1B50A

Nmr structure of human mip-1a d26a, 10 structures
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
69
structure length
69
Chain Sequence
SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIP-1A
publication title Identification of amino acid residues critical for aggregation of human CC chemokines macrophage inflammatory protein (MIP)-1alpha, MIP-1beta, and RANTES. Characterization of active disaggregated chemokine variants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
total genus 3
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b50A00
4RWSC 5E4WC 1EIHA 4IUQA 1XYIA 1O7YA 5T1GA 4QUFA 1DZ1A 3F2UA 1F9SA 2KEEA 3I8ZA 5DNFA 2K1BA 4MHEA 4X3TA 4CJ1B 3SVMA 2L9HA 1DOMA 4R9WA 3KBXA 2K03A 1RTOA 1U4PA 3I3CA 4U68A 1WD1A 2IL8A 1MGSA 1WTWA 1CA6A 5JJZA 5CBEE 1F9PA 2VXWA 2B2TA 2B2VC 2FINB 2K01A 3DM1A 3TN2A 1GUWA 2EOTA 4MN3A 1HFGA 1M8AA 1Q3LA 3FDTA 3I90A 1PLFA 2K28A 1G6ZA 2KVMA 1WVLA 3DEPA 2B2YC 2N55A 1C8CA 3G7LA 1LV9A 1G91A 1HA6A 2M2LA 5D65A 1X3QA 1B4OA 1NR2A 1DONA 2HDMA 2L11A 1EL0A 2B2WA 2KUMA 5T1IA 4LMQD 3MTSA 1IKMA 2FMMA 3ONAB 1SAPA 1F9QA 2EPBA 2X6LA 1ESRA 1G2SA 1VMCA 2RSNA 4X3KA 4ZKCB 2RA4A 2B2TC 5CMDA 2MJ8A 1BBXC 1PFNA 2FJ2A 2Q8TA 3R93A 4R8IA 5EPLA 1AZQA 4CJ2C 1J9OA 2RSOA 2XIWA 2BDNA 2EE1A 1MSGA 1PFBA 1HRJA 3LWEA 4IUUA 5COYA 4IUPA 2R3ZA 2DY7A 2B2WC 1AP0A 2K04A 3GV3A 1WTVA 1S4ZA 1KNEA 4XT3B 2CVRA 2J7ZA 4X3UA 4CJ0B 1ILQA 3KUPA 1PDQA 4IURA 1SDFA 1HUMA 2L12A 2L4NA 3N52A 1BF4A 1DOLA 3I91A 4UAIA 5EPJA 4DN4M 1WD0A 3H91A 1O80A 4RA8A 1PFMA 1NCVA 1X3PA 2KOLA 3IL8A 5AFWA 1A15A 1X32A 3Q6SA 1B3AA 1G2TA 1ML0D 1RHPA 2FHTA 4XT1B 5D14A 1MSHA 2D9UA 1QG7A 3DEOA 1KNAA 1QNKA 4HSVA 1U4LA 1SSOA 2B2UA 2HCIA 5EKIA 1MI2A 1NR4A 1U4MA 1NAPA 1E0BA 1U4RA 1IL8A 1O7ZA 2RVLA 5EQ0A 5CORA 1JE4A 3GV6A 1WTOA 1XX8A 2MPMA 4ZLTF 1WTRA 1WTPA 2SDFA 1F2LA 2JP1A 2HUGA 1B53A 4X3SA 1WTQA 2H1EA 4IUTA 2MP1A 2N88A 3MWYW 1ICWA 1RODA 3IFDA 4OIJA 1VMPA 2NYZD 4NW2A 1BNZA 4O42A 1WTXA 1CA5A 1IKLA 4HAEA 4XDXA 2Q8RE 1DOKA 2KEDA 1AZPA 1TVXA 3FPUB 2FFKB 4OIKA 5EJWA 4ZAIA 2X6GA 4HEDA 1CM9A 2HDLA 2L1BA 2NWGA 1JICA 1EQTA 2B2UC 1ZXTA 1BO0A 3HP3A 3QO2A 4IUVA 3UI2A 1B2TA 1B50A 1J8IA 1HFNA 1F9RA 2KECA 1RTNA 5E4XA 5EPKA 1HUNA 2JYOA 4HCSA 1HHVA 2B2VA 3TZDA 2DY8A 2X69A 1RJTA 5CBAE 1EIGA 3P7JA 4RAUC 4ZKBB 2NZ1D 4QUCA 1QE6A 2HCCA 2MGSA 1ILPA 3D6WA 2B2YA 4ZK9B 2K05A 1EOTA
chains in the Genus database with same CATH superfamily
3S17B 3KDFA 4A3MH 1DJRD 5CR3A 1YNXA 2Q2IA 4JI1Q 3I8ZA 5DNFA 2NN6G 1SR3A 4R9WA 1EYAA 1XPOA 1CA6A 1HZ9A 4KY6A 1JB7A 4EX5A 1VQCA 2B2VC 5F2DA 4CGYB 2HHHQ 1EU3A 1E3PA 3VR4A 4A3MB 4DV3Q 2NB0A 2VQEQ 3A5ZB 2F03A 1SJED 4NXML 1Y1VG 2F0OA 2SEBD 2B2WA 1L1OC 3PUZA 2E2JH 1U0LA 2PNHA 1YNND 4A3EG 2F0NA 3I4MB 4OL7A 1QZHA 2EPBA 1G291 1DCZA 3H15A 3AMUA 3PIO3 1PXUA 4A3FB 4EQPA 3KDFB 1KRTA 2M00A 2VB2X 2XIWA 3G71A 3ND8A 2E2HH 3RNUA 2NVXH 3NQIA 2DN8A 4IUPA 4RGNA 5KYIA 3J7AV 1S4ZA 1UE6A 4A3LG 2UXDQ 2KBNA 1KHIA 4CBVA 1XPRA 2QDBA 5J39A 2CVRA 4IFDJ 1F2YA 2K33A 5EPJA 3OSOA 2E2HB 1RIPA 4GKJL 4QCLA 4BA1I 3MXPA 5DEHA 4IPDA 4RHSA 1GHJA 1K0RA 1TWHH 3SK8A 3WOEA 3V05A 4X66L 1MIUA 2ZJQA 3RLFA 3J81c 4WJ3M 2O4XA 3P1HA 1NAPA 1U4RA 2YYZA 4OHJA 1VS0A 2Z6KA 1WTOA 1ZYRC 4JBMA 4NXNQ 1Q1BA 1B53A 4K8IA 1PV4A 1IBKQ 1TWHB 1IXRA 3IFDA 1JJCB 1VMPA 1B1ZA 1Y1WB 2KCCA 2UXBQ 3AFPA 1GM5A 4A3KB 3T1HL 3CC4A 4IUVA 1ZXTA 3OTOQ 1LM0A 4JI7Q 5IYCG 2K75A 3P7JA 2UUCQ 1LT4D 2F0GA 3FP9A 1T9HA 1YITA 3L0OA 4FYDA 5GAGC 4RG1A 1CSPA 3MEHA 1F9SA 4IN3A 3EVQA 1PTOC 4U68A 1YJWA 3I3CA 2VY3A 2EYLA 1WJJA 1EWCA 3NE5B 2EOTA 1FNVA 3BYTB 4M8AA 2KVMA 2BH2A 4OO1G 3QOJA 1QJOA 1LV9A 1YBYA 1SMYD 5HGQA 4GKKQ 3D31A 5E7NA 3HKZE 2OXPA 1PRTF 1RF2D 2EYPA 2SNSA 3J81i 4AQYQ 4NB3A 2ZM6Q 2PZTA 1EY8A 3PO3H 3S9WA 1M1KC 4PNYA 5IGBA 4GLVB 3V96A 3LGJA 2D62A 1AZQA 2K5WA 3M85A 1Y69U 2BDNA 4N9TA 1O78A 3KF8B 2OCEA 1HJPA 3TQYA 1Y8PB 2DY7A 2VQFQ 5KIXA 1EFWA 1N36L 3PO3B 2PPBC 3C2PA 1YJNA 3S15H 1MBYA 2L4NA 3J81j 1SEBD 3M9BA 3VA7A 4POFA 2NVQB 3RLOA 4DNRB 1HR0Q 2F3WA 2ZTEA 4YHHQ 5LMNW 3E0EA 1KNAA 3S15B 1I4GA 1MI2A 3HOZB 4KD4A 3C1FA 3S2DH 2E5LL 2ZTDA 4JV5Q 4CDDC 2VS1A 5E3FA 4IZ8A 1LACA 4BXXH 3FVQA 4IUTA 1HNZL 2DUDA 4MIUA 2ZJRA 1VDZA 4XDXA 3S2DB 4BY7H 1HNWQ 1Y14B 1EWHA 4POGA 1KRSA 1CM9A 2HDLA 4J15A 2B63G 3DWPA 3SHLA 4I65A 1VQLA 2PW5A 3S16B 1V1QA 1HA5A 4DV4Q 1RL2A 3VR3A 4FXGC 3F2BA 2X69A 1YNJD 4UP8A 1QOHA 2NZ1D 1JE5A 1H9KA 3HOYG 2F4IA 1VQNA 3S1NH 4L5TA 5E4WC 1SYCA 4P75A 4HR7B 3ZYYX 4A93H 3LX0A 2LMCB 2BA1A 4CKEA 2FXQA 1I4RA 4V0BA 2OTLA 1KQSA 4YY3Q 2VXWA 4S3SA 4DPGA 4A3IG 1LO5D 2EY6A 1K0SA 2PW7A 4EVOA 1RKNA 4A93B 2Z8LA 3URYA 1HA6A 2M2LA 5D65A 5GADC 2JA5H 1B4OA 2LY7A 5FO9B 4JI8L 3HOXG 1MD2D 5C6AA 1LTID 1HNXQ 1EY7A 1PRTD 4F7XA 1J5EL 3ONAB 2WV6D 2VW9A 1JT8A 3RN5A 1I6VC 4WORA 1H9RA 4L5QA 3RZOH 2KA7A 4ZUIA 1BOSA 1D5XC 2K4KA 3PO2G 3IRBA 4B08A 1SNPA 3E5SA 1W6JA 4KHVA 2B2WC 4RGTA 4BBRG 5ELFA 4KY7A 3HOVB 5M3MG 3UDXA 4E6IA 4JI6L 2XTIA 4CKCA 1A3VA 2F0DA 2UXCQ 1LTLA 3EJIA 4TVAB 3CU7A 1LT5D 1SLJA 3QR8A 1ICFB 1K3RA 2QCPX 4NDXA 1JB3A 3PCOB 2RDFA 1U4MA 2R93B 1E0BA 3ERSX 5C4ZA 3HKZG 3GTLH 3FPPA 4PZ8A 3ULLA 4IPGA 2JA8G 5IP9H 3E3XA 1YNNC 1XWEA 4B3RL 3EA6A 3L7ZC 3EIVA 1NTGA 1Q12A 1R9TH 1AZPA 1STNA 2QGQA 1QVGA 3H3VH 3CW2C 4LF7L 1G8ZD 2XNAC 4J6HA 4YWKA 3UI2A 3HG9A 1PRTB 2KECA 4GS3A 4K5VA 1PH2A 2TSSA 1X54A 2Z6KC 4QJFA 1UEAB 1NSNS 1TS3A 3CRKC 5FJ8G 1R9TB 1F77A 2B2YA 3J80E 2AQ1B 1X3EA 3LNNA 1EIHA 1XYIA 2XN9C 3A8IE 4NP5A 3SVMA 4OX9L 1WD1A 1H9SA 1KAAA 4KKUA 2E8GA 5C0XH 3BVGA 1V1PA 2AWOA 5IYBH 1PH3A 2Q2TA 3GTPB 1WOCA 3JAME 1EYGA 4UY8C 2F52A 3G7LA 3I56A 3GTKH 5K36G 4ZRZA 4DV0L 1V9PA 1V1OA 2LS01 4DR3Q 1AEXA 4YWMA 4KD3A 4OWWB 3OWEB 1B8AA 3VYRA 4DUZQ 2PZWA 2KHIA 4L5RC 3GTKB 5M3FH 5EPLA 1FD7D 3VYTA 4QF4A 3AYHB 3PIP3 1E2ZA 3T4AC 1I3QH 1SRUA 1PFBA 5FLXE 4K6DA 3AB9A 4XQNA 5M5XH 5A2QE 2R3ZA 1H9SB 1ET6A 4HMJA 4XT3B 2RCNA 1PVOA 3Q23A 5M3FB 3HOUH 1PDQA 1XNQQ 1HUMA 2JJQA 1GO3E 4UAIA 4FF1A 1I3QB 4LF5L 2R92B 5L37A 1VQOA 5M5XB 3M4YA 5IE8A 2J4XA 1MSHA 1WI5A 4HSVA 2B29A 4K2LA 4GN4B 5AJ3L 4RGOS 5IYDH 3HOUB 2K6AA 3A56A 4PQXA 1SMYC 2MPMA 2KHJA 4G7ZC 4ODGA 1SE3A 3W2DA 2Y0SE 2ATWA 1NMFA 2NVYH 1ICWA 2A1AA 5IWAQ 3NBIA 5EBDA 5D3IB 1KXLA 2K14A 2F0PA 5CC4A 4G7OC 2OEOA 4QGUA 4HMIA 2AHOB 2R7ZH 3A0JA 1HUNA 1WCMG 4P74A 2A68D 4XIGS 3J7ZC 3T1YL 4P71A 3BG3A 2NVYB 1ZKOA 3NEMA 3IKJA 1CSQA 4RAUC 4X62Q 2A6HD 1ILPA 3E0JA 5C44G 5LHY1 1Y1VB 3K57A 3H0GH 4QUFA 3F2UA 4A3EB 4CJ1B 2LXKA 3PQIA 2ASBA 4B3TQ 3PIOA 1QCBD 2B2TA 3DM1A 3OYYA 2B8FA 1BUVT 4OGQC 1TKWB 1OTCA 4A3CG 1X9NA 2K7VA 3H0GB 1G6ZA 1N9WA 4LFAQ 2EY2A 4QIWB 1TWCB 4IPCA 3ER0A 2L11A 5FO8B 1I6HH 1AN8A 4V190 1E22A 2UUAL 3ITPA 3LWUA 3N6RA 4MNOA 2CW0C 4FF2A 4DA2A 4AYBG 1L0XB 3PUXA 4HIKA 5CV7A 5C0XJ 1C0AA 3X3MA 4LUOA 4HSPA 3OIQA 5ELCA 1D7QA 4UP7A 4BWGB 1AFPA 2JA6H 2GVBA 1MSGA 1W2BA 1Z47A 3PSIA 3NPPA 4IUUA 1SYGA 4XYOA 1GXDC 2YTVA 2KHSA 1OXUA 4WRDA 1XNRL 1FYCA 1SDFA 3I91A 5IGCA 2JA6B 2NUCA 1N33L 1XMQL 1NCVA 4RCOA 4LFCQ 4H13C 4JYAL 3Q6SA 1BCPC 4PMBA 2I5MX 3VYSA 2FHTA 3CRLC 4DR4Q 4X65L 3GTOH 1N34L 3GDEA 5IP7H 4A3BG 1IL8A 1S5FD 1XX8A 4XYQA 3K5MA 1WTPA 2O2LD 4DXFA 3D6CA 3PUVA 2N88A 3MWYW 4OIJA 4NW2A 1FJGL 2F0LA 1Y8OB 2KEDA 3A55A 4HCEA 3GTOB 1FL0A 4YCVA 5C4XG 3G6JB 3H3VC 3HP3A 1TY2A 1X3GA 2XVSA 2VUMH 4J8QA 3TZDA 4ZYSA 4Z9CB 2WB1B 1L0YB 2RHQB 1YHQA 2ZXRA 1CFMA 4HJ5A 1IYUA 4RWSC 5EKLA 2CHBD 2B8GA 2ZT9C 3NP8A 1EEID 2M9VA 3CPFA 1LTSD 3NHHA 1VQAA 2VUMB 1EIFA 1BVSA 3NUCA 4RCNA 2JEAI 2E2DC 4LFBL 1D8LA 2DJFC 3HOWG 5EBCA 3BZDB 5LMUQ 4KMUC 4JI3Q 1F9PA 3PF5A 1EY9A 3F2DA 4DR2Q 1IBLL 3C3LA 1ESFA 2B2YC 5IT9L 2Y0SG 1K83H 3VR2A 2JEBI 1UWVA 3BU2A 3CCQA 2VZAA 2HT1A 1ESRA 4BY1H 3R3OA 1ONLA 5LMNL 2OQ0A 1I50H 4MZ9A 1WFQA 2PQEA 1BBXC 4A4IA 1VQ6A 4OXPA 2IHEA 1S3OA 1K83B 2AQ3B 1PH8A 3I4MH 1SYFA 2EYJA 4IUNA 4ME3A 4P72A 1MJEA 3CF5A 4DAYA 1HZBA 2YTXA 1WTVA 4BY1B 4A3FH 2A69D 1SN8A 1IBMQ 1TWGH 3Q22A 1I50B 4DV6L 3AFQA 1I4HA 2AWNA 2CCZA 4KY5A 3U9OA 1O7IA 5JJKA 1Z7TA 2B39A 1EQRA 3A7AB 4JBKA 4LF9Q 1EZ8A 4QY7A 4FO2A 3SEBA 1TWGB 1I5FA 1GUSA 2PI2E 3NK9A 4DNTB 2TMPA 2ZXOA 4KI0A 1PHJA 1SFOB 1VF5C 3I4LA 3HOYB 2MP1A 2AQ2B 1RODA 2F0HA 5FOBB 4DAYB 1K28A 2Q8RE 3L3OC 1YVCA 5C4JH 3GTGB 4H7BA 4NMZA 3FKIH 3CD6A 1PZID 1BO0A 1ZEQX 3VA5A 3GTJH 1BQQT 1H9JA 3RMHA 2ICIA 3MHBA 1Y1WH 3X3NA 2P5ZX 1H95A 5ELDA 4A3KH 5C4JB 4CDFC 3I4NG 3CHBD 3KYHC 3FKIB 1VQ4A 1VQ8A 5T1GA 5IT9c 3GTJB 4G7HC 4DR7L 3KJPA 4XQJA 1HTLD 3HRZC 5JPNC 3M4OB 5DM63 4JI5Q 2XSCA 1XMOL 3CCJA 1PYWD 2VL6A 3NSWA 1F2ZA 1WVLA 4K5XA 4K14A 2K52A 3CCRA 5G3LF 4JI4Q 2BE5C 3KLRA 2SOBA 1E1TA 1Q81C 5M3MB 4HN7A 3KF8A 2DGYA 5C3WA 5DM73 2RA4A 2B2TC 4H0LC 2MJ8A 3K5LA 2NVTH 3M7NA 2A68C 2C5CA 2ZTCA 4IFDG 4DR6L 3LWEA 2A6HC 4BBSB 1HRJA 1AP0A 1GOZA 4A3DG 1TS4A 4B3SQ 1KNEA 1PA6A 3MXUA 2NVTB 2JA8B 3S14H 4DV7Q 1UUPA 4IURA 2L12A 2IY5B 3EBEA 1EWIA 2QA4A 3HKSA 3KLSA 1CKMA 3E9IA 1B9NA 1DD2A 1HQRD 3W5OA 1STGA 2HCIA 1EY5A 4IPHA 4WJWA 3TP7A 4H02A 1NR4A 4K5WA 3S14B 1DXMA 4JI0L 2NVQH 5FLMH 3DLLA 5C3EG 2BCOA 4LAAA 3W1BA 4X64Q 3J81E 4ZCKA 3HOZH 1GUOA 1CA5A 4O42A 4DAVA 2LSSA 3J80L 1WTXA 4HAEA 4N8X1 5EJWA 4ZAIA 4BA2I 1SXTA 1GD7A 3BJUA 2F0FA 3QO2A 2LXJA 1EQQA 3BDLA 2JA7G 2JYOA 1EUJA 3A8JE 4DR1L 2LKVA 1Q7YC 2WKDA 1QE6A 4DV1L 3D6WA 3SE0A 1A63A 2K05A 1EOTA 3KFUA 3S16H 2MFIA 2QILA 1HH2P 3DMUA 2JE6I 1NBWA 3D8GA 4KHZA 2WACA 4K0KL 4KTAA 1DOMA 3KBXA 4F87A 1TS2A 4A76A 3S24A 1VQ7A 1MGSA 4PMCA 1I94L 2D0PA 3U4ZA 4A3MG 1M8AA 3PIPA 5CV9A 3W3AA 1IW7D 4QB4A 2AMCB 1DONA 5BR8Q 1IZ6A 5GROA 5G3LD 3D4DA 1VQDA 5A2QL 4LMQD 3D3RA 2UU9L 1B3QA 1QWYA 2OF1A 3D4WA 4LF8Q 4R4OA 5CV4A 1G2SA 4OWTB 2H4OA 5CMDA 1Q8IA 2NN6I 2PCFB 3BDCA 1NNXA 1MJCA 2WKCA 2UUBL 2RSOA 4UHVA 4GN5A 4FVMA 1PH5A 4L6TB 4C2MH 2K5NA 2F0TA 3GV3A 4B3TL 5EGTA 3RLNA 2D0OA 4B9WA 4B3ML 4NXMQ 1BR9A 3I2ZA 4JBWA 1VQBA 2QW7A 2WAQB 4C2MB 1XTCD 3HOVH 3NQTA 1ML0D 2CFMA 3W1GA 4C3JH 5EKKA 3ULJA 1L2FA 4C3HB 5KGUA 3NTHA 3Q8DA 3S1MH 2RVLA 3B6YA 5D3DA 3HFZB 3TSSA 3EROA 2QF7A 1K73C 1TWFH 3U4VA 5JEAH 3A5UA 5C44B 4C3JB 4LF4L 4AH6A 5KRUA 2R93H 2F0MA 1STAA 1DOKA 1T5EA 1U9RA 3S1MB 1CZWA 4DUYL 1FVIA 2H5XA 3AQQA 4A3JH 2E74C 1TWFB 1STBA 1F9RA 1JOQA 3OMCA 4PV1C 4GKJQ 5I6YA 1OO9B 4LF6L 4HCSA 2GVAA 2F1MA 5IGEA 1K9MC 4O0AA 2R7DA 4X66Q 2A69C 2MGSA 3CCMA 2D5DA 4DV5L 3P20A 5TSSA 1DM0B 4A3JB 1SNDA 4GN3B 3S2HH 3I72A 1GKHA 2V1CC 4DR5L 4DR4L 2K1BA 1B44D 4P2CB 3CAMA 2CWAA 2L9HA 2K03A 1Q86C 4AYBE 2R6GA 3M3YH 3NXWA 4XXEA 3L2PA 2K01A 3CKIB 1HFGA 3T56B 3S2HB 3T1HQ 2F4VL 1D5MC 1X3QA 1QB5D 1Z9FA 2A5HA 3J80i 2L0CA 3M3YB 3C46A 3GTPH 1O7LA 4KK7A 1UE5A 3MA2B 3BDOA 5CV6A 1DGSA 1GVPA 4TSSA 4QMGA 2RSNA 3CCSA 2AUJD 1HQMC 3R93A 3QWNA 1CT1D 4DV2L 5KYLA 4Q5VA 4RMFA 3SK6A 1KABA 3PO3G 2G9DA 4M1UB 3G4SA 4IFDI 1KLGD 1N32L 3K8AA 1EY0A 1IHZA 1B9MA 2EJGC 3SDZA 3OIPA 4OO1I 3V2TA 4R4IA 1KAWA 4G57A 1S5BD 5M9OA 1VQMA 4CDEC 3KK7A 1DOLA 1WD0A 4KHPL 5LL6X 4YWLA 1KTKA 2RDGA 1PFMA 2PMZB 1J6QA 1PH6A 5C4XB 1ASYA 5ELEA 5EKIA 1IL2A 4EQOA 2N3SA 1E1OA 1DYQA 2R92H 4JI1L 4ILWA 1W3SA 3R2TA 1I4QA 1X6OA 4RGMA 2V4DA 2CH4W 1D5ZC 2Z4IA 1IKLA 1N36Q 4IO9A 2HHHL 1R4QB 1G6PA 2FFKB 5KNDA 2K5VA 4DV3L 4BXXG 4C3IB 2VQEL 4A3GH 2MO0A 1AE3A 2NWGA 3HOWB 3U58A 4LUZA 1J8IA 3RUZA 5EPKA 2HQEA 2A19A 5DLQE 1UAPA 4BY7G 3I7FA 2WP8J 1JWUD 5JEAJ 2IT1A 3OW2A 4RH6A 4JVZA 3I70A 2HQLA 1OXXK 2EXDA 2E5LQ 4A3GB 3Q0AA 4NKLA 5EAYA 4R1JA 1KLUD 1VQFA 2A6ED 4B9XA 3QJYA 3S1RB 4JW0A 1HNZQ 3SXHA 1WTWA 1Y1VH 2EIFA 5IGFA 1STHA 4K8JA 2HD3A 4A93G 3K58A 2UXDL 1Q3LA 4A3EH 4Q0FA 4I7AA 1VQHA 1Q46A 1HPCA 1G91A 2O5IC 1TWAH 4I7ZC 1R4PB 1EL0A 1CHQD 2EJMA 3MFGA 1CKNB 3BVMA 1LABA 5IGGA 2A8VA 3MAQA 1F9QA 3A54A 4DK6C 5IIFA 2JA5G 1TWCH 1GJXA 1EYCA 1VQIA 2C35B 1KL9A 1LTTD 1PFNA 1TWAB 2FJ2A 2F0SA 4DXGA 5CV8A 1RCVD 3RR5A 4NXNL 1IBKL 4XTCS 3HOVG 2K04A 2K50A 4C1NK 1WTHA 2UXBL 1KC8C 5IGDA 1KDAA 1A3TA 4JI5L 2J7ZA 1TU2B 5J3BA 1D1IA 2KENA 4JG2A 1S5CD 1X56A 4AIMA 1UE7A 3AU7A 4JI8Q 3OTOL 1Z6HA 4JI7L 1J5EQ 5JJIA 3IL8A 5AFWA 4HIOA 2L15A 2NZOA 2UUCL 4XT1B 4WFN3 1ENAA 2EZVA 3L9AX 4GLAC 4R8NA 1YNJC 3VDYA 1JWMD 1Q82C 4QIWE 3HS0C 4HJAA 4Y52H 2H1EA 5CYUA 1PFSA 5IY0A 1LTAD 2CQAA 3NWTA 2NTSA 4ZUJA 5IYCH 2QDLA 2ES2A 2RDHA 4APVA 2F3IA 4JI6Q 5IP9G 5H1SE 2AKWB 4GNXA 1EQTA 1SYEA 4GKKL 1ASZA 1TR5A 1PH1A 3CCLA 4KV6A 3ERQA 1WYDA 3RZDB 1EIGA 4AQYL 3E6ZX 5BN3A 2ZM6L 4UP9A 4X3SA 3QG1A 1VQGA 1PRTC 1IYVA 4IUQA 1HCZA 3DWQA 4IQZA 1O7YA 3K0XA 3C1EA 2R7FA 2K5QA 2IPKD 4OO1H 1RTOA 4MTKA 2IL8A 1JJ2A 2VQFL 4B3RQ 1RDPD 2RCFA 3H09A 1YZ6A 2MQHA 3FHWA 4MN3A 1TQOA 2K28A 4LF7Q 2N55A 3IAYA 5C0XG 2N8NA 2MHVA 1NR2A 1JOOA 4C56C 1BDOA 4GNXB 4A3DB 1HR0L 5IYBG 3MTSA 4KKTA 1IKMA 2FMMA 4YHHL 4UDUC 2K32A 2E2IB 3DUZA 2JA9A 3CCEA 1VMCA 2WINB 4JV5L 4FF4A 1A0IA 2I5HA 1II3A 4N8FA 4TKOB 2EQSA 4CJ2C 1J9OA 3A74A 4PG3A 3BS1A 4OX9Q 2G5DA 3QB3A 1UNSA 3J7A5 2F0KA 1K3BC 2WB1E 3S1QB 4TRDA 3VYUA 2DJGC 2EDGA 2QKIC 1MHWC 2EYOA 3DM3A 5M3FG 1HNWL 1E2WA 2L55A 3ULPA 4X3UA 1YEZA 1ILQA 2R92G 1BXTA 4K6LA 2WIIB 1X55A 4DV0Q 4DV4L 2CQOA 3A7LA 5I6WA 1CQVA 1CUKA 2KOLA 3TRZA 2NBFA 3MXNA 1B3AA 3T51B 5FKAC 1QNUA 4J1MA 5GAEC 5D14A 3WWVA 3HOUG 1QG7A 3UDIA 1U4LA 1SSOA 2A74C 2BDOA 1LLRD 1O7ZA 5GAHC 2XGTA 4KJOA 1WTRA 4JCVE 5ISRA 2JP1A 2B63H 1UEBA 1WTQA 4R4CA 3Q24A 5IYDG 1ENFA 2KQ3A 3TS2A 4YY3L 3MC0B 2IX1A 3PF4A 4XQQA 1SFOH 2KCNA 1JICA 3HOYH 1B2TA 1TIID 4X6AH 2B63B 4LF5Q 3D0FA 3VR6A 1JWSD 1HNXL 3FRPB 2OTJA 3GTGH 2K5HA 3R2IA 2HCCA 1D2BA 3I4OA 2A73B 3MXNB 3SK4A 2R7ZG 1YHBA 5AJ3Q 4F88A 4FF3A 4DKAC 2EY5A 4A3IH 2E75C 3TMEA 1EZ6A 1SE2A 2SNMA 3IFTA 3PUWA 1EIYB 3MFYA 2HIVA 1QZGA 4CDCC 3HOXH 3H0GG 3NTKA 3TN2A 2E2JB 4MTNA 4A3IB 2RF4A 1C8CA 3EQLC 5C5LA 3M4OH 2UXCL 1C7YA 3T1YQ 2CWPA 4HJ8A 2KUMA 1CKOA 1Q8KA 5T1IA 2OWOA 4DAPA 1RD9D 4KLKA 3HOXB 5JJLA 1GUTA 3PO2H 4DAMA 3STBD 4O2DA 2NVXB 1SROA 3TP5A 1QVCA 3CQZH 3K80C 3PV0A 4G4KA 2NTTA 4BBRH 4H44C 2E76C 5M3MH 1Y8NB 4Y7NH 1A8VA 1YIJA 3PO2B 1TT2A 3TP8A 5I9OA 1CZGA 2WFWA 3CQZB 4ABNA 2Z1CA 3CC7A 4LUVA 1HZAA 2XWBB 2JA6G 4CJ0B 4BBRB 3PUYA 4ID6A 3FEWX 2A6EC 3OMGA 3OPOA 4BBSH 4DN4M 3PMFA 4F8MA 4GOPA 4Y7NB 1O80A 4RA8A 1X3PA 1XPUA 4L63B 2UUAQ 2RBMA 1HXYD 2JA8H 2XWJB 4HIMA 3CC2A 1STEA 5CORA 2NZHA 3MXGA 4ZLTF 3KLWA 1F2LA 2HUGA 4JOIA 1MKHA 3HKZB 4YCUA 1E24A 1HTPA 1BNZA 1HR0W 5IP7G 3HZXA 2LFNA 3M4PA 1XNRQ 1SYBA 3CP0A 4FXKC 2R61A 2MO1A 1BBWA 5J1ZA 5FJ8H 3GTQH 1BCPF 1E2VA 4OEMB 2WB1G 1RTNA 2I46A 1N33Q 2AUKA 5E1FA 4HJ7A 1A6XA 4QL5A 1XMQQ 2I0QA 4JYAQ 4GOPB 4DR3L 1KIXA 1CI3M 2F0WA 1ENCA 2VNUD 4X65Q 2L1BA 4DUZL 1N34Q 2VUMG 2ZJPA 3H3VI 3GTQB 5ELBA 1EEFD 3UE0A 2KEEA 1GUGA 1PH7A 5BN4A 5JVG3 1G51A 1K8OA 1U4PA 4GNXC 4ALPA 1SNMA 3PGZA 1FR3A 3K5OA 5HURA 1EY4A 1VQ9A 5K36H 3K0YA 5CBEE 5IT9E 1FJGQ 1NY4A 5IODA 1EOVA 3I90A 3ICEA 1FNWA 4EGVA 2Q2UA 1CTMA 1AH9A 1XNQL 2EJFC 3MZ5A 4JI2Q 4BS9A 3JAML 5C0XI 4JK1C 1SAPA 2YU9H 3HEJA 2O5JC 1AW7A 4X3KA 4ZKCB 1V8QA 4RHRA 1C9OA 3GP7A 2ID0A 1U5KA 4FXDA 2IX0A 3WOFA 2MUYA 4ULLA 1XXGA 1KDCA 4LFBQ 4BY1G 4DGZA 4RKLA 5JAVA 3WDNA 5IWAL 2YU9B 3TEHB 4L5SA 1B7YB 1I4XA 2IWHA 5FLXL 1IBLQ 3EFXD 1VF7A 3I4MG 5FO7B 3N52A 2CW0D 3P75A 3TS0A 2YTYA 4A3FG 1PMRA 1NJIC 1X32A 4X62L 1IYJB 4DK0A 3D4RA 5LMNQ 5EQ0A 3TZUA 5HGTA 4BY7B 1OXTA 1K8AC 2DNCA 4FP5D 4C3HH 3BYYB 1WCMH 1A3UA 5KNBA 2EYHA 4QQBX 2X6GA 4DV6Q 4LFAL 5DAUA 5C44H 1BCPD 3I55A 3S1NB 1EYDA 1B50A 3J80c 5E4XA 1CQFA 1LTRD 2BOSA 2J0TD 2RKSA 3RD4A 1RJTA 1WCMB 2CKZB 2BA0A 4QUCA 4LK1C 2N78A 2Q2HA 3FKIG 1VQEA 3NBHA 4IALA 1BKBA 5J22A 1E7ZA 4NPSA 1Y1WG 1Q90A 3VR5A 3R8BA 4A3CH 1ET9A 1QILA 4ZQ3A 5C3XA 4A3KG 3OWFA 2F0EA 5CV5A 1A2TA 2WAQE 4R4QA 1QUQA 3JAMc 2JA5B 4OELB 3U9SA 2JN4A 3UDFA 2FINB 1D6EC 1GUWA 1TY0A 4O1NA 3FDTA 4KKSA 3I73A 1Q1EA 4P73A 1NMGA 3RN2A 3RZOB 5C4HA 2ZXPA 1JCKB 4LFCL 5ELOA 3GQBA 2ALYB 3T53B 5FK9C 3QOLA 2OT2A 4AYBB 5FLXc 4LNQA 3NBHB 2JSOA 2Q8TA 3O13A 3DWAA 1K8GA 4DR7Q 4BBSG 4DU9A 1OXVA 1STYA 4GZYC 4K2KA 1SBBB 1QUQB 1NUCA 1XMOQ 3SR1A 1BCPB 1SMXA 4DK3C 3F2CA 2PNRC 1FGBD 4L8JA 3J7AF 1CHPD 2CH4A 1C4QA 2EVBA 3KBGA 4A3BH 1PTOF 3GTLB 1A15A 1SNOA 3NELA 4DNIA 2HIXA 1RHPA 2F0JA 1YJ9A 1H9MA 2B2UA 2Z6BA 5M5YH 3OHXC 5I4DA 1AE2A 2YV5A 3CCUA 1QVFA 3JAMi 5LL6S 5C4XH 2PQAA 4A3BB 3GO5A 2SDFA 3H94A 4KN7C 4DR6Q 5LMUL 3STBC 4JI3L 4GOPC 4KJNA 4PZ7A 2JXMB 5M5YB 3FMCA 3K81C 5FLMG 1XTDA 1TVXA 3MEFA 4OIKA 1S5ED 4DR2L 1VCIA 4HEDA 2BH8A 3HOZG 3GTMH 2FMCA 1HHVA 1LT3D 1FGUA 2B2VA 1JQYD 5M5WH 1EY6A 2ICEC 4YIJA 4ZKBB 4JOIC 1JR0D 1YHAA 4C3IH 4HTHA 4ZK9B 2PZUA 2PO4A 3HOWH 1HFNA 3ND9A 5CGKA 4JI0Q 4DF7A 5KNCA 1L1OA 3SGIA 2XRSD 5BN5A 3GTMB 4MHEA 4X3TA 3CMEA 4JC0A 2PMZE 5M5WB 2PQAB 2IHFA 1JORA 3AEVA 2L5TA 1IBML 1CKNA 4OONA 1UE1A 2EYMA 1TS5A 1P16A 1PYBA 3S1RH 2NN6H 1JOKA 1LTBD 1SE4A 5I2YA 3NWSA 5ELNA 1L0WA 1TXYA 1ZYRD 2C9OA 1V1PB 3GD7A 3KJOA 4IOCA 4DR1Q 2Y0SB 4LF9L 1JC7A 5NUCA 2G9HD 5KEEA 4RKBA 4DV1Q 4DK1A 1K8MA 2X6LA 3UDGA 2VB3X 3CCVA 2RHSB 4EQNA 3TREA 4R8IA 2Q8IB 1EQVA 3JC66 4K0KQ 1VQJA 3UE1A 2EYFA 1L1OB 3BVZA 5JPMC 2F0VA 3EN2A 2EE1A 3DXJC 3F1ZA 1S72A 1LYLA 2K5DA 3NTIA 4YCWA 3DHQA 1I94Q 1A2UA 3G6EA 1CK1A 4HJ9A 1LT6D 2OQKA 3TBIB 2BE5D 5IOCA 3E9HA 1BBUA 4TQUS 2IW3A 1GHKA 3M4QA 2WAQG 3H91A 3K5NA 1PTOD 1D1KA 1EU4A 4KN4C 1G2TA 4N9PA 2EXZA 4C3HG 2UU9Q 3K7AH 5C5MA 2QEJC 4A3LH 3DEOA 1QNKA 1GUNA 1FNUA 4LJZC 1I4PA 1VQPA 1SJHD 1S40A 1JE4A 3GV6A 4HIDA 2UUBQ 3KF6A 4C3JG 1EFID 2R7ZB 3K7AB 3CPWA 2F0QA 2KCMA 3KLSX 3FPUB 4LW1A 4IJHA 3TP6A 1SNQA 5JEAG 3MVVA 1V43A 3F8TA 3I4NH 4B3MQ 5JVH3 1PZJD 3A8KE 1PH9A 1SE8A 2JK8A 2R93G 4JI4L 2DY8A 2JQOA 1IW7C 1JMCA 1XJVA 4WJ4A 4A3JG 3TDQA 2QEXA 1YI2A 4R4TA 2MNAA 3T16A 4ME5A 3I4NB 1DZ1A 4JBJA 3RZDH 1PTOH 1P8LA 1VQKA 3KF6B 3J7YW 5K5PA 1PH4A 4LF4Q 1JJGA 5JJZA 4A75A 1I6HB 2N49A 2XRQD 4B3SL 1SNCA 2IX3A 4DUYQ 1PLFA 1A62A 1PZKD 4DV7L 3DEPA 2GA4B 1PTOB 2F0UA 2HDMA 3CXCA 2Z0SA 4LF6Q 4IJLA 1M90C 1F2MA 3U50C 2F0IA 5A35A 4IFDH 4DV5Q 3M7GA 2DNEA 2B3GA 4LWCA 4A3DH 1X65A 2Z9HA 4DR5Q 1PYSB 3SK5A 4X64L 1C48A 3ZJYC 2E2IH 2F3VA 5COYA 3QIAA 3OW7A 2I07B 1VQ5A 4PMWA 2GN5A 1LUZA 3K7UC 3KUPA 2F4VQ 4RFBA 3S1QH 1M4VA 2KJXA 4IOAA 2RQXA 1BF4A 3K59A 4FNFA 1X3FA 2PYKA 3BZCA 4GLXA 1T5XD 4U673 5C3EH 1N8RC 1W6KA 2D9UA 1NE3A 4UPAA 4JI2L 3BZKA 4C1NI 1S5DD 4CKBA 1HZCA 5I2XA 5JOBA 5I9PA 3OOCA 4FDBA 4DV2Q 3T13A 3G48A 5C3EB 2I5LX 2NYZD 3CMAA 4OWXB 2JA7H 1N32Q 4EQ5A 4CHTB 4C3IG 3J81L 2PI2A 2EY1A 1LTGD 3H6MA 1SYDA 4PZ6A 3S17H 3HGBA 2B2UC 1B70B 2ENBA 3NENA 5BR8L 4KHPQ 5GQOA 2IJ0A 2D2CC 2Z4HA 5CBAE 1KD1C 2JA7B 4JPBW 1KDBA 3K6OA 3KOJA 5HY6A 4DFAA 4A3GG 1OXSC 4LF8L 2KCTA
chains in the Genus database with same CATH topology
3S17B 1DJRD 5CR3A 3I8ZA 5DNFA 2NN6G 4R9WA 1EYAA 1CA6A 4KY6A 5F2DA 2B2VC 4CGYB 1EU3A 3VR4A 4A3MB 2NB0A 2F03A 1SJED 2F0OA 2SEBD 2B2WA 3PUZA 1YNND 2F0NA 3I4MB 4OL7A 2EPBA 1G291 1DCZA 3AMUA 3PIO3 1PXUA 4A3FB 4EQPA 2M00A 2VB2X 2XIWA 3ND8A 3NQIA 2DN8A 4IUPA 4RGNA 5KYIA 3J7AV 1S4ZA 4CBVA 2QDBA 5J39A 2CVRA 4IFDJ 1F2YA 2K33A 5EPJA 3OSOA 2E2HB 4QCLA 4BA1I 3MXPA 5DEHA 4RHSA 1GHJA 3SK8A 3WOEA 3V05A 3RLFA 2O4XA 3P1HA 1NAPA 1U4RA 2YYZA 4OHJA 1WTOA 1ZYRC 1Q1BA 1B53A 4K8IA 1TWHB 3IFDA 1VMPA 1B1ZA 1Y1WB 2KCCA 4A3KB 4IUVA 1ZXTA 3P7JA 1LT4D 2F0GA 4FYDA 3MEHA 1F9SA 4IN3A 3EVQA 1PTOC 4U68A 3I3CA 2EYLA 1EWCA 3NE5B 2EOTA 1FNVA 3BYTB 4M8AA 2KVMA 4OO1G 3QOJA 1QJOA 1LV9A 1SMYD 3D31A 2OXPA 1PRTF 1RF2D 2EYPA 2SNSA 2PZTA 1EY8A 3S9WA 4PNYA 5IGBA 3V96A 2D62A 1AZQA 2K5WA 3M85A 1Y69U 2BDNA 4N9TA 1O78A 1Y8PB 2DY7A 5KIXA 3PO3B 2PPBC 3C2PA 1MBYA 2L4NA 1SEBD 3VA7A 2NVQB 4DNRB 2F3WA 1KNAA 3S15B 1I4GA 1MI2A 3HOZB 4KD4A 3C1FA 5E3FA 4IZ8A 1LACA 3FVQA 4IUTA 4MIUA 1VDZA 4XDXA 3S2DB 1EWHA 1CM9A 2HDLA 3DWPA 3SHLA 4I65A 2PW5A 3S16B 1HA5A 3VR3A 4FXGC 2X69A 1YNJD 1QOHA 2NZ1D 1H9KA 2F4IA 5E4WC 1SYCA 4HR7B 3ZYYX 3LX0A 2LMCB 2BA1A 4CKEA 1I4RA 4V0BA 2VXWA 4S3SA 1LO5D 2EY6A 2PW7A 4EVOA 1RKNA 4A93B 2Z8LA 3URYA 1HA6A 2M2LA 5D65A 1B4OA 2LY7A 5FO9B 1MD2D 5C6AA 1LTID 1EY7A 1PRTD 4F7XA 3ONAB 2WV6D 1I6VC 4WORA 1H9RA 2KA7A 4ZUIA 1BOSA 1D5XC 4B08A 1SNPA 3E5SA 1W6JA 4KHVA 2B2WC 4RGTA 5ELFA 4KY7A 3HOVB 4E6IA 4CKCA 1A3VA 2F0DA 3EJIA 3CU7A 1LT5D 2QCPX 4NDXA 1JB3A 2RDFA 1U4MA 2R93B 1E0BA 5C4ZA 3FPPA 1YNNC 1XWEA 3EA6A 3L7ZC 1Q12A 1AZPA 1STNA 1G8ZD 2XNAC 4J6HA 3UI2A 3HG9A 1PRTB 2KECA 4K5VA 2TSSA 1UEAB 1NSNS 1TS3A 3CRKC 1R9TB 1F77A 2B2YA 3J80E 2AQ1B 1EIHA 3LNNA 1XYIA 2XN9C 3A8IE 4NP5A 3SVMA 1WD1A 1H9SA 1KAAA 4KKUA 5C0XH 3BVGA 1V1PA 2AWOA 3GTPB 3JAME 3G7LA 5K36G 4ZRZA 1V1OA 2LS01 1AEXA 4KD3A 3OWEB 3VYRA 2PZWA 3GTKB 5EPLA 1FD7D 3VYTA 4QF4A 3PIP3 1E2ZA 3T4AC 1PFBA 5FLXE 4K6DA 3AB9A 4XQNA 5A2QE 2R3ZA 1H9SB 1ET6A 4HMJA 4XT3B 3Q23A 5M3FB 1PDQA 1HUMA 4UAIA 4FF1A 1I3QB 2R92B 5M5XB 3M4YA 2J4XA 1MSHA 4HSVA 4K2LA 4RGOS 3HOUB 2K6AA 3A56A 4PQXA 1SMYC 2MPMA 4G7ZC 4ODGA 1SE3A 3W2DA 1ICWA 3NBIA 5EBDA 5D3IB 2F0PA 5CC4A 4G7OC 2OEOA 4HMIA 1HUNA 2A68D 4XIGS 3BG3A 2NVYB 1ZKOA 3IKJA 4RAUC 2A6HD 1ILPA 3E0JA 5LHY1 1Y1VB 3K57A 4QUFA 3F2UA 4A3EB 4CJ1B 1QCBD 2B2TA 3DM1A 4OGQC 2B8FA 1BUVT 1TKWB 2K7VA 3H0GB 1G6ZA 2EY2A 4QIWB 1TWCB 2L11A 5FO8B 1AN8A 4V190 3ITPA 3LWUA 3N6RA 4FF2A 2CW0C 4DA2A 1L0XB 3PUXA 5CV7A 5C0XJ 3X3MA 4HSPA 3OIQA 5ELCA 4BWGB 1AFPA 1MSGA 1Z47A 3NPPA 4IUUA 1SYGA 4XYOA 1GXDC 2KHSA 1OXUA 4WRDA 1FYCA 1SDFA 3I91A 5IGCA 2JA6B 2NUCA 1NCVA 4RCOA 4H13C 3Q6SA 1BCPC 4PMBA 3VYSA 2FHTA 3CRLC 1IL8A 1S5FD 1XX8A 4XYQA 3K5MA 1WTPA 2O2LD 4DXFA 3D6CA 3PUVA 2N88A 3MWYW 4OIJA 4NW2A 2F0LA 1Y8OB 2KEDA 3A55A 4HCEA 3GTOB 3G6JB 3H3VC 3HP3A 1TY2A 2XVSA 4J8QA 3TZDA 4ZYSA 4Z9CB 2WB1B 1L0YB 2ZXRA 1CFMA 1IYUA 4RWSC 5EKLA 2CHBD 2B8GA 2ZT9C 3NP8A 1EEID 2M9VA 1LTSD 3NHHA 2VUMB 3NUCA 2JEAI 4RCNA 2E2DC 5EBCA 3BZDB 4KMUC 1F9PA 1EY9A 3C3LA 1ESFA 2B2YC 5IT9L 3VR2A 2JEBI 1ESRA 3R3OA 1ONLA 2PQEA 1BBXC 1K83B 2AQ3B 1SYFA 2EYJA 4IUNA 4DAYA 1WTVA 4BY1B 2A69D 3Q22A 1I50B 1I4HA 2AWNA 4KY5A 3U9OA 1Z7TA 2B39A 3A7AB 1EZ8A 4FO2A 3SEBA 1TWGB 1GUSA 3NK9A 4DNTB 2TMPA 2ZXOA 4KI0A 1SFOB 1VF5C 3I4LA 3HOYB 2MP1A 2AQ2B 1RODA 2F0HA 5FOBB 2Q8RE 3L3OC 3GTGB 4H7BA 4NMZA 1PZID 1BO0A 1ZEQX 3VA5A 1BQQT 1H9JA 3RMHA 2ICIA 3MHBA 3X3NA 5ELDA 5C4JB 3CHBD 3FKIB 5T1GA 3GTJB 4G7HC 4XQJA 1HTLD 3HRZC 5JPNC 3M4OB 5DM63 2XSCA 1PYWD 3NSWA 1F2ZA 1WVLA 4K5XA 4K14A 5G3LF 2BE5C 3KLRA 2SOBA 5M3MB 4HN7A 3KF8A 5C3WA 5DM73 2RA4A 2B2TC 4H0LC 2MJ8A 3K5LA 3M7NA 2A68C 2C5CA 4IFDG 1HRJA 3LWEA 2A6HC 4BBSB 1AP0A 1GOZA 1TS4A 1KNEA 3MXUA 2NVTB 2JA8B 1UUPA 4IURA 2L12A 3KLSA 1B9NA 1DD2A 1HQRD 1STGA 2HCIA 1EY5A 4WJWA 3TP7A 1NR4A 4K5WA 3S14B 1DXMA 2BCOA 4LAAA 3J81E 1GUOA 1CA5A 4O42A 4DAVA 3J80L 1WTXA 4HAEA 5EJWA 4ZAIA 4BA2I 1SXTA 2F0FA 3QO2A 3BDLA 2JYOA 3A8JE 2LKVA 2WKDA 1QE6A 3D6WA 3SE0A 2K05A 1EOTA 2QILA 3DMUA 2JE6I 3D8GA 4KHZA 2WACA 4KTAA 1DOMA 3KBXA 4F87A 1TS2A 1MGSA 4PMCA 1M8AA 5CV9A 3W3AA 1IW7D 4QB4A 1DONA 5G3LD 3D4DA 5A2QL 4LMQD 3D3RA 2OF1A 1QWYA 3D4WA 5CV4A 1G2SA 2H4OA 5CMDA 1Q8IA 2NN6I 2PCFB 3BDCA 2WKCA 2RSOA 4FVMA 4L6TB 2F0TA 3GV3A 5EGTA 4B9WA 1BR9A 4JBWA 4C2MB 2WAQB 1XTCD 3NQTA 1ML0D 5EKKA 4C3HB 5KGUA 3NTHA 2RVLA 5D3DA 3TSSA 3EROA 2QF7A 5JEAH 5C44B 4C3JB 5KRUA 2F0MA 1STAA 1DOKA 1T5EA 1U9RA 3S1MB 1CZWA 2E74C 1TWFB 1STBA 1F9RA 1JOQA 4PV1C 3OMCA 5I6YA 1OO9B 4HCSA 2F1MA 5IGEA 2A69C 2MGSA 2D5DA 3P20A 5TSSA 1DM0B 4A3JB 1SNDA 3I72A 2K1BA 1B44D 4P2CB 2L9HA 2K03A 2R6GA 3NXWA 4XXEA 2K01A 3CKIB 1HFGA 3T56B 3S2HB 1D5MC 1X3QA 1QB5D 2A5HA 2L0CA 3M3YB 3C46A 1O7LA 4KK7A 3MA2B 3BDOA 5CV6A 4TSSA 4QMGA 2RSNA 2AUJD 1HQMC 3R93A 3QWNA 1CT1D 5KYLA 4Q5VA 3SK6A 1KABA 2G9DA 4M1UB 4IFDI 1KLGD 1EY0A 1IHZA 1B9MA 2EJGC 3SDZA 3OIPA 4OO1I 3V2TA 4G57A 1S5BD 5M9OA 3KK7A 1DOLA 1WD0A 5LL6X 1KTKA 2RDGA 1PFMA 2PMZB 5C4XB 5ELEA 5EKIA 4EQOA 1DYQA 4ILWA 3R2TA 1I4QA 4RGMA 2V4DA 1D5ZC 2Z4IA 1IKLA 1R4QB 2FFKB 5KNDA 4C3IB 2NWGA 3HOWB 1J8IA 3RUZA 5EPKA 2HQEA 1UAPA 2WP8J 1JWUD 5JEAJ 2IT1A 4RH6A 3I70A 1OXXK 4A3GB 3Q0AA 4NKLA 1KLUD 2A6ED 4B9XA 3QJYA 3S1RB 3SXHA 1WTWA 5IGFA 1STHA 4K8JA 3K58A 1Q3LA 4Q0FA 1HPCA 1G91A 2O5IC 4I7ZC 1R4PB 1EL0A 1CHQD 2EJMA 3MFGA 3BVMA 1LABA 5IGGA 3MAQA 1F9QA 3A54A 5IIFA 1GJXA 1EYCA 1LTTD 1PFNA 1TWAB 2FJ2A 2F0SA 4DXGA 5CV8A 1RCVD 4XTCS 2K04A 4C1NK 5IGDA 1KDAA 1A3TA 2J7ZA 1TU2B 1D1IA 1S5CD 3AU7A 1Z6HA 3IL8A 5AFWA 4XT1B 4WFN3 1ENAA 2EZVA 3L9AX 4R8NA 1YNJC 1JWMD 3HS0C 2H1EA 5CYUA 1LTAD 2CQAA 3NWTA 2NTSA 4ZUJA 2RDHA 1EQTA 1SYEA 1TR5A 4KV6A 3ERQA 3RZDB 1EIGA 3E6ZX 5BN3A 4X3SA 3QG1A 1PRTC 1IYVA 4IUQA 1HCZA 3DWQA 4IQZA 1O7YA 3C1EA 2K5QA 2IPKD 4OO1H 1RTOA 2IL8A 1RDPD 4MN3A 3H09A 1TQOA 2K28A 2N55A 3IAYA 5C0XG 2MHVA 1NR2A 1JOOA 4C56C 1BDOA 4A3DB 3MTSA 4KKTA 1IKMA 2FMMA 4UDUC 2K32A 2E2IB 3DUZA 1VMCA 2WINB 4FF4A 4TKOB 1II3A 4CJ2C 1J9OA 3BS1A 3QB3A 1UNSA 2F0KA 3S1QB 4TRDA 3VYUA 2EDGA 2QKIC 2EYOA 1E2WA 2L55A 4X3UA 1ILQA 1BXTA 4K6LA 2WIIB 3A7LA 5I6WA 1CQVA 2KOLA 2NBFA 3MXNA 1B3AA 3T51B 5FKAC 1QNUA 4J1MA 5D14A 1QG7A 1U4LA 1SSOA 2A74C 2BDOA 1LLRD 1O7ZA 4KJOA 1WTRA 5ISRA 2JP1A 1WTQA 3Q24A 1ENFA 2KQ3A 3MC0B 2IX1A 4XQQA 2KCNA 1JICA 1B2TA 1TIID 2B63B 3VR6A 1JWSD 3FRPB 3R2IA 2HCCA 1D2BA 2A73B 3SK4A 4F88A 4FF3A 2EY5A 2E75C 3TMEA 1EZ6A 1SE2A 2SNMA 3IFTA 3PUWA 3MFYA 3NTKA 3TN2A 2E2JB 4A3IB 1C8CA 3EQLC 5C5LA 2KUMA 5T1IA 4DAPA 1RD9D 3HOXB 1GUTA 2NVXB 3TP5A 3PV0A 4G4KA 2NTTA 4H44C 2E76C 1Y8NB 3PO2B 1TT2A 3TP8A 5I9OA 1CZGA 3CQZB 4ABNA 2Z1CA 2XWBB 4CJ0B 4BBRB 3PUYA 4ID6A 3FEWX 2A6EC 3OMGA 3OPOA 4DN4M 3PMFA 4F8MA 4Y7NB 1O80A 4RA8A 1X3PA 4L63B 2RBMA 1HXYD 2XWJB 1STEA 5CORA 3MXGA 4ZLTF 1F2LA 2HUGA 3HKZB 1HTPA 1BNZA 3HZXA 2LFNA 1SYBA 2R61A 4FXKC 5J1ZA 1BCPF 1E2VA 1RTNA 2I46A 2AUKA 5E1FA 1A6XA 1CI3M 2F0WA 1ENCA 2VNUD 2L1BA 3GTQB 5ELBA 1EEFD 2KEEA 1GUGA 5BN4A 5JVG3 1K8OA 1U4PA 1SNMA 1FR3A 3K5OA 5HURA 1EY4A 5K36H 3K0YA 5CBEE 5IT9E 5IODA 3I90A 1FNWA 4EGVA 1CTMA 2EJFC 3MZ5A 4BS9A 3JAML 5C0XI 4JK1C 1SAPA 3HEJA 2O5JC 1AW7A 4X3KA 4ZKCB 1V8QA 4RHRA 3GP7A 2ID0A 4FXDA 2IX0A 3WOFA 2MUYA 4ULLA 1XXGA 1KDCA 4DGZA 4RKLA 5JAVA 3WDNA 2YU9B 1I4XA 2IWHA 5FLXL 3EFXD 1VF7A 5FO7B 3N52A 2CW0D 3P75A 1PMRA 1X32A 4DK0A 3D4RA 5EQ0A 3TZUA 5HGTA 4BY7B 1OXTA 2DNCA 4FP5D 3BYYB 1A3UA 5KNBA 2EYHA 2X6GA 5DAUA 1BCPD 3S1NB 1EYDA 1B50A 5E4XA 1CQFA 1LTRD 2BOSA 2J0TD 2RKSA 3RD4A 1RJTA 1WCMB 2BA0A 4QUCA 4LK1C 3NBHA 4IALA 5J22A 1Q90A 3VR5A 3R8BA 1ET9A 1QILA 4ZQ3A 5C3XA 3OWFA 2F0EA 5CV5A 1A2TA 2JA5B 3U9SA 2FINB 1D6EC 1GUWA 1TY0A 4O1NA 3FDTA 4KKSA 3I73A 1Q1EA 3RZOB 5C4HA 2ZXPA 1JCKB 3GQBA 3T53B 5FK9C 3QOLA 2OT2A 4AYBB 2JSOA 2Q8TA 3O13A 3DWAA 4DU9A 1OXVA 1STYA 4GZYC 4K2KA 1SBBB 1NUCA 3SR1A 1BCPB 2PNRC 1FGBD 4L8JA 3J7AF 1CHPD 2EVBA 1C4QA 3KBGA 1PTOF 3GTLB 1A15A 1SNOA 1RHPA 2F0JA 1H9MA 2B2UA 3OHXC 5I4DA 5LL6S 4A3BB 3GO5A 2SDFA 3H94A 4KN7C 4KJNA 2JXMB 5M5YB 3FMCA 1TVXA 4OIKA 1S5ED 1VCIA 4HEDA 2FMCA 1HHVA 1LT3D 2B2VA 1JQYD 1EY6A 2ICEC 4YIJA 4ZKBB 1JR0D 4HTHA 4ZK9B 2PZUA 2PO4A 1HFNA 3ND9A 5CGKA 4DF7A 5KNCA 2XRSD 5BN5A 3GTMB 4MHEA 4X3TA 5M5WB 1JORA 2L5TA 2EYMA 1TS5A 2NN6H 1JOKA 1LTBD 1SE4A 5I2YA 3NWSA 1ZYRD 2C9OA 1V1PB 3GD7A 2Y0SB 1JC7A 5NUCA 2G9HD 5KEEA 4RKBA 4DK1A 1K8MA 2X6LA 2VB3X 4EQNA 4R8IA 2Q8IB 1EQVA 2EYFA 3BVZA 5JPMC 2F0VA 3DXJC 2EE1A 2K5DA 3NTIA 3DHQA 1A2UA 1CK1A 1LT6D 3TBIB 2BE5D 5IOCA 4TQUS 2IW3A 1GHKA 3H91A 3K5NA 1PTOD 1D1KA 1EU4A 4KN4C 1G2TA 4N9PA 2EXZA 4C3HG 5C5MA 2QEJC 3DEOA 1QNKA 1GUNA 1FNUA 4LJZC 1I4PA 1SJHD 1JE4A 3GV6A 4C3JG 1EFID 2R7ZB 3K7AB 2F0QA 3KLSX 3FPUB 3TP6A 1SNQA 5JEAG 3MVVA 1V43A 5JVH3 1PZJD 3A8KE 2DY8A 1IW7C 3TDQA 3T16A 4ME5A 3I4NB 1DZ1A 1PTOH 3J7YW 5K5PA 5JJZA 1I6HB 2XRQD 1SNCA 2IX3A 1PLFA 1PZKD 3DEPA 2GA4B 1PTOB 2F0UA 2HDMA 1F2MA 2F0IA 5A35A 4IFDH 3M7GA 2DNEA 3SK5A 1C48A 2F3VA 5COYA 3QIAA 3OW7A 2I07B 4PMWA 3KUPA 4RFBA 1M4VA 2KJXA 2RQXA 1BF4A 3K59A 4FNFA 2PYKA 1T5XD 4U673 1W6KA 2D9UA 4C1NI 1S5DD 4CKBA 5I2XA 5JOBA 5I9PA 3OOCA 3T13A 5C3EB 2NYZD 4CHTB 4C3IG 3J81L 2EY1A 1LTGD 3H6MA 1SYDA 3HGBA 2B2UC 2ENBA 2IJ0A 2D2CC 2Z4HA 5CBAE 2JA7B 1KDBA 3K6OA 4DFAA 1OXSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RWS C;  5E4W C;  1EIH A;  4IUQ A;  1XYI A;  1O7Y A;  5T1G A;  4QUF A;  1DZ1 A;  3F2U A;  1F9S A;  2KEE A;  3I8Z A;  5DNF A;  2K1B A;  4MHE A;  4X3T A;  4CJ1 B;  3SVM A;  2L9H A;  1DOM A;  4R9W A;  3KBX A;  2K03 A;  1RTO A;  1U4P A;  3I3C A;  4U68 A;  1WD1 A;  2IL8 A;  1MGS A;  1WTW A;  1CA6 A;  5JJZ A;  5CBE E;  1F9P A;  2VXW A;  2B2T A;  2B2V C;  2FIN B;  2K01 A;  3DM1 A;  3TN2 A;  1GUW A;  2EOT A;  4MN3 A;  1HFG A;  1M8A A;  1Q3L A;  3FDT A;  3I90 A;  1PLF A;  2K28 A;  1G6Z A;  2KVM A;  1WVL A;  3DEP A;  2B2Y C;  2N55 A;  1C8C A;  3G7L A;  1LV9 A;  1G91 A;  1HA6 A;  2M2L A;  5D65 A;  1X3Q A;  1B4O A;  1NR2 A;  1DON A;  2HDM A;  2L11 A;  1EL0 A;  2B2W A;  2KUM A;  5T1I A;  4LMQ D;  3MTS A;  1IKM A;  2FMM A;  3ONA B;  1SAP A;  1F9Q A;  2EPB A;  2X6L A;  1ESR A;  1G2S A;  1VMC A;  2RSN A;  4X3K A;  4ZKC B;  2RA4 A;  2B2T C;  5CMD A;  2MJ8 A;  1BBX C;  1PFN A;  2FJ2 A;  2Q8T A;  3R93 A;  4R8I A;  5EPL A;  1AZQ A;  4CJ2 C;  1J9O A;  2RSO A;  2XIW A;  2BDN A;  2EE1 A;  1MSG A;  1PFB A;  1HRJ A;  3LWE A;  4IUU A;  5COY A;  4IUP A;  2R3Z A;  2DY7 A;  2B2W C;  1AP0 A;  2K04 A;  3GV3 A;  1WTV A;  1S4Z A;  1KNE A;  4XT3 B;  2CVR A;  2J7Z A;  4X3U A;  4CJ0 B;  1ILQ A;  3KUP A;  1PDQ A;  4IUR A;  1SDF A;  1HUM A;  2L12 A;  2L4N A;  3N52 A;  1BF4 A;  1DOL A;  3I91 A;  4UAI A;  5EPJ A;  4DN4 M;  1WD0 A;  3H91 A;  1O80 A;  4RA8 A;  1PFM A;  1NCV A;  1X3P A;  2KOL A;  3IL8 A;  5AFW A;  1A15 A;  1X32 A;  3Q6S A;  1B3A A;  1G2T A;  1ML0 D;  1RHP A;  2FHT A;  4XT1 B;  5D14 A;  1MSH A;  2D9U A;  1QG7 A;  3DEO A;  1KNA A;  1QNK A;  4HSV A;  1U4L A;  1SSO A;  2B2U A;  2HCI A;  5EKI A;  1MI2 A;  1NR4 A;  1U4M A;  1NAP A;  1E0B A;  1U4R A;  1IL8 A;  1O7Z A;  2RVL A;  5EQ0 A;  5COR A;  1JE4 A;  3GV6 A;  1WTO A;  1XX8 A;  2MPM A;  4ZLT F;  1WTR A;  1WTP A;  2SDF A;  1F2L A;  2JP1 A;  2HUG A;  1B53 A;  4X3S A;  1WTQ A;  2H1E A;  4IUT A;  2MP1 A;  2N88 A;  3MWY W;  1ICW A;  1ROD A;  3IFD A;  4OIJ A;  1VMP A;  2NYZ D;  4NW2 A;  1BNZ A;  4O42 A;  1WTX A;  1CA5 A;  1IKL A;  4HAE A;  4XDX A;  2Q8R E;  1DOK A;  2KED A;  1AZP A;  1TVX A;  3FPU B;  2FFK B;  4OIK A;  5EJW A;  4ZAI A;  2X6G A;  4HED A;  1CM9 A;  2HDL A;  2L1B A;  2NWG A;  1JIC A;  1EQT A;  2B2U C;  1ZXT A;  1BO0 A;  3HP3 A;  3QO2 A;  4IUV A;  3UI2 A;  1B2T A;  1B50 A;  1J8I A;  1HFN A;  1F9R A;  2KEC A;  1RTN A;  5E4X A;  5EPK A;  1HUN A;  2JYO A;  4HCS A;  1HHV A;  2B2V A;  3TZD A;  2DY8 A;  2X69 A;  1RJT A;  5CBA E;  1EIG A;  3P7J A;  4RAU C;  4ZKB B;  2NZ1 D;  4QUC A;  1QE6 A;  2HCC A;  2MGS A;  1ILP A;  3D6W A;  2B2Y A;  4ZK9 B;  2K05 A;  1EOT A; 
#chains in the Genus database with same CATH topology
 3S17 B;  3KDF A;  4A3M H;  1DJR D;  5CR3 A;  1YNX A;  2Q2I A;  4JI1 Q;  3I8Z A;  5DNF A;  2NN6 G;  1SR3 A;  4R9W A;  1EYA A;  1XPO A;  1CA6 A;  1HZ9 A;  4KY6 A;  1JB7 A;  4EX5 A;  1VQC A;  2B2V C;  5F2D A;  4CGY B;  2HHH Q;  1EU3 A;  1E3P A;  3VR4 A;  4A3M B;  4DV3 Q;  2NB0 A;  2VQE Q;  3A5Z B;  2F03 A;  1SJE D;  4NXM L;  1Y1V G;  2F0O A;  2SEB D;  2B2W A;  1L1O C;  3PUZ A;  2E2J H;  1U0L A;  2PNH A;  1YNN D;  4A3E G;  2F0N A;  3I4M B;  4OL7 A;  1QZH A;  2EPB A;  1G29 1;  1DCZ A;  3H15 A;  3AMU A;  3PIO 3;  1PXU A;  4A3F B;  4EQP A;  3KDF B;  1KRT A;  2M00 A;  2VB2 X;  2XIW A;  3G71 A;  3ND8 A;  2E2H H;  3RNU A;  2NVX H;  3NQI A;  2DN8 A;  4IUP A;  4RGN A;  5KYI A;  3J7A V;  1S4Z A;  1UE6 A;  4A3L G;  2UXD Q;  2KBN A;  1KHI A;  4CBV A;  1XPR A;  2QDB A;  5J39 A;  2CVR A;  4IFD J;  1F2Y A;  2K33 A;  5EPJ A;  3OSO A;  2E2H B;  1RIP A;  4GKJ L;  4QCL A;  4BA1 I;  3MXP A;  5DEH A;  4IPD A;  4RHS A;  1GHJ A;  1K0R A;  1TWH H;  3SK8 A;  3WOE A;  3V05 A;  4X66 L;  1MIU A;  2ZJQ A;  3RLF A;  3J81 c;  4WJ3 M;  2O4X A;  3P1H A;  1NAP A;  1U4R A;  2YYZ A;  4OHJ A;  1VS0 A;  2Z6K A;  1WTO A;  1ZYR C;  4JBM A;  4NXN Q;  1Q1B A;  1B53 A;  4K8I A;  1PV4 A;  1IBK Q;  1TWH B;  1IXR A;  3IFD A;  1JJC B;  1VMP A;  1B1Z A;  1Y1W B;  2KCC A;  2UXB Q;  3AFP A;  1GM5 A;  4A3K B;  3T1H L;  3CC4 A;  4IUV A;  1ZXT A;  3OTO Q;  1LM0 A;  4JI7 Q;  5IYC G;  2K75 A;  3P7J A;  2UUC Q;  1LT4 D;  2F0G A;  3FP9 A;  1T9H A;  1YIT A;  3L0O A;  4FYD A;  5GAG C;  4RG1 A;  1CSP A;  3MEH A;  1F9S A;  4IN3 A;  3EVQ A;  1PTO C;  4U68 A;  1YJW A;  3I3C A;  2VY3 A;  2EYL A;  1WJJ A;  1EWC A;  3NE5 B;  2EOT A;  1FNV A;  3BYT B;  4M8A A;  2KVM A;  2BH2 A;  4OO1 G;  3QOJ A;  1QJO A;  1LV9 A;  1YBY A;  1SMY D;  5HGQ A;  4GKK Q;  3D31 A;  5E7N A;  3HKZ E;  2OXP A;  1PRT F;  1RF2 D;  2EYP A;  2SNS A;  3J81 i;  4AQY Q;  4NB3 A;  2ZM6 Q;  2PZT A;  1EY8 A;  3PO3 H;  3S9W A;  1M1K C;  4PNY A;  5IGB A;  4GLV B;  3V96 A;  3LGJ A;  2D62 A;  1AZQ A;  2K5W A;  3M85 A;  1Y69 U;  2BDN A;  4N9T A;  1O78 A;  3KF8 B;  2OCE A;  1HJP A;  3TQY A;  1Y8P B;  2DY7 A;  2VQF Q;  5KIX A;  1EFW A;  1N36 L;  3PO3 B;  2PPB C;  3C2P A;  1YJN A;  3S15 H;  1MBY A;  2L4N A;  3J81 j;  1SEB D;  3M9B A;  3VA7 A;  4POF A;  2NVQ B;  3RLO A;  4DNR B;  1HR0 Q;  2F3W A;  2ZTE A;  4YHH Q;  5LMN W;  3E0E A;  1KNA A;  3S15 B;  1I4G A;  1MI2 A;  3HOZ B;  4KD4 A;  3C1F A;  3S2D H;  2E5L L;  2ZTD A;  4JV5 Q;  4CDD C;  2VS1 A;  5E3F A;  4IZ8 A;  1LAC A;  4BXX H;  3FVQ A;  4IUT A;  1HNZ L;  2DUD A;  4MIU A;  2ZJR A;  1VDZ A;  4XDX A;  3S2D B;  4BY7 H;  1HNW Q;  1Y14 B;  1EWH A;  4POG A;  1KRS A;  1CM9 A;  2HDL A;  4J15 A;  2B63 G;  3DWP A;  3SHL A;  4I65 A;  1VQL A;  2PW5 A;  3S16 B;  1V1Q A;  1HA5 A;  4DV4 Q;  1RL2 A;  3VR3 A;  4FXG C;  3F2B A;  2X69 A;  1YNJ D;  4UP8 A;  1QOH A;  2NZ1 D;  1JE5 A;  1H9K A;  3HOY G;  2F4I A;  1VQN A;  3S1N H;  4L5T A;  5E4W C;  1SYC A;  4P75 A;  4HR7 B;  3ZYY X;  4A93 H;  3LX0 A;  2LMC B;  2BA1 A;  4CKE A;  2FXQ A;  1I4R A;  4V0B A;  2OTL A;  1KQS A;  4YY3 Q;  2VXW A;  4S3S A;  4DPG A;  4A3I G;  1LO5 D;  2EY6 A;  1K0S A;  2PW7 A;  4EVO A;  1RKN A;  4A93 B;  2Z8L A;  3URY A;  1HA6 A;  2M2L A;  5D65 A;  5GAD C;  2JA5 H;  1B4O A;  2LY7 A;  5FO9 B;  4JI8 L;  3HOX G;  1MD2 D;  5C6A A;  1LTI D;  1HNX Q;  1EY7 A;  1PRT D;  4F7X A;  1J5E L;  3ONA B;  2WV6 D;  2VW9 A;  1JT8 A;  3RN5 A;  1I6V C;  4WOR A;  1H9R A;  4L5Q A;  3RZO H;  2KA7 A;  4ZUI A;  1BOS A;  1D5X C;  2K4K A;  3PO2 G;  3IRB A;  4B08 A;  1SNP A;  3E5S A;  1W6J A;  4KHV A;  2B2W C;  4RGT A;  4BBR G;  5ELF A;  4KY7 A;  3HOV B;  5M3M G;  3UDX A;  4E6I A;  4JI6 L;  2XTI A;  4CKC A;  1A3V A;  2F0D A;  2UXC Q;  1LTL A;  3EJI A;  4TVA B;  3CU7 A;  1LT5 D;  1SLJ A;  3QR8 A;  1ICF B;  1K3R A;  2QCP X;  4NDX A;  1JB3 A;  3PCO B;  2RDF A;  1U4M A;  2R93 B;  1E0B A;  3ERS X;  5C4Z A;  3HKZ G;  3GTL H;  3FPP A;  4PZ8 A;  3ULL A;  4IPG A;  2JA8 G;  5IP9 H;  3E3X A;  1YNN C;  1XWE A;  4B3R L;  3EA6 A;  3L7Z C;  3EIV A;  1NTG A;  1Q12 A;  1R9T H;  1AZP A;  1STN A;  2QGQ A;  1QVG A;  3H3V H;  3CW2 C;  4LF7 L;  1G8Z D;  2XNA C;  4J6H A;  4YWK A;  3UI2 A;  3HG9 A;  1PRT B;  2KEC A;  4GS3 A;  4K5V A;  1PH2 A;  2TSS A;  1X54 A;  2Z6K C;  4QJF A;  1UEA B;  1NSN S;  1TS3 A;  3CRK C;  5FJ8 G;  1R9T B;  1F77 A;  2B2Y A;  3J80 E;  2AQ1 B;  1X3E A;  3LNN A;  1EIH A;  1XYI A;  2XN9 C;  3A8I E;  4NP5 A;  3SVM A;  4OX9 L;  1WD1 A;  1H9S A;  1KAA A;  4KKU A;  2E8G A;  5C0X H;  3BVG A;  1V1P A;  2AWO A;  5IYB H;  1PH3 A;  2Q2T A;  3GTP B;  1WOC A;  3JAM E;  1EYG A;  4UY8 C;  2F52 A;  3G7L A;  3I56 A;  3GTK H;  5K36 G;  4ZRZ A;  4DV0 L;  1V9P A;  1V1O A;  2LS0 1;  4DR3 Q;  1AEX A;  4YWM A;  4KD3 A;  4OWW B;  3OWE B;  1B8A A;  3VYR A;  4DUZ Q;  2PZW A;  2KHI A;  4L5R C;  3GTK B;  5M3F H;  5EPL A;  1FD7 D;  3VYT A;  4QF4 A;  3AYH B;  3PIP 3;  1E2Z A;  3T4A C;  1I3Q H;  1SRU A;  1PFB A;  5FLX E;  4K6D A;  3AB9 A;  4XQN A;  5M5X H;  5A2Q E;  2R3Z A;  1H9S B;  1ET6 A;  4HMJ A;  4XT3 B;  2RCN A;  1PVO A;  3Q23 A;  5M3F B;  3HOU H;  1PDQ A;  1XNQ Q;  1HUM A;  2JJQ A;  1GO3 E;  4UAI A;  4FF1 A;  1I3Q B;  4LF5 L;  2R92 B;  5L37 A;  1VQO A;  5M5X B;  3M4Y A;  5IE8 A;  2J4X A;  1MSH A;  1WI5 A;  4HSV A;  2B29 A;  4K2L A;  4GN4 B;  5AJ3 L;  4RGO S;  5IYD H;  3HOU B;  2K6A A;  3A56 A;  4PQX A;  1SMY C;  2MPM A;  2KHJ A;  4G7Z C;  4ODG A;  1SE3 A;  3W2D A;  2Y0S E;  2ATW A;  1NMF A;  2NVY H;  1ICW A;  2A1A A;  5IWA Q;  3NBI A;  5EBD A;  5D3I B;  1KXL A;  2K14 A;  2F0P A;  5CC4 A;  4G7O C;  2OEO A;  4QGU A;  4HMI A;  2AHO B;  2R7Z H;  3A0J A;  1HUN A;  1WCM G;  4P74 A;  2A68 D;  4XIG S;  3J7Z C;  3T1Y L;  4P71 A;  3BG3 A;  2NVY B;  1ZKO A;  3NEM A;  3IKJ A;  1CSQ A;  4RAU C;  4X62 Q;  2A6H D;  1ILP A;  3E0J A;  5C44 G;  5LHY 1;  1Y1V B;  3K57 A;  3H0G H;  4QUF A;  3F2U A;  4A3E B;  4CJ1 B;  2LXK A;  3PQI A;  2ASB A;  4B3T Q;  3PIO A;  1QCB D;  2B2T A;  3DM1 A;  3OYY A;  2B8F A;  1BUV T;  4OGQ C;  1TKW B;  1OTC A;  4A3C G;  1X9N A;  2K7V A;  3H0G B;  1G6Z A;  1N9W A;  4LFA Q;  2EY2 A;  4QIW B;  1TWC B;  4IPC A;  3ER0 A;  2L11 A;  5FO8 B;  1I6H H;  1AN8 A;  4V19 0;  1E22 A;  2UUA L;  3ITP A;  3LWU A;  3N6R A;  4MNO A;  2CW0 C;  4FF2 A;  4DA2 A;  4AYB G;  1L0X B;  3PUX A;  4HIK A;  5CV7 A;  5C0X J;  1C0A A;  3X3M A;  4LUO A;  4HSP A;  3OIQ A;  5ELC A;  1D7Q A;  4UP7 A;  4BWG B;  1AFP A;  2JA6 H;  2GVB A;  1MSG A;  1W2B A;  1Z47 A;  3PSI A;  3NPP A;  4IUU A;  1SYG A;  4XYO A;  1GXD C;  2YTV A;  2KHS A;  1OXU A;  4WRD A;  1XNR L;  1FYC A;  1SDF A;  3I91 A;  5IGC A;  2JA6 B;  2NUC A;  1N33 L;  1XMQ L;  1NCV A;  4RCO A;  4LFC Q;  4H13 C;  4JYA L;  3Q6S A;  1BCP C;  4PMB A;  2I5M X;  3VYS A;  2FHT A;  3CRL C;  4DR4 Q;  4X65 L;  3GTO H;  1N34 L;  3GDE A;  5IP7 H;  4A3B G;  1IL8 A;  1S5F D;  1XX8 A;  4XYQ A;  3K5M A;  1WTP A;  2O2L D;  4DXF A;  3D6C A;  3PUV A;  2N88 A;  3MWY W;  4OIJ A;  4NW2 A;  1FJG L;  2F0L A;  1Y8O B;  2KED A;  3A55 A;  4HCE A;  3GTO B;  1FL0 A;  4YCV A;  5C4X G;  3G6J B;  3H3V C;  3HP3 A;  1TY2 A;  1X3G A;  2XVS A;  2VUM H;  4J8Q A;  3TZD A;  4ZYS A;  4Z9C B;  2WB1 B;  1L0Y B;  2RHQ B;  1YHQ A;  2ZXR A;  1CFM A;  4HJ5 A;  1IYU A;  4RWS C;  5EKL A;  2CHB D;  2B8G A;  2ZT9 C;  3NP8 A;  1EEI D;  2M9V A;  3CPF A;  1LTS D;  3NHH A;  1VQA A;  2VUM B;  1EIF A;  1BVS A;  3NUC A;  4RCN A;  2JEA I;  2E2D C;  4LFB L;  1D8L A;  2DJF C;  3HOW G;  5EBC A;  3BZD B;  5LMU Q;  4KMU C;  4JI3 Q;  1F9P A;  3PF5 A;  1EY9 A;  3F2D A;  4DR2 Q;  1IBL L;  3C3L A;  1ESF A;  2B2Y C;  5IT9 L;  2Y0S G;  1K83 H;  3VR2 A;  2JEB I;  1UWV A;  3BU2 A;  3CCQ A;  2VZA A;  2HT1 A;  1ESR A;  4BY1 H;  3R3O A;  1ONL A;  5LMN L;  2OQ0 A;  1I50 H;  4MZ9 A;  1WFQ A;  2PQE A;  1BBX C;  4A4I A;  1VQ6 A;  4OXP A;  2IHE A;  1S3O A;  1K83 B;  2AQ3 B;  1PH8 A;  3I4M H;  1SYF A;  2EYJ A;  4IUN A;  4ME3 A;  4P72 A;  1MJE A;  3CF5 A;  4DAY A;  1HZB A;  2YTX A;  1WTV A;  4BY1 B;  4A3F H;  2A69 D;  1SN8 A;  1IBM Q;  1TWG H;  3Q22 A;  1I50 B;  4DV6 L;  3AFQ A;  1I4H A;  2AWN A;  2CCZ A;  4KY5 A;  3U9O A;  1O7I A;  5JJK A;  1Z7T A;  2B39 A;  1EQR A;  3A7A B;  4JBK A;  4LF9 Q;  1EZ8 A;  4QY7 A;  4FO2 A;  3SEB A;  1TWG B;  1I5F A;  1GUS A;  2PI2 E;  3NK9 A;  4DNT B;  2TMP A;  2ZXO A;  4KI0 A;  1PHJ A;  1SFO B;  1VF5 C;  3I4L A;  3HOY B;  2MP1 A;  2AQ2 B;  1ROD A;  2F0H A;  5FOB B;  4DAY B;  1K28 A;  2Q8R E;  3L3O C;  1YVC A;  5C4J H;  3GTG B;  4H7B A;  4NMZ A;  3FKI H;  3CD6 A;  1PZI D;  1BO0 A;  1ZEQ X;  3VA5 A;  3GTJ H;  1BQQ T;  1H9J A;  3RMH A;  2ICI A;  3MHB A;  1Y1W H;  3X3N A;  2P5Z X;  1H95 A;  5ELD A;  4A3K H;  5C4J B;  4CDF C;  3I4N G;  3CHB D;  3KYH C;  3FKI B;  1VQ4 A;  1VQ8 A;  5T1G A;  5IT9 c;  3GTJ B;  4G7H C;  4DR7 L;  3KJP A;  4XQJ A;  1HTL D;  3HRZ C;  5JPN C;  3M4O B;  5DM6 3;  4JI5 Q;  2XSC A;  1XMO L;  3CCJ A;  1PYW D;  2VL6 A;  3NSW A;  1F2Z A;  1WVL A;  4K5X A;  4K14 A;  2K52 A;  3CCR A;  5G3L F;  4JI4 Q;  2BE5 C;  3KLR A;  2SOB A;  1E1T A;  1Q81 C;  5M3M B;  4HN7 A;  3KF8 A;  2DGY A;  5C3W A;  5DM7 3;  2RA4 A;  2B2T C;  4H0L C;  2MJ8 A;  3K5L A;  2NVT H;  3M7N A;  2A68 C;  2C5C A;  2ZTC A;  4IFD G;  4DR6 L;  3LWE A;  2A6H C;  4BBS B;  1HRJ A;  1AP0 A;  1GOZ A;  4A3D G;  1TS4 A;  4B3S Q;  1KNE A;  1PA6 A;  3MXU A;  2NVT B;  2JA8 B;  3S14 H;  4DV7 Q;  1UUP A;  4IUR A;  2L12 A;  2IY5 B;  3EBE A;  1EWI A;  2QA4 A;  3HKS A;  3KLS A;  1CKM A;  3E9I A;  1B9N A;  1DD2 A;  1HQR D;  3W5O A;  1STG A;  2HCI A;  1EY5 A;  4IPH A;  4WJW A;  3TP7 A;  4H02 A;  1NR4 A;  4K5W A;  3S14 B;  1DXM A;  4JI0 L;  2NVQ H;  5FLM H;  3DLL A;  5C3E G;  2BCO A;  4LAA A;  3W1B A;  4X64 Q;  3J81 E;  4ZCK A;  3HOZ H;  1GUO A;  1CA5 A;  4O42 A;  4DAV A;  2LSS A;  3J80 L;  1WTX A;  4HAE A;  4N8X 1;  5EJW A;  4ZAI A;  4BA2 I;  1SXT A;  1GD7 A;  3BJU A;  2F0F A;  3QO2 A;  2LXJ A;  1EQQ A;  3BDL A;  2JA7 G;  2JYO A;  1EUJ A;  3A8J E;  4DR1 L;  2LKV A;  1Q7Y C;  2WKD A;  1QE6 A;  4DV1 L;  3D6W A;  3SE0 A;  1A63 A;  2K05 A;  1EOT A;  3KFU A;  3S16 H;  2MFI A;  2QIL A;  1HH2 P;  3DMU A;  2JE6 I;  1NBW A;  3D8G A;  4KHZ A;  2WAC A;  4K0K L;  4KTA A;  1DOM A;  3KBX A;  4F87 A;  1TS2 A;  4A76 A;  3S24 A;  1VQ7 A;  1MGS A;  4PMC A;  1I94 L;  2D0P A;  3U4Z A;  4A3M G;  1M8A A;  3PIP A;  5CV9 A;  3W3A A;  1IW7 D;  4QB4 A;  2AMC B;  1DON A;  5BR8 Q;  1IZ6 A;  5GRO A;  5G3L D;  3D4D A;  1VQD A;  5A2Q L;  4LMQ D;  3D3R A;  2UU9 L;  1B3Q A;  1QWY A;  2OF1 A;  3D4W A;  4LF8 Q;  4R4O A;  5CV4 A;  1G2S A;  4OWT B;  2H4O A;  5CMD A;  1Q8I A;  2NN6 I;  2PCF B;  3BDC A;  1NNX A;  1MJC A;  2WKC A;  2UUB L;  2RSO A;  4UHV A;  4GN5 A;  4FVM A;  1PH5 A;  4L6T B;  4C2M H;  2K5N A;  2F0T A;  3GV3 A;  4B3T L;  5EGT A;  3RLN A;  2D0O A;  4B9W A;  4B3M L;  4NXM Q;  1BR9 A;  3I2Z A;  4JBW A;  1VQB A;  2QW7 A;  2WAQ B;  4C2M B;  1XTC D;  3HOV H;  3NQT A;  1ML0 D;  2CFM A;  3W1G A;  4C3J H;  5EKK A;  3ULJ A;  1L2F A;  4C3H B;  5KGU A;  3NTH A;  3Q8D A;  3S1M H;  2RVL A;  3B6Y A;  5D3D A;  3HFZ B;  3TSS A;  3ERO A;  2QF7 A;  1K73 C;  1TWF H;  3U4V A;  5JEA H;  3A5U A;  5C44 B;  4C3J B;  4LF4 L;  4AH6 A;  5KRU A;  2R93 H;  2F0M A;  1STA A;  1DOK A;  1T5E A;  1U9R A;  3S1M B;  1CZW A;  4DUY L;  1FVI A;  2H5X A;  3AQQ A;  4A3J H;  2E74 C;  1TWF B;  1STB A;  1F9R A;  1JOQ A;  3OMC A;  4PV1 C;  4GKJ Q;  5I6Y A;  1OO9 B;  4LF6 L;  4HCS A;  2GVA A;  2F1M A;  5IGE A;  1K9M C;  4O0A A;  2R7D A;  4X66 Q;  2A69 C;  2MGS A;  3CCM A;  2D5D A;  4DV5 L;  3P20 A;  5TSS A;  1DM0 B;  4A3J B;  1SND A;  4GN3 B;  3S2H H;  3I72 A;  1GKH A;  2V1C C;  4DR5 L;  4DR4 L;  2K1B A;  1B44 D;  4P2C B;  3CAM A;  2CWA A;  2L9H A;  2K03 A;  1Q86 C;  4AYB E;  2R6G A;  3M3Y H;  3NXW A;  4XXE A;  3L2P A;  2K01 A;  3CKI B;  1HFG A;  3T56 B;  3S2H B;  3T1H Q;  2F4V L;  1D5M C;  1X3Q A;  1QB5 D;  1Z9F A;  2A5H A;  3J80 i;  2L0C A;  3M3Y B;  3C46 A;  3GTP H;  1O7L A;  4KK7 A;  1UE5 A;  3MA2 B;  3BDO A;  5CV6 A;  1DGS A;  1GVP A;  4TSS A;  4QMG A;  2RSN A;  3CCS A;  2AUJ D;  1HQM C;  3R93 A;  3QWN A;  1CT1 D;  4DV2 L;  5KYL A;  4Q5V A;  4RMF A;  3SK6 A;  1KAB A;  3PO3 G;  2G9D A;  4M1U B;  3G4S A;  4IFD I;  1KLG D;  1N32 L;  3K8A A;  1EY0 A;  1IHZ A;  1B9M A;  2EJG C;  3SDZ A;  3OIP A;  4OO1 I;  3V2T A;  4R4I A;  1KAW A;  4G57 A;  1S5B D;  5M9O A;  1VQM A;  4CDE C;  3KK7 A;  1DOL A;  1WD0 A;  4KHP L;  5LL6 X;  4YWL A;  1KTK A;  2RDG A;  1PFM A;  2PMZ B;  1J6Q A;  1PH6 A;  5C4X B;  1ASY A;  5ELE A;  5EKI A;  1IL2 A;  4EQO A;  2N3S A;  1E1O A;  1DYQ A;  2R92 H;  4JI1 L;  4ILW A;  1W3S A;  3R2T A;  1I4Q A;  1X6O A;  4RGM A;  2V4D A;  2CH4 W;  1D5Z C;  2Z4I A;  1IKL A;  1N36 Q;  4IO9 A;  2HHH L;  1R4Q B;  1G6P A;  2FFK B;  5KND A;  2K5V A;  4DV3 L;  4BXX G;  4C3I B;  2VQE L;  4A3G H;  2MO0 A;  1AE3 A;  2NWG A;  3HOW B;  3U58 A;  4LUZ A;  1J8I A;  3RUZ A;  5EPK A;  2HQE A;  2A19 A;  5DLQ E;  1UAP A;  4BY7 G;  3I7F A;  2WP8 J;  1JWU D;  5JEA J;  2IT1 A;  3OW2 A;  4RH6 A;  4JVZ A;  3I70 A;  2HQL A;  1OXX K;  2EXD A;  2E5L Q;  4A3G B;  3Q0A A;  4NKL A;  5EAY A;  4R1J A;  1KLU D;  1VQF A;  2A6E D;  4B9X A;  3QJY A;  3S1R B;  4JW0 A;  1HNZ Q;  3SXH A;  1WTW A;  1Y1V H;  2EIF A;  5IGF A;  1STH A;  4K8J A;  2HD3 A;  4A93 G;  3K58 A;  2UXD L;  1Q3L A;  4A3E H;  4Q0F A;  4I7A A;  1VQH A;  1Q46 A;  1HPC A;  1G91 A;  2O5I C;  1TWA H;  4I7Z C;  1R4P B;  1EL0 A;  1CHQ D;  2EJM A;  3MFG A;  1CKN B;  3BVM A;  1LAB A;  5IGG A;  2A8V A;  3MAQ A;  1F9Q A;  3A54 A;  4DK6 C;  5IIF A;  2JA5 G;  1TWC H;  1GJX A;  1EYC A;  1VQI A;  2C35 B;  1KL9 A;  1LTT D;  1PFN A;  1TWA B;  2FJ2 A;  2F0S A;  4DXG A;  5CV8 A;  1RCV D;  3RR5 A;  4NXN L;  1IBK L;  4XTC S;  3HOV G;  2K04 A;  2K50 A;  4C1N K;  1WTH A;  2UXB L;  1KC8 C;  5IGD A;  1KDA A;  1A3T A;  4JI5 L;  2J7Z A;  1TU2 B;  5J3B A;  1D1I A;  2KEN A;  4JG2 A;  1S5C D;  1X56 A;  4AIM A;  1UE7 A;  3AU7 A;  4JI8 Q;  3OTO L;  1Z6H A;  4JI7 L;  1J5E Q;  5JJI A;  3IL8 A;  5AFW A;  4HIO A;  2L15 A;  2NZO A;  2UUC L;  4XT1 B;  4WFN 3;  1ENA A;  2EZV A;  3L9A X;  4GLA C;  4R8N A;  1YNJ C;  3VDY A;  1JWM D;  1Q82 C;  4QIW E;  3HS0 C;  4HJA A;  4Y52 H;  2H1E A;  5CYU A;  1PFS A;  5IY0 A;  1LTA D;  2CQA A;  3NWT A;  2NTS A;  4ZUJ A;  5IYC H;  2QDL A;  2ES2 A;  2RDH A;  4APV A;  2F3I A;  4JI6 Q;  5IP9 G;  5H1S E;  2AKW B;  4GNX A;  1EQT A;  1SYE A;  4GKK L;  1ASZ A;  1TR5 A;  1PH1 A;  3CCL A;  4KV6 A;  3ERQ A;  1WYD A;  3RZD B;  1EIG A;  4AQY L;  3E6Z X;  5BN3 A;  2ZM6 L;  4UP9 A;  4X3S A;  3QG1 A;  1VQG A;  1PRT C;  1IYV A;  4IUQ A;  1HCZ A;  3DWQ A;  4IQZ A;  1O7Y A;  3K0X A;  3C1E A;  2R7F A;  2K5Q A;  2IPK D;  4OO1 H;  1RTO A;  4MTK A;  2IL8 A;  1JJ2 A;  2VQF L;  4B3R Q;  1RDP D;  2RCF A;  3H09 A;  1YZ6 A;  2MQH A;  3FHW A;  4MN3 A;  1TQO A;  2K28 A;  4LF7 Q;  2N55 A;  3IAY A;  5C0X G;  2N8N A;  2MHV A;  1NR2 A;  1JOO A;  4C56 C;  1BDO A;  4GNX B;  4A3D B;  1HR0 L;  5IYB G;  3MTS A;  4KKT A;  1IKM A;  2FMM A;  4YHH L;  4UDU C;  2K32 A;  2E2I B;  3DUZ A;  2JA9 A;  3CCE A;  1VMC A;  2WIN B;  4JV5 L;  4FF4 A;  1A0I A;  2I5H A;  1II3 A;  4N8F A;  4TKO B;  2EQS A;  4CJ2 C;  1J9O A;  3A74 A;  4PG3 A;  3BS1 A;  4OX9 Q;  2G5D A;  3QB3 A;  1UNS A;  3J7A 5;  2F0K A;  1K3B C;  2WB1 E;  3S1Q B;  4TRD A;  3VYU A;  2DJG C;  2EDG A;  2QKI C;  1MHW C;  2EYO A;  3DM3 A;  5M3F G;  1HNW L;  1E2W A;  2L55 A;  3ULP A;  4X3U A;  1YEZ A;  1ILQ A;  2R92 G;  1BXT A;  4K6L A;  2WII B;  1X55 A;  4DV0 Q;  4DV4 L;  2CQO A;  3A7L A;  5I6W A;  1CQV A;  1CUK A;  2KOL A;  3TRZ A;  2NBF A;  3MXN A;  1B3A A;  3T51 B;  5FKA C;  1QNU A;  4J1M A;  5GAE C;  5D14 A;  3WWV A;  3HOU G;  1QG7 A;  3UDI A;  1U4L A;  1SSO A;  2A74 C;  2BDO A;  1LLR D;  1O7Z A;  5GAH C;  2XGT A;  4KJO A;  1WTR A;  4JCV E;  5ISR A;  2JP1 A;  2B63 H;  1UEB A;  1WTQ A;  4R4C A;  3Q24 A;  5IYD G;  1ENF A;  2KQ3 A;  3TS2 A;  4YY3 L;  3MC0 B;  2IX1 A;  3PF4 A;  4XQQ A;  1SFO H;  2KCN A;  1JIC A;  3HOY H;  1B2T A;  1TII D;  4X6A H;  2B63 B;  4LF5 Q;  3D0F A;  3VR6 A;  1JWS D;  1HNX L;  3FRP B;  2OTJ A;  3GTG H;  2K5H A;  3R2I A;  2HCC A;  1D2B A;  3I4O A;  2A73 B;  3MXN B;  3SK4 A;  2R7Z G;  1YHB A;  5AJ3 Q;  4F88 A;  4FF3 A;  4DKA C;  2EY5 A;  4A3I H;  2E75 C;  3TME A;  1EZ6 A;  1SE2 A;  2SNM A;  3IFT A;  3PUW A;  1EIY B;  3MFY A;  2HIV A;  1QZG A;  4CDC C;  3HOX H;  3H0G G;  3NTK A;  3TN2 A;  2E2J B;  4MTN A;  4A3I B;  2RF4 A;  1C8C A;  3EQL C;  5C5L A;  3M4O H;  2UXC L;  1C7Y A;  3T1Y Q;  2CWP A;  4HJ8 A;  2KUM A;  1CKO A;  1Q8K A;  5T1I A;  2OWO A;  4DAP A;  1RD9 D;  4KLK A;  3HOX B;  5JJL A;  1GUT A;  3PO2 H;  4DAM A;  3STB D;  4O2D A;  2NVX B;  1SRO A;  3TP5 A;  1QVC A;  3CQZ H;  3K80 C;  3PV0 A;  4G4K A;  2NTT A;  4BBR H;  4H44 C;  2E76 C;  5M3M H;  1Y8N B;  4Y7N H;  1A8V A;  1YIJ A;  3PO2 B;  1TT2 A;  3TP8 A;  5I9O A;  1CZG A;  2WFW A;  3CQZ B;  4ABN A;  2Z1C A;  3CC7 A;  4LUV A;  1HZA A;  2XWB B;  2JA6 G;  4CJ0 B;  4BBR B;  3PUY A;  4ID6 A;  3FEW X;  2A6E C;  3OMG A;  3OPO A;  4BBS H;  4DN4 M;  3PMF A;  4F8M A;  4GOP A;  4Y7N B;  1O80 A;  4RA8 A;  1X3P A;  1XPU A;  4L63 B;  2UUA Q;  2RBM A;  1HXY D;  2JA8 H;  2XWJ B;  4HIM A;  3CC2 A;  1STE A;  5COR A;  2NZH A;  3MXG A;  4ZLT F;  3KLW A;  1F2L A;  2HUG A;  4JOI A;  1MKH A;  3HKZ B;  4YCU A;  1E24 A;  1HTP A;  1BNZ A;  1HR0 W;  5IP7 G;  3HZX A;  2LFN A;  3M4P A;  1XNR Q;  1SYB A;  3CP0 A;  4FXK C;  2R61 A;  2MO1 A;  1BBW A;  5J1Z A;  5FJ8 H;  3GTQ H;  1BCP F;  1E2V A;  4OEM B;  2WB1 G;  1RTN A;  2I46 A;  1N33 Q;  2AUK A;  5E1F A;  4HJ7 A;  1A6X A;  4QL5 A;  1XMQ Q;  2I0Q A;  4JYA Q;  4GOP B;  4DR3 L;  1KIX A;  1CI3 M;  2F0W A;  1ENC A;  2VNU D;  4X65 Q;  2L1B A;  4DUZ L;  1N34 Q;  2VUM G;  2ZJP A;  3H3V I;  3GTQ B;  5ELB A;  1EEF D;  3UE0 A;  2KEE A;  1GUG A;  1PH7 A;  5BN4 A;  5JVG 3;  1G51 A;  1K8O A;  1U4P A;  4GNX C;  4ALP A;  1SNM A;  3PGZ A;  1FR3 A;  3K5O A;  5HUR A;  1EY4 A;  1VQ9 A;  5K36 H;  3K0Y A;  5CBE E;  5IT9 E;  1FJG Q;  1NY4 A;  5IOD A;  1EOV A;  3I90 A;  3ICE A;  1FNW A;  4EGV A;  2Q2U A;  1CTM A;  1AH9 A;  1XNQ L;  2EJF C;  3MZ5 A;  4JI2 Q;  4BS9 A;  3JAM L;  5C0X I;  4JK1 C;  1SAP A;  2YU9 H;  3HEJ A;  2O5J C;  1AW7 A;  4X3K A;  4ZKC B;  1V8Q A;  4RHR A;  1C9O A;  3GP7 A;  2ID0 A;  1U5K A;  4FXD A;  2IX0 A;  3WOF A;  2MUY A;  4ULL A;  1XXG A;  1KDC A;  4LFB Q;  4BY1 G;  4DGZ A;  4RKL A;  5JAV A;  3WDN A;  5IWA L;  2YU9 B;  3TEH B;  4L5S A;  1B7Y B;  1I4X A;  2IWH A;  5FLX L;  1IBL Q;  3EFX D;  1VF7 A;  3I4M G;  5FO7 B;  3N52 A;  2CW0 D;  3P75 A;  3TS0 A;  2YTY A;  4A3F G;  1PMR A;  1NJI C;  1X32 A;  4X62 L;  1IYJ B;  4DK0 A;  3D4R A;  5LMN Q;  5EQ0 A;  3TZU A;  5HGT A;  4BY7 B;  1OXT A;  1K8A C;  2DNC A;  4FP5 D;  4C3H H;  3BYY B;  1WCM H;  1A3U A;  5KNB A;  2EYH A;  4QQB X;  2X6G A;  4DV6 Q;  4LFA L;  5DAU A;  5C44 H;  1BCP D;  3I55 A;  3S1N B;  1EYD A;  1B50 A;  3J80 c;  5E4X A;  1CQF A;  1LTR D;  2BOS A;  2J0T D;  2RKS A;  3RD4 A;  1RJT A;  1WCM B;  2CKZ B;  2BA0 A;  4QUC A;  4LK1 C;  2N78 A;  2Q2H A;  3FKI G;  1VQE A;  3NBH A;  4IAL A;  1BKB A;  5J22 A;  1E7Z A;  4NPS A;  1Y1W G;  1Q90 A;  3VR5 A;  3R8B A;  4A3C H;  1ET9 A;  1QIL A;  4ZQ3 A;  5C3X A;  4A3K G;  3OWF A;  2F0E A;  5CV5 A;  1A2T A;  2WAQ E;  4R4Q A;  1QUQ A;  3JAM c;  2JA5 B;  4OEL B;  3U9S A;  2JN4 A;  3UDF A;  2FIN B;  1D6E C;  1GUW A;  1TY0 A;  4O1N A;  3FDT A;  4KKS A;  3I73 A;  1Q1E A;  4P73 A;  1NMG A;  3RN2 A;  3RZO B;  5C4H A;  2ZXP A;  1JCK B;  4LFC L;  5ELO A;  3GQB A;  2ALY B;  3T53 B;  5FK9 C;  3QOL A;  2OT2 A;  4AYB B;  5FLX c;  4LNQ A;  3NBH B;  2JSO A;  2Q8T A;  3O13 A;  3DWA A;  1K8G A;  4DR7 Q;  4BBS G;  4DU9 A;  1OXV A;  1STY A;  4GZY C;  4K2K A;  1SBB B;  1QUQ B;  1NUC A;  1XMO Q;  3SR1 A;  1BCP B;  1SMX A;  4DK3 C;  3F2C A;  2PNR C;  1FGB D;  4L8J A;  3J7A F;  1CHP D;  2CH4 A;  1C4Q A;  2EVB A;  3KBG A;  4A3B H;  1PTO F;  3GTL B;  1A15 A;  1SNO A;  3NEL A;  4DNI A;  2HIX A;  1RHP A;  2F0J A;  1YJ9 A;  1H9M A;  2B2U A;  2Z6B A;  5M5Y H;  3OHX C;  5I4D A;  1AE2 A;  2YV5 A;  3CCU A;  1QVF A;  3JAM i;  5LL6 S;  5C4X H;  2PQA A;  4A3B B;  3GO5 A;  2SDF A;  3H94 A;  4KN7 C;  4DR6 Q;  5LMU L;  3STB C;  4JI3 L;  4GOP C;  4KJN A;  4PZ7 A;  2JXM B;  5M5Y B;  3FMC A;  3K81 C;  5FLM G;  1XTD A;  1TVX A;  3MEF A;  4OIK A;  1S5E D;  4DR2 L;  1VCI A;  4HED A;  2BH8 A;  3HOZ G;  3GTM H;  2FMC A;  1HHV A;  1LT3 D;  1FGU A;  2B2V A;  1JQY D;  5M5W H;  1EY6 A;  2ICE C;  4YIJ A;  4ZKB B;  4JOI C;  1JR0 D;  1YHA A;  4C3I H;  4HTH A;  4ZK9 B;  2PZU A;  2PO4 A;  3HOW H;  1HFN A;  3ND9 A;  5CGK A;  4JI0 Q;  4DF7 A;  5KNC A;  1L1O A;  3SGI A;  2XRS D;  5BN5 A;  3GTM B;  4MHE A;  4X3T A;  3CME A;  4JC0 A;  2PMZ E;  5M5W B;  2PQA B;  2IHF A;  1JOR A;  3AEV A;  2L5T A;  1IBM L;  1CKN A;  4OON A;  1UE1 A;  2EYM A;  1TS5 A;  1P16 A;  1PYB A;  3S1R H;  2NN6 H;  1JOK A;  1LTB D;  1SE4 A;  5I2Y A;  3NWS A;  5ELN A;  1L0W A;  1TXY A;  1ZYR D;  2C9O A;  1V1P B;  3GD7 A;  3KJO A;  4IOC A;  4DR1 Q;  2Y0S B;  4LF9 L;  1JC7 A;  5NUC A;  2G9H D;  5KEE A;  4RKB A;  4DV1 Q;  4DK1 A;  1K8M A;  2X6L A;  3UDG A;  2VB3 X;  3CCV A;  2RHS B;  4EQN A;  3TRE A;  4R8I A;  2Q8I B;  1EQV A;  3JC6 6;  4K0K Q;  1VQJ A;  3UE1 A;  2EYF A;  1L1O B;  3BVZ A;  5JPM C;  2F0V A;  3EN2 A;  2EE1 A;  3DXJ C;  3F1Z A;  1S72 A;  1LYL A;  2K5D A;  3NTI A;  4YCW A;  3DHQ A;  1I94 Q;  1A2U A;  3G6E A;  1CK1 A;  4HJ9 A;  1LT6 D;  2OQK A;  3TBI B;  2BE5 D;  5IOC A;  3E9H A;  1BBU A;  4TQU S;  2IW3 A;  1GHK A;  3M4Q A;  2WAQ G;  3H91 A;  3K5N A;  1PTO D;  1D1K A;  1EU4 A;  4KN4 C;  1G2T A;  4N9P A;  2EXZ A;  4C3H G;  2UU9 Q;  3K7A H;  5C5M A;  2QEJ C;  4A3L H;  3DEO A;  1QNK A;  1GUN A;  1FNU A;  4LJZ C;  1I4P A;  1VQP A;  1SJH D;  1S40 A;  1JE4 A;  3GV6 A;  4HID A;  2UUB Q;  3KF6 A;  4C3J G;  1EFI D;  2R7Z B;  3K7A B;  3CPW A;  2F0Q A;  2KCM A;  3KLS X;  3FPU B;  4LW1 A;  4IJH A;  3TP6 A;  1SNQ A;  5JEA G;  3MVV A;  1V43 A;  3F8T A;  3I4N H;  4B3M Q;  5JVH 3;  1PZJ D;  3A8K E;  1PH9 A;  1SE8 A;  2JK8 A;  2R93 G;  4JI4 L;  2DY8 A;  2JQO A;  1IW7 C;  1JMC A;  1XJV A;  4WJ4 A;  4A3J G;  3TDQ A;  2QEX A;  1YI2 A;  4R4T A;  2MNA A;  3T16 A;  4ME5 A;  3I4N B;  1DZ1 A;  4JBJ A;  3RZD H;  1PTO H;  1P8L A;  1VQK A;  3KF6 B;  3J7Y W;  5K5P A;  1PH4 A;  4LF4 Q;  1JJG A;  5JJZ A;  4A75 A;  1I6H B;  2N49 A;  2XRQ D;  4B3S L;  1SNC A;  2IX3 A;  4DUY Q;  1PLF A;  1A62 A;  1PZK D;  4DV7 L;  3DEP A;  2GA4 B;  1PTO B;  2F0U A;  2HDM A;  3CXC A;  2Z0S A;  4LF6 Q;  4IJL A;  1M90 C;  1F2M A;  3U50 C;  2F0I A;  5A35 A;  4IFD H;  4DV5 Q;  3M7G A;  2DNE A;  2B3G A;  4LWC A;  4A3D H;  1X65 A;  2Z9H A;  4DR5 Q;  1PYS B;  3SK5 A;  4X64 L;  1C48 A;  3ZJY C;  2E2I H;  2F3V A;  5COY A;  3QIA A;  3OW7 A;  2I07 B;  1VQ5 A;  4PMW A;  2GN5 A;  1LUZ A;  3K7U C;  3KUP A;  2F4V Q;  4RFB A;  3S1Q H;  1M4V A;  2KJX A;  4IOA A;  2RQX A;  1BF4 A;  3K59 A;  4FNF A;  1X3F A;  2PYK A;  3BZC A;  4GLX A;  1T5X D;  4U67 3;  5C3E H;  1N8R C;  1W6K A;  2D9U A;  1NE3 A;  4UPA A;  4JI2 L;  3BZK A;  4C1N I;  1S5D D;  4CKB A;  1HZC A;  5I2X A;  5JOB A;  5I9P A;  3OOC A;  4FDB A;  4DV2 Q;  3T13 A;  3G48 A;  5C3E B;  2I5L X;  2NYZ D;  3CMA A;  4OWX B;  2JA7 H;  1N32 Q;  4EQ5 A;  4CHT B;  4C3I G;  3J81 L;  2PI2 A;  2EY1 A;  1LTG D;  3H6M A;  1SYD A;  4PZ6 A;  3S17 H;  3HGB A;  2B2U C;  1B70 B;  2ENB A;  3NEN A;  5BR8 L;  4KHP Q;  5GQO A;  2IJ0 A;  2D2C C;  2Z4H A;  5CBA E;  1KD1 C;  2JA7 B;  4JPB W;  1KDB A;  3K6O A;  3KOJ A;  5HY6 A;  4DFA A;  4A3G G;  1OXS C;  4LF8 L;  2KCT A; 
#chains in the Genus database with same CATH homology
 3S17 B;  1DJR D;  5CR3 A;  3I8Z A;  5DNF A;  2NN6 G;  4R9W A;  1EYA A;  1CA6 A;  4KY6 A;  5F2D A;  2B2V C;  4CGY B;  1EU3 A;  3VR4 A;  4A3M B;  2NB0 A;  2F03 A;  1SJE D;  2F0O A;  2SEB D;  2B2W A;  3PUZ A;  1YNN D;  2F0N A;  3I4M B;  4OL7 A;  2EPB A;  1G29 1;  1DCZ A;  3AMU A;  3PIO 3;  1PXU A;  4A3F B;  4EQP A;  2M00 A;  2VB2 X;  2XIW A;  3ND8 A;  3NQI A;  2DN8 A;  4IUP A;  4RGN A;  5KYI A;  3J7A V;  1S4Z A;  4CBV A;  2QDB A;  5J39 A;  2CVR A;  4IFD J;  1F2Y A;  2K33 A;  5EPJ A;  3OSO A;  2E2H B;  4QCL A;  4BA1 I;  3MXP A;  5DEH A;  4RHS A;  1GHJ A;  3SK8 A;  3WOE A;  3V05 A;  3RLF A;  2O4X A;  3P1H A;  1NAP A;  1U4R A;  2YYZ A;  4OHJ A;  1WTO A;  1ZYR C;  1Q1B A;  1B53 A;  4K8I A;  1TWH B;  3IFD A;  1VMP A;  1B1Z A;  1Y1W B;  2KCC A;  4A3K B;  4IUV A;  1ZXT A;  3P7J A;  1LT4 D;  2F0G A;  4FYD A;  3MEH A;  1F9S A;  4IN3 A;  3EVQ A;  1PTO C;  4U68 A;  3I3C A;  2EYL A;  1EWC A;  3NE5 B;  2EOT A;  1FNV A;  3BYT B;  4M8A A;  2KVM A;  4OO1 G;  3QOJ A;  1QJO A;  1LV9 A;  1SMY D;  3D31 A;  2OXP A;  1PRT F;  1RF2 D;  2EYP A;  2SNS A;  2PZT A;  1EY8 A;  3S9W A;  4PNY A;  5IGB A;  3V96 A;  2D62 A;  1AZQ A;  2K5W A;  3M85 A;  1Y69 U;  2BDN A;  4N9T A;  1O78 A;  1Y8P B;  2DY7 A;  5KIX A;  3PO3 B;  2PPB C;  3C2P A;  1MBY A;  2L4N A;  1SEB D;  3VA7 A;  2NVQ B;  4DNR B;  2F3W A;  1KNA A;  3S15 B;  1I4G A;  1MI2 A;  3HOZ B;  4KD4 A;  3C1F A;  5E3F A;  4IZ8 A;  1LAC A;  3FVQ A;  4IUT A;  4MIU A;  1VDZ A;  4XDX A;  3S2D B;  1EWH A;  1CM9 A;  2HDL A;  3DWP A;  3SHL A;  4I65 A;  2PW5 A;  3S16 B;  1HA5 A;  3VR3 A;  4FXG C;  2X69 A;  1YNJ D;  1QOH A;  2NZ1 D;  1H9K A;  2F4I A;  5E4W C;  1SYC A;  4HR7 B;  3ZYY X;  3LX0 A;  2LMC B;  2BA1 A;  4CKE A;  1I4R A;  4V0B A;  2VXW A;  4S3S A;  1LO5 D;  2EY6 A;  2PW7 A;  4EVO A;  1RKN A;  4A93 B;  2Z8L A;  3URY A;  1HA6 A;  2M2L A;  5D65 A;  1B4O A;  2LY7 A;  5FO9 B;  1MD2 D;  5C6A A;  1LTI D;  1EY7 A;  1PRT D;  4F7X A;  3ONA B;  2WV6 D;  1I6V C;  4WOR A;  1H9R A;  2KA7 A;  4ZUI A;  1BOS A;  1D5X C;  4B08 A;  1SNP A;  3E5S A;  1W6J A;  4KHV A;  2B2W C;  4RGT A;  5ELF A;  4KY7 A;  3HOV B;  4E6I A;  4CKC A;  1A3V A;  2F0D A;  3EJI A;  3CU7 A;  1LT5 D;  2QCP X;  4NDX A;  1JB3 A;  2RDF A;  1U4M A;  2R93 B;  1E0B A;  5C4Z A;  3FPP A;  1YNN C;  1XWE A;  3EA6 A;  3L7Z C;  1Q12 A;  1AZP A;  1STN A;  1G8Z D;  2XNA C;  4J6H A;  3UI2 A;  3HG9 A;  1PRT B;  2KEC A;  4K5V A;  2TSS A;  1UEA B;  1NSN S;  1TS3 A;  3CRK C;  1R9T B;  1F77 A;  2B2Y A;  3J80 E;  2AQ1 B;  1EIH A;  3LNN A;  1XYI A;  2XN9 C;  3A8I E;  4NP5 A;  3SVM A;  1WD1 A;  1H9S A;  1KAA A;  4KKU A;  5C0X H;  3BVG A;  1V1P A;  2AWO A;  3GTP B;  3JAM E;  3G7L A;  5K36 G;  4ZRZ A;  1V1O A;  2LS0 1;  1AEX A;  4KD3 A;  3OWE B;  3VYR A;  2PZW A;  3GTK B;  5EPL A;  1FD7 D;  3VYT A;  4QF4 A;  3PIP 3;  1E2Z A;  3T4A C;  1PFB A;  5FLX E;  4K6D A;  3AB9 A;  4XQN A;  5A2Q E;  2R3Z A;  1H9S B;  1ET6 A;  4HMJ A;  4XT3 B;  3Q23 A;  5M3F B;  1PDQ A;  1HUM A;  4UAI A;  4FF1 A;  1I3Q B;  2R92 B;  5M5X B;  3M4Y A;  2J4X A;  1MSH A;  4HSV A;  4K2L A;  4RGO S;  3HOU B;  2K6A A;  3A56 A;  4PQX A;  1SMY C;  2MPM A;  4G7Z C;  4ODG A;  1SE3 A;  3W2D A;  1ICW A;  3NBI A;  5EBD A;  5D3I B;  2F0P A;  5CC4 A;  4G7O C;  2OEO A;  4HMI A;  1HUN A;  2A68 D;  4XIG S;  3BG3 A;  2NVY B;  1ZKO A;  3IKJ A;  4RAU C;  2A6H D;  1ILP A;  3E0J A;  5LHY 1;  1Y1V B;  3K57 A;  4QUF A;  3F2U A;  4A3E B;  4CJ1 B;  1QCB D;  2B2T A;  3DM1 A;  4OGQ C;  2B8F A;  1BUV T;  1TKW B;  2K7V A;  3H0G B;  1G6Z A;  2EY2 A;  4QIW B;  1TWC B;  2L11 A;  5FO8 B;  1AN8 A;  4V19 0;  3ITP A;  3LWU A;  3N6R A;  4FF2 A;  2CW0 C;  4DA2 A;  1L0X B;  3PUX A;  5CV7 A;  5C0X J;  3X3M A;  4HSP A;  3OIQ A;  5ELC A;  4BWG B;  1AFP A;  1MSG A;  1Z47 A;  3NPP A;  4IUU A;  1SYG A;  4XYO A;  1GXD C;  2KHS A;  1OXU A;  4WRD A;  1FYC A;  1SDF A;  3I91 A;  5IGC A;  2JA6 B;  2NUC A;  1NCV A;  4RCO A;  4H13 C;  3Q6S A;  1BCP C;  4PMB A;  3VYS A;  2FHT A;  3CRL C;  1IL8 A;  1S5F D;  1XX8 A;  4XYQ A;  3K5M A;  1WTP A;  2O2L D;  4DXF A;  3D6C A;  3PUV A;  2N88 A;  3MWY W;  4OIJ A;  4NW2 A;  2F0L A;  1Y8O B;  2KED A;  3A55 A;  4HCE A;  3GTO B;  3G6J B;  3H3V C;  3HP3 A;  1TY2 A;  2XVS A;  4J8Q A;  3TZD A;  4ZYS A;  4Z9C B;  2WB1 B;  1L0Y B;  2ZXR A;  1CFM A;  1IYU A;  4RWS C;  5EKL A;  2CHB D;  2B8G A;  2ZT9 C;  3NP8 A;  1EEI D;  2M9V A;  1LTS D;  3NHH A;  2VUM B;  3NUC A;  2JEA I;  4RCN A;  2E2D C;  5EBC A;  3BZD B;  4KMU C;  1F9P A;  1EY9 A;  3C3L A;  1ESF A;  2B2Y C;  5IT9 L;  3VR2 A;  2JEB I;  1ESR A;  3R3O A;  1ONL A;  2PQE A;  1BBX C;  1K83 B;  2AQ3 B;  1SYF A;  2EYJ A;  4IUN A;  4DAY A;  1WTV A;  4BY1 B;  2A69 D;  3Q22 A;  1I50 B;  1I4H A;  2AWN A;  4KY5 A;  3U9O A;  1Z7T A;  2B39 A;  3A7A B;  1EZ8 A;  4FO2 A;  3SEB A;  1TWG B;  1GUS A;  3NK9 A;  4DNT B;  2TMP A;  2ZXO A;  4KI0 A;  1SFO B;  1VF5 C;  3I4L A;  3HOY B;  2MP1 A;  2AQ2 B;  1ROD A;  2F0H A;  5FOB B;  2Q8R E;  3L3O C;  3GTG B;  4H7B A;  4NMZ A;  1PZI D;  1BO0 A;  1ZEQ X;  3VA5 A;  1BQQ T;  1H9J A;  3RMH A;  2ICI A;  3MHB A;  3X3N A;  5ELD A;  5C4J B;  3CHB D;  3FKI B;  5T1G A;  3GTJ B;  4G7H C;  4XQJ A;  1HTL D;  3HRZ C;  5JPN C;  3M4O B;  5DM6 3;  2XSC A;  1PYW D;  3NSW A;  1F2Z A;  1WVL A;  4K5X A;  4K14 A;  5G3L F;  2BE5 C;  3KLR A;  2SOB A;  5M3M B;  4HN7 A;  3KF8 A;  5C3W A;  5DM7 3;  2RA4 A;  2B2T C;  4H0L C;  2MJ8 A;  3K5L A;  3M7N A;  2A68 C;  2C5C A;  4IFD G;  1HRJ A;  3LWE A;  2A6H C;  4BBS B;  1AP0 A;  1GOZ A;  1TS4 A;  1KNE A;  3MXU A;  2NVT B;  2JA8 B;  1UUP A;  4IUR A;  2L12 A;  3KLS A;  1B9N A;  1DD2 A;  1HQR D;  1STG A;  2HCI A;  1EY5 A;  4WJW A;  3TP7 A;  1NR4 A;  4K5W A;  3S14 B;  1DXM A;  2BCO A;  4LAA A;  3J81 E;  1GUO A;  1CA5 A;  4O42 A;  4DAV A;  3J80 L;  1WTX A;  4HAE A;  5EJW A;  4ZAI A;  4BA2 I;  1SXT A;  2F0F A;  3QO2 A;  3BDL A;  2JYO A;  3A8J E;  2LKV A;  2WKD A;  1QE6 A;  3D6W A;  3SE0 A;  2K05 A;  1EOT A;  2QIL A;  3DMU A;  2JE6 I;  3D8G A;  4KHZ A;  2WAC A;  4KTA A;  1DOM A;  3KBX A;  4F87 A;  1TS2 A;  1MGS A;  4PMC A;  1M8A A;  5CV9 A;  3W3A A;  1IW7 D;  4QB4 A;  1DON A;  5G3L D;  3D4D A;  5A2Q L;  4LMQ D;  3D3R A;  2OF1 A;  1QWY A;  3D4W A;  5CV4 A;  1G2S A;  2H4O A;  5CMD A;  1Q8I A;  2NN6 I;  2PCF B;  3BDC A;  2WKC A;  2RSO A;  4FVM A;  4L6T B;  2F0T A;  3GV3 A;  5EGT A;  4B9W A;  1BR9 A;  4JBW A;  4C2M B;  2WAQ B;  1XTC D;  3NQT A;  1ML0 D;  5EKK A;  4C3H B;  5KGU A;  3NTH A;  2RVL A;  5D3D A;  3TSS A;  3ERO A;  2QF7 A;  5JEA H;  5C44 B;  4C3J B;  5KRU A;  2F0M A;  1STA A;  1DOK A;  1T5E A;  1U9R A;  3S1M B;  1CZW A;  2E74 C;  1TWF B;  1STB A;  1F9R A;  1JOQ A;  4PV1 C;  3OMC A;  5I6Y A;  1OO9 B;  4HCS A;  2F1M A;  5IGE A;  2A69 C;  2MGS A;  2D5D A;  3P20 A;  5TSS A;  1DM0 B;  4A3J B;  1SND A;  3I72 A;  2K1B A;  1B44 D;  4P2C B;  2L9H A;  2K03 A;  2R6G A;  3NXW A;  4XXE A;  2K01 A;  3CKI B;  1HFG A;  3T56 B;  3S2H B;  1D5M C;  1X3Q A;  1QB5 D;  2A5H A;  2L0C A;  3M3Y B;  3C46 A;  1O7L A;  4KK7 A;  3MA2 B;  3BDO A;  5CV6 A;  4TSS A;  4QMG A;  2RSN A;  2AUJ D;  1HQM C;  3R93 A;  3QWN A;  1CT1 D;  5KYL A;  4Q5V A;  3SK6 A;  1KAB A;  2G9D A;  4M1U B;  4IFD I;  1KLG D;  1EY0 A;  1IHZ A;  1B9M A;  2EJG C;  3SDZ A;  3OIP A;  4OO1 I;  3V2T A;  4G57 A;  1S5B D;  5M9O A;  3KK7 A;  1DOL A;  1WD0 A;  5LL6 X;  1KTK A;  2RDG A;  1PFM A;  2PMZ B;  5C4X B;  5ELE A;  5EKI A;  4EQO A;  1DYQ A;  4ILW A;  3R2T A;  1I4Q A;  4RGM A;  2V4D A;  1D5Z C;  2Z4I A;  1IKL A;  1R4Q B;  2FFK B;  5KND A;  4C3I B;  2NWG A;  3HOW B;  1J8I A;  3RUZ A;  5EPK A;  2HQE A;  1UAP A;  2WP8 J;  1JWU D;  5JEA J;  2IT1 A;  4RH6 A;  3I70 A;  1OXX K;  4A3G B;  3Q0A A;  4NKL A;  1KLU D;  2A6E D;  4B9X A;  3QJY A;  3S1R B;  3SXH A;  1WTW A;  5IGF A;  1STH A;  4K8J A;  3K58 A;  1Q3L A;  4Q0F A;  1HPC A;  1G91 A;  2O5I C;  4I7Z C;  1R4P B;  1EL0 A;  1CHQ D;  2EJM A;  3MFG A;  3BVM A;  1LAB A;  5IGG A;  3MAQ A;  1F9Q A;  3A54 A;  5IIF A;  1GJX A;  1EYC A;  1LTT D;  1PFN A;  1TWA B;  2FJ2 A;  2F0S A;  4DXG A;  5CV8 A;  1RCV D;  4XTC S;  2K04 A;  4C1N K;  5IGD A;  1KDA A;  1A3T A;  2J7Z A;  1TU2 B;  1D1I A;  1S5C D;  3AU7 A;  1Z6H A;  3IL8 A;  5AFW A;  4XT1 B;  4WFN 3;  1ENA A;  2EZV A;  3L9A X;  4R8N A;  1YNJ C;  1JWM D;  3HS0 C;  2H1E A;  5CYU A;  1LTA D;  2CQA A;  3NWT A;  2NTS A;  4ZUJ A;  2RDH A;  1EQT A;  1SYE A;  1TR5 A;  4KV6 A;  3ERQ A;  3RZD B;  1EIG A;  3E6Z X;  5BN3 A;  4X3S A;  3QG1 A;  1PRT C;  1IYV A;  4IUQ A;  1HCZ A;  3DWQ A;  4IQZ A;  1O7Y A;  3C1E A;  2K5Q A;  2IPK D;  4OO1 H;  1RTO A;  2IL8 A;  1RDP D;  4MN3 A;  3H09 A;  1TQO A;  2K28 A;  2N55 A;  3IAY A;  5C0X G;  2MHV A;  1NR2 A;  1JOO A;  4C56 C;  1BDO A;  4A3D B;  3MTS A;  4KKT A;  1IKM A;  2FMM A;  4UDU C;  2K32 A;  2E2I B;  3DUZ A;  1VMC A;  2WIN B;  4FF4 A;  4TKO B;  1II3 A;  4CJ2 C;  1J9O A;  3BS1 A;  3QB3 A;  1UNS A;  2F0K A;  3S1Q B;  4TRD A;  3VYU A;  2EDG A;  2QKI C;  2EYO A;  1E2W A;  2L55 A;  4X3U A;  1ILQ A;  1BXT A;  4K6L A;  2WII B;  3A7L A;  5I6W A;  1CQV A;  2KOL A;  2NBF A;  3MXN A;  1B3A A;  3T51 B;  5FKA C;  1QNU A;  4J1M A;  5D14 A;  1QG7 A;  1U4L A;  1SSO A;  2A74 C;  2BDO A;  1LLR D;  1O7Z A;  4KJO A;  1WTR A;  5ISR A;  2JP1 A;  1WTQ A;  3Q24 A;  1ENF A;  2KQ3 A;  3MC0 B;  2IX1 A;  4XQQ A;  2KCN A;  1JIC A;  1B2T A;  1TII D;  2B63 B;  3VR6 A;  1JWS D;  3FRP B;  3R2I A;  2HCC A;  1D2B A;  2A73 B;  3SK4 A;  4F88 A;  4FF3 A;  2EY5 A;  2E75 C;  3TME A;  1EZ6 A;  1SE2 A;  2SNM A;  3IFT A;  3PUW A;  3MFY A;  3NTK A;  3TN2 A;  2E2J B;  4A3I B;  1C8C A;  3EQL C;  5C5L A;  2KUM A;  5T1I A;  4DAP A;  1RD9 D;  3HOX B;  1GUT A;  2NVX B;  3TP5 A;  3PV0 A;  4G4K A;  2NTT A;  4H44 C;  2E76 C;  1Y8N B;  3PO2 B;  1TT2 A;  3TP8 A;  5I9O A;  1CZG A;  3CQZ B;  4ABN A;  2Z1C A;  2XWB B;  4CJ0 B;  4BBR B;  3PUY A;  4ID6 A;  3FEW X;  2A6E C;  3OMG A;  3OPO A;  4DN4 M;  3PMF A;  4F8M A;  4Y7N B;  1O80 A;  4RA8 A;  1X3P A;  4L63 B;  2RBM A;  1HXY D;  2XWJ B;  1STE A;  5COR A;  3MXG A;  4ZLT F;  1F2L A;  2HUG A;  3HKZ B;  1HTP A;  1BNZ A;  3HZX A;  2LFN A;  1SYB A;  2R61 A;  4FXK C;  5J1Z A;  1BCP F;  1E2V A;  1RTN A;  2I46 A;  2AUK A;  5E1F A;  1A6X A;  1CI3 M;  2F0W A;  1ENC A;  2VNU D;  2L1B A;  3GTQ B;  5ELB A;  1EEF D;  2KEE A;  1GUG A;  5BN4 A;  5JVG 3;  1K8O A;  1U4P A;  1SNM A;  1FR3 A;  3K5O A;  5HUR A;  1EY4 A;  5K36 H;  3K0Y A;  5CBE E;  5IT9 E;  5IOD A;  3I90 A;  1FNW A;  4EGV A;  1CTM A;  2EJF C;  3MZ5 A;  4BS9 A;  3JAM L;  5C0X I;  4JK1 C;  1SAP A;  3HEJ A;  2O5J C;  1AW7 A;  4X3K A;  4ZKC B;  1V8Q A;  4RHR A;  3GP7 A;  2ID0 A;  4FXD A;  2IX0 A;  3WOF A;  2MUY A;  4ULL A;  1XXG A;  1KDC A;  4DGZ A;  4RKL A;  5JAV A;  3WDN A;  2YU9 B;  1I4X A;  2IWH A;  5FLX L;  3EFX D;  1VF7 A;  5FO7 B;  3N52 A;  2CW0 D;  3P75 A;  1PMR A;  1X32 A;  4DK0 A;  3D4R A;  5EQ0 A;  3TZU A;  5HGT A;  4BY7 B;  1OXT A;  2DNC A;  4FP5 D;  3BYY B;  1A3U A;  5KNB A;  2EYH A;  2X6G A;  5DAU A;  1BCP D;  3S1N B;  1EYD A;  1B50 A;  5E4X A;  1CQF A;  1LTR D;  2BOS A;  2J0T D;  2RKS A;  3RD4 A;  1RJT A;  1WCM B;  2BA0 A;  4QUC A;  4LK1 C;  3NBH A;  4IAL A;  5J22 A;  1Q90 A;  3VR5 A;  3R8B A;  1ET9 A;  1QIL A;  4ZQ3 A;  5C3X A;  3OWF A;  2F0E A;  5CV5 A;  1A2T A;  2JA5 B;  3U9S A;  2FIN B;  1D6E C;  1GUW A;  1TY0 A;  4O1N A;  3FDT A;  4KKS A;  3I73 A;  1Q1E A;  3RZO B;  5C4H A;  2ZXP A;  1JCK B;  3GQB A;  3T53 B;  5FK9 C;  3QOL A;  2OT2 A;  4AYB B;  2JSO A;  2Q8T A;  3O13 A;  3DWA A;  4DU9 A;  1OXV A;  1STY A;  4GZY C;  4K2K A;  1SBB B;  1NUC A;  3SR1 A;  1BCP B;  2PNR C;  1FGB D;  4L8J A;  3J7A F;  1CHP D;  2EVB A;  1C4Q A;  3KBG A;  1PTO F;  3GTL B;  1A15 A;  1SNO A;  1RHP A;  2F0J A;  1H9M A;  2B2U A;  3OHX C;  5I4D A;  5LL6 S;  4A3B B;  3GO5 A;  2SDF A;  3H94 A;  4KN7 C;  4KJN A;  2JXM B;  5M5Y B;  3FMC A;  1TVX A;  4OIK A;  1S5E D;  1VCI A;  4HED A;  2FMC A;  1HHV A;  1LT3 D;  2B2V A;  1JQY D;  1EY6 A;  2ICE C;  4YIJ A;  4ZKB B;  1JR0 D;  4HTH A;  4ZK9 B;  2PZU A;  2PO4 A;  1HFN A;  3ND9 A;  5CGK A;  4DF7 A;  5KNC A;  2XRS D;  5BN5 A;  3GTM B;  4MHE A;  4X3T A;  5M5W B;  1JOR A;  2L5T A;  2EYM A;  1TS5 A;  2NN6 H;  1JOK A;  1LTB D;  1SE4 A;  5I2Y A;  3NWS A;  1ZYR D;  2C9O A;  1V1P B;  3GD7 A;  2Y0S B;  1JC7 A;  5NUC A;  2G9H D;  5KEE A;  4RKB A;  4DK1 A;  1K8M A;  2X6L A;  2VB3 X;  4EQN A;  4R8I A;  2Q8I B;  1EQV A;  2EYF A;  3BVZ A;  5JPM C;  2F0V A;  3DXJ C;  2EE1 A;  2K5D A;  3NTI A;  3DHQ A;  1A2U A;  1CK1 A;  1LT6 D;  3TBI B;  2BE5 D;  5IOC A;  4TQU S;  2IW3 A;  1GHK A;  3H91 A;  3K5N A;  1PTO D;  1D1K A;  1EU4 A;  4KN4 C;  1G2T A;  4N9P A;  2EXZ A;  4C3H G;  5C5M A;  2QEJ C;  3DEO A;  1QNK A;  1GUN A;  1FNU A;  4LJZ C;  1I4P A;  1SJH D;  1JE4 A;  3GV6 A;  4C3J G;  1EFI D;  2R7Z B;  3K7A B;  2F0Q A;  3KLS X;  3FPU B;  3TP6 A;  1SNQ A;  5JEA G;  3MVV A;  1V43 A;  5JVH 3;  1PZJ D;  3A8K E;  2DY8 A;  1IW7 C;  3TDQ A;  3T16 A;  4ME5 A;  3I4N B;  1DZ1 A;  1PTO H;  3J7Y W;  5K5P A;  5JJZ A;  1I6H B;  2XRQ D;  1SNC A;  2IX3 A;  1PLF A;  1PZK D;  3DEP A;  2GA4 B;  1PTO B;  2F0U A;  2HDM A;  1F2M A;  2F0I A;  5A35 A;  4IFD H;  3M7G A;  2DNE A;  3SK5 A;  1C48 A;  2F3V A;  5COY A;  3QIA A;  3OW7 A;  2I07 B;  4PMW A;  3KUP A;  4RFB A;  1M4V A;  2KJX A;  2RQX A;  1BF4 A;  3K59 A;  4FNF A;  2PYK A;  1T5X D;  4U67 3;  1W6K A;  2D9U A;  4C1N I;  1S5D D;  4CKB A;  5I2X A;  5JOB A;  5I9P A;  3OOC A;  3T13 A;  5C3E B;  2NYZ D;  4CHT B;  4C3I G;  3J81 L;  2EY1 A;  1LTG D;  3H6M A;  1SYD A;  3HGB A;  2B2U C;  2ENB A;  2IJ0 A;  2D2C C;  2Z4H A;  5CBA E;  2JA7 B;  1KDB A;  3K6O A;  4DFA A;  1OXS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...