2F3VA

Solution structure of 1-110 fragment of staphylococcal nuclease with v66w mutation
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
110
structure length
110
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMWENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Folding stability and cooperativity of the three forms of 1-110 residues fragment of staphylococcal nuclease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 3
structure length 110
sequence length 110
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f3vA00
2F0WA 2F0UA 4KD3A 1SYFA 3MEHA 5DEHA 1STHA 3S9WA 2EXZA 2EYLA 4KV6A 4HMIA 5NUCA 3MVVA 2F0TA 2F0SA 3T13A 5KYIA 4TRDA 5KYLA 3TP6A 1JOQA 2PW7A 4WORA 2F0GA 4K2LA 4HMJA 1IHZA 4B9XA 3D4WA 3OWFA 4ZQ3A 1EY7A 4K2KA 5C5MA 1STAA 1F2YA 4PMBA 3SK6A 2F0OA 2F0JA 4NKLA 4EQOA 2PZWA 5I6WA 4N9TA 1EY0A 5KGUA 4R8NA 4DU9A 3HEJA 3EROA 5IGGA 1F2MA 3ERQA 1KDBA 1EYCA 3OSOA 1II3A 3EJIA 4K5VA 2F0QA 4YIJA 5C5LA 1RKNA 3RUZA 5IGBA 1EY6A 5KEEA 1NUCA 2F0DA 2PZTA 1SYDA 5F2DA 1SNOA 1AEXA 4LAAA 2F0EA 3NUCA 4J6HA 4WRDA 4NMZA 1ENCA 2EYHA 3SK4A 3TP5A 5CV5A 3QB3A 5E1FA 5C3WA 5IGDA 5IGEA 4I65A 4QB4A 4ME5A 3V2TA 1A3VA 2HQEA 4G57A 2OEOA 4J1MA 4KJOA 5E3FA 5C4HA 5I9PA 3VA5A 5J39A 1TQOA 1SYBA 2NUCA 3BDLA 1KDAA 1SYEA 2F0KA 2EYFA 4K6DA 4K8IA 2WACA 4ID6A 1A3TA 1STGA 5CR3A 4DGZA 3P1HA 2EY1A 1TT2A 4PMCA 3SR1A 4OL7A 1NSNS 4QF4A 1A3UA 2EYOA 2PW5A 4RKLA 5CV6A 4EQPA 5JAVA 4MIUA 1STBA 5DAUA 3DHQA 3NXWA 4RKBA 3MZ5A 1JOKA 3T16A 4ODGA 2EYJA 3U9OA 3H6MA 3R3OA 1EYAA 2F0NA 3EVQA 5C3XA 4IUNA 1STNA 1SNCA 4KY6A 1SNDA 4H7BA 5CGKA 1TR5A 1F2ZA 4DFAA 4IZ8A 2F0MA 1A2TA 3SK5A 3E5SA 4IALA 1EY9A 5I9OA 5HURA 3TP8A 4NP5A 4E6IA 2KHSA 3NHHA 3D8GA 3QOJA 3QOLA 4NDXA 5IGFA 3MHBA 3MXPA 1SYGA 2EY2A 5EKKA 3P75A 2PQEA 1SYCA 3OMCA 2RDFA 1SNPA 1EY4A 2SNSA 3BDCA 2F0PA 1EZ8A 5IGCA 5KRUA 2SOBA 2F0VA 3ITPA 5EKLA 3TMEA 4B9WA 2PYKA 5C6AA 5IIFA 1JORA 2LKVA 4K8JA 4F7XA 4KTAA 2ENBA 4EVOA 1EY5A 3C1FA 1KAAA 1ENAA 1KABA 4KD4A 5J1ZA 1EQVA 2RKSA 5ISRA 2QDBA 5IODA 2KQ3A 4DF7A 1EYDA 4PNYA 1A2UA 4EQNA 5EGTA 4N9PA 5HGTA 5M9OA 2F0HA 4KY5A 4S3SA 1U9RA 4ZUIA 3NQTA 4HTHA 5C4ZA 3LX0A 1STYA 3D6CA 2EY5A 5JOBA 2OF1A 2F0IA 4ZUJA 5CV8A 1EY8A 5CV9A 4QMGA 3SK8A 2F3VA 4F8MA 5CV4A 1JOOA 5CC4A 2M00A 3NP8A 3D4DA 2O4XA 2OXPA 4KY7A 3TP7A 3OMGA 5I6YA 5KIXA 5J22A 2EYMA 2EY6A 3DMUA 2PZUA 3C1EA 3HZXA 2EYPA 4KJNA 5IOCA 1SNQA 3SXHA 2F0FA 1EZ6A 2F0LA 2F3WA 4KHVA 5K5PA 3PMFA 4K14A 2SNMA 3NK9A 4K5WA 1SNMA 3SHLA 4K5XA 1KDCA 2RBMA 5CV7A
chains in the Genus database with same CATH superfamily
5C3EG 2EPBA 5DEHA 1LTID 2ASBA 1O7ZA 3H94A 4CGYB 1E1TA 4CDFC 1CK1A 4DV5Q 4RWSC 2AUKA 1FGUA 3OOCA 1IHZA 2F4IA 2HDLA 1CZGA 5COYA 3GTOB 2F4VL 3GTQB 5D3IB 1CHPD 5FO7B 5CYUA 1HNWQ 3KJOA 3JC66 3SEBA 2E2DC 3OYYA 4LF5Q 1LTAD 2JYOA 2PMZB 4ZLTF 4HCSA 4R8NA 1U4RA 3I4MB 3EROA 3ER0A 3OHXC 3OSOA 1VQPA 2JA8H 1FL0A 1DGSA 2WV6D 1NUCA 1UNSA 1ONLA 1EOVA 2I5LX 4WRDA 4CDEC 1DOKA 1WVLA 4FXKC 3S16H 5L37A 1I94L 3QB3A 2UXCQ 1YNND 5G3LD 4ZK9B 3FPUB 2RSNA 3D6WA 3H0GB 1KDAA 3DEPA 1MSGA 3EFXD 1M4VA 4BY1H 1WD0A 4FF4A 3HOVG 4DR2Q 3QR8A 2EY1A 4OL7A 3DWPA 2PW5A 2YYZA 4MIUA 4BA1I 3OPOA 1XPRA 2KCCA 1EYGA 2YV5A 1SDFA 2D2CC 3G48A 3UDXA 1SNDA 1DXMA 3IFDA 1KXLA 2H1EA 2LFNA 1IW7C 1MGSA 1ILQA 4JVZA 1Z6HA 2Q2HA 4NDXA 4JI8Q 4OEMB 3U4VA 2PQAB 4B3TQ 2MP1A 2F0PA 1SMXA 4O2DA 1TY2A 1QVCA 3TMEA 5C6AA 3CCQA 3CKIB 4F7XA 2ENBA 4DAMA 3UE1A 1FYCA 1PTOC 1WTXA 4GN4B 5IODA 1EYDA 3ZYYX 4LFBQ 4B3MQ 2MHVA 4R4TA 1S3OA 1SMYD 4S3SA 1TIID 2ZXRA 2QKIC 3QIAA 1XPOA 5JEAJ 1V1OA 5CV4A 3ULPA 2O4XA 3I55A 2UU9L 5IWAQ 2IL8A 2EYMA 3HZXA 5M5XB 1CQFA 2A19A 2IJ0A 2Q2IA 2F3WA 2R93H 2J4XA 3CCJA 1CSQA 5M5WH 5GAGC 2JN4A 2KCMA 1EFWA 3MC0B 3PV0A 3RZOB 3U9SA 1PZKD 5DM73 2D0PA 4YCUA 4DR3L 3ZJYC 4OO1G 4A3GG 1PRTF 3PCOB 1PV4A 2KOLA 1D5MC 1W6KA 4H02A 3H15A 1Q1BA 2F3IA 2B8GA 3J81L 4YY3L 3NEMA 3MWYW 1FJGL 3BZDB 3PO3G 3K5MA 4YIJA 3O13A 1B44D 1JMCA 2XWBB 1B1ZA 1OXUA 3JAML 4G7HC 1B53A 4J15A 2UUBQ 1HTLD 2IX1A 2XNAC 2K5HA 1YZ6A 1GHKA 1DCZA 1A3TA 3CQZB 3V05A 1NTGA 1N32L 4DV2Q 5BN3A 3SE0A 3H6MA 3R3OA 5C3XA 3KFUA 5KNBA 1NJIC 2NN6I 1QVFA 1KLGD 4DFAA 1Q81C 2B63B 1C48A 3A8KE 4OX9L 1EY9A 4I7ZC 2B2WA 4NP5A 5IGFA 2UUAL 1AE3A 1MBYA 5IT9L 5JJIA 2PQEA 4BXXG 2PQAA 3OMCA 3S1NB 4BY7B 1SNPA 2C5CA 1LT6D 1VQKA 1E2ZA 1EY5A 1YJNA 4K0KQ 3I4MH 2QDBA 1FNUA 1TVXA 1BQQT 1EWIA 1Y1VB 4GS3A 3SGIA 5M3MB 3S2HB 3HOUB 1TWAH 1TY0A 2LS01 2EY5A 4X66Q 1QJOA 2JA5H 4F8MA 5CC4A 1JOOA 3D4DA 1SE3A 1VMCA 3K5NA 1OXTA 2Z4IA 5KIXA 3T1YL 2NVTB 4G7ZC 4UP8A 3NWTA 2G9DA 2SNMA 1M90C 3GV6A 4BBSG 3KYHC 1SYFA 3I73A 3TQYA 5IY0A 4HMIA 3T13A 5D65A 5KYIA 4HIDA 5KYLA 4OWWB 3CC2A 3D3RA 3C2PA 2QEJC 4EX5A 2UXDL 1NMFA 1PTOD 2FHTA 3G6JB 2MQHA 1WTRA 1J6QA 3T1HQ 1Q3LA 1IL8A 5IGGA 1I50B 5IGBA 3GDEA 1X65A 4HIKA 4C1NK 4NMZA 3I4NG 1B50A 1WYDA 4L5TA 1XMOQ 5JJZA 5CBAE 1LTSD 5LL6X 4YCWA 2AQ3B 1NAPA 1I4GA 3BDLA 1SYBA 2TMPA 1KL9A 4K6DA 3K7AB 1SSOA 1P8LA 1NR4A 2R6GA 2O5IC 1PMRA 5M5XH 4A3KH 3CMEA 4DR7Q 5DAUA 1I3QB 4DUYL 4DN4M 4UDUC 3NE5B 2EE1A 3QG1A 2HHHL 2AHOB 3M4OH 3S17B 1ET9A 4TKOB 2PNHA 4V0BA 3RZOH 2Q2UA 1HR0Q 3PO2B 1V43A 4MN3A 2E5LL 4LF4L 1E3PA 2BOSA 3HOWB 4IFDI 3EBEA 4HAEA 2QW7A 1V1PA 4JI2Q 5FJ8G 1BNZA 4KI0A 4IUVA 2R7ZB 1S5FD 3HOXB 4DV5L 1NMGA 3HKZB 1IYUA 4EVOA 3F2BA 5J1ZA 4KK7A 2WB1B 2L15A 4XYQA 1X54A 3S24A 1HNWL 1Y8NB 2MUYA 5HGTA 3T51B 1VQ9A 3J80c 4LF5L 4JOIA 1EWCA 4Y52H 4XQQA 4PG3A 3KLRA 3VR4A 4CHTB 2A6HD 2KVMA 3STBC 1W2BA 4C3JG 1HUNA 1STEA 4I7AA 1HXYD 4GKJQ 1WFQA 3PUWA 5FLMH 3C1EA 2Y0SG 1X3FA 3GTKB 4YHHL 4KHVA 2AQ1B 4ILWA 4JI6Q 2ATWA 5BN5A 4AYBE 2F0WA 4Y7NB 1YHAA 3TS0A 4MNOA 2IW3A 4DNTB 5IYDH 3CCLA 4LUZA 1BO0A 3P20A 1OXVA 1JOQA 3S1RH 1I5FA 4X62L 2ZXPA 1CFMA 1MI2A 1L0WA 1Q12A 4BY7H 2K04A 3HOZB 2DY8A 4JI8L 3HOYB 1B3AA 2DNCA 2PZTA 2N78A 2N8NA 3T4AC 1SNOA 1DOLA 1K0SA 5LL6S 2NYZD 3HOUH 4I65A 5ELCA 4LFBL 3LGJA 5I9PA 4JYAQ 4A3FB 3IL8A 1SROA 1LTLA 4A3EH 4B3ML 2WACA 1HA6A 3EIVA 1YNJD 4JI5Q 1LLRD 1G291 1S72A 4Z9CB 1STBA 4IPCA 3H0GG 1CKNB 4RMFA 5IWAL 2NVYH 2WKCA 3F8TA 1DJRD 2ZM6Q 2TSSA 2YTXA 1EIHA 2K4KA 3J80E 5CORA 2PCFB 1EY4A 1SRUA 2VL6A 5EKLA 3ITPA 4OELB 2JP1A 2E8GA 5E7NA 5LMUQ 4H13C 4OONA 1EQVA 3J81i 1I50H 3VR3A 3D4RA 3PF4A 4FP5D 1U5KA 2EQSA 2UUCQ 4QIWB 1U4PA 5C4ZA 3DWAA 2L0CA 4UPAA 3CCRA 5EAYA 3SK8A 1WCMB 1RL2A 1BBUA 4R1JA 4DKAC 3CXCA 2BDNA 1F9QA 1O7LA 2AWNA 3K7AH 1EU3A 3DMUA 2PZUA 3F2UA 2JXMB 1A63A 1IKMA 2EZVA 5I2XA 1E2VA 3TDQA 2WFWA 2UUBL 3WDNA 2O2LD 2IHEA 2XVSA 5ELNA 1YJWA 5EQ0A 1PLFA 1MJEA 1DOMA 5EKIA 3J81j 1KC8C 1STHA 1D8LA 4A3MB 4R4OA 4XIGS 2IHFA 3PIO3 4TRDA 1F9PA 1HZBA 1TKWB 2NN6G 1N8RC 1HNXQ 3NPPA 4DUZL 4HMJA 1H95A 4A93H 2E74C 5H1SE 4UHVA 1WD1A 2IY5B 1FNWA 1K8GA 2A6EC 2F0OA 2R7ZH 3A74A 5T1IA 1EOTA 3DM1A 1VQ8A 4FVMA 4JI1Q 3PSIA 3A8JE 3EJIA 2F0QA 2AMCB 4JPBW 1SFOB 2Z6KC 5DNFA 2X6LA 5EPKA 3GV3A 2Y0SE 3FHWA 4NXMQ 1JCKB 4GN3B 2CCZA 4K0KL 3UI2A 1CKOA 4J1MA 3JAME 2K7VA 1ET6A 1Q90A 1D1IA 3RD4A 5EBCA 4N8FA 4PZ7A 4EGVA 4X66L 3GTKH 2BA0A 2IWHA 3X3MA 1HJPA 1X3QA 1SJED 1EYAA 1CKNA 4YWKA 4C3HH 1BR9A 1F2LA 3GTJB 5C0XH 3CRLC 3T56B 5CBEE 1FGBD 1K8AC 2FXQA 1HRJA 3FVQA 5GAHC 4JI0Q 1BDOA 2L12A 2B63G 1RDPD 4RGMA 1A0IA 1Q1EA 3CMAA 5IT9E 3C1FA 5IYBH 1RCVD 2YU9H 2UXBL 4BY7G 3HOYH 2QA4A 1YNXA 3RMHA 3CCSA 3T1HL 1VQJA 4AH6A 3I90A 5ELBA 1ICFB 2DNEA 1UUPA 4HTHA 4HIMA 4LF8Q 3D6CA 1PYBA 4A3IG 2OT2A 2F0IA 1JJCB 4HEDA 2B2UC 1Y1VG 4A3FH 2RHQB 5M3MG 1ASZA 4OWTB 1LUZA 4KN4C 4DV1L 2B39A 3N52A 3RLNA 3KBGA 4A3DH 2NWGA 3AMUA 4LFAL 2VUMB 1V1QA 4K5XA 1LTBD 2LSSA 3D4WA 3I70A 2F52A 3S9WA 1EIGA 1QILA 4NB3A 1E1OA 2QDLA 1JC7A 4M8AA 3Q22A 2E2JH 4DR7L 4LK1C 4QQBX 4QCLA 3HFZB 5FLXE 2WAQG 1ZEQX 5IE8A 3ICEA 4ZRZA 3MFGA 2Q2TA 4GLAC 1Z47A 4OIJA 1K0RA 1HR0L 5IYCH 4B3SQ 4IFDG 5KGUA 1BUVT 1MD2D 2CW0C 2M9VA 3MXNB 1BCPC 1EY6A 3S15B 4IURA 1O80A 2JA9A 3GTLH 1FNVA 3K80C 4GOPB 1BF4A 1O78A 3CC4A 2A69C 1B7YB 4BA2I 2K03A 1WCMH 4G57A 2OEOA 4IPHA 4PZ6A 3BU2A 1MSHA 1R4PB 3P1HA 1Y69U 2RF4A 3URYA 2RCNA 2Z8LA 4IUUA 1IBLL 4AQYQ 4POFA 1AH9A 1JB7A 1VMPA 3A55A 1UEAB 4IUNA 1STNA 3DWQA 2Z6BA 2HCIA 1YIJA 4DAVA 1WJJA 4JI7Q 2E2HB 1PDQA 1G6ZA 1TWAB 4A3MH 1VQ6A 3KBXA 5JPNC 2A6ED 4LF9L 2JA5B 4JI6L 2EJFC 4X3UA 2AUJD 1VQHA 1HZAA 4DR5Q 2SNSA 1K73C 3H3VI 2SOBA 3PO2G 4KKSA 4N8X1 2ALYB 1E24A 4F87A 3HOWG 1H9RA 4CJ2C 3M9BA 4TQUS 1YEZA 5K36H 1VQBA 1FVIA 1SFOH 2KJXA 2R7ZG 3HOXG 3HKZG 5D14A 1VQOA 4X3TA 4QUCA 4C2MH 2VB2X 3J80L 4HCEA 3Q8DA 3LNNA 2A73B 1HCZA 2CQAA 4HJ8A 1AFPA 3KLWA 1XMQL 1J9OA 2KEEA 1ICWA 3FKIH 5J22A 2FMCA 4L5RC 3CRKC 1VQCA 3SXHA 2BE5C 3OTOQ 1F77A 4JYAL 2K28A 2K50A 3DM3A 4FNFA 5CV7A 1ZKOA 3GTJH 3CF5A 1QUQA 2JEAI 1RTOA 4QL5A 3LWEA 5NUCA 1VQAA 4IJHA 2CQOA 2X6GA 4C3IG 5IP9H 3K6OA 4DV3L 4RGNA 5C5MA 1KAWA 4XQNA 4P73A 5FKAC 4NKLA 4A3KB 2PZWA 3PUYA 4K5VA 1X3GA 4XTCS 3M4OB 3BDOA 3L7ZC 3RUZA 3RZDH 3M4PA 2Q8TA 1X55A 1SYDA 1VQGA 4CKCA 1XWEA 1PH6A 3HOZG 5LMUL 1AW7A 3TP5A 2KENA 5CV5A 4LF7Q 4O42A 5IGEA 3G7LA 4QB4A 3SDZA 3V2TA 3TBIB 5C4HA 5E3FA 4KJOA 4HR7B 5HGQA 1NY4A 1TQOA 1X6OA 1JICA 1SYEA 2UUCL 3UDFA 2IT1A 2WAQE 5EJWA 3A5UA 1PRTD 1I4PA 1WTPA 3BG3A 2VUMH 3L3OC 1K28A 1RF2D 2DN8A 2EJMA 1BCPF 4IFDJ 3SK5A 1KQSA 3E5SA 2K5NA 3E3XA 4DNRB 1EU4A 4DV0Q 5EKKA 2K33A 2F1MA 1HNZQ 3H3VH 1G91A 2CW0D 1R9TH 4C1NI 2H4OA 2JA6B 1N34Q 2SEBD 3BYYB 4K8JA 4KTAA 1HNXL 4DPGA 1KABA 3KLSX 1HFNA 4NXNQ 1LYLA 2K14A 3S15H 1SE2A 4FYDA 3K7UC 3DXJC 3K81C 4JI1L 4CJ0B 1YJ9A 1QNKA 1GD7A 3S1RB 4IPGA 1CSPA 2K5QA 4ABNA 3IFTA 5FOBB 5IP7H 1S5BD 1VQFA 4B3RQ 3I8ZA 1SE8A 4MTKA 4K5WA 1K3RA 3WOFA 2JQOA 1IBKQ 2E2HH 1XNRL 1J8IA 2EYLA 4FXGC 3I2ZA 1PA6A 4XT1B 3S1QB 2JA8G 1Y14B 2BCOA 2PNRC 3OWFA 3GTGH 4ZQ3A 4DV7Q 3FDTA 4A3EB 4A3MG 3RNUA 4JI3L 4A3JB 1Q82C 2E2IH 4Q5VA 1GUNA 1K9MC 4XDXA 4QJFA 3ERQA 1KDBA 2KHJA 4H44C 3GP7A 4DV4Q 1IW7D 1I4HA 4JI0L 3BVMA 4IOAA 1WOCA 4BY1G 2RDGA 2NVYB 5FLXL 2N49A 2YTYA 4LUOA 1OXXK 3NUCA 2B2YC 3A8IE 4KKUA 1BCPB 1PH4A 2V1CC 1QNUA 4G7OC 2Z6KA 1SJHD 3EN2A 4FF1A 2BE5D 1CA6A 1PH3A 2XIWA 4A3CH 3VA5A 2F0KA 2H5XA 2ZXOA 1HPCA 4DGZA 2AQ2B 3IKJA 3RLFA 1A3UA 5JVG3 2O5JC 1ENFA 3DHQA 1UAPA 1H9SB 1C4QA 3TZUA 1IYVA 5C44H 2F0NA 3EA6A 1SNCA 1X32A 3S14H 1F2ZA 4UP7A 2E76C 1GUOA 1LT4D 5ELOA 2JE6I 3U50C 3VA7A 5LMNQ 3I91A 3GTMB 2B2TC 2ZJQA 3MTSA 4TSSA 3UDIA 4RFBA 2F0VA 1C0AA 5IIFA 3QWNA 4DK1A 2IPKD 2FMMA 2HIVA 2EDGA 3KF6B 4R9WA 4B3SL 4WJ3M 1BOSA 2R93G 3CCEA 4JC0A 5JOBA 2CFMA 2OF1A 3NELA 4IO9A 1EY8A 2CH4W 4BBRH 4DR6L 1GUWA 4A93B 2M00A 3X3NA 3OIPA 4CKBA 1D1KA 2I5MX 5DM63 4FDBA 1KHIA 3FEWX 3VR2A 4FF2A 1PVOA 2D9UA 2B2UA 3TREA 3TN2A 1JWSD 2A74C 5GADC 1S5CD 2XN9C 2NVQB 1JWUD 1H9MA 4NPSA 4P72A 2BA1A 3CC7A 2F0SA 4A3BH 3J7YW 3TP6A 2RCFA 1IKLA 1BBWA 1V8QA 4X65Q 2MO1A 5JJLA 1F2YA 2JA6H 3E9IA 1K83B 2DGYA 2I07B 2QEXA 1B9MA 1GXDC 1O7YA 2WINB 2UXCL 1QZHA 4DR5L 4C3HB 4QIWE 2F4VQ 1PH1A 1E7ZA 3A7LA 5TSSA 4DR2L 5M5YH 5M3FH 3H3VC 1OXSC 1S40A 4APVA 3E0EA 1M8AA 3MEFA 4OHJA 3J80i 4CBVA 2NZ1D 3PUVA 1JB3A 3AEVA 1WTVA 1NE3A 1CHQD 2RA4A 2AKWB 2HCCA 3NXWA 2YU9B 4KY6A 4B3TL 4GOPC 1D5ZC 2Q8RE 3AQQA 2NZHA 3OTOL 4MZ9A 5I9OA 3S1QH 1OO9B 3BZKA 3I4MG 4E6IA 2OWOA 4RH6A 5JEAH 3P75A 1YHBA 1EZ8A 1AE2A 1JORA 2LKVA 4A3JH 1AP0A 2RDHA 4A3DB 3ULLA 2JA5G 1HFGA 1Y8PB 2A1AA 4PNYA 1Y1WH 2L5TA 2EIFA 2JK8A 2KBNA 3KF6A 2K05A 3KK7A 2L1BA 4KY5A 1JJGA 5C0XI 2E2JB 2KECA 4JBKA 1X56A 3U4ZA 2A8VA 3KLSA 2I46A 1SAPA 4PQXA 1E2WA 4LNQA 3I56A 1TWFH 4RGTA 2VQFQ 3PUZA 1N9WA 5I4DA 2J7ZA 1CM9A 1MHWC 1KDCA 2UU9Q 3DEOA 2R92H 2ZT9C 1GO3E 1TU2B 1U4MA 3M85A 2JA7H 4KV6A 3GTLB 1WTWA 4LUVA 4R8IA 4K6LA 4DAPA 1TWGH 4IOCA 2A5HA 2QILA 3GTMH 3JAMi 4NW2A 3DUZA 2G9HD 2ZJRA 4OIKA 5C3EH 2X69A 4DR3Q 5E4WC 1Q8IA 4FO2A 3NENA 3K5LA 2D0OA 3GQBA 1JJ2A 1FR3A 1W6JA 4LFCQ 4DV0L 2VXWA 1WI5A 5C5LA 1HNZL 3CCUA 2B2VC 2F0DA 4AYBB 2OQ0A 3K0YA 2R3ZA 4JV5Q 4YWMA 4A3KG 1JE4A 1D5XC 3QO2A 4YY3Q 2XRQD 4MHEA 3G4SA 2EYHA 3KOJA 1S5ED 2DUDA 2J0TD 3LWUA 4DV2L 4L5SA 3NWSA 1G2TA 2KHIA 1I6HH 1MKHA 3BZCA 1I6VC 4XQJA 5FK9C 5JVH3 3MZ5A 1A6XA 2GN5A 1AZQA 1EWHA 5KNCA 4LF6Q 2NVQH 3HGBA 4H7BA 1TR5A 4RGOS 3STBD 3RN2A 1TS4A 5BR8Q 4C2MB 3HOVH 5GROA 2VS1A 4X6AH 3K57A 1C7YA 3PIPA 1GUTA 3CP0A 4WFN3 3PGZA 3MXPA 1N36Q 1SYGA 1L2FA 2E75C 3FKIB 4U673 1VQ7A 3VYRA 1K83H 4JBMA 1KAAA 1S4ZA 1CTMA 1ENAA 4KD4A 2UUAQ 4A3LH 4DV7L 2ICIA 2JA6G 3A0JA 5FLMG 2RQXA 2VB3X 1PTOH 1O7IA 3C46A 2VZAA 1RTNA 1ZXTA 3LX0A 1STYA 2QF7A 4ZUJA 4JBWA 1BVSA 1GUGA 5AJ3Q 1VF7A 3WWVA 3CD6A 1RODA 3RR5A 1EIYB 4P75A 1RD9D 2PMZE 4KJNA 5IOCA 5IYDG 4ME3A 3I4NB 1C9OA 2F0LA 1K8OA 3NK9A 1A8VA 1B2TA 1B4OA 3RZDB 4IUQA 2RVLA 3NQIA 3T53B 3ND8A 2EXZA 4G4KA 2ICEC 3NTHA 3R2IA 1IBMQ 1B70B 4GLVB 3GTPH 2R61A 1SMYC 1ZYRC 2MFIA 1STAA 3G6EA 4MTNA 3MXUA 1EEFD 2PO4A 4PMBA 3HOUG 2F0JA 1IL2A 1XMOL 3FP9A 1F9RA 2NTTA 1EY0A 2ZTEA 5LMNL 4OO1H 4A3GH 4A3EG 1RKNA 4RAUC 3TEHB 1ILPA 4LAAA 4A76A 5HY6A 1ENCA 4RCOA 3ERSX 1KIXA 1L1OB 1QG7A 4UP9A 3PO3H 1KD1C 2B2YA 1R9TB 1CKMA 4HSVA 4PMCA 4QF4A 5CV6A 1DYQA 5JAVA 4RKBA 2EYJA 1UE5A 1WTHA 4KKTA 5C4XB 2KUMA 1YHQA 1M1KC 4JI2L 5AFWA 2D5DA 3QJYA 4Q0FA 1BXTA 4IZ8A 5FO9B 4IUTA 1XX8A 2DJGC 1XPUA 2KHSA 2ID0A 1HR0W 2HHHQ 4OXPA 1XNQQ 4KN7C 3CAMA 1SYCA 1TS3A 3Q23A 1G2SA 1HQMC 1Z7TA 1CUKA 4R4IA 2B2TA 3VYSA 4LF4Q 3Q24A 3BYTB 1LT3D 1MIUA 4X65L 1IZ6A 2HD3A 1A2UA 2LXJA 4N9PA 4GKJL 5M9OA 4BXXH 1LTTD 2NBFA 5A35A 3W2DA 2VW9A 1LTRD 4EQ5A 1UEBA 3I4OA 2MJ8A 2QCPX 3GTGB 4KY7A 3NSWA 3OMGA 2CVRA 1AN8A 4HJ7A 1GVPA 1B3QA 5JPMC 2E2IB 3AU7A 1HZ9A 1B9NA 3FPPA 5G3LF 3C3LA 3PMFA 4K14A 3J7AF 3S2DB 4DK6C 4A93G 1S5DD 3SHLA 4X64Q 3P7JA 4DK3C 3RLOA 1Z9FA 3J7AV 4HIOA 3RN5A 1A15A 3OIQA 4GNXB 3S1MH 1HTPA 4YHHQ 1VQNA 3GD7A 1VS0A 1EQTA 1HA5A 2MPMA 2WB1G 2KEDA 4K2LA 2NTSA 3UE0A 4PZ8A 1Q46A 4K2KA 1U0LA 1QZGA 4BBSH 5JJKA 1J5EQ 1SR3A 2CHBD 1CQVA 2A68C 2EJGC 3UDGA 2N55A 4N9TA 2C9OA 4DU9A 4X62Q 4JI4Q 4ALPA 1II3A 5C44B 2K5DA 3CCVA 3S14B 1F9SA 2CWPA 1Y8OB 1ESFA 4JI5L 4A3LG 2OCEA 3W5OA 1A62A 1L1OA 1QWYA 4C3HG 1A3VA 1PH5A 5C0XG 1HQRD 1PFNA 1DONA 4K8IA 4XT3B 3HG9A 5C4JB 4BWGB 1W3SA 3K58A 3SR1A 2ZM6L 1K3BC 3I4NH 1UE7A 1EFID 2XTIA 4ODGA 1JT8A 3U9OA 3MXNA 1H9JA 4KHPQ 1EQQA 1ML0D 5ELFA 1VF5C 1ZYRD 2BDOA 1VQLA 3G71A 4ZYSA 2F0MA 1RIPA 5IYBG 2VQFL 3HOYG 4GOPA 3D8GA 3HS0C 2HT1A 4BBRB 1VQIA 1R4QB 3AFPA 3L2PA 1SBBB 5A2QE 2IX3A 1NNXA 1SN8A 4B9WA 2RHSB 3R93A 2EVBA 3BVGA 4ZKBB 4DR4Q 4CDCC 1B8AA 2RKSA 2K6AA 4DR1Q 4A3FG 3NBIA 4EQNA 2XWJB 1C8CA 5ELEA 5FJ8H 4A3DG 1HH2P 3NQTA 2NB0A 1I4XA 3SVMA 1YI2A 4A3BB 4LFCL 5CV8A 4XXEA 3TRZA 3E6ZX 3NP8A 3TP7A 4JBJA 4J8QA 5KNDA 4TVAB 4JV5L 1BCPD 3PQIA 1EQRA 4IQZA 1XTDA 1V9PA 1RJTA 4C3JH 1PFBA 3I3CA 3AYHB 2F0UA 2XRSD 4KD3A 5C4XH 5IYCG 2NVXH 2A69D 4A75A 4DV6Q 3W1GA 5M5YB 4RCNA 4GNXA 1QCBD 3HRZC 3MVVA 5M3FB 3MA2B 1TS2A 3I7FA 1VQ4A 4WORA 3BS1A 4LF6L 4B9XA 1YITA 4DXFA 1EY7A 1PH8A 1CI3M 1JR0D 2K01A 5BR8L 1PXUA 2A6HC 2GA4B 2D62A 4NXML 5D3DA 5I6WA 1D7QA 3M3YB 2MGSA 4U68A 2N88A 1LO5D 1WCMG 3HEJA 1N36L 1T9HA 4DUZQ 2GVAA 4HJ5A 4FF3A 1MJCA 1AEXA 3HP3A 3R8BA 4J6HA 1PH9A 1OTCA 4WJ4A 2B2VA 1VQEA 3TZDA 2OTLA 1V1PB 1TWCB 4AYBG 3GTOH 5LHY1 4R4CA 3GTQH 2PI2A 3A7AB 3FRPB 3HKZE 1VQMA 2QGQA 2ZTDA 4RKLA 4V190 4A3IB 1VQ5A 2KCNA 2JSOA 2WB1E 5AJ3L 3S2DH 1QOHA 1KLUD 3EVQA 4X3SA 1Q8KA 1Y1WB 1HUMA 4C56C 1I4QA 4HSPA 3AB9A 5HURA 1PRTB 3QOJA 2A68D 5K36G 3H0GH 2I5HA 3BDCA 3I4LA 2PYKA 4LF8L 2B29A 1TWFB 3GO5A 1IBML 2WAQB 2Z1CA 1QVGA 5EBDA 4OGQC 5C0XJ 1PTOF 3B6YA 2CH4A 1YNJC 2KQ3A 4DF7A 1XXGA 3FKIG 5EGTA 2R92B 3J7ZC 3TSSA 1CT1D 2L11A 2JA7B 3CPWA 1KTKA 1TWGB 1DM0B 2UXBQ 1GKHA 2K75A 2RSOA 1Q86C 2Z0SA 1I4RA 2EY6A 5C3EB 5C4JH 3NTKA 1TXYA 2F0FA 2VQEQ 4PMWA 5E4XA 5IP9G 2MO0A 1GHJA 4IJLA 2RBMA 2ZTCA 4HN7A 4DV1Q 1XTCD 2VNUD 4DA2A 2B8FA 3H91A 1VCIA 3ONAB 2F0GA 4LFAQ 1D6EC 2L4NA 1DZ1A 3HKSA 2G5DA 1I6HB 2KA7A 5BN4A 2JEBI 2FFKB 2FINB 4JK1C 1XNQL 3OWEB 4QUFA 2NN6H 4CDDC 4LJZC 2LXKA 5KEEA 1P16A 3VYTA 2F0EA 2K32A 3KF8B 2DY7A 3HOVB 3L9AX 1QE6A 5C3WA 3OW2A 2VUMG 4UAIA 4ME5A 4AQYL 3F1ZA 5J39A 4L6TB 1YVCA 2NUCA 1N33Q 4GKKQ 4JI7L 1PFMA 1TT2A 1NSNS 5EPJA 5J3BA 2R7DA 1LV9A 3KDFB 1L1OC 1PTOB 2CWAA 2K5VA 4FXDA 2WKDA 1PYSB 1A2TA 5CMDA 3ULJA 4QGUA 4HJAA 2F03A 5C4XG 4X64L 1IBLQ 1HHVA 2EY2A 1PHJA 4POGA 1XYIA 3PUXA 1LT5D 1PH7A 3CHBD 3CQZH 4R4QA 3M3YH 1I94Q 4LF9Q 4RHRA 1UE1A 2GVBA 1H9SA 3KUPA 4C3IB 1J5EL 5IP7G 2B63H 4ZUIA 5T1GA 1AZPA 2WIIB 5A2QL 2K5WA 2CKZB 4JI4L 3M4YA 4CKEA 2F3VA 3E0JA 3GTPB 1ESRA 1VDZA 1QB5D 1XJVA 3IAYA 3CU7A 3S1NH 1TWCH 1BKBA 3CW2C 1YBYA 4JG2A 5I6YA 4ZCKA 1L0XB 1SNQA 2L55A 5K5PA 2HUGA 4A3IH 4DXGA 4A3GB 1WTOA 1UE6A 4LWCA 1PZID 3A56A 4H0LC 1XMQQ 1Y1VH 3K0XA 5M3MH 3S2HH 1LABA 1CZWA 2HQLA 3PF5A 3A54A 3A5ZB 2K1BA 1BBXC 1TWHB 5ELDA 3PO3B 3ND9A 4KHPL 1GM5A 2NVTH 3J81c 1GUSA 4DAYB 2DJFC 4EQOA 1CA5A 4LF7L 3NBHB 1EEID 4A3CG 4M1UB 4GNXC 3CPFA 4DV3Q 4ZAIA 3JAMc 3W1BA 3F2DA 1G6PA 4DR4L 3E9HA 1SE4A 3KF8A 4IFDH 2VY3A 1E22A 5E1FA 5C44G 4DR1L 2HQEA 2OQKA 4JCVE 1KRTA 2Z4HA 1KNEA 2FJ2A 2ES2A 2IX0A 2EYFA 3K5OA 3VR5A 3L0OA 1STGA 5CR3A 2ZJPA 1SXTA 1D2BA 2LMCB 2C35B 4EQPA 4KHZA 1K8MA 4X3KA 2I0QA 1VQDA 4DK0A 1DD2A 2WP8J 2Q8IB 4OO1I 2B2WC 3Q6SA 3KDFA 4CJ1B 4L63B 4A4IA 2YTVA 1N34L 2BH8A 4RHSA 1PZJD 3PIOA 1U4LA 4IALA 5EPLA 1X3EA 3K8AA 4L5QA 1X9NA 3NHHA 3QOLA 3W3AA 5IT9c 3IRBA 3Q0AA 1FJGQ 1Q7YC 1EL0A 4NXNL 4P2CB 4GZYC 1JWMD 2RDFA 1EIFA 4DV6L 5KRUA 1GOZA 1NBWA 3M7NA 1G8ZD 4BBRG 4LW1A 1KNAA 1I3QH 2JA8B 1IYJB 2JJQA 5ISRA 3S17H 1SLJA 1LM0A 1X3PA 2F0HA 2SDFA 1E0BA 3PO2H 3S16B 3S1MB 3OW7A 4B3RL 1LACA 4QMGA 3HOWH 1N32Q 3BVZA 4O0AA 4BY1B 4BBSB 2LY7A 2HDMA 3HOXH 1NCVA 1IBKL 4A3BG 1LTGD 2Z9HA 3N6RA 3U58A 1UWVA 1YNNC 4UY8C 4OX9Q 3M7GA 1T5EA 3R2TA 5FLXc 3J81E 2EXDA 1HZCA 1T5XD 4XYOA 4JW0A 2P5ZX 3MEHA 3MAQA 2XGTA 4WJWA 2F0TA 4L8JA 4YCVA 2M2LA 2OTJA 3PIP3 2V4DA 3NTIA 2PW7A 4DV4L 3CCMA 4GN5A 4F88A 3DLLA 4IN3A 3V96A 5M3FG 3SK6A 1XNRQ 2AWOA 2PPBC 4DAYA 3NBHA 1F2MA 1EYCA 3I72A 3VR6A 3VYUA 5F2DA 1SEBD 1H9KA 4Y7NH 4C3IH 4JI3Q 3T1YQ 3KJPA 1IXRA 1FD7D 3SK4A 5IGDA 4QY7A 4GLXA 1G51A 1RHPA 1KRSA 1PYWD 4PV1C 2R7FA 3TS2A 4HJ9A 4ID6A 1L0YB 5I2YA 4IPDA 3HOZH 2R93B 2EYOA 2B3GA 4OWXB 2HIXA 5M5WB 1JOKA 4IUPA 3T16A 3WOEA 5JEAG 1ASYA 2KCTA 3MXGA 5CGKA 2UXDQ 2BH2A 2L9HA 4A3JG 3BJUA 3D0FA 2VQEL 2EOTA 3TP8A 4YWLA 2MNAA 3MHBA 4P71A 1Y1WG 1TWHH 2XSCA 3H09A 5LMNW 4O1NA 5FO8B 5IGCA 1PH2A 2K52A 4RA8A 4JOIC 3F2CA 1QUQB 3J7A5 1EUJA 3MFYA 4C3JB 2N3SA 5GAEC 1WTQA 2NVXB 1PRTC 4P74A 5DLQE 4RG1A 1U9RA 5GQOA 4ZKCB 3AFQA 3VDYA 2Y0SB 1GJXA 3K59A 5CV9A 4KLKA 4KMUC 4B08A 2PI2E 4DUYQ 2R92G 1NR2A 2OXPA 4DNIA 1JE5A 2NZOA 4BS9A 2JA7G 1JQYD 4LMQD 1TS5A 2EYPA 4ULLA 3EQLC 4AIMA 1PFSA 1EZ6A 3D31A 2E5LQ 4DR6Q 3M4QA 1SNMA 1N33L 3FMCA 4GKKL
chains in the Genus database with same CATH topology
2EPBA 5DEHA 1LTID 1O7ZA 3H94A 4CGYB 1CK1A 4RWSC 2AUKA 3OOCA 1IHZA 2F4IA 2HDLA 1CZGA 5COYA 3GTOB 3GTQB 5D3IB 1CHPD 5FO7B 5CYUA 3SEBA 2E2DC 1LTAD 2JYOA 2PMZB 4ZLTF 4HCSA 4R8NA 1U4RA 3I4MB 3EROA 3OHXC 3OSOA 2WV6D 1NUCA 1UNSA 1ONLA 4WRDA 1DOKA 1WVLA 4FXKC 3QB3A 1YNND 5G3LD 4ZK9B 3FPUB 2RSNA 3D6WA 3H0GB 1KDAA 3DEPA 1MSGA 3EFXD 1M4VA 1WD0A 4FF4A 2EY1A 4OL7A 3DWPA 2PW5A 2YYZA 4MIUA 4BA1I 3OPOA 2KCCA 1SDFA 2D2CC 1SNDA 1DXMA 3IFDA 2H1EA 2LFNA 1IW7C 1MGSA 1ILQA 1Z6HA 4NDXA 2MP1A 2F0PA 3TMEA 1TY2A 5C6AA 3CKIB 4F7XA 2ENBA 1FYCA 1PTOC 1WTXA 5IODA 1EYDA 3ZYYX 2MHVA 1SMYD 4S3SA 1TIID 2ZXRA 2QKIC 3QIAA 5JEAJ 1V1OA 5CV4A 2O4XA 2IL8A 2EYMA 3HZXA 5M5XB 1CQFA 2IJ0A 2F3WA 2J4XA 3MC0B 3PV0A 3RZOB 3U9SA 1PZKD 5DM73 4OO1G 1PRTF 2KOLA 1D5MC 1W6KA 1Q1BA 2B8GA 3J81L 3MWYW 3BZDB 3K5MA 4YIJA 3O13A 1B44D 2XWBB 1B1ZA 1OXUA 3JAML 4G7HC 1B53A 1HTLD 2IX1A 2XNAC 1GHKA 1DCZA 1A3TA 3CQZB 3V05A 5BN3A 3SE0A 3H6MA 3R3OA 5C3XA 5KNBA 2NN6I 1KLGD 4DFAA 2B63B 1C48A 3A8KE 1EY9A 4I7ZC 2B2WA 4NP5A 5IGFA 5IT9L 1MBYA 2PQEA 3S1NB 3OMCA 4BY7B 1SNPA 2C5CA 1LT6D 1E2ZA 1EY5A 2QDBA 1FNUA 1TVXA 1BQQT 1Y1VB 5M3MB 3S2HB 3HOUB 1TY0A 2LS01 2EY5A 1QJOA 4F8MA 5CC4A 1JOOA 3D4DA 1SE3A 1VMCA 3K5NA 1OXTA 2Z4IA 5KIXA 2NVTB 4G7ZC 3NWTA 2G9DA 2SNMA 3GV6A 1SYFA 3I73A 4HMIA 3T13A 5D65A 5KYIA 5KYLA 3D3RA 3C2PA 2QEJC 1PTOD 2FHTA 3G6JB 1WTRA 1Q3LA 1IL8A 5IGGA 1I50B 5IGBA 4C1NK 4NMZA 1B50A 5JJZA 5CBAE 1LTSD 5LL6X 2AQ3B 1NAPA 1I4GA 1SYBA 2TMPA 3BDLA 4K6DA 3K7AB 1SSOA 1NR4A 2R6GA 2O5IC 1PMRA 5DAUA 1I3QB 4DN4M 4UDUC 3NE5B 2EE1A 3QG1A 3S17B 1ET9A 4TKOB 4V0BA 3PO2B 1V43A 4MN3A 2BOSA 3HOWB 4IFDI 4HAEA 1V1PA 1BNZA 4KI0A 4IUVA 2R7ZB 1S5FD 3HOXB 3HKZB 1IYUA 4EVOA 5J1ZA 4KK7A 2WB1B 4XYQA 1Y8NB 2MUYA 5HGTA 3T51B 1EWCA 4XQQA 3KLRA 3VR4A 4CHTB 2A6HD 2KVMA 4C3JG 1HUNA 1STEA 1HXYD 3PUWA 3C1EA 3GTKB 4KHVA 2AQ1B 4ILWA 5BN5A 2F0WA 4Y7NB 2IW3A 4DNTB 1BO0A 1OXVA 3P20A 1JOQA 2ZXPA 1CFMA 1MI2A 1Q12A 2K04A 3HOZB 2DY8A 3HOYB 1B3AA 2DNCA 2PZTA 3T4AC 1SNOA 1DOLA 5LL6S 2NYZD 4I65A 5ELCA 5I9PA 4A3FB 3IL8A 2WACA 1HA6A 1YNJD 1LLRD 1G291 4Z9CB 1STBA 2WKCA 1DJRD 2TSSA 1EIHA 3J80E 5CORA 2PCFB 1EY4A 5EKLA 3ITPA 2JP1A 4H13C 1EQVA 3VR3A 3D4RA 4FP5D 4QIWB 1U4PA 5C4ZA 3DWAA 2L0CA 3SK8A 1WCMB 2BDNA 1F9QA 1O7LA 2AWNA 1EU3A 3DMUA 2PZUA 3F2UA 2JXMB 1IKMA 2EZVA 5I2XA 1E2VA 3TDQA 3WDNA 2O2LD 2XVSA 5EQ0A 1PLFA 1DOMA 5EKIA 1STHA 4A3MB 4XIGS 3PIO3 4TRDA 1F9PA 1TKWB 2NN6G 3NPPA 4HMJA 2E74C 1WD1A 1FNWA 2A6EC 2F0OA 5T1IA 1EOTA 3DM1A 4FVMA 3A8JE 3EJIA 2F0QA 1SFOB 5DNFA 2X6LA 5EPKA 3GV3A 1JCKB 3UI2A 4J1MA 3JAME 2K7VA 1ET6A 1Q90A 1D1IA 3RD4A 5EBCA 4EGVA 2BA0A 2IWHA 3X3MA 1X3QA 1SJED 1EYAA 3GTJB 1BR9A 1F2LA 5C0XH 3CRLC 3T56B 5CBEE 1FGBD 1HRJA 3FVQA 1BDOA 2L12A 1RDPD 4RGMA 1Q1EA 5IT9E 3C1FA 1RCVD 3RMHA 3I90A 5ELBA 4HTHA 2DNEA 1UUPA 3D6CA 2OT2A 2F0IA 4HEDA 2B2UC 4KN4C 2B39A 3N52A 3KBGA 2NWGA 3AMUA 2VUMB 4K5XA 1LTBD 3D4WA 3I70A 3S9WA 1EIGA 1QILA 4M8AA 1JC7A 3Q22A 4QCLA 4LK1C 5FLXE 1ZEQX 4ZRZA 3MFGA 4OIJA 1Z47A 4IFDG 5KGUA 1BUVT 1MD2D 2CW0C 2M9VA 1BCPC 1EY6A 3S15B 4IURA 1O80A 1FNVA 1BF4A 1O78A 2A69C 4BA2I 2K03A 4G57A 2OEOA 1MSHA 1R4PB 3P1HA 1Y69U 3URYA 4IUUA 2Z8LA 1VMPA 3A55A 1UEAB 4IUNA 1STNA 3DWQA 2HCIA 2E2HB 4DAVA 1G6ZA 1PDQA 1TWAB 3KBXA 5JPNC 2A6ED 2JA5B 2EJFC 4X3UA 2AUJD 2SNSA 2SOBA 4KKSA 4F87A 1H9RA 4CJ2C 4TQUS 5K36H 2KJXA 5D14A 4X3TA 4QUCA 2VB2X 3J80L 4HCEA 3LNNA 2A73B 1HCZA 2CQAA 1AFPA 1J9OA 2KEEA 1ICWA 5J22A 2FMCA 3CRKC 3SXHA 2BE5C 1F77A 2K28A 4FNFA 5CV7A 1ZKOA 2JEAI 1RTOA 3LWEA 5NUCA 2X6GA 4C3IG 3K6OA 4RGNA 5C5MA 4XQNA 5FKAC 4NKLA 4A3KB 2PZWA 3PUYA 4K5VA 4XTCS 3M4OB 3BDOA 3L7ZC 3RUZA 2Q8TA 1SYDA 4CKCA 1XWEA 1AW7A 3TP5A 5CV5A 4O42A 5IGEA 3G7LA 4QB4A 3SDZA 3V2TA 3TBIB 5C4HA 5E3FA 4KJOA 4HR7B 1TQOA 1JICA 1SYEA 2IT1A 5EJWA 1PRTD 1I4PA 1WTPA 3BG3A 3L3OC 1RF2D 2DN8A 2EJMA 1BCPF 4IFDJ 3SK5A 3E5SA 4DNRB 1EU4A 5EKKA 2K33A 2F1MA 1G91A 2CW0D 4C1NI 2H4OA 2JA6B 2SEBD 3BYYB 4K8JA 4KTAA 1KABA 3KLSX 1HFNA 1SE2A 4FYDA 3DXJC 4CJ0B 1QNKA 3S1RB 2K5QA 4ABNA 3IFTA 5FOBB 1S5BD 3I8ZA 4K5WA 3WOFA 1J8IA 2EYLA 4FXGC 4XT1B 3S1QB 2BCOA 2PNRC 3OWFA 4ZQ3A 3FDTA 4A3EB 4A3JB 4Q5VA 1GUNA 4XDXA 3ERQA 1KDBA 4H44C 3GP7A 1IW7D 1I4HA 3BVMA 5FLXL 2RDGA 2NVYB 1OXXK 3NUCA 2B2YC 3A8IE 4KKUA 1BCPB 1QNUA 4G7OC 1SJHD 4FF1A 2BE5D 1CA6A 2XIWA 3VA5A 2F0KA 2ZXOA 1HPCA 4DGZA 2AQ2B 3IKJA 3RLFA 1A3UA 5JVG3 2O5JC 1ENFA 3DHQA 1UAPA 1H9SB 1C4QA 3TZUA 1IYVA 2F0NA 3EA6A 1SNCA 1X32A 1F2ZA 2E76C 1GUOA 1LT4D 2JE6I 3VA7A 3I91A 3GTMB 2B2TC 3MTSA 4TSSA 4RFBA 2F0VA 5IIFA 3QWNA 4DK1A 2IPKD 2FMMA 2EDGA 4R9WA 1BOSA 5JOBA 2OF1A 1EY8A 1GUWA 4A93B 2M00A 3X3NA 3OIPA 4CKBA 1D1KA 5DM63 3FEWX 3VR2A 4FF2A 2D9UA 2B2UA 3TN2A 1JWSD 2A74C 1S5CD 2XN9C 2NVQB 1JWUD 1H9MA 2BA1A 2F0SA 3J7YW 3TP6A 1IKLA 1V8QA 1F2YA 1K83B 2I07B 1B9MA 1GXDC 1O7YA 2WINB 4C3HB 3A7LA 5TSSA 3H3VC 1OXSC 1M8AA 4CBVA 4OHJA 2NZ1D 1JB3A 3PUVA 1WTVA 1CHQD 2RA4A 2HCCA 3NXWA 2YU9B 4KY6A 1D5ZC 2Q8RE 5I9OA 1OO9B 4E6IA 4RH6A 5JEAH 3P75A 1EZ8A 1JORA 2LKVA 1AP0A 2RDHA 4A3DB 1HFGA 1Y8PB 4PNYA 2L5TA 2K05A 4KY5A 2L1BA 3KK7A 5C0XI 2E2JB 2KECA 3KLSA 2I46A 1SAPA 4PQXA 1E2WA 4RGTA 3PUZA 5I4DA 2J7ZA 1CM9A 1KDCA 3DEOA 2ZT9C 1TU2B 1U4MA 3M85A 4KV6A 3GTLB 1WTWA 4R8IA 4K6LA 4DAPA 2A5HA 2QILA 4NW2A 3DUZA 2G9HD 4OIKA 2X69A 5E4WC 1Q8IA 4FO2A 3K5LA 3GQBA 1FR3A 1W6JA 2VXWA 5C5LA 2B2VC 2F0DA 4AYBB 3K0YA 2R3ZA 1JE4A 1D5XC 3QO2A 2XRQD 4MHEA 2EYHA 1S5ED 2J0TD 3LWUA 3NWSA 1G2TA 1I6VC 4XQJA 5FK9C 5JVH3 3MZ5A 1A6XA 1AZQA 1EWHA 5KNCA 3HGBA 4H7BA 1TR5A 4RGOS 1TS4A 4C2MB 3K57A 1GUTA 4WFN3 3MXPA 1SYGA 2E75C 3FKIB 4U673 3VYRA 1S4ZA 1KAAA 1CTMA 1ENAA 4KD4A 2ICIA 2RQXA 2VB3X 1PTOH 3C46A 1RTNA 1ZXTA 3LX0A 1STYA 2QF7A 4ZUJA 4JBWA 1GUGA 1VF7A 1RODA 1RD9D 4KJNA 5IOCA 3I4NB 2F0LA 1K8OA 3NK9A 1B2TA 1B4OA 3RZDB 4IUQA 2RVLA 3NQIA 3T53B 3ND8A 2EXZA 4G4KA 2ICEC 3NTHA 3R2IA 2R61A 1SMYC 1ZYRC 1STAA 3MXUA 1EEFD 2PO4A 4PMBA 2F0JA 1F9RA 2NTTA 1EY0A 4OO1H 1RKNA 4RAUC 1ILPA 4LAAA 1ENCA 4RCOA 1QG7A 2B2YA 1R9TB 4HSVA 4PMCA 4QF4A 5CV6A 1DYQA 5JAVA 4RKBA 2EYJA 4KKTA 5C4XB 2KUMA 5AFWA 2D5DA 3QJYA 4Q0FA 1BXTA 4IZ8A 5FO9B 4IUTA 1XX8A 2KHSA 2ID0A 4KN7C 1SYCA 1TS3A 3Q23A 1G2SA 1HQMC 1Z7TA 2B2TA 3VYSA 3Q24A 3BYTB 1LT3D 1A2UA 4N9PA 5M9OA 1LTTD 2NBFA 5A35A 3W2DA 1LTRD 2MJ8A 2QCPX 3GTGB 4KY7A 3NSWA 3OMGA 2CVRA 1AN8A 5JPMC 2E2IB 3AU7A 1B9NA 3FPPA 5G3LF 3C3LA 3PMFA 4K14A 3J7AF 3S2DB 1S5DD 3SHLA 3P7JA 3J7AV 1A15A 3OIQA 1HTPA 3GD7A 1EQTA 1HA5A 2MPMA 2KEDA 4K2LA 2NTSA 4K2KA 2CHBD 1CQVA 2A68C 2EJGC 2N55A 4N9TA 2C9OA 4DU9A 1II3A 5C44B 2K5DA 3S14B 1F9SA 1Y8OB 1ESFA 1QWYA 4C3HG 1A3VA 5C0XG 1HQRD 1PFNA 1DONA 4K8IA 4XT3B 3HG9A 5C4JB 4BWGB 3K58A 3SR1A 1EFID 4ODGA 3U9OA 3MXNA 1H9JA 1ML0D 5ELFA 1VF5C 1ZYRD 2BDOA 4ZYSA 2F0MA 3D8GA 3HS0C 4BBRB 1R4QB 1SBBB 5A2QE 2IX3A 4B9WA 3R93A 2EVBA 3BVGA 4ZKBB 2RKSA 2K6AA 3NBIA 4EQNA 2XWJB 1C8CA 5ELEA 3NQTA 2NB0A 1I4XA 3SVMA 4A3BB 5CV8A 4XXEA 3E6ZX 3NP8A 3TP7A 4J8QA 5KNDA 1BCPD 4IQZA 1RJTA 1PFBA 3I3CA 4KD3A 2F0UA 2XRSD 2A69D 5M5YB 4RCNA 5M3FB 1QCBD 3HRZC 3MVVA 3MA2B 1TS2A 4WORA 3BS1A 4B9XA 4DXFA 1EY7A 1CI3M 1JR0D 2K01A 1PXUA 2A6HC 2GA4B 2D62A 5D3DA 5I6WA 3M3YB 2MGSA 4U68A 2N88A 1LO5D 3HEJA 4FF3A 1AEXA 3HP3A 3R8BA 4J6HA 2B2VA 3TZDA 1V1PB 1TWCB 5LHY1 3A7AB 3FRPB 4RKLA 4V190 4A3IB 2KCNA 2JSOA 1QOHA 1KLUD 3EVQA 4X3SA 1Y1WB 1HUMA 4C56C 1I4QA 4HSPA 3AB9A 5HURA 1PRTB 3QOJA 2A68D 5K36G 3BDCA 3I4LA 2PYKA 1TWFB 3GO5A 2WAQB 2Z1CA 5EBDA 4OGQC 5C0XJ 1PTOF 2KQ3A 1YNJC 4DF7A 1XXGA 5EGTA 2R92B 3TSSA 1CT1D 2L11A 2JA7B 1KTKA 1TWGB 1DM0B 2RSOA 1I4RA 2EY6A 5C3EB 3NTKA 2F0FA 4PMWA 5E4XA 1GHJA 2RBMA 4HN7A 1XTCD 2VNUD 4DA2A 2B8FA 3H91A 1VCIA 3ONAB 2F0GA 1D6EC 2L4NA 1DZ1A 1I6HB 2KA7A 5BN4A 2JEBI 2FFKB 2FINB 4JK1C 3OWEB 4QUFA 2NN6H 4LJZC 5KEEA 3VYTA 2F0EA 2K32A 2DY7A 3HOVB 3L9AX 1QE6A 5C3WA 4UAIA 4ME5A 5J39A 4L6TB 2NUCA 1PFMA 1TT2A 1NSNS 5EPJA 1LV9A 1PTOB 4FXDA 2WKDA 1A2TA 5CMDA 2F03A 1HHVA 2EY2A 1XYIA 3PUXA 1LT5D 3CHBD 4RHRA 1H9SA 3KUPA 4C3IB 4ZUIA 5T1GA 1AZPA 2WIIB 5A2QL 2K5WA 3M4YA 4CKEA 2F3VA 3E0JA 3GTPB 1ESRA 1VDZA 1QB5D 3IAYA 3CU7A 5I6YA 1L0XB 1SNQA 2L55A 5K5PA 2HUGA 4DXGA 4A3GB 1WTOA 1PZID 3A56A 4H0LC 1LABA 1CZWA 3A54A 2K1BA 1BBXC 1TWHB 5ELDA 3PO3B 3ND9A 1GUSA 4EQOA 1CA5A 1EEID 4M1UB 4ZAIA 1SE4A 3KF8A 4IFDH 5E1FA 2HQEA 2Z4HA 1KNEA 2FJ2A 2IX0A 2EYFA 3K5OA 3VR5A 1STGA 5CR3A 1SXTA 1D2BA 2LMCB 4EQPA 4KHZA 1K8MA 4X3KA 4DK0A 1DD2A 2WP8J 2Q8IB 4OO1I 2B2WC 3Q6SA 4CJ1B 4L63B 4RHSA 1PZJD 1U4LA 4IALA 5EPLA 3NHHA 3QOLA 3W3AA 3Q0AA 1EL0A 4P2CB 4GZYC 1JWMD 2RDFA 5KRUA 1GOZA 3M7NA 1G8ZD 1KNAA 2JA8B 5ISRA 1X3PA 2F0HA 2SDFA 1E0BA 3S16B 3S1MB 3OW7A 1LACA 4QMGA 3BVZA 4BY1B 4BBSB 2LY7A 2HDMA 1NCVA 1LTGD 3N6RA 1YNNC 3M7GA 1T5EA 3R2TA 3J81E 1T5XD 4XYOA 3MEHA 3MAQA 4WJWA 2F0TA 4L8JA 2M2LA 3PIP3 2V4DA 3NTIA 2PW7A 4F88A 4IN3A 3V96A 3SK6A 2AWOA 2PPBC 4DAYA 3NBHA 1F2MA 1EYCA 3I72A 3VR6A 3VYUA 5F2DA 1SEBD 1H9KA 1FD7D 3SK4A 5IGDA 1RHPA 1PYWD 4PV1C 4ID6A 1L0YB 5I2YA 2R93B 2EYOA 5M5WB 1JOKA 4IUPA 3T16A 3WOEA 5JEAG 3MXGA 5CGKA 2L9HA 2EOTA 3TP8A 3MHBA 2XSCA 3H09A 4O1NA 5FO8B 5IGCA 4RA8A 3MFYA 4C3JB 1WTQA 2NVXB 1PRTC 1U9RA 4ZKCB 2Y0SB 1GJXA 3K59A 5CV9A 4KMUC 4B08A 1NR2A 2OXPA 4BS9A 1JQYD 4LMQD 1TS5A 2EYPA 4ULLA 3EQLC 1EZ6A 3D31A 1SNMA 3FMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0W A;  2F0U A;  4KD3 A;  1SYF A;  3MEH A;  5DEH A;  1STH A;  3S9W A;  2EXZ A;  2EYL A;  4KV6 A;  4HMI A;  5NUC A;  3MVV A;  2F0T A;  2F0S A;  3T13 A;  5KYI A;  4TRD A;  5KYL A;  3TP6 A;  1JOQ A;  2PW7 A;  4WOR A;  2F0G A;  4K2L A;  4HMJ A;  1IHZ A;  4B9X A;  3D4W A;  3OWF A;  4ZQ3 A;  1EY7 A;  4K2K A;  5C5M A;  1STA A;  1F2Y A;  4PMB A;  3SK6 A;  2F0O A;  2F0J A;  4NKL A;  4EQO A;  2PZW A;  5I6W A;  4N9T A;  1EY0 A;  5KGU A;  4R8N A;  4DU9 A;  3HEJ A;  3ERO A;  5IGG A;  1F2M A;  3ERQ A;  1KDB A;  1EYC A;  3OSO A;  1II3 A;  3EJI A;  4K5V A;  2F0Q A;  4YIJ A;  5C5L A;  1RKN A;  3RUZ A;  5IGB A;  1EY6 A;  5KEE A;  1NUC A;  2F0D A;  2PZT A;  1SYD A;  5F2D A;  1SNO A;  1AEX A;  4LAA A;  2F0E A;  3NUC A;  4J6H A;  4WRD A;  4NMZ A;  1ENC A;  2EYH A;  3SK4 A;  3TP5 A;  5CV5 A;  3QB3 A;  5E1F A;  5C3W A;  5IGD A;  5IGE A;  4I65 A;  4QB4 A;  4ME5 A;  3V2T A;  1A3V A;  2HQE A;  4G57 A;  2OEO A;  4J1M A;  4KJO A;  5E3F A;  5C4H A;  5I9P A;  3VA5 A;  5J39 A;  1TQO A;  1SYB A;  2NUC A;  3BDL A;  1KDA A;  1SYE A;  2F0K A;  2EYF A;  4K6D A;  4K8I A;  2WAC A;  4ID6 A;  1A3T A;  1STG A;  5CR3 A;  4DGZ A;  3P1H A;  2EY1 A;  1TT2 A;  4PMC A;  3SR1 A;  4OL7 A;  1NSN S;  4QF4 A;  1A3U A;  2EYO A;  2PW5 A;  4RKL A;  5CV6 A;  4EQP A;  5JAV A;  4MIU A;  1STB A;  5DAU A;  3DHQ A;  3NXW A;  4RKB A;  3MZ5 A;  1JOK A;  3T16 A;  4ODG A;  2EYJ A;  3U9O A;  3H6M A;  3R3O A;  1EYA A;  2F0N A;  3EVQ A;  5C3X A;  4IUN A;  1STN A;  1SNC A;  4KY6 A;  1SND A;  4H7B A;  5CGK A;  1TR5 A;  1F2Z A;  4DFA A;  4IZ8 A;  2F0M A;  1A2T A;  3SK5 A;  3E5S A;  4IAL A;  1EY9 A;  5I9O A;  5HUR A;  3TP8 A;  4NP5 A;  4E6I A;  2KHS A;  3NHH A;  3D8G A;  3QOJ A;  3QOL A;  4NDX A;  5IGF A;  3MHB A;  3MXP A;  1SYG A;  2EY2 A;  5EKK A;  3P75 A;  2PQE A;  1SYC A;  3OMC A;  2RDF A;  1SNP A;  1EY4 A;  2SNS A;  3BDC A;  2F0P A;  1EZ8 A;  5IGC A;  5KRU A;  2SOB A;  2F0V A;  3ITP A;  5EKL A;  3TME A;  4B9W A;  2PYK A;  5C6A A;  5IIF A;  1JOR A;  2LKV A;  4K8J A;  4F7X A;  4KTA A;  2ENB A;  4EVO A;  1EY5 A;  3C1F A;  1KAA A;  1ENA A;  1KAB A;  4KD4 A;  5J1Z A;  1EQV A;  2RKS A;  5ISR A;  2QDB A;  5IOD A;  2KQ3 A;  4DF7 A;  1EYD A;  4PNY A;  1A2U A;  4EQN A;  5EGT A;  4N9P A;  5HGT A;  5M9O A;  2F0H A;  4KY5 A;  4S3S A;  1U9R A;  4ZUI A;  3NQT A;  4HTH A;  5C4Z A;  3LX0 A;  1STY A;  3D6C A;  2EY5 A;  5JOB A;  2OF1 A;  2F0I A;  4ZUJ A;  5CV8 A;  1EY8 A;  5CV9 A;  4QMG A;  3SK8 A;  2F3V A;  4F8M A;  5CV4 A;  1JOO A;  5CC4 A;  2M00 A;  3NP8 A;  3D4D A;  2O4X A;  2OXP A;  4KY7 A;  3TP7 A;  3OMG A;  5I6Y A;  5KIX A;  5J22 A;  2EYM A;  2EY6 A;  3DMU A;  2PZU A;  3C1E A;  3HZX A;  2EYP A;  4KJN A;  5IOC A;  1SNQ A;  3SXH A;  2F0F A;  1EZ6 A;  2F0L A;  2F3W A;  4KHV A;  5K5P A;  3PMF A;  4K14 A;  2SNM A;  3NK9 A;  4K5W A;  1SNM A;  3SHL A;  4K5X A;  1KDC A;  2RBM A;  5CV7 A; 
#chains in the Genus database with same CATH topology
 5C3E G;  2EPB A;  5DEH A;  1LTI D;  2ASB A;  1O7Z A;  3H94 A;  4CGY B;  1E1T A;  4CDF C;  1CK1 A;  4DV5 Q;  4RWS C;  2AUK A;  1FGU A;  3OOC A;  1IHZ A;  2F4I A;  2HDL A;  1CZG A;  5COY A;  3GTO B;  2F4V L;  3GTQ B;  5D3I B;  1CHP D;  5FO7 B;  5CYU A;  1HNW Q;  3KJO A;  3JC6 6;  3SEB A;  2E2D C;  3OYY A;  4LF5 Q;  1LTA D;  2JYO A;  2PMZ B;  4ZLT F;  4HCS A;  4R8N A;  1U4R A;  3I4M B;  3ERO A;  3ER0 A;  3OHX C;  3OSO A;  1VQP A;  2JA8 H;  1FL0 A;  1DGS A;  2WV6 D;  1NUC A;  1UNS A;  1ONL A;  1EOV A;  2I5L X;  4WRD A;  4CDE C;  1DOK A;  1WVL A;  4FXK C;  3S16 H;  5L37 A;  1I94 L;  3QB3 A;  2UXC Q;  1YNN D;  5G3L D;  4ZK9 B;  3FPU B;  2RSN A;  3D6W A;  3H0G B;  1KDA A;  3DEP A;  1MSG A;  3EFX D;  1M4V A;  4BY1 H;  1WD0 A;  4FF4 A;  3HOV G;  4DR2 Q;  3QR8 A;  2EY1 A;  4OL7 A;  3DWP A;  2PW5 A;  2YYZ A;  4MIU A;  4BA1 I;  3OPO A;  1XPR A;  2KCC A;  1EYG A;  2YV5 A;  1SDF A;  2D2C C;  3G48 A;  3UDX A;  1SND A;  1DXM A;  3IFD A;  1KXL A;  2H1E A;  2LFN A;  1IW7 C;  1MGS A;  1ILQ A;  4JVZ A;  1Z6H A;  2Q2H A;  4NDX A;  4JI8 Q;  4OEM B;  3U4V A;  2PQA B;  4B3T Q;  2MP1 A;  2F0P A;  1SMX A;  4O2D A;  1TY2 A;  1QVC A;  3TME A;  5C6A A;  3CCQ A;  3CKI B;  4F7X A;  2ENB A;  4DAM A;  3UE1 A;  1FYC A;  1PTO C;  1WTX A;  4GN4 B;  5IOD A;  1EYD A;  3ZYY X;  4LFB Q;  4B3M Q;  2MHV A;  4R4T A;  1S3O A;  1SMY D;  4S3S A;  1TII D;  2ZXR A;  2QKI C;  3QIA A;  1XPO A;  5JEA J;  1V1O A;  5CV4 A;  3ULP A;  2O4X A;  3I55 A;  2UU9 L;  5IWA Q;  2IL8 A;  2EYM A;  3HZX A;  5M5X B;  1CQF A;  2A19 A;  2IJ0 A;  2Q2I A;  2F3W A;  2R93 H;  2J4X A;  3CCJ A;  1CSQ A;  5M5W H;  5GAG C;  2JN4 A;  2KCM A;  1EFW A;  3MC0 B;  3PV0 A;  3RZO B;  3U9S A;  1PZK D;  5DM7 3;  2D0P A;  4YCU A;  4DR3 L;  3ZJY C;  4OO1 G;  4A3G G;  1PRT F;  3PCO B;  1PV4 A;  2KOL A;  1D5M C;  1W6K A;  4H02 A;  3H15 A;  1Q1B A;  2F3I A;  2B8G A;  3J81 L;  4YY3 L;  3NEM A;  3MWY W;  1FJG L;  3BZD B;  3PO3 G;  3K5M A;  4YIJ A;  3O13 A;  1B44 D;  1JMC A;  2XWB B;  1B1Z A;  1OXU A;  3JAM L;  4G7H C;  1B53 A;  4J15 A;  2UUB Q;  1HTL D;  2IX1 A;  2XNA C;  2K5H A;  1YZ6 A;  1GHK A;  1DCZ A;  1A3T A;  3CQZ B;  3V05 A;  1NTG A;  1N32 L;  4DV2 Q;  5BN3 A;  3SE0 A;  3H6M A;  3R3O A;  5C3X A;  3KFU A;  5KNB A;  1NJI C;  2NN6 I;  1QVF A;  1KLG D;  4DFA A;  1Q81 C;  2B63 B;  1C48 A;  3A8K E;  4OX9 L;  1EY9 A;  4I7Z C;  2B2W A;  4NP5 A;  5IGF A;  2UUA L;  1AE3 A;  1MBY A;  5IT9 L;  5JJI A;  2PQE A;  4BXX G;  2PQA A;  3OMC A;  3S1N B;  4BY7 B;  1SNP A;  2C5C A;  1LT6 D;  1VQK A;  1E2Z A;  1EY5 A;  1YJN A;  4K0K Q;  3I4M H;  2QDB A;  1FNU A;  1TVX A;  1BQQ T;  1EWI A;  1Y1V B;  4GS3 A;  3SGI A;  5M3M B;  3S2H B;  3HOU B;  1TWA H;  1TY0 A;  2LS0 1;  2EY5 A;  4X66 Q;  1QJO A;  2JA5 H;  4F8M A;  5CC4 A;  1JOO A;  3D4D A;  1SE3 A;  1VMC A;  3K5N A;  1OXT A;  2Z4I A;  5KIX A;  3T1Y L;  2NVT B;  4G7Z C;  4UP8 A;  3NWT A;  2G9D A;  2SNM A;  1M90 C;  3GV6 A;  4BBS G;  3KYH C;  1SYF A;  3I73 A;  3TQY A;  5IY0 A;  4HMI A;  3T13 A;  5D65 A;  5KYI A;  4HID A;  5KYL A;  4OWW B;  3CC2 A;  3D3R A;  3C2P A;  2QEJ C;  4EX5 A;  2UXD L;  1NMF A;  1PTO D;  2FHT A;  3G6J B;  2MQH A;  1WTR A;  1J6Q A;  3T1H Q;  1Q3L A;  1IL8 A;  5IGG A;  1I50 B;  5IGB A;  3GDE A;  1X65 A;  4HIK A;  4C1N K;  4NMZ A;  3I4N G;  1B50 A;  1WYD A;  4L5T A;  1XMO Q;  5JJZ A;  5CBA E;  1LTS D;  5LL6 X;  4YCW A;  2AQ3 B;  1NAP A;  1I4G A;  3BDL A;  1SYB A;  2TMP A;  1KL9 A;  4K6D A;  3K7A B;  1SSO A;  1P8L A;  1NR4 A;  2R6G A;  2O5I C;  1PMR A;  5M5X H;  4A3K H;  3CME A;  4DR7 Q;  5DAU A;  1I3Q B;  4DUY L;  4DN4 M;  4UDU C;  3NE5 B;  2EE1 A;  3QG1 A;  2HHH L;  2AHO B;  3M4O H;  3S17 B;  1ET9 A;  4TKO B;  2PNH A;  4V0B A;  3RZO H;  2Q2U A;  1HR0 Q;  3PO2 B;  1V43 A;  4MN3 A;  2E5L L;  4LF4 L;  1E3P A;  2BOS A;  3HOW B;  4IFD I;  3EBE A;  4HAE A;  2QW7 A;  1V1P A;  4JI2 Q;  5FJ8 G;  1BNZ A;  4KI0 A;  4IUV A;  2R7Z B;  1S5F D;  3HOX B;  4DV5 L;  1NMG A;  3HKZ B;  1IYU A;  4EVO A;  3F2B A;  5J1Z A;  4KK7 A;  2WB1 B;  2L15 A;  4XYQ A;  1X54 A;  3S24 A;  1HNW L;  1Y8N B;  2MUY A;  5HGT A;  3T51 B;  1VQ9 A;  3J80 c;  4LF5 L;  4JOI A;  1EWC A;  4Y52 H;  4XQQ A;  4PG3 A;  3KLR A;  3VR4 A;  4CHT B;  2A6H D;  2KVM A;  3STB C;  1W2B A;  4C3J G;  1HUN A;  1STE A;  4I7A A;  1HXY D;  4GKJ Q;  1WFQ A;  3PUW A;  5FLM H;  3C1E A;  2Y0S G;  1X3F A;  3GTK B;  4YHH L;  4KHV A;  2AQ1 B;  4ILW A;  4JI6 Q;  2ATW A;  5BN5 A;  4AYB E;  2F0W A;  4Y7N B;  1YHA A;  3TS0 A;  4MNO A;  2IW3 A;  4DNT B;  5IYD H;  3CCL A;  4LUZ A;  1BO0 A;  3P20 A;  1OXV A;  1JOQ A;  3S1R H;  1I5F A;  4X62 L;  2ZXP A;  1CFM A;  1MI2 A;  1L0W A;  1Q12 A;  4BY7 H;  2K04 A;  3HOZ B;  2DY8 A;  4JI8 L;  3HOY B;  1B3A A;  2DNC A;  2PZT A;  2N78 A;  2N8N A;  3T4A C;  1SNO A;  1DOL A;  1K0S A;  5LL6 S;  2NYZ D;  3HOU H;  4I65 A;  5ELC A;  4LFB L;  3LGJ A;  5I9P A;  4JYA Q;  4A3F B;  3IL8 A;  1SRO A;  1LTL A;  4A3E H;  4B3M L;  2WAC A;  1HA6 A;  3EIV A;  1YNJ D;  4JI5 Q;  1LLR D;  1G29 1;  1S72 A;  4Z9C B;  1STB A;  4IPC A;  3H0G G;  1CKN B;  4RMF A;  5IWA L;  2NVY H;  2WKC A;  3F8T A;  1DJR D;  2ZM6 Q;  2TSS A;  2YTX A;  1EIH A;  2K4K A;  3J80 E;  5COR A;  2PCF B;  1EY4 A;  1SRU A;  2VL6 A;  5EKL A;  3ITP A;  4OEL B;  2JP1 A;  2E8G A;  5E7N A;  5LMU Q;  4H13 C;  4OON A;  1EQV A;  3J81 i;  1I50 H;  3VR3 A;  3D4R A;  3PF4 A;  4FP5 D;  1U5K A;  2EQS A;  2UUC Q;  4QIW B;  1U4P A;  5C4Z A;  3DWA A;  2L0C A;  4UPA A;  3CCR A;  5EAY A;  3SK8 A;  1WCM B;  1RL2 A;  1BBU A;  4R1J A;  4DKA C;  3CXC A;  2BDN A;  1F9Q A;  1O7L A;  2AWN A;  3K7A H;  1EU3 A;  3DMU A;  2PZU A;  3F2U A;  2JXM B;  1A63 A;  1IKM A;  2EZV A;  5I2X A;  1E2V A;  3TDQ A;  2WFW A;  2UUB L;  3WDN A;  2O2L D;  2IHE A;  2XVS A;  5ELN A;  1YJW A;  5EQ0 A;  1PLF A;  1MJE A;  1DOM A;  5EKI A;  3J81 j;  1KC8 C;  1STH A;  1D8L A;  4A3M B;  4R4O A;  4XIG S;  2IHF A;  3PIO 3;  4TRD A;  1F9P A;  1HZB A;  1TKW B;  2NN6 G;  1N8R C;  1HNX Q;  3NPP A;  4DUZ L;  4HMJ A;  1H95 A;  4A93 H;  2E74 C;  5H1S E;  4UHV A;  1WD1 A;  2IY5 B;  1FNW A;  1K8G A;  2A6E C;  2F0O A;  2R7Z H;  3A74 A;  5T1I A;  1EOT A;  3DM1 A;  1VQ8 A;  4FVM A;  4JI1 Q;  3PSI A;  3A8J E;  3EJI A;  2F0Q A;  2AMC B;  4JPB W;  1SFO B;  2Z6K C;  5DNF A;  2X6L A;  5EPK A;  3GV3 A;  2Y0S E;  3FHW A;  4NXM Q;  1JCK B;  4GN3 B;  2CCZ A;  4K0K L;  3UI2 A;  1CKO A;  4J1M A;  3JAM E;  2K7V A;  1ET6 A;  1Q90 A;  1D1I A;  3RD4 A;  5EBC A;  4N8F A;  4PZ7 A;  4EGV A;  4X66 L;  3GTK H;  2BA0 A;  2IWH A;  3X3M A;  1HJP A;  1X3Q A;  1SJE D;  1EYA A;  1CKN A;  4YWK A;  4C3H H;  1BR9 A;  1F2L A;  3GTJ B;  5C0X H;  3CRL C;  3T56 B;  5CBE E;  1FGB D;  1K8A C;  2FXQ A;  1HRJ A;  3FVQ A;  5GAH C;  4JI0 Q;  1BDO A;  2L12 A;  2B63 G;  1RDP D;  4RGM A;  1A0I A;  1Q1E A;  3CMA A;  5IT9 E;  3C1F A;  5IYB H;  1RCV D;  2YU9 H;  2UXB L;  4BY7 G;  3HOY H;  2QA4 A;  1YNX A;  3RMH A;  3CCS A;  3T1H L;  1VQJ A;  4AH6 A;  3I90 A;  5ELB A;  1ICF B;  2DNE A;  1UUP A;  4HTH A;  4HIM A;  4LF8 Q;  3D6C A;  1PYB A;  4A3I G;  2OT2 A;  2F0I A;  1JJC B;  4HED A;  2B2U C;  1Y1V G;  4A3F H;  2RHQ B;  5M3M G;  1ASZ A;  4OWT B;  1LUZ A;  4KN4 C;  4DV1 L;  2B39 A;  3N52 A;  3RLN A;  3KBG A;  4A3D H;  2NWG A;  3AMU A;  4LFA L;  2VUM B;  1V1Q A;  4K5X A;  1LTB D;  2LSS A;  3D4W A;  3I70 A;  2F52 A;  3S9W A;  1EIG A;  1QIL A;  4NB3 A;  1E1O A;  2QDL A;  1JC7 A;  4M8A A;  3Q22 A;  2E2J H;  4DR7 L;  4LK1 C;  4QQB X;  4QCL A;  3HFZ B;  5FLX E;  2WAQ G;  1ZEQ X;  5IE8 A;  3ICE A;  4ZRZ A;  3MFG A;  2Q2T A;  4GLA C;  1Z47 A;  4OIJ A;  1K0R A;  1HR0 L;  5IYC H;  4B3S Q;  4IFD G;  5KGU A;  1BUV T;  1MD2 D;  2CW0 C;  2M9V A;  3MXN B;  1BCP C;  1EY6 A;  3S15 B;  4IUR A;  1O80 A;  2JA9 A;  3GTL H;  1FNV A;  3K80 C;  4GOP B;  1BF4 A;  1O78 A;  3CC4 A;  2A69 C;  1B7Y B;  4BA2 I;  2K03 A;  1WCM H;  4G57 A;  2OEO A;  4IPH A;  4PZ6 A;  3BU2 A;  1MSH A;  1R4P B;  3P1H A;  1Y69 U;  2RF4 A;  3URY A;  2RCN A;  2Z8L A;  4IUU A;  1IBL L;  4AQY Q;  4POF A;  1AH9 A;  1JB7 A;  1VMP A;  3A55 A;  1UEA B;  4IUN A;  1STN A;  3DWQ A;  2Z6B A;  2HCI A;  1YIJ A;  4DAV A;  1WJJ A;  4JI7 Q;  2E2H B;  1PDQ A;  1G6Z A;  1TWA B;  4A3M H;  1VQ6 A;  3KBX A;  5JPN C;  2A6E D;  4LF9 L;  2JA5 B;  4JI6 L;  2EJF C;  4X3U A;  2AUJ D;  1VQH A;  1HZA A;  4DR5 Q;  2SNS A;  1K73 C;  3H3V I;  2SOB A;  3PO2 G;  4KKS A;  4N8X 1;  2ALY B;  1E24 A;  4F87 A;  3HOW G;  1H9R A;  4CJ2 C;  3M9B A;  4TQU S;  1YEZ A;  5K36 H;  1VQB A;  1FVI A;  1SFO H;  2KJX A;  2R7Z G;  3HOX G;  3HKZ G;  5D14 A;  1VQO A;  4X3T A;  4QUC A;  4C2M H;  2VB2 X;  3J80 L;  4HCE A;  3Q8D A;  3LNN A;  2A73 B;  1HCZ A;  2CQA A;  4HJ8 A;  1AFP A;  3KLW A;  1XMQ L;  1J9O A;  2KEE A;  1ICW A;  3FKI H;  5J22 A;  2FMC A;  4L5R C;  3CRK C;  1VQC A;  3SXH A;  2BE5 C;  3OTO Q;  1F77 A;  4JYA L;  2K28 A;  2K50 A;  3DM3 A;  4FNF A;  5CV7 A;  1ZKO A;  3GTJ H;  3CF5 A;  1QUQ A;  2JEA I;  1RTO A;  4QL5 A;  3LWE A;  5NUC A;  1VQA A;  4IJH A;  2CQO A;  2X6G A;  4C3I G;  5IP9 H;  3K6O A;  4DV3 L;  4RGN A;  5C5M A;  1KAW A;  4XQN A;  4P73 A;  5FKA C;  4NKL A;  4A3K B;  2PZW A;  3PUY A;  4K5V A;  1X3G A;  4XTC S;  3M4O B;  3BDO A;  3L7Z C;  3RUZ A;  3RZD H;  3M4P A;  2Q8T A;  1X55 A;  1SYD A;  1VQG A;  4CKC A;  1XWE A;  1PH6 A;  3HOZ G;  5LMU L;  1AW7 A;  3TP5 A;  2KEN A;  5CV5 A;  4LF7 Q;  4O42 A;  5IGE A;  3G7L A;  4QB4 A;  3SDZ A;  3V2T A;  3TBI B;  5C4H A;  5E3F A;  4KJO A;  4HR7 B;  5HGQ A;  1NY4 A;  1TQO A;  1X6O A;  1JIC A;  1SYE A;  2UUC L;  3UDF A;  2IT1 A;  2WAQ E;  5EJW A;  3A5U A;  1PRT D;  1I4P A;  1WTP A;  3BG3 A;  2VUM H;  3L3O C;  1K28 A;  1RF2 D;  2DN8 A;  2EJM A;  1BCP F;  4IFD J;  3SK5 A;  1KQS A;  3E5S A;  2K5N A;  3E3X A;  4DNR B;  1EU4 A;  4DV0 Q;  5EKK A;  2K33 A;  2F1M A;  1HNZ Q;  3H3V H;  1G91 A;  2CW0 D;  1R9T H;  4C1N I;  2H4O A;  2JA6 B;  1N34 Q;  2SEB D;  3BYY B;  4K8J A;  4KTA A;  1HNX L;  4DPG A;  1KAB A;  3KLS X;  1HFN A;  4NXN Q;  1LYL A;  2K14 A;  3S15 H;  1SE2 A;  4FYD A;  3K7U C;  3DXJ C;  3K81 C;  4JI1 L;  4CJ0 B;  1YJ9 A;  1QNK A;  1GD7 A;  3S1R B;  4IPG A;  1CSP A;  2K5Q A;  4ABN A;  3IFT A;  5FOB B;  5IP7 H;  1S5B D;  1VQF A;  4B3R Q;  3I8Z A;  1SE8 A;  4MTK A;  4K5W A;  1K3R A;  3WOF A;  2JQO A;  1IBK Q;  2E2H H;  1XNR L;  1J8I A;  2EYL A;  4FXG C;  3I2Z A;  1PA6 A;  4XT1 B;  3S1Q B;  2JA8 G;  1Y14 B;  2BCO A;  2PNR C;  3OWF A;  3GTG H;  4ZQ3 A;  4DV7 Q;  3FDT A;  4A3E B;  4A3M G;  3RNU A;  4JI3 L;  4A3J B;  1Q82 C;  2E2I H;  4Q5V A;  1GUN A;  1K9M C;  4XDX A;  4QJF A;  3ERQ A;  1KDB A;  2KHJ A;  4H44 C;  3GP7 A;  4DV4 Q;  1IW7 D;  1I4H A;  4JI0 L;  3BVM A;  4IOA A;  1WOC A;  4BY1 G;  2RDG A;  2NVY B;  5FLX L;  2N49 A;  2YTY A;  4LUO A;  1OXX K;  3NUC A;  2B2Y C;  3A8I E;  4KKU A;  1BCP B;  1PH4 A;  2V1C C;  1QNU A;  4G7O C;  2Z6K A;  1SJH D;  3EN2 A;  4FF1 A;  2BE5 D;  1CA6 A;  1PH3 A;  2XIW A;  4A3C H;  3VA5 A;  2F0K A;  2H5X A;  2ZXO A;  1HPC A;  4DGZ A;  2AQ2 B;  3IKJ A;  3RLF A;  1A3U A;  5JVG 3;  2O5J C;  1ENF A;  3DHQ A;  1UAP A;  1H9S B;  1C4Q A;  3TZU A;  1IYV A;  5C44 H;  2F0N A;  3EA6 A;  1SNC A;  1X32 A;  3S14 H;  1F2Z A;  4UP7 A;  2E76 C;  1GUO A;  1LT4 D;  5ELO A;  2JE6 I;  3U50 C;  3VA7 A;  5LMN Q;  3I91 A;  3GTM B;  2B2T C;  2ZJQ A;  3MTS A;  4TSS A;  3UDI A;  4RFB A;  2F0V A;  1C0A A;  5IIF A;  3QWN A;  4DK1 A;  2IPK D;  2FMM A;  2HIV A;  2EDG A;  3KF6 B;  4R9W A;  4B3S L;  4WJ3 M;  1BOS A;  2R93 G;  3CCE A;  4JC0 A;  5JOB A;  2CFM A;  2OF1 A;  3NEL A;  4IO9 A;  1EY8 A;  2CH4 W;  4BBR H;  4DR6 L;  1GUW A;  4A93 B;  2M00 A;  3X3N A;  3OIP A;  4CKB A;  1D1K A;  2I5M X;  5DM6 3;  4FDB A;  1KHI A;  3FEW X;  3VR2 A;  4FF2 A;  1PVO A;  2D9U A;  2B2U A;  3TRE A;  3TN2 A;  1JWS D;  2A74 C;  5GAD C;  1S5C D;  2XN9 C;  2NVQ B;  1JWU D;  1H9M A;  4NPS A;  4P72 A;  2BA1 A;  3CC7 A;  2F0S A;  4A3B H;  3J7Y W;  3TP6 A;  2RCF A;  1IKL A;  1BBW A;  1V8Q A;  4X65 Q;  2MO1 A;  5JJL A;  1F2Y A;  2JA6 H;  3E9I A;  1K83 B;  2DGY A;  2I07 B;  2QEX A;  1B9M A;  1GXD C;  1O7Y A;  2WIN B;  2UXC L;  1QZH A;  4DR5 L;  4C3H B;  4QIW E;  2F4V Q;  1PH1 A;  1E7Z A;  3A7L A;  5TSS A;  4DR2 L;  5M5Y H;  5M3F H;  3H3V C;  1OXS C;  1S40 A;  4APV A;  3E0E A;  1M8A A;  3MEF A;  4OHJ A;  3J80 i;  4CBV A;  2NZ1 D;  3PUV A;  1JB3 A;  3AEV A;  1WTV A;  1NE3 A;  1CHQ D;  2RA4 A;  2AKW B;  2HCC A;  3NXW A;  2YU9 B;  4KY6 A;  4B3T L;  4GOP C;  1D5Z C;  2Q8R E;  3AQQ A;  2NZH A;  3OTO L;  4MZ9 A;  5I9O A;  3S1Q H;  1OO9 B;  3BZK A;  3I4M G;  4E6I A;  2OWO A;  4RH6 A;  5JEA H;  3P75 A;  1YHB A;  1EZ8 A;  1AE2 A;  1JOR A;  2LKV A;  4A3J H;  1AP0 A;  2RDH A;  4A3D B;  3ULL A;  2JA5 G;  1HFG A;  1Y8P B;  2A1A A;  4PNY A;  1Y1W H;  2L5T A;  2EIF A;  2JK8 A;  2KBN A;  3KF6 A;  2K05 A;  3KK7 A;  2L1B A;  4KY5 A;  1JJG A;  5C0X I;  2E2J B;  2KEC A;  4JBK A;  1X56 A;  3U4Z A;  2A8V A;  3KLS A;  2I46 A;  1SAP A;  4PQX A;  1E2W A;  4LNQ A;  3I56 A;  1TWF H;  4RGT A;  2VQF Q;  3PUZ A;  1N9W A;  5I4D A;  2J7Z A;  1CM9 A;  1MHW C;  1KDC A;  2UU9 Q;  3DEO A;  2R92 H;  2ZT9 C;  1GO3 E;  1TU2 B;  1U4M A;  3M85 A;  2JA7 H;  4KV6 A;  3GTL B;  1WTW A;  4LUV A;  4R8I A;  4K6L A;  4DAP A;  1TWG H;  4IOC A;  2A5H A;  2QIL A;  3GTM H;  3JAM i;  4NW2 A;  3DUZ A;  2G9H D;  2ZJR A;  4OIK A;  5C3E H;  2X69 A;  4DR3 Q;  5E4W C;  1Q8I A;  4FO2 A;  3NEN A;  3K5L A;  2D0O A;  3GQB A;  1JJ2 A;  1FR3 A;  1W6J A;  4LFC Q;  4DV0 L;  2VXW A;  1WI5 A;  5C5L A;  1HNZ L;  3CCU A;  2B2V C;  2F0D A;  4AYB B;  2OQ0 A;  3K0Y A;  2R3Z A;  4JV5 Q;  4YWM A;  4A3K G;  1JE4 A;  1D5X C;  3QO2 A;  4YY3 Q;  2XRQ D;  4MHE A;  3G4S A;  2EYH A;  3KOJ A;  1S5E D;  2DUD A;  2J0T D;  3LWU A;  4DV2 L;  4L5S A;  3NWS A;  1G2T A;  2KHI A;  1I6H H;  1MKH A;  3BZC A;  1I6V C;  4XQJ A;  5FK9 C;  5JVH 3;  3MZ5 A;  1A6X A;  2GN5 A;  1AZQ A;  1EWH A;  5KNC A;  4LF6 Q;  2NVQ H;  3HGB A;  4H7B A;  1TR5 A;  4RGO S;  3STB D;  3RN2 A;  1TS4 A;  5BR8 Q;  4C2M B;  3HOV H;  5GRO A;  2VS1 A;  4X6A H;  3K57 A;  1C7Y A;  3PIP A;  1GUT A;  3CP0 A;  4WFN 3;  3PGZ A;  3MXP A;  1N36 Q;  1SYG A;  1L2F A;  2E75 C;  3FKI B;  4U67 3;  1VQ7 A;  3VYR A;  1K83 H;  4JBM A;  1KAA A;  1S4Z A;  1CTM A;  1ENA A;  4KD4 A;  2UUA Q;  4A3L H;  4DV7 L;  2ICI A;  2JA6 G;  3A0J A;  5FLM G;  2RQX A;  2VB3 X;  1PTO H;  1O7I A;  3C46 A;  2VZA A;  1RTN A;  1ZXT A;  3LX0 A;  1STY A;  2QF7 A;  4ZUJ A;  4JBW A;  1BVS A;  1GUG A;  5AJ3 Q;  1VF7 A;  3WWV A;  3CD6 A;  1ROD A;  3RR5 A;  1EIY B;  4P75 A;  1RD9 D;  2PMZ E;  4KJN A;  5IOC A;  5IYD G;  4ME3 A;  3I4N B;  1C9O A;  2F0L A;  1K8O A;  3NK9 A;  1A8V A;  1B2T A;  1B4O A;  3RZD B;  4IUQ A;  2RVL A;  3NQI A;  3T53 B;  3ND8 A;  2EXZ A;  4G4K A;  2ICE C;  3NTH A;  3R2I A;  1IBM Q;  1B70 B;  4GLV B;  3GTP H;  2R61 A;  1SMY C;  1ZYR C;  2MFI A;  1STA A;  3G6E A;  4MTN A;  3MXU A;  1EEF D;  2PO4 A;  4PMB A;  3HOU G;  2F0J A;  1IL2 A;  1XMO L;  3FP9 A;  1F9R A;  2NTT A;  1EY0 A;  2ZTE A;  5LMN L;  4OO1 H;  4A3G H;  4A3E G;  1RKN A;  4RAU C;  3TEH B;  1ILP A;  4LAA A;  4A76 A;  5HY6 A;  1ENC A;  4RCO A;  3ERS X;  1KIX A;  1L1O B;  1QG7 A;  4UP9 A;  3PO3 H;  1KD1 C;  2B2Y A;  1R9T B;  1CKM A;  4HSV A;  4PMC A;  4QF4 A;  5CV6 A;  1DYQ A;  5JAV A;  4RKB A;  2EYJ A;  1UE5 A;  1WTH A;  4KKT A;  5C4X B;  2KUM A;  1YHQ A;  1M1K C;  4JI2 L;  5AFW A;  2D5D A;  3QJY A;  4Q0F A;  1BXT A;  4IZ8 A;  5FO9 B;  4IUT A;  1XX8 A;  2DJG C;  1XPU A;  2KHS A;  2ID0 A;  1HR0 W;  2HHH Q;  4OXP A;  1XNQ Q;  4KN7 C;  3CAM A;  1SYC A;  1TS3 A;  3Q23 A;  1G2S A;  1HQM C;  1Z7T A;  1CUK A;  4R4I A;  2B2T A;  3VYS A;  4LF4 Q;  3Q24 A;  3BYT B;  1LT3 D;  1MIU A;  4X65 L;  1IZ6 A;  2HD3 A;  1A2U A;  2LXJ A;  4N9P A;  4GKJ L;  5M9O A;  4BXX H;  1LTT D;  2NBF A;  5A35 A;  3W2D A;  2VW9 A;  1LTR D;  4EQ5 A;  1UEB A;  3I4O A;  2MJ8 A;  2QCP X;  3GTG B;  4KY7 A;  3NSW A;  3OMG A;  2CVR A;  1AN8 A;  4HJ7 A;  1GVP A;  1B3Q A;  5JPM C;  2E2I B;  3AU7 A;  1HZ9 A;  1B9N A;  3FPP A;  5G3L F;  3C3L A;  3PMF A;  4K14 A;  3J7A F;  3S2D B;  4DK6 C;  4A93 G;  1S5D D;  3SHL A;  4X64 Q;  3P7J A;  4DK3 C;  3RLO A;  1Z9F A;  3J7A V;  4HIO A;  3RN5 A;  1A15 A;  3OIQ A;  4GNX B;  3S1M H;  1HTP A;  4YHH Q;  1VQN A;  3GD7 A;  1VS0 A;  1EQT A;  1HA5 A;  2MPM A;  2WB1 G;  2KED A;  4K2L A;  2NTS A;  3UE0 A;  4PZ8 A;  1Q46 A;  4K2K A;  1U0L A;  1QZG A;  4BBS H;  5JJK A;  1J5E Q;  1SR3 A;  2CHB D;  1CQV A;  2A68 C;  2EJG C;  3UDG A;  2N55 A;  4N9T A;  2C9O A;  4DU9 A;  4X62 Q;  4JI4 Q;  4ALP A;  1II3 A;  5C44 B;  2K5D A;  3CCV A;  3S14 B;  1F9S A;  2CWP A;  1Y8O B;  1ESF A;  4JI5 L;  4A3L G;  2OCE A;  3W5O A;  1A62 A;  1L1O A;  1QWY A;  4C3H G;  1A3V A;  1PH5 A;  5C0X G;  1HQR D;  1PFN A;  1DON A;  4K8I A;  4XT3 B;  3HG9 A;  5C4J B;  4BWG B;  1W3S A;  3K58 A;  3SR1 A;  2ZM6 L;  1K3B C;  3I4N H;  1UE7 A;  1EFI D;  2XTI A;  4ODG A;  1JT8 A;  3U9O A;  3MXN A;  1H9J A;  4KHP Q;  1EQQ A;  1ML0 D;  5ELF A;  1VF5 C;  1ZYR D;  2BDO A;  1VQL A;  3G71 A;  4ZYS A;  2F0M A;  1RIP A;  5IYB G;  2VQF L;  3HOY G;  4GOP A;  3D8G A;  3HS0 C;  2HT1 A;  4BBR B;  1VQI A;  1R4Q B;  3AFP A;  3L2P A;  1SBB B;  5A2Q E;  2IX3 A;  1NNX A;  1SN8 A;  4B9W A;  2RHS B;  3R93 A;  2EVB A;  3BVG A;  4ZKB B;  4DR4 Q;  4CDC C;  1B8A A;  2RKS A;  2K6A A;  4DR1 Q;  4A3F G;  3NBI A;  4EQN A;  2XWJ B;  1C8C A;  5ELE A;  5FJ8 H;  4A3D G;  1HH2 P;  3NQT A;  2NB0 A;  1I4X A;  3SVM A;  1YI2 A;  4A3B B;  4LFC L;  5CV8 A;  4XXE A;  3TRZ A;  3E6Z X;  3NP8 A;  3TP7 A;  4JBJ A;  4J8Q A;  5KND A;  4TVA B;  4JV5 L;  1BCP D;  3PQI A;  1EQR A;  4IQZ A;  1XTD A;  1V9P A;  1RJT A;  4C3J H;  1PFB A;  3I3C A;  3AYH B;  2F0U A;  2XRS D;  4KD3 A;  5C4X H;  5IYC G;  2NVX H;  2A69 D;  4A75 A;  4DV6 Q;  3W1G A;  5M5Y B;  4RCN A;  4GNX A;  1QCB D;  3HRZ C;  3MVV A;  5M3F B;  3MA2 B;  1TS2 A;  3I7F A;  1VQ4 A;  4WOR A;  3BS1 A;  4LF6 L;  4B9X A;  1YIT A;  4DXF A;  1EY7 A;  1PH8 A;  1CI3 M;  1JR0 D;  2K01 A;  5BR8 L;  1PXU A;  2A6H C;  2GA4 B;  2D62 A;  4NXM L;  5D3D A;  5I6W A;  1D7Q A;  3M3Y B;  2MGS A;  4U68 A;  2N88 A;  1LO5 D;  1WCM G;  3HEJ A;  1N36 L;  1T9H A;  4DUZ Q;  2GVA A;  4HJ5 A;  4FF3 A;  1MJC A;  1AEX A;  3HP3 A;  3R8B A;  4J6H A;  1PH9 A;  1OTC A;  4WJ4 A;  2B2V A;  1VQE A;  3TZD A;  2OTL A;  1V1P B;  1TWC B;  4AYB G;  3GTO H;  5LHY 1;  4R4C A;  3GTQ H;  2PI2 A;  3A7A B;  3FRP B;  3HKZ E;  1VQM A;  2QGQ A;  2ZTD A;  4RKL A;  4V19 0;  4A3I B;  1VQ5 A;  2KCN A;  2JSO A;  2WB1 E;  5AJ3 L;  3S2D H;  1QOH A;  1KLU D;  3EVQ A;  4X3S A;  1Q8K A;  1Y1W B;  1HUM A;  4C56 C;  1I4Q A;  4HSP A;  3AB9 A;  5HUR A;  1PRT B;  3QOJ A;  2A68 D;  5K36 G;  3H0G H;  2I5H A;  3BDC A;  3I4L A;  2PYK A;  4LF8 L;  2B29 A;  1TWF B;  3GO5 A;  1IBM L;  2WAQ B;  2Z1C A;  1QVG A;  5EBD A;  4OGQ C;  5C0X J;  1PTO F;  3B6Y A;  2CH4 A;  1YNJ C;  2KQ3 A;  4DF7 A;  1XXG A;  3FKI G;  5EGT A;  2R92 B;  3J7Z C;  3TSS A;  1CT1 D;  2L11 A;  2JA7 B;  3CPW A;  1KTK A;  1TWG B;  1DM0 B;  2UXB Q;  1GKH A;  2K75 A;  2RSO A;  1Q86 C;  2Z0S A;  1I4R A;  2EY6 A;  5C3E B;  5C4J H;  3NTK A;  1TXY A;  2F0F A;  2VQE Q;  4PMW A;  5E4X A;  5IP9 G;  2MO0 A;  1GHJ A;  4IJL A;  2RBM A;  2ZTC A;  4HN7 A;  4DV1 Q;  1XTC D;  2VNU D;  4DA2 A;  2B8F A;  3H91 A;  1VCI A;  3ONA B;  2F0G A;  4LFA Q;  1D6E C;  2L4N A;  1DZ1 A;  3HKS A;  2G5D A;  1I6H B;  2KA7 A;  5BN4 A;  2JEB I;  2FFK B;  2FIN B;  4JK1 C;  1XNQ L;  3OWE B;  4QUF A;  2NN6 H;  4CDD C;  4LJZ C;  2LXK A;  5KEE A;  1P16 A;  3VYT A;  2F0E A;  2K32 A;  3KF8 B;  2DY7 A;  3HOV B;  3L9A X;  1QE6 A;  5C3W A;  3OW2 A;  2VUM G;  4UAI A;  4ME5 A;  4AQY L;  3F1Z A;  5J39 A;  4L6T B;  1YVC A;  2NUC A;  1N33 Q;  4GKK Q;  4JI7 L;  1PFM A;  1TT2 A;  1NSN S;  5EPJ A;  5J3B A;  2R7D A;  1LV9 A;  3KDF B;  1L1O C;  1PTO B;  2CWA A;  2K5V A;  4FXD A;  2WKD A;  1PYS B;  1A2T A;  5CMD A;  3ULJ A;  4QGU A;  4HJA A;  2F03 A;  5C4X G;  4X64 L;  1IBL Q;  1HHV A;  2EY2 A;  1PHJ A;  4POG A;  1XYI A;  3PUX A;  1LT5 D;  1PH7 A;  3CHB D;  3CQZ H;  4R4Q A;  3M3Y H;  1I94 Q;  4LF9 Q;  4RHR A;  1UE1 A;  2GVB A;  1H9S A;  3KUP A;  4C3I B;  1J5E L;  5IP7 G;  2B63 H;  4ZUI A;  5T1G A;  1AZP A;  2WII B;  5A2Q L;  2K5W A;  2CKZ B;  4JI4 L;  3M4Y A;  4CKE A;  2F3V A;  3E0J A;  3GTP B;  1ESR A;  1VDZ A;  1QB5 D;  1XJV A;  3IAY A;  3CU7 A;  3S1N H;  1TWC H;  1BKB A;  3CW2 C;  1YBY A;  4JG2 A;  5I6Y A;  4ZCK A;  1L0X B;  1SNQ A;  2L55 A;  5K5P A;  2HUG A;  4A3I H;  4DXG A;  4A3G B;  1WTO A;  1UE6 A;  4LWC A;  1PZI D;  3A56 A;  4H0L C;  1XMQ Q;  1Y1V H;  3K0X A;  5M3M H;  3S2H H;  1LAB A;  1CZW A;  2HQL A;  3PF5 A;  3A54 A;  3A5Z B;  2K1B A;  1BBX C;  1TWH B;  5ELD A;  3PO3 B;  3ND9 A;  4KHP L;  1GM5 A;  2NVT H;  3J81 c;  1GUS A;  4DAY B;  2DJF C;  4EQO A;  1CA5 A;  4LF7 L;  3NBH B;  1EEI D;  4A3C G;  4M1U B;  4GNX C;  3CPF A;  4DV3 Q;  4ZAI A;  3JAM c;  3W1B A;  3F2D A;  1G6P A;  4DR4 L;  3E9H A;  1SE4 A;  3KF8 A;  4IFD H;  2VY3 A;  1E22 A;  5E1F A;  5C44 G;  4DR1 L;  2HQE A;  2OQK A;  4JCV E;  1KRT A;  2Z4H A;  1KNE A;  2FJ2 A;  2ES2 A;  2IX0 A;  2EYF A;  3K5O A;  3VR5 A;  3L0O A;  1STG A;  5CR3 A;  2ZJP A;  1SXT A;  1D2B A;  2LMC B;  2C35 B;  4EQP A;  4KHZ A;  1K8M A;  4X3K A;  2I0Q A;  1VQD A;  4DK0 A;  1DD2 A;  2WP8 J;  2Q8I B;  4OO1 I;  2B2W C;  3Q6S A;  3KDF A;  4CJ1 B;  4L63 B;  4A4I A;  2YTV A;  1N34 L;  2BH8 A;  4RHS A;  1PZJ D;  3PIO A;  1U4L A;  4IAL A;  5EPL A;  1X3E A;  3K8A A;  4L5Q A;  1X9N A;  3NHH A;  3QOL A;  3W3A A;  5IT9 c;  3IRB A;  3Q0A A;  1FJG Q;  1Q7Y C;  1EL0 A;  4NXN L;  4P2C B;  4GZY C;  1JWM D;  2RDF A;  1EIF A;  4DV6 L;  5KRU A;  1GOZ A;  1NBW A;  3M7N A;  1G8Z D;  4BBR G;  4LW1 A;  1KNA A;  1I3Q H;  2JA8 B;  1IYJ B;  2JJQ A;  5ISR A;  3S17 H;  1SLJ A;  1LM0 A;  1X3P A;  2F0H A;  2SDF A;  1E0B A;  3PO2 H;  3S16 B;  3S1M B;  3OW7 A;  4B3R L;  1LAC A;  4QMG A;  3HOW H;  1N32 Q;  3BVZ A;  4O0A A;  4BY1 B;  4BBS B;  2LY7 A;  2HDM A;  3HOX H;  1NCV A;  1IBK L;  4A3B G;  1LTG D;  2Z9H A;  3N6R A;  3U58 A;  1UWV A;  1YNN C;  4UY8 C;  4OX9 Q;  3M7G A;  1T5E A;  3R2T A;  5FLX c;  3J81 E;  2EXD A;  1HZC A;  1T5X D;  4XYO A;  4JW0 A;  2P5Z X;  3MEH A;  3MAQ A;  2XGT A;  4WJW A;  2F0T A;  4L8J A;  4YCV A;  2M2L A;  2OTJ A;  3PIP 3;  2V4D A;  3NTI A;  2PW7 A;  4DV4 L;  3CCM A;  4GN5 A;  4F88 A;  3DLL A;  4IN3 A;  3V96 A;  5M3F G;  3SK6 A;  1XNR Q;  2AWO A;  2PPB C;  4DAY A;  3NBH A;  1F2M A;  1EYC A;  3I72 A;  3VR6 A;  3VYU A;  5F2D A;  1SEB D;  1H9K A;  4Y7N H;  4C3I H;  4JI3 Q;  3T1Y Q;  3KJP A;  1IXR A;  1FD7 D;  3SK4 A;  5IGD A;  4QY7 A;  4GLX A;  1G51 A;  1RHP A;  1KRS A;  1PYW D;  4PV1 C;  2R7F A;  3TS2 A;  4HJ9 A;  4ID6 A;  1L0Y B;  5I2Y A;  4IPD A;  3HOZ H;  2R93 B;  2EYO A;  2B3G A;  4OWX B;  2HIX A;  5M5W B;  1JOK A;  4IUP A;  3T16 A;  3WOE A;  5JEA G;  1ASY A;  2KCT A;  3MXG A;  5CGK A;  2UXD Q;  2BH2 A;  2L9H A;  4A3J G;  3BJU A;  3D0F A;  2VQE L;  2EOT A;  3TP8 A;  4YWL A;  2MNA A;  3MHB A;  4P71 A;  1Y1W G;  1TWH H;  2XSC A;  3H09 A;  5LMN W;  4O1N A;  5FO8 B;  5IGC A;  1PH2 A;  2K52 A;  4RA8 A;  4JOI C;  3F2C A;  1QUQ B;  3J7A 5;  1EUJ A;  3MFY A;  4C3J B;  2N3S A;  5GAE C;  1WTQ A;  2NVX B;  1PRT C;  4P74 A;  5DLQ E;  4RG1 A;  1U9R A;  5GQO A;  4ZKC B;  3AFQ A;  3VDY A;  2Y0S B;  1GJX A;  3K59 A;  5CV9 A;  4KLK A;  4KMU C;  4B08 A;  2PI2 E;  4DUY Q;  2R92 G;  1NR2 A;  2OXP A;  4DNI A;  1JE5 A;  2NZO A;  4BS9 A;  2JA7 G;  1JQY D;  4LMQ D;  1TS5 A;  2EYP A;  4ULL A;  3EQL C;  4AIM A;  1PFS A;  1EZ6 A;  3D31 A;  2E5L Q;  4DR6 Q;  3M4Q A;  1SNM A;  1N33 L;  3FMC A;  4GKK L; 
#chains in the Genus database with same CATH homology
 2EPB A;  5DEH A;  1LTI D;  1O7Z A;  3H94 A;  4CGY B;  1CK1 A;  4RWS C;  2AUK A;  3OOC A;  1IHZ A;  2F4I A;  2HDL A;  1CZG A;  5COY A;  3GTO B;  3GTQ B;  5D3I B;  1CHP D;  5FO7 B;  5CYU A;  3SEB A;  2E2D C;  1LTA D;  2JYO A;  2PMZ B;  4ZLT F;  4HCS A;  4R8N A;  1U4R A;  3I4M B;  3ERO A;  3OHX C;  3OSO A;  2WV6 D;  1NUC A;  1UNS A;  1ONL A;  4WRD A;  1DOK A;  1WVL A;  4FXK C;  3QB3 A;  1YNN D;  5G3L D;  4ZK9 B;  3FPU B;  2RSN A;  3D6W A;  3H0G B;  1KDA A;  3DEP A;  1MSG A;  3EFX D;  1M4V A;  1WD0 A;  4FF4 A;  2EY1 A;  4OL7 A;  3DWP A;  2PW5 A;  2YYZ A;  4MIU A;  4BA1 I;  3OPO A;  2KCC A;  1SDF A;  2D2C C;  1SND A;  1DXM A;  3IFD A;  2H1E A;  2LFN A;  1IW7 C;  1MGS A;  1ILQ A;  1Z6H A;  4NDX A;  2MP1 A;  2F0P A;  3TME A;  1TY2 A;  5C6A A;  3CKI B;  4F7X A;  2ENB A;  1FYC A;  1PTO C;  1WTX A;  5IOD A;  1EYD A;  3ZYY X;  2MHV A;  1SMY D;  4S3S A;  1TII D;  2ZXR A;  2QKI C;  3QIA A;  5JEA J;  1V1O A;  5CV4 A;  2O4X A;  2IL8 A;  2EYM A;  3HZX A;  5M5X B;  1CQF A;  2IJ0 A;  2F3W A;  2J4X A;  3MC0 B;  3PV0 A;  3RZO B;  3U9S A;  1PZK D;  5DM7 3;  4OO1 G;  1PRT F;  2KOL A;  1D5M C;  1W6K A;  1Q1B A;  2B8G A;  3J81 L;  3MWY W;  3BZD B;  3K5M A;  4YIJ A;  3O13 A;  1B44 D;  2XWB B;  1B1Z A;  1OXU A;  3JAM L;  4G7H C;  1B53 A;  1HTL D;  2IX1 A;  2XNA C;  1GHK A;  1DCZ A;  1A3T A;  3CQZ B;  3V05 A;  5BN3 A;  3SE0 A;  3H6M A;  3R3O A;  5C3X A;  5KNB A;  2NN6 I;  1KLG D;  4DFA A;  2B63 B;  1C48 A;  3A8K E;  1EY9 A;  4I7Z C;  2B2W A;  4NP5 A;  5IGF A;  5IT9 L;  1MBY A;  2PQE A;  3S1N B;  3OMC A;  4BY7 B;  1SNP A;  2C5C A;  1LT6 D;  1E2Z A;  1EY5 A;  2QDB A;  1FNU A;  1TVX A;  1BQQ T;  1Y1V B;  5M3M B;  3S2H B;  3HOU B;  1TY0 A;  2LS0 1;  2EY5 A;  1QJO A;  4F8M A;  5CC4 A;  1JOO A;  3D4D A;  1SE3 A;  1VMC A;  3K5N A;  1OXT A;  2Z4I A;  5KIX A;  2NVT B;  4G7Z C;  3NWT A;  2G9D A;  2SNM A;  3GV6 A;  1SYF A;  3I73 A;  4HMI A;  3T13 A;  5D65 A;  5KYI A;  5KYL A;  3D3R A;  3C2P A;  2QEJ C;  1PTO D;  2FHT A;  3G6J B;  1WTR A;  1Q3L A;  1IL8 A;  5IGG A;  1I50 B;  5IGB A;  4C1N K;  4NMZ A;  1B50 A;  5JJZ A;  5CBA E;  1LTS D;  5LL6 X;  2AQ3 B;  1NAP A;  1I4G A;  1SYB A;  2TMP A;  3BDL A;  4K6D A;  3K7A B;  1SSO A;  1NR4 A;  2R6G A;  2O5I C;  1PMR A;  5DAU A;  1I3Q B;  4DN4 M;  4UDU C;  3NE5 B;  2EE1 A;  3QG1 A;  3S17 B;  1ET9 A;  4TKO B;  4V0B A;  3PO2 B;  1V43 A;  4MN3 A;  2BOS A;  3HOW B;  4IFD I;  4HAE A;  1V1P A;  1BNZ A;  4KI0 A;  4IUV A;  2R7Z B;  1S5F D;  3HOX B;  3HKZ B;  1IYU A;  4EVO A;  5J1Z A;  4KK7 A;  2WB1 B;  4XYQ A;  1Y8N B;  2MUY A;  5HGT A;  3T51 B;  1EWC A;  4XQQ A;  3KLR A;  3VR4 A;  4CHT B;  2A6H D;  2KVM A;  4C3J G;  1HUN A;  1STE A;  1HXY D;  3PUW A;  3C1E A;  3GTK B;  4KHV A;  2AQ1 B;  4ILW A;  5BN5 A;  2F0W A;  4Y7N B;  2IW3 A;  4DNT B;  1BO0 A;  1OXV A;  3P20 A;  1JOQ A;  2ZXP A;  1CFM A;  1MI2 A;  1Q12 A;  2K04 A;  3HOZ B;  2DY8 A;  3HOY B;  1B3A A;  2DNC A;  2PZT A;  3T4A C;  1SNO A;  1DOL A;  5LL6 S;  2NYZ D;  4I65 A;  5ELC A;  5I9P A;  4A3F B;  3IL8 A;  2WAC A;  1HA6 A;  1YNJ D;  1LLR D;  1G29 1;  4Z9C B;  1STB A;  2WKC A;  1DJR D;  2TSS A;  1EIH A;  3J80 E;  5COR A;  2PCF B;  1EY4 A;  5EKL A;  3ITP A;  2JP1 A;  4H13 C;  1EQV A;  3VR3 A;  3D4R A;  4FP5 D;  4QIW B;  1U4P A;  5C4Z A;  3DWA A;  2L0C A;  3SK8 A;  1WCM B;  2BDN A;  1F9Q A;  1O7L A;  2AWN A;  1EU3 A;  3DMU A;  2PZU A;  3F2U A;  2JXM B;  1IKM A;  2EZV A;  5I2X A;  1E2V A;  3TDQ A;  3WDN A;  2O2L D;  2XVS A;  5EQ0 A;  1PLF A;  1DOM A;  5EKI A;  1STH A;  4A3M B;  4XIG S;  3PIO 3;  4TRD A;  1F9P A;  1TKW B;  2NN6 G;  3NPP A;  4HMJ A;  2E74 C;  1WD1 A;  1FNW A;  2A6E C;  2F0O A;  5T1I A;  1EOT A;  3DM1 A;  4FVM A;  3A8J E;  3EJI A;  2F0Q A;  1SFO B;  5DNF A;  2X6L A;  5EPK A;  3GV3 A;  1JCK B;  3UI2 A;  4J1M A;  3JAM E;  2K7V A;  1ET6 A;  1Q90 A;  1D1I A;  3RD4 A;  5EBC A;  4EGV A;  2BA0 A;  2IWH A;  3X3M A;  1X3Q A;  1SJE D;  1EYA A;  3GTJ B;  1BR9 A;  1F2L A;  5C0X H;  3CRL C;  3T56 B;  5CBE E;  1FGB D;  1HRJ A;  3FVQ A;  1BDO A;  2L12 A;  1RDP D;  4RGM A;  1Q1E A;  5IT9 E;  3C1F A;  1RCV D;  3RMH A;  3I90 A;  5ELB A;  4HTH A;  2DNE A;  1UUP A;  3D6C A;  2OT2 A;  2F0I A;  4HED A;  2B2U C;  4KN4 C;  2B39 A;  3N52 A;  3KBG A;  2NWG A;  3AMU A;  2VUM B;  4K5X A;  1LTB D;  3D4W A;  3I70 A;  3S9W A;  1EIG A;  1QIL A;  4M8A A;  1JC7 A;  3Q22 A;  4QCL A;  4LK1 C;  5FLX E;  1ZEQ X;  4ZRZ A;  3MFG A;  4OIJ A;  1Z47 A;  4IFD G;  5KGU A;  1BUV T;  1MD2 D;  2CW0 C;  2M9V A;  1BCP C;  1EY6 A;  3S15 B;  4IUR A;  1O80 A;  1FNV A;  1BF4 A;  1O78 A;  2A69 C;  4BA2 I;  2K03 A;  4G57 A;  2OEO A;  1MSH A;  1R4P B;  3P1H A;  1Y69 U;  3URY A;  4IUU A;  2Z8L A;  1VMP A;  3A55 A;  1UEA B;  4IUN A;  1STN A;  3DWQ A;  2HCI A;  2E2H B;  4DAV A;  1G6Z A;  1PDQ A;  1TWA B;  3KBX A;  5JPN C;  2A6E D;  2JA5 B;  2EJF C;  4X3U A;  2AUJ D;  2SNS A;  2SOB A;  4KKS A;  4F87 A;  1H9R A;  4CJ2 C;  4TQU S;  5K36 H;  2KJX A;  5D14 A;  4X3T A;  4QUC A;  2VB2 X;  3J80 L;  4HCE A;  3LNN A;  2A73 B;  1HCZ A;  2CQA A;  1AFP A;  1J9O A;  2KEE A;  1ICW A;  5J22 A;  2FMC A;  3CRK C;  3SXH A;  2BE5 C;  1F77 A;  2K28 A;  4FNF A;  5CV7 A;  1ZKO A;  2JEA I;  1RTO A;  3LWE A;  5NUC A;  2X6G A;  4C3I G;  3K6O A;  4RGN A;  5C5M A;  4XQN A;  5FKA C;  4NKL A;  4A3K B;  2PZW A;  3PUY A;  4K5V A;  4XTC S;  3M4O B;  3BDO A;  3L7Z C;  3RUZ A;  2Q8T A;  1SYD A;  4CKC A;  1XWE A;  1AW7 A;  3TP5 A;  5CV5 A;  4O42 A;  5IGE A;  3G7L A;  4QB4 A;  3SDZ A;  3V2T A;  3TBI B;  5C4H A;  5E3F A;  4KJO A;  4HR7 B;  1TQO A;  1JIC A;  1SYE A;  2IT1 A;  5EJW A;  1PRT D;  1I4P A;  1WTP A;  3BG3 A;  3L3O C;  1RF2 D;  2DN8 A;  2EJM A;  1BCP F;  4IFD J;  3SK5 A;  3E5S A;  4DNR B;  1EU4 A;  5EKK A;  2K33 A;  2F1M A;  1G91 A;  2CW0 D;  4C1N I;  2H4O A;  2JA6 B;  2SEB D;  3BYY B;  4K8J A;  4KTA A;  1KAB A;  3KLS X;  1HFN A;  1SE2 A;  4FYD A;  3DXJ C;  4CJ0 B;  1QNK A;  3S1R B;  2K5Q A;  4ABN A;  3IFT A;  5FOB B;  1S5B D;  3I8Z A;  4K5W A;  3WOF A;  1J8I A;  2EYL A;  4FXG C;  4XT1 B;  3S1Q B;  2BCO A;  2PNR C;  3OWF A;  4ZQ3 A;  3FDT A;  4A3E B;  4A3J B;  4Q5V A;  1GUN A;  4XDX A;  3ERQ A;  1KDB A;  4H44 C;  3GP7 A;  1IW7 D;  1I4H A;  3BVM A;  5FLX L;  2RDG A;  2NVY B;  1OXX K;  3NUC A;  2B2Y C;  3A8I E;  4KKU A;  1BCP B;  1QNU A;  4G7O C;  1SJH D;  4FF1 A;  2BE5 D;  1CA6 A;  2XIW A;  3VA5 A;  2F0K A;  2ZXO A;  1HPC A;  4DGZ A;  2AQ2 B;  3IKJ A;  3RLF A;  1A3U A;  5JVG 3;  2O5J C;  1ENF A;  3DHQ A;  1UAP A;  1H9S B;  1C4Q A;  3TZU A;  1IYV A;  2F0N A;  3EA6 A;  1SNC A;  1X32 A;  1F2Z A;  2E76 C;  1GUO A;  1LT4 D;  2JE6 I;  3VA7 A;  3I91 A;  3GTM B;  2B2T C;  3MTS A;  4TSS A;  4RFB A;  2F0V A;  5IIF A;  3QWN A;  4DK1 A;  2IPK D;  2FMM A;  2EDG A;  4R9W A;  1BOS A;  5JOB A;  2OF1 A;  1EY8 A;  1GUW A;  4A93 B;  2M00 A;  3X3N A;  3OIP A;  4CKB A;  1D1K A;  5DM6 3;  3FEW X;  3VR2 A;  4FF2 A;  2D9U A;  2B2U A;  3TN2 A;  1JWS D;  2A74 C;  1S5C D;  2XN9 C;  2NVQ B;  1JWU D;  1H9M A;  2BA1 A;  2F0S A;  3J7Y W;  3TP6 A;  1IKL A;  1V8Q A;  1F2Y A;  1K83 B;  2I07 B;  1B9M A;  1GXD C;  1O7Y A;  2WIN B;  4C3H B;  3A7L A;  5TSS A;  3H3V C;  1OXS C;  1M8A A;  4CBV A;  4OHJ A;  2NZ1 D;  1JB3 A;  3PUV A;  1WTV A;  1CHQ D;  2RA4 A;  2HCC A;  3NXW A;  2YU9 B;  4KY6 A;  1D5Z C;  2Q8R E;  5I9O A;  1OO9 B;  4E6I A;  4RH6 A;  5JEA H;  3P75 A;  1EZ8 A;  1JOR A;  2LKV A;  1AP0 A;  2RDH A;  4A3D B;  1HFG A;  1Y8P B;  4PNY A;  2L5T A;  2K05 A;  4KY5 A;  2L1B A;  3KK7 A;  5C0X I;  2E2J B;  2KEC A;  3KLS A;  2I46 A;  1SAP A;  4PQX A;  1E2W A;  4RGT A;  3PUZ A;  5I4D A;  2J7Z A;  1CM9 A;  1KDC A;  3DEO A;  2ZT9 C;  1TU2 B;  1U4M A;  3M85 A;  4KV6 A;  3GTL B;  1WTW A;  4R8I A;  4K6L A;  4DAP A;  2A5H A;  2QIL A;  4NW2 A;  3DUZ A;  2G9H D;  4OIK A;  2X69 A;  5E4W C;  1Q8I A;  4FO2 A;  3K5L A;  3GQB A;  1FR3 A;  1W6J A;  2VXW A;  5C5L A;  2B2V C;  2F0D A;  4AYB B;  3K0Y A;  2R3Z A;  1JE4 A;  1D5X C;  3QO2 A;  2XRQ D;  4MHE A;  2EYH A;  1S5E D;  2J0T D;  3LWU A;  3NWS A;  1G2T A;  1I6V C;  4XQJ A;  5FK9 C;  5JVH 3;  3MZ5 A;  1A6X A;  1AZQ A;  1EWH A;  5KNC A;  3HGB A;  4H7B A;  1TR5 A;  4RGO S;  1TS4 A;  4C2M B;  3K57 A;  1GUT A;  4WFN 3;  3MXP A;  1SYG A;  2E75 C;  3FKI B;  4U67 3;  3VYR A;  1S4Z A;  1KAA A;  1CTM A;  1ENA A;  4KD4 A;  2ICI A;  2RQX A;  2VB3 X;  1PTO H;  3C46 A;  1RTN A;  1ZXT A;  3LX0 A;  1STY A;  2QF7 A;  4ZUJ A;  4JBW A;  1GUG A;  1VF7 A;  1ROD A;  1RD9 D;  4KJN A;  5IOC A;  3I4N B;  2F0L A;  1K8O A;  3NK9 A;  1B2T A;  1B4O A;  3RZD B;  4IUQ A;  2RVL A;  3NQI A;  3T53 B;  3ND8 A;  2EXZ A;  4G4K A;  2ICE C;  3NTH A;  3R2I A;  2R61 A;  1SMY C;  1ZYR C;  1STA A;  3MXU A;  1EEF D;  2PO4 A;  4PMB A;  2F0J A;  1F9R A;  2NTT A;  1EY0 A;  4OO1 H;  1RKN A;  4RAU C;  1ILP A;  4LAA A;  1ENC A;  4RCO A;  1QG7 A;  2B2Y A;  1R9T B;  4HSV A;  4PMC A;  4QF4 A;  5CV6 A;  1DYQ A;  5JAV A;  4RKB A;  2EYJ A;  4KKT A;  5C4X B;  2KUM A;  5AFW A;  2D5D A;  3QJY A;  4Q0F A;  1BXT A;  4IZ8 A;  5FO9 B;  4IUT A;  1XX8 A;  2KHS A;  2ID0 A;  4KN7 C;  1SYC A;  1TS3 A;  3Q23 A;  1G2S A;  1HQM C;  1Z7T A;  2B2T A;  3VYS A;  3Q24 A;  3BYT B;  1LT3 D;  1A2U A;  4N9P A;  5M9O A;  1LTT D;  2NBF A;  5A35 A;  3W2D A;  1LTR D;  2MJ8 A;  2QCP X;  3GTG B;  4KY7 A;  3NSW A;  3OMG A;  2CVR A;  1AN8 A;  5JPM C;  2E2I B;  3AU7 A;  1B9N A;  3FPP A;  5G3L F;  3C3L A;  3PMF A;  4K14 A;  3J7A F;  3S2D B;  1S5D D;  3SHL A;  3P7J A;  3J7A V;  1A15 A;  3OIQ A;  1HTP A;  3GD7 A;  1EQT A;  1HA5 A;  2MPM A;  2KED A;  4K2L A;  2NTS A;  4K2K A;  2CHB D;  1CQV A;  2A68 C;  2EJG C;  2N55 A;  4N9T A;  2C9O A;  4DU9 A;  1II3 A;  5C44 B;  2K5D A;  3S14 B;  1F9S A;  1Y8O B;  1ESF A;  1QWY A;  4C3H G;  1A3V A;  5C0X G;  1HQR D;  1PFN A;  1DON A;  4K8I A;  4XT3 B;  3HG9 A;  5C4J B;  4BWG B;  3K58 A;  3SR1 A;  1EFI D;  4ODG A;  3U9O A;  3MXN A;  1H9J A;  1ML0 D;  5ELF A;  1VF5 C;  1ZYR D;  2BDO A;  4ZYS A;  2F0M A;  3D8G A;  3HS0 C;  4BBR B;  1R4Q B;  1SBB B;  5A2Q E;  2IX3 A;  4B9W A;  3R93 A;  2EVB A;  3BVG A;  4ZKB B;  2RKS A;  2K6A A;  3NBI A;  4EQN A;  2XWJ B;  1C8C A;  5ELE A;  3NQT A;  2NB0 A;  1I4X A;  3SVM A;  4A3B B;  5CV8 A;  4XXE A;  3E6Z X;  3NP8 A;  3TP7 A;  4J8Q A;  5KND A;  1BCP D;  4IQZ A;  1RJT A;  1PFB A;  3I3C A;  4KD3 A;  2F0U A;  2XRS D;  2A69 D;  5M5Y B;  4RCN A;  5M3F B;  1QCB D;  3HRZ C;  3MVV A;  3MA2 B;  1TS2 A;  4WOR A;  3BS1 A;  4B9X A;  4DXF A;  1EY7 A;  1CI3 M;  1JR0 D;  2K01 A;  1PXU A;  2A6H C;  2GA4 B;  2D62 A;  5D3D A;  5I6W A;  3M3Y B;  2MGS A;  4U68 A;  2N88 A;  1LO5 D;  3HEJ A;  4FF3 A;  1AEX A;  3HP3 A;  3R8B A;  4J6H A;  2B2V A;  3TZD A;  1V1P B;  1TWC B;  5LHY 1;  3A7A B;  3FRP B;  4RKL A;  4V19 0;  4A3I B;  2KCN A;  2JSO A;  1QOH A;  1KLU D;  3EVQ A;  4X3S A;  1Y1W B;  1HUM A;  4C56 C;  1I4Q A;  4HSP A;  3AB9 A;  5HUR A;  1PRT B;  3QOJ A;  2A68 D;  5K36 G;  3BDC A;  3I4L A;  2PYK A;  1TWF B;  3GO5 A;  2WAQ B;  2Z1C A;  5EBD A;  4OGQ C;  5C0X J;  1PTO F;  2KQ3 A;  1YNJ C;  4DF7 A;  1XXG A;  5EGT A;  2R92 B;  3TSS A;  1CT1 D;  2L11 A;  2JA7 B;  1KTK A;  1TWG B;  1DM0 B;  2RSO A;  1I4R A;  2EY6 A;  5C3E B;  3NTK A;  2F0F A;  4PMW A;  5E4X A;  1GHJ A;  2RBM A;  4HN7 A;  1XTC D;  2VNU D;  4DA2 A;  2B8F A;  3H91 A;  1VCI A;  3ONA B;  2F0G A;  1D6E C;  2L4N A;  1DZ1 A;  1I6H B;  2KA7 A;  5BN4 A;  2JEB I;  2FFK B;  2FIN B;  4JK1 C;  3OWE B;  4QUF A;  2NN6 H;  4LJZ C;  5KEE A;  3VYT A;  2F0E A;  2K32 A;  2DY7 A;  3HOV B;  3L9A X;  1QE6 A;  5C3W A;  4UAI A;  4ME5 A;  5J39 A;  4L6T B;  2NUC A;  1PFM A;  1TT2 A;  1NSN S;  5EPJ A;  1LV9 A;  1PTO B;  4FXD A;  2WKD A;  1A2T A;  5CMD A;  2F03 A;  1HHV A;  2EY2 A;  1XYI A;  3PUX A;  1LT5 D;  3CHB D;  4RHR A;  1H9S A;  3KUP A;  4C3I B;  4ZUI A;  5T1G A;  1AZP A;  2WII B;  5A2Q L;  2K5W A;  3M4Y A;  4CKE A;  2F3V A;  3E0J A;  3GTP B;  1ESR A;  1VDZ A;  1QB5 D;  3IAY A;  3CU7 A;  5I6Y A;  1L0X B;  1SNQ A;  2L55 A;  5K5P A;  2HUG A;  4DXG A;  4A3G B;  1WTO A;  1PZI D;  3A56 A;  4H0L C;  1LAB A;  1CZW A;  3A54 A;  2K1B A;  1BBX C;  1TWH B;  5ELD A;  3PO3 B;  3ND9 A;  1GUS A;  4EQO A;  1CA5 A;  1EEI D;  4M1U B;  4ZAI A;  1SE4 A;  3KF8 A;  4IFD H;  5E1F A;  2HQE A;  2Z4H A;  1KNE A;  2FJ2 A;  2IX0 A;  2EYF A;  3K5O A;  3VR5 A;  1STG A;  5CR3 A;  1SXT A;  1D2B A;  2LMC B;  4EQP A;  4KHZ A;  1K8M A;  4X3K A;  4DK0 A;  1DD2 A;  2WP8 J;  2Q8I B;  4OO1 I;  2B2W C;  3Q6S A;  4CJ1 B;  4L63 B;  4RHS A;  1PZJ D;  1U4L A;  4IAL A;  5EPL A;  3NHH A;  3QOL A;  3W3A A;  3Q0A A;  1EL0 A;  4P2C B;  4GZY C;  1JWM D;  2RDF A;  5KRU A;  1GOZ A;  3M7N A;  1G8Z D;  1KNA A;  2JA8 B;  5ISR A;  1X3P A;  2F0H A;  2SDF A;  1E0B A;  3S16 B;  3S1M B;  3OW7 A;  1LAC A;  4QMG A;  3BVZ A;  4BY1 B;  4BBS B;  2LY7 A;  2HDM A;  1NCV A;  1LTG D;  3N6R A;  1YNN C;  3M7G A;  1T5E A;  3R2T A;  3J81 E;  1T5X D;  4XYO A;  3MEH A;  3MAQ A;  4WJW A;  2F0T A;  4L8J A;  2M2L A;  3PIP 3;  2V4D A;  3NTI A;  2PW7 A;  4F88 A;  4IN3 A;  3V96 A;  3SK6 A;  2AWO A;  2PPB C;  4DAY A;  3NBH A;  1F2M A;  1EYC A;  3I72 A;  3VR6 A;  3VYU A;  5F2D A;  1SEB D;  1H9K A;  1FD7 D;  3SK4 A;  5IGD A;  1RHP A;  1PYW D;  4PV1 C;  4ID6 A;  1L0Y B;  5I2Y A;  2R93 B;  2EYO A;  5M5W B;  1JOK A;  4IUP A;  3T16 A;  3WOE A;  5JEA G;  3MXG A;  5CGK A;  2L9H A;  2EOT A;  3TP8 A;  3MHB A;  2XSC A;  3H09 A;  4O1N A;  5FO8 B;  5IGC A;  4RA8 A;  3MFY A;  4C3J B;  1WTQ A;  2NVX B;  1PRT C;  1U9R A;  4ZKC B;  2Y0S B;  1GJX A;  3K59 A;  5CV9 A;  4KMU C;  4B08 A;  1NR2 A;  2OXP A;  4BS9 A;  1JQY D;  4LMQ D;  1TS5 A;  2EYP A;  4ULL A;  3EQL C;  1EZ6 A;  3D31 A;  1SNM A;  3FMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...