1B50A

Nmr structure of human mip-1a d26a, 10 structures
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
69
structure length
69
Chain Sequence
SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of amino acid residues critical for aggregation of human CC chemokines macrophage inflammatory protein (MIP)-1alpha, MIP-1beta, and RANTES. Characterization of active disaggregated chemokine variants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
molecule keywords MIP-1A
total genus 3
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b50A00
2KUMA 2K05A 2SDFA 4XT3B 1Q3LA 1F9RA 5EPJA 1XYIA 4IUPA 2K1BA 2DY7A 1M8AA 1B3AA 2Q8TA 1J9OA 1NR4A 1QG7A 1U4RA 2KEEA 2Q8RE 3DEPA 1O7ZA 2J7ZA 3R93A 5D65A 5CBEE 1EOTA 5T1IA 5EPLA 3QO2A 2EOTA 1EL0A 2DY8A 1U4LA 4CJ2C 2N55A 3HP3A 1WVLA 1O7YA 4HEDA 1RHPA 1SSOA 1TVXA 4XT1B 3IL8A 4O42A 1DOLA 2B2VA 1NAPA 1BBXC 1BNZA 2HDLA 2R3ZA 1QNKA 2B2WC 5T1GA 4ZK9B 3MWYW 5E4XA 4OIKA 1AZPA 2HCCA 5EQ0A 2JYOA 4QUFA 1SDFA 3FDTA 2X69A 2B2YA 1E0BA 1RTNA 4IUUA 5COYA 5JJZA 1XX8A 2B2UC 2RSNA 4RAUC 1AP0A 1G2TA 3GV6A 1BO0A 1SAPA 2B2UA 2NYZD 3I91A 4ZAIA 1G2SA 1CA6A 1WTOA 1WD1A 2K03A 3GV3A 4MN3A 2IL8A 3N52A 4X3UA 1GUWA 2N88A 1WTRA 2RVLA 1MSGA 1JICA 2EE1A 2FMMA 1DZ1A 1ML0D 2B2WA 2L12A 5CORA 1CM9A 5CMDA 4CJ0B 2K04A 3G7LA 1HUNA 2HDMA 1B53A 1BF4A 2KEDA 1WTQA 1PFNA 4IURA 2X6LA 1G91A 4ZKBB 5D14A 1WTXA 2D9UA 1B50A 1HUMA 2CVRA 2FHTA 3IFDA 1MI2A 2HUGA 4R8IA 1F9QA 4XDXA 3KUPA 1VMPA 4IUQA 2KVMA 4U68A 2FINB 1EIGA 4OIJA 1AZQA 1DONA 1HFNA 1IKMA 3ONAB 1PDQA 1J8IA 1MGSA 4NW2A 4RA8A 5E4WC 2B2YC 1CA5A 1O80A 1RTOA 2BDNA 3UI2A 3H91A 2EPBA 1ESRA 4ZLTF 2B2TC 1KNEA 4IUVA 4MHEA 2MGSA 1HFGA 1S4ZA 5EKIA 1U4PA 2VXWA 3TZDA 3I8ZA 3I90A 1WTWA 2L9HA 4X3TA 2NZ1D 1NR2A 2KOLA 1F2LA 2L11A 5AFWA 2HCIA 3P7JA 4RWSC 1EQTA 4ZKCB 1PLFA 1IL8A 1HHVA 1DOKA 2JP1A 3MTSA 2MP1A 1RJTA 1HA6A 4HCSA 2NWGA 2XIWA 1X3PA 1WTVA 1ICWA 4X3SA 1QE6A 4R9WA 2K01A 3DM1A 2KECA 1VMCA 3D6WA 4LMQD 4X3KA 1ILQA 5CBAE 1WTPA 2MJ8A 2B2VC 2MPMA 5EJWA 1MSHA 1NCVA 2X6GA 2L1BA 1A15A 2K28A 1WD0A 3DEOA 1EIHA 3KBXA 4DN4M 1JE4A 2M2LA 3F2UA 1F9PA 1X32A 1B4OA 4IUTA 5DNFA 1HRJA 4HSVA 2H1EA 1KNAA 2L4NA 2RSOA 4HAEA 1X3QA 2FFKB 2RA4A 4UAIA 3TN2A 1F9SA 3I3CA 1C8CA 1ILPA 1B2TA 3LWEA 3Q6SA 3FPUB 1PFBA 1G6ZA 1PFMA 1ZXTA 1U4MA 2FJ2A 1IKLA 2B2TA 4QUCA 3SVMA 5EPKA 1RODA 1DOMA 4CJ1B 1LV9A
chains in the Genus database with same CATH superfamily
3FRPB 1Q3LA 1JJCB 2VZAA 4IUPA 2Q8RE 5CBEE 2AKWB 1I4RA 4CDCC 1E7ZA 1VF7A 4YWLA 1VS0A 2N78A 3K0YA 4DR2Q 5ELOA 1EL0A 4JPBW 3JC66 4OXPA 3LWUA 1WVLA 4KN7C 1B1ZA 1Y1WB 2A19A 2XRQD 1DOLA 2QDLA 4LF9Q 1BNZA 5T1GA 4CKCA 4HJ9A 2IWHA 1JJGA 3JAMc 1WTHA 4IUUA 1RTNA 2A8VA 5JJZA 5CGKA 2F0LA 4LFAQ 3VR3A 1STBA 1G2TA 4DNRB 3CXCA 3GTKB 4ZAIA 4R4OA 2D0OA 2AWNA 2F0MA 2O4XA 1X65A 1PYWD 4QGUA 3T1YQ 3MFYA 1AN8A 1IHZA 3GTQH 1DZ1A 2A69D 1HUNA 1X55A 5NUCA 4YHHQ 4B3SQ 1SMYD 2FHTA 1IBMQ 2DGYA 1EIFA 2Z6KC 2M00A 4IUQA 3CCMA 4A3JB 3S15B 1WFQA 3SE0A 2K14A 5C3WA 2UU9Q 5I9OA 2ZXPA 2XWJB 4LUOA 1X3GA 2R7ZB 2NZHA 1V43A 2MGSA 4EQNA 2Q2UA 3HOZG 3CC4A 3UE1A 2EY6A 1EQVA 3P7JA 1OTCA 1JOKA 5JJIA 2UUAL 5JAVA 4X3SA 1SMXA 3TP6A 4R4QA 2OF1A 1Y1VB 2EJFC 2B2VC 2CQAA 1SMYC 2MUYA 1EWCA 4PZ8A 1D6EC 1W2BA 4BWGB 2MFIA 1TS3A 4KTAA 3AFQA 4R4CA 5EBCA 5CC4A 4LUVA 5J39A 4R8NA 3J81E 1Q1EA 1JB7A 3TN2A 4JCVE 1B2TA 5C4HA 1ZXTA 1WI5A 4QUCA 3C1FA 3PUXA 4KJNA 5K36H 2K05A 3H0GH 3KDFB 3IFTA 1CUKA 1B3QA 4H0LC 4ME5A 4HMIA 4J8QA 1H9SB 4DK6C 3HOWG 1TS2A 2L55A 3A8IE 3KF8B 4XIGS 2I5MX 2BA1A 4ZYSA 1W6KA 1JJ2A 3GP7A 1RDPD 3H0GG 3I55A 3SK5A 4KKUA 4PMWA 2F0OA 3FMCA 1GHKA 4JI3Q 2UXDL 4B3SL 4PV1C 4QL5A 1KDCA 1TWCB 4KHPQ 4KY7A 1CA6A 3F2BA 1WTOA 1PH2A 1UE1A 4P74A 3AFPA 1PH7A 3CC2A 1STEA 2RVLA 4HJ8A 2Q2IA 4HIMA 4OO1H 3J80c 1GXDC 1YHAA 1VQNA 4O2DA 3Q24A 5C4XB 5EKKA 1SNDA 3S1MB 2K5QA 3KDFA 4A3JG 1I94Q 4P72A 5CV7A 3KK7A 1F2ZA 1OO9B 5J1ZA 2AMCB 1NTGA 1MBYA 3CCQA 3GTLH 2NZOA 1HFNA 2A68D 4DV6Q 3HOYB 3QIAA 1MGSA 4NW2A 4LF8Q 2BH8A 2D62A 3K5LA 1Q86C 4JYAQ 1O80A 1HZ9A 5C0XJ 3ZYYX 1TXYA 1LTBD 4DF7A 2KOLA 1XTCD 5C3EB 1A2UA 1TS5A 2EYOA 3ERSX 2N3SA 3RN2A 2HHHL 2UUBL 1XNQL 4PZ7A 1BOSA 5EAYA 2JP1A 5JPMC 4HMJA 1SYFA 3K5NA 4LFBL 5I4DA 3C1EA 2ZTDA 3KJOA 2DJGC 3I72A 3RZOB 1QOHA 1S5DD 1VMCA 2F0PA 5FO7B 4X3KA 3SK6A 4L5SA 1LO5D 3T56B 1OXTA 3BJUA 1VDZA 2HT1A 1H95A 1TR5A 1KC8C 3G6JB 5L37A 2F4VL 1ENAA 4A3GB 3X3MA 5JEAJ 4YIJA 2E2IH 2HQEA 4HAEA 4UP8A 2RSOA 4JI4Q 2EYHA 4KV6A 3HOZB 3S14H 2E76C 1F2MA 1DGSA 4A3IH 1C8CA 4M1UB 1BBWA 3V96A 4XT3B 2K52A 1O7IA 3CU7A 1D7QA 1EYCA 2HD3A 5GAEC 3PO2G 1HRJA 2EXZA 5T1IA 3T53B 2UXBQ 5ISRA 1VF5C 4X64L 3ULLA 4ZUJA 5C4XG 2UXDQ 3WOEA 1HTLD 4HEDA 1PH9A 4KHPL 3OOCA 3TS2A 2I46A 5C44B 2JA6B 4BY1G 5A2QL 1NAPA 5I2YA 2P5ZX 1MHWC 3BZKA 4OWTB 4K0KQ 2PQAA 5IOCA 5M9OA 2B2YA 3BVMA 1E2WA 3P1HA 2B2UC 5FLMH 1ET6A 4RGMA 2O5IC 4QB4A 5HURA 1T5EA 1K83B 1WOCA 2ID0A 3CMEA 5FLXE 1WCMG 4DV6L 1B53A 1E24A 3PUYA 3GD7A 4FO2A 2C35B 5LMUQ 1MI2A 3CKIB 3RNUA 3G71A 1TKWB 4C2MB 1LACA 3PF5A 1Y1WG 2PMZB 2WV6D 1ASYA 5BN4A 5M5XB 3E9HA 4B3MQ 3HOUB 4CDEC 1RTOA 3S16H 2VXWA 4C3JG 1YHBA 4ABNA 1E3PA 1R4PB 1NNXA 2RKSA 4X3TA 3TREA 1PTOF 5IGCA 4A3IG 5BR8Q 1DOKA 1JWMD 4ALPA 1AFPA 1K83H 4JV5L 1UEAB 2R61A 5KGUA 3I70A 3GDEA 1V8QA 4UY8C 2KECA 4TSSA 5M3MB 3C2PA 5IYDH 2D0PA 3GTGB 4JVZA 1PFSA 2TMPA 2LS01 3CCVA 3J7A5 2K28A 1ZKOA 1JR0D 4DR2L 3ZJYC 4IUNA 1Y8OB 2B63H 2F0UA 2LKVA 3T13A 3CCEA 5IY0A 1UE7A 5K36G 4UAIA 4Y52H 3J80i 4DV0Q 2ZXOA 2FJ2A 1A3TA 4RCNA 2L5TA 1RODA 3I56A 4K8IA 1SYEA 4KN4C 5IE8A 4J15A 3HOXH 1JMCA 2DJFC 3SK8A 3FP9A 1SNMA 3QOLA 4H02A 2K6AA 3VYSA 3T1YL 1GM5A 1VQ7A 3I4MG 3ND8A 2F4IA 3ND9A 2EOTA 5CYUA 3PGZA 2KQ3A 3DM3A 4EGVA 2Z4HA 4FNFA 3AU7A 1YVCA 5C5LA 3SXHA 4A3GG 1RHPA 2SOBA 5JPNC 3FHWA 3BDOA 4OONA 4QIWE 3MWYW 4DXGA 2B63B 3EFXD 1KHIA 5IP9G 2NVQH 2UU9L 3H6MA 3NE5B 4X3UA 1TWCH 1A2TA 5GADC 3BU2A 4Q0FA 4DAPA 4NXML 1AE3A 1P8LA 5FJ8H 4JI7Q 1WTQA 1PH6A 1JOOA 2X6LA 1HR0Q 1B50A 3IFDA 2NVYB 2H5XA 1KTKA 2PPBC 3JAME 1I6HH 4IJHA 5IYCH 3K7AB 4U68A 2D2CC 5EBDA 3PO3B 3BZDB 3MEHA 2BE5C 4DNTB 3HOYH 2PMZE 2VQFL 2MO1A 5KRUA 1N32Q 1Q90A 4L8JA 3RD4A 4A3MH 1HFGA 1S4ZA 5IGDA 4ILWA 3U58A 1HNWQ 3D4RA 4DV1L 4P71A 2HCIA 3BVZA 2KBNA 3K7AH 4QY7A 4N9TA 1NJIC 4DUZQ 1X3PA 3ULPA 4EQPA 5IP7G 3RN5A 1PYSB 3JAMi 2R92H 4A93G 1W3SA 1Y8NB 1WJJA 1FD7D 1YNNC 3F2CA 2EZVA 1CHQD 1FVIA 5C44G 2JA6G 2IT1A 2EDGA 1IL2A 3D6CA 4A3DB 3DHQA 4C3HB 3MEFA 1VQ5A 1GHJA 2NN6I 4XYQA 4DKAC 1TIID 1KAWA 3M85A 3KJPA 3MZ5A 1IKMA 4AIMA 1ICFB 3NTIA 1BUVT 3HOVH 4LW1A 1B7YB 1N36L 3J80L 2D5DA 1LUZA 2K1BA 3TZUA 1GD7A 1J9OA 1U4RA 2FXQA 2JA8B 2AHOB 4BA2I 3U9SA 2GA4B 4BBSB 4O1NA 4BBRG 3KBGA 4A3EH 3QO2A 3KLRA 2ENBA 1EY4A 2NVTB 3W3AA 5LL6S 4FF1A 1RCVD 4NMZA 3S17H 4BBSH 4G7ZC 3S14B 3HOUG 1SE8A 4OIKA 1SDFA 3DWAA 3CCLA 1H9SA 3FKIG 4B3TQ 5GAGC 4YY3L 3CCJA 4LF8L 2LSSA 4KD3A 4OEMB 2K03A 1WD1A 4DV2L 4NXNQ 3GTPH 4K14A 4EQOA 1JICA 3SK4A 1PTOD 5CMDA 2VQEQ 2JA7G 1BCPD 4MZ9A 2UUBQ 3JAML 1IW7C 1TWHH 2D9UA 1K8MA 1N32L 2VS1A 3U4ZA 1TT2A 1I6VC 3V05A 1HNWL 1LYLA 1IBKQ 1EY6A 3HOZH 4EQ5A 1CI3M 2NVTH 4XQJA 3I73A 1HH2P 2MQHA 1SNCA 2O5JC 4B9WA 3IAYA 1C7YA 4RKLA 1YJNA 2VUMH 2K50A 2IY5B 2KCMA 4A3LG 1HHVA 4CGYB 1OXXK 5LHY1 3EQLC 2UUAQ 1EWHA 2BE5D 3DM1A 4A3FB 1FJGQ 4HR7B 3K5OA 3VA7A 1YI2A 1STHA 1SYDA 3T16A 5AJ3L 3D4WA 1LTGD 1PRTD 4C3JH 1CK1A 2EY2A 3GTJB 2JA9A 3F2UA 3PIOA 1PA6A 3URYA 1CKMA 1N36Q 1AE2A 4UHVA 1ENCA 3SGIA 3LGJA 1X3QA 1L1OC 3STBC 4C3JB 2ICIA 3I3CA 3Q6SA 1PFBA 4XTCS 1SNOA 4JW0A 3W5OA 5FLXc 2WB1B 4CJ1B 3CAMA 4C1NK 3GQBA 1Q8KA 5M3FB 1XMQQ 4G57A 1VQOA 4G4KA 1FYCA 2DY7A 3R3OA 3DEPA 5A35A 3GTOB 1XXGA 2XTIA 5DAUA 3A56A 4K5XA 1DXMA 4JI2Q 1JE5A 2VUMB 3KFUA 3K6OA 1HZBA 3L0OA 4NB3A 4CJ2C 3C46A 1TQOA 2XWBB 4V190 2ASBA 2K33A 2EIFA 1BBXC 4DV5L 4NXNL 3G48A 3EA6A 1I6HB 1EY9A 5KNBA 1BCPB 3E0EA 1FL0A 4OELB 4AH6A 2LFNA 1D5ZC 1I50B 3MHBA 4C1NI 2AQ2B 1JORA 2JA5H 5LMNQ 3T51B 2HIXA 1AW7A 4NPSA 1E2VA 4CBVA 1HXYD 2A5HA 4DR5L 4A3MB 4IO9A 4IURA 3LX0A 1U9RA 2RBMA 2FMCA 2CVRA 4GN5A 4QJFA 1VCIA 5IGFA 3VR6A 3UDFA 1A0IA 2JK8A 4CHTB 2KVMA 1V1QA 5JJKA 1PH1A 3DWPA 3CPWA 5C3EH 2R7ZH 2JE6I 4YWMA 1HNZQ 2Y0SB 3OWFA 2BDNA 3UI2A 3FVQA 2F1MA 4ZLTF 3F2DA 2OEOA 3U9OA 5LL6X 3TP5A 3A8JE 3HOWB 3I8ZA 4A3BG 4YCUA 1FJGL 4R4IA 1O7LA 4FF3A 4QF4A 1A8VA 3RLNA 5IP7H 1YJ9A 4KMUC 4GKKL 3R2TA 2JA8G 1VQCA 3E5SA 3AB9A 1XTDA 1BR9A 4RHRA 4LF5L 4A3BB 1XNRL 2ZJRA 1ILQA 2CQOA 1SROA 4GS3A 1VQ4A 4EVOA 4RG1A 3UDGA 3BYYB 2PNHA 4K5WA 3OWEB 5E7NA 2L1BA 4A3DH 3HOYG 1Y8PB 2F4VQ 4HSVA 1QUQA 1Y1VG 3A8KE 1ONLA 5KYIA 3FPUB 4FXDA 2IX1A 2NN6H 1EQQA 4A3LH 3P75A 2NZ1D 1DOMA 4JI2L 4A93B 2K5DA 5EPJA 2IX0A 3S1RH 1B3AA 1DONA 3PSIA 2ATWA 4DV5Q 5FOBB 4NXMQ 5JEAG 5ELCA 2IPKD 5DEHA 1XMOQ 4JI7L 3TS0A 2JXMB 4HJ5A 3H09A 1LT4D 1PXUA 1QVGA 2B2WC 5I6WA 3NK9A 4RCOA 3FDTA 1R4QB 4K0KL 3VYTA 1I50H 1EFID 2PI2E 4RGTA 1PH5A 3CW2C 1PRTB 4NKLA 2VQFQ 5KYLA 3J81i 3CP0A 3U50C 2NBFA 2L12A 1S40A 4J1MA 5FK9C 4QCLA 1VQ9A 5IYCG 3L9AX 1QILA 4DUYL 4RGOS 3W1GA 2F0KA 1CSPA 3K5MA 1X3FA 5G3LD 1X6OA 3KLSX 5M5XH 5D3IB 3S1NB 2E5LL 1TWGH 1K9MC 4U673 2F3WA 1D2BA 1KABA 3NUCA 2A6EC 5C4JB 3E9IA 3NQIA 1KNEA 2B8GA 5IWAQ 3TZDA 3T1HL 3PF4A 4FF4A 4GOPC 1Y69U 1X3EA 2F3VA 4I7AA 2UUCQ 1KRSA 3OPOA 1RJTA 5K5PA 5GROA 3VR2A 2ES2A 3A5ZB 1PTOH 5FO9B 1AH9A 4DR1L 1IW7D 2LY7A 4DAYA 3TQYA 1EIYB 5IT9E 1VQPA 4KLKA 2AQ1B 2YYZA 1GUTA 2CHBD 5E3FA 4MTNA 3CPFA 2DNCA 4GLAC 2WAQG 4IPDA 1CZWA 1EYDA 2L4NA 3K7UC 1SLJA 3BVGA 1U4MA 4ULLA 3CQZH 2KJXA 4FP5D 3K58A 1ZEQX 4JI5Q 2WAQB 1R9TH 2BA0A 1O7ZA 3PQIA 1F77A 1HCZA 1T5XD 4KI0A 4BY7B 5EPLA 1K0SA 3HGBA 2OTLA 1U4LA 3ICEA 2N55A 2I0QA 2OTJA 4PQXA 3E3XA 1SSOA 1BVSA 1N33L 1QVCA 2E75C 5E4XA 5EQ0A 4G7HC 1B9MA 3TMEA 4WRDA 3PUWA 4H44C 4DK0A 4C2MH 2OT2A 3DLLA 4A3EG 1TWFH 2MHVA 3PO2H 4N9PA 5IP9H 1BF4A 1SE4A 1T9HA 3D3RA 1WTXA 5D14A 1X9NA 4UPAA 4IN3A 4BBRB 4A3EB 2ICEC 4A3CG 1H9KA 1D5XC 1B44D 3T1HQ 3HOXB 4JOIA 4X6AH 1KLUD 1J8IA 1GOZA 5C4JH 1GUOA 3KF8A 2G9DA 2YU9H 1I4HA 1SFOH 5EKIA 3EVQA 3TP8A 2GVBA 3I90A 3TBIB 2VY3A 4OL7A 1SXTA 4DGZA 1IL8A 2JSOA 1PTOB 1Z6HA 1JB3A 5CV9A 4POGA 1S5FD 3S15H 4K6LA 4DUZL 1XMQL 2JEBI 1SJHD 2PCFB 4LMQD 4FYDA 2EXDA 2QDBA 1WTPA 3BZCA 1HQRD 4WJ3M 5EJWA 4PG3A 5KIXA 1LT6D 4F8MA 1YNXA 1C9OA 1A15A 3KBXA 4A3FH 4A3KG 4QMGA 1B4OA 1C48A 1E2ZA 1V1PB 1ZYRC 3I7FA 2F0WA 3HOVG 2R93H 1L1OB 2RA4A 3TEHB 4LFAL 1ILPA 1LTAD 2QA4A 2B2TA 4JBMA 1Z9FA 4KKTA 1LV9A 2I07B 5DM73 1IYVA 5GAHC 5M3MH 4OO1G 1YIJA 2DN8A 1N33Q 4L5RC 5DM63 1QJOA 1V1PA 2NTTA 5IT9L 4DR5Q 1UAPA 1S3OA 3CQZB 2Y0SE 2E2DC 1G291 4O42A 3H15A 4HIOA 3M9BA 1H9JA 2X69A 1B70B 1E0BA 3HRZC 1SYCA 4LWCA 3Q23A 4H7BA 3I91A 4BS9A 3GTPB 2CW0D 4WJ4A 3NHHA 3D4DA 1PH4A 4KK7A 3J80E 4PMCA 2EE1A 4GNXB 1MJEA 4LF7Q 1X54A 5CORA 5M3FH 1M90C 4DV7Q 4BXXG 1L2FA 1J6QA 4WFN3 1EY0A 2KHSA 1MKHA 2VQEL 4G7OC 4C3HH 1SNPA 1FR3A 4HCEA 4L5QA 4JOIC 4LF6Q 5ELFA 4LF5Q 4GKJL 3M4YA 4P75A 3KLWA 1RF2D 4E6IA 2A6HC 3NWTA 4MHEA 3K81C 3BDLA 3UE0A 1DYQA 2K5VA 2PQAB 2ZTCA 4A4IA 4JI6Q 1LT3D 4C3IG 1N34L 3KF6A 3MTSA 1C4QA 2E8GA 4HCSA 3K59A 5CR3A 2RDGA 1QE6A 2PW7A 5J3BA 2TSSA 1YEZA 1KDBA 1EY8A 2ZJPA 1VQ6A 1MSHA 3NTKA 4M8AA 1I3QB 1EWIA 3S1RB 4DK3C 1CHPD 1LTLA 3DEOA 2E2JB 4DN4M 4A75A 3PIP3 4A93H 3EIVA 2CW0C 4LUZA 2PZTA 4JI3L 3SHLA 3MC0B 4IZ8A 1F9SA 3M3YB 1IBLQ 3J7AV 4BBSG 1GJXA 1D1KA 4FF2A 1JCKB 5EPKA 3OMCA 1WCMB 3WDNA 1KQSA 4PMBA 1EQRA 1G51A 4BXXH 1BDOA 3MXGA 1VQLA 3CCRA 3K80C 4ZCKA 3IRBA 3HP3A 4KJOA 1QCBD 4DUYQ 2OWOA 1JC7A 4XT1B 3VR5A 4CDDC 4BY1B 2B2VA 3C3LA 1ESFA 1HJPA 3V2TA 3S17B 3CHBD 4OX9Q 4JYAL 4LF7L 2F03A 4A3JH 4LAAA 2B39A 1D1IA 1EFWA 4A76A 1TY2A 4K2KA 2CH4A 1AP0A 2B2UA 1Q46A 1TWAH 3M7NA 5C3XA 4ODGA 4UP9A 5IWAL 2VW9A 4LF6L 3QWNA 4GKJQ 3RR5A 2KEDA 4JG2A 5J22A 4GOPA 3A54A 2PYKA 2ZT9C 3OTOL 3ITPA 2Z6KA 1NMGA 3J81j 1UE5A 1VMPA 1WCMH 4FVMA 2FINB 4DV3Q 4DR1Q 1UNSA 4IJLA 2F3IA 2XRSD 5E4WC 3A55A 1H9MA 4AYBB 3W2DA 3M3YH 2QEXA 3HOWH 4X66L 1ESRA 2B2TC 3FKIH 2F0JA 1U4PA 1D5MC 2QKIC 1XPOA 3PO2B 2IHFA 1NR2A 1F2LA 2LXJA 1K73C 2Q2HA 3AEVA 1TWFB 2G5DA 1HNXL 2K75A 1L0WA 4GKKQ 4MNOA 3A7LA 1BCPC 2VB3X 1PTOC 2QEJC 4BA1I 4F87A 1I94L 1RL2A 1A6XA 4DR3L 2MO0A 5HGTA 2F0QA 3TSSA 1CQVA 1EY7A 1NCVA 2YTXA 1O78A 5KEEA 2M2LA 2F0NA 3WWVA 2H1EA 2IJ0A 3KYHC 3I4NH 3EN2A 4TVAB 1XJVA 2F0EA 3K0XA 1G6ZA 1PFMA 2KCNA 4OHJA 3SVMA 1CKNA 2WACA 1XNQQ 3S16B 2EYLA 4DR6L 2PO4A 3E6ZX 3J7ZC 3LNNA 3A7AB 2KEEA 2Z6BA 1X56A 1ASZA 1LM0A 3GTOH 2RCFA 4HJ7A 2C5CA 3HOVB 4IPGA 2KA7A 3CCUA 2HIVA 3ULJA 3UDIA 1K8OA 4V0BA 4DR4L 1TU2B 4B3ML 4LFCQ 1NE3A 1Q8IA 2LXKA 4DV4L 1K3RA 1PMRA 2QGQA 1EU3A 1I4GA 2A74C 4HTHA 4A3MG 1N8RC 2A1AA 5M3FG 2JN4A 2RF4A 4ME3A 1E22A 3GV3A 2IL8A 2BH2A 2BOSA 1LT5D 2KENA 4DA2A 1CM9A 4CJ0B 4DV3L 4JBKA 3I4NB 4DAYB 1HA5A 2RDHA 2CKZB 1BCPF 1G91A 1CFMA 4B3RQ 2A6HD 2V4DA 2IX3A 1V9PA 4IQZA 2HUGA 4GN3B 4JBWA 5ELBA 1CZGA 1E1OA 3OW7A 2AWOA 4X64Q 1F9QA 4XDXA 4R8IA 3CF5A 3BDCA 1QVFA 4IFDG 1EIGA 2SNSA 3RZDH 1V1OA 3NWSA 2E5LQ 2XN9C 2WFWA 2Q8IB 1G6PA 3ONAB 3HKSA 2B2YC 3RZOH 5M5YH 3H91A 3EBEA 5C3EG 1SBBB 4GLVB 3I4MB 1PLFA 2YTVA 3CMAA 4HJAA 1OXVA 5E1FA 2UUCL 2XIWA 5I6YA 1BBUA 1LTSD 1A3VA 1SE2A 2VNUD 2Z0SA 4FDBA 3PIPA 4A3KH 4KKSA 3DUZA 3O13A 4OWXB 1J5EQ 1PZID 3SR1A 1U0LA 2G9HD 2F0FA 4JC0A 4IUTA 5DNFA 4XYOA 4L63B 3Q0AA 5JOBA 2EJGC 1SR3A 5C6AA 1DD2A 4FXKC 4DR7L 4MIUA 3PV0A 5C5MA 5H1SE 1HZCA 1HTPA 1A63A 2JA7B 1F9RA 3F1ZA 5BR8L 5C0XH 1BKBA 3G6EA 1XYIA 1FNUA 5M5WH 3R93A 1K8AC 3BYTB 5IGEA 1HR0W 4A3IB 5EKLA 2K5WA 4DV4Q 3W1BA 3HKZG 3NP8A 3GTLB 2RQXA 3QJYA 4HSPA 4EX5A 1VQJA 4K2LA 1TVXA 1GUWA 1QNKA 1RKNA 3VA5A 1Q7YC 2BDOA 2KCCA 5D3DA 4ZQ3A 1Q81C 1JOQA 3ER0A 2QW7A 4LF4Q 2RSNA 2WIIB 4KHVA 2GVAA 3Q22A 3L7ZC 4IFDJ 4BBRH 2B2WA 2F0VA 2WKCA 4POFA 1VQ8A 1Y1WH 5DLQE 4RMFA 3NSWA 4RGNA 4ZKBB 5A2QE 4JI6L 1HUMA 2LMCB 1EOVA 1GVPA 1VQIA 2EYMA 4DAMA 4P73A 1PZJD 2E74C 2A68C 4OIJA 3NENA 2PQEA 1YHQA 2ZM6Q 1PDQA 4K6DA 1I5FA 3HFZB 1YITA 4QQBX 2J0TD 2CWAA 3PCOB 3MFGA 2PNRC 3EJIA 2I5LX 5FLMG 5IYBH 1ENFA 3NEMA 1I4QA 2N49A 5AFWA 1DCZA 2R7FA 3NELA 1IZ6A 2M9VA 4DNIA 4ZKCB 2F0GA 2CWPA 4DK1A 1KD1C 2I5HA 3FEWX 1EYGA 2L0CA 4DU9A 2VL6A 2NWGA 1P16A 1MIUA 4YWKA 3S2HB 2F0IA 1SYBA 3D6WA 2UXCQ 5GQOA 3HZXA 3MXNA 1AEXA 1GUNA 1S5ED 1VQEA 1EZ8A 2ZTEA 5M3MG 1F9PA 1HZAA 3OYYA 1ET9A 1QWYA 4GOPB 1B9NA 4YY3Q 1NMFA 1MD2D 4YCWA 4C3IH 5CV8A 5KNDA 1A3UA 4FXGC 4L6TB 3RUZA 1DJRD 4DV2Q 1KL9A 2SDFA 5C4ZA 4JI0L 1DM0B 1M8AA 2EY5A 3X3NA 1NR4A 2F0DA 1YNJD 1SN8A 5JJLA 2J7ZA 3GTMH 1RIPA 4KY6A 2AUJD 2XGTA 1GKHA 2EYFA 3NBHB 3WOFA 3H94A 1Q12A 2F0TA 1YJWA 1HQMC 4RFBA 1JWUD 2E2JH 4ZK9B 2BCOA 4QUFA 2IHEA 5COYA 1BXTA 2HQLA 3TDQA 1XX8A 2A73B 1W6JA 4A3GH 3L3OC 1Y1VH 4DFAA 1BO0A 4RHSA 1YNND 2ALYB 1QB5D 2OQKA 3P20A 3GTKH 3S9WA 3S1NH 3DMUA 1MSGA 3OIPA 4IFDI 5ELNA 3GTGH 4DV7L 3MAQA 1PFNA 2R93B 3VYUA 1E1TA 4H13C 2NTSA 2PI2A 3H3VC 2A6ED 5JVG3 3OW2A 2NUCA 3CRLC 1B8AA 5BN5A 2K32A 2QF7A 3RLFA 4JI1L 1UWVA 1STYA 3QR8A 1JQYD 1CKNB 2F52A 1UEBA 2EY1A 5CV6A 4UP7A 4ID6A 3VYRA 1STGA 2GN5A 3D0FA 4B3TL 1WTWA 3CD6A 1EY5A 3A0JA 1NUCA 4KD4A 3CC7A 3S2DB 2WP8J 3AQQA 4RWSC 2RCNA 1S5CD 2NB0A 5CV5A 3R2IA 4AQYQ 2EQSA 3QG1A 1N34Q 3F8TA 1PHJA 1VQFA 1WTVA 1CSQA 5IIFA 3B6YA 4CKBA 2K01A 3MVVA 4J6HA 3RLOA 2SNMA 5CBAE 1II3A 2EJMA 5FJ8G 2NVYH 3HG9A 4IALA 2VUMG 3PUVA 1IYUA 2X6GA 3UDXA 1IBKL 2AUKA 4I65A 1NBWA 1Z47A 5KNCA 1VQMA 3GTJH 1KNAA 1VQKA 1IYJB 2JA8H 3LWEA 1WYDA 4WJWA 4B9XA 3I2ZA 3M4QA 4DR4Q 4JK1C 2PW5A 1IBLL 1QZHA 3M4PA 1QUQB 3AMUA 3GO5A 3A74A 2SEBD 1PVOA 1C0AA 4ZUIA 2Q8TA 2B29A 3N6RA 3DXJC 2CFMA 2Y0SG 4X62L 1QZGA 4RKBA 3S2DH 2DY8A 4K5VA 3FPPA 3E0JA 3NXWA 4A3KB 5AJ3Q 1LABA 3PO3H 1NY4A 4A3CH 3HEJA 4X65Q 4TQUS 2R93G 1YBYA 2JYOA 4IPCA 4OX9L 4R4TA 3QB3A 4A3FG 3OMGA 3GV6A 3S1QB 1JWSD 1G2SA 1NSNS 1S5BD 5JEAH 1EEID 1SYGA 1CKOA 4MN3A 3N52A 2N88A 5F2DA 2FMMA 2Z4IA 3STBD 2Q2TA 2WB1G 4LJZC 2NVQB 4JI1Q 3MA2B 1TS4A 1G8ZD 4K8JA 1SJED 3S1MH 4GNXA 3OTOQ 1L0YB 3KUPA 5I2XA 1AZQA 3OSOA 5FO8B 1FGUA 4RA8A 2C9OA 2NVXH 1UUPA 1K28A 1TWAB 3TP7A 1J5EL 1KAAA 2KCTA 2EPBA 1XPUA 1BQQT 4X66Q 2HHHQ 3D31A 1SE3A 2L9HA 2L11A 5C0XG 1L0XB 1TY0A 3NBIA 3M4OH 5M5YB 1H9RA 1PYBA 3J81c 4LFBQ 5LMNL 4DR7Q 2MP1A 3A5UA 1HNXQ 1ICWA 1LTRD 2OQ0A 2Z9HA 3DWQA 3K57A 1VQHA 3KLSA 4DAVA 5IT9c 1XMOL 4OWWB 2B63G 4QIWB 4A3BH 5CV4A 2K5HA 2MPMA 2OCEA 4DPGA 1KDAA 5FLXL 4DR3Q 1VQBA 2E2HH 2KHIA 1EIHA 1WD0A 4GNXC 1L1OA 5FKAC 1HNZL 1VQAA 2ZXRA 4X62Q 1SEBD 2K7VA 4JI8L 1XWEA 5JVH3 4BY1H 3S2HH 4IOAA 1EU4A 3I4LA 4LF4L 4A3DG 1QG7A 1SRUA 5C44H 4I7ZC 2MNAA 2JA6H 4DR6Q 3M7GA 1TWHB 2YTYA 5D65A 2JA5G 3RMHA 4X65L 2UXBL 2N8NA 4ZRZA 1A62A 4AYBG 3MXNB 1XNRQ 1CQFA 1KIXA 3ERQA 2XNAC 1K3BC 2B3GA 4XQNA 1K0RA 3H0GB 2JJQA 1GUSA 3IL8A 4APVA 2HDLA 3QOJA 1S72A 2JA5B 2F0HA 2WAQE 3J81L 1QNUA 1STNA 2HCCA 1AZPA 3CRKC 2PZUA 4LFCL 3G4SA 3I4OA 4DXFA 4HIDA 3PO3G 2RHSB 2ZM6L 4RAUC 4BY7H 2NYZD 2CH4W 3NQTA 1EZ6A 3NTHA 1FNVA 1GUGA 1R9TB 2B8FA 1PH8A 2JEAI 3I4MH 1CTMA 1OXSC 3BG3A 3K8AA 4PNYA 5BN3A 2K5NA 4LNQA 1I3QH 2R7ZG 5G3LF 1ML0D 1PZKD 2R7DA 2K04A 4O0AA 3G7LA 4KHZA 4TRDA 1ZYRD 1LLRD 4R1JA 3GTMB 4LK1C 3HOUH 4NDXA 1LTID 2DNEA 4B3RL 1PRTF 5ELEA 1SNQA 5LMNW 2VB2X 5C4XH 1I4XA 2UXCL 1CA5A 4P2CB 3PUZA 5IYBG 4Z9CB 1D8LA 2Z1CA 2A69C 1M1KC 2OXPA 4JI5L 4JV5Q 2QCPX 1N9WA 1LTTD 3MXPA 2R92B 4CDFC 2ZJQA 3EROA 3NBHA 3PIO3 4JI0Q 2KHJA 1KLGD 2E2IB 2E2HB 2MJ8A 1RD9D 1Q82C 4OO1I 3J7AF 4Q5VA 1Y14B 3D8GA 4JBJA 3GTQB 5IGGA 3T4AC 1SFOB 4UDUC 2CCZA 2K4KA 4JI8Q 2IW3A 1F2YA 1X32A 4Y7NB 1FGBD 3HKZB 4DV0L 1OXUA 4IFDH 4GN4B 2YV5A 3S24A 4AYBE 4L5TA 3MXUA 1YNJC 1M4VA 4HN7A 1IKLA 5C0XI 4IPHA 1U5KA 2KUMA 1HPCA 2L15A 4RH6A 1KRTA 2WB1E 3S1QH 1MJCA 2F0SA 4C3HG 4GZYC 1CT1D 1Q1BA 3HS0C 5ELDA 1GO3E 1EOTA 2EYPA 4F88A 4F7XA 1O7YA 2NN6G 1Z7TA 1I4PA 5HY6A 2V1CC 2Z8LA 4JI4L 2EVBA 3U4VA 3HOXG 5HGQA 4N8X1 2R3ZA 2RHQB 4Y7NH 3RZDB 4C56C 3KF6B 2PZWA 1PRTC 1SAPA 2XSCA 1PH3A 4LF9L 3KOJA 1WTRA 4CKEA 2RDFA 3HKZE 4XQQA 2HDMA 1EEFD 3FKIB 1HR0L 5I9PA 3BS1A 4TKOB 2JQOA 2R6GA 1JT8A 3J7YW 1VQDA 4AQYL 5M5WB 3VDYA 4WORA 1STAA 2XVSA 3NPPA 2JA7H 3H3VI 4PZ6A 4YHHL 1KXLA 4KY5A 4XXEA 3I4NG 1K8GA 4YCVA 3H3VH 1IBML 4BY7G 1FNWA 4IUVA 4DV1Q 4B08A 4C3IB 1UE6A 2YU9B 3R8BA 1TWGB 2WINB 2R92G 3Q8DA 3SEBA 2J4XA 1XPRA 4S3SA 4HIKA 4N8FA 1EQTA 3OHXC 3IKJA 2H4OA 1IXRA 5LMUL 4OGQC 3M4OB 1HA6A 1VQGA 2DUDA 4R9WA 1YZ6A 5TSSA 5EGTA 3VR4A 3SDZA 4NP5A 3CCSA 2NVXB 3AYHB 5IODA 3TRZA 1JE4A 2O2LD 5IYDG 2QILA 4GLXA 2FFKB 4IOCA 2EYJA 2AQ3B 5IGBA 4MTKA 1EYAA 3L2PA 1PV4A 1EUJA 2WKDA 3PMFA 3OIQA
chains in the Genus database with same CATH topology
3FRPB 1Q3LA 4IUPA 2Q8RE 5CBEE 1I4RA 1VF7A 3K0YA 1EL0A 3LWUA 1WVLA 4KN7C 1B1ZA 1Y1WB 2XRQD 1DOLA 1BNZA 5T1GA 4CKCA 2IWHA 4IUUA 1RTNA 5JJZA 5CGKA 2F0LA 3VR3A 1G2TA 1STBA 4DNRB 3GTKB 4ZAIA 2AWNA 2F0MA 2O4XA 1PYWD 3MFYA 1AN8A 1IHZA 1DZ1A 2A69D 1HUNA 5NUCA 1SMYD 2FHTA 2M00A 4IUQA 4A3JB 3S15B 3SE0A 5C3WA 5I9OA 2ZXPA 2XWJB 2R7ZB 1V43A 2MGSA 4EQNA 2EY6A 1EQVA 3P7JA 1JOKA 5JAVA 4X3SA 3TP6A 2OF1A 1Y1VB 2EJFC 2B2VC 2CQAA 1SMYC 2MUYA 1EWCA 1D6EC 4BWGB 1TS3A 4KTAA 5CC4A 5EBCA 5J39A 4R8NA 3J81E 1Q1EA 3TN2A 1B2TA 5C4HA 1ZXTA 4QUCA 3C1FA 3PUXA 4KJNA 5K36H 2K05A 3IFTA 4H0LC 4ME5A 4HMIA 4J8QA 1H9SB 1TS2A 2L55A 3A8IE 4XIGS 4ZYSA 2BA1A 1W6KA 3GP7A 1RDPD 3SK5A 4KKUA 4PMWA 2F0OA 3FMCA 1GHKA 4PV1C 1KDCA 1TWCB 4KY7A 1CA6A 1WTOA 1STEA 2RVLA 4OO1H 1GXDC 3Q24A 5C4XB 5EKKA 1SNDA 3S1MB 2K5QA 5CV7A 3KK7A 1F2ZA 1OO9B 5J1ZA 1MBYA 1HFNA 2A68D 3HOYB 3QIAA 1MGSA 4NW2A 2D62A 3K5LA 1O80A 5C0XJ 3ZYYX 1LTBD 4DF7A 2KOLA 1XTCD 5C3EB 1A2UA 1TS5A 2EYOA 1BOSA 2JP1A 5JPMC 4HMJA 1SYFA 3K5NA 5I4DA 3C1EA 3I72A 3RZOB 1QOHA 1S5DD 1VMCA 2F0PA 5FO7B 4X3KA 3SK6A 1LO5D 3T56B 1OXTA 1VDZA 1TR5A 3G6JB 1ENAA 4A3GB 3X3MA 5JEAJ 4YIJA 2HQEA 4HAEA 2RSOA 2EYHA 4KV6A 3HOZB 2E76C 1F2MA 1C8CA 4M1UB 3V96A 4XT3B 3CU7A 1EYCA 1HRJA 2EXZA 5T1IA 3T53B 5ISRA 1VF5C 4ZUJA 3WOEA 1HTLD 4HEDA 3OOCA 2I46A 5C44B 2JA6B 5A2QL 1NAPA 5I2YA 5IOCA 5M9OA 2B2YA 1E2WA 3BVMA 3P1HA 2B2UC 1ET6A 2O5IC 4RGMA 4QB4A 5HURA 1T5EA 1K83B 2ID0A 5FLXE 1B53A 3PUYA 3GD7A 4FO2A 1MI2A 3CKIB 1TKWB 4C2MB 1LACA 2PMZB 2WV6D 5BN4A 5M5XB 3HOUB 1RTOA 2VXWA 4C3JG 4ABNA 1R4PB 2RKSA 4X3TA 1PTOF 5IGCA 1DOKA 1JWMD 1AFPA 1UEAB 2R61A 5KGUA 3I70A 1V8QA 2KECA 4TSSA 5M3MB 3C2PA 3GTGB 2TMPA 2LS01 2K28A 1ZKOA 1JR0D 4IUNA 1Y8OB 2F0UA 2LKVA 3T13A 5K36G 4UAIA 2ZXOA 2FJ2A 1A3TA 4RCNA 2L5TA 1RODA 4K8IA 1SYEA 4KN4C 3SK8A 1SNMA 3QOLA 2K6AA 3VYSA 3ND8A 2F4IA 3ND9A 2EOTA 5CYUA 2KQ3A 4EGVA 2Z4HA 4FNFA 3AU7A 3SXHA 5C5LA 1RHPA 2SOBA 5JPNC 3BDOA 3MWYW 4DXGA 2B63B 3EFXD 3H6MA 3NE5B 4X3UA 1A2TA 4Q0FA 4DAPA 1WTQA 1JOOA 2X6LA 1B50A 3IFDA 2NVYB 1KTKA 2PPBC 3JAME 3K7AB 4U68A 2D2CC 5EBDA 3PO3B 3BZDB 3MEHA 2BE5C 4DNTB 5KRUA 1Q90A 4L8JA 3RD4A 1HFGA 1S4ZA 5IGDA 4ILWA 3D4RA 2HCIA 3BVZA 4N9TA 1X3PA 4EQPA 1Y8NB 2EZVA 1FD7D 1YNNC 1CHQD 2IT1A 2EDGA 3D6CA 4A3DB 3DHQA 4C3HB 1GHJA 2NN6I 4XYQA 1TIID 3M85A 3MZ5A 1IKMA 3NTIA 1BUVT 3J80L 2D5DA 2K1BA 3TZUA 1J9OA 1U4RA 2JA8B 4BA2I 3U9SA 2GA4B 4BBSB 4O1NA 3KBGA 3QO2A 3KLRA 2ENBA 1EY4A 2NVTB 3W3AA 5LL6S 4FF1A 1RCVD 4NMZA 4G7ZC 3S14B 4OIKA 1SDFA 3DWAA 1H9SA 4KD3A 1WD1A 2K03A 4K14A 4EQOA 1JICA 3SK4A 1PTOD 5CMDA 1BCPD 3JAML 1IW7C 2D9UA 1K8MA 1TT2A 1I6VC 3V05A 1EY6A 1CI3M 4XQJA 3I73A 1SNCA 2O5JC 4B9WA 3IAYA 4RKLA 1HHVA 4CGYB 1OXXK 5LHY1 3EQLC 1EWHA 2BE5D 3DM1A 4A3FB 4HR7B 3K5OA 3VA7A 1STHA 1SYDA 3T16A 3D4WA 1LTGD 1PRTD 1CK1A 2EY2A 3GTJB 3F2UA 3URYA 1ENCA 1X3QA 4C3JB 2ICIA 3I3CA 3Q6SA 1PFBA 4XTCS 1SNOA 2WB1B 4CJ1B 4C1NK 3GQBA 5M3FB 4G57A 4G4KA 1FYCA 2DY7A 3R3OA 3DEPA 5A35A 3GTOB 1XXGA 5DAUA 3A56A 4K5XA 1DXMA 2VUMB 3K6OA 4CJ2C 3C46A 1TQOA 2XWBB 4V190 2K33A 1BBXC 3EA6A 1I6HB 1EY9A 5KNBA 1BCPB 2LFNA 1D5ZC 1I50B 3MHBA 4C1NI 2AQ2B 1JORA 3T51B 1AW7A 4CBVA 1E2VA 1HXYD 2A5HA 4A3MB 4IURA 3LX0A 1U9RA 2RBMA 2FMCA 2CVRA 1VCIA 5IGFA 3VR6A 4CHTB 2KVMA 3DWPA 2JE6I 2Y0SB 3OWFA 2BDNA 3UI2A 3FVQA 2F1MA 4ZLTF 2OEOA 3U9OA 5LL6X 3TP5A 3A8JE 3HOWB 3I8ZA 1O7LA 4FF3A 4QF4A 4KMUC 3R2TA 3E5SA 3AB9A 1BR9A 4RHRA 4A3BB 1ILQA 4EVOA 3BYYB 4K5WA 3OWEB 2L1BA 1Y8PB 4HSVA 3A8KE 1ONLA 5KYIA 3FPUB 4FXDA 2IX1A 2NN6H 3P75A 2NZ1D 1DOMA 4A93B 2K5DA 5EPJA 2IX0A 1B3AA 1DONA 5FOBB 5JEAG 5ELCA 2IPKD 5DEHA 2JXMB 3H09A 1LT4D 1PXUA 2B2WC 5I6WA 3NK9A 4RCOA 3FDTA 1R4QB 3VYTA 1EFID 4RGTA 1PRTB 4NKLA 5KYLA 2NBFA 2L12A 4J1MA 5FK9C 4QCLA 3L9AX 1QILA 4RGOS 2F0KA 3K5MA 5G3LD 3KLSX 5D3IB 3S1NB 4U673 2F3WA 1D2BA 1KABA 3NUCA 2A6EC 5C4JB 3NQIA 1KNEA 2B8GA 3TZDA 4FF4A 1Y69U 2F3VA 3OPOA 1RJTA 5K5PA 3VR2A 1PTOH 5FO9B 1IW7D 2LY7A 4DAYA 5IT9E 2AQ1B 2YYZA 1GUTA 2CHBD 5E3FA 2DNCA 1CZWA 1EYDA 2L4NA 3BVGA 1U4MA 4ULLA 2KJXA 4FP5D 3K58A 1ZEQX 2WAQB 2BA0A 1O7ZA 1F77A 1HCZA 1T5XD 4KI0A 4BY7B 5EPLA 3HGBA 1U4LA 2N55A 4PQXA 1SSOA 2E75C 5E4XA 5EQ0A 4G7HC 1B9MA 3TMEA 4WRDA 3PUWA 4H44C 4DK0A 2OT2A 2MHVA 4N9PA 1BF4A 1SE4A 3D3RA 1WTXA 5D14A 4IN3A 4BBRB 4A3EB 2ICEC 1H9KA 1D5XC 3HOXB 1B44D 1KLUD 1J8IA 1GOZA 1GUOA 3KF8A 2G9DA 1I4HA 5EKIA 3EVQA 3TP8A 3I90A 3TBIB 4OL7A 1SXTA 4DGZA 1IL8A 2JSOA 1PTOB 1Z6HA 1JB3A 5CV9A 1S5FD 4K6LA 2JEBI 1SJHD 2PCFB 4LMQD 4FYDA 2QDBA 1WTPA 1HQRD 5EJWA 5KIXA 1LT6D 4F8MA 1A15A 3KBXA 4QMGA 1B4OA 1C48A 1E2ZA 1V1PB 1ZYRC 2F0WA 2RA4A 1ILPA 1LTAD 2B2TA 4KKTA 1LV9A 2I07B 5DM73 1IYVA 4OO1G 2DN8A 5DM63 1QJOA 1V1PA 2NTTA 5IT9L 1UAPA 3CQZB 4O42A 2E2DC 1G291 1H9JA 2X69A 1E0BA 3HRZC 1SYCA 3Q23A 4H7BA 3I91A 4BS9A 3GTPB 2CW0D 3NHHA 3D4DA 4KK7A 3J80E 4PMCA 2EE1A 5CORA 4WFN3 1EY0A 2KHSA 4G7OC 1SNPA 1FR3A 4HCEA 5ELFA 3M4YA 1RF2D 4E6IA 2A6HC 3NWTA 4MHEA 3BDLA 1DYQA 1LT3D 4C3IG 3MTSA 1C4QA 4HCSA 3K59A 5CR3A 2RDGA 1QE6A 2PW7A 2TSSA 1KDBA 1EY8A 1MSHA 3NTKA 4M8AA 1I3QB 3S1RB 1CHPD 3DEOA 2E2JB 4DN4M 3PIP3 2CW0C 2PZTA 3SHLA 3MC0B 4IZ8A 1F9SA 3M3YB 3J7AV 1GJXA 1D1KA 4FF2A 1JCKB 5EPKA 3OMCA 1WCMB 3WDNA 4PMBA 1BDOA 3MXGA 3HP3A 4KJOA 1QCBD 1JC7A 4XT1B 3VR5A 4BY1B 3C3LA 2B2VA 1ESFA 3V2TA 3S17B 3CHBD 2F03A 4LAAA 2B39A 1D1IA 1TY2A 4K2KA 1AP0A 2B2UA 3M7NA 5C3XA 4ODGA 3QWNA 2KEDA 5J22A 3A54A 2PYKA 2ZT9C 3ITPA 1VMPA 4FVMA 2FINB 1UNSA 5E4WC 2XRSD 3A55A 1H9MA 4AYBB 3W2DA 1ESRA 2B2TC 2F0JA 1U4PA 1D5MC 2QKIC 3PO2B 1NR2A 1F2LA 1TWFB 3A7LA 1BCPC 2VB3X 1PTOC 2QEJC 4BA1I 4F87A 1A6XA 5HGTA 2F0QA 3TSSA 1CQVA 1EY7A 1NCVA 1O78A 5KEEA 2M2LA 2F0NA 2H1EA 2IJ0A 2F0EA 1G6ZA 1PFMA 2KCNA 4OHJA 3SVMA 2WACA 3S16B 2EYLA 2PO4A 3E6ZX 3LNNA 3A7AB 2KEEA 2C5CA 3HOVB 2KA7A 1K8OA 4V0BA 1TU2B 1Q8IA 1PMRA 1EU3A 1I4GA 2A74C 4HTHA 3GV3A 2IL8A 2BOSA 1LT5D 4DA2A 1CM9A 4CJ0B 3I4NB 1HA5A 2RDHA 1BCPF 1G91A 1CFMA 2A6HD 2V4DA 2IX3A 4IQZA 2HUGA 4JBWA 5ELBA 1CZGA 3OW7A 2AWOA 4R8IA 1F9QA 4XDXA 3BDCA 4IFDG 1EIGA 2SNSA 1V1OA 3NWSA 2XN9C 2Q8IB 3ONAB 2B2YC 3H91A 1SBBB 3I4MB 1PLFA 1OXVA 5E1FA 2XIWA 5I6YA 1LTSD 1A3VA 1SE2A 2VNUD 4KKSA 3DUZA 3O13A 1PZID 3SR1A 2G9HD 2F0FA 5DNFA 4IUTA 4XYOA 4L63B 3Q0AA 5JOBA 2EJGC 5C6AA 1DD2A 4FXKC 4MIUA 3PV0A 5C5MA 1HTPA 2JA7B 1F9RA 5C0XH 1XYIA 1FNUA 3R93A 3BYTB 5IGEA 4A3IB 5EKLA 2K5WA 3NP8A 3GTLB 2RQXA 3QJYA 4HSPA 4K2LA 1TVXA 1GUWA 1QNKA 1RKNA 3VA5A 2BDOA 2KCCA 5D3DA 4ZQ3A 1JOQA 2RSNA 2WIIB 4KHVA 3Q22A 3L7ZC 4IFDJ 2B2WA 2F0VA 2WKCA 3NSWA 4RGNA 4ZKBB 5A2QE 1HUMA 2LMCB 2EYMA 1PZJD 2E74C 2A68C 4OIJA 2PQEA 1PDQA 4K6DA 2J0TD 3MFGA 2PNRC 3EJIA 1ENFA 1I4QA 5AFWA 1DCZA 2M9VA 4ZKCB 2F0GA 4DK1A 3FEWX 2L0CA 4DU9A 2NWGA 3S2HB 2F0IA 1SYBA 3D6WA 3HZXA 3MXNA 1S5ED 1AEXA 1GUNA 1EZ8A 1F9PA 1ET9A 1QWYA 1B9NA 1MD2D 5CV8A 5KNDA 1A3UA 4FXGC 4L6TB 3RUZA 1DJRD 2SDFA 5C4ZA 1DM0B 1M8AA 2EY5A 3X3NA 1NR4A 2F0DA 1YNJD 2J7ZA 4KY6A 2AUJD 2EYFA 3WOFA 3H94A 1Q12A 2F0TA 1HQMC 4RFBA 1JWUD 4ZK9B 2BCOA 4QUFA 5COYA 1BXTA 3TDQA 1XX8A 2A73B 1W6JA 3L3OC 4DFAA 1BO0A 4RHSA 1YNND 1QB5D 3P20A 3S9WA 3DMUA 1MSGA 3OIPA 4IFDI 3MAQA 1PFNA 2R93B 3VYUA 4H13C 2NTSA 3H3VC 2A6ED 5JVG3 2NUCA 3CRLC 5BN5A 2K32A 2QF7A 3RLFA 1STYA 1JQYD 5CV6A 2EY1A 4ID6A 3VYRA 1STGA 1WTWA 1EY5A 1NUCA 4KD4A 3S2DB 2WP8J 4RWSC 1S5CD 2NB0A 5CV5A 3R2IA 3QG1A 1WTVA 5IIFA 4CKBA 2K01A 3MVVA 4J6HA 2SNMA 5CBAE 1II3A 2EJMA 3HG9A 4IALA 3PUVA 1IYUA 2X6GA 2AUKA 4I65A 1Z47A 5KNCA 1KNAA 3LWEA 4WJWA 4B9XA 4JK1C 2PW5A 3AMUA 3GO5A 2SEBD 4ZUIA 2Q8TA 3N6RA 3DXJC 4RKBA 2DY8A 4K5VA 3FPPA 3E0JA 3NXWA 4A3KB 1LABA 3HEJA 4TQUS 2JYOA 3QB3A 3OMGA 3GV6A 3S1QB 1JWSD 1G2SA 1NSNS 1S5BD 5JEAH 1EEID 1SYGA 4MN3A 3N52A 2N88A 5F2DA 2FMMA 2Z4IA 4LJZC 2NVQB 3MA2B 1TS4A 1G8ZD 4K8JA 1SJED 1L0YB 3KUPA 5I2XA 1AZQA 3OSOA 5FO8B 4RA8A 2C9OA 1UUPA 1TWAB 3TP7A 1KAAA 2EPBA 1BQQT 3D31A 1SE3A 2L9HA 5C0XG 2L11A 1L0XB 1TY0A 3NBIA 5M5YB 1H9RA 2MP1A 1ICWA 1LTRD 3DWQA 3K57A 3KLSA 4DAVA 4QIWB 5CV4A 2MPMA 1KDAA 5FLXL 1EIHA 1WD0A 5FKAC 2ZXRA 1SEBD 2K7VA 1XWEA 5JVH3 1EU4A 3I4LA 1QG7A 4I7ZC 3M7GA 1TWHB 5D65A 3RMHA 4ZRZA 1CQFA 3ERQA 2XNAC 4XQNA 3H0GB 3IL8A 1GUSA 2HDLA 3QOJA 2JA5B 2F0HA 3J81L 1QNUA 1STNA 2HCCA 1AZPA 3CRKC 2PZUA 4DXFA 4RAUC 2NYZD 3NQTA 1EZ6A 3NTHA 1FNVA 1GUGA 1R9TB 2B8FA 2JEAI 1CTMA 1OXSC 3BG3A 4PNYA 5BN3A 5G3LF 1ML0D 1PZKD 2K04A 3G7LA 4KHZA 4TRDA 1ZYRD 1LLRD 3GTMB 4LK1C 1LTID 4NDXA 2DNEA 1PRTF 5ELEA 1SNQA 2VB2X 1I4XA 1CA5A 4P2CB 3PUZA 4Z9CB 2Z1CA 2A69C 2OXPA 2QCPX 1LTTD 3MXPA 2R92B 3EROA 3NBHA 3PIO3 1KLGD 2E2IB 2E2HB 2MJ8A 1RD9D 4OO1I 3J7AF 4Q5VA 3D8GA 3GTQB 5IGGA 3T4AC 1SFOB 4UDUC 2IW3A 1F2YA 1X32A 4Y7NB 1FGBD 3HKZB 1OXUA 4IFDH 3MXUA 1YNJC 1M4VA 5C0XI 1IKLA 4HN7A 2KUMA 1HPCA 4RH6A 4GZYC 4C3HG 2F0SA 1CT1D 1Q1BA 3HS0C 5ELDA 1EOTA 2EYPA 4F88A 4F7XA 1O7YA 2NN6G 1Z7TA 1I4PA 2Z8LA 2EVBA 2R3ZA 3RZDB 4C56C 2PZWA 1PRTC 1SAPA 2XSCA 1WTRA 4CKEA 2RDFA 4XQQA 2HDMA 1EEFD 3FKIB 5I9PA 3BS1A 4TKOB 2R6GA 3J7YW 5M5WB 4WORA 1STAA 2XVSA 3NPPA 4KY5A 4XXEA 1FNWA 4IUVA 4B08A 4C3IB 2YU9B 3R8BA 1TWGB 2WINB 3SEBA 2J4XA 4S3SA 1EQTA 3OHXC 3IKJA 2H4OA 3M4OB 4OGQC 1HA6A 4R9WA 5TSSA 5EGTA 3VR4A 3SDZA 4NP5A 2NVXB 5IODA 1JE4A 2O2LD 2QILA 2FFKB 2EYJA 2AQ3B 5IGBA 1EYAA 2WKDA 3PMFA 3OIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUM A;  2K05 A;  2SDF A;  4XT3 B;  1Q3L A;  1F9R A;  5EPJ A;  1XYI A;  4IUP A;  2K1B A;  2DY7 A;  1M8A A;  1B3A A;  2Q8T A;  1J9O A;  1NR4 A;  1QG7 A;  1U4R A;  2KEE A;  2Q8R E;  3DEP A;  1O7Z A;  2J7Z A;  3R93 A;  5D65 A;  5CBE E;  1EOT A;  5T1I A;  5EPL A;  3QO2 A;  2EOT A;  1EL0 A;  2DY8 A;  1U4L A;  4CJ2 C;  2N55 A;  3HP3 A;  1WVL A;  1O7Y A;  4HED A;  1RHP A;  1SSO A;  1TVX A;  4XT1 B;  3IL8 A;  4O42 A;  1DOL A;  2B2V A;  1NAP A;  1BBX C;  1BNZ A;  2HDL A;  2R3Z A;  1QNK A;  2B2W C;  5T1G A;  4ZK9 B;  3MWY W;  5E4X A;  4OIK A;  1AZP A;  2HCC A;  5EQ0 A;  2JYO A;  4QUF A;  1SDF A;  3FDT A;  2X69 A;  2B2Y A;  1E0B A;  1RTN A;  4IUU A;  5COY A;  5JJZ A;  1XX8 A;  2B2U C;  2RSN A;  4RAU C;  1AP0 A;  1G2T A;  3GV6 A;  1BO0 A;  1SAP A;  2B2U A;  2NYZ D;  3I91 A;  4ZAI A;  1G2S A;  1CA6 A;  1WTO A;  1WD1 A;  2K03 A;  3GV3 A;  4MN3 A;  2IL8 A;  3N52 A;  4X3U A;  1GUW A;  2N88 A;  1WTR A;  2RVL A;  1MSG A;  1JIC A;  2EE1 A;  2FMM A;  1DZ1 A;  1ML0 D;  2B2W A;  2L12 A;  5COR A;  1CM9 A;  5CMD A;  4CJ0 B;  2K04 A;  3G7L A;  1HUN A;  2HDM A;  1B53 A;  1BF4 A;  2KED A;  1WTQ A;  1PFN A;  4IUR A;  2X6L A;  1G91 A;  4ZKB B;  5D14 A;  1WTX A;  2D9U A;  1B50 A;  1HUM A;  2CVR A;  2FHT A;  3IFD A;  1MI2 A;  2HUG A;  4R8I A;  1F9Q A;  4XDX A;  3KUP A;  1VMP A;  4IUQ A;  2KVM A;  4U68 A;  2FIN B;  1EIG A;  4OIJ A;  1AZQ A;  1DON A;  1HFN A;  1IKM A;  3ONA B;  1PDQ A;  1J8I A;  1MGS A;  4NW2 A;  4RA8 A;  5E4W C;  2B2Y C;  1CA5 A;  1O80 A;  1RTO A;  2BDN A;  3UI2 A;  3H91 A;  2EPB A;  1ESR A;  4ZLT F;  2B2T C;  1KNE A;  4IUV A;  4MHE A;  2MGS A;  1HFG A;  1S4Z A;  5EKI A;  1U4P A;  2VXW A;  3TZD A;  3I8Z A;  3I90 A;  1WTW A;  2L9H A;  4X3T A;  2NZ1 D;  1NR2 A;  2KOL A;  1F2L A;  2L11 A;  5AFW A;  2HCI A;  3P7J A;  4RWS C;  1EQT A;  4ZKC B;  1PLF A;  1IL8 A;  1HHV A;  1DOK A;  2JP1 A;  3MTS A;  2MP1 A;  1RJT A;  1HA6 A;  4HCS A;  2NWG A;  2XIW A;  1X3P A;  1WTV A;  1ICW A;  4X3S A;  1QE6 A;  4R9W A;  2K01 A;  3DM1 A;  2KEC A;  1VMC A;  3D6W A;  4LMQ D;  4X3K A;  1ILQ A;  5CBA E;  1WTP A;  2MJ8 A;  2B2V C;  2MPM A;  5EJW A;  1MSH A;  1NCV A;  2X6G A;  2L1B A;  1A15 A;  2K28 A;  1WD0 A;  3DEO A;  1EIH A;  3KBX A;  4DN4 M;  1JE4 A;  2M2L A;  3F2U A;  1F9P A;  1X32 A;  1B4O A;  4IUT A;  5DNF A;  1HRJ A;  4HSV A;  2H1E A;  1KNA A;  2L4N A;  2RSO A;  4HAE A;  1X3Q A;  2FFK B;  2RA4 A;  4UAI A;  3TN2 A;  1F9S A;  3I3C A;  1C8C A;  1ILP A;  1B2T A;  3LWE A;  3Q6S A;  3FPU B;  1PFB A;  1G6Z A;  1PFM A;  1ZXT A;  1U4M A;  2FJ2 A;  1IKL A;  2B2T A;  4QUC A;  3SVM A;  5EPK A;  1ROD A;  1DOM A;  4CJ1 B;  1LV9 A; 
#chains in the Genus database with same CATH topology
 3FRP B;  1Q3L A;  1JJC B;  2VZA A;  4IUP A;  2Q8R E;  5CBE E;  2AKW B;  1I4R A;  4CDC C;  1E7Z A;  1VF7 A;  4YWL A;  1VS0 A;  2N78 A;  3K0Y A;  4DR2 Q;  5ELO A;  1EL0 A;  4JPB W;  3JC6 6;  4OXP A;  3LWU A;  1WVL A;  4KN7 C;  1B1Z A;  1Y1W B;  2A19 A;  2XRQ D;  1DOL A;  2QDL A;  4LF9 Q;  1BNZ A;  5T1G A;  4CKC A;  4HJ9 A;  2IWH A;  1JJG A;  3JAM c;  1WTH A;  4IUU A;  1RTN A;  2A8V A;  5JJZ A;  5CGK A;  2F0L A;  4LFA Q;  3VR3 A;  1STB A;  1G2T A;  4DNR B;  3CXC A;  3GTK B;  4ZAI A;  4R4O A;  2D0O A;  2AWN A;  2F0M A;  2O4X A;  1X65 A;  1PYW D;  4QGU A;  3T1Y Q;  3MFY A;  1AN8 A;  1IHZ A;  3GTQ H;  1DZ1 A;  2A69 D;  1HUN A;  1X55 A;  5NUC A;  4YHH Q;  4B3S Q;  1SMY D;  2FHT A;  1IBM Q;  2DGY A;  1EIF A;  2Z6K C;  2M00 A;  4IUQ A;  3CCM A;  4A3J B;  3S15 B;  1WFQ A;  3SE0 A;  2K14 A;  5C3W A;  2UU9 Q;  5I9O A;  2ZXP A;  2XWJ B;  4LUO A;  1X3G A;  2R7Z B;  2NZH A;  1V43 A;  2MGS A;  4EQN A;  2Q2U A;  3HOZ G;  3CC4 A;  3UE1 A;  2EY6 A;  1EQV A;  3P7J A;  1OTC A;  1JOK A;  5JJI A;  2UUA L;  5JAV A;  4X3S A;  1SMX A;  3TP6 A;  4R4Q A;  2OF1 A;  1Y1V B;  2EJF C;  2B2V C;  2CQA A;  1SMY C;  2MUY A;  1EWC A;  4PZ8 A;  1D6E C;  1W2B A;  4BWG B;  2MFI A;  1TS3 A;  4KTA A;  3AFQ A;  4R4C A;  5EBC A;  5CC4 A;  4LUV A;  5J39 A;  4R8N A;  3J81 E;  1Q1E A;  1JB7 A;  3TN2 A;  4JCV E;  1B2T A;  5C4H A;  1ZXT A;  1WI5 A;  4QUC A;  3C1F A;  3PUX A;  4KJN A;  5K36 H;  2K05 A;  3H0G H;  3KDF B;  3IFT A;  1CUK A;  1B3Q A;  4H0L C;  4ME5 A;  4HMI A;  4J8Q A;  1H9S B;  4DK6 C;  3HOW G;  1TS2 A;  2L55 A;  3A8I E;  3KF8 B;  4XIG S;  2I5M X;  2BA1 A;  4ZYS A;  1W6K A;  1JJ2 A;  3GP7 A;  1RDP D;  3H0G G;  3I55 A;  3SK5 A;  4KKU A;  4PMW A;  2F0O A;  3FMC A;  1GHK A;  4JI3 Q;  2UXD L;  4B3S L;  4PV1 C;  4QL5 A;  1KDC A;  1TWC B;  4KHP Q;  4KY7 A;  1CA6 A;  3F2B A;  1WTO A;  1PH2 A;  1UE1 A;  4P74 A;  3AFP A;  1PH7 A;  3CC2 A;  1STE A;  2RVL A;  4HJ8 A;  2Q2I A;  4HIM A;  4OO1 H;  3J80 c;  1GXD C;  1YHA A;  1VQN A;  4O2D A;  3Q24 A;  5C4X B;  5EKK A;  1SND A;  3S1M B;  2K5Q A;  3KDF A;  4A3J G;  1I94 Q;  4P72 A;  5CV7 A;  3KK7 A;  1F2Z A;  1OO9 B;  5J1Z A;  2AMC B;  1NTG A;  1MBY A;  3CCQ A;  3GTL H;  2NZO A;  1HFN A;  2A68 D;  4DV6 Q;  3HOY B;  3QIA A;  1MGS A;  4NW2 A;  4LF8 Q;  2BH8 A;  2D62 A;  3K5L A;  1Q86 C;  4JYA Q;  1O80 A;  1HZ9 A;  5C0X J;  3ZYY X;  1TXY A;  1LTB D;  4DF7 A;  2KOL A;  1XTC D;  5C3E B;  1A2U A;  1TS5 A;  2EYO A;  3ERS X;  2N3S A;  3RN2 A;  2HHH L;  2UUB L;  1XNQ L;  4PZ7 A;  1BOS A;  5EAY A;  2JP1 A;  5JPM C;  4HMJ A;  1SYF A;  3K5N A;  4LFB L;  5I4D A;  3C1E A;  2ZTD A;  3KJO A;  2DJG C;  3I72 A;  3RZO B;  1QOH A;  1S5D D;  1VMC A;  2F0P A;  5FO7 B;  4X3K A;  3SK6 A;  4L5S A;  1LO5 D;  3T56 B;  1OXT A;  3BJU A;  1VDZ A;  2HT1 A;  1H95 A;  1TR5 A;  1KC8 C;  3G6J B;  5L37 A;  2F4V L;  1ENA A;  4A3G B;  3X3M A;  5JEA J;  4YIJ A;  2E2I H;  2HQE A;  4HAE A;  4UP8 A;  2RSO A;  4JI4 Q;  2EYH A;  4KV6 A;  3HOZ B;  3S14 H;  2E76 C;  1F2M A;  1DGS A;  4A3I H;  1C8C A;  4M1U B;  1BBW A;  3V96 A;  4XT3 B;  2K52 A;  1O7I A;  3CU7 A;  1D7Q A;  1EYC A;  2HD3 A;  5GAE C;  3PO2 G;  1HRJ A;  2EXZ A;  5T1I A;  3T53 B;  2UXB Q;  5ISR A;  1VF5 C;  4X64 L;  3ULL A;  4ZUJ A;  5C4X G;  2UXD Q;  3WOE A;  1HTL D;  4HED A;  1PH9 A;  4KHP L;  3OOC A;  3TS2 A;  2I46 A;  5C44 B;  2JA6 B;  4BY1 G;  5A2Q L;  1NAP A;  5I2Y A;  2P5Z X;  1MHW C;  3BZK A;  4OWT B;  4K0K Q;  2PQA A;  5IOC A;  5M9O A;  2B2Y A;  3BVM A;  1E2W A;  3P1H A;  2B2U C;  5FLM H;  1ET6 A;  4RGM A;  2O5I C;  4QB4 A;  5HUR A;  1T5E A;  1K83 B;  1WOC A;  2ID0 A;  3CME A;  5FLX E;  1WCM G;  4DV6 L;  1B53 A;  1E24 A;  3PUY A;  3GD7 A;  4FO2 A;  2C35 B;  5LMU Q;  1MI2 A;  3CKI B;  3RNU A;  3G71 A;  1TKW B;  4C2M B;  1LAC A;  3PF5 A;  1Y1W G;  2PMZ B;  2WV6 D;  1ASY A;  5BN4 A;  5M5X B;  3E9H A;  4B3M Q;  3HOU B;  4CDE C;  1RTO A;  3S16 H;  2VXW A;  4C3J G;  1YHB A;  4ABN A;  1E3P A;  1R4P B;  1NNX A;  2RKS A;  4X3T A;  3TRE A;  1PTO F;  5IGC A;  4A3I G;  5BR8 Q;  1DOK A;  1JWM D;  4ALP A;  1AFP A;  1K83 H;  4JV5 L;  1UEA B;  2R61 A;  5KGU A;  3I70 A;  3GDE A;  1V8Q A;  4UY8 C;  2KEC A;  4TSS A;  5M3M B;  3C2P A;  5IYD H;  2D0P A;  3GTG B;  4JVZ A;  1PFS A;  2TMP A;  2LS0 1;  3CCV A;  3J7A 5;  2K28 A;  1ZKO A;  1JR0 D;  4DR2 L;  3ZJY C;  4IUN A;  1Y8O B;  2B63 H;  2F0U A;  2LKV A;  3T13 A;  3CCE A;  5IY0 A;  1UE7 A;  5K36 G;  4UAI A;  4Y52 H;  3J80 i;  4DV0 Q;  2ZXO A;  2FJ2 A;  1A3T A;  4RCN A;  2L5T A;  1ROD A;  3I56 A;  4K8I A;  1SYE A;  4KN4 C;  5IE8 A;  4J15 A;  3HOX H;  1JMC A;  2DJF C;  3SK8 A;  3FP9 A;  1SNM A;  3QOL A;  4H02 A;  2K6A A;  3VYS A;  3T1Y L;  1GM5 A;  1VQ7 A;  3I4M G;  3ND8 A;  2F4I A;  3ND9 A;  2EOT A;  5CYU A;  3PGZ A;  2KQ3 A;  3DM3 A;  4EGV A;  2Z4H A;  4FNF A;  3AU7 A;  1YVC A;  5C5L A;  3SXH A;  4A3G G;  1RHP A;  2SOB A;  5JPN C;  3FHW A;  3BDO A;  4OON A;  4QIW E;  3MWY W;  4DXG A;  2B63 B;  3EFX D;  1KHI A;  5IP9 G;  2NVQ H;  2UU9 L;  3H6M A;  3NE5 B;  4X3U A;  1TWC H;  1A2T A;  5GAD C;  3BU2 A;  4Q0F A;  4DAP A;  4NXM L;  1AE3 A;  1P8L A;  5FJ8 H;  4JI7 Q;  1WTQ A;  1PH6 A;  1JOO A;  2X6L A;  1HR0 Q;  1B50 A;  3IFD A;  2NVY B;  2H5X A;  1KTK A;  2PPB C;  3JAM E;  1I6H H;  4IJH A;  5IYC H;  3K7A B;  4U68 A;  2D2C C;  5EBD A;  3PO3 B;  3BZD B;  3MEH A;  2BE5 C;  4DNT B;  3HOY H;  2PMZ E;  2VQF L;  2MO1 A;  5KRU A;  1N32 Q;  1Q90 A;  4L8J A;  3RD4 A;  4A3M H;  1HFG A;  1S4Z A;  5IGD A;  4ILW A;  3U58 A;  1HNW Q;  3D4R A;  4DV1 L;  4P71 A;  2HCI A;  3BVZ A;  2KBN A;  3K7A H;  4QY7 A;  4N9T A;  1NJI C;  4DUZ Q;  1X3P A;  3ULP A;  4EQP A;  5IP7 G;  3RN5 A;  1PYS B;  3JAM i;  2R92 H;  4A93 G;  1W3S A;  1Y8N B;  1WJJ A;  1FD7 D;  1YNN C;  3F2C A;  2EZV A;  1CHQ D;  1FVI A;  5C44 G;  2JA6 G;  2IT1 A;  2EDG A;  1IL2 A;  3D6C A;  4A3D B;  3DHQ A;  4C3H B;  3MEF A;  1VQ5 A;  1GHJ A;  2NN6 I;  4XYQ A;  4DKA C;  1TII D;  1KAW A;  3M85 A;  3KJP A;  3MZ5 A;  1IKM A;  4AIM A;  1ICF B;  3NTI A;  1BUV T;  3HOV H;  4LW1 A;  1B7Y B;  1N36 L;  3J80 L;  2D5D A;  1LUZ A;  2K1B A;  3TZU A;  1GD7 A;  1J9O A;  1U4R A;  2FXQ A;  2JA8 B;  2AHO B;  4BA2 I;  3U9S A;  2GA4 B;  4BBS B;  4O1N A;  4BBR G;  3KBG A;  4A3E H;  3QO2 A;  3KLR A;  2ENB A;  1EY4 A;  2NVT B;  3W3A A;  5LL6 S;  4FF1 A;  1RCV D;  4NMZ A;  3S17 H;  4BBS H;  4G7Z C;  3S14 B;  3HOU G;  1SE8 A;  4OIK A;  1SDF A;  3DWA A;  3CCL A;  1H9S A;  3FKI G;  4B3T Q;  5GAG C;  4YY3 L;  3CCJ A;  4LF8 L;  2LSS A;  4KD3 A;  4OEM B;  2K03 A;  1WD1 A;  4DV2 L;  4NXN Q;  3GTP H;  4K14 A;  4EQO A;  1JIC A;  3SK4 A;  1PTO D;  5CMD A;  2VQE Q;  2JA7 G;  1BCP D;  4MZ9 A;  2UUB Q;  3JAM L;  1IW7 C;  1TWH H;  2D9U A;  1K8M A;  1N32 L;  2VS1 A;  3U4Z A;  1TT2 A;  1I6V C;  3V05 A;  1HNW L;  1LYL A;  1IBK Q;  1EY6 A;  3HOZ H;  4EQ5 A;  1CI3 M;  2NVT H;  4XQJ A;  3I73 A;  1HH2 P;  2MQH A;  1SNC A;  2O5J C;  4B9W A;  3IAY A;  1C7Y A;  4RKL A;  1YJN A;  2VUM H;  2K50 A;  2IY5 B;  2KCM A;  4A3L G;  1HHV A;  4CGY B;  1OXX K;  5LHY 1;  3EQL C;  2UUA Q;  1EWH A;  2BE5 D;  3DM1 A;  4A3F B;  1FJG Q;  4HR7 B;  3K5O A;  3VA7 A;  1YI2 A;  1STH A;  1SYD A;  3T16 A;  5AJ3 L;  3D4W A;  1LTG D;  1PRT D;  4C3J H;  1CK1 A;  2EY2 A;  3GTJ B;  2JA9 A;  3F2U A;  3PIO A;  1PA6 A;  3URY A;  1CKM A;  1N36 Q;  1AE2 A;  4UHV A;  1ENC A;  3SGI A;  3LGJ A;  1X3Q A;  1L1O C;  3STB C;  4C3J B;  2ICI A;  3I3C A;  3Q6S A;  1PFB A;  4XTC S;  1SNO A;  4JW0 A;  3W5O A;  5FLX c;  2WB1 B;  4CJ1 B;  3CAM A;  4C1N K;  3GQB A;  1Q8K A;  5M3F B;  1XMQ Q;  4G57 A;  1VQO A;  4G4K A;  1FYC A;  2DY7 A;  3R3O A;  3DEP A;  5A35 A;  3GTO B;  1XXG A;  2XTI A;  5DAU A;  3A56 A;  4K5X A;  1DXM A;  4JI2 Q;  1JE5 A;  2VUM B;  3KFU A;  3K6O A;  1HZB A;  3L0O A;  4NB3 A;  4CJ2 C;  3C46 A;  1TQO A;  2XWB B;  4V19 0;  2ASB A;  2K33 A;  2EIF A;  1BBX C;  4DV5 L;  4NXN L;  3G48 A;  3EA6 A;  1I6H B;  1EY9 A;  5KNB A;  1BCP B;  3E0E A;  1FL0 A;  4OEL B;  4AH6 A;  2LFN A;  1D5Z C;  1I50 B;  3MHB A;  4C1N I;  2AQ2 B;  1JOR A;  2JA5 H;  5LMN Q;  3T51 B;  2HIX A;  1AW7 A;  4NPS A;  1E2V A;  4CBV A;  1HXY D;  2A5H A;  4DR5 L;  4A3M B;  4IO9 A;  4IUR A;  3LX0 A;  1U9R A;  2RBM A;  2FMC A;  2CVR A;  4GN5 A;  4QJF A;  1VCI A;  5IGF A;  3VR6 A;  3UDF A;  1A0I A;  2JK8 A;  4CHT B;  2KVM A;  1V1Q A;  5JJK A;  1PH1 A;  3DWP A;  3CPW A;  5C3E H;  2R7Z H;  2JE6 I;  4YWM A;  1HNZ Q;  2Y0S B;  3OWF A;  2BDN A;  3UI2 A;  3FVQ A;  2F1M A;  4ZLT F;  3F2D A;  2OEO A;  3U9O A;  5LL6 X;  3TP5 A;  3A8J E;  3HOW B;  3I8Z A;  4A3B G;  4YCU A;  1FJG L;  4R4I A;  1O7L A;  4FF3 A;  4QF4 A;  1A8V A;  3RLN A;  5IP7 H;  1YJ9 A;  4KMU C;  4GKK L;  3R2T A;  2JA8 G;  1VQC A;  3E5S A;  3AB9 A;  1XTD A;  1BR9 A;  4RHR A;  4LF5 L;  4A3B B;  1XNR L;  2ZJR A;  1ILQ A;  2CQO A;  1SRO A;  4GS3 A;  1VQ4 A;  4EVO A;  4RG1 A;  3UDG A;  3BYY B;  2PNH A;  4K5W A;  3OWE B;  5E7N A;  2L1B A;  4A3D H;  3HOY G;  1Y8P B;  2F4V Q;  4HSV A;  1QUQ A;  1Y1V G;  3A8K E;  1ONL A;  5KYI A;  3FPU B;  4FXD A;  2IX1 A;  2NN6 H;  1EQQ A;  4A3L H;  3P75 A;  2NZ1 D;  1DOM A;  4JI2 L;  4A93 B;  2K5D A;  5EPJ A;  2IX0 A;  3S1R H;  1B3A A;  1DON A;  3PSI A;  2ATW A;  4DV5 Q;  5FOB B;  4NXM Q;  5JEA G;  5ELC A;  2IPK D;  5DEH A;  1XMO Q;  4JI7 L;  3TS0 A;  2JXM B;  4HJ5 A;  3H09 A;  1LT4 D;  1PXU A;  1QVG A;  2B2W C;  5I6W A;  3NK9 A;  4RCO A;  3FDT A;  1R4Q B;  4K0K L;  3VYT A;  1I50 H;  1EFI D;  2PI2 E;  4RGT A;  1PH5 A;  3CW2 C;  1PRT B;  4NKL A;  2VQF Q;  5KYL A;  3J81 i;  3CP0 A;  3U50 C;  2NBF A;  2L12 A;  1S40 A;  4J1M A;  5FK9 C;  4QCL A;  1VQ9 A;  5IYC G;  3L9A X;  1QIL A;  4DUY L;  4RGO S;  3W1G A;  2F0K A;  1CSP A;  3K5M A;  1X3F A;  5G3L D;  1X6O A;  3KLS X;  5M5X H;  5D3I B;  3S1N B;  2E5L L;  1TWG H;  1K9M C;  4U67 3;  2F3W A;  1D2B A;  1KAB A;  3NUC A;  2A6E C;  5C4J B;  3E9I A;  3NQI A;  1KNE A;  2B8G A;  5IWA Q;  3TZD A;  3T1H L;  3PF4 A;  4FF4 A;  4GOP C;  1Y69 U;  1X3E A;  2F3V A;  4I7A A;  2UUC Q;  1KRS A;  3OPO A;  1RJT A;  5K5P A;  5GRO A;  3VR2 A;  2ES2 A;  3A5Z B;  1PTO H;  5FO9 B;  1AH9 A;  4DR1 L;  1IW7 D;  2LY7 A;  4DAY A;  3TQY A;  1EIY B;  5IT9 E;  1VQP A;  4KLK A;  2AQ1 B;  2YYZ A;  1GUT A;  2CHB D;  5E3F A;  4MTN A;  3CPF A;  2DNC A;  4GLA C;  2WAQ G;  4IPD A;  1CZW A;  1EYD A;  2L4N A;  3K7U C;  1SLJ A;  3BVG A;  1U4M A;  4ULL A;  3CQZ H;  2KJX A;  4FP5 D;  3K58 A;  1ZEQ X;  4JI5 Q;  2WAQ B;  1R9T H;  2BA0 A;  1O7Z A;  3PQI A;  1F77 A;  1HCZ A;  1T5X D;  4KI0 A;  4BY7 B;  5EPL A;  1K0S A;  3HGB A;  2OTL A;  1U4L A;  3ICE A;  2N55 A;  2I0Q A;  2OTJ A;  4PQX A;  3E3X A;  1SSO A;  1BVS A;  1N33 L;  1QVC A;  2E75 C;  5E4X A;  5EQ0 A;  4G7H C;  1B9M A;  3TME A;  4WRD A;  3PUW A;  4H44 C;  4DK0 A;  4C2M H;  2OT2 A;  3DLL A;  4A3E G;  1TWF H;  2MHV A;  3PO2 H;  4N9P A;  5IP9 H;  1BF4 A;  1SE4 A;  1T9H A;  3D3R A;  1WTX A;  5D14 A;  1X9N A;  4UPA A;  4IN3 A;  4BBR B;  4A3E B;  2ICE C;  4A3C G;  1H9K A;  1D5X C;  1B44 D;  3T1H Q;  3HOX B;  4JOI A;  4X6A H;  1KLU D;  1J8I A;  1GOZ A;  5C4J H;  1GUO A;  3KF8 A;  2G9D A;  2YU9 H;  1I4H A;  1SFO H;  5EKI A;  3EVQ A;  3TP8 A;  2GVB A;  3I90 A;  3TBI B;  2VY3 A;  4OL7 A;  1SXT A;  4DGZ A;  1IL8 A;  2JSO A;  1PTO B;  1Z6H A;  1JB3 A;  5CV9 A;  4POG A;  1S5F D;  3S15 H;  4K6L A;  4DUZ L;  1XMQ L;  2JEB I;  1SJH D;  2PCF B;  4LMQ D;  4FYD A;  2EXD A;  2QDB A;  1WTP A;  3BZC A;  1HQR D;  4WJ3 M;  5EJW A;  4PG3 A;  5KIX A;  1LT6 D;  4F8M A;  1YNX A;  1C9O A;  1A15 A;  3KBX A;  4A3F H;  4A3K G;  4QMG A;  1B4O A;  1C48 A;  1E2Z A;  1V1P B;  1ZYR C;  3I7F A;  2F0W A;  3HOV G;  2R93 H;  1L1O B;  2RA4 A;  3TEH B;  4LFA L;  1ILP A;  1LTA D;  2QA4 A;  2B2T A;  4JBM A;  1Z9F A;  4KKT A;  1LV9 A;  2I07 B;  5DM7 3;  1IYV A;  5GAH C;  5M3M H;  4OO1 G;  1YIJ A;  2DN8 A;  1N33 Q;  4L5R C;  5DM6 3;  1QJO A;  1V1P A;  2NTT A;  5IT9 L;  4DR5 Q;  1UAP A;  1S3O A;  3CQZ B;  2Y0S E;  2E2D C;  1G29 1;  4O42 A;  3H15 A;  4HIO A;  3M9B A;  1H9J A;  2X69 A;  1B70 B;  1E0B A;  3HRZ C;  1SYC A;  4LWC A;  3Q23 A;  4H7B A;  3I91 A;  4BS9 A;  3GTP B;  2CW0 D;  4WJ4 A;  3NHH A;  3D4D A;  1PH4 A;  4KK7 A;  3J80 E;  4PMC A;  2EE1 A;  4GNX B;  1MJE A;  4LF7 Q;  1X54 A;  5COR A;  5M3F H;  1M90 C;  4DV7 Q;  4BXX G;  1L2F A;  1J6Q A;  4WFN 3;  1EY0 A;  2KHS A;  1MKH A;  2VQE L;  4G7O C;  4C3H H;  1SNP A;  1FR3 A;  4HCE A;  4L5Q A;  4JOI C;  4LF6 Q;  5ELF A;  4LF5 Q;  4GKJ L;  3M4Y A;  4P75 A;  3KLW A;  1RF2 D;  4E6I A;  2A6H C;  3NWT A;  4MHE A;  3K81 C;  3BDL A;  3UE0 A;  1DYQ A;  2K5V A;  2PQA B;  2ZTC A;  4A4I A;  4JI6 Q;  1LT3 D;  4C3I G;  1N34 L;  3KF6 A;  3MTS A;  1C4Q A;  2E8G A;  4HCS A;  3K59 A;  5CR3 A;  2RDG A;  1QE6 A;  2PW7 A;  5J3B A;  2TSS A;  1YEZ A;  1KDB A;  1EY8 A;  2ZJP A;  1VQ6 A;  1MSH A;  3NTK A;  4M8A A;  1I3Q B;  1EWI A;  3S1R B;  4DK3 C;  1CHP D;  1LTL A;  3DEO A;  2E2J B;  4DN4 M;  4A75 A;  3PIP 3;  4A93 H;  3EIV A;  2CW0 C;  4LUZ A;  2PZT A;  4JI3 L;  3SHL A;  3MC0 B;  4IZ8 A;  1F9S A;  3M3Y B;  1IBL Q;  3J7A V;  4BBS G;  1GJX A;  1D1K A;  4FF2 A;  1JCK B;  5EPK A;  3OMC A;  1WCM B;  3WDN A;  1KQS A;  4PMB A;  1EQR A;  1G51 A;  4BXX H;  1BDO A;  3MXG A;  1VQL A;  3CCR A;  3K80 C;  4ZCK A;  3IRB A;  3HP3 A;  4KJO A;  1QCB D;  4DUY Q;  2OWO A;  1JC7 A;  4XT1 B;  3VR5 A;  4CDD C;  4BY1 B;  2B2V A;  3C3L A;  1ESF A;  1HJP A;  3V2T A;  3S17 B;  3CHB D;  4OX9 Q;  4JYA L;  4LF7 L;  2F03 A;  4A3J H;  4LAA A;  2B39 A;  1D1I A;  1EFW A;  4A76 A;  1TY2 A;  4K2K A;  2CH4 A;  1AP0 A;  2B2U A;  1Q46 A;  1TWA H;  3M7N A;  5C3X A;  4ODG A;  4UP9 A;  5IWA L;  2VW9 A;  4LF6 L;  3QWN A;  4GKJ Q;  3RR5 A;  2KED A;  4JG2 A;  5J22 A;  4GOP A;  3A54 A;  2PYK A;  2ZT9 C;  3OTO L;  3ITP A;  2Z6K A;  1NMG A;  3J81 j;  1UE5 A;  1VMP A;  1WCM H;  4FVM A;  2FIN B;  4DV3 Q;  4DR1 Q;  1UNS A;  4IJL A;  2F3I A;  2XRS D;  5E4W C;  3A55 A;  1H9M A;  4AYB B;  3W2D A;  3M3Y H;  2QEX A;  3HOW H;  4X66 L;  1ESR A;  2B2T C;  3FKI H;  2F0J A;  1U4P A;  1D5M C;  2QKI C;  1XPO A;  3PO2 B;  2IHF A;  1NR2 A;  1F2L A;  2LXJ A;  1K73 C;  2Q2H A;  3AEV A;  1TWF B;  2G5D A;  1HNX L;  2K75 A;  1L0W A;  4GKK Q;  4MNO A;  3A7L A;  1BCP C;  2VB3 X;  1PTO C;  2QEJ C;  4BA1 I;  4F87 A;  1I94 L;  1RL2 A;  1A6X A;  4DR3 L;  2MO0 A;  5HGT A;  2F0Q A;  3TSS A;  1CQV A;  1EY7 A;  1NCV A;  2YTX A;  1O78 A;  5KEE A;  2M2L A;  2F0N A;  3WWV A;  2H1E A;  2IJ0 A;  3KYH C;  3I4N H;  3EN2 A;  4TVA B;  1XJV A;  2F0E A;  3K0X A;  1G6Z A;  1PFM A;  2KCN A;  4OHJ A;  3SVM A;  1CKN A;  2WAC A;  1XNQ Q;  3S16 B;  2EYL A;  4DR6 L;  2PO4 A;  3E6Z X;  3J7Z C;  3LNN A;  3A7A B;  2KEE A;  2Z6B A;  1X56 A;  1ASZ A;  1LM0 A;  3GTO H;  2RCF A;  4HJ7 A;  2C5C A;  3HOV B;  4IPG A;  2KA7 A;  3CCU A;  2HIV A;  3ULJ A;  3UDI A;  1K8O A;  4V0B A;  4DR4 L;  1TU2 B;  4B3M L;  4LFC Q;  1NE3 A;  1Q8I A;  2LXK A;  4DV4 L;  1K3R A;  1PMR A;  2QGQ A;  1EU3 A;  1I4G A;  2A74 C;  4HTH A;  4A3M G;  1N8R C;  2A1A A;  5M3F G;  2JN4 A;  2RF4 A;  4ME3 A;  1E22 A;  3GV3 A;  2IL8 A;  2BH2 A;  2BOS A;  1LT5 D;  2KEN A;  4DA2 A;  1CM9 A;  4CJ0 B;  4DV3 L;  4JBK A;  3I4N B;  4DAY B;  1HA5 A;  2RDH A;  2CKZ B;  1BCP F;  1G91 A;  1CFM A;  4B3R Q;  2A6H D;  2V4D A;  2IX3 A;  1V9P A;  4IQZ A;  2HUG A;  4GN3 B;  4JBW A;  5ELB A;  1CZG A;  1E1O A;  3OW7 A;  2AWO A;  4X64 Q;  1F9Q A;  4XDX A;  4R8I A;  3CF5 A;  3BDC A;  1QVF A;  4IFD G;  1EIG A;  2SNS A;  3RZD H;  1V1O A;  3NWS A;  2E5L Q;  2XN9 C;  2WFW A;  2Q8I B;  1G6P A;  3ONA B;  3HKS A;  2B2Y C;  3RZO H;  5M5Y H;  3H91 A;  3EBE A;  5C3E G;  1SBB B;  4GLV B;  3I4M B;  1PLF A;  2YTV A;  3CMA A;  4HJA A;  1OXV A;  5E1F A;  2UUC L;  2XIW A;  5I6Y A;  1BBU A;  1LTS D;  1A3V A;  1SE2 A;  2VNU D;  2Z0S A;  4FDB A;  3PIP A;  4A3K H;  4KKS A;  3DUZ A;  3O13 A;  4OWX B;  1J5E Q;  1PZI D;  3SR1 A;  1U0L A;  2G9H D;  2F0F A;  4JC0 A;  4IUT A;  5DNF A;  4XYO A;  4L63 B;  3Q0A A;  5JOB A;  2EJG C;  1SR3 A;  5C6A A;  1DD2 A;  4FXK C;  4DR7 L;  4MIU A;  3PV0 A;  5C5M A;  5H1S E;  1HZC A;  1HTP A;  1A63 A;  2JA7 B;  1F9R A;  3F1Z A;  5BR8 L;  5C0X H;  1BKB A;  3G6E A;  1XYI A;  1FNU A;  5M5W H;  3R93 A;  1K8A C;  3BYT B;  5IGE A;  1HR0 W;  4A3I B;  5EKL A;  2K5W A;  4DV4 Q;  3W1B A;  3HKZ G;  3NP8 A;  3GTL B;  2RQX A;  3QJY A;  4HSP A;  4EX5 A;  1VQJ A;  4K2L A;  1TVX A;  1GUW A;  1QNK A;  1RKN A;  3VA5 A;  1Q7Y C;  2BDO A;  2KCC A;  5D3D A;  4ZQ3 A;  1Q81 C;  1JOQ A;  3ER0 A;  2QW7 A;  4LF4 Q;  2RSN A;  2WII B;  4KHV A;  2GVA A;  3Q22 A;  3L7Z C;  4IFD J;  4BBR H;  2B2W A;  2F0V A;  2WKC A;  4POF A;  1VQ8 A;  1Y1W H;  5DLQ E;  4RMF A;  3NSW A;  4RGN A;  4ZKB B;  5A2Q E;  4JI6 L;  1HUM A;  2LMC B;  1EOV A;  1GVP A;  1VQI A;  2EYM A;  4DAM A;  4P73 A;  1PZJ D;  2E74 C;  2A68 C;  4OIJ A;  3NEN A;  2PQE A;  1YHQ A;  2ZM6 Q;  1PDQ A;  4K6D A;  1I5F A;  3HFZ B;  1YIT A;  4QQB X;  2J0T D;  2CWA A;  3PCO B;  3MFG A;  2PNR C;  3EJI A;  2I5L X;  5FLM G;  5IYB H;  1ENF A;  3NEM A;  1I4Q A;  2N49 A;  5AFW A;  1DCZ A;  2R7F A;  3NEL A;  1IZ6 A;  2M9V A;  4DNI A;  4ZKC B;  2F0G A;  2CWP A;  4DK1 A;  1KD1 C;  2I5H A;  3FEW X;  1EYG A;  2L0C A;  4DU9 A;  2VL6 A;  2NWG A;  1P16 A;  1MIU A;  4YWK A;  3S2H B;  2F0I A;  1SYB A;  3D6W A;  2UXC Q;  5GQO A;  3HZX A;  3MXN A;  1AEX A;  1GUN A;  1S5E D;  1VQE A;  1EZ8 A;  2ZTE A;  5M3M G;  1F9P A;  1HZA A;  3OYY A;  1ET9 A;  1QWY A;  4GOP B;  1B9N A;  4YY3 Q;  1NMF A;  1MD2 D;  4YCW A;  4C3I H;  5CV8 A;  5KND A;  1A3U A;  4FXG C;  4L6T B;  3RUZ A;  1DJR D;  4DV2 Q;  1KL9 A;  2SDF A;  5C4Z A;  4JI0 L;  1DM0 B;  1M8A A;  2EY5 A;  3X3N A;  1NR4 A;  2F0D A;  1YNJ D;  1SN8 A;  5JJL A;  2J7Z A;  3GTM H;  1RIP A;  4KY6 A;  2AUJ D;  2XGT A;  1GKH A;  2EYF A;  3NBH B;  3WOF A;  3H94 A;  1Q12 A;  2F0T A;  1YJW A;  1HQM C;  4RFB A;  1JWU D;  2E2J H;  4ZK9 B;  2BCO A;  4QUF A;  2IHE A;  5COY A;  1BXT A;  2HQL A;  3TDQ A;  1XX8 A;  2A73 B;  1W6J A;  4A3G H;  3L3O C;  1Y1V H;  4DFA A;  1BO0 A;  4RHS A;  1YNN D;  2ALY B;  1QB5 D;  2OQK A;  3P20 A;  3GTK H;  3S9W A;  3S1N H;  3DMU A;  1MSG A;  3OIP A;  4IFD I;  5ELN A;  3GTG H;  4DV7 L;  3MAQ A;  1PFN A;  2R93 B;  3VYU A;  1E1T A;  4H13 C;  2NTS A;  2PI2 A;  3H3V C;  2A6E D;  5JVG 3;  3OW2 A;  2NUC A;  3CRL C;  1B8A A;  5BN5 A;  2K32 A;  2QF7 A;  3RLF A;  4JI1 L;  1UWV A;  1STY A;  3QR8 A;  1JQY D;  1CKN B;  2F52 A;  1UEB A;  2EY1 A;  5CV6 A;  4UP7 A;  4ID6 A;  3VYR A;  1STG A;  2GN5 A;  3D0F A;  4B3T L;  1WTW A;  3CD6 A;  1EY5 A;  3A0J A;  1NUC A;  4KD4 A;  3CC7 A;  3S2D B;  2WP8 J;  3AQQ A;  4RWS C;  2RCN A;  1S5C D;  2NB0 A;  5CV5 A;  3R2I A;  4AQY Q;  2EQS A;  3QG1 A;  1N34 Q;  3F8T A;  1PHJ A;  1VQF A;  1WTV A;  1CSQ A;  5IIF A;  3B6Y A;  4CKB A;  2K01 A;  3MVV A;  4J6H A;  3RLO A;  2SNM A;  5CBA E;  1II3 A;  2EJM A;  5FJ8 G;  2NVY H;  3HG9 A;  4IAL A;  2VUM G;  3PUV A;  1IYU A;  2X6G A;  3UDX A;  1IBK L;  2AUK A;  4I65 A;  1NBW A;  1Z47 A;  5KNC A;  1VQM A;  3GTJ H;  1KNA A;  1VQK A;  1IYJ B;  2JA8 H;  3LWE A;  1WYD A;  4WJW A;  4B9X A;  3I2Z A;  3M4Q A;  4DR4 Q;  4JK1 C;  2PW5 A;  1IBL L;  1QZH A;  3M4P A;  1QUQ B;  3AMU A;  3GO5 A;  3A74 A;  2SEB D;  1PVO A;  1C0A A;  4ZUI A;  2Q8T A;  2B29 A;  3N6R A;  3DXJ C;  2CFM A;  2Y0S G;  4X62 L;  1QZG A;  4RKB A;  3S2D H;  2DY8 A;  4K5V A;  3FPP A;  3E0J A;  3NXW A;  4A3K B;  5AJ3 Q;  1LAB A;  3PO3 H;  1NY4 A;  4A3C H;  3HEJ A;  4X65 Q;  4TQU S;  2R93 G;  1YBY A;  2JYO A;  4IPC A;  4OX9 L;  4R4T A;  3QB3 A;  4A3F G;  3OMG A;  3GV6 A;  3S1Q B;  1JWS D;  1G2S A;  1NSN S;  1S5B D;  5JEA H;  1EEI D;  1SYG A;  1CKO A;  4MN3 A;  3N52 A;  2N88 A;  5F2D A;  2FMM A;  2Z4I A;  3STB D;  2Q2T A;  2WB1 G;  4LJZ C;  2NVQ B;  4JI1 Q;  3MA2 B;  1TS4 A;  1G8Z D;  4K8J A;  1SJE D;  3S1M H;  4GNX A;  3OTO Q;  1L0Y B;  3KUP A;  5I2X A;  1AZQ A;  3OSO A;  5FO8 B;  1FGU A;  4RA8 A;  2C9O A;  2NVX H;  1UUP A;  1K28 A;  1TWA B;  3TP7 A;  1J5E L;  1KAA A;  2KCT A;  2EPB A;  1XPU A;  1BQQ T;  4X66 Q;  2HHH Q;  3D31 A;  1SE3 A;  2L9H A;  2L11 A;  5C0X G;  1L0X B;  1TY0 A;  3NBI A;  3M4O H;  5M5Y B;  1H9R A;  1PYB A;  3J81 c;  4LFB Q;  5LMN L;  4DR7 Q;  2MP1 A;  3A5U A;  1HNX Q;  1ICW A;  1LTR D;  2OQ0 A;  2Z9H A;  3DWQ A;  3K57 A;  1VQH A;  3KLS A;  4DAV A;  5IT9 c;  1XMO L;  4OWW B;  2B63 G;  4QIW B;  4A3B H;  5CV4 A;  2K5H A;  2MPM A;  2OCE A;  4DPG A;  1KDA A;  5FLX L;  4DR3 Q;  1VQB A;  2E2H H;  2KHI A;  1EIH A;  1WD0 A;  4GNX C;  1L1O A;  5FKA C;  1HNZ L;  1VQA A;  2ZXR A;  4X62 Q;  1SEB D;  2K7V A;  4JI8 L;  1XWE A;  5JVH 3;  4BY1 H;  3S2H H;  4IOA A;  1EU4 A;  3I4L A;  4LF4 L;  4A3D G;  1QG7 A;  1SRU A;  5C44 H;  4I7Z C;  2MNA A;  2JA6 H;  4DR6 Q;  3M7G A;  1TWH B;  2YTY A;  5D65 A;  2JA5 G;  3RMH A;  4X65 L;  2UXB L;  2N8N A;  4ZRZ A;  1A62 A;  4AYB G;  3MXN B;  1XNR Q;  1CQF A;  1KIX A;  3ERQ A;  2XNA C;  1K3B C;  2B3G A;  4XQN A;  1K0R A;  3H0G B;  2JJQ A;  1GUS A;  3IL8 A;  4APV A;  2HDL A;  3QOJ A;  1S72 A;  2JA5 B;  2F0H A;  2WAQ E;  3J81 L;  1QNU A;  1STN A;  2HCC A;  1AZP A;  3CRK C;  2PZU A;  4LFC L;  3G4S A;  3I4O A;  4DXF A;  4HID A;  3PO3 G;  2RHS B;  2ZM6 L;  4RAU C;  4BY7 H;  2NYZ D;  2CH4 W;  3NQT A;  1EZ6 A;  3NTH A;  1FNV A;  1GUG A;  1R9T B;  2B8F A;  1PH8 A;  2JEA I;  3I4M H;  1CTM A;  1OXS C;  3BG3 A;  3K8A A;  4PNY A;  5BN3 A;  2K5N A;  4LNQ A;  1I3Q H;  2R7Z G;  5G3L F;  1ML0 D;  1PZK D;  2R7D A;  2K04 A;  4O0A A;  3G7L A;  4KHZ A;  4TRD A;  1ZYR D;  1LLR D;  4R1J A;  3GTM B;  4LK1 C;  3HOU H;  4NDX A;  1LTI D;  2DNE A;  4B3R L;  1PRT F;  5ELE A;  1SNQ A;  5LMN W;  2VB2 X;  5C4X H;  1I4X A;  2UXC L;  1CA5 A;  4P2C B;  3PUZ A;  5IYB G;  4Z9C B;  1D8L A;  2Z1C A;  2A69 C;  1M1K C;  2OXP A;  4JI5 L;  4JV5 Q;  2QCP X;  1N9W A;  1LTT D;  3MXP A;  2R92 B;  4CDF C;  2ZJQ A;  3ERO A;  3NBH A;  3PIO 3;  4JI0 Q;  2KHJ A;  1KLG D;  2E2I B;  2E2H B;  2MJ8 A;  1RD9 D;  1Q82 C;  4OO1 I;  3J7A F;  4Q5V A;  1Y14 B;  3D8G A;  4JBJ A;  3GTQ B;  5IGG A;  3T4A C;  1SFO B;  4UDU C;  2CCZ A;  2K4K A;  4JI8 Q;  2IW3 A;  1F2Y A;  1X32 A;  4Y7N B;  1FGB D;  3HKZ B;  4DV0 L;  1OXU A;  4IFD H;  4GN4 B;  2YV5 A;  3S24 A;  4AYB E;  4L5T A;  3MXU A;  1YNJ C;  1M4V A;  4HN7 A;  1IKL A;  5C0X I;  4IPH A;  1U5K A;  2KUM A;  1HPC A;  2L15 A;  4RH6 A;  1KRT A;  2WB1 E;  3S1Q H;  1MJC A;  2F0S A;  4C3H G;  4GZY C;  1CT1 D;  1Q1B A;  3HS0 C;  5ELD A;  1GO3 E;  1EOT A;  2EYP A;  4F88 A;  4F7X A;  1O7Y A;  2NN6 G;  1Z7T A;  1I4P A;  5HY6 A;  2V1C C;  2Z8L A;  4JI4 L;  2EVB A;  3U4V A;  3HOX G;  5HGQ A;  4N8X 1;  2R3Z A;  2RHQ B;  4Y7N H;  3RZD B;  4C56 C;  3KF6 B;  2PZW A;  1PRT C;  1SAP A;  2XSC A;  1PH3 A;  4LF9 L;  3KOJ A;  1WTR A;  4CKE A;  2RDF A;  3HKZ E;  4XQQ A;  2HDM A;  1EEF D;  3FKI B;  1HR0 L;  5I9P A;  3BS1 A;  4TKO B;  2JQO A;  2R6G A;  1JT8 A;  3J7Y W;  1VQD A;  4AQY L;  5M5W B;  3VDY A;  4WOR A;  1STA A;  2XVS A;  3NPP A;  2JA7 H;  3H3V I;  4PZ6 A;  4YHH L;  1KXL A;  4KY5 A;  4XXE A;  3I4N G;  1K8G A;  4YCV A;  3H3V H;  1IBM L;  4BY7 G;  1FNW A;  4IUV A;  4DV1 Q;  4B08 A;  4C3I B;  1UE6 A;  2YU9 B;  3R8B A;  1TWG B;  2WIN B;  2R92 G;  3Q8D A;  3SEB A;  2J4X A;  1XPR A;  4S3S A;  4HIK A;  4N8F A;  1EQT A;  3OHX C;  3IKJ A;  2H4O A;  1IXR A;  5LMU L;  4OGQ C;  3M4O B;  1HA6 A;  1VQG A;  2DUD A;  4R9W A;  1YZ6 A;  5TSS A;  5EGT A;  3VR4 A;  3SDZ A;  4NP5 A;  3CCS A;  2NVX B;  3AYH B;  5IOD A;  3TRZ A;  1JE4 A;  2O2L D;  5IYD G;  2QIL A;  4GLX A;  2FFK B;  4IOC A;  2EYJ A;  2AQ3 B;  5IGB A;  4MTK A;  1EYA A;  3L2P A;  1PV4 A;  1EUJ A;  2WKD A;  3PMF A;  3OIQ A; 
#chains in the Genus database with same CATH homology
 3FRP B;  1Q3L A;  4IUP A;  2Q8R E;  5CBE E;  1I4R A;  1VF7 A;  3K0Y A;  1EL0 A;  3LWU A;  1WVL A;  4KN7 C;  1B1Z A;  1Y1W B;  2XRQ D;  1DOL A;  1BNZ A;  5T1G A;  4CKC A;  2IWH A;  4IUU A;  1RTN A;  5JJZ A;  5CGK A;  2F0L A;  3VR3 A;  1G2T A;  1STB A;  4DNR B;  3GTK B;  4ZAI A;  2AWN A;  2F0M A;  2O4X A;  1PYW D;  3MFY A;  1AN8 A;  1IHZ A;  1DZ1 A;  2A69 D;  1HUN A;  5NUC A;  1SMY D;  2FHT A;  2M00 A;  4IUQ A;  4A3J B;  3S15 B;  3SE0 A;  5C3W A;  5I9O A;  2ZXP A;  2XWJ B;  2R7Z B;  1V43 A;  2MGS A;  4EQN A;  2EY6 A;  1EQV A;  3P7J A;  1JOK A;  5JAV A;  4X3S A;  3TP6 A;  2OF1 A;  1Y1V B;  2EJF C;  2B2V C;  2CQA A;  1SMY C;  2MUY A;  1EWC A;  1D6E C;  4BWG B;  1TS3 A;  4KTA A;  5CC4 A;  5EBC A;  5J39 A;  4R8N A;  3J81 E;  1Q1E A;  3TN2 A;  1B2T A;  5C4H A;  1ZXT A;  4QUC A;  3C1F A;  3PUX A;  4KJN A;  5K36 H;  2K05 A;  3IFT A;  4H0L C;  4ME5 A;  4HMI A;  4J8Q A;  1H9S B;  1TS2 A;  2L55 A;  3A8I E;  4XIG S;  4ZYS A;  2BA1 A;  1W6K A;  3GP7 A;  1RDP D;  3SK5 A;  4KKU A;  4PMW A;  2F0O A;  3FMC A;  1GHK A;  4PV1 C;  1KDC A;  1TWC B;  4KY7 A;  1CA6 A;  1WTO A;  1STE A;  2RVL A;  4OO1 H;  1GXD C;  3Q24 A;  5C4X B;  5EKK A;  1SND A;  3S1M B;  2K5Q A;  5CV7 A;  3KK7 A;  1F2Z A;  1OO9 B;  5J1Z A;  1MBY A;  1HFN A;  2A68 D;  3HOY B;  3QIA A;  1MGS A;  4NW2 A;  2D62 A;  3K5L A;  1O80 A;  5C0X J;  3ZYY X;  1LTB D;  4DF7 A;  2KOL A;  1XTC D;  5C3E B;  1A2U A;  1TS5 A;  2EYO A;  1BOS A;  2JP1 A;  5JPM C;  4HMJ A;  1SYF A;  3K5N A;  5I4D A;  3C1E A;  3I72 A;  3RZO B;  1QOH A;  1S5D D;  1VMC A;  2F0P A;  5FO7 B;  4X3K A;  3SK6 A;  1LO5 D;  3T56 B;  1OXT A;  1VDZ A;  1TR5 A;  3G6J B;  1ENA A;  4A3G B;  3X3M A;  5JEA J;  4YIJ A;  2HQE A;  4HAE A;  2RSO A;  2EYH A;  4KV6 A;  3HOZ B;  2E76 C;  1F2M A;  1C8C A;  4M1U B;  3V96 A;  4XT3 B;  3CU7 A;  1EYC A;  1HRJ A;  2EXZ A;  5T1I A;  3T53 B;  5ISR A;  1VF5 C;  4ZUJ A;  3WOE A;  1HTL D;  4HED A;  3OOC A;  2I46 A;  5C44 B;  2JA6 B;  5A2Q L;  1NAP A;  5I2Y A;  5IOC A;  5M9O A;  2B2Y A;  1E2W A;  3BVM A;  3P1H A;  2B2U C;  1ET6 A;  2O5I C;  4RGM A;  4QB4 A;  5HUR A;  1T5E A;  1K83 B;  2ID0 A;  5FLX E;  1B53 A;  3PUY A;  3GD7 A;  4FO2 A;  1MI2 A;  3CKI B;  1TKW B;  4C2M B;  1LAC A;  2PMZ B;  2WV6 D;  5BN4 A;  5M5X B;  3HOU B;  1RTO A;  2VXW A;  4C3J G;  4ABN A;  1R4P B;  2RKS A;  4X3T A;  1PTO F;  5IGC A;  1DOK A;  1JWM D;  1AFP A;  1UEA B;  2R61 A;  5KGU A;  3I70 A;  1V8Q A;  2KEC A;  4TSS A;  5M3M B;  3C2P A;  3GTG B;  2TMP A;  2LS0 1;  2K28 A;  1ZKO A;  1JR0 D;  4IUN A;  1Y8O B;  2F0U A;  2LKV A;  3T13 A;  5K36 G;  4UAI A;  2ZXO A;  2FJ2 A;  1A3T A;  4RCN A;  2L5T A;  1ROD A;  4K8I A;  1SYE A;  4KN4 C;  3SK8 A;  1SNM A;  3QOL A;  2K6A A;  3VYS A;  3ND8 A;  2F4I A;  3ND9 A;  2EOT A;  5CYU A;  2KQ3 A;  4EGV A;  2Z4H A;  4FNF A;  3AU7 A;  3SXH A;  5C5L A;  1RHP A;  2SOB A;  5JPN C;  3BDO A;  3MWY W;  4DXG A;  2B63 B;  3EFX D;  3H6M A;  3NE5 B;  4X3U A;  1A2T A;  4Q0F A;  4DAP A;  1WTQ A;  1JOO A;  2X6L A;  1B50 A;  3IFD A;  2NVY B;  1KTK A;  2PPB C;  3JAM E;  3K7A B;  4U68 A;  2D2C C;  5EBD A;  3PO3 B;  3BZD B;  3MEH A;  2BE5 C;  4DNT B;  5KRU A;  1Q90 A;  4L8J A;  3RD4 A;  1HFG A;  1S4Z A;  5IGD A;  4ILW A;  3D4R A;  2HCI A;  3BVZ A;  4N9T A;  1X3P A;  4EQP A;  1Y8N B;  2EZV A;  1FD7 D;  1YNN C;  1CHQ D;  2IT1 A;  2EDG A;  3D6C A;  4A3D B;  3DHQ A;  4C3H B;  1GHJ A;  2NN6 I;  4XYQ A;  1TII D;  3M85 A;  3MZ5 A;  1IKM A;  3NTI A;  1BUV T;  3J80 L;  2D5D A;  2K1B A;  3TZU A;  1J9O A;  1U4R A;  2JA8 B;  4BA2 I;  3U9S A;  2GA4 B;  4BBS B;  4O1N A;  3KBG A;  3QO2 A;  3KLR A;  2ENB A;  1EY4 A;  2NVT B;  3W3A A;  5LL6 S;  4FF1 A;  1RCV D;  4NMZ A;  4G7Z C;  3S14 B;  4OIK A;  1SDF A;  3DWA A;  1H9S A;  4KD3 A;  1WD1 A;  2K03 A;  4K14 A;  4EQO A;  1JIC A;  3SK4 A;  1PTO D;  5CMD A;  1BCP D;  3JAM L;  1IW7 C;  2D9U A;  1K8M A;  1TT2 A;  1I6V C;  3V05 A;  1EY6 A;  1CI3 M;  4XQJ A;  3I73 A;  1SNC A;  2O5J C;  4B9W A;  3IAY A;  4RKL A;  1HHV A;  4CGY B;  1OXX K;  5LHY 1;  3EQL C;  1EWH A;  2BE5 D;  3DM1 A;  4A3F B;  4HR7 B;  3K5O A;  3VA7 A;  1STH A;  1SYD A;  3T16 A;  3D4W A;  1LTG D;  1PRT D;  1CK1 A;  2EY2 A;  3GTJ B;  3F2U A;  3URY A;  1ENC A;  1X3Q A;  4C3J B;  2ICI A;  3I3C A;  3Q6S A;  1PFB A;  4XTC S;  1SNO A;  2WB1 B;  4CJ1 B;  4C1N K;  3GQB A;  5M3F B;  4G57 A;  4G4K A;  1FYC A;  2DY7 A;  3R3O A;  3DEP A;  5A35 A;  3GTO B;  1XXG A;  5DAU A;  3A56 A;  4K5X A;  1DXM A;  2VUM B;  3K6O A;  4CJ2 C;  3C46 A;  1TQO A;  2XWB B;  4V19 0;  2K33 A;  1BBX C;  3EA6 A;  1I6H B;  1EY9 A;  5KNB A;  1BCP B;  2LFN A;  1D5Z C;  1I50 B;  3MHB A;  4C1N I;  2AQ2 B;  1JOR A;  3T51 B;  1AW7 A;  4CBV A;  1E2V A;  1HXY D;  2A5H A;  4A3M B;  4IUR A;  3LX0 A;  1U9R A;  2RBM A;  2FMC A;  2CVR A;  1VCI A;  5IGF A;  3VR6 A;  4CHT B;  2KVM A;  3DWP A;  2JE6 I;  2Y0S B;  3OWF A;  2BDN A;  3UI2 A;  3FVQ A;  2F1M A;  4ZLT F;  2OEO A;  3U9O A;  5LL6 X;  3TP5 A;  3A8J E;  3HOW B;  3I8Z A;  1O7L A;  4FF3 A;  4QF4 A;  4KMU C;  3R2T A;  3E5S A;  3AB9 A;  1BR9 A;  4RHR A;  4A3B B;  1ILQ A;  4EVO A;  3BYY B;  4K5W A;  3OWE B;  2L1B A;  1Y8P B;  4HSV A;  3A8K E;  1ONL A;  5KYI A;  3FPU B;  4FXD A;  2IX1 A;  2NN6 H;  3P75 A;  2NZ1 D;  1DOM A;  4A93 B;  2K5D A;  5EPJ A;  2IX0 A;  1B3A A;  1DON A;  5FOB B;  5JEA G;  5ELC A;  2IPK D;  5DEH A;  2JXM B;  3H09 A;  1LT4 D;  1PXU A;  2B2W C;  5I6W A;  3NK9 A;  4RCO A;  3FDT A;  1R4Q B;  3VYT A;  1EFI D;  4RGT A;  1PRT B;  4NKL A;  5KYL A;  2NBF A;  2L12 A;  4J1M A;  5FK9 C;  4QCL A;  3L9A X;  1QIL A;  4RGO S;  2F0K A;  3K5M A;  5G3L D;  3KLS X;  5D3I B;  3S1N B;  4U67 3;  2F3W A;  1D2B A;  1KAB A;  3NUC A;  2A6E C;  5C4J B;  3NQI A;  1KNE A;  2B8G A;  3TZD A;  4FF4 A;  1Y69 U;  2F3V A;  3OPO A;  1RJT A;  5K5P A;  3VR2 A;  1PTO H;  5FO9 B;  1IW7 D;  2LY7 A;  4DAY A;  5IT9 E;  2AQ1 B;  2YYZ A;  1GUT A;  2CHB D;  5E3F A;  2DNC A;  1CZW A;  1EYD A;  2L4N A;  3BVG A;  1U4M A;  4ULL A;  2KJX A;  4FP5 D;  3K58 A;  1ZEQ X;  2WAQ B;  2BA0 A;  1O7Z A;  1F77 A;  1HCZ A;  1T5X D;  4KI0 A;  4BY7 B;  5EPL A;  3HGB A;  1U4L A;  2N55 A;  4PQX A;  1SSO A;  2E75 C;  5E4X A;  5EQ0 A;  4G7H C;  1B9M A;  3TME A;  4WRD A;  3PUW A;  4H44 C;  4DK0 A;  2OT2 A;  2MHV A;  4N9P A;  1BF4 A;  1SE4 A;  3D3R A;  1WTX A;  5D14 A;  4IN3 A;  4BBR B;  4A3E B;  2ICE C;  1H9K A;  1D5X C;  3HOX B;  1B44 D;  1KLU D;  1J8I A;  1GOZ A;  1GUO A;  3KF8 A;  2G9D A;  1I4H A;  5EKI A;  3EVQ A;  3TP8 A;  3I90 A;  3TBI B;  4OL7 A;  1SXT A;  4DGZ A;  1IL8 A;  2JSO A;  1PTO B;  1Z6H A;  1JB3 A;  5CV9 A;  1S5F D;  4K6L A;  2JEB I;  1SJH D;  2PCF B;  4LMQ D;  4FYD A;  2QDB A;  1WTP A;  1HQR D;  5EJW A;  5KIX A;  1LT6 D;  4F8M A;  1A15 A;  3KBX A;  4QMG A;  1B4O A;  1C48 A;  1E2Z A;  1V1P B;  1ZYR C;  2F0W A;  2RA4 A;  1ILP A;  1LTA D;  2B2T A;  4KKT A;  1LV9 A;  2I07 B;  5DM7 3;  1IYV A;  4OO1 G;  2DN8 A;  5DM6 3;  1QJO A;  1V1P A;  2NTT A;  5IT9 L;  1UAP A;  3CQZ B;  4O42 A;  2E2D C;  1G29 1;  1H9J A;  2X69 A;  1E0B A;  3HRZ C;  1SYC A;  3Q23 A;  4H7B A;  3I91 A;  4BS9 A;  3GTP B;  2CW0 D;  3NHH A;  3D4D A;  4KK7 A;  3J80 E;  4PMC A;  2EE1 A;  5COR A;  4WFN 3;  1EY0 A;  2KHS A;  4G7O C;  1SNP A;  1FR3 A;  4HCE A;  5ELF A;  3M4Y A;  1RF2 D;  4E6I A;  2A6H C;  3NWT A;  4MHE A;  3BDL A;  1DYQ A;  1LT3 D;  4C3I G;  3MTS A;  1C4Q A;  4HCS A;  3K59 A;  5CR3 A;  2RDG A;  1QE6 A;  2PW7 A;  2TSS A;  1KDB A;  1EY8 A;  1MSH A;  3NTK A;  4M8A A;  1I3Q B;  3S1R B;  1CHP D;  3DEO A;  2E2J B;  4DN4 M;  3PIP 3;  2CW0 C;  2PZT A;  3SHL A;  3MC0 B;  4IZ8 A;  1F9S A;  3M3Y B;  3J7A V;  1GJX A;  1D1K A;  4FF2 A;  1JCK B;  5EPK A;  3OMC A;  1WCM B;  3WDN A;  4PMB A;  1BDO A;  3MXG A;  3HP3 A;  4KJO A;  1QCB D;  1JC7 A;  4XT1 B;  3VR5 A;  4BY1 B;  3C3L A;  2B2V A;  1ESF A;  3V2T A;  3S17 B;  3CHB D;  2F03 A;  4LAA A;  2B39 A;  1D1I A;  1TY2 A;  4K2K A;  1AP0 A;  2B2U A;  3M7N A;  5C3X A;  4ODG A;  3QWN A;  2KED A;  5J22 A;  3A54 A;  2PYK A;  2ZT9 C;  3ITP A;  1VMP A;  4FVM A;  2FIN B;  1UNS A;  5E4W C;  2XRS D;  3A55 A;  1H9M A;  4AYB B;  3W2D A;  1ESR A;  2B2T C;  2F0J A;  1U4P A;  1D5M C;  2QKI C;  3PO2 B;  1NR2 A;  1F2L A;  1TWF B;  3A7L A;  1BCP C;  2VB3 X;  1PTO C;  2QEJ C;  4BA1 I;  4F87 A;  1A6X A;  5HGT A;  2F0Q A;  3TSS A;  1CQV A;  1EY7 A;  1NCV A;  1O78 A;  5KEE A;  2M2L A;  2F0N A;  2H1E A;  2IJ0 A;  2F0E A;  1G6Z A;  1PFM A;  2KCN A;  4OHJ A;  3SVM A;  2WAC A;  3S16 B;  2EYL A;  2PO4 A;  3E6Z X;  3LNN A;  3A7A B;  2KEE A;  2C5C A;  3HOV B;  2KA7 A;  1K8O A;  4V0B A;  1TU2 B;  1Q8I A;  1PMR A;  1EU3 A;  1I4G A;  2A74 C;  4HTH A;  3GV3 A;  2IL8 A;  2BOS A;  1LT5 D;  4DA2 A;  1CM9 A;  4CJ0 B;  3I4N B;  1HA5 A;  2RDH A;  1BCP F;  1G91 A;  1CFM A;  2A6H D;  2V4D A;  2IX3 A;  4IQZ A;  2HUG A;  4JBW A;  5ELB A;  1CZG A;  3OW7 A;  2AWO A;  4R8I A;  1F9Q A;  4XDX A;  3BDC A;  4IFD G;  1EIG A;  2SNS A;  1V1O A;  3NWS A;  2XN9 C;  2Q8I B;  3ONA B;  2B2Y C;  3H91 A;  1SBB B;  3I4M B;  1PLF A;  1OXV A;  5E1F A;  2XIW A;  5I6Y A;  1LTS D;  1A3V A;  1SE2 A;  2VNU D;  4KKS A;  3DUZ A;  3O13 A;  1PZI D;  3SR1 A;  2G9H D;  2F0F A;  5DNF A;  4IUT A;  4XYO A;  4L63 B;  3Q0A A;  5JOB A;  2EJG C;  5C6A A;  1DD2 A;  4FXK C;  4MIU A;  3PV0 A;  5C5M A;  1HTP A;  2JA7 B;  1F9R A;  5C0X H;  1XYI A;  1FNU A;  3R93 A;  3BYT B;  5IGE A;  4A3I B;  5EKL A;  2K5W A;  3NP8 A;  3GTL B;  2RQX A;  3QJY A;  4HSP A;  4K2L A;  1TVX A;  1GUW A;  1QNK A;  1RKN A;  3VA5 A;  2BDO A;  2KCC A;  5D3D A;  4ZQ3 A;  1JOQ A;  2RSN A;  2WII B;  4KHV A;  3Q22 A;  3L7Z C;  4IFD J;  2B2W A;  2F0V A;  2WKC A;  3NSW A;  4RGN A;  4ZKB B;  5A2Q E;  1HUM A;  2LMC B;  2EYM A;  1PZJ D;  2E74 C;  2A68 C;  4OIJ A;  2PQE A;  1PDQ A;  4K6D A;  2J0T D;  3MFG A;  2PNR C;  3EJI A;  1ENF A;  1I4Q A;  5AFW A;  1DCZ A;  2M9V A;  4ZKC B;  2F0G A;  4DK1 A;  3FEW X;  2L0C A;  4DU9 A;  2NWG A;  3S2H B;  2F0I A;  1SYB A;  3D6W A;  3HZX A;  3MXN A;  1S5E D;  1AEX A;  1GUN A;  1EZ8 A;  1F9P A;  1ET9 A;  1QWY A;  1B9N A;  1MD2 D;  5CV8 A;  5KND A;  1A3U A;  4FXG C;  4L6T B;  3RUZ A;  1DJR D;  2SDF A;  5C4Z A;  1DM0 B;  1M8A A;  2EY5 A;  3X3N A;  1NR4 A;  2F0D A;  1YNJ D;  2J7Z A;  4KY6 A;  2AUJ D;  2EYF A;  3WOF A;  3H94 A;  1Q12 A;  2F0T A;  1HQM C;  4RFB A;  1JWU D;  4ZK9 B;  2BCO A;  4QUF A;  5COY A;  1BXT A;  3TDQ A;  1XX8 A;  2A73 B;  1W6J A;  3L3O C;  4DFA A;  1BO0 A;  4RHS A;  1YNN D;  1QB5 D;  3P20 A;  3S9W A;  3DMU A;  1MSG A;  3OIP A;  4IFD I;  3MAQ A;  1PFN A;  2R93 B;  3VYU A;  4H13 C;  2NTS A;  3H3V C;  2A6E D;  5JVG 3;  2NUC A;  3CRL C;  5BN5 A;  2K32 A;  2QF7 A;  3RLF A;  1STY A;  1JQY D;  5CV6 A;  2EY1 A;  4ID6 A;  3VYR A;  1STG A;  1WTW A;  1EY5 A;  1NUC A;  4KD4 A;  3S2D B;  2WP8 J;  4RWS C;  1S5C D;  2NB0 A;  5CV5 A;  3R2I A;  3QG1 A;  1WTV A;  5IIF A;  4CKB A;  2K01 A;  3MVV A;  4J6H A;  2SNM A;  5CBA E;  1II3 A;  2EJM A;  3HG9 A;  4IAL A;  3PUV A;  1IYU A;  2X6G A;  2AUK A;  4I65 A;  1Z47 A;  5KNC A;  1KNA A;  3LWE A;  4WJW A;  4B9X A;  4JK1 C;  2PW5 A;  3AMU A;  3GO5 A;  2SEB D;  4ZUI A;  2Q8T A;  3N6R A;  3DXJ C;  4RKB A;  2DY8 A;  4K5V A;  3FPP A;  3E0J A;  3NXW A;  4A3K B;  1LAB A;  3HEJ A;  4TQU S;  2JYO A;  3QB3 A;  3OMG A;  3GV6 A;  3S1Q B;  1JWS D;  1G2S A;  1NSN S;  1S5B D;  5JEA H;  1EEI D;  1SYG A;  4MN3 A;  3N52 A;  2N88 A;  5F2D A;  2FMM A;  2Z4I A;  4LJZ C;  2NVQ B;  3MA2 B;  1TS4 A;  1G8Z D;  4K8J A;  1SJE D;  1L0Y B;  3KUP A;  5I2X A;  1AZQ A;  3OSO A;  5FO8 B;  4RA8 A;  2C9O A;  1UUP A;  1TWA B;  3TP7 A;  1KAA A;  2EPB A;  1BQQ T;  3D31 A;  1SE3 A;  2L9H A;  5C0X G;  2L11 A;  1L0X B;  1TY0 A;  3NBI A;  5M5Y B;  1H9R A;  2MP1 A;  1ICW A;  1LTR D;  3DWQ A;  3K57 A;  3KLS A;  4DAV A;  4QIW B;  5CV4 A;  2MPM A;  1KDA A;  5FLX L;  1EIH A;  1WD0 A;  5FKA C;  2ZXR A;  1SEB D;  2K7V A;  1XWE A;  5JVH 3;  1EU4 A;  3I4L A;  1QG7 A;  4I7Z C;  3M7G A;  1TWH B;  5D65 A;  3RMH A;  4ZRZ A;  1CQF A;  3ERQ A;  2XNA C;  4XQN A;  3H0G B;  3IL8 A;  1GUS A;  2HDL A;  3QOJ A;  2JA5 B;  2F0H A;  3J81 L;  1QNU A;  1STN A;  2HCC A;  1AZP A;  3CRK C;  2PZU A;  4DXF A;  4RAU C;  2NYZ D;  3NQT A;  1EZ6 A;  3NTH A;  1FNV A;  1GUG A;  1R9T B;  2B8F A;  2JEA I;  1CTM A;  1OXS C;  3BG3 A;  4PNY A;  5BN3 A;  5G3L F;  1ML0 D;  1PZK D;  2K04 A;  3G7L A;  4KHZ A;  4TRD A;  1ZYR D;  1LLR D;  3GTM B;  4LK1 C;  1LTI D;  4NDX A;  2DNE A;  1PRT F;  5ELE A;  1SNQ A;  2VB2 X;  1I4X A;  1CA5 A;  4P2C B;  3PUZ A;  4Z9C B;  2Z1C A;  2A69 C;  2OXP A;  2QCP X;  1LTT D;  3MXP A;  2R92 B;  3ERO A;  3NBH A;  3PIO 3;  1KLG D;  2E2I B;  2E2H B;  2MJ8 A;  1RD9 D;  4OO1 I;  3J7A F;  4Q5V A;  3D8G A;  3GTQ B;  5IGG A;  3T4A C;  1SFO B;  4UDU C;  2IW3 A;  1F2Y A;  1X32 A;  4Y7N B;  1FGB D;  3HKZ B;  1OXU A;  4IFD H;  3MXU A;  1YNJ C;  1M4V A;  5C0X I;  1IKL A;  4HN7 A;  2KUM A;  1HPC A;  4RH6 A;  4GZY C;  4C3H G;  2F0S A;  1CT1 D;  1Q1B A;  3HS0 C;  5ELD A;  1EOT A;  2EYP A;  4F88 A;  4F7X A;  1O7Y A;  2NN6 G;  1Z7T A;  1I4P A;  2Z8L A;  2EVB A;  2R3Z A;  3RZD B;  4C56 C;  2PZW A;  1PRT C;  1SAP A;  2XSC A;  1WTR A;  4CKE A;  2RDF A;  4XQQ A;  2HDM A;  1EEF D;  3FKI B;  5I9P A;  3BS1 A;  4TKO B;  2R6G A;  3J7Y W;  5M5W B;  4WOR A;  1STA A;  2XVS A;  3NPP A;  4KY5 A;  4XXE A;  1FNW A;  4IUV A;  4B08 A;  4C3I B;  2YU9 B;  3R8B A;  1TWG B;  2WIN B;  3SEB A;  2J4X A;  4S3S A;  1EQT A;  3OHX C;  3IKJ A;  2H4O A;  3M4O B;  4OGQ C;  1HA6 A;  4R9W A;  5TSS A;  5EGT A;  3VR4 A;  3SDZ A;  4NP5 A;  2NVX B;  5IOD A;  1JE4 A;  2O2L D;  2QIL A;  2FFK B;  2EYJ A;  2AQ3 B;  5IGB A;  1EYA A;  2WKD A;  3PMF A;  3OIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...