2F3VA

Solution structure of 1-110 fragment of staphylococcal nuclease with v66w mutation
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
110
structure length
110
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMWENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Folding stability and cooperativity of the three forms of 1-110 residues fragment of staphylococcal nuclease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 3
structure length 110
sequence length 110
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f3vA00
4KY6A 4N9TA 4QB4A 3ITPA 2RKSA 2F0SA 1SNCA 1F2YA 4NP5A 5E1FA 1EY9A 1ENCA 2EY6A 5C3WA 1EZ8A 1EYCA 2F0DA 2EYLA 5E3FA 1KAAA 1SNQA 1SYCA 5I9OA 4B9WA 5KEEA 1A3VA 1F2MA 1II3A 1EY8A 4HMJA 4ZUIA 4EVOA 4F8MA 4EQPA 5HURA 3R3OA 3EROA 3D4WA 4DF7A 3SHLA 5KRUA 5KGUA 5KYLA 1JOQA 3BDLA 2F0VA 3QB3A 2F0OA 3MHBA 1STAA 4QF4A 2PZTA 5IGCA 4K2LA 4RKLA 4PMCA 2EY1A 1A3TA 4G57A 3E5SA 2PW7A 2EY5A 5C4ZA 1SNDA 1A3UA 3BDCA 1A2TA 1NUCA 2F0FA 2F0MA 5CV7A 4R8NA 5C5LA 3TP7A 5IGGA 5F2DA 2F0QA 5C5MA 5IIFA 3D8GA 2PZUA 5JAVA 2EYMA 1NSNS 3SK5A 1EYDA 4E6IA 2RDFA 1STHA 4H7BA 4ODGA 3TP8A 5CV5A 5ISRA 2EYHA 1IHZA 1SYDA 4KV6A 1TQOA 1SYEA 2F3WA 2F0PA 3NHHA 2ENBA 2PZWA 1RKNA 3MVVA 4K6DA 5C4HA 4PNYA 4KD4A 4QMGA 4PMBA 5EGTA 4N9PA 3SK8A 3TMEA 5KIXA 3P1HA 2O4XA 1SYFA 5EKLA 1STNA 1JOKA 3ERQA 3NUCA 3QOJA 3D6CA 5J1ZA 3SK4A 4EQNA 1U9RA 2QDBA 1SNMA 4K8JA 1EY0A 4ZQ3A 4EQOA 1STGA 2OF1A 3SR1A 3U9OA 4K5WA 4WORA 4MIUA 4K8IA 4ME5A 1JOOA 1EYAA 5NUCA 4DGZA 3MZ5A 4B9XA 3C1EA 5I9PA 3MXPA 5IGFA 1F2ZA 3OMCA 4K2KA 3NP8A 3T13A 1ENAA 5CV4A 4NKLA 4KHVA 3EVQA 5DEHA 4J1MA 4WRDA 3T16A 5IGDA 2SNMA 3D4DA 1KABA 4K14A 2M00A 2F0IA 4OL7A 5M9OA 4K5XA 5C3XA 2EY2A 2NUCA 2HQEA 3EJIA 4ID6A 4KY5A 5C6AA 2RBMA 1SYBA 3OWFA 1SYGA 2LKVA 4S3SA 3NK9A 4TRDA 1SNOA 5DAUA 3TP6A 4F7XA 5I6YA 4K5VA 4I65A 1JORA 2F0TA 1KDCA 2EXZA 2KQ3A 1STBA 4IUNA 1TR5A 2F0NA 4NDXA 2F0LA 4ZUJA 3RUZA 3MEHA 3OMGA 2F0WA 3NXWA 1EY5A 3NQTA 3P75A 5CV8A 5IGEA 2SOBA 2WACA 4KJOA 5CV6A 2F0UA 3QOLA 3V2TA 5HGTA 5IOCA 2F0GA 3HEJA 2OEOA 4J6HA 4KD3A 5IGBA 3DMUA 2PQEA 5IODA 1STYA 2F0HA 1KDAA 3C1FA 3HZXA 3TP5A 5K5PA 5KYIA 3OSOA 4KTAA 1EQVA 5CR3A 3DHQA 2EYFA 4HMIA 3H6MA 2F0EA 2F0KA 2PW5A 3VA5A 4DFAA 5CC4A 1A2UA 4DU9A 1EZ6A 5I6WA 3S9WA 1AEXA 2PYKA 4IALA 3SXHA 2EYOA 4YIJA 1EY6A 5CV9A 1EY7A 5J22A 2EYPA 5J39A 1TT2A 3PMFA 2OXPA 1KDBA 1EY4A 2SNSA 3LX0A 2F0JA 1SNPA 2KHSA 4LAAA 4NMZA 4KY7A 4IZ8A 4KJNA 3SK6A 2EYJA 2F3VA 4RKBA 5JOBA 5CGKA 4HTHA 5EKKA
chains in the Genus database with same CATH superfamily
4DK0A 5CBAE 4M8AA 1VF7A 2JA8B 3HOZB 1EY9A 1ENCA 5FOBB 2A68D 4A3LH 4XT3B 4HMJA 4PZ7A 4F8MA 5HURA 4HCEA 3UI2A 3W2DA 3D4WA 3Q0AA 1PH5A 1YNXA 1G6PA 4LK1C 2F03A 3HKSA 5IYBH 4X3TA 1Y69U 3K8AA 2EY1A 3W1GA 1A15A 1NUCA 2F0MA 4R8NA 5JAVA 4JBKA 4ME3A 4AH6A 2RDFA 1VQ4A 1KXLA 4UDUC 3IRBA 1PYBA 2PZWA 4KHPQ 3TRZA 5C44G 2UUCL 4X3SA 3HOYG 2P5ZX 1LTBD 1STNA 2RVLA 3PQIA 2XIWA 2C9OA 1A8VA 5DM73 4Q5VA 2RHQB 3G7LA 3J81j 1CQVA 2KECA 2RF4A 5FJ8G 3JAMi 2BCOA 3C1EA 3GTJH 2EJMA 2K5VA 3BDOA 1HNZQ 1CA6A 1SMXA 4KHVA 4DAPA 1J5EQ 1NBWA 1H9SA 2NVQH 2DY8A 3S1RB 1KHIA 3FHWA 3RUZA 1GUGA 4NXMQ 3GTKB 3S2DB 1B3AA 1S5DD 1PLFA 3Q23A 5KNBA 2UUAL 3GTOB 3QWNA 5IP9H 4JVZA 1GUSA 1Q8KA 4HEDA 4AQYL 4IJHA 4DV5Q 1QVGA 3VR3A 4GN4B 4C56C 3SXHA 1XPUA 1JJGA 2LY7A 3H15A 3HOVG 4A3GG 4A93G 3OW7A 3G4SA 1AZPA 4IUTA 1TWGB 4C3HG 2ES2A 3PUYA 3S15B 1JE5A 1LT5D 2H5XA 4NP5A 1ASZA 1CHQD 3I70A 1VQKA 2JA8H 3HOZH 3QIAA 1TVXA 3W1BA 1HH2P 4LF8L 1W2BA 4XYQA 3H91A 1SROA 2PZTA 5HY6A 3BZCA 1L2FA 2RA4A 3OW2A 4IFDH 1AZQA 4AYBG 1NSNS 4FVMA 2VB3X 1STHA 1TS5A 4JW0A 4P71A 1W3SA 2ZXOA 1KLUD 5IYCH 1N8RC 4QY7A 1TU2B 1PDQA 1BNZA 1Q90A 4RGTA 3A74A 4X65L 3G6EA 4JV5Q 4DXFA 4IQZA 3EA6A 1E22A 1P16A 2Q2UA 2E5LL 2JJQA 4LF9Q 4QUFA 2OF1A 2Z4HA 3K57A 1GUNA 2CQOA 3I4MB 1VQ8A 2B2YA 4BY7G 5I9PA 5IE8A 5G3LF 1PTOC 1K8MA 1SR3A 4B3TL 4HAEA 1T9HA 2F0IA 4CJ1B 3TN2A 2K5QA 2DUDA 4R8IA 4DN4M 1GHJA 1EQTA 1R9TB 4LF6L 1K28A 5BR8L 2JA5B 5FO9B 1F77A 3S1RH 3D6WA 1MJCA 5CV8A 1RTOA 2SOBA 1DD2A 4JBMA 5CV6A 1EQRA 3GTKH 4JI1L 5IWAL 3S2DH 1PZID 4CDEC 3H0GB 3UDGA 2Y0SG 1BCPD 3GTOH 1HCZA 2K7VA 4IALA 3AB9A 1CUKA 4RH6A 4OO1I 4ULLA 2AWNA 2E76C 1DCZA 3PMFA 1N33Q 4DUZQ 1QZGA 1MD2D 4LJZC 1SNPA 2XWJB 4KJNA 5JOBA 1QNKA 1I4HA 2WV6D 4PZ6A 1HA5A 4DUZL 1TWGH 3ER0A 1I5FA 1ONLA 3M4OB 1JR0D 1CT1D 1IBMQ 1XMQQ 3S15H 1EEFD 1NJIC 5C3WA 2FHTA 1LT3D 2XSCA 1CA5A 3M3YB 3CW2C 1TY2A 2VUMG 4BY1H 3SHLA 4GN5A 3CC2A 1FNWA 1K83B 2G9DA 5IP7H 1A0IA 2KOLA 1CTMA 1YNJC 2KUMA 3MA2B 2Z0SA 1PYWD 1WD0A 4C3JG 5EJWA 4JI0Q 4A3EG 2ZXRA 4BXXG 1X9NA 1VQPA 1M4VA 4QIWE 4E6IA 4AIMA 4G7HC 4JI0L 1IHZA 2DJGC 1XXGA 2E2JB 1I4XA 1JCKB 4PNYA 4GKKQ 3KF6B 3SK8A 4OONA 4X3UA 1YIJA 3J7YW 1NTGA 1VQMA 4KLKA 4X62L 3HS0C 1RCVD 2MO1A 4L5SA 1EY0A 1ET9A 3CF5A 2B2YC 1BXTA 2A6HC 1C8CA 2PNHA 5LMUL 5ELFA 1HZBA 3NWSA 3S1QB 1YHAA 3I4MH 4KHZA 1Y14B 2NVXB 2NN6H 3CRKC 4YCUA 4A75A 1O80A 3LWUA 1BKBA 3K0YA 5C44B 3HOYB 1QB5D 5EAYA 3GP7A 1B8AA 5I6YA 1SNOA 3X3NA 3STBC 1PRTB 3EQLC 3RLOA 4JI6Q 1QVFA 2AHOB 2AQ1B 5M3FH 3MFGA 2EJGC 3KBGA 3QJYA 2BH8A 2JA5H 1M1KC 3KUPA 4HJ5A 1GXDC 3UDFA 1SN8A 5GADC 2BA1A 1O7IA 2QGQA 4DR6Q 3H0GH 2EYOA 4BBRG 5C0XI 4DR7L 3VA7A 4DXGA 5CV9A 2R92G 2A1AA 2EYPA 4GOPB 2A8VA 1N32L 3VDYA 1Y8NB 3E0JA 4DR6L 4RAUC 1XNRQ 5FKAC 5I2YA 4FF1A 4DV1Q 5KNDA 1E24A 2Z1CA 3MXNA 3H3VI 3HP3A 1Q81C 3BVMA 3HOXB 4LFCL 5E1FA 4DV1L 1R4PB 4DR3Q 1D1IA 3T1YL 1EZ8A 3M4OH 1C4QA 1SNQA 2Q2IA 3EBEA 1A3VA 5C4JB 3PGZA 2EDGA 3H09A 3BDLA 4A3GB 3HOVB 1I4RA 4A93B 3M3YH 1G2SA 1I4PA 1S5CD 2XWBB 3E9IA 4H13C 2JA9A 4C3HB 3PF5A 4Y52H 2R6GA 4QUCA 1AE3A 1QJOA 2MFIA 1K83H 5C5LA 3AMUA 1A2TA 2ZM6L 3HG9A 1IKLA 4MZ9A 1VQGA 1SDFA 4RHRA 5BN5A 3PO2G 4YHHQ 2K5NA 3P7JA 4OGQC 4FF3A 2EJFC 4K0KQ 3MVVA 4KD4A 2EQSA 4N9PA 1Z9FA 4YWLA 3CRLC 4A3KG 2E2JH 2JQOA 1EWCA 2B2UC 3D0FA 1IYVA 5CORA 3OHXC 3J81L 5IYDG 1SE8A 4DR1Q 3MZ5A 3ERSX 3T51B 4B9XA 3CCUA 1J8IA 1GOZA 3DXJC 4AYBB 4FXGC 1JMCA 4DV3L 4Y7NB 3DEOA 1VQCA 2M2LA 2BOSA 2MQHA 2Y0SE 4FDBA 3RLFA 2KCMA 1Y1VB 2XRQD 2VS1A 2QW7A 3KF6A 1YNND 1XTDA 2JE6I 2O2LD 2NVXH 1U5KA 2K14A 4A3CH 2EIFA 5C44H 1VMPA 3HOYH 4J8QA 2F0NA 3QG1A 2CCZA 3J80i 2UXCQ 3MTSA 4DR5L 3R8BA 3NQTA 5LL6S 4BY7B 5IGEA 1SE4A 3RN2A 4BWGB 1F9QA 5FJ8H 4LUZA 4YWMA 2UXCL 2XRSD 4KTAA 3AU7A 4DV7L 2EYFA 3VA5A 3H6MA 2YTYA 5H1SE 2C5CA 1VQJA 1YI2A 2ICEC 1I50B 3A8JE 1WI5A 4IPCA 1S72A 2WAQG 1KD1C 3CCMA 1XNQQ 2KHSA 2M9VA 4POGA 2MNAA 4LF7Q 3PIOA 4RGNA 4FYDA 1LTID 1G51A 1OXTA 1Z7TA 1HRJA 3ULPA 2R3ZA 4KK7A 1HUMA 4GS3A 1SYCA 3FKIG 4TVAB 5JEAG 4I7ZC 2Q2TA 1LO5D 3BU2A 2RDGA 1QOHA 1NR2A 4DK3C 2UUBL 5C4JH 2BE5C 3IFTA 4GOPA 2BH2A 1GUWA 4A3GH 4R4TA 3HOVH 2H4OA 2QA4A 5E7NA 4HIKA 4A93H 4JYAQ 3SDZA 3A55A 4RG1A 4C3HH 1KC8C 4JYAL 5EKIA 3A0JA 3FDTA 4ODGA 1FGBD 2AQ2B 2R7ZG 1SYDA 3W5OA 1PFNA 4YCVA 4X3KA 4YWKA 2VUMB 4OIKA 5EGTA 3L7ZC 2C35B 3TS2A 4DA2A 2O4XA 3QOJA 1BQQT 3HOUG 4CHTB 4JI7L 5IT9L 5C0XJ 4HJ8A 3I2ZA 2J4XA 3U58A 1YJ9A 1HZ9A 4C3JB 4XTCS 5ELNA 3GTLB 3MXPA 2RDHA 4K2KA 2JXMB 4DNIA 3K5NA 4WRDA 3K58A 1PTOB 4K14A 3GTGB 1RJTA 1Q86C 1H9SB 2D5DA 4FXKC 4Y7NH 1IXRA 3T1HQ 2N3SA 4P74A 3UDXA 1GHKA 1N34Q 4A3DG 4GZYC 4YY3Q 1DYQA 2ZT9C 3UE1A 2K75A 1RTNA 4I7AA 3BZDB 1N9WA 4BY7H 1STYA 4XQNA 1ZEQX 1WJJA 2D9UA 1HR0Q 3BYYB 1PRTF 1SE3A 1PRTC 2BDNA 1PXUA 4MTKA 1OTCA 3IAYA 1I50H 2PI2A 4BS9A 1ET6A 4A3MH 1RL2A 1Q12A 5FO8B 4EQPA 3HOWG 1BDOA 4JI8L 3CPFA 1IBKQ 2UXDQ 5LL6X 2LFNA 3E9HA 1W6KA 1QWYA 2ATWA 4DV4Q 4LF5Q 3LGJA 3VR2A 1LTSD 1II3A 4P75A 3RLNA 1WD1A 4BBRB 2R92B 4TSSA 4GOPC 1STAA 4IFDI 5E4XA 2WFWA 1QNUA 2G9HD 2J0TD 5D3DA 1WVLA 1PH8A 1D1KA 1UAPA 1IW7C 4IURA 5C3EG 1PH9A 1T5EA 1KLGD 4ZAIA 4DPGA 1VQDA 1X3QA 3D8GA 3F2UA 2NVYB 1SRUA 3VYSA 1TXYA 4KV6A 5KNCA 1TIID 2ZJRA 1I94L 4G4KA 1ZYRD 1GVPA 1JJ2A 4BBSG 3SEBA 2VUMH 2X69A 1SMYD 1UE7A 3NPPA 1HR0W 3J7A5 1UWVA 4ZQ3A 2AWOA 3Q6SA 2MO0A 5FLMG 1LTRD 4O2DA 1LLRD 3I4OA 4IN3A 4LWCA 3PO2B 3RZOB 4C3JH 3S2HB 4ALPA 4A3EH 3GTLH 4BXXH 2UUCQ 1VQEA 3NTIA 5IGDA 3SVMA 4OL7A 5AJ3L 2QDLA 5HGQA 1K3RA 1H9KA 2OQ0A 1PTOH 4A3KB 1AE2A 3NK9A 3TP6A 4HJ7A 3OWEB 4C3IG 1JORA 3OOCA 1H95A 4IUNA 4C1NI 1DOLA 1HZAA 1FYCA 3U9SA 3S1NB 3QO2A 4DR4L 1EY5A 4NPSA 2O5JC 2XNAC 2N49A 2OQKA 2CWPA 1NR4A 2Z8LA 1VQAA 4DFAA 4X64L 1UE1A 1DOKA 2KJXA 3KLSA 1KNAA 2UUAQ 4LAAA 1ML0D 1SJHD 3TS0A 2K5DA 1XWEA 2K6AA 2PCFB 3ITPA 3TZUA 3EIVA 3HOXG 1FR3A 3KJOA 5TSSA 4EQ5A 3F2CA 4AQYQ 4F87A 1VQOA 2KCTA 2VL6A 3ND9A 4KKTA 1IKMA 4U673 3I73A 4PG3A 3DWAA 4KN4C 3QB3A 2PMZB 4V190 3KBXA 2WAQB 4CDCC 2B2TA 4BBRH 1I6VC 4R4IA 4UP9A 4A3JB 2R92H 1EIFA 1SSOA 4IPDA 3I3CA 3CCJA 5IIFA 5DNFA 2L5TA 2JP1A 2CW0D 2MUYA 2D0PA 5CMDA 3FKIB 1RHPA 2NVYH 5LMNL 1CSQA 5C4HA 4LF8Q 3W3AA 2R7FA 4JI2L 2RHSB 1JWSD 1JOKA 1EQQA 4X6AH 1EFID 3KLRA 1Q7YC 3TDQA 3HFZB 4LUOA 3RMHA 2VY3A 3DLLA 1X65A 1VQ9A 3GTMB 2NN6I 4HJAA 2JSOA 4DAYA 1PFBA 3DUZA 1BBUA 4R4CA 3WWVA 5COYA 3QR8A 3VYTA 3EVQA 2QEXA 2I5HA 3PV0A 2R7ZB 2NZ1D 3T16A 4X65Q 3PO2H 3RZOH 2M00A 3S2HH 5C3XA 3N52A 3A5UA 2HQEA 1Y1VG 1FGUA 3G71A 3F2DA 4S3SA 1YJNA 2E5LQ 3HOUB 1FVIA 1EU4A 4ZUJA 4A3KH 1YHBA 3MEHA 4PV1C 4DAVA 4IFDJ 5JJIA 4FP5D 4B08A 4TKOB 2ALYB 4J15A 3S1NH 3N6RA 4XXEA 4B3TQ 5IYDH 5IOCA 2LXKA 4J6HA 2OEOA 1PH1A 3CMAA 1PTOF 3E3XA 2ICIA 3C1FA 5K5PA 4HMIA 2HDLA 1PH4A 3DM1A 2PW5A 1U4PA 1DOMA 4LF6Q 5BR8Q 4B3ML 4DV0L 1C9OA 4A3DB 3LX0A 4JBWA 1RIPA 4MTNA 1EWHA 3S16B 3J7AF 4JI1Q 5IWAQ 2F3VA 4X66L 1E7ZA 5EKKA 3MXNB 4KY6A 1CM9A 2GVAA 2F1MA 1WTWA 1RODA 1F2YA 1VQNA 1MSGA 1L0YB 1HZCA 1RDPD 2IJ0A 2XGTA 2K4KA 5CBEE 4NXNL 2VB2X 5C4XG 3EROA 2WB1G 5KGUA 1F9SA 2D62A 2B2TC 3K7AB 3D31A 4G57A 4IO9A 4F88A 2R93G 1D5MC 1OXSC 3HOWB 2IHEA 1VQIA 5CV7A 5A2QE 3PO3G 3S14B 4JCVE 3SK5A 1EYDA 2MJ8A 1EIHA 4R1JA 5CV5A 2XVSA 4JBJA 5ISRA 3PUXA 1L1OA 4K6DA 3FKIH 3FP9A 4UPAA 5JEAH 1KIXA 3ZJYC 4YCWA 1CKNB 4HCSA 3TMEA 1VQ6A 2NVTB 2GN5A 1S5FD 2A69C 3D6CA 3GV3A 5EBCA 1ENFA 1K0SA 5C3EB 2NYZD 2QILA 4HR7B 1GM5A 3BS1A 3E6ZX 4LF4Q 1YHQA 2JA6B 4CKCA 1F2ZA 4DNRB 5GQOA 3JAME 2K5HA 5CV4A 5EPKA 3GTMH 4LF4L 2CWAA 5FO7B 5JEAJ 1FNVA 2G5DA 4KY5A 2DJFC 4X62Q 5EKLA 4EQNA 4BBSB 2UXBL 5CYUA 3PIPA 1S40A 1YJWA 1D5XC 3I7FA 1KDCA 2B2UA 4NDXA 1TR5A 3EN2A 1VQLA 3HOUH 5LMUQ 2HHHL 3PF4A 3M4QA 5A2QL 3P75A 1KTKA 2A6EC 1MKHA 2GA4B 4JI4Q 1EOVA 3UE0A 2NZOA 5M5YB 1E1TA 4JI4L 4L5QA 3CQZB 1U0LA 4UP8A 1PFSA 3X3MA 2B2WA 2K01A 5GAGC 2BDOA 1KAWA 3I4NG 4C3IB 1DGSA 2FXQA 3VR5A 3MXGA 4HIMA 3ND8A 1BVSA 4A3DH 5K36G 2I5MX 3JAML 4GKJL 1R9TH 3S16H 4IUVA 2A68C 4DR7Q 2UU9Q 3I90A 1N32Q 1LACA 4Z9CB 1JOQA 4B3RL 3MHBA 3U4VA 2UU9L 2EE1A 4RHSA 5IGCA 1N36Q 2ZJQA 1EYGA 2I0QA 4LFCQ 1XMOQ 2PW7A 3K7AH 1TWAB 5FK9C 3Q22A 3T1YQ 1N36L 1FJGL 2F0QA 2ZJPA 1XMOL 3HOWH 2WIIB 4AYBE 5IY0A 2EVBA 3S14H 1SAPA 3IKJA 1CQFA 1L1OC 4UP7A 1PH7A 2ENBA 1EIGA 4XYOA 4CKEA 4CDDC 4PMBA 1QCBD 1E2ZA 3P1HA 2IHFA 4JI3Q 4DV6L 2JA7G 3ERQA 4N8X1 3CAMA 3CMEA 4DAMA 2QDBA 2VW9A 1K8AC 2ZM6Q 1QE6A 4JI3L 3TEHB 1ZXTA 4JC0A 2PI2E 4K8IA 5NUCA 5ELDA 5C3EH 1X56A 2ZXPA 3M4PA 1IBLL 3A5ZB 3NP8A 5J3BA 2VQEL 2JYOA 3NELA 4ABNA 2AKWB 1DXMA 4J1MA 3OIPA 2QCPX 1H9JA 3OYYA 4RGOS 4UHVA 2D0OA 4LFBL 3MAQA 2EY2A 2PNRC 1CKNA 3MFYA 4HIDA 1E2WA 1X54A 4IUPA 2EPBA 1WTHA 4OIJA 3CCEA 2KQ3A 1STBA 3JAMc 3AEVA 1UEAB 4BBSH 3NBHB 1NAPA 1PZJD 3S1MB 1LTLA 1BBXC 2Q8TA 3RZDB 3HKZG 3ULJA 4G7OC 1VQBA 4DV3Q 5BN3A 3I72A 5FLMH 3HEJA 4MN3A 5IODA 2FMCA 3LWEA 1VMCA 3E0EA 3NSWA 2B2WC 3S1QH 4OEMB 4CJ2C 1EZ6A 5M5YH 4YIJA 3CQZH 2A5HA 4DR5Q 2LMCB 1B7YB 1HXYD 4C3IH 1PH2A 2QF7A 4APVA 5BN4A 1EOTA 1SNCA 1D7QA 4DV7Q 2SEBD 3K5MA 5E3FA 1E2VA 5KEEA 2WP8J 4R4QA 2VNUD 3R3OA 2ID0A 1FL0A 1WOCA 5KRUA 3I55A 5D65A 1WTPA 2AUKA 4LMQD 4OX9L 2O5IC 4A3JG 1PFMA 5C4ZA 1F2LA 2F0FA 1EU3A 5JJZA 1OXUA 1QILA 2IWHA 1TWAH 2PPBC 3FEWX 1S3OA 1DJRD 1TWHB 2EXDA 3FMCA 1TS3A 1LV9A 3HOXH 3NHHA 1V9PA 2UUBQ 3ZYYX 4KKUA 1ASYA 2IPKD 5C4XB 2WB1B 2B29A 2K50A 1SYFA 3AFQA 1I6HB 1G6ZA 1K3BC 2F52A 3I91A 4BA1I 2CH4W 3U9OA 2R93B 4K5WA 1JOOA 3PO3B 4HSPA 3G48A 1PH6A 4IJLA 3KK7A 1PTOD 5GAEC 5G3LD 4H0LC 2F4VL 4HN7A 3WOEA 3BZKA 2Q8RE 1LT4D 2JK8A 4JI7Q 2Z6KA 1O78A 2ZTEA 3SGIA 4ZYSA 2PQAB 2EXZA 2SDFA 4WJ3M 3KDFB 4IOAA 1WTRA 4JI5L 3GQBA 2FFKB 1TS2A 2MPMA 3RZDH 2YYZA 3ULLA 4L8JA 1NCVA 2VZAA 3HZXA 2QKIC 3L3OC 1V1OA 2L4NA 4MNOA 1BCPC 2B8FA 3BVZA 1JB7A 5I6WA 4DK6C 1D2BA 3B6YA 3VYUA 1X32A 2H1EA 5J39A 4L5RC 1Y1VH 1EFWA 4RCOA 1DM0B 3NBHA 1PHJA 1X6OA 1YEZA 1C48A 3SK6A 4C2MB 3CC7A 2K32A 4HIOA 2RKSA 1HNWL 3CCSA 1K8GA 5AFWA 4A4IA 5ELOA 2JN4A 2HD3A 2KCCA 4PZ8A 1HFGA 3PUVA 2K5WA 1PV4A 2E2IB 1V43A 1S4ZA 1GKHA 1ZKOA 2B2VA 4GN3B 2OT2A 3I4NB 4ZKCB 5M3FG 2GVBA 4P73A 4GNXB 1I4QA 2YTVA 1YNJD 4JI8Q 2YTXA 3E5SA 3C3LA 3R2IA 5M5XB 1EIYB 4LUVA 1A3UA 4LFAL 5A35A 3OIQA 5F2DA 1HTPA 2ASBA 2N55A 2VQFL 4RA8A 2YU9B 4XIGS 4FXDA 1SXTA 4ZCKA 3CD6A 1MSHA 3G6JB 3CHBD 1MGSA 3F1ZA 1TWHH 5D3IB 1B2TA 2F4IA 4C1NK 3NUCA 5C4XH 2IT1A 5DM63 1AP0A 4K8JA 2B8GA 4A76A 3OTOL 4A3BG 4O1NA 1I6HH 2A6HD 4WORA 4ME5A 5T1IA 5IGFA 5EBDA 4DAYB 2R93H 2JA6G 1SBBB 4NKLA 1I94Q 5EPLA 3PO3H 4DKAC 4V0BA 3D4DA 2DNCA 1KABA 2OCEA 2IX1A 1SFOB 2FINB 2Z6KC 4ID6A 2L9HA 4TRDA 5DAUA 1I4GA 4XQQA 2JA7B 3P20A 3STBD 4F7XA 5T1GA 1MJEA 1UE6A 4HJ9A 4OO1G 1Q46A 1YBYA 2F0LA 3OMGA 1V1PA 3NWTA 4DUYL 3M9BA 2RSOA 3QOLA 3J80E 2HCCA 3A7AB 1WCMG 5AJ3Q 3MWYW 1STEA 1GUTA 3K7UC 5JPNC 1CHPD 2L55A 4FO2A 2CHBD 2N78A 2PYKA 4A3IG 3GTGH 1A63A 2PQAA 1D6EC 2PMZE 4DR2Q 4DR4Q 1QG7A 2F0JA 2WAQE 3KDFA 1QZHA 1T5XD 1LTTD 3HKZB 4DR2L 4HTHA 3H3VC 3M7NA 4N9TA 5D14A 2F0SA 3CCQA 1XPRA 4C2MH 4CDFC 4OXPA 1UUPA 4L5TA 4JG2A 4X64Q 1KL9A 2EYLA 5I9OA 4FF2A 2LXJA 4A3CG 2B2VC 1EY8A 1TWCB 2RCFA 1CKOA 1TKWB 2E2IH 4KHPL 3K6OA 3FRPB 4QJFA 3I4NH 4RKLA 1QUQB 1HNXQ 3NQIA 3L0OA 3M7GA 4ZK9B 3GDEA 1SNDA 1NMFA 3TP7A 1U4MA 3J80L 1Q1EA 1FNUA 5M5XH 1B44D 1B53A 1X3EA 1HNXL 3KF8B 5K36H 2NBFA 4GLAC 2EYHA 2F3WA 2K52A 1HNZL 1RKNA 1AW7A 1Q1BA 1EEID 2YU9H 2B63G 2IX3A 1J5EL 1L1OB 2V1CC 4CJ0B 4GNXA 1SNMA 2VXWA 4PQXA 3I4LA 1STGA 2CKZB 3L9AX 3SR1A 3KOJA 2J7ZA 4MIUA 2K05A 4NXML 3T13A 2DN8A 5LMNQ 1HQRD 3C2PA 3NE5B 2Q8IB 4JI2Q 3DWQA 5M9OA 1KRTA 1YNNC 3OWFA 1SYBA 3IFDA 1NMGA 2RQXA 1J6QA 4DV5L 4K5VA 1SFOH 4NB3A 1Y1WG 2F0TA 5C0XG 4XT1B 1BF4A 3CKIB 3PIP3 2DGYA 2JA7H 2D2CC 2WINB 3FPUB 2F0WA 5L37A 5ELBA 3U50C 3CCLA 2WACA 4KJOA 2YV5A 1GUOA 3T53B 2F0GA 4KD3A 3DMUA 4IOCA 1R4QB 4BY1B 3TP5A 2N8NA 3S9WA 2IW3A 1B50A 4RMFA 1CZGA 1LTAD 1D5ZC 3V96A 2HT1A 1BR9A 2WKDA 1HHVA 5FLXE 1A62A 1TY0A 1KDBA 2SNSA 3J80c 3LNNA 3J81i 1QVCA 4U68A 4NMZA 4DNTB 2HCIA 4RKBA 4DV2Q 2X6GA 4QB4A 4WJ4A 2NZHA 1K9MC 3PCOB 1VS0A 4DV2L 3Q8DA 1B9NA 1KAAA 1TS4A 2L1BA 4B3MQ 5LMNW 4DV0Q 1LUZA 1PH3A 2R61A 1Q8IA 2NB0A 2BE5D 3TSSA 1TWCH 1BUVT 1VQ5A 4X66Q 4JV5L 1E3PA 3A56A 4OWXB 2FJ2A 3BDCA 2OWOA 4LF9L 5C5MA 1X3GA 1KNEA 1LYLA 1V8QA 4NXNQ 2BA0A 4H7BA 3FVQA 1Q3LA 4CKBA 1S5BD 5E4WC 1TWFB 3EFXD 1B1ZA 1U4RA 4N8FA 5FLXL 5M3FB 4GNXC 2K28A 3T4AC 5J1ZA 4A3MG 1IYUA 4IPGA 2HIXA 4TQUS 3WOFA 5LHY1 1Z6HA 1QUQA 1CKMA 3BJUA 4A3JH 3KF8A 3CCRA 4A3FG 1IYJB 2B3GA 5DLQE 3EJIA 2RCNA 5EPJA 2LKVA 3TREA 5M3MG 1WTXA 1FD7D 5M5WB 3O13A 2K03A 1ICWA 1SEBD 1HA6A 4A3BB 4O42A 5JPMC 1N33L 4XQJA 2F3IA 4JOIA 4KKSA 1DONA 4OHJA 2Q2HA 4A3LG 1JWMD 3RD4A 2PQEA 3M4YA 2KVMA 2RSNA 1IBML 2L12A 4KI0A 2EZVA 3DHQA 1XMQL 3ICEA 2UXBQ 3L2PA 1A2UA 4DU9A 4R9WA 1BCPB 1O7LA 5IYBG 4ZKBB 2R7ZH 1PRTD 1P8LA 5JVG3 5J22A 1PA6A 1LT6D 2CQAA 3KJPA 2HHHQ 1U4LA 2NWGA 3CPWA 2OXPA 1F9RA 2A19A 2A74C 1BO0A 1LM0A 2JEBI 4QGUA 4IUQA 4QQBX 4KN7C 1WCMB 3KLWA 5ELCA 5FLXc 1EL0A 2KHJA 3BYTB 2ZTDA 1F2MA 4ZRZA 3AFPA 1SLJA 2KENA 2OTLA 4A3IB 3K5OA 1E0BA 3RN5A 2F0OA 4GKKL 4QF4A 2NTTA 3DWPA 3K0XA 4ZLTF 2AUJD 4PMCA 1IW7D 4GKJQ 4RFBA 2EY5A 3PUZA 1V1QA 2KCNA 3CXCA 1K0RA 4WFN3 5IGGA 2E74C 4QCLA 3M85A 2DNEA 3PIO3 2HIVA 3GD7A 1RD9D 5GAHC 4B3RQ 1ZYRC 3J7AV 1TWFH 1JICA 2L15A 1B4OA 4KMUC 4EX5A 1C0AA 1U9RA 2K33A 1SMYC 5JVH3 4IUUA 4UY8C 1PMRA 1FJGQ 3ONAB 1X3FA 3A8IE 3CCVA 1GD7A 4JI6L 3WDNA 4DGZA 4FNFA 5IP9G 4QIWB 1XYIA 2CVRA 3R93A 1UNSA 3OMCA 1VF5C 2X6LA 1ENAA 2Z4IA 1M8AA 4DV6Q 2B63B 1SYGA 1CK1A 1YITA 3GV6A 1W6JA 4I65A 2IL8A 3H94A 1UE5A 2JEAI 2NVTH 1L0WA 5M5WH 1IBLQ 3J81E 3NXWA 2V4DA 2VQEQ 1HTLD 4JOIC 1ICFB 2L11A 1XNRL 2A73B 3I56A 4A3BH 2E2HB 4ILWA 2KBNA 4IPHA 3V2TA 1SE2A 4XDXA 4PMWA 5HGTA 4LFBQ 2JA8G 3HOZG 1NY4A 5IGBA 2B39A 2DY7A 3PUWA 3S17B 1J9OA 2JA6H 4P2CB 4DR3L 1K73C 4QL5A 1Y8OB 2QEJC 2FMMA 1EY6A 4M1UB 3R2TA 2I5LX 1Y1WB 1VCIA 1Q82C 3NTKA 3UDIA 4IFDG 2I07B 4L63B 2KEDA 3SE0A 4OO1H 3URYA 3FPPA 3K81C 1CZWA 5IYCG 1AH9A 1O7YA 2F0DA 1OO9B 2MGSA 3CU7A 1WCMH 4YHHL 2KA7A 3MXUA 4DF7A 3PSIA 3K80C 4K0KL 2F0VA 2WB1E 1YVCA 4Q0FA 1KRSA 1XX8A 1SJED 3GO5A 4GLVB 4POFA 4R4OA 4A3IH 4K2LA 1JJCB 1ILPA 3I8ZA 4OWTB 1G291 1L0XB 2KEEA 1ESRA 1CSPA 2EYMA 4HSVA 1PVOA 2CW0C 4DR1L 4H02A 1TQOA 4WJWA 2F0PA 1B3QA 4QMGA 3JC66 3Q24A 4OX9Q 1HJPA 3SK4A 3V05A 1DZ1A 5EQ0A 2HQLA 3A7LA 1NE3A 4EQOA 3NTHA 1XTCD 1UEBA 1EYAA 3F8TA 1MIUA 2XN9C 4B3SQ 4LNQA 3HRZC 1HFNA 4O0AA 1M90C 1IL2A 5DEHA 1KQSA 1VQHA 2OTJA 2E75C 4B3SL 2NUCA 2CFMA 2AMCB 4DK1A 5KYLA 1RF2D 4A3MB 2B63H 1S5ED 2LSSA 5JJKA 1VDZA 2R7DA 5IT9E 1JWUD 1D8LA 1VQFA 4RGMA 1V1PB 3K59A 1XNQL 2F4VQ 3KYHC 2F0UA 4BA2I 1X3PA 1LABA 1F9PA 4H44C 4GLXA 4LF7L 1JQYD 4A3FB 2KHIA 1I3QB 3GTQB 2IX0A 2Y0SB 2N88A 2F0HA 1JE4A 2E2HH 5KYIA 1GO3E 3IL8A 1AFPA 1EQVA 3BVGA 3AQQA 4BY1G 4EGVA 1ESFA 2F0EA 2F0KA 5CC4A 4P72A 3S17H 1AEXA 1G8ZD 4L6TB 3J81c 3GTPB 1ILQA 1BOSA 5M3MB 5IP7G 1HQMC 1EY7A 1TT2A 1XPOA 1K8OA 4JI5Q 1WTVA 2K04A 3RR5A 5C0XH 1Y1WH 3RNUA 5CGKA 1O7ZA 3U4ZA 2E2DC 3K5LA 3S1MH 2EY6A 4OWWB 3TBIB 1B9MA 1EYCA 3A54A 1GJXA 3J7ZC 1MI2A 4B9WA 3H3VH 1AN8A 2WKCA 3MC0B 4ZUIA 1BCPF 5GROA 4EVOA 4NW2A 2Z6BA 3NENA 1C7YA 2I46A 4MHEA 1A3TA 3VR4A 1HNWQ 2E8GA 3T56B 4A3EB 3NEMA 3I4MG 1JB3A 3AYHB 2TSSA 3DEPA 2PZUA 1YZ6A 2NN6G 2XTIA 1CI3M 1HUNA 3TP8A 1OXXK 1H9MA 1BBWA 1HPCA 1EWIA 1SYEA 3C46A 1G91A 1H9RA 3A8KE 5KIXA 4UAIA 1B70B 1E1OA 2A69D 1CFMA 1VQ7A 4FF4A 4LFAQ 3T1HL 3GTJB 2JA5G 3TZDA 3OPOA 1OXVA 1MBYA 4JK1C 2VQFQ 1N34L 4K6LA 3D4RA 4YY3L 3DM3A 3VR6A 1IL8A 1LTGD 3CP0A 2HDMA 2TMPA 4CGYB 3KFUA 5ELEA 1X55A 1Y8PB 3BG3A 2NVQB 3H0GG 2SNMA 1XJVA 1JC7A 3HGBA 2MP1A 4K5XA 2Z9HA 5JJLA 2LS01 1PYSB 5C6AA 2RBMA 3TQYA 3VYRA 3OTOQ 2ZTCA 4RWSC 5I4DA 1PZKD 1HR0L 2IY5B 2EOTA 2AQ3B 2CH4A 1EUJA 2L0CA 1NNXA 1WTOA 1G2TA 4JPBW 1WFQA 2A6ED 3F2BA 3HKZE 5I2XA 1WTQA 2UXDL 1IBKL 1KDAA 3OSOA 5CR3A 4A3FH 5IT9c 3S24A 1I3QH 3GTQH 2PO4A 4LW1A 4DV4L 4CBVA 4LF5L 4OELB 2HUGA 1Z47A 4DUYQ 3NBIA 2NTSA 1EY4A 2K1BA 1A6XA 3GTPH 5M3MH 4G7ZC 1JT8A 4RCNA 4KY7A 1WYDA 4IZ8A 3D3RA 2EYJA 1MHWC 3KLSX 3CC4A 3MEFA 2MHVA 1IZ6A
chains in the Genus database with same CATH topology
4DK0A 5CBAE 4M8AA 1VF7A 2JA8B 3HOZB 1EY9A 1ENCA 5FOBB 2A68D 4XT3B 4HMJA 4F8MA 5HURA 4HCEA 3UI2A 3W2DA 3D4WA 3Q0AA 4LK1C 2F03A 4X3TA 1Y69U 2EY1A 1A15A 1NUCA 2F0MA 4R8NA 5JAVA 2RDFA 4UDUC 2PZWA 4X3SA 1LTBD 1STNA 2RVLA 2XIWA 2C9OA 4Q5VA 5DM73 3G7LA 1CQVA 2KECA 2BCOA 3C1EA 2EJMA 3BDOA 1CA6A 4KHVA 4DAPA 1H9SA 2DY8A 3S1RB 3RUZA 1GUGA 3GTKB 3S2DB 1B3AA 1S5DD 1PLFA 3Q23A 5KNBA 3GTOB 3QWNA 1GUSA 4HEDA 3VR3A 4C56C 3SXHA 2LY7A 3OW7A 1AZPA 4IUTA 1TWGB 4C3HG 3PUYA 3S15B 1LT5D 4NP5A 1CHQD 3I70A 3QIAA 1TVXA 4XYQA 3H91A 2PZTA 2RA4A 4IFDH 1AZQA 1NSNS 4FVMA 2VB3X 1STHA 1TS5A 2ZXOA 1KLUD 1TU2B 1PDQA 1BNZA 1Q90A 4RGTA 4DXFA 4IQZA 3EA6A 4QUFA 2OF1A 2Z4HA 3K57A 1GUNA 3I4MB 2B2YA 5I9PA 5G3LF 1PTOC 1K8MA 4HAEA 2F0IA 4CJ1B 3TN2A 2K5QA 4R8IA 4DN4M 1GHJA 1EQTA 1R9TB 2JA5B 5FO9B 1F77A 3D6WA 5CV8A 1RTOA 2SOBA 1DD2A 5CV6A 1PZID 3H0GB 1BCPD 1HCZA 2K7VA 4IALA 3AB9A 4RH6A 4OO1I 4ULLA 2AWNA 2E76C 1DCZA 3PMFA 1MD2D 4LJZC 1SNPA 2XWJB 4KJNA 5JOBA 1QNKA 1I4HA 2WV6D 1HA5A 1ONLA 3M4OB 1JR0D 1CT1D 1EEFD 5C3WA 2FHTA 1LT3D 2XSCA 1CA5A 3M3YB 1TY2A 3SHLA 1FNWA 1K83B 2G9DA 2KOLA 1CTMA 1YNJC 2KUMA 3MA2B 1PYWD 1WD0A 4C3JG 5EJWA 2ZXRA 1M4VA 4E6IA 4G7HC 1IHZA 1XXGA 2E2JB 1I4XA 1JCKB 4PNYA 3SK8A 4X3UA 3J7YW 3HS0C 1RCVD 1EY0A 1ET9A 2B2YC 1BXTA 2A6HC 1C8CA 5ELFA 3NWSA 3S1QB 4KHZA 2NVXB 2NN6H 3CRKC 1O80A 3LWUA 5C44B 3K0YA 3HOYB 1QB5D 3GP7A 5I6YA 1SNOA 3X3NA 1PRTB 3EQLC 2AQ1B 3MFGA 2EJGC 3KBGA 3QJYA 3KUPA 1GXDC 2BA1A 2EYOA 5C0XI 3VA7A 4DXGA 5CV9A 2EYPA 1Y8NB 3E0JA 4RAUC 5FKAC 5I2YA 4FF1A 5KNDA 2Z1CA 3MXNA 3HP3A 3BVMA 3HOXB 5E1FA 1R4PB 1D1IA 1EZ8A 1C4QA 1SNQA 1A3VA 5C4JB 2EDGA 3H09A 3BDLA 4A3GB 3HOVB 1I4RA 4A93B 1G2SA 1I4PA 1S5CD 2XWBB 4H13C 4C3HB 2R6GA 4QUCA 1QJOA 3AMUA 5C5LA 1A2TA 3HG9A 1IKLA 5BN5A 4RHRA 1SDFA 3P7JA 4OGQC 4FF3A 2EJFC 3MVVA 4KD4A 4N9PA 3CRLC 1EWCA 2B2UC 1IYVA 5CORA 3OHXC 3J81L 3MZ5A 3T51B 4B9XA 1J8IA 1GOZA 3DXJC 4AYBB 4FXGC 4Y7NB 3DEOA 2M2LA 2BOSA 3RLFA 1Y1VB 2XRQD 1YNND 2JE6I 2O2LD 1VMPA 4J8QA 2F0NA 3QG1A 3MTSA 3R8BA 3NQTA 5LL6S 4BY7B 5IGEA 1SE4A 4BWGB 1F9QA 2XRSD 4KTAA 3AU7A 2EYFA 3VA5A 3H6MA 2C5CA 2ICEC 1I50B 3A8JE 2KHSA 2M9VA 4RGNA 4FYDA 1LTID 1OXTA 1Z7TA 1HRJA 2R3ZA 4KK7A 1HUMA 1SYCA 5JEAG 4I7ZC 1LO5D 2RDGA 1QOHA 1NR2A 2BE5C 3IFTA 1GUWA 2H4OA 3SDZA 3A55A 5EKIA 3FDTA 4ODGA 1FGBD 2AQ2B 1SYDA 1PFNA 4X3KA 2VUMB 4OIKA 5EGTA 3L7ZC 4DA2A 2O4XA 3QOJA 1BQQT 4CHTB 5IT9L 5C0XJ 2J4XA 4C3JB 4XTCS 3GTLB 3MXPA 2RDHA 4K2KA 2JXMB 3K5NA 4WRDA 3K58A 1PTOB 4K14A 3GTGB 1RJTA 1H9SB 2D5DA 4FXKC 1GHKA 4GZYC 1DYQA 2ZT9C 1RTNA 3BZDB 1STYA 4XQNA 1ZEQX 2D9UA 3BYYB 1PRTF 1SE3A 1PRTC 2BDNA 1PXUA 3IAYA 4BS9A 1ET6A 1Q12A 5FO8B 4EQPA 1BDOA 5LL6X 2LFNA 1W6KA 1QWYA 3VR2A 1LTSD 1II3A 1WD1A 4BBRB 2R92B 4TSSA 1STAA 4IFDI 5E4XA 1QNUA 2G9HD 2J0TD 5D3DA 1WVLA 1D1KA 1UAPA 1IW7C 4IURA 1T5EA 1KLGD 4ZAIA 3D8GA 1X3QA 3F2UA 2NVYB 3VYSA 4KV6A 5KNCA 1TIID 4G4KA 1ZYRD 3SEBA 2X69A 1SMYD 3NPPA 4ZQ3A 2AWOA 3Q6SA 1LTRD 1LLRD 4IN3A 3PO2B 3RZOB 3S2HB 3NTIA 5IGDA 3SVMA 4OL7A 1H9KA 1PTOH 4A3KB 3NK9A 3TP6A 3OWEB 4C3IG 1JORA 3OOCA 4IUNA 4C1NI 1DOLA 1FYCA 3U9SA 3S1NB 3QO2A 1EY5A 2O5JC 2XNAC 1NR4A 2Z8LA 4DFAA 1DOKA 2KJXA 3KLSA 1KNAA 4LAAA 1ML0D 1SJHD 2K5DA 1XWEA 2K6AA 2PCFB 3ITPA 3TZUA 1FR3A 5TSSA 4F87A 3ND9A 4KKTA 1IKMA 4U673 3I73A 3DWAA 4KN4C 3QB3A 2PMZB 4V190 3KBXA 2WAQB 2B2TA 1I6VC 4A3JB 1SSOA 3I3CA 5IIFA 5DNFA 2L5TA 2JP1A 2CW0D 2MUYA 5CMDA 3FKIB 1RHPA 5C4HA 3W3AA 1JWSD 1JOKA 1EFID 3KLRA 3TDQA 3RMHA 3GTMB 2NN6I 2JSOA 4DAYA 1PFBA 3DUZA 5COYA 3VYTA 3EVQA 3PV0A 2R7ZB 2NZ1D 3T16A 2M00A 5C3XA 3N52A 2HQEA 4S3SA 3HOUB 1EU4A 4ZUJA 3MEHA 4PV1C 4DAVA 4IFDJ 4FP5D 4B08A 4TKOB 3N6RA 4XXEA 5IOCA 4J6HA 2OEOA 1PTOF 2ICIA 3C1FA 5K5PA 4HMIA 2HDLA 3DM1A 2PW5A 1U4PA 1DOMA 4A3DB 3LX0A 4JBWA 1EWHA 3S16B 3J7AF 2F3VA 5EKKA 4KY6A 1CM9A 2F1MA 1WTWA 1RODA 1F2YA 1MSGA 1L0YB 1RDPD 2IJ0A 5CBEE 2VB2X 3EROA 5KGUA 1F9SA 2D62A 2B2TC 3K7AB 3D31A 4G57A 4F88A 1D5MC 1OXSC 3HOWB 5CV7A 5A2QE 3S14B 3SK5A 1EYDA 2MJ8A 1EIHA 5CV5A 2XVSA 5ISRA 3PUXA 4K6DA 5JEAH 3TMEA 4HCSA 2NVTB 1S5FD 2A69C 3D6CA 3GV3A 5EBCA 1ENFA 5C3EB 2NYZD 2QILA 4HR7B 3BS1A 3E6ZX 2JA6B 4CKCA 1F2ZA 4DNRB 3JAME 5CV4A 5EPKA 5FO7B 5JEAJ 1FNVA 4KY5A 5EKLA 4EQNA 4BBSB 5CYUA 1D5XC 1KDCA 2B2UA 4NDXA 1TR5A 5A2QL 3P75A 1KTKA 2A6EC 2GA4B 5M5YB 3CQZB 3X3MA 2B2WA 2K01A 2BDOA 4C3IB 3VR5A 3MXGA 3ND8A 5K36G 3JAML 4IUVA 2A68C 3I90A 1LACA 4Z9CB 1JOQA 3MHBA 2EE1A 4RHSA 5IGCA 2PW7A 1TWAB 5FK9C 3Q22A 2F0QA 2WIIB 2EVBA 1SAPA 3IKJA 1CQFA 2ENBA 1EIGA 4XYOA 4CKEA 4PMBA 1QCBD 1E2ZA 3P1HA 3ERQA 2QDBA 1QE6A 1ZXTA 4K8IA 5NUCA 5ELDA 2ZXPA 3NP8A 2JYOA 4ABNA 1DXMA 4J1MA 3OIPA 2QCPX 1H9JA 4RGOS 3MAQA 2EY2A 2PNRC 3MFYA 1E2WA 4IUPA 2EPBA 4OIJA 2KQ3A 1STBA 1UEAB 1NAPA 1PZJD 3S1MB 1BBXC 2Q8TA 3RZDB 4G7OC 5BN3A 3I72A 3HEJA 4MN3A 5IODA 2FMCA 3LWEA 1VMCA 3NSWA 2B2WC 4CJ2C 1EZ6A 4YIJA 2A5HA 2LMCB 1HXYD 2QF7A 5BN4A 1EOTA 1SNCA 2SEBD 3K5MA 5E3FA 1E2VA 5KEEA 2WP8J 2VNUD 3R3OA 2ID0A 5KRUA 5D65A 1WTPA 2AUKA 4LMQD 2O5IC 1PFMA 5C4ZA 1F2LA 2F0FA 1EU3A 5JJZA 1OXUA 1QILA 2IWHA 2PPBC 3FEWX 1TWHB 1DJRD 3FMCA 1TS3A 1LV9A 3NHHA 3ZYYX 4KKUA 2IPKD 5C4XB 2WB1B 1SYFA 1I6HB 1G6ZA 3I91A 4BA1I 3U9OA 2R93B 4K5WA 1JOOA 3PO3B 4HSPA 3KK7A 1PTOD 5G3LD 4H0LC 4HN7A 3WOEA 2Q8RE 1LT4D 1O78A 4ZYSA 2EXZA 2SDFA 1WTRA 3GQBA 2FFKB 1TS2A 2MPMA 2YYZA 4L8JA 1NCVA 3HZXA 2QKIC 3L3OC 1V1OA 2L4NA 1BCPC 2B8FA 3BVZA 5I6WA 1D2BA 3VYUA 1X32A 2H1EA 5J39A 4RCOA 1DM0B 3NBHA 1C48A 3SK6A 4C2MB 2K32A 2RKSA 5AFWA 2KCCA 1HFGA 3PUVA 2K5WA 2E2IB 1V43A 1S4ZA 2B2VA 1ZKOA 2OT2A 3I4NB 4ZKCB 1I4QA 1YNJD 3E5SA 3C3LA 3R2IA 5M5XB 1A3UA 5A35A 3OIQA 5F2DA 1HTPA 2N55A 4RA8A 2YU9B 4XIGS 4FXDA 1SXTA 1MSHA 3G6JB 3CHBD 1MGSA 5D3IB 1B2TA 2F4IA 4C1NK 3NUCA 2IT1A 5DM63 1AP0A 4K8JA 2B8GA 4O1NA 2A6HD 4WORA 4ME5A 5T1IA 5IGFA 5EBDA 1SBBB 4NKLA 5EPLA 4V0BA 3D4DA 2DNCA 1KABA 2IX1A 1SFOB 2FINB 4ID6A 2L9HA 4TRDA 5DAUA 1I4GA 4XQQA 2JA7B 3P20A 4F7XA 5T1GA 4OO1G 2F0LA 3OMGA 1V1PA 3NWTA 2RSOA 3QOLA 3J80E 2HCCA 3A7AB 3MWYW 1STEA 1GUTA 5JPNC 1CHPD 2L55A 4FO2A 2CHBD 2PYKA 1D6EC 1QG7A 2F0JA 1T5XD 1LTTD 3HKZB 4HTHA 3H3VC 3M7NA 4N9TA 5D14A 2F0SA 1UUPA 2EYLA 5I9OA 4FF2A 2B2VC 1EY8A 1TWCB 1TKWB 3K6OA 3FRPB 4RKLA 3NQIA 3M7GA 4ZK9B 1SNDA 3TP7A 1U4MA 3J80L 1Q1EA 1FNUA 1B44D 1B53A 5K36H 2NBFA 2EYHA 2F3WA 1RKNA 1AW7A 1Q1BA 1EEID 2IX3A 4CJ0B 1SNMA 2VXWA 4PQXA 3I4LA 1STGA 3SR1A 3L9AX 4MIUA 2J7ZA 2K05A 3T13A 2DN8A 1HQRD 3C2PA 3NE5B 2Q8IB 3DWQA 5M9OA 1YNNC 1SYBA 3IFDA 3OWFA 2RQXA 4K5VA 2F0TA 5C0XG 4XT1B 1BF4A 3CKIB 3PIP3 2D2CC 2WINB 3FPUB 2F0WA 5ELBA 2WACA 4KJOA 1GUOA 3T53B 2F0GA 4KD3A 3DMUA 1R4QB 4BY1B 3TP5A 3S9WA 2IW3A 1B50A 1CZGA 1LTAD 1D5ZC 3V96A 1BR9A 2WKDA 1HHVA 5FLXE 1TY0A 1KDBA 2SNSA 3LNNA 4U68A 4DNTB 4NMZA 2HCIA 4RKBA 2X6GA 4QB4A 1B9NA 1KAAA 1TS4A 2L1BA 2R61A 1Q8IA 2NB0A 2BE5D 3TSSA 1BUVT 3A56A 2FJ2A 3BDCA 5C5MA 1KNEA 1V8QA 2BA0A 4H7BA 3FVQA 1Q3LA 4CKBA 1S5BD 5E4WC 1TWFB 3EFXD 1B1ZA 1U4RA 5FLXL 5M3FB 2K28A 3T4AC 5J1ZA 1IYUA 4TQUS 3WOFA 5LHY1 1Z6HA 3KF8A 3EJIA 5EPJA 2LKVA 1WTXA 1FD7D 5M5WB 3O13A 2K03A 1ICWA 1SEBD 1HA6A 4A3BB 4O42A 5JPMC 4XQJA 4KKSA 1DONA 4OHJA 1JWMD 3RD4A 2PQEA 3M4YA 2KVMA 2RSNA 2L12A 4KI0A 2EZVA 3DHQA 1A2UA 4DU9A 4R9WA 1BCPB 1O7LA 4ZKBB 1PRTD 5JVG3 5J22A 1LT6D 2CQAA 1U4LA 2NWGA 2OXPA 1F9RA 2A74C 1BO0A 2JEBI 4IUQA 4KN7C 1WCMB 5ELCA 1EL0A 3BYTB 1F2MA 4ZRZA 4A3IB 3K5OA 1E0BA 2F0OA 4QF4A 2NTTA 3DWPA 4ZLTF 2AUJD 4PMCA 1IW7D 4RFBA 2EY5A 3PUZA 2KCNA 4WFN3 5IGGA 2E74C 4QCLA 3M85A 2DNEA 3PIO3 3GD7A 1RD9D 1ZYRC 3J7AV 1JICA 4KMUC 1B4OA 1U9RA 2K33A 1SMYC 5JVH3 4IUUA 1PMRA 3ONAB 3A8IE 3WDNA 4DGZA 4FNFA 4QIWB 1XYIA 2CVRA 3R93A 1UNSA 3OMCA 1VF5C 2X6LA 1ENAA 2Z4IA 1M8AA 2B63B 1SYGA 1CK1A 3GV6A 1W6JA 4I65A 2IL8A 3H94A 2JEAI 3J81E 3NXWA 2V4DA 1HTLD 2L11A 2A73B 2E2HB 4ILWA 3V2TA 5HGTA 1SE2A 4XDXA 4PMWA 5IGBA 2B39A 2DY7A 3PUWA 3S17B 1J9OA 4P2CB 1Y8OB 2QEJC 2FMMA 1EY6A 4M1UB 3R2TA 1Y1WB 1VCIA 3NTKA 4IFDG 2I07B 4L63B 2KEDA 3SE0A 4OO1H 3URYA 3FPPA 1CZWA 1O7YA 2F0DA 1OO9B 2MGSA 3CU7A 2KA7A 3MXUA 4DF7A 2F0VA 4Q0FA 1XX8A 1SJED 3GO5A 4K2LA 1ILPA 3I8ZA 1G291 1L0XB 2KEEA 1ESRA 2EYMA 4HSVA 2CW0C 1TQOA 4WJWA 2F0PA 4QMGA 3Q24A 3SK4A 3V05A 1DZ1A 5EQ0A 3A7LA 4EQOA 3NTHA 1XTCD 1EYAA 2XN9C 3HRZC 1HFNA 5DEHA 2E75C 2NUCA 4DK1A 5KYLA 1RF2D 4A3MB 1S5ED 1VDZA 5IT9E 1JWUD 4RGMA 1V1PB 3K59A 2F0UA 4BA2I 1X3PA 1LABA 1F9PA 4H44C 1JQYD 4A3FB 1I3QB 3GTQB 2IX0A 2Y0SB 2N88A 2F0HA 1JE4A 5KYIA 3IL8A 1AFPA 1EQVA 3BVGA 4EGVA 1ESFA 2F0EA 2F0KA 5CC4A 1AEXA 1G8ZD 4L6TB 3GTPB 1ILQA 1BOSA 5M3MB 1HQMC 1EY7A 1TT2A 1K8OA 1WTVA 2K04A 5C0XH 5CGKA 1O7ZA 2E2DC 3K5LA 2EY6A 3TBIB 1B9MA 1EYCA 3A54A 1GJXA 1MI2A 4B9WA 1AN8A 2WKCA 3MC0B 4ZUIA 1BCPF 4EVOA 4NW2A 2I46A 4MHEA 1A3TA 3VR4A 3T56B 4A3EB 1JB3A 2TSSA 3DEPA 2PZUA 2NN6G 1CI3M 1HUNA 3TP8A 1OXXK 1H9MA 1HPCA 1SYEA 3C46A 1G91A 1H9RA 3A8KE 5KIXA 4UAIA 2A69D 1CFMA 4FF4A 3GTJB 3TZDA 3OPOA 1OXVA 1MBYA 4JK1C 4K6LA 3D4RA 3VR6A 1IL8A 1LTGD 2HDMA 2TMPA 4CGYB 5ELEA 1Y8PB 3BG3A 2NVQB 2SNMA 1JC7A 3HGBA 2MP1A 4K5XA 2LS01 5C6AA 2RBMA 3VYRA 4RWSC 5I4DA 1PZKD 2EOTA 2AQ3B 2L0CA 1WTOA 1G2TA 2A6ED 5I2XA 1WTQA 1KDAA 3OSOA 5CR3A 2PO4A 4CBVA 2HUGA 1Z47A 3NBIA 2NTSA 1EY4A 2K1BA 1A6XA 4G7ZC 4RCNA 4KY7A 4IZ8A 3D3RA 2EYJA 3KLSX 2MHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY6 A;  4N9T A;  4QB4 A;  3ITP A;  2RKS A;  2F0S A;  1SNC A;  1F2Y A;  4NP5 A;  5E1F A;  1EY9 A;  1ENC A;  2EY6 A;  5C3W A;  1EZ8 A;  1EYC A;  2F0D A;  2EYL A;  5E3F A;  1KAA A;  1SNQ A;  1SYC A;  5I9O A;  4B9W A;  5KEE A;  1A3V A;  1F2M A;  1II3 A;  1EY8 A;  4HMJ A;  4ZUI A;  4EVO A;  4F8M A;  4EQP A;  5HUR A;  3R3O A;  3ERO A;  3D4W A;  4DF7 A;  3SHL A;  5KRU A;  5KGU A;  5KYL A;  1JOQ A;  3BDL A;  2F0V A;  3QB3 A;  2F0O A;  3MHB A;  1STA A;  4QF4 A;  2PZT A;  5IGC A;  4K2L A;  4RKL A;  4PMC A;  2EY1 A;  1A3T A;  4G57 A;  3E5S A;  2PW7 A;  2EY5 A;  5C4Z A;  1SND A;  1A3U A;  3BDC A;  1A2T A;  1NUC A;  2F0F A;  2F0M A;  5CV7 A;  4R8N A;  5C5L A;  3TP7 A;  5IGG A;  5F2D A;  2F0Q A;  5C5M A;  5IIF A;  3D8G A;  2PZU A;  5JAV A;  2EYM A;  1NSN S;  3SK5 A;  1EYD A;  4E6I A;  2RDF A;  1STH A;  4H7B A;  4ODG A;  3TP8 A;  5CV5 A;  5ISR A;  2EYH A;  1IHZ A;  1SYD A;  4KV6 A;  1TQO A;  1SYE A;  2F3W A;  2F0P A;  3NHH A;  2ENB A;  2PZW A;  1RKN A;  3MVV A;  4K6D A;  5C4H A;  4PNY A;  4KD4 A;  4QMG A;  4PMB A;  5EGT A;  4N9P A;  3SK8 A;  3TME A;  5KIX A;  3P1H A;  2O4X A;  1SYF A;  5EKL A;  1STN A;  1JOK A;  3ERQ A;  3NUC A;  3QOJ A;  3D6C A;  5J1Z A;  3SK4 A;  4EQN A;  1U9R A;  2QDB A;  1SNM A;  4K8J A;  1EY0 A;  4ZQ3 A;  4EQO A;  1STG A;  2OF1 A;  3SR1 A;  3U9O A;  4K5W A;  4WOR A;  4MIU A;  4K8I A;  4ME5 A;  1JOO A;  1EYA A;  5NUC A;  4DGZ A;  3MZ5 A;  4B9X A;  3C1E A;  5I9P A;  3MXP A;  5IGF A;  1F2Z A;  3OMC A;  4K2K A;  3NP8 A;  3T13 A;  1ENA A;  5CV4 A;  4NKL A;  4KHV A;  3EVQ A;  5DEH A;  4J1M A;  4WRD A;  3T16 A;  5IGD A;  2SNM A;  3D4D A;  1KAB A;  4K14 A;  2M00 A;  2F0I A;  4OL7 A;  5M9O A;  4K5X A;  5C3X A;  2EY2 A;  2NUC A;  2HQE A;  3EJI A;  4ID6 A;  4KY5 A;  5C6A A;  2RBM A;  1SYB A;  3OWF A;  1SYG A;  2LKV A;  4S3S A;  3NK9 A;  4TRD A;  1SNO A;  5DAU A;  3TP6 A;  4F7X A;  5I6Y A;  4K5V A;  4I65 A;  1JOR A;  2F0T A;  1KDC A;  2EXZ A;  2KQ3 A;  1STB A;  4IUN A;  1TR5 A;  2F0N A;  4NDX A;  2F0L A;  4ZUJ A;  3RUZ A;  3MEH A;  3OMG A;  2F0W A;  3NXW A;  1EY5 A;  3NQT A;  3P75 A;  5CV8 A;  5IGE A;  2SOB A;  2WAC A;  4KJO A;  5CV6 A;  2F0U A;  3QOL A;  3V2T A;  5HGT A;  5IOC A;  2F0G A;  3HEJ A;  2OEO A;  4J6H A;  4KD3 A;  5IGB A;  3DMU A;  2PQE A;  5IOD A;  1STY A;  2F0H A;  1KDA A;  3C1F A;  3HZX A;  3TP5 A;  5K5P A;  5KYI A;  3OSO A;  4KTA A;  1EQV A;  5CR3 A;  3DHQ A;  2EYF A;  4HMI A;  3H6M A;  2F0E A;  2F0K A;  2PW5 A;  3VA5 A;  4DFA A;  5CC4 A;  1A2U A;  4DU9 A;  1EZ6 A;  5I6W A;  3S9W A;  1AEX A;  2PYK A;  4IAL A;  3SXH A;  2EYO A;  4YIJ A;  1EY6 A;  5CV9 A;  1EY7 A;  5J22 A;  2EYP A;  5J39 A;  1TT2 A;  3PMF A;  2OXP A;  1KDB A;  1EY4 A;  2SNS A;  3LX0 A;  2F0J A;  1SNP A;  2KHS A;  4LAA A;  4NMZ A;  4KY7 A;  4IZ8 A;  4KJN A;  3SK6 A;  2EYJ A;  2F3V A;  4RKB A;  5JOB A;  5CGK A;  4HTH A;  5EKK A; 
#chains in the Genus database with same CATH topology
 4DK0 A;  5CBA E;  4M8A A;  1VF7 A;  2JA8 B;  3HOZ B;  1EY9 A;  1ENC A;  5FOB B;  2A68 D;  4A3L H;  4XT3 B;  4HMJ A;  4PZ7 A;  4F8M A;  5HUR A;  4HCE A;  3UI2 A;  3W2D A;  3D4W A;  3Q0A A;  1PH5 A;  1YNX A;  1G6P A;  4LK1 C;  2F03 A;  3HKS A;  5IYB H;  4X3T A;  1Y69 U;  3K8A A;  2EY1 A;  3W1G A;  1A15 A;  1NUC A;  2F0M A;  4R8N A;  5JAV A;  4JBK A;  4ME3 A;  4AH6 A;  2RDF A;  1VQ4 A;  1KXL A;  4UDU C;  3IRB A;  1PYB A;  2PZW A;  4KHP Q;  3TRZ A;  5C44 G;  2UUC L;  4X3S A;  3HOY G;  2P5Z X;  1LTB D;  1STN A;  2RVL A;  3PQI A;  2XIW A;  2C9O A;  1A8V A;  5DM7 3;  4Q5V A;  2RHQ B;  3G7L A;  3J81 j;  1CQV A;  2KEC A;  2RF4 A;  5FJ8 G;  3JAM i;  2BCO A;  3C1E A;  3GTJ H;  2EJM A;  2K5V A;  3BDO A;  1HNZ Q;  1CA6 A;  1SMX A;  4KHV A;  4DAP A;  1J5E Q;  1NBW A;  1H9S A;  2NVQ H;  2DY8 A;  3S1R B;  1KHI A;  3FHW A;  3RUZ A;  1GUG A;  4NXM Q;  3GTK B;  3S2D B;  1B3A A;  1S5D D;  1PLF A;  3Q23 A;  5KNB A;  2UUA L;  3GTO B;  3QWN A;  5IP9 H;  4JVZ A;  1GUS A;  1Q8K A;  4HED A;  4AQY L;  4IJH A;  4DV5 Q;  1QVG A;  3VR3 A;  4GN4 B;  4C56 C;  3SXH A;  1XPU A;  1JJG A;  2LY7 A;  3H15 A;  3HOV G;  4A3G G;  4A93 G;  3OW7 A;  3G4S A;  1AZP A;  4IUT A;  1TWG B;  4C3H G;  2ES2 A;  3PUY A;  3S15 B;  1JE5 A;  1LT5 D;  2H5X A;  4NP5 A;  1ASZ A;  1CHQ D;  3I70 A;  1VQK A;  2JA8 H;  3HOZ H;  3QIA A;  1TVX A;  3W1B A;  1HH2 P;  4LF8 L;  1W2B A;  4XYQ A;  3H91 A;  1SRO A;  2PZT A;  5HY6 A;  3BZC A;  1L2F A;  2RA4 A;  3OW2 A;  4IFD H;  1AZQ A;  4AYB G;  1NSN S;  4FVM A;  2VB3 X;  1STH A;  1TS5 A;  4JW0 A;  4P71 A;  1W3S A;  2ZXO A;  1KLU D;  5IYC H;  1N8R C;  4QY7 A;  1TU2 B;  1PDQ A;  1BNZ A;  1Q90 A;  4RGT A;  3A74 A;  4X65 L;  3G6E A;  4JV5 Q;  4DXF A;  4IQZ A;  3EA6 A;  1E22 A;  1P16 A;  2Q2U A;  2E5L L;  2JJQ A;  4LF9 Q;  4QUF A;  2OF1 A;  2Z4H A;  3K57 A;  1GUN A;  2CQO A;  3I4M B;  1VQ8 A;  2B2Y A;  4BY7 G;  5I9P A;  5IE8 A;  5G3L F;  1PTO C;  1K8M A;  1SR3 A;  4B3T L;  4HAE A;  1T9H A;  2F0I A;  4CJ1 B;  3TN2 A;  2K5Q A;  2DUD A;  4R8I A;  4DN4 M;  1GHJ A;  1EQT A;  1R9T B;  4LF6 L;  1K28 A;  5BR8 L;  2JA5 B;  5FO9 B;  1F77 A;  3S1R H;  3D6W A;  1MJC A;  5CV8 A;  1RTO A;  2SOB A;  1DD2 A;  4JBM A;  5CV6 A;  1EQR A;  3GTK H;  4JI1 L;  5IWA L;  3S2D H;  1PZI D;  4CDE C;  3H0G B;  3UDG A;  2Y0S G;  1BCP D;  3GTO H;  1HCZ A;  2K7V A;  4IAL A;  3AB9 A;  1CUK A;  4RH6 A;  4OO1 I;  4ULL A;  2AWN A;  2E76 C;  1DCZ A;  3PMF A;  1N33 Q;  4DUZ Q;  1QZG A;  1MD2 D;  4LJZ C;  1SNP A;  2XWJ B;  4KJN A;  5JOB A;  1QNK A;  1I4H A;  2WV6 D;  4PZ6 A;  1HA5 A;  4DUZ L;  1TWG H;  3ER0 A;  1I5F A;  1ONL A;  3M4O B;  1JR0 D;  1CT1 D;  1IBM Q;  1XMQ Q;  3S15 H;  1EEF D;  1NJI C;  5C3W A;  2FHT A;  1LT3 D;  2XSC A;  1CA5 A;  3M3Y B;  3CW2 C;  1TY2 A;  2VUM G;  4BY1 H;  3SHL A;  4GN5 A;  3CC2 A;  1FNW A;  1K83 B;  2G9D A;  5IP7 H;  1A0I A;  2KOL A;  1CTM A;  1YNJ C;  2KUM A;  3MA2 B;  2Z0S A;  1PYW D;  1WD0 A;  4C3J G;  5EJW A;  4JI0 Q;  4A3E G;  2ZXR A;  4BXX G;  1X9N A;  1VQP A;  1M4V A;  4QIW E;  4E6I A;  4AIM A;  4G7H C;  4JI0 L;  1IHZ A;  2DJG C;  1XXG A;  2E2J B;  1I4X A;  1JCK B;  4PNY A;  4GKK Q;  3KF6 B;  3SK8 A;  4OON A;  4X3U A;  1YIJ A;  3J7Y W;  1NTG A;  1VQM A;  4KLK A;  4X62 L;  3HS0 C;  1RCV D;  2MO1 A;  4L5S A;  1EY0 A;  1ET9 A;  3CF5 A;  2B2Y C;  1BXT A;  2A6H C;  1C8C A;  2PNH A;  5LMU L;  5ELF A;  1HZB A;  3NWS A;  3S1Q B;  1YHA A;  3I4M H;  4KHZ A;  1Y14 B;  2NVX B;  2NN6 H;  3CRK C;  4YCU A;  4A75 A;  1O80 A;  3LWU A;  1BKB A;  3K0Y A;  5C44 B;  3HOY B;  1QB5 D;  5EAY A;  3GP7 A;  1B8A A;  5I6Y A;  1SNO A;  3X3N A;  3STB C;  1PRT B;  3EQL C;  3RLO A;  4JI6 Q;  1QVF A;  2AHO B;  2AQ1 B;  5M3F H;  3MFG A;  2EJG C;  3KBG A;  3QJY A;  2BH8 A;  2JA5 H;  1M1K C;  3KUP A;  4HJ5 A;  1GXD C;  3UDF A;  1SN8 A;  5GAD C;  2BA1 A;  1O7I A;  2QGQ A;  4DR6 Q;  3H0G H;  2EYO A;  4BBR G;  5C0X I;  4DR7 L;  3VA7 A;  4DXG A;  5CV9 A;  2R92 G;  2A1A A;  2EYP A;  4GOP B;  2A8V A;  1N32 L;  3VDY A;  1Y8N B;  3E0J A;  4DR6 L;  4RAU C;  1XNR Q;  5FKA C;  5I2Y A;  4FF1 A;  4DV1 Q;  5KND A;  1E24 A;  2Z1C A;  3MXN A;  3H3V I;  3HP3 A;  1Q81 C;  3BVM A;  3HOX B;  4LFC L;  5E1F A;  4DV1 L;  1R4P B;  4DR3 Q;  1D1I A;  3T1Y L;  1EZ8 A;  3M4O H;  1C4Q A;  1SNQ A;  2Q2I A;  3EBE A;  1A3V A;  5C4J B;  3PGZ A;  2EDG A;  3H09 A;  3BDL A;  4A3G B;  3HOV B;  1I4R A;  4A93 B;  3M3Y H;  1G2S A;  1I4P A;  1S5C D;  2XWB B;  3E9I A;  4H13 C;  2JA9 A;  4C3H B;  3PF5 A;  4Y52 H;  2R6G A;  4QUC A;  1AE3 A;  1QJO A;  2MFI A;  1K83 H;  5C5L A;  3AMU A;  1A2T A;  2ZM6 L;  3HG9 A;  1IKL A;  4MZ9 A;  1VQG A;  1SDF A;  4RHR A;  5BN5 A;  3PO2 G;  4YHH Q;  2K5N A;  3P7J A;  4OGQ C;  4FF3 A;  2EJF C;  4K0K Q;  3MVV A;  4KD4 A;  2EQS A;  4N9P A;  1Z9F A;  4YWL A;  3CRL C;  4A3K G;  2E2J H;  2JQO A;  1EWC A;  2B2U C;  3D0F A;  1IYV A;  5COR A;  3OHX C;  3J81 L;  5IYD G;  1SE8 A;  4DR1 Q;  3MZ5 A;  3ERS X;  3T51 B;  4B9X A;  3CCU A;  1J8I A;  1GOZ A;  3DXJ C;  4AYB B;  4FXG C;  1JMC A;  4DV3 L;  4Y7N B;  3DEO A;  1VQC A;  2M2L A;  2BOS A;  2MQH A;  2Y0S E;  4FDB A;  3RLF A;  2KCM A;  1Y1V B;  2XRQ D;  2VS1 A;  2QW7 A;  3KF6 A;  1YNN D;  1XTD A;  2JE6 I;  2O2L D;  2NVX H;  1U5K A;  2K14 A;  4A3C H;  2EIF A;  5C44 H;  1VMP A;  3HOY H;  4J8Q A;  2F0N A;  3QG1 A;  2CCZ A;  3J80 i;  2UXC Q;  3MTS A;  4DR5 L;  3R8B A;  3NQT A;  5LL6 S;  4BY7 B;  5IGE A;  1SE4 A;  3RN2 A;  4BWG B;  1F9Q A;  5FJ8 H;  4LUZ A;  4YWM A;  2UXC L;  2XRS D;  4KTA A;  3AU7 A;  4DV7 L;  2EYF A;  3VA5 A;  3H6M A;  2YTY A;  5H1S E;  2C5C A;  1VQJ A;  1YI2 A;  2ICE C;  1I50 B;  3A8J E;  1WI5 A;  4IPC A;  1S72 A;  2WAQ G;  1KD1 C;  3CCM A;  1XNQ Q;  2KHS A;  2M9V A;  4POG A;  2MNA A;  4LF7 Q;  3PIO A;  4RGN A;  4FYD A;  1LTI D;  1G51 A;  1OXT A;  1Z7T A;  1HRJ A;  3ULP A;  2R3Z A;  4KK7 A;  1HUM A;  4GS3 A;  1SYC A;  3FKI G;  4TVA B;  5JEA G;  4I7Z C;  2Q2T A;  1LO5 D;  3BU2 A;  2RDG A;  1QOH A;  1NR2 A;  4DK3 C;  2UUB L;  5C4J H;  2BE5 C;  3IFT A;  4GOP A;  2BH2 A;  1GUW A;  4A3G H;  4R4T A;  3HOV H;  2H4O A;  2QA4 A;  5E7N A;  4HIK A;  4A93 H;  4JYA Q;  3SDZ A;  3A55 A;  4RG1 A;  4C3H H;  1KC8 C;  4JYA L;  5EKI A;  3A0J A;  3FDT A;  4ODG A;  1FGB D;  2AQ2 B;  2R7Z G;  1SYD A;  3W5O A;  1PFN A;  4YCV A;  4X3K A;  4YWK A;  2VUM B;  4OIK A;  5EGT A;  3L7Z C;  2C35 B;  3TS2 A;  4DA2 A;  2O4X A;  3QOJ A;  1BQQ T;  3HOU G;  4CHT B;  4JI7 L;  5IT9 L;  5C0X J;  4HJ8 A;  3I2Z A;  2J4X A;  3U58 A;  1YJ9 A;  1HZ9 A;  4C3J B;  4XTC S;  5ELN A;  3GTL B;  3MXP A;  2RDH A;  4K2K A;  2JXM B;  4DNI A;  3K5N A;  4WRD A;  3K58 A;  1PTO B;  4K14 A;  3GTG B;  1RJT A;  1Q86 C;  1H9S B;  2D5D A;  4FXK C;  4Y7N H;  1IXR A;  3T1H Q;  2N3S A;  4P74 A;  3UDX A;  1GHK A;  1N34 Q;  4A3D G;  4GZY C;  4YY3 Q;  1DYQ A;  2ZT9 C;  3UE1 A;  2K75 A;  1RTN A;  4I7A A;  3BZD B;  1N9W A;  4BY7 H;  1STY A;  4XQN A;  1ZEQ X;  1WJJ A;  2D9U A;  1HR0 Q;  3BYY B;  1PRT F;  1SE3 A;  1PRT C;  2BDN A;  1PXU A;  4MTK A;  1OTC A;  3IAY A;  1I50 H;  2PI2 A;  4BS9 A;  1ET6 A;  4A3M H;  1RL2 A;  1Q12 A;  5FO8 B;  4EQP A;  3HOW G;  1BDO A;  4JI8 L;  3CPF A;  1IBK Q;  2UXD Q;  5LL6 X;  2LFN A;  3E9H A;  1W6K A;  1QWY A;  2ATW A;  4DV4 Q;  4LF5 Q;  3LGJ A;  3VR2 A;  1LTS D;  1II3 A;  4P75 A;  3RLN A;  1WD1 A;  4BBR B;  2R92 B;  4TSS A;  4GOP C;  1STA A;  4IFD I;  5E4X A;  2WFW A;  1QNU A;  2G9H D;  2J0T D;  5D3D A;  1WVL A;  1PH8 A;  1D1K A;  1UAP A;  1IW7 C;  4IUR A;  5C3E G;  1PH9 A;  1T5E A;  1KLG D;  4ZAI A;  4DPG A;  1VQD A;  1X3Q A;  3D8G A;  3F2U A;  2NVY B;  1SRU A;  3VYS A;  1TXY A;  4KV6 A;  5KNC A;  1TII D;  2ZJR A;  1I94 L;  4G4K A;  1ZYR D;  1GVP A;  1JJ2 A;  4BBS G;  3SEB A;  2VUM H;  2X69 A;  1SMY D;  1UE7 A;  3NPP A;  1HR0 W;  3J7A 5;  1UWV A;  4ZQ3 A;  2AWO A;  3Q6S A;  2MO0 A;  5FLM G;  1LTR D;  4O2D A;  1LLR D;  3I4O A;  4IN3 A;  4LWC A;  3PO2 B;  3RZO B;  4C3J H;  3S2H B;  4ALP A;  4A3E H;  3GTL H;  4BXX H;  2UUC Q;  1VQE A;  3NTI A;  5IGD A;  3SVM A;  4OL7 A;  5AJ3 L;  2QDL A;  5HGQ A;  1K3R A;  1H9K A;  2OQ0 A;  1PTO H;  4A3K B;  1AE2 A;  3NK9 A;  3TP6 A;  4HJ7 A;  3OWE B;  4C3I G;  1JOR A;  3OOC A;  1H95 A;  4IUN A;  4C1N I;  1DOL A;  1HZA A;  1FYC A;  3U9S A;  3S1N B;  3QO2 A;  4DR4 L;  1EY5 A;  4NPS A;  2O5J C;  2XNA C;  2N49 A;  2OQK A;  2CWP A;  1NR4 A;  2Z8L A;  1VQA A;  4DFA A;  4X64 L;  1UE1 A;  1DOK A;  2KJX A;  3KLS A;  1KNA A;  2UUA Q;  4LAA A;  1ML0 D;  1SJH D;  3TS0 A;  2K5D A;  1XWE A;  2K6A A;  2PCF B;  3ITP A;  3TZU A;  3EIV A;  3HOX G;  1FR3 A;  3KJO A;  5TSS A;  4EQ5 A;  3F2C A;  4AQY Q;  4F87 A;  1VQO A;  2KCT A;  2VL6 A;  3ND9 A;  4KKT A;  1IKM A;  4U67 3;  3I73 A;  4PG3 A;  3DWA A;  4KN4 C;  3QB3 A;  2PMZ B;  4V19 0;  3KBX A;  2WAQ B;  4CDC C;  2B2T A;  4BBR H;  1I6V C;  4R4I A;  4UP9 A;  4A3J B;  2R92 H;  1EIF A;  1SSO A;  4IPD A;  3I3C A;  3CCJ A;  5IIF A;  5DNF A;  2L5T A;  2JP1 A;  2CW0 D;  2MUY A;  2D0P A;  5CMD A;  3FKI B;  1RHP A;  2NVY H;  5LMN L;  1CSQ A;  5C4H A;  4LF8 Q;  3W3A A;  2R7F A;  4JI2 L;  2RHS B;  1JWS D;  1JOK A;  1EQQ A;  4X6A H;  1EFI D;  3KLR A;  1Q7Y C;  3TDQ A;  3HFZ B;  4LUO A;  3RMH A;  2VY3 A;  3DLL A;  1X65 A;  1VQ9 A;  3GTM B;  2NN6 I;  4HJA A;  2JSO A;  4DAY A;  1PFB A;  3DUZ A;  1BBU A;  4R4C A;  3WWV A;  5COY A;  3QR8 A;  3VYT A;  3EVQ A;  2QEX A;  2I5H A;  3PV0 A;  2R7Z B;  2NZ1 D;  3T16 A;  4X65 Q;  3PO2 H;  3RZO H;  2M00 A;  3S2H H;  5C3X A;  3N52 A;  3A5U A;  2HQE A;  1Y1V G;  1FGU A;  3G71 A;  3F2D A;  4S3S A;  1YJN A;  2E5L Q;  3HOU B;  1FVI A;  1EU4 A;  4ZUJ A;  4A3K H;  1YHB A;  3MEH A;  4PV1 C;  4DAV A;  4IFD J;  5JJI A;  4FP5 D;  4B08 A;  4TKO B;  2ALY B;  4J15 A;  3S1N H;  3N6R A;  4XXE A;  4B3T Q;  5IYD H;  5IOC A;  2LXK A;  4J6H A;  2OEO A;  1PH1 A;  3CMA A;  1PTO F;  3E3X A;  2ICI A;  3C1F A;  5K5P A;  4HMI A;  2HDL A;  1PH4 A;  3DM1 A;  2PW5 A;  1U4P A;  1DOM A;  4LF6 Q;  5BR8 Q;  4B3M L;  4DV0 L;  1C9O A;  4A3D B;  3LX0 A;  4JBW A;  1RIP A;  4MTN A;  1EWH A;  3S16 B;  3J7A F;  4JI1 Q;  5IWA Q;  2F3V A;  4X66 L;  1E7Z A;  5EKK A;  3MXN B;  4KY6 A;  1CM9 A;  2GVA A;  2F1M A;  1WTW A;  1ROD A;  1F2Y A;  1VQN A;  1MSG A;  1L0Y B;  1HZC A;  1RDP D;  2IJ0 A;  2XGT A;  2K4K A;  5CBE E;  4NXN L;  2VB2 X;  5C4X G;  3ERO A;  2WB1 G;  5KGU A;  1F9S A;  2D62 A;  2B2T C;  3K7A B;  3D31 A;  4G57 A;  4IO9 A;  4F88 A;  2R93 G;  1D5M C;  1OXS C;  3HOW B;  2IHE A;  1VQI A;  5CV7 A;  5A2Q E;  3PO3 G;  3S14 B;  4JCV E;  3SK5 A;  1EYD A;  2MJ8 A;  1EIH A;  4R1J A;  5CV5 A;  2XVS A;  4JBJ A;  5ISR A;  3PUX A;  1L1O A;  4K6D A;  3FKI H;  3FP9 A;  4UPA A;  5JEA H;  1KIX A;  3ZJY C;  4YCW A;  1CKN B;  4HCS A;  3TME A;  1VQ6 A;  2NVT B;  2GN5 A;  1S5F D;  2A69 C;  3D6C A;  3GV3 A;  5EBC A;  1ENF A;  1K0S A;  5C3E B;  2NYZ D;  2QIL A;  4HR7 B;  1GM5 A;  3BS1 A;  3E6Z X;  4LF4 Q;  1YHQ A;  2JA6 B;  4CKC A;  1F2Z A;  4DNR B;  5GQO A;  3JAM E;  2K5H A;  5CV4 A;  5EPK A;  3GTM H;  4LF4 L;  2CWA A;  5FO7 B;  5JEA J;  1FNV A;  2G5D A;  4KY5 A;  2DJF C;  4X62 Q;  5EKL A;  4EQN A;  4BBS B;  2UXB L;  5CYU A;  3PIP A;  1S40 A;  1YJW A;  1D5X C;  3I7F A;  1KDC A;  2B2U A;  4NDX A;  1TR5 A;  3EN2 A;  1VQL A;  3HOU H;  5LMU Q;  2HHH L;  3PF4 A;  3M4Q A;  5A2Q L;  3P75 A;  1KTK A;  2A6E C;  1MKH A;  2GA4 B;  4JI4 Q;  1EOV A;  3UE0 A;  2NZO A;  5M5Y B;  1E1T A;  4JI4 L;  4L5Q A;  3CQZ B;  1U0L A;  4UP8 A;  1PFS A;  3X3M A;  2B2W A;  2K01 A;  5GAG C;  2BDO A;  1KAW A;  3I4N G;  4C3I B;  1DGS A;  2FXQ A;  3VR5 A;  3MXG A;  4HIM A;  3ND8 A;  1BVS A;  4A3D H;  5K36 G;  2I5M X;  3JAM L;  4GKJ L;  1R9T H;  3S16 H;  4IUV A;  2A68 C;  4DR7 Q;  2UU9 Q;  3I90 A;  1N32 Q;  1LAC A;  4Z9C B;  1JOQ A;  4B3R L;  3MHB A;  3U4V A;  2UU9 L;  2EE1 A;  4RHS A;  5IGC A;  1N36 Q;  2ZJQ A;  1EYG A;  2I0Q A;  4LFC Q;  1XMO Q;  2PW7 A;  3K7A H;  1TWA B;  5FK9 C;  3Q22 A;  3T1Y Q;  1N36 L;  1FJG L;  2F0Q A;  2ZJP A;  1XMO L;  3HOW H;  2WII B;  4AYB E;  5IY0 A;  2EVB A;  3S14 H;  1SAP A;  3IKJ A;  1CQF A;  1L1O C;  4UP7 A;  1PH7 A;  2ENB A;  1EIG A;  4XYO A;  4CKE A;  4CDD C;  4PMB A;  1QCB D;  1E2Z A;  3P1H A;  2IHF A;  4JI3 Q;  4DV6 L;  2JA7 G;  3ERQ A;  4N8X 1;  3CAM A;  3CME A;  4DAM A;  2QDB A;  2VW9 A;  1K8A C;  2ZM6 Q;  1QE6 A;  4JI3 L;  3TEH B;  1ZXT A;  4JC0 A;  2PI2 E;  4K8I A;  5NUC A;  5ELD A;  5C3E H;  1X56 A;  2ZXP A;  3M4P A;  1IBL L;  3A5Z B;  3NP8 A;  5J3B A;  2VQE L;  2JYO A;  3NEL A;  4ABN A;  2AKW B;  1DXM A;  4J1M A;  3OIP A;  2QCP X;  1H9J A;  3OYY A;  4RGO S;  4UHV A;  2D0O A;  4LFB L;  3MAQ A;  2EY2 A;  2PNR C;  1CKN A;  3MFY A;  4HID A;  1E2W A;  1X54 A;  4IUP A;  2EPB A;  1WTH A;  4OIJ A;  3CCE A;  2KQ3 A;  1STB A;  3JAM c;  3AEV A;  1UEA B;  4BBS H;  3NBH B;  1NAP A;  1PZJ D;  3S1M B;  1LTL A;  1BBX C;  2Q8T A;  3RZD B;  3HKZ G;  3ULJ A;  4G7O C;  1VQB A;  4DV3 Q;  5BN3 A;  3I72 A;  5FLM H;  3HEJ A;  4MN3 A;  5IOD A;  2FMC A;  3LWE A;  1VMC A;  3E0E A;  3NSW A;  2B2W C;  3S1Q H;  4OEM B;  4CJ2 C;  1EZ6 A;  5M5Y H;  4YIJ A;  3CQZ H;  2A5H A;  4DR5 Q;  2LMC B;  1B7Y B;  1HXY D;  4C3I H;  1PH2 A;  2QF7 A;  4APV A;  5BN4 A;  1EOT A;  1SNC A;  1D7Q A;  4DV7 Q;  2SEB D;  3K5M A;  5E3F A;  1E2V A;  5KEE A;  2WP8 J;  4R4Q A;  2VNU D;  3R3O A;  2ID0 A;  1FL0 A;  1WOC A;  5KRU A;  3I55 A;  5D65 A;  1WTP A;  2AUK A;  4LMQ D;  4OX9 L;  2O5I C;  4A3J G;  1PFM A;  5C4Z A;  1F2L A;  2F0F A;  1EU3 A;  5JJZ A;  1OXU A;  1QIL A;  2IWH A;  1TWA H;  2PPB C;  3FEW X;  1S3O A;  1DJR D;  1TWH B;  2EXD A;  3FMC A;  1TS3 A;  1LV9 A;  3HOX H;  3NHH A;  1V9P A;  2UUB Q;  3ZYY X;  4KKU A;  1ASY A;  2IPK D;  5C4X B;  2WB1 B;  2B29 A;  2K50 A;  1SYF A;  3AFQ A;  1I6H B;  1G6Z A;  1K3B C;  2F52 A;  3I91 A;  4BA1 I;  2CH4 W;  3U9O A;  2R93 B;  4K5W A;  1JOO A;  3PO3 B;  4HSP A;  3G48 A;  1PH6 A;  4IJL A;  3KK7 A;  1PTO D;  5GAE C;  5G3L D;  4H0L C;  2F4V L;  4HN7 A;  3WOE A;  3BZK A;  2Q8R E;  1LT4 D;  2JK8 A;  4JI7 Q;  2Z6K A;  1O78 A;  2ZTE A;  3SGI A;  4ZYS A;  2PQA B;  2EXZ A;  2SDF A;  4WJ3 M;  3KDF B;  4IOA A;  1WTR A;  4JI5 L;  3GQB A;  2FFK B;  1TS2 A;  2MPM A;  3RZD H;  2YYZ A;  3ULL A;  4L8J A;  1NCV A;  2VZA A;  3HZX A;  2QKI C;  3L3O C;  1V1O A;  2L4N A;  4MNO A;  1BCP C;  2B8F A;  3BVZ A;  1JB7 A;  5I6W A;  4DK6 C;  1D2B A;  3B6Y A;  3VYU A;  1X32 A;  2H1E A;  5J39 A;  4L5R C;  1Y1V H;  1EFW A;  4RCO A;  1DM0 B;  3NBH A;  1PHJ A;  1X6O A;  1YEZ A;  1C48 A;  3SK6 A;  4C2M B;  3CC7 A;  2K32 A;  4HIO A;  2RKS A;  1HNW L;  3CCS A;  1K8G A;  5AFW A;  4A4I A;  5ELO A;  2JN4 A;  2HD3 A;  2KCC A;  4PZ8 A;  1HFG A;  3PUV A;  2K5W A;  1PV4 A;  2E2I B;  1V43 A;  1S4Z A;  1GKH A;  1ZKO A;  2B2V A;  4GN3 B;  2OT2 A;  3I4N B;  4ZKC B;  5M3F G;  2GVB A;  4P73 A;  4GNX B;  1I4Q A;  2YTV A;  1YNJ D;  4JI8 Q;  2YTX A;  3E5S A;  3C3L A;  3R2I A;  5M5X B;  1EIY B;  4LUV A;  1A3U A;  4LFA L;  5A35 A;  3OIQ A;  5F2D A;  1HTP A;  2ASB A;  2N55 A;  2VQF L;  4RA8 A;  2YU9 B;  4XIG S;  4FXD A;  1SXT A;  4ZCK A;  3CD6 A;  1MSH A;  3G6J B;  3CHB D;  1MGS A;  3F1Z A;  1TWH H;  5D3I B;  1B2T A;  2F4I A;  4C1N K;  3NUC A;  5C4X H;  2IT1 A;  5DM6 3;  1AP0 A;  4K8J A;  2B8G A;  4A76 A;  3OTO L;  4A3B G;  4O1N A;  1I6H H;  2A6H D;  4WOR A;  4ME5 A;  5T1I A;  5IGF A;  5EBD A;  4DAY B;  2R93 H;  2JA6 G;  1SBB B;  4NKL A;  1I94 Q;  5EPL A;  3PO3 H;  4DKA C;  4V0B A;  3D4D A;  2DNC A;  1KAB A;  2OCE A;  2IX1 A;  1SFO B;  2FIN B;  2Z6K C;  4ID6 A;  2L9H A;  4TRD A;  5DAU A;  1I4G A;  4XQQ A;  2JA7 B;  3P20 A;  3STB D;  4F7X A;  5T1G A;  1MJE A;  1UE6 A;  4HJ9 A;  4OO1 G;  1Q46 A;  1YBY A;  2F0L A;  3OMG A;  1V1P A;  3NWT A;  4DUY L;  3M9B A;  2RSO A;  3QOL A;  3J80 E;  2HCC A;  3A7A B;  1WCM G;  5AJ3 Q;  3MWY W;  1STE A;  1GUT A;  3K7U C;  5JPN C;  1CHP D;  2L55 A;  4FO2 A;  2CHB D;  2N78 A;  2PYK A;  4A3I G;  3GTG H;  1A63 A;  2PQA A;  1D6E C;  2PMZ E;  4DR2 Q;  4DR4 Q;  1QG7 A;  2F0J A;  2WAQ E;  3KDF A;  1QZH A;  1T5X D;  1LTT D;  3HKZ B;  4DR2 L;  4HTH A;  3H3V C;  3M7N A;  4N9T A;  5D14 A;  2F0S A;  3CCQ A;  1XPR A;  4C2M H;  4CDF C;  4OXP A;  1UUP A;  4L5T A;  4JG2 A;  4X64 Q;  1KL9 A;  2EYL A;  5I9O A;  4FF2 A;  2LXJ A;  4A3C G;  2B2V C;  1EY8 A;  1TWC B;  2RCF A;  1CKO A;  1TKW B;  2E2I H;  4KHP L;  3K6O A;  3FRP B;  4QJF A;  3I4N H;  4RKL A;  1QUQ B;  1HNX Q;  3NQI A;  3L0O A;  3M7G A;  4ZK9 B;  3GDE A;  1SND A;  1NMF A;  3TP7 A;  1U4M A;  3J80 L;  1Q1E A;  1FNU A;  5M5X H;  1B44 D;  1B53 A;  1X3E A;  1HNX L;  3KF8 B;  5K36 H;  2NBF A;  4GLA C;  2EYH A;  2F3W A;  2K52 A;  1HNZ L;  1RKN A;  1AW7 A;  1Q1B A;  1EEI D;  2YU9 H;  2B63 G;  2IX3 A;  1J5E L;  1L1O B;  2V1C C;  4CJ0 B;  4GNX A;  1SNM A;  2VXW A;  4PQX A;  3I4L A;  1STG A;  2CKZ B;  3L9A X;  3SR1 A;  3KOJ A;  2J7Z A;  4MIU A;  2K05 A;  4NXM L;  3T13 A;  2DN8 A;  5LMN Q;  1HQR D;  3C2P A;  3NE5 B;  2Q8I B;  4JI2 Q;  3DWQ A;  5M9O A;  1KRT A;  1YNN C;  3OWF A;  1SYB A;  3IFD A;  1NMG A;  2RQX A;  1J6Q A;  4DV5 L;  4K5V A;  1SFO H;  4NB3 A;  1Y1W G;  2F0T A;  5C0X G;  4XT1 B;  1BF4 A;  3CKI B;  3PIP 3;  2DGY A;  2JA7 H;  2D2C C;  2WIN B;  3FPU B;  2F0W A;  5L37 A;  5ELB A;  3U50 C;  3CCL A;  2WAC A;  4KJO A;  2YV5 A;  1GUO A;  3T53 B;  2F0G A;  4KD3 A;  3DMU A;  4IOC A;  1R4Q B;  4BY1 B;  3TP5 A;  2N8N A;  3S9W A;  2IW3 A;  1B50 A;  4RMF A;  1CZG A;  1LTA D;  1D5Z C;  3V96 A;  2HT1 A;  1BR9 A;  2WKD A;  1HHV A;  5FLX E;  1A62 A;  1TY0 A;  1KDB A;  2SNS A;  3J80 c;  3LNN A;  3J81 i;  1QVC A;  4U68 A;  4NMZ A;  4DNT B;  2HCI A;  4RKB A;  4DV2 Q;  2X6G A;  4QB4 A;  4WJ4 A;  2NZH A;  1K9M C;  3PCO B;  1VS0 A;  4DV2 L;  3Q8D A;  1B9N A;  1KAA A;  1TS4 A;  2L1B A;  4B3M Q;  5LMN W;  4DV0 Q;  1LUZ A;  1PH3 A;  2R61 A;  1Q8I A;  2NB0 A;  2BE5 D;  3TSS A;  1TWC H;  1BUV T;  1VQ5 A;  4X66 Q;  4JV5 L;  1E3P A;  3A56 A;  4OWX B;  2FJ2 A;  3BDC A;  2OWO A;  4LF9 L;  5C5M A;  1X3G A;  1KNE A;  1LYL A;  1V8Q A;  4NXN Q;  2BA0 A;  4H7B A;  3FVQ A;  1Q3L A;  4CKB A;  1S5B D;  5E4W C;  1TWF B;  3EFX D;  1B1Z A;  1U4R A;  4N8F A;  5FLX L;  5M3F B;  4GNX C;  2K28 A;  3T4A C;  5J1Z A;  4A3M G;  1IYU A;  4IPG A;  2HIX A;  4TQU S;  3WOF A;  5LHY 1;  1Z6H A;  1QUQ A;  1CKM A;  3BJU A;  4A3J H;  3KF8 A;  3CCR A;  4A3F G;  1IYJ B;  2B3G A;  5DLQ E;  3EJI A;  2RCN A;  5EPJ A;  2LKV A;  3TRE A;  5M3M G;  1WTX A;  1FD7 D;  5M5W B;  3O13 A;  2K03 A;  1ICW A;  1SEB D;  1HA6 A;  4A3B B;  4O42 A;  5JPM C;  1N33 L;  4XQJ A;  2F3I A;  4JOI A;  4KKS A;  1DON A;  4OHJ A;  2Q2H A;  4A3L G;  1JWM D;  3RD4 A;  2PQE A;  3M4Y A;  2KVM A;  2RSN A;  1IBM L;  2L12 A;  4KI0 A;  2EZV A;  3DHQ A;  1XMQ L;  3ICE A;  2UXB Q;  3L2P A;  1A2U A;  4DU9 A;  4R9W A;  1BCP B;  1O7L A;  5IYB G;  4ZKB B;  2R7Z H;  1PRT D;  1P8L A;  5JVG 3;  5J22 A;  1PA6 A;  1LT6 D;  2CQA A;  3KJP A;  2HHH Q;  1U4L A;  2NWG A;  3CPW A;  2OXP A;  1F9R A;  2A19 A;  2A74 C;  1BO0 A;  1LM0 A;  2JEB I;  4QGU A;  4IUQ A;  4QQB X;  4KN7 C;  1WCM B;  3KLW A;  5ELC A;  5FLX c;  1EL0 A;  2KHJ A;  3BYT B;  2ZTD A;  1F2M A;  4ZRZ A;  3AFP A;  1SLJ A;  2KEN A;  2OTL A;  4A3I B;  3K5O A;  1E0B A;  3RN5 A;  2F0O A;  4GKK L;  4QF4 A;  2NTT A;  3DWP A;  3K0X A;  4ZLT F;  2AUJ D;  4PMC A;  1IW7 D;  4GKJ Q;  4RFB A;  2EY5 A;  3PUZ A;  1V1Q A;  2KCN A;  3CXC A;  1K0R A;  4WFN 3;  5IGG A;  2E74 C;  4QCL A;  3M85 A;  2DNE A;  3PIO 3;  2HIV A;  3GD7 A;  1RD9 D;  5GAH C;  4B3R Q;  1ZYR C;  3J7A V;  1TWF H;  1JIC A;  2L15 A;  1B4O A;  4KMU C;  4EX5 A;  1C0A A;  1U9R A;  2K33 A;  1SMY C;  5JVH 3;  4IUU A;  4UY8 C;  1PMR A;  1FJG Q;  3ONA B;  1X3F A;  3A8I E;  3CCV A;  1GD7 A;  4JI6 L;  3WDN A;  4DGZ A;  4FNF A;  5IP9 G;  4QIW B;  1XYI A;  2CVR A;  3R93 A;  1UNS A;  3OMC A;  1VF5 C;  2X6L A;  1ENA A;  2Z4I A;  1M8A A;  4DV6 Q;  2B63 B;  1SYG A;  1CK1 A;  1YIT A;  3GV6 A;  1W6J A;  4I65 A;  2IL8 A;  3H94 A;  1UE5 A;  2JEA I;  2NVT H;  1L0W A;  5M5W H;  1IBL Q;  3J81 E;  3NXW A;  2V4D A;  2VQE Q;  1HTL D;  4JOI C;  1ICF B;  2L11 A;  1XNR L;  2A73 B;  3I56 A;  4A3B H;  2E2H B;  4ILW A;  2KBN A;  4IPH A;  3V2T A;  1SE2 A;  4XDX A;  4PMW A;  5HGT A;  4LFB Q;  2JA8 G;  3HOZ G;  1NY4 A;  5IGB A;  2B39 A;  2DY7 A;  3PUW A;  3S17 B;  1J9O A;  2JA6 H;  4P2C B;  4DR3 L;  1K73 C;  4QL5 A;  1Y8O B;  2QEJ C;  2FMM A;  1EY6 A;  4M1U B;  3R2T A;  2I5L X;  1Y1W B;  1VCI A;  1Q82 C;  3NTK A;  3UDI A;  4IFD G;  2I07 B;  4L63 B;  2KED A;  3SE0 A;  4OO1 H;  3URY A;  3FPP A;  3K81 C;  1CZW A;  5IYC G;  1AH9 A;  1O7Y A;  2F0D A;  1OO9 B;  2MGS A;  3CU7 A;  1WCM H;  4YHH L;  2KA7 A;  3MXU A;  4DF7 A;  3PSI A;  3K80 C;  4K0K L;  2F0V A;  2WB1 E;  1YVC A;  4Q0F A;  1KRS A;  1XX8 A;  1SJE D;  3GO5 A;  4GLV B;  4POF A;  4R4O A;  4A3I H;  4K2L A;  1JJC B;  1ILP A;  3I8Z A;  4OWT B;  1G29 1;  1L0X B;  2KEE A;  1ESR A;  1CSP A;  2EYM A;  4HSV A;  1PVO A;  2CW0 C;  4DR1 L;  4H02 A;  1TQO A;  4WJW A;  2F0P A;  1B3Q A;  4QMG A;  3JC6 6;  3Q24 A;  4OX9 Q;  1HJP A;  3SK4 A;  3V05 A;  1DZ1 A;  5EQ0 A;  2HQL A;  3A7L A;  1NE3 A;  4EQO A;  3NTH A;  1XTC D;  1UEB A;  1EYA A;  3F8T A;  1MIU A;  2XN9 C;  4B3S Q;  4LNQ A;  3HRZ C;  1HFN A;  4O0A A;  1M90 C;  1IL2 A;  5DEH A;  1KQS A;  1VQH A;  2OTJ A;  2E75 C;  4B3S L;  2NUC A;  2CFM A;  2AMC B;  4DK1 A;  5KYL A;  1RF2 D;  4A3M B;  2B63 H;  1S5E D;  2LSS A;  5JJK A;  1VDZ A;  2R7D A;  5IT9 E;  1JWU D;  1D8L A;  1VQF A;  4RGM A;  1V1P B;  3K59 A;  1XNQ L;  2F4V Q;  3KYH C;  2F0U A;  4BA2 I;  1X3P A;  1LAB A;  1F9P A;  4H44 C;  4GLX A;  4LF7 L;  1JQY D;  4A3F B;  2KHI A;  1I3Q B;  3GTQ B;  2IX0 A;  2Y0S B;  2N88 A;  2F0H A;  1JE4 A;  2E2H H;  5KYI A;  1GO3 E;  3IL8 A;  1AFP A;  1EQV A;  3BVG A;  3AQQ A;  4BY1 G;  4EGV A;  1ESF A;  2F0E A;  2F0K A;  5CC4 A;  4P72 A;  3S17 H;  1AEX A;  1G8Z D;  4L6T B;  3J81 c;  3GTP B;  1ILQ A;  1BOS A;  5M3M B;  5IP7 G;  1HQM C;  1EY7 A;  1TT2 A;  1XPO A;  1K8O A;  4JI5 Q;  1WTV A;  2K04 A;  3RR5 A;  5C0X H;  1Y1W H;  3RNU A;  5CGK A;  1O7Z A;  3U4Z A;  2E2D C;  3K5L A;  3S1M H;  2EY6 A;  4OWW B;  3TBI B;  1B9M A;  1EYC A;  3A54 A;  1GJX A;  3J7Z C;  1MI2 A;  4B9W A;  3H3V H;  1AN8 A;  2WKC A;  3MC0 B;  4ZUI A;  1BCP F;  5GRO A;  4EVO A;  4NW2 A;  2Z6B A;  3NEN A;  1C7Y A;  2I46 A;  4MHE A;  1A3T A;  3VR4 A;  1HNW Q;  2E8G A;  3T56 B;  4A3E B;  3NEM A;  3I4M G;  1JB3 A;  3AYH B;  2TSS A;  3DEP A;  2PZU A;  1YZ6 A;  2NN6 G;  2XTI A;  1CI3 M;  1HUN A;  3TP8 A;  1OXX K;  1H9M A;  1BBW A;  1HPC A;  1EWI A;  1SYE A;  3C46 A;  1G91 A;  1H9R A;  3A8K E;  5KIX A;  4UAI A;  1B70 B;  1E1O A;  2A69 D;  1CFM A;  1VQ7 A;  4FF4 A;  4LFA Q;  3T1H L;  3GTJ B;  2JA5 G;  3TZD A;  3OPO A;  1OXV A;  1MBY A;  4JK1 C;  2VQF Q;  1N34 L;  4K6L A;  3D4R A;  4YY3 L;  3DM3 A;  3VR6 A;  1IL8 A;  1LTG D;  3CP0 A;  2HDM A;  2TMP A;  4CGY B;  3KFU A;  5ELE A;  1X55 A;  1Y8P B;  3BG3 A;  2NVQ B;  3H0G G;  2SNM A;  1XJV A;  1JC7 A;  3HGB A;  2MP1 A;  4K5X A;  2Z9H A;  5JJL A;  2LS0 1;  1PYS B;  5C6A A;  2RBM A;  3TQY A;  3VYR A;  3OTO Q;  2ZTC A;  4RWS C;  5I4D A;  1PZK D;  1HR0 L;  2IY5 B;  2EOT A;  2AQ3 B;  2CH4 A;  1EUJ A;  2L0C A;  1NNX A;  1WTO A;  1G2T A;  4JPB W;  1WFQ A;  2A6E D;  3F2B A;  3HKZ E;  5I2X A;  1WTQ A;  2UXD L;  1IBK L;  1KDA A;  3OSO A;  5CR3 A;  4A3F H;  5IT9 c;  3S24 A;  1I3Q H;  3GTQ H;  2PO4 A;  4LW1 A;  4DV4 L;  4CBV A;  4LF5 L;  4OEL B;  2HUG A;  1Z47 A;  4DUY Q;  3NBI A;  2NTS A;  1EY4 A;  2K1B A;  1A6X A;  3GTP H;  5M3M H;  4G7Z C;  1JT8 A;  4RCN A;  4KY7 A;  1WYD A;  4IZ8 A;  3D3R A;  2EYJ A;  1MHW C;  3KLS X;  3CC4 A;  3MEF A;  2MHV A;  1IZ6 A; 
#chains in the Genus database with same CATH homology
 4DK0 A;  5CBA E;  4M8A A;  1VF7 A;  2JA8 B;  3HOZ B;  1EY9 A;  1ENC A;  5FOB B;  2A68 D;  4XT3 B;  4HMJ A;  4F8M A;  5HUR A;  4HCE A;  3UI2 A;  3W2D A;  3D4W A;  3Q0A A;  4LK1 C;  2F03 A;  4X3T A;  1Y69 U;  2EY1 A;  1A15 A;  1NUC A;  2F0M A;  4R8N A;  5JAV A;  2RDF A;  4UDU C;  2PZW A;  4X3S A;  1LTB D;  1STN A;  2RVL A;  2XIW A;  2C9O A;  4Q5V A;  5DM7 3;  3G7L A;  1CQV A;  2KEC A;  2BCO A;  3C1E A;  2EJM A;  3BDO A;  1CA6 A;  4KHV A;  4DAP A;  1H9S A;  2DY8 A;  3S1R B;  3RUZ A;  1GUG A;  3GTK B;  3S2D B;  1B3A A;  1S5D D;  1PLF A;  3Q23 A;  5KNB A;  3GTO B;  3QWN A;  1GUS A;  4HED A;  3VR3 A;  4C56 C;  3SXH A;  2LY7 A;  3OW7 A;  1AZP A;  4IUT A;  1TWG B;  4C3H G;  3PUY A;  3S15 B;  1LT5 D;  4NP5 A;  1CHQ D;  3I70 A;  3QIA A;  1TVX A;  4XYQ A;  3H91 A;  2PZT A;  2RA4 A;  4IFD H;  1AZQ A;  1NSN S;  4FVM A;  2VB3 X;  1STH A;  1TS5 A;  2ZXO A;  1KLU D;  1TU2 B;  1PDQ A;  1BNZ A;  1Q90 A;  4RGT A;  4DXF A;  4IQZ A;  3EA6 A;  4QUF A;  2OF1 A;  2Z4H A;  3K57 A;  1GUN A;  3I4M B;  2B2Y A;  5I9P A;  5G3L F;  1PTO C;  1K8M A;  4HAE A;  2F0I A;  4CJ1 B;  3TN2 A;  2K5Q A;  4R8I A;  4DN4 M;  1GHJ A;  1EQT A;  1R9T B;  2JA5 B;  5FO9 B;  1F77 A;  3D6W A;  5CV8 A;  1RTO A;  2SOB A;  1DD2 A;  5CV6 A;  1PZI D;  3H0G B;  1BCP D;  1HCZ A;  2K7V A;  4IAL A;  3AB9 A;  4RH6 A;  4OO1 I;  4ULL A;  2AWN A;  2E76 C;  1DCZ A;  3PMF A;  1MD2 D;  4LJZ C;  1SNP A;  2XWJ B;  4KJN A;  5JOB A;  1QNK A;  1I4H A;  2WV6 D;  1HA5 A;  1ONL A;  3M4O B;  1JR0 D;  1CT1 D;  1EEF D;  5C3W A;  2FHT A;  1LT3 D;  2XSC A;  1CA5 A;  3M3Y B;  1TY2 A;  3SHL A;  1FNW A;  1K83 B;  2G9D A;  2KOL A;  1CTM A;  1YNJ C;  2KUM A;  3MA2 B;  1PYW D;  1WD0 A;  4C3J G;  5EJW A;  2ZXR A;  1M4V A;  4E6I A;  4G7H C;  1IHZ A;  1XXG A;  2E2J B;  1I4X A;  1JCK B;  4PNY A;  3SK8 A;  4X3U A;  3J7Y W;  3HS0 C;  1RCV D;  1EY0 A;  1ET9 A;  2B2Y C;  1BXT A;  2A6H C;  1C8C A;  5ELF A;  3NWS A;  3S1Q B;  4KHZ A;  2NVX B;  2NN6 H;  3CRK C;  1O80 A;  3LWU A;  5C44 B;  3K0Y A;  3HOY B;  1QB5 D;  3GP7 A;  5I6Y A;  1SNO A;  3X3N A;  1PRT B;  3EQL C;  2AQ1 B;  3MFG A;  2EJG C;  3KBG A;  3QJY A;  3KUP A;  1GXD C;  2BA1 A;  2EYO A;  5C0X I;  3VA7 A;  4DXG A;  5CV9 A;  2EYP A;  1Y8N B;  3E0J A;  4RAU C;  5FKA C;  5I2Y A;  4FF1 A;  5KND A;  2Z1C A;  3MXN A;  3HP3 A;  3BVM A;  3HOX B;  5E1F A;  1R4P B;  1D1I A;  1EZ8 A;  1C4Q A;  1SNQ A;  1A3V A;  5C4J B;  2EDG A;  3H09 A;  3BDL A;  4A3G B;  3HOV B;  1I4R A;  4A93 B;  1G2S A;  1I4P A;  1S5C D;  2XWB B;  4H13 C;  4C3H B;  2R6G A;  4QUC A;  1QJO A;  3AMU A;  5C5L A;  1A2T A;  3HG9 A;  1IKL A;  5BN5 A;  4RHR A;  1SDF A;  3P7J A;  4OGQ C;  4FF3 A;  2EJF C;  3MVV A;  4KD4 A;  4N9P A;  3CRL C;  1EWC A;  2B2U C;  1IYV A;  5COR A;  3OHX C;  3J81 L;  3MZ5 A;  3T51 B;  4B9X A;  1J8I A;  1GOZ A;  3DXJ C;  4AYB B;  4FXG C;  4Y7N B;  3DEO A;  2M2L A;  2BOS A;  3RLF A;  1Y1V B;  2XRQ D;  1YNN D;  2JE6 I;  2O2L D;  1VMP A;  4J8Q A;  2F0N A;  3QG1 A;  3MTS A;  3R8B A;  3NQT A;  5LL6 S;  4BY7 B;  5IGE A;  1SE4 A;  4BWG B;  1F9Q A;  2XRS D;  4KTA A;  3AU7 A;  2EYF A;  3VA5 A;  3H6M A;  2C5C A;  2ICE C;  1I50 B;  3A8J E;  2KHS A;  2M9V A;  4RGN A;  4FYD A;  1LTI D;  1OXT A;  1Z7T A;  1HRJ A;  2R3Z A;  4KK7 A;  1HUM A;  1SYC A;  5JEA G;  4I7Z C;  1LO5 D;  2RDG A;  1QOH A;  1NR2 A;  2BE5 C;  3IFT A;  1GUW A;  2H4O A;  3SDZ A;  3A55 A;  5EKI A;  3FDT A;  4ODG A;  1FGB D;  2AQ2 B;  1SYD A;  1PFN A;  4X3K A;  2VUM B;  4OIK A;  5EGT A;  3L7Z C;  4DA2 A;  2O4X A;  3QOJ A;  1BQQ T;  4CHT B;  5IT9 L;  5C0X J;  2J4X A;  4C3J B;  4XTC S;  3GTL B;  3MXP A;  2RDH A;  4K2K A;  2JXM B;  3K5N A;  4WRD A;  3K58 A;  1PTO B;  4K14 A;  3GTG B;  1RJT A;  1H9S B;  2D5D A;  4FXK C;  1GHK A;  4GZY C;  1DYQ A;  2ZT9 C;  1RTN A;  3BZD B;  1STY A;  4XQN A;  1ZEQ X;  2D9U A;  3BYY B;  1PRT F;  1SE3 A;  1PRT C;  2BDN A;  1PXU A;  3IAY A;  4BS9 A;  1ET6 A;  1Q12 A;  5FO8 B;  4EQP A;  1BDO A;  5LL6 X;  2LFN A;  1W6K A;  1QWY A;  3VR2 A;  1LTS D;  1II3 A;  1WD1 A;  4BBR B;  2R92 B;  4TSS A;  1STA A;  4IFD I;  5E4X A;  1QNU A;  2G9H D;  2J0T D;  5D3D A;  1WVL A;  1D1K A;  1UAP A;  1IW7 C;  4IUR A;  1T5E A;  1KLG D;  4ZAI A;  3D8G A;  1X3Q A;  3F2U A;  2NVY B;  3VYS A;  4KV6 A;  5KNC A;  1TII D;  4G4K A;  1ZYR D;  3SEB A;  2X69 A;  1SMY D;  3NPP A;  4ZQ3 A;  2AWO A;  3Q6S A;  1LTR D;  1LLR D;  4IN3 A;  3PO2 B;  3RZO B;  3S2H B;  3NTI A;  5IGD A;  3SVM A;  4OL7 A;  1H9K A;  1PTO H;  4A3K B;  3NK9 A;  3TP6 A;  3OWE B;  4C3I G;  1JOR A;  3OOC A;  4IUN A;  4C1N I;  1DOL A;  1FYC A;  3U9S A;  3S1N B;  3QO2 A;  1EY5 A;  2O5J C;  2XNA C;  1NR4 A;  2Z8L A;  4DFA A;  1DOK A;  2KJX A;  3KLS A;  1KNA A;  4LAA A;  1ML0 D;  1SJH D;  2K5D A;  1XWE A;  2K6A A;  2PCF B;  3ITP A;  3TZU A;  1FR3 A;  5TSS A;  4F87 A;  3ND9 A;  4KKT A;  1IKM A;  4U67 3;  3I73 A;  3DWA A;  4KN4 C;  3QB3 A;  2PMZ B;  4V19 0;  3KBX A;  2WAQ B;  2B2T A;  1I6V C;  4A3J B;  1SSO A;  3I3C A;  5IIF A;  5DNF A;  2L5T A;  2JP1 A;  2CW0 D;  2MUY A;  5CMD A;  3FKI B;  1RHP A;  5C4H A;  3W3A A;  1JWS D;  1JOK A;  1EFI D;  3KLR A;  3TDQ A;  3RMH A;  3GTM B;  2NN6 I;  2JSO A;  4DAY A;  1PFB A;  3DUZ A;  5COY A;  3VYT A;  3EVQ A;  3PV0 A;  2R7Z B;  2NZ1 D;  3T16 A;  2M00 A;  5C3X A;  3N52 A;  2HQE A;  4S3S A;  3HOU B;  1EU4 A;  4ZUJ A;  3MEH A;  4PV1 C;  4DAV A;  4IFD J;  4FP5 D;  4B08 A;  4TKO B;  3N6R A;  4XXE A;  5IOC A;  4J6H A;  2OEO A;  1PTO F;  2ICI A;  3C1F A;  5K5P A;  4HMI A;  2HDL A;  3DM1 A;  2PW5 A;  1U4P A;  1DOM A;  4A3D B;  3LX0 A;  4JBW A;  1EWH A;  3S16 B;  3J7A F;  2F3V A;  5EKK A;  4KY6 A;  1CM9 A;  2F1M A;  1WTW A;  1ROD A;  1F2Y A;  1MSG A;  1L0Y B;  1RDP D;  2IJ0 A;  5CBE E;  2VB2 X;  3ERO A;  5KGU A;  1F9S A;  2D62 A;  2B2T C;  3K7A B;  3D31 A;  4G57 A;  4F88 A;  1D5M C;  1OXS C;  3HOW B;  5CV7 A;  5A2Q E;  3S14 B;  3SK5 A;  1EYD A;  2MJ8 A;  1EIH A;  5CV5 A;  2XVS A;  5ISR A;  3PUX A;  4K6D A;  5JEA H;  3TME A;  4HCS A;  2NVT B;  1S5F D;  2A69 C;  3D6C A;  3GV3 A;  5EBC A;  1ENF A;  5C3E B;  2NYZ D;  2QIL A;  4HR7 B;  3BS1 A;  3E6Z X;  2JA6 B;  4CKC A;  1F2Z A;  4DNR B;  3JAM E;  5CV4 A;  5EPK A;  5FO7 B;  5JEA J;  1FNV A;  4KY5 A;  5EKL A;  4EQN A;  4BBS B;  5CYU A;  1D5X C;  1KDC A;  2B2U A;  4NDX A;  1TR5 A;  5A2Q L;  3P75 A;  1KTK A;  2A6E C;  2GA4 B;  5M5Y B;  3CQZ B;  3X3M A;  2B2W A;  2K01 A;  2BDO A;  4C3I B;  3VR5 A;  3MXG A;  3ND8 A;  5K36 G;  3JAM L;  4IUV A;  2A68 C;  3I90 A;  1LAC A;  4Z9C B;  1JOQ A;  3MHB A;  2EE1 A;  4RHS A;  5IGC A;  2PW7 A;  1TWA B;  5FK9 C;  3Q22 A;  2F0Q A;  2WII B;  2EVB A;  1SAP A;  3IKJ A;  1CQF A;  2ENB A;  1EIG A;  4XYO A;  4CKE A;  4PMB A;  1QCB D;  1E2Z A;  3P1H A;  3ERQ A;  2QDB A;  1QE6 A;  1ZXT A;  4K8I A;  5NUC A;  5ELD A;  2ZXP A;  3NP8 A;  2JYO A;  4ABN A;  1DXM A;  4J1M A;  3OIP A;  2QCP X;  1H9J A;  4RGO S;  3MAQ A;  2EY2 A;  2PNR C;  3MFY A;  1E2W A;  4IUP A;  2EPB A;  4OIJ A;  2KQ3 A;  1STB A;  1UEA B;  1NAP A;  1PZJ D;  3S1M B;  1BBX C;  2Q8T A;  3RZD B;  4G7O C;  5BN3 A;  3I72 A;  3HEJ A;  4MN3 A;  5IOD A;  2FMC A;  3LWE A;  1VMC A;  3NSW A;  2B2W C;  4CJ2 C;  1EZ6 A;  4YIJ A;  2A5H A;  2LMC B;  1HXY D;  2QF7 A;  5BN4 A;  1EOT A;  1SNC A;  2SEB D;  3K5M A;  5E3F A;  1E2V A;  5KEE A;  2WP8 J;  2VNU D;  3R3O A;  2ID0 A;  5KRU A;  5D65 A;  1WTP A;  2AUK A;  4LMQ D;  2O5I C;  1PFM A;  5C4Z A;  1F2L A;  2F0F A;  1EU3 A;  5JJZ A;  1OXU A;  1QIL A;  2IWH A;  2PPB C;  3FEW X;  1TWH B;  1DJR D;  3FMC A;  1TS3 A;  1LV9 A;  3NHH A;  3ZYY X;  4KKU A;  2IPK D;  5C4X B;  2WB1 B;  1SYF A;  1I6H B;  1G6Z A;  3I91 A;  4BA1 I;  3U9O A;  2R93 B;  4K5W A;  1JOO A;  3PO3 B;  4HSP A;  3KK7 A;  1PTO D;  5G3L D;  4H0L C;  4HN7 A;  3WOE A;  2Q8R E;  1LT4 D;  1O78 A;  4ZYS A;  2EXZ A;  2SDF A;  1WTR A;  3GQB A;  2FFK B;  1TS2 A;  2MPM A;  2YYZ A;  4L8J A;  1NCV A;  3HZX A;  2QKI C;  3L3O C;  1V1O A;  2L4N A;  1BCP C;  2B8F A;  3BVZ A;  5I6W A;  1D2B A;  3VYU A;  1X32 A;  2H1E A;  5J39 A;  4RCO A;  1DM0 B;  3NBH A;  1C48 A;  3SK6 A;  4C2M B;  2K32 A;  2RKS A;  5AFW A;  2KCC A;  1HFG A;  3PUV A;  2K5W A;  2E2I B;  1V43 A;  1S4Z A;  2B2V A;  1ZKO A;  2OT2 A;  3I4N B;  4ZKC B;  1I4Q A;  1YNJ D;  3E5S A;  3C3L A;  3R2I A;  5M5X B;  1A3U A;  5A35 A;  3OIQ A;  5F2D A;  1HTP A;  2N55 A;  4RA8 A;  2YU9 B;  4XIG S;  4FXD A;  1SXT A;  1MSH A;  3G6J B;  3CHB D;  1MGS A;  5D3I B;  1B2T A;  2F4I A;  4C1N K;  3NUC A;  2IT1 A;  5DM6 3;  1AP0 A;  4K8J A;  2B8G A;  4O1N A;  2A6H D;  4WOR A;  4ME5 A;  5T1I A;  5IGF A;  5EBD A;  1SBB B;  4NKL A;  5EPL A;  4V0B A;  3D4D A;  2DNC A;  1KAB A;  2IX1 A;  1SFO B;  2FIN B;  4ID6 A;  2L9H A;  4TRD A;  5DAU A;  1I4G A;  4XQQ A;  2JA7 B;  3P20 A;  4F7X A;  5T1G A;  4OO1 G;  2F0L A;  3OMG A;  1V1P A;  3NWT A;  2RSO A;  3QOL A;  3J80 E;  2HCC A;  3A7A B;  3MWY W;  1STE A;  1GUT A;  5JPN C;  1CHP D;  2L55 A;  4FO2 A;  2CHB D;  2PYK A;  1D6E C;  1QG7 A;  2F0J A;  1T5X D;  1LTT D;  3HKZ B;  4HTH A;  3H3V C;  3M7N A;  4N9T A;  5D14 A;  2F0S A;  1UUP A;  2EYL A;  5I9O A;  4FF2 A;  2B2V C;  1EY8 A;  1TWC B;  1TKW B;  3K6O A;  3FRP B;  4RKL A;  3NQI A;  3M7G A;  4ZK9 B;  1SND A;  3TP7 A;  1U4M A;  3J80 L;  1Q1E A;  1FNU A;  1B44 D;  1B53 A;  5K36 H;  2NBF A;  2EYH A;  2F3W A;  1RKN A;  1AW7 A;  1Q1B A;  1EEI D;  2IX3 A;  4CJ0 B;  1SNM A;  2VXW A;  4PQX A;  3I4L A;  1STG A;  3SR1 A;  3L9A X;  4MIU A;  2J7Z A;  2K05 A;  3T13 A;  2DN8 A;  1HQR D;  3C2P A;  3NE5 B;  2Q8I B;  3DWQ A;  5M9O A;  1YNN C;  1SYB A;  3IFD A;  3OWF A;  2RQX A;  4K5V A;  2F0T A;  5C0X G;  4XT1 B;  1BF4 A;  3CKI B;  3PIP 3;  2D2C C;  2WIN B;  3FPU B;  2F0W A;  5ELB A;  2WAC A;  4KJO A;  1GUO A;  3T53 B;  2F0G A;  4KD3 A;  3DMU A;  1R4Q B;  4BY1 B;  3TP5 A;  3S9W A;  2IW3 A;  1B50 A;  1CZG A;  1LTA D;  1D5Z C;  3V96 A;  1BR9 A;  2WKD A;  1HHV A;  5FLX E;  1TY0 A;  1KDB A;  2SNS A;  3LNN A;  4U68 A;  4DNT B;  4NMZ A;  2HCI A;  4RKB A;  2X6G A;  4QB4 A;  1B9N A;  1KAA A;  1TS4 A;  2L1B A;  2R61 A;  1Q8I A;  2NB0 A;  2BE5 D;  3TSS A;  1BUV T;  3A56 A;  2FJ2 A;  3BDC A;  5C5M A;  1KNE A;  1V8Q A;  2BA0 A;  4H7B A;  3FVQ A;  1Q3L A;  4CKB A;  1S5B D;  5E4W C;  1TWF B;  3EFX D;  1B1Z A;  1U4R A;  5FLX L;  5M3F B;  2K28 A;  3T4A C;  5J1Z A;  1IYU A;  4TQU S;  3WOF A;  5LHY 1;  1Z6H A;  3KF8 A;  3EJI A;  5EPJ A;  2LKV A;  1WTX A;  1FD7 D;  5M5W B;  3O13 A;  2K03 A;  1ICW A;  1SEB D;  1HA6 A;  4A3B B;  4O42 A;  5JPM C;  4XQJ A;  4KKS A;  1DON A;  4OHJ A;  1JWM D;  3RD4 A;  2PQE A;  3M4Y A;  2KVM A;  2RSN A;  2L12 A;  4KI0 A;  2EZV A;  3DHQ A;  1A2U A;  4DU9 A;  4R9W A;  1BCP B;  1O7L A;  4ZKB B;  1PRT D;  5JVG 3;  5J22 A;  1LT6 D;  2CQA A;  1U4L A;  2NWG A;  2OXP A;  1F9R A;  2A74 C;  1BO0 A;  2JEB I;  4IUQ A;  4KN7 C;  1WCM B;  5ELC A;  1EL0 A;  3BYT B;  1F2M A;  4ZRZ A;  4A3I B;  3K5O A;  1E0B A;  2F0O A;  4QF4 A;  2NTT A;  3DWP A;  4ZLT F;  2AUJ D;  4PMC A;  1IW7 D;  4RFB A;  2EY5 A;  3PUZ A;  2KCN A;  4WFN 3;  5IGG A;  2E74 C;  4QCL A;  3M85 A;  2DNE A;  3PIO 3;  3GD7 A;  1RD9 D;  1ZYR C;  3J7A V;  1JIC A;  4KMU C;  1B4O A;  1U9R A;  2K33 A;  1SMY C;  5JVH 3;  4IUU A;  1PMR A;  3ONA B;  3A8I E;  3WDN A;  4DGZ A;  4FNF A;  4QIW B;  1XYI A;  2CVR A;  3R93 A;  1UNS A;  3OMC A;  1VF5 C;  2X6L A;  1ENA A;  2Z4I A;  1M8A A;  2B63 B;  1SYG A;  1CK1 A;  3GV6 A;  1W6J A;  4I65 A;  2IL8 A;  3H94 A;  2JEA I;  3J81 E;  3NXW A;  2V4D A;  1HTL D;  2L11 A;  2A73 B;  2E2H B;  4ILW A;  3V2T A;  5HGT A;  1SE2 A;  4XDX A;  4PMW A;  5IGB A;  2B39 A;  2DY7 A;  3PUW A;  3S17 B;  1J9O A;  4P2C B;  1Y8O B;  2QEJ C;  2FMM A;  1EY6 A;  4M1U B;  3R2T A;  1Y1W B;  1VCI A;  3NTK A;  4IFD G;  2I07 B;  4L63 B;  2KED A;  3SE0 A;  4OO1 H;  3URY A;  3FPP A;  1CZW A;  1O7Y A;  2F0D A;  1OO9 B;  2MGS A;  3CU7 A;  2KA7 A;  3MXU A;  4DF7 A;  2F0V A;  4Q0F A;  1XX8 A;  1SJE D;  3GO5 A;  4K2L A;  1ILP A;  3I8Z A;  1G29 1;  1L0X B;  2KEE A;  1ESR A;  2EYM A;  4HSV A;  2CW0 C;  1TQO A;  4WJW A;  2F0P A;  4QMG A;  3Q24 A;  3SK4 A;  3V05 A;  1DZ1 A;  5EQ0 A;  3A7L A;  4EQO A;  3NTH A;  1XTC D;  1EYA A;  2XN9 C;  3HRZ C;  1HFN A;  5DEH A;  2E75 C;  2NUC A;  4DK1 A;  5KYL A;  1RF2 D;  4A3M B;  1S5E D;  1VDZ A;  5IT9 E;  1JWU D;  4RGM A;  1V1P B;  3K59 A;  2F0U A;  4BA2 I;  1X3P A;  1LAB A;  1F9P A;  4H44 C;  1JQY D;  4A3F B;  1I3Q B;  3GTQ B;  2IX0 A;  2Y0S B;  2N88 A;  2F0H A;  1JE4 A;  5KYI A;  3IL8 A;  1AFP A;  1EQV A;  3BVG A;  4EGV A;  1ESF A;  2F0E A;  2F0K A;  5CC4 A;  1AEX A;  1G8Z D;  4L6T B;  3GTP B;  1ILQ A;  1BOS A;  5M3M B;  1HQM C;  1EY7 A;  1TT2 A;  1K8O A;  1WTV A;  2K04 A;  5C0X H;  5CGK A;  1O7Z A;  2E2D C;  3K5L A;  2EY6 A;  3TBI B;  1B9M A;  1EYC A;  3A54 A;  1GJX A;  1MI2 A;  4B9W A;  1AN8 A;  2WKC A;  3MC0 B;  4ZUI A;  1BCP F;  4EVO A;  4NW2 A;  2I46 A;  4MHE A;  1A3T A;  3VR4 A;  3T56 B;  4A3E B;  1JB3 A;  2TSS A;  3DEP A;  2PZU A;  2NN6 G;  1CI3 M;  1HUN A;  3TP8 A;  1OXX K;  1H9M A;  1HPC A;  1SYE A;  3C46 A;  1G91 A;  1H9R A;  3A8K E;  5KIX A;  4UAI A;  2A69 D;  1CFM A;  4FF4 A;  3GTJ B;  3TZD A;  3OPO A;  1OXV A;  1MBY A;  4JK1 C;  4K6L A;  3D4R A;  3VR6 A;  1IL8 A;  1LTG D;  2HDM A;  2TMP A;  4CGY B;  5ELE A;  1Y8P B;  3BG3 A;  2NVQ B;  2SNM A;  1JC7 A;  3HGB A;  2MP1 A;  4K5X A;  2LS0 1;  5C6A A;  2RBM A;  3VYR A;  4RWS C;  5I4D A;  1PZK D;  2EOT A;  2AQ3 B;  2L0C A;  1WTO A;  1G2T A;  2A6E D;  5I2X A;  1WTQ A;  1KDA A;  3OSO A;  5CR3 A;  2PO4 A;  4CBV A;  2HUG A;  1Z47 A;  3NBI A;  2NTS A;  1EY4 A;  2K1B A;  1A6X A;  4G7Z C;  4RCN A;  4KY7 A;  4IZ8 A;  3D3R A;  2EYJ A;  3KLS X;  2MHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...