4DAMA

Crystal structure of small single-stranded dna-binding protein from streptomyces coelicolor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
113
Chain Sequence
SMNEIMICAVGNVATTPVFRDLANGPSVRFRLAVTARYWDREKNAWTDGHTNFFTVWANRQLATNASGSLAVGDPVVVQGRLKVRTDVREGQSRTSADIDAVAIGHDLARGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships of two paralogous single-stranded DNA-binding proteins from Streptomyces coelicolor: implication of SsbB in chromosome segregation during sporulation.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein 1
total genus 20
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4damA00
1E3PA 4OWXB 2ATWA 4GKKQ 3PUWA 2VZAA 3GTJH 2MQHA 2KBNA 2A8VA 4LF7Q 4JI2Q 1IBMQ 1S72A 3GD7A 4YCUA 1N36Q 2ZTCA 2WB1E 3PUZA 2R92H 2NN6I 4JI1L 3K7UC 1K8AC 1YEZA 3S16H 3CF5A 4B3SQ 3S2DH 4HIDA 3NBHB 4DR5Q 1HNXQ 5DLQE 1UE5A 3KDFA 4LF8L 2UXDL 1C0AA 2FXQA 4R4OA 5JJIA 5M5XH 1YNXA 4X62L 5FLMH 4DNIA 2MFIA 3RN5A 2D62A 3KF6A 4GKKL 5C0XI 3D31A 4O2DA 1WYDA 3W1BA 4UY8C 1EQRA 3AFQA 1L1OC 3HKZG 1NJIC 2NZOA 3HOXG 4L5TA 5J3BA 1FJGQ 2VL6A 1EWIA 4DK6C 2H5XA 4DV7L 4OONA 4JOIA 1PH3A 4B3TL 4LFCQ 4C3JH 3HOVG 2V1CC 5C4XG 1VQOA 4IFDJ 4NPSA 3HOXH 1G291 3CCLA 3K7AH 3CW2C 4X65L 4DK3C 2B63H 1TWAH 1Y1WH 1GVPA 2EXDA 5ELOA 1I94Q 3HOYH 1A62A 4JI3Q 3ZJYC 1FVIA 1VQBA 5FJ8H 2PI2E 4BXXG 4LUOA 2JA9A 2K5HA 4JI6L 5E7NA 1VQIA 2AMCB 3RZDH 1PH1A 5LMUQ 4H02A 1BBWA 1HJPA 1Q12A 1X3EA 4YHHQ 1XNRQ 3HOWH 1H95A 3GTOH 3PUVA 1QVCA 5IP9G 4X6AH 3RZOH 3KF8B 3ULLA 1VQCA 3EIVA 4NXMQ 1PYSB 5C0XJ 3HOWG 1GD7A 1OXUA 4LUZA 1E22A 1E7ZA 2VUMG 3RR5A 3A5ZB 3IRBA 1I94L 4LF6Q 1X54A 3FP9A 5GAEC 1V9PA 2B3GA 1YI2A 2UUBL 2F4VQ 3I56A 1N34Q 2JA5G 4GKJL 3HOZG 2ALYB 3WWVA 1VCIA 3ICEA 1YJNA 4OO1G 4DR4L 1TWGH 3M85A 4JI6Q 2N3SA 3PUXA 3CPFA 2PQAA 4KHZA 5FLMG 3S17H 1V1QA 2B63G 2Z6KC 2IX1A 2NVTH 3I7FA 2EIFA 4PMWA 1K9MC 3I4MG 4B3RQ 4A3KG 4OXPA 3UDXA 4YCWA 1VS0A 1EUJA 4P73A 1IYJB 4LW1A 3BJUA 1KRTA 4NXML 1PHJA 2I5LX 4A3JH 1UEBA 3UE0A 2JA6H 1DGSA 1X56A 4JI5Q 4YWMA 1SLJA 1B8AA 3T1HL 1P16A 3GDEA 2VQFL 4BY7G 2R7DA 4DV6Q 2R6GA 1MIUA 2QA4A 1KIXA 3RLFA 4BBRH 2UUAL 4B3SL 3HOYG 4A3EG 3HFZB 4LFCL 1M90C 4UP7A 2ZM6Q 4Y52H 1PYBA 4YY3Q 5BR8Q 4DV7Q 2GVBA 2Y0SG 1C7YA 4GLAC 1LM0A 4AYBE 4DR1L 1YHBA 2LSSA 3TS0A 3F8TA 4HIOA 2NVXH 1Q8KA 4TVAB 5JEAG 3J81c 1SRUA 2JK8A 1NY4A 2OWOA 1EIFA 4B3RL 5C4XH 4PG3A 1X3FA 2UXBL 1D7QA 2N8NA 2E8GA 4WJ3M 1EFWA 1HZ9A 3JC66 3CMAA 4HIKA 1KC8C 2KCMA 4HJ7A 3S15H 4DR6Q 4QQBX 1KAWA 5GROA 4JI5L 3PIOA 4R1JA 4A3MH 1XJVA 1MJCA 3EN2A 4QIWE 3W1GA 1M1KC 1ASYA 2WFWA 4JI2L 2WAQG 4GN3B 3CC7A 5IYBG 1VQLA 4JI4Q 2IHFA 5C3EH 4LF7L 2ZM6L 2CQOA 4GNXA 4B3ML 4JG2A 5M3FH 2JQOA 2AKWB 2JE6I 3S14H 3KJOA 2UU9L 4IPCA 3T1YL 1SROA 3SGIA 4LFBQ 2NVYH 2ZTDA 3KLWA 4IO9A 3GTPH 2R93G 4NB3A 1FGUA 3LGJA 3W5OA 1GO3E 3ULJA 1I50H 3HKSA 4X64Q 1VQJA 2K5NA 1AH9A 3E9IA 5C0XG 2E5LL 3M3YH 2OTJA 1NMGA 4P75A 3H3VI 1XNRL 2I5MX 3OW2A 1EIYB 3CCQA 2HHHQ 4LFAL 1VQGA 3PV0A 3Q8DA 2EQSA 2YTYA 1BVSA 3KJPA 3JAMi 5M3FG 4A3BH 4A3GH 1TWCH 2YTXA 4PZ6A 4JI0L 4QY7A 4A3FG 3PO3G 1N8RC 1NMFA 2GN5A 1N9WA 2K4KA 3BZCA 2UUCQ 3L7ZC 4GOPC 4R4IA 3CC2A 3UDGA 3VDYA 2WP8J 4QJFA 2IX0A 2KHJA 2PNHA 4DUYQ 1KD1C 1HR0L 4DR6L 3DLLA 1ASZA 3PO3H 1XMQL 4PZ7A 4A93H 1Y14B 3KDFB 2KHIA 4A3BG 1XMOQ 1KHIA 3NEMA 4KI0A 4X66Q 2OCEA 4IFDG 3ERSX 1PH7A 1TWFH 2OQ0A 1HR0W 2IT1A 4JC0A 4JCVE 1Q7YC 1E1TA 3H15A 1VQ9A 4JBKA 1N33Q 3AEVA 2K50A 2Z0SA 1K3RA 4YHHL 2YTVA 4X65Q 4GLVB 4GN5A 4YCVA 3ULPA 5JJLA 1E24A 1U0LA 1K83H 2E5LQ 2CWAA 1QUQB 2PI2A 1LUZA 4R4TA 4DAMA 4GN4B 4A3DH 1K8GA 4A3CG 1MJEA 4LFAQ 3K81C 4JBMA 3T1HQ 2ZTEA 2JJQA 3AYHB 3I55A 4JI3L 3CCEA 4BY7H 1I6HH 4FDBA 4R4QA 5GQOA 1LTLA 1EQQA 3I4NH 1K73C 4JV5L 2E2JH 3CP0A 1OXSC 3AFPA 3K8AA 4POFA 3PIPA 1JMCA 1Q1EA 2K5VA 3L2PA 4MTNA 5H1SE 3CMEA 1UE1A 1J5EQ 1SE8A 1XTDA 4DR1Q 5LMNW 3TRZA 1FL0A 1CSQA 3OYYA 1VQ4A 4HIMA 1OXTA 1U5KA 4DKAC 3TS2A 1L0WA 5JJKA 4AYBG 1L1OA 2GVAA 2IHEA 3J80i 4LUVA 4Y7NH 1RL2A 4L5RC 4J15A 2JA7H 1WI5A 5C3EG 2AWOA 1UWVA 3I2ZA 1NE3A 2E2HH 2UXBQ 4DV1Q 4JYAL 3UDIA 2ZJQA 4LF6L 1N32L 2VUMH 2N78A 2Q2TA 4BA2I 3CCSA 4LFBL 5IYDH 4OWWB 3M9BA 1FJGL 2R7FA 4APVA 1MKHA 2JA8H 1VQPA 1CSPA 3PSIA 4KHPL 4DV0L 1IBKQ 4K0KL 4JI0Q 4HJ9A 4JI8L 2I5HA 2JEAI 2RHSB 2VS1A 2YV5A 3PCOB 4GS3A 4KLKA 2DUDA 3BU2A 2OTLA 3JAMc 5IP7G 3M7NA 1YHQA 5LMUL 1S3OA 4R4CA 5IT9c 5IWAL 3OTOL 3PGZA 4RG1A 3UDFA 4A3CH 2Z6KA 4DR2Q 4MNOA 2YYZA 2LXKA 1KRSA 1B70B 4BXXH 4DR2L 3B6YA 1J5EL 3DM3A 1VQMA 1CKOA 1KQSA 4A3JG 3A74A 1QVGA 1X3GA 1YZ6A 4YWLA 2HIXA 2BA0A 4EX5A 1C9OA 5HY6A 4LF9L 3S2HH 4C3HH 4IFDI 3MXNB 5GAHC 2IY5B 5JEAJ 1HH2P 4JI1Q 4LF4L 1R9TH 1KXLA 3A0JA 1CKMA 3RLOA 2F3IA 1VQFA 4A4IA 1J6QA 2XGTA 3A5UA 1NBWA 2NVQH 3FKIG 5M5WH 4HJ8A 4A3EH 3STBD 2CCZA 3HOZH 4NXNQ 2UUBQ 4A3DG 3STBC 4DR3Q 3CPWA 1YITA 5LMNQ 1X65A 1VQ8A 1O7IA 2A19A 1PH4A 4OWTB 3F2BA 2VNUD 2R7ZG 3NENA 1WFQA 3FHWA 4IPGA 2JA6G 4WJ4A 1Q81C 5IP7H 3KFUA 4B3TQ 1JT8A 1KL9A 2C35B 5IP9H 1CUKA 3T1YQ 5EAYA 2R7ZH 3PF4A 2HQLA 2LXJA 4IPDA 4A93G 2R93H 3KOJA 1V43A 1Z9FA 2ASBA 2YU9H 2AWNA 4AQYL 3CC4A 1VQAA 1JJGA 3CAMA 1VQHA 1WJJA 5IYCH 3GTKH 3RNUA 2CKZB 1XMOL 1IXRA 5FLXc 4DV6L 4GOPA 2NN6G 5M3MG 1XMQQ 2Q2HA 1WCMH 3CXCA 2HHHL 2ZJPA 4L5SA 1K0RA 4LF4Q 4DV4L 4A3LH 1Q82C 2UXCL 1CKNB 2VY3A 1A63A 3CCUA 4LF5L 4JBJA 4A3FH 3G4SA 1XNQL 4GLXA 3S1QH 1I5FA 1TWHH 2Y0SE 4JI7Q 1YVCA 4MZ9A 3RN2A 4A76A 3U50C 3U58A 1BBUA 3PO2G 1GM5A 2KCTA 4AIMA 1PH8A 2AHOB 4JOIC 3F2CA 4O0AA 3S24A 4HJ5A 1PV4A 5C44H 3ER0A 2RF4A 4X62Q 1I3QH 1TXYA 1HNWL 2D0PA 4P74A 4LF8Q 2UXDQ 3U4ZA 3H0GH 4LWCA 4X66L 1VQ7A 5GADC 4JI4L 3GTLH 2WB1G 2ZJRA 4DV4Q 3HOUG 4DPGA 3CCRA 2E2IH 2WAQE 4IPHA 1YJWA 4BBRG 3H0GG 1Y1VG 4LF9Q 2UU9Q 1PA6A 4TQUS 3KF6B 2VQEQ 3M4OH 3F2DA 1G6PA 1A8VA 2OQKA 1YJ9A 2I0QA 1OXVA 1HZBA 1L2FA 5IWAQ 1W2BA 3J7A5 4IOCA 4A3IG 3J7ZC 3GTMH 3TEHB 2UUCL 2QEXA 3G71A 1HNZQ 5ELNA 3RLNA 1XPOA 1XPRA 4ALPA 3G48A 2Q2IA 3CQZH 2JEBI 1JJCB 3MEFA 4BY1H 1EYGA 3S1NH 4A3IH 1BKBA 1HZCA 1YBYA 1RIPA 2MO0A 4EQ5A 1PFSA 5GAGC 1X9NA 3CD6A 4DR4Q 3I4NG 1WCMG 3I4OA 4UP8A 5M3MH 3H3VH 1T9HA 3F1ZA 2VW9A 4DR7L 5K36G 3CCJA 4A3LG 1PVOA 1VQ6A 1WOCA 5HGQA 5LMNL 1X6OA 2PMZE 2HT1A 1LYLA 4JI8Q 4DUZQ 3G6EA 2ID0A 4GNXB 5BR8L 1IBKL 3J81i 1UE7A 1N33L 4QGUA 4UPAA 4DAYB 4RMFA 2VQEL 1IL2A 3L0OA 1HZAA 4BA1I 4QL5A 3OTOQ 1Q1BA 2HIVA 3D0FA 1PH9A 2K14A 2F52A 2VQFQ 1QVFA 3AQQA 5C44G 4IOAA 1N32Q 1Q86C 4C3IH 2DGYA 1QZGA 2D0OA 4XTCS 4GOPB 2F4VL 3UE1A 4HJAA 2R92G 4BBSG 4DR3L 1CKNA 1VQDA 4P71A 4POGA 3S1MH 4DV2L 4A3KH 2RHQB 2JA8G 4KHPQ 3EBEA 4PZ8A 1N34L 2XTIA 1P8LA 3HKZE 3M4PA 2N49A 1SR3A 2BA1A 1NTGA 4DV5L 3E9HA 2QGQA 5IYDG 4IJLA 2JA5H 3GO5A 1SMXA 4DUZL 1VQEA 1PH5A 3PF5A 3GTGH 2CFMA 3E0EA 3KYHC 4IJHA 4C2MH 1SN8A 1XNQQ 2Q2UA 1GKHA 5IYCG 1D8LA 2ES2A 3S1RH 4JV5Q 1B7YB 3NELA 4X64L 4AH6A 1X55A 5IE8A 1UE6A 2L15A 4LNQA 1HNWQ 2KENA 2K52A 4GKJQ 3J81j 2UXCQ 3M4QA 3J80c 5AJ3L 3HOVH 4DV3Q 4JBWA 4B3MQ 3U4VA 1G51A 4UP9A 2RCNA 1OXXK 2UUAQ 4L5QA 1IBLL 4JI7L 1VQKA 1QZHA 1YHAA 1Z47A 1JB7A 1OTCA 4DV5Q 1AE3A 3GTQH 3HOUH 2A1AA 4DV1L 4OX9Q 4JYAQ 4XIGS 1VQNA 3CCVA 4YWKA 5FJ8G 5C4JH 1SFOH 4DUYL 1HR0Q 4DV2Q 5IYBH 4A3GG 5M5YH 1XPUA 4NXNL 1A0IA 1Q46A 3PUYA 4AQYQ 3TREA 1W3SA 3FKIH 3TQYA 1JJ2A 4A3MG 4BBSH 1N36L 3PO2H 4P72A 4K0KQ 1IBML 3I4MH 4A75A 4DV0Q 4YY3L 3BZKA 4DV3L 2BH2A 4BY1G 2K75A 5AJ3Q 1IZ6A 2PQAB 1PH6A 1PH2A 2MNAA 1IBLQ 4DR5L 5IY0A 4DR7Q 2NZHA 1VQ5A 1AE2A 2B29A 2CWPA 1HNXL 1L1OB 1E1OA 1S40A 4LF5Q 3K80C 4OX9L 1JE5A 2MO1A 3K0XA 1HNZL 4OO1I 4GNXC 1Y1WG 1Y1VH 2JA7G 3CCMA 1QUQA 2BH8A 1EOVA 1YIJA 4ME3A
chains in the Genus database with same CATH superfamily
4FNFA 3PUWA 2VZAA 1R4PB 4LF7Q 1SMYC 4IQZA 2K1BA 5JEAH 2LS01 5BN3A 2R92H 2NN6I 1SEBD 3K7UC 3IFTA 1YEZA 4A3KB 1K8AC 3S9WA 4B3SQ 2DJFC 1C0AA 1STYA 4LF8L 2UXDL 3WOFA 1EL0A 2FXQA 5JJIA 2EY2A 1YNXA 3NE5B 1GHJA 1IHZA 4O2DA 1X3QA 4UY8C 3EA6A 1KLGD 1L1OC 5FOBB 2X69A 4HR7B 4DV7L 2H5XA 4C3JH 2PQEA 4IFDJ 3CCLA 3NTHA 4FF1A 1TQOA 3NXWA 1QOHA 4JI3Q 2FMCA 3HP3A 1HRJA 5F2DA 4ILWA 4LUOA 2JA9A 5TSSA 3P7JA 3T4AC 2AMCB 4H02A 1X3EA 1B9NA 4YHHQ 4CKBA 5IP9G 2NZ1D 5DEHA 3RZOH 5C0XH 5C0XJ 3DUZA 2VUMG 3A5ZB 3IRBA 4H0LC 1T5XD 1II3A 2F4VQ 1Y1WB 3EQLC 1MGSA 4K5XA 3S17H 1EIGA 1RTNA 4PMWA 1FD7D 2NUCA 1AZPA 1BXTA 1VS0A 4KN7C 3TBIB 1KRTA 1EIHA 3SK6A 5CV9A 1MI2A 1DGSA 4YWMA 1B8AA 3GDEA 4DR4L 2PZTA 4DV6Q 2F0KA 2QA4A 1KIXA 4BBRH 3HOYG 4A3EG 3SR1A 4RGNA 3MTSA 5BR8Q 3GTPB 3QOJA 2CH4A 1C7YA 1NCVA 1LM0A 2LSSA 5M5YB 4HIOA 3I4LA 4C3JB 4CJ1B 2NVXH 2KEEA 1SRUA 2OWOA 2F0HA 4QUCA 5C4XH 4PG3A 2N8NA 4WJ3M 3NPPA 1KC8C 2KCMA 4RFBA 2KQ3A 5GROA 4FXKC 1F2YA 1XJVA 4BBSG 1MJCA 3EN2A 3W1GA 2EXZA 2IHFA 4MHEA 4PV1C 5J39A 1B2TA 1WTRA 4JG2A 3MC0B 1HUNA 2UU9L 2R93G 4LFBQ 2EY1A 3GTPH 1FGUA 4X64Q 2D5DA 2OTJA 1NMGA 4RCNA 4N8FA 4LFAL 2HHHQ 3KJPA 2EQSA 2YTYA 4A3BH 5M3FG 4TSSA 4A3GH 3KK7A 1TWCH 2YTXA 2K32A 4A3FG 4DA2A 4RWSC 1N8RC 5E4XA 3CQZB 2L0CA 1RD9D 2KHJA 4FF3A 3BDOA 1MHWC 4ME5A 5D3IB 2KHIA 1XMOQ 3URYA 3VYTA 4X66Q 2OCEA 5KNDA 5ELEA 1JR0D 1TWFH 2K04A 2EVBA 3A56A 3K5LA 1E1TA 3H15A 3R2TA 3G6JB 1STGA 2K50A 4QIWB 4YHHL 4GN5A 2B63B 3GTJB 2PYKA 2E5LQ 1YNNC 2CWAA 2PI2A 1IKMA 3I4MB 4A3DH 4A3CG 1MJEA 2XWBB 1W6KA 4LFAQ 4DF7A 2PPBC 3AYHB 3I55A 4JI3L 4BY7H 1I6HH 2NVXB 1EY8A 5GQOA 4JV5L 1LTLA 4G57A 1K73C 3ZYYX 4KV6A 4OIKA 4XDXA 1JMCA 4MTNA 2L11A 1M8AA 2EJMA 4HSPA 1I4XA 5LL6S 4C3HG 4HIMA 3DXJC 1BNZA 1J9OA 5JJKA 3H94A 4G4KA 2R93B 2GVAA 2JN4A 3J80i 4XQQA 1D5MC 3VR4A 4Y7NH 1WI5A 2AWOA 2NN6H 2UXBQ 4EGVA 3NTIA 5FLXE 2L4NA 2SDFA 2VUMH 4LFBL 3C46A 1FJGL 3PSIA 4KHPL 4DV0L 1JC7A 1IBKQ 4K0KL 4JI0Q 4JI8L 2I5HA 4GS3A 4NKLA 3NQTA 1D6EC 1W6JA 2EYHA 1EQTA 1TWAB 4DAYA 1KAAA 5C5LA 5IWAL 4RG1A 4HMIA 1LT4D 1B50A 2K7VA 1B70B 3B6YA 1ZYRD 1VQMA 3K7AB 2F0JA 4LAAA 5CYUA 4A3JG 3A74A 1YZ6A 2BA0A 2A6HC 2EDGA 3RZOB 3GTMB 1DOMA 2F0SA 5JEAJ 3T56B 3MA2B 1R9TH 2F3IA 1VQFA 1AN8A 1VMPA 2RSOA 2XGTA 1NBWA 5JJZA 3A5UA 5J22A 1Y8OB 3FKIG 5M5WH 3HOZH 4NXNQ 3HGBA 3STBC 4DR3Q 3CPWA 3MXPA 3GV3A 3K57A 1O7IA 2A19A 1PH4A 1G8ZD 5BN5A 2R7ZG 3MEHA 1F9SA 5IP7H 3J7YW 1KL9A 2C35B 5EAYA 2R7ZH 2KEDA 2LXJA 4A93G 2R93H 1IW7C 2ASBA 4XXEA 1MSGA 5IGCA 1SNPA 3CC4A 1VQHA 4CHTB 3T53B 2A68C 2UUAQ 3AEVA 1XMQQ 4L5SA 3CXCA 1JCKB 1XWEA 2ZJPA 5CV4A 2VY3A 1A63A 2WKCA 4LF5L 1TY0A 4CDEC 1H9JA 2PO4A 4A3FH 2F0WA 4MZ9A 3C1EA 3U50C 2KCTA 4JOIC 4XT3B 5K5PA 1QE6A 3S24A 4H44C 4CJ2C 5IT9E 1XX8A 5IOCA 1H9MA 1QNKA 1VQ7A 5CV8A 1AP0A 1GOZA 4I65A 2WB1G 1D1IA 5C3WA 3HOUG 4DPGA 1LTAD 2IJ0A 1EQVA 3S14B 1PTOD 2VQEQ 2OQKA 1PDQA 2QF7A 3PMFA 5IWAQ 3J7A5 3GTMH 3TEHB 3TZDA 2UUCL 5I9OA 1HNZQ 3Q0AA 3P75A 3RLNA 1XPOA 2ICIA 3G48A 3CQZH 3K0YA 1JJCB 3QO2A 1BKBA 1YBYA 4EQ5A 3SVMA 2VW9A 3OPOA 1CZWA 1PVOA 1VQ6A 2PMZE 1CA5A 1LYLA 1F2ZA 1HCZA 1STEA 2CW0D 3BZDB 3M3YB 4DUZQ 3V96A 4BWGB 4A3IB 3VYSA 1N33L 2VQEL 4RMFA 3E5SA 2EJGC 1IL2A 2LY7A 4QL5A 3OTOQ 5C44G 4C3IH 2L5TA 1QZGA 4GOPB 2R92G 2ZXPA 4DR3L 4P71A 1SYDA 1PTOC 2N49A 2JA5H 3E9HA 4KKUA 2QDBA 3F2UA 5IYDG 1SFOB 5E4WC 2CFMA 2N55A 4LK1C 3NELA 2FJ2A 5C4HA 4BBSB 4Z9CB 2IPKD 4LNQA 2K52A 3J81j 1ZEQX 5EBDA 4B3MQ 3U4VA 1G51A 4OL7A 2RCNA 3WDNA 1VQKA 1KDBA 1RF2D 1OTCA 4DV5Q 2HD3A 3HRZC 1PXUA 2PMZB 2A1AA 4OX9Q 2RDGA 3CCVA 4YWKA 1SFOH 3J7AV 3GP7A 4DV2Q 5M5YH 1CM9A 1Q46A 4AQYQ 2M00A 1JQYD 1JJ2A 4BBSH 2HQEA 1N36L 3DWPA 4P72A 3GTOB 3BZKA 1SJED 4G7ZC 4BY1G 1IZ6A 5L37A 4ABNA 2PQAB 2RA4A 1AW7A 2NZHA 2XRSD 1VQ5A 1S40A 3K80C 2MO1A 3K0XA 4GNXC 4E6IA 2A8VA 3PO3H 2BH8A 3M4QA 3K5OA 1UAPA 4ME3A 2ATWA 5IIFA 2H4OA 1R4QB 2KA7A 2KBNA 1IBMQ 3PUZA 4DK1A 1PRTB 3S16H 3S2DH 3K59A 5IODA 2MGSA 1HNXQ 4QB4A 1UE5A 3KDFA 4A3JB 5DNFA 1TR5A 4X62L 5FLMH 3BVZA 4IUVA 2MFIA 2ICEC 3KF6A 2HCIA 4K6LA 1U4PA 3PO3B 3W1BA 1WYDA 3RZDB 2F0FA 2R7ZB 2JXMB 4WRDA 3HKZG 1NJIC 3HOXG 1FJGQ 2G5DA 2F0QA 3J80E 4JOIA 1PH3A 1Y8PB 4LFCQ 4C56C 3HOZB 2KECA 4L8JA 3MVVA 4ZUJA 3HOVG 5IGGA 5C4XG 3H91A 4NPSA 3HOXH 3VR5A 2D9UA 4X65L 2B63H 3FDTA 2F0IA 5ELOA 2NBFA 1S5FD 1A62A 1EU3A 1LTBD 3NBIA 2J0TD 2PI2E 3OMGA 2K5HA 2P5ZX 3QIAA 2KVMA 1YNJD 5E7NA 3RZDH 2XVSA 1PH1A 1XNRQ 1HJPA 1H95A 3GTOH 3MXGA 1QG7A 2PW5A 5ISRA 4NXMQ 3I8ZA 3VA7A 4DFAA 4K2LA 1GD7A 1JB3A 1OXUA 1DOKA 2IW3A 1HFGA 1E7ZA 3RR5A 1DOLA 2RSNA 1I94L 4LF6Q 1YI2A 2I07B 2B2TA 1SBBB 1SYCA 1BCPB 2AQ1B 2NTSA 3WOEA 5KNCA 1TWHB 5IGDA 3HOYB 3WWVA 1YJNA 4OO1G 3NQIA 5CC4A 2N3SA 1VF5C 4KHZA 2PQAA 3CPFA 3DM1A 2B63G 2Z6KC 3IL8A 1D1KA 3I7FA 1K9MC 4DNRB 4B3RQ 4OXPA 1EUJA 5JOBA 3A8KE 4NXML 1PHJA 2NWGA 2I5LX 3QR8A 4A3JH 2JA6H 1X56A 1P16A 2R7DA 1LABA 2R6GA 3T16A 3O13A 3HFZB 4DXGA 4LFCL 2GVBA 5KEEA 4O1NA 3NHHA 4AYBE 2VXWA 3TS0A 2NVTB 3F8TA 1Q8KA 5JEAG 1HQMC 3J81c 1ICFB 2JK8A 1NY4A 1EIFA 4B3RL 1FGBD 4DXFA 3CMAA 4HIKA 4HJ7A 4DR6Q 1KAWA 4JI5L 2DJGC 4R1JA 1ASYA 3FRPB 5A35A 2NVYB 2WFWA 1NSNS 4JI4Q 5IYBG 1VQLA 1CQFA 4LF7L 4B3ML 2AKWB 2JE6I 2SOBA 3P20A 3W5OA 2E2IB 3CRLC 4P75A 3OMCA 3H3VI 1K83B 1XNRL 1VQGA 1NNXA 2QDLA 1LTTD 2F0NA 1GUGA 1A2UA 4QY7A 5C4XB 1G2TA 1NMFA 2FFKB 1GUTA 3D3RA 3UDGA 2G9HD 3S15B 2WP8J 1EY6A 1BDOA 5DAUA 3DLLA 1AZQA 1XMQL 5CORA 4A93H 3KDFB 1KHIA 1I50B 4IFDG 1RCVD 1JWSD 4JC0A 4JBKA 1N33Q 1ET9A 3BVMA 3VYRA 2C9OA 3ERQA 2Z0SA 2XN9C 2YTVA 5JJLA 1EWCA 4YCVA 3KF8A 1CI3M 2ZT9C 4KJOA 3SE0A 2SNSA 3BYTB 4JBMA 3TZUA 4IN3A 1Q8IA 1EQQA 1QNUA 2E2JH 2F0OA 2K5VA 3L2PA 3CMEA 1J5EQ 2RCFA 5FK9C 1XTDA 4LMQD 1FL0A 3OYYA 4A3MB 1U5KA 3I90A 3TS2A 3NWTA 2IHEA 2K28A 4KHVA 5FO9B 1IKLA 4J15A 2L55A 5C3EG 1UWVA 5JPNC 4DV1Q 4S3SA 3PIP3 2Q2TA 1HA6A 4EQNA 3HOXB 1E0BA 5CV6A 4J8QA 2R7FA 3JAML 2RVLA 2JA8H 3LNNA 1CSPA 2EYMA 4C3HB 1SYBA 1EYCA 5IT9L 2RHSB 2OTLA 5IP7G 1WD1A 5LMUL 3R8BA 2QKIC 3DWAA 3OTOL 2LXKA 1I4QA 2EYFA 4BXXH 1IYVA 1R9TB 1B1ZA 3NBHA 1DXMA 1X3GA 4CBVA 4EX5A 1C9OA 2YU9B 1QILA 4XYOA 4TRDA 3S2HH 1LO5D 2IY5B 3W2DA 1HH2P 4JI1Q 4LF4L 1D2BA 5M9OA 1DYQA 1TS2A 1S5BD 4A4IA 1J6QA 1CA6A 2Q8TA 4HJ8A 1CHQD 3STBD 2CCZA 2R92B 1Y69U 2BE5D 1U4MA 1SMYD 1B3QA 2WAQB 1X65A 1VQ8A 2EE1A 4OWTB 3I91A 3F2BA 3TP8A 3NENA 3FHWA 2JA6G 1S5ED 4WJ4A 1Q81C 2XNAC 1JT8A 1E2WA 1PYWD 1CUKA 1STHA 3KOJA 2E2DC 1Z7TA 1JJGA 4K2KA 5IYCH 1Q3LA 3RNUA 1LV9A 1XMOL 4OO1H 5FLXc 1EY4A 1PLFA 1FYCA 3L9AX 4LF4Q 4A3LH 1Q82C 2QILA 1CKNB 4K5VA 3CCUA 4JBJA 5CMDA 1ILPA 1XNQL 2CVRA 5T1IA 4GLXA 2Y0SE 1VF7A 2XWJB 1BBUA 1PH8A 2AHOB 3RMHA 4DNTB 3F2CA 3ER0A 4U673 1HNWL 1PFNA 3OHXC 4WJWA 1JWUD 3GTLH 1H9KA 2E2IH 2B39A 1X3PA 2WAQE 1WCMB 1Y1VG 3PIO3 2UU9Q 2WV6D 1G6PA 3F2DA 1HZBA 3MXUA 2B2UC 3ONAB 1MD2D 4RGMA 4A3IG 1FNUA 1XPRA 4ALPA 3MEFA 4ZRZA 2JEBI 4RAUC 4KY5A 4BY1H 5T1GA 2K5WA 4A3IH 5CGKA 4UAIA 2MO0A 1RIPA 5GAGC 3CD6A 2BCOA 3I4NG 5M3MH 4QF4A 3H3VC 1T9HA 2CW0C 3MWYW 5K36G 1WOCA 5LMNL 1X6OA 3KLSX 4JI8Q 2WINB 5KGUA 2B2WA 1IBKL 5BR8L 3Q22A 1EFID 1UEAB 2DNEA 4QGUA 4FXGC 5IGBA 1BOSA 1Q1BA 2EPBA 4IOAA 1HHVA 1Q86C 1CKNA 1K0SA 1C4QA 1G2SA 2RHQB 2JA8G 4KY6A 3GTKB 4KHPQ 3EBEA 1N34L 4G7OC 1P8LA 1TY2A 2E74C 5JVH3 5M3MB 1NTGA 4X3SA 4IJLA 1SMXA 2FMMA 4ZLTF 3PF5A 3E0EA 3EROA 1TT2A 1SDFA 3ND9A 3VR3A 2ES2A 4JV5Q 1B7YB 4N8X1 4X64L 4AH6A 1UE6A 4QUFA 2B2YA 2L15A 1HNWQ 2KENA 4C1NK 4IFDH 2UXCQ 2LFNA 3EVQA 3BS1A 4U68A 3HOVH 1ZKOA 4UP9A 1OXXK 4L5QA 1IBLL 5LHY1 2DN8A 1A3UA 3GTLB 3J80L 1F9PA 2L9HA 4A3GB 4K14A 2F0TA 3GTQH 4IUPA 3R3OA 1GXDC 3M4OB 4FYDA 1HR0Q 5JVG3 4KKSA 4WORA 1V1PA 1W3SA 4K0KQ 2EZVA 5D65A 1IBML 3I4MH 4A3DB 4DV0Q 2PZUA 4C2MB 4TKOB 2BH2A 3NSWA 3I3CA 1PH6A 1IBLQ 4C3JG 4RGTA 4KD3A 5IY0A 1OO9B 5HGTA 1Q90A 2A6ED 2CWPA 1E1OA 4HMJA 1H9SA 3J81E 4G7HC 4KY7A 2JA5G 1EOVA 4DR2Q 1SNDA 5FO7B 3GTJH 2MQHA 2BE5C 2RDFA 4JI2Q 1KNEA 5CV7A 4L6TB 1S72A 4YCUA 5I2XA 1N36Q 2WB1E 4JPBW 4JI1L 1F2MA 3CF5A 3IKJA 4HIDA 1I3QB 5DLQE 2F0VA 4R4OA 1IL8A 3HG9A 2OEOA 5KIXA 3Q23A 1WTVA 2D62A 2RDHA 5C0XI 2NVQB 3CU7A 2JP1A 2NZOA 4ZKCB 3SXHA 4FF4A 1EWHA 2VL6A 4DK6C 4OONA 4CDCC 4B3TL 2V1CC 1G291 3K7AH 1PTOF 3CW2C 1KABA 3OIPA 4DK3C 2K01A 1GUSA 1TWAH 1GUOA 1Y1WH 1GVPA 2EXDA 1I94Q 3ZJYC 1FR3A 1VQBA 1JWMD 1YNJC 2CQAA 4OELB 4HN7A 4FO2A 4JW0A 4DK0A 1BBXC 2IL8A 5DM73 1S5DD 3PUVA 4XQNA 5JPMC 3QJYA 3ULLA 1VQCA 2FHTA 1WTOA 1PYSB 1TIID 1HTLD 3G7LA 3Q24A 4BS9A 2A69C 5GAEC 3FP9A 1V9PA 5ELDA 2UUBL 1RJTA 4EVOA 1N34Q 4OIJA 3HOZG 4B08A 2ALYB 1VCIA 3ICEA 4ZKBB 3M85A 4JI6Q 1F2LA 1S5CD 1CT1D 5FLMG 2IX1A 2EIFA 4EQPA 1WTPA 2EYJA 4A3KG 3UDXA 4H7BA 4YCWA 1G91A 4HTHA 1SE2A 2F0EA 5G3LF 3A54A 1PFMA 2EY6A 3N6RA 1KNAA 1UEBA 2TSSA 2LMCB 3TSSA 5EBCA 1SLJA 3T1HL 2Z6BA 2VQFL 3K5NA 3A8JE 2TMPA 4K5WA 5LL6X 2QW7A 2ZM6Q 4Y52H 3U9OA 4YY3Q 5KNBA 4DV7Q 3S17B 1WD0A 4GLAC 2M9VA 4TVAB 1MSHA 3EFXD 2A74C 4FP5D 5ELBA 2VB2X 3JC66 3S15H 4QQBX 5EKIA 4ZAIA 1M1KC 2ZXOA 3X3MA 1VMCA 3CC7A 1QB5D 1EEFD 5C3EH 1A15A 2ZM6L 5M3FH 2Z1CA 2MJ8A 3S14H 3C3LA 5G3LD 3KJOA 2F0MA 2VUMB 1SROA 2NVYH 2N88A 3KLWA 3DWQA 4I7AA 3HZXA 1GO3E 3ULJA 1VQJA 2K5NA 1AH9A 3E9IA 3M3YH 2CHBD 1EZ6A 2H1EA 2I5MX 1QJOA 3OW2A 1EIYB 3CCQA 3PV0A 3Q8DA 3JAMi 1U4RA 2IWHA 1M4VA 4PZ6A 3S2DB 3N52A 2B2VA 4F7XA 1V1OA 2GN5A 1N9WA 2K4KA 2R3ZA 3BZCA 3L7ZC 1SNCA 4GOPC 2UUCQ 4ODGA 2WKDA 2IX0A 1I6HB 2A6EC 4RA8A 4DUYQ 1PZKD 1XXGA 3I4NB 1MBYA 1ASZA 2HDMA 5I4DA 4PZ7A 1O7ZA 4A3BG 1ONLA 4KI0A 3HEJA 3HOUB 3ERSX 3IFDA 2OQ0A 1HR0W 2IT1A 4P2CB 1L0XB 4GLVB 1E24A 1K83H 3DHQA 1AEXA 4R4TA 2AUKA 4GN4B 4DAMA 1K8GA 3E0JA 1ESRA 1QWYA 1K8OA 3T1HQ 2ZTEA 1RODA 3CCEA 4FDBA 1GUWA 1B44D 3I4NH 5CR3A 3RD4A 5DM63 3P1HA 3AFPA 1ZYRC 3K8AA 3PIPA 2F0UA 5H1SE 3LWUA 1UE1A 1HA5A 1DD2A 4DR1Q 5LMNW 3TRZA 1CSQA 1VQ4A 1OXTA 3OWFA 1TU2B 1GHKA 4LUVA 3I73A 3FMCA 4FF2A 4L5RC 3D6CA 3R2IA 4K6DA 5EPKA 2E2HH 4JYAL 3UDIA 5FLXL 3D6WA 4BA2I 2N78A 1N32L 2EY5A 1TWGB 5FKAC 5IYDH 1ILQA 5C5MA 4J6HA 1MKHA 4YIJA 3KBGA 2WACA 4R8NA 5ELCA 1SNMA 1Y1VB 3NK9A 2JEAI 2VS1A 2YV5A 3PCOB 3BU2A 5ELFA 1WTXA 1YHQA 1S3OA 1U4LA 1ESFA 2AQ3B 4R4CA 2Z6KA 1C48A 5I9PA 5IGFA 3KLRA 1KRSA 4DR2L 1J5EL 2E2HB 3S1RB 1U9RA 3W3AA 4O42A 3CHBD 4IUQA 4XT1B 1QVGA 2HIXA 1CZGA 3GQBA 5HY6A 4CKCA 4IFDI 1JOQA 4UDUC 3DEOA 3I72A 4HEDA 3LX0A 1KXLA 3RLOA 1CKMA 3V2TA 4CDDC 3TMEA 2GA4B 4A3EH 1PRTC 4KK7A 3DMUA 1F9QA 2UUBQ 1O78A 2B8FA 4OGQC 1Y8NB 1YITA 2A73B 3FKIB 5HURA 4A3FB 2VNUD 1ET6A 5M5XB 2G9DA 4IPGA 3KFUA 3OSOA 5C44B 2DY8A 1EY9A 4ZK9B 1NR2A 1V43A 1Z9FA 1NAPA 2YU9H 2AWNA 4AQYL 2RQXA 1WJJA 2I46A 4R8IA 3NTKA 5M5WB 4M1UB 4GOPA 2Q2HA 2KCCA 3C1FA 5CBEE 1HTPA 4DV4L 3C2PA 4KJNA 1HQRD 1DONA 2M2LA 4IUUA 3G4SA 3S1QH 2KJXA 1JICA 1TWHH 1A2TA 3U58A 2L12A 3PO2G 2JSOA 4AIMA 3JAME 1PV4A 4O0AA 5C44H 2RF4A 3FEWX 4X62Q 1EY7A 4C3IG 1I3QH 1TXYA 4P74A 1K28A 3H0GH 2F0LA 1LT6D 3HKZB 3VR2A 4X66L 4JI4L 2IX3A 3QB3A 4DV4Q 2B2UA 4HCEA 3CCRA 3PQIA 1YJWA 3H0GG 4LF9Q 2F4IA 3J81L 1EEID 3KF6B 1A8VA 5E1FA 1YJ9A 5A2QE 1OXVA 4EQOA 3MAQA 3FPUB 2QEXA 1TWCB 1LTRD 4CGYB 3A8IE 2Q2IA 4MTKA 1EYGA 1TVXA 1DZ1A 4IURA 1JORA 3S1NH 2EYLA 1HZCA 3GTGB 1PFSA 1K8MA 1BO0A 1WCMG 3I4OA 3F1ZA 1AFPA 3VR6A 5HGQA 5EKLA 1UUPA 3G6EA 2ID0A 3NP8A 4GNXB 3OIQA 1UE7A 3J81i 4DGZA 4UPAA 4DAYB 2NYZD 2KOLA 3L0OA 1YNND 2Y0SB 2HDLA 2HIVA 3D0FA 1PZJD 1LTID 2KHSA 4NW2A 2F52A 1QVFA 3AQQA 2DGYA 2F4VL 4HJAA 3GTQB 3S1MH 4POGA 1QCBD 2MHVA 3S1NB 2NB0A 3H09A 4PZ8A 1PTOH 2BOSA 3M4PA 2L1BA 1SR3A 2BA1A 1SJHD 5IGEA 3PO2B 4IJHA 4C2MH 3MHBA 1RTOA 1GKHA 5IYCG 1WTWA 1ENFA 2FINB 3K6OA 5E3FA 3VYUA 1STAA 2A5HA 4GKJQ 2WB1B 1EZ8A 1CTMA 1SSOA 2K05A 4DV3Q 2EOTA 4CDFC 4R9WA 4PQXA 1YHAA 1AE3A 1GUNA 2ENBA 3HOVB 3A7AB 4JYAQ 4XIGS 1VQNA 5C4JH 4B9XA 4DUYL 4F88A 5IYBH 1CHPD 4RKLA 1A0IA 2XSCA 5CBAE 3K58A 2B2YC 2OXPA 3AB9A 4Y7NB 4A75A 3OOCA 3ITPA 3S16B 2K75A 3H6MA 5AJ3Q 3TN2A 3KBXA 4A93B 5AFWA 1HNXL 1L1OB 4OX9L 1KDAA 1HNZL 4OO1I 2JA7G 1Y1VH 4DAVA 2Q8RE 5JAVA 1QUQA 4HAEA 3MFYA 3CCMA 1YIJA 1E3PA 1XTCD 4OWXB 3K5MA 4GKKQ 2BDNA 1NR4A 5C4ZA 4RHRA 3GD7A 2ZTCA 4KD4A 2Z8LA 2JYOA 1DCZA 3NBHB 4DR5Q 3BG3A 2HCCA 1H9RA 5M5XH 4MIUA 1D5XC 4V0BA 4DNIA 3RN5A 4GKKL 1O7LA 2E75C 3D31A 1EQRA 3AFQA 3M4YA 4L5TA 5J3BA 1EWIA 5EJWA 2QCPX 2B8GA 1HUMA 2A6HD 4JK1C 5CV5A 1VQOA 4X3KA 3T13A 2PZWA 3HOYH 2CH4W 3VA5A 5A2QL 1EYAA 1FVIA 1E2VA 4NP5A 1L0YB 5FJ8H 4BXXG 3KLSA 4JI6L 1VQIA 5LMUQ 3NWSA 1BBWA 1Q12A 4AYBB 1WTHA 3HOWH 1HFNA 1KLUD 1QVCA 4X6AH 3KF8B 3EIVA 4HCSA 1CFMA 3HOWG 1JOKA 1E22A 4LUZA 2JA6B 4OHJA 1X54A 5I6WA 2B3GA 1IW7D 1RKNA 3I56A 4GKJL 2A69D 2D2CC 2RBMA 2X6LA 5BN4A 1TWGH 3PUXA 1A3TA 3E3XA 1V1QA 2SEBD 3TP7A 5NUCA 2NVTH 1TS3A 3I4MG 2O5IC 4P73A 5D14A 3U9SA 1IYJB 3KUPA 4LW1A 1EU4A 3UI2A 3BJUA 5C3EB 2K5QA 2Z4IA 1DJRD 1Z6HA 1WTQA 3UE0A 1RHPA 4JI5Q 1F9RA 4BY7G 2UUAL 3RLFA 4B3SL 3QWNA 1FNVA 5EPJA 4LJZC 2Z9HA 2OF1A 3HS0C 4UP7A 1M90C 1PYBA 3J7AF 1NUCA 1PMRA 2DY7A 3AU7A 2Y0SG 1EY5A 1EYDA 1LLRD 1I4PA 1YHBA 4FVMA 4DR1L 3BVGA 2C5CA 4BBRB 3BYYB 2K5DA 2K6AA 1X3FA 2UXBL 1D7QA 2E8GA 1B4OA 1HZ9A 1EFWA 4RCOA 1BR9A 1TKWB 5M3FB 2B2VC 1D5ZC 3PIOA 1SE4A 4X3TA 4QIWE 4A3MH 4JI2L 2AQ2B 2LKVA 2WAQG 4GN3B 4HSVA 1B53A 4Q5VA 4BY1B 2CQOA 4GNXA 2JQOA 2J7ZA 1ICWA 4ZCKA 4IPCA 3T1YL 3SGIA 1XYIA 4WFN3 1LT5D 2ZTDA 2B2TC 4H13C 4QMGA 4NB3A 4XYQA 4IO9A 1PTOB 3LGJA 1I50H 3HKSA 4RGOS 1I4HA 1SYGA 4N9TA 5C0XG 2E5LL 2WIIB 3FVQA 3A7LA 3R93A 3A55A 3SDZA 1C8CA 1BCPC 1BVSA 4M8AA 4JI0L 3PO3G 5COYA 4R4IA 3CC2A 2NTTA 4PNYA 3VDYA 4QJFA 2O5JC 2PNHA 4F87A 3SEBA 2PNRC 1KD1C 1HR0L 4DR6L 2K33A 4NDXA 1Y14B 1ML0D 3NEMA 4ULLA 2MPMA 1PH7A 1SXTA 1F77A 1I4RA 4JCVE 1Q7YC 1VQ9A 4KKTA 1K3BC 1B9MA 1V1PB 1SAPA 4OEMB 1K3RA 3ULPA 1SYFA 2K03A 5EGTA 4X65Q 1U0LA 4RH6A 1QUQB 4CJ0B 1LUZA 2PCFB 3K81C 4K8JA 2JJQA 4R4QA 3CP0A 1OXSC 3T51B 4Q0FA 4QCLA 4POFA 5EKKA 1KTKA 1Q1EA 1LT3D 5J1ZA 1SE8A 4CKEA 1SNQA 4DKAC 1L0WA 3AMUA 4AYBG 5D3DA 1L1OA 3CRKC 2XIWA 1RL2A 1SNOA 3GV6A 2JA7H 1PFBA 3I2ZA 1NE3A 1GJXA 2ZJQA 2F1MA 4LF6L 2EYPA 3CCSA 4OWWB 3M9BA 1J8IA 1SE3A 4APVA 4B9WA 1VQPA 4C3IB 1DM0B 4ZUIA 2E2JB 4J1MA 2EJFC 3M7GA 3FPPA 4HJ9A 4KLKA 5KRUA 4BY7B 2DUDA 2VB3X 2V4DA 3D8GA 4NMZA 3JAMc 1B3AA 3M7NA 4I7ZC 2F0DA 1ENAA 2JA5B 5IT9c 1O7YA 4ZYSA 2QEJC 3PGZA 3UDFA 4A3CH 4PMCA 1ENCA 3SHLA 4MNOA 2YYZA 1JOOA 2SNMA 1O80A 5C6AA 1LACA 3DM3A 1CKOA 1KQSA 1I6VC 2F0PA 2XRQD 4YWLA 4KTAA 3X3NA 5C3XA 4UHVA 4DAPA 4LF9L 4C3HH 3MXNB 3Q6SA 5GAHC 1BF4A 1E2ZA 3BDLA 3A0JA 1PRTD 3LWEA 2X6GA 3OW7A 1T5EA 3HOWB 3S1QB 4JVZA 3TP5A 4A3DG 1JE4A 5LMNQ 5KYLA 1WFQA 2EYOA 4B3TQ 1HXYD 3MZ5A 5IP9H 3T1YQ 3RUZA 3PF4A 2HQLA 4FXDA 4IPDA 3TDQA 3E6ZX 2A68D 1VQAA 3CAMA 1IYUA 3GTKH 2CKZB 1IXRA 4DV6L 2HHHL 2NN6G 5M3MG 4PMBA 1EY0A 1KDCA 1WCMH 5K36H 1K0RA 4KN4C 1BCPF 2UXCL 2RKSA 5KYIA 2JA8B 1CK1A 1PRTF 4XQJA 1FNWA 1I5FA 4N9PA 3H0GB 4JI7Q 1YVCA 4ID6A 4RHSA 3RN2A 4A76A 4RKBA 1GM5A 1A3VA 4HJ5A 2KCNA 1RDPD 2MP1A 1VDZA 3CKIB 1TWFB 4F8MA 3NUCA 2D0PA 3QG1A 4LF8Q 2UXDQ 1S4ZA 3U4ZA 4GZYC 4LWCA 2F3VA 5GADC 3QOLA 2ZJRA 2DNCA 4IPHA 4BBRG 1BCPD 2O4XA 1PA6A 4TQUS 3M4OH 2I0QA 1L2FA 2OT2A 1W2BA 4IOCA 3J7ZC 2HUGA 1V8QA 3G71A 3IAYA 5ELNA 2F03A 1BQQT 1BUVT 3V05A 1X9NA 1TS4A 2B2WC 4DR4Q 4UP8A 3H3VH 4DR7L 3SK5A 3CCJA 2Z4HA 4A3LG 2HT1A 1ZXTA 2Q8IB 1PZID 3S1MB 1CQVA 2KUMA 3I70A 1HZAA 4BA1I 1PH9A 2K14A 1WVLA 2VQFQ 1N32Q 1SYEA 1G6ZA 2D0OA 4XTCS 4V190 3UE1A 3ND8A 2BDOA 1VQDA 1STNA 5EPLA 3SK8A 4DV2L 2E76C 4A3KH 1HPCA 2XTIA 3HKZE 1EOTA 4K8IA 3D4DA 4DV5L 2QGQA 2AUJD 3GO5A 4DUZL 2O2LD 1VQEA 4DN4M 1PH5A 3GTGH 5I2YA 3KYHC 3L3OC 2MUYA 1SN8A 1XNQQ 2Q2UA 1A6XA 1D8LA 3DEPA 3TP6A 3S1RH 1X55A 5IE8A 4C1NI 1STBA 3J80c 1TS5A 5AJ3L 4KMUC 2JA7B 4JBWA 4X3UA 4L63B 4JI7L 1LTGD 1QZHA 1Z47A 1JB7A 1I4GA 2J4XA 3EJIA 3HOUH 5I6YA 3D4RA 5FO8B 4A3EB 4DV1L 3MXNA 5FJ8G 5EQ0A 4A3BB 4IALA 4IUTA 1LTSD 4A3GG 1XPUA 2F0GA 4NXNL 3PUYA 4MN3A 2R61A 3FKIH 3TQYA 3TREA 4A3MG 3PO2H 1UNSA 2PW7A 2ZXRA 4ZQ3A 4YY3L 4DU9A 3BDCA 5C4JB 3MFGA 4DV3L 3OWEB 1PH2A 2MNAA 1X32A 4DR5L 4DR7Q 2F3WA 4IZ8A 1AE2A 2B29A 4IUNA 4LF5Q 3SK4A 1JE5A 1H9SB 1Y1WG 3S2HB 2NVQH 1MIUA 3D4WA
chains in the Genus database with same CATH topology
1E3PA 4OWXB 2ATWA 4GKKQ 3PUWA 2VZAA 3GTJH 2MQHA 2KBNA 2A8VA 4LF7Q 4JI2Q 1IBMQ 1S72A 3GD7A 4YCUA 1N36Q 2ZTCA 2WB1E 3PUZA 2R92H 2NN6I 4JI1L 3K7UC 1K8AC 1YEZA 3S16H 3CF5A 4B3SQ 3S2DH 4HIDA 3NBHB 4DR5Q 1HNXQ 5DLQE 1UE5A 3KDFA 4LF8L 2UXDL 1C0AA 2FXQA 4R4OA 5JJIA 5M5XH 1YNXA 4X62L 5FLMH 4DNIA 2MFIA 3RN5A 2D62A 3KF6A 4GKKL 5C0XI 3D31A 4O2DA 1WYDA 3W1BA 4UY8C 1EQRA 3AFQA 1L1OC 3HKZG 1NJIC 2NZOA 3HOXG 4L5TA 5J3BA 1FJGQ 2VL6A 1EWIA 4DK6C 2H5XA 4DV7L 4OONA 4JOIA 1PH3A 4B3TL 4LFCQ 4C3JH 3HOVG 2V1CC 5C4XG 1VQOA 4IFDJ 4NPSA 3HOXH 1G291 3CCLA 3K7AH 3CW2C 4X65L 4DK3C 2B63H 1TWAH 1Y1WH 1GVPA 2EXDA 5ELOA 1I94Q 3HOYH 1A62A 4JI3Q 3ZJYC 1FVIA 1VQBA 5FJ8H 2PI2E 4BXXG 4LUOA 2JA9A 2K5HA 4JI6L 5E7NA 1VQIA 2AMCB 3RZDH 1PH1A 5LMUQ 4H02A 1BBWA 1HJPA 1Q12A 1X3EA 4YHHQ 1XNRQ 3HOWH 1H95A 3GTOH 3PUVA 1QVCA 5IP9G 4X6AH 3RZOH 3KF8B 3ULLA 1VQCA 3EIVA 4NXMQ 1PYSB 5C0XJ 3HOWG 1GD7A 1OXUA 4LUZA 1E22A 1E7ZA 2VUMG 3RR5A 3A5ZB 3IRBA 1I94L 4LF6Q 1X54A 3FP9A 5GAEC 1V9PA 2B3GA 1YI2A 2UUBL 2F4VQ 3I56A 1N34Q 2JA5G 4GKJL 3HOZG 2ALYB 3WWVA 1VCIA 3ICEA 1YJNA 4OO1G 4DR4L 1TWGH 3M85A 4JI6Q 2N3SA 3PUXA 3CPFA 2PQAA 4KHZA 5FLMG 3S17H 1V1QA 2B63G 2Z6KC 2IX1A 2NVTH 3I7FA 2EIFA 4PMWA 1K9MC 3I4MG 4B3RQ 4A3KG 4OXPA 3UDXA 4YCWA 1VS0A 1EUJA 4P73A 1IYJB 4LW1A 3BJUA 1KRTA 4NXML 1PHJA 2I5LX 4A3JH 1UEBA 3UE0A 2JA6H 1DGSA 1X56A 4JI5Q 4YWMA 1SLJA 1B8AA 3T1HL 1P16A 3GDEA 2VQFL 4BY7G 2R7DA 4DV6Q 2R6GA 1MIUA 2QA4A 1KIXA 3RLFA 4BBRH 2UUAL 4B3SL 3HOYG 4A3EG 3HFZB 4LFCL 1M90C 4UP7A 2ZM6Q 4Y52H 1PYBA 4YY3Q 5BR8Q 4DV7Q 2GVBA 2Y0SG 1C7YA 4GLAC 1LM0A 4AYBE 4DR1L 1YHBA 2LSSA 3TS0A 3F8TA 4HIOA 2NVXH 1Q8KA 4TVAB 5JEAG 3J81c 1SRUA 2JK8A 1NY4A 2OWOA 1EIFA 4B3RL 5C4XH 4PG3A 1X3FA 2UXBL 1D7QA 2N8NA 2E8GA 4WJ3M 1EFWA 1HZ9A 3JC66 3CMAA 4HIKA 1KC8C 2KCMA 4HJ7A 3S15H 4DR6Q 4QQBX 1KAWA 5GROA 4JI5L 3PIOA 4R1JA 4A3MH 1XJVA 1MJCA 3EN2A 4QIWE 3W1GA 1M1KC 1ASYA 2WFWA 4JI2L 2WAQG 4GN3B 3CC7A 5IYBG 1VQLA 4JI4Q 2IHFA 5C3EH 4LF7L 2ZM6L 2CQOA 4GNXA 4B3ML 4JG2A 5M3FH 2JQOA 2AKWB 2JE6I 3S14H 3KJOA 2UU9L 4IPCA 3T1YL 1SROA 3SGIA 4LFBQ 2NVYH 2ZTDA 3KLWA 4IO9A 3GTPH 2R93G 4NB3A 1FGUA 3LGJA 3W5OA 1GO3E 3ULJA 1I50H 3HKSA 4X64Q 1VQJA 2K5NA 1AH9A 3E9IA 5C0XG 2E5LL 3M3YH 2OTJA 1NMGA 4P75A 3H3VI 1XNRL 2I5MX 3OW2A 1EIYB 3CCQA 2HHHQ 4LFAL 1VQGA 3PV0A 3Q8DA 2EQSA 2YTYA 1BVSA 3KJPA 3JAMi 5M3FG 4A3BH 4A3GH 1TWCH 2YTXA 4PZ6A 4JI0L 4QY7A 4A3FG 3PO3G 1N8RC 1NMFA 2GN5A 1N9WA 2K4KA 3BZCA 2UUCQ 3L7ZC 4GOPC 4R4IA 3CC2A 3UDGA 3VDYA 2WP8J 4QJFA 2IX0A 2KHJA 2PNHA 4DUYQ 1KD1C 1HR0L 4DR6L 3DLLA 1ASZA 3PO3H 1XMQL 4PZ7A 4A93H 1Y14B 3KDFB 2KHIA 4A3BG 1XMOQ 1KHIA 3NEMA 4KI0A 4X66Q 2OCEA 4IFDG 3ERSX 1PH7A 1TWFH 2OQ0A 1HR0W 2IT1A 4JC0A 4JCVE 1Q7YC 1E1TA 3H15A 1VQ9A 4JBKA 1N33Q 3AEVA 2K50A 2Z0SA 1K3RA 4YHHL 2YTVA 4X65Q 4GLVB 4GN5A 4YCVA 3ULPA 5JJLA 1E24A 1U0LA 1K83H 2E5LQ 2CWAA 1QUQB 2PI2A 1LUZA 4R4TA 4DAMA 4GN4B 4A3DH 1K8GA 4A3CG 1MJEA 4LFAQ 3K81C 4JBMA 3T1HQ 2ZTEA 2JJQA 3AYHB 3I55A 4JI3L 3CCEA 4BY7H 1I6HH 4FDBA 4R4QA 5GQOA 1LTLA 1EQQA 3I4NH 1K73C 4JV5L 2E2JH 3CP0A 1OXSC 3AFPA 3K8AA 4POFA 3PIPA 1JMCA 1Q1EA 2K5VA 3L2PA 4MTNA 5H1SE 3CMEA 1UE1A 1J5EQ 1SE8A 1XTDA 4DR1Q 5LMNW 3TRZA 1FL0A 1CSQA 3OYYA 1VQ4A 4HIMA 1OXTA 1U5KA 4DKAC 3TS2A 1L0WA 5JJKA 4AYBG 1L1OA 2GVAA 2IHEA 3J80i 4LUVA 4Y7NH 1RL2A 4L5RC 4J15A 2JA7H 1WI5A 5C3EG 2AWOA 1UWVA 3I2ZA 1NE3A 2E2HH 2UXBQ 4DV1Q 4JYAL 3UDIA 2ZJQA 4LF6L 1N32L 2VUMH 2N78A 2Q2TA 4BA2I 3CCSA 4LFBL 5IYDH 4OWWB 3M9BA 1FJGL 2R7FA 4APVA 1MKHA 2JA8H 1VQPA 1CSPA 3PSIA 4KHPL 4DV0L 1IBKQ 4K0KL 4JI0Q 4HJ9A 4JI8L 2I5HA 2JEAI 2RHSB 2VS1A 2YV5A 3PCOB 4GS3A 4KLKA 2DUDA 3BU2A 2OTLA 3JAMc 5IP7G 3M7NA 1YHQA 5LMUL 1S3OA 4R4CA 5IT9c 5IWAL 3OTOL 3PGZA 4RG1A 3UDFA 4A3CH 2Z6KA 4DR2Q 4MNOA 2YYZA 2LXKA 1KRSA 1B70B 4BXXH 4DR2L 3B6YA 1J5EL 3DM3A 1VQMA 1CKOA 1KQSA 4A3JG 3A74A 1QVGA 1X3GA 1YZ6A 4YWLA 2HIXA 2BA0A 4EX5A 1C9OA 5HY6A 4LF9L 3S2HH 4C3HH 4IFDI 3MXNB 5GAHC 2IY5B 5JEAJ 1HH2P 4JI1Q 4LF4L 1R9TH 1KXLA 3A0JA 1CKMA 3RLOA 2F3IA 1VQFA 4A4IA 1J6QA 2XGTA 3A5UA 1NBWA 2NVQH 3FKIG 5M5WH 4HJ8A 4A3EH 3STBD 2CCZA 3HOZH 4NXNQ 2UUBQ 4A3DG 3STBC 4DR3Q 3CPWA 1YITA 5LMNQ 1X65A 1VQ8A 1O7IA 2A19A 1PH4A 4OWTB 3F2BA 2VNUD 2R7ZG 3NENA 1WFQA 3FHWA 4IPGA 2JA6G 4WJ4A 1Q81C 5IP7H 3KFUA 4B3TQ 1JT8A 1KL9A 2C35B 5IP9H 1CUKA 3T1YQ 5EAYA 2R7ZH 3PF4A 2HQLA 2LXJA 4IPDA 4A93G 2R93H 3KOJA 1V43A 1Z9FA 2ASBA 2YU9H 2AWNA 4AQYL 3CC4A 1VQAA 1JJGA 3CAMA 1VQHA 1WJJA 5IYCH 3GTKH 3RNUA 2CKZB 1XMOL 1IXRA 5FLXc 4DV6L 4GOPA 2NN6G 5M3MG 1XMQQ 2Q2HA 1WCMH 3CXCA 2HHHL 2ZJPA 4L5SA 1K0RA 4LF4Q 4DV4L 4A3LH 1Q82C 2UXCL 1CKNB 2VY3A 1A63A 3CCUA 4LF5L 4JBJA 4A3FH 3G4SA 1XNQL 4GLXA 3S1QH 1I5FA 1TWHH 2Y0SE 4JI7Q 1YVCA 4MZ9A 3RN2A 4A76A 3U50C 3U58A 1BBUA 3PO2G 1GM5A 2KCTA 4AIMA 1PH8A 2AHOB 4JOIC 3F2CA 4O0AA 3S24A 4HJ5A 1PV4A 5C44H 3ER0A 2RF4A 4X62Q 1I3QH 1TXYA 1HNWL 2D0PA 4P74A 4LF8Q 2UXDQ 3U4ZA 3H0GH 4LWCA 4X66L 1VQ7A 5GADC 4JI4L 3GTLH 2WB1G 2ZJRA 4DV4Q 3HOUG 4DPGA 3CCRA 2E2IH 2WAQE 4IPHA 1YJWA 4BBRG 3H0GG 1Y1VG 4LF9Q 2UU9Q 1PA6A 4TQUS 3KF6B 2VQEQ 3M4OH 3F2DA 1G6PA 1A8VA 2OQKA 1YJ9A 2I0QA 1OXVA 1HZBA 1L2FA 5IWAQ 1W2BA 3J7A5 4IOCA 4A3IG 3J7ZC 3GTMH 3TEHB 2UUCL 2QEXA 3G71A 1HNZQ 5ELNA 3RLNA 1XPOA 1XPRA 4ALPA 3G48A 2Q2IA 3CQZH 2JEBI 1JJCB 3MEFA 4BY1H 1EYGA 3S1NH 4A3IH 1BKBA 1HZCA 1YBYA 1RIPA 2MO0A 4EQ5A 1PFSA 5GAGC 1X9NA 3CD6A 4DR4Q 3I4NG 1WCMG 3I4OA 4UP8A 5M3MH 3H3VH 1T9HA 3F1ZA 2VW9A 4DR7L 5K36G 3CCJA 4A3LG 1PVOA 1VQ6A 1WOCA 5HGQA 5LMNL 1X6OA 2PMZE 2HT1A 1LYLA 4JI8Q 4DUZQ 3G6EA 2ID0A 4GNXB 5BR8L 1IBKL 3J81i 1UE7A 1N33L 4QGUA 4UPAA 4DAYB 4RMFA 2VQEL 1IL2A 3L0OA 1HZAA 4BA1I 4QL5A 3OTOQ 1Q1BA 2HIVA 3D0FA 1PH9A 2K14A 2F52A 2VQFQ 1QVFA 3AQQA 5C44G 4IOAA 1N32Q 1Q86C 4C3IH 2DGYA 1QZGA 2D0OA 4XTCS 4GOPB 2F4VL 3UE1A 4HJAA 2R92G 4BBSG 4DR3L 1CKNA 1VQDA 4P71A 4POGA 3S1MH 4DV2L 4A3KH 2RHQB 2JA8G 4KHPQ 3EBEA 4PZ8A 1N34L 2XTIA 1P8LA 3HKZE 3M4PA 2N49A 1SR3A 2BA1A 1NTGA 4DV5L 3E9HA 2QGQA 5IYDG 4IJLA 2JA5H 3GO5A 1SMXA 4DUZL 1VQEA 1PH5A 3PF5A 3GTGH 2CFMA 3E0EA 3KYHC 4IJHA 4C2MH 1SN8A 1XNQQ 2Q2UA 1GKHA 5IYCG 1D8LA 2ES2A 3S1RH 4JV5Q 1B7YB 3NELA 4X64L 4AH6A 1X55A 5IE8A 1UE6A 2L15A 4LNQA 1HNWQ 2KENA 2K52A 4GKJQ 3J81j 2UXCQ 3M4QA 3J80c 5AJ3L 3HOVH 4DV3Q 4JBWA 4B3MQ 3U4VA 1G51A 4UP9A 2RCNA 1OXXK 2UUAQ 4L5QA 1IBLL 4JI7L 1VQKA 1QZHA 1YHAA 1Z47A 1JB7A 1OTCA 4DV5Q 1AE3A 3GTQH 3HOUH 2A1AA 4DV1L 4OX9Q 4JYAQ 4XIGS 1VQNA 3CCVA 4YWKA 5FJ8G 5C4JH 1SFOH 4DUYL 1HR0Q 4DV2Q 5IYBH 4A3GG 5M5YH 1XPUA 4NXNL 1A0IA 1Q46A 3PUYA 4AQYQ 3TREA 1W3SA 3FKIH 3TQYA 1JJ2A 4A3MG 4BBSH 1N36L 3PO2H 4P72A 4K0KQ 1IBML 3I4MH 4A75A 4DV0Q 4YY3L 3BZKA 4DV3L 2BH2A 4BY1G 2K75A 5AJ3Q 1IZ6A 2PQAB 1PH6A 1PH2A 2MNAA 1IBLQ 4DR5L 5IY0A 4DR7Q 2NZHA 1VQ5A 1AE2A 2B29A 2CWPA 1HNXL 1L1OB 1E1OA 1S40A 4LF5Q 3K80C 4OX9L 1JE5A 2MO1A 3K0XA 1HNZL 4OO1I 4GNXC 1Y1WG 1Y1VH 2JA7G 3CCMA 1QUQA 2BH8A 1EOVA 1YIJA 4ME3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3P A;  4OWX B;  2ATW A;  4GKK Q;  3PUW A;  2VZA A;  3GTJ H;  2MQH A;  2KBN A;  2A8V A;  4LF7 Q;  4JI2 Q;  1IBM Q;  1S72 A;  3GD7 A;  4YCU A;  1N36 Q;  2ZTC A;  2WB1 E;  3PUZ A;  2R92 H;  2NN6 I;  4JI1 L;  3K7U C;  1K8A C;  1YEZ A;  3S16 H;  3CF5 A;  4B3S Q;  3S2D H;  4HID A;  3NBH B;  4DR5 Q;  1HNX Q;  5DLQ E;  1UE5 A;  3KDF A;  4LF8 L;  2UXD L;  1C0A A;  2FXQ A;  4R4O A;  5JJI A;  5M5X H;  1YNX A;  4X62 L;  5FLM H;  4DNI A;  2MFI A;  3RN5 A;  2D62 A;  3KF6 A;  4GKK L;  5C0X I;  3D31 A;  4O2D A;  1WYD A;  3W1B A;  4UY8 C;  1EQR A;  3AFQ A;  1L1O C;  3HKZ G;  1NJI C;  2NZO A;  3HOX G;  4L5T A;  5J3B A;  1FJG Q;  2VL6 A;  1EWI A;  4DK6 C;  2H5X A;  4DV7 L;  4OON A;  4JOI A;  1PH3 A;  4B3T L;  4LFC Q;  4C3J H;  3HOV G;  2V1C C;  5C4X G;  1VQO A;  4IFD J;  4NPS A;  3HOX H;  1G29 1;  3CCL A;  3K7A H;  3CW2 C;  4X65 L;  4DK3 C;  2B63 H;  1TWA H;  1Y1W H;  1GVP A;  2EXD A;  5ELO A;  1I94 Q;  3HOY H;  1A62 A;  4JI3 Q;  3ZJY C;  1FVI A;  1VQB A;  5FJ8 H;  2PI2 E;  4BXX G;  4LUO A;  2JA9 A;  2K5H A;  4JI6 L;  5E7N A;  1VQI A;  2AMC B;  3RZD H;  1PH1 A;  5LMU Q;  4H02 A;  1BBW A;  1HJP A;  1Q12 A;  1X3E A;  4YHH Q;  1XNR Q;  3HOW H;  1H95 A;  3GTO H;  3PUV A;  1QVC A;  5IP9 G;  4X6A H;  3RZO H;  3KF8 B;  3ULL A;  1VQC A;  3EIV A;  4NXM Q;  1PYS B;  5C0X J;  3HOW G;  1GD7 A;  1OXU A;  4LUZ A;  1E22 A;  1E7Z A;  2VUM G;  3RR5 A;  3A5Z B;  3IRB A;  1I94 L;  4LF6 Q;  1X54 A;  3FP9 A;  5GAE C;  1V9P A;  2B3G A;  1YI2 A;  2UUB L;  2F4V Q;  3I56 A;  1N34 Q;  2JA5 G;  4GKJ L;  3HOZ G;  2ALY B;  3WWV A;  1VCI A;  3ICE A;  1YJN A;  4OO1 G;  4DR4 L;  1TWG H;  3M85 A;  4JI6 Q;  2N3S A;  3PUX A;  3CPF A;  2PQA A;  4KHZ A;  5FLM G;  3S17 H;  1V1Q A;  2B63 G;  2Z6K C;  2IX1 A;  2NVT H;  3I7F A;  2EIF A;  4PMW A;  1K9M C;  3I4M G;  4B3R Q;  4A3K G;  4OXP A;  3UDX A;  4YCW A;  1VS0 A;  1EUJ A;  4P73 A;  1IYJ B;  4LW1 A;  3BJU A;  1KRT A;  4NXM L;  1PHJ A;  2I5L X;  4A3J H;  1UEB A;  3UE0 A;  2JA6 H;  1DGS A;  1X56 A;  4JI5 Q;  4YWM A;  1SLJ A;  1B8A A;  3T1H L;  1P16 A;  3GDE A;  2VQF L;  4BY7 G;  2R7D A;  4DV6 Q;  2R6G A;  1MIU A;  2QA4 A;  1KIX A;  3RLF A;  4BBR H;  2UUA L;  4B3S L;  3HOY G;  4A3E G;  3HFZ B;  4LFC L;  1M90 C;  4UP7 A;  2ZM6 Q;  4Y52 H;  1PYB A;  4YY3 Q;  5BR8 Q;  4DV7 Q;  2GVB A;  2Y0S G;  1C7Y A;  4GLA C;  1LM0 A;  4AYB E;  4DR1 L;  1YHB A;  2LSS A;  3TS0 A;  3F8T A;  4HIO A;  2NVX H;  1Q8K A;  4TVA B;  5JEA G;  3J81 c;  1SRU A;  2JK8 A;  1NY4 A;  2OWO A;  1EIF A;  4B3R L;  5C4X H;  4PG3 A;  1X3F A;  2UXB L;  1D7Q A;  2N8N A;  2E8G A;  4WJ3 M;  1EFW A;  1HZ9 A;  3JC6 6;  3CMA A;  4HIK A;  1KC8 C;  2KCM A;  4HJ7 A;  3S15 H;  4DR6 Q;  4QQB X;  1KAW A;  5GRO A;  4JI5 L;  3PIO A;  4R1J A;  4A3M H;  1XJV A;  1MJC A;  3EN2 A;  4QIW E;  3W1G A;  1M1K C;  1ASY A;  2WFW A;  4JI2 L;  2WAQ G;  4GN3 B;  3CC7 A;  5IYB G;  1VQL A;  4JI4 Q;  2IHF A;  5C3E H;  4LF7 L;  2ZM6 L;  2CQO A;  4GNX A;  4B3M L;  4JG2 A;  5M3F H;  2JQO A;  2AKW B;  2JE6 I;  3S14 H;  3KJO A;  2UU9 L;  4IPC A;  3T1Y L;  1SRO A;  3SGI A;  4LFB Q;  2NVY H;  2ZTD A;  3KLW A;  4IO9 A;  3GTP H;  2R93 G;  4NB3 A;  1FGU A;  3LGJ A;  3W5O A;  1GO3 E;  3ULJ A;  1I50 H;  3HKS A;  4X64 Q;  1VQJ A;  2K5N A;  1AH9 A;  3E9I A;  5C0X G;  2E5L L;  3M3Y H;  2OTJ A;  1NMG A;  4P75 A;  3H3V I;  1XNR L;  2I5M X;  3OW2 A;  1EIY B;  3CCQ A;  2HHH Q;  4LFA L;  1VQG A;  3PV0 A;  3Q8D A;  2EQS A;  2YTY A;  1BVS A;  3KJP A;  3JAM i;  5M3F G;  4A3B H;  4A3G H;  1TWC H;  2YTX A;  4PZ6 A;  4JI0 L;  4QY7 A;  4A3F G;  3PO3 G;  1N8R C;  1NMF A;  2GN5 A;  1N9W A;  2K4K A;  3BZC A;  2UUC Q;  3L7Z C;  4GOP C;  4R4I A;  3CC2 A;  3UDG A;  3VDY A;  2WP8 J;  4QJF A;  2IX0 A;  2KHJ A;  2PNH A;  4DUY Q;  1KD1 C;  1HR0 L;  4DR6 L;  3DLL A;  1ASZ A;  3PO3 H;  1XMQ L;  4PZ7 A;  4A93 H;  1Y14 B;  3KDF B;  2KHI A;  4A3B G;  1XMO Q;  1KHI A;  3NEM A;  4KI0 A;  4X66 Q;  2OCE A;  4IFD G;  3ERS X;  1PH7 A;  1TWF H;  2OQ0 A;  1HR0 W;  2IT1 A;  4JC0 A;  4JCV E;  1Q7Y C;  1E1T A;  3H15 A;  1VQ9 A;  4JBK A;  1N33 Q;  3AEV A;  2K50 A;  2Z0S A;  1K3R A;  4YHH L;  2YTV A;  4X65 Q;  4GLV B;  4GN5 A;  4YCV A;  3ULP A;  5JJL A;  1E24 A;  1U0L A;  1K83 H;  2E5L Q;  2CWA A;  1QUQ B;  2PI2 A;  1LUZ A;  4R4T A;  4DAM A;  4GN4 B;  4A3D H;  1K8G A;  4A3C G;  1MJE A;  4LFA Q;  3K81 C;  4JBM A;  3T1H Q;  2ZTE A;  2JJQ A;  3AYH B;  3I55 A;  4JI3 L;  3CCE A;  4BY7 H;  1I6H H;  4FDB A;  4R4Q A;  5GQO A;  1LTL A;  1EQQ A;  3I4N H;  1K73 C;  4JV5 L;  2E2J H;  3CP0 A;  1OXS C;  3AFP A;  3K8A A;  4POF A;  3PIP A;  1JMC A;  1Q1E A;  2K5V A;  3L2P A;  4MTN A;  5H1S E;  3CME A;  1UE1 A;  1J5E Q;  1SE8 A;  1XTD A;  4DR1 Q;  5LMN W;  3TRZ A;  1FL0 A;  1CSQ A;  3OYY A;  1VQ4 A;  4HIM A;  1OXT A;  1U5K A;  4DKA C;  3TS2 A;  1L0W A;  5JJK A;  4AYB G;  1L1O A;  2GVA A;  2IHE A;  3J80 i;  4LUV A;  4Y7N H;  1RL2 A;  4L5R C;  4J15 A;  2JA7 H;  1WI5 A;  5C3E G;  2AWO A;  1UWV A;  3I2Z A;  1NE3 A;  2E2H H;  2UXB Q;  4DV1 Q;  4JYA L;  3UDI A;  2ZJQ A;  4LF6 L;  1N32 L;  2VUM H;  2N78 A;  2Q2T A;  4BA2 I;  3CCS A;  4LFB L;  5IYD H;  4OWW B;  3M9B A;  1FJG L;  2R7F A;  4APV A;  1MKH A;  2JA8 H;  1VQP A;  1CSP A;  3PSI A;  4KHP L;  4DV0 L;  1IBK Q;  4K0K L;  4JI0 Q;  4HJ9 A;  4JI8 L;  2I5H A;  2JEA I;  2RHS B;  2VS1 A;  2YV5 A;  3PCO B;  4GS3 A;  4KLK A;  2DUD A;  3BU2 A;  2OTL A;  3JAM c;  5IP7 G;  3M7N A;  1YHQ A;  5LMU L;  1S3O A;  4R4C A;  5IT9 c;  5IWA L;  3OTO L;  3PGZ A;  4RG1 A;  3UDF A;  4A3C H;  2Z6K A;  4DR2 Q;  4MNO A;  2YYZ A;  2LXK A;  1KRS A;  1B70 B;  4BXX H;  4DR2 L;  3B6Y A;  1J5E L;  3DM3 A;  1VQM A;  1CKO A;  1KQS A;  4A3J G;  3A74 A;  1QVG A;  1X3G A;  1YZ6 A;  4YWL A;  2HIX A;  2BA0 A;  4EX5 A;  1C9O A;  5HY6 A;  4LF9 L;  3S2H H;  4C3H H;  4IFD I;  3MXN B;  5GAH C;  2IY5 B;  5JEA J;  1HH2 P;  4JI1 Q;  4LF4 L;  1R9T H;  1KXL A;  3A0J A;  1CKM A;  3RLO A;  2F3I A;  1VQF A;  4A4I A;  1J6Q A;  2XGT A;  3A5U A;  1NBW A;  2NVQ H;  3FKI G;  5M5W H;  4HJ8 A;  4A3E H;  3STB D;  2CCZ A;  3HOZ H;  4NXN Q;  2UUB Q;  4A3D G;  3STB C;  4DR3 Q;  3CPW A;  1YIT A;  5LMN Q;  1X65 A;  1VQ8 A;  1O7I A;  2A19 A;  1PH4 A;  4OWT B;  3F2B A;  2VNU D;  2R7Z G;  3NEN A;  1WFQ A;  3FHW A;  4IPG A;  2JA6 G;  4WJ4 A;  1Q81 C;  5IP7 H;  3KFU A;  4B3T Q;  1JT8 A;  1KL9 A;  2C35 B;  5IP9 H;  1CUK A;  3T1Y Q;  5EAY A;  2R7Z H;  3PF4 A;  2HQL A;  2LXJ A;  4IPD A;  4A93 G;  2R93 H;  3KOJ A;  1V43 A;  1Z9F A;  2ASB A;  2YU9 H;  2AWN A;  4AQY L;  3CC4 A;  1VQA A;  1JJG A;  3CAM A;  1VQH A;  1WJJ A;  5IYC H;  3GTK H;  3RNU A;  2CKZ B;  1XMO L;  1IXR A;  5FLX c;  4DV6 L;  4GOP A;  2NN6 G;  5M3M G;  1XMQ Q;  2Q2H A;  1WCM H;  3CXC A;  2HHH L;  2ZJP A;  4L5S A;  1K0R A;  4LF4 Q;  4DV4 L;  4A3L H;  1Q82 C;  2UXC L;  1CKN B;  2VY3 A;  1A63 A;  3CCU A;  4LF5 L;  4JBJ A;  4A3F H;  3G4S A;  1XNQ L;  4GLX A;  3S1Q H;  1I5F A;  1TWH H;  2Y0S E;  4JI7 Q;  1YVC A;  4MZ9 A;  3RN2 A;  4A76 A;  3U50 C;  3U58 A;  1BBU A;  3PO2 G;  1GM5 A;  2KCT A;  4AIM A;  1PH8 A;  2AHO B;  4JOI C;  3F2C A;  4O0A A;  3S24 A;  4HJ5 A;  1PV4 A;  5C44 H;  3ER0 A;  2RF4 A;  4X62 Q;  1I3Q H;  1TXY A;  1HNW L;  2D0P A;  4P74 A;  4LF8 Q;  2UXD Q;  3U4Z A;  3H0G H;  4LWC A;  4X66 L;  1VQ7 A;  5GAD C;  4JI4 L;  3GTL H;  2WB1 G;  2ZJR A;  4DV4 Q;  3HOU G;  4DPG A;  3CCR A;  2E2I H;  2WAQ E;  4IPH A;  1YJW A;  4BBR G;  3H0G G;  1Y1V G;  4LF9 Q;  2UU9 Q;  1PA6 A;  4TQU S;  3KF6 B;  2VQE Q;  3M4O H;  3F2D A;  1G6P A;  1A8V A;  2OQK A;  1YJ9 A;  2I0Q A;  1OXV A;  1HZB A;  1L2F A;  5IWA Q;  1W2B A;  3J7A 5;  4IOC A;  4A3I G;  3J7Z C;  3GTM H;  3TEH B;  2UUC L;  2QEX A;  3G71 A;  1HNZ Q;  5ELN A;  3RLN A;  1XPO A;  1XPR A;  4ALP A;  3G48 A;  2Q2I A;  3CQZ H;  2JEB I;  1JJC B;  3MEF A;  4BY1 H;  1EYG A;  3S1N H;  4A3I H;  1BKB A;  1HZC A;  1YBY A;  1RIP A;  2MO0 A;  4EQ5 A;  1PFS A;  5GAG C;  1X9N A;  3CD6 A;  4DR4 Q;  3I4N G;  1WCM G;  3I4O A;  4UP8 A;  5M3M H;  3H3V H;  1T9H A;  3F1Z A;  2VW9 A;  4DR7 L;  5K36 G;  3CCJ A;  4A3L G;  1PVO A;  1VQ6 A;  1WOC A;  5HGQ A;  5LMN L;  1X6O A;  2PMZ E;  2HT1 A;  1LYL A;  4JI8 Q;  4DUZ Q;  3G6E A;  2ID0 A;  4GNX B;  5BR8 L;  1IBK L;  3J81 i;  1UE7 A;  1N33 L;  4QGU A;  4UPA A;  4DAY B;  4RMF A;  2VQE L;  1IL2 A;  3L0O A;  1HZA A;  4BA1 I;  4QL5 A;  3OTO Q;  1Q1B A;  2HIV A;  3D0F A;  1PH9 A;  2K14 A;  2F52 A;  2VQF Q;  1QVF A;  3AQQ A;  5C44 G;  4IOA A;  1N32 Q;  1Q86 C;  4C3I H;  2DGY A;  1QZG A;  2D0O A;  4XTC S;  4GOP B;  2F4V L;  3UE1 A;  4HJA A;  2R92 G;  4BBS G;  4DR3 L;  1CKN A;  1VQD A;  4P71 A;  4POG A;  3S1M H;  4DV2 L;  4A3K H;  2RHQ B;  2JA8 G;  4KHP Q;  3EBE A;  4PZ8 A;  1N34 L;  2XTI A;  1P8L A;  3HKZ E;  3M4P A;  2N49 A;  1SR3 A;  2BA1 A;  1NTG A;  4DV5 L;  3E9H A;  2QGQ A;  5IYD G;  4IJL A;  2JA5 H;  3GO5 A;  1SMX A;  4DUZ L;  1VQE A;  1PH5 A;  3PF5 A;  3GTG H;  2CFM A;  3E0E A;  3KYH C;  4IJH A;  4C2M H;  1SN8 A;  1XNQ Q;  2Q2U A;  1GKH A;  5IYC G;  1D8L A;  2ES2 A;  3S1R H;  4JV5 Q;  1B7Y B;  3NEL A;  4X64 L;  4AH6 A;  1X55 A;  5IE8 A;  1UE6 A;  2L15 A;  4LNQ A;  1HNW Q;  2KEN A;  2K52 A;  4GKJ Q;  3J81 j;  2UXC Q;  3M4Q A;  3J80 c;  5AJ3 L;  3HOV H;  4DV3 Q;  4JBW A;  4B3M Q;  3U4V A;  1G51 A;  4UP9 A;  2RCN A;  1OXX K;  2UUA Q;  4L5Q A;  1IBL L;  4JI7 L;  1VQK A;  1QZH A;  1YHA A;  1Z47 A;  1JB7 A;  1OTC A;  4DV5 Q;  1AE3 A;  3GTQ H;  3HOU H;  2A1A A;  4DV1 L;  4OX9 Q;  4JYA Q;  4XIG S;  1VQN A;  3CCV A;  4YWK A;  5FJ8 G;  5C4J H;  1SFO H;  4DUY L;  1HR0 Q;  4DV2 Q;  5IYB H;  4A3G G;  5M5Y H;  1XPU A;  4NXN L;  1A0I A;  1Q46 A;  3PUY A;  4AQY Q;  3TRE A;  1W3S A;  3FKI H;  3TQY A;  1JJ2 A;  4A3M G;  4BBS H;  1N36 L;  3PO2 H;  4P72 A;  4K0K Q;  1IBM L;  3I4M H;  4A75 A;  4DV0 Q;  4YY3 L;  3BZK A;  4DV3 L;  2BH2 A;  4BY1 G;  2K75 A;  5AJ3 Q;  1IZ6 A;  2PQA B;  1PH6 A;  1PH2 A;  2MNA A;  1IBL Q;  4DR5 L;  5IY0 A;  4DR7 Q;  2NZH A;  1VQ5 A;  1AE2 A;  2B29 A;  2CWP A;  1HNX L;  1L1O B;  1E1O A;  1S40 A;  4LF5 Q;  3K80 C;  4OX9 L;  1JE5 A;  2MO1 A;  3K0X A;  1HNZ L;  4OO1 I;  4GNX C;  1Y1W G;  1Y1V H;  2JA7 G;  3CCM A;  1QUQ A;  2BH8 A;  1EOV A;  1YIJ A;  4ME3 A; 
#chains in the Genus database with same CATH topology
 4FNF A;  3PUW A;  2VZA A;  1R4P B;  4LF7 Q;  1SMY C;  4IQZ A;  2K1B A;  5JEA H;  2LS0 1;  5BN3 A;  2R92 H;  2NN6 I;  1SEB D;  3K7U C;  3IFT A;  1YEZ A;  4A3K B;  1K8A C;  3S9W A;  4B3S Q;  2DJF C;  1C0A A;  1STY A;  4LF8 L;  2UXD L;  3WOF A;  1EL0 A;  2FXQ A;  5JJI A;  2EY2 A;  1YNX A;  3NE5 B;  1GHJ A;  1IHZ A;  4O2D A;  1X3Q A;  4UY8 C;  3EA6 A;  1KLG D;  1L1O C;  5FOB B;  2X69 A;  4HR7 B;  4DV7 L;  2H5X A;  4C3J H;  2PQE A;  4IFD J;  3CCL A;  3NTH A;  4FF1 A;  1TQO A;  3NXW A;  1QOH A;  4JI3 Q;  2FMC A;  3HP3 A;  1HRJ A;  5F2D A;  4ILW A;  4LUO A;  2JA9 A;  5TSS A;  3P7J A;  3T4A C;  2AMC B;  4H02 A;  1X3E A;  1B9N A;  4YHH Q;  4CKB A;  5IP9 G;  2NZ1 D;  5DEH A;  3RZO H;  5C0X H;  5C0X J;  3DUZ A;  2VUM G;  3A5Z B;  3IRB A;  4H0L C;  1T5X D;  1II3 A;  2F4V Q;  1Y1W B;  3EQL C;  1MGS A;  4K5X A;  3S17 H;  1EIG A;  1RTN A;  4PMW A;  1FD7 D;  2NUC A;  1AZP A;  1BXT A;  1VS0 A;  4KN7 C;  3TBI B;  1KRT A;  1EIH A;  3SK6 A;  5CV9 A;  1MI2 A;  1DGS A;  4YWM A;  1B8A A;  3GDE A;  4DR4 L;  2PZT A;  4DV6 Q;  2F0K A;  2QA4 A;  1KIX A;  4BBR H;  3HOY G;  4A3E G;  3SR1 A;  4RGN A;  3MTS A;  5BR8 Q;  3GTP B;  3QOJ A;  2CH4 A;  1C7Y A;  1NCV A;  1LM0 A;  2LSS A;  5M5Y B;  4HIO A;  3I4L A;  4C3J B;  4CJ1 B;  2NVX H;  2KEE A;  1SRU A;  2OWO A;  2F0H A;  4QUC A;  5C4X H;  4PG3 A;  2N8N A;  4WJ3 M;  3NPP A;  1KC8 C;  2KCM A;  4RFB A;  2KQ3 A;  5GRO A;  4FXK C;  1F2Y A;  1XJV A;  4BBS G;  1MJC A;  3EN2 A;  3W1G A;  2EXZ A;  2IHF A;  4MHE A;  4PV1 C;  5J39 A;  1B2T A;  1WTR A;  4JG2 A;  3MC0 B;  1HUN A;  2UU9 L;  2R93 G;  4LFB Q;  2EY1 A;  3GTP H;  1FGU A;  4X64 Q;  2D5D A;  2OTJ A;  1NMG A;  4RCN A;  4N8F A;  4LFA L;  2HHH Q;  3KJP A;  2EQS A;  2YTY A;  4A3B H;  5M3F G;  4TSS A;  4A3G H;  3KK7 A;  1TWC H;  2YTX A;  2K32 A;  4A3F G;  4DA2 A;  4RWS C;  1N8R C;  5E4X A;  3CQZ B;  2L0C A;  1RD9 D;  2KHJ A;  4FF3 A;  3BDO A;  1MHW C;  4ME5 A;  5D3I B;  2KHI A;  1XMO Q;  3URY A;  3VYT A;  4X66 Q;  2OCE A;  5KND A;  5ELE A;  1JR0 D;  1TWF H;  2K04 A;  2EVB A;  3A56 A;  3K5L A;  1E1T A;  3H15 A;  3R2T A;  3G6J B;  1STG A;  2K50 A;  4QIW B;  4YHH L;  4GN5 A;  2B63 B;  3GTJ B;  2PYK A;  2E5L Q;  1YNN C;  2CWA A;  2PI2 A;  1IKM A;  3I4M B;  4A3D H;  4A3C G;  1MJE A;  2XWB B;  1W6K A;  4LFA Q;  4DF7 A;  2PPB C;  3AYH B;  3I55 A;  4JI3 L;  4BY7 H;  1I6H H;  2NVX B;  1EY8 A;  5GQO A;  4JV5 L;  1LTL A;  4G57 A;  1K73 C;  3ZYY X;  4KV6 A;  4OIK A;  4XDX A;  1JMC A;  4MTN A;  2L11 A;  1M8A A;  2EJM A;  4HSP A;  1I4X A;  5LL6 S;  4C3H G;  4HIM A;  3DXJ C;  1BNZ A;  1J9O A;  5JJK A;  3H94 A;  4G4K A;  2R93 B;  2GVA A;  2JN4 A;  3J80 i;  4XQQ A;  1D5M C;  3VR4 A;  4Y7N H;  1WI5 A;  2AWO A;  2NN6 H;  2UXB Q;  4EGV A;  3NTI A;  5FLX E;  2L4N A;  2SDF A;  2VUM H;  4LFB L;  3C46 A;  1FJG L;  3PSI A;  4KHP L;  4DV0 L;  1JC7 A;  1IBK Q;  4K0K L;  4JI0 Q;  4JI8 L;  2I5H A;  4GS3 A;  4NKL A;  3NQT A;  1D6E C;  1W6J A;  2EYH A;  1EQT A;  1TWA B;  4DAY A;  1KAA A;  5C5L A;  5IWA L;  4RG1 A;  4HMI A;  1LT4 D;  1B50 A;  2K7V A;  1B70 B;  3B6Y A;  1ZYR D;  1VQM A;  3K7A B;  2F0J A;  4LAA A;  5CYU A;  4A3J G;  3A74 A;  1YZ6 A;  2BA0 A;  2A6H C;  2EDG A;  3RZO B;  3GTM B;  1DOM A;  2F0S A;  5JEA J;  3T56 B;  3MA2 B;  1R9T H;  2F3I A;  1VQF A;  1AN8 A;  1VMP A;  2RSO A;  2XGT A;  1NBW A;  5JJZ A;  3A5U A;  5J22 A;  1Y8O B;  3FKI G;  5M5W H;  3HOZ H;  4NXN Q;  3HGB A;  3STB C;  4DR3 Q;  3CPW A;  3MXP A;  3GV3 A;  3K57 A;  1O7I A;  2A19 A;  1PH4 A;  1G8Z D;  5BN5 A;  2R7Z G;  3MEH A;  1F9S A;  5IP7 H;  3J7Y W;  1KL9 A;  2C35 B;  5EAY A;  2R7Z H;  2KED A;  2LXJ A;  4A93 G;  2R93 H;  1IW7 C;  2ASB A;  4XXE A;  1MSG A;  5IGC A;  1SNP A;  3CC4 A;  1VQH A;  4CHT B;  3T53 B;  2A68 C;  2UUA Q;  3AEV A;  1XMQ Q;  4L5S A;  3CXC A;  1JCK B;  1XWE A;  2ZJP A;  5CV4 A;  2VY3 A;  1A63 A;  2WKC A;  4LF5 L;  1TY0 A;  4CDE C;  1H9J A;  2PO4 A;  4A3F H;  2F0W A;  4MZ9 A;  3C1E A;  3U50 C;  2KCT A;  4JOI C;  4XT3 B;  5K5P A;  1QE6 A;  3S24 A;  4H44 C;  4CJ2 C;  5IT9 E;  1XX8 A;  5IOC A;  1H9M A;  1QNK A;  1VQ7 A;  5CV8 A;  1AP0 A;  1GOZ A;  4I65 A;  2WB1 G;  1D1I A;  5C3W A;  3HOU G;  4DPG A;  1LTA D;  2IJ0 A;  1EQV A;  3S14 B;  1PTO D;  2VQE Q;  2OQK A;  1PDQ A;  2QF7 A;  3PMF A;  5IWA Q;  3J7A 5;  3GTM H;  3TEH B;  3TZD A;  2UUC L;  5I9O A;  1HNZ Q;  3Q0A A;  3P75 A;  3RLN A;  1XPO A;  2ICI A;  3G48 A;  3CQZ H;  3K0Y A;  1JJC B;  3QO2 A;  1BKB A;  1YBY A;  4EQ5 A;  3SVM A;  2VW9 A;  3OPO A;  1CZW A;  1PVO A;  1VQ6 A;  2PMZ E;  1CA5 A;  1LYL A;  1F2Z A;  1HCZ A;  1STE A;  2CW0 D;  3BZD B;  3M3Y B;  4DUZ Q;  3V96 A;  4BWG B;  4A3I B;  3VYS A;  1N33 L;  2VQE L;  4RMF A;  3E5S A;  2EJG C;  1IL2 A;  2LY7 A;  4QL5 A;  3OTO Q;  5C44 G;  4C3I H;  2L5T A;  1QZG A;  4GOP B;  2R92 G;  2ZXP A;  4DR3 L;  4P71 A;  1SYD A;  1PTO C;  2N49 A;  2JA5 H;  3E9H A;  4KKU A;  2QDB A;  3F2U A;  5IYD G;  1SFO B;  5E4W C;  2CFM A;  2N55 A;  4LK1 C;  3NEL A;  2FJ2 A;  5C4H A;  4BBS B;  4Z9C B;  2IPK D;  4LNQ A;  2K52 A;  3J81 j;  1ZEQ X;  5EBD A;  4B3M Q;  3U4V A;  1G51 A;  4OL7 A;  2RCN A;  3WDN A;  1VQK A;  1KDB A;  1RF2 D;  1OTC A;  4DV5 Q;  2HD3 A;  3HRZ C;  1PXU A;  2PMZ B;  2A1A A;  4OX9 Q;  2RDG A;  3CCV A;  4YWK A;  1SFO H;  3J7A V;  3GP7 A;  4DV2 Q;  5M5Y H;  1CM9 A;  1Q46 A;  4AQY Q;  2M00 A;  1JQY D;  1JJ2 A;  4BBS H;  2HQE A;  1N36 L;  3DWP A;  4P72 A;  3GTO B;  3BZK A;  1SJE D;  4G7Z C;  4BY1 G;  1IZ6 A;  5L37 A;  4ABN A;  2PQA B;  2RA4 A;  1AW7 A;  2NZH A;  2XRS D;  1VQ5 A;  1S40 A;  3K80 C;  2MO1 A;  3K0X A;  4GNX C;  4E6I A;  2A8V A;  3PO3 H;  2BH8 A;  3M4Q A;  3K5O A;  1UAP A;  4ME3 A;  2ATW A;  5IIF A;  2H4O A;  1R4Q B;  2KA7 A;  2KBN A;  1IBM Q;  3PUZ A;  4DK1 A;  1PRT B;  3S16 H;  3S2D H;  3K59 A;  5IOD A;  2MGS A;  1HNX Q;  4QB4 A;  1UE5 A;  3KDF A;  4A3J B;  5DNF A;  1TR5 A;  4X62 L;  5FLM H;  3BVZ A;  4IUV A;  2MFI A;  2ICE C;  3KF6 A;  2HCI A;  4K6L A;  1U4P A;  3PO3 B;  3W1B A;  1WYD A;  3RZD B;  2F0F A;  2R7Z B;  2JXM B;  4WRD A;  3HKZ G;  1NJI C;  3HOX G;  1FJG Q;  2G5D A;  2F0Q A;  3J80 E;  4JOI A;  1PH3 A;  1Y8P B;  4LFC Q;  4C56 C;  3HOZ B;  2KEC A;  4L8J A;  3MVV A;  4ZUJ A;  3HOV G;  5IGG A;  5C4X G;  3H91 A;  4NPS A;  3HOX H;  3VR5 A;  2D9U A;  4X65 L;  2B63 H;  3FDT A;  2F0I A;  5ELO A;  2NBF A;  1S5F D;  1A62 A;  1EU3 A;  1LTB D;  3NBI A;  2J0T D;  2PI2 E;  3OMG A;  2K5H A;  2P5Z X;  3QIA A;  2KVM A;  1YNJ D;  5E7N A;  3RZD H;  2XVS A;  1PH1 A;  1XNR Q;  1HJP A;  1H95 A;  3GTO H;  3MXG A;  1QG7 A;  2PW5 A;  5ISR A;  4NXM Q;  3I8Z A;  3VA7 A;  4DFA A;  4K2L A;  1GD7 A;  1JB3 A;  1OXU A;  1DOK A;  2IW3 A;  1HFG A;  1E7Z A;  3RR5 A;  1DOL A;  2RSN A;  1I94 L;  4LF6 Q;  1YI2 A;  2I07 B;  2B2T A;  1SBB B;  1SYC A;  1BCP B;  2AQ1 B;  2NTS A;  3WOE A;  5KNC A;  1TWH B;  5IGD A;  3HOY B;  3WWV A;  1YJN A;  4OO1 G;  3NQI A;  5CC4 A;  2N3S A;  1VF5 C;  4KHZ A;  2PQA A;  3CPF A;  3DM1 A;  2B63 G;  2Z6K C;  3IL8 A;  1D1K A;  3I7F A;  1K9M C;  4DNR B;  4B3R Q;  4OXP A;  1EUJ A;  5JOB A;  3A8K E;  4NXM L;  1PHJ A;  2NWG A;  2I5L X;  3QR8 A;  4A3J H;  2JA6 H;  1X56 A;  1P16 A;  2R7D A;  1LAB A;  2R6G A;  3T16 A;  3O13 A;  3HFZ B;  4DXG A;  4LFC L;  2GVB A;  5KEE A;  4O1N A;  3NHH A;  4AYB E;  2VXW A;  3TS0 A;  2NVT B;  3F8T A;  1Q8K A;  5JEA G;  1HQM C;  3J81 c;  1ICF B;  2JK8 A;  1NY4 A;  1EIF A;  4B3R L;  1FGB D;  4DXF A;  3CMA A;  4HIK A;  4HJ7 A;  4DR6 Q;  1KAW A;  4JI5 L;  2DJG C;  4R1J A;  1ASY A;  3FRP B;  5A35 A;  2NVY B;  2WFW A;  1NSN S;  4JI4 Q;  5IYB G;  1VQL A;  1CQF A;  4LF7 L;  4B3M L;  2AKW B;  2JE6 I;  2SOB A;  3P20 A;  3W5O A;  2E2I B;  3CRL C;  4P75 A;  3OMC A;  3H3V I;  1K83 B;  1XNR L;  1VQG A;  1NNX A;  2QDL A;  1LTT D;  2F0N A;  1GUG A;  1A2U A;  4QY7 A;  5C4X B;  1G2T A;  1NMF A;  2FFK B;  1GUT A;  3D3R A;  3UDG A;  2G9H D;  3S15 B;  2WP8 J;  1EY6 A;  1BDO A;  5DAU A;  3DLL A;  1AZQ A;  1XMQ L;  5COR A;  4A93 H;  3KDF B;  1KHI A;  1I50 B;  4IFD G;  1RCV D;  1JWS D;  4JC0 A;  4JBK A;  1N33 Q;  1ET9 A;  3BVM A;  3VYR A;  2C9O A;  3ERQ A;  2Z0S A;  2XN9 C;  2YTV A;  5JJL A;  1EWC A;  4YCV A;  3KF8 A;  1CI3 M;  2ZT9 C;  4KJO A;  3SE0 A;  2SNS A;  3BYT B;  4JBM A;  3TZU A;  4IN3 A;  1Q8I A;  1EQQ A;  1QNU A;  2E2J H;  2F0O A;  2K5V A;  3L2P A;  3CME A;  1J5E Q;  2RCF A;  5FK9 C;  1XTD A;  4LMQ D;  1FL0 A;  3OYY A;  4A3M B;  1U5K A;  3I90 A;  3TS2 A;  3NWT A;  2IHE A;  2K28 A;  4KHV A;  5FO9 B;  1IKL A;  4J15 A;  2L55 A;  5C3E G;  1UWV A;  5JPN C;  4DV1 Q;  4S3S A;  3PIP 3;  2Q2T A;  1HA6 A;  4EQN A;  3HOX B;  1E0B A;  5CV6 A;  4J8Q A;  2R7F A;  3JAM L;  2RVL A;  2JA8 H;  3LNN A;  1CSP A;  2EYM A;  4C3H B;  1SYB A;  1EYC A;  5IT9 L;  2RHS B;  2OTL A;  5IP7 G;  1WD1 A;  5LMU L;  3R8B A;  2QKI C;  3DWA A;  3OTO L;  2LXK A;  1I4Q A;  2EYF A;  4BXX H;  1IYV A;  1R9T B;  1B1Z A;  3NBH A;  1DXM A;  1X3G A;  4CBV A;  4EX5 A;  1C9O A;  2YU9 B;  1QIL A;  4XYO A;  4TRD A;  3S2H H;  1LO5 D;  2IY5 B;  3W2D A;  1HH2 P;  4JI1 Q;  4LF4 L;  1D2B A;  5M9O A;  1DYQ A;  1TS2 A;  1S5B D;  4A4I A;  1J6Q A;  1CA6 A;  2Q8T A;  4HJ8 A;  1CHQ D;  3STB D;  2CCZ A;  2R92 B;  1Y69 U;  2BE5 D;  1U4M A;  1SMY D;  1B3Q A;  2WAQ B;  1X65 A;  1VQ8 A;  2EE1 A;  4OWT B;  3I91 A;  3F2B A;  3TP8 A;  3NEN A;  3FHW A;  2JA6 G;  1S5E D;  4WJ4 A;  1Q81 C;  2XNA C;  1JT8 A;  1E2W A;  1PYW D;  1CUK A;  1STH A;  3KOJ A;  2E2D C;  1Z7T A;  1JJG A;  4K2K A;  5IYC H;  1Q3L A;  3RNU A;  1LV9 A;  1XMO L;  4OO1 H;  5FLX c;  1EY4 A;  1PLF A;  1FYC A;  3L9A X;  4LF4 Q;  4A3L H;  1Q82 C;  2QIL A;  1CKN B;  4K5V A;  3CCU A;  4JBJ A;  5CMD A;  1ILP A;  1XNQ L;  2CVR A;  5T1I A;  4GLX A;  2Y0S E;  1VF7 A;  2XWJ B;  1BBU A;  1PH8 A;  2AHO B;  3RMH A;  4DNT B;  3F2C A;  3ER0 A;  4U67 3;  1HNW L;  1PFN A;  3OHX C;  4WJW A;  1JWU D;  3GTL H;  1H9K A;  2E2I H;  2B39 A;  1X3P A;  2WAQ E;  1WCM B;  1Y1V G;  3PIO 3;  2UU9 Q;  2WV6 D;  1G6P A;  3F2D A;  1HZB A;  3MXU A;  2B2U C;  3ONA B;  1MD2 D;  4RGM A;  4A3I G;  1FNU A;  1XPR A;  4ALP A;  3MEF A;  4ZRZ A;  2JEB I;  4RAU C;  4KY5 A;  4BY1 H;  5T1G A;  2K5W A;  4A3I H;  5CGK A;  4UAI A;  2MO0 A;  1RIP A;  5GAG C;  3CD6 A;  2BCO A;  3I4N G;  5M3M H;  4QF4 A;  3H3V C;  1T9H A;  2CW0 C;  3MWY W;  5K36 G;  1WOC A;  5LMN L;  1X6O A;  3KLS X;  4JI8 Q;  2WIN B;  5KGU A;  2B2W A;  1IBK L;  5BR8 L;  3Q22 A;  1EFI D;  1UEA B;  2DNE A;  4QGU A;  4FXG C;  5IGB A;  1BOS A;  1Q1B A;  2EPB A;  4IOA A;  1HHV A;  1Q86 C;  1CKN A;  1K0S A;  1C4Q A;  1G2S A;  2RHQ B;  2JA8 G;  4KY6 A;  3GTK B;  4KHP Q;  3EBE A;  1N34 L;  4G7O C;  1P8L A;  1TY2 A;  2E74 C;  5JVH 3;  5M3M B;  1NTG A;  4X3S A;  4IJL A;  1SMX A;  2FMM A;  4ZLT F;  3PF5 A;  3E0E A;  3ERO A;  1TT2 A;  1SDF A;  3ND9 A;  3VR3 A;  2ES2 A;  4JV5 Q;  1B7Y B;  4N8X 1;  4X64 L;  4AH6 A;  1UE6 A;  4QUF A;  2B2Y A;  2L15 A;  1HNW Q;  2KEN A;  4C1N K;  4IFD H;  2UXC Q;  2LFN A;  3EVQ A;  3BS1 A;  4U68 A;  3HOV H;  1ZKO A;  4UP9 A;  1OXX K;  4L5Q A;  1IBL L;  5LHY 1;  2DN8 A;  1A3U A;  3GTL B;  3J80 L;  1F9P A;  2L9H A;  4A3G B;  4K14 A;  2F0T A;  3GTQ H;  4IUP A;  3R3O A;  1GXD C;  3M4O B;  4FYD A;  1HR0 Q;  5JVG 3;  4KKS A;  4WOR A;  1V1P A;  1W3S A;  4K0K Q;  2EZV A;  5D65 A;  1IBM L;  3I4M H;  4A3D B;  4DV0 Q;  2PZU A;  4C2M B;  4TKO B;  2BH2 A;  3NSW A;  3I3C A;  1PH6 A;  1IBL Q;  4C3J G;  4RGT A;  4KD3 A;  5IY0 A;  1OO9 B;  5HGT A;  1Q90 A;  2A6E D;  2CWP A;  1E1O A;  4HMJ A;  1H9S A;  3J81 E;  4G7H C;  4KY7 A;  2JA5 G;  1EOV A;  4DR2 Q;  1SND A;  5FO7 B;  3GTJ H;  2MQH A;  2BE5 C;  2RDF A;  4JI2 Q;  1KNE A;  5CV7 A;  4L6T B;  1S72 A;  4YCU A;  5I2X A;  1N36 Q;  2WB1 E;  4JPB W;  4JI1 L;  1F2M A;  3CF5 A;  3IKJ A;  4HID A;  1I3Q B;  5DLQ E;  2F0V A;  4R4O A;  1IL8 A;  3HG9 A;  2OEO A;  5KIX A;  3Q23 A;  1WTV A;  2D62 A;  2RDH A;  5C0X I;  2NVQ B;  3CU7 A;  2JP1 A;  2NZO A;  4ZKC B;  3SXH A;  4FF4 A;  1EWH A;  2VL6 A;  4DK6 C;  4OON A;  4CDC C;  4B3T L;  2V1C C;  1G29 1;  3K7A H;  1PTO F;  3CW2 C;  1KAB A;  3OIP A;  4DK3 C;  2K01 A;  1GUS A;  1TWA H;  1GUO A;  1Y1W H;  1GVP A;  2EXD A;  1I94 Q;  3ZJY C;  1FR3 A;  1VQB A;  1JWM D;  1YNJ C;  2CQA A;  4OEL B;  4HN7 A;  4FO2 A;  4JW0 A;  4DK0 A;  1BBX C;  2IL8 A;  5DM7 3;  1S5D D;  3PUV A;  4XQN A;  5JPM C;  3QJY A;  3ULL A;  1VQC A;  2FHT A;  1WTO A;  1PYS B;  1TII D;  1HTL D;  3G7L A;  3Q24 A;  4BS9 A;  2A69 C;  5GAE C;  3FP9 A;  1V9P A;  5ELD A;  2UUB L;  1RJT A;  4EVO A;  1N34 Q;  4OIJ A;  3HOZ G;  4B08 A;  2ALY B;  1VCI A;  3ICE A;  4ZKB B;  3M85 A;  4JI6 Q;  1F2L A;  1S5C D;  1CT1 D;  5FLM G;  2IX1 A;  2EIF A;  4EQP A;  1WTP A;  2EYJ A;  4A3K G;  3UDX A;  4H7B A;  4YCW A;  1G91 A;  4HTH A;  1SE2 A;  2F0E A;  5G3L F;  3A54 A;  1PFM A;  2EY6 A;  3N6R A;  1KNA A;  1UEB A;  2TSS A;  2LMC B;  3TSS A;  5EBC A;  1SLJ A;  3T1H L;  2Z6B A;  2VQF L;  3K5N A;  3A8J E;  2TMP A;  4K5W A;  5LL6 X;  2QW7 A;  2ZM6 Q;  4Y52 H;  3U9O A;  4YY3 Q;  5KNB A;  4DV7 Q;  3S17 B;  1WD0 A;  4GLA C;  2M9V A;  4TVA B;  1MSH A;  3EFX D;  2A74 C;  4FP5 D;  5ELB A;  2VB2 X;  3JC6 6;  3S15 H;  4QQB X;  5EKI A;  4ZAI A;  1M1K C;  2ZXO A;  3X3M A;  1VMC A;  3CC7 A;  1QB5 D;  1EEF D;  5C3E H;  1A15 A;  2ZM6 L;  5M3F H;  2Z1C A;  2MJ8 A;  3S14 H;  3C3L A;  5G3L D;  3KJO A;  2F0M A;  2VUM B;  1SRO A;  2NVY H;  2N88 A;  3KLW A;  3DWQ A;  4I7A A;  3HZX A;  1GO3 E;  3ULJ A;  1VQJ A;  2K5N A;  1AH9 A;  3E9I A;  3M3Y H;  2CHB D;  1EZ6 A;  2H1E A;  2I5M X;  1QJO A;  3OW2 A;  1EIY B;  3CCQ A;  3PV0 A;  3Q8D A;  3JAM i;  1U4R A;  2IWH A;  1M4V A;  4PZ6 A;  3S2D B;  3N52 A;  2B2V A;  4F7X A;  1V1O A;  2GN5 A;  1N9W A;  2K4K A;  2R3Z A;  3BZC A;  3L7Z C;  1SNC A;  4GOP C;  2UUC Q;  4ODG A;  2WKD A;  2IX0 A;  1I6H B;  2A6E C;  4RA8 A;  4DUY Q;  1PZK D;  1XXG A;  3I4N B;  1MBY A;  1ASZ A;  2HDM A;  5I4D A;  4PZ7 A;  1O7Z A;  4A3B G;  1ONL A;  4KI0 A;  3HEJ A;  3HOU B;  3ERS X;  3IFD A;  2OQ0 A;  1HR0 W;  2IT1 A;  4P2C B;  1L0X B;  4GLV B;  1E24 A;  1K83 H;  3DHQ A;  1AEX A;  4R4T A;  2AUK A;  4GN4 B;  4DAM A;  1K8G A;  3E0J A;  1ESR A;  1QWY A;  1K8O A;  3T1H Q;  2ZTE A;  1ROD A;  3CCE A;  4FDB A;  1GUW A;  1B44 D;  3I4N H;  5CR3 A;  3RD4 A;  5DM6 3;  3P1H A;  3AFP A;  1ZYR C;  3K8A A;  3PIP A;  2F0U A;  5H1S E;  3LWU A;  1UE1 A;  1HA5 A;  1DD2 A;  4DR1 Q;  5LMN W;  3TRZ A;  1CSQ A;  1VQ4 A;  1OXT A;  3OWF A;  1TU2 B;  1GHK A;  4LUV A;  3I73 A;  3FMC A;  4FF2 A;  4L5R C;  3D6C A;  3R2I A;  4K6D A;  5EPK A;  2E2H H;  4JYA L;  3UDI A;  5FLX L;  3D6W A;  4BA2 I;  2N78 A;  1N32 L;  2EY5 A;  1TWG B;  5FKA C;  5IYD H;  1ILQ A;  5C5M A;  4J6H A;  1MKH A;  4YIJ A;  3KBG A;  2WAC A;  4R8N A;  5ELC A;  1SNM A;  1Y1V B;  3NK9 A;  2JEA I;  2VS1 A;  2YV5 A;  3PCO B;  3BU2 A;  5ELF A;  1WTX A;  1YHQ A;  1S3O A;  1U4L A;  1ESF A;  2AQ3 B;  4R4C A;  2Z6K A;  1C48 A;  5I9P A;  5IGF A;  3KLR A;  1KRS A;  4DR2 L;  1J5E L;  2E2H B;  3S1R B;  1U9R A;  3W3A A;  4O42 A;  3CHB D;  4IUQ A;  4XT1 B;  1QVG A;  2HIX A;  1CZG A;  3GQB A;  5HY6 A;  4CKC A;  4IFD I;  1JOQ A;  4UDU C;  3DEO A;  3I72 A;  4HED A;  3LX0 A;  1KXL A;  3RLO A;  1CKM A;  3V2T A;  4CDD C;  3TME A;  2GA4 B;  4A3E H;  1PRT C;  4KK7 A;  3DMU A;  1F9Q A;  2UUB Q;  1O78 A;  2B8F A;  4OGQ C;  1Y8N B;  1YIT A;  2A73 B;  3FKI B;  5HUR A;  4A3F B;  2VNU D;  1ET6 A;  5M5X B;  2G9D A;  4IPG A;  3KFU A;  3OSO A;  5C44 B;  2DY8 A;  1EY9 A;  4ZK9 B;  1NR2 A;  1V43 A;  1Z9F A;  1NAP A;  2YU9 H;  2AWN A;  4AQY L;  2RQX A;  1WJJ A;  2I46 A;  4R8I A;  3NTK A;  5M5W B;  4M1U B;  4GOP A;  2Q2H A;  2KCC A;  3C1F A;  5CBE E;  1HTP A;  4DV4 L;  3C2P A;  4KJN A;  1HQR D;  1DON A;  2M2L A;  4IUU A;  3G4S A;  3S1Q H;  2KJX A;  1JIC A;  1TWH H;  1A2T A;  3U58 A;  2L12 A;  3PO2 G;  2JSO A;  4AIM A;  3JAM E;  1PV4 A;  4O0A A;  5C44 H;  2RF4 A;  3FEW X;  4X62 Q;  1EY7 A;  4C3I G;  1I3Q H;  1TXY A;  4P74 A;  1K28 A;  3H0G H;  2F0L A;  1LT6 D;  3HKZ B;  3VR2 A;  4X66 L;  4JI4 L;  2IX3 A;  3QB3 A;  4DV4 Q;  2B2U A;  4HCE A;  3CCR A;  3PQI A;  1YJW A;  3H0G G;  4LF9 Q;  2F4I A;  3J81 L;  1EEI D;  3KF6 B;  1A8V A;  5E1F A;  1YJ9 A;  5A2Q E;  1OXV A;  4EQO A;  3MAQ A;  3FPU B;  2QEX A;  1TWC B;  1LTR D;  4CGY B;  3A8I E;  2Q2I A;  4MTK A;  1EYG A;  1TVX A;  1DZ1 A;  4IUR A;  1JOR A;  3S1N H;  2EYL A;  1HZC A;  3GTG B;  1PFS A;  1K8M A;  1BO0 A;  1WCM G;  3I4O A;  3F1Z A;  1AFP A;  3VR6 A;  5HGQ A;  5EKL A;  1UUP A;  3G6E A;  2ID0 A;  3NP8 A;  4GNX B;  3OIQ A;  1UE7 A;  3J81 i;  4DGZ A;  4UPA A;  4DAY B;  2NYZ D;  2KOL A;  3L0O A;  1YNN D;  2Y0S B;  2HDL A;  2HIV A;  3D0F A;  1PZJ D;  1LTI D;  2KHS A;  4NW2 A;  2F52 A;  1QVF A;  3AQQ A;  2DGY A;  2F4V L;  4HJA A;  3GTQ B;  3S1M H;  4POG A;  1QCB D;  2MHV A;  3S1N B;  2NB0 A;  3H09 A;  4PZ8 A;  1PTO H;  2BOS A;  3M4P A;  2L1B A;  1SR3 A;  2BA1 A;  1SJH D;  5IGE A;  3PO2 B;  4IJH A;  4C2M H;  3MHB A;  1RTO A;  1GKH A;  5IYC G;  1WTW A;  1ENF A;  2FIN B;  3K6O A;  5E3F A;  3VYU A;  1STA A;  2A5H A;  4GKJ Q;  2WB1 B;  1EZ8 A;  1CTM A;  1SSO A;  2K05 A;  4DV3 Q;  2EOT A;  4CDF C;  4R9W A;  4PQX A;  1YHA A;  1AE3 A;  1GUN A;  2ENB A;  3HOV B;  3A7A B;  4JYA Q;  4XIG S;  1VQN A;  5C4J H;  4B9X A;  4DUY L;  4F88 A;  5IYB H;  1CHP D;  4RKL A;  1A0I A;  2XSC A;  5CBA E;  3K58 A;  2B2Y C;  2OXP A;  3AB9 A;  4Y7N B;  4A75 A;  3OOC A;  3ITP A;  3S16 B;  2K75 A;  3H6M A;  5AJ3 Q;  3TN2 A;  3KBX A;  4A93 B;  5AFW A;  1HNX L;  1L1O B;  4OX9 L;  1KDA A;  1HNZ L;  4OO1 I;  2JA7 G;  1Y1V H;  4DAV A;  2Q8R E;  5JAV A;  1QUQ A;  4HAE A;  3MFY A;  3CCM A;  1YIJ A;  1E3P A;  1XTC D;  4OWX B;  3K5M A;  4GKK Q;  2BDN A;  1NR4 A;  5C4Z A;  4RHR A;  3GD7 A;  2ZTC A;  4KD4 A;  2Z8L A;  2JYO A;  1DCZ A;  3NBH B;  4DR5 Q;  3BG3 A;  2HCC A;  1H9R A;  5M5X H;  4MIU A;  1D5X C;  4V0B A;  4DNI A;  3RN5 A;  4GKK L;  1O7L A;  2E75 C;  3D31 A;  1EQR A;  3AFQ A;  3M4Y A;  4L5T A;  5J3B A;  1EWI A;  5EJW A;  2QCP X;  2B8G A;  1HUM A;  2A6H D;  4JK1 C;  5CV5 A;  1VQO A;  4X3K A;  3T13 A;  2PZW A;  3HOY H;  2CH4 W;  3VA5 A;  5A2Q L;  1EYA A;  1FVI A;  1E2V A;  4NP5 A;  1L0Y B;  5FJ8 H;  4BXX G;  3KLS A;  4JI6 L;  1VQI A;  5LMU Q;  3NWS A;  1BBW A;  1Q12 A;  4AYB B;  1WTH A;  3HOW H;  1HFN A;  1KLU D;  1QVC A;  4X6A H;  3KF8 B;  3EIV A;  4HCS A;  1CFM A;  3HOW G;  1JOK A;  1E22 A;  4LUZ A;  2JA6 B;  4OHJ A;  1X54 A;  5I6W A;  2B3G A;  1IW7 D;  1RKN A;  3I56 A;  4GKJ L;  2A69 D;  2D2C C;  2RBM A;  2X6L A;  5BN4 A;  1TWG H;  3PUX A;  1A3T A;  3E3X A;  1V1Q A;  2SEB D;  3TP7 A;  5NUC A;  2NVT H;  1TS3 A;  3I4M G;  2O5I C;  4P73 A;  5D14 A;  3U9S A;  1IYJ B;  3KUP A;  4LW1 A;  1EU4 A;  3UI2 A;  3BJU A;  5C3E B;  2K5Q A;  2Z4I A;  1DJR D;  1Z6H A;  1WTQ A;  3UE0 A;  1RHP A;  4JI5 Q;  1F9R A;  4BY7 G;  2UUA L;  3RLF A;  4B3S L;  3QWN A;  1FNV A;  5EPJ A;  4LJZ C;  2Z9H A;  2OF1 A;  3HS0 C;  4UP7 A;  1M90 C;  1PYB A;  3J7A F;  1NUC A;  1PMR A;  2DY7 A;  3AU7 A;  2Y0S G;  1EY5 A;  1EYD A;  1LLR D;  1I4P A;  1YHB A;  4FVM A;  4DR1 L;  3BVG A;  2C5C A;  4BBR B;  3BYY B;  2K5D A;  2K6A A;  1X3F A;  2UXB L;  1D7Q A;  2E8G A;  1B4O A;  1HZ9 A;  1EFW A;  4RCO A;  1BR9 A;  1TKW B;  5M3F B;  2B2V C;  1D5Z C;  3PIO A;  1SE4 A;  4X3T A;  4QIW E;  4A3M H;  4JI2 L;  2AQ2 B;  2LKV A;  2WAQ G;  4GN3 B;  4HSV A;  1B53 A;  4Q5V A;  4BY1 B;  2CQO A;  4GNX A;  2JQO A;  2J7Z A;  1ICW A;  4ZCK A;  4IPC A;  3T1Y L;  3SGI A;  1XYI A;  4WFN 3;  1LT5 D;  2ZTD A;  2B2T C;  4H13 C;  4QMG A;  4NB3 A;  4XYQ A;  4IO9 A;  1PTO B;  3LGJ A;  1I50 H;  3HKS A;  4RGO S;  1I4H A;  1SYG A;  4N9T A;  5C0X G;  2E5L L;  2WII B;  3FVQ A;  3A7L A;  3R93 A;  3A55 A;  3SDZ A;  1C8C A;  1BCP C;  1BVS A;  4M8A A;  4JI0 L;  3PO3 G;  5COY A;  4R4I A;  3CC2 A;  2NTT A;  4PNY A;  3VDY A;  4QJF A;  2O5J C;  2PNH A;  4F87 A;  3SEB A;  2PNR C;  1KD1 C;  1HR0 L;  4DR6 L;  2K33 A;  4NDX A;  1Y14 B;  1ML0 D;  3NEM A;  4ULL A;  2MPM A;  1PH7 A;  1SXT A;  1F77 A;  1I4R A;  4JCV E;  1Q7Y C;  1VQ9 A;  4KKT A;  1K3B C;  1B9M A;  1V1P B;  1SAP A;  4OEM B;  1K3R A;  3ULP A;  1SYF A;  2K03 A;  5EGT A;  4X65 Q;  1U0L A;  4RH6 A;  1QUQ B;  4CJ0 B;  1LUZ A;  2PCF B;  3K81 C;  4K8J A;  2JJQ A;  4R4Q A;  3CP0 A;  1OXS C;  3T51 B;  4Q0F A;  4QCL A;  4POF A;  5EKK A;  1KTK A;  1Q1E A;  1LT3 D;  5J1Z A;  1SE8 A;  4CKE A;  1SNQ A;  4DKA C;  1L0W A;  3AMU A;  4AYB G;  5D3D A;  1L1O A;  3CRK C;  2XIW A;  1RL2 A;  1SNO A;  3GV6 A;  2JA7 H;  1PFB A;  3I2Z A;  1NE3 A;  1GJX A;  2ZJQ A;  2F1M A;  4LF6 L;  2EYP A;  3CCS A;  4OWW B;  3M9B A;  1J8I A;  1SE3 A;  4APV A;  4B9W A;  1VQP A;  4C3I B;  1DM0 B;  4ZUI A;  2E2J B;  4J1M A;  2EJF C;  3M7G A;  3FPP A;  4HJ9 A;  4KLK A;  5KRU A;  4BY7 B;  2DUD A;  2VB3 X;  2V4D A;  3D8G A;  4NMZ A;  3JAM c;  1B3A A;  3M7N A;  4I7Z C;  2F0D A;  1ENA A;  2JA5 B;  5IT9 c;  1O7Y A;  4ZYS A;  2QEJ C;  3PGZ A;  3UDF A;  4A3C H;  4PMC A;  1ENC A;  3SHL A;  4MNO A;  2YYZ A;  1JOO A;  2SNM A;  1O80 A;  5C6A A;  1LAC A;  3DM3 A;  1CKO A;  1KQS A;  1I6V C;  2F0P A;  2XRQ D;  4YWL A;  4KTA A;  3X3N A;  5C3X A;  4UHV A;  4DAP A;  4LF9 L;  4C3H H;  3MXN B;  3Q6S A;  5GAH C;  1BF4 A;  1E2Z A;  3BDL A;  3A0J A;  1PRT D;  3LWE A;  2X6G A;  3OW7 A;  1T5E A;  3HOW B;  3S1Q B;  4JVZ A;  3TP5 A;  4A3D G;  1JE4 A;  5LMN Q;  5KYL A;  1WFQ A;  2EYO A;  4B3T Q;  1HXY D;  3MZ5 A;  5IP9 H;  3T1Y Q;  3RUZ A;  3PF4 A;  2HQL A;  4FXD A;  4IPD A;  3TDQ A;  3E6Z X;  2A68 D;  1VQA A;  3CAM A;  1IYU A;  3GTK H;  2CKZ B;  1IXR A;  4DV6 L;  2HHH L;  2NN6 G;  5M3M G;  4PMB A;  1EY0 A;  1KDC A;  1WCM H;  5K36 H;  1K0R A;  4KN4 C;  1BCP F;  2UXC L;  2RKS A;  5KYI A;  2JA8 B;  1CK1 A;  1PRT F;  4XQJ A;  1FNW A;  1I5F A;  4N9P A;  3H0G B;  4JI7 Q;  1YVC A;  4ID6 A;  4RHS A;  3RN2 A;  4A76 A;  4RKB A;  1GM5 A;  1A3V A;  4HJ5 A;  2KCN A;  1RDP D;  2MP1 A;  1VDZ A;  3CKI B;  1TWF B;  4F8M A;  3NUC A;  2D0P A;  3QG1 A;  4LF8 Q;  2UXD Q;  1S4Z A;  3U4Z A;  4GZY C;  4LWC A;  2F3V A;  5GAD C;  3QOL A;  2ZJR A;  2DNC A;  4IPH A;  4BBR G;  1BCP D;  2O4X A;  1PA6 A;  4TQU S;  3M4O H;  2I0Q A;  1L2F A;  2OT2 A;  1W2B A;  4IOC A;  3J7Z C;  2HUG A;  1V8Q A;  3G71 A;  3IAY A;  5ELN A;  2F03 A;  1BQQ T;  1BUV T;  3V05 A;  1X9N A;  1TS4 A;  2B2W C;  4DR4 Q;  4UP8 A;  3H3V H;  4DR7 L;  3SK5 A;  3CCJ A;  2Z4H A;  4A3L G;  2HT1 A;  1ZXT A;  2Q8I B;  1PZI D;  3S1M B;  1CQV A;  2KUM A;  3I70 A;  1HZA A;  4BA1 I;  1PH9 A;  2K14 A;  1WVL A;  2VQF Q;  1N32 Q;  1SYE A;  1G6Z A;  2D0O A;  4XTC S;  4V19 0;  3UE1 A;  3ND8 A;  2BDO A;  1VQD A;  1STN A;  5EPL A;  3SK8 A;  4DV2 L;  2E76 C;  4A3K H;  1HPC A;  2XTI A;  3HKZ E;  1EOT A;  4K8I A;  3D4D A;  4DV5 L;  2QGQ A;  2AUJ D;  3GO5 A;  4DUZ L;  2O2L D;  1VQE A;  4DN4 M;  1PH5 A;  3GTG H;  5I2Y A;  3KYH C;  3L3O C;  2MUY A;  1SN8 A;  1XNQ Q;  2Q2U A;  1A6X A;  1D8L A;  3DEP A;  3TP6 A;  3S1R H;  1X55 A;  5IE8 A;  4C1N I;  1STB A;  3J80 c;  1TS5 A;  5AJ3 L;  4KMU C;  2JA7 B;  4JBW A;  4X3U A;  4L63 B;  4JI7 L;  1LTG D;  1QZH A;  1Z47 A;  1JB7 A;  1I4G A;  2J4X A;  3EJI A;  3HOU H;  5I6Y A;  3D4R A;  5FO8 B;  4A3E B;  4DV1 L;  3MXN A;  5FJ8 G;  5EQ0 A;  4A3B B;  4IAL A;  4IUT A;  1LTS D;  4A3G G;  1XPU A;  2F0G A;  4NXN L;  3PUY A;  4MN3 A;  2R61 A;  3FKI H;  3TQY A;  3TRE A;  4A3M G;  3PO2 H;  1UNS A;  2PW7 A;  2ZXR A;  4ZQ3 A;  4YY3 L;  4DU9 A;  3BDC A;  5C4J B;  3MFG A;  4DV3 L;  3OWE B;  1PH2 A;  2MNA A;  1X32 A;  4DR5 L;  4DR7 Q;  2F3W A;  4IZ8 A;  1AE2 A;  2B29 A;  4IUN A;  4LF5 Q;  3SK4 A;  1JE5 A;  1H9S B;  1Y1W G;  3S2H B;  2NVQ H;  1MIU A;  3D4W A; 
#chains in the Genus database with same CATH homology
 1E3P A;  4OWX B;  2ATW A;  4GKK Q;  3PUW A;  2VZA A;  3GTJ H;  2MQH A;  2KBN A;  2A8V A;  4LF7 Q;  4JI2 Q;  1IBM Q;  1S72 A;  3GD7 A;  4YCU A;  1N36 Q;  2ZTC A;  2WB1 E;  3PUZ A;  2R92 H;  2NN6 I;  4JI1 L;  3K7U C;  1K8A C;  1YEZ A;  3S16 H;  3CF5 A;  4B3S Q;  3S2D H;  4HID A;  3NBH B;  4DR5 Q;  1HNX Q;  5DLQ E;  1UE5 A;  3KDF A;  4LF8 L;  2UXD L;  1C0A A;  2FXQ A;  4R4O A;  5JJI A;  5M5X H;  1YNX A;  4X62 L;  5FLM H;  4DNI A;  2MFI A;  3RN5 A;  2D62 A;  3KF6 A;  4GKK L;  5C0X I;  3D31 A;  4O2D A;  1WYD A;  3W1B A;  4UY8 C;  1EQR A;  3AFQ A;  1L1O C;  3HKZ G;  1NJI C;  2NZO A;  3HOX G;  4L5T A;  5J3B A;  1FJG Q;  2VL6 A;  1EWI A;  4DK6 C;  2H5X A;  4DV7 L;  4OON A;  4JOI A;  1PH3 A;  4B3T L;  4LFC Q;  4C3J H;  3HOV G;  2V1C C;  5C4X G;  1VQO A;  4IFD J;  4NPS A;  3HOX H;  1G29 1;  3CCL A;  3K7A H;  3CW2 C;  4X65 L;  4DK3 C;  2B63 H;  1TWA H;  1Y1W H;  1GVP A;  2EXD A;  5ELO A;  1I94 Q;  3HOY H;  1A62 A;  4JI3 Q;  3ZJY C;  1FVI A;  1VQB A;  5FJ8 H;  2PI2 E;  4BXX G;  4LUO A;  2JA9 A;  2K5H A;  4JI6 L;  5E7N A;  1VQI A;  2AMC B;  3RZD H;  1PH1 A;  5LMU Q;  4H02 A;  1BBW A;  1HJP A;  1Q12 A;  1X3E A;  4YHH Q;  1XNR Q;  3HOW H;  1H95 A;  3GTO H;  3PUV A;  1QVC A;  5IP9 G;  4X6A H;  3RZO H;  3KF8 B;  3ULL A;  1VQC A;  3EIV A;  4NXM Q;  1PYS B;  5C0X J;  3HOW G;  1GD7 A;  1OXU A;  4LUZ A;  1E22 A;  1E7Z A;  2VUM G;  3RR5 A;  3A5Z B;  3IRB A;  1I94 L;  4LF6 Q;  1X54 A;  3FP9 A;  5GAE C;  1V9P A;  2B3G A;  1YI2 A;  2UUB L;  2F4V Q;  3I56 A;  1N34 Q;  2JA5 G;  4GKJ L;  3HOZ G;  2ALY B;  3WWV A;  1VCI A;  3ICE A;  1YJN A;  4OO1 G;  4DR4 L;  1TWG H;  3M85 A;  4JI6 Q;  2N3S A;  3PUX A;  3CPF A;  2PQA A;  4KHZ A;  5FLM G;  3S17 H;  1V1Q A;  2B63 G;  2Z6K C;  2IX1 A;  2NVT H;  3I7F A;  2EIF A;  4PMW A;  1K9M C;  3I4M G;  4B3R Q;  4A3K G;  4OXP A;  3UDX A;  4YCW A;  1VS0 A;  1EUJ A;  4P73 A;  1IYJ B;  4LW1 A;  3BJU A;  1KRT A;  4NXM L;  1PHJ A;  2I5L X;  4A3J H;  1UEB A;  3UE0 A;  2JA6 H;  1DGS A;  1X56 A;  4JI5 Q;  4YWM A;  1SLJ A;  1B8A A;  3T1H L;  1P16 A;  3GDE A;  2VQF L;  4BY7 G;  2R7D A;  4DV6 Q;  2R6G A;  1MIU A;  2QA4 A;  1KIX A;  3RLF A;  4BBR H;  2UUA L;  4B3S L;  3HOY G;  4A3E G;  3HFZ B;  4LFC L;  1M90 C;  4UP7 A;  2ZM6 Q;  4Y52 H;  1PYB A;  4YY3 Q;  5BR8 Q;  4DV7 Q;  2GVB A;  2Y0S G;  1C7Y A;  4GLA C;  1LM0 A;  4AYB E;  4DR1 L;  1YHB A;  2LSS A;  3TS0 A;  3F8T A;  4HIO A;  2NVX H;  1Q8K A;  4TVA B;  5JEA G;  3J81 c;  1SRU A;  2JK8 A;  1NY4 A;  2OWO A;  1EIF A;  4B3R L;  5C4X H;  4PG3 A;  1X3F A;  2UXB L;  1D7Q A;  2N8N A;  2E8G A;  4WJ3 M;  1EFW A;  1HZ9 A;  3JC6 6;  3CMA A;  4HIK A;  1KC8 C;  2KCM A;  4HJ7 A;  3S15 H;  4DR6 Q;  4QQB X;  1KAW A;  5GRO A;  4JI5 L;  3PIO A;  4R1J A;  4A3M H;  1XJV A;  1MJC A;  3EN2 A;  4QIW E;  3W1G A;  1M1K C;  1ASY A;  2WFW A;  4JI2 L;  2WAQ G;  4GN3 B;  3CC7 A;  5IYB G;  1VQL A;  4JI4 Q;  2IHF A;  5C3E H;  4LF7 L;  2ZM6 L;  2CQO A;  4GNX A;  4B3M L;  4JG2 A;  5M3F H;  2JQO A;  2AKW B;  2JE6 I;  3S14 H;  3KJO A;  2UU9 L;  4IPC A;  3T1Y L;  1SRO A;  3SGI A;  4LFB Q;  2NVY H;  2ZTD A;  3KLW A;  4IO9 A;  3GTP H;  2R93 G;  4NB3 A;  1FGU A;  3LGJ A;  3W5O A;  1GO3 E;  3ULJ A;  1I50 H;  3HKS A;  4X64 Q;  1VQJ A;  2K5N A;  1AH9 A;  3E9I A;  5C0X G;  2E5L L;  3M3Y H;  2OTJ A;  1NMG A;  4P75 A;  3H3V I;  1XNR L;  2I5M X;  3OW2 A;  1EIY B;  3CCQ A;  2HHH Q;  4LFA L;  1VQG A;  3PV0 A;  3Q8D A;  2EQS A;  2YTY A;  1BVS A;  3KJP A;  3JAM i;  5M3F G;  4A3B H;  4A3G H;  1TWC H;  2YTX A;  4PZ6 A;  4JI0 L;  4QY7 A;  4A3F G;  3PO3 G;  1N8R C;  1NMF A;  2GN5 A;  1N9W A;  2K4K A;  3BZC A;  2UUC Q;  3L7Z C;  4GOP C;  4R4I A;  3CC2 A;  3UDG A;  3VDY A;  2WP8 J;  4QJF A;  2IX0 A;  2KHJ A;  2PNH A;  4DUY Q;  1KD1 C;  1HR0 L;  4DR6 L;  3DLL A;  1ASZ A;  3PO3 H;  1XMQ L;  4PZ7 A;  4A93 H;  1Y14 B;  3KDF B;  2KHI A;  4A3B G;  1XMO Q;  1KHI A;  3NEM A;  4KI0 A;  4X66 Q;  2OCE A;  4IFD G;  3ERS X;  1PH7 A;  1TWF H;  2OQ0 A;  1HR0 W;  2IT1 A;  4JC0 A;  4JCV E;  1Q7Y C;  1E1T A;  3H15 A;  1VQ9 A;  4JBK A;  1N33 Q;  3AEV A;  2K50 A;  2Z0S A;  1K3R A;  4YHH L;  2YTV A;  4X65 Q;  4GLV B;  4GN5 A;  4YCV A;  3ULP A;  5JJL A;  1E24 A;  1U0L A;  1K83 H;  2E5L Q;  2CWA A;  1QUQ B;  2PI2 A;  1LUZ A;  4R4T A;  4DAM A;  4GN4 B;  4A3D H;  1K8G A;  4A3C G;  1MJE A;  4LFA Q;  3K81 C;  4JBM A;  3T1H Q;  2ZTE A;  2JJQ A;  3AYH B;  3I55 A;  4JI3 L;  3CCE A;  4BY7 H;  1I6H H;  4FDB A;  4R4Q A;  5GQO A;  1LTL A;  1EQQ A;  3I4N H;  1K73 C;  4JV5 L;  2E2J H;  3CP0 A;  1OXS C;  3AFP A;  3K8A A;  4POF A;  3PIP A;  1JMC A;  1Q1E A;  2K5V A;  3L2P A;  4MTN A;  5H1S E;  3CME A;  1UE1 A;  1J5E Q;  1SE8 A;  1XTD A;  4DR1 Q;  5LMN W;  3TRZ A;  1FL0 A;  1CSQ A;  3OYY A;  1VQ4 A;  4HIM A;  1OXT A;  1U5K A;  4DKA C;  3TS2 A;  1L0W A;  5JJK A;  4AYB G;  1L1O A;  2GVA A;  2IHE A;  3J80 i;  4LUV A;  4Y7N H;  1RL2 A;  4L5R C;  4J15 A;  2JA7 H;  1WI5 A;  5C3E G;  2AWO A;  1UWV A;  3I2Z A;  1NE3 A;  2E2H H;  2UXB Q;  4DV1 Q;  4JYA L;  3UDI A;  2ZJQ A;  4LF6 L;  1N32 L;  2VUM H;  2N78 A;  2Q2T A;  4BA2 I;  3CCS A;  4LFB L;  5IYD H;  4OWW B;  3M9B A;  1FJG L;  2R7F A;  4APV A;  1MKH A;  2JA8 H;  1VQP A;  1CSP A;  3PSI A;  4KHP L;  4DV0 L;  1IBK Q;  4K0K L;  4JI0 Q;  4HJ9 A;  4JI8 L;  2I5H A;  2JEA I;  2RHS B;  2VS1 A;  2YV5 A;  3PCO B;  4GS3 A;  4KLK A;  2DUD A;  3BU2 A;  2OTL A;  3JAM c;  5IP7 G;  3M7N A;  1YHQ A;  5LMU L;  1S3O A;  4R4C A;  5IT9 c;  5IWA L;  3OTO L;  3PGZ A;  4RG1 A;  3UDF A;  4A3C H;  2Z6K A;  4DR2 Q;  4MNO A;  2YYZ A;  2LXK A;  1KRS A;  1B70 B;  4BXX H;  4DR2 L;  3B6Y A;  1J5E L;  3DM3 A;  1VQM A;  1CKO A;  1KQS A;  4A3J G;  3A74 A;  1QVG A;  1X3G A;  1YZ6 A;  4YWL A;  2HIX A;  2BA0 A;  4EX5 A;  1C9O A;  5HY6 A;  4LF9 L;  3S2H H;  4C3H H;  4IFD I;  3MXN B;  5GAH C;  2IY5 B;  5JEA J;  1HH2 P;  4JI1 Q;  4LF4 L;  1R9T H;  1KXL A;  3A0J A;  1CKM A;  3RLO A;  2F3I A;  1VQF A;  4A4I A;  1J6Q A;  2XGT A;  3A5U A;  1NBW A;  2NVQ H;  3FKI G;  5M5W H;  4HJ8 A;  4A3E H;  3STB D;  2CCZ A;  3HOZ H;  4NXN Q;  2UUB Q;  4A3D G;  3STB C;  4DR3 Q;  3CPW A;  1YIT A;  5LMN Q;  1X65 A;  1VQ8 A;  1O7I A;  2A19 A;  1PH4 A;  4OWT B;  3F2B A;  2VNU D;  2R7Z G;  3NEN A;  1WFQ A;  3FHW A;  4IPG A;  2JA6 G;  4WJ4 A;  1Q81 C;  5IP7 H;  3KFU A;  4B3T Q;  1JT8 A;  1KL9 A;  2C35 B;  5IP9 H;  1CUK A;  3T1Y Q;  5EAY A;  2R7Z H;  3PF4 A;  2HQL A;  2LXJ A;  4IPD A;  4A93 G;  2R93 H;  3KOJ A;  1V43 A;  1Z9F A;  2ASB A;  2YU9 H;  2AWN A;  4AQY L;  3CC4 A;  1VQA A;  1JJG A;  3CAM A;  1VQH A;  1WJJ A;  5IYC H;  3GTK H;  3RNU A;  2CKZ B;  1XMO L;  1IXR A;  5FLX c;  4DV6 L;  4GOP A;  2NN6 G;  5M3M G;  1XMQ Q;  2Q2H A;  1WCM H;  3CXC A;  2HHH L;  2ZJP A;  4L5S A;  1K0R A;  4LF4 Q;  4DV4 L;  4A3L H;  1Q82 C;  2UXC L;  1CKN B;  2VY3 A;  1A63 A;  3CCU A;  4LF5 L;  4JBJ A;  4A3F H;  3G4S A;  1XNQ L;  4GLX A;  3S1Q H;  1I5F A;  1TWH H;  2Y0S E;  4JI7 Q;  1YVC A;  4MZ9 A;  3RN2 A;  4A76 A;  3U50 C;  3U58 A;  1BBU A;  3PO2 G;  1GM5 A;  2KCT A;  4AIM A;  1PH8 A;  2AHO B;  4JOI C;  3F2C A;  4O0A A;  3S24 A;  4HJ5 A;  1PV4 A;  5C44 H;  3ER0 A;  2RF4 A;  4X62 Q;  1I3Q H;  1TXY A;  1HNW L;  2D0P A;  4P74 A;  4LF8 Q;  2UXD Q;  3U4Z A;  3H0G H;  4LWC A;  4X66 L;  1VQ7 A;  5GAD C;  4JI4 L;  3GTL H;  2WB1 G;  2ZJR A;  4DV4 Q;  3HOU G;  4DPG A;  3CCR A;  2E2I H;  2WAQ E;  4IPH A;  1YJW A;  4BBR G;  3H0G G;  1Y1V G;  4LF9 Q;  2UU9 Q;  1PA6 A;  4TQU S;  3KF6 B;  2VQE Q;  3M4O H;  3F2D A;  1G6P A;  1A8V A;  2OQK A;  1YJ9 A;  2I0Q A;  1OXV A;  1HZB A;  1L2F A;  5IWA Q;  1W2B A;  3J7A 5;  4IOC A;  4A3I G;  3J7Z C;  3GTM H;  3TEH B;  2UUC L;  2QEX A;  3G71 A;  1HNZ Q;  5ELN A;  3RLN A;  1XPO A;  1XPR A;  4ALP A;  3G48 A;  2Q2I A;  3CQZ H;  2JEB I;  1JJC B;  3MEF A;  4BY1 H;  1EYG A;  3S1N H;  4A3I H;  1BKB A;  1HZC A;  1YBY A;  1RIP A;  2MO0 A;  4EQ5 A;  1PFS A;  5GAG C;  1X9N A;  3CD6 A;  4DR4 Q;  3I4N G;  1WCM G;  3I4O A;  4UP8 A;  5M3M H;  3H3V H;  1T9H A;  3F1Z A;  2VW9 A;  4DR7 L;  5K36 G;  3CCJ A;  4A3L G;  1PVO A;  1VQ6 A;  1WOC A;  5HGQ A;  5LMN L;  1X6O A;  2PMZ E;  2HT1 A;  1LYL A;  4JI8 Q;  4DUZ Q;  3G6E A;  2ID0 A;  4GNX B;  5BR8 L;  1IBK L;  3J81 i;  1UE7 A;  1N33 L;  4QGU A;  4UPA A;  4DAY B;  4RMF A;  2VQE L;  1IL2 A;  3L0O A;  1HZA A;  4BA1 I;  4QL5 A;  3OTO Q;  1Q1B A;  2HIV A;  3D0F A;  1PH9 A;  2K14 A;  2F52 A;  2VQF Q;  1QVF A;  3AQQ A;  5C44 G;  4IOA A;  1N32 Q;  1Q86 C;  4C3I H;  2DGY A;  1QZG A;  2D0O A;  4XTC S;  4GOP B;  2F4V L;  3UE1 A;  4HJA A;  2R92 G;  4BBS G;  4DR3 L;  1CKN A;  1VQD A;  4P71 A;  4POG A;  3S1M H;  4DV2 L;  4A3K H;  2RHQ B;  2JA8 G;  4KHP Q;  3EBE A;  4PZ8 A;  1N34 L;  2XTI A;  1P8L A;  3HKZ E;  3M4P A;  2N49 A;  1SR3 A;  2BA1 A;  1NTG A;  4DV5 L;  3E9H A;  2QGQ A;  5IYD G;  4IJL A;  2JA5 H;  3GO5 A;  1SMX A;  4DUZ L;  1VQE A;  1PH5 A;  3PF5 A;  3GTG H;  2CFM A;  3E0E A;  3KYH C;  4IJH A;  4C2M H;  1SN8 A;  1XNQ Q;  2Q2U A;  1GKH A;  5IYC G;  1D8L A;  2ES2 A;  3S1R H;  4JV5 Q;  1B7Y B;  3NEL A;  4X64 L;  4AH6 A;  1X55 A;  5IE8 A;  1UE6 A;  2L15 A;  4LNQ A;  1HNW Q;  2KEN A;  2K52 A;  4GKJ Q;  3J81 j;  2UXC Q;  3M4Q A;  3J80 c;  5AJ3 L;  3HOV H;  4DV3 Q;  4JBW A;  4B3M Q;  3U4V A;  1G51 A;  4UP9 A;  2RCN A;  1OXX K;  2UUA Q;  4L5Q A;  1IBL L;  4JI7 L;  1VQK A;  1QZH A;  1YHA A;  1Z47 A;  1JB7 A;  1OTC A;  4DV5 Q;  1AE3 A;  3GTQ H;  3HOU H;  2A1A A;  4DV1 L;  4OX9 Q;  4JYA Q;  4XIG S;  1VQN A;  3CCV A;  4YWK A;  5FJ8 G;  5C4J H;  1SFO H;  4DUY L;  1HR0 Q;  4DV2 Q;  5IYB H;  4A3G G;  5M5Y H;  1XPU A;  4NXN L;  1A0I A;  1Q46 A;  3PUY A;  4AQY Q;  3TRE A;  1W3S A;  3FKI H;  3TQY A;  1JJ2 A;  4A3M G;  4BBS H;  1N36 L;  3PO2 H;  4P72 A;  4K0K Q;  1IBM L;  3I4M H;  4A75 A;  4DV0 Q;  4YY3 L;  3BZK A;  4DV3 L;  2BH2 A;  4BY1 G;  2K75 A;  5AJ3 Q;  1IZ6 A;  2PQA B;  1PH6 A;  1PH2 A;  2MNA A;  1IBL Q;  4DR5 L;  5IY0 A;  4DR7 Q;  2NZH A;  1VQ5 A;  1AE2 A;  2B29 A;  2CWP A;  1HNX L;  1L1O B;  1E1O A;  1S40 A;  4LF5 Q;  3K80 C;  4OX9 L;  1JE5 A;  2MO1 A;  3K0X A;  1HNZ L;  4OO1 I;  4GNX C;  1Y1W G;  1Y1V H;  2JA7 G;  3CCM A;  1QUQ A;  2BH8 A;  1EOV A;  1YIJ A;  4ME3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...