1B50A

Nmr structure of human mip-1a d26a, 10 structures
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
69
structure length
69
Chain Sequence
SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemokine
molecule keywords MIP-1A
publication title Identification of amino acid residues critical for aggregation of human CC chemokines macrophage inflammatory protein (MIP)-1alpha, MIP-1beta, and RANTES. Characterization of active disaggregated chemokine variants.
pubmed doi rcsb
source organism Homo sapiens
total genus 3
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b50A00
1IL8A 1U4PA 1WTQA 1RJTA 4RAUC 1TVXA 5AFWA 1U4LA 4IUTA 4X3KA 5E4XA 2D9UA 1ESRA 1MI2A 1RHPA 5D14A 1EIHA 3IFDA 2FFKB 5T1GA 4IUPA 4HSVA 4HEDA 5EKIA 4DN4M 2H1EA 2B2TC 4XT1B 1JICA 5T1IA 1XX8A 1WTRA 1WD0A 5EPKA 1BNZA 2L4NA 1IKMA 2HCIA 5EPJA 1DOMA 1O7ZA 2NZ1D 2K28A 2B2VC 2KUMA 1GUWA 2L11A 4NW2A 1ML0D 1PFBA 1AZPA 1B4OA 2X6GA 3DEPA 4MHEA 2N55A 1F9QA 5DNFA 1SSOA 1BF4A 1HFNA 3MWYW 1IKLA 1JE4A 1O7YA 2KEEA 4CJ2C 2B2WC 1X32A 1NCVA 1CM9A 2B2YA 2FINB 4X3UA 5D65A 5CBAE 1BBXC 4RWSC 2JP1A 2M2LA 4O42A 1HUMA 1HFGA 1MSGA 1SAPA 1QE6A 3I90A 1F2LA 3FPUB 1EQTA 2RA4A 3TZDA 3HP3A 1EL0A 4ZLTF 3D6WA 4LMQD 1DOKA 2RSOA 1BO0A 1NR2A 1EOTA 1X3PA 3FDTA 2DY7A 5JJZA 5CBEE 2JYOA 1O80A 3IL8A 2Q8TA 1G2TA 4OIJA 2J7ZA 4QUCA 1CA5A 1HUNA 3SVMA 1RTNA 2MGSA 3I3CA 2CVRA 2X69A 2HDLA 4R8IA 1B50A 4X3TA 1QNKA 1RODA 5EJWA 1F9SA 2RSNA 2K01A 4R9WA 4XT3B 1RTOA 2B2UC 5COYA 1SDFA 2EPBA 5CORA 1AP0A 1U4MA 2KEDA 2K05A 2K03A 1E0BA 2IL8A 1B2TA 1DZ1A 1WVLA 1PLFA 1WTVA 2B2TA 1J9OA 1KNEA 2EOTA 2HDMA 3F2UA 4ZK9B 1J8IA 3KBXA 1WTWA 1X3QA 2VXWA 3G7LA 2N88A 3ONAB 1ICWA 2B2VA 2FHTA 1HA6A 2NWGA 4IUQA 5EQ0A 1LV9A 4OIKA 1PFMA 5E4WC 1VMPA 2KOLA 1M8AA 5EPLA 1DONA 1G2SA 1ZXTA 2L12A 4QUFA 3DM1A 3GV3A 1WTXA 1F9RA 3P7JA 4MN3A 1Q3LA 1ILQA 3DEOA 3GV6A 3H91A 2Q8RE 4HCSA 1DOLA 4U68A 2B2WA 4CJ1B 1HRJA 3Q6SA 2SDFA 2HUGA 2FMMA 2K04A 2K1BA 1VMCA 1QG7A 2KECA 2EE1A 2L9HA 4HAEA 2NYZD 4XDXA 1B3AA 4ZKBB 1XYIA 1HHVA 1AZQA 4ZAIA 1A15A 2MJ8A 1F9PA 3MTSA 2HCCA 1MSHA 3UI2A 4RA8A 1KNAA 5CMDA 3QO2A 1EIGA 1U4RA 4IURA 4IUVA 1G6ZA 1NR4A 4ZKCB 1WD1A 2X6LA 1CA6A 2L1BA 1WTOA 4CJ0B 3I91A 1ILPA 2B2YC 1PDQA 1PFNA 4IUUA 4UAIA 2RVLA 3TN2A 2B2UA 2FJ2A 2DY8A 1NAPA 3I8ZA 3LWEA 3KUPA 1B53A 2MPMA 2XIWA 3R93A 1WTPA 4X3SA 1MGSA 2KVMA 2R3ZA 3N52A 1C8CA 1G91A 2BDNA 1S4ZA 2MP1A
chains in the Genus database with same CATH superfamily
4DR6L 3SGIA 2QDLA 5C3EB 2HQLA 2WAQB 1E2WA 4X3KA 3KF6B 1HXYD 4A3BH 1MD2D 4DNIA 3K7AH 4AYBB 1K8OA 2NZ1D 1TKWB 1EU4A 4KKUA 4NW2A 3OIPA 3PIO3 1K9MC 3BVMA 3PO3B 2GVBA 1FJGL 2H4OA 1F9QA 1QUQB 1XJVA 4FF3A 3CMEA 1N34Q 5K36G 3T1YL 2B2WC 1Y8OB 2HHHL 1DXMA 4WRDA 1A63A 2E2IH 3TZDA 3I2ZA 3HOXB 1EY8A 1ENFA 3EBEA 3TP5A 1VQKA 1EEFD 2C5CA 4OIJA 3E0EA 4JI0L 1XMOQ 1LABA 1H9KA 4QGUA 3HOVG 4HJ7A 2B2UC 2WIIB 3DWAA 4HIKA 1LTID 4IFDH 4JI4L 3A54A 4QJFA 5LMNW 3VYSA 1KIXA 3OPOA 3AEVA 1SN8A 4XYQA 2B2VA 4C56C 5JVG3 4DR5L 4GOPA 5E4WC 1HNZQ 3DM1A 3VYTA 4MIUA 1VQ7A 1PTOD 1FNVA 2DNEA 4Q0FA 3ICEA 1I4QA 2KCCA 3CAMA 3CCQA 1EY6A 1UE7A 4XQQA 3W5OA 3AFPA 4YHHQ 2K33A 1N33L 5IWAL 4DV5Q 2PNRC 1R9TH 2MJ8A 3M3YH 3KDFB 2HCCA 4A3JB 3RD4A 4OX9Q 5CV4A 1YHBA 2R7ZG 1AH9A 1ILPA 2KCMA 2HT1A 5FOBB 3PSIA 3DUZA 3ND8A 1STBA 4QIWE 3LWEA 1B3QA 3NUCA 5JEAH 2OEOA 3NHHA 4GNXC 4BY1H 2D0OA 1QOHA 1YITA 5FJ8G 5LMUL 3BYYB 4RAUC 2ATWA 1TT2A 1PRTF 1YZ6A 1HPCA 1PYSB 4O1NA 1KDCA 1CUKA 3HOVB 1STEA 2E2HH 1GO3E 1QWYA 3H94A 2Q2HA 3HFZB 5A35A 5C0XG 4IQZA 2JEAI 2B2TC 4TRDA 1X55A 2CHBD 4DK1A 1C0AA 4BBRB 1MJEA 3CPWA 4KN4C 1NUCA 1TWFH 4X65L 3AB9A 3MWYW 3K59A 4GLXA 2KCTA 3S14B 3G6JB 4RWSC 2M2LA 1EQTA 3PO2H 1GVPA 3S1QB 1EY4A 1PRTC 5IGGA 4P73A 4DK0A 1Y8NB 3DM3A 4X62L 2LSSA 1X65A 1GOZA 3J81j 4U673 1TS2A 1RTNA 4R8IA 5C4ZA 1QNKA 1G51A 4HTHA 2KA7A 3CC4A 5I2XA 1HTLD 1PH5A 1H9JA 1TWCB 1K83H 5KGUA 1UUPA 4NXNL 1WCMG 2FHTA 1JJ2A 2CKZB 4R4CA 1WTHA 3I7FA 2A69C 2A68D 1I3QH 3P7JA 1HCZA 2NTSA 4KI0A 2UUCL 3GTPB 3M7NA 4LF9Q 1FGBD 3UDXA 3I4NG 4HIDA 2VQFL 2K04A 1RD9D 4A3FG 1HHVA 3HRZC 4Y52H 4K0KQ 2L5TA 4KN7C 2CWPA 1SR3A 1YJ9A 1EYCA 4NKLA 3FEWX 2IW3A 1SE3A 2UXDQ 2O5IC 2XVSA 1L0WA 4K6LA 2B2YC 4C3IH 2OF1A 4A3KH 4TKOB 1UE5A 4Z9CB 1Y1WG 4DR7Q 2PQAB 2IPKD 5BR8Q 4IFDJ 2DN8A 3HOWB 2I0QA 3EFXD 2JA8H 1L1OA 1C8CA 2LMCB 1STGA 3C46A 5L37A 3K8AA 4JW0A 5JAVA 3CW2C 3M4PA 1GJXA 5E3FA 4RGOS 4GKKQ 1U4LA 4JI7L 2N3SA 1SYFA 5T1GA 4FO2A 4OL7A 3KYHC 1JJCB 1LTTD 4HJ5A 1BBUA 2AWOA 2HCIA 2IHFA 1JR0D 4DXFA 4CBVA 4QB4A 4A93H 5KRUA 5LMNQ 1B4OA 1G8ZD 4UP7A 4G57A 1XPOA 1HNWQ 5CBAE 5M5YH 4DV1Q 3I4NB 3RZDH 4JCVE 1CKNB 1EYGA 2UUBL 2F0KA 3D8GA 5JEAJ 3S1MH 4NB3A 3EN2A 1DGSA 2P5ZX 1VQDA 3EROA 1C4QA 4MZ9A 3IL8A 3QR8A 1B1ZA 2WACA 4KHZA 2NN6I 4GNXB 2YU9B 3GTLH 4LFCL 1PYWD 2SOBA 1Y1WB 4B3TQ 3HOZB 1HR0L 3P20A 2K03A 1CKMA 4BWGB 5KEEA 4K5VA 1KNEA 3PGZA 4CGYB 3VA7A 3A7LA 2NVQB 3H0GG 2SNMA 1HNXL 3ULJA 4HCEA 4QUFA 2VY3A 1VQEA 2Z8LA 2KHSA 4ILWA 2SDFA 1GD7A 1QZGA 1K8AC 3Q0AA 2IX3A 2KJXA 3DHQA 3P75A 2JA5G 5FK9C 3STBC 4A3MH 2JA7G 1VQOA 1QILA 4DAYB 3GTJH 4GN5A 3H3VC 3NXWA 1I4RA 4IURA 3NTIA 2YTVA 1FR3A 5CV8A 1PRTB 3Q22A 3T4AC 4XQJA 5GROA 3MFGA 2JA9A 3SHLA 3C1EA 2JJQA 4G4KA 1HJPA 1JOOA 1VQ4A 3FKIG 3S15H 1GUNA 4JI6Q 2QCPX 5CV5A 2MPMA 2PW7A 3U50C 1KL9A 4YWLA 4C3IG 2D0PA 4A3EH 1WTQA 5KIXA 2R92H 4I7AA 2EYOA 4AYBE 1Q8KA 4MNOA 5C4XB 4OWXB 4DN4M 2ASBA 2JA8G 1V8QA 2XN9C 4IALA 2F0GA 3VR5A 3SK8A 3H0GB 4LF8Q 5EPJA 1O7ZA 2KUMA 4IPHA 3JAMc 1N34L 3DEPA 4F7XA 5M5WH 1VQFA 3HKZB 2XRSD 1IYUA 1TY0A 2JA5B 2EZVA 2E5LQ 3K0YA 4UY8C 5HGQA 4N8X1 4JBJA 1Q7YC 5C44B 4FXGC 2IJ0A 2C35B 2Z4IA 2J7ZA 3SVMA 2K5WA 4FXKC 2BDOA 3QB3A 2PO4A 5CORA 4B9XA 4JOIA 4G7HC 3U9OA 5EGTA 1VQMA 4NPSA 4UDUC 1LT6D 5I6YA 1MHWC 3K80C 2PQEA 3NQIA 1WTVA 1J9OA 3KK7A 5IYBH 3VR3A 3KBXA 4HN7A 4K8JA 3PCOB 1TS3A 4GKJQ 4F8MA 1OTCA 5M3FB 2L55A 3E9HA 3H15A 4TSSA 1XTCD 1XMQQ 3A5ZB 2B63H 3GTOB 4OELB 1GUSA 4YHHL 2K1BA 5GAHC 4DV5L 1TWHB 3BDLA 2J4XA 1KQSA 2ICEC 1D1KA 3T56B 5K5PA 5C3EH 1PZJD 5KYIA 3URYA 5A2QL 1KNAA 4C3HG 2F3VA 1K28A 3S1NH 1LTGD 2NZHA 4FF1A 1GM5A 1B44D 3OMGA 3GTQB 4R1JA 5JOBA 3S16B 2CQOA 1KXLA 5G3LF 1VQJA 3KLRA 5BN4A 2ZM6Q 3PO3H 3R93A 1WTPA 4X3SA 2R3ZA 2IY5B 4JBKA 1KDAA 2Q8IB 1A8VA 5ELOA 4QQBX 2MP1A 5IY0A 1VQHA 4DV3Q 2Z6BA 3RUZA 1I5FA 1DJRD 3BU2A 1VQGA 3RMHA 5IYCH 5E4XA 1ENAA 2D9UA 1E2ZA 3K5MA 1KC8C 3NK9A 1D6EC 1E7ZA 3B6YA 4HEDA 5IODA 5M3MH 3U58A 2R93B 1K3BC 3NBHA 2H5XA 4A3IB 1QCBD 3J80i 3VR2A 4LFBQ 3M9BA 2R92G 2A1AA 1IHZA 3KJOA 5JVH3 1EYDA 2WKCA 5BN5A 2X6GA 5KNDA 2B29A 3GTKB 1EEID 2R7FA 4PMWA 4FVMA 2K5VA 2WP8J 5KYLA 5ISRA 1MBYA 1O7YA 3HEJA 1IZ6A 5IP9H 4DNTB 4PNYA 2NVTB 1QE6A 1Q1EA 1WJJA 3HOUH 1TQOA 1E2VA 5C4JB 3CCEA 1VDZA 3FHWA 2I07B 3PUZA 4UP9A 4A3GG 4LF5Q 2PZTA 3A5UA 4S3SA 1ZKOA 1PTOC 5EJWA 4P72A 3AU7A 1DZ1A 3A7AB 1TU2B 2ZJRA 4ZUJA 1Y69U 1AEXA 2F0QA 1GUOA 3TP6A 4LF9L 2WB1B 3MXNA 4MN3A 4U68A 1LTAD 4CJ1B 1EFID 4HCSA 5IYBG 1TWAH 2JE6I 1PH4A 2OT2A 1XYIA 2IHEA 4DV7Q 1QNUA 4ZAIA 3BYTB 4APVA 1S72A 4RA8A 3PF5A 1U4RA 3I4LA 3CPFA 1CZGA 1WD1A 3D4DA 2E2JB 2L1BA 2EQSA 3E9IA 5AJ3Q 4DF7A 3TDQA 4DR7L 1I6HB 5BR8L 4G7ZC 2QW7A 2B8GA 2F0PA 2KHJA 2JXMB 1LT4D 3TBIB 3RLFA 2Z1CA 2CQAA 5JPMC 2PPBC 4A3GB 2NVYH 2KHIA 3MZ5A 4ZQ3A 4GKKL 4BY7H 1EUJA 1S3OA 1TVXA 2IWHA 1SNOA 4R8NA 2JA6H 3IFDA 2R7DA 1D5ZC 3S1QH 2RBMA 5IYDG 4J6HA 2XWJB 1K8GA 3VR6A 1WTRA 3ND9A 5LMNL 4OO1G 4OHJA 1VQLA 1A0IA 1VS0A 1TY2A 2Y0SB 2ZTDA 3PV0A 5JJKA 4I7ZC 1VQ9A 1I94Q 4DV1L 3SXHA 1L1OC 4X3UA 1XNQQ 4H44C 1TS5A 4AQYQ 1TWCH 5M5XH 3HP3A 1Y1VH 1CT1D 5C0XI 2ALYB 3MC0B 1XNRQ 4KY6A 4BS9A 3H6MA 2VQEQ 4ME5A 1JOQA 1GHJA 5EBCA 5F2DA 4A3DH 5IP9G 2A6ED 2NVXB 1KABA 3GTPH 2A68C 5FLXc 2MO0A 2QF7A 3I73A 4JI5Q 3HOUG 1N32L 4X64Q 1RTOA 1I6VC 4A3LH 3TZUA 4GN4B 1WVLA 2RQXA 3KF8A 3JC66 2HDMA 3S2HH 4JBMA 4DR4Q 1LLRD 2LKVA 4KHPL 2VXWA 1JB7A 2F52A 1QVCA 2BA1A 5EQ0A 1LV9A 3HGBA 4BXXH 3V96A 1KLUD 1YBYA 1BBWA 2SNSA 1VQ6A 1ZEQX 3M4QA 1IYJB 2MNAA 2K5DA 2KECA 4XDXA 2EE1A 2Z6KC 4DR2Q 2FXQA 1SNMA 3K0XA 2EJMA 2RHSB 3I56A 3AMUA 3QIAA 1TWGH 4K6DA 4LUVA 4ZKCB 2XWBB 4JYAQ 1DCZA 2K5HA 1H9SA 1D5XC 2AQ1B 1HA5A 3VDYA 1B53A 2I46A 3KJPA 4IUNA 2PMZB 2HQEA 2RHQB 1CHQD 3GTMB 4POFA 1ESFA 2OTJA 3KF6A 3OWEB 3UDFA 1QVFA 4LFAL 2JK8A 1IBMQ 1MKHA 1UE1A 2MHVA 1N8RC 3NSWA 1LTSD 4LF7Q 4LF8L 5HURA 3F2CA 4BBSG 4RGNA 3R3OA 1QUQA 1WOCA 3RZOH 3I4MH 2E8GA 4NXML 4M1UB 4GZYC 2JA6G 1S5CD 5J1ZA 1TR5A 4DUYQ 4DV2Q 1BCPF 1OXSC 1K73C 3HOZH 3G48A 4C2MB 1NBWA 3BVGA 2JEBI 2ZXOA 2F03A 4JI8Q 3X3NA 3D0FA 1SJHD 4DR3Q 2AHOB 2E5LL 2RCNA 5C4HA 3PUWA 1SNDA 3OTOQ 2EYMA 5IOCA 4GS3A 3FRPB 5ELDA 1LUZA 1YJWA 2ZXPA 4C3JH 1V1PB 4PZ8A 1SNPA 1Y1VG 1JWUD 1VQ5A 1KAWA 4CHTB 1B2TA 4A3BG 3K58A 5DM63 4A3DG 1JC7A 2EOTA 4H02A 1BCPC 4GKJL 5M9OA 4RCOA 4P74A 4L5TA 1SNQA 2AWNA 1HA6A 2NWGA 1XMQL 4HIMA 1STNA 1Z47A 1ZXTA 4A3LG 2F0LA 4EQ5A 5I9PA 4A3CH 2F3WA 3GV6A 1SMYC 1Q90A 2Q8RE 3TREA 3CQZH 2EY5A 2R7ZB 3KDFA 1VMCA 5I9OA 2F1MA 1JJGA 3LWUA 4BXXG 1CK1A 4IJHA 2F0IA 1EIGA 4JOIC 4RHRA 1EIYB 4RGTA 5C4XH 2PI2A 4XTCS 3R8BA 4IO9A 2B8FA 4PV1C 4CJ0B 3Q8DA 4JI3L 2F4VQ 4UAIA 4PZ7A 1Q12A 2WFWA 4IFDG 4P71A 1BOSA 2BOSA 2QGQA 2FMCA 2M00A 3KUPA 2UXBQ 2OCEA 1M90C 4DV0Q 1Z7TA 1NJIC 3L2PA 3S1RB 3W3AA 5JJIA 4ALPA 3G6EA 1CSPA 3A8KE 1YHAA 2LXJA 1QZHA 2FFKB 2NB0A 2E74C 2Q2TA 4A3BB 4LFBL 4XT1B 3K7AB 5T1IA 1KD1C 3HOYH 2L4NA 1E3PA 5IGFA 1DOMA 3GO5A 4WJ3M 1AZPA 5J3BA 1ASZA 2G5DA 3PUVA 2VUMH 1HFNA 2PZWA 2F0OA 5IGCA 2F0DA 2KEEA 3WOFA 3GQBA 2PW5A 1BBXC 3OIQA 3F8TA 4O2DA 3DWQA 2VZAA 1O78A 3I4MG 2EJGC 4ZLTF 3NP8A 3NEMA 1K3RA 1H95A 5JEAG 3RR5A 3D31A 2AQ2B 4QL5A 4BY1G 2DNCA 3J7YW 5M3FH 1Q82C 3HKSA 4LF5L 4X66Q 1IBLL 3J81c 2Q8TA 1EU3A 2DUDA 1WCMB 3VYRA 1IBKQ 3ZJYC 2ZTEA 3G4SA 4XT3B 1YI2A 1VF7A 1TWHH 1T9HA 2EPBA 3BVZA 4H7BA 3GP7A 3J80c 2IL8A 1AE3A 1E1TA 4ZK9B 3MEFA 3F2UA 4LK1C 3G71A 1D8LA 4C3JG 5A2QE 2Z0SA 2O4XA 4A3FB 1WTWA 4C1NI 2CW0D 1IW7C 2Z9HA 1GXDC 2DGYA 3GTQH 3UE1A 1M8AA 1TXYA 1DONA 3AYHB 2UUAQ 4TQUS 3CCJA 1PZKD 1B8AA 3NENA 1DOLA 2B2WA 3SK5A 4DV7L 3NTKA 5C3XA 3CCMA 1G2TA 1Y8PB 3PO2G 4JI2Q 1QVGA 4TVAB 5FLXL 3M3YB 4QY7A 1WYDA 3BDOA 3OYYA 4LF4Q 3ERSX 1A3TA 3QOLA 4Y7NH 4IUVA 4AH6A 5AJ3L 3HG9A 1XPRA 4G7OC 2WINB 4EGVA 2PQAA 5ELFA 5NUCA 1D2BA 3I91A 2R93H 3PIP3 5FKAC 1PDQA 1W6KA 5IGEA 1STHA 2SEBD 1GUGA 2VNUD 2B2UA 1YNND 1N36Q 3OHXC 3H3VI 4KJOA 4DXGA 2K75A 3P1HA 3ITPA 1SNCA 4BY1B 2BH8A 2GVAA 3GTKH 1NMFA 1BKBA 1LTRD 1YEZA 5C3WA 1RJTA 1RCVD 2QKIC 1P16A 4NMZA 2HHHQ 1BCPB 2NVTH 1MIUA 2I5HA 1A6XA 1EFWA 3NTHA 1AN8A 2DJFC 2ES2A 4HMJA 4B3SQ 4AIMA 3PIOA 3S17H 1K8MA 1YJNA 4K5WA 2OXPA 3O13A 2JQOA 2JSOA 1TS4A 3ULPA 5CV9A 1VQ8A 2WAQE 2C9OA 4L63B 2IX1A 1ML0D 1ZYRC 4L5SA 2WV6D 1I94L 5J22A 1TWFB 4YIJA 1HZBA 1LYLA 1CKNA 1X54A 4YCWA 4EQOA 1CHPD 1XNQL 3IKJA 1SROA 3CHBD 4A3KG 1IL2A 4AQYL 4JI4Q 4JI1Q 2JN4A 1PRTD 4EQNA 2KENA 3AQQA 4LNQA 1EY5A 2VQEL 4FDBA 1RL2A 4E6IA 1EOTA 1X3PA 5LL6S 4DR5Q 4GNXA 4B9WA 1EY0A 5TSSA 4FYDA 3PQIA 3MXGA 1R4PB 4X64L 2X69A 4B3RQ 1KAAA 5C6AA 4R9WA 1AP0A 2QEJC 2KEDA 5IWAQ 3BZKA 4DR4L 1DD2A 3A74A 2B2TA 2QA4A 1J8IA 2EDGA 3M85A 3ONAB 1PHJA 4A93G 2JA7B 4ABNA 1HR0W 2MFIA 1S5ED 2CH4W 3RLOA 3W1GA 1I3QB 2NUCA 2QDBA 2QILA 3L0OA 1I50H 1VQNA 1RDPD 1ET6A 1XMOL 4YY3Q 1SXTA 4DR2L 4DAYA 3Q6SA 5EBDA 1QG7A 3MAQA 3K5NA 2HD3A 1J5EQ 3FKIB 4QIWB 4R4IA 5LMUQ 3TP7A 5I4DA 3FPPA 4QCLA 2X6LA 1HZ9A 4C3IB 1WTOA 4OONA 1STYA 1HNZL 4L8JA 1WFQA 2RDHA 3L9AX 3TN2A 3WWVA 3VA5A 3KFUA 1O7LA 1N9WA 2F0JA 3FP9A 2JA8B 3V2TA 1S5DD 3WDNA 1KHIA 2BA0A 2K14A 3X3MA 1YIJA 1GHKA 3EQLC 1IBML 2PI2E 3TP8A 2XNAC 4OX9L 2OQ0A 1MI2A 1STAA 4LF7L 3DMUA 2LXKA 4HJ8A 4P75A 1D5MC 1EQRA 4A3MG 1AFPA 4DAMA 1EYAA 5CR3A 2B2VC 2L11A 4K2LA 4DUYL 4ZCKA 4DV2L 4GOPC 3TS2A 4X6AH 2A6EC 2E76C 4MHEA 4LF6Q 3GTGB 1BXTA 2VS1A 1WI5A 1IKLA 4JI8L 3CC7A 5M5YB 4DR3L 3RZDB 1Q46A 2B2YA 2F3IA 2VL6A 3QG1A 4KJNA 3FPUB 4DR1Q 3F1ZA 3H09A 4LMQD 1B7YB 2RSOA 5CGKA 3HOXH 3CCRA 1W2BA 5CBEE 1PTOF 4A3EG 1KDBA 1O80A 1OXVA 1K0RA 4DGZA 4OO1I 1W3SA 3GTLB 4X3TA 2E2DC 1JWMD 2RSNA 2K01A 5IIFA 1Q81C 2BE5D 2GA4B 5IT9c 4IOAA 1E0BA 1UAPA 2ZJQA 3T1HQ 3SK4A 3MVVA 1E22A 1U0LA 3S2DB 4IUQA 4DAPA 2MQHA 3D6CA 4C3HB 4C1NK 1G2SA 1P8LA 3D4WA 4DV4Q 5EKLA 3H91A 1V1QA 3E3XA 3J81L 3CP0A 1B3AA 4ZKBB 4XQNA 4POGA 5KNCA 2ZXRA 3GTJB 1F9PA 1SE4A 3KLWA 2F0VA 4A3JH 3QO2A 5DEHA 5CC4A 1JE5A 2EY1A 1YNJD 2F4VL 4ID6A 1HH2P 3CC2A 4IUUA 1AW7A 4V190 1O7IA 1E24A 2EY6A 2LFNA 2KCNA 3TQYA 4J1MA 2LY7A 4DV0L 3PF4A 1MGSA 2KVMA 1VQBA 4K0KL 1A3VA 1SYCA 3CU7A 2BDNA 4KY7A 3SK6A 2YV5A 2R92B 5DAUA 1EWCA 1SMXA 4K2KA 2UXDL 2UU9Q 2B63G 3HOVH 4IJLA 4IUPA 2H1EA 2EJFC 1SYBA 3A0JA 5FO9B 1XX8A 5EPKA 5ELEA 1RF2D 2LS01 4PG3A 5C3EG 2WAQG 2I5MX 5C5LA 2Q2IA 3I70A 4HR7B 5ELCA 4BBRH 4DPGA 4A76A 1SYGA 5DNFA 1TIID 5M5WB 3A8IE 3CD6A 1W6JA 1HR0Q 2BCOA 4WJWA 2FINB 3ERQA 3LGJA 4J8QA 4RMFA 1T5EA 3S14H 4BA2I 3M7GA 4AYBG 1F2LA 1RIPA 2RA4A 1DOKA 3PO3G 2XRQD 1CQVA 1FL0A 4H0LC 4X66L 2EIFA 1NSNS 1HNXQ 4K5XA 3LNNA 5DM73 1IBKL 4MTKA 2UXCQ 4KMUC 3W1BA 3QJYA 4KLKA 5IYCG 2R7ZH 1F9SA 4XXEA 4DV6Q 2CFMA 4DK3C 4YCVA 1HNWL 5M3MG 1Q8IA 4F87A 3U4VA 3PIPA 4DUZQ 2A6HD 4P2CB 1SE2A 2NBFA 2N88A 1PVOA 1JMCA 3OWFA 2AQ3B 5FJ8H 1VQAA 2UUAL 3LX0A 3SR1A 1WTXA 1LM0A 1YHQA 3MFYA 1CTMA 5EAYA 3FVQA 1ILQA 4GOPB 4OGQC 1OO9B 2N8NA 4WFN3 4JI2L 1S5BD 1PH3A 1D1IA 4B3TL 1KRSA 4KV6A 2A19A 4LF4L 2EYFA 4KHVA 3JAML 3S1RH 4N8FA 1SJED 3MTSA 3K57A 1PYBA 3S1NB 1EIFA 1PH2A 1B70B 1N36L 1SYDA 1VCIA 4CKBA 4PZ6A 4A3JG 1BUVT 3HOWH 4HMIA 2R61A 2XIWA 1MJCA 3N52A 3Q23A 1XWEA 1S4ZA 3BG3A 3R2IA 4LJZC 1DM0B 3L3OC 1X9NA 1L2FA 1M4VA 4JC0A 1QB5D 4B3SL 3OOCA 1ESRA 5ELNA 1RHPA 5M3MB 4HSVA 4XYOA 5EKKA 1JB3A 1YNXA 2L15A 5IP7H 1ENCA 4IFDI 1SE8A 2OTLA 1PMRA 4JI6L 4CDDC 3J7AF 1GUWA 1EQQA 5G3LD 1EZ8A 1WCMH 3J7A5 4R4OA 1PTOB 3VR4A 1L0XB 1Y14B 1SFOB 1SSOA 1YVCA 1ASYA 2IX0A 1V9PA 1F2YA 1FVIA 4JI1L 3AFQA 4MTNA 1X32A 1NCVA 2AUKA 3MXUA 3I4NH 2JP1A 4JK1C 1HUMA 1GUTA 1HFGA 2Z4HA 3HOUB 4A3FH 4BBRG 5GADC 1PH6A 1HZAA 4LUOA 2CW0C 2ID0A 2DY7A 2TMPA 3HKZE 4BY7G 4B3RL 1HUNA 3DWPA 1CA5A 4ME3A 2MGSA 3IFTA 1X56A 4RHSA 2YU9H 5COYA 1Y1WH 1U4MA 5FLXE 1M1KC 1F2ZA 1PLFA 4UP8A 2RDGA 1PFSA 3CKIB 5E7NA 5DLQE 1X3QA 3D4RA 2NVQH 3M4OB 5HGTA 3TMEA 1II3A 4OIKA 1VMPA 5KNBA 2V1CC 4YY3L 3NWTA 2ZJPA 1Q3LA 3SDZA 3DEOA 4PMBA 1HQMC 1TWAB 2K32A 4ZYSA 1YNNC 2EVBA 2HUGA 2D62A 4LW1A 3K81C 4HAEA 1J5EL 5FO8B 3UI2A 4UHVA 4PMCA 1IXRA 1VQCA 4KY5A 5IT9L 1JQYD 2MUYA 3RN2A 3E6ZX 2Q2UA 4RKLA 1EOVA 4HJAA 1CA6A 1I4XA 1CQFA 3KOJA 1U5KA 4PQXA 2F0TA 4K8IA 1A3UA 2RVLA 2FJ2A 2DY8A 3K5LA 4BA1I 4QMGA 2EXZA 2NVYB 4DK6C 4BBSB 4KTAA 2O2LD 2A8VA 1IL8A 4BY7B 1U4PA 4L5RC 5BN3A 3EJIA 1L1OB 2F0WA 1S40A 4JV5Q 2JA6B 4IUTA 4GLAC 4B3MQ 1SRUA 1QJOA 3HOWG 5D14A 1HQRD 3MEHA 3M4YA 5C0XJ 5ELBA 2OWOA 1JICA 2ENBA 1I4PA 2RCFA 4CKEA 3UDIA 3H0GH 2K28A 4LF6L 2ZM6L 2WKDA 2K5NA 3SE0A 1B9NA 2N55A 4CDFC 4DV3L 4L6TB 1JE4A 3I55A 2MO1A 4CJ2C 3E5SA 5IP7G 1LTLA 2A73B 4DR1L 4O42A 4ODGA 2G9DA 1MSGA 1SAPA 5M5XB 1Y1VB 1EL0A 2JA5H 1B9MA 3CXCA 2JA7H 1NR2A 1V1PA 4ZUIA 3ER0A 1UWVA 3MXPA 4A3DB 2EYLA 3GDEA 1C7YA 5C44H 2L0CA 1A62A 2A74C 3D3RA 2ZT9C 1B50A 2E75C 2HDLA 2EYHA 4FNFA 1V1OA 2A5HA 2XGTA 3T1HL 1H9RA 5LL6X 1XXGA 4IZ8A 2EXDA 3FKIH 3S2HB 4OXPA 1AE2A 2E2IB 3G7LA 2XSCA 1X6OA 2O5JC 2F0EA 4DV4L 2KOLA 3HOZG 1A2TA 2F0SA 3T51B 3A8JE 3CCSA 1NY4A 1JORA 2KQ3A 1EWIA 3GTOH 4RFBA 2FMMA 4RCNA 1ET9A 3J7ZC 2RKSA 1OXXK 4HSPA 1CI3M 4OEMB 1CSQA 1OXUA 1TWGB 2WB1E 1EY9A 4DNRB 1G6ZA 3OSOA 3CF5A 2F0FA 1JWSD 2PYKA 3S16H 1GKHA 3I8ZA 2NZOA 4RGMA 5GAGC 3EA6A 5LHY1 3VYUA 4H13C 3GTGH 3F2DA 5HY6A 5IGDA 3RLNA 3U4ZA 1R9TB 2UU9L 3NE5B 4DR6Q 3SEBA 5FLMH 1UEAB 4A3CG 2NN6H 3DLLA 4IPGA 1PZID 1LO5D 1WD0A 4A75A 1BNZA 4YWKA 2Z6KA 1PH7A 4A3IH 2AKWB 3I4MB 3RZOB 1CZWA 2D5DA 4L5QA 3NQTA 5C4XG 2F4IA 2R6GA 5E1FA 3V05A 1N32Q 1FJGQ 1BR9A 1VQIA 3FMCA 3J7AV 2BE5C 1U9RA 5D65A 3T1YQ 3H3VH 3NELA 3QOJA 2AUJD 4CDCC 2E2HB 3PMFA 3S2DH 3D6WA 4KHPQ 2Y0SE 1FGUA 3GD7A 3K5OA 3FDTA 5C4JH 2K5QA 2NTTA 4DU9A 4C3HH 2UXCL 1ICFB 2JYOA 4C3JB 3ULLA 3HKZG 1SBBB 4KKSA 4J15A 3I3CA 4JPBW 2CVRA 2YYZA 3QWNA 4M8AA 4EQPA 2HIXA 4DV6L 1KTKA 3F2BA 4FF4A 3CCVA 4JI0Q 3J81E 4DUZL 2EYJA 1BCPD 1X3GA 1PH1A 1EWHA 5CYUA 2K6AA 1BDOA 5C44G 2AMCB 3HOYG 1PXUA 4GN3B 3I72A 4UPAA 2RDFA 3PO2B 2PZUA 3J80E 4ULLA 1JOKA 1FYCA 1XNRL 1Z6HA 2XTIA 1SMYD 1YNJC 2GN5A 2VUMG 4OWTB 2L12A 1F9RA 4KKTA 3CQZB 4YCUA 1KRTA 3T53B 4JI5L 4EVOA 1Q86C 2EYPA 1ONLA 2NYZD 4CKCA 3T16A 4KD4A 1AZQA 4RG1A 5M3FG 4DKAC 1PH9A 1N33Q 4FP5D 3NBIA 2B3GA 5D3DA 1K83B 1NR4A 4LFAQ 5CV7A 2E2JH 1OXTA 2A69D 5GQOA 1I6HH 3IRBA 4DA2A 2KBNA 1BVSA 3UDGA 3TEHB 2B39A 1LT3D 3S9WA 4R4QA 4NXMQ 1CKOA 2PCFB 1CFMA 1G6PA 1C9OA 1UE6A 4A3GH 3KBGA 5AFWA 1FNWA 4LUZA 3A56A 4GLVB 3CRLC 3C3LA 1RKNA 4JYAL 1K0SA 4KD3A 2N78A 4A3KB 2PMZE 3HOYB 4FF2A 1SEBD 3CCUA 1NNXA 1BQQT 5IGBA 3ZYYX 1EY7A 2HIVA 5FLMG 5H1SE 2K50A 4JG2A 1PFBA 3NBHB 4A4IA 2NN6G 2EY2A 2VUMB 1BF4A 1T5XD 3KLSX 3NWSA 4O0AA 5J39A 2R93G 4B08A 4X65Q 1CM9A 3MHBA 4A3IG 3T13A 4LAAA 1KLGD 1LT5D 3I90A 1C48A 1SLJA 4FXDA 1UEBA 2A6HC 5CV6A 1BO0A 3OW2A 3CRKC 4NDXA 3MA2B 1Q1BA 4X62Q 4QUCA 2NVXH 4A93B 4IPDA 4YWMA 1NE3A 1SDFA 2J0TD 2VB3X 2ICIA 1D7QA 1JCKB 2G9HD 3JAME 3EVQA 1IW7D 4F88A 3BDCA 3OW7A 2F0NA 2N49A 1G291 1ICWA 1LTBD 4CDEC 4EX5A 1E1OA 1J6QA 3S24A 3S1MB 3OTOL 1S5FD 4NXNQ 4Q5VA 5EPLA 4JI3Q 3GV3A 1FD7D 2BH2A 3E0JA 2F0HA 3PUXA 5IYDH 2UUCQ 3MXNB 1LACA 3HS0C 2VQFQ 4OWWB 1FNUA 1SYEA 1A15A 4K14A 4Y7NB 1MSHA 4OO1H 3J81i 1JT8A 4HJ9A 2D2CC 4R4TA 2WB1G 2CH4A 2F0UA 3RNUA 3HZXA 2VB2X 1I4GA 2RF4A 2I5LX 2CWAA 4RH6A 2QEXA 3BJUA 3STBD 1PTOH 2K52A 1G91A 4KK7A 4WORA 2K4KA 1UNSA 4XIGS 3BZCA 1SFOH 3BS1A 3TSSA 3TRZA 3W2DA 4N9PA 4A3MB 2DJGC 4QF4A 1NMGA 4JV5L 1EZ6A 3GTMH 3U9SA 1X3EA 4B3ML 4DFAA 3I4OA 3J80L 4JI7Q 3N6RA 1EIHA 3S17B 5EKIA 1F2MA 5K36H 1HTPA 4ZRZA 2YTXA 3CCLA 1ZYRD 1V43A 3PUYA 2K7VA 1IKMA 2OQKA 3S15B 3C1FA 1IBLQ 2YTYA 5JPNC 1PH8A 2UXBL 1XPUA 4LWCA 1H9MA 4A3EB 1F77A 4C2MH 3OMCA 2TSSA 3EIVA 1DYQA 2CCZA 2VW9A 3KLSA 3M4OH 3BZDB 4N9TA 2UUBQ 2Y0SG 1XTDA 3K6OA 5IE8A 1NTGA 4HIOA 5JJZA 4V0BA 3C2PA 1L0YB 4IPCA 4WJ4A 3UE0A 2F0MA 1RODA 1PV4A 3A55A 2ZTCA 3CMAA 1HZCA 4LFCQ 2K05A 4IN3A 3WOEA 4JBWA 1IYVA 1VQPA 4IOCA 1PA6A 3DXJC 5IT9E 1R4QB 5D3IB 3KF8B 3R2TA 3NPPA 1PFMA 5I6WA 4JVZA 3TS0A 1I50B 3RN5A 1HRJA 1EQVA 2M9VA 2L9HA 4RKBA 1VF5C 4BBSH 3HOXG 2PNHA 2V4DA 5CMDA 5C5MA 3IAYA 5JJLA 3JAMi 3K7UC 1A2UA 3L7ZC 3Q24A 5GAEC 1PFNA 1Z9FA 4I65A 4DAVA 1NAPA 2B63B 1I4HA 5FO7B 1H9SB 4NP5A 2IT1A 5I2YA 5C0XH 1X3FA
chains in the Genus database with same CATH topology
5C3EB 2WAQB 1E2WA 4X3KA 1HXYD 1MD2D 4AYBB 1K8OA 2NZ1D 1TKWB 1EU4A 4KKUA 4NW2A 3OIPA 3PIO3 3BVMA 3PO3B 2H4OA 1F9QA 4FF3A 5K36G 2B2WC 1Y8OB 1DXMA 4WRDA 3TZDA 3HOXB 1EY8A 1ENFA 3TP5A 1EEFD 2C5CA 4OIJA 1LABA 1H9KA 2B2UC 2WIIB 3DWAA 1LTID 4IFDH 3A54A 3VYSA 3OPOA 4XYQA 2B2VA 4C56C 5JVG3 5E4WC 3DM1A 3VYTA 4MIUA 1PTOD 1FNVA 2DNEA 4Q0FA 1I4QA 2KCCA 1EY6A 4XQQA 2K33A 2PNRC 2MJ8A 2HCCA 4A3JB 3RD4A 5CV4A 1ILPA 5FOBB 3DUZA 3ND8A 1STBA 3LWEA 3NUCA 5JEAH 2OEOA 3NHHA 1QOHA 3BYYB 4RAUC 1TT2A 1PRTF 1HPCA 4O1NA 1KDCA 3HOVB 1STEA 1QWYA 3H94A 5A35A 5C0XG 4IQZA 2JEAI 2B2TC 4TRDA 2CHBD 4DK1A 4BBRB 4KN4C 1NUCA 3AB9A 3MWYW 3K59A 3S14B 3G6JB 4RWSC 2M2LA 1EQTA 3S1QB 1EY4A 1PRTC 5IGGA 4DK0A 1Y8NB 1GOZA 4U673 1TS2A 1RTNA 4R8IA 5C4ZA 1QNKA 4HTHA 2KA7A 5I2XA 1HTLD 1H9JA 1TWCB 5KGUA 1UUPA 2FHTA 2A69C 2A68D 3P7JA 1HCZA 2NTSA 4KI0A 3GTPB 3M7NA 1FGBD 2K04A 1RD9D 1HHVA 3HRZC 2L5TA 4KN7C 1EYCA 4NKLA 3FEWX 2IW3A 1SE3A 2O5IC 2XVSA 4K6LA 2B2YC 2OF1A 4TKOB 4Z9CB 2IPKD 4IFDJ 2DN8A 3HOWB 3EFXD 1C8CA 2LMCB 1STGA 3C46A 5JAVA 1GJXA 5E3FA 4RGOS 1U4LA 1SYFA 5T1GA 4FO2A 4OL7A 1LTTD 2AWOA 2HCIA 1JR0D 4DXFA 4CBVA 4QB4A 5KRUA 1B4OA 1G8ZD 4G57A 5CBAE 3I4NB 2F0KA 3D8GA 5JEAJ 3EROA 1C4QA 3IL8A 1B1ZA 2WACA 4KHZA 2NN6I 2YU9B 1PYWD 2SOBA 1Y1WB 3HOZB 3P20A 2K03A 4BWGB 5KEEA 4K5VA 1KNEA 4CGYB 3VA7A 3A7LA 2NVQB 2SNMA 4HCEA 4QUFA 2Z8LA 2KHSA 4ILWA 2SDFA 3Q0AA 2IX3A 2KJXA 3DHQA 3P75A 5FK9C 1QILA 3H3VC 3NXWA 1I4RA 4IURA 3NTIA 1FR3A 5CV8A 1PRTB 3Q22A 3T4AC 4XQJA 3MFGA 3SHLA 3C1EA 4G4KA 1JOOA 1GUNA 2QCPX 5CV5A 2MPMA 2PW7A 4C3IG 1WTQA 5KIXA 2EYOA 5C4XB 4DN4M 1V8QA 2XN9C 4IALA 2F0GA 3VR5A 3SK8A 3H0GB 5EPJA 1O7ZA 2KUMA 3DEPA 4F7XA 3HKZB 2XRSD 1IYUA 1TY0A 2JA5B 2EZVA 3K0YA 5C44B 4FXGC 2IJ0A 2Z4IA 2J7ZA 3SVMA 2K5WA 4FXKC 2BDOA 3QB3A 2PO4A 5CORA 4B9XA 4G7HC 3U9OA 5EGTA 4UDUC 1LT6D 5I6YA 2PQEA 3NQIA 1WTVA 1J9OA 3KK7A 3VR3A 3KBXA 4HN7A 4K8JA 1TS3A 4F8MA 5M3FB 2L55A 4TSSA 1XTCD 3GTOB 1GUSA 2K1BA 1TWHB 3BDLA 2J4XA 2ICEC 1D1KA 3T56B 5K5PA 1PZJD 5KYIA 3URYA 5A2QL 1KNAA 4C3HG 2F3VA 1LTGD 4FF1A 1B44D 3OMGA 3GTQB 5JOBA 3S16B 5G3LF 3KLRA 5BN4A 3R93A 1WTPA 4X3SA 2R3ZA 1KDAA 2Q8IB 2MP1A 3RUZA 1DJRD 3RMHA 5E4XA 1ENAA 2D9UA 1E2ZA 3K5MA 3NK9A 1D6EC 4HEDA 5IODA 2R93B 3NBHA 4A3IB 1QCBD 3VR2A 1IHZA 5JVH3 1EYDA 2WKCA 5BN5A 2X6GA 5KNDA 3GTKB 1EEID 4PMWA 4FVMA 2WP8J 5KYLA 5ISRA 1MBYA 1O7YA 3HEJA 4DNTB 4PNYA 2NVTB 1QE6A 1Q1EA 1TQOA 1E2VA 5C4JB 1VDZA 2I07B 3PUZA 2PZTA 4S3SA 1ZKOA 1PTOC 5EJWA 3AU7A 1DZ1A 3A7AB 1TU2B 4ZUJA 1Y69U 1AEXA 2F0QA 1GUOA 3TP6A 2WB1B 3MXNA 4MN3A 4U68A 1LTAD 4CJ1B 1EFID 4HCSA 2JE6I 2OT2A 1XYIA 1QNUA 4ZAIA 3BYTB 4RA8A 1U4RA 3I4LA 1CZGA 1WD1A 3D4DA 2E2JB 2L1BA 4DF7A 3TDQA 1I6HB 4G7ZC 2B8GA 2F0PA 2JXMB 1LT4D 3TBIB 3RLFA 2Z1CA 2CQAA 5JPMC 2PPBC 4A3GB 3MZ5A 4ZQ3A 1TVXA 2IWHA 1SNOA 4R8NA 3IFDA 1D5ZC 2RBMA 4J6HA 2XWJB 3VR6A 1WTRA 3ND9A 4OO1G 4OHJA 1TY2A 2Y0SB 3PV0A 4I7ZC 3SXHA 4X3UA 4H44C 1TS5A 3HP3A 1CT1D 5C0XI 3MC0B 4KY6A 4BS9A 3H6MA 4ME5A 1JOQA 1GHJA 5EBCA 5F2DA 2A6ED 2NVXB 1KABA 2A68C 2QF7A 3I73A 1RTOA 1I6VC 3TZUA 1WVLA 2RQXA 3KF8A 2HDMA 1LLRD 2LKVA 2VXWA 2BA1A 5EQ0A 1LV9A 3HGBA 3V96A 1KLUD 2SNSA 1ZEQX 2K5DA 2KECA 4XDXA 2EE1A 1SNMA 2EJMA 3AMUA 3QIAA 4K6DA 4ZKCB 2XWBB 1DCZA 1H9SA 1D5XC 2AQ1B 1HA5A 1B53A 2I46A 4IUNA 2PMZB 2HQEA 1CHQD 3GTMB 1ESFA 3OWEB 2MHVA 3NSWA 1LTSD 5HURA 4RGNA 3R3OA 4M1UB 4GZYC 1S5CD 5J1ZA 1TR5A 1BCPF 1OXSC 4C2MB 3BVGA 2JEBI 2ZXOA 2F03A 3X3NA 1SJHD 5C4HA 3PUWA 1SNDA 2EYMA 5IOCA 3FRPB 5ELDA 2ZXPA 1V1PB 1SNPA 1JWUD 4CHTB 1B2TA 3K58A 5DM63 1JC7A 2EOTA 1BCPC 5M9OA 4RCOA 1SNQA 2AWNA 1HA6A 2NWGA 1STNA 1Z47A 1ZXTA 2F0LA 5I9PA 2F3WA 3GV6A 1SMYC 1Q90A 2Q8RE 2EY5A 2R7ZB 1VMCA 5I9OA 2F1MA 3LWUA 1CK1A 2F0IA 1EIGA 4RHRA 4RGTA 4XTCS 3R8BA 2B8FA 4PV1C 4CJ0B 4UAIA 1Q12A 4IFDG 1BOSA 2BOSA 2FMCA 2M00A 3KUPA 1Z7TA 3S1RB 3W3AA 3A8KE 2FFKB 2NB0A 2E74C 4A3BB 4XT1B 3K7AB 5T1IA 2L4NA 5IGFA 1DOMA 3GO5A 1AZPA 3PUVA 1HFNA 2PZWA 2F0OA 5IGCA 2F0DA 2KEEA 3WOFA 3GQBA 2PW5A 1BBXC 3OIQA 3DWQA 1O78A 2EJGC 4ZLTF 3NP8A 5JEAG 3D31A 2AQ2B 3J7YW 2DNCA 2Q8TA 1EU3A 1WCMB 3VYRA 4XT3B 1VF7A 2EPBA 3BVZA 4H7BA 3GP7A 2IL8A 4ZK9B 3F2UA 4LK1C 4C3JG 5A2QE 2O4XA 4A3FB 1WTWA 4C1NI 2CW0D 1IW7C 1GXDC 1M8AA 1DONA 4TQUS 1PZKD 1DOLA 2B2WA 3SK5A 3NTKA 5C3XA 1G2TA 1Y8PB 5FLXL 3M3YB 3BDOA 3QOLA 1A3TA 4IUVA 3HG9A 4G7OC 2WINB 4EGVA 5ELFA 5NUCA 1D2BA 3I91A 3PIP3 5FKAC 1PDQA 1W6KA 5IGEA 1STHA 2SEBD 1GUGA 2VNUD 2B2UA 1YNND 3OHXC 4KJOA 4DXGA 3P1HA 3ITPA 1SNCA 4BY1B 1LTRD 5C3WA 1RJTA 1RCVD 2QKIC 4NMZA 1BCPB 1A6XA 3NTHA 1AN8A 4HMJA 1K8MA 4K5WA 2OXPA 3O13A 2JSOA 1TS4A 5CV9A 2C9OA 4L63B 2IX1A 1ML0D 1ZYRC 2WV6D 5J22A 1TWFB 4YIJA 4EQOA 1CHPD 3IKJA 3CHBD 1PRTD 4EQNA 1EY5A 4E6IA 1EOTA 1X3PA 5LL6S 4B9WA 1EY0A 5TSSA 4FYDA 3MXGA 1R4PB 2X69A 1KAAA 5C6AA 4R9WA 1AP0A 2QEJC 2KEDA 1DD2A 2B2TA 1J8IA 2EDGA 3M85A 3ONAB 2JA7B 4ABNA 1S5ED 1I3QB 2NUCA 2QDBA 2QILA 1RDPD 1ET6A 1SXTA 4DAYA 3Q6SA 5EBDA 1QG7A 3MAQA 3K5NA 3FKIB 4QIWB 3TP7A 5I4DA 3FPPA 4QCLA 2X6LA 4C3IB 1WTOA 1STYA 4L8JA 2RDHA 3L9AX 3TN2A 3VA5A 1O7LA 2F0JA 2JA8B 3V2TA 1S5DD 3WDNA 2BA0A 3X3MA 1GHKA 3EQLC 3TP8A 2XNAC 1MI2A 1STAA 3DMUA 1D5MC 1AFPA 1EYAA 5CR3A 2B2VC 2L11A 4K2LA 2A6EC 2E76C 4MHEA 3GTGB 1BXTA 1IKLA 5M5YB 3RZDB 2B2YA 3QG1A 4KJNA 3FPUB 3H09A 4LMQD 2RSOA 5CGKA 5CBEE 1PTOF 1KDBA 1O80A 1OXVA 4DGZA 4OO1I 3GTLB 4X3TA 2E2DC 1JWMD 2RSNA 2K01A 5IIFA 2BE5D 2GA4B 1E0BA 1UAPA 3SK4A 3MVVA 3S2DB 4IUQA 4DAPA 3D6CA 4C3HB 4C1NK 1G2SA 3D4WA 5EKLA 3H91A 3J81L 1B3AA 4ZKBB 4XQNA 5KNCA 2ZXRA 3GTJB 1F9PA 1SE4A 2F0VA 3QO2A 5DEHA 5CC4A 2EY1A 1YNJD 4ID6A 4IUUA 1AW7A 4V190 2EY6A 2LFNA 2KCNA 4J1MA 2LY7A 1MGSA 2KVMA 1SYCA 1A3VA 3CU7A 2BDNA 4KY7A 3SK6A 2R92B 5DAUA 1EWCA 4K2KA 4IUPA 2H1EA 2EJFC 1SYBA 5FO9B 1XX8A 5EPKA 5ELEA 1RF2D 2LS01 5C5LA 4HR7B 3I70A 5ELCA 1SYGA 5DNFA 1TIID 5M5WB 3A8IE 1W6JA 2BCOA 4WJWA 2FINB 3ERQA 4J8QA 4BA2I 1T5EA 3M7GA 1F2LA 2RA4A 1DOKA 2XRQD 1CQVA 4H0LC 1NSNS 4K5XA 3LNNA 5DM73 4KMUC 3QJYA 1F9SA 4XXEA 1Q8IA 4F87A 2A6HD 4P2CB 1SE2A 2NBFA 2N88A 3OWFA 2AQ3B 3LX0A 3SR1A 1WTXA 3MFYA 1CTMA 3FVQA 1ILQA 4OGQC 1OO9B 4WFN3 1S5BD 1D1IA 4KV6A 2EYFA 4KHVA 3JAML 1SJED 3MTSA 3K57A 3S1NB 1SYDA 1VCIA 4CKBA 1BUVT 4HMIA 2R61A 2XIWA 3N52A 3Q23A 1XWEA 1S4ZA 3BG3A 3R2IA 4LJZC 1DM0B 3L3OC 1M4VA 1QB5D 3OOCA 1ESRA 1RHPA 5M3MB 4HSVA 4XYOA 5EKKA 1JB3A 1ENCA 4IFDI 1PMRA 3J7AF 1GUWA 5G3LD 1EZ8A 1PTOB 3VR4A 1L0XB 1SFOB 1SSOA 2IX0A 1F2YA 1X32A 1NCVA 2AUKA 3MXUA 2JP1A 4JK1C 1HUMA 1GUTA 1HFGA 2Z4HA 3HOUB 2CW0C 2ID0A 2DY7A 2TMPA 1HUNA 3DWPA 1CA5A 2MGSA 3IFTA 4RHSA 5COYA 1U4MA 5FLXE 1F2ZA 1PLFA 2RDGA 3CKIB 1X3QA 3D4RA 3M4OB 5HGTA 3TMEA 1II3A 4OIKA 1VMPA 5KNBA 3NWTA 1Q3LA 3SDZA 3DEOA 4PMBA 1HQMC 1TWAB 2K32A 4ZYSA 1YNNC 2EVBA 2HUGA 2D62A 4HAEA 5FO8B 3UI2A 4PMCA 4KY5A 5IT9L 1JQYD 2MUYA 3E6ZX 4RKLA 1CA6A 1I4XA 1CQFA 4PQXA 2F0TA 4K8IA 1A3UA 2RVLA 2FJ2A 2DY8A 3K5LA 4BA1I 4QMGA 2EXZA 2NVYB 4BBSB 4KTAA 2O2LD 1IL8A 4BY7B 1U4PA 5BN3A 3EJIA 2F0WA 2JA6B 4IUTA 1QJOA 5D14A 1HQRD 3MEHA 3M4YA 5C0XJ 5ELBA 1JICA 2ENBA 1I4PA 4CKEA 2K28A 2WKDA 3SE0A 1B9NA 2N55A 4L6TB 1JE4A 4CJ2C 3E5SA 2A73B 4O42A 4ODGA 2G9DA 1MSGA 1SAPA 5M5XB 1Y1VB 1EL0A 1B9MA 1NR2A 1V1PA 4ZUIA 3MXPA 4A3DB 2EYLA 2L0CA 2A74C 3D3RA 2ZT9C 1B50A 2E75C 2HDLA 2EYHA 4FNFA 1V1OA 2A5HA 1H9RA 5LL6X 1XXGA 4IZ8A 3S2HB 2E2IB 3G7LA 2XSCA 2O5JC 2F0EA 2KOLA 1A2TA 2F0SA 3T51B 3A8JE 1JORA 2KQ3A 4RFBA 2FMMA 4RCNA 1ET9A 2RKSA 1OXXK 4HSPA 1CI3M 1TWGB 1OXUA 1EY9A 4DNRB 1G6ZA 3OSOA 2F0FA 1JWSD 2PYKA 3I8ZA 4RGMA 3EA6A 5LHY1 3VYUA 4H13C 5IGDA 1R9TB 3NE5B 3SEBA 1UEAB 2NN6H 1PZID 1LO5D 1WD0A 1BNZA 3RZOB 3I4MB 1CZWA 2D5DA 3NQTA 2F4IA 2R6GA 5E1FA 3V05A 1BR9A 3FMCA 3J7AV 2BE5C 1U9RA 5D65A 3QOJA 2AUJD 2E2HB 3PMFA 3D6WA 3K5OA 3GD7A 3FDTA 2K5QA 2NTTA 4DU9A 2JYOA 4C3JB 1SBBB 4KKSA 3I3CA 4M8AA 2CVRA 2YYZA 3QWNA 4EQPA 1KTKA 4FF4A 3J81E 2EYJA 1BCPD 1EWHA 5CYUA 2K6AA 1BDOA 1PXUA 3I72A 2RDFA 3PO2B 2PZUA 3J80E 4ULLA 1JOKA 1FYCA 1Z6HA 1SMYD 1YNJC 2L12A 1F9RA 4KKTA 3CQZB 3T53B 4EVOA 2EYPA 1ONLA 2NYZD 4CKCA 3T16A 4KD4A 1AZQA 4FP5D 3NBIA 5D3DA 1K83B 1NR4A 5CV7A 1OXTA 2A69D 4DA2A 2B39A 1LT3D 3S9WA 2PCFB 1CFMA 3KBGA 5AFWA 1FNWA 3A56A 3CRLC 3C3LA 1RKNA 4KD3A 4A3KB 3HOYB 4FF2A 1SEBD 5IGBA 1BQQT 3ZYYX 1EY7A 1PFBA 2NN6G 2EY2A 2VUMB 1BF4A 1T5XD 3KLSX 3NWSA 5J39A 4B08A 1CM9A 3MHBA 3T13A 4LAAA 1KLGD 1LT5D 3I90A 1C48A 4FXDA 2A6HC 5CV6A 1BO0A 3CRKC 4NDXA 3MA2B 1Q1BA 4QUCA 4A93B 1SDFA 2J0TD 2VB3X 2ICIA 1JCKB 2G9HD 3JAME 3EVQA 1IW7D 4F88A 3BDCA 3OW7A 2F0NA 1G291 1ICWA 1LTBD 3S1MB 1S5FD 4Q5VA 5EPLA 3GV3A 1FD7D 3E0JA 2F0HA 3PUXA 1LACA 3HS0C 1FNUA 1SYEA 1A15A 4K14A 4Y7NB 1MSHA 4OO1H 2D2CC 2F0UA 3HZXA 2VB2X 1I4GA 4RH6A 1PTOH 1G91A 4KK7A 4WORA 1UNSA 4XIGS 3BS1A 3TSSA 3W2DA 4N9PA 4A3MB 4QF4A 1EZ6A 3U9SA 4DFAA 3J80L 1EIHA 3N6RA 3S17B 5EKIA 1F2MA 5K36H 1HTPA 4ZRZA 1ZYRD 1V43A 3PUYA 2K7VA 1IKMA 3S15B 3C1FA 5JPNC 1H9MA 4A3EB 1F77A 3OMCA 2TSSA 1DYQA 3KLSA 3BZDB 4N9TA 3K6OA 5JJZA 4V0BA 3C2PA 1L0YB 2F0MA 1RODA 3A55A 2K05A 4IN3A 3WOEA 4JBWA 1IYVA 3DXJC 5IT9E 1R4QB 5D3IB 3R2TA 3NPPA 1PFMA 5I6WA 1I50B 1HRJA 1EQVA 2M9VA 2L9HA 4RKBA 1VF5C 2V4DA 5CMDA 5C5MA 3IAYA 1A2UA 3L7ZC 3Q24A 1PFNA 4I65A 4DAVA 1NAPA 2B63B 1I4HA 5FO7B 1H9SB 4NP5A 2IT1A 5I2YA 5C0XH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IL8 A;  1U4P A;  1WTQ A;  1RJT A;  4RAU C;  1TVX A;  5AFW A;  1U4L A;  4IUT A;  4X3K A;  5E4X A;  2D9U A;  1ESR A;  1MI2 A;  1RHP A;  5D14 A;  1EIH A;  3IFD A;  2FFK B;  5T1G A;  4IUP A;  4HSV A;  4HED A;  5EKI A;  4DN4 M;  2H1E A;  2B2T C;  4XT1 B;  1JIC A;  5T1I A;  1XX8 A;  1WTR A;  1WD0 A;  5EPK A;  1BNZ A;  2L4N A;  1IKM A;  2HCI A;  5EPJ A;  1DOM A;  1O7Z A;  2NZ1 D;  2K28 A;  2B2V C;  2KUM A;  1GUW A;  2L11 A;  4NW2 A;  1ML0 D;  1PFB A;  1AZP A;  1B4O A;  2X6G A;  3DEP A;  4MHE A;  2N55 A;  1F9Q A;  5DNF A;  1SSO A;  1BF4 A;  1HFN A;  3MWY W;  1IKL A;  1JE4 A;  1O7Y A;  2KEE A;  4CJ2 C;  2B2W C;  1X32 A;  1NCV A;  1CM9 A;  2B2Y A;  2FIN B;  4X3U A;  5D65 A;  5CBA E;  1BBX C;  4RWS C;  2JP1 A;  2M2L A;  4O42 A;  1HUM A;  1HFG A;  1MSG A;  1SAP A;  1QE6 A;  3I90 A;  1F2L A;  3FPU B;  1EQT A;  2RA4 A;  3TZD A;  3HP3 A;  1EL0 A;  4ZLT F;  3D6W A;  4LMQ D;  1DOK A;  2RSO A;  1BO0 A;  1NR2 A;  1EOT A;  1X3P A;  3FDT A;  2DY7 A;  5JJZ A;  5CBE E;  2JYO A;  1O80 A;  3IL8 A;  2Q8T A;  1G2T A;  4OIJ A;  2J7Z A;  4QUC A;  1CA5 A;  1HUN A;  3SVM A;  1RTN A;  2MGS A;  3I3C A;  2CVR A;  2X69 A;  2HDL A;  4R8I A;  1B50 A;  4X3T A;  1QNK A;  1ROD A;  5EJW A;  1F9S A;  2RSN A;  2K01 A;  4R9W A;  4XT3 B;  1RTO A;  2B2U C;  5COY A;  1SDF A;  2EPB A;  5COR A;  1AP0 A;  1U4M A;  2KED A;  2K05 A;  2K03 A;  1E0B A;  2IL8 A;  1B2T A;  1DZ1 A;  1WVL A;  1PLF A;  1WTV A;  2B2T A;  1J9O A;  1KNE A;  2EOT A;  2HDM A;  3F2U A;  4ZK9 B;  1J8I A;  3KBX A;  1WTW A;  1X3Q A;  2VXW A;  3G7L A;  2N88 A;  3ONA B;  1ICW A;  2B2V A;  2FHT A;  1HA6 A;  2NWG A;  4IUQ A;  5EQ0 A;  1LV9 A;  4OIK A;  1PFM A;  5E4W C;  1VMP A;  2KOL A;  1M8A A;  5EPL A;  1DON A;  1G2S A;  1ZXT A;  2L12 A;  4QUF A;  3DM1 A;  3GV3 A;  1WTX A;  1F9R A;  3P7J A;  4MN3 A;  1Q3L A;  1ILQ A;  3DEO A;  3GV6 A;  3H91 A;  2Q8R E;  4HCS A;  1DOL A;  4U68 A;  2B2W A;  4CJ1 B;  1HRJ A;  3Q6S A;  2SDF A;  2HUG A;  2FMM A;  2K04 A;  2K1B A;  1VMC A;  1QG7 A;  2KEC A;  2EE1 A;  2L9H A;  4HAE A;  2NYZ D;  4XDX A;  1B3A A;  4ZKB B;  1XYI A;  1HHV A;  1AZQ A;  4ZAI A;  1A15 A;  2MJ8 A;  1F9P A;  3MTS A;  2HCC A;  1MSH A;  3UI2 A;  4RA8 A;  1KNA A;  5CMD A;  3QO2 A;  1EIG A;  1U4R A;  4IUR A;  4IUV A;  1G6Z A;  1NR4 A;  4ZKC B;  1WD1 A;  2X6L A;  1CA6 A;  2L1B A;  1WTO A;  4CJ0 B;  3I91 A;  1ILP A;  2B2Y C;  1PDQ A;  1PFN A;  4IUU A;  4UAI A;  2RVL A;  3TN2 A;  2B2U A;  2FJ2 A;  2DY8 A;  1NAP A;  3I8Z A;  3LWE A;  3KUP A;  1B53 A;  2MPM A;  2XIW A;  3R93 A;  1WTP A;  4X3S A;  1MGS A;  2KVM A;  2R3Z A;  3N52 A;  1C8C A;  1G91 A;  2BDN A;  1S4Z A;  2MP1 A; 
#chains in the Genus database with same CATH topology
 4DR6 L;  3SGI A;  2QDL A;  5C3E B;  2HQL A;  2WAQ B;  1E2W A;  4X3K A;  3KF6 B;  1HXY D;  4A3B H;  1MD2 D;  4DNI A;  3K7A H;  4AYB B;  1K8O A;  2NZ1 D;  1TKW B;  1EU4 A;  4KKU A;  4NW2 A;  3OIP A;  3PIO 3;  1K9M C;  3BVM A;  3PO3 B;  2GVB A;  1FJG L;  2H4O A;  1F9Q A;  1QUQ B;  1XJV A;  4FF3 A;  3CME A;  1N34 Q;  5K36 G;  3T1Y L;  2B2W C;  1Y8O B;  2HHH L;  1DXM A;  4WRD A;  1A63 A;  2E2I H;  3TZD A;  3I2Z A;  3HOX B;  1EY8 A;  1ENF A;  3EBE A;  3TP5 A;  1VQK A;  1EEF D;  2C5C A;  4OIJ A;  3E0E A;  4JI0 L;  1XMO Q;  1LAB A;  1H9K A;  4QGU A;  3HOV G;  4HJ7 A;  2B2U C;  2WII B;  3DWA A;  4HIK A;  1LTI D;  4IFD H;  4JI4 L;  3A54 A;  4QJF A;  5LMN W;  3VYS A;  1KIX A;  3OPO A;  3AEV A;  1SN8 A;  4XYQ A;  2B2V A;  4C56 C;  5JVG 3;  4DR5 L;  4GOP A;  5E4W C;  1HNZ Q;  3DM1 A;  3VYT A;  4MIU A;  1VQ7 A;  1PTO D;  1FNV A;  2DNE A;  4Q0F A;  3ICE A;  1I4Q A;  2KCC A;  3CAM A;  3CCQ A;  1EY6 A;  1UE7 A;  4XQQ A;  3W5O A;  3AFP A;  4YHH Q;  2K33 A;  1N33 L;  5IWA L;  4DV5 Q;  2PNR C;  1R9T H;  2MJ8 A;  3M3Y H;  3KDF B;  2HCC A;  4A3J B;  3RD4 A;  4OX9 Q;  5CV4 A;  1YHB A;  2R7Z G;  1AH9 A;  1ILP A;  2KCM A;  2HT1 A;  5FOB B;  3PSI A;  3DUZ A;  3ND8 A;  1STB A;  4QIW E;  3LWE A;  1B3Q A;  3NUC A;  5JEA H;  2OEO A;  3NHH A;  4GNX C;  4BY1 H;  2D0O A;  1QOH A;  1YIT A;  5FJ8 G;  5LMU L;  3BYY B;  4RAU C;  2ATW A;  1TT2 A;  1PRT F;  1YZ6 A;  1HPC A;  1PYS B;  4O1N A;  1KDC A;  1CUK A;  3HOV B;  1STE A;  2E2H H;  1GO3 E;  1QWY A;  3H94 A;  2Q2H A;  3HFZ B;  5A35 A;  5C0X G;  4IQZ A;  2JEA I;  2B2T C;  4TRD A;  1X55 A;  2CHB D;  4DK1 A;  1C0A A;  4BBR B;  1MJE A;  3CPW A;  4KN4 C;  1NUC A;  1TWF H;  4X65 L;  3AB9 A;  3MWY W;  3K59 A;  4GLX A;  2KCT A;  3S14 B;  3G6J B;  4RWS C;  2M2L A;  1EQT A;  3PO2 H;  1GVP A;  3S1Q B;  1EY4 A;  1PRT C;  5IGG A;  4P73 A;  4DK0 A;  1Y8N B;  3DM3 A;  4X62 L;  2LSS A;  1X65 A;  1GOZ A;  3J81 j;  4U67 3;  1TS2 A;  1RTN A;  4R8I A;  5C4Z A;  1QNK A;  1G51 A;  4HTH A;  2KA7 A;  3CC4 A;  5I2X A;  1HTL D;  1PH5 A;  1H9J A;  1TWC B;  1K83 H;  5KGU A;  1UUP A;  4NXN L;  1WCM G;  2FHT A;  1JJ2 A;  2CKZ B;  4R4C A;  1WTH A;  3I7F A;  2A69 C;  2A68 D;  1I3Q H;  3P7J A;  1HCZ A;  2NTS A;  4KI0 A;  2UUC L;  3GTP B;  3M7N A;  4LF9 Q;  1FGB D;  3UDX A;  3I4N G;  4HID A;  2VQF L;  2K04 A;  1RD9 D;  4A3F G;  1HHV A;  3HRZ C;  4Y52 H;  4K0K Q;  2L5T A;  4KN7 C;  2CWP A;  1SR3 A;  1YJ9 A;  1EYC A;  4NKL A;  3FEW X;  2IW3 A;  1SE3 A;  2UXD Q;  2O5I C;  2XVS A;  1L0W A;  4K6L A;  2B2Y C;  4C3I H;  2OF1 A;  4A3K H;  4TKO B;  1UE5 A;  4Z9C B;  1Y1W G;  4DR7 Q;  2PQA B;  2IPK D;  5BR8 Q;  4IFD J;  2DN8 A;  3HOW B;  2I0Q A;  3EFX D;  2JA8 H;  1L1O A;  1C8C A;  2LMC B;  1STG A;  3C46 A;  5L37 A;  3K8A A;  4JW0 A;  5JAV A;  3CW2 C;  3M4P A;  1GJX A;  5E3F A;  4RGO S;  4GKK Q;  1U4L A;  4JI7 L;  2N3S A;  1SYF A;  5T1G A;  4FO2 A;  4OL7 A;  3KYH C;  1JJC B;  1LTT D;  4HJ5 A;  1BBU A;  2AWO A;  2HCI A;  2IHF A;  1JR0 D;  4DXF A;  4CBV A;  4QB4 A;  4A93 H;  5KRU A;  5LMN Q;  1B4O A;  1G8Z D;  4UP7 A;  4G57 A;  1XPO A;  1HNW Q;  5CBA E;  5M5Y H;  4DV1 Q;  3I4N B;  3RZD H;  4JCV E;  1CKN B;  1EYG A;  2UUB L;  2F0K A;  3D8G A;  5JEA J;  3S1M H;  4NB3 A;  3EN2 A;  1DGS A;  2P5Z X;  1VQD A;  3ERO A;  1C4Q A;  4MZ9 A;  3IL8 A;  3QR8 A;  1B1Z A;  2WAC A;  4KHZ A;  2NN6 I;  4GNX B;  2YU9 B;  3GTL H;  4LFC L;  1PYW D;  2SOB A;  1Y1W B;  4B3T Q;  3HOZ B;  1HR0 L;  3P20 A;  2K03 A;  1CKM A;  4BWG B;  5KEE A;  4K5V A;  1KNE A;  3PGZ A;  4CGY B;  3VA7 A;  3A7L A;  2NVQ B;  3H0G G;  2SNM A;  1HNX L;  3ULJ A;  4HCE A;  4QUF A;  2VY3 A;  1VQE A;  2Z8L A;  2KHS A;  4ILW A;  2SDF A;  1GD7 A;  1QZG A;  1K8A C;  3Q0A A;  2IX3 A;  2KJX A;  3DHQ A;  3P75 A;  2JA5 G;  5FK9 C;  3STB C;  4A3M H;  2JA7 G;  1VQO A;  1QIL A;  4DAY B;  3GTJ H;  4GN5 A;  3H3V C;  3NXW A;  1I4R A;  4IUR A;  3NTI A;  2YTV A;  1FR3 A;  5CV8 A;  1PRT B;  3Q22 A;  3T4A C;  4XQJ A;  5GRO A;  3MFG A;  2JA9 A;  3SHL A;  3C1E A;  2JJQ A;  4G4K A;  1HJP A;  1JOO A;  1VQ4 A;  3FKI G;  3S15 H;  1GUN A;  4JI6 Q;  2QCP X;  5CV5 A;  2MPM A;  2PW7 A;  3U50 C;  1KL9 A;  4YWL A;  4C3I G;  2D0P A;  4A3E H;  1WTQ A;  5KIX A;  2R92 H;  4I7A A;  2EYO A;  4AYB E;  1Q8K A;  4MNO A;  5C4X B;  4OWX B;  4DN4 M;  2ASB A;  2JA8 G;  1V8Q A;  2XN9 C;  4IAL A;  2F0G A;  3VR5 A;  3SK8 A;  3H0G B;  4LF8 Q;  5EPJ A;  1O7Z A;  2KUM A;  4IPH A;  3JAM c;  1N34 L;  3DEP A;  4F7X A;  5M5W H;  1VQF A;  3HKZ B;  2XRS D;  1IYU A;  1TY0 A;  2JA5 B;  2EZV A;  2E5L Q;  3K0Y A;  4UY8 C;  5HGQ A;  4N8X 1;  4JBJ A;  1Q7Y C;  5C44 B;  4FXG C;  2IJ0 A;  2C35 B;  2Z4I A;  2J7Z A;  3SVM A;  2K5W A;  4FXK C;  2BDO A;  3QB3 A;  2PO4 A;  5COR A;  4B9X A;  4JOI A;  4G7H C;  3U9O A;  5EGT A;  1VQM A;  4NPS A;  4UDU C;  1LT6 D;  5I6Y A;  1MHW C;  3K80 C;  2PQE A;  3NQI A;  1WTV A;  1J9O A;  3KK7 A;  5IYB H;  3VR3 A;  3KBX A;  4HN7 A;  4K8J A;  3PCO B;  1TS3 A;  4GKJ Q;  4F8M A;  1OTC A;  5M3F B;  2L55 A;  3E9H A;  3H15 A;  4TSS A;  1XTC D;  1XMQ Q;  3A5Z B;  2B63 H;  3GTO B;  4OEL B;  1GUS A;  4YHH L;  2K1B A;  5GAH C;  4DV5 L;  1TWH B;  3BDL A;  2J4X A;  1KQS A;  2ICE C;  1D1K A;  3T56 B;  5K5P A;  5C3E H;  1PZJ D;  5KYI A;  3URY A;  5A2Q L;  1KNA A;  4C3H G;  2F3V A;  1K28 A;  3S1N H;  1LTG D;  2NZH A;  4FF1 A;  1GM5 A;  1B44 D;  3OMG A;  3GTQ B;  4R1J A;  5JOB A;  3S16 B;  2CQO A;  1KXL A;  5G3L F;  1VQJ A;  3KLR A;  5BN4 A;  2ZM6 Q;  3PO3 H;  3R93 A;  1WTP A;  4X3S A;  2R3Z A;  2IY5 B;  4JBK A;  1KDA A;  2Q8I B;  1A8V A;  5ELO A;  4QQB X;  2MP1 A;  5IY0 A;  1VQH A;  4DV3 Q;  2Z6B A;  3RUZ A;  1I5F A;  1DJR D;  3BU2 A;  1VQG A;  3RMH A;  5IYC H;  5E4X A;  1ENA A;  2D9U A;  1E2Z A;  3K5M A;  1KC8 C;  3NK9 A;  1D6E C;  1E7Z A;  3B6Y A;  4HED A;  5IOD A;  5M3M H;  3U58 A;  2R93 B;  1K3B C;  3NBH A;  2H5X A;  4A3I B;  1QCB D;  3J80 i;  3VR2 A;  4LFB Q;  3M9B A;  2R92 G;  2A1A A;  1IHZ A;  3KJO A;  5JVH 3;  1EYD A;  2WKC A;  5BN5 A;  2X6G A;  5KND A;  2B29 A;  3GTK B;  1EEI D;  2R7F A;  4PMW A;  4FVM A;  2K5V A;  2WP8 J;  5KYL A;  5ISR A;  1MBY A;  1O7Y A;  3HEJ A;  1IZ6 A;  5IP9 H;  4DNT B;  4PNY A;  2NVT B;  1QE6 A;  1Q1E A;  1WJJ A;  3HOU H;  1TQO A;  1E2V A;  5C4J B;  3CCE A;  1VDZ A;  3FHW A;  2I07 B;  3PUZ A;  4UP9 A;  4A3G G;  4LF5 Q;  2PZT A;  3A5U A;  4S3S A;  1ZKO A;  1PTO C;  5EJW A;  4P72 A;  3AU7 A;  1DZ1 A;  3A7A B;  1TU2 B;  2ZJR A;  4ZUJ A;  1Y69 U;  1AEX A;  2F0Q A;  1GUO A;  3TP6 A;  4LF9 L;  2WB1 B;  3MXN A;  4MN3 A;  4U68 A;  1LTA D;  4CJ1 B;  1EFI D;  4HCS A;  5IYB G;  1TWA H;  2JE6 I;  1PH4 A;  2OT2 A;  1XYI A;  2IHE A;  4DV7 Q;  1QNU A;  4ZAI A;  3BYT B;  4APV A;  1S72 A;  4RA8 A;  3PF5 A;  1U4R A;  3I4L A;  3CPF A;  1CZG A;  1WD1 A;  3D4D A;  2E2J B;  2L1B A;  2EQS A;  3E9I A;  5AJ3 Q;  4DF7 A;  3TDQ A;  4DR7 L;  1I6H B;  5BR8 L;  4G7Z C;  2QW7 A;  2B8G A;  2F0P A;  2KHJ A;  2JXM B;  1LT4 D;  3TBI B;  3RLF A;  2Z1C A;  2CQA A;  5JPM C;  2PPB C;  4A3G B;  2NVY H;  2KHI A;  3MZ5 A;  4ZQ3 A;  4GKK L;  4BY7 H;  1EUJ A;  1S3O A;  1TVX A;  2IWH A;  1SNO A;  4R8N A;  2JA6 H;  3IFD A;  2R7D A;  1D5Z C;  3S1Q H;  2RBM A;  5IYD G;  4J6H A;  2XWJ B;  1K8G A;  3VR6 A;  1WTR A;  3ND9 A;  5LMN L;  4OO1 G;  4OHJ A;  1VQL A;  1A0I A;  1VS0 A;  1TY2 A;  2Y0S B;  2ZTD A;  3PV0 A;  5JJK A;  4I7Z C;  1VQ9 A;  1I94 Q;  4DV1 L;  3SXH A;  1L1O C;  4X3U A;  1XNQ Q;  4H44 C;  1TS5 A;  4AQY Q;  1TWC H;  5M5X H;  3HP3 A;  1Y1V H;  1CT1 D;  5C0X I;  2ALY B;  3MC0 B;  1XNR Q;  4KY6 A;  4BS9 A;  3H6M A;  2VQE Q;  4ME5 A;  1JOQ A;  1GHJ A;  5EBC A;  5F2D A;  4A3D H;  5IP9 G;  2A6E D;  2NVX B;  1KAB A;  3GTP H;  2A68 C;  5FLX c;  2MO0 A;  2QF7 A;  3I73 A;  4JI5 Q;  3HOU G;  1N32 L;  4X64 Q;  1RTO A;  1I6V C;  4A3L H;  3TZU A;  4GN4 B;  1WVL A;  2RQX A;  3KF8 A;  3JC6 6;  2HDM A;  3S2H H;  4JBM A;  4DR4 Q;  1LLR D;  2LKV A;  4KHP L;  2VXW A;  1JB7 A;  2F52 A;  1QVC A;  2BA1 A;  5EQ0 A;  1LV9 A;  3HGB A;  4BXX H;  3V96 A;  1KLU D;  1YBY A;  1BBW A;  2SNS A;  1VQ6 A;  1ZEQ X;  3M4Q A;  1IYJ B;  2MNA A;  2K5D A;  2KEC A;  4XDX A;  2EE1 A;  2Z6K C;  4DR2 Q;  2FXQ A;  1SNM A;  3K0X A;  2EJM A;  2RHS B;  3I56 A;  3AMU A;  3QIA A;  1TWG H;  4K6D A;  4LUV A;  4ZKC B;  2XWB B;  4JYA Q;  1DCZ A;  2K5H A;  1H9S A;  1D5X C;  2AQ1 B;  1HA5 A;  3VDY A;  1B53 A;  2I46 A;  3KJP A;  4IUN A;  2PMZ B;  2HQE A;  2RHQ B;  1CHQ D;  3GTM B;  4POF A;  1ESF A;  2OTJ A;  3KF6 A;  3OWE B;  3UDF A;  1QVF A;  4LFA L;  2JK8 A;  1IBM Q;  1MKH A;  1UE1 A;  2MHV A;  1N8R C;  3NSW A;  1LTS D;  4LF7 Q;  4LF8 L;  5HUR A;  3F2C A;  4BBS G;  4RGN A;  3R3O A;  1QUQ A;  1WOC A;  3RZO H;  3I4M H;  2E8G A;  4NXM L;  4M1U B;  4GZY C;  2JA6 G;  1S5C D;  5J1Z A;  1TR5 A;  4DUY Q;  4DV2 Q;  1BCP F;  1OXS C;  1K73 C;  3HOZ H;  3G48 A;  4C2M B;  1NBW A;  3BVG A;  2JEB I;  2ZXO A;  2F03 A;  4JI8 Q;  3X3N A;  3D0F A;  1SJH D;  4DR3 Q;  2AHO B;  2E5L L;  2RCN A;  5C4H A;  3PUW A;  1SND A;  3OTO Q;  2EYM A;  5IOC A;  4GS3 A;  3FRP B;  5ELD A;  1LUZ A;  1YJW A;  2ZXP A;  4C3J H;  1V1P B;  4PZ8 A;  1SNP A;  1Y1V G;  1JWU D;  1VQ5 A;  1KAW A;  4CHT B;  1B2T A;  4A3B G;  3K58 A;  5DM6 3;  4A3D G;  1JC7 A;  2EOT A;  4H02 A;  1BCP C;  4GKJ L;  5M9O A;  4RCO A;  4P74 A;  4L5T A;  1SNQ A;  2AWN A;  1HA6 A;  2NWG A;  1XMQ L;  4HIM A;  1STN A;  1Z47 A;  1ZXT A;  4A3L G;  2F0L A;  4EQ5 A;  5I9P A;  4A3C H;  2F3W A;  3GV6 A;  1SMY C;  1Q90 A;  2Q8R E;  3TRE A;  3CQZ H;  2EY5 A;  2R7Z B;  3KDF A;  1VMC A;  5I9O A;  2F1M A;  1JJG A;  3LWU A;  4BXX G;  1CK1 A;  4IJH A;  2F0I A;  1EIG A;  4JOI C;  4RHR A;  1EIY B;  4RGT A;  5C4X H;  2PI2 A;  4XTC S;  3R8B A;  4IO9 A;  2B8F A;  4PV1 C;  4CJ0 B;  3Q8D A;  4JI3 L;  2F4V Q;  4UAI A;  4PZ7 A;  1Q12 A;  2WFW A;  4IFD G;  4P71 A;  1BOS A;  2BOS A;  2QGQ A;  2FMC A;  2M00 A;  3KUP A;  2UXB Q;  2OCE A;  1M90 C;  4DV0 Q;  1Z7T A;  1NJI C;  3L2P A;  3S1R B;  3W3A A;  5JJI A;  4ALP A;  3G6E A;  1CSP A;  3A8K E;  1YHA A;  2LXJ A;  1QZH A;  2FFK B;  2NB0 A;  2E74 C;  2Q2T A;  4A3B B;  4LFB L;  4XT1 B;  3K7A B;  5T1I A;  1KD1 C;  3HOY H;  2L4N A;  1E3P A;  5IGF A;  1DOM A;  3GO5 A;  4WJ3 M;  1AZP A;  5J3B A;  1ASZ A;  2G5D A;  3PUV A;  2VUM H;  1HFN A;  2PZW A;  2F0O A;  5IGC A;  2F0D A;  2KEE A;  3WOF A;  3GQB A;  2PW5 A;  1BBX C;  3OIQ A;  3F8T A;  4O2D A;  3DWQ A;  2VZA A;  1O78 A;  3I4M G;  2EJG C;  4ZLT F;  3NP8 A;  3NEM A;  1K3R A;  1H95 A;  5JEA G;  3RR5 A;  3D31 A;  2AQ2 B;  4QL5 A;  4BY1 G;  2DNC A;  3J7Y W;  5M3F H;  1Q82 C;  3HKS A;  4LF5 L;  4X66 Q;  1IBL L;  3J81 c;  2Q8T A;  1EU3 A;  2DUD A;  1WCM B;  3VYR A;  1IBK Q;  3ZJY C;  2ZTE A;  3G4S A;  4XT3 B;  1YI2 A;  1VF7 A;  1TWH H;  1T9H A;  2EPB A;  3BVZ A;  4H7B A;  3GP7 A;  3J80 c;  2IL8 A;  1AE3 A;  1E1T A;  4ZK9 B;  3MEF A;  3F2U A;  4LK1 C;  3G71 A;  1D8L A;  4C3J G;  5A2Q E;  2Z0S A;  2O4X A;  4A3F B;  1WTW A;  4C1N I;  2CW0 D;  1IW7 C;  2Z9H A;  1GXD C;  2DGY A;  3GTQ H;  3UE1 A;  1M8A A;  1TXY A;  1DON A;  3AYH B;  2UUA Q;  4TQU S;  3CCJ A;  1PZK D;  1B8A A;  3NEN A;  1DOL A;  2B2W A;  3SK5 A;  4DV7 L;  3NTK A;  5C3X A;  3CCM A;  1G2T A;  1Y8P B;  3PO2 G;  4JI2 Q;  1QVG A;  4TVA B;  5FLX L;  3M3Y B;  4QY7 A;  1WYD A;  3BDO A;  3OYY A;  4LF4 Q;  3ERS X;  1A3T A;  3QOL A;  4Y7N H;  4IUV A;  4AH6 A;  5AJ3 L;  3HG9 A;  1XPR A;  4G7O C;  2WIN B;  4EGV A;  2PQA A;  5ELF A;  5NUC A;  1D2B A;  3I91 A;  2R93 H;  3PIP 3;  5FKA C;  1PDQ A;  1W6K A;  5IGE A;  1STH A;  2SEB D;  1GUG A;  2VNU D;  2B2U A;  1YNN D;  1N36 Q;  3OHX C;  3H3V I;  4KJO A;  4DXG A;  2K75 A;  3P1H A;  3ITP A;  1SNC A;  4BY1 B;  2BH8 A;  2GVA A;  3GTK H;  1NMF A;  1BKB A;  1LTR D;  1YEZ A;  5C3W A;  1RJT A;  1RCV D;  2QKI C;  1P16 A;  4NMZ A;  2HHH Q;  1BCP B;  2NVT H;  1MIU A;  2I5H A;  1A6X A;  1EFW A;  3NTH A;  1AN8 A;  2DJF C;  2ES2 A;  4HMJ A;  4B3S Q;  4AIM A;  3PIO A;  3S17 H;  1K8M A;  1YJN A;  4K5W A;  2OXP A;  3O13 A;  2JQO A;  2JSO A;  1TS4 A;  3ULP A;  5CV9 A;  1VQ8 A;  2WAQ E;  2C9O A;  4L63 B;  2IX1 A;  1ML0 D;  1ZYR C;  4L5S A;  2WV6 D;  1I94 L;  5J22 A;  1TWF B;  4YIJ A;  1HZB A;  1LYL A;  1CKN A;  1X54 A;  4YCW A;  4EQO A;  1CHP D;  1XNQ L;  3IKJ A;  1SRO A;  3CHB D;  4A3K G;  1IL2 A;  4AQY L;  4JI4 Q;  4JI1 Q;  2JN4 A;  1PRT D;  4EQN A;  2KEN A;  3AQQ A;  4LNQ A;  1EY5 A;  2VQE L;  4FDB A;  1RL2 A;  4E6I A;  1EOT A;  1X3P A;  5LL6 S;  4DR5 Q;  4GNX A;  4B9W A;  1EY0 A;  5TSS A;  4FYD A;  3PQI A;  3MXG A;  1R4P B;  4X64 L;  2X69 A;  4B3R Q;  1KAA A;  5C6A A;  4R9W A;  1AP0 A;  2QEJ C;  2KED A;  5IWA Q;  3BZK A;  4DR4 L;  1DD2 A;  3A74 A;  2B2T A;  2QA4 A;  1J8I A;  2EDG A;  3M85 A;  3ONA B;  1PHJ A;  4A93 G;  2JA7 B;  4ABN A;  1HR0 W;  2MFI A;  1S5E D;  2CH4 W;  3RLO A;  3W1G A;  1I3Q B;  2NUC A;  2QDB A;  2QIL A;  3L0O A;  1I50 H;  1VQN A;  1RDP D;  1ET6 A;  1XMO L;  4YY3 Q;  1SXT A;  4DR2 L;  4DAY A;  3Q6S A;  5EBD A;  1QG7 A;  3MAQ A;  3K5N A;  2HD3 A;  1J5E Q;  3FKI B;  4QIW B;  4R4I A;  5LMU Q;  3TP7 A;  5I4D A;  3FPP A;  4QCL A;  2X6L A;  1HZ9 A;  4C3I B;  1WTO A;  4OON A;  1STY A;  1HNZ L;  4L8J A;  1WFQ A;  2RDH A;  3L9A X;  3TN2 A;  3WWV A;  3VA5 A;  3KFU A;  1O7L A;  1N9W A;  2F0J A;  3FP9 A;  2JA8 B;  3V2T A;  1S5D D;  3WDN A;  1KHI A;  2BA0 A;  2K14 A;  3X3M A;  1YIJ A;  1GHK A;  3EQL C;  1IBM L;  2PI2 E;  3TP8 A;  2XNA C;  4OX9 L;  2OQ0 A;  1MI2 A;  1STA A;  4LF7 L;  3DMU A;  2LXK A;  4HJ8 A;  4P75 A;  1D5M C;  1EQR A;  4A3M G;  1AFP A;  4DAM A;  1EYA A;  5CR3 A;  2B2V C;  2L11 A;  4K2L A;  4DUY L;  4ZCK A;  4DV2 L;  4GOP C;  3TS2 A;  4X6A H;  2A6E C;  2E76 C;  4MHE A;  4LF6 Q;  3GTG B;  1BXT A;  2VS1 A;  1WI5 A;  1IKL A;  4JI8 L;  3CC7 A;  5M5Y B;  4DR3 L;  3RZD B;  1Q46 A;  2B2Y A;  2F3I A;  2VL6 A;  3QG1 A;  4KJN A;  3FPU B;  4DR1 Q;  3F1Z A;  3H09 A;  4LMQ D;  1B7Y B;  2RSO A;  5CGK A;  3HOX H;  3CCR A;  1W2B A;  5CBE E;  1PTO F;  4A3E G;  1KDB A;  1O80 A;  1OXV A;  1K0R A;  4DGZ A;  4OO1 I;  1W3S A;  3GTL B;  4X3T A;  2E2D C;  1JWM D;  2RSN A;  2K01 A;  5IIF A;  1Q81 C;  2BE5 D;  2GA4 B;  5IT9 c;  4IOA A;  1E0B A;  1UAP A;  2ZJQ A;  3T1H Q;  3SK4 A;  3MVV A;  1E22 A;  1U0L A;  3S2D B;  4IUQ A;  4DAP A;  2MQH A;  3D6C A;  4C3H B;  4C1N K;  1G2S A;  1P8L A;  3D4W A;  4DV4 Q;  5EKL A;  3H91 A;  1V1Q A;  3E3X A;  3J81 L;  3CP0 A;  1B3A A;  4ZKB B;  4XQN A;  4POG A;  5KNC A;  2ZXR A;  3GTJ B;  1F9P A;  1SE4 A;  3KLW A;  2F0V A;  4A3J H;  3QO2 A;  5DEH A;  5CC4 A;  1JE5 A;  2EY1 A;  1YNJ D;  2F4V L;  4ID6 A;  1HH2 P;  3CC2 A;  4IUU A;  1AW7 A;  4V19 0;  1O7I A;  1E24 A;  2EY6 A;  2LFN A;  2KCN A;  3TQY A;  4J1M A;  2LY7 A;  4DV0 L;  3PF4 A;  1MGS A;  2KVM A;  1VQB A;  4K0K L;  1A3V A;  1SYC A;  3CU7 A;  2BDN A;  4KY7 A;  3SK6 A;  2YV5 A;  2R92 B;  5DAU A;  1EWC A;  1SMX A;  4K2K A;  2UXD L;  2UU9 Q;  2B63 G;  3HOV H;  4IJL A;  4IUP A;  2H1E A;  2EJF C;  1SYB A;  3A0J A;  5FO9 B;  1XX8 A;  5EPK A;  5ELE A;  1RF2 D;  2LS0 1;  4PG3 A;  5C3E G;  2WAQ G;  2I5M X;  5C5L A;  2Q2I A;  3I70 A;  4HR7 B;  5ELC A;  4BBR H;  4DPG A;  4A76 A;  1SYG A;  5DNF A;  1TII D;  5M5W B;  3A8I E;  3CD6 A;  1W6J A;  1HR0 Q;  2BCO A;  4WJW A;  2FIN B;  3ERQ A;  3LGJ A;  4J8Q A;  4RMF A;  1T5E A;  3S14 H;  4BA2 I;  3M7G A;  4AYB G;  1F2L A;  1RIP A;  2RA4 A;  1DOK A;  3PO3 G;  2XRQ D;  1CQV A;  1FL0 A;  4H0L C;  4X66 L;  2EIF A;  1NSN S;  1HNX Q;  4K5X A;  3LNN A;  5DM7 3;  1IBK L;  4MTK A;  2UXC Q;  4KMU C;  3W1B A;  3QJY A;  4KLK A;  5IYC G;  2R7Z H;  1F9S A;  4XXE A;  4DV6 Q;  2CFM A;  4DK3 C;  4YCV A;  1HNW L;  5M3M G;  1Q8I A;  4F87 A;  3U4V A;  3PIP A;  4DUZ Q;  2A6H D;  4P2C B;  1SE2 A;  2NBF A;  2N88 A;  1PVO A;  1JMC A;  3OWF A;  2AQ3 B;  5FJ8 H;  1VQA A;  2UUA L;  3LX0 A;  3SR1 A;  1WTX A;  1LM0 A;  1YHQ A;  3MFY A;  1CTM A;  5EAY A;  3FVQ A;  1ILQ A;  4GOP B;  4OGQ C;  1OO9 B;  2N8N A;  4WFN 3;  4JI2 L;  1S5B D;  1PH3 A;  1D1I A;  4B3T L;  1KRS A;  4KV6 A;  2A19 A;  4LF4 L;  2EYF A;  4KHV A;  3JAM L;  3S1R H;  4N8F A;  1SJE D;  3MTS A;  3K57 A;  1PYB A;  3S1N B;  1EIF A;  1PH2 A;  1B70 B;  1N36 L;  1SYD A;  1VCI A;  4CKB A;  4PZ6 A;  4A3J G;  1BUV T;  3HOW H;  4HMI A;  2R61 A;  2XIW A;  1MJC A;  3N52 A;  3Q23 A;  1XWE A;  1S4Z A;  3BG3 A;  3R2I A;  4LJZ C;  1DM0 B;  3L3O C;  1X9N A;  1L2F A;  1M4V A;  4JC0 A;  1QB5 D;  4B3S L;  3OOC A;  1ESR A;  5ELN A;  1RHP A;  5M3M B;  4HSV A;  4XYO A;  5EKK A;  1JB3 A;  1YNX A;  2L15 A;  5IP7 H;  1ENC A;  4IFD I;  1SE8 A;  2OTL A;  1PMR A;  4JI6 L;  4CDD C;  3J7A F;  1GUW A;  1EQQ A;  5G3L D;  1EZ8 A;  1WCM H;  3J7A 5;  4R4O A;  1PTO B;  3VR4 A;  1L0X B;  1Y14 B;  1SFO B;  1SSO A;  1YVC A;  1ASY A;  2IX0 A;  1V9P A;  1F2Y A;  1FVI A;  4JI1 L;  3AFQ A;  4MTN A;  1X32 A;  1NCV A;  2AUK A;  3MXU A;  3I4N H;  2JP1 A;  4JK1 C;  1HUM A;  1GUT A;  1HFG A;  2Z4H A;  3HOU B;  4A3F H;  4BBR G;  5GAD C;  1PH6 A;  1HZA A;  4LUO A;  2CW0 C;  2ID0 A;  2DY7 A;  2TMP A;  3HKZ E;  4BY7 G;  4B3R L;  1HUN A;  3DWP A;  1CA5 A;  4ME3 A;  2MGS A;  3IFT A;  1X56 A;  4RHS A;  2YU9 H;  5COY A;  1Y1W H;  1U4M A;  5FLX E;  1M1K C;  1F2Z A;  1PLF A;  4UP8 A;  2RDG A;  1PFS A;  3CKI B;  5E7N A;  5DLQ E;  1X3Q A;  3D4R A;  2NVQ H;  3M4O B;  5HGT A;  3TME A;  1II3 A;  4OIK A;  1VMP A;  5KNB A;  2V1C C;  4YY3 L;  3NWT A;  2ZJP A;  1Q3L A;  3SDZ A;  3DEO A;  4PMB A;  1HQM C;  1TWA B;  2K32 A;  4ZYS A;  1YNN C;  2EVB A;  2HUG A;  2D62 A;  4LW1 A;  3K81 C;  4HAE A;  1J5E L;  5FO8 B;  3UI2 A;  4UHV A;  4PMC A;  1IXR A;  1VQC A;  4KY5 A;  5IT9 L;  1JQY D;  2MUY A;  3RN2 A;  3E6Z X;  2Q2U A;  4RKL A;  1EOV A;  4HJA A;  1CA6 A;  1I4X A;  1CQF A;  3KOJ A;  1U5K A;  4PQX A;  2F0T A;  4K8I A;  1A3U A;  2RVL A;  2FJ2 A;  2DY8 A;  3K5L A;  4BA1 I;  4QMG A;  2EXZ A;  2NVY B;  4DK6 C;  4BBS B;  4KTA A;  2O2L D;  2A8V A;  1IL8 A;  4BY7 B;  1U4P A;  4L5R C;  5BN3 A;  3EJI A;  1L1O B;  2F0W A;  1S40 A;  4JV5 Q;  2JA6 B;  4IUT A;  4GLA C;  4B3M Q;  1SRU A;  1QJO A;  3HOW G;  5D14 A;  1HQR D;  3MEH A;  3M4Y A;  5C0X J;  5ELB A;  2OWO A;  1JIC A;  2ENB A;  1I4P A;  2RCF A;  4CKE A;  3UDI A;  3H0G H;  2K28 A;  4LF6 L;  2ZM6 L;  2WKD A;  2K5N A;  3SE0 A;  1B9N A;  2N55 A;  4CDF C;  4DV3 L;  4L6T B;  1JE4 A;  3I55 A;  2MO1 A;  4CJ2 C;  3E5S A;  5IP7 G;  1LTL A;  2A73 B;  4DR1 L;  4O42 A;  4ODG A;  2G9D A;  1MSG A;  1SAP A;  5M5X B;  1Y1V B;  1EL0 A;  2JA5 H;  1B9M A;  3CXC A;  2JA7 H;  1NR2 A;  1V1P A;  4ZUI A;  3ER0 A;  1UWV A;  3MXP A;  4A3D B;  2EYL A;  3GDE A;  1C7Y A;  5C44 H;  2L0C A;  1A62 A;  2A74 C;  3D3R A;  2ZT9 C;  1B50 A;  2E75 C;  2HDL A;  2EYH A;  4FNF A;  1V1O A;  2A5H A;  2XGT A;  3T1H L;  1H9R A;  5LL6 X;  1XXG A;  4IZ8 A;  2EXD A;  3FKI H;  3S2H B;  4OXP A;  1AE2 A;  2E2I B;  3G7L A;  2XSC A;  1X6O A;  2O5J C;  2F0E A;  4DV4 L;  2KOL A;  3HOZ G;  1A2T A;  2F0S A;  3T51 B;  3A8J E;  3CCS A;  1NY4 A;  1JOR A;  2KQ3 A;  1EWI A;  3GTO H;  4RFB A;  2FMM A;  4RCN A;  1ET9 A;  3J7Z C;  2RKS A;  1OXX K;  4HSP A;  1CI3 M;  4OEM B;  1CSQ A;  1OXU A;  1TWG B;  2WB1 E;  1EY9 A;  4DNR B;  1G6Z A;  3OSO A;  3CF5 A;  2F0F A;  1JWS D;  2PYK A;  3S16 H;  1GKH A;  3I8Z A;  2NZO A;  4RGM A;  5GAG C;  3EA6 A;  5LHY 1;  3VYU A;  4H13 C;  3GTG H;  3F2D A;  5HY6 A;  5IGD A;  3RLN A;  3U4Z A;  1R9T B;  2UU9 L;  3NE5 B;  4DR6 Q;  3SEB A;  5FLM H;  1UEA B;  4A3C G;  2NN6 H;  3DLL A;  4IPG A;  1PZI D;  1LO5 D;  1WD0 A;  4A75 A;  1BNZ A;  4YWK A;  2Z6K A;  1PH7 A;  4A3I H;  2AKW B;  3I4M B;  3RZO B;  1CZW A;  2D5D A;  4L5Q A;  3NQT A;  5C4X G;  2F4I A;  2R6G A;  5E1F A;  3V05 A;  1N32 Q;  1FJG Q;  1BR9 A;  1VQI A;  3FMC A;  3J7A V;  2BE5 C;  1U9R A;  5D65 A;  3T1Y Q;  3H3V H;  3NEL A;  3QOJ A;  2AUJ D;  4CDC C;  2E2H B;  3PMF A;  3S2D H;  3D6W A;  4KHP Q;  2Y0S E;  1FGU A;  3GD7 A;  3K5O A;  3FDT A;  5C4J H;  2K5Q A;  2NTT A;  4DU9 A;  4C3H H;  2UXC L;  1ICF B;  2JYO A;  4C3J B;  3ULL A;  3HKZ G;  1SBB B;  4KKS A;  4J15 A;  3I3C A;  4JPB W;  2CVR A;  2YYZ A;  3QWN A;  4M8A A;  4EQP A;  2HIX A;  4DV6 L;  1KTK A;  3F2B A;  4FF4 A;  3CCV A;  4JI0 Q;  3J81 E;  4DUZ L;  2EYJ A;  1BCP D;  1X3G A;  1PH1 A;  1EWH A;  5CYU A;  2K6A A;  1BDO A;  5C44 G;  2AMC B;  3HOY G;  1PXU A;  4GN3 B;  3I72 A;  4UPA A;  2RDF A;  3PO2 B;  2PZU A;  3J80 E;  4ULL A;  1JOK A;  1FYC A;  1XNR L;  1Z6H A;  2XTI A;  1SMY D;  1YNJ C;  2GN5 A;  2VUM G;  4OWT B;  2L12 A;  1F9R A;  4KKT A;  3CQZ B;  4YCU A;  1KRT A;  3T53 B;  4JI5 L;  4EVO A;  1Q86 C;  2EYP A;  1ONL A;  2NYZ D;  4CKC A;  3T16 A;  4KD4 A;  1AZQ A;  4RG1 A;  5M3F G;  4DKA C;  1PH9 A;  1N33 Q;  4FP5 D;  3NBI A;  2B3G A;  5D3D A;  1K83 B;  1NR4 A;  4LFA Q;  5CV7 A;  2E2J H;  1OXT A;  2A69 D;  5GQO A;  1I6H H;  3IRB A;  4DA2 A;  2KBN A;  1BVS A;  3UDG A;  3TEH B;  2B39 A;  1LT3 D;  3S9W A;  4R4Q A;  4NXM Q;  1CKO A;  2PCF B;  1CFM A;  1G6P A;  1C9O A;  1UE6 A;  4A3G H;  3KBG A;  5AFW A;  1FNW A;  4LUZ A;  3A56 A;  4GLV B;  3CRL C;  3C3L A;  1RKN A;  4JYA L;  1K0S A;  4KD3 A;  2N78 A;  4A3K B;  2PMZ E;  3HOY B;  4FF2 A;  1SEB D;  3CCU A;  1NNX A;  1BQQ T;  5IGB A;  3ZYY X;  1EY7 A;  2HIV A;  5FLM G;  5H1S E;  2K50 A;  4JG2 A;  1PFB A;  3NBH B;  4A4I A;  2NN6 G;  2EY2 A;  2VUM B;  1BF4 A;  1T5X D;  3KLS X;  3NWS A;  4O0A A;  5J39 A;  2R93 G;  4B08 A;  4X65 Q;  1CM9 A;  3MHB A;  4A3I G;  3T13 A;  4LAA A;  1KLG D;  1LT5 D;  3I90 A;  1C48 A;  1SLJ A;  4FXD A;  1UEB A;  2A6H C;  5CV6 A;  1BO0 A;  3OW2 A;  3CRK C;  4NDX A;  3MA2 B;  1Q1B A;  4X62 Q;  4QUC A;  2NVX H;  4A93 B;  4IPD A;  4YWM A;  1NE3 A;  1SDF A;  2J0T D;  2VB3 X;  2ICI A;  1D7Q A;  1JCK B;  2G9H D;  3JAM E;  3EVQ A;  1IW7 D;  4F88 A;  3BDC A;  3OW7 A;  2F0N A;  2N49 A;  1G29 1;  1ICW A;  1LTB D;  4CDE C;  4EX5 A;  1E1O A;  1J6Q A;  3S24 A;  3S1M B;  3OTO L;  1S5F D;  4NXN Q;  4Q5V A;  5EPL A;  4JI3 Q;  3GV3 A;  1FD7 D;  2BH2 A;  3E0J A;  2F0H A;  3PUX A;  5IYD H;  2UUC Q;  3MXN B;  1LAC A;  3HS0 C;  2VQF Q;  4OWW B;  1FNU A;  1SYE A;  1A15 A;  4K14 A;  4Y7N B;  1MSH A;  4OO1 H;  3J81 i;  1JT8 A;  4HJ9 A;  2D2C C;  4R4T A;  2WB1 G;  2CH4 A;  2F0U A;  3RNU A;  3HZX A;  2VB2 X;  1I4G A;  2RF4 A;  2I5L X;  2CWA A;  4RH6 A;  2QEX A;  3BJU A;  3STB D;  1PTO H;  2K52 A;  1G91 A;  4KK7 A;  4WOR A;  2K4K A;  1UNS A;  4XIG S;  3BZC A;  1SFO H;  3BS1 A;  3TSS A;  3TRZ A;  3W2D A;  4N9P A;  4A3M B;  2DJG C;  4QF4 A;  1NMG A;  4JV5 L;  1EZ6 A;  3GTM H;  3U9S A;  1X3E A;  4B3M L;  4DFA A;  3I4O A;  3J80 L;  4JI7 Q;  3N6R A;  1EIH A;  3S17 B;  5EKI A;  1F2M A;  5K36 H;  1HTP A;  4ZRZ A;  2YTX A;  3CCL A;  1ZYR D;  1V43 A;  3PUY A;  2K7V A;  1IKM A;  2OQK A;  3S15 B;  3C1F A;  1IBL Q;  2YTY A;  5JPN C;  1PH8 A;  2UXB L;  1XPU A;  4LWC A;  1H9M A;  4A3E B;  1F77 A;  4C2M H;  3OMC A;  2TSS A;  3EIV A;  1DYQ A;  2CCZ A;  2VW9 A;  3KLS A;  3M4O H;  3BZD B;  4N9T A;  2UUB Q;  2Y0S G;  1XTD A;  3K6O A;  5IE8 A;  1NTG A;  4HIO A;  5JJZ A;  4V0B A;  3C2P A;  1L0Y B;  4IPC A;  4WJ4 A;  3UE0 A;  2F0M A;  1ROD A;  1PV4 A;  3A55 A;  2ZTC A;  3CMA A;  1HZC A;  4LFC Q;  2K05 A;  4IN3 A;  3WOE A;  4JBW A;  1IYV A;  1VQP A;  4IOC A;  1PA6 A;  3DXJ C;  5IT9 E;  1R4Q B;  5D3I B;  3KF8 B;  3R2T A;  3NPP A;  1PFM A;  5I6W A;  4JVZ A;  3TS0 A;  1I50 B;  3RN5 A;  1HRJ A;  1EQV A;  2M9V A;  2L9H A;  4RKB A;  1VF5 C;  4BBS H;  3HOX G;  2PNH A;  2V4D A;  5CMD A;  5C5M A;  3IAY A;  5JJL A;  3JAM i;  3K7U C;  1A2U A;  3L7Z C;  3Q24 A;  5GAE C;  1PFN A;  1Z9F A;  4I65 A;  4DAV A;  1NAP A;  2B63 B;  1I4H A;  5FO7 B;  1H9S B;  4NP5 A;  2IT1 A;  5I2Y A;  5C0X H;  1X3F A; 
#chains in the Genus database with same CATH homology
 5C3E B;  2WAQ B;  1E2W A;  4X3K A;  1HXY D;  1MD2 D;  4AYB B;  1K8O A;  2NZ1 D;  1TKW B;  1EU4 A;  4KKU A;  4NW2 A;  3OIP A;  3PIO 3;  3BVM A;  3PO3 B;  2H4O A;  1F9Q A;  4FF3 A;  5K36 G;  2B2W C;  1Y8O B;  1DXM A;  4WRD A;  3TZD A;  3HOX B;  1EY8 A;  1ENF A;  3TP5 A;  1EEF D;  2C5C A;  4OIJ A;  1LAB A;  1H9K A;  2B2U C;  2WII B;  3DWA A;  1LTI D;  4IFD H;  3A54 A;  3VYS A;  3OPO A;  4XYQ A;  2B2V A;  4C56 C;  5JVG 3;  5E4W C;  3DM1 A;  3VYT A;  4MIU A;  1PTO D;  1FNV A;  2DNE A;  4Q0F A;  1I4Q A;  2KCC A;  1EY6 A;  4XQQ A;  2K33 A;  2PNR C;  2MJ8 A;  2HCC A;  4A3J B;  3RD4 A;  5CV4 A;  1ILP A;  5FOB B;  3DUZ A;  3ND8 A;  1STB A;  3LWE A;  3NUC A;  5JEA H;  2OEO A;  3NHH A;  1QOH A;  3BYY B;  4RAU C;  1TT2 A;  1PRT F;  1HPC A;  4O1N A;  1KDC A;  3HOV B;  1STE A;  1QWY A;  3H94 A;  5A35 A;  5C0X G;  4IQZ A;  2JEA I;  2B2T C;  4TRD A;  2CHB D;  4DK1 A;  4BBR B;  4KN4 C;  1NUC A;  3AB9 A;  3MWY W;  3K59 A;  3S14 B;  3G6J B;  4RWS C;  2M2L A;  1EQT A;  3S1Q B;  1EY4 A;  1PRT C;  5IGG A;  4DK0 A;  1Y8N B;  1GOZ A;  4U67 3;  1TS2 A;  1RTN A;  4R8I A;  5C4Z A;  1QNK A;  4HTH A;  2KA7 A;  5I2X A;  1HTL D;  1H9J A;  1TWC B;  5KGU A;  1UUP A;  2FHT A;  2A69 C;  2A68 D;  3P7J A;  1HCZ A;  2NTS A;  4KI0 A;  3GTP B;  3M7N A;  1FGB D;  2K04 A;  1RD9 D;  1HHV A;  3HRZ C;  2L5T A;  4KN7 C;  1EYC A;  4NKL A;  3FEW X;  2IW3 A;  1SE3 A;  2O5I C;  2XVS A;  4K6L A;  2B2Y C;  2OF1 A;  4TKO B;  4Z9C B;  2IPK D;  4IFD J;  2DN8 A;  3HOW B;  3EFX D;  1C8C A;  2LMC B;  1STG A;  3C46 A;  5JAV A;  1GJX A;  5E3F A;  4RGO S;  1U4L A;  1SYF A;  5T1G A;  4FO2 A;  4OL7 A;  1LTT D;  2AWO A;  2HCI A;  1JR0 D;  4DXF A;  4CBV A;  4QB4 A;  5KRU A;  1B4O A;  1G8Z D;  4G57 A;  5CBA E;  3I4N B;  2F0K A;  3D8G A;  5JEA J;  3ERO A;  1C4Q A;  3IL8 A;  1B1Z A;  2WAC A;  4KHZ A;  2NN6 I;  2YU9 B;  1PYW D;  2SOB A;  1Y1W B;  3HOZ B;  3P20 A;  2K03 A;  4BWG B;  5KEE A;  4K5V A;  1KNE A;  4CGY B;  3VA7 A;  3A7L A;  2NVQ B;  2SNM A;  4HCE A;  4QUF A;  2Z8L A;  2KHS A;  4ILW A;  2SDF A;  3Q0A A;  2IX3 A;  2KJX A;  3DHQ A;  3P75 A;  5FK9 C;  1QIL A;  3H3V C;  3NXW A;  1I4R A;  4IUR A;  3NTI A;  1FR3 A;  5CV8 A;  1PRT B;  3Q22 A;  3T4A C;  4XQJ A;  3MFG A;  3SHL A;  3C1E A;  4G4K A;  1JOO A;  1GUN A;  2QCP X;  5CV5 A;  2MPM A;  2PW7 A;  4C3I G;  1WTQ A;  5KIX A;  2EYO A;  5C4X B;  4DN4 M;  1V8Q A;  2XN9 C;  4IAL A;  2F0G A;  3VR5 A;  3SK8 A;  3H0G B;  5EPJ A;  1O7Z A;  2KUM A;  3DEP A;  4F7X A;  3HKZ B;  2XRS D;  1IYU A;  1TY0 A;  2JA5 B;  2EZV A;  3K0Y A;  5C44 B;  4FXG C;  2IJ0 A;  2Z4I A;  2J7Z A;  3SVM A;  2K5W A;  4FXK C;  2BDO A;  3QB3 A;  2PO4 A;  5COR A;  4B9X A;  4G7H C;  3U9O A;  5EGT A;  4UDU C;  1LT6 D;  5I6Y A;  2PQE A;  3NQI A;  1WTV A;  1J9O A;  3KK7 A;  3VR3 A;  3KBX A;  4HN7 A;  4K8J A;  1TS3 A;  4F8M A;  5M3F B;  2L55 A;  4TSS A;  1XTC D;  3GTO B;  1GUS A;  2K1B A;  1TWH B;  3BDL A;  2J4X A;  2ICE C;  1D1K A;  3T56 B;  5K5P A;  1PZJ D;  5KYI A;  3URY A;  5A2Q L;  1KNA A;  4C3H G;  2F3V A;  1LTG D;  4FF1 A;  1B44 D;  3OMG A;  3GTQ B;  5JOB A;  3S16 B;  5G3L F;  3KLR A;  5BN4 A;  3R93 A;  1WTP A;  4X3S A;  2R3Z A;  1KDA A;  2Q8I B;  2MP1 A;  3RUZ A;  1DJR D;  3RMH A;  5E4X A;  1ENA A;  2D9U A;  1E2Z A;  3K5M A;  3NK9 A;  1D6E C;  4HED A;  5IOD A;  2R93 B;  3NBH A;  4A3I B;  1QCB D;  3VR2 A;  1IHZ A;  5JVH 3;  1EYD A;  2WKC A;  5BN5 A;  2X6G A;  5KND A;  3GTK B;  1EEI D;  4PMW A;  4FVM A;  2WP8 J;  5KYL A;  5ISR A;  1MBY A;  1O7Y A;  3HEJ A;  4DNT B;  4PNY A;  2NVT B;  1QE6 A;  1Q1E A;  1TQO A;  1E2V A;  5C4J B;  1VDZ A;  2I07 B;  3PUZ A;  2PZT A;  4S3S A;  1ZKO A;  1PTO C;  5EJW A;  3AU7 A;  1DZ1 A;  3A7A B;  1TU2 B;  4ZUJ A;  1Y69 U;  1AEX A;  2F0Q A;  1GUO A;  3TP6 A;  2WB1 B;  3MXN A;  4MN3 A;  4U68 A;  1LTA D;  4CJ1 B;  1EFI D;  4HCS A;  2JE6 I;  2OT2 A;  1XYI A;  1QNU A;  4ZAI A;  3BYT B;  4RA8 A;  1U4R A;  3I4L A;  1CZG A;  1WD1 A;  3D4D A;  2E2J B;  2L1B A;  4DF7 A;  3TDQ A;  1I6H B;  4G7Z C;  2B8G A;  2F0P A;  2JXM B;  1LT4 D;  3TBI B;  3RLF A;  2Z1C A;  2CQA A;  5JPM C;  2PPB C;  4A3G B;  3MZ5 A;  4ZQ3 A;  1TVX A;  2IWH A;  1SNO A;  4R8N A;  3IFD A;  1D5Z C;  2RBM A;  4J6H A;  2XWJ B;  3VR6 A;  1WTR A;  3ND9 A;  4OO1 G;  4OHJ A;  1TY2 A;  2Y0S B;  3PV0 A;  4I7Z C;  3SXH A;  4X3U A;  4H44 C;  1TS5 A;  3HP3 A;  1CT1 D;  5C0X I;  3MC0 B;  4KY6 A;  4BS9 A;  3H6M A;  4ME5 A;  1JOQ A;  1GHJ A;  5EBC A;  5F2D A;  2A6E D;  2NVX B;  1KAB A;  2A68 C;  2QF7 A;  3I73 A;  1RTO A;  1I6V C;  3TZU A;  1WVL A;  2RQX A;  3KF8 A;  2HDM A;  1LLR D;  2LKV A;  2VXW A;  2BA1 A;  5EQ0 A;  1LV9 A;  3HGB A;  3V96 A;  1KLU D;  2SNS A;  1ZEQ X;  2K5D A;  2KEC A;  4XDX A;  2EE1 A;  1SNM A;  2EJM A;  3AMU A;  3QIA A;  4K6D A;  4ZKC B;  2XWB B;  1DCZ A;  1H9S A;  1D5X C;  2AQ1 B;  1HA5 A;  1B53 A;  2I46 A;  4IUN A;  2PMZ B;  2HQE A;  1CHQ D;  3GTM B;  1ESF A;  3OWE B;  2MHV A;  3NSW A;  1LTS D;  5HUR A;  4RGN A;  3R3O A;  4M1U B;  4GZY C;  1S5C D;  5J1Z A;  1TR5 A;  1BCP F;  1OXS C;  4C2M B;  3BVG A;  2JEB I;  2ZXO A;  2F03 A;  3X3N A;  1SJH D;  5C4H A;  3PUW A;  1SND A;  2EYM A;  5IOC A;  3FRP B;  5ELD A;  2ZXP A;  1V1P B;  1SNP A;  1JWU D;  4CHT B;  1B2T A;  3K58 A;  5DM6 3;  1JC7 A;  2EOT A;  1BCP C;  5M9O A;  4RCO A;  1SNQ A;  2AWN A;  1HA6 A;  2NWG A;  1STN A;  1Z47 A;  1ZXT A;  2F0L A;  5I9P A;  2F3W A;  3GV6 A;  1SMY C;  1Q90 A;  2Q8R E;  2EY5 A;  2R7Z B;  1VMC A;  5I9O A;  2F1M A;  3LWU A;  1CK1 A;  2F0I A;  1EIG A;  4RHR A;  4RGT A;  4XTC S;  3R8B A;  2B8F A;  4PV1 C;  4CJ0 B;  4UAI A;  1Q12 A;  4IFD G;  1BOS A;  2BOS A;  2FMC A;  2M00 A;  3KUP A;  1Z7T A;  3S1R B;  3W3A A;  3A8K E;  2FFK B;  2NB0 A;  2E74 C;  4A3B B;  4XT1 B;  3K7A B;  5T1I A;  2L4N A;  5IGF A;  1DOM A;  3GO5 A;  1AZP A;  3PUV A;  1HFN A;  2PZW A;  2F0O A;  5IGC A;  2F0D A;  2KEE A;  3WOF A;  3GQB A;  2PW5 A;  1BBX C;  3OIQ A;  3DWQ A;  1O78 A;  2EJG C;  4ZLT F;  3NP8 A;  5JEA G;  3D31 A;  2AQ2 B;  3J7Y W;  2DNC A;  2Q8T A;  1EU3 A;  1WCM B;  3VYR A;  4XT3 B;  1VF7 A;  2EPB A;  3BVZ A;  4H7B A;  3GP7 A;  2IL8 A;  4ZK9 B;  3F2U A;  4LK1 C;  4C3J G;  5A2Q E;  2O4X A;  4A3F B;  1WTW A;  4C1N I;  2CW0 D;  1IW7 C;  1GXD C;  1M8A A;  1DON A;  4TQU S;  1PZK D;  1DOL A;  2B2W A;  3SK5 A;  3NTK A;  5C3X A;  1G2T A;  1Y8P B;  5FLX L;  3M3Y B;  3BDO A;  3QOL A;  1A3T A;  4IUV A;  3HG9 A;  4G7O C;  2WIN B;  4EGV A;  5ELF A;  5NUC A;  1D2B A;  3I91 A;  3PIP 3;  5FKA C;  1PDQ A;  1W6K A;  5IGE A;  1STH A;  2SEB D;  1GUG A;  2VNU D;  2B2U A;  1YNN D;  3OHX C;  4KJO A;  4DXG A;  3P1H A;  3ITP A;  1SNC A;  4BY1 B;  1LTR D;  5C3W A;  1RJT A;  1RCV D;  2QKI C;  4NMZ A;  1BCP B;  1A6X A;  3NTH A;  1AN8 A;  4HMJ A;  1K8M A;  4K5W A;  2OXP A;  3O13 A;  2JSO A;  1TS4 A;  5CV9 A;  2C9O A;  4L63 B;  2IX1 A;  1ML0 D;  1ZYR C;  2WV6 D;  5J22 A;  1TWF B;  4YIJ A;  4EQO A;  1CHP D;  3IKJ A;  3CHB D;  1PRT D;  4EQN A;  1EY5 A;  4E6I A;  1EOT A;  1X3P A;  5LL6 S;  4B9W A;  1EY0 A;  5TSS A;  4FYD A;  3MXG A;  1R4P B;  2X69 A;  1KAA A;  5C6A A;  4R9W A;  1AP0 A;  2QEJ C;  2KED A;  1DD2 A;  2B2T A;  1J8I A;  2EDG A;  3M85 A;  3ONA B;  2JA7 B;  4ABN A;  1S5E D;  1I3Q B;  2NUC A;  2QDB A;  2QIL A;  1RDP D;  1ET6 A;  1SXT A;  4DAY A;  3Q6S A;  5EBD A;  1QG7 A;  3MAQ A;  3K5N A;  3FKI B;  4QIW B;  3TP7 A;  5I4D A;  3FPP A;  4QCL A;  2X6L A;  4C3I B;  1WTO A;  1STY A;  4L8J A;  2RDH A;  3L9A X;  3TN2 A;  3VA5 A;  1O7L A;  2F0J A;  2JA8 B;  3V2T A;  1S5D D;  3WDN A;  2BA0 A;  3X3M A;  1GHK A;  3EQL C;  3TP8 A;  2XNA C;  1MI2 A;  1STA A;  3DMU A;  1D5M C;  1AFP A;  1EYA A;  5CR3 A;  2B2V C;  2L11 A;  4K2L A;  2A6E C;  2E76 C;  4MHE A;  3GTG B;  1BXT A;  1IKL A;  5M5Y B;  3RZD B;  2B2Y A;  3QG1 A;  4KJN A;  3FPU B;  3H09 A;  4LMQ D;  2RSO A;  5CGK A;  5CBE E;  1PTO F;  1KDB A;  1O80 A;  1OXV A;  4DGZ A;  4OO1 I;  3GTL B;  4X3T A;  2E2D C;  1JWM D;  2RSN A;  2K01 A;  5IIF A;  2BE5 D;  2GA4 B;  1E0B A;  1UAP A;  3SK4 A;  3MVV A;  3S2D B;  4IUQ A;  4DAP A;  3D6C A;  4C3H B;  4C1N K;  1G2S A;  3D4W A;  5EKL A;  3H91 A;  3J81 L;  1B3A A;  4ZKB B;  4XQN A;  5KNC A;  2ZXR A;  3GTJ B;  1F9P A;  1SE4 A;  2F0V A;  3QO2 A;  5DEH A;  5CC4 A;  2EY1 A;  1YNJ D;  4ID6 A;  4IUU A;  1AW7 A;  4V19 0;  2EY6 A;  2LFN A;  2KCN A;  4J1M A;  2LY7 A;  1MGS A;  2KVM A;  1SYC A;  1A3V A;  3CU7 A;  2BDN A;  4KY7 A;  3SK6 A;  2R92 B;  5DAU A;  1EWC A;  4K2K A;  4IUP A;  2H1E A;  2EJF C;  1SYB A;  5FO9 B;  1XX8 A;  5EPK A;  5ELE A;  1RF2 D;  2LS0 1;  5C5L A;  4HR7 B;  3I70 A;  5ELC A;  1SYG A;  5DNF A;  1TII D;  5M5W B;  3A8I E;  1W6J A;  2BCO A;  4WJW A;  2FIN B;  3ERQ A;  4J8Q A;  4BA2 I;  1T5E A;  3M7G A;  1F2L A;  2RA4 A;  1DOK A;  2XRQ D;  1CQV A;  4H0L C;  1NSN S;  4K5X A;  3LNN A;  5DM7 3;  4KMU C;  3QJY A;  1F9S A;  4XXE A;  1Q8I A;  4F87 A;  2A6H D;  4P2C B;  1SE2 A;  2NBF A;  2N88 A;  3OWF A;  2AQ3 B;  3LX0 A;  3SR1 A;  1WTX A;  3MFY A;  1CTM A;  3FVQ A;  1ILQ A;  4OGQ C;  1OO9 B;  4WFN 3;  1S5B D;  1D1I A;  4KV6 A;  2EYF A;  4KHV A;  3JAM L;  1SJE D;  3MTS A;  3K57 A;  3S1N B;  1SYD A;  1VCI A;  4CKB A;  1BUV T;  4HMI A;  2R61 A;  2XIW A;  3N52 A;  3Q23 A;  1XWE A;  1S4Z A;  3BG3 A;  3R2I A;  4LJZ C;  1DM0 B;  3L3O C;  1M4V A;  1QB5 D;  3OOC A;  1ESR A;  1RHP A;  5M3M B;  4HSV A;  4XYO A;  5EKK A;  1JB3 A;  1ENC A;  4IFD I;  1PMR A;  3J7A F;  1GUW A;  5G3L D;  1EZ8 A;  1PTO B;  3VR4 A;  1L0X B;  1SFO B;  1SSO A;  2IX0 A;  1F2Y A;  1X32 A;  1NCV A;  2AUK A;  3MXU A;  2JP1 A;  4JK1 C;  1HUM A;  1GUT A;  1HFG A;  2Z4H A;  3HOU B;  2CW0 C;  2ID0 A;  2DY7 A;  2TMP A;  1HUN A;  3DWP A;  1CA5 A;  2MGS A;  3IFT A;  4RHS A;  5COY A;  1U4M A;  5FLX E;  1F2Z A;  1PLF A;  2RDG A;  3CKI B;  1X3Q A;  3D4R A;  3M4O B;  5HGT A;  3TME A;  1II3 A;  4OIK A;  1VMP A;  5KNB A;  3NWT A;  1Q3L A;  3SDZ A;  3DEO A;  4PMB A;  1HQM C;  1TWA B;  2K32 A;  4ZYS A;  1YNN C;  2EVB A;  2HUG A;  2D62 A;  4HAE A;  5FO8 B;  3UI2 A;  4PMC A;  4KY5 A;  5IT9 L;  1JQY D;  2MUY A;  3E6Z X;  4RKL A;  1CA6 A;  1I4X A;  1CQF A;  4PQX A;  2F0T A;  4K8I A;  1A3U A;  2RVL A;  2FJ2 A;  2DY8 A;  3K5L A;  4BA1 I;  4QMG A;  2EXZ A;  2NVY B;  4BBS B;  4KTA A;  2O2L D;  1IL8 A;  4BY7 B;  1U4P A;  5BN3 A;  3EJI A;  2F0W A;  2JA6 B;  4IUT A;  1QJO A;  5D14 A;  1HQR D;  3MEH A;  3M4Y A;  5C0X J;  5ELB A;  1JIC A;  2ENB A;  1I4P A;  4CKE A;  2K28 A;  2WKD A;  3SE0 A;  1B9N A;  2N55 A;  4L6T B;  1JE4 A;  4CJ2 C;  3E5S A;  2A73 B;  4O42 A;  4ODG A;  2G9D A;  1MSG A;  1SAP A;  5M5X B;  1Y1V B;  1EL0 A;  1B9M A;  1NR2 A;  1V1P A;  4ZUI A;  3MXP A;  4A3D B;  2EYL A;  2L0C A;  2A74 C;  3D3R A;  2ZT9 C;  1B50 A;  2E75 C;  2HDL A;  2EYH A;  4FNF A;  1V1O A;  2A5H A;  1H9R A;  5LL6 X;  1XXG A;  4IZ8 A;  3S2H B;  2E2I B;  3G7L A;  2XSC A;  2O5J C;  2F0E A;  2KOL A;  1A2T A;  2F0S A;  3T51 B;  3A8J E;  1JOR A;  2KQ3 A;  4RFB A;  2FMM A;  4RCN A;  1ET9 A;  2RKS A;  1OXX K;  4HSP A;  1CI3 M;  1TWG B;  1OXU A;  1EY9 A;  4DNR B;  1G6Z A;  3OSO A;  2F0F A;  1JWS D;  2PYK A;  3I8Z A;  4RGM A;  3EA6 A;  5LHY 1;  3VYU A;  4H13 C;  5IGD A;  1R9T B;  3NE5 B;  3SEB A;  1UEA B;  2NN6 H;  1PZI D;  1LO5 D;  1WD0 A;  1BNZ A;  3RZO B;  3I4M B;  1CZW A;  2D5D A;  3NQT A;  2F4I A;  2R6G A;  5E1F A;  3V05 A;  1BR9 A;  3FMC A;  3J7A V;  2BE5 C;  1U9R A;  5D65 A;  3QOJ A;  2AUJ D;  2E2H B;  3PMF A;  3D6W A;  3K5O A;  3GD7 A;  3FDT A;  2K5Q A;  2NTT A;  4DU9 A;  2JYO A;  4C3J B;  1SBB B;  4KKS A;  3I3C A;  4M8A A;  2CVR A;  2YYZ A;  3QWN A;  4EQP A;  1KTK A;  4FF4 A;  3J81 E;  2EYJ A;  1BCP D;  1EWH A;  5CYU A;  2K6A A;  1BDO A;  1PXU A;  3I72 A;  2RDF A;  3PO2 B;  2PZU A;  3J80 E;  4ULL A;  1JOK A;  1FYC A;  1Z6H A;  1SMY D;  1YNJ C;  2L12 A;  1F9R A;  4KKT A;  3CQZ B;  3T53 B;  4EVO A;  2EYP A;  1ONL A;  2NYZ D;  4CKC A;  3T16 A;  4KD4 A;  1AZQ A;  4FP5 D;  3NBI A;  5D3D A;  1K83 B;  1NR4 A;  5CV7 A;  1OXT A;  2A69 D;  4DA2 A;  2B39 A;  1LT3 D;  3S9W A;  2PCF B;  1CFM A;  3KBG A;  5AFW A;  1FNW A;  3A56 A;  3CRL C;  3C3L A;  1RKN A;  4KD3 A;  4A3K B;  3HOY B;  4FF2 A;  1SEB D;  5IGB A;  1BQQ T;  3ZYY X;  1EY7 A;  1PFB A;  2NN6 G;  2EY2 A;  2VUM B;  1BF4 A;  1T5X D;  3KLS X;  3NWS A;  5J39 A;  4B08 A;  1CM9 A;  3MHB A;  3T13 A;  4LAA A;  1KLG D;  1LT5 D;  3I90 A;  1C48 A;  4FXD A;  2A6H C;  5CV6 A;  1BO0 A;  3CRK C;  4NDX A;  3MA2 B;  1Q1B A;  4QUC A;  4A93 B;  1SDF A;  2J0T D;  2VB3 X;  2ICI A;  1JCK B;  2G9H D;  3JAM E;  3EVQ A;  1IW7 D;  4F88 A;  3BDC A;  3OW7 A;  2F0N A;  1G29 1;  1ICW A;  1LTB D;  3S1M B;  1S5F D;  4Q5V A;  5EPL A;  3GV3 A;  1FD7 D;  3E0J A;  2F0H A;  3PUX A;  1LAC A;  3HS0 C;  1FNU A;  1SYE A;  1A15 A;  4K14 A;  4Y7N B;  1MSH A;  4OO1 H;  2D2C C;  2F0U A;  3HZX A;  2VB2 X;  1I4G A;  4RH6 A;  1PTO H;  1G91 A;  4KK7 A;  4WOR A;  1UNS A;  4XIG S;  3BS1 A;  3TSS A;  3W2D A;  4N9P A;  4A3M B;  4QF4 A;  1EZ6 A;  3U9S A;  4DFA A;  3J80 L;  1EIH A;  3N6R A;  3S17 B;  5EKI A;  1F2M A;  5K36 H;  1HTP A;  4ZRZ A;  1ZYR D;  1V43 A;  3PUY A;  2K7V A;  1IKM A;  3S15 B;  3C1F A;  5JPN C;  1H9M A;  4A3E B;  1F77 A;  3OMC A;  2TSS A;  1DYQ A;  3KLS A;  3BZD B;  4N9T A;  3K6O A;  5JJZ A;  4V0B A;  3C2P A;  1L0Y B;  2F0M A;  1ROD A;  3A55 A;  2K05 A;  4IN3 A;  3WOE A;  4JBW A;  1IYV A;  3DXJ C;  5IT9 E;  1R4Q B;  5D3I B;  3R2T A;  3NPP A;  1PFM A;  5I6W A;  1I50 B;  1HRJ A;  1EQV A;  2M9V A;  2L9H A;  4RKB A;  1VF5 C;  2V4D A;  5CMD A;  5C5M A;  3IAY A;  1A2U A;  3L7Z C;  3Q24 A;  1PFN A;  4I65 A;  4DAV A;  1NAP A;  2B63 B;  1I4H A;  5FO7 B;  1H9S B;  4NP5 A;  2IT1 A;  5I2Y A;  5C0X H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...