1B50A

Nmr structure of human mip-1a d26a, 10 structures
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
69
structure length
69
Chain Sequence
b'SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIP-1A
molecule tags Chemokine
source organism Homo sapiens
publication title Identification of amino acid residues critical for aggregation of human CC chemokines macrophage inflammatory protein (MIP)-1alpha, MIP-1beta, and RANTES. Characterization of active disaggregated chemokine variants.
pubmed doi rcsb
total genus 3
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b50A00
1HUMA 2H1EA 1BO0A 4MN3A 1X3PA 3G7LA 4RA8A 1CA5A 5E4XA 1Q3LA 2HCCA 3TZDA 5CBAE 2Q8TA 3FDTA 4IUVA 3TN2A 1BF4A 2HDMA 1CM9A 3I3CA 2CVRA 4OIKA 2L9HA 4IUUA 1EIHA 2FJ2A 3KBXA 5CORA 1RTOA 1PDQA 1CA6A 1J8IA 5T1GA 2MPMA 4R9WA 1X3QA 1F9QA 2JYOA 1B53A 2MGSA 3F2UA 3ONAB 3N52A 1RHPA 4QUCA 3UI2A 1DOLA 2K28A 3HP3A 4CJ1B 5T1IA 2KOLA 4X3SA 4CJ0B 1B50A 4RWSC 1SDFA 4OIJA 5EQ0A 1MSGA 1ML0D 1B3AA 1AP0A 1PLFA 2RSOA 4ZAIA 4HCSA 1F9PA 3SVMA 1RODA 2NYZD 1AZPA 5E4WC 1G6ZA 1ILQA 4U68A 1QE6A 1VMPA 3I8ZA 4DN4M 4ZKCB 1J9OA 5EPLA 5CMDA 2IL8A 3H91A 3IL8A 5CBEE 1MI2A 1M8AA 1RJTA 2K1BA 2JP1A 1HRJA 3LWEA 1MSHA 2RA4A 5AFWA 4CJ2C 4MHEA 1LV9A 4LMQD 3MTSA 4NW2A 1HUNA 1WD0A 2B2VC 5D14A 1WTPA 1U4LA 2KEDA 2HDLA 1B2TA 2RSNA 3I90A 2EE1A 2B2UA 3R93A 5EPKA 1DONA 1EOTA 1WTRA 2X6GA 3P7JA 1WTQA 1F9SA 2B2YA 5JJZA 1WVLA 1ESRA 2EOTA 1WTOA 1HFGA 2B2TC 1U4RA 2B2WA 2J7ZA 2L4NA 3MWYW 2DY7A 2XIWA 1PFMA 1O7ZA 2KVMA 3GV6A 2EPBA 2K01A 4QUFA 1G91A 1EL0A 3QO2A 1NCVA 2KECA 1S4ZA 2L12A 4RAUC 1F2LA 5EKIA 1WTVA 1IKLA 4ZKBB 3D6WA 2B2WC 1XYIA 3DM1A 1ILPA 1QNKA 2KEEA 1ICWA 2B2YC 1SSOA 4IUQA 1JICA 2D9UA 1HHVA 1WTXA 1O80A 1U4PA 1VMCA 1XX8A 2K04A 1QG7A 4IURA 2L1BA 1G2TA 4O42A 1JE4A 2BDNA 4R8IA 2NWGA 2HUGA 2MP1A 5COYA 1MGSA 2B2TA 2B2VA 1EIGA 1NAPA 2MJ8A 3IFDA 1F9RA 4X3KA 5EPJA 4ZLTF 1WTWA 1WD1A 1KNAA 1B4OA 2FFKB 2SDFA 2FMMA 1KNEA 1U4MA 1DOMA 5DNFA 2L11A 1G2SA 2K03A 3I91A 2B2UC 1ZXTA 3FPUB 4X3TA 4XDXA 2KUMA 1SAPA 5D65A 1IL8A 2FINB 2VXWA 1BNZA 1GUWA 1PFBA 2X69A 4UAIA 1C8CA 1IKMA 3DEPA 2RVLA 5EJWA 4X3UA 4IUPA 4HEDA 1RTNA 1NR4A 2FHTA 2M2LA 2K05A 2DY8A 3KUPA 1BBXC 1EQTA 3GV3A 2NZ1D 4XT3B 1A15A 2Q8RE 4IUTA 1HFNA 4HSVA 1NR2A 2R3ZA 1E0BA 1DOKA 1X32A 4HAEA 4XT1B 1AZQA 1HA6A 3DEOA 2HCIA 1O7YA 2N88A 1DZ1A 3Q6SA 1PFNA 2N55A 2X6LA 1TVXA 4ZK9B
chains in the Genus database with same CATH superfamily
4NXMQ 3QWNA 2UXCQ 2R92H 5ELEA 3HOZH 3QIAA 1PTOD 3RZDH 1VF5C 4F7XA 1YI2A 3V2TA 1KTKA 1S5BD 4RG1A 5BN4A 4XTCS 1AH9A 4O2DA 2F0NA 1AW7A 2MPMA 2K5QA 1QUQA 2F0KA 4QUCA 3ND9A 4C3HG 4CJ0B 2JE6I 1B3AA 1GUSA 4YIJA 3VYRA 4KLKA 3WDNA 4HMIA 4ILWA 3TDQA 1VQOA 1TWGH 1JB7A 2I46A 3QOLA 2R93H 3GTPH 2Q8IB 2K6AA 4YCVA 2NZOA 2SEBD 3HG9A 1WTHA 1HUNA 2KA7A 3HOYB 3S24A 2NUCA 3A7AB 3M7NA 3M4YA 3J80E 1LTAD 1F9SA 3M4PA 5JJZA 1EEFD 1S40A 4RGNA 1F2ZA 1NCVA 3D4WA 1F2LA 1Z47A 3Q0AA 4JW0A 2NVYH 1HNZL 4DV6L 1SSOA 1Y1WG 1PHJA 1SXTA 4KHZA 3CQZH 1D5ZC 1VMCA 1XX8A 1SNQA 1LTLA 5JVG3 2MP1A 4X3KA 4DGZA 4LFAL 4JBKA 3H3VI 1PTOB 5IYBG 1G291 1JE5A 5JOBA 1BDOA 1CQFA 4JYAL 1B70B 2KUMA 4H7BA 2VB2X 4DR3L 1CSPA 2EYHA 1E22A 3MXNB 3NENA 4JI2Q 4DAMA 4C3IH 3HOVG 2RVLA 2KCTA 1AN8A 4HEDA 5M5YH 1STGA 1CKOA 3TQYA 5M3MB 4X66Q 1XXGA 3DWPA 3U9OA 2NZ1D 4POFA 1A8VA 3DLLA 1B7YB 1E0BA 1X32A 4A3BB 3D0FA 4OO1G 1O7YA 4DAYA 4PMWA 2N55A 4RMFA 4HJ8A 1X54A 3AU7A 3S16H 3HOYH 5FJ8H 4IUVA 5IGEA 3GTQH 2L9HA 3S2HH 2FJ2A 1UNSA 1FGBD 3A8KE 1PRTC 1C4QA 4C3IB 2Y0SE 2NTSA 4FNFA 3TBIB 2OXPA 4I65A 3I7FA 4LAAA 4Y52H 3F2UA 3K0YA 2O5IC 4E6IA 1W3SA 3T56B 1GVPA 2QKIC 1SDFA 1GHJA 3PUWA 4HCSA 3I70A 1C0AA 3H0GG 4B3TQ 4EX5A 3NEMA 2EY1A 4DAVA 3J81c 3J81i 3PQIA 3L0OA 3H91A 3CF5A 3J81E 1MI2A 4NXNL 1Y8NB 1TS5A 4BBRB 3EBEA 3TS0A 4OGQC 1JOOA 2R6GA 1EZ6A 2ZTCA 1VQ6A 4HTHA 5EPKA 1DONA 4KK7A 3CMAA 1JWUD 3HOVB 2K32A 4DUYQ 4JBJA 1LTRD 5K5PA 1EIFA 1YJNA 2PZTA 4A76A 4RAUC 3K8AA 4JI1Q 1X3EA 4L5SA 1PH3A 1SNOA 3KLSA 1O7LA 2LKVA 2F0QA 4R1JA 2B2YC 4C3HH 3I4MG 3M4OB 1IXRA 3DMUA 1U4PA 5ELOA 3S1NH 2EQSA 3KLRA 2DJGC 1WYDA 5CC4A 1PV4A 4LF4Q 1STBA 4CDCC 3NK9A 1WD1A 1PH9A 1B9MA 3I55A 3MC0B 3I73A 1Q8KA 5M3FG 2JA8H 3E9IA 2E2HB 2PI2A 2FINB 2A6ED 5CV4A 5IGGA 1K83H 4DR6L 2DY8A 1BBXC 5K36G 1M90C 2ZJPA 3MVVA 2JA5B 2RBMA 2F0EA 4L8JA 5M5WB 2F4VQ 2B39A 1SROA 4R4TA 3BG3A 1PZID 4N9TA 1LTGD 3G7LA 4YWMA 5C4JB 3H09A 5IGCA 5H1SE 3UDXA 2M00A 3JAMi 4JI8Q 1S72A 2Z6KA 4BXXH 5CORA 4IO9A 4DV2L 1ET9A 1F9QA 2HQLA 4DV3L 2E5LL 3ONAB 3D6CA 3T13A 4OWTB 2FXQA 5M3FH 1MSGA 2A68C 3AFPA 3NTKA 3SVMA 3M3YH 2AMCB 1HNXL 4BBSH 2NN6H 2Q2IA 3J7ZC 4P73A 1K8AC 1VS0A 4OWXB 4X64Q 1CT1D 1K8GA 4LMQD 3SDZA 2UUBQ 3LX0A 1TWFB 4DV7L 3J80c 1V8QA 4H13C 3UDFA 1K8MA 4X64L 2BH8A 2KCMA 3C2PA 3R93A 3CRKC 3K6OA 4MTKA 1WTQA 5IWAL 5BN3A 1WVLA 1BQQT 3KF8B 2B2WA 1QILA 2KVMA 2VW9A 3OW2A 3S14H 3HKZE 1LT3D 4KI0A 2PCFB 4BBRG 1OXSC 3H0GH 2QA4A 4CKEA 1OXXK 1KAAA 1IBKQ 5CGKA 1H9RA 5I9PA 3CC2A 1UWVA 1GJXA 2AQ2B 3NP8A 2BA0A 4R4CA 2CH4A 4A3KH 2BDNA 3ER0A 2B2TA 5EPJA 3KFUA 4LF7Q 3CAMA 4HJ9A 2FMMA 4OELB 1KNEA 1QWYA 1DOMA 5DNFA 3CC7A 4K0KQ 1TWAH 1EQQA 1SYDA 2I5HA 1YHQA 2QEXA 3P75A 4QQBX 1ZEQX 4PV1C 4DR4L 5M3FB 1D2BA 3O13A 1I4XA 2Z4HA 4BBSG 5ELDA 2VNUD 1I3QH 2M2LA 3MXUA 3CCLA 2MUYA 3JAME 1IBKL 1S3OA 3GTJH 4AYBB 4GKJL 2B29A 2WFWA 3QR8A 4JI8L 5CYUA 3Q6SA 4A93B 1GUOA 4ZK9B 4Q5VA 3KYHC 2NTTA 3RLOA 3VR5A 4POGA 2EYPA 3J81L 1EEID 3FDTA 2AWOA 1KAWA 1B1ZA 1K8OA 4OIKA 1HR0L 4BWGB 2PMZE 4ME5A 1UE7A 2VY3A 4JI0L 1CTMA 2QDLA 3UI2A 1B50A 4KKTA 4A3IG 2K5HA 5IP9H 1JB3A 3HRZC 5C4ZA 1ML0D 3OTOL 1NTGA 3EQLC 3Q23A 2Y0SG 1IHZA 4V190 1EWIA 4JI6L 4KHPQ 5IODA 3GP7A 3I8ZA 2C9OA 1SYGA 2K50A 5ELCA 1Q8IA 1Q86C 1VQEA 3RUZA 4DV0L 4ALPA 2OWOA 2EJFC 4B3ML 4NXNQ 1RCVD 3IKJA 1VCIA 3CXCA 1WCMB 4RGMA 4A3DG 1WD0A 2KHSA 1A2TA 2B2UA 2QF7A 3NSWA 4LF9L 2R92G 3GTLB 1EY9A 4LNQA 2EOTA 3J80i 4HSPA 5BR8Q 4RCNA 1VQJA 5FO7B 3V05A 1P8LA 2L15A 2QW7A 5C44H 4BY1H 1TWCH 4N9PA 4LF5Q 3C46A 2UXCL 2NVXB 2H4OA 5FLMG 3T4AC 3A5UA 4A3KB 2UUAQ 4R8IA 1IW7D 4UPAA 2N78A 2V1CC 3IRBA 5CR3A 1HZBA 3AB9A 3TMEA 2F0VA 3IFTA 4B3SL 1M1KC 1UE6A 1TS2A 2IX3A 2XWBB 3G6EA 4EQOA 3RZDB 1ASZA 3SR1A 1VQBA 1YHAA 3ERSX 3BVGA 3H6MA 3Q8DA 2BA1A 2N49A 2HD3A 4A3FG 1EY5A 3PIO3 4K6LA 4HIOA 4FVMA 1E2VA 1EQTA 3PO2G 1NY4A 3PGZA 4F88A 3JC66 2VQFL 3IAYA 1LO5D 2JA6G 3NWTA 2EVBA 3ND8A 1TWHH 5FO8B 5IYDH 5C44G 1NUCA 1CFMA 1HTPA 4R8NA 1Q3LA 1EY8A 4QIWB 4AH6A 3S9WA 4GN5A 5FLXc 3VR3A 3LGJA 4H0LC 2F1MA 4LFBQ 3I3CA 4JPBW 3KBXA 1SFOH 3FKIG 3WWVA 1RTOA 1PH7A 4AYBG 2PMZB 2EYJA 1B53A 2IPKD 3N52A 4EQ5A 2D0PA 4X3SA 4JBMA 1UUPA 4DV6Q 3DUZA 1I50H 5I4DA 1EWHA 1JJ2A 3MZ5A 1BKBA 1PH4A 1IYJB 2HT1A 4G57A 2AUJD 1AZPA 2PNRC 1TWHB 3D3RA 1YITA 2AHOB 2F03A 1K0SA 3GTPB 4B3RQ 1YNJC 2E2DC 1IL2A 3VA7A 1GUGA 3LWEA 1IBLQ 2UXDQ 4FF2A 3OWFA 4IFDJ 4A3LG 3E0JA 4TKOB 5I9OA 2K75A 3FHWA 1OXVA 1ESRA 1HNZQ 3RN2A 3MWYW 1O7ZA 2EPBA 1H9SB 4DV3Q 4RH6A 3QO2A 2F0TA 4C1NK 1E3PA 1WCMH 2C5CA 2D5DA 2EYFA 2A5HA 1SYBA 4G7ZC 2E5LQ 3KK7A 4RFBA 3RZOH 1PH6A 2VUMB 1BBUA 3DWAA 2ATWA 4LW1A 2BE5C 3RN5A 4CDFC 5KNCA 1VQHA 2FFKB 2EXDA 4FF1A 4K2LA 3CCRA 5G3LF 1ZXTA 4A3EB 3NWSA 1PRTB 3J80L 2ID0A 3KBGA 1XJVA 2VXWA 4MIUA 3HOXB 1CKNA 2X69A 1JOQA 1CK1A 1QUQB 1C8CA 4XXEA 1NMFA 3SK6A 1I6VC 3I4OA 3PUZA 3VR4A 3CMEA 4UY8C 4DR2L 2VL6A 2KHIA 2A1AA 4JK1C 3ULPA 1EY6A 3L7ZC 2PQAA 4MTNA 4KY7A 1Q7YC 4HAEA 5FLXL 3R2IA 4B3MQ 1PTOF 3VR2A 3EN2A 1HUMA 4C2MB 1CA5A 1I4GA 1X3PA 2WAQB 2YTVA 1HZCA 5CBAE 1SNCA 4R4OA 2NB0A 1CM9A 2HIXA 4QIWE 1O7IA 2Z4IA 1JORA 3BDCA 1K28A 4C3JB 1QVCA 5C6AA 1J8IA 1EU4A 1QVFA 2A68D 2PQAB 4C3IG 1RDPD 2K28A 4XYOA 1TWAB 2BH2A 3BVMA 4Q0FA 1LTSD 1ENFA 3CCJA 1D7QA 5C0XJ 2AUKA 1LTTD 1RODA 3KF6A 1VQNA 1Q46A 5EGTA 1SMXA 4J8QA 3OW7A 3RD4A 3I4MB 1QE6A 1VMPA 4GN4B 1YNND 2IJ0A 2XNAC 4CGYB 2K14A 5ELFA 5IE8A 4DR2Q 1N36Q 3S16B 4A3GG 4A3MH 4DR1Q 2UXBQ 2PZWA 2NN6I 1SNDA 1KDCA 4UP9A 2MNAA 1JWMD 5AFWA 5FJ8G 2K5DA 5JAVA 5GROA 1BOSA 1EYCA 3PF5A 2WIIB 3MTSA 3PV0A 5CV6A 1XNQL 1B2TA 1U4LA 2KEDA 2HDLA 3S1RH 2UUCL 2EXZA 1EOTA 5DAUA 4PG3A 4NP5A 2WB1E 2R61A 2F4IA 4L5QA 2VS1A 5GAHC 3TP8A 5HURA 1IKLA 2SOBA 4DV1L 4A3CH 2RDFA 3I72A 2D9UA 2F0OA 1MD2D 3EROA 1PH8A 2KQ3A 1E2WA 5LMNW 2JA8B 4DV2Q 4DUZQ 4KMUC 2RHQB 1TT2A 3W1BA 1U4MA 1JJGA 4B3TL 4A3DH 3DWQA 1MJCA 4KY6A 2R7FA 2NZHA 4X62L 1Q1EA 3DHQA 3L2PA 3I4NB 4XYQA 2LXKA 2MO0A 2Q2HA 1PFBA 1V43A 4GZYC 2F0FA 2PYKA 3FRPB 3CCQA 1IBMQ 5KIXA 3VYSA 1FL0A 1NR4A 3I56A 2FHTA 1YNJD 2UUCQ 4A3MG 1GHKA 3SHLA 4LFAQ 4JCVE 2JSOA 3U50C 1A15A 2GN5A 4XT1B 3HOWH 5LMUQ 3MXNA 1TS3A 1HA6A 1ENAA 4JI7L 1JC7A 5IT9L 1FJGL 1UE1A 2NBFA 5E4XA 2CFMA 3GO5A 3STBD 3GDEA 4LF8Q 2BCOA 2CQOA 4KJOA 1TU2B 4CDEC 2CVRA 3NQIA 4QCLA 3STBC 3A5ZB 5FK9C 3VYUA 3HKSA 1SRUA 3K5NA 1D1KA 2A69D 1HQMC 1S5DD 1J6QA 2A6HD 2E75C 2MGSA 1LTBD 4PZ8A 1RHPA 4ID6A 3HOZB 3NPPA 5CV5A 5I6YA 4NMZA 1AFPA 4A3FH 3S1QH 5KYLA 1KL9A 1Y1VG 3IL8A 2AWNA 3PO2H 4DR7Q 1M8AA 2Q2TA 2A6EC 2EIFA 1F2MA 2CWPA 4L5RC 4MHEA 3CCSA 4KV6A 1T5EA 3U58A 1W6JA 2JXMB 4DNRB 1VQKA 2RSNA 5FKAC 4K5XA 3KJPA 5LMNL 1STEA 2BDOA 4A3JH 1VQGA 1UEBA 3MFGA 3CCMA 2NVYB 2CKZB 5GQOA 4DAPA 3D4DA 4OHJA 2DUDA 1IZ6A 5E7NA 2WAQE 2DY7A 5F2DA 3J7AF 5M5WH 3ERQA 2OCEA 3NTIA 3U4VA 2L12A 4F87A 1W2BA 1X55A 4ZKBB 1QNKA 2RDHA 4OO1H 3S2DH 1WTXA 1O80A 1KIXA 3HKZB 5ELNA 2L1BA 3A7LA 5DM63 3M85A 1NSNS 4UP8A 1PA6A 2XRQD 2UU9Q 5DM73 4OX9Q 1P16A 4JI1L 5BN5A 1VQIA 5KNBA 4K5VA 1PH2A 3P20A 1LM0A 2ZXOA 4LF8L 4LUOA 3BU2A 5D65A 1M4VA 4I7AA 1GUWA 1YHBA 1K73C 2AQ1B 3FKIB 3X3NA 2LY7A 4FXGC 4ZRZA 4IUPA 3NBHB 1H95A 3PSIA 4JI5L 4LFCL 3KUPA 4DV7Q 2ASBA 4X66L 3PUYA 3BYYB 5C3EH 2JK8A 1N32Q 4A3GH 1TIID 2QEJC 4HIDA 3RNUA 3S17B 4LF7L 5M9OA 3CCVA 4ABNA 4LUZA 1N9WA 1XPRA 4HMJA 4NB3A 3CC4A 1RL2A 2E74C 1X56A 3NE5B 3KLSX 1QB5D 1B8AA 1IYUA 4U673 4DK3C 3JAMc 3KF8A 1Z6HA 2KOLA 5DEHA 5TSSA 3UE1A 2JA7G 3NBIA 2A74C 1CZWA 2RF4A 2DNCA 1A6XA 3F2DA 2UXDL 1CUKA 4A3GB 4CBVA 1G6ZA 1T9HA 4Z9CB 4LF6Q 4GKJQ 3K5MA 4JI2L 3NHHA 3AQQA 3S1MB 1RJTA 1EY0A 4DR1L 2UXBL 1PVOA 3RR5A 1E1TA 1PH1A 2R7ZH 1QNUA 2Z6BA 3M4QA 1WTPA 1KRTA 2VB3X 3W5OA 1F77A 1G51A 3SK8A 1YEZA 3CW2C 5CV9A 4JC0A 4CKCA 1GXDC 2L4NA 3K7UC 3VA5A 3TEHB 1GUTA 2CHBD 3EIVA 3GV6A 1N33Q 5C4HA 1EL0A 4IZ8A 4UP7A 3OHXC 4JG2A 2UU9L 3BVZA 4GNXC 1ENCA 3M7GA 4KN7C 2RCNA 4JI5Q 5IYDG 2ZXRA 5J1ZA 4IOCA 1MJEA 4A3DB 1FVIA 1VQMA 3A74A 2IX0A 2IWHA 2KCCA 1V9PA 4CKBA 5KRUA 2RKSA 2WV6D 4LFCQ 3W1GA 4GKKL 1Q81C 4P75A 5GADC 4CHTB 2ZJQA 4B3SQ 3HS0C 1L1OC 2PO4A 3HOXH 4IJHA 3PCOB 2RDGA 1DCZA 2E2IH 1I3QB 2EYOA 1H9KA 1Q12A 5EKKA 2ICIA 1LYLA 1SYEA 2K05A 2MO1A 2KENA 3AYHB 1N34Q 1KC8C 2PW5A 4DK1A 4GLAC 2R3ZA 2F3IA 1RD9D 2NVTH 5JJLA 4IPDA 1HQRD 1PFNA 4DK6C 4BY7B 1TVXA 5ISRA 3PIPA 1X9NA 1STYA 3C1EA 2HQEA 2DGYA 1SJED 3A55A 2RCFA 1PDQA 5C3WA 4WJWA 3BDLA 1NE3A 1SFOB 4CJ1B 3HP3A 5T1IA 4DV0Q 2VZAA 1LLRD 1CSQA 5KNDA 3R3OA 4LF9Q 4XQNA 1YNNC 4K6DA 1WJJA 4DXGA 1RKNA 1SBBB 3T1YQ 1J9OA 4DUYL 4JBWA 1ZKOA 5C4XH 4BBSB 2ALYB 1SE3A 1TWGB 4NW2A 1MHWC 2CCZA 3TP5A 1LACA 3G71A 2JQOA 4BA2I 1BXTA 1SYFA 1JR0D 3F8TA 5CV7A 2P5ZX 4C1NI 4LWCA 4DK0A 3S17H 1S5FD 2K52A 4O1NA 1TWFH 2EY2A 1EIYB 1WFQA 2K5NA 4XQJA 2K33A 4YY3Q 3T1HQ 5HGTA 2SNMA 3GD7A 1EFID 1EYAA 3OIPA 4A3JB 4ZUIA 3I4LA 1D5MC 1HPCA 4ME3A 3J81j 2CWAA 2CQAA 2WAQG 1N33L 1FNWA 2G9DA 3CHBD 5LMUL 1LT6D 2NWGA 3RLNA 2I0QA 1MGSA 5I2XA 4A3FB 4JI4Q 2K7VA 4L6TB 1NMGA 1XNRL 2L11A 1G2SA 4PQXA 5I6WA 4X3TA 2J0TD 5JJIA 3S1QB 3GTJB 2F52A 1JT8A 3H94A 4J6HA 1IBLL 1TS4A 2XN9C 1I6HB 1X65A 3MAQA 1DD2A 1GKHA 3B6YA 5FOBB 2N88A 3LNNA 4IUNA 3NXWA 1PH5A 1C9OA 4PNYA 4JI4L 3E0EA 2VUMH 4QJFA 3OIQA 5GAGC 5C4XG 4BY1G 5G3LD 4IFDH 5DLQE 3K81C 4ZUJA 1I4QA 5C5LA 2F3WA 4XIGS 2A69C 1KDAA 3K5LA 2B3GA 5D3DA 3EJIA 4R9WA 1KABA 4KKUA 3NUCA 1WCMG 1PYSB 5LL6S 1I50B 3F2CA 4C3JG 1PLFA 5I2YA 4GOPC 1Y8OB 1F9PA 3MEHA 1PMRA 1VF7A 3W3AA 4JYAQ 2NYZD 4IFDI 1BBWA 4PMBA 3MFYA 2D2CC 2BE5D 1FD7D 1PFSA 1TKWB 4RHSA 1HJPA 2ICEC 2ZTEA 1A2UA 1STAA 1H9JA 5K36H 1Y8PB 3KOJA 2JA8G 2D0OA 4QF4A 1Z9FA 1MSHA 3OPOA 2RA4A 3S2HB 3HGBA 2YV5A 3FMCA 4L63B 4XQQA 3HOVH 4K2KA 5M5XB 2E2IB 2YTXA 2J4XA 3T1YL 1KXLA 4NDXA 4WJ4A 1X3GA 4OX9L 4ULLA 3ZJYC 1VQAA 3I4NH 3CCUA 2IHFA 3CKIB 2PZUA 1VQ7A 2IX1A 3GTKB 1PFMA 4EGVA 2K01A 3WOEA 4FXKC 3PUVA 5EKIA 2WB1B 3MXPA 4PZ6A 3TREA 1XYIA 1LUZA 3DM1A 3MEFA 1X6OA 1JICA 3HOZG 4DF7A 4KD3A 4APVA 1YJWA 3CD6A 4O42A 3BDOA 2D62A 4O0AA 1H9SA 2R93G 2WP8J 4KY5A 4QGUA 5EAYA 1PTOH 1B4OA 1L0YB 2IT1A 2EJMA 4DXFA 1Q90A 3BZKA 1AEXA 1C7YA 4UAIA 4A3JG 2KCNA 3GTMB 4JI0Q 4JV5Q 1UAPA 4AQYQ 1VQ5A 5IIFA 2H5XA 4HR7B 3GTOH 3Q24A 1N34L 2Q8RE 4IPCA 4A4IA 4A3MB 2L0CA 4NKLA 2WKCA 1CKNB 4YWLA 5IT9c 2NN6G 1Q1BA 1PZKD 2YYZA 3NTHA 4A3KG 4QMGA 1AE3A 4RKLA 1ZYRD 2RHSB 3QOJA 1I4PA 3TZDA 2F0PA 3I4NG 2JA5G 2LMCB 4X65L 5M5YB 2NVXH 1UEAB 5IGDA 3KF6B 5EKLA 3TP6A 2I5LX 4JV5L 2E76C 4DR5Q 1KD1C 1BCPC 3A8IE 1EUJA 2DJFC 2R7DA 1XTCD 3U4ZA 1Y1WB 4A3CG 2ZM6L 1TR5A 5ELBA 1HA5A 2UUBL 4YWKA 4CDDC 1R9TB 5IGFA 4DR4Q 5IP7H 1VQDA 4P74A 2JP1A 4RCOA 3S1MH 3MHBA 1SE4A 4FP5D 3WOFA 3CCEA 4F8MA 2DNEA 4JI3L 5A35A 2XVSA 2PNHA 2B2VC 3SEBA 2EE1A 3K58A 1EFWA 2LS01 1WTRA 1VQ4A 1ONLA 3P7JA 1CI3M 3HFZB 4B9XA 1EYGA 1LT5D 4YHHQ 1XMQL 1KHIA 4LFBL 3KDFB 2QILA 1A3TA 2I07B 3JAML 5J22A 1PXUA 2IW3A 1JQYD 4KJNA 1HHVA 3TSSA 3GTQB 4FYDA 2B8GA 2F0UA 4IPHA 1QZGA 2MQHA 1G2TA 1NAPA 3IFDA 3HKZG 1GOZA 1KNAA 2TSSA 1LT4D 1S5CD 1K3BC 3ITPA 1SAPA 3SK5A 2CW0C 1L2FA 1I6HH 3D8GA 1EY4A 3KDFA 3BZDB 4KHVA 4KKSA 1IKMA 4DU9A 3TS2A 4OO1I 2BOSA 3M3YB 1RTNA 3PMFA 1STNA 4A93H 3OYYA 4G4KA 2SNSA 4JOIC 3HZXA 4IALA 4YY3L 3DEOA 4YHHL 5E3FA 1U5KA 1Y1VH 2O2LD 1SNPA 3BJUA 3SXHA 3A54A 4RA8A 3PO3B 1YNXA 4DAYB 4OEMB 1EU3A 1UE5A 4FDBA 3L3OC 3CQZB 3J7A5 3OTOQ 4L5TA 2XTIA 4I7ZC 3HOXG 3CPFA 3RZOB 1JOKA 4WFN3 1DOLA 3MA2B 1FR3A 4RWSC 2YU9H 3H3VH 3FP9A 5EBCA 1N32L 3T53B 4BBRH 3BS1A 1E1OA 1F2YA 3EFXD 3N6RA 4U68A 1KDBA 2B63H 3PO3H 3PO2B 4B08A 4LJZC 3V96A 1EY7A 3AEVA 1JCKB 2JEBI 3K7AB 1Y69U 1ASYA 1GD7A 1JWSD 1EQVA 1FNVA 4DV4Q 1SJHD 2IY5B 2Z1CA 4N8FA 3I90A 3PIOA 4J15A 1I4HA 1ZYRC 2OQKA 4JVZA 1KRSA 1YVCA 2JA5H 1HCZA 5A2QL 4LK1C 1QZHA 5IOCA 1HFGA 5D3IB 4QUFA 1BCPF 1HR0Q 1S5ED 2KECA 2F0WA 2B2WC 1ILPA 1ICFB 2VQEQ 3K59A 2Z9HA 1BVSA 3GQBA 3TP7A 2L5TA 4M1UB 4BXXG 1EQRA 1TWCB 1V1OA 3MXGA 2KJXA 2QDBA 2B2VA 1BCPB 2SDFA 1R4PB 2XGTA 2YTYA 5C4XB 5IP7G 1VQ9A 1EYDA 3GTLH 5AJ3Q 4ZQ3A 4HCEA 1IL8A 4A3BG 3A0JA 2EYLA 1D5XC 5HY6A 3ULLA 1GUNA 1FNUA 4X3UA 1I94L 4YCWA 4B3RL 1YIJA 1HH2P 1NR2A 3T16A 5C0XI 2H1EA 4K14A 4IN3A 4IPGA 3BZCA 3SK4A 3AFQA 4LF6L 2Q8TA 1BF4A 3HOWB 1V1PB 2HDMA 3SE0A 3G6JB 4GLXA 1CHQD 3H0GB 2F0DA 2JEAI 2E2JB 3GTGH 3T1HL 2JYOA 2EY6A 1Z7TA 1HXYD 4DPGA 1IBML 3CU7A 3S2DB 1AP0A 1TQOA 3DXJC 1NBWA 4AYBE 2K5WA 5JEAH 4JOIA 1ILQA 4DN4M 1V1PA 5EPLA 4FF4A 3QJYA 4V0BA 1YBYA 3GTOB 1MBYA 3HEJA 1VQCA 1LV9A 5NUCA 3TRZA 2HHHL 4OXPA 4DR3Q 2M9VA 5D14A 4JI3Q 4DUZL 1DJRD 3D31A 1PYWD 2GA4B 1BUVT 3E5SA 1K9MC 1HNWL 3EVQA 3W2DA 5CV8A 2B2YA 1B44D 3HOWG 5AJ3L 2PPBC 3GTKH 4DR5L 2XRSD 2ENBA 2N8NA 4GS3A 3PUXA 1SE8A 3D6WA 3QG1A 2E8GA 1JJCB 4A3IH 1CQVA 2NVQB 2MHVA 1DGSA 3FEWX 2JA7H 1VDZA 1CKMA 1X3FA 4IURA 1SN8A 2F0SA 4A3EH 1EIGA 4C2MH 3QB3A 1D6EC 1WTWA 1WI5A 2C35B 1B9NA 5LL6X 2K03A 5C44B 2KHJA 2F4VL 2I5MX 2F0LA 1SMYC 3OSOA 3H3VC 5M3MH 4ODGA 1BNZA 3PIP3 4NXML 4H44C 4HIKA 1N36L 4EQPA 3DEPA 4OL7A 2K4KA 1MIUA 3GV3A 2V4DA 1HFNA 3T51B 4LF4L 5J3BA 2JJQA 4X65Q 1SE2A 1AZQA 1WOCA 2AKWB 2OF1A 2LSSA 3DM3A 3H15A 2X6LA 2K1BA 4HIMA 3K0XA 2ZXPA 4LUVA 2TMPA 3OMGA 4P2CB 1PZJD 3KLWA 4MNOA 4Y7NB 4TQUS 3NBHA 4RGTA 1A63A 4BY1B 2Z8LA 4DNIA 5L37A 1ESFA 1QOHA 2A19A 1BCPD 2EYMA 3GTGB 1KQSA 3C3LA 1PTOC 4MZ9A 4TSSA 2B8FA 4R4QA 3M9BA 3NELA 4N8X1 1SLJA 4JI7Q 1L0WA 1GM5A 5EQ0A 5E1FA 3I4MH 4HJ7A 5M3MG 3RMHA 1EWCA 5E4WC 1XMQQ 2WINB 2IL8A 2XWJB 1OTCA 3OMCA 1R9TH 2R93B 4FO2A 4A3EG 1HRJA 2QCPX 2JA6H 3HOUB 4DKAC 1DXMA 4IFDG 4KD4A 2VQFQ 1RIPA 4BS9A 2WACA 2VUMG 3ULJA 1U0LA 1I94Q 3P1HA 1IYVA 2OTLA 5C0XH 2F0MA 2MFIA 2Y0SB 1MKHA 1U4RA 3A56A 4GLVB 4BY7G 2XIWA 1YJ9A 4TRDA 3K57A 3K5OA 1CHPD 1TY2A 4UDUC 4K0KL 4K8IA 2F0JA 1WTVA 2OQ0A 1LABA 3SGIA 1DM0B 1ICWA 2WB1G 4IUQA 1IW7C 2UUAL 2PQEA 1A3VA 4HJAA 4K8JA 4RHRA 1JE4A 2HUGA 5COYA 1E7ZA 2KBNA 2LFNA 2A6HC 3EA6A 3VYTA 3HOYG 5KYIA 3PO3G 1A0IA 1TXYA 4AIMA 2B2UC 3FPUB 2A73B 4XDXA 3RLFA 1XNQQ 3S15B 1R4QB 1T5XD 4QL5A 3F1ZA 3OOCA 4P72A 1JMCA 5JEAJ 1K0RA 5EJWA 3E9HA 5JEAG 2XSCA 1RF2D 2HIVA 4IJLA 1YZ6A 4ZYSA 5JPNC 3K7AH 4X62Q 1HNXQ 4H02A 1D8LA 4HJ5A 1V1QA 1NJIC 3F2BA 2EZVA 4IUTA 5EBDA 2LXJA 1II3A 4DR6Q 2HCIA 2F0GA 1HR0W 4QB4A 1J5EL 4GOPA 1LTID 4MN3A 3D4RA 2VQEL 5IWAQ 1PRTD 2GVBA 3TN2A 1AE2A 4KHPL 2E2HH 1A62A 4IUUA 1L1OB 3UDGA 3L9AX 4BY7H 1C48A 3X3MA 1STHA 1SNMA 2ZJRA 1CA6A 2G9HD 2F0HA 5IYBH 2RQXA 1OXUA 4OIJA 1Y1WH 4J1MA 4UHVA 2RSOA 4C3HB 4GOPB 1NNXA 2PI2E 4AQYL 4DA2A 5IGBA 2EY5A 4DV4L 1DYQA 2DN8A 3CRLC 1FGUA 4X6AH 3Q22A 3E3XA 2ZM6Q 1U9RA 1Q82C 2JA6B 1SMYD 5LMNQ 4R4IA 1OXTA 1GO3E 1ET6A 2NVTB 4CJ2C 2O5JC 4PMCA 1XPUA 3S1RB 2R7ZB 1HZAA 4KN4C 4FXDA 3LWUA 1PRTF 2X6GA 3UE0A 4GN3B 4FF3A 2B2TC 2J7ZA 1XMOL 1BR9A 1G91A 5GAEC 2E2JH 4NPSA 1XPOA 1XMOQ 1VQLA 3HOUG 5M5XH 1N8RC 2KEEA 5IP9G 2CH4W 2L55A 1HZ9A 3S1NB 3S14B 2K5VA 2K04A 3R8BA 1QG7A 5IYCG 5BR8L 4DFAA 4DV5Q 2MJ8A 2N3SA 2A8VA 4IQZA 4EQNA 3CP0A 3VDYA 1I5FA 2ZT9C 4IOAA 2B63G 1XWEA 3OWEB 3BYTB 4C56C 1SR3A 3I91A 5JJKA 5KEEA 2AQ3B 1QJOA 1J5EQ 3UDIA 3K80C 4WRDA 2OTJA 4JI6Q 5C3EB 5IT9E 2QGQA 1XTDA 4HSVA 1PYBA 1DOKA 4RKBA 3VR6A 5HGQA 2PW7A 4PZ7A 1BO0A 2F0IA 1OO9B 2HCCA 3G48A 2OT2A 4TVAB 2JA7B 1EIHA 2R7ZG 4A3LH 4A3IB 1KLGD 5JVH3 4DV1Q 5IYCH 2NVQH 1L0XB 1A3UA 2Z0SA 5FLXE 2Z6KC 4YCUA 5T1GA 1X3QA 5KGUA 3PF4A 4G7OC 3ZYYX 1VQPA 1HNWQ 3ICEA 1FJGQ 2O4XA 5C3XA 3J7AV 1E2ZA 3C1FA 4WORA 5FLMH 3URYA 4ZAIA 3M4OH 2FMCA 3HOUH 2EDGA 2ES2A 4GKKQ 4EVOA 4ZKCB 5IY0A 5CMDA 3R2TA 2F3VA 1HTLD 5CBEE 4A93G 2CW0D 2Q2UA 1W6KA 1K3RA 3U9SA 4A3BH 4BA1I 1I4RA 2B63B 4DNTB 1K83B 4WJ3M 3NQTA 1L1OA 1VQFA 1TY0A 1VQ8A 1D1IA 3AMUA 3FKIH 2R92B 4RGOS 1G8ZD 1KLUD 1XNRQ 1QVGA 3TZUA 4HN7A 2YU9B 2JN4A 4M8AA 5JPMC 1WTOA 1E24A 2JA9A 5LHY1 5C3EG 1H9MA 4C3JH 2OEOA 4LF5L 1B3QA 4Y7NH 1S4ZA 3G4SA 2G5DA 3FVQA 1Y14B 2HHHQ 4GNXA 2IHEA 1QCBD 2WKDA 4ZLTF 4OWWB 1F9RA 1EOVA 4OONA 5C5MA 4P71A 3GTMH 1SEBD 5J39A 3KJOA 5FO9B 4QY7A 3FPPA 2EJGC 1CZGA 4KTAA 4DV5L 5C0XG 1SYCA 4S3SA 4GNXB 4ZCKA 3E6ZX 4A75A 3CPWA 3S15H 3A8JE 4B9WA 2ZTDA 4XT3B 1FYCA 5C4JH 3J7YW 4K5WA 4G7HC 2GVAA 3I2ZA 1O78A 5A2QE 1G6PA 1Y1VB 1DZ1A 1EZ8A 4DR7L
chains in the Genus database with same CATH topology
3QWNA 5ELEA 3QIAA 1PTOD 1VF5C 4F7XA 3V2TA 1KTKA 1S5BD 5BN4A 4XTCS 2F0NA 1AW7A 2MPMA 2K5QA 2F0KA 4QUCA 3ND9A 4C3HG 4CJ0B 2JE6I 1B3AA 1GUSA 4YIJA 3VYRA 3WDNA 4HMIA 4ILWA 3TDQA 2I46A 3QOLA 2Q8IB 2K6AA 2SEBD 3HG9A 1HUNA 2KA7A 3HOYB 2NUCA 3A7AB 3M7NA 3M4YA 3J80E 1LTAD 1F9SA 5JJZA 1EEFD 4RGNA 1F2ZA 1NCVA 3D4WA 1F2LA 1Z47A 3Q0AA 1SSOA 1SXTA 4KHZA 1D5ZC 1VMCA 1XX8A 1SNQA 5JVG3 2MP1A 4X3KA 4DGZA 1PTOB 1G291 5JOBA 1BDOA 1CQFA 2KUMA 4H7BA 2VB2X 2EYHA 2RVLA 1AN8A 4HEDA 1STGA 5M3MB 1XXGA 3DWPA 3U9OA 2NZ1D 1E0BA 1X32A 4A3BB 4OO1G 1O7YA 4DAYA 4PMWA 2N55A 3AU7A 4IUVA 5IGEA 2L9HA 2FJ2A 1UNSA 1FGBD 3A8KE 1PRTC 1C4QA 4C3IB 2NTSA 4FNFA 3TBIB 2OXPA 4I65A 4LAAA 3F2UA 3K0YA 2O5IC 4E6IA 3T56B 2QKIC 1SDFA 1GHJA 3PUWA 4HCSA 3I70A 2EY1A 4DAVA 3H91A 3J81E 1MI2A 1Y8NB 1TS5A 4BBRB 4OGQC 1JOOA 2R6GA 1EZ6A 4HTHA 5EPKA 1DONA 4KK7A 3HOVB 1JWUD 2K32A 1LTRD 5K5PA 2PZTA 4RAUC 1SNOA 3KLSA 1O7LA 2LKVA 2F0QA 2B2YC 3M4OB 3DMUA 1U4PA 3KLRA 5CC4A 1STBA 3NK9A 1WD1A 1B9MA 3MC0B 3I73A 2E2HB 2FINB 2A6ED 5CV4A 5IGGA 2DY8A 1BBXC 5K36G 2JA5B 3MVVA 2RBMA 2F0EA 4L8JA 5M5WB 2B39A 3BG3A 1PZID 4N9TA 1LTGD 3G7LA 5C4JB 3H09A 5IGCA 2M00A 5CORA 1ET9A 1F9QA 3ONAB 3D6CA 3T13A 1MSGA 2A68C 3NTKA 3SVMA 2NN6H 1CT1D 4LMQD 3SDZA 3LX0A 1TWFB 1V8QA 4H13C 1K8MA 3C2PA 3R93A 3CRKC 3K6OA 1WTQA 5BN3A 1WVLA 1BQQT 2B2WA 1QILA 2KVMA 1LT3D 4KI0A 2PCFB 1OXSC 4CKEA 1OXXK 1KAAA 5CGKA 1H9RA 5I9PA 1GJXA 2AQ2B 3NP8A 2BA0A 2BDNA 2B2TA 5EPJA 2FMMA 1KNEA 1QWYA 1DOMA 5DNFA 1SYDA 3P75A 1ZEQX 4PV1C 5M3FB 1D2BA 3O13A 1I4XA 2Z4HA 5ELDA 2VNUD 2M2LA 3MXUA 2MUYA 3JAME 4AYBB 5CYUA 3Q6SA 4A93B 1GUOA 4ZK9B 4Q5VA 2NTTA 3VR5A 2EYPA 3J81L 1EEID 3FDTA 2AWOA 1B1ZA 1K8OA 4OIKA 4BWGB 4ME5A 1CTMA 3UI2A 1B50A 4KKTA 1JB3A 3HRZC 5C4ZA 1ML0D 3EQLC 3Q23A 4V190 1IHZA 5IODA 3GP7A 3I8ZA 2C9OA 1SYGA 5ELCA 1Q8IA 3RUZA 2EJFC 1RCVD 3IKJA 1VCIA 1WCMB 4RGMA 1WD0A 2KHSA 1A2TA 2B2UA 2QF7A 3NSWA 3GTLB 1EY9A 2EOTA 4HSPA 4RCNA 5FO7B 3V05A 3C46A 4N9PA 2NVXB 2H4OA 3T4AC 4A3KB 4R8IA 1IW7D 5CR3A 3AB9A 3TMEA 2F0VA 3IFTA 1TS2A 2IX3A 2XWBB 3RZDB 4EQOA 3SR1A 3BVGA 3H6MA 2BA1A 1EY5A 3PIO3 4K6LA 4FVMA 1E2VA 1EQTA 4F88A 3IAYA 1LO5D 3NWTA 2EVBA 3ND8A 5FO8B 1NUCA 1CFMA 1HTPA 4R8NA 1Q3LA 1EY8A 4QIWB 3S9WA 3VR3A 4H0LC 2F1MA 3I3CA 3KBXA 1RTOA 2PMZB 2EYJA 1B53A 2IPKD 3N52A 4X3SA 1UUPA 3DUZA 5I4DA 1EWHA 3MZ5A 4G57A 2AUJD 1AZPA 2PNRC 1TWHB 3D3RA 2F03A 3GTPB 1YNJC 2E2DC 3VA7A 1GUGA 3LWEA 4FF2A 3OWFA 4IFDJ 3E0JA 4TKOB 5I9OA 1OXVA 1ESRA 3MWYW 1O7ZA 2EPBA 1H9SB 4RH6A 3QO2A 2F0TA 4C1NK 2C5CA 2D5DA 2EYFA 2A5HA 1SYBA 4G7ZC 3KK7A 4RFBA 2VUMB 3DWAA 2BE5C 5KNCA 2FFKB 4FF1A 4K2LA 5G3LF 1ZXTA 4A3EB 3NWSA 1PRTB 3J80L 2ID0A 3KBGA 2VXWA 4MIUA 3HOXB 1JOQA 2X69A 1CK1A 1C8CA 4XXEA 3SK6A 1I6VC 3PUZA 3VR4A 4JK1C 1EY6A 3L7ZC 4KY7A 4HAEA 5FLXL 3R2IA 1PTOF 3VR2A 1HUMA 4C2MB 1CA5A 1I4GA 1X3PA 2WAQB 5CBAE 1SNCA 2NB0A 1CM9A 2Z4IA 1JORA 3BDCA 4C3JB 5C6AA 1J8IA 1EU4A 2A68D 4C3IG 1RDPD 2K28A 4XYOA 1TWAB 3BVMA 4Q0FA 1LTSD 1ENFA 5C0XJ 2AUKA 1LTTD 1RODA 5EGTA 4J8QA 3OW7A 3RD4A 3I4MB 1QE6A 1VMPA 1YNND 2IJ0A 2XNAC 4CGYB 5ELFA 3S16B 2PZWA 2NN6I 1SNDA 1KDCA 1JWMD 5AFWA 2K5DA 5JAVA 1BOSA 1EYCA 2WIIB 3MTSA 3PV0A 5CV6A 1B2TA 1U4LA 2KEDA 2HDLA 2EXZA 1EOTA 5DAUA 4NP5A 2R61A 2F4IA 3TP8A 5HURA 1IKLA 2SOBA 2RDFA 3I72A 2D9UA 2F0OA 1MD2D 3EROA 2KQ3A 1E2WA 2JA8B 4KMUC 1TT2A 1U4MA 3DWQA 4KY6A 1Q1EA 3DHQA 3I4NB 4XYQA 1PFBA 1V43A 4GZYC 2F0FA 2PYKA 3FRPB 5KIXA 3VYSA 1NR4A 2FHTA 1YNJD 1GHKA 3SHLA 2JSOA 1A15A 4XT1B 1HA6A 3MXNA 1TS3A 1ENAA 1JC7A 5IT9L 2NBFA 5E4XA 3GO5A 2BCOA 4KJOA 1TU2B 2CVRA 3NQIA 4QCLA 5FK9C 3VYUA 3K5NA 1D1KA 2A69D 1HQMC 1S5DD 2E75C 2A6HD 2MGSA 1LTBD 1RHPA 4ID6A 3HOZB 3NPPA 5CV5A 5I6YA 4NMZA 1AFPA 5KYLA 3IL8A 2AWNA 1M8AA 2A6EC 1F2MA 4MHEA 4KV6A 1T5EA 1W6JA 2JXMB 4DNRB 2RSNA 5FKAC 4K5XA 1STEA 2BDOA 3MFGA 2NVYB 4DAPA 3D4DA 4OHJA 3J7AF 2DY7A 5F2DA 3ERQA 3NTIA 4F87A 2L12A 4ZKBB 1QNKA 2RDHA 4OO1H 1WTXA 1O80A 3HKZB 2L1BA 3A7LA 5DM63 3M85A 1NSNS 2XRQD 5DM73 5BN5A 5KNBA 4K5VA 3P20A 2ZXOA 5D65A 1M4VA 1GUWA 2AQ1B 3FKIB 3X3NA 2LY7A 4FXGC 4ZRZA 4IUPA 3KUPA 3PUYA 3BYYB 1TIID 2QEJC 3S17B 5M9OA 4ABNA 4HMJA 2E74C 3NE5B 3KLSX 1QB5D 1IYUA 4U673 3KF8A 1Z6HA 2KOLA 5DEHA 5TSSA 3NBIA 2A74C 1CZWA 1A6XA 2DNCA 4A3GB 4CBVA 1G6ZA 4Z9CB 3K5MA 3NHHA 3S1MB 1RJTA 1EY0A 1QNUA 1WTPA 2VB3X 1F77A 3SK8A 5CV9A 4CKCA 1GXDC 2L4NA 3VA5A 1GUTA 2CHBD 3GV6A 5C4HA 1EL0A 4IZ8A 3OHXC 3BVZA 1ENCA 3M7GA 4KN7C 2ZXRA 5J1ZA 4A3DB 2IX0A 2IWHA 2KCCA 4CKBA 5KRUA 2RKSA 2WV6D 4CHTB 3HS0C 2PO4A 2RDGA 1DCZA 1I3QB 2EYOA 1H9KA 1Q12A 5EKKA 2ICIA 2K05A 1SYEA 2PW5A 4DK1A 2R3ZA 1RD9D 1HQRD 1PFNA 4BY7B 1TVXA 5ISRA 1STYA 3C1EA 2HQEA 1SJED 3A55A 1PDQA 5C3WA 4WJWA 3BDLA 1SFOB 4CJ1B 3HP3A 5T1IA 1LLRD 5KNDA 3R3OA 4XQNA 1YNNC 4K6DA 4DXGA 1RKNA 1SBBB 1J9OA 4JBWA 1ZKOA 4BBSB 1SE3A 1TWGB 4NW2A 3TP5A 1LACA 4BA2I 1BXTA 1SYFA 1JR0D 5CV7A 4C1NI 4DK0A 1S5FD 4O1NA 2EY2A 4XQJA 2K33A 5HGTA 2SNMA 3GD7A 1EFID 1EYAA 3OIPA 4A3JB 4ZUIA 3I4LA 1D5MC 1HPCA 2CQAA 1FNWA 2G9DA 3CHBD 1LT6D 2NWGA 1MGSA 5I2XA 4A3FB 2K7VA 4L6TB 2L11A 1G2SA 4PQXA 5I6WA 4X3TA 2J0TD 3S1QB 3GTJB 3H94A 4J6HA 1TS4A 2XN9C 1I6HB 3MAQA 1DD2A 5FOBB 2N88A 3LNNA 4IUNA 3NXWA 4PNYA 3OIQA 5G3LD 4IFDH 4ZUJA 1I4QA 5C5LA 2F3WA 4XIGS 2A69C 1KDAA 3K5LA 5D3DA 3EJIA 4R9WA 1KABA 4KKUA 3NUCA 5LL6S 1I50B 4C3JG 1PLFA 5I2YA 1Y8OB 1F9PA 3MEHA 1PMRA 1VF7A 3W3AA 2NYZD 4IFDI 4PMBA 3MFYA 2D2CC 2BE5D 1FD7D 1TKWB 4RHSA 2ICEC 1A2UA 1STAA 1H9JA 5K36H 1Y8PB 4QF4A 1MSHA 3OPOA 2RA4A 3S2HB 3HGBA 4L63B 3FMCA 4XQQA 4K2KA 5M5XB 2E2IB 2J4XA 4NDXA 4ULLA 3CKIB 2PZUA 2IX1A 3GTKB 1PFMA 4EGVA 2K01A 3WOEA 4FXKC 3PUVA 5EKIA 2WB1B 3MXPA 1XYIA 3DM1A 1JICA 4DF7A 4KD3A 4O42A 3BDOA 2D62A 1H9SA 2WP8J 4KY5A 1PTOH 1B4OA 1L0YB 2IT1A 2EJMA 4DXFA 1Q90A 1AEXA 4UAIA 2KCNA 3GTMB 1UAPA 5IIFA 4HR7B 3Q24A 2Q8RE 4A3MB 2L0CA 4NKLA 2WKCA 2NN6G 1Q1BA 1PZKD 2YYZA 3NTHA 4QMGA 4RKLA 1ZYRD 3QOJA 1I4PA 3TZDA 2F0PA 2LMCB 5M5YB 1UEAB 5IGDA 5EKLA 3TP6A 2E76C 1BCPC 3A8IE 1XTCD 1Y1WB 1TR5A 5ELBA 1HA5A 1R9TB 5IGFA 2JP1A 4RCOA 3MHBA 1SE4A 4FP5D 3WOFA 4F8MA 2DNEA 5A35A 2XVSA 2B2VC 3SEBA 2EE1A 3K58A 2LS01 1WTRA 1ONLA 3P7JA 1CI3M 4B9XA 1LT5D 2QILA 1A3TA 2I07B 3JAML 5J22A 1PXUA 2IW3A 1JQYD 4KJNA 1HHVA 3TSSA 3GTQB 4FYDA 2B8GA 2F0UA 1G2TA 1NAPA 3IFDA 1GOZA 1KNAA 2TSSA 1LT4D 1S5CD 3ITPA 3SK5A 1SAPA 2CW0C 3D8GA 1EY4A 3BZDB 4KHVA 4KKSA 1IKMA 4DU9A 4OO1I 2BOSA 3M3YB 1RTNA 3PMFA 1STNA 4G4KA 2SNSA 3HZXA 4IALA 3DEOA 5E3FA 2O2LD 1SNPA 3SXHA 3A54A 4RA8A 3PO3B 1EU3A 3L3OC 3CQZB 4I7ZC 3RZOB 1JOKA 4WFN3 1DOLA 3MA2B 1FR3A 4RWSC 5EBCA 3T53B 3BS1A 1F2YA 3EFXD 3N6RA 4U68A 1KDBA 3PO2B 4B08A 4LJZC 3V96A 1EY7A 1JCKB 2JEBI 3K7AB 1Y69U 1JWSD 1EQVA 1FNVA 1SJHD 2Z1CA 3I90A 1I4HA 1ZYRC 1HCZA 5A2QL 4LK1C 5IOCA 1HFGA 5D3IB 4QUFA 1BCPF 1S5ED 2KECA 2F0WA 2B2WC 1ILPA 3K59A 3GQBA 3TP7A 2L5TA 4M1UB 1TWCB 1V1OA 3MXGA 2KJXA 2QDBA 2B2VA 1BCPB 2SDFA 1R4PB 5C4XB 1EYDA 4ZQ3A 4HCEA 1IL8A 2EYLA 1D5XC 1GUNA 1FNUA 4X3UA 1NR2A 3T16A 5C0XI 2H1EA 4K14A 4IN3A 3SK4A 2Q8TA 1BF4A 3HOWB 1V1PB 2HDMA 3SE0A 3G6JB 1CHQD 3H0GB 2F0DA 2JEAI 2E2JB 2JYOA 2EY6A 1Z7TA 1HXYD 3CU7A 3S2DB 1AP0A 1TQOA 3DXJC 2K5WA 5JEAH 1ILQA 4DN4M 1V1PA 5EPLA 4FF4A 3QJYA 4V0BA 3GTOB 1MBYA 3HEJA 1LV9A 5NUCA 2M9VA 5D14A 1DJRD 3D31A 1PYWD 2GA4B 1BUVT 3E5SA 3EVQA 3W2DA 5CV8A 2B2YA 1B44D 2PPBC 2XRSD 2ENBA 3PUXA 3D6WA 3QG1A 2NVQB 1CQVA 2MHVA 3FEWX 1VDZA 4IURA 2F0SA 1EIGA 3QB3A 1D6EC 1WTWA 1B9NA 5LL6X 2K03A 5C44B 2F0LA 1SMYC 3OSOA 3H3VC 4ODGA 1BNZA 3PIP3 4H44C 4EQPA 3DEPA 4OL7A 3GV3A 2V4DA 1HFNA 3T51B 1SE2A 1AZQA 2OF1A 2X6LA 2K1BA 2ZXPA 2TMPA 3OMGA 4P2CB 1PZJD 4Y7NB 4TQUS 3NBHA 4RGTA 4BY1B 2Z8LA 1ESFA 1QOHA 2EYMA 1BCPD 3GTGB 3C3LA 1PTOC 4TSSA 2B8FA 5EQ0A 5E1FA 3RMHA 1EWCA 5E4WC 2WINB 2IL8A 2XWJB 3OMCA 2R93B 4FO2A 1HRJA 2QCPX 3HOUB 1DXMA 4IFDG 4KD4A 4BS9A 2WACA 3P1HA 1IYVA 5C0XH 2F0MA 2Y0SB 1U4RA 3A56A 2XIWA 4TRDA 3K57A 3K5OA 1CHPD 1TY2A 4UDUC 4K8IA 2F0JA 1WTVA 1LABA 1DM0B 1ICWA 4IUQA 1IW7C 2PQEA 1A3VA 4K8JA 4RHRA 1JE4A 2HUGA 5COYA 2LFNA 3EA6A 2A6HC 3VYTA 5KYIA 2B2UC 3FPUB 2A73B 4XDXA 3RLFA 3S15B 1R4QB 1T5XD 3OOCA 5JEAJ 5EJWA 5JEAG 2XSCA 1RF2D 4ZYSA 5JPNC 2EZVA 4IUTA 5EBDA 1II3A 2HCIA 2F0GA 4QB4A 1LTID 4MN3A 3D4RA 1PRTD 3TN2A 4IUUA 3L9AX 1C48A 3X3MA 1STHA 1SNMA 1CA6A 2G9HD 2F0HA 2RQXA 1OXUA 4OIJA 4J1MA 2RSOA 4C3HB 4DA2A 5IGBA 2EY5A 1DYQA 2DN8A 3CRLC 3Q22A 1U9RA 2JA6B 1SMYD 1OXTA 1ET6A 2NVTB 4CJ2C 2O5JC 4PMCA 3S1RB 2R7ZB 4KN4C 4FXDA 3LWUA 1PRTF 2X6GA 4FF3A 2B2TC 2J7ZA 1BR9A 1G91A 2KEEA 2L55A 3S1NB 3S14B 2K04A 3R8BA 1QG7A 4DFAA 2MJ8A 4IQZA 4EQNA 2ZT9C 1XWEA 3OWEB 3BYTB 4C56C 3I91A 5KEEA 2AQ3B 1QJOA 4WRDA 5C3EB 5IT9E 4HSVA 1DOKA 4RKBA 3VR6A 2PW7A 1BO0A 2F0IA 1OO9B 2HCCA 2OT2A 2JA7B 1EIHA 4A3IB 1KLGD 5JVH3 1L0XB 1A3UA 5FLXE 5T1GA 1X3QA 5KGUA 4G7OC 3ZYYX 3J7AV 2O4XA 5C3XA 1E2ZA 3C1FA 4WORA 3URYA 4ZAIA 2FMCA 2EDGA 4EVOA 4ZKCB 5CMDA 3R2TA 2F3VA 1HTLD 5CBEE 2CW0D 1W6KA 3U9SA 4BA1I 1I4RA 2B63B 4DNTB 1K83B 3NQTA 1TY0A 3AMUA 1D1IA 2R92B 4RGOS 1G8ZD 1KLUD 3TZUA 4HN7A 2YU9B 4M8AA 5JPMC 1WTOA 5LHY1 1H9MA 2OEOA 1S4ZA 3FVQA 1QCBD 2WKDA 4ZLTF 1F9RA 5C5MA 1SEBD 5J39A 5FO9B 3FPPA 2EJGC 1CZGA 4KTAA 5C0XG 1SYCA 4S3SA 3E6ZX 3A8JE 4B9WA 4XT3B 1FYCA 3J7YW 4K5WA 4G7HC 1O78A 5A2QE 1Y1VB 1DZ1A 1EZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUM A;  2H1E A;  1BO0 A;  4MN3 A;  1X3P A;  3G7L A;  4RA8 A;  1CA5 A;  5E4X A;  1Q3L A;  2HCC A;  3TZD A;  5CBA E;  2Q8T A;  3FDT A;  4IUV A;  3TN2 A;  1BF4 A;  2HDM A;  1CM9 A;  3I3C A;  2CVR A;  4OIK A;  2L9H A;  4IUU A;  1EIH A;  2FJ2 A;  3KBX A;  5COR A;  1RTO A;  1PDQ A;  1CA6 A;  1J8I A;  5T1G A;  2MPM A;  4R9W A;  1X3Q A;  1F9Q A;  2JYO A;  1B53 A;  2MGS A;  3F2U A;  3ONA B;  3N52 A;  1RHP A;  4QUC A;  3UI2 A;  1DOL A;  2K28 A;  3HP3 A;  4CJ1 B;  5T1I A;  2KOL A;  4X3S A;  4CJ0 B;  1B50 A;  4RWS C;  1SDF A;  4OIJ A;  5EQ0 A;  1MSG A;  1ML0 D;  1B3A A;  1AP0 A;  1PLF A;  2RSO A;  4ZAI A;  4HCS A;  1F9P A;  3SVM A;  1ROD A;  2NYZ D;  1AZP A;  5E4W C;  1G6Z A;  1ILQ A;  4U68 A;  1QE6 A;  1VMP A;  3I8Z A;  4DN4 M;  4ZKC B;  1J9O A;  5EPL A;  5CMD A;  2IL8 A;  3H91 A;  3IL8 A;  5CBE E;  1MI2 A;  1M8A A;  1RJT A;  2K1B A;  2JP1 A;  1HRJ A;  3LWE A;  1MSH A;  2RA4 A;  5AFW A;  4CJ2 C;  4MHE A;  1LV9 A;  4LMQ D;  3MTS A;  4NW2 A;  1HUN A;  1WD0 A;  2B2V C;  5D14 A;  1WTP A;  1U4L A;  2KED A;  2HDL A;  1B2T A;  2RSN A;  3I90 A;  2EE1 A;  2B2U A;  3R93 A;  5EPK A;  1DON A;  1EOT A;  1WTR A;  2X6G A;  3P7J A;  1WTQ A;  1F9S A;  2B2Y A;  5JJZ A;  1WVL A;  1ESR A;  2EOT A;  1WTO A;  1HFG A;  2B2T C;  1U4R A;  2B2W A;  2J7Z A;  2L4N A;  3MWY W;  2DY7 A;  2XIW A;  1PFM A;  1O7Z A;  2KVM A;  3GV6 A;  2EPB A;  2K01 A;  4QUF A;  1G91 A;  1EL0 A;  3QO2 A;  1NCV A;  2KEC A;  1S4Z A;  2L12 A;  4RAU C;  1F2L A;  5EKI A;  1WTV A;  1IKL A;  4ZKB B;  3D6W A;  2B2W C;  1XYI A;  3DM1 A;  1ILP A;  1QNK A;  2KEE A;  1ICW A;  2B2Y C;  1SSO A;  4IUQ A;  1JIC A;  2D9U A;  1HHV A;  1WTX A;  1O80 A;  1U4P A;  1VMC A;  1XX8 A;  2K04 A;  1QG7 A;  4IUR A;  2L1B A;  1G2T A;  4O42 A;  1JE4 A;  2BDN A;  4R8I A;  2NWG A;  2HUG A;  2MP1 A;  5COY A;  1MGS A;  2B2T A;  2B2V A;  1EIG A;  1NAP A;  2MJ8 A;  3IFD A;  1F9R A;  4X3K A;  5EPJ A;  4ZLT F;  1WTW A;  1WD1 A;  1KNA A;  1B4O A;  2FFK B;  2SDF A;  2FMM A;  1KNE A;  1U4M A;  1DOM A;  5DNF A;  2L11 A;  1G2S A;  2K03 A;  3I91 A;  2B2U C;  1ZXT A;  3FPU B;  4X3T A;  4XDX A;  2KUM A;  1SAP A;  5D65 A;  1IL8 A;  2FIN B;  2VXW A;  1BNZ A;  1GUW A;  1PFB A;  2X69 A;  4UAI A;  1C8C A;  1IKM A;  3DEP A;  2RVL A;  5EJW A;  4X3U A;  4IUP A;  4HED A;  1RTN A;  1NR4 A;  2FHT A;  2M2L A;  2K05 A;  2DY8 A;  3KUP A;  1BBX C;  1EQT A;  3GV3 A;  2NZ1 D;  4XT3 B;  1A15 A;  2Q8R E;  4IUT A;  1HFN A;  4HSV A;  1NR2 A;  2R3Z A;  1E0B A;  1DOK A;  1X32 A;  4HAE A;  4XT1 B;  1AZQ A;  1HA6 A;  3DEO A;  2HCI A;  1O7Y A;  2N88 A;  1DZ1 A;  3Q6S A;  1PFN A;  2N55 A;  2X6L A;  1TVX A;  4ZK9 B; 
#chains in the Genus database with same CATH topology
 4NXM Q;  3QWN A;  2UXC Q;  2R92 H;  5ELE A;  3HOZ H;  3QIA A;  1PTO D;  3RZD H;  1VF5 C;  4F7X A;  1YI2 A;  3V2T A;  1KTK A;  1S5B D;  4RG1 A;  5BN4 A;  4XTC S;  1AH9 A;  4O2D A;  2F0N A;  1AW7 A;  2MPM A;  2K5Q A;  1QUQ A;  2F0K A;  4QUC A;  3ND9 A;  4C3H G;  4CJ0 B;  2JE6 I;  1B3A A;  1GUS A;  4YIJ A;  3VYR A;  4KLK A;  3WDN A;  4HMI A;  4ILW A;  3TDQ A;  1VQO A;  1TWG H;  1JB7 A;  2I46 A;  3QOL A;  2R93 H;  3GTP H;  2Q8I B;  2K6A A;  4YCV A;  2NZO A;  2SEB D;  3HG9 A;  1WTH A;  1HUN A;  2KA7 A;  3HOY B;  3S24 A;  2NUC A;  3A7A B;  3M7N A;  3M4Y A;  3J80 E;  1LTA D;  1F9S A;  3M4P A;  5JJZ A;  1EEF D;  1S40 A;  4RGN A;  1F2Z A;  1NCV A;  3D4W A;  1F2L A;  1Z47 A;  3Q0A A;  4JW0 A;  2NVY H;  1HNZ L;  4DV6 L;  1SSO A;  1Y1W G;  1PHJ A;  1SXT A;  4KHZ A;  3CQZ H;  1D5Z C;  1VMC A;  1XX8 A;  1SNQ A;  1LTL A;  5JVG 3;  2MP1 A;  4X3K A;  4DGZ A;  4LFA L;  4JBK A;  3H3V I;  1PTO B;  5IYB G;  1G29 1;  1JE5 A;  5JOB A;  1BDO A;  1CQF A;  4JYA L;  1B70 B;  2KUM A;  4H7B A;  2VB2 X;  4DR3 L;  1CSP A;  2EYH A;  1E22 A;  3MXN B;  3NEN A;  4JI2 Q;  4DAM A;  4C3I H;  3HOV G;  2RVL A;  2KCT A;  1AN8 A;  4HED A;  5M5Y H;  1STG A;  1CKO A;  3TQY A;  5M3M B;  4X66 Q;  1XXG A;  3DWP A;  3U9O A;  2NZ1 D;  4POF A;  1A8V A;  3DLL A;  1B7Y B;  1E0B A;  1X32 A;  4A3B B;  3D0F A;  4OO1 G;  1O7Y A;  4DAY A;  4PMW A;  2N55 A;  4RMF A;  4HJ8 A;  1X54 A;  3AU7 A;  3S16 H;  3HOY H;  5FJ8 H;  4IUV A;  5IGE A;  3GTQ H;  2L9H A;  3S2H H;  2FJ2 A;  1UNS A;  1FGB D;  3A8K E;  1PRT C;  1C4Q A;  4C3I B;  2Y0S E;  2NTS A;  4FNF A;  3TBI B;  2OXP A;  4I65 A;  3I7F A;  4LAA A;  4Y52 H;  3F2U A;  3K0Y A;  2O5I C;  4E6I A;  1W3S A;  3T56 B;  1GVP A;  2QKI C;  1SDF A;  1GHJ A;  3PUW A;  4HCS A;  3I70 A;  1C0A A;  3H0G G;  4B3T Q;  4EX5 A;  3NEM A;  2EY1 A;  4DAV A;  3J81 c;  3J81 i;  3PQI A;  3L0O A;  3H91 A;  3CF5 A;  3J81 E;  1MI2 A;  4NXN L;  1Y8N B;  1TS5 A;  4BBR B;  3EBE A;  3TS0 A;  4OGQ C;  1JOO A;  2R6G A;  1EZ6 A;  2ZTC A;  1VQ6 A;  4HTH A;  5EPK A;  1DON A;  4KK7 A;  3CMA A;  1JWU D;  3HOV B;  2K32 A;  4DUY Q;  4JBJ A;  1LTR D;  5K5P A;  1EIF A;  1YJN A;  2PZT A;  4A76 A;  4RAU C;  3K8A A;  4JI1 Q;  1X3E A;  4L5S A;  1PH3 A;  1SNO A;  3KLS A;  1O7L A;  2LKV A;  2F0Q A;  4R1J A;  2B2Y C;  4C3H H;  3I4M G;  3M4O B;  1IXR A;  3DMU A;  1U4P A;  5ELO A;  3S1N H;  2EQS A;  3KLR A;  2DJG C;  1WYD A;  5CC4 A;  1PV4 A;  4LF4 Q;  1STB A;  4CDC C;  3NK9 A;  1WD1 A;  1PH9 A;  1B9M A;  3I55 A;  3MC0 B;  3I73 A;  1Q8K A;  5M3F G;  2JA8 H;  3E9I A;  2E2H B;  2PI2 A;  2FIN B;  2A6E D;  5CV4 A;  5IGG A;  1K83 H;  4DR6 L;  2DY8 A;  1BBX C;  5K36 G;  1M90 C;  2ZJP A;  3MVV A;  2JA5 B;  2RBM A;  2F0E A;  4L8J A;  5M5W B;  2F4V Q;  2B39 A;  1SRO A;  4R4T A;  3BG3 A;  1PZI D;  4N9T A;  1LTG D;  3G7L A;  4YWM A;  5C4J B;  3H09 A;  5IGC A;  5H1S E;  3UDX A;  2M00 A;  3JAM i;  4JI8 Q;  1S72 A;  2Z6K A;  4BXX H;  5COR A;  4IO9 A;  4DV2 L;  1ET9 A;  1F9Q A;  2HQL A;  4DV3 L;  2E5L L;  3ONA B;  3D6C A;  3T13 A;  4OWT B;  2FXQ A;  5M3F H;  1MSG A;  2A68 C;  3AFP A;  3NTK A;  3SVM A;  3M3Y H;  2AMC B;  1HNX L;  4BBS H;  2NN6 H;  2Q2I A;  3J7Z C;  4P73 A;  1K8A C;  1VS0 A;  4OWX B;  4X64 Q;  1CT1 D;  1K8G A;  4LMQ D;  3SDZ A;  2UUB Q;  3LX0 A;  1TWF B;  4DV7 L;  3J80 c;  1V8Q A;  4H13 C;  3UDF A;  1K8M A;  4X64 L;  2BH8 A;  2KCM A;  3C2P A;  3R93 A;  3CRK C;  3K6O A;  4MTK A;  1WTQ A;  5IWA L;  5BN3 A;  1WVL A;  1BQQ T;  3KF8 B;  2B2W A;  1QIL A;  2KVM A;  2VW9 A;  3OW2 A;  3S14 H;  3HKZ E;  1LT3 D;  4KI0 A;  2PCF B;  4BBR G;  1OXS C;  3H0G H;  2QA4 A;  4CKE A;  1OXX K;  1KAA A;  1IBK Q;  5CGK A;  1H9R A;  5I9P A;  3CC2 A;  1UWV A;  1GJX A;  2AQ2 B;  3NP8 A;  2BA0 A;  4R4C A;  2CH4 A;  4A3K H;  2BDN A;  3ER0 A;  2B2T A;  5EPJ A;  3KFU A;  4LF7 Q;  3CAM A;  4HJ9 A;  2FMM A;  4OEL B;  1KNE A;  1QWY A;  1DOM A;  5DNF A;  3CC7 A;  4K0K Q;  1TWA H;  1EQQ A;  1SYD A;  2I5H A;  1YHQ A;  2QEX A;  3P75 A;  4QQB X;  1ZEQ X;  4PV1 C;  4DR4 L;  5M3F B;  1D2B A;  3O13 A;  1I4X A;  2Z4H A;  4BBS G;  5ELD A;  2VNU D;  1I3Q H;  2M2L A;  3MXU A;  3CCL A;  2MUY A;  3JAM E;  1IBK L;  1S3O A;  3GTJ H;  4AYB B;  4GKJ L;  2B29 A;  2WFW A;  3QR8 A;  4JI8 L;  5CYU A;  3Q6S A;  4A93 B;  1GUO A;  4ZK9 B;  4Q5V A;  3KYH C;  2NTT A;  3RLO A;  3VR5 A;  4POG A;  2EYP A;  3J81 L;  1EEI D;  3FDT A;  2AWO A;  1KAW A;  1B1Z A;  1K8O A;  4OIK A;  1HR0 L;  4BWG B;  2PMZ E;  4ME5 A;  1UE7 A;  2VY3 A;  4JI0 L;  1CTM A;  2QDL A;  3UI2 A;  1B50 A;  4KKT A;  4A3I G;  2K5H A;  5IP9 H;  1JB3 A;  3HRZ C;  5C4Z A;  1ML0 D;  3OTO L;  1NTG A;  3EQL C;  3Q23 A;  2Y0S G;  1IHZ A;  4V19 0;  1EWI A;  4JI6 L;  4KHP Q;  5IOD A;  3GP7 A;  3I8Z A;  2C9O A;  1SYG A;  2K50 A;  5ELC A;  1Q8I A;  1Q86 C;  1VQE A;  3RUZ A;  4DV0 L;  4ALP A;  2OWO A;  2EJF C;  4B3M L;  4NXN Q;  1RCV D;  3IKJ A;  1VCI A;  3CXC A;  1WCM B;  4RGM A;  4A3D G;  1WD0 A;  2KHS A;  1A2T A;  2B2U A;  2QF7 A;  3NSW A;  4LF9 L;  2R92 G;  3GTL B;  1EY9 A;  4LNQ A;  2EOT A;  3J80 i;  4HSP A;  5BR8 Q;  4RCN A;  1VQJ A;  5FO7 B;  3V05 A;  1P8L A;  2L15 A;  2QW7 A;  5C44 H;  4BY1 H;  1TWC H;  4N9P A;  4LF5 Q;  3C46 A;  2UXC L;  2NVX B;  2H4O A;  5FLM G;  3T4A C;  3A5U A;  4A3K B;  2UUA Q;  4R8I A;  1IW7 D;  4UPA A;  2N78 A;  2V1C C;  3IRB A;  5CR3 A;  1HZB A;  3AB9 A;  3TME A;  2F0V A;  3IFT A;  4B3S L;  1M1K C;  1UE6 A;  1TS2 A;  2IX3 A;  2XWB B;  3G6E A;  4EQO A;  3RZD B;  1ASZ A;  3SR1 A;  1VQB A;  1YHA A;  3ERS X;  3BVG A;  3H6M A;  3Q8D A;  2BA1 A;  2N49 A;  2HD3 A;  4A3F G;  1EY5 A;  3PIO 3;  4K6L A;  4HIO A;  4FVM A;  1E2V A;  1EQT A;  3PO2 G;  1NY4 A;  3PGZ A;  4F88 A;  3JC6 6;  2VQF L;  3IAY A;  1LO5 D;  2JA6 G;  3NWT A;  2EVB A;  3ND8 A;  1TWH H;  5FO8 B;  5IYD H;  5C44 G;  1NUC A;  1CFM A;  1HTP A;  4R8N A;  1Q3L A;  1EY8 A;  4QIW B;  4AH6 A;  3S9W A;  4GN5 A;  5FLX c;  3VR3 A;  3LGJ A;  4H0L C;  2F1M A;  4LFB Q;  3I3C A;  4JPB W;  3KBX A;  1SFO H;  3FKI G;  3WWV A;  1RTO A;  1PH7 A;  4AYB G;  2PMZ B;  2EYJ A;  1B53 A;  2IPK D;  3N52 A;  4EQ5 A;  2D0P A;  4X3S A;  4JBM A;  1UUP A;  4DV6 Q;  3DUZ A;  1I50 H;  5I4D A;  1EWH A;  1JJ2 A;  3MZ5 A;  1BKB A;  1PH4 A;  1IYJ B;  2HT1 A;  4G57 A;  2AUJ D;  1AZP A;  2PNR C;  1TWH B;  3D3R A;  1YIT A;  2AHO B;  2F03 A;  1K0S A;  3GTP B;  4B3R Q;  1YNJ C;  2E2D C;  1IL2 A;  3VA7 A;  1GUG A;  3LWE A;  1IBL Q;  2UXD Q;  4FF2 A;  3OWF A;  4IFD J;  4A3L G;  3E0J A;  4TKO B;  5I9O A;  2K75 A;  3FHW A;  1OXV A;  1ESR A;  1HNZ Q;  3RN2 A;  3MWY W;  1O7Z A;  2EPB A;  1H9S B;  4DV3 Q;  4RH6 A;  3QO2 A;  2F0T A;  4C1N K;  1E3P A;  1WCM H;  2C5C A;  2D5D A;  2EYF A;  2A5H A;  1SYB A;  4G7Z C;  2E5L Q;  3KK7 A;  4RFB A;  3RZO H;  1PH6 A;  2VUM B;  1BBU A;  3DWA A;  2ATW A;  4LW1 A;  2BE5 C;  3RN5 A;  4CDF C;  5KNC A;  1VQH A;  2FFK B;  2EXD A;  4FF1 A;  4K2L A;  3CCR A;  5G3L F;  1ZXT A;  4A3E B;  3NWS A;  1PRT B;  3J80 L;  2ID0 A;  3KBG A;  1XJV A;  2VXW A;  4MIU A;  3HOX B;  1CKN A;  2X69 A;  1JOQ A;  1CK1 A;  1QUQ B;  1C8C A;  4XXE A;  1NMF A;  3SK6 A;  1I6V C;  3I4O A;  3PUZ A;  3VR4 A;  3CME A;  4UY8 C;  4DR2 L;  2VL6 A;  2KHI A;  2A1A A;  4JK1 C;  3ULP A;  1EY6 A;  3L7Z C;  2PQA A;  4MTN A;  4KY7 A;  1Q7Y C;  4HAE A;  5FLX L;  3R2I A;  4B3M Q;  1PTO F;  3VR2 A;  3EN2 A;  1HUM A;  4C2M B;  1CA5 A;  1I4G A;  1X3P A;  2WAQ B;  2YTV A;  1HZC A;  5CBA E;  1SNC A;  4R4O A;  2NB0 A;  1CM9 A;  2HIX A;  4QIW E;  1O7I A;  2Z4I A;  1JOR A;  3BDC A;  1K28 A;  4C3J B;  1QVC A;  5C6A A;  1J8I A;  1EU4 A;  1QVF A;  2A68 D;  2PQA B;  4C3I G;  1RDP D;  2K28 A;  4XYO A;  1TWA B;  2BH2 A;  3BVM A;  4Q0F A;  1LTS D;  1ENF A;  3CCJ A;  1D7Q A;  5C0X J;  2AUK A;  1LTT D;  1ROD A;  3KF6 A;  1VQN A;  1Q46 A;  5EGT A;  1SMX A;  4J8Q A;  3OW7 A;  3RD4 A;  3I4M B;  1QE6 A;  1VMP A;  4GN4 B;  1YNN D;  2IJ0 A;  2XNA C;  4CGY B;  2K14 A;  5ELF A;  5IE8 A;  4DR2 Q;  1N36 Q;  3S16 B;  4A3G G;  4A3M H;  4DR1 Q;  2UXB Q;  2PZW A;  2NN6 I;  1SND A;  1KDC A;  4UP9 A;  2MNA A;  1JWM D;  5AFW A;  5FJ8 G;  2K5D A;  5JAV A;  5GRO A;  1BOS A;  1EYC A;  3PF5 A;  2WII B;  3MTS A;  3PV0 A;  5CV6 A;  1XNQ L;  1B2T A;  1U4L A;  2KED A;  2HDL A;  3S1R H;  2UUC L;  2EXZ A;  1EOT A;  5DAU A;  4PG3 A;  4NP5 A;  2WB1 E;  2R61 A;  2F4I A;  4L5Q A;  2VS1 A;  5GAH C;  3TP8 A;  5HUR A;  1IKL A;  2SOB A;  4DV1 L;  4A3C H;  2RDF A;  3I72 A;  2D9U A;  2F0O A;  1MD2 D;  3ERO A;  1PH8 A;  2KQ3 A;  1E2W A;  5LMN W;  2JA8 B;  4DV2 Q;  4DUZ Q;  4KMU C;  2RHQ B;  1TT2 A;  3W1B A;  1U4M A;  1JJG A;  4B3T L;  4A3D H;  3DWQ A;  1MJC A;  4KY6 A;  2R7F A;  2NZH A;  4X62 L;  1Q1E A;  3DHQ A;  3L2P A;  3I4N B;  4XYQ A;  2LXK A;  2MO0 A;  2Q2H A;  1PFB A;  1V43 A;  4GZY C;  2F0F A;  2PYK A;  3FRP B;  3CCQ A;  1IBM Q;  5KIX A;  3VYS A;  1FL0 A;  1NR4 A;  3I56 A;  2FHT A;  1YNJ D;  2UUC Q;  4A3M G;  1GHK A;  3SHL A;  4LFA Q;  4JCV E;  2JSO A;  3U50 C;  1A15 A;  2GN5 A;  4XT1 B;  3HOW H;  5LMU Q;  3MXN A;  1TS3 A;  1HA6 A;  1ENA A;  4JI7 L;  1JC7 A;  5IT9 L;  1FJG L;  1UE1 A;  2NBF A;  5E4X A;  2CFM A;  3GO5 A;  3STB D;  3GDE A;  4LF8 Q;  2BCO A;  2CQO A;  4KJO A;  1TU2 B;  4CDE C;  2CVR A;  3NQI A;  4QCL A;  3STB C;  3A5Z B;  5FK9 C;  3VYU A;  3HKS A;  1SRU A;  3K5N A;  1D1K A;  2A69 D;  1HQM C;  1S5D D;  1J6Q A;  2A6H D;  2E75 C;  2MGS A;  1LTB D;  4PZ8 A;  1RHP A;  4ID6 A;  3HOZ B;  3NPP A;  5CV5 A;  5I6Y A;  4NMZ A;  1AFP A;  4A3F H;  3S1Q H;  5KYL A;  1KL9 A;  1Y1V G;  3IL8 A;  2AWN A;  3PO2 H;  4DR7 Q;  1M8A A;  2Q2T A;  2A6E C;  2EIF A;  1F2M A;  2CWP A;  4L5R C;  4MHE A;  3CCS A;  4KV6 A;  1T5E A;  3U58 A;  1W6J A;  2JXM B;  4DNR B;  1VQK A;  2RSN A;  5FKA C;  4K5X A;  3KJP A;  5LMN L;  1STE A;  2BDO A;  4A3J H;  1VQG A;  1UEB A;  3MFG A;  3CCM A;  2NVY B;  2CKZ B;  5GQO A;  4DAP A;  3D4D A;  4OHJ A;  2DUD A;  1IZ6 A;  5E7N A;  2WAQ E;  2DY7 A;  5F2D A;  3J7A F;  5M5W H;  3ERQ A;  2OCE A;  3NTI A;  3U4V A;  2L12 A;  4F87 A;  1W2B A;  1X55 A;  4ZKB B;  1QNK A;  2RDH A;  4OO1 H;  3S2D H;  1WTX A;  1O80 A;  1KIX A;  3HKZ B;  5ELN A;  2L1B A;  3A7L A;  5DM6 3;  3M85 A;  1NSN S;  4UP8 A;  1PA6 A;  2XRQ D;  2UU9 Q;  5DM7 3;  4OX9 Q;  1P16 A;  4JI1 L;  5BN5 A;  1VQI A;  5KNB A;  4K5V A;  1PH2 A;  3P20 A;  1LM0 A;  2ZXO A;  4LF8 L;  4LUO A;  3BU2 A;  5D65 A;  1M4V A;  4I7A A;  1GUW A;  1YHB A;  1K73 C;  2AQ1 B;  3FKI B;  3X3N A;  2LY7 A;  4FXG C;  4ZRZ A;  4IUP A;  3NBH B;  1H95 A;  3PSI A;  4JI5 L;  4LFC L;  3KUP A;  4DV7 Q;  2ASB A;  4X66 L;  3PUY A;  3BYY B;  5C3E H;  2JK8 A;  1N32 Q;  4A3G H;  1TII D;  2QEJ C;  4HID A;  3RNU A;  3S17 B;  4LF7 L;  5M9O A;  3CCV A;  4ABN A;  4LUZ A;  1N9W A;  1XPR A;  4HMJ A;  4NB3 A;  3CC4 A;  1RL2 A;  2E74 C;  1X56 A;  3NE5 B;  3KLS X;  1QB5 D;  1B8A A;  1IYU A;  4U67 3;  4DK3 C;  3JAM c;  3KF8 A;  1Z6H A;  2KOL A;  5DEH A;  5TSS A;  3UE1 A;  2JA7 G;  3NBI A;  2A74 C;  1CZW A;  2RF4 A;  2DNC A;  1A6X A;  3F2D A;  2UXD L;  1CUK A;  4A3G B;  4CBV A;  1G6Z A;  1T9H A;  4Z9C B;  4LF6 Q;  4GKJ Q;  3K5M A;  4JI2 L;  3NHH A;  3AQQ A;  3S1M B;  1RJT A;  1EY0 A;  4DR1 L;  2UXB L;  1PVO A;  3RR5 A;  1E1T A;  1PH1 A;  2R7Z H;  1QNU A;  2Z6B A;  3M4Q A;  1WTP A;  1KRT A;  2VB3 X;  3W5O A;  1F77 A;  1G51 A;  3SK8 A;  1YEZ A;  3CW2 C;  5CV9 A;  4JC0 A;  4CKC A;  1GXD C;  2L4N A;  3K7U C;  3VA5 A;  3TEH B;  1GUT A;  2CHB D;  3EIV A;  3GV6 A;  1N33 Q;  5C4H A;  1EL0 A;  4IZ8 A;  4UP7 A;  3OHX C;  4JG2 A;  2UU9 L;  3BVZ A;  4GNX C;  1ENC A;  3M7G A;  4KN7 C;  2RCN A;  4JI5 Q;  5IYD G;  2ZXR A;  5J1Z A;  4IOC A;  1MJE A;  4A3D B;  1FVI A;  1VQM A;  3A74 A;  2IX0 A;  2IWH A;  2KCC A;  1V9P A;  4CKB A;  5KRU A;  2RKS A;  2WV6 D;  4LFC Q;  3W1G A;  4GKK L;  1Q81 C;  4P75 A;  5GAD C;  4CHT B;  2ZJQ A;  4B3S Q;  3HS0 C;  1L1O C;  2PO4 A;  3HOX H;  4IJH A;  3PCO B;  2RDG A;  1DCZ A;  2E2I H;  1I3Q B;  2EYO A;  1H9K A;  1Q12 A;  5EKK A;  2ICI A;  1LYL A;  1SYE A;  2K05 A;  2MO1 A;  2KEN A;  3AYH B;  1N34 Q;  1KC8 C;  2PW5 A;  4DK1 A;  4GLA C;  2R3Z A;  2F3I A;  1RD9 D;  2NVT H;  5JJL A;  4IPD A;  1HQR D;  1PFN A;  4DK6 C;  4BY7 B;  1TVX A;  5ISR A;  3PIP A;  1X9N A;  1STY A;  3C1E A;  2HQE A;  2DGY A;  1SJE D;  3A55 A;  2RCF A;  1PDQ A;  5C3W A;  4WJW A;  3BDL A;  1NE3 A;  1SFO B;  4CJ1 B;  3HP3 A;  5T1I A;  4DV0 Q;  2VZA A;  1LLR D;  1CSQ A;  5KND A;  3R3O A;  4LF9 Q;  4XQN A;  1YNN C;  4K6D A;  1WJJ A;  4DXG A;  1RKN A;  1SBB B;  3T1Y Q;  1J9O A;  4DUY L;  4JBW A;  1ZKO A;  5C4X H;  4BBS B;  2ALY B;  1SE3 A;  1TWG B;  4NW2 A;  1MHW C;  2CCZ A;  3TP5 A;  1LAC A;  3G71 A;  2JQO A;  4BA2 I;  1BXT A;  1SYF A;  1JR0 D;  3F8T A;  5CV7 A;  2P5Z X;  4C1N I;  4LWC A;  4DK0 A;  3S17 H;  1S5F D;  2K52 A;  4O1N A;  1TWF H;  2EY2 A;  1EIY B;  1WFQ A;  2K5N A;  4XQJ A;  2K33 A;  4YY3 Q;  3T1H Q;  5HGT A;  2SNM A;  3GD7 A;  1EFI D;  1EYA A;  3OIP A;  4A3J B;  4ZUI A;  3I4L A;  1D5M C;  1HPC A;  4ME3 A;  3J81 j;  2CWA A;  2CQA A;  2WAQ G;  1N33 L;  1FNW A;  2G9D A;  3CHB D;  5LMU L;  1LT6 D;  2NWG A;  3RLN A;  2I0Q A;  1MGS A;  5I2X A;  4A3F B;  4JI4 Q;  2K7V A;  4L6T B;  1NMG A;  1XNR L;  2L11 A;  1G2S A;  4PQX A;  5I6W A;  4X3T A;  2J0T D;  5JJI A;  3S1Q B;  3GTJ B;  2F52 A;  1JT8 A;  3H94 A;  4J6H A;  1IBL L;  1TS4 A;  2XN9 C;  1I6H B;  1X65 A;  3MAQ A;  1DD2 A;  1GKH A;  3B6Y A;  5FOB B;  2N88 A;  3LNN A;  4IUN A;  3NXW A;  1PH5 A;  1C9O A;  4PNY A;  4JI4 L;  3E0E A;  2VUM H;  4QJF A;  3OIQ A;  5GAG C;  5C4X G;  4BY1 G;  5G3L D;  4IFD H;  5DLQ E;  3K81 C;  4ZUJ A;  1I4Q A;  5C5L A;  2F3W A;  4XIG S;  2A69 C;  1KDA A;  3K5L A;  2B3G A;  5D3D A;  3EJI A;  4R9W A;  1KAB A;  4KKU A;  3NUC A;  1WCM G;  1PYS B;  5LL6 S;  1I50 B;  3F2C A;  4C3J G;  1PLF A;  5I2Y A;  4GOP C;  1Y8O B;  1F9P A;  3MEH A;  1PMR A;  1VF7 A;  3W3A A;  4JYA Q;  2NYZ D;  4IFD I;  1BBW A;  4PMB A;  3MFY A;  2D2C C;  2BE5 D;  1FD7 D;  1PFS A;  1TKW B;  4RHS A;  1HJP A;  2ICE C;  2ZTE A;  1A2U A;  1STA A;  1H9J A;  5K36 H;  1Y8P B;  3KOJ A;  2JA8 G;  2D0O A;  4QF4 A;  1Z9F A;  1MSH A;  3OPO A;  2RA4 A;  3S2H B;  3HGB A;  2YV5 A;  3FMC A;  4L63 B;  4XQQ A;  3HOV H;  4K2K A;  5M5X B;  2E2I B;  2YTX A;  2J4X A;  3T1Y L;  1KXL A;  4NDX A;  4WJ4 A;  1X3G A;  4OX9 L;  4ULL A;  3ZJY C;  1VQA A;  3I4N H;  3CCU A;  2IHF A;  3CKI B;  2PZU A;  1VQ7 A;  2IX1 A;  3GTK B;  1PFM A;  4EGV A;  2K01 A;  3WOE A;  4FXK C;  3PUV A;  5EKI A;  2WB1 B;  3MXP A;  4PZ6 A;  3TRE A;  1XYI A;  1LUZ A;  3DM1 A;  3MEF A;  1X6O A;  1JIC A;  3HOZ G;  4DF7 A;  4KD3 A;  4APV A;  1YJW A;  3CD6 A;  4O42 A;  3BDO A;  2D62 A;  4O0A A;  1H9S A;  2R93 G;  2WP8 J;  4KY5 A;  4QGU A;  5EAY A;  1PTO H;  1B4O A;  1L0Y B;  2IT1 A;  2EJM A;  4DXF A;  1Q90 A;  3BZK A;  1AEX A;  1C7Y A;  4UAI A;  4A3J G;  2KCN A;  3GTM B;  4JI0 Q;  4JV5 Q;  1UAP A;  4AQY Q;  1VQ5 A;  5IIF A;  2H5X A;  4HR7 B;  3GTO H;  3Q24 A;  1N34 L;  2Q8R E;  4IPC A;  4A4I A;  4A3M B;  2L0C A;  4NKL A;  2WKC A;  1CKN B;  4YWL A;  5IT9 c;  2NN6 G;  1Q1B A;  1PZK D;  2YYZ A;  3NTH A;  4A3K G;  4QMG A;  1AE3 A;  4RKL A;  1ZYR D;  2RHS B;  3QOJ A;  1I4P A;  3TZD A;  2F0P A;  3I4N G;  2JA5 G;  2LMC B;  4X65 L;  5M5Y B;  2NVX H;  1UEA B;  5IGD A;  3KF6 B;  5EKL A;  3TP6 A;  2I5L X;  4JV5 L;  2E76 C;  4DR5 Q;  1KD1 C;  1BCP C;  3A8I E;  1EUJ A;  2DJF C;  2R7D A;  1XTC D;  3U4Z A;  1Y1W B;  4A3C G;  2ZM6 L;  1TR5 A;  5ELB A;  1HA5 A;  2UUB L;  4YWK A;  4CDD C;  1R9T B;  5IGF A;  4DR4 Q;  5IP7 H;  1VQD A;  4P74 A;  2JP1 A;  4RCO A;  3S1M H;  3MHB A;  1SE4 A;  4FP5 D;  3WOF A;  3CCE A;  4F8M A;  2DNE A;  4JI3 L;  5A35 A;  2XVS A;  2PNH A;  2B2V C;  3SEB A;  2EE1 A;  3K58 A;  1EFW A;  2LS0 1;  1WTR A;  1VQ4 A;  1ONL A;  3P7J A;  1CI3 M;  3HFZ B;  4B9X A;  1EYG A;  1LT5 D;  4YHH Q;  1XMQ L;  1KHI A;  4LFB L;  3KDF B;  2QIL A;  1A3T A;  2I07 B;  3JAM L;  5J22 A;  1PXU A;  2IW3 A;  1JQY D;  4KJN A;  1HHV A;  3TSS A;  3GTQ B;  4FYD A;  2B8G A;  2F0U A;  4IPH A;  1QZG A;  2MQH A;  1G2T A;  1NAP A;  3IFD A;  3HKZ G;  1GOZ A;  1KNA A;  2TSS A;  1LT4 D;  1S5C D;  1K3B C;  3ITP A;  1SAP A;  3SK5 A;  2CW0 C;  1L2F A;  1I6H H;  3D8G A;  1EY4 A;  3KDF A;  3BZD B;  4KHV A;  4KKS A;  1IKM A;  4DU9 A;  3TS2 A;  4OO1 I;  2BOS A;  3M3Y B;  1RTN A;  3PMF A;  1STN A;  4A93 H;  3OYY A;  4G4K A;  2SNS A;  4JOI C;  3HZX A;  4IAL A;  4YY3 L;  3DEO A;  4YHH L;  5E3F A;  1U5K A;  1Y1V H;  2O2L D;  1SNP A;  3BJU A;  3SXH A;  3A54 A;  4RA8 A;  3PO3 B;  1YNX A;  4DAY B;  4OEM B;  1EU3 A;  1UE5 A;  4FDB A;  3L3O C;  3CQZ B;  3J7A 5;  3OTO Q;  4L5T A;  2XTI A;  4I7Z C;  3HOX G;  3CPF A;  3RZO B;  1JOK A;  4WFN 3;  1DOL A;  3MA2 B;  1FR3 A;  4RWS C;  2YU9 H;  3H3V H;  3FP9 A;  5EBC A;  1N32 L;  3T53 B;  4BBR H;  3BS1 A;  1E1O A;  1F2Y A;  3EFX D;  3N6R A;  4U68 A;  1KDB A;  2B63 H;  3PO3 H;  3PO2 B;  4B08 A;  4LJZ C;  3V96 A;  1EY7 A;  3AEV A;  1JCK B;  2JEB I;  3K7A B;  1Y69 U;  1ASY A;  1GD7 A;  1JWS D;  1EQV A;  1FNV A;  4DV4 Q;  1SJH D;  2IY5 B;  2Z1C A;  4N8F A;  3I90 A;  3PIO A;  4J15 A;  1I4H A;  1ZYR C;  2OQK A;  4JVZ A;  1KRS A;  1YVC A;  2JA5 H;  1HCZ A;  5A2Q L;  4LK1 C;  1QZH A;  5IOC A;  1HFG A;  5D3I B;  4QUF A;  1BCP F;  1HR0 Q;  1S5E D;  2KEC A;  2F0W A;  2B2W C;  1ILP A;  1ICF B;  2VQE Q;  3K59 A;  2Z9H A;  1BVS A;  3GQB A;  3TP7 A;  2L5T A;  4M1U B;  4BXX G;  1EQR A;  1TWC B;  1V1O A;  3MXG A;  2KJX A;  2QDB A;  2B2V A;  1BCP B;  2SDF A;  1R4P B;  2XGT A;  2YTY A;  5C4X B;  5IP7 G;  1VQ9 A;  1EYD A;  3GTL H;  5AJ3 Q;  4ZQ3 A;  4HCE A;  1IL8 A;  4A3B G;  3A0J A;  2EYL A;  1D5X C;  5HY6 A;  3ULL A;  1GUN A;  1FNU A;  4X3U A;  1I94 L;  4YCW A;  4B3R L;  1YIJ A;  1HH2 P;  1NR2 A;  3T16 A;  5C0X I;  2H1E A;  4K14 A;  4IN3 A;  4IPG A;  3BZC A;  3SK4 A;  3AFQ A;  4LF6 L;  2Q8T A;  1BF4 A;  3HOW B;  1V1P B;  2HDM A;  3SE0 A;  3G6J B;  4GLX A;  1CHQ D;  3H0G B;  2F0D A;  2JEA I;  2E2J B;  3GTG H;  3T1H L;  2JYO A;  2EY6 A;  1Z7T A;  1HXY D;  4DPG A;  1IBM L;  3CU7 A;  3S2D B;  1AP0 A;  1TQO A;  3DXJ C;  1NBW A;  4AYB E;  2K5W A;  5JEA H;  4JOI A;  1ILQ A;  4DN4 M;  1V1P A;  5EPL A;  4FF4 A;  3QJY A;  4V0B A;  1YBY A;  3GTO B;  1MBY A;  3HEJ A;  1VQC A;  1LV9 A;  5NUC A;  3TRZ A;  2HHH L;  4OXP A;  4DR3 Q;  2M9V A;  5D14 A;  4JI3 Q;  4DUZ L;  1DJR D;  3D31 A;  1PYW D;  2GA4 B;  1BUV T;  3E5S A;  1K9M C;  1HNW L;  3EVQ A;  3W2D A;  5CV8 A;  2B2Y A;  1B44 D;  3HOW G;  5AJ3 L;  2PPB C;  3GTK H;  4DR5 L;  2XRS D;  2ENB A;  2N8N A;  4GS3 A;  3PUX A;  1SE8 A;  3D6W A;  3QG1 A;  2E8G A;  1JJC B;  4A3I H;  1CQV A;  2NVQ B;  2MHV A;  1DGS A;  3FEW X;  2JA7 H;  1VDZ A;  1CKM A;  1X3F A;  4IUR A;  1SN8 A;  2F0S A;  4A3E H;  1EIG A;  4C2M H;  3QB3 A;  1D6E C;  1WTW A;  1WI5 A;  2C35 B;  1B9N A;  5LL6 X;  2K03 A;  5C44 B;  2KHJ A;  2F4V L;  2I5M X;  2F0L A;  1SMY C;  3OSO A;  3H3V C;  5M3M H;  4ODG A;  1BNZ A;  3PIP 3;  4NXM L;  4H44 C;  4HIK A;  1N36 L;  4EQP A;  3DEP A;  4OL7 A;  2K4K A;  1MIU A;  3GV3 A;  2V4D A;  1HFN A;  3T51 B;  4LF4 L;  5J3B A;  2JJQ A;  4X65 Q;  1SE2 A;  1AZQ A;  1WOC A;  2AKW B;  2OF1 A;  2LSS A;  3DM3 A;  3H15 A;  2X6L A;  2K1B A;  4HIM A;  3K0X A;  2ZXP A;  4LUV A;  2TMP A;  3OMG A;  4P2C B;  1PZJ D;  3KLW A;  4MNO A;  4Y7N B;  4TQU S;  3NBH A;  4RGT A;  1A63 A;  4BY1 B;  2Z8L A;  4DNI A;  5L37 A;  1ESF A;  1QOH A;  2A19 A;  1BCP D;  2EYM A;  3GTG B;  1KQS A;  3C3L A;  1PTO C;  4MZ9 A;  4TSS A;  2B8F A;  4R4Q A;  3M9B A;  3NEL A;  4N8X 1;  1SLJ A;  4JI7 Q;  1L0W A;  1GM5 A;  5EQ0 A;  5E1F A;  3I4M H;  4HJ7 A;  5M3M G;  3RMH A;  1EWC A;  5E4W C;  1XMQ Q;  2WIN B;  2IL8 A;  2XWJ B;  1OTC A;  3OMC A;  1R9T H;  2R93 B;  4FO2 A;  4A3E G;  1HRJ A;  2QCP X;  2JA6 H;  3HOU B;  4DKA C;  1DXM A;  4IFD G;  4KD4 A;  2VQF Q;  1RIP A;  4BS9 A;  2WAC A;  2VUM G;  3ULJ A;  1U0L A;  1I94 Q;  3P1H A;  1IYV A;  2OTL A;  5C0X H;  2F0M A;  2MFI A;  2Y0S B;  1MKH A;  1U4R A;  3A56 A;  4GLV B;  4BY7 G;  2XIW A;  1YJ9 A;  4TRD A;  3K57 A;  3K5O A;  1CHP D;  1TY2 A;  4UDU C;  4K0K L;  4K8I A;  2F0J A;  1WTV A;  2OQ0 A;  1LAB A;  3SGI A;  1DM0 B;  1ICW A;  2WB1 G;  4IUQ A;  1IW7 C;  2UUA L;  2PQE A;  1A3V A;  4HJA A;  4K8J A;  4RHR A;  1JE4 A;  2HUG A;  5COY A;  1E7Z A;  2KBN A;  2LFN A;  2A6H C;  3EA6 A;  3VYT A;  3HOY G;  5KYI A;  3PO3 G;  1A0I A;  1TXY A;  4AIM A;  2B2U C;  3FPU B;  2A73 B;  4XDX A;  3RLF A;  1XNQ Q;  3S15 B;  1R4Q B;  1T5X D;  4QL5 A;  3F1Z A;  3OOC A;  4P72 A;  1JMC A;  5JEA J;  1K0R A;  5EJW A;  3E9H A;  5JEA G;  2XSC A;  1RF2 D;  2HIV A;  4IJL A;  1YZ6 A;  4ZYS A;  5JPN C;  3K7A H;  4X62 Q;  1HNX Q;  4H02 A;  1D8L A;  4HJ5 A;  1V1Q A;  1NJI C;  3F2B A;  2EZV A;  4IUT A;  5EBD A;  2LXJ A;  1II3 A;  4DR6 Q;  2HCI A;  2F0G A;  1HR0 W;  4QB4 A;  1J5E L;  4GOP A;  1LTI D;  4MN3 A;  3D4R A;  2VQE L;  5IWA Q;  1PRT D;  2GVB A;  3TN2 A;  1AE2 A;  4KHP L;  2E2H H;  1A62 A;  4IUU A;  1L1O B;  3UDG A;  3L9A X;  4BY7 H;  1C48 A;  3X3M A;  1STH A;  1SNM A;  2ZJR A;  1CA6 A;  2G9H D;  2F0H A;  5IYB H;  2RQX A;  1OXU A;  4OIJ A;  1Y1W H;  4J1M A;  4UHV A;  2RSO A;  4C3H B;  4GOP B;  1NNX A;  2PI2 E;  4AQY L;  4DA2 A;  5IGB A;  2EY5 A;  4DV4 L;  1DYQ A;  2DN8 A;  3CRL C;  1FGU A;  4X6A H;  3Q22 A;  3E3X A;  2ZM6 Q;  1U9R A;  1Q82 C;  2JA6 B;  1SMY D;  5LMN Q;  4R4I A;  1OXT A;  1GO3 E;  1ET6 A;  2NVT B;  4CJ2 C;  2O5J C;  4PMC A;  1XPU A;  3S1R B;  2R7Z B;  1HZA A;  4KN4 C;  4FXD A;  3LWU A;  1PRT F;  2X6G A;  3UE0 A;  4GN3 B;  4FF3 A;  2B2T C;  2J7Z A;  1XMO L;  1BR9 A;  1G91 A;  5GAE C;  2E2J H;  4NPS A;  1XPO A;  1XMO Q;  1VQL A;  3HOU G;  5M5X H;  1N8R C;  2KEE A;  5IP9 G;  2CH4 W;  2L55 A;  1HZ9 A;  3S1N B;  3S14 B;  2K5V A;  2K04 A;  3R8B A;  1QG7 A;  5IYC G;  5BR8 L;  4DFA A;  4DV5 Q;  2MJ8 A;  2N3S A;  2A8V A;  4IQZ A;  4EQN A;  3CP0 A;  3VDY A;  1I5F A;  2ZT9 C;  4IOA A;  2B63 G;  1XWE A;  3OWE B;  3BYT B;  4C56 C;  1SR3 A;  3I91 A;  5JJK A;  5KEE A;  2AQ3 B;  1QJO A;  1J5E Q;  3UDI A;  3K80 C;  4WRD A;  2OTJ A;  4JI6 Q;  5C3E B;  5IT9 E;  2QGQ A;  1XTD A;  4HSV A;  1PYB A;  1DOK A;  4RKB A;  3VR6 A;  5HGQ A;  2PW7 A;  4PZ7 A;  1BO0 A;  2F0I A;  1OO9 B;  2HCC A;  3G48 A;  2OT2 A;  4TVA B;  2JA7 B;  1EIH A;  2R7Z G;  4A3L H;  4A3I B;  1KLG D;  5JVH 3;  4DV1 Q;  5IYC H;  2NVQ H;  1L0X B;  1A3U A;  2Z0S A;  5FLX E;  2Z6K C;  4YCU A;  5T1G A;  1X3Q A;  5KGU A;  3PF4 A;  4G7O C;  3ZYY X;  1VQP A;  1HNW Q;  3ICE A;  1FJG Q;  2O4X A;  5C3X A;  3J7A V;  1E2Z A;  3C1F A;  4WOR A;  5FLM H;  3URY A;  4ZAI A;  3M4O H;  2FMC A;  3HOU H;  2EDG A;  2ES2 A;  4GKK Q;  4EVO A;  4ZKC B;  5IY0 A;  5CMD A;  3R2T A;  2F3V A;  1HTL D;  5CBE E;  4A93 G;  2CW0 D;  2Q2U A;  1W6K A;  1K3R A;  3U9S A;  4A3B H;  4BA1 I;  1I4R A;  2B63 B;  4DNT B;  1K83 B;  4WJ3 M;  3NQT A;  1L1O A;  1VQF A;  1TY0 A;  1VQ8 A;  1D1I A;  3AMU A;  3FKI H;  2R92 B;  4RGO S;  1G8Z D;  1KLU D;  1XNR Q;  1QVG A;  3TZU A;  4HN7 A;  2YU9 B;  2JN4 A;  4M8A A;  5JPM C;  1WTO A;  1E24 A;  2JA9 A;  5LHY 1;  5C3E G;  1H9M A;  4C3J H;  2OEO A;  4LF5 L;  1B3Q A;  4Y7N H;  1S4Z A;  3G4S A;  2G5D A;  3FVQ A;  1Y14 B;  2HHH Q;  4GNX A;  2IHE A;  1QCB D;  2WKD A;  4ZLT F;  4OWW B;  1F9R A;  1EOV A;  4OON A;  5C5M A;  4P71 A;  3GTM H;  1SEB D;  5J39 A;  3KJO A;  5FO9 B;  4QY7 A;  3FPP A;  2EJG C;  1CZG A;  4KTA A;  4DV5 L;  5C0X G;  1SYC A;  4S3S A;  4GNX B;  4ZCK A;  3E6Z X;  4A75 A;  3CPW A;  3S15 H;  3A8J E;  4B9W A;  2ZTD A;  4XT3 B;  1FYC A;  5C4J H;  3J7Y W;  4K5W A;  4G7H C;  2GVA A;  3I2Z A;  1O78 A;  5A2Q E;  1G6P A;  1Y1V B;  1DZ1 A;  1EZ8 A;  4DR7 L; 
#chains in the Genus database with same CATH homology
 3QWN A;  5ELE A;  3QIA A;  1PTO D;  1VF5 C;  4F7X A;  3V2T A;  1KTK A;  1S5B D;  5BN4 A;  4XTC S;  2F0N A;  1AW7 A;  2MPM A;  2K5Q A;  2F0K A;  4QUC A;  3ND9 A;  4C3H G;  4CJ0 B;  2JE6 I;  1B3A A;  1GUS A;  4YIJ A;  3VYR A;  3WDN A;  4HMI A;  4ILW A;  3TDQ A;  2I46 A;  3QOL A;  2Q8I B;  2K6A A;  2SEB D;  3HG9 A;  1HUN A;  2KA7 A;  3HOY B;  2NUC A;  3A7A B;  3M7N A;  3M4Y A;  3J80 E;  1LTA D;  1F9S A;  5JJZ A;  1EEF D;  4RGN A;  1F2Z A;  1NCV A;  3D4W A;  1F2L A;  1Z47 A;  3Q0A A;  1SSO A;  1SXT A;  4KHZ A;  1D5Z C;  1VMC A;  1XX8 A;  1SNQ A;  5JVG 3;  2MP1 A;  4X3K A;  4DGZ A;  1PTO B;  1G29 1;  5JOB A;  1BDO A;  1CQF A;  2KUM A;  4H7B A;  2VB2 X;  2EYH A;  2RVL A;  1AN8 A;  4HED A;  1STG A;  5M3M B;  1XXG A;  3DWP A;  3U9O A;  2NZ1 D;  1E0B A;  1X32 A;  4A3B B;  4OO1 G;  1O7Y A;  4DAY A;  4PMW A;  2N55 A;  3AU7 A;  4IUV A;  5IGE A;  2L9H A;  2FJ2 A;  1UNS A;  1FGB D;  3A8K E;  1PRT C;  1C4Q A;  4C3I B;  2NTS A;  4FNF A;  3TBI B;  2OXP A;  4I65 A;  4LAA A;  3F2U A;  3K0Y A;  2O5I C;  4E6I A;  3T56 B;  2QKI C;  1SDF A;  1GHJ A;  3PUW A;  4HCS A;  3I70 A;  2EY1 A;  4DAV A;  3H91 A;  3J81 E;  1MI2 A;  1Y8N B;  1TS5 A;  4BBR B;  4OGQ C;  1JOO A;  2R6G A;  1EZ6 A;  4HTH A;  5EPK A;  1DON A;  4KK7 A;  3HOV B;  1JWU D;  2K32 A;  1LTR D;  5K5P A;  2PZT A;  4RAU C;  1SNO A;  3KLS A;  1O7L A;  2LKV A;  2F0Q A;  2B2Y C;  3M4O B;  3DMU A;  1U4P A;  3KLR A;  5CC4 A;  1STB A;  3NK9 A;  1WD1 A;  1B9M A;  3MC0 B;  3I73 A;  2E2H B;  2FIN B;  2A6E D;  5CV4 A;  5IGG A;  2DY8 A;  1BBX C;  5K36 G;  2JA5 B;  3MVV A;  2RBM A;  2F0E A;  4L8J A;  5M5W B;  2B39 A;  3BG3 A;  1PZI D;  4N9T A;  1LTG D;  3G7L A;  5C4J B;  3H09 A;  5IGC A;  2M00 A;  5COR A;  1ET9 A;  1F9Q A;  3ONA B;  3D6C A;  3T13 A;  1MSG A;  2A68 C;  3NTK A;  3SVM A;  2NN6 H;  1CT1 D;  4LMQ D;  3SDZ A;  3LX0 A;  1TWF B;  1V8Q A;  4H13 C;  1K8M A;  3C2P A;  3R93 A;  3CRK C;  3K6O A;  1WTQ A;  5BN3 A;  1WVL A;  1BQQ T;  2B2W A;  1QIL A;  2KVM A;  1LT3 D;  4KI0 A;  2PCF B;  1OXS C;  4CKE A;  1OXX K;  1KAA A;  5CGK A;  1H9R A;  5I9P A;  1GJX A;  2AQ2 B;  3NP8 A;  2BA0 A;  2BDN A;  2B2T A;  5EPJ A;  2FMM A;  1KNE A;  1QWY A;  1DOM A;  5DNF A;  1SYD A;  3P75 A;  1ZEQ X;  4PV1 C;  5M3F B;  1D2B A;  3O13 A;  1I4X A;  2Z4H A;  5ELD A;  2VNU D;  2M2L A;  3MXU A;  2MUY A;  3JAM E;  4AYB B;  5CYU A;  3Q6S A;  4A93 B;  1GUO A;  4ZK9 B;  4Q5V A;  2NTT A;  3VR5 A;  2EYP A;  3J81 L;  1EEI D;  3FDT A;  2AWO A;  1B1Z A;  1K8O A;  4OIK A;  4BWG B;  4ME5 A;  1CTM A;  3UI2 A;  1B50 A;  4KKT A;  1JB3 A;  3HRZ C;  5C4Z A;  1ML0 D;  3EQL C;  3Q23 A;  4V19 0;  1IHZ A;  5IOD A;  3GP7 A;  3I8Z A;  2C9O A;  1SYG A;  5ELC A;  1Q8I A;  3RUZ A;  2EJF C;  1RCV D;  3IKJ A;  1VCI A;  1WCM B;  4RGM A;  1WD0 A;  2KHS A;  1A2T A;  2B2U A;  2QF7 A;  3NSW A;  3GTL B;  1EY9 A;  2EOT A;  4HSP A;  4RCN A;  5FO7 B;  3V05 A;  3C46 A;  4N9P A;  2NVX B;  2H4O A;  3T4A C;  4A3K B;  4R8I A;  1IW7 D;  5CR3 A;  3AB9 A;  3TME A;  2F0V A;  3IFT A;  1TS2 A;  2IX3 A;  2XWB B;  3RZD B;  4EQO A;  3SR1 A;  3BVG A;  3H6M A;  2BA1 A;  1EY5 A;  3PIO 3;  4K6L A;  4FVM A;  1E2V A;  1EQT A;  4F88 A;  3IAY A;  1LO5 D;  3NWT A;  2EVB A;  3ND8 A;  5FO8 B;  1NUC A;  1CFM A;  1HTP A;  4R8N A;  1Q3L A;  1EY8 A;  4QIW B;  3S9W A;  3VR3 A;  4H0L C;  2F1M A;  3I3C A;  3KBX A;  1RTO A;  2PMZ B;  2EYJ A;  1B53 A;  2IPK D;  3N52 A;  4X3S A;  1UUP A;  3DUZ A;  5I4D A;  1EWH A;  3MZ5 A;  4G57 A;  2AUJ D;  1AZP A;  2PNR C;  1TWH B;  3D3R A;  2F03 A;  3GTP B;  1YNJ C;  2E2D C;  3VA7 A;  1GUG A;  3LWE A;  4FF2 A;  3OWF A;  4IFD J;  3E0J A;  4TKO B;  5I9O A;  1OXV A;  1ESR A;  3MWY W;  1O7Z A;  2EPB A;  1H9S B;  4RH6 A;  3QO2 A;  2F0T A;  4C1N K;  2C5C A;  2D5D A;  2EYF A;  2A5H A;  1SYB A;  4G7Z C;  3KK7 A;  4RFB A;  2VUM B;  3DWA A;  2BE5 C;  5KNC A;  2FFK B;  4FF1 A;  4K2L A;  5G3L F;  1ZXT A;  4A3E B;  3NWS A;  1PRT B;  3J80 L;  2ID0 A;  3KBG A;  2VXW A;  4MIU A;  3HOX B;  1JOQ A;  2X69 A;  1CK1 A;  1C8C A;  4XXE A;  3SK6 A;  1I6V C;  3PUZ A;  3VR4 A;  4JK1 C;  1EY6 A;  3L7Z C;  4KY7 A;  4HAE A;  5FLX L;  3R2I A;  1PTO F;  3VR2 A;  1HUM A;  4C2M B;  1CA5 A;  1I4G A;  1X3P A;  2WAQ B;  5CBA E;  1SNC A;  2NB0 A;  1CM9 A;  2Z4I A;  1JOR A;  3BDC A;  4C3J B;  5C6A A;  1J8I A;  1EU4 A;  2A68 D;  4C3I G;  1RDP D;  2K28 A;  4XYO A;  1TWA B;  3BVM A;  4Q0F A;  1LTS D;  1ENF A;  5C0X J;  2AUK A;  1LTT D;  1ROD A;  5EGT A;  4J8Q A;  3OW7 A;  3RD4 A;  3I4M B;  1QE6 A;  1VMP A;  1YNN D;  2IJ0 A;  2XNA C;  4CGY B;  5ELF A;  3S16 B;  2PZW A;  2NN6 I;  1SND A;  1KDC A;  1JWM D;  5AFW A;  2K5D A;  5JAV A;  1BOS A;  1EYC A;  2WII B;  3MTS A;  3PV0 A;  5CV6 A;  1B2T A;  1U4L A;  2KED A;  2HDL A;  2EXZ A;  1EOT A;  5DAU A;  4NP5 A;  2R61 A;  2F4I A;  3TP8 A;  5HUR A;  1IKL A;  2SOB A;  2RDF A;  3I72 A;  2D9U A;  2F0O A;  1MD2 D;  3ERO A;  2KQ3 A;  1E2W A;  2JA8 B;  4KMU C;  1TT2 A;  1U4M A;  3DWQ A;  4KY6 A;  1Q1E A;  3DHQ A;  3I4N B;  4XYQ A;  1PFB A;  1V43 A;  4GZY C;  2F0F A;  2PYK A;  3FRP B;  5KIX A;  3VYS A;  1NR4 A;  2FHT A;  1YNJ D;  1GHK A;  3SHL A;  2JSO A;  1A15 A;  4XT1 B;  1HA6 A;  3MXN A;  1TS3 A;  1ENA A;  1JC7 A;  5IT9 L;  2NBF A;  5E4X A;  3GO5 A;  2BCO A;  4KJO A;  1TU2 B;  2CVR A;  3NQI A;  4QCL A;  5FK9 C;  3VYU A;  3K5N A;  1D1K A;  2A69 D;  1HQM C;  1S5D D;  2E75 C;  2A6H D;  2MGS A;  1LTB D;  1RHP A;  4ID6 A;  3HOZ B;  3NPP A;  5CV5 A;  5I6Y A;  4NMZ A;  1AFP A;  5KYL A;  3IL8 A;  2AWN A;  1M8A A;  2A6E C;  1F2M A;  4MHE A;  4KV6 A;  1T5E A;  1W6J A;  2JXM B;  4DNR B;  2RSN A;  5FKA C;  4K5X A;  1STE A;  2BDO A;  3MFG A;  2NVY B;  4DAP A;  3D4D A;  4OHJ A;  3J7A F;  2DY7 A;  5F2D A;  3ERQ A;  3NTI A;  4F87 A;  2L12 A;  4ZKB B;  1QNK A;  2RDH A;  4OO1 H;  1WTX A;  1O80 A;  3HKZ B;  2L1B A;  3A7L A;  5DM6 3;  3M85 A;  1NSN S;  2XRQ D;  5DM7 3;  5BN5 A;  5KNB A;  4K5V A;  3P20 A;  2ZXO A;  5D65 A;  1M4V A;  1GUW A;  2AQ1 B;  3FKI B;  3X3N A;  2LY7 A;  4FXG C;  4ZRZ A;  4IUP A;  3KUP A;  3PUY A;  3BYY B;  1TII D;  2QEJ C;  3S17 B;  5M9O A;  4ABN A;  4HMJ A;  2E74 C;  3NE5 B;  3KLS X;  1QB5 D;  1IYU A;  4U67 3;  3KF8 A;  1Z6H A;  2KOL A;  5DEH A;  5TSS A;  3NBI A;  2A74 C;  1CZW A;  1A6X A;  2DNC A;  4A3G B;  4CBV A;  1G6Z A;  4Z9C B;  3K5M A;  3NHH A;  3S1M B;  1RJT A;  1EY0 A;  1QNU A;  1WTP A;  2VB3 X;  1F77 A;  3SK8 A;  5CV9 A;  4CKC A;  1GXD C;  2L4N A;  3VA5 A;  1GUT A;  2CHB D;  3GV6 A;  5C4H A;  1EL0 A;  4IZ8 A;  3OHX C;  3BVZ A;  1ENC A;  3M7G A;  4KN7 C;  2ZXR A;  5J1Z A;  4A3D B;  2IX0 A;  2IWH A;  2KCC A;  4CKB A;  5KRU A;  2RKS A;  2WV6 D;  4CHT B;  3HS0 C;  2PO4 A;  2RDG A;  1DCZ A;  1I3Q B;  2EYO A;  1H9K A;  1Q12 A;  5EKK A;  2ICI A;  2K05 A;  1SYE A;  2PW5 A;  4DK1 A;  2R3Z A;  1RD9 D;  1HQR D;  1PFN A;  4BY7 B;  1TVX A;  5ISR A;  1STY A;  3C1E A;  2HQE A;  1SJE D;  3A55 A;  1PDQ A;  5C3W A;  4WJW A;  3BDL A;  1SFO B;  4CJ1 B;  3HP3 A;  5T1I A;  1LLR D;  5KND A;  3R3O A;  4XQN A;  1YNN C;  4K6D A;  4DXG A;  1RKN A;  1SBB B;  1J9O A;  4JBW A;  1ZKO A;  4BBS B;  1SE3 A;  1TWG B;  4NW2 A;  3TP5 A;  1LAC A;  4BA2 I;  1BXT A;  1SYF A;  1JR0 D;  5CV7 A;  4C1N I;  4DK0 A;  1S5F D;  4O1N A;  2EY2 A;  4XQJ A;  2K33 A;  5HGT A;  2SNM A;  3GD7 A;  1EFI D;  1EYA A;  3OIP A;  4A3J B;  4ZUI A;  3I4L A;  1D5M C;  1HPC A;  2CQA A;  1FNW A;  2G9D A;  3CHB D;  1LT6 D;  2NWG A;  1MGS A;  5I2X A;  4A3F B;  2K7V A;  4L6T B;  2L11 A;  1G2S A;  4PQX A;  5I6W A;  4X3T A;  2J0T D;  3S1Q B;  3GTJ B;  3H94 A;  4J6H A;  1TS4 A;  2XN9 C;  1I6H B;  3MAQ A;  1DD2 A;  5FOB B;  2N88 A;  3LNN A;  4IUN A;  3NXW A;  4PNY A;  3OIQ A;  5G3L D;  4IFD H;  4ZUJ A;  1I4Q A;  5C5L A;  2F3W A;  4XIG S;  2A69 C;  1KDA A;  3K5L A;  5D3D A;  3EJI A;  4R9W A;  1KAB A;  4KKU A;  3NUC A;  5LL6 S;  1I50 B;  4C3J G;  1PLF A;  5I2Y A;  1Y8O B;  1F9P A;  3MEH A;  1PMR A;  1VF7 A;  3W3A A;  2NYZ D;  4IFD I;  4PMB A;  3MFY A;  2D2C C;  2BE5 D;  1FD7 D;  1TKW B;  4RHS A;  2ICE C;  1A2U A;  1STA A;  1H9J A;  5K36 H;  1Y8P B;  4QF4 A;  1MSH A;  3OPO A;  2RA4 A;  3S2H B;  3HGB A;  4L63 B;  3FMC A;  4XQQ A;  4K2K A;  5M5X B;  2E2I B;  2J4X A;  4NDX A;  4ULL A;  3CKI B;  2PZU A;  2IX1 A;  3GTK B;  1PFM A;  4EGV A;  2K01 A;  3WOE A;  4FXK C;  3PUV A;  5EKI A;  2WB1 B;  3MXP A;  1XYI A;  3DM1 A;  1JIC A;  4DF7 A;  4KD3 A;  4O42 A;  3BDO A;  2D62 A;  1H9S A;  2WP8 J;  4KY5 A;  1PTO H;  1B4O A;  1L0Y B;  2IT1 A;  2EJM A;  4DXF A;  1Q90 A;  1AEX A;  4UAI A;  2KCN A;  3GTM B;  1UAP A;  5IIF A;  4HR7 B;  3Q24 A;  2Q8R E;  4A3M B;  2L0C A;  4NKL A;  2WKC A;  2NN6 G;  1Q1B A;  1PZK D;  2YYZ A;  3NTH A;  4QMG A;  4RKL A;  1ZYR D;  3QOJ A;  1I4P A;  3TZD A;  2F0P A;  2LMC B;  5M5Y B;  1UEA B;  5IGD A;  5EKL A;  3TP6 A;  2E76 C;  1BCP C;  3A8I E;  1XTC D;  1Y1W B;  1TR5 A;  5ELB A;  1HA5 A;  1R9T B;  5IGF A;  2JP1 A;  4RCO A;  3MHB A;  1SE4 A;  4FP5 D;  3WOF A;  4F8M A;  2DNE A;  5A35 A;  2XVS A;  2B2V C;  3SEB A;  2EE1 A;  3K58 A;  2LS0 1;  1WTR A;  1ONL A;  3P7J A;  1CI3 M;  4B9X A;  1LT5 D;  2QIL A;  1A3T A;  2I07 B;  3JAM L;  5J22 A;  1PXU A;  2IW3 A;  1JQY D;  4KJN A;  1HHV A;  3TSS A;  3GTQ B;  4FYD A;  2B8G A;  2F0U A;  1G2T A;  1NAP A;  3IFD A;  1GOZ A;  1KNA A;  2TSS A;  1LT4 D;  1S5C D;  3ITP A;  3SK5 A;  1SAP A;  2CW0 C;  3D8G A;  1EY4 A;  3BZD B;  4KHV A;  4KKS A;  1IKM A;  4DU9 A;  4OO1 I;  2BOS A;  3M3Y B;  1RTN A;  3PMF A;  1STN A;  4G4K A;  2SNS A;  3HZX A;  4IAL A;  3DEO A;  5E3F A;  2O2L D;  1SNP A;  3SXH A;  3A54 A;  4RA8 A;  3PO3 B;  1EU3 A;  3L3O C;  3CQZ B;  4I7Z C;  3RZO B;  1JOK A;  4WFN 3;  1DOL A;  3MA2 B;  1FR3 A;  4RWS C;  5EBC A;  3T53 B;  3BS1 A;  1F2Y A;  3EFX D;  3N6R A;  4U68 A;  1KDB A;  3PO2 B;  4B08 A;  4LJZ C;  3V96 A;  1EY7 A;  1JCK B;  2JEB I;  3K7A B;  1Y69 U;  1JWS D;  1EQV A;  1FNV A;  1SJH D;  2Z1C A;  3I90 A;  1I4H A;  1ZYR C;  1HCZ A;  5A2Q L;  4LK1 C;  5IOC A;  1HFG A;  5D3I B;  4QUF A;  1BCP F;  1S5E D;  2KEC A;  2F0W A;  2B2W C;  1ILP A;  3K59 A;  3GQB A;  3TP7 A;  2L5T A;  4M1U B;  1TWC B;  1V1O A;  3MXG A;  2KJX A;  2QDB A;  2B2V A;  1BCP B;  2SDF A;  1R4P B;  5C4X B;  1EYD A;  4ZQ3 A;  4HCE A;  1IL8 A;  2EYL A;  1D5X C;  1GUN A;  1FNU A;  4X3U A;  1NR2 A;  3T16 A;  5C0X I;  2H1E A;  4K14 A;  4IN3 A;  3SK4 A;  2Q8T A;  1BF4 A;  3HOW B;  1V1P B;  2HDM A;  3SE0 A;  3G6J B;  1CHQ D;  3H0G B;  2F0D A;  2JEA I;  2E2J B;  2JYO A;  2EY6 A;  1Z7T A;  1HXY D;  3CU7 A;  3S2D B;  1AP0 A;  1TQO A;  3DXJ C;  2K5W A;  5JEA H;  1ILQ A;  4DN4 M;  1V1P A;  5EPL A;  4FF4 A;  3QJY A;  4V0B A;  3GTO B;  1MBY A;  3HEJ A;  1LV9 A;  5NUC A;  2M9V A;  5D14 A;  1DJR D;  3D31 A;  1PYW D;  2GA4 B;  1BUV T;  3E5S A;  3EVQ A;  3W2D A;  5CV8 A;  2B2Y A;  1B44 D;  2PPB C;  2XRS D;  2ENB A;  3PUX A;  3D6W A;  3QG1 A;  2NVQ B;  1CQV A;  2MHV A;  3FEW X;  1VDZ A;  4IUR A;  2F0S A;  1EIG A;  3QB3 A;  1D6E C;  1WTW A;  1B9N A;  5LL6 X;  2K03 A;  5C44 B;  2F0L A;  1SMY C;  3OSO A;  3H3V C;  4ODG A;  1BNZ A;  3PIP 3;  4H44 C;  4EQP A;  3DEP A;  4OL7 A;  3GV3 A;  2V4D A;  1HFN A;  3T51 B;  1SE2 A;  1AZQ A;  2OF1 A;  2X6L A;  2K1B A;  2ZXP A;  2TMP A;  3OMG A;  4P2C B;  1PZJ D;  4Y7N B;  4TQU S;  3NBH A;  4RGT A;  4BY1 B;  2Z8L A;  1ESF A;  1QOH A;  2EYM A;  1BCP D;  3GTG B;  3C3L A;  1PTO C;  4TSS A;  2B8F A;  5EQ0 A;  5E1F A;  3RMH A;  1EWC A;  5E4W C;  2WIN B;  2IL8 A;  2XWJ B;  3OMC A;  2R93 B;  4FO2 A;  1HRJ A;  2QCP X;  3HOU B;  1DXM A;  4IFD G;  4KD4 A;  4BS9 A;  2WAC A;  3P1H A;  1IYV A;  5C0X H;  2F0M A;  2Y0S B;  1U4R A;  3A56 A;  2XIW A;  4TRD A;  3K57 A;  3K5O A;  1CHP D;  1TY2 A;  4UDU C;  4K8I A;  2F0J A;  1WTV A;  1LAB A;  1DM0 B;  1ICW A;  4IUQ A;  1IW7 C;  2PQE A;  1A3V A;  4K8J A;  4RHR A;  1JE4 A;  2HUG A;  5COY A;  2LFN A;  3EA6 A;  2A6H C;  3VYT A;  5KYI A;  2B2U C;  3FPU B;  2A73 B;  4XDX A;  3RLF A;  3S15 B;  1R4Q B;  1T5X D;  3OOC A;  5JEA J;  5EJW A;  5JEA G;  2XSC A;  1RF2 D;  4ZYS A;  5JPN C;  2EZV A;  4IUT A;  5EBD A;  1II3 A;  2HCI A;  2F0G A;  4QB4 A;  1LTI D;  4MN3 A;  3D4R A;  1PRT D;  3TN2 A;  4IUU A;  3L9A X;  1C48 A;  3X3M A;  1STH A;  1SNM A;  1CA6 A;  2G9H D;  2F0H A;  2RQX A;  1OXU A;  4OIJ A;  4J1M A;  2RSO A;  4C3H B;  4DA2 A;  5IGB A;  2EY5 A;  1DYQ A;  2DN8 A;  3CRL C;  3Q22 A;  1U9R A;  2JA6 B;  1SMY D;  1OXT A;  1ET6 A;  2NVT B;  4CJ2 C;  2O5J C;  4PMC A;  3S1R B;  2R7Z B;  4KN4 C;  4FXD A;  3LWU A;  1PRT F;  2X6G A;  4FF3 A;  2B2T C;  2J7Z A;  1BR9 A;  1G91 A;  2KEE A;  2L55 A;  3S1N B;  3S14 B;  2K04 A;  3R8B A;  1QG7 A;  4DFA A;  2MJ8 A;  4IQZ A;  4EQN A;  2ZT9 C;  1XWE A;  3OWE B;  3BYT B;  4C56 C;  3I91 A;  5KEE A;  2AQ3 B;  1QJO A;  4WRD A;  5C3E B;  5IT9 E;  4HSV A;  1DOK A;  4RKB A;  3VR6 A;  2PW7 A;  1BO0 A;  2F0I A;  1OO9 B;  2HCC A;  2OT2 A;  2JA7 B;  1EIH A;  4A3I B;  1KLG D;  5JVH 3;  1L0X B;  1A3U A;  5FLX E;  5T1G A;  1X3Q A;  5KGU A;  4G7O C;  3ZYY X;  3J7A V;  2O4X A;  5C3X A;  1E2Z A;  3C1F A;  4WOR A;  3URY A;  4ZAI A;  2FMC A;  2EDG A;  4EVO A;  4ZKC B;  5CMD A;  3R2T A;  2F3V A;  1HTL D;  5CBE E;  2CW0 D;  1W6K A;  3U9S A;  4BA1 I;  1I4R A;  2B63 B;  4DNT B;  1K83 B;  3NQT A;  1TY0 A;  3AMU A;  1D1I A;  2R92 B;  4RGO S;  1G8Z D;  1KLU D;  3TZU A;  4HN7 A;  2YU9 B;  4M8A A;  5JPM C;  1WTO A;  5LHY 1;  1H9M A;  2OEO A;  1S4Z A;  3FVQ A;  1QCB D;  2WKD A;  4ZLT F;  1F9R A;  5C5M A;  1SEB D;  5J39 A;  5FO9 B;  3FPP A;  2EJG C;  1CZG A;  4KTA A;  5C0X G;  1SYC A;  4S3S A;  3E6Z X;  3A8J E;  4B9W A;  4XT3 B;  1FYC A;  3J7Y W;  4K5W A;  4G7H C;  1O78 A;  5A2Q E;  1Y1V B;  1DZ1 A;  1EZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...