4LFCL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 11
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfcL00
4DV1L 3UDXA 4X64Q 2WB1E 3EN2A 3KYHC 4DR1Q 1PV4A 2R7ZG 2UXDQ 5C44G 4HIKA 2F4VL 1A62A 4QGUA 1W2BA 1VQ8A 4A3LH 5C4XG 1X3GA 3ZJYC 5JJIA 1S3OA 4LF5L 1UE5A 2LXJA 1IL2A 3S17H 3GTMH 4X66L 3S2HH 2AWNA 4UPAA 1OXSC 2DUDA 1N33L 3OW2A 4BXXG 3L7ZC 2KHIA 2K4KA 5LMNW 5C3EG 4DNIA 3KFUA 4GKKQ 3NENA 1OTCA 1EUJA 3GTPH 4DR2L 4DAMA 4IOAA 2JEBI 3MEFA 1QVFA 1L1OB 1XNRL 1KIXA 3S2DH 4KHPQ 1YHQA 1VQ5A 5E7NA 3KLWA 1N34Q 1EFWA 4AQYL 4R4CA 1XMOQ 1NY4A 2VNUD 2R7DA 1L2FA 3BZKA 2WP8J 2EXDA 4GN3B 3KDFB 3DLLA 4GOPC 4OX9Q 4K0KQ 1KHIA 3U4ZA 4KHZA 5GQOA 2I5LX 2RF4A 2ASBA 3M85A 2AWOA 2ZTEA 4QJFA 4DV0Q 1N36Q 4IJLA 4JI3Q 4YWKA 2Q2UA 2UU9Q 3S24A 5H1SE 1ASYA 5IYDH 3S1NH 3FHWA 3SGIA 4L5TA 4A3BG 3W1BA 2JE6I 1VQAA 1Z9FA 3PGZA 5FJ8G 3T1YL 4AYBG 3JC66 3CCLA 2IX0A 3CCVA 1S40A 1FVIA 3OTOL 1X3EA 1B8AA 3TEHB 1PH1A 1Q12A 1C7YA 1TWAH 4A3MG 4DV6L 1HZBA 1IBKL 1JB7A 2I0QA 4GN5A 4XIGS 2MQHA 1I94L 4L5SA 4NXNQ 2B63G 1HH2P 1YBYA 2PNHA 5BR8Q 3S15H 3E0EA 1PH3A 4A3KH 1Z47A 2MNAA 4LUVA 2CCZA 3J7A5 4X65L 1I6HH 5M3FH 4GS3A 1WFQA 1L0WA 1IBLQ 2JEAI 3G4SA 2ZJPA 4DR4Q 3ULJA 4LFAQ 2QA4A 2HT1A 1PFSA 2ZTDA 3K7UC 3M9BA 4O0AA 2HIXA 3PV0A 2ATWA 4IPDA 3CF5A 4OONA 2N3SA 1D8LA 3I4NG 2K5VA 1U5KA 3H0GG 4LF4Q 1VS0A 4DV2L 4HJ7A 1XMQQ 4LFCL 2KCMA 5C44H 4BY7G 1AH9A 3NBHB 3GDEA 5C4XH 2VQFL 2Y0SE 3U50C 4DUZQ 1MKHA 5LMNL 4IO9A 2F3IA 4L5RC 1TXYA 2F52A 1EIYB 1G6PA 1E1OA 1WI5A 2JJQA 5IT9c 5LMUQ 2E5LL 3HOXH 3CXCA 4BXXH 2VW9A 2JA5H 1HNWL 3M3YH 1XPUA 1SRUA 2NVYH 4JI8Q 5C3EH 4HIOA 2FXQA 4IFDJ 5JEAJ 1VQKA 2R93H 4DR6L 4GNXB 1TWGH 1VQDA 3PUXA 4QY7A 3EIVA 4R1JA 4RMFA 4X62L 2ZJRA 1O7IA 3A74A 4QIWE 3JAMc 4ME3A 1HZAA 1P16A 1VQOA 3NELA 3F2DA 4YHHL 5C0XJ 4AIMA 4YY3Q 2R7FA 1KC8C 1PH4A 2BA0A 4JI1L 1K8GA 4R4TA 3I7FA 4JI6Q 2Q2IA 2HQLA 3GTQH 4QQBX 3A0JA 4ALPA 1FJGQ 2JA7G 4JBJA 3M7NA 4YCWA 1FL0A 3A5UA 4YWLA 4C3HH 2PMZE 3U4VA 3CMAA 5FJ8H 2JA8G 3HOWG 1Y1VG 1QUQB 2QEXA 4DV1Q 2L15A 3CPWA 2XTIA 3RNUA 1PH5A 4YCUA 3KJOA 4NXML 4BY1H 4B3RL 3CC2A 2GVAA 3RZOH 1HNXL 2K50A 4P74A 4A3MH 3CMEA 3RLNA 2HHHL 2Z0SA 5IP9G 1GD7A 2WAQE 4DV3L 2B63H 2OWOA 5IYCH 4JI7L 1YJ9A 3EBEA 2AKWB 1N33Q 1OXXK 3AEVA 2VQEL 5M5YH 5IP7H 2LSSA 2IT1A 2UUBL 2R92G 3PUYA 4AH6A 3I55A 3KF6A 4A3FH 1MJCA 4DR2Q 4UP7A 2KBNA 2N78A 3TRZA 4DV5Q 1XNRQ 4JBMA 3PO2G 3STBD 1VQ6A 5GAHC 3CCQA 1UWVA 2UUAQ 4JYAL 3CAMA 4B3ML 1YHBA 5IY0A 1PH9A 4AQYQ 2YU9H 5FLMH 1S72A 4A3BH 4JI5L 3KDFA 3ULPA 4KI0A 2IHEA 2RCNA 5J3BA 1EYGA 1SFOH 3I56A 5GAGC 1X54A 3BU2A 1EIFA 3J7ZC 4JI0L 3E9IA 3FKIG 2BH2A 2Z6KA 4PZ6A 4APVA 1JJCB 1VQEA 2MO1A 4LF7L 1VQNA 3K0XA 4L5QA 3T1YQ 3GO5A 4X6AH 4POGA 3JAMi 2I5MX 4A4IA 1YVCA 1QVGA 4DKAC 4LWCA 1PH7A 3I4MG 2NN6I 2YTXA 1Q82C 2ZM6L 2Q2TA 4A3DG 4JV5L 1E22A 1UE6A 4C2MH 1RIPA 2Q2HA 3B6YA 5GAEC 4DV6Q 1IBKQ 4BBRG 1P8LA 4H02A 1JJGA 3T1HQ 1K73C 1VCIA 4X64L 4DR1L 1JT8A 1GKHA 2ALYB 3CCEA 4A3IG 4GN4B 3S16H 4JC0A 2AMCB 4OO1I 2DGYA 2NZOA 4JI4L 1E24A 4OWTB 1J5EQ 3H3VH 4GKJL 4IPCA 1WOCA 4X65Q 1HR0L 1Q1EA 4B3SL 1FGUA 4A3JG 3GTOH 4LF8L 4RG1A 2UUCL 1W3SA 2VL6A 1EQQA 1J6QA 1VQJA 1B7YB 3A5ZB 3CC4A 1A8VA 1VQGA 5M3MG 3L0OA 1KQSA 1SN8A 1T9HA 4BBSG 3PUWA 3G6EA 4DR5L 3HOZH 2GN5A 1EOVA 4DK3C 1NMGA 5AJ3Q 1MJEA 4KHPL 3U58A 2JA8H 3HOWH 1Y1VH 5IWAQ 1G51A 4DV2Q 3GTKH 4BA2I 4EQ5A 4LFCQ 1PH2A 1YZ6A 5DLQE 4TQUS 2VQFQ 3I2ZA 3HOUH 5LMNQ 1L1OC 4AYBE 2VUMG 1Q7YC 1PYSB 1Q86C 2E5LQ 5IYBH 2UXBL 4DV0L 2R6GA 4GLVB 1CKNB 1EWIA 4PG3A 4DV4L 2UU9L 1HNWQ 1RL2A 1V43A 3J81i 2R7ZH 3NEMA 1HZ9A 2ID0A 1WYDA 2KENA 4LNQA 4X62Q 3K8AA 1U0LA 3HOVG 4A3GG 2KHJA 5FLXc 3OYYA 4LF9L 4DPGA 1GM5A 1CKOA 1VQPA 4A3LG 4DUYQ 1VQLA 4YHHQ 1NE3A 1QZHA 2Z6KC 4A3EG 4JI1Q 3F1ZA 4Y52H 1DGSA 3BZCA 1M90C 1I50H 1IZ6A 3HKZG 3CCRA 3D31A 4MTNA 1KAWA 4JOIC 2PI2E 2I5HA 2K14A 1TWFH 1SMXA 2PQAB 4A3CG 3FKIH 2WFWA 1IBMQ 2GVBA 2D0PA 2YV5A 4A76A 1Q1BA 1X9NA 5EAYA 4LFAL 3PF4A 2RHQB 1KXLA 2IHFA 4DK6C 4LFBQ 2JK8A 2EIFA 4B3RQ 1A63A 1VQCA 1K3RA 3Q8DA 4IOCA 1HNXQ 2NVTH 3I4MH 4POFA 1X3FA 4JI2L 1X55A 2NVQH 1XNQL 2CFMA 2HHHQ 1HR0W 2OTLA 2MO0A 1XMQL 1GVPA 3S1MH 2IY5B 4JI7Q 1YHAA 4A3IH 1PA6A 2VQEQ 4DUZL 4Y7NH 2YTYA 1VQMA 1KD1C 2UUBQ 2OQ0A 1VQFA 3CP0A 4R4IA 1WJJA 1PHJA 1D7QA 2JA6G 1TWCH 2F4VQ 3ERSX 4A3JH 1VQ7A 5K36G 1PH6A 4LF5Q 2UXCL 1E1TA 4B3MQ 4X66Q 1B70B 5M3MH 1YJWA 3DM3A 4HIDA 2PI2A 1KL9A 1VQ4A 3STBC 4GLXA 2ES2A 1SROA 1C9OA 4JI5Q 2WB1G 1N9WA 4R4QA 2VS1A 1HNZL 3UDFA 4LF6L 2C35B 1L1OA 3CCJA 2BH8A 3E9HA 4A3KG 2B29A 1OXUA 3TREA 1BVSA 4JI0Q 3RLFA 1V9PA 4GNXC 4GOPB 1NBWA 3PF5A 4IFDI 1H95A 3CC7A 1JE5A 3KF8B 3AYHB 3J81j 4DV7L 3VDYA 4B3TL 4WJ4A 4YCVA 4LF7Q 4UY8C 1FJGL 3J81c 4HJ8A 2JQOA 2KCTA 3I4NH 3RR5A 4DR7L 1A0IA 3H0GH 4LUOA 1K8AC 5C0XI 1IXRA 2XGTA 4JV5Q 3PSIA 3M4OH 5GADC 4BY7H 1X56A 1N32L 1K0RA 3KOJA 1Y1WG 4NPSA 3HOVH 4A3GH 5JJLA 1PH8A 2NN6G 2N49A 5M5XH 3W5OA 4C3JH 1K9MC 4JI4Q 4JOIA 4HJ5A 1YNXA 4GKJQ 2JA9A 4A3EH 3GTLH 1R9TH 2VZAA 3OTOQ 3I4OA 3ER0A 1HR0Q 2ZJQA 1SE8A 3MXNB 3HOXG 1SR3A 3K81C 1XPRA 4B3SQ 2YYZA 4LF8Q 4OO1G 2JA5G 2UUCQ 3TS0A 1BBWA 4DR3L 4IPHA 1N8RC 2UXDL 4IJHA 1I94Q 2R93G 3L2PA 4A3CH 1KRTA 3W1GA 2B3GA 4DR5Q 3KF6B 4DV5L 4A93G 1M1KC 2CWAA 2UUAL 1SLJA 1V1QA 4JCVE 1WCMG 1NMFA 2H5XA 3IRBA 2JA7H 1CSQA 3GD7A 4GKKL 1KRSA 1UEBA 3PUZA 5JJKA 2RHSB 1CKNA 2CWPA 3AFPA 2UXBQ 1AE2A 2K52A 4DV4Q 4OWWB 3F8TA 3BJUA 1N34L 3CCSA 1E3PA 2JA6H 1XMOL 3PO3G 1PYBA 3HKSA 4HJAA 3UE0A 2V1CC 3K80C 4BA1I 1JMCA 4NB3A 4LF9Q 3PCOB 4BY1G 4WJ3M 1AE3A 4P73A 4OX9L 2A19A 4K0KL 5IP9H 1I3QH 4XTCS 3UE1A 1E7ZA 1CUKA 3GTJH 4HJ9A 1N36L 3FP9A 4JI3L 4C3IH 3T1HL 3S1QH 4IPGA 1LTLA 1EQRA 5IYCG 4GNXA 3CCUA 2R92H 3HOYG 2E2HH 2Y0SG 4DR6Q 2PQAA 4JBWA 5IP7G 3AFQA 1YEZA 1J5EL 2K5NA 1QZGA 3ICEA 4A3FG 3PO2H 2E8GA 3S14H 1UE7A 3J80c 1VQHA 4UP8A 1BKBA 1X6OA 1TWHH 1ASZA 1XPOA 1LUZA 3WWVA 2CQOA 1K83H 4A75A 3LGJA 4NXNL 2QGQA 2E2IH 1YJNA 3AQQA 3S1RH 1C0AA 1VQBA 5FLMG 2MFIA 5ELOA 4P71A 5HGQA 5BR8L 3D0FA 1Q81C 1LYLA 3CQZH 5AJ3L 1YIJA 2A8VA 4MZ9A 3ULLA 1IYJB 4JI2Q 1XNQQ 4LW1A 1VQ9A 4P75A 5IWAL 3F2BA 1Y1WH 2YTVA 1IBLL 2D0OA 1HZCA 1LM0A 2CKZB 1QUQA 3M4PA 1OXTA 1UE1A 1NTGA 4DR4L 4MNOA 3GTGH 4OWXB 1JJ2A 1PVOA 1Q46A 1XTDA 3TQYA 4DAYB 4PMWA 2ZTCA 4GLAC 4NXMQ 4QL5A 4A3DH 3RZDH 1HJPA 4O2DA 1GO3E 4LF4L 4KLKA 2D62A 2UXCQ 4BBRH 3HFZB 4DV3Q 2VY3A 3UDIA 4OXPA 3M4QA 3HOUG 2EQSA 3HKZE 4JG2A 5IE8A 2K75A 1MIUA 3F2CA 4JBKA 3CD6A 1BBUA 3RN5A 1HNZQ 5IYDG 3KJPA 2A1AA 4LF6Q 4A93H 2BA1A 4P72A 4DUYL 1G291 4UP9A 5LMUL 4LUZA 3CCMA 4GOPA 1WCMH 4PZ7A 4J15A 5HY6A 2WAQG 3G48A 4TVAB 3TS2A 4JYAQ 4DV7Q 3UDGA 2LXKA 4JI8L 1YITA 1XJVA 2HIVA 3H15A 4B3TQ 4HIMA 2N8NA 3PIOA 4BBSH 3H3VI 4FDBA 2OQKA 4R4OA 3CPFA 4PZ8A 1Y14B 4DR7Q 4IFDG 5JEAG 2IX1A 3HOZG 4YWMA 1IBML 3RLOA 4YY3L 2NVXH 2OCEA 2NZHA 1NJIC 2E2JH 3PO3H 3PUVA 1N32Q 5M3FG 4LFBL 4JI6L 5GROA 1CKMA 5C0XG 3PIPA 2OTJA 5M5WH 2VUMH 1VQIA 1X65A 1Q8KA 3K7AH 3J80i 4EX5A 1I5FA 1YI2A 5ELNA 1QVCA 3RN2A 5IYBG 2ZM6Q 2AHOB 5C4JH 1OXVA 3HOYH 1CSPA 2K5HA 3CW2C 4DR3Q 3G71A
chains in the Genus database with same CATH superfamily
3EN2A 2KJXA 4YIJA 3DM1A 1EWHA 3R93A 1XYIA 4A3FB 1X3GA 5JJIA 1S3OA 4ODGA 1HCZA 2D2CC 1ILQA 1UE5A 3S17H 1STNA 1N33L 1L0XB 2K4KA 3S2HB 1AP0A 1O7YA 1QG7A 3K5NA 3KFUA 3MEHA 5A35A 1OTCA 1EUJA 4KY6A 4DR2L 4IOAA 2N88A 4C1NI 1KIXA 4KHPQ 2HQEA 4K2LA 5CR3A 4DU9A 3S2DB 2LFNA 1DOMA 5ELCA 1L2FA 1JQYD 2EXDA 1GHKA 3DLLA 1KHIA 1JWUD 1U4RA 4KHZA 5GQOA 2Q8TA 4DV0Q 2PMZB 4QJFA 4JI3Q 4YWKA 3BVGA 5H1SE 1ASYA 3SGIA 5FJ8G 1R4PB 4AYBG 3CCLA 3S16B 1S40A 3DEPA 1PH1A 1PFNA 1C7YA 2WAQB 1HZBA 1IBKL 1ILPA 4XIGS 4L5SA 4NXNQ 4IUPA 5JEAH 1YBYA 2X69A 3E0EA 3P7JA 4A3KB 1HQRD 1IBLQ 1L0WA 2F0QA 3DUZA 5J22A 4DR4Q 4LFAQ 4DAYA 3TBIB 1EY5A 1M8AA 3C1EA 1PFSA 2HT1A 2KA7A 2K28A 3TMEA 4IPDA 3CF5A 1FNWA 2N3SA 1D8LA 1VDZA 2K5VA 3H0GG 2B39A 5LHY1 3BYYB 1XMQQ 4LFCL 2BDNA 4DF7A 1QCBD 2R7ZB 1EU4A 1MKHA 5C4XB 2F3IA 3TP8A 1EIYB 1E1OA 1NSNS 5IT9c 4EVOA 5LMUQ 4DN4M 3CXCA 4ZKCB 4CJ0B 4ABNA 2NVYH 4HIOA 2FXQA 1PRTB 1VQKA 1FR3A 4IFDJ 1D1IA 4DR6L 1JE4A 4GNXB 4QY7A 3VR3A 2PCFB 1HZAA 1VF7A 1BNZA 3F2DA 2K32A 1PH4A 1B9NA 2XVSA 1SSOA 1ICWA 2Q2IA 3D4DA 1S5BD 3NTIA 4V190 4OL7A 4JBJA 1TS4A 1A3VA 4LK1C 4U673 2PMZE 5FJ8H 1HXYD 4DV1Q 3FDTA 3I90A 4PNYA 4BY1H 2GVAA 3RZOH 2EYLA 2E76C 5C3XA 2HHHL 2WAQE 2AKWB 3AEVA 1OXXK 1CTMA 3OSOA 5IP7H 1RTNA 3E6ZX 3PUYA 4AH6A 4LJZC 3KF6A 2WKCA 2IL8A 1K8MA 4L63B 2N78A 4KKUA 2PNRC 4JBMA 3STBD 3VR5A 1EY7A 2PZWA 1YHBA 1QILA 1KNAA 3HZXA 3A7AB 5FLMH 4A3BH 1SYDA 2IHEA 1ESRA 3I56A 3NXWA 3I4NB 4QIWB 5GAGC 1X54A 3OWFA 4JI0L 2BH2A 3M4OB 2HCCA 5EKKA 1Y69U 3U9SA 3K0XA 3BDOA 1BCPC 3GO5A 4NDXA 2EVBA 2A69C 2I5MX 1QVGA 3T16A 4DKAC 2K5DA 4JV5L 3A8JE 1UE6A 2G5DA 1P8LA 1VCIA 3EA6A 2OT2A 1GUOA 1GKHA 2EYOA 5I4DA 2AMCB 1ENFA 2KHSA 1WOCA 3V2TA 4X65Q 4ME5A 1HR0L 2L11A 2M2LA 3C1FA 4XT3B 1VQJA 1B7YB 1VQGA 1KQSA 3L0OA 4B08A 1ZYRC 1T9HA 4N8X1 3G6EA 3HOZH 5LL6X 1MJEA 2O5JC 1E2VA 3NBIA 4DV2Q 2FFKB 2JA8B 2RA4A 3HOWB 1ZYRD 5HURA 2SNSA 2A73B 2VQFQ 1EIGA 1Z6HA 4CKEA 5LMNQ 4KMUC 1PTOH 1Q7YC 2KCNA 2J7ZA 2R6GA 3CHBD 3M7GA 2UU9L 5JAVA 1LTRD 4EQNA 2F0NA 3OMGA 2ID0A 4A3GG 5FLXc 4LF9L 3OYYA 1HQMC 4DPGA 5DM73 3PO2B 2MGSA 4RKBA 4YHHQ 2F3VA 5ELBA 4JI1Q 3F1ZA 1I50H 2ZXRA 1H9MA 3CCRA 1SBBB 1GUGA 1KAWA 2I5HA 5CMDA 2K14A 1TWFH 4HMIA 1SMXA 4A3CG 2WFWA 5IGBA 3OWEB 5CV9A 1WTOA 2YV5A 3D8GA 1IW7C 1Q1BA 2ZXPA 1JOOA 2EYMA 2RHQB 5I6WA 1KXLA 1SEBD 4H13C 2QILA 5NUCA 4ZYSA 1AN8A 4B3RQ 3Q8DA 3SE0A 1HNXQ 2NVTH 1Q3LA 5E4WC 1X3FA 2ICIA 5J1ZA 3WDNA 2HD3A 2PW5A 2BE5C 2MO0A 2IY5B 5KNCA 4DUZL 1PTOC 2F0VA 4A3IB 2OQ0A 4R4IA 2UUBQ 2K05A 4JPBW 2BE5D 3ERSX 1VQ7A 3FPUB 2B2UC 2DNCA 1DXMA 1Z7TA 4A3JB 1PTOD 1YJWA 3DM3A 1VQ4A 4GLXA 2RKSA 2F0WA 1C9OA 4JI5Q 1BF4A 4H0LC 2VS1A 5T1GA 1L1OA 1TQOA 1X3PA 3VYSA 3DHQA 3RLFA 5C5MA 2Q8IB 1FJGL 4Q5VA 3J81c 1SYBA 4DR7L 2H4OA 4LUOA 3SK6A 1K8AC 1GOZA 1SNCA 2BCOA 3PSIA 4CDCC 5IGEA 5GADC 4HSVA 1X56A 1N32L 3H94A 1FD7D 4NPSA 4A3GH 5JJLA 1PH8A 1K28A 2N49A 5M5XH 3NSWA 3HOVB 1K9MC 3OMCA 4JOIA 2JA9A 3VR6A 3GTLH 1R9TH 2ZJQA 1SE8A 4A3EB 1XPRA 4OO1G 2UUCQ 1I4QA 5DM63 4RGNA 1N8RC 5I9PA 2LY7A 5IGGA 3L2PA 4A3CH 3W1GA 1BCPF 4DR5Q 3KF6B 3GTPB 1SLJA 4O42A 3IAYA 1WCMG 1HUNA 2H5XA 2JA7H 5E1FA 3IL8A 4QMGA 1FYCA 1UEBA 2RBMA 3PUZA 1LTSD 1CKNA 2CWPA 1AE2A 3AMUA 2QDLA 4OWWB 3F8TA 5FKAC 1JB3A 1KAAA 1AZQA 2HDLA 3PO3G 4IUTA 1B2TA 4UHVA 4C1NK 2JA6B 4BA1I 1JMCA 4WJ3M 5KIXA 3MFGA 1AE3A 4ZLTF 3PIP3 2IW3A 2NBFA 3UE1A 1SE3A 4JI3L 2OF1A 4IPGA 4C56C 5IYCG 2R92H 3HOYG 3HGBA 4DR6Q 1J5EL 2E2HB 4A3FG 3S14H 1TY0A 1UE7A 1EL0A 1LV9A 3R8BA 1GJXA 4HAEA 1TS3A 1ASZA 1ZXTA 1ICFB 1TWHB 4NXNL 2E2IH 3D6WA 3AQQA 5KNBA 1YJNA 1Q81C 4P71A 2A8VA 1LYLA 3CQZH 4MZ9A 4JI2Q 3TSSA 4LW1A 1IBLL 2D0OA 4CDDC 4DR4L 1NTGA 1B50A 3GTGH 1PVOA 1MD2D 3TQYA 4PMWA 4GLAC 2SEBD 1D1KA 1HA5A 3I70A 2F0IA 4OO1H 2D62A 5ELDA 3HFZB 2EXZA 1YNNC 4OXPA 3P20A 3CD6A 3D4RA 4JBKA 2R3ZA 1L0YB 2EJMA 1S4ZA 4CJ2C 3RN5A 3OPOA 3KJPA 1RF2D 2A1AA 4LF6Q 1LTBD 4G7OC 4DUYL 5LMUL 4LUZA 1SAPA 4HCSA 1WCMH 5HY6A 1JWSD 2WAQG 3G48A 3TS2A 3SXHA 3UDGA 2LXKA 1XJVA 4B3TQ 4HIMA 2OQKA 3CPFA 1RCVD 1KLGD 1QNUA 4YWMA 1IBML 2E2JH 3PO3H 1CA6A 4LFBL 1CKMA 5C0XG 4ILWA 2TMPA 1SE4A 1VQIA 5KEEA 1IKMA 1DJRD 1GUNA 1F2LA 1Q8KA 4EX5A 3MFYA 1QVCA 5IYBG 3HOYH 1WTXA 2IWHA 3CW2C 5BN4A 4ZCKA 4DR3Q 2X6LA 5C4JB 4DV1L 2Y0SB 2R7ZG 5C4XG 1W2BA 1VQ8A 4A3LH 3ZJYC 4O1NA 4X66L 3S2HH 1S5ED 4ZAIA 2XN9C 2O5IC 4BXXG 1G2TA 4JVZA 3AU7A 4DNIA 4GKKQ 3NENA 5EPLA 2PQEA 3NK9A 3MEFA 1QVFA 1L1OB 5D3DA 3S2DH 1CHQD 1EFWA 1XMOQ 2WKDA 3BZKA 4FVMA 2K7VA 5KYIA 2WP8J 3KDFB 4OX9Q 1EOTA 2XIWA 2ASBA 1EYCA 3M85A 4K6LA 3HOUB 2Q2UA 2F0UA 2UU9Q 1M4VA 2JYOA 4OIKA 3S1NH 2RQXA 2M00A 2JE6I 1VQAA 4EQPA 3OTOL 2PW7A 1KDCA 1TWAH 4KJNA 4Q0FA 3A55A 2I0QA 1JB7A 3IKJA 4GN5A 4HN7A 1KDAA 2PNHA 5BR8Q 1GXDC 4A3KH 4DXFA 1E0BA 4LUVA 2RDFA 4X65L 1I6HH 2B8FA 2JEAI 3G4SA 1S5FD 3ULJA 3KBGA 5I9OA 3K7UC 2PPBC 2ATWA 2NB0A 2P5ZX 3NWTA 3I4NG 4LF4Q 4FF3A 4DV2L 3QIAA 4HJ7A 2PYKA 3G6JB 3WOEA 4F87A 1AH9A 5C4XH 1TVXA 2VQFL 2Y0SE 4DUZQ 5C44B 5LMNL 4L5RC 1TXYA 1G6PA 3HOXH 1VMPA 4BXXH 2JA5H 5D14A 4JI8Q 1J9OA 2R93H 5JEAJ 2C5CA 3PUXA 4RMFA 4X3SA 1O7IA 1B4OA 3A74A 1Y8PB 1LT4D 3NELA 1CHPD 4YHHL 5EBCA 3V05A 4JI1L 4R4TA 3HG9A 5TSSA 3I7FA 4JI6Q 1V8QA 1WTPA 4QQBX 1FJGQ 2SNMA 2K33A 3BYTB 1FL0A 1Y8OB 3A5UA 1ML0D 2NVQB 2EYJA 3CMAA 2JA8G 3HOWG 3TN2A 2QEXA 2XTIA 4Y7NB 4JW0A 2F1MA 4B3RL 3CC2A 1HNXL 2ICEC 1TWCB 3MXNA 3RLNA 2Z0SA 1GUSA 5IP9G 2EY1A 4ZK9B 4K5XA 2IT1A 2B8GA 5D3IB 2UUBL 3C46A 4ZQ3A 4F7XA 4UP7A 4Z9CB 3PO2G 2KUMA 5GAHC 3HEJA 4FYDA 1UWVA 2MPMA 1KDBA 2EY6A 2YU9H 1S72A 4XDXA 4JI5L 1PRTD 4KI0A 2RCNA 2FHTA 1MI2A 1EYGA 4B9XA 3QG1A 1UNSA 2DNEA 1SFOB 1EIFA 1CK1A 3EFXD 4BY7B 1XWEA 4PZ6A 4APVA 2B2VA 1VQEA 3NQTA 4OIJA 1VQNA 1S5CD 1TR5A 3OIQA 4TSSA 4C3JB 4A4IA 1YVCA 2Q8RE 1EQTA 1Q82C 1IHZA 2ZM6L 4C2MH 1QNKA 4NKLA 1WTRA 1TU2B 3TP5A 4X64L 2QEJC 4DR1L 1JT8A 1HTPA 4A3IG 4GN4B 1STBA 4OO1I 1Y8NB 2AUJD 1E24A 4OWTB 1J5EQ 3H3VH 1GUTA 1LACA 4K8IA 3GTOH 1FGUA 4A3JG 2NWGA 3ITPA 2UUCL 2VL6A 1EQQA 4ID6A 3A5ZB 3CC4A 1SN8A 4KY5A 2EJFC 4DR5L 2VXWA 5KGUA 1KLUD 3SK4A 1B1ZA 2JA8H 3HOWH 4MIUA 3GTKH 4EQ5A 4R8IA 1YZ6A 5DLQE 2BDOA 2K04A 3VYUA 2E5LQ 1DD2A 1G8ZD 4GLVB 4PG3A 3FRPB 1AEXA 1PZID 5FO7B 3NEMA 2KENA 4LNQA 1H9SA 3K8AA 3HOVG 2OEOA 5BN3A 2KHJA 3M4YA 1G91A 4DUYQ 2V4DA 3TZDA 1NE3A 4A3EG 4Y52H 2VB2X 2SDFA 1M90C 1IZ6A 2B2VC 4MTNA 1V1PA 2PI2E 3FMCA 2HDMA 2L4NA 1IBMQ 1U4LA 3RUZA 4A76A 1X9NA 3NE5B 4LFBQ 2EIFA 3K57A 1K3RA 3K5MA 5CC4A 2XRSD 1LT3D 4M8AA 3I4MB 4JI2L 4A3DB 3I4LA 2OTLA 4DXGA 1GVPA 4BBRB 4JI7Q 4A3IH 4U68A 4RGTA 2VQEQ 1VQMA 1KD1C 1PHJA 1WJJA 2JA6G 1TS5A 2IJ0A 4A3JH 4FO2A 4FXKC 1XX8A 1PH6A 2EDGA 1RTOA 3R2IA 3CU7A 4X66Q 1B70B 4V0BA 4HIDA 1PXUA 3STBC 1SROA 4BBSB 4MN3A 4LF6L 3CRLC 2C35B 2BH8A 5ELFA 3TREA 1O7ZA 5AFWA 1V9PA 4CJ1B 2NVXB 1NUCA 2Z4HA 3KF8B 3J81j 4B3TL 3K58A 3VDYA 1CI3M 4WJ4A 4X3TA 1O7LA 2KEDA 3L3OC 2JQOA 2KCTA 2VUMB 2RDGA 3E3XA 3MHBA 3H0GH 3HS0C 4L6TB 5C0XI 1CQFA 3OOCA 3HOVH 4F8MA 5C6AA 1EEFD 5JVH3 4HJ5A 4GKJQ 4J1MA 4A3EH 2O2LD 4ZUIA 3OTOQ 3I4OA 3MXNB 1LLRD 1D5XC 3PMFA 3FVQA 3UI2A 3HKZB 4DR3L 1C48A 2B3GA 1ESFA 1HPCA 5C3WA 2KEEA 4DV5L 4CGYB 4FXGC 2UUAL 1W6JA 2CWAA 1NR2A 5BN5A 4RFBA 3QR8A 4GKKL 1KRSA 1LABA 5JJKA 4KTAA 3Q24A 2IX3A 3RD4A 1CFMA 2K52A 2B2UA 4DV4Q 3NBHA 1B44D 2F0JA 1XMOL 2JA6H 4HJAA 3UE0A 3VYTA 2V1CC 4NB3A 1X3QA 1BDOA 4OX9L 4R9WA 4KK7A 1I3QB 3GTJB 1EQRA 2F03A 4C3IB 3CCUA 2R61A 2E2HH 2WB1B 3S1QB 2Y0SG 2PQAA 4JBWA 1YEZA 2K5NA 4CKCA 1QZGA 3ICEA 5JJZA 1H9KA 4RH6A 2DJGC 1JWMD 1BKBA 1SMYC 1TWHH 1K83H 1VQBA 5ELOA 5BR8L 1F2ZA 1WTQA 1SMYD 5AJ3L 1YIJA 2I46A 3QO2A 1XNQQ 2K03A 5CV8A 5IT9E 2N55A 1HZCA 2CKZB 4XQNA 1QUQA 1Y1WB 1UUPA 3A8KE 1UE1A 1EEID 5JPNC 3Q23A 1CQVA 1Q46A 1XTDA 5KNDA 4DAYB 1E2WA 2ZTCA 3RZDH 1BR9A 1GO3E 4LF4L 4KLKA 3M4QA 3HOUG 2EQSA 3HKZE 5IE8A 2K75A 2NVYB 1HNZQ 5IYDG 1VF5C 2J4XA 4UP9A 5K5PA 4GOPA 4A93B 3T4AC 1DM0B 4QUFA 1SE2A 4J15A 4HEDA 3KLRA 3JAML 4FF2A 4DV7Q 3BG3A 4JI8L 2X6GA 1I4HA 3H3VI 1V1PB 4R4OA 1LTTD 4K6DA 1MSHA 1Y14B 2IX1A 4PQXA 5KYLA 1BCPB 3X3NA 3RLOA 2OCEA 2NZHA 3I8ZA 3SK8A 4JI6L 5GROA 3OW7A 5F2DA 4BY1B 5M5WB 1YI2A 3K7AB 5CBAE 5C4JH 2ZM6Q 2K5HA 4G4KA 4H7BA 4X64Q 2WB1E 4DR1Q 2EZVA 4RWSC 5C44G 4HIKA 2F4VL 4WORA 3G7LA 3DXJC 1BQQT 4LF5L 3LNNA 1IL2A 1RDPD 3P75A 3X3MA 2PO4A 1OXSC 4ZKBB 3OW2A 3TP6A 3L7ZC 2KHIA 3GTMB 5DAUA 1RJTA 4A3BB 4UAIA 1D5ZC 4DAMA 2JEBI 3QOJA 2K6AA 2NZ1D 3DWPA 2JSOA 3J7YW 1DZ1A 3K0YA 2VNUD 2R7DA 4LAAA 2L5TA 4GOPC 1UEAB 4K0KQ 3U4ZA 3HOUH 4IQZA 2AWOA 2ZTEA 1N36Q 4IJLA 4XT1B 5IYDH 3FHWA 4L5TA 3N52A 1STYA 3W1BA 1SXTA 3JC66 2PZTA 3CCVA 1SYCA 1B8AA 4RHSA 2MP1A 1I94L 1LT6D 3MTSA 1GHJA 5C5LA 3S15H 3SVMA 2MNAA 3HOZB 3J7A5 1IYUA 2EY5A 4GS3A 1WFQA 1JCKB 2A6HC 4BS9A 5M3FB 4IURA 1AFPA 4FNFA 2AUKA 2QA4A 2ZTDA 4O0AA 2HIXA 3PV0A 3VA7A 1TIID 4OONA 1PTOB 2A6HD 5CV5A 3SK5A 1U5KA 1SNDA 5JVG3 1U4MA 3MXUA 5C44H 4BY7G 3NBHB 3GDEA 1ZKOA 2I07B 3MC0B 5G3LD 5DNFA 4IO9A 2F52A 4C3JG 1F9SA 2JJQA 2Z9HA 4J8QA 2E5LL 5EJWA 4IN3A 1CM9A 3JAME 3M3YH 1SRUA 3MVVA 1I50B 2K1BA 5C3EB 4R1JA 3EIVA 1TWFB 1TWGB 1VQOA 1P16A 5C0XJ 4YY3Q 3GTQH 3KUPA 3A0JA 4ALPA 1B3AA 3R3OA 4KD3A 1PTOF 4QF4A 4DA2A 2RSNA 2PZUA 4WRDA 1Q8IA 3U4VA 1NNXA 4C3HB 2KQ3A 1QUQB 3CPWA 2Z1CA 3RNUA 1DOLA 3KJOA 4NXML 5FOBB 1QOHA 3CMEA 4A3MB 1YNJD 3C2PA 3D6CA 2OWOA 5IYCH 1HFGA 1YJ9A 4JI7L 1I4RA 2VQEL 2B63B 2ENBA 2LSSA 4TRDA 3I55A 5M5YB 4A3FH 1D5MC 1SDFA 4KKSA 3J81E 2KBNA 4DV5Q 1XNRQ 2K01A 1VQ6A 3HRZC 1K8OA 3CCQA 2UUAQ 1DONA 3V96A 5IY0A 3BDCA 4AQYQ 2L0CA 4K5VA 1SFOH 1BO0A 4B9WA 4I7ZC 3BU2A 2Z6KA 2CH4A 2MO1A 1II3A 1S5DD 1X32A 3DWQA 4L5QA 4N8FA 3T1YQ 4X6AH 4POGA 3JAMi 1STHA 2F4IA 2AQ1B 4A3DG 4LWCA 2LS01 1PH7A 3I4MG 1ONLA 3GTLB 2LMCB 1T5XD 2DN8A 2Q2HA 2RDHA 5GAEC 4DV6Q 4BBRG 4H02A 1RODA 1K73C 3VA5A 3CCEA 4M1UB 5FO8B 2D5DA 4JC0A 3S16H 2DGYA 2NZOA 4GKJL 3K5OA 4IPCA 2Z4IA 2QKIC 1Q1EA 1I4GA 2NTSA 4RG1A 1J6QA 3F2UA 1A8VA 4L8JA 2JA7B 4BBSG 3FEWX 1EOVA 3J7AF 5AJ3Q 4MHEA 3PQIA 2CW0D 3R2TA 2F0GA 5C0XH 1CZWA 1Y1VB 1EY0A 4TQUS 1BUVT 3I2ZA 2B2TC 1QB5D 5KRUA 2VUMG 3NHHA 1Q86C 5IYBH 1CKNB 4DV4L 1HNWQ 3J81i 2R7ZH 2R92B 2L55A 4X62Q 1O80A 1U0LA 2F0HA 1J8IA 3Q22A 1CT1D 3NTHA 2Z6KC 1NCVA 1DGSA 3J80L 3HKZG 4IUUA 3D31A 4XYOA 3QWNA 4IZ8A 2E2IB 5EPKA 1I6VC 1TS2A 3E0JA 3FPPA 4ZUJA 2GVBA 3FKIB 4I7AA 3PF4A 5EAYA 1U4PA 1HA6A 2DJFC 2JK8A 1LT5D 3LWEA 1VQCA 3A7LA 3I4MH 4IOCA 1A63A 1D6EC 1X55A 1XNQL 2CFMA 4RKLA 1YHAA 4DNRB 1PA6A 1EY6A 3S1MB 4JK1C 1D7QA 1K0SA 1W6KA 5I2XA 2F4VQ 3T56B 4CKBA 5K36G 1IYVA 4LF5Q 3MXGA 1E1TA 1C8CA 4B3MQ 2ZXOA 1KL9A 1MSGA 2ES2A 5T1IA 1KTKA 2XWJB 4C3IG 5M3MB 2F0TA 2WB1G 3C3LA 1A3TA 1HNZL 5CYUA 3UDFA 5IIFA 4KN4C 3CCJA 4J6HA 4G7HC 3E9HA 2EYFA 1OXUA 1PRTC 2BOSA 1TT2A 4GNXC 1NBWA 3PF5A 3CC7A 1JE5A 4DV7L 3QB3A 4YCVA 4LF7Q 4UY8C 3K59A 1RKNA 5EPJA 3I4NH 3RR5A 4NW2A 4RGOS 2XGTA 3M4OH 1XXGA 1IL8A 3N6RA 1Y1WG 2KECA 2NN6G 1MHWC 1OO9B 1D2BA 4JI4Q 1STGA 1JR0D 3ER0A 2VB3X 3H91A 1WTVA 1SR3A 3K81C 4HCEA 4B3SQ 2YYZA 4LF8Q 1H9JA 3TS0A 1BBWA 5COYA 2F0OA 1I94Q 3AB9A 4DK1A 1HRJA 3DEOA 1EIHA 2RCFA 1WVLA 3I3CA 2AQ2B 4A93G 4IUVA 4FF4A 1M1KC 1EY8A 1QWYA 1V1QA 2CVRA 1HTLD 5A2QE 4JCVE 3LWUA 4HSPA 3IRBA 5IGCA 2L9HA 3GD7A 4LMQD 3EVQA 1SJED 2K5QA 5LL6S 2UXBQ 2EYHA 2F0MA 2E2DC 5C4ZA 2AQ3B 5CV4A 2EJGC 3SR1A 1PZKD 2KVMA 3K5LA 4KHVA 3S1NB 5JOBA 5K36H 4BY1G 1STAA 4DAVA 1G2SA 2WINB 4K0KL 5IP9H 1I3QH 1I4PA 3GTJH 1N36L 1TWAB 3FP9A 4C3IH 1KABA 3T1HL 3S1QH 4NP5A 5ISRA 3J80E 1EQVA 5CORA 3U9OA 1FNVA 1UAPA 5IP7G 4MTKA 3AFQA 3PO2H 3VR2A 2ZT9C 1VQHA 4UP8A 1I6HB 4OEMB 1X6OA 3MA2B 1LUZA 3WWVA 2CQOA 3LGJA 3CKIB 1SNMA 4DK0A 5FLMG 1NAPA 2MFIA 4A3BG 5HGQA 3H3VC 3D0FA 3S1RB 3SDZA 3ULLA 1IYJB 3OIPA 1VQ9A 2XRQD 1Q90A 3ZYYX 5IWAL 2YTVA 1Y1WH 1LM0A 1MBYA 2NN6H 4OWXB 4KN7C 1O78A 3BVMA 4QL5A 4G7ZC 4NXMQ 3QJYA 1HJPA 4O2DA 3HOXB 2UXCQ 2VY3A 5IT9L 1JICA 2JA5B 3F2CA 1A6XA 4K8JA 2R93B 2IPKD 5CV6A 1EU3A 4KY7A 4A93H 2BA1A 2F0SA 3I91A 4P72A 4UDUC 2JP1A 3Q6SA 1AZPA 1TY2A 4PZ7A 2A74C 2Z8LA 1BOSA 4TVAB 3NP8A 4DNTB 1PFBA 3ND9A 3SHLA 5CGKA 3H15A 2N8NA 4OELB 3PIOA 3IFDA 1F9QA 2QF7A 4PZ8A 4IFDG 2E74C 1F77A 4PMBA 3HOZG 4YY3L 5I2YA 3PUVA 2E75C 5M3FG 1A2TA 2OTJA 5M5WH 1B3QA 4ULLA 1X65A 4KJOA 3K7AH 1PZJD 3J80i 1I5FA 2A68C 2H1EA 3GQBA 3RN2A 1OXVA 1PRTF 1CSPA 1WD0A 1EZ8A 3G71A 2MUYA 4KD4A 3UDXA 2UXDQ 1PV4A 3KYHC 1SNQA 2A68D 2FJ2A 4N9TA 1A62A 4QGUA 2LXJA 3H09A 2EYPA 3GTMH 3BS1A 2AWNA 4UPAA 2DUDA 2OXPA 3S17B 5LMNW 2YU9B 5C3EG 3A54A 4RCOA 3GTPH 1A15A 5IGFA 1XNRL 2NTTA 5J39A 1YHQA 3VR4A 1VQ5A 2GA4B 5E7NA 3KLWA 1N34Q 4AQYL 3MAQA 4R4CA 1NY4A 1LTGD 3RMHA 4GN3B 3I72A 2J0TD 2I5LX 2RF4A 1BCPD 4C2MB 5EQ0A 4C3HG 3S24A 2A69D 3T53B 3Q0AA 1A3UA 3PGZA 1Z9FA 5DEHA 3T1YL 4S3SA 1PDQA 4QUCA 2IX0A 1FVIA 1X3EA 3D4WA 3TEHB 1Q12A 4XQJA 4IALA 4A3MG 3MZ5A 4DV6L 3GTOB 5I6YA 2MQHA 2NYZD 2NUCA 2B63G 1HH2P 4IFDH 1A2UA 3W2DA 5L37A 3BZDB 5EBDA 1PH3A 1Z47A 3A56A 2CCZA 5M3FH 2TSSA 5IODA 2ZJPA 3GTKB 1H9RA 3MXPA 1EYDA 2CH4W 3M9BA 4XYQA 5EKLA 1SYGA 1VS0A 4KKTA 4DGZA 3TZUA 4I65A 2KCMA 4RHRA 2Z6BA 3U50C 1EY9A 4XXEA 4X3UA 4BWGB 1HHVA 1WI5A 1JC7A 5FLXL 2VW9A 1HNWL 4X3KA 1XPUA 4WFN3 5C3EH 1E2ZA 3NUCA 1TWGH 1VQDA 2CQAA 1AW7A 5EKIA 4X62L 4HTHA 2ZJRA 5FO9B 4QIWE 3JAMc 4ME3A 1H9SB 3KK7A 4AIMA 1RHPA 2R7FA 1KC8C 1K8GA 2BA0A 3DMUA 3HOYB 2A5HA 1QE6A 3P1HA 2HQLA 3NPPA 2JA7G 3M7NA 2XNAC 4HMJA 4YCWA 1IW7D 5HGTA 2XWBB 4YWLA 4C3HH 1EWCA 2EPBA 2D9UA 1Y1VG 3ONAB 2L15A 1PH5A 4YCUA 1LTAD 4AYBB 3W3AA 2K50A 1KNEA 4P74A 4A3MH 3RZOB 5E4XA 4DV3L 1SNPA 1GD7A 4IUNA 2B63H 1N33Q 3EBEA 1NR4A 5M5YH 1GUWA 2F0KA 2R92G 2RSOA 3I73A 1MJCA 4DAPA 3EQLC 4DR2Q 2B2WA 2EE1A 3TRZA 1F9RA 3T13A 4JYAL 3CAMA 1ET9A 2CHBD 4B3ML 1PH9A 1B9MA 1JORA 3KDFA 3ULPA 1PFMA 5J3BA 1WTWA 1CZGA 4H44C 3J81L 4PMCA 3H0GB 3J7ZC 3E9IA 3FKIG 2FINB 1JJCB 4LF7L 3BDLA 1T5EA 4PV1C 5JPMC 3J7AV 4K14A 4K2KA 1K3BC 2NN6I 2YTXA 2Q2TA 1E22A 1RIPA 3B6YA 1JJGA 3K6OA 1IBKQ 4CHTB 1FNUA 4CDEC 3T1HQ 1V1OA 3KLSX 2ALYB 2DY7A 1EY4A 4JI4L 2QW7A 4FXDA 4IUQA 4B3SL 4DFAA 1SNOA 4LF8L 4ZRZA 1W3SA 5M3MG 3O13A 5CBEE 4RA8A 3PUWA 1SYFA 2GN5A 4DK3C 1CA5A 1NMGA 1VMCA 3GP7A 4KHPL 3U58A 1Y1VH 5M9OA 1G51A 4EGVA 5IWAQ 3DWAA 4BA2I 4LFCQ 1PH2A 3D3RA 1L1OC 4AYBE 4QCLA 2B2WC 1PYSB 3WOFA 2UXBL 4DV0L 5FLXE 2F0FA 1EWIA 1RL2A 1V43A 2G9DA 1PMRA 1LTID 1HZ9A 1DCZA 1WYDA 1PYWD 1GM5A 1CKOA 1VQPA 4A3LG 1R4QB 3ERQA 5E3FA 1VQLA 5C4HA 1QZHA 4CBVA 2F0EA 3BZCA 1K83B 3NWSA 4JOIC 4G57A 4FF1A 2PQAB 1G6ZA 3FKIH 2WIIB 2M9VA 3E5SA 2D0PA 4LFAL 1WTHA 1U9RA 2IHFA 4DK6C 2C9OA 1STEA 5ELEA 4FP5D 1PLFA 4N9PA 4NMZA 4POFA 4RGMA 3RZDB 2NVQH 2NVTB 2HHHQ 1HR0W 1XMQL 3S1MH 3GV3A 4TKOB 2WV6D 4F88A 4Y7NH 2YTYA 2MHVA 1YNJC 3CP0A 1VQFA 2DY8A 2RVLA 1TWCH 1YNND 2K5WA 3BVZA 1I4XA 2UXCL 3GV6A 5D65A 5M3MH 2EY2A 3EROA 2PI2A 1EFID 1N9WA 1HUMA 4R4QA 1DOKA 2F0LA 2B2TA 1F9PA 4A3KG 3L9AX 1TKWB 2B29A 1BVSA 4R8NA 4JI0Q 4GOPB 1IKLA 4IFDI 1H95A 2HCIA 3AYHB 4HJ8A 4QB4A 4K5WA 1A0IA 3HP3A 1IXRA 1QJOA 4JV5Q 1ZEQX 3H6MA 3URYA 4BY7H 1K0RA 3KOJA 3W5OA 3CRKC 4C3JH 4A3GB 1WD1A 1YNXA 5M5XB 2VZAA 2B2YA 1HR0Q 3HOXG 2KCCA 1R9TB 3TDQA 4GZYC 2JA5G 3OHXC 1ET6A 3S9WA 4IPHA 2UXDL 4IJHA 4RCNA 2R93G 2F0PA 5IOCA 1KRTA 3EJIA 4RAUC 3NTKA 3NQIA 3ND8A 1SJHD 3QOLA 2KOLA 1NMFA 3TP7A 4WJWA 2CW0C 1C4QA 1CSQA 5FK9C 2RHSB 3VYRA 3PIO3 3AFPA 5A2QL 3BJUA 1N34L 3CCSA 1E3PA 1PYBA 3HKSA 1EZ6A 1RD9D 3K80C 4LF9Q 3PCOB 1B53A 4P73A 2A19A 4XTCS 1E7ZA 1CUKA 4HJ9A 1HFNA 4OHJA 1LTLA 4GNXA 2FMMA 2F0DA 3S15B 2L1BA 1MGSA 1DYQA 2E8GA 3MWYW 3IFTA 5EGTA 3J80c 1SYEA 5G3LF 3S14B 1XPOA 4A75A 2QGQA 3T51B 3S1RH 1C0AA 4OGQC 2HUGA 4E6IA 2B2YC 2SOBA 3CQZB 4P75A 2JXMB 3F2BA 2LKVA 3M4PA 1OXTA 1ENCA 4MNOA 1JJ2A 3SEBA 3GTGB 2FMCA 2JN4A 4A3DH 1BXTA 4BBRH 4DV3Q 3UDIA 4HR7B 4EQOA 3M3YB 4JG2A 1MIUA 2XSCA 1BBUA 2QDBA 2WACA 2QCPX 1G291 1FGBD 1F2YA 3CCMA 2G9HD 2A6EC 3KF8A 1BBXC 4P2CB 2F3WA 3KBXA 1WCMB 3A8IE 2EOTA 4JYAQ 5IGDA 1YITA 2HIVA 4BBSH 4FDBA 4KV6A 3GTQB 4CDFC 2A6ED 4DR7Q 5JEAG 1F2MA 2NVXH 1NJIC 1LO5D 1N32Q 2E2JB 3PO3B 3PIPA 2VUMH 1XTCD 2L12A 1ENAA 5CV7A 2O4XA 1JOKA 4XQQA 2MJ8A 1JOQA 5ELNA 2AHOB 3KLSA 3LX0A 1EYAA
chains in the Genus database with same CATH topology
4DV1L 3UDXA 4X64Q 2WB1E 3EN2A 3KYHC 4DR1Q 1PV4A 2R7ZG 2UXDQ 5C44G 4HIKA 2F4VL 1A62A 4QGUA 1W2BA 1VQ8A 4A3LH 5C4XG 1X3GA 3ZJYC 5JJIA 1S3OA 4LF5L 1UE5A 2LXJA 1IL2A 3S17H 3GTMH 4X66L 3S2HH 2AWNA 4UPAA 1OXSC 2DUDA 1N33L 3OW2A 4BXXG 3L7ZC 2KHIA 2K4KA 5LMNW 5C3EG 4DNIA 3KFUA 4GKKQ 3NENA 1OTCA 1EUJA 3GTPH 4DR2L 4DAMA 4IOAA 2JEBI 3MEFA 1QVFA 1L1OB 1XNRL 1KIXA 3S2DH 4KHPQ 1YHQA 1VQ5A 5E7NA 3KLWA 1N34Q 1EFWA 4AQYL 4R4CA 1XMOQ 1NY4A 2VNUD 2R7DA 1L2FA 3BZKA 2WP8J 2EXDA 4GN3B 3KDFB 3DLLA 4GOPC 4OX9Q 4K0KQ 1KHIA 3U4ZA 4KHZA 5GQOA 2I5LX 2RF4A 2ASBA 3M85A 2AWOA 2ZTEA 4QJFA 4DV0Q 1N36Q 4IJLA 4JI3Q 4YWKA 2Q2UA 2UU9Q 3S24A 5H1SE 1ASYA 5IYDH 3S1NH 3FHWA 3SGIA 4L5TA 4A3BG 3W1BA 2JE6I 1VQAA 1Z9FA 3PGZA 5FJ8G 3T1YL 4AYBG 3JC66 3CCLA 2IX0A 3CCVA 1S40A 1FVIA 3OTOL 1X3EA 1B8AA 3TEHB 1PH1A 1Q12A 1C7YA 1TWAH 4A3MG 4DV6L 1HZBA 1IBKL 1JB7A 2I0QA 4GN5A 4XIGS 2MQHA 1I94L 4L5SA 4NXNQ 2B63G 1HH2P 1YBYA 2PNHA 5BR8Q 3S15H 3E0EA 1PH3A 4A3KH 1Z47A 2MNAA 4LUVA 2CCZA 3J7A5 4X65L 1I6HH 5M3FH 4GS3A 1WFQA 1L0WA 1IBLQ 2JEAI 3G4SA 2ZJPA 4DR4Q 3ULJA 4LFAQ 2QA4A 2HT1A 1PFSA 2ZTDA 3K7UC 3M9BA 4O0AA 2HIXA 3PV0A 2ATWA 4IPDA 3CF5A 4OONA 2N3SA 1D8LA 3I4NG 2K5VA 1U5KA 3H0GG 4LF4Q 1VS0A 4DV2L 4HJ7A 1XMQQ 4LFCL 2KCMA 5C44H 4BY7G 1AH9A 3NBHB 3GDEA 5C4XH 2VQFL 2Y0SE 3U50C 4DUZQ 1MKHA 5LMNL 4IO9A 2F3IA 4L5RC 1TXYA 2F52A 1EIYB 1G6PA 1E1OA 1WI5A 2JJQA 5IT9c 5LMUQ 2E5LL 3HOXH 3CXCA 4BXXH 2VW9A 2JA5H 1HNWL 3M3YH 1XPUA 1SRUA 2NVYH 4JI8Q 5C3EH 4HIOA 2FXQA 4IFDJ 5JEAJ 1VQKA 2R93H 4DR6L 4GNXB 1TWGH 1VQDA 3PUXA 4QY7A 3EIVA 4R1JA 4RMFA 4X62L 2ZJRA 1O7IA 3A74A 4QIWE 3JAMc 4ME3A 1HZAA 1P16A 1VQOA 3NELA 3F2DA 4YHHL 5C0XJ 4AIMA 4YY3Q 2R7FA 1KC8C 1PH4A 2BA0A 4JI1L 1K8GA 4R4TA 3I7FA 4JI6Q 2Q2IA 2HQLA 3GTQH 4QQBX 3A0JA 4ALPA 1FJGQ 2JA7G 4JBJA 3M7NA 4YCWA 1FL0A 3A5UA 4YWLA 4C3HH 2PMZE 3U4VA 3CMAA 5FJ8H 2JA8G 3HOWG 1Y1VG 1QUQB 2QEXA 4DV1Q 2L15A 3CPWA 2XTIA 3RNUA 1PH5A 4YCUA 3KJOA 4NXML 4BY1H 4B3RL 3CC2A 2GVAA 3RZOH 1HNXL 2K50A 4P74A 4A3MH 3CMEA 3RLNA 2HHHL 2Z0SA 5IP9G 1GD7A 2WAQE 4DV3L 2B63H 2OWOA 5IYCH 4JI7L 1YJ9A 3EBEA 2AKWB 1N33Q 1OXXK 3AEVA 2VQEL 5M5YH 5IP7H 2LSSA 2IT1A 2UUBL 2R92G 3PUYA 4AH6A 3I55A 3KF6A 4A3FH 1MJCA 4DR2Q 4UP7A 2KBNA 2N78A 3TRZA 4DV5Q 1XNRQ 4JBMA 3PO2G 3STBD 1VQ6A 5GAHC 3CCQA 1UWVA 2UUAQ 4JYAL 3CAMA 4B3ML 1YHBA 5IY0A 1PH9A 4AQYQ 2YU9H 5FLMH 1S72A 4A3BH 4JI5L 3KDFA 3ULPA 4KI0A 2IHEA 2RCNA 5J3BA 1EYGA 1SFOH 3I56A 5GAGC 1X54A 3BU2A 1EIFA 3J7ZC 4JI0L 3E9IA 3FKIG 2BH2A 2Z6KA 4PZ6A 4APVA 1JJCB 1VQEA 2MO1A 4LF7L 1VQNA 3K0XA 4L5QA 3T1YQ 3GO5A 4X6AH 4POGA 3JAMi 2I5MX 4A4IA 1YVCA 1QVGA 4DKAC 4LWCA 1PH7A 3I4MG 2NN6I 2YTXA 1Q82C 2ZM6L 2Q2TA 4A3DG 4JV5L 1E22A 1UE6A 4C2MH 1RIPA 2Q2HA 3B6YA 5GAEC 4DV6Q 1IBKQ 4BBRG 1P8LA 4H02A 1JJGA 3T1HQ 1K73C 1VCIA 4X64L 4DR1L 1JT8A 1GKHA 2ALYB 3CCEA 4A3IG 4GN4B 3S16H 4JC0A 2AMCB 4OO1I 2DGYA 2NZOA 4JI4L 1E24A 4OWTB 1J5EQ 3H3VH 4GKJL 4IPCA 1WOCA 4X65Q 1HR0L 1Q1EA 4B3SL 1FGUA 4A3JG 3GTOH 4LF8L 4RG1A 2UUCL 1W3SA 2VL6A 1EQQA 1J6QA 1VQJA 1B7YB 3A5ZB 3CC4A 1A8VA 1VQGA 5M3MG 3L0OA 1KQSA 1SN8A 1T9HA 4BBSG 3PUWA 3G6EA 4DR5L 3HOZH 2GN5A 1EOVA 4DK3C 1NMGA 5AJ3Q 1MJEA 4KHPL 3U58A 2JA8H 3HOWH 1Y1VH 5IWAQ 1G51A 4DV2Q 3GTKH 4BA2I 4EQ5A 4LFCQ 1PH2A 1YZ6A 5DLQE 4TQUS 2VQFQ 3I2ZA 3HOUH 5LMNQ 1L1OC 4AYBE 2VUMG 1Q7YC 1PYSB 1Q86C 2E5LQ 5IYBH 2UXBL 4DV0L 2R6GA 4GLVB 1CKNB 1EWIA 4PG3A 4DV4L 2UU9L 1HNWQ 1RL2A 1V43A 3J81i 2R7ZH 3NEMA 1HZ9A 2ID0A 1WYDA 2KENA 4LNQA 4X62Q 3K8AA 1U0LA 3HOVG 4A3GG 2KHJA 5FLXc 3OYYA 4LF9L 4DPGA 1GM5A 1CKOA 1VQPA 4A3LG 4DUYQ 1VQLA 4YHHQ 1NE3A 1QZHA 2Z6KC 4A3EG 4JI1Q 3F1ZA 4Y52H 1DGSA 3BZCA 1M90C 1I50H 1IZ6A 3HKZG 3CCRA 3D31A 4MTNA 1KAWA 4JOIC 2PI2E 2I5HA 2K14A 1TWFH 1SMXA 2PQAB 4A3CG 3FKIH 2WFWA 1IBMQ 2GVBA 2D0PA 2YV5A 4A76A 1Q1BA 1X9NA 5EAYA 4LFAL 3PF4A 2RHQB 1KXLA 2IHFA 4DK6C 4LFBQ 2JK8A 2EIFA 4B3RQ 1A63A 1VQCA 1K3RA 3Q8DA 4IOCA 1HNXQ 2NVTH 3I4MH 4POFA 1X3FA 4JI2L 1X55A 2NVQH 1XNQL 2CFMA 2HHHQ 1HR0W 2OTLA 2MO0A 1XMQL 1GVPA 3S1MH 2IY5B 4JI7Q 1YHAA 4A3IH 1PA6A 2VQEQ 4DUZL 4Y7NH 2YTYA 1VQMA 1KD1C 2UUBQ 2OQ0A 1VQFA 3CP0A 4R4IA 1WJJA 1PHJA 1D7QA 2JA6G 1TWCH 2F4VQ 3ERSX 4A3JH 1VQ7A 5K36G 1PH6A 4LF5Q 2UXCL 1E1TA 4B3MQ 4X66Q 1B70B 5M3MH 1YJWA 3DM3A 4HIDA 2PI2A 1KL9A 1VQ4A 3STBC 4GLXA 2ES2A 1SROA 1C9OA 4JI5Q 2WB1G 1N9WA 4R4QA 2VS1A 1HNZL 3UDFA 4LF6L 2C35B 1L1OA 3CCJA 2BH8A 3E9HA 4A3KG 2B29A 1OXUA 3TREA 1BVSA 4JI0Q 3RLFA 1V9PA 4GNXC 4GOPB 1NBWA 3PF5A 4IFDI 1H95A 3CC7A 1JE5A 3KF8B 3AYHB 3J81j 4DV7L 3VDYA 4B3TL 4WJ4A 4YCVA 4LF7Q 4UY8C 1FJGL 3J81c 4HJ8A 2JQOA 2KCTA 3I4NH 3RR5A 4DR7L 1A0IA 3H0GH 4LUOA 1K8AC 5C0XI 1IXRA 2XGTA 4JV5Q 3PSIA 3M4OH 5GADC 4BY7H 1X56A 1N32L 1K0RA 3KOJA 1Y1WG 4NPSA 3HOVH 4A3GH 5JJLA 1PH8A 2NN6G 2N49A 5M5XH 3W5OA 4C3JH 1K9MC 4JI4Q 4JOIA 4HJ5A 1YNXA 4GKJQ 2JA9A 4A3EH 3GTLH 1R9TH 2VZAA 3OTOQ 3I4OA 3ER0A 1HR0Q 2ZJQA 1SE8A 3MXNB 3HOXG 1SR3A 3K81C 1XPRA 4B3SQ 2YYZA 4LF8Q 4OO1G 2JA5G 2UUCQ 3TS0A 1BBWA 4DR3L 4IPHA 1N8RC 2UXDL 4IJHA 1I94Q 2R93G 3L2PA 4A3CH 1KRTA 3W1GA 2B3GA 4DR5Q 3KF6B 4DV5L 4A93G 1M1KC 2CWAA 2UUAL 1SLJA 1V1QA 4JCVE 1WCMG 1NMFA 2H5XA 3IRBA 2JA7H 1CSQA 3GD7A 4GKKL 1KRSA 1UEBA 3PUZA 5JJKA 2RHSB 1CKNA 2CWPA 3AFPA 2UXBQ 1AE2A 2K52A 4DV4Q 4OWWB 3F8TA 3BJUA 1N34L 3CCSA 1E3PA 2JA6H 1XMOL 3PO3G 1PYBA 3HKSA 4HJAA 3UE0A 2V1CC 3K80C 4BA1I 1JMCA 4NB3A 4LF9Q 3PCOB 4BY1G 4WJ3M 1AE3A 4P73A 4OX9L 2A19A 4K0KL 5IP9H 1I3QH 4XTCS 3UE1A 1E7ZA 1CUKA 3GTJH 4HJ9A 1N36L 3FP9A 4JI3L 4C3IH 3T1HL 3S1QH 4IPGA 1LTLA 1EQRA 5IYCG 4GNXA 3CCUA 2R92H 3HOYG 2E2HH 2Y0SG 4DR6Q 2PQAA 4JBWA 5IP7G 3AFQA 1YEZA 1J5EL 2K5NA 1QZGA 3ICEA 4A3FG 3PO2H 2E8GA 3S14H 1UE7A 3J80c 1VQHA 4UP8A 1BKBA 1X6OA 1TWHH 1ASZA 1XPOA 1LUZA 3WWVA 2CQOA 1K83H 4A75A 3LGJA 4NXNL 2QGQA 2E2IH 1YJNA 3AQQA 3S1RH 1C0AA 1VQBA 5FLMG 2MFIA 5ELOA 4P71A 5HGQA 5BR8L 3D0FA 1Q81C 1LYLA 3CQZH 5AJ3L 1YIJA 2A8VA 4MZ9A 3ULLA 1IYJB 4JI2Q 1XNQQ 4LW1A 1VQ9A 4P75A 5IWAL 3F2BA 1Y1WH 2YTVA 1IBLL 2D0OA 1HZCA 1LM0A 2CKZB 1QUQA 3M4PA 1OXTA 1UE1A 1NTGA 4DR4L 4MNOA 3GTGH 4OWXB 1JJ2A 1PVOA 1Q46A 1XTDA 3TQYA 4DAYB 4PMWA 2ZTCA 4GLAC 4NXMQ 4QL5A 4A3DH 3RZDH 1HJPA 4O2DA 1GO3E 4LF4L 4KLKA 2D62A 2UXCQ 4BBRH 3HFZB 4DV3Q 2VY3A 3UDIA 4OXPA 3M4QA 3HOUG 2EQSA 3HKZE 4JG2A 5IE8A 2K75A 1MIUA 3F2CA 4JBKA 3CD6A 1BBUA 3RN5A 1HNZQ 5IYDG 3KJPA 2A1AA 4LF6Q 4A93H 2BA1A 4P72A 4DUYL 1G291 4UP9A 5LMUL 4LUZA 3CCMA 4GOPA 1WCMH 4PZ7A 4J15A 5HY6A 2WAQG 3G48A 4TVAB 3TS2A 4JYAQ 4DV7Q 3UDGA 2LXKA 4JI8L 1YITA 1XJVA 2HIVA 3H15A 4B3TQ 4HIMA 2N8NA 3PIOA 4BBSH 3H3VI 4FDBA 2OQKA 4R4OA 3CPFA 4PZ8A 1Y14B 4DR7Q 4IFDG 5JEAG 2IX1A 3HOZG 4YWMA 1IBML 3RLOA 4YY3L 2NVXH 2OCEA 2NZHA 1NJIC 2E2JH 3PO3H 3PUVA 1N32Q 5M3FG 4LFBL 4JI6L 5GROA 1CKMA 5C0XG 3PIPA 2OTJA 5M5WH 2VUMH 1VQIA 1X65A 1Q8KA 3K7AH 3J80i 4EX5A 1I5FA 1YI2A 5ELNA 1QVCA 3RN2A 5IYBG 2ZM6Q 2AHOB 5C4JH 1OXVA 3HOYH 1CSPA 2K5HA 3CW2C 4DR3Q 3G71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 L;  3UDX A;  4X64 Q;  2WB1 E;  3EN2 A;  3KYH C;  4DR1 Q;  1PV4 A;  2R7Z G;  2UXD Q;  5C44 G;  4HIK A;  2F4V L;  1A62 A;  4QGU A;  1W2B A;  1VQ8 A;  4A3L H;  5C4X G;  1X3G A;  3ZJY C;  5JJI A;  1S3O A;  4LF5 L;  1UE5 A;  2LXJ A;  1IL2 A;  3S17 H;  3GTM H;  4X66 L;  3S2H H;  2AWN A;  4UPA A;  1OXS C;  2DUD A;  1N33 L;  3OW2 A;  4BXX G;  3L7Z C;  2KHI A;  2K4K A;  5LMN W;  5C3E G;  4DNI A;  3KFU A;  4GKK Q;  3NEN A;  1OTC A;  1EUJ A;  3GTP H;  4DR2 L;  4DAM A;  4IOA A;  2JEB I;  3MEF A;  1QVF A;  1L1O B;  1XNR L;  1KIX A;  3S2D H;  4KHP Q;  1YHQ A;  1VQ5 A;  5E7N A;  3KLW A;  1N34 Q;  1EFW A;  4AQY L;  4R4C A;  1XMO Q;  1NY4 A;  2VNU D;  2R7D A;  1L2F A;  3BZK A;  2WP8 J;  2EXD A;  4GN3 B;  3KDF B;  3DLL A;  4GOP C;  4OX9 Q;  4K0K Q;  1KHI A;  3U4Z A;  4KHZ A;  5GQO A;  2I5L X;  2RF4 A;  2ASB A;  3M85 A;  2AWO A;  2ZTE A;  4QJF A;  4DV0 Q;  1N36 Q;  4IJL A;  4JI3 Q;  4YWK A;  2Q2U A;  2UU9 Q;  3S24 A;  5H1S E;  1ASY A;  5IYD H;  3S1N H;  3FHW A;  3SGI A;  4L5T A;  4A3B G;  3W1B A;  2JE6 I;  1VQA A;  1Z9F A;  3PGZ A;  5FJ8 G;  3T1Y L;  4AYB G;  3JC6 6;  3CCL A;  2IX0 A;  3CCV A;  1S40 A;  1FVI A;  3OTO L;  1X3E A;  1B8A A;  3TEH B;  1PH1 A;  1Q12 A;  1C7Y A;  1TWA H;  4A3M G;  4DV6 L;  1HZB A;  1IBK L;  1JB7 A;  2I0Q A;  4GN5 A;  4XIG S;  2MQH A;  1I94 L;  4L5S A;  4NXN Q;  2B63 G;  1HH2 P;  1YBY A;  2PNH A;  5BR8 Q;  3S15 H;  3E0E A;  1PH3 A;  4A3K H;  1Z47 A;  2MNA A;  4LUV A;  2CCZ A;  3J7A 5;  4X65 L;  1I6H H;  5M3F H;  4GS3 A;  1WFQ A;  1L0W A;  1IBL Q;  2JEA I;  3G4S A;  2ZJP A;  4DR4 Q;  3ULJ A;  4LFA Q;  2QA4 A;  2HT1 A;  1PFS A;  2ZTD A;  3K7U C;  3M9B A;  4O0A A;  2HIX A;  3PV0 A;  2ATW A;  4IPD A;  3CF5 A;  4OON A;  2N3S A;  1D8L A;  3I4N G;  2K5V A;  1U5K A;  3H0G G;  4LF4 Q;  1VS0 A;  4DV2 L;  4HJ7 A;  1XMQ Q;  4LFC L;  2KCM A;  5C44 H;  4BY7 G;  1AH9 A;  3NBH B;  3GDE A;  5C4X H;  2VQF L;  2Y0S E;  3U50 C;  4DUZ Q;  1MKH A;  5LMN L;  4IO9 A;  2F3I A;  4L5R C;  1TXY A;  2F52 A;  1EIY B;  1G6P A;  1E1O A;  1WI5 A;  2JJQ A;  5IT9 c;  5LMU Q;  2E5L L;  3HOX H;  3CXC A;  4BXX H;  2VW9 A;  2JA5 H;  1HNW L;  3M3Y H;  1XPU A;  1SRU A;  2NVY H;  4JI8 Q;  5C3E H;  4HIO A;  2FXQ A;  4IFD J;  5JEA J;  1VQK A;  2R93 H;  4DR6 L;  4GNX B;  1TWG H;  1VQD A;  3PUX A;  4QY7 A;  3EIV A;  4R1J A;  4RMF A;  4X62 L;  2ZJR A;  1O7I A;  3A74 A;  4QIW E;  3JAM c;  4ME3 A;  1HZA A;  1P16 A;  1VQO A;  3NEL A;  3F2D A;  4YHH L;  5C0X J;  4AIM A;  4YY3 Q;  2R7F A;  1KC8 C;  1PH4 A;  2BA0 A;  4JI1 L;  1K8G A;  4R4T A;  3I7F A;  4JI6 Q;  2Q2I A;  2HQL A;  3GTQ H;  4QQB X;  3A0J A;  4ALP A;  1FJG Q;  2JA7 G;  4JBJ A;  3M7N A;  4YCW A;  1FL0 A;  3A5U A;  4YWL A;  4C3H H;  2PMZ E;  3U4V A;  3CMA A;  5FJ8 H;  2JA8 G;  3HOW G;  1Y1V G;  1QUQ B;  2QEX A;  4DV1 Q;  2L15 A;  3CPW A;  2XTI A;  3RNU A;  1PH5 A;  4YCU A;  3KJO A;  4NXM L;  4BY1 H;  4B3R L;  3CC2 A;  2GVA A;  3RZO H;  1HNX L;  2K50 A;  4P74 A;  4A3M H;  3CME A;  3RLN A;  2HHH L;  2Z0S A;  5IP9 G;  1GD7 A;  2WAQ E;  4DV3 L;  2B63 H;  2OWO A;  5IYC H;  4JI7 L;  1YJ9 A;  3EBE A;  2AKW B;  1N33 Q;  1OXX K;  3AEV A;  2VQE L;  5M5Y H;  5IP7 H;  2LSS A;  2IT1 A;  2UUB L;  2R92 G;  3PUY A;  4AH6 A;  3I55 A;  3KF6 A;  4A3F H;  1MJC A;  4DR2 Q;  4UP7 A;  2KBN A;  2N78 A;  3TRZ A;  4DV5 Q;  1XNR Q;  4JBM A;  3PO2 G;  3STB D;  1VQ6 A;  5GAH C;  3CCQ A;  1UWV A;  2UUA Q;  4JYA L;  3CAM A;  4B3M L;  1YHB A;  5IY0 A;  1PH9 A;  4AQY Q;  2YU9 H;  5FLM H;  1S72 A;  4A3B H;  4JI5 L;  3KDF A;  3ULP A;  4KI0 A;  2IHE A;  2RCN A;  5J3B A;  1EYG A;  1SFO H;  3I56 A;  5GAG C;  1X54 A;  3BU2 A;  1EIF A;  3J7Z C;  4JI0 L;  3E9I A;  3FKI G;  2BH2 A;  2Z6K A;  4PZ6 A;  4APV A;  1JJC B;  1VQE A;  2MO1 A;  4LF7 L;  1VQN A;  3K0X A;  4L5Q A;  3T1Y Q;  3GO5 A;  4X6A H;  4POG A;  3JAM i;  2I5M X;  4A4I A;  1YVC A;  1QVG A;  4DKA C;  4LWC A;  1PH7 A;  3I4M G;  2NN6 I;  2YTX A;  1Q82 C;  2ZM6 L;  2Q2T A;  4A3D G;  4JV5 L;  1E22 A;  1UE6 A;  4C2M H;  1RIP A;  2Q2H A;  3B6Y A;  5GAE C;  4DV6 Q;  1IBK Q;  4BBR G;  1P8L A;  4H02 A;  1JJG A;  3T1H Q;  1K73 C;  1VCI A;  4X64 L;  4DR1 L;  1JT8 A;  1GKH A;  2ALY B;  3CCE A;  4A3I G;  4GN4 B;  3S16 H;  4JC0 A;  2AMC B;  4OO1 I;  2DGY A;  2NZO A;  4JI4 L;  1E24 A;  4OWT B;  1J5E Q;  3H3V H;  4GKJ L;  4IPC A;  1WOC A;  4X65 Q;  1HR0 L;  1Q1E A;  4B3S L;  1FGU A;  4A3J G;  3GTO H;  4LF8 L;  4RG1 A;  2UUC L;  1W3S A;  2VL6 A;  1EQQ A;  1J6Q A;  1VQJ A;  1B7Y B;  3A5Z B;  3CC4 A;  1A8V A;  1VQG A;  5M3M G;  3L0O A;  1KQS A;  1SN8 A;  1T9H A;  4BBS G;  3PUW A;  3G6E A;  4DR5 L;  3HOZ H;  2GN5 A;  1EOV A;  4DK3 C;  1NMG A;  5AJ3 Q;  1MJE A;  4KHP L;  3U58 A;  2JA8 H;  3HOW H;  1Y1V H;  5IWA Q;  1G51 A;  4DV2 Q;  3GTK H;  4BA2 I;  4EQ5 A;  4LFC Q;  1PH2 A;  1YZ6 A;  5DLQ E;  4TQU S;  2VQF Q;  3I2Z A;  3HOU H;  5LMN Q;  1L1O C;  4AYB E;  2VUM G;  1Q7Y C;  1PYS B;  1Q86 C;  2E5L Q;  5IYB H;  2UXB L;  4DV0 L;  2R6G A;  4GLV B;  1CKN B;  1EWI A;  4PG3 A;  4DV4 L;  2UU9 L;  1HNW Q;  1RL2 A;  1V43 A;  3J81 i;  2R7Z H;  3NEM A;  1HZ9 A;  2ID0 A;  1WYD A;  2KEN A;  4LNQ A;  4X62 Q;  3K8A A;  1U0L A;  3HOV G;  4A3G G;  2KHJ A;  5FLX c;  3OYY A;  4LF9 L;  4DPG A;  1GM5 A;  1CKO A;  1VQP A;  4A3L G;  4DUY Q;  1VQL A;  4YHH Q;  1NE3 A;  1QZH A;  2Z6K C;  4A3E G;  4JI1 Q;  3F1Z A;  4Y52 H;  1DGS A;  3BZC A;  1M90 C;  1I50 H;  1IZ6 A;  3HKZ G;  3CCR A;  3D31 A;  4MTN A;  1KAW A;  4JOI C;  2PI2 E;  2I5H A;  2K14 A;  1TWF H;  1SMX A;  2PQA B;  4A3C G;  3FKI H;  2WFW A;  1IBM Q;  2GVB A;  2D0P A;  2YV5 A;  4A76 A;  1Q1B A;  1X9N A;  5EAY A;  4LFA L;  3PF4 A;  2RHQ B;  1KXL A;  2IHF A;  4DK6 C;  4LFB Q;  2JK8 A;  2EIF A;  4B3R Q;  1A63 A;  1VQC A;  1K3R A;  3Q8D A;  4IOC A;  1HNX Q;  2NVT H;  3I4M H;  4POF A;  1X3F A;  4JI2 L;  1X55 A;  2NVQ H;  1XNQ L;  2CFM A;  2HHH Q;  1HR0 W;  2OTL A;  2MO0 A;  1XMQ L;  1GVP A;  3S1M H;  2IY5 B;  4JI7 Q;  1YHA A;  4A3I H;  1PA6 A;  2VQE Q;  4DUZ L;  4Y7N H;  2YTY A;  1VQM A;  1KD1 C;  2UUB Q;  2OQ0 A;  1VQF A;  3CP0 A;  4R4I A;  1WJJ A;  1PHJ A;  1D7Q A;  2JA6 G;  1TWC H;  2F4V Q;  3ERS X;  4A3J H;  1VQ7 A;  5K36 G;  1PH6 A;  4LF5 Q;  2UXC L;  1E1T A;  4B3M Q;  4X66 Q;  1B70 B;  5M3M H;  1YJW A;  3DM3 A;  4HID A;  2PI2 A;  1KL9 A;  1VQ4 A;  3STB C;  4GLX A;  2ES2 A;  1SRO A;  1C9O A;  4JI5 Q;  2WB1 G;  1N9W A;  4R4Q A;  2VS1 A;  1HNZ L;  3UDF A;  4LF6 L;  2C35 B;  1L1O A;  3CCJ A;  2BH8 A;  3E9H A;  4A3K G;  2B29 A;  1OXU A;  3TRE A;  1BVS A;  4JI0 Q;  3RLF A;  1V9P A;  4GNX C;  4GOP B;  1NBW A;  3PF5 A;  4IFD I;  1H95 A;  3CC7 A;  1JE5 A;  3KF8 B;  3AYH B;  3J81 j;  4DV7 L;  3VDY A;  4B3T L;  4WJ4 A;  4YCV A;  4LF7 Q;  4UY8 C;  1FJG L;  3J81 c;  4HJ8 A;  2JQO A;  2KCT A;  3I4N H;  3RR5 A;  4DR7 L;  1A0I A;  3H0G H;  4LUO A;  1K8A C;  5C0X I;  1IXR A;  2XGT A;  4JV5 Q;  3PSI A;  3M4O H;  5GAD C;  4BY7 H;  1X56 A;  1N32 L;  1K0R A;  3KOJ A;  1Y1W G;  4NPS A;  3HOV H;  4A3G H;  5JJL A;  1PH8 A;  2NN6 G;  2N49 A;  5M5X H;  3W5O A;  4C3J H;  1K9M C;  4JI4 Q;  4JOI A;  4HJ5 A;  1YNX A;  4GKJ Q;  2JA9 A;  4A3E H;  3GTL H;  1R9T H;  2VZA A;  3OTO Q;  3I4O A;  3ER0 A;  1HR0 Q;  2ZJQ A;  1SE8 A;  3MXN B;  3HOX G;  1SR3 A;  3K81 C;  1XPR A;  4B3S Q;  2YYZ A;  4LF8 Q;  4OO1 G;  2JA5 G;  2UUC Q;  3TS0 A;  1BBW A;  4DR3 L;  4IPH A;  1N8R C;  2UXD L;  4IJH A;  1I94 Q;  2R93 G;  3L2P A;  4A3C H;  1KRT A;  3W1G A;  2B3G A;  4DR5 Q;  3KF6 B;  4DV5 L;  4A93 G;  1M1K C;  2CWA A;  2UUA L;  1SLJ A;  1V1Q A;  4JCV E;  1WCM G;  1NMF A;  2H5X A;  3IRB A;  2JA7 H;  1CSQ A;  3GD7 A;  4GKK L;  1KRS A;  1UEB A;  3PUZ A;  5JJK A;  2RHS B;  1CKN A;  2CWP A;  3AFP A;  2UXB Q;  1AE2 A;  2K52 A;  4DV4 Q;  4OWW B;  3F8T A;  3BJU A;  1N34 L;  3CCS A;  1E3P A;  2JA6 H;  1XMO L;  3PO3 G;  1PYB A;  3HKS A;  4HJA A;  3UE0 A;  2V1C C;  3K80 C;  4BA1 I;  1JMC A;  4NB3 A;  4LF9 Q;  3PCO B;  4BY1 G;  4WJ3 M;  1AE3 A;  4P73 A;  4OX9 L;  2A19 A;  4K0K L;  5IP9 H;  1I3Q H;  4XTC S;  3UE1 A;  1E7Z A;  1CUK A;  3GTJ H;  4HJ9 A;  1N36 L;  3FP9 A;  4JI3 L;  4C3I H;  3T1H L;  3S1Q H;  4IPG A;  1LTL A;  1EQR A;  5IYC G;  4GNX A;  3CCU A;  2R92 H;  3HOY G;  2E2H H;  2Y0S G;  4DR6 Q;  2PQA A;  4JBW A;  5IP7 G;  3AFQ A;  1YEZ A;  1J5E L;  2K5N A;  1QZG A;  3ICE A;  4A3F G;  3PO2 H;  2E8G A;  3S14 H;  1UE7 A;  3J80 c;  1VQH A;  4UP8 A;  1BKB A;  1X6O A;  1TWH H;  1ASZ A;  1XPO A;  1LUZ A;  3WWV A;  2CQO A;  1K83 H;  4A75 A;  3LGJ A;  4NXN L;  2QGQ A;  2E2I H;  1YJN A;  3AQQ A;  3S1R H;  1C0A A;  1VQB A;  5FLM G;  2MFI A;  5ELO A;  4P71 A;  5HGQ A;  5BR8 L;  3D0F A;  1Q81 C;  1LYL A;  3CQZ H;  5AJ3 L;  1YIJ A;  2A8V A;  4MZ9 A;  3ULL A;  1IYJ B;  4JI2 Q;  1XNQ Q;  4LW1 A;  1VQ9 A;  4P75 A;  5IWA L;  3F2B A;  1Y1W H;  2YTV A;  1IBL L;  2D0O A;  1HZC A;  1LM0 A;  2CKZ B;  1QUQ A;  3M4P A;  1OXT A;  1UE1 A;  1NTG A;  4DR4 L;  4MNO A;  3GTG H;  4OWX B;  1JJ2 A;  1PVO A;  1Q46 A;  1XTD A;  3TQY A;  4DAY B;  4PMW A;  2ZTC A;  4GLA C;  4NXM Q;  4QL5 A;  4A3D H;  3RZD H;  1HJP A;  4O2D A;  1GO3 E;  4LF4 L;  4KLK A;  2D62 A;  2UXC Q;  4BBR H;  3HFZ B;  4DV3 Q;  2VY3 A;  3UDI A;  4OXP A;  3M4Q A;  3HOU G;  2EQS A;  3HKZ E;  4JG2 A;  5IE8 A;  2K75 A;  1MIU A;  3F2C A;  4JBK A;  3CD6 A;  1BBU A;  3RN5 A;  1HNZ Q;  5IYD G;  3KJP A;  2A1A A;  4LF6 Q;  4A93 H;  2BA1 A;  4P72 A;  4DUY L;  1G29 1;  4UP9 A;  5LMU L;  4LUZ A;  3CCM A;  4GOP A;  1WCM H;  4PZ7 A;  4J15 A;  5HY6 A;  2WAQ G;  3G48 A;  4TVA B;  3TS2 A;  4JYA Q;  4DV7 Q;  3UDG A;  2LXK A;  4JI8 L;  1YIT A;  1XJV A;  2HIV A;  3H15 A;  4B3T Q;  4HIM A;  2N8N A;  3PIO A;  4BBS H;  3H3V I;  4FDB A;  2OQK A;  4R4O A;  3CPF A;  4PZ8 A;  1Y14 B;  4DR7 Q;  4IFD G;  5JEA G;  2IX1 A;  3HOZ G;  4YWM A;  1IBM L;  3RLO A;  4YY3 L;  2NVX H;  2OCE A;  2NZH A;  1NJI C;  2E2J H;  3PO3 H;  3PUV A;  1N32 Q;  5M3F G;  4LFB L;  4JI6 L;  5GRO A;  1CKM A;  5C0X G;  3PIP A;  2OTJ A;  5M5W H;  2VUM H;  1VQI A;  1X65 A;  1Q8K A;  3K7A H;  3J80 i;  4EX5 A;  1I5F A;  1YI2 A;  5ELN A;  1QVC A;  3RN2 A;  5IYB G;  2ZM6 Q;  2AHO B;  5C4J H;  1OXV A;  3HOY H;  1CSP A;  2K5H A;  3CW2 C;  4DR3 Q;  3G71 A; 
#chains in the Genus database with same CATH topology
 3EN2 A;  2KJX A;  4YIJ A;  3DM1 A;  1EWH A;  3R93 A;  1XYI A;  4A3F B;  1X3G A;  5JJI A;  1S3O A;  4ODG A;  1HCZ A;  2D2C C;  1ILQ A;  1UE5 A;  3S17 H;  1STN A;  1N33 L;  1L0X B;  2K4K A;  3S2H B;  1AP0 A;  1O7Y A;  1QG7 A;  3K5N A;  3KFU A;  3MEH A;  5A35 A;  1OTC A;  1EUJ A;  4KY6 A;  4DR2 L;  4IOA A;  2N88 A;  4C1N I;  1KIX A;  4KHP Q;  2HQE A;  4K2L A;  5CR3 A;  4DU9 A;  3S2D B;  2LFN A;  1DOM A;  5ELC A;  1L2F A;  1JQY D;  2EXD A;  1GHK A;  3DLL A;  1KHI A;  1JWU D;  1U4R A;  4KHZ A;  5GQO A;  2Q8T A;  4DV0 Q;  2PMZ B;  4QJF A;  4JI3 Q;  4YWK A;  3BVG A;  5H1S E;  1ASY A;  3SGI A;  5FJ8 G;  1R4P B;  4AYB G;  3CCL A;  3S16 B;  1S40 A;  3DEP A;  1PH1 A;  1PFN A;  1C7Y A;  2WAQ B;  1HZB A;  1IBK L;  1ILP A;  4XIG S;  4L5S A;  4NXN Q;  4IUP A;  5JEA H;  1YBY A;  2X69 A;  3E0E A;  3P7J A;  4A3K B;  1HQR D;  1IBL Q;  1L0W A;  2F0Q A;  3DUZ A;  5J22 A;  4DR4 Q;  4LFA Q;  4DAY A;  3TBI B;  1EY5 A;  1M8A A;  3C1E A;  1PFS A;  2HT1 A;  2KA7 A;  2K28 A;  3TME A;  4IPD A;  3CF5 A;  1FNW A;  2N3S A;  1D8L A;  1VDZ A;  2K5V A;  3H0G G;  2B39 A;  5LHY 1;  3BYY B;  1XMQ Q;  4LFC L;  2BDN A;  4DF7 A;  1QCB D;  2R7Z B;  1EU4 A;  1MKH A;  5C4X B;  2F3I A;  3TP8 A;  1EIY B;  1E1O A;  1NSN S;  5IT9 c;  4EVO A;  5LMU Q;  4DN4 M;  3CXC A;  4ZKC B;  4CJ0 B;  4ABN A;  2NVY H;  4HIO A;  2FXQ A;  1PRT B;  1VQK A;  1FR3 A;  4IFD J;  1D1I A;  4DR6 L;  1JE4 A;  4GNX B;  4QY7 A;  3VR3 A;  2PCF B;  1HZA A;  1VF7 A;  1BNZ A;  3F2D A;  2K32 A;  1PH4 A;  1B9N A;  2XVS A;  1SSO A;  1ICW A;  2Q2I A;  3D4D A;  1S5B D;  3NTI A;  4V19 0;  4OL7 A;  4JBJ A;  1TS4 A;  1A3V A;  4LK1 C;  4U67 3;  2PMZ E;  5FJ8 H;  1HXY D;  4DV1 Q;  3FDT A;  3I90 A;  4PNY A;  4BY1 H;  2GVA A;  3RZO H;  2EYL A;  2E76 C;  5C3X A;  2HHH L;  2WAQ E;  2AKW B;  3AEV A;  1OXX K;  1CTM A;  3OSO A;  5IP7 H;  1RTN A;  3E6Z X;  3PUY A;  4AH6 A;  4LJZ C;  3KF6 A;  2WKC A;  2IL8 A;  1K8M A;  4L63 B;  2N78 A;  4KKU A;  2PNR C;  4JBM A;  3STB D;  3VR5 A;  1EY7 A;  2PZW A;  1YHB A;  1QIL A;  1KNA A;  3HZX A;  3A7A B;  5FLM H;  4A3B H;  1SYD A;  2IHE A;  1ESR A;  3I56 A;  3NXW A;  3I4N B;  4QIW B;  5GAG C;  1X54 A;  3OWF A;  4JI0 L;  2BH2 A;  3M4O B;  2HCC A;  5EKK A;  1Y69 U;  3U9S A;  3K0X A;  3BDO A;  1BCP C;  3GO5 A;  4NDX A;  2EVB A;  2A69 C;  2I5M X;  1QVG A;  3T16 A;  4DKA C;  2K5D A;  4JV5 L;  3A8J E;  1UE6 A;  2G5D A;  1P8L A;  1VCI A;  3EA6 A;  2OT2 A;  1GUO A;  1GKH A;  2EYO A;  5I4D A;  2AMC B;  1ENF A;  2KHS A;  1WOC A;  3V2T A;  4X65 Q;  4ME5 A;  1HR0 L;  2L11 A;  2M2L A;  3C1F A;  4XT3 B;  1VQJ A;  1B7Y B;  1VQG A;  1KQS A;  3L0O A;  4B08 A;  1ZYR C;  1T9H A;  4N8X 1;  3G6E A;  3HOZ H;  5LL6 X;  1MJE A;  2O5J C;  1E2V A;  3NBI A;  4DV2 Q;  2FFK B;  2JA8 B;  2RA4 A;  3HOW B;  1ZYR D;  5HUR A;  2SNS A;  2A73 B;  2VQF Q;  1EIG A;  1Z6H A;  4CKE A;  5LMN Q;  4KMU C;  1PTO H;  1Q7Y C;  2KCN A;  2J7Z A;  2R6G A;  3CHB D;  3M7G A;  2UU9 L;  5JAV A;  1LTR D;  4EQN A;  2F0N A;  3OMG A;  2ID0 A;  4A3G G;  5FLX c;  4LF9 L;  3OYY A;  1HQM C;  4DPG A;  5DM7 3;  3PO2 B;  2MGS A;  4RKB A;  4YHH Q;  2F3V A;  5ELB A;  4JI1 Q;  3F1Z A;  1I50 H;  2ZXR A;  1H9M A;  3CCR A;  1SBB B;  1GUG A;  1KAW A;  2I5H A;  5CMD A;  2K14 A;  1TWF H;  4HMI A;  1SMX A;  4A3C G;  2WFW A;  5IGB A;  3OWE B;  5CV9 A;  1WTO A;  2YV5 A;  3D8G A;  1IW7 C;  1Q1B A;  2ZXP A;  1JOO A;  2EYM A;  2RHQ B;  5I6W A;  1KXL A;  1SEB D;  4H13 C;  2QIL A;  5NUC A;  4ZYS A;  1AN8 A;  4B3R Q;  3Q8D A;  3SE0 A;  1HNX Q;  2NVT H;  1Q3L A;  5E4W C;  1X3F A;  2ICI A;  5J1Z A;  3WDN A;  2HD3 A;  2PW5 A;  2BE5 C;  2MO0 A;  2IY5 B;  5KNC A;  4DUZ L;  1PTO C;  2F0V A;  4A3I B;  2OQ0 A;  4R4I A;  2UUB Q;  2K05 A;  4JPB W;  2BE5 D;  3ERS X;  1VQ7 A;  3FPU B;  2B2U C;  2DNC A;  1DXM A;  1Z7T A;  4A3J B;  1PTO D;  1YJW A;  3DM3 A;  1VQ4 A;  4GLX A;  2RKS A;  2F0W A;  1C9O A;  4JI5 Q;  1BF4 A;  4H0L C;  2VS1 A;  5T1G A;  1L1O A;  1TQO A;  1X3P A;  3VYS A;  3DHQ A;  3RLF A;  5C5M A;  2Q8I B;  1FJG L;  4Q5V A;  3J81 c;  1SYB A;  4DR7 L;  2H4O A;  4LUO A;  3SK6 A;  1K8A C;  1GOZ A;  1SNC A;  2BCO A;  3PSI A;  4CDC C;  5IGE A;  5GAD C;  4HSV A;  1X56 A;  1N32 L;  3H94 A;  1FD7 D;  4NPS A;  4A3G H;  5JJL A;  1PH8 A;  1K28 A;  2N49 A;  5M5X H;  3NSW A;  3HOV B;  1K9M C;  3OMC A;  4JOI A;  2JA9 A;  3VR6 A;  3GTL H;  1R9T H;  2ZJQ A;  1SE8 A;  4A3E B;  1XPR A;  4OO1 G;  2UUC Q;  1I4Q A;  5DM6 3;  4RGN A;  1N8R C;  5I9P A;  2LY7 A;  5IGG A;  3L2P A;  4A3C H;  3W1G A;  1BCP F;  4DR5 Q;  3KF6 B;  3GTP B;  1SLJ A;  4O42 A;  3IAY A;  1WCM G;  1HUN A;  2H5X A;  2JA7 H;  5E1F A;  3IL8 A;  4QMG A;  1FYC A;  1UEB A;  2RBM A;  3PUZ A;  1LTS D;  1CKN A;  2CWP A;  1AE2 A;  3AMU A;  2QDL A;  4OWW B;  3F8T A;  5FKA C;  1JB3 A;  1KAA A;  1AZQ A;  2HDL A;  3PO3 G;  4IUT A;  1B2T A;  4UHV A;  4C1N K;  2JA6 B;  4BA1 I;  1JMC A;  4WJ3 M;  5KIX A;  3MFG A;  1AE3 A;  4ZLT F;  3PIP 3;  2IW3 A;  2NBF A;  3UE1 A;  1SE3 A;  4JI3 L;  2OF1 A;  4IPG A;  4C56 C;  5IYC G;  2R92 H;  3HOY G;  3HGB A;  4DR6 Q;  1J5E L;  2E2H B;  4A3F G;  3S14 H;  1TY0 A;  1UE7 A;  1EL0 A;  1LV9 A;  3R8B A;  1GJX A;  4HAE A;  1TS3 A;  1ASZ A;  1ZXT A;  1ICF B;  1TWH B;  4NXN L;  2E2I H;  3D6W A;  3AQQ A;  5KNB A;  1YJN A;  1Q81 C;  4P71 A;  2A8V A;  1LYL A;  3CQZ H;  4MZ9 A;  4JI2 Q;  3TSS A;  4LW1 A;  1IBL L;  2D0O A;  4CDD C;  4DR4 L;  1NTG A;  1B50 A;  3GTG H;  1PVO A;  1MD2 D;  3TQY A;  4PMW A;  4GLA C;  2SEB D;  1D1K A;  1HA5 A;  3I70 A;  2F0I A;  4OO1 H;  2D62 A;  5ELD A;  3HFZ B;  2EXZ A;  1YNN C;  4OXP A;  3P20 A;  3CD6 A;  3D4R A;  4JBK A;  2R3Z A;  1L0Y B;  2EJM A;  1S4Z A;  4CJ2 C;  3RN5 A;  3OPO A;  3KJP A;  1RF2 D;  2A1A A;  4LF6 Q;  1LTB D;  4G7O C;  4DUY L;  5LMU L;  4LUZ A;  1SAP A;  4HCS A;  1WCM H;  5HY6 A;  1JWS D;  2WAQ G;  3G48 A;  3TS2 A;  3SXH A;  3UDG A;  2LXK A;  1XJV A;  4B3T Q;  4HIM A;  2OQK A;  3CPF A;  1RCV D;  1KLG D;  1QNU A;  4YWM A;  1IBM L;  2E2J H;  3PO3 H;  1CA6 A;  4LFB L;  1CKM A;  5C0X G;  4ILW A;  2TMP A;  1SE4 A;  1VQI A;  5KEE A;  1IKM A;  1DJR D;  1GUN A;  1F2L A;  1Q8K A;  4EX5 A;  3MFY A;  1QVC A;  5IYB G;  3HOY H;  1WTX A;  2IWH A;  3CW2 C;  5BN4 A;  4ZCK A;  4DR3 Q;  2X6L A;  5C4J B;  4DV1 L;  2Y0S B;  2R7Z G;  5C4X G;  1W2B A;  1VQ8 A;  4A3L H;  3ZJY C;  4O1N A;  4X66 L;  3S2H H;  1S5E D;  4ZAI A;  2XN9 C;  2O5I C;  4BXX G;  1G2T A;  4JVZ A;  3AU7 A;  4DNI A;  4GKK Q;  3NEN A;  5EPL A;  2PQE A;  3NK9 A;  3MEF A;  1QVF A;  1L1O B;  5D3D A;  3S2D H;  1CHQ D;  1EFW A;  1XMO Q;  2WKD A;  3BZK A;  4FVM A;  2K7V A;  5KYI A;  2WP8 J;  3KDF B;  4OX9 Q;  1EOT A;  2XIW A;  2ASB A;  1EYC A;  3M85 A;  4K6L A;  3HOU B;  2Q2U A;  2F0U A;  2UU9 Q;  1M4V A;  2JYO A;  4OIK A;  3S1N H;  2RQX A;  2M00 A;  2JE6 I;  1VQA A;  4EQP A;  3OTO L;  2PW7 A;  1KDC A;  1TWA H;  4KJN A;  4Q0F A;  3A55 A;  2I0Q A;  1JB7 A;  3IKJ A;  4GN5 A;  4HN7 A;  1KDA A;  2PNH A;  5BR8 Q;  1GXD C;  4A3K H;  4DXF A;  1E0B A;  4LUV A;  2RDF A;  4X65 L;  1I6H H;  2B8F A;  2JEA I;  3G4S A;  1S5F D;  3ULJ A;  3KBG A;  5I9O A;  3K7U C;  2PPB C;  2ATW A;  2NB0 A;  2P5Z X;  3NWT A;  3I4N G;  4LF4 Q;  4FF3 A;  4DV2 L;  3QIA A;  4HJ7 A;  2PYK A;  3G6J B;  3WOE A;  4F87 A;  1AH9 A;  5C4X H;  1TVX A;  2VQF L;  2Y0S E;  4DUZ Q;  5C44 B;  5LMN L;  4L5R C;  1TXY A;  1G6P A;  3HOX H;  1VMP A;  4BXX H;  2JA5 H;  5D14 A;  4JI8 Q;  1J9O A;  2R93 H;  5JEA J;  2C5C A;  3PUX A;  4RMF A;  4X3S A;  1O7I A;  1B4O A;  3A74 A;  1Y8P B;  1LT4 D;  3NEL A;  1CHP D;  4YHH L;  5EBC A;  3V05 A;  4JI1 L;  4R4T A;  3HG9 A;  5TSS A;  3I7F A;  4JI6 Q;  1V8Q A;  1WTP A;  4QQB X;  1FJG Q;  2SNM A;  2K33 A;  3BYT B;  1FL0 A;  1Y8O B;  3A5U A;  1ML0 D;  2NVQ B;  2EYJ A;  3CMA A;  2JA8 G;  3HOW G;  3TN2 A;  2QEX A;  2XTI A;  4Y7N B;  4JW0 A;  2F1M A;  4B3R L;  3CC2 A;  1HNX L;  2ICE C;  1TWC B;  3MXN A;  3RLN A;  2Z0S A;  1GUS A;  5IP9 G;  2EY1 A;  4ZK9 B;  4K5X A;  2IT1 A;  2B8G A;  5D3I B;  2UUB L;  3C46 A;  4ZQ3 A;  4F7X A;  4UP7 A;  4Z9C B;  3PO2 G;  2KUM A;  5GAH C;  3HEJ A;  4FYD A;  1UWV A;  2MPM A;  1KDB A;  2EY6 A;  2YU9 H;  1S72 A;  4XDX A;  4JI5 L;  1PRT D;  4KI0 A;  2RCN A;  2FHT A;  1MI2 A;  1EYG A;  4B9X A;  3QG1 A;  1UNS A;  2DNE A;  1SFO B;  1EIF A;  1CK1 A;  3EFX D;  4BY7 B;  1XWE A;  4PZ6 A;  4APV A;  2B2V A;  1VQE A;  3NQT A;  4OIJ A;  1VQN A;  1S5C D;  1TR5 A;  3OIQ A;  4TSS A;  4C3J B;  4A4I A;  1YVC A;  2Q8R E;  1EQT A;  1Q82 C;  1IHZ A;  2ZM6 L;  4C2M H;  1QNK A;  4NKL A;  1WTR A;  1TU2 B;  3TP5 A;  4X64 L;  2QEJ C;  4DR1 L;  1JT8 A;  1HTP A;  4A3I G;  4GN4 B;  1STB A;  4OO1 I;  1Y8N B;  2AUJ D;  1E24 A;  4OWT B;  1J5E Q;  3H3V H;  1GUT A;  1LAC A;  4K8I A;  3GTO H;  1FGU A;  4A3J G;  2NWG A;  3ITP A;  2UUC L;  2VL6 A;  1EQQ A;  4ID6 A;  3A5Z B;  3CC4 A;  1SN8 A;  4KY5 A;  2EJF C;  4DR5 L;  2VXW A;  5KGU A;  1KLU D;  3SK4 A;  1B1Z A;  2JA8 H;  3HOW H;  4MIU A;  3GTK H;  4EQ5 A;  4R8I A;  1YZ6 A;  5DLQ E;  2BDO A;  2K04 A;  3VYU A;  2E5L Q;  1DD2 A;  1G8Z D;  4GLV B;  4PG3 A;  3FRP B;  1AEX A;  1PZI D;  5FO7 B;  3NEM A;  2KEN A;  4LNQ A;  1H9S A;  3K8A A;  3HOV G;  2OEO A;  5BN3 A;  2KHJ A;  3M4Y A;  1G91 A;  4DUY Q;  2V4D A;  3TZD A;  1NE3 A;  4A3E G;  4Y52 H;  2VB2 X;  2SDF A;  1M90 C;  1IZ6 A;  2B2V C;  4MTN A;  1V1P A;  2PI2 E;  3FMC A;  2HDM A;  2L4N A;  1IBM Q;  1U4L A;  3RUZ A;  4A76 A;  1X9N A;  3NE5 B;  4LFB Q;  2EIF A;  3K57 A;  1K3R A;  3K5M A;  5CC4 A;  2XRS D;  1LT3 D;  4M8A A;  3I4M B;  4JI2 L;  4A3D B;  3I4L A;  2OTL A;  4DXG A;  1GVP A;  4BBR B;  4JI7 Q;  4A3I H;  4U68 A;  4RGT A;  2VQE Q;  1VQM A;  1KD1 C;  1PHJ A;  1WJJ A;  2JA6 G;  1TS5 A;  2IJ0 A;  4A3J H;  4FO2 A;  4FXK C;  1XX8 A;  1PH6 A;  2EDG A;  1RTO A;  3R2I A;  3CU7 A;  4X66 Q;  1B70 B;  4V0B A;  4HID A;  1PXU A;  3STB C;  1SRO A;  4BBS B;  4MN3 A;  4LF6 L;  3CRL C;  2C35 B;  2BH8 A;  5ELF A;  3TRE A;  1O7Z A;  5AFW A;  1V9P A;  4CJ1 B;  2NVX B;  1NUC A;  2Z4H A;  3KF8 B;  3J81 j;  4B3T L;  3K58 A;  3VDY A;  1CI3 M;  4WJ4 A;  4X3T A;  1O7L A;  2KED A;  3L3O C;  2JQO A;  2KCT A;  2VUM B;  2RDG A;  3E3X A;  3MHB A;  3H0G H;  3HS0 C;  4L6T B;  5C0X I;  1CQF A;  3OOC A;  3HOV H;  4F8M A;  5C6A A;  1EEF D;  5JVH 3;  4HJ5 A;  4GKJ Q;  4J1M A;  4A3E H;  2O2L D;  4ZUI A;  3OTO Q;  3I4O A;  3MXN B;  1LLR D;  1D5X C;  3PMF A;  3FVQ A;  3UI2 A;  3HKZ B;  4DR3 L;  1C48 A;  2B3G A;  1ESF A;  1HPC A;  5C3W A;  2KEE A;  4DV5 L;  4CGY B;  4FXG C;  2UUA L;  1W6J A;  2CWA A;  1NR2 A;  5BN5 A;  4RFB A;  3QR8 A;  4GKK L;  1KRS A;  1LAB A;  5JJK A;  4KTA A;  3Q24 A;  2IX3 A;  3RD4 A;  1CFM A;  2K52 A;  2B2U A;  4DV4 Q;  3NBH A;  1B44 D;  2F0J A;  1XMO L;  2JA6 H;  4HJA A;  3UE0 A;  3VYT A;  2V1C C;  4NB3 A;  1X3Q A;  1BDO A;  4OX9 L;  4R9W A;  4KK7 A;  1I3Q B;  3GTJ B;  1EQR A;  2F03 A;  4C3I B;  3CCU A;  2R61 A;  2E2H H;  2WB1 B;  3S1Q B;  2Y0S G;  2PQA A;  4JBW A;  1YEZ A;  2K5N A;  4CKC A;  1QZG A;  3ICE A;  5JJZ A;  1H9K A;  4RH6 A;  2DJG C;  1JWM D;  1BKB A;  1SMY C;  1TWH H;  1K83 H;  1VQB A;  5ELO A;  5BR8 L;  1F2Z A;  1WTQ A;  1SMY D;  5AJ3 L;  1YIJ A;  2I46 A;  3QO2 A;  1XNQ Q;  2K03 A;  5CV8 A;  5IT9 E;  2N55 A;  1HZC A;  2CKZ B;  4XQN A;  1QUQ A;  1Y1W B;  1UUP A;  3A8K E;  1UE1 A;  1EEI D;  5JPN C;  3Q23 A;  1CQV A;  1Q46 A;  1XTD A;  5KND A;  4DAY B;  1E2W A;  2ZTC A;  3RZD H;  1BR9 A;  1GO3 E;  4LF4 L;  4KLK A;  3M4Q A;  3HOU G;  2EQS A;  3HKZ E;  5IE8 A;  2K75 A;  2NVY B;  1HNZ Q;  5IYD G;  1VF5 C;  2J4X A;  4UP9 A;  5K5P A;  4GOP A;  4A93 B;  3T4A C;  1DM0 B;  4QUF A;  1SE2 A;  4J15 A;  4HED A;  3KLR A;  3JAM L;  4FF2 A;  4DV7 Q;  3BG3 A;  4JI8 L;  2X6G A;  1I4H A;  3H3V I;  1V1P B;  4R4O A;  1LTT D;  4K6D A;  1MSH A;  1Y14 B;  2IX1 A;  4PQX A;  5KYL A;  1BCP B;  3X3N A;  3RLO A;  2OCE A;  2NZH A;  3I8Z A;  3SK8 A;  4JI6 L;  5GRO A;  3OW7 A;  5F2D A;  4BY1 B;  5M5W B;  1YI2 A;  3K7A B;  5CBA E;  5C4J H;  2ZM6 Q;  2K5H A;  4G4K A;  4H7B A;  4X64 Q;  2WB1 E;  4DR1 Q;  2EZV A;  4RWS C;  5C44 G;  4HIK A;  2F4V L;  4WOR A;  3G7L A;  3DXJ C;  1BQQ T;  4LF5 L;  3LNN A;  1IL2 A;  1RDP D;  3P75 A;  3X3M A;  2PO4 A;  1OXS C;  4ZKB B;  3OW2 A;  3TP6 A;  3L7Z C;  2KHI A;  3GTM B;  5DAU A;  1RJT A;  4A3B B;  4UAI A;  1D5Z C;  4DAM A;  2JEB I;  3QOJ A;  2K6A A;  2NZ1 D;  3DWP A;  2JSO A;  3J7Y W;  1DZ1 A;  3K0Y A;  2VNU D;  2R7D A;  4LAA A;  2L5T A;  4GOP C;  1UEA B;  4K0K Q;  3U4Z A;  3HOU H;  4IQZ A;  2AWO A;  2ZTE A;  1N36 Q;  4IJL A;  4XT1 B;  5IYD H;  3FHW A;  4L5T A;  3N52 A;  1STY A;  3W1B A;  1SXT A;  3JC6 6;  2PZT A;  3CCV A;  1SYC A;  1B8A A;  4RHS A;  2MP1 A;  1I94 L;  1LT6 D;  3MTS A;  1GHJ A;  5C5L A;  3S15 H;  3SVM A;  2MNA A;  3HOZ B;  3J7A 5;  1IYU A;  2EY5 A;  4GS3 A;  1WFQ A;  1JCK B;  2A6H C;  4BS9 A;  5M3F B;  4IUR A;  1AFP A;  4FNF A;  2AUK A;  2QA4 A;  2ZTD A;  4O0A A;  2HIX A;  3PV0 A;  3VA7 A;  1TII D;  4OON A;  1PTO B;  2A6H D;  5CV5 A;  3SK5 A;  1U5K A;  1SND A;  5JVG 3;  1U4M A;  3MXU A;  5C44 H;  4BY7 G;  3NBH B;  3GDE A;  1ZKO A;  2I07 B;  3MC0 B;  5G3L D;  5DNF A;  4IO9 A;  2F52 A;  4C3J G;  1F9S A;  2JJQ A;  2Z9H A;  4J8Q A;  2E5L L;  5EJW A;  4IN3 A;  1CM9 A;  3JAM E;  3M3Y H;  1SRU A;  3MVV A;  1I50 B;  2K1B A;  5C3E B;  4R1J A;  3EIV A;  1TWF B;  1TWG B;  1VQO A;  1P16 A;  5C0X J;  4YY3 Q;  3GTQ H;  3KUP A;  3A0J A;  4ALP A;  1B3A A;  3R3O A;  4KD3 A;  1PTO F;  4QF4 A;  4DA2 A;  2RSN A;  2PZU A;  4WRD A;  1Q8I A;  3U4V A;  1NNX A;  4C3H B;  2KQ3 A;  1QUQ B;  3CPW A;  2Z1C A;  3RNU A;  1DOL A;  3KJO A;  4NXM L;  5FOB B;  1QOH A;  3CME A;  4A3M B;  1YNJ D;  3C2P A;  3D6C A;  2OWO A;  5IYC H;  1HFG A;  1YJ9 A;  4JI7 L;  1I4R A;  2VQE L;  2B63 B;  2ENB A;  2LSS A;  4TRD A;  3I55 A;  5M5Y B;  4A3F H;  1D5M C;  1SDF A;  4KKS A;  3J81 E;  2KBN A;  4DV5 Q;  1XNR Q;  2K01 A;  1VQ6 A;  3HRZ C;  1K8O A;  3CCQ A;  2UUA Q;  1DON A;  3V96 A;  5IY0 A;  3BDC A;  4AQY Q;  2L0C A;  4K5V A;  1SFO H;  1BO0 A;  4B9W A;  4I7Z C;  3BU2 A;  2Z6K A;  2CH4 A;  2MO1 A;  1II3 A;  1S5D D;  1X32 A;  3DWQ A;  4L5Q A;  4N8F A;  3T1Y Q;  4X6A H;  4POG A;  3JAM i;  1STH A;  2F4I A;  2AQ1 B;  4A3D G;  4LWC A;  2LS0 1;  1PH7 A;  3I4M G;  1ONL A;  3GTL B;  2LMC B;  1T5X D;  2DN8 A;  2Q2H A;  2RDH A;  5GAE C;  4DV6 Q;  4BBR G;  4H02 A;  1ROD A;  1K73 C;  3VA5 A;  3CCE A;  4M1U B;  5FO8 B;  2D5D A;  4JC0 A;  3S16 H;  2DGY A;  2NZO A;  4GKJ L;  3K5O A;  4IPC A;  2Z4I A;  2QKI C;  1Q1E A;  1I4G A;  2NTS A;  4RG1 A;  1J6Q A;  3F2U A;  1A8V A;  4L8J A;  2JA7 B;  4BBS G;  3FEW X;  1EOV A;  3J7A F;  5AJ3 Q;  4MHE A;  3PQI A;  2CW0 D;  3R2T A;  2F0G A;  5C0X H;  1CZW A;  1Y1V B;  1EY0 A;  4TQU S;  1BUV T;  3I2Z A;  2B2T C;  1QB5 D;  5KRU A;  2VUM G;  3NHH A;  1Q86 C;  5IYB H;  1CKN B;  4DV4 L;  1HNW Q;  3J81 i;  2R7Z H;  2R92 B;  2L55 A;  4X62 Q;  1O80 A;  1U0L A;  2F0H A;  1J8I A;  3Q22 A;  1CT1 D;  3NTH A;  2Z6K C;  1NCV A;  1DGS A;  3J80 L;  3HKZ G;  4IUU A;  3D31 A;  4XYO A;  3QWN A;  4IZ8 A;  2E2I B;  5EPK A;  1I6V C;  1TS2 A;  3E0J A;  3FPP A;  4ZUJ A;  2GVB A;  3FKI B;  4I7A A;  3PF4 A;  5EAY A;  1U4P A;  1HA6 A;  2DJF C;  2JK8 A;  1LT5 D;  3LWE A;  1VQC A;  3A7L A;  3I4M H;  4IOC A;  1A63 A;  1D6E C;  1X55 A;  1XNQ L;  2CFM A;  4RKL A;  1YHA A;  4DNR B;  1PA6 A;  1EY6 A;  3S1M B;  4JK1 C;  1D7Q A;  1K0S A;  1W6K A;  5I2X A;  2F4V Q;  3T56 B;  4CKB A;  5K36 G;  1IYV A;  4LF5 Q;  3MXG A;  1E1T A;  1C8C A;  4B3M Q;  2ZXO A;  1KL9 A;  1MSG A;  2ES2 A;  5T1I A;  1KTK A;  2XWJ B;  4C3I G;  5M3M B;  2F0T A;  2WB1 G;  3C3L A;  1A3T A;  1HNZ L;  5CYU A;  3UDF A;  5IIF A;  4KN4 C;  3CCJ A;  4J6H A;  4G7H C;  3E9H A;  2EYF A;  1OXU A;  1PRT C;  2BOS A;  1TT2 A;  4GNX C;  1NBW A;  3PF5 A;  3CC7 A;  1JE5 A;  4DV7 L;  3QB3 A;  4YCV A;  4LF7 Q;  4UY8 C;  3K59 A;  1RKN A;  5EPJ A;  3I4N H;  3RR5 A;  4NW2 A;  4RGO S;  2XGT A;  3M4O H;  1XXG A;  1IL8 A;  3N6R A;  1Y1W G;  2KEC A;  2NN6 G;  1MHW C;  1OO9 B;  1D2B A;  4JI4 Q;  1STG A;  1JR0 D;  3ER0 A;  2VB3 X;  3H91 A;  1WTV A;  1SR3 A;  3K81 C;  4HCE A;  4B3S Q;  2YYZ A;  4LF8 Q;  1H9J A;  3TS0 A;  1BBW A;  5COY A;  2F0O A;  1I94 Q;  3AB9 A;  4DK1 A;  1HRJ A;  3DEO A;  1EIH A;  2RCF A;  1WVL A;  3I3C A;  2AQ2 B;  4A93 G;  4IUV A;  4FF4 A;  1M1K C;  1EY8 A;  1QWY A;  1V1Q A;  2CVR A;  1HTL D;  5A2Q E;  4JCV E;  3LWU A;  4HSP A;  3IRB A;  5IGC A;  2L9H A;  3GD7 A;  4LMQ D;  3EVQ A;  1SJE D;  2K5Q A;  5LL6 S;  2UXB Q;  2EYH A;  2F0M A;  2E2D C;  5C4Z A;  2AQ3 B;  5CV4 A;  2EJG C;  3SR1 A;  1PZK D;  2KVM A;  3K5L A;  4KHV A;  3S1N B;  5JOB A;  5K36 H;  4BY1 G;  1STA A;  4DAV A;  1G2S A;  2WIN B;  4K0K L;  5IP9 H;  1I3Q H;  1I4P A;  3GTJ H;  1N36 L;  1TWA B;  3FP9 A;  4C3I H;  1KAB A;  3T1H L;  3S1Q H;  4NP5 A;  5ISR A;  3J80 E;  1EQV A;  5COR A;  3U9O A;  1FNV A;  1UAP A;  5IP7 G;  4MTK A;  3AFQ A;  3PO2 H;  3VR2 A;  2ZT9 C;  1VQH A;  4UP8 A;  1I6H B;  4OEM B;  1X6O A;  3MA2 B;  1LUZ A;  3WWV A;  2CQO A;  3LGJ A;  3CKI B;  1SNM A;  4DK0 A;  5FLM G;  1NAP A;  2MFI A;  4A3B G;  5HGQ A;  3H3V C;  3D0F A;  3S1R B;  3SDZ A;  3ULL A;  1IYJ B;  3OIP A;  1VQ9 A;  2XRQ D;  1Q90 A;  3ZYY X;  5IWA L;  2YTV A;  1Y1W H;  1LM0 A;  1MBY A;  2NN6 H;  4OWX B;  4KN7 C;  1O78 A;  3BVM A;  4QL5 A;  4G7Z C;  4NXM Q;  3QJY A;  1HJP A;  4O2D A;  3HOX B;  2UXC Q;  2VY3 A;  5IT9 L;  1JIC A;  2JA5 B;  3F2C A;  1A6X A;  4K8J A;  2R93 B;  2IPK D;  5CV6 A;  1EU3 A;  4KY7 A;  4A93 H;  2BA1 A;  2F0S A;  3I91 A;  4P72 A;  4UDU C;  2JP1 A;  3Q6S A;  1AZP A;  1TY2 A;  4PZ7 A;  2A74 C;  2Z8L A;  1BOS A;  4TVA B;  3NP8 A;  4DNT B;  1PFB A;  3ND9 A;  3SHL A;  5CGK A;  3H15 A;  2N8N A;  4OEL B;  3PIO A;  3IFD A;  1F9Q A;  2QF7 A;  4PZ8 A;  4IFD G;  2E74 C;  1F77 A;  4PMB A;  3HOZ G;  4YY3 L;  5I2Y A;  3PUV A;  2E75 C;  5M3F G;  1A2T A;  2OTJ A;  5M5W H;  1B3Q A;  4ULL A;  1X65 A;  4KJO A;  3K7A H;  1PZJ D;  3J80 i;  1I5F A;  2A68 C;  2H1E A;  3GQB A;  3RN2 A;  1OXV A;  1PRT F;  1CSP A;  1WD0 A;  1EZ8 A;  3G71 A;  2MUY A;  4KD4 A;  3UDX A;  2UXD Q;  1PV4 A;  3KYH C;  1SNQ A;  2A68 D;  2FJ2 A;  4N9T A;  1A62 A;  4QGU A;  2LXJ A;  3H09 A;  2EYP A;  3GTM H;  3BS1 A;  2AWN A;  4UPA A;  2DUD A;  2OXP A;  3S17 B;  5LMN W;  2YU9 B;  5C3E G;  3A54 A;  4RCO A;  3GTP H;  1A15 A;  5IGF A;  1XNR L;  2NTT A;  5J39 A;  1YHQ A;  3VR4 A;  1VQ5 A;  2GA4 B;  5E7N A;  3KLW A;  1N34 Q;  4AQY L;  3MAQ A;  4R4C A;  1NY4 A;  1LTG D;  3RMH A;  4GN3 B;  3I72 A;  2J0T D;  2I5L X;  2RF4 A;  1BCP D;  4C2M B;  5EQ0 A;  4C3H G;  3S24 A;  2A69 D;  3T53 B;  3Q0A A;  1A3U A;  3PGZ A;  1Z9F A;  5DEH A;  3T1Y L;  4S3S A;  1PDQ A;  4QUC A;  2IX0 A;  1FVI A;  1X3E A;  3D4W A;  3TEH B;  1Q12 A;  4XQJ A;  4IAL A;  4A3M G;  3MZ5 A;  4DV6 L;  3GTO B;  5I6Y A;  2MQH A;  2NYZ D;  2NUC A;  2B63 G;  1HH2 P;  4IFD H;  1A2U A;  3W2D A;  5L37 A;  3BZD B;  5EBD A;  1PH3 A;  1Z47 A;  3A56 A;  2CCZ A;  5M3F H;  2TSS A;  5IOD A;  2ZJP A;  3GTK B;  1H9R A;  3MXP A;  1EYD A;  2CH4 W;  3M9B A;  4XYQ A;  5EKL A;  1SYG A;  1VS0 A;  4KKT A;  4DGZ A;  3TZU A;  4I65 A;  2KCM A;  4RHR A;  2Z6B A;  3U50 C;  1EY9 A;  4XXE A;  4X3U A;  4BWG B;  1HHV A;  1WI5 A;  1JC7 A;  5FLX L;  2VW9 A;  1HNW L;  4X3K A;  1XPU A;  4WFN 3;  5C3E H;  1E2Z A;  3NUC A;  1TWG H;  1VQD A;  2CQA A;  1AW7 A;  5EKI A;  4X62 L;  4HTH A;  2ZJR A;  5FO9 B;  4QIW E;  3JAM c;  4ME3 A;  1H9S B;  3KK7 A;  4AIM A;  1RHP A;  2R7F A;  1KC8 C;  1K8G A;  2BA0 A;  3DMU A;  3HOY B;  2A5H A;  1QE6 A;  3P1H A;  2HQL A;  3NPP A;  2JA7 G;  3M7N A;  2XNA C;  4HMJ A;  4YCW A;  1IW7 D;  5HGT A;  2XWB B;  4YWL A;  4C3H H;  1EWC A;  2EPB A;  2D9U A;  1Y1V G;  3ONA B;  2L15 A;  1PH5 A;  4YCU A;  1LTA D;  4AYB B;  3W3A A;  2K50 A;  1KNE A;  4P74 A;  4A3M H;  3RZO B;  5E4X A;  4DV3 L;  1SNP A;  1GD7 A;  4IUN A;  2B63 H;  1N33 Q;  3EBE A;  1NR4 A;  5M5Y H;  1GUW A;  2F0K A;  2R92 G;  2RSO A;  3I73 A;  1MJC A;  4DAP A;  3EQL C;  4DR2 Q;  2B2W A;  2EE1 A;  3TRZ A;  1F9R A;  3T13 A;  4JYA L;  3CAM A;  1ET9 A;  2CHB D;  4B3M L;  1PH9 A;  1B9M A;  1JOR A;  3KDF A;  3ULP A;  1PFM A;  5J3B A;  1WTW A;  1CZG A;  4H44 C;  3J81 L;  4PMC A;  3H0G B;  3J7Z C;  3E9I A;  3FKI G;  2FIN B;  1JJC B;  4LF7 L;  3BDL A;  1T5E A;  4PV1 C;  5JPM C;  3J7A V;  4K14 A;  4K2K A;  1K3B C;  2NN6 I;  2YTX A;  2Q2T A;  1E22 A;  1RIP A;  3B6Y A;  1JJG A;  3K6O A;  1IBK Q;  4CHT B;  1FNU A;  4CDE C;  3T1H Q;  1V1O A;  3KLS X;  2ALY B;  2DY7 A;  1EY4 A;  4JI4 L;  2QW7 A;  4FXD A;  4IUQ A;  4B3S L;  4DFA A;  1SNO A;  4LF8 L;  4ZRZ A;  1W3S A;  5M3M G;  3O13 A;  5CBE E;  4RA8 A;  3PUW A;  1SYF A;  2GN5 A;  4DK3 C;  1CA5 A;  1NMG A;  1VMC A;  3GP7 A;  4KHP L;  3U58 A;  1Y1V H;  5M9O A;  1G51 A;  4EGV A;  5IWA Q;  3DWA A;  4BA2 I;  4LFC Q;  1PH2 A;  3D3R A;  1L1O C;  4AYB E;  4QCL A;  2B2W C;  1PYS B;  3WOF A;  2UXB L;  4DV0 L;  5FLX E;  2F0F A;  1EWI A;  1RL2 A;  1V43 A;  2G9D A;  1PMR A;  1LTI D;  1HZ9 A;  1DCZ A;  1WYD A;  1PYW D;  1GM5 A;  1CKO A;  1VQP A;  4A3L G;  1R4Q B;  3ERQ A;  5E3F A;  1VQL A;  5C4H A;  1QZH A;  4CBV A;  2F0E A;  3BZC A;  1K83 B;  3NWS A;  4JOI C;  4G57 A;  4FF1 A;  2PQA B;  1G6Z A;  3FKI H;  2WII B;  2M9V A;  3E5S A;  2D0P A;  4LFA L;  1WTH A;  1U9R A;  2IHF A;  4DK6 C;  2C9O A;  1STE A;  5ELE A;  4FP5 D;  1PLF A;  4N9P A;  4NMZ A;  4POF A;  4RGM A;  3RZD B;  2NVQ H;  2NVT B;  2HHH Q;  1HR0 W;  1XMQ L;  3S1M H;  3GV3 A;  4TKO B;  2WV6 D;  4F88 A;  4Y7N H;  2YTY A;  2MHV A;  1YNJ C;  3CP0 A;  1VQF A;  2DY8 A;  2RVL A;  1TWC H;  1YNN D;  2K5W A;  3BVZ A;  1I4X A;  2UXC L;  3GV6 A;  5D65 A;  5M3M H;  2EY2 A;  3ERO A;  2PI2 A;  1EFI D;  1N9W A;  1HUM A;  4R4Q A;  1DOK A;  2F0L A;  2B2T A;  1F9P A;  4A3K G;  3L9A X;  1TKW B;  2B29 A;  1BVS A;  4R8N A;  4JI0 Q;  4GOP B;  1IKL A;  4IFD I;  1H95 A;  2HCI A;  3AYH B;  4HJ8 A;  4QB4 A;  4K5W A;  1A0I A;  3HP3 A;  1IXR A;  1QJO A;  4JV5 Q;  1ZEQ X;  3H6M A;  3URY A;  4BY7 H;  1K0R A;  3KOJ A;  3W5O A;  3CRK C;  4C3J H;  4A3G B;  1WD1 A;  1YNX A;  5M5X B;  2VZA A;  2B2Y A;  1HR0 Q;  3HOX G;  2KCC A;  1R9T B;  3TDQ A;  4GZY C;  2JA5 G;  3OHX C;  1ET6 A;  3S9W A;  4IPH A;  2UXD L;  4IJH A;  4RCN A;  2R93 G;  2F0P A;  5IOC A;  1KRT A;  3EJI A;  4RAU C;  3NTK A;  3NQI A;  3ND8 A;  1SJH D;  3QOL A;  2KOL A;  1NMF A;  3TP7 A;  4WJW A;  2CW0 C;  1C4Q A;  1CSQ A;  5FK9 C;  2RHS B;  3VYR A;  3PIO 3;  3AFP A;  5A2Q L;  3BJU A;  1N34 L;  3CCS A;  1E3P A;  1PYB A;  3HKS A;  1EZ6 A;  1RD9 D;  3K80 C;  4LF9 Q;  3PCO B;  1B53 A;  4P73 A;  2A19 A;  4XTC S;  1E7Z A;  1CUK A;  4HJ9 A;  1HFN A;  4OHJ A;  1LTL A;  4GNX A;  2FMM A;  2F0D A;  3S15 B;  2L1B A;  1MGS A;  1DYQ A;  2E8G A;  3MWY W;  3IFT A;  5EGT A;  3J80 c;  1SYE A;  5G3L F;  3S14 B;  1XPO A;  4A75 A;  2QGQ A;  3T51 B;  3S1R H;  1C0A A;  4OGQ C;  2HUG A;  4E6I A;  2B2Y C;  2SOB A;  3CQZ B;  4P75 A;  2JXM B;  3F2B A;  2LKV A;  3M4P A;  1OXT A;  1ENC A;  4MNO A;  1JJ2 A;  3SEB A;  3GTG B;  2FMC A;  2JN4 A;  4A3D H;  1BXT A;  4BBR H;  4DV3 Q;  3UDI A;  4HR7 B;  4EQO A;  3M3Y B;  4JG2 A;  1MIU A;  2XSC A;  1BBU A;  2QDB A;  2WAC A;  2QCP X;  1G29 1;  1FGB D;  1F2Y A;  3CCM A;  2G9H D;  2A6E C;  3KF8 A;  1BBX C;  4P2C B;  2F3W A;  3KBX A;  1WCM B;  3A8I E;  2EOT A;  4JYA Q;  5IGD A;  1YIT A;  2HIV A;  4BBS H;  4FDB A;  4KV6 A;  3GTQ B;  4CDF C;  2A6E D;  4DR7 Q;  5JEA G;  1F2M A;  2NVX H;  1NJI C;  1LO5 D;  1N32 Q;  2E2J B;  3PO3 B;  3PIP A;  2VUM H;  1XTC D;  2L12 A;  1ENA A;  5CV7 A;  2O4X A;  1JOK A;  4XQQ A;  2MJ8 A;  1JOQ A;  5ELN A;  2AHO B;  3KLS A;  3LX0 A;  1EYA A; 
#chains in the Genus database with same CATH homology
 4DV1 L;  3UDX A;  4X64 Q;  2WB1 E;  3EN2 A;  3KYH C;  4DR1 Q;  1PV4 A;  2R7Z G;  2UXD Q;  5C44 G;  4HIK A;  2F4V L;  1A62 A;  4QGU A;  1W2B A;  1VQ8 A;  4A3L H;  5C4X G;  1X3G A;  3ZJY C;  5JJI A;  1S3O A;  4LF5 L;  1UE5 A;  2LXJ A;  1IL2 A;  3S17 H;  3GTM H;  4X66 L;  3S2H H;  2AWN A;  4UPA A;  1OXS C;  2DUD A;  1N33 L;  3OW2 A;  4BXX G;  3L7Z C;  2KHI A;  2K4K A;  5LMN W;  5C3E G;  4DNI A;  3KFU A;  4GKK Q;  3NEN A;  1OTC A;  1EUJ A;  3GTP H;  4DR2 L;  4DAM A;  4IOA A;  2JEB I;  3MEF A;  1QVF A;  1L1O B;  1XNR L;  1KIX A;  3S2D H;  4KHP Q;  1YHQ A;  1VQ5 A;  5E7N A;  3KLW A;  1N34 Q;  1EFW A;  4AQY L;  4R4C A;  1XMO Q;  1NY4 A;  2VNU D;  2R7D A;  1L2F A;  3BZK A;  2WP8 J;  2EXD A;  4GN3 B;  3KDF B;  3DLL A;  4GOP C;  4OX9 Q;  4K0K Q;  1KHI A;  3U4Z A;  4KHZ A;  5GQO A;  2I5L X;  2RF4 A;  2ASB A;  3M85 A;  2AWO A;  2ZTE A;  4QJF A;  4DV0 Q;  1N36 Q;  4IJL A;  4JI3 Q;  4YWK A;  2Q2U A;  2UU9 Q;  3S24 A;  5H1S E;  1ASY A;  5IYD H;  3S1N H;  3FHW A;  3SGI A;  4L5T A;  4A3B G;  3W1B A;  2JE6 I;  1VQA A;  1Z9F A;  3PGZ A;  5FJ8 G;  3T1Y L;  4AYB G;  3JC6 6;  3CCL A;  2IX0 A;  3CCV A;  1S40 A;  1FVI A;  3OTO L;  1X3E A;  1B8A A;  3TEH B;  1PH1 A;  1Q12 A;  1C7Y A;  1TWA H;  4A3M G;  4DV6 L;  1HZB A;  1IBK L;  1JB7 A;  2I0Q A;  4GN5 A;  4XIG S;  2MQH A;  1I94 L;  4L5S A;  4NXN Q;  2B63 G;  1HH2 P;  1YBY A;  2PNH A;  5BR8 Q;  3S15 H;  3E0E A;  1PH3 A;  4A3K H;  1Z47 A;  2MNA A;  4LUV A;  2CCZ A;  3J7A 5;  4X65 L;  1I6H H;  5M3F H;  4GS3 A;  1WFQ A;  1L0W A;  1IBL Q;  2JEA I;  3G4S A;  2ZJP A;  4DR4 Q;  3ULJ A;  4LFA Q;  2QA4 A;  2HT1 A;  1PFS A;  2ZTD A;  3K7U C;  3M9B A;  4O0A A;  2HIX A;  3PV0 A;  2ATW A;  4IPD A;  3CF5 A;  4OON A;  2N3S A;  1D8L A;  3I4N G;  2K5V A;  1U5K A;  3H0G G;  4LF4 Q;  1VS0 A;  4DV2 L;  4HJ7 A;  1XMQ Q;  4LFC L;  2KCM A;  5C44 H;  4BY7 G;  1AH9 A;  3NBH B;  3GDE A;  5C4X H;  2VQF L;  2Y0S E;  3U50 C;  4DUZ Q;  1MKH A;  5LMN L;  4IO9 A;  2F3I A;  4L5R C;  1TXY A;  2F52 A;  1EIY B;  1G6P A;  1E1O A;  1WI5 A;  2JJQ A;  5IT9 c;  5LMU Q;  2E5L L;  3HOX H;  3CXC A;  4BXX H;  2VW9 A;  2JA5 H;  1HNW L;  3M3Y H;  1XPU A;  1SRU A;  2NVY H;  4JI8 Q;  5C3E H;  4HIO A;  2FXQ A;  4IFD J;  5JEA J;  1VQK A;  2R93 H;  4DR6 L;  4GNX B;  1TWG H;  1VQD A;  3PUX A;  4QY7 A;  3EIV A;  4R1J A;  4RMF A;  4X62 L;  2ZJR A;  1O7I A;  3A74 A;  4QIW E;  3JAM c;  4ME3 A;  1HZA A;  1P16 A;  1VQO A;  3NEL A;  3F2D A;  4YHH L;  5C0X J;  4AIM A;  4YY3 Q;  2R7F A;  1KC8 C;  1PH4 A;  2BA0 A;  4JI1 L;  1K8G A;  4R4T A;  3I7F A;  4JI6 Q;  2Q2I A;  2HQL A;  3GTQ H;  4QQB X;  3A0J A;  4ALP A;  1FJG Q;  2JA7 G;  4JBJ A;  3M7N A;  4YCW A;  1FL0 A;  3A5U A;  4YWL A;  4C3H H;  2PMZ E;  3U4V A;  3CMA A;  5FJ8 H;  2JA8 G;  3HOW G;  1Y1V G;  1QUQ B;  2QEX A;  4DV1 Q;  2L15 A;  3CPW A;  2XTI A;  3RNU A;  1PH5 A;  4YCU A;  3KJO A;  4NXM L;  4BY1 H;  4B3R L;  3CC2 A;  2GVA A;  3RZO H;  1HNX L;  2K50 A;  4P74 A;  4A3M H;  3CME A;  3RLN A;  2HHH L;  2Z0S A;  5IP9 G;  1GD7 A;  2WAQ E;  4DV3 L;  2B63 H;  2OWO A;  5IYC H;  4JI7 L;  1YJ9 A;  3EBE A;  2AKW B;  1N33 Q;  1OXX K;  3AEV A;  2VQE L;  5M5Y H;  5IP7 H;  2LSS A;  2IT1 A;  2UUB L;  2R92 G;  3PUY A;  4AH6 A;  3I55 A;  3KF6 A;  4A3F H;  1MJC A;  4DR2 Q;  4UP7 A;  2KBN A;  2N78 A;  3TRZ A;  4DV5 Q;  1XNR Q;  4JBM A;  3PO2 G;  3STB D;  1VQ6 A;  5GAH C;  3CCQ A;  1UWV A;  2UUA Q;  4JYA L;  3CAM A;  4B3M L;  1YHB A;  5IY0 A;  1PH9 A;  4AQY Q;  2YU9 H;  5FLM H;  1S72 A;  4A3B H;  4JI5 L;  3KDF A;  3ULP A;  4KI0 A;  2IHE A;  2RCN A;  5J3B A;  1EYG A;  1SFO H;  3I56 A;  5GAG C;  1X54 A;  3BU2 A;  1EIF A;  3J7Z C;  4JI0 L;  3E9I A;  3FKI G;  2BH2 A;  2Z6K A;  4PZ6 A;  4APV A;  1JJC B;  1VQE A;  2MO1 A;  4LF7 L;  1VQN A;  3K0X A;  4L5Q A;  3T1Y Q;  3GO5 A;  4X6A H;  4POG A;  3JAM i;  2I5M X;  4A4I A;  1YVC A;  1QVG A;  4DKA C;  4LWC A;  1PH7 A;  3I4M G;  2NN6 I;  2YTX A;  1Q82 C;  2ZM6 L;  2Q2T A;  4A3D G;  4JV5 L;  1E22 A;  1UE6 A;  4C2M H;  1RIP A;  2Q2H A;  3B6Y A;  5GAE C;  4DV6 Q;  1IBK Q;  4BBR G;  1P8L A;  4H02 A;  1JJG A;  3T1H Q;  1K73 C;  1VCI A;  4X64 L;  4DR1 L;  1JT8 A;  1GKH A;  2ALY B;  3CCE A;  4A3I G;  4GN4 B;  3S16 H;  4JC0 A;  2AMC B;  4OO1 I;  2DGY A;  2NZO A;  4JI4 L;  1E24 A;  4OWT B;  1J5E Q;  3H3V H;  4GKJ L;  4IPC A;  1WOC A;  4X65 Q;  1HR0 L;  1Q1E A;  4B3S L;  1FGU A;  4A3J G;  3GTO H;  4LF8 L;  4RG1 A;  2UUC L;  1W3S A;  2VL6 A;  1EQQ A;  1J6Q A;  1VQJ A;  1B7Y B;  3A5Z B;  3CC4 A;  1A8V A;  1VQG A;  5M3M G;  3L0O A;  1KQS A;  1SN8 A;  1T9H A;  4BBS G;  3PUW A;  3G6E A;  4DR5 L;  3HOZ H;  2GN5 A;  1EOV A;  4DK3 C;  1NMG A;  5AJ3 Q;  1MJE A;  4KHP L;  3U58 A;  2JA8 H;  3HOW H;  1Y1V H;  5IWA Q;  1G51 A;  4DV2 Q;  3GTK H;  4BA2 I;  4EQ5 A;  4LFC Q;  1PH2 A;  1YZ6 A;  5DLQ E;  4TQU S;  2VQF Q;  3I2Z A;  3HOU H;  5LMN Q;  1L1O C;  4AYB E;  2VUM G;  1Q7Y C;  1PYS B;  1Q86 C;  2E5L Q;  5IYB H;  2UXB L;  4DV0 L;  2R6G A;  4GLV B;  1CKN B;  1EWI A;  4PG3 A;  4DV4 L;  2UU9 L;  1HNW Q;  1RL2 A;  1V43 A;  3J81 i;  2R7Z H;  3NEM A;  1HZ9 A;  2ID0 A;  1WYD A;  2KEN A;  4LNQ A;  4X62 Q;  3K8A A;  1U0L A;  3HOV G;  4A3G G;  2KHJ A;  5FLX c;  3OYY A;  4LF9 L;  4DPG A;  1GM5 A;  1CKO A;  1VQP A;  4A3L G;  4DUY Q;  1VQL A;  4YHH Q;  1NE3 A;  1QZH A;  2Z6K C;  4A3E G;  4JI1 Q;  3F1Z A;  4Y52 H;  1DGS A;  3BZC A;  1M90 C;  1I50 H;  1IZ6 A;  3HKZ G;  3CCR A;  3D31 A;  4MTN A;  1KAW A;  4JOI C;  2PI2 E;  2I5H A;  2K14 A;  1TWF H;  1SMX A;  2PQA B;  4A3C G;  3FKI H;  2WFW A;  1IBM Q;  2GVB A;  2D0P A;  2YV5 A;  4A76 A;  1Q1B A;  1X9N A;  5EAY A;  4LFA L;  3PF4 A;  2RHQ B;  1KXL A;  2IHF A;  4DK6 C;  4LFB Q;  2JK8 A;  2EIF A;  4B3R Q;  1A63 A;  1VQC A;  1K3R A;  3Q8D A;  4IOC A;  1HNX Q;  2NVT H;  3I4M H;  4POF A;  1X3F A;  4JI2 L;  1X55 A;  2NVQ H;  1XNQ L;  2CFM A;  2HHH Q;  1HR0 W;  2OTL A;  2MO0 A;  1XMQ L;  1GVP A;  3S1M H;  2IY5 B;  4JI7 Q;  1YHA A;  4A3I H;  1PA6 A;  2VQE Q;  4DUZ L;  4Y7N H;  2YTY A;  1VQM A;  1KD1 C;  2UUB Q;  2OQ0 A;  1VQF A;  3CP0 A;  4R4I A;  1WJJ A;  1PHJ A;  1D7Q A;  2JA6 G;  1TWC H;  2F4V Q;  3ERS X;  4A3J H;  1VQ7 A;  5K36 G;  1PH6 A;  4LF5 Q;  2UXC L;  1E1T A;  4B3M Q;  4X66 Q;  1B70 B;  5M3M H;  1YJW A;  3DM3 A;  4HID A;  2PI2 A;  1KL9 A;  1VQ4 A;  3STB C;  4GLX A;  2ES2 A;  1SRO A;  1C9O A;  4JI5 Q;  2WB1 G;  1N9W A;  4R4Q A;  2VS1 A;  1HNZ L;  3UDF A;  4LF6 L;  2C35 B;  1L1O A;  3CCJ A;  2BH8 A;  3E9H A;  4A3K G;  2B29 A;  1OXU A;  3TRE A;  1BVS A;  4JI0 Q;  3RLF A;  1V9P A;  4GNX C;  4GOP B;  1NBW A;  3PF5 A;  4IFD I;  1H95 A;  3CC7 A;  1JE5 A;  3KF8 B;  3AYH B;  3J81 j;  4DV7 L;  3VDY A;  4B3T L;  4WJ4 A;  4YCV A;  4LF7 Q;  4UY8 C;  1FJG L;  3J81 c;  4HJ8 A;  2JQO A;  2KCT A;  3I4N H;  3RR5 A;  4DR7 L;  1A0I A;  3H0G H;  4LUO A;  1K8A C;  5C0X I;  1IXR A;  2XGT A;  4JV5 Q;  3PSI A;  3M4O H;  5GAD C;  4BY7 H;  1X56 A;  1N32 L;  1K0R A;  3KOJ A;  1Y1W G;  4NPS A;  3HOV H;  4A3G H;  5JJL A;  1PH8 A;  2NN6 G;  2N49 A;  5M5X H;  3W5O A;  4C3J H;  1K9M C;  4JI4 Q;  4JOI A;  4HJ5 A;  1YNX A;  4GKJ Q;  2JA9 A;  4A3E H;  3GTL H;  1R9T H;  2VZA A;  3OTO Q;  3I4O A;  3ER0 A;  1HR0 Q;  2ZJQ A;  1SE8 A;  3MXN B;  3HOX G;  1SR3 A;  3K81 C;  1XPR A;  4B3S Q;  2YYZ A;  4LF8 Q;  4OO1 G;  2JA5 G;  2UUC Q;  3TS0 A;  1BBW A;  4DR3 L;  4IPH A;  1N8R C;  2UXD L;  4IJH A;  1I94 Q;  2R93 G;  3L2P A;  4A3C H;  1KRT A;  3W1G A;  2B3G A;  4DR5 Q;  3KF6 B;  4DV5 L;  4A93 G;  1M1K C;  2CWA A;  2UUA L;  1SLJ A;  1V1Q A;  4JCV E;  1WCM G;  1NMF A;  2H5X A;  3IRB A;  2JA7 H;  1CSQ A;  3GD7 A;  4GKK L;  1KRS A;  1UEB A;  3PUZ A;  5JJK A;  2RHS B;  1CKN A;  2CWP A;  3AFP A;  2UXB Q;  1AE2 A;  2K52 A;  4DV4 Q;  4OWW B;  3F8T A;  3BJU A;  1N34 L;  3CCS A;  1E3P A;  2JA6 H;  1XMO L;  3PO3 G;  1PYB A;  3HKS A;  4HJA A;  3UE0 A;  2V1C C;  3K80 C;  4BA1 I;  1JMC A;  4NB3 A;  4LF9 Q;  3PCO B;  4BY1 G;  4WJ3 M;  1AE3 A;  4P73 A;  4OX9 L;  2A19 A;  4K0K L;  5IP9 H;  1I3Q H;  4XTC S;  3UE1 A;  1E7Z A;  1CUK A;  3GTJ H;  4HJ9 A;  1N36 L;  3FP9 A;  4JI3 L;  4C3I H;  3T1H L;  3S1Q H;  4IPG A;  1LTL A;  1EQR A;  5IYC G;  4GNX A;  3CCU A;  2R92 H;  3HOY G;  2E2H H;  2Y0S G;  4DR6 Q;  2PQA A;  4JBW A;  5IP7 G;  3AFQ A;  1YEZ A;  1J5E L;  2K5N A;  1QZG A;  3ICE A;  4A3F G;  3PO2 H;  2E8G A;  3S14 H;  1UE7 A;  3J80 c;  1VQH A;  4UP8 A;  1BKB A;  1X6O A;  1TWH H;  1ASZ A;  1XPO A;  1LUZ A;  3WWV A;  2CQO A;  1K83 H;  4A75 A;  3LGJ A;  4NXN L;  2QGQ A;  2E2I H;  1YJN A;  3AQQ A;  3S1R H;  1C0A A;  1VQB A;  5FLM G;  2MFI A;  5ELO A;  4P71 A;  5HGQ A;  5BR8 L;  3D0F A;  1Q81 C;  1LYL A;  3CQZ H;  5AJ3 L;  1YIJ A;  2A8V A;  4MZ9 A;  3ULL A;  1IYJ B;  4JI2 Q;  1XNQ Q;  4LW1 A;  1VQ9 A;  4P75 A;  5IWA L;  3F2B A;  1Y1W H;  2YTV A;  1IBL L;  2D0O A;  1HZC A;  1LM0 A;  2CKZ B;  1QUQ A;  3M4P A;  1OXT A;  1UE1 A;  1NTG A;  4DR4 L;  4MNO A;  3GTG H;  4OWX B;  1JJ2 A;  1PVO A;  1Q46 A;  1XTD A;  3TQY A;  4DAY B;  4PMW A;  2ZTC A;  4GLA C;  4NXM Q;  4QL5 A;  4A3D H;  3RZD H;  1HJP A;  4O2D A;  1GO3 E;  4LF4 L;  4KLK A;  2D62 A;  2UXC Q;  4BBR H;  3HFZ B;  4DV3 Q;  2VY3 A;  3UDI A;  4OXP A;  3M4Q A;  3HOU G;  2EQS A;  3HKZ E;  4JG2 A;  5IE8 A;  2K75 A;  1MIU A;  3F2C A;  4JBK A;  3CD6 A;  1BBU A;  3RN5 A;  1HNZ Q;  5IYD G;  3KJP A;  2A1A A;  4LF6 Q;  4A93 H;  2BA1 A;  4P72 A;  4DUY L;  1G29 1;  4UP9 A;  5LMU L;  4LUZ A;  3CCM A;  4GOP A;  1WCM H;  4PZ7 A;  4J15 A;  5HY6 A;  2WAQ G;  3G48 A;  4TVA B;  3TS2 A;  4JYA Q;  4DV7 Q;  3UDG A;  2LXK A;  4JI8 L;  1YIT A;  1XJV A;  2HIV A;  3H15 A;  4B3T Q;  4HIM A;  2N8N A;  3PIO A;  4BBS H;  3H3V I;  4FDB A;  2OQK A;  4R4O A;  3CPF A;  4PZ8 A;  1Y14 B;  4DR7 Q;  4IFD G;  5JEA G;  2IX1 A;  3HOZ G;  4YWM A;  1IBM L;  3RLO A;  4YY3 L;  2NVX H;  2OCE A;  2NZH A;  1NJI C;  2E2J H;  3PO3 H;  3PUV A;  1N32 Q;  5M3F G;  4LFB L;  4JI6 L;  5GRO A;  1CKM A;  5C0X G;  3PIP A;  2OTJ A;  5M5W H;  2VUM H;  1VQI A;  1X65 A;  1Q8K A;  3K7A H;  3J80 i;  4EX5 A;  1I5F A;  1YI2 A;  5ELN A;  1QVC A;  3RN2 A;  5IYB G;  2ZM6 Q;  2AHO B;  5C4J H;  1OXV A;  3HOY H;  1CSP A;  2K5H A;  3CW2 C;  4DR3 Q;  3G71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...