4JI7L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7L00
3FKIG 4A3JH 3UDXA 2LXKA 3UDIA 4LF9Q 1VQ8A 1Q82C 4DV3L 1NMGA 1VQHA 1PH5A 1Q12A 4DV5Q 3GDEA 1N36L 1IL2A 2JJQA 1V1QA 2UXCQ 4A3DG 5E7NA 2E8GA 4NXML 2BA1A 4DAYB 3TS2A 2GVAA 5IYCH 2ZJRA 3MXNB 3RN5A 1X55A 5H1SE 2ALYB 1HJPA 1Y1WG 2XGTA 4DNIA 3PV0A 1IZ6A 4AQYQ 4XIGS 1O7IA 1VQ4A 2UUBQ 1V43A 1HR0Q 1E7ZA 1VQAA 2EQSA 1VQFA 2ZJQA 3S1RH 1IYJB 3PCOB 2VZAA 3TQYA 1SRUA 5M3MG 1KQSA 4DR2L 1OXUA 1KL9A 3CF5A 4JI1Q 4BY7H 1N33L 4HJAA 2Q2IA 5IP7H 1GKHA 2JA8H 4PZ8A 4DR3Q 3HOVH 1UE7A 1P16A 4OX9L 3H15A 3B6YA 3H0GH 5C0XI 2Y0SG 2KCTA 3EN2A 1C9OA 1CUKA 2EIFA 2NVYH 1T9HA 4DKAC 3G4SA 2HIVA 4DV0L 4A3JG 1SR3A 4JBKA 4DR4Q 4JI4Q 1SFOH 1SROA 4LF4Q 3PGZA 3S14H 2HT1A 2LSSA 4LFAL 3F2BA 4GS3A 4UP9A 1VQGA 3E0EA 4YCUA 4GKKL 5M3FH 5IYCG 4UP8A 2CFMA 3RLFA 1TWHH 1D7QA 1Q81C 3ZJYC 3OTOL 4A3FH 4IFDG 4MTNA 3PO3H 4DV2L 2F4VQ 1PH9A 1TWFH 1YBYA 2PQAB 4DK3C 3PUXA 4X62L 2VW9A 1PH4A 3J81c 4OO1I 1PFSA 2UUAQ 1X56A 3EIVA 4QJFA 3OYYA 3S15H 3GO5A 1PYSB 2NZHA 4A3LH 3GTJH 2I5MX 1PH3A 4LF8L 4A75A 1OXTA 4WJ3M 5GQOA 1BBWA 5IP7G 1TWGH 5LMUQ 2E5LL 3GTMH 1UE6A 4APVA 3HOVG 2DGYA 3LGJA 2KENA 3H0GG 3CCMA 4HJ9A 3G48A 1XMQL 1PV4A 4LF5Q 2VUMG 2LXJA 2UXCL 2QA4A 4LF6L 2V1CC 2WB1E 4DUYQ 2KHJA 2OTLA 5C4JH 4A93H 4YCVA 4HJ8A 2R6GA 2IHEA 1FL0A 4JG2A 4L5RC 2KBNA 3I7FA 3FHWA 1L0WA 4JYAQ 2K14A 4Y7NH 2UU9L 5EAYA 4DAMA 2R93G 5M5XH 3M3YH 1UE1A 1JT8A 3PUYA 1XMOQ 4JI7Q 3KDFA 5M3FG 2UUBL 2K5VA 3W1GA 1HR0L 1VQEA 2GN5A 1QZGA 3J7ZC 3CPFA 4YCWA 2UXDQ 3BU2A 5IWAQ 1S40A 3WWVA 2VQEQ 4A3FG 1N9WA 1OXSC 1EIFA 2JK8A 4DR6L 4GNXA 3S16H 4IO9A 1PVOA 3HKSA 4GNXC 5BR8Q 4GOPA 1AH9A 4YY3L 1JJ2A 4R4CA 2IX0A 4AYBE 1HNXL 3PIPA 3I55A 2FXQA 2JE6I 4A3LG 1PHJA 1NE3A 4ALPA 1X3FA 2F3IA 4NB3A 5JEAJ 1YZ6A 1IBLL 3CCEA 4X66L 4KLKA 1YHBA 4LF4L 3KFUA 1XPUA 1UWVA 3TS0A 1G6PA 1S3OA 1VQ9A 4P73A 2I0QA 4OWTB 4X64L 4NXNQ 3S2HH 4DR1Q 4YHHQ 2OQKA 4C3JH 4RG1A 1XPOA 1YHAA 1K0RA 3CW2C 3I2ZA 1TWCH 4IPDA 2F4VL 1I50H 2UUCQ 1N32L 2K52A 4P72A 1EYGA 3S1MH 2UUAL 4JI8Q 4QGUA 3TRZA 3HOUH 3E9HA 3KF8B 1YVCA 2AKWB 4GNXB 1EIYB 4LNQA 4UPAA 2QGQA 1XPRA 1M1KC 5DLQE 3HOZH 4A3CH 4KHPL 3M4QA 4A3MH 4A4IA 4JI0Q 2NZOA 1YIJA 2K5NA 4DUYL 2RHQB 3S2DH 4C3IH 1P8LA 2CCZA 1FJGL 3PSIA 2MNAA 3T1YQ 4LF7Q 1HZAA 4JYAL 3J7A5 1JJGA 4P74A 4B3SQ 3U58A 1N34L 2PI2E 3I4MH 4JI7L 2JQOA 5FLMG 3UE0A 3M85A 1Z9FA 1EFWA 1AE2A 3A5UA 4OONA 1AE3A 3CQZH 4LUVA 5IYDG 2ATWA 2YTVA 4UP7A 4MZ9A 3RLOA 4A3BH 5BR8L 3RLNA 1EQRA 2N78A 3GTLH 3CMEA 1XNQL 3T1HQ 5FLXc 4PZ6A 1NTGA 3HOUG 2PNHA 1YHQA 2PQAA 3E9IA 4BY1H 4A3CG 5C3EH 2NN6I 3J81i 4O2DA 4ME3A 2NVQH 4HIMA 3RZDH 4DV4Q 1YJWA 5JJKA 3PUWA 4R4OA 1ASYA 4IFDJ 4X65Q 4DR1L 4YHHL 1W3SA 1W2BA 3I4NG 3S17H 2ZJPA 2ZTDA 1XNRQ 1SMXA 4IPHA 1QZHA 1KIXA 2K50A 5HGQA 3CXCA 4GN3B 2UUCL 1SLJA 4IJHA 1L1OA 1XJVA 1L1OC 4P75A 1NJIC 3HKZE 4A76A 3PF5A 4AYBG 1HH2P 2HQLA 3HOWH 1BVSA 2JA6H 3CD6A 4DV7Q 4BBSH 1GD7A 4HIOA 4JI3Q 2JA9A 4O0AA 3NELA 2B3GA 2UXBQ 1YI2A 3OW2A 2YU9H 1PH2A 1H95A 1VS0A 1JJCB 1VQKA 4YWLA 2ES2A 4JI0L 2MQHA 4X6AH 3F2DA 3CMAA 1SE8A 1X6OA 1Q1BA 4BY1G 5AJ3L 2IY5B 5FJ8H 1LM0A 2YTYA 3L0OA 5LMNL 4HIDA 5LMNW 2PMZE 3T1YL 4B3RL 4BY7G 4IOAA 4H02A 4TQUS 3UDGA 4B3SL 1L2FA 2I5HA 2JA8G 3MEFA 1LYLA 2HHHQ 1SN8A 1IBKQ 2F52A 4DV5L 2VS1A 4GLAC 3NENA 1ASZA 4B3TQ 1X9NA 3ULPA 2ID0A 2R92H 3U4ZA 4DV6Q 4LUZA 3AEVA 1QUQB 2VQFQ 2OWOA 1L1OB 4P71A 4Y52H 5GROA 3J81j 4AQYL 4JV5Q 1E3PA 3D31A 4KI0A 4JI2Q 1CKOA 2KCMA 1VQOA 1HNZQ 1HR0W 2JA6G 4BBSG 4R4TA 3M7NA 4MNOA 2A19A 3L2PA 2IT1A 3NEMA 1VQIA 3A5ZB 1VQNA 4BA2I 4B3MQ 4JI1L 5GAHC 2ZM6Q 4DR7Q 3PO3G 5C0XG 4L5SA 4DV4L 1IXRA 1DGSA 4A3KH 1Q86C 4LFCQ 3U50C 2VL6A 4DR3L 1D8LA 1I3QH 1KXLA 4HIKA 4QY7A 2QEXA 5FJ8G 1I94Q 3CAMA 3BZKA 1A0IA 3SGIA 1VQLA 1XNRL 1K83H 1JB7A 4QIWE 1PH8A 1M90C 1GM5A 3ULLA 1IBMQ 4JI4L 2A8VA 4DR4L 1Q46A 1X3EA 3GTOH 1KAWA 2JA5H 2WFWA 3CCLA 3HOYH 1C0AA 4OXPA 2Z6KC 2VY3A 4BA1I 1HZBA 3HOXH 3K0XA 2Q2UA 4NXMQ 3PO2H 4A93G 1HZCA 4GLXA 1QVFA 3UE1A 5ELOA 4YWKA 1CKMA 1WYDA 1UE5A 4HJ5A 2JEBI 1Y1VH 1WCMH 3Q8DA 1UEBA 1CKNA 4DR5Q 3W1BA 2R7ZH 2Z0SA 1YEZA 1VQMA 4JI5Q 4DR2Q 3RZOH 3I4OA 2JEAI 2OTJA 1JE5A 5LMUL 3FKIH 3ULJA 2JA7H 3RNUA 3CPWA 1IBKL 1KRSA 1VQ6A 3M4PA 4LF5L 3RR5A 2ZTCA 3J80c 2CKZB 1EOVA 3F8TA 4B3TL 3ICEA 2I5LX 4GKJQ 3K8AA 2CWAA 1OXXK 3HKZG 1VCIA 2D0PA 1J6QA 4DV0Q 4EX5A 2VQFL 3TEHB 2JA5G 3CCRA 3HOYG 1TWAH 2IHFA 5JJIA 4QL5A 1N8RC 5JJLA 1XMOL 1PA6A 2B63H 3HOXG 1S72A 4PZ7A 4GKKQ 2UXDL 3CCSA 4IPCA 2MO0A 5IWAL 3CCJA 4K0KQ 2VQEL 1MKHA 3F2CA 1PYBA 1C7YA 2MO1A 1Y1VG 4B3ML 2B29A 1KHIA 2K75A 3AFPA 1CKNB 1Z47A 4LFCL 1K73C 3CC7A 4JBWA 4JBJA 4IFDI 1I6HH 2YV5A 4OWWB 1E1OA 1NY4A 4DV1Q 2AWOA 3H3VH 3HOZG 3GTQH 1KD1C 1B70B 4GN4B 2WB1G 3DM3A 4LF8Q 1KC8C 1IBML 2JA7G 1X3GA 2E5LQ 2N49A 3JAMc 1I5FA 1HNWQ 4A3MG 2ZTEA 1K8GA 2YYZA 3W5OA 3A74A 4POGA 4JOIA 2C35B 1XMQQ 4NXNL 3K7UC 4JOIC 4J15A 2R7FA 4LF6Q 2WAQE 1VQBA 5J3BA 4JC0A 3HFZB 4L5QA 3S1NH 3F1ZA 1QVCA 3I4MG 2UU9Q 4YWMA 2B63G 1QUQA 1GVPA 4DR5L 1PH1A 4JI8L 3S24A 3M4OH 3CC2A 1A63A 1E24A 3STBD 1VQCA 1Q8KA 5C44H 5ELNA 3U4VA 4JI5L 3G6EA 2E2JH 3CCVA 4LW1A 5GADC 3CC4A 4A3BG 4DR6Q 4KHZA 1A8VA 3KOJA 3DLLA 3PUVA 2WP8J 3UDFA 4AH6A 4YY3Q 4BXXH 1FGUA 1EUJA 1HNXQ 2AHOB 2HIXA 2VUMH 1NMFA 4GKJL 4LFBQ 3AFQA 4DK6C 5C3EG 2AWNA 1VQPA 1WJJA 1IBLQ 4JBMA 1MIUA 4LF7L 2K4KA 3CCQA 4X66Q 1YITA 2ASBA 1HZ9A 2A1AA 5GAGC 4EQ5A 2R93H 4JCVE 4BBRH 3A0JA 4X64Q 1VQJA 4DUZQ 2XTIA 1NBWA 2L15A 4WJ4A 4RMFA 2N3SA 5C0XJ 4K0KL 5IT9c 1WOCA 3KJPA 1PH6A 2N8NA 4GN5A 3ER0A 2CWPA 1K3RA 3CP0A 2PI2A 1E22A 4PMWA 4L5TA 3T1HL 3G71A 1N32Q 2VNUD 2NN6G 1YJ9A 5C44G 4DV1L 3HOWG 2DUDA 4AIMA 1Q7YC 3GTKH 3I56A 3S1QH 3BZCA 5IYBH 2K5HA 4NPSA 1KRTA 4FDBA 1HNWL 3EBEA 5IP9H 1J5EQ 2GVBA 4UY8C 4BXXG 1G51A 2D0OA 3PIOA 1LUZA 4JI6Q 4KHPQ 3IRBA 4X65L 1Y14B 1V9PA 1BKBA 2RCNA 1R9TH 1FJGQ 2OQ0A 4IPGA 1CSQA 3J80i 2AMCB 1QVGA 4A3EH 2E2IH 1Q1EA 5IE8A 4A3IH 3K7AH 3TREA 4BBRG 1N34Q 2RF4A 3JC66 3GD7A 4DV3Q 2Y0SE 2Z6KA 4QQBX 1MJCA 1N36Q 1TXYA 2R92G 1E1TA 2BH8A 4DV7L 4HJ7A 1CSPA 1RL2A 4JI3L 4LWCA 3RN2A 2D62A 1JMCA 4OO1G 2UXBL 1XNQQ 1PH7A 4GOPC 1BBUA 1YNXA 1VQ7A 2NVTH 2NVXH 4LFBL 2RHSB 5GAEC 3K81C 5IY0A 5IYBG 1OTCA 1WI5A 4A3GH 4OWXB 4LF9L 2WAQG 1YJNA 5C4XH 5IP9G 3KF6A 1LTLA 3GTGH 3CCUA 4A3KG 1N33Q 3GTPH 1EWIA 1VQDA 2HHHL 4XTCS 4DUZL 1FVIA 2H5XA 4OX9Q 1U5KA 2R7DA 2Q2HA 5FLMH 4GLVB 3JAMi 1WFQA 1MJEA 1X54A 1XTDA 2YTXA 2IX1A 5K36G 3BJUA 4DV6L 4A3EG 4A3DH 1EQQA 1K8AC 5IYDH 4A3IG 1VQ5A 2EXDA 4R4IA 3KDFB 4R4QA 3KYHC 4DPGA 3NBHB 4POFA 3VDYA 3PUZA 5JEAG 3AYHB 4LUOA 3KJOA 4IJLA 1Y1WH 4LFAQ 2Q2TA 4JI2L 3PO2G 1HNZL 3FP9A 3KLWA 3L7ZC 4IOCA 2KHIA 4JV5L 1B7YB 4C2MH 2CQOA 4GOPB 3PF4A 3K80C 5M3MH 3OTOQ 2ZM6L 4DR7L 5HY6A 1G291 3AQQA 1WCMG 1J5EL 3M9BA 1A62A 5M5WH 1K9MC 1GO3E 4JI6L 2OCEA 4DV2Q 1RIPA 4X62Q 3STBC 2R7ZG 4A3GG 1I94L 5AJ3Q 2MFIA 1U0LA 4TVAB 5M5YH 5C4XG 3KF6B 4R1JA 5LMNQ 2E2HH 4B3RQ 3I4NH 1X65A 1OXVA 4PG3A 3ERSX 2BH2A 3H3VI 4C3HH 2BA0A 3D0FA 1B8AA
chains in the Genus database with same CATH superfamily
2K01A 3UDXA 4OHJA 4QUCA 3TP6A 4EGVA 4DV3L 1NMGA 1VQHA 1TS5A 3GDEA 2JJQA 4NXML 4DAYB 2M00A 3MXNB 3RN5A 2TSSA 5H1SE 2ALYB 2XGTA 1AEXA 1Y8NB 3PV0A 2QDLA 3H3VC 3QB3A 1E7ZA 1VQAA 2EQSA 4IQZA 1IYJB 3TQYA 1SRUA 3CF5A 2EYFA 4K6LA 1N33L 4BY7H 2B2VC 1SYCA 2QDBA 2RDGA 2Q2IA 3QOJA 4UHVA 5IP7H 4KKTA 1D5ZC 1STGA 4DU9A 5LHY1 1P16A 3B6YA 3H0GH 4XT3B 3EN2A 2KCTA 2EDGA 4EQPA 2HIVA 1EL0A 2B8FA 1EOTA 1CZGA 3PGZA 1SE4A 5M3FH 3RLFA 2CFMA 1TWHH 2WIIB 1O7YA 3OPOA 1HHVA 2B2WA 4MTNA 1PH9A 1YBYA 4X62L 2VW9A 1PH4A 3MXPA 5ELEA 2UUAQ 3EVQA 1PFBA 3DUZA 3EIVA 4QJFA 5KNBA 1QCBD 1E2WA 2NZHA 2L55A 3VYUA 2I5MX 1TS3A 4A75A 5IP7G 3J7AV 1TWGH 4APVA 2DGYA 3H0GG 3NHHA 3DXJC 1DM0B 1EY5A 3KLRA 4HN7A 4ZYSA 3K59A 1QJOA 2B2TC 2OTLA 4DAPA 4TSSA 4JG2A 4L5RC 1M4VA 2K14A 3N6RA 5M5XH 1LO5D 3M3YH 4CJ0B 5M3FG 1EZ8A 1U4MA 2GN5A 1QZGA 1DZ1A 3J81E 1PFNA 3BU2A 3IL8A 3H0GB 1EIFA 2JK8A 4DR6L 2B2UC 2Z6BA 5CGKA 4IO9A 1PVOA 3I73A 1LT5D 3NXWA 4AYBE 2HDLA 1PTOD 3I55A 1YNJC 1GUNA 1EZ6A 2JE6I 1NSNS 4ALPA 1IBLL 4X66L 1YHBA 1Z7TA 3KFUA 1I4XA 1S3OA 1AN8A 1VQ9A 4HR7B 3MAQA 3FPPA 1A2TA 2TMPA 3HOXB 4M1UB 4DR1Q 1JE4A 4RG1A 2AQ3B 4DN4M 1PRTB 1UAPA 4ZKCB 1TWCH 4LAAA 1HCZA 4IPDA 1N32L 2D9UA 2UUAL 2F0WA 1FNWA 3TRZA 1EIYB 4LNQA 1AW7A 2EYLA 2QILA 4FP5D 5I9PA 4CGYB 5EKLA 1SYDA 2E2IB 5M5XB 1FGBD 1YIJA 2K5NA 2K03A 3SE0A 1Q3LA 4C3IH 1ZXTA 2EYHA 3J81L 3I91A 4P74A 2F0NA 2PZTA 3BS1A 4RFBA 3X3MA 1I4QA 3UE0A 1WTRA 1AE2A 1KDCA 2PW5A 3IKJA 5IYDG 2NVTB 4ZAIA 4UP7A 2OF1A 4A3BH 4XXEA 1GUSA 3GTLH 5I4DA 3T1HQ 1KDBA 1NTGA 3L9AX 4Q0FA 1H9SA 1STYA 3H6MA 5EBDA 1JR0D 2EYOA 2NVQH 4ME3A 5HGTA 3RZDH 4DV4Q 1YJWA 4XT1B 1ZKOA 3KBGA 1ASYA 1CHQD 4X65Q 4DR1L 2K5QA 1H9RA 1WTOA 1GHJA 5J1ZA 3VYTA 1SMXA 3C3LA 1SXTA 4GN3B 1SLJA 3EQLC 4RCOA 1LTGD 1L1OC 5A2QE 1DYQA 3HKZE 5M5WB 5FLXE 4IN3A 4A76A 1G2SA 2HQLA 2JA6H 3K0YA 4DV7Q 4HIOA 1A3UA 5M5YB 2FHTA 5D3DA 1YI2A 1F2MA 4YWLA 2MJ8A 2P5ZX 4X6AH 2OXPA 2N88A 2IY5B 1LABA 3KUPA 5FJ8H 2RDFA 2YTYA 3L0OA 5FO8B 3K5NA 4HIDA 2BDOA 2XSCA 4IOAA 1C4QA 3VR5A 4DGZA 4TQUS 3UDGA 4I65A 1LYLA 1SN8A 1PTOC 5EJWA 2EY6A 2SDFA 4B3TQ 3DMUA 1X9NA 3G7LA 3S1RB 3BG3A 1XTCD 4Y52H 5GROA 1PLFA 4DNTB 1STBA 2KCMA 2JA6G 1HR0W 2L12A 4R4TA 3L2PA 2IT1A 3NEMA 4KD3A 4JI1L 2ZM6Q 4DV4L 1IXRA 1QG7A 2F0KA 4A3KH 3U50C 4CDEC 4HIKA 2QEXA 5FJ8G 4H13C 3S14B 2IX3A 1B44D 1GHKA 5A2QL 2NYZD 1M90C 2X69A 1GM5A 3ULLA 1Q46A 1X3EA 4K2KA 1KAWA 3GTOH 2WFWA 3HOYH 1F2LA 3R8BA 1HZBA 5FO9B 4PMBA 4GLXA 4KJNA 2F3WA 4R9WA 4QMGA 1LTAD 2SNMA 1WCMH 2A6HD 3HGBA 3Q8DA 2F0VA 4IZ8A 4DR5Q 2R7ZH 2Z0SA 1VQMA 2F0TA 2RCFA 3I4OA 2JEAI 5LMUL 5JOBA 3MVVA 4IURA 1KRSA 3H09A 3E0JA 4B3TL 4GKJQ 3OMGA 5D65A 4EX5A 4MIUA 2C5CA 3HOYG 1TWAH 2IHFA 2JYOA 2B63H 3SK5A 4B9WA 4MHEA 2PW7A 1PYBA 2B29A 4RKLA 1EY8A 1I6HH 1I4PA 4KJOA 1SNOA 3ERQA 3NBIA 3HOYB 3BDLA 1BCPB 2AWOA 3QOLA 1VF7A 5CBEE 3H3VH 1ET6A 3GTQH 1KD1C 2WB1G 3VYSA 2QKIC 2E5LQ 4A3MG 2SEBD 4L6TB 3W5OA 3HP3A 2NB0A 1H9MA 4CKCA 4F87A 4UAIA 3S1NH 3HFZB 3S1MB 2XVSA 2FJ2A 4QF4A 3G6JB 2UU9Q 3I4MG 3C46A 2B63G 1GVPA 4DR5L 2WB1B 3S24A 1L0XB 3STBD 4KV6A 1VQCA 1RODA 4A3MB 1Q8KA 1BBXC 1FNVA 3U4VA 4LW1A 3TP5A 5GADC 2KHSA 4KHZA 2H1EA 1G91A 2WP8J 4AH6A 2LFNA 1TWAB 3I4MB 4GKJL 5NUCA 2AWNA 1WJJA 1MIUA 4LF7L 2K4KA 3CCQA 2J4XA 1EY4A 1PRTF 2A1AA 3CQZB 2F1MA 3SXHA 2R93H 1LTID 1K8OA 1NBWA 4RMFA 2N3SA 1WOCA 1LTTD 1LT3D 4GN5A 2CWPA 1K3RA 4DXFA 4PMWA 2PQEA 1TT2A 3L3OC 4G7HC 3HOWG 3I56A 3OIQA 2EJMA 2JP1A 2A6HC 4UY8C 3I72A 1QB5D 4KHPQ 2KJXA 1BXTA 4PQXA 2G9DA 1QNKA 4TRDA 2RCNA 2OQ0A 3QJYA 5IT9E 1QVGA 3HOWB 4OL7A 1QOHA 1Q1EA 2MP1A 4BBSB 3TREA 5CV7A 2KCNA 4RWSC 4H0LC 4S3SA 2Y0SE 2Z6KA 3R2TA 1M8AA 2R92G 4HJ7A 4WORA 2UXBL 1XNQQ 1NUCA 2NVXH 4I7ZC 3BZDB 5GAEC 1OTCA 3NE5B 2M2LA 1YJNA 1S5FD 2D5DA 5EKKA 4ZLTF 2PZWA 1B3QA 2R92B 3GTPH 4XTCS 2DY7A 1FVIA 3JAMi 1MJEA 1X54A 1XTDA 2A5HA 4DV6L 3VR2A 3CRKC 4A3DH 1K8AC 2XWBB 1VQ5A 4MN3A 2EXDA 3D4WA 1ENFA 3AYHB 1B3AA 2Q2TA 3KJOA 3FP9A 4ZCKA 3D8GA 3L7ZC 5IGCA 2F0HA 5ISRA 4GOPB 2CQOA 4DNRB 5M3MH 3OTOQ 4LMQD 3AQQA 1ZEQX 3M9BA 1K9MC 2FMMA 4DV2Q 1RIPA 2RSOA 5IT9L 3STBC 1GJXA 4KD4A 2DN8A 3I4NH 2BA0A 3OSOA 4A3JH 2LXKA 3MXUA 1R4PB 1BOSA 1Y1VB 2NWGA 2PMZB 1V1QA 1EY6A 4A3DG 2B2YA 1RHPA 2NVXB 3OWEB 5KYLA 2L0CA 1X55A 2SOBA 2LKVA 4DNIA 1ILPA 1VQ4A 2KCCA 2ZJQA 1VQFA 2IW3A 3GP7A 3PCOB 2KEDA 5M3MG 1S5CD 1OXUA 1KL9A 2QF7A 4A3DB 2JA8H 1GKHA 3CU7A 3HOVH 1UE7A 1HUNA 3NSWA 1T5EA 3RMHA 1C9OA 1D5MC 1T9HA 3G4SA 4DV0L 4A3JG 4JBKA 4DR4Q 1WTWA 4JI4Q 3I3CA 1SROA 1BF4A 4LF4Q 1CA5A 2NBFA 4K5VA 5T1IA 1EYAA 2LSSA 3A8JE 5J22A 4GS3A 4UP9A 3E0EA 1TY0A 4YCUA 1PTOH 1D7QA 3OTOL 4A3FH 1EY0A 4DV2L 2F4VQ 4DK3C 4A3JB 1JB3A 3QWNA 1PFSA 1X56A 3OYYA 2F0UA 1PYSB 3GTJH 1V1PB 1PH3A 4WJ3M 4KKSA 3HOVG 3M7GA 2HCIA 3GTMH 5ELDA 2KENA 1JOOA 3CCMA 4HJ9A 4LF5Q 1RTNA 2VUMG 2LXJA 4JK1C 3TMEA 2QA4A 2V1CC 2WB1E 4DUYQ 1TIID 1LT6D 2KHJA 1K8MA 5C4JH 4HJ8A 3M4OB 2KBNA 5IGGA 3MC0B 4DAMA 1UE1A 4JI7Q 1HPCA 1VQEA 3CHBD 4YCWA 3A55A 5IWAQ 1EYDA 2VQEQ 4A3FG 1N9WA 4ODGA 1BCPF 1OXSC 2VUMB 4GNXA 1JJ2A 4HCEA 2XIWA 1HNXL 3PIPA 4Z9CB 1HQMC 5JEAJ 1KTKA 3CCEA 1E2ZA 1GUOA 4LF4L 1XPUA 4H44C 1G6PA 4IUNA 4A3FB 4OWTB 4X64L 4NXNQ 2KA7A 1HRJA 1S5BD 2OQKA 4C3JH 1LTSD 1YHAA 1MBYA 2CW0D 3GTKB 1GUGA 1XWEA 3RUZA 2F4VL 1I50H 1STNA 1TS4A 2EY1A 4PNYA 4JI8Q 4QGUA 2L11A 2E2DC 1EIHA 3KF8B 4GNXB 5K5PA 4UPAA 4OGQC 1XPRA 5DLQE 3C2PA 3HOZH 5C4JB 3A54A 4V190 2SNSA 1SDFA 4A4IA 3R2IA 4LK1C 2PCFB 4DUYL 1MD2D 4HAEA 1P8LA 1FJGL 4CBVA 2MNAA 3T1YQ 1HZAA 1A3VA 1JJGA 1SE2A 1N34L 1SNDA 4JI7L 3D4RA 2JQOA 1JQYD 5FLMG 3M85A 1Z9FA 3A5UA 4OONA 4WRDA 1WTXA 2K1BA 2F4IA 4RGTA 2ATWA 2YTVA 1U4PA 4MZ9A 4A3GB 4K2LA 1EQRA 3CMEA 3K5OA 5C4XB 3V05A 1JOKA 2BDNA 2G9HD 4PZ6A 2PNHA 1PZID 1YHQA 3GTGB 4CDFC 3E9IA 3VR6A 3J81i 1V1OA 1S4ZA 2IJ0A 4N9TA 5JJKA 2K04A 2RSNA 2A74C 1W2BA 3A7AB 3S17H 2K5WA 3EA6A 4R8NA 1S5DD 3VYRA 1HTPA 3MZ5A 4IPHA 1QZHA 2DNCA 1JWUD 2K50A 4RGNA 4IJHA 3X3NA 1VMCA 3T16A 3GV3A 2CQAA 5G3LF 2B8GA 2HQEA 2L1BA 3EFXD 2WACA 1B2TA 3OW2A 2YU9H 4KY5A 2ES2A 1TS2A 4KMUC 3F2DA 1Q1BA 2MUYA 1LM0A 4B3RL 2PMZE 3T1YL 4BY7G 1L2FA 2I5HA 4RCNA 3MEFA 1CA6A 3Q23A 4K8JA 1IBKQ 2VS1A 4GLAC 3PMFA 4KY6A 2ID0A 2EOTA 1QUQB 2OWOA 1QNUA 1I6VC 4WJWA 2OEOA 1WTHA 4BY7B 1CKOA 1VQOA 1A2UA 5ELCA 2XNAC 3A8KE 1CM9A 1U4RA 1VQIA 3A5ZB 2CW0C 4E6IA 5GAHC 4DR7Q 1GUWA 2F0JA 1D8LA 1KXLA 4QY7A 1EQVA 3H91A 1VQLA 5K36H 1DONA 3DEOA 1JB7A 5M3FB 1HA5A 1TWHB 4XQNA 1C0AA 2JXMB 1CTMA 4RHSA 2Z6KC 2VY3A 2Q2UA 2NTTA 3PO2H 2Z1CA 1HQRD 2QCPX 4RH6A 3AU7A 3FMCA 1UEBA 1TWGB 2Z9HA 3SK6A 1C48A 5LL6X 3W1BA 3ONAB 1O78A 4DR2Q 3RZOH 4RHRA 2OTJA 4C1NI 3D3RA 3FKIH 2EYMA 2JA7H 1DOMA 2J0TD 3CPWA 1IBKL 1VQ6A 3K5LA 3MFGA 5DNFA 3RR5A 3J80c 1EOVA 3M3YB 4DA2A 3K8AA 1BUVT 1DCZA 4J6HA 2V4DA 2F03A 2EVBA 4FYDA 1ESFA 2E74C 2RKSA 1BNZA 1V8QA 1PA6A 2KVMA 4IUPA 4Q5VA 1S72A 4GKKQ 1D1KA 3CCSA 2F0QA 3NWTA 4K0KQ 1G6ZA 2K75A 1Z47A 1K73C 4JBWA 4JBJA 2C9OA 1MGSA 1PZJD 3W2DA 1NY4A 1SAPA 4LF8Q 2JA7G 1X3GA 4K5XA 2DJGC 1K8GA 1S5ED 3A74A 1TWCB 4POGA 1XMQQ 4JOIC 5I6YA 2L5TA 4C3IG 4LF6Q 1VQBA 2B2YC 2KOLA 4L5QA 2R3ZA 1BQQT 2JA7B 3SVMA 4GZYC 2HCCA 5C44H 5ELNA 4A3BG 3CCVA 3BDOA 1K3BC 2BE5D 1SE3A 4C3IB 5KEEA 4YY3Q 4OIKA 1EEFD 4BXXH 4G7OC 1CQVA 2KECA 4DFAA 1ENCA 1EY9A 4LFBQ 3CRLC 3AFQA 4KN7C 1VQPA 4JBMA 4LF9Q 3S15H 4NMZA 3TP8A 3U9OA 5GAGC 2EJFC 3OIPA 1EYCA 4EQ5A 4A3BB 1LLRD 2ICEC 4DUZQ 1VQJA 3GTLB 2XTIA 3ND9A 4EVOA 4K0KL 1PYWD 1PH6A 1D5XC 1F9SA 3E3XA 2AQ2B 3NTHA 2PI2A 4XYQA 4XQJA 3IAYA 5L37A 1B50A 1E22A 2NVQB 4L5TA 3T1HL 1KLGD 4IUTA 3RZDB 2O5JC 5C44G 1VDZA 1CT1D 3C1EA 3S1QH 1F2YA 1KRTA 1GXDC 5E3FA 4BXXG 1G51A 2D0OA 5C5LA 1EU4A 1FYCA 4X65L 1Y14B 1V9PA 1HTLD 1R9TH 4BWGB 1CSQA 4ULLA 5C44B 1AZPA 2JA6B 3K7AH 1Q90A 1MJCA 4F7XA 1TXYA 2K05A 1E1TA 4DV7L 1RL2A 3HRZC 4FO2A 1JMCA 1I4HA 5EPLA 3OW7A 4OEMB 1BBUA 1VQ7A 4LFBL 2RHSB 2MHVA 5IY0A 1PDQA 3LNNA 4OWXB 4LF9L 1HA6A 2WAQG 4M8AA 3A8IE 3KF6A 4A3KG 3DWPA 4J1MA 4DUZL 5C6AA 1PRTD 4OX9Q 1U5KA 4RKBA 4FF1A 2IX1A 3BJUA 4R8IA 2EE1A 2KUMA 3KDFB 5DAUA 2CHBD 3VDYA 3PUZA 2WAQB 3F2UA 4IJLA 1STAA 2EPBA 5E4XA 4A3KB 4N9PA 3KLWA 3NK9A 1IL8A 4IOCA 3DHQA 4C2MH 3PF4A 3P1HA 2ZM6L 3Q22A 1WCMG 3D4DA 2R7ZG 1E0BA 1WTQA 3GTOB 5AJ3Q 2O4XA 1YNND 3KF6B 4U68A 5LMNQ 2E2HH 2PZUA 4DXGA 1OXVA 2BE5C 4C3HH 1PH2A 3KBXA 3TBIB 1IYVA 5I6WA 1QWYA 4MTKA 2L4NA 1PH5A 1VF5C 4DV5Q 5CV5A 1IL2A 1SJHD 4F88A 1WCMB 1SMYD 4HTHA 4FF3A 5E7NA 2VB3X 3Q24A 2AUKA 3D6WA 3DEPA 5IYCH 5KNCA 4C56C 3T13A 2R7ZB 1ESRA 4IFDH 2I07B 4AQYQ 1SSOA 4XIGS 4V0BA 2UUBQ 1FR3A 1JORA 4QB4A 1A6XA 4CKEA 4HJAA 4DR3Q 3NUCA 4OX9L 3H15A 1DOKA 2EIFA 1NCVA 2NVYH 4C3HG 2B63B 2IPKD 5I2XA 2J7ZA 1SR3A 1UNSA 1SFOH 3BVZA 1CQFA 1D6EC 2EY5A 3F2BA 2ZXOA 5KNDA 5IYCG 4QIWB 4UP8A 1I6HB 1Q81C 1UUPA 3ZJYC 4IFDG 2E2HB 1X3PA 3GTQB 1Y8PB 2B2WC 3PO3H 1SYEA 4C3HB 1TWFH 2PQAB 3PUXA 3ND8A 4A3LH 1OXTA 1BBWA 1IYUA 2E5LL 3S1NB 1UE6A 3BYTB 2MGSA 5BN4A 4A93H 2R6GA 2IHEA 3GQBA 3I7FA 4KK7A 4Y7NH 2UU9L 5EAYA 2R93G 1LT4D 4ZQ3A 1ML0D 1PRTC 1XMOQ 2UUBL 2UXDQ 3BVGA 4NKLA 3CPFA 3J7ZC 1C8CA 1TQOA 2FINB 5ELBA 2QW7A 3MWYW 3S16H 2NVYB 3CKIB 4NW2A 3HZXA 4GOPA 4R4CA 2FXQA 4A3LG 3OWFA 2R93B 1NE3A 3MA2B 1X3FA 1B9MA 4NDXA 5EPKA 4KLKA 4EQOA 3I4LA 2O2LD 4P73A 2I0QA 3S2HH 1RTOA 3SDZA 1YNNC 1TWFB 4FNFA 4KY7A 1LTRD 1SBBB 3IFDA 1IW7D 5CMDA 1XPOA 1K0RA 2NZ1D 3I2ZA 1F2ZA 4ZUIA 2K52A 1EYGA 2JN4A 2FFKB 2AKWB 5CV6A 2QGQA 1O80A 1X3QA 4OIJA 3T53B 1Q8IA 5BN3A 4A3CH 5CC4A 1K0SA 1I4GA 2EZVA 1SNQA 4KHPL 4Y7NB 2F0FA 4JI0Q 3EJIA 5FO7B 2RHQB 3S2DH 2CCZA 3PSIA 1HFGA 5C4ZA 2XRQD 2PI2E 1KDAA 1EFWA 1EEID 3KK7A 5JAVA 4LUVA 5JPNC 3VR3A 2RDHA 4G4KA 3RLOA 5F2DA 3RLNA 2N78A 1XNQL 1BCPD 1KNEA 4X3UA 4HMJA 5I2YA 3GTPB 4A3CG 5C3EH 4ME5A 2IL8A 2F0SA 4I7AA 4O2DA 2G5DA 4HIMA 1IHZA 1V1PA 3OOCA 3PUWA 5EPJA 3I4NG 2ZTDA 1XNRQ 4G57A 1X32A 1KIXA 2AUJD 1L1OA 5IOCA 5M3MB 1XJVA 1F77A 4P75A 1NJIC 4AYBG 4RAUC 1A15A 3CD6A 1KLUD 4JI3Q 4O0AA 3I4NB 3S9WA 3QG1A 5C0XH 1VS0A 1JJCB 3TZUA 5FOBB 1VQKA 4JI0L 2MQHA 3CMAA 1X6OA 1G8ZD 3Q6SA 1XX8A 2DY8A 1QILA 5JPMC 4AYBB 2JA8G 1JWSD 1PMRA 2HHHQ 2ZXPA 5KYIA 3NQTA 3NENA 1ASZA 3ULPA 1J9OA 1MSGA 2VQFQ 1CI3M 1L1OB 3SK8A 4CKBA 4OO1H 1E3PA 2CH4A 3D31A 3NPPA 3I90A 1JICA 4JI2Q 3T4AC 4DK0A 1HNZQ 2JA8B 3HOVB 4MNOA 1IW7C 1I4RA 2A19A 4JV5Q 1H9KA 4BA2I 3FPUB 3KF8A 5CV9A 5CYUA 5DM73 5C0XG 4U673 1DGSA 2FMCA 3EROA 2AQ1B 1B4OA 1Q86C 4LFCQ 1I3QH 1ENAA 1I94Q 1A0IA 1Y69U 1XNRL 5T1GA 1K83H 3BDCA 4QIWE 1II3A 4DR4L 4JI4L 1PTOB 1IBMQ 1KAAA 5C3XA 2A8VA 2RQXA 2JA5H 3NQIA 3CCLA 5JEAH 1O7LA 3HOXH 4KTAA 4NXMQ 3JAML 5EKIA 5ELOA 2MPMA 5G3LD 1CKMA 4YWKA 4HJ5A 5EQ0A 2JEBI 3GTJB 1LTBD 5CV4A 3GTMB 1JC7A 2DNEA 4TKOB 1YEZA 4JI5Q 2RBMA 1BCPC 1JE5A 4CDCC 2K33A 3ULJA 1JOQA 4LF5L 2KQ3A 2Q8IB 3F8TA 4FXKC 2K6AA 3HKZG 3KLSA 2D0PA 5CORA 4RA8A 2VQFL 2JA5G 2K32A 5E1FA 1N8RC 1RDPD 4L8JA 3HOXG 2NTSA 4C3JG 1DXMA 4IPCA 5IWAL 3PIP3 2VQEL 2KEEA 1T5XD 1KHIA 1BO0A 4LFCL 2K7VA 3CC7A 4IFDI 1VMPA 2YV5A 4OWWB 1E1OA 2JA5B 4DV1Q 3J80E 5IGFA 5IGEA 3HOZG 1B70B 4GN4B 1KC8C 1H9JA 1IBML 4C3JB 1HNWQ 3JAMc 1LACA 2YYZA 1SJED 4NXNL 4J15A 3RD4A 1I50B 4IUVA 3F1ZA 4YWMA 2PNRC 1QUQA 3J7YW 3HOZB 4QUFA 1PH1A 4JI8L 2NN6H 2WV6D 2N55A 3G6EA 5JJZA 2E2JH 4K14A 4JI5L 4DR6Q 1A8VA 3DLLA 3PUVA 2K28A 1F9RA 3UDFA 4UDUC 1FGUA 1EUJA 3BVMA 2AHOB 2A68D 4DK6C 1FD7D 1IBLQ 2ASBA 4X66Q 5FKAC 2A73B 1YITA 1ILQA 4BS9A 2F0GA 3D6CA 3A0JA 4WJ4A 2L15A 1QE6A 4B9XA 2QEJC 2LMCB 1B53A 4IUQA 3KJPA 3ER0A 3TP7A 3J80L 3CP0A 3HS0C 1N32Q 3G71A 2NN6G 3K5MA 3SR1A 4DV1L 4AIMA 1Q7YC 1SNCA 2K5HA 2X6GA 4LJZC 3S17B 1HNWL 4FXDA 1ET9A 5IP9H 2GVBA 4KKUA 3IRBA 1U4LA 1BKBA 1SNPA 2E2JB 2E2IH 1IKLA 1U9RA 5D3IB 1CK1A 2RF4A 3GD7A 5JVG3 1N36Q 2YU9B 3Q0AA 5IODA 2BH8A 1CSPA 4O1NA 4LWCA 1FNUA 1L0YB 4GOPC 1EWHA 4H7BA 2BOSA 3TN2A 2NVTH 3K81C 1SYFA 1WI5A 4QCLA 5IP9G 1LTLA 2F0PA 2BCOA 1UEAB 1VQDA 1F9PA 1ONLA 1STEA 5EGTA 2H5XA 3I8ZA 2R7DA 1AP0A 5K36G 1WFQA 2JSOA 1EQQA 5IYDH 1TKWB 4R4IA 3KYHC 4DPGA 1NR4A 5FK9C 4LUOA 1Y1WH 4LFAQ 3PO2G 3V96A 2EXZA 2KHIA 1B7YB 3SK4A 3NWSA 4DR7L 1G291 5M5WH 1GO3E 1Y8OB 2OCEA 5DEHA 4X3KA 2MFIA 4K6DA 4TVAB 5M5YH 1CHPD 1ICFB 3ERSX 4PG3A 3SHLA 1TVXA 3D0FA 1B8AA 3PO2B 3FKIG 4ZK9B 3UDIA 4HSPA 1VQ8A 1Q82C 2Z4HA 1Q12A 1N36L 2A68C 1WD0A 2UXCQ 3TS2A 2E8GA 2BA1A 2GVAA 2ZJRA 2A69D 1CZWA 1W6JA 1WVLA 1HJPA 1Y1WG 3RZOB 1IZ6A 1MSHA 3VA7A 1O7IA 3P20A 1V43A 3FKIB 1HR0Q 5IGBA 3S1RH 2GA4B 3WOEA 2VZAA 2E75C 1KQSA 4DR2L 4HEDA 4JI1Q 1PTOF 5C3WA 2EYPA 4PZ8A 5C0XI 1NNXA 4HSVA 2Y0SG 2F0IA 4DKAC 1CUKA 1Y1WB 4N8FA 2F0EA 3T51B 4JW0A 3S14H 2HT1A 4LFAL 4GKKL 1VQGA 4G7ZC 3PQIA 3N52A 2HUGA 4KN4C 2Y0SB 4XDXA 5C5MA 5LL6S 1H9SB 3J81c 4OO1I 2A6ED 3GO5A 3W3AA 4LF8L 2CH4W 5GQOA 5LMUQ 3LGJA 3G48A 1XMQL 1PV4A 3MFYA 2UXCL 1O7ZA 4LF6L 1TR5A 3AMUA 4ZRZA 4YCVA 1FL0A 1ZYRD 4JYAQ 3FHWA 1L0WA 1JT8A 3PUYA 3KDFA 3A7LA 4CJ2C 2K5VA 4RGOS 3W1GA 5A35A 1HR0L 1B1ZA 1GOZA 1S40A 3WWVA 2WINB 4O42A 3HKSA 4GNXC 5BR8Q 3WOFA 3S15B 3HEJA 1AH9A 1DJRD 4YY3L 1SNMA 5E4WC 2IX0A 1PHJA 2F0MA 4NB3A 2F3IA 1YZ6A 1EFID 5FLXL 3H94A 2XN9C 4FF4A 1UWVA 3TS0A 1KABA 4YHHQ 2XWJB 3GV6A 3K58A 3CW2C 5KRUA 2ENBA 3NTIA 3S1QB 3C1FA 1WTVA 1W6KA 2UUCQ 4P72A 3S1MH 3TSSA 4PMCA 3HOUH 3E9HA 1YVCA 3K57A 2A69C 4XQQA 1A3TA 1M1KC 1R9TB 4HMIA 3M4QA 4A3MH 3A56A 2NZOA 3K7AB 3HG9A 3MHBA 3ZYYX 1MHWC 4JYAL 4LF7Q 3J7A5 4P2CB 4B3SQ 3U58A 1D2BA 3I4MH 5DM63 5AFWA 1AE3A 3M4YA 3R93A 3CQZH 2HDMA 1CFMA 3KLSX 2E76C 1E2VA 5BR8L 2WKDA 4ID6A 1STHA 5FLXc 3HOUG 4K5WA 2PQAA 2DJFC 4BY1H 2NN6I 2F0DA 2D2CC 2B2VA 1RD9D 4L63B 4N8X1 4R4OA 1SYBA 1KNAA 2A6EC 4IFDJ 1Z6HA 4YHHL 1W3SA 4B08A 1EY7A 2ZJPA 3HOUB 3P7JA 5HGQA 3CXCA 4C2MB 2UUCL 3OMCA 3PF5A 1HH2P 3HOWH 3WDNA 1BVSA 2ZXRA 1ZYRC 4BBSH 1WD1A 2F0LA 1GD7A 3VR4A 2JA9A 3NELA 2B3GA 2Z4IA 2UXBQ 1H95A 4IALA 1J8IA 1SE8A 5AJ3L 4BY1G 5LMNL 5LMNW 2M9VA 1HUMA 2ICIA 4H02A 1AFPA 4B3SL 2Q8RE 2RVLA 2F52A 2B2TA 4DV5L 3J7AF 4FF2A 2R92H 3U4ZA 4DV6Q 4LUZA 3AEVA 2F0OA 4BY1B 4P71A 1TY2A 3J81j 4AQYL 4KI0A 4BBSG 3FVQA 1SYGA 3M7NA 5IGDA 2ZT9C 1VQNA 2B2UA 3SEBA 1JWMD 4B3MQ 4WFN3 4C1NK 3PO3G 4L5SA 1DOLA 3QIAA 2VL6A 4DK1A 4DR3L 3E5SA 1SFOB 2PO4A 3CAMA 2RA4A 3BZKA 2VXWA 3SGIA 1RF2D 1EIGA 1PH8A 3LX0A 2OT2A 1LV9A 3MXGA 1JCKB 3NTKA 4OXPA 3PO3B 1EQTA 4BA1I 4A93G 3K0XA 4ZUJA 4X3TA 1HZCA 2EYJA 4CJ1B 1QVFA 3UE1A 1WYDA 2Q8TA 1UE5A 1Y1VH 1MI2A 1CKNA 1K28A 1SMYC 5M9OA 1DD2A 2H4OA 1R4QB 4OELB 4PV1C 3K6OA 2Z8LA 4A93B 5CR3A 2LY7A 4KHVA 3RNUA 5C4HA 4ABNA 3M4PA 2ZTCA 2CKZB 2I5LX 2CWAA 1OXXK 2O5IC 1VCIA 3IFTA 1J6QA 5HURA 4DV0Q 3E6ZX 3O13A 3TEHB 1G2TA 3CCRA 3P75A 5JJIA 4QL5A 3S16B 5JJLA 1XMOL 2F3VA 2I46A 3DWQA 4RGMA 4PZ7A 2UXDL 1EU3A 2MO0A 3CCJA 3MTSA 1AZQA 1MKHA 5EBCA 3F2CA 1C7YA 2MO1A 1Y1VG 3TZDA 3NP8A 4B3ML 3V2TA 3AFPA 1CKNB 5TSSA 1EWCA 4F8MA 1B9NA 3S2HB 3DM3A 3TDQA 2VB2X 2N49A 1I5FA 2ZTEA 3VA5A 2CVRA 4JOIA 2C35B 3K7UC 2R7FA 2WAQE 2IWHA 5J3BA 4JC0A 1RCVD 1QVCA 3URYA 1PXUA 3FEWX 3QO2A 2XRSD 2LS01 3M4OH 3LWUA 3CC2A 1A63A 1E24A 2EY2A 5I9OA 3DM1A 3CC4A 3LWEA 4ILWA 1TU2B 1F9QA 3KOJA 3S2DB 3QR8A 2R61A 3JAME 1HNXQ 2PYKA 2HIXA 2VUMH 1NMFA 5C3EG 2X6LA 1HZ9A 1NR2A 4JCVE 4FVMA 4CHTB 4BBRH 4X64Q 5BN5A 4CDDC 5C0XJ 4NP5A 1SEBD 5IT9c 4X3SA 2N8NA 1PZKD 4IUUA 4EQNA 4FXGC 5KIXA 5C3EB 1BDOA 2VNUD 1YJ9A 3AB9A 2DUDA 4JPBW 2L9HA 1OO9B 2HD3A 5CV8A 2WKCA 3GTKH 5KGUA 3BZCA 5IYBH 4NPSA 1RKNA 3FRPB 4FDBA 3EBEA 1J5EQ 3MEHA 4JI6Q 3PIOA 1LUZA 1NAPA 3I70A 4J8QA 5D14A 1FJGQ 4IPGA 5IIFA 5JVH3 3J80i 5J39A 2AMCB 1RJTA 4A3EH 5IE8A 4A3IH 1WTPA 3BYYB 4BBRG 1N34Q 3JC66 4DV3Q 3NBHA 4QQBX 1XXGA 4JVZA 5COYA 1IKMA 3FDTA 1D1IA 4JI3L 3RN2A 3UI2A 2PPBC 2D62A 4OO1G 1PH7A 1YNXA 1HFNA 2B39A 5IYBG 4BBRB 4A3GH 3R3OA 4ZKBB 3U9SA 5C4XH 3OHXC 3GTGH 3CCUA 1N33Q 1EWIA 2HHHL 2Q2HA 5FLMH 4GLVB 3DWAA 2YTXA 3ITPA 4HCSA 4A3EG 5CBAE 4A3IG 4DAYA 3MXNA 4R4QA 1ICWA 4POFA 3NBHB 2EJGC 2NUCA 5JEAG 3PIO3 1HXYD 4JI2L 4DF7A 4DAVA 1HNZL 5ELFA 3T56B 1GUTA 1I3QB 1YNJD 2K5DA 4JV5L 3K80C 5HY6A 1J5EL 1PFMA 1A62A 1XYIA 4JI6L 1K83B 3HKZB 4A3EB 4X62Q 4A3IB 4YIJA 4A3GG 1I94L 4K8IA 1U0LA 5C4XG 4R1JA 4B3RQ 4XYOA 1X65A 2BH2A 3H3VI 3ICEA 1BR9A
chains in the Genus database with same CATH topology
3FKIG 4A3JH 3UDXA 2LXKA 3UDIA 4LF9Q 1VQ8A 1Q82C 4DV3L 1NMGA 1VQHA 1PH5A 1Q12A 4DV5Q 3GDEA 1N36L 1IL2A 2JJQA 1V1QA 2UXCQ 4A3DG 5E7NA 2E8GA 4NXML 2BA1A 4DAYB 3TS2A 2GVAA 5IYCH 2ZJRA 3MXNB 3RN5A 1X55A 5H1SE 2ALYB 1HJPA 1Y1WG 2XGTA 4DNIA 3PV0A 1IZ6A 4AQYQ 4XIGS 1O7IA 1VQ4A 2UUBQ 1V43A 1HR0Q 1E7ZA 1VQAA 2EQSA 1VQFA 2ZJQA 3S1RH 1IYJB 3PCOB 2VZAA 3TQYA 1SRUA 5M3MG 1KQSA 4DR2L 1OXUA 1KL9A 3CF5A 4JI1Q 4BY7H 1N33L 4HJAA 2Q2IA 5IP7H 1GKHA 2JA8H 4PZ8A 4DR3Q 3HOVH 1UE7A 1P16A 4OX9L 3H15A 3B6YA 3H0GH 5C0XI 2Y0SG 2KCTA 3EN2A 1C9OA 1CUKA 2EIFA 2NVYH 1T9HA 4DKAC 3G4SA 2HIVA 4DV0L 4A3JG 1SR3A 4JBKA 4DR4Q 4JI4Q 1SFOH 1SROA 4LF4Q 3PGZA 3S14H 2HT1A 2LSSA 4LFAL 3F2BA 4GS3A 4UP9A 1VQGA 3E0EA 4YCUA 4GKKL 5M3FH 5IYCG 4UP8A 2CFMA 3RLFA 1TWHH 1D7QA 1Q81C 3ZJYC 3OTOL 4A3FH 4IFDG 4MTNA 3PO3H 4DV2L 2F4VQ 1PH9A 1TWFH 1YBYA 2PQAB 4DK3C 3PUXA 4X62L 2VW9A 1PH4A 3J81c 4OO1I 1PFSA 2UUAQ 1X56A 3EIVA 4QJFA 3OYYA 3S15H 3GO5A 1PYSB 2NZHA 4A3LH 3GTJH 2I5MX 1PH3A 4LF8L 4A75A 1OXTA 4WJ3M 5GQOA 1BBWA 5IP7G 1TWGH 5LMUQ 2E5LL 3GTMH 1UE6A 4APVA 3HOVG 2DGYA 3LGJA 2KENA 3H0GG 3CCMA 4HJ9A 3G48A 1XMQL 1PV4A 4LF5Q 2VUMG 2LXJA 2UXCL 2QA4A 4LF6L 2V1CC 2WB1E 4DUYQ 2KHJA 2OTLA 5C4JH 4A93H 4YCVA 4HJ8A 2R6GA 2IHEA 1FL0A 4JG2A 4L5RC 2KBNA 3I7FA 3FHWA 1L0WA 4JYAQ 2K14A 4Y7NH 2UU9L 5EAYA 4DAMA 2R93G 5M5XH 3M3YH 1UE1A 1JT8A 3PUYA 1XMOQ 4JI7Q 3KDFA 5M3FG 2UUBL 2K5VA 3W1GA 1HR0L 1VQEA 2GN5A 1QZGA 3J7ZC 3CPFA 4YCWA 2UXDQ 3BU2A 5IWAQ 1S40A 3WWVA 2VQEQ 4A3FG 1N9WA 1OXSC 1EIFA 2JK8A 4DR6L 4GNXA 3S16H 4IO9A 1PVOA 3HKSA 4GNXC 5BR8Q 4GOPA 1AH9A 4YY3L 1JJ2A 4R4CA 2IX0A 4AYBE 1HNXL 3PIPA 3I55A 2FXQA 2JE6I 4A3LG 1PHJA 1NE3A 4ALPA 1X3FA 2F3IA 4NB3A 5JEAJ 1YZ6A 1IBLL 3CCEA 4X66L 4KLKA 1YHBA 4LF4L 3KFUA 1XPUA 1UWVA 3TS0A 1G6PA 1S3OA 1VQ9A 4P73A 2I0QA 4OWTB 4X64L 4NXNQ 3S2HH 4DR1Q 4YHHQ 2OQKA 4C3JH 4RG1A 1XPOA 1YHAA 1K0RA 3CW2C 3I2ZA 1TWCH 4IPDA 2F4VL 1I50H 2UUCQ 1N32L 2K52A 4P72A 1EYGA 3S1MH 2UUAL 4JI8Q 4QGUA 3TRZA 3HOUH 3E9HA 3KF8B 1YVCA 2AKWB 4GNXB 1EIYB 4LNQA 4UPAA 2QGQA 1XPRA 1M1KC 5DLQE 3HOZH 4A3CH 4KHPL 3M4QA 4A3MH 4A4IA 4JI0Q 2NZOA 1YIJA 2K5NA 4DUYL 2RHQB 3S2DH 4C3IH 1P8LA 2CCZA 1FJGL 3PSIA 2MNAA 3T1YQ 4LF7Q 1HZAA 4JYAL 3J7A5 1JJGA 4P74A 4B3SQ 3U58A 1N34L 2PI2E 3I4MH 4JI7L 2JQOA 5FLMG 3UE0A 3M85A 1Z9FA 1EFWA 1AE2A 3A5UA 4OONA 1AE3A 3CQZH 4LUVA 5IYDG 2ATWA 2YTVA 4UP7A 4MZ9A 3RLOA 4A3BH 5BR8L 3RLNA 1EQRA 2N78A 3GTLH 3CMEA 1XNQL 3T1HQ 5FLXc 4PZ6A 1NTGA 3HOUG 2PNHA 1YHQA 2PQAA 3E9IA 4BY1H 4A3CG 5C3EH 2NN6I 3J81i 4O2DA 4ME3A 2NVQH 4HIMA 3RZDH 4DV4Q 1YJWA 5JJKA 3PUWA 4R4OA 1ASYA 4IFDJ 4X65Q 4DR1L 4YHHL 1W3SA 1W2BA 3I4NG 3S17H 2ZJPA 2ZTDA 1XNRQ 1SMXA 4IPHA 1QZHA 1KIXA 2K50A 5HGQA 3CXCA 4GN3B 2UUCL 1SLJA 4IJHA 1L1OA 1XJVA 1L1OC 4P75A 1NJIC 3HKZE 4A76A 3PF5A 4AYBG 1HH2P 2HQLA 3HOWH 1BVSA 2JA6H 3CD6A 4DV7Q 4BBSH 1GD7A 4HIOA 4JI3Q 2JA9A 4O0AA 3NELA 2B3GA 2UXBQ 1YI2A 3OW2A 2YU9H 1PH2A 1H95A 1VS0A 1JJCB 1VQKA 4YWLA 2ES2A 4JI0L 2MQHA 4X6AH 3F2DA 3CMAA 1SE8A 1X6OA 1Q1BA 4BY1G 5AJ3L 2IY5B 5FJ8H 1LM0A 2YTYA 3L0OA 5LMNL 4HIDA 5LMNW 2PMZE 3T1YL 4B3RL 4BY7G 4IOAA 4H02A 4TQUS 3UDGA 4B3SL 1L2FA 2I5HA 2JA8G 3MEFA 1LYLA 2HHHQ 1SN8A 1IBKQ 2F52A 4DV5L 2VS1A 4GLAC 3NENA 1ASZA 4B3TQ 1X9NA 3ULPA 2ID0A 2R92H 3U4ZA 4DV6Q 4LUZA 3AEVA 1QUQB 2VQFQ 2OWOA 1L1OB 4P71A 4Y52H 5GROA 3J81j 4AQYL 4JV5Q 1E3PA 3D31A 4KI0A 4JI2Q 1CKOA 2KCMA 1VQOA 1HNZQ 1HR0W 2JA6G 4BBSG 4R4TA 3M7NA 4MNOA 2A19A 3L2PA 2IT1A 3NEMA 1VQIA 3A5ZB 1VQNA 4BA2I 4B3MQ 4JI1L 5GAHC 2ZM6Q 4DR7Q 3PO3G 5C0XG 4L5SA 4DV4L 1IXRA 1DGSA 4A3KH 1Q86C 4LFCQ 3U50C 2VL6A 4DR3L 1D8LA 1I3QH 1KXLA 4HIKA 4QY7A 2QEXA 5FJ8G 1I94Q 3CAMA 3BZKA 1A0IA 3SGIA 1VQLA 1XNRL 1K83H 1JB7A 4QIWE 1PH8A 1M90C 1GM5A 3ULLA 1IBMQ 4JI4L 2A8VA 4DR4L 1Q46A 1X3EA 3GTOH 1KAWA 2JA5H 2WFWA 3CCLA 3HOYH 1C0AA 4OXPA 2Z6KC 2VY3A 4BA1I 1HZBA 3HOXH 3K0XA 2Q2UA 4NXMQ 3PO2H 4A93G 1HZCA 4GLXA 1QVFA 3UE1A 5ELOA 4YWKA 1CKMA 1WYDA 1UE5A 4HJ5A 2JEBI 1Y1VH 1WCMH 3Q8DA 1UEBA 1CKNA 4DR5Q 3W1BA 2R7ZH 2Z0SA 1YEZA 1VQMA 4JI5Q 4DR2Q 3RZOH 3I4OA 2JEAI 2OTJA 1JE5A 5LMUL 3FKIH 3ULJA 2JA7H 3RNUA 3CPWA 1IBKL 1KRSA 1VQ6A 3M4PA 4LF5L 3RR5A 2ZTCA 3J80c 2CKZB 1EOVA 3F8TA 4B3TL 3ICEA 2I5LX 4GKJQ 3K8AA 2CWAA 1OXXK 3HKZG 1VCIA 2D0PA 1J6QA 4DV0Q 4EX5A 2VQFL 3TEHB 2JA5G 3CCRA 3HOYG 1TWAH 2IHFA 5JJIA 4QL5A 1N8RC 5JJLA 1XMOL 1PA6A 2B63H 3HOXG 1S72A 4PZ7A 4GKKQ 2UXDL 3CCSA 4IPCA 2MO0A 5IWAL 3CCJA 4K0KQ 2VQEL 1MKHA 3F2CA 1PYBA 1C7YA 2MO1A 1Y1VG 4B3ML 2B29A 1KHIA 2K75A 3AFPA 1CKNB 1Z47A 4LFCL 1K73C 3CC7A 4JBWA 4JBJA 4IFDI 1I6HH 2YV5A 4OWWB 1E1OA 1NY4A 4DV1Q 2AWOA 3H3VH 3HOZG 3GTQH 1KD1C 1B70B 4GN4B 2WB1G 3DM3A 4LF8Q 1KC8C 1IBML 2JA7G 1X3GA 2E5LQ 2N49A 3JAMc 1I5FA 1HNWQ 4A3MG 2ZTEA 1K8GA 2YYZA 3W5OA 3A74A 4POGA 4JOIA 2C35B 1XMQQ 4NXNL 3K7UC 4JOIC 4J15A 2R7FA 4LF6Q 2WAQE 1VQBA 5J3BA 4JC0A 3HFZB 4L5QA 3S1NH 3F1ZA 1QVCA 3I4MG 2UU9Q 4YWMA 2B63G 1QUQA 1GVPA 4DR5L 1PH1A 4JI8L 3S24A 3M4OH 3CC2A 1A63A 1E24A 3STBD 1VQCA 1Q8KA 5C44H 5ELNA 3U4VA 4JI5L 3G6EA 2E2JH 3CCVA 4LW1A 5GADC 3CC4A 4A3BG 4DR6Q 4KHZA 1A8VA 3KOJA 3DLLA 3PUVA 2WP8J 3UDFA 4AH6A 4YY3Q 4BXXH 1FGUA 1EUJA 1HNXQ 2AHOB 2HIXA 2VUMH 1NMFA 4GKJL 4LFBQ 3AFQA 4DK6C 5C3EG 2AWNA 1VQPA 1WJJA 1IBLQ 4JBMA 1MIUA 4LF7L 2K4KA 3CCQA 4X66Q 1YITA 2ASBA 1HZ9A 2A1AA 5GAGC 4EQ5A 2R93H 4JCVE 4BBRH 3A0JA 4X64Q 1VQJA 4DUZQ 2XTIA 1NBWA 2L15A 4WJ4A 4RMFA 2N3SA 5C0XJ 4K0KL 5IT9c 1WOCA 3KJPA 1PH6A 2N8NA 4GN5A 3ER0A 2CWPA 1K3RA 3CP0A 2PI2A 1E22A 4PMWA 4L5TA 3T1HL 3G71A 1N32Q 2VNUD 2NN6G 1YJ9A 5C44G 4DV1L 3HOWG 2DUDA 4AIMA 1Q7YC 3GTKH 3I56A 3S1QH 3BZCA 5IYBH 2K5HA 4NPSA 1KRTA 4FDBA 1HNWL 3EBEA 5IP9H 1J5EQ 2GVBA 4UY8C 4BXXG 1G51A 2D0OA 3PIOA 1LUZA 4JI6Q 4KHPQ 3IRBA 4X65L 1Y14B 1V9PA 1BKBA 2RCNA 1R9TH 1FJGQ 2OQ0A 4IPGA 1CSQA 3J80i 2AMCB 1QVGA 4A3EH 2E2IH 1Q1EA 5IE8A 4A3IH 3K7AH 3TREA 4BBRG 1N34Q 2RF4A 3JC66 3GD7A 4DV3Q 2Y0SE 2Z6KA 4QQBX 1MJCA 1N36Q 1TXYA 2R92G 1E1TA 2BH8A 4DV7L 4HJ7A 1CSPA 1RL2A 4JI3L 4LWCA 3RN2A 2D62A 1JMCA 4OO1G 2UXBL 1XNQQ 1PH7A 4GOPC 1BBUA 1YNXA 1VQ7A 2NVTH 2NVXH 4LFBL 2RHSB 5GAEC 3K81C 5IY0A 5IYBG 1OTCA 1WI5A 4A3GH 4OWXB 4LF9L 2WAQG 1YJNA 5C4XH 5IP9G 3KF6A 1LTLA 3GTGH 3CCUA 4A3KG 1N33Q 3GTPH 1EWIA 1VQDA 2HHHL 4XTCS 4DUZL 1FVIA 2H5XA 4OX9Q 1U5KA 2R7DA 2Q2HA 5FLMH 4GLVB 3JAMi 1WFQA 1MJEA 1X54A 1XTDA 2YTXA 2IX1A 5K36G 3BJUA 4DV6L 4A3EG 4A3DH 1EQQA 1K8AC 5IYDH 4A3IG 1VQ5A 2EXDA 4R4IA 3KDFB 4R4QA 3KYHC 4DPGA 3NBHB 4POFA 3VDYA 3PUZA 5JEAG 3AYHB 4LUOA 3KJOA 4IJLA 1Y1WH 4LFAQ 2Q2TA 4JI2L 3PO2G 1HNZL 3FP9A 3KLWA 3L7ZC 4IOCA 2KHIA 4JV5L 1B7YB 4C2MH 2CQOA 4GOPB 3PF4A 3K80C 5M3MH 3OTOQ 2ZM6L 4DR7L 5HY6A 1G291 3AQQA 1WCMG 1J5EL 3M9BA 1A62A 5M5WH 1K9MC 1GO3E 4JI6L 2OCEA 4DV2Q 1RIPA 4X62Q 3STBC 2R7ZG 4A3GG 1I94L 5AJ3Q 2MFIA 1U0LA 4TVAB 5M5YH 5C4XG 3KF6B 4R1JA 5LMNQ 2E2HH 4B3RQ 3I4NH 1X65A 1OXVA 4PG3A 3ERSX 2BH2A 3H3VI 4C3HH 2BA0A 3D0FA 1B8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI G;  4A3J H;  3UDX A;  2LXK A;  3UDI A;  4LF9 Q;  1VQ8 A;  1Q82 C;  4DV3 L;  1NMG A;  1VQH A;  1PH5 A;  1Q12 A;  4DV5 Q;  3GDE A;  1N36 L;  1IL2 A;  2JJQ A;  1V1Q A;  2UXC Q;  4A3D G;  5E7N A;  2E8G A;  4NXM L;  2BA1 A;  4DAY B;  3TS2 A;  2GVA A;  5IYC H;  2ZJR A;  3MXN B;  3RN5 A;  1X55 A;  5H1S E;  2ALY B;  1HJP A;  1Y1W G;  2XGT A;  4DNI A;  3PV0 A;  1IZ6 A;  4AQY Q;  4XIG S;  1O7I A;  1VQ4 A;  2UUB Q;  1V43 A;  1HR0 Q;  1E7Z A;  1VQA A;  2EQS A;  1VQF A;  2ZJQ A;  3S1R H;  1IYJ B;  3PCO B;  2VZA A;  3TQY A;  1SRU A;  5M3M G;  1KQS A;  4DR2 L;  1OXU A;  1KL9 A;  3CF5 A;  4JI1 Q;  4BY7 H;  1N33 L;  4HJA A;  2Q2I A;  5IP7 H;  1GKH A;  2JA8 H;  4PZ8 A;  4DR3 Q;  3HOV H;  1UE7 A;  1P16 A;  4OX9 L;  3H15 A;  3B6Y A;  3H0G H;  5C0X I;  2Y0S G;  2KCT A;  3EN2 A;  1C9O A;  1CUK A;  2EIF A;  2NVY H;  1T9H A;  4DKA C;  3G4S A;  2HIV A;  4DV0 L;  4A3J G;  1SR3 A;  4JBK A;  4DR4 Q;  4JI4 Q;  1SFO H;  1SRO A;  4LF4 Q;  3PGZ A;  3S14 H;  2HT1 A;  2LSS A;  4LFA L;  3F2B A;  4GS3 A;  4UP9 A;  1VQG A;  3E0E A;  4YCU A;  4GKK L;  5M3F H;  5IYC G;  4UP8 A;  2CFM A;  3RLF A;  1TWH H;  1D7Q A;  1Q81 C;  3ZJY C;  3OTO L;  4A3F H;  4IFD G;  4MTN A;  3PO3 H;  4DV2 L;  2F4V Q;  1PH9 A;  1TWF H;  1YBY A;  2PQA B;  4DK3 C;  3PUX A;  4X62 L;  2VW9 A;  1PH4 A;  3J81 c;  4OO1 I;  1PFS A;  2UUA Q;  1X56 A;  3EIV A;  4QJF A;  3OYY A;  3S15 H;  3GO5 A;  1PYS B;  2NZH A;  4A3L H;  3GTJ H;  2I5M X;  1PH3 A;  4LF8 L;  4A75 A;  1OXT A;  4WJ3 M;  5GQO A;  1BBW A;  5IP7 G;  1TWG H;  5LMU Q;  2E5L L;  3GTM H;  1UE6 A;  4APV A;  3HOV G;  2DGY A;  3LGJ A;  2KEN A;  3H0G G;  3CCM A;  4HJ9 A;  3G48 A;  1XMQ L;  1PV4 A;  4LF5 Q;  2VUM G;  2LXJ A;  2UXC L;  2QA4 A;  4LF6 L;  2V1C C;  2WB1 E;  4DUY Q;  2KHJ A;  2OTL A;  5C4J H;  4A93 H;  4YCV A;  4HJ8 A;  2R6G A;  2IHE A;  1FL0 A;  4JG2 A;  4L5R C;  2KBN A;  3I7F A;  3FHW A;  1L0W A;  4JYA Q;  2K14 A;  4Y7N H;  2UU9 L;  5EAY A;  4DAM A;  2R93 G;  5M5X H;  3M3Y H;  1UE1 A;  1JT8 A;  3PUY A;  1XMO Q;  4JI7 Q;  3KDF A;  5M3F G;  2UUB L;  2K5V A;  3W1G A;  1HR0 L;  1VQE A;  2GN5 A;  1QZG A;  3J7Z C;  3CPF A;  4YCW A;  2UXD Q;  3BU2 A;  5IWA Q;  1S40 A;  3WWV A;  2VQE Q;  4A3F G;  1N9W A;  1OXS C;  1EIF A;  2JK8 A;  4DR6 L;  4GNX A;  3S16 H;  4IO9 A;  1PVO A;  3HKS A;  4GNX C;  5BR8 Q;  4GOP A;  1AH9 A;  4YY3 L;  1JJ2 A;  4R4C A;  2IX0 A;  4AYB E;  1HNX L;  3PIP A;  3I55 A;  2FXQ A;  2JE6 I;  4A3L G;  1PHJ A;  1NE3 A;  4ALP A;  1X3F A;  2F3I A;  4NB3 A;  5JEA J;  1YZ6 A;  1IBL L;  3CCE A;  4X66 L;  4KLK A;  1YHB A;  4LF4 L;  3KFU A;  1XPU A;  1UWV A;  3TS0 A;  1G6P A;  1S3O A;  1VQ9 A;  4P73 A;  2I0Q A;  4OWT B;  4X64 L;  4NXN Q;  3S2H H;  4DR1 Q;  4YHH Q;  2OQK A;  4C3J H;  4RG1 A;  1XPO A;  1YHA A;  1K0R A;  3CW2 C;  3I2Z A;  1TWC H;  4IPD A;  2F4V L;  1I50 H;  2UUC Q;  1N32 L;  2K52 A;  4P72 A;  1EYG A;  3S1M H;  2UUA L;  4JI8 Q;  4QGU A;  3TRZ A;  3HOU H;  3E9H A;  3KF8 B;  1YVC A;  2AKW B;  4GNX B;  1EIY B;  4LNQ A;  4UPA A;  2QGQ A;  1XPR A;  1M1K C;  5DLQ E;  3HOZ H;  4A3C H;  4KHP L;  3M4Q A;  4A3M H;  4A4I A;  4JI0 Q;  2NZO A;  1YIJ A;  2K5N A;  4DUY L;  2RHQ B;  3S2D H;  4C3I H;  1P8L A;  2CCZ A;  1FJG L;  3PSI A;  2MNA A;  3T1Y Q;  4LF7 Q;  1HZA A;  4JYA L;  3J7A 5;  1JJG A;  4P74 A;  4B3S Q;  3U58 A;  1N34 L;  2PI2 E;  3I4M H;  4JI7 L;  2JQO A;  5FLM G;  3UE0 A;  3M85 A;  1Z9F A;  1EFW A;  1AE2 A;  3A5U A;  4OON A;  1AE3 A;  3CQZ H;  4LUV A;  5IYD G;  2ATW A;  2YTV A;  4UP7 A;  4MZ9 A;  3RLO A;  4A3B H;  5BR8 L;  3RLN A;  1EQR A;  2N78 A;  3GTL H;  3CME A;  1XNQ L;  3T1H Q;  5FLX c;  4PZ6 A;  1NTG A;  3HOU G;  2PNH A;  1YHQ A;  2PQA A;  3E9I A;  4BY1 H;  4A3C G;  5C3E H;  2NN6 I;  3J81 i;  4O2D A;  4ME3 A;  2NVQ H;  4HIM A;  3RZD H;  4DV4 Q;  1YJW A;  5JJK A;  3PUW A;  4R4O A;  1ASY A;  4IFD J;  4X65 Q;  4DR1 L;  4YHH L;  1W3S A;  1W2B A;  3I4N G;  3S17 H;  2ZJP A;  2ZTD A;  1XNR Q;  1SMX A;  4IPH A;  1QZH A;  1KIX A;  2K50 A;  5HGQ A;  3CXC A;  4GN3 B;  2UUC L;  1SLJ A;  4IJH A;  1L1O A;  1XJV A;  1L1O C;  4P75 A;  1NJI C;  3HKZ E;  4A76 A;  3PF5 A;  4AYB G;  1HH2 P;  2HQL A;  3HOW H;  1BVS A;  2JA6 H;  3CD6 A;  4DV7 Q;  4BBS H;  1GD7 A;  4HIO A;  4JI3 Q;  2JA9 A;  4O0A A;  3NEL A;  2B3G A;  2UXB Q;  1YI2 A;  3OW2 A;  2YU9 H;  1PH2 A;  1H95 A;  1VS0 A;  1JJC B;  1VQK A;  4YWL A;  2ES2 A;  4JI0 L;  2MQH A;  4X6A H;  3F2D A;  3CMA A;  1SE8 A;  1X6O A;  1Q1B A;  4BY1 G;  5AJ3 L;  2IY5 B;  5FJ8 H;  1LM0 A;  2YTY A;  3L0O A;  5LMN L;  4HID A;  5LMN W;  2PMZ E;  3T1Y L;  4B3R L;  4BY7 G;  4IOA A;  4H02 A;  4TQU S;  3UDG A;  4B3S L;  1L2F A;  2I5H A;  2JA8 G;  3MEF A;  1LYL A;  2HHH Q;  1SN8 A;  1IBK Q;  2F52 A;  4DV5 L;  2VS1 A;  4GLA C;  3NEN A;  1ASZ A;  4B3T Q;  1X9N A;  3ULP A;  2ID0 A;  2R92 H;  3U4Z A;  4DV6 Q;  4LUZ A;  3AEV A;  1QUQ B;  2VQF Q;  2OWO A;  1L1O B;  4P71 A;  4Y52 H;  5GRO A;  3J81 j;  4AQY L;  4JV5 Q;  1E3P A;  3D31 A;  4KI0 A;  4JI2 Q;  1CKO A;  2KCM A;  1VQO A;  1HNZ Q;  1HR0 W;  2JA6 G;  4BBS G;  4R4T A;  3M7N A;  4MNO A;  2A19 A;  3L2P A;  2IT1 A;  3NEM A;  1VQI A;  3A5Z B;  1VQN A;  4BA2 I;  4B3M Q;  4JI1 L;  5GAH C;  2ZM6 Q;  4DR7 Q;  3PO3 G;  5C0X G;  4L5S A;  4DV4 L;  1IXR A;  1DGS A;  4A3K H;  1Q86 C;  4LFC Q;  3U50 C;  2VL6 A;  4DR3 L;  1D8L A;  1I3Q H;  1KXL A;  4HIK A;  4QY7 A;  2QEX A;  5FJ8 G;  1I94 Q;  3CAM A;  3BZK A;  1A0I A;  3SGI A;  1VQL A;  1XNR L;  1K83 H;  1JB7 A;  4QIW E;  1PH8 A;  1M90 C;  1GM5 A;  3ULL A;  1IBM Q;  4JI4 L;  2A8V A;  4DR4 L;  1Q46 A;  1X3E A;  3GTO H;  1KAW A;  2JA5 H;  2WFW A;  3CCL A;  3HOY H;  1C0A A;  4OXP A;  2Z6K C;  2VY3 A;  4BA1 I;  1HZB A;  3HOX H;  3K0X A;  2Q2U A;  4NXM Q;  3PO2 H;  4A93 G;  1HZC A;  4GLX A;  1QVF A;  3UE1 A;  5ELO A;  4YWK A;  1CKM A;  1WYD A;  1UE5 A;  4HJ5 A;  2JEB I;  1Y1V H;  1WCM H;  3Q8D A;  1UEB A;  1CKN A;  4DR5 Q;  3W1B A;  2R7Z H;  2Z0S A;  1YEZ A;  1VQM A;  4JI5 Q;  4DR2 Q;  3RZO H;  3I4O A;  2JEA I;  2OTJ A;  1JE5 A;  5LMU L;  3FKI H;  3ULJ A;  2JA7 H;  3RNU A;  3CPW A;  1IBK L;  1KRS A;  1VQ6 A;  3M4P A;  4LF5 L;  3RR5 A;  2ZTC A;  3J80 c;  2CKZ B;  1EOV A;  3F8T A;  4B3T L;  3ICE A;  2I5L X;  4GKJ Q;  3K8A A;  2CWA A;  1OXX K;  3HKZ G;  1VCI A;  2D0P A;  1J6Q A;  4DV0 Q;  4EX5 A;  2VQF L;  3TEH B;  2JA5 G;  3CCR A;  3HOY G;  1TWA H;  2IHF A;  5JJI A;  4QL5 A;  1N8R C;  5JJL A;  1XMO L;  1PA6 A;  2B63 H;  3HOX G;  1S72 A;  4PZ7 A;  4GKK Q;  2UXD L;  3CCS A;  4IPC A;  2MO0 A;  5IWA L;  3CCJ A;  4K0K Q;  2VQE L;  1MKH A;  3F2C A;  1PYB A;  1C7Y A;  2MO1 A;  1Y1V G;  4B3M L;  2B29 A;  1KHI A;  2K75 A;  3AFP A;  1CKN B;  1Z47 A;  4LFC L;  1K73 C;  3CC7 A;  4JBW A;  4JBJ A;  4IFD I;  1I6H H;  2YV5 A;  4OWW B;  1E1O A;  1NY4 A;  4DV1 Q;  2AWO A;  3H3V H;  3HOZ G;  3GTQ H;  1KD1 C;  1B70 B;  4GN4 B;  2WB1 G;  3DM3 A;  4LF8 Q;  1KC8 C;  1IBM L;  2JA7 G;  1X3G A;  2E5L Q;  2N49 A;  3JAM c;  1I5F A;  1HNW Q;  4A3M G;  2ZTE A;  1K8G A;  2YYZ A;  3W5O A;  3A74 A;  4POG A;  4JOI A;  2C35 B;  1XMQ Q;  4NXN L;  3K7U C;  4JOI C;  4J15 A;  2R7F A;  4LF6 Q;  2WAQ E;  1VQB A;  5J3B A;  4JC0 A;  3HFZ B;  4L5Q A;  3S1N H;  3F1Z A;  1QVC A;  3I4M G;  2UU9 Q;  4YWM A;  2B63 G;  1QUQ A;  1GVP A;  4DR5 L;  1PH1 A;  4JI8 L;  3S24 A;  3M4O H;  3CC2 A;  1A63 A;  1E24 A;  3STB D;  1VQC A;  1Q8K A;  5C44 H;  5ELN A;  3U4V A;  4JI5 L;  3G6E A;  2E2J H;  3CCV A;  4LW1 A;  5GAD C;  3CC4 A;  4A3B G;  4DR6 Q;  4KHZ A;  1A8V A;  3KOJ A;  3DLL A;  3PUV A;  2WP8 J;  3UDF A;  4AH6 A;  4YY3 Q;  4BXX H;  1FGU A;  1EUJ A;  1HNX Q;  2AHO B;  2HIX A;  2VUM H;  1NMF A;  4GKJ L;  4LFB Q;  3AFQ A;  4DK6 C;  5C3E G;  2AWN A;  1VQP A;  1WJJ A;  1IBL Q;  4JBM A;  1MIU A;  4LF7 L;  2K4K A;  3CCQ A;  4X66 Q;  1YIT A;  2ASB A;  1HZ9 A;  2A1A A;  5GAG C;  4EQ5 A;  2R93 H;  4JCV E;  4BBR H;  3A0J A;  4X64 Q;  1VQJ A;  4DUZ Q;  2XTI A;  1NBW A;  2L15 A;  4WJ4 A;  4RMF A;  2N3S A;  5C0X J;  4K0K L;  5IT9 c;  1WOC A;  3KJP A;  1PH6 A;  2N8N A;  4GN5 A;  3ER0 A;  2CWP A;  1K3R A;  3CP0 A;  2PI2 A;  1E22 A;  4PMW A;  4L5T A;  3T1H L;  3G71 A;  1N32 Q;  2VNU D;  2NN6 G;  1YJ9 A;  5C44 G;  4DV1 L;  3HOW G;  2DUD A;  4AIM A;  1Q7Y C;  3GTK H;  3I56 A;  3S1Q H;  3BZC A;  5IYB H;  2K5H A;  4NPS A;  1KRT A;  4FDB A;  1HNW L;  3EBE A;  5IP9 H;  1J5E Q;  2GVB A;  4UY8 C;  4BXX G;  1G51 A;  2D0O A;  3PIO A;  1LUZ A;  4JI6 Q;  4KHP Q;  3IRB A;  4X65 L;  1Y14 B;  1V9P A;  1BKB A;  2RCN A;  1R9T H;  1FJG Q;  2OQ0 A;  4IPG A;  1CSQ A;  3J80 i;  2AMC B;  1QVG A;  4A3E H;  2E2I H;  1Q1E A;  5IE8 A;  4A3I H;  3K7A H;  3TRE A;  4BBR G;  1N34 Q;  2RF4 A;  3JC6 6;  3GD7 A;  4DV3 Q;  2Y0S E;  2Z6K A;  4QQB X;  1MJC A;  1N36 Q;  1TXY A;  2R92 G;  1E1T A;  2BH8 A;  4DV7 L;  4HJ7 A;  1CSP A;  1RL2 A;  4JI3 L;  4LWC A;  3RN2 A;  2D62 A;  1JMC A;  4OO1 G;  2UXB L;  1XNQ Q;  1PH7 A;  4GOP C;  1BBU A;  1YNX A;  1VQ7 A;  2NVT H;  2NVX H;  4LFB L;  2RHS B;  5GAE C;  3K81 C;  5IY0 A;  5IYB G;  1OTC A;  1WI5 A;  4A3G H;  4OWX B;  4LF9 L;  2WAQ G;  1YJN A;  5C4X H;  5IP9 G;  3KF6 A;  1LTL A;  3GTG H;  3CCU A;  4A3K G;  1N33 Q;  3GTP H;  1EWI A;  1VQD A;  2HHH L;  4XTC S;  4DUZ L;  1FVI A;  2H5X A;  4OX9 Q;  1U5K A;  2R7D A;  2Q2H A;  5FLM H;  4GLV B;  3JAM i;  1WFQ A;  1MJE A;  1X54 A;  1XTD A;  2YTX A;  2IX1 A;  5K36 G;  3BJU A;  4DV6 L;  4A3E G;  4A3D H;  1EQQ A;  1K8A C;  5IYD H;  4A3I G;  1VQ5 A;  2EXD A;  4R4I A;  3KDF B;  4R4Q A;  3KYH C;  4DPG A;  3NBH B;  4POF A;  3VDY A;  3PUZ A;  5JEA G;  3AYH B;  4LUO A;  3KJO A;  4IJL A;  1Y1W H;  4LFA Q;  2Q2T A;  4JI2 L;  3PO2 G;  1HNZ L;  3FP9 A;  3KLW A;  3L7Z C;  4IOC A;  2KHI A;  4JV5 L;  1B7Y B;  4C2M H;  2CQO A;  4GOP B;  3PF4 A;  3K80 C;  5M3M H;  3OTO Q;  2ZM6 L;  4DR7 L;  5HY6 A;  1G29 1;  3AQQ A;  1WCM G;  1J5E L;  3M9B A;  1A62 A;  5M5W H;  1K9M C;  1GO3 E;  4JI6 L;  2OCE A;  4DV2 Q;  1RIP A;  4X62 Q;  3STB C;  2R7Z G;  4A3G G;  1I94 L;  5AJ3 Q;  2MFI A;  1U0L A;  4TVA B;  5M5Y H;  5C4X G;  3KF6 B;  4R1J A;  5LMN Q;  2E2H H;  4B3R Q;  3I4N H;  1X65 A;  1OXV A;  4PG3 A;  3ERS X;  2BH2 A;  3H3V I;  4C3H H;  2BA0 A;  3D0F A;  1B8A A; 
#chains in the Genus database with same CATH topology
 2K01 A;  3UDX A;  4OHJ A;  4QUC A;  3TP6 A;  4EGV A;  4DV3 L;  1NMG A;  1VQH A;  1TS5 A;  3GDE A;  2JJQ A;  4NXM L;  4DAY B;  2M00 A;  3MXN B;  3RN5 A;  2TSS A;  5H1S E;  2ALY B;  2XGT A;  1AEX A;  1Y8N B;  3PV0 A;  2QDL A;  3H3V C;  3QB3 A;  1E7Z A;  1VQA A;  2EQS A;  4IQZ A;  1IYJ B;  3TQY A;  1SRU A;  3CF5 A;  2EYF A;  4K6L A;  1N33 L;  4BY7 H;  2B2V C;  1SYC A;  2QDB A;  2RDG A;  2Q2I A;  3QOJ A;  4UHV A;  5IP7 H;  4KKT A;  1D5Z C;  1STG A;  4DU9 A;  5LHY 1;  1P16 A;  3B6Y A;  3H0G H;  4XT3 B;  3EN2 A;  2KCT A;  2EDG A;  4EQP A;  2HIV A;  1EL0 A;  2B8F A;  1EOT A;  1CZG A;  3PGZ A;  1SE4 A;  5M3F H;  3RLF A;  2CFM A;  1TWH H;  2WII B;  1O7Y A;  3OPO A;  1HHV A;  2B2W A;  4MTN A;  1PH9 A;  1YBY A;  4X62 L;  2VW9 A;  1PH4 A;  3MXP A;  5ELE A;  2UUA Q;  3EVQ A;  1PFB A;  3DUZ A;  3EIV A;  4QJF A;  5KNB A;  1QCB D;  1E2W A;  2NZH A;  2L55 A;  3VYU A;  2I5M X;  1TS3 A;  4A75 A;  5IP7 G;  3J7A V;  1TWG H;  4APV A;  2DGY A;  3H0G G;  3NHH A;  3DXJ C;  1DM0 B;  1EY5 A;  3KLR A;  4HN7 A;  4ZYS A;  3K59 A;  1QJO A;  2B2T C;  2OTL A;  4DAP A;  4TSS A;  4JG2 A;  4L5R C;  1M4V A;  2K14 A;  3N6R A;  5M5X H;  1LO5 D;  3M3Y H;  4CJ0 B;  5M3F G;  1EZ8 A;  1U4M A;  2GN5 A;  1QZG A;  1DZ1 A;  3J81 E;  1PFN A;  3BU2 A;  3IL8 A;  3H0G B;  1EIF A;  2JK8 A;  4DR6 L;  2B2U C;  2Z6B A;  5CGK A;  4IO9 A;  1PVO A;  3I73 A;  1LT5 D;  3NXW A;  4AYB E;  2HDL A;  1PTO D;  3I55 A;  1YNJ C;  1GUN A;  1EZ6 A;  2JE6 I;  1NSN S;  4ALP A;  1IBL L;  4X66 L;  1YHB A;  1Z7T A;  3KFU A;  1I4X A;  1S3O A;  1AN8 A;  1VQ9 A;  4HR7 B;  3MAQ A;  3FPP A;  1A2T A;  2TMP A;  3HOX B;  4M1U B;  4DR1 Q;  1JE4 A;  4RG1 A;  2AQ3 B;  4DN4 M;  1PRT B;  1UAP A;  4ZKC B;  1TWC H;  4LAA A;  1HCZ A;  4IPD A;  1N32 L;  2D9U A;  2UUA L;  2F0W A;  1FNW A;  3TRZ A;  1EIY B;  4LNQ A;  1AW7 A;  2EYL A;  2QIL A;  4FP5 D;  5I9P A;  4CGY B;  5EKL A;  1SYD A;  2E2I B;  5M5X B;  1FGB D;  1YIJ A;  2K5N A;  2K03 A;  3SE0 A;  1Q3L A;  4C3I H;  1ZXT A;  2EYH A;  3J81 L;  3I91 A;  4P74 A;  2F0N A;  2PZT A;  3BS1 A;  4RFB A;  3X3M A;  1I4Q A;  3UE0 A;  1WTR A;  1AE2 A;  1KDC A;  2PW5 A;  3IKJ A;  5IYD G;  2NVT B;  4ZAI A;  4UP7 A;  2OF1 A;  4A3B H;  4XXE A;  1GUS A;  3GTL H;  5I4D A;  3T1H Q;  1KDB A;  1NTG A;  3L9A X;  4Q0F A;  1H9S A;  1STY A;  3H6M A;  5EBD A;  1JR0 D;  2EYO A;  2NVQ H;  4ME3 A;  5HGT A;  3RZD H;  4DV4 Q;  1YJW A;  4XT1 B;  1ZKO A;  3KBG A;  1ASY A;  1CHQ D;  4X65 Q;  4DR1 L;  2K5Q A;  1H9R A;  1WTO A;  1GHJ A;  5J1Z A;  3VYT A;  1SMX A;  3C3L A;  1SXT A;  4GN3 B;  1SLJ A;  3EQL C;  4RCO A;  1LTG D;  1L1O C;  5A2Q E;  1DYQ A;  3HKZ E;  5M5W B;  5FLX E;  4IN3 A;  4A76 A;  1G2S A;  2HQL A;  2JA6 H;  3K0Y A;  4DV7 Q;  4HIO A;  1A3U A;  5M5Y B;  2FHT A;  5D3D A;  1YI2 A;  1F2M A;  4YWL A;  2MJ8 A;  2P5Z X;  4X6A H;  2OXP A;  2N88 A;  2IY5 B;  1LAB A;  3KUP A;  5FJ8 H;  2RDF A;  2YTY A;  3L0O A;  5FO8 B;  3K5N A;  4HID A;  2BDO A;  2XSC A;  4IOA A;  1C4Q A;  3VR5 A;  4DGZ A;  4TQU S;  3UDG A;  4I65 A;  1LYL A;  1SN8 A;  1PTO C;  5EJW A;  2EY6 A;  2SDF A;  4B3T Q;  3DMU A;  1X9N A;  3G7L A;  3S1R B;  3BG3 A;  1XTC D;  4Y52 H;  5GRO A;  1PLF A;  4DNT B;  1STB A;  2KCM A;  2JA6 G;  1HR0 W;  2L12 A;  4R4T A;  3L2P A;  2IT1 A;  3NEM A;  4KD3 A;  4JI1 L;  2ZM6 Q;  4DV4 L;  1IXR A;  1QG7 A;  2F0K A;  4A3K H;  3U50 C;  4CDE C;  4HIK A;  2QEX A;  5FJ8 G;  4H13 C;  3S14 B;  2IX3 A;  1B44 D;  1GHK A;  5A2Q L;  2NYZ D;  1M90 C;  2X69 A;  1GM5 A;  3ULL A;  1Q46 A;  1X3E A;  4K2K A;  1KAW A;  3GTO H;  2WFW A;  3HOY H;  1F2L A;  3R8B A;  1HZB A;  5FO9 B;  4PMB A;  4GLX A;  4KJN A;  2F3W A;  4R9W A;  4QMG A;  1LTA D;  2SNM A;  1WCM H;  2A6H D;  3HGB A;  3Q8D A;  2F0V A;  4IZ8 A;  4DR5 Q;  2R7Z H;  2Z0S A;  1VQM A;  2F0T A;  2RCF A;  3I4O A;  2JEA I;  5LMU L;  5JOB A;  3MVV A;  4IUR A;  1KRS A;  3H09 A;  3E0J A;  4B3T L;  4GKJ Q;  3OMG A;  5D65 A;  4EX5 A;  4MIU A;  2C5C A;  3HOY G;  1TWA H;  2IHF A;  2JYO A;  2B63 H;  3SK5 A;  4B9W A;  4MHE A;  2PW7 A;  1PYB A;  2B29 A;  4RKL A;  1EY8 A;  1I6H H;  1I4P A;  4KJO A;  1SNO A;  3ERQ A;  3NBI A;  3HOY B;  3BDL A;  1BCP B;  2AWO A;  3QOL A;  1VF7 A;  5CBE E;  3H3V H;  1ET6 A;  3GTQ H;  1KD1 C;  2WB1 G;  3VYS A;  2QKI C;  2E5L Q;  4A3M G;  2SEB D;  4L6T B;  3W5O A;  3HP3 A;  2NB0 A;  1H9M A;  4CKC A;  4F87 A;  4UAI A;  3S1N H;  3HFZ B;  3S1M B;  2XVS A;  2FJ2 A;  4QF4 A;  3G6J B;  2UU9 Q;  3I4M G;  3C46 A;  2B63 G;  1GVP A;  4DR5 L;  2WB1 B;  3S24 A;  1L0X B;  3STB D;  4KV6 A;  1VQC A;  1ROD A;  4A3M B;  1Q8K A;  1BBX C;  1FNV A;  3U4V A;  4LW1 A;  3TP5 A;  5GAD C;  2KHS A;  4KHZ A;  2H1E A;  1G91 A;  2WP8 J;  4AH6 A;  2LFN A;  1TWA B;  3I4M B;  4GKJ L;  5NUC A;  2AWN A;  1WJJ A;  1MIU A;  4LF7 L;  2K4K A;  3CCQ A;  2J4X A;  1EY4 A;  1PRT F;  2A1A A;  3CQZ B;  2F1M A;  3SXH A;  2R93 H;  1LTI D;  1K8O A;  1NBW A;  4RMF A;  2N3S A;  1WOC A;  1LTT D;  1LT3 D;  4GN5 A;  2CWP A;  1K3R A;  4DXF A;  4PMW A;  2PQE A;  1TT2 A;  3L3O C;  4G7H C;  3HOW G;  3I56 A;  3OIQ A;  2EJM A;  2JP1 A;  2A6H C;  4UY8 C;  3I72 A;  1QB5 D;  4KHP Q;  2KJX A;  1BXT A;  4PQX A;  2G9D A;  1QNK A;  4TRD A;  2RCN A;  2OQ0 A;  3QJY A;  5IT9 E;  1QVG A;  3HOW B;  4OL7 A;  1QOH A;  1Q1E A;  2MP1 A;  4BBS B;  3TRE A;  5CV7 A;  2KCN A;  4RWS C;  4H0L C;  4S3S A;  2Y0S E;  2Z6K A;  3R2T A;  1M8A A;  2R92 G;  4HJ7 A;  4WOR A;  2UXB L;  1XNQ Q;  1NUC A;  2NVX H;  4I7Z C;  3BZD B;  5GAE C;  1OTC A;  3NE5 B;  2M2L A;  1YJN A;  1S5F D;  2D5D A;  5EKK A;  4ZLT F;  2PZW A;  1B3Q A;  2R92 B;  3GTP H;  4XTC S;  2DY7 A;  1FVI A;  3JAM i;  1MJE A;  1X54 A;  1XTD A;  2A5H A;  4DV6 L;  3VR2 A;  3CRK C;  4A3D H;  1K8A C;  2XWB B;  1VQ5 A;  4MN3 A;  2EXD A;  3D4W A;  1ENF A;  3AYH B;  1B3A A;  2Q2T A;  3KJO A;  3FP9 A;  4ZCK A;  3D8G A;  3L7Z C;  5IGC A;  2F0H A;  5ISR A;  4GOP B;  2CQO A;  4DNR B;  5M3M H;  3OTO Q;  4LMQ D;  3AQQ A;  1ZEQ X;  3M9B A;  1K9M C;  2FMM A;  4DV2 Q;  1RIP A;  2RSO A;  5IT9 L;  3STB C;  1GJX A;  4KD4 A;  2DN8 A;  3I4N H;  2BA0 A;  3OSO A;  4A3J H;  2LXK A;  3MXU A;  1R4P B;  1BOS A;  1Y1V B;  2NWG A;  2PMZ B;  1V1Q A;  1EY6 A;  4A3D G;  2B2Y A;  1RHP A;  2NVX B;  3OWE B;  5KYL A;  2L0C A;  1X55 A;  2SOB A;  2LKV A;  4DNI A;  1ILP A;  1VQ4 A;  2KCC A;  2ZJQ A;  1VQF A;  2IW3 A;  3GP7 A;  3PCO B;  2KED A;  5M3M G;  1S5C D;  1OXU A;  1KL9 A;  2QF7 A;  4A3D B;  2JA8 H;  1GKH A;  3CU7 A;  3HOV H;  1UE7 A;  1HUN A;  3NSW A;  1T5E A;  3RMH A;  1C9O A;  1D5M C;  1T9H A;  3G4S A;  4DV0 L;  4A3J G;  4JBK A;  4DR4 Q;  1WTW A;  4JI4 Q;  3I3C A;  1SRO A;  1BF4 A;  4LF4 Q;  1CA5 A;  2NBF A;  4K5V A;  5T1I A;  1EYA A;  2LSS A;  3A8J E;  5J22 A;  4GS3 A;  4UP9 A;  3E0E A;  1TY0 A;  4YCU A;  1PTO H;  1D7Q A;  3OTO L;  4A3F H;  1EY0 A;  4DV2 L;  2F4V Q;  4DK3 C;  4A3J B;  1JB3 A;  3QWN A;  1PFS A;  1X56 A;  3OYY A;  2F0U A;  1PYS B;  3GTJ H;  1V1P B;  1PH3 A;  4WJ3 M;  4KKS A;  3HOV G;  3M7G A;  2HCI A;  3GTM H;  5ELD A;  2KEN A;  1JOO A;  3CCM A;  4HJ9 A;  4LF5 Q;  1RTN A;  2VUM G;  2LXJ A;  4JK1 C;  3TME A;  2QA4 A;  2V1C C;  2WB1 E;  4DUY Q;  1TII D;  1LT6 D;  2KHJ A;  1K8M A;  5C4J H;  4HJ8 A;  3M4O B;  2KBN A;  5IGG A;  3MC0 B;  4DAM A;  1UE1 A;  4JI7 Q;  1HPC A;  1VQE A;  3CHB D;  4YCW A;  3A55 A;  5IWA Q;  1EYD A;  2VQE Q;  4A3F G;  1N9W A;  4ODG A;  1BCP F;  1OXS C;  2VUM B;  4GNX A;  1JJ2 A;  4HCE A;  2XIW A;  1HNX L;  3PIP A;  4Z9C B;  1HQM C;  5JEA J;  1KTK A;  3CCE A;  1E2Z A;  1GUO A;  4LF4 L;  1XPU A;  4H44 C;  1G6P A;  4IUN A;  4A3F B;  4OWT B;  4X64 L;  4NXN Q;  2KA7 A;  1HRJ A;  1S5B D;  2OQK A;  4C3J H;  1LTS D;  1YHA A;  1MBY A;  2CW0 D;  3GTK B;  1GUG A;  1XWE A;  3RUZ A;  2F4V L;  1I50 H;  1STN A;  1TS4 A;  2EY1 A;  4PNY A;  4JI8 Q;  4QGU A;  2L11 A;  2E2D C;  1EIH A;  3KF8 B;  4GNX B;  5K5P A;  4UPA A;  4OGQ C;  1XPR A;  5DLQ E;  3C2P A;  3HOZ H;  5C4J B;  3A54 A;  4V19 0;  2SNS A;  1SDF A;  4A4I A;  3R2I A;  4LK1 C;  2PCF B;  4DUY L;  1MD2 D;  4HAE A;  1P8L A;  1FJG L;  4CBV A;  2MNA A;  3T1Y Q;  1HZA A;  1A3V A;  1JJG A;  1SE2 A;  1N34 L;  1SND A;  4JI7 L;  3D4R A;  2JQO A;  1JQY D;  5FLM G;  3M85 A;  1Z9F A;  3A5U A;  4OON A;  4WRD A;  1WTX A;  2K1B A;  2F4I A;  4RGT A;  2ATW A;  2YTV A;  1U4P A;  4MZ9 A;  4A3G B;  4K2L A;  1EQR A;  3CME A;  3K5O A;  5C4X B;  3V05 A;  1JOK A;  2BDN A;  2G9H D;  4PZ6 A;  2PNH A;  1PZI D;  1YHQ A;  3GTG B;  4CDF C;  3E9I A;  3VR6 A;  3J81 i;  1V1O A;  1S4Z A;  2IJ0 A;  4N9T A;  5JJK A;  2K04 A;  2RSN A;  2A74 C;  1W2B A;  3A7A B;  3S17 H;  2K5W A;  3EA6 A;  4R8N A;  1S5D D;  3VYR A;  1HTP A;  3MZ5 A;  4IPH A;  1QZH A;  2DNC A;  1JWU D;  2K50 A;  4RGN A;  4IJH A;  3X3N A;  1VMC A;  3T16 A;  3GV3 A;  2CQA A;  5G3L F;  2B8G A;  2HQE A;  2L1B A;  3EFX D;  2WAC A;  1B2T A;  3OW2 A;  2YU9 H;  4KY5 A;  2ES2 A;  1TS2 A;  4KMU C;  3F2D A;  1Q1B A;  2MUY A;  1LM0 A;  4B3R L;  2PMZ E;  3T1Y L;  4BY7 G;  1L2F A;  2I5H A;  4RCN A;  3MEF A;  1CA6 A;  3Q23 A;  4K8J A;  1IBK Q;  2VS1 A;  4GLA C;  3PMF A;  4KY6 A;  2ID0 A;  2EOT A;  1QUQ B;  2OWO A;  1QNU A;  1I6V C;  4WJW A;  2OEO A;  1WTH A;  4BY7 B;  1CKO A;  1VQO A;  1A2U A;  5ELC A;  2XNA C;  3A8K E;  1CM9 A;  1U4R A;  1VQI A;  3A5Z B;  2CW0 C;  4E6I A;  5GAH C;  4DR7 Q;  1GUW A;  2F0J A;  1D8L A;  1KXL A;  4QY7 A;  1EQV A;  3H91 A;  1VQL A;  5K36 H;  1DON A;  3DEO A;  1JB7 A;  5M3F B;  1HA5 A;  1TWH B;  4XQN A;  1C0A A;  2JXM B;  1CTM A;  4RHS A;  2Z6K C;  2VY3 A;  2Q2U A;  2NTT A;  3PO2 H;  2Z1C A;  1HQR D;  2QCP X;  4RH6 A;  3AU7 A;  3FMC A;  1UEB A;  1TWG B;  2Z9H A;  3SK6 A;  1C48 A;  5LL6 X;  3W1B A;  3ONA B;  1O78 A;  4DR2 Q;  3RZO H;  4RHR A;  2OTJ A;  4C1N I;  3D3R A;  3FKI H;  2EYM A;  2JA7 H;  1DOM A;  2J0T D;  3CPW A;  1IBK L;  1VQ6 A;  3K5L A;  3MFG A;  5DNF A;  3RR5 A;  3J80 c;  1EOV A;  3M3Y B;  4DA2 A;  3K8A A;  1BUV T;  1DCZ A;  4J6H A;  2V4D A;  2F03 A;  2EVB A;  4FYD A;  1ESF A;  2E74 C;  2RKS A;  1BNZ A;  1V8Q A;  1PA6 A;  2KVM A;  4IUP A;  4Q5V A;  1S72 A;  4GKK Q;  1D1K A;  3CCS A;  2F0Q A;  3NWT A;  4K0K Q;  1G6Z A;  2K75 A;  1Z47 A;  1K73 C;  4JBW A;  4JBJ A;  2C9O A;  1MGS A;  1PZJ D;  3W2D A;  1NY4 A;  1SAP A;  4LF8 Q;  2JA7 G;  1X3G A;  4K5X A;  2DJG C;  1K8G A;  1S5E D;  3A74 A;  1TWC B;  4POG A;  1XMQ Q;  4JOI C;  5I6Y A;  2L5T A;  4C3I G;  4LF6 Q;  1VQB A;  2B2Y C;  2KOL A;  4L5Q A;  2R3Z A;  1BQQ T;  2JA7 B;  3SVM A;  4GZY C;  2HCC A;  5C44 H;  5ELN A;  4A3B G;  3CCV A;  3BDO A;  1K3B C;  2BE5 D;  1SE3 A;  4C3I B;  5KEE A;  4YY3 Q;  4OIK A;  1EEF D;  4BXX H;  4G7O C;  1CQV A;  2KEC A;  4DFA A;  1ENC A;  1EY9 A;  4LFB Q;  3CRL C;  3AFQ A;  4KN7 C;  1VQP A;  4JBM A;  4LF9 Q;  3S15 H;  4NMZ A;  3TP8 A;  3U9O A;  5GAG C;  2EJF C;  3OIP A;  1EYC A;  4EQ5 A;  4A3B B;  1LLR D;  2ICE C;  4DUZ Q;  1VQJ A;  3GTL B;  2XTI A;  3ND9 A;  4EVO A;  4K0K L;  1PYW D;  1PH6 A;  1D5X C;  1F9S A;  3E3X A;  2AQ2 B;  3NTH A;  2PI2 A;  4XYQ A;  4XQJ A;  3IAY A;  5L37 A;  1B50 A;  1E22 A;  2NVQ B;  4L5T A;  3T1H L;  1KLG D;  4IUT A;  3RZD B;  2O5J C;  5C44 G;  1VDZ A;  1CT1 D;  3C1E A;  3S1Q H;  1F2Y A;  1KRT A;  1GXD C;  5E3F A;  4BXX G;  1G51 A;  2D0O A;  5C5L A;  1EU4 A;  1FYC A;  4X65 L;  1Y14 B;  1V9P A;  1HTL D;  1R9T H;  4BWG B;  1CSQ A;  4ULL A;  5C44 B;  1AZP A;  2JA6 B;  3K7A H;  1Q90 A;  1MJC A;  4F7X A;  1TXY A;  2K05 A;  1E1T A;  4DV7 L;  1RL2 A;  3HRZ C;  4FO2 A;  1JMC A;  1I4H A;  5EPL A;  3OW7 A;  4OEM B;  1BBU A;  1VQ7 A;  4LFB L;  2RHS B;  2MHV A;  5IY0 A;  1PDQ A;  3LNN A;  4OWX B;  4LF9 L;  1HA6 A;  2WAQ G;  4M8A A;  3A8I E;  3KF6 A;  4A3K G;  3DWP A;  4J1M A;  4DUZ L;  5C6A A;  1PRT D;  4OX9 Q;  1U5K A;  4RKB A;  4FF1 A;  2IX1 A;  3BJU A;  4R8I A;  2EE1 A;  2KUM A;  3KDF B;  5DAU A;  2CHB D;  3VDY A;  3PUZ A;  2WAQ B;  3F2U A;  4IJL A;  1STA A;  2EPB A;  5E4X A;  4A3K B;  4N9P A;  3KLW A;  3NK9 A;  1IL8 A;  4IOC A;  3DHQ A;  4C2M H;  3PF4 A;  3P1H A;  2ZM6 L;  3Q22 A;  1WCM G;  3D4D A;  2R7Z G;  1E0B A;  1WTQ A;  3GTO B;  5AJ3 Q;  2O4X A;  1YNN D;  3KF6 B;  4U68 A;  5LMN Q;  2E2H H;  2PZU A;  4DXG A;  1OXV A;  2BE5 C;  4C3H H;  1PH2 A;  3KBX A;  3TBI B;  1IYV A;  5I6W A;  1QWY A;  4MTK A;  2L4N A;  1PH5 A;  1VF5 C;  4DV5 Q;  5CV5 A;  1IL2 A;  1SJH D;  4F88 A;  1WCM B;  1SMY D;  4HTH A;  4FF3 A;  5E7N A;  2VB3 X;  3Q24 A;  2AUK A;  3D6W A;  3DEP A;  5IYC H;  5KNC A;  4C56 C;  3T13 A;  2R7Z B;  1ESR A;  4IFD H;  2I07 B;  4AQY Q;  1SSO A;  4XIG S;  4V0B A;  2UUB Q;  1FR3 A;  1JOR A;  4QB4 A;  1A6X A;  4CKE A;  4HJA A;  4DR3 Q;  3NUC A;  4OX9 L;  3H15 A;  1DOK A;  2EIF A;  1NCV A;  2NVY H;  4C3H G;  2B63 B;  2IPK D;  5I2X A;  2J7Z A;  1SR3 A;  1UNS A;  1SFO H;  3BVZ A;  1CQF A;  1D6E C;  2EY5 A;  3F2B A;  2ZXO A;  5KND A;  5IYC G;  4QIW B;  4UP8 A;  1I6H B;  1Q81 C;  1UUP A;  3ZJY C;  4IFD G;  2E2H B;  1X3P A;  3GTQ B;  1Y8P B;  2B2W C;  3PO3 H;  1SYE A;  4C3H B;  1TWF H;  2PQA B;  3PUX A;  3ND8 A;  4A3L H;  1OXT A;  1BBW A;  1IYU A;  2E5L L;  3S1N B;  1UE6 A;  3BYT B;  2MGS A;  5BN4 A;  4A93 H;  2R6G A;  2IHE A;  3GQB A;  3I7F A;  4KK7 A;  4Y7N H;  2UU9 L;  5EAY A;  2R93 G;  1LT4 D;  4ZQ3 A;  1ML0 D;  1PRT C;  1XMO Q;  2UUB L;  2UXD Q;  3BVG A;  4NKL A;  3CPF A;  3J7Z C;  1C8C A;  1TQO A;  2FIN B;  5ELB A;  2QW7 A;  3MWY W;  3S16 H;  2NVY B;  3CKI B;  4NW2 A;  3HZX A;  4GOP A;  4R4C A;  2FXQ A;  4A3L G;  3OWF A;  2R93 B;  1NE3 A;  3MA2 B;  1X3F A;  1B9M A;  4NDX A;  5EPK A;  4KLK A;  4EQO A;  3I4L A;  2O2L D;  4P73 A;  2I0Q A;  3S2H H;  1RTO A;  3SDZ A;  1YNN C;  1TWF B;  4FNF A;  4KY7 A;  1LTR D;  1SBB B;  3IFD A;  1IW7 D;  5CMD A;  1XPO A;  1K0R A;  2NZ1 D;  3I2Z A;  1F2Z A;  4ZUI A;  2K52 A;  1EYG A;  2JN4 A;  2FFK B;  2AKW B;  5CV6 A;  2QGQ A;  1O80 A;  1X3Q A;  4OIJ A;  3T53 B;  1Q8I A;  5BN3 A;  4A3C H;  5CC4 A;  1K0S A;  1I4G A;  2EZV A;  1SNQ A;  4KHP L;  4Y7N B;  2F0F A;  4JI0 Q;  3EJI A;  5FO7 B;  2RHQ B;  3S2D H;  2CCZ A;  3PSI A;  1HFG A;  5C4Z A;  2XRQ D;  2PI2 E;  1KDA A;  1EFW A;  1EEI D;  3KK7 A;  5JAV A;  4LUV A;  5JPN C;  3VR3 A;  2RDH A;  4G4K A;  3RLO A;  5F2D A;  3RLN A;  2N78 A;  1XNQ L;  1BCP D;  1KNE A;  4X3U A;  4HMJ A;  5I2Y A;  3GTP B;  4A3C G;  5C3E H;  4ME5 A;  2IL8 A;  2F0S A;  4I7A A;  4O2D A;  2G5D A;  4HIM A;  1IHZ A;  1V1P A;  3OOC A;  3PUW A;  5EPJ A;  3I4N G;  2ZTD A;  1XNR Q;  4G57 A;  1X32 A;  1KIX A;  2AUJ D;  1L1O A;  5IOC A;  5M3M B;  1XJV A;  1F77 A;  4P75 A;  1NJI C;  4AYB G;  4RAU C;  1A15 A;  3CD6 A;  1KLU D;  4JI3 Q;  4O0A A;  3I4N B;  3S9W A;  3QG1 A;  5C0X H;  1VS0 A;  1JJC B;  3TZU A;  5FOB B;  1VQK A;  4JI0 L;  2MQH A;  3CMA A;  1X6O A;  1G8Z D;  3Q6S A;  1XX8 A;  2DY8 A;  1QIL A;  5JPM C;  4AYB B;  2JA8 G;  1JWS D;  1PMR A;  2HHH Q;  2ZXP A;  5KYI A;  3NQT A;  3NEN A;  1ASZ A;  3ULP A;  1J9O A;  1MSG A;  2VQF Q;  1CI3 M;  1L1O B;  3SK8 A;  4CKB A;  4OO1 H;  1E3P A;  2CH4 A;  3D31 A;  3NPP A;  3I90 A;  1JIC A;  4JI2 Q;  3T4A C;  4DK0 A;  1HNZ Q;  2JA8 B;  3HOV B;  4MNO A;  1IW7 C;  1I4R A;  2A19 A;  4JV5 Q;  1H9K A;  4BA2 I;  3FPU B;  3KF8 A;  5CV9 A;  5CYU A;  5DM7 3;  5C0X G;  4U67 3;  1DGS A;  2FMC A;  3ERO A;  2AQ1 B;  1B4O A;  1Q86 C;  4LFC Q;  1I3Q H;  1ENA A;  1I94 Q;  1A0I A;  1Y69 U;  1XNR L;  5T1G A;  1K83 H;  3BDC A;  4QIW E;  1II3 A;  4DR4 L;  4JI4 L;  1PTO B;  1IBM Q;  1KAA A;  5C3X A;  2A8V A;  2RQX A;  2JA5 H;  3NQI A;  3CCL A;  5JEA H;  1O7L A;  3HOX H;  4KTA A;  4NXM Q;  3JAM L;  5EKI A;  5ELO A;  2MPM A;  5G3L D;  1CKM A;  4YWK A;  4HJ5 A;  5EQ0 A;  2JEB I;  3GTJ B;  1LTB D;  5CV4 A;  3GTM B;  1JC7 A;  2DNE A;  4TKO B;  1YEZ A;  4JI5 Q;  2RBM A;  1BCP C;  1JE5 A;  4CDC C;  2K33 A;  3ULJ A;  1JOQ A;  4LF5 L;  2KQ3 A;  2Q8I B;  3F8T A;  4FXK C;  2K6A A;  3HKZ G;  3KLS A;  2D0P A;  5COR A;  4RA8 A;  2VQF L;  2JA5 G;  2K32 A;  5E1F A;  1N8R C;  1RDP D;  4L8J A;  3HOX G;  2NTS A;  4C3J G;  1DXM A;  4IPC A;  5IWA L;  3PIP 3;  2VQE L;  2KEE A;  1T5X D;  1KHI A;  1BO0 A;  4LFC L;  2K7V A;  3CC7 A;  4IFD I;  1VMP A;  2YV5 A;  4OWW B;  1E1O A;  2JA5 B;  4DV1 Q;  3J80 E;  5IGF A;  5IGE A;  3HOZ G;  1B70 B;  4GN4 B;  1KC8 C;  1H9J A;  1IBM L;  4C3J B;  1HNW Q;  3JAM c;  1LAC A;  2YYZ A;  1SJE D;  4NXN L;  4J15 A;  3RD4 A;  1I50 B;  4IUV A;  3F1Z A;  4YWM A;  2PNR C;  1QUQ A;  3J7Y W;  3HOZ B;  4QUF A;  1PH1 A;  4JI8 L;  2NN6 H;  2WV6 D;  2N55 A;  3G6E A;  5JJZ A;  2E2J H;  4K14 A;  4JI5 L;  4DR6 Q;  1A8V A;  3DLL A;  3PUV A;  2K28 A;  1F9R A;  3UDF A;  4UDU C;  1FGU A;  1EUJ A;  3BVM A;  2AHO B;  2A68 D;  4DK6 C;  1FD7 D;  1IBL Q;  2ASB A;  4X66 Q;  5FKA C;  2A73 B;  1YIT A;  1ILQ A;  4BS9 A;  2F0G A;  3D6C A;  3A0J A;  4WJ4 A;  2L15 A;  1QE6 A;  4B9X A;  2QEJ C;  2LMC B;  1B53 A;  4IUQ A;  3KJP A;  3ER0 A;  3TP7 A;  3J80 L;  3CP0 A;  3HS0 C;  1N32 Q;  3G71 A;  2NN6 G;  3K5M A;  3SR1 A;  4DV1 L;  4AIM A;  1Q7Y C;  1SNC A;  2K5H A;  2X6G A;  4LJZ C;  3S17 B;  1HNW L;  4FXD A;  1ET9 A;  5IP9 H;  2GVB A;  4KKU A;  3IRB A;  1U4L A;  1BKB A;  1SNP A;  2E2J B;  2E2I H;  1IKL A;  1U9R A;  5D3I B;  1CK1 A;  2RF4 A;  3GD7 A;  5JVG 3;  1N36 Q;  2YU9 B;  3Q0A A;  5IOD A;  2BH8 A;  1CSP A;  4O1N A;  4LWC A;  1FNU A;  1L0Y B;  4GOP C;  1EWH A;  4H7B A;  2BOS A;  3TN2 A;  2NVT H;  3K81 C;  1SYF A;  1WI5 A;  4QCL A;  5IP9 G;  1LTL A;  2F0P A;  2BCO A;  1UEA B;  1VQD A;  1F9P A;  1ONL A;  1STE A;  5EGT A;  2H5X A;  3I8Z A;  2R7D A;  1AP0 A;  5K36 G;  1WFQ A;  2JSO A;  1EQQ A;  5IYD H;  1TKW B;  4R4I A;  3KYH C;  4DPG A;  1NR4 A;  5FK9 C;  4LUO A;  1Y1W H;  4LFA Q;  3PO2 G;  3V96 A;  2EXZ A;  2KHI A;  1B7Y B;  3SK4 A;  3NWS A;  4DR7 L;  1G29 1;  5M5W H;  1GO3 E;  1Y8O B;  2OCE A;  5DEH A;  4X3K A;  2MFI A;  4K6D A;  4TVA B;  5M5Y H;  1CHP D;  1ICF B;  3ERS X;  4PG3 A;  3SHL A;  1TVX A;  3D0F A;  1B8A A;  3PO2 B;  3FKI G;  4ZK9 B;  3UDI A;  4HSP A;  1VQ8 A;  1Q82 C;  2Z4H A;  1Q12 A;  1N36 L;  2A68 C;  1WD0 A;  2UXC Q;  3TS2 A;  2E8G A;  2BA1 A;  2GVA A;  2ZJR A;  2A69 D;  1CZW A;  1W6J A;  1WVL A;  1HJP A;  1Y1W G;  3RZO B;  1IZ6 A;  1MSH A;  3VA7 A;  1O7I A;  3P20 A;  1V43 A;  3FKI B;  1HR0 Q;  5IGB A;  3S1R H;  2GA4 B;  3WOE A;  2VZA A;  2E75 C;  1KQS A;  4DR2 L;  4HED A;  4JI1 Q;  1PTO F;  5C3W A;  2EYP A;  4PZ8 A;  5C0X I;  1NNX A;  4HSV A;  2Y0S G;  2F0I A;  4DKA C;  1CUK A;  1Y1W B;  4N8F A;  2F0E A;  3T51 B;  4JW0 A;  3S14 H;  2HT1 A;  4LFA L;  4GKK L;  1VQG A;  4G7Z C;  3PQI A;  3N52 A;  2HUG A;  4KN4 C;  2Y0S B;  4XDX A;  5C5M A;  5LL6 S;  1H9S B;  3J81 c;  4OO1 I;  2A6E D;  3GO5 A;  3W3A A;  4LF8 L;  2CH4 W;  5GQO A;  5LMU Q;  3LGJ A;  3G48 A;  1XMQ L;  1PV4 A;  3MFY A;  2UXC L;  1O7Z A;  4LF6 L;  1TR5 A;  3AMU A;  4ZRZ A;  4YCV A;  1FL0 A;  1ZYR D;  4JYA Q;  3FHW A;  1L0W A;  1JT8 A;  3PUY A;  3KDF A;  3A7L A;  4CJ2 C;  2K5V A;  4RGO S;  3W1G A;  5A35 A;  1HR0 L;  1B1Z A;  1GOZ A;  1S40 A;  3WWV A;  2WIN B;  4O42 A;  3HKS A;  4GNX C;  5BR8 Q;  3WOF A;  3S15 B;  3HEJ A;  1AH9 A;  1DJR D;  4YY3 L;  1SNM A;  5E4W C;  2IX0 A;  1PHJ A;  2F0M A;  4NB3 A;  2F3I A;  1YZ6 A;  1EFI D;  5FLX L;  3H94 A;  2XN9 C;  4FF4 A;  1UWV A;  3TS0 A;  1KAB A;  4YHH Q;  2XWJ B;  3GV6 A;  3K58 A;  3CW2 C;  5KRU A;  2ENB A;  3NTI A;  3S1Q B;  3C1F A;  1WTV A;  1W6K A;  2UUC Q;  4P72 A;  3S1M H;  3TSS A;  4PMC A;  3HOU H;  3E9H A;  1YVC A;  3K57 A;  2A69 C;  4XQQ A;  1A3T A;  1M1K C;  1R9T B;  4HMI A;  3M4Q A;  4A3M H;  3A56 A;  2NZO A;  3K7A B;  3HG9 A;  3MHB A;  3ZYY X;  1MHW C;  4JYA L;  4LF7 Q;  3J7A 5;  4P2C B;  4B3S Q;  3U58 A;  1D2B A;  3I4M H;  5DM6 3;  5AFW A;  1AE3 A;  3M4Y A;  3R93 A;  3CQZ H;  2HDM A;  1CFM A;  3KLS X;  2E76 C;  1E2V A;  5BR8 L;  2WKD A;  4ID6 A;  1STH A;  5FLX c;  3HOU G;  4K5W A;  2PQA A;  2DJF C;  4BY1 H;  2NN6 I;  2F0D A;  2D2C C;  2B2V A;  1RD9 D;  4L63 B;  4N8X 1;  4R4O A;  1SYB A;  1KNA A;  2A6E C;  4IFD J;  1Z6H A;  4YHH L;  1W3S A;  4B08 A;  1EY7 A;  2ZJP A;  3HOU B;  3P7J A;  5HGQ A;  3CXC A;  4C2M B;  2UUC L;  3OMC A;  3PF5 A;  1HH2 P;  3HOW H;  3WDN A;  1BVS A;  2ZXR A;  1ZYR C;  4BBS H;  1WD1 A;  2F0L A;  1GD7 A;  3VR4 A;  2JA9 A;  3NEL A;  2B3G A;  2Z4I A;  2UXB Q;  1H95 A;  4IAL A;  1J8I A;  1SE8 A;  5AJ3 L;  4BY1 G;  5LMN L;  5LMN W;  2M9V A;  1HUM A;  2ICI A;  4H02 A;  1AFP A;  4B3S L;  2Q8R E;  2RVL A;  2F52 A;  2B2T A;  4DV5 L;  3J7A F;  4FF2 A;  2R92 H;  3U4Z A;  4DV6 Q;  4LUZ A;  3AEV A;  2F0O A;  4BY1 B;  4P71 A;  1TY2 A;  3J81 j;  4AQY L;  4KI0 A;  4BBS G;  3FVQ A;  1SYG A;  3M7N A;  5IGD A;  2ZT9 C;  1VQN A;  2B2U A;  3SEB A;  1JWM D;  4B3M Q;  4WFN 3;  4C1N K;  3PO3 G;  4L5S A;  1DOL A;  3QIA A;  2VL6 A;  4DK1 A;  4DR3 L;  3E5S A;  1SFO B;  2PO4 A;  3CAM A;  2RA4 A;  3BZK A;  2VXW A;  3SGI A;  1RF2 D;  1EIG A;  1PH8 A;  3LX0 A;  2OT2 A;  1LV9 A;  3MXG A;  1JCK B;  3NTK A;  4OXP A;  3PO3 B;  1EQT A;  4BA1 I;  4A93 G;  3K0X A;  4ZUJ A;  4X3T A;  1HZC A;  2EYJ A;  4CJ1 B;  1QVF A;  3UE1 A;  1WYD A;  2Q8T A;  1UE5 A;  1Y1V H;  1MI2 A;  1CKN A;  1K28 A;  1SMY C;  5M9O A;  1DD2 A;  2H4O A;  1R4Q B;  4OEL B;  4PV1 C;  3K6O A;  2Z8L A;  4A93 B;  5CR3 A;  2LY7 A;  4KHV A;  3RNU A;  5C4H A;  4ABN A;  3M4P A;  2ZTC A;  2CKZ B;  2I5L X;  2CWA A;  1OXX K;  2O5I C;  1VCI A;  3IFT A;  1J6Q A;  5HUR A;  4DV0 Q;  3E6Z X;  3O13 A;  3TEH B;  1G2T A;  3CCR A;  3P75 A;  5JJI A;  4QL5 A;  3S16 B;  5JJL A;  1XMO L;  2F3V A;  2I46 A;  3DWQ A;  4RGM A;  4PZ7 A;  2UXD L;  1EU3 A;  2MO0 A;  3CCJ A;  3MTS A;  1AZQ A;  1MKH A;  5EBC A;  3F2C A;  1C7Y A;  2MO1 A;  1Y1V G;  3TZD A;  3NP8 A;  4B3M L;  3V2T A;  3AFP A;  1CKN B;  5TSS A;  1EWC A;  4F8M A;  1B9N A;  3S2H B;  3DM3 A;  3TDQ A;  2VB2 X;  2N49 A;  1I5F A;  2ZTE A;  3VA5 A;  2CVR A;  4JOI A;  2C35 B;  3K7U C;  2R7F A;  2WAQ E;  2IWH A;  5J3B A;  4JC0 A;  1RCV D;  1QVC A;  3URY A;  1PXU A;  3FEW X;  3QO2 A;  2XRS D;  2LS0 1;  3M4O H;  3LWU A;  3CC2 A;  1A63 A;  1E24 A;  2EY2 A;  5I9O A;  3DM1 A;  3CC4 A;  3LWE A;  4ILW A;  1TU2 B;  1F9Q A;  3KOJ A;  3S2D B;  3QR8 A;  2R61 A;  3JAM E;  1HNX Q;  2PYK A;  2HIX A;  2VUM H;  1NMF A;  5C3E G;  2X6L A;  1HZ9 A;  1NR2 A;  4JCV E;  4FVM A;  4CHT B;  4BBR H;  4X64 Q;  5BN5 A;  4CDD C;  5C0X J;  4NP5 A;  1SEB D;  5IT9 c;  4X3S A;  2N8N A;  1PZK D;  4IUU A;  4EQN A;  4FXG C;  5KIX A;  5C3E B;  1BDO A;  2VNU D;  1YJ9 A;  3AB9 A;  2DUD A;  4JPB W;  2L9H A;  1OO9 B;  2HD3 A;  5CV8 A;  2WKC A;  3GTK H;  5KGU A;  3BZC A;  5IYB H;  4NPS A;  1RKN A;  3FRP B;  4FDB A;  3EBE A;  1J5E Q;  3MEH A;  4JI6 Q;  3PIO A;  1LUZ A;  1NAP A;  3I70 A;  4J8Q A;  5D14 A;  1FJG Q;  4IPG A;  5IIF A;  5JVH 3;  3J80 i;  5J39 A;  2AMC B;  1RJT A;  4A3E H;  5IE8 A;  4A3I H;  1WTP A;  3BYY B;  4BBR G;  1N34 Q;  3JC6 6;  4DV3 Q;  3NBH A;  4QQB X;  1XXG A;  4JVZ A;  5COY A;  1IKM A;  3FDT A;  1D1I A;  4JI3 L;  3RN2 A;  3UI2 A;  2PPB C;  2D62 A;  4OO1 G;  1PH7 A;  1YNX A;  1HFN A;  2B39 A;  5IYB G;  4BBR B;  4A3G H;  3R3O A;  4ZKB B;  3U9S A;  5C4X H;  3OHX C;  3GTG H;  3CCU A;  1N33 Q;  1EWI A;  2HHH L;  2Q2H A;  5FLM H;  4GLV B;  3DWA A;  2YTX A;  3ITP A;  4HCS A;  4A3E G;  5CBA E;  4A3I G;  4DAY A;  3MXN A;  4R4Q A;  1ICW A;  4POF A;  3NBH B;  2EJG C;  2NUC A;  5JEA G;  3PIO 3;  1HXY D;  4JI2 L;  4DF7 A;  4DAV A;  1HNZ L;  5ELF A;  3T56 B;  1GUT A;  1I3Q B;  1YNJ D;  2K5D A;  4JV5 L;  3K80 C;  5HY6 A;  1J5E L;  1PFM A;  1A62 A;  1XYI A;  4JI6 L;  1K83 B;  3HKZ B;  4A3E B;  4X62 Q;  4A3I B;  4YIJ A;  4A3G G;  1I94 L;  4K8I A;  1U0L A;  5C4X G;  4R1J A;  4B3R Q;  4XYO A;  1X65 A;  2BH2 A;  3H3V I;  3ICE A;  1BR9 A; 
#chains in the Genus database with same CATH homology
 3FKI G;  4A3J H;  3UDX A;  2LXK A;  3UDI A;  4LF9 Q;  1VQ8 A;  1Q82 C;  4DV3 L;  1NMG A;  1VQH A;  1PH5 A;  1Q12 A;  4DV5 Q;  3GDE A;  1N36 L;  1IL2 A;  2JJQ A;  1V1Q A;  2UXC Q;  4A3D G;  5E7N A;  2E8G A;  4NXM L;  2BA1 A;  4DAY B;  3TS2 A;  2GVA A;  5IYC H;  2ZJR A;  3MXN B;  3RN5 A;  1X55 A;  5H1S E;  2ALY B;  1HJP A;  1Y1W G;  2XGT A;  4DNI A;  3PV0 A;  1IZ6 A;  4AQY Q;  4XIG S;  1O7I A;  1VQ4 A;  2UUB Q;  1V43 A;  1HR0 Q;  1E7Z A;  1VQA A;  2EQS A;  1VQF A;  2ZJQ A;  3S1R H;  1IYJ B;  3PCO B;  2VZA A;  3TQY A;  1SRU A;  5M3M G;  1KQS A;  4DR2 L;  1OXU A;  1KL9 A;  3CF5 A;  4JI1 Q;  4BY7 H;  1N33 L;  4HJA A;  2Q2I A;  5IP7 H;  1GKH A;  2JA8 H;  4PZ8 A;  4DR3 Q;  3HOV H;  1UE7 A;  1P16 A;  4OX9 L;  3H15 A;  3B6Y A;  3H0G H;  5C0X I;  2Y0S G;  2KCT A;  3EN2 A;  1C9O A;  1CUK A;  2EIF A;  2NVY H;  1T9H A;  4DKA C;  3G4S A;  2HIV A;  4DV0 L;  4A3J G;  1SR3 A;  4JBK A;  4DR4 Q;  4JI4 Q;  1SFO H;  1SRO A;  4LF4 Q;  3PGZ A;  3S14 H;  2HT1 A;  2LSS A;  4LFA L;  3F2B A;  4GS3 A;  4UP9 A;  1VQG A;  3E0E A;  4YCU A;  4GKK L;  5M3F H;  5IYC G;  4UP8 A;  2CFM A;  3RLF A;  1TWH H;  1D7Q A;  1Q81 C;  3ZJY C;  3OTO L;  4A3F H;  4IFD G;  4MTN A;  3PO3 H;  4DV2 L;  2F4V Q;  1PH9 A;  1TWF H;  1YBY A;  2PQA B;  4DK3 C;  3PUX A;  4X62 L;  2VW9 A;  1PH4 A;  3J81 c;  4OO1 I;  1PFS A;  2UUA Q;  1X56 A;  3EIV A;  4QJF A;  3OYY A;  3S15 H;  3GO5 A;  1PYS B;  2NZH A;  4A3L H;  3GTJ H;  2I5M X;  1PH3 A;  4LF8 L;  4A75 A;  1OXT A;  4WJ3 M;  5GQO A;  1BBW A;  5IP7 G;  1TWG H;  5LMU Q;  2E5L L;  3GTM H;  1UE6 A;  4APV A;  3HOV G;  2DGY A;  3LGJ A;  2KEN A;  3H0G G;  3CCM A;  4HJ9 A;  3G48 A;  1XMQ L;  1PV4 A;  4LF5 Q;  2VUM G;  2LXJ A;  2UXC L;  2QA4 A;  4LF6 L;  2V1C C;  2WB1 E;  4DUY Q;  2KHJ A;  2OTL A;  5C4J H;  4A93 H;  4YCV A;  4HJ8 A;  2R6G A;  2IHE A;  1FL0 A;  4JG2 A;  4L5R C;  2KBN A;  3I7F A;  3FHW A;  1L0W A;  4JYA Q;  2K14 A;  4Y7N H;  2UU9 L;  5EAY A;  4DAM A;  2R93 G;  5M5X H;  3M3Y H;  1UE1 A;  1JT8 A;  3PUY A;  1XMO Q;  4JI7 Q;  3KDF A;  5M3F G;  2UUB L;  2K5V A;  3W1G A;  1HR0 L;  1VQE A;  2GN5 A;  1QZG A;  3J7Z C;  3CPF A;  4YCW A;  2UXD Q;  3BU2 A;  5IWA Q;  1S40 A;  3WWV A;  2VQE Q;  4A3F G;  1N9W A;  1OXS C;  1EIF A;  2JK8 A;  4DR6 L;  4GNX A;  3S16 H;  4IO9 A;  1PVO A;  3HKS A;  4GNX C;  5BR8 Q;  4GOP A;  1AH9 A;  4YY3 L;  1JJ2 A;  4R4C A;  2IX0 A;  4AYB E;  1HNX L;  3PIP A;  3I55 A;  2FXQ A;  2JE6 I;  4A3L G;  1PHJ A;  1NE3 A;  4ALP A;  1X3F A;  2F3I A;  4NB3 A;  5JEA J;  1YZ6 A;  1IBL L;  3CCE A;  4X66 L;  4KLK A;  1YHB A;  4LF4 L;  3KFU A;  1XPU A;  1UWV A;  3TS0 A;  1G6P A;  1S3O A;  1VQ9 A;  4P73 A;  2I0Q A;  4OWT B;  4X64 L;  4NXN Q;  3S2H H;  4DR1 Q;  4YHH Q;  2OQK A;  4C3J H;  4RG1 A;  1XPO A;  1YHA A;  1K0R A;  3CW2 C;  3I2Z A;  1TWC H;  4IPD A;  2F4V L;  1I50 H;  2UUC Q;  1N32 L;  2K52 A;  4P72 A;  1EYG A;  3S1M H;  2UUA L;  4JI8 Q;  4QGU A;  3TRZ A;  3HOU H;  3E9H A;  3KF8 B;  1YVC A;  2AKW B;  4GNX B;  1EIY B;  4LNQ A;  4UPA A;  2QGQ A;  1XPR A;  1M1K C;  5DLQ E;  3HOZ H;  4A3C H;  4KHP L;  3M4Q A;  4A3M H;  4A4I A;  4JI0 Q;  2NZO A;  1YIJ A;  2K5N A;  4DUY L;  2RHQ B;  3S2D H;  4C3I H;  1P8L A;  2CCZ A;  1FJG L;  3PSI A;  2MNA A;  3T1Y Q;  4LF7 Q;  1HZA A;  4JYA L;  3J7A 5;  1JJG A;  4P74 A;  4B3S Q;  3U58 A;  1N34 L;  2PI2 E;  3I4M H;  4JI7 L;  2JQO A;  5FLM G;  3UE0 A;  3M85 A;  1Z9F A;  1EFW A;  1AE2 A;  3A5U A;  4OON A;  1AE3 A;  3CQZ H;  4LUV A;  5IYD G;  2ATW A;  2YTV A;  4UP7 A;  4MZ9 A;  3RLO A;  4A3B H;  5BR8 L;  3RLN A;  1EQR A;  2N78 A;  3GTL H;  3CME A;  1XNQ L;  3T1H Q;  5FLX c;  4PZ6 A;  1NTG A;  3HOU G;  2PNH A;  1YHQ A;  2PQA A;  3E9I A;  4BY1 H;  4A3C G;  5C3E H;  2NN6 I;  3J81 i;  4O2D A;  4ME3 A;  2NVQ H;  4HIM A;  3RZD H;  4DV4 Q;  1YJW A;  5JJK A;  3PUW A;  4R4O A;  1ASY A;  4IFD J;  4X65 Q;  4DR1 L;  4YHH L;  1W3S A;  1W2B A;  3I4N G;  3S17 H;  2ZJP A;  2ZTD A;  1XNR Q;  1SMX A;  4IPH A;  1QZH A;  1KIX A;  2K50 A;  5HGQ A;  3CXC A;  4GN3 B;  2UUC L;  1SLJ A;  4IJH A;  1L1O A;  1XJV A;  1L1O C;  4P75 A;  1NJI C;  3HKZ E;  4A76 A;  3PF5 A;  4AYB G;  1HH2 P;  2HQL A;  3HOW H;  1BVS A;  2JA6 H;  3CD6 A;  4DV7 Q;  4BBS H;  1GD7 A;  4HIO A;  4JI3 Q;  2JA9 A;  4O0A A;  3NEL A;  2B3G A;  2UXB Q;  1YI2 A;  3OW2 A;  2YU9 H;  1PH2 A;  1H95 A;  1VS0 A;  1JJC B;  1VQK A;  4YWL A;  2ES2 A;  4JI0 L;  2MQH A;  4X6A H;  3F2D A;  3CMA A;  1SE8 A;  1X6O A;  1Q1B A;  4BY1 G;  5AJ3 L;  2IY5 B;  5FJ8 H;  1LM0 A;  2YTY A;  3L0O A;  5LMN L;  4HID A;  5LMN W;  2PMZ E;  3T1Y L;  4B3R L;  4BY7 G;  4IOA A;  4H02 A;  4TQU S;  3UDG A;  4B3S L;  1L2F A;  2I5H A;  2JA8 G;  3MEF A;  1LYL A;  2HHH Q;  1SN8 A;  1IBK Q;  2F52 A;  4DV5 L;  2VS1 A;  4GLA C;  3NEN A;  1ASZ A;  4B3T Q;  1X9N A;  3ULP A;  2ID0 A;  2R92 H;  3U4Z A;  4DV6 Q;  4LUZ A;  3AEV A;  1QUQ B;  2VQF Q;  2OWO A;  1L1O B;  4P71 A;  4Y52 H;  5GRO A;  3J81 j;  4AQY L;  4JV5 Q;  1E3P A;  3D31 A;  4KI0 A;  4JI2 Q;  1CKO A;  2KCM A;  1VQO A;  1HNZ Q;  1HR0 W;  2JA6 G;  4BBS G;  4R4T A;  3M7N A;  4MNO A;  2A19 A;  3L2P A;  2IT1 A;  3NEM A;  1VQI A;  3A5Z B;  1VQN A;  4BA2 I;  4B3M Q;  4JI1 L;  5GAH C;  2ZM6 Q;  4DR7 Q;  3PO3 G;  5C0X G;  4L5S A;  4DV4 L;  1IXR A;  1DGS A;  4A3K H;  1Q86 C;  4LFC Q;  3U50 C;  2VL6 A;  4DR3 L;  1D8L A;  1I3Q H;  1KXL A;  4HIK A;  4QY7 A;  2QEX A;  5FJ8 G;  1I94 Q;  3CAM A;  3BZK A;  1A0I A;  3SGI A;  1VQL A;  1XNR L;  1K83 H;  1JB7 A;  4QIW E;  1PH8 A;  1M90 C;  1GM5 A;  3ULL A;  1IBM Q;  4JI4 L;  2A8V A;  4DR4 L;  1Q46 A;  1X3E A;  3GTO H;  1KAW A;  2JA5 H;  2WFW A;  3CCL A;  3HOY H;  1C0A A;  4OXP A;  2Z6K C;  2VY3 A;  4BA1 I;  1HZB A;  3HOX H;  3K0X A;  2Q2U A;  4NXM Q;  3PO2 H;  4A93 G;  1HZC A;  4GLX A;  1QVF A;  3UE1 A;  5ELO A;  4YWK A;  1CKM A;  1WYD A;  1UE5 A;  4HJ5 A;  2JEB I;  1Y1V H;  1WCM H;  3Q8D A;  1UEB A;  1CKN A;  4DR5 Q;  3W1B A;  2R7Z H;  2Z0S A;  1YEZ A;  1VQM A;  4JI5 Q;  4DR2 Q;  3RZO H;  3I4O A;  2JEA I;  2OTJ A;  1JE5 A;  5LMU L;  3FKI H;  3ULJ A;  2JA7 H;  3RNU A;  3CPW A;  1IBK L;  1KRS A;  1VQ6 A;  3M4P A;  4LF5 L;  3RR5 A;  2ZTC A;  3J80 c;  2CKZ B;  1EOV A;  3F8T A;  4B3T L;  3ICE A;  2I5L X;  4GKJ Q;  3K8A A;  2CWA A;  1OXX K;  3HKZ G;  1VCI A;  2D0P A;  1J6Q A;  4DV0 Q;  4EX5 A;  2VQF L;  3TEH B;  2JA5 G;  3CCR A;  3HOY G;  1TWA H;  2IHF A;  5JJI A;  4QL5 A;  1N8R C;  5JJL A;  1XMO L;  1PA6 A;  2B63 H;  3HOX G;  1S72 A;  4PZ7 A;  4GKK Q;  2UXD L;  3CCS A;  4IPC A;  2MO0 A;  5IWA L;  3CCJ A;  4K0K Q;  2VQE L;  1MKH A;  3F2C A;  1PYB A;  1C7Y A;  2MO1 A;  1Y1V G;  4B3M L;  2B29 A;  1KHI A;  2K75 A;  3AFP A;  1CKN B;  1Z47 A;  4LFC L;  1K73 C;  3CC7 A;  4JBW A;  4JBJ A;  4IFD I;  1I6H H;  2YV5 A;  4OWW B;  1E1O A;  1NY4 A;  4DV1 Q;  2AWO A;  3H3V H;  3HOZ G;  3GTQ H;  1KD1 C;  1B70 B;  4GN4 B;  2WB1 G;  3DM3 A;  4LF8 Q;  1KC8 C;  1IBM L;  2JA7 G;  1X3G A;  2E5L Q;  2N49 A;  3JAM c;  1I5F A;  1HNW Q;  4A3M G;  2ZTE A;  1K8G A;  2YYZ A;  3W5O A;  3A74 A;  4POG A;  4JOI A;  2C35 B;  1XMQ Q;  4NXN L;  3K7U C;  4JOI C;  4J15 A;  2R7F A;  4LF6 Q;  2WAQ E;  1VQB A;  5J3B A;  4JC0 A;  3HFZ B;  4L5Q A;  3S1N H;  3F1Z A;  1QVC A;  3I4M G;  2UU9 Q;  4YWM A;  2B63 G;  1QUQ A;  1GVP A;  4DR5 L;  1PH1 A;  4JI8 L;  3S24 A;  3M4O H;  3CC2 A;  1A63 A;  1E24 A;  3STB D;  1VQC A;  1Q8K A;  5C44 H;  5ELN A;  3U4V A;  4JI5 L;  3G6E A;  2E2J H;  3CCV A;  4LW1 A;  5GAD C;  3CC4 A;  4A3B G;  4DR6 Q;  4KHZ A;  1A8V A;  3KOJ A;  3DLL A;  3PUV A;  2WP8 J;  3UDF A;  4AH6 A;  4YY3 Q;  4BXX H;  1FGU A;  1EUJ A;  1HNX Q;  2AHO B;  2HIX A;  2VUM H;  1NMF A;  4GKJ L;  4LFB Q;  3AFQ A;  4DK6 C;  5C3E G;  2AWN A;  1VQP A;  1WJJ A;  1IBL Q;  4JBM A;  1MIU A;  4LF7 L;  2K4K A;  3CCQ A;  4X66 Q;  1YIT A;  2ASB A;  1HZ9 A;  2A1A A;  5GAG C;  4EQ5 A;  2R93 H;  4JCV E;  4BBR H;  3A0J A;  4X64 Q;  1VQJ A;  4DUZ Q;  2XTI A;  1NBW A;  2L15 A;  4WJ4 A;  4RMF A;  2N3S A;  5C0X J;  4K0K L;  5IT9 c;  1WOC A;  3KJP A;  1PH6 A;  2N8N A;  4GN5 A;  3ER0 A;  2CWP A;  1K3R A;  3CP0 A;  2PI2 A;  1E22 A;  4PMW A;  4L5T A;  3T1H L;  3G71 A;  1N32 Q;  2VNU D;  2NN6 G;  1YJ9 A;  5C44 G;  4DV1 L;  3HOW G;  2DUD A;  4AIM A;  1Q7Y C;  3GTK H;  3I56 A;  3S1Q H;  3BZC A;  5IYB H;  2K5H A;  4NPS A;  1KRT A;  4FDB A;  1HNW L;  3EBE A;  5IP9 H;  1J5E Q;  2GVB A;  4UY8 C;  4BXX G;  1G51 A;  2D0O A;  3PIO A;  1LUZ A;  4JI6 Q;  4KHP Q;  3IRB A;  4X65 L;  1Y14 B;  1V9P A;  1BKB A;  2RCN A;  1R9T H;  1FJG Q;  2OQ0 A;  4IPG A;  1CSQ A;  3J80 i;  2AMC B;  1QVG A;  4A3E H;  2E2I H;  1Q1E A;  5IE8 A;  4A3I H;  3K7A H;  3TRE A;  4BBR G;  1N34 Q;  2RF4 A;  3JC6 6;  3GD7 A;  4DV3 Q;  2Y0S E;  2Z6K A;  4QQB X;  1MJC A;  1N36 Q;  1TXY A;  2R92 G;  1E1T A;  2BH8 A;  4DV7 L;  4HJ7 A;  1CSP A;  1RL2 A;  4JI3 L;  4LWC A;  3RN2 A;  2D62 A;  1JMC A;  4OO1 G;  2UXB L;  1XNQ Q;  1PH7 A;  4GOP C;  1BBU A;  1YNX A;  1VQ7 A;  2NVT H;  2NVX H;  4LFB L;  2RHS B;  5GAE C;  3K81 C;  5IY0 A;  5IYB G;  1OTC A;  1WI5 A;  4A3G H;  4OWX B;  4LF9 L;  2WAQ G;  1YJN A;  5C4X H;  5IP9 G;  3KF6 A;  1LTL A;  3GTG H;  3CCU A;  4A3K G;  1N33 Q;  3GTP H;  1EWI A;  1VQD A;  2HHH L;  4XTC S;  4DUZ L;  1FVI A;  2H5X A;  4OX9 Q;  1U5K A;  2R7D A;  2Q2H A;  5FLM H;  4GLV B;  3JAM i;  1WFQ A;  1MJE A;  1X54 A;  1XTD A;  2YTX A;  2IX1 A;  5K36 G;  3BJU A;  4DV6 L;  4A3E G;  4A3D H;  1EQQ A;  1K8A C;  5IYD H;  4A3I G;  1VQ5 A;  2EXD A;  4R4I A;  3KDF B;  4R4Q A;  3KYH C;  4DPG A;  3NBH B;  4POF A;  3VDY A;  3PUZ A;  5JEA G;  3AYH B;  4LUO A;  3KJO A;  4IJL A;  1Y1W H;  4LFA Q;  2Q2T A;  4JI2 L;  3PO2 G;  1HNZ L;  3FP9 A;  3KLW A;  3L7Z C;  4IOC A;  2KHI A;  4JV5 L;  1B7Y B;  4C2M H;  2CQO A;  4GOP B;  3PF4 A;  3K80 C;  5M3M H;  3OTO Q;  2ZM6 L;  4DR7 L;  5HY6 A;  1G29 1;  3AQQ A;  1WCM G;  1J5E L;  3M9B A;  1A62 A;  5M5W H;  1K9M C;  1GO3 E;  4JI6 L;  2OCE A;  4DV2 Q;  1RIP A;  4X62 Q;  3STB C;  2R7Z G;  4A3G G;  1I94 L;  5AJ3 Q;  2MFI A;  1U0L A;  4TVA B;  5M5Y H;  5C4X G;  3KF6 B;  4R1J A;  5LMN Q;  2E2H H;  4B3R Q;  3I4N H;  1X65 A;  1OXV A;  4PG3 A;  3ERS X;  2BH2 A;  3H3V I;  4C3H H;  2BA0 A;  3D0F A;  1B8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...