4LFCL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 11
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfcL00
5BR8Q 4DV7Q 1IBKL 5FLMG 4C3JH 2KENA 1MKHA 4JI3Q 1PYBA 4QQBX 1X54A 2AWOA 4R4TA 1YEZA 3M4OH 1WYDA 2I0QA 3PO3G 1OXXK 1Z9FA 4A3KH 2ATWA 2E8GA 4P74A 2UXDL 4LUOA 3UDXA 3T1YQ 1SMXA 1HR0L 4P75A 1QUQA 4GNXA 1JB7A 3L0OA 4DV6L 3K80C 4JV5Q 4KHPQ 1HNXQ 3GTJH 1EQRA 2NZOA 3UDFA 1PH1A 4MNOA 5C4XG 2MO1A 3K7AH 4HIKA 3TS0A 2AWNA 1YHAA 4JI1Q 1PH8A 3CQZH 1SROA 5IYBH 4GLAC 4DV1L 5BR8L 4DV7L 1KQSA 5HGQA 3B6YA 2DGYA 3G6EA 4APVA 4A4IA 3ER0A 1MIUA 3K8AA 1QVFA 1NE3A 5LMUL 3HOWH 1UE1A 2Y0SG 4JI2Q 5FJ8G 4LF9L 2I5HA 3HKZE 1QZGA 4C3HH 4X65Q 2K52A 4R4CA 3OW2A 1PH4A 1L0WA 3I4NH 4DR6Q 1J5EQ 2PI2E 4JC0A 2LXKA 1OXTA 4Y52H 2DUDA 4JV5L 3UDIA 3J7A5 4RG1A 4A75A 4A3BG 5GAHC 3UE1A 4DUZQ 3L2PA 4JI1L 3CCVA 1XTDA 3KDFA 1N36Q 2QGQA 4YCVA 4LFAL 1KL9A 1KRSA 3CAMA 1VS0A 4GN3B 2JA8G 4TQUS 3STBD 1K9MC 3S2DH 2JA5H 4GKJL 1N32Q 2JEBI 4UP9A 3TS2A 1Q8KA 4JI2L 3AFQA 1WI5A 3I4NG 1XMQQ 5JJLA 2Y0SE 4X65L 5IE8A 4GN4B 2WB1E 2IX0A 3W1BA 1S3OA 2D0OA 3CCMA 2VZAA 1Q7YC 4OO1G 1NTGA 2VQFL 2IHEA 4JI8Q 4DR2L 1Q82C 5LMNQ 3ERSX 2E5LQ 1TXYA 2VUMH 2MO0A 4GOPB 1WOCA 2JA7H 4IFDI 2CKZB 2NVYH 1EQQA 4LF8L 1VQIA 4YWKA 1YVCA 5M3MH 2CWPA 2FXQA 4OWXB 1N36L 1OXSC 2JA6H 1CKNA 5K36G 5GAGC 1YBYA 5EAYA 4JI6Q 4NPSA 3PF5A 4DR3Q 2RCNA 1IXRA 2NN6I 1XNQL 4HIDA 4DPGA 1VQ7A 1X65A 4OX9Q 2JEAI 4YHHQ 2CWAA 2K4KA 1YHBA 2UU9Q 2VQEQ 2B63G 1K8GA 4HJ5A 1JJGA 5IWAL 4JI8L 4RMFA 3GTGH 3HOXH 2E5LL 2MFIA 1PVOA 4A3FG 3D0FA 1Y1WH 2ASBA 4A3LG 4DV0L 1HH2P 3F1ZA 4DR1Q 1BKBA 4FDBA 5IT9c 5FLXc 2R92G 3KJOA 3CCQA 4BBSG 3PF4A 3FKIG 3K81C 3E9HA 2V1CC 1CSQA 1XMOL 2R7ZH 1C0AA 3OYYA 1E7ZA 1LUZA 5M3FG 1PH2A 4A3CH 2BA1A 2HIVA 1O7IA 4QJFA 3W1GA 1TWFH 3JC66 1YNXA 2OCEA 3I4OA 5E7NA 5GADC 4JI6L 4A3EH 3AYHB 4JBMA 1VQJA 1PA6A 4A3IH 5IP7G 2R93H 2B3GA 2GN5A 4P71A 1A8VA 3S16H 3TRZA 1B7YB 4QY7A 1W2BA 2UU9L 4QIWE 1V43A 5FLMH 4POGA 1SE8A 4NXNL 4IO9A 1YJ9A 1R9TH 2BH2A 1C7YA 1Z47A 3PIOA 2A8VA 3NBHB 4DNIA 1HR0Q 3RLFA 3TREA 5C4JH 3PO3H 2R7ZG 3PGZA 1RIPA 4DR1L 3CCSA 4DV6Q 3M7NA 1JE5A 3S24A 5ELNA 3IRBA 2GVAA 3ULLA 2NZHA 1VQ9A 2OTLA 4DR7Q 4IOCA 1D7QA 2Q2HA 4A3EG 1GO3E 2K50A 1L1OC 3BU2A 4YY3L 1GD7A 3RN2A 4A3IG 3GTMH 3CW2C 3M3YH 4IPDA 1UE5A 1IZ6A 5C4XH 4QGUA 1EIYB 2HT1A 3GTPH 2R7DA 2E2HH 2JK8A 3CF5A 5IYCG 2OQ0A 1VQHA 4JCVE 5LMUQ 1ASZA 2HHHQ 3HKZG 3H0GG 2VNUD 3G71A 4LF9Q 3CCJA 3HKSA 3A74A 1JT8A 4GKKQ 1VQLA 3U4ZA 3LGJA 3WWVA 5FJ8H 4HJAA 3CXCA 2RF4A 1VQ4A 3J7ZC 2GVBA 3L7ZC 5IP9G 3PV0A 1TWGH 2B29A 4R4QA 3J81i 3PO2H 4DR7L 3CCRA 4X66L 2JJQA 3ZJYC 1VQEA 1LTLA 4BA1I 2ZTEA 2NVQH 3CC7A 1YJWA 1BVSA 3EN2A 3PSIA 3I4MG 4LFAQ 1TWCH 4A3BH 2E2JH 3UE0A 2HIXA 4GKJQ 1RL2A 1L1OB 5AJ3Q 1I6HH 3CCUA 4XIGS 1BBWA 5ELOA 2HHHL 3CMEA 1PH6A 1I94Q 4JOIC 2JA8H 1JMCA 4JBKA 4GLXA 2WB1G 1PFSA 3MEFA 3D31A 1VQOA 3OTOQ 4GOPC 1KHIA 1E24A 3KF8B 3DM3A 3PIPA 4NXML 4O2DA 1QVGA 4GKKL 4O0AA 4LF7Q 3PO2G 1KXLA 3J81c 2VQFQ 4DR2Q 2VL6A 4WJ3M 1VQMA 4IPHA 3AEVA 2XGTA 2KCTA 3KF6A 4LFBL 2Q2IA 1GM5A 4LF5Q 4LF8Q 4Y7NH 4AYBG 2EQSA 1BBUA 1GVPA 1X9NA 2PQAA 4C3IH 5IYDG 1VQKA 4L5SA 2JA9A 2UUCQ 3PUZA 5GAEC 3KYHC 4X62L 3FHWA 5AJ3L 3M4QA 2CQOA 5GROA 1I94L 1T9HA 1XPRA 1XNQQ 2VW9A 1HZAA 3RZDH 4OWWB 3S1NH 4P72A 3OTOL 5H1SE 1YJNA 4B3ML 3A5ZB 3MXNB 1CSPA 4LF7L 1FJGL 1Q86C 5IWAQ 4A3JG 3HOZG 3S1MH 4YWMA 1NY4A 3F2DA 3S14H 4X64L 5C0XG 3GTOH 4UP7A 4DV0Q 4JYAL 1G291 4JG2A 1Q12A 2B63H 4LF5L 4QL5A 2NVXH 3F2CA 2YTXA 4BBSH 3TEHB 3K0XA 4L5TA 4HJ7A 3HOUG 4OO1I 5C0XJ 4A3FH 4A3LH 4AYBE 2D0PA 1XMOQ 2JE6I 1X6OA 5IY0A 2UUCL 1NJIC 2WP8J 4PMWA 5M5WH 3RN5A 4XTCS 2UUAL 2R92H 3FP9A 4BY7G 1M1KC 1UE6A 2F52A 3PUWA 1L1OA 3FKIH 4EQ5A 2Z0SA 3G4SA 2I5MX 1NBWA 2E2IH 1C9OA 1CKOA 1WJJA 2YYZA 4C2MH 4K0KQ 4KHZA 5M3FH 4JI7Q 1S40A 4A93H 4DV2Q 3STBC 1N33Q 2IHFA 3BZKA 2QA4A 1KRTA 4B3RL 1X56A 1Q81C 4NXNQ 5JJKA 1JJCB 5IP7H 3RZOH 4LW1A 3J80i 2BA0A 2WFWA 4H02A 2K5VA 3G48A 1PV4A 1VQNA 4NB3A 1PH7A 3CPFA 4A3DH 3AQQA 3Q8DA 4BBRG 3UDGA 1KC8C 2ZJPA 4L5QA 2K14A 4R4OA 4KI0A 1KIXA 4UY8C 3CP0A 4AIMA 2MQHA 4YY3Q 2N78A 4LUVA 1EOVA 3CMAA 2UXCQ 1EWIA 4A93G 3DLLA 4DR5L 4AQYQ 1Y14B 3I7FA 2OWOA 3E0EA 1U0LA 4UPAA 4K0KL 1YI2A 4B3SQ 1MJEA 1PH9A 4JI7L 2Z6KC 4OONA 3J80c 3M85A 4DV2L 1N33L 1K8AC 5IYCH 5C3EG 1QUQB 3CCEA 3I2ZA 4GNXB 4JOIA 1VQAA 4A3GG 4A3DG 1IYJB 1K73C 3H0GH 4OWTB 4GOPA 1X55A 2JQOA 4TVAB 2PNHA 3A0JA 3EBEA 2YV5A 1QZHA 3CC4A 4GN5A 1HNWL 3ULPA 3GDEA 1E1TA 1E22A 5JJIA 4X66Q 3PUXA 5IP9H 3VDYA 4DK6C 1SN8A 2RHSB 1VQDA 4B3TQ 2UXCL 1VQBA 3I55A 4AQYL 3I56A 2R6GA 3PUYA 1WFQA 4IPCA 4IOAA 2LXJA 3H15A 2QEXA 4B3SL 1FVIA 1VCIA 1UE7A 3I4MH 2L15A 2NVTH 3GO5A 1Q46A 3KLWA 3ULJA 3BZCA 4DV3L 4NXMQ 1PH3A 1CKMA 3HOYG 2EXDA 1X3GA 4PZ8A 2ES2A 1AH9A 2HQLA 1E1OA 1L2FA 1UWVA 2ZM6Q 4A76A 1Y1VG 1WCMG 4IJLA 5C44G 2UUBL 4LNQA 3U4VA 2ALYB 2YTYA 1NMFA 1XNRL 4LFBQ 1VQ5A 3KDFB 4JBWA 1AE3A 4KLKA 1N34Q 1HZCA 3TQYA 4B3TL 3HOVG 3F2BA 4IJHA 4BXXH 2CFMA 4PZ7A 1IBMQ 2H5XA 2F4VL 3CD6A 5HY6A 4X62Q 5IYDH 3RLOA 2KHIA 4LF6Q 4OXPA 1DGSA 1G6PA 2WAQG 3CCLA 1SLJA 4BY1G 3JAMi 3F8TA 1K3RA 1A62A 1I5FA 1YZ6A 1EIFA 2BH8A 2N49A 1OXVA 2OQKA 3EIVA 2AMCB 4B3MQ 1FJGQ 2AHOB 3GD7A 1JJ2A 3KFUA 4JI0L 2ZM6L 2N8NA 3S1RH 4X64Q 2VY3A 1B70B 4BXXG 4JYAQ 3BJUA 3NEMA 2ZTCA 1IBLQ 4A3JH 3HOZH 1N34L 1IL2A 4GS3A 1SRUA 1CKNB 4IPGA 1VQ8A 4A3KG 4JI3L 3HFZB 1EUJA 4R1JA 3RR5A 1IBML 4PZ6A 2UUAQ 4LUZA 3HOUH 2EIFA 1SR3A 1W3SA 3JAMc 2LSSA 2RHQB 4HIOA 1XPUA 1XJVA 4DR4Q 1A63A 4DV5Q 4LF6L 1Q1EA 3M4PA 3T1YL 1VQGA 4BY7H 4JI4Q 2N3SA 2WAQE 2ZTDA 3S17H 4KHPL 1U5KA 2PI2A 1HNXL 3T1HQ 2Z6KA 4B3RQ 1HZBA 3M9BA 4AH6A 5IYBG 3AFPA 4YCUA 2UXBQ 3GTLH 2IY5B 2K5HA 1V9PA 2KCMA 4DAYB 1ASYA 1H95A 1IBLL 1GKHA 1Q1BA 4EX5A 2YTVA 3HOWG 1KAWA 4JBJA 1I3QH 5C0XI 3PUVA 4A3MH 4LF4Q 4HJ8A 2IT1A 3NENA 4BBRH 4HJ9A 1VQPA 4MTNA 4LWCA 1YIJA 1YITA 4DR5Q 2ZJRA 4ALPA 3U58A 4DR4L 1I50H 2PMZE 1TWHH 4IFDG 1A0IA 1K83H 4DV5L 4GNXC 1P16A 5LMNW 1QVCA 2IX1A 4JI4L 4DR6L 1J5EL 2I5LX 1NMGA 4JI5Q 5GQOA 5M5XH 2VS1A 3T1HL 4IFDJ 5JEAG 1YHQA 4YWLA 3S2HH 4DUYQ 3K7UC 2Q2TA 4J15A 1B8AA 1LYLA 4DUZL 2UXBL 3CC2A 2KHJA 2JA5G 1HNZQ 5C3EH 4A3MG 1HNWQ 5JEAJ 1EFWA 1TWAH 4A3GH 2NN6G 4BA2I 1VQ6A 1D8LA 4DV4Q 4X6AH 1CUKA 4POFA 3CPWA 1N32L 4LF4L 4WJ4A 1OTCA 1UEBA 2OTJA 4YCWA 3W5OA 1XMQL 3NELA 1X3EA 3KOJA 2VUMG 2YU9H 4R4IA 2JA7G 3GTKH 1MJCA 1PHJA 3H3VH 2MNAA 2D62A 2AKWB 1FGUA 4ME3A 4DAMA 3RNUA 1S72A 4JI5L 5M3MG 5LMNL 1SFOH 2KBNA 1VQFA 4DUYL 4DV3Q 4HIMA 5DLQE 4L5RC 2JA6G 3PCOB 1N9WA 4PG3A 3S1QH 4LFCQ 1HNZL 1HZ9A 1G51A 2UUBQ 3E9IA 2Q2UA 4P73A 2K5NA 3HOYH 1XNRQ 3GTQH 3ICEA 1V1QA 1J6QA 3A5UA 4DV4L 1N8RC 2F3IA 1OXUA 1Y1VH 1WCMH 3RLNA 5C44H 1M90C 4DR3L 1IBKQ 4DK3C 2ZJQA 2C35B 4MZ9A 2A1AA 2F4VQ 3HOXG 4OX9L 4YHHL 1P8LA 5J3BA 1X3FA 4DKAC 2K75A 1Y1WG 1E3PA 4GLVB 1EYGA 5M5YH 2VQEL 1HR0W 3HOVH 1K0RA 3J81j 3H3VI 3U50C 2UXDQ 2CCZA 4UP8A 3KJPA 1PYSB 1FL0A 4LFCL 4A3CG 3KF6B 1LM0A 4JI0Q 2A19A 4BY1H 1AE2A 1HJPA 2ID0A 1PH5A 3S15H 1VQCA 1KD1C 2PQAB 2XTIA 1XPOA 2R93G 3SGIA 4DV1Q 2R7FA
chains in the Genus database with same CATH superfamily
5BR8Q 1CZGA 1IBKL 4C3JH 1PYBA 4R4TA 3C46A 2AQ3B 1OXXK 4P74A 4F87A 5CMDA 2UXDL 4CHTB 3C1FA 3RMHA 4BY1B 2HD3A 3MHBA 4N9PA 4JV5Q 5D65A 3GTJH 2NZOA 3UDFA 2MO1A 3Q24A 3K7AH 4HIKA 2EDGA 4JI1Q 3CQZH 4DV1L 1RHPA 5BR8L 3RUZA 5HGQA 3B6YA 2DGYA 3G6EA 4N8FA 4APVA 1QVFA 4JI2Q 5LL6X 2I5HA 3DWPA 3HKZE 4C3HH 2HDLA 1BDOA 3OW2A 1PH4A 4ABNA 2Z1CA 1L0WA 3I4NH 1LO5D 4BWGB 1IYVA 5IT9L 4IFDH 4JV5L 3UDIA 1PZID 3J7AF 2L0CA 3J7A5 1GUWA 1DOKA 3NTKA 1PZJD 4JI1L 3DHQA 5IOCA 4YCVA 1DOLA 5AFWA 2LMCB 4F7XA 2NB0A 2MPMA 4BY7B 2NN6H 4JI2L 3I4NG 1XMQQ 4OIJA 3K6OA 5COYA 5F2DA 5ELBA 5D14A 2WB1E 2IX0A 2A69C 2RKSA 1JWSD 2D0OA 2M9VA 5C4ZA 4X3KA 4DR2L 4JI8Q 2EZVA 4GOPB 2CKZB 3SK6A 2NTSA 2NVYH 2JA5B 3IFDA 1TS2A 2FXQA 4OWXB 3H3VC 1HTPA 2PW7A 1K83B 2ZXRA 5EAYA 2L11A 1LTSD 3PF5A 2F03A 1UEAB 1XNQL 3SDZA 1VQ7A 1B9NA 1X65A 4CKBA 4OX9Q 1YHBA 2IWHA 1R4PB 2VQEQ 2B63G 4DF7A 1RCVD 1Z7TA 3C1EA 4JI8L 4RMFA 5C3EB 2A5HA 2ASBA 4TRDA 4FF1A 1DZ1A 4DV0L 4DR1Q 4FDBA 2R92G 3CCQA 1T5EA 3K81C 1CZWA 2QF7A 3OYYA 3I91A 1E7ZA 5KGUA 1PH2A 4A3CH 3W1GA 2HIVA 4C1NK 1O78A 1EU4A 1D6EC 1MBYA 1LV9A 1VQJA 3NBIA 5DM63 2B3GA 2GN5A 3HOXB 1A8VA 5FLMH 1SE8A 4IO9A 4HSVA 2KA7A 1QCBD 1I4XA 1V1OA 3RLFA 2Z8LA 1IW7C 3SVMA 3PO3H 4DR1L 1RIPA 3M7NA 4DV6Q 3IKJA 2GVAA 5C44B 3DM1A 2B8FA 2KCNA 2OEOA 2HCCA 4YY3L 3RN2A 5D3DA 1GJXA 3S16B 1IZ6A 3GTPH 2JK8A 4TKOB 1EWHA 3CF5A 1VQHA 2KHSA 5LMUQ 1ASZA 2HHHQ 4LF9Q 3HKSA 4EVOA 1JT8A 4GKKQ 2WAQB 1VQLA 3U4ZA 3CXCA 3H94A 5IGBA 3L7ZC 5IP9G 3K5NA 3PV0A 4EQPA 5IGCA 1XYIA 2B29A 3J81i 4NKLA 4RWSC 2JJQA 1LTLA 1SNOA 2EYPA 2ZTEA 3EJIA 4BA1I 4E6IA 4N9TA 2WKCA 4LFAQ 4A3BH 1U4LA 3Q23A 2BCOA 1PYWD 1PRTD 4GKJQ 2A68C 1L1OB 4FF2A 2HHHL 1I4QA 2PMZB 2JA8H 4JBKA 4GLXA 3MEFA 1TWGB 3VYUA 4GOPC 1E24A 4HMIA 4GKKL 3PIPA 1KXLA 2L1BA 2VQFQ 3C2PA 2H1EA 4HAEA 5CV7A 1U4PA 2KCTA 4LFBL 5JJZA 1W6JA 4LF5Q 4G7HC 1RTNA 4Y7NH 3VR3A 4L5SA 4C3IH 3K59A 1I4PA 3PUZA 4JVZA 2SEBD 3KYHC 5NUCA 4DA2A 2B2VA 1SJED 2K33A 1HZAA 3S1NH 1EY5A 1JCKB 1YJNA 2F3WA 1CSPA 1FJGL 1ZYRD 1Q86C 3I3CA 1JICA 5C0XG 1FD7D 1PFNA 4IUUA 4JYAL 3K58A 4LF5L 4H13C 4HJ7A 4OO1I 1EIHA 4A3LH 5CYUA 1TY2A 3CHBD 5IY0A 1NJIC 2WP8J 4PMWA 1AW7A 3RZDB 3FP9A 2DY7A 4BY7G 5I9PA 1UE6A 2F52A 1L1OA 2K1BA 2E2IH 2KOLA 4KHZA 1EZ6A 4JI7Q 5EBDA 2IHFA 3VR6A 2DJGC 1X56A 4NXNQ 5IP7H 4KJNA 5EBCA 3J80i 1NR2A 2WFWA 3G48A 1PV4A 1PRTB 2O4XA 4NB3A 1PH7A 1PRTF 4UHVA 1EEFD 1MSHA 5ISRA 4AIMA 2EPBA 1F2ZA 5J1ZA 2UXCQ 1Y14B 5I2XA 4B3SQ 4KKTA 4J8QA 4XYOA 1O7ZA 1HTLD 4JI7L 4OONA 1WTPA 1K8AC 5C3EG 1QUQB 3I2ZA 2F0KA 3D6WA 1HA5A 4A3GG 1DCZA 1JWUD 5ELFA 1QZHA 1X55A 1PTOD 2JN4A 1CM9A 4GN5A 1HNWL 5G3LF 3GDEA 2F1MA 3D4WA 4CDCC 5JJIA 3PUXA 4A3IB 2UXCL 3QB3A 3I55A 4RGTA 3I56A 1KLGD 4B3SL 4QF4A 1VCIA 4DNRB 3I4MH 1K0SA 2L15A 4ZLTF 3GO5A 4KY5A 2QEJC 1D2BA 1O80A 4HEDA 1FNVA 5ELCA 4DV3L 4QUFA 4RHSA 4NXMQ 1CKMA 3D8GA 4PZ8A 1AEXA 1AH9A 4A76A 5C44G 3DXJC 1VQ5A 2XSCA 2GA4B 3KDFB 4WJWA 1TT2A 3EA6A 2F0OA 5J22A 3HOVG 4BXXH 2Q8TA 1BXTA 3V96A 2LS01 4X62Q 3A54A 5IT9E 1A3VA 2XRSD 3KLSA 3R93A 1SNPA 3VYSA 4FF4A 1G6PA 2WAQG 1B3AA 1H9SA 1YNND 1K3RA 2BH8A 2IL8A 2N49A 1OXVA 4KV6A 3KLSX 1TIID 1KLUD 2EE1A 2N8NA 1CTMA 4LK1C 1V1PB 4BXXG 4RAUC 3BJUA 1DONA 1IBLQ 4GZYC 1O7LA 1IKLA 2P5ZX 1MGSA 1HQMC 3NQTA 3RR5A 3BYYB 3LX0A 3HOUH 1PTOB 4DR4Q 1Y8PB 1PTOF 4HIOA 1XPUA 1XJVA 1KDBA 3TP6A 4DV5Q 2AQ1B 1VQGA 3UI2A 4JI4Q 2WAQE 4RGMA 5EKLA 2ZTDA 1X32A 1U9RA 2PI2A 3I73A 4ZQ3A 3M9BA 1JC7A 3SEBA 1KAAA 2K5HA 1H95A 1IBLL 1EYCA 2CH4A 2ZT9C 4IUNA 2DNCA 3BVMA 4HJ9A 3M4YA 4LWCA 1YIJA 4DR5Q 2ZJRA 3D4DA 4DR4L 2VB3X 4PMBA 2PMZE 1TWHH 4ZUIA 1G91A 4DV5L 2F0QA 4CKCA 4JI4L 3OMGA 1J5EL 3KF8A 5CBEE 1H9MA 2PNRC 3QO2A 5T1GA 4DUYQ 3K7UC 4A3FB 4DUZL 2MUYA 2KHJA 3KBXA 1HNZQ 4YIJA 1PDQA 5JEAJ 1EFWA 4BA2I 2EYJA 1D8LA 3I90A 2A6HD 1CUKA 4OELB 3GV3A 1N32L 5M3FB 4A93B 4YCWA 3W5OA 4ZK9B 3FMCA 3NELA 4HCSA 5KYIA 1VMPA 2XVSA 4K8IA 3M7GA 4K14A 2E75C 1STGA 2K05A 3MXNA 1CT1D 2F0PA 1VQFA 2FFKB 1TWAB 5M3MG 4A3DB 4DUYL 5C5LA 1CI3M 5DLQE 4HIMA 4L5RC 3S1QH 1HNZL 3E9IA 4ULLA 3HOYH 1XNRQ 3ICEA 1V1QA 3A5UA 2YU9B 4XT1B 3DEPA 1WCMH 3J7AV 3ITPA 2A1AA 4CJ1B 4YHHL 1A6XA 5J3BA 1SMYD 3K5OA 3H0GB 4EGVA 3H3VI 3HG9A 4V0BA 3BG3A 1HHVA 5JPNC 3QJYA 3T4AC 5D3IB 2B2YA 2ID0A 1RTOA 2Z4IA 1AZPA 3S15H 2XTIA 2R93G 5HURA 2D2CC 4DV7Q 1PTOC 5C6AA 2BDNA 2AWOA 3BZDB 2L5TA 5DM73 1Z9FA 4A3KH 2ATWA 3HRZC 4LUOA 3T1YQ 1HR0L 5FKAC 1EQRA 3TBIB 1PH1A 5C4XG 3KK7A 3TS0A 1YHAA 1GUSA 2RCFA 1G2TA 1LTID 4AYBB 4DV7L 1QB5D 3BS1A 1LT5D 4A4IA 3K8AA 3HOWH 2Z9HA 4R4CA 1S5FD 2PI2E 4JC0A 3CQZB 5EKIA 2F0JA 4A3JB 3HOZB 3C3LA 1BNZA 5CC4A 4RG1A 1FNUA 1S5CD 5GAHC 3UE1A 1V8QA 3CCVA 4DAVA 1XTDA 1KL9A 4GN3B 2LFNA 2EYLA 1K9MC 3S2DH 2CH4W 4DFAA 4UP9A 3U9SA 1Q8KA 1ILQA 3AFQA 3S17B 2L9HA 1E2WA 4KD4A 3GV6A 1FR3A 5I2YA 3W1BA 1II3A 1XXGA 3CCMA 1Q7YC 1KDCA 3L9AX 1NTGA 2VUMH 1EYAA 4OO1G 1SE3A 4PMCA 3ERSX 5LMNQ 1B50A 3NHHA 1WOCA 4I65A 1EQQA 4A3MB 5JVH3 1GXDC 1OXSC 2JA6H 1EFID 1CKNA 3TP7A 5K36G 1I50B 1ILPA 3LWEA 4ZKBB 3CU7A 1IXRA 1BF4A 1BQQT 1IW7D 2JEAI 3S2HB 4Q0FA 4XT3B 1J8IA 2K4KA 3HZXA 2NVYB 5DEHA 2F3VA 3E5SA 4A3FG 3D0FA 1SBBB 2OT2A 2F0WA 5FO8B 5IT9c 2G5DA 1UAPA 5CBAE 4BBSG 1Q90A 4DAYA 1XMOL 1LTRD 1CSQA 2XN9C 5M3FG 4QJFA 2XIWA 3I4OA 1TVXA 4A3EH 4JBMA 2O5JC 4P71A 3TRZA 1B7YB 2A6HC 2BH2A 1V43A 3J81L 4ZKCB 1R9TH 5LL6S 4LMQD 4XQJA 1JE4A 1C4QA 3NBHB 4DNIA 4K5WA 2SOBA 3CCSA 2HQEA 1B53A 2KECA 4DR7Q 5JAVA 1D7QA 5J39A 4A3EG 2K50A 3BU2A 3M3YH 1GD7A 1BCPD 4QGUA 4OGQC 3A56A 2J0TD 2E2HH 1Z6HA 3HKZG 3H0GG 3G71A 3QG1A 1DD2A 1EY4A 5ELDA 1EIGA 2GVBA 2JXMB 1SMYC 2NUCA 2K6AA 3GTPB 1PZKD 2M00A 4DR7L 3CCRA 3NWSA 1YJWA 1ZKOA 2MHVA 3PSIA 2E2JH 1QE6A 2HIXA 5DNFA 1RL2A 3VYRA 5AJ3Q 1I6HH 4XIGS 3TDQA 3DWAA 1JMCA 2KCCA 2WB1G 3FPPA 3TN2A 1IHZA 3CRLC 2KUMA 4O2DA 1QVGA 4O0AA 3NBHA 4WORA 2VL6A 4DR2Q 3T53B 4IPHA 3KF6A 2Q2IA 3SK4A 1STBA 2KVMA 1BOSA 2WV6D 5JPMC 2XWBB 4AYBG 2SNSA 1X9NA 2PQAA 1SSOA 1VQKA 3OPOA 5AJ3L 3J80L 3BDCA 5GROA 1XNQQ 4MTKA 4KKSA 4RKLA 4B3ML 2F0MA 1BCPB 4OIKA 3SK8A 1BCPF 4A3JG 3HOZG 3S1MH 4L8JA 3S14H 4X64L 1X3PA 4C3IB 3GTOH 2DNEA 2KJXA 1I4GA 3P20A 4DV0Q 2B63H 1Q12A 2YTXA 3TEHB 5C0XJ 1RJTA 4AYBE 2JE6I 4PQXA 3S1NB 4XTCS 2UUAL 2R92H 4FXKC 1F9SA 1M1KC 3PUWA 5IGEA 4KK7A 2M2LA 2Z0SA 1CKOA 1JR0D 4ZUJA 4Q5VA 4K0KQ 2EYHA 2JA7B 4B3RL 1D1IA 3BDLA 3QIAA 1VQNA 4O1NA 1SYFA 1A2TA 1A2UA 2NYZD 4G7OC 3AQQA 1ENAA 2F0LA 4BBRG 2ZJPA 4L5QA 2E2IB 1KIXA 3CP0A 4YY3Q 3FVQA 3E0JA 1S4ZA 2OWOA 4K0KL 3GTGB 1MJEA 4JPBW 1Y1WB 3EFXD 3CCEA 2RA4A 4GNXB 3R2IA 1IYJB 3NK9A 2R7ZB 4H7BA 4OWTB 3I72A 4GOPA 3AMUA 4IUTA 1KNAA 1TWFB 1WTRA 2TMPA 2J7ZA 5A2QL 5IP9H 2RHSB 1VQDA 3AB9A 4B3TQ 3FRPB 1Q8IA 3PUYA 2QEXA 5C4JB 1DJRD 4M8AA 1VMCA 3MZ5A 3BZCA 1HA6A 2RVLA 1EWCA 4HCEA 1Q3LA 2ES2A 1UWVA 4JK1C 3GTMB 1Y1VG 2UUBL 2F0EA 2ALYB 1NMFA 3ND8A 4LFBQ 3K0YA 4JBWA 1N34Q 1HZCA 2L12A 1LACA 4B3TL 3F2BA 2HUGA 4ZYSA 2CFMA 1IBMQ 2H5XA 2ZXPA 2Y0SB 2SDFA 1BCPC 4LF6Q 2DY8A 4OHJA 3A8IE 3CCLA 1SLJA 2L55A 1A3TA 4BY1G 3JAMi 3PO2B 1FJGQ 2AHOB 3GD7A 3S9WA 4JI0L 2NVQB 1STHA 2VY3A 1B70B 1TWCB 4JYAQ 1LTAD 2X69A 3HGBA 1N34L 4EQOA 5C0XH 1HUNA 5TSSA 1HCZA 4JI3L 2B39A 3MFGA 1IBML 1WTOA 4LUZA 1DOMA 5G3LD 1W3SA 3TP5A 2WINB 4OEMB 1F9QA 4LF6L 4BY7H 4K5VA 5KEEA 2NBFA 4KHPL 1U5KA 1K8OA 1HNXL 3T1HQ 1HZBA 1SNMA 5IYBG 3T13A 2AQ2B 3HOUB 2YTVA 3IFTA 1SXTA 1I3QH 2FMCA 3NENA 3V05A 4G7ZC 1OO9B 1K83H 4GNXC 1JQYD 5LMNW 5EPJA 4DR6L 4QIWB 2I5LX 4JI5Q 5GQOA 2VS1A 3H91A 3T1HL 1LT3D 2Q2TA 4J15A 1B8AA 1LYLA 5EGTA 4F88A 2JA5G 3CC2A 5M5WB 5C3EH 4U673 1HNWQ 4A3GH 3NSWA 5IGGA 5E4WC 1VQ6A 3FKIB 2DN8A 3SR1A 1TWHB 3RD4A 4C2MB 4POFA 1AZQA 2QW7A 3OMCA 1OTCA 1UEBA 2OTJA 1QWYA 3J81E 1X3EA 1XX8A 3RZOB 1O7YA 2JA7G 2PZUA 4WRDA 1PHJA 2MNAA 2L4NA 2NZ1D 4ME3A 5CV9A 4DAMA 4JI5L 2KBNA 4DV3Q 4PG3A 1N9WA 4LFCQ 1HZ9A 3GTQH 1J6QA 4F8MA 5CGKA 2B2VC 3RLNA 5C44H 3MXPA 1GOZA 4DR3L 3F2UA 4M1UB 2ZJQA 3EQLC 2C35B 3HEJA 3HOXG 1P8LA 1AFPA 1Y1WG 5KNCA 4CBVA 3HOVH 3NXWA 2VXWA 3V2TA 3VA7A 5L37A 3T16A 1YNJD 4FVMA 4DNTB 3URYA 1PLFA 4TSSA 4LFCL 1WCMB 1PH5A 1XPOA 4KHVA 4X3UA 2EJGC 1X54A 3I8ZA 3VR4A 3M4OH 1E2VA 4UAIA 2I0QA 1K8MA 2E8GA 5KNDA 1QUQA 1JB7A 1A3UA 2G9DA 3L0OA 2F0IA 1QILA 5KNBA 2AWNA 1PH8A 3J80E 2ENBA 3TSSA 2HDMA 4GLAC 1NNXA 4A3KB 4B9XA 1MIUA 2A74C 3ONAB 1NE3A 1TS3A 5FJ8G 2Y0SG 2K52A 4NMZA 3MTSA 1J5EQ 4I7AA 2LXKA 1OXTA 4Y52H 2DUDA 3BDOA 5FLXL 4RGOS 2PW5A 4KD3A 4RH6A 5DAUA 3D4RA 4A75A 4HN7A 4DUZQ 3L2PA 3PMFA 3KDFA 2QGQA 2EJMA 1KRSA 2LKVA 4TQUS 3STBD 4DN4M 1DM0B 3KLRA 1ET6A 4MHEA 1N32Q 1BO0A 2JEBI 3TS2A 1WI5A 4CKEA 2WIIB 2Y0SE 4GN4B 4S3SA 3W3AA 1EY6A 1DXMA 1S3OA 2IHEA 1I6VC 2IW3A 4IFDI 4XQQA 3S2DB 4LF8L 1VQIA 2A73B 3H6MA 4OL7A 3SXHA 4YWKA 5M3MH 1V1PA 2CWPA 1SJHD 2QCPX 4RFBA 2JP1A 1YBYA 2R3ZA 2D9UA 2NN6I 4DPGA 5E3FA 4YHHQ 3K5MA 1CQFA 4RA8A 3J7YW 4KKUA 1K8GA 5BN5A 5IWAL 1QJOA 2EOTA 5A2QE 4BS9A 3F1ZA 1BKBA 3KJOA 5CV8A 3PF4A 3FKIG 3E9HA 2XNAC 5CORA 1C0AA 4IUQA 1L0YB 1YNXA 2OCEA 1LT6D 1D5ZC 1PA6A 4FP5D 4A3IH 3IL8A 3WOEA 2R93H 3WDNA 4G4KA 1AP0A 2F0TA 4QY7A 1J9OA 1W2BA 4QIWE 2O5IC 1RDPD 1YJ9A 1C7YA 1Z47A 3R8BA 1HR0Q 3TREA 5M9OA 3CRKC 5I9OA 1G2SA 3MWYW 3ULLA 2EYOA 1VQ9A 1E0BA 2OTLA 4IOCA 4DXGA 1GO3E 4A3IG 3CW2C 5C4HA 1EIYB 5C4XH 2PCFB 5C5MA 2R7DA 5M5YB 2B2UA 5IYCG 2OQ0A 4JCVE 1XTCD 2DJFC 1JORA 4NDXA 1L0XB 3A74A 1KNEA 1JOKA 3SK5A 2B2WC 3LGJA 4HJAA 2OXPA 2O2LD 1VQ4A 3M3YB 3QOJA 5HGTA 2JYOA 4R4QA 1DYQA 2E2HB 4X66L 4C3JB 3ZJYC 1VQEA 1YNJC 3CC7A 1BVSA 1QOHA 3MFYA 3A7LA 3OW7A 3UE0A 1F9PA 2E76C 1BBWA 3CMEA 1EY7A 1B2TA 1I94Q 4JOIC 3GTJB 1EU3A 1VQOA 3OTOQ 1KHIA 1LABA 3FPUB 5BN4A 3TMEA 3I4LA 3PIP3 3K7AB 4LF7Q 3MA2B 3J81c 4WJ3M 1M4VA 3DMUA 1VQMA 1ONLA 1CHQD 4OO1H 1I6HB 1BBUA 5IYDG 4C3HB 1HFGA 1STYA 3I4NB 2R61A 2CQOA 1I94L 4IN3A 5K36H 4OWWB 1VF7A 3OTOL 5H1SE 2PZTA 4H44C 4LF7L 1MHWC 1C8CA 1U4RA 3F2DA 3T51B 5E1FA 4FXDA 1F2LA 1G291 4JG2A 2NVXH 5KYLA 1B1ZA 2V4DA 4A3FH 2D0PA 1XMOQ 1XWEA 5FO7B 4BBSH 2EVBA 3E6ZX 2I5MX 3G4SA 4QCLA 1C9OA 4J6HA 1WJJA 2YYZA 5M3FH 2VB2X 1S40A 3GTOB 4A93H 4DV2Q 1MSGA 3STBC 4RCOA 3BZKA 2B63B 1KRTA 1Q81C 1JJCB 4KY6A 1PFBA 3OHXC 5KRUA 2BA0A 4H02A 4CGYB 3Q0AA 3OIPA 3CPFA 2R92B 1C48A 4A3DH 3UDGA 2QDLA 1FYCA 4KI0A 3NQIA 4QB4A 2N78A 1SAPA 2K01A 5C3WA 4DK1A 1G8ZD 4A93G 1PXUA 2EY1A 1U0LA 3NTIA 1YI2A 2PQEA 1GUNA 1PH9A 1M8AA 1HUMA 2Z6KC 3J80c 3M85A 4DV2L 4L6TB 2IPKD 4A3DG 1VQAA 4EQNA 1TS5A 1K73C 3H0GH 1SE4A 1WTXA 4TVAB 2PNHA 3A0JA 3T56B 3ULPA 3MXGA 1VDZA 4KJOA 2E74C 1SN8A 3OIQA 3JAML 1EY8A 2AUKA 2K04A 2R6GA 1WFQA 4IOAA 2LXJA 1FVIA 3D3RA 1UE7A 1W6KA 2K28A 3PO3B 2NVTH 1Q46A 4KTAA 4H0LC 3ULJA 2CQAA 2D5DA 1X3GA 2Z4HA 1WD0A 3CKIB 4IJLA 2EYFA 3U4VA 2EYMA 2YTYA 1WTVA 4KLKA 4KMUC 4IJHA 2FJ2A 4PZ7A 2F4VL 2ZXOA 5HY6A 1GUTA 4DK0A 5FLXE 1SNDA 5FK9C 3RLOA 4OXPA 2B2TC 3N6RA 1SYBA 3F8TA 3AU7A 1I5FA 1YZ6A 2OQKA 5C3XA 4B3MQ 3EIVA 2K32A 5LHY1 1H9JA 1JJ2A 3S1RH 4X64Q 3D6CA 1S5ED 4C3JG 4A3BB 2ZTCA 4A3JH 3HOZH 1IL2A 4IPGA 1SRUA 2RDFA 2PYKA 1GHKA 2JA8B 3HFZB 2B8GA 2UUAQ 1BUVT 3LWUA 1F2MA 3DUZA 1Q1EA 3M4PA 4RKBA 2N3SA 3S17H 4B3RQ 3VYTA 4FNFA 4Y7NB 2C5CA 4AH6A 3AFPA 2JSOA 4YCUA 3P1HA 2X6GA 3GTLH 2KCMA 1EY9A 1V9PA 3MXUA 1ASYA 1GKHA 1Q1BA 4EX5A 2RDHA 4HMJA 1KAWA 4JBJA 1K3BC 1K28A 4C3HG 4DU9A 3PUVA 4IZ8A 3BYTB 4A3MH 4LF4Q 4IUVA 2H4OA 3Q22A 4HJ8A 4BBRH 3U58A 4IFDG 1I50H 3QOLA 1A0IA 2NTTA 1TU2B 4XYQA 1P16A 2E2DC 5CV6A 5M5XH 4K5XA 2IJ0A 4YWLA 3S2HH 1I3QB 1EQVA 3SE0A 2ICEC 2K5QA 4A3MG 5EPKA 3TP8A 1EL0A 2NN6G 4R8NA 1U4MA 5I6YA 4DV4Q 4Z9CB 3K5LA 4LF4L 3A55A 2Z6BA 1CHPD 1XMQL 3KBGA 3KOJA 4HR7B 3MEHA 4R4IA 4KN7C 1MJCA 4QMGA 3GTKH 3H3VH 2D62A 4UDUC 4NW2A 1LTGD 4O42A 1S72A 1SFOH 4A3GB 1I4HA 1RKNA 2EY2A 4QUCA 1G51A 1WTHA 3KUPA 1FGBD 2UUBQ 2K5NA 4ODGA 4DV4L 5FOBB 2F3IA 1OXUA 1Y1VH 2XRQD 1M90C 1CQVA 4DK3C 1PFMA 2F0VA 3O13A 1EY0A 1D5MC 2BE5D 4OX9L 2PZWA 1B4OA 1EOTA 2VQEL 2RBMA 1HR0W 1QG7A 1GUOA 1K0RA 3MC0B 3J81j 3U50C 3KJPA 1PYSB 4C1NI 3P75A 3GTQB 1CA5A 3I70A 1BBXC 1FL0A 4K6LA 4A3CG 4JI0Q 2A19A 4BY1H 1HJPA 1PMRA 3A8JE 1VQCA 4CJ2C 3SGIA 2R7FA 3HOVB 1LTBD 4K2LA 2A6ED 3I4MB 5FLMG 2KENA 4DAPA 1MKHA 4JI3Q 2CW0D 4QQBX 1YEZA 1WYDA 1Y8NB 1STAA 3PO3G 3GP7A 1KTKA 3UDXA 1SMXA 4P75A 3GQBA 4GNXA 4KHPQ 4DV6L 3K80C 1HNXQ 2RQXA 4MNOA 1TS4A 4ME5A 3NWTA 4RGNA 1MI2A 3M4OB 1D1KA 1SROA 2F0DA 3HP3A 5IYBH 1KQSA 2IY5B 1ESRA 5KIXA 3ER0A 5LMUL 4X3TA 1UE1A 4K2KA 4LF9L 1QZGA 1E2ZA 4X65Q 4K6DA 5I4DA 3NTHA 2F0GA 4DR6Q 4XDXA 4RCNA 2RSOA 1QNUA 1Y8OB 4A3BG 5IIFA 5A35A 3R2TA 1N36Q 4LFAL 3CAMA 1VS0A 3MVVA 4DXFA 2JA8G 4GKJL 2JA5H 4LAAA 4C56C 5JJLA 4HSPA 1NR4A 4X65L 5IE8A 1A15A 5IGDA 1NSNS 2VZAA 2VQFL 1Q82C 1F9RA 3A7AB 1TXYA 2E5LQ 2MO0A 2JA7H 1T5XD 4C3IG 1LT4D 1CK1A 1YVCA 2BOSA 3VR2A 4R9WA 4ID6A 1N36L 1NAPA 5GAGC 4B9WA 1EYDA 5EPLA 4JI6Q 4NPSA 3TZUA 4DR3Q 2RCNA 1SE2A 2K7VA 4HIDA 1ZXTA 4G57A 1H9KA 2CWAA 3X3NA 3QWNA 2UU9Q 1EEID 1X3QA 4HJ5A 1JJGA 5M3MB 3GTGH 3HOXH 1RODA 2MFIA 2E5LL 1PVOA 1Y1WH 3H09A 4A3LG 1HH2P 1LTTD 5FLXc 4CDEC 3JAME 1IYUA 1ICFB 4X3SA 1RD9D 2V1CC 2R7ZH 3R3OA 1LUZA 4XQNA 2BA1A 1O7IA 1KDAA 1TWFH 3JC66 1HQRD 5E4XA 5E7NA 5GADC 4JI6L 3AYHB 5EKKA 3P7JA 4CDDC 5IP7G 1LLRD 3S16H 4POGA 2K03A 2UU9L 4R8IA 1H9SB 3S1QB 1JOOA 4NXNL 3K57A 3NUCA 3PIOA 2A8VA 1F2YA 3OWFA 5C4JH 2EY6A 4L63B 3HOYB 2R7ZG 3PGZA 1JE5A 3S24A 5ELNA 2FMMA 3IRBA 2NZHA 1ML0D 2Q2HA 1L1OC 2R93B 4IQZA 4WFN3 3GTMH 4MN3A 4IPDA 1UE5A 2HT1A 3DEOA 2PO4A 3WOFA 2HCIA 3ZYYX 5CV5A 2VNUD 3CCJA 1HFNA 4ILWA 1KABA 4XXEA 5FJ8H 3WWVA 2XWJB 3S15B 2RF4A 3J7ZC 2BE5C 1Y69U 2MGSA 5C4XB 1TWGH 3EVQA 3PO2H 2NVQH 5JOBA 3EN2A 3I4MG 1TWCH 4PNYA 2F4IA 1EZ8A 3CCUA 5ELOA 1PH6A 1PFSA 5ELEA 4FYDA 3D31A 2I46A 2A6EC 4NXML 3KF8B 3DM3A 3ERQA 1B9MA 1JB3A 2CW0C 3PO2G 3OWEB 2PPBC 1SEBD 3G7LA 3U9OA 3NPPA 3AEVA 4ZRZA 2XGTA 1GM5A 4LF8Q 2F0FA 2K5DA 2EQSA 3HOWB 1GVPA 2QDBA 3BVZA 2JA9A 3LNNA 1RF2D 2UUCQ 4IUPA 2RDGA 4ZAIA 5GAEC 4X62L 3FHWA 3M4QA 1STEA 1T9HA 4ZCKA 1XPRA 2VW9A 3RZDH 4P72A 1PRTC 3A5ZB 3MXNB 1NCVA 5IWAQ 4P2CB 1GUGA 1NY4A 4YWMA 4UP7A 2F0NA 1HPCA 4QL5A 3F2CA 3K0XA 4L5TA 3HOUG 2N88A 1AN8A 1X6OA 2UUCL 1HRJA 5M5WH 3RN5A 3FKIH 4EQ5A 1NBWA 3FEWX 4C2MH 2VUMB 1WTQA 1R4QB 1N33Q 2QA4A 2NVXB 5JJKA 4IURA 3RZOH 4LW1A 2K5VA 5CV4A 1MD2D 5IODA 2FINB 2JA6B 2B2WA 3BVGA 3Q8DA 4BBSB 1KC8C 1ZYRC 5CR3A 2K14A 2WACA 4R4OA 4UY8C 2ICIA 2MQHA 5T1IA 4CJ0B 4LUVA 1EOVA 2C9OA 2IX3A 3CMAA 1EWIA 3DLLA 4DR5L 4AQYQ 3I7FA 3E0EA 4UPAA 4V190 4U68A 2TSSA 1UNSA 1G6ZA 3MAQA 1N33L 1VF5C 1S5DD 5IYCH 4JOIA 1HXYD 1EQTA 1QNKA 1TR5A 1FNWA 2JQOA 3EBEA 4RHRA 2K5WA 2YV5A 3CC4A 1WD1A 3EROA 1E1TA 1E22A 4A3EB 4X66Q 2Q8RE 3VDYA 4DK6C 1CA6A 1VQBA 4HTHA 4AQYL 4IPCA 1R9TB 3H15A 5K5PA 2OF1A 3HKZB 3KLWA 2RSNA 1PH3A 3HOYG 2EXDA 2F0SA 1H9RA 4K8JA 2HQLA 1E1OA 1L2FA 4LNQA 2ZM6Q 1WCMG 1ENCA 1XNRL 2NWGA 2KEEA 4KN4C 1AE3A 3TQYA 2EJFC 3N52A 1ICWA 1B44D 2NVTB 3SHLA 4FO2A 3OSOA 3E3XA 3CD6A 5IYDH 3L3OC 1F77A 2KHIA 2WB1B 1DGSA 1JWMD 1A62A 1WVLA 1EIFA 4PV1C 1PTOH 3A8KE 2AMCB 2F0UA 2MP1A 4IALA 4JW0A 3KFUA 1SNQA 4FXGC 5I6WA 2ZM6L 2E2JB 3NEMA 5FO9B 4GS3A 1VQ8A 1CKNB 2A69D 4A3KG 2BDOA 2FHTA 1EUJA 1NUCA 4R1JA 4PZ6A 4DGZA 1ESFA 1JOQA 2EIFA 2QILA 1SR3A 4CDFC 3JAMc 2LSSA 1D5XC 2RHQB 1WTWA 1A63A 2MJ8A 3T1YL 1ET9A 3S1RB 3NE5B 2B2YC 1SYDA 2Z6KA 1ZEQX 1IL8A 3FDTA 2UXBQ 1YNNC 4B08A 4DAYB 5JEAH 2B2UC 3HOWG 3IAYA 5C0XI 2EY5A 1IKMA 1UUPA 1GHJA 1B3QA 2IT1A 1VQPA 4MTNA 1YITA 1SNCA 1STNA 1TY0A 4ALPA 3W2DA 5IGFA 4J1MA 3S1MB 3S14B 1QVCA 2IX1A 3GTLB 1NMGA 2QKIC 2N55A 4LJZC 4IFDJ 2F0HA 5JEAG 1YHQA 3X3MA 3HS0C 4FF3A 2UXBL 3VR5A 4BBRB 1SYEA 1TWAH 3DWQA 2WKDA 3NP8A 4X6AH 1S5BD 3CPWA 1SYCA 5EQ0A 4WJ4A 5JVG3 1I4RA 2SNMA 5M5XB 2VUMG 2YU9H 4MIUA 5EJWA 2AKWB 1FGUA 3RNUA 3G6JB 5LMNL 2B2TA 3ND9A 2JA6G 1BR9A 3PCOB 1SYGA 3TZDA 1ENFA 2AUJD 5BN3A 2CVRA 2EXZA 2Q2UA 4P73A 2KEDA 4N8X1 1N8RC 3PQIA 3GTKB 2Q8IB 2X6LA 1IBKQ 4MZ9A 1SFOB 2F4VQ 2J4XA 4DKAC 1X3FA 2K75A 1EYGA 1E3PA 4GLVB 5M5YH 3Q6SA 4NP5A 2UXDQ 2KQ3A 1TKWB 1CFMA 3PIO3 2CHBD 2G9HD 4KY7A 4UP8A 2CCZA 1SDFA 3KF6B 1LM0A 3QR8A 3VA5A 1Y1VB 1AE2A 2A68D 4I7ZC 1TQOA 2I07B 1KD1C 2PQAB 3OOCA 4DV1Q 2LY7A
chains in the Genus database with same CATH topology
5BR8Q 4DV7Q 1IBKL 5FLMG 4C3JH 2KENA 1MKHA 4JI3Q 1PYBA 4QQBX 1X54A 2AWOA 4R4TA 1YEZA 3M4OH 1WYDA 2I0QA 3PO3G 1OXXK 1Z9FA 4A3KH 2ATWA 2E8GA 4P74A 2UXDL 4LUOA 3UDXA 3T1YQ 1SMXA 1HR0L 4P75A 1QUQA 4GNXA 1JB7A 3L0OA 4DV6L 3K80C 4JV5Q 4KHPQ 1HNXQ 3GTJH 1EQRA 2NZOA 3UDFA 1PH1A 4MNOA 5C4XG 2MO1A 3K7AH 4HIKA 3TS0A 2AWNA 1YHAA 4JI1Q 1PH8A 3CQZH 1SROA 5IYBH 4GLAC 4DV1L 5BR8L 4DV7L 1KQSA 5HGQA 3B6YA 2DGYA 3G6EA 4APVA 4A4IA 3ER0A 1MIUA 3K8AA 1QVFA 1NE3A 5LMUL 3HOWH 1UE1A 2Y0SG 4JI2Q 5FJ8G 4LF9L 2I5HA 3HKZE 1QZGA 4C3HH 4X65Q 2K52A 4R4CA 3OW2A 1PH4A 1L0WA 3I4NH 4DR6Q 1J5EQ 2PI2E 4JC0A 2LXKA 1OXTA 4Y52H 2DUDA 4JV5L 3UDIA 3J7A5 4RG1A 4A75A 4A3BG 5GAHC 3UE1A 4DUZQ 3L2PA 4JI1L 3CCVA 1XTDA 3KDFA 1N36Q 2QGQA 4YCVA 4LFAL 1KL9A 1KRSA 3CAMA 1VS0A 4GN3B 2JA8G 4TQUS 3STBD 1K9MC 3S2DH 2JA5H 4GKJL 1N32Q 2JEBI 4UP9A 3TS2A 1Q8KA 4JI2L 3AFQA 1WI5A 3I4NG 1XMQQ 5JJLA 2Y0SE 4X65L 5IE8A 4GN4B 2WB1E 2IX0A 3W1BA 1S3OA 2D0OA 3CCMA 2VZAA 1Q7YC 4OO1G 1NTGA 2VQFL 2IHEA 4JI8Q 4DR2L 1Q82C 5LMNQ 3ERSX 2E5LQ 1TXYA 2VUMH 2MO0A 4GOPB 1WOCA 2JA7H 4IFDI 2CKZB 2NVYH 1EQQA 4LF8L 1VQIA 4YWKA 1YVCA 5M3MH 2CWPA 2FXQA 4OWXB 1N36L 1OXSC 2JA6H 1CKNA 5K36G 5GAGC 1YBYA 5EAYA 4JI6Q 4NPSA 3PF5A 4DR3Q 2RCNA 1IXRA 2NN6I 1XNQL 4HIDA 4DPGA 1VQ7A 1X65A 4OX9Q 2JEAI 4YHHQ 2CWAA 2K4KA 1YHBA 2UU9Q 2VQEQ 2B63G 1K8GA 4HJ5A 1JJGA 5IWAL 4JI8L 4RMFA 3GTGH 3HOXH 2E5LL 2MFIA 1PVOA 4A3FG 3D0FA 1Y1WH 2ASBA 4A3LG 4DV0L 1HH2P 3F1ZA 4DR1Q 1BKBA 4FDBA 5IT9c 5FLXc 2R92G 3KJOA 3CCQA 4BBSG 3PF4A 3FKIG 3K81C 3E9HA 2V1CC 1CSQA 1XMOL 2R7ZH 1C0AA 3OYYA 1E7ZA 1LUZA 5M3FG 1PH2A 4A3CH 2BA1A 2HIVA 1O7IA 4QJFA 3W1GA 1TWFH 3JC66 1YNXA 2OCEA 3I4OA 5E7NA 5GADC 4JI6L 4A3EH 3AYHB 4JBMA 1VQJA 1PA6A 4A3IH 5IP7G 2R93H 2B3GA 2GN5A 4P71A 1A8VA 3S16H 3TRZA 1B7YB 4QY7A 1W2BA 2UU9L 4QIWE 1V43A 5FLMH 4POGA 1SE8A 4NXNL 4IO9A 1YJ9A 1R9TH 2BH2A 1C7YA 1Z47A 3PIOA 2A8VA 3NBHB 4DNIA 1HR0Q 3RLFA 3TREA 5C4JH 3PO3H 2R7ZG 3PGZA 1RIPA 4DR1L 3CCSA 4DV6Q 3M7NA 1JE5A 3S24A 5ELNA 3IRBA 2GVAA 3ULLA 2NZHA 1VQ9A 2OTLA 4DR7Q 4IOCA 1D7QA 2Q2HA 4A3EG 1GO3E 2K50A 1L1OC 3BU2A 4YY3L 1GD7A 3RN2A 4A3IG 3GTMH 3CW2C 3M3YH 4IPDA 1UE5A 1IZ6A 5C4XH 4QGUA 1EIYB 2HT1A 3GTPH 2R7DA 2E2HH 2JK8A 3CF5A 5IYCG 2OQ0A 1VQHA 4JCVE 5LMUQ 1ASZA 2HHHQ 3HKZG 3H0GG 2VNUD 3G71A 4LF9Q 3CCJA 3HKSA 3A74A 1JT8A 4GKKQ 1VQLA 3U4ZA 3LGJA 3WWVA 5FJ8H 4HJAA 3CXCA 2RF4A 1VQ4A 3J7ZC 2GVBA 3L7ZC 5IP9G 3PV0A 1TWGH 2B29A 4R4QA 3J81i 3PO2H 4DR7L 3CCRA 4X66L 2JJQA 3ZJYC 1VQEA 1LTLA 4BA1I 2ZTEA 2NVQH 3CC7A 1YJWA 1BVSA 3EN2A 3PSIA 3I4MG 4LFAQ 1TWCH 4A3BH 2E2JH 3UE0A 2HIXA 4GKJQ 1RL2A 1L1OB 5AJ3Q 1I6HH 3CCUA 4XIGS 1BBWA 5ELOA 2HHHL 3CMEA 1PH6A 1I94Q 4JOIC 2JA8H 1JMCA 4JBKA 4GLXA 2WB1G 1PFSA 3MEFA 3D31A 1VQOA 3OTOQ 4GOPC 1KHIA 1E24A 3KF8B 3DM3A 3PIPA 4NXML 4O2DA 1QVGA 4GKKL 4O0AA 4LF7Q 3PO2G 1KXLA 3J81c 2VQFQ 4DR2Q 2VL6A 4WJ3M 1VQMA 4IPHA 3AEVA 2XGTA 2KCTA 3KF6A 4LFBL 2Q2IA 1GM5A 4LF5Q 4LF8Q 4Y7NH 4AYBG 2EQSA 1BBUA 1GVPA 1X9NA 2PQAA 4C3IH 5IYDG 1VQKA 4L5SA 2JA9A 2UUCQ 3PUZA 5GAEC 3KYHC 4X62L 3FHWA 5AJ3L 3M4QA 2CQOA 5GROA 1I94L 1T9HA 1XPRA 1XNQQ 2VW9A 1HZAA 3RZDH 4OWWB 3S1NH 4P72A 3OTOL 5H1SE 1YJNA 4B3ML 3A5ZB 3MXNB 1CSPA 4LF7L 1FJGL 1Q86C 5IWAQ 4A3JG 3HOZG 3S1MH 4YWMA 1NY4A 3F2DA 3S14H 4X64L 5C0XG 3GTOH 4UP7A 4DV0Q 4JYAL 1G291 4JG2A 1Q12A 2B63H 4LF5L 4QL5A 2NVXH 3F2CA 2YTXA 4BBSH 3TEHB 3K0XA 4L5TA 4HJ7A 3HOUG 4OO1I 5C0XJ 4A3FH 4A3LH 4AYBE 2D0PA 1XMOQ 2JE6I 1X6OA 5IY0A 2UUCL 1NJIC 2WP8J 4PMWA 5M5WH 3RN5A 4XTCS 2UUAL 2R92H 3FP9A 4BY7G 1M1KC 1UE6A 2F52A 3PUWA 1L1OA 3FKIH 4EQ5A 2Z0SA 3G4SA 2I5MX 1NBWA 2E2IH 1C9OA 1CKOA 1WJJA 2YYZA 4C2MH 4K0KQ 4KHZA 5M3FH 4JI7Q 1S40A 4A93H 4DV2Q 3STBC 1N33Q 2IHFA 3BZKA 2QA4A 1KRTA 4B3RL 1X56A 1Q81C 4NXNQ 5JJKA 1JJCB 5IP7H 3RZOH 4LW1A 3J80i 2BA0A 2WFWA 4H02A 2K5VA 3G48A 1PV4A 1VQNA 4NB3A 1PH7A 3CPFA 4A3DH 3AQQA 3Q8DA 4BBRG 3UDGA 1KC8C 2ZJPA 4L5QA 2K14A 4R4OA 4KI0A 1KIXA 4UY8C 3CP0A 4AIMA 2MQHA 4YY3Q 2N78A 4LUVA 1EOVA 3CMAA 2UXCQ 1EWIA 4A93G 3DLLA 4DR5L 4AQYQ 1Y14B 3I7FA 2OWOA 3E0EA 1U0LA 4UPAA 4K0KL 1YI2A 4B3SQ 1MJEA 1PH9A 4JI7L 2Z6KC 4OONA 3J80c 3M85A 4DV2L 1N33L 1K8AC 5IYCH 5C3EG 1QUQB 3CCEA 3I2ZA 4GNXB 4JOIA 1VQAA 4A3GG 4A3DG 1IYJB 1K73C 3H0GH 4OWTB 4GOPA 1X55A 2JQOA 4TVAB 2PNHA 3A0JA 3EBEA 2YV5A 1QZHA 3CC4A 4GN5A 1HNWL 3ULPA 3GDEA 1E1TA 1E22A 5JJIA 4X66Q 3PUXA 5IP9H 3VDYA 4DK6C 1SN8A 2RHSB 1VQDA 4B3TQ 2UXCL 1VQBA 3I55A 4AQYL 3I56A 2R6GA 3PUYA 1WFQA 4IPCA 4IOAA 2LXJA 3H15A 2QEXA 4B3SL 1FVIA 1VCIA 1UE7A 3I4MH 2L15A 2NVTH 3GO5A 1Q46A 3KLWA 3ULJA 3BZCA 4DV3L 4NXMQ 1PH3A 1CKMA 3HOYG 2EXDA 1X3GA 4PZ8A 2ES2A 1AH9A 2HQLA 1E1OA 1L2FA 1UWVA 2ZM6Q 4A76A 1Y1VG 1WCMG 4IJLA 5C44G 2UUBL 4LNQA 3U4VA 2ALYB 2YTYA 1NMFA 1XNRL 4LFBQ 1VQ5A 3KDFB 4JBWA 1AE3A 4KLKA 1N34Q 1HZCA 3TQYA 4B3TL 3HOVG 3F2BA 4IJHA 4BXXH 2CFMA 4PZ7A 1IBMQ 2H5XA 2F4VL 3CD6A 5HY6A 4X62Q 5IYDH 3RLOA 2KHIA 4LF6Q 4OXPA 1DGSA 1G6PA 2WAQG 3CCLA 1SLJA 4BY1G 3JAMi 3F8TA 1K3RA 1A62A 1I5FA 1YZ6A 1EIFA 2BH8A 2N49A 1OXVA 2OQKA 3EIVA 2AMCB 4B3MQ 1FJGQ 2AHOB 3GD7A 1JJ2A 3KFUA 4JI0L 2ZM6L 2N8NA 3S1RH 4X64Q 2VY3A 1B70B 4BXXG 4JYAQ 3BJUA 3NEMA 2ZTCA 1IBLQ 4A3JH 3HOZH 1N34L 1IL2A 4GS3A 1SRUA 1CKNB 4IPGA 1VQ8A 4A3KG 4JI3L 3HFZB 1EUJA 4R1JA 3RR5A 1IBML 4PZ6A 2UUAQ 4LUZA 3HOUH 2EIFA 1SR3A 1W3SA 3JAMc 2LSSA 2RHQB 4HIOA 1XPUA 1XJVA 4DR4Q 1A63A 4DV5Q 4LF6L 1Q1EA 3M4PA 3T1YL 1VQGA 4BY7H 4JI4Q 2N3SA 2WAQE 2ZTDA 3S17H 4KHPL 1U5KA 2PI2A 1HNXL 3T1HQ 2Z6KA 4B3RQ 1HZBA 3M9BA 4AH6A 5IYBG 3AFPA 4YCUA 2UXBQ 3GTLH 2IY5B 2K5HA 1V9PA 2KCMA 4DAYB 1ASYA 1H95A 1IBLL 1GKHA 1Q1BA 4EX5A 2YTVA 3HOWG 1KAWA 4JBJA 1I3QH 5C0XI 3PUVA 4A3MH 4LF4Q 4HJ8A 2IT1A 3NENA 4BBRH 4HJ9A 1VQPA 4MTNA 4LWCA 1YIJA 1YITA 4DR5Q 2ZJRA 4ALPA 3U58A 4DR4L 1I50H 2PMZE 1TWHH 4IFDG 1A0IA 1K83H 4DV5L 4GNXC 1P16A 5LMNW 1QVCA 2IX1A 4JI4L 4DR6L 1J5EL 2I5LX 1NMGA 4JI5Q 5GQOA 5M5XH 2VS1A 3T1HL 4IFDJ 5JEAG 1YHQA 4YWLA 3S2HH 4DUYQ 3K7UC 2Q2TA 4J15A 1B8AA 1LYLA 4DUZL 2UXBL 3CC2A 2KHJA 2JA5G 1HNZQ 5C3EH 4A3MG 1HNWQ 5JEAJ 1EFWA 1TWAH 4A3GH 2NN6G 4BA2I 1VQ6A 1D8LA 4DV4Q 4X6AH 1CUKA 4POFA 3CPWA 1N32L 4LF4L 4WJ4A 1OTCA 1UEBA 2OTJA 4YCWA 3W5OA 1XMQL 3NELA 1X3EA 3KOJA 2VUMG 2YU9H 4R4IA 2JA7G 3GTKH 1MJCA 1PHJA 3H3VH 2MNAA 2D62A 2AKWB 1FGUA 4ME3A 4DAMA 3RNUA 1S72A 4JI5L 5M3MG 5LMNL 1SFOH 2KBNA 1VQFA 4DUYL 4DV3Q 4HIMA 5DLQE 4L5RC 2JA6G 3PCOB 1N9WA 4PG3A 3S1QH 4LFCQ 1HNZL 1HZ9A 1G51A 2UUBQ 3E9IA 2Q2UA 4P73A 2K5NA 3HOYH 1XNRQ 3GTQH 3ICEA 1V1QA 1J6QA 3A5UA 4DV4L 1N8RC 2F3IA 1OXUA 1Y1VH 1WCMH 3RLNA 5C44H 1M90C 4DR3L 1IBKQ 4DK3C 2ZJQA 2C35B 4MZ9A 2A1AA 2F4VQ 3HOXG 4OX9L 4YHHL 1P8LA 5J3BA 1X3FA 4DKAC 2K75A 1Y1WG 1E3PA 4GLVB 1EYGA 5M5YH 2VQEL 1HR0W 3HOVH 1K0RA 3J81j 3H3VI 3U50C 2UXDQ 2CCZA 4UP8A 3KJPA 1PYSB 1FL0A 4LFCL 4A3CG 3KF6B 1LM0A 4JI0Q 2A19A 4BY1H 1AE2A 1HJPA 2ID0A 1PH5A 3S15H 1VQCA 1KD1C 2PQAB 2XTIA 1XPOA 2R93G 3SGIA 4DV1Q 2R7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 Q;  4DV7 Q;  1IBK L;  5FLM G;  4C3J H;  2KEN A;  1MKH A;  4JI3 Q;  1PYB A;  4QQB X;  1X54 A;  2AWO A;  4R4T A;  1YEZ A;  3M4O H;  1WYD A;  2I0Q A;  3PO3 G;  1OXX K;  1Z9F A;  4A3K H;  2ATW A;  2E8G A;  4P74 A;  2UXD L;  4LUO A;  3UDX A;  3T1Y Q;  1SMX A;  1HR0 L;  4P75 A;  1QUQ A;  4GNX A;  1JB7 A;  3L0O A;  4DV6 L;  3K80 C;  4JV5 Q;  4KHP Q;  1HNX Q;  3GTJ H;  1EQR A;  2NZO A;  3UDF A;  1PH1 A;  4MNO A;  5C4X G;  2MO1 A;  3K7A H;  4HIK A;  3TS0 A;  2AWN A;  1YHA A;  4JI1 Q;  1PH8 A;  3CQZ H;  1SRO A;  5IYB H;  4GLA C;  4DV1 L;  5BR8 L;  4DV7 L;  1KQS A;  5HGQ A;  3B6Y A;  2DGY A;  3G6E A;  4APV A;  4A4I A;  3ER0 A;  1MIU A;  3K8A A;  1QVF A;  1NE3 A;  5LMU L;  3HOW H;  1UE1 A;  2Y0S G;  4JI2 Q;  5FJ8 G;  4LF9 L;  2I5H A;  3HKZ E;  1QZG A;  4C3H H;  4X65 Q;  2K52 A;  4R4C A;  3OW2 A;  1PH4 A;  1L0W A;  3I4N H;  4DR6 Q;  1J5E Q;  2PI2 E;  4JC0 A;  2LXK A;  1OXT A;  4Y52 H;  2DUD A;  4JV5 L;  3UDI A;  3J7A 5;  4RG1 A;  4A75 A;  4A3B G;  5GAH C;  3UE1 A;  4DUZ Q;  3L2P A;  4JI1 L;  3CCV A;  1XTD A;  3KDF A;  1N36 Q;  2QGQ A;  4YCV A;  4LFA L;  1KL9 A;  1KRS A;  3CAM A;  1VS0 A;  4GN3 B;  2JA8 G;  4TQU S;  3STB D;  1K9M C;  3S2D H;  2JA5 H;  4GKJ L;  1N32 Q;  2JEB I;  4UP9 A;  3TS2 A;  1Q8K A;  4JI2 L;  3AFQ A;  1WI5 A;  3I4N G;  1XMQ Q;  5JJL A;  2Y0S E;  4X65 L;  5IE8 A;  4GN4 B;  2WB1 E;  2IX0 A;  3W1B A;  1S3O A;  2D0O A;  3CCM A;  2VZA A;  1Q7Y C;  4OO1 G;  1NTG A;  2VQF L;  2IHE A;  4JI8 Q;  4DR2 L;  1Q82 C;  5LMN Q;  3ERS X;  2E5L Q;  1TXY A;  2VUM H;  2MO0 A;  4GOP B;  1WOC A;  2JA7 H;  4IFD I;  2CKZ B;  2NVY H;  1EQQ A;  4LF8 L;  1VQI A;  4YWK A;  1YVC A;  5M3M H;  2CWP A;  2FXQ A;  4OWX B;  1N36 L;  1OXS C;  2JA6 H;  1CKN A;  5K36 G;  5GAG C;  1YBY A;  5EAY A;  4JI6 Q;  4NPS A;  3PF5 A;  4DR3 Q;  2RCN A;  1IXR A;  2NN6 I;  1XNQ L;  4HID A;  4DPG A;  1VQ7 A;  1X65 A;  4OX9 Q;  2JEA I;  4YHH Q;  2CWA A;  2K4K A;  1YHB A;  2UU9 Q;  2VQE Q;  2B63 G;  1K8G A;  4HJ5 A;  1JJG A;  5IWA L;  4JI8 L;  4RMF A;  3GTG H;  3HOX H;  2E5L L;  2MFI A;  1PVO A;  4A3F G;  3D0F A;  1Y1W H;  2ASB A;  4A3L G;  4DV0 L;  1HH2 P;  3F1Z A;  4DR1 Q;  1BKB A;  4FDB A;  5IT9 c;  5FLX c;  2R92 G;  3KJO A;  3CCQ A;  4BBS G;  3PF4 A;  3FKI G;  3K81 C;  3E9H A;  2V1C C;  1CSQ A;  1XMO L;  2R7Z H;  1C0A A;  3OYY A;  1E7Z A;  1LUZ A;  5M3F G;  1PH2 A;  4A3C H;  2BA1 A;  2HIV A;  1O7I A;  4QJF A;  3W1G A;  1TWF H;  3JC6 6;  1YNX A;  2OCE A;  3I4O A;  5E7N A;  5GAD C;  4JI6 L;  4A3E H;  3AYH B;  4JBM A;  1VQJ A;  1PA6 A;  4A3I H;  5IP7 G;  2R93 H;  2B3G A;  2GN5 A;  4P71 A;  1A8V A;  3S16 H;  3TRZ A;  1B7Y B;  4QY7 A;  1W2B A;  2UU9 L;  4QIW E;  1V43 A;  5FLM H;  4POG A;  1SE8 A;  4NXN L;  4IO9 A;  1YJ9 A;  1R9T H;  2BH2 A;  1C7Y A;  1Z47 A;  3PIO A;  2A8V A;  3NBH B;  4DNI A;  1HR0 Q;  3RLF A;  3TRE A;  5C4J H;  3PO3 H;  2R7Z G;  3PGZ A;  1RIP A;  4DR1 L;  3CCS A;  4DV6 Q;  3M7N A;  1JE5 A;  3S24 A;  5ELN A;  3IRB A;  2GVA A;  3ULL A;  2NZH A;  1VQ9 A;  2OTL A;  4DR7 Q;  4IOC A;  1D7Q A;  2Q2H A;  4A3E G;  1GO3 E;  2K50 A;  1L1O C;  3BU2 A;  4YY3 L;  1GD7 A;  3RN2 A;  4A3I G;  3GTM H;  3CW2 C;  3M3Y H;  4IPD A;  1UE5 A;  1IZ6 A;  5C4X H;  4QGU A;  1EIY B;  2HT1 A;  3GTP H;  2R7D A;  2E2H H;  2JK8 A;  3CF5 A;  5IYC G;  2OQ0 A;  1VQH A;  4JCV E;  5LMU Q;  1ASZ A;  2HHH Q;  3HKZ G;  3H0G G;  2VNU D;  3G71 A;  4LF9 Q;  3CCJ A;  3HKS A;  3A74 A;  1JT8 A;  4GKK Q;  1VQL A;  3U4Z A;  3LGJ A;  3WWV A;  5FJ8 H;  4HJA A;  3CXC A;  2RF4 A;  1VQ4 A;  3J7Z C;  2GVB A;  3L7Z C;  5IP9 G;  3PV0 A;  1TWG H;  2B29 A;  4R4Q A;  3J81 i;  3PO2 H;  4DR7 L;  3CCR A;  4X66 L;  2JJQ A;  3ZJY C;  1VQE A;  1LTL A;  4BA1 I;  2ZTE A;  2NVQ H;  3CC7 A;  1YJW A;  1BVS A;  3EN2 A;  3PSI A;  3I4M G;  4LFA Q;  1TWC H;  4A3B H;  2E2J H;  3UE0 A;  2HIX A;  4GKJ Q;  1RL2 A;  1L1O B;  5AJ3 Q;  1I6H H;  3CCU A;  4XIG S;  1BBW A;  5ELO A;  2HHH L;  3CME A;  1PH6 A;  1I94 Q;  4JOI C;  2JA8 H;  1JMC A;  4JBK A;  4GLX A;  2WB1 G;  1PFS A;  3MEF A;  3D31 A;  1VQO A;  3OTO Q;  4GOP C;  1KHI A;  1E24 A;  3KF8 B;  3DM3 A;  3PIP A;  4NXM L;  4O2D A;  1QVG A;  4GKK L;  4O0A A;  4LF7 Q;  3PO2 G;  1KXL A;  3J81 c;  2VQF Q;  4DR2 Q;  2VL6 A;  4WJ3 M;  1VQM A;  4IPH A;  3AEV A;  2XGT A;  2KCT A;  3KF6 A;  4LFB L;  2Q2I A;  1GM5 A;  4LF5 Q;  4LF8 Q;  4Y7N H;  4AYB G;  2EQS A;  1BBU A;  1GVP A;  1X9N A;  2PQA A;  4C3I H;  5IYD G;  1VQK A;  4L5S A;  2JA9 A;  2UUC Q;  3PUZ A;  5GAE C;  3KYH C;  4X62 L;  3FHW A;  5AJ3 L;  3M4Q A;  2CQO A;  5GRO A;  1I94 L;  1T9H A;  1XPR A;  1XNQ Q;  2VW9 A;  1HZA A;  3RZD H;  4OWW B;  3S1N H;  4P72 A;  3OTO L;  5H1S E;  1YJN A;  4B3M L;  3A5Z B;  3MXN B;  1CSP A;  4LF7 L;  1FJG L;  1Q86 C;  5IWA Q;  4A3J G;  3HOZ G;  3S1M H;  4YWM A;  1NY4 A;  3F2D A;  3S14 H;  4X64 L;  5C0X G;  3GTO H;  4UP7 A;  4DV0 Q;  4JYA L;  1G29 1;  4JG2 A;  1Q12 A;  2B63 H;  4LF5 L;  4QL5 A;  2NVX H;  3F2C A;  2YTX A;  4BBS H;  3TEH B;  3K0X A;  4L5T A;  4HJ7 A;  3HOU G;  4OO1 I;  5C0X J;  4A3F H;  4A3L H;  4AYB E;  2D0P A;  1XMO Q;  2JE6 I;  1X6O A;  5IY0 A;  2UUC L;  1NJI C;  2WP8 J;  4PMW A;  5M5W H;  3RN5 A;  4XTC S;  2UUA L;  2R92 H;  3FP9 A;  4BY7 G;  1M1K C;  1UE6 A;  2F52 A;  3PUW A;  1L1O A;  3FKI H;  4EQ5 A;  2Z0S A;  3G4S A;  2I5M X;  1NBW A;  2E2I H;  1C9O A;  1CKO A;  1WJJ A;  2YYZ A;  4C2M H;  4K0K Q;  4KHZ A;  5M3F H;  4JI7 Q;  1S40 A;  4A93 H;  4DV2 Q;  3STB C;  1N33 Q;  2IHF A;  3BZK A;  2QA4 A;  1KRT A;  4B3R L;  1X56 A;  1Q81 C;  4NXN Q;  5JJK A;  1JJC B;  5IP7 H;  3RZO H;  4LW1 A;  3J80 i;  2BA0 A;  2WFW A;  4H02 A;  2K5V A;  3G48 A;  1PV4 A;  1VQN A;  4NB3 A;  1PH7 A;  3CPF A;  4A3D H;  3AQQ A;  3Q8D A;  4BBR G;  3UDG A;  1KC8 C;  2ZJP A;  4L5Q A;  2K14 A;  4R4O A;  4KI0 A;  1KIX A;  4UY8 C;  3CP0 A;  4AIM A;  2MQH A;  4YY3 Q;  2N78 A;  4LUV A;  1EOV A;  3CMA A;  2UXC Q;  1EWI A;  4A93 G;  3DLL A;  4DR5 L;  4AQY Q;  1Y14 B;  3I7F A;  2OWO A;  3E0E A;  1U0L A;  4UPA A;  4K0K L;  1YI2 A;  4B3S Q;  1MJE A;  1PH9 A;  4JI7 L;  2Z6K C;  4OON A;  3J80 c;  3M85 A;  4DV2 L;  1N33 L;  1K8A C;  5IYC H;  5C3E G;  1QUQ B;  3CCE A;  3I2Z A;  4GNX B;  4JOI A;  1VQA A;  4A3G G;  4A3D G;  1IYJ B;  1K73 C;  3H0G H;  4OWT B;  4GOP A;  1X55 A;  2JQO A;  4TVA B;  2PNH A;  3A0J A;  3EBE A;  2YV5 A;  1QZH A;  3CC4 A;  4GN5 A;  1HNW L;  3ULP A;  3GDE A;  1E1T A;  1E22 A;  5JJI A;  4X66 Q;  3PUX A;  5IP9 H;  3VDY A;  4DK6 C;  1SN8 A;  2RHS B;  1VQD A;  4B3T Q;  2UXC L;  1VQB A;  3I55 A;  4AQY L;  3I56 A;  2R6G A;  3PUY A;  1WFQ A;  4IPC A;  4IOA A;  2LXJ A;  3H15 A;  2QEX A;  4B3S L;  1FVI A;  1VCI A;  1UE7 A;  3I4M H;  2L15 A;  2NVT H;  3GO5 A;  1Q46 A;  3KLW A;  3ULJ A;  3BZC A;  4DV3 L;  4NXM Q;  1PH3 A;  1CKM A;  3HOY G;  2EXD A;  1X3G A;  4PZ8 A;  2ES2 A;  1AH9 A;  2HQL A;  1E1O A;  1L2F A;  1UWV A;  2ZM6 Q;  4A76 A;  1Y1V G;  1WCM G;  4IJL A;  5C44 G;  2UUB L;  4LNQ A;  3U4V A;  2ALY B;  2YTY A;  1NMF A;  1XNR L;  4LFB Q;  1VQ5 A;  3KDF B;  4JBW A;  1AE3 A;  4KLK A;  1N34 Q;  1HZC A;  3TQY A;  4B3T L;  3HOV G;  3F2B A;  4IJH A;  4BXX H;  2CFM A;  4PZ7 A;  1IBM Q;  2H5X A;  2F4V L;  3CD6 A;  5HY6 A;  4X62 Q;  5IYD H;  3RLO A;  2KHI A;  4LF6 Q;  4OXP A;  1DGS A;  1G6P A;  2WAQ G;  3CCL A;  1SLJ A;  4BY1 G;  3JAM i;  3F8T A;  1K3R A;  1A62 A;  1I5F A;  1YZ6 A;  1EIF A;  2BH8 A;  2N49 A;  1OXV A;  2OQK A;  3EIV A;  2AMC B;  4B3M Q;  1FJG Q;  2AHO B;  3GD7 A;  1JJ2 A;  3KFU A;  4JI0 L;  2ZM6 L;  2N8N A;  3S1R H;  4X64 Q;  2VY3 A;  1B70 B;  4BXX G;  4JYA Q;  3BJU A;  3NEM A;  2ZTC A;  1IBL Q;  4A3J H;  3HOZ H;  1N34 L;  1IL2 A;  4GS3 A;  1SRU A;  1CKN B;  4IPG A;  1VQ8 A;  4A3K G;  4JI3 L;  3HFZ B;  1EUJ A;  4R1J A;  3RR5 A;  1IBM L;  4PZ6 A;  2UUA Q;  4LUZ A;  3HOU H;  2EIF A;  1SR3 A;  1W3S A;  3JAM c;  2LSS A;  2RHQ B;  4HIO A;  1XPU A;  1XJV A;  4DR4 Q;  1A63 A;  4DV5 Q;  4LF6 L;  1Q1E A;  3M4P A;  3T1Y L;  1VQG A;  4BY7 H;  4JI4 Q;  2N3S A;  2WAQ E;  2ZTD A;  3S17 H;  4KHP L;  1U5K A;  2PI2 A;  1HNX L;  3T1H Q;  2Z6K A;  4B3R Q;  1HZB A;  3M9B A;  4AH6 A;  5IYB G;  3AFP A;  4YCU A;  2UXB Q;  3GTL H;  2IY5 B;  2K5H A;  1V9P A;  2KCM A;  4DAY B;  1ASY A;  1H95 A;  1IBL L;  1GKH A;  1Q1B A;  4EX5 A;  2YTV A;  3HOW G;  1KAW A;  4JBJ A;  1I3Q H;  5C0X I;  3PUV A;  4A3M H;  4LF4 Q;  4HJ8 A;  2IT1 A;  3NEN A;  4BBR H;  4HJ9 A;  1VQP A;  4MTN A;  4LWC A;  1YIJ A;  1YIT A;  4DR5 Q;  2ZJR A;  4ALP A;  3U58 A;  4DR4 L;  1I50 H;  2PMZ E;  1TWH H;  4IFD G;  1A0I A;  1K83 H;  4DV5 L;  4GNX C;  1P16 A;  5LMN W;  1QVC A;  2IX1 A;  4JI4 L;  4DR6 L;  1J5E L;  2I5L X;  1NMG A;  4JI5 Q;  5GQO A;  5M5X H;  2VS1 A;  3T1H L;  4IFD J;  5JEA G;  1YHQ A;  4YWL A;  3S2H H;  4DUY Q;  3K7U C;  2Q2T A;  4J15 A;  1B8A A;  1LYL A;  4DUZ L;  2UXB L;  3CC2 A;  2KHJ A;  2JA5 G;  1HNZ Q;  5C3E H;  4A3M G;  1HNW Q;  5JEA J;  1EFW A;  1TWA H;  4A3G H;  2NN6 G;  4BA2 I;  1VQ6 A;  1D8L A;  4DV4 Q;  4X6A H;  1CUK A;  4POF A;  3CPW A;  1N32 L;  4LF4 L;  4WJ4 A;  1OTC A;  1UEB A;  2OTJ A;  4YCW A;  3W5O A;  1XMQ L;  3NEL A;  1X3E A;  3KOJ A;  2VUM G;  2YU9 H;  4R4I A;  2JA7 G;  3GTK H;  1MJC A;  1PHJ A;  3H3V H;  2MNA A;  2D62 A;  2AKW B;  1FGU A;  4ME3 A;  4DAM A;  3RNU A;  1S72 A;  4JI5 L;  5M3M G;  5LMN L;  1SFO H;  2KBN A;  1VQF A;  4DUY L;  4DV3 Q;  4HIM A;  5DLQ E;  4L5R C;  2JA6 G;  3PCO B;  1N9W A;  4PG3 A;  3S1Q H;  4LFC Q;  1HNZ L;  1HZ9 A;  1G51 A;  2UUB Q;  3E9I A;  2Q2U A;  4P73 A;  2K5N A;  3HOY H;  1XNR Q;  3GTQ H;  3ICE A;  1V1Q A;  1J6Q A;  3A5U A;  4DV4 L;  1N8R C;  2F3I A;  1OXU A;  1Y1V H;  1WCM H;  3RLN A;  5C44 H;  1M90 C;  4DR3 L;  1IBK Q;  4DK3 C;  2ZJQ A;  2C35 B;  4MZ9 A;  2A1A A;  2F4V Q;  3HOX G;  4OX9 L;  4YHH L;  1P8L A;  5J3B A;  1X3F A;  4DKA C;  2K75 A;  1Y1W G;  1E3P A;  4GLV B;  1EYG A;  5M5Y H;  2VQE L;  1HR0 W;  3HOV H;  1K0R A;  3J81 j;  3H3V I;  3U50 C;  2UXD Q;  2CCZ A;  4UP8 A;  3KJP A;  1PYS B;  1FL0 A;  4LFC L;  4A3C G;  3KF6 B;  1LM0 A;  4JI0 Q;  2A19 A;  4BY1 H;  1AE2 A;  1HJP A;  2ID0 A;  1PH5 A;  3S15 H;  1VQC A;  1KD1 C;  2PQA B;  2XTI A;  1XPO A;  2R93 G;  3SGI A;  4DV1 Q;  2R7F A; 
#chains in the Genus database with same CATH topology
 5BR8 Q;  1CZG A;  1IBK L;  4C3J H;  1PYB A;  4R4T A;  3C46 A;  2AQ3 B;  1OXX K;  4P74 A;  4F87 A;  5CMD A;  2UXD L;  4CHT B;  3C1F A;  3RMH A;  4BY1 B;  2HD3 A;  3MHB A;  4N9P A;  4JV5 Q;  5D65 A;  3GTJ H;  2NZO A;  3UDF A;  2MO1 A;  3Q24 A;  3K7A H;  4HIK A;  2EDG A;  4JI1 Q;  3CQZ H;  4DV1 L;  1RHP A;  5BR8 L;  3RUZ A;  5HGQ A;  3B6Y A;  2DGY A;  3G6E A;  4N8F A;  4APV A;  1QVF A;  4JI2 Q;  5LL6 X;  2I5H A;  3DWP A;  3HKZ E;  4C3H H;  2HDL A;  1BDO A;  3OW2 A;  1PH4 A;  4ABN A;  2Z1C A;  1L0W A;  3I4N H;  1LO5 D;  4BWG B;  1IYV A;  5IT9 L;  4IFD H;  4JV5 L;  3UDI A;  1PZI D;  3J7A F;  2L0C A;  3J7A 5;  1GUW A;  1DOK A;  3NTK A;  1PZJ D;  4JI1 L;  3DHQ A;  5IOC A;  4YCV A;  1DOL A;  5AFW A;  2LMC B;  4F7X A;  2NB0 A;  2MPM A;  4BY7 B;  2NN6 H;  4JI2 L;  3I4N G;  1XMQ Q;  4OIJ A;  3K6O A;  5COY A;  5F2D A;  5ELB A;  5D14 A;  2WB1 E;  2IX0 A;  2A69 C;  2RKS A;  1JWS D;  2D0O A;  2M9V A;  5C4Z A;  4X3K A;  4DR2 L;  4JI8 Q;  2EZV A;  4GOP B;  2CKZ B;  3SK6 A;  2NTS A;  2NVY H;  2JA5 B;  3IFD A;  1TS2 A;  2FXQ A;  4OWX B;  3H3V C;  1HTP A;  2PW7 A;  1K83 B;  2ZXR A;  5EAY A;  2L11 A;  1LTS D;  3PF5 A;  2F03 A;  1UEA B;  1XNQ L;  3SDZ A;  1VQ7 A;  1B9N A;  1X65 A;  4CKB A;  4OX9 Q;  1YHB A;  2IWH A;  1R4P B;  2VQE Q;  2B63 G;  4DF7 A;  1RCV D;  1Z7T A;  3C1E A;  4JI8 L;  4RMF A;  5C3E B;  2A5H A;  2ASB A;  4TRD A;  4FF1 A;  1DZ1 A;  4DV0 L;  4DR1 Q;  4FDB A;  2R92 G;  3CCQ A;  1T5E A;  3K81 C;  1CZW A;  2QF7 A;  3OYY A;  3I91 A;  1E7Z A;  5KGU A;  1PH2 A;  4A3C H;  3W1G A;  2HIV A;  4C1N K;  1O78 A;  1EU4 A;  1D6E C;  1MBY A;  1LV9 A;  1VQJ A;  3NBI A;  5DM6 3;  2B3G A;  2GN5 A;  3HOX B;  1A8V A;  5FLM H;  1SE8 A;  4IO9 A;  4HSV A;  2KA7 A;  1QCB D;  1I4X A;  1V1O A;  3RLF A;  2Z8L A;  1IW7 C;  3SVM A;  3PO3 H;  4DR1 L;  1RIP A;  3M7N A;  4DV6 Q;  3IKJ A;  2GVA A;  5C44 B;  3DM1 A;  2B8F A;  2KCN A;  2OEO A;  2HCC A;  4YY3 L;  3RN2 A;  5D3D A;  1GJX A;  3S16 B;  1IZ6 A;  3GTP H;  2JK8 A;  4TKO B;  1EWH A;  3CF5 A;  1VQH A;  2KHS A;  5LMU Q;  1ASZ A;  2HHH Q;  4LF9 Q;  3HKS A;  4EVO A;  1JT8 A;  4GKK Q;  2WAQ B;  1VQL A;  3U4Z A;  3CXC A;  3H94 A;  5IGB A;  3L7Z C;  5IP9 G;  3K5N A;  3PV0 A;  4EQP A;  5IGC A;  1XYI A;  2B29 A;  3J81 i;  4NKL A;  4RWS C;  2JJQ A;  1LTL A;  1SNO A;  2EYP A;  2ZTE A;  3EJI A;  4BA1 I;  4E6I A;  4N9T A;  2WKC A;  4LFA Q;  4A3B H;  1U4L A;  3Q23 A;  2BCO A;  1PYW D;  1PRT D;  4GKJ Q;  2A68 C;  1L1O B;  4FF2 A;  2HHH L;  1I4Q A;  2PMZ B;  2JA8 H;  4JBK A;  4GLX A;  3MEF A;  1TWG B;  3VYU A;  4GOP C;  1E24 A;  4HMI A;  4GKK L;  3PIP A;  1KXL A;  2L1B A;  2VQF Q;  3C2P A;  2H1E A;  4HAE A;  5CV7 A;  1U4P A;  2KCT A;  4LFB L;  5JJZ A;  1W6J A;  4LF5 Q;  4G7H C;  1RTN A;  4Y7N H;  3VR3 A;  4L5S A;  4C3I H;  3K59 A;  1I4P A;  3PUZ A;  4JVZ A;  2SEB D;  3KYH C;  5NUC A;  4DA2 A;  2B2V A;  1SJE D;  2K33 A;  1HZA A;  3S1N H;  1EY5 A;  1JCK B;  1YJN A;  2F3W A;  1CSP A;  1FJG L;  1ZYR D;  1Q86 C;  3I3C A;  1JIC A;  5C0X G;  1FD7 D;  1PFN A;  4IUU A;  4JYA L;  3K58 A;  4LF5 L;  4H13 C;  4HJ7 A;  4OO1 I;  1EIH A;  4A3L H;  5CYU A;  1TY2 A;  3CHB D;  5IY0 A;  1NJI C;  2WP8 J;  4PMW A;  1AW7 A;  3RZD B;  3FP9 A;  2DY7 A;  4BY7 G;  5I9P A;  1UE6 A;  2F52 A;  1L1O A;  2K1B A;  2E2I H;  2KOL A;  4KHZ A;  1EZ6 A;  4JI7 Q;  5EBD A;  2IHF A;  3VR6 A;  2DJG C;  1X56 A;  4NXN Q;  5IP7 H;  4KJN A;  5EBC A;  3J80 i;  1NR2 A;  2WFW A;  3G48 A;  1PV4 A;  1PRT B;  2O4X A;  4NB3 A;  1PH7 A;  1PRT F;  4UHV A;  1EEF D;  1MSH A;  5ISR A;  4AIM A;  2EPB A;  1F2Z A;  5J1Z A;  2UXC Q;  1Y14 B;  5I2X A;  4B3S Q;  4KKT A;  4J8Q A;  4XYO A;  1O7Z A;  1HTL D;  4JI7 L;  4OON A;  1WTP A;  1K8A C;  5C3E G;  1QUQ B;  3I2Z A;  2F0K A;  3D6W A;  1HA5 A;  4A3G G;  1DCZ A;  1JWU D;  5ELF A;  1QZH A;  1X55 A;  1PTO D;  2JN4 A;  1CM9 A;  4GN5 A;  1HNW L;  5G3L F;  3GDE A;  2F1M A;  3D4W A;  4CDC C;  5JJI A;  3PUX A;  4A3I B;  2UXC L;  3QB3 A;  3I55 A;  4RGT A;  3I56 A;  1KLG D;  4B3S L;  4QF4 A;  1VCI A;  4DNR B;  3I4M H;  1K0S A;  2L15 A;  4ZLT F;  3GO5 A;  4KY5 A;  2QEJ C;  1D2B A;  1O80 A;  4HED A;  1FNV A;  5ELC A;  4DV3 L;  4QUF A;  4RHS A;  4NXM Q;  1CKM A;  3D8G A;  4PZ8 A;  1AEX A;  1AH9 A;  4A76 A;  5C44 G;  3DXJ C;  1VQ5 A;  2XSC A;  2GA4 B;  3KDF B;  4WJW A;  1TT2 A;  3EA6 A;  2F0O A;  5J22 A;  3HOV G;  4BXX H;  2Q8T A;  1BXT A;  3V96 A;  2LS0 1;  4X62 Q;  3A54 A;  5IT9 E;  1A3V A;  2XRS D;  3KLS A;  3R93 A;  1SNP A;  3VYS A;  4FF4 A;  1G6P A;  2WAQ G;  1B3A A;  1H9S A;  1YNN D;  1K3R A;  2BH8 A;  2IL8 A;  2N49 A;  1OXV A;  4KV6 A;  3KLS X;  1TII D;  1KLU D;  2EE1 A;  2N8N A;  1CTM A;  4LK1 C;  1V1P B;  4BXX G;  4RAU C;  3BJU A;  1DON A;  1IBL Q;  4GZY C;  1O7L A;  1IKL A;  2P5Z X;  1MGS A;  1HQM C;  3NQT A;  3RR5 A;  3BYY B;  3LX0 A;  3HOU H;  1PTO B;  4DR4 Q;  1Y8P B;  1PTO F;  4HIO A;  1XPU A;  1XJV A;  1KDB A;  3TP6 A;  4DV5 Q;  2AQ1 B;  1VQG A;  3UI2 A;  4JI4 Q;  2WAQ E;  4RGM A;  5EKL A;  2ZTD A;  1X32 A;  1U9R A;  2PI2 A;  3I73 A;  4ZQ3 A;  3M9B A;  1JC7 A;  3SEB A;  1KAA A;  2K5H A;  1H95 A;  1IBL L;  1EYC A;  2CH4 A;  2ZT9 C;  4IUN A;  2DNC A;  3BVM A;  4HJ9 A;  3M4Y A;  4LWC A;  1YIJ A;  4DR5 Q;  2ZJR A;  3D4D A;  4DR4 L;  2VB3 X;  4PMB A;  2PMZ E;  1TWH H;  4ZUI A;  1G91 A;  4DV5 L;  2F0Q A;  4CKC A;  4JI4 L;  3OMG A;  1J5E L;  3KF8 A;  5CBE E;  1H9M A;  2PNR C;  3QO2 A;  5T1G A;  4DUY Q;  3K7U C;  4A3F B;  4DUZ L;  2MUY A;  2KHJ A;  3KBX A;  1HNZ Q;  4YIJ A;  1PDQ A;  5JEA J;  1EFW A;  4BA2 I;  2EYJ A;  1D8L A;  3I90 A;  2A6H D;  1CUK A;  4OEL B;  3GV3 A;  1N32 L;  5M3F B;  4A93 B;  4YCW A;  3W5O A;  4ZK9 B;  3FMC A;  3NEL A;  4HCS A;  5KYI A;  1VMP A;  2XVS A;  4K8I A;  3M7G A;  4K14 A;  2E75 C;  1STG A;  2K05 A;  3MXN A;  1CT1 D;  2F0P A;  1VQF A;  2FFK B;  1TWA B;  5M3M G;  4A3D B;  4DUY L;  5C5L A;  1CI3 M;  5DLQ E;  4HIM A;  4L5R C;  3S1Q H;  1HNZ L;  3E9I A;  4ULL A;  3HOY H;  1XNR Q;  3ICE A;  1V1Q A;  3A5U A;  2YU9 B;  4XT1 B;  3DEP A;  1WCM H;  3J7A V;  3ITP A;  2A1A A;  4CJ1 B;  4YHH L;  1A6X A;  5J3B A;  1SMY D;  3K5O A;  3H0G B;  4EGV A;  3H3V I;  3HG9 A;  4V0B A;  3BG3 A;  1HHV A;  5JPN C;  3QJY A;  3T4A C;  5D3I B;  2B2Y A;  2ID0 A;  1RTO A;  2Z4I A;  1AZP A;  3S15 H;  2XTI A;  2R93 G;  5HUR A;  2D2C C;  4DV7 Q;  1PTO C;  5C6A A;  2BDN A;  2AWO A;  3BZD B;  2L5T A;  5DM7 3;  1Z9F A;  4A3K H;  2ATW A;  3HRZ C;  4LUO A;  3T1Y Q;  1HR0 L;  5FKA C;  1EQR A;  3TBI B;  1PH1 A;  5C4X G;  3KK7 A;  3TS0 A;  1YHA A;  1GUS A;  2RCF A;  1G2T A;  1LTI D;  4AYB B;  4DV7 L;  1QB5 D;  3BS1 A;  1LT5 D;  4A4I A;  3K8A A;  3HOW H;  2Z9H A;  4R4C A;  1S5F D;  2PI2 E;  4JC0 A;  3CQZ B;  5EKI A;  2F0J A;  4A3J B;  3HOZ B;  3C3L A;  1BNZ A;  5CC4 A;  4RG1 A;  1FNU A;  1S5C D;  5GAH C;  3UE1 A;  1V8Q A;  3CCV A;  4DAV A;  1XTD A;  1KL9 A;  4GN3 B;  2LFN A;  2EYL A;  1K9M C;  3S2D H;  2CH4 W;  4DFA A;  4UP9 A;  3U9S A;  1Q8K A;  1ILQ A;  3AFQ A;  3S17 B;  2L9H A;  1E2W A;  4KD4 A;  3GV6 A;  1FR3 A;  5I2Y A;  3W1B A;  1II3 A;  1XXG A;  3CCM A;  1Q7Y C;  1KDC A;  3L9A X;  1NTG A;  2VUM H;  1EYA A;  4OO1 G;  1SE3 A;  4PMC A;  3ERS X;  5LMN Q;  1B50 A;  3NHH A;  1WOC A;  4I65 A;  1EQQ A;  4A3M B;  5JVH 3;  1GXD C;  1OXS C;  2JA6 H;  1EFI D;  1CKN A;  3TP7 A;  5K36 G;  1I50 B;  1ILP A;  3LWE A;  4ZKB B;  3CU7 A;  1IXR A;  1BF4 A;  1BQQ T;  1IW7 D;  2JEA I;  3S2H B;  4Q0F A;  4XT3 B;  1J8I A;  2K4K A;  3HZX A;  2NVY B;  5DEH A;  2F3V A;  3E5S A;  4A3F G;  3D0F A;  1SBB B;  2OT2 A;  2F0W A;  5FO8 B;  5IT9 c;  2G5D A;  1UAP A;  5CBA E;  4BBS G;  1Q90 A;  4DAY A;  1XMO L;  1LTR D;  1CSQ A;  2XN9 C;  5M3F G;  4QJF A;  2XIW A;  3I4O A;  1TVX A;  4A3E H;  4JBM A;  2O5J C;  4P71 A;  3TRZ A;  1B7Y B;  2A6H C;  2BH2 A;  1V43 A;  3J81 L;  4ZKC B;  1R9T H;  5LL6 S;  4LMQ D;  4XQJ A;  1JE4 A;  1C4Q A;  3NBH B;  4DNI A;  4K5W A;  2SOB A;  3CCS A;  2HQE A;  1B53 A;  2KEC A;  4DR7 Q;  5JAV A;  1D7Q A;  5J39 A;  4A3E G;  2K50 A;  3BU2 A;  3M3Y H;  1GD7 A;  1BCP D;  4QGU A;  4OGQ C;  3A56 A;  2J0T D;  2E2H H;  1Z6H A;  3HKZ G;  3H0G G;  3G71 A;  3QG1 A;  1DD2 A;  1EY4 A;  5ELD A;  1EIG A;  2GVB A;  2JXM B;  1SMY C;  2NUC A;  2K6A A;  3GTP B;  1PZK D;  2M00 A;  4DR7 L;  3CCR A;  3NWS A;  1YJW A;  1ZKO A;  2MHV A;  3PSI A;  2E2J H;  1QE6 A;  2HIX A;  5DNF A;  1RL2 A;  3VYR A;  5AJ3 Q;  1I6H H;  4XIG S;  3TDQ A;  3DWA A;  1JMC A;  2KCC A;  2WB1 G;  3FPP A;  3TN2 A;  1IHZ A;  3CRL C;  2KUM A;  4O2D A;  1QVG A;  4O0A A;  3NBH A;  4WOR A;  2VL6 A;  4DR2 Q;  3T53 B;  4IPH A;  3KF6 A;  2Q2I A;  3SK4 A;  1STB A;  2KVM A;  1BOS A;  2WV6 D;  5JPM C;  2XWB B;  4AYB G;  2SNS A;  1X9N A;  2PQA A;  1SSO A;  1VQK A;  3OPO A;  5AJ3 L;  3J80 L;  3BDC A;  5GRO A;  1XNQ Q;  4MTK A;  4KKS A;  4RKL A;  4B3M L;  2F0M A;  1BCP B;  4OIK A;  3SK8 A;  1BCP F;  4A3J G;  3HOZ G;  3S1M H;  4L8J A;  3S14 H;  4X64 L;  1X3P A;  4C3I B;  3GTO H;  2DNE A;  2KJX A;  1I4G A;  3P20 A;  4DV0 Q;  2B63 H;  1Q12 A;  2YTX A;  3TEH B;  5C0X J;  1RJT A;  4AYB E;  2JE6 I;  4PQX A;  3S1N B;  4XTC S;  2UUA L;  2R92 H;  4FXK C;  1F9S A;  1M1K C;  3PUW A;  5IGE A;  4KK7 A;  2M2L A;  2Z0S A;  1CKO A;  1JR0 D;  4ZUJ A;  4Q5V A;  4K0K Q;  2EYH A;  2JA7 B;  4B3R L;  1D1I A;  3BDL A;  3QIA A;  1VQN A;  4O1N A;  1SYF A;  1A2T A;  1A2U A;  2NYZ D;  4G7O C;  3AQQ A;  1ENA A;  2F0L A;  4BBR G;  2ZJP A;  4L5Q A;  2E2I B;  1KIX A;  3CP0 A;  4YY3 Q;  3FVQ A;  3E0J A;  1S4Z A;  2OWO A;  4K0K L;  3GTG B;  1MJE A;  4JPB W;  1Y1W B;  3EFX D;  3CCE A;  2RA4 A;  4GNX B;  3R2I A;  1IYJ B;  3NK9 A;  2R7Z B;  4H7B A;  4OWT B;  3I72 A;  4GOP A;  3AMU A;  4IUT A;  1KNA A;  1TWF B;  1WTR A;  2TMP A;  2J7Z A;  5A2Q L;  5IP9 H;  2RHS B;  1VQD A;  3AB9 A;  4B3T Q;  3FRP B;  1Q8I A;  3PUY A;  2QEX A;  5C4J B;  1DJR D;  4M8A A;  1VMC A;  3MZ5 A;  3BZC A;  1HA6 A;  2RVL A;  1EWC A;  4HCE A;  1Q3L A;  2ES2 A;  1UWV A;  4JK1 C;  3GTM B;  1Y1V G;  2UUB L;  2F0E A;  2ALY B;  1NMF A;  3ND8 A;  4LFB Q;  3K0Y A;  4JBW A;  1N34 Q;  1HZC A;  2L12 A;  1LAC A;  4B3T L;  3F2B A;  2HUG A;  4ZYS A;  2CFM A;  1IBM Q;  2H5X A;  2ZXP A;  2Y0S B;  2SDF A;  1BCP C;  4LF6 Q;  2DY8 A;  4OHJ A;  3A8I E;  3CCL A;  1SLJ A;  2L55 A;  1A3T A;  4BY1 G;  3JAM i;  3PO2 B;  1FJG Q;  2AHO B;  3GD7 A;  3S9W A;  4JI0 L;  2NVQ B;  1STH A;  2VY3 A;  1B70 B;  1TWC B;  4JYA Q;  1LTA D;  2X69 A;  3HGB A;  1N34 L;  4EQO A;  5C0X H;  1HUN A;  5TSS A;  1HCZ A;  4JI3 L;  2B39 A;  3MFG A;  1IBM L;  1WTO A;  4LUZ A;  1DOM A;  5G3L D;  1W3S A;  3TP5 A;  2WIN B;  4OEM B;  1F9Q A;  4LF6 L;  4BY7 H;  4K5V A;  5KEE A;  2NBF A;  4KHP L;  1U5K A;  1K8O A;  1HNX L;  3T1H Q;  1HZB A;  1SNM A;  5IYB G;  3T13 A;  2AQ2 B;  3HOU B;  2YTV A;  3IFT A;  1SXT A;  1I3Q H;  2FMC A;  3NEN A;  3V05 A;  4G7Z C;  1OO9 B;  1K83 H;  4GNX C;  1JQY D;  5LMN W;  5EPJ A;  4DR6 L;  4QIW B;  2I5L X;  4JI5 Q;  5GQO A;  2VS1 A;  3H91 A;  3T1H L;  1LT3 D;  2Q2T A;  4J15 A;  1B8A A;  1LYL A;  5EGT A;  4F88 A;  2JA5 G;  3CC2 A;  5M5W B;  5C3E H;  4U67 3;  1HNW Q;  4A3G H;  3NSW A;  5IGG A;  5E4W C;  1VQ6 A;  3FKI B;  2DN8 A;  3SR1 A;  1TWH B;  3RD4 A;  4C2M B;  4POF A;  1AZQ A;  2QW7 A;  3OMC A;  1OTC A;  1UEB A;  2OTJ A;  1QWY A;  3J81 E;  1X3E A;  1XX8 A;  3RZO B;  1O7Y A;  2JA7 G;  2PZU A;  4WRD A;  1PHJ A;  2MNA A;  2L4N A;  2NZ1 D;  4ME3 A;  5CV9 A;  4DAM A;  4JI5 L;  2KBN A;  4DV3 Q;  4PG3 A;  1N9W A;  4LFC Q;  1HZ9 A;  3GTQ H;  1J6Q A;  4F8M A;  5CGK A;  2B2V C;  3RLN A;  5C44 H;  3MXP A;  1GOZ A;  4DR3 L;  3F2U A;  4M1U B;  2ZJQ A;  3EQL C;  2C35 B;  3HEJ A;  3HOX G;  1P8L A;  1AFP A;  1Y1W G;  5KNC A;  4CBV A;  3HOV H;  3NXW A;  2VXW A;  3V2T A;  3VA7 A;  5L37 A;  3T16 A;  1YNJ D;  4FVM A;  4DNT B;  3URY A;  1PLF A;  4TSS A;  4LFC L;  1WCM B;  1PH5 A;  1XPO A;  4KHV A;  4X3U A;  2EJG C;  1X54 A;  3I8Z A;  3VR4 A;  3M4O H;  1E2V A;  4UAI A;  2I0Q A;  1K8M A;  2E8G A;  5KND A;  1QUQ A;  1JB7 A;  1A3U A;  2G9D A;  3L0O A;  2F0I A;  1QIL A;  5KNB A;  2AWN A;  1PH8 A;  3J80 E;  2ENB A;  3TSS A;  2HDM A;  4GLA C;  1NNX A;  4A3K B;  4B9X A;  1MIU A;  2A74 C;  3ONA B;  1NE3 A;  1TS3 A;  5FJ8 G;  2Y0S G;  2K52 A;  4NMZ A;  3MTS A;  1J5E Q;  4I7A A;  2LXK A;  1OXT A;  4Y52 H;  2DUD A;  3BDO A;  5FLX L;  4RGO S;  2PW5 A;  4KD3 A;  4RH6 A;  5DAU A;  3D4R A;  4A75 A;  4HN7 A;  4DUZ Q;  3L2P A;  3PMF A;  3KDF A;  2QGQ A;  2EJM A;  1KRS A;  2LKV A;  4TQU S;  3STB D;  4DN4 M;  1DM0 B;  3KLR A;  1ET6 A;  4MHE A;  1N32 Q;  1BO0 A;  2JEB I;  3TS2 A;  1WI5 A;  4CKE A;  2WII B;  2Y0S E;  4GN4 B;  4S3S A;  3W3A A;  1EY6 A;  1DXM A;  1S3O A;  2IHE A;  1I6V C;  2IW3 A;  4IFD I;  4XQQ A;  3S2D B;  4LF8 L;  1VQI A;  2A73 B;  3H6M A;  4OL7 A;  3SXH A;  4YWK A;  5M3M H;  1V1P A;  2CWP A;  1SJH D;  2QCP X;  4RFB A;  2JP1 A;  1YBY A;  2R3Z A;  2D9U A;  2NN6 I;  4DPG A;  5E3F A;  4YHH Q;  3K5M A;  1CQF A;  4RA8 A;  3J7Y W;  4KKU A;  1K8G A;  5BN5 A;  5IWA L;  1QJO A;  2EOT A;  5A2Q E;  4BS9 A;  3F1Z A;  1BKB A;  3KJO A;  5CV8 A;  3PF4 A;  3FKI G;  3E9H A;  2XNA C;  5COR A;  1C0A A;  4IUQ A;  1L0Y B;  1YNX A;  2OCE A;  1LT6 D;  1D5Z C;  1PA6 A;  4FP5 D;  4A3I H;  3IL8 A;  3WOE A;  2R93 H;  3WDN A;  4G4K A;  1AP0 A;  2F0T A;  4QY7 A;  1J9O A;  1W2B A;  4QIW E;  2O5I C;  1RDP D;  1YJ9 A;  1C7Y A;  1Z47 A;  3R8B A;  1HR0 Q;  3TRE A;  5M9O A;  3CRK C;  5I9O A;  1G2S A;  3MWY W;  3ULL A;  2EYO A;  1VQ9 A;  1E0B A;  2OTL A;  4IOC A;  4DXG A;  1GO3 E;  4A3I G;  3CW2 C;  5C4H A;  1EIY B;  5C4X H;  2PCF B;  5C5M A;  2R7D A;  5M5Y B;  2B2U A;  5IYC G;  2OQ0 A;  4JCV E;  1XTC D;  2DJF C;  1JOR A;  4NDX A;  1L0X B;  3A74 A;  1KNE A;  1JOK A;  3SK5 A;  2B2W C;  3LGJ A;  4HJA A;  2OXP A;  2O2L D;  1VQ4 A;  3M3Y B;  3QOJ A;  5HGT A;  2JYO A;  4R4Q A;  1DYQ A;  2E2H B;  4X66 L;  4C3J B;  3ZJY C;  1VQE A;  1YNJ C;  3CC7 A;  1BVS A;  1QOH A;  3MFY A;  3A7L A;  3OW7 A;  3UE0 A;  1F9P A;  2E76 C;  1BBW A;  3CME A;  1EY7 A;  1B2T A;  1I94 Q;  4JOI C;  3GTJ B;  1EU3 A;  1VQO A;  3OTO Q;  1KHI A;  1LAB A;  3FPU B;  5BN4 A;  3TME A;  3I4L A;  3PIP 3;  3K7A B;  4LF7 Q;  3MA2 B;  3J81 c;  4WJ3 M;  1M4V A;  3DMU A;  1VQM A;  1ONL A;  1CHQ D;  4OO1 H;  1I6H B;  1BBU A;  5IYD G;  4C3H B;  1HFG A;  1STY A;  3I4N B;  2R61 A;  2CQO A;  1I94 L;  4IN3 A;  5K36 H;  4OWW B;  1VF7 A;  3OTO L;  5H1S E;  2PZT A;  4H44 C;  4LF7 L;  1MHW C;  1C8C A;  1U4R A;  3F2D A;  3T51 B;  5E1F A;  4FXD A;  1F2L A;  1G29 1;  4JG2 A;  2NVX H;  5KYL A;  1B1Z A;  2V4D A;  4A3F H;  2D0P A;  1XMO Q;  1XWE A;  5FO7 B;  4BBS H;  2EVB A;  3E6Z X;  2I5M X;  3G4S A;  4QCL A;  1C9O A;  4J6H A;  1WJJ A;  2YYZ A;  5M3F H;  2VB2 X;  1S40 A;  3GTO B;  4A93 H;  4DV2 Q;  1MSG A;  3STB C;  4RCO A;  3BZK A;  2B63 B;  1KRT A;  1Q81 C;  1JJC B;  4KY6 A;  1PFB A;  3OHX C;  5KRU A;  2BA0 A;  4H02 A;  4CGY B;  3Q0A A;  3OIP A;  3CPF A;  2R92 B;  1C48 A;  4A3D H;  3UDG A;  2QDL A;  1FYC A;  4KI0 A;  3NQI A;  4QB4 A;  2N78 A;  1SAP A;  2K01 A;  5C3W A;  4DK1 A;  1G8Z D;  4A93 G;  1PXU A;  2EY1 A;  1U0L A;  3NTI A;  1YI2 A;  2PQE A;  1GUN A;  1PH9 A;  1M8A A;  1HUM A;  2Z6K C;  3J80 c;  3M85 A;  4DV2 L;  4L6T B;  2IPK D;  4A3D G;  1VQA A;  4EQN A;  1TS5 A;  1K73 C;  3H0G H;  1SE4 A;  1WTX A;  4TVA B;  2PNH A;  3A0J A;  3T56 B;  3ULP A;  3MXG A;  1VDZ A;  4KJO A;  2E74 C;  1SN8 A;  3OIQ A;  3JAM L;  1EY8 A;  2AUK A;  2K04 A;  2R6G A;  1WFQ A;  4IOA A;  2LXJ A;  1FVI A;  3D3R A;  1UE7 A;  1W6K A;  2K28 A;  3PO3 B;  2NVT H;  1Q46 A;  4KTA A;  4H0L C;  3ULJ A;  2CQA A;  2D5D A;  1X3G A;  2Z4H A;  1WD0 A;  3CKI B;  4IJL A;  2EYF A;  3U4V A;  2EYM A;  2YTY A;  1WTV A;  4KLK A;  4KMU C;  4IJH A;  2FJ2 A;  4PZ7 A;  2F4V L;  2ZXO A;  5HY6 A;  1GUT A;  4DK0 A;  5FLX E;  1SND A;  5FK9 C;  3RLO A;  4OXP A;  2B2T C;  3N6R A;  1SYB A;  3F8T A;  3AU7 A;  1I5F A;  1YZ6 A;  2OQK A;  5C3X A;  4B3M Q;  3EIV A;  2K32 A;  5LHY 1;  1H9J A;  1JJ2 A;  3S1R H;  4X64 Q;  3D6C A;  1S5E D;  4C3J G;  4A3B B;  2ZTC A;  4A3J H;  3HOZ H;  1IL2 A;  4IPG A;  1SRU A;  2RDF A;  2PYK A;  1GHK A;  2JA8 B;  3HFZ B;  2B8G A;  2UUA Q;  1BUV T;  3LWU A;  1F2M A;  3DUZ A;  1Q1E A;  3M4P A;  4RKB A;  2N3S A;  3S17 H;  4B3R Q;  3VYT A;  4FNF A;  4Y7N B;  2C5C A;  4AH6 A;  3AFP A;  2JSO A;  4YCU A;  3P1H A;  2X6G A;  3GTL H;  2KCM A;  1EY9 A;  1V9P A;  3MXU A;  1ASY A;  1GKH A;  1Q1B A;  4EX5 A;  2RDH A;  4HMJ A;  1KAW A;  4JBJ A;  1K3B C;  1K28 A;  4C3H G;  4DU9 A;  3PUV A;  4IZ8 A;  3BYT B;  4A3M H;  4LF4 Q;  4IUV A;  2H4O A;  3Q22 A;  4HJ8 A;  4BBR H;  3U58 A;  4IFD G;  1I50 H;  3QOL A;  1A0I A;  2NTT A;  1TU2 B;  4XYQ A;  1P16 A;  2E2D C;  5CV6 A;  5M5X H;  4K5X A;  2IJ0 A;  4YWL A;  3S2H H;  1I3Q B;  1EQV A;  3SE0 A;  2ICE C;  2K5Q A;  4A3M G;  5EPK A;  3TP8 A;  1EL0 A;  2NN6 G;  4R8N A;  1U4M A;  5I6Y A;  4DV4 Q;  4Z9C B;  3K5L A;  4LF4 L;  3A55 A;  2Z6B A;  1CHP D;  1XMQ L;  3KBG A;  3KOJ A;  4HR7 B;  3MEH A;  4R4I A;  4KN7 C;  1MJC A;  4QMG A;  3GTK H;  3H3V H;  2D62 A;  4UDU C;  4NW2 A;  1LTG D;  4O42 A;  1S72 A;  1SFO H;  4A3G B;  1I4H A;  1RKN A;  2EY2 A;  4QUC A;  1G51 A;  1WTH A;  3KUP A;  1FGB D;  2UUB Q;  2K5N A;  4ODG A;  4DV4 L;  5FOB B;  2F3I A;  1OXU A;  1Y1V H;  2XRQ D;  1M90 C;  1CQV A;  4DK3 C;  1PFM A;  2F0V A;  3O13 A;  1EY0 A;  1D5M C;  2BE5 D;  4OX9 L;  2PZW A;  1B4O A;  1EOT A;  2VQE L;  2RBM A;  1HR0 W;  1QG7 A;  1GUO A;  1K0R A;  3MC0 B;  3J81 j;  3U50 C;  3KJP A;  1PYS B;  4C1N I;  3P75 A;  3GTQ B;  1CA5 A;  3I70 A;  1BBX C;  1FL0 A;  4K6L A;  4A3C G;  4JI0 Q;  2A19 A;  4BY1 H;  1HJP A;  1PMR A;  3A8J E;  1VQC A;  4CJ2 C;  3SGI A;  2R7F A;  3HOV B;  1LTB D;  4K2L A;  2A6E D;  3I4M B;  5FLM G;  2KEN A;  4DAP A;  1MKH A;  4JI3 Q;  2CW0 D;  4QQB X;  1YEZ A;  1WYD A;  1Y8N B;  1STA A;  3PO3 G;  3GP7 A;  1KTK A;  3UDX A;  1SMX A;  4P75 A;  3GQB A;  4GNX A;  4KHP Q;  4DV6 L;  3K80 C;  1HNX Q;  2RQX A;  4MNO A;  1TS4 A;  4ME5 A;  3NWT A;  4RGN A;  1MI2 A;  3M4O B;  1D1K A;  1SRO A;  2F0D A;  3HP3 A;  5IYB H;  1KQS A;  2IY5 B;  1ESR A;  5KIX A;  3ER0 A;  5LMU L;  4X3T A;  1UE1 A;  4K2K A;  4LF9 L;  1QZG A;  1E2Z A;  4X65 Q;  4K6D A;  5I4D A;  3NTH A;  2F0G A;  4DR6 Q;  4XDX A;  4RCN A;  2RSO A;  1QNU A;  1Y8O B;  4A3B G;  5IIF A;  5A35 A;  3R2T A;  1N36 Q;  4LFA L;  3CAM A;  1VS0 A;  3MVV A;  4DXF A;  2JA8 G;  4GKJ L;  2JA5 H;  4LAA A;  4C56 C;  5JJL A;  4HSP A;  1NR4 A;  4X65 L;  5IE8 A;  1A15 A;  5IGD A;  1NSN S;  2VZA A;  2VQF L;  1Q82 C;  1F9R A;  3A7A B;  1TXY A;  2E5L Q;  2MO0 A;  2JA7 H;  1T5X D;  4C3I G;  1LT4 D;  1CK1 A;  1YVC A;  2BOS A;  3VR2 A;  4R9W A;  4ID6 A;  1N36 L;  1NAP A;  5GAG C;  4B9W A;  1EYD A;  5EPL A;  4JI6 Q;  4NPS A;  3TZU A;  4DR3 Q;  2RCN A;  1SE2 A;  2K7V A;  4HID A;  1ZXT A;  4G57 A;  1H9K A;  2CWA A;  3X3N A;  3QWN A;  2UU9 Q;  1EEI D;  1X3Q A;  4HJ5 A;  1JJG A;  5M3M B;  3GTG H;  3HOX H;  1ROD A;  2MFI A;  2E5L L;  1PVO A;  1Y1W H;  3H09 A;  4A3L G;  1HH2 P;  1LTT D;  5FLX c;  4CDE C;  3JAM E;  1IYU A;  1ICF B;  4X3S A;  1RD9 D;  2V1C C;  2R7Z H;  3R3O A;  1LUZ A;  4XQN A;  2BA1 A;  1O7I A;  1KDA A;  1TWF H;  3JC6 6;  1HQR D;  5E4X A;  5E7N A;  5GAD C;  4JI6 L;  3AYH B;  5EKK A;  3P7J A;  4CDD C;  5IP7 G;  1LLR D;  3S16 H;  4POG A;  2K03 A;  2UU9 L;  4R8I A;  1H9S B;  3S1Q B;  1JOO A;  4NXN L;  3K57 A;  3NUC A;  3PIO A;  2A8V A;  1F2Y A;  3OWF A;  5C4J H;  2EY6 A;  4L63 B;  3HOY B;  2R7Z G;  3PGZ A;  1JE5 A;  3S24 A;  5ELN A;  2FMM A;  3IRB A;  2NZH A;  1ML0 D;  2Q2H A;  1L1O C;  2R93 B;  4IQZ A;  4WFN 3;  3GTM H;  4MN3 A;  4IPD A;  1UE5 A;  2HT1 A;  3DEO A;  2PO4 A;  3WOF A;  2HCI A;  3ZYY X;  5CV5 A;  2VNU D;  3CCJ A;  1HFN A;  4ILW A;  1KAB A;  4XXE A;  5FJ8 H;  3WWV A;  2XWJ B;  3S15 B;  2RF4 A;  3J7Z C;  2BE5 C;  1Y69 U;  2MGS A;  5C4X B;  1TWG H;  3EVQ A;  3PO2 H;  2NVQ H;  5JOB A;  3EN2 A;  3I4M G;  1TWC H;  4PNY A;  2F4I A;  1EZ8 A;  3CCU A;  5ELO A;  1PH6 A;  1PFS A;  5ELE A;  4FYD A;  3D31 A;  2I46 A;  2A6E C;  4NXM L;  3KF8 B;  3DM3 A;  3ERQ A;  1B9M A;  1JB3 A;  2CW0 C;  3PO2 G;  3OWE B;  2PPB C;  1SEB D;  3G7L A;  3U9O A;  3NPP A;  3AEV A;  4ZRZ A;  2XGT A;  1GM5 A;  4LF8 Q;  2F0F A;  2K5D A;  2EQS A;  3HOW B;  1GVP A;  2QDB A;  3BVZ A;  2JA9 A;  3LNN A;  1RF2 D;  2UUC Q;  4IUP A;  2RDG A;  4ZAI A;  5GAE C;  4X62 L;  3FHW A;  3M4Q A;  1STE A;  1T9H A;  4ZCK A;  1XPR A;  2VW9 A;  3RZD H;  4P72 A;  1PRT C;  3A5Z B;  3MXN B;  1NCV A;  5IWA Q;  4P2C B;  1GUG A;  1NY4 A;  4YWM A;  4UP7 A;  2F0N A;  1HPC A;  4QL5 A;  3F2C A;  3K0X A;  4L5T A;  3HOU G;  2N88 A;  1AN8 A;  1X6O A;  2UUC L;  1HRJ A;  5M5W H;  3RN5 A;  3FKI H;  4EQ5 A;  1NBW A;  3FEW X;  4C2M H;  2VUM B;  1WTQ A;  1R4Q B;  1N33 Q;  2QA4 A;  2NVX B;  5JJK A;  4IUR A;  3RZO H;  4LW1 A;  2K5V A;  5CV4 A;  1MD2 D;  5IOD A;  2FIN B;  2JA6 B;  2B2W A;  3BVG A;  3Q8D A;  4BBS B;  1KC8 C;  1ZYR C;  5CR3 A;  2K14 A;  2WAC A;  4R4O A;  4UY8 C;  2ICI A;  2MQH A;  5T1I A;  4CJ0 B;  4LUV A;  1EOV A;  2C9O A;  2IX3 A;  3CMA A;  1EWI A;  3DLL A;  4DR5 L;  4AQY Q;  3I7F A;  3E0E A;  4UPA A;  4V19 0;  4U68 A;  2TSS A;  1UNS A;  1G6Z A;  3MAQ A;  1N33 L;  1VF5 C;  1S5D D;  5IYC H;  4JOI A;  1HXY D;  1EQT A;  1QNK A;  1TR5 A;  1FNW A;  2JQO A;  3EBE A;  4RHR A;  2K5W A;  2YV5 A;  3CC4 A;  1WD1 A;  3ERO A;  1E1T A;  1E22 A;  4A3E B;  4X66 Q;  2Q8R E;  3VDY A;  4DK6 C;  1CA6 A;  1VQB A;  4HTH A;  4AQY L;  4IPC A;  1R9T B;  3H15 A;  5K5P A;  2OF1 A;  3HKZ B;  3KLW A;  2RSN A;  1PH3 A;  3HOY G;  2EXD A;  2F0S A;  1H9R A;  4K8J A;  2HQL A;  1E1O A;  1L2F A;  4LNQ A;  2ZM6 Q;  1WCM G;  1ENC A;  1XNR L;  2NWG A;  2KEE A;  4KN4 C;  1AE3 A;  3TQY A;  2EJF C;  3N52 A;  1ICW A;  1B44 D;  2NVT B;  3SHL A;  4FO2 A;  3OSO A;  3E3X A;  3CD6 A;  5IYD H;  3L3O C;  1F77 A;  2KHI A;  2WB1 B;  1DGS A;  1JWM D;  1A62 A;  1WVL A;  1EIF A;  4PV1 C;  1PTO H;  3A8K E;  2AMC B;  2F0U A;  2MP1 A;  4IAL A;  4JW0 A;  3KFU A;  1SNQ A;  4FXG C;  5I6W A;  2ZM6 L;  2E2J B;  3NEM A;  5FO9 B;  4GS3 A;  1VQ8 A;  1CKN B;  2A69 D;  4A3K G;  2BDO A;  2FHT A;  1EUJ A;  1NUC A;  4R1J A;  4PZ6 A;  4DGZ A;  1ESF A;  1JOQ A;  2EIF A;  2QIL A;  1SR3 A;  4CDF C;  3JAM c;  2LSS A;  1D5X C;  2RHQ B;  1WTW A;  1A63 A;  2MJ8 A;  3T1Y L;  1ET9 A;  3S1R B;  3NE5 B;  2B2Y C;  1SYD A;  2Z6K A;  1ZEQ X;  1IL8 A;  3FDT A;  2UXB Q;  1YNN C;  4B08 A;  4DAY B;  5JEA H;  2B2U C;  3HOW G;  3IAY A;  5C0X I;  2EY5 A;  1IKM A;  1UUP A;  1GHJ A;  1B3Q A;  2IT1 A;  1VQP A;  4MTN A;  1YIT A;  1SNC A;  1STN A;  1TY0 A;  4ALP A;  3W2D A;  5IGF A;  4J1M A;  3S1M B;  3S14 B;  1QVC A;  2IX1 A;  3GTL B;  1NMG A;  2QKI C;  2N55 A;  4LJZ C;  4IFD J;  2F0H A;  5JEA G;  1YHQ A;  3X3M A;  3HS0 C;  4FF3 A;  2UXB L;  3VR5 A;  4BBR B;  1SYE A;  1TWA H;  3DWQ A;  2WKD A;  3NP8 A;  4X6A H;  1S5B D;  3CPW A;  1SYC A;  5EQ0 A;  4WJ4 A;  5JVG 3;  1I4R A;  2SNM A;  5M5X B;  2VUM G;  2YU9 H;  4MIU A;  5EJW A;  2AKW B;  1FGU A;  3RNU A;  3G6J B;  5LMN L;  2B2T A;  3ND9 A;  2JA6 G;  1BR9 A;  3PCO B;  1SYG A;  3TZD A;  1ENF A;  2AUJ D;  5BN3 A;  2CVR A;  2EXZ A;  2Q2U A;  4P73 A;  2KED A;  4N8X 1;  1N8R C;  3PQI A;  3GTK B;  2Q8I B;  2X6L A;  1IBK Q;  4MZ9 A;  1SFO B;  2F4V Q;  2J4X A;  4DKA C;  1X3F A;  2K75 A;  1EYG A;  1E3P A;  4GLV B;  5M5Y H;  3Q6S A;  4NP5 A;  2UXD Q;  2KQ3 A;  1TKW B;  1CFM A;  3PIO 3;  2CHB D;  2G9H D;  4KY7 A;  4UP8 A;  2CCZ A;  1SDF A;  3KF6 B;  1LM0 A;  3QR8 A;  3VA5 A;  1Y1V B;  1AE2 A;  2A68 D;  4I7Z C;  1TQO A;  2I07 B;  1KD1 C;  2PQA B;  3OOC A;  4DV1 Q;  2LY7 A; 
#chains in the Genus database with same CATH homology
 5BR8 Q;  4DV7 Q;  1IBK L;  5FLM G;  4C3J H;  2KEN A;  1MKH A;  4JI3 Q;  1PYB A;  4QQB X;  1X54 A;  2AWO A;  4R4T A;  1YEZ A;  3M4O H;  1WYD A;  2I0Q A;  3PO3 G;  1OXX K;  1Z9F A;  4A3K H;  2ATW A;  2E8G A;  4P74 A;  2UXD L;  4LUO A;  3UDX A;  3T1Y Q;  1SMX A;  1HR0 L;  4P75 A;  1QUQ A;  4GNX A;  1JB7 A;  3L0O A;  4DV6 L;  3K80 C;  4JV5 Q;  4KHP Q;  1HNX Q;  3GTJ H;  1EQR A;  2NZO A;  3UDF A;  1PH1 A;  4MNO A;  5C4X G;  2MO1 A;  3K7A H;  4HIK A;  3TS0 A;  2AWN A;  1YHA A;  4JI1 Q;  1PH8 A;  3CQZ H;  1SRO A;  5IYB H;  4GLA C;  4DV1 L;  5BR8 L;  4DV7 L;  1KQS A;  5HGQ A;  3B6Y A;  2DGY A;  3G6E A;  4APV A;  4A4I A;  3ER0 A;  1MIU A;  3K8A A;  1QVF A;  1NE3 A;  5LMU L;  3HOW H;  1UE1 A;  2Y0S G;  4JI2 Q;  5FJ8 G;  4LF9 L;  2I5H A;  3HKZ E;  1QZG A;  4C3H H;  4X65 Q;  2K52 A;  4R4C A;  3OW2 A;  1PH4 A;  1L0W A;  3I4N H;  4DR6 Q;  1J5E Q;  2PI2 E;  4JC0 A;  2LXK A;  1OXT A;  4Y52 H;  2DUD A;  4JV5 L;  3UDI A;  3J7A 5;  4RG1 A;  4A75 A;  4A3B G;  5GAH C;  3UE1 A;  4DUZ Q;  3L2P A;  4JI1 L;  3CCV A;  1XTD A;  3KDF A;  1N36 Q;  2QGQ A;  4YCV A;  4LFA L;  1KL9 A;  1KRS A;  3CAM A;  1VS0 A;  4GN3 B;  2JA8 G;  4TQU S;  3STB D;  1K9M C;  3S2D H;  2JA5 H;  4GKJ L;  1N32 Q;  2JEB I;  4UP9 A;  3TS2 A;  1Q8K A;  4JI2 L;  3AFQ A;  1WI5 A;  3I4N G;  1XMQ Q;  5JJL A;  2Y0S E;  4X65 L;  5IE8 A;  4GN4 B;  2WB1 E;  2IX0 A;  3W1B A;  1S3O A;  2D0O A;  3CCM A;  2VZA A;  1Q7Y C;  4OO1 G;  1NTG A;  2VQF L;  2IHE A;  4JI8 Q;  4DR2 L;  1Q82 C;  5LMN Q;  3ERS X;  2E5L Q;  1TXY A;  2VUM H;  2MO0 A;  4GOP B;  1WOC A;  2JA7 H;  4IFD I;  2CKZ B;  2NVY H;  1EQQ A;  4LF8 L;  1VQI A;  4YWK A;  1YVC A;  5M3M H;  2CWP A;  2FXQ A;  4OWX B;  1N36 L;  1OXS C;  2JA6 H;  1CKN A;  5K36 G;  5GAG C;  1YBY A;  5EAY A;  4JI6 Q;  4NPS A;  3PF5 A;  4DR3 Q;  2RCN A;  1IXR A;  2NN6 I;  1XNQ L;  4HID A;  4DPG A;  1VQ7 A;  1X65 A;  4OX9 Q;  2JEA I;  4YHH Q;  2CWA A;  2K4K A;  1YHB A;  2UU9 Q;  2VQE Q;  2B63 G;  1K8G A;  4HJ5 A;  1JJG A;  5IWA L;  4JI8 L;  4RMF A;  3GTG H;  3HOX H;  2E5L L;  2MFI A;  1PVO A;  4A3F G;  3D0F A;  1Y1W H;  2ASB A;  4A3L G;  4DV0 L;  1HH2 P;  3F1Z A;  4DR1 Q;  1BKB A;  4FDB A;  5IT9 c;  5FLX c;  2R92 G;  3KJO A;  3CCQ A;  4BBS G;  3PF4 A;  3FKI G;  3K81 C;  3E9H A;  2V1C C;  1CSQ A;  1XMO L;  2R7Z H;  1C0A A;  3OYY A;  1E7Z A;  1LUZ A;  5M3F G;  1PH2 A;  4A3C H;  2BA1 A;  2HIV A;  1O7I A;  4QJF A;  3W1G A;  1TWF H;  3JC6 6;  1YNX A;  2OCE A;  3I4O A;  5E7N A;  5GAD C;  4JI6 L;  4A3E H;  3AYH B;  4JBM A;  1VQJ A;  1PA6 A;  4A3I H;  5IP7 G;  2R93 H;  2B3G A;  2GN5 A;  4P71 A;  1A8V A;  3S16 H;  3TRZ A;  1B7Y B;  4QY7 A;  1W2B A;  2UU9 L;  4QIW E;  1V43 A;  5FLM H;  4POG A;  1SE8 A;  4NXN L;  4IO9 A;  1YJ9 A;  1R9T H;  2BH2 A;  1C7Y A;  1Z47 A;  3PIO A;  2A8V A;  3NBH B;  4DNI A;  1HR0 Q;  3RLF A;  3TRE A;  5C4J H;  3PO3 H;  2R7Z G;  3PGZ A;  1RIP A;  4DR1 L;  3CCS A;  4DV6 Q;  3M7N A;  1JE5 A;  3S24 A;  5ELN A;  3IRB A;  2GVA A;  3ULL A;  2NZH A;  1VQ9 A;  2OTL A;  4DR7 Q;  4IOC A;  1D7Q A;  2Q2H A;  4A3E G;  1GO3 E;  2K50 A;  1L1O C;  3BU2 A;  4YY3 L;  1GD7 A;  3RN2 A;  4A3I G;  3GTM H;  3CW2 C;  3M3Y H;  4IPD A;  1UE5 A;  1IZ6 A;  5C4X H;  4QGU A;  1EIY B;  2HT1 A;  3GTP H;  2R7D A;  2E2H H;  2JK8 A;  3CF5 A;  5IYC G;  2OQ0 A;  1VQH A;  4JCV E;  5LMU Q;  1ASZ A;  2HHH Q;  3HKZ G;  3H0G G;  2VNU D;  3G71 A;  4LF9 Q;  3CCJ A;  3HKS A;  3A74 A;  1JT8 A;  4GKK Q;  1VQL A;  3U4Z A;  3LGJ A;  3WWV A;  5FJ8 H;  4HJA A;  3CXC A;  2RF4 A;  1VQ4 A;  3J7Z C;  2GVB A;  3L7Z C;  5IP9 G;  3PV0 A;  1TWG H;  2B29 A;  4R4Q A;  3J81 i;  3PO2 H;  4DR7 L;  3CCR A;  4X66 L;  2JJQ A;  3ZJY C;  1VQE A;  1LTL A;  4BA1 I;  2ZTE A;  2NVQ H;  3CC7 A;  1YJW A;  1BVS A;  3EN2 A;  3PSI A;  3I4M G;  4LFA Q;  1TWC H;  4A3B H;  2E2J H;  3UE0 A;  2HIX A;  4GKJ Q;  1RL2 A;  1L1O B;  5AJ3 Q;  1I6H H;  3CCU A;  4XIG S;  1BBW A;  5ELO A;  2HHH L;  3CME A;  1PH6 A;  1I94 Q;  4JOI C;  2JA8 H;  1JMC A;  4JBK A;  4GLX A;  2WB1 G;  1PFS A;  3MEF A;  3D31 A;  1VQO A;  3OTO Q;  4GOP C;  1KHI A;  1E24 A;  3KF8 B;  3DM3 A;  3PIP A;  4NXM L;  4O2D A;  1QVG A;  4GKK L;  4O0A A;  4LF7 Q;  3PO2 G;  1KXL A;  3J81 c;  2VQF Q;  4DR2 Q;  2VL6 A;  4WJ3 M;  1VQM A;  4IPH A;  3AEV A;  2XGT A;  2KCT A;  3KF6 A;  4LFB L;  2Q2I A;  1GM5 A;  4LF5 Q;  4LF8 Q;  4Y7N H;  4AYB G;  2EQS A;  1BBU A;  1GVP A;  1X9N A;  2PQA A;  4C3I H;  5IYD G;  1VQK A;  4L5S A;  2JA9 A;  2UUC Q;  3PUZ A;  5GAE C;  3KYH C;  4X62 L;  3FHW A;  5AJ3 L;  3M4Q A;  2CQO A;  5GRO A;  1I94 L;  1T9H A;  1XPR A;  1XNQ Q;  2VW9 A;  1HZA A;  3RZD H;  4OWW B;  3S1N H;  4P72 A;  3OTO L;  5H1S E;  1YJN A;  4B3M L;  3A5Z B;  3MXN B;  1CSP A;  4LF7 L;  1FJG L;  1Q86 C;  5IWA Q;  4A3J G;  3HOZ G;  3S1M H;  4YWM A;  1NY4 A;  3F2D A;  3S14 H;  4X64 L;  5C0X G;  3GTO H;  4UP7 A;  4DV0 Q;  4JYA L;  1G29 1;  4JG2 A;  1Q12 A;  2B63 H;  4LF5 L;  4QL5 A;  2NVX H;  3F2C A;  2YTX A;  4BBS H;  3TEH B;  3K0X A;  4L5T A;  4HJ7 A;  3HOU G;  4OO1 I;  5C0X J;  4A3F H;  4A3L H;  4AYB E;  2D0P A;  1XMO Q;  2JE6 I;  1X6O A;  5IY0 A;  2UUC L;  1NJI C;  2WP8 J;  4PMW A;  5M5W H;  3RN5 A;  4XTC S;  2UUA L;  2R92 H;  3FP9 A;  4BY7 G;  1M1K C;  1UE6 A;  2F52 A;  3PUW A;  1L1O A;  3FKI H;  4EQ5 A;  2Z0S A;  3G4S A;  2I5M X;  1NBW A;  2E2I H;  1C9O A;  1CKO A;  1WJJ A;  2YYZ A;  4C2M H;  4K0K Q;  4KHZ A;  5M3F H;  4JI7 Q;  1S40 A;  4A93 H;  4DV2 Q;  3STB C;  1N33 Q;  2IHF A;  3BZK A;  2QA4 A;  1KRT A;  4B3R L;  1X56 A;  1Q81 C;  4NXN Q;  5JJK A;  1JJC B;  5IP7 H;  3RZO H;  4LW1 A;  3J80 i;  2BA0 A;  2WFW A;  4H02 A;  2K5V A;  3G48 A;  1PV4 A;  1VQN A;  4NB3 A;  1PH7 A;  3CPF A;  4A3D H;  3AQQ A;  3Q8D A;  4BBR G;  3UDG A;  1KC8 C;  2ZJP A;  4L5Q A;  2K14 A;  4R4O A;  4KI0 A;  1KIX A;  4UY8 C;  3CP0 A;  4AIM A;  2MQH A;  4YY3 Q;  2N78 A;  4LUV A;  1EOV A;  3CMA A;  2UXC Q;  1EWI A;  4A93 G;  3DLL A;  4DR5 L;  4AQY Q;  1Y14 B;  3I7F A;  2OWO A;  3E0E A;  1U0L A;  4UPA A;  4K0K L;  1YI2 A;  4B3S Q;  1MJE A;  1PH9 A;  4JI7 L;  2Z6K C;  4OON A;  3J80 c;  3M85 A;  4DV2 L;  1N33 L;  1K8A C;  5IYC H;  5C3E G;  1QUQ B;  3CCE A;  3I2Z A;  4GNX B;  4JOI A;  1VQA A;  4A3G G;  4A3D G;  1IYJ B;  1K73 C;  3H0G H;  4OWT B;  4GOP A;  1X55 A;  2JQO A;  4TVA B;  2PNH A;  3A0J A;  3EBE A;  2YV5 A;  1QZH A;  3CC4 A;  4GN5 A;  1HNW L;  3ULP A;  3GDE A;  1E1T A;  1E22 A;  5JJI A;  4X66 Q;  3PUX A;  5IP9 H;  3VDY A;  4DK6 C;  1SN8 A;  2RHS B;  1VQD A;  4B3T Q;  2UXC L;  1VQB A;  3I55 A;  4AQY L;  3I56 A;  2R6G A;  3PUY A;  1WFQ A;  4IPC A;  4IOA A;  2LXJ A;  3H15 A;  2QEX A;  4B3S L;  1FVI A;  1VCI A;  1UE7 A;  3I4M H;  2L15 A;  2NVT H;  3GO5 A;  1Q46 A;  3KLW A;  3ULJ A;  3BZC A;  4DV3 L;  4NXM Q;  1PH3 A;  1CKM A;  3HOY G;  2EXD A;  1X3G A;  4PZ8 A;  2ES2 A;  1AH9 A;  2HQL A;  1E1O A;  1L2F A;  1UWV A;  2ZM6 Q;  4A76 A;  1Y1V G;  1WCM G;  4IJL A;  5C44 G;  2UUB L;  4LNQ A;  3U4V A;  2ALY B;  2YTY A;  1NMF A;  1XNR L;  4LFB Q;  1VQ5 A;  3KDF B;  4JBW A;  1AE3 A;  4KLK A;  1N34 Q;  1HZC A;  3TQY A;  4B3T L;  3HOV G;  3F2B A;  4IJH A;  4BXX H;  2CFM A;  4PZ7 A;  1IBM Q;  2H5X A;  2F4V L;  3CD6 A;  5HY6 A;  4X62 Q;  5IYD H;  3RLO A;  2KHI A;  4LF6 Q;  4OXP A;  1DGS A;  1G6P A;  2WAQ G;  3CCL A;  1SLJ A;  4BY1 G;  3JAM i;  3F8T A;  1K3R A;  1A62 A;  1I5F A;  1YZ6 A;  1EIF A;  2BH8 A;  2N49 A;  1OXV A;  2OQK A;  3EIV A;  2AMC B;  4B3M Q;  1FJG Q;  2AHO B;  3GD7 A;  1JJ2 A;  3KFU A;  4JI0 L;  2ZM6 L;  2N8N A;  3S1R H;  4X64 Q;  2VY3 A;  1B70 B;  4BXX G;  4JYA Q;  3BJU A;  3NEM A;  2ZTC A;  1IBL Q;  4A3J H;  3HOZ H;  1N34 L;  1IL2 A;  4GS3 A;  1SRU A;  1CKN B;  4IPG A;  1VQ8 A;  4A3K G;  4JI3 L;  3HFZ B;  1EUJ A;  4R1J A;  3RR5 A;  1IBM L;  4PZ6 A;  2UUA Q;  4LUZ A;  3HOU H;  2EIF A;  1SR3 A;  1W3S A;  3JAM c;  2LSS A;  2RHQ B;  4HIO A;  1XPU A;  1XJV A;  4DR4 Q;  1A63 A;  4DV5 Q;  4LF6 L;  1Q1E A;  3M4P A;  3T1Y L;  1VQG A;  4BY7 H;  4JI4 Q;  2N3S A;  2WAQ E;  2ZTD A;  3S17 H;  4KHP L;  1U5K A;  2PI2 A;  1HNX L;  3T1H Q;  2Z6K A;  4B3R Q;  1HZB A;  3M9B A;  4AH6 A;  5IYB G;  3AFP A;  4YCU A;  2UXB Q;  3GTL H;  2IY5 B;  2K5H A;  1V9P A;  2KCM A;  4DAY B;  1ASY A;  1H95 A;  1IBL L;  1GKH A;  1Q1B A;  4EX5 A;  2YTV A;  3HOW G;  1KAW A;  4JBJ A;  1I3Q H;  5C0X I;  3PUV A;  4A3M H;  4LF4 Q;  4HJ8 A;  2IT1 A;  3NEN A;  4BBR H;  4HJ9 A;  1VQP A;  4MTN A;  4LWC A;  1YIJ A;  1YIT A;  4DR5 Q;  2ZJR A;  4ALP A;  3U58 A;  4DR4 L;  1I50 H;  2PMZ E;  1TWH H;  4IFD G;  1A0I A;  1K83 H;  4DV5 L;  4GNX C;  1P16 A;  5LMN W;  1QVC A;  2IX1 A;  4JI4 L;  4DR6 L;  1J5E L;  2I5L X;  1NMG A;  4JI5 Q;  5GQO A;  5M5X H;  2VS1 A;  3T1H L;  4IFD J;  5JEA G;  1YHQ A;  4YWL A;  3S2H H;  4DUY Q;  3K7U C;  2Q2T A;  4J15 A;  1B8A A;  1LYL A;  4DUZ L;  2UXB L;  3CC2 A;  2KHJ A;  2JA5 G;  1HNZ Q;  5C3E H;  4A3M G;  1HNW Q;  5JEA J;  1EFW A;  1TWA H;  4A3G H;  2NN6 G;  4BA2 I;  1VQ6 A;  1D8L A;  4DV4 Q;  4X6A H;  1CUK A;  4POF A;  3CPW A;  1N32 L;  4LF4 L;  4WJ4 A;  1OTC A;  1UEB A;  2OTJ A;  4YCW A;  3W5O A;  1XMQ L;  3NEL A;  1X3E A;  3KOJ A;  2VUM G;  2YU9 H;  4R4I A;  2JA7 G;  3GTK H;  1MJC A;  1PHJ A;  3H3V H;  2MNA A;  2D62 A;  2AKW B;  1FGU A;  4ME3 A;  4DAM A;  3RNU A;  1S72 A;  4JI5 L;  5M3M G;  5LMN L;  1SFO H;  2KBN A;  1VQF A;  4DUY L;  4DV3 Q;  4HIM A;  5DLQ E;  4L5R C;  2JA6 G;  3PCO B;  1N9W A;  4PG3 A;  3S1Q H;  4LFC Q;  1HNZ L;  1HZ9 A;  1G51 A;  2UUB Q;  3E9I A;  2Q2U A;  4P73 A;  2K5N A;  3HOY H;  1XNR Q;  3GTQ H;  3ICE A;  1V1Q A;  1J6Q A;  3A5U A;  4DV4 L;  1N8R C;  2F3I A;  1OXU A;  1Y1V H;  1WCM H;  3RLN A;  5C44 H;  1M90 C;  4DR3 L;  1IBK Q;  4DK3 C;  2ZJQ A;  2C35 B;  4MZ9 A;  2A1A A;  2F4V Q;  3HOX G;  4OX9 L;  4YHH L;  1P8L A;  5J3B A;  1X3F A;  4DKA C;  2K75 A;  1Y1W G;  1E3P A;  4GLV B;  1EYG A;  5M5Y H;  2VQE L;  1HR0 W;  3HOV H;  1K0R A;  3J81 j;  3H3V I;  3U50 C;  2UXD Q;  2CCZ A;  4UP8 A;  3KJP A;  1PYS B;  1FL0 A;  4LFC L;  4A3C G;  3KF6 B;  1LM0 A;  4JI0 Q;  2A19 A;  4BY1 H;  1AE2 A;  1HJP A;  2ID0 A;  1PH5 A;  3S15 H;  1VQC A;  1KD1 C;  2PQA B;  2XTI A;  1XPO A;  2R93 G;  3SGI A;  4DV1 Q;  2R7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...