4DAMA

Crystal structure of small single-stranded dna-binding protein from streptomyces coelicolor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
113
Chain Sequence
b'SMNEIMICAVGNVATTPVFRDLANGPSVRFRLAVTARYWDREKNAWTDGHTNFFTVWANRQLATNASGSLAVGDPVVVQGRLKVRTDVREGQSRTSADIDAVAIGHDLARGTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein 1
publication title Structure-function relationships of two paralogous single-stranded DNA-binding proteins from Streptomyces coelicolor: implication of SsbB in chromosome segregation during sporulation.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Dna binding protein
total genus 20
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4damA00
1YVCA 3OYYA 4LF6Q 2QA4A 1HZAA 1EUJA 3J7A5 1YJ9A 1HH2P 3CCSA 4R4TA 4DK3C 1CSQA 1V9PA 5JEAJ 1XNQL 4AIMA 3K0XA 2I0QA 1L2FA 4A3CH 2K75A 3BU2A 5LMUQ 3I55A 1VQHA 2VQEL 1VQCA 1D7QA 3PF5A 4B3SL 2ATWA 4A3LH 4OWTB 1EFWA 4P72A 3T1YQ 5C3EG 3PUWA 4LF5L 4DR4Q 4L5SA 1G291 3H3VI 2PNHA 3PCOB 2ZTDA 4DR1L 2YTYA 5ELOA 4AYBE 4PZ6A 2NVTH 1VQGA 3UDXA 4LWCA 1LUZA 2UU9L 4LF9Q 2HT1A 5C0XI 3S2HH 3MEFA 1W3SA 3K7AH 4DV4L 1SRUA 3W1BA 4C3HH 4LF7L 1OXVA 4QIWE 2E5LL 2VZAA 3S14H 1PVOA 1I50H 1NE3A 4TVAB 2CFMA 2EIFA 4JI2Q 5GAEC 4A3KH 4A93H 1KXLA 4GOPB 3I4NH 4DAMA 1RL2A 2C35B 4A3LG 2JA8G 3F8TA 4IFDJ 3GO5A 3TREA 4L5RC 3H0GG 3PUYA 1IBLL 1VQ7A 4X66L 1E7ZA 2IHEA 2IHFA 4UPAA 4DR7L 2I5HA 4GN4B 4YCWA 5AJ3L 3HOVG 3S15H 4YHHQ 4LF8Q 3CD6A 1NJIC 5M3MH 4LFCL 1J5EQ 3GTQH 4HJ9A 4BY7H 2RCNA 1LYLA 5GQOA 2YTVA 3J7ZC 3PUVA 1M1KC 1NBWA 4IOAA 4JI1L 4JI7Q 2N8NA 2OTLA 4L5TA 1IYJB 2HHHL 1EYGA 3U4ZA 2PQAB 4HIMA 1WJJA 4JI8Q 4DUZQ 1N34Q 2E2JH 3KJOA 1AE3A 1SLJA 1VQEA 4A3KG 4A93G 4DV3Q 3I4NG 3FKIH 4A3FG 3M4PA 1Q86C 1RIPA 2F3IA 1OXUA 1UEBA 4AQYL 3U4VA 3HKSA 2BH2A 2JJQA 4JBMA 3GTOH 3PO3H 1N33L 4JI3L 4YY3Q 4UP8A 2D62A 3CCMA 1Y1WG 2MQHA 4RG1A 4YWMA 4DV1L 5EAYA 3CCLA 5C0XG 1X56A 4DK6C 5M3MG 4L5QA 3I4MG 1UWVA 3LGJA 2AMCB 3S1QH 1QVCA 4BY7G 4DV5Q 1LM0A 1Q1BA 4J15A 4LFAQ 3CCJA 5ELNA 2BA1A 4YWLA 1XPUA 3GTKH 1KHIA 3A5UA 2UUAL 4LFBQ 1PH1A 3L2PA 4OWWB 1CKMA 4TQUS 1N36Q 2AKWB 2HIXA 2NN6G 2YV5A 3KF6B 1CSPA 4DR2Q 4B3ML 4HJ8A 4X62L 3KDFA 4YWKA 1KD1C 1TWFH 2R93G 1W2BA 3PIPA 4JG2A 1K9MC 1OXTA 4R4IA 1HNXQ 1E1TA 1GO3E 4JI4L 4IPCA 5C4XH 3JAMi 4DV6Q 3RN5A 5K36G 2NZOA 1PH4A 1EOVA 1PH9A 3T1HL 1G6PA 5HY6A 3E0EA 2VY3A 4DR5L 4HJAA 4LW1A 1B70B 2OQ0A 4NXML 4JV5Q 2MFIA 1CKNB 3CPFA 3S17H 2ZTCA 4OXPA 1VQNA 2JA7G 2VQFQ 2Q2IA 4R4OA 3F2BA 2GN5A 1K73C 1T9HA 1WFQA 4RMFA 5IY0A 3B6YA 2D0OA 5C4XG 1TWHH 1N8RC 3KYHC 4A4IA 4C2MH 3EN2A 4BBRH 4HIKA 3HOYH 3L7ZC 1K0RA 4JI6L 1X3EA 2R7DA 3OTOQ 4DUYL 3U50C 1Q7YC 2Q2UA 2UXCL 2VNUD 4DV7L 2KCMA 3RLFA 4OX9L 1VQAA 3PIOA 1L1OA 1JJ2A 1PH5A 3CMAA 1I6HH 1VS0A 1YHQA 2IY5B 4APVA 5C0XJ 4HJ7A 2QGQA 3RNUA 1XNRQ 4KI0A 5GAGC 1HNWQ 4IJHA 3CQZH 2Q2TA 2UUBL 1V43A 5IYBH 1VQMA 2CWAA 4MZ9A 4LF5Q 2ALYB 3AEVA 2YTXA 2ZM6L 4DR3L 2MNAA 1E1OA 4O0AA 3SGIA 1U5KA 2B63G 3DM3A 1UE6A 1HNZL 3PGZA 2JA8H 2UXBL 3HOYG 4BBRG 4JBWA 5M5XH 4P73A 4GNXA 1Q81C 4A3DG 1VQFA 3H0GH 3F2DA 4KHZA 3RZDH 3PUXA 3S1NH 4ME3A 5DLQE 3EBEA 4JI5L 2E2HH 3I4MH 3WWVA 4O2DA 2E5LQ 1FJGQ 3D31A 2FXQA 1X6OA 4IPHA 2VUMH 5IWAQ 3HOVH 2HQLA 3CC2A 3RZOH 1HZBA 2CQOA 1Q12A 2N3SA 3FHWA 3CC7A 3VDYA 4P74A 3CXCA 3TS2A 4LF6L 4BBSH 3PV0A 2F52A 3A0JA 1I3QH 3ERSX 3HFZB 1IBKQ 4DKAC 1E24A 3M7NA 1VQIA 4A75A 2LSSA 3UE0A 4H02A 5IYBG 1JMCA 4X65Q 4JI0L 3CF5A 3STBC 4POGA 2OWOA 5LMUL 4B3RL 2GVBA 2NN6I 4X66Q 4A3FH 2A1AA 1A0IA 4GLXA 3G6EA 4JBKA 1KRTA 3A74A 5AJ3Q 1GM5A 1K83H 4LUVA 5C4JH 1IZ6A 2WFWA 3AYHB 4QL5A 3T1YL 3G48A 4DR4L 2Q2HA 1Y1WH 4NB3A 2EQSA 3FP9A 1YHAA 3KF8B 4YCUA 2AWNA 4JI1Q 5C44H 1TWCH 3CPWA 1OTCA 2VUMG 4KHPQ 1IBMQ 4OO1G 1X54A 5IYCH 2R7ZH 4K0KL 3HOUH 4AH6A 4BBSG 1E22A 4BY1G 2NVXH 4LF9L 3HOXH 1Z9FA 1B8AA 5IT9c 1DGSA 1X9NA 1CKOA 4GKKQ 2UXDL 3EIVA 1I5FA 3RN2A 2CKZB 1VQ4A 2E8GA 4QQBX 5E7NA 3CCVA 3HOWG 3S2DH 1PH6A 4BXXG 3H15A 4JI3Q 1YZ6A 1HZ9A 4JI2L 3M4QA 2R93H 2BA0A 3CCUA 1R9TH 2JEAI 1NMFA 2F4VQ 4DAYB 4OWXB 4QY7A 3IRBA 3AQQA 4DV2Q 4BA1I 1G51A 4PMWA 1JE5A 1YNXA 2K5HA 3J81j 2RHQB 2HIVA 1XMOQ 1PH3A 1Q1EA 1YBYA 4X64Q 5C44G 1VQOA 1SMXA 2Z0SA 2UUAQ 5IYCG 2R7ZG 3GDEA 3HOUG 2IX0A 4YHHL 1JT8A 4POFA 2QEXA 2ZJRA 3HOXG 1J5EL 2IT1A 4B3MQ 4IPGA 4GKJL 2N49A 3NELA 1WCMG 2A8VA 3S16H 1YITA 4FDBA 3K7UC 3NBHB 4JI7L 2UUCQ 2ZJPA 2PI2A 4LF4Q 1C7YA 4B3TQ 1QVGA 4JI8L 4DUZL 1SR3A 1VCIA 2YYZA 1Q82C 1PHJA 1N34L 2JA7H 1A63A 1AH9A 4DV3L 2Z6KC 1YI2A 3ICEA 2OQKA 4HJ5A 5JEAG 1MKHA 1GD7A 4QJFA 3K8AA 2JQOA 2B29A 1WYDA 4YY3L 3CAMA 2R92H 2VW9A 1HR0L 1XJVA 3W5OA 1BBUA 2BH8A 4NXNQ 2OTJA 4DV0Q 3S1RH 2PMZE 1X3FA 4HIDA 5JJIA 3CMEA 1EQQA 4P75A 2K4KA 2WAQE 2JA5G 4DV5L 2RHSB 3W1GA 5FJ8G 1QUQA 1L1OC 5M5WH 3PUZA 3GTLH 3J80c 3PO2G 1CUKA 4DR6Q 1UE7A 3RLOA 4LFBL 4A3IG 2Z6KA 1N36L 2K14A 1X3GA 3J81c 1EIFA 1KRSA 5BR8Q 4JI6Q 2N78A 3UDFA 3M4OH 1OXXK 2OCEA 3KDFB 4DV7Q 2B63H 4A3JG 2R6GA 4OX9Q 3Q8DA 2R92G 4A3DH 4UY8C 2NVQH 3ULJA 4GNXC 4DV6L 3E9IA 2LXJA 4C3JH 1U0LA 1VQ9A 1XNQQ 2K5VA 1VQPA 2AWOA 4JYAL 3I7FA 4JOIA 1XMQL 2ASBA 4GN3B 4LUOA 3NENA 1TXYA 2KHJA 4YCVA 3S1MH 4OO1I 1YEZA 4GOPC 4A3EG 3I2ZA 4PG3A 4Y52H 2VQEQ 4JBJA 4QGUA 2V1CC 3JC66 1PH2A 4JV5L 1FGUA 1GKHA 1KIXA 1I94Q 2ES2A 4B3SQ 1N32L 1QZHA 3ZJYC 5FLXc 4Y7NH 2VQFL 1JB7A 2WB1E 3D0FA 1XPOA 3KOJA 1VQ8A 1QVFA 1Z47A 1ASYA 4DR1Q 5FLMG 3NEMA 1ASZA 1YJWA 1KL9A 1J6QA 2EXDA 2I5LX 3AFQA 4P71A 2UU9Q 2YU9H 4KLKA 1VQJA 2D0PA 2JE6I 1A62A 3F2CA 4A3MH 4DV4Q 1SFOH 4LF7Q 2H5XA 2WAQG 3OTOL 2AHOB 3CC4A 3A5ZB 5LMNL 1Y14B 1YHBA 2A19A 4GOPA 4A3BH 1S3OA 1VQDA 4JI0Q 3UDIA 4DPGA 4BY1H 4B3RQ 1SE8A 5J3BA 1L0WA 2I5MX 4R1JA 1L1OB 1P16A 1WOCA 3CP0A 4JCVE 2R7FA 1XNRL 1SROA 2KCTA 5IP9G 1IBLQ 3HOWH 4BXXH 5IYDG 1HNWL 2NVYH 1N9WA 5GADC 4DR7Q 3I56A 3L0OA 5IE8A 3GTPH 4EQ5A 4IJLA 4LFCQ 2CWPA 5IP7H 1S40A 4K0KQ 4A3MG 2PQAA 1VQ5A 4X6AH 4WJ3M 1WI5A 2JA9A 3RLNA 4GNXB 2HHHQ 1E3PA 4A3BG 2UXDQ 2ID0A 1FJGL 1KC8C 4A3CG 4OONA 4GN5A 4R4QA 5IWAL 3DLLA 1PYBA 3HOZH 2Y0SE 1IL2A 4A3GH 1O7IA 1VQBA 1WCMH 1HR0W 2CCZA 4UP7A 1AE2A 1BVSA 1PFSA 4AQYQ 3HKZG 1FL0A 1EWIA 3UDGA 1JJGA 2XGTA 2WB1G 1IBKL 1N33Q 3I4OA 5M3FH 2K5NA 4X65L 3CW2C 3GD7A 1JJCB 1NMGA 1NTGA 1KAWA 4NPSA 3H3VH 4DV1Q 1YJNA 5GROA 3U58A 2PI2E 3M3YH 1PYSB 2NZHA 4IPDA 3RR5A 5IP7G 3CCQA 1D8LA 1GVPA 3TRZA 1XTDA 4EX5A 1S72A 3GTMH 1YIJA 1PH8A 1KQSA 1EIYB 2VL6A 4GKJQ 2B3GA 3KF6A 4KHPL 3OW2A 1B7YB 2LXKA 3BZKA 1MJEA 4LF8L 3MXNB 2JEBI 2L15A 3M9BA 3TS0A 1IBML 3HOZG 1FVIA 3G4SA 4X62Q 2JA5H 4BA2I 4A3GG 4MTNA 5FJ8H 4IFDI 1OXSC 1VQLA 5HGQA 4GLVB 3PO2H 4GKKL 3E9HA 4JI4Q 3F1ZA 5M3FG 4A3IH 2KENA 3AFPA 3PSIA 5GAHC 1M90C 1NY4A 1HR0Q 4PZ7A 1HJPA 3G71A 2K50A 1P8LA 4AYBG 3T1HQ 2JK8A 1K3RA 3K80C 3BJUA 2F4VL 4A3JH 1PH7A 4DV2L 4HIOA 1CKNA 4DR5Q 1I94L 4JC0A 1C0AA 1H95A 1XMOL 1XPRA 1QZGA 4NXMQ 2KHIA 1TWGH 5JJKA 5M5YH 4X64L 1TWAH 4IO9A 1Q8KA 3J80i 4ALPA 2Y0SG 2ZTEA 3ER0A 1Y1VH 4LFAL 3J81i 3FKIG 5H1SE 3GTJH 1PV4A 1V1QA 4A76A 3K81C 4JOIC 4A3EH 2MO1A 2UUCL 1BKBA 3CCRA 4LF4L 1HZCA 2RF4A 3TEHB 4B3TL 5LMNW 2JA6H 3PO3G 4DR2L 1BBWA 1VQKA 1X65A 1LTLA 3S24A 4DUYQ 2KBNA 4LNQA 2UXCQ 1HNXL 2DGYA 2MO0A 5FLMH 3GTGH 1UE1A 4MNOA 3ULLA 1K8AC 4XIGS 4JYAQ 4C3IH 3JAMc 4GLAC 1XMQQ 2IX1A 3KLWA 2VS1A 1Q46A 2ZJQA 4NXNL 4IFDG 4DV0L 1Y1VG 3PF4A 2XTIA 1PA6A 1N32Q 1SN8A 3ULPA 2UUBQ 4GS3A 1EQRA 2ZM6Q 4DR3Q 1K8GA 3BZCA 1MJCA 2WP8J 2JA6G 4DR6L 1HNZQ 1QUQB 2UXBQ 4WJ4A 3HKZE 3CCEA 1MIUA 5IP9H 4DNIA 4IOCA 5IYDH 4PZ8A 4R4CA 1C9OA 5C3EH 5BR8L 3M85A 4JI5Q 1VQ6A 3KFUA 2K52A 4XTCS 1IXRA 5JJLA 4LUZA 4UP9A 3STBD 5LMNQ 1UE5A 3TQYA 3KJPA 3UE1A 2GVAA 1A8VA 1X55A 2E2IH 2DUDA
chains in the Genus database with same CATH superfamily
2WIIB 3A7LA 1YJ9A 1FNVA 3CCSA 4R4TA 4DK3C 1XNQL 4AIMA 3I4LA 5FLXE 5LMUQ 3SEBA 2A6EC 4O42A 1KDCA 1TWHB 3PF5A 3I72A 4MHEA 1D2BA 2QW7A 3EJIA 3T1YQ 2R61A 3PUWA 5C3EG 5HURA 3BS1A 2F4IA 1XWEA 1G291 4DR1L 2F0UA 4OELB 1I4HA 5ELOA 3OWEB 2NVTH 3A55A 4X3KA 4DK0A 2HT1A 4N9PA 4DV4L 1SRUA 3W1BA 4CKEA 4YIJA 3D6CA 1PVOA 5IT9L 2EIFA 1D1KA 5GAEC 4DAVA 1S5DD 4UAIA 1AZPA 4A3LG 3P1HA 3GO5A 3H0GG 5J22A 1DONA 1D1IA 3L3OC 2IHFA 3V2TA 1VF7A 2K01A 4HEDA 3AB9A 4YHHQ 4LF8Q 5CV7A 1NJIC 3RZOB 1LYLA 3J7ZC 4C3HB 5IT9E 1M1KC 1F9PA 2EYLA 2XIWA 1PZKD 2N8NA 2OTLA 2HHHL 3S14B 1EYGA 3U4ZA 1ML0D 4JI8Q 4A3KB 3NXWA 1KLUD 1VQEA 3I4NG 3FKIH 4K2LA 4OIJA 1TS5A 5C4JB 4JI3L 4RCOA 4RAUC 4UP8A 4YY3Q 1KDBA 4RG1A 4YWMA 3CCLA 5EAYA 5C0XG 1X56A 2GA4B 3VA7A 5M3MG 1UWVA 1EZ8A 4J15A 4LAAA 3CCJA 3X3MA 3TN2A 3GTKH 1KHIA 1KABA 3A5UA 1PH1A 3L2PA 1M4VA 4TQUS 1JOKA 2AKWB 2YV5A 3KF6B 1CSPA 4B3ML 5C6AA 1V1PB 4YWKA 4JG2A 4C1NI 3Q22A 4R4IA 1E1TA 1SXTA 2Z9HA 3CKIB 3JAMi 2PYKA 2LY7A 5DEHA 4DV6Q 3RN5A 1TY0A 5K36G 1HFNA 1EOVA 1CM9A 5C4HA 4EGVA 4XQNA 1G6PA 2B2VC 4FVMA 3E0EA 4DR5L 4HJAA 3MA2B 1B70B 1EYAA 3P7JA 3OSOA 4NKLA 2L55A 2DNCA 1CFMA 1RTOA 3QG1A 2VQFQ 2JA7G 1TY2A 1CTMA 4R4OA 2C9OA 2VB3X 5BN5A 2L9HA 1KLGD 1T9HA 1MSGA 4RMFA 3B6YA 2D0OA 3NP8A 3ND9A 4OL7A 1TWHH 4A4IA 4C2MH 4J1MA 1K0RA 1GUGA 2Q2UA 5EJWA 1Q7YC 2VNUD 4DV7L 1DJRD 1II3A 2F0DA 4OX9L 1F2MA 3S17B 1L0YB 5LHY1 1YHQA 2IY5B 1QJOA 1HNWQ 4CJ0B 4IJHA 1JQYD 2Q2TA 1IHZA 1WTPA 1PZJD 2YTXA 3MXPA 4ME5A 1UE6A 2UXBL 4BBRB 4A3DB 5M5XH 4GNXA 1Q81C 3LX0A 1VQFA 3PUXA 2PPBC 4C3JB 4ME3A 5E4XA 2PZTA 3KK7A 4JI5L 3WWVA 2E5LQ 5JVG3 4IPHA 3CC2A 3RZOH 3CXCA 1F2YA 1I3QH 4F8MA 1IBKQ 1ICWA 4DKAC 3SK6A 3M7NA 1Y69U 4H02A 5CV9A 2GVBA 3GQBA 2JA8B 4GLXA 3LNNA 4FO2A 1SMYC 2QF7A 4K8JA 5C4JH 3QJYA 3AYHB 3MXNA 2VUMB 1YHAA 2WINB 1X54A 3A7AB 3HOUH 4RHRA 1EU3A 2SOBA 5EPJA 4BBSG 1E22A 3E6ZX 4LF9L 2RKSA 1SYEA 1X9NA 3G6JB 4CHTB 4GKKQ 1SAPA 2E8GA 3CCVA 3HOWG 1LTAD 3S2DH 1HZ9A 1EU4A 2A68D 2ZXPA 3WOFA 1NMFA 2ZXOA 4RGTA 4QY7A 4MN3A 2OF1A 2XWBB 3FDTA 4PMWA 1XMOQ 2HIVA 3C1EA 1Q1EA 4X64Q 2KA7A 5F2DA 5K5PA 2XSCA 3GDEA 5IYCG 1T5EA 2A6HD 2R7ZG 4U68A 3HOXG 1J5EL 2IT1A 2N49A 3NELA 1WCMG 4FDBA 3K7UC 3NBHB 2WKCA 2F0TA 2PI2A 1C7YA 1PHJA 1R9TB 2Z6KC 1YI2A 2JP1A 2OQKA 4H7BA 4QJFA 3R93A 5CV8A 2R92H 3CRLC 4DXFA 1DOMA 1GUNA 1V8QA 4OHJA 4DFAA 1QG7A 2K33A 4IUVA 4HIDA 1EQQA 1PYWD 2JA5G 2WAQE 3R2IA 5J1ZA 1H9SB 3W1GA 2F0JA 4OIKA 2V4DA 4KY6A 5BN4A 3PO2G 3FRPB 1CUKA 1IW7D 2M2LA 4DR6Q 3NHHA 2Z6KA 1N36L 2B2WC 3J81c 1W6JA 3MZ5A 1B1ZA 5BR8Q 1OXXK 2OCEA 2B63H 1G8ZD 4A3DH 4JW0A 3S1RB 3ULJA 2LMCB 5I6YA 1JOQA 3MWYW 4C3JH 1XNQQ 4EVOA 1VQPA 1JB3A 3DEOA 3U9SA 1JE4A 2Z4IA 2ASBA 2KUMA 3KLSX 2KHJA 4OO1I 1AEXA 4A3EG 2B2WA 3DWAA 2DJGC 1PH2A 1JCKB 1FGUA 1QOHA 1KIXA 2L12A 3OMGA 4QF4A 3M4OB 1XPOA 1ASYA 4DR1Q 3NEMA 5LL6S 4A3MH 3F2CA 1S4ZA 4DV4Q 2WAQB 1SFOH 2H5XA 1DD2A 1F9RA 1MI2A 4A3BH 2B39A 4B3RQ 1SE8A 5J3BA 4E6IA 1L1OB 1WOCA 3CP0A 4KN7C 2KCTA 1B4OA 3J7AV 3T53B 3VR2A 3AU7A 4G7OC 4KD3A 5IE8A 3GTPH 4EQ5A 1EYCA 2A69C 3CU7A 2XN9C 1VQ5A 4FF1A 4X6AH 2JXMB 2FHTA 1WI5A 2HHHQ 3RLNA 5HGTA 1EZ6A 3VR6A 5G3LF 1KC8C 1QWYA 5A35A 4GN5A 1H9RA 4R4QA 1EIHA 1PYBA 3W2DA 1IL2A 1O7IA 1NAPA 4L8JA 4XDXA 2CCZA 1PRTB 2EZVA 3MAQA 1FL0A 3UDGA 4RGOS 2K03A 2NVYB 5ELBA 1ENAA 1BXTA 3GD7A 4X65L 2ICIA 2EYOA 3HG9A 1YJNA 1TR5A 1ICFB 5IP7G 2NB0A 3CCQA 3TP6A 1S72A 3S2HB 4GKJQ 2RVLA 4KHPL 2F3WA 3OW2A 2MUYA 1CA6A 1STGA 1PFNA 4LF8L 3M9BA 1GUWA 4BA2I 1WTXA 5IOCA 3V05A 1VQLA 5HGQA 1GHKA 3K6OA 3E9HA 5M3FG 1HA5A 3IL8A 3AFPA 4XQJA 4XQQA 3MHBA 3G71A 1YNNC 2K50A 3K80C 5ELFA 2F4VL 1PH7A 1H95A 4DR5Q 4JC0A 3QO2A 2KHIA 2A73B 4DK1A 5M5YH 1D5XC 1XXGA 2A68C 2XWJB 2ZTEA 3Q24A 2E2JB 1PTOC 1IYVA 4JVZA 3J81i 2EY5A 1D5ZC 1V1QA 4A76A 2MO1A 4ZYSA 4LF4L 3EVQA 3GTOB 1D5MC 1GXDC 3PO3G 1EQVA 2I07B 2A6HC 2ENBA 5EPLA 2KBNA 4HMIA 1EYDA 5FLMH 1IL8A 1SJED 1UE1A 4KY7A 2A6ED 1TWGB 1TWAB 1Q46A 1MHWC 1H9KA 4IFDG 4DV0L 2QDLA 1Y1VG 2XTIA 1IKLA 1PA6A 1KNAA 1TWFB 4GS3A 1K8GA 3BZCA 1JOOA 1MJCA 1NUCA 2JA6B 2WP8J 3QWNA 1NR4A 2UXBQ 2X69A 3HKZE 3CCEA 2CHBD 4ABNA 4DNIA 4IOCA 3GV3A 5C3EH 3GTGB 3M85A 4JI5Q 5JJLA 1IXRA 4C3IB 4LUZA 4UP9A 3WOEA 3STBD 1BCPD 1IW7C 4DA2A 5E1FA 3DWQA 1Y8NB 1X55A 3DEPA 1YVCA 3OYYA 2QA4A 3J7A5 1A3VA 1EUJA 2RBMA 1V9PA 4KMUC 1L2FA 4A3CH 4KN4C 1VQCA 1D7QA 4A3LH 4L6TB 2HD3A 4OWTB 1EFWA 2AQ2B 1R4QB 4L5SA 1U4PA 2PW7A 3CHBD 2FJ2A 2PNHA 3PCOB 4ZUJA 2YTYA 4AYBE 1RF2D 1VQGA 3UDXA 4FF2A 2SNSA 2UU9L 4LF9Q 1C8CA 3S2HH 1I6HB 3K7AH 2QKIC 4HN7A 4LF7L 2E5LL 1RKNA 5EBCA 2VZAA 4UDUC 1NE3A 3Q6SA 2F0HA 3HKZB 3SVMA 3TP7A 4GOPB 4DAMA 3I4NH 2JA8G 2N55A 4L5RC 3PUYA 1HA6A 2D5DA 1E7ZA 2E2HB 3E0JA 1C4QA 4K5WA 2DY7A 2I5HA 3HOVG 1EOTA 4YCWA 5C0XH 3CD6A 5M3MH 4LFCL 1J5EQ 4NW2A 5GQOA 4IOAA 3VYRA 4L5TA 1IYJB 2PQAB 2FMMA 5EKLA 1WJJA 4HIMA 1FR3A 1I4QA 2E2JH 2E74C 4G7ZC 4A93G 4A3FG 2O5IC 1RIPA 2NWGA 1G6ZA 1OXUA 2BDOA 4AQYL 1J9OA 1WTOA 2BH2A 1K83B 1SNQA 3GTOH 4IZ8A 3CCMA 2M00A 4PNYA 1DYQA 5K36H 2X6GA 1CQFA 4DK6C 4L5QA 2PW5A 3LGJA 4BY7G 1Q1BA 4ODGA 3N6RA 1G91A 1GUSA 5ELNA 2BA1A 3M7GA 1O80A 3NBIA 4U673 1N36Q 4XYOA 1LT4D 2VB2X 4DR2Q 2NZ1D 3KDFA 2R93B 1TWFH 3MXGA 1W2BA 1OXTA 3R8BA 4JI4L 2NZOA 3T1HL 1L0XB 1SBBB 2BCOA 1ILPA 3GTKB 4ZQ3A 5CV4A 4LW1A 5CORA 2OQ0A 1QB5D 3K0YA 3C46A 4NXML 5FO9B 2ZTCA 1HPCA 3ONAB 1ZYRC 1VQNA 1GUTA 4H44C 1K73C 1PTOF 1X3PA 1STBA 5C4XG 1EY5A 1X3EA 1Y8PB 2UXCL 1FGBD 4X3UA 1H9MA 4KHVA 1VQAA 3PIOA 1JJ2A 2H4OA 1SMYD 5D3DA 5M9OA 1I6HH 2EYPA 2KVMA 1I6VC 4L63B 5C0XJ 2QGQA 1WTHA 3N52A 3FVQA 1VQMA 2CWAA 4LF5Q 2ZM6L 1TVXA 1E1OA 4C2MB 3HOYG 4WJWA 4P73A 3F2DA 4KHZA 4ID6A 1ENCA 1DOLA 2E2HH 1HUMA 1R4PB 1X6OA 1K3BC 5CR3A 2CQOA 1Q12A 2N3SA 4BBSH 3T56B 4P74A 4LK1C 5FO7B 2DNEA 4EQNA 2LSSA 4DNRB 1F2LA 4X65Q 1F9SA 3CF5A 3STBC 1BCPC 4B3RL 2IX3A 4X66Q 1STNA 1T5XD 1A0IA 4KY5A 2D9UA 3TP8A 3G6EA 5M5XB 1KRTA 3A54A 3A74A 5AJ3Q 4ZAIA 1K83H 3TZUA 3I90A 4DR4L 3BVGA 1Y1WH 4JI1Q 3NE5B 3I4MG 4KHPQ 3KF8B 2AWNA 1HQMC 1TWCH 4OO1G 1LO5D 2X6LA 1IKMA 2F3VA 5IYCH 3P75A 2R7ZH 1CQVA 5I9PA 4HCSA 4AH6A 4BY1G 3HOXH 1I3QB 5IT9c 2K5DA 5C3XA 1CKOA 2CH4W 1I5FA 2CKZB 1VQ4A 2NN6H 1MSHA 4NDXA 4BXXG 4JI2L 2R93H 3ND8A 3MVVA 3GV6A 2F4VQ 4DAYB 1G51A 1SNOA 2K5HA 2RHQB 5C44G 2WACA 4CDCC 3HOUB 4POFA 2QEXA 4IPGA 4GKJL 4IUTA 1YITA 4TRDA 2ZJPA 4LF4Q 2HDMA 3S2DB 3R3OA 1N34L 1SR3A 1VCIA 2YYZA 1AH9A 1ET9A 2RDHA 1A6XA 2K5QA 2XVSA 3KBXA 3K8AA 4XYQA 2JQOA 3GTMB 1WYDA 2J7ZA 2VW9A 1DOKA 3W5OA 2FMCA 4DV0Q 2PMZE 2HCCA 1X3FA 2EOTA 1QNKA 2K4KA 5FOBB 2K6AA 3DMUA 5FJ8G 4TSSA 1Q3LA 2KHSA 3RLOA 4LFBL 4A3IG 1U4MA 1EIFA 5I2XA 5KEEA 1XYIA 4DF7A 1F2ZA 3UDFA 3WDNA 2Z8LA 4A3JG 2R92B 2NVQH 4GNXC 3E9IA 3MTSA 3VYUA 2CW0C 4F88A 1O7ZA 1BF4A 3IFDA 2AWOA 2F0LA 3I7FA 3EQLC 4GN3B 3NTHA 4YCVA 1YEZA 2A69D 4QGUA 4JV5L 5LL6X 1GKHA 1STAA 3OIPA 3ZJYC 2K5WA 4O1NA 4Y7NH 1JB7A 3KUPA 3D0FA 3KOJA 2B63B 1EL0A 2RCFA 1KL9A 2EXDA 4C3IG 2I5LX 5J39A 2UU9Q 2HQEA 2PMZB 4IUQA 1ET6A 2JE6I 5D65A 4LF7Q 1J8IA 3OTOL 2BE5C 3GP7A 4IUNA 4JI0Q 3T13A 2I5MX 1P16A 4N9TA 4JCVE 2R7FA 1SROA 5IP9G 2QILA 5IYDG 3BDLA 3J7AF 3DM1A 3L0OA 1PXUA 1KDAA 4RKLA 4LFCQ 2CWPA 5IP7H 4RGNA 4A3MB 4K0KQ 1SFOB 2EYHA 2AQ1B 3Q0AA 4A3BB 5EKIA 1K28A 1FJGL 1WVLA 1YNND 2Y0SE 1AN8A 1ESRA 1A15A 1VQBA 1ESFA 1AE2A 3VYTA 4AQYQ 3HKZG 4ZKBB 1EWIA 3DUZA 2WB1G 3IFTA 2OXPA 3I4OA 5M3FH 2K5NA 5FO8B 4NPSA 1KAWA 1IYUA 1PTOD 1YNJD 3GTPB 2BOSA 3TMEA 2NZHA 1BCPF 2Z6BA 4IPDA 3RR5A 5JEAH 1D8LA 1GVPA 4EX5A 3GTMH 1YIJA 1PH8A 2IJ0A 3KF6A 5DNFA 1B7YB 1MJEA 1V1PA 3A8IE 1I50B 3TS0A 2SNMA 3HOZG 4A3GG 4MTNA 3VYSA 5KNDA 1OXSC 1A3UA 3OIQA 4GLVB 5I2YA 4JI4Q 4B9WA 3V96A 5GAHC 4CBVA 4AYBG 3T1HQ 2JK8A 3EROA 3BJUA 3GTQB 1C0AA 4HIOA 4FF3A 1SYDA 3NK9A 4NXMQ 2VXWA 3D4RA 1Q8KA 3C1FA 2Y0SB 1U9RA 4IFDH 1VMPA 1Y1VH 5I9OA 4ZKCB 3FKIG 1V1OA 2UUCL 4B3TL 4DR2L 1BBWA 1PRTD 1DZ1A 4DNTB 5KYIA 3VR4A 3SK4A 2UXCQ 3H94A 2DGYA 1SYFA 2TSSA 4MNOA 1K8AC 4JYAQ 4JPBW 5M5YB 1QILA 4GLAC 1XMQQ 3HZXA 1HRJA 3KLWA 4NXNL 3SK8A 1B3AA 3ULPA 4Z9CB 3H09A 4CDFC 2ZM6Q 3A8KE 4WJ4A 1F9QA 1QUQB 2F1MA 3OPOA 2EXZA 1MIUA 2F0IA 4PZ8A 3BG3A 3MFGA 1STHA 4R4CA 2K52A 2QEJC 1SNDA 2SDFA 4MTKA 3OOCA 2Q8TA 3UE1A 1A8VA 1STEA 5JJZA 1HZAA 1HH2P 5JEAJ 3K0XA 2I0QA 1MGSA 1EQTA 3BVZA 1VQHA 5JPNC 3VR5A 4B3SL 2ATWA 3I73A 5C3EB 2XRSD 4DR4Q 4LF5L 1HHVA 3NWSA 2OT2A 4G4KA 3H3VI 1DM0B 2G9DA 4PZ6A 3OMCA 3S9WA 5C0XI 3MEFA 1W3SA 2K32A 1OXVA 4QIWE 1UEAB 4HAEA 1CZWA 2WKDA 1I50H 1TQOA 4JI2Q 4A93H 1RL2A 2C35B 3G7LA 4P2CB 4R8NA 4IFDJ 1PFBA 3TREA 2ICEC 3H0GB 1VQ7A 2D2CC 4X66L 4DU9A 4DR7L 4UPAA 1LABA 3I70A 4GN4B 5AJ3L 2O2LD 3K7AB 1X3QA 1ZKOA 3NBHA 5KGUA 2RCNA 2F0MA 4HJ9A 2YTVA 3GTQH 4BY7H 4QB4A 4RH6A 4C3HG 1NBWA 4JI1L 5CBEE 4HR7B 2O5JC 3TP5A 1H9JA 1SNPA 1N34Q 1AE3A 1SLJA 4A3KG 3I4NB 3M4PA 3MEHA 1EEFD 5TSSA 3U4VA 1SYBA 4JBMA 1N33L 2PCFB 1ZYRD 2O4XA 4DV1L 1BR9A 1H9SA 5M3MB 4I65A 3S1QH 2AMCB 1QVCA 1LM0A 1M8AA 4QIWB 4ZRZA 1XPUA 1HFGA 1LTTD 2XRQD 4LFBQ 4OWWB 1YNJC 2KOLA 4KKTA 1XTCD 4X62L 3NQIA 1KD1C 3HP3A 3PIPA 1K9MC 3TZDA 1HNXQ 4GZYC 1GO3E 1RHPA 5C4XH 1NNXA 4JK1C 1PDQA 1KNEA 1EFID 1PH4A 1JWUD 4X3SA 2KECA 4IURA 2VY3A 2EJMA 1RDPD 4M8AA 4JV5Q 1CKNB 4OXPA 2JA7B 3FPPA 2DJFC 3HRZC 2GN5A 1PTOH 1A2TA 5DM63 1EY6A 3MFYA 1WFQA 1EWHA 5IY0A 2BDNA 1ILQA 5CBAE 4CDEC 1AFPA 4HIKA 3HOYH 3EN2A 1EIGA 1B9MA 4BS9A 2E2DC 2F0VA 3TSSA 3OTOQ 4DUYL 1LTBD 2ZXRA 3D3RA 3RLFA 1L1OA 2MPMA 4FXKC 3CMAA 5IGFA 1PRTC 4APVA 1TKWB 3RNUA 2F0PA 4S3SA 3A8JE 5GAGC 3H6MA 2Z4HA 1V43A 4MZ9A 3AEVA 1EY8A 2MNAA 3SGIA 1U5KA 2B63G 2N88A 3PGZA 1VF5C 4WORA 4JBWA 4BBRG 4A3DG 3H0GH 3RZDH 5KRUA 3S1NH 4C3JG 5DLQE 3EBEA 4H13C 3I4MH 3BYTB 1FJGQ 2R3ZA 5CV5A 3D31A 2FXQA 5ELCA 2NBFA 4OO1H 2HQLA 1HZBA 3S1MB 4C1NK 3FHWA 3TS2A 1I4XA 4LF6L 2L0CA 3NQTA 3A0JA 3HFZB 2KCNA 2F0QA 3ERSX 3H3VC 1E24A 1JMCA 4A75A 2J0TD 3UE0A 5IYBG 4JI0L 4HSPA 4POGA 2OWOA 4K6DA 2NN6I 2A1AA 1LT5D 2LS01 4JBKA 1HTPA 1S5CD 4DGZA 1TS2A 4LUVA 1IZ6A 1A2UA 2RSNA 2WFWA 4QL5A 3G48A 1FNUA 2Q2HA 1SE4A 4NB3A 3FP9A 2VUMG 3BDCA 5C44H 4M1UB 1OTCA 1GUOA 1LV9A 4K0KL 4BBSB 1EY0A 2MP1A 4ZUIA 2NVXH 4K14A 4HSVA 3SE0A 1B8AA 4K5VA 1DGSA 1LTID 3HOWB 5E7NA 4Q5VA 1PH6A 3M4QA 2P5ZX 3H91A 2BA0A 4OWXB 1CHPD 3AQQA 1Y1WB 4I7AA 1JE5A 3J81j 1PH3A 4BWGB 1TWCB 4PMBA 2KQ3A 1YBYA 3D6WA 1VQOA 2R7ZB 2L5TA 2UUAQ 2HUGA 1JT8A 3HOXB 1WCMB 2A8VA 3BZDB 4H0LC 5IODA 4JI7L 2UUCQ 4V190 4B3TQ 5L37A 2RQXA 4DUZL 2CW0D 2JA7H 1PLFA 4DV3L 1BCPB 3M3YB 2EYJA 2B29A 3CAMA 5NUCA 1BBUA 2BH8A 4NXNQ 3JAML 5COYA 2JA5B 3FEWX 4DXGA 4DV5L 2LFNA 1HCZA 5JVH3 3PO2B 3D8GA 5M5WH 3PUZA 3GTLH 3J80c 3CRKC 4QCLA 1RODA 3D4DA 1Q8IA 2BE5D 2EYMA 4X3TA 1SNCA 4CJ2C 4JI6Q 1QNUA 1LTSD 4EQPA 4XXEA 2A74C 1EWCA 3JAME 1C48A 4RHSA 3TBIB 2G9HD 3SR1A 1EY7A 2LXJA 1VQ9A 2K5VA 2HDLA 4JYAL 3GTJB 1G2TA 4JOIA 1XMQL 2IW3A 1TXYA 1BO0A 3NENA 4A3EB 3S1MH 4GOPC 4FYDA 3I2ZA 4JBJA 3JC66 4QMGA 2EY1A 2ES2A 4B3SQ 1QZHA 5FLXc 1KAAA 1BNZA 3DWPA 3LWUA 1QVFA 1Z47A 1EY4A 2K7VA 5FLMG 3K58A 1ASZA 1YJWA 1K8MA 2Z1CA 2NVQB 2NTSA 2YU9H 1Y8OB 2D0PA 1A62A 2K1BA 2WAQG 1S5BD 2AHOB 3CC4A 3A5ZB 1RCVD 2KEEA 2A19A 1B50A 4GOPA 2SEBD 1VQDA 2F0EA 3PIP3 5FKAC 4Y7NB 4NP5A 1PRTF 5EBDA 1XNRL 4ULLA 5JPMC 3HOWH 5GADC 1N9WA 4DR7Q 3I56A 1SSOA 1E2WA 1LACA 5T1GA 3IAYA 4KV6A 3T16A 4IJLA 5C3WA 1S40A 1O7LA 3O13A 1CI3M 2PQAA 4WJ3M 2JA9A 4GNXB 1E3PA 2UXDQ 3NTIA 4A3CG 1ZEQX 5IWAL 3DLLA 3HOZH 1CK1A 4N8FA 4A3GH 3BYYB 1WCMH 1ENFA 4UP7A 1PFSA 3K5LA 5IIFA 1N33Q 3CW2C 1NTGA 4ZLTF 4DV1Q 3U58A 2PI2E 3M3YH 1LLRD 1A3TA 1MD2D 4F7XA 4ZK9B 3TRZA 3KLSA 1EIYB 1I4PA 2LXKA 1NR2A 1RJTA 3MXNB 2L15A 1IBML 2PQEA 2JA5H 4X62Q 4OGQC 4IFDI 1HXYD 2KCCA 3PO2H 5M3FB 5JAVA 4K6LA 4IQZA 1M90C 2M9VA 1NY4A 1HR0Q 4PZ7A 1E0BA 5ELDA 3S15B 5EKKA 4FXDA 1FD7D 1ONLA 4DV2L 3F2UA 1I94L 2G5DA 4LMQD 1TS3A 3SDZA 4IO9A 2PZUA 3J80i 3ER0A 1K8OA 3E3XA 3GTJH 5H1SE 3EA6A 3K81C 5DAUA 4A3EH 3FMCA 4KKSA 3CCRA 1HZCA 1JWMD 3PO3B 5IGBA 2IWHA 5AFWA 1LTLA 3S24A 4DUYQ 3VA5A 3MXUA 4LNQA 4B9XA 1F77A 1HNXL 1RTNA 3ULLA 4N8X1 3L9AX 2VS1A 1Y1VB 2F03A 3KLRA 4RA8A 3I3CA 1N32Q 5C4ZA 1SN8A 3EFXD 1EQRA 1JWSD 2TMPA 2JA6G 1DXMA 3QR8A 3QOLA 3T51B 4CJ1B 2C5CA 2FINB 4TKOB 2B2VA 4XTCS 2A5HA 5LMNQ 1FYCA 1TIID 5KNCA 3Q23A 1SJHD 1STYA 3KJPA 4LF6Q 5I4DA 1CSQA 2CH4A 2Q8RE 3SK5A 2K75A 1O78A 3BU2A 5C5LA 3I55A 3K5NA 3K57A 2VQEL 3KF8A 4P72A 2MJ8A 2ZTDA 4FNFA 4R8IA 4LWCA 5KYLA 1LUZA 3OW7A 3NPPA 1WD0A 1BOSA 1WTQA 1JR0D 3D4WA 4C3HH 3CQZB 3S14H 1TU2B 4TVAB 1CT1D 2CFMA 4DAYA 4A3KH 1KXLA 2RSOA 4XT3B 2H1EA 1HQRD 3F8TA 2I46A 2F0OA 2HCIA 1TS4A 1KTKA 4C56C 1IBLL 2FFKB 4KK7A 2IHEA 3HOVB 3K5MA 3S15H 2E75C 1B2TA 3PIO3 3PUVA 2PNRC 4JI7Q 2XNAC 3NSWA 1U4RA 4DUZQ 1HTLD 3KJOA 4A93B 4A3FB 4DV3Q 1Q86C 2F3IA 2EE1A 1DCZA 1UEBA 1CA5A 3HKSA 4RCNA 2JJQA 1Q90A 3T4AC 3J7YW 3PO3H 2K04A 2D62A 4NMZA 1Y1WG 2MQHA 4BY7B 5IGGA 1LT3D 4R9WA 4DV5Q 4UHVA 4LFAQ 1JORA 4YWLA 2MHVA 3E5SA 2UUAL 4PV1C 1CKMA 2NN6G 2HIXA 1PZID 4ZCKA 2WV6D 4HJ8A 4F87A 4QUCA 2R93G 3QB3A 4FF4A 3J81L 4J6HA 4IPCA 5D14A 1SNMA 1FNWA 5EQ0A 5IGDA 2IPKD 4CKCA 3S1QB 2B2TC 1EY9A 1PH9A 1SE2A 5HY6A 2EY6A 1O7YA 3S16B 1D6EC 4HCEA 4FXGC 1BDOA 3BDOA 1W6KA 2MFIA 4IALA 3CPFA 1LT6D 3S17H 4HMJA 1X32A 3J81E 2Q2IA 3F2BA 1SYCA 4G7HC 3NTKA 5C4XB 3QOJA 2PO4A 4ILWA 2DY8A 2B2TA 1N8RC 3K59A 4RGMA 2DN8A 3KYHC 4BBRH 3L7ZC 4JI6L 4OEMB 2R7DA 2B8GA 3U50C 2KCMA 1PH5A 5E3FA 2EJGC 1VMCA 1VS0A 3K5OA 4HJ7A 1XNRQ 1PTOB 4KI0A 3CQZH 2UUBL 5IYBH 2ALYB 1BBXC 4DR3L 4O0AA 3DM3A 1HNZL 4WRDA 2JA8H 3HOYB 1QE6A 2CVRA 2F0GA 1I4RA 2VUMH 4O2DA 3HOVH 1AP0A 1GHJA 5IWAQ 2RDFA 3C2PA 1S5FD 3CC7A 3VDYA 2JN4A 3PV0A 2F52A 4LJZC 1SDFA 2B2YC 4QUFA 1VQIA 1WTRA 3OHXC 4IUUA 5LMUL 4A3FH 1RD9D 1NSNS 2JYOA 1GM5A 3RZDB 3S1NB 1GOZA 3T1YL 3I4MB 3SHLA 2EQSA 4YCUA 3CPWA 1IBMQ 4BY1B 3HGBA 2B2YA 2NYZD 1Z9FA 1MBYA 2UXDL 3EIVA 3RN2A 4QQBX 2EYFA 1CHQD 2EY2A 3H15A 4JI3Q 1YZ6A 3W3AA 4G57A 4KKUA 1QCBD 2F0SA 2OEOA 5C5MA 1R9TH 3CCUA 1B53A 2JEAI 4CKBA 4KTAA 1UUPA 3KBGA 3IRBA 2Q8IB 4DV2Q 1E2ZA 3RMHA 4BA1I 1I94Q 1YNXA 1WD1A 5CGKA 5C44B 5D3IB 1SMXA 2Z0SA 4KD4A 3HOUG 2IX0A 4YHHL 2NVXB 2ZJRA 5CC4A 3R2TA 4B3MQ 2JSOA 3S16H 5JOBA 5ISRA 2QDBA 1JC7A 3PQIA 2F0KA 1QVGA 4JI8L 2L4NA 1Q82C 2RA4A 1A63A 4I7ZC 1HUNA 5IGEA 3ICEA 4HJ5A 5JEAG 1MKHA 1GD7A 1EEID 3PMFA 4WFN3 3ITPA 4YY3L 1HR0L 2IL8A 1XJVA 2OTJA 3S1RH 5JJIA 3CMEA 4P75A 2RHSB 1QUQA 4V0BA 1Z6HA 1L1OC 2NUCA 3U9OA 3HEJA 1UE7A 4A3IB 3QIAA 2K14A 1X3GA 3FPUB 1KRSA 1SEBD 2NTTA 5CV6A 2N78A 1S5ED 5CYUA 3M4OH 3KDFB 2LKVA 4DV7Q 1JICA 4A3JB 4CDDC 2R6GA 4OX9Q 4K2KA 3Q8DA 2R92G 4KJNA 4UY8C 1UNSA 1SE3A 3MC0B 4DV6L 4K5XA 1U0LA 2QCPX 2E76C 2J4XA 4EQOA 3LWEA 2EJFC 3NWTA 2KEDA 1WTWA 5M5WB 3GTLB 4LUOA 2RDGA 5A2QL 4PG3A 4Y52H 2VQEQ 1B44D 2AQ3B 2V1CC 2MGSA 1N32L 2L1BA 3IKJA 2VQFL 1I4GA 2WB1E 5ELEA 1VQ8A 2KJXA 5KNBA 4PMCA 3AFQA 1J6QA 4P71A 2EVBA 4KLKA 1VQJA 4IUPA 5A2QE 1ZXTA 2EPBA 5LMNL 1Y14B 1YHBA 1S3OA 1LTGD 3UDIA 4DPGA 5IGCA 4BY1H 3X3NA 1L0WA 1K0SA 4R1JA 4Q0FA 3M4YA 1IBLQ 5KIXA 4BXXH 1HNWL 1LTRD 2NVYH 2EDGA 2YU9B 1AZQA 1BQQT 2B2UC 3BVMA 4A3MG 4HTHA 2E2IB 4DAPA 3C3LA 3A56A 1VDZA 4A3BG 2ID0A 4OONA 3ZYYX 3NUCA 1HR0W 1BVSA 1JJGA 2WB1B 2XGTA 1PFMA 2F0FA 1WTVA 1IBKL 4RKBA 5BN3A 3H3VH 1JJCB 1NMGA 1TT2A 2B2UA 5GROA 1PYSB 2NVTB 1XTDA 1OO9B 1KQSA 3VR3A 2VL6A 2B3GA 1Z7TA 1B9NA 3BZKA 4FP5D 3SXHA 2L11A 3HOZB 2JEBI 4A3GB 1FVIA 4MIUA 3G4SA 3P20A 3DXJC 4J8QA 4DN4M 2AUJD 5FJ8H 2F0NA 3I91A 4GKKL 3F1ZA 1B3QA 4A3IH 5T1IA 3URYA 3UI2A 2KENA 3PSIA 5I6WA 2CQAA 3HS0C 3OWFA 1HJPA 4AYBB 1PMRA 2AUKA 1P8LA 2PZWA 1K3RA 1UAPA 4A3JH 4RFBA 1CKNA 3TDQA 1XMOL 1XPRA 1QZGA 1GJXA 1TWGH 5E4WC 4X64L 5JJKA 1TWAH 1AW7A 4ALPA 4B08A 4XT1B 2Y0SG 3AMUA 3DHQA 4LFAL 3FKIB 3ERQA 1PV4A 4KJOA 1BUVT 3J80L 4JOIC 1BKBA 1SYGA 2RF4A 3TEHB 5LMNW 2JA6H 1CZGA 1VQKA 1X65A 4RWSC 1U4LA 2K05A 1E2VA 2MO0A 1G2SA 3GTGH 4PQXA 4XIGS 4C3IH 3JAMc 2ZT9C 2IX1A 4K8IA 2ZJQA 3J80E 3PF4A 2B8FA 5G3LD 2UUBQ 4CGYB 5DM73 5EGTA 4DR3Q 3RD4A 2F0WA 4IN3A 1HNZQ 4DR6L 5FLXL 1NCVA 2K28A 5IP9H 5IYDH 3I8ZA 1XX8A 1C9OA 1VQ6A 5BR8L 3RUZA 3KFUA 5FK9C 1UE5A 5CMDA 3TQYA 2GVAA 5EPKA 2E2IH 2DUDA
chains in the Genus database with same CATH topology
1YVCA 3OYYA 4LF6Q 2QA4A 1HZAA 1EUJA 3J7A5 1YJ9A 1HH2P 3CCSA 4R4TA 4DK3C 1CSQA 1V9PA 5JEAJ 1XNQL 4AIMA 3K0XA 2I0QA 1L2FA 4A3CH 2K75A 3BU2A 5LMUQ 3I55A 1VQHA 2VQEL 1VQCA 1D7QA 3PF5A 4B3SL 2ATWA 4A3LH 4OWTB 1EFWA 4P72A 3T1YQ 5C3EG 3PUWA 4LF5L 4DR4Q 4L5SA 1G291 3H3VI 2PNHA 3PCOB 2ZTDA 4DR1L 2YTYA 5ELOA 4AYBE 4PZ6A 2NVTH 1VQGA 3UDXA 4LWCA 1LUZA 2UU9L 4LF9Q 2HT1A 5C0XI 3S2HH 3MEFA 1W3SA 3K7AH 4DV4L 1SRUA 3W1BA 4C3HH 4LF7L 1OXVA 4QIWE 2E5LL 2VZAA 3S14H 1PVOA 1I50H 1NE3A 4TVAB 2CFMA 2EIFA 4JI2Q 5GAEC 4A3KH 4A93H 1KXLA 4GOPB 3I4NH 4DAMA 1RL2A 2C35B 4A3LG 2JA8G 3F8TA 4IFDJ 3GO5A 3TREA 4L5RC 3H0GG 3PUYA 1IBLL 1VQ7A 4X66L 1E7ZA 2IHEA 2IHFA 4UPAA 4DR7L 2I5HA 4GN4B 4YCWA 5AJ3L 3HOVG 3S15H 4YHHQ 4LF8Q 3CD6A 1NJIC 5M3MH 4LFCL 1J5EQ 3GTQH 4HJ9A 4BY7H 2RCNA 1LYLA 5GQOA 2YTVA 3J7ZC 3PUVA 1M1KC 1NBWA 4IOAA 4JI1L 4JI7Q 2N8NA 2OTLA 4L5TA 1IYJB 2HHHL 1EYGA 3U4ZA 2PQAB 4HIMA 1WJJA 4JI8Q 4DUZQ 1N34Q 2E2JH 3KJOA 1AE3A 1SLJA 1VQEA 4A3KG 4A93G 4DV3Q 3I4NG 3FKIH 4A3FG 3M4PA 1Q86C 1RIPA 2F3IA 1OXUA 1UEBA 4AQYL 3U4VA 3HKSA 2BH2A 2JJQA 4JBMA 3GTOH 3PO3H 1N33L 4JI3L 4YY3Q 4UP8A 2D62A 3CCMA 1Y1WG 2MQHA 4RG1A 4YWMA 4DV1L 5EAYA 3CCLA 5C0XG 1X56A 4DK6C 5M3MG 4L5QA 3I4MG 1UWVA 3LGJA 2AMCB 3S1QH 1QVCA 4BY7G 4DV5Q 1LM0A 1Q1BA 4J15A 4LFAQ 3CCJA 5ELNA 2BA1A 4YWLA 1XPUA 3GTKH 1KHIA 3A5UA 2UUAL 4LFBQ 1PH1A 3L2PA 4OWWB 1CKMA 4TQUS 1N36Q 2AKWB 2HIXA 2NN6G 2YV5A 3KF6B 1CSPA 4DR2Q 4B3ML 4HJ8A 4X62L 3KDFA 4YWKA 1KD1C 1TWFH 2R93G 1W2BA 3PIPA 4JG2A 1K9MC 1OXTA 4R4IA 1HNXQ 1E1TA 1GO3E 4JI4L 4IPCA 5C4XH 3JAMi 4DV6Q 3RN5A 5K36G 2NZOA 1PH4A 1EOVA 1PH9A 3T1HL 1G6PA 5HY6A 3E0EA 2VY3A 4DR5L 4HJAA 4LW1A 1B70B 2OQ0A 4NXML 4JV5Q 2MFIA 1CKNB 3CPFA 3S17H 2ZTCA 4OXPA 1VQNA 2JA7G 2VQFQ 2Q2IA 4R4OA 3F2BA 2GN5A 1K73C 1T9HA 1WFQA 4RMFA 5IY0A 3B6YA 2D0OA 5C4XG 1TWHH 1N8RC 3KYHC 4A4IA 4C2MH 3EN2A 4BBRH 4HIKA 3HOYH 3L7ZC 1K0RA 4JI6L 1X3EA 2R7DA 3OTOQ 4DUYL 3U50C 1Q7YC 2Q2UA 2UXCL 2VNUD 4DV7L 2KCMA 3RLFA 4OX9L 1VQAA 3PIOA 1L1OA 1JJ2A 1PH5A 3CMAA 1I6HH 1VS0A 1YHQA 2IY5B 4APVA 5C0XJ 4HJ7A 2QGQA 3RNUA 1XNRQ 4KI0A 5GAGC 1HNWQ 4IJHA 3CQZH 2Q2TA 2UUBL 1V43A 5IYBH 1VQMA 2CWAA 4MZ9A 4LF5Q 2ALYB 3AEVA 2YTXA 2ZM6L 4DR3L 2MNAA 1E1OA 4O0AA 3SGIA 1U5KA 2B63G 3DM3A 1UE6A 1HNZL 3PGZA 2JA8H 2UXBL 3HOYG 4BBRG 4JBWA 5M5XH 4P73A 4GNXA 1Q81C 4A3DG 1VQFA 3H0GH 3F2DA 4KHZA 3RZDH 3PUXA 3S1NH 4ME3A 5DLQE 3EBEA 4JI5L 2E2HH 3I4MH 3WWVA 4O2DA 2E5LQ 1FJGQ 3D31A 2FXQA 1X6OA 4IPHA 2VUMH 5IWAQ 3HOVH 2HQLA 3CC2A 3RZOH 1HZBA 2CQOA 1Q12A 2N3SA 3FHWA 3CC7A 3VDYA 4P74A 3CXCA 3TS2A 4LF6L 4BBSH 3PV0A 2F52A 3A0JA 1I3QH 3ERSX 3HFZB 1IBKQ 4DKAC 1E24A 3M7NA 1VQIA 4A75A 2LSSA 3UE0A 4H02A 5IYBG 1JMCA 4X65Q 4JI0L 3CF5A 3STBC 4POGA 2OWOA 5LMUL 4B3RL 2GVBA 2NN6I 4X66Q 4A3FH 2A1AA 1A0IA 4GLXA 3G6EA 4JBKA 1KRTA 3A74A 5AJ3Q 1GM5A 1K83H 4LUVA 5C4JH 1IZ6A 2WFWA 3AYHB 4QL5A 3T1YL 3G48A 4DR4L 2Q2HA 1Y1WH 4NB3A 2EQSA 3FP9A 1YHAA 3KF8B 4YCUA 2AWNA 4JI1Q 5C44H 1TWCH 3CPWA 1OTCA 2VUMG 4KHPQ 1IBMQ 4OO1G 1X54A 5IYCH 2R7ZH 4K0KL 3HOUH 4AH6A 4BBSG 1E22A 4BY1G 2NVXH 4LF9L 3HOXH 1Z9FA 1B8AA 5IT9c 1DGSA 1X9NA 1CKOA 4GKKQ 2UXDL 3EIVA 1I5FA 3RN2A 2CKZB 1VQ4A 2E8GA 4QQBX 5E7NA 3CCVA 3HOWG 3S2DH 1PH6A 4BXXG 3H15A 4JI3Q 1YZ6A 1HZ9A 4JI2L 3M4QA 2R93H 2BA0A 3CCUA 1R9TH 2JEAI 1NMFA 2F4VQ 4DAYB 4OWXB 4QY7A 3IRBA 3AQQA 4DV2Q 4BA1I 1G51A 4PMWA 1JE5A 1YNXA 2K5HA 3J81j 2RHQB 2HIVA 1XMOQ 1PH3A 1Q1EA 1YBYA 4X64Q 5C44G 1VQOA 1SMXA 2Z0SA 2UUAQ 5IYCG 2R7ZG 3GDEA 3HOUG 2IX0A 4YHHL 1JT8A 4POFA 2QEXA 2ZJRA 3HOXG 1J5EL 2IT1A 4B3MQ 4IPGA 4GKJL 2N49A 3NELA 1WCMG 2A8VA 3S16H 1YITA 4FDBA 3K7UC 3NBHB 4JI7L 2UUCQ 2ZJPA 2PI2A 4LF4Q 1C7YA 4B3TQ 1QVGA 4JI8L 4DUZL 1SR3A 1VCIA 2YYZA 1Q82C 1PHJA 1N34L 2JA7H 1A63A 1AH9A 4DV3L 2Z6KC 1YI2A 3ICEA 2OQKA 4HJ5A 5JEAG 1MKHA 1GD7A 4QJFA 3K8AA 2JQOA 2B29A 1WYDA 4YY3L 3CAMA 2R92H 2VW9A 1HR0L 1XJVA 3W5OA 1BBUA 2BH8A 4NXNQ 2OTJA 4DV0Q 3S1RH 2PMZE 1X3FA 4HIDA 5JJIA 3CMEA 1EQQA 4P75A 2K4KA 2WAQE 2JA5G 4DV5L 2RHSB 3W1GA 5FJ8G 1QUQA 1L1OC 5M5WH 3PUZA 3GTLH 3J80c 3PO2G 1CUKA 4DR6Q 1UE7A 3RLOA 4LFBL 4A3IG 2Z6KA 1N36L 2K14A 1X3GA 3J81c 1EIFA 1KRSA 5BR8Q 4JI6Q 2N78A 3UDFA 3M4OH 1OXXK 2OCEA 3KDFB 4DV7Q 2B63H 4A3JG 2R6GA 4OX9Q 3Q8DA 2R92G 4A3DH 4UY8C 2NVQH 3ULJA 4GNXC 4DV6L 3E9IA 2LXJA 4C3JH 1U0LA 1VQ9A 1XNQQ 2K5VA 1VQPA 2AWOA 4JYAL 3I7FA 4JOIA 1XMQL 2ASBA 4GN3B 4LUOA 3NENA 1TXYA 2KHJA 4YCVA 3S1MH 4OO1I 1YEZA 4GOPC 4A3EG 3I2ZA 4PG3A 4Y52H 2VQEQ 4JBJA 4QGUA 2V1CC 3JC66 1PH2A 4JV5L 1FGUA 1GKHA 1KIXA 1I94Q 2ES2A 4B3SQ 1N32L 1QZHA 3ZJYC 5FLXc 4Y7NH 2VQFL 1JB7A 2WB1E 3D0FA 1XPOA 3KOJA 1VQ8A 1QVFA 1Z47A 1ASYA 4DR1Q 5FLMG 3NEMA 1ASZA 1YJWA 1KL9A 1J6QA 2EXDA 2I5LX 3AFQA 4P71A 2UU9Q 2YU9H 4KLKA 1VQJA 2D0PA 2JE6I 1A62A 3F2CA 4A3MH 4DV4Q 1SFOH 4LF7Q 2H5XA 2WAQG 3OTOL 2AHOB 3CC4A 3A5ZB 5LMNL 1Y14B 1YHBA 2A19A 4GOPA 4A3BH 1S3OA 1VQDA 4JI0Q 3UDIA 4DPGA 4BY1H 4B3RQ 1SE8A 5J3BA 1L0WA 2I5MX 4R1JA 1L1OB 1P16A 1WOCA 3CP0A 4JCVE 2R7FA 1XNRL 1SROA 2KCTA 5IP9G 1IBLQ 3HOWH 4BXXH 5IYDG 1HNWL 2NVYH 1N9WA 5GADC 4DR7Q 3I56A 3L0OA 5IE8A 3GTPH 4EQ5A 4IJLA 4LFCQ 2CWPA 5IP7H 1S40A 4K0KQ 4A3MG 2PQAA 1VQ5A 4X6AH 4WJ3M 1WI5A 2JA9A 3RLNA 4GNXB 2HHHQ 1E3PA 4A3BG 2UXDQ 2ID0A 1FJGL 1KC8C 4A3CG 4OONA 4GN5A 4R4QA 5IWAL 3DLLA 1PYBA 3HOZH 2Y0SE 1IL2A 4A3GH 1O7IA 1VQBA 1WCMH 1HR0W 2CCZA 4UP7A 1AE2A 1BVSA 1PFSA 4AQYQ 3HKZG 1FL0A 1EWIA 3UDGA 1JJGA 2XGTA 2WB1G 1IBKL 1N33Q 3I4OA 5M3FH 2K5NA 4X65L 3CW2C 3GD7A 1JJCB 1NMGA 1NTGA 1KAWA 4NPSA 3H3VH 4DV1Q 1YJNA 5GROA 3U58A 2PI2E 3M3YH 1PYSB 2NZHA 4IPDA 3RR5A 5IP7G 3CCQA 1D8LA 1GVPA 3TRZA 1XTDA 4EX5A 1S72A 3GTMH 1YIJA 1PH8A 1KQSA 1EIYB 2VL6A 4GKJQ 2B3GA 3KF6A 4KHPL 3OW2A 1B7YB 2LXKA 3BZKA 1MJEA 4LF8L 3MXNB 2JEBI 2L15A 3M9BA 3TS0A 1IBML 3HOZG 1FVIA 3G4SA 4X62Q 2JA5H 4BA2I 4A3GG 4MTNA 5FJ8H 4IFDI 1OXSC 1VQLA 5HGQA 4GLVB 3PO2H 4GKKL 3E9HA 4JI4Q 3F1ZA 5M3FG 4A3IH 2KENA 3AFPA 3PSIA 5GAHC 1M90C 1NY4A 1HR0Q 4PZ7A 1HJPA 3G71A 2K50A 1P8LA 4AYBG 3T1HQ 2JK8A 1K3RA 3K80C 3BJUA 2F4VL 4A3JH 1PH7A 4DV2L 4HIOA 1CKNA 4DR5Q 1I94L 4JC0A 1C0AA 1H95A 1XMOL 1XPRA 1QZGA 4NXMQ 2KHIA 1TWGH 5JJKA 5M5YH 4X64L 1TWAH 4IO9A 1Q8KA 3J80i 4ALPA 2Y0SG 2ZTEA 3ER0A 1Y1VH 4LFAL 3J81i 3FKIG 5H1SE 3GTJH 1PV4A 1V1QA 4A76A 3K81C 4JOIC 4A3EH 2MO1A 2UUCL 1BKBA 3CCRA 4LF4L 1HZCA 2RF4A 3TEHB 4B3TL 5LMNW 2JA6H 3PO3G 4DR2L 1BBWA 1VQKA 1X65A 1LTLA 3S24A 4DUYQ 2KBNA 4LNQA 2UXCQ 1HNXL 2DGYA 2MO0A 5FLMH 3GTGH 1UE1A 4MNOA 3ULLA 1K8AC 4XIGS 4JYAQ 4C3IH 3JAMc 4GLAC 1XMQQ 2IX1A 3KLWA 2VS1A 1Q46A 2ZJQA 4NXNL 4IFDG 4DV0L 1Y1VG 3PF4A 2XTIA 1PA6A 1N32Q 1SN8A 3ULPA 2UUBQ 4GS3A 1EQRA 2ZM6Q 4DR3Q 1K8GA 3BZCA 1MJCA 2WP8J 2JA6G 4DR6L 1HNZQ 1QUQB 2UXBQ 4WJ4A 3HKZE 3CCEA 1MIUA 5IP9H 4DNIA 4IOCA 5IYDH 4PZ8A 4R4CA 1C9OA 5C3EH 5BR8L 3M85A 4JI5Q 1VQ6A 3KFUA 2K52A 4XTCS 1IXRA 5JJLA 4LUZA 4UP9A 3STBD 5LMNQ 1UE5A 3TQYA 3KJPA 3UE1A 2GVAA 1A8VA 1X55A 2E2IH 2DUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVC A;  3OYY A;  4LF6 Q;  2QA4 A;  1HZA A;  1EUJ A;  3J7A 5;  1YJ9 A;  1HH2 P;  3CCS A;  4R4T A;  4DK3 C;  1CSQ A;  1V9P A;  5JEA J;  1XNQ L;  4AIM A;  3K0X A;  2I0Q A;  1L2F A;  4A3C H;  2K75 A;  3BU2 A;  5LMU Q;  3I55 A;  1VQH A;  2VQE L;  1VQC A;  1D7Q A;  3PF5 A;  4B3S L;  2ATW A;  4A3L H;  4OWT B;  1EFW A;  4P72 A;  3T1Y Q;  5C3E G;  3PUW A;  4LF5 L;  4DR4 Q;  4L5S A;  1G29 1;  3H3V I;  2PNH A;  3PCO B;  2ZTD A;  4DR1 L;  2YTY A;  5ELO A;  4AYB E;  4PZ6 A;  2NVT H;  1VQG A;  3UDX A;  4LWC A;  1LUZ A;  2UU9 L;  4LF9 Q;  2HT1 A;  5C0X I;  3S2H H;  3MEF A;  1W3S A;  3K7A H;  4DV4 L;  1SRU A;  3W1B A;  4C3H H;  4LF7 L;  1OXV A;  4QIW E;  2E5L L;  2VZA A;  3S14 H;  1PVO A;  1I50 H;  1NE3 A;  4TVA B;  2CFM A;  2EIF A;  4JI2 Q;  5GAE C;  4A3K H;  4A93 H;  1KXL A;  4GOP B;  3I4N H;  4DAM A;  1RL2 A;  2C35 B;  4A3L G;  2JA8 G;  3F8T A;  4IFD J;  3GO5 A;  3TRE A;  4L5R C;  3H0G G;  3PUY A;  1IBL L;  1VQ7 A;  4X66 L;  1E7Z A;  2IHE A;  2IHF A;  4UPA A;  4DR7 L;  2I5H A;  4GN4 B;  4YCW A;  5AJ3 L;  3HOV G;  3S15 H;  4YHH Q;  4LF8 Q;  3CD6 A;  1NJI C;  5M3M H;  4LFC L;  1J5E Q;  3GTQ H;  4HJ9 A;  4BY7 H;  2RCN A;  1LYL A;  5GQO A;  2YTV A;  3J7Z C;  3PUV A;  1M1K C;  1NBW A;  4IOA A;  4JI1 L;  4JI7 Q;  2N8N A;  2OTL A;  4L5T A;  1IYJ B;  2HHH L;  1EYG A;  3U4Z A;  2PQA B;  4HIM A;  1WJJ A;  4JI8 Q;  4DUZ Q;  1N34 Q;  2E2J H;  3KJO A;  1AE3 A;  1SLJ A;  1VQE A;  4A3K G;  4A93 G;  4DV3 Q;  3I4N G;  3FKI H;  4A3F G;  3M4P A;  1Q86 C;  1RIP A;  2F3I A;  1OXU A;  1UEB A;  4AQY L;  3U4V A;  3HKS A;  2BH2 A;  2JJQ A;  4JBM A;  3GTO H;  3PO3 H;  1N33 L;  4JI3 L;  4YY3 Q;  4UP8 A;  2D62 A;  3CCM A;  1Y1W G;  2MQH A;  4RG1 A;  4YWM A;  4DV1 L;  5EAY A;  3CCL A;  5C0X G;  1X56 A;  4DK6 C;  5M3M G;  4L5Q A;  3I4M G;  1UWV A;  3LGJ A;  2AMC B;  3S1Q H;  1QVC A;  4BY7 G;  4DV5 Q;  1LM0 A;  1Q1B A;  4J15 A;  4LFA Q;  3CCJ A;  5ELN A;  2BA1 A;  4YWL A;  1XPU A;  3GTK H;  1KHI A;  3A5U A;  2UUA L;  4LFB Q;  1PH1 A;  3L2P A;  4OWW B;  1CKM A;  4TQU S;  1N36 Q;  2AKW B;  2HIX A;  2NN6 G;  2YV5 A;  3KF6 B;  1CSP A;  4DR2 Q;  4B3M L;  4HJ8 A;  4X62 L;  3KDF A;  4YWK A;  1KD1 C;  1TWF H;  2R93 G;  1W2B A;  3PIP A;  4JG2 A;  1K9M C;  1OXT A;  4R4I A;  1HNX Q;  1E1T A;  1GO3 E;  4JI4 L;  4IPC A;  5C4X H;  3JAM i;  4DV6 Q;  3RN5 A;  5K36 G;  2NZO A;  1PH4 A;  1EOV A;  1PH9 A;  3T1H L;  1G6P A;  5HY6 A;  3E0E A;  2VY3 A;  4DR5 L;  4HJA A;  4LW1 A;  1B70 B;  2OQ0 A;  4NXM L;  4JV5 Q;  2MFI A;  1CKN B;  3CPF A;  3S17 H;  2ZTC A;  4OXP A;  1VQN A;  2JA7 G;  2VQF Q;  2Q2I A;  4R4O A;  3F2B A;  2GN5 A;  1K73 C;  1T9H A;  1WFQ A;  4RMF A;  5IY0 A;  3B6Y A;  2D0O A;  5C4X G;  1TWH H;  1N8R C;  3KYH C;  4A4I A;  4C2M H;  3EN2 A;  4BBR H;  4HIK A;  3HOY H;  3L7Z C;  1K0R A;  4JI6 L;  1X3E A;  2R7D A;  3OTO Q;  4DUY L;  3U50 C;  1Q7Y C;  2Q2U A;  2UXC L;  2VNU D;  4DV7 L;  2KCM A;  3RLF A;  4OX9 L;  1VQA A;  3PIO A;  1L1O A;  1JJ2 A;  1PH5 A;  3CMA A;  1I6H H;  1VS0 A;  1YHQ A;  2IY5 B;  4APV A;  5C0X J;  4HJ7 A;  2QGQ A;  3RNU A;  1XNR Q;  4KI0 A;  5GAG C;  1HNW Q;  4IJH A;  3CQZ H;  2Q2T A;  2UUB L;  1V43 A;  5IYB H;  1VQM A;  2CWA A;  4MZ9 A;  4LF5 Q;  2ALY B;  3AEV A;  2YTX A;  2ZM6 L;  4DR3 L;  2MNA A;  1E1O A;  4O0A A;  3SGI A;  1U5K A;  2B63 G;  3DM3 A;  1UE6 A;  1HNZ L;  3PGZ A;  2JA8 H;  2UXB L;  3HOY G;  4BBR G;  4JBW A;  5M5X H;  4P73 A;  4GNX A;  1Q81 C;  4A3D G;  1VQF A;  3H0G H;  3F2D A;  4KHZ A;  3RZD H;  3PUX A;  3S1N H;  4ME3 A;  5DLQ E;  3EBE A;  4JI5 L;  2E2H H;  3I4M H;  3WWV A;  4O2D A;  2E5L Q;  1FJG Q;  3D31 A;  2FXQ A;  1X6O A;  4IPH A;  2VUM H;  5IWA Q;  3HOV H;  2HQL A;  3CC2 A;  3RZO H;  1HZB A;  2CQO A;  1Q12 A;  2N3S A;  3FHW A;  3CC7 A;  3VDY A;  4P74 A;  3CXC A;  3TS2 A;  4LF6 L;  4BBS H;  3PV0 A;  2F52 A;  3A0J A;  1I3Q H;  3ERS X;  3HFZ B;  1IBK Q;  4DKA C;  1E24 A;  3M7N A;  1VQI A;  4A75 A;  2LSS A;  3UE0 A;  4H02 A;  5IYB G;  1JMC A;  4X65 Q;  4JI0 L;  3CF5 A;  3STB C;  4POG A;  2OWO A;  5LMU L;  4B3R L;  2GVB A;  2NN6 I;  4X66 Q;  4A3F H;  2A1A A;  1A0I A;  4GLX A;  3G6E A;  4JBK A;  1KRT A;  3A74 A;  5AJ3 Q;  1GM5 A;  1K83 H;  4LUV A;  5C4J H;  1IZ6 A;  2WFW A;  3AYH B;  4QL5 A;  3T1Y L;  3G48 A;  4DR4 L;  2Q2H A;  1Y1W H;  4NB3 A;  2EQS A;  3FP9 A;  1YHA A;  3KF8 B;  4YCU A;  2AWN A;  4JI1 Q;  5C44 H;  1TWC H;  3CPW A;  1OTC A;  2VUM G;  4KHP Q;  1IBM Q;  4OO1 G;  1X54 A;  5IYC H;  2R7Z H;  4K0K L;  3HOU H;  4AH6 A;  4BBS G;  1E22 A;  4BY1 G;  2NVX H;  4LF9 L;  3HOX H;  1Z9F A;  1B8A A;  5IT9 c;  1DGS A;  1X9N A;  1CKO A;  4GKK Q;  2UXD L;  3EIV A;  1I5F A;  3RN2 A;  2CKZ B;  1VQ4 A;  2E8G A;  4QQB X;  5E7N A;  3CCV A;  3HOW G;  3S2D H;  1PH6 A;  4BXX G;  3H15 A;  4JI3 Q;  1YZ6 A;  1HZ9 A;  4JI2 L;  3M4Q A;  2R93 H;  2BA0 A;  3CCU A;  1R9T H;  2JEA I;  1NMF A;  2F4V Q;  4DAY B;  4OWX B;  4QY7 A;  3IRB A;  3AQQ A;  4DV2 Q;  4BA1 I;  1G51 A;  4PMW A;  1JE5 A;  1YNX A;  2K5H A;  3J81 j;  2RHQ B;  2HIV A;  1XMO Q;  1PH3 A;  1Q1E A;  1YBY A;  4X64 Q;  5C44 G;  1VQO A;  1SMX A;  2Z0S A;  2UUA Q;  5IYC G;  2R7Z G;  3GDE A;  3HOU G;  2IX0 A;  4YHH L;  1JT8 A;  4POF A;  2QEX A;  2ZJR A;  3HOX G;  1J5E L;  2IT1 A;  4B3M Q;  4IPG A;  4GKJ L;  2N49 A;  3NEL A;  1WCM G;  2A8V A;  3S16 H;  1YIT A;  4FDB A;  3K7U C;  3NBH B;  4JI7 L;  2UUC Q;  2ZJP A;  2PI2 A;  4LF4 Q;  1C7Y A;  4B3T Q;  1QVG A;  4JI8 L;  4DUZ L;  1SR3 A;  1VCI A;  2YYZ A;  1Q82 C;  1PHJ A;  1N34 L;  2JA7 H;  1A63 A;  1AH9 A;  4DV3 L;  2Z6K C;  1YI2 A;  3ICE A;  2OQK A;  4HJ5 A;  5JEA G;  1MKH A;  1GD7 A;  4QJF A;  3K8A A;  2JQO A;  2B29 A;  1WYD A;  4YY3 L;  3CAM A;  2R92 H;  2VW9 A;  1HR0 L;  1XJV A;  3W5O A;  1BBU A;  2BH8 A;  4NXN Q;  2OTJ A;  4DV0 Q;  3S1R H;  2PMZ E;  1X3F A;  4HID A;  5JJI A;  3CME A;  1EQQ A;  4P75 A;  2K4K A;  2WAQ E;  2JA5 G;  4DV5 L;  2RHS B;  3W1G A;  5FJ8 G;  1QUQ A;  1L1O C;  5M5W H;  3PUZ A;  3GTL H;  3J80 c;  3PO2 G;  1CUK A;  4DR6 Q;  1UE7 A;  3RLO A;  4LFB L;  4A3I G;  2Z6K A;  1N36 L;  2K14 A;  1X3G A;  3J81 c;  1EIF A;  1KRS A;  5BR8 Q;  4JI6 Q;  2N78 A;  3UDF A;  3M4O H;  1OXX K;  2OCE A;  3KDF B;  4DV7 Q;  2B63 H;  4A3J G;  2R6G A;  4OX9 Q;  3Q8D A;  2R92 G;  4A3D H;  4UY8 C;  2NVQ H;  3ULJ A;  4GNX C;  4DV6 L;  3E9I A;  2LXJ A;  4C3J H;  1U0L A;  1VQ9 A;  1XNQ Q;  2K5V A;  1VQP A;  2AWO A;  4JYA L;  3I7F A;  4JOI A;  1XMQ L;  2ASB A;  4GN3 B;  4LUO A;  3NEN A;  1TXY A;  2KHJ A;  4YCV A;  3S1M H;  4OO1 I;  1YEZ A;  4GOP C;  4A3E G;  3I2Z A;  4PG3 A;  4Y52 H;  2VQE Q;  4JBJ A;  4QGU A;  2V1C C;  3JC6 6;  1PH2 A;  4JV5 L;  1FGU A;  1GKH A;  1KIX A;  1I94 Q;  2ES2 A;  4B3S Q;  1N32 L;  1QZH A;  3ZJY C;  5FLX c;  4Y7N H;  2VQF L;  1JB7 A;  2WB1 E;  3D0F A;  1XPO A;  3KOJ A;  1VQ8 A;  1QVF A;  1Z47 A;  1ASY A;  4DR1 Q;  5FLM G;  3NEM A;  1ASZ A;  1YJW A;  1KL9 A;  1J6Q A;  2EXD A;  2I5L X;  3AFQ A;  4P71 A;  2UU9 Q;  2YU9 H;  4KLK A;  1VQJ A;  2D0P A;  2JE6 I;  1A62 A;  3F2C A;  4A3M H;  4DV4 Q;  1SFO H;  4LF7 Q;  2H5X A;  2WAQ G;  3OTO L;  2AHO B;  3CC4 A;  3A5Z B;  5LMN L;  1Y14 B;  1YHB A;  2A19 A;  4GOP A;  4A3B H;  1S3O A;  1VQD A;  4JI0 Q;  3UDI A;  4DPG A;  4BY1 H;  4B3R Q;  1SE8 A;  5J3B A;  1L0W A;  2I5M X;  4R1J A;  1L1O B;  1P16 A;  1WOC A;  3CP0 A;  4JCV E;  2R7F A;  1XNR L;  1SRO A;  2KCT A;  5IP9 G;  1IBL Q;  3HOW H;  4BXX H;  5IYD G;  1HNW L;  2NVY H;  1N9W A;  5GAD C;  4DR7 Q;  3I56 A;  3L0O A;  5IE8 A;  3GTP H;  4EQ5 A;  4IJL A;  4LFC Q;  2CWP A;  5IP7 H;  1S40 A;  4K0K Q;  4A3M G;  2PQA A;  1VQ5 A;  4X6A H;  4WJ3 M;  1WI5 A;  2JA9 A;  3RLN A;  4GNX B;  2HHH Q;  1E3P A;  4A3B G;  2UXD Q;  2ID0 A;  1FJG L;  1KC8 C;  4A3C G;  4OON A;  4GN5 A;  4R4Q A;  5IWA L;  3DLL A;  1PYB A;  3HOZ H;  2Y0S E;  1IL2 A;  4A3G H;  1O7I A;  1VQB A;  1WCM H;  1HR0 W;  2CCZ A;  4UP7 A;  1AE2 A;  1BVS A;  1PFS A;  4AQY Q;  3HKZ G;  1FL0 A;  1EWI A;  3UDG A;  1JJG A;  2XGT A;  2WB1 G;  1IBK L;  1N33 Q;  3I4O A;  5M3F H;  2K5N A;  4X65 L;  3CW2 C;  3GD7 A;  1JJC B;  1NMG A;  1NTG A;  1KAW A;  4NPS A;  3H3V H;  4DV1 Q;  1YJN A;  5GRO A;  3U58 A;  2PI2 E;  3M3Y H;  1PYS B;  2NZH A;  4IPD A;  3RR5 A;  5IP7 G;  3CCQ A;  1D8L A;  1GVP A;  3TRZ A;  1XTD A;  4EX5 A;  1S72 A;  3GTM H;  1YIJ A;  1PH8 A;  1KQS A;  1EIY B;  2VL6 A;  4GKJ Q;  2B3G A;  3KF6 A;  4KHP L;  3OW2 A;  1B7Y B;  2LXK A;  3BZK A;  1MJE A;  4LF8 L;  3MXN B;  2JEB I;  2L15 A;  3M9B A;  3TS0 A;  1IBM L;  3HOZ G;  1FVI A;  3G4S A;  4X62 Q;  2JA5 H;  4BA2 I;  4A3G G;  4MTN A;  5FJ8 H;  4IFD I;  1OXS C;  1VQL A;  5HGQ A;  4GLV B;  3PO2 H;  4GKK L;  3E9H A;  4JI4 Q;  3F1Z A;  5M3F G;  4A3I H;  2KEN A;  3AFP A;  3PSI A;  5GAH C;  1M90 C;  1NY4 A;  1HR0 Q;  4PZ7 A;  1HJP A;  3G71 A;  2K50 A;  1P8L A;  4AYB G;  3T1H Q;  2JK8 A;  1K3R A;  3K80 C;  3BJU A;  2F4V L;  4A3J H;  1PH7 A;  4DV2 L;  4HIO A;  1CKN A;  4DR5 Q;  1I94 L;  4JC0 A;  1C0A A;  1H95 A;  1XMO L;  1XPR A;  1QZG A;  4NXM Q;  2KHI A;  1TWG H;  5JJK A;  5M5Y H;  4X64 L;  1TWA H;  4IO9 A;  1Q8K A;  3J80 i;  4ALP A;  2Y0S G;  2ZTE A;  3ER0 A;  1Y1V H;  4LFA L;  3J81 i;  3FKI G;  5H1S E;  3GTJ H;  1PV4 A;  1V1Q A;  4A76 A;  3K81 C;  4JOI C;  4A3E H;  2MO1 A;  2UUC L;  1BKB A;  3CCR A;  4LF4 L;  1HZC A;  2RF4 A;  3TEH B;  4B3T L;  5LMN W;  2JA6 H;  3PO3 G;  4DR2 L;  1BBW A;  1VQK A;  1X65 A;  1LTL A;  3S24 A;  4DUY Q;  2KBN A;  4LNQ A;  2UXC Q;  1HNX L;  2DGY A;  2MO0 A;  5FLM H;  3GTG H;  1UE1 A;  4MNO A;  3ULL A;  1K8A C;  4XIG S;  4JYA Q;  4C3I H;  3JAM c;  4GLA C;  1XMQ Q;  2IX1 A;  3KLW A;  2VS1 A;  1Q46 A;  2ZJQ A;  4NXN L;  4IFD G;  4DV0 L;  1Y1V G;  3PF4 A;  2XTI A;  1PA6 A;  1N32 Q;  1SN8 A;  3ULP A;  2UUB Q;  4GS3 A;  1EQR A;  2ZM6 Q;  4DR3 Q;  1K8G A;  3BZC A;  1MJC A;  2WP8 J;  2JA6 G;  4DR6 L;  1HNZ Q;  1QUQ B;  2UXB Q;  4WJ4 A;  3HKZ E;  3CCE A;  1MIU A;  5IP9 H;  4DNI A;  4IOC A;  5IYD H;  4PZ8 A;  4R4C A;  1C9O A;  5C3E H;  5BR8 L;  3M85 A;  4JI5 Q;  1VQ6 A;  3KFU A;  2K52 A;  4XTC S;  1IXR A;  5JJL A;  4LUZ A;  4UP9 A;  3STB D;  5LMN Q;  1UE5 A;  3TQY A;  3KJP A;  3UE1 A;  2GVA A;  1A8V A;  1X55 A;  2E2I H;  2DUD A; 
#chains in the Genus database with same CATH topology
 2WII B;  3A7L A;  1YJ9 A;  1FNV A;  3CCS A;  4R4T A;  4DK3 C;  1XNQ L;  4AIM A;  3I4L A;  5FLX E;  5LMU Q;  3SEB A;  2A6E C;  4O42 A;  1KDC A;  1TWH B;  3PF5 A;  3I72 A;  4MHE A;  1D2B A;  2QW7 A;  3EJI A;  3T1Y Q;  2R61 A;  3PUW A;  5C3E G;  5HUR A;  3BS1 A;  2F4I A;  1XWE A;  1G29 1;  4DR1 L;  2F0U A;  4OEL B;  1I4H A;  5ELO A;  3OWE B;  2NVT H;  3A55 A;  4X3K A;  4DK0 A;  2HT1 A;  4N9P A;  4DV4 L;  1SRU A;  3W1B A;  4CKE A;  4YIJ A;  3D6C A;  1PVO A;  5IT9 L;  2EIF A;  1D1K A;  5GAE C;  4DAV A;  1S5D D;  4UAI A;  1AZP A;  4A3L G;  3P1H A;  3GO5 A;  3H0G G;  5J22 A;  1DON A;  1D1I A;  3L3O C;  2IHF A;  3V2T A;  1VF7 A;  2K01 A;  4HED A;  3AB9 A;  4YHH Q;  4LF8 Q;  5CV7 A;  1NJI C;  3RZO B;  1LYL A;  3J7Z C;  4C3H B;  5IT9 E;  1M1K C;  1F9P A;  2EYL A;  2XIW A;  1PZK D;  2N8N A;  2OTL A;  2HHH L;  3S14 B;  1EYG A;  3U4Z A;  1ML0 D;  4JI8 Q;  4A3K B;  3NXW A;  1KLU D;  1VQE A;  3I4N G;  3FKI H;  4K2L A;  4OIJ A;  1TS5 A;  5C4J B;  4JI3 L;  4RCO A;  4RAU C;  4UP8 A;  4YY3 Q;  1KDB A;  4RG1 A;  4YWM A;  3CCL A;  5EAY A;  5C0X G;  1X56 A;  2GA4 B;  3VA7 A;  5M3M G;  1UWV A;  1EZ8 A;  4J15 A;  4LAA A;  3CCJ A;  3X3M A;  3TN2 A;  3GTK H;  1KHI A;  1KAB A;  3A5U A;  1PH1 A;  3L2P A;  1M4V A;  4TQU S;  1JOK A;  2AKW B;  2YV5 A;  3KF6 B;  1CSP A;  4B3M L;  5C6A A;  1V1P B;  4YWK A;  4JG2 A;  4C1N I;  3Q22 A;  4R4I A;  1E1T A;  1SXT A;  2Z9H A;  3CKI B;  3JAM i;  2PYK A;  2LY7 A;  5DEH A;  4DV6 Q;  3RN5 A;  1TY0 A;  5K36 G;  1HFN A;  1EOV A;  1CM9 A;  5C4H A;  4EGV A;  4XQN A;  1G6P A;  2B2V C;  4FVM A;  3E0E A;  4DR5 L;  4HJA A;  3MA2 B;  1B70 B;  1EYA A;  3P7J A;  3OSO A;  4NKL A;  2L55 A;  2DNC A;  1CFM A;  1RTO A;  3QG1 A;  2VQF Q;  2JA7 G;  1TY2 A;  1CTM A;  4R4O A;  2C9O A;  2VB3 X;  5BN5 A;  2L9H A;  1KLG D;  1T9H A;  1MSG A;  4RMF A;  3B6Y A;  2D0O A;  3NP8 A;  3ND9 A;  4OL7 A;  1TWH H;  4A4I A;  4C2M H;  4J1M A;  1K0R A;  1GUG A;  2Q2U A;  5EJW A;  1Q7Y C;  2VNU D;  4DV7 L;  1DJR D;  1II3 A;  2F0D A;  4OX9 L;  1F2M A;  3S17 B;  1L0Y B;  5LHY 1;  1YHQ A;  2IY5 B;  1QJO A;  1HNW Q;  4CJ0 B;  4IJH A;  1JQY D;  2Q2T A;  1IHZ A;  1WTP A;  1PZJ D;  2YTX A;  3MXP A;  4ME5 A;  1UE6 A;  2UXB L;  4BBR B;  4A3D B;  5M5X H;  4GNX A;  1Q81 C;  3LX0 A;  1VQF A;  3PUX A;  2PPB C;  4C3J B;  4ME3 A;  5E4X A;  2PZT A;  3KK7 A;  4JI5 L;  3WWV A;  2E5L Q;  5JVG 3;  4IPH A;  3CC2 A;  3RZO H;  3CXC A;  1F2Y A;  1I3Q H;  4F8M A;  1IBK Q;  1ICW A;  4DKA C;  3SK6 A;  3M7N A;  1Y69 U;  4H02 A;  5CV9 A;  2GVB A;  3GQB A;  2JA8 B;  4GLX A;  3LNN A;  4FO2 A;  1SMY C;  2QF7 A;  4K8J A;  5C4J H;  3QJY A;  3AYH B;  3MXN A;  2VUM B;  1YHA A;  2WIN B;  1X54 A;  3A7A B;  3HOU H;  4RHR A;  1EU3 A;  2SOB A;  5EPJ A;  4BBS G;  1E22 A;  3E6Z X;  4LF9 L;  2RKS A;  1SYE A;  1X9N A;  3G6J B;  4CHT B;  4GKK Q;  1SAP A;  2E8G A;  3CCV A;  3HOW G;  1LTA D;  3S2D H;  1HZ9 A;  1EU4 A;  2A68 D;  2ZXP A;  3WOF A;  1NMF A;  2ZXO A;  4RGT A;  4QY7 A;  4MN3 A;  2OF1 A;  2XWB B;  3FDT A;  4PMW A;  1XMO Q;  2HIV A;  3C1E A;  1Q1E A;  4X64 Q;  2KA7 A;  5F2D A;  5K5P A;  2XSC A;  3GDE A;  5IYC G;  1T5E A;  2A6H D;  2R7Z G;  4U68 A;  3HOX G;  1J5E L;  2IT1 A;  2N49 A;  3NEL A;  1WCM G;  4FDB A;  3K7U C;  3NBH B;  2WKC A;  2F0T A;  2PI2 A;  1C7Y A;  1PHJ A;  1R9T B;  2Z6K C;  1YI2 A;  2JP1 A;  2OQK A;  4H7B A;  4QJF A;  3R93 A;  5CV8 A;  2R92 H;  3CRL C;  4DXF A;  1DOM A;  1GUN A;  1V8Q A;  4OHJ A;  4DFA A;  1QG7 A;  2K33 A;  4IUV A;  4HID A;  1EQQ A;  1PYW D;  2JA5 G;  2WAQ E;  3R2I A;  5J1Z A;  1H9S B;  3W1G A;  2F0J A;  4OIK A;  2V4D A;  4KY6 A;  5BN4 A;  3PO2 G;  3FRP B;  1CUK A;  1IW7 D;  2M2L A;  4DR6 Q;  3NHH A;  2Z6K A;  1N36 L;  2B2W C;  3J81 c;  1W6J A;  3MZ5 A;  1B1Z A;  5BR8 Q;  1OXX K;  2OCE A;  2B63 H;  1G8Z D;  4A3D H;  4JW0 A;  3S1R B;  3ULJ A;  2LMC B;  5I6Y A;  1JOQ A;  3MWY W;  4C3J H;  1XNQ Q;  4EVO A;  1VQP A;  1JB3 A;  3DEO A;  3U9S A;  1JE4 A;  2Z4I A;  2ASB A;  2KUM A;  3KLS X;  2KHJ A;  4OO1 I;  1AEX A;  4A3E G;  2B2W A;  3DWA A;  2DJG C;  1PH2 A;  1JCK B;  1FGU A;  1QOH A;  1KIX A;  2L12 A;  3OMG A;  4QF4 A;  3M4O B;  1XPO A;  1ASY A;  4DR1 Q;  3NEM A;  5LL6 S;  4A3M H;  3F2C A;  1S4Z A;  4DV4 Q;  2WAQ B;  1SFO H;  2H5X A;  1DD2 A;  1F9R A;  1MI2 A;  4A3B H;  2B39 A;  4B3R Q;  1SE8 A;  5J3B A;  4E6I A;  1L1O B;  1WOC A;  3CP0 A;  4KN7 C;  2KCT A;  1B4O A;  3J7A V;  3T53 B;  3VR2 A;  3AU7 A;  4G7O C;  4KD3 A;  5IE8 A;  3GTP H;  4EQ5 A;  1EYC A;  2A69 C;  3CU7 A;  2XN9 C;  1VQ5 A;  4FF1 A;  4X6A H;  2JXM B;  2FHT A;  1WI5 A;  2HHH Q;  3RLN A;  5HGT A;  1EZ6 A;  3VR6 A;  5G3L F;  1KC8 C;  1QWY A;  5A35 A;  4GN5 A;  1H9R A;  4R4Q A;  1EIH A;  1PYB A;  3W2D A;  1IL2 A;  1O7I A;  1NAP A;  4L8J A;  4XDX A;  2CCZ A;  1PRT B;  2EZV A;  3MAQ A;  1FL0 A;  3UDG A;  4RGO S;  2K03 A;  2NVY B;  5ELB A;  1ENA A;  1BXT A;  3GD7 A;  4X65 L;  2ICI A;  2EYO A;  3HG9 A;  1YJN A;  1TR5 A;  1ICF B;  5IP7 G;  2NB0 A;  3CCQ A;  3TP6 A;  1S72 A;  3S2H B;  4GKJ Q;  2RVL A;  4KHP L;  2F3W A;  3OW2 A;  2MUY A;  1CA6 A;  1STG A;  1PFN A;  4LF8 L;  3M9B A;  1GUW A;  4BA2 I;  1WTX A;  5IOC A;  3V05 A;  1VQL A;  5HGQ A;  1GHK A;  3K6O A;  3E9H A;  5M3F G;  1HA5 A;  3IL8 A;  3AFP A;  4XQJ A;  4XQQ A;  3MHB A;  3G71 A;  1YNN C;  2K50 A;  3K80 C;  5ELF A;  2F4V L;  1PH7 A;  1H95 A;  4DR5 Q;  4JC0 A;  3QO2 A;  2KHI A;  2A73 B;  4DK1 A;  5M5Y H;  1D5X C;  1XXG A;  2A68 C;  2XWJ B;  2ZTE A;  3Q24 A;  2E2J B;  1PTO C;  1IYV A;  4JVZ A;  3J81 i;  2EY5 A;  1D5Z C;  1V1Q A;  4A76 A;  2MO1 A;  4ZYS A;  4LF4 L;  3EVQ A;  3GTO B;  1D5M C;  1GXD C;  3PO3 G;  1EQV A;  2I07 B;  2A6H C;  2ENB A;  5EPL A;  2KBN A;  4HMI A;  1EYD A;  5FLM H;  1IL8 A;  1SJE D;  1UE1 A;  4KY7 A;  2A6E D;  1TWG B;  1TWA B;  1Q46 A;  1MHW C;  1H9K A;  4IFD G;  4DV0 L;  2QDL A;  1Y1V G;  2XTI A;  1IKL A;  1PA6 A;  1KNA A;  1TWF B;  4GS3 A;  1K8G A;  3BZC A;  1JOO A;  1MJC A;  1NUC A;  2JA6 B;  2WP8 J;  3QWN A;  1NR4 A;  2UXB Q;  2X69 A;  3HKZ E;  3CCE A;  2CHB D;  4ABN A;  4DNI A;  4IOC A;  3GV3 A;  5C3E H;  3GTG B;  3M85 A;  4JI5 Q;  5JJL A;  1IXR A;  4C3I B;  4LUZ A;  4UP9 A;  3WOE A;  3STB D;  1BCP D;  1IW7 C;  4DA2 A;  5E1F A;  3DWQ A;  1Y8N B;  1X55 A;  3DEP A;  1YVC A;  3OYY A;  2QA4 A;  3J7A 5;  1A3V A;  1EUJ A;  2RBM A;  1V9P A;  4KMU C;  1L2F A;  4A3C H;  4KN4 C;  1VQC A;  1D7Q A;  4A3L H;  4L6T B;  2HD3 A;  4OWT B;  1EFW A;  2AQ2 B;  1R4Q B;  4L5S A;  1U4P A;  2PW7 A;  3CHB D;  2FJ2 A;  2PNH A;  3PCO B;  4ZUJ A;  2YTY A;  4AYB E;  1RF2 D;  1VQG A;  3UDX A;  4FF2 A;  2SNS A;  2UU9 L;  4LF9 Q;  1C8C A;  3S2H H;  1I6H B;  3K7A H;  2QKI C;  4HN7 A;  4LF7 L;  2E5L L;  1RKN A;  5EBC A;  2VZA A;  4UDU C;  1NE3 A;  3Q6S A;  2F0H A;  3HKZ B;  3SVM A;  3TP7 A;  4GOP B;  4DAM A;  3I4N H;  2JA8 G;  2N55 A;  4L5R C;  3PUY A;  1HA6 A;  2D5D A;  1E7Z A;  2E2H B;  3E0J A;  1C4Q A;  4K5W A;  2DY7 A;  2I5H A;  3HOV G;  1EOT A;  4YCW A;  5C0X H;  3CD6 A;  5M3M H;  4LFC L;  1J5E Q;  4NW2 A;  5GQO A;  4IOA A;  3VYR A;  4L5T A;  1IYJ B;  2PQA B;  2FMM A;  5EKL A;  1WJJ A;  4HIM A;  1FR3 A;  1I4Q A;  2E2J H;  2E74 C;  4G7Z C;  4A93 G;  4A3F G;  2O5I C;  1RIP A;  2NWG A;  1G6Z A;  1OXU A;  2BDO A;  4AQY L;  1J9O A;  1WTO A;  2BH2 A;  1K83 B;  1SNQ A;  3GTO H;  4IZ8 A;  3CCM A;  2M00 A;  4PNY A;  1DYQ A;  5K36 H;  2X6G A;  1CQF A;  4DK6 C;  4L5Q A;  2PW5 A;  3LGJ A;  4BY7 G;  1Q1B A;  4ODG A;  3N6R A;  1G91 A;  1GUS A;  5ELN A;  2BA1 A;  3M7G A;  1O80 A;  3NBI A;  4U67 3;  1N36 Q;  4XYO A;  1LT4 D;  2VB2 X;  4DR2 Q;  2NZ1 D;  3KDF A;  2R93 B;  1TWF H;  3MXG A;  1W2B A;  1OXT A;  3R8B A;  4JI4 L;  2NZO A;  3T1H L;  1L0X B;  1SBB B;  2BCO A;  1ILP A;  3GTK B;  4ZQ3 A;  5CV4 A;  4LW1 A;  5COR A;  2OQ0 A;  1QB5 D;  3K0Y A;  3C46 A;  4NXM L;  5FO9 B;  2ZTC A;  1HPC A;  3ONA B;  1ZYR C;  1VQN A;  1GUT A;  4H44 C;  1K73 C;  1PTO F;  1X3P A;  1STB A;  5C4X G;  1EY5 A;  1X3E A;  1Y8P B;  2UXC L;  1FGB D;  4X3U A;  1H9M A;  4KHV A;  1VQA A;  3PIO A;  1JJ2 A;  2H4O A;  1SMY D;  5D3D A;  5M9O A;  1I6H H;  2EYP A;  2KVM A;  1I6V C;  4L63 B;  5C0X J;  2QGQ A;  1WTH A;  3N52 A;  3FVQ A;  1VQM A;  2CWA A;  4LF5 Q;  2ZM6 L;  1TVX A;  1E1O A;  4C2M B;  3HOY G;  4WJW A;  4P73 A;  3F2D A;  4KHZ A;  4ID6 A;  1ENC A;  1DOL A;  2E2H H;  1HUM A;  1R4P B;  1X6O A;  1K3B C;  5CR3 A;  2CQO A;  1Q12 A;  2N3S A;  4BBS H;  3T56 B;  4P74 A;  4LK1 C;  5FO7 B;  2DNE A;  4EQN A;  2LSS A;  4DNR B;  1F2L A;  4X65 Q;  1F9S A;  3CF5 A;  3STB C;  1BCP C;  4B3R L;  2IX3 A;  4X66 Q;  1STN A;  1T5X D;  1A0I A;  4KY5 A;  2D9U A;  3TP8 A;  3G6E A;  5M5X B;  1KRT A;  3A54 A;  3A74 A;  5AJ3 Q;  4ZAI A;  1K83 H;  3TZU A;  3I90 A;  4DR4 L;  3BVG A;  1Y1W H;  4JI1 Q;  3NE5 B;  3I4M G;  4KHP Q;  3KF8 B;  2AWN A;  1HQM C;  1TWC H;  4OO1 G;  1LO5 D;  2X6L A;  1IKM A;  2F3V A;  5IYC H;  3P75 A;  2R7Z H;  1CQV A;  5I9P A;  4HCS A;  4AH6 A;  4BY1 G;  3HOX H;  1I3Q B;  5IT9 c;  2K5D A;  5C3X A;  1CKO A;  2CH4 W;  1I5F A;  2CKZ B;  1VQ4 A;  2NN6 H;  1MSH A;  4NDX A;  4BXX G;  4JI2 L;  2R93 H;  3ND8 A;  3MVV A;  3GV6 A;  2F4V Q;  4DAY B;  1G51 A;  1SNO A;  2K5H A;  2RHQ B;  5C44 G;  2WAC A;  4CDC C;  3HOU B;  4POF A;  2QEX A;  4IPG A;  4GKJ L;  4IUT A;  1YIT A;  4TRD A;  2ZJP A;  4LF4 Q;  2HDM A;  3S2D B;  3R3O A;  1N34 L;  1SR3 A;  1VCI A;  2YYZ A;  1AH9 A;  1ET9 A;  2RDH A;  1A6X A;  2K5Q A;  2XVS A;  3KBX A;  3K8A A;  4XYQ A;  2JQO A;  3GTM B;  1WYD A;  2J7Z A;  2VW9 A;  1DOK A;  3W5O A;  2FMC A;  4DV0 Q;  2PMZ E;  2HCC A;  1X3F A;  2EOT A;  1QNK A;  2K4K A;  5FOB B;  2K6A A;  3DMU A;  5FJ8 G;  4TSS A;  1Q3L A;  2KHS A;  3RLO A;  4LFB L;  4A3I G;  1U4M A;  1EIF A;  5I2X A;  5KEE A;  1XYI A;  4DF7 A;  1F2Z A;  3UDF A;  3WDN A;  2Z8L A;  4A3J G;  2R92 B;  2NVQ H;  4GNX C;  3E9I A;  3MTS A;  3VYU A;  2CW0 C;  4F88 A;  1O7Z A;  1BF4 A;  3IFD A;  2AWO A;  2F0L A;  3I7F A;  3EQL C;  4GN3 B;  3NTH A;  4YCV A;  1YEZ A;  2A69 D;  4QGU A;  4JV5 L;  5LL6 X;  1GKH A;  1STA A;  3OIP A;  3ZJY C;  2K5W A;  4O1N A;  4Y7N H;  1JB7 A;  3KUP A;  3D0F A;  3KOJ A;  2B63 B;  1EL0 A;  2RCF A;  1KL9 A;  2EXD A;  4C3I G;  2I5L X;  5J39 A;  2UU9 Q;  2HQE A;  2PMZ B;  4IUQ A;  1ET6 A;  2JE6 I;  5D65 A;  4LF7 Q;  1J8I A;  3OTO L;  2BE5 C;  3GP7 A;  4IUN A;  4JI0 Q;  3T13 A;  2I5M X;  1P16 A;  4N9T A;  4JCV E;  2R7F A;  1SRO A;  5IP9 G;  2QIL A;  5IYD G;  3BDL A;  3J7A F;  3DM1 A;  3L0O A;  1PXU A;  1KDA A;  4RKL A;  4LFC Q;  2CWP A;  5IP7 H;  4RGN A;  4A3M B;  4K0K Q;  1SFO B;  2EYH A;  2AQ1 B;  3Q0A A;  4A3B B;  5EKI A;  1K28 A;  1FJG L;  1WVL A;  1YNN D;  2Y0S E;  1AN8 A;  1ESR A;  1A15 A;  1VQB A;  1ESF A;  1AE2 A;  3VYT A;  4AQY Q;  3HKZ G;  4ZKB B;  1EWI A;  3DUZ A;  2WB1 G;  3IFT A;  2OXP A;  3I4O A;  5M3F H;  2K5N A;  5FO8 B;  4NPS A;  1KAW A;  1IYU A;  1PTO D;  1YNJ D;  3GTP B;  2BOS A;  3TME A;  2NZH A;  1BCP F;  2Z6B A;  4IPD A;  3RR5 A;  5JEA H;  1D8L A;  1GVP A;  4EX5 A;  3GTM H;  1YIJ A;  1PH8 A;  2IJ0 A;  3KF6 A;  5DNF A;  1B7Y B;  1MJE A;  1V1P A;  3A8I E;  1I50 B;  3TS0 A;  2SNM A;  3HOZ G;  4A3G G;  4MTN A;  3VYS A;  5KND A;  1OXS C;  1A3U A;  3OIQ A;  4GLV B;  5I2Y A;  4JI4 Q;  4B9W A;  3V96 A;  5GAH C;  4CBV A;  4AYB G;  3T1H Q;  2JK8 A;  3ERO A;  3BJU A;  3GTQ B;  1C0A A;  4HIO A;  4FF3 A;  1SYD A;  3NK9 A;  4NXM Q;  2VXW A;  3D4R A;  1Q8K A;  3C1F A;  2Y0S B;  1U9R A;  4IFD H;  1VMP A;  1Y1V H;  5I9O A;  4ZKC B;  3FKI G;  1V1O A;  2UUC L;  4B3T L;  4DR2 L;  1BBW A;  1PRT D;  1DZ1 A;  4DNT B;  5KYI A;  3VR4 A;  3SK4 A;  2UXC Q;  3H94 A;  2DGY A;  1SYF A;  2TSS A;  4MNO A;  1K8A C;  4JYA Q;  4JPB W;  5M5Y B;  1QIL A;  4GLA C;  1XMQ Q;  3HZX A;  1HRJ A;  3KLW A;  4NXN L;  3SK8 A;  1B3A A;  3ULP A;  4Z9C B;  3H09 A;  4CDF C;  2ZM6 Q;  3A8K E;  4WJ4 A;  1F9Q A;  1QUQ B;  2F1M A;  3OPO A;  2EXZ A;  1MIU A;  2F0I A;  4PZ8 A;  3BG3 A;  3MFG A;  1STH A;  4R4C A;  2K52 A;  2QEJ C;  1SND A;  2SDF A;  4MTK A;  3OOC A;  2Q8T A;  3UE1 A;  1A8V A;  1STE A;  5JJZ A;  1HZA A;  1HH2 P;  5JEA J;  3K0X A;  2I0Q A;  1MGS A;  1EQT A;  3BVZ A;  1VQH A;  5JPN C;  3VR5 A;  4B3S L;  2ATW A;  3I73 A;  5C3E B;  2XRS D;  4DR4 Q;  4LF5 L;  1HHV A;  3NWS A;  2OT2 A;  4G4K A;  3H3V I;  1DM0 B;  2G9D A;  4PZ6 A;  3OMC A;  3S9W A;  5C0X I;  3MEF A;  1W3S A;  2K32 A;  1OXV A;  4QIW E;  1UEA B;  4HAE A;  1CZW A;  2WKD A;  1I50 H;  1TQO A;  4JI2 Q;  4A93 H;  1RL2 A;  2C35 B;  3G7L A;  4P2C B;  4R8N A;  4IFD J;  1PFB A;  3TRE A;  2ICE C;  3H0G B;  1VQ7 A;  2D2C C;  4X66 L;  4DU9 A;  4DR7 L;  4UPA A;  1LAB A;  3I70 A;  4GN4 B;  5AJ3 L;  2O2L D;  3K7A B;  1X3Q A;  1ZKO A;  3NBH A;  5KGU A;  2RCN A;  2F0M A;  4HJ9 A;  2YTV A;  3GTQ H;  4BY7 H;  4QB4 A;  4RH6 A;  4C3H G;  1NBW A;  4JI1 L;  5CBE E;  4HR7 B;  2O5J C;  3TP5 A;  1H9J A;  1SNP A;  1N34 Q;  1AE3 A;  1SLJ A;  4A3K G;  3I4N B;  3M4P A;  3MEH A;  1EEF D;  5TSS A;  3U4V A;  1SYB A;  4JBM A;  1N33 L;  2PCF B;  1ZYR D;  2O4X A;  4DV1 L;  1BR9 A;  1H9S A;  5M3M B;  4I65 A;  3S1Q H;  2AMC B;  1QVC A;  1LM0 A;  1M8A A;  4QIW B;  4ZRZ A;  1XPU A;  1HFG A;  1LTT D;  2XRQ D;  4LFB Q;  4OWW B;  1YNJ C;  2KOL A;  4KKT A;  1XTC D;  4X62 L;  3NQI A;  1KD1 C;  3HP3 A;  3PIP A;  1K9M C;  3TZD A;  1HNX Q;  4GZY C;  1GO3 E;  1RHP A;  5C4X H;  1NNX A;  4JK1 C;  1PDQ A;  1KNE A;  1EFI D;  1PH4 A;  1JWU D;  4X3S A;  2KEC A;  4IUR A;  2VY3 A;  2EJM A;  1RDP D;  4M8A A;  4JV5 Q;  1CKN B;  4OXP A;  2JA7 B;  3FPP A;  2DJF C;  3HRZ C;  2GN5 A;  1PTO H;  1A2T A;  5DM6 3;  1EY6 A;  3MFY A;  1WFQ A;  1EWH A;  5IY0 A;  2BDN A;  1ILQ A;  5CBA E;  4CDE C;  1AFP A;  4HIK A;  3HOY H;  3EN2 A;  1EIG A;  1B9M A;  4BS9 A;  2E2D C;  2F0V A;  3TSS A;  3OTO Q;  4DUY L;  1LTB D;  2ZXR A;  3D3R A;  3RLF A;  1L1O A;  2MPM A;  4FXK C;  3CMA A;  5IGF A;  1PRT C;  4APV A;  1TKW B;  3RNU A;  2F0P A;  4S3S A;  3A8J E;  5GAG C;  3H6M A;  2Z4H A;  1V43 A;  4MZ9 A;  3AEV A;  1EY8 A;  2MNA A;  3SGI A;  1U5K A;  2B63 G;  2N88 A;  3PGZ A;  1VF5 C;  4WOR A;  4JBW A;  4BBR G;  4A3D G;  3H0G H;  3RZD H;  5KRU A;  3S1N H;  4C3J G;  5DLQ E;  3EBE A;  4H13 C;  3I4M H;  3BYT B;  1FJG Q;  2R3Z A;  5CV5 A;  3D31 A;  2FXQ A;  5ELC A;  2NBF A;  4OO1 H;  2HQL A;  1HZB A;  3S1M B;  4C1N K;  3FHW A;  3TS2 A;  1I4X A;  4LF6 L;  2L0C A;  3NQT A;  3A0J A;  3HFZ B;  2KCN A;  2F0Q A;  3ERS X;  3H3V C;  1E24 A;  1JMC A;  4A75 A;  2J0T D;  3UE0 A;  5IYB G;  4JI0 L;  4HSP A;  4POG A;  2OWO A;  4K6D A;  2NN6 I;  2A1A A;  1LT5 D;  2LS0 1;  4JBK A;  1HTP A;  1S5C D;  4DGZ A;  1TS2 A;  4LUV A;  1IZ6 A;  1A2U A;  2RSN A;  2WFW A;  4QL5 A;  3G48 A;  1FNU A;  2Q2H A;  1SE4 A;  4NB3 A;  3FP9 A;  2VUM G;  3BDC A;  5C44 H;  4M1U B;  1OTC A;  1GUO A;  1LV9 A;  4K0K L;  4BBS B;  1EY0 A;  2MP1 A;  4ZUI A;  2NVX H;  4K14 A;  4HSV A;  3SE0 A;  1B8A A;  4K5V A;  1DGS A;  1LTI D;  3HOW B;  5E7N A;  4Q5V A;  1PH6 A;  3M4Q A;  2P5Z X;  3H91 A;  2BA0 A;  4OWX B;  1CHP D;  3AQQ A;  1Y1W B;  4I7A A;  1JE5 A;  3J81 j;  1PH3 A;  4BWG B;  1TWC B;  4PMB A;  2KQ3 A;  1YBY A;  3D6W A;  1VQO A;  2R7Z B;  2L5T A;  2UUA Q;  2HUG A;  1JT8 A;  3HOX B;  1WCM B;  2A8V A;  3BZD B;  4H0L C;  5IOD A;  4JI7 L;  2UUC Q;  4V19 0;  4B3T Q;  5L37 A;  2RQX A;  4DUZ L;  2CW0 D;  2JA7 H;  1PLF A;  4DV3 L;  1BCP B;  3M3Y B;  2EYJ A;  2B29 A;  3CAM A;  5NUC A;  1BBU A;  2BH8 A;  4NXN Q;  3JAM L;  5COY A;  2JA5 B;  3FEW X;  4DXG A;  4DV5 L;  2LFN A;  1HCZ A;  5JVH 3;  3PO2 B;  3D8G A;  5M5W H;  3PUZ A;  3GTL H;  3J80 c;  3CRK C;  4QCL A;  1ROD A;  3D4D A;  1Q8I A;  2BE5 D;  2EYM A;  4X3T A;  1SNC A;  4CJ2 C;  4JI6 Q;  1QNU A;  1LTS D;  4EQP A;  4XXE A;  2A74 C;  1EWC A;  3JAM E;  1C48 A;  4RHS A;  3TBI B;  2G9H D;  3SR1 A;  1EY7 A;  2LXJ A;  1VQ9 A;  2K5V A;  2HDL A;  4JYA L;  3GTJ B;  1G2T A;  4JOI A;  1XMQ L;  2IW3 A;  1TXY A;  1BO0 A;  3NEN A;  4A3E B;  3S1M H;  4GOP C;  4FYD A;  3I2Z A;  4JBJ A;  3JC6 6;  4QMG A;  2EY1 A;  2ES2 A;  4B3S Q;  1QZH A;  5FLX c;  1KAA A;  1BNZ A;  3DWP A;  3LWU A;  1QVF A;  1Z47 A;  1EY4 A;  2K7V A;  5FLM G;  3K58 A;  1ASZ A;  1YJW A;  1K8M A;  2Z1C A;  2NVQ B;  2NTS A;  2YU9 H;  1Y8O B;  2D0P A;  1A62 A;  2K1B A;  2WAQ G;  1S5B D;  2AHO B;  3CC4 A;  3A5Z B;  1RCV D;  2KEE A;  2A19 A;  1B50 A;  4GOP A;  2SEB D;  1VQD A;  2F0E A;  3PIP 3;  5FKA C;  4Y7N B;  4NP5 A;  1PRT F;  5EBD A;  1XNR L;  4ULL A;  5JPM C;  3HOW H;  5GAD C;  1N9W A;  4DR7 Q;  3I56 A;  1SSO A;  1E2W A;  1LAC A;  5T1G A;  3IAY A;  4KV6 A;  3T16 A;  4IJL A;  5C3W A;  1S40 A;  1O7L A;  3O13 A;  1CI3 M;  2PQA A;  4WJ3 M;  2JA9 A;  4GNX B;  1E3P A;  2UXD Q;  3NTI A;  4A3C G;  1ZEQ X;  5IWA L;  3DLL A;  3HOZ H;  1CK1 A;  4N8F A;  4A3G H;  3BYY B;  1WCM H;  1ENF A;  4UP7 A;  1PFS A;  3K5L A;  5IIF A;  1N33 Q;  3CW2 C;  1NTG A;  4ZLT F;  4DV1 Q;  3U58 A;  2PI2 E;  3M3Y H;  1LLR D;  1A3T A;  1MD2 D;  4F7X A;  4ZK9 B;  3TRZ A;  3KLS A;  1EIY B;  1I4P A;  2LXK A;  1NR2 A;  1RJT A;  3MXN B;  2L15 A;  1IBM L;  2PQE A;  2JA5 H;  4X62 Q;  4OGQ C;  4IFD I;  1HXY D;  2KCC A;  3PO2 H;  5M3F B;  5JAV A;  4K6L A;  4IQZ A;  1M90 C;  2M9V A;  1NY4 A;  1HR0 Q;  4PZ7 A;  1E0B A;  5ELD A;  3S15 B;  5EKK A;  4FXD A;  1FD7 D;  1ONL A;  4DV2 L;  3F2U A;  1I94 L;  2G5D A;  4LMQ D;  1TS3 A;  3SDZ A;  4IO9 A;  2PZU A;  3J80 i;  3ER0 A;  1K8O A;  3E3X A;  3GTJ H;  5H1S E;  3EA6 A;  3K81 C;  5DAU A;  4A3E H;  3FMC A;  4KKS A;  3CCR A;  1HZC A;  1JWM D;  3PO3 B;  5IGB A;  2IWH A;  5AFW A;  1LTL A;  3S24 A;  4DUY Q;  3VA5 A;  3MXU A;  4LNQ A;  4B9X A;  1F77 A;  1HNX L;  1RTN A;  3ULL A;  4N8X 1;  3L9A X;  2VS1 A;  1Y1V B;  2F03 A;  3KLR A;  4RA8 A;  3I3C A;  1N32 Q;  5C4Z A;  1SN8 A;  3EFX D;  1EQR A;  1JWS D;  2TMP A;  2JA6 G;  1DXM A;  3QR8 A;  3QOL A;  3T51 B;  4CJ1 B;  2C5C A;  2FIN B;  4TKO B;  2B2V A;  4XTC S;  2A5H A;  5LMN Q;  1FYC A;  1TII D;  5KNC A;  3Q23 A;  1SJH D;  1STY A;  3KJP A;  4LF6 Q;  5I4D A;  1CSQ A;  2CH4 A;  2Q8R E;  3SK5 A;  2K75 A;  1O78 A;  3BU2 A;  5C5L A;  3I55 A;  3K5N A;  3K57 A;  2VQE L;  3KF8 A;  4P72 A;  2MJ8 A;  2ZTD A;  4FNF A;  4R8I A;  4LWC A;  5KYL A;  1LUZ A;  3OW7 A;  3NPP A;  1WD0 A;  1BOS A;  1WTQ A;  1JR0 D;  3D4W A;  4C3H H;  3CQZ B;  3S14 H;  1TU2 B;  4TVA B;  1CT1 D;  2CFM A;  4DAY A;  4A3K H;  1KXL A;  2RSO A;  4XT3 B;  2H1E A;  1HQR D;  3F8T A;  2I46 A;  2F0O A;  2HCI A;  1TS4 A;  1KTK A;  4C56 C;  1IBL L;  2FFK B;  4KK7 A;  2IHE A;  3HOV B;  3K5M A;  3S15 H;  2E75 C;  1B2T A;  3PIO 3;  3PUV A;  2PNR C;  4JI7 Q;  2XNA C;  3NSW A;  1U4R A;  4DUZ Q;  1HTL D;  3KJO A;  4A93 B;  4A3F B;  4DV3 Q;  1Q86 C;  2F3I A;  2EE1 A;  1DCZ A;  1UEB A;  1CA5 A;  3HKS A;  4RCN A;  2JJQ A;  1Q90 A;  3T4A C;  3J7Y W;  3PO3 H;  2K04 A;  2D62 A;  4NMZ A;  1Y1W G;  2MQH A;  4BY7 B;  5IGG A;  1LT3 D;  4R9W A;  4DV5 Q;  4UHV A;  4LFA Q;  1JOR A;  4YWL A;  2MHV A;  3E5S A;  2UUA L;  4PV1 C;  1CKM A;  2NN6 G;  2HIX A;  1PZI D;  4ZCK A;  2WV6 D;  4HJ8 A;  4F87 A;  4QUC A;  2R93 G;  3QB3 A;  4FF4 A;  3J81 L;  4J6H A;  4IPC A;  5D14 A;  1SNM A;  1FNW A;  5EQ0 A;  5IGD A;  2IPK D;  4CKC A;  3S1Q B;  2B2T C;  1EY9 A;  1PH9 A;  1SE2 A;  5HY6 A;  2EY6 A;  1O7Y A;  3S16 B;  1D6E C;  4HCE A;  4FXG C;  1BDO A;  3BDO A;  1W6K A;  2MFI A;  4IAL A;  3CPF A;  1LT6 D;  3S17 H;  4HMJ A;  1X32 A;  3J81 E;  2Q2I A;  3F2B A;  1SYC A;  4G7H C;  3NTK A;  5C4X B;  3QOJ A;  2PO4 A;  4ILW A;  2DY8 A;  2B2T A;  1N8R C;  3K59 A;  4RGM A;  2DN8 A;  3KYH C;  4BBR H;  3L7Z C;  4JI6 L;  4OEM B;  2R7D A;  2B8G A;  3U50 C;  2KCM A;  1PH5 A;  5E3F A;  2EJG C;  1VMC A;  1VS0 A;  3K5O A;  4HJ7 A;  1XNR Q;  1PTO B;  4KI0 A;  3CQZ H;  2UUB L;  5IYB H;  2ALY B;  1BBX C;  4DR3 L;  4O0A A;  3DM3 A;  1HNZ L;  4WRD A;  2JA8 H;  3HOY B;  1QE6 A;  2CVR A;  2F0G A;  1I4R A;  2VUM H;  4O2D A;  3HOV H;  1AP0 A;  1GHJ A;  5IWA Q;  2RDF A;  3C2P A;  1S5F D;  3CC7 A;  3VDY A;  2JN4 A;  3PV0 A;  2F52 A;  4LJZ C;  1SDF A;  2B2Y C;  4QUF A;  1VQI A;  1WTR A;  3OHX C;  4IUU A;  5LMU L;  4A3F H;  1RD9 D;  1NSN S;  2JYO A;  1GM5 A;  3RZD B;  3S1N B;  1GOZ A;  3T1Y L;  3I4M B;  3SHL A;  2EQS A;  4YCU A;  3CPW A;  1IBM Q;  4BY1 B;  3HGB A;  2B2Y A;  2NYZ D;  1Z9F A;  1MBY A;  2UXD L;  3EIV A;  3RN2 A;  4QQB X;  2EYF A;  1CHQ D;  2EY2 A;  3H15 A;  4JI3 Q;  1YZ6 A;  3W3A A;  4G57 A;  4KKU A;  1QCB D;  2F0S A;  2OEO A;  5C5M A;  1R9T H;  3CCU A;  1B53 A;  2JEA I;  4CKB A;  4KTA A;  1UUP A;  3KBG A;  3IRB A;  2Q8I B;  4DV2 Q;  1E2Z A;  3RMH A;  4BA1 I;  1I94 Q;  1YNX A;  1WD1 A;  5CGK A;  5C44 B;  5D3I B;  1SMX A;  2Z0S A;  4KD4 A;  3HOU G;  2IX0 A;  4YHH L;  2NVX B;  2ZJR A;  5CC4 A;  3R2T A;  4B3M Q;  2JSO A;  3S16 H;  5JOB A;  5ISR A;  2QDB A;  1JC7 A;  3PQI A;  2F0K A;  1QVG A;  4JI8 L;  2L4N A;  1Q82 C;  2RA4 A;  1A63 A;  4I7Z C;  1HUN A;  5IGE A;  3ICE A;  4HJ5 A;  5JEA G;  1MKH A;  1GD7 A;  1EEI D;  3PMF A;  4WFN 3;  3ITP A;  4YY3 L;  1HR0 L;  2IL8 A;  1XJV A;  2OTJ A;  3S1R H;  5JJI A;  3CME A;  4P75 A;  2RHS B;  1QUQ A;  4V0B A;  1Z6H A;  1L1O C;  2NUC A;  3U9O A;  3HEJ A;  1UE7 A;  4A3I B;  3QIA A;  2K14 A;  1X3G A;  3FPU B;  1KRS A;  1SEB D;  2NTT A;  5CV6 A;  2N78 A;  1S5E D;  5CYU A;  3M4O H;  3KDF B;  2LKV A;  4DV7 Q;  1JIC A;  4A3J B;  4CDD C;  2R6G A;  4OX9 Q;  4K2K A;  3Q8D A;  2R92 G;  4KJN A;  4UY8 C;  1UNS A;  1SE3 A;  3MC0 B;  4DV6 L;  4K5X A;  1U0L A;  2QCP X;  2E76 C;  2J4X A;  4EQO A;  3LWE A;  2EJF C;  3NWT A;  2KED A;  1WTW A;  5M5W B;  3GTL B;  4LUO A;  2RDG A;  5A2Q L;  4PG3 A;  4Y52 H;  2VQE Q;  1B44 D;  2AQ3 B;  2V1C C;  2MGS A;  1N32 L;  2L1B A;  3IKJ A;  2VQF L;  1I4G A;  2WB1 E;  5ELE A;  1VQ8 A;  2KJX A;  5KNB A;  4PMC A;  3AFQ A;  1J6Q A;  4P71 A;  2EVB A;  4KLK A;  1VQJ A;  4IUP A;  5A2Q E;  1ZXT A;  2EPB A;  5LMN L;  1Y14 B;  1YHB A;  1S3O A;  1LTG D;  3UDI A;  4DPG A;  5IGC A;  4BY1 H;  3X3N A;  1L0W A;  1K0S A;  4R1J A;  4Q0F A;  3M4Y A;  1IBL Q;  5KIX A;  4BXX H;  1HNW L;  1LTR D;  2NVY H;  2EDG A;  2YU9 B;  1AZQ A;  1BQQ T;  2B2U C;  3BVM A;  4A3M G;  4HTH A;  2E2I B;  4DAP A;  3C3L A;  3A56 A;  1VDZ A;  4A3B G;  2ID0 A;  4OON A;  3ZYY X;  3NUC A;  1HR0 W;  1BVS A;  1JJG A;  2WB1 B;  2XGT A;  1PFM A;  2F0F A;  1WTV A;  1IBK L;  4RKB A;  5BN3 A;  3H3V H;  1JJC B;  1NMG A;  1TT2 A;  2B2U A;  5GRO A;  1PYS B;  2NVT B;  1XTD A;  1OO9 B;  1KQS A;  3VR3 A;  2VL6 A;  2B3G A;  1Z7T A;  1B9N A;  3BZK A;  4FP5 D;  3SXH A;  2L11 A;  3HOZ B;  2JEB I;  4A3G B;  1FVI A;  4MIU A;  3G4S A;  3P20 A;  3DXJ C;  4J8Q A;  4DN4 M;  2AUJ D;  5FJ8 H;  2F0N A;  3I91 A;  4GKK L;  3F1Z A;  1B3Q A;  4A3I H;  5T1I A;  3URY A;  3UI2 A;  2KEN A;  3PSI A;  5I6W A;  2CQA A;  3HS0 C;  3OWF A;  1HJP A;  4AYB B;  1PMR A;  2AUK A;  1P8L A;  2PZW A;  1K3R A;  1UAP A;  4A3J H;  4RFB A;  1CKN A;  3TDQ A;  1XMO L;  1XPR A;  1QZG A;  1GJX A;  1TWG H;  5E4W C;  4X64 L;  5JJK A;  1TWA H;  1AW7 A;  4ALP A;  4B08 A;  4XT1 B;  2Y0S G;  3AMU A;  3DHQ A;  4LFA L;  3FKI B;  3ERQ A;  1PV4 A;  4KJO A;  1BUV T;  3J80 L;  4JOI C;  1BKB A;  1SYG A;  2RF4 A;  3TEH B;  5LMN W;  2JA6 H;  1CZG A;  1VQK A;  1X65 A;  4RWS C;  1U4L A;  2K05 A;  1E2V A;  2MO0 A;  1G2S A;  3GTG H;  4PQX A;  4XIG S;  4C3I H;  3JAM c;  2ZT9 C;  2IX1 A;  4K8I A;  2ZJQ A;  3J80 E;  3PF4 A;  2B8F A;  5G3L D;  2UUB Q;  4CGY B;  5DM7 3;  5EGT A;  4DR3 Q;  3RD4 A;  2F0W A;  4IN3 A;  1HNZ Q;  4DR6 L;  5FLX L;  1NCV A;  2K28 A;  5IP9 H;  5IYD H;  3I8Z A;  1XX8 A;  1C9O A;  1VQ6 A;  5BR8 L;  3RUZ A;  3KFU A;  5FK9 C;  1UE5 A;  5CMD A;  3TQY A;  2GVA A;  5EPK A;  2E2I H;  2DUD A; 
#chains in the Genus database with same CATH homology
 1YVC A;  3OYY A;  4LF6 Q;  2QA4 A;  1HZA A;  1EUJ A;  3J7A 5;  1YJ9 A;  1HH2 P;  3CCS A;  4R4T A;  4DK3 C;  1CSQ A;  1V9P A;  5JEA J;  1XNQ L;  4AIM A;  3K0X A;  2I0Q A;  1L2F A;  4A3C H;  2K75 A;  3BU2 A;  5LMU Q;  3I55 A;  1VQH A;  2VQE L;  1VQC A;  1D7Q A;  3PF5 A;  4B3S L;  2ATW A;  4A3L H;  4OWT B;  1EFW A;  4P72 A;  3T1Y Q;  5C3E G;  3PUW A;  4LF5 L;  4DR4 Q;  4L5S A;  1G29 1;  3H3V I;  2PNH A;  3PCO B;  2ZTD A;  4DR1 L;  2YTY A;  5ELO A;  4AYB E;  4PZ6 A;  2NVT H;  1VQG A;  3UDX A;  4LWC A;  1LUZ A;  2UU9 L;  4LF9 Q;  2HT1 A;  5C0X I;  3S2H H;  3MEF A;  1W3S A;  3K7A H;  4DV4 L;  1SRU A;  3W1B A;  4C3H H;  4LF7 L;  1OXV A;  4QIW E;  2E5L L;  2VZA A;  3S14 H;  1PVO A;  1I50 H;  1NE3 A;  4TVA B;  2CFM A;  2EIF A;  4JI2 Q;  5GAE C;  4A3K H;  4A93 H;  1KXL A;  4GOP B;  3I4N H;  4DAM A;  1RL2 A;  2C35 B;  4A3L G;  2JA8 G;  3F8T A;  4IFD J;  3GO5 A;  3TRE A;  4L5R C;  3H0G G;  3PUY A;  1IBL L;  1VQ7 A;  4X66 L;  1E7Z A;  2IHE A;  2IHF A;  4UPA A;  4DR7 L;  2I5H A;  4GN4 B;  4YCW A;  5AJ3 L;  3HOV G;  3S15 H;  4YHH Q;  4LF8 Q;  3CD6 A;  1NJI C;  5M3M H;  4LFC L;  1J5E Q;  3GTQ H;  4HJ9 A;  4BY7 H;  2RCN A;  1LYL A;  5GQO A;  2YTV A;  3J7Z C;  3PUV A;  1M1K C;  1NBW A;  4IOA A;  4JI1 L;  4JI7 Q;  2N8N A;  2OTL A;  4L5T A;  1IYJ B;  2HHH L;  1EYG A;  3U4Z A;  2PQA B;  4HIM A;  1WJJ A;  4JI8 Q;  4DUZ Q;  1N34 Q;  2E2J H;  3KJO A;  1AE3 A;  1SLJ A;  1VQE A;  4A3K G;  4A93 G;  4DV3 Q;  3I4N G;  3FKI H;  4A3F G;  3M4P A;  1Q86 C;  1RIP A;  2F3I A;  1OXU A;  1UEB A;  4AQY L;  3U4V A;  3HKS A;  2BH2 A;  2JJQ A;  4JBM A;  3GTO H;  3PO3 H;  1N33 L;  4JI3 L;  4YY3 Q;  4UP8 A;  2D62 A;  3CCM A;  1Y1W G;  2MQH A;  4RG1 A;  4YWM A;  4DV1 L;  5EAY A;  3CCL A;  5C0X G;  1X56 A;  4DK6 C;  5M3M G;  4L5Q A;  3I4M G;  1UWV A;  3LGJ A;  2AMC B;  3S1Q H;  1QVC A;  4BY7 G;  4DV5 Q;  1LM0 A;  1Q1B A;  4J15 A;  4LFA Q;  3CCJ A;  5ELN A;  2BA1 A;  4YWL A;  1XPU A;  3GTK H;  1KHI A;  3A5U A;  2UUA L;  4LFB Q;  1PH1 A;  3L2P A;  4OWW B;  1CKM A;  4TQU S;  1N36 Q;  2AKW B;  2HIX A;  2NN6 G;  2YV5 A;  3KF6 B;  1CSP A;  4DR2 Q;  4B3M L;  4HJ8 A;  4X62 L;  3KDF A;  4YWK A;  1KD1 C;  1TWF H;  2R93 G;  1W2B A;  3PIP A;  4JG2 A;  1K9M C;  1OXT A;  4R4I A;  1HNX Q;  1E1T A;  1GO3 E;  4JI4 L;  4IPC A;  5C4X H;  3JAM i;  4DV6 Q;  3RN5 A;  5K36 G;  2NZO A;  1PH4 A;  1EOV A;  1PH9 A;  3T1H L;  1G6P A;  5HY6 A;  3E0E A;  2VY3 A;  4DR5 L;  4HJA A;  4LW1 A;  1B70 B;  2OQ0 A;  4NXM L;  4JV5 Q;  2MFI A;  1CKN B;  3CPF A;  3S17 H;  2ZTC A;  4OXP A;  1VQN A;  2JA7 G;  2VQF Q;  2Q2I A;  4R4O A;  3F2B A;  2GN5 A;  1K73 C;  1T9H A;  1WFQ A;  4RMF A;  5IY0 A;  3B6Y A;  2D0O A;  5C4X G;  1TWH H;  1N8R C;  3KYH C;  4A4I A;  4C2M H;  3EN2 A;  4BBR H;  4HIK A;  3HOY H;  3L7Z C;  1K0R A;  4JI6 L;  1X3E A;  2R7D A;  3OTO Q;  4DUY L;  3U50 C;  1Q7Y C;  2Q2U A;  2UXC L;  2VNU D;  4DV7 L;  2KCM A;  3RLF A;  4OX9 L;  1VQA A;  3PIO A;  1L1O A;  1JJ2 A;  1PH5 A;  3CMA A;  1I6H H;  1VS0 A;  1YHQ A;  2IY5 B;  4APV A;  5C0X J;  4HJ7 A;  2QGQ A;  3RNU A;  1XNR Q;  4KI0 A;  5GAG C;  1HNW Q;  4IJH A;  3CQZ H;  2Q2T A;  2UUB L;  1V43 A;  5IYB H;  1VQM A;  2CWA A;  4MZ9 A;  4LF5 Q;  2ALY B;  3AEV A;  2YTX A;  2ZM6 L;  4DR3 L;  2MNA A;  1E1O A;  4O0A A;  3SGI A;  1U5K A;  2B63 G;  3DM3 A;  1UE6 A;  1HNZ L;  3PGZ A;  2JA8 H;  2UXB L;  3HOY G;  4BBR G;  4JBW A;  5M5X H;  4P73 A;  4GNX A;  1Q81 C;  4A3D G;  1VQF A;  3H0G H;  3F2D A;  4KHZ A;  3RZD H;  3PUX A;  3S1N H;  4ME3 A;  5DLQ E;  3EBE A;  4JI5 L;  2E2H H;  3I4M H;  3WWV A;  4O2D A;  2E5L Q;  1FJG Q;  3D31 A;  2FXQ A;  1X6O A;  4IPH A;  2VUM H;  5IWA Q;  3HOV H;  2HQL A;  3CC2 A;  3RZO H;  1HZB A;  2CQO A;  1Q12 A;  2N3S A;  3FHW A;  3CC7 A;  3VDY A;  4P74 A;  3CXC A;  3TS2 A;  4LF6 L;  4BBS H;  3PV0 A;  2F52 A;  3A0J A;  1I3Q H;  3ERS X;  3HFZ B;  1IBK Q;  4DKA C;  1E24 A;  3M7N A;  1VQI A;  4A75 A;  2LSS A;  3UE0 A;  4H02 A;  5IYB G;  1JMC A;  4X65 Q;  4JI0 L;  3CF5 A;  3STB C;  4POG A;  2OWO A;  5LMU L;  4B3R L;  2GVB A;  2NN6 I;  4X66 Q;  4A3F H;  2A1A A;  1A0I A;  4GLX A;  3G6E A;  4JBK A;  1KRT A;  3A74 A;  5AJ3 Q;  1GM5 A;  1K83 H;  4LUV A;  5C4J H;  1IZ6 A;  2WFW A;  3AYH B;  4QL5 A;  3T1Y L;  3G48 A;  4DR4 L;  2Q2H A;  1Y1W H;  4NB3 A;  2EQS A;  3FP9 A;  1YHA A;  3KF8 B;  4YCU A;  2AWN A;  4JI1 Q;  5C44 H;  1TWC H;  3CPW A;  1OTC A;  2VUM G;  4KHP Q;  1IBM Q;  4OO1 G;  1X54 A;  5IYC H;  2R7Z H;  4K0K L;  3HOU H;  4AH6 A;  4BBS G;  1E22 A;  4BY1 G;  2NVX H;  4LF9 L;  3HOX H;  1Z9F A;  1B8A A;  5IT9 c;  1DGS A;  1X9N A;  1CKO A;  4GKK Q;  2UXD L;  3EIV A;  1I5F A;  3RN2 A;  2CKZ B;  1VQ4 A;  2E8G A;  4QQB X;  5E7N A;  3CCV A;  3HOW G;  3S2D H;  1PH6 A;  4BXX G;  3H15 A;  4JI3 Q;  1YZ6 A;  1HZ9 A;  4JI2 L;  3M4Q A;  2R93 H;  2BA0 A;  3CCU A;  1R9T H;  2JEA I;  1NMF A;  2F4V Q;  4DAY B;  4OWX B;  4QY7 A;  3IRB A;  3AQQ A;  4DV2 Q;  4BA1 I;  1G51 A;  4PMW A;  1JE5 A;  1YNX A;  2K5H A;  3J81 j;  2RHQ B;  2HIV A;  1XMO Q;  1PH3 A;  1Q1E A;  1YBY A;  4X64 Q;  5C44 G;  1VQO A;  1SMX A;  2Z0S A;  2UUA Q;  5IYC G;  2R7Z G;  3GDE A;  3HOU G;  2IX0 A;  4YHH L;  1JT8 A;  4POF A;  2QEX A;  2ZJR A;  3HOX G;  1J5E L;  2IT1 A;  4B3M Q;  4IPG A;  4GKJ L;  2N49 A;  3NEL A;  1WCM G;  2A8V A;  3S16 H;  1YIT A;  4FDB A;  3K7U C;  3NBH B;  4JI7 L;  2UUC Q;  2ZJP A;  2PI2 A;  4LF4 Q;  1C7Y A;  4B3T Q;  1QVG A;  4JI8 L;  4DUZ L;  1SR3 A;  1VCI A;  2YYZ A;  1Q82 C;  1PHJ A;  1N34 L;  2JA7 H;  1A63 A;  1AH9 A;  4DV3 L;  2Z6K C;  1YI2 A;  3ICE A;  2OQK A;  4HJ5 A;  5JEA G;  1MKH A;  1GD7 A;  4QJF A;  3K8A A;  2JQO A;  2B29 A;  1WYD A;  4YY3 L;  3CAM A;  2R92 H;  2VW9 A;  1HR0 L;  1XJV A;  3W5O A;  1BBU A;  2BH8 A;  4NXN Q;  2OTJ A;  4DV0 Q;  3S1R H;  2PMZ E;  1X3F A;  4HID A;  5JJI A;  3CME A;  1EQQ A;  4P75 A;  2K4K A;  2WAQ E;  2JA5 G;  4DV5 L;  2RHS B;  3W1G A;  5FJ8 G;  1QUQ A;  1L1O C;  5M5W H;  3PUZ A;  3GTL H;  3J80 c;  3PO2 G;  1CUK A;  4DR6 Q;  1UE7 A;  3RLO A;  4LFB L;  4A3I G;  2Z6K A;  1N36 L;  2K14 A;  1X3G A;  3J81 c;  1EIF A;  1KRS A;  5BR8 Q;  4JI6 Q;  2N78 A;  3UDF A;  3M4O H;  1OXX K;  2OCE A;  3KDF B;  4DV7 Q;  2B63 H;  4A3J G;  2R6G A;  4OX9 Q;  3Q8D A;  2R92 G;  4A3D H;  4UY8 C;  2NVQ H;  3ULJ A;  4GNX C;  4DV6 L;  3E9I A;  2LXJ A;  4C3J H;  1U0L A;  1VQ9 A;  1XNQ Q;  2K5V A;  1VQP A;  2AWO A;  4JYA L;  3I7F A;  4JOI A;  1XMQ L;  2ASB A;  4GN3 B;  4LUO A;  3NEN A;  1TXY A;  2KHJ A;  4YCV A;  3S1M H;  4OO1 I;  1YEZ A;  4GOP C;  4A3E G;  3I2Z A;  4PG3 A;  4Y52 H;  2VQE Q;  4JBJ A;  4QGU A;  2V1C C;  3JC6 6;  1PH2 A;  4JV5 L;  1FGU A;  1GKH A;  1KIX A;  1I94 Q;  2ES2 A;  4B3S Q;  1N32 L;  1QZH A;  3ZJY C;  5FLX c;  4Y7N H;  2VQF L;  1JB7 A;  2WB1 E;  3D0F A;  1XPO A;  3KOJ A;  1VQ8 A;  1QVF A;  1Z47 A;  1ASY A;  4DR1 Q;  5FLM G;  3NEM A;  1ASZ A;  1YJW A;  1KL9 A;  1J6Q A;  2EXD A;  2I5L X;  3AFQ A;  4P71 A;  2UU9 Q;  2YU9 H;  4KLK A;  1VQJ A;  2D0P A;  2JE6 I;  1A62 A;  3F2C A;  4A3M H;  4DV4 Q;  1SFO H;  4LF7 Q;  2H5X A;  2WAQ G;  3OTO L;  2AHO B;  3CC4 A;  3A5Z B;  5LMN L;  1Y14 B;  1YHB A;  2A19 A;  4GOP A;  4A3B H;  1S3O A;  1VQD A;  4JI0 Q;  3UDI A;  4DPG A;  4BY1 H;  4B3R Q;  1SE8 A;  5J3B A;  1L0W A;  2I5M X;  4R1J A;  1L1O B;  1P16 A;  1WOC A;  3CP0 A;  4JCV E;  2R7F A;  1XNR L;  1SRO A;  2KCT A;  5IP9 G;  1IBL Q;  3HOW H;  4BXX H;  5IYD G;  1HNW L;  2NVY H;  1N9W A;  5GAD C;  4DR7 Q;  3I56 A;  3L0O A;  5IE8 A;  3GTP H;  4EQ5 A;  4IJL A;  4LFC Q;  2CWP A;  5IP7 H;  1S40 A;  4K0K Q;  4A3M G;  2PQA A;  1VQ5 A;  4X6A H;  4WJ3 M;  1WI5 A;  2JA9 A;  3RLN A;  4GNX B;  2HHH Q;  1E3P A;  4A3B G;  2UXD Q;  2ID0 A;  1FJG L;  1KC8 C;  4A3C G;  4OON A;  4GN5 A;  4R4Q A;  5IWA L;  3DLL A;  1PYB A;  3HOZ H;  2Y0S E;  1IL2 A;  4A3G H;  1O7I A;  1VQB A;  1WCM H;  1HR0 W;  2CCZ A;  4UP7 A;  1AE2 A;  1BVS A;  1PFS A;  4AQY Q;  3HKZ G;  1FL0 A;  1EWI A;  3UDG A;  1JJG A;  2XGT A;  2WB1 G;  1IBK L;  1N33 Q;  3I4O A;  5M3F H;  2K5N A;  4X65 L;  3CW2 C;  3GD7 A;  1JJC B;  1NMG A;  1NTG A;  1KAW A;  4NPS A;  3H3V H;  4DV1 Q;  1YJN A;  5GRO A;  3U58 A;  2PI2 E;  3M3Y H;  1PYS B;  2NZH A;  4IPD A;  3RR5 A;  5IP7 G;  3CCQ A;  1D8L A;  1GVP A;  3TRZ A;  1XTD A;  4EX5 A;  1S72 A;  3GTM H;  1YIJ A;  1PH8 A;  1KQS A;  1EIY B;  2VL6 A;  4GKJ Q;  2B3G A;  3KF6 A;  4KHP L;  3OW2 A;  1B7Y B;  2LXK A;  3BZK A;  1MJE A;  4LF8 L;  3MXN B;  2JEB I;  2L15 A;  3M9B A;  3TS0 A;  1IBM L;  3HOZ G;  1FVI A;  3G4S A;  4X62 Q;  2JA5 H;  4BA2 I;  4A3G G;  4MTN A;  5FJ8 H;  4IFD I;  1OXS C;  1VQL A;  5HGQ A;  4GLV B;  3PO2 H;  4GKK L;  3E9H A;  4JI4 Q;  3F1Z A;  5M3F G;  4A3I H;  2KEN A;  3AFP A;  3PSI A;  5GAH C;  1M90 C;  1NY4 A;  1HR0 Q;  4PZ7 A;  1HJP A;  3G71 A;  2K50 A;  1P8L A;  4AYB G;  3T1H Q;  2JK8 A;  1K3R A;  3K80 C;  3BJU A;  2F4V L;  4A3J H;  1PH7 A;  4DV2 L;  4HIO A;  1CKN A;  4DR5 Q;  1I94 L;  4JC0 A;  1C0A A;  1H95 A;  1XMO L;  1XPR A;  1QZG A;  4NXM Q;  2KHI A;  1TWG H;  5JJK A;  5M5Y H;  4X64 L;  1TWA H;  4IO9 A;  1Q8K A;  3J80 i;  4ALP A;  2Y0S G;  2ZTE A;  3ER0 A;  1Y1V H;  4LFA L;  3J81 i;  3FKI G;  5H1S E;  3GTJ H;  1PV4 A;  1V1Q A;  4A76 A;  3K81 C;  4JOI C;  4A3E H;  2MO1 A;  2UUC L;  1BKB A;  3CCR A;  4LF4 L;  1HZC A;  2RF4 A;  3TEH B;  4B3T L;  5LMN W;  2JA6 H;  3PO3 G;  4DR2 L;  1BBW A;  1VQK A;  1X65 A;  1LTL A;  3S24 A;  4DUY Q;  2KBN A;  4LNQ A;  2UXC Q;  1HNX L;  2DGY A;  2MO0 A;  5FLM H;  3GTG H;  1UE1 A;  4MNO A;  3ULL A;  1K8A C;  4XIG S;  4JYA Q;  4C3I H;  3JAM c;  4GLA C;  1XMQ Q;  2IX1 A;  3KLW A;  2VS1 A;  1Q46 A;  2ZJQ A;  4NXN L;  4IFD G;  4DV0 L;  1Y1V G;  3PF4 A;  2XTI A;  1PA6 A;  1N32 Q;  1SN8 A;  3ULP A;  2UUB Q;  4GS3 A;  1EQR A;  2ZM6 Q;  4DR3 Q;  1K8G A;  3BZC A;  1MJC A;  2WP8 J;  2JA6 G;  4DR6 L;  1HNZ Q;  1QUQ B;  2UXB Q;  4WJ4 A;  3HKZ E;  3CCE A;  1MIU A;  5IP9 H;  4DNI A;  4IOC A;  5IYD H;  4PZ8 A;  4R4C A;  1C9O A;  5C3E H;  5BR8 L;  3M85 A;  4JI5 Q;  1VQ6 A;  3KFU A;  2K52 A;  4XTC S;  1IXR A;  5JJL A;  4LUZ A;  4UP9 A;  3STB D;  5LMN Q;  1UE5 A;  3TQY A;  3KJP A;  3UE1 A;  2GVA A;  1A8V A;  1X55 A;  2E2I H;  2DUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...