOP C;  2JEB I;  3KF6 A;  3SGI A;  2E2J H;  5IYB H;  4WJ4 A;  3PV0 A;  3T1H Q;  2LXJ A;  2KBN A;  4DV4 Q;  2VUM G;  1HNW L;  4YHH Q;  4X66 L;  2ZM6 L;  1YZ6 A;  1V43 A;  3U58 A;  3TRZ A;  2JA8 H;  3CC2 A;  3HOV H;  4IFD J;  1I6H H;  1QVC A;  1X55 A;  5GAG C;  3HOW G;  4IFD G;  1B8A A;  4B3R L;  4NXM L;  2KEN A;  1A0I A;  1FL0 A;  3A74 A;  1K9M C;  1YHA A;  1VQG A;  4R4I A;  1K8A C;  4LNQ A;  1PH9 A;  5IY0 A;  4A3M G;  4A75 A;  3JC6 6;  4HID A;  4JOI A;  4DPG A;  3CW2 C;  4X65 Q;  3EBE A;  3PUZ A;  4BA2 I;  4DR4 Q;  4X62 L;  1SFO H;  1VQ9 A;  4GLX A;  1N32 L;  4YCU A;  5JJI A;  3HOZ H;  2HIV A;  2R6G A;  4PZ6 A;  3NEL A;  2ID0 A;  4A3G G;  3I55 A;  1D8L A;  1K3R A;  4JYA L;  1PVO A;  2F3I A;  1HNZ L;  2IX0 A;  2R93 G;  4DR5 Q;  4JI0 L;  1JE5 A;  4DV7 Q;  1Y1W H;  1VQ4 A;  1VQJ A;  3S2D H;  1YBY A;  1X65 A;  2N8N A;  4B3T L;  1EUJ A;  5IYD H;  5FLM H;  1E22 A;  1MKH A;  3RR5 A;  4DV1 Q;  3HOY G;  2DUD A;  3I4M G;  3ULJ A;  4JI4 L;  3S1R H;  2PMZ E;  5IYB G;  4QL5 A;  1DGS A;  4GS3 A;  2BH2 A;  3K7U C;  2JQO A;  2F4V L;  1X54 A;  2B63 H;  1HNZ Q;  3S14 H;  2MQH A;  3E9I A;  5IE8 A;  2B29 A;  4R4T A;  1S3O A;  1PH1 A;  2K5H A;  4LUZ A;  2MO1 A;  2N3S A;  4GN3 B;  1NJI C;  1UE7 A;  3E0E A;  4R4Q A;  1L2F A;  1SRU A;  1N32 Q;  1NBW A;  3GTG H;  4JI2 Q;  4BXX G;  1B7Y B;  1G6P A;  4NPS A;  1EFW A;  4GKJ Q;  4DV1 L;  2I5H A;  3PCO B;  2VQE Q;  2V1C C;  1VQL A;  3S24 A;  2K5V A;  4ME3 A;  5C3E H;  4AIM A;  4DR6 Q;  3PUW A;  4IPD A;  4IJH A;  1K83 H;  1VQ8 A;  3PUV A;  2MNA A;  1WFQ A;  1IYJ B;  1KC8 C;  1PH8 A;  3GD7 A;  1MJE A;  2CWP A;  3OYY A;  1TWA H;  3AYH B;  2ZM6 Q;  1Z47 A;  2DGY A;  4R4O A;  1I3Q H;  1X56 A;  1WI5 A;  4B3M L;  1WJJ A;  3EN2 A;  2CQO A;  2LXK A;  1PV4 A;  2UU9 Q;  4A93 G;  4L5Q A;  2UXC Q;  3K81 C;  2F4V Q;  2YV5 A;  1HZA A;  3PO3 H;  1YVC A;  4DKA C;  4DR1 Q;  1XMQ Q;  1B70 B;  3HKS A;  4A76 A;  2ASB A;  4LWC A;  2Z6K A;  2ZJR A;  1Q86 C;  2JA7 G;  1O7I A;  1Y14 B;  3RN2 A;  3S2H H;  1G29 1;  2A1A A;  2EXD A;  4OWX B;  4YY3 Q;  4OX9 L;  2JA8 G;  3HOV G;  3S16 H;  4JI5 L;  4HIO A;  1GO3 E;  1PYS B;  4B3M Q;  2R7F A;  4IJL A;  1MIU A;  3I7F A;  2F52 A;  1VQF A;  3I4N H;  4OO1 I;  2NN6 I;  3CCJ A;  3ERS X;  3U4Z A;  1VQA A;  2D0P A;  2WP8 J;  3A5Z B;  4DV0 Q;  1PH6 A;  4APV A;  1VS0 A;  2B3G A;  2KHJ A;  3K0X A;  1GVP A;  4GLA C;  4LF6 Q;  4YY3 L;  4A3C G;  3CP0 A;  1EQQ A;  4DV6 L;  4HJ7 A;  1TXY A;  4BBR H;  4DV5 L;  3ULP A;  1Q1B A;  1NMG A;  5C44 G;  4X64 Q;  2IT1 A;  5IP7 G;  3GTL H;  1VQ5 A;  3HOY H;  3GO5 A;  4GKK L;  2L15 A;  5C44 H;  2YTV A;  3J7Z C;  2VL6 A;  1KD1 C;  3M3Y H;  3J81 i;  3M85 A;  4DV2 L;  2K5N A;  1IBL Q;  1SMX A;  5M3M H;  3PF5 A;  4YCW A;  3U4V A;  3BZC A;  4JBW A;  5IP9 G;  2B63 G;  2UXD L;  1BBU A;  4YWK A;  2PQA B;  2QA4 A;  2NN6 G;  1XPU A;  4AYB E;  2E2I H;  4B3S L;  3GTQ H;  4B3R Q;  1VCI A;  2H5X A;  1UEB A;  2EIF A;  4P73 A;  3KJO A;  4DV0 L;  4GNX A;  4JBJ A;  5M5X H;  2WB1 G;  1CKN B;  2Q2H A;  4JG2 A;  4HIK A;  2ZTD A;  3I56 A;  1PH5 A;  4LF7 Q;  1Q12 A;  4UPA A;  2XGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...