4LFCL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 11
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfcL00
1ASYA 5LMNQ 2JK8A 2VQFL 3RN2A 2NZOA 4UP7A 3STBD 2N3SA 1KXLA 4B3RQ 4A75A 2E2HH 4LFBQ 4JI7Q 4DR6Q 2A8VA 2K5HA 3CQZH 4P74A 1WFQA 2Z0SA 3M4OH 4BA2I 1HNXQ 4JBMA 4HIKA 1HR0W 1VQ5A 4YWLA 3CCUA 4A3GG 4LF6Q 4DR4Q 2VUMH 4X65L 4LF7L 1OTCA 3HOUG 2B29A 4AQYQ 5J3BA 4O0AA 3TREA 4AYBG 2JA6G 4A3BH 4RMFA 2YV5A 3VDYA 4IFDI 4O2DA 2WAQE 1VQ9A 1A0IA 3KOJA 3U58A 2RHQB 1YITA 3HOVH 3UDGA 4B3ML 4LF8L 3T1YL 1VQEA 1YHQA 3J7A5 4LFCQ 5LMUQ 3M85A 1RIPA 3PIOA 3PGZA 4KI0A 4JI3Q 4DPGA 3PO3H 4MZ9A 2OTJA 1G291 1LUZA 5C4XG 3ZJYC 1JJGA 2UUBQ 2ZJQA 1JE5A 3HOWH 1VQJA 2PI2E 3S2HH 4MTNA 4DV4Q 2I5LX 1MKHA 1UE1A 4YHHL 1D7QA 1U5KA 4A76A 5M3MH 1E22A 1HZ9A 4QY7A 4NXMQ 1VQHA 4C3JH 4JI8Q 3H15A 4HJ8A 2PQAA 1SMXA 1PV4A 3HOYG 3J81j 2QA4A 4DR5Q 3EIVA 1PA6A 4B3TQ 3AYHB 2I0QA 1KQSA 1N33Q 4IPGA 4K0KL 4A3CG 2UU9L 3BU2A 1D8LA 4X62L 1GKHA 1XMOL 2OQKA 1L1OA 1E1TA 4JI2L 4LFAL 3STBC 1HNWL 5M5WH 4B3RL 4OWWB 1KD1C 4DR3L 2Q2HA 1KAWA 4H02A 1YBYA 1VQ4A 4LF8Q 3CCVA 4DUYL 4BY7G 1OXUA 5JJIA 1QVGA 1IXRA 5JEAJ 3H3VH 3E0EA 5M3FH 5C4JH 4L5TA 4Y52H 1PVOA 3K81C 3WWVA 4GLVB 3ULJA 3UDXA 3CPFA 3OW2A 3PUZA 3DLLA 3GTOH 4GS3A 2DGYA 3CCRA 3TS0A 4A3LH 2YTXA 2XGTA 4WJ4A 1L1OC 4NXNL 1VQBA 2RCNA 1Q7YC 3I4NH 4X6AH 1IBKL 1HJPA 1EIYB 3TEHB 2YTVA 1ASZA 4IOAA 3OYYA 2H5XA 4DKAC 1KL9A 4DK3C 1TWFH 3JC66 1Z47A 3MEFA 2VS1A 2JA7H 4DR4L 1IL2A 4K0KQ 1K73C 3RR5A 2Y0SE 1SROA 4YCVA 1XPOA 1SE8A 4FDBA 3RZOH 1A63A 3KLWA 1XNRL 4BY1G 4JOIC 1Q8KA 4DV5L 1KIXA 1WCMG 1Q1EA 4P73A 2KCTA 3I55A 5ELOA 5EAYA 2FXQA 2HIXA 3J81i 4BY1H 4DV6L 4IPHA 2BA0A 2ZJPA 3A74A 1S3OA 2VNUD 4A3LG 4POGA 4A93G 1PH3A 3HKZE 4BBSG 4WJ3M 3H3VI 1YJ9A 3H0GH 4DV4L 2Q2UA 4GN5A 1HR0L 3ER0A 2HT1A 1MIUA 3D0FA 4LWCA 2IY5B 5FLMH 1XMQL 4JC0A 2JA8G 3W5OA 4JV5Q 1W2BA 4A3JG 3S1QH 3GD7A 1VQAA 1T9HA 3K7UC 1OXXK 3ULPA 1IZ6A 4ME3A 1G6PA 1L1OB 2CKZB 1EQRA 1J6QA 4P72A 1N9WA 3U50C 5IP9H 5AJ3L 4HJ7A 4DR2Q 1BBWA 1VQPA 2IT1A 2NN6G 5JEAG 4LF6L 4R4QA 4PZ6A 4A3MG 4HJAA 4GLXA 2D0PA 1YHBA 2BA1A 4JBJA 2K4KA 3S24A 5C44G 3U4VA 3A0JA 5IE8A 3D31A 1VS0A 3PUXA 4QGUA 3HOYH 4LNQA 1EOVA 1W3SA 1NMFA 5IY0A 1Q46A 2GVAA 2L15A 2LXKA 4DV0L 4B3SL 2AWNA 2D0OA 4JCVE 4A93H 3CF5A 4GNXA 1JJCB 4X64Q 1Y1VG 2R93H 3PCOB 4GN3B 4A3EH 1N8RC 5GAEC 4GOPA 4LFCL 1HZBA 1N32L 3B6YA 2NVXH 1MJCA 3HFZB 1E1OA 1LM0A 2IHFA 4OWXB 4HJ5A 2R93G 4DV5Q 1CSPA 2AMCB 1HH2P 1PH2A 3K80C 1VQMA 2R7DA 1PH9A 4B3SQ 1BBUA 5LMUL 1WJJA 3TRZA 2K50A 1MJEA 3AFQA 3S14H 2RHSB 3RLFA 4B3MQ 1CKNA 2VZAA 1Q82C 2A19A 2NN6I 2K14A 2Q2IA 4DR2L 4DR5L 4DV7Q 4APVA 2I5MX 4KLKA 4GKJQ 5BR8Q 1WYDA 2JA7G 3KJOA 4A3EG 1M1KC 1XNQQ 4BBRG 1K8AC 2UXDQ 1FJGQ 1JT8A 2AWOA 2E8GA 1VQFA 2Z6KA 1PYBA 4JI7L 3RLOA 1SN8A 4GOPC 4HIMA 2BH2A 3KJPA 4LF4Q 1XMOQ 3ULLA 5GADC 2PQAB 1VQLA 4BXXH 1Y1WH 5K36G 4DV2L 3M9BA 1KHIA 2UXBQ 4GKJL 1X3GA 1OXTA 1SRUA 1P16A 1B7YB 4R1JA 4AH6A 5BR8L 3KF6A 1HNWQ 2N49A 1XNQL 2UXCQ 2ALYB 3RZDH 1VCIA 2OCEA 4A3GH 3LGJA 2Z6KC 3T1HQ 1TXYA 4L5QA 1UE6A 3E9HA 4L5RC 5C3EH 4C3IH 1VQNA 3CMEA 1C9OA 2WB1E 5IP7G 1XPRA 3F8TA 3NBHB 2JEAI 4IOCA 5IYDH 2NVQH 2HQLA 5HY6A 3KDFB 1UWVA 2PMZE 2KBNA 2K5NA 1PH5A 1X65A 5C3EG 3S1RH 2VQFQ 3K8AA 4YCWA 1VQ8A 1IBKQ 3AQQA 3M4PA 3PO3G 2QGQA 1A62A 2VQEQ 3HOZH 2ZTCA 3T1HL 1SFOH 4A3IH 3NEMA 2AHOB 3CC2A 3UDFA 3KF8B 4JI6Q 3U4ZA 2CWAA 2K52A 4JI1Q 2B3GA 4LF7Q 1K83H 1YJNA 5JJKA 1K9MC 1CKNB 4A3IG 1X9NA 1NE3A 1K0RA 2YYZA 1QVCA 5E7NA 2Q2TA 3AEVA 1I94Q 4DR6L 2WFWA 4DV0Q 2JA9A 1Y14B 1TWGH 4GN4B 4GNXC 2B63H 1HNXL 4B3TL 1IBLL 2MO1A 2E5LL 2K5VA 3BZKA 4OONA 1JJ2A 1Z9FA 4LF9L 3J80i 2CQOA 1PH1A 1IBMQ 3CCJA 1AE3A 1GO3E 4X66Q 3FHWA 1PYSB 1M90C 4JI5Q 1PHJA 4YWMA 3GTJH 4GLAC 5M3FG 2HHHQ 3CP0A 4YWKA 1S40A 2ZM6L 5C0XG 3I7FA 3UE0A 5LMNW 4A3BG 4HIOA 3KF6B 3HOXH 3CAMA 1EWIA 2KHIA 1X55A 1R9TH 2AKWB 1HR0Q 2ZTDA 2MO0A 1E24A 1GVPA 4UY8C 2WP8J 1KC8C 1N36Q 2JA5G 2OTLA 4OO1G 1AE2A 3G71A 4PG3A 2B63G 2PNHA 3G6EA 4R4OA 3L2PA 2UUAL 4P71A 5FLMG 4YY3Q 2ZM6Q 3CCSA 1L0WA 1EUJA 3A5ZB 4POFA 2A1AA 2JQOA 4KHPQ 4LUVA 3CMAA 1XTDA 3DM3A 3M4QA 1DGSA 5HGQA 3J81c 2E5LQ 4NXNQ 3EN2A 2JEBI 2KHJA 4A3MH 2CWPA 1Q86C 4QQBX 3HKZG 5C4XH 3SGIA 1I50H 2JJQA 1XJVA 4AYBE 1EQQA 1VQ6A 3M3YH 4IFDJ 1H95A 1G51A 1E7ZA 1S72A 1FJGL 5AJ3Q 1OXVA 4HIDA 4JI0L 3GO5A 1AH9A 2E2IH 2YTYA 3K0XA 1PH4A 4DR7Q 3FP9A 4OO1I 3F2CA 4DUZL 4DV1L 1NJIC 4DV6Q 3I2ZA 1J5EQ 4LF5L 1B70B 4YY3L 2I5HA 3KFUA 2RF4A 4C3HH 2VY3A 3CC7A 4LF9Q 3RNUA 3JAMi 1BVSA 4R4TA 2NZHA 2C35B 3CD6A 2OQ0A 4OX9L 2ASBA 3KYHC 4JYAQ 1EIFA 4JI5L 3CCQA 4A3FH 4UP8A 2ES2A 2R7FA 1B8AA 1YVCA 2UUBL 4J15A 3A5UA 1V1QA 5H1SE 1QVFA 3PF4A 4JV5L 5IYCG 4HJ9A 3CC4A 1CUKA 2YU9H 3S16H 3TS2A 4AIMA 1EYGA 4A3CH 2JA8H 1X6OA 1PH7A 3NELA 1A8VA 1FVIA 4LF4L 2NVTH 4JI3L 3I4NG 3S15H 2WAQG 4LW1A 3L0OA 1C7YA 3PUWA 4JBKA 1NY4A 2KCMA 2LSSA 2PI2A 3KDFA 4OWTB 3EBEA 5DLQE 1YEZA 5ELNA 3GTQH 3S1MH 4JI2Q 5IT9c 1QZGA 3MXNB 4X62Q 4DR3Q 2BH8A 4UPAA 1BKBA 2VW9A 1V9PA 4GNXB 5C44H 4LFAQ 1WI5A 2F4VL 4IJLA 4RG1A 1GM5A 1Q12A 1PH6A 1WCMH 2JA6H 1O7IA 4BA1I 5M3MG 4ALPA 2EXDA 2R92G 1I6HH 1UE5A 2UU9Q 4UP9A 3S2DH 2IHEA 4BBRH 5LMNL 1I3QH 2CCZA 1WOCA 2GVBA 2GN5A 1OXSC 4QJFA 1I94L 4OX9Q 1HNZQ 2R7ZG 1TWHH 3G48A 3RLNA 4LFBL 4A3KH 4JI4Q 2VQEL 3ICEA 1RL2A 5C0XI 1VQDA 2UUCQ 4L5SA 3GTMH 2DUDA 2MFIA 4PZ7A 1NBWA 2ZJRA 3CXCA 4JI0Q 4PMWA 2CFMA 1SR3A 4EX5A 3OTOL 4A3KG 1N34Q 4GKKQ 1E3PA 2JE6I 4X66L 3GTPH 2KENA 3GTLH 3GTKH 5IYBH 1HZCA 1PH8A 1IBML 2HHHL 3HKSA 3F2DA 2UXBL 3UDIA 1VQOA 4IPCA 1Y1VH 4LUOA 4NB3A 2QEXA 2WB1G 3PIPA 1YNXA 3K7AH 2R92H 5IWAL 1EFWA 1QUQA 3I4OA 4Y7NH 4OXPA 3J80c 5FJ8G 4X65Q 5JJLA 1UE7A 4IO9A 3PUYA 1HZAA 3I4MH 4JI1L 4XTCS 4P75A 1LYLA 1TWAH 3W1BA 4DR7L 3FKIH 3G4SA 3JAMc 2F4VQ 1QUQB 5IWAQ 2HIVA 1SLJA 2IX1A 5GQOA 1U0LA 3E9IA 4JG2A 1JMCA 1CSQA 5IYBG 4DAYB 3S1NH 1KRTA 3NENA 1VQCA 4JI6L 4TVAB 1NTGA 1IYJB 4TQUS 3M7NA 1V43A 3BJUA 1YIJA 2IX0A 3CCEA 1XMQQ 1YJWA 3HOXG 1N34L 4GKKL 1P8LA 1HNZL 1X54A 2EQSA 4XIGS 2D62A 4DK6C 5FJ8H 4JI4L 1C0AA 2K75A 3W1GA 3J7ZC 2JA5H 4X64L 2OWOA 4JI8L 1CKMA 2R7ZH 4KHPL 4R4IA 2EIFA 3ERSX 1IBLQ 1K3RA 4LUZA 3IRBA 4DV3L 1YI2A 1N33L 2ATWA 3CCMA 3GTGH 5GROA 1LTLA 2NVYH 4C2MH 4DNIA 2MQHA 4NPSA 1UEBA 1N32Q 1GD7A 2N78A 1YZ6A 5M5YH 3AFPA 3PSIA 4DUZQ 4BXXG 4A4IA 3HOWG 1Y1WG 3F2BA 4DR1L 5IP7H 5IYDG 1X3EA 1X56A 4BBSH 1J5EL 2ZTEA 1KRSA 3H0GG 3PUVA 4LF5Q 2VUMG 3HOUH 4IJHA 4DUYQ 1X3FA 4YCUA 1VQ7A 1Q1BA 5M5XH 4R4CA 4A3JH 3I56A 3PF5A 4IPDA 1NMGA 3PV0A 4DV2Q 4AQYL 3HOVG 3GDEA 2VL6A 5GAHC 1TWCH 2F3IA 4JOIA 1QZHA 3CCLA 3PO2H 5IP9G 4MNOA 3TQYA 4DAMA 1Q81C 1VQKA 2N8NA 2LXJA 4A3DH 4DR1Q 3I4MG 5FLXc 4GOPB 2UUAQ 1XPUA 2ID0A 4QL5A 2UXDL 1YHAA 4QIWE 2E2JH 1L2FA 2XTIA 5C0XJ 3L7ZC 4DV3Q 4JYAL 4DV7L 1N36L 1FL0A 4BY7H 1VQIA 3CW2C 4A3DG 2F52A 3HOZG 1I5FA 1JB7A 2Y0SG 2V1CC 4KHZA 1VQGA 4PZ8A 4YHHQ 4EQ5A 3F1ZA 4IFDG 4NXML 4DV1Q 4A3FG 3S17H 1PFSA 3BZCA 4JBWA 5GAGC 1FGUA 1K8GA 3T1YQ 2UXCL 3OTOQ 2UUCL 3CPWA 3PO2G 3UE1A 5IYCH 2R6GA 1XNRQ 1CKOA 3FKIG 3RN5A 3Q8DA 2MNAA
chains in the Genus database with same CATH superfamily
5LMNQ 2VQFL 2NZOA 3K5OA 5CBEE 4A3IB 4B3RQ 2QDBA 2EY5A 1B4OA 3BVZA 2A8VA 3E6ZX 4BA2I 3GTOB 3M4OH 2KEDA 1T5EA 4UDUC 4OHJA 4X65L 3Q6SA 1OTCA 2ENBA 4AQYQ 2JA6G 3TREA 3VDYA 3RUZA 4O2DA 1A0IA 2R3ZA 3KOJA 5C5LA 3EA6A 3U58A 1YITA 4KMUC 4B3ML 1VQEA 1HQRD 5LMUQ 2ZT9C 4JI3Q 3MHBA 4B08A 4DPGA 3L3OC 1K0SA 2PI2E 4JPBW 4DV4Q 3K5LA 4DFAA 1MKHA 5I6WA 4YHHL 1D7QA 4A76A 2EDGA 5M3MH 1HZ9A 1SE3A 4JI8Q 2F0MA 1WTWA 1SMXA 3HOYG 3RD4A 2QA4A 1KDAA 4CDDC 2ICEC 3TDQA 1ILQA 1LTBD 1WVLA 2HUGA 1IW7D 2UU9L 4HEDA 4X62L 1H9JA 1XMOL 1STNA 5M5WH 2VUMB 4DR3L 4H02A 4V190 3QG1A 2FFKB 1QVGA 1IXRA 1HA5A 4QF4A 1EY0A 1PVOA 3K81C 4GLVB 2J7ZA 2B2UA 3OW2A 1RODA 2DGYA 2YTXA 3MWYW 1Q7YC 1IBKL 1ASZA 3OYYA 3MEFA 4DR4L 1F2YA 1XPOA 1SE8A 4FDBA 5D3IB 2A74C 3KLWA 3P75A 4C1NI 1WCMG 1Q1EA 4IUQA 2KCTA 1LTAD 3I55A 3EVQA 2FXQA 2HIXA 4BY1H 3OSOA 4XQJA 4A3LG 1A3UA 3E5SA 1CA6A 5IGFA 4POGA 3ND8A 4BBSG 3QIAA 4WJ3M 1YJ9A 2F0OA 2Q2UA 4GN5A 2HT1A 1MIUA 1XMQL 2X6LA 3CQZB 2VB2X 4PMBA 1K8OA 2A6EC 3K7UC 1OXXK 3RZOB 1L1OB 2XVSA 2K01A 2IT1A 4PZ6A 3T51B 4HJAA 5EPJA 5C44B 3UI2A 3U4VA 1GUWA 3HOYH 3QOLA 1EOVA 1Q46A 1R4QB 2KCNA 1PTOC 2FINB 2AQ2B 1JJCB 1ICWA 4GOPA 2N55A 2WIIB 1B3AA 3NP8A 3S1QB 3HFZB 4OWXB 1DOKA 1LTTD 2EJGC 1CSPA 1Q90A 3MXGA 4YIJA 3K80C 5DEHA 1AEXA 2EVBA 4DK0A 2IJ0A 1C48A 1WJJA 3TRZA 1HFGA 4L6TB 3NBIA 3RLFA 3JAML 1LT6D 1Q82C 4DR2L 4DV7Q 3TZDA 2Y0SB 2I5MX 2DY7A 5BR8Q 1I4GA 2F03A 4QMGA 1JT8A 4CJ1B 2A6HC 2PPBC 3BYYB 3VR4A 4PV1C 5C3XA 2F0HA 2EY6A 3KLSA 3URYA 5GADC 2DN8A 2PQAB 1VQLA 4KK7A 1EQTA 5CMDA 3O13A 2GA4B 1UNSA 1RTNA 2OEOA 4A3GH 1VCIA 3GTQB 4L5QA 2K5WA 4L5RC 1FNUA 3TZUA 1VQNA 2A69D 2WB1E 4RFBA 5IP7G 3K57A 5J1ZA 1BCPC 4KY6A 4RKLA 4KJOA 3PO3B 3PO3G 3R2TA 3D4WA 1SFOH 1TU2B 2DY8A 2PMZB 5FOBB 3UDFA 4JI6Q 1B50A 3W3AA 2K52A 4JI1Q 3KBGA 1SYEA 2L1BA 3M3YB 1K83H 5JJKA 1X9NA 1QVCA 2LS01 2F0NA 2XWBB 1G91A 2WFWA 4TSSA 2E2IB 2L5TA 1D5ZC 3VR3A 4B3TL 4RHRA 2WKCA 3S1RB 2B39A 5JPMC 1ZYRD 4OONA 1Z9FA 2PO4A 2FHTA 4JI5Q 1PHJA 1LACA 1D6EC 4YWMA 4GLAC 1EQVA 2Z8LA 2DJGC 3GV6A 3IFTA 5NUCA 5DM73 3EFXD 1X55A 1JB3A 2AKWB 4FO2A 1HR0Q 5CV8A 4UY8C 1KC8C 1SAPA 1N36Q 2JA5G 1AE2A 2PNHA 1IKLA 1K83B 1SYFA 2ZM6Q 4POFA 2EPBA 3KLSX 4LUVA 4KHPQ 1STYA 2L0CA 1TKWB 1TS2A 1Q86C 2CWPA 5T1GA 1H95A 4AYBE 1VQ6A 1E7ZA 5EGTA 2M00A 1SNPA 1OXVA 3A8KE 4HIDA 2F0QA 2YTYA 2G9HD 4DR7Q 4OO1I 5CV5A 1SNQA 1J5EQ 1QNKA 4YY3L 4PNYA 4JW0A 4I65A 1TS3A 4LF9Q 4RGOS 1CI3M 4JYAQ 3KYHC 3CCQA 4JI5L 1HPCA 4UP8A 1YVCA 5I4DA 1QG7A 1GOZA 1QVFA 1QWYA 4JV5L 1CM9A 1CUKA 3TS2A 4KV6A 3SDZA 4A3CH 1X6OA 3S15H 3MFGA 3NELA 1SE2A 4R8IA 4BWGB 2KEEA 1GUOA 1NY4A 2OT2A 4CJ2C 5DLQE 2B2WA 3DHQA 4KN7C 2Z1CA 4DR3Q 2BH8A 2CH4A 4G7OC 3D4DA 4K5XA 4FF2A 4DAPA 2L4NA 2UU9Q 2IHEA 3HOZB 2GVBA 1II3A 4OX9Q 3G48A 2JA7B 1R9TB 3RLNA 2H4OA 4LFBL 3SHLA 1RL2A 3DWPA 2MFIA 2ZJRA 5A2QE 5DAUA 4PMWA 2CFMA 4EX5A 2FMMA 4A3KG 3GTPH 2KENA 3GTKH 1NR2A 3HKSA 3F2DA 3UDIA 4OELB 1VQOA 4IPCA 1Y1VH 2NUCA 3S1NB 4LUOA 4NB3A 2X69A 2WB1G 4KN4C 3PIPA 1LV9A 1VDZA 3I4OA 1KABA 1FD7D 2F0TA 3J80c 4X65Q 3VR5A 1I4QA 4DGZA 4ULLA 2JP1A 1F2MA 4HMJA 4BY1B 4LAAA 1HZAA 4JI1L 2AQ1B 3W1BA 3FKIH 4KKTA 1O78A 5IWAQ 3E9IA 1JMCA 5IYBG 3C1FA 4ZRZA 2QDLA 3NENA 3NTHA 2BE5D 3M7NA 3HOXG 4IN3A 4GKKL 1P8LA 1X54A 2RSNA 1DOLA 2F4IA 4JI4L 1C0AA 2OXPA 2RCFA 2JA5H 1CFMA 1I3QB 1RTOA 1IBLQ 3U9OA 1K3RA 4DV3L 1HFNA 2KOLA 1N32Q 1GUNA 1SMYD 1GD7A 5M5YH 5D14A 2XNAC 4C3IG 3HOWG 3F2BA 2ZTEA 1TWAB 1JICA 1Q1BA 4R4CA 3PF5A 3GDEA 4JOIA 3TQYA 4Z9CB 4WRDA 3I4MG 1SMYC 1XPUA 4F88A 3OW7A 1L2FA 1QE6A 5C0XJ 1BDOA 3NK9A 1VQIA 1WTRA 1JWUD 1NCVA 3H91A 1I5FA 2B2WC 2Y0SG 3X3NA 1D5XC 1VQGA 4PZ8A 4QB4A 3F1ZA 4DV1Q 4A3FG 2CW0C 3R3OA 3BDCA 3PO2B 2BE5C 5IYCH 1XNRQ 2MNAA 4KTAA 3NBHA 3I90A 4UP7A 4KJNA 1I6HB 1KXLA 2E2HH 4JI7Q 2O4XA 5G3LD 4JBMA 4HIKA 4A3GG 2Q8RE 4A3GB 2B29A 3KF8A 5J3BA 4O0AA 2QKIC 5E1FA 1RD9D 4RMFA 2YV5A 4IFDI 1GHJA 1VQ9A 5EBDA 2EJFC 1AW7A 3UDGA 4LF8L 3T1YL 3M85A 4X3TA 1ONLA 4KI0A 3P7JA 3PO3H 4U68A 3Q23A 3ONAB 2OTJA 5C4XG 1H9MA 4K6LA 4DF7A 4C3HG 3HOWH 3S2HH 4C3HB 3JAME 1IL8A 3FEWX 3BVMA 1EYDA 3MXPA 4C3JH 1PA6A 4B3TQ 3AYHB 3VYSA 4ABNA 1TWHB 2F0VA 3PMFA 4K0KL 3TP7A 3OMCA 3S14B 1D8LA 2X6GA 3ITPA 1E1TA 4JI2L 2AQ3B 5I2XA 2VXWA 1YBYA 2QILA 3CCVA 4DUYL 3G7LA 5JEAJ 3H3VH 1FYCA 4L5TA 4Y52H 1PFNA 3QO2A 4A3KB 2JA5B 3PUZA 4GS3A 3TS0A 1L1OC 2HCCA 3I4NH 1EIYB 4CDFC 4MIUA 4DKAC 2G5DA 2SDFA 5IIFA 1KL9A 5CR3A 1GXDC 2J0TD 3JC66 1CQVA 2PQEA 1STBA 2Y0SE 4C3JB 1EU4A 3RZOH 1A63A 3E3XA 4L8JA 4BY1G 3OWEB 3D8GA 1Q8KA 1UAPA 4DV5L 1KIXA 1WTVA 3K59A 3GTLB 3Q22A 5DM63 1CT1D 2B8GA 4DV6L 2VNUD 4DV4L 3QOJA 3D0FA 4LWCA 2IY5B 1PTOD 2F0FA 4JV5Q 1Y8PB 4A3JG 3S1QH 1T9HA 2K32A 4K8IA 4ME3A 4I7ZC 1EQRA 1J9OA 2CKZB 4G57A 3U50C 4DR2Q 1XPRA 1O7LA 1BBWA 2NYZD 2NN6G 1U4RA 2PZUA 4A3MG 4LF6L 3BVGA 4J8QA 4GLXA 5C44G 4XQNA 3D31A 1ESRA 4LNQA 3NUCA 1NMFA 2BDOA 2L15A 4DV0L 1EY7A 2AWNA 2CQAA 2D0OA 3HGBA 5M5XB 3CF5A 1YNND 3EROA 2NVYB 3HOWB 3PCOB 1STHA 5GAEC 4OL7A 3B6YA 1E1OA 4HJ5A 3NSWA 1F2ZA 2AMCB 1G2TA 1PH2A 3PQIA 1VQMA 2EXZA 2P5ZX 1PH9A 4B3SQ 1BBUA 2KJXA 3AFQA 2RHSB 3SK5A 1CKNA 1BCPD 2NN6I 2K14A 4DR5L 4APVA 5HGTA 2JSOA 4XQQA 2A6ED 4KLKA 3I70A 1ESFA 3WOFA 4I7AA 3KJOA 2JA7G 2L11A 1AN8A 3HZXA 4BBRG 1K8AC 1FJGQ 1ILPA 2AWOA 1I6VC 1PYBA 4JI7L 1F9PA 2Q8IB 4GOPC 1EWCA 1STAA 2RSOA 3R8BA 2NB0A 4OEMB 4R9WA 5K36G 1Y1WH 4DV2L 5M9OA 1OXTA 1ML0D 4R1JA 5BR8L 3KF6A 3MZ5A 3SVMA 4NP5A 2N49A 3BDOA 1PZJD 1XNQL 1E2VA 2MPMA 3RZDH 1HTPA 1JQYD 1WD1A 3S1MB 3T1HQ 1TXYA 2KCCA 5C4HA 3E9HA 5C3EH 4FXGC 4C3IH 3CMEA 1C9OA 2QCPX 3NBHB 5HY6A 1UWVA 2PMZE 1JORA 4AYBB 5C3EG 4IALA 3S1RH 5IGDA 1SXTA 3TP5A 3K8AA 3AQQA 1A62A 2B2YC 3ND9A 3T1HL 3R93A 4A3IH 3CRKC 1EY4A 2AHOB 3KF8B 3U4ZA 2RDFA 2CWAA 4N9PA 5AFWA 5E4WC 1WTQA 2O5IC 4IUUA 1K9MC 4KD3A 4F87A 1GHKA 2YYZA 5E7NA 3Q24A 2Q2TA 1PMRA 1DZ1A 2JA9A 1TWGH 4GN4B 5FO8B 1HNXL 4KY7A 3PIO3 1U9RA 2MO1A 2J4XA 1IBMQ 4IUPA 4FXKC 4LK1C 4X66Q 1M90C 1IYVA 4C3IB 4ZLTF 5CV4A 3GTJH 3CP0A 4HTHA 3CHBD 5C0XG 2G9DA 3UE0A 4HIOA 1EWIA 1T5XD 2A5HA 2D9UA 1E24A 2MO0A 3CKIB 1W6JA 1SYCA 4OO1G 1EY8A 4L63B 4O1NA 4ZAIA 3G71A 4PG3A 4RCNA 2L55A 1HRJA 1D1KA 3LWUA 3L2PA 2TMPA 4P71A 2D5DA 3CCSA 1L0WA 1HCZA 1JCKB 3CMAA 1XTDA 3DM3A 5I2YA 5FO9B 2JEBI 4A3MH 4QQBX 2R61A 5C4XH 1K8MA 5EKLA 3M3YH 1G51A 4K8JA 3X3MA 1FJGL 1NUCA 1A3TA 3K0XA 1PH4A 1H9SB 5LHY1 4QCLA 3I2ZA 3FPPA 4RGNA 2I5HA 2NBFA 4C3HH 2VY3A 3CC7A 3RNUA 2C35B 4OX9L 2F0JA 3K5NA 4A3FH 3MTSA 2B2VA 3OPOA 3A5UA 4DN4M 1SNOA 2QF7A 5IYCG 1Y1WB 2NVXB 4N9TA 4DNTB 2JA8H 2BDNA 1A8VA 2NVTH 4JI3L 3V05A 3I4NG 3I73A 2EY1A 4O42A 3D6WA 2SOBA 5HURA 3S1MH 2Z4IA 4U673 2Z9HA 4JI2Q 5IT9c 1QZGA 2K5DA 2WINB 4IQZA 4LFAQ 4HCEA 4RG1A 2PNRC 1GM5A 1Q12A 3HOYB 2JA6H 4JVZA 5M3MG 4ALPA 2EXDA 1LT3D 2R92G 1UE5A 3NQTA 3M7GA 4UP9A 4BBRH 5LMNL 1E2ZA 1X32A 1WOCA 2GN5A 4QJFA 2EOTA 3TBIB 4A3KH 2VQEL 3OIPA 2MP1A 5C0XI 1VQDA 4L5SA 3GTMH 1HTLD 4JI0Q 3MA2B 1SR3A 1QNUA 4OIKA 5CC4A 1Y69U 1N34Q 1E3PA 2JE6I 1BCPB 1HZCA 2SNMA 2UXBL 5JEAH 1JR0D 1WTHA 1EYCA 1PFMA 1WD0A 1I4PA 1ICFB 3DWAA 5FJ8G 1SYGA 3PUYA 4C1NK 3HOUB 2NZ1D 3T13A 3H09A 4DXFA 1FNVA 1ET9A 2D2CC 1QUQB 2IX1A 1SLJA 5GQOA 4JG2A 2NTTA 1SJED 2PW7A 4TVAB 1IYJB 3BJUA 1YIJA 2IX0A 3CCEA 4FYDA 1N34L 4ZUIA 3RMHA 1HNZL 3C1EA 4XIGS 2D62A 1KDBA 2K75A 4KHVA 3W1GA 3J7ZC 4X64L 4ZKBB 2R7ZH 5G3LF 4A3MB 3NXWA 4R4IA 2RQXA 4LUZA 3IRBA 2ATWA 3CCMA 4UAIA 1LTLA 4C2MH 4WFN3 1Q8IA 4FVMA 1TWFB 5C0XH 2XRQD 4DUZQ 5C3WA 2Z6BA 5FKAC 5IYDG 1J5EL 3PUVA 1OO9B 4EVOA 3HOUH 1CHQD 1ENFA 3A55A 2HDMA 5M5XH 3HOVB 4A3JH 1TS5A 3G6JB 3HOVG 5T1IA 3PO2H 5GAHC 1TWCH 1V1OA 3CCLA 3GQBA 1G2SA 1Q81C 5EKKA 1BO0A 4DR1Q 4GOPB 1NAPA 3IL8A 2B2TA 2MGSA 5BN5A 1N36L 3S16B 4C56C 4EQNA 4KHZA 5CGKA 4PMCA 1MI2A 4YHHQ 2PYKA 4EQ5A 3S17H 1PFSA 5ELBA 1KAAA 1K8GA 4IUTA 4DXGA 4ZYSA 2UUCL 2EYMA 1EFID 3PO2G 3UE1A 4BBSB 2R6GA 4B9WA 1D1IA 1VMPA 1GUSA 2OF1A 2WB1B 1UUPA 3RN2A 3STBD 2F0IA 4A75A 3FMCA 1SSOA 2K5HA 3CQZH 4P74A 1WFQA 1JWSD 1HR0W 1VQ5A 2K5QA 4YWLA 1LTID 3I8ZA 4LF6Q 2VUMH 4DR4Q 5I9OA 3HOUG 2RBMA 4AYBG 3A8JE 2F0GA 3S15B 2RHQB 1TY0A 4RGTA 1EY9A 3J7A5 3DXJC 1NR4A 4LFCQ 4K2KA 1RIPA 3PIOA 1MSHA 4MZ9A 1EYAA 2WAQB 3A56A 3ZJYC 4K5WA 3MAQA 1JJGA 3KUPA 1I4XA 3BG3A 2I5LX 2Z4HA 3DWQA 2IWHA 4ZQ3A 1B2TA 1U5KA 5EQ0A 1E22A 4QY7A 2Q8TA 2PQAA 3SK4A 5JVG3 1PV4A 3J81j 4DR5Q 1X3QA 5J39A 1KQSA 1N33Q 1H9SA 2ZXRA 2OQKA 4JK1C 3STBC 1LO5D 1HNWL 4OWWB 5F2DA 2Q2HA 1KAWA 1CA5A 3H0GB 1OXUA 5KEEA 3E0EA 4ZUJA 5M3FH 5C4JH 3WWVA 2M2LA 1TQOA 3ULJA 3UDXA 4A93B 1EWHA 3HG9A 4XT1B 4WJ4A 1DONA 4X6AH 3NWSA 1HJPA 3TEHB 2YTVA 4IOAA 3R2IA 2F0UA 1V1PA 1TWFH 1CZGA 2JA7H 2KQ3A 1IL2A 4K0KQ 1K73C 3RR5A 3A54A 1LTSD 4B9XA 3K58A 4CBVA 1LLRD 2E75C 2ZJPA 4NDXA 2EYHA 1S3OA 3A74A 2M9VA 4CDCC 4XXEA 4A93G 3HKZE 3F2UA 3H3VI 3H0GH 1KNEA 2MHVA 3ER0A 2JA8B 3TN2A 2JA8G 3W5OA 3C2PA 1G6PA 4HMIA 1ZYRC 1J6QA 1VQPA 4HJ7A 1N9WA 5IP9H 1IW7C 4XT3B 4R4QA 2D0PA 4JBJA 2FJ2A 3A0JA 3PUXA 1VS0A 3MVVA 3SXHA 4MTKA 5IY0A 2LXKA 4HN7A 3MXNA 4B3SL 4JCVE 3S2DB 1G8ZD 4GNXA 2R93H 4CKEA 1QOHA 1CK1A 4LFCL 4DNRB 2NVXH 1MJCA 2R93G 3VYRA 4KD4A 1MSGA 2E2JB 2R7DA 5ELFA 5LMUL 2K50A 1MJEA 4RKBA 3TSSA 4B3MQ 2B2TC 2VZAA 5JAVA 2Q2IA 3EQLC 1XXGA 4DAYA 1TWGB 5E4XA 4GKJQ 1SFOB 1WYDA 4A3EG 1M1KC 1XNQQ 2C9OA 2UXDQ 4BBRB 2E8GA 1F77A 1VQFA 1F9QA 3AB9A 3RLOA 2BH2A 2JXMB 4RHSA 1XMOQ 1TS4A 3ULLA 4BXXH 2RDHA 3M9BA 1KHIA 4ODGA 1SRUA 1B7YB 5DNFA 4AH6A 1HNWQ 4XDXA 3A8IE 2BCOA 3DUZA 5IGCA 1Y8OB 5M5WB 1AFPA 2IW3A 4IFDH 4ILWA 1JOQA 5IYDH 2JEAI 1NSNS 2HQLA 5IGEA 2XWJB 1UEAB 5I6YA 2KBNA 2WACA 2K5NA 4A3EB 1PH5A 1X65A 2KECA 2MUYA 4YCWA 1VQ8A 5BN4A 2F0EA 2F0LA 2VQEQ 1J8IA 3HOZH 2F0DA 3CC2A 1W6KA 2HQEA 3VR2A 1SNDA 2EJMA 2B3GA 3NHHA 1CKNB 3ZYYX 4A3IG 5KNCA 1K0RA 2HD3A 1Y8NB 4DV0Q 2ZXOA 3GP7A 4HCSA 2B63H 3S2HB 1SEBD 1YNJD 2A68C 2EYFA 3BS1A 1DD2A 1HXYD 1STEA 1YNJC 2A68D 4CJ0B 5FLXL 4LF9L 1DJRD 1JJ2A 3J80i 1PH1A 1K28A 1PZID 3CCJA 1GO3E 3C3LA 3I7FA 1ZKOA 5L37A 4A3FB 5LMNW 3HRZC 4A3BG 3KF6B 3HOXH 5KNDA 3CAMA 1R9TH 2KHIA 1VMCA 3SK6A 2LKVA 2WP8J 2OTLA 2PZWA 2HDLA 2B63G 3G6EA 4R4OA 1BCPF 4NW2A 2UUAL 2B2YA 1R4PB 1JWMD 1GUGA 2A69C 4KY5A 5COYA 4ZCKA 1A6XA 1I4RA 2A1AA 3IAYA 3C46A 3M4QA 1SE4A 5HGQA 5C4ZA 2E5LQ 4NXNQ 1H9KA 3D6CA 1WCMB 2KHJA 3EN2A 3WOEA 1I50H 2JJQA 5JVH3 4BY7B 2JN4A 5EBCA 4JI0L 1QB5D 3GO5A 2RA4A 1L0YB 4OGQC 4F7XA 1WTOA 3ERQA 3HOXB 3MC0B 4DAVA 1BQQT 4DUZL 4DV1L 2SNSA 3TP8A 5CORA 3FDTA 2RF4A 1BVSA 3K0YA 2NZHA 4J1MA 4R4TA 5CV9A 2OQ0A 3CD6A 4RH6A 1A15A 2R92B 1EIFA 1PTOF 2L9HA 2ES2A 1EY6A 1B8AA 4E6IA 2IPKD 2UUBL 3T4AC 1V1QA 1HA6A 5H1SE 3CC4A 2YU9H 4AIMA 3BZDB 1EYGA 3GTKB 1FVIA 4LF4L 1FR3A 1TY2A 4Q5VA 2WAQG 1C7YA 2PW5A 4FXDA 3KDFA 2PI2A 4X3SA 1YEZA 3GTQH 3MXNB 4X62Q 2VW9A 4GNXB 2F3VA 1M8AA 5JPNC 4BA1I 4CKCA 3P20A 3N6RA 5M3MB 1I6HH 5I9PA 5IGBA 4HSPA 1SYBA 3NWTA 4EGVA 2R7ZB 4MN3A 1OXSC 5C4JB 1I94L 1KLUD 2R7ZG 1SNMA 2NN6H 2DNCA 4N8FA 4JI4Q 1F9RA 3GTGB 2DUDA 3Q0AA 5EPKA 3CXCA 3OTOL 4XYOA 4GKKQ 1QILA 1PH8A 2B63B 1SBBB 1ZEQX 1LT4D 1MBYA 3SE0A 2QEXA 2F0WA 5IWAL 1O7YA 4A3JB 2F3WA 4Y7NH 4OXPA 1EZ8A 4KKSA 1M4VA 3A7AB 1UE7A 2PZTA 1B53A 1ET6A 2E2HB 1FNWA 3QB3A 4IO9A 3I4MH 4XTCS 1TWAH 2K7VA 4DR7L 3G4SA 5EKIA 2F4VQ 2LMCB 3D4RA 1XTCD 4DAYB 1KRTA 1VF5C 4JI6L 5IT9L 3K7AB 4ZK9B 1PRTF 2R93B 1IKMA 3KBXA 1LTGD 1ENAA 2NVQB 4DU9A 3LX0A 2KVMA 5CV7A 1CKMA 4JI8L 4KHPL 1V8QA 4M8AA 2EIFA 3ERSX 4BS9A 4DA2A 5C5MA 1N33L 2DNEA 1PRTD 1EIGA 2MQHA 1UEBA 2N78A 3AFPA 3TP6A 2BOSA 1CHPD 4BXXG 4A4IA 3AMUA 3VR6A 1Y1WG 4DR1L 4LF5Q 4DUYQ 3DEOA 4YCUA 3SR1A 3OIQA 1RJTA 4AQYL 1CZWA 1STGA 2K28A 2VL6A 2L12A 4MNOA 1VQKA 4RWSC 2N8NA 4FF1A 4KKUA 4A3DH 1Q3LA 1KDCA 5FLXc 3OOCA 3S9WA 2ID0A 2ZXPA 2UXDL 1YHAA 2RKSA 2E2JH 3L7ZC 4FF3A 4JYAL 4DV7L 5IODA 2F52A 3HOZG 4IURA 5KYIA 5FLXE 3M4OB 1VF7A 2K6AA 2N88A 4NXML 3BZCA 4JBWA 5GAGC 1FGUA 3T1YQ 5K5PA 3OTOQ 2UXCL 2KUMA 1B9NA 1CKOA 3RN5A 3Q8DA 4A3DG 2TSSA 1ASYA 3L9AX 2JK8A 1EZ6A 3MEHA 1CTMA 1QCBD 2N3SA 3M4YA 5A35A 4FNFA 1RHPA 1S5DD 3IFDA 4HSVA 4LFBQ 5EPLA 1PYWD 1MHWC 4DR6Q 1BF4A 2Z0SA 1CQFA 1HNXQ 1PTOB 3I91A 4WORA 4C3JG 3CCUA 1KTKA 4LF7L 1K3BC 4A3BH 3T16A 5J22A 2WAQE 4X3KA 1BOSA 2FMCA 3HOVH 4X3UA 5FK9C 5LL6X 1XWEA 1YHQA 1E2WA 3I4LA 1PRTB 3PGZA 1G291 1LUZA 2XN9C 2UUBQ 1JE5A 2I46A 1VQJA 2PCFB 2ZJQA 4MTNA 1UE1A 4NXMQ 3T56B 1XX8A 1FGBD 1VQHA 4EQPA 3H15A 1PLFA 1U4MA 4RGMA 4HJ8A 3I4MB 2WKDA 1RKNA 3EIVA 4G4KA 2I0QA 4IUVA 4IPGA 4A3CG 3J80E 3BU2A 3CU7A 1GKHA 1L1OA 4LFAL 1KNAA 4B3RL 1KD1C 3KLRA 1VQ4A 4LF8Q 4A3BB 4BY7G 5KNBA 5JJIA 4EQOA 3PIP3 4NMZA 1QJOA 2QW7A 3CPFA 5KIXA 3DLLA 2XSCA 3GTOH 4A3LH 3CCRA 3GTMB 1L0XB 2XGTA 2O5JC 4NXNL 2EZVA 2F1MA 1VQBA 2RCNA 3N52A 4G7HC 1Z7TA 2H5XA 2H1EA 4H44C 3FRPB 2QEJC 4DK3C 1F9SA 1Z47A 2VS1A 1SROA 4YCVA 1B9MA 1EIHA 1XNRL 1S4ZA 4JOIC 3HKZB 3K6OA 5C3EB 4P73A 5ELOA 5EAYA 5E3FA 4J6HA 3J81i 5KGUA 1HUNA 4IPHA 2BA0A 1B44D 1E0BA 3T53B 1HUMA 1I50B 2B2UC 1PH3A 3GTJB 2CW0D 4A3DB 1HR0L 5A2QL 5FLMH 5D3DA 2F0KA 4JC0A 4H0LC 1PTOH 1S5BD 1W2BA 3V2TA 3GD7A 1VQAA 3NPPA 3ULPA 3A7LA 1IZ6A 5AJ3L 4P72A 3MXUA 2C5CA 5JEAG 2K04A 3J7YW 4Q0FA 1O80A 3KK7A 1TR5A 2E2DC 1YHBA 2BA1A 2K4KA 3S24A 2WV6D 5LL6S 5IE8A 1AZPA 4QGUA 1W3SA 2GVAA 3SK8A 4A93H 4M1UB 1GJXA 4C2MB 4X64Q 1Y1VG 4GN3B 4A3EH 1N8RC 1U4PA 1C8CA 4MHEA 4H7BA 1HZBA 2SEBD 2NTSA 1N32L 5C4XB 1V1PB 2KA7A 1LM0A 2IHFA 4K6DA 3HP3A 4DV5Q 3CRLC 1HH2P 3J81L 2EYLA 4P2CB 2XRSD 4CGYB 5ELDA 3S14H 2A19A 3J7AF 3V96A 2VB3X 3E0JA 2DJFC 2Z6KA 1PZKD 4HR7B 1SN8A 4HIMA 3KJPA 1BBXC 4LF4Q 3FKIB 4Y7NB 3LWEA 2V4DA 3OWFA 3S17B 2UXBQ 4GKJL 1X3GA 2IL8A 1P16A 3GV3A 3TMEA 4V0BA 2UXCQ 2ALYB 5JJZA 2OCEA 4IUNA 1WTXA 3LGJA 1BXTA 2Z6KC 2A73B 4CDEC 1UE6A 2EY2A 3AU7A 3F8TA 4IOCA 2NVQH 3KDFB 1EEFD 5C6AA 4OIJA 1HQMC 2JA6B 2VQFQ 3FVQA 5ELCA 1GUTA 1IBKQ 3M4PA 2QGQA 4ID6A 4F8MA 2ZTCA 3NEMA 3I4NB 3W2DA 3OMGA 4LF7Q 1YJNA 3I72A 1TIID 2B8FA 2A6HD 2NVTB 1NE3A 1NNXA 4QUFA 3AEVA 1LTRD 1I94Q 1RDPD 4DR6L 1PDQA 1Y14B 3QR8A 4GNXC 1PXUA 1JOKA 1IBLL 1WTPA 2E5LL 2K5VA 3BZKA 2CQOA 1EL0A 4WJWA 1AE3A 1S5CD 1EEID 4HAEA 3FHWA 1PYSB 2AUJD 3H6MA 3QJYA 5KRUA 1BUVT 5M3FG 3DMUA 1U4LA 2HHHQ 4YWKA 1S40A 2ZM6L 4R8NA 3H94A 2ZTDA 3MFYA 3DM1A 1GVPA 1Z6HA 1A3VA 2EYJA 2O2LD 2HCIA 1RCVD 5FLMG 4YY3Q 1MGSA 4ME5A 2XIWA 1EUJA 3A5ZB 4RA8A 1D5MC 2JQOA 5TSSA 4N8X1 2MJ8A 1DGSA 3J81c 1D2BA 1HHVA 4TKOB 2LY7A 5M3FB 1I4HA 2CVRA 1B3QA 3HKZG 1EQQA 3SGIA 3VA5A 1XJVA 4IFDJ 5IT9E 1S72A 5CBAE 1C4QA 4S3SA 5AJ3Q 1XYIA 1PFBA 1BNZA 3NTIA 2YU9B 1AH9A 2E2IH 3BYTB 4CHTB 2B2VC 3FP9A 3DEPA 3F2CA 2EYPA 1A2TA 1NJIC 4DV6Q 1TVXA 1SYDA 4LF5L 1B70B 5FO7B 3KFUA 2E74C 3JAMi 4XYQA 2ASBA 1H9RA 2R7FA 3EJIA 4J15A 1EU3A 4K14A 5IGGA 3NE5B 3PF4A 1B1ZA 4HJ9A 3S16H 2K03A 2RVLA 2CH4W 1PH7A 2EYOA 2CHBD 4LW1A 3L0OA 3PUWA 4JBKA 2LSSA 2KCMA 4RCOA 5ELNA 4OWTB 3EBEA 1YNNC 4ZKCB 4UPAA 1BKBA 1BR9A 3H3VC 1V9PA 3GTPB 5C44H 1RF2D 3I3CA 4LJZC 1WI5A 5CV6A 3VA7A 4IJLA 2F4VL 1PH6A 1TWCB 1WCMH 3J81E 1F2LA 1O7IA 3BDLA 1DXMA 1PRTC 1DYQA 4QIWB 1JOOA 3S2DH 1DM0B 2I07B 4TRDA 1I3QH 2CCZA 1A2UA 4QUCA 1TWHH 1HNZQ 2F0SA 3VYTA 3D3RA 5ELEA 1DOMA 3ICEA 2EE1A 1G6ZA 2UUCQ 4H13C 4K5VA 4PZ7A 1NBWA 3OHXC 2K1BA 4X66L 3GTLH 5IYBH 1IBML 2HHHL 4IZ8A 2RDGA 4G7ZC 1KLGD 4UHVA 1YNXA 3K7AH 2R92H 1EFWA 1QUQA 5D65A 2NWGA 1ENCA 2K05A 5JJLA 1SDFA 3J7AV 4P75A 1LYLA 1LABA 3HS0C 3JAMc 2IX3A 5KYLA 2HIVA 4GZYC 1U0LA 1CSQA 2F0PA 2LFNA 4FP5D 1Y1VB 3S1NH 1VQCA 1DCZA 1NTGA 4TQUS 1V43A 3P1HA 3VYUA 1XMQQ 1YJWA 3U9SA 1TT2A 2EQSA 4DK6C 5FJ8H 1O7ZA 3SEBA 1LT5D 3WDNA 2E76C 4OO1H 2OWOA 3HEJA 4LMQD 1JE4A 4PQXA 3IKJA 3K5MA 1ZXTA 2AUKA 1YI2A 4CKBA 4K2LA 3GTGH 5GROA 2NVYH 4DNIA 4NPSA 3NQIA 5JOBA 5IOCA 1YZ6A 3NTKA 3J80L 1MD2D 3PSIA 5K36H 4IFDG 1EY5A 5IP7H 1X3EA 1X56A 4BBSH 3H0GG 1KRSA 1S5FD 2VUMG 4IJHA 3QWNA 2ICIA 1X3FA 1VQ7A 5BN3A 3I56A 1SNCA 1NMGA 3PV0A 4IPDA 4DV2Q 1IYUA 2F3IA 1QZHA 1SJHD 5IP9G 4DAMA 4NKLA 2LXJA 1X3PA 4FF4A 2UUAQ 4QL5A 4QIWE 2XTIA 4DV3Q 5M5YB 1IHZA 1FL0A 4BY7H 3CW2C 3RZDB 3LNNA 1EOTA 2K33A 2V1CC 2JYOA 1JB7A 1AZQA 2KHSA 1AP0A 5CYUA 3CPWA 4RAUC 5EJWA 5ISRA 1JC7A 4DK1A 3FKIG 3FPUB 1S5ED
chains in the Genus database with same CATH topology
1ASYA 5LMNQ 2JK8A 2VQFL 3RN2A 2NZOA 4UP7A 3STBD 2N3SA 1KXLA 4B3RQ 4A75A 2E2HH 4LFBQ 4JI7Q 4DR6Q 2A8VA 2K5HA 3CQZH 4P74A 1WFQA 2Z0SA 3M4OH 4BA2I 1HNXQ 4JBMA 4HIKA 1HR0W 1VQ5A 4YWLA 3CCUA 4A3GG 4LF6Q 4DR4Q 2VUMH 4X65L 4LF7L 1OTCA 3HOUG 2B29A 4AQYQ 5J3BA 4O0AA 3TREA 4AYBG 2JA6G 4A3BH 4RMFA 2YV5A 3VDYA 4IFDI 4O2DA 2WAQE 1VQ9A 1A0IA 3KOJA 3U58A 2RHQB 1YITA 3HOVH 3UDGA 4B3ML 4LF8L 3T1YL 1VQEA 1YHQA 3J7A5 4LFCQ 5LMUQ 3M85A 1RIPA 3PIOA 3PGZA 4KI0A 4JI3Q 4DPGA 3PO3H 4MZ9A 2OTJA 1G291 1LUZA 5C4XG 3ZJYC 1JJGA 2UUBQ 2ZJQA 1JE5A 3HOWH 1VQJA 2PI2E 3S2HH 4MTNA 4DV4Q 2I5LX 1MKHA 1UE1A 4YHHL 1D7QA 1U5KA 4A76A 5M3MH 1E22A 1HZ9A 4QY7A 4NXMQ 1VQHA 4C3JH 4JI8Q 3H15A 4HJ8A 2PQAA 1SMXA 1PV4A 3HOYG 3J81j 2QA4A 4DR5Q 3EIVA 1PA6A 4B3TQ 3AYHB 2I0QA 1KQSA 1N33Q 4IPGA 4K0KL 4A3CG 2UU9L 3BU2A 1D8LA 4X62L 1GKHA 1XMOL 2OQKA 1L1OA 1E1TA 4JI2L 4LFAL 3STBC 1HNWL 5M5WH 4B3RL 4OWWB 1KD1C 4DR3L 2Q2HA 1KAWA 4H02A 1YBYA 1VQ4A 4LF8Q 3CCVA 4DUYL 4BY7G 1OXUA 5JJIA 1QVGA 1IXRA 5JEAJ 3H3VH 3E0EA 5M3FH 5C4JH 4L5TA 4Y52H 1PVOA 3K81C 3WWVA 4GLVB 3ULJA 3UDXA 3CPFA 3OW2A 3PUZA 3DLLA 3GTOH 4GS3A 2DGYA 3CCRA 3TS0A 4A3LH 2YTXA 2XGTA 4WJ4A 1L1OC 4NXNL 1VQBA 2RCNA 1Q7YC 3I4NH 4X6AH 1IBKL 1HJPA 1EIYB 3TEHB 2YTVA 1ASZA 4IOAA 3OYYA 2H5XA 4DKAC 1KL9A 4DK3C 1TWFH 3JC66 1Z47A 3MEFA 2VS1A 2JA7H 4DR4L 1IL2A 4K0KQ 1K73C 3RR5A 2Y0SE 1SROA 4YCVA 1XPOA 1SE8A 4FDBA 3RZOH 1A63A 3KLWA 1XNRL 4BY1G 4JOIC 1Q8KA 4DV5L 1KIXA 1WCMG 1Q1EA 4P73A 2KCTA 3I55A 5ELOA 5EAYA 2FXQA 2HIXA 3J81i 4BY1H 4DV6L 4IPHA 2BA0A 2ZJPA 3A74A 1S3OA 2VNUD 4A3LG 4POGA 4A93G 1PH3A 3HKZE 4BBSG 4WJ3M 3H3VI 1YJ9A 3H0GH 4DV4L 2Q2UA 4GN5A 1HR0L 3ER0A 2HT1A 1MIUA 3D0FA 4LWCA 2IY5B 5FLMH 1XMQL 4JC0A 2JA8G 3W5OA 4JV5Q 1W2BA 4A3JG 3S1QH 3GD7A 1VQAA 1T9HA 3K7UC 1OXXK 3ULPA 1IZ6A 4ME3A 1G6PA 1L1OB 2CKZB 1EQRA 1J6QA 4P72A 1N9WA 3U50C 5IP9H 5AJ3L 4HJ7A 4DR2Q 1BBWA 1VQPA 2IT1A 2NN6G 5JEAG 4LF6L 4R4QA 4PZ6A 4A3MG 4HJAA 4GLXA 2D0PA 1YHBA 2BA1A 4JBJA 2K4KA 3S24A 5C44G 3U4VA 3A0JA 5IE8A 3D31A 1VS0A 3PUXA 4QGUA 3HOYH 4LNQA 1EOVA 1W3SA 1NMFA 5IY0A 1Q46A 2GVAA 2L15A 2LXKA 4DV0L 4B3SL 2AWNA 2D0OA 4JCVE 4A93H 3CF5A 4GNXA 1JJCB 4X64Q 1Y1VG 2R93H 3PCOB 4GN3B 4A3EH 1N8RC 5GAEC 4GOPA 4LFCL 1HZBA 1N32L 3B6YA 2NVXH 1MJCA 3HFZB 1E1OA 1LM0A 2IHFA 4OWXB 4HJ5A 2R93G 4DV5Q 1CSPA 2AMCB 1HH2P 1PH2A 3K80C 1VQMA 2R7DA 1PH9A 4B3SQ 1BBUA 5LMUL 1WJJA 3TRZA 2K50A 1MJEA 3AFQA 3S14H 2RHSB 3RLFA 4B3MQ 1CKNA 2VZAA 1Q82C 2A19A 2NN6I 2K14A 2Q2IA 4DR2L 4DR5L 4DV7Q 4APVA 2I5MX 4KLKA 4GKJQ 5BR8Q 1WYDA 2JA7G 3KJOA 4A3EG 1M1KC 1XNQQ 4BBRG 1K8AC 2UXDQ 1FJGQ 1JT8A 2AWOA 2E8GA 1VQFA 2Z6KA 1PYBA 4JI7L 3RLOA 1SN8A 4GOPC 4HIMA 2BH2A 3KJPA 4LF4Q 1XMOQ 3ULLA 5GADC 2PQAB 1VQLA 4BXXH 1Y1WH 5K36G 4DV2L 3M9BA 1KHIA 2UXBQ 4GKJL 1X3GA 1OXTA 1SRUA 1P16A 1B7YB 4R1JA 4AH6A 5BR8L 3KF6A 1HNWQ 2N49A 1XNQL 2UXCQ 2ALYB 3RZDH 1VCIA 2OCEA 4A3GH 3LGJA 2Z6KC 3T1HQ 1TXYA 4L5QA 1UE6A 3E9HA 4L5RC 5C3EH 4C3IH 1VQNA 3CMEA 1C9OA 2WB1E 5IP7G 1XPRA 3F8TA 3NBHB 2JEAI 4IOCA 5IYDH 2NVQH 2HQLA 5HY6A 3KDFB 1UWVA 2PMZE 2KBNA 2K5NA 1PH5A 1X65A 5C3EG 3S1RH 2VQFQ 3K8AA 4YCWA 1VQ8A 1IBKQ 3AQQA 3M4PA 3PO3G 2QGQA 1A62A 2VQEQ 3HOZH 2ZTCA 3T1HL 1SFOH 4A3IH 3NEMA 2AHOB 3CC2A 3UDFA 3KF8B 4JI6Q 3U4ZA 2CWAA 2K52A 4JI1Q 2B3GA 4LF7Q 1K83H 1YJNA 5JJKA 1K9MC 1CKNB 4A3IG 1X9NA 1NE3A 1K0RA 2YYZA 1QVCA 5E7NA 2Q2TA 3AEVA 1I94Q 4DR6L 2WFWA 4DV0Q 2JA9A 1Y14B 1TWGH 4GN4B 4GNXC 2B63H 1HNXL 4B3TL 1IBLL 2MO1A 2E5LL 2K5VA 3BZKA 4OONA 1JJ2A 1Z9FA 4LF9L 3J80i 2CQOA 1PH1A 1IBMQ 3CCJA 1AE3A 1GO3E 4X66Q 3FHWA 1PYSB 1M90C 4JI5Q 1PHJA 4YWMA 3GTJH 4GLAC 5M3FG 2HHHQ 3CP0A 4YWKA 1S40A 2ZM6L 5C0XG 3I7FA 3UE0A 5LMNW 4A3BG 4HIOA 3KF6B 3HOXH 3CAMA 1EWIA 2KHIA 1X55A 1R9TH 2AKWB 1HR0Q 2ZTDA 2MO0A 1E24A 1GVPA 4UY8C 2WP8J 1KC8C 1N36Q 2JA5G 2OTLA 4OO1G 1AE2A 3G71A 4PG3A 2B63G 2PNHA 3G6EA 4R4OA 3L2PA 2UUAL 4P71A 5FLMG 4YY3Q 2ZM6Q 3CCSA 1L0WA 1EUJA 3A5ZB 4POFA 2A1AA 2JQOA 4KHPQ 4LUVA 3CMAA 1XTDA 3DM3A 3M4QA 1DGSA 5HGQA 3J81c 2E5LQ 4NXNQ 3EN2A 2JEBI 2KHJA 4A3MH 2CWPA 1Q86C 4QQBX 3HKZG 5C4XH 3SGIA 1I50H 2JJQA 1XJVA 4AYBE 1EQQA 1VQ6A 3M3YH 4IFDJ 1H95A 1G51A 1E7ZA 1S72A 1FJGL 5AJ3Q 1OXVA 4HIDA 4JI0L 3GO5A 1AH9A 2E2IH 2YTYA 3K0XA 1PH4A 4DR7Q 3FP9A 4OO1I 3F2CA 4DUZL 4DV1L 1NJIC 4DV6Q 3I2ZA 1J5EQ 4LF5L 1B70B 4YY3L 2I5HA 3KFUA 2RF4A 4C3HH 2VY3A 3CC7A 4LF9Q 3RNUA 3JAMi 1BVSA 4R4TA 2NZHA 2C35B 3CD6A 2OQ0A 4OX9L 2ASBA 3KYHC 4JYAQ 1EIFA 4JI5L 3CCQA 4A3FH 4UP8A 2ES2A 2R7FA 1B8AA 1YVCA 2UUBL 4J15A 3A5UA 1V1QA 5H1SE 1QVFA 3PF4A 4JV5L 5IYCG 4HJ9A 3CC4A 1CUKA 2YU9H 3S16H 3TS2A 4AIMA 1EYGA 4A3CH 2JA8H 1X6OA 1PH7A 3NELA 1A8VA 1FVIA 4LF4L 2NVTH 4JI3L 3I4NG 3S15H 2WAQG 4LW1A 3L0OA 1C7YA 3PUWA 4JBKA 1NY4A 2KCMA 2LSSA 2PI2A 3KDFA 4OWTB 3EBEA 5DLQE 1YEZA 5ELNA 3GTQH 3S1MH 4JI2Q 5IT9c 1QZGA 3MXNB 4X62Q 4DR3Q 2BH8A 4UPAA 1BKBA 2VW9A 1V9PA 4GNXB 5C44H 4LFAQ 1WI5A 2F4VL 4IJLA 4RG1A 1GM5A 1Q12A 1PH6A 1WCMH 2JA6H 1O7IA 4BA1I 5M3MG 4ALPA 2EXDA 2R92G 1I6HH 1UE5A 2UU9Q 4UP9A 3S2DH 2IHEA 4BBRH 5LMNL 1I3QH 2CCZA 1WOCA 2GVBA 2GN5A 1OXSC 4QJFA 1I94L 4OX9Q 1HNZQ 2R7ZG 1TWHH 3G48A 3RLNA 4LFBL 4A3KH 4JI4Q 2VQEL 3ICEA 1RL2A 5C0XI 1VQDA 2UUCQ 4L5SA 3GTMH 2DUDA 2MFIA 4PZ7A 1NBWA 2ZJRA 3CXCA 4JI0Q 4PMWA 2CFMA 1SR3A 4EX5A 3OTOL 4A3KG 1N34Q 4GKKQ 1E3PA 2JE6I 4X66L 3GTPH 2KENA 3GTLH 3GTKH 5IYBH 1HZCA 1PH8A 1IBML 2HHHL 3HKSA 3F2DA 2UXBL 3UDIA 1VQOA 4IPCA 1Y1VH 4LUOA 4NB3A 2QEXA 2WB1G 3PIPA 1YNXA 3K7AH 2R92H 5IWAL 1EFWA 1QUQA 3I4OA 4Y7NH 4OXPA 3J80c 5FJ8G 4X65Q 5JJLA 1UE7A 4IO9A 3PUYA 1HZAA 3I4MH 4JI1L 4XTCS 4P75A 1LYLA 1TWAH 3W1BA 4DR7L 3FKIH 3G4SA 3JAMc 2F4VQ 1QUQB 5IWAQ 2HIVA 1SLJA 2IX1A 5GQOA 1U0LA 3E9IA 4JG2A 1JMCA 1CSQA 5IYBG 4DAYB 3S1NH 1KRTA 3NENA 1VQCA 4JI6L 4TVAB 1NTGA 1IYJB 4TQUS 3M7NA 1V43A 3BJUA 1YIJA 2IX0A 3CCEA 1XMQQ 1YJWA 3HOXG 1N34L 4GKKL 1P8LA 1HNZL 1X54A 2EQSA 4XIGS 2D62A 4DK6C 5FJ8H 4JI4L 1C0AA 2K75A 3W1GA 3J7ZC 2JA5H 4X64L 2OWOA 4JI8L 1CKMA 2R7ZH 4KHPL 4R4IA 2EIFA 3ERSX 1IBLQ 1K3RA 4LUZA 3IRBA 4DV3L 1YI2A 1N33L 2ATWA 3CCMA 3GTGH 5GROA 1LTLA 2NVYH 4C2MH 4DNIA 2MQHA 4NPSA 1UEBA 1N32Q 1GD7A 2N78A 1YZ6A 5M5YH 3AFPA 3PSIA 4DUZQ 4BXXG 4A4IA 3HOWG 1Y1WG 3F2BA 4DR1L 5IP7H 5IYDG 1X3EA 1X56A 4BBSH 1J5EL 2ZTEA 1KRSA 3H0GG 3PUVA 4LF5Q 2VUMG 3HOUH 4IJHA 4DUYQ 1X3FA 4YCUA 1VQ7A 1Q1BA 5M5XH 4R4CA 4A3JH 3I56A 3PF5A 4IPDA 1NMGA 3PV0A 4DV2Q 4AQYL 3HOVG 3GDEA 2VL6A 5GAHC 1TWCH 2F3IA 4JOIA 1QZHA 3CCLA 3PO2H 5IP9G 4MNOA 3TQYA 4DAMA 1Q81C 1VQKA 2N8NA 2LXJA 4A3DH 4DR1Q 3I4MG 5FLXc 4GOPB 2UUAQ 1XPUA 2ID0A 4QL5A 2UXDL 1YHAA 4QIWE 2E2JH 1L2FA 2XTIA 5C0XJ 3L7ZC 4DV3Q 4JYAL 4DV7L 1N36L 1FL0A 4BY7H 1VQIA 3CW2C 4A3DG 2F52A 3HOZG 1I5FA 1JB7A 2Y0SG 2V1CC 4KHZA 1VQGA 4PZ8A 4YHHQ 4EQ5A 3F1ZA 4IFDG 4NXML 4DV1Q 4A3FG 3S17H 1PFSA 3BZCA 4JBWA 5GAGC 1FGUA 1K8GA 3T1YQ 2UXCL 3OTOQ 2UUCL 3CPWA 3PO2G 3UE1A 5IYCH 2R6GA 1XNRQ 1CKOA 3FKIG 3RN5A 3Q8DA 2MNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASY A;  5LMN Q;  2JK8 A;  2VQF L;  3RN2 A;  2NZO A;  4UP7 A;  3STB D;  2N3S A;  1KXL A;  4B3R Q;  4A75 A;  2E2H H;  4LFB Q;  4JI7 Q;  4DR6 Q;  2A8V A;  2K5H A;  3CQZ H;  4P74 A;  1WFQ A;  2Z0S A;  3M4O H;  4BA2 I;  1HNX Q;  4JBM A;  4HIK A;  1HR0 W;  1VQ5 A;  4YWL A;  3CCU A;  4A3G G;  4LF6 Q;  4DR4 Q;  2VUM H;  4X65 L;  4LF7 L;  1OTC A;  3HOU G;  2B29 A;  4AQY Q;  5J3B A;  4O0A A;  3TRE A;  4AYB G;  2JA6 G;  4A3B H;  4RMF A;  2YV5 A;  3VDY A;  4IFD I;  4O2D A;  2WAQ E;  1VQ9 A;  1A0I A;  3KOJ A;  3U58 A;  2RHQ B;  1YIT A;  3HOV H;  3UDG A;  4B3M L;  4LF8 L;  3T1Y L;  1VQE A;  1YHQ A;  3J7A 5;  4LFC Q;  5LMU Q;  3M85 A;  1RIP A;  3PIO A;  3PGZ A;  4KI0 A;  4JI3 Q;  4DPG A;  3PO3 H;  4MZ9 A;  2OTJ A;  1G29 1;  1LUZ A;  5C4X G;  3ZJY C;  1JJG A;  2UUB Q;  2ZJQ A;  1JE5 A;  3HOW H;  1VQJ A;  2PI2 E;  3S2H H;  4MTN A;  4DV4 Q;  2I5L X;  1MKH A;  1UE1 A;  4YHH L;  1D7Q A;  1U5K A;  4A76 A;  5M3M H;  1E22 A;  1HZ9 A;  4QY7 A;  4NXM Q;  1VQH A;  4C3J H;  4JI8 Q;  3H15 A;  4HJ8 A;  2PQA A;  1SMX A;  1PV4 A;  3HOY G;  3J81 j;  2QA4 A;  4DR5 Q;  3EIV A;  1PA6 A;  4B3T Q;  3AYH B;  2I0Q A;  1KQS A;  1N33 Q;  4IPG A;  4K0K L;  4A3C G;  2UU9 L;  3BU2 A;  1D8L A;  4X62 L;  1GKH A;  1XMO L;  2OQK A;  1L1O A;  1E1T A;  4JI2 L;  4LFA L;  3STB C;  1HNW L;  5M5W H;  4B3R L;  4OWW B;  1KD1 C;  4DR3 L;  2Q2H A;  1KAW A;  4H02 A;  1YBY A;  1VQ4 A;  4LF8 Q;  3CCV A;  4DUY L;  4BY7 G;  1OXU A;  5JJI A;  1QVG A;  1IXR A;  5JEA J;  3H3V H;  3E0E A;  5M3F H;  5C4J H;  4L5T A;  4Y52 H;  1PVO A;  3K81 C;  3WWV A;  4GLV B;  3ULJ A;  3UDX A;  3CPF A;  3OW2 A;  3PUZ A;  3DLL A;  3GTO H;  4GS3 A;  2DGY A;  3CCR A;  3TS0 A;  4A3L H;  2YTX A;  2XGT A;  4WJ4 A;  1L1O C;  4NXN L;  1VQB A;  2RCN A;  1Q7Y C;  3I4N H;  4X6A H;  1IBK L;  1HJP A;  1EIY B;  3TEH B;  2YTV A;  1ASZ A;  4IOA A;  3OYY A;  2H5X A;  4DKA C;  1KL9 A;  4DK3 C;  1TWF H;  3JC6 6;  1Z47 A;  3MEF A;  2VS1 A;  2JA7 H;  4DR4 L;  1IL2 A;  4K0K Q;  1K73 C;  3RR5 A;  2Y0S E;  1SRO A;  4YCV A;  1XPO A;  1SE8 A;  4FDB A;  3RZO H;  1A63 A;  3KLW A;  1XNR L;  4BY1 G;  4JOI C;  1Q8K A;  4DV5 L;  1KIX A;  1WCM G;  1Q1E A;  4P73 A;  2KCT A;  3I55 A;  5ELO A;  5EAY A;  2FXQ A;  2HIX A;  3J81 i;  4BY1 H;  4DV6 L;  4IPH A;  2BA0 A;  2ZJP A;  3A74 A;  1S3O A;  2VNU D;  4A3L G;  4POG A;  4A93 G;  1PH3 A;  3HKZ E;  4BBS G;  4WJ3 M;  3H3V I;  1YJ9 A;  3H0G H;  4DV4 L;  2Q2U A;  4GN5 A;  1HR0 L;  3ER0 A;  2HT1 A;  1MIU A;  3D0F A;  4LWC A;  2IY5 B;  5FLM H;  1XMQ L;  4JC0 A;  2JA8 G;  3W5O A;  4JV5 Q;  1W2B A;  4A3J G;  3S1Q H;  3GD7 A;  1VQA A;  1T9H A;  3K7U C;  1OXX K;  3ULP A;  1IZ6 A;  4ME3 A;  1G6P A;  1L1O B;  2CKZ B;  1EQR A;  1J6Q A;  4P72 A;  1N9W A;  3U50 C;  5IP9 H;  5AJ3 L;  4HJ7 A;  4DR2 Q;  1BBW A;  1VQP A;  2IT1 A;  2NN6 G;  5JEA G;  4LF6 L;  4R4Q A;  4PZ6 A;  4A3M G;  4HJA A;  4GLX A;  2D0P A;  1YHB A;  2BA1 A;  4JBJ A;  2K4K A;  3S24 A;  5C44 G;  3U4V A;  3A0J A;  5IE8 A;  3D31 A;  1VS0 A;  3PUX A;  4QGU A;  3HOY H;  4LNQ A;  1EOV A;  1W3S A;  1NMF A;  5IY0 A;  1Q46 A;  2GVA A;  2L15 A;  2LXK A;  4DV0 L;  4B3S L;  2AWN A;  2D0O A;  4JCV E;  4A93 H;  3CF5 A;  4GNX A;  1JJC B;  4X64 Q;  1Y1V G;  2R93 H;  3PCO B;  4GN3 B;  4A3E H;  1N8R C;  5GAE C;  4GOP A;  4LFC L;  1HZB A;  1N32 L;  3B6Y A;  2NVX H;  1MJC A;  3HFZ B;  1E1O A;  1LM0 A;  2IHF A;  4OWX B;  4HJ5 A;  2R93 G;  4DV5 Q;  1CSP A;  2AMC B;  1HH2 P;  1PH2 A;  3K80 C;  1VQM A;  2R7D A;  1PH9 A;  4B3S Q;  1BBU A;  5LMU L;  1WJJ A;  3TRZ A;  2K50 A;  1MJE A;  3AFQ A;  3S14 H;  2RHS B;  3RLF A;  4B3M Q;  1CKN A;  2VZA A;  1Q82 C;  2A19 A;  2NN6 I;  2K14 A;  2Q2I A;  4DR2 L;  4DR5 L;  4DV7 Q;  4APV A;  2I5M X;  4KLK A;  4GKJ Q;  5BR8 Q;  1WYD A;  2JA7 G;  3KJO A;  4A3E G;  1M1K C;  1XNQ Q;  4BBR G;  1K8A C;  2UXD Q;  1FJG Q;  1JT8 A;  2AWO A;  2E8G A;  1VQF A;  2Z6K A;  1PYB A;  4JI7 L;  3RLO A;  1SN8 A;  4GOP C;  4HIM A;  2BH2 A;  3KJP A;  4LF4 Q;  1XMO Q;  3ULL A;  5GAD C;  2PQA B;  1VQL A;  4BXX H;  1Y1W H;  5K36 G;  4DV2 L;  3M9B A;  1KHI A;  2UXB Q;  4GKJ L;  1X3G A;  1OXT A;  1SRU A;  1P16 A;  1B7Y B;  4R1J A;  4AH6 A;  5BR8 L;  3KF6 A;  1HNW Q;  2N49 A;  1XNQ L;  2UXC Q;  2ALY B;  3RZD H;  1VCI A;  2OCE A;  4A3G H;  3LGJ A;  2Z6K C;  3T1H Q;  1TXY A;  4L5Q A;  1UE6 A;  3E9H A;  4L5R C;  5C3E H;  4C3I H;  1VQN A;  3CME A;  1C9O A;  2WB1 E;  5IP7 G;  1XPR A;  3F8T A;  3NBH B;  2JEA I;  4IOC A;  5IYD H;  2NVQ H;  2HQL A;  5HY6 A;  3KDF B;  1UWV A;  2PMZ E;  2KBN A;  2K5N A;  1PH5 A;  1X65 A;  5C3E G;  3S1R H;  2VQF Q;  3K8A A;  4YCW A;  1VQ8 A;  1IBK Q;  3AQQ A;  3M4P A;  3PO3 G;  2QGQ A;  1A62 A;  2VQE Q;  3HOZ H;  2ZTC A;  3T1H L;  1SFO H;  4A3I H;  3NEM A;  2AHO B;  3CC2 A;  3UDF A;  3KF8 B;  4JI6 Q;  3U4Z A;  2CWA A;  2K52 A;  4JI1 Q;  2B3G A;  4LF7 Q;  1K83 H;  1YJN A;  5JJK A;  1K9M C;  1CKN B;  4A3I G;  1X9N A;  1NE3 A;  1K0R A;  2YYZ A;  1QVC A;  5E7N A;  2Q2T A;  3AEV A;  1I94 Q;  4DR6 L;  2WFW A;  4DV0 Q;  2JA9 A;  1Y14 B;  1TWG H;  4GN4 B;  4GNX C;  2B63 H;  1HNX L;  4B3T L;  1IBL L;  2MO1 A;  2E5L L;  2K5V A;  3BZK A;  4OON A;  1JJ2 A;  1Z9F A;  4LF9 L;  3J80 i;  2CQO A;  1PH1 A;  1IBM Q;  3CCJ A;  1AE3 A;  1GO3 E;  4X66 Q;  3FHW A;  1PYS B;  1M90 C;  4JI5 Q;  1PHJ A;  4YWM A;  3GTJ H;  4GLA C;  5M3F G;  2HHH Q;  3CP0 A;  4YWK A;  1S40 A;  2ZM6 L;  5C0X G;  3I7F A;  3UE0 A;  5LMN W;  4A3B G;  4HIO A;  3KF6 B;  3HOX H;  3CAM A;  1EWI A;  2KHI A;  1X55 A;  1R9T H;  2AKW B;  1HR0 Q;  2ZTD A;  2MO0 A;  1E24 A;  1GVP A;  4UY8 C;  2WP8 J;  1KC8 C;  1N36 Q;  2JA5 G;  2OTL A;  4OO1 G;  1AE2 A;  3G71 A;  4PG3 A;  2B63 G;  2PNH A;  3G6E A;  4R4O A;  3L2P A;  2UUA L;  4P71 A;  5FLM G;  4YY3 Q;  2ZM6 Q;  3CCS A;  1L0W A;  1EUJ A;  3A5Z B;  4POF A;  2A1A A;  2JQO A;  4KHP Q;  4LUV A;  3CMA A;  1XTD A;  3DM3 A;  3M4Q A;  1DGS A;  5HGQ A;  3J81 c;  2E5L Q;  4NXN Q;  3EN2 A;  2JEB I;  2KHJ A;  4A3M H;  2CWP A;  1Q86 C;  4QQB X;  3HKZ G;  5C4X H;  3SGI A;  1I50 H;  2JJQ A;  1XJV A;  4AYB E;  1EQQ A;  1VQ6 A;  3M3Y H;  4IFD J;  1H95 A;  1G51 A;  1E7Z A;  1S72 A;  1FJG L;  5AJ3 Q;  1OXV A;  4HID A;  4JI0 L;  3GO5 A;  1AH9 A;  2E2I H;  2YTY A;  3K0X A;  1PH4 A;  4DR7 Q;  3FP9 A;  4OO1 I;  3F2C A;  4DUZ L;  4DV1 L;  1NJI C;  4DV6 Q;  3I2Z A;  1J5E Q;  4LF5 L;  1B70 B;  4YY3 L;  2I5H A;  3KFU A;  2RF4 A;  4C3H H;  2VY3 A;  3CC7 A;  4LF9 Q;  3RNU A;  3JAM i;  1BVS A;  4R4T A;  2NZH A;  2C35 B;  3CD6 A;  2OQ0 A;  4OX9 L;  2ASB A;  3KYH C;  4JYA Q;  1EIF A;  4JI5 L;  3CCQ A;  4A3F H;  4UP8 A;  2ES2 A;  2R7F A;  1B8A A;  1YVC A;  2UUB L;  4J15 A;  3A5U A;  1V1Q A;  5H1S E;  1QVF A;  3PF4 A;  4JV5 L;  5IYC G;  4HJ9 A;  3CC4 A;  1CUK A;  2YU9 H;  3S16 H;  3TS2 A;  4AIM A;  1EYG A;  4A3C H;  2JA8 H;  1X6O A;  1PH7 A;  3NEL A;  1A8V A;  1FVI A;  4LF4 L;  2NVT H;  4JI3 L;  3I4N G;  3S15 H;  2WAQ G;  4LW1 A;  3L0O A;  1C7Y A;  3PUW A;  4JBK A;  1NY4 A;  2KCM A;  2LSS A;  2PI2 A;  3KDF A;  4OWT B;  3EBE A;  5DLQ E;  1YEZ A;  5ELN A;  3GTQ H;  3S1M H;  4JI2 Q;  5IT9 c;  1QZG A;  3MXN B;  4X62 Q;  4DR3 Q;  2BH8 A;  4UPA A;  1BKB A;  2VW9 A;  1V9P A;  4GNX B;  5C44 H;  4LFA Q;  1WI5 A;  2F4V L;  4IJL A;  4RG1 A;  1GM5 A;  1Q12 A;  1PH6 A;  1WCM H;  2JA6 H;  1O7I A;  4BA1 I;  5M3M G;  4ALP A;  2EXD A;  2R92 G;  1I6H H;  1UE5 A;  2UU9 Q;  4UP9 A;  3S2D H;  2IHE A;  4BBR H;  5LMN L;  1I3Q H;  2CCZ A;  1WOC A;  2GVB A;  2GN5 A;  1OXS C;  4QJF A;  1I94 L;  4OX9 Q;  1HNZ Q;  2R7Z G;  1TWH H;  3G48 A;  3RLN A;  4LFB L;  4A3K H;  4JI4 Q;  2VQE L;  3ICE A;  1RL2 A;  5C0X I;  1VQD A;  2UUC Q;  4L5S A;  3GTM H;  2DUD A;  2MFI A;  4PZ7 A;  1NBW A;  2ZJR A;  3CXC A;  4JI0 Q;  4PMW A;  2CFM A;  1SR3 A;  4EX5 A;  3OTO L;  4A3K G;  1N34 Q;  4GKK Q;  1E3P A;  2JE6 I;  4X66 L;  3GTP H;  2KEN A;  3GTL H;  3GTK H;  5IYB H;  1HZC A;  1PH8 A;  1IBM L;  2HHH L;  3HKS A;  3F2D A;  2UXB L;  3UDI A;  1VQO A;  4IPC A;  1Y1V H;  4LUO A;  4NB3 A;  2QEX A;  2WB1 G;  3PIP A;  1YNX A;  3K7A H;  2R92 H;  5IWA L;  1EFW A;  1QUQ A;  3I4O A;  4Y7N H;  4OXP A;  3J80 c;  5FJ8 G;  4X65 Q;  5JJL A;  1UE7 A;  4IO9 A;  3PUY A;  1HZA A;  3I4M H;  4JI1 L;  4XTC S;  4P75 A;  1LYL A;  1TWA H;  3W1B A;  4DR7 L;  3FKI H;  3G4S A;  3JAM c;  2F4V Q;  1QUQ B;  5IWA Q;  2HIV A;  1SLJ A;  2IX1 A;  5GQO A;  1U0L A;  3E9I A;  4JG2 A;  1JMC A;  1CSQ A;  5IYB G;  4DAY B;  3S1N H;  1KRT A;  3NEN A;  1VQC A;  4JI6 L;  4TVA B;  1NTG A;  1IYJ B;  4TQU S;  3M7N A;  1V43 A;  3BJU A;  1YIJ A;  2IX0 A;  3CCE A;  1XMQ Q;  1YJW A;  3HOX G;  1N34 L;  4GKK L;  1P8L A;  1HNZ L;  1X54 A;  2EQS A;  4XIG S;  2D62 A;  4DK6 C;  5FJ8 H;  4JI4 L;  1C0A A;  2K75 A;  3W1G A;  3J7Z C;  2JA5 H;  4X64 L;  2OWO A;  4JI8 L;  1CKM A;  2R7Z H;  4KHP L;  4R4I A;  2EIF A;  3ERS X;  1IBL Q;  1K3R A;  4LUZ A;  3IRB A;  4DV3 L;  1YI2 A;  1N33 L;  2ATW A;  3CCM A;  3GTG H;  5GRO A;  1LTL A;  2NVY H;  4C2M H;  4DNI A;  2MQH A;  4NPS A;  1UEB A;  1N32 Q;  1GD7 A;  2N78 A;  1YZ6 A;  5M5Y H;  3AFP A;  3PSI A;  4DUZ Q;  4BXX G;  4A4I A;  3HOW G;  1Y1W G;  3F2B A;  4DR1 L;  5IP7 H;  5IYD G;  1X3E A;  1X56 A;  4BBS H;  1J5E L;  2ZTE A;  1KRS A;  3H0G G;  3PUV A;  4LF5 Q;  2VUM G;  3HOU H;  4IJH A;  4DUY Q;  1X3F A;  4YCU A;  1VQ7 A;  1Q1B A;  5M5X H;  4R4C A;  4A3J H;  3I56 A;  3PF5 A;  4IPD A;  1NMG A;  3PV0 A;  4DV2 Q;  4AQY L;  3HOV G;  3GDE A;  2VL6 A;  5GAH C;  1TWC H;  2F3I A;  4JOI A;  1QZH A;  3CCL A;  3PO2 H;  5IP9 G;  4MNO A;  3TQY A;  4DAM A;  1Q81 C;  1VQK A;  2N8N A;  2LXJ A;  4A3D H;  4DR1 Q;  3I4M G;  5FLX c;  4GOP B;  2UUA Q;  1XPU A;  2ID0 A;  4QL5 A;  2UXD L;  1YHA A;  4QIW E;  2E2J H;  1L2F A;  2XTI A;  5C0X J;  3L7Z C;  4DV3 Q;  4JYA L;  4DV7 L;  1N36 L;  1FL0 A;  4BY7 H;  1VQI A;  3CW2 C;  4A3D G;  2F52 A;  3HOZ G;  1I5F A;  1JB7 A;  2Y0S G;  2V1C C;  4KHZ A;  1VQG A;  4PZ8 A;  4YHH Q;  4EQ5 A;  3F1Z A;  4IFD G;  4NXM L;  4DV1 Q;  4A3F G;  3S17 H;  1PFS A;  3BZC A;  4JBW A;  5GAG C;  1FGU A;  1K8G A;  3T1Y Q;  2UXC L;  3OTO Q;  2UUC L;  3CPW A;  3PO2 G;  3UE1 A;  5IYC H;  2R6G A;  1XNR Q;  1CKO A;  3FKI G;  3RN5 A;  3Q8D A;  2MNA A; 
#chains in the Genus database with same CATH topology
 5LMN Q;  2VQF L;  2NZO A;  3K5O A;  5CBE E;  4A3I B;  4B3R Q;  2QDB A;  2EY5 A;  1B4O A;  3BVZ A;  2A8V A;  3E6Z X;  4BA2 I;  3GTO B;  3M4O H;  2KED A;  1T5E A;  4UDU C;  4OHJ A;  4X65 L;  3Q6S A;  1OTC A;  2ENB A;  4AQY Q;  2JA6 G;  3TRE A;  3VDY A;  3RUZ A;  4O2D A;  1A0I A;  2R3Z A;  3KOJ A;  5C5L A;  3EA6 A;  3U58 A;  1YIT A;  4KMU C;  4B3M L;  1VQE A;  1HQR D;  5LMU Q;  2ZT9 C;  4JI3 Q;  3MHB A;  4B08 A;  4DPG A;  3L3O C;  1K0S A;  2PI2 E;  4JPB W;  4DV4 Q;  3K5L A;  4DFA A;  1MKH A;  5I6W A;  4YHH L;  1D7Q A;  4A76 A;  2EDG A;  5M3M H;  1HZ9 A;  1SE3 A;  4JI8 Q;  2F0M A;  1WTW A;  1SMX A;  3HOY G;  3RD4 A;  2QA4 A;  1KDA A;  4CDD C;  2ICE C;  3TDQ A;  1ILQ A;  1LTB D;  1WVL A;  2HUG A;  1IW7 D;  2UU9 L;  4HED A;  4X62 L;  1H9J A;  1XMO L;  1STN A;  5M5W H;  2VUM B;  4DR3 L;  4H02 A;  4V19 0;  3QG1 A;  2FFK B;  1QVG A;  1IXR A;  1HA5 A;  4QF4 A;  1EY0 A;  1PVO A;  3K81 C;  4GLV B;  2J7Z A;  2B2U A;  3OW2 A;  1ROD A;  2DGY A;  2YTX A;  3MWY W;  1Q7Y C;  1IBK L;  1ASZ A;  3OYY A;  3MEF A;  4DR4 L;  1F2Y A;  1XPO A;  1SE8 A;  4FDB A;  5D3I B;  2A74 C;  3KLW A;  3P75 A;  4C1N I;  1WCM G;  1Q1E A;  4IUQ A;  2KCT A;  1LTA D;  3I55 A;  3EVQ A;  2FXQ A;  2HIX A;  4BY1 H;  3OSO A;  4XQJ A;  4A3L G;  1A3U A;  3E5S A;  1CA6 A;  5IGF A;  4POG A;  3ND8 A;  4BBS G;  3QIA A;  4WJ3 M;  1YJ9 A;  2F0O A;  2Q2U A;  4GN5 A;  2HT1 A;  1MIU A;  1XMQ L;  2X6L A;  3CQZ B;  2VB2 X;  4PMB A;  1K8O A;  2A6E C;  3K7U C;  1OXX K;  3RZO B;  1L1O B;  2XVS A;  2K01 A;  2IT1 A;  4PZ6 A;  3T51 B;  4HJA A;  5EPJ A;  5C44 B;  3UI2 A;  3U4V A;  1GUW A;  3HOY H;  3QOL A;  1EOV A;  1Q46 A;  1R4Q B;  2KCN A;  1PTO C;  2FIN B;  2AQ2 B;  1JJC B;  1ICW A;  4GOP A;  2N55 A;  2WII B;  1B3A A;  3NP8 A;  3S1Q B;  3HFZ B;  4OWX B;  1DOK A;  1LTT D;  2EJG C;  1CSP A;  1Q90 A;  3MXG A;  4YIJ A;  3K80 C;  5DEH A;  1AEX A;  2EVB A;  4DK0 A;  2IJ0 A;  1C48 A;  1WJJ A;  3TRZ A;  1HFG A;  4L6T B;  3NBI A;  3RLF A;  3JAM L;  1LT6 D;  1Q82 C;  4DR2 L;  4DV7 Q;  3TZD A;  2Y0S B;  2I5M X;  2DY7 A;  5BR8 Q;  1I4G A;  2F03 A;  4QMG A;  1JT8 A;  4CJ1 B;  2A6H C;  2PPB C;  3BYY B;  3VR4 A;  4PV1 C;  5C3X A;  2F0H A;  2EY6 A;  3KLS A;  3URY A;  5GAD C;  2DN8 A;  2PQA B;  1VQL A;  4KK7 A;  1EQT A;  5CMD A;  3O13 A;  2GA4 B;  1UNS A;  1RTN A;  2OEO A;  4A3G H;  1VCI A;  3GTQ B;  4L5Q A;  2K5W A;  4L5R C;  1FNU A;  3TZU A;  1VQN A;  2A69 D;  2WB1 E;  4RFB A;  5IP7 G;  3K57 A;  5J1Z A;  1BCP C;  4KY6 A;  4RKL A;  4KJO A;  3PO3 B;  3PO3 G;  3R2T A;  3D4W A;  1SFO H;  1TU2 B;  2DY8 A;  2PMZ B;  5FOB B;  3UDF A;  4JI6 Q;  1B50 A;  3W3A A;  2K52 A;  4JI1 Q;  3KBG A;  1SYE A;  2L1B A;  3M3Y B;  1K83 H;  5JJK A;  1X9N A;  1QVC A;  2LS0 1;  2F0N A;  2XWB B;  1G91 A;  2WFW A;  4TSS A;  2E2I B;  2L5T A;  1D5Z C;  3VR3 A;  4B3T L;  4RHR A;  2WKC A;  3S1R B;  2B39 A;  5JPM C;  1ZYR D;  4OON A;  1Z9F A;  2PO4 A;  2FHT A;  4JI5 Q;  1PHJ A;  1LAC A;  1D6E C;  4YWM A;  4GLA C;  1EQV A;  2Z8L A;  2DJG C;  3GV6 A;  3IFT A;  5NUC A;  5DM7 3;  3EFX D;  1X55 A;  1JB3 A;  2AKW B;  4FO2 A;  1HR0 Q;  5CV8 A;  4UY8 C;  1KC8 C;  1SAP A;  1N36 Q;  2JA5 G;  1AE2 A;  2PNH A;  1IKL A;  1K83 B;  1SYF A;  2ZM6 Q;  4POF A;  2EPB A;  3KLS X;  4LUV A;  4KHP Q;  1STY A;  2L0C A;  1TKW B;  1TS2 A;  1Q86 C;  2CWP A;  5T1G A;  1H95 A;  4AYB E;  1VQ6 A;  1E7Z A;  5EGT A;  2M00 A;  1SNP A;  1OXV A;  3A8K E;  4HID A;  2F0Q A;  2YTY A;  2G9H D;  4DR7 Q;  4OO1 I;  5CV5 A;  1SNQ A;  1J5E Q;  1QNK A;  4YY3 L;  4PNY A;  4JW0 A;  4I65 A;  1TS3 A;  4LF9 Q;  4RGO S;  1CI3 M;  4JYA Q;  3KYH C;  3CCQ A;  4JI5 L;  1HPC A;  4UP8 A;  1YVC A;  5I4D A;  1QG7 A;  1GOZ A;  1QVF A;  1QWY A;  4JV5 L;  1CM9 A;  1CUK A;  3TS2 A;  4KV6 A;  3SDZ A;  4A3C H;  1X6O A;  3S15 H;  3MFG A;  3NEL A;  1SE2 A;  4R8I A;  4BWG B;  2KEE A;  1GUO A;  1NY4 A;  2OT2 A;  4CJ2 C;  5DLQ E;  2B2W A;  3DHQ A;  4KN7 C;  2Z1C A;  4DR3 Q;  2BH8 A;  2CH4 A;  4G7O C;  3D4D A;  4K5X A;  4FF2 A;  4DAP A;  2L4N A;  2UU9 Q;  2IHE A;  3HOZ B;  2GVB A;  1II3 A;  4OX9 Q;  3G48 A;  2JA7 B;  1R9T B;  3RLN A;  2H4O A;  4LFB L;  3SHL A;  1RL2 A;  3DWP A;  2MFI A;  2ZJR A;  5A2Q E;  5DAU A;  4PMW A;  2CFM A;  4EX5 A;  2FMM A;  4A3K G;  3GTP H;  2KEN A;  3GTK H;  1NR2 A;  3HKS A;  3F2D A;  3UDI A;  4OEL B;  1VQO A;  4IPC A;  1Y1V H;  2NUC A;  3S1N B;  4LUO A;  4NB3 A;  2X69 A;  2WB1 G;  4KN4 C;  3PIP A;  1LV9 A;  1VDZ A;  3I4O A;  1KAB A;  1FD7 D;  2F0T A;  3J80 c;  4X65 Q;  3VR5 A;  1I4Q A;  4DGZ A;  4ULL A;  2JP1 A;  1F2M A;  4HMJ A;  4BY1 B;  4LAA A;  1HZA A;  4JI1 L;  2AQ1 B;  3W1B A;  3FKI H;  4KKT A;  1O78 A;  5IWA Q;  3E9I A;  1JMC A;  5IYB G;  3C1F A;  4ZRZ A;  2QDL A;  3NEN A;  3NTH A;  2BE5 D;  3M7N A;  3HOX G;  4IN3 A;  4GKK L;  1P8L A;  1X54 A;  2RSN A;  1DOL A;  2F4I A;  4JI4 L;  1C0A A;  2OXP A;  2RCF A;  2JA5 H;  1CFM A;  1I3Q B;  1RTO A;  1IBL Q;  3U9O A;  1K3R A;  4DV3 L;  1HFN A;  2KOL A;  1N32 Q;  1GUN A;  1SMY D;  1GD7 A;  5M5Y H;  5D14 A;  2XNA C;  4C3I G;  3HOW G;  3F2B A;  2ZTE A;  1TWA B;  1JIC A;  1Q1B A;  4R4C A;  3PF5 A;  3GDE A;  4JOI A;  3TQY A;  4Z9C B;  4WRD A;  3I4M G;  1SMY C;  1XPU A;  4F88 A;  3OW7 A;  1L2F A;  1QE6 A;  5C0X J;  1BDO A;  3NK9 A;  1VQI A;  1WTR A;  1JWU D;  1NCV A;  3H91 A;  1I5F A;  2B2W C;  2Y0S G;  3X3N A;  1D5X C;  1VQG A;  4PZ8 A;  4QB4 A;  3F1Z A;  4DV1 Q;  4A3F G;  2CW0 C;  3R3O A;  3BDC A;  3PO2 B;  2BE5 C;  5IYC H;  1XNR Q;  2MNA A;  4KTA A;  3NBH A;  3I90 A;  4UP7 A;  4KJN A;  1I6H B;  1KXL A;  2E2H H;  4JI7 Q;  2O4X A;  5G3L D;  4JBM A;  4HIK A;  4A3G G;  2Q8R E;  4A3G B;  2B29 A;  3KF8 A;  5J3B A;  4O0A A;  2QKI C;  5E1F A;  1RD9 D;  4RMF A;  2YV5 A;  4IFD I;  1GHJ A;  1VQ9 A;  5EBD A;  2EJF C;  1AW7 A;  3UDG A;  4LF8 L;  3T1Y L;  3M85 A;  4X3T A;  1ONL A;  4KI0 A;  3P7J A;  3PO3 H;  4U68 A;  3Q23 A;  3ONA B;  2OTJ A;  5C4X G;  1H9M A;  4K6L A;  4DF7 A;  4C3H G;  3HOW H;  3S2H H;  4C3H B;  3JAM E;  1IL8 A;  3FEW X;  3BVM A;  1EYD A;  3MXP A;  4C3J H;  1PA6 A;  4B3T Q;  3AYH B;  3VYS A;  4ABN A;  1TWH B;  2F0V A;  3PMF A;  4K0K L;  3TP7 A;  3OMC A;  3S14 B;  1D8L A;  2X6G A;  3ITP A;  1E1T A;  4JI2 L;  2AQ3 B;  5I2X A;  2VXW A;  1YBY A;  2QIL A;  3CCV A;  4DUY L;  3G7L A;  5JEA J;  3H3V H;  1FYC A;  4L5T A;  4Y52 H;  1PFN A;  3QO2 A;  4A3K B;  2JA5 B;  3PUZ A;  4GS3 A;  3TS0 A;  1L1O C;  2HCC A;  3I4N H;  1EIY B;  4CDF C;  4MIU A;  4DKA C;  2G5D A;  2SDF A;  5IIF A;  1KL9 A;  5CR3 A;  1GXD C;  2J0T D;  3JC6 6;  1CQV A;  2PQE A;  1STB A;  2Y0S E;  4C3J B;  1EU4 A;  3RZO H;  1A63 A;  3E3X A;  4L8J A;  4BY1 G;  3OWE B;  3D8G A;  1Q8K A;  1UAP A;  4DV5 L;  1KIX A;  1WTV A;  3K59 A;  3GTL B;  3Q22 A;  5DM6 3;  1CT1 D;  2B8G A;  4DV6 L;  2VNU D;  4DV4 L;  3QOJ A;  3D0F A;  4LWC A;  2IY5 B;  1PTO D;  2F0F A;  4JV5 Q;  1Y8P B;  4A3J G;  3S1Q H;  1T9H A;  2K32 A;  4K8I A;  4ME3 A;  4I7Z C;  1EQR A;  1J9O A;  2CKZ B;  4G57 A;  3U50 C;  4DR2 Q;  1XPR A;  1O7L A;  1BBW A;  2NYZ D;  2NN6 G;  1U4R A;  2PZU A;  4A3M G;  4LF6 L;  3BVG A;  4J8Q A;  4GLX A;  5C44 G;  4XQN A;  3D31 A;  1ESR A;  4LNQ A;  3NUC A;  1NMF A;  2BDO A;  2L15 A;  4DV0 L;  1EY7 A;  2AWN A;  2CQA A;  2D0O A;  3HGB A;  5M5X B;  3CF5 A;  1YNN D;  3ERO A;  2NVY B;  3HOW B;  3PCO B;  1STH A;  5GAE C;  4OL7 A;  3B6Y A;  1E1O A;  4HJ5 A;  3NSW A;  1F2Z A;  2AMC B;  1G2T A;  1PH2 A;  3PQI A;  1VQM A;  2EXZ A;  2P5Z X;  1PH9 A;  4B3S Q;  1BBU A;  2KJX A;  3AFQ A;  2RHS B;  3SK5 A;  1CKN A;  1BCP D;  2NN6 I;  2K14 A;  4DR5 L;  4APV A;  5HGT A;  2JSO A;  4XQQ A;  2A6E D;  4KLK A;  3I70 A;  1ESF A;  3WOF A;  4I7A A;  3KJO A;  2JA7 G;  2L11 A;  1AN8 A;  3HZX A;  4BBR G;  1K8A C;  1FJG Q;  1ILP A;  2AWO A;  1I6V C;  1PYB A;  4JI7 L;  1F9P A;  2Q8I B;  4GOP C;  1EWC A;  1STA A;  2RSO A;  3R8B A;  2NB0 A;  4OEM B;  4R9W A;  5K36 G;  1Y1W H;  4DV2 L;  5M9O A;  1OXT A;  1ML0 D;  4R1J A;  5BR8 L;  3KF6 A;  3MZ5 A;  3SVM A;  4NP5 A;  2N49 A;  3BDO A;  1PZJ D;  1XNQ L;  1E2V A;  2MPM A;  3RZD H;  1HTP A;  1JQY D;  1WD1 A;  3S1M B;  3T1H Q;  1TXY A;  2KCC A;  5C4H A;  3E9H A;  5C3E H;  4FXG C;  4C3I H;  3CME A;  1C9O A;  2QCP X;  3NBH B;  5HY6 A;  1UWV A;  2PMZ E;  1JOR A;  4AYB B;  5C3E G;  4IAL A;  3S1R H;  5IGD A;  1SXT A;  3TP5 A;  3K8A A;  3AQQ A;  1A62 A;  2B2Y C;  3ND9 A;  3T1H L;  3R93 A;  4A3I H;  3CRK C;  1EY4 A;  2AHO B;  3KF8 B;  3U4Z A;  2RDF A;  2CWA A;  4N9P A;  5AFW A;  5E4W C;  1WTQ A;  2O5I C;  4IUU A;  1K9M C;  4KD3 A;  4F87 A;  1GHK A;  2YYZ A;  5E7N A;  3Q24 A;  2Q2T A;  1PMR A;  1DZ1 A;  2JA9 A;  1TWG H;  4GN4 B;  5FO8 B;  1HNX L;  4KY7 A;  3PIO 3;  1U9R A;  2MO1 A;  2J4X A;  1IBM Q;  4IUP A;  4FXK C;  4LK1 C;  4X66 Q;  1M90 C;  1IYV A;  4C3I B;  4ZLT F;  5CV4 A;  3GTJ H;  3CP0 A;  4HTH A;  3CHB D;  5C0X G;  2G9D A;  3UE0 A;  4HIO A;  1EWI A;  1T5X D;  2A5H A;  2D9U A;  1E24 A;  2MO0 A;  3CKI B;  1W6J A;  1SYC A;  4OO1 G;  1EY8 A;  4L63 B;  4O1N A;  4ZAI A;  3G71 A;  4PG3 A;  4RCN A;  2L55 A;  1HRJ A;  1D1K A;  3LWU A;  3L2P A;  2TMP A;  4P71 A;  2D5D A;  3CCS A;  1L0W A;  1HCZ A;  1JCK B;  3CMA A;  1XTD A;  3DM3 A;  5I2Y A;  5FO9 B;  2JEB I;  4A3M H;  4QQB X;  2R61 A;  5C4X H;  1K8M A;  5EKL A;  3M3Y H;  1G51 A;  4K8J A;  3X3M A;  1FJG L;  1NUC A;  1A3T A;  3K0X A;  1PH4 A;  1H9S B;  5LHY 1;  4QCL A;  3I2Z A;  3FPP A;  4RGN A;  2I5H A;  2NBF A;  4C3H H;  2VY3 A;  3CC7 A;  3RNU A;  2C35 B;  4OX9 L;  2F0J A;  3K5N A;  4A3F H;  3MTS A;  2B2V A;  3OPO A;  3A5U A;  4DN4 M;  1SNO A;  2QF7 A;  5IYC G;  1Y1W B;  2NVX B;  4N9T A;  4DNT B;  2JA8 H;  2BDN A;  1A8V A;  2NVT H;  4JI3 L;  3V05 A;  3I4N G;  3I73 A;  2EY1 A;  4O42 A;  3D6W A;  2SOB A;  5HUR A;  3S1M H;  2Z4I A;  4U67 3;  2Z9H A;  4JI2 Q;  5IT9 c;  1QZG A;  2K5D A;  2WIN B;  4IQZ A;  4LFA Q;  4HCE A;  4RG1 A;  2PNR C;  1GM5 A;  1Q12 A;  3HOY B;  2JA6 H;  4JVZ A;  5M3M G;  4ALP A;  2EXD A;  1LT3 D;  2R92 G;  1UE5 A;  3NQT A;  3M7G A;  4UP9 A;  4BBR H;  5LMN L;  1E2Z A;  1X32 A;  1WOC A;  2GN5 A;  4QJF A;  2EOT A;  3TBI B;  4A3K H;  2VQE L;  3OIP A;  2MP1 A;  5C0X I;  1VQD A;  4L5S A;  3GTM H;  1HTL D;  4JI0 Q;  3MA2 B;  1SR3 A;  1QNU A;  4OIK A;  5CC4 A;  1Y69 U;  1N34 Q;  1E3P A;  2JE6 I;  1BCP B;  1HZC A;  2SNM A;  2UXB L;  5JEA H;  1JR0 D;  1WTH A;  1EYC A;  1PFM A;  1WD0 A;  1I4P A;  1ICF B;  3DWA A;  5FJ8 G;  1SYG A;  3PUY A;  4C1N K;  3HOU B;  2NZ1 D;  3T13 A;  3H09 A;  4DXF A;  1FNV A;  1ET9 A;  2D2C C;  1QUQ B;  2IX1 A;  1SLJ A;  5GQO A;  4JG2 A;  2NTT A;  1SJE D;  2PW7 A;  4TVA B;  1IYJ B;  3BJU A;  1YIJ A;  2IX0 A;  3CCE A;  4FYD A;  1N34 L;  4ZUI A;  3RMH A;  1HNZ L;  3C1E A;  4XIG S;  2D62 A;  1KDB A;  2K75 A;  4KHV A;  3W1G A;  3J7Z C;  4X64 L;  4ZKB B;  2R7Z H;  5G3L F;  4A3M B;  3NXW A;  4R4I A;  2RQX A;  4LUZ A;  3IRB A;  2ATW A;  3CCM A;  4UAI A;  1LTL A;  4C2M H;  4WFN 3;  1Q8I A;  4FVM A;  1TWF B;  5C0X H;  2XRQ D;  4DUZ Q;  5C3W A;  2Z6B A;  5FKA C;  5IYD G;  1J5E L;  3PUV A;  1OO9 B;  4EVO A;  3HOU H;  1CHQ D;  1ENF A;  3A55 A;  2HDM A;  5M5X H;  3HOV B;  4A3J H;  1TS5 A;  3G6J B;  3HOV G;  5T1I A;  3PO2 H;  5GAH C;  1TWC H;  1V1O A;  3CCL A;  3GQB A;  1G2S A;  1Q81 C;  5EKK A;  1BO0 A;  4DR1 Q;  4GOP B;  1NAP A;  3IL8 A;  2B2T A;  2MGS A;  5BN5 A;  1N36 L;  3S16 B;  4C56 C;  4EQN A;  4KHZ A;  5CGK A;  4PMC A;  1MI2 A;  4YHH Q;  2PYK A;  4EQ5 A;  3S17 H;  1PFS A;  5ELB A;  1KAA A;  1K8G A;  4IUT A;  4DXG A;  4ZYS A;  2UUC L;  2EYM A;  1EFI D;  3PO2 G;  3UE1 A;  4BBS B;  2R6G A;  4B9W A;  1D1I A;  1VMP A;  1GUS A;  2OF1 A;  2WB1 B;  1UUP A;  3RN2 A;  3STB D;  2F0I A;  4A75 A;  3FMC A;  1SSO A;  2K5H A;  3CQZ H;  4P74 A;  1WFQ A;  1JWS D;  1HR0 W;  1VQ5 A;  2K5Q A;  4YWL A;  1LTI D;  3I8Z A;  4LF6 Q;  2VUM H;  4DR4 Q;  5I9O A;  3HOU G;  2RBM A;  4AYB G;  3A8J E;  2F0G A;  3S15 B;  2RHQ B;  1TY0 A;  4RGT A;  1EY9 A;  3J7A 5;  3DXJ C;  1NR4 A;  4LFC Q;  4K2K A;  1RIP A;  3PIO A;  1MSH A;  4MZ9 A;  1EYA A;  2WAQ B;  3A56 A;  3ZJY C;  4K5W A;  3MAQ A;  1JJG A;  3KUP A;  1I4X A;  3BG3 A;  2I5L X;  2Z4H A;  3DWQ A;  2IWH A;  4ZQ3 A;  1B2T A;  1U5K A;  5EQ0 A;  1E22 A;  4QY7 A;  2Q8T A;  2PQA A;  3SK4 A;  5JVG 3;  1PV4 A;  3J81 j;  4DR5 Q;  1X3Q A;  5J39 A;  1KQS A;  1N33 Q;  1H9S A;  2ZXR A;  2OQK A;  4JK1 C;  3STB C;  1LO5 D;  1HNW L;  4OWW B;  5F2D A;  2Q2H A;  1KAW A;  1CA5 A;  3H0G B;  1OXU A;  5KEE A;  3E0E A;  4ZUJ A;  5M3F H;  5C4J H;  3WWV A;  2M2L A;  1TQO A;  3ULJ A;  3UDX A;  4A93 B;  1EWH A;  3HG9 A;  4XT1 B;  4WJ4 A;  1DON A;  4X6A H;  3NWS A;  1HJP A;  3TEH B;  2YTV A;  4IOA A;  3R2I A;  2F0U A;  1V1P A;  1TWF H;  1CZG A;  2JA7 H;  2KQ3 A;  1IL2 A;  4K0K Q;  1K73 C;  3RR5 A;  3A54 A;  1LTS D;  4B9X A;  3K58 A;  4CBV A;  1LLR D;  2E75 C;  2ZJP A;  4NDX A;  2EYH A;  1S3O A;  3A74 A;  2M9V A;  4CDC C;  4XXE A;  4A93 G;  3HKZ E;  3F2U A;  3H3V I;  3H0G H;  1KNE A;  2MHV A;  3ER0 A;  2JA8 B;  3TN2 A;  2JA8 G;  3W5O A;  3C2P A;  1G6P A;  4HMI A;  1ZYR C;  1J6Q A;  1VQP A;  4HJ7 A;  1N9W A;  5IP9 H;  1IW7 C;  4XT3 B;  4R4Q A;  2D0P A;  4JBJ A;  2FJ2 A;  3A0J A;  3PUX A;  1VS0 A;  3MVV A;  3SXH A;  4MTK A;  5IY0 A;  2LXK A;  4HN7 A;  3MXN A;  4B3S L;  4JCV E;  3S2D B;  1G8Z D;  4GNX A;  2R93 H;  4CKE A;  1QOH A;  1CK1 A;  4LFC L;  4DNR B;  2NVX H;  1MJC A;  2R93 G;  3VYR A;  4KD4 A;  1MSG A;  2E2J B;  2R7D A;  5ELF A;  5LMU L;  2K50 A;  1MJE A;  4RKB A;  3TSS A;  4B3M Q;  2B2T C;  2VZA A;  5JAV A;  2Q2I A;  3EQL C;  1XXG A;  4DAY A;  1TWG B;  5E4X A;  4GKJ Q;  1SFO B;  1WYD A;  4A3E G;  1M1K C;  1XNQ Q;  2C9O A;  2UXD Q;  4BBR B;  2E8G A;  1F77 A;  1VQF A;  1F9Q A;  3AB9 A;  3RLO A;  2BH2 A;  2JXM B;  4RHS A;  1XMO Q;  1TS4 A;  3ULL A;  4BXX H;  2RDH A;  3M9B A;  1KHI A;  4ODG A;  1SRU A;  1B7Y B;  5DNF A;  4AH6 A;  1HNW Q;  4XDX A;  3A8I E;  2BCO A;  3DUZ A;  5IGC A;  1Y8O B;  5M5W B;  1AFP A;  2IW3 A;  4IFD H;  4ILW A;  1JOQ A;  5IYD H;  2JEA I;  1NSN S;  2HQL A;  5IGE A;  2XWJ B;  1UEA B;  5I6Y A;  2KBN A;  2WAC A;  2K5N A;  4A3E B;  1PH5 A;  1X65 A;  2KEC A;  2MUY A;  4YCW A;  1VQ8 A;  5BN4 A;  2F0E A;  2F0L A;  2VQE Q;  1J8I A;  3HOZ H;  2F0D A;  3CC2 A;  1W6K A;  2HQE A;  3VR2 A;  1SND A;  2EJM A;  2B3G A;  3NHH A;  1CKN B;  3ZYY X;  4A3I G;  5KNC A;  1K0R A;  2HD3 A;  1Y8N B;  4DV0 Q;  2ZXO A;  3GP7 A;  4HCS A;  2B63 H;  3S2H B;  1SEB D;  1YNJ D;  2A68 C;  2EYF A;  3BS1 A;  1DD2 A;  1HXY D;  1STE A;  1YNJ C;  2A68 D;  4CJ0 B;  5FLX L;  4LF9 L;  1DJR D;  1JJ2 A;  3J80 i;  1PH1 A;  1K28 A;  1PZI D;  3CCJ A;  1GO3 E;  3C3L A;  3I7F A;  1ZKO A;  5L37 A;  4A3F B;  5LMN W;  3HRZ C;  4A3B G;  3KF6 B;  3HOX H;  5KND A;  3CAM A;  1R9T H;  2KHI A;  1VMC A;  3SK6 A;  2LKV A;  2WP8 J;  2OTL A;  2PZW A;  2HDL A;  2B63 G;  3G6E A;  4R4O A;  1BCP F;  4NW2 A;  2UUA L;  2B2Y A;  1R4P B;  1JWM D;  1GUG A;  2A69 C;  4KY5 A;  5COY A;  4ZCK A;  1A6X A;  1I4R A;  2A1A A;  3IAY A;  3C46 A;  3M4Q A;  1SE4 A;  5HGQ A;  5C4Z A;  2E5L Q;  4NXN Q;  1H9K A;  3D6C A;  1WCM B;  2KHJ A;  3EN2 A;  3WOE A;  1I50 H;  2JJQ A;  5JVH 3;  4BY7 B;  2JN4 A;  5EBC A;  4JI0 L;  1QB5 D;  3GO5 A;  2RA4 A;  1L0Y B;  4OGQ C;  4F7X A;  1WTO A;  3ERQ A;  3HOX B;  3MC0 B;  4DAV A;  1BQQ T;  4DUZ L;  4DV1 L;  2SNS A;  3TP8 A;  5COR A;  3FDT A;  2RF4 A;  1BVS A;  3K0Y A;  2NZH A;  4J1M A;  4R4T A;  5CV9 A;  2OQ0 A;  3CD6 A;  4RH6 A;  1A15 A;  2R92 B;  1EIF A;  1PTO F;  2L9H A;  2ES2 A;  1EY6 A;  1B8A A;  4E6I A;  2IPK D;  2UUB L;  3T4A C;  1V1Q A;  1HA6 A;  5H1S E;  3CC4 A;  2YU9 H;  4AIM A;  3BZD B;  1EYG A;  3GTK B;  1FVI A;  4LF4 L;  1FR3 A;  1TY2 A;  4Q5V A;  2WAQ G;  1C7Y A;  2PW5 A;  4FXD A;  3KDF A;  2PI2 A;  4X3S A;  1YEZ A;  3GTQ H;  3MXN B;  4X62 Q;  2VW9 A;  4GNX B;  2F3V A;  1M8A A;  5JPN C;  4BA1 I;  4CKC A;  3P20 A;  3N6R A;  5M3M B;  1I6H H;  5I9P A;  5IGB A;  4HSP A;  1SYB A;  3NWT A;  4EGV A;  2R7Z B;  4MN3 A;  1OXS C;  5C4J B;  1I94 L;  1KLU D;  2R7Z G;  1SNM A;  2NN6 H;  2DNC A;  4N8F A;  4JI4 Q;  1F9R A;  3GTG B;  2DUD A;  3Q0A A;  5EPK A;  3CXC A;  3OTO L;  4XYO A;  4GKK Q;  1QIL A;  1PH8 A;  2B63 B;  1SBB B;  1ZEQ X;  1LT4 D;  1MBY A;  3SE0 A;  2QEX A;  2F0W A;  5IWA L;  1O7Y A;  4A3J B;  2F3W A;  4Y7N H;  4OXP A;  1EZ8 A;  4KKS A;  1M4V A;  3A7A B;  1UE7 A;  2PZT A;  1B53 A;  1ET6 A;  2E2H B;  1FNW A;  3QB3 A;  4IO9 A;  3I4M H;  4XTC S;  1TWA H;  2K7V A;  4DR7 L;  3G4S A;  5EKI A;  2F4V Q;  2LMC B;  3D4R A;  1XTC D;  4DAY B;  1KRT A;  1VF5 C;  4JI6 L;  5IT9 L;  3K7A B;  4ZK9 B;  1PRT F;  2R93 B;  1IKM A;  3KBX A;  1LTG D;  1ENA A;  2NVQ B;  4DU9 A;  3LX0 A;  2KVM A;  5CV7 A;  1CKM A;  4JI8 L;  4KHP L;  1V8Q A;  4M8A A;  2EIF A;  3ERS X;  4BS9 A;  4DA2 A;  5C5M A;  1N33 L;  2DNE A;  1PRT D;  1EIG A;  2MQH A;  1UEB A;  2N78 A;  3AFP A;  3TP6 A;  2BOS A;  1CHP D;  4BXX G;  4A4I A;  3AMU A;  3VR6 A;  1Y1W G;  4DR1 L;  4LF5 Q;  4DUY Q;  3DEO A;  4YCU A;  3SR1 A;  3OIQ A;  1RJT A;  4AQY L;  1CZW A;  1STG A;  2K28 A;  2VL6 A;  2L12 A;  4MNO A;  1VQK A;  4RWS C;  2N8N A;  4FF1 A;  4KKU A;  4A3D H;  1Q3L A;  1KDC A;  5FLX c;  3OOC A;  3S9W A;  2ID0 A;  2ZXP A;  2UXD L;  1YHA A;  2RKS A;  2E2J H;  3L7Z C;  4FF3 A;  4JYA L;  4DV7 L;  5IOD A;  2F52 A;  3HOZ G;  4IUR A;  5KYI A;  5FLX E;  3M4O B;  1VF7 A;  2K6A A;  2N88 A;  4NXM L;  3BZC A;  4JBW A;  5GAG C;  1FGU A;  3T1Y Q;  5K5P A;  3OTO Q;  2UXC L;  2KUM A;  1B9N A;  1CKO A;  3RN5 A;  3Q8D A;  4A3D G;  2TSS A;  1ASY A;  3L9A X;  2JK8 A;  1EZ6 A;  3MEH A;  1CTM A;  1QCB D;  2N3S A;  3M4Y A;  5A35 A;  4FNF A;  1RHP A;  1S5D D;  3IFD A;  4HSV A;  4LFB Q;  5EPL A;  1PYW D;  1MHW C;  4DR6 Q;  1BF4 A;  2Z0S A;  1CQF A;  1HNX Q;  1PTO B;  3I91 A;  4WOR A;  4C3J G;  3CCU A;  1KTK A;  4LF7 L;  1K3B C;  4A3B H;  3T16 A;  5J22 A;  2WAQ E;  4X3K A;  1BOS A;  2FMC A;  3HOV H;  4X3U A;  5FK9 C;  5LL6 X;  1XWE A;  1YHQ A;  1E2W A;  3I4L A;  1PRT B;  3PGZ A;  1G29 1;  1LUZ A;  2XN9 C;  2UUB Q;  1JE5 A;  2I46 A;  1VQJ A;  2PCF B;  2ZJQ A;  4MTN A;  1UE1 A;  4NXM Q;  3T56 B;  1XX8 A;  1FGB D;  1VQH A;  4EQP A;  3H15 A;  1PLF A;  1U4M A;  4RGM A;  4HJ8 A;  3I4M B;  2WKD A;  1RKN A;  3EIV A;  4G4K A;  2I0Q A;  4IUV A;  4IPG A;  4A3C G;  3J80 E;  3BU2 A;  3CU7 A;  1GKH A;  1L1O A;  4LFA L;  1KNA A;  4B3R L;  1KD1 C;  3KLR A;  1VQ4 A;  4LF8 Q;  4A3B B;  4BY7 G;  5KNB A;  5JJI A;  4EQO A;  3PIP 3;  4NMZ A;  1QJO A;  2QW7 A;  3CPF A;  5KIX A;  3DLL A;  2XSC A;  3GTO H;  4A3L H;  3CCR A;  3GTM B;  1L0X B;  2XGT A;  2O5J C;  4NXN L;  2EZV A;  2F1M A;  1VQB A;  2RCN A;  3N52 A;  4G7H C;  1Z7T A;  2H5X A;  2H1E A;  4H44 C;  3FRP B;  2QEJ C;  4DK3 C;  1F9S A;  1Z47 A;  2VS1 A;  1SRO A;  4YCV A;  1B9M A;  1EIH A;  1XNR L;  1S4Z A;  4JOI C;  3HKZ B;  3K6O A;  5C3E B;  4P73 A;  5ELO A;  5EAY A;  5E3F A;  4J6H A;  3J81 i;  5KGU A;  1HUN A;  4IPH A;  2BA0 A;  1B44 D;  1E0B A;  3T53 B;  1HUM A;  1I50 B;  2B2U C;  1PH3 A;  3GTJ B;  2CW0 D;  4A3D B;  1HR0 L;  5A2Q L;  5FLM H;  5D3D A;  2F0K A;  4JC0 A;  4H0L C;  1PTO H;  1S5B D;  1W2B A;  3V2T A;  3GD7 A;  1VQA A;  3NPP A;  3ULP A;  3A7L A;  1IZ6 A;  5AJ3 L;  4P72 A;  3MXU A;  2C5C A;  5JEA G;  2K04 A;  3J7Y W;  4Q0F A;  1O80 A;  3KK7 A;  1TR5 A;  2E2D C;  1YHB A;  2BA1 A;  2K4K A;  3S24 A;  2WV6 D;  5LL6 S;  5IE8 A;  1AZP A;  4QGU A;  1W3S A;  2GVA A;  3SK8 A;  4A93 H;  4M1U B;  1GJX A;  4C2M B;  4X64 Q;  1Y1V G;  4GN3 B;  4A3E H;  1N8R C;  1U4P A;  1C8C A;  4MHE A;  4H7B A;  1HZB A;  2SEB D;  2NTS A;  1N32 L;  5C4X B;  1V1P B;  2KA7 A;  1LM0 A;  2IHF A;  4K6D A;  3HP3 A;  4DV5 Q;  3CRL C;  1HH2 P;  3J81 L;  2EYL A;  4P2C B;  2XRS D;  4CGY B;  5ELD A;  3S14 H;  2A19 A;  3J7A F;  3V96 A;  2VB3 X;  3E0J A;  2DJF C;  2Z6K A;  1PZK D;  4HR7 B;  1SN8 A;  4HIM A;  3KJP A;  1BBX C;  4LF4 Q;  3FKI B;  4Y7N B;  3LWE A;  2V4D A;  3OWF A;  3S17 B;  2UXB Q;  4GKJ L;  1X3G A;  2IL8 A;  1P16 A;  3GV3 A;  3TME A;  4V0B A;  2UXC Q;  2ALY B;  5JJZ A;  2OCE A;  4IUN A;  1WTX A;  3LGJ A;  1BXT A;  2Z6K C;  2A73 B;  4CDE C;  1UE6 A;  2EY2 A;  3AU7 A;  3F8T A;  4IOC A;  2NVQ H;  3KDF B;  1EEF D;  5C6A A;  4OIJ A;  1HQM C;  2JA6 B;  2VQF Q;  3FVQ A;  5ELC A;  1GUT A;  1IBK Q;  3M4P A;  2QGQ A;  4ID6 A;  4F8M A;  2ZTC A;  3NEM A;  3I4N B;  3W2D A;  3OMG A;  4LF7 Q;  1YJN A;  3I72 A;  1TII D;  2B8F A;  2A6H D;  2NVT B;  1NE3 A;  1NNX A;  4QUF A;  3AEV A;  1LTR D;  1I94 Q;  1RDP D;  4DR6 L;  1PDQ A;  1Y14 B;  3QR8 A;  4GNX C;  1PXU A;  1JOK A;  1IBL L;  1WTP A;  2E5L L;  2K5V A;  3BZK A;  2CQO A;  1EL0 A;  4WJW A;  1AE3 A;  1S5C D;  1EEI D;  4HAE A;  3FHW A;  1PYS B;  2AUJ D;  3H6M A;  3QJY A;  5KRU A;  1BUV T;  5M3F G;  3DMU A;  1U4L A;  2HHH Q;  4YWK A;  1S40 A;  2ZM6 L;  4R8N A;  3H94 A;  2ZTD A;  3MFY A;  3DM1 A;  1GVP A;  1Z6H A;  1A3V A;  2EYJ A;  2O2L D;  2HCI A;  1RCV D;  5FLM G;  4YY3 Q;  1MGS A;  4ME5 A;  2XIW A;  1EUJ A;  3A5Z B;  4RA8 A;  1D5M C;  2JQO A;  5TSS A;  4N8X 1;  2MJ8 A;  1DGS A;  3J81 c;  1D2B A;  1HHV A;  4TKO B;  2LY7 A;  5M3F B;  1I4H A;  2CVR A;  1B3Q A;  3HKZ G;  1EQQ A;  3SGI A;  3VA5 A;  1XJV A;  4IFD J;  5IT9 E;  1S72 A;  5CBA E;  1C4Q A;  4S3S A;  5AJ3 Q;  1XYI A;  1PFB A;  1BNZ A;  3NTI A;  2YU9 B;  1AH9 A;  2E2I H;  3BYT B;  4CHT B;  2B2V C;  3FP9 A;  3DEP A;  3F2C A;  2EYP A;  1A2T A;  1NJI C;  4DV6 Q;  1TVX A;  1SYD A;  4LF5 L;  1B70 B;  5FO7 B;  3KFU A;  2E74 C;  3JAM i;  4XYQ A;  2ASB A;  1H9R A;  2R7F A;  3EJI A;  4J15 A;  1EU3 A;  4K14 A;  5IGG A;  3NE5 B;  3PF4 A;  1B1Z A;  4HJ9 A;  3S16 H;  2K03 A;  2RVL A;  2CH4 W;  1PH7 A;  2EYO A;  2CHB D;  4LW1 A;  3L0O A;  3PUW A;  4JBK A;  2LSS A;  2KCM A;  4RCO A;  5ELN A;  4OWT B;  3EBE A;  1YNN C;  4ZKC B;  4UPA A;  1BKB A;  1BR9 A;  3H3V C;  1V9P A;  3GTP B;  5C44 H;  1RF2 D;  3I3C A;  4LJZ C;  1WI5 A;  5CV6 A;  3VA7 A;  4IJL A;  2F4V L;  1PH6 A;  1TWC B;  1WCM H;  3J81 E;  1F2L A;  1O7I A;  3BDL A;  1DXM A;  1PRT C;  1DYQ A;  4QIW B;  1JOO A;  3S2D H;  1DM0 B;  2I07 B;  4TRD A;  1I3Q H;  2CCZ A;  1A2U A;  4QUC A;  1TWH H;  1HNZ Q;  2F0S A;  3VYT A;  3D3R A;  5ELE A;  1DOM A;  3ICE A;  2EE1 A;  1G6Z A;  2UUC Q;  4H13 C;  4K5V A;  4PZ7 A;  1NBW A;  3OHX C;  2K1B A;  4X66 L;  3GTL H;  5IYB H;  1IBM L;  2HHH L;  4IZ8 A;  2RDG A;  4G7Z C;  1KLG D;  4UHV A;  1YNX A;  3K7A H;  2R92 H;  1EFW A;  1QUQ A;  5D65 A;  2NWG A;  1ENC A;  2K05 A;  5JJL A;  1SDF A;  3J7A V;  4P75 A;  1LYL A;  1LAB A;  3HS0 C;  3JAM c;  2IX3 A;  5KYL A;  2HIV A;  4GZY C;  1U0L A;  1CSQ A;  2F0P A;  2LFN A;  4FP5 D;  1Y1V B;  3S1N H;  1VQC A;  1DCZ A;  1NTG A;  4TQU S;  1V43 A;  3P1H A;  3VYU A;  1XMQ Q;  1YJW A;  3U9S A;  1TT2 A;  2EQS A;  4DK6 C;  5FJ8 H;  1O7Z A;  3SEB A;  1LT5 D;  3WDN A;  2E76 C;  4OO1 H;  2OWO A;  3HEJ A;  4LMQ D;  1JE4 A;  4PQX A;  3IKJ A;  3K5M A;  1ZXT A;  2AUK A;  1YI2 A;  4CKB A;  4K2L A;  3GTG H;  5GRO A;  2NVY H;  4DNI A;  4NPS A;  3NQI A;  5JOB A;  5IOC A;  1YZ6 A;  3NTK A;  3J80 L;  1MD2 D;  3PSI A;  5K36 H;  4IFD G;  1EY5 A;  5IP7 H;  1X3E A;  1X56 A;  4BBS H;  3H0G G;  1KRS A;  1S5F D;  2VUM G;  4IJH A;  3QWN A;  2ICI A;  1X3F A;  1VQ7 A;  5BN3 A;  3I56 A;  1SNC A;  1NMG A;  3PV0 A;  4IPD A;  4DV2 Q;  1IYU A;  2F3I A;  1QZH A;  1SJH D;  5IP9 G;  4DAM A;  4NKL A;  2LXJ A;  1X3P A;  4FF4 A;  2UUA Q;  4QL5 A;  4QIW E;  2XTI A;  4DV3 Q;  5M5Y B;  1IHZ A;  1FL0 A;  4BY7 H;  3CW2 C;  3RZD B;  3LNN A;  1EOT A;  2K33 A;  2V1C C;  2JYO A;  1JB7 A;  1AZQ A;  2KHS A;  1AP0 A;  5CYU A;  3CPW A;  4RAU C;  5EJW A;  5ISR A;  1JC7 A;  4DK1 A;  3FKI G;  3FPU B;  1S5E D; 
#chains in the Genus database with same CATH homology
 1ASY A;  5LMN Q;  2JK8 A;  2VQF L;  3RN2 A;  2NZO A;  4UP7 A;  3STB D;  2N3S A;  1KXL A;  4B3R Q;  4A75 A;  2E2H H;  4LFB Q;  4JI7 Q;  4DR6 Q;  2A8V A;  2K5H A;  3CQZ H;  4P74 A;  1WFQ A;  2Z0S A;  3M4O H;  4BA2 I;  1HNX Q;  4JBM A;  4HIK A;  1HR0 W;  1VQ5 A;  4YWL A;  3CCU A;  4A3G G;  4LF6 Q;  4DR4 Q;  2VUM H;  4X65 L;  4LF7 L;  1OTC A;  3HOU G;  2B29 A;  4AQY Q;  5J3B A;  4O0A A;  3TRE A;  4AYB G;  2JA6 G;  4A3B H;  4RMF A;  2YV5 A;  3VDY A;  4IFD I;  4O2D A;  2WAQ E;  1VQ9 A;  1A0I A;  3KOJ A;  3U58 A;  2RHQ B;  1YIT A;  3HOV H;  3UDG A;  4B3M L;  4LF8 L;  3T1Y L;  1VQE A;  1YHQ A;  3J7A 5;  4LFC Q;  5LMU Q;  3M85 A;  1RIP A;  3PIO A;  3PGZ A;  4KI0 A;  4JI3 Q;  4DPG A;  3PO3 H;  4MZ9 A;  2OTJ A;  1G29 1;  1LUZ A;  5C4X G;  3ZJY C;  1JJG A;  2UUB Q;  2ZJQ A;  1JE5 A;  3HOW H;  1VQJ A;  2PI2 E;  3S2H H;  4MTN A;  4DV4 Q;  2I5L X;  1MKH A;  1UE1 A;  4YHH L;  1D7Q A;  1U5K A;  4A76 A;  5M3M H;  1E22 A;  1HZ9 A;  4QY7 A;  4NXM Q;  1VQH A;  4C3J H;  4JI8 Q;  3H15 A;  4HJ8 A;  2PQA A;  1SMX A;  1PV4 A;  3HOY G;  3J81 j;  2QA4 A;  4DR5 Q;  3EIV A;  1PA6 A;  4B3T Q;  3AYH B;  2I0Q A;  1KQS A;  1N33 Q;  4IPG A;  4K0K L;  4A3C G;  2UU9 L;  3BU2 A;  1D8L A;  4X62 L;  1GKH A;  1XMO L;  2OQK A;  1L1O A;  1E1T A;  4JI2 L;  4LFA L;  3STB C;  1HNW L;  5M5W H;  4B3R L;  4OWW B;  1KD1 C;  4DR3 L;  2Q2H A;  1KAW A;  4H02 A;  1YBY A;  1VQ4 A;  4LF8 Q;  3CCV A;  4DUY L;  4BY7 G;  1OXU A;  5JJI A;  1QVG A;  1IXR A;  5JEA J;  3H3V H;  3E0E A;  5M3F H;  5C4J H;  4L5T A;  4Y52 H;  1PVO A;  3K81 C;  3WWV A;  4GLV B;  3ULJ A;  3UDX A;  3CPF A;  3OW2 A;  3PUZ A;  3DLL A;  3GTO H;  4GS3 A;  2DGY A;  3CCR A;  3TS0 A;  4A3L H;  2YTX A;  2XGT A;  4WJ4 A;  1L1O C;  4NXN L;  1VQB A;  2RCN A;  1Q7Y C;  3I4N H;  4X6A H;  1IBK L;  1HJP A;  1EIY B;  3TEH B;  2YTV A;  1ASZ A;  4IOA A;  3OYY A;  2H5X A;  4DKA C;  1KL9 A;  4DK3 C;  1TWF H;  3JC6 6;  1Z47 A;  3MEF A;  2VS1 A;  2JA7 H;  4DR4 L;  1IL2 A;  4K0K Q;  1K73 C;  3RR5 A;  2Y0S E;  1SRO A;  4YCV A;  1XPO A;  1SE8 A;  4FDB A;  3RZO H;  1A63 A;  3KLW A;  1XNR L;  4BY1 G;  4JOI C;  1Q8K A;  4DV5 L;  1KIX A;  1WCM G;  1Q1E A;  4P73 A;  2KCT A;  3I55 A;  5ELO A;  5EAY A;  2FXQ A;  2HIX A;  3J81 i;  4BY1 H;  4DV6 L;  4IPH A;  2BA0 A;  2ZJP A;  3A74 A;  1S3O A;  2VNU D;  4A3L G;  4POG A;  4A93 G;  1PH3 A;  3HKZ E;  4BBS G;  4WJ3 M;  3H3V I;  1YJ9 A;  3H0G H;  4DV4 L;  2Q2U A;  4GN5 A;  1HR0 L;  3ER0 A;  2HT1 A;  1MIU A;  3D0F A;  4LWC A;  2IY5 B;  5FLM H;  1XMQ L;  4JC0 A;  2JA8 G;  3W5O A;  4JV5 Q;  1W2B A;  4A3J G;  3S1Q H;  3GD7 A;  1VQA A;  1T9H A;  3K7U C;  1OXX K;  3ULP A;  1IZ6 A;  4ME3 A;  1G6P A;  1L1O B;  2CKZ B;  1EQR A;  1J6Q A;  4P72 A;  1N9W A;  3U50 C;  5IP9 H;  5AJ3 L;  4HJ7 A;  4DR2 Q;  1BBW A;  1VQP A;  2IT1 A;  2NN6 G;  5JEA G;  4LF6 L;  4R4Q A;  4PZ6 A;  4A3M G;  4HJA A;  4GLX A;  2D0P A;  1YHB A;  2BA1 A;  4JBJ A;  2K4K A;  3S24 A;  5C44 G;  3U4V A;  3A0J A;  5IE8 A;  3D31 A;  1VS0 A;  3PUX A;  4QGU A;  3HOY H;  4LNQ A;  1EOV A;  1W3S A;  1NMF A;  5IY0 A;  1Q46 A;  2GVA A;  2L15 A;  2LXK A;  4DV0 L;  4B3S L;  2AWN A;  2D0O A;  4JCV E;  4A93 H;  3CF5 A;  4GNX A;  1JJC B;  4X64 Q;  1Y1V G;  2R93 H;  3PCO B;  4GN3 B;  4A3E H;  1N8R C;  5GAE C;  4GOP A;  4LFC L;  1HZB A;  1N32 L;  3B6Y A;  2NVX H;  1MJC A;  3HFZ B;  1E1O A;  1LM0 A;  2IHF A;  4OWX B;  4HJ5 A;  2R93 G;  4DV5 Q;  1CSP A;  2AMC B;  1HH2 P;  1PH2 A;  3K80 C;  1VQM A;  2R7D A;  1PH9 A;  4B3S Q;  1BBU A;  5LMU L;  1WJJ A;  3TRZ A;  2K50 A;  1MJE A;  3AFQ A;  3S14 H;  2RHS B;  3RLF A;  4B3M Q;  1CKN A;  2VZA A;  1Q82 C;  2A19 A;  2NN6 I;  2K14 A;  2Q2I A;  4DR2 L;  4DR5 L;  4DV7 Q;  4APV A;  2I5M X;  4KLK A;  4GKJ Q;  5BR8 Q;  1WYD A;  2JA7 G;  3KJO A;  4A3E G;  1M1K C;  1XNQ Q;  4BBR G;  1K8A C;  2UXD Q;  1FJG Q;  1JT8 A;  2AWO A;  2E8G A;  1VQF A;  2Z6K A;  1PYB A;  4JI7 L;  3RLO A;  1SN8 A;  4GOP C;  4HIM A;  2BH2 A;  3KJP A;  4LF4 Q;  1XMO Q;  3ULL A;  5GAD C;  2PQA B;  1VQL A;  4BXX H;  1Y1W H;  5K36 G;  4DV2 L;  3M9B A;  1KHI A;  2UXB Q;  4GKJ L;  1X3G A;  1OXT A;  1SRU A;  1P16 A;  1B7Y B;  4R1J A;  4AH6 A;  5BR8 L;  3KF6 A;  1HNW Q;  2N49 A;  1XNQ L;  2UXC Q;  2ALY B;  3RZD H;  1VCI A;  2OCE A;  4A3G H;  3LGJ A;  2Z6K C;  3T1H Q;  1TXY A;  4L5Q A;  1UE6 A;  3E9H A;  4L5R C;  5C3E H;  4C3I H;  1VQN A;  3CME A;  1C9O A;  2WB1 E;  5IP7 G;  1XPR A;  3F8T A;  3NBH B;  2JEA I;  4IOC A;  5IYD H;  2NVQ H;  2HQL A;  5HY6 A;  3KDF B;  1UWV A;  2PMZ E;  2KBN A;  2K5N A;  1PH5 A;  1X65 A;  5C3E G;  3S1R H;  2VQF Q;  3K8A A;  4YCW A;  1VQ8 A;  1IBK Q;  3AQQ A;  3M4P A;  3PO3 G;  2QGQ A;  1A62 A;  2VQE Q;  3HOZ H;  2ZTC A;  3T1H L;  1SFO H;  4A3I H;  3NEM A;  2AHO B;  3CC2 A;  3UDF A;  3KF8 B;  4JI6 Q;  3U4Z A;  2CWA A;  2K52 A;  4JI1 Q;  2B3G A;  4LF7 Q;  1K83 H;  1YJN A;  5JJK A;  1K9M C;  1CKN B;  4A3I G;  1X9N A;  1NE3 A;  1K0R A;  2YYZ A;  1QVC A;  5E7N A;  2Q2T A;  3AEV A;  1I94 Q;  4DR6 L;  2WFW A;  4DV0 Q;  2JA9 A;  1Y14 B;  1TWG H;  4GN4 B;  4GNX C;  2B63 H;  1HNX L;  4B3T L;  1IBL L;  2MO1 A;  2E5L L;  2K5V A;  3BZK A;  4OON A;  1JJ2 A;  1Z9F A;  4LF9 L;  3J80 i;  2CQO A;  1PH1 A;  1IBM Q;  3CCJ A;  1AE3 A;  1GO3 E;  4X66 Q;  3FHW A;  1PYS B;  1M90 C;  4JI5 Q;  1PHJ A;  4YWM A;  3GTJ H;  4GLA C;  5M3F G;  2HHH Q;  3CP0 A;  4YWK A;  1S40 A;  2ZM6 L;  5C0X G;  3I7F A;  3UE0 A;  5LMN W;  4A3B G;  4HIO A;  3KF6 B;  3HOX H;  3CAM A;  1EWI A;  2KHI A;  1X55 A;  1R9T H;  2AKW B;  1HR0 Q;  2ZTD A;  2MO0 A;  1E24 A;  1GVP A;  4UY8 C;  2WP8 J;  1KC8 C;  1N36 Q;  2JA5 G;  2OTL A;  4OO1 G;  1AE2 A;  3G71 A;  4PG3 A;  2B63 G;  2PNH A;  3G6E A;  4R4O A;  3L2P A;  2UUA L;  4P71 A;  5FLM G;  4YY3 Q;  2ZM6 Q;  3CCS A;  1L0W A;  1EUJ A;  3A5Z B;  4POF A;  2A1A A;  2JQO A;  4KHP Q;  4LUV A;  3CMA A;  1XTD A;  3DM3 A;  3M4Q A;  1DGS A;  5HGQ A;  3J81 c;  2E5L Q;  4NXN Q;  3EN2 A;  2JEB I;  2KHJ A;  4A3M H;  2CWP A;  1Q86 C;  4QQB X;  3HKZ G;  5C4X H;  3SGI A;  1I50 H;  2JJQ A;  1XJV A;  4AYB E;  1EQQ A;  1VQ6 A;  3M3Y H;  4IFD J;  1H95 A;  1G51 A;  1E7Z A;  1S72 A;  1FJG L;  5AJ3 Q;  1OXV A;  4HID A;  4JI0 L;  3GO5 A;  1AH9 A;  2E2I H;  2YTY A;  3K0X A;  1PH4 A;  4DR7 Q;  3FP9 A;  4OO1 I;  3F2C A;  4DUZ L;  4DV1 L;  1NJI C;  4DV6 Q;  3I2Z A;  1J5E Q;  4LF5 L;  1B70 B;  4YY3 L;  2I5H A;  3KFU A;  2RF4 A;  4C3H H;  2VY3 A;  3CC7 A;  4LF9 Q;  3RNU A;  3JAM i;  1BVS A;  4R4T A;  2NZH A;  2C35 B;  3CD6 A;  2OQ0 A;  4OX9 L;  2ASB A;  3KYH C;  4JYA Q;  1EIF A;  4JI5 L;  3CCQ A;  4A3F H;  4UP8 A;  2ES2 A;  2R7F A;  1B8A A;  1YVC A;  2UUB L;  4J15 A;  3A5U A;  1V1Q A;  5H1S E;  1QVF A;  3PF4 A;  4JV5 L;  5IYC G;  4HJ9 A;  3CC4 A;  1CUK A;  2YU9 H;  3S16 H;  3TS2 A;  4AIM A;  1EYG A;  4A3C H;  2JA8 H;  1X6O A;  1PH7 A;  3NEL A;  1A8V A;  1FVI A;  4LF4 L;  2NVT H;  4JI3 L;  3I4N G;  3S15 H;  2WAQ G;  4LW1 A;  3L0O A;  1C7Y A;  3PUW A;  4JBK A;  1NY4 A;  2KCM A;  2LSS A;  2PI2 A;  3KDF A;  4OWT B;  3EBE A;  5DLQ E;  1YEZ A;  5ELN A;  3GTQ H;  3S1M H;  4JI2 Q;  5IT9 c;  1QZG A;  3MXN B;  4X62 Q;  4DR3 Q;  2BH8 A;  4UPA A;  1BKB A;  2VW9 A;  1V9P A;  4GNX B;  5C44 H;  4LFA Q;  1WI5 A;  2F4V L;  4IJL A;  4RG1 A;  1GM5 A;  1Q12 A;  1PH6 A;  1WCM H;  2JA6 H;  1O7I A;  4BA1 I;  5M3M G;  4ALP A;  2EXD A;  2R92 G;  1I6H H;  1UE5 A;  2UU9 Q;  4UP9 A;  3S2D H;  2IHE A;  4BBR H;  5LMN L;  1I3Q H;  2CCZ A;  1WOC A;  2GVB A;  2GN5 A;  1OXS C;  4QJF A;  1I94 L;  4OX9 Q;  1HNZ Q;  2R7Z G;  1TWH H;  3G48 A;  3RLN A;  4LFB L;  4A3K H;  4JI4 Q;  2VQE L;  3ICE A;  1RL2 A;  5C0X I;  1VQD A;  2UUC Q;  4L5S A;  3GTM H;  2DUD A;  2MFI A;  4PZ7 A;  1NBW A;  2ZJR A;  3CXC A;  4JI0 Q;  4PMW A;  2CFM A;  1SR3 A;  4EX5 A;  3OTO L;  4A3K G;  1N34 Q;  4GKK Q;  1E3P A;  2JE6 I;  4X66 L;  3GTP H;  2KEN A;  3GTL H;  3GTK H;  5IYB H;  1HZC A;  1PH8 A;  1IBM L;  2HHH L;  3HKS A;  3F2D A;  2UXB L;  3UDI A;  1VQO A;  4IPC A;  1Y1V H;  4LUO A;  4NB3 A;  2QEX A;  2WB1 G;  3PIP A;  1YNX A;  3K7A H;  2R92 H;  5IWA L;  1EFW A;  1QUQ A;  3I4O A;  4Y7N H;  4OXP A;  3J80 c;  5FJ8 G;  4X65 Q;  5JJL A;  1UE7 A;  4IO9 A;  3PUY A;  1HZA A;  3I4M H;  4JI1 L;  4XTC S;  4P75 A;  1LYL A;  1TWA H;  3W1B A;  4DR7 L;  3FKI H;  3G4S A;  3JAM c;  2F4V Q;  1QUQ B;  5IWA Q;  2HIV A;  1SLJ A;  2IX1 A;  5GQO A;  1U0L A;  3E9I A;  4JG2 A;  1JMC A;  1CSQ A;  5IYB G;  4DAY B;  3S1N H;  1KRT A;  3NEN A;  1VQC A;  4JI6 L;  4TVA B;  1NTG A;  1IYJ B;  4TQU S;  3M7N A;  1V43 A;  3BJU A;  1YIJ A;  2IX0 A;  3CCE A;  1XMQ Q;  1YJW A;  3HOX G;  1N34 L;  4GKK L;  1P8L A;  1HNZ L;  1X54 A;  2EQS A;  4XIG S;  2D62 A;  4DK6 C;  5FJ8 H;  4JI4 L;  1C0A A;  2K75 A;  3W1G A;  3J7Z C;  2JA5 H;  4X64 L;  2OWO A;  4JI8 L;  1CKM A;  2R7Z H;  4KHP L;  4R4I A;  2EIF A;  3ERS X;  1IBL Q;  1K3R A;  4LUZ A;  3IRB A;  4DV3 L;  1YI2 A;  1N33 L;  2ATW A;  3CCM A;  3GTG H;  5GRO A;  1LTL A;  2NVY H;  4C2M H;  4DNI A;  2MQH A;  4NPS A;  1UEB A;  1N32 Q;  1GD7 A;  2N78 A;  1YZ6 A;  5M5Y H;  3AFP A;  3PSI A;  4DUZ Q;  4BXX G;  4A4I A;  3HOW G;  1Y1W G;  3F2B A;  4DR1 L;  5IP7 H;  5IYD G;  1X3E A;  1X56 A;  4BBS H;  1J5E L;  2ZTE A;  1KRS A;  3H0G G;  3PUV A;  4LF5 Q;  2VUM G;  3HOU H;  4IJH A;  4DUY Q;  1X3F A;  4YCU A;  1VQ7 A;  1Q1B A;  5M5X H;  4R4C A;  4A3J H;  3I56 A;  3PF5 A;  4IPD A;  1NMG A;  3PV0 A;  4DV2 Q;  4AQY L;  3HOV G;  3GDE A;  2VL6 A;  5GAH C;  1TWC H;  2F3I A;  4JOI A;  1QZH A;  3CCL A;  3PO2 H;  5IP9 G;  4MNO A;  3TQY A;  4DAM A;  1Q81 C;  1VQK A;  2N8N A;  2LXJ A;  4A3D H;  4DR1 Q;  3I4M G;  5FLX c;  4GOP B;  2UUA Q;  1XPU A;  2ID0 A;  4QL5 A;  2UXD L;  1YHA A;  4QIW E;  2E2J H;  1L2F A;  2XTI A;  5C0X J;  3L7Z C;  4DV3 Q;  4JYA L;  4DV7 L;  1N36 L;  1FL0 A;  4BY7 H;  1VQI A;  3CW2 C;  4A3D G;  2F52 A;  3HOZ G;  1I5F A;  1JB7 A;  2Y0S G;  2V1C C;  4KHZ A;  1VQG A;  4PZ8 A;  4YHH Q;  4EQ5 A;  3F1Z A;  4IFD G;  4NXM L;  4DV1 Q;  4A3F G;  3S17 H;  1PFS A;  3BZC A;  4JBW A;  5GAG C;  1FGU A;  1K8G A;  3T1Y Q;  2UXC L;  3OTO Q;  2UUC L;  3CPW A;  3PO2 G;  3UE1 A;  5IYC H;  2R6G A;  1XNR Q;  1CKO A;  3FKI G;  3RN5 A;  3Q8D A;  2MNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...