4DAMA

Crystal structure of small single-stranded dna-binding protein from streptomyces coelicolor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
113
Chain Sequence
SMNEIMICAVGNVATTPVFRDLANGPSVRFRLAVTARYWDREKNAWTDGHTNFFTVWANRQLATNASGSLAVGDPVVVQGRLKVRTDVREGQSRTSADIDAVAIGHDLARGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein 1
publication title Structure-function relationships of two paralogous single-stranded DNA-binding proteins from Streptomyces coelicolor: implication of SsbB in chromosome segregation during sporulation.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 20
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4damA00
4O0AA 4IJLA 1YHQA 4JI7Q 2K5NA 2ALYB 1C0AA 5M3MG 1VQAA 3HOZH 4DV1L 2WAQG 5IYBH 4LWCA 2D0PA 4DUZL 1OXUA 5C3EG 2K14A 1WCMG 1EWIA 5M3FH 3F2DA 4OX9Q 4DV2L 5C0XJ 4HJ7A 4IPHA 4BY7G 2NVTH 1KHIA 4OWTB 4NXNQ 3S1QH 1YHAA 2OWOA 2LXJA 3W5OA 3J81j 1S3OA 4UP7A 3CCSA 1J5EL 2HHHL 1Q82C 3A0JA 3HOVH 1BBWA 2UU9L 2KHJA 4A3FG 4LF9Q 3S1RH 2R7DA 5JJKA 1WOCA 1HZ9A 2DUDA 4P75A 4LFCL 4B3RQ 2RHQB 1KRTA 2JA6H 3H0GG 4DR6Q 4XTCS 2I5MX 5ELOA 5JEAG 3M85A 1N36L 2R7ZG 3CC7A 1X3FA 4HIKA 1Y1VG 3T1YL 4LF4Q 1YVCA 2AKWB 3ZJYC 4DR1L 2R7FA 3MEFA 5J3BA 1W2BA 5M3MH 4HJ9A 1VQ5A 3TS0A 1HZBA 1Q81C 2E2HH 4GKJQ 3G71A 2AWOA 2WB1E 1PYBA 2H5XA 5IWAL 4JI0L 3TRZA 2KHIA 3S15H 5K36G 4LF7Q 4BY7H 4OWXB 2YTYA 4OO1G 4DV6L 3STBD 2KBNA 2QGQA 4DAMA 2HIVA 4YWMA 3J81i 3RN5A 4LF8L 3AQQA 1D8LA 2YTXA 5M5WH 3CMEA 1XNQL 1HNZQ 4BBSG 1C9OA 1IZ6A 2RF4A 4ME3A 4JI3L 2F4VQ 1CKNA 1LTLA 1CKNB 4GN5A 3H0GH 3TREA 2Z6KC 2IX1A 4HJ5A 4KI0A 4A76A 1EOVA 3J7A5 1VQCA 5FJ8H 1XPOA 4PZ8A 4X62Q 4JI6Q 4LNQA 5LMNQ 3FP9A 3AYHB 3RZOH 3T1HL 3TEHB 1K0RA 1YJ9A 4HIDA 1LYLA 3RLNA 3AFQA 5IY0A 3D0FA 2ZM6Q 1Q1EA 2A19A 2IX0A 5H1SE 3CXCA 1OXSC 5M5XH 4LFAL 4UPAA 2PQAA 5HGQA 4AQYL 3I2ZA 4A3DH 4GNXA 4A3BH 2E5LQ 3L7ZC 2UUCQ 4C2MH 1TWAH 2I5LX 3EIVA 2VQEQ 1QZGA 4JI7L 3ICEA 2R93G 4OO1I 1HH2P 3PIPA 5IE8A 1XPUA 2NVQH 3CAMA 3KYHC 3CCQA 1PH5A 4LF5Q 3GTGH 4BBSH 2JK8A 4MZ9A 1LUZA 4A3GH 4OX9L 3IRBA 1BVSA 1OXVA 4NXNL 5ELNA 5IP7G 2N49A 4H02A 4DV6Q 1IBLQ 4BA1I 1VQDA 2KCTA 3PO3H 1VQHA 3AEVA 3GD7A 3JAMi 4LUZA 4YWLA 3S1NH 1TXYA 4B3TQ 1S40A 2BA0A 4B3ML 2WFWA 1RIPA 1HZCA 5BR8Q 4C3IH 3I4NG 4DV5Q 4AYBE 3TS2A 4LF9L 1PH4A 3S2HH 4WJ3M 2UUBL 1A63A 4YY3Q 4B3RL 2QEXA 4QIWE 1XJVA 1QZHA 1CUKA 2NVXH 4DR6L 3U50C 1I50H 1WYDA 4LF4L 3KLWA 4IPDA 1Q7YC 1VQKA 2CKZB 2CFMA 3S16H 2R6GA 2JA9A 2NZOA 3HOUG 1S72A 1HR0W 2E2JH 4A3CG 1A8VA 1NE3A 3D31A 4A3EG 4GKJL 3PV0A 3OW2A 1VQOA 1GO3E 3GTMH 4NB3A 5C0XI 4LF7L 1TWCH 4A4IA 1VQ9A 1JE5A 2K5HA 2LXKA 1P8LA 5IP7H 2B63G 3KFUA 1HNWQ 4DV3Q 2UXCQ 4A75A 1SN8A 1UE6A 5IYCH 5GADC 4JG2A 1NY4A 1PV4A 2KCMA 1U5KA 2HQLA 4R4OA 4YWKA 2CWAA 2JEAI 2IT1A 1X65A 1MJEA 1E1TA 1JJCB 3E0EA 2KENA 4QY7A 2VQFQ 1HNZL 4NXMQ 2F4VL 4GKKQ 3CP0A 3PSIA 4O2DA 3I55A 2R92G 4PZ7A 3KJPA 4GOPC 1GM5A 1FVIA 4QQBX 1GVPA 3BJUA 1X56A 2ATWA 2N78A 3UE0A 2MNAA 4X65Q 5IP9G 2VZAA 2Q2TA 4X62L 4JI6L 2GVAA 2JA7H 3CC2A 5LMNL 4HJ8A 4B3MQ 4KLKA 4EX5A 2Z6KA 4LUOA 3ERSX 2UUBQ 1J6QA 1XTDA 2DGYA 3W1GA 2ZM6L 4A3EH 2MFIA 2JA5H 1KIXA 5FLMH 3H15A 1E22A 2BH8A 2VY3A 4FDBA 4YCWA 4DR5Q 4DR4Q 1CSQA 1N34Q 2B63H 1B8AA 2E5LL 2UUCL 3PUZA 2VQEL 1YZ6A 2IHFA 3F8TA 1I94L 2ASBA 3PO2G 1JJ2A 2VL6A 4LF5L 3H3VI 3I4MG 4JI4Q 4BA2I 5C3EH 2K52A 1MIUA 1WCMH 3RLOA 4WJ4A 1KXLA 3KF6B 3J81c 2L15A 4L5QA 1KL9A 1K8AC 2UUAQ 1MKHA 3MXNB 5M5YH 1IBLL 1VQPA 1C7YA 1EIFA 4RG1A 4B3SQ 1CSPA 3UDIA 4DKAC 5IP9H 4JI5Q 4B3TL 2Q2HA 1H95A 1BBUA 2ID0A 1IXRA 2VUMG 1KAWA 5BR8L 4A3FH 4DV5L 1JMCA 4JI8Q 4L5RC 1PH6A 4YY3L 3S2DH 2BA1A 1PH8A 3RN2A 3A5UA 1EUJA 2R7ZH 3GTKH 4GLXA 1TWFH 1Y1VH 2E8GA 4UP9A 2Z0SA 4DV7Q 2ES2A 2UXDQ 1UE7A 1KRSA 3ULPA 4JV5Q 5LMUQ 1I5FA 3PO2H 1BKBA 4LF6Q 1B7YB 1V9PA 2JE6I 4DV4Q 4X64Q 1K8GA 4A3MG 4YHHL 3K0XA 4QGUA 1VS0A 1N32L 2WB1G 1W3SA 1E1OA 4UP8A 4DR3Q 4HIMA 4LUVA 2YU9H 3UDFA 1PH3A 1PFSA 1GKHA 4KHPQ 5GROA 2OCEA 3S1MH 1PA6A 3M9BA 3HKSA 4DV3L 4MTNA 2UXCL 1HNWL 1P16A 1VQEA 4BXXG 2ZTDA 1EQRA 1U0LA 4DK6C 1I94Q 1Z47A 5AJ3Q 4JYAQ 2Y0SE 5C0XG 4QL5A 2OQ0A 4GLAC 3DLLA 3BZCA 3DM3A 2VQFL 1NBWA 1IBKQ 4NXML 2JEBI 2K4KA 4GKKL 3U4ZA 1UE1A 3E9IA 4DK3C 2YYZA 4BY1G 3M4PA 4A93G 3HOYG 1YBYA 1GD7A 2B29A 3HKZE 3J80c 1HR0Q 4RMFA 4X65L 3CCEA 4A3JG 4L5SA 3KF8B 2D0OA 2PI2A 1AH9A 3ER0A 2ZJQA 1X54A 3S24A 1YIJA 1Y1WG 3GTQH 1KD1C 4JI1Q 4GOPA 5JJIA 2JJQA 3CPWA 1XMOQ 2LSSA 1HNXQ 1YEZA 1FJGQ 4A3KG 4PZ6A 3CD6A 2ZJPA 3AFPA 4K0KQ 4GOPB 5IYDG 3KJOA 3K81C 4C3HH 3CF5A 1DGSA 2HT1A 1G6PA 3I56A 1IYJB 4P71A 4DR5L 4DR4L 4JOIC 4IOCA 1NMFA 5LMNW 1N34L 5C4XG 1QUQB 1RL2A 1SRUA 1UEBA 3WWVA 4P72A 2R93H 4TVAB 2JA8G 4JBMA 4IFDJ 3F1ZA 1A62A 3F2BA 3CMAA 4JI4L 4YHHQ 1VQBA 3HOZG 2WAQE 5IYBG 1N32Q 3HFZB 3FKIG 4IJHA 3J7ZC 3PF5A 1X9NA 3CQZH 1B70B 4BY1H 5M3FG 2D62A 4X66Q 3CCRA 3HOYH 2UUAL 3KOJA 3NENA 3W1BA 3S14H 5E7NA 2CQOA 4JI5L 4A3JH 4B3SL 1NMGA 1N33Q 1XNRQ 3L0OA 3HOWG 3PUXA 1EYGA 3A5ZB 4PG3A 3GTJH 4AIMA 1PHJA 2F52A 1OXTA 1YNXA 2JA8H 3ULLA 3RR5A 2GVBA 2HIXA 1AE2A 2AWNA 1VQMA 3HOVG 2I5HA 3I4NH 4X6AH 4AYBG 1XPRA 4JI8L 1JT8A 3PUVA 4JBWA 2K75A 1YI2A 1OTCA 1L1OC 1SFOH 3STBC 1KC8C 3M4QA 4APVA 3B6YA 4GLVB 1PH1A 4L5TA 2JA6G 2IY5B 1KQSA 3G48A 5C4XH 3K8AA 2Q2IA 3PCOB 3PUWA 4DV7L 2UXDL 4DR2Q 1Y14B 5IT9c 5FLXc 1Q12A 4TQUS 3HOXG 1R9TH 1G51A 4JV5L 5LMUL 4UY8C 1HJPA 3HOUH 1X3EA 3CCLA 4LF6L 3NELA 4X64L 2F3IA 4DV4L 4A3CH 4P73A 3SGIA 4DV0Q 1CKMA 3FKIH 4DR3L 4LFBQ 2A1AA 4KHPL 1QVCA 4OONA 3CCJA 2CCZA 1EQQA 3H3VH 3K80C 1E24A 2PI2E 3NBHB 1L0WA 2NN6G 3HOWH 3VDYA 3OTOQ 3CPFA 3EBEA 2RHSB 1K3RA 5AJ3L 4JYAL 1X3GA 3KDFA 3BU2A 3KF6A 2GN5A 1IBKL 1LM0A 3JC66 3KDFB 3GTPH 1PVOA 2I0QA 1UWVA 3OYYA 1YJNA 2R92H 1N9WA 4DNIA 4Y7NH 3PIOA 1ASZA 2OQKA 1HR0L 5GAEC 5C44G 4DUYL 1VQLA 1FGUA 3HOXH 4NPSA 5FJ8G 2C35B 4AH6A 2MO1A 1VCIA 2N3SA 4JI1L 2QA4A 4ALPA 1TWGH 1XMOL 4K0KL 1HNXL 1WJJA 1Q46A 1FJGL 3PF4A 4JC0A 3I7FA 1PH2A 3M4OH 1CKOA 1K9MC 2VW9A 3M7NA 1WI5A 1YHBA 2ZTEA 3GTLH 2VS1A 3LGJA 3NEMA 4HIOA 3RNUA 2YV5A 5GQOA 1X6OA 3G4SA 1SE8A 1X55A 1VQNA 1IBMQ 4IFDG 2XGTA 1Q1BA 2UXBQ 2CWPA 4P74A 1VQ6A 4A3DG 3TQYA 3RLFA 1VQ7A 3G6EA 1XMQQ 2EQSA 2YTVA 4A3BG 3FHWA 4DR7Q 1JJGA 1FL0A 2FXQA 3I4MH 2NN6I 4R4TA 4JOIA 4DV1Q 2N8NA 1Z9FA 4DUZQ 1TWHH 3UDGA 3RZDH 4X66L 4A3GG 4DV2Q 3UE1A 2JQOA 2K50A 3K7UC 1QVFA 1L2FA 3CCUA 2RCNA 1VQGA 2IHEA 5HY6A 4JI2L 1QVGA 5C44H 4JBJA 1UE5A 1N33L 1XNRL 3PO3G 2XTIA 4YCVA 5JJLA 2PNHA 4GN3B 4DPGA 3L2PA 1J5EQ 2AHOB 2HHHQ 1AE3A 3CC4A 1VQFA 1Q86C 4A3IG 2VUMH 4R4QA 4DAYB 2UU9Q 4IPGA 1VQIA 4OWWB 3JAMc 3GDEA 4A3LG 4GN4B 2V1CC 4EQ5A 2OTJA 4LFCQ 2OTLA 2WP8J 4BBRG 1HZAA 4R4CA 1N36Q 4DUYQ 2K5VA 1JB7A 1YITA 1E3PA 4DR2L 4POGA 1V1QA 3T1YQ 4IO9A 3GTOH 1K83H 4Y52H 4MNOA 2PQAB 3EN2A 5JEAJ 1MJCA 1SMXA 4DR1Q 1L1OA 4IFDI 1N8RC 4PMWA 4GNXB 4A3MH 1SLJA 4QJFA 1IL2A 4IOAA 1L1OB 1NTGA 1T9HA 4C3JH 4DV0L 1O7IA 3Q8DA 4XIGS 4J15A 5GAGC 1G291 1QUQA 1PH7A 1WFQA 5IWAQ 1M1KC 2Q2UA 4JI0Q 1I6HH 1PYSB 2NZHA 2ZJRA 2BH2A 4BXXH 2VNUD 3U58A 2E2IH 3OTOL 4KHZA 4R1JA 5IYCG 3S17H 5EAYA 4LF8Q 4LW1A 4YCUA 2Y0SG 2ZTCA 4A3IH 3J80i 1XNQQ 3ULJA 4GS3A 2EIFA 3F2CA 2B3GA 1K73C 1E7ZA 4JI3Q 4A3LH 4POFA 4A93H 3BZKA 1M90C 1NJIC 3M3YH 1D7QA 3HKZG 1I3QH 4BBRH 3A74A 4JI2Q 2MO0A 3I4OA 2MQHA 1YJWA 4OXPA 3CCMA 2EXDA 1VQ8A 3PUYA 1Y1WH 2JA7G 5C4JH 2PMZE 4JCVE 4R4IA 1A0IA 4A3KH 1PH9A 5DLQE 3T1HQ 5IYDH 4GNXC 3U4VA 1VQJA 1OXXK 4IPCA 1SROA 1VQ4A 4LFBL 3CW2C 3PGZA 2JA5G 4DR7L 1EIYB 3E9HA 3K7AH 4LFAQ 5FLMG 5GAHC 2AMCB 3GO5A 3CCVA 2NVYH 1IBML 1EFWA 2UXBL 4AQYQ 2A8VA 1Q8KA 1ASYA 1SR3A 1V43A 3UDXA 4HJAA 1XMQL 4JBKA
chains in the Genus database with same CATH superfamily
4O0AA 4JI7Q 1Y8OB 2ALYB 3DHQA 2KVMA 4F88A 5I2YA 1C0AA 2WAQG 4DUZL 2D9UA 3NHHA 5C4JB 1WCMG 5M3FH 4HJ7A 3NBHA 2PZWA 2NVTH 4CDDC 4NXNQ 4H44C 2B2TA 2LXJA 5CV8A 4BWGB 2HHHL 5T1IA 2Z4HA 2F0KA 2FMCA 5JJKA 1HZ9A 4JW0A 4B3RQ 1KRTA 2QDLA 4UDUC 2Z4IA 4HIKA 1QNUA 1GUGA 1YNND 5M3MH 3TS0A 2SNMA 2H4OA 4GKJQ 3T4AC 2AWOA 2L0CA 3PIP3 3TRZA 4FF3A 3OPOA 1HA6A 2KHIA 2NUCA 4LF7Q 4BY7H 3MHBA 1LACA 3A8IE 1ZKOA 3S1RB 4ZCKA 4LF8L 3J81i 1D8LA 3N52A 3HP3A 3E5SA 1ENAA 2CQAA 1C9OA 4ME3A 3KLRA 3TREA 1RJTA 3N6RA 4QCLA 3R2TA 5KIXA 2ZXOA 5IOCA 5L37A 5FJ8H 1XPOA 4JI6Q 1AZPA 3FP9A 1SBBB 1D5ZC 3AYHB 3A8JE 1K8OA 3TEHB 4O1NA 1S5CD 4HIDA 3RLNA 2ZM6Q 1Q1EA 2A19A 2IX0A 3OWFA 4LFAL 4DK1A 5IGFA 4IFDH 2CW0D 3I2ZA 1EYDA 2E5LQ 4C2MH 2EYMA 3EIVA 1QZGA 3ICEA 1AP0A 4JI7L 1K0SA 4OO1I 1LTTD 3LWEA 2WINB 3CAMA 3KYHC 4LF5Q 3GTGH 1BVSA 1OXVA 3RMHA 4NXNL 4HAEA 2D2CC 5IP7G 1IBLQ 1GHKA 4BA1I 1VQDA 1S5FD 1VQHA 4LUZA 1TXYA 1S40A 2YU9B 4B08A 4A3DB 3SK4A 1WTHA 3I4NG 1MD2D 1B4OA 4HSVA 4B3RL 2QEXA 5JPMC 1CUKA 3VYRA 4BBSB 1WYDA 1HTLD 1WD0A 2X69A 3KLWA 4IPDA 2CKZB 2CFMA 1ET6A 2JA9A 1HR0W 3D31A 3MXUA 1T5EA 4GKJL 4WFN3 3T53B 3R2IA 4NB3A 5C0XI 5IIFA 4LF7L 3QWNA 1SN8A 1UE6A 4KD3A 4R4OA 4WORA 2IT1A 1QG7A 1E1TA 2F0HA 3E0EA 2KENA 4NXMQ 1QB5D 1G2SA 4RCOA 3CP0A 4O2DA 4ZUIA 1GM5A 1OO9B 1WTXA 4JI6L 3R3OA 4OELB 3CRKC 3NTHA 4NW2A 3MXPA 3L3OC 5C3WA 2UUBQ 1J6QA 2DGYA 2Y0SB 2ZM6L 2MFIA 3BDCA 4K8JA 1AN8A 4J8QA 1KIXA 1KNEA 2JSOA 2X6GA 2BH8A 3NPPA 4YCWA 4DR5Q 4DR4Q 2F0MA 2E5LL 1HRJA 1YZ6A 2ASBA 3PO2G 1JJ2A 4LF5L 3I4MG 4JI4Q 2K52A 3QO2A 1GOZA 4WJ4A 1KXLA 3MXNA 3J81c 2R3ZA 2E74C 1K8AC 4A3EB 1IBLL 2A69C 1EIFA 2CH4A 2K03A 3UDIA 4B3SQ 4DKAC 5E1FA 2Q2HA 4HR7B 4ZYSA 1KAWA 4UAIA 2B63B 2TMPA 4JI8Q 1PH6A 1EY4A 2AUJD 3H09A 1F2MA 2WAQB 2CVRA 3RN2A 1XYIA 5JEAH 2EXZA 1Y1VH 2E8GA 1Y69U 4LJZC 1A15A 3TZDA 1KRSA 1BKBA 2RA4A 5CV5A 1A2UA 1STNA 1N32L 1W3SA 4UP8A 3FRPB 5K36H 1D1KA 2YU9H 2OCEA 5CYUA 3S1MH 4K6DA 4MTNA 4ABNA 2ZTDA 2ENBA 3MFGA 4ZRZA 5C0XG 2MPMA 2EJGC 4GLAC 4NXML 1IBKQ 1NBWA 4RWSC 2JEBI 1CT1D 1UE1A 3MC0B 3HOYG 1GD7A 3J80c 3RUZA 4KY7A 1LTID 3S24A 1YIJA 1KD1C 2K5WA 4JI1Q 5JJIA 2JJQA 3CPWA 1DONA 4A3KG 2ZJPA 3AFPA 4GOPB 3MXGA 3BVGA 4QMGA 1DGSA 4CDFC 4KN7C 2PCFB 1M8AA 1PTOB 3BYTB 4DR5L 4DR4L 4MTKA 4QUFA 5LMNW 3V96A 3NQTA 1J9OA 1RL2A 1SRUA 4IFDJ 3F1ZA 4JI4L 3TZUA 1BR9A 3CU7A 3HFZB 2IW3A 1X9NA 3CQZH 4BY1H 2AQ3B 3A7AB 3I90A 4KKTA 5M3FG 4FVMA 1CM9A 1R4QB 4B3SL 4FYDA 3TMEA 3NWSA 3L0OA 3A5ZB 4G7ZC 3RR5A 4HCEA 1AE2A 4K6LA 4AYBG 4JI8L 3PUVA 4JBWA 1YI2A 4XT3B 1L1OC 1KC8C 4APVA 1PH1A 2AUKA 1PDQA 1PTOC 1BCPF 2L1BA 5ISRA 4DR2Q 3Q6SA 5FLXc 4IALA 3HOXG 5CV9A 3QB3A 1HXYD 1I3QB 2DN8A 3NELA 2L5TA 4P73A 2HDLA 3SGIA 4DV0Q 1E0BA 1GXDC 3I4NB 4TKOB 4OONA 3TP8A 5E4WC 3H3VH 3K80C 1E24A 2PI2E 1SFOB 1L0WA 3CPFA 3EBEA 3KDFA 3BU2A 2GN5A 1IBKL 1CI3M 3JC66 4DNTB 5CR3A 5FO7B 2KECA 2JA8B 1N9WA 2EY5A 4M8AA 1IYUA 3PIOA 1JCKB 3HOZB 1DOKA 3T56B 1Q90A 1G91A 5FJ8G 2N3SA 4JI1L 4CJ2C 1Q46A 1TS4A 3I7FA 3HOWB 3M4OH 2BOSA 1JE4A 3GTLH 1RKNA 3KLSA 2FJ2A 3GTPB 3FPUB 1X55A 4IFDG 5J22A 1F2ZA 2JYOA 4Y7NB 3RLFA 5EPLA 3G6EA 1XMQQ 2YTVA 1CFMA 2PMZB 3Q22A 1TWGB 4G7OC 2LY7A 2K50A 3UE1A 3CCUA 2RSOA 2RCNA 2F0WA 1VQGA 2IHEA 2Z9HA 1QVGA 5C44H 3I72A 3OWEB 4GN3B 5EKKA 4DPGA 3L2PA 4A3IG 1PTOH 1PXUA 4KJNA 2BE5C 4DAYB 4IPGA 3G6JB 3C3LA 3I91A 3JAMc 3GDEA 1IHZA 2NB0A 3I4MB 2OTJA 2WIIB 3SXHA 2WP8J 1N36Q 1GUTA 3VA7A 4DR2L 3RZDB 4POGA 5ELEA 5AFWA 1V1QA 2RSNA 4MNOA 2PQAB 4RH6A 5JEAJ 1MJCA 1SMXA 1L1OA 1N8RC 3HG9A 4GNXB 1KDBA 1PRTD 1IL2A 1NTGA 1T9HA 3D4WA 4DV0L 4XIGS 3MFYA 1G291 1M1KC 3LNNA 1PYSB 2ZJRA 3ONAB 3R8BA 4R1JA 5M5XB 5EAYA 4LW1A 1F2YA 4RKBA 1XNQQ 2Z8LA 1DJRD 4GS3A 3ULJA 4A3BB 2EJFC 1WD1A 2N88A 4JK1C 4N8X1 1NJIC 1EQVA 1I3QH 3C2PA 2IX3A 3J80L 2QILA 4A3GB 1IKMA 1A0IA 5EGTA 5IYDH 4GNXC 1Q8IA 3S17B 4IPCA 3IAYA 4I7ZC 1EIYB 3K7AH 3GO5A 1NCVA 1EFWA 3DUZA 1ASYA 4JBKA 4B9WA 3UDXA 1XMQL 3M3YB 2JA8H 4CDCC 1AW7A 3IFDA 3HOZH 4LWCA 1I4RA 2B2UC 4OX9Q 3SK6A 4R8NA 1LT3D 5HGTA 3W5OA 2F0OA 4UP7A 3CCSA 3SDZA 2NVYB 2K6AA 3A0JA 1Q82C 1VF7A 1T5XD 5T1GA 4FP5D 3E3XA 2DUDA 1BF4A 2EYHA 5JEAG 1VF5C 5ELOA 3M85A 1N36L 5M3FB 1Y1VG 4XXEA 5FLXL 3HKZB 2NVTB 2C5CA 3V2TA 4PMCA 5EKIA 5KRUA 4HJ9A 1VQ5A 1HZBA 2JA7B 1Q81C 1DM0B 1PMRA 5K36G 3A54A 2YTYA 4PQXA 2E75C 5D3IB 1JWMD 1TVXA 3EQLC 4ILWA 2QGQA 2HIVA 2KCNA 4I65A 1XNQL 3K57A 1SXTA 4BBSG 2RF4A 5CMDA 1E2ZA 5M3MB 3VA5A 4GN5A 1SYEA 3H0GH 2JP1A 3D4RA 2IX1A 4ZQ3A 4DAYA 3SK8A 1EY8A 4OIJA 4BY7B 2B2YC 5LMNQ 1LYLA 5IY0A 1IW7D 3D0FA 1SE3A 1WTVA 1OXSC 5M5XH 2PQAA 5D14A 4CKEA 4GNXA 4A3BH 1GHJA 4RAUC 1H9RA 1TWAH 2G5DA 4R8IA 1HH2P 3ERQA 4F8MA 5IE8A 3PIPA 1XPUA 2RQXA 3CCQA 1ICWA 4MZ9A 4A3GH 4OX9L 4LK1C 1W6KA 1QILA 2EPBA 1STHA 1HQRD 1ZEQX 2IL8A 3W2DA 3VR3A 3PO3H 1RHPA 3Q0AA 3AEVA 2B2UA 4YWLA 4ZAIA 1KABA 4Z9CB 2WFWA 1I6HH 4C3IH 3S2HH 4DV5Q 4C2MB 2MUYA 4K5WA 4IUPA 1MHWC 3JAML 2NVXH 3GTGB 1I50H 5D65A 2DY7A 2NBFA 1II3A 2R6GA 2NZOA 3U9OA 2EJMA 1S72A 2E2JH 1A8VA 1SEBD 4A3EG 5KNBA 2QDBA 3MA2B 2CH4W 3GTMH 4FF4A 1TWCH 1JE5A 2K5HA 2B63G 1MSHA 3KFUA 2UXCQ 1PZJD 3P7JA 3TSSA 2F0LA 3QIAA 1U5KA 2HQLA 4N8FA 1X65A 1JJCB 4GKKQ 4RCNA 3TP5A 3OIQA 4KN4C 1Y8PB 4NP5A 3UE0A 5IP9G 2F0NA 2VZAA 2JA7H 3CC2A 5LMNL 2HCIA 1BCPC 2EE1A 1IYVA 4EX5A 5C5MA 3ERSX 3W1GA 2JA5H 5C4ZA 3G7LA 1WTRA 1ML0D 2B2YA 3I73A 3GV3A 5A2QE 5LHY1 1C48A 2IWHA 5KYIA 1EFID 1CZWA 2IHFA 1I94L 2Q8IB 4XQJA 3FVQA 4BA2I 1GUWA 3KF6B 4MIUA 4L5QA 2UUAQ 3MXNB 4RG1A 4JI5Q 1CSPA 2PNRC 2K33A 1L0XB 1H95A 2RVLA 1IXRA 2M00A 3NQIA 2G9HD 4DV5L 4HMIA 1FNWA 4Q0FA 1SNPA 3A5UA 4RHRA 4GLXA 3J80E 2Z0SA 4DV7Q 2UXDQ 2KA7A 2QW7A 3ULPA 2NYZD 4JV5Q 5LMUQ 4OGQC 1G8ZD 1B7YB 1BQQT 4YHHL 3D6WA 3K0XA 2WB1G 3BDLA 1E1OA 4XQQA 4HIMA 4LUVA 1L0YB 4KHPQ 4PV1C 2UXCL 3M9BA 3GV6A 1HTPA 4H7BA 4DK6C 1Y1VB 2PQEA 3SHLA 2Y0SE 4JYAQ 4DU9A 3DLLA 4GKKL 1EY6A 2K4KA 3D3RA 1DD2A 4QUCA 3WDNA 3D8GA 1QE6A 2B29A 3KF8A 5EKLA 1CQFA 1QWYA 4KJOA 1AH9A 1XTCD 1B44D 3S1MB 1ILPA 2LSSA 3SR1A 3CD6A 1JB3A 4PZ6A 4X3UA 5IYDG 1MGSA 3K81C 1LTBD 4C3HH 3KJOA 1EWHA 1YNJD 3I3CA 1PYWD 3I56A 2HT1A 4RKLA 1G6PA 2A68D 4JOIC 1NMFA 1GUNA 3WWVA 3NWTA 2SOBA 2JA8G 3LWUA 4JBMA 2QCPX 1A62A 1EU4A 3KK7A 3F2BA 4CBVA 2EZVA 1VQBA 1NR4A 2WAQE 1EZ8A 4IUNA 1V1PB 3HOZG 1N32Q 3J7ZC 1B70B 1RTNA 1C8CA 4X66Q 2UUAL 3MEHA 3NENA 3S14H 4IQZA 1WTPA 2J4XA 4JI5L 4F7XA 3DEOA 4A3JH 1N33Q 3HOWG 5F2DA 4PG3A 3A55A 2TSSA 1OXTA 1YNXA 2AWNA 5DAUA 2I5HA 5D3DA 1XPRA 2K75A 3M4QA 3OMGA 3TBIB 4G57A 5C4XH 3K8AA 5KNCA 2F4IA 2Q2IA 3CQZB 4DV7L 3J7YW 4BY1B 2UXDL 1Y14B 4HTHA 5IT9c 4TQUS 2F03A 1G51A 4L63B 5LMUL 4JV5L 1HJPA 1NUCA 1EEFD 1SNQA 1U4MA 4IUTA 1ZYRC 3FKIH 2A6ED 4OEMB 3DMUA 4KHPL 1QVCA 3BG3A 4IURA 1EQQA 1JOOA 3PQIA 3HZXA 1PLFA 2RHSB 1K3RA 4NKLA 1PFNA 4JYAL 1X3QA 2DJGC 3KF6A 1Z6HA 3KDFB 5JVG3 2I0QA 1UWVA 3OYYA 1YJNA 2R92H 1HUMA 3OMCA 1S5ED 1QNKA 4DUYL 4DA2A 1EY5A 2C35B 2MO1A 5JAVA 4ALPA 1SMYC 3PF4A 4JC0A 4TSSA 2EYLA 3MWYW 1F77A 1WI5A 3NBIA 2M9VA 3A8KE 3NEMA 3JAME 3SE0A 2F0JA 5GQOA 3G4SA 1XX8A 5A35A 1U4PA 2L55A 2UXBQ 2CWPA 1VQ6A 3NSWA 2DNEA 5JVH3 3FDTA 4A3BG 1B53A 1H9KA 2JA6B 4FF2A 1FL0A 2FXQA 2GA4B 1LTAD 2K7VA 4JOIA 4DV1Q 2AQ1B 1RTOA 2OF1A 4X3SA 3UDGA 1SYBA 4A3GG 4X66L 5C5LA 1QVFA 3M4OB 5HY6A 1N33L 3PO3G 3HRZC 3GTLB 2XTIA 1JICA 4ID6A 2AHOB 3CC4A 1VQFA 4R4QA 2IJ0A 3TN2A 2UU9Q 4C3IG 3H3VC 2V1CC 4EQ5A 4LFCQ 4UHVA 5M5WB 2PZTA 3D6CA 1JB7A 2A6HD 1G2TA 2BDNA 1K28A 3DEPA 4IFDI 5C44B 3NXWA 4A3MH 2K04A 3H91A 4ME5A 1L1OB 1W6JA 2F0IA 4QJFA 3VR4A 4C3JH 3IKJA 5GAGC 1PH7A 1B9MA 4ZLTF 2NZHA 3K5OA 3R93A 4BXXH 1IL8A 2ZT9C 4CJ0B 1V1PA 1EEID 1STBA 1BXTA 1S4ZA 2FHTA 3F2CA 4JI3Q 4A3LH 4POFA 3BZKA 2M2LA 5TSSA 1D7QA 3HKZG 2Q8TA 3SEBA 4BBRH 2NVQB 2WB1B 2EYOA 1H9SA 1YNNC 3I4OA 2MQHA 4DK0A 4OXPA 1YJWA 1O7YA 2JA7G 3P1HA 2PMZE 5DLQE 3U4VA 5E4XA 1VQ4A 2B8FA 2R61A 3CW2C 3PGZA 3C1EA 4FXKC 3BS1A 2JA5G 5EPJA 3E9HA 3QOLA 2AMCB 3LX0A 3CCVA 2UXBL 2A8VA 5IGEA 1Q8KA 1HCZA 1V43A 4HJAA 3M4YA 1YHQA 2K5NA 1LT6D 5M3MG 4DV1L 5IYBH 4CDEC 2D0PA 1OXUA 2K14A 1EWIA 3F2DA 3S16B 4IPHA 4BY7G 4X3KA 1KHIA 3VYUA 3T51B 3S1QH 1B2TA 1E2VA 2OWOA 1EWCA 1G6ZA 5EBCA 3K7AB 2LS01 3D4DA 3HOVH 4ZUJA 1BBWA 2UU9L 2KHJA 1EZ6A 4G4KA 1X3PA 2CW0C 2R7DA 2F0QA 1HQMC 4LFCL 1TIID 1PRTF 4WRDA 4IUQA 2JA6H 1S5DD 3EROA 4XTCS 2I5MX 3NP8A 3CC7A 1X3FA 2O2LD 5C3XA 5IGGA 3K5LA 1XWEA 4LF4Q 2IPKD 1DOLA 2HQEA 1YVCA 5IT9L 3ZJYC 2R7FA 1A6XA 1MSGA 3MEFA 3W3AA 5J3BA 1W2BA 1ENCA 4FXDA 3G71A 3S15H 1FNUA 4OWXB 4QIWB 5CGKA 2F0GA 2NN6H 3STBD 4FXGC 1DXMA 4HCSA 4DAMA 4DV6L 1QJOA 4YWMA 3RN5A 4CKBA 5M5WH 3CMEA 2JXMB 1EU3A 1IZ6A 4JI3L 1CKNA 4K5VA 4V190 4QF4A 3J81L 1LTLA 5G3LD 5C3EB 2EY6A 3M7GA 5ELCA 2KEDA 3J7A5 1VQCA 4PZ8A 4X62Q 3NTIA 1K0RA 1DCZA 1CHQD 3AFQA 4C3HG 2X6LA 3VYTA 3OSOA 4UPAA 4A3FB 2UUCQ 3L7ZC 2O4XA 2I5LX 3H0GB 1VDZA 2R7ZB 3BVZA 2NVQH 2O5JC 1LUZA 1KLGD 1MI2A 3O13A 4HSPA 1I4XA 4IUUA 2K1BA 2KOLA 1ILQA 3C1FA 2J0TD 3HGBA 5ELNA 4H02A 2KJXA 2PW7A 3Q23A 2KCTA 3GD7A 4B3TQ 2XVSA 2BA0A 4B3ML 1ICFB 1BO0A 1HZCA 1LV9A 3GQBA 5BR8Q 1TS3A 4AYBE 2FMMA 1TWAB 2KHSA 3WOFA 4WJ3M 5BN4A 1A63A 1XJVA 1QZHA 3WOEA 4LF4L 5I6YA 3QG1A 5FKAC 1TKWB 1IKLA 3S16H 1F9QA 5CV7A 3PO3B 1ONLA 3VR5A 3E0JA 4V0BA 1V1OA 1NE3A 4HMJA 3PV0A 3MVVA 1GO3E 2F0FA 1I6HB 1GUOA 4C3IB 3S2HB 3V05A 4A4IA 2BDOA 4H0LC 1VQ9A 2F0DA 5IP7H 1HNWQ 2B2VC 4CKCA 2NVXB 2K28A 1O7LA 1PV4A 2KCMA 1I50B 1EYAA 1D2BA 5IGBA 2JEAI 1MJEA 4QY7A 1EIGA 2EYJA 4N9TA 3PSIA 3I55A 2R92G 5EQ0A 1FVIA 4DXFA 4QQBX 2E2JB 3BJUA 1X56A 2VB3X 1NNXA 2MNAA 4X65Q 3OHXC 3GTMB 3EA6A 4OIKA 4X62L 3K5MA 1TWCB 4LAAA 1NAPA 3NTKA 3ND9A 3H15A 2I07B 2RDGA 2VY3A 1D5MC 1CSQA 1UNSA 1B8AA 2UUCL 3Q24A 2L11A 4IZ8A 3H3VI 1TY2A 5C3EH 1XXGA 2K05A 3RLOA 2RDHA 3T16A 3X3NA 1A3TA 1KL9A 4P2CB 5HURA 2LKVA 2JA5B 1C7YA 2ICEC 4B3TL 1TT2A 2ID0A 1I4GA 5BR8L 4A3FH 3KBGA 4L5RC 3S2DH 2BA1A 2MGSA 1PH8A 2R7ZH 3GTKH 1TWFH 3BYYB 3DXJC 2ES2A 4DF7A 1UE7A 1JOKA 1Z7TA 1BUVT 3PO2H 1V9PA 1STYA 2JE6I 4DV4Q 4X64Q 4A3MG 1SYDA 4QGUA 4C3JG 4C56C 2XSCA 4EVOA 4DR3Q 1I6VC 4XYOA 5BN3A 1PH3A 4DXGA 4H13C 4OO1H 1PA6A 1HNWL 3HKSA 3E6ZX 1P16A 1VQEA 4BXXG 1EQRA 1H9JA 1U0LA 4HN7A 1I94Q 1SE4A 1TY0A 3PMFA 1Z47A 2EOTA 1FR3A 4QL5A 4U68A 4FNFA 2OQ0A 5I6WA 1F9SA 3BZCA 3DM3A 3U4ZA 1EIHA 2B2VA 3E9IA 2BCOA 2YYZA 4BY1G 4JPBW 1GJXA 1YBYA 4U673 1CHPD 4RMFA 4X65L 1D1IA 1I4HA 3KF8B 2PI2A 3ER0A 3GTQH 1X54A 3NE5B 3SVMA 4K0KQ 2A69D 1FJGQ 1JQYD 4B9XA 5CORA 4P71A 4J1MA 1BCPB 5IGDA 1AZQA 4P72A 2R93H 4TVAB 2RCFA 5C0XH 1X32A 2WKCA 4YHHQ 3ND8A 5IYBG 3GTOB 3FPPA 1RCVD 3HOYH 3OIPA 3W1BA 2CQOA 4C3HB 3T13A 4DGZA 1NMGA 1LT4D 3PUXA 3GTJH 4AIMA 1PHJA 5C6AA 1NR2A 2F52A 3ULLA 1VQMA 2EY2A 3AU7A 3HOVG 4X6AH 3K58A 1JT8A 2E2IB 2N55A 3STBC 3B6YA 4GLVB 3J81E 2JA6G 1PRTB 2B8GA 2CHBD 4KHVA 3PUWA 1R9TH 1Q12A 4A93B 1I4QA 2NTSA 4ULLA 4UY8C 3S14B 1DOMA 3HOUH 1X3EA 3CCLA 2DJFC 1EQTA 1SYGA 4A3JB 4DV4L 4X64L 2F3IA 4A3CH 1Y1WB 2PZUA 4DR3L 2LMCB 3MTSA 1ENFA 2A1AA 1JWSD 1JOQA 2CCZA 1ESFA 2NN6G 1X3GA 5C4XB 2Q8RE 5LL6X 3HEJA 1PVOA 4DN4M 1TS2A 4DNIA 1ASZA 2LFNA 3URYA 5GAEC 1E2WA 3FKIB 5C44G 1PRTC 5FO8B 4DAPA 1VQLA 1FGUA 3HOXH 4K0KL 1CQVA 1FJGL 4MN3A 2ICIA 1CKOA 1K9MC 2RDFA 2ZTEA 3TP6A 2ZXRA 2VS1A 3LGJA 4HIOA 3RNUA 3C46A 1IBMQ 2R92B 5KEEA 4P74A 1VQ7A 1KTKA 2OT2A 3DWAA 4IUVA 3FHWA 4KMUC 1JJGA 2RKSA 4K5XA 1PTOD 2XRSD 4R4TA 1S5BD 1SAPA 1TWHH 5C4HA 4DV2Q 2EYPA 3K7UC 5K5PA 3CKIB 1MBYA 1TU2B 1VMCA 4JI2L 3L9AX 1UE5A 4JBJA 2KCCA 2E2HB 4YCVA 1J5EQ 4QB4A 2VUMH 1AE3A 1B3AA 2B2WC 2WACA 2HUGA 3IFTA 4GN4B 4EQPA 2I46A 2OTLA 4Q5VA 4R4CA 4DUYQ 1YITA 1E3PA 3AB9A 3T1YQ 3GTOH 1K83H 1JR0D 1WTQA 2KUMA 4DR1Q 2F0TA 2EDGA 3I8ZA 4IOAA 1STAA 3DWQA 1I4PA 2V4DA 1O7IA 3Q8DA 4J15A 1UAPA 5IWAQ 2QKIC 4JI0Q 3RZOB 4O42A 1FNVA 2BH2A 5I9OA 3MAQA 2L12A 2VNUD 2E2IH 4KV6A 4KHZA 5FLXE 3P20A 2ZTCA 4RFBA 2K5DA 4A3IH 1WTWA 3J80i 2EIFA 1K73C 4A93H 1M90C 4RGOS 3SK5A 4A3MB 1SDFA 4C3JB 3A74A 4C1NK 2EXDA 1VQ8A 1Y1WH 1H9SB 1KLUD 5EPKA 1KAAA 5C4JH 1LT5D 2XNAC 5CV6A 1A3UA 1JWUD 3T1HQ 1B3QA 3S1NB 1CZGA 1TQOA 1DYQA 2Z6BA 3VR6A 2BE5D 5GAHC 1IBML 4AQYQ 4S3SA 4CJ1B 1SR3A 4BBRB 4IJLA 1B9NA 4PMBA 3F2UA 1VQAA 3OW7A 1F2LA 5C3EG 5CBEE 4DV2L 5C0XJ 4TRDA 4OWTB 4RGTA 1YHAA 5J39A 1LTSD 5FK9C 3J81j 3K59A 1PFBA 1S3OA 1J5EL 3AMUA 1IW7C 3P75A 5KYLA 1SNDA 4A3FG 4LF9Q 3S1RH 1WOCA 4P75A 2E2DC 3NK9A 2RHQB 4FO2A 2B2WA 3H0GG 2HCCA 4X3TA 4DR6Q 4DFAA 2R7ZG 1C4QA 1UEAB 3T1YL 1WTOA 1RODA 2AKWB 3FEWX 4DR1L 1KDCA 3BVMA 2B39A 3S1QB 2E2HH 2F1MA 2WB1E 5IWAL 1PYBA 2H5XA 4JI0L 3HOVB 2SEBD 5FO9B 4OO1G 1EOTA 1EY7A 2KBNA 1R4PB 5I9PA 3EJIA 3AQQA 2YTXA 4KKUA 2H1EA 1HNZQ 1F9RA 2L4NA 2F4VQ 4M1UB 2PYKA 4DNRB 5LL6S 1CKNB 1BNZA 2Z6KC 5COYA 4HJ5A 2KEEA 4KI0A 1TS5A 1WCMB 1EOVA 4A76A 4G7HC 3S15B 4EQNA 1FD7D 4LNQA 2F0VA 5M5YB 3RZOH 3T1HL 1YJ9A 1EY0A 4MHEA 5JPNC 1DZ1A 3CXCA 5H1SE 4EQOA 3KLSX 1FGBD 5HGQA 4AQYL 4A3DH 1U9RA 2VQEQ 2R93G 1PH5A 4BBSH 2XRQD 4OHJA 2JK8A 5CV4A 1GUSA 1SNOA 3NUCA 4K2LA 3IRBA 2NWGA 1H9MA 2PW5A 2N49A 4OL7A 4DV6Q 1HPCA 3JAMi 3A7LA 3S1NH 3IL8A 1HFGA 3K0YA 1RIPA 4BS9A 3TS2A 4LF9L 2SDFA 1QOHA 3QJYA 1PH4A 2UUBL 4YY3Q 1SYFA 5ELBA 4QIWE 4DR6L 3U50C 1Q7YC 1VQKA 1LO5D 2F3WA 1BDOA 1RF2D 3HOUG 4KKSA 1WVLA 4EGVA 4A3CG 2SNSA 3OW2A 1VQOA 1KNAA 5KGUA 2A5HA 2LXKA 1P8LA 4IN3A 1BBXC 1KDAA 4DV3Q 4A75A 5IYCH 5GADC 2OEOA 4JG2A 1NY4A 1O78A 5G3LF 3TDQA 4YWKA 4DAVA 2CWAA 1HNZL 4ZK9B 2VQFQ 2F0PA 2F4VL 2C9OA 2HDMA 4PZ7A 2D5DA 3KJPA 4GOPC 1GVPA 4XT1B 1HHVA 2ATWA 2N78A 2Q2TA 2GVAA 1LTRD 3ZYYX 4HJ8A 4B3MQ 1Y8NB 4KLKA 4ODGA 2Z6KA 4LUOA 5DEHA 5ELFA 1XTDA 4A3EH 3I70A 5KNDA 4KTAA 5FLMH 4ZKBB 1E22A 4FDBA 5ELDA 1O80A 3ITPA 1N34Q 2B63H 3PUZA 2VQEL 1SSOA 3CHBD 3F8TA 2EVBA 2VL6A 3CRLC 2G9DA 1MIUA 1WCMH 1HA5A 4CGYB 2J7ZA 2L15A 1VMPA 1MKHA 5M5YH 3EVQA 1VQPA 4RHSA 4KY6A 1LABA 2XWBB 4RGMA 5IP9H 5CC4A 5NUCA 1BBUA 2KQ3A 1LTGD 2VUMG 1YNJC 1A2TA 2A68C 1ZXTA 4RGNA 1JMCA 4YY3L 3DM1A 1EUJA 1SNMA 4UP9A 1CK1A 4YIJA 1I5FA 2NZ1D 4LF6Q 1K8GA 3H94A 1VS0A 3DWPA 1BCPD 1B50A 1K3BC 2A73B 3UDFA 1PFSA 1GKHA 3EFXD 5GROA 2AQ2B 1Q3LA 4K8IA 4DV3L 3S2DB 1CTMA 4XDXA 3GTKB 1V8QA 4LMQD 1K8MA 1TWFB 5AJ3Q 1STGA 1D6EC 1ESRA 2VQFL 1ET9A 1TR5A 1EYCA 4DK3C 3PO2B 3M4PA 4A93G 3VYSA 3HKZE 2VXWA 1HR0Q 2K32A 5A2QL 4ZKCB 5M9OA 3CCEA 4NMZA 1NSNS 3QR8A 4A3JG 4L5SA 1HUNA 2D0OA 1JORA 2ZJQA 1PZID 1Y1WG 2A6EC 5JOBA 4GOPA 1XMOQ 1HNXQ 1YEZA 2F0UA 3CF5A 2EY1A 4KD4A 1IYJB 5C4XG 2EYFA 4IOCA 1N34L 2VB2X 1QUQB 1UEBA 1U4RA 3K5NA 3OOCA 2Z1CA 2F0SA 4CHTB 1AFPA 2HD3A 3K6OA 4FF1A 3CMAA 1AEXA 3HS0C 3GTQB 4IJHA 3FKIG 2MP1A 4F87A 3PF5A 1PZKD 2D62A 3CCRA 2WKDA 3KOJA 1RDPD 5E7NA 2XWJB 1XNRQ 5E3FA 3PIO3 1EYGA 2GVBA 2HIXA 3I4NH 4KK7A 2R93B 1UUPA 2F0EA 1OTCA 1SFOH 2IY5B 4L5TA 1KQSA 1CA6A 3G48A 5FOBB 3FMCA 4HEDA 3PCOB 4RA8A 2L9HA 2K01A 3HOYB 4LF6L 2XN9C 3GP7A 3GTJB 4XQNA 1CKMA 4LFBQ 2PO4A 2XIWA 4WJWA 4A3KB 3A56A 3CCJA 3NBHB 4NDXA 3HOWH 3VDYA 4K14A 3OTOQ 1J8IA 5AJ3L 1R9TB 1LM0A 5DNFA 3GTPH 4N9PA 3HOUB 2A6HC 3BZDB 4Y7NH 1O7ZA 2OQKA 1HR0L 1STEA 4E6IA 2E76C 1HFNA 2ZXPA 3BDOA 5CBAE 1JC7A 4NPSA 5I4DA 2QA4A 4AH6A 1SJHD 1VCIA 1XMOL 1TWGH 2FFKB 1HNXL 1EY9A 1WJJA 1U4LA 1PH2A 2VW9A 3M7NA 2A74C 1YHBA 1EL0A 1B1ZA 2RBMA 4JVZA 2YV5A 4AYBB 5JJZA 1X6OA 2OXPA 1SE8A 4J6HA 2K5QA 1VQNA 2XGTA 1Q1BA 1SNCA 4K2KA 4A3DG 4I7AA 3TQYA 2EQSA 4DR7Q 2F3VA 2JN4A 3J7AV 3I4MH 5EJWA 2NN6I 2B2TC 2O5IC 2N8NA 1Z9FA 3HOXB 1BOSA 2QF7A 4DUZQ 3KBXA 3RZDH 3U9SA 2JQOA 1L2FA 1SYCA 1ZYRD 3S9WA 1XNRL 3MZ5A 1SJED 2MHVA 2PPBC 5JJLA 5IGCA 2PNHA 5EBDA 2HHHQ 2NTTA 1Q86C 3VR2A 1VQIA 4OWWB 2DY8A 4A3LG 2FINB 1LLRD 4BBRG 3TP7A 1F9PA 2DNCA 4PNYA 1HZAA 1TWHB 2K5VA 1A3VA 3QOJA 4Y52H 4IO9A 2MJ8A 3EN2A 4KY5A 4GZYC 5I2XA 4PMWA 4XYQA 1SLJA 2VUMB 4LFBL 1RD9D 1SE2A 2Q2UA 1QUQA 1WFQA 4R9WA 1SMYD 2WV6D 5IODA 5BN5A 3U58A 4L6TB 3OTOL 5IT9E 1PFMA 5IYCG 3S17H 4LF8Q 4YCUA 5J1ZA 2Y0SG 1K83B 1FYCA 3RD4A 2B3GA 1E7ZA 3KUPA 3J7AF 3UI2A 1QCBD 2QEJC 3M3YH 5DM73 4JI2Q 5DM63 2MO0A 3CCMA 3PUYA 1M4VA 1D5XC 4JCVE 4R4IA 4A3KH 1PH9A 4L8JA 3I4LA 1VQJA 1OXXK 1SROA 1PTOF 1CA5A 4A3IB 4C1NI 2P5ZX 3H6MA 3X3MA 4LFAQ 5FLMG 2NVYH 4DR7L
chains in the Genus database with same CATH topology
4O0AA 4IJLA 1YHQA 4JI7Q 2K5NA 2ALYB 1C0AA 5M3MG 1VQAA 3HOZH 4DV1L 2WAQG 5IYBH 4LWCA 2D0PA 4DUZL 1OXUA 5C3EG 2K14A 1WCMG 1EWIA 5M3FH 3F2DA 4OX9Q 4DV2L 5C0XJ 4HJ7A 4IPHA 4BY7G 2NVTH 1KHIA 4OWTB 4NXNQ 3S1QH 1YHAA 2OWOA 2LXJA 3W5OA 3J81j 1S3OA 4UP7A 3CCSA 1J5EL 2HHHL 1Q82C 3A0JA 3HOVH 1BBWA 2UU9L 2KHJA 4A3FG 4LF9Q 3S1RH 2R7DA 5JJKA 1WOCA 1HZ9A 2DUDA 4P75A 4LFCL 4B3RQ 2RHQB 1KRTA 2JA6H 3H0GG 4DR6Q 4XTCS 2I5MX 5ELOA 5JEAG 3M85A 1N36L 2R7ZG 3CC7A 1X3FA 4HIKA 1Y1VG 3T1YL 4LF4Q 1YVCA 2AKWB 3ZJYC 4DR1L 2R7FA 3MEFA 5J3BA 1W2BA 5M3MH 4HJ9A 1VQ5A 3TS0A 1HZBA 1Q81C 2E2HH 4GKJQ 3G71A 2AWOA 2WB1E 1PYBA 2H5XA 5IWAL 4JI0L 3TRZA 2KHIA 3S15H 5K36G 4LF7Q 4BY7H 4OWXB 2YTYA 4OO1G 4DV6L 3STBD 2KBNA 2QGQA 4DAMA 2HIVA 4YWMA 3J81i 3RN5A 4LF8L 3AQQA 1D8LA 2YTXA 5M5WH 3CMEA 1XNQL 1HNZQ 4BBSG 1C9OA 1IZ6A 2RF4A 4ME3A 4JI3L 2F4VQ 1CKNA 1LTLA 1CKNB 4GN5A 3H0GH 3TREA 2Z6KC 2IX1A 4HJ5A 4KI0A 4A76A 1EOVA 3J7A5 1VQCA 5FJ8H 1XPOA 4PZ8A 4X62Q 4JI6Q 4LNQA 5LMNQ 3FP9A 3AYHB 3RZOH 3T1HL 3TEHB 1K0RA 1YJ9A 4HIDA 1LYLA 3RLNA 3AFQA 5IY0A 3D0FA 2ZM6Q 1Q1EA 2A19A 2IX0A 5H1SE 3CXCA 1OXSC 5M5XH 4LFAL 4UPAA 2PQAA 5HGQA 4AQYL 3I2ZA 4A3DH 4GNXA 4A3BH 2E5LQ 3L7ZC 2UUCQ 4C2MH 1TWAH 2I5LX 3EIVA 2VQEQ 1QZGA 4JI7L 3ICEA 2R93G 4OO1I 1HH2P 3PIPA 5IE8A 1XPUA 2NVQH 3CAMA 3KYHC 3CCQA 1PH5A 4LF5Q 3GTGH 4BBSH 2JK8A 4MZ9A 1LUZA 4A3GH 4OX9L 3IRBA 1BVSA 1OXVA 4NXNL 5ELNA 5IP7G 2N49A 4H02A 4DV6Q 1IBLQ 4BA1I 1VQDA 2KCTA 3PO3H 1VQHA 3AEVA 3GD7A 3JAMi 4LUZA 4YWLA 3S1NH 1TXYA 4B3TQ 1S40A 2BA0A 4B3ML 2WFWA 1RIPA 1HZCA 5BR8Q 4C3IH 3I4NG 4DV5Q 4AYBE 3TS2A 4LF9L 1PH4A 3S2HH 4WJ3M 2UUBL 1A63A 4YY3Q 4B3RL 2QEXA 4QIWE 1XJVA 1QZHA 1CUKA 2NVXH 4DR6L 3U50C 1I50H 1WYDA 4LF4L 3KLWA 4IPDA 1Q7YC 1VQKA 2CKZB 2CFMA 3S16H 2R6GA 2JA9A 2NZOA 3HOUG 1S72A 1HR0W 2E2JH 4A3CG 1A8VA 1NE3A 3D31A 4A3EG 4GKJL 3PV0A 3OW2A 1VQOA 1GO3E 3GTMH 4NB3A 5C0XI 4LF7L 1TWCH 4A4IA 1VQ9A 1JE5A 2K5HA 2LXKA 1P8LA 5IP7H 2B63G 3KFUA 1HNWQ 4DV3Q 2UXCQ 4A75A 1SN8A 1UE6A 5IYCH 5GADC 4JG2A 1NY4A 1PV4A 2KCMA 1U5KA 2HQLA 4R4OA 4YWKA 2CWAA 2JEAI 2IT1A 1X65A 1MJEA 1E1TA 1JJCB 3E0EA 2KENA 4QY7A 2VQFQ 1HNZL 4NXMQ 2F4VL 4GKKQ 3CP0A 3PSIA 4O2DA 3I55A 2R92G 4PZ7A 3KJPA 4GOPC 1GM5A 1FVIA 4QQBX 1GVPA 3BJUA 1X56A 2ATWA 2N78A 3UE0A 2MNAA 4X65Q 5IP9G 2VZAA 2Q2TA 4X62L 4JI6L 2GVAA 2JA7H 3CC2A 5LMNL 4HJ8A 4B3MQ 4KLKA 4EX5A 2Z6KA 4LUOA 3ERSX 2UUBQ 1J6QA 1XTDA 2DGYA 3W1GA 2ZM6L 4A3EH 2MFIA 2JA5H 1KIXA 5FLMH 3H15A 1E22A 2BH8A 2VY3A 4FDBA 4YCWA 4DR5Q 4DR4Q 1CSQA 1N34Q 2B63H 1B8AA 2E5LL 2UUCL 3PUZA 2VQEL 1YZ6A 2IHFA 3F8TA 1I94L 2ASBA 3PO2G 1JJ2A 2VL6A 4LF5L 3H3VI 3I4MG 4JI4Q 4BA2I 5C3EH 2K52A 1MIUA 1WCMH 3RLOA 4WJ4A 1KXLA 3KF6B 3J81c 2L15A 4L5QA 1KL9A 1K8AC 2UUAQ 1MKHA 3MXNB 5M5YH 1IBLL 1VQPA 1C7YA 1EIFA 4RG1A 4B3SQ 1CSPA 3UDIA 4DKAC 5IP9H 4JI5Q 4B3TL 2Q2HA 1H95A 1BBUA 2ID0A 1IXRA 2VUMG 1KAWA 5BR8L 4A3FH 4DV5L 1JMCA 4JI8Q 4L5RC 1PH6A 4YY3L 3S2DH 2BA1A 1PH8A 3RN2A 3A5UA 1EUJA 2R7ZH 3GTKH 4GLXA 1TWFH 1Y1VH 2E8GA 4UP9A 2Z0SA 4DV7Q 2ES2A 2UXDQ 1UE7A 1KRSA 3ULPA 4JV5Q 5LMUQ 1I5FA 3PO2H 1BKBA 4LF6Q 1B7YB 1V9PA 2JE6I 4DV4Q 4X64Q 1K8GA 4A3MG 4YHHL 3K0XA 4QGUA 1VS0A 1N32L 2WB1G 1W3SA 1E1OA 4UP8A 4DR3Q 4HIMA 4LUVA 2YU9H 3UDFA 1PH3A 1PFSA 1GKHA 4KHPQ 5GROA 2OCEA 3S1MH 1PA6A 3M9BA 3HKSA 4DV3L 4MTNA 2UXCL 1HNWL 1P16A 1VQEA 4BXXG 2ZTDA 1EQRA 1U0LA 4DK6C 1I94Q 1Z47A 5AJ3Q 4JYAQ 2Y0SE 5C0XG 4QL5A 2OQ0A 4GLAC 3DLLA 3BZCA 3DM3A 2VQFL 1NBWA 1IBKQ 4NXML 2JEBI 2K4KA 4GKKL 3U4ZA 1UE1A 3E9IA 4DK3C 2YYZA 4BY1G 3M4PA 4A93G 3HOYG 1YBYA 1GD7A 2B29A 3HKZE 3J80c 1HR0Q 4RMFA 4X65L 3CCEA 4A3JG 4L5SA 3KF8B 2D0OA 2PI2A 1AH9A 3ER0A 2ZJQA 1X54A 3S24A 1YIJA 1Y1WG 3GTQH 1KD1C 4JI1Q 4GOPA 5JJIA 2JJQA 3CPWA 1XMOQ 2LSSA 1HNXQ 1YEZA 1FJGQ 4A3KG 4PZ6A 3CD6A 2ZJPA 3AFPA 4K0KQ 4GOPB 5IYDG 3KJOA 3K81C 4C3HH 3CF5A 1DGSA 2HT1A 1G6PA 3I56A 1IYJB 4P71A 4DR5L 4DR4L 4JOIC 4IOCA 1NMFA 5LMNW 1N34L 5C4XG 1QUQB 1RL2A 1SRUA 1UEBA 3WWVA 4P72A 2R93H 4TVAB 2JA8G 4JBMA 4IFDJ 3F1ZA 1A62A 3F2BA 3CMAA 4JI4L 4YHHQ 1VQBA 3HOZG 2WAQE 5IYBG 1N32Q 3HFZB 3FKIG 4IJHA 3J7ZC 3PF5A 1X9NA 3CQZH 1B70B 4BY1H 5M3FG 2D62A 4X66Q 3CCRA 3HOYH 2UUAL 3KOJA 3NENA 3W1BA 3S14H 5E7NA 2CQOA 4JI5L 4A3JH 4B3SL 1NMGA 1N33Q 1XNRQ 3L0OA 3HOWG 3PUXA 1EYGA 3A5ZB 4PG3A 3GTJH 4AIMA 1PHJA 2F52A 1OXTA 1YNXA 2JA8H 3ULLA 3RR5A 2GVBA 2HIXA 1AE2A 2AWNA 1VQMA 3HOVG 2I5HA 3I4NH 4X6AH 4AYBG 1XPRA 4JI8L 1JT8A 3PUVA 4JBWA 2K75A 1YI2A 1OTCA 1L1OC 1SFOH 3STBC 1KC8C 3M4QA 4APVA 3B6YA 4GLVB 1PH1A 4L5TA 2JA6G 2IY5B 1KQSA 3G48A 5C4XH 3K8AA 2Q2IA 3PCOB 3PUWA 4DV7L 2UXDL 4DR2Q 1Y14B 5IT9c 5FLXc 1Q12A 4TQUS 3HOXG 1R9TH 1G51A 4JV5L 5LMUL 4UY8C 1HJPA 3HOUH 1X3EA 3CCLA 4LF6L 3NELA 4X64L 2F3IA 4DV4L 4A3CH 4P73A 3SGIA 4DV0Q 1CKMA 3FKIH 4DR3L 4LFBQ 2A1AA 4KHPL 1QVCA 4OONA 3CCJA 2CCZA 1EQQA 3H3VH 3K80C 1E24A 2PI2E 3NBHB 1L0WA 2NN6G 3HOWH 3VDYA 3OTOQ 3CPFA 3EBEA 2RHSB 1K3RA 5AJ3L 4JYAL 1X3GA 3KDFA 3BU2A 3KF6A 2GN5A 1IBKL 1LM0A 3JC66 3KDFB 3GTPH 1PVOA 2I0QA 1UWVA 3OYYA 1YJNA 2R92H 1N9WA 4DNIA 4Y7NH 3PIOA 1ASZA 2OQKA 1HR0L 5GAEC 5C44G 4DUYL 1VQLA 1FGUA 3HOXH 4NPSA 5FJ8G 2C35B 4AH6A 2MO1A 1VCIA 2N3SA 4JI1L 2QA4A 4ALPA 1TWGH 1XMOL 4K0KL 1HNXL 1WJJA 1Q46A 1FJGL 3PF4A 4JC0A 3I7FA 1PH2A 3M4OH 1CKOA 1K9MC 2VW9A 3M7NA 1WI5A 1YHBA 2ZTEA 3GTLH 2VS1A 3LGJA 3NEMA 4HIOA 3RNUA 2YV5A 5GQOA 1X6OA 3G4SA 1SE8A 1X55A 1VQNA 1IBMQ 4IFDG 2XGTA 1Q1BA 2UXBQ 2CWPA 4P74A 1VQ6A 4A3DG 3TQYA 3RLFA 1VQ7A 3G6EA 1XMQQ 2EQSA 2YTVA 4A3BG 3FHWA 4DR7Q 1JJGA 1FL0A 2FXQA 3I4MH 2NN6I 4R4TA 4JOIA 4DV1Q 2N8NA 1Z9FA 4DUZQ 1TWHH 3UDGA 3RZDH 4X66L 4A3GG 4DV2Q 3UE1A 2JQOA 2K50A 3K7UC 1QVFA 1L2FA 3CCUA 2RCNA 1VQGA 2IHEA 5HY6A 4JI2L 1QVGA 5C44H 4JBJA 1UE5A 1N33L 1XNRL 3PO3G 2XTIA 4YCVA 5JJLA 2PNHA 4GN3B 4DPGA 3L2PA 1J5EQ 2AHOB 2HHHQ 1AE3A 3CC4A 1VQFA 1Q86C 4A3IG 2VUMH 4R4QA 4DAYB 2UU9Q 4IPGA 1VQIA 4OWWB 3JAMc 3GDEA 4A3LG 4GN4B 2V1CC 4EQ5A 2OTJA 4LFCQ 2OTLA 2WP8J 4BBRG 1HZAA 4R4CA 1N36Q 4DUYQ 2K5VA 1JB7A 1YITA 1E3PA 4DR2L 4POGA 1V1QA 3T1YQ 4IO9A 3GTOH 1K83H 4Y52H 4MNOA 2PQAB 3EN2A 5JEAJ 1MJCA 1SMXA 4DR1Q 1L1OA 4IFDI 1N8RC 4PMWA 4GNXB 4A3MH 1SLJA 4QJFA 1IL2A 4IOAA 1L1OB 1NTGA 1T9HA 4C3JH 4DV0L 1O7IA 3Q8DA 4XIGS 4J15A 5GAGC 1G291 1QUQA 1PH7A 1WFQA 5IWAQ 1M1KC 2Q2UA 4JI0Q 1I6HH 1PYSB 2NZHA 2ZJRA 2BH2A 4BXXH 2VNUD 3U58A 2E2IH 3OTOL 4KHZA 4R1JA 5IYCG 3S17H 5EAYA 4LF8Q 4LW1A 4YCUA 2Y0SG 2ZTCA 4A3IH 3J80i 1XNQQ 3ULJA 4GS3A 2EIFA 3F2CA 2B3GA 1K73C 1E7ZA 4JI3Q 4A3LH 4POFA 4A93H 3BZKA 1M90C 1NJIC 3M3YH 1D7QA 3HKZG 1I3QH 4BBRH 3A74A 4JI2Q 2MO0A 3I4OA 2MQHA 1YJWA 4OXPA 3CCMA 2EXDA 1VQ8A 3PUYA 1Y1WH 2JA7G 5C4JH 2PMZE 4JCVE 4R4IA 1A0IA 4A3KH 1PH9A 5DLQE 3T1HQ 5IYDH 4GNXC 3U4VA 1VQJA 1OXXK 4IPCA 1SROA 1VQ4A 4LFBL 3CW2C 3PGZA 2JA5G 4DR7L 1EIYB 3E9HA 3K7AH 4LFAQ 5FLMG 5GAHC 2AMCB 3GO5A 3CCVA 2NVYH 1IBML 1EFWA 2UXBL 4AQYQ 2A8VA 1Q8KA 1ASYA 1SR3A 1V43A 3UDXA 4HJAA 1XMQL 4JBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O0A A;  4IJL A;  1YHQ A;  4JI7 Q;  2K5N A;  2ALY B;  1C0A A;  5M3M G;  1VQA A;  3HOZ H;  4DV1 L;  2WAQ G;  5IYB H;  4LWC A;  2D0P A;  4DUZ L;  1OXU A;  5C3E G;  2K14 A;  1WCM G;  1EWI A;  5M3F H;  3F2D A;  4OX9 Q;  4DV2 L;  5C0X J;  4HJ7 A;  4IPH A;  4BY7 G;  2NVT H;  1KHI A;  4OWT B;  4NXN Q;  3S1Q H;  1YHA A;  2OWO A;  2LXJ A;  3W5O A;  3J81 j;  1S3O A;  4UP7 A;  3CCS A;  1J5E L;  2HHH L;  1Q82 C;  3A0J A;  3HOV H;  1BBW A;  2UU9 L;  2KHJ A;  4A3F G;  4LF9 Q;  3S1R H;  2R7D A;  5JJK A;  1WOC A;  1HZ9 A;  2DUD A;  4P75 A;  4LFC L;  4B3R Q;  2RHQ B;  1KRT A;  2JA6 H;  3H0G G;  4DR6 Q;  4XTC S;  2I5M X;  5ELO A;  5JEA G;  3M85 A;  1N36 L;  2R7Z G;  3CC7 A;  1X3F A;  4HIK A;  1Y1V G;  3T1Y L;  4LF4 Q;  1YVC A;  2AKW B;  3ZJY C;  4DR1 L;  2R7F A;  3MEF A;  5J3B A;  1W2B A;  5M3M H;  4HJ9 A;  1VQ5 A;  3TS0 A;  1HZB A;  1Q81 C;  2E2H H;  4GKJ Q;  3G71 A;  2AWO A;  2WB1 E;  1PYB A;  2H5X A;  5IWA L;  4JI0 L;  3TRZ A;  2KHI A;  3S15 H;  5K36 G;  4LF7 Q;  4BY7 H;  4OWX B;  2YTY A;  4OO1 G;  4DV6 L;  3STB D;  2KBN A;  2QGQ A;  4DAM A;  2HIV A;  4YWM A;  3J81 i;  3RN5 A;  4LF8 L;  3AQQ A;  1D8L A;  2YTX A;  5M5W H;  3CME A;  1XNQ L;  1HNZ Q;  4BBS G;  1C9O A;  1IZ6 A;  2RF4 A;  4ME3 A;  4JI3 L;  2F4V Q;  1CKN A;  1LTL A;  1CKN B;  4GN5 A;  3H0G H;  3TRE A;  2Z6K C;  2IX1 A;  4HJ5 A;  4KI0 A;  4A76 A;  1EOV A;  3J7A 5;  1VQC A;  5FJ8 H;  1XPO A;  4PZ8 A;  4X62 Q;  4JI6 Q;  4LNQ A;  5LMN Q;  3FP9 A;  3AYH B;  3RZO H;  3T1H L;  3TEH B;  1K0R A;  1YJ9 A;  4HID A;  1LYL A;  3RLN A;  3AFQ A;  5IY0 A;  3D0F A;  2ZM6 Q;  1Q1E A;  2A19 A;  2IX0 A;  5H1S E;  3CXC A;  1OXS C;  5M5X H;  4LFA L;  4UPA A;  2PQA A;  5HGQ A;  4AQY L;  3I2Z A;  4A3D H;  4GNX A;  4A3B H;  2E5L Q;  3L7Z C;  2UUC Q;  4C2M H;  1TWA H;  2I5L X;  3EIV A;  2VQE Q;  1QZG A;  4JI7 L;  3ICE A;  2R93 G;  4OO1 I;  1HH2 P;  3PIP A;  5IE8 A;  1XPU A;  2NVQ H;  3CAM A;  3KYH C;  3CCQ A;  1PH5 A;  4LF5 Q;  3GTG H;  4BBS H;  2JK8 A;  4MZ9 A;  1LUZ A;  4A3G H;  4OX9 L;  3IRB A;  1BVS A;  1OXV A;  4NXN L;  5ELN A;  5IP7 G;  2N49 A;  4H02 A;  4DV6 Q;  1IBL Q;  4BA1 I;  1VQD A;  2KCT A;  3PO3 H;  1VQH A;  3AEV A;  3GD7 A;  3JAM i;  4LUZ A;  4YWL A;  3S1N H;  1TXY A;  4B3T Q;  1S40 A;  2BA0 A;  4B3M L;  2WFW A;  1RIP A;  1HZC A;  5BR8 Q;  4C3I H;  3I4N G;  4DV5 Q;  4AYB E;  3TS2 A;  4LF9 L;  1PH4 A;  3S2H H;  4WJ3 M;  2UUB L;  1A63 A;  4YY3 Q;  4B3R L;  2QEX A;  4QIW E;  1XJV A;  1QZH A;  1CUK A;  2NVX H;  4DR6 L;  3U50 C;  1I50 H;  1WYD A;  4LF4 L;  3KLW A;  4IPD A;  1Q7Y C;  1VQK A;  2CKZ B;  2CFM A;  3S16 H;  2R6G A;  2JA9 A;  2NZO A;  3HOU G;  1S72 A;  1HR0 W;  2E2J H;  4A3C G;  1A8V A;  1NE3 A;  3D31 A;  4A3E G;  4GKJ L;  3PV0 A;  3OW2 A;  1VQO A;  1GO3 E;  3GTM H;  4NB3 A;  5C0X I;  4LF7 L;  1TWC H;  4A4I A;  1VQ9 A;  1JE5 A;  2K5H A;  2LXK A;  1P8L A;  5IP7 H;  2B63 G;  3KFU A;  1HNW Q;  4DV3 Q;  2UXC Q;  4A75 A;  1SN8 A;  1UE6 A;  5IYC H;  5GAD C;  4JG2 A;  1NY4 A;  1PV4 A;  2KCM A;  1U5K A;  2HQL A;  4R4O A;  4YWK A;  2CWA A;  2JEA I;  2IT1 A;  1X65 A;  1MJE A;  1E1T A;  1JJC B;  3E0E A;  2KEN A;  4QY7 A;  2VQF Q;  1HNZ L;  4NXM Q;  2F4V L;  4GKK Q;  3CP0 A;  3PSI A;  4O2D A;  3I55 A;  2R92 G;  4PZ7 A;  3KJP A;  4GOP C;  1GM5 A;  1FVI A;  4QQB X;  1GVP A;  3BJU A;  1X56 A;  2ATW A;  2N78 A;  3UE0 A;  2MNA A;  4X65 Q;  5IP9 G;  2VZA A;  2Q2T A;  4X62 L;  4JI6 L;  2GVA A;  2JA7 H;  3CC2 A;  5LMN L;  4HJ8 A;  4B3M Q;  4KLK A;  4EX5 A;  2Z6K A;  4LUO A;  3ERS X;  2UUB Q;  1J6Q A;  1XTD A;  2DGY A;  3W1G A;  2ZM6 L;  4A3E H;  2MFI A;  2JA5 H;  1KIX A;  5FLM H;  3H15 A;  1E22 A;  2BH8 A;  2VY3 A;  4FDB A;  4YCW A;  4DR5 Q;  4DR4 Q;  1CSQ A;  1N34 Q;  2B63 H;  1B8A A;  2E5L L;  2UUC L;  3PUZ A;  2VQE L;  1YZ6 A;  2IHF A;  3F8T A;  1I94 L;  2ASB A;  3PO2 G;  1JJ2 A;  2VL6 A;  4LF5 L;  3H3V I;  3I4M G;  4JI4 Q;  4BA2 I;  5C3E H;  2K52 A;  1MIU A;  1WCM H;  3RLO A;  4WJ4 A;  1KXL A;  3KF6 B;  3J81 c;  2L15 A;  4L5Q A;  1KL9 A;  1K8A C;  2UUA Q;  1MKH A;  3MXN B;  5M5Y H;  1IBL L;  1VQP A;  1C7Y A;  1EIF A;  4RG1 A;  4B3S Q;  1CSP A;  3UDI A;  4DKA C;  5IP9 H;  4JI5 Q;  4B3T L;  2Q2H A;  1H95 A;  1BBU A;  2ID0 A;  1IXR A;  2VUM G;  1KAW A;  5BR8 L;  4A3F H;  4DV5 L;  1JMC A;  4JI8 Q;  4L5R C;  1PH6 A;  4YY3 L;  3S2D H;  2BA1 A;  1PH8 A;  3RN2 A;  3A5U A;  1EUJ A;  2R7Z H;  3GTK H;  4GLX A;  1TWF H;  1Y1V H;  2E8G A;  4UP9 A;  2Z0S A;  4DV7 Q;  2ES2 A;  2UXD Q;  1UE7 A;  1KRS A;  3ULP A;  4JV5 Q;  5LMU Q;  1I5F A;  3PO2 H;  1BKB A;  4LF6 Q;  1B7Y B;  1V9P A;  2JE6 I;  4DV4 Q;  4X64 Q;  1K8G A;  4A3M G;  4YHH L;  3K0X A;  4QGU A;  1VS0 A;  1N32 L;  2WB1 G;  1W3S A;  1E1O A;  4UP8 A;  4DR3 Q;  4HIM A;  4LUV A;  2YU9 H;  3UDF A;  1PH3 A;  1PFS A;  1GKH A;  4KHP Q;  5GRO A;  2OCE A;  3S1M H;  1PA6 A;  3M9B A;  3HKS A;  4DV3 L;  4MTN A;  2UXC L;  1HNW L;  1P16 A;  1VQE A;  4BXX G;  2ZTD A;  1EQR A;  1U0L A;  4DK6 C;  1I94 Q;  1Z47 A;  5AJ3 Q;  4JYA Q;  2Y0S E;  5C0X G;  4QL5 A;  2OQ0 A;  4GLA C;  3DLL A;  3BZC A;  3DM3 A;  2VQF L;  1NBW A;  1IBK Q;  4NXM L;  2JEB I;  2K4K A;  4GKK L;  3U4Z A;  1UE1 A;  3E9I A;  4DK3 C;  2YYZ A;  4BY1 G;  3M4P A;  4A93 G;  3HOY G;  1YBY A;  1GD7 A;  2B29 A;  3HKZ E;  3J80 c;  1HR0 Q;  4RMF A;  4X65 L;  3CCE A;  4A3J G;  4L5S A;  3KF8 B;  2D0O A;  2PI2 A;  1AH9 A;  3ER0 A;  2ZJQ A;  1X54 A;  3S24 A;  1YIJ A;  1Y1W G;  3GTQ H;  1KD1 C;  4JI1 Q;  4GOP A;  5JJI A;  2JJQ A;  3CPW A;  1XMO Q;  2LSS A;  1HNX Q;  1YEZ A;  1FJG Q;  4A3K G;  4PZ6 A;  3CD6 A;  2ZJP A;  3AFP A;  4K0K Q;  4GOP B;  5IYD G;  3KJO A;  3K81 C;  4C3H H;  3CF5 A;  1DGS A;  2HT1 A;  1G6P A;  3I56 A;  1IYJ B;  4P71 A;  4DR5 L;  4DR4 L;  4JOI C;  4IOC A;  1NMF A;  5LMN W;  1N34 L;  5C4X G;  1QUQ B;  1RL2 A;  1SRU A;  1UEB A;  3WWV A;  4P72 A;  2R93 H;  4TVA B;  2JA8 G;  4JBM A;  4IFD J;  3F1Z A;  1A62 A;  3F2B A;  3CMA A;  4JI4 L;  4YHH Q;  1VQB A;  3HOZ G;  2WAQ E;  5IYB G;  1N32 Q;  3HFZ B;  3FKI G;  4IJH A;  3J7Z C;  3PF5 A;  1X9N A;  3CQZ H;  1B70 B;  4BY1 H;  5M3F G;  2D62 A;  4X66 Q;  3CCR A;  3HOY H;  2UUA L;  3KOJ A;  3NEN A;  3W1B A;  3S14 H;  5E7N A;  2CQO A;  4JI5 L;  4A3J H;  4B3S L;  1NMG A;  1N33 Q;  1XNR Q;  3L0O A;  3HOW G;  3PUX A;  1EYG A;  3A5Z B;  4PG3 A;  3GTJ H;  4AIM A;  1PHJ A;  2F52 A;  1OXT A;  1YNX A;  2JA8 H;  3ULL A;  3RR5 A;  2GVB A;  2HIX A;  1AE2 A;  2AWN A;  1VQM A;  3HOV G;  2I5H A;  3I4N H;  4X6A H;  4AYB G;  1XPR A;  4JI8 L;  1JT8 A;  3PUV A;  4JBW A;  2K75 A;  1YI2 A;  1OTC A;  1L1O C;  1SFO H;  3STB C;  1KC8 C;  3M4Q A;  4APV A;  3B6Y A;  4GLV B;  1PH1 A;  4L5T A;  2JA6 G;  2IY5 B;  1KQS A;  3G48 A;  5C4X H;  3K8A A;  2Q2I A;  3PCO B;  3PUW A;  4DV7 L;  2UXD L;  4DR2 Q;  1Y14 B;  5IT9 c;  5FLX c;  1Q12 A;  4TQU S;  3HOX G;  1R9T H;  1G51 A;  4JV5 L;  5LMU L;  4UY8 C;  1HJP A;  3HOU H;  1X3E A;  3CCL A;  4LF6 L;  3NEL A;  4X64 L;  2F3I A;  4DV4 L;  4A3C H;  4P73 A;  3SGI A;  4DV0 Q;  1CKM A;  3FKI H;  4DR3 L;  4LFB Q;  2A1A A;  4KHP L;  1QVC A;  4OON A;  3CCJ A;  2CCZ A;  1EQQ A;  3H3V H;  3K80 C;  1E24 A;  2PI2 E;  3NBH B;  1L0W A;  2NN6 G;  3HOW H;  3VDY A;  3OTO Q;  3CPF A;  3EBE A;  2RHS B;  1K3R A;  5AJ3 L;  4JYA L;  1X3G A;  3KDF A;  3BU2 A;  3KF6 A;  2GN5 A;  1IBK L;  1LM0 A;  3JC6 6;  3KDF B;  3GTP H;  1PVO A;  2I0Q A;  1UWV A;  3OYY A;  1YJN A;  2R92 H;  1N9W A;  4DNI A;  4Y7N H;  3PIO A;  1ASZ A;  2OQK A;  1HR0 L;  5GAE C;  5C44 G;  4DUY L;  1VQL A;  1FGU A;  3HOX H;  4NPS A;  5FJ8 G;  2C35 B;  4AH6 A;  2MO1 A;  1VCI A;  2N3S A;  4JI1 L;  2QA4 A;  4ALP A;  1TWG H;  1XMO L;  4K0K L;  1HNX L;  1WJJ A;  1Q46 A;  1FJG L;  3PF4 A;  4JC0 A;  3I7F A;  1PH2 A;  3M4O H;  1CKO A;  1K9M C;  2VW9 A;  3M7N A;  1WI5 A;  1YHB A;  2ZTE A;  3GTL H;  2VS1 A;  3LGJ A;  3NEM A;  4HIO A;  3RNU A;  2YV5 A;  5GQO A;  1X6O A;  3G4S A;  1SE8 A;  1X55 A;  1VQN A;  1IBM Q;  4IFD G;  2XGT A;  1Q1B A;  2UXB Q;  2CWP A;  4P74 A;  1VQ6 A;  4A3D G;  3TQY A;  3RLF A;  1VQ7 A;  3G6E A;  1XMQ Q;  2EQS A;  2YTV A;  4A3B G;  3FHW A;  4DR7 Q;  1JJG A;  1FL0 A;  2FXQ A;  3I4M H;  2NN6 I;  4R4T A;  4JOI A;  4DV1 Q;  2N8N A;  1Z9F A;  4DUZ Q;  1TWH H;  3UDG A;  3RZD H;  4X66 L;  4A3G G;  4DV2 Q;  3UE1 A;  2JQO A;  2K50 A;  3K7U C;  1QVF A;  1L2F A;  3CCU A;  2RCN A;  1VQG A;  2IHE A;  5HY6 A;  4JI2 L;  1QVG A;  5C44 H;  4JBJ A;  1UE5 A;  1N33 L;  1XNR L;  3PO3 G;  2XTI A;  4YCV A;  5JJL A;  2PNH A;  4GN3 B;  4DPG A;  3L2P A;  1J5E Q;  2AHO B;  2HHH Q;  1AE3 A;  3CC4 A;  1VQF A;  1Q86 C;  4A3I G;  2VUM H;  4R4Q A;  4DAY B;  2UU9 Q;  4IPG A;  1VQI A;  4OWW B;  3JAM c;  3GDE A;  4A3L G;  4GN4 B;  2V1C C;  4EQ5 A;  2OTJ A;  4LFC Q;  2OTL A;  2WP8 J;  4BBR G;  1HZA A;  4R4C A;  1N36 Q;  4DUY Q;  2K5V A;  1JB7 A;  1YIT A;  1E3P A;  4DR2 L;  4POG A;  1V1Q A;  3T1Y Q;  4IO9 A;  3GTO H;  1K83 H;  4Y52 H;  4MNO A;  2PQA B;  3EN2 A;  5JEA J;  1MJC A;  1SMX A;  4DR1 Q;  1L1O A;  4IFD I;  1N8R C;  4PMW A;  4GNX B;  4A3M H;  1SLJ A;  4QJF A;  1IL2 A;  4IOA A;  1L1O B;  1NTG A;  1T9H A;  4C3J H;  4DV0 L;  1O7I A;  3Q8D A;  4XIG S;  4J15 A;  5GAG C;  1G29 1;  1QUQ A;  1PH7 A;  1WFQ A;  5IWA Q;  1M1K C;  2Q2U A;  4JI0 Q;  1I6H H;  1PYS B;  2NZH A;  2ZJR A;  2BH2 A;  4BXX H;  2VNU D;  3U58 A;  2E2I H;  3OTO L;  4KHZ A;  4R1J A;  5IYC G;  3S17 H;  5EAY A;  4LF8 Q;  4LW1 A;  4YCU A;  2Y0S G;  2ZTC A;  4A3I H;  3J80 i;  1XNQ Q;  3ULJ A;  4GS3 A;  2EIF A;  3F2C A;  2B3G A;  1K73 C;  1E7Z A;  4JI3 Q;  4A3L H;  4POF A;  4A93 H;  3BZK A;  1M90 C;  1NJI C;  3M3Y H;  1D7Q A;  3HKZ G;  1I3Q H;  4BBR H;  3A74 A;  4JI2 Q;  2MO0 A;  3I4O A;  2MQH A;  1YJW A;  4OXP A;  3CCM A;  2EXD A;  1VQ8 A;  3PUY A;  1Y1W H;  2JA7 G;  5C4J H;  2PMZ E;  4JCV E;  4R4I A;  1A0I A;  4A3K H;  1PH9 A;  5DLQ E;  3T1H Q;  5IYD H;  4GNX C;  3U4V A;  1VQJ A;  1OXX K;  4IPC A;  1SRO A;  1VQ4 A;  4LFB L;  3CW2 C;  3PGZ A;  2JA5 G;  4DR7 L;  1EIY B;  3E9H A;  3K7A H;  4LFA Q;  5FLM G;  5GAH C;  2AMC B;  3GO5 A;  3CCV A;  2NVY H;  1IBM L;  1EFW A;  2UXB L;  4AQY Q;  2A8V A;  1Q8K A;  1ASY A;  1SR3 A;  1V43 A;  3UDX A;  4HJA A;  1XMQ L;  4JBK A; 
#chains in the Genus database with same CATH topology
 4O0A A;  4JI7 Q;  1Y8O B;  2ALY B;  3DHQ A;  2KVM A;  4F88 A;  5I2Y A;  1C0A A;  2WAQ G;  4DUZ L;  2D9U A;  3NHH A;  5C4J B;  1WCM G;  5M3F H;  4HJ7 A;  3NBH A;  2PZW A;  2NVT H;  4CDD C;  4NXN Q;  4H44 C;  2B2T A;  2LXJ A;  5CV8 A;  4BWG B;  2HHH L;  5T1I A;  2Z4H A;  2F0K A;  2FMC A;  5JJK A;  1HZ9 A;  4JW0 A;  4B3R Q;  1KRT A;  2QDL A;  4UDU C;  2Z4I A;  4HIK A;  1QNU A;  1GUG A;  1YNN D;  5M3M H;  3TS0 A;  2SNM A;  2H4O A;  4GKJ Q;  3T4A C;  2AWO A;  2L0C A;  3PIP 3;  3TRZ A;  4FF3 A;  3OPO A;  1HA6 A;  2KHI A;  2NUC A;  4LF7 Q;  4BY7 H;  3MHB A;  1LAC A;  3A8I E;  1ZKO A;  3S1R B;  4ZCK A;  4LF8 L;  3J81 i;  1D8L A;  3N52 A;  3HP3 A;  3E5S A;  1ENA A;  2CQA A;  1C9O A;  4ME3 A;  3KLR A;  3TRE A;  1RJT A;  3N6R A;  4QCL A;  3R2T A;  5KIX A;  2ZXO A;  5IOC A;  5L37 A;  5FJ8 H;  1XPO A;  4JI6 Q;  1AZP A;  3FP9 A;  1SBB B;  1D5Z C;  3AYH B;  3A8J E;  1K8O A;  3TEH B;  4O1N A;  1S5C D;  4HID A;  3RLN A;  2ZM6 Q;  1Q1E A;  2A19 A;  2IX0 A;  3OWF A;  4LFA L;  4DK1 A;  5IGF A;  4IFD H;  2CW0 D;  3I2Z A;  1EYD A;  2E5L Q;  4C2M H;  2EYM A;  3EIV A;  1QZG A;  3ICE A;  1AP0 A;  4JI7 L;  1K0S A;  4OO1 I;  1LTT D;  3LWE A;  2WIN B;  3CAM A;  3KYH C;  4LF5 Q;  3GTG H;  1BVS A;  1OXV A;  3RMH A;  4NXN L;  4HAE A;  2D2C C;  5IP7 G;  1IBL Q;  1GHK A;  4BA1 I;  1VQD A;  1S5F D;  1VQH A;  4LUZ A;  1TXY A;  1S40 A;  2YU9 B;  4B08 A;  4A3D B;  3SK4 A;  1WTH A;  3I4N G;  1MD2 D;  1B4O A;  4HSV A;  4B3R L;  2QEX A;  5JPM C;  1CUK A;  3VYR A;  4BBS B;  1WYD A;  1HTL D;  1WD0 A;  2X69 A;  3KLW A;  4IPD A;  2CKZ B;  2CFM A;  1ET6 A;  2JA9 A;  1HR0 W;  3D31 A;  3MXU A;  1T5E A;  4GKJ L;  4WFN 3;  3T53 B;  3R2I A;  4NB3 A;  5C0X I;  5IIF A;  4LF7 L;  3QWN A;  1SN8 A;  1UE6 A;  4KD3 A;  4R4O A;  4WOR A;  2IT1 A;  1QG7 A;  1E1T A;  2F0H A;  3E0E A;  2KEN A;  4NXM Q;  1QB5 D;  1G2S A;  4RCO A;  3CP0 A;  4O2D A;  4ZUI A;  1GM5 A;  1OO9 B;  1WTX A;  4JI6 L;  3R3O A;  4OEL B;  3CRK C;  3NTH A;  4NW2 A;  3MXP A;  3L3O C;  5C3W A;  2UUB Q;  1J6Q A;  2DGY A;  2Y0S B;  2ZM6 L;  2MFI A;  3BDC A;  4K8J A;  1AN8 A;  4J8Q A;  1KIX A;  1KNE A;  2JSO A;  2X6G A;  2BH8 A;  3NPP A;  4YCW A;  4DR5 Q;  4DR4 Q;  2F0M A;  2E5L L;  1HRJ A;  1YZ6 A;  2ASB A;  3PO2 G;  1JJ2 A;  4LF5 L;  3I4M G;  4JI4 Q;  2K52 A;  3QO2 A;  1GOZ A;  4WJ4 A;  1KXL A;  3MXN A;  3J81 c;  2R3Z A;  2E74 C;  1K8A C;  4A3E B;  1IBL L;  2A69 C;  1EIF A;  2CH4 A;  2K03 A;  3UDI A;  4B3S Q;  4DKA C;  5E1F A;  2Q2H A;  4HR7 B;  4ZYS A;  1KAW A;  4UAI A;  2B63 B;  2TMP A;  4JI8 Q;  1PH6 A;  1EY4 A;  2AUJ D;  3H09 A;  1F2M A;  2WAQ B;  2CVR A;  3RN2 A;  1XYI A;  5JEA H;  2EXZ A;  1Y1V H;  2E8G A;  1Y69 U;  4LJZ C;  1A15 A;  3TZD A;  1KRS A;  1BKB A;  2RA4 A;  5CV5 A;  1A2U A;  1STN A;  1N32 L;  1W3S A;  4UP8 A;  3FRP B;  5K36 H;  1D1K A;  2YU9 H;  2OCE A;  5CYU A;  3S1M H;  4K6D A;  4MTN A;  4ABN A;  2ZTD A;  2ENB A;  3MFG A;  4ZRZ A;  5C0X G;  2MPM A;  2EJG C;  4GLA C;  4NXM L;  1IBK Q;  1NBW A;  4RWS C;  2JEB I;  1CT1 D;  1UE1 A;  3MC0 B;  3HOY G;  1GD7 A;  3J80 c;  3RUZ A;  4KY7 A;  1LTI D;  3S24 A;  1YIJ A;  1KD1 C;  2K5W A;  4JI1 Q;  5JJI A;  2JJQ A;  3CPW A;  1DON A;  4A3K G;  2ZJP A;  3AFP A;  4GOP B;  3MXG A;  3BVG A;  4QMG A;  1DGS A;  4CDF C;  4KN7 C;  2PCF B;  1M8A A;  1PTO B;  3BYT B;  4DR5 L;  4DR4 L;  4MTK A;  4QUF A;  5LMN W;  3V96 A;  3NQT A;  1J9O A;  1RL2 A;  1SRU A;  4IFD J;  3F1Z A;  4JI4 L;  3TZU A;  1BR9 A;  3CU7 A;  3HFZ B;  2IW3 A;  1X9N A;  3CQZ H;  4BY1 H;  2AQ3 B;  3A7A B;  3I90 A;  4KKT A;  5M3F G;  4FVM A;  1CM9 A;  1R4Q B;  4B3S L;  4FYD A;  3TME A;  3NWS A;  3L0O A;  3A5Z B;  4G7Z C;  3RR5 A;  4HCE A;  1AE2 A;  4K6L A;  4AYB G;  4JI8 L;  3PUV A;  4JBW A;  1YI2 A;  4XT3 B;  1L1O C;  1KC8 C;  4APV A;  1PH1 A;  2AUK A;  1PDQ A;  1PTO C;  1BCP F;  2L1B A;  5ISR A;  4DR2 Q;  3Q6S A;  5FLX c;  4IAL A;  3HOX G;  5CV9 A;  3QB3 A;  1HXY D;  1I3Q B;  2DN8 A;  3NEL A;  2L5T A;  4P73 A;  2HDL A;  3SGI A;  4DV0 Q;  1E0B A;  1GXD C;  3I4N B;  4TKO B;  4OON A;  3TP8 A;  5E4W C;  3H3V H;  3K80 C;  1E24 A;  2PI2 E;  1SFO B;  1L0W A;  3CPF A;  3EBE A;  3KDF A;  3BU2 A;  2GN5 A;  1IBK L;  1CI3 M;  3JC6 6;  4DNT B;  5CR3 A;  5FO7 B;  2KEC A;  2JA8 B;  1N9W A;  2EY5 A;  4M8A A;  1IYU A;  3PIO A;  1JCK B;  3HOZ B;  1DOK A;  3T56 B;  1Q90 A;  1G91 A;  5FJ8 G;  2N3S A;  4JI1 L;  4CJ2 C;  1Q46 A;  1TS4 A;  3I7F A;  3HOW B;  3M4O H;  2BOS A;  1JE4 A;  3GTL H;  1RKN A;  3KLS A;  2FJ2 A;  3GTP B;  3FPU B;  1X55 A;  4IFD G;  5J22 A;  1F2Z A;  2JYO A;  4Y7N B;  3RLF A;  5EPL A;  3G6E A;  1XMQ Q;  2YTV A;  1CFM A;  2PMZ B;  3Q22 A;  1TWG B;  4G7O C;  2LY7 A;  2K50 A;  3UE1 A;  3CCU A;  2RSO A;  2RCN A;  2F0W A;  1VQG A;  2IHE A;  2Z9H A;  1QVG A;  5C44 H;  3I72 A;  3OWE B;  4GN3 B;  5EKK A;  4DPG A;  3L2P A;  4A3I G;  1PTO H;  1PXU A;  4KJN A;  2BE5 C;  4DAY B;  4IPG A;  3G6J B;  3C3L A;  3I91 A;  3JAM c;  3GDE A;  1IHZ A;  2NB0 A;  3I4M B;  2OTJ A;  2WII B;  3SXH A;  2WP8 J;  1N36 Q;  1GUT A;  3VA7 A;  4DR2 L;  3RZD B;  4POG A;  5ELE A;  5AFW A;  1V1Q A;  2RSN A;  4MNO A;  2PQA B;  4RH6 A;  5JEA J;  1MJC A;  1SMX A;  1L1O A;  1N8R C;  3HG9 A;  4GNX B;  1KDB A;  1PRT D;  1IL2 A;  1NTG A;  1T9H A;  3D4W A;  4DV0 L;  4XIG S;  3MFY A;  1G29 1;  1M1K C;  3LNN A;  1PYS B;  2ZJR A;  3ONA B;  3R8B A;  4R1J A;  5M5X B;  5EAY A;  4LW1 A;  1F2Y A;  4RKB A;  1XNQ Q;  2Z8L A;  1DJR D;  4GS3 A;  3ULJ A;  4A3B B;  2EJF C;  1WD1 A;  2N88 A;  4JK1 C;  4N8X 1;  1NJI C;  1EQV A;  1I3Q H;  3C2P A;  2IX3 A;  3J80 L;  2QIL A;  4A3G B;  1IKM A;  1A0I A;  5EGT A;  5IYD H;  4GNX C;  1Q8I A;  3S17 B;  4IPC A;  3IAY A;  4I7Z C;  1EIY B;  3K7A H;  3GO5 A;  1NCV A;  1EFW A;  3DUZ A;  1ASY A;  4JBK A;  4B9W A;  3UDX A;  1XMQ L;  3M3Y B;  2JA8 H;  4CDC C;  1AW7 A;  3IFD A;  3HOZ H;  4LWC A;  1I4R A;  2B2U C;  4OX9 Q;  3SK6 A;  4R8N A;  1LT3 D;  5HGT A;  3W5O A;  2F0O A;  4UP7 A;  3CCS A;  3SDZ A;  2NVY B;  2K6A A;  3A0J A;  1Q82 C;  1VF7 A;  1T5X D;  5T1G A;  4FP5 D;  3E3X A;  2DUD A;  1BF4 A;  2EYH A;  5JEA G;  1VF5 C;  5ELO A;  3M85 A;  1N36 L;  5M3F B;  1Y1V G;  4XXE A;  5FLX L;  3HKZ B;  2NVT B;  2C5C A;  3V2T A;  4PMC A;  5EKI A;  5KRU A;  4HJ9 A;  1VQ5 A;  1HZB A;  2JA7 B;  1Q81 C;  1DM0 B;  1PMR A;  5K36 G;  3A54 A;  2YTY A;  4PQX A;  2E75 C;  5D3I B;  1JWM D;  1TVX A;  3EQL C;  4ILW A;  2QGQ A;  2HIV A;  2KCN A;  4I65 A;  1XNQ L;  3K57 A;  1SXT A;  4BBS G;  2RF4 A;  5CMD A;  1E2Z A;  5M3M B;  3VA5 A;  4GN5 A;  1SYE A;  3H0G H;  2JP1 A;  3D4R A;  2IX1 A;  4ZQ3 A;  4DAY A;  3SK8 A;  1EY8 A;  4OIJ A;  4BY7 B;  2B2Y C;  5LMN Q;  1LYL A;  5IY0 A;  1IW7 D;  3D0F A;  1SE3 A;  1WTV A;  1OXS C;  5M5X H;  2PQA A;  5D14 A;  4CKE A;  4GNX A;  4A3B H;  1GHJ A;  4RAU C;  1H9R A;  1TWA H;  2G5D A;  4R8I A;  1HH2 P;  3ERQ A;  4F8M A;  5IE8 A;  3PIP A;  1XPU A;  2RQX A;  3CCQ A;  1ICW A;  4MZ9 A;  4A3G H;  4OX9 L;  4LK1 C;  1W6K A;  1QIL A;  2EPB A;  1STH A;  1HQR D;  1ZEQ X;  2IL8 A;  3W2D A;  3VR3 A;  3PO3 H;  1RHP A;  3Q0A A;  3AEV A;  2B2U A;  4YWL A;  4ZAI A;  1KAB A;  4Z9C B;  2WFW A;  1I6H H;  4C3I H;  3S2H H;  4DV5 Q;  4C2M B;  2MUY A;  4K5W A;  4IUP A;  1MHW C;  3JAM L;  2NVX H;  3GTG B;  1I50 H;  5D65 A;  2DY7 A;  2NBF A;  1II3 A;  2R6G A;  2NZO A;  3U9O A;  2EJM A;  1S72 A;  2E2J H;  1A8V A;  1SEB D;  4A3E G;  5KNB A;  2QDB A;  3MA2 B;  2CH4 W;  3GTM H;  4FF4 A;  1TWC H;  1JE5 A;  2K5H A;  2B63 G;  1MSH A;  3KFU A;  2UXC Q;  1PZJ D;  3P7J A;  3TSS A;  2F0L A;  3QIA A;  1U5K A;  2HQL A;  4N8F A;  1X65 A;  1JJC B;  4GKK Q;  4RCN A;  3TP5 A;  3OIQ A;  4KN4 C;  1Y8P B;  4NP5 A;  3UE0 A;  5IP9 G;  2F0N A;  2VZA A;  2JA7 H;  3CC2 A;  5LMN L;  2HCI A;  1BCP C;  2EE1 A;  1IYV A;  4EX5 A;  5C5M A;  3ERS X;  3W1G A;  2JA5 H;  5C4Z A;  3G7L A;  1WTR A;  1ML0 D;  2B2Y A;  3I73 A;  3GV3 A;  5A2Q E;  5LHY 1;  1C48 A;  2IWH A;  5KYI A;  1EFI D;  1CZW A;  2IHF A;  1I94 L;  2Q8I B;  4XQJ A;  3FVQ A;  4BA2 I;  1GUW A;  3KF6 B;  4MIU A;  4L5Q A;  2UUA Q;  3MXN B;  4RG1 A;  4JI5 Q;  1CSP A;  2PNR C;  2K33 A;  1L0X B;  1H95 A;  2RVL A;  1IXR A;  2M00 A;  3NQI A;  2G9H D;  4DV5 L;  4HMI A;  1FNW A;  4Q0F A;  1SNP A;  3A5U A;  4RHR A;  4GLX A;  3J80 E;  2Z0S A;  4DV7 Q;  2UXD Q;  2KA7 A;  2QW7 A;  3ULP A;  2NYZ D;  4JV5 Q;  5LMU Q;  4OGQ C;  1G8Z D;  1B7Y B;  1BQQ T;  4YHH L;  3D6W A;  3K0X A;  2WB1 G;  3BDL A;  1E1O A;  4XQQ A;  4HIM A;  4LUV A;  1L0Y B;  4KHP Q;  4PV1 C;  2UXC L;  3M9B A;  3GV6 A;  1HTP A;  4H7B A;  4DK6 C;  1Y1V B;  2PQE A;  3SHL A;  2Y0S E;  4JYA Q;  4DU9 A;  3DLL A;  4GKK L;  1EY6 A;  2K4K A;  3D3R A;  1DD2 A;  4QUC A;  3WDN A;  3D8G A;  1QE6 A;  2B29 A;  3KF8 A;  5EKL A;  1CQF A;  1QWY A;  4KJO A;  1AH9 A;  1XTC D;  1B44 D;  3S1M B;  1ILP A;  2LSS A;  3SR1 A;  3CD6 A;  1JB3 A;  4PZ6 A;  4X3U A;  5IYD G;  1MGS A;  3K81 C;  1LTB D;  4C3H H;  3KJO A;  1EWH A;  1YNJ D;  3I3C A;  1PYW D;  3I56 A;  2HT1 A;  4RKL A;  1G6P A;  2A68 D;  4JOI C;  1NMF A;  1GUN A;  3WWV A;  3NWT A;  2SOB A;  2JA8 G;  3LWU A;  4JBM A;  2QCP X;  1A62 A;  1EU4 A;  3KK7 A;  3F2B A;  4CBV A;  2EZV A;  1VQB A;  1NR4 A;  2WAQ E;  1EZ8 A;  4IUN A;  1V1P B;  3HOZ G;  1N32 Q;  3J7Z C;  1B70 B;  1RTN A;  1C8C A;  4X66 Q;  2UUA L;  3MEH A;  3NEN A;  3S14 H;  4IQZ A;  1WTP A;  2J4X A;  4JI5 L;  4F7X A;  3DEO A;  4A3J H;  1N33 Q;  3HOW G;  5F2D A;  4PG3 A;  3A55 A;  2TSS A;  1OXT A;  1YNX A;  2AWN A;  5DAU A;  2I5H A;  5D3D A;  1XPR A;  2K75 A;  3M4Q A;  3OMG A;  3TBI B;  4G57 A;  5C4X H;  3K8A A;  5KNC A;  2F4I A;  2Q2I A;  3CQZ B;  4DV7 L;  3J7Y W;  4BY1 B;  2UXD L;  1Y14 B;  4HTH A;  5IT9 c;  4TQU S;  2F03 A;  1G51 A;  4L63 B;  5LMU L;  4JV5 L;  1HJP A;  1NUC A;  1EEF D;  1SNQ A;  1U4M A;  4IUT A;  1ZYR C;  3FKI H;  2A6E D;  4OEM B;  3DMU A;  4KHP L;  1QVC A;  3BG3 A;  4IUR A;  1EQQ A;  1JOO A;  3PQI A;  3HZX A;  1PLF A;  2RHS B;  1K3R A;  4NKL A;  1PFN A;  4JYA L;  1X3Q A;  2DJG C;  3KF6 A;  1Z6H A;  3KDF B;  5JVG 3;  2I0Q A;  1UWV A;  3OYY A;  1YJN A;  2R92 H;  1HUM A;  3OMC A;  1S5E D;  1QNK A;  4DUY L;  4DA2 A;  1EY5 A;  2C35 B;  2MO1 A;  5JAV A;  4ALP A;  1SMY C;  3PF4 A;  4JC0 A;  4TSS A;  2EYL A;  3MWY W;  1F77 A;  1WI5 A;  3NBI A;  2M9V A;  3A8K E;  3NEM A;  3JAM E;  3SE0 A;  2F0J A;  5GQO A;  3G4S A;  1XX8 A;  5A35 A;  1U4P A;  2L55 A;  2UXB Q;  2CWP A;  1VQ6 A;  3NSW A;  2DNE A;  5JVH 3;  3FDT A;  4A3B G;  1B53 A;  1H9K A;  2JA6 B;  4FF2 A;  1FL0 A;  2FXQ A;  2GA4 B;  1LTA D;  2K7V A;  4JOI A;  4DV1 Q;  2AQ1 B;  1RTO A;  2OF1 A;  4X3S A;  3UDG A;  1SYB A;  4A3G G;  4X66 L;  5C5L A;  1QVF A;  3M4O B;  5HY6 A;  1N33 L;  3PO3 G;  3HRZ C;  3GTL B;  2XTI A;  1JIC A;  4ID6 A;  2AHO B;  3CC4 A;  1VQF A;  4R4Q A;  2IJ0 A;  3TN2 A;  2UU9 Q;  4C3I G;  3H3V C;  2V1C C;  4EQ5 A;  4LFC Q;  4UHV A;  5M5W B;  2PZT A;  3D6C A;  1JB7 A;  2A6H D;  1G2T A;  2BDN A;  1K28 A;  3DEP A;  4IFD I;  5C44 B;  3NXW A;  4A3M H;  2K04 A;  3H91 A;  4ME5 A;  1L1O B;  1W6J A;  2F0I A;  4QJF A;  3VR4 A;  4C3J H;  3IKJ A;  5GAG C;  1PH7 A;  1B9M A;  4ZLT F;  2NZH A;  3K5O A;  3R93 A;  4BXX H;  1IL8 A;  2ZT9 C;  4CJ0 B;  1V1P A;  1EEI D;  1STB A;  1BXT A;  1S4Z A;  2FHT A;  3F2C A;  4JI3 Q;  4A3L H;  4POF A;  3BZK A;  2M2L A;  5TSS A;  1D7Q A;  3HKZ G;  2Q8T A;  3SEB A;  4BBR H;  2NVQ B;  2WB1 B;  2EYO A;  1H9S A;  1YNN C;  3I4O A;  2MQH A;  4DK0 A;  4OXP A;  1YJW A;  1O7Y A;  2JA7 G;  3P1H A;  2PMZ E;  5DLQ E;  3U4V A;  5E4X A;  1VQ4 A;  2B8F A;  2R61 A;  3CW2 C;  3PGZ A;  3C1E A;  4FXK C;  3BS1 A;  2JA5 G;  5EPJ A;  3E9H A;  3QOL A;  2AMC B;  3LX0 A;  3CCV A;  2UXB L;  2A8V A;  5IGE A;  1Q8K A;  1HCZ A;  1V43 A;  4HJA A;  3M4Y A;  1YHQ A;  2K5N A;  1LT6 D;  5M3M G;  4DV1 L;  5IYB H;  4CDE C;  2D0P A;  1OXU A;  2K14 A;  1EWI A;  3F2D A;  3S16 B;  4IPH A;  4BY7 G;  4X3K A;  1KHI A;  3VYU A;  3T51 B;  3S1Q H;  1B2T A;  1E2V A;  2OWO A;  1EWC A;  1G6Z A;  5EBC A;  3K7A B;  2LS0 1;  3D4D A;  3HOV H;  4ZUJ A;  1BBW A;  2UU9 L;  2KHJ A;  1EZ6 A;  4G4K A;  1X3P A;  2CW0 C;  2R7D A;  2F0Q A;  1HQM C;  4LFC L;  1TII D;  1PRT F;  4WRD A;  4IUQ A;  2JA6 H;  1S5D D;  3ERO A;  4XTC S;  2I5M X;  3NP8 A;  3CC7 A;  1X3F A;  2O2L D;  5C3X A;  5IGG A;  3K5L A;  1XWE A;  4LF4 Q;  2IPK D;  1DOL A;  2HQE A;  1YVC A;  5IT9 L;  3ZJY C;  2R7F A;  1A6X A;  1MSG A;  3MEF A;  3W3A A;  5J3B A;  1W2B A;  1ENC A;  4FXD A;  3G71 A;  3S15 H;  1FNU A;  4OWX B;  4QIW B;  5CGK A;  2F0G A;  2NN6 H;  3STB D;  4FXG C;  1DXM A;  4HCS A;  4DAM A;  4DV6 L;  1QJO A;  4YWM A;  3RN5 A;  4CKB A;  5M5W H;  3CME A;  2JXM B;  1EU3 A;  1IZ6 A;  4JI3 L;  1CKN A;  4K5V A;  4V19 0;  4QF4 A;  3J81 L;  1LTL A;  5G3L D;  5C3E B;  2EY6 A;  3M7G A;  5ELC A;  2KED A;  3J7A 5;  1VQC A;  4PZ8 A;  4X62 Q;  3NTI A;  1K0R A;  1DCZ A;  1CHQ D;  3AFQ A;  4C3H G;  2X6L A;  3VYT A;  3OSO A;  4UPA A;  4A3F B;  2UUC Q;  3L7Z C;  2O4X A;  2I5L X;  3H0G B;  1VDZ A;  2R7Z B;  3BVZ A;  2NVQ H;  2O5J C;  1LUZ A;  1KLG D;  1MI2 A;  3O13 A;  4HSP A;  1I4X A;  4IUU A;  2K1B A;  2KOL A;  1ILQ A;  3C1F A;  2J0T D;  3HGB A;  5ELN A;  4H02 A;  2KJX A;  2PW7 A;  3Q23 A;  2KCT A;  3GD7 A;  4B3T Q;  2XVS A;  2BA0 A;  4B3M L;  1ICF B;  1BO0 A;  1HZC A;  1LV9 A;  3GQB A;  5BR8 Q;  1TS3 A;  4AYB E;  2FMM A;  1TWA B;  2KHS A;  3WOF A;  4WJ3 M;  5BN4 A;  1A63 A;  1XJV A;  1QZH A;  3WOE A;  4LF4 L;  5I6Y A;  3QG1 A;  5FKA C;  1TKW B;  1IKL A;  3S16 H;  1F9Q A;  5CV7 A;  3PO3 B;  1ONL A;  3VR5 A;  3E0J A;  4V0B A;  1V1O A;  1NE3 A;  4HMJ A;  3PV0 A;  3MVV A;  1GO3 E;  2F0F A;  1I6H B;  1GUO A;  4C3I B;  3S2H B;  3V05 A;  4A4I A;  2BDO A;  4H0L C;  1VQ9 A;  2F0D A;  5IP7 H;  1HNW Q;  2B2V C;  4CKC A;  2NVX B;  2K28 A;  1O7L A;  1PV4 A;  2KCM A;  1I50 B;  1EYA A;  1D2B A;  5IGB A;  2JEA I;  1MJE A;  4QY7 A;  1EIG A;  2EYJ A;  4N9T A;  3PSI A;  3I55 A;  2R92 G;  5EQ0 A;  1FVI A;  4DXF A;  4QQB X;  2E2J B;  3BJU A;  1X56 A;  2VB3 X;  1NNX A;  2MNA A;  4X65 Q;  3OHX C;  3GTM B;  3EA6 A;  4OIK A;  4X62 L;  3K5M A;  1TWC B;  4LAA A;  1NAP A;  3NTK A;  3ND9 A;  3H15 A;  2I07 B;  2RDG A;  2VY3 A;  1D5M C;  1CSQ A;  1UNS A;  1B8A A;  2UUC L;  3Q24 A;  2L11 A;  4IZ8 A;  3H3V I;  1TY2 A;  5C3E H;  1XXG A;  2K05 A;  3RLO A;  2RDH A;  3T16 A;  3X3N A;  1A3T A;  1KL9 A;  4P2C B;  5HUR A;  2LKV A;  2JA5 B;  1C7Y A;  2ICE C;  4B3T L;  1TT2 A;  2ID0 A;  1I4G A;  5BR8 L;  4A3F H;  3KBG A;  4L5R C;  3S2D H;  2BA1 A;  2MGS A;  1PH8 A;  2R7Z H;  3GTK H;  1TWF H;  3BYY B;  3DXJ C;  2ES2 A;  4DF7 A;  1UE7 A;  1JOK A;  1Z7T A;  1BUV T;  3PO2 H;  1V9P A;  1STY A;  2JE6 I;  4DV4 Q;  4X64 Q;  4A3M G;  1SYD A;  4QGU A;  4C3J G;  4C56 C;  2XSC A;  4EVO A;  4DR3 Q;  1I6V C;  4XYO A;  5BN3 A;  1PH3 A;  4DXG A;  4H13 C;  4OO1 H;  1PA6 A;  1HNW L;  3HKS A;  3E6Z X;  1P16 A;  1VQE A;  4BXX G;  1EQR A;  1H9J A;  1U0L A;  4HN7 A;  1I94 Q;  1SE4 A;  1TY0 A;  3PMF A;  1Z47 A;  2EOT A;  1FR3 A;  4QL5 A;  4U68 A;  4FNF A;  2OQ0 A;  5I6W A;  1F9S A;  3BZC A;  3DM3 A;  3U4Z A;  1EIH A;  2B2V A;  3E9I A;  2BCO A;  2YYZ A;  4BY1 G;  4JPB W;  1GJX A;  1YBY A;  4U67 3;  1CHP D;  4RMF A;  4X65 L;  1D1I A;  1I4H A;  3KF8 B;  2PI2 A;  3ER0 A;  3GTQ H;  1X54 A;  3NE5 B;  3SVM A;  4K0K Q;  2A69 D;  1FJG Q;  1JQY D;  4B9X A;  5COR A;  4P71 A;  4J1M A;  1BCP B;  5IGD A;  1AZQ A;  4P72 A;  2R93 H;  4TVA B;  2RCF A;  5C0X H;  1X32 A;  2WKC A;  4YHH Q;  3ND8 A;  5IYB G;  3GTO B;  3FPP A;  1RCV D;  3HOY H;  3OIP A;  3W1B A;  2CQO A;  4C3H B;  3T13 A;  4DGZ A;  1NMG A;  1LT4 D;  3PUX A;  3GTJ H;  4AIM A;  1PHJ A;  5C6A A;  1NR2 A;  2F52 A;  3ULL A;  1VQM A;  2EY2 A;  3AU7 A;  3HOV G;  4X6A H;  3K58 A;  1JT8 A;  2E2I B;  2N55 A;  3STB C;  3B6Y A;  4GLV B;  3J81 E;  2JA6 G;  1PRT B;  2B8G A;  2CHB D;  4KHV A;  3PUW A;  1R9T H;  1Q12 A;  4A93 B;  1I4Q A;  2NTS A;  4ULL A;  4UY8 C;  3S14 B;  1DOM A;  3HOU H;  1X3E A;  3CCL A;  2DJF C;  1EQT A;  1SYG A;  4A3J B;  4DV4 L;  4X64 L;  2F3I A;  4A3C H;  1Y1W B;  2PZU A;  4DR3 L;  2LMC B;  3MTS A;  1ENF A;  2A1A A;  1JWS D;  1JOQ A;  2CCZ A;  1ESF A;  2NN6 G;  1X3G A;  5C4X B;  2Q8R E;  5LL6 X;  3HEJ A;  1PVO A;  4DN4 M;  1TS2 A;  4DNI A;  1ASZ A;  2LFN A;  3URY A;  5GAE C;  1E2W A;  3FKI B;  5C44 G;  1PRT C;  5FO8 B;  4DAP A;  1VQL A;  1FGU A;  3HOX H;  4K0K L;  1CQV A;  1FJG L;  4MN3 A;  2ICI A;  1CKO A;  1K9M C;  2RDF A;  2ZTE A;  3TP6 A;  2ZXR A;  2VS1 A;  3LGJ A;  4HIO A;  3RNU A;  3C46 A;  1IBM Q;  2R92 B;  5KEE A;  4P74 A;  1VQ7 A;  1KTK A;  2OT2 A;  3DWA A;  4IUV A;  3FHW A;  4KMU C;  1JJG A;  2RKS A;  4K5X A;  1PTO D;  2XRS D;  4R4T A;  1S5B D;  1SAP A;  1TWH H;  5C4H A;  4DV2 Q;  2EYP A;  3K7U C;  5K5P A;  3CKI B;  1MBY A;  1TU2 B;  1VMC A;  4JI2 L;  3L9A X;  1UE5 A;  4JBJ A;  2KCC A;  2E2H B;  4YCV A;  1J5E Q;  4QB4 A;  2VUM H;  1AE3 A;  1B3A A;  2B2W C;  2WAC A;  2HUG A;  3IFT A;  4GN4 B;  4EQP A;  2I46 A;  2OTL A;  4Q5V A;  4R4C A;  4DUY Q;  1YIT A;  1E3P A;  3AB9 A;  3T1Y Q;  3GTO H;  1K83 H;  1JR0 D;  1WTQ A;  2KUM A;  4DR1 Q;  2F0T A;  2EDG A;  3I8Z A;  4IOA A;  1STA A;  3DWQ A;  1I4P A;  2V4D A;  1O7I A;  3Q8D A;  4J15 A;  1UAP A;  5IWA Q;  2QKI C;  4JI0 Q;  3RZO B;  4O42 A;  1FNV A;  2BH2 A;  5I9O A;  3MAQ A;  2L12 A;  2VNU D;  2E2I H;  4KV6 A;  4KHZ A;  5FLX E;  3P20 A;  2ZTC A;  4RFB A;  2K5D A;  4A3I H;  1WTW A;  3J80 i;  2EIF A;  1K73 C;  4A93 H;  1M90 C;  4RGO S;  3SK5 A;  4A3M B;  1SDF A;  4C3J B;  3A74 A;  4C1N K;  2EXD A;  1VQ8 A;  1Y1W H;  1H9S B;  1KLU D;  5EPK A;  1KAA A;  5C4J H;  1LT5 D;  2XNA C;  5CV6 A;  1A3U A;  1JWU D;  3T1H Q;  1B3Q A;  3S1N B;  1CZG A;  1TQO A;  1DYQ A;  2Z6B A;  3VR6 A;  2BE5 D;  5GAH C;  1IBM L;  4AQY Q;  4S3S A;  4CJ1 B;  1SR3 A;  4BBR B;  4IJL A;  1B9N A;  4PMB A;  3F2U A;  1VQA A;  3OW7 A;  1F2L A;  5C3E G;  5CBE E;  4DV2 L;  5C0X J;  4TRD A;  4OWT B;  4RGT A;  1YHA A;  5J39 A;  1LTS D;  5FK9 C;  3J81 j;  3K59 A;  1PFB A;  1S3O A;  1J5E L;  3AMU A;  1IW7 C;  3P75 A;  5KYL A;  1SND A;  4A3F G;  4LF9 Q;  3S1R H;  1WOC A;  4P75 A;  2E2D C;  3NK9 A;  2RHQ B;  4FO2 A;  2B2W A;  3H0G G;  2HCC A;  4X3T A;  4DR6 Q;  4DFA A;  2R7Z G;  1C4Q A;  1UEA B;  3T1Y L;  1WTO A;  1ROD A;  2AKW B;  3FEW X;  4DR1 L;  1KDC A;  3BVM A;  2B39 A;  3S1Q B;  2E2H H;  2F1M A;  2WB1 E;  5IWA L;  1PYB A;  2H5X A;  4JI0 L;  3HOV B;  2SEB D;  5FO9 B;  4OO1 G;  1EOT A;  1EY7 A;  2KBN A;  1R4P B;  5I9P A;  3EJI A;  3AQQ A;  2YTX A;  4KKU A;  2H1E A;  1HNZ Q;  1F9R A;  2L4N A;  2F4V Q;  4M1U B;  2PYK A;  4DNR B;  5LL6 S;  1CKN B;  1BNZ A;  2Z6K C;  5COY A;  4HJ5 A;  2KEE A;  4KI0 A;  1TS5 A;  1WCM B;  1EOV A;  4A76 A;  4G7H C;  3S15 B;  4EQN A;  1FD7 D;  4LNQ A;  2F0V A;  5M5Y B;  3RZO H;  3T1H L;  1YJ9 A;  1EY0 A;  4MHE A;  5JPN C;  1DZ1 A;  3CXC A;  5H1S E;  4EQO A;  3KLS X;  1FGB D;  5HGQ A;  4AQY L;  4A3D H;  1U9R A;  2VQE Q;  2R93 G;  1PH5 A;  4BBS H;  2XRQ D;  4OHJ A;  2JK8 A;  5CV4 A;  1GUS A;  1SNO A;  3NUC A;  4K2L A;  3IRB A;  2NWG A;  1H9M A;  2PW5 A;  2N49 A;  4OL7 A;  4DV6 Q;  1HPC A;  3JAM i;  3A7L A;  3S1N H;  3IL8 A;  1HFG A;  3K0Y A;  1RIP A;  4BS9 A;  3TS2 A;  4LF9 L;  2SDF A;  1QOH A;  3QJY A;  1PH4 A;  2UUB L;  4YY3 Q;  1SYF A;  5ELB A;  4QIW E;  4DR6 L;  3U50 C;  1Q7Y C;  1VQK A;  1LO5 D;  2F3W A;  1BDO A;  1RF2 D;  3HOU G;  4KKS A;  1WVL A;  4EGV A;  4A3C G;  2SNS A;  3OW2 A;  1VQO A;  1KNA A;  5KGU A;  2A5H A;  2LXK A;  1P8L A;  4IN3 A;  1BBX C;  1KDA A;  4DV3 Q;  4A75 A;  5IYC H;  5GAD C;  2OEO A;  4JG2 A;  1NY4 A;  1O78 A;  5G3L F;  3TDQ A;  4YWK A;  4DAV A;  2CWA A;  1HNZ L;  4ZK9 B;  2VQF Q;  2F0P A;  2F4V L;  2C9O A;  2HDM A;  4PZ7 A;  2D5D A;  3KJP A;  4GOP C;  1GVP A;  4XT1 B;  1HHV A;  2ATW A;  2N78 A;  2Q2T A;  2GVA A;  1LTR D;  3ZYY X;  4HJ8 A;  4B3M Q;  1Y8N B;  4KLK A;  4ODG A;  2Z6K A;  4LUO A;  5DEH A;  5ELF A;  1XTD A;  4A3E H;  3I70 A;  5KND A;  4KTA A;  5FLM H;  4ZKB B;  1E22 A;  4FDB A;  5ELD A;  1O80 A;  3ITP A;  1N34 Q;  2B63 H;  3PUZ A;  2VQE L;  1SSO A;  3CHB D;  3F8T A;  2EVB A;  2VL6 A;  3CRL C;  2G9D A;  1MIU A;  1WCM H;  1HA5 A;  4CGY B;  2J7Z A;  2L15 A;  1VMP A;  1MKH A;  5M5Y H;  3EVQ A;  1VQP A;  4RHS A;  4KY6 A;  1LAB A;  2XWB B;  4RGM A;  5IP9 H;  5CC4 A;  5NUC A;  1BBU A;  2KQ3 A;  1LTG D;  2VUM G;  1YNJ C;  1A2T A;  2A68 C;  1ZXT A;  4RGN A;  1JMC A;  4YY3 L;  3DM1 A;  1EUJ A;  1SNM A;  4UP9 A;  1CK1 A;  4YIJ A;  1I5F A;  2NZ1 D;  4LF6 Q;  1K8G A;  3H94 A;  1VS0 A;  3DWP A;  1BCP D;  1B50 A;  1K3B C;  2A73 B;  3UDF A;  1PFS A;  1GKH A;  3EFX D;  5GRO A;  2AQ2 B;  1Q3L A;  4K8I A;  4DV3 L;  3S2D B;  1CTM A;  4XDX A;  3GTK B;  1V8Q A;  4LMQ D;  1K8M A;  1TWF B;  5AJ3 Q;  1STG A;  1D6E C;  1ESR A;  2VQF L;  1ET9 A;  1TR5 A;  1EYC A;  4DK3 C;  3PO2 B;  3M4P A;  4A93 G;  3VYS A;  3HKZ E;  2VXW A;  1HR0 Q;  2K32 A;  5A2Q L;  4ZKC B;  5M9O A;  3CCE A;  4NMZ A;  1NSN S;  3QR8 A;  4A3J G;  4L5S A;  1HUN A;  2D0O A;  1JOR A;  2ZJQ A;  1PZI D;  1Y1W G;  2A6E C;  5JOB A;  4GOP A;  1XMO Q;  1HNX Q;  1YEZ A;  2F0U A;  3CF5 A;  2EY1 A;  4KD4 A;  1IYJ B;  5C4X G;  2EYF A;  4IOC A;  1N34 L;  2VB2 X;  1QUQ B;  1UEB A;  1U4R A;  3K5N A;  3OOC A;  2Z1C A;  2F0S A;  4CHT B;  1AFP A;  2HD3 A;  3K6O A;  4FF1 A;  3CMA A;  1AEX A;  3HS0 C;  3GTQ B;  4IJH A;  3FKI G;  2MP1 A;  4F87 A;  3PF5 A;  1PZK D;  2D62 A;  3CCR A;  2WKD A;  3KOJ A;  1RDP D;  5E7N A;  2XWJ B;  1XNR Q;  5E3F A;  3PIO 3;  1EYG A;  2GVB A;  2HIX A;  3I4N H;  4KK7 A;  2R93 B;  1UUP A;  2F0E A;  1OTC A;  1SFO H;  2IY5 B;  4L5T A;  1KQS A;  1CA6 A;  3G48 A;  5FOB B;  3FMC A;  4HED A;  3PCO B;  4RA8 A;  2L9H A;  2K01 A;  3HOY B;  4LF6 L;  2XN9 C;  3GP7 A;  3GTJ B;  4XQN A;  1CKM A;  4LFB Q;  2PO4 A;  2XIW A;  4WJW A;  4A3K B;  3A56 A;  3CCJ A;  3NBH B;  4NDX A;  3HOW H;  3VDY A;  4K14 A;  3OTO Q;  1J8I A;  5AJ3 L;  1R9T B;  1LM0 A;  5DNF A;  3GTP H;  4N9P A;  3HOU B;  2A6H C;  3BZD B;  4Y7N H;  1O7Z A;  2OQK A;  1HR0 L;  1STE A;  4E6I A;  2E76 C;  1HFN A;  2ZXP A;  3BDO A;  5CBA E;  1JC7 A;  4NPS A;  5I4D A;  2QA4 A;  4AH6 A;  1SJH D;  1VCI A;  1XMO L;  1TWG H;  2FFK B;  1HNX L;  1EY9 A;  1WJJ A;  1U4L A;  1PH2 A;  2VW9 A;  3M7N A;  2A74 C;  1YHB A;  1EL0 A;  1B1Z A;  2RBM A;  4JVZ A;  2YV5 A;  4AYB B;  5JJZ A;  1X6O A;  2OXP A;  1SE8 A;  4J6H A;  2K5Q A;  1VQN A;  2XGT A;  1Q1B A;  1SNC A;  4K2K A;  4A3D G;  4I7A A;  3TQY A;  2EQS A;  4DR7 Q;  2F3V A;  2JN4 A;  3J7A V;  3I4M H;  5EJW A;  2NN6 I;  2B2T C;  2O5I C;  2N8N A;  1Z9F A;  3HOX B;  1BOS A;  2QF7 A;  4DUZ Q;  3KBX A;  3RZD H;  3U9S A;  2JQO A;  1L2F A;  1SYC A;  1ZYR D;  3S9W A;  1XNR L;  3MZ5 A;  1SJE D;  2MHV A;  2PPB C;  5JJL A;  5IGC A;  2PNH A;  5EBD A;  2HHH Q;  2NTT A;  1Q86 C;  3VR2 A;  1VQI A;  4OWW B;  2DY8 A;  4A3L G;  2FIN B;  1LLR D;  4BBR G;  3TP7 A;  1F9P A;  2DNC A;  4PNY A;  1HZA A;  1TWH B;  2K5V A;  1A3V A;  3QOJ A;  4Y52 H;  4IO9 A;  2MJ8 A;  3EN2 A;  4KY5 A;  4GZY C;  5I2X A;  4PMW A;  4XYQ A;  1SLJ A;  2VUM B;  4LFB L;  1RD9 D;  1SE2 A;  2Q2U A;  1QUQ A;  1WFQ A;  4R9W A;  1SMY D;  2WV6 D;  5IOD A;  5BN5 A;  3U58 A;  4L6T B;  3OTO L;  5IT9 E;  1PFM A;  5IYC G;  3S17 H;  4LF8 Q;  4YCU A;  5J1Z A;  2Y0S G;  1K83 B;  1FYC A;  3RD4 A;  2B3G A;  1E7Z A;  3KUP A;  3J7A F;  3UI2 A;  1QCB D;  2QEJ C;  3M3Y H;  5DM7 3;  4JI2 Q;  5DM6 3;  2MO0 A;  3CCM A;  3PUY A;  1M4V A;  1D5X C;  4JCV E;  4R4I A;  4A3K H;  1PH9 A;  4L8J A;  3I4L A;  1VQJ A;  1OXX K;  1SRO A;  1PTO F;  1CA5 A;  4A3I B;  4C1N I;  2P5Z X;  3H6M A;  3X3M A;  4LFA Q;  5FLM G;  2NVY H;  4DR7 L; 
#chains in the Genus database with same CATH homology
 4O0A A;  4IJL A;  1YHQ A;  4JI7 Q;  2K5N A;  2ALY B;  1C0A A;  5M3M G;  1VQA A;  3HOZ H;  4DV1 L;  2WAQ G;  5IYB H;  4LWC A;  2D0P A;  4DUZ L;  1OXU A;  5C3E G;  2K14 A;  1WCM G;  1EWI A;  5M3F H;  3F2D A;  4OX9 Q;  4DV2 L;  5C0X J;  4HJ7 A;  4IPH A;  4BY7 G;  2NVT H;  1KHI A;  4OWT B;  4NXN Q;  3S1Q H;  1YHA A;  2OWO A;  2LXJ A;  3W5O A;  3J81 j;  1S3O A;  4UP7 A;  3CCS A;  1J5E L;  2HHH L;  1Q82 C;  3A0J A;  3HOV H;  1BBW A;  2UU9 L;  2KHJ A;  4A3F G;  4LF9 Q;  3S1R H;  2R7D A;  5JJK A;  1WOC A;  1HZ9 A;  2DUD A;  4P75 A;  4LFC L;  4B3R Q;  2RHQ B;  1KRT A;  2JA6 H;  3H0G G;  4DR6 Q;  4XTC S;  2I5M X;  5ELO A;  5JEA G;  3M85 A;  1N36 L;  2R7Z G;  3CC7 A;  1X3F A;  4HIK A;  1Y1V G;  3T1Y L;  4LF4 Q;  1YVC A;  2AKW B;  3ZJY C;  4DR1 L;  2R7F A;  3MEF A;  5J3B A;  1W2B A;  5M3M H;  4HJ9 A;  1VQ5 A;  3TS0 A;  1HZB A;  1Q81 C;  2E2H H;  4GKJ Q;  3G71 A;  2AWO A;  2WB1 E;  1PYB A;  2H5X A;  5IWA L;  4JI0 L;  3TRZ A;  2KHI A;  3S15 H;  5K36 G;  4LF7 Q;  4BY7 H;  4OWX B;  2YTY A;  4OO1 G;  4DV6 L;  3STB D;  2KBN A;  2QGQ A;  4DAM A;  2HIV A;  4YWM A;  3J81 i;  3RN5 A;  4LF8 L;  3AQQ A;  1D8L A;  2YTX A;  5M5W H;  3CME A;  1XNQ L;  1HNZ Q;  4BBS G;  1C9O A;  1IZ6 A;  2RF4 A;  4ME3 A;  4JI3 L;  2F4V Q;  1CKN A;  1LTL A;  1CKN B;  4GN5 A;  3H0G H;  3TRE A;  2Z6K C;  2IX1 A;  4HJ5 A;  4KI0 A;  4A76 A;  1EOV A;  3J7A 5;  1VQC A;  5FJ8 H;  1XPO A;  4PZ8 A;  4X62 Q;  4JI6 Q;  4LNQ A;  5LMN Q;  3FP9 A;  3AYH B;  3RZO H;  3T1H L;  3TEH B;  1K0R A;  1YJ9 A;  4HID A;  1LYL A;  3RLN A;  3AFQ A;  5IY0 A;  3D0F A;  2ZM6 Q;  1Q1E A;  2A19 A;  2IX0 A;  5H1S E;  3CXC A;  1OXS C;  5M5X H;  4LFA L;  4UPA A;  2PQA A;  5HGQ A;  4AQY L;  3I2Z A;  4A3D H;  4GNX A;  4A3B H;  2E5L Q;  3L7Z C;  2UUC Q;  4C2M H;  1TWA H;  2I5L X;  3EIV A;  2VQE Q;  1QZG A;  4JI7 L;  3ICE A;  2R93 G;  4OO1 I;  1HH2 P;  3PIP A;  5IE8 A;  1XPU A;  2NVQ H;  3CAM A;  3KYH C;  3CCQ A;  1PH5 A;  4LF5 Q;  3GTG H;  4BBS H;  2JK8 A;  4MZ9 A;  1LUZ A;  4A3G H;  4OX9 L;  3IRB A;  1BVS A;  1OXV A;  4NXN L;  5ELN A;  5IP7 G;  2N49 A;  4H02 A;  4DV6 Q;  1IBL Q;  4BA1 I;  1VQD A;  2KCT A;  3PO3 H;  1VQH A;  3AEV A;  3GD7 A;  3JAM i;  4LUZ A;  4YWL A;  3S1N H;  1TXY A;  4B3T Q;  1S40 A;  2BA0 A;  4B3M L;  2WFW A;  1RIP A;  1HZC A;  5BR8 Q;  4C3I H;  3I4N G;  4DV5 Q;  4AYB E;  3TS2 A;  4LF9 L;  1PH4 A;  3S2H H;  4WJ3 M;  2UUB L;  1A63 A;  4YY3 Q;  4B3R L;  2QEX A;  4QIW E;  1XJV A;  1QZH A;  1CUK A;  2NVX H;  4DR6 L;  3U50 C;  1I50 H;  1WYD A;  4LF4 L;  3KLW A;  4IPD A;  1Q7Y C;  1VQK A;  2CKZ B;  2CFM A;  3S16 H;  2R6G A;  2JA9 A;  2NZO A;  3HOU G;  1S72 A;  1HR0 W;  2E2J H;  4A3C G;  1A8V A;  1NE3 A;  3D31 A;  4A3E G;  4GKJ L;  3PV0 A;  3OW2 A;  1VQO A;  1GO3 E;  3GTM H;  4NB3 A;  5C0X I;  4LF7 L;  1TWC H;  4A4I A;  1VQ9 A;  1JE5 A;  2K5H A;  2LXK A;  1P8L A;  5IP7 H;  2B63 G;  3KFU A;  1HNW Q;  4DV3 Q;  2UXC Q;  4A75 A;  1SN8 A;  1UE6 A;  5IYC H;  5GAD C;  4JG2 A;  1NY4 A;  1PV4 A;  2KCM A;  1U5K A;  2HQL A;  4R4O A;  4YWK A;  2CWA A;  2JEA I;  2IT1 A;  1X65 A;  1MJE A;  1E1T A;  1JJC B;  3E0E A;  2KEN A;  4QY7 A;  2VQF Q;  1HNZ L;  4NXM Q;  2F4V L;  4GKK Q;  3CP0 A;  3PSI A;  4O2D A;  3I55 A;  2R92 G;  4PZ7 A;  3KJP A;  4GOP C;  1GM5 A;  1FVI A;  4QQB X;  1GVP A;  3BJU A;  1X56 A;  2ATW A;  2N78 A;  3UE0 A;  2MNA A;  4X65 Q;  5IP9 G;  2VZA A;  2Q2T A;  4X62 L;  4JI6 L;  2GVA A;  2JA7 H;  3CC2 A;  5LMN L;  4HJ8 A;  4B3M Q;  4KLK A;  4EX5 A;  2Z6K A;  4LUO A;  3ERS X;  2UUB Q;  1J6Q A;  1XTD A;  2DGY A;  3W1G A;  2ZM6 L;  4A3E H;  2MFI A;  2JA5 H;  1KIX A;  5FLM H;  3H15 A;  1E22 A;  2BH8 A;  2VY3 A;  4FDB A;  4YCW A;  4DR5 Q;  4DR4 Q;  1CSQ A;  1N34 Q;  2B63 H;  1B8A A;  2E5L L;  2UUC L;  3PUZ A;  2VQE L;  1YZ6 A;  2IHF A;  3F8T A;  1I94 L;  2ASB A;  3PO2 G;  1JJ2 A;  2VL6 A;  4LF5 L;  3H3V I;  3I4M G;  4JI4 Q;  4BA2 I;  5C3E H;  2K52 A;  1MIU A;  1WCM H;  3RLO A;  4WJ4 A;  1KXL A;  3KF6 B;  3J81 c;  2L15 A;  4L5Q A;  1KL9 A;  1K8A C;  2UUA Q;  1MKH A;  3MXN B;  5M5Y H;  1IBL L;  1VQP A;  1C7Y A;  1EIF A;  4RG1 A;  4B3S Q;  1CSP A;  3UDI A;  4DKA C;  5IP9 H;  4JI5 Q;  4B3T L;  2Q2H A;  1H95 A;  1BBU A;  2ID0 A;  1IXR A;  2VUM G;  1KAW A;  5BR8 L;  4A3F H;  4DV5 L;  1JMC A;  4JI8 Q;  4L5R C;  1PH6 A;  4YY3 L;  3S2D H;  2BA1 A;  1PH8 A;  3RN2 A;  3A5U A;  1EUJ A;  2R7Z H;  3GTK H;  4GLX A;  1TWF H;  1Y1V H;  2E8G A;  4UP9 A;  2Z0S A;  4DV7 Q;  2ES2 A;  2UXD Q;  1UE7 A;  1KRS A;  3ULP A;  4JV5 Q;  5LMU Q;  1I5F A;  3PO2 H;  1BKB A;  4LF6 Q;  1B7Y B;  1V9P A;  2JE6 I;  4DV4 Q;  4X64 Q;  1K8G A;  4A3M G;  4YHH L;  3K0X A;  4QGU A;  1VS0 A;  1N32 L;  2WB1 G;  1W3S A;  1E1O A;  4UP8 A;  4DR3 Q;  4HIM A;  4LUV A;  2YU9 H;  3UDF A;  1PH3 A;  1PFS A;  1GKH A;  4KHP Q;  5GRO A;  2OCE A;  3S1M H;  1PA6 A;  3M9B A;  3HKS A;  4DV3 L;  4MTN A;  2UXC L;  1HNW L;  1P16 A;  1VQE A;  4BXX G;  2ZTD A;  1EQR A;  1U0L A;  4DK6 C;  1I94 Q;  1Z47 A;  5AJ3 Q;  4JYA Q;  2Y0S E;  5C0X G;  4QL5 A;  2OQ0 A;  4GLA C;  3DLL A;  3BZC A;  3DM3 A;  2VQF L;  1NBW A;  1IBK Q;  4NXM L;  2JEB I;  2K4K A;  4GKK L;  3U4Z A;  1UE1 A;  3E9I A;  4DK3 C;  2YYZ A;  4BY1 G;  3M4P A;  4A93 G;  3HOY G;  1YBY A;  1GD7 A;  2B29 A;  3HKZ E;  3J80 c;  1HR0 Q;  4RMF A;  4X65 L;  3CCE A;  4A3J G;  4L5S A;  3KF8 B;  2D0O A;  2PI2 A;  1AH9 A;  3ER0 A;  2ZJQ A;  1X54 A;  3S24 A;  1YIJ A;  1Y1W G;  3GTQ H;  1KD1 C;  4JI1 Q;  4GOP A;  5JJI A;  2JJQ A;  3CPW A;  1XMO Q;  2LSS A;  1HNX Q;  1YEZ A;  1FJG Q;  4A3K G;  4PZ6 A;  3CD6 A;  2ZJP A;  3AFP A;  4K0K Q;  4GOP B;  5IYD G;  3KJO A;  3K81 C;  4C3H H;  3CF5 A;  1DGS A;  2HT1 A;  1G6P A;  3I56 A;  1IYJ B;  4P71 A;  4DR5 L;  4DR4 L;  4JOI C;  4IOC A;  1NMF A;  5LMN W;  1N34 L;  5C4X G;  1QUQ B;  1RL2 A;  1SRU A;  1UEB A;  3WWV A;  4P72 A;  2R93 H;  4TVA B;  2JA8 G;  4JBM A;  4IFD J;  3F1Z A;  1A62 A;  3F2B A;  3CMA A;  4JI4 L;  4YHH Q;  1VQB A;  3HOZ G;  2WAQ E;  5IYB G;  1N32 Q;  3HFZ B;  3FKI G;  4IJH A;  3J7Z C;  3PF5 A;  1X9N A;  3CQZ H;  1B70 B;  4BY1 H;  5M3F G;  2D62 A;  4X66 Q;  3CCR A;  3HOY H;  2UUA L;  3KOJ A;  3NEN A;  3W1B A;  3S14 H;  5E7N A;  2CQO A;  4JI5 L;  4A3J H;  4B3S L;  1NMG A;  1N33 Q;  1XNR Q;  3L0O A;  3HOW G;  3PUX A;  1EYG A;  3A5Z B;  4PG3 A;  3GTJ H;  4AIM A;  1PHJ A;  2F52 A;  1OXT A;  1YNX A;  2JA8 H;  3ULL A;  3RR5 A;  2GVB A;  2HIX A;  1AE2 A;  2AWN A;  1VQM A;  3HOV G;  2I5H A;  3I4N H;  4X6A H;  4AYB G;  1XPR A;  4JI8 L;  1JT8 A;  3PUV A;  4JBW A;  2K75 A;  1YI2 A;  1OTC A;  1L1O C;  1SFO H;  3STB C;  1KC8 C;  3M4Q A;  4APV A;  3B6Y A;  4GLV B;  1PH1 A;  4L5T A;  2JA6 G;  2IY5 B;  1KQS A;  3G48 A;  5C4X H;  3K8A A;  2Q2I A;  3PCO B;  3PUW A;  4DV7 L;  2UXD L;  4DR2 Q;  1Y14 B;  5IT9 c;  5FLX c;  1Q12 A;  4TQU S;  3HOX G;  1R9T H;  1G51 A;  4JV5 L;  5LMU L;  4UY8 C;  1HJP A;  3HOU H;  1X3E A;  3CCL A;  4LF6 L;  3NEL A;  4X64 L;  2F3I A;  4DV4 L;  4A3C H;  4P73 A;  3SGI A;  4DV0 Q;  1CKM A;  3FKI H;  4DR3 L;  4LFB Q;  2A1A A;  4KHP L;  1QVC A;  4OON A;  3CCJ A;  2CCZ A;  1EQQ A;  3H3V H;  3K80 C;  1E24 A;  2PI2 E;  3NBH B;  1L0W A;  2NN6 G;  3HOW H;  3VDY A;  3OTO Q;  3CPF A;  3EBE A;  2RHS B;  1K3R A;  5AJ3 L;  4JYA L;  1X3G A;  3KDF A;  3BU2 A;  3KF6 A;  2GN5 A;  1IBK L;  1LM0 A;  3JC6 6;  3KDF B;  3GTP H;  1PVO A;  2I0Q A;  1UWV A;  3OYY A;  1YJN A;  2R92 H;  1N9W A;  4DNI A;  4Y7N H;  3PIO A;  1ASZ A;  2OQK A;  1HR0 L;  5GAE C;  5C44 G;  4DUY L;  1VQL A;  1FGU A;  3HOX H;  4NPS A;  5FJ8 G;  2C35 B;  4AH6 A;  2MO1 A;  1VCI A;  2N3S A;  4JI1 L;  2QA4 A;  4ALP A;  1TWG H;  1XMO L;  4K0K L;  1HNX L;  1WJJ A;  1Q46 A;  1FJG L;  3PF4 A;  4JC0 A;  3I7F A;  1PH2 A;  3M4O H;  1CKO A;  1K9M C;  2VW9 A;  3M7N A;  1WI5 A;  1YHB A;  2ZTE A;  3GTL H;  2VS1 A;  3LGJ A;  3NEM A;  4HIO A;  3RNU A;  2YV5 A;  5GQO A;  1X6O A;  3G4S A;  1SE8 A;  1X55 A;  1VQN A;  1IBM Q;  4IFD G;  2XGT A;  1Q1B A;  2UXB Q;  2CWP A;  4P74 A;  1VQ6 A;  4A3D G;  3TQY A;  3RLF A;  1VQ7 A;  3G6E A;  1XMQ Q;  2EQS A;  2YTV A;  4A3B G;  3FHW A;  4DR7 Q;  1JJG A;  1FL0 A;  2FXQ A;  3I4M H;  2NN6 I;  4R4T A;  4JOI A;  4DV1 Q;  2N8N A;  1Z9F A;  4DUZ Q;  1TWH H;  3UDG A;  3RZD H;  4X66 L;  4A3G G;  4DV2 Q;  3UE1 A;  2JQO A;  2K50 A;  3K7U C;  1QVF A;  1L2F A;  3CCU A;  2RCN A;  1VQG A;  2IHE A;  5HY6 A;  4JI2 L;  1QVG A;  5C44 H;  4JBJ A;  1UE5 A;  1N33 L;  1XNR L;  3PO3 G;  2XTI A;  4YCV A;  5JJL A;  2PNH A;  4GN3 B;  4DPG A;  3L2P A;  1J5E Q;  2AHO B;  2HHH Q;  1AE3 A;  3CC4 A;  1VQF A;  1Q86 C;  4A3I G;  2VUM H;  4R4Q A;  4DAY B;  2UU9 Q;  4IPG A;  1VQI A;  4OWW B;  3JAM c;  3GDE A;  4A3L G;  4GN4 B;  2V1C C;  4EQ5 A;  2OTJ A;  4LFC Q;  2OTL A;  2WP8 J;  4BBR G;  1HZA A;  4R4C A;  1N36 Q;  4DUY Q;  2K5V A;  1JB7 A;  1YIT A;  1E3P A;  4DR2 L;  4POG A;  1V1Q A;  3T1Y Q;  4IO9 A;  3GTO H;  1K83 H;  4Y52 H;  4MNO A;  2PQA B;  3EN2 A;  5JEA J;  1MJC A;  1SMX A;  4DR1 Q;  1L1O A;  4IFD I;  1N8R C;  4PMW A;  4GNX B;  4A3M H;  1SLJ A;  4QJF A;  1IL2 A;  4IOA A;  1L1O B;  1NTG A;  1T9H A;  4C3J H;  4DV0 L;  1O7I A;  3Q8D A;  4XIG S;  4J15 A;  5GAG C;  1G29 1;  1QUQ A;  1PH7 A;  1WFQ A;  5IWA Q;  1M1K C;  2Q2U A;  4JI0 Q;  1I6H H;  1PYS B;  2NZH A;  2ZJR A;  2BH2 A;  4BXX H;  2VNU D;  3U58 A;  2E2I H;  3OTO L;  4KHZ A;  4R1J A;  5IYC G;  3S17 H;  5EAY A;  4LF8 Q;  4LW1 A;  4YCU A;  2Y0S G;  2ZTC A;  4A3I H;  3J80 i;  1XNQ Q;  3ULJ A;  4GS3 A;  2EIF A;  3F2C A;  2B3G A;  1K73 C;  1E7Z A;  4JI3 Q;  4A3L H;  4POF A;  4A93 H;  3BZK A;  1M90 C;  1NJI C;  3M3Y H;  1D7Q A;  3HKZ G;  1I3Q H;  4BBR H;  3A74 A;  4JI2 Q;  2MO0 A;  3I4O A;  2MQH A;  1YJW A;  4OXP A;  3CCM A;  2EXD A;  1VQ8 A;  3PUY A;  1Y1W H;  2JA7 G;  5C4J H;  2PMZ E;  4JCV E;  4R4I A;  1A0I A;  4A3K H;  1PH9 A;  5DLQ E;  3T1H Q;  5IYD H;  4GNX C;  3U4V A;  1VQJ A;  1OXX K;  4IPC A;  1SRO A;  1VQ4 A;  4LFB L;  3CW2 C;  3PGZ A;  2JA5 G;  4DR7 L;  1EIY B;  3E9H A;  3K7A H;  4LFA Q;  5FLM G;  5GAH C;  2AMC B;  3GO5 A;  3CCV A;  2NVY H;  1IBM L;  1EFW A;  2UXB L;  4AQY Q;  2A8V A;  1Q8K A;  1ASY A;  1SR3 A;  1V43 A;  3UDX A;  4HJA A;  1XMQ L;  4JBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...