4DAMA

Crystal structure of small single-stranded dna-binding protein from streptomyces coelicolor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
113
Chain Sequence
SMNEIMICAVGNVATTPVFRDLANGPSVRFRLAVTARYWDREKNAWTDGHTNFFTVWANRQLATNASGSLAVGDPVVVQGRLKVRTDVREGQSRTSADIDAVAIGHDLARGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein 1
publication title Structure-function relationships of two paralogous single-stranded DNA-binding proteins from Streptomyces coelicolor: implication of SsbB in chromosome segregation during sporulation.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Dna binding protein
total genus 20
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4damA00
3NBHB 1XJVA 4GOPB 4GN5A 4HJ9A 4A3JH 1YIJA 3HOVG 4BY1G 3S1NH 2KBNA 2UU9Q 1UEBA 1HR0W 1E24A 2RHQB 2IX1A 4JBMA 2JA8G 4Y52H 2CFMA 3ER0A 4JBKA 1W3SA 1MIUA 3M4PA 4DR6L 1TWCH 4A3MG 4OO1G 2UXCL 5C4XG 2JA5G 3HOYG 2F52A 5C4JH 2Q2HA 2PMZE 4DV2Q 2IT1A 3HKZG 5M5YH 1Z9FA 2R7ZG 1XNRQ 4JI7Q 1YJ9A 1Q82C 2AHOB 3M4QA 4DR2L 4JI3Q 3T1YQ 1JB7A 4JC0A 3CPWA 1KRSA 1FVIA 2I0QA 1C0AA 3H3VH 2E8GA 4HIMA 4YWLA 1Y1VH 1FGUA 4YHHL 3CMEA 2CKZB 2D0PA 4GNXC 4DR3Q 1PV4A 5HY6A 4BBSH 3S15H 3MXNB 2NN6G 4BA2I 1PYSB 1FJGQ 2OCEA 1VQLA 2OWOA 3U58A 1PH9A 4A3KH 4B3SQ 1EWIA 1A63A 2VY3A 1P16A 2UUBL 1VQ6A 3F1ZA 2K14A 2Q2UA 4GLAC 3NEMA 5IY0A 1I94L 4R4TA 2R7FA 4P71A 1VQDA 2E5LQ 2HHHL 4GOPA 4J15A 3CC7A 2UUAQ 1M90C 4JCVE 4NXML 1CKNB 1SR3A 3HKZE 4X62Q 4K0KL 4NB3A 3U50C 4A3LG 2VL6A 1X3EA 4LUVA 1EYGA 1IBML 4DV0Q 1U0LA 1YJWA 4LW1A 1A0IA 4MZ9A 3GDEA 2I5MX 1GM5A 4A3BG 2VQFQ 1TWGH 3E0EA 1TWAH 1MJEA 2I5LX 3PO2G 4GKJL 5IWAQ 2RHSB 4LF9L 4YY3Q 4LF7L 1UE7A 2VUMG 1UE5A 3ULPA 1XPUA 2UXDQ 1KXLA 3TQYA 1HZCA 1V9PA 3H0GH 3UE0A 4DUYL 3S2HH 2PQAB 1SN8A 1IBLL 3PUZA 1Q1BA 4AQYL 3H3VI 3EIVA 1VQGA 3CMAA 4JI0Q 2K5VA 1SMXA 2LSSA 1N9WA 1TWFH 1X56A 3EBEA 1N34Q 3I56A 3PCOB 4LFCL 3Q8DA 1BBWA 1L1OC 3OYYA 4KLKA 3ULJA 1YEZA 1GKHA 1XMQQ 1K73C 1NY4A 1VQKA 2VQEQ 3U4VA 4JI4L 3I4NH 4H02A 1VQBA 3J80c 2R6GA 5M3FG 5IE8A 4JBWA 5LMUL 1AE3A 3E9IA 4AH6A 3CCSA 1JT8A 2OTJA 4PZ7A 3PO3G 4OONA 1L1OB 4DV7Q 3J80i 1CKNA 4LF5L 2JA6H 4RMFA 1I3QH 4DV6Q 3A0JA 4LFBL 4JYAQ 1C9OA 3CCUA 3GD7A 4B3ML 2A8VA 5HGQA 1YVCA 2PNHA 1PYBA 3IRBA 5GQOA 2ID0A 4NXNQ 2QGQA 1X65A 4ALPA 2YTXA 4JI2L 1EIYB 1J6QA 4A3GH 2LXJA 4A3EG 4DV3L 1X54A 1PFSA 3CCEA 2N78A 3KF8B 3I7FA 2B63G 4DUZQ 2PQAA 3PIOA 1B7YB 2F4VQ 1Y1WH 4AYBE 4C3IH 1HNWL 2LXKA 1MJCA 3HOXH 2VZAA 3KJOA 3HOVH 3CCLA 2ZM6L 1X3GA 5M5WH 5C44G 4QJFA 3UDFA 4C3JH 3RZOH 3TS2A 4OX9L 3NELA 1A62A 2ZJRA 4UY8C 4A93H 4JI5Q 4A76A 4GOPC 1IXRA 1L2FA 4PZ8A 2A1AA 2KHIA 2I5HA 2PI2E 4R4IA 3RLOA 3S24A 3PF5A 4QL5A 3HOZG 3FHWA 4A3MH 4QY7A 5C4XH 1N32Q 1LYLA 1VCIA 2JA5H 4C2MH 3HOYH 2WB1E 1XTDA 1E3PA 2EQSA 1N8RC 2E2HH 1K83H 4OXPA 3UE1A 1HNXQ 2R7ZH 4DR5Q 1N36L 4GN3B 4DV2L 1YI2A 3GTOH 1PH4A 1JJGA 1L1OA 1OXXK 1XNRL 1EFWA 2JE6I 3G4SA 1E1TA 2JA7G 4JI3L 1TXYA 3T1YL 1Y14B 3KDFB 1QVFA 1AH9A 5C0XG 5ELNA 1YHQA 2CQOA 4JI6L 3HOUG 4DV1Q 1X6OA 2L15A 4DV4L 1XPOA 4DR3L 4LUZA 4IFDI 2CCZA 5C0XJ 1FJGL 2IHFA 3M9BA 4BA1I 1E22A 2MO0A 4B3SL 1VQPA 3J81c 2GVBA 3D31A 5GAHC 1SLJA 3H15A 2BA0A 2R92G 3BZKA 1JE5A 4X64Q 3JAMc 2NVXH 4QQBX 3CF5A 3T1HQ 3TRZA 4QIWE 4JI8Q 3A5ZB 1Q7YC 1EQQA 5J3BA 4BY7G 2YV5A 1HR0Q 4X6AH 3CCRA 4GLXA 4L5RC 2K50A 2AKWB 4KHZA 1Q12A 4RG1A 4P72A 3PIPA 2E5LL 3J81i 4TQUS 2UUAL 4KHPQ 2UXBQ 1IBKQ 3JAMi 2K52A 4A3LH 1VQFA 3E9HA 2HQLA 4LF6Q 2CWAA 4X62L 3M85A 3M3YH 1JMCA 1K3RA 2K5NA 4PG3A 3PUWA 2QA4A 1VQ4A 2NVTH 4OO1I 5IYBG 1J5EQ 2BA1A 2Z6KC 5IP7H 4YCUA 3F2BA 4UP7A 5IYDG 3TS0A 3PO2H 2VQFL 4LF4L 2NVYH 4DAMA 1SROA 2VUMH 2VNUD 2JA9A 4GKKQ 5IWAL 2FXQA 1VQOA 5BR8Q 3S17H 4YCVA 1KC8C 4BXXG 2ATWA 3KDFA 1JJ2A 5ELOA 1BBUA 2B3GA 3PUYA 4JI0L 1BVSA 4UPAA 1KD1C 1G291 2NN6I 1N34L 1D7QA 4IO9A 3AFPA 3F8TA 2MO1A 3GTLH 3PV0A 2ZJQA 3HOWG 3I2ZA 4GLVB 4HIOA 4JI1L 4IJHA 1G6PA 1XMQL 1VS0A 4GN4B 1PH6A 2VQEL 1KQSA 1OXVA 5M3FH 4DR2Q 5JJLA 4JV5Q 1NTGA 4JG2A 4XIGS 3PUVA 4PMWA 4X66Q 3S1QH 5C3EG 3G6EA 1OXUA 3CC4A 5FJ8G 4DV6L 4HJ7A 1SRUA 4LNQA 2BH2A 2CWPA 1VQ9A 4JYAL 1K0RA 4APVA 4A3CH 2K5HA 1EUJA 3WWVA 1N33L 4AYBG 1B8AA 2OTLA 1X3FA 3S16H 3KLWA 4NXNL 2N49A 1RIPA 3RLNA 3AFQA 4A3EH 4LFAQ 4R4QA 3I4OA 3U4ZA 4DV5L 1KAWA 2JQOA 1Q46A 5JEAG 3L2PA 2HHHQ 2GVAA 2AWNA 2GN5A 1NE3A 4EQ5A 4DR1L 4POGA 2B63H 1T9HA 1EIFA 1YHAA 2NZOA 4X65Q 4NXMQ 2WAQE 5IYCG 4A3FG 2N3SA 4DR7Q 4IOAA 2RF4A 5JEAJ 1H95A 2B29A 2D62A 2Z6KA 4IPCA 4A3DG 5C44H 4MTNA 2WB1G 3CCQA 3OW2A 4BBRG 1BKBA 5GAGC 3I4MG 4DR4Q 2K4KA 2KCMA 1QUQB 2AMCB 3D0FA 4P73A 5E7NA 4R4OA 4JI5L 3HOZH 4GKJQ 1L0WA 1E1OA 4POFA 5LMNL 1PHJA 1HNZQ 3STBD 4LF7Q 1N32L 5AJ3L 4OWWB 2HT1A 1PH8A 1WCMG 1WI5A 3JC66 4UP9A 1QVCA 4XTCS 3OTOQ 4GS3A 5K36G 1HNXL 1EOVA 4DR5L 2ZJPA 4IFDJ 1S3OA 1E7ZA 3ZJYC 3G71A 1VQMA 2MQHA 2JA7H 3GTPH 3KF6B 4BY1H 5GAEC 1VQNA 3KJPA 1KHIA 2UUCQ 2Z0SA 3W1BA 4A3IG 2JA8H 1IZ6A 5IT9c 2UU9L 5EAYA 4LUOA 2F3IA 2ASBA 2H5XA 1TWHH 4OWTB 1SE8A 4JOIA 4DV1L 3RNUA 3K8AA 4IJLA 1NMFA 3M4OH 3I4NG 4R4CA 1YITA 4HIKA 1X9NA 5LMNW 4P75A 2R92H 3K80C 3K7UC 4LF8Q 3K81C 4DK6C 2XTIA 5IP9G 1XMOQ 3J7A5 4BY7H 1RL2A 1VQJA 4JI7L 5GROA 3HFZB 3A5UA 1D8LA 4JI8L 3PSIA 2Q2TA 1QZHA 2R93G 2E2JH 2HIXA 2ZTCA 1LM0A 2ZTEA 1XNQQ 4KHPL 1QUQA 3BZCA 3K7AH 1YNXA 1CKMA 2WP8J 1CKOA 3GTJH 1M1KC 1I5FA 1YZ6A 4LF6L 3KOJA 5IYBH 1K8GA 1V43A 1WJJA 4Y7NH 5M3MG 1VQ5A 1P8LA 4L5SA 4IFDG 4LWCA 1J5EL 5IYDH 4L5TA 1CSPA 1X55A 2Y0SE 3F2CA 2JK8A 1PH1A 2JEAI 2AWOA 1LTLA 1PH5A 1VQ7A 1C7YA 4B3RQ 1XPRA 3GTQH 3FKIG 2N8NA 1Y1WG 1PH2A 4GKKL 2ZM6Q 3HOXG 2KHJA 3KF6A 4HJ5A 4BXXH 3GO5A 4DNIA 5BR8L 4OX9Q 1GO3E 4R1JA 5C0XI 1Q8KA 1VQ8A 1QVGA 4ME3A 2C35B 3LGJA 3RN2A 1SFOH 4A93G 2NZHA 3FP9A 2DUDA 3STBC 3SGIA 4B3TQ 3HOWH 2MNAA 4QGUA 3L0OA 2JEBI 1VQHA 4DK3C 2EXDA 1CSQA 4DPGA 4DV0L 4A3BH 1AE2A 5DLQE 1GVPA 4PZ6A 1N36Q 4IPGA 1UE1A 3GTKH 5FLMG 3ULLA 2OQKA 2EIFA 2IY5B 4L5QA 4YY3L 1Q81C 2UXDL 3CCMA 2YTYA 2YYZA 4A3JG 4JV5L 3GTMH 2IHEA 3I55A 1GD7A 1JJCB 3DLLA 2WFWA 4HJAA 4JI6Q 2V1CC 5C3EH 4DV4Q 1DGSA 3CP0A 1CUKA 4X66L 5FJ8H 4DR6Q 1QZGA 3F2DA 2UXCQ 1W2BA 4JBJA 2OQ0A 4IPDA 2WAQG 3S14H 4UP8A 1I6HH 3CPFA 3ICEA 3CAMA 3J81j 1VQAA 3DM3A 4NPSA 3CCJA 4C3HH 1PH3A 4LFAL 4JOIC 1VQIA 1MKHA 1NBWA 3CD6A 3K0XA 4GNXB 4AIMA 3UDIA 3VDYA 4A3FH 5IYCH 1VQEA 1Q86C 1PA6A 4YHHQ 1IL2A 3PO3H 4YWMA 1VQCA 4X65L 1Y1VG 4OWXB 4DV7L 1WYDA 4DR7L 4A3DH 3S1RH 3AEVA 1LUZA 4BBRH 1ASYA 4BBSG 4HIDA 1YHBA 3I4MH 2Q2IA 4YCWA 3UDXA 1S72A 1OTCA 1YBYA 4KI0A 3AYHB 2UUBQ 3TREA 1S40A 1UWVA 4A3KG 4DR4L 2QEXA 2ALYB 2ZTDA 5H1SE 2E2IH 1IYJB 3G48A 5IP7G 4EX5A 1YJNA 1I94Q 4LF4Q 1OXTA 4FDBA 1HNZL 1EQRA 1WCMH 2ES2A 1R9TH 4DUZL 4K0KQ 3OTOL 2F4VL 1HJPA 1Q1EA 2MFIA 1HZBA 4MNOA 2PI2A 1OXSC 2BH8A 4A3IH 1IBMQ 4DKAC 1V1QA 1K8AC 1HH2P 2HIVA 2UUCL 2YTVA 3M7NA 4JI1Q 5JJIA 3TEHB 2K75A 5M5XH 3CXCA 4YWKA 1PH7A 1O7IA 3RR5A 4LF9Q 3EN2A 3GTGH 1KIXA 1ASZA 3AQQA 4DUYQ 1IBLQ 1NMGA 4AQYQ 3S2DH 3PUXA 4DAYB 4GNXA 3H0GG 5IP9H 4LF8L 3PF4A 3CW2C 4IOCA 3B6YA 1WOCA 1U5KA 4P74A 3KYHC 1XMOL 1Z47A 5GADC 4LFCQ 2JJQA 2NVQH 2YU9H 3S1MH 2R93H 3KFUA 1I50H 2Y0SG 4O0AA 1FL0A 1G51A 4IPHA 2KENA 1N33Q 3HOUH 3UDGA 3ERSX 3HKSA 4JI4Q 1XNQL 4A3CG 2A19A 3CQZH 2RCNA 5M3MH 4DV5Q 4HJ8A 3W5OA 4DR1Q 5LMUQ 1UE6A 3RZDH 1PVOA 3A74A 5FLXc 1KRTA 3RN5A 1WFQA 1K9MC 3FKIH 4LF5Q 4WJ4A 4X64L 2VW9A 3W1GA 2VS1A 4B3RL 3L7ZC 3T1HL 4LFBQ 1HZ9A 4TVAB 2JA6G 1HR0L 1KL9A 4B3MQ 2R7DA 2D0OA 4WJ3M 1HZAA 3PGZA 2UXBL 1IBKL 4JI2Q 5JJKA 3CCVA 4A75A 3CC2A 1A8VA 2DGYA 5LMNQ 1NJIC 2KCTA 3MEFA 5AJ3Q 4DV3Q 4B3TL 3J7ZC 4A3GG 3NENA 3BJUA 3BU2A 4A4IA 5FLMH 1HNWQ 2IX0A 2XGTA 4O2DA 3RLFA 1B70B
chains in the Genus database with same CATH superfamily
4FVMA 1BNZA 2LS01 4ULLA 4A3JH 3GTKB 1CZGA 4K5WA 2K5DA 3OPOA 3N52A 1HR0W 1E24A 4OHJA 2CFMA 4CDFC 4JBKA 3D4DA 5DM73 3BDLA 4GZYC 4DR6L 5C4XG 2KA7A 2D9UA 1EY8A 5C3EB 1SNDA 5M5YH 2A5HA 1PZJD 4ZQ3A 3T1YQ 4WORA 2E8GA 3CRLC 5D65A 4YWLA 1Y1VH 3IL8A 1FGUA 4ZKCB 4DR3Q 1LTID 1BCPF 4BA2I 3O13A 1VQLA 4XQJA 1PFNA 3A55A 1A63A 4KY6A 4BBRB 2Q2UA 5C3WA 2XSCA 3NEMA 1S4ZA 2I07B 2E2IB 2HHHL 1ESRA 1LT3D 3CC7A 2UUAQ 2JSOA 4OIKA 1M90C 4NXML 4K0KL 3HKZE 4X62Q 1SNQA 3U50C 2B2YA 2WKCA 2F0GA 5KEEA 1WTXA 4DV0Q 3NTIA 2RSNA 1RDPD 3L9AX 1S5FD 1GM5A 4A3BG 1TWGH 2K1BA 4G4KA 1TY2A 2K28A 3D3RA 3KLSX 1TKWB 4KN7C 5JJZA 3TP6A 4JI0Q 1FYCA 5LL6S 3HGBA 2ZXOA 4FF3A 4H0LC 2DN8A 4KLKA 1YEZA 4X3KA 3Q6SA 5IODA 2VQEQ 3U4VA 1KDAA 3A56A 3K0YA 1TS2A 1GUNA 1A2UA 4RGOS 3E9IA 5KNCA 2VB2X 1JT8A 3ONAB 3RZDB 1CKNA 3TZDA 4LF5L 4DV6Q 4UAIA 4LFBL 1O7YA 2NTTA 1ZKOA 3GV6A 4B3ML 1YNJD 2PNHA 1PYBA 2CVRA 5C5LA 3OHXC 1ET6A 4IFDH 4O1NA 2L5TA 4A3EG 1B1ZA 5K5PA 1TS3A 1PFSA 2EY1A 3CCEA 2N78A 3KF8B 1B7YB 5JOBA 2K33A 2VZAA 3KLSA 5C5MA 4QJFA 4C3JH 3TS2A 3RZOH 1D5XC 4OX9L 1A62A 1F2LA 4A93H 1MI2A 1PRTD 1L2FA 1PZKD 2A1AA 3RLOA 3S1NB 2HUGA 4QY7A 1LYLA 3HOYH 2FJ2A 4F8MA 5AFWA 2R7ZH 1ET9A 3J81L 4CKEA 1N36L 3GTOH 3JAML 1XNRL 1EFWA 2JE6I 5C4JB 3OWEB 2JA7G 1SNPA 2EDGA 3Q23A 5ELNA 1I4PA 2CQOA 3M4YA 3HOUG 1I4HA 2L15A 4ODGA 4R8NA 3RD4A 1A6XA 4HSVA 1FJGL 4BA1I 2MO0A 1H9RA 5IIFA 2R92G 1M8AA 4A3KB 3SK8A 4JI8Q 1LABA 1YNJC 2K6AA 2E5LL 4P72A 1SAPA 4TQUS 2UXBQ 1TQOA 4K8IA 1IBKQ 4A3LH 1EY7A 3M3YH 2BE5D 3GQBA 3M85A 1EY0A 4G7OC 3PUWA 1VQ4A 2BA1A 4YCUA 1RODA 2EYHA 2QKIC 4UP7A 4RHRA 1ZEQX 4FF1A 4C56C 3GTLB 2Q8IB 4LF4L 4DAMA 2VUMH 1SROA 2IJ0A 1KNAA 3MFYA 2FXQA 2BDOA 3G7LA 5BR8Q 3MTSA 1TWAB 2F0LA 5CBAE 2R3ZA 3KDFA 2A68D 1JJ2A 1PRTC 1UEAB 2M2LA 4J6HA 1BBUA 2B3GA 2IX3A 1GHJA 4UPAA 3LWUA 3H0GB 2NN6I 3S2HB 2QF7A 1RD9D 2MO1A 3I2ZA 4GLVB 1QB5D 1PTOB 2F03A 2SDFA 1VS0A 4GN4B 1M4VA 1WD0A 5E3FA 3LWEA 3PUVA 2F1MA 2LFNA 5C3EG 4LNQA 1V1PB 1A3TA 4JYAL 3DM1A 4A3CH 3GP7A 3C46A 2SNMA 2OTLA 1ENFA 3RLNA 1B2TA 3U4ZA 2JQOA 1ZXTA 3L2PA 3ERQA 2HHHQ 2AWNA 2B63H 4QMGA 1LT5D 1X3PA 1YHAA 4NXMQ 4DR7Q 2RF4A 1SMYD 2BE5C 1H95A 1B3QA 2C5CA 2Z6KA 2KECA 3X3MA 2FMCA 4BBRG 1BKBA 4C3IB 1F2ZA 4CKCA 3HOVB 3D0FA 3VR3A 2F0KA 5M5WB 2O2LD 1JC7A 1HNZQ 4NW2A 3H91A 2F4IA 1N32L 5HURA 5AJ3L 2A68C 1SNOA 1WI5A 3JC66 4A3MB 1U9RA 1EOVA 1S3OA 1VQMA 1K83B 1VQNA 4FXKC 1KHIA 2Z0SA 5C0XH 3EA6A 2PZWA 2UU9L 5IT9c 4J8QA 2F3IA 4BS9A 2ASBA 2G9HD 3M4OH 4K5VA 4DV1L 2XN9C 3I4NG 1NSNS 5I9PA 3H3VC 2NZ1D 1U4LA 3EFXD 4KD3A 2KEEA 1KDCA 3NXWA 3BVMA 4BY7H 1VQJA 1PZID 2N55A 1BQQT 3PSIA 1QZHA 2NVXB 5CV9A 2E2JH 2HIXA 1XTCD 5FO9B 1XNQQ 1QUQA 1YNXA 1CKOA 2QDLA 3P1HA 5IYBH 3TMEA 2EY6A 4LWCA 4XYQA 2PPBC 1X55A 2B2UA 1MSGA 1PH1A 2AWOA 3OSOA 1VQ7A 1SMYC 2NVTB 4IALA 1Y1WG 2F0IA 5CYUA 1PH2A 3HOXG 4BXXH 3PO2B 4OX9Q 2NVYB 2WV6D 3NSWA 4TRDA 5HGTA 3NQTA 1SFOH 3S17B 3OIQA 3HOWH 3K59A 5I2XA 1AE2A 4PZ6A 5FK9C 1N36Q 5J39A 3ULLA 5FLMG 4L5QA 1CA6A 4JV5L 1T5EA 2A73B 4KMUC 5M3FB 3VA7A 3I55A 1JJCB 1D5MC 3MFGA 4X66L 5FJ8H 4DNTB 3P75A 1CFMA 5EBCA 5ELEA 1L0XB 3S1QB 2L12A 4DN4M 3S14H 3PMFA 2V4DA 4RAUC 4UP8A 1I6HH 3J81j 1VQAA 4NPSA 4EVOA 4C3HH 3CCJA 3BVZA 4JOIC 3K0XA 2F0DA 1PA6A 3PO3H 1STHA 4WRDA 1SNCA 2F0HA 4OWXB 4A3DH 3AEVA 2G9DA 4HIDA 2Q2IA 1EU3A 4KI0A 3TREA 4DR4L 1UWVA 4K6DA 4DK0A 2QEXA 2ALYB 4A3KG 5C44B 3G48A 5IP7G 1YJNA 1I94Q 4LF4Q 1W6JA 2CH4W 2F0UA 4FDBA 1EQRA 3HOZB 1LACA 1R9TH 1EY6A 3PIP3 4XQNA 1PFMA 2PQEA 4ID6A 1F9RA 1OXSC 4IUPA 3D8GA 1K8AC 2AQ2B 2UUCL 3NTHA 1SEBD 2QCPX 2Q8TA 3VR4A 1VF5C 3PUXA 4GNXA 3H0GG 1XWEA 1D6EC 3I4LA 3CW2C 1U5KA 1DOLA 1XMOL 3URYA 1HQMC 5BN5A 2K7VA 2CQAA 4ILWA 5FOBB 4MIUA 5IT9E 1A15A 5M3MH 2HCCA 3K7AB 1EZ6A 1PVOA 5FLXc 1IL8A 3DMUA 2L0CA 3FKIH 5LHY1 4WJ4A 4ZCKA 4X64L 4B3RL 3L7ZC 3BDCA 3T1HL 1JB3A 1HZ9A 4RKBA 4NDXA 4N9TA 3MXUA 4J1MA 2K05A 3NTKA 2D0OA 2Z1CA 1O7ZA 4JI2Q 3UI2A 5JJKA 3Q22A 4U673 4A75A 2KCTA 1RTNA 5AJ3Q 4DV3Q 2B2YC 3I70A 3NENA 3NBIA 2XWBB 1HNWQ 1H9MA 2XGTA 3SVMA 2CW0D 5CV8A 4C3IG 1WTRA 1ILPA 5I9OA 3HOVG 4IUVA 2KBNA 1SJED 2UU9Q 1CA5A 2HCIA 2RHQB 2IX1A 4JPBW 2CH4A 1W3SA 1MIUA 3M4PA 3GTMB 5JPMC 5JVH3 1TWCH 3I73A 4A3MG 4OO1G 3BDOA 2Q2HA 2AUKA 5BN3A 2L9HA 4G57A 4AYBB 1LO5D 1Q82C 4ZRZA 3M4QA 4JC0A 4MHEA 1KRSA 3CPWA 1O7LA 3W2DA 3H3VH 5I6YA 3CMEA 2CKZB 4BBSH 5KGUA 1PH9A 4PNYA 5EBDA 3S1RB 1HCZA 3FPPA 1O80A 4R4TA 5IGEA 3NBHA 4GOPA 1Y8NB 2KCCA 1WCMB 1BCPC 1CKNB 1SR3A 3R2TA 1B70B 4NB3A 3DEOA 3SEBA 4RGTA 2VL6A 4ABNA 5IGFA 1HA5A 1U0LA 4K14A 4MZ9A 2RA4A 2EJFC 3BG3A 2VQFQ 3E0EA 2CW0C 5E4WC 1IW7D 3PO2G 5IWAQ 2RHSB 3J80L 4LF7L 1UE7A 1XPUA 4IZ8A 3TQYA 1HZCA 1BCPB 5EPJA 5M5XB 3UE0A 2X69A 4DUYL 4AQYL 3GTGB 1BR9A 3CMAA 4JW0A 2K5VA 2LSSA 1X32A 4PV1C 1N34Q 3FDTA 3I56A 3S2DB 1BF4A 3MXNA 3NP8A 3ULJA 2B8GA 3A8IE 2NVQB 2B2TA 1G91A 1K73C 1NY4A 1I50B 4JI4L 1DZ1A 2B2WC 1VQBA 2R6GA 5M3FG 4JBWA 1ENAA 1UAPA 5LMUL 1S5CD 4AH6A 2WACA 2OTJA 1GXDC 2JA6H 1I3QH 1KLUD 1NR4A 3GD7A 2A8VA 3D4WA 1YVCA 5HGQA 3V05A 1VMPA 4NXNQ 2YTXA 1XYIA 5J22A 1CK1A 1NNXA 4ZUJA 3I7FA 2PQAA 2A6EC 3MC0B 4OELB 5FLXE 3PIOA 4AYBE 1VMCA 3A8KE 4DU9A 5C44G 2AQ3B 1I4XA 5A2QL 4UY8C 4N9PA 4A76A 4JI5Q 1IXRA 4PZ8A 1IW7C 2I5HA 2PI2E 3HOZG 5C4XH 1D2BA 1VCIA 5DNFA 3TP5A 4C2MH 2O5IC 1XTDA 2EQSA 5EKLA 4OXPA 3UE1A 1U4PA 1LLRD 4DV2L 3DUZA 1PH4A 1JJGA 1B9MA 1E1TA 4JI3L 1TXYA 2ZT9C 3KDFB 4R8IA 1AH9A 1YHQA 4O42A 3SXHA 2H4OA 1AN8A 4DV4L 3U9OA 1V1OA 4IFDI 3HZXA 4QCLA 2IHFA 3VYRA 4X3TA 4B3SL 1VQPA 3S15B 5GAHC 4PQXA 4HSPA 2BA0A 4X64Q 4QQBX 3T1HQ 3TRZA 1EYDA 1Q7YC 3EJIA 3CCRA 1ENCA 4KHZA 1Q12A 5CBEE 4KHPQ 1FD7D 2K52A 1MSHA 2HQLA 4DAPA 4XDXA 4CJ2C 4PG3A 1L0YB 1SNMA 2K5NA 2MP1A 2QA4A 1LTTD 1HUNA 1EEID 3IFDA 1HXYD 2Z6KC 1WVLA 1HTLD 3R93A 1GHKA 2JA9A 4CBVA 2KEDA 1GUOA 4HAEA 2LMCB 5ELOA 1D7QA 4IO9A 2MUYA 3AFPA 3F8TA 4CDEC 1TWFB 1MBYA 4JI1L 4IJHA 4XXEA 1G6PA 1XMQL 2J0TD 1KQSA 1GUWA 4KTAA 4KHVA 4ZUIA 2MJ8A 3I4NB 2D5DA 1QNUA 4B9WA 4EQPA 3J7YW 1LTBD 1ICFB 3CC4A 1EU4A 2K5WA 1SRUA 2BH2A 2CWPA 3CKIB 1BOSA 5D14A 4KK7A 2EYLA 4AYBG 2P5ZX 3KLWA 4A3EH 2GA4B 4DV5L 3S16H 1Q46A 4POGA 2GVAA 1NE3A 1FR3A 3TP7A 1TR5A 2NZOA 5TSSA 4A3GB 4EGVA 4HEDA 4HTHA 2A74C 1D1IA 1U4MA 4IPCA 3T53B 4MTNA 3OW2A 1F2YA 2DJGC 1Y1WB 2O4XA 2RQXA 3HOXB 1QUQB 1R4QB 2AMCB 1JOKA 4R4OA 2E75C 3A7AB 3T56B 1L0WA 4POFA 4LF7Q 5FO7B 3STBD 2G5DA 2HT1A 1PH8A 1WCMG 1QVCA 2JA5B 1HNXL 4DR5L 1CI3M 2TMPA 2MQHA 2E2HB 2JA7H 1ZYRD 2L1BA 3QB3A 4BY1H 1PTOD 1HFGA 3KJPA 4Q5VA 1KABA 2JA8H 1I6VC 4M1UB 3BYYB 2H5XA 1TWHH 4IN3A 3RNUA 4IJLA 1NMFA 4R4CA 4V0BA 1SDFA 4HIKA 1X9NA 1DONA 2DY8A 2R92H 3K80C 4LF8Q 2XTIA 1DYQA 5EQ0A 4JI7L 1F9QA 5G3LF 1D8LA 4KY5A 1Q90A 1LM0A 3NQIA 3BZCA 3GTJH 2E74C 1IHZA 4LF6L 1K8GA 4Y7NH 4IUQA 4IFDG 1JR0D 1J5EL 1TT2A 3F2CA 2AQ1B 2JK8A 4KKTA 2JEAI 1LTLA 4RA8A 1C7YA 1XPRA 1DXMA 5KRUA 3V96A 4GKKL 3GO5A 5CORA 4RCNA 4Q0FA 5C0XI 1VQ8A 1Q8KA 2E2DC 1QVGA 2C35B 3LGJA 2KHSA 3QJYA 4A93G 1F2MA 2NZHA 5DAUA 2DUDA 3STBC 3KK7A 4QGUA 3L0OA 2JEBI 3VR6A 4DPGA 1KNEA 1UE1A 3GTKH 1ZYRC 2EIFA 3NE5B 3X3NA 1PTOC 2N88A 1RCVD 4QF4A 2QDBA 1IKMA 1TS5A 3CCMA 3T16A 2IHEA 4CDDC 1DM0B 3DLLA 4G7ZC 5C3EH 4DV4Q 1DGSA 3CP0A 1WTWA 3J7AV 4DR6Q 4I7ZC 5ELFA 2PYKA 2OQ0A 5LL6X 2KOLA 1T5XD 4HMJA 3CPFA 3CAMA 2LKVA 2MGSA 2L4NA 4LFAL 1ESFA 3CD6A 1NBWA 4DNRB 4AIMA 4GNXB 3VDYA 1EOTA 1NCVA 1VQEA 1Q86C 3T51B 4YWMA 1VQCA 3A8JE 2H1EA 4X65L 4CJ1B 1FNVA 4MN3A 4DV7L 1I4GA 1LUZA 4BBRH 1QOHA 4LJZC 5BN4A 4YCWA 4JVZA 1YBYA 1SE4A 3SK6A 2E2IH 4V190 2PMZB 4FP5D 1SE3A 5ELDA 3ZYYX 1AFPA 1B44D 3DXJC 4DUZL 3KUPA 4K0KQ 3OTOL 4CHTB 2J7ZA 1PYWD 4MNOA 2EZVA 4DKAC 4FXDA 5A35A 3M7NA 4JI1Q 1BDOA 3GTPB 2F0VA 1O7IA 1I4QA 1QE6A 3EN2A 1CM9A 5KNDA 1SYGA 3AQQA 3RUZA 1NMGA 3WOFA 4FF4A 3PF4A 3B6YA 3DWAA 1WOCA 1EIGA 5GADC 3MHBA 3KFUA 3PQIA 1ICWA 5FKAC 1G51A 2KENA 1GUTA 3UDGA 4A3CG 4L6TB 2A19A 3EROA 4DV5Q 4KD4A 4L63B 5IGBA 1UE6A 2SOBA 3RZDH 1CTMA 1AW7A 1X3QA 1DD2A 4LF5Q 3W1GA 3NHHA 4LFBQ 3NWTA 1KL9A 4B3MQ 4F87A 2R7DA 3I72A 3GTQB 1HZAA 3PGZA 3T13A 2ICEC 1AP0A 4K5XA 1A8VA 1NJIC 2K5QA 3MEFA 4B3TL 3J7ZC 3K5LA 4A3GG 4A4IA 3K5NA 5FLMH 3Q0AA 1EQTA 4KN4C 3NBHB 2NWGA 4GOPB 4HJ9A 3S1NH 2Z4IA 2EE1A 3I8ZA 3ER0A 4XT3B 2A6HD 2RBMA 2UXCL 3K57A 2JA5G 3U9SA 5C4JH 5NUCA 2PMZE 1NUCA 1JICA 1XNRQ 4JI7Q 1YJ9A 1F77A 1QNKA 2AHOB 4DR2L 1CQFA 2EYFA 1FVIA 1C0AA 4HIMA 2EYPA 4YHHL 3MVVA 1PRTF 2F0FA 1PV4A 5CR3A 3MXNB 2NN6G 4A3FB 1PYSB 1FJGQ 1CQVA 2OCEA 2K03A 4A3KH 1EWIA 2NBFA 1H9JA 1P16A 2WB1B 2UUBL 3BZDB 3F1ZA 1LTSD 2K14A 1VQ6A 3I4MB 4GLAC 1KDBA 5IY0A 1VQDA 2E5LQ 4J15A 3S9WA 4B08A 3QIAA 3L3OC 4M8AA 1S5DD 4NP5A 1X3EA 1EYGA 5CV7A 1EY9A 1YJWA 1IBML 2F0WA 3ND9A 3GDEA 5I4DA 1JWMD 4A3IB 1B53A 1TWAH 4OEMB 1MJEA 3K58A 4LF9L 4RKLA 4RGMA 1QCBD 3ULPA 4QIWB 1KXLA 4WFN3 1V9PA 3H0GH 3HEJA 3S2HH 2PQAB 1SN8A 1IBLL 4FF2A 3PUZA 3H3VI 3EIVA 1VQGA 3FPUB 3QOJA 1X56A 4HMIA 2A6HC 3EBEA 4LFCL 1H9SA 1PTOH 3Q8DA 1BBWA 3OYYA 3A54A 5FO8B 1EQVA 2YU9B 4DAVA 3S1MB 2R93B 4LK1C 3K5OA 4ZKBB 4RFBA 1B4OA 1G2SA 1EYAA 3TZUA 1AE3A 3CQZB 1S5BD 3GV3A 1RKNA 3E6ZX 3CCSA 2PW7A 2SNSA 4PZ7A 3PO3G 4DV7Q 2F0SA 4RMFA 1EZ8A 4JYAQ 4X3SA 1C9OA 4DA2A 3AMUA 3IRBA 2ID0A 3QOLA 3N6RA 1HRJA 4ALPA 1EIYB 5ELBA 1J6QA 4OL7A 4HR7B 1B50A 3E0JA 4FYDA 4DUZQ 1EFID 4C3IH 2XIWA 4XQQA 1MJCA 5JPNC 3KJOA 4ME5A 3HOVH 3CCLA 1HHVA 5M5WH 4I7AA 1O78A 3W3AA 4JK1C 3PIPA 2KHIA 4R4IA 3FVQA 1BCPD 3S24A 3PF5A 4A3JB 1TY0A 4QL5A 4A3MH 4OO1H 1N32Q 1GJXA 4R9WA 4FXGC 3VYSA 2OEOA 4KY7A 1QG7A 2WB1E 1E3PA 2EVBA 1K83H 1DJRD 5KYIA 4C1NI 2WAQB 1L1OA 1OXXK 1JCKB 1EYCA 3G4SA 5M5YB 3T1YL 1Y14B 4UDUC 4DV1Q 3E5SA 4IUTA 1X6OA 3AB9A 1XPOA 4DR3L 1I4RA 1AEXA 3I91A 1Y1VB 5CC4A 3J81c 3D31A 3H15A 1SLJA 2NVXH 1JE5A 3JAMc 3CF5A 1C4QA 4QIWE 3A5ZB 4X6AH 2XVSA 4GLXA 4L5RC 2AKWB 3J81i 2UUAL 5D3DA 5C3XA 3EQLC 3JAMi 1VQFA 1MGSA 2CWAA 4X62L 1HQRD 1K3RA 5JVG3 2NVTH 1FGBD 3F2BA 5IYDG 1HA6A 3TS0A 3PO2H 2NVYH 5COYA 4BWGB 1VQOA 3S17H 1TWGB 4YCVA 1KC8C 2L55A 1JOOA 1JE4A 2A6ED 3PUYA 2JXMB 4JI0L 5KIXA 1KD1C 1G291 3PV0A 2F0MA 1SE2A 4HIOA 1RTOA 3SDZA 2Y0SB 1UUPA 1PH6A 2VQEL 1JWUD 2D2CC 5M3FH 4FO2A 4DR2Q 5JJLA 4JV5Q 1NTGA 4JG2A 4XIGS 3BVGA 3I3CA 2PZTA 4PMWA 1HFNA 3FRPB 4X66Q 3S1QH 1VDZA 2RSOA 1JQYD 1OXUA 4DV6L 1C48A 2EJMA 4HJ7A 2IL8A 4APVA 2K5HA 2KCNA 1EUJA 3HS0C 1X3FA 2F3WA 3AFQA 4R4QA 5JEAG 4EQ5A 2GN5A 1E2VA 3Q24A 1EIFA 2RCFA 2WAQE 5IYCG 4A3FG 5JEAJ 2D62A 3CRKC 4K8JA 4P2CB 5C44H 2WB1G 4PMCA 1PDQA 5GAGC 2PW5A 3I4MG 4DR4Q 2K4KA 4HCSA 4N8FA 1D5ZC 2XWJB 5IT9L 3HOZH 2L11A 1B9NA 4C3JB 3RZOB 1PHJA 1QWYA 5LMNL 2JA8B 4A93B 4RH6A 3MXGA 4UP9A 3D4RA 4XTCS 2C9OA 5T1IA 2SEBD 5K36G 3HOYB 3ZJYC 3HKZB 4KJOA 5GAEC 2R7ZB 1K28A 4ZLTF 3GTOB 5DEHA 2UUCQ 2NYZD 3W1BA 4A3IG 1WTHA 5EAYA 4LUOA 3P20A 4OWTB 1ML0D 1SE8A 4JOIA 3K8AA 3OOCA 1PMRA 1XX8A 1EEFD 3VR2A 4F88A 1YITA 4P75A 2R61A 3D6WA 4CKBA 3K81C 4DK6C 5IP9G 1XMOQ 3J7A5 1RL2A 4G7HC 3MWYW 4JI8L 1Y69U 2R93G 3K7AH 1M1KC 3OW7A 1YZ6A 1WJJA 3I90A 1VQ5A 4L5SA 3M3YB 2WKDA 1CSPA 2Y0SE 1W6KA 2PNRC 4ZK9B 3J81E 1PH5A 4B3RQ 3JAME 2HDMA 3KF6A 2E76C 5BR8L 2VUMB 2QILA 1IYUA 4ME3A 3RN2A 5IGGA 3SGIA 4DK3C 2EXDA 1CSQA 4A3BH 1WD1A 4RWSC 1MD2D 3VYUA 3CHBD 4IPGA 1BXTA 4IQZA 1BBXC 2OQKA 2IY5B 5IGCA 4YY3L 2UXDL 1XXGA 2YYZA 4A3JG 3GTMH 2EYJA 2WFWA 2V1CC 3SHLA 2IPKD 1W2BA 3F2UA 3LNNA 4YIJA 2WAQG 3IAYA 1Z7TA 4CJ0B 3D6CA 3DM3A 3H94A 1STAA 4H13C 1VQIA 2A69D 2QEJC 1EWCA 3UDIA 3TSSA 1LT6D 1Y1VG 4DR7L 2B63B 1KTKA 3S1RH 1YHBA 3MZ5A 4K2LA 4HCEA 1S40A 2ZTDA 1IYJB 1WTQA 4I65A 1C8CA 1HNZL 1WCMH 5DM63 2XNAC 2F4VL 2B2UC 3KBGA 1HJPA 1Q1EA 1HZBA 3WOEA 1AZQA 2PI2A 2BH8A 3QO2A 3VA5A 5M9OA 1HH2P 4TKOB 2HIVA 2YTVA 3TEHB 5M5XH 3CXCA 1K0SA 1PH7A 3RR5A 2M00A 3GTGH 1ASZA 2DNEA 4DUYQ 3M4OB 4AQYQ 3S2DH 5FLXL 1CHPD 4IOCA 4KV6A 3KYHC 2NVQH 1I50H 2Y0SG 4O0AA 4BY7B 4IPHA 3HOUH 4JI4Q 2RDGA 1XNQL 3G6JB 2E2JB 4OGQC 2PZUA 2A69C 5LMUQ 5IOCA 2LY7A 3A74A 1KRTA 3RN5A 3R2IA 3HP3A 1WFQA 1K9MC 4CGYB 2VW9A 2MHVA 1DOMA 4TVAB 1HR0L 3MAQA 2OF1A 1EY4A 1A3UA 2EPBA 1Q3LA 3CC2A 3OMGA 2DGYA 1EWHA 5LMNQ 4ZAIA 1A2TA 1Y8OB 1DOKA 1SFOB 2EXZA 3QG1A 5EPLA 5CV5A 3BU2A 4DAYA 3HOWB 2ZJPA 2RDHA 2BCOA 4IFDJ 2JN4A 5EPKA 1XJVA 2NB0A 4GN5A 1YIJA 2X6LA 1TVXA 4BY1G 1UEBA 4C3JG 2B2WA 4JBMA 2JA8G 4Y52H 5ELCA 1WTVA 1SSOA 3HOYG 1A3VA 2F52A 3OIPA 4DV2Q 3DHQA 2IT1A 3HKZG 1Q8IA 1Z9FA 2R7ZG 4S3SA 5E4XA 2XRQD 3S14B 2EYMA 4JI3Q 1JB7A 1I6HB 2I0QA 1G2TA 4XT1B 5JAVA 2WINB 5E1FA 4C3HB 3DEPA 4K6LA 5EJWA 2D0PA 5I2YA 4GNXC 5HY6A 1H9SB 2DY7A 3S15H 1LV9A 3PO3B 1J9OA 2OWOA 4B3SQ 3U58A 1ONLA 2B2VA 4A3DB 2VY3A 5IGDA 1QJOA 1I94L 2PCFB 2R7FA 1J8IA 4P71A 1SYDA 3TN2A 2EJGC 2B8FA 1R4PB 2CHBD 4N8X1 4NKLA 3ITPA 4JCVE 1Z6HA 4HN7A 4MTKA 4A3LG 2FMMA 1R9TB 4LUVA 4LW1A 2K32A 1A0IA 2I5MX 3NK9A 2I5LX 5KYLA 4GKJL 3QR8A 4YY3Q 1WTOA 1Y8PB 1UE5A 2VUMG 2UXDQ 1PRTB 2XRSD 2I46A 1PFBA 1STGA 3E3XA 1BUVT 1Q1BA 1KAAA 1SMXA 1N9WA 1TWFH 2K01A 3PCOB 1L1OC 5J1ZA 2HDLA 3NWSA 2F0JA 1GKHA 2NUCA 1XMQQ 1VQKA 3I4NH 4H02A 3J80c 1E2WA 1ILQA 2QW7A 5F2DA 1U4RA 5IE8A 5M3MB 1MHWC 4OONA 1L1OB 3J80i 2X6GA 3A0JA 4H7BA 2FHTA 3FKIB 3CCUA 5GQOA 3AU7A 2QGQA 5EKKA 1X65A 4WJWA 4JI2L 2F0OA 4OIJA 1K8OA 4DF7A 1G8ZD 4KJNA 4A3GH 2LXJA 4DV3L 1X54A 2B63G 1STEA 2F4VQ 1SYFA 1Y1WH 1HNWL 2LXKA 3HOXH 3MXPA 1EL0A 2ZM6L 1X3GA 3UDFA 2FINB 3NELA 2ZJRA 3C2PA 5C4ZA 2IW3A 1K8MA 4GOPC 1E0BA 3LX0A 3FHWA 2JA5H 5KNBA 3DWPA 3TP8A 1N8RC 3NUCA 2E2HH 3VR5A 1HNXQ 4DR5Q 1TWCB 4GN3B 1YI2A 1FNWA 1VF7A 4DGZA 3BS1A 2Z9HA 3TDQA 1GOZA 1QVFA 2NTSA 2EY2A 4EQNA 1JWSD 5CV4A 5C0XG 1E2ZA 1TU2B 4JI6L 1FNUA 2NN6H 3A7LA 4LUZA 4IURA 2CCZA 5C0XJ 3M9BA 5CV6A 1E22A 3OMCA 4BBSB 4H44C 2F3VA 2GVBA 3KF8A 1WTPA 3BZKA 2B2TC 3C3LA 4BY7G 2ICIA 2ZXPA 5J3BA 1EQQA 1HR0Q 3J7AF 1UNSA 5I6WA 1PTOF 2K50A 4RG1A 4DK1A 2KQ3A 3E9HA 4LF6Q 1CZWA 4DFAA 2AUJD 2JYOA 1JMCA 2ENBA 4OO1I 3C1EA 4IUUA 5IYBG 2EYOA 1J5EQ 1IYVA 5IP7H 1LTGD 3KBXA 2VQFL 1PLFA 2VNUD 4DXFA 4GKKQ 5IWAL 3FMCA 4BXXG 2ATWA 1SYEA 3IKJA 2OXPA 1BVSA 1SYBA 3SR1A 1N34L 3GTLH 1KLGD 2ZJQA 2Q8RE 3HOWG 2KJXA 4UHVA 2PO4A 5ISRA 1OXVA 2Z8LA 4U68A 5EGTA 2BOSA 1OO9B 1TIID 3K6OA 1AZPA 3G6EA 5FJ8G 1HUMA 1LTRD 1VQ9A 1K0RA 2JA6B 3WWVA 1N33L 1I3QB 1B8AA 3FEWX 4NXNL 2N49A 1RIPA 4KKSA 4LFAQ 3J80E 3I4OA 1KAWA 3KLRA 3SK5A 4C3HG 4DR1L 1T9HA 3WDNA 3IFTA 4X65Q 4IOAA 2N3SA 2B29A 2FFKB 4A3DG 2JP1A 3CCQA 3MA2B 3NPPA 2KCMA 1F9PA 2KUMA 5E7NA 4P73A 4JI5L 1IKLA 4GKJQ 1E1OA 4NMZA 3V2TA 4OWWB 3R8BA 2HQEA 5C4XB 2EY5A 3OTOQ 4GS3A 4C2MB 3BYTB 4TSSA 3G71A 1E7ZA 5EKIA 3GTPH 3KF6B 4QB4A 1V1PA 3ND8A 1IZ6A 5CMDA 2WIIB 5L37A 2RDFA 1SYCA 5LMNW 3K7UC 2RKSA 3T4AC 3QWNA 3OWFA 1D1KA 3H6MA 3HFZB 5GROA 3A5UA 1EIHA 3P7JA 2Q2TA 2EOTA 2ZTCA 1V8QA 2ZTEA 5A2QE 1CT1D 4KHPL 2WP8J 1CKMA 1I5FA 3KOJA 1V43A 5M3MG 1P8LA 3RMHA 5IYDH 4L5TA 1YNND 2TSSA 4C1NK 2ZXRA 3GTQH 2K04A 3FKIG 2N8NA 2BDNA 4A3BB 2RVLA 4PMBA 2ZM6Q 2KHJA 3MEHA 4HJ5A 2B39A 4DNIA 1GO3E 4R1JA 2Z4HA 1II3A 2OT2A 4CDCC 4X3UA 3R3OA 3FP9A 2VB3X 3TBIB 1STYA 4B3TQ 2MNAA 1VQHA 4DV0L 5DLQE 1GVPA 3C1FA 4K2KA 3SK4A 2F0QA 1HPCA 3SE0A 4E6IA 1Q81C 2F0EA 2YTYA 4Z9CB 4HJAA 1GD7A 4JI6Q 4KKUA 1CUKA 4XYOA 1QZGA 3F2DA 2UXCQ 2M9VA 4JBJA 2Z6BA 4IPDA 3ICEA 5JEAH 1PH3A 1MKHA 2HD3A 1EY5A 1STNA 4A3FH 5IYCH 1IL2A 4A3EB 4YHHQ 3S16B 1H9KA 2O5JC 1G6ZA 1WYDA 4BBSG 1RF2D 5C6AA 1ASYA 3I4MH 3UDXA 1S72A 1OTCA 2IWHA 3AYHB 2UUBQ 1YNNC 1STBA 5H1SE 1HTPA 3K5MA 4EX5A 3PIO3 1OXTA 1B3AA 1LT4D 5K36H 4RHSA 2ES2A 1GUSA 4RGNA 5G3LD 2MFIA 4EQOA 2DJFC 2DNCA 1IBMQ 4A3IH 3EVQA 1V1QA 4ZYSA 1JORA 5JJIA 2JA7B 1SJHD 2K75A 4BY1B 4RCOA 4QUCA 4YWKA 4LF9Q 1LTAD 2VXWA 1GUGA 3HOUB 1DCZA 1KIXA 1NR2A 1RJTA 1BO0A 1TWHB 1IBLQ 1JOQA 1TS4A 2F0NA 4DAYB 5IP9H 3HG9A 4LF8L 2MPMA 4P74A 2KVMA 1Z47A 4LFCQ 2R92B 2JJQA 2YU9H 3S1MH 2R93H 1FL0A 1N33Q 3ERSX 3HKSA 5T1GA 3CQZH 2RCNA 1PXUA 2F0PA 5C4HA 1RHPA 4HJ8A 3W5OA 4DR1Q 4F7XA 4QUFA 5D3IB 3GTJB 2F0TA 3CU7A 4LAAA 5CGKA 2B2VC 4Y7NB 4B9XA 2VS1A 4FNFA 1CHQD 1SBBB 1SXTA 2JA6G 2J4XA 4IUNA 3VYTA 4WJ3M 2UXBL 1F9SA 1NAPA 4L8JA 1IBKL 3CCVA 1K3BC 3M7GA 1S5ED 3BJUA 3HRZC 3H09A 4DXGA 2IX0A 4O2DA 4LMQD 1QILA 3RLFA 3DWQA 2YV5A
chains in the Genus database with same CATH topology
3NBHB 1XJVA 4GOPB 4GN5A 4HJ9A 4A3JH 1YIJA 3HOVG 4BY1G 3S1NH 2KBNA 2UU9Q 1UEBA 1HR0W 1E24A 2RHQB 2IX1A 4JBMA 2JA8G 4Y52H 2CFMA 3ER0A 4JBKA 1W3SA 1MIUA 3M4PA 4DR6L 1TWCH 4A3MG 4OO1G 2UXCL 5C4XG 2JA5G 3HOYG 2F52A 5C4JH 2Q2HA 2PMZE 4DV2Q 2IT1A 3HKZG 5M5YH 1Z9FA 2R7ZG 1XNRQ 4JI7Q 1YJ9A 1Q82C 2AHOB 3M4QA 4DR2L 4JI3Q 3T1YQ 1JB7A 4JC0A 3CPWA 1KRSA 1FVIA 2I0QA 1C0AA 3H3VH 2E8GA 4HIMA 4YWLA 1Y1VH 1FGUA 4YHHL 3CMEA 2CKZB 2D0PA 4GNXC 4DR3Q 1PV4A 5HY6A 4BBSH 3S15H 3MXNB 2NN6G 4BA2I 1PYSB 1FJGQ 2OCEA 1VQLA 2OWOA 3U58A 1PH9A 4A3KH 4B3SQ 1EWIA 1A63A 2VY3A 1P16A 2UUBL 1VQ6A 3F1ZA 2K14A 2Q2UA 4GLAC 3NEMA 5IY0A 1I94L 4R4TA 2R7FA 4P71A 1VQDA 2E5LQ 2HHHL 4GOPA 4J15A 3CC7A 2UUAQ 1M90C 4JCVE 4NXML 1CKNB 1SR3A 3HKZE 4X62Q 4K0KL 4NB3A 3U50C 4A3LG 2VL6A 1X3EA 4LUVA 1EYGA 1IBML 4DV0Q 1U0LA 1YJWA 4LW1A 1A0IA 4MZ9A 3GDEA 2I5MX 1GM5A 4A3BG 2VQFQ 1TWGH 3E0EA 1TWAH 1MJEA 2I5LX 3PO2G 4GKJL 5IWAQ 2RHSB 4LF9L 4YY3Q 4LF7L 1UE7A 2VUMG 1UE5A 3ULPA 1XPUA 2UXDQ 1KXLA 3TQYA 1HZCA 1V9PA 3H0GH 3UE0A 4DUYL 3S2HH 2PQAB 1SN8A 1IBLL 3PUZA 1Q1BA 4AQYL 3H3VI 3EIVA 1VQGA 3CMAA 4JI0Q 2K5VA 1SMXA 2LSSA 1N9WA 1TWFH 1X56A 3EBEA 1N34Q 3I56A 3PCOB 4LFCL 3Q8DA 1BBWA 1L1OC 3OYYA 4KLKA 3ULJA 1YEZA 1GKHA 1XMQQ 1K73C 1NY4A 1VQKA 2VQEQ 3U4VA 4JI4L 3I4NH 4H02A 1VQBA 3J80c 2R6GA 5M3FG 5IE8A 4JBWA 5LMUL 1AE3A 3E9IA 4AH6A 3CCSA 1JT8A 2OTJA 4PZ7A 3PO3G 4OONA 1L1OB 4DV7Q 3J80i 1CKNA 4LF5L 2JA6H 4RMFA 1I3QH 4DV6Q 3A0JA 4LFBL 4JYAQ 1C9OA 3CCUA 3GD7A 4B3ML 2A8VA 5HGQA 1YVCA 2PNHA 1PYBA 3IRBA 5GQOA 2ID0A 4NXNQ 2QGQA 1X65A 4ALPA 2YTXA 4JI2L 1EIYB 1J6QA 4A3GH 2LXJA 4A3EG 4DV3L 1X54A 1PFSA 3CCEA 2N78A 3KF8B 3I7FA 2B63G 4DUZQ 2PQAA 3PIOA 1B7YB 2F4VQ 1Y1WH 4AYBE 4C3IH 1HNWL 2LXKA 1MJCA 3HOXH 2VZAA 3KJOA 3HOVH 3CCLA 2ZM6L 1X3GA 5M5WH 5C44G 4QJFA 3UDFA 4C3JH 3RZOH 3TS2A 4OX9L 3NELA 1A62A 2ZJRA 4UY8C 4A93H 4JI5Q 4A76A 4GOPC 1IXRA 1L2FA 4PZ8A 2A1AA 2KHIA 2I5HA 2PI2E 4R4IA 3RLOA 3S24A 3PF5A 4QL5A 3HOZG 3FHWA 4A3MH 4QY7A 5C4XH 1N32Q 1LYLA 1VCIA 2JA5H 4C2MH 3HOYH 2WB1E 1XTDA 1E3PA 2EQSA 1N8RC 2E2HH 1K83H 4OXPA 3UE1A 1HNXQ 2R7ZH 4DR5Q 1N36L 4GN3B 4DV2L 1YI2A 3GTOH 1PH4A 1JJGA 1L1OA 1OXXK 1XNRL 1EFWA 2JE6I 3G4SA 1E1TA 2JA7G 4JI3L 1TXYA 3T1YL 1Y14B 3KDFB 1QVFA 1AH9A 5C0XG 5ELNA 1YHQA 2CQOA 4JI6L 3HOUG 4DV1Q 1X6OA 2L15A 4DV4L 1XPOA 4DR3L 4LUZA 4IFDI 2CCZA 5C0XJ 1FJGL 2IHFA 3M9BA 4BA1I 1E22A 2MO0A 4B3SL 1VQPA 3J81c 2GVBA 3D31A 5GAHC 1SLJA 3H15A 2BA0A 2R92G 3BZKA 1JE5A 4X64Q 3JAMc 2NVXH 4QQBX 3CF5A 3T1HQ 3TRZA 4QIWE 4JI8Q 3A5ZB 1Q7YC 1EQQA 5J3BA 4BY7G 2YV5A 1HR0Q 4X6AH 3CCRA 4GLXA 4L5RC 2K50A 2AKWB 4KHZA 1Q12A 4RG1A 4P72A 3PIPA 2E5LL 3J81i 4TQUS 2UUAL 4KHPQ 2UXBQ 1IBKQ 3JAMi 2K52A 4A3LH 1VQFA 3E9HA 2HQLA 4LF6Q 2CWAA 4X62L 3M85A 3M3YH 1JMCA 1K3RA 2K5NA 4PG3A 3PUWA 2QA4A 1VQ4A 2NVTH 4OO1I 5IYBG 1J5EQ 2BA1A 2Z6KC 5IP7H 4YCUA 3F2BA 4UP7A 5IYDG 3TS0A 3PO2H 2VQFL 4LF4L 2NVYH 4DAMA 1SROA 2VUMH 2VNUD 2JA9A 4GKKQ 5IWAL 2FXQA 1VQOA 5BR8Q 3S17H 4YCVA 1KC8C 4BXXG 2ATWA 3KDFA 1JJ2A 5ELOA 1BBUA 2B3GA 3PUYA 4JI0L 1BVSA 4UPAA 1KD1C 1G291 2NN6I 1N34L 1D7QA 4IO9A 3AFPA 3F8TA 2MO1A 3GTLH 3PV0A 2ZJQA 3HOWG 3I2ZA 4GLVB 4HIOA 4JI1L 4IJHA 1G6PA 1XMQL 1VS0A 4GN4B 1PH6A 2VQEL 1KQSA 1OXVA 5M3FH 4DR2Q 5JJLA 4JV5Q 1NTGA 4JG2A 4XIGS 3PUVA 4PMWA 4X66Q 3S1QH 5C3EG 3G6EA 1OXUA 3CC4A 5FJ8G 4DV6L 4HJ7A 1SRUA 4LNQA 2BH2A 2CWPA 1VQ9A 4JYAL 1K0RA 4APVA 4A3CH 2K5HA 1EUJA 3WWVA 1N33L 4AYBG 1B8AA 2OTLA 1X3FA 3S16H 3KLWA 4NXNL 2N49A 1RIPA 3RLNA 3AFQA 4A3EH 4LFAQ 4R4QA 3I4OA 3U4ZA 4DV5L 1KAWA 2JQOA 1Q46A 5JEAG 3L2PA 2HHHQ 2GVAA 2AWNA 2GN5A 1NE3A 4EQ5A 4DR1L 4POGA 2B63H 1T9HA 1EIFA 1YHAA 2NZOA 4X65Q 4NXMQ 2WAQE 5IYCG 4A3FG 2N3SA 4DR7Q 4IOAA 2RF4A 5JEAJ 1H95A 2B29A 2D62A 2Z6KA 4IPCA 4A3DG 5C44H 4MTNA 2WB1G 3CCQA 3OW2A 4BBRG 1BKBA 5GAGC 3I4MG 4DR4Q 2K4KA 2KCMA 1QUQB 2AMCB 3D0FA 4P73A 5E7NA 4R4OA 4JI5L 3HOZH 4GKJQ 1L0WA 1E1OA 4POFA 5LMNL 1PHJA 1HNZQ 3STBD 4LF7Q 1N32L 5AJ3L 4OWWB 2HT1A 1PH8A 1WCMG 1WI5A 3JC66 4UP9A 1QVCA 4XTCS 3OTOQ 4GS3A 5K36G 1HNXL 1EOVA 4DR5L 2ZJPA 4IFDJ 1S3OA 1E7ZA 3ZJYC 3G71A 1VQMA 2MQHA 2JA7H 3GTPH 3KF6B 4BY1H 5GAEC 1VQNA 3KJPA 1KHIA 2UUCQ 2Z0SA 3W1BA 4A3IG 2JA8H 1IZ6A 5IT9c 2UU9L 5EAYA 4LUOA 2F3IA 2ASBA 2H5XA 1TWHH 4OWTB 1SE8A 4JOIA 4DV1L 3RNUA 3K8AA 4IJLA 1NMFA 3M4OH 3I4NG 4R4CA 1YITA 4HIKA 1X9NA 5LMNW 4P75A 2R92H 3K80C 3K7UC 4LF8Q 3K81C 4DK6C 2XTIA 5IP9G 1XMOQ 3J7A5 4BY7H 1RL2A 1VQJA 4JI7L 5GROA 3HFZB 3A5UA 1D8LA 4JI8L 3PSIA 2Q2TA 1QZHA 2R93G 2E2JH 2HIXA 2ZTCA 1LM0A 2ZTEA 1XNQQ 4KHPL 1QUQA 3BZCA 3K7AH 1YNXA 1CKMA 2WP8J 1CKOA 3GTJH 1M1KC 1I5FA 1YZ6A 4LF6L 3KOJA 5IYBH 1K8GA 1V43A 1WJJA 4Y7NH 5M3MG 1VQ5A 1P8LA 4L5SA 4IFDG 4LWCA 1J5EL 5IYDH 4L5TA 1CSPA 1X55A 2Y0SE 3F2CA 2JK8A 1PH1A 2JEAI 2AWOA 1LTLA 1PH5A 1VQ7A 1C7YA 4B3RQ 1XPRA 3GTQH 3FKIG 2N8NA 1Y1WG 1PH2A 4GKKL 2ZM6Q 3HOXG 2KHJA 3KF6A 4HJ5A 4BXXH 3GO5A 4DNIA 5BR8L 4OX9Q 1GO3E 4R1JA 5C0XI 1Q8KA 1VQ8A 1QVGA 4ME3A 2C35B 3LGJA 3RN2A 1SFOH 4A93G 2NZHA 3FP9A 2DUDA 3STBC 3SGIA 4B3TQ 3HOWH 2MNAA 4QGUA 3L0OA 2JEBI 1VQHA 4DK3C 2EXDA 1CSQA 4DPGA 4DV0L 4A3BH 1AE2A 5DLQE 1GVPA 4PZ6A 1N36Q 4IPGA 1UE1A 3GTKH 5FLMG 3ULLA 2OQKA 2EIFA 2IY5B 4L5QA 4YY3L 1Q81C 2UXDL 3CCMA 2YTYA 2YYZA 4A3JG 4JV5L 3GTMH 2IHEA 3I55A 1GD7A 1JJCB 3DLLA 2WFWA 4HJAA 4JI6Q 2V1CC 5C3EH 4DV4Q 1DGSA 3CP0A 1CUKA 4X66L 5FJ8H 4DR6Q 1QZGA 3F2DA 2UXCQ 1W2BA 4JBJA 2OQ0A 4IPDA 2WAQG 3S14H 4UP8A 1I6HH 3CPFA 3ICEA 3CAMA 3J81j 1VQAA 3DM3A 4NPSA 3CCJA 4C3HH 1PH3A 4LFAL 4JOIC 1VQIA 1MKHA 1NBWA 3CD6A 3K0XA 4GNXB 4AIMA 3UDIA 3VDYA 4A3FH 5IYCH 1VQEA 1Q86C 1PA6A 4YHHQ 1IL2A 3PO3H 4YWMA 1VQCA 4X65L 1Y1VG 4OWXB 4DV7L 1WYDA 4DR7L 4A3DH 3S1RH 3AEVA 1LUZA 4BBRH 1ASYA 4BBSG 4HIDA 1YHBA 3I4MH 2Q2IA 4YCWA 3UDXA 1S72A 1OTCA 1YBYA 4KI0A 3AYHB 2UUBQ 3TREA 1S40A 1UWVA 4A3KG 4DR4L 2QEXA 2ALYB 2ZTDA 5H1SE 2E2IH 1IYJB 3G48A 5IP7G 4EX5A 1YJNA 1I94Q 4LF4Q 1OXTA 4FDBA 1HNZL 1EQRA 1WCMH 2ES2A 1R9TH 4DUZL 4K0KQ 3OTOL 2F4VL 1HJPA 1Q1EA 2MFIA 1HZBA 4MNOA 2PI2A 1OXSC 2BH8A 4A3IH 1IBMQ 4DKAC 1V1QA 1K8AC 1HH2P 2HIVA 2UUCL 2YTVA 3M7NA 4JI1Q 5JJIA 3TEHB 2K75A 5M5XH 3CXCA 4YWKA 1PH7A 1O7IA 3RR5A 4LF9Q 3EN2A 3GTGH 1KIXA 1ASZA 3AQQA 4DUYQ 1IBLQ 1NMGA 4AQYQ 3S2DH 3PUXA 4DAYB 4GNXA 3H0GG 5IP9H 4LF8L 3PF4A 3CW2C 4IOCA 3B6YA 1WOCA 1U5KA 4P74A 3KYHC 1XMOL 1Z47A 5GADC 4LFCQ 2JJQA 2NVQH 2YU9H 3S1MH 2R93H 3KFUA 1I50H 2Y0SG 4O0AA 1FL0A 1G51A 4IPHA 2KENA 1N33Q 3HOUH 3UDGA 3ERSX 3HKSA 4JI4Q 1XNQL 4A3CG 2A19A 3CQZH 2RCNA 5M3MH 4DV5Q 4HJ8A 3W5OA 4DR1Q 5LMUQ 1UE6A 3RZDH 1PVOA 3A74A 5FLXc 1KRTA 3RN5A 1WFQA 1K9MC 3FKIH 4LF5Q 4WJ4A 4X64L 2VW9A 3W1GA 2VS1A 4B3RL 3L7ZC 3T1HL 4LFBQ 1HZ9A 4TVAB 2JA6G 1HR0L 1KL9A 4B3MQ 2R7DA 2D0OA 4WJ3M 1HZAA 3PGZA 2UXBL 1IBKL 4JI2Q 5JJKA 3CCVA 4A75A 3CC2A 1A8VA 2DGYA 5LMNQ 1NJIC 2KCTA 3MEFA 5AJ3Q 4DV3Q 4B3TL 3J7ZC 4A3GG 3NENA 3BJUA 3BU2A 4A4IA 5FLMH 1HNWQ 2IX0A 2XGTA 4O2DA 3RLFA 1B70B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBH B;  1XJV A;  4GOP B;  4GN5 A;  4HJ9 A;  4A3J H;  1YIJ A;  3HOV G;  4BY1 G;  3S1N H;  2KBN A;  2UU9 Q;  1UEB A;  1HR0 W;  1E24 A;  2RHQ B;  2IX1 A;  4JBM A;  2JA8 G;  4Y52 H;  2CFM A;  3ER0 A;  4JBK A;  1W3S A;  1MIU A;  3M4P A;  4DR6 L;  1TWC H;  4A3M G;  4OO1 G;  2UXC L;  5C4X G;  2JA5 G;  3HOY G;  2F52 A;  5C4J H;  2Q2H A;  2PMZ E;  4DV2 Q;  2IT1 A;  3HKZ G;  5M5Y H;  1Z9F A;  2R7Z G;  1XNR Q;  4JI7 Q;  1YJ9 A;  1Q82 C;  2AHO B;  3M4Q A;  4DR2 L;  4JI3 Q;  3T1Y Q;  1JB7 A;  4JC0 A;  3CPW A;  1KRS A;  1FVI A;  2I0Q A;  1C0A A;  3H3V H;  2E8G A;  4HIM A;  4YWL A;  1Y1V H;  1FGU A;  4YHH L;  3CME A;  2CKZ B;  2D0P A;  4GNX C;  4DR3 Q;  1PV4 A;  5HY6 A;  4BBS H;  3S15 H;  3MXN B;  2NN6 G;  4BA2 I;  1PYS B;  1FJG Q;  2OCE A;  1VQL A;  2OWO A;  3U58 A;  1PH9 A;  4A3K H;  4B3S Q;  1EWI A;  1A63 A;  2VY3 A;  1P16 A;  2UUB L;  1VQ6 A;  3F1Z A;  2K14 A;  2Q2U A;  4GLA C;  3NEM A;  5IY0 A;  1I94 L;  4R4T A;  2R7F A;  4P71 A;  1VQD A;  2E5L Q;  2HHH L;  4GOP A;  4J15 A;  3CC7 A;  2UUA Q;  1M90 C;  4JCV E;  4NXM L;  1CKN B;  1SR3 A;  3HKZ E;  4X62 Q;  4K0K L;  4NB3 A;  3U50 C;  4A3L G;  2VL6 A;  1X3E A;  4LUV A;  1EYG A;  1IBM L;  4DV0 Q;  1U0L A;  1YJW A;  4LW1 A;  1A0I A;  4MZ9 A;  3GDE A;  2I5M X;  1GM5 A;  4A3B G;  2VQF Q;  1TWG H;  3E0E A;  1TWA H;  1MJE A;  2I5L X;  3PO2 G;  4GKJ L;  5IWA Q;  2RHS B;  4LF9 L;  4YY3 Q;  4LF7 L;  1UE7 A;  2VUM G;  1UE5 A;  3ULP A;  1XPU A;  2UXD Q;  1KXL A;  3TQY A;  1HZC A;  1V9P A;  3H0G H;  3UE0 A;  4DUY L;  3S2H H;  2PQA B;  1SN8 A;  1IBL L;  3PUZ A;  1Q1B A;  4AQY L;  3H3V I;  3EIV A;  1VQG A;  3CMA A;  4JI0 Q;  2K5V A;  1SMX A;  2LSS A;  1N9W A;  1TWF H;  1X56 A;  3EBE A;  1N34 Q;  3I56 A;  3PCO B;  4LFC L;  3Q8D A;  1BBW A;  1L1O C;  3OYY A;  4KLK A;  3ULJ A;  1YEZ A;  1GKH A;  1XMQ Q;  1K73 C;  1NY4 A;  1VQK A;  2VQE Q;  3U4V A;  4JI4 L;  3I4N H;  4H02 A;  1VQB A;  3J80 c;  2R6G A;  5M3F G;  5IE8 A;  4JBW A;  5LMU L;  1AE3 A;  3E9I A;  4AH6 A;  3CCS A;  1JT8 A;  2OTJ A;  4PZ7 A;  3PO3 G;  4OON A;  1L1O B;  4DV7 Q;  3J80 i;  1CKN A;  4LF5 L;  2JA6 H;  4RMF A;  1I3Q H;  4DV6 Q;  3A0J A;  4LFB L;  4JYA Q;  1C9O A;  3CCU A;  3GD7 A;  4B3M L;  2A8V A;  5HGQ A;  1YVC A;  2PNH A;  1PYB A;  3IRB A;  5GQO A;  2ID0 A;  4NXN Q;  2QGQ A;  1X65 A;  4ALP A;  2YTX A;  4JI2 L;  1EIY B;  1J6Q A;  4A3G H;  2LXJ A;  4A3E G;  4DV3 L;  1X54 A;  1PFS A;  3CCE A;  2N78 A;  3KF8 B;  3I7F A;  2B63 G;  4DUZ Q;  2PQA A;  3PIO A;  1B7Y B;  2F4V Q;  1Y1W H;  4AYB E;  4C3I H;  1HNW L;  2LXK A;  1MJC A;  3HOX H;  2VZA A;  3KJO A;  3HOV H;  3CCL A;  2ZM6 L;  1X3G A;  5M5W H;  5C44 G;  4QJF A;  3UDF A;  4C3J H;  3RZO H;  3TS2 A;  4OX9 L;  3NEL A;  1A62 A;  2ZJR A;  4UY8 C;  4A93 H;  4JI5 Q;  4A76 A;  4GOP C;  1IXR A;  1L2F A;  4PZ8 A;  2A1A A;  2KHI A;  2I5H A;  2PI2 E;  4R4I A;  3RLO A;  3S24 A;  3PF5 A;  4QL5 A;  3HOZ G;  3FHW A;  4A3M H;  4QY7 A;  5C4X H;  1N32 Q;  1LYL A;  1VCI A;  2JA5 H;  4C2M H;  3HOY H;  2WB1 E;  1XTD A;  1E3P A;  2EQS A;  1N8R C;  2E2H H;  1K83 H;  4OXP A;  3UE1 A;  1HNX Q;  2R7Z H;  4DR5 Q;  1N36 L;  4GN3 B;  4DV2 L;  1YI2 A;  3GTO H;  1PH4 A;  1JJG A;  1L1O A;  1OXX K;  1XNR L;  1EFW A;  2JE6 I;  3G4S A;  1E1T A;  2JA7 G;  4JI3 L;  1TXY A;  3T1Y L;  1Y14 B;  3KDF B;  1QVF A;  1AH9 A;  5C0X G;  5ELN A;  1YHQ A;  2CQO A;  4JI6 L;  3HOU G;  4DV1 Q;  1X6O A;  2L15 A;  4DV4 L;  1XPO A;  4DR3 L;  4LUZ A;  4IFD I;  2CCZ A;  5C0X J;  1FJG L;  2IHF A;  3M9B A;  4BA1 I;  1E22 A;  2MO0 A;  4B3S L;  1VQP A;  3J81 c;  2GVB A;  3D31 A;  5GAH C;  1SLJ A;  3H15 A;  2BA0 A;  2R92 G;  3BZK A;  1JE5 A;  4X64 Q;  3JAM c;  2NVX H;  4QQB X;  3CF5 A;  3T1H Q;  3TRZ A;  4QIW E;  4JI8 Q;  3A5Z B;  1Q7Y C;  1EQQ A;  5J3B A;  4BY7 G;  2YV5 A;  1HR0 Q;  4X6A H;  3CCR A;  4GLX A;  4L5R C;  2K50 A;  2AKW B;  4KHZ A;  1Q12 A;  4RG1 A;  4P72 A;  3PIP A;  2E5L L;  3J81 i;  4TQU S;  2UUA L;  4KHP Q;  2UXB Q;  1IBK Q;  3JAM i;  2K52 A;  4A3L H;  1VQF A;  3E9H A;  2HQL A;  4LF6 Q;  2CWA A;  4X62 L;  3M85 A;  3M3Y H;  1JMC A;  1K3R A;  2K5N A;  4PG3 A;  3PUW A;  2QA4 A;  1VQ4 A;  2NVT H;  4OO1 I;  5IYB G;  1J5E Q;  2BA1 A;  2Z6K C;  5IP7 H;  4YCU A;  3F2B A;  4UP7 A;  5IYD G;  3TS0 A;  3PO2 H;  2VQF L;  4LF4 L;  2NVY H;  4DAM A;  1SRO A;  2VUM H;  2VNU D;  2JA9 A;  4GKK Q;  5IWA L;  2FXQ A;  1VQO A;  5BR8 Q;  3S17 H;  4YCV A;  1KC8 C;  4BXX G;  2ATW A;  3KDF A;  1JJ2 A;  5ELO A;  1BBU A;  2B3G A;  3PUY A;  4JI0 L;  1BVS A;  4UPA A;  1KD1 C;  1G29 1;  2NN6 I;  1N34 L;  1D7Q A;  4IO9 A;  3AFP A;  3F8T A;  2MO1 A;  3GTL H;  3PV0 A;  2ZJQ A;  3HOW G;  3I2Z A;  4GLV B;  4HIO A;  4JI1 L;  4IJH A;  1G6P A;  1XMQ L;  1VS0 A;  4GN4 B;  1PH6 A;  2VQE L;  1KQS A;  1OXV A;  5M3F H;  4DR2 Q;  5JJL A;  4JV5 Q;  1NTG A;  4JG2 A;  4XIG S;  3PUV A;  4PMW A;  4X66 Q;  3S1Q H;  5C3E G;  3G6E A;  1OXU A;  3CC4 A;  5FJ8 G;  4DV6 L;  4HJ7 A;  1SRU A;  4LNQ A;  2BH2 A;  2CWP A;  1VQ9 A;  4JYA L;  1K0R A;  4APV A;  4A3C H;  2K5H A;  1EUJ A;  3WWV A;  1N33 L;  4AYB G;  1B8A A;  2OTL A;  1X3F A;  3S16 H;  3KLW A;  4NXN L;  2N49 A;  1RIP A;  3RLN A;  3AFQ A;  4A3E H;  4LFA Q;  4R4Q A;  3I4O A;  3U4Z A;  4DV5 L;  1KAW A;  2JQO A;  1Q46 A;  5JEA G;  3L2P A;  2HHH Q;  2GVA A;  2AWN A;  2GN5 A;  1NE3 A;  4EQ5 A;  4DR1 L;  4POG A;  2B63 H;  1T9H A;  1EIF A;  1YHA A;  2NZO A;  4X65 Q;  4NXM Q;  2WAQ E;  5IYC G;  4A3F G;  2N3S A;  4DR7 Q;  4IOA A;  2RF4 A;  5JEA J;  1H95 A;  2B29 A;  2D62 A;  2Z6K A;  4IPC A;  4A3D G;  5C44 H;  4MTN A;  2WB1 G;  3CCQ A;  3OW2 A;  4BBR G;  1BKB A;  5GAG C;  3I4M G;  4DR4 Q;  2K4K A;  2KCM A;  1QUQ B;  2AMC B;  3D0F A;  4P73 A;  5E7N A;  4R4O A;  4JI5 L;  3HOZ H;  4GKJ Q;  1L0W A;  1E1O A;  4POF A;  5LMN L;  1PHJ A;  1HNZ Q;  3STB D;  4LF7 Q;  1N32 L;  5AJ3 L;  4OWW B;  2HT1 A;  1PH8 A;  1WCM G;  1WI5 A;  3JC6 6;  4UP9 A;  1QVC A;  4XTC S;  3OTO Q;  4GS3 A;  5K36 G;  1HNX L;  1EOV A;  4DR5 L;  2ZJP A;  4IFD J;  1S3O A;  1E7Z A;  3ZJY C;  3G71 A;  1VQM A;  2MQH A;  2JA7 H;  3GTP H;  3KF6 B;  4BY1 H;  5GAE C;  1VQN A;  3KJP A;  1KHI A;  2UUC Q;  2Z0S A;  3W1B A;  4A3I G;  2JA8 H;  1IZ6 A;  5IT9 c;  2UU9 L;  5EAY A;  4LUO A;  2F3I A;  2ASB A;  2H5X A;  1TWH H;  4OWT B;  1SE8 A;  4JOI A;  4DV1 L;  3RNU A;  3K8A A;  4IJL A;  1NMF A;  3M4O H;  3I4N G;  4R4C A;  1YIT A;  4HIK A;  1X9N A;  5LMN W;  4P75 A;  2R92 H;  3K80 C;  3K7U C;  4LF8 Q;  3K81 C;  4DK6 C;  2XTI A;  5IP9 G;  1XMO Q;  3J7A 5;  4BY7 H;  1RL2 A;  1VQJ A;  4JI7 L;  5GRO A;  3HFZ B;  3A5U A;  1D8L A;  4JI8 L;  3PSI A;  2Q2T A;  1QZH A;  2R93 G;  2E2J H;  2HIX A;  2ZTC A;  1LM0 A;  2ZTE A;  1XNQ Q;  4KHP L;  1QUQ A;  3BZC A;  3K7A H;  1YNX A;  1CKM A;  2WP8 J;  1CKO A;  3GTJ H;  1M1K C;  1I5F A;  1YZ6 A;  4LF6 L;  3KOJ A;  5IYB H;  1K8G A;  1V43 A;  1WJJ A;  4Y7N H;  5M3M G;  1VQ5 A;  1P8L A;  4L5S A;  4IFD G;  4LWC A;  1J5E L;  5IYD H;  4L5T A;  1CSP A;  1X55 A;  2Y0S E;  3F2C A;  2JK8 A;  1PH1 A;  2JEA I;  2AWO A;  1LTL A;  1PH5 A;  1VQ7 A;  1C7Y A;  4B3R Q;  1XPR A;  3GTQ H;  3FKI G;  2N8N A;  1Y1W G;  1PH2 A;  4GKK L;  2ZM6 Q;  3HOX G;  2KHJ A;  3KF6 A;  4HJ5 A;  4BXX H;  3GO5 A;  4DNI A;  5BR8 L;  4OX9 Q;  1GO3 E;  4R1J A;  5C0X I;  1Q8K A;  1VQ8 A;  1QVG A;  4ME3 A;  2C35 B;  3LGJ A;  3RN2 A;  1SFO H;  4A93 G;  2NZH A;  3FP9 A;  2DUD A;  3STB C;  3SGI A;  4B3T Q;  3HOW H;  2MNA A;  4QGU A;  3L0O A;  2JEB I;  1VQH A;  4DK3 C;  2EXD A;  1CSQ A;  4DPG A;  4DV0 L;  4A3B H;  1AE2 A;  5DLQ E;  1GVP A;  4PZ6 A;  1N36 Q;  4IPG A;  1UE1 A;  3GTK H;  5FLM G;  3ULL A;  2OQK A;  2EIF A;  2IY5 B;  4L5Q A;  4YY3 L;  1Q81 C;  2UXD L;  3CCM A;  2YTY A;  2YYZ A;  4A3J G;  4JV5 L;  3GTM H;  2IHE A;  3I55 A;  1GD7 A;  1JJC B;  3DLL A;  2WFW A;  4HJA A;  4JI6 Q;  2V1C C;  5C3E H;  4DV4 Q;  1DGS A;  3CP0 A;  1CUK A;  4X66 L;  5FJ8 H;  4DR6 Q;  1QZG A;  3F2D A;  2UXC Q;  1W2B A;  4JBJ A;  2OQ0 A;  4IPD A;  2WAQ G;  3S14 H;  4UP8 A;  1I6H H;  3CPF A;  3ICE A;  3CAM A;  3J81 j;  1VQA A;  3DM3 A;  4NPS A;  3CCJ A;  4C3H H;  1PH3 A;  4LFA L;  4JOI C;  1VQI A;  1MKH A;  1NBW A;  3CD6 A;  3K0X A;  4GNX B;  4AIM A;  3UDI A;  3VDY A;  4A3F H;  5IYC H;  1VQE A;  1Q86 C;  1PA6 A;  4YHH Q;  1IL2 A;  3PO3 H;  4YWM A;  1VQC A;  4X65 L;  1Y1V G;  4OWX B;  4DV7 L;  1WYD A;  4DR7 L;  4A3D H;  3S1R H;  3AEV A;  1LUZ A;  4BBR H;  1ASY A;  4BBS G;  4HID A;  1YHB A;  3I4M H;  2Q2I A;  4YCW A;  3UDX A;  1S72 A;  1OTC A;  1YBY A;  4KI0 A;  3AYH B;  2UUB Q;  3TRE A;  1S40 A;  1UWV A;  4A3K G;  4DR4 L;  2QEX A;  2ALY B;  2ZTD A;  5H1S E;  2E2I H;  1IYJ B;  3G48 A;  5IP7 G;  4EX5 A;  1YJN A;  1I94 Q;  4LF4 Q;  1OXT A;  4FDB A;  1HNZ L;  1EQR A;  1WCM H;  2ES2 A;  1R9T H;  4DUZ L;  4K0K Q;  3OTO L;  2F4V L;  1HJP A;  1Q1E A;  2MFI A;  1HZB A;  4MNO A;  2PI2 A;  1OXS C;  2BH8 A;  4A3I H;  1IBM Q;  4DKA C;  1V1Q A;  1K8A C;  1HH2 P;  2HIV A;  2UUC L;  2YTV A;  3M7N A;  4JI1 Q;  5JJI A;  3TEH B;  2K75 A;  5M5X H;  3CXC A;  4YWK A;  1PH7 A;  1O7I A;  3RR5 A;  4LF9 Q;  3EN2 A;  3GTG H;  1KIX A;  1ASZ A;  3AQQ A;  4DUY Q;  1IBL Q;  1NMG A;  4AQY Q;  3S2D H;  3PUX A;  4DAY B;  4GNX A;  3H0G G;  5IP9 H;  4LF8 L;  3PF4 A;  3CW2 C;  4IOC A;  3B6Y A;  1WOC A;  1U5K A;  4P74 A;  3KYH C;  1XMO L;  1Z47 A;  5GAD C;  4LFC Q;  2JJQ A;  2NVQ H;  2YU9 H;  3S1M H;  2R93 H;  3KFU A;  1I50 H;  2Y0S G;  4O0A A;  1FL0 A;  1G51 A;  4IPH A;  2KEN A;  1N33 Q;  3HOU H;  3UDG A;  3ERS X;  3HKS A;  4JI4 Q;  1XNQ L;  4A3C G;  2A19 A;  3CQZ H;  2RCN A;  5M3M H;  4DV5 Q;  4HJ8 A;  3W5O A;  4DR1 Q;  5LMU Q;  1UE6 A;  3RZD H;  1PVO A;  3A74 A;  5FLX c;  1KRT A;  3RN5 A;  1WFQ A;  1K9M C;  3FKI H;  4LF5 Q;  4WJ4 A;  4X64 L;  2VW9 A;  3W1G A;  2VS1 A;  4B3R L;  3L7Z C;  3T1H L;  4LFB Q;  1HZ9 A;  4TVA B;  2JA6 G;  1HR0 L;  1KL9 A;  4B3M Q;  2R7D A;  2D0O A;  4WJ3 M;  1HZA A;  3PGZ A;  2UXB L;  1IBK L;  4JI2 Q;  5JJK A;  3CCV A;  4A75 A;  3CC2 A;  1A8V A;  2DGY A;  5LMN Q;  1NJI C;  2KCT A;  3MEF A;  5AJ3 Q;  4DV3 Q;  4B3T L;  3J7Z C;  4A3G G;  3NEN A;  3BJU A;  3BU2 A;  4A4I A;  5FLM H;  1HNW Q;  2IX0 A;  2XGT A;  4O2D A;  3RLF A;  1B70 B; 
#chains in the Genus database with same CATH topology
 4FVM A;  1BNZ A;  2LS0 1;  4ULL A;  4A3J H;  3GTK B;  1CZG A;  4K5W A;  2K5D A;  3OPO A;  3N52 A;  1HR0 W;  1E24 A;  4OHJ A;  2CFM A;  4CDF C;  4JBK A;  3D4D A;  5DM7 3;  3BDL A;  4GZY C;  4DR6 L;  5C4X G;  2KA7 A;  2D9U A;  1EY8 A;  5C3E B;  1SND A;  5M5Y H;  2A5H A;  1PZJ D;  4ZQ3 A;  3T1Y Q;  4WOR A;  2E8G A;  3CRL C;  5D65 A;  4YWL A;  1Y1V H;  3IL8 A;  1FGU A;  4ZKC B;  4DR3 Q;  1LTI D;  1BCP F;  4BA2 I;  3O13 A;  1VQL A;  4XQJ A;  1PFN A;  3A55 A;  1A63 A;  4KY6 A;  4BBR B;  2Q2U A;  5C3W A;  2XSC A;  3NEM A;  1S4Z A;  2I07 B;  2E2I B;  2HHH L;  1ESR A;  1LT3 D;  3CC7 A;  2UUA Q;  2JSO A;  4OIK A;  1M90 C;  4NXM L;  4K0K L;  3HKZ E;  4X62 Q;  1SNQ A;  3U50 C;  2B2Y A;  2WKC A;  2F0G A;  5KEE A;  1WTX A;  4DV0 Q;  3NTI A;  2RSN A;  1RDP D;  3L9A X;  1S5F D;  1GM5 A;  4A3B G;  1TWG H;  2K1B A;  4G4K A;  1TY2 A;  2K28 A;  3D3R A;  3KLS X;  1TKW B;  4KN7 C;  5JJZ A;  3TP6 A;  4JI0 Q;  1FYC A;  5LL6 S;  3HGB A;  2ZXO A;  4FF3 A;  4H0L C;  2DN8 A;  4KLK A;  1YEZ A;  4X3K A;  3Q6S A;  5IOD A;  2VQE Q;  3U4V A;  1KDA A;  3A56 A;  3K0Y A;  1TS2 A;  1GUN A;  1A2U A;  4RGO S;  3E9I A;  5KNC A;  2VB2 X;  1JT8 A;  3ONA B;  3RZD B;  1CKN A;  3TZD A;  4LF5 L;  4DV6 Q;  4UAI A;  4LFB L;  1O7Y A;  2NTT A;  1ZKO A;  3GV6 A;  4B3M L;  1YNJ D;  2PNH A;  1PYB A;  2CVR A;  5C5L A;  3OHX C;  1ET6 A;  4IFD H;  4O1N A;  2L5T A;  4A3E G;  1B1Z A;  5K5P A;  1TS3 A;  1PFS A;  2EY1 A;  3CCE A;  2N78 A;  3KF8 B;  1B7Y B;  5JOB A;  2K33 A;  2VZA A;  3KLS A;  5C5M A;  4QJF A;  4C3J H;  3TS2 A;  3RZO H;  1D5X C;  4OX9 L;  1A62 A;  1F2L A;  4A93 H;  1MI2 A;  1PRT D;  1L2F A;  1PZK D;  2A1A A;  3RLO A;  3S1N B;  2HUG A;  4QY7 A;  1LYL A;  3HOY H;  2FJ2 A;  4F8M A;  5AFW A;  2R7Z H;  1ET9 A;  3J81 L;  4CKE A;  1N36 L;  3GTO H;  3JAM L;  1XNR L;  1EFW A;  2JE6 I;  5C4J B;  3OWE B;  2JA7 G;  1SNP A;  2EDG A;  3Q23 A;  5ELN A;  1I4P A;  2CQO A;  3M4Y A;  3HOU G;  1I4H A;  2L15 A;  4ODG A;  4R8N A;  3RD4 A;  1A6X A;  4HSV A;  1FJG L;  4BA1 I;  2MO0 A;  1H9R A;  5IIF A;  2R92 G;  1M8A A;  4A3K B;  3SK8 A;  4JI8 Q;  1LAB A;  1YNJ C;  2K6A A;  2E5L L;  4P72 A;  1SAP A;  4TQU S;  2UXB Q;  1TQO A;  4K8I A;  1IBK Q;  4A3L H;  1EY7 A;  3M3Y H;  2BE5 D;  3GQB A;  3M85 A;  1EY0 A;  4G7O C;  3PUW A;  1VQ4 A;  2BA1 A;  4YCU A;  1ROD A;  2EYH A;  2QKI C;  4UP7 A;  4RHR A;  1ZEQ X;  4FF1 A;  4C56 C;  3GTL B;  2Q8I B;  4LF4 L;  4DAM A;  2VUM H;  1SRO A;  2IJ0 A;  1KNA A;  3MFY A;  2FXQ A;  2BDO A;  3G7L A;  5BR8 Q;  3MTS A;  1TWA B;  2F0L A;  5CBA E;  2R3Z A;  3KDF A;  2A68 D;  1JJ2 A;  1PRT C;  1UEA B;  2M2L A;  4J6H A;  1BBU A;  2B3G A;  2IX3 A;  1GHJ A;  4UPA A;  3LWU A;  3H0G B;  2NN6 I;  3S2H B;  2QF7 A;  1RD9 D;  2MO1 A;  3I2Z A;  4GLV B;  1QB5 D;  1PTO B;  2F03 A;  2SDF A;  1VS0 A;  4GN4 B;  1M4V A;  1WD0 A;  5E3F A;  3LWE A;  3PUV A;  2F1M A;  2LFN A;  5C3E G;  4LNQ A;  1V1P B;  1A3T A;  4JYA L;  3DM1 A;  4A3C H;  3GP7 A;  3C46 A;  2SNM A;  2OTL A;  1ENF A;  3RLN A;  1B2T A;  3U4Z A;  2JQO A;  1ZXT A;  3L2P A;  3ERQ A;  2HHH Q;  2AWN A;  2B63 H;  4QMG A;  1LT5 D;  1X3P A;  1YHA A;  4NXM Q;  4DR7 Q;  2RF4 A;  1SMY D;  2BE5 C;  1H95 A;  1B3Q A;  2C5C A;  2Z6K A;  2KEC A;  3X3M A;  2FMC A;  4BBR G;  1BKB A;  4C3I B;  1F2Z A;  4CKC A;  3HOV B;  3D0F A;  3VR3 A;  2F0K A;  5M5W B;  2O2L D;  1JC7 A;  1HNZ Q;  4NW2 A;  3H91 A;  2F4I A;  1N32 L;  5HUR A;  5AJ3 L;  2A68 C;  1SNO A;  1WI5 A;  3JC6 6;  4A3M B;  1U9R A;  1EOV A;  1S3O A;  1VQM A;  1K83 B;  1VQN A;  4FXK C;  1KHI A;  2Z0S A;  5C0X H;  3EA6 A;  2PZW A;  2UU9 L;  5IT9 c;  4J8Q A;  2F3I A;  4BS9 A;  2ASB A;  2G9H D;  3M4O H;  4K5V A;  4DV1 L;  2XN9 C;  3I4N G;  1NSN S;  5I9P A;  3H3V C;  2NZ1 D;  1U4L A;  3EFX D;  4KD3 A;  2KEE A;  1KDC A;  3NXW A;  3BVM A;  4BY7 H;  1VQJ A;  1PZI D;  2N55 A;  1BQQ T;  3PSI A;  1QZH A;  2NVX B;  5CV9 A;  2E2J H;  2HIX A;  1XTC D;  5FO9 B;  1XNQ Q;  1QUQ A;  1YNX A;  1CKO A;  2QDL A;  3P1H A;  5IYB H;  3TME A;  2EY6 A;  4LWC A;  4XYQ A;  2PPB C;  1X55 A;  2B2U A;  1MSG A;  1PH1 A;  2AWO A;  3OSO A;  1VQ7 A;  1SMY C;  2NVT B;  4IAL A;  1Y1W G;  2F0I A;  5CYU A;  1PH2 A;  3HOX G;  4BXX H;  3PO2 B;  4OX9 Q;  2NVY B;  2WV6 D;  3NSW A;  4TRD A;  5HGT A;  3NQT A;  1SFO H;  3S17 B;  3OIQ A;  3HOW H;  3K59 A;  5I2X A;  1AE2 A;  4PZ6 A;  5FK9 C;  1N36 Q;  5J39 A;  3ULL A;  5FLM G;  4L5Q A;  1CA6 A;  4JV5 L;  1T5E A;  2A73 B;  4KMU C;  5M3F B;  3VA7 A;  3I55 A;  1JJC B;  1D5M C;  3MFG A;  4X66 L;  5FJ8 H;  4DNT B;  3P75 A;  1CFM A;  5EBC A;  5ELE A;  1L0X B;  3S1Q B;  2L12 A;  4DN4 M;  3S14 H;  3PMF A;  2V4D A;  4RAU C;  4UP8 A;  1I6H H;  3J81 j;  1VQA A;  4NPS A;  4EVO A;  4C3H H;  3CCJ A;  3BVZ A;  4JOI C;  3K0X A;  2F0D A;  1PA6 A;  3PO3 H;  1STH A;  4WRD A;  1SNC A;  2F0H A;  4OWX B;  4A3D H;  3AEV A;  2G9D A;  4HID A;  2Q2I A;  1EU3 A;  4KI0 A;  3TRE A;  4DR4 L;  1UWV A;  4K6D A;  4DK0 A;  2QEX A;  2ALY B;  4A3K G;  5C44 B;  3G48 A;  5IP7 G;  1YJN A;  1I94 Q;  4LF4 Q;  1W6J A;  2CH4 W;  2F0U A;  4FDB A;  1EQR A;  3HOZ B;  1LAC A;  1R9T H;  1EY6 A;  3PIP 3;  4XQN A;  1PFM A;  2PQE A;  4ID6 A;  1F9R A;  1OXS C;  4IUP A;  3D8G A;  1K8A C;  2AQ2 B;  2UUC L;  3NTH A;  1SEB D;  2QCP X;  2Q8T A;  3VR4 A;  1VF5 C;  3PUX A;  4GNX A;  3H0G G;  1XWE A;  1D6E C;  3I4L A;  3CW2 C;  1U5K A;  1DOL A;  1XMO L;  3URY A;  1HQM C;  5BN5 A;  2K7V A;  2CQA A;  4ILW A;  5FOB B;  4MIU A;  5IT9 E;  1A15 A;  5M3M H;  2HCC A;  3K7A B;  1EZ6 A;  1PVO A;  5FLX c;  1IL8 A;  3DMU A;  2L0C A;  3FKI H;  5LHY 1;  4WJ4 A;  4ZCK A;  4X64 L;  4B3R L;  3L7Z C;  3BDC A;  3T1H L;  1JB3 A;  1HZ9 A;  4RKB A;  4NDX A;  4N9T A;  3MXU A;  4J1M A;  2K05 A;  3NTK A;  2D0O A;  2Z1C A;  1O7Z A;  4JI2 Q;  3UI2 A;  5JJK A;  3Q22 A;  4U67 3;  4A75 A;  2KCT A;  1RTN A;  5AJ3 Q;  4DV3 Q;  2B2Y C;  3I70 A;  3NEN A;  3NBI A;  2XWB B;  1HNW Q;  1H9M A;  2XGT A;  3SVM A;  2CW0 D;  5CV8 A;  4C3I G;  1WTR A;  1ILP A;  5I9O A;  3HOV G;  4IUV A;  2KBN A;  1SJE D;  2UU9 Q;  1CA5 A;  2HCI A;  2RHQ B;  2IX1 A;  4JPB W;  2CH4 A;  1W3S A;  1MIU A;  3M4P A;  3GTM B;  5JPM C;  5JVH 3;  1TWC H;  3I73 A;  4A3M G;  4OO1 G;  3BDO A;  2Q2H A;  2AUK A;  5BN3 A;  2L9H A;  4G57 A;  4AYB B;  1LO5 D;  1Q82 C;  4ZRZ A;  3M4Q A;  4JC0 A;  4MHE A;  1KRS A;  3CPW A;  1O7L A;  3W2D A;  3H3V H;  5I6Y A;  3CME A;  2CKZ B;  4BBS H;  5KGU A;  1PH9 A;  4PNY A;  5EBD A;  3S1R B;  1HCZ A;  3FPP A;  1O80 A;  4R4T A;  5IGE A;  3NBH A;  4GOP A;  1Y8N B;  2KCC A;  1WCM B;  1BCP C;  1CKN B;  1SR3 A;  3R2T A;  1B70 B;  4NB3 A;  3DEO A;  3SEB A;  4RGT A;  2VL6 A;  4ABN A;  5IGF A;  1HA5 A;  1U0L A;  4K14 A;  4MZ9 A;  2RA4 A;  2EJF C;  3BG3 A;  2VQF Q;  3E0E A;  2CW0 C;  5E4W C;  1IW7 D;  3PO2 G;  5IWA Q;  2RHS B;  3J80 L;  4LF7 L;  1UE7 A;  1XPU A;  4IZ8 A;  3TQY A;  1HZC A;  1BCP B;  5EPJ A;  5M5X B;  3UE0 A;  2X69 A;  4DUY L;  4AQY L;  3GTG B;  1BR9 A;  3CMA A;  4JW0 A;  2K5V A;  2LSS A;  1X32 A;  4PV1 C;  1N34 Q;  3FDT A;  3I56 A;  3S2D B;  1BF4 A;  3MXN A;  3NP8 A;  3ULJ A;  2B8G A;  3A8I E;  2NVQ B;  2B2T A;  1G91 A;  1K73 C;  1NY4 A;  1I50 B;  4JI4 L;  1DZ1 A;  2B2W C;  1VQB A;  2R6G A;  5M3F G;  4JBW A;  1ENA A;  1UAP A;  5LMU L;  1S5C D;  4AH6 A;  2WAC A;  2OTJ A;  1GXD C;  2JA6 H;  1I3Q H;  1KLU D;  1NR4 A;  3GD7 A;  2A8V A;  3D4W A;  1YVC A;  5HGQ A;  3V05 A;  1VMP A;  4NXN Q;  2YTX A;  1XYI A;  5J22 A;  1CK1 A;  1NNX A;  4ZUJ A;  3I7F A;  2PQA A;  2A6E C;  3MC0 B;  4OEL B;  5FLX E;  3PIO A;  4AYB E;  1VMC A;  3A8K E;  4DU9 A;  5C44 G;  2AQ3 B;  1I4X A;  5A2Q L;  4UY8 C;  4N9P A;  4A76 A;  4JI5 Q;  1IXR A;  4PZ8 A;  1IW7 C;  2I5H A;  2PI2 E;  3HOZ G;  5C4X H;  1D2B A;  1VCI A;  5DNF A;  3TP5 A;  4C2M H;  2O5I C;  1XTD A;  2EQS A;  5EKL A;  4OXP A;  3UE1 A;  1U4P A;  1LLR D;  4DV2 L;  3DUZ A;  1PH4 A;  1JJG A;  1B9M A;  1E1T A;  4JI3 L;  1TXY A;  2ZT9 C;  3KDF B;  4R8I A;  1AH9 A;  1YHQ A;  4O42 A;  3SXH A;  2H4O A;  1AN8 A;  4DV4 L;  3U9O A;  1V1O A;  4IFD I;  3HZX A;  4QCL A;  2IHF A;  3VYR A;  4X3T A;  4B3S L;  1VQP A;  3S15 B;  5GAH C;  4PQX A;  4HSP A;  2BA0 A;  4X64 Q;  4QQB X;  3T1H Q;  3TRZ A;  1EYD A;  1Q7Y C;  3EJI A;  3CCR A;  1ENC A;  4KHZ A;  1Q12 A;  5CBE E;  4KHP Q;  1FD7 D;  2K52 A;  1MSH A;  2HQL A;  4DAP A;  4XDX A;  4CJ2 C;  4PG3 A;  1L0Y B;  1SNM A;  2K5N A;  2MP1 A;  2QA4 A;  1LTT D;  1HUN A;  1EEI D;  3IFD A;  1HXY D;  2Z6K C;  1WVL A;  1HTL D;  3R93 A;  1GHK A;  2JA9 A;  4CBV A;  2KED A;  1GUO A;  4HAE A;  2LMC B;  5ELO A;  1D7Q A;  4IO9 A;  2MUY A;  3AFP A;  3F8T A;  4CDE C;  1TWF B;  1MBY A;  4JI1 L;  4IJH A;  4XXE A;  1G6P A;  1XMQ L;  2J0T D;  1KQS A;  1GUW A;  4KTA A;  4KHV A;  4ZUI A;  2MJ8 A;  3I4N B;  2D5D A;  1QNU A;  4B9W A;  4EQP A;  3J7Y W;  1LTB D;  1ICF B;  3CC4 A;  1EU4 A;  2K5W A;  1SRU A;  2BH2 A;  2CWP A;  3CKI B;  1BOS A;  5D14 A;  4KK7 A;  2EYL A;  4AYB G;  2P5Z X;  3KLW A;  4A3E H;  2GA4 B;  4DV5 L;  3S16 H;  1Q46 A;  4POG A;  2GVA A;  1NE3 A;  1FR3 A;  3TP7 A;  1TR5 A;  2NZO A;  5TSS A;  4A3G B;  4EGV A;  4HED A;  4HTH A;  2A74 C;  1D1I A;  1U4M A;  4IPC A;  3T53 B;  4MTN A;  3OW2 A;  1F2Y A;  2DJG C;  1Y1W B;  2O4X A;  2RQX A;  3HOX B;  1QUQ B;  1R4Q B;  2AMC B;  1JOK A;  4R4O A;  2E75 C;  3A7A B;  3T56 B;  1L0W A;  4POF A;  4LF7 Q;  5FO7 B;  3STB D;  2G5D A;  2HT1 A;  1PH8 A;  1WCM G;  1QVC A;  2JA5 B;  1HNX L;  4DR5 L;  1CI3 M;  2TMP A;  2MQH A;  2E2H B;  2JA7 H;  1ZYR D;  2L1B A;  3QB3 A;  4BY1 H;  1PTO D;  1HFG A;  3KJP A;  4Q5V A;  1KAB A;  2JA8 H;  1I6V C;  4M1U B;  3BYY B;  2H5X A;  1TWH H;  4IN3 A;  3RNU A;  4IJL A;  1NMF A;  4R4C A;  4V0B A;  1SDF A;  4HIK A;  1X9N A;  1DON A;  2DY8 A;  2R92 H;  3K80 C;  4LF8 Q;  2XTI A;  1DYQ A;  5EQ0 A;  4JI7 L;  1F9Q A;  5G3L F;  1D8L A;  4KY5 A;  1Q90 A;  1LM0 A;  3NQI A;  3BZC A;  3GTJ H;  2E74 C;  1IHZ A;  4LF6 L;  1K8G A;  4Y7N H;  4IUQ A;  4IFD G;  1JR0 D;  1J5E L;  1TT2 A;  3F2C A;  2AQ1 B;  2JK8 A;  4KKT A;  2JEA I;  1LTL A;  4RA8 A;  1C7Y A;  1XPR A;  1DXM A;  5KRU A;  3V96 A;  4GKK L;  3GO5 A;  5COR A;  4RCN A;  4Q0F A;  5C0X I;  1VQ8 A;  1Q8K A;  2E2D C;  1QVG A;  2C35 B;  3LGJ A;  2KHS A;  3QJY A;  4A93 G;  1F2M A;  2NZH A;  5DAU A;  2DUD A;  3STB C;  3KK7 A;  4QGU A;  3L0O A;  2JEB I;  3VR6 A;  4DPG A;  1KNE A;  1UE1 A;  3GTK H;  1ZYR C;  2EIF A;  3NE5 B;  3X3N A;  1PTO C;  2N88 A;  1RCV D;  4QF4 A;  2QDB A;  1IKM A;  1TS5 A;  3CCM A;  3T16 A;  2IHE A;  4CDD C;  1DM0 B;  3DLL A;  4G7Z C;  5C3E H;  4DV4 Q;  1DGS A;  3CP0 A;  1WTW A;  3J7A V;  4DR6 Q;  4I7Z C;  5ELF A;  2PYK A;  2OQ0 A;  5LL6 X;  2KOL A;  1T5X D;  4HMJ A;  3CPF A;  3CAM A;  2LKV A;  2MGS A;  2L4N A;  4LFA L;  1ESF A;  3CD6 A;  1NBW A;  4DNR B;  4AIM A;  4GNX B;  3VDY A;  1EOT A;  1NCV A;  1VQE A;  1Q86 C;  3T51 B;  4YWM A;  1VQC A;  3A8J E;  2H1E A;  4X65 L;  4CJ1 B;  1FNV A;  4MN3 A;  4DV7 L;  1I4G A;  1LUZ A;  4BBR H;  1QOH A;  4LJZ C;  5BN4 A;  4YCW A;  4JVZ A;  1YBY A;  1SE4 A;  3SK6 A;  2E2I H;  4V19 0;  2PMZ B;  4FP5 D;  1SE3 A;  5ELD A;  3ZYY X;  1AFP A;  1B44 D;  3DXJ C;  4DUZ L;  3KUP A;  4K0K Q;  3OTO L;  4CHT B;  2J7Z A;  1PYW D;  4MNO A;  2EZV A;  4DKA C;  4FXD A;  5A35 A;  3M7N A;  4JI1 Q;  1BDO A;  3GTP B;  2F0V A;  1O7I A;  1I4Q A;  1QE6 A;  3EN2 A;  1CM9 A;  5KND A;  1SYG A;  3AQQ A;  3RUZ A;  1NMG A;  3WOF A;  4FF4 A;  3PF4 A;  3B6Y A;  3DWA A;  1WOC A;  1EIG A;  5GAD C;  3MHB A;  3KFU A;  3PQI A;  1ICW A;  5FKA C;  1G51 A;  2KEN A;  1GUT A;  3UDG A;  4A3C G;  4L6T B;  2A19 A;  3ERO A;  4DV5 Q;  4KD4 A;  4L63 B;  5IGB A;  1UE6 A;  2SOB A;  3RZD H;  1CTM A;  1AW7 A;  1X3Q A;  1DD2 A;  4LF5 Q;  3W1G A;  3NHH A;  4LFB Q;  3NWT A;  1KL9 A;  4B3M Q;  4F87 A;  2R7D A;  3I72 A;  3GTQ B;  1HZA A;  3PGZ A;  3T13 A;  2ICE C;  1AP0 A;  4K5X A;  1A8V A;  1NJI C;  2K5Q A;  3MEF A;  4B3T L;  3J7Z C;  3K5L A;  4A3G G;  4A4I A;  3K5N A;  5FLM H;  3Q0A A;  1EQT A;  4KN4 C;  3NBH B;  2NWG A;  4GOP B;  4HJ9 A;  3S1N H;  2Z4I A;  2EE1 A;  3I8Z A;  3ER0 A;  4XT3 B;  2A6H D;  2RBM A;  2UXC L;  3K57 A;  2JA5 G;  3U9S A;  5C4J H;  5NUC A;  2PMZ E;  1NUC A;  1JIC A;  1XNR Q;  4JI7 Q;  1YJ9 A;  1F77 A;  1QNK A;  2AHO B;  4DR2 L;  1CQF A;  2EYF A;  1FVI A;  1C0A A;  4HIM A;  2EYP A;  4YHH L;  3MVV A;  1PRT F;  2F0F A;  1PV4 A;  5CR3 A;  3MXN B;  2NN6 G;  4A3F B;  1PYS B;  1FJG Q;  1CQV A;  2OCE A;  2K03 A;  4A3K H;  1EWI A;  2NBF A;  1H9J A;  1P16 A;  2WB1 B;  2UUB L;  3BZD B;  3F1Z A;  1LTS D;  2K14 A;  1VQ6 A;  3I4M B;  4GLA C;  1KDB A;  5IY0 A;  1VQD A;  2E5L Q;  4J15 A;  3S9W A;  4B08 A;  3QIA A;  3L3O C;  4M8A A;  1S5D D;  4NP5 A;  1X3E A;  1EYG A;  5CV7 A;  1EY9 A;  1YJW A;  1IBM L;  2F0W A;  3ND9 A;  3GDE A;  5I4D A;  1JWM D;  4A3I B;  1B53 A;  1TWA H;  4OEM B;  1MJE A;  3K58 A;  4LF9 L;  4RKL A;  4RGM A;  1QCB D;  3ULP A;  4QIW B;  1KXL A;  4WFN 3;  1V9P A;  3H0G H;  3HEJ A;  3S2H H;  2PQA B;  1SN8 A;  1IBL L;  4FF2 A;  3PUZ A;  3H3V I;  3EIV A;  1VQG A;  3FPU B;  3QOJ A;  1X56 A;  4HMI A;  2A6H C;  3EBE A;  4LFC L;  1H9S A;  1PTO H;  3Q8D A;  1BBW A;  3OYY A;  3A54 A;  5FO8 B;  1EQV A;  2YU9 B;  4DAV A;  3S1M B;  2R93 B;  4LK1 C;  3K5O A;  4ZKB B;  4RFB A;  1B4O A;  1G2S A;  1EYA A;  3TZU A;  1AE3 A;  3CQZ B;  1S5B D;  3GV3 A;  1RKN A;  3E6Z X;  3CCS A;  2PW7 A;  2SNS A;  4PZ7 A;  3PO3 G;  4DV7 Q;  2F0S A;  4RMF A;  1EZ8 A;  4JYA Q;  4X3S A;  1C9O A;  4DA2 A;  3AMU A;  3IRB A;  2ID0 A;  3QOL A;  3N6R A;  1HRJ A;  4ALP A;  1EIY B;  5ELB A;  1J6Q A;  4OL7 A;  4HR7 B;  1B50 A;  3E0J A;  4FYD A;  4DUZ Q;  1EFI D;  4C3I H;  2XIW A;  4XQQ A;  1MJC A;  5JPN C;  3KJO A;  4ME5 A;  3HOV H;  3CCL A;  1HHV A;  5M5W H;  4I7A A;  1O78 A;  3W3A A;  4JK1 C;  3PIP A;  2KHI A;  4R4I A;  3FVQ A;  1BCP D;  3S24 A;  3PF5 A;  4A3J B;  1TY0 A;  4QL5 A;  4A3M H;  4OO1 H;  1N32 Q;  1GJX A;  4R9W A;  4FXG C;  3VYS A;  2OEO A;  4KY7 A;  1QG7 A;  2WB1 E;  1E3P A;  2EVB A;  1K83 H;  1DJR D;  5KYI A;  4C1N I;  2WAQ B;  1L1O A;  1OXX K;  1JCK B;  1EYC A;  3G4S A;  5M5Y B;  3T1Y L;  1Y14 B;  4UDU C;  4DV1 Q;  3E5S A;  4IUT A;  1X6O A;  3AB9 A;  1XPO A;  4DR3 L;  1I4R A;  1AEX A;  3I91 A;  1Y1V B;  5CC4 A;  3J81 c;  3D31 A;  3H15 A;  1SLJ A;  2NVX H;  1JE5 A;  3JAM c;  3CF5 A;  1C4Q A;  4QIW E;  3A5Z B;  4X6A H;  2XVS A;  4GLX A;  4L5R C;  2AKW B;  3J81 i;  2UUA L;  5D3D A;  5C3X A;  3EQL C;  3JAM i;  1VQF A;  1MGS A;  2CWA A;  4X62 L;  1HQR D;  1K3R A;  5JVG 3;  2NVT H;  1FGB D;  3F2B A;  5IYD G;  1HA6 A;  3TS0 A;  3PO2 H;  2NVY H;  5COY A;  4BWG B;  1VQO A;  3S17 H;  1TWG B;  4YCV A;  1KC8 C;  2L55 A;  1JOO A;  1JE4 A;  2A6E D;  3PUY A;  2JXM B;  4JI0 L;  5KIX A;  1KD1 C;  1G29 1;  3PV0 A;  2F0M A;  1SE2 A;  4HIO A;  1RTO A;  3SDZ A;  2Y0S B;  1UUP A;  1PH6 A;  2VQE L;  1JWU D;  2D2C C;  5M3F H;  4FO2 A;  4DR2 Q;  5JJL A;  4JV5 Q;  1NTG A;  4JG2 A;  4XIG S;  3BVG A;  3I3C A;  2PZT A;  4PMW A;  1HFN A;  3FRP B;  4X66 Q;  3S1Q H;  1VDZ A;  2RSO A;  1JQY D;  1OXU A;  4DV6 L;  1C48 A;  2EJM A;  4HJ7 A;  2IL8 A;  4APV A;  2K5H A;  2KCN A;  1EUJ A;  3HS0 C;  1X3F A;  2F3W A;  3AFQ A;  4R4Q A;  5JEA G;  4EQ5 A;  2GN5 A;  1E2V A;  3Q24 A;  1EIF A;  2RCF A;  2WAQ E;  5IYC G;  4A3F G;  5JEA J;  2D62 A;  3CRK C;  4K8J A;  4P2C B;  5C44 H;  2WB1 G;  4PMC A;  1PDQ A;  5GAG C;  2PW5 A;  3I4M G;  4DR4 Q;  2K4K A;  4HCS A;  4N8F A;  1D5Z C;  2XWJ B;  5IT9 L;  3HOZ H;  2L11 A;  1B9N A;  4C3J B;  3RZO B;  1PHJ A;  1QWY A;  5LMN L;  2JA8 B;  4A93 B;  4RH6 A;  3MXG A;  4UP9 A;  3D4R A;  4XTC S;  2C9O A;  5T1I A;  2SEB D;  5K36 G;  3HOY B;  3ZJY C;  3HKZ B;  4KJO A;  5GAE C;  2R7Z B;  1K28 A;  4ZLT F;  3GTO B;  5DEH A;  2UUC Q;  2NYZ D;  3W1B A;  4A3I G;  1WTH A;  5EAY A;  4LUO A;  3P20 A;  4OWT B;  1ML0 D;  1SE8 A;  4JOI A;  3K8A A;  3OOC A;  1PMR A;  1XX8 A;  1EEF D;  3VR2 A;  4F88 A;  1YIT A;  4P75 A;  2R61 A;  3D6W A;  4CKB A;  3K81 C;  4DK6 C;  5IP9 G;  1XMO Q;  3J7A 5;  1RL2 A;  4G7H C;  3MWY W;  4JI8 L;  1Y69 U;  2R93 G;  3K7A H;  1M1K C;  3OW7 A;  1YZ6 A;  1WJJ A;  3I90 A;  1VQ5 A;  4L5S A;  3M3Y B;  2WKD A;  1CSP A;  2Y0S E;  1W6K A;  2PNR C;  4ZK9 B;  3J81 E;  1PH5 A;  4B3R Q;  3JAM E;  2HDM A;  3KF6 A;  2E76 C;  5BR8 L;  2VUM B;  2QIL A;  1IYU A;  4ME3 A;  3RN2 A;  5IGG A;  3SGI A;  4DK3 C;  2EXD A;  1CSQ A;  4A3B H;  1WD1 A;  4RWS C;  1MD2 D;  3VYU A;  3CHB D;  4IPG A;  1BXT A;  4IQZ A;  1BBX C;  2OQK A;  2IY5 B;  5IGC A;  4YY3 L;  2UXD L;  1XXG A;  2YYZ A;  4A3J G;  3GTM H;  2EYJ A;  2WFW A;  2V1C C;  3SHL A;  2IPK D;  1W2B A;  3F2U A;  3LNN A;  4YIJ A;  2WAQ G;  3IAY A;  1Z7T A;  4CJ0 B;  3D6C A;  3DM3 A;  3H94 A;  1STA A;  4H13 C;  1VQI A;  2A69 D;  2QEJ C;  1EWC A;  3UDI A;  3TSS A;  1LT6 D;  1Y1V G;  4DR7 L;  2B63 B;  1KTK A;  3S1R H;  1YHB A;  3MZ5 A;  4K2L A;  4HCE A;  1S40 A;  2ZTD A;  1IYJ B;  1WTQ A;  4I65 A;  1C8C A;  1HNZ L;  1WCM H;  5DM6 3;  2XNA C;  2F4V L;  2B2U C;  3KBG A;  1HJP A;  1Q1E A;  1HZB A;  3WOE A;  1AZQ A;  2PI2 A;  2BH8 A;  3QO2 A;  3VA5 A;  5M9O A;  1HH2 P;  4TKO B;  2HIV A;  2YTV A;  3TEH B;  5M5X H;  3CXC A;  1K0S A;  1PH7 A;  3RR5 A;  2M00 A;  3GTG H;  1ASZ A;  2DNE A;  4DUY Q;  3M4O B;  4AQY Q;  3S2D H;  5FLX L;  1CHP D;  4IOC A;  4KV6 A;  3KYH C;  2NVQ H;  1I50 H;  2Y0S G;  4O0A A;  4BY7 B;  4IPH A;  3HOU H;  4JI4 Q;  2RDG A;  1XNQ L;  3G6J B;  2E2J B;  4OGQ C;  2PZU A;  2A69 C;  5LMU Q;  5IOC A;  2LY7 A;  3A74 A;  1KRT A;  3RN5 A;  3R2I A;  3HP3 A;  1WFQ A;  1K9M C;  4CGY B;  2VW9 A;  2MHV A;  1DOM A;  4TVA B;  1HR0 L;  3MAQ A;  2OF1 A;  1EY4 A;  1A3U A;  2EPB A;  1Q3L A;  3CC2 A;  3OMG A;  2DGY A;  1EWH A;  5LMN Q;  4ZAI A;  1A2T A;  1Y8O B;  1DOK A;  1SFO B;  2EXZ A;  3QG1 A;  5EPL A;  5CV5 A;  3BU2 A;  4DAY A;  3HOW B;  2ZJP A;  2RDH A;  2BCO A;  4IFD J;  2JN4 A;  5EPK A;  1XJV A;  2NB0 A;  4GN5 A;  1YIJ A;  2X6L A;  1TVX A;  4BY1 G;  1UEB A;  4C3J G;  2B2W A;  4JBM A;  2JA8 G;  4Y52 H;  5ELC A;  1WTV A;  1SSO A;  3HOY G;  1A3V A;  2F52 A;  3OIP A;  4DV2 Q;  3DHQ A;  2IT1 A;  3HKZ G;  1Q8I A;  1Z9F A;  2R7Z G;  4S3S A;  5E4X A;  2XRQ D;  3S14 B;  2EYM A;  4JI3 Q;  1JB7 A;  1I6H B;  2I0Q A;  1G2T A;  4XT1 B;  5JAV A;  2WIN B;  5E1F A;  4C3H B;  3DEP A;  4K6L A;  5EJW A;  2D0P A;  5I2Y A;  4GNX C;  5HY6 A;  1H9S B;  2DY7 A;  3S15 H;  1LV9 A;  3PO3 B;  1J9O A;  2OWO A;  4B3S Q;  3U58 A;  1ONL A;  2B2V A;  4A3D B;  2VY3 A;  5IGD A;  1QJO A;  1I94 L;  2PCF B;  2R7F A;  1J8I A;  4P71 A;  1SYD A;  3TN2 A;  2EJG C;  2B8F A;  1R4P B;  2CHB D;  4N8X 1;  4NKL A;  3ITP A;  4JCV E;  1Z6H A;  4HN7 A;  4MTK A;  4A3L G;  2FMM A;  1R9T B;  4LUV A;  4LW1 A;  2K32 A;  1A0I A;  2I5M X;  3NK9 A;  2I5L X;  5KYL A;  4GKJ L;  3QR8 A;  4YY3 Q;  1WTO A;  1Y8P B;  1UE5 A;  2VUM G;  2UXD Q;  1PRT B;  2XRS D;  2I46 A;  1PFB A;  1STG A;  3E3X A;  1BUV T;  1Q1B A;  1KAA A;  1SMX A;  1N9W A;  1TWF H;  2K01 A;  3PCO B;  1L1O C;  5J1Z A;  2HDL A;  3NWS A;  2F0J A;  1GKH A;  2NUC A;  1XMQ Q;  1VQK A;  3I4N H;  4H02 A;  3J80 c;  1E2W A;  1ILQ A;  2QW7 A;  5F2D A;  1U4R A;  5IE8 A;  5M3M B;  1MHW C;  4OON A;  1L1O B;  3J80 i;  2X6G A;  3A0J A;  4H7B A;  2FHT A;  3FKI B;  3CCU A;  5GQO A;  3AU7 A;  2QGQ A;  5EKK A;  1X65 A;  4WJW A;  4JI2 L;  2F0O A;  4OIJ A;  1K8O A;  4DF7 A;  1G8Z D;  4KJN A;  4A3G H;  2LXJ A;  4DV3 L;  1X54 A;  2B63 G;  1STE A;  2F4V Q;  1SYF A;  1Y1W H;  1HNW L;  2LXK A;  3HOX H;  3MXP A;  1EL0 A;  2ZM6 L;  1X3G A;  3UDF A;  2FIN B;  3NEL A;  2ZJR A;  3C2P A;  5C4Z A;  2IW3 A;  1K8M A;  4GOP C;  1E0B A;  3LX0 A;  3FHW A;  2JA5 H;  5KNB A;  3DWP A;  3TP8 A;  1N8R C;  3NUC A;  2E2H H;  3VR5 A;  1HNX Q;  4DR5 Q;  1TWC B;  4GN3 B;  1YI2 A;  1FNW A;  1VF7 A;  4DGZ A;  3BS1 A;  2Z9H A;  3TDQ A;  1GOZ A;  1QVF A;  2NTS A;  2EY2 A;  4EQN A;  1JWS D;  5CV4 A;  5C0X G;  1E2Z A;  1TU2 B;  4JI6 L;  1FNU A;  2NN6 H;  3A7L A;  4LUZ A;  4IUR A;  2CCZ A;  5C0X J;  3M9B A;  5CV6 A;  1E22 A;  3OMC A;  4BBS B;  4H44 C;  2F3V A;  2GVB A;  3KF8 A;  1WTP A;  3BZK A;  2B2T C;  3C3L A;  4BY7 G;  2ICI A;  2ZXP A;  5J3B A;  1EQQ A;  1HR0 Q;  3J7A F;  1UNS A;  5I6W A;  1PTO F;  2K50 A;  4RG1 A;  4DK1 A;  2KQ3 A;  3E9H A;  4LF6 Q;  1CZW A;  4DFA A;  2AUJ D;  2JYO A;  1JMC A;  2ENB A;  4OO1 I;  3C1E A;  4IUU A;  5IYB G;  2EYO A;  1J5E Q;  1IYV A;  5IP7 H;  1LTG D;  3KBX A;  2VQF L;  1PLF A;  2VNU D;  4DXF A;  4GKK Q;  5IWA L;  3FMC A;  4BXX G;  2ATW A;  1SYE A;  3IKJ A;  2OXP A;  1BVS A;  1SYB A;  3SR1 A;  1N34 L;  3GTL H;  1KLG D;  2ZJQ A;  2Q8R E;  3HOW G;  2KJX A;  4UHV A;  2PO4 A;  5ISR A;  1OXV A;  2Z8L A;  4U68 A;  5EGT A;  2BOS A;  1OO9 B;  1TII D;  3K6O A;  1AZP A;  3G6E A;  5FJ8 G;  1HUM A;  1LTR D;  1VQ9 A;  1K0R A;  2JA6 B;  3WWV A;  1N33 L;  1I3Q B;  1B8A A;  3FEW X;  4NXN L;  2N49 A;  1RIP A;  4KKS A;  4LFA Q;  3J80 E;  3I4O A;  1KAW A;  3KLR A;  3SK5 A;  4C3H G;  4DR1 L;  1T9H A;  3WDN A;  3IFT A;  4X65 Q;  4IOA A;  2N3S A;  2B29 A;  2FFK B;  4A3D G;  2JP1 A;  3CCQ A;  3MA2 B;  3NPP A;  2KCM A;  1F9P A;  2KUM A;  5E7N A;  4P73 A;  4JI5 L;  1IKL A;  4GKJ Q;  1E1O A;  4NMZ A;  3V2T A;  4OWW B;  3R8B A;  2HQE A;  5C4X B;  2EY5 A;  3OTO Q;  4GS3 A;  4C2M B;  3BYT B;  4TSS A;  3G71 A;  1E7Z A;  5EKI A;  3GTP H;  3KF6 B;  4QB4 A;  1V1P A;  3ND8 A;  1IZ6 A;  5CMD A;  2WII B;  5L37 A;  2RDF A;  1SYC A;  5LMN W;  3K7U C;  2RKS A;  3T4A C;  3QWN A;  3OWF A;  1D1K A;  3H6M A;  3HFZ B;  5GRO A;  3A5U A;  1EIH A;  3P7J A;  2Q2T A;  2EOT A;  2ZTC A;  1V8Q A;  2ZTE A;  5A2Q E;  1CT1 D;  4KHP L;  2WP8 J;  1CKM A;  1I5F A;  3KOJ A;  1V43 A;  5M3M G;  1P8L A;  3RMH A;  5IYD H;  4L5T A;  1YNN D;  2TSS A;  4C1N K;  2ZXR A;  3GTQ H;  2K04 A;  3FKI G;  2N8N A;  2BDN A;  4A3B B;  2RVL A;  4PMB A;  2ZM6 Q;  2KHJ A;  3MEH A;  4HJ5 A;  2B39 A;  4DNI A;  1GO3 E;  4R1J A;  2Z4H A;  1II3 A;  2OT2 A;  4CDC C;  4X3U A;  3R3O A;  3FP9 A;  2VB3 X;  3TBI B;  1STY A;  4B3T Q;  2MNA A;  1VQH A;  4DV0 L;  5DLQ E;  1GVP A;  3C1F A;  4K2K A;  3SK4 A;  2F0Q A;  1HPC A;  3SE0 A;  4E6I A;  1Q81 C;  2F0E A;  2YTY A;  4Z9C B;  4HJA A;  1GD7 A;  4JI6 Q;  4KKU A;  1CUK A;  4XYO A;  1QZG A;  3F2D A;  2UXC Q;  2M9V A;  4JBJ A;  2Z6B A;  4IPD A;  3ICE A;  5JEA H;  1PH3 A;  1MKH A;  2HD3 A;  1EY5 A;  1STN A;  4A3F H;  5IYC H;  1IL2 A;  4A3E B;  4YHH Q;  3S16 B;  1H9K A;  2O5J C;  1G6Z A;  1WYD A;  4BBS G;  1RF2 D;  5C6A A;  1ASY A;  3I4M H;  3UDX A;  1S72 A;  1OTC A;  2IWH A;  3AYH B;  2UUB Q;  1YNN C;  1STB A;  5H1S E;  1HTP A;  3K5M A;  4EX5 A;  3PIO 3;  1OXT A;  1B3A A;  1LT4 D;  5K36 H;  4RHS A;  2ES2 A;  1GUS A;  4RGN A;  5G3L D;  2MFI A;  4EQO A;  2DJF C;  2DNC A;  1IBM Q;  4A3I H;  3EVQ A;  1V1Q A;  4ZYS A;  1JOR A;  5JJI A;  2JA7 B;  1SJH D;  2K75 A;  4BY1 B;  4RCO A;  4QUC A;  4YWK A;  4LF9 Q;  1LTA D;  2VXW A;  1GUG A;  3HOU B;  1DCZ A;  1KIX A;  1NR2 A;  1RJT A;  1BO0 A;  1TWH B;  1IBL Q;  1JOQ A;  1TS4 A;  2F0N A;  4DAY B;  5IP9 H;  3HG9 A;  4LF8 L;  2MPM A;  4P74 A;  2KVM A;  1Z47 A;  4LFC Q;  2R92 B;  2JJQ A;  2YU9 H;  3S1M H;  2R93 H;  1FL0 A;  1N33 Q;  3ERS X;  3HKS A;  5T1G A;  3CQZ H;  2RCN A;  1PXU A;  2F0P A;  5C4H A;  1RHP A;  4HJ8 A;  3W5O A;  4DR1 Q;  4F7X A;  4QUF A;  5D3I B;  3GTJ B;  2F0T A;  3CU7 A;  4LAA A;  5CGK A;  2B2V C;  4Y7N B;  4B9X A;  2VS1 A;  4FNF A;  1CHQ D;  1SBB B;  1SXT A;  2JA6 G;  2J4X A;  4IUN A;  3VYT A;  4WJ3 M;  2UXB L;  1F9S A;  1NAP A;  4L8J A;  1IBK L;  3CCV A;  1K3B C;  3M7G A;  1S5E D;  3BJU A;  3HRZ C;  3H09 A;  4DXG A;  2IX0 A;  4O2D A;  4LMQ D;  1QIL A;  3RLF A;  3DWQ A;  2YV5 A; 
#chains in the Genus database with same CATH homology
 3NBH B;  1XJV A;  4GOP B;  4GN5 A;  4HJ9 A;  4A3J H;  1YIJ A;  3HOV G;  4BY1 G;  3S1N H;  2KBN A;  2UU9 Q;  1UEB A;  1HR0 W;  1E24 A;  2RHQ B;  2IX1 A;  4JBM A;  2JA8 G;  4Y52 H;  2CFM A;  3ER0 A;  4JBK A;  1W3S A;  1MIU A;  3M4P A;  4DR6 L;  1TWC H;  4A3M G;  4OO1 G;  2UXC L;  5C4X G;  2JA5 G;  3HOY G;  2F52 A;  5C4J H;  2Q2H A;  2PMZ E;  4DV2 Q;  2IT1 A;  3HKZ G;  5M5Y H;  1Z9F A;  2R7Z G;  1XNR Q;  4JI7 Q;  1YJ9 A;  1Q82 C;  2AHO B;  3M4Q A;  4DR2 L;  4JI3 Q;  3T1Y Q;  1JB7 A;  4JC0 A;  3CPW A;  1KRS A;  1FVI A;  2I0Q A;  1C0A A;  3H3V H;  2E8G A;  4HIM A;  4YWL A;  1Y1V H;  1FGU A;  4YHH L;  3CME A;  2CKZ B;  2D0P A;  4GNX C;  4DR3 Q;  1PV4 A;  5HY6 A;  4BBS H;  3S15 H;  3MXN B;  2NN6 G;  4BA2 I;  1PYS B;  1FJG Q;  2OCE A;  1VQL A;  2OWO A;  3U58 A;  1PH9 A;  4A3K H;  4B3S Q;  1EWI A;  1A63 A;  2VY3 A;  1P16 A;  2UUB L;  1VQ6 A;  3F1Z A;  2K14 A;  2Q2U A;  4GLA C;  3NEM A;  5IY0 A;  1I94 L;  4R4T A;  2R7F A;  4P71 A;  1VQD A;  2E5L Q;  2HHH L;  4GOP A;  4J15 A;  3CC7 A;  2UUA Q;  1M90 C;  4JCV E;  4NXM L;  1CKN B;  1SR3 A;  3HKZ E;  4X62 Q;  4K0K L;  4NB3 A;  3U50 C;  4A3L G;  2VL6 A;  1X3E A;  4LUV A;  1EYG A;  1IBM L;  4DV0 Q;  1U0L A;  1YJW A;  4LW1 A;  1A0I A;  4MZ9 A;  3GDE A;  2I5M X;  1GM5 A;  4A3B G;  2VQF Q;  1TWG H;  3E0E A;  1TWA H;  1MJE A;  2I5L X;  3PO2 G;  4GKJ L;  5IWA Q;  2RHS B;  4LF9 L;  4YY3 Q;  4LF7 L;  1UE7 A;  2VUM G;  1UE5 A;  3ULP A;  1XPU A;  2UXD Q;  1KXL A;  3TQY A;  1HZC A;  1V9P A;  3H0G H;  3UE0 A;  4DUY L;  3S2H H;  2PQA B;  1SN8 A;  1IBL L;  3PUZ A;  1Q1B A;  4AQY L;  3H3V I;  3EIV A;  1VQG A;  3CMA A;  4JI0 Q;  2K5V A;  1SMX A;  2LSS A;  1N9W A;  1TWF H;  1X56 A;  3EBE A;  1N34 Q;  3I56 A;  3PCO B;  4LFC L;  3Q8D A;  1BBW A;  1L1O C;  3OYY A;  4KLK A;  3ULJ A;  1YEZ A;  1GKH A;  1XMQ Q;  1K73 C;  1NY4 A;  1VQK A;  2VQE Q;  3U4V A;  4JI4 L;  3I4N H;  4H02 A;  1VQB A;  3J80 c;  2R6G A;  5M3F G;  5IE8 A;  4JBW A;  5LMU L;  1AE3 A;  3E9I A;  4AH6 A;  3CCS A;  1JT8 A;  2OTJ A;  4PZ7 A;  3PO3 G;  4OON A;  1L1O B;  4DV7 Q;  3J80 i;  1CKN A;  4LF5 L;  2JA6 H;  4RMF A;  1I3Q H;  4DV6 Q;  3A0J A;  4LFB L;  4JYA Q;  1C9O A;  3CCU A;  3GD7 A;  4B3M L;  2A8V A;  5HGQ A;  1YVC A;  2PNH A;  1PYB A;  3IRB A;  5GQO A;  2ID0 A;  4NXN Q;  2QGQ A;  1X65 A;  4ALP A;  2YTX A;  4JI2 L;  1EIY B;  1J6Q A;  4A3G H;  2LXJ A;  4A3E G;  4DV3 L;  1X54 A;  1PFS A;  3CCE A;  2N78 A;  3KF8 B;  3I7F A;  2B63 G;  4DUZ Q;  2PQA A;  3PIO A;  1B7Y B;  2F4V Q;  1Y1W H;  4AYB E;  4C3I H;  1HNW L;  2LXK A;  1MJC A;  3HOX H;  2VZA A;  3KJO A;  3HOV H;  3CCL A;  2ZM6 L;  1X3G A;  5M5W H;  5C44 G;  4QJF A;  3UDF A;  4C3J H;  3RZO H;  3TS2 A;  4OX9 L;  3NEL A;  1A62 A;  2ZJR A;  4UY8 C;  4A93 H;  4JI5 Q;  4A76 A;  4GOP C;  1IXR A;  1L2F A;  4PZ8 A;  2A1A A;  2KHI A;  2I5H A;  2PI2 E;  4R4I A;  3RLO A;  3S24 A;  3PF5 A;  4QL5 A;  3HOZ G;  3FHW A;  4A3M H;  4QY7 A;  5C4X H;  1N32 Q;  1LYL A;  1VCI A;  2JA5 H;  4C2M H;  3HOY H;  2WB1 E;  1XTD A;  1E3P A;  2EQS A;  1N8R C;  2E2H H;  1K83 H;  4OXP A;  3UE1 A;  1HNX Q;  2R7Z H;  4DR5 Q;  1N36 L;  4GN3 B;  4DV2 L;  1YI2 A;  3GTO H;  1PH4 A;  1JJG A;  1L1O A;  1OXX K;  1XNR L;  1EFW A;  2JE6 I;  3G4S A;  1E1T A;  2JA7 G;  4JI3 L;  1TXY A;  3T1Y L;  1Y14 B;  3KDF B;  1QVF A;  1AH9 A;  5C0X G;  5ELN A;  1YHQ A;  2CQO A;  4JI6 L;  3HOU G;  4DV1 Q;  1X6O A;  2L15 A;  4DV4 L;  1XPO A;  4DR3 L;  4LUZ A;  4IFD I;  2CCZ A;  5C0X J;  1FJG L;  2IHF A;  3M9B A;  4BA1 I;  1E22 A;  2MO0 A;  4B3S L;  1VQP A;  3J81 c;  2GVB A;  3D31 A;  5GAH C;  1SLJ A;  3H15 A;  2BA0 A;  2R92 G;  3BZK A;  1JE5 A;  4X64 Q;  3JAM c;  2NVX H;  4QQB X;  3CF5 A;  3T1H Q;  3TRZ A;  4QIW E;  4JI8 Q;  3A5Z B;  1Q7Y C;  1EQQ A;  5J3B A;  4BY7 G;  2YV5 A;  1HR0 Q;  4X6A H;  3CCR A;  4GLX A;  4L5R C;  2K50 A;  2AKW B;  4KHZ A;  1Q12 A;  4RG1 A;  4P72 A;  3PIP A;  2E5L L;  3J81 i;  4TQU S;  2UUA L;  4KHP Q;  2UXB Q;  1IBK Q;  3JAM i;  2K52 A;  4A3L H;  1VQF A;  3E9H A;  2HQL A;  4LF6 Q;  2CWA A;  4X62 L;  3M85 A;  3M3Y H;  1JMC A;  1K3R A;  2K5N A;  4PG3 A;  3PUW A;  2QA4 A;  1VQ4 A;  2NVT H;  4OO1 I;  5IYB G;  1J5E Q;  2BA1 A;  2Z6K C;  5IP7 H;  4YCU A;  3F2B A;  4UP7 A;  5IYD G;  3TS0 A;  3PO2 H;  2VQF L;  4LF4 L;  2NVY H;  4DAM A;  1SRO A;  2VUM H;  2VNU D;  2JA9 A;  4GKK Q;  5IWA L;  2FXQ A;  1VQO A;  5BR8 Q;  3S17 H;  4YCV A;  1KC8 C;  4BXX G;  2ATW A;  3KDF A;  1JJ2 A;  5ELO A;  1BBU A;  2B3G A;  3PUY A;  4JI0 L;  1BVS A;  4UPA A;  1KD1 C;  1G29 1;  2NN6 I;  1N34 L;  1D7Q A;  4IO9 A;  3AFP A;  3F8T A;  2MO1 A;  3GTL H;  3PV0 A;  2ZJQ A;  3HOW G;  3I2Z A;  4GLV B;  4HIO A;  4JI1 L;  4IJH A;  1G6P A;  1XMQ L;  1VS0 A;  4GN4 B;  1PH6 A;  2VQE L;  1KQS A;  1OXV A;  5M3F H;  4DR2 Q;  5JJL A;  4JV5 Q;  1NTG A;  4JG2 A;  4XIG S;  3PUV A;  4PMW A;  4X66 Q;  3S1Q H;  5C3E G;  3G6E A;  1OXU A;  3CC4 A;  5FJ8 G;  4DV6 L;  4HJ7 A;  1SRU A;  4LNQ A;  2BH2 A;  2CWP A;  1VQ9 A;  4JYA L;  1K0R A;  4APV A;  4A3C H;  2K5H A;  1EUJ A;  3WWV A;  1N33 L;  4AYB G;  1B8A A;  2OTL A;  1X3F A;  3S16 H;  3KLW A;  4NXN L;  2N49 A;  1RIP A;  3RLN A;  3AFQ A;  4A3E H;  4LFA Q;  4R4Q A;  3I4O A;  3U4Z A;  4DV5 L;  1KAW A;  2JQO A;  1Q46 A;  5JEA G;  3L2P A;  2HHH Q;  2GVA A;  2AWN A;  2GN5 A;  1NE3 A;  4EQ5 A;  4DR1 L;  4POG A;  2B63 H;  1T9H A;  1EIF A;  1YHA A;  2NZO A;  4X65 Q;  4NXM Q;  2WAQ E;  5IYC G;  4A3F G;  2N3S A;  4DR7 Q;  4IOA A;  2RF4 A;  5JEA J;  1H95 A;  2B29 A;  2D62 A;  2Z6K A;  4IPC A;  4A3D G;  5C44 H;  4MTN A;  2WB1 G;  3CCQ A;  3OW2 A;  4BBR G;  1BKB A;  5GAG C;  3I4M G;  4DR4 Q;  2K4K A;  2KCM A;  1QUQ B;  2AMC B;  3D0F A;  4P73 A;  5E7N A;  4R4O A;  4JI5 L;  3HOZ H;  4GKJ Q;  1L0W A;  1E1O A;  4POF A;  5LMN L;  1PHJ A;  1HNZ Q;  3STB D;  4LF7 Q;  1N32 L;  5AJ3 L;  4OWW B;  2HT1 A;  1PH8 A;  1WCM G;  1WI5 A;  3JC6 6;  4UP9 A;  1QVC A;  4XTC S;  3OTO Q;  4GS3 A;  5K36 G;  1HNX L;  1EOV A;  4DR5 L;  2ZJP A;  4IFD J;  1S3O A;  1E7Z A;  3ZJY C;  3G71 A;  1VQM A;  2MQH A;  2JA7 H;  3GTP H;  3KF6 B;  4BY1 H;  5GAE C;  1VQN A;  3KJP A;  1KHI A;  2UUC Q;  2Z0S A;  3W1B A;  4A3I G;  2JA8 H;  1IZ6 A;  5IT9 c;  2UU9 L;  5EAY A;  4LUO A;  2F3I A;  2ASB A;  2H5X A;  1TWH H;  4OWT B;  1SE8 A;  4JOI A;  4DV1 L;  3RNU A;  3K8A A;  4IJL A;  1NMF A;  3M4O H;  3I4N G;  4R4C A;  1YIT A;  4HIK A;  1X9N A;  5LMN W;  4P75 A;  2R92 H;  3K80 C;  3K7U C;  4LF8 Q;  3K81 C;  4DK6 C;  2XTI A;  5IP9 G;  1XMO Q;  3J7A 5;  4BY7 H;  1RL2 A;  1VQJ A;  4JI7 L;  5GRO A;  3HFZ B;  3A5U A;  1D8L A;  4JI8 L;  3PSI A;  2Q2T A;  1QZH A;  2R93 G;  2E2J H;  2HIX A;  2ZTC A;  1LM0 A;  2ZTE A;  1XNQ Q;  4KHP L;  1QUQ A;  3BZC A;  3K7A H;  1YNX A;  1CKM A;  2WP8 J;  1CKO A;  3GTJ H;  1M1K C;  1I5F A;  1YZ6 A;  4LF6 L;  3KOJ A;  5IYB H;  1K8G A;  1V43 A;  1WJJ A;  4Y7N H;  5M3M G;  1VQ5 A;  1P8L A;  4L5S A;  4IFD G;  4LWC A;  1J5E L;  5IYD H;  4L5T A;  1CSP A;  1X55 A;  2Y0S E;  3F2C A;  2JK8 A;  1PH1 A;  2JEA I;  2AWO A;  1LTL A;  1PH5 A;  1VQ7 A;  1C7Y A;  4B3R Q;  1XPR A;  3GTQ H;  3FKI G;  2N8N A;  1Y1W G;  1PH2 A;  4GKK L;  2ZM6 Q;  3HOX G;  2KHJ A;  3KF6 A;  4HJ5 A;  4BXX H;  3GO5 A;  4DNI A;  5BR8 L;  4OX9 Q;  1GO3 E;  4R1J A;  5C0X I;  1Q8K A;  1VQ8 A;  1QVG A;  4ME3 A;  2C35 B;  3LGJ A;  3RN2 A;  1SFO H;  4A93 G;  2NZH A;  3FP9 A;  2DUD A;  3STB C;  3SGI A;  4B3T Q;  3HOW H;  2MNA A;  4QGU A;  3L0O A;  2JEB I;  1VQH A;  4DK3 C;  2EXD A;  1CSQ A;  4DPG A;  4DV0 L;  4A3B H;  1AE2 A;  5DLQ E;  1GVP A;  4PZ6 A;  1N36 Q;  4IPG A;  1UE1 A;  3GTK H;  5FLM G;  3ULL A;  2OQK A;  2EIF A;  2IY5 B;  4L5Q A;  4YY3 L;  1Q81 C;  2UXD L;  3CCM A;  2YTY A;  2YYZ A;  4A3J G;  4JV5 L;  3GTM H;  2IHE A;  3I55 A;  1GD7 A;  1JJC B;  3DLL A;  2WFW A;  4HJA A;  4JI6 Q;  2V1C C;  5C3E H;  4DV4 Q;  1DGS A;  3CP0 A;  1CUK A;  4X66 L;  5FJ8 H;  4DR6 Q;  1QZG A;  3F2D A;  2UXC Q;  1W2B A;  4JBJ A;  2OQ0 A;  4IPD A;  2WAQ G;  3S14 H;  4UP8 A;  1I6H H;  3CPF A;  3ICE A;  3CAM A;  3J81 j;  1VQA A;  3DM3 A;  4NPS A;  3CCJ A;  4C3H H;  1PH3 A;  4LFA L;  4JOI C;  1VQI A;  1MKH A;  1NBW A;  3CD6 A;  3K0X A;  4GNX B;  4AIM A;  3UDI A;  3VDY A;  4A3F H;  5IYC H;  1VQE A;  1Q86 C;  1PA6 A;  4YHH Q;  1IL2 A;  3PO3 H;  4YWM A;  1VQC A;  4X65 L;  1Y1V G;  4OWX B;  4DV7 L;  1WYD A;  4DR7 L;  4A3D H;  3S1R H;  3AEV A;  1LUZ A;  4BBR H;  1ASY A;  4BBS G;  4HID A;  1YHB A;  3I4M H;  2Q2I A;  4YCW A;  3UDX A;  1S72 A;  1OTC A;  1YBY A;  4KI0 A;  3AYH B;  2UUB Q;  3TRE A;  1S40 A;  1UWV A;  4A3K G;  4DR4 L;  2QEX A;  2ALY B;  2ZTD A;  5H1S E;  2E2I H;  1IYJ B;  3G48 A;  5IP7 G;  4EX5 A;  1YJN A;  1I94 Q;  4LF4 Q;  1OXT A;  4FDB A;  1HNZ L;  1EQR A;  1WCM H;  2ES2 A;  1R9T H;  4DUZ L;  4K0K Q;  3OTO L;  2F4V L;  1HJP A;  1Q1E A;  2MFI A;  1HZB A;  4MNO A;  2PI2 A;  1OXS C;  2BH8 A;  4A3I H;  1IBM Q;  4DKA C;  1V1Q A;  1K8A C;  1HH2 P;  2HIV A;  2UUC L;  2YTV A;  3M7N A;  4JI1 Q;  5JJI A;  3TEH B;  2K75 A;  5M5X H;  3CXC A;  4YWK A;  1PH7 A;  1O7I A;  3RR5 A;  4LF9 Q;  3EN2 A;  3GTG H;  1KIX A;  1ASZ A;  3AQQ A;  4DUY Q;  1IBL Q;  1NMG A;  4AQY Q;  3S2D H;  3PUX A;  4DAY B;  4GNX A;  3H0G G;  5IP9 H;  4LF8 L;  3PF4 A;  3CW2 C;  4IOC A;  3B6Y A;  1WOC A;  1U5K A;  4P74 A;  3KYH C;  1XMO L;  1Z47 A;  5GAD C;  4LFC Q;  2JJQ A;  2NVQ H;  2YU9 H;  3S1M H;  2R93 H;  3KFU A;  1I50 H;  2Y0S G;  4O0A A;  1FL0 A;  1G51 A;  4IPH A;  2KEN A;  1N33 Q;  3HOU H;  3UDG A;  3ERS X;  3HKS A;  4JI4 Q;  1XNQ L;  4A3C G;  2A19 A;  3CQZ H;  2RCN A;  5M3M H;  4DV5 Q;  4HJ8 A;  3W5O A;  4DR1 Q;  5LMU Q;  1UE6 A;  3RZD H;  1PVO A;  3A74 A;  5FLX c;  1KRT A;  3RN5 A;  1WFQ A;  1K9M C;  3FKI H;  4LF5 Q;  4WJ4 A;  4X64 L;  2VW9 A;  3W1G A;  2VS1 A;  4B3R L;  3L7Z C;  3T1H L;  4LFB Q;  1HZ9 A;  4TVA B;  2JA6 G;  1HR0 L;  1KL9 A;  4B3M Q;  2R7D A;  2D0O A;  4WJ3 M;  1HZA A;  3PGZ A;  2UXB L;  1IBK L;  4JI2 Q;  5JJK A;  3CCV A;  4A75 A;  3CC2 A;  1A8V A;  2DGY A;  5LMN Q;  1NJI C;  2KCT A;  3MEF A;  5AJ3 Q;  4DV3 Q;  4B3T L;  3J7Z C;  4A3G G;  3NEN A;  3BJU A;  3BU2 A;  4A4I A;  5FLM H;  1HNW Q;  2IX0 A;  2XGT A;  4O2D A;  3RLF A;  1B70 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...