4JI7L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7L00
4ALPA 3UDGA 4IPHA 5JJLA 4B3ML 2LXJA 2A19A 2E2JH 2JA7H 3CPFA 1B8AA 4B3TQ 1K3RA 2ZM6Q 1IXRA 2D62A 4QL5A 4NXMQ 1IL2A 3S17H 2HQLA 1X3GA 3I56A 1KXLA 2NVYH 3PCOB 4JCVE 4GOPB 2Q2TA 1EIFA 5FJ8H 4DUYQ 4A76A 2NVXH 5JEAJ 4UY8C 4A3DG 5K36G 2PNHA 2AWOA 1E22A 2ZJQA 4L5RC 1QVGA 4OXPA 4X65Q 4IPDA 3S1NH 3HOVH 1A62A 3L2PA 4KHPQ 3L7ZC 1HZAA 4MTNA 4Y52H 1KAWA 1S40A 1VQ9A 3BZKA 5IYBG 4TVAB 3GO5A 3G71A 2HHHQ 1PH6A 5HY6A 4DPGA 1J5EQ 3GTPH 1G6PA 4DNIA 2VQEQ 4L5TA 1JT8A 4JI1Q 3L0OA 2XGTA 1FVIA 2AHOB 3M3YH 3S1MH 1XNRQ 1XPOA 1X55A 1P8LA 2VS1A 2K5NA 2PMZE 4DR4Q 4A4IA 1PYBA 2BA1A 2E8GA 1SMXA 1WFQA 4RMFA 3HOWG 4IFDJ 1Q8KA 4YHHQ 1WYDA 3FKIG 4DV6Q 1HNXQ 4AYBE 3KDFB 1CSPA 2UUCQ 2MFIA 3S2HH 1HR0L 2UXDQ 1K73C 1LYLA 1V43A 4DV0Q 2E5LQ 1Z47A 2Q2HA 2QEXA 4GS3A 4A3FG 2Y0SG 3KF8B 3NELA 5C4JH 1YJWA 3RZOH 3TS2A 4XIGS 1AE2A 3PUYA 1VQEA 3FKIH 2MNAA 1XMQQ 2YU9H 4DUZQ 2WB1E 1I94Q 1X54A 4OO1G 4JI0L 4APVA 5LMNL 1HZBA 3S1RH 2JQOA 4JI2L 4C3IH 3ERSX 3PUXA 4DV2L 3PUVA 3AFPA 2HIVA 3RLFA 5J3BA 1OTCA 1VQ6A 1ASYA 2UXBQ 1XJVA 4QQBX 2A8VA 4PZ6A 2UU9L 1U0LA 1UE6A 3E9IA 2ES2A 4DK6C 4DR5L 1W3SA 4PZ7A 4DV4Q 1EIYB 2MQHA 1VQBA 4UPAA 1VQIA 2UUAL 2K50A 1B7YB 1KL9A 2JK8A 4MZ9A 2K14A 4UP7A 1SROA 2R6GA 3MXNB 4DV7L 1SFOH 1Q46A 2YTYA 2ATWA 1YHAA 4LF9L 1OXVA 4IOCA 1JE5A 5GROA 1G291 4QGUA 3GTJH 1IBKQ 4DR6L 3KF6A 5C4XG 3CD6A 2JA6H 3PUWA 4H02A 4IJHA 5JEAG 3BU2A 1MJEA 4LF7L 4OX9L 1VQDA 4A3MH 2F4VQ 2JA9A 2AMCB 1K8GA 2B63G 1N32Q 3PUZA 4X64L 4HIKA 1L2FA 1P16A 5ELNA 4GOPA 4JI6Q 4LFAQ 1PH9A 3CCSA 1C7YA 1X6OA 1UE7A 2RCNA 3PF5A 2VQFQ 3T1YQ 3W5OA 1HNWL 1Q7YC 3HKSA 4GNXB 2WAQG 3BZCA 2BA0A 2YV5A 3HOUG 1Y1VG 1KIXA 3F2BA 3G6EA 1KD1C 2B3GA 1VQNA 1WCMH 5C0XJ 4JI8Q 2ID0A 4DR7L 5H1SE 1I50H 2K75A 2PI2A 3I2ZA 4YWLA 1RL2A 5IE8A 3S1QH 4UP8A 3RN2A 4OONA 4LFBL 2R7ZH 4HIDA 3HOUH 1Y1VH 2JE6I 4JI3L 1QVFA 3WWVA 4AQYQ 2NVTH 4JBWA 4DV3L 3I4NG 2R93G 3STBD 4HJ5A 1PA6A 4BY7G 5M3FG 4LUOA 2Q2IA 4B3TL 1GVPA 1VQCA 2H5XA 1VQMA 4QIWE 2DGYA 2ZM6L 1A0IA 2LSSA 1VQ7A 1H95A 2GVAA 3RLOA 1LTLA 1NMFA 2VL6A 3T1HQ 4KLKA 1U5KA 3S24A 4OWXB 4DR2Q 2VW9A 4NPSA 1PH7A 1VQ5A 4DUYL 1UE5A 3J80c 3M4QA 2UUBQ 3I55A 4BY7H 1HJPA 1S3OA 4JBJA 5M5WH 5M3FH 5IP7G 3RNUA 1CUKA 5C44G 2ZJRA 4A3EG 1EQQA 4B3RL 1N36Q 1N8RC 4EX5A 2JJQA 3F1ZA 4HIMA 4JI4L 2HHHL 1TXYA 1Q1BA 1W2BA 2E2IH 4GNXC 3E0EA 4IJLA 1HZCA 1HH2P 2I5MX 1CKNA 5IP7H 4JI1L 4A3EH 1CSQA 1SE8A 5C44H 2YTXA 4POGA 3RR5A 5EAYA 4L5QA 1KRTA 1XNRL 4O2DA 1WI5A 2RHQB 4GLAC 1EOVA 2NVQH 4AYBG 3PSIA 3K7UC 2CCZA 4K0KL 3W1BA 1MIUA 4X62L 4JV5Q 4YY3L 4YHHL 1TWAH 1PVOA 1SRUA 4DV6L 5LMUQ 2QA4A 1VQJA 1HNXL 4LF6Q 1X3EA 3TREA 3AFQA 4OWTB 4YCVA 1ASZA 3F8TA 1EUJA 1V9PA 4P74A 3RZDH 2UXDL 3Q8DA 2WB1G 1IBLL 4QJFA 2ALYB 4DV0L 4A75A 2E5LL 3W1GA 5IWAQ 3D31A 4P72A 3K81C 3STBC 5IYBH 2V1CC 4LF8Q 4A3GG 3UE0A 1Y1WG 1XMQL 1PH8A 1I6HH 4DUZL 2OQKA 5GAEC 3JAMi 2Z6KC 1VQAA 4PMWA 3HOXG 3ULPA 3M9BA 3PO3G 4AIMA 1XPUA 1VQFA 3J80i 5C0XG 2NN6G 5AJ3Q 2MO0A 3CCQA 1N9WA 1UE1A 4GNXA 4DR1Q 4A3JG 4B3MQ 3GTOH 3S16H 4A3GH 2KENA 1Y1WH 1IZ6A 4LWCA 1XNQL 2ASBA 1CKOA 5FLXc 1FJGQ 3ICEA 2CWPA 1Q1EA 3HOWH 3J7A5 2DUDA 4C2MH 3HOXH 3K8AA 1PH2A 2N49A 3PO3H 4DV3Q 4LUZA 4GOPC 3H15A 4KHZA 3S14H 1B70B 2YYZA 3MEFA 4LFCL 2D0PA 4A3JH 1YVCA 3AQQA 4GN3B 4DR3Q 3CQZH 1PHJA 2VZAA 4LUVA 3J7ZC 1XPRA 2R93H 5JJIA 1K0RA 4X66Q 3RN5A 1OXUA 4A3FH 1QZHA 3H0GG 1EYGA 2JA5G 1Q81C 4DV5L 1PYSB 1HNZQ 5IYCG 2PQAB 1X65A 5IT9c 3H3VH 1C9OA 4A3KG 1QUQA 3VDYA 4GLXA 1L1OB 1JB7A 1RIPA 3H0GH 4HIOA 4B3SL 2CWAA 4DK3C 3E9HA 3CC2A 1OXXK 4NB3A 2JA5H 1VQPA 4LF5L 1UEBA 2Z6KA 3EBEA 3I7FA 4IPGA 3SGIA 3S2DH 5E7NA 3CW2C 3K80C 3CPWA 2ZTDA 1S72A 2ZJPA 4DKAC 1YIJA 1N33L 2KBNA 4DAMA 1G51A 1Q86C 1HR0W 4LF4Q 4YWMA 1JJCB 3F2CA 3GTMH 2MO1A 3KLWA 5IYDG 1VQLA 4JYAL 1NTGA 4BA1I 2K4KA 3EIVA 1BBWA 5DLQE 5C3EG 2UXCQ 2D0OA 4FDBA 5C4XH 5LMNW 4P73A 4AQYL 1GD7A 3B6YA 2FXQA 3A74A 2R7FA 1YBYA 1PH1A 2B63H 3UE1A 3G4SA 2NZHA 4A3IG 5C3EH 4BBSG 2KHJA 3GTLH 2R92G 2I0QA 4YCUA 1VQHA 4R4OA 3CCMA 3T1HL 1WJJA 3I4OA 4A3CG 4HJ9A 2KCTA 5BR8Q 3H3VI 4OO1I 1XMOL 3CCVA 3PIOA 2UUBL 2UU9Q 5IP9G 4DR5Q 4IFDG 1L1OC 2C35B 4A3IH 3OTOL 1E1OA 5M3MG 4JI5L 4BBSH 1AH9A 4LW1A 2R92H 3M7NA 2UUAQ 2JEBI 1N34L 4YCWA 3HOZG 3UDFA 3GDEA 2JEAI 3CCLA 1C0AA 1JJ2A 3OW2A 3KYHC 4L5SA 2PI2E 2IX1A 1XTDA 5IP9H 3CMAA 4DR6Q 4BXXG 3U4VA 1Z9FA 4GLVB 4GKKQ 4X6AH 1AE3A 3G48A 3KDFA 4NXML 2IHEA 3M4PA 4A3BG 4IO9A 1E24A 1YNXA 2VY3A 3NENA 2OTLA 3I4NH 4WJ3M 1T9HA 4BA2I 4X64Q 1PH4A 4ME3A 4X65L 3KOJA 2ZTEA 1O7IA 4BXXH 4KHPL 2F3IA 5GAGC 4O0AA 1HNWQ 1K83H 4A3BH 5LMUL 1J5EL 4GN4B 1L0WA 2ZTCA 4BY1G 3CXCA 2VQEL 3OYYA 1Q82C 4IOAA 1YEZA 2CKZB 2OWOA 5IWAL 4JC0A 5IY0A 2OQ0A 3U58A 1PH3A 1E3PA 4DR7Q 1X3FA 3J81c 4LF8L 4DR4L 3UDIA 3EN2A 1E1TA 3HKZE 1L1OA 3CCUA 1KQSA 4LFBQ 4J15A 1JMCA 1VQGA 2RF4A 4JBKA 1BKBA 3U50C 4MNOA 1VCIA 1BBUA 5M5YH 1QZGA 4WJ4A 3A0JA 1TWHH 1X56A 5FJ8G 2I5HA 1SLJA 1K8AC 3KF6B 4DR1L 1MJCA 2AKWB 3KJPA 4UP9A 1MKHA 2UUCL 4IFDI 1YHBA 3ULJA 3CF5A 5JJKA 3HOVG 3ULLA 4HJAA 1FJGL 3HFZB 1IBMQ 4RG1A 2B29A 3D0FA 3KFUA 1D7QA 2F52A 2WFWA 4NXNQ 4DV1Q 1E7ZA 1YITA 2IHFA 2LXKA 1TWCH 4R1JA 1YJNA 1I94L 1D8LA 3GTQH 3RLNA 4R4IA 4EQ5A 2IX0A 3M85A 4DR3L 4B3RQ 1QVCA 1I5FA 1SR3A 4X66L 3A5UA 4JI7Q 4JI4Q 3HOYG 2N3SA 3GD7A 3J81j 1NMGA 3TQYA 2L15A 1HNZL 2OTJA 3CCRA 3PV0A 4C3HH 2UXBL 2K5HA 4OWWB 3GTKH 4DV4L 1Q12A 2IT1A 3TEHB 3CC4A 2KHIA 3HOYH 2EXDA 1DGSA 3PIPA 1KC8C 4QY7A 4K0KQ 2R7DA 4X62Q 1IBKL 1TWFH 4JOIC 4YY3Q 3J81i 3IRBA 1YJ9A 4LF4L 3CAMA 4Y7NH 4GKJL 1IYJB 2F4VL 2VNUD 3I4MG 3M4OH 4POFA 3CC7A 1VQ4A 3TS0A 1IBLQ 1N32L 3GTGH 5ELOA 2UXCL 4JI6L 4LFAL 1FGUA 4GN5A 3TRZA 3A5ZB 1EQRA 2KCMA 2VQFL 1TWGH 5IYCH 3T1YL 4JBMA 1NBWA 2EQSA 1OXTA 2Q2UA 4A3KH 1M1KC 3K7AH 2RHSB 2GN5A 3KJOA 1HZ9A 4HJ8A 3NBHB 1NE3A 1PV4A 2E2HH 3PF4A 4A3LG 3I4MH 1CKNB 4JI8L 1J6QA 2YTVA 2BH2A 1FL0A 1VS0A 4PZ8A 2GVBA 1YZ6A 2N78A 3DM3A 5HGQA 5BR8L 1HR0Q 1VQKA 1XNQQ 2JA8G 4A93G 2WP8J 5C0XI 2NN6I 4A3LH 1LM0A 4LFCQ 2JA6G 1YI2A 1GM5A 3JC66 1EWIA 3BJUA 3ER0A 5IYDH 1A63A 1JJGA 4A3MG 4JI0Q 5GADC 5LMNQ 1YHQA 4JI2Q 2Y0SE 2JA8H 3LGJA 4JG2A 4DV2Q 3NEMA 4A93H 4GKJQ 4JOIA 1KHIA 1GKHA 2A1AA 4XTCS 2K5VA 4GKKL 4DV5Q 2QGQA 1NJIC 3K0XA 4DR2L 3FHWA 4BBRG 1VQOA 3DLLA 4R4CA 4C3JH 4P71A 1V1QA 3F2DA 1K9MC 1PFSA 4A3DH 3PGZA 4HJ7A 1VQ8A 4LNQA 2IY5B 3UDXA 1N36L 1WCMG 4B3SQ 4AH6A 4LF5Q 2VUMG 2XTIA 2K52A 4A3CH 1OXSC 1SN8A 1I3QH 5M5XH 4DV7Q 4BBRH 2CQOA 2Z0SA 4LF9Q 1CKMA 2AWNA 2R7ZG 1M90C 3S15H 1N33Q 1NY4A 3HKZG 5GQOA 1X9NA 5M3MH 1EFWA 1R9TH 3CCJA 2I5LX 1WOCA 4LF7Q 4OX9Q 2VUMH 4JYAQ 3HOZH 2N8NA 3PO2G 4R4QA 5GAHC 4P75A 2BH8A 4JV5L 3AEVA 2HIXA 4DAYB 2EIFA 3CMEA 3AYHB 3U4ZA 4LF6L 5FLMG 1BVSA 3PO2H 3CCEA 4R4TA 3ZJYC 1IBML 2PQAA 3JAMc 2CFMA 1GO3E 1QUQB 4NXNL 4DV1L 2NZOA 2WAQE 1XMOQ 1LUZA 2JA7G 4KI0A 1PH5A 2HT1A 4TQUS 5FLMH 4BY1H 4PG3A 3OTOQ 4YWKA 1A8VA 4JI3Q 1UWVA 4JI5Q 1Y14B 2OCEA 1KRSA 3FP9A 4JI7L 1N34Q 5AJ3L 4IPCA 3CP0A
chains in the Genus database with same CATH superfamily
2JA7H 1EWCA 2IJ0A 1EOTA 5I2YA 4RH6A 4A3FB 3S17H 4JCVE 5CBAE 1SDFA 4DAPA 4DUYQ 2NVXH 4KD3A 2PNHA 5C3WA 3H91A 4TRDA 4OXPA 3S1NH 1A62A 4KHPQ 3L7ZC 5EQ0A 1KAWA 1JWUD 1S40A 3E0JA 3G71A 1PH6A 4DPGA 5K36H 3O13A 1ENCA 4PMBA 3GTJB 1KDBA 2L4NA 2D2CC 4UAIA 2VS1A 2B2YA 2K5NA 3ND9A 3A55A 2A6HC 1SMXA 2NWGA 4RMFA 1WTQA 4X3TA 1VF5C 1WYDA 3FKIG 3KDFB 4CGYB 3HP3A 2MFIA 3S2HH 2ZXRA 1HR0L 2UXDQ 1LYLA 4F87A 1GUOA 1BCPF 2ZT9C 4DV0Q 2Q2HA 4A3FG 4GS3A 1SEBD 4RGNA 5C4JH 4ME5A 1WCMB 1ZXTA 1YJWA 1BBXC 3FDTA 2YU9H 1I94Q 1I50B 1EYDA 4K6LA 4OO1G 3S1RH 4JI2L 2RDFA 4DV2L 5EKIA 1S5BD 2B2UA 2HIVA 2NVTB 1ILQA 5J3BA 4U673 2SDFA 1XJVA 4IZ8A 2A8VA 1QWYA 1U0LA 4H7BA 1S5CD 4PNYA 1B7YB 3NWTA 4MZ9A 2L11A 2K14A 4J8QA 4RAUC 5M5WB 1G2SA 1OXVA 1G291 3JAML 2EY6A 3KF6A 5CV7A 5IGGA 3TMEA 3CD6A 2NBFA 1B1ZA 3PUWA 4GKJQ 2F4VQ 5IGEA 1VQDA 2JA9A 2AMCB 2F0JA 1CT1D 4X64L 1L2FA 5ELNA 1FGBD 2DJFC 1PH9A 4JI6Q 1GUGA 2FMMA 1CFMA 3PF5A 2Z9HA 1EEFD 2NVQB 4GNXB 4FYDA 3BZCA 4K14A 1SAPA 2BA0A 1TQOA 3F2BA 5IGFA 1BNZA 1PZKD 2K03A 1VQNA 5C0XJ 1TWAB 1U9RA 3NUCA 4JI8Q 4DR7L 5H1SE 2QF7A 5IE8A 4UP8A 4AYBB 3RN2A 2R7ZH 3HOUH 1SE3A 1Y1VH 1I4QA 4CKCA 1PA6A 1SBBB 3S9WA 3A8JE 1UNSA 4H0LC 5KNBA 3MVVA 3EQLC 3RLOA 3T1HQ 4DR2Q 2B2TC 3GTOB 4A3GB 3KLSX 1UE5A 4DUYL 5JVH3 3HOWB 3BZDB 1HJPA 3RNUA 4B3RL 3PO3B 5BN3A 3CHBD 4EX5A 3F1ZA 4XQQA 4F8MA 3TDQA 5A2QL 1TXYA 2HDLA 3NBHA 1HZCA 3R8BA 3K0YA 1A3VA 4KY6A 3U9SA 4A3EH 4POGA 2QDLA 3VR3A 4L5QA 5JJZA 5L37A 4RHRA 3ONAB 4AYBG 1BCPB 2B2VA 3H0GB 3D4RA 5IOCA 4YY3L 2JA5B 1PVOA 2QA4A 3OWEB 1ICFB 2FFKB 4G7OC 2UXDL 4DV0L 4P72A 4RCOA 3Q22A 4LF8Q 4A3GG 3UE0A 4IUUA 1I6HH 2F0FA 5JPNC 3MXGA 1ENAA 1VQAA 2B2WA 4PMWA 1CQFA 3PO3G 2I46A 1XPUA 3J80i 5C0XG 4O1NA 3CCQA 4DR1Q 1UE1A 4B3MQ 1FNVA 2MUYA 2O5JC 3QR8A 1CKOA 1EU3A 2B63B 1Q1EA 3HOXH 3K8AA 4ZQ3A 5KNCA 1MSHA 4LFCL 2QKIC 3AQQA 3GP7A 4GN3B 3RMHA 4DR3Q 2R93H 4LUVA 2B8FA 4A3FH 3H0GG 4CDEC 2JA5G 4B9XA 5IYCG 4MN3A 4OO1H 1QUQA 1B44D 4GLXA 4O42A 1PTOH 2EYOA 1L1OB 1RIPA 4HIOA 4DA2A 2CWAA 3CC2A 3E9HA 4B3SL 2Z6KA 5E7NA 1B2TA 1YIJA 2EDGA 4K6DA 2JYOA 5KNDA 3F2CA 3GTMH 4A3BB 1VQLA 4JYAL 2PCFB 4BA1I 2K4KA 3EIVA 5HURA 2FMCA 2LMCB 2XN9C 1D5ZC 4RKBA 1PFNA 2R7FA 2L0CA 3G4SA 4IUQA 1CM9A 4XXEA 3H94A 3T1HL 2E2DC 2KCTA 3NPPA 4G7ZC 2F0NA 1D5XC 4HCSA 3FPUB 4DR5Q 4A3IH 3OTOL 4CDCC 4FF1A 4LW1A 3M7NA 1RD9D 2UUAQ 2JEBI 1PFBA 1TWCB 3C3LA 3UDFA 2F0IA 2QW7A 3CCLA 5IP9H 4DR6Q 2HDMA 3U4VA 1Z9FA 4GKKQ 1DCZA 3M4PA 1VF7A 4A3BG 1QOHA 1YNXA 4TSSA 5CV8A 4WJ3M 2RDGA 1TVXA 4ME3A 2K32A 4X65L 1SYGA 1O7IA 3VYSA 4KY5A 1SE2A 4X3KA 3M7GA 3D4WA 1J5EL 1L0WA 3OYYA 1S5FD 1Q82C 3NWSA 2F0LA 2CKZB 1PTOD 1NUCA 1RF2D 1SJHD 3T56B 4Y7NB 3J81c 4LF8L 1HRJA 3CCUA 4EQNA 3IL8A 4J15A 3SHLA 1BKBA 3U50C 5I9OA 1VCIA 1BBUA 1D5MC 5M5YH 1TWHH 5CGKA 1G91A 3KF6B 4DR1L 1LLRD 3KJPA 3ULJA 1R4QB 4A3KB 4FXGC 4L63B 2DY8A 3CRKC 3HFZB 1IBMQ 3KFUA 2B29A 4NXNQ 4DV1Q 1E7ZA 3I4MB 2IHFA 4N8X1 3I90A 5C5LA 1IKMA 1YJNA 2BE5D 3GTQH 4ULLA 3RLNA 3M85A 4DR3L 1MBYA 1I5FA 1JOQA 3N6RA 1SJED 1D1KA 2OTJA 1NAPA 3OMCA 2RKSA 2ICIA 2JA8B 4A93B 1O7YA 3P20A 1RHPA 3GTKH 1STHA 1QNKA 3TEHB 2KHIA 5C5MA 1X3PA 1NR2A 3H3VC 1ZKOA 1BCPC 1EQVA 2R7DA 1TWFH 1A2TA 1ICWA 3Q24A 4BBRB 2PZUA 2VNUD 2EYJA 1AFPA 2VXWA 4POFA 2JN4A 1S5DD 1JWSD 3A7LA 3S15B 3HZXA 1MGSA 1V1PB 4LFAL 5CV4A 3M4YA 1HQMC 1EQRA 1XXGA 3HOZB 2KCMA 4JBMA 5IYCH 1E2VA 2EQSA 4ID6A 1LTSD 3K7AH 2RHSB 3HKZB 3KJOA 1ZYRD 3NBHB 3PF4A 2YTVA 3MXUA 1FL0A 1XNQQ 2GVBA 2N78A 1UAPA 2JA8G 4A93G 3C1EA 3KBGA 3X3MA 1D2BA 1I4XA 3R3OA 2JA6G 2L9HA 1GM5A 1VDZA 2XVSA 3JC66 3ER0A 2Z8LA 1IHZA 1YHQA 1CA5A 3LGJA 4JG2A 4KK7A 1GKHA 4XTCS 4GKKL 1F9SA 3K0XA 3TP8A 4BBRG 1I4HA 2JA7B 2A6ED 4ZAIA 2DY7A 3PGZA 4RHSA 4LNQA 3S17B 3UDXA 2IY5B 1N36L 2EY5A 1CK1A 1HUMA 3NXWA 2NVXB 1SN8A 2VB2X 2JXMB 3J81E 2CQOA 4LF9Q 2AWNA 3S1NB 2H4OA 3VR6A 1NY4A 3HKZG 4XYQA 3I73A 1R9TH 2PZWA 3CCJA 1WOCA 3BYYB 4B08A 4LF7Q 2VUMH 1AEXA 4FF3A 2Z4IA 5GAHC 1LT4D 5E3FA 4JV5L 2X69A 2HD3A 1KDCA 1SYEA 3NTKA 4LF6L 3V05A 1XX8A 3CCEA 4R4TA 2KCNA 3ZJYC 4ZKCB 1IBML 3JAMc 1FNWA 1QUQB 4NXNL 5I9PA 1TS3A 2NZOA 5J39A 5M9OA 4DV1L 1XMOQ 1LUZA 2JA7G 4OEMB 3S2HB 2B2YC 5FLMH 5EPLA 2F0UA 4YWKA 5C4JB 4JI5Q 1UWVA 1BOSA 1KRSA 5AJ3L 2YU9B 3UDGA 3GV3A 1EL0A 2CQAA 5JJLA 2E2JH 3W3AA 5I4DA 3OHXC 3S1RB 4B3TQ 1K3RA 3CRLC 1IL2A 4NXMQ 2CW0D 3BS1A 1IW7C 3EA6A 4Z9CB 1LO5D 3I56A 1CZWA 2MJ8A 4GOPB 3QWNA 5JEAJ 2XRQD 4A3DG 5K36G 2LS01 1X32A 3MXPA 4V0BA 1AZPA 3FVQA 3BZKA 1UEAB 1HA5A 2B2UC 4EQPA 4DNIA 3SEBA 2VQEQ 4L5TA 1JT8A 4JI1Q 3L0OA 2AHOB 2HQEA 3SK6A 1F2LA 4DR4Q 4A4IA 1PMRA 1O78A 1PYBA 2E8GA 3BVGA 1D6EC 4IFDJ 1Q8KA 2AUKA 1DD2A 1RTNA 4DV6Q 1HNXQ 1KNAA 1JOKA 4AYBE 1CSPA 5JOBA 1QCBD 5CC4A 1PTOF 3NBIA 2E5LQ 1Z47A 2QEXA 1NCVA 3NELA 1H9RA 4XIGS 3PUYA 2MNAA 1EIGA 2EJFC 1X54A 3TZDA 5CV6A 1CI3M 1HZBA 3HOUB 1Y1VB 3PUXA 4C3IH 3RLFA 2K01A 4QQBX 1A6XA 5C3XA 1TS2A 4DK6C 3P7JA 1VQBA 4C1NI 4N9PA 4UPAA 4FXKC 1SROA 2R6GA 1K8MA 1YHAA 4DNRB 1RTOA 4LF9L 4IOCA 2R61A 1IBKQ 2Z1CA 2JA6H 5JEAG 1HUNA 3BU2A 4LF7L 2DJGC 3TZUA 1STEA 1P16A 4A3EB 4FF2A 3CCSA 3JAME 1C7YA 3DEOA 1L0YB 1IW7D 3T1YQ 1SNQA 3W5OA 4FNFA 2PMZB 2WAQG 5T1IA 2YV5A 3HOUG 1Y1VG 1KIXA 3G6EA 2B3GA 2PYKA 2ID0A 4P2CB 1KAAA 2WV6D 3I2ZA 1RL2A 4LFBL 1QB5D 1STYA 4HIDA 2JE6I 1Y69U 1F2ZA 4IALA 4Q0FA 4ZLTF 3HEJA 1I6HB 2ENBA 1TR5A 3E5SA 1H9SB 3STBD 2PZTA 4B3TL 1GVPA 1VQMA 4QIWE 2DGYA 2LSSA 4RWSC 2DN8A 1WTWA 2F03A 1NMFA 2VL6A 1GHKA 1F77A 3G6JB 1Y8NB 2F0TA 2UUBQ 4OELB 1S3OA 5M3FH 4A3EG 1CA6A 4G7HC 3HOXB 2ZJRA 1EQQA 1N8RC 1NSNS 2B2WC 5BN5A 4HIMA 4L6TB 2LFNA 2KEDA 2BDNA 5G3LF 2R93B 2MP1A 3SK4A 4C1NK 1U4RA 4KJOA 4JI1L 1CSQA 5C44H 1SXTA 5EAYA 1STGA 1ONLA 2K7VA 5A2QE 5KEEA 1WI5A 2JP1A 2RHQB 4GLAC 4Q5VA 2TSSA 1EIHA 1PTOB 1Q8IA 2MPMA 1MIUA 2RDHA 3WDNA 4X62L 4CJ2C 4DV6L 1GHJA 1ML0D 1HNXL 4A3DH 2K04A 3QOLA 3AFQA 3EVQA 4P74A 2AQ2B 2WB1G 4PQXA 3E3XA 4QJFA 4A75A 2E5LL 3D31A 3WOEA 3GTMB 3IFDA 4CJ0B 1LACA 2Z6KC 1JORA 3HOXG 1H9JA 5COYA 5J22A 3ULPA 4AIMA 3RUZA 1KNEA 2KENA 1Y1WH 4M8AA 2R93G 4QMGA 3J7A5 2DUDA 4GOPC 3S14H 4HR7B 1B70B 2YYZA 3MEFA 3Q23A 4A3JH 3QO2A 2F0DA 1C8CA 1PHJA 2K6AA 2VZAA 1Y8OB 1E0BA 3RN5A 4A3IB 3IKJA 1QZHA 3NK9A 4HN7A 5DAUA 2D5DA 4DV5L 1Q81C 2M00A 4X3UA 2QILA 1L0XB 4DK3C 4LF5L 2K28A 4IPGA 5CORA 4H13C 2ZTDA 2ZJPA 1N33L 2KBNA 1Q86C 1HR0W 4LF4Q 4YWMA 5IYDG 3UI2A 1NTGA 2SNSA 3BVZA 1EWHA 1BBWA 4KMUC 4FDBA 4YIJA 1LTID 4RGOS 1GD7A 3I4LA 5JEAH 1E2ZA 1YBYA 2M9VA 3UE1A 2NZHA 4A3IG 5C3EH 5M5YB 2KHJA 1TWHB 4YCUA 1IYUA 1VQHA 2IW3A 4A3CG 1WJJA 2J0TD 3H3VI 1TKWB 5I6YA 2UUBL 2UU9Q 5IP9G 1F2MA 4BBSH 1DOKA 2R92H 2KECA 1N34L 4YCWA 1WTHA 1W6KA 3GDEA 1C0AA 2PPBC 3IAYA 3GTQB 4HMJA 1XTDA 3CMAA 4IFDH 1JE4A 1AE3A 5I2XA 1KABA 4IO9A 1M8AA 2VY3A 3NENA 2OTLA 4RCNA 4OL7A 1EYAA 4IUPA 2PO4A 1PH4A 5CV9A 3GTKB 4IN3A 4KHPL 1TIID 2NYZD 1V8QA 1HNWQ 1K83H 5FLXL 3TP6A 3CXCA 2OT2A 3K5OA 1TWFB 2NZ1D 2KOLA 2OQ0A 1X3FA 3UDIA 3HKZE 3W2DA 1EU4A 1WTRA 3J7AV 4HTHA 4MNOA 1QZGA 3QG1A 1JR0D 2I07B 5FJ8G 3VR2A 5IT9L 5J1ZA 1B9MA 1YHBA 1RDPD 1TY0A 3K7AB 3C2PA 4HJAA 4RG1A 3D0FA 2F52A 2WFWA 1PZJD 4ZYSA 1I94L 1I4PA 5E4WC 4R4IA 2IX0A 2NTTA 3VR4A 1HHVA 4JI7Q 5I6WA 3DUZA 1SNOA 4JI4Q 2XSCA 2BCOA 1NMGA 1SNDA 1F9PA 4C3HH 3HG9A 4MTKA 1DOMA 2EYFA 2FINB 2D9UA 1Q90A 4QIWB 2WIIB 2IT1A 4K8IA 3CC4A 3BG3A 3NP8A 1KC8C 3A54A 5A35A 1PTOC 4K0KQ 1NNXA 2IWHA 5ISRA 3J81i 1YJ9A 1K3BC 1R4PB 4LF4L 3CAMA 3FPPA 4GKJL 1IYJB 2F4VL 1VQ4A 1IBLQ 1AZQA 3GTGH 4JI6L 5D3DA 5EGTA 4GN5A 1R9TB 3TRZA 1HTPA 2VUMB 3A8KE 1G8ZD 3VYUA 2AUJD 1NBWA 1ET9A 1M1KC 1CHQD 1HZ9A 1LV9A 4HJ8A 2E2HH 5FK9C 3MA2B 2BE5C 4JI8L 1B3QA 4DNTB 5HGQA 1YZ6A 2F0VA 2NN6I 1I6VC 3GQBA 1EWIA 5IYDH 1JJGA 4A3MG 4JI0Q 4B9WA 5LMNQ 3NEMA 4JOIA 4NDXA 2OF1A 1KHIA 3E6ZX 4L8JA 1CTMA 2QGQA 2K1BA 4DR2L 3FHWA 1VQOA 2A74C 1TT2A 2NUCA 4P71A 4R4CA 4C3JH 2E2JB 1K9MC 3LWEA 1SMYD 4UDUC 2KCCA 3OW7A 4QUFA 3A8IE 4DAVA 4HMIA 4MHEA 2VUMG 4A3CH 2K52A 1OXSC 1I3QH 1VMPA 1EZ6A 4J1MA 4N9TA 3HRZC 3L9AX 4V190 1HQRD 1FNUA 4QF4A 4OX9Q 2NB0A 4OIKA 1ZYRC 1EFID 1RODA 4F88A 4R4QA 3HGBA 1GUNA 2BH8A 1A3TA 1YNND 1K8OA 1QILA 5FLMG 3LWUA 1BVSA 1EY7A 2K5DA 3Q6SA 2PQAA 1WTPA 2WAQE 1HTLD 1PH5A 1BR9A 4TQUS 1B50A 1MHWC 4RGMA 1A8VA 4JI3Q 3FEWX 4JI7L 5KIXA 2HCIA 2A73B 2A6EC 4DV3Q 4IPHA 4B3ML 2LXJA 2A19A 2F0WA 3CPFA 4LK1C 4C3IB 2ZM6Q 2D62A 2HQLA 5JVG3 1KXLA 3PCOB 2AQ3B 2Q2TA 1EIFA 5FJ8H 4IUVA 4A76A 4UY8C 1E22A 4L5RC 4IPDA 5IGCA 1HZAA 4Y52H 4TVAB 2HHHQ 2KA7A 2XIWA 2CH4A 2XGTA 4NKLA 4K5VA 2Q8IB 3S1MH 1STNA 2JA6B 2ICEC 1G2TA 3R2TA 2PMZE 1H9KA 2BA1A 5FKAC 5E1FA 2BDOA 3OSOA 4CBVA 3MEHA 2F0PA 4YHHQ 4KY7A 2UUCQ 2TMPA 4C3IG 1V43A 3TS2A 1PLFA 5KGUA 1AE2A 4HCEA 1XMQQ 4DUZQ 2WB1E 2XWJB 4G57A 2CW0C 4JI0L 1MI2A 2KVMA 5LMNL 1T5EA 3D6CA 3P75A 3PUVA 5IODA 3AFPA 3TN2A 5EJWA 4DXFA 3VR5A 1VQ6A 1LT5D 1ASYA 2UXBQ 1G6ZA 1YNJD 2OEOA 3E9IA 4ZUJA 2ES2A 4DR5L 1EIYB 4DV4Q 3DM1A 1C4QA 2UUAL 4K2KA 1KL9A 1F9RA 2JK8A 1KTKA 4KD4A 4UP7A 1SFOH 5M3FB 1Q46A 2YTYA 2ATWA 5G3LD 5GROA 4QGUA 2B8GA 4DR6L 1LTAD 5C4XG 1II3A 3T13A 1U4PA 4OX9L 4A3MH 1K8GA 1N32Q 1RCVD 4HIKA 5C44B 1UE7A 1U4MA 2VQFQ 2CVRA 3MAQA 1Q7YC 3HKSA 1D1IA 4RA8A 2A68D 3DWQA 1KD1C 3EJIA 3NQIA 3QJYA 5FO8B 1WTXA 4A3DB 3KUPA 2K75A 2PI2A 2PNRC 4YWLA 4E6IA 3S1QH 4OONA 3I91A 2FJ2A 4JI3L 1J9OA 4JBWA 4DV3L 3I4NG 3LX0A 3TSSA 3KLRA 5M3FG 4LUOA 2ZM6L 3MWYW 1JB3A 4WRDA 2GVAA 1JOOA 1LTLA 3T4AC 4ZKBB 1PH8A 3S24A 2DNCA 1PH7A 1Y1WB 5BN4A 3M4QA 3I55A 4BY7H 4JBJA 4ZCKA 1WTVA 5C44G 3S14B 5EPKA 4A3JB 1SYFA 1MSGA 2HHHL 1Q1BA 1W2BA 2E2IH 3DEPA 1TU2B 4IJLA 1HH2P 1CKNA 1EY6A 5IP7H 1CHPD 1SE8A 2RQXA 2YTXA 2E75C 3AB9A 3RR5A 1KRTA 4O2DA 4DN4M 3TP5A 1A15A 2C9OA 4G4KA 3VYRA 2CCZA 2F0QA 3W1BA 4YHHL 4XDXA 2IL8A 4LJZC 1VQJA 1X3EA 3TREA 1ASZA 4OWTB 4YCVA 2F0KA 1HCZA 3RZDH 3D3RA 1H9MA 2KHSA 3W1GA 5IWAQ 3D6WA 3K81C 3STBC 2V1CC 3R93A 1XMQL 2EPBA 2L5TA 1Y1WG 4JK1C 3NTIA 4DUZL 4NW2A 3V2TA 1RKNA 3V96A 1VQFA 1JICA 2MO0A 1N9WA 4GNXA 4A3JG 3S16H 4DF7A 2ASBA 5NUCA 1XNQL 3ICEA 5FLXc 1SYBA 3NSWA 5C3EB 4C2MH 1PH2A 2N49A 1HFGA 1PDQA 4KHZA 5K5PA 2D0PA 1M4VA 1TY2A 3CQZH 2WAQB 1MD2D 4HAEA 4DAYA 4X66Q 4BBSB 1OXUA 4I65A 2A69D 2R92B 4ODGA 5DM73 4PV1C 1PYSB 1HNZQ 2PQAB 5IT9c 3QOJA 3R2IA 1LTGD 3VDYA 3EROA 1JB7A 1UUPA 1OXXK 1UEBA 3I7FA 3EBEA 3SGIA 3K57A 1EY5A 4X3SA 3CW2C 3BDLA 3S2DH 1GJXA 2AQ1B 4JVZA 1HA6A 1VMCA 1CQVA 3MFYA 4PMCA 4DKAC 1G51A 1DM0B 1K83B 2MO1A 4EQOA 2O2LD 3DHQA 3J80L 1BO0A 1K0SA 2K33A 3DXJC 4J6HA 5C3EG 2D0OA 5C4XH 2HCCA 3FMCA 3B6YA 2FXQA 3A74A 1PH1A 2G9HD 4BY1B 5LHY1 5F2DA 4BBSG 5C4ZA 3GTLH 2R92G 4I7ZC 2RSNA 4R4OA 2WINB 3I4OA 4OO1I 3HS0C 4HJ9A 3OPOA 3J81L 1BXTA 1XMOL 3CCVA 3PIOA 1XWEA 5FOBB 1SSOA 2EOTA 4IFDG 4HEDA 1WVLA 1E1OA 5M3MG 4JI5L 1DONA 2KQ3A 4HSVA 2B2VC 1WD0A 2NVYB 2IX3A 2P5ZX 2L55A 2JEAI 1JJ2A 3OW2A 5EPJA 2WB1B 3K5LA 4KV6A 4NXML 1JQYD 1E24A 5ELBA 3I4NH 4C3HB 3KF8A 1T9HA 4X64Q 3K59A 1LTRD 3KOJA 4CJ1B 4BXXH 1AN8A 2F3IA 1O7ZA 1SNMA 4K2LA 3VYTA 1S4ZA 4GN4B 3SE0A 4XQNA 2ZTCA 4BY1G 2VQEL 4IOAA 1QNUA 1YEZA 4UHVA 3NQTA 3ITPA 5IWAL 5IY0A 3U58A 4DR7Q 4DR4L 3PIO3 3EN2A 1E1TA 1L1OA 5FLXE 1F2YA 4WORA 1KQSA 3GTGB 3OOCA 1VQGA 2RF4A 1KLGD 4JBKA 2ZXPA 4WJ4A 2LKVA 3MXNA 2I5HA 1PRTF 1SLJA 4RGTA 2F0HA 3HOVG 3ULLA 3J7YW 1D7QA 2E2HB 5KYLA 4DFAA 1YITA 1O80A 3K58A 4R1JA 4C3HG 1HPCA 3F2UA 5IT9E 5KYIA 4B3RQ 5D65A 1QVCA 4C56C 4X66L 2X6LA 5JPMC 2CHBD 4IUTA 2N3SA 3GD7A 3J81j 2L15A 1HNZL 3P1HA 2ZXOA 3PV0A 2K5HA 4OWWB 2Q8TA 1Q12A 4OHJA 3G7LA 3HOYH 2F0GA 4C3JB 4DK1A 2EXDA 5EBCA 1DGSA 4XQJA 4M1UB 4FO2A 1DZ1A 5D14A 1IBKL 4JOIC 2SOBA 4U68A 1LT3D 3IRBA 4YY3Q 1I4RA 1I3QB 1V1OA 3M4OH 1RJTA 5IGDA 3TS0A 4ILWA 1JC7A 3DWAA 1FGUA 2JSOA 3T1YL 1TWGH 1BUVT 2EYLA 2WKDA 1OXTA 2Q2UA 2GN5A 1FR3A 1NE3A 2GA4B 1SYCA 3BVMA 1CKNB 2EZVA 1BF4A 3DM3A 1VQKA 1PZID 3MHBA 2WP8J 5C0XI 2MHVA 4A3LH 1LM0A 1STAA 4LFCQ 1YI2A 3BJUA 4XT1B 5FO7B 4C3JG 4CKEA 1A63A 3X3NA 5GADC 4R8NA 2PW5A 1SNPA 1EEID 2K5VA 1WD1A 3NHHA 3DLLA 3L3OC 1SNCA 3H6MA 3F2DA 1PFSA 2A5HA 4HJ7A 2BOSA 1WCMG 4B3SQ 4RKLA 4I7AA 2XTIA 2WACA 3RD4A 3T16A 5M5XH 4DV7Q 1KLUD 2Z0SA 1CKMA 2MGSA 1M90C 2RCFA 3A56A 5GQOA 5M3MH 4QCLA 3I3CA 2K5WA 4JYAQ 2KEEA 1PRTB 2M2LA 4FXDA 5ELEA 2EYMA 3PMFA 1TS4A 3S1MB 2VB3X 4P75A 1HXYD 4DAYB 2F4IA 2J4XA 2EIFA 3Q0AA 3CMEA 3GV6A 3AYHB 3U4ZA 3IFTA 2F0SA 1DYQA 3PO2H 3I8ZA 2A6HD 3NE5B 2CFMA 1GO3E 1V1PA 4BY1H 4PG3A 3OTOQ 1Y14B 2OCEA 3CP0A 4ALPA 1QE6A 1SMYC 1SE4A 4OIJA 1B8AA 2WKCA 1B9NA 1IXRA 4QL5A 2Y0SB 1X3GA 2PQEA 2V4DA 2NVYH 4LAAA 4CHTB 1S5ED 2AWOA 2ZJQA 1QVGA 4X65Q 3HOVH 3L2PA 4MTNA 1VQ9A 1ESRA 2EJMA 5IYBG 1U4LA 3GO5A 5HY6A 1J5EQ 3GTPH 1SFOB 1G6PA 4WFN3 1FVIA 3M3YH 1EQTA 1YNNC 1XNRQ 1XPOA 1X55A 1P8LA 3KLSA 4A3MB 4ABNA 1WFQA 3HOWG 4KKUA 1IYVA 1CZGA 3SXHA 1EY4A 1SYDA 1K73C 3QIAA 4H44C 3VA5A 2Y0SG 3KF8B 3RZOH 1VQEA 3AU7A 3FKIH 1FD7D 2HUGA 4ZUIA 3KK7A 3S1QB 2QDBA 4APVA 2JQOA 1ENFA 2EY2A 3ERSX 2K05A 2SEBD 3AMUA 1OTCA 1DOLA 1T5XD 3SK8A 5IIFA 4QB4A 4PZ6A 2UU9L 1UE6A 2O4XA 1W3SA 4PZ7A 5D3IB 2MQHA 2KJXA 4EGVA 1VQIA 2K50A 3MXNB 1B4OA 4XYOA 4DV7L 4BY7B 1B53A 1JE5A 3GTJH 4K5WA 4KN4C 1GUTA 5HGTA 4H02A 4IJHA 1MJEA 2F1MA 2E2IB 2B63G 3PUZA 4ZK9B 2F0OA 3U9OA 4GOPA 4LFAQ 3K5MA 1LTTD 2Z6BA 1X6OA 2RCNA 3SR1A 3D8GA 1JCKB 1HNWL 4CDFC 3BDCA 2EYHA 1GOZA 3C46A 1WCMH 1Z6HA 4IUNA 3OIPA 3I72A 4HSPA 4DXGA 1I50H 3RZDB 3OWFA 4KKSA 5KRUA 1QVFA 3WWVA 2L12A 4AQYQ 2NVTH 1Y8PB 1YNJC 5ELCA 4HJ5A 4N8FA 4BY7G 2Q2IA 1VQCA 2H5XA 1VQ7A 1H95A 1EY9A 1A0IA 1JMCA 4FP5D 4KLKA 1U5KA 4OWXB 3S16B 2VW9A 4NPSA 1VQ5A 3J80c 5TSSA 4C2MB 5M5WH 3TBIB 1CUKA 5IP7G 2IPKD 1N36Q 2F0MA 2JJQA 3ERQA 5ELFA 1EY8A 3CKIB 4JI4L 4OGQC 2QEJC 4GNXC 3CQZB 3E0EA 4RFBA 2I5MX 1C48A 2EVBA 1PXUA 1PRTC 1XNRL 4FF4A 2A68C 3D4DA 2NVQH 1EOVA 3DMUA 3PSIA 3T51B 3K7UC 4K0KL 3MC0B 4JV5Q 3MTSA 1TWAH 2KUMA 1SRUA 3S2DB 5LMUQ 4LF6Q 4GZYC 3F8TA 1EUJA 1V9PA 2R3ZA 3Q8DA 1IBLL 2ALYB 2B2TA 1JWMD 5IYBH 3KBXA 5CMDA 5DM63 2OQKA 5GAEC 3JAMi 2EYPA 3M9BA 5C4XB 5AJ3Q 2NN6G 3K5NA 1W6JA 3GTOH 4FVMA 4A3GH 1IZ6A 4LWCA 1FJGQ 2CWPA 3HOWH 1O7LA 3GTLB 3PO3H 4LUZA 1J8IA 3H15A 5C0XH 5EKLA 1YVCA 2SNMA 3J7ZC 1XPRA 3I70A 5JJIA 1K0RA 2XNAC 3CU7A 3MZ5A 3URYA 1EYGA 1H9SA 2F3WA 1X65A 3H3VH 1C9OA 4A3KG 5AFWA 1E2WA 3SK5A 3H0GH 1QJOA 3I4MG 1ZEQX 4NB3A 2JA5H 1VQPA 3I4NB 2RBMA 5DNFA 4BS9A 1OO9B 4BWGB 3K80C 3CPWA 1S72A 5CBEE 4DAMA 4NMZA 1JJCB 3N52A 3KLWA 4IURA 1HFNA 5DLQE 3SDZA 5LL6S 2UXCQ 5ELDA 2FHTA 2OXPA 5LMNW 4P73A 1NR4A 4AQYL 4R9WA 5EKKA 3J80E 1PRTD 1X3QA 2B63H 4F7XA 5CR3A 4DGZA 2O5IC 5C4HA 2I0QA 3CCMA 2E74C 5BR8Q 2N55A 5CYUA 2A69C 1FYCA 4JPBW 3WOFA 1L1OC 2C35B 1AW7A 2F3VA 1AH9A 2EXZA 3HOZG 1PFMA 4DU9A 2PW7A 4K8JA 3KYHC 4L5SA 1ESFA 1Z7TA 2PI2E 2IX1A 1B3AA 4BXXG 4X6AH 4GLVB 5FO9B 3G48A 3KDFA 5DEHA 2IHEA 2Z4HA 4WJWA 4BA2I 1STBA 2K5QA 2L1BA 2ZTEA 1EY0A 5GAGC 3J7AF 3K6OA 1TS5A 1GUWA 1QG7A 4O0AA 3HOYB 4A3BH 1F9QA 1LABA 5LL6X 5LMUL 4ZRZA 1XYIA 1PYWD 2OWOA 1BCPD 4JC0A 3ZYYX 1PH3A 5C6AA 1E3PA 1DXMA 3M4OB 4CDDC 4LFBQ 4DK0A 3A0JA 2B39A 3ND8A 3C1FA 1ET6A 1IKLA 1X56A 1TWGB 1K8AC 4LMQD 1MJCA 2AKWB 4UP9A 1MKHA 2UUCL 2C5CA 4IFDI 3CF5A 5JJKA 1FJGL 3MFGA 4R8IA 1BQQT 3QB3A 1EZ8A 3NTHA 5T1GA 1AP0A 4NP5A 2LXKA 1TWCH 3LNNA 1D8LA 2RA4A 4EQ5A 2EE1A 1SR3A 3A5UA 2EY1A 5JAVA 4KHVA 1XTCD 3HOYG 3TQYA 3CCRA 2UXBL 4KKTA 4DV4L 2EJGC 2NN6H 3OIQA 3OMGA 3A7AB 2G5DA 1BDOA 3PIPA 3TP7A 4QY7A 1DJRD 3FRPB 4X62Q 4CKBA 2E76C 2CH4W 5M5XB 4Y7NH 3T53B 3SVMA 2H1EA 3CC7A 1N32L 1GXDC 5ELOA 5M3MB 2UXCL 1WTOA 4KTAA 3A5ZB 2DNEA 2VQFL 1A3UA 2NTSA 4A3KH 2R7ZB 1PV4A 4A3LG 3H09A 1Q3LA 3I4MH 2Q8RE 2LY7A 1J6QA 2BH2A 1VS0A 4PZ8A 5BR8L 1HR0Q 4KN7C 4QUCA 5E4XA 3PO2B 4EVOA 1EYCA 3VA7A 2N88A 2F0EA 3PIP3 2XRSD 4JI2Q 2Y0SE 2JA8H 4A93H 4DV2Q 3BYTB 4MIUA 4KJNA 2A1AA 4DV5Q 1LTBD 1KDAA 5EBDA 1NJIC 2J7ZA 4IQZA 1A2UA 5IGBA 1V1QA 2RSOA 3PQIA 1VQ8A 4AH6A 4LF5Q 4BBRH 4TKOB 3HOVB 1LT6D 2R7ZG 3S15H 5CV5A 1N33Q 1X9NA 1EFWA 3EFXD 2I5LX 3HOZH 4XT3B 1I4GA 3GTPB 2QCPX 2N8NA 3PO2G 2XWBB 4S3SA 3M3YB 2G9DA 1GUSA 3AEVA 2HIXA 1ILPA 4JW0A 4K5XA 3BDOA 2RVLA 2X6GA 3DWPA 1IL8A 4KI0A 2HT1A 1K28A 3RZOB 3FP9A 1N34Q 3FKIB 4IPCA
chains in the Genus database with same CATH topology
4ALPA 3UDGA 4IPHA 5JJLA 4B3ML 2LXJA 2A19A 2E2JH 2JA7H 3CPFA 1B8AA 4B3TQ 1K3RA 2ZM6Q 1IXRA 2D62A 4QL5A 4NXMQ 1IL2A 3S17H 2HQLA 1X3GA 3I56A 1KXLA 2NVYH 3PCOB 4JCVE 4GOPB 2Q2TA 1EIFA 5FJ8H 4DUYQ 4A76A 2NVXH 5JEAJ 4UY8C 4A3DG 5K36G 2PNHA 2AWOA 1E22A 2ZJQA 4L5RC 1QVGA 4OXPA 4X65Q 4IPDA 3S1NH 3HOVH 1A62A 3L2PA 4KHPQ 3L7ZC 1HZAA 4MTNA 4Y52H 1KAWA 1S40A 1VQ9A 3BZKA 5IYBG 4TVAB 3GO5A 3G71A 2HHHQ 1PH6A 5HY6A 4DPGA 1J5EQ 3GTPH 1G6PA 4DNIA 2VQEQ 4L5TA 1JT8A 4JI1Q 3L0OA 2XGTA 1FVIA 2AHOB 3M3YH 3S1MH 1XNRQ 1XPOA 1X55A 1P8LA 2VS1A 2K5NA 2PMZE 4DR4Q 4A4IA 1PYBA 2BA1A 2E8GA 1SMXA 1WFQA 4RMFA 3HOWG 4IFDJ 1Q8KA 4YHHQ 1WYDA 3FKIG 4DV6Q 1HNXQ 4AYBE 3KDFB 1CSPA 2UUCQ 2MFIA 3S2HH 1HR0L 2UXDQ 1K73C 1LYLA 1V43A 4DV0Q 2E5LQ 1Z47A 2Q2HA 2QEXA 4GS3A 4A3FG 2Y0SG 3KF8B 3NELA 5C4JH 1YJWA 3RZOH 3TS2A 4XIGS 1AE2A 3PUYA 1VQEA 3FKIH 2MNAA 1XMQQ 2YU9H 4DUZQ 2WB1E 1I94Q 1X54A 4OO1G 4JI0L 4APVA 5LMNL 1HZBA 3S1RH 2JQOA 4JI2L 4C3IH 3ERSX 3PUXA 4DV2L 3PUVA 3AFPA 2HIVA 3RLFA 5J3BA 1OTCA 1VQ6A 1ASYA 2UXBQ 1XJVA 4QQBX 2A8VA 4PZ6A 2UU9L 1U0LA 1UE6A 3E9IA 2ES2A 4DK6C 4DR5L 1W3SA 4PZ7A 4DV4Q 1EIYB 2MQHA 1VQBA 4UPAA 1VQIA 2UUAL 2K50A 1B7YB 1KL9A 2JK8A 4MZ9A 2K14A 4UP7A 1SROA 2R6GA 3MXNB 4DV7L 1SFOH 1Q46A 2YTYA 2ATWA 1YHAA 4LF9L 1OXVA 4IOCA 1JE5A 5GROA 1G291 4QGUA 3GTJH 1IBKQ 4DR6L 3KF6A 5C4XG 3CD6A 2JA6H 3PUWA 4H02A 4IJHA 5JEAG 3BU2A 1MJEA 4LF7L 4OX9L 1VQDA 4A3MH 2F4VQ 2JA9A 2AMCB 1K8GA 2B63G 1N32Q 3PUZA 4X64L 4HIKA 1L2FA 1P16A 5ELNA 4GOPA 4JI6Q 4LFAQ 1PH9A 3CCSA 1C7YA 1X6OA 1UE7A 2RCNA 3PF5A 2VQFQ 3T1YQ 3W5OA 1HNWL 1Q7YC 3HKSA 4GNXB 2WAQG 3BZCA 2BA0A 2YV5A 3HOUG 1Y1VG 1KIXA 3F2BA 3G6EA 1KD1C 2B3GA 1VQNA 1WCMH 5C0XJ 4JI8Q 2ID0A 4DR7L 5H1SE 1I50H 2K75A 2PI2A 3I2ZA 4YWLA 1RL2A 5IE8A 3S1QH 4UP8A 3RN2A 4OONA 4LFBL 2R7ZH 4HIDA 3HOUH 1Y1VH 2JE6I 4JI3L 1QVFA 3WWVA 4AQYQ 2NVTH 4JBWA 4DV3L 3I4NG 2R93G 3STBD 4HJ5A 1PA6A 4BY7G 5M3FG 4LUOA 2Q2IA 4B3TL 1GVPA 1VQCA 2H5XA 1VQMA 4QIWE 2DGYA 2ZM6L 1A0IA 2LSSA 1VQ7A 1H95A 2GVAA 3RLOA 1LTLA 1NMFA 2VL6A 3T1HQ 4KLKA 1U5KA 3S24A 4OWXB 4DR2Q 2VW9A 4NPSA 1PH7A 1VQ5A 4DUYL 1UE5A 3J80c 3M4QA 2UUBQ 3I55A 4BY7H 1HJPA 1S3OA 4JBJA 5M5WH 5M3FH 5IP7G 3RNUA 1CUKA 5C44G 2ZJRA 4A3EG 1EQQA 4B3RL 1N36Q 1N8RC 4EX5A 2JJQA 3F1ZA 4HIMA 4JI4L 2HHHL 1TXYA 1Q1BA 1W2BA 2E2IH 4GNXC 3E0EA 4IJLA 1HZCA 1HH2P 2I5MX 1CKNA 5IP7H 4JI1L 4A3EH 1CSQA 1SE8A 5C44H 2YTXA 4POGA 3RR5A 5EAYA 4L5QA 1KRTA 1XNRL 4O2DA 1WI5A 2RHQB 4GLAC 1EOVA 2NVQH 4AYBG 3PSIA 3K7UC 2CCZA 4K0KL 3W1BA 1MIUA 4X62L 4JV5Q 4YY3L 4YHHL 1TWAH 1PVOA 1SRUA 4DV6L 5LMUQ 2QA4A 1VQJA 1HNXL 4LF6Q 1X3EA 3TREA 3AFQA 4OWTB 4YCVA 1ASZA 3F8TA 1EUJA 1V9PA 4P74A 3RZDH 2UXDL 3Q8DA 2WB1G 1IBLL 4QJFA 2ALYB 4DV0L 4A75A 2E5LL 3W1GA 5IWAQ 3D31A 4P72A 3K81C 3STBC 5IYBH 2V1CC 4LF8Q 4A3GG 3UE0A 1Y1WG 1XMQL 1PH8A 1I6HH 4DUZL 2OQKA 5GAEC 3JAMi 2Z6KC 1VQAA 4PMWA 3HOXG 3ULPA 3M9BA 3PO3G 4AIMA 1XPUA 1VQFA 3J80i 5C0XG 2NN6G 5AJ3Q 2MO0A 3CCQA 1N9WA 1UE1A 4GNXA 4DR1Q 4A3JG 4B3MQ 3GTOH 3S16H 4A3GH 2KENA 1Y1WH 1IZ6A 4LWCA 1XNQL 2ASBA 1CKOA 5FLXc 1FJGQ 3ICEA 2CWPA 1Q1EA 3HOWH 3J7A5 2DUDA 4C2MH 3HOXH 3K8AA 1PH2A 2N49A 3PO3H 4DV3Q 4LUZA 4GOPC 3H15A 4KHZA 3S14H 1B70B 2YYZA 3MEFA 4LFCL 2D0PA 4A3JH 1YVCA 3AQQA 4GN3B 4DR3Q 3CQZH 1PHJA 2VZAA 4LUVA 3J7ZC 1XPRA 2R93H 5JJIA 1K0RA 4X66Q 3RN5A 1OXUA 4A3FH 1QZHA 3H0GG 1EYGA 2JA5G 1Q81C 4DV5L 1PYSB 1HNZQ 5IYCG 2PQAB 1X65A 5IT9c 3H3VH 1C9OA 4A3KG 1QUQA 3VDYA 4GLXA 1L1OB 1JB7A 1RIPA 3H0GH 4HIOA 4B3SL 2CWAA 4DK3C 3E9HA 3CC2A 1OXXK 4NB3A 2JA5H 1VQPA 4LF5L 1UEBA 2Z6KA 3EBEA 3I7FA 4IPGA 3SGIA 3S2DH 5E7NA 3CW2C 3K80C 3CPWA 2ZTDA 1S72A 2ZJPA 4DKAC 1YIJA 1N33L 2KBNA 4DAMA 1G51A 1Q86C 1HR0W 4LF4Q 4YWMA 1JJCB 3F2CA 3GTMH 2MO1A 3KLWA 5IYDG 1VQLA 4JYAL 1NTGA 4BA1I 2K4KA 3EIVA 1BBWA 5DLQE 5C3EG 2UXCQ 2D0OA 4FDBA 5C4XH 5LMNW 4P73A 4AQYL 1GD7A 3B6YA 2FXQA 3A74A 2R7FA 1YBYA 1PH1A 2B63H 3UE1A 3G4SA 2NZHA 4A3IG 5C3EH 4BBSG 2KHJA 3GTLH 2R92G 2I0QA 4YCUA 1VQHA 4R4OA 3CCMA 3T1HL 1WJJA 3I4OA 4A3CG 4HJ9A 2KCTA 5BR8Q 3H3VI 4OO1I 1XMOL 3CCVA 3PIOA 2UUBL 2UU9Q 5IP9G 4DR5Q 4IFDG 1L1OC 2C35B 4A3IH 3OTOL 1E1OA 5M3MG 4JI5L 4BBSH 1AH9A 4LW1A 2R92H 3M7NA 2UUAQ 2JEBI 1N34L 4YCWA 3HOZG 3UDFA 3GDEA 2JEAI 3CCLA 1C0AA 1JJ2A 3OW2A 3KYHC 4L5SA 2PI2E 2IX1A 1XTDA 5IP9H 3CMAA 4DR6Q 4BXXG 3U4VA 1Z9FA 4GLVB 4GKKQ 4X6AH 1AE3A 3G48A 3KDFA 4NXML 2IHEA 3M4PA 4A3BG 4IO9A 1E24A 1YNXA 2VY3A 3NENA 2OTLA 3I4NH 4WJ3M 1T9HA 4BA2I 4X64Q 1PH4A 4ME3A 4X65L 3KOJA 2ZTEA 1O7IA 4BXXH 4KHPL 2F3IA 5GAGC 4O0AA 1HNWQ 1K83H 4A3BH 5LMUL 1J5EL 4GN4B 1L0WA 2ZTCA 4BY1G 3CXCA 2VQEL 3OYYA 1Q82C 4IOAA 1YEZA 2CKZB 2OWOA 5IWAL 4JC0A 5IY0A 2OQ0A 3U58A 1PH3A 1E3PA 4DR7Q 1X3FA 3J81c 4LF8L 4DR4L 3UDIA 3EN2A 1E1TA 3HKZE 1L1OA 3CCUA 1KQSA 4LFBQ 4J15A 1JMCA 1VQGA 2RF4A 4JBKA 1BKBA 3U50C 4MNOA 1VCIA 1BBUA 5M5YH 1QZGA 4WJ4A 3A0JA 1TWHH 1X56A 5FJ8G 2I5HA 1SLJA 1K8AC 3KF6B 4DR1L 1MJCA 2AKWB 3KJPA 4UP9A 1MKHA 2UUCL 4IFDI 1YHBA 3ULJA 3CF5A 5JJKA 3HOVG 3ULLA 4HJAA 1FJGL 3HFZB 1IBMQ 4RG1A 2B29A 3D0FA 3KFUA 1D7QA 2F52A 2WFWA 4NXNQ 4DV1Q 1E7ZA 1YITA 2IHFA 2LXKA 1TWCH 4R1JA 1YJNA 1I94L 1D8LA 3GTQH 3RLNA 4R4IA 4EQ5A 2IX0A 3M85A 4DR3L 4B3RQ 1QVCA 1I5FA 1SR3A 4X66L 3A5UA 4JI7Q 4JI4Q 3HOYG 2N3SA 3GD7A 3J81j 1NMGA 3TQYA 2L15A 1HNZL 2OTJA 3CCRA 3PV0A 4C3HH 2UXBL 2K5HA 4OWWB 3GTKH 4DV4L 1Q12A 2IT1A 3TEHB 3CC4A 2KHIA 3HOYH 2EXDA 1DGSA 3PIPA 1KC8C 4QY7A 4K0KQ 2R7DA 4X62Q 1IBKL 1TWFH 4JOIC 4YY3Q 3J81i 3IRBA 1YJ9A 4LF4L 3CAMA 4Y7NH 4GKJL 1IYJB 2F4VL 2VNUD 3I4MG 3M4OH 4POFA 3CC7A 1VQ4A 3TS0A 1IBLQ 1N32L 3GTGH 5ELOA 2UXCL 4JI6L 4LFAL 1FGUA 4GN5A 3TRZA 3A5ZB 1EQRA 2KCMA 2VQFL 1TWGH 5IYCH 3T1YL 4JBMA 1NBWA 2EQSA 1OXTA 2Q2UA 4A3KH 1M1KC 3K7AH 2RHSB 2GN5A 3KJOA 1HZ9A 4HJ8A 3NBHB 1NE3A 1PV4A 2E2HH 3PF4A 4A3LG 3I4MH 1CKNB 4JI8L 1J6QA 2YTVA 2BH2A 1FL0A 1VS0A 4PZ8A 2GVBA 1YZ6A 2N78A 3DM3A 5HGQA 5BR8L 1HR0Q 1VQKA 1XNQQ 2JA8G 4A93G 2WP8J 5C0XI 2NN6I 4A3LH 1LM0A 4LFCQ 2JA6G 1YI2A 1GM5A 3JC66 1EWIA 3BJUA 3ER0A 5IYDH 1A63A 1JJGA 4A3MG 4JI0Q 5GADC 5LMNQ 1YHQA 4JI2Q 2Y0SE 2JA8H 3LGJA 4JG2A 4DV2Q 3NEMA 4A93H 4GKJQ 4JOIA 1KHIA 1GKHA 2A1AA 4XTCS 2K5VA 4GKKL 4DV5Q 2QGQA 1NJIC 3K0XA 4DR2L 3FHWA 4BBRG 1VQOA 3DLLA 4R4CA 4C3JH 4P71A 1V1QA 3F2DA 1K9MC 1PFSA 4A3DH 3PGZA 4HJ7A 1VQ8A 4LNQA 2IY5B 3UDXA 1N36L 1WCMG 4B3SQ 4AH6A 4LF5Q 2VUMG 2XTIA 2K52A 4A3CH 1OXSC 1SN8A 1I3QH 5M5XH 4DV7Q 4BBRH 2CQOA 2Z0SA 4LF9Q 1CKMA 2AWNA 2R7ZG 1M90C 3S15H 1N33Q 1NY4A 3HKZG 5GQOA 1X9NA 5M3MH 1EFWA 1R9TH 3CCJA 2I5LX 1WOCA 4LF7Q 4OX9Q 2VUMH 4JYAQ 3HOZH 2N8NA 3PO2G 4R4QA 5GAHC 4P75A 2BH8A 4JV5L 3AEVA 2HIXA 4DAYB 2EIFA 3CMEA 3AYHB 3U4ZA 4LF6L 5FLMG 1BVSA 3PO2H 3CCEA 4R4TA 3ZJYC 1IBML 2PQAA 3JAMc 2CFMA 1GO3E 1QUQB 4NXNL 4DV1L 2NZOA 2WAQE 1XMOQ 1LUZA 2JA7G 4KI0A 1PH5A 2HT1A 4TQUS 5FLMH 4BY1H 4PG3A 3OTOQ 4YWKA 1A8VA 4JI3Q 1UWVA 4JI5Q 1Y14B 2OCEA 1KRSA 3FP9A 4JI7L 1N34Q 5AJ3L 4IPCA 3CP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ALP A;  3UDG A;  4IPH A;  5JJL A;  4B3M L;  2LXJ A;  2A19 A;  2E2J H;  2JA7 H;  3CPF A;  1B8A A;  4B3T Q;  1K3R A;  2ZM6 Q;  1IXR A;  2D62 A;  4QL5 A;  4NXM Q;  1IL2 A;  3S17 H;  2HQL A;  1X3G A;  3I56 A;  1KXL A;  2NVY H;  3PCO B;  4JCV E;  4GOP B;  2Q2T A;  1EIF A;  5FJ8 H;  4DUY Q;  4A76 A;  2NVX H;  5JEA J;  4UY8 C;  4A3D G;  5K36 G;  2PNH A;  2AWO A;  1E22 A;  2ZJQ A;  4L5R C;  1QVG A;  4OXP A;  4X65 Q;  4IPD A;  3S1N H;  3HOV H;  1A62 A;  3L2P A;  4KHP Q;  3L7Z C;  1HZA A;  4MTN A;  4Y52 H;  1KAW A;  1S40 A;  1VQ9 A;  3BZK A;  5IYB G;  4TVA B;  3GO5 A;  3G71 A;  2HHH Q;  1PH6 A;  5HY6 A;  4DPG A;  1J5E Q;  3GTP H;  1G6P A;  4DNI A;  2VQE Q;  4L5T A;  1JT8 A;  4JI1 Q;  3L0O A;  2XGT A;  1FVI A;  2AHO B;  3M3Y H;  3S1M H;  1XNR Q;  1XPO A;  1X55 A;  1P8L A;  2VS1 A;  2K5N A;  2PMZ E;  4DR4 Q;  4A4I A;  1PYB A;  2BA1 A;  2E8G A;  1SMX A;  1WFQ A;  4RMF A;  3HOW G;  4IFD J;  1Q8K A;  4YHH Q;  1WYD A;  3FKI G;  4DV6 Q;  1HNX Q;  4AYB E;  3KDF B;  1CSP A;  2UUC Q;  2MFI A;  3S2H H;  1HR0 L;  2UXD Q;  1K73 C;  1LYL A;  1V43 A;  4DV0 Q;  2E5L Q;  1Z47 A;  2Q2H A;  2QEX A;  4GS3 A;  4A3F G;  2Y0S G;  3KF8 B;  3NEL A;  5C4J H;  1YJW A;  3RZO H;  3TS2 A;  4XIG S;  1AE2 A;  3PUY A;  1VQE A;  3FKI H;  2MNA A;  1XMQ Q;  2YU9 H;  4DUZ Q;  2WB1 E;  1I94 Q;  1X54 A;  4OO1 G;  4JI0 L;  4APV A;  5LMN L;  1HZB A;  3S1R H;  2JQO A;  4JI2 L;  4C3I H;  3ERS X;  3PUX A;  4DV2 L;  3PUV A;  3AFP A;  2HIV A;  3RLF A;  5J3B A;  1OTC A;  1VQ6 A;  1ASY A;  2UXB Q;  1XJV A;  4QQB X;  2A8V A;  4PZ6 A;  2UU9 L;  1U0L A;  1UE6 A;  3E9I A;  2ES2 A;  4DK6 C;  4DR5 L;  1W3S A;  4PZ7 A;  4DV4 Q;  1EIY B;  2MQH A;  1VQB A;  4UPA A;  1VQI A;  2UUA L;  2K50 A;  1B7Y B;  1KL9 A;  2JK8 A;  4MZ9 A;  2K14 A;  4UP7 A;  1SRO A;  2R6G A;  3MXN B;  4DV7 L;  1SFO H;  1Q46 A;  2YTY A;  2ATW A;  1YHA A;  4LF9 L;  1OXV A;  4IOC A;  1JE5 A;  5GRO A;  1G29 1;  4QGU A;  3GTJ H;  1IBK Q;  4DR6 L;  3KF6 A;  5C4X G;  3CD6 A;  2JA6 H;  3PUW A;  4H02 A;  4IJH A;  5JEA G;  3BU2 A;  1MJE A;  4LF7 L;  4OX9 L;  1VQD A;  4A3M H;  2F4V Q;  2JA9 A;  2AMC B;  1K8G A;  2B63 G;  1N32 Q;  3PUZ A;  4X64 L;  4HIK A;  1L2F A;  1P16 A;  5ELN A;  4GOP A;  4JI6 Q;  4LFA Q;  1PH9 A;  3CCS A;  1C7Y A;  1X6O A;  1UE7 A;  2RCN A;  3PF5 A;  2VQF Q;  3T1Y Q;  3W5O A;  1HNW L;  1Q7Y C;  3HKS A;  4GNX B;  2WAQ G;  3BZC A;  2BA0 A;  2YV5 A;  3HOU G;  1Y1V G;  1KIX A;  3F2B A;  3G6E A;  1KD1 C;  2B3G A;  1VQN A;  1WCM H;  5C0X J;  4JI8 Q;  2ID0 A;  4DR7 L;  5H1S E;  1I50 H;  2K75 A;  2PI2 A;  3I2Z A;  4YWL A;  1RL2 A;  5IE8 A;  3S1Q H;  4UP8 A;  3RN2 A;  4OON A;  4LFB L;  2R7Z H;  4HID A;  3HOU H;  1Y1V H;  2JE6 I;  4JI3 L;  1QVF A;  3WWV A;  4AQY Q;  2NVT H;  4JBW A;  4DV3 L;  3I4N G;  2R93 G;  3STB D;  4HJ5 A;  1PA6 A;  4BY7 G;  5M3F G;  4LUO A;  2Q2I A;  4B3T L;  1GVP A;  1VQC A;  2H5X A;  1VQM A;  4QIW E;  2DGY A;  2ZM6 L;  1A0I A;  2LSS A;  1VQ7 A;  1H95 A;  2GVA A;  3RLO A;  1LTL A;  1NMF A;  2VL6 A;  3T1H Q;  4KLK A;  1U5K A;  3S24 A;  4OWX B;  4DR2 Q;  2VW9 A;  4NPS A;  1PH7 A;  1VQ5 A;  4DUY L;  1UE5 A;  3J80 c;  3M4Q A;  2UUB Q;  3I55 A;  4BY7 H;  1HJP A;  1S3O A;  4JBJ A;  5M5W H;  5M3F H;  5IP7 G;  3RNU A;  1CUK A;  5C44 G;  2ZJR A;  4A3E G;  1EQQ A;  4B3R L;  1N36 Q;  1N8R C;  4EX5 A;  2JJQ A;  3F1Z A;  4HIM A;  4JI4 L;  2HHH L;  1TXY A;  1Q1B A;  1W2B A;  2E2I H;  4GNX C;  3E0E A;  4IJL A;  1HZC A;  1HH2 P;  2I5M X;  1CKN A;  5IP7 H;  4JI1 L;  4A3E H;  1CSQ A;  1SE8 A;  5C44 H;  2YTX A;  4POG A;  3RR5 A;  5EAY A;  4L5Q A;  1KRT A;  1XNR L;  4O2D A;  1WI5 A;  2RHQ B;  4GLA C;  1EOV A;  2NVQ H;  4AYB G;  3PSI A;  3K7U C;  2CCZ A;  4K0K L;  3W1B A;  1MIU A;  4X62 L;  4JV5 Q;  4YY3 L;  4YHH L;  1TWA H;  1PVO A;  1SRU A;  4DV6 L;  5LMU Q;  2QA4 A;  1VQJ A;  1HNX L;  4LF6 Q;  1X3E A;  3TRE A;  3AFQ A;  4OWT B;  4YCV A;  1ASZ A;  3F8T A;  1EUJ A;  1V9P A;  4P74 A;  3RZD H;  2UXD L;  3Q8D A;  2WB1 G;  1IBL L;  4QJF A;  2ALY B;  4DV0 L;  4A75 A;  2E5L L;  3W1G A;  5IWA Q;  3D31 A;  4P72 A;  3K81 C;  3STB C;  5IYB H;  2V1C C;  4LF8 Q;  4A3G G;  3UE0 A;  1Y1W G;  1XMQ L;  1PH8 A;  1I6H H;  4DUZ L;  2OQK A;  5GAE C;  3JAM i;  2Z6K C;  1VQA A;  4PMW A;  3HOX G;  3ULP A;  3M9B A;  3PO3 G;  4AIM A;  1XPU A;  1VQF A;  3J80 i;  5C0X G;  2NN6 G;  5AJ3 Q;  2MO0 A;  3CCQ A;  1N9W A;  1UE1 A;  4GNX A;  4DR1 Q;  4A3J G;  4B3M Q;  3GTO H;  3S16 H;  4A3G H;  2KEN A;  1Y1W H;  1IZ6 A;  4LWC A;  1XNQ L;  2ASB A;  1CKO A;  5FLX c;  1FJG Q;  3ICE A;  2CWP A;  1Q1E A;  3HOW H;  3J7A 5;  2DUD A;  4C2M H;  3HOX H;  3K8A A;  1PH2 A;  2N49 A;  3PO3 H;  4DV3 Q;  4LUZ A;  4GOP C;  3H15 A;  4KHZ A;  3S14 H;  1B70 B;  2YYZ A;  3MEF A;  4LFC L;  2D0P A;  4A3J H;  1YVC A;  3AQQ A;  4GN3 B;  4DR3 Q;  3CQZ H;  1PHJ A;  2VZA A;  4LUV A;  3J7Z C;  1XPR A;  2R93 H;  5JJI A;  1K0R A;  4X66 Q;  3RN5 A;  1OXU A;  4A3F H;  1QZH A;  3H0G G;  1EYG A;  2JA5 G;  1Q81 C;  4DV5 L;  1PYS B;  1HNZ Q;  5IYC G;  2PQA B;  1X65 A;  5IT9 c;  3H3V H;  1C9O A;  4A3K G;  1QUQ A;  3VDY A;  4GLX A;  1L1O B;  1JB7 A;  1RIP A;  3H0G H;  4HIO A;  4B3S L;  2CWA A;  4DK3 C;  3E9H A;  3CC2 A;  1OXX K;  4NB3 A;  2JA5 H;  1VQP A;  4LF5 L;  1UEB A;  2Z6K A;  3EBE A;  3I7F A;  4IPG A;  3SGI A;  3S2D H;  5E7N A;  3CW2 C;  3K80 C;  3CPW A;  2ZTD A;  1S72 A;  2ZJP A;  4DKA C;  1YIJ A;  1N33 L;  2KBN A;  4DAM A;  1G51 A;  1Q86 C;  1HR0 W;  4LF4 Q;  4YWM A;  1JJC B;  3F2C A;  3GTM H;  2MO1 A;  3KLW A;  5IYD G;  1VQL A;  4JYA L;  1NTG A;  4BA1 I;  2K4K A;  3EIV A;  1BBW A;  5DLQ E;  5C3E G;  2UXC Q;  2D0O A;  4FDB A;  5C4X H;  5LMN W;  4P73 A;  4AQY L;  1GD7 A;  3B6Y A;  2FXQ A;  3A74 A;  2R7F A;  1YBY A;  1PH1 A;  2B63 H;  3UE1 A;  3G4S A;  2NZH A;  4A3I G;  5C3E H;  4BBS G;  2KHJ A;  3GTL H;  2R92 G;  2I0Q A;  4YCU A;  1VQH A;  4R4O A;  3CCM A;  3T1H L;  1WJJ A;  3I4O A;  4A3C G;  4HJ9 A;  2KCT A;  5BR8 Q;  3H3V I;  4OO1 I;  1XMO L;  3CCV A;  3PIO A;  2UUB L;  2UU9 Q;  5IP9 G;  4DR5 Q;  4IFD G;  1L1O C;  2C35 B;  4A3I H;  3OTO L;  1E1O A;  5M3M G;  4JI5 L;  4BBS H;  1AH9 A;  4LW1 A;  2R92 H;  3M7N A;  2UUA Q;  2JEB I;  1N34 L;  4YCW A;  3HOZ G;  3UDF A;  3GDE A;  2JEA I;  3CCL A;  1C0A A;  1JJ2 A;  3OW2 A;  3KYH C;  4L5S A;  2PI2 E;  2IX1 A;  1XTD A;  5IP9 H;  3CMA A;  4DR6 Q;  4BXX G;  3U4V A;  1Z9F A;  4GLV B;  4GKK Q;  4X6A H;  1AE3 A;  3G48 A;  3KDF A;  4NXM L;  2IHE A;  3M4P A;  4A3B G;  4IO9 A;  1E24 A;  1YNX A;  2VY3 A;  3NEN A;  2OTL A;  3I4N H;  4WJ3 M;  1T9H A;  4BA2 I;  4X64 Q;  1PH4 A;  4ME3 A;  4X65 L;  3KOJ A;  2ZTE A;  1O7I A;  4BXX H;  4KHP L;  2F3I A;  5GAG C;  4O0A A;  1HNW Q;  1K83 H;  4A3B H;  5LMU L;  1J5E L;  4GN4 B;  1L0W A;  2ZTC A;  4BY1 G;  3CXC A;  2VQE L;  3OYY A;  1Q82 C;  4IOA A;  1YEZ A;  2CKZ B;  2OWO A;  5IWA L;  4JC0 A;  5IY0 A;  2OQ0 A;  3U58 A;  1PH3 A;  1E3P A;  4DR7 Q;  1X3F A;  3J81 c;  4LF8 L;  4DR4 L;  3UDI A;  3EN2 A;  1E1T A;  3HKZ E;  1L1O A;  3CCU A;  1KQS A;  4LFB Q;  4J15 A;  1JMC A;  1VQG A;  2RF4 A;  4JBK A;  1BKB A;  3U50 C;  4MNO A;  1VCI A;  1BBU A;  5M5Y H;  1QZG A;  4WJ4 A;  3A0J A;  1TWH H;  1X56 A;  5FJ8 G;  2I5H A;  1SLJ A;  1K8A C;  3KF6 B;  4DR1 L;  1MJC A;  2AKW B;  3KJP A;  4UP9 A;  1MKH A;  2UUC L;  4IFD I;  1YHB A;  3ULJ A;  3CF5 A;  5JJK A;  3HOV G;  3ULL A;  4HJA A;  1FJG L;  3HFZ B;  1IBM Q;  4RG1 A;  2B29 A;  3D0F A;  3KFU A;  1D7Q A;  2F52 A;  2WFW A;  4NXN Q;  4DV1 Q;  1E7Z A;  1YIT A;  2IHF A;  2LXK A;  1TWC H;  4R1J A;  1YJN A;  1I94 L;  1D8L A;  3GTQ H;  3RLN A;  4R4I A;  4EQ5 A;  2IX0 A;  3M85 A;  4DR3 L;  4B3R Q;  1QVC A;  1I5F A;  1SR3 A;  4X66 L;  3A5U A;  4JI7 Q;  4JI4 Q;  3HOY G;  2N3S A;  3GD7 A;  3J81 j;  1NMG A;  3TQY A;  2L15 A;  1HNZ L;  2OTJ A;  3CCR A;  3PV0 A;  4C3H H;  2UXB L;  2K5H A;  4OWW B;  3GTK H;  4DV4 L;  1Q12 A;  2IT1 A;  3TEH B;  3CC4 A;  2KHI A;  3HOY H;  2EXD A;  1DGS A;  3PIP A;  1KC8 C;  4QY7 A;  4K0K Q;  2R7D A;  4X62 Q;  1IBK L;  1TWF H;  4JOI C;  4YY3 Q;  3J81 i;  3IRB A;  1YJ9 A;  4LF4 L;  3CAM A;  4Y7N H;  4GKJ L;  1IYJ B;  2F4V L;  2VNU D;  3I4M G;  3M4O H;  4POF A;  3CC7 A;  1VQ4 A;  3TS0 A;  1IBL Q;  1N32 L;  3GTG H;  5ELO A;  2UXC L;  4JI6 L;  4LFA L;  1FGU A;  4GN5 A;  3TRZ A;  3A5Z B;  1EQR A;  2KCM A;  2VQF L;  1TWG H;  5IYC H;  3T1Y L;  4JBM A;  1NBW A;  2EQS A;  1OXT A;  2Q2U A;  4A3K H;  1M1K C;  3K7A H;  2RHS B;  2GN5 A;  3KJO A;  1HZ9 A;  4HJ8 A;  3NBH B;  1NE3 A;  1PV4 A;  2E2H H;  3PF4 A;  4A3L G;  3I4M H;  1CKN B;  4JI8 L;  1J6Q A;  2YTV A;  2BH2 A;  1FL0 A;  1VS0 A;  4PZ8 A;  2GVB A;  1YZ6 A;  2N78 A;  3DM3 A;  5HGQ A;  5BR8 L;  1HR0 Q;  1VQK A;  1XNQ Q;  2JA8 G;  4A93 G;  2WP8 J;  5C0X I;  2NN6 I;  4A3L H;  1LM0 A;  4LFC Q;  2JA6 G;  1YI2 A;  1GM5 A;  3JC6 6;  1EWI A;  3BJU A;  3ER0 A;  5IYD H;  1A63 A;  1JJG A;  4A3M G;  4JI0 Q;  5GAD C;  5LMN Q;  1YHQ A;  4JI2 Q;  2Y0S E;  2JA8 H;  3LGJ A;  4JG2 A;  4DV2 Q;  3NEM A;  4A93 H;  4GKJ Q;  4JOI A;  1KHI A;  1GKH A;  2A1A A;  4XTC S;  2K5V A;  4GKK L;  4DV5 Q;  2QGQ A;  1NJI C;  3K0X A;  4DR2 L;  3FHW A;  4BBR G;  1VQO A;  3DLL A;  4R4C A;  4C3J H;  4P71 A;  1V1Q A;  3F2D A;  1K9M C;  1PFS A;  4A3D H;  3PGZ A;  4HJ7 A;  1VQ8 A;  4LNQ A;  2IY5 B;  3UDX A;  1N36 L;  1WCM G;  4B3S Q;  4AH6 A;  4LF5 Q;  2VUM G;  2XTI A;  2K52 A;  4A3C H;  1OXS C;  1SN8 A;  1I3Q H;  5M5X H;  4DV7 Q;  4BBR H;  2CQO A;  2Z0S A;  4LF9 Q;  1CKM A;  2AWN A;  2R7Z G;  1M90 C;  3S15 H;  1N33 Q;  1NY4 A;  3HKZ G;  5GQO A;  1X9N A;  5M3M H;  1EFW A;  1R9T H;  3CCJ A;  2I5L X;  1WOC A;  4LF7 Q;  4OX9 Q;  2VUM H;  4JYA Q;  3HOZ H;  2N8N A;  3PO2 G;  4R4Q A;  5GAH C;  4P75 A;  2BH8 A;  4JV5 L;  3AEV A;  2HIX A;  4DAY B;  2EIF A;  3CME A;  3AYH B;  3U4Z A;  4LF6 L;  5FLM G;  1BVS A;  3PO2 H;  3CCE A;  4R4T A;  3ZJY C;  1IBM L;  2PQA A;  3JAM c;  2CFM A;  1GO3 E;  1QUQ B;  4NXN L;  4DV1 L;  2NZO A;  2WAQ E;  1XMO Q;  1LUZ A;  2JA7 G;  4KI0 A;  1PH5 A;  2HT1 A;  4TQU S;  5FLM H;  4BY1 H;  4PG3 A;  3OTO Q;  4YWK A;  1A8V A;  4JI3 Q;  1UWV A;  4JI5 Q;  1Y14 B;  2OCE A;  1KRS A;  3FP9 A;  4JI7 L;  1N34 Q;  5AJ3 L;  4IPC A;  3CP0 A; 
#chains in the Genus database with same CATH topology
 2JA7 H;  1EWC A;  2IJ0 A;  1EOT A;  5I2Y A;  4RH6 A;  4A3F B;  3S17 H;  4JCV E;  5CBA E;  1SDF A;  4DAP A;  4DUY Q;  2NVX H;  4KD3 A;  2PNH A;  5C3W A;  3H91 A;  4TRD A;  4OXP A;  3S1N H;  1A62 A;  4KHP Q;  3L7Z C;  5EQ0 A;  1KAW A;  1JWU D;  1S40 A;  3E0J A;  3G71 A;  1PH6 A;  4DPG A;  5K36 H;  3O13 A;  1ENC A;  4PMB A;  3GTJ B;  1KDB A;  2L4N A;  2D2C C;  4UAI A;  2VS1 A;  2B2Y A;  2K5N A;  3ND9 A;  3A55 A;  2A6H C;  1SMX A;  2NWG A;  4RMF A;  1WTQ A;  4X3T A;  1VF5 C;  1WYD A;  3FKI G;  3KDF B;  4CGY B;  3HP3 A;  2MFI A;  3S2H H;  2ZXR A;  1HR0 L;  2UXD Q;  1LYL A;  4F87 A;  1GUO A;  1BCP F;  2ZT9 C;  4DV0 Q;  2Q2H A;  4A3F G;  4GS3 A;  1SEB D;  4RGN A;  5C4J H;  4ME5 A;  1WCM B;  1ZXT A;  1YJW A;  1BBX C;  3FDT A;  2YU9 H;  1I94 Q;  1I50 B;  1EYD A;  4K6L A;  4OO1 G;  3S1R H;  4JI2 L;  2RDF A;  4DV2 L;  5EKI A;  1S5B D;  2B2U A;  2HIV A;  2NVT B;  1ILQ A;  5J3B A;  4U67 3;  2SDF A;  1XJV A;  4IZ8 A;  2A8V A;  1QWY A;  1U0L A;  4H7B A;  1S5C D;  4PNY A;  1B7Y B;  3NWT A;  4MZ9 A;  2L11 A;  2K14 A;  4J8Q A;  4RAU C;  5M5W B;  1G2S A;  1OXV A;  1G29 1;  3JAM L;  2EY6 A;  3KF6 A;  5CV7 A;  5IGG A;  3TME A;  3CD6 A;  2NBF A;  1B1Z A;  3PUW A;  4GKJ Q;  2F4V Q;  5IGE A;  1VQD A;  2JA9 A;  2AMC B;  2F0J A;  1CT1 D;  4X64 L;  1L2F A;  5ELN A;  1FGB D;  2DJF C;  1PH9 A;  4JI6 Q;  1GUG A;  2FMM A;  1CFM A;  3PF5 A;  2Z9H A;  1EEF D;  2NVQ B;  4GNX B;  4FYD A;  3BZC A;  4K14 A;  1SAP A;  2BA0 A;  1TQO A;  3F2B A;  5IGF A;  1BNZ A;  1PZK D;  2K03 A;  1VQN A;  5C0X J;  1TWA B;  1U9R A;  3NUC A;  4JI8 Q;  4DR7 L;  5H1S E;  2QF7 A;  5IE8 A;  4UP8 A;  4AYB B;  3RN2 A;  2R7Z H;  3HOU H;  1SE3 A;  1Y1V H;  1I4Q A;  4CKC A;  1PA6 A;  1SBB B;  3S9W A;  3A8J E;  1UNS A;  4H0L C;  5KNB A;  3MVV A;  3EQL C;  3RLO A;  3T1H Q;  4DR2 Q;  2B2T C;  3GTO B;  4A3G B;  3KLS X;  1UE5 A;  4DUY L;  5JVH 3;  3HOW B;  3BZD B;  1HJP A;  3RNU A;  4B3R L;  3PO3 B;  5BN3 A;  3CHB D;  4EX5 A;  3F1Z A;  4XQQ A;  4F8M A;  3TDQ A;  5A2Q L;  1TXY A;  2HDL A;  3NBH A;  1HZC A;  3R8B A;  3K0Y A;  1A3V A;  4KY6 A;  3U9S A;  4A3E H;  4POG A;  2QDL A;  3VR3 A;  4L5Q A;  5JJZ A;  5L37 A;  4RHR A;  3ONA B;  4AYB G;  1BCP B;  2B2V A;  3H0G B;  3D4R A;  5IOC A;  4YY3 L;  2JA5 B;  1PVO A;  2QA4 A;  3OWE B;  1ICF B;  2FFK B;  4G7O C;  2UXD L;  4DV0 L;  4P72 A;  4RCO A;  3Q22 A;  4LF8 Q;  4A3G G;  3UE0 A;  4IUU A;  1I6H H;  2F0F A;  5JPN C;  3MXG A;  1ENA A;  1VQA A;  2B2W A;  4PMW A;  1CQF A;  3PO3 G;  2I46 A;  1XPU A;  3J80 i;  5C0X G;  4O1N A;  3CCQ A;  4DR1 Q;  1UE1 A;  4B3M Q;  1FNV A;  2MUY A;  2O5J C;  3QR8 A;  1CKO A;  1EU3 A;  2B63 B;  1Q1E A;  3HOX H;  3K8A A;  4ZQ3 A;  5KNC A;  1MSH A;  4LFC L;  2QKI C;  3AQQ A;  3GP7 A;  4GN3 B;  3RMH A;  4DR3 Q;  2R93 H;  4LUV A;  2B8F A;  4A3F H;  3H0G G;  4CDE C;  2JA5 G;  4B9X A;  5IYC G;  4MN3 A;  4OO1 H;  1QUQ A;  1B44 D;  4GLX A;  4O42 A;  1PTO H;  2EYO A;  1L1O B;  1RIP A;  4HIO A;  4DA2 A;  2CWA A;  3CC2 A;  3E9H A;  4B3S L;  2Z6K A;  5E7N A;  1B2T A;  1YIJ A;  2EDG A;  4K6D A;  2JYO A;  5KND A;  3F2C A;  3GTM H;  4A3B B;  1VQL A;  4JYA L;  2PCF B;  4BA1 I;  2K4K A;  3EIV A;  5HUR A;  2FMC A;  2LMC B;  2XN9 C;  1D5Z C;  4RKB A;  1PFN A;  2R7F A;  2L0C A;  3G4S A;  4IUQ A;  1CM9 A;  4XXE A;  3H94 A;  3T1H L;  2E2D C;  2KCT A;  3NPP A;  4G7Z C;  2F0N A;  1D5X C;  4HCS A;  3FPU B;  4DR5 Q;  4A3I H;  3OTO L;  4CDC C;  4FF1 A;  4LW1 A;  3M7N A;  1RD9 D;  2UUA Q;  2JEB I;  1PFB A;  1TWC B;  3C3L A;  3UDF A;  2F0I A;  2QW7 A;  3CCL A;  5IP9 H;  4DR6 Q;  2HDM A;  3U4V A;  1Z9F A;  4GKK Q;  1DCZ A;  3M4P A;  1VF7 A;  4A3B G;  1QOH A;  1YNX A;  4TSS A;  5CV8 A;  4WJ3 M;  2RDG A;  1TVX A;  4ME3 A;  2K32 A;  4X65 L;  1SYG A;  1O7I A;  3VYS A;  4KY5 A;  1SE2 A;  4X3K A;  3M7G A;  3D4W A;  1J5E L;  1L0W A;  3OYY A;  1S5F D;  1Q82 C;  3NWS A;  2F0L A;  2CKZ B;  1PTO D;  1NUC A;  1RF2 D;  1SJH D;  3T56 B;  4Y7N B;  3J81 c;  4LF8 L;  1HRJ A;  3CCU A;  4EQN A;  3IL8 A;  4J15 A;  3SHL A;  1BKB A;  3U50 C;  5I9O A;  1VCI A;  1BBU A;  1D5M C;  5M5Y H;  1TWH H;  5CGK A;  1G91 A;  3KF6 B;  4DR1 L;  1LLR D;  3KJP A;  3ULJ A;  1R4Q B;  4A3K B;  4FXG C;  4L63 B;  2DY8 A;  3CRK C;  3HFZ B;  1IBM Q;  3KFU A;  2B29 A;  4NXN Q;  4DV1 Q;  1E7Z A;  3I4M B;  2IHF A;  4N8X 1;  3I90 A;  5C5L A;  1IKM A;  1YJN A;  2BE5 D;  3GTQ H;  4ULL A;  3RLN A;  3M85 A;  4DR3 L;  1MBY A;  1I5F A;  1JOQ A;  3N6R A;  1SJE D;  1D1K A;  2OTJ A;  1NAP A;  3OMC A;  2RKS A;  2ICI A;  2JA8 B;  4A93 B;  1O7Y A;  3P20 A;  1RHP A;  3GTK H;  1STH A;  1QNK A;  3TEH B;  2KHI A;  5C5M A;  1X3P A;  1NR2 A;  3H3V C;  1ZKO A;  1BCP C;  1EQV A;  2R7D A;  1TWF H;  1A2T A;  1ICW A;  3Q24 A;  4BBR B;  2PZU A;  2VNU D;  2EYJ A;  1AFP A;  2VXW A;  4POF A;  2JN4 A;  1S5D D;  1JWS D;  3A7L A;  3S15 B;  3HZX A;  1MGS A;  1V1P B;  4LFA L;  5CV4 A;  3M4Y A;  1HQM C;  1EQR A;  1XXG A;  3HOZ B;  2KCM A;  4JBM A;  5IYC H;  1E2V A;  2EQS A;  4ID6 A;  1LTS D;  3K7A H;  2RHS B;  3HKZ B;  3KJO A;  1ZYR D;  3NBH B;  3PF4 A;  2YTV A;  3MXU A;  1FL0 A;  1XNQ Q;  2GVB A;  2N78 A;  1UAP A;  2JA8 G;  4A93 G;  3C1E A;  3KBG A;  3X3M A;  1D2B A;  1I4X A;  3R3O A;  2JA6 G;  2L9H A;  1GM5 A;  1VDZ A;  2XVS A;  3JC6 6;  3ER0 A;  2Z8L A;  1IHZ A;  1YHQ A;  1CA5 A;  3LGJ A;  4JG2 A;  4KK7 A;  1GKH A;  4XTC S;  4GKK L;  1F9S A;  3K0X A;  3TP8 A;  4BBR G;  1I4H A;  2JA7 B;  2A6E D;  4ZAI A;  2DY7 A;  3PGZ A;  4RHS A;  4LNQ A;  3S17 B;  3UDX A;  2IY5 B;  1N36 L;  2EY5 A;  1CK1 A;  1HUM A;  3NXW A;  2NVX B;  1SN8 A;  2VB2 X;  2JXM B;  3J81 E;  2CQO A;  4LF9 Q;  2AWN A;  3S1N B;  2H4O A;  3VR6 A;  1NY4 A;  3HKZ G;  4XYQ A;  3I73 A;  1R9T H;  2PZW A;  3CCJ A;  1WOC A;  3BYY B;  4B08 A;  4LF7 Q;  2VUM H;  1AEX A;  4FF3 A;  2Z4I A;  5GAH C;  1LT4 D;  5E3F A;  4JV5 L;  2X69 A;  2HD3 A;  1KDC A;  1SYE A;  3NTK A;  4LF6 L;  3V05 A;  1XX8 A;  3CCE A;  4R4T A;  2KCN A;  3ZJY C;  4ZKC B;  1IBM L;  3JAM c;  1FNW A;  1QUQ B;  4NXN L;  5I9P A;  1TS3 A;  2NZO A;  5J39 A;  5M9O A;  4DV1 L;  1XMO Q;  1LUZ A;  2JA7 G;  4OEM B;  3S2H B;  2B2Y C;  5FLM H;  5EPL A;  2F0U A;  4YWK A;  5C4J B;  4JI5 Q;  1UWV A;  1BOS A;  1KRS A;  5AJ3 L;  2YU9 B;  3UDG A;  3GV3 A;  1EL0 A;  2CQA A;  5JJL A;  2E2J H;  3W3A A;  5I4D A;  3OHX C;  3S1R B;  4B3T Q;  1K3R A;  3CRL C;  1IL2 A;  4NXM Q;  2CW0 D;  3BS1 A;  1IW7 C;  3EA6 A;  4Z9C B;  1LO5 D;  3I56 A;  1CZW A;  2MJ8 A;  4GOP B;  3QWN A;  5JEA J;  2XRQ D;  4A3D G;  5K36 G;  2LS0 1;  1X32 A;  3MXP A;  4V0B A;  1AZP A;  3FVQ A;  3BZK A;  1UEA B;  1HA5 A;  2B2U C;  4EQP A;  4DNI A;  3SEB A;  2VQE Q;  4L5T A;  1JT8 A;  4JI1 Q;  3L0O A;  2AHO B;  2HQE A;  3SK6 A;  1F2L A;  4DR4 Q;  4A4I A;  1PMR A;  1O78 A;  1PYB A;  2E8G A;  3BVG A;  1D6E C;  4IFD J;  1Q8K A;  2AUK A;  1DD2 A;  1RTN A;  4DV6 Q;  1HNX Q;  1KNA A;  1JOK A;  4AYB E;  1CSP A;  5JOB A;  1QCB D;  5CC4 A;  1PTO F;  3NBI A;  2E5L Q;  1Z47 A;  2QEX A;  1NCV A;  3NEL A;  1H9R A;  4XIG S;  3PUY A;  2MNA A;  1EIG A;  2EJF C;  1X54 A;  3TZD A;  5CV6 A;  1CI3 M;  1HZB A;  3HOU B;  1Y1V B;  3PUX A;  4C3I H;  3RLF A;  2K01 A;  4QQB X;  1A6X A;  5C3X A;  1TS2 A;  4DK6 C;  3P7J A;  1VQB A;  4C1N I;  4N9P A;  4UPA A;  4FXK C;  1SRO A;  2R6G A;  1K8M A;  1YHA A;  4DNR B;  1RTO A;  4LF9 L;  4IOC A;  2R61 A;  1IBK Q;  2Z1C A;  2JA6 H;  5JEA G;  1HUN A;  3BU2 A;  4LF7 L;  2DJG C;  3TZU A;  1STE A;  1P16 A;  4A3E B;  4FF2 A;  3CCS A;  3JAM E;  1C7Y A;  3DEO A;  1L0Y B;  1IW7 D;  3T1Y Q;  1SNQ A;  3W5O A;  4FNF A;  2PMZ B;  2WAQ G;  5T1I A;  2YV5 A;  3HOU G;  1Y1V G;  1KIX A;  3G6E A;  2B3G A;  2PYK A;  2ID0 A;  4P2C B;  1KAA A;  2WV6 D;  3I2Z A;  1RL2 A;  4LFB L;  1QB5 D;  1STY A;  4HID A;  2JE6 I;  1Y69 U;  1F2Z A;  4IAL A;  4Q0F A;  4ZLT F;  3HEJ A;  1I6H B;  2ENB A;  1TR5 A;  3E5S A;  1H9S B;  3STB D;  2PZT A;  4B3T L;  1GVP A;  1VQM A;  4QIW E;  2DGY A;  2LSS A;  4RWS C;  2DN8 A;  1WTW A;  2F03 A;  1NMF A;  2VL6 A;  1GHK A;  1F77 A;  3G6J B;  1Y8N B;  2F0T A;  2UUB Q;  4OEL B;  1S3O A;  5M3F H;  4A3E G;  1CA6 A;  4G7H C;  3HOX B;  2ZJR A;  1EQQ A;  1N8R C;  1NSN S;  2B2W C;  5BN5 A;  4HIM A;  4L6T B;  2LFN A;  2KED A;  2BDN A;  5G3L F;  2R93 B;  2MP1 A;  3SK4 A;  4C1N K;  1U4R A;  4KJO A;  4JI1 L;  1CSQ A;  5C44 H;  1SXT A;  5EAY A;  1STG A;  1ONL A;  2K7V A;  5A2Q E;  5KEE A;  1WI5 A;  2JP1 A;  2RHQ B;  4GLA C;  4Q5V A;  2TSS A;  1EIH A;  1PTO B;  1Q8I A;  2MPM A;  1MIU A;  2RDH A;  3WDN A;  4X62 L;  4CJ2 C;  4DV6 L;  1GHJ A;  1ML0 D;  1HNX L;  4A3D H;  2K04 A;  3QOL A;  3AFQ A;  3EVQ A;  4P74 A;  2AQ2 B;  2WB1 G;  4PQX A;  3E3X A;  4QJF A;  4A75 A;  2E5L L;  3D31 A;  3WOE A;  3GTM B;  3IFD A;  4CJ0 B;  1LAC A;  2Z6K C;  1JOR A;  3HOX G;  1H9J A;  5COY A;  5J22 A;  3ULP A;  4AIM A;  3RUZ A;  1KNE A;  2KEN A;  1Y1W H;  4M8A A;  2R93 G;  4QMG A;  3J7A 5;  2DUD A;  4GOP C;  3S14 H;  4HR7 B;  1B70 B;  2YYZ A;  3MEF A;  3Q23 A;  4A3J H;  3QO2 A;  2F0D A;  1C8C A;  1PHJ A;  2K6A A;  2VZA A;  1Y8O B;  1E0B A;  3RN5 A;  4A3I B;  3IKJ A;  1QZH A;  3NK9 A;  4HN7 A;  5DAU A;  2D5D A;  4DV5 L;  1Q81 C;  2M00 A;  4X3U A;  2QIL A;  1L0X B;  4DK3 C;  4LF5 L;  2K28 A;  4IPG A;  5COR A;  4H13 C;  2ZTD A;  2ZJP A;  1N33 L;  2KBN A;  1Q86 C;  1HR0 W;  4LF4 Q;  4YWM A;  5IYD G;  3UI2 A;  1NTG A;  2SNS A;  3BVZ A;  1EWH A;  1BBW A;  4KMU C;  4FDB A;  4YIJ A;  1LTI D;  4RGO S;  1GD7 A;  3I4L A;  5JEA H;  1E2Z A;  1YBY A;  2M9V A;  3UE1 A;  2NZH A;  4A3I G;  5C3E H;  5M5Y B;  2KHJ A;  1TWH B;  4YCU A;  1IYU A;  1VQH A;  2IW3 A;  4A3C G;  1WJJ A;  2J0T D;  3H3V I;  1TKW B;  5I6Y A;  2UUB L;  2UU9 Q;  5IP9 G;  1F2M A;  4BBS H;  1DOK A;  2R92 H;  2KEC A;  1N34 L;  4YCW A;  1WTH A;  1W6K A;  3GDE A;  1C0A A;  2PPB C;  3IAY A;  3GTQ B;  4HMJ A;  1XTD A;  3CMA A;  4IFD H;  1JE4 A;  1AE3 A;  5I2X A;  1KAB A;  4IO9 A;  1M8A A;  2VY3 A;  3NEN A;  2OTL A;  4RCN A;  4OL7 A;  1EYA A;  4IUP A;  2PO4 A;  1PH4 A;  5CV9 A;  3GTK B;  4IN3 A;  4KHP L;  1TII D;  2NYZ D;  1V8Q A;  1HNW Q;  1K83 H;  5FLX L;  3TP6 A;  3CXC A;  2OT2 A;  3K5O A;  1TWF B;  2NZ1 D;  2KOL A;  2OQ0 A;  1X3F A;  3UDI A;  3HKZ E;  3W2D A;  1EU4 A;  1WTR A;  3J7A V;  4HTH A;  4MNO A;  1QZG A;  3QG1 A;  1JR0 D;  2I07 B;  5FJ8 G;  3VR2 A;  5IT9 L;  5J1Z A;  1B9M A;  1YHB A;  1RDP D;  1TY0 A;  3K7A B;  3C2P A;  4HJA A;  4RG1 A;  3D0F A;  2F52 A;  2WFW A;  1PZJ D;  4ZYS A;  1I94 L;  1I4P A;  5E4W C;  4R4I A;  2IX0 A;  2NTT A;  3VR4 A;  1HHV A;  4JI7 Q;  5I6W A;  3DUZ A;  1SNO A;  4JI4 Q;  2XSC A;  2BCO A;  1NMG A;  1SND A;  1F9P A;  4C3H H;  3HG9 A;  4MTK A;  1DOM A;  2EYF A;  2FIN B;  2D9U A;  1Q90 A;  4QIW B;  2WII B;  2IT1 A;  4K8I A;  3CC4 A;  3BG3 A;  3NP8 A;  1KC8 C;  3A54 A;  5A35 A;  1PTO C;  4K0K Q;  1NNX A;  2IWH A;  5ISR A;  3J81 i;  1YJ9 A;  1K3B C;  1R4P B;  4LF4 L;  3CAM A;  3FPP A;  4GKJ L;  1IYJ B;  2F4V L;  1VQ4 A;  1IBL Q;  1AZQ A;  3GTG H;  4JI6 L;  5D3D A;  5EGT A;  4GN5 A;  1R9T B;  3TRZ A;  1HTP A;  2VUM B;  3A8K E;  1G8Z D;  3VYU A;  2AUJ D;  1NBW A;  1ET9 A;  1M1K C;  1CHQ D;  1HZ9 A;  1LV9 A;  4HJ8 A;  2E2H H;  5FK9 C;  3MA2 B;  2BE5 C;  4JI8 L;  1B3Q A;  4DNT B;  5HGQ A;  1YZ6 A;  2F0V A;  2NN6 I;  1I6V C;  3GQB A;  1EWI A;  5IYD H;  1JJG A;  4A3M G;  4JI0 Q;  4B9W A;  5LMN Q;  3NEM A;  4JOI A;  4NDX A;  2OF1 A;  1KHI A;  3E6Z X;  4L8J A;  1CTM A;  2QGQ A;  2K1B A;  4DR2 L;  3FHW A;  1VQO A;  2A74 C;  1TT2 A;  2NUC A;  4P71 A;  4R4C A;  4C3J H;  2E2J B;  1K9M C;  3LWE A;  1SMY D;  4UDU C;  2KCC A;  3OW7 A;  4QUF A;  3A8I E;  4DAV A;  4HMI A;  4MHE A;  2VUM G;  4A3C H;  2K52 A;  1OXS C;  1I3Q H;  1VMP A;  1EZ6 A;  4J1M A;  4N9T A;  3HRZ C;  3L9A X;  4V19 0;  1HQR D;  1FNU A;  4QF4 A;  4OX9 Q;  2NB0 A;  4OIK A;  1ZYR C;  1EFI D;  1ROD A;  4F88 A;  4R4Q A;  3HGB A;  1GUN A;  2BH8 A;  1A3T A;  1YNN D;  1K8O A;  1QIL A;  5FLM G;  3LWU A;  1BVS A;  1EY7 A;  2K5D A;  3Q6S A;  2PQA A;  1WTP A;  2WAQ E;  1HTL D;  1PH5 A;  1BR9 A;  4TQU S;  1B50 A;  1MHW C;  4RGM A;  1A8V A;  4JI3 Q;  3FEW X;  4JI7 L;  5KIX A;  2HCI A;  2A73 B;  2A6E C;  4DV3 Q;  4IPH A;  4B3M L;  2LXJ A;  2A19 A;  2F0W A;  3CPF A;  4LK1 C;  4C3I B;  2ZM6 Q;  2D62 A;  2HQL A;  5JVG 3;  1KXL A;  3PCO B;  2AQ3 B;  2Q2T A;  1EIF A;  5FJ8 H;  4IUV A;  4A76 A;  4UY8 C;  1E22 A;  4L5R C;  4IPD A;  5IGC A;  1HZA A;  4Y52 H;  4TVA B;  2HHH Q;  2KA7 A;  2XIW A;  2CH4 A;  2XGT A;  4NKL A;  4K5V A;  2Q8I B;  3S1M H;  1STN A;  2JA6 B;  2ICE C;  1G2T A;  3R2T A;  2PMZ E;  1H9K A;  2BA1 A;  5FKA C;  5E1F A;  2BDO A;  3OSO A;  4CBV A;  3MEH A;  2F0P A;  4YHH Q;  4KY7 A;  2UUC Q;  2TMP A;  4C3I G;  1V43 A;  3TS2 A;  1PLF A;  5KGU A;  1AE2 A;  4HCE A;  1XMQ Q;  4DUZ Q;  2WB1 E;  2XWJ B;  4G57 A;  2CW0 C;  4JI0 L;  1MI2 A;  2KVM A;  5LMN L;  1T5E A;  3D6C A;  3P75 A;  3PUV A;  5IOD A;  3AFP A;  3TN2 A;  5EJW A;  4DXF A;  3VR5 A;  1VQ6 A;  1LT5 D;  1ASY A;  2UXB Q;  1G6Z A;  1YNJ D;  2OEO A;  3E9I A;  4ZUJ A;  2ES2 A;  4DR5 L;  1EIY B;  4DV4 Q;  3DM1 A;  1C4Q A;  2UUA L;  4K2K A;  1KL9 A;  1F9R A;  2JK8 A;  1KTK A;  4KD4 A;  4UP7 A;  1SFO H;  5M3F B;  1Q46 A;  2YTY A;  2ATW A;  5G3L D;  5GRO A;  4QGU A;  2B8G A;  4DR6 L;  1LTA D;  5C4X G;  1II3 A;  3T13 A;  1U4P A;  4OX9 L;  4A3M H;  1K8G A;  1N32 Q;  1RCV D;  4HIK A;  5C44 B;  1UE7 A;  1U4M A;  2VQF Q;  2CVR A;  3MAQ A;  1Q7Y C;  3HKS A;  1D1I A;  4RA8 A;  2A68 D;  3DWQ A;  1KD1 C;  3EJI A;  3NQI A;  3QJY A;  5FO8 B;  1WTX A;  4A3D B;  3KUP A;  2K75 A;  2PI2 A;  2PNR C;  4YWL A;  4E6I A;  3S1Q H;  4OON A;  3I91 A;  2FJ2 A;  4JI3 L;  1J9O A;  4JBW A;  4DV3 L;  3I4N G;  3LX0 A;  3TSS A;  3KLR A;  5M3F G;  4LUO A;  2ZM6 L;  3MWY W;  1JB3 A;  4WRD A;  2GVA A;  1JOO A;  1LTL A;  3T4A C;  4ZKB B;  1PH8 A;  3S24 A;  2DNC A;  1PH7 A;  1Y1W B;  5BN4 A;  3M4Q A;  3I55 A;  4BY7 H;  4JBJ A;  4ZCK A;  1WTV A;  5C44 G;  3S14 B;  5EPK A;  4A3J B;  1SYF A;  1MSG A;  2HHH L;  1Q1B A;  1W2B A;  2E2I H;  3DEP A;  1TU2 B;  4IJL A;  1HH2 P;  1CKN A;  1EY6 A;  5IP7 H;  1CHP D;  1SE8 A;  2RQX A;  2YTX A;  2E75 C;  3AB9 A;  3RR5 A;  1KRT A;  4O2D A;  4DN4 M;  3TP5 A;  1A15 A;  2C9O A;  4G4K A;  3VYR A;  2CCZ A;  2F0Q A;  3W1B A;  4YHH L;  4XDX A;  2IL8 A;  4LJZ C;  1VQJ A;  1X3E A;  3TRE A;  1ASZ A;  4OWT B;  4YCV A;  2F0K A;  1HCZ A;  3RZD H;  3D3R A;  1H9M A;  2KHS A;  3W1G A;  5IWA Q;  3D6W A;  3K81 C;  3STB C;  2V1C C;  3R93 A;  1XMQ L;  2EPB A;  2L5T A;  1Y1W G;  4JK1 C;  3NTI A;  4DUZ L;  4NW2 A;  3V2T A;  1RKN A;  3V96 A;  1VQF A;  1JIC A;  2MO0 A;  1N9W A;  4GNX A;  4A3J G;  3S16 H;  4DF7 A;  2ASB A;  5NUC A;  1XNQ L;  3ICE A;  5FLX c;  1SYB A;  3NSW A;  5C3E B;  4C2M H;  1PH2 A;  2N49 A;  1HFG A;  1PDQ A;  4KHZ A;  5K5P A;  2D0P A;  1M4V A;  1TY2 A;  3CQZ H;  2WAQ B;  1MD2 D;  4HAE A;  4DAY A;  4X66 Q;  4BBS B;  1OXU A;  4I65 A;  2A69 D;  2R92 B;  4ODG A;  5DM7 3;  4PV1 C;  1PYS B;  1HNZ Q;  2PQA B;  5IT9 c;  3QOJ A;  3R2I A;  1LTG D;  3VDY A;  3ERO A;  1JB7 A;  1UUP A;  1OXX K;  1UEB A;  3I7F A;  3EBE A;  3SGI A;  3K57 A;  1EY5 A;  4X3S A;  3CW2 C;  3BDL A;  3S2D H;  1GJX A;  2AQ1 B;  4JVZ A;  1HA6 A;  1VMC A;  1CQV A;  3MFY A;  4PMC A;  4DKA C;  1G51 A;  1DM0 B;  1K83 B;  2MO1 A;  4EQO A;  2O2L D;  3DHQ A;  3J80 L;  1BO0 A;  1K0S A;  2K33 A;  3DXJ C;  4J6H A;  5C3E G;  2D0O A;  5C4X H;  2HCC A;  3FMC A;  3B6Y A;  2FXQ A;  3A74 A;  1PH1 A;  2G9H D;  4BY1 B;  5LHY 1;  5F2D A;  4BBS G;  5C4Z A;  3GTL H;  2R92 G;  4I7Z C;  2RSN A;  4R4O A;  2WIN B;  3I4O A;  4OO1 I;  3HS0 C;  4HJ9 A;  3OPO A;  3J81 L;  1BXT A;  1XMO L;  3CCV A;  3PIO A;  1XWE A;  5FOB B;  1SSO A;  2EOT A;  4IFD G;  4HED A;  1WVL A;  1E1O A;  5M3M G;  4JI5 L;  1DON A;  2KQ3 A;  4HSV A;  2B2V C;  1WD0 A;  2NVY B;  2IX3 A;  2P5Z X;  2L55 A;  2JEA I;  1JJ2 A;  3OW2 A;  5EPJ A;  2WB1 B;  3K5L A;  4KV6 A;  4NXM L;  1JQY D;  1E24 A;  5ELB A;  3I4N H;  4C3H B;  3KF8 A;  1T9H A;  4X64 Q;  3K59 A;  1LTR D;  3KOJ A;  4CJ1 B;  4BXX H;  1AN8 A;  2F3I A;  1O7Z A;  1SNM A;  4K2L A;  3VYT A;  1S4Z A;  4GN4 B;  3SE0 A;  4XQN A;  2ZTC A;  4BY1 G;  2VQE L;  4IOA A;  1QNU A;  1YEZ A;  4UHV A;  3NQT A;  3ITP A;  5IWA L;  5IY0 A;  3U58 A;  4DR7 Q;  4DR4 L;  3PIO 3;  3EN2 A;  1E1T A;  1L1O A;  5FLX E;  1F2Y A;  4WOR A;  1KQS A;  3GTG B;  3OOC A;  1VQG A;  2RF4 A;  1KLG D;  4JBK A;  2ZXP A;  4WJ4 A;  2LKV A;  3MXN A;  2I5H A;  1PRT F;  1SLJ A;  4RGT A;  2F0H A;  3HOV G;  3ULL A;  3J7Y W;  1D7Q A;  2E2H B;  5KYL A;  4DFA A;  1YIT A;  1O80 A;  3K58 A;  4R1J A;  4C3H G;  1HPC A;  3F2U A;  5IT9 E;  5KYI A;  4B3R Q;  5D65 A;  1QVC A;  4C56 C;  4X66 L;  2X6L A;  5JPM C;  2CHB D;  4IUT A;  2N3S A;  3GD7 A;  3J81 j;  2L15 A;  1HNZ L;  3P1H A;  2ZXO A;  3PV0 A;  2K5H A;  4OWW B;  2Q8T A;  1Q12 A;  4OHJ A;  3G7L A;  3HOY H;  2F0G A;  4C3J B;  4DK1 A;  2EXD A;  5EBC A;  1DGS A;  4XQJ A;  4M1U B;  4FO2 A;  1DZ1 A;  5D14 A;  1IBK L;  4JOI C;  2SOB A;  4U68 A;  1LT3 D;  3IRB A;  4YY3 Q;  1I4R A;  1I3Q B;  1V1O A;  3M4O H;  1RJT A;  5IGD A;  3TS0 A;  4ILW A;  1JC7 A;  3DWA A;  1FGU A;  2JSO A;  3T1Y L;  1TWG H;  1BUV T;  2EYL A;  2WKD A;  1OXT A;  2Q2U A;  2GN5 A;  1FR3 A;  1NE3 A;  2GA4 B;  1SYC A;  3BVM A;  1CKN B;  2EZV A;  1BF4 A;  3DM3 A;  1VQK A;  1PZI D;  3MHB A;  2WP8 J;  5C0X I;  2MHV A;  4A3L H;  1LM0 A;  1STA A;  4LFC Q;  1YI2 A;  3BJU A;  4XT1 B;  5FO7 B;  4C3J G;  4CKE A;  1A63 A;  3X3N A;  5GAD C;  4R8N A;  2PW5 A;  1SNP A;  1EEI D;  2K5V A;  1WD1 A;  3NHH A;  3DLL A;  3L3O C;  1SNC A;  3H6M A;  3F2D A;  1PFS A;  2A5H A;  4HJ7 A;  2BOS A;  1WCM G;  4B3S Q;  4RKL A;  4I7A A;  2XTI A;  2WAC A;  3RD4 A;  3T16 A;  5M5X H;  4DV7 Q;  1KLU D;  2Z0S A;  1CKM A;  2MGS A;  1M90 C;  2RCF A;  3A56 A;  5GQO A;  5M3M H;  4QCL A;  3I3C A;  2K5W A;  4JYA Q;  2KEE A;  1PRT B;  2M2L A;  4FXD A;  5ELE A;  2EYM A;  3PMF A;  1TS4 A;  3S1M B;  2VB3 X;  4P75 A;  1HXY D;  4DAY B;  2F4I A;  2J4X A;  2EIF A;  3Q0A A;  3CME A;  3GV6 A;  3AYH B;  3U4Z A;  3IFT A;  2F0S A;  1DYQ A;  3PO2 H;  3I8Z A;  2A6H D;  3NE5 B;  2CFM A;  1GO3 E;  1V1P A;  4BY1 H;  4PG3 A;  3OTO Q;  1Y14 B;  2OCE A;  3CP0 A;  4ALP A;  1QE6 A;  1SMY C;  1SE4 A;  4OIJ A;  1B8A A;  2WKC A;  1B9N A;  1IXR A;  4QL5 A;  2Y0S B;  1X3G A;  2PQE A;  2V4D A;  2NVY H;  4LAA A;  4CHT B;  1S5E D;  2AWO A;  2ZJQ A;  1QVG A;  4X65 Q;  3HOV H;  3L2P A;  4MTN A;  1VQ9 A;  1ESR A;  2EJM A;  5IYB G;  1U4L A;  3GO5 A;  5HY6 A;  1J5E Q;  3GTP H;  1SFO B;  1G6P A;  4WFN 3;  1FVI A;  3M3Y H;  1EQT A;  1YNN C;  1XNR Q;  1XPO A;  1X55 A;  1P8L A;  3KLS A;  4A3M B;  4ABN A;  1WFQ A;  3HOW G;  4KKU A;  1IYV A;  1CZG A;  3SXH A;  1EY4 A;  1SYD A;  1K73 C;  3QIA A;  4H44 C;  3VA5 A;  2Y0S G;  3KF8 B;  3RZO H;  1VQE A;  3AU7 A;  3FKI H;  1FD7 D;  2HUG A;  4ZUI A;  3KK7 A;  3S1Q B;  2QDB A;  4APV A;  2JQO A;  1ENF A;  2EY2 A;  3ERS X;  2K05 A;  2SEB D;  3AMU A;  1OTC A;  1DOL A;  1T5X D;  3SK8 A;  5IIF A;  4QB4 A;  4PZ6 A;  2UU9 L;  1UE6 A;  2O4X A;  1W3S A;  4PZ7 A;  5D3I B;  2MQH A;  2KJX A;  4EGV A;  1VQI A;  2K50 A;  3MXN B;  1B4O A;  4XYO A;  4DV7 L;  4BY7 B;  1B53 A;  1JE5 A;  3GTJ H;  4K5W A;  4KN4 C;  1GUT A;  5HGT A;  4H02 A;  4IJH A;  1MJE A;  2F1M A;  2E2I B;  2B63 G;  3PUZ A;  4ZK9 B;  2F0O A;  3U9O A;  4GOP A;  4LFA Q;  3K5M A;  1LTT D;  2Z6B A;  1X6O A;  2RCN A;  3SR1 A;  3D8G A;  1JCK B;  1HNW L;  4CDF C;  3BDC A;  2EYH A;  1GOZ A;  3C46 A;  1WCM H;  1Z6H A;  4IUN A;  3OIP A;  3I72 A;  4HSP A;  4DXG A;  1I50 H;  3RZD B;  3OWF A;  4KKS A;  5KRU A;  1QVF A;  3WWV A;  2L12 A;  4AQY Q;  2NVT H;  1Y8P B;  1YNJ C;  5ELC A;  4HJ5 A;  4N8F A;  4BY7 G;  2Q2I A;  1VQC A;  2H5X A;  1VQ7 A;  1H95 A;  1EY9 A;  1A0I A;  1JMC A;  4FP5 D;  4KLK A;  1U5K A;  4OWX B;  3S16 B;  2VW9 A;  4NPS A;  1VQ5 A;  3J80 c;  5TSS A;  4C2M B;  5M5W H;  3TBI B;  1CUK A;  5IP7 G;  2IPK D;  1N36 Q;  2F0M A;  2JJQ A;  3ERQ A;  5ELF A;  1EY8 A;  3CKI B;  4JI4 L;  4OGQ C;  2QEJ C;  4GNX C;  3CQZ B;  3E0E A;  4RFB A;  2I5M X;  1C48 A;  2EVB A;  1PXU A;  1PRT C;  1XNR L;  4FF4 A;  2A68 C;  3D4D A;  2NVQ H;  1EOV A;  3DMU A;  3PSI A;  3T51 B;  3K7U C;  4K0K L;  3MC0 B;  4JV5 Q;  3MTS A;  1TWA H;  2KUM A;  1SRU A;  3S2D B;  5LMU Q;  4LF6 Q;  4GZY C;  3F8T A;  1EUJ A;  1V9P A;  2R3Z A;  3Q8D A;  1IBL L;  2ALY B;  2B2T A;  1JWM D;  5IYB H;  3KBX A;  5CMD A;  5DM6 3;  2OQK A;  5GAE C;  3JAM i;  2EYP A;  3M9B A;  5C4X B;  5AJ3 Q;  2NN6 G;  3K5N A;  1W6J A;  3GTO H;  4FVM A;  4A3G H;  1IZ6 A;  4LWC A;  1FJG Q;  2CWP A;  3HOW H;  1O7L A;  3GTL B;  3PO3 H;  4LUZ A;  1J8I A;  3H15 A;  5C0X H;  5EKL A;  1YVC A;  2SNM A;  3J7Z C;  1XPR A;  3I70 A;  5JJI A;  1K0R A;  2XNA C;  3CU7 A;  3MZ5 A;  3URY A;  1EYG A;  1H9S A;  2F3W A;  1X65 A;  3H3V H;  1C9O A;  4A3K G;  5AFW A;  1E2W A;  3SK5 A;  3H0G H;  1QJO A;  3I4M G;  1ZEQ X;  4NB3 A;  2JA5 H;  1VQP A;  3I4N B;  2RBM A;  5DNF A;  4BS9 A;  1OO9 B;  4BWG B;  3K80 C;  3CPW A;  1S72 A;  5CBE E;  4DAM A;  4NMZ A;  1JJC B;  3N52 A;  3KLW A;  4IUR A;  1HFN A;  5DLQ E;  3SDZ A;  5LL6 S;  2UXC Q;  5ELD A;  2FHT A;  2OXP A;  5LMN W;  4P73 A;  1NR4 A;  4AQY L;  4R9W A;  5EKK A;  3J80 E;  1PRT D;  1X3Q A;  2B63 H;  4F7X A;  5CR3 A;  4DGZ A;  2O5I C;  5C4H A;  2I0Q A;  3CCM A;  2E74 C;  5BR8 Q;  2N55 A;  5CYU A;  2A69 C;  1FYC A;  4JPB W;  3WOF A;  1L1O C;  2C35 B;  1AW7 A;  2F3V A;  1AH9 A;  2EXZ A;  3HOZ G;  1PFM A;  4DU9 A;  2PW7 A;  4K8J A;  3KYH C;  4L5S A;  1ESF A;  1Z7T A;  2PI2 E;  2IX1 A;  1B3A A;  4BXX G;  4X6A H;  4GLV B;  5FO9 B;  3G48 A;  3KDF A;  5DEH A;  2IHE A;  2Z4H A;  4WJW A;  4BA2 I;  1STB A;  2K5Q A;  2L1B A;  2ZTE A;  1EY0 A;  5GAG C;  3J7A F;  3K6O A;  1TS5 A;  1GUW A;  1QG7 A;  4O0A A;  3HOY B;  4A3B H;  1F9Q A;  1LAB A;  5LL6 X;  5LMU L;  4ZRZ A;  1XYI A;  1PYW D;  2OWO A;  1BCP D;  4JC0 A;  3ZYY X;  1PH3 A;  5C6A A;  1E3P A;  1DXM A;  3M4O B;  4CDD C;  4LFB Q;  4DK0 A;  3A0J A;  2B39 A;  3ND8 A;  3C1F A;  1ET6 A;  1IKL A;  1X56 A;  1TWG B;  1K8A C;  4LMQ D;  1MJC A;  2AKW B;  4UP9 A;  1MKH A;  2UUC L;  2C5C A;  4IFD I;  3CF5 A;  5JJK A;  1FJG L;  3MFG A;  4R8I A;  1BQQ T;  3QB3 A;  1EZ8 A;  3NTH A;  5T1G A;  1AP0 A;  4NP5 A;  2LXK A;  1TWC H;  3LNN A;  1D8L A;  2RA4 A;  4EQ5 A;  2EE1 A;  1SR3 A;  3A5U A;  2EY1 A;  5JAV A;  4KHV A;  1XTC D;  3HOY G;  3TQY A;  3CCR A;  2UXB L;  4KKT A;  4DV4 L;  2EJG C;  2NN6 H;  3OIQ A;  3OMG A;  3A7A B;  2G5D A;  1BDO A;  3PIP A;  3TP7 A;  4QY7 A;  1DJR D;  3FRP B;  4X62 Q;  4CKB A;  2E76 C;  2CH4 W;  5M5X B;  4Y7N H;  3T53 B;  3SVM A;  2H1E A;  3CC7 A;  1N32 L;  1GXD C;  5ELO A;  5M3M B;  2UXC L;  1WTO A;  4KTA A;  3A5Z B;  2DNE A;  2VQF L;  1A3U A;  2NTS A;  4A3K H;  2R7Z B;  1PV4 A;  4A3L G;  3H09 A;  1Q3L A;  3I4M H;  2Q8R E;  2LY7 A;  1J6Q A;  2BH2 A;  1VS0 A;  4PZ8 A;  5BR8 L;  1HR0 Q;  4KN7 C;  4QUC A;  5E4X A;  3PO2 B;  4EVO A;  1EYC A;  3VA7 A;  2N88 A;  2F0E A;  3PIP 3;  2XRS D;  4JI2 Q;  2Y0S E;  2JA8 H;  4A93 H;  4DV2 Q;  3BYT B;  4MIU A;  4KJN A;  2A1A A;  4DV5 Q;  1LTB D;  1KDA A;  5EBD A;  1NJI C;  2J7Z A;  4IQZ A;  1A2U A;  5IGB A;  1V1Q A;  2RSO A;  3PQI A;  1VQ8 A;  4AH6 A;  4LF5 Q;  4BBR H;  4TKO B;  3HOV B;  1LT6 D;  2R7Z G;  3S15 H;  5CV5 A;  1N33 Q;  1X9N A;  1EFW A;  3EFX D;  2I5L X;  3HOZ H;  4XT3 B;  1I4G A;  3GTP B;  2QCP X;  2N8N A;  3PO2 G;  2XWB B;  4S3S A;  3M3Y B;  2G9D A;  1GUS A;  3AEV A;  2HIX A;  1ILP A;  4JW0 A;  4K5X A;  3BDO A;  2RVL A;  2X6G A;  3DWP A;  1IL8 A;  4KI0 A;  2HT1 A;  1K28 A;  3RZO B;  3FP9 A;  1N34 Q;  3FKI B;  4IPC A; 
#chains in the Genus database with same CATH homology
 4ALP A;  3UDG A;  4IPH A;  5JJL A;  4B3M L;  2LXJ A;  2A19 A;  2E2J H;  2JA7 H;  3CPF A;  1B8A A;  4B3T Q;  1K3R A;  2ZM6 Q;  1IXR A;  2D62 A;  4QL5 A;  4NXM Q;  1IL2 A;  3S17 H;  2HQL A;  1X3G A;  3I56 A;  1KXL A;  2NVY H;  3PCO B;  4JCV E;  4GOP B;  2Q2T A;  1EIF A;  5FJ8 H;  4DUY Q;  4A76 A;  2NVX H;  5JEA J;  4UY8 C;  4A3D G;  5K36 G;  2PNH A;  2AWO A;  1E22 A;  2ZJQ A;  4L5R C;  1QVG A;  4OXP A;  4X65 Q;  4IPD A;  3S1N H;  3HOV H;  1A62 A;  3L2P A;  4KHP Q;  3L7Z C;  1HZA A;  4MTN A;  4Y52 H;  1KAW A;  1S40 A;  1VQ9 A;  3BZK A;  5IYB G;  4TVA B;  3GO5 A;  3G71 A;  2HHH Q;  1PH6 A;  5HY6 A;  4DPG A;  1J5E Q;  3GTP H;  1G6P A;  4DNI A;  2VQE Q;  4L5T A;  1JT8 A;  4JI1 Q;  3L0O A;  2XGT A;  1FVI A;  2AHO B;  3M3Y H;  3S1M H;  1XNR Q;  1XPO A;  1X55 A;  1P8L A;  2VS1 A;  2K5N A;  2PMZ E;  4DR4 Q;  4A4I A;  1PYB A;  2BA1 A;  2E8G A;  1SMX A;  1WFQ A;  4RMF A;  3HOW G;  4IFD J;  1Q8K A;  4YHH Q;  1WYD A;  3FKI G;  4DV6 Q;  1HNX Q;  4AYB E;  3KDF B;  1CSP A;  2UUC Q;  2MFI A;  3S2H H;  1HR0 L;  2UXD Q;  1K73 C;  1LYL A;  1V43 A;  4DV0 Q;  2E5L Q;  1Z47 A;  2Q2H A;  2QEX A;  4GS3 A;  4A3F G;  2Y0S G;  3KF8 B;  3NEL A;  5C4J H;  1YJW A;  3RZO H;  3TS2 A;  4XIG S;  1AE2 A;  3PUY A;  1VQE A;  3FKI H;  2MNA A;  1XMQ Q;  2YU9 H;  4DUZ Q;  2WB1 E;  1I94 Q;  1X54 A;  4OO1 G;  4JI0 L;  4APV A;  5LMN L;  1HZB A;  3S1R H;  2JQO A;  4JI2 L;  4C3I H;  3ERS X;  3PUX A;  4DV2 L;  3PUV A;  3AFP A;  2HIV A;  3RLF A;  5J3B A;  1OTC A;  1VQ6 A;  1ASY A;  2UXB Q;  1XJV A;  4QQB X;  2A8V A;  4PZ6 A;  2UU9 L;  1U0L A;  1UE6 A;  3E9I A;  2ES2 A;  4DK6 C;  4DR5 L;  1W3S A;  4PZ7 A;  4DV4 Q;  1EIY B;  2MQH A;  1VQB A;  4UPA A;  1VQI A;  2UUA L;  2K50 A;  1B7Y B;  1KL9 A;  2JK8 A;  4MZ9 A;  2K14 A;  4UP7 A;  1SRO A;  2R6G A;  3MXN B;  4DV7 L;  1SFO H;  1Q46 A;  2YTY A;  2ATW A;  1YHA A;  4LF9 L;  1OXV A;  4IOC A;  1JE5 A;  5GRO A;  1G29 1;  4QGU A;  3GTJ H;  1IBK Q;  4DR6 L;  3KF6 A;  5C4X G;  3CD6 A;  2JA6 H;  3PUW A;  4H02 A;  4IJH A;  5JEA G;  3BU2 A;  1MJE A;  4LF7 L;  4OX9 L;  1VQD A;  4A3M H;  2F4V Q;  2JA9 A;  2AMC B;  1K8G A;  2B63 G;  1N32 Q;  3PUZ A;  4X64 L;  4HIK A;  1L2F A;  1P16 A;  5ELN A;  4GOP A;  4JI6 Q;  4LFA Q;  1PH9 A;  3CCS A;  1C7Y A;  1X6O A;  1UE7 A;  2RCN A;  3PF5 A;  2VQF Q;  3T1Y Q;  3W5O A;  1HNW L;  1Q7Y C;  3HKS A;  4GNX B;  2WAQ G;  3BZC A;  2BA0 A;  2YV5 A;  3HOU G;  1Y1V G;  1KIX A;  3F2B A;  3G6E A;  1KD1 C;  2B3G A;  1VQN A;  1WCM H;  5C0X J;  4JI8 Q;  2ID0 A;  4DR7 L;  5H1S E;  1I50 H;  2K75 A;  2PI2 A;  3I2Z A;  4YWL A;  1RL2 A;  5IE8 A;  3S1Q H;  4UP8 A;  3RN2 A;  4OON A;  4LFB L;  2R7Z H;  4HID A;  3HOU H;  1Y1V H;  2JE6 I;  4JI3 L;  1QVF A;  3WWV A;  4AQY Q;  2NVT H;  4JBW A;  4DV3 L;  3I4N G;  2R93 G;  3STB D;  4HJ5 A;  1PA6 A;  4BY7 G;  5M3F G;  4LUO A;  2Q2I A;  4B3T L;  1GVP A;  1VQC A;  2H5X A;  1VQM A;  4QIW E;  2DGY A;  2ZM6 L;  1A0I A;  2LSS A;  1VQ7 A;  1H95 A;  2GVA A;  3RLO A;  1LTL A;  1NMF A;  2VL6 A;  3T1H Q;  4KLK A;  1U5K A;  3S24 A;  4OWX B;  4DR2 Q;  2VW9 A;  4NPS A;  1PH7 A;  1VQ5 A;  4DUY L;  1UE5 A;  3J80 c;  3M4Q A;  2UUB Q;  3I55 A;  4BY7 H;  1HJP A;  1S3O A;  4JBJ A;  5M5W H;  5M3F H;  5IP7 G;  3RNU A;  1CUK A;  5C44 G;  2ZJR A;  4A3E G;  1EQQ A;  4B3R L;  1N36 Q;  1N8R C;  4EX5 A;  2JJQ A;  3F1Z A;  4HIM A;  4JI4 L;  2HHH L;  1TXY A;  1Q1B A;  1W2B A;  2E2I H;  4GNX C;  3E0E A;  4IJL A;  1HZC A;  1HH2 P;  2I5M X;  1CKN A;  5IP7 H;  4JI1 L;  4A3E H;  1CSQ A;  1SE8 A;  5C44 H;  2YTX A;  4POG A;  3RR5 A;  5EAY A;  4L5Q A;  1KRT A;  1XNR L;  4O2D A;  1WI5 A;  2RHQ B;  4GLA C;  1EOV A;  2NVQ H;  4AYB G;  3PSI A;  3K7U C;  2CCZ A;  4K0K L;  3W1B A;  1MIU A;  4X62 L;  4JV5 Q;  4YY3 L;  4YHH L;  1TWA H;  1PVO A;  1SRU A;  4DV6 L;  5LMU Q;  2QA4 A;  1VQJ A;  1HNX L;  4LF6 Q;  1X3E A;  3TRE A;  3AFQ A;  4OWT B;  4YCV A;  1ASZ A;  3F8T A;  1EUJ A;  1V9P A;  4P74 A;  3RZD H;  2UXD L;  3Q8D A;  2WB1 G;  1IBL L;  4QJF A;  2ALY B;  4DV0 L;  4A75 A;  2E5L L;  3W1G A;  5IWA Q;  3D31 A;  4P72 A;  3K81 C;  3STB C;  5IYB H;  2V1C C;  4LF8 Q;  4A3G G;  3UE0 A;  1Y1W G;  1XMQ L;  1PH8 A;  1I6H H;  4DUZ L;  2OQK A;  5GAE C;  3JAM i;  2Z6K C;  1VQA A;  4PMW A;  3HOX G;  3ULP A;  3M9B A;  3PO3 G;  4AIM A;  1XPU A;  1VQF A;  3J80 i;  5C0X G;  2NN6 G;  5AJ3 Q;  2MO0 A;  3CCQ A;  1N9W A;  1UE1 A;  4GNX A;  4DR1 Q;  4A3J G;  4B3M Q;  3GTO H;  3S16 H;  4A3G H;  2KEN A;  1Y1W H;  1IZ6 A;  4LWC A;  1XNQ L;  2ASB A;  1CKO A;  5FLX c;  1FJG Q;  3ICE A;  2CWP A;  1Q1E A;  3HOW H;  3J7A 5;  2DUD A;  4C2M H;  3HOX H;  3K8A A;  1PH2 A;  2N49 A;  3PO3 H;  4DV3 Q;  4LUZ A;  4GOP C;  3H15 A;  4KHZ A;  3S14 H;  1B70 B;  2YYZ A;  3MEF A;  4LFC L;  2D0P A;  4A3J H;  1YVC A;  3AQQ A;  4GN3 B;  4DR3 Q;  3CQZ H;  1PHJ A;  2VZA A;  4LUV A;  3J7Z C;  1XPR A;  2R93 H;  5JJI A;  1K0R A;  4X66 Q;  3RN5 A;  1OXU A;  4A3F H;  1QZH A;  3H0G G;  1EYG A;  2JA5 G;  1Q81 C;  4DV5 L;  1PYS B;  1HNZ Q;  5IYC G;  2PQA B;  1X65 A;  5IT9 c;  3H3V H;  1C9O A;  4A3K G;  1QUQ A;  3VDY A;  4GLX A;  1L1O B;  1JB7 A;  1RIP A;  3H0G H;  4HIO A;  4B3S L;  2CWA A;  4DK3 C;  3E9H A;  3CC2 A;  1OXX K;  4NB3 A;  2JA5 H;  1VQP A;  4LF5 L;  1UEB A;  2Z6K A;  3EBE A;  3I7F A;  4IPG A;  3SGI A;  3S2D H;  5E7N A;  3CW2 C;  3K80 C;  3CPW A;  2ZTD A;  1S72 A;  2ZJP A;  4DKA C;  1YIJ A;  1N33 L;  2KBN A;  4DAM A;  1G51 A;  1Q86 C;  1HR0 W;  4LF4 Q;  4YWM A;  1JJC B;  3F2C A;  3GTM H;  2MO1 A;  3KLW A;  5IYD G;  1VQL A;  4JYA L;  1NTG A;  4BA1 I;  2K4K A;  3EIV A;  1BBW A;  5DLQ E;  5C3E G;  2UXC Q;  2D0O A;  4FDB A;  5C4X H;  5LMN W;  4P73 A;  4AQY L;  1GD7 A;  3B6Y A;  2FXQ A;  3A74 A;  2R7F A;  1YBY A;  1PH1 A;  2B63 H;  3UE1 A;  3G4S A;  2NZH A;  4A3I G;  5C3E H;  4BBS G;  2KHJ A;  3GTL H;  2R92 G;  2I0Q A;  4YCU A;  1VQH A;  4R4O A;  3CCM A;  3T1H L;  1WJJ A;  3I4O A;  4A3C G;  4HJ9 A;  2KCT A;  5BR8 Q;  3H3V I;  4OO1 I;  1XMO L;  3CCV A;  3PIO A;  2UUB L;  2UU9 Q;  5IP9 G;  4DR5 Q;  4IFD G;  1L1O C;  2C35 B;  4A3I H;  3OTO L;  1E1O A;  5M3M G;  4JI5 L;  4BBS H;  1AH9 A;  4LW1 A;  2R92 H;  3M7N A;  2UUA Q;  2JEB I;  1N34 L;  4YCW A;  3HOZ G;  3UDF A;  3GDE A;  2JEA I;  3CCL A;  1C0A A;  1JJ2 A;  3OW2 A;  3KYH C;  4L5S A;  2PI2 E;  2IX1 A;  1XTD A;  5IP9 H;  3CMA A;  4DR6 Q;  4BXX G;  3U4V A;  1Z9F A;  4GLV B;  4GKK Q;  4X6A H;  1AE3 A;  3G48 A;  3KDF A;  4NXM L;  2IHE A;  3M4P A;  4A3B G;  4IO9 A;  1E24 A;  1YNX A;  2VY3 A;  3NEN A;  2OTL A;  3I4N H;  4WJ3 M;  1T9H A;  4BA2 I;  4X64 Q;  1PH4 A;  4ME3 A;  4X65 L;  3KOJ A;  2ZTE A;  1O7I A;  4BXX H;  4KHP L;  2F3I A;  5GAG C;  4O0A A;  1HNW Q;  1K83 H;  4A3B H;  5LMU L;  1J5E L;  4GN4 B;  1L0W A;  2ZTC A;  4BY1 G;  3CXC A;  2VQE L;  3OYY A;  1Q82 C;  4IOA A;  1YEZ A;  2CKZ B;  2OWO A;  5IWA L;  4JC0 A;  5IY0 A;  2OQ0 A;  3U58 A;  1PH3 A;  1E3P A;  4DR7 Q;  1X3F A;  3J81 c;  4LF8 L;  4DR4 L;  3UDI A;  3EN2 A;  1E1T A;  3HKZ E;  1L1O A;  3CCU A;  1KQS A;  4LFB Q;  4J15 A;  1JMC A;  1VQG A;  2RF4 A;  4JBK A;  1BKB A;  3U50 C;  4MNO A;  1VCI A;  1BBU A;  5M5Y H;  1QZG A;  4WJ4 A;  3A0J A;  1TWH H;  1X56 A;  5FJ8 G;  2I5H A;  1SLJ A;  1K8A C;  3KF6 B;  4DR1 L;  1MJC A;  2AKW B;  3KJP A;  4UP9 A;  1MKH A;  2UUC L;  4IFD I;  1YHB A;  3ULJ A;  3CF5 A;  5JJK A;  3HOV G;  3ULL A;  4HJA A;  1FJG L;  3HFZ B;  1IBM Q;  4RG1 A;  2B29 A;  3D0F A;  3KFU A;  1D7Q A;  2F52 A;  2WFW A;  4NXN Q;  4DV1 Q;  1E7Z A;  1YIT A;  2IHF A;  2LXK A;  1TWC H;  4R1J A;  1YJN A;  1I94 L;  1D8L A;  3GTQ H;  3RLN A;  4R4I A;  4EQ5 A;  2IX0 A;  3M85 A;  4DR3 L;  4B3R Q;  1QVC A;  1I5F A;  1SR3 A;  4X66 L;  3A5U A;  4JI7 Q;  4JI4 Q;  3HOY G;  2N3S A;  3GD7 A;  3J81 j;  1NMG A;  3TQY A;  2L15 A;  1HNZ L;  2OTJ A;  3CCR A;  3PV0 A;  4C3H H;  2UXB L;  2K5H A;  4OWW B;  3GTK H;  4DV4 L;  1Q12 A;  2IT1 A;  3TEH B;  3CC4 A;  2KHI A;  3HOY H;  2EXD A;  1DGS A;  3PIP A;  1KC8 C;  4QY7 A;  4K0K Q;  2R7D A;  4X62 Q;  1IBK L;  1TWF H;  4JOI C;  4YY3 Q;  3J81 i;  3IRB A;  1YJ9 A;  4LF4 L;  3CAM A;  4Y7N H;  4GKJ L;  1IYJ B;  2F4V L;  2VNU D;  3I4M G;  3M4O H;  4POF A;  3CC7 A;  1VQ4 A;  3TS0 A;  1IBL Q;  1N32 L;  3GTG H;  5ELO A;  2UXC L;  4JI6 L;  4LFA L;  1FGU A;  4GN5 A;  3TRZ A;  3A5Z B;  1EQR A;  2KCM A;  2VQF L;  1TWG H;  5IYC H;  3T1Y L;  4JBM A;  1NBW A;  2EQS A;  1OXT A;  2Q2U A;  4A3K H;  1M1K C;  3K7A H;  2RHS B;  2GN5 A;  3KJO A;  1HZ9 A;  4HJ8 A;  3NBH B;  1NE3 A;  1PV4 A;  2E2H H;  3PF4 A;  4A3L G;  3I4M H;  1CKN B;  4JI8 L;  1J6Q A;  2YTV A;  2BH2 A;  1FL0 A;  1VS0 A;  4PZ8 A;  2GVB A;  1YZ6 A;  2N78 A;  3DM3 A;  5HGQ A;  5BR8 L;  1HR0 Q;  1VQK A;  1XNQ Q;  2JA8 G;  4A93 G;  2WP8 J;  5C0X I;  2NN6 I;  4A3L H;  1LM0 A;  4LFC Q;  2JA6 G;  1YI2 A;  1GM5 A;  3JC6 6;  1EWI A;  3BJU A;  3ER0 A;  5IYD H;  1A63 A;  1JJG A;  4A3M G;  4JI0 Q;  5GAD C;  5LMN Q;  1YHQ A;  4JI2 Q;  2Y0S E;  2JA8 H;  3LGJ A;  4JG2 A;  4DV2 Q;  3NEM A;  4A93 H;  4GKJ Q;  4JOI A;  1KHI A;  1GKH A;  2A1A A;  4XTC S;  2K5V A;  4GKK L;  4DV5 Q;  2QGQ A;  1NJI C;  3K0X A;  4DR2 L;  3FHW A;  4BBR G;  1VQO A;  3DLL A;  4R4C A;  4C3J H;  4P71 A;  1V1Q A;  3F2D A;  1K9M C;  1PFS A;  4A3D H;  3PGZ A;  4HJ7 A;  1VQ8 A;  4LNQ A;  2IY5 B;  3UDX A;  1N36 L;  1WCM G;  4B3S Q;  4AH6 A;  4LF5 Q;  2VUM G;  2XTI A;  2K52 A;  4A3C H;  1OXS C;  1SN8 A;  1I3Q H;  5M5X H;  4DV7 Q;  4BBR H;  2CQO A;  2Z0S A;  4LF9 Q;  1CKM A;  2AWN A;  2R7Z G;  1M90 C;  3S15 H;  1N33 Q;  1NY4 A;  3HKZ G;  5GQO A;  1X9N A;  5M3M H;  1EFW A;  1R9T H;  3CCJ A;  2I5L X;  1WOC A;  4LF7 Q;  4OX9 Q;  2VUM H;  4JYA Q;  3HOZ H;  2N8N A;  3PO2 G;  4R4Q A;  5GAH C;  4P75 A;  2BH8 A;  4JV5 L;  3AEV A;  2HIX A;  4DAY B;  2EIF A;  3CME A;  3AYH B;  3U4Z A;  4LF6 L;  5FLM G;  1BVS A;  3PO2 H;  3CCE A;  4R4T A;  3ZJY C;  1IBM L;  2PQA A;  3JAM c;  2CFM A;  1GO3 E;  1QUQ B;  4NXN L;  4DV1 L;  2NZO A;  2WAQ E;  1XMO Q;  1LUZ A;  2JA7 G;  4KI0 A;  1PH5 A;  2HT1 A;  4TQU S;  5FLM H;  4BY1 H;  4PG3 A;  3OTO Q;  4YWK A;  1A8V A;  4JI3 Q;  1UWV A;  4JI5 Q;  1Y14 B;  2OCE A;  1KRS A;  3FP9 A;  4JI7 L;  1N34 Q;  5AJ3 L;  4IPC A;  3CP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...