4JI7L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7L00
3M4QA 3HOXH 5IYDG 1KRTA 3KF6B 1S40A 4POGA 3U50C 3HOZG 2PMZE 2MO0A 5C4XH 1VQFA 2D62A 3KOJA 1OXVA 1TWAH 1YHQA 4A3LH 4X62Q 2JA9A 2OWOA 1FJGQ 3CCQA 2NVXH 1LUZA 2RHQB 4Y7NH 4AYBG 2WAQE 4LF5L 3KLWA 4DUYL 4DV4L 1PV4A 2Z0SA 4BBSG 1G291 1VS0A 1Z47A 2IHFA 1NY4A 4DV6Q 3TRZA 3GDEA 1VQ7A 4K0KQ 1X54A 3RLNA 1UE7A 1QUQA 4YHHQ 3A5UA 1VQBA 2KCMA 3GTOH 5JJLA 2R92H 3M9BA 1PVOA 1B8AA 1XPOA 4JI8Q 3H15A 4ALPA 1YJWA 4QQBX 3K8AA 5IYCG 2ID0A 5IYDH 4JV5L 4A93G 3W5OA 4B3TL 3T1HL 2A19A 4LUOA 3J80i 1XPRA 1YITA 3BZKA 4LF5Q 2EIFA 4DR3L 5IY0A 1L2FA 4A3IG 1KIXA 4DAMA 4APVA 3HOVH 4BBRH 1I94Q 4K0KL 1CSQA 3I4MH 3CC7A 1XNRQ 1QUQB 3CCMA 4DR4L 2UUBL 4OWWB 5FLMG 2A1AA 1VQGA 2RHSB 4BA2I 4BY7G 4R4TA 4JI5L 1SRUA 4IFDG 4UPAA 4GLVB 1KQSA 4BBRG 1YJ9A 1EYGA 2VZAA 1GVPA 4GOPA 2R7ZG 4GLAC 4MNOA 1E22A 4QIWE 1KAWA 1SMXA 2VW9A 3CCRA 3T1YL 1N34L 4DR3Q 3CD6A 3J7A5 3G48A 2K5HA 1GD7A 3K0XA 4GOPC 4BY1G 2AKWB 1Q82C 1N33L 2MFIA 3PF5A 4C2MH 4GKKL 4A3CG 1HNWQ 3OTOQ 4JBMA 4GN3B 4LUZA 3BJUA 2WAQG 4A3FG 1KHIA 4LF6Q 3UDIA 1VQHA 3J81j 2UUBQ 1HNXL 1IL2A 3I2ZA 2R7FA 1Q81C 3WWVA 4IFDI 3RLFA 3VDYA 4A3EH 2GN5A 5GAHC 3S17H 4IFDJ 2R93H 5LMNW 2GVBA 2K52A 2VQFL 3CPWA 1FJGL 3HOWH 2PQAB 1PA6A 3PO3G 4GNXC 3I4NG 1CSPA 4L5RC 1P8LA 3NEMA 2Z6KA 4AIMA 1X3EA 4X65L 1BVSA 4YCVA 1EFWA 2AMCB 1EQRA 3OTOL 1H95A 3HOXG 5JEAG 4OX9L 2VS1A 3HOUH 1HNXQ 1P16A 2JEBI 2K50A 2LSSA 1MIUA 4JI8L 1OXUA 4DV2L 3RNUA 3NBHB 1SN8A 4JI0Q 4KHZA 1S3OA 1LM0A 1Y1VH 4R4QA 1Z9FA 1G51A 1X3GA 2YYZA 3GO5A 1V9PA 1O7IA 3CMEA 4A75A 3S1NH 1YJNA 3CCLA 2JA6G 4WJ3M 4LF4L 1FL0A 4GN5A 2UUCL 4OONA 2E8GA 2OTJA 1EUJA 4DV0L 1KD1C 1YBYA 4A3GG 3K80C 4KHPL 3F8TA 4OX9Q 1DGSA 1NBWA 3G71A 1XNRL 1AH9A 3S2DH 3F1ZA 4BXXG 1PH8A 5C44H 1Q7YC 1VQ5A 4DV2Q 1YNXA 4A3BH 1WOCA 2F4VQ 5JJIA 1RL2A 4IO9A 2R6GA 3GD7A 1N36Q 1KRSA 3PGZA 4JG2A 4LF4Q 3HOYG 2VUMH 4GLXA 1LYLA 1NMFA 2UUCQ 1D7QA 3CPFA 3J7ZC 1N33Q 1QZHA 4TVAB 1NJIC 4A3CH 3KJOA 4IPGA 4GKKQ 4DR7Q 2IHEA 4OWXB 4A76A 3FKIH 2B29A 1QVFA 2F52A 1L1OB 4BBSH 1Q1BA 4XIGS 4LFAL 3OW2A 4HJ8A 1HR0W 2AWNA 3KJPA 3CCJA 1JJ2A 1GO3E 1WCMH 4JBWA 4A3MG 4DK3C 1OXSC 5IP7G 2VQFQ 2NZOA 1VQDA 1BKBA 4NPSA 4P75A 1N36L 3D0FA 1XMOQ 3S16H 2YU9H 5C4XG 1A8VA 2DGYA 4DR1Q 4X65Q 4DPGA 2CKZB 2YV5A 1VQNA 2HT1A 2PI2A 1TXYA 3S1RH 2ZJQA 1JE5A 1J6QA 5C4JH 5GQOA 1PH3A 2H5XA 2ZM6Q 1EQQA 1R9TH 4LUVA 4A3IH 1L1OA 3Q8DA 2DUDA 5E7NA 2I0QA 3GTGH 2UXBQ 1YIJA 4JI0L 2I5HA 4B3ML 4DK6C 1G6PA 2JA8H 5IYCH 3CAMA 1U0LA 2Q2UA 1K0RA 3S24A 2BH8A 1VQKA 2MNAA 3F2DA 2F3IA 4DR1L 5IP7H 1HH2P 4DKAC 3CCEA 2CCZA 4DV0Q 5J3BA 5HY6A 1K3RA 2ASBA 2HIVA 4JI1Q 5GAGC 4EQ5A 2MO1A 4KHPQ 1C0AA 4X6AH 2KBNA 1S72A 1JT8A 3HKSA 4A3KG 2ES2A 2I5LX 2PNHA 2B3GA 1SFOH 2UXBL 4L5QA 5JEAJ 4BA1I 2F4VL 2K4KA 4B3MQ 4A3MH 4QJFA 1UE6A 4MZ9A 2YTVA 4LWCA 1B70B 3PUYA 1PHJA 1X9NA 4QY7A 3M4PA 1K8AC 4BY1H 4A3EG 2WFWA 4PZ7A 5M3FH 2BH2A 3FHWA 4JBKA 4JI1L 4DR7L 3G6EA 5GADC 5C0XI 2K5NA 4H02A 2JK8A 4LFAQ 1KL9A 4OWTB 3GTPH 1XTDA 1NTGA 4O2DA 2E2JH 2NVYH 3HOYH 3PO2G 1TWFH 4Y52H 1WJJA 1IZ6A 2JJQA 1CKNA 4P73A 5M3MH 3FP9A 5FLMH 5FJ8G 4GNXB 2KHIA 4IJLA 4A3JG 2Z6KC 1IBML 3UDXA 1AE3A 1K83H 3F2CA 5C44G 1XMOL 2IX0A 3H3VH 1MJCA 3ERSX 4GKJQ 2B63H 4YY3Q 5DLQE 3CC2A 1VQJA 2CFMA 3HKZG 4HIOA 1Q8KA 2ZM6L 2PI2E 3E0EA 4A3JH 4AQYL 1XNQL 1X55A 2UU9Q 1E1OA 2L15A 4A93H 2NVQH 5C3EG 1SE8A 3HKZE 3F2BA 1Y1WH 2N3SA 1C7YA 1YVCA 4JBJA 3RZDH 2IX1A 1JMCA 3CC4A 4B3SL 5IT9c 2WB1E 5ELOA 1WI5A 2UXDL 1IBMQ 2K75A 3GTJH 4X64L 5AJ3L 3PO3H 3I4OA 5EAYA 1IBKL 3PSIA 1PH9A 3AFQA 4JOIC 2XTIA 4YY3L 2OQ0A 2AWOA 3I7FA 3ULPA 4YCWA 1V43A 2WB1G 4FDBA 3EN2A 1KC8C 2KCTA 1XNQQ 4P71A 3M7NA 2UU9L 3S1MH 1TWCH 1PYSB 3J81c 2PQAA 3ULLA 1CUKA 1X56A 3A0JA 3LGJA 4HIDA 4LF8L 1E3PA 4L5SA 4C3HH 4OO1I 4POFA 3RN5A 2UXDQ 4A3BG 1U5KA 4NB3A 2JE6I 1X3FA 5IP9G 1IBKQ 1RIPA 1C9OA 1UE1A 4O0AA 1PH6A 2OTLA 3K81C 3U4VA 3CF5A 2JA7H 1N32L 2VUMG 3DM3A 3DLLA 2HQLA 2K14A 2NVTH 1EOVA 3EIVA 3RR5A 5M5WH 1PFSA 4IPCA 1PYBA 3KDFB 3CXCA 4YWMA 3I4MG 4GNXA 1YHBA 4IPHA 2BA0A 1Q86C 4UP8A 2CQOA 1I5FA 1UE5A 1Y14B 3EBEA 3RN2A 1PH4A 1M1KC 4DV1Q 1Y1WG 2ZTEA 3OYYA 3PUZA 3PCOB 4A3GH 1JJGA 1FVIA 2OQKA 3HOUG 5IE8A 2HIXA 3U58A 2E2HH 4GKJL 1N32Q 4HJ5A 4PZ6A 2R7DA 4LFCL 5M5YH 4IJHA 5GROA 4IOCA 1JJCB 2CWPA 3JC66 4XTCS 4QGUA 4AQYQ 4DNIA 5LMUQ 1VQMA 1Y1VG 3STBC 2LXKA 4GS3A 4JI3Q 3KDFA 1YZ6A 2UXCL 1GKHA 4DV7Q 4JI7Q 4PZ8A 4B3SQ 2Q2TA 4DUZL 4LNQA 4IPDA 1K9MC 4DR6L 4X64Q 4HJAA 5AJ3Q 3PO2H 2JA5H 4UY8C 3M3YH 2RCNA 1EIYB 2R92G 4NXMQ 1VQOA 2HHHQ 2Y0SE 3TS2A 4OO1G 1SR3A 3KYHC 5K36G 3JAMc 3CP0A 3HOZH 2EXDA 3E9IA 5IYBH 4LFCQ 3I4NH 3M4OH 3STBD 4DV5Q 3GTKH 1A62A 3GTLH 1VQEA 5LMUL 1Q1EA 4PG3A 3SGIA 1HZAA 2I5MX 3UE0A 3A5ZB 4JI3L 2KHJA 2D0OA 1HZBA 4A4IA 5IYBG 1HR0Q 3I55A 2UUAL 4LF8Q 4IOAA 5JJKA 2R7ZH 1TWHH 4DV7L 4JI7L 3JAMi 4P72A 4YCUA 3PIOA 4JI2L 3BZCA 3PF4A 2JA8G 1OXTA 3BU2A 3L0OA 5C0XG 4LFBL 4NXML 3KF8B 1I6HH 2N8NA 1OTCA 2A8VA 2JA6H 2JQOA 4DV5L 4JC0A 4DR5Q 3TREA 1HZ9A 3K7AH 5ELNA 3TEHB 2Y0SG 4NXNL 3S2HH 1HR0L 2NZHA 1K73C 4HJ7A 1IXRA 1BBWA 3ULJA 1VQPA 1ASYA 1YEZA 5M3MG 3J81i 1QVCA 3AYHB 3M85A 4DV1L 1IBLQ 1CKNB 4R4IA 2WP8J 3H0GH 1VCIA 1HNZL 4RMFA 1YHAA 1NE3A 4R4CA 1Q46A 2JA7G 4LFBQ 4JOIA 4KI0A 3B6YA 1W2BA 1EWIA 1JB7A 1WCMG 5GAEC 1QVGA 1QZGA 3G4SA 1XPUA 2ALYB 4JI6Q 4MTNA 3MEFA 2FXQA 4UP7A 2D0PA 4ME3A 3E9HA 4DV3L 1MJEA 3FKIG 3NENA 2GVAA 4KLKA 1YI2A 4NXNQ 3PUWA 4B3RQ 1A63A 3CQZH 1I3QH 4R4OA 2UXCQ 4QL5A 3GTQH 1NMGA 3HFZB 2QGQA 2QEXA 2E5LQ 1SLJA 4A3LG 4DUZQ 4DR6Q 2JA5G 1EIFA 3MXNB 4YWLA 1KXLA 5M5XH 1WYDA 2LXJA 1L1OC 2C35B 2RF4A 1HJPA 4LW1A 5M3FG 1OXXK 1PH2A 2ZTCA 2HHHL 3S14H 2R93G 3GTMH 4LF9Q 2BA1A 3NELA 4JI6L 3CCSA 2NN6G 4LF7Q 4TQUS 2E2IH 4DV3Q 3S15H 1ASZA 4A3FH 1WFQA 5C3EH 1VQIA 3L2PA 2UUAQ 1LTLA 5FLXc 1IYJB 1X65A 5IWAQ 3UDGA 1VQ6A 3IRBA 4JI2Q 2IT1A 1PH7A 3ZJYC 2VNUD 1TWGH 3HOVG 3RLOA 1D8LA 5BR8L 2QA4A 4J15A 3TQYA 2VQEQ 1E24A 4P74A 1V1QA 3U4ZA 2YTXA 4DR5L 4LF7L 1XMQL 3L7ZC 5LMNL 3CW2C 4DR2L 1J5EQ 4OXPA 3I56A 4PMWA 1Q12A 1W3SA 3AFPA 4RG1A 4JYAL 1K8GA 3CCVA 2B63G 3PUXA 2ZJRA 2XGTA 1IBLL 3K7UC 5IP9H 4YWKA 1XJVA 1M90C 1UEBA 3ER0A 2ZJPA 1HNZQ 1BBUA 4AH6A 1VQ9A 2Q2IA 2N49A 5FJ8H 2AHOB 2EQSA 4R1JA 4A3DG 2CWAA 2KENA 1VQ4A 5C0XJ 3PIPA 4DUYQ 4DV4Q 2N78A 1UWVA 4DR2Q 1HZCA 1N8RC 3PV0A 3CCUA 4DV6L 4GOPB 4UP9A 3CMAA 4B3RL 1VQCA 4C3JH 1AE2A 3D31A 3HOWG 4A3DH 4JYAQ 2E5LL 1B7YB 2Q2HA 1SROA 4WJ4A 3UE1A 1GM5A 4AYBE 1VQLA 3KFUA 3ICEA 2K5VA 4HIMA 3RZOH 2YTYA 4JV5Q 4EX5A 4B3TQ 2V1CC 3T1HQ 3A74A 1PH1A 1T9HA 4JCVE 4LF9L 3H0GG 2ATWA 4HIKA 4A3KH 4HJ9A 2MQHA 1VQ8A 3W1GA 3H3VI 4C3IH 1E1TA 2OCEA 5H1SE 1I94L 4L5TA 4GN4B 3S1QH 4BXXH 1VQAA 4X66Q 5HGQA 1E7ZA 1PH5A 3KF6A 5IWAL 4JI4Q 4DR4Q 1FGUA 2JEAI 1N9WA 1I50H 3J80c 3W1BA 4JI5Q 2IY5B 4BY7H 1MKHA 2VY3A 3UDFA 5BR8Q 3PUVA 4X62L 1L0WA 2VQEL 1CKMA 1HNWL 3T1YQ 1N34Q 2ZTDA 1XMQQ 3AQQA 3TS0A 5LMNQ 1J5EL 1X6OA 1A0IA 2NN6I 3AEVA 4DAYB 4YHHL 4X66L 4LF6L 4JI4L 1CKOA 2VL6A
chains in the Genus database with same CATH superfamily
3M4QA 1KRTA 1K0SA 2EYMA 1A15A 3I3CA 2MO0A 1VQFA 3BVGA 1OXVA 1TWAH 1YHQA 1FNWA 2JA9A 4IUQA 2EYLA 3CCQA 1LUZA 1SNCA 3A8IE 4Y7NH 5M5WB 4LF5L 1CTMA 2LKVA 2R3ZA 2DNCA 4QIWB 4DV6Q 1VQ7A 4K0KQ 4K5XA 5HGTA 4FVMA 3V2TA 1WD1A 2KCMA 2X69A 4OO1H 3A8KE 3GTOH 5JJLA 2BE5C 2X6LA 3K8AA 4HMJA 5KIXA 5IYDH 4B3TL 3T1HL 3J80i 3U9SA 4RGTA 1YITA 3K6OA 1L2FA 3VR4A 4BBRH 4X3SA 4A93B 3DEOA 4BBRB 4HEDA 1XNRQ 2UUBL 1MD2D 5FLMG 2A1AA 4BY7G 4F87A 4JI5L 3G6JB 3BDOA 3M4OB 5C3EB 2VW9A 4QMGA 3J7A5 3G48A 1TVXA 1GD7A 2K5QA 4BY1G 3NSWA 4F7XA 1N33L 3J81E 2EY2A 1HNWQ 4A3FG 3BJUA 3IKJA 4LF6Q 1VQHA 2H1EA 2UUBQ 4C3HB 4QB4A 5GAHC 1SDFA 1VF7A 1A2UA 2GVBA 1FJGL 4CHTB 1CSPA 3VYUA 1Q8IA 2F0FA 1BVSA 4YCVA 5DM63 2JA5B 2L9HA 1GHJA 1TY2A 4IQZA 2AMCB 1TR5A 4RAUC 4OX9L 2RQXA 1RTOA 1S3OA 1Y1VH 4HTHA 1Z9FA 1X3GA 4A75A 3S1NH 2PZUA 4LJZC 2JXMB 1E2VA 2F0UA 5JPNC 2UUCL 2F03A 3EVQA 1KD1C 4DV0L 1YBYA 3K80C 3F8TA 4OX9Q 1NBWA 1XNRL 1G2SA 3S2DH 5C44H 2K28A 1VQ5A 4A3BH 4IO9A 2R6GA 1G91A 1X32A 3GD7A 1EYCA 1N36Q 2G5DA 3C46A 1KRSA 4LF4Q 1HTLD 4XQQA 3J7ZC 1QZHA 2O5IC 4TVAB 1SNDA 1B53A 1EU4A 2F52A 4LFAL 3OW2A 3KJPA 2CH4W 3CCJA 1JJ2A 1WCMH 5IGCA 1OXSC 5IP7G 2VQFQ 2NZOA 3D0FA 1XMOQ 2FJ2A 2CKZB 3S1RH 4RH6A 4XQJA 1J6QA 1PH3A 1U9RA 1L1OA 3Q8DA 1YIJA 4B3ML 4DK6C 1G6PA 3N52A 3CRKC 5IYCH 4XT3B 5I9PA 2QDBA 4DR1L 2WV6D 4DKAC 3CCEA 1S5ED 4DV0Q 3MWYW 5J3BA 4HSVA 4JI1Q 2MO1A 4RWSC 4KHPQ 1C0AA 1FNUA 2F0PA 2XIWA 1S72A 4H13C 5FO8B 4BA1I 4YIJA 2K4KA 4P2CB 3IL8A 1BOSA 4A3MH 3QO2A 3H94A 1HQMC 4KKUA 5LL6S 2L55A 1B70B 2AQ2B 3HEJA 1TS3A 2KCCA 3S9WA 1X9NA 4BY1H 2WFWA 2BH2A 3FHWA 3SXHA 2EYJA 4B9XA 1QNKA 4G7OC 2IL8A 1XTDA 3GTPH 3K0YA 2A74C 2NVYH 4Y52H 2JJQA 2B8GA 3FP9A 5M9OA 1UUPA 1XMOL 4E6IA 4C2MB 5C6AA 1Z7TA 1Y69U 1S4ZA 1CM9A 4G7HC 5A2QE 5G3LD 1VQJA 2CFMA 2F0WA 1CI3M 4A3JH 1X55A 4A93H 2L15A 2NVQH 5FO9B 1C7YA 4JBJA 2IX1A 4B3SL 1WI5A 1KDAA 4X64L 1EY0A 5IOCA 1IBKL 4B9WA 3PSIA 2WAQB 2PO4A 2XTIA 4JOIC 4C1NI 1SYEA 4YY3L 3I7FA 1MSGA 4PNYA 4XQNA 3EN2A 1S5CD 1KC8C 4P71A 4A3DB 3J81c 4Q5VA 3A0JA 4HIDA 1F9RA 3ITPA 4C3HH 4OO1I 2RKSA 2K33A 3QJYA 1RIPA 1C9OA 1UE1A 4O0AA 4RFBA 1IYVA 5EQ0A 2K14A 1R9TB 3EIVA 1PYBA 3ERQA 5J1ZA 2VB3X 3I4MG 4GNXA 4IPHA 1Q86C 1I5FA 3RN2A 4DV1Q 2B2TA 3OYYA 1Y1VB 1FVIA 1SBBB 5FK9C 5IE8A 4GKJL 2B2WA 3OIQA 3NBIA 4HJ5A 4PZ6A 1N32Q 5M5YH 4IJHA 4QGUA 2NTTA 4AQYQ 1VQMA 2EPBA 3STBC 1TKWB 1QE6A 4J6HA 1O7ZA 1TT2A 1YZ6A 1SMYC 1HFGA 1OO9B 4MTKA 5E1FA 1G2TA 3T16A 4DUZL 2N88A 2KQ3A 3C3LA 1H9RA 4OIKA 1AW7A 2Z9HA 2R92G 3KUPA 2Y0SE 2MHVA 3DMUA 3CHBD 5K36G 4CJ2C 3CP0A 2EXDA 1CZWA 3I4NH 1ZYRC 4DV5Q 3SGIA 3S1MB 1HTPA 5IGBA 5C4ZA 2K7VA 4JI3L 3ND8A 5IYBG 1HR0Q 4DV7L 1I4GA 4JI7L 4YCUA 5K5PA 4PV1C 4RKLA 3BZCA 1U4PA 3PF4A 4J1MA 3D6CA 2N8NA 1HQRD 1HUMA 3S1RB 5C4XB 1PZKD 1LTTD 3W3AA 4NXNL 3S2HH 4FYDA 2NZHA 4HJ7A 1IXRA 4R9WA 1VQPA 1WTOA 1HXYD 3J81i 3AYHB 5J22A 4R4IA 3DHQA 3AB9A 1VCIA 4RMFA 1YHAA 1NE3A 4LFBQ 1LTSD 3B6YA 1EWIA 2B39A 4RA8A 1QZGA 2ALYB 4JI6Q 2E2JB 2RSNA 4UP7A 2RDGA 4IUTA 2B2YC 3GTQB 4NXNQ 1YI2A 4ODGA 3GTQH 2QGQA 2QEXA 4EQNA 3I4MB 4N8X1 4GOPB 1GHKA 2C35B 2LS01 5I6WA 2HHHL 2R93G 5A2QL 1PTOF 3MFYA 5E3FA 2NN6G 4TQUS 2L4NA 1WTVA 1B1ZA 1VQIA 3L2PA 5FLXc 1IYJB 1PZID 2G9HD 1SE3A 2F1MA 2PZTA 3IRBA 4OL7A 2IJ0A 2IT1A 1PH7A 1B9MA 3HOVG 1D5XC 5BR8L 2K32A 2OF1A 4P74A 2YTXA 2LMCB 4DR5L 1XMQL 3L7ZC 4DR2L 2EY5A 1Q12A 5JOBA 3K7AB 1DYQA 3AFPA 4RG1A 4JYAL 2XGTA 1HFNA 4HSPA 1UEBA 3ER0A 4FXKC 1LTID 1HNZQ 5CBEE 4R1JA 2A6ED 2EDGA 1GUGA 1JB3A 5IGDA 2N78A 2HCCA 3CKIB 4B3RL 4C3JH 4A3DH 3D31A 3HOWG 1GUOA 1B7YB 4WJ4A 1SROA 3HG9A 5C4HA 2LFNA 4RHSA 4WFN3 4PMBA 1E0BA 3DXJC 4ZKCB 3T1HQ 1PH1A 4LF9L 2FMCA 1DM0B 4ZYSA 2ATWA 4HIKA 1WTHA 4ME5A 3W1GA 4C3IH 3Q23A 3H3VI 2G9DA 2E2IB 1I94L 3KF8A 1DOMA 1V1PB 4BXXH 4WORA 4JI4Q 4DR4Q 4V0BA 2EJGC 4JI5Q 5C3XA 2C5CA 5I2XA 3L3OC 2XNAC 2VQEL 1CKMA 1N34Q 2D5DA 1I4HA 2SEBD 1RD9D 3S16B 2AQ1B 5HURA 1KABA 4DAYB 1KDCA 1GOZA 2VL6A 3HOXH 5IYDG 4QUCA 3VR3A 3HOXB 1STGA 4A3LH 1FJGQ 1HRJA 2NVXH 4G7ZC 2EYFA 4DUYL 4DV4L 1PV4A 1VS0A 1TS4A 4R8NA 1SSOA 4C3JG 1UE7A 4FO2A 3C2PA 1VQBA 5JPMC 2MP1A 3FPUB 1XPOA 1F9SA 5CR3A 2NZ1D 2F0OA 4JV5L 1H9SA 1XPRA 1HUNA 1NUCA 2WKCA 3UI2A 1D1IA 1D5ZC 3HOVH 4K6LA 3M7GA 1CSQA 5KRUA 3OOCA 1AZQA 3CC7A 3S1QB 1QUQB 4DR4L 2RHSB 3W2DA 4IFDG 1IKLA 1XXGA 1GVPA 2CHBD 4GOPA 1EY6A 2R7ZG 4QCLA 2A69D 1N34L 5EBDA 5M3MB 1U4LA 1S5DD 3K0XA 1JC7A 3K57A 2AKWB 5G3LF 4CDEC 1MHWC 1PDQA 5CBAE 2PMZB 1TS5A 3UDIA 1HA6A 1HNXL 1IL2A 1VMPA 3K59A 4IFDI 3TN2A 4S3SA 3VA5A 2A69C 4IFDJ 3MAQA 1GUTA 1TWAB 3HOWH 3CPWA 1UAPA 4K14A 2PQAB 1PA6A 3PO3G 4BS9A 1P8LA 1L0YB 2KEDA 1T5EA 2AUJD 2EY6A 3R3OA 3J7AV 5CV9A 5F2DA 4ULLA 1K8MA 4MHEA 3HOXG 2N55A 2VS1A 1HNXQ 1P16A 2K50A 4JI8L 1OXUA 4DV2L 4I65A 3SK4A 1SN8A 2NVYB 4R4QA 2YYZA 1XX8A 3CMEA 5EJWA 4WJ3M 2A6HD 2JA6G 1E2ZA 2K04A 1SYGA 1CZGA 5C5MA 4GN5A 1BO0A 2OT2A 1JOQA 2I07B 3L9AX 1EUJA 1SYFA 3P1HA 4M1UB 4PQXA 4KHPL 1QOHA 5T1GA 1U4RA 1Q7YC 3D4RA 2A6HC 2F4VQ 1TU2B 2Z4HA 3X3MA 3ND9A 3JAME 3HOYG 2VUMH 1M8AA 1NMFA 2UUCQ 1SYDA 1PRTC 3GTKB 2QDLA 3VR2A 3KJOA 4DR7Q 2IHEA 1QVFA 1ILPA 5LL6X 1L1OB 1TQOA 3HKZB 1BCPC 2F0QA 4DA2A 2K1BA 4HJ8A 2AWNA 1ENAA 3SK5A 3CQZB 4DK3C 1K83B 1HPCA 1N36L 3AMUA 1PRTD 2A73B 1A8VA 4DR1Q 3MXUA 3I4LA 1EFID 1M4VA 4DPGA 3T13A 2HT1A 5C4JH 4KN4C 1RCVD 5GQOA 3E6ZX 1SE4A 4IZ8A 1R9TH 2NYZD 4FNFA 5C4JB 4HAEA 5E7NA 2I0QA 1Z6HA 4JI0L 1PFBA 4RCOA 3G7LA 3CAMA 1O78A 1U0LA 3S24A 4RGMA 3QIAA 2F3IA 4KJNA 4DGZA 2L1BA 1MSHA 4KY5A 4UHVA 2ASBA 5GAGC 1LTBD 4X6AH 1QWYA 3N6RA 4A3KG 2JA6B 3MXPA 4IUVA 2PQEA 4PMCA 5JEAJ 2F4VL 2SNMA 4QJFA 1FD7D 1UE6A 3SHLA 1DD2A 3WOEA 1LTAD 1MBYA 1PHJA 2J0TD 1PTOB 2A68D 3Q22A 3LX0A 3D4WA 2PNRC 3H3VC 5JVG3 4PZ7A 4JBKA 4DR7L 4LMQD 3G6EA 2KCNA 4H02A 1KL9A 3QB3A 1CHQD 2B8FA 1TWFH 1EU3A 1WJJA 1IYUA 4P73A 5FLMH 1H9SB 1V1PA 2ZXOA 3QWNA 4IJLA 4A3JG 2Z6KC 2F4IA 3F2CA 1D6EC 5KYIA 3H3VH 5KNCA 4GKJQ 4YY3Q 5D14A 3HKZG 4XXEA 2ZM6L 5CV6A 4AQYL 1XNQL 3OW7A 2F3WA 1HHVA 3VA7A 1SE8A 1UEAB 3DUZA 3Q0AA 3T53B 1ICWA 2B2YA 2JP1A 5IT9c 5ELOA 3SEBA 3GTJH 5AJ3L 3PO3H 3I4OA 5EAYA 3C1FA 1PH9A 4BY7B 3QOLA 2OQ0A 4FDBA 2V4DA 1LACA 3MHBA 1ZKOA 1XNQQ 3M7NA 2B2UA 1A3TA 5FOBB 1TIID 2NB0A 1LV9A 3OMGA 1ESRA 3ULLA 2R7ZB 4RKBA 1E3PA 3A7AB 3K5NA 1PFMA 4A3BG 4JK1C 4CJ1B 5K36H 1IBKQ 1BNZA 5BN3A 1PH6A 1S5FD 3U4VA 1I4RA 3CRLC 3CF5A 1YNJC 3DM3A 3DLLA 2BOSA 3MC0B 5M5WH 3WOFA 1EL0A 4IPCA 5E4WC 1B2TA 1YHBA 5CMDA 5C5LA 2RA4A 3EBEA 1Y14B 1PH4A 1J8IA 1CA5A 3TMEA 1JJGA 2AUKA 2R7DA 4LFCL 3QG1A 4XT1B 1Y1VG 4ZK9B 4A3JB 4AYBB 5IGEA 4GS3A 1GKHA 3J7YW 2Q2TA 2QILA 4LNQA 1WTRA 4DR6L 5E4XA 4X64Q 3PO2H 1SNMA 3M3YH 3MXNA 2B2WC 3KBXA 4NXMQ 2HHHQ 4EQPA 2EJMA 3JAMc 3HOZH 4LFCQ 3M4OH 3GTKH 1A62A 5KEEA 4PG3A 5DNFA 3FVQA 1CA6A 2KHJA 4FF4A 2R92B 3JAMi 4P72A 2KVMA 3PIOA 4JI2L 4XYOA 1IHZA 2ICIA 1SE2A 4O1NA 1EWCA 4V190 3KF8B 1SJHD 1SAPA 1OTCA 2A8VA 4DV5L 4JC0A 3TREA 1BBWA 2NWGA 4KD3A 5I6YA 2RDFA 3M85A 1IBLQ 3OHXC 3OMCA 2HDMA 3NUCA 4R4CA 5JAVA 4JOIA 5IGFA 1QG7A 1JB7A 2NN6H 3FKIB 1XPUA 4MTNA 2WACA 2L12A 5JJZA 1F77A 4DV3L 3K5MA 1UNSA 3OPOA 1DOLA 2EJFC 2ENBA 1CFMA 1A63A 2KJXA 1TY0A 2UXCQ 1YNND 5CGKA 2F3VA 4A3LG 2XRQD 1JCKB 1B9NA 4YWLA 1KXLA 3BDCA 4BWGB 2I46A 4U68A 2BA1A 3CCSA 4X3KA 2VB2X 2F0DA 3HOUB 1SNOA 2VXWA 3UDGA 4A3GB 3I90A 1LT3D 2F0JA 4JVZA 4UAIA 3T4AC 3TQYA 1A6XA 3DM1A 1E24A 2WIIB 5AFWA 4IUPA 1J5EQ 3I56A 4PMWA 4DAPA 1W3SA 5L37A 1K8GA 1G8ZD 2ZJRA 1U4MA 5IP9H 4YWKA 2C9OA 1BBUA 2NBFA 4AH6A 2Q2IA 5EPLA 4NP5A 1DOKA 2L5TA 1VQ4A 3GTLB 1ZXTA 1UWVA 1ML0D 1HZCA 4NKLA 1I6VC 3PV0A 2EVBA 4OEMB 3CCUA 4DV6L 4UP9A 3M4YA 1F2LA 1NNXA 4DFAA 1H9MA 2Q2HA 4AYBE 4LAAA 4EX5A 4B3TQ 3HS0C 2K01A 1T9HA 1EOTA 3LWEA 3V05A 3MZ5A 2CH4A 3BZDB 4DXFA 5H1SE 1O7LA 5FO7B 2F0NA 2JN4A 2CQAA 3AU7A 3NWTA 4X66Q 5HGQA 1E7ZA 2WKDA 3VYTA 5IWAL 2KHSA 2ZXPA 3J80c 2IY5B 2E2DC 5EGTA 3TP6A 1AP0A 2PPBC 5BR8Q 2ZT9C 2RDHA 3AQQA 3TS0A 1FR3A 1CT1D 4CBVA 1KNEA 2SNSA 2Z6BA 4POGA 4K8JA 2PMZE 5C4XH 2D62A 4X62Q 3PO2B 2OWOA 1B50A 2O5JC 3HGBA 4AYBG 2WAQE 4DF7A 3SVMA 3KLWA 1Y8PB 4C1NK 4MIUA 4NDXA 1G291 3R93A 3TRZA 3GDEA 1K28A 1QUQA 4YHHQ 4FF2A 2R92H 1JICA 2KA7A 4JI8Q 4ALPA 3RMHA 1C48A 1XTCD 4C3JB 2A19A 5EBCA 2M9VA 2F0EA 4LF5Q 2EIFA 4DR3L 5IY0A 1BF4A 4A3IG 1KIXA 4DAMA 1I94Q 4K0KL 3EA6A 3O13A 2WB1B 3CCMA 4C3IB 4R4TA 4CKEA 4UPAA 4GLVB 4BBRG 1YJ9A 1EYAA 1FYCA 2XWJB 2ICEC 4GLAC 1PTOD 1E22A 4MNOA 1KAWA 1SMXA 4QIWE 2CVRA 3T1YL 3CD6A 4DR3Q 1BQQT 2K5HA 3Q6SA 5IGGA 1Q82C 3A54A 4QF4A 4K2KA 4C2MH 4CGYB 1TWCB 4GKKL 4A3CG 5COYA 5CV8A 4GN3B 4LUZA 3T56B 2WAQG 2E76C 1KHIA 5KNBA 3GQBA 5M5YB 3H91A 3IAYA 1JWMD 1EZ8A 3I2ZA 3MA2B 2R7FA 1GUNA 2DN8A 2NTSA 3WWVA 5I9OA 2MPMA 2F0IA 3VDYA 1PTOC 2NVQB 4C3HG 4IURA 3BVZA 2DY8A 4GNXC 4A3KB 2PW5A 3NEMA 4WRDA 1X3EA 1Y1WB 3FPPA 3DEPA 2F0VA 5A35A 4ZCKA 1JOKA 3NQTA 5JEAG 3FDTA 2SDFA 3HOUH 2JEBI 1ET6A 1RJTA 2J7ZA 4M8AA 2LSSA 1MIUA 2FFKB 3E0JA 3KK7A 3RNUA 1G51A 3GO5A 2EXZA 4ZRZA 2IX3A 1YJNA 3CCLA 1XWEA 4LF4L 1FL0A 4OONA 2E8GA 2OTJA 3HOVB 4A3GG 3JAML 4OHJA 3RZOB 3G71A 1D1KA 1AH9A 4ABNA 1O7YA 5M5XB 4OELB 4BXXG 4C56C 4DV2Q 1ONLA 3K5LA 1WOCA 1RL2A 1DCZA 3PQIA 1BR9A 3PGZA 4GLXA 3NXWA 1NSNS 3EROA 2F0LA 3LNNA 4TSSA 1NJIC 4A3CH 4IPGA 4OWXB 2B29A 3J80L 4BBSH 1Q1BA 1B3QA 5DAUA 5J39A 3HOYB 3MEHA 3P75A 2TMPA 3R8BA 1BDOA 4DAVA 1ILQA 5BN5A 4A3MG 1VQDA 4NPSA 3HOWB 2YU9H 3FMCA 2DGYA 2FMMA 1EY8A 4CDCC 4X65Q 2OXPA 4B08A 1TXYA 1KAAA 2X6GA 1V1OA 1JE5A 1PFNA 2ZM6Q 1EQQA 3IFDA 4LUVA 2PCFB 4A3IH 1QB5D 2DUDA 2AQ3B 3GTGH 1X3PA 2LY7A 1QJOA 2I5HA 2JA8H 1HA5A 1D5MC 1VQKA 2MNAA 5D3DA 1RTNA 2WINB 4IUNA 2CCZA 5HY6A 2ZXRA 1K3RA 1EYDA 5C3WA 1LTRD 1STAA 3E3XA 1JT8A 3HKSA 2I5LX 2PNHA 4ZUIA 2UXBL 4A3EB 4L5QA 3S17B 4RHRA 4X3UA 4TKOB 1EY7A 2RSOA 1ENCA 4MZ9A 3ZYYX 2BCOA 5CV4A 4CKBA 5M3FH 1SNQA 4JI1L 1I4XA 5C0XI 1RDPD 2K5NA 2K5WA 2JK8A 3KLSX 4LFAQ 3NPPA 4OWTB 2E2JH 1NTGA 3PO2G 4DK0A 4GNXB 2F0MA 3FEWX 5FJ8G 3E5SA 1AEXA 1PRTB 1K83H 4FF3A 3K58A 1MJCA 5DLQE 1NR2A 3CC2A 4HIOA 1Q8KA 2PI2E 2CW0D 2UU9Q 5JEAH 1A3UA 5C3EG 3GTMB 3HKZE 4EQOA 2L11A 3NTHA 1IBMQ 3U9OA 1KDBA 5LHY1 5FKAC 3ULPA 2AWOA 3KLRA 2K05A 4YCWA 1V43A 2WB1G 1CK1A 1LTGD 4IALA 3GTOB 1TWCH 1PYSB 1XYIA 1X56A 3LGJA 1K3BC 1K8OA 1TS2A 2DY7A 4R8IA 4POFA 2UXDQ 3VR6A 1U5KA 4NB3A 2JE6I 5IP9G 3VYRA 1Q3LA 3WDNA 2JA7H 1SEBD 2VUMG 3V96A 2HQLA 2NVTH 1EOVA 1DZ1A 2F0GA 2JA7B 1PFSA 4A3BB 4KJOA 2DNEA 1ET9A 4KK7A 4YWMA 1LT5D 2CQOA 1M1KC 1Y1WG 2ZTEA 4K2LA 4A3GH 5EKLA 3HOUG 2E2HH 5ELEA 1STEA 1I3QB 2F0KA 4IOCA 5GROA 4FF1A 1JJCB 2CWPA 3JC66 4XTCS 2B2VC 2MJ8A 2LXKA 4JI3Q 3KDFA 3S14B 3TSSA 2UXCL 4DV7Q 4JI7Q 4PZ8A 4B3SQ 2EZVA 3D3RA 4IPDA 4HJAA 3H09A 2KUMA 2JA5H 1BXTA 4UY8C 2RCNA 1EIYB 4HMIA 1VQOA 5JVH3 1SR3A 3KYHC 3E9IA 1I50B 1EY9A 3GTLH 1RF2D 1C4QA 1VQEA 1HZAA 2I5MX 1TWHB 3A5ZB 1TWGB 3HZXA 4IOAA 2D0OA 2H4OA 2R7ZH 1TWHH 3R2IA 3BS1A 4KY7A 4HR7B 2XRSD 3BU2A 1STYA 4NXML 4DNTB 1BBXC 1I6HH 3TP8A 1JWSD 4KV6A 4DK1A 4HN7A 1VMCA 1WTXA 1A3VA 1STHA 5ELNA 2Y0SG 3TEHB 4A3MB 3NBHA 2FHTA 1K73C 1FNVA 4XDXA 4Y7NB 4Q0FA 3ULJA 3TZDA 4K6DA 2BE5D 1ASYA 3GTGB 4DV1L 4BY1B 2WP8J 1HNZL 5IT9L 3I72A 2JA7G 1Q46A 2JSOA 1W2BA 1WCMG 1TWFB 5NUCA 3MEFA 3RD4A 2M00A 4ME3A 2D0PA 2QEJC 3E9HA 1IL8A 1W6KA 2PW7A 3NENA 2GVAA 3PUWA 2K5DA 4QL5A 3HFZB 2SOBA 4DUZQ 2R93B 4DR6Q 2JA5G 1EIFA 1WYDA 2LXJA 1L1OC 4X3TA 4KD4A 3PIO3 1JOOA 1B3AA 2Z1CA 4LF9Q 3K5OA 4JI6L 4DV3Q 4A3FH 5C3EH 2UUAQ 2Q8RE 1X65A 4TRDA 1B44D 1VQ6A 4JW0A 4JI2Q 2E75C 4N9TA 1PRTF 3ZJYC 2VNUD 3BYYB 1D8LA 1KNAA 2QA4A 4J15A 2VQEQ 2PYKA 1STNA 4CKCA 1V1QA 4Z9CB 4LF7L 4RGNA 3BDLA 3CW2C 4J8QA 1SJED 3LWUA 5I2YA 2QF7A 5CORA 3CCVA 3NQIA 1ESFA 2J4XA 1IBLL 2HCIA 1XJVA 1M90C 1AFPA 4LK1C 1VQ9A 2N49A 2AHOB 4A3DG 1KLUD 2Y0SB 1HCZA 1YNJD 4DR2Q 4DAYA 4I7AA 1VQCA 3R2TA 1EY4A 3UE1A 1GM5A 1VQLA 3MVVA 2K5VA 3URYA 2YTYA 4JV5Q 3A74A 3NTKA 4JCVE 2E74C 3H0GG 3ONAB 1SYCA 3P7JA 5CC4A 2MQHA 4A3KH 1GUSA 1EWHA 1E1TA 2OEOA 1PTOH 4L5TA 4UDUC 3M3YB 5DEHA 2L0CA 1VQAA 1D2BA 1DONA 5ELFA 1EY5A 1FGUA 2JEAI 2HDLA 3W1BA 2XN9C 4X62L 1F2MA 3DWAA 1L0WA 1HNWL 2ZTDA 1EIHA 4QUFA 4EVOA 5LMNQ 1J5EL 1X6OA 3SK8A 3NHHA 3MXGA 3X3NA 1JQYD 1CKOA 3HRZC 4JI4L 2DJFC 3KF6B 1S40A 2QKIC 3U50C 1STBA 3HOZG 3KOJA 3D4DA 3EQLC 4L6TB 2RHQB 1QCBD 2Z8LA 2Z0SA 4BBSG 2IHFA 1I4QA 1Z47A 1JE4A 1NY4A 1X54A 2EY1A 3RLNA 3A5UA 3FRPB 4ZQ3A 3M9BA 1PVOA 4IFDH 1B8AA 1L0XB 3H15A 1YJWA 4QQBX 4FXGC 5IYCG 3NP8A 2ID0A 4A93G 3W5OA 3S1NB 4LUOA 2KECA 4XYQA 2BDOA 3BZKA 3GV6A 1BUVT 4APVA 4O42A 3I4MH 3PIP3 2F0HA 3S2DB 1EQVA 4OWWB 5T1IA 4EGVA 2IWHA 1VQGA 4BA2I 1SRUA 1KQSA 1EYGA 2VZAA 1GXDC 3OTOQ 1B4OA 2EOTA 3ICEA 3CCRA 3RUZA 4GOPC 3P20A 2MFIA 2D2CC 2HUGA 3PF5A 1RHPA 3OSOA 4JBMA 3DWPA 3J81j 1EZ6A 1LT6D 4H0LC 4KKSA 3BYTB 1Q81C 1WCMB 3RLFA 4A3EH 2GN5A 3S17H 2R93H 5LMNW 2K52A 1LO5D 2VQFL 3I4NG 4L5RC 1MI2A 2Z6KA 4AIMA 4X65L 1AZPA 3PO3B 2EE1A 2F0SA 1EFWA 4F88A 3EFXD 1EQRA 3QOJA 3OTOL 3HOZB 1H95A 3TBIB 4RGOS 4ZAIA 1PXUA 4OIJA 5FLXE 3F2UA 5ELDA 5DM73 3NBHB 4JI0Q 4KHZA 2QCPX 1LM0A 1V9PA 1O7IA 1LLRD 3TDQA 2XSCA 3OWFA 1EQTA 1Y8NB 2EYHA 3SR1A 2B2UC 3DWQA 1S5BD 1C8CA 3A56A 3KBGA 1RODA 1DGSA 3F1ZA 1PH8A 4KHVA 1YNXA 5JJIA 1DXMA 5EKIA 1YNNC 4JG2A 3PMFA 1F2ZA 1LYLA 1D7QA 4FXDA 3CPFA 1N33Q 2KEEA 4K5VA 4GKKQ 3J7AF 4A76A 4L63B 5KGUA 3FKIH 4XIGS 3GTPB 1HR0W 1PZJD 1GO3E 4JBWA 1JR0D 1QILA 2HQEA 1BKBA 4P75A 3S16H 5C4XG 3A7LA 1BCPB 1VQNA 2YV5A 2PI2A 2ZJQA 3I73A 2H5XA 1VDZA 2NVTB 1Y8OB 4JPBW 2UXBQ 1GUWA 3I4NB 2K6AA 3SE0A 1WVLA 2Q2UA 1K0RA 3H6MA 2BH8A 3F2DA 4DN4M 1HH2P 5IP7H 1II3A 1T5XD 2Z4IA 3NWSA 2HIVA 5BN4A 4EQ5A 2XWBB 5CYUA 2KBNA 1IW7C 2ES2A 1GJXA 4G57A 2B3GA 1SFOH 2TSSA 4B3MQ 1KLGD 2EYPA 4IN3A 2YTVA 3NTIA 1RKNA 4LWCA 3PUYA 4QY7A 3M4PA 1K8AC 4A3EG 1O80A 1F2YA 2DJGC 5GADC 2KOLA 2A5HA 2P5ZX 1E2WA 3HOYH 4O2DA 2JYOA 1IZ6A 1JWUD 1CKNA 1NAPA 5M3MH 2KHIA 3VR5A 1IBML 3UDXA 1AE3A 5C44G 2B63B 4KY6A 2EYOA 2IX0A 3OIPA 1MGSA 3ERSX 2B63H 4ZKBB 3E0EA 1BCPF 3I8ZA 1E1OA 4A3IB 5KYLA 3F2BA 1PLFA 1Y1WH 4DNRB 2N3SA 2D9UA 4OGQC 1YVCA 3RZDH 1JMCA 3CC4A 1LT4D 2WB1E 2UXDL 5EPKA 2K75A 3I70A 5CV7A 1KTKA 1H9JA 3AFQA 4C3IG 4KMUC 2F0TA 2JA8B 1W6JA 2KCTA 3S1MH 2UU9L 2PQAA 1CUKA 1WTQA 4LF8L 1NR4A 4L5SA 1FGBD 3RN5A 2HD3A 4ID6A 1X3FA 4IUUA 2A6EC 5FLXL 2OTLA 1VF5C 3K81C 1N32L 2O4XA 5IODA 3RR5A 1EIGA 3SDZA 3GP7A 3KDFB 4NMZA 3CXCA 3J80E 2BA0A 5M3FB 4UP8A 3CU7A 1J9OA 1UE5A 2IPKD 2XVSA 3PUZA 3PCOB 5I4DA 1LABA 2OQKA 2HIXA 3U58A 1QNUA 3I91A 4H7BA 3KLSA 3D8GA 2NUCA 5TSSA 4DNIA 5LMUQ 1WD0A 2YU9B 4N8FA 1JORA 3TZUA 4GZYC 1AN8A 4RCNA 1K9MC 3IFTA 5AJ3Q 3GV3A 3TS2A 4OO1G 4DXGA 4KN7C 1R4PB 5IYBH 5CV5A 4ILWA 3EJIA 2B2TC 3STBD 3T51B 1WTPA 5IIFA 3BG3A 5LMUL 1Q1EA 3UE0A 1SMYD 5JJKA 1HZBA 4K8IA 4A4IA 2UUAL 3I55A 4LF8Q 1Q90A 2RCFA 1CHPD 3MFGA 1NCVA 4CDDC 2JA8G 1OXTA 3L0OA 3MTSA 4MN3A 2Q8TA 5C0XG 4LFBL 1ZYRD 4KKTA 2GA4B 2JA6H 2JQOA 4DR5Q 1HZ9A 4KTAA 3K7AH 1F9QA 1HR0L 4G4KA 1IW7D 3H0GB 1SYBA 1YEZA 5M3MG 1QVCA 1CKNB 1SNPA 3H0GH 1SXTA 3C1EA 4KI0A 2E2HB 5GAEC 4ZUJA 1QVGA 3G4SA 1R4QB 1CQFA 2FXQA 1MJEA 3FKIG 2MUYA 4KLKA 1CQVA 4B3RQ 1IKMA 2QW7A 1I3QH 1V8QA 3CQZH 4R4OA 1NMGA 2PZWA 2E5LQ 1SLJA 3A55A 1SFOB 3NK9A 4H44C 3MXNB 1I4PA 5M5XH 5M3FG 4LW1A 2RF4A 1HJPA 1OXXK 1PH2A 2ZTCA 3S14H 1F9PA 3GTMH 5ISRA 3NELA 5ELBA 4LF7Q 2E2IH 5D65A 3S15H 1ASZA 4DU9A 1WFQA 4NW2A 3D6WA 3HP3A 5D3IB 1LTLA 3S15B 1H9KA 5IWAQ 2FINB 3TP5A 2BDNA 4BBSB 4L8JA 1TWGH 3RLOA 3SK6A 2RBMA 3U4ZA 5LMNL 1X3QA 4U673 4OXPA 4K5WA 4FP5D 1EEFD 5C44B 2B63G 2NVXB 3PUXA 3K7UC 1WTWA 3RZDB 2ZJPA 2O2LD 5IT9E 2MGSA 3NE5B 5FJ8H 2EQSA 2CWAA 1PYWD 2KENA 5C0XJ 5ELCA 3PIPA 3Q24A 4DUYQ 1ZEQX 4DV4Q 2M2LA 4I7ZC 1G6ZA 1N8RC 4CJ0B 4CDFC 3CMAA 1AE2A 4JYAQ 2E5LL 1PMRA 3KFUA 2A68C 4HIMA 3OWEB 3RZOH 5KNDA 5EKKA 2V1CC 2K03A 4N9PA 3VYSA 4HJ9A 1A2TA 1VQ8A 2OCEA 3S2HB 5EPJA 2Q8IB 3TP7A 4GN4B 3S1QH 1BCPD 4WJWA 3A8JE 1PH5A 3KF6A 2RVLA 4HCSA 3GTJB 2VUMB 1N9WA 1I50H 2CW0C 4ZLTF 4BY7H 2R61A 4A3FB 1DJRD 1MKHA 2VY3A 3UDFA 5C0XH 3PUVA 3J81L 1EEID 4HCEA 3T1YQ 2IW3A 1XMQQ 3QR8A 4F8MA 1A0IA 1ENFA 1ICFB 2NN6I 3AEVA 2B2VA 4YHHL 4X66L 4LF6L 3BVMA 1I6HB
chains in the Genus database with same CATH topology
3M4QA 3HOXH 5IYDG 1KRTA 3KF6B 1S40A 4POGA 3U50C 3HOZG 2PMZE 2MO0A 5C4XH 1VQFA 2D62A 3KOJA 1OXVA 1TWAH 1YHQA 4A3LH 4X62Q 2JA9A 2OWOA 1FJGQ 3CCQA 2NVXH 1LUZA 2RHQB 4Y7NH 4AYBG 2WAQE 4LF5L 3KLWA 4DUYL 4DV4L 1PV4A 2Z0SA 4BBSG 1G291 1VS0A 1Z47A 2IHFA 1NY4A 4DV6Q 3TRZA 3GDEA 1VQ7A 4K0KQ 1X54A 3RLNA 1UE7A 1QUQA 4YHHQ 3A5UA 1VQBA 2KCMA 3GTOH 5JJLA 2R92H 3M9BA 1PVOA 1B8AA 1XPOA 4JI8Q 3H15A 4ALPA 1YJWA 4QQBX 3K8AA 5IYCG 2ID0A 5IYDH 4JV5L 4A93G 3W5OA 4B3TL 3T1HL 2A19A 4LUOA 3J80i 1XPRA 1YITA 3BZKA 4LF5Q 2EIFA 4DR3L 5IY0A 1L2FA 4A3IG 1KIXA 4DAMA 4APVA 3HOVH 4BBRH 1I94Q 4K0KL 1CSQA 3I4MH 3CC7A 1XNRQ 1QUQB 3CCMA 4DR4L 2UUBL 4OWWB 5FLMG 2A1AA 1VQGA 2RHSB 4BA2I 4BY7G 4R4TA 4JI5L 1SRUA 4IFDG 4UPAA 4GLVB 1KQSA 4BBRG 1YJ9A 1EYGA 2VZAA 1GVPA 4GOPA 2R7ZG 4GLAC 4MNOA 1E22A 4QIWE 1KAWA 1SMXA 2VW9A 3CCRA 3T1YL 1N34L 4DR3Q 3CD6A 3J7A5 3G48A 2K5HA 1GD7A 3K0XA 4GOPC 4BY1G 2AKWB 1Q82C 1N33L 2MFIA 3PF5A 4C2MH 4GKKL 4A3CG 1HNWQ 3OTOQ 4JBMA 4GN3B 4LUZA 3BJUA 2WAQG 4A3FG 1KHIA 4LF6Q 3UDIA 1VQHA 3J81j 2UUBQ 1HNXL 1IL2A 3I2ZA 2R7FA 1Q81C 3WWVA 4IFDI 3RLFA 3VDYA 4A3EH 2GN5A 5GAHC 3S17H 4IFDJ 2R93H 5LMNW 2GVBA 2K52A 2VQFL 3CPWA 1FJGL 3HOWH 2PQAB 1PA6A 3PO3G 4GNXC 3I4NG 1CSPA 4L5RC 1P8LA 3NEMA 2Z6KA 4AIMA 1X3EA 4X65L 1BVSA 4YCVA 1EFWA 2AMCB 1EQRA 3OTOL 1H95A 3HOXG 5JEAG 4OX9L 2VS1A 3HOUH 1HNXQ 1P16A 2JEBI 2K50A 2LSSA 1MIUA 4JI8L 1OXUA 4DV2L 3RNUA 3NBHB 1SN8A 4JI0Q 4KHZA 1S3OA 1LM0A 1Y1VH 4R4QA 1Z9FA 1G51A 1X3GA 2YYZA 3GO5A 1V9PA 1O7IA 3CMEA 4A75A 3S1NH 1YJNA 3CCLA 2JA6G 4WJ3M 4LF4L 1FL0A 4GN5A 2UUCL 4OONA 2E8GA 2OTJA 1EUJA 4DV0L 1KD1C 1YBYA 4A3GG 3K80C 4KHPL 3F8TA 4OX9Q 1DGSA 1NBWA 3G71A 1XNRL 1AH9A 3S2DH 3F1ZA 4BXXG 1PH8A 5C44H 1Q7YC 1VQ5A 4DV2Q 1YNXA 4A3BH 1WOCA 2F4VQ 5JJIA 1RL2A 4IO9A 2R6GA 3GD7A 1N36Q 1KRSA 3PGZA 4JG2A 4LF4Q 3HOYG 2VUMH 4GLXA 1LYLA 1NMFA 2UUCQ 1D7QA 3CPFA 3J7ZC 1N33Q 1QZHA 4TVAB 1NJIC 4A3CH 3KJOA 4IPGA 4GKKQ 4DR7Q 2IHEA 4OWXB 4A76A 3FKIH 2B29A 1QVFA 2F52A 1L1OB 4BBSH 1Q1BA 4XIGS 4LFAL 3OW2A 4HJ8A 1HR0W 2AWNA 3KJPA 3CCJA 1JJ2A 1GO3E 1WCMH 4JBWA 4A3MG 4DK3C 1OXSC 5IP7G 2VQFQ 2NZOA 1VQDA 1BKBA 4NPSA 4P75A 1N36L 3D0FA 1XMOQ 3S16H 2YU9H 5C4XG 1A8VA 2DGYA 4DR1Q 4X65Q 4DPGA 2CKZB 2YV5A 1VQNA 2HT1A 2PI2A 1TXYA 3S1RH 2ZJQA 1JE5A 1J6QA 5C4JH 5GQOA 1PH3A 2H5XA 2ZM6Q 1EQQA 1R9TH 4LUVA 4A3IH 1L1OA 3Q8DA 2DUDA 5E7NA 2I0QA 3GTGH 2UXBQ 1YIJA 4JI0L 2I5HA 4B3ML 4DK6C 1G6PA 2JA8H 5IYCH 3CAMA 1U0LA 2Q2UA 1K0RA 3S24A 2BH8A 1VQKA 2MNAA 3F2DA 2F3IA 4DR1L 5IP7H 1HH2P 4DKAC 3CCEA 2CCZA 4DV0Q 5J3BA 5HY6A 1K3RA 2ASBA 2HIVA 4JI1Q 5GAGC 4EQ5A 2MO1A 4KHPQ 1C0AA 4X6AH 2KBNA 1S72A 1JT8A 3HKSA 4A3KG 2ES2A 2I5LX 2PNHA 2B3GA 1SFOH 2UXBL 4L5QA 5JEAJ 4BA1I 2F4VL 2K4KA 4B3MQ 4A3MH 4QJFA 1UE6A 4MZ9A 2YTVA 4LWCA 1B70B 3PUYA 1PHJA 1X9NA 4QY7A 3M4PA 1K8AC 4BY1H 4A3EG 2WFWA 4PZ7A 5M3FH 2BH2A 3FHWA 4JBKA 4JI1L 4DR7L 3G6EA 5GADC 5C0XI 2K5NA 4H02A 2JK8A 4LFAQ 1KL9A 4OWTB 3GTPH 1XTDA 1NTGA 4O2DA 2E2JH 2NVYH 3HOYH 3PO2G 1TWFH 4Y52H 1WJJA 1IZ6A 2JJQA 1CKNA 4P73A 5M3MH 3FP9A 5FLMH 5FJ8G 4GNXB 2KHIA 4IJLA 4A3JG 2Z6KC 1IBML 3UDXA 1AE3A 1K83H 3F2CA 5C44G 1XMOL 2IX0A 3H3VH 1MJCA 3ERSX 4GKJQ 2B63H 4YY3Q 5DLQE 3CC2A 1VQJA 2CFMA 3HKZG 4HIOA 1Q8KA 2ZM6L 2PI2E 3E0EA 4A3JH 4AQYL 1XNQL 1X55A 2UU9Q 1E1OA 2L15A 4A93H 2NVQH 5C3EG 1SE8A 3HKZE 3F2BA 1Y1WH 2N3SA 1C7YA 1YVCA 4JBJA 3RZDH 2IX1A 1JMCA 3CC4A 4B3SL 5IT9c 2WB1E 5ELOA 1WI5A 2UXDL 1IBMQ 2K75A 3GTJH 4X64L 5AJ3L 3PO3H 3I4OA 5EAYA 1IBKL 3PSIA 1PH9A 3AFQA 4JOIC 2XTIA 4YY3L 2OQ0A 2AWOA 3I7FA 3ULPA 4YCWA 1V43A 2WB1G 4FDBA 3EN2A 1KC8C 2KCTA 1XNQQ 4P71A 3M7NA 2UU9L 3S1MH 1TWCH 1PYSB 3J81c 2PQAA 3ULLA 1CUKA 1X56A 3A0JA 3LGJA 4HIDA 4LF8L 1E3PA 4L5SA 4C3HH 4OO1I 4POFA 3RN5A 2UXDQ 4A3BG 1U5KA 4NB3A 2JE6I 1X3FA 5IP9G 1IBKQ 1RIPA 1C9OA 1UE1A 4O0AA 1PH6A 2OTLA 3K81C 3U4VA 3CF5A 2JA7H 1N32L 2VUMG 3DM3A 3DLLA 2HQLA 2K14A 2NVTH 1EOVA 3EIVA 3RR5A 5M5WH 1PFSA 4IPCA 1PYBA 3KDFB 3CXCA 4YWMA 3I4MG 4GNXA 1YHBA 4IPHA 2BA0A 1Q86C 4UP8A 2CQOA 1I5FA 1UE5A 1Y14B 3EBEA 3RN2A 1PH4A 1M1KC 4DV1Q 1Y1WG 2ZTEA 3OYYA 3PUZA 3PCOB 4A3GH 1JJGA 1FVIA 2OQKA 3HOUG 5IE8A 2HIXA 3U58A 2E2HH 4GKJL 1N32Q 4HJ5A 4PZ6A 2R7DA 4LFCL 5M5YH 4IJHA 5GROA 4IOCA 1JJCB 2CWPA 3JC66 4XTCS 4QGUA 4AQYQ 4DNIA 5LMUQ 1VQMA 1Y1VG 3STBC 2LXKA 4GS3A 4JI3Q 3KDFA 1YZ6A 2UXCL 1GKHA 4DV7Q 4JI7Q 4PZ8A 4B3SQ 2Q2TA 4DUZL 4LNQA 4IPDA 1K9MC 4DR6L 4X64Q 4HJAA 5AJ3Q 3PO2H 2JA5H 4UY8C 3M3YH 2RCNA 1EIYB 2R92G 4NXMQ 1VQOA 2HHHQ 2Y0SE 3TS2A 4OO1G 1SR3A 3KYHC 5K36G 3JAMc 3CP0A 3HOZH 2EXDA 3E9IA 5IYBH 4LFCQ 3I4NH 3M4OH 3STBD 4DV5Q 3GTKH 1A62A 3GTLH 1VQEA 5LMUL 1Q1EA 4PG3A 3SGIA 1HZAA 2I5MX 3UE0A 3A5ZB 4JI3L 2KHJA 2D0OA 1HZBA 4A4IA 5IYBG 1HR0Q 3I55A 2UUAL 4LF8Q 4IOAA 5JJKA 2R7ZH 1TWHH 4DV7L 4JI7L 3JAMi 4P72A 4YCUA 3PIOA 4JI2L 3BZCA 3PF4A 2JA8G 1OXTA 3BU2A 3L0OA 5C0XG 4LFBL 4NXML 3KF8B 1I6HH 2N8NA 1OTCA 2A8VA 2JA6H 2JQOA 4DV5L 4JC0A 4DR5Q 3TREA 1HZ9A 3K7AH 5ELNA 3TEHB 2Y0SG 4NXNL 3S2HH 1HR0L 2NZHA 1K73C 4HJ7A 1IXRA 1BBWA 3ULJA 1VQPA 1ASYA 1YEZA 5M3MG 3J81i 1QVCA 3AYHB 3M85A 4DV1L 1IBLQ 1CKNB 4R4IA 2WP8J 3H0GH 1VCIA 1HNZL 4RMFA 1YHAA 1NE3A 4R4CA 1Q46A 2JA7G 4LFBQ 4JOIA 4KI0A 3B6YA 1W2BA 1EWIA 1JB7A 1WCMG 5GAEC 1QVGA 1QZGA 3G4SA 1XPUA 2ALYB 4JI6Q 4MTNA 3MEFA 2FXQA 4UP7A 2D0PA 4ME3A 3E9HA 4DV3L 1MJEA 3FKIG 3NENA 2GVAA 4KLKA 1YI2A 4NXNQ 3PUWA 4B3RQ 1A63A 3CQZH 1I3QH 4R4OA 2UXCQ 4QL5A 3GTQH 1NMGA 3HFZB 2QGQA 2QEXA 2E5LQ 1SLJA 4A3LG 4DUZQ 4DR6Q 2JA5G 1EIFA 3MXNB 4YWLA 1KXLA 5M5XH 1WYDA 2LXJA 1L1OC 2C35B 2RF4A 1HJPA 4LW1A 5M3FG 1OXXK 1PH2A 2ZTCA 2HHHL 3S14H 2R93G 3GTMH 4LF9Q 2BA1A 3NELA 4JI6L 3CCSA 2NN6G 4LF7Q 4TQUS 2E2IH 4DV3Q 3S15H 1ASZA 4A3FH 1WFQA 5C3EH 1VQIA 3L2PA 2UUAQ 1LTLA 5FLXc 1IYJB 1X65A 5IWAQ 3UDGA 1VQ6A 3IRBA 4JI2Q 2IT1A 1PH7A 3ZJYC 2VNUD 1TWGH 3HOVG 3RLOA 1D8LA 5BR8L 2QA4A 4J15A 3TQYA 2VQEQ 1E24A 4P74A 1V1QA 3U4ZA 2YTXA 4DR5L 4LF7L 1XMQL 3L7ZC 5LMNL 3CW2C 4DR2L 1J5EQ 4OXPA 3I56A 4PMWA 1Q12A 1W3SA 3AFPA 4RG1A 4JYAL 1K8GA 3CCVA 2B63G 3PUXA 2ZJRA 2XGTA 1IBLL 3K7UC 5IP9H 4YWKA 1XJVA 1M90C 1UEBA 3ER0A 2ZJPA 1HNZQ 1BBUA 4AH6A 1VQ9A 2Q2IA 2N49A 5FJ8H 2AHOB 2EQSA 4R1JA 4A3DG 2CWAA 2KENA 1VQ4A 5C0XJ 3PIPA 4DUYQ 4DV4Q 2N78A 1UWVA 4DR2Q 1HZCA 1N8RC 3PV0A 3CCUA 4DV6L 4GOPB 4UP9A 3CMAA 4B3RL 1VQCA 4C3JH 1AE2A 3D31A 3HOWG 4A3DH 4JYAQ 2E5LL 1B7YB 2Q2HA 1SROA 4WJ4A 3UE1A 1GM5A 4AYBE 1VQLA 3KFUA 3ICEA 2K5VA 4HIMA 3RZOH 2YTYA 4JV5Q 4EX5A 4B3TQ 2V1CC 3T1HQ 3A74A 1PH1A 1T9HA 4JCVE 4LF9L 3H0GG 2ATWA 4HIKA 4A3KH 4HJ9A 2MQHA 1VQ8A 3W1GA 3H3VI 4C3IH 1E1TA 2OCEA 5H1SE 1I94L 4L5TA 4GN4B 3S1QH 4BXXH 1VQAA 4X66Q 5HGQA 1E7ZA 1PH5A 3KF6A 5IWAL 4JI4Q 4DR4Q 1FGUA 2JEAI 1N9WA 1I50H 3J80c 3W1BA 4JI5Q 2IY5B 4BY7H 1MKHA 2VY3A 3UDFA 5BR8Q 3PUVA 4X62L 1L0WA 2VQEL 1CKMA 1HNWL 3T1YQ 1N34Q 2ZTDA 1XMQQ 3AQQA 3TS0A 5LMNQ 1J5EL 1X6OA 1A0IA 2NN6I 3AEVA 4DAYB 4YHHL 4X66L 4LF6L 4JI4L 1CKOA 2VL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4Q A;  3HOX H;  5IYD G;  1KRT A;  3KF6 B;  1S40 A;  4POG A;  3U50 C;  3HOZ G;  2PMZ E;  2MO0 A;  5C4X H;  1VQF A;  2D62 A;  3KOJ A;  1OXV A;  1TWA H;  1YHQ A;  4A3L H;  4X62 Q;  2JA9 A;  2OWO A;  1FJG Q;  3CCQ A;  2NVX H;  1LUZ A;  2RHQ B;  4Y7N H;  4AYB G;  2WAQ E;  4LF5 L;  3KLW A;  4DUY L;  4DV4 L;  1PV4 A;  2Z0S A;  4BBS G;  1G29 1;  1VS0 A;  1Z47 A;  2IHF A;  1NY4 A;  4DV6 Q;  3TRZ A;  3GDE A;  1VQ7 A;  4K0K Q;  1X54 A;  3RLN A;  1UE7 A;  1QUQ A;  4YHH Q;  3A5U A;  1VQB A;  2KCM A;  3GTO H;  5JJL A;  2R92 H;  3M9B A;  1PVO A;  1B8A A;  1XPO A;  4JI8 Q;  3H15 A;  4ALP A;  1YJW A;  4QQB X;  3K8A A;  5IYC G;  2ID0 A;  5IYD H;  4JV5 L;  4A93 G;  3W5O A;  4B3T L;  3T1H L;  2A19 A;  4LUO A;  3J80 i;  1XPR A;  1YIT A;  3BZK A;  4LF5 Q;  2EIF A;  4DR3 L;  5IY0 A;  1L2F A;  4A3I G;  1KIX A;  4DAM A;  4APV A;  3HOV H;  4BBR H;  1I94 Q;  4K0K L;  1CSQ A;  3I4M H;  3CC7 A;  1XNR Q;  1QUQ B;  3CCM A;  4DR4 L;  2UUB L;  4OWW B;  5FLM G;  2A1A A;  1VQG A;  2RHS B;  4BA2 I;  4BY7 G;  4R4T A;  4JI5 L;  1SRU A;  4IFD G;  4UPA A;  4GLV B;  1KQS A;  4BBR G;  1YJ9 A;  1EYG A;  2VZA A;  1GVP A;  4GOP A;  2R7Z G;  4GLA C;  4MNO A;  1E22 A;  4QIW E;  1KAW A;  1SMX A;  2VW9 A;  3CCR A;  3T1Y L;  1N34 L;  4DR3 Q;  3CD6 A;  3J7A 5;  3G48 A;  2K5H A;  1GD7 A;  3K0X A;  4GOP C;  4BY1 G;  2AKW B;  1Q82 C;  1N33 L;  2MFI A;  3PF5 A;  4C2M H;  4GKK L;  4A3C G;  1HNW Q;  3OTO Q;  4JBM A;  4GN3 B;  4LUZ A;  3BJU A;  2WAQ G;  4A3F G;  1KHI A;  4LF6 Q;  3UDI A;  1VQH A;  3J81 j;  2UUB Q;  1HNX L;  1IL2 A;  3I2Z A;  2R7F A;  1Q81 C;  3WWV A;  4IFD I;  3RLF A;  3VDY A;  4A3E H;  2GN5 A;  5GAH C;  3S17 H;  4IFD J;  2R93 H;  5LMN W;  2GVB A;  2K52 A;  2VQF L;  3CPW A;  1FJG L;  3HOW H;  2PQA B;  1PA6 A;  3PO3 G;  4GNX C;  3I4N G;  1CSP A;  4L5R C;  1P8L A;  3NEM A;  2Z6K A;  4AIM A;  1X3E A;  4X65 L;  1BVS A;  4YCV A;  1EFW A;  2AMC B;  1EQR A;  3OTO L;  1H95 A;  3HOX G;  5JEA G;  4OX9 L;  2VS1 A;  3HOU H;  1HNX Q;  1P16 A;  2JEB I;  2K50 A;  2LSS A;  1MIU A;  4JI8 L;  1OXU A;  4DV2 L;  3RNU A;  3NBH B;  1SN8 A;  4JI0 Q;  4KHZ A;  1S3O A;  1LM0 A;  1Y1V H;  4R4Q A;  1Z9F A;  1G51 A;  1X3G A;  2YYZ A;  3GO5 A;  1V9P A;  1O7I A;  3CME A;  4A75 A;  3S1N H;  1YJN A;  3CCL A;  2JA6 G;  4WJ3 M;  4LF4 L;  1FL0 A;  4GN5 A;  2UUC L;  4OON A;  2E8G A;  2OTJ A;  1EUJ A;  4DV0 L;  1KD1 C;  1YBY A;  4A3G G;  3K80 C;  4KHP L;  3F8T A;  4OX9 Q;  1DGS A;  1NBW A;  3G71 A;  1XNR L;  1AH9 A;  3S2D H;  3F1Z A;  4BXX G;  1PH8 A;  5C44 H;  1Q7Y C;  1VQ5 A;  4DV2 Q;  1YNX A;  4A3B H;  1WOC A;  2F4V Q;  5JJI A;  1RL2 A;  4IO9 A;  2R6G A;  3GD7 A;  1N36 Q;  1KRS A;  3PGZ A;  4JG2 A;  4LF4 Q;  3HOY G;  2VUM H;  4GLX A;  1LYL A;  1NMF A;  2UUC Q;  1D7Q A;  3CPF A;  3J7Z C;  1N33 Q;  1QZH A;  4TVA B;  1NJI C;  4A3C H;  3KJO A;  4IPG A;  4GKK Q;  4DR7 Q;  2IHE A;  4OWX B;  4A76 A;  3FKI H;  2B29 A;  1QVF A;  2F52 A;  1L1O B;  4BBS H;  1Q1B A;  4XIG S;  4LFA L;  3OW2 A;  4HJ8 A;  1HR0 W;  2AWN A;  3KJP A;  3CCJ A;  1JJ2 A;  1GO3 E;  1WCM H;  4JBW A;  4A3M G;  4DK3 C;  1OXS C;  5IP7 G;  2VQF Q;  2NZO A;  1VQD A;  1BKB A;  4NPS A;  4P75 A;  1N36 L;  3D0F A;  1XMO Q;  3S16 H;  2YU9 H;  5C4X G;  1A8V A;  2DGY A;  4DR1 Q;  4X65 Q;  4DPG A;  2CKZ B;  2YV5 A;  1VQN A;  2HT1 A;  2PI2 A;  1TXY A;  3S1R H;  2ZJQ A;  1JE5 A;  1J6Q A;  5C4J H;  5GQO A;  1PH3 A;  2H5X A;  2ZM6 Q;  1EQQ A;  1R9T H;  4LUV A;  4A3I H;  1L1O A;  3Q8D A;  2DUD A;  5E7N A;  2I0Q A;  3GTG H;  2UXB Q;  1YIJ A;  4JI0 L;  2I5H A;  4B3M L;  4DK6 C;  1G6P A;  2JA8 H;  5IYC H;  3CAM A;  1U0L A;  2Q2U A;  1K0R A;  3S24 A;  2BH8 A;  1VQK A;  2MNA A;  3F2D A;  2F3I A;  4DR1 L;  5IP7 H;  1HH2 P;  4DKA C;  3CCE A;  2CCZ A;  4DV0 Q;  5J3B A;  5HY6 A;  1K3R A;  2ASB A;  2HIV A;  4JI1 Q;  5GAG C;  4EQ5 A;  2MO1 A;  4KHP Q;  1C0A A;  4X6A H;  2KBN A;  1S72 A;  1JT8 A;  3HKS A;  4A3K G;  2ES2 A;  2I5L X;  2PNH A;  2B3G A;  1SFO H;  2UXB L;  4L5Q A;  5JEA J;  4BA1 I;  2F4V L;  2K4K A;  4B3M Q;  4A3M H;  4QJF A;  1UE6 A;  4MZ9 A;  2YTV A;  4LWC A;  1B70 B;  3PUY A;  1PHJ A;  1X9N A;  4QY7 A;  3M4P A;  1K8A C;  4BY1 H;  4A3E G;  2WFW A;  4PZ7 A;  5M3F H;  2BH2 A;  3FHW A;  4JBK A;  4JI1 L;  4DR7 L;  3G6E A;  5GAD C;  5C0X I;  2K5N A;  4H02 A;  2JK8 A;  4LFA Q;  1KL9 A;  4OWT B;  3GTP H;  1XTD A;  1NTG A;  4O2D A;  2E2J H;  2NVY H;  3HOY H;  3PO2 G;  1TWF H;  4Y52 H;  1WJJ A;  1IZ6 A;  2JJQ A;  1CKN A;  4P73 A;  5M3M H;  3FP9 A;  5FLM H;  5FJ8 G;  4GNX B;  2KHI A;  4IJL A;  4A3J G;  2Z6K C;  1IBM L;  3UDX A;  1AE3 A;  1K83 H;  3F2C A;  5C44 G;  1XMO L;  2IX0 A;  3H3V H;  1MJC A;  3ERS X;  4GKJ Q;  2B63 H;  4YY3 Q;  5DLQ E;  3CC2 A;  1VQJ A;  2CFM A;  3HKZ G;  4HIO A;  1Q8K A;  2ZM6 L;  2PI2 E;  3E0E A;  4A3J H;  4AQY L;  1XNQ L;  1X55 A;  2UU9 Q;  1E1O A;  2L15 A;  4A93 H;  2NVQ H;  5C3E G;  1SE8 A;  3HKZ E;  3F2B A;  1Y1W H;  2N3S A;  1C7Y A;  1YVC A;  4JBJ A;  3RZD H;  2IX1 A;  1JMC A;  3CC4 A;  4B3S L;  5IT9 c;  2WB1 E;  5ELO A;  1WI5 A;  2UXD L;  1IBM Q;  2K75 A;  3GTJ H;  4X64 L;  5AJ3 L;  3PO3 H;  3I4O A;  5EAY A;  1IBK L;  3PSI A;  1PH9 A;  3AFQ A;  4JOI C;  2XTI A;  4YY3 L;  2OQ0 A;  2AWO A;  3I7F A;  3ULP A;  4YCW A;  1V43 A;  2WB1 G;  4FDB A;  3EN2 A;  1KC8 C;  2KCT A;  1XNQ Q;  4P71 A;  3M7N A;  2UU9 L;  3S1M H;  1TWC H;  1PYS B;  3J81 c;  2PQA A;  3ULL A;  1CUK A;  1X56 A;  3A0J A;  3LGJ A;  4HID A;  4LF8 L;  1E3P A;  4L5S A;  4C3H H;  4OO1 I;  4POF A;  3RN5 A;  2UXD Q;  4A3B G;  1U5K A;  4NB3 A;  2JE6 I;  1X3F A;  5IP9 G;  1IBK Q;  1RIP A;  1C9O A;  1UE1 A;  4O0A A;  1PH6 A;  2OTL A;  3K81 C;  3U4V A;  3CF5 A;  2JA7 H;  1N32 L;  2VUM G;  3DM3 A;  3DLL A;  2HQL A;  2K14 A;  2NVT H;  1EOV A;  3EIV A;  3RR5 A;  5M5W H;  1PFS A;  4IPC A;  1PYB A;  3KDF B;  3CXC A;  4YWM A;  3I4M G;  4GNX A;  1YHB A;  4IPH A;  2BA0 A;  1Q86 C;  4UP8 A;  2CQO A;  1I5F A;  1UE5 A;  1Y14 B;  3EBE A;  3RN2 A;  1PH4 A;  1M1K C;  4DV1 Q;  1Y1W G;  2ZTE A;  3OYY A;  3PUZ A;  3PCO B;  4A3G H;  1JJG A;  1FVI A;  2OQK A;  3HOU G;  5IE8 A;  2HIX A;  3U58 A;  2E2H H;  4GKJ L;  1N32 Q;  4HJ5 A;  4PZ6 A;  2R7D A;  4LFC L;  5M5Y H;  4IJH A;  5GRO A;  4IOC A;  1JJC B;  2CWP A;  3JC6 6;  4XTC S;  4QGU A;  4AQY Q;  4DNI A;  5LMU Q;  1VQM A;  1Y1V G;  3STB C;  2LXK A;  4GS3 A;  4JI3 Q;  3KDF A;  1YZ6 A;  2UXC L;  1GKH A;  4DV7 Q;  4JI7 Q;  4PZ8 A;  4B3S Q;  2Q2T A;  4DUZ L;  4LNQ A;  4IPD A;  1K9M C;  4DR6 L;  4X64 Q;  4HJA A;  5AJ3 Q;  3PO2 H;  2JA5 H;  4UY8 C;  3M3Y H;  2RCN A;  1EIY B;  2R92 G;  4NXM Q;  1VQO A;  2HHH Q;  2Y0S E;  3TS2 A;  4OO1 G;  1SR3 A;  3KYH C;  5K36 G;  3JAM c;  3CP0 A;  3HOZ H;  2EXD A;  3E9I A;  5IYB H;  4LFC Q;  3I4N H;  3M4O H;  3STB D;  4DV5 Q;  3GTK H;  1A62 A;  3GTL H;  1VQE A;  5LMU L;  1Q1E A;  4PG3 A;  3SGI A;  1HZA A;  2I5M X;  3UE0 A;  3A5Z B;  4JI3 L;  2KHJ A;  2D0O A;  1HZB A;  4A4I A;  5IYB G;  1HR0 Q;  3I55 A;  2UUA L;  4LF8 Q;  4IOA A;  5JJK A;  2R7Z H;  1TWH H;  4DV7 L;  4JI7 L;  3JAM i;  4P72 A;  4YCU A;  3PIO A;  4JI2 L;  3BZC A;  3PF4 A;  2JA8 G;  1OXT A;  3BU2 A;  3L0O A;  5C0X G;  4LFB L;  4NXM L;  3KF8 B;  1I6H H;  2N8N A;  1OTC A;  2A8V A;  2JA6 H;  2JQO A;  4DV5 L;  4JC0 A;  4DR5 Q;  3TRE A;  1HZ9 A;  3K7A H;  5ELN A;  3TEH B;  2Y0S G;  4NXN L;  3S2H H;  1HR0 L;  2NZH A;  1K73 C;  4HJ7 A;  1IXR A;  1BBW A;  3ULJ A;  1VQP A;  1ASY A;  1YEZ A;  5M3M G;  3J81 i;  1QVC A;  3AYH B;  3M85 A;  4DV1 L;  1IBL Q;  1CKN B;  4R4I A;  2WP8 J;  3H0G H;  1VCI A;  1HNZ L;  4RMF A;  1YHA A;  1NE3 A;  4R4C A;  1Q46 A;  2JA7 G;  4LFB Q;  4JOI A;  4KI0 A;  3B6Y A;  1W2B A;  1EWI A;  1JB7 A;  1WCM G;  5GAE C;  1QVG A;  1QZG A;  3G4S A;  1XPU A;  2ALY B;  4JI6 Q;  4MTN A;  3MEF A;  2FXQ A;  4UP7 A;  2D0P A;  4ME3 A;  3E9H A;  4DV3 L;  1MJE A;  3FKI G;  3NEN A;  2GVA A;  4KLK A;  1YI2 A;  4NXN Q;  3PUW A;  4B3R Q;  1A63 A;  3CQZ H;  1I3Q H;  4R4O A;  2UXC Q;  4QL5 A;  3GTQ H;  1NMG A;  3HFZ B;  2QGQ A;  2QEX A;  2E5L Q;  1SLJ A;  4A3L G;  4DUZ Q;  4DR6 Q;  2JA5 G;  1EIF A;  3MXN B;  4YWL A;  1KXL A;  5M5X H;  1WYD A;  2LXJ A;  1L1O C;  2C35 B;  2RF4 A;  1HJP A;  4LW1 A;  5M3F G;  1OXX K;  1PH2 A;  2ZTC A;  2HHH L;  3S14 H;  2R93 G;  3GTM H;  4LF9 Q;  2BA1 A;  3NEL A;  4JI6 L;  3CCS A;  2NN6 G;  4LF7 Q;  4TQU S;  2E2I H;  4DV3 Q;  3S15 H;  1ASZ A;  4A3F H;  1WFQ A;  5C3E H;  1VQI A;  3L2P A;  2UUA Q;  1LTL A;  5FLX c;  1IYJ B;  1X65 A;  5IWA Q;  3UDG A;  1VQ6 A;  3IRB A;  4JI2 Q;  2IT1 A;  1PH7 A;  3ZJY C;  2VNU D;  1TWG H;  3HOV G;  3RLO A;  1D8L A;  5BR8 L;  2QA4 A;  4J15 A;  3TQY A;  2VQE Q;  1E24 A;  4P74 A;  1V1Q A;  3U4Z A;  2YTX A;  4DR5 L;  4LF7 L;  1XMQ L;  3L7Z C;  5LMN L;  3CW2 C;  4DR2 L;  1J5E Q;  4OXP A;  3I56 A;  4PMW A;  1Q12 A;  1W3S A;  3AFP A;  4RG1 A;  4JYA L;  1K8G A;  3CCV A;  2B63 G;  3PUX A;  2ZJR A;  2XGT A;  1IBL L;  3K7U C;  5IP9 H;  4YWK A;  1XJV A;  1M90 C;  1UEB A;  3ER0 A;  2ZJP A;  1HNZ Q;  1BBU A;  4AH6 A;  1VQ9 A;  2Q2I A;  2N49 A;  5FJ8 H;  2AHO B;  2EQS A;  4R1J A;  4A3D G;  2CWA A;  2KEN A;  1VQ4 A;  5C0X J;  3PIP A;  4DUY Q;  4DV4 Q;  2N78 A;  1UWV A;  4DR2 Q;  1HZC A;  1N8R C;  3PV0 A;  3CCU A;  4DV6 L;  4GOP B;  4UP9 A;  3CMA A;  4B3R L;  1VQC A;  4C3J H;  1AE2 A;  3D31 A;  3HOW G;  4A3D H;  4JYA Q;  2E5L L;  1B7Y B;  2Q2H A;  1SRO A;  4WJ4 A;  3UE1 A;  1GM5 A;  4AYB E;  1VQL A;  3KFU A;  3ICE A;  2K5V A;  4HIM A;  3RZO H;  2YTY A;  4JV5 Q;  4EX5 A;  4B3T Q;  2V1C C;  3T1H Q;  3A74 A;  1PH1 A;  1T9H A;  4JCV E;  4LF9 L;  3H0G G;  2ATW A;  4HIK A;  4A3K H;  4HJ9 A;  2MQH A;  1VQ8 A;  3W1G A;  3H3V I;  4C3I H;  1E1T A;  2OCE A;  5H1S E;  1I94 L;  4L5T A;  4GN4 B;  3S1Q H;  4BXX H;  1VQA A;  4X66 Q;  5HGQ A;  1E7Z A;  1PH5 A;  3KF6 A;  5IWA L;  4JI4 Q;  4DR4 Q;  1FGU A;  2JEA I;  1N9W A;  1I50 H;  3J80 c;  3W1B A;  4JI5 Q;  2IY5 B;  4BY7 H;  1MKH A;  2VY3 A;  3UDF A;  5BR8 Q;  3PUV A;  4X62 L;  1L0W A;  2VQE L;  1CKM A;  1HNW L;  3T1Y Q;  1N34 Q;  2ZTD A;  1XMQ Q;  3AQQ A;  3TS0 A;  5LMN Q;  1J5E L;  1X6O A;  1A0I A;  2NN6 I;  3AEV A;  4DAY B;  4YHH L;  4X66 L;  4LF6 L;  4JI4 L;  1CKO A;  2VL6 A; 
#chains in the Genus database with same CATH topology
 3M4Q A;  1KRT A;  1K0S A;  2EYM A;  1A15 A;  3I3C A;  2MO0 A;  1VQF A;  3BVG A;  1OXV A;  1TWA H;  1YHQ A;  1FNW A;  2JA9 A;  4IUQ A;  2EYL A;  3CCQ A;  1LUZ A;  1SNC A;  3A8I E;  4Y7N H;  5M5W B;  4LF5 L;  1CTM A;  2LKV A;  2R3Z A;  2DNC A;  4QIW B;  4DV6 Q;  1VQ7 A;  4K0K Q;  4K5X A;  5HGT A;  4FVM A;  3V2T A;  1WD1 A;  2KCM A;  2X69 A;  4OO1 H;  3A8K E;  3GTO H;  5JJL A;  2BE5 C;  2X6L A;  3K8A A;  4HMJ A;  5KIX A;  5IYD H;  4B3T L;  3T1H L;  3J80 i;  3U9S A;  4RGT A;  1YIT A;  3K6O A;  1L2F A;  3VR4 A;  4BBR H;  4X3S A;  4A93 B;  3DEO A;  4BBR B;  4HED A;  1XNR Q;  2UUB L;  1MD2 D;  5FLM G;  2A1A A;  4BY7 G;  4F87 A;  4JI5 L;  3G6J B;  3BDO A;  3M4O B;  5C3E B;  2VW9 A;  4QMG A;  3J7A 5;  3G48 A;  1TVX A;  1GD7 A;  2K5Q A;  4BY1 G;  3NSW A;  4F7X A;  1N33 L;  3J81 E;  2EY2 A;  1HNW Q;  4A3F G;  3BJU A;  3IKJ A;  4LF6 Q;  1VQH A;  2H1E A;  2UUB Q;  4C3H B;  4QB4 A;  5GAH C;  1SDF A;  1VF7 A;  1A2U A;  2GVB A;  1FJG L;  4CHT B;  1CSP A;  3VYU A;  1Q8I A;  2F0F A;  1BVS A;  4YCV A;  5DM6 3;  2JA5 B;  2L9H A;  1GHJ A;  1TY2 A;  4IQZ A;  2AMC B;  1TR5 A;  4RAU C;  4OX9 L;  2RQX A;  1RTO A;  1S3O A;  1Y1V H;  4HTH A;  1Z9F A;  1X3G A;  4A75 A;  3S1N H;  2PZU A;  4LJZ C;  2JXM B;  1E2V A;  2F0U A;  5JPN C;  2UUC L;  2F03 A;  3EVQ A;  1KD1 C;  4DV0 L;  1YBY A;  3K80 C;  3F8T A;  4OX9 Q;  1NBW A;  1XNR L;  1G2S A;  3S2D H;  5C44 H;  2K28 A;  1VQ5 A;  4A3B H;  4IO9 A;  2R6G A;  1G91 A;  1X32 A;  3GD7 A;  1EYC A;  1N36 Q;  2G5D A;  3C46 A;  1KRS A;  4LF4 Q;  1HTL D;  4XQQ A;  3J7Z C;  1QZH A;  2O5I C;  4TVA B;  1SND A;  1B53 A;  1EU4 A;  2F52 A;  4LFA L;  3OW2 A;  3KJP A;  2CH4 W;  3CCJ A;  1JJ2 A;  1WCM H;  5IGC A;  1OXS C;  5IP7 G;  2VQF Q;  2NZO A;  3D0F A;  1XMO Q;  2FJ2 A;  2CKZ B;  3S1R H;  4RH6 A;  4XQJ A;  1J6Q A;  1PH3 A;  1U9R A;  1L1O A;  3Q8D A;  1YIJ A;  4B3M L;  4DK6 C;  1G6P A;  3N52 A;  3CRK C;  5IYC H;  4XT3 B;  5I9P A;  2QDB A;  4DR1 L;  2WV6 D;  4DKA C;  3CCE A;  1S5E D;  4DV0 Q;  3MWY W;  5J3B A;  4HSV A;  4JI1 Q;  2MO1 A;  4RWS C;  4KHP Q;  1C0A A;  1FNU A;  2F0P A;  2XIW A;  1S72 A;  4H13 C;  5FO8 B;  4BA1 I;  4YIJ A;  2K4K A;  4P2C B;  3IL8 A;  1BOS A;  4A3M H;  3QO2 A;  3H94 A;  1HQM C;  4KKU A;  5LL6 S;  2L55 A;  1B70 B;  2AQ2 B;  3HEJ A;  1TS3 A;  2KCC A;  3S9W A;  1X9N A;  4BY1 H;  2WFW A;  2BH2 A;  3FHW A;  3SXH A;  2EYJ A;  4B9X A;  1QNK A;  4G7O C;  2IL8 A;  1XTD A;  3GTP H;  3K0Y A;  2A74 C;  2NVY H;  4Y52 H;  2JJQ A;  2B8G A;  3FP9 A;  5M9O A;  1UUP A;  1XMO L;  4E6I A;  4C2M B;  5C6A A;  1Z7T A;  1Y69 U;  1S4Z A;  1CM9 A;  4G7H C;  5A2Q E;  5G3L D;  1VQJ A;  2CFM A;  2F0W A;  1CI3 M;  4A3J H;  1X55 A;  4A93 H;  2L15 A;  2NVQ H;  5FO9 B;  1C7Y A;  4JBJ A;  2IX1 A;  4B3S L;  1WI5 A;  1KDA A;  4X64 L;  1EY0 A;  5IOC A;  1IBK L;  4B9W A;  3PSI A;  2WAQ B;  2PO4 A;  2XTI A;  4JOI C;  4C1N I;  1SYE A;  4YY3 L;  3I7F A;  1MSG A;  4PNY A;  4XQN A;  3EN2 A;  1S5C D;  1KC8 C;  4P71 A;  4A3D B;  3J81 c;  4Q5V A;  3A0J A;  4HID A;  1F9R A;  3ITP A;  4C3H H;  4OO1 I;  2RKS A;  2K33 A;  3QJY A;  1RIP A;  1C9O A;  1UE1 A;  4O0A A;  4RFB A;  1IYV A;  5EQ0 A;  2K14 A;  1R9T B;  3EIV A;  1PYB A;  3ERQ A;  5J1Z A;  2VB3 X;  3I4M G;  4GNX A;  4IPH A;  1Q86 C;  1I5F A;  3RN2 A;  4DV1 Q;  2B2T A;  3OYY A;  1Y1V B;  1FVI A;  1SBB B;  5FK9 C;  5IE8 A;  4GKJ L;  2B2W A;  3OIQ A;  3NBI A;  4HJ5 A;  4PZ6 A;  1N32 Q;  5M5Y H;  4IJH A;  4QGU A;  2NTT A;  4AQY Q;  1VQM A;  2EPB A;  3STB C;  1TKW B;  1QE6 A;  4J6H A;  1O7Z A;  1TT2 A;  1YZ6 A;  1SMY C;  1HFG A;  1OO9 B;  4MTK A;  5E1F A;  1G2T A;  3T16 A;  4DUZ L;  2N88 A;  2KQ3 A;  3C3L A;  1H9R A;  4OIK A;  1AW7 A;  2Z9H A;  2R92 G;  3KUP A;  2Y0S E;  2MHV A;  3DMU A;  3CHB D;  5K36 G;  4CJ2 C;  3CP0 A;  2EXD A;  1CZW A;  3I4N H;  1ZYR C;  4DV5 Q;  3SGI A;  3S1M B;  1HTP A;  5IGB A;  5C4Z A;  2K7V A;  4JI3 L;  3ND8 A;  5IYB G;  1HR0 Q;  4DV7 L;  1I4G A;  4JI7 L;  4YCU A;  5K5P A;  4PV1 C;  4RKL A;  3BZC A;  1U4P A;  3PF4 A;  4J1M A;  3D6C A;  2N8N A;  1HQR D;  1HUM A;  3S1R B;  5C4X B;  1PZK D;  1LTT D;  3W3A A;  4NXN L;  3S2H H;  4FYD A;  2NZH A;  4HJ7 A;  1IXR A;  4R9W A;  1VQP A;  1WTO A;  1HXY D;  3J81 i;  3AYH B;  5J22 A;  4R4I A;  3DHQ A;  3AB9 A;  1VCI A;  4RMF A;  1YHA A;  1NE3 A;  4LFB Q;  1LTS D;  3B6Y A;  1EWI A;  2B39 A;  4RA8 A;  1QZG A;  2ALY B;  4JI6 Q;  2E2J B;  2RSN A;  4UP7 A;  2RDG A;  4IUT A;  2B2Y C;  3GTQ B;  4NXN Q;  1YI2 A;  4ODG A;  3GTQ H;  2QGQ A;  2QEX A;  4EQN A;  3I4M B;  4N8X 1;  4GOP B;  1GHK A;  2C35 B;  2LS0 1;  5I6W A;  2HHH L;  2R93 G;  5A2Q L;  1PTO F;  3MFY A;  5E3F A;  2NN6 G;  4TQU S;  2L4N A;  1WTV A;  1B1Z A;  1VQI A;  3L2P A;  5FLX c;  1IYJ B;  1PZI D;  2G9H D;  1SE3 A;  2F1M A;  2PZT A;  3IRB A;  4OL7 A;  2IJ0 A;  2IT1 A;  1PH7 A;  1B9M A;  3HOV G;  1D5X C;  5BR8 L;  2K32 A;  2OF1 A;  4P74 A;  2YTX A;  2LMC B;  4DR5 L;  1XMQ L;  3L7Z C;  4DR2 L;  2EY5 A;  1Q12 A;  5JOB A;  3K7A B;  1DYQ A;  3AFP A;  4RG1 A;  4JYA L;  2XGT A;  1HFN A;  4HSP A;  1UEB A;  3ER0 A;  4FXK C;  1LTI D;  1HNZ Q;  5CBE E;  4R1J A;  2A6E D;  2EDG A;  1GUG A;  1JB3 A;  5IGD A;  2N78 A;  2HCC A;  3CKI B;  4B3R L;  4C3J H;  4A3D H;  3D31 A;  3HOW G;  1GUO A;  1B7Y B;  4WJ4 A;  1SRO A;  3HG9 A;  5C4H A;  2LFN A;  4RHS A;  4WFN 3;  4PMB A;  1E0B A;  3DXJ C;  4ZKC B;  3T1H Q;  1PH1 A;  4LF9 L;  2FMC A;  1DM0 B;  4ZYS A;  2ATW A;  4HIK A;  1WTH A;  4ME5 A;  3W1G A;  4C3I H;  3Q23 A;  3H3V I;  2G9D A;  2E2I B;  1I94 L;  3KF8 A;  1DOM A;  1V1P B;  4BXX H;  4WOR A;  4JI4 Q;  4DR4 Q;  4V0B A;  2EJG C;  4JI5 Q;  5C3X A;  2C5C A;  5I2X A;  3L3O C;  2XNA C;  2VQE L;  1CKM A;  1N34 Q;  2D5D A;  1I4H A;  2SEB D;  1RD9 D;  3S16 B;  2AQ1 B;  5HUR A;  1KAB A;  4DAY B;  1KDC A;  1GOZ A;  2VL6 A;  3HOX H;  5IYD G;  4QUC A;  3VR3 A;  3HOX B;  1STG A;  4A3L H;  1FJG Q;  1HRJ A;  2NVX H;  4G7Z C;  2EYF A;  4DUY L;  4DV4 L;  1PV4 A;  1VS0 A;  1TS4 A;  4R8N A;  1SSO A;  4C3J G;  1UE7 A;  4FO2 A;  3C2P A;  1VQB A;  5JPM C;  2MP1 A;  3FPU B;  1XPO A;  1F9S A;  5CR3 A;  2NZ1 D;  2F0O A;  4JV5 L;  1H9S A;  1XPR A;  1HUN A;  1NUC A;  2WKC A;  3UI2 A;  1D1I A;  1D5Z C;  3HOV H;  4K6L A;  3M7G A;  1CSQ A;  5KRU A;  3OOC A;  1AZQ A;  3CC7 A;  3S1Q B;  1QUQ B;  4DR4 L;  2RHS B;  3W2D A;  4IFD G;  1IKL A;  1XXG A;  1GVP A;  2CHB D;  4GOP A;  1EY6 A;  2R7Z G;  4QCL A;  2A69 D;  1N34 L;  5EBD A;  5M3M B;  1U4L A;  1S5D D;  3K0X A;  1JC7 A;  3K57 A;  2AKW B;  5G3L F;  4CDE C;  1MHW C;  1PDQ A;  5CBA E;  2PMZ B;  1TS5 A;  3UDI A;  1HA6 A;  1HNX L;  1IL2 A;  1VMP A;  3K59 A;  4IFD I;  3TN2 A;  4S3S A;  3VA5 A;  2A69 C;  4IFD J;  3MAQ A;  1GUT A;  1TWA B;  3HOW H;  3CPW A;  1UAP A;  4K14 A;  2PQA B;  1PA6 A;  3PO3 G;  4BS9 A;  1P8L A;  1L0Y B;  2KED A;  1T5E A;  2AUJ D;  2EY6 A;  3R3O A;  3J7A V;  5CV9 A;  5F2D A;  4ULL A;  1K8M A;  4MHE A;  3HOX G;  2N55 A;  2VS1 A;  1HNX Q;  1P16 A;  2K50 A;  4JI8 L;  1OXU A;  4DV2 L;  4I65 A;  3SK4 A;  1SN8 A;  2NVY B;  4R4Q A;  2YYZ A;  1XX8 A;  3CME A;  5EJW A;  4WJ3 M;  2A6H D;  2JA6 G;  1E2Z A;  2K04 A;  1SYG A;  1CZG A;  5C5M A;  4GN5 A;  1BO0 A;  2OT2 A;  1JOQ A;  2I07 B;  3L9A X;  1EUJ A;  1SYF A;  3P1H A;  4M1U B;  4PQX A;  4KHP L;  1QOH A;  5T1G A;  1U4R A;  1Q7Y C;  3D4R A;  2A6H C;  2F4V Q;  1TU2 B;  2Z4H A;  3X3M A;  3ND9 A;  3JAM E;  3HOY G;  2VUM H;  1M8A A;  1NMF A;  2UUC Q;  1SYD A;  1PRT C;  3GTK B;  2QDL A;  3VR2 A;  3KJO A;  4DR7 Q;  2IHE A;  1QVF A;  1ILP A;  5LL6 X;  1L1O B;  1TQO A;  3HKZ B;  1BCP C;  2F0Q A;  4DA2 A;  2K1B A;  4HJ8 A;  2AWN A;  1ENA A;  3SK5 A;  3CQZ B;  4DK3 C;  1K83 B;  1HPC A;  1N36 L;  3AMU A;  1PRT D;  2A73 B;  1A8V A;  4DR1 Q;  3MXU A;  3I4L A;  1EFI D;  1M4V A;  4DPG A;  3T13 A;  2HT1 A;  5C4J H;  4KN4 C;  1RCV D;  5GQO A;  3E6Z X;  1SE4 A;  4IZ8 A;  1R9T H;  2NYZ D;  4FNF A;  5C4J B;  4HAE A;  5E7N A;  2I0Q A;  1Z6H A;  4JI0 L;  1PFB A;  4RCO A;  3G7L A;  3CAM A;  1O78 A;  1U0L A;  3S24 A;  4RGM A;  3QIA A;  2F3I A;  4KJN A;  4DGZ A;  2L1B A;  1MSH A;  4KY5 A;  4UHV A;  2ASB A;  5GAG C;  1LTB D;  4X6A H;  1QWY A;  3N6R A;  4A3K G;  2JA6 B;  3MXP A;  4IUV A;  2PQE A;  4PMC A;  5JEA J;  2F4V L;  2SNM A;  4QJF A;  1FD7 D;  1UE6 A;  3SHL A;  1DD2 A;  3WOE A;  1LTA D;  1MBY A;  1PHJ A;  2J0T D;  1PTO B;  2A68 D;  3Q22 A;  3LX0 A;  3D4W A;  2PNR C;  3H3V C;  5JVG 3;  4PZ7 A;  4JBK A;  4DR7 L;  4LMQ D;  3G6E A;  2KCN A;  4H02 A;  1KL9 A;  3QB3 A;  1CHQ D;  2B8F A;  1TWF H;  1EU3 A;  1WJJ A;  1IYU A;  4P73 A;  5FLM H;  1H9S B;  1V1P A;  2ZXO A;  3QWN A;  4IJL A;  4A3J G;  2Z6K C;  2F4I A;  3F2C A;  1D6E C;  5KYI A;  3H3V H;  5KNC A;  4GKJ Q;  4YY3 Q;  5D14 A;  3HKZ G;  4XXE A;  2ZM6 L;  5CV6 A;  4AQY L;  1XNQ L;  3OW7 A;  2F3W A;  1HHV A;  3VA7 A;  1SE8 A;  1UEA B;  3DUZ A;  3Q0A A;  3T53 B;  1ICW A;  2B2Y A;  2JP1 A;  5IT9 c;  5ELO A;  3SEB A;  3GTJ H;  5AJ3 L;  3PO3 H;  3I4O A;  5EAY A;  3C1F A;  1PH9 A;  4BY7 B;  3QOL A;  2OQ0 A;  4FDB A;  2V4D A;  1LAC A;  3MHB A;  1ZKO A;  1XNQ Q;  3M7N A;  2B2U A;  1A3T A;  5FOB B;  1TII D;  2NB0 A;  1LV9 A;  3OMG A;  1ESR A;  3ULL A;  2R7Z B;  4RKB A;  1E3P A;  3A7A B;  3K5N A;  1PFM A;  4A3B G;  4JK1 C;  4CJ1 B;  5K36 H;  1IBK Q;  1BNZ A;  5BN3 A;  1PH6 A;  1S5F D;  3U4V A;  1I4R A;  3CRL C;  3CF5 A;  1YNJ C;  3DM3 A;  3DLL A;  2BOS A;  3MC0 B;  5M5W H;  3WOF A;  1EL0 A;  4IPC A;  5E4W C;  1B2T A;  1YHB A;  5CMD A;  5C5L A;  2RA4 A;  3EBE A;  1Y14 B;  1PH4 A;  1J8I A;  1CA5 A;  3TME A;  1JJG A;  2AUK A;  2R7D A;  4LFC L;  3QG1 A;  4XT1 B;  1Y1V G;  4ZK9 B;  4A3J B;  4AYB B;  5IGE A;  4GS3 A;  1GKH A;  3J7Y W;  2Q2T A;  2QIL A;  4LNQ A;  1WTR A;  4DR6 L;  5E4X A;  4X64 Q;  3PO2 H;  1SNM A;  3M3Y H;  3MXN A;  2B2W C;  3KBX A;  4NXM Q;  2HHH Q;  4EQP A;  2EJM A;  3JAM c;  3HOZ H;  4LFC Q;  3M4O H;  3GTK H;  1A62 A;  5KEE A;  4PG3 A;  5DNF A;  3FVQ A;  1CA6 A;  2KHJ A;  4FF4 A;  2R92 B;  3JAM i;  4P72 A;  2KVM A;  3PIO A;  4JI2 L;  4XYO A;  1IHZ A;  2ICI A;  1SE2 A;  4O1N A;  1EWC A;  4V19 0;  3KF8 B;  1SJH D;  1SAP A;  1OTC A;  2A8V A;  4DV5 L;  4JC0 A;  3TRE A;  1BBW A;  2NWG A;  4KD3 A;  5I6Y A;  2RDF A;  3M85 A;  1IBL Q;  3OHX C;  3OMC A;  2HDM A;  3NUC A;  4R4C A;  5JAV A;  4JOI A;  5IGF A;  1QG7 A;  1JB7 A;  2NN6 H;  3FKI B;  1XPU A;  4MTN A;  2WAC A;  2L12 A;  5JJZ A;  1F77 A;  4DV3 L;  3K5M A;  1UNS A;  3OPO A;  1DOL A;  2EJF C;  2ENB A;  1CFM A;  1A63 A;  2KJX A;  1TY0 A;  2UXC Q;  1YNN D;  5CGK A;  2F3V A;  4A3L G;  2XRQ D;  1JCK B;  1B9N A;  4YWL A;  1KXL A;  3BDC A;  4BWG B;  2I46 A;  4U68 A;  2BA1 A;  3CCS A;  4X3K A;  2VB2 X;  2F0D A;  3HOU B;  1SNO A;  2VXW A;  3UDG A;  4A3G B;  3I90 A;  1LT3 D;  2F0J A;  4JVZ A;  4UAI A;  3T4A C;  3TQY A;  1A6X A;  3DM1 A;  1E24 A;  2WII B;  5AFW A;  4IUP A;  1J5E Q;  3I56 A;  4PMW A;  4DAP A;  1W3S A;  5L37 A;  1K8G A;  1G8Z D;  2ZJR A;  1U4M A;  5IP9 H;  4YWK A;  2C9O A;  1BBU A;  2NBF A;  4AH6 A;  2Q2I A;  5EPL A;  4NP5 A;  1DOK A;  2L5T A;  1VQ4 A;  3GTL B;  1ZXT A;  1UWV A;  1ML0 D;  1HZC A;  4NKL A;  1I6V C;  3PV0 A;  2EVB A;  4OEM B;  3CCU A;  4DV6 L;  4UP9 A;  3M4Y A;  1F2L A;  1NNX A;  4DFA A;  1H9M A;  2Q2H A;  4AYB E;  4LAA A;  4EX5 A;  4B3T Q;  3HS0 C;  2K01 A;  1T9H A;  1EOT A;  3LWE A;  3V05 A;  3MZ5 A;  2CH4 A;  3BZD B;  4DXF A;  5H1S E;  1O7L A;  5FO7 B;  2F0N A;  2JN4 A;  2CQA A;  3AU7 A;  3NWT A;  4X66 Q;  5HGQ A;  1E7Z A;  2WKD A;  3VYT A;  5IWA L;  2KHS A;  2ZXP A;  3J80 c;  2IY5 B;  2E2D C;  5EGT A;  3TP6 A;  1AP0 A;  2PPB C;  5BR8 Q;  2ZT9 C;  2RDH A;  3AQQ A;  3TS0 A;  1FR3 A;  1CT1 D;  4CBV A;  1KNE A;  2SNS A;  2Z6B A;  4POG A;  4K8J A;  2PMZ E;  5C4X H;  2D62 A;  4X62 Q;  3PO2 B;  2OWO A;  1B50 A;  2O5J C;  3HGB A;  4AYB G;  2WAQ E;  4DF7 A;  3SVM A;  3KLW A;  1Y8P B;  4C1N K;  4MIU A;  4NDX A;  1G29 1;  3R93 A;  3TRZ A;  3GDE A;  1K28 A;  1QUQ A;  4YHH Q;  4FF2 A;  2R92 H;  1JIC A;  2KA7 A;  4JI8 Q;  4ALP A;  3RMH A;  1C48 A;  1XTC D;  4C3J B;  2A19 A;  5EBC A;  2M9V A;  2F0E A;  4LF5 Q;  2EIF A;  4DR3 L;  5IY0 A;  1BF4 A;  4A3I G;  1KIX A;  4DAM A;  1I94 Q;  4K0K L;  3EA6 A;  3O13 A;  2WB1 B;  3CCM A;  4C3I B;  4R4T A;  4CKE A;  4UPA A;  4GLV B;  4BBR G;  1YJ9 A;  1EYA A;  1FYC A;  2XWJ B;  2ICE C;  4GLA C;  1PTO D;  1E22 A;  4MNO A;  1KAW A;  1SMX A;  4QIW E;  2CVR A;  3T1Y L;  3CD6 A;  4DR3 Q;  1BQQ T;  2K5H A;  3Q6S A;  5IGG A;  1Q82 C;  3A54 A;  4QF4 A;  4K2K A;  4C2M H;  4CGY B;  1TWC B;  4GKK L;  4A3C G;  5COY A;  5CV8 A;  4GN3 B;  4LUZ A;  3T56 B;  2WAQ G;  2E76 C;  1KHI A;  5KNB A;  3GQB A;  5M5Y B;  3H91 A;  3IAY A;  1JWM D;  1EZ8 A;  3I2Z A;  3MA2 B;  2R7F A;  1GUN A;  2DN8 A;  2NTS A;  3WWV A;  5I9O A;  2MPM A;  2F0I A;  3VDY A;  1PTO C;  2NVQ B;  4C3H G;  4IUR A;  3BVZ A;  2DY8 A;  4GNX C;  4A3K B;  2PW5 A;  3NEM A;  4WRD A;  1X3E A;  1Y1W B;  3FPP A;  3DEP A;  2F0V A;  5A35 A;  4ZCK A;  1JOK A;  3NQT A;  5JEA G;  3FDT A;  2SDF A;  3HOU H;  2JEB I;  1ET6 A;  1RJT A;  2J7Z A;  4M8A A;  2LSS A;  1MIU A;  2FFK B;  3E0J A;  3KK7 A;  3RNU A;  1G51 A;  3GO5 A;  2EXZ A;  4ZRZ A;  2IX3 A;  1YJN A;  3CCL A;  1XWE A;  4LF4 L;  1FL0 A;  4OON A;  2E8G A;  2OTJ A;  3HOV B;  4A3G G;  3JAM L;  4OHJ A;  3RZO B;  3G71 A;  1D1K A;  1AH9 A;  4ABN A;  1O7Y A;  5M5X B;  4OEL B;  4BXX G;  4C56 C;  4DV2 Q;  1ONL A;  3K5L A;  1WOC A;  1RL2 A;  1DCZ A;  3PQI A;  1BR9 A;  3PGZ A;  4GLX A;  3NXW A;  1NSN S;  3ERO A;  2F0L A;  3LNN A;  4TSS A;  1NJI C;  4A3C H;  4IPG A;  4OWX B;  2B29 A;  3J80 L;  4BBS H;  1Q1B A;  1B3Q A;  5DAU A;  5J39 A;  3HOY B;  3MEH A;  3P75 A;  2TMP A;  3R8B A;  1BDO A;  4DAV A;  1ILQ A;  5BN5 A;  4A3M G;  1VQD A;  4NPS A;  3HOW B;  2YU9 H;  3FMC A;  2DGY A;  2FMM A;  1EY8 A;  4CDC C;  4X65 Q;  2OXP A;  4B08 A;  1TXY A;  1KAA A;  2X6G A;  1V1O A;  1JE5 A;  1PFN A;  2ZM6 Q;  1EQQ A;  3IFD A;  4LUV A;  2PCF B;  4A3I H;  1QB5 D;  2DUD A;  2AQ3 B;  3GTG H;  1X3P A;  2LY7 A;  1QJO A;  2I5H A;  2JA8 H;  1HA5 A;  1D5M C;  1VQK A;  2MNA A;  5D3D A;  1RTN A;  2WIN B;  4IUN A;  2CCZ A;  5HY6 A;  2ZXR A;  1K3R A;  1EYD A;  5C3W A;  1LTR D;  1STA A;  3E3X A;  1JT8 A;  3HKS A;  2I5L X;  2PNH A;  4ZUI A;  2UXB L;  4A3E B;  4L5Q A;  3S17 B;  4RHR A;  4X3U A;  4TKO B;  1EY7 A;  2RSO A;  1ENC A;  4MZ9 A;  3ZYY X;  2BCO A;  5CV4 A;  4CKB A;  5M3F H;  1SNQ A;  4JI1 L;  1I4X A;  5C0X I;  1RDP D;  2K5N A;  2K5W A;  2JK8 A;  3KLS X;  4LFA Q;  3NPP A;  4OWT B;  2E2J H;  1NTG A;  3PO2 G;  4DK0 A;  4GNX B;  2F0M A;  3FEW X;  5FJ8 G;  3E5S A;  1AEX A;  1PRT B;  1K83 H;  4FF3 A;  3K58 A;  1MJC A;  5DLQ E;  1NR2 A;  3CC2 A;  4HIO A;  1Q8K A;  2PI2 E;  2CW0 D;  2UU9 Q;  5JEA H;  1A3U A;  5C3E G;  3GTM B;  3HKZ E;  4EQO A;  2L11 A;  3NTH A;  1IBM Q;  3U9O A;  1KDB A;  5LHY 1;  5FKA C;  3ULP A;  2AWO A;  3KLR A;  2K05 A;  4YCW A;  1V43 A;  2WB1 G;  1CK1 A;  1LTG D;  4IAL A;  3GTO B;  1TWC H;  1PYS B;  1XYI A;  1X56 A;  3LGJ A;  1K3B C;  1K8O A;  1TS2 A;  2DY7 A;  4R8I A;  4POF A;  2UXD Q;  3VR6 A;  1U5K A;  4NB3 A;  2JE6 I;  5IP9 G;  3VYR A;  1Q3L A;  3WDN A;  2JA7 H;  1SEB D;  2VUM G;  3V96 A;  2HQL A;  2NVT H;  1EOV A;  1DZ1 A;  2F0G A;  2JA7 B;  1PFS A;  4A3B B;  4KJO A;  2DNE A;  1ET9 A;  4KK7 A;  4YWM A;  1LT5 D;  2CQO A;  1M1K C;  1Y1W G;  2ZTE A;  4K2L A;  4A3G H;  5EKL A;  3HOU G;  2E2H H;  5ELE A;  1STE A;  1I3Q B;  2F0K A;  4IOC A;  5GRO A;  4FF1 A;  1JJC B;  2CWP A;  3JC6 6;  4XTC S;  2B2V C;  2MJ8 A;  2LXK A;  4JI3 Q;  3KDF A;  3S14 B;  3TSS A;  2UXC L;  4DV7 Q;  4JI7 Q;  4PZ8 A;  4B3S Q;  2EZV A;  3D3R A;  4IPD A;  4HJA A;  3H09 A;  2KUM A;  2JA5 H;  1BXT A;  4UY8 C;  2RCN A;  1EIY B;  4HMI A;  1VQO A;  5JVH 3;  1SR3 A;  3KYH C;  3E9I A;  1I50 B;  1EY9 A;  3GTL H;  1RF2 D;  1C4Q A;  1VQE A;  1HZA A;  2I5M X;  1TWH B;  3A5Z B;  1TWG B;  3HZX A;  4IOA A;  2D0O A;  2H4O A;  2R7Z H;  1TWH H;  3R2I A;  3BS1 A;  4KY7 A;  4HR7 B;  2XRS D;  3BU2 A;  1STY A;  4NXM L;  4DNT B;  1BBX C;  1I6H H;  3TP8 A;  1JWS D;  4KV6 A;  4DK1 A;  4HN7 A;  1VMC A;  1WTX A;  1A3V A;  1STH A;  5ELN A;  2Y0S G;  3TEH B;  4A3M B;  3NBH A;  2FHT A;  1K73 C;  1FNV A;  4XDX A;  4Y7N B;  4Q0F A;  3ULJ A;  3TZD A;  4K6D A;  2BE5 D;  1ASY A;  3GTG B;  4DV1 L;  4BY1 B;  2WP8 J;  1HNZ L;  5IT9 L;  3I72 A;  2JA7 G;  1Q46 A;  2JSO A;  1W2B A;  1WCM G;  1TWF B;  5NUC A;  3MEF A;  3RD4 A;  2M00 A;  4ME3 A;  2D0P A;  2QEJ C;  3E9H A;  1IL8 A;  1W6K A;  2PW7 A;  3NEN A;  2GVA A;  3PUW A;  2K5D A;  4QL5 A;  3HFZ B;  2SOB A;  4DUZ Q;  2R93 B;  4DR6 Q;  2JA5 G;  1EIF A;  1WYD A;  2LXJ A;  1L1O C;  4X3T A;  4KD4 A;  3PIO 3;  1JOO A;  1B3A A;  2Z1C A;  4LF9 Q;  3K5O A;  4JI6 L;  4DV3 Q;  4A3F H;  5C3E H;  2UUA Q;  2Q8R E;  1X65 A;  4TRD A;  1B44 D;  1VQ6 A;  4JW0 A;  4JI2 Q;  2E75 C;  4N9T A;  1PRT F;  3ZJY C;  2VNU D;  3BYY B;  1D8L A;  1KNA A;  2QA4 A;  4J15 A;  2VQE Q;  2PYK A;  1STN A;  4CKC A;  1V1Q A;  4Z9C B;  4LF7 L;  4RGN A;  3BDL A;  3CW2 C;  4J8Q A;  1SJE D;  3LWU A;  5I2Y A;  2QF7 A;  5COR A;  3CCV A;  3NQI A;  1ESF A;  2J4X A;  1IBL L;  2HCI A;  1XJV A;  1M90 C;  1AFP A;  4LK1 C;  1VQ9 A;  2N49 A;  2AHO B;  4A3D G;  1KLU D;  2Y0S B;  1HCZ A;  1YNJ D;  4DR2 Q;  4DAY A;  4I7A A;  1VQC A;  3R2T A;  1EY4 A;  3UE1 A;  1GM5 A;  1VQL A;  3MVV A;  2K5V A;  3URY A;  2YTY A;  4JV5 Q;  3A74 A;  3NTK A;  4JCV E;  2E74 C;  3H0G G;  3ONA B;  1SYC A;  3P7J A;  5CC4 A;  2MQH A;  4A3K H;  1GUS A;  1EWH A;  1E1T A;  2OEO A;  1PTO H;  4L5T A;  4UDU C;  3M3Y B;  5DEH A;  2L0C A;  1VQA A;  1D2B A;  1DON A;  5ELF A;  1EY5 A;  1FGU A;  2JEA I;  2HDL A;  3W1B A;  2XN9 C;  4X62 L;  1F2M A;  3DWA A;  1L0W A;  1HNW L;  2ZTD A;  1EIH A;  4QUF A;  4EVO A;  5LMN Q;  1J5E L;  1X6O A;  3SK8 A;  3NHH A;  3MXG A;  3X3N A;  1JQY D;  1CKO A;  3HRZ C;  4JI4 L;  2DJF C;  3KF6 B;  1S40 A;  2QKI C;  3U50 C;  1STB A;  3HOZ G;  3KOJ A;  3D4D A;  3EQL C;  4L6T B;  2RHQ B;  1QCB D;  2Z8L A;  2Z0S A;  4BBS G;  2IHF A;  1I4Q A;  1Z47 A;  1JE4 A;  1NY4 A;  1X54 A;  2EY1 A;  3RLN A;  3A5U A;  3FRP B;  4ZQ3 A;  3M9B A;  1PVO A;  4IFD H;  1B8A A;  1L0X B;  3H15 A;  1YJW A;  4QQB X;  4FXG C;  5IYC G;  3NP8 A;  2ID0 A;  4A93 G;  3W5O A;  3S1N B;  4LUO A;  2KEC A;  4XYQ A;  2BDO A;  3BZK A;  3GV6 A;  1BUV T;  4APV A;  4O42 A;  3I4M H;  3PIP 3;  2F0H A;  3S2D B;  1EQV A;  4OWW B;  5T1I A;  4EGV A;  2IWH A;  1VQG A;  4BA2 I;  1SRU A;  1KQS A;  1EYG A;  2VZA A;  1GXD C;  3OTO Q;  1B4O A;  2EOT A;  3ICE A;  3CCR A;  3RUZ A;  4GOP C;  3P20 A;  2MFI A;  2D2C C;  2HUG A;  3PF5 A;  1RHP A;  3OSO A;  4JBM A;  3DWP A;  3J81 j;  1EZ6 A;  1LT6 D;  4H0L C;  4KKS A;  3BYT B;  1Q81 C;  1WCM B;  3RLF A;  4A3E H;  2GN5 A;  3S17 H;  2R93 H;  5LMN W;  2K52 A;  1LO5 D;  2VQF L;  3I4N G;  4L5R C;  1MI2 A;  2Z6K A;  4AIM A;  4X65 L;  1AZP A;  3PO3 B;  2EE1 A;  2F0S A;  1EFW A;  4F88 A;  3EFX D;  1EQR A;  3QOJ A;  3OTO L;  3HOZ B;  1H95 A;  3TBI B;  4RGO S;  4ZAI A;  1PXU A;  4OIJ A;  5FLX E;  3F2U A;  5ELD A;  5DM7 3;  3NBH B;  4JI0 Q;  4KHZ A;  2QCP X;  1LM0 A;  1V9P A;  1O7I A;  1LLR D;  3TDQ A;  2XSC A;  3OWF A;  1EQT A;  1Y8N B;  2EYH A;  3SR1 A;  2B2U C;  3DWQ A;  1S5B D;  1C8C A;  3A56 A;  3KBG A;  1ROD A;  1DGS A;  3F1Z A;  1PH8 A;  4KHV A;  1YNX A;  5JJI A;  1DXM A;  5EKI A;  1YNN C;  4JG2 A;  3PMF A;  1F2Z A;  1LYL A;  1D7Q A;  4FXD A;  3CPF A;  1N33 Q;  2KEE A;  4K5V A;  4GKK Q;  3J7A F;  4A76 A;  4L63 B;  5KGU A;  3FKI H;  4XIG S;  3GTP B;  1HR0 W;  1PZJ D;  1GO3 E;  4JBW A;  1JR0 D;  1QIL A;  2HQE A;  1BKB A;  4P75 A;  3S16 H;  5C4X G;  3A7L A;  1BCP B;  1VQN A;  2YV5 A;  2PI2 A;  2ZJQ A;  3I73 A;  2H5X A;  1VDZ A;  2NVT B;  1Y8O B;  4JPB W;  2UXB Q;  1GUW A;  3I4N B;  2K6A A;  3SE0 A;  1WVL A;  2Q2U A;  1K0R A;  3H6M A;  2BH8 A;  3F2D A;  4DN4 M;  1HH2 P;  5IP7 H;  1II3 A;  1T5X D;  2Z4I A;  3NWS A;  2HIV A;  5BN4 A;  4EQ5 A;  2XWB B;  5CYU A;  2KBN A;  1IW7 C;  2ES2 A;  1GJX A;  4G57 A;  2B3G A;  1SFO H;  2TSS A;  4B3M Q;  1KLG D;  2EYP A;  4IN3 A;  2YTV A;  3NTI A;  1RKN A;  4LWC A;  3PUY A;  4QY7 A;  3M4P A;  1K8A C;  4A3E G;  1O80 A;  1F2Y A;  2DJG C;  5GAD C;  2KOL A;  2A5H A;  2P5Z X;  1E2W A;  3HOY H;  4O2D A;  2JYO A;  1IZ6 A;  1JWU D;  1CKN A;  1NAP A;  5M3M H;  2KHI A;  3VR5 A;  1IBM L;  3UDX A;  1AE3 A;  5C44 G;  2B63 B;  4KY6 A;  2EYO A;  2IX0 A;  3OIP A;  1MGS A;  3ERS X;  2B63 H;  4ZKB B;  3E0E A;  1BCP F;  3I8Z A;  1E1O A;  4A3I B;  5KYL A;  3F2B A;  1PLF A;  1Y1W H;  4DNR B;  2N3S A;  2D9U A;  4OGQ C;  1YVC A;  3RZD H;  1JMC A;  3CC4 A;  1LT4 D;  2WB1 E;  2UXD L;  5EPK A;  2K75 A;  3I70 A;  5CV7 A;  1KTK A;  1H9J A;  3AFQ A;  4C3I G;  4KMU C;  2F0T A;  2JA8 B;  1W6J A;  2KCT A;  3S1M H;  2UU9 L;  2PQA A;  1CUK A;  1WTQ A;  4LF8 L;  1NR4 A;  4L5S A;  1FGB D;  3RN5 A;  2HD3 A;  4ID6 A;  1X3F A;  4IUU A;  2A6E C;  5FLX L;  2OTL A;  1VF5 C;  3K81 C;  1N32 L;  2O4X A;  5IOD A;  3RR5 A;  1EIG A;  3SDZ A;  3GP7 A;  3KDF B;  4NMZ A;  3CXC A;  3J80 E;  2BA0 A;  5M3F B;  4UP8 A;  3CU7 A;  1J9O A;  1UE5 A;  2IPK D;  2XVS A;  3PUZ A;  3PCO B;  5I4D A;  1LAB A;  2OQK A;  2HIX A;  3U58 A;  1QNU A;  3I91 A;  4H7B A;  3KLS A;  3D8G A;  2NUC A;  5TSS A;  4DNI A;  5LMU Q;  1WD0 A;  2YU9 B;  4N8F A;  1JOR A;  3TZU A;  4GZY C;  1AN8 A;  4RCN A;  1K9M C;  3IFT A;  5AJ3 Q;  3GV3 A;  3TS2 A;  4OO1 G;  4DXG A;  4KN7 C;  1R4P B;  5IYB H;  5CV5 A;  4ILW A;  3EJI A;  2B2T C;  3STB D;  3T51 B;  1WTP A;  5IIF A;  3BG3 A;  5LMU L;  1Q1E A;  3UE0 A;  1SMY D;  5JJK A;  1HZB A;  4K8I A;  4A4I A;  2UUA L;  3I55 A;  4LF8 Q;  1Q90 A;  2RCF A;  1CHP D;  3MFG A;  1NCV A;  4CDD C;  2JA8 G;  1OXT A;  3L0O A;  3MTS A;  4MN3 A;  2Q8T A;  5C0X G;  4LFB L;  1ZYR D;  4KKT A;  2GA4 B;  2JA6 H;  2JQO A;  4DR5 Q;  1HZ9 A;  4KTA A;  3K7A H;  1F9Q A;  1HR0 L;  4G4K A;  1IW7 D;  3H0G B;  1SYB A;  1YEZ A;  5M3M G;  1QVC A;  1CKN B;  1SNP A;  3H0G H;  1SXT A;  3C1E A;  4KI0 A;  2E2H B;  5GAE C;  4ZUJ A;  1QVG A;  3G4S A;  1R4Q B;  1CQF A;  2FXQ A;  1MJE A;  3FKI G;  2MUY A;  4KLK A;  1CQV A;  4B3R Q;  1IKM A;  2QW7 A;  1I3Q H;  1V8Q A;  3CQZ H;  4R4O A;  1NMG A;  2PZW A;  2E5L Q;  1SLJ A;  3A55 A;  1SFO B;  3NK9 A;  4H44 C;  3MXN B;  1I4P A;  5M5X H;  5M3F G;  4LW1 A;  2RF4 A;  1HJP A;  1OXX K;  1PH2 A;  2ZTC A;  3S14 H;  1F9P A;  3GTM H;  5ISR A;  3NEL A;  5ELB A;  4LF7 Q;  2E2I H;  5D65 A;  3S15 H;  1ASZ A;  4DU9 A;  1WFQ A;  4NW2 A;  3D6W A;  3HP3 A;  5D3I B;  1LTL A;  3S15 B;  1H9K A;  5IWA Q;  2FIN B;  3TP5 A;  2BDN A;  4BBS B;  4L8J A;  1TWG H;  3RLO A;  3SK6 A;  2RBM A;  3U4Z A;  5LMN L;  1X3Q A;  4U67 3;  4OXP A;  4K5W A;  4FP5 D;  1EEF D;  5C44 B;  2B63 G;  2NVX B;  3PUX A;  3K7U C;  1WTW A;  3RZD B;  2ZJP A;  2O2L D;  5IT9 E;  2MGS A;  3NE5 B;  5FJ8 H;  2EQS A;  2CWA A;  1PYW D;  2KEN A;  5C0X J;  5ELC A;  3PIP A;  3Q24 A;  4DUY Q;  1ZEQ X;  4DV4 Q;  2M2L A;  4I7Z C;  1G6Z A;  1N8R C;  4CJ0 B;  4CDF C;  3CMA A;  1AE2 A;  4JYA Q;  2E5L L;  1PMR A;  3KFU A;  2A68 C;  4HIM A;  3OWE B;  3RZO H;  5KND A;  5EKK A;  2V1C C;  2K03 A;  4N9P A;  3VYS A;  4HJ9 A;  1A2T A;  1VQ8 A;  2OCE A;  3S2H B;  5EPJ A;  2Q8I B;  3TP7 A;  4GN4 B;  3S1Q H;  1BCP D;  4WJW A;  3A8J E;  1PH5 A;  3KF6 A;  2RVL A;  4HCS A;  3GTJ B;  2VUM B;  1N9W A;  1I50 H;  2CW0 C;  4ZLT F;  4BY7 H;  2R61 A;  4A3F B;  1DJR D;  1MKH A;  2VY3 A;  3UDF A;  5C0X H;  3PUV A;  3J81 L;  1EEI D;  4HCE A;  3T1Y Q;  2IW3 A;  1XMQ Q;  3QR8 A;  4F8M A;  1A0I A;  1ENF A;  1ICF B;  2NN6 I;  3AEV A;  2B2V A;  4YHH L;  4X66 L;  4LF6 L;  3BVM A;  1I6H B; 
#chains in the Genus database with same CATH homology
 3M4Q A;  3HOX H;  5IYD G;  1KRT A;  3KF6 B;  1S40 A;  4POG A;  3U50 C;  3HOZ G;  2PMZ E;  2MO0 A;  5C4X H;  1VQF A;  2D62 A;  3KOJ A;  1OXV A;  1TWA H;  1YHQ A;  4A3L H;  4X62 Q;  2JA9 A;  2OWO A;  1FJG Q;  3CCQ A;  2NVX H;  1LUZ A;  2RHQ B;  4Y7N H;  4AYB G;  2WAQ E;  4LF5 L;  3KLW A;  4DUY L;  4DV4 L;  1PV4 A;  2Z0S A;  4BBS G;  1G29 1;  1VS0 A;  1Z47 A;  2IHF A;  1NY4 A;  4DV6 Q;  3TRZ A;  3GDE A;  1VQ7 A;  4K0K Q;  1X54 A;  3RLN A;  1UE7 A;  1QUQ A;  4YHH Q;  3A5U A;  1VQB A;  2KCM A;  3GTO H;  5JJL A;  2R92 H;  3M9B A;  1PVO A;  1B8A A;  1XPO A;  4JI8 Q;  3H15 A;  4ALP A;  1YJW A;  4QQB X;  3K8A A;  5IYC G;  2ID0 A;  5IYD H;  4JV5 L;  4A93 G;  3W5O A;  4B3T L;  3T1H L;  2A19 A;  4LUO A;  3J80 i;  1XPR A;  1YIT A;  3BZK A;  4LF5 Q;  2EIF A;  4DR3 L;  5IY0 A;  1L2F A;  4A3I G;  1KIX A;  4DAM A;  4APV A;  3HOV H;  4BBR H;  1I94 Q;  4K0K L;  1CSQ A;  3I4M H;  3CC7 A;  1XNR Q;  1QUQ B;  3CCM A;  4DR4 L;  2UUB L;  4OWW B;  5FLM G;  2A1A A;  1VQG A;  2RHS B;  4BA2 I;  4BY7 G;  4R4T A;  4JI5 L;  1SRU A;  4IFD G;  4UPA A;  4GLV B;  1KQS A;  4BBR G;  1YJ9 A;  1EYG A;  2VZA A;  1GVP A;  4GOP A;  2R7Z G;  4GLA C;  4MNO A;  1E22 A;  4QIW E;  1KAW A;  1SMX A;  2VW9 A;  3CCR A;  3T1Y L;  1N34 L;  4DR3 Q;  3CD6 A;  3J7A 5;  3G48 A;  2K5H A;  1GD7 A;  3K0X A;  4GOP C;  4BY1 G;  2AKW B;  1Q82 C;  1N33 L;  2MFI A;  3PF5 A;  4C2M H;  4GKK L;  4A3C G;  1HNW Q;  3OTO Q;  4JBM A;  4GN3 B;  4LUZ A;  3BJU A;  2WAQ G;  4A3F G;  1KHI A;  4LF6 Q;  3UDI A;  1VQH A;  3J81 j;  2UUB Q;  1HNX L;  1IL2 A;  3I2Z A;  2R7F A;  1Q81 C;  3WWV A;  4IFD I;  3RLF A;  3VDY A;  4A3E H;  2GN5 A;  5GAH C;  3S17 H;  4IFD J;  2R93 H;  5LMN W;  2GVB A;  2K52 A;  2VQF L;  3CPW A;  1FJG L;  3HOW H;  2PQA B;  1PA6 A;  3PO3 G;  4GNX C;  3I4N G;  1CSP A;  4L5R C;  1P8L A;  3NEM A;  2Z6K A;  4AIM A;  1X3E A;  4X65 L;  1BVS A;  4YCV A;  1EFW A;  2AMC B;  1EQR A;  3OTO L;  1H95 A;  3HOX G;  5JEA G;  4OX9 L;  2VS1 A;  3HOU H;  1HNX Q;  1P16 A;  2JEB I;  2K50 A;  2LSS A;  1MIU A;  4JI8 L;  1OXU A;  4DV2 L;  3RNU A;  3NBH B;  1SN8 A;  4JI0 Q;  4KHZ A;  1S3O A;  1LM0 A;  1Y1V H;  4R4Q A;  1Z9F A;  1G51 A;  1X3G A;  2YYZ A;  3GO5 A;  1V9P A;  1O7I A;  3CME A;  4A75 A;  3S1N H;  1YJN A;  3CCL A;  2JA6 G;  4WJ3 M;  4LF4 L;  1FL0 A;  4GN5 A;  2UUC L;  4OON A;  2E8G A;  2OTJ A;  1EUJ A;  4DV0 L;  1KD1 C;  1YBY A;  4A3G G;  3K80 C;  4KHP L;  3F8T A;  4OX9 Q;  1DGS A;  1NBW A;  3G71 A;  1XNR L;  1AH9 A;  3S2D H;  3F1Z A;  4BXX G;  1PH8 A;  5C44 H;  1Q7Y C;  1VQ5 A;  4DV2 Q;  1YNX A;  4A3B H;  1WOC A;  2F4V Q;  5JJI A;  1RL2 A;  4IO9 A;  2R6G A;  3GD7 A;  1N36 Q;  1KRS A;  3PGZ A;  4JG2 A;  4LF4 Q;  3HOY G;  2VUM H;  4GLX A;  1LYL A;  1NMF A;  2UUC Q;  1D7Q A;  3CPF A;  3J7Z C;  1N33 Q;  1QZH A;  4TVA B;  1NJI C;  4A3C H;  3KJO A;  4IPG A;  4GKK Q;  4DR7 Q;  2IHE A;  4OWX B;  4A76 A;  3FKI H;  2B29 A;  1QVF A;  2F52 A;  1L1O B;  4BBS H;  1Q1B A;  4XIG S;  4LFA L;  3OW2 A;  4HJ8 A;  1HR0 W;  2AWN A;  3KJP A;  3CCJ A;  1JJ2 A;  1GO3 E;  1WCM H;  4JBW A;  4A3M G;  4DK3 C;  1OXS C;  5IP7 G;  2VQF Q;  2NZO A;  1VQD A;  1BKB A;  4NPS A;  4P75 A;  1N36 L;  3D0F A;  1XMO Q;  3S16 H;  2YU9 H;  5C4X G;  1A8V A;  2DGY A;  4DR1 Q;  4X65 Q;  4DPG A;  2CKZ B;  2YV5 A;  1VQN A;  2HT1 A;  2PI2 A;  1TXY A;  3S1R H;  2ZJQ A;  1JE5 A;  1J6Q A;  5C4J H;  5GQO A;  1PH3 A;  2H5X A;  2ZM6 Q;  1EQQ A;  1R9T H;  4LUV A;  4A3I H;  1L1O A;  3Q8D A;  2DUD A;  5E7N A;  2I0Q A;  3GTG H;  2UXB Q;  1YIJ A;  4JI0 L;  2I5H A;  4B3M L;  4DK6 C;  1G6P A;  2JA8 H;  5IYC H;  3CAM A;  1U0L A;  2Q2U A;  1K0R A;  3S24 A;  2BH8 A;  1VQK A;  2MNA A;  3F2D A;  2F3I A;  4DR1 L;  5IP7 H;  1HH2 P;  4DKA C;  3CCE A;  2CCZ A;  4DV0 Q;  5J3B A;  5HY6 A;  1K3R A;  2ASB A;  2HIV A;  4JI1 Q;  5GAG C;  4EQ5 A;  2MO1 A;  4KHP Q;  1C0A A;  4X6A H;  2KBN A;  1S72 A;  1JT8 A;  3HKS A;  4A3K G;  2ES2 A;  2I5L X;  2PNH A;  2B3G A;  1SFO H;  2UXB L;  4L5Q A;  5JEA J;  4BA1 I;  2F4V L;  2K4K A;  4B3M Q;  4A3M H;  4QJF A;  1UE6 A;  4MZ9 A;  2YTV A;  4LWC A;  1B70 B;  3PUY A;  1PHJ A;  1X9N A;  4QY7 A;  3M4P A;  1K8A C;  4BY1 H;  4A3E G;  2WFW A;  4PZ7 A;  5M3F H;  2BH2 A;  3FHW A;  4JBK A;  4JI1 L;  4DR7 L;  3G6E A;  5GAD C;  5C0X I;  2K5N A;  4H02 A;  2JK8 A;  4LFA Q;  1KL9 A;  4OWT B;  3GTP H;  1XTD A;  1NTG A;  4O2D A;  2E2J H;  2NVY H;  3HOY H;  3PO2 G;  1TWF H;  4Y52 H;  1WJJ A;  1IZ6 A;  2JJQ A;  1CKN A;  4P73 A;  5M3M H;  3FP9 A;  5FLM H;  5FJ8 G;  4GNX B;  2KHI A;  4IJL A;  4A3J G;  2Z6K C;  1IBM L;  3UDX A;  1AE3 A;  1K83 H;  3F2C A;  5C44 G;  1XMO L;  2IX0 A;  3H3V H;  1MJC A;  3ERS X;  4GKJ Q;  2B63 H;  4YY3 Q;  5DLQ E;  3CC2 A;  1VQJ A;  2CFM A;  3HKZ G;  4HIO A;  1Q8K A;  2ZM6 L;  2PI2 E;  3E0E A;  4A3J H;  4AQY L;  1XNQ L;  1X55 A;  2UU9 Q;  1E1O A;  2L15 A;  4A93 H;  2NVQ H;  5C3E G;  1SE8 A;  3HKZ E;  3F2B A;  1Y1W H;  2N3S A;  1C7Y A;  1YVC A;  4JBJ A;  3RZD H;  2IX1 A;  1JMC A;  3CC4 A;  4B3S L;  5IT9 c;  2WB1 E;  5ELO A;  1WI5 A;  2UXD L;  1IBM Q;  2K75 A;  3GTJ H;  4X64 L;  5AJ3 L;  3PO3 H;  3I4O A;  5EAY A;  1IBK L;  3PSI A;  1PH9 A;  3AFQ A;  4JOI C;  2XTI A;  4YY3 L;  2OQ0 A;  2AWO A;  3I7F A;  3ULP A;  4YCW A;  1V43 A;  2WB1 G;  4FDB A;  3EN2 A;  1KC8 C;  2KCT A;  1XNQ Q;  4P71 A;  3M7N A;  2UU9 L;  3S1M H;  1TWC H;  1PYS B;  3J81 c;  2PQA A;  3ULL A;  1CUK A;  1X56 A;  3A0J A;  3LGJ A;  4HID A;  4LF8 L;  1E3P A;  4L5S A;  4C3H H;  4OO1 I;  4POF A;  3RN5 A;  2UXD Q;  4A3B G;  1U5K A;  4NB3 A;  2JE6 I;  1X3F A;  5IP9 G;  1IBK Q;  1RIP A;  1C9O A;  1UE1 A;  4O0A A;  1PH6 A;  2OTL A;  3K81 C;  3U4V A;  3CF5 A;  2JA7 H;  1N32 L;  2VUM G;  3DM3 A;  3DLL A;  2HQL A;  2K14 A;  2NVT H;  1EOV A;  3EIV A;  3RR5 A;  5M5W H;  1PFS A;  4IPC A;  1PYB A;  3KDF B;  3CXC A;  4YWM A;  3I4M G;  4GNX A;  1YHB A;  4IPH A;  2BA0 A;  1Q86 C;  4UP8 A;  2CQO A;  1I5F A;  1UE5 A;  1Y14 B;  3EBE A;  3RN2 A;  1PH4 A;  1M1K C;  4DV1 Q;  1Y1W G;  2ZTE A;  3OYY A;  3PUZ A;  3PCO B;  4A3G H;  1JJG A;  1FVI A;  2OQK A;  3HOU G;  5IE8 A;  2HIX A;  3U58 A;  2E2H H;  4GKJ L;  1N32 Q;  4HJ5 A;  4PZ6 A;  2R7D A;  4LFC L;  5M5Y H;  4IJH A;  5GRO A;  4IOC A;  1JJC B;  2CWP A;  3JC6 6;  4XTC S;  4QGU A;  4AQY Q;  4DNI A;  5LMU Q;  1VQM A;  1Y1V G;  3STB C;  2LXK A;  4GS3 A;  4JI3 Q;  3KDF A;  1YZ6 A;  2UXC L;  1GKH A;  4DV7 Q;  4JI7 Q;  4PZ8 A;  4B3S Q;  2Q2T A;  4DUZ L;  4LNQ A;  4IPD A;  1K9M C;  4DR6 L;  4X64 Q;  4HJA A;  5AJ3 Q;  3PO2 H;  2JA5 H;  4UY8 C;  3M3Y H;  2RCN A;  1EIY B;  2R92 G;  4NXM Q;  1VQO A;  2HHH Q;  2Y0S E;  3TS2 A;  4OO1 G;  1SR3 A;  3KYH C;  5K36 G;  3JAM c;  3CP0 A;  3HOZ H;  2EXD A;  3E9I A;  5IYB H;  4LFC Q;  3I4N H;  3M4O H;  3STB D;  4DV5 Q;  3GTK H;  1A62 A;  3GTL H;  1VQE A;  5LMU L;  1Q1E A;  4PG3 A;  3SGI A;  1HZA A;  2I5M X;  3UE0 A;  3A5Z B;  4JI3 L;  2KHJ A;  2D0O A;  1HZB A;  4A4I A;  5IYB G;  1HR0 Q;  3I55 A;  2UUA L;  4LF8 Q;  4IOA A;  5JJK A;  2R7Z H;  1TWH H;  4DV7 L;  4JI7 L;  3JAM i;  4P72 A;  4YCU A;  3PIO A;  4JI2 L;  3BZC A;  3PF4 A;  2JA8 G;  1OXT A;  3BU2 A;  3L0O A;  5C0X G;  4LFB L;  4NXM L;  3KF8 B;  1I6H H;  2N8N A;  1OTC A;  2A8V A;  2JA6 H;  2JQO A;  4DV5 L;  4JC0 A;  4DR5 Q;  3TRE A;  1HZ9 A;  3K7A H;  5ELN A;  3TEH B;  2Y0S G;  4NXN L;  3S2H H;  1HR0 L;  2NZH A;  1K73 C;  4HJ7 A;  1IXR A;  1BBW A;  3ULJ A;  1VQP A;  1ASY A;  1YEZ A;  5M3M G;  3J81 i;  1QVC A;  3AYH B;  3M85 A;  4DV1 L;  1IBL Q;  1CKN B;  4R4I A;  2WP8 J;  3H0G H;  1VCI A;  1HNZ L;  4RMF A;  1YHA A;  1NE3 A;  4R4C A;  1Q46 A;  2JA7 G;  4LFB Q;  4JOI A;  4KI0 A;  3B6Y A;  1W2B A;  1EWI A;  1JB7 A;  1WCM G;  5GAE C;  1QVG A;  1QZG A;  3G4S A;  1XPU A;  2ALY B;  4JI6 Q;  4MTN A;  3MEF A;  2FXQ A;  4UP7 A;  2D0P A;  4ME3 A;  3E9H A;  4DV3 L;  1MJE A;  3FKI G;  3NEN A;  2GVA A;  4KLK A;  1YI2 A;  4NXN Q;  3PUW A;  4B3R Q;  1A63 A;  3CQZ H;  1I3Q H;  4R4O A;  2UXC Q;  4QL5 A;  3GTQ H;  1NMG A;  3HFZ B;  2QGQ A;  2QEX A;  2E5L Q;  1SLJ A;  4A3L G;  4DUZ Q;  4DR6 Q;  2JA5 G;  1EIF A;  3MXN B;  4YWL A;  1KXL A;  5M5X H;  1WYD A;  2LXJ A;  1L1O C;  2C35 B;  2RF4 A;  1HJP A;  4LW1 A;  5M3F G;  1OXX K;  1PH2 A;  2ZTC A;  2HHH L;  3S14 H;  2R93 G;  3GTM H;  4LF9 Q;  2BA1 A;  3NEL A;  4JI6 L;  3CCS A;  2NN6 G;  4LF7 Q;  4TQU S;  2E2I H;  4DV3 Q;  3S15 H;  1ASZ A;  4A3F H;  1WFQ A;  5C3E H;  1VQI A;  3L2P A;  2UUA Q;  1LTL A;  5FLX c;  1IYJ B;  1X65 A;  5IWA Q;  3UDG A;  1VQ6 A;  3IRB A;  4JI2 Q;  2IT1 A;  1PH7 A;  3ZJY C;  2VNU D;  1TWG H;  3HOV G;  3RLO A;  1D8L A;  5BR8 L;  2QA4 A;  4J15 A;  3TQY A;  2VQE Q;  1E24 A;  4P74 A;  1V1Q A;  3U4Z A;  2YTX A;  4DR5 L;  4LF7 L;  1XMQ L;  3L7Z C;  5LMN L;  3CW2 C;  4DR2 L;  1J5E Q;  4OXP A;  3I56 A;  4PMW A;  1Q12 A;  1W3S A;  3AFP A;  4RG1 A;  4JYA L;  1K8G A;  3CCV A;  2B63 G;  3PUX A;  2ZJR A;  2XGT A;  1IBL L;  3K7U C;  5IP9 H;  4YWK A;  1XJV A;  1M90 C;  1UEB A;  3ER0 A;  2ZJP A;  1HNZ Q;  1BBU A;  4AH6 A;  1VQ9 A;  2Q2I A;  2N49 A;  5FJ8 H;  2AHO B;  2EQS A;  4R1J A;  4A3D G;  2CWA A;  2KEN A;  1VQ4 A;  5C0X J;  3PIP A;  4DUY Q;  4DV4 Q;  2N78 A;  1UWV A;  4DR2 Q;  1HZC A;  1N8R C;  3PV0 A;  3CCU A;  4DV6 L;  4GOP B;  4UP9 A;  3CMA A;  4B3R L;  1VQC A;  4C3J H;  1AE2 A;  3D31 A;  3HOW G;  4A3D H;  4JYA Q;  2E5L L;  1B7Y B;  2Q2H A;  1SRO A;  4WJ4 A;  3UE1 A;  1GM5 A;  4AYB E;  1VQL A;  3KFU A;  3ICE A;  2K5V A;  4HIM A;  3RZO H;  2YTY A;  4JV5 Q;  4EX5 A;  4B3T Q;  2V1C C;  3T1H Q;  3A74 A;  1PH1 A;  1T9H A;  4JCV E;  4LF9 L;  3H0G G;  2ATW A;  4HIK A;  4A3K H;  4HJ9 A;  2MQH A;  1VQ8 A;  3W1G A;  3H3V I;  4C3I H;  1E1T A;  2OCE A;  5H1S E;  1I94 L;  4L5T A;  4GN4 B;  3S1Q H;  4BXX H;  1VQA A;  4X66 Q;  5HGQ A;  1E7Z A;  1PH5 A;  3KF6 A;  5IWA L;  4JI4 Q;  4DR4 Q;  1FGU A;  2JEA I;  1N9W A;  1I50 H;  3J80 c;  3W1B A;  4JI5 Q;  2IY5 B;  4BY7 H;  1MKH A;  2VY3 A;  3UDF A;  5BR8 Q;  3PUV A;  4X62 L;  1L0W A;  2VQE L;  1CKM A;  1HNW L;  3T1Y Q;  1N34 Q;  2ZTD A;  1XMQ Q;  3AQQ A;  3TS0 A;  5LMN Q;  1J5E L;  1X6O A;  1A0I A;  2NN6 I;  3AEV A;  4DAY B;  4YHH L;  4X66 L;  4LF6 L;  4JI4 L;  1CKO A;  2VL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...