2F3VA

Solution structure of 1-110 fragment of staphylococcal nuclease with v66w mutation
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
110
structure length
110
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMWENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Folding stability and cooperativity of the three forms of 1-110 residues fragment of staphylococcal nuclease
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 3
structure length 110
sequence length 110
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f3vA00
4HTHA 3NUCA 3EVQA 5M9OA 3OSOA 3P1HA 3T16A 5IGFA 1EZ8A 3E5SA 1JORA 2KQ3A 5IGEA 3ITPA 5HGTA 2PZUA 4B9XA 1F2MA 4K5WA 3NK9A 1A3UA 2RDFA 4KTAA 4ZQ3A 3LX0A 3RUZA 3SK8A 2QDBA 3SK4A 5KEEA 3MZ5A 5CV6A 5KGUA 5KYIA 2OXPA 4QB4A 2EYMA 3HEJA 2HQEA 4DGZA 2SNMA 2F0GA 1JOKA 5I6YA 5KIXA 5CV9A 2F0PA 1EYDA 4KY5A 1TR5A 1NUCA 2F0WA 3NHHA 4J6HA 2SOBA 4K2KA 3NXWA 4K8JA 5F2DA 1SNDA 5E1FA 2KHSA 1SNCA 5EKLA 4HMIA 2EY5A 2SNSA 4PMBA 4QF4A 5CGKA 1KDBA 1KAAA 2RBMA 3VA5A 2EYJA 3T13A 4K5VA 3OMCA 3QB3A 4ZUJA 2EY1A 4K8IA 4J1MA 4RKBA 1EY8A 2ENBA 5CV4A 3QOJA 1AEXA 1A2TA 3NQTA 4IALA 4PNYA 5IODA 4DF7A 1TT2A 2F0KA 3MHBA 4WORA 4ZUIA 3P75A 3HZXA 1EY7A 3D4DA 2F0QA 4NP5A 5C6AA 3MEHA 1EYCA 2EYHA 2EYFA 5E3FA 5K5PA 1SNQA 2EYPA 3D8GA 4KY7A 4NDXA 2F0TA 2F0DA 1STAA 3DMUA 5J39A 4EQNA 3ERQA 5C4ZA 5I6WA 2WACA 4RKLA 2EY6A 1TQOA 3TMEA 5CV7A 1U9RA 4K6DA 1KABA 4QMGA 5DAUA 4KJOA 4NMZA 3TP8A 4EQPA 5I9PA 4HMJA 4WRDA 3C1EA 5C5LA 5IOCA 2EY2A 1A3VA 3PMFA 5IGGA 1SYFA 3EJIA 1STBA 4IUNA 5EKKA 1SYDA 5DEHA 5NUCA 3SXHA 5KRUA 5ISRA 5EGTA 5KYLA 2F0SA 2F0EA 4R8NA 5CV8A 3SK5A 3U9OA 1A3TA 3BDLA 3D6CA 4EVOA 1STGA 2F3WA 2M00A 1ENCA 4F8MA 5C4HA 4S3SA 4YIJA 3QOLA 1F2ZA 4I65A 1SNMA 3EROA 4N9PA 3DHQA 1ENAA 4ME5A 1SYCA 5IGDA 3V2TA 1A2UA 1STHA 1EY4A 5IGCA 3S9WA 2PQEA 3R3OA 1SNPA 4MIUA 2PW5A 5IIFA 3TP5A 1EY5A 4LAAA 5JAVA 1SYBA 1SNOA 2F0VA 2NUCA 2F3VA 3C1FA 3MXPA 4KV6A 4KD3A 3TP6A 4B9WA 4EQOA 4G57A 2F0OA 1NSNS 2EYOA 1IHZA 2F0JA 2F0HA 2LKVA 1KDAA 4TRDA 5CV5A 1SYEA 2F0LA 3OMGA 3SR1A 1STYA 3D4WA 2EXZA 2OEOA 5C5MA 2PZTA 4PMCA 2F0MA 1JOOA 2F0NA 4H7BA 3SHLA 5I9OA 5IGBA 5HURA 3H6MA 5CR3A 5J1ZA 1RKNA 2EYLA 3BDCA 2OF1A 3TP7A 4OL7A 3SK6A 3MVVA 2PZWA 4DU9A 1EYAA 2RKSA 2O4XA 1STNA 4IZ8A 4ODGA 5CC4A 1KDCA 4K5XA 4KD4A 4KY6A 1EY0A 1EY9A 2PYKA 3OWFA 1EQVA 3NP8A 4ID6A 4K14A 4F7XA 4DFAA 4E6IA 2F0UA 5C3WA 2F0FA 5C3XA 1JOQA 5JOBA 1II3A 2F0IA 4K2LA 4KHVA 5J22A 4N9TA 4NKLA 1F2YA 1SYGA 1EZ6A 4KJNA 2PW7A 1EY6A
chains in the Genus database with same CATH superfamily
4R1JA 1CKMA 2K5HA 1HUMA 3LNNA 3I91A 2ZT9C 3VYTA 5HGTA 1CSPA 4B3TL 4K5WA 1I4XA 4KTAA 3RUZA 3SK8A 2BA0A 3MTSA 4JI4Q 2HQEA 5CV9A 4K2KA 1DYQA 1CA6A 3IFTA 1CUKA 2KHSA 2R7ZB 2J7ZA 1VF5C 2K5VA 4XQNA 5ELNA 3T13A 4ABNA 5LHY1 3ULLA 1V1QA 4A3MG 1AEXA 1RODA 4B08A 3S1RH 4BBSG 4IALA 1V1OA 2MO0A 4LF6Q 1L0WA 4OIJA 2KJXA 4WFN3 3S17B 2JA7H 3D8GA 5FJ8G 3K5NA 1KC8C 2QGQA 5I6WA 4V0BA 1UE1A 4LFBQ 2JA9A 3H3VC 3A54A 1X3PA 2DY8A 4QMGA 1HR0Q 2UUBL 2YV5A 3TZDA 2ZXRA 2JEBI 1NR4A 1L1OC 3TZUA 1DGSA 2JQOA 3M9BA 3A8IE 3F2DA 1GUGA 4G7OC 1YNND 3VR6A 2X6LA 4B3MQ 3KBXA 4P72A 1WTVA 2VY3A 2HQLA 4YIJA 3AMUA 4QIWB 4DK1A 4JCVE 3FKIG 1W6KA 2FMMA 1MD2D 5IGCA 2NVYB 3A5ZB 2B39A 4BXXG 2Z6KC 1EY5A 4JBKA 3C46A 1EYGA 2F0VA 3KDFA 2BOSA 2LKVA 1JOQA 4MN3A 1X54A 1SMXA 4PZ7A 4LNQA 5C5MA 4DR4L 1CQFA 2R7ZH 3MVVA 3BDOA 1XNRQ 2NB0A 1CHPD 3J81j 1TS4A 1I4GA 1WCMB 2F0UA 1X65A 2ALYB 1ONLA 4GOPC 4DR1L 4HAEA 2F0IA 3ND8A 4A3BG 4HTHA 1VDZA 4H13C 4JW0A 3P1HA 4LF8L 3S17H 1IZ6A 1C7YA 1UEAB 2JN4A 1SROA 5ELFA 4B3SL 1UUPA 4DR5L 2Q8RE 1EIFA 3KOJA 3C2PA 3A55A 2F0PA 4QUCA 2IW3A 5KNDA 3K7UC 1LTSD 3BVGA 4QF4A 2QCPX 4IUPA 1N8RC 4BY7G 2DY7A 2UUCL 1D1KA 1LUZA 5CV4A 2B2WC 5KNCA 2B8GA 1IBKL 1Y1VG 1ZEQX 5C0XG 4R4TA 2NTSA 2Y0SE 1K28A 5COYA 4YWKA 2BH2A 1VQDA 3STBC 1XPUA 1G2TA 3PO2B 2MUYA 3M4YA 4KI0A 1Q86C 4OELB 5IP7H 1Q1BA 2NVYH 4IUUA 3HOVG 1O7ZA 2IPKD 3I4MG 3J81c 1QWYA 2NN6G 3UDIA 1CKNB 1K8AC 2C35B 4K6DA 1WD1A 4M8AA 4YY3Q 2RA4A 3KJOA 4L5TA 2K01A 2X6GA 3J81E 2H1EA 4JI8L 3VYUA 2QA4A 3SXHA 4KMUC 5IYBG 4N8X1 4ZKCB 2EJGC 5C4JB 4HN7A 3D31A 5LL6S 3D3RA 1NJIC 5K36H 4EVOA 2Z8LA 1A0IA 4R9WA 1YJ9A 1F2LA 1SNMA 3TRZA 1WCMH 1IL8A 2DNEA 2R93B 1VQ7A 1PH7A 4L63B 3DEOA 1A2UA 2ZTDA 2B2YC 2AQ1B 5IY0A 1B1ZA 1ML0D 4DV1Q 4A76A 4K6LA 3BS1A 4DR6Q 1IBLL 2VB3X 5JVH3 4AIMA 4A75A 2B63G 1AE2A 4PMCA 2F0MA 4A3EG 1LT3D 3S2HB 1FJGL 2GVAA 2ASBA 1BOSA 3NBHB 2E2JB 3K5MA 5FK9C 2L4NA 2PZWA 1PH6A 3MFGA 2Q2TA 2O5IC 4K5XA 3OWFA 3J81i 1D5MC 4IQZA 3WOFA 2VZAA 2B2UC 1I4QA 1Y8PB 1SYGA 4CJ1B 4QCLA 1YNNC 3G7LA 3CP0A 3T16A 3E5SA 3PO2H 1SDFA 3K58A 2L0CA 4DUZL 3T1HQ 1ICWA 3EN2A 4ZQ3A 2HIVA 2OXPA 4RCOA 2NVXB 5KIXA 4FF1A 1WFQA 4GNXC 3TREA 1QVCA 3W1BA 4L6TB 5I4DA 5C4JH 2EYJA 5A2QE 4DV2L 4A3CH 4L5SA 1B70B 4J1MA 4IUQA 3QOJA 4DNRB 4PQXA 3VYRA 2ZXPA 1UEBA 5C4XG 1V43A 2R93H 3MEHA 4CJ2C 3PGZA 2IT1A 5IT9c 1JWMD 4DR3L 1BCPF 4OO1I 3R8BA 4X65L 1M1KC 1RTOA 4DR7Q 5IT9E 4FXKC 4RGMA 2XWBB 1S40A 3I55A 1F9RA 2K6AA 2MQHA 1GM5A 4X3UA 3CPWA 2A8VA 2LXKA 5EKKA 1EIHA 3S2HH 3MC0B 2E2JH 3DLLA 4C3IB 3I56A 4BY1G 1LT5D 5C4HA 2VUMG 1AZQA 4ZLTF 1PTOB 4OWWB 1BUVT 3SEBA 1OXUA 4ME5A 2KCCA 2J4XA 3OIPA 5EJWA 4A3FG 1O7IA 1B3AA 1TIID 5IIFA 4DUYQ 4JI4L 1TVXA 4EQOA 4KV6A 1SN8A 3MXNA 2NZ1D 1GKHA 2LFNA 5DLQE 1SYEA 3M4PA 1V8QA 2NVXH 2XRQD 3CC4A 3KF6A 1BKBA 4JBWA 3UDGA 3V96A 1B50A 3DWAA 3SK6A 1YITA 2G9DA 3S1NB 3H15A 1KDCA 4X3KA 3NP8A 1K8GA 3KDFB 1BF4A 1IKLA 1HNWL 4IJLA 3Q22A 3GTOH 3NWSA 4GLVB 4IURA 3ITPA 2V4DA 3Q6SA 4LFBL 4MTKA 5JPMC 1LYLA 2AQ3B 2RDFA 4L5QA 4X62L 1HR0L 4IJHA 3GTMB 3MEFA 1Z6HA 2F4IA 4X3SA 4YCUA 3RNUA 4CDFC 2F4VQ 1NUCA 2VL6A 2SOBA 1SNDA 3EIVA 1MSHA 1QZGA 1S5DD 3D0FA 2RBMA 4HIDA 3HOUG 4K5VA 4C3IH 5M5YB 1BCPD 4PNYA 1NCVA 1PTOH 5JEAJ 2F0KA 3MHBA 1VQ8A 1IL2A 4C3JG 3U58A 4NXNQ 4DR2Q 4IN3A 3I4OA 1X3GA 4NDXA 3PIP3 2E74C 2HCCA 3VR4A 1Q1EA 1SAPA 2KCTA 1OO9B 2CQAA 2KCMA 1XMQQ 3GDEA 1C4QA 3K8AA 1KL9A 2Y0SG 1MHWC 3IL8A 2PQAB 1E22A 2NVTB 1STBA 5NUCA 4JG2A 5ISRA 2CCZA 5EGTA 5BR8Q 5E4WC 3W2DA 5DM63 1Y69U 2VQEQ 1XNRL 3DUZA 1B4OA 3BDLA 4DAYA 2MHVA 4QL5A 3QIAA 1R9TB 3S1NH 4A3MB 3NBIA 1LLRD 2ZTCA 4N9PA 2AWNA 4BBSB 1SYCA 5I2XA 4P73A 2H5XA 3UDXA 1K0RA 3J80L 2A19A 3M4OB 2A5HA 5M5WB 3S15B 3W1GA 4MIUA 4LMQD 4DA2A 4OWXB 2I5LX 4JVZA 4LFCQ 1P16A 4KD3A 2K4KA 3A7AB 3GTMH 2KA7A 2Z4IA 2LSSA 3OMGA 1VQKA 2D0PA 3SHLA 4LFAQ 1ASZA 1RL2A 1XMOL 1PFNA 4ZYSA 2Z0SA 2N3SA 1V9PA 1YHBA 2WKDA 3QR8A 2E2HB 4KY6A 5M5YH 1K3RA 5JOBA 2QDLA 3ICEA 1TWAB 2EQSA 1C0AA 4K0KQ 4KJNA 2PW7A 2R92G 4LUVA 2WAQE 4ZAIA 3FKIB 1M4VA 4OIKA 2AQ2B 3KLWA 4CHTB 4BA1I 2OT2A 4BWGB 4YY3L 2B2VC 4TQUS 3GTKB 5F2DA 2NVTH 2B2WA 1D5XC 2EY5A 4RH6A 3PUXA 5EBCA 3K6OA 1KDBA 3WOEA 3CQZB 1R9TH 1CZGA 5JJLA 4A3MH 1CI3M 4ZUIA 4CDCC 3HZXA 4BBSH 3MXUA 3TQYA 3L2PA 2JA6G 1YIJA 4A3BB 4A3LG 4J8QA 4DV1L 4HJ7A 5M5WH 2UXDQ 4XT1B 3I73A 4DR6L 1EEID 5FJ8H 5GQOA 4GN3B 1KABA 2XVSA 4DAVA 3RN2A 5JJIA 2EY2A 1ESFA 2CKZB 3CRKC 1FGBD 5BN4A 4HIKA 1VQ9A 1AH9A 4H0LC 1PRTF 2K03A 1QB5D 3I8ZA 2B2YA 4BY7B 4RGOS 4Y7NB 2E2HH 5LMNW 2UXCQ 3TS2A 1Y1VB 1CK1A 4V190 3MWYW 1TWAH 1Q90A 2QILA 1WOCA 3FKIH 1O78A 3V05A 4N8FA 5L37A 3C1FA 4O0AA 4BXXH 1BCPC 3F2UA 2CWPA 3I4MB 1XWEA 3GTKH 1NSNS 1RJTA 2OEOA 2JEAI 2F0NA 2A6HC 1LTBD 5EKIA 1ET6A 5DM73 3AB9A 3CQZH 2PYKA 2F0FA 1YJNA 4CDDC 3OWEB 5D3IB 2SDFA 1YEZA 3CAMA 1VQ6A 3K5OA 3NTKA 4NW2A 3S2DB 2BA1A 4I7ZC 4A3BH 1HUNA 3KBGA 4DR7L 4GKJL 4GNXA 4C56C 3U9SA 3NK9A 1M90C 1TWFB 3OIQA 3O13A 2QEXA 2F0GA 5BN3A 5I6YA 4YCWA 4Q5VA 1AP0A 3U50C 1HTLD 4CDEC 2PI2E 3CCSA 2B63B 3T53B 4A3EB 4HMIA 5FLMG 4FF2A 3OMCA 2I5MX 3H91A 2YTYA 1D5ZC 1EOVA 4BY7H 4LF4L 4Y7NH 2OCEA 3E0EA 3ULJA 5EPLA 5KNBA 1J6QA 1Y1VH 4IFDG 1ASYA 2F0QA 5C0XH 1D6EC 4HJ8A 5K5PA 1SNQA 2EYPA 1EWIA 2R7FA 1IXRA 3ERQA 1I3QB 3IRBA 2YU9B 1XPOA 3CCEA 3I4MH 1PRTD 3HKSA 5I9PA 1B44D 1F9PA 1LO5D 2NN6H 4JI0Q 3HOYG 1AZPA 5IGGA 2BE5D 3AQQA 3HOZG 2CW0C 1T5EA 5DEHA 3LWEA 1PFBA 1D7QA 1XJVA 5IYBH 1H9SB 4NPSA 4L8JA 4FP5D 4JI6Q 5ELBA 4RG1A 2C9OA 3U4ZA 1L1OB 2GVBA 4OGQC 1GUNA 1I50B 1FL0A 5C4XB 2FHTA 4YWMA 4DV4Q 2K04A 1E3PA 3NPPA 3S2DH 4G7HC 1I5FA 5CORA 5D65A 1TWFH 4G57A 2F4VL 5I2YA 3KYHC 4MTNA 1BXTA 3CC2A 1Q82C 1PTOF 3FP9A 5G3LF 1KNEA 5HURA 1TY0A 2EDGA 2B63H 1RKNA 3KF8B 4A3EH 1J5EL 3HG9A 4MNOA 2B2TC 1OXSC 1QUQA 3TDQA 4DNTB 3ONAB 4DK3C 5CC4A 1JCKB 2VUMB 4NXNL 4DR2L 2NYZD 3NSWA 2AHOB 1KTKA 5J22A 1U4PA 5JJKA 3CD6A 1YZ6A 4DV6Q 1P8LA 4X3TA 1EZ8A 1HH2P 3BYYB 2CH4W 3A8KE 4A3FB 1I3QH 5KEEA 2MNAA 1GHJA 4FF3A 2YU9H 4GN5A 4GOPB 1N34Q 1U4LA 1Y14B 3BYTB 4UDUC 5BR8L 2WAQG 2ID0A 2VQEL 5E1FA 4C3HG 2NWGA 2DJGC 2RVLA 4DK6C 1B8AA 5H1SE 3S1QB 1YI2A 2QEJC 3OYYA 1OTCA 3H3VH 2P5ZX 1MJEA 1VQNA 1V1PA 4JI1Q 3NQTA 3CU7A 1YNXA 3K7AB 3K0YA 1D8LA 1Q8IA 2WB1E 1I50H 5C4XH 1S5CD 4XQJA 4KY7A 4LFCL 4A3DG 1MI2A 5FLXL 1YHQA 2H4OA 5IYCG 4JI7Q 2NZOA 2WACA 1SBBB 1N32Q 3HKZG 1B3QA 1U9RA 2UU9Q 1H95A 3K80C 5D14A 2A74C 1IYJB 3J7AV 2RDHA 5AFWA 3DWQA 3SK5A 4KHPQ 4XIGS 2JA8G 4C2MB 3HOUB 2D2CC 3T56B 1QZHA 1U4RA 2F3WA 4A4IA 1FYCA 4I65A 4BY1H 4GZYC 2VUMH 2K5NA 4K0KL 1LACA 5IE8A 1E2ZA 4C3JB 4DV7Q 1PTOD 5G3LD 2WKCA 1CHQD 1RHPA 2PCFB 4A3FH 1LM0A 4R4OA 1WD0A 3KUPA 2WV6D 1EIYB 1WJJA 2I46A 3R2IA 4GLAC 4LW1A 3D4WA 2Y0SB 2EXZA 2GN5A 2CH4A 2K32A 5IGBA 5E7NA 1WTRA 1L2FA 1A6XA 1X55A 2WP8J 4H02A 2OQKA 4Y52H 1B7YB 3PUZA 3S1QH 5TSSA 3M7GA 3J80c 2K05A 3HFZB 1S3OA 2QKIC 2Z1CA 1AW7A 1PRTC 5LMNQ 5C3WA 2V1CC 3BZDB 3K7AH 1VQJA 2BE5C 3F8TA 4NKLA 1HA5A 4GKKQ 2D9UA 2FXQA 1EY6A 2B2VA 1A62A 1HFGA 2UXDL 1RDPD 4ZCKA 2KQ3A 3KK7A 2PZUA 2VXWA 1ENFA 1MKHA 3G4SA 4HEDA 3DM1A 1L0YB 1VQBA 3SDZA 4DPGA 2JA5G 4C1NI 1E7ZA 1TS2A 3AFQA 4J6HA 3KJPA 4XTCS 1QG7A 2EJMA 4OXPA 3JAML 3OW2A 3B6YA 5D3DA 3VYSA 1A63A 4A93G 4C2MH 1H9MA 3HOUH 2UXCL 1SJED 3GTPB 2F1MA 4XYQA 3DXJC 5HGQA 1K8MA 4GNXB 3P75A 3BG3A 1UWVA 4APVA 2E5LQ 4C3JH 1FD7D 1TWGB 2D0OA 2R92B 1EWHA 2Q2UA 3DMUA 4AYBE 3J80i 4RHRA 1TQOA 2EY6A 4DV5Q 5CV7A 1HNZQ 1QVFA 5C0XJ 4NMZA 3TP8A 3C1EA 4DKAC 3T4AC 5FO8B 3EQLC 5KRUA 1KNAA 4X64Q 4P75A 1XNQL 4R8NA 3URYA 3D4RA 3FPUB 1NBWA 1I94Q 3D6CA 1JE5A 4RHSA 1STGA 2M00A 4UP8A 4G7ZC 3GTOB 2Q2IA 5FOBB 1EIGA 4JV5L 1STHA 3I4NG 4BA2I 2L11A 2JA6B 4HCEA 2B3GA 2CHBD 3TP6A 1BBXC 2NUCA 2D62A 2K5DA 2EYOA 2F0JA 2E8GA 1KDAA 2R61A 3PV0A 3PO3G 4JYAQ 3WDNA 3G48A 5J1ZA 2I5HA 3BDCA 5LMUQ 4LF7Q 3TP7A 5JEAG 2PPBC 1X32A 2RKSA 3PIPA 1PH9A 1K3BC 1CT1D 1VQAA 2A69D 2PNRC 4BBRG 1LT4D 3GTPH 4R4IA 4JPBW 3M85A 2VW9A 2B29A 5IWAQ 1RIPA 5A35A 3NUCA 3NEMA 1TY2A 1TWGH 4Z9CB 3CW2C 2R92H 1A3UA 5C0XI 3UE1A 2OTJA 5KGUA 3S16B 2PO4A 1JOKA 3PCOB 2JP1A 3HOWG 4B3TQ 2K50A 1DOLA 1KD1C 2ICIA 4U68A 3VA5A 2NN6I 4LF6L 3BU2A 1K73C 4JI6L 1X3QA 4K8IA 3BJUA 3HRZC 3QO2A 1JR0D 3GO5A 3FDTA 2DUDA 4PZ6A 4R4QA 5IODA 2MJ8A 2FJ2A 4JBMA 4JI2Q 1X3EA 4LF5Q 2XRSD 4DV4L 1LABA 3NE5B 4KN4C 4JC0A 1SLJA 2K7VA 1I6VC 2JA6H 4A3LH 5HY6A 3X3MA 5GROA 1RCVD 4RKLA 3RLFA 4I7AA 2PI2A 4FYDA 4B3ML 2WB1G 1R4QB 4Q0FA 2E2IB 4JK1C 2NZHA 3U9OA 2FFKB 3HOXG 1A3TA 1OXVA 1PV4A 1VS0A 3JC66 1HXYD 1ENCA 2HD3A 2EXDA 1G6PA 3I2ZA 1UNSA 1OXTA 1UAPA 1TXYA 4CJ0B 3SE0A 4OHJA 1B53A 4DNIA 4DV6L 3Q8DA 1GUWA 5IGDA 3E6ZX 5T1IA 1C9OA 1G6ZA 1EY4A 2LXJA 4MHEA 2E2DC 2TSSA 4UY8C 4ME3A 1BR9A 2K52A 3MXPA 3F2CA 1N34L 3S16H 4HSVA 2B2TA 1STYA 3E3XA 3HOYB 2A1AA 2KEEA 1D1IA 3HOZB 1EU3A 1HZBA 3QWNA 1E2VA 5JPNC 2L12A 4JI1L 4GN4B 1STEA 3TN2A 1T9HA 2FINB 4HJ5A 4DAPA 1SE4A 4E6IA 2ES2A 1LTID 1PH1A 4EGVA 1KAWA 2ZJQA 4ZK9B 2PW5A 2RHSB 3L9AX 3H3VI 1LTLA 1X6OA 4JI7L 1W3SA 2EVBA 4B9XA 4DV3Q 1ZYRD 5JVG3 3PQIA 3LX0A 5JJZA 4DR1Q 2QDBA 1PH3A 1EOTA 3MZ5A 3TS0A 3GQBA 1PH8A 4QB4A 1S5BD 1Q46A 4OX9Q 2L15A 1TR5A 1LTGD 2ICEC 4J15A 2F0WA 2VNUD 1GUSA 1B2TA 2E2IH 1W6JA 4B3SQ 1J8IA 1XX8A 3QB3A 2EY1A 1DM0B 5FLMH 3HGBA 3OOCA 3RZDB 2JJQA 1DZ1A 4FVMA 2VB2X 1EY7A 1AN8A 1CA5A 1EYCA 2KENA 1KRSA 5E3FA 1QVGA 1QOHA 4IFDH 4ZKBB 2OWOA 2F0TA 4P71A 3L0OA 2A69C 4IPHA 4EQNA 4YHHQ 1JICA 4IPCA 3RLOA 1MJCA 4KJOA 4WRDA 1QJOA 4IPGA 4JOIA 4O2DA 3HOYH 2WAQB 2IL8A 3CKIB 1F77A 4C3HB 4XQQA 3HOZH 4AYBG 4C1NK 5AJ3Q 4F8MA 5CMDA 3M7NA 1N9WA 1FNUA 1EQQA 1JC7A 4GKKL 5M5XB 5GADC 3H09A 3V2TA 1VMCA 5IP9G 1VQPA 3D6WA 1BVSA 4RGNA 4A3DB 3A7LA 2F3VA 1IKMA 2ZTEA 4KK7A 1IBMQ 3HKZB 2BDNA 1DOMA 5E4XA 1X3FA 4QUFA 1BNZA 3TEHB 4X66Q 2EYLA 1K83B 3SGIA 4P2CB 2K33A 1DJRD 2JA8B 1BCPB 2O5JC 1A8VA 1EY0A 1YVCA 3RZDH 1CKNA 3TSSA 1ESRA 2ZXOA 4A3KG 4FF4A 1H9RA 3T1HL 1XTDA 4K2LA 3GTJB 4N9TA 2E5LL 1F2YA 1EZ6A 3HOVB 3T51B 3EVQA 3CCUA 1QNKA 3ERSX 5C44G 2L55A 1C8CA 1JQYD 1F2MA 1JB7A 4DV5L 1KLUD 2ZM6Q 1HNZL 4IUVA 2CWAA 1DCZA 1PYSB 5CYUA 5ELDA 4PMWA 2EYMA 4A3IG 3CMAA 1VF7A 2WIIB 3R93A 4X64L 4K8JA 2KOLA 3HS0C 4LUZA 3H0GG 2AUKA 2AWOA 1EEFD 1PYWD 2K14A 2N49A 2SNSA 1WTQA 1I94L 2IWHA 4MZ9A 4C3HH 2G5DA 1BO0A 1JWUD 2KEDA 1NNXA 3MXNB 4KLKA 2N78A 2JK8A 3Q23A 1G291 4WORA 1F9QA 1O80A 3GV3A 4OEMB 3KF6B 5M5XH 4DV2Q 1SFOB 4NP5A 1QILA 3NBHA 1WVLA 5C3EG 1STAA 3ZYYX 3JAMc 1DXMA 4A3DH 1Q7YC 1VQGA 3R2TA 5IYCH 1SEBD 5ELCA 3NQIA 3J7A5 1IYVA 2Z6BA 5C5LA 2JA5B 2WINB 3PMFA 5LMUL 2PMZB 2F0EA 4JI5Q 2LMCB 1PZKD 1K83H 2MP1A 4A93B 2JA8H 2PNHA 3QOLA 1MIUA 1QE6A 5IWAL 3VR3A 4DUYL 1SMYD 3RLNA 1VQFA 3GTJH 1FR3A 1JB3A 3HOVH 2NVQB 1GJXA 1HRJA 2C5CA 1DOKA 3GP7A 4FXGC 3TP5A 4LAAA 3L3OC 2EE1A 2E76C 4NB3A 4B9WA 1JT8A 1VQMA 3RZOB 4IO9A 4WJ4A 2F0OA 1KIXA 1EWCA 2EOTA 2F0HA 1KHIA 5CV5A 2EZVA 1J9OA 4HSPA 3ER0A 3PF4A 1HA6A 2XSCA 2OF1A 1EQRA 2JE6I 1PHJA 1STNA 1RD9D 3JAMi 4ODGA 4HJAA 1XTCD 3FEWX 4A3GG 3QG1A 4K14A 4JI2L 1HZAA 4LF5L 1LTRD 4KHVA 4JI3Q 1CM9A 1VQIA 2IX1A 1U0LA 1SFOH 5M9OA 1EQTA 1YHAA 4FNFA 4POGA 3I4NB 1TWCB 4WJ3M 4DAYB 5CV6A 4QQBX 2VS1A 3A5UA 1HNWQ 1VQHA 4DGZA 4KKUA 4QIWE 2SNMA 3NHHA 1HZCA 2EIFA 2XIWA 2JA5H 1Q81C 3NXWA 3GTLB 3PO3B 4AH6A 1SRUA 5EKLA 4X62Q 1PYBA 4BY1B 1S5ED 2RHQB 1NR2A 1PZJD 1Y1WG 4A93H 2A68D 2ENBA 3ZJYC 1EL0A 1A2TA 1CQVA 2XNAC 4O42A 4BBRB 3PSIA 1EFWA 1XMQL 5M3MG 1H9KA 2M2LA 2NVQH 4DAMA 5IYDG 3LGJA 1WI5A 1UE5A 3CPFA 2HCIA 2YYZA 5C4ZA 1AFPA 2N55A 4R4CA 4GLXA 5EBDA 3TMEA 3K59A 1CTMA 4A3JG 2EPBA 3RZOH 4KKSA 4XYOA 4IFDJ 1WTXA 1RF2D 3HOWB 4NXMQ 1N33Q 1JMCA 3J7AF 1LTAD 1I4HA 2LY7A 4CKEA 4B3RQ 3OPOA 3RMHA 1CKOA 2MFIA 1Q12A 1F2ZA 4OO1G 1NMFA 3DHQA 4HJ9A 1WTOA 4M1UB 4HIOA 3PIOA 3OTOQ 4DV3L 4LFAL 1HFNA 3I4NH 3BVMA 2UUAQ 2G9HD 1SNOA 1TWCH 3AU7A 4ULLA 4OX9L 1IHZA 3EBEA 5LL6X 1I4PA 3SR1A 3M3YB 1WTWA 3CCVA 2WB1B 4JOIC 3GTLH 1IW7D 5CR3A 4QGUA 1ET9A 3PO3H 3BVZA 2RCFA 1H9JA 5M3FG 1S5FD 1EYAA 3HOXB 1SR3A 3MFYA 2K5QA 5JEAH 4KD4A 1Q3LA 2AUJD 4ID6A 1XMOQ 5C3XA 1FNVA 1F9SA 1PFSA 2MO1A 2PQAA 5FKAC 4BBRH 2RF4A 2L5TA 1HQRD 2M9VA 1U5KA 3GTGB 5IGFA 1GUOA 4YHHL 3KFUA 1JORA 5IGEA 2HIXA 4KKTA 4EQ5A 1I6HB 3CCMA 1N36Q 1PRTB 4X6AH 3X3NA 4IFDI 3HEJA 1SMYC 1GHKA 1YNJD 4CBVA 5EPJA 2HT1A 3MXGA 2KECA 1D2BA 3K57A 3HOWH 5AJ3L 1KXLA 1L0XB 2MGSA 5CGKA 3J80E 1OXXK 1QNUA 2IX3A 3NWTA 3IFDA 1SSOA 3EFXD 3CC7A 2Q8IB 2VQFQ 3GV6A 2N8NA 1O7LA 1W2BA 4QJFA 4TVAB 1SJHD 2F3IA 1TKWB 3CF5A 3D4DA 2JA7G 1EU4A 4IPDA 1ICFB 2CFMA 2EYHA 3DWPA 4ZRZA 1PZID 1EFID 2F0DA 1BBWA 3A8JE 1IBML 4YCVA 3I7FA 3PIO3 1LV9A 2D5DA 3CMEA 4X66L 1K8OA 5T1GA 5IOCA 3M3YH 4HIMA 4BS9A 1PDQA 2UXBQ 5CV8A 3S14B 1UE6A 1PLFA 1HNXQ 3HOXH 3NTIA 1TWHB 3S24A 1R4PB 4RWSC 3CCJA 2B8FA 1SXTA 3L7ZC 5DNFA 4LF9Q 1SE3A 2DGYA 2HDLA 3PF5A 3GTGH 2ZM6L 3R3OA 1CFMA 1SNPA 5GAEC 1Z7TA 2A68C 1I6HH 4PZ8A 3I90A 4TRDA 2A73B 2IHFA 1HHVA 2N88A 2OQ0A 3GTQB 4H7BA 1E1OA 1VQEA 5I9OA 2R7ZG 2CQOA 2YTVA 1YBYA 1ZKOA 3MA2B 1VQ4A 1NY4A 4AQYQ 1Z47A 4AYBB 3FHWA 2F03A 1VCIA 5GAHC 3RN5A 1II3A 4IOCA 3DM3A 1PH4A 3CRLC 3P7JA 2K5WA 3OW7A 3CCRA 1DONA 1DD2A 3AFPA 3SK4A 3UE0A 3G6JB 3T1YQ 1SE2A 3S1MB 4GKJQ 2HDMA 4ILWA 4JI5L 3ULPA 3E9HA 3OHXC 1KAAA 3AYHB 4ZUJA 5BN5A 1GUTA 3DEPA 3S14H 4RKBA 3U4VA 4DV0Q 1PFMA 1TS3A 1TWHH 2KCNA 5EPKA 2L9HA 2YTXA 4A3KB 4GS3A 4DXFA 1IW7C 2EJFC 4F88A 5ELEA 2I07B 5IP7G 3WWVA 2RCNA 1G2SA 2HHHQ 4JI0L 4LF4Q 1SE8A 2DNCA 5EQ0A 5C44B 1QUQB 1XYIA 3I4LA 3FPPA 2L1BA 1PTOC 4A3IB 3P20A 2Z4HA 1VQLA 4UP9A 1A3VA 3EJIA 4IUNA 1B9NA 3GTQH 3HP3A 3J7ZC 5K36G 4DXGA 1PH2A 3H0GB 5KYLA 2F0SA 2A6ED 1JWSD 2BH8A 2Z9HA 3VA7A 4RMFA 2RQXA 2FMCA 1YNJC 1WCMG 3KLRA 4FO2A 4JI3L 2LS01 4LWCA 1CSQA 3KLSA 2KBNA 4KN7C 1AE3A 3S9WA 2RDGA 3I3CA 5IP9H 5C3EB 1HPCA 2JXMB 3A56A 1E1TA 2R7DA 1FNWA 1V1PB 1TS5A 3H94A 2O2LD 1GO3E 3F2BA 3S1MH 1EUJA 2CVRA 1NAPA 2UUBQ 3H6MA 3LWUA 4IZ8A 3FMCA 2KVMA 1JJ2A 4F87A 4DN4M 5CBEE 3AEVA 4DFAA 3NELA 1J5EQ 4KHZA 2JYOA 3PUVA 4A3KH 4RA8A 3PO2G 1WTPA 1ILQA 4UAIA 4XT3B 4CKBA 2NBFA 3OSOA 1FVIA 2KUMA 1H9SA 4G4KA 3BZKA 4LK1C 5FO7B 5C44H 2BDOA 2A6HD 1BQQT 2I0QA 4POFA 2GA4B 1ILPA 3PUYA 3VR5A 1HR0W 1PMRA 4PG3A 1L1OA 4KY5A 1PXUA 4A3IH 4NXML 4L5RC 1N33L 1JJGA 1SNCA 3MAQA 4A3CG 4DR4Q 3I70A 3H0GH 4B3RL 1IYUA 1QCBD 4IUTA 3J81L 3J7YW 2KHJA 3W5OA 3CCLA 1Z9FA 1G8ZD 2E75C 3CCQA 4A3GB 2R93G 4DF7A 1TT2A 1GOZA 3OTOL 1N32L 1BBUA 2EYFA 3KF8A 2UU9L 2UUAL 4O1NA 4ALPA 1ZXTA 2Z6KA 4WJWA 2ZJRA 3RR5A 4LF8Q 3E0JA 3UI2A 3UDFA 5C3EH 2Q8TA 4KHPL 4HR7B 4RAUC 3PUWA 2ATWA 4DR5Q 5GAGC 1VQOA 3Q24A 2QF7A 1G91A 1HZ9A 4PV1C 1E0BA 2K28A 2BCOA 2Q2HA 3K81C 2IY5B 1LT6D 1E24A 3N6RA 4S3SA 4DV7L 1YJWA 1Y1WB 4GOPA 2UUCQ 1XXGA 1LTTD 1IBKQ 2WFWA 1KRTA 5M3MB 1UE7A 2SEBD 2AMCB 2DJFC 3G6EA 2PQEA 2R6GA 1E2WA 4DK0A 3QJYA 1N36L 1WYDA 3M4QA 5JAVA 1SYBA 1M8AA 2NTTA 2CW0D 1Y8OB 2XN9C 5ELOA 4CKCA 1PH5A 1S72A 3A74A 4A3JB 3BZCA 4IOAA 5LMNL 1VQ5A 4JI8Q 5FLXc 2IX0A 1HJPA 3W3AA 1PVOA 3IKJA 4OL7A 2K1BA 4EX5A 3CHBD 2VQFL 3EA6A 2IHEA 1VQCA 2R3ZA 5FLXE 2JSOA 1A15A 1O7YA 3NENA 5A2QL 1I4RA 4A3GH 2RSOA 1FGUA 2A6EC 1KQSA 3E9IA 1NE3A 3HKZE 4TKOB 4JBJA 3N52A 5KYIA 1MGSA 1CZWA 1Q8KA 3M4OH 5FO9B 3S15H 1EYDA 3RD4A 1IBLQ 1NMGA 5IT9L 5EAYA 2UXBL 3F1ZA 5J3BA 4PMBA 1JJCB 2ZJPA 1HNXL 1FJGQ 4C3IG 2X69A 5M3FB 4RCNA 4R8IA 1EY8A 4OWTB 2TMPA 4RGTA 1S4ZA 1Y1WH 1G51A 4LF9L 2RSNA 1GXDC 1JE4A 1GD7A 3VDYA 3GD7A 1T5XD 1MBYA 5C6AA 1HCZA 1X9NA 5M3MH 1K9MC 5J39A 2XTIA 5IYDH 1RTNA 4DUZQ 5CBAE 2OTLA 5DAUA 3I72A 4UP7A 4EQPA 1Y8NB 2IJ0A 4HMJA 4LUOA 3TBIB 2XGTA 3SVMA 4A3JH 4FXDA 1SYFA 2QW7A 1SYDA 4UHVA 4AQYL 2K75A 1PA6A 3Q0AA 3FVQA 1GVPA 1VMPA 1TU2B 1MSGA 3S1RB 2B2UA 2HUGA 2XWJB 3EROA 1XNQQ 3CXCA 4FDBA 4XDXA 1K0SA 2AKWB 4OO1H 1ENAA 1KLGD 4LJZC 1X56A 4UPAA 2KHIA 3KLSX 2JA7B 3ND9A 3NTHA 4P74A 3VR2A 4JYAL 3JAME 4U673 4DR3Q 3T1YL 4RFBA 2PMZE 1B9MA 4X65Q 4LF7L 4JV5Q 4TSSA 2MPMA 2F0LA 1ZYRC 1WTHA 3C3LA 2PZTA 3K5LA 1JOOA 4XXEA 4CGYB 4HCSA 1C48A 3STBD 3G71A 1U4MA 4YWLA 4DU9A 3A0JA 2O4XA 4H44C 2J0TD 3K0XA 4DV0L 4QY7A 5M3FH 2DN8A 3FRPB 1HQMC 1EY9A 1HTPA 1EQVA 1NTGA 1BDOA 4OONA 1XPRA 2F52A 4F7XA 3IAYA 2HHHL
chains in the Genus database with same CATH topology
1HUMA 3LNNA 3I91A 2ZT9C 3VYTA 5HGTA 4K5WA 1I4XA 4KTAA 3RUZA 3SK8A 2BA0A 3MTSA 2HQEA 5CV9A 4K2KA 1DYQA 1CA6A 3IFTA 2KHSA 2R7ZB 2J7ZA 1VF5C 4XQNA 3T13A 4ABNA 5LHY1 1AEXA 1RODA 4B08A 4IALA 1V1OA 4OIJA 2KJXA 4WFN3 3S17B 3D8GA 3K5NA 5I6WA 4V0BA 3H3VC 3A54A 1X3PA 2DY8A 4QMGA 3TZDA 2ZXRA 2JEBI 1NR4A 3TZUA 3A8IE 1GUGA 4G7OC 1YNND 3VR6A 2X6LA 3KBXA 1WTVA 4YIJA 3AMUA 4QIWB 4DK1A 1W6KA 2FMMA 1MD2D 5IGCA 2NVYB 2B39A 1EY5A 3C46A 2F0VA 2BOSA 2LKVA 1JOQA 4MN3A 5C5MA 1CQFA 3MVVA 3BDOA 2NB0A 1CHPD 1TS4A 1I4GA 1WCMB 2F0UA 1ONLA 4HAEA 2F0IA 3ND8A 4HTHA 1VDZA 4H13C 3P1HA 1UEAB 5ELFA 1UUPA 2Q8RE 3C2PA 3A55A 2F0PA 4QUCA 2IW3A 5KNDA 1LTSD 3BVGA 4QF4A 2QCPX 4IUPA 2DY7A 1D1KA 5CV4A 2B2WC 5KNCA 2B8GA 1ZEQX 5C0XG 2NTSA 5COYA 1G2TA 3PO2B 2MUYA 3M4YA 4KI0A 1Q1BA 4IUUA 1O7ZA 2IPKD 1QWYA 2NN6G 4K6DA 1WD1A 4M8AA 2RA4A 2K01A 2X6GA 3J81E 2H1EA 3VYUA 3SXHA 4KMUC 4ZKCB 2EJGC 5C4JB 4HN7A 3D31A 5LL6S 3D3RA 5K36H 4EVOA 2Z8LA 4R9WA 1F2LA 1SNMA 1IL8A 2DNEA 2R93B 4L63B 3DEOA 1A2UA 2B2YC 2AQ1B 1B1ZA 1ML0D 4K6LA 3BS1A 2VB3X 5JVH3 4PMCA 2F0MA 1LT3D 3S2HB 1BOSA 2E2JB 3K5MA 5FK9C 2L4NA 2PZWA 3MFGA 2O5IC 4K5XA 3OWFA 1D5MC 4IQZA 3WOFA 2B2UC 1I4QA 1Y8PB 1SYGA 4CJ1B 4QCLA 1YNNC 3G7LA 3T16A 3E5SA 1SDFA 3K58A 2L0CA 1ICWA 4ZQ3A 2OXPA 4RCOA 2NVXB 5KIXA 4FF1A 4L6TB 5I4DA 2EYJA 5A2QE 4J1MA 4IUQA 3QOJA 4DNRB 4PQXA 3VYRA 2ZXPA 1V43A 3MEHA 4CJ2C 2IT1A 1JWMD 1BCPF 4OO1I 3R8BA 1RTOA 5IT9E 4FXKC 4RGMA 2XWBB 1F9RA 2K6AA 4X3UA 5EKKA 1EIHA 3MC0B 4C3IB 1LT5D 5C4HA 1AZQA 4ZLTF 1PTOB 1BUVT 3SEBA 1OXUA 4ME5A 2KCCA 2J4XA 3OIPA 5EJWA 1B3AA 1TIID 5IIFA 1TVXA 4EQOA 4KV6A 3MXNA 2NZ1D 2LFNA 1SYEA 1V8QA 2XRQD 4JBWA 3V96A 1B50A 3DWAA 3SK6A 2G9DA 3S1NB 1KDCA 4X3KA 3NP8A 1BF4A 1IKLA 3Q22A 3NWSA 4IURA 3ITPA 2V4DA 3Q6SA 5JPMC 2AQ3B 2RDFA 3GTMB 1Z6HA 2F4IA 4X3SA 1NUCA 2SOBA 1SNDA 1MSHA 1S5DD 2RBMA 4K5VA 5M5YB 1BCPD 4PNYA 1NCVA 1PTOH 5JEAJ 2F0KA 3MHBA 4C3JG 4IN3A 4NDXA 3PIP3 2E74C 2HCCA 3VR4A 1Q1EA 1SAPA 1OO9B 2CQAA 1C4QA 3IL8A 2NVTB 1STBA 5NUCA 5ISRA 5EGTA 5E4WC 3W2DA 5DM63 1Y69U 3DUZA 1B4OA 3BDLA 4DAYA 2MHVA 3QIAA 1R9TB 4A3MB 3NBIA 1LLRD 4N9PA 2AWNA 4BBSB 1SYCA 5I2XA 3J80L 3M4OB 2A5HA 5M5WB 3S15B 4MIUA 4LMQD 4DA2A 4KD3A 3A7AB 2KA7A 2Z4IA 3OMGA 3SHLA 1PFNA 4ZYSA 2WKDA 2E2HB 4KY6A 5JOBA 1TWAB 4KJNA 2PW7A 4ZAIA 3FKIB 1M4VA 4OIKA 2AQ2B 4CHTB 4BA1I 2OT2A 4BWGB 2B2VC 4TQUS 3GTKB 5F2DA 2B2WA 1D5XC 2EY5A 4RH6A 3PUXA 5EBCA 3K6OA 1KDBA 3WOEA 3CQZB 1CZGA 1CI3M 4ZUIA 3HZXA 3MXUA 4A3BB 4J8QA 4XT1B 3I73A 1EEID 1KABA 2XVSA 4DAVA 2EY2A 1ESFA 3CRKC 1FGBD 5BN4A 4H0LC 1PRTF 2K03A 1QB5D 3I8ZA 2B2YA 4BY7B 4RGOS 4Y7NB 1Y1VB 1CK1A 4V190 3MWYW 1Q90A 2QILA 1O78A 3V05A 3C1FA 1BCPC 3F2UA 3I4MB 1XWEA 1NSNS 1RJTA 2OEOA 2JEAI 2F0NA 2A6HC 1LTBD 5EKIA 1ET6A 5DM73 3AB9A 2PYKA 2F0FA 3OWEB 5D3IB 2SDFA 3K5OA 3NTKA 4NW2A 3S2DB 2BA1A 4I7ZC 1HUNA 3KBGA 4C56C 3U9SA 3NK9A 1TWFB 3OIQA 3O13A 1AP0A 2F0GA 5BN3A 5I6YA 4Q5VA 1HTLD 2B63B 3T53B 4A3EB 4HMIA 4FF2A 3OMCA 3H91A 1D5ZC 5EPLA 5KNBA 4IFDG 2F0QA 5C0XH 1D6EC 5K5PA 1SNQA 2EYPA 3ERQA 1I3QB 2YU9B 1PRTD 5I9PA 1B44D 1F9PA 1LO5D 2NN6H 1AZPA 5IGGA 2BE5D 2CW0C 1T5EA 5DEHA 3LWEA 1PFBA 1H9SB 4L8JA 4FP5D 5ELBA 2C9OA 4OGQC 1GUNA 1I50B 5C4XB 2FHTA 2K04A 3NPPA 4G7HC 5CORA 5D65A 4G57A 5I2YA 1BXTA 1PTOF 5G3LF 1KNEA 5HURA 1TY0A 2EDGA 1RKNA 3HG9A 2B2TC 1OXSC 3TDQA 4DNTB 3ONAB 5CC4A 1JCKB 2VUMB 2NYZD 3NSWA 1KTKA 5J22A 1U4PA 4X3TA 1EZ8A 3BYYB 4A3FB 3A8KE 5KEEA 1GHJA 4FF3A 1U4LA 3BYTB 4UDUC 2ID0A 5E1FA 4C3HG 2NWGA 2RVLA 3S1QB 2QEJC 1V1PA 3NQTA 3CU7A 3K7AB 3K0YA 1Q8IA 1S5CD 4XQJA 4KY7A 1MI2A 5FLXL 2H4OA 2WACA 1SBBB 1U9RA 5D14A 2A74C 3J7AV 2RDHA 5AFWA 3DWQA 3SK5A 4XIGS 4C2MB 3HOUB 2D2CC 3T56B 1U4RA 2F3WA 1FYCA 4I65A 4GZYC 1LACA 1E2ZA 4C3JB 1PTOD 5G3LD 2WKCA 1CHQD 1RHPA 2PCFB 1WD0A 3KUPA 2WV6D 2I46A 3R2IA 3D4WA 2Y0SB 2EXZA 2K32A 5IGBA 1WTRA 1A6XA 2WP8J 3PUZA 5TSSA 3M7GA 2K05A 2QKIC 2Z1CA 1AW7A 1PRTC 5C3WA 3BZDB 2BE5C 4NKLA 1HA5A 2D9UA 1EY6A 2B2VA 1HFGA 1RDPD 2KQ3A 3KK7A 2PZUA 2VXWA 1ENFA 4HEDA 3DM1A 1L0YB 3SDZA 4C1NI 1TS2A 4J6HA 4XTCS 1QG7A 2EJMA 3JAML 5D3DA 3VYSA 1H9MA 1SJED 3GTPB 2F1MA 4XYQA 3DXJC 1K8MA 3P75A 3BG3A 1FD7D 1TWGB 2R92B 1EWHA 3DMUA 4RHRA 1TQOA 2EY6A 5CV7A 5C0XJ 4NMZA 3TP8A 3C1EA 5FO8B 3T4AC 3EQLC 5KRUA 1KNAA 4R8NA 3URYA 3D4RA 3FPUB 3D6CA 4RHSA 1STGA 2M00A 4G7ZC 3GTOB 5FOBB 1EIGA 1STHA 4BA2I 2L11A 2JA6B 4HCEA 2CHBD 3TP6A 1BBXC 2NUCA 2D62A 2K5DA 2EYOA 2F0JA 2R61A 1KDAA 3PV0A 3WDNA 5J1ZA 3BDCA 3TP7A 5JEAG 2PPBC 1X32A 2RKSA 1CT1D 2A69D 2PNRC 1LT4D 3M85A 5A35A 3NUCA 1TY2A 4Z9CB 1A3UA 5C0XI 5KGUA 3S16B 2PO4A 1JOKA 2JP1A 1DOLA 2ICIA 4U68A 3VA5A 2NN6I 1X3QA 4K8IA 3HRZC 3QO2A 1JR0D 3GO5A 3FDTA 5IODA 2MJ8A 2FJ2A 2XRSD 1LABA 3NE5B 4KN4C 2K7VA 1I6VC 3X3MA 1RCVD 4RKLA 3RLFA 4FYDA 1R4QB 4Q0FA 2E2IB 4JK1C 3U9OA 2FFKB 1A3TA 1OXVA 1HXYD 1ENCA 1UNSA 1OXTA 1UAPA 4CJ0B 3SE0A 4OHJA 1B53A 1GUWA 5IGDA 3E6ZX 5T1IA 1G6ZA 1EY4A 4MHEA 2E2DC 2TSSA 1BR9A 3MXPA 4HSVA 2B2TA 1STYA 3HOYB 2KEEA 1D1IA 3HOZB 1EU3A 3QWNA 1E2VA 5JPNC 2L12A 1STEA 3TN2A 2FINB 4DAPA 1SE4A 4E6IA 1LTID 4EGVA 4ZK9B 2PW5A 3L9AX 2EVBA 4B9XA 1ZYRD 5JVG3 3LX0A 5JJZA 2QDBA 1EOTA 3MZ5A 3GQBA 4QB4A 1S5BD 1TR5A 1LTGD 2ICEC 2F0WA 2VNUD 1GUSA 1B2TA 1W6JA 1J8IA 1XX8A 3QB3A 2EY1A 1DM0B 3HGBA 3OOCA 3RZDB 1DZ1A 4FVMA 2VB2X 1EY7A 1AN8A 1CA5A 1EYCA 5E3FA 1QOHA 4IFDH 4ZKBB 2F0TA 2A69C 4EQNA 1JICA 4KJOA 4WRDA 1QJOA 2WAQB 2IL8A 3CKIB 1F77A 4C3HB 4XQQA 4C1NK 4F8MA 5CMDA 3M7NA 1FNUA 1JC7A 5M5XB 3H09A 3V2TA 1VMCA 3D6WA 4RGNA 4A3DB 3A7LA 2F3VA 1IKMA 4KK7A 3HKZB 2BDNA 1DOMA 5E4XA 4QUFA 1BNZA 2EYLA 1K83B 4P2CB 2K33A 1DJRD 2JA8B 1BCPB 2O5JC 1EY0A 3TSSA 1ESRA 2ZXOA 4FF4A 1H9RA 4K2LA 3GTJB 4N9TA 1F2YA 1EZ6A 3HOVB 3T51B 3EVQA 1QNKA 2L55A 1C8CA 1JQYD 1F2MA 1KLUD 4IUVA 1DCZA 5CYUA 5ELDA 4PMWA 2EYMA 1VF7A 2WIIB 3R93A 4K8JA 2KOLA 3HS0C 2AUKA 2AWOA 1EEFD 1PYWD 2SNSA 1WTQA 2IWHA 1BO0A 1JWUD 2KEDA 3Q23A 1G291 4WORA 1F9QA 1O80A 3GV3A 1SFOB 4NP5A 1QILA 3NBHA 1WVLA 1STAA 3ZYYX 1DXMA 3R2TA 1SEBD 5ELCA 3NQIA 1IYVA 5C5LA 2JA5B 2WINB 3PMFA 2PMZB 2F0EA 2LMCB 1PZKD 2MP1A 4A93B 3QOLA 1QE6A 3VR3A 1SMYD 1FR3A 1JB3A 2NVQB 1GJXA 1HRJA 2C5CA 1DOKA 3GP7A 4FXGC 3TP5A 4LAAA 3L3OC 2EE1A 2E76C 4B9WA 3RZOB 2F0OA 1EWCA 2EOTA 2F0HA 5CV5A 2EZVA 1J9OA 4HSPA 1HA6A 2XSCA 2OF1A 2JE6I 1STNA 1RD9D 4ODGA 1XTCD 3FEWX 3QG1A 4K14A 1LTRD 4KHVA 1CM9A 2IX1A 5M9OA 1EQTA 4FNFA 3I4NB 1TWCB 5CV6A 4DGZA 4KKUA 2SNMA 3NHHA 2XIWA 3GTLB 3NXWA 3PO3B 5EKLA 4BY1B 1S5ED 1NR2A 1PZJD 2A68D 2ENBA 1EL0A 1A2TA 1CQVA 2XNAC 4O42A 4BBRB 1H9KA 2M2LA 2HCIA 2YYZA 5C4ZA 1AFPA 2N55A 5EBDA 3TMEA 3K59A 1CTMA 2EPBA 4KKSA 4XYOA 4IFDJ 1WTXA 1RF2D 3HOWB 3J7AF 1LTAD 1I4HA 2LY7A 4CKEA 3OPOA 3RMHA 1Q12A 1F2ZA 4OO1G 3DHQA 1WTOA 4M1UB 1HFNA 3BVMA 2G9HD 1SNOA 3AU7A 4ULLA 1IHZA 5LL6X 1I4PA 3SR1A 3M3YB 1WTWA 2WB1B 1IW7D 5CR3A 1ET9A 3BVZA 1H9JA 1S5FD 1EYAA 3HOXB 3MFYA 2K5QA 5JEAH 4KD4A 1Q3LA 2AUJD 4ID6A 5C3XA 1FNVA 1F9SA 5FKAC 2L5TA 1HQRD 2M9VA 3GTGB 5IGFA 1GUOA 1JORA 5IGEA 4KKTA 1I6HB 1PRTB 3X3NA 4IFDI 3HEJA 1SMYC 1GHKA 1YNJD 4CBVA 5EPJA 3MXGA 2KECA 1D2BA 3K57A 1L0XB 2MGSA 5CGKA 3J80E 1OXXK 1QNUA 2IX3A 3NWTA 3IFDA 1SSOA 3EFXD 2Q8IB 3GV6A 1O7LA 1SJHD 1TKWB 3D4DA 1EU4A 2EYHA 3DWPA 4ZRZA 1PZID 1EFID 2F0DA 3A8JE 3PIO3 1LV9A 2D5DA 1K8OA 5T1GA 5IOCA 4BS9A 1PDQA 5CV8A 3S14B 1PLFA 3NTIA 1TWHB 1R4PB 4RWSC 2B8FA 1SXTA 3L7ZC 5DNFA 1SE3A 2HDLA 3R3OA 1CFMA 1SNPA 1Z7TA 2A68C 3I90A 4TRDA 2A73B 1HHVA 2N88A 3GTQB 4H7BA 5I9OA 1ZKOA 3MA2B 1Z47A 4AYBB 2F03A 1VCIA 1II3A 3CRLC 3P7JA 2K5WA 3OW7A 1DONA 1DD2A 3SK4A 3G6JB 1SE2A 3S1MB 2HDMA 4ILWA 3OHXC 1KAAA 4ZUJA 5BN5A 1GUTA 3DEPA 4RKBA 1PFMA 1TS3A 2KCNA 5EPKA 2L9HA 4A3KB 4DXFA 1IW7C 2EJFC 4F88A 5ELEA 2I07B 1G2SA 2DNCA 5EQ0A 5C44B 1XYIA 3I4LA 3FPPA 2L1BA 1PTOC 4A3IB 3P20A 2Z4HA 1A3VA 3EJIA 4IUNA 1B9NA 3HP3A 5K36G 4DXGA 3H0GB 5KYLA 2F0SA 2A6ED 1JWSD 3VA7A 2RQXA 2FMCA 1YNJC 3KLRA 4FO2A 2LS01 3KLSA 4KN7C 3S9WA 2RDGA 3I3CA 5C3EB 1HPCA 2JXMB 3A56A 1FNWA 1V1PB 1TS5A 3H94A 2O2LD 2CVRA 1NAPA 3H6MA 3LWUA 4IZ8A 3FMCA 2KVMA 4F87A 4DN4M 5CBEE 4DFAA 4KHZA 2JYOA 3PUVA 4RA8A 1WTPA 1ILQA 4UAIA 4XT3B 4CKBA 2NBFA 3OSOA 2KUMA 1H9SA 4G4KA 4LK1C 5FO7B 2BDOA 2A6HD 1BQQT 2GA4B 1ILPA 3PUYA 3VR5A 1PMRA 4KY5A 1PXUA 1SNCA 3MAQA 3I70A 1IYUA 1QCBD 4IUTA 3J81L 3J7YW 2E75C 1G8ZD 4A3GB 4DF7A 1TT2A 1GOZA 2EYFA 3KF8A 4O1NA 1ZXTA 4WJWA 3E0JA 3UI2A 2Q8TA 4HR7B 4RAUC 3PUWA 3Q24A 2QF7A 1G91A 4PV1C 1E0BA 2K28A 2BCOA 1LT6D 3N6RA 4S3SA 1Y1WB 1XXGA 1LTTD 5M3MB 2SEBD 2PQEA 2R6GA 1E2WA 4DK0A 3QJYA 5JAVA 1SYBA 1M8AA 2NTTA 2CW0D 1Y8OB 2XN9C 4CKCA 4A3JB 2IX0A 3W3AA 3IKJA 4OL7A 2K1BA 3CHBD 3EA6A 2R3ZA 5FLXE 2JSOA 1A15A 1O7YA 5A2QL 1I4RA 2RSOA 2A6EC 4TKOB 3N52A 5KYIA 1MGSA 1CZWA 5FO9B 1EYDA 3RD4A 5IT9L 4PMBA 4C3IG 2X69A 5M3FB 4RCNA 4R8IA 1EY8A 2TMPA 4RGTA 1S4ZA 2RSNA 1GXDC 1JE4A 3GD7A 1T5XD 1MBYA 5C6AA 1HCZA 5J39A 1RTNA 5CBAE 5DAUA 3I72A 4EQPA 1Y8NB 2IJ0A 4HMJA 3TBIB 3SVMA 4FXDA 1SYFA 1SYDA 3Q0AA 3FVQA 1VMPA 1TU2B 1MSGA 3S1RB 2B2UA 2HUGA 2XWJB 3EROA 4XDXA 4OO1H 1ENAA 1KLGD 4LJZC 2JA7B 3KLSX 3ND9A 3NTHA 3VR2A 3JAME 4U673 4RFBA 1B9MA 4TSSA 2MPMA 2F0LA 1ZYRC 3C3LA 2PZTA 3K5LA 1JOOA 4XXEA 4CGYB 4HCSA 1C48A 1U4MA 4DU9A 2O4XA 4H44C 2J0TD 2DN8A 3FRPB 1HQMC 1EY9A 1HTPA 1EQVA 1BDOA 4F7XA 3IAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTH A;  3NUC A;  3EVQ A;  5M9O A;  3OSO A;  3P1H A;  3T16 A;  5IGF A;  1EZ8 A;  3E5S A;  1JOR A;  2KQ3 A;  5IGE A;  3ITP A;  5HGT A;  2PZU A;  4B9X A;  1F2M A;  4K5W A;  3NK9 A;  1A3U A;  2RDF A;  4KTA A;  4ZQ3 A;  3LX0 A;  3RUZ A;  3SK8 A;  2QDB A;  3SK4 A;  5KEE A;  3MZ5 A;  5CV6 A;  5KGU A;  5KYI A;  2OXP A;  4QB4 A;  2EYM A;  3HEJ A;  2HQE A;  4DGZ A;  2SNM A;  2F0G A;  1JOK A;  5I6Y A;  5KIX A;  5CV9 A;  2F0P A;  1EYD A;  4KY5 A;  1TR5 A;  1NUC A;  2F0W A;  3NHH A;  4J6H A;  2SOB A;  4K2K A;  3NXW A;  4K8J A;  5F2D A;  1SND A;  5E1F A;  2KHS A;  1SNC A;  5EKL A;  4HMI A;  2EY5 A;  2SNS A;  4PMB A;  4QF4 A;  5CGK A;  1KDB A;  1KAA A;  2RBM A;  3VA5 A;  2EYJ A;  3T13 A;  4K5V A;  3OMC A;  3QB3 A;  4ZUJ A;  2EY1 A;  4K8I A;  4J1M A;  4RKB A;  1EY8 A;  2ENB A;  5CV4 A;  3QOJ A;  1AEX A;  1A2T A;  3NQT A;  4IAL A;  4PNY A;  5IOD A;  4DF7 A;  1TT2 A;  2F0K A;  3MHB A;  4WOR A;  4ZUI A;  3P75 A;  3HZX A;  1EY7 A;  3D4D A;  2F0Q A;  4NP5 A;  5C6A A;  3MEH A;  1EYC A;  2EYH A;  2EYF A;  5E3F A;  5K5P A;  1SNQ A;  2EYP A;  3D8G A;  4KY7 A;  4NDX A;  2F0T A;  2F0D A;  1STA A;  3DMU A;  5J39 A;  4EQN A;  3ERQ A;  5C4Z A;  5I6W A;  2WAC A;  4RKL A;  2EY6 A;  1TQO A;  3TME A;  5CV7 A;  1U9R A;  4K6D A;  1KAB A;  4QMG A;  5DAU A;  4KJO A;  4NMZ A;  3TP8 A;  4EQP A;  5I9P A;  4HMJ A;  4WRD A;  3C1E A;  5C5L A;  5IOC A;  2EY2 A;  1A3V A;  3PMF A;  5IGG A;  1SYF A;  3EJI A;  1STB A;  4IUN A;  5EKK A;  1SYD A;  5DEH A;  5NUC A;  3SXH A;  5KRU A;  5ISR A;  5EGT A;  5KYL A;  2F0S A;  2F0E A;  4R8N A;  5CV8 A;  3SK5 A;  3U9O A;  1A3T A;  3BDL A;  3D6C A;  4EVO A;  1STG A;  2F3W A;  2M00 A;  1ENC A;  4F8M A;  5C4H A;  4S3S A;  4YIJ A;  3QOL A;  1F2Z A;  4I65 A;  1SNM A;  3ERO A;  4N9P A;  3DHQ A;  1ENA A;  4ME5 A;  1SYC A;  5IGD A;  3V2T A;  1A2U A;  1STH A;  1EY4 A;  5IGC A;  3S9W A;  2PQE A;  3R3O A;  1SNP A;  4MIU A;  2PW5 A;  5IIF A;  3TP5 A;  1EY5 A;  4LAA A;  5JAV A;  1SYB A;  1SNO A;  2F0V A;  2NUC A;  2F3V A;  3C1F A;  3MXP A;  4KV6 A;  4KD3 A;  3TP6 A;  4B9W A;  4EQO A;  4G57 A;  2F0O A;  1NSN S;  2EYO A;  1IHZ A;  2F0J A;  2F0H A;  2LKV A;  1KDA A;  4TRD A;  5CV5 A;  1SYE A;  2F0L A;  3OMG A;  3SR1 A;  1STY A;  3D4W A;  2EXZ A;  2OEO A;  5C5M A;  2PZT A;  4PMC A;  2F0M A;  1JOO A;  2F0N A;  4H7B A;  3SHL A;  5I9O A;  5IGB A;  5HUR A;  3H6M A;  5CR3 A;  5J1Z A;  1RKN A;  2EYL A;  3BDC A;  2OF1 A;  3TP7 A;  4OL7 A;  3SK6 A;  3MVV A;  2PZW A;  4DU9 A;  1EYA A;  2RKS A;  2O4X A;  1STN A;  4IZ8 A;  4ODG A;  5CC4 A;  1KDC A;  4K5X A;  4KD4 A;  4KY6 A;  1EY0 A;  1EY9 A;  2PYK A;  3OWF A;  1EQV A;  3NP8 A;  4ID6 A;  4K14 A;  4F7X A;  4DFA A;  4E6I A;  2F0U A;  5C3W A;  2F0F A;  5C3X A;  1JOQ A;  5JOB A;  1II3 A;  2F0I A;  4K2L A;  4KHV A;  5J22 A;  4N9T A;  4NKL A;  1F2Y A;  1SYG A;  1EZ6 A;  4KJN A;  2PW7 A;  1EY6 A; 
#chains in the Genus database with same CATH topology
 4R1J A;  1CKM A;  2K5H A;  1HUM A;  3LNN A;  3I91 A;  2ZT9 C;  3VYT A;  5HGT A;  1CSP A;  4B3T L;  4K5W A;  1I4X A;  4KTA A;  3RUZ A;  3SK8 A;  2BA0 A;  3MTS A;  4JI4 Q;  2HQE A;  5CV9 A;  4K2K A;  1DYQ A;  1CA6 A;  3IFT A;  1CUK A;  2KHS A;  2R7Z B;  2J7Z A;  1VF5 C;  2K5V A;  4XQN A;  5ELN A;  3T13 A;  4ABN A;  5LHY 1;  3ULL A;  1V1Q A;  4A3M G;  1AEX A;  1ROD A;  4B08 A;  3S1R H;  4BBS G;  4IAL A;  1V1O A;  2MO0 A;  4LF6 Q;  1L0W A;  4OIJ A;  2KJX A;  4WFN 3;  3S17 B;  2JA7 H;  3D8G A;  5FJ8 G;  3K5N A;  1KC8 C;  2QGQ A;  5I6W A;  4V0B A;  1UE1 A;  4LFB Q;  2JA9 A;  3H3V C;  3A54 A;  1X3P A;  2DY8 A;  4QMG A;  1HR0 Q;  2UUB L;  2YV5 A;  3TZD A;  2ZXR A;  2JEB I;  1NR4 A;  1L1O C;  3TZU A;  1DGS A;  2JQO A;  3M9B A;  3A8I E;  3F2D A;  1GUG A;  4G7O C;  1YNN D;  3VR6 A;  2X6L A;  4B3M Q;  3KBX A;  4P72 A;  1WTV A;  2VY3 A;  2HQL A;  4YIJ A;  3AMU A;  4QIW B;  4DK1 A;  4JCV E;  3FKI G;  1W6K A;  2FMM A;  1MD2 D;  5IGC A;  2NVY B;  3A5Z B;  2B39 A;  4BXX G;  2Z6K C;  1EY5 A;  4JBK A;  3C46 A;  1EYG A;  2F0V A;  3KDF A;  2BOS A;  2LKV A;  1JOQ A;  4MN3 A;  1X54 A;  1SMX A;  4PZ7 A;  4LNQ A;  5C5M A;  4DR4 L;  1CQF A;  2R7Z H;  3MVV A;  3BDO A;  1XNR Q;  2NB0 A;  1CHP D;  3J81 j;  1TS4 A;  1I4G A;  1WCM B;  2F0U A;  1X65 A;  2ALY B;  1ONL A;  4GOP C;  4DR1 L;  4HAE A;  2F0I A;  3ND8 A;  4A3B G;  4HTH A;  1VDZ A;  4H13 C;  4JW0 A;  3P1H A;  4LF8 L;  3S17 H;  1IZ6 A;  1C7Y A;  1UEA B;  2JN4 A;  1SRO A;  5ELF A;  4B3S L;  1UUP A;  4DR5 L;  2Q8R E;  1EIF A;  3KOJ A;  3C2P A;  3A55 A;  2F0P A;  4QUC A;  2IW3 A;  5KND A;  3K7U C;  1LTS D;  3BVG A;  4QF4 A;  2QCP X;  4IUP A;  1N8R C;  4BY7 G;  2DY7 A;  2UUC L;  1D1K A;  1LUZ A;  5CV4 A;  2B2W C;  5KNC A;  2B8G A;  1IBK L;  1Y1V G;  1ZEQ X;  5C0X G;  4R4T A;  2NTS A;  2Y0S E;  1K28 A;  5COY A;  4YWK A;  2BH2 A;  1VQD A;  3STB C;  1XPU A;  1G2T A;  3PO2 B;  2MUY A;  3M4Y A;  4KI0 A;  1Q86 C;  4OEL B;  5IP7 H;  1Q1B A;  2NVY H;  4IUU A;  3HOV G;  1O7Z A;  2IPK D;  3I4M G;  3J81 c;  1QWY A;  2NN6 G;  3UDI A;  1CKN B;  1K8A C;  2C35 B;  4K6D A;  1WD1 A;  4M8A A;  4YY3 Q;  2RA4 A;  3KJO A;  4L5T A;  2K01 A;  2X6G A;  3J81 E;  2H1E A;  4JI8 L;  3VYU A;  2QA4 A;  3SXH A;  4KMU C;  5IYB G;  4N8X 1;  4ZKC B;  2EJG C;  5C4J B;  4HN7 A;  3D31 A;  5LL6 S;  3D3R A;  1NJI C;  5K36 H;  4EVO A;  2Z8L A;  1A0I A;  4R9W A;  1YJ9 A;  1F2L A;  1SNM A;  3TRZ A;  1WCM H;  1IL8 A;  2DNE A;  2R93 B;  1VQ7 A;  1PH7 A;  4L63 B;  3DEO A;  1A2U A;  2ZTD A;  2B2Y C;  2AQ1 B;  5IY0 A;  1B1Z A;  1ML0 D;  4DV1 Q;  4A76 A;  4K6L A;  3BS1 A;  4DR6 Q;  1IBL L;  2VB3 X;  5JVH 3;  4AIM A;  4A75 A;  2B63 G;  1AE2 A;  4PMC A;  2F0M A;  4A3E G;  1LT3 D;  3S2H B;  1FJG L;  2GVA A;  2ASB A;  1BOS A;  3NBH B;  2E2J B;  3K5M A;  5FK9 C;  2L4N A;  2PZW A;  1PH6 A;  3MFG A;  2Q2T A;  2O5I C;  4K5X A;  3OWF A;  3J81 i;  1D5M C;  4IQZ A;  3WOF A;  2VZA A;  2B2U C;  1I4Q A;  1Y8P B;  1SYG A;  4CJ1 B;  4QCL A;  1YNN C;  3G7L A;  3CP0 A;  3T16 A;  3E5S A;  3PO2 H;  1SDF A;  3K58 A;  2L0C A;  4DUZ L;  3T1H Q;  1ICW A;  3EN2 A;  4ZQ3 A;  2HIV A;  2OXP A;  4RCO A;  2NVX B;  5KIX A;  4FF1 A;  1WFQ A;  4GNX C;  3TRE A;  1QVC A;  3W1B A;  4L6T B;  5I4D A;  5C4J H;  2EYJ A;  5A2Q E;  4DV2 L;  4A3C H;  4L5S A;  1B70 B;  4J1M A;  4IUQ A;  3QOJ A;  4DNR B;  4PQX A;  3VYR A;  2ZXP A;  1UEB A;  5C4X G;  1V43 A;  2R93 H;  3MEH A;  4CJ2 C;  3PGZ A;  2IT1 A;  5IT9 c;  1JWM D;  4DR3 L;  1BCP F;  4OO1 I;  3R8B A;  4X65 L;  1M1K C;  1RTO A;  4DR7 Q;  5IT9 E;  4FXK C;  4RGM A;  2XWB B;  1S40 A;  3I55 A;  1F9R A;  2K6A A;  2MQH A;  1GM5 A;  4X3U A;  3CPW A;  2A8V A;  2LXK A;  5EKK A;  1EIH A;  3S2H H;  3MC0 B;  2E2J H;  3DLL A;  4C3I B;  3I56 A;  4BY1 G;  1LT5 D;  5C4H A;  2VUM G;  1AZQ A;  4ZLT F;  1PTO B;  4OWW B;  1BUV T;  3SEB A;  1OXU A;  4ME5 A;  2KCC A;  2J4X A;  3OIP A;  5EJW A;  4A3F G;  1O7I A;  1B3A A;  1TII D;  5IIF A;  4DUY Q;  4JI4 L;  1TVX A;  4EQO A;  4KV6 A;  1SN8 A;  3MXN A;  2NZ1 D;  1GKH A;  2LFN A;  5DLQ E;  1SYE A;  3M4P A;  1V8Q A;  2NVX H;  2XRQ D;  3CC4 A;  3KF6 A;  1BKB A;  4JBW A;  3UDG A;  3V96 A;  1B50 A;  3DWA A;  3SK6 A;  1YIT A;  2G9D A;  3S1N B;  3H15 A;  1KDC A;  4X3K A;  3NP8 A;  1K8G A;  3KDF B;  1BF4 A;  1IKL A;  1HNW L;  4IJL A;  3Q22 A;  3GTO H;  3NWS A;  4GLV B;  4IUR A;  3ITP A;  2V4D A;  3Q6S A;  4LFB L;  4MTK A;  5JPM C;  1LYL A;  2AQ3 B;  2RDF A;  4L5Q A;  4X62 L;  1HR0 L;  4IJH A;  3GTM B;  3MEF A;  1Z6H A;  2F4I A;  4X3S A;  4YCU A;  3RNU A;  4CDF C;  2F4V Q;  1NUC A;  2VL6 A;  2SOB A;  1SND A;  3EIV A;  1MSH A;  1QZG A;  1S5D D;  3D0F A;  2RBM A;  4HID A;  3HOU G;  4K5V A;  4C3I H;  5M5Y B;  1BCP D;  4PNY A;  1NCV A;  1PTO H;  5JEA J;  2F0K A;  3MHB A;  1VQ8 A;  1IL2 A;  4C3J G;  3U58 A;  4NXN Q;  4DR2 Q;  4IN3 A;  3I4O A;  1X3G A;  4NDX A;  3PIP 3;  2E74 C;  2HCC A;  3VR4 A;  1Q1E A;  1SAP A;  2KCT A;  1OO9 B;  2CQA A;  2KCM A;  1XMQ Q;  3GDE A;  1C4Q A;  3K8A A;  1KL9 A;  2Y0S G;  1MHW C;  3IL8 A;  2PQA B;  1E22 A;  2NVT B;  1STB A;  5NUC A;  4JG2 A;  5ISR A;  2CCZ A;  5EGT A;  5BR8 Q;  5E4W C;  3W2D A;  5DM6 3;  1Y69 U;  2VQE Q;  1XNR L;  3DUZ A;  1B4O A;  3BDL A;  4DAY A;  2MHV A;  4QL5 A;  3QIA A;  1R9T B;  3S1N H;  4A3M B;  3NBI A;  1LLR D;  2ZTC A;  4N9P A;  2AWN A;  4BBS B;  1SYC A;  5I2X A;  4P73 A;  2H5X A;  3UDX A;  1K0R A;  3J80 L;  2A19 A;  3M4O B;  2A5H A;  5M5W B;  3S15 B;  3W1G A;  4MIU A;  4LMQ D;  4DA2 A;  4OWX B;  2I5L X;  4JVZ A;  4LFC Q;  1P16 A;  4KD3 A;  2K4K A;  3A7A B;  3GTM H;  2KA7 A;  2Z4I A;  2LSS A;  3OMG A;  1VQK A;  2D0P A;  3SHL A;  4LFA Q;  1ASZ A;  1RL2 A;  1XMO L;  1PFN A;  4ZYS A;  2Z0S A;  2N3S A;  1V9P A;  1YHB A;  2WKD A;  3QR8 A;  2E2H B;  4KY6 A;  5M5Y H;  1K3R A;  5JOB A;  2QDL A;  3ICE A;  1TWA B;  2EQS A;  1C0A A;  4K0K Q;  4KJN A;  2PW7 A;  2R92 G;  4LUV A;  2WAQ E;  4ZAI A;  3FKI B;  1M4V A;  4OIK A;  2AQ2 B;  3KLW A;  4CHT B;  4BA1 I;  2OT2 A;  4BWG B;  4YY3 L;  2B2V C;  4TQU S;  3GTK B;  5F2D A;  2NVT H;  2B2W A;  1D5X C;  2EY5 A;  4RH6 A;  3PUX A;  5EBC A;  3K6O A;  1KDB A;  3WOE A;  3CQZ B;  1R9T H;  1CZG A;  5JJL A;  4A3M H;  1CI3 M;  4ZUI A;  4CDC C;  3HZX A;  4BBS H;  3MXU A;  3TQY A;  3L2P A;  2JA6 G;  1YIJ A;  4A3B B;  4A3L G;  4J8Q A;  4DV1 L;  4HJ7 A;  5M5W H;  2UXD Q;  4XT1 B;  3I73 A;  4DR6 L;  1EEI D;  5FJ8 H;  5GQO A;  4GN3 B;  1KAB A;  2XVS A;  4DAV A;  3RN2 A;  5JJI A;  2EY2 A;  1ESF A;  2CKZ B;  3CRK C;  1FGB D;  5BN4 A;  4HIK A;  1VQ9 A;  1AH9 A;  4H0L C;  1PRT F;  2K03 A;  1QB5 D;  3I8Z A;  2B2Y A;  4BY7 B;  4RGO S;  4Y7N B;  2E2H H;  5LMN W;  2UXC Q;  3TS2 A;  1Y1V B;  1CK1 A;  4V19 0;  3MWY W;  1TWA H;  1Q90 A;  2QIL A;  1WOC A;  3FKI H;  1O78 A;  3V05 A;  4N8F A;  5L37 A;  3C1F A;  4O0A A;  4BXX H;  1BCP C;  3F2U A;  2CWP A;  3I4M B;  1XWE A;  3GTK H;  1NSN S;  1RJT A;  2OEO A;  2JEA I;  2F0N A;  2A6H C;  1LTB D;  5EKI A;  1ET6 A;  5DM7 3;  3AB9 A;  3CQZ H;  2PYK A;  2F0F A;  1YJN A;  4CDD C;  3OWE B;  5D3I B;  2SDF A;  1YEZ A;  3CAM A;  1VQ6 A;  3K5O A;  3NTK A;  4NW2 A;  3S2D B;  2BA1 A;  4I7Z C;  4A3B H;  1HUN A;  3KBG A;  4DR7 L;  4GKJ L;  4GNX A;  4C56 C;  3U9S A;  3NK9 A;  1M90 C;  1TWF B;  3OIQ A;  3O13 A;  2QEX A;  2F0G A;  5BN3 A;  5I6Y A;  4YCW A;  4Q5V A;  1AP0 A;  3U50 C;  1HTL D;  4CDE C;  2PI2 E;  3CCS A;  2B63 B;  3T53 B;  4A3E B;  4HMI A;  5FLM G;  4FF2 A;  3OMC A;  2I5M X;  3H91 A;  2YTY A;  1D5Z C;  1EOV A;  4BY7 H;  4LF4 L;  4Y7N H;  2OCE A;  3E0E A;  3ULJ A;  5EPL A;  5KNB A;  1J6Q A;  1Y1V H;  4IFD G;  1ASY A;  2F0Q A;  5C0X H;  1D6E C;  4HJ8 A;  5K5P A;  1SNQ A;  2EYP A;  1EWI A;  2R7F A;  1IXR A;  3ERQ A;  1I3Q B;  3IRB A;  2YU9 B;  1XPO A;  3CCE A;  3I4M H;  1PRT D;  3HKS A;  5I9P A;  1B44 D;  1F9P A;  1LO5 D;  2NN6 H;  4JI0 Q;  3HOY G;  1AZP A;  5IGG A;  2BE5 D;  3AQQ A;  3HOZ G;  2CW0 C;  1T5E A;  5DEH A;  3LWE A;  1PFB A;  1D7Q A;  1XJV A;  5IYB H;  1H9S B;  4NPS A;  4L8J A;  4FP5 D;  4JI6 Q;  5ELB A;  4RG1 A;  2C9O A;  3U4Z A;  1L1O B;  2GVB A;  4OGQ C;  1GUN A;  1I50 B;  1FL0 A;  5C4X B;  2FHT A;  4YWM A;  4DV4 Q;  2K04 A;  1E3P A;  3NPP A;  3S2D H;  4G7H C;  1I5F A;  5COR A;  5D65 A;  1TWF H;  4G57 A;  2F4V L;  5I2Y A;  3KYH C;  4MTN A;  1BXT A;  3CC2 A;  1Q82 C;  1PTO F;  3FP9 A;  5G3L F;  1KNE A;  5HUR A;  1TY0 A;  2EDG A;  2B63 H;  1RKN A;  3KF8 B;  4A3E H;  1J5E L;  3HG9 A;  4MNO A;  2B2T C;  1OXS C;  1QUQ A;  3TDQ A;  4DNT B;  3ONA B;  4DK3 C;  5CC4 A;  1JCK B;  2VUM B;  4NXN L;  4DR2 L;  2NYZ D;  3NSW A;  2AHO B;  1KTK A;  5J22 A;  1U4P A;  5JJK A;  3CD6 A;  1YZ6 A;  4DV6 Q;  1P8L A;  4X3T A;  1EZ8 A;  1HH2 P;  3BYY B;  2CH4 W;  3A8K E;  4A3F B;  1I3Q H;  5KEE A;  2MNA A;  1GHJ A;  4FF3 A;  2YU9 H;  4GN5 A;  4GOP B;  1N34 Q;  1U4L A;  1Y14 B;  3BYT B;  4UDU C;  5BR8 L;  2WAQ G;  2ID0 A;  2VQE L;  5E1F A;  4C3H G;  2NWG A;  2DJG C;  2RVL A;  4DK6 C;  1B8A A;  5H1S E;  3S1Q B;  1YI2 A;  2QEJ C;  3OYY A;  1OTC A;  3H3V H;  2P5Z X;  1MJE A;  1VQN A;  1V1P A;  4JI1 Q;  3NQT A;  3CU7 A;  1YNX A;  3K7A B;  3K0Y A;  1D8L A;  1Q8I A;  2WB1 E;  1I50 H;  5C4X H;  1S5C D;  4XQJ A;  4KY7 A;  4LFC L;  4A3D G;  1MI2 A;  5FLX L;  1YHQ A;  2H4O A;  5IYC G;  4JI7 Q;  2NZO A;  2WAC A;  1SBB B;  1N32 Q;  3HKZ G;  1B3Q A;  1U9R A;  2UU9 Q;  1H95 A;  3K80 C;  5D14 A;  2A74 C;  1IYJ B;  3J7A V;  2RDH A;  5AFW A;  3DWQ A;  3SK5 A;  4KHP Q;  4XIG S;  2JA8 G;  4C2M B;  3HOU B;  2D2C C;  3T56 B;  1QZH A;  1U4R A;  2F3W A;  4A4I A;  1FYC A;  4I65 A;  4BY1 H;  4GZY C;  2VUM H;  2K5N A;  4K0K L;  1LAC A;  5IE8 A;  1E2Z A;  4C3J B;  4DV7 Q;  1PTO D;  5G3L D;  2WKC A;  1CHQ D;  1RHP A;  2PCF B;  4A3F H;  1LM0 A;  4R4O A;  1WD0 A;  3KUP A;  2WV6 D;  1EIY B;  1WJJ A;  2I46 A;  3R2I A;  4GLA C;  4LW1 A;  3D4W A;  2Y0S B;  2EXZ A;  2GN5 A;  2CH4 A;  2K32 A;  5IGB A;  5E7N A;  1WTR A;  1L2F A;  1A6X A;  1X55 A;  2WP8 J;  4H02 A;  2OQK A;  4Y52 H;  1B7Y B;  3PUZ A;  3S1Q H;  5TSS A;  3M7G A;  3J80 c;  2K05 A;  3HFZ B;  1S3O A;  2QKI C;  2Z1C A;  1AW7 A;  1PRT C;  5LMN Q;  5C3W A;  2V1C C;  3BZD B;  3K7A H;  1VQJ A;  2BE5 C;  3F8T A;  4NKL A;  1HA5 A;  4GKK Q;  2D9U A;  2FXQ A;  1EY6 A;  2B2V A;  1A62 A;  1HFG A;  2UXD L;  1RDP D;  4ZCK A;  2KQ3 A;  3KK7 A;  2PZU A;  2VXW A;  1ENF A;  1MKH A;  3G4S A;  4HED A;  3DM1 A;  1L0Y B;  1VQB A;  3SDZ A;  4DPG A;  2JA5 G;  4C1N I;  1E7Z A;  1TS2 A;  3AFQ A;  4J6H A;  3KJP A;  4XTC S;  1QG7 A;  2EJM A;  4OXP A;  3JAM L;  3OW2 A;  3B6Y A;  5D3D A;  3VYS A;  1A63 A;  4A93 G;  4C2M H;  1H9M A;  3HOU H;  2UXC L;  1SJE D;  3GTP B;  2F1M A;  4XYQ A;  3DXJ C;  5HGQ A;  1K8M A;  4GNX B;  3P75 A;  3BG3 A;  1UWV A;  4APV A;  2E5L Q;  4C3J H;  1FD7 D;  1TWG B;  2D0O A;  2R92 B;  1EWH A;  2Q2U A;  3DMU A;  4AYB E;  3J80 i;  4RHR A;  1TQO A;  2EY6 A;  4DV5 Q;  5CV7 A;  1HNZ Q;  1QVF A;  5C0X J;  4NMZ A;  3TP8 A;  3C1E A;  4DKA C;  3T4A C;  5FO8 B;  3EQL C;  5KRU A;  1KNA A;  4X64 Q;  4P75 A;  1XNQ L;  4R8N A;  3URY A;  3D4R A;  3FPU B;  1NBW A;  1I94 Q;  3D6C A;  1JE5 A;  4RHS A;  1STG A;  2M00 A;  4UP8 A;  4G7Z C;  3GTO B;  2Q2I A;  5FOB B;  1EIG A;  4JV5 L;  1STH A;  3I4N G;  4BA2 I;  2L11 A;  2JA6 B;  4HCE A;  2B3G A;  2CHB D;  3TP6 A;  1BBX C;  2NUC A;  2D62 A;  2K5D A;  2EYO A;  2F0J A;  2E8G A;  1KDA A;  2R61 A;  3PV0 A;  3PO3 G;  4JYA Q;  3WDN A;  3G48 A;  5J1Z A;  2I5H A;  3BDC A;  5LMU Q;  4LF7 Q;  3TP7 A;  5JEA G;  2PPB C;  1X32 A;  2RKS A;  3PIP A;  1PH9 A;  1K3B C;  1CT1 D;  1VQA A;  2A69 D;  2PNR C;  4BBR G;  1LT4 D;  3GTP H;  4R4I A;  4JPB W;  3M85 A;  2VW9 A;  2B29 A;  5IWA Q;  1RIP A;  5A35 A;  3NUC A;  3NEM A;  1TY2 A;  1TWG H;  4Z9C B;  3CW2 C;  2R92 H;  1A3U A;  5C0X I;  3UE1 A;  2OTJ A;  5KGU A;  3S16 B;  2PO4 A;  1JOK A;  3PCO B;  2JP1 A;  3HOW G;  4B3T Q;  2K50 A;  1DOL A;  1KD1 C;  2ICI A;  4U68 A;  3VA5 A;  2NN6 I;  4LF6 L;  3BU2 A;  1K73 C;  4JI6 L;  1X3Q A;  4K8I A;  3BJU A;  3HRZ C;  3QO2 A;  1JR0 D;  3GO5 A;  3FDT A;  2DUD A;  4PZ6 A;  4R4Q A;  5IOD A;  2MJ8 A;  2FJ2 A;  4JBM A;  4JI2 Q;  1X3E A;  4LF5 Q;  2XRS D;  4DV4 L;  1LAB A;  3NE5 B;  4KN4 C;  4JC0 A;  1SLJ A;  2K7V A;  1I6V C;  2JA6 H;  4A3L H;  5HY6 A;  3X3M A;  5GRO A;  1RCV D;  4RKL A;  3RLF A;  4I7A A;  2PI2 A;  4FYD A;  4B3M L;  2WB1 G;  1R4Q B;  4Q0F A;  2E2I B;  4JK1 C;  2NZH A;  3U9O A;  2FFK B;  3HOX G;  1A3T A;  1OXV A;  1PV4 A;  1VS0 A;  3JC6 6;  1HXY D;  1ENC A;  2HD3 A;  2EXD A;  1G6P A;  3I2Z A;  1UNS A;  1OXT A;  1UAP A;  1TXY A;  4CJ0 B;  3SE0 A;  4OHJ A;  1B53 A;  4DNI A;  4DV6 L;  3Q8D A;  1GUW A;  5IGD A;  3E6Z X;  5T1I A;  1C9O A;  1G6Z A;  1EY4 A;  2LXJ A;  4MHE A;  2E2D C;  2TSS A;  4UY8 C;  4ME3 A;  1BR9 A;  2K52 A;  3MXP A;  3F2C A;  1N34 L;  3S16 H;  4HSV A;  2B2T A;  1STY A;  3E3X A;  3HOY B;  2A1A A;  2KEE A;  1D1I A;  3HOZ B;  1EU3 A;  1HZB A;  3QWN A;  1E2V A;  5JPN C;  2L12 A;  4JI1 L;  4GN4 B;  1STE A;  3TN2 A;  1T9H A;  2FIN B;  4HJ5 A;  4DAP A;  1SE4 A;  4E6I A;  2ES2 A;  1LTI D;  1PH1 A;  4EGV A;  1KAW A;  2ZJQ A;  4ZK9 B;  2PW5 A;  2RHS B;  3L9A X;  3H3V I;  1LTL A;  1X6O A;  4JI7 L;  1W3S A;  2EVB A;  4B9X A;  4DV3 Q;  1ZYR D;  5JVG 3;  3PQI A;  3LX0 A;  5JJZ A;  4DR1 Q;  2QDB A;  1PH3 A;  1EOT A;  3MZ5 A;  3TS0 A;  3GQB A;  1PH8 A;  4QB4 A;  1S5B D;  1Q46 A;  4OX9 Q;  2L15 A;  1TR5 A;  1LTG D;  2ICE C;  4J15 A;  2F0W A;  2VNU D;  1GUS A;  1B2T A;  2E2I H;  1W6J A;  4B3S Q;  1J8I A;  1XX8 A;  3QB3 A;  2EY1 A;  1DM0 B;  5FLM H;  3HGB A;  3OOC A;  3RZD B;  2JJQ A;  1DZ1 A;  4FVM A;  2VB2 X;  1EY7 A;  1AN8 A;  1CA5 A;  1EYC A;  2KEN A;  1KRS A;  5E3F A;  1QVG A;  1QOH A;  4IFD H;  4ZKB B;  2OWO A;  2F0T A;  4P71 A;  3L0O A;  2A69 C;  4IPH A;  4EQN A;  4YHH Q;  1JIC A;  4IPC A;  3RLO A;  1MJC A;  4KJO A;  4WRD A;  1QJO A;  4IPG A;  4JOI A;  4O2D A;  3HOY H;  2WAQ B;  2IL8 A;  3CKI B;  1F77 A;  4C3H B;  4XQQ A;  3HOZ H;  4AYB G;  4C1N K;  5AJ3 Q;  4F8M A;  5CMD A;  3M7N A;  1N9W A;  1FNU A;  1EQQ A;  1JC7 A;  4GKK L;  5M5X B;  5GAD C;  3H09 A;  3V2T A;  1VMC A;  5IP9 G;  1VQP A;  3D6W A;  1BVS A;  4RGN A;  4A3D B;  3A7L A;  2F3V A;  1IKM A;  2ZTE A;  4KK7 A;  1IBM Q;  3HKZ B;  2BDN A;  1DOM A;  5E4X A;  1X3F A;  4QUF A;  1BNZ A;  3TEH B;  4X66 Q;  2EYL A;  1K83 B;  3SGI A;  4P2C B;  2K33 A;  1DJR D;  2JA8 B;  1BCP B;  2O5J C;  1A8V A;  1EY0 A;  1YVC A;  3RZD H;  1CKN A;  3TSS A;  1ESR A;  2ZXO A;  4A3K G;  4FF4 A;  1H9R A;  3T1H L;  1XTD A;  4K2L A;  3GTJ B;  4N9T A;  2E5L L;  1F2Y A;  1EZ6 A;  3HOV B;  3T51 B;  3EVQ A;  3CCU A;  1QNK A;  3ERS X;  5C44 G;  2L55 A;  1C8C A;  1JQY D;  1F2M A;  1JB7 A;  4DV5 L;  1KLU D;  2ZM6 Q;  1HNZ L;  4IUV A;  2CWA A;  1DCZ A;  1PYS B;  5CYU A;  5ELD A;  4PMW A;  2EYM A;  4A3I G;  3CMA A;  1VF7 A;  2WII B;  3R93 A;  4X64 L;  4K8J A;  2KOL A;  3HS0 C;  4LUZ A;  3H0G G;  2AUK A;  2AWO A;  1EEF D;  1PYW D;  2K14 A;  2N49 A;  2SNS A;  1WTQ A;  1I94 L;  2IWH A;  4MZ9 A;  4C3H H;  2G5D A;  1BO0 A;  1JWU D;  2KED A;  1NNX A;  3MXN B;  4KLK A;  2N78 A;  2JK8 A;  3Q23 A;  1G29 1;  4WOR A;  1F9Q A;  1O80 A;  3GV3 A;  4OEM B;  3KF6 B;  5M5X H;  4DV2 Q;  1SFO B;  4NP5 A;  1QIL A;  3NBH A;  1WVL A;  5C3E G;  1STA A;  3ZYY X;  3JAM c;  1DXM A;  4A3D H;  1Q7Y C;  1VQG A;  3R2T A;  5IYC H;  1SEB D;  5ELC A;  3NQI A;  3J7A 5;  1IYV A;  2Z6B A;  5C5L A;  2JA5 B;  2WIN B;  3PMF A;  5LMU L;  2PMZ B;  2F0E A;  4JI5 Q;  2LMC B;  1PZK D;  1K83 H;  2MP1 A;  4A93 B;  2JA8 H;  2PNH A;  3QOL A;  1MIU A;  1QE6 A;  5IWA L;  3VR3 A;  4DUY L;  1SMY D;  3RLN A;  1VQF A;  3GTJ H;  1FR3 A;  1JB3 A;  3HOV H;  2NVQ B;  1GJX A;  1HRJ A;  2C5C A;  1DOK A;  3GP7 A;  4FXG C;  3TP5 A;  4LAA A;  3L3O C;  2EE1 A;  2E76 C;  4NB3 A;  4B9W A;  1JT8 A;  1VQM A;  3RZO B;  4IO9 A;  4WJ4 A;  2F0O A;  1KIX A;  1EWC A;  2EOT A;  2F0H A;  1KHI A;  5CV5 A;  2EZV A;  1J9O A;  4HSP A;  3ER0 A;  3PF4 A;  1HA6 A;  2XSC A;  2OF1 A;  1EQR A;  2JE6 I;  1PHJ A;  1STN A;  1RD9 D;  3JAM i;  4ODG A;  4HJA A;  1XTC D;  3FEW X;  4A3G G;  3QG1 A;  4K14 A;  4JI2 L;  1HZA A;  4LF5 L;  1LTR D;  4KHV A;  4JI3 Q;  1CM9 A;  1VQI A;  2IX1 A;  1U0L A;  1SFO H;  5M9O A;  1EQT A;  1YHA A;  4FNF A;  4POG A;  3I4N B;  1TWC B;  4WJ3 M;  4DAY B;  5CV6 A;  4QQB X;  2VS1 A;  3A5U A;  1HNW Q;  1VQH A;  4DGZ A;  4KKU A;  4QIW E;  2SNM A;  3NHH A;  1HZC A;  2EIF A;  2XIW A;  2JA5 H;  1Q81 C;  3NXW A;  3GTL B;  3PO3 B;  4AH6 A;  1SRU A;  5EKL A;  4X62 Q;  1PYB A;  4BY1 B;  1S5E D;  2RHQ B;  1NR2 A;  1PZJ D;  1Y1W G;  4A93 H;  2A68 D;  2ENB A;  3ZJY C;  1EL0 A;  1A2T A;  1CQV A;  2XNA C;  4O42 A;  4BBR B;  3PSI A;  1EFW A;  1XMQ L;  5M3M G;  1H9K A;  2M2L A;  2NVQ H;  4DAM A;  5IYD G;  3LGJ A;  1WI5 A;  1UE5 A;  3CPF A;  2HCI A;  2YYZ A;  5C4Z A;  1AFP A;  2N55 A;  4R4C A;  4GLX A;  5EBD A;  3TME A;  3K59 A;  1CTM A;  4A3J G;  2EPB A;  3RZO H;  4KKS A;  4XYO A;  4IFD J;  1WTX A;  1RF2 D;  3HOW B;  4NXM Q;  1N33 Q;  1JMC A;  3J7A F;  1LTA D;  1I4H A;  2LY7 A;  4CKE A;  4B3R Q;  3OPO A;  3RMH A;  1CKO A;  2MFI A;  1Q12 A;  1F2Z A;  4OO1 G;  1NMF A;  3DHQ A;  4HJ9 A;  1WTO A;  4M1U B;  4HIO A;  3PIO A;  3OTO Q;  4DV3 L;  4LFA L;  1HFN A;  3I4N H;  3BVM A;  2UUA Q;  2G9H D;  1SNO A;  1TWC H;  3AU7 A;  4ULL A;  4OX9 L;  1IHZ A;  3EBE A;  5LL6 X;  1I4P A;  3SR1 A;  3M3Y B;  1WTW A;  3CCV A;  2WB1 B;  4JOI C;  3GTL H;  1IW7 D;  5CR3 A;  4QGU A;  1ET9 A;  3PO3 H;  3BVZ A;  2RCF A;  1H9J A;  5M3F G;  1S5F D;  1EYA A;  3HOX B;  1SR3 A;  3MFY A;  2K5Q A;  5JEA H;  4KD4 A;  1Q3L A;  2AUJ D;  4ID6 A;  1XMO Q;  5C3X A;  1FNV A;  1F9S A;  1PFS A;  2MO1 A;  2PQA A;  5FKA C;  4BBR H;  2RF4 A;  2L5T A;  1HQR D;  2M9V A;  1U5K A;  3GTG B;  5IGF A;  1GUO A;  4YHH L;  3KFU A;  1JOR A;  5IGE A;  2HIX A;  4KKT A;  4EQ5 A;  1I6H B;  3CCM A;  1N36 Q;  1PRT B;  4X6A H;  3X3N A;  4IFD I;  3HEJ A;  1SMY C;  1GHK A;  1YNJ D;  4CBV A;  5EPJ A;  2HT1 A;  3MXG A;  2KEC A;  1D2B A;  3K57 A;  3HOW H;  5AJ3 L;  1KXL A;  1L0X B;  2MGS A;  5CGK A;  3J80 E;  1OXX K;  1QNU A;  2IX3 A;  3NWT A;  3IFD A;  1SSO A;  3EFX D;  3CC7 A;  2Q8I B;  2VQF Q;  3GV6 A;  2N8N A;  1O7L A;  1W2B A;  4QJF A;  4TVA B;  1SJH D;  2F3I A;  1TKW B;  3CF5 A;  3D4D A;  2JA7 G;  1EU4 A;  4IPD A;  1ICF B;  2CFM A;  2EYH A;  3DWP A;  4ZRZ A;  1PZI D;  1EFI D;  2F0D A;  1BBW A;  3A8J E;  1IBM L;  4YCV A;  3I7F A;  3PIO 3;  1LV9 A;  2D5D A;  3CME A;  4X66 L;  1K8O A;  5T1G A;  5IOC A;  3M3Y H;  4HIM A;  4BS9 A;  1PDQ A;  2UXB Q;  5CV8 A;  3S14 B;  1UE6 A;  1PLF A;  1HNX Q;  3HOX H;  3NTI A;  1TWH B;  3S24 A;  1R4P B;  4RWS C;  3CCJ A;  2B8F A;  1SXT A;  3L7Z C;  5DNF A;  4LF9 Q;  1SE3 A;  2DGY A;  2HDL A;  3PF5 A;  3GTG H;  2ZM6 L;  3R3O A;  1CFM A;  1SNP A;  5GAE C;  1Z7T A;  2A68 C;  1I6H H;  4PZ8 A;  3I90 A;  4TRD A;  2A73 B;  2IHF A;  1HHV A;  2N88 A;  2OQ0 A;  3GTQ B;  4H7B A;  1E1O A;  1VQE A;  5I9O A;  2R7Z G;  2CQO A;  2YTV A;  1YBY A;  1ZKO A;  3MA2 B;  1VQ4 A;  1NY4 A;  4AQY Q;  1Z47 A;  4AYB B;  3FHW A;  2F03 A;  1VCI A;  5GAH C;  3RN5 A;  1II3 A;  4IOC A;  3DM3 A;  1PH4 A;  3CRL C;  3P7J A;  2K5W A;  3OW7 A;  3CCR A;  1DON A;  1DD2 A;  3AFP A;  3SK4 A;  3UE0 A;  3G6J B;  3T1Y Q;  1SE2 A;  3S1M B;  4GKJ Q;  2HDM A;  4ILW A;  4JI5 L;  3ULP A;  3E9H A;  3OHX C;  1KAA A;  3AYH B;  4ZUJ A;  5BN5 A;  1GUT A;  3DEP A;  3S14 H;  4RKB A;  3U4V A;  4DV0 Q;  1PFM A;  1TS3 A;  1TWH H;  2KCN A;  5EPK A;  2L9H A;  2YTX A;  4A3K B;  4GS3 A;  4DXF A;  1IW7 C;  2EJF C;  4F88 A;  5ELE A;  2I07 B;  5IP7 G;  3WWV A;  2RCN A;  1G2S A;  2HHH Q;  4JI0 L;  4LF4 Q;  1SE8 A;  2DNC A;  5EQ0 A;  5C44 B;  1QUQ B;  1XYI A;  3I4L A;  3FPP A;  2L1B A;  1PTO C;  4A3I B;  3P20 A;  2Z4H A;  1VQL A;  4UP9 A;  1A3V A;  3EJI A;  4IUN A;  1B9N A;  3GTQ H;  3HP3 A;  3J7Z C;  5K36 G;  4DXG A;  1PH2 A;  3H0G B;  5KYL A;  2F0S A;  2A6E D;  1JWS D;  2BH8 A;  2Z9H A;  3VA7 A;  4RMF A;  2RQX A;  2FMC A;  1YNJ C;  1WCM G;  3KLR A;  4FO2 A;  4JI3 L;  2LS0 1;  4LWC A;  1CSQ A;  3KLS A;  2KBN A;  4KN7 C;  1AE3 A;  3S9W A;  2RDG A;  3I3C A;  5IP9 H;  5C3E B;  1HPC A;  2JXM B;  3A56 A;  1E1T A;  2R7D A;  1FNW A;  1V1P B;  1TS5 A;  3H94 A;  2O2L D;  1GO3 E;  3F2B A;  3S1M H;  1EUJ A;  2CVR A;  1NAP A;  2UUB Q;  3H6M A;  3LWU A;  4IZ8 A;  3FMC A;  2KVM A;  1JJ2 A;  4F87 A;  4DN4 M;  5CBE E;  3AEV A;  4DFA A;  3NEL A;  1J5E Q;  4KHZ A;  2JYO A;  3PUV A;  4A3K H;  4RA8 A;  3PO2 G;  1WTP A;  1ILQ A;  4UAI A;  4XT3 B;  4CKB A;  2NBF A;  3OSO A;  1FVI A;  2KUM A;  1H9S A;  4G4K A;  3BZK A;  4LK1 C;  5FO7 B;  5C44 H;  2BDO A;  2A6H D;  1BQQ T;  2I0Q A;  4POF A;  2GA4 B;  1ILP A;  3PUY A;  3VR5 A;  1HR0 W;  1PMR A;  4PG3 A;  1L1O A;  4KY5 A;  1PXU A;  4A3I H;  4NXM L;  4L5R C;  1N33 L;  1JJG A;  1SNC A;  3MAQ A;  4A3C G;  4DR4 Q;  3I70 A;  3H0G H;  4B3R L;  1IYU A;  1QCB D;  4IUT A;  3J81 L;  3J7Y W;  2KHJ A;  3W5O A;  3CCL A;  1Z9F A;  1G8Z D;  2E75 C;  3CCQ A;  4A3G B;  2R93 G;  4DF7 A;  1TT2 A;  1GOZ A;  3OTO L;  1N32 L;  1BBU A;  2EYF A;  3KF8 A;  2UU9 L;  2UUA L;  4O1N A;  4ALP A;  1ZXT A;  2Z6K A;  4WJW A;  2ZJR A;  3RR5 A;  4LF8 Q;  3E0J A;  3UI2 A;  3UDF A;  5C3E H;  2Q8T A;  4KHP L;  4HR7 B;  4RAU C;  3PUW A;  2ATW A;  4DR5 Q;  5GAG C;  1VQO A;  3Q24 A;  2QF7 A;  1G91 A;  1HZ9 A;  4PV1 C;  1E0B A;  2K28 A;  2BCO A;  2Q2H A;  3K81 C;  2IY5 B;  1LT6 D;  1E24 A;  3N6R A;  4S3S A;  4DV7 L;  1YJW A;  1Y1W B;  4GOP A;  2UUC Q;  1XXG A;  1LTT D;  1IBK Q;  2WFW A;  1KRT A;  5M3M B;  1UE7 A;  2SEB D;  2AMC B;  2DJF C;  3G6E A;  2PQE A;  2R6G A;  1E2W A;  4DK0 A;  3QJY A;  1N36 L;  1WYD A;  3M4Q A;  5JAV A;  1SYB A;  1M8A A;  2NTT A;  2CW0 D;  1Y8O B;  2XN9 C;  5ELO A;  4CKC A;  1PH5 A;  1S72 A;  3A74 A;  4A3J B;  3BZC A;  4IOA A;  5LMN L;  1VQ5 A;  4JI8 Q;  5FLX c;  2IX0 A;  1HJP A;  3W3A A;  1PVO A;  3IKJ A;  4OL7 A;  2K1B A;  4EX5 A;  3CHB D;  2VQF L;  3EA6 A;  2IHE A;  1VQC A;  2R3Z A;  5FLX E;  2JSO A;  1A15 A;  1O7Y A;  3NEN A;  5A2Q L;  1I4R A;  4A3G H;  2RSO A;  1FGU A;  2A6E C;  1KQS A;  3E9I A;  1NE3 A;  3HKZ E;  4TKO B;  4JBJ A;  3N52 A;  5KYI A;  1MGS A;  1CZW A;  1Q8K A;  3M4O H;  5FO9 B;  3S15 H;  1EYD A;  3RD4 A;  1IBL Q;  1NMG A;  5IT9 L;  5EAY A;  2UXB L;  3F1Z A;  5J3B A;  4PMB A;  1JJC B;  2ZJP A;  1HNX L;  1FJG Q;  4C3I G;  2X69 A;  5M3F B;  4RCN A;  4R8I A;  1EY8 A;  4OWT B;  2TMP A;  4RGT A;  1S4Z A;  1Y1W H;  1G51 A;  4LF9 L;  2RSN A;  1GXD C;  1JE4 A;  1GD7 A;  3VDY A;  3GD7 A;  1T5X D;  1MBY A;  5C6A A;  1HCZ A;  1X9N A;  5M3M H;  1K9M C;  5J39 A;  2XTI A;  5IYD H;  1RTN A;  4DUZ Q;  5CBA E;  2OTL A;  5DAU A;  3I72 A;  4UP7 A;  4EQP A;  1Y8N B;  2IJ0 A;  4HMJ A;  4LUO A;  3TBI B;  2XGT A;  3SVM A;  4A3J H;  4FXD A;  1SYF A;  2QW7 A;  1SYD A;  4UHV A;  4AQY L;  2K75 A;  1PA6 A;  3Q0A A;  3FVQ A;  1GVP A;  1VMP A;  1TU2 B;  1MSG A;  3S1R B;  2B2U A;  2HUG A;  2XWJ B;  3ERO A;  1XNQ Q;  3CXC A;  4FDB A;  4XDX A;  1K0S A;  2AKW B;  4OO1 H;  1ENA A;  1KLG D;  4LJZ C;  1X56 A;  4UPA A;  2KHI A;  3KLS X;  2JA7 B;  3ND9 A;  3NTH A;  4P74 A;  3VR2 A;  4JYA L;  3JAM E;  4U67 3;  4DR3 Q;  3T1Y L;  4RFB A;  2PMZ E;  1B9M A;  4X65 Q;  4LF7 L;  4JV5 Q;  4TSS A;  2MPM A;  2F0L A;  1ZYR C;  1WTH A;  3C3L A;  2PZT A;  3K5L A;  1JOO A;  4XXE A;  4CGY B;  4HCS A;  1C48 A;  3STB D;  3G71 A;  1U4M A;  4YWL A;  4DU9 A;  3A0J A;  2O4X A;  4H44 C;  2J0T D;  3K0X A;  4DV0 L;  4QY7 A;  5M3F H;  2DN8 A;  3FRP B;  1HQM C;  1EY9 A;  1HTP A;  1EQV A;  1NTG A;  1BDO A;  4OON A;  1XPR A;  2F52 A;  4F7X A;  3IAY A;  2HHH L; 
#chains in the Genus database with same CATH homology
 1HUM A;  3LNN A;  3I91 A;  2ZT9 C;  3VYT A;  5HGT A;  4K5W A;  1I4X A;  4KTA A;  3RUZ A;  3SK8 A;  2BA0 A;  3MTS A;  2HQE A;  5CV9 A;  4K2K A;  1DYQ A;  1CA6 A;  3IFT A;  2KHS A;  2R7Z B;  2J7Z A;  1VF5 C;  4XQN A;  3T13 A;  4ABN A;  5LHY 1;  1AEX A;  1ROD A;  4B08 A;  4IAL A;  1V1O A;  4OIJ A;  2KJX A;  4WFN 3;  3S17 B;  3D8G A;  3K5N A;  5I6W A;  4V0B A;  3H3V C;  3A54 A;  1X3P A;  2DY8 A;  4QMG A;  3TZD A;  2ZXR A;  2JEB I;  1NR4 A;  3TZU A;  3A8I E;  1GUG A;  4G7O C;  1YNN D;  3VR6 A;  2X6L A;  3KBX A;  1WTV A;  4YIJ A;  3AMU A;  4QIW B;  4DK1 A;  1W6K A;  2FMM A;  1MD2 D;  5IGC A;  2NVY B;  2B39 A;  1EY5 A;  3C46 A;  2F0V A;  2BOS A;  2LKV A;  1JOQ A;  4MN3 A;  5C5M A;  1CQF A;  3MVV A;  3BDO A;  2NB0 A;  1CHP D;  1TS4 A;  1I4G A;  1WCM B;  2F0U A;  1ONL A;  4HAE A;  2F0I A;  3ND8 A;  4HTH A;  1VDZ A;  4H13 C;  3P1H A;  1UEA B;  5ELF A;  1UUP A;  2Q8R E;  3C2P A;  3A55 A;  2F0P A;  4QUC A;  2IW3 A;  5KND A;  1LTS D;  3BVG A;  4QF4 A;  2QCP X;  4IUP A;  2DY7 A;  1D1K A;  5CV4 A;  2B2W C;  5KNC A;  2B8G A;  1ZEQ X;  5C0X G;  2NTS A;  5COY A;  1G2T A;  3PO2 B;  2MUY A;  3M4Y A;  4KI0 A;  1Q1B A;  4IUU A;  1O7Z A;  2IPK D;  1QWY A;  2NN6 G;  4K6D A;  1WD1 A;  4M8A A;  2RA4 A;  2K01 A;  2X6G A;  3J81 E;  2H1E A;  3VYU A;  3SXH A;  4KMU C;  4ZKC B;  2EJG C;  5C4J B;  4HN7 A;  3D31 A;  5LL6 S;  3D3R A;  5K36 H;  4EVO A;  2Z8L A;  4R9W A;  1F2L A;  1SNM A;  1IL8 A;  2DNE A;  2R93 B;  4L63 B;  3DEO A;  1A2U A;  2B2Y C;  2AQ1 B;  1B1Z A;  1ML0 D;  4K6L A;  3BS1 A;  2VB3 X;  5JVH 3;  4PMC A;  2F0M A;  1LT3 D;  3S2H B;  1BOS A;  2E2J B;  3K5M A;  5FK9 C;  2L4N A;  2PZW A;  3MFG A;  2O5I C;  4K5X A;  3OWF A;  1D5M C;  4IQZ A;  3WOF A;  2B2U C;  1I4Q A;  1Y8P B;  1SYG A;  4CJ1 B;  4QCL A;  1YNN C;  3G7L A;  3T16 A;  3E5S A;  1SDF A;  3K58 A;  2L0C A;  1ICW A;  4ZQ3 A;  2OXP A;  4RCO A;  2NVX B;  5KIX A;  4FF1 A;  4L6T B;  5I4D A;  2EYJ A;  5A2Q E;  4J1M A;  4IUQ A;  3QOJ A;  4DNR B;  4PQX A;  3VYR A;  2ZXP A;  1V43 A;  3MEH A;  4CJ2 C;  2IT1 A;  1JWM D;  1BCP F;  4OO1 I;  3R8B A;  1RTO A;  5IT9 E;  4FXK C;  4RGM A;  2XWB B;  1F9R A;  2K6A A;  4X3U A;  5EKK A;  1EIH A;  3MC0 B;  4C3I B;  1LT5 D;  5C4H A;  1AZQ A;  4ZLT F;  1PTO B;  1BUV T;  3SEB A;  1OXU A;  4ME5 A;  2KCC A;  2J4X A;  3OIP A;  5EJW A;  1B3A A;  1TII D;  5IIF A;  1TVX A;  4EQO A;  4KV6 A;  3MXN A;  2NZ1 D;  2LFN A;  1SYE A;  1V8Q A;  2XRQ D;  4JBW A;  3V96 A;  1B50 A;  3DWA A;  3SK6 A;  2G9D A;  3S1N B;  1KDC A;  4X3K A;  3NP8 A;  1BF4 A;  1IKL A;  3Q22 A;  3NWS A;  4IUR A;  3ITP A;  2V4D A;  3Q6S A;  5JPM C;  2AQ3 B;  2RDF A;  3GTM B;  1Z6H A;  2F4I A;  4X3S A;  1NUC A;  2SOB A;  1SND A;  1MSH A;  1S5D D;  2RBM A;  4K5V A;  5M5Y B;  1BCP D;  4PNY A;  1NCV A;  1PTO H;  5JEA J;  2F0K A;  3MHB A;  4C3J G;  4IN3 A;  4NDX A;  3PIP 3;  2E74 C;  2HCC A;  3VR4 A;  1Q1E A;  1SAP A;  1OO9 B;  2CQA A;  1C4Q A;  3IL8 A;  2NVT B;  1STB A;  5NUC A;  5ISR A;  5EGT A;  5E4W C;  3W2D A;  5DM6 3;  1Y69 U;  3DUZ A;  1B4O A;  3BDL A;  4DAY A;  2MHV A;  3QIA A;  1R9T B;  4A3M B;  3NBI A;  1LLR D;  4N9P A;  2AWN A;  4BBS B;  1SYC A;  5I2X A;  3J80 L;  3M4O B;  2A5H A;  5M5W B;  3S15 B;  4MIU A;  4LMQ D;  4DA2 A;  4KD3 A;  3A7A B;  2KA7 A;  2Z4I A;  3OMG A;  3SHL A;  1PFN A;  4ZYS A;  2WKD A;  2E2H B;  4KY6 A;  5JOB A;  1TWA B;  4KJN A;  2PW7 A;  4ZAI A;  3FKI B;  1M4V A;  4OIK A;  2AQ2 B;  4CHT B;  4BA1 I;  2OT2 A;  4BWG B;  2B2V C;  4TQU S;  3GTK B;  5F2D A;  2B2W A;  1D5X C;  2EY5 A;  4RH6 A;  3PUX A;  5EBC A;  3K6O A;  1KDB A;  3WOE A;  3CQZ B;  1CZG A;  1CI3 M;  4ZUI A;  3HZX A;  3MXU A;  4A3B B;  4J8Q A;  4XT1 B;  3I73 A;  1EEI D;  1KAB A;  2XVS A;  4DAV A;  2EY2 A;  1ESF A;  3CRK C;  1FGB D;  5BN4 A;  4H0L C;  1PRT F;  2K03 A;  1QB5 D;  3I8Z A;  2B2Y A;  4BY7 B;  4RGO S;  4Y7N B;  1Y1V B;  1CK1 A;  4V19 0;  3MWY W;  1Q90 A;  2QIL A;  1O78 A;  3V05 A;  3C1F A;  1BCP C;  3F2U A;  3I4M B;  1XWE A;  1NSN S;  1RJT A;  2OEO A;  2JEA I;  2F0N A;  2A6H C;  1LTB D;  5EKI A;  1ET6 A;  5DM7 3;  3AB9 A;  2PYK A;  2F0F A;  3OWE B;  5D3I B;  2SDF A;  3K5O A;  3NTK A;  4NW2 A;  3S2D B;  2BA1 A;  4I7Z C;  1HUN A;  3KBG A;  4C56 C;  3U9S A;  3NK9 A;  1TWF B;  3OIQ A;  3O13 A;  1AP0 A;  2F0G A;  5BN3 A;  5I6Y A;  4Q5V A;  1HTL D;  2B63 B;  3T53 B;  4A3E B;  4HMI A;  4FF2 A;  3OMC A;  3H91 A;  1D5Z C;  5EPL A;  5KNB A;  4IFD G;  2F0Q A;  5C0X H;  1D6E C;  5K5P A;  1SNQ A;  2EYP A;  3ERQ A;  1I3Q B;  2YU9 B;  1PRT D;  5I9P A;  1B44 D;  1F9P A;  1LO5 D;  2NN6 H;  1AZP A;  5IGG A;  2BE5 D;  2CW0 C;  1T5E A;  5DEH A;  3LWE A;  1PFB A;  1H9S B;  4L8J A;  4FP5 D;  5ELB A;  2C9O A;  4OGQ C;  1GUN A;  1I50 B;  5C4X B;  2FHT A;  2K04 A;  3NPP A;  4G7H C;  5COR A;  5D65 A;  4G57 A;  5I2Y A;  1BXT A;  1PTO F;  5G3L F;  1KNE A;  5HUR A;  1TY0 A;  2EDG A;  1RKN A;  3HG9 A;  2B2T C;  1OXS C;  3TDQ A;  4DNT B;  3ONA B;  5CC4 A;  1JCK B;  2VUM B;  2NYZ D;  3NSW A;  1KTK A;  5J22 A;  1U4P A;  4X3T A;  1EZ8 A;  3BYY B;  4A3F B;  3A8K E;  5KEE A;  1GHJ A;  4FF3 A;  1U4L A;  3BYT B;  4UDU C;  2ID0 A;  5E1F A;  4C3H G;  2NWG A;  2RVL A;  3S1Q B;  2QEJ C;  1V1P A;  3NQT A;  3CU7 A;  3K7A B;  3K0Y A;  1Q8I A;  1S5C D;  4XQJ A;  4KY7 A;  1MI2 A;  5FLX L;  2H4O A;  2WAC A;  1SBB B;  1U9R A;  5D14 A;  2A74 C;  3J7A V;  2RDH A;  5AFW A;  3DWQ A;  3SK5 A;  4XIG S;  4C2M B;  3HOU B;  2D2C C;  3T56 B;  1U4R A;  2F3W A;  1FYC A;  4I65 A;  4GZY C;  1LAC A;  1E2Z A;  4C3J B;  1PTO D;  5G3L D;  2WKC A;  1CHQ D;  1RHP A;  2PCF B;  1WD0 A;  3KUP A;  2WV6 D;  2I46 A;  3R2I A;  3D4W A;  2Y0S B;  2EXZ A;  2K32 A;  5IGB A;  1WTR A;  1A6X A;  2WP8 J;  3PUZ A;  5TSS A;  3M7G A;  2K05 A;  2QKI C;  2Z1C A;  1AW7 A;  1PRT C;  5C3W A;  3BZD B;  2BE5 C;  4NKL A;  1HA5 A;  2D9U A;  1EY6 A;  2B2V A;  1HFG A;  1RDP D;  2KQ3 A;  3KK7 A;  2PZU A;  2VXW A;  1ENF A;  4HED A;  3DM1 A;  1L0Y B;  3SDZ A;  4C1N I;  1TS2 A;  4J6H A;  4XTC S;  1QG7 A;  2EJM A;  3JAM L;  5D3D A;  3VYS A;  1H9M A;  1SJE D;  3GTP B;  2F1M A;  4XYQ A;  3DXJ C;  1K8M A;  3P75 A;  3BG3 A;  1FD7 D;  1TWG B;  2R92 B;  1EWH A;  3DMU A;  4RHR A;  1TQO A;  2EY6 A;  5CV7 A;  5C0X J;  4NMZ A;  3TP8 A;  3C1E A;  5FO8 B;  3T4A C;  3EQL C;  5KRU A;  1KNA A;  4R8N A;  3URY A;  3D4R A;  3FPU B;  3D6C A;  4RHS A;  1STG A;  2M00 A;  4G7Z C;  3GTO B;  5FOB B;  1EIG A;  1STH A;  4BA2 I;  2L11 A;  2JA6 B;  4HCE A;  2CHB D;  3TP6 A;  1BBX C;  2NUC A;  2D62 A;  2K5D A;  2EYO A;  2F0J A;  2R61 A;  1KDA A;  3PV0 A;  3WDN A;  5J1Z A;  3BDC A;  3TP7 A;  5JEA G;  2PPB C;  1X32 A;  2RKS A;  1CT1 D;  2A69 D;  2PNR C;  1LT4 D;  3M85 A;  5A35 A;  3NUC A;  1TY2 A;  4Z9C B;  1A3U A;  5C0X I;  5KGU A;  3S16 B;  2PO4 A;  1JOK A;  2JP1 A;  1DOL A;  2ICI A;  4U68 A;  3VA5 A;  2NN6 I;  1X3Q A;  4K8I A;  3HRZ C;  3QO2 A;  1JR0 D;  3GO5 A;  3FDT A;  5IOD A;  2MJ8 A;  2FJ2 A;  2XRS D;  1LAB A;  3NE5 B;  4KN4 C;  2K7V A;  1I6V C;  3X3M A;  1RCV D;  4RKL A;  3RLF A;  4FYD A;  1R4Q B;  4Q0F A;  2E2I B;  4JK1 C;  3U9O A;  2FFK B;  1A3T A;  1OXV A;  1HXY D;  1ENC A;  1UNS A;  1OXT A;  1UAP A;  4CJ0 B;  3SE0 A;  4OHJ A;  1B53 A;  1GUW A;  5IGD A;  3E6Z X;  5T1I A;  1G6Z A;  1EY4 A;  4MHE A;  2E2D C;  2TSS A;  1BR9 A;  3MXP A;  4HSV A;  2B2T A;  1STY A;  3HOY B;  2KEE A;  1D1I A;  3HOZ B;  1EU3 A;  3QWN A;  1E2V A;  5JPN C;  2L12 A;  1STE A;  3TN2 A;  2FIN B;  4DAP A;  1SE4 A;  4E6I A;  1LTI D;  4EGV A;  4ZK9 B;  2PW5 A;  3L9A X;  2EVB A;  4B9X A;  1ZYR D;  5JVG 3;  3LX0 A;  5JJZ A;  2QDB A;  1EOT A;  3MZ5 A;  3GQB A;  4QB4 A;  1S5B D;  1TR5 A;  1LTG D;  2ICE C;  2F0W A;  2VNU D;  1GUS A;  1B2T A;  1W6J A;  1J8I A;  1XX8 A;  3QB3 A;  2EY1 A;  1DM0 B;  3HGB A;  3OOC A;  3RZD B;  1DZ1 A;  4FVM A;  2VB2 X;  1EY7 A;  1AN8 A;  1CA5 A;  1EYC A;  5E3F A;  1QOH A;  4IFD H;  4ZKB B;  2F0T A;  2A69 C;  4EQN A;  1JIC A;  4KJO A;  4WRD A;  1QJO A;  2WAQ B;  2IL8 A;  3CKI B;  1F77 A;  4C3H B;  4XQQ A;  4C1N K;  4F8M A;  5CMD A;  3M7N A;  1FNU A;  1JC7 A;  5M5X B;  3H09 A;  3V2T A;  1VMC A;  3D6W A;  4RGN A;  4A3D B;  3A7L A;  2F3V A;  1IKM A;  4KK7 A;  3HKZ B;  2BDN A;  1DOM A;  5E4X A;  4QUF A;  1BNZ A;  2EYL A;  1K83 B;  4P2C B;  2K33 A;  1DJR D;  2JA8 B;  1BCP B;  2O5J C;  1EY0 A;  3TSS A;  1ESR A;  2ZXO A;  4FF4 A;  1H9R A;  4K2L A;  3GTJ B;  4N9T A;  1F2Y A;  1EZ6 A;  3HOV B;  3T51 B;  3EVQ A;  1QNK A;  2L55 A;  1C8C A;  1JQY D;  1F2M A;  1KLU D;  4IUV A;  1DCZ A;  5CYU A;  5ELD A;  4PMW A;  2EYM A;  1VF7 A;  2WII B;  3R93 A;  4K8J A;  2KOL A;  3HS0 C;  2AUK A;  2AWO A;  1EEF D;  1PYW D;  2SNS A;  1WTQ A;  2IWH A;  1BO0 A;  1JWU D;  2KED A;  3Q23 A;  1G29 1;  4WOR A;  1F9Q A;  1O80 A;  3GV3 A;  1SFO B;  4NP5 A;  1QIL A;  3NBH A;  1WVL A;  1STA A;  3ZYY X;  1DXM A;  3R2T A;  1SEB D;  5ELC A;  3NQI A;  1IYV A;  5C5L A;  2JA5 B;  2WIN B;  3PMF A;  2PMZ B;  2F0E A;  2LMC B;  1PZK D;  2MP1 A;  4A93 B;  3QOL A;  1QE6 A;  3VR3 A;  1SMY D;  1FR3 A;  1JB3 A;  2NVQ B;  1GJX A;  1HRJ A;  2C5C A;  1DOK A;  3GP7 A;  4FXG C;  3TP5 A;  4LAA A;  3L3O C;  2EE1 A;  2E76 C;  4B9W A;  3RZO B;  2F0O A;  1EWC A;  2EOT A;  2F0H A;  5CV5 A;  2EZV A;  1J9O A;  4HSP A;  1HA6 A;  2XSC A;  2OF1 A;  2JE6 I;  1STN A;  1RD9 D;  4ODG A;  1XTC D;  3FEW X;  3QG1 A;  4K14 A;  1LTR D;  4KHV A;  1CM9 A;  2IX1 A;  5M9O A;  1EQT A;  4FNF A;  3I4N B;  1TWC B;  5CV6 A;  4DGZ A;  4KKU A;  2SNM A;  3NHH A;  2XIW A;  3GTL B;  3NXW A;  3PO3 B;  5EKL A;  4BY1 B;  1S5E D;  1NR2 A;  1PZJ D;  2A68 D;  2ENB A;  1EL0 A;  1A2T A;  1CQV A;  2XNA C;  4O42 A;  4BBR B;  1H9K A;  2M2L A;  2HCI A;  2YYZ A;  5C4Z A;  1AFP A;  2N55 A;  5EBD A;  3TME A;  3K59 A;  1CTM A;  2EPB A;  4KKS A;  4XYO A;  4IFD J;  1WTX A;  1RF2 D;  3HOW B;  3J7A F;  1LTA D;  1I4H A;  2LY7 A;  4CKE A;  3OPO A;  3RMH A;  1Q12 A;  1F2Z A;  4OO1 G;  3DHQ A;  1WTO A;  4M1U B;  1HFN A;  3BVM A;  2G9H D;  1SNO A;  3AU7 A;  4ULL A;  1IHZ A;  5LL6 X;  1I4P A;  3SR1 A;  3M3Y B;  1WTW A;  2WB1 B;  1IW7 D;  5CR3 A;  1ET9 A;  3BVZ A;  1H9J A;  1S5F D;  1EYA A;  3HOX B;  3MFY A;  2K5Q A;  5JEA H;  4KD4 A;  1Q3L A;  2AUJ D;  4ID6 A;  5C3X A;  1FNV A;  1F9S A;  5FKA C;  2L5T A;  1HQR D;  2M9V A;  3GTG B;  5IGF A;  1GUO A;  1JOR A;  5IGE A;  4KKT A;  1I6H B;  1PRT B;  3X3N A;  4IFD I;  3HEJ A;  1SMY C;  1GHK A;  1YNJ D;  4CBV A;  5EPJ A;  3MXG A;  2KEC A;  1D2B A;  3K57 A;  1L0X B;  2MGS A;  5CGK A;  3J80 E;  1OXX K;  1QNU A;  2IX3 A;  3NWT A;  3IFD A;  1SSO A;  3EFX D;  2Q8I B;  3GV6 A;  1O7L A;  1SJH D;  1TKW B;  3D4D A;  1EU4 A;  2EYH A;  3DWP A;  4ZRZ A;  1PZI D;  1EFI D;  2F0D A;  3A8J E;  3PIO 3;  1LV9 A;  2D5D A;  1K8O A;  5T1G A;  5IOC A;  4BS9 A;  1PDQ A;  5CV8 A;  3S14 B;  1PLF A;  3NTI A;  1TWH B;  1R4P B;  4RWS C;  2B8F A;  1SXT A;  3L7Z C;  5DNF A;  1SE3 A;  2HDL A;  3R3O A;  1CFM A;  1SNP A;  1Z7T A;  2A68 C;  3I90 A;  4TRD A;  2A73 B;  1HHV A;  2N88 A;  3GTQ B;  4H7B A;  5I9O A;  1ZKO A;  3MA2 B;  1Z47 A;  4AYB B;  2F03 A;  1VCI A;  1II3 A;  3CRL C;  3P7J A;  2K5W A;  3OW7 A;  1DON A;  1DD2 A;  3SK4 A;  3G6J B;  1SE2 A;  3S1M B;  2HDM A;  4ILW A;  3OHX C;  1KAA A;  4ZUJ A;  5BN5 A;  1GUT A;  3DEP A;  4RKB A;  1PFM A;  1TS3 A;  2KCN A;  5EPK A;  2L9H A;  4A3K B;  4DXF A;  1IW7 C;  2EJF C;  4F88 A;  5ELE A;  2I07 B;  1G2S A;  2DNC A;  5EQ0 A;  5C44 B;  1XYI A;  3I4L A;  3FPP A;  2L1B A;  1PTO C;  4A3I B;  3P20 A;  2Z4H A;  1A3V A;  3EJI A;  4IUN A;  1B9N A;  3HP3 A;  5K36 G;  4DXG A;  3H0G B;  5KYL A;  2F0S A;  2A6E D;  1JWS D;  3VA7 A;  2RQX A;  2FMC A;  1YNJ C;  3KLR A;  4FO2 A;  2LS0 1;  3KLS A;  4KN7 C;  3S9W A;  2RDG A;  3I3C A;  5C3E B;  1HPC A;  2JXM B;  3A56 A;  1FNW A;  1V1P B;  1TS5 A;  3H94 A;  2O2L D;  2CVR A;  1NAP A;  3H6M A;  3LWU A;  4IZ8 A;  3FMC A;  2KVM A;  4F87 A;  4DN4 M;  5CBE E;  4DFA A;  4KHZ A;  2JYO A;  3PUV A;  4RA8 A;  1WTP A;  1ILQ A;  4UAI A;  4XT3 B;  4CKB A;  2NBF A;  3OSO A;  2KUM A;  1H9S A;  4G4K A;  4LK1 C;  5FO7 B;  2BDO A;  2A6H D;  1BQQ T;  2GA4 B;  1ILP A;  3PUY A;  3VR5 A;  1PMR A;  4KY5 A;  1PXU A;  1SNC A;  3MAQ A;  3I70 A;  1IYU A;  1QCB D;  4IUT A;  3J81 L;  3J7Y W;  2E75 C;  1G8Z D;  4A3G B;  4DF7 A;  1TT2 A;  1GOZ A;  2EYF A;  3KF8 A;  4O1N A;  1ZXT A;  4WJW A;  3E0J A;  3UI2 A;  2Q8T A;  4HR7 B;  4RAU C;  3PUW A;  3Q24 A;  2QF7 A;  1G91 A;  4PV1 C;  1E0B A;  2K28 A;  2BCO A;  1LT6 D;  3N6R A;  4S3S A;  1Y1W B;  1XXG A;  1LTT D;  5M3M B;  2SEB D;  2PQE A;  2R6G A;  1E2W A;  4DK0 A;  3QJY A;  5JAV A;  1SYB A;  1M8A A;  2NTT A;  2CW0 D;  1Y8O B;  2XN9 C;  4CKC A;  4A3J B;  2IX0 A;  3W3A A;  3IKJ A;  4OL7 A;  2K1B A;  3CHB D;  3EA6 A;  2R3Z A;  5FLX E;  2JSO A;  1A15 A;  1O7Y A;  5A2Q L;  1I4R A;  2RSO A;  2A6E C;  4TKO B;  3N52 A;  5KYI A;  1MGS A;  1CZW A;  5FO9 B;  1EYD A;  3RD4 A;  5IT9 L;  4PMB A;  4C3I G;  2X69 A;  5M3F B;  4RCN A;  4R8I A;  1EY8 A;  2TMP A;  4RGT A;  1S4Z A;  2RSN A;  1GXD C;  1JE4 A;  3GD7 A;  1T5X D;  1MBY A;  5C6A A;  1HCZ A;  5J39 A;  1RTN A;  5CBA E;  5DAU A;  3I72 A;  4EQP A;  1Y8N B;  2IJ0 A;  4HMJ A;  3TBI B;  3SVM A;  4FXD A;  1SYF A;  1SYD A;  3Q0A A;  3FVQ A;  1VMP A;  1TU2 B;  1MSG A;  3S1R B;  2B2U A;  2HUG A;  2XWJ B;  3ERO A;  4XDX A;  4OO1 H;  1ENA A;  1KLG D;  4LJZ C;  2JA7 B;  3KLS X;  3ND9 A;  3NTH A;  3VR2 A;  3JAM E;  4U67 3;  4RFB A;  1B9M A;  4TSS A;  2MPM A;  2F0L A;  1ZYR C;  3C3L A;  2PZT A;  3K5L A;  1JOO A;  4XXE A;  4CGY B;  4HCS A;  1C48 A;  1U4M A;  4DU9 A;  2O4X A;  4H44 C;  2J0T D;  2DN8 A;  3FRP B;  1HQM C;  1EY9 A;  1HTP A;  1EQV A;  1BDO A;  4F7X A;  3IAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...