4LFCL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 11
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfcL00
4DR1Q 2R7ZH 3D0FA 2N78A 1KXLA 1HNZQ 4UP8A 1WCMG 2K75A 3ERSX 3CQZH 3F1ZA 4A3FH 1KIXA 4B3TQ 4HJ9A 4L5TA 3PF4A 2VW9A 1VQ6A 5IYCG 3M9BA 4X66Q 2E8GA 2RF4A 4OONA 3STBD 3GTKH 3CCRA 5JJIA 4LF5L 2F4VL 2NZOA 3MEFA 5IE8A 2ZTCA 1HJPA 1VQAA 1WCMH 5LMUL 4A3FG 3PIOA 4H02A 4A3GG 4WJ3M 4C2MH 2VY3A 3EBEA 3ICEA 3KJPA 1K83H 1EYGA 1E24A 2Y0SG 5IYCH 3ULPA 1OTCA 4LF8L 1XPUA 4IFDG 4OWWB 2OCEA 3HOYH 1WI5A 1C7YA 3J81c 4LF8Q 4A3CG 3J80i 1Y1WH 2WB1G 1SR3A 3HKZG 5AJ3L 3T1YQ 3L7ZC 1YJ9A 2I0QA 4IFDJ 5K36G 4DV7Q 1AH9A 2UUBQ 4DAMA 1CUKA 2VL6A 2E2JH 2JA6G 5C4XG 1V1QA 2F4VQ 2K5HA 3T1HQ 1B70B 3I4NG 1CKMA 3K0XA 3I4MG 2HT1A 3KOJA 1Y14B 2QEXA 4J15A 4EQ5A 4IPHA 4MNOA 4LF7L 2XGTA 4TVAB 3CC2A 2IY5B 3NENA 2IX1A 1HZCA 4MZ9A 1GM5A 4YY3Q 3HOVG 4BA1I 4DR2L 3CMAA 3UDGA 3KF6A 4JYAL 4QJFA 4X64Q 1UE1A 2D62A 4JBWA 4LF7Q 3S15H 1D8LA 1B8AA 4A3JH 3G4SA 4DR5Q 4BY7G 4LF4L 1X3GA 4K0KQ 1VQCA 4R4IA 3TREA 5M3MG 1N34Q 5HGQA 4K0KL 3HOXG 3RZDH 1CKOA 3PO3H 1QUQB 1N36Q 1XMOL 4JI2Q 3CP0A 3H0GG 2JA9A 3J80c 1UE7A 5M3FH 2K5NA 1GVPA 4IFDI 4YHHL 1PH2A 2D0PA 2N49A 4A3JG 1NBWA 4X64L 2ASBA 4BY7H 2DGYA 3G71A 1I94Q 3M4OH 3DLLA 1L1OC 4JI1Q 1XJVA 4A3DG 1KC8C 4LF9L 1VS0A 1PH3A 2UXBQ 1AE2A 2KHJA 1K8AC 1Q8KA 3HOWH 3GTJH 5C0XI 1Q81C 1S40A 1VQJA 5BR8L 1V9PA 1Q86C 4YHHQ 3AEVA 1W3SA 2JA8H 2PMZE 5M3FG 5JJKA 1SE8A 4GNXC 1VQ9A 4JI6Q 4JI2L 1BVSA 3RR5A 4X66L 1B7YB 1X56A 2UXCQ 1SROA 2BA0A 1S3OA 1JB7A 4B3MQ 2HIVA 3G48A 4OX9Q 3I4NH 3S2DH 2QGQA 4A3BH 1HR0W 4L5QA 3RLOA 3GTMH 2NZHA 5GADC 3STBC 3BZKA 1K8GA 1PYBA 4UP9A 3F2DA 1IBML 4NPSA 1WJJA 1X55A 2NN6G 3E0EA 1VQNA 4JV5L 3NELA 3PV0A 2FXQA 3HOVH 3HOYG 1DGSA 1KL9A 2JQOA 2UXDQ 4JI4Q 1VQHA 4A3CH 4DK3C 2UXBL 3KYHC 4DV2L 3CCVA 1N32Q 1VQBA 3A0JA 1V43A 4UP7A 1VCIA 4A3GH 1Q1BA 4BBSH 4BY1H 1CSQA 1VQ7A 4GN3B 2WB1E 3HKZE 2B63H 4IPCA 3F2BA 1J6QA 4YWLA 3CC7A 4DUZL 2YU9H 4DUYQ 4DPGA 1EUJA 1MJEA 3BZCA 4A3MH 2UXDL 1X3FA 2JEBI 3AFQA 2DUDA 1YHAA 5C0XJ 2N8NA 4GKKQ 4GN5A 2OQ0A 1K9MC 4LFBL 4R4CA 2AWOA 5LMNQ 2YTYA 1I5FA 1Q1EA 3I55A 1JE5A 4BBRH 4HIKA 2NVXH 2OTLA 3HOZH 4IOAA 4BXXG 1TWFH 3DM3A 2CFMA 2MQHA 5IP7G 4A3MG 1SRUA 4NB3A 1W2BA 4B3ML 4IJLA 1KHIA 4DV6L 1OXXK 3E9HA 1HZAA 2QA4A 1PH9A 1U0LA 5IP9G 3PF5A 2YTXA 4DV5Q 1R9TH 1L0WA 1YI2A 2NN6I 3RNUA 4IJHA 1QZGA 2E5LL 3MXNB 2Q2TA 3UE0A 2IHEA 1VQPA 4JCVE 4PMWA 2VQFL 1X9NA 3PCOB 1JT8A 1HNXL 1NJIC 3AYHB 3CCQA 2Q2HA 3FP9A 4JI4L 2D0OA 4GOPC 4IPGA 4ALPA 2C35B 2K4KA 4PZ6A 5AJ3Q 1PHJA 2R7DA 2ZTDA 1M1KC 2UU9Q 2KCTA 4XIGS 4PG3A 2K14A 4DV4L 4GLVB 4B3SL 1VQOA 4POFA 1XPOA 1HNXQ 1YBYA 1UEBA 4PZ8A 4APVA 5ELOA 1N36L 3UDIA 1J5EQ 3LGJA 4L5RC 2A19A 3WWVA 2JEAI 3OYYA 1NMFA 4YCVA 5C3EG 1VQ5A 1P8LA 3CCLA 2EXDA 4KI0A 1S72A 4AQYL 3PO2G 2B63G 4NXML 1QVCA 2A1AA 4DV1Q 1JJCB 4A3KG 3HOWG 4NXMQ 3K80C 1PYSB 4QL5A 2BH2A 4AYBE 4JYAQ 4LF6Q 3A74A 3KF6B 3J7A5 5ELNA 3U58A 3TS2A 3ULLA 5IYBH 1X6OA 3PO3G 3CD6A 4DV0Q 1BBUA 4JC0A 1HZBA 2LXKA 4LFBQ 4LFCL 1LUZA 2JA5H 4POGA 2GN5A 3AQQA 3FKIG 5IP7H 3H3VI 2KENA 4DR7L 4OX9L 5M5XH 3TRZA 1VQMA 2RCNA 3H15A 1XMOQ 4A75A 1IBMQ 4JI0L 4A3LG 2ZJRA 3IRBA 1TXYA 1YHQA 1GKHA 2E5LQ 2UUBL 2YTVA 5E7NA 5C0XG 1XNRL 1EOVA 1GO3E 1QVGA 4BXXH 3RLNA 3W1GA 4AIMA 4YCWA 1D7QA 3EIVA 3A5ZB 3L0OA 1VQ8A 2UXCL 3M85A 1XMQL 1PH1A 4A93G 1RIPA 4GKJL 4KHZA 3G6EA 4DV2Q 2KHIA 1PVOA 2AMCB 1U5KA 3ZJYC 4YY3L 4HJ8A 3VDYA 4P71A 5M5WH 1YJNA 2IT1A 3CC4A 5J3BA 1EIFA 2ZJPA 2MNAA 1Q82C 4LNQA 1QVFA 1IYJB 3PIPA 5JEAG 1Q12A 1X3EA 3CCMA 5LMNL 2LXJA 1XMQQ 4DV1L 1VQEA 2HQLA 2I5LX 4JI1L 1YEZA 3F8TA 3I4OA 3CW2C 4JOIA 2ALYB 5M3MH 1M90C 1O7IA 2BH8A 2L15A 4GOPA 4IO9A 1EQQA 1QUQA 5IWAQ 4DR3L 1N8RC 1Q46A 4DR5L 3H0GH 3KFUA 1OXSC 4GNXA 5IWAL 3JAMi 1UE5A 3CCEA 2JA7G 5FJ8G 5FLMG 1K73C 4JI6L 1QZHA 4IOCA 4JI7L 3KF8B 2JK8A 2LSSA 2PI2E 1NMGA 2VZAA 2CWAA 2GVBA 4UPAA 1HZ9A 4JI5L 4DV0L 3TS0A 3S1NH 1KAWA 4JBKA 3PUXA 4JI5Q 2NVTH 5JEAJ 1I6HH 2B29A 3OTOL 1ASZA 4Y7NH 4DR2Q 2UUAL 4DV3L 1EWIA 3PGZA 3TEHB 3HOUH 2AKWB 4X6AH 5C3EH 4LUOA 3PUZA 4LUZA 1YVCA 2Y0SE 3GTPH 1XTDA 5EAYA 3PO2H 1X65A 1HNWQ 3GTOH 2CWPA 2VNUD 3BJUA 1A8VA 2I5HA 1FGUA 4BBRG 3HOZG 3S1MH 1Q7YC 3CAMA 3S14H 1VQGA 1Y1WG 1N34L 2R93G 4B3RQ 1IZ6A 1IXRA 3K8AA 2KCMA 1HR0L 2Z0SA 4DV4Q 1VQKA 4AH6A 4QQBX 1E7ZA 1P16A 4X62L 1Y1VG 4X62Q 1LM0A 4QY7A 2UUCQ 3CCUA 1HH2P 3KDFA 3GTLH 4HJ5A 2VQFQ 1SFOH 4P73A 4JG2A 1JJGA 1JMCA 4KHPL 2R93H 2BA1A 2N3SA 3S2HH 4DUZQ 1OXUA 2YV5A 4HIOA 4BBSG 4EX5A 2CKZB 1Z9FA 4DV6Q 3U4ZA 4LF5Q 1EQRA 3GDEA 2WAQE 4JI8Q 2MO0A 3S16H 1A63A 3HFZB 1YIJA 2VUMG 1L2FA 4GN4B 3RLFA 4RG1A 3CMEA 2AHOB 3E9IA 4HJ7A 4GLXA 2YYZA 3T1YL 4LFCQ 2K50A 1KRTA 5C44G 3PUWA 4GNXB 4A3IG 1IBLQ 1WYDA 1KD1C 3HOXH 3I2ZA 2WAQG 4A3BG 3S17H 4NXNL 1IBLL 4B3RL 2XTIA 2ZM6L 2R92H 1L1OB 1PV4A 1L1OA 1NE3A 1C9OA 2PQAA 2PQAB 4DAYB 3KJOA 1EIYB 2HIXA 4LF6L 2ZTEA 1VQFA 4P74A 5HY6A 4HIMA 1HNWL 1C0AA 5IYDH 3S24A 4DNIA 2ID0A 2VS1A 1FL0A 2JJQA 3RZOH 1OXVA 5LMNW 3ER0A 4A3EG 5IP9H 4DUYL 4JI3L 3GD7A 2AWNA 4A4IA 2VQEQ 4DR6L 4DV5L 2RHSB 2CCZA 2R7ZG 4QIWE 2K52A 4JOIC 5IT9c 1N32L 5IYDG 3RN5A 1HNZL 2UUCL 4B3TL 4OXPA 4DR1L 2EQSA 4B3SQ 4DR4Q 4A76A 3CCJA 1TWAH 2Q2UA 1Z47A 3EN2A 1I50H 3PUVA 4P72A 1KRSA 3SGIA 4C3HH 4X65Q 1XNQQ 2MFIA 4RMFA 2JA5G 4TQUS 1NTGA 2OQKA 2Z6KC 5M5YH 5FLMH 1TWHH 4DR3Q 4R4TA 1PH4A 2ATWA 2PNHA 2PI2A 5C4XH 3CCSA 1IBKQ 5LMUQ 1XNRQ 4KLKA 1IBKL 4DKAC 4JI0Q 5JJLA 2R6GA 4OWTB 4JI8L 3CXCA 5GQOA 2EIFA 3I7FA 1VQ4A 4DR7Q 4FDBA 1LYLA 3ULJA 3HOUG 2Q2IA 2CQOA 3B6YA 1A62A 2UUAQ 1CSPA 5C4JH 4O2DA 3U4VA 3OTOQ 4LF9Q 1YNXA 4BY1G 5IYBG 4GS3A 4A3DH 1Y1VH 2H5XA 5DLQE 3RN2A 2E2IH 1N33Q 5GROA 1PH8A 1I94L 3BU2A 4JI7Q 1YITA 3M4QA 1FJGQ 5FLXc 2R92G 4R1JA 3PSIA 3KLWA 5FJ8H 4Y52H 2GVAA 3K81C 3M4PA 4HIDA 2NVQH 1G6PA 3CPFA 1MKHA 1OXTA 3PUYA 4AYBG 5GAGC 1WOCA 1E3PA 4AQYQ 4YWMA 4OO1G 1GD7A 1TWCH 2RHQB 1E1TA 4DV7L 4JBMA 4GOPB 1MIUA 1J5EL 4LF4Q 4MTNA 4XTCS 3D31A 2HHHQ 4WJ4A 2ZM6Q 3I56A 1G291 1SLJA 3W1BA 3KDFB 1LTLA 2ES2A 3HKSA 1K0RA 5H1SE 3Q8DA 3K7UC 3NEMA 3TQYA 3JC66 3NBHB 4DV3Q 2UU9L 1YHBA 4DK6C 3S1QH 1ASYA 1WFQA 5BR8Q 4R4OA 4A3KH 4GKJQ 4QGUA 4UY8C 1NY4A 2A8VA 4OWXB 1N33L 2E2HH 3F2CA 2JA8G 1BKBA 1EFWA 4YWKA 4O0AA 1AE3A 3AFPA 1T9HA 2ZJQA 3GO5A 1VQLA 1CKNA 1CKNB 1A0IA 1UWVA 1BBWA 2IX0A 4LFAQ 2JA6H 2HHHL 2JE6I 4LUVA 4A3EH 1PH6A 3FHWA 2B3GA 5IY0A 4C3IH 1PH7A 3L2PA 2WFWA 3J7ZC 4KHPQ 4IPDA 4GLAC 2NVYH 3H3VH 1VQIA 2JA7H 2F3IA 1FVIA 4X65L 1H95A 1JJ2A 1K3RA 3W5OA 2OTJA 4LFAL 4P75A 4NXNQ 2WP8J 2OWOA 4A3LH 1G51A 1YZ6A 1PH5A 1FJGL 3J81j 4YCUA 1XNQL 4PZ7A 1UE6A 4GKKL 3JAMc 3UDXA 2V1CC 1VQDA 4L5SA 4OO1I 5GAHC 2VUMH 2VQEL 4DR6Q 4DR4L 1E1OA 4JI3Q 1RL2A 4A93H 3UDFA 1N9WA 1MJCA 1TWGH 2I5MX 2R7FA 1KQSA 3OW2A 3I4MH 3A5UA 1XPRA 1SMXA 3J81i 1PFSA 3M3YH 4R4QA 2Z6KA 4JBJA 4LW1A 4LWCA 2F52A 2K5VA 3GTGH 4HJAA 3T1HL 3CPWA 3FKIH 5GAEC 2MO1A 3U50C 1YJWA 3M7NA 4ME3A 3GTQH 3S1RH 1IL2A 2IHFA 1SN8A 3UE1A 1PA6A 2KBNA 1I3QH 1X54A 3CF5A 5C44H 4A3IH 4C3JH 3K7AH 4BA2I 4JV5Q 1HR0Q 1E22A
chains in the Genus database with same CATH superfamily
2LKVA 4DR1Q 3D0FA 4B3TQ 1S5FD 1WCMG 1U4LA 1SE3A 3PF4A 4HSPA 3M9BA 1KLUD 1TWCB 4ZAIA 3T51B 3MXPA 3MEHA 2ZTCA 4A3FG 4IZ8A 4H02A 5E3FA 3KJPA 2Y0SG 4R8IA 3ULPA 4WORA 3NQIA 1Y1WH 2WB1G 5AJ3L 1BF4A 1YJ9A 2I0QA 2KECA 2UUBQ 3SXHA 1A3TA 2K5HA 1B70B 1SMYD 2MJ8A 3T56B 1CKMA 3I4MG 2HT1A 1Y14B 5EBCA 3IAYA 4MNOA 2XGTA 4TVAB 1XYIA 1Y8OB 1SE2A 3VR6A 4YY3Q 4KK7A 3HOVG 4BA1I 4DR2L 1WTHA 1F2ZA 3KF6A 5L37A 1HXYD 4RKBA 1UE1A 4Z9CB 3J80E 5CV9A 2TMPA 2A69C 2FMCA 2PZUA 3MXUA 3G4SA 1O7ZA 4BY7G 1GHJA 3L3OC 4KN7C 1CI3M 2K6AA 4R4IA 1N34Q 5M3MG 2X6LA 4TKOB 3CP0A 2JA9A 3J80c 5M3FH 2MPMA 1PH2A 4A3JG 2F0NA 4F87A 1FD7D 1I94Q 1L1OC 1X3QA 3OMCA 1BCPF 3NE5B 3PO3B 1PH3A 3GTJH 1Q81C 1S40A 2KJXA 1V9PA 3LNNA 3AEVA 3J7AF 1KDAA 4UAIA 4JI2L 4FF3A 1SROA 1S3OA 1STGA 2QGQA 1IW7D 1EEID 1LT3D 5CMDA 3BZKA 4IURA 1EL0A 1K8GA 5AFWA 1PDQA 4NPSA 3DXJC 3S17B 3PV0A 2FXQA 1EFID 3FPPA 1HTLD 3A7LA 3HOYG 2JQOA 4JI4Q 2F0WA 3A56A 3J7YW 4DK3C 3CCVA 1TWHB 3QB3A 1Q8IA 3A8JE 1N32Q 3TBIB 3MFGA 5IIFA 3FRPB 2F03A 5TSSA 4BBSH 5K5PA 4GN3B 3HKZE 1J6QA 1E2WA 3DEPA 4FP5D 4HMIA 1QE6A 1MJEA 3BZCA 1UNSA 4A3MB 4K2LA 1X3FA 4GKKQ 5C0XJ 1WD1A 1K9MC 4R4CA 1B44D 1Y8NB 1PRTD 1EYCA 3OMGA 4IUPA 3HOZH 4QMGA 2NVXH 3DM3A 4A3MG 1I4QA 2BE5C 4KY5A 3ITPA 1HZAA 4C3IB 3RNUA 2K04A 1VDZA 3D6WA 4PMWA 2VQFL 3PCOB 1HNXL 4GZYC 3AYHB 3LWEA 3CCQA 2Q2HA 5C4ZA 2KHSA 3D6CA 1BOSA 3WOEA 3K6OA 4PG3A 4XQJA 1HA6A 2WV6D 1CT1D 1XPOA 2QCPX 2RSNA 5ELOA 3LGJA 2A19A 3WWVA 1VQ5A 1U4RA 1P8LA 1QG7A 1S72A 4A3KG 2R61A 2A6HC 2BH2A 5M3FB 2K7VA 1LTSD 4KMUC 1X6OA 5C44B 2AQ3B 2PCFB 2B2WA 4DV0Q 2LXKA 4LFBQ 1LUZA 4POGA 3AQQA 3FKIG 4DR7L 2K5DA 1VQMA 1EOTA 1KLGD 4OIKA 2ZJRA 3IRBA 3D4RA 1CQFA 2QKIC 1ILQA 5C0XG 4KY6A 3W1GA 1SDFA 4AIMA 3EIVA 3M85A 1PH1A 4KKUA 4A93G 2F0KA 4GKJL 1DD2A 2AMCB 4HAEA 4R9WA 1Y1VB 4YY3L 2E2IB 4HJ8A 4P71A 2K1BA 2IT1A 2ZJPA 2KCNA 1WTVA 4RH6A 1Q82C 2EVBA 3CCMA 1EQVA 2EPBA 1EYAA 1SMYC 3I4OA 4JOIA 1V8QA 2L15A 1CHQD 4CGYB 1EQQA 1QUQA 1D6EC 4C3JG 1OO9B 3DWQA 4BS9A 3QIAA 5EPJA 1UE5A 3CCEA 2JA7G 1H9MA 5FJ8G 2NB0A 4A3BB 2CWAA 4UPAA 1WTQA 2M00A 2B29A 1ASZA 2XVSA 1EY8A 4DR2Q 2UUAL 5E4XA 3PGZA 4PQXA 1K8MA 4LUZA 2DJFC 1T5EA 3P1HA 3RZOB 1B3AA 2I5HA 3S1MH 4LJZC 3S14H 3CAMA 1N34L 1IZ6A 5F2DA 1IXRA 3A54A 2Z0SA 3DM1A 4X62L 1KAAA 2CW0C 3PIO3 4FF2A 2XNAC 4HJ5A 2F0QA 4JG2A 5EKLA 4KHPL 2R93H 4DUZQ 2YV5A 4EQPA 1B50A 4HIOA 2O5IC 2EYFA 1C48A 4EX5A 1IW7C 2HQEA 1ML0D 5C0XH 3MC0B 1PXUA 2XRSD 2FJ2A 1YIJA 2EJGC 2VUMG 4CDEC 4RG1A 2F3WA 3E9IA 4GLXA 4G7HC 1PZKD 3T1YL 1ET9A 2A74C 2K50A 5C3XA 5C44G 1IBLQ 1TWAB 1WYDA 2PMZB 2WINB 3FPUB 2XTIA 3N52A 5CR3A 1L1OA 2PQAB 1C9OA 2PQAA 2G9HD 3NWTA 4DAYA 4DAYB 1D5ZC 5IYDH 1SNOA 3S24A 4DNIA 1SFOB 1HA5A 2ID0A 2VS1A 4A3KB 3CRLC 5LMNW 4DUYL 1EZ8A 3K5LA 5I6WA 3Q6SA 1E2ZA 4H44C 4ZYSA 3BVMA 3MVVA 3RN5A 2ZXRA 3HZXA 4A76A 1YNND 2F1MA 4ZLTF 3T16A 3PUVA 3SGIA 1KRSA 2IPKD 1XNQQ 1IYVA 4RMFA 2B2VC 2OQKA 5CBAE 5M5YH 1TWHH 4R4TA 3A8IE 4ZQ3A 2ATWA 2EJMA 1H9SA 1EY0A 5C4XH 4KLKA 1ENCA 4DKAC 4JI0Q 3CXCA 4RCOA 1LYLA 3ULJA 3HOUG 2Q2IA 3B6YA 3I70A 2RCFA 3PMFA 5IYBG 4GS3A 4A3DH 2DY7A 1SSOA 4JI7Q 3QO2A 4CDFC 1K0SA 4Y52H 2BDNA 3D3RA 2AQ2B 3G6JB 3K81C 4IN3A 3SK5A 3TP5A 1MKHA 1XTCD 1STNA 1W6JA 4YWMA 5BN3A 1TWCH 4ZKCB 1GUOA 1BXTA 3KBGA 2HHHQ 3GV3A 3I56A 3NPPA 3W1BA 4OELB 3K57A 2PYKA 2JA8B 4G7OC 1PZJD 2UU9L 4DV3Q 1ASYA 4R4OA 4N9TA 2EYHA 4QGUA 3ZYYX 4OWXB 4KD3A 3S1RB 4YWKA 2F0HA 3AFPA 3LWUA 1B4OA 1K28A 4LUVA 3GTKB 3A7AB 3KUPA 4C3IH 2VB3X 3L2PA 3GQBA 2F0MA 5KNCA 1VQIA 2JA7H 5CV6A 5DM73 1B53A 1JJ2A 5J39A 4RCNA 3P75A 1QILA 1V1OA 2NTSA 4A3LH 1G51A 1YZ6A 4IUQA 1PH5A 4IFDH 1CA5A 1PTOH 1DOLA 1L0YB 1UE6A 3CU7A 2VQEL 1RL2A 3T53B 5C3WA 2OF1A 5CV5A 2D9UA 3K5MA 3H0GB 4DK1A 2I5MX 3OW2A 4X3KA 3BDOA 1PFSA 4QB4A 1GUNA 4R4QA 3OHXC 4K5XA 4IALA 1IL8A 2Z6KA 4LW1A 1G91A 2H4OA 1Z7TA 3T1HL 3CPWA 4P2CB 5GAEC 3GTGB 2F0UA 2IHFA 3UE1A 1CM9A 2KBNA 1X54A 4V0BA 3NXWA 3KLSA 4G7ZC 4G4KA 3K7AH 5FO9B 1VMCA 1K83B 1F9SA 2QEJC 2R7ZH 1HNZQ 2WACA 4ABNA 3ERSX 1SYEA 3E6ZX 4RAUC 4L5TA 3CCRA 4KKSA 1D5MC 5IE8A 1VQAA 1PRTB 2V4DA 5LMUL 5BN4A 1I4HA 1ZYRC 4WJ3M 3EBEA 3TMEA 4IQZA 1K83H 1S5ED 4IFDG 2F0PA 1XPUA 4OWWB 5CBEE 3MFYA 1LTTD 1C7YA 4LF8Q 1SR3A 4KJNA 3L7ZC 5K36G 3NUCA 2M9VA 2IJ0A 1CUKA 2VL6A 3I72A 3DHQA 3NP8A 4DAMA 2F4VQ 3GTPB 3T1HQ 4DFAA 3K0XA 2B2VA 4K6DA 1JICA 3KOJA 1X3PA 4RGMA 2QEXA 4EQ5A 3D4WA 4FF1A 2IY5B 2IX1A 1HZCA 1RCVD 1GM5A 1STYA 1VF7A 2KEDA 1ESFA 2B2TA 3CHBD 1BQQT 4LF7Q 2XWJB 5JPMC 4A3JH 1PRTF 4WFN3 2R93B 2A6HD 4LF4L 3TP8A 1X3GA 3FDTA 1VQCA 3TREA 1PFNA 5HGQA 3HP3A 3S9WA 3AB9A 1N36Q 4KKTA 2AUKA 3H0GG 5C4XB 4DAPA 3GTQB 3HG9A 4IFDI 1GVPA 4YHHL 4BY7H 4X64L 2ASBA 3G71A 4JI1Q 2QW7A 1JWSD 2P5ZX 4NDXA 1GOZA 1AE2A 2KHJA 1K8AC 1F77A 3KK7A 5C0XI 4BXXH 1QB5D 1VQJA 5BR8L 1W3SA 4EVOA 5M3FG 2QF7A 1SE8A 2EE1A 4GNXC 1BVSA 4X66L 5IGFA 4A3BH 1HR0W 4L8JA 4C3HG 3GTMH 4RFBA 3STBC 1HCZA 1PYBA 4Q0FA 2HDMA 1I4XA 1WJJA 1X55A 4FXKC 1EYDA 1O78A 3NELA 1G8ZD 1DGSA 1KL9A 1XWEA 2MP1A 5LHY1 2UXDQ 2X69A 1VQHA 2XWBB 3QR8A 3NQTA 4A93B 4DV2L 1M8AA 1FR3A 2B2UA 4K5VA 4NW2A 5C5LA 4K2KA 4XYOA 2K32A 4BY1H 1VQ7A 2B63H 4ODGA 5D3IB 3F2BA 4YWLA 1DYQA 1S5BD 3CC7A 2YU9H 4DPGA 3CQZB 1LLRD 2DY8A 2IWHA 2JEBI 2DUDA 1YHAA 2Z4HA 3S1NB 1UAPA 1EEFD 3R2IA 4BBRH 2OTLA 2CFMA 1SRUA 3CKIB 3P20A 1EWCA 1W2BA 4EQNA 4QF4A 3TDQA 1AFPA 1OXXK 2CQAA 1RD9D 3S1QB 1U0LA 2CHBD 2VB2X 1PFBA 2Q2TA 1X9NA 1VQPA 3OIQA 1QWYA 4JI4L 4CKCA 2D0OA 4IPGA 4ALPA 2C35B 2B39A 4O42A 4PZ6A 1PHJA 2R7DA 2ZTDA 1M1KC 4HMJA 2UU9Q 3HOYB 4XIGS 4DV4L 1B1ZA 1VQOA 3BZDB 4L5RC 1N36L 2R7ZB 5I6YA 1I4GA 2RQXA 1NMFA 4C3HB 5C3EG 2EXDA 3PO2G 3NSWA 3BYYB 2B63G 1QVCA 4DV1Q 1JJCB 4LAAA 4NXMQ 1PYSB 3J80L 4CJ1B 2DNCA 1MSHA 2LMCB 2XN9C 3A74A 1AZQA 1MSGA 1BBUA 1AZPA 5KIXA 3TRZA 1KABA 4A75A 3S14B 1IBMQ 3NHHA 1PLFA 2UUBL 1O80A 5ELCA 1QNKA 1GO3E 1QVGA 4ME5A 1D7QA 3A5ZB 2UXCL 1PTOF 1RIPA 4DV2Q 2L4NA 3VDYA 1YJNA 2X6GA 1IYJB 1EY6A 3PIPA 1TT2A 5JEAG 1Q12A 1X3EA 5T1IA 1XMQQ 4DV1L 2HD3A 1VMPA 5KEEA 1M90C 2B8GA 4GOPA 2F0EA 4DR3L 3GP7A 4DR5L 1OXSC 5IWAL 1Y69U 1I6VC 3C1EA 3HS0C 4JI6L 1V1PA 2MUYA 3D4DA 1LTBD 2PI2E 2VZAA 2WAQB 5IGEA 2Z1CA 4DV0L 3TS0A 2F4IA 3PUXA 5NUCA 4KTAA 5JEAJ 5M9OA 3BS1A 4JI5Q 1I6HH 2AQ1B 4A3FB 1EWIA 2L0CA 3TEHB 3EFXD 4LUOA 4C3JB 5EAYA 4RKLA 2CWPA 1F9RA 3MAQA 3BJUA 1TKWB 1FGUA 2NTTA 4G57A 3K8AA 2R3ZA 2KCMA 2WKDA 3HEJA 1XXGA 1A3UA 4AH6A 4DV4Q 1HR0L 1P16A 4QQBX 4I65A 2Z8LA 1Y1VG 1SBBB 1LM0A 2UUCQ 4DAVA 3BVZA 5G3LD 3GTLH 1JOKA 3U9SA 4P73A 1JJGA 1JMCA 2BA1A 2JSOA 2N3SA 3TZUA 1OXUA 1I6HB 1TWFB 1EU3A 2DNEA 2BOSA 3SVMA 2A68D 2CKZB 2Q8IB 3GTOB 4DV6Q 3U4ZA 1Y8PB 3S16H 3MZ5A 4X3UA 2RDFA 3RLFA 2K5WA 5A35A 2WB1B 3CMEA 4HJ7A 3I73A 2YYZA 2RBMA 3FVQA 4FNFA 1KRTA 2KEEA 3HOXH 1TS4A 2EY6A 3S17H 2A6EC 4NXNL 2J0TD 2ZM6L 4A3GB 3ND8A 3V05A 1L1OB 5JEAH 1NE3A 1EIYB 4LF6L 2ZT9C 4HIMA 5IT9E 2JJQA 3RZOH 3TSSA 1ZKOA 3GD7A 2AWNA 2N88A 4QIWB 2VQEQ 1EIHA 4C2MB 2R7ZG 4QIWE 1GUGA 4JOIC 3JAML 4CHTB 5IYDG 4B3TL 4OXPA 4DR1L 5ELFA 2Q2UA 2A68C 1Z47A 1CA6A 3EN2A 5EKKA 4P72A 1G2TA 4DF7A 5JOBA 4TQUS 5EKIA 4EGVA 4DR3Q 1GUSA 4MTKA 3MHBA 1PH4A 1EU4A 3CCSA 2HCCA 1IBKL 1BCPB 4E6IA 4OWTB 5GQOA 3AU7A 1ENFA 3R8BA 3X3NA 1VQ4A 1RKNA 1QCBD 1SNMA 5FLXE 4FDBA 5D65A 2CQOA 4R8NA 2R92B 4LF9Q 1YNXA 1Y1VH 5DLQE 2E2IH 2ICEC 2NYZD 1N33Q 5GROA 1PH8A 3K5OA 3BU2A 1YITA 2N55A 1FJGQ 2R92G 1DOMA 3H3VC 5JVG3 2DN8A 3HOUB 2GVAA 3M4PA 4HIDA 2NZ1D 5G3LF 5GAGC 4OO1G 1E3PA 1HHVA 1SEBD 1E1TA 2Z6BA 4JBMA 5T1GA 4ID6A 4GOPB 1S5DD 1JOOA 1ZYRD 2G9DA 2ZM6Q 1GJXA 1G291 3KDFB 1LTLA 1LTRD 4OIJA 5H1SE 3Q8DA 4H13C 1SYFA 4DA2A 1YHBA 4DK6C 3S1QH 4GKJQ 1FYCA 4Q5VA 1TS5A 2E2JB 1BKBA 4WRDA 1CKNA 3SE0A 1UWVA 4LFAQ 2IX0A 2JE6I 1MD2D 5IY0A 4XT1B 1A6XA 1PH7A 1PMRA 1TU2B 4GLAC 1H95A 1H9SB 1EZ6A 2B2WC 1G2SA 3W5OA 1GUWA 4NXNQ 2WP8J 3J81j 4YCUA 4BY1B 1HTPA 4HTHA 2QILA 4OO1I 3VYUA 5GAHC 5IGBA 4DR6Q 2Q8TA 1VF5C 2L9HA 4A93H 2TSSA 4KHVA 1TWGH 3I4MH 5M3MB 1JE4A 1ESRA 1RF2D 4LWCA 4TRDA 2K5VA 3IFTA 4MIUA 1JR0D 2B2TC 3GTGH 3URYA 4ME3A 5EGTA 1IL2A 5CGKA 3CF5A 4LMQD 2OEOA 4C3JH 2KUMA 4RGOS 4BA2I 1DM0B 1KXLA 1DOKA 4RGNA 2K75A 3CQZH 3F1ZA 1EQTA 2KA7A 2RVLA 2VW9A 4ZKBB 1VQ6A 2QDLA 5IYCG 1KDCA 5LL6X 2EY1A 3MA2B 4X66Q 2E8GA 2RF4A 3GTKH 3I4NB 5JJIA 4ZUIA 2NZOA 3MEFA 5JVH3 2EYPA 1NAPA 2PNRC 3VR3A 3QOLA 1EYGA 1E24A 2EZVA 4LF8L 1JQYD 3HOYH 1WI5A 3J81c 1NCVA 2ZXPA 4A3CG 3J80i 1QOHA 1SYBA 2FHTA 3HKZG 1F9QA 4IFDJ 5ELEA 1AH9A 3OIPA 2E2JH 3NTHA 2JA6G 3GTMB 4N9PA 3DEOA 3QOJA 2EXZA 2FFKB 4YIJA 2XSCA 3NENA 3WOFA 1R4QB 2WIIB 1GXDC 4MZ9A 4CBVA 2NVXB 2IL8A 3UDGA 1MHWC 1B3QA 2HDLA 3SHLA 1I3QB 1MGSA 2ENBA 5FOBB 1II3A 4JBWA 3S15H 1D8LA 1B8AA 3M3YB 4F8MA 1EY4A 4K0KL 4ZK9B 3RZDH 1CKOA 1QUQB 1DONA 2PPBC 2BCOA 1QNUA 1UE7A 2K5NA 4H7BA 2D0PA 2N49A 3FKIB 1YNNC 2DGYA 3M4OH 3DLLA 4X3SA 4FXGC 3V2TA 1XJVA 4KY7A 1SYDA 1HUMA 4LF9L 1VS0A 4N8X1 2UXBQ 2Y0SB 3ND9A 3HOWH 1SJED 4OL7A 5A2QL 2JA8H 3EVQA 1NUCA 5M5YB 1VQ9A 4OO1H 3RR5A 1B7YB 1X56A 4B3MQ 2HIVA 1STBA 4L5QA 3RUZA 5GADC 3KF8A 4UP9A 4CDDC 1IBML 1A3VA 5KNDA 3E0EA 1VQNA 4BWGB 3HOVH 4N8FA 5DEHA 5COYA 4A3CH 3Q22A 3H94A 1K3BC 4A3GH 3I8ZA 1Q1BA 2E2HB 1CSQA 3MXNA 1IYUA 2WB1E 5M5WB 4IPCA 1J8IA 5D14A 1H9RA 1AP0A 4JW0A 4DU9A 2NVQB 1B9NA 1PYWD 2N8NA 1I50B 2AWOA 5LMNQ 2YTYA 1LT6D 1Q1EA 4QUFA 1JE5A 4IOAA 3N6RA 1TWFH 2JN4A 2K05A 1SYCA 2MQHA 2F3VA 1NR2A 4UHVA 2A69D 4IJLA 3TP7A 3WDNA 3E9HA 4ULLA 1PH9A 3PF5A 1EY7A 4DV5Q 1QZGA 3IFDA 2B2YA 2E5LL 3MXNB 5CORA 2NWGA 3OSOA 3UE0A 5K36H 4JCVE 2D5DA 3RMHA 1JT8A 1NJIC 3FP9A 1Q3LA 4I7AA 2K4KA 3MTSA 1NNXA 1SAPA 2KCTA 5DNFA 2K14A 1DXMA 1ZEQX 4B3SL 4POFA 3S2HB 1HNXQ 1YBYA 1UEBA 4APVA 3ERQA 3UDIA 1J5EQ 4YCVA 3E5SA 3R2TA 4AQYL 5FK9C 4A3EB 1PTOB 2B2UC 5KGUA 4NXML 2A1AA 1GHKA 4K8JA 4AYBB 3K80C 1YNJD 4JYAQ 1ET6A 3KF6B 4CJ2C 5HURA 5ELNA 1JB3A 1XX8A 2EDGA 3ULLA 5IYBH 3U58A 5EPLA 3PO3G 3CD6A 1SNQA 4JC0A 4LFCL 4A3JB 3H3VI 1A2TA 1STHA 2VUMB 5M5XH 1DCZA 1XMOQ 4JI0L 3K5NA 1TXYA 3DUZA 1GKHA 1YHQA 2YTVA 5E7NA 3G7LA 1EOVA 3M7GA 2A5HA 1LV9A 4ZRZA 5LL6S 1BO0A 1YNJC 4YCWA 1CK1A 1VQ8A 4H0LC 4RHSA 3QWNA 3GTLB 3G6EA 2KHIA 3SDZA 3ZJYC 5E1FA 5M5WH 1JOQA 2RSOA 5LMNL 3C1FA 2HQLA 5JAVA 3F8TA 5IOCA 3CRKC 5M3MH 1FNVA 4QCLA 2BH8A 3I4MB 4IO9A 5IWAQ 3EA6A 1Q46A 1LABA 3KFUA 4GNXA 3JAMi 2DJGC 1MI2A 1WTOA 1K73C 4JI7L 2LSSA 1NMGA 3PQIA 1HZ9A 4O1NA 4JI5L 1PRTC 1F2YA 1KAWA 2NVTH 2A6ED 5BN5A 3OTOL 2SDFA 4DV3L 1HUNA 4X6AH 1YVCA 2Y0SE 2K33A 4HEDA 1XTDA 1X65A 1HNWQ 2VNUD 4BBRG 1LACA 1Y1WG 4B3RQ 1W6KA 2HUGA 3VR4A 2EYLA 1RODA 2F0DA 1JWUD 4CKBA 1WTXA 1C4QA 1D1IA 5J1ZA 4OGQC 4QY7A 3HOVB 3CCUA 4B9XA 3K58A 2VQFQ 1TS3A 1SFOH 4K8IA 5FO8B 1R4PB 3S2HH 3L9AX 4BBSG 1STEA 4BBRB 1BDOA 3I90A 1Z9FA 2FMMA 4LF5Q 3GDEA 2WAQE 4HCSA 4JI8Q 2MO0A 2L11A 1A63A 1IHZA 1PTOD 1LTAD 4PMBA 2EYJA 1WVLA 4LFCQ 1SYGA 3PUWA 2QDBA 4A3IG 1KD1C 3VA7A 4A3BG 1SJHD 4B3RL 1STAA 1PTOC 3KJOA 1LO5D 2HIXA 2ZTEA 5HY6A 1C0AA 1D5XC 2ICIA 1FL0A 1OXVA 3DMUA 3RZDB 4MHEA 4JI3L 5KNBA 4DR6L 3EQLC 5C4HA 5C3EB 4U673 4DV5L 2CCZA 3VA5A 2BE5D 2SEBD 2MGSA 3D8GA 4IUVA 5IT9c 1HNZL 2UUCL 5I9OA 2EQSA 3CCJA 1H9KA 1TWAH 3M4YA 4WJWA 3VYSA 2L12A 2LS01 2Z6KC 5FLMH 4B08A 1CQVA 1BNZA 1IBKQ 1XNRQ 5LMUQ 4DNRB 3DWAA 4C3IG 2NUCA 5JJLA 1WTWA 2EIFA 4DR7Q 1MBYA 3BVGA 5JJZA 3TZDA 5EBDA 1CSPA 4I7ZC 1SNPA 2F0TA 3OTOQ 2B8FA 5IODA 2H5XA 2O4XA 1X32A 1I94L 2M2LA 5FLXc 3KLWA 2RKSA 1G6PA 2NVQH 4JK1C 3R93A 3CPFA 1OXTA 1U4PA 4DN4M 1AW7A 2RHQB 4DV7L 3A55A 1J5EL 4LF4Q 1RTOA 4XTCS 3D31A 1SLJA 3W3AA 1JWMD 3K7UC 2XIWA 3H91A 3JC66 3NBHB 3TQYA 3GTJB 1WFQA 5BR8Q 1JORA 1AEXA 4UY8C 1NY4A 2A8VA 1N33L 3VR5A 4O0AA 3W2DA 2ZJQA 1HFGA 3NTIA 1CKNB 2PW5A 1BBWA 2HHHL 2B3GA 3JAME 2WFWA 1B9MA 3J7ZC 4KHPQ 4F7XA 2CH4W 5IGGA 1EWHA 2F3IA 1E2VA 2SNSA 3BYTB 1K3RA 2CH4A 2OTJA 2NN6H 4P75A 2F0FA 4FYDA 3VYTA 1F2MA 4V190 1FJGL 5FO7B 4GKKL 3JAMc 2V1CC 1VQDA 3BG3A 3SEBA 2KCCA 4JI3Q 3UDFA 1N9WA 1R9TB 4XYQA 2R7FA 3R3OA 3A5UA 2D2CC 1KDBA 3M3YH 4XXEA 3C2PA 1UEAB 4JBJA 2F52A 3FKIH 3SK8A 4CDCC 2MO1A 3U50C 4JVZA 3S1RH 3S1MB 5EPKA 1SN8A 1PA6A 1I3QH 5C44H 4A3IH 4JV5Q 1E22A 4IUNA 2N78A 4UP8A 4A3FH 4C1NI 1KIXA 4K14A 4HJ9A 1TY2A 4J6HA 4L6TB 3FEWX 3I91A 5A2QE 3STBD 4OONA 3LX0A 3P7JA 4ZUJA 2EJFC 4LF5L 2RDHA 4M1UB 2F4VL 1SE4A 1HJPA 3KLRA 2ZXOA 1PZID 1WCMH 3PIOA 3J7AV 4A3GG 2KVMA 2JXMB 4C2MH 2VY3A 3O13A 4FO2A 4C56C 3ICEA 5IYCH 1OTCA 2YU9B 4A3IB 2F0SA 2OCEA 3HRZC 4J8QA 4A3DB 1D2BA 4M8AA 3T1YQ 4XDXA 1KNAA 1ONLA 2HCIA 3BDCA 3EROA 4DV7Q 5C4XG 1V1QA 3NK9A 2L55A 3I4NG 3OPOA 4J15A 3SR1A 1TQOA 3E3XA 4IPHA 3KBXA 4LF7L 1WCMB 3CC2A 1HQRD 1DZ1A 2E2DC 1IKLA 3F2UA 3CMAA 3IKJA 4JYAL 4QJFA 4X64Q 2EYMA 1IKMA 5ELDA 2D62A 3A8KE 4ZCKA 1TVXA 4FVMA 4DR5Q 4K5WA 5JPNC 4K0KQ 3T4AC 4F88A 1G6ZA 2K01A 3Q23A 3HOXG 3PO3H 1XMOL 5C5MA 1GUTA 4JI2Q 1TY0A 4B9WA 1NBWA 2A73B 4A3DG 1KC8C 3PIP3 4LK1C 1Q8KA 1Q86C 4YHHQ 2PMZE 3OW7A 4NKLA 5JJKA 1K8OA 4XT3B 4JI6Q 2UXCQ 1M4VA 4NMZA 1D1KA 2BA0A 1JB7A 3I4NH 3G48A 1I4RA 2KQ3A 4OX9Q 3S2DH 3RLOA 5IT9L 2EY5A 2NZHA 1Q90A 3J81E 5HGTA 2E74C 3F2DA 2NN6G 4JV5L 3BDLA 1BBXC 1PFMA 4NP5A 2UXBL 1LTID 3KYHC 2PZWA 2L1BA 2F0GA 1VQBA 3A0JA 3S15B 1V43A 4UP7A 1VCIA 4HSVA 4QUCA 2F0OA 1O7YA 5CC4A 4HR7B 4DXFA 3DWPA 4DUZL 4DUYQ 1EUJA 1TWGB 4DGZA 1FNUA 4A3MH 3I4LA 1FNWA 2L5TA 2UXDL 1BCPC 3AFQA 1QJOA 5I9PA 4GN5A 2OQ0A 5CV4A 4LFBL 4OEMB 1I5FA 5I2YA 3I55A 3RD4A 4CJ0B 3H6MA 4HIKA 1CTMA 3M4OB 4BXXG 3I3CA 5IP7G 3C3LA 5DM63 4NB3A 4B3ML 1ENAA 1KHIA 4U68A 4DV6L 1UUPA 4TSSA 2QA4A 3ONAB 2CW0D 5IP9G 1KTKA 2YTXA 2FINB 1R9TH 1L0WA 1LT5D 1YI2A 2NN6I 3PO2B 4IJHA 3QJYA 2IHEA 4IUTA 1BR9A 2WKCA 4GOPC 1T5XD 1CZGA 5AJ3Q 1H9JA 1LT4D 4GLVB 3UI2A 1TR5A 3SK6A 4ILWA 3TN2A 4PZ8A 5ELBA 4PMCA 1Z6HA 2JEAI 3OYYA 3CCLA 2OT2A 1B2TA 4UDUC 2I07B 4K6LA 4KI0A 2E75C 5CV8A 3NBIA 5C4JB 3HOWG 1JCKB 4HN7A 4S3SA 4QL5A 1CFMA 1HQMC 4AYBE 2O2LD 3T13A 1S4ZA 4LF6Q 1EY5A 1F2LA 3IL8A 4RGTA 2PQEA 3J7A5 3TS2A 2NBFA 3Q24A 5E4WC 3MXGA 1HZBA 1I4PA 2JA5H 2GN5A 3V96A 5IP7H 2KENA 4OX9L 1ICFB 2E76C 2RCNA 2XRQD 4RA8A 4CKEA 3H15A 4A3LG 5FLXL 2E5LQ 3HOXB 1XNRL 2EY2A 2PZTA 3RLNA 1ICWA 3L0OA 1XMQL 4Y7NB 4KHZA 1U4MA 2EOTA 1PVOA 4MN3A 1U5KA 3CC4A 1BUVT 1RDPD 4LNQA 1QVFA 3GTPH 5J3BA 1EIFA 1WTRA 2MNAA 5CYUA 1LTGD 1RJTA 5KYLA 2LFNA 2LXJA 1VQEA 2I5LX 4JI1L 1YEZA 1Y1WB 4EQOA 3J81L 2NVYB 3CW2C 2ALYB 1O7IA 2C9OA 3GV6A 1AN8A 1N8RC 3H0GH 1RTNA 2JA6B 1C8CA 5IGCA 1CZWA 5FLMG 1QZHA 4IOCA 3KF8B 2JK8A 1WD0A 2GVBA 5DAUA 2IX3A 3K0YA 3S1NH 5I4DA 4JBKA 2B2YC 2F0JA 5M5XB 4Y7NH 1BCPD 3HOUH 2AKWB 3SK4A 2JA7B 5C3EH 4KJOA 3PUZA 3PO2H 3EJIA 2SNMA 4PNYA 1SNCA 3GTOH 3HOZG 1A8VA 4DK0A 5ISRA 4BBSB 1Q7YC 1VQGA 2R93G 1VQKA 1TS2A 1E7ZA 5EJWA 2F0IA 2K5QA 3QG1A 4X62Q 5KYIA 1HH2P 3KDFA 1ILPA 4KN4C 4RHRA 4KD4A 3NTKA 4XQNA 1RHPA 2BDOA 3HOZB 3E0JA 2IW3A 3OWFA 1EQRA 5IGDA 4PV1C 3HFZB 2LY7A 1L2FA 4GN4B 3HKZB 2AHOB 3NWSA 4IUUA 4GNXB 3C46A 4JPBW 3I2ZA 2WAQG 2OXPA 1ZXTA 1IBLL 2R92H 1PV4A 3FMCA 2J4XA 1VQFA 4P74A 1HNWL 2RDGA 1HFNA 4C1NK 3U9OA 3ER0A 3KLSX 4A3EG 5IP9H 2K03A 4FF4A 4X3TA 4A4IA 2RA4A 2RHSB 1E0BA 1FGBD 2K52A 1N32L 3S16B 1A15A 4B3SQ 4DR4Q 3S2DB 4L63B 1I50H 2F0LA 4C3HH 4X65Q 2MFIA 2JA5G 3Q0AA 3HGBA 1NTGA 2VXWA 2EYOA 2PNHA 2PI2A 3TP6A 1NR4A 2R6GA 4JI8L 2JYOA 3I7FA 4KV6A 5D3DA 1A62A 2UUAQ 5C4JH 4O2DA 4XQQA 1WTPA 3U4VA 1NSNS 4BY1G 1DJRD 2SOBA 3OOCA 3RN2A 4J1MA 5CV7A 1S5CD 3M4QA 5FKAC 4R1JA 3PSIA 2C5CA 1SNDA 5FJ8H 3MWYW 5C6AA 4HCEA 3PUYA 4AYBG 3HOWB 1WOCA 2H1EA 4AQYQ 1J9OA 2B63B 2O5JC 1GD7A 1MIUA 2CVRA 4MTNA 1V1PB 4WJ4A 4FXDA 1A2UA 1TIID 1F9PA 2ES2A 2JA5B 3HKSA 1K0RA 1JC7A 3NEMA 3X3MA 2NVTB 3K7AB 1HRJA 4A3KH 4OHJA 2E2HH 3F2CA 2JA8G 1EFWA 2GA4B 1AE3A 1HPCA 1T9HA 3GO5A 1VQLA 1A0IA 5KRUA 2JA6H 3K59A 1PH6A 1SXTA 4A3EH 3FHWA 2Z9HA 4IPDA 2MHVA 2NVYH 4DNTB 3H3VH 1L0XB 4X65L 1FVIA 5J22A 1O7LA 1CHPD 3OWEB 4LFAL 3AMUA 2J7ZA 2OWOA 2Z4IA 1KNEA 1EIGA 5I2XA 2KOLA 1XNQL 4PZ7A 3UDXA 4L5SA 3VYRA 2G5DA 3NBHA 2VUMH 4DR4L 1E1OA 2K28A 1MJCA 2I46A 1KQSA 2PW7A 1XPRA 1EY9A 1SMXA 3J81i 2JP1A 5EQ0A 4HJAA 4BY7B 1YJWA 1U9RA 2F0VA 3M7NA 3GTQH 4DXGA 4RWSC 3H09A 2AUJD 2Q8RE 2PO4A 3VR2A 1HR0Q
chains in the Genus database with same CATH topology
4DR1Q 2R7ZH 3D0FA 2N78A 1KXLA 1HNZQ 4UP8A 1WCMG 2K75A 3ERSX 3CQZH 3F1ZA 4A3FH 1KIXA 4B3TQ 4HJ9A 4L5TA 3PF4A 2VW9A 1VQ6A 5IYCG 3M9BA 4X66Q 2E8GA 2RF4A 4OONA 3STBD 3GTKH 3CCRA 5JJIA 4LF5L 2F4VL 2NZOA 3MEFA 5IE8A 2ZTCA 1HJPA 1VQAA 1WCMH 5LMUL 4A3FG 3PIOA 4H02A 4A3GG 4WJ3M 4C2MH 2VY3A 3EBEA 3ICEA 3KJPA 1K83H 1EYGA 1E24A 2Y0SG 5IYCH 3ULPA 1OTCA 4LF8L 1XPUA 4IFDG 4OWWB 2OCEA 3HOYH 1WI5A 1C7YA 3J81c 4LF8Q 4A3CG 3J80i 1Y1WH 2WB1G 1SR3A 3HKZG 5AJ3L 3T1YQ 3L7ZC 1YJ9A 2I0QA 4IFDJ 5K36G 4DV7Q 1AH9A 2UUBQ 4DAMA 1CUKA 2VL6A 2E2JH 2JA6G 5C4XG 1V1QA 2F4VQ 2K5HA 3T1HQ 1B70B 3I4NG 1CKMA 3K0XA 3I4MG 2HT1A 3KOJA 1Y14B 2QEXA 4J15A 4EQ5A 4IPHA 4MNOA 4LF7L 2XGTA 4TVAB 3CC2A 2IY5B 3NENA 2IX1A 1HZCA 4MZ9A 1GM5A 4YY3Q 3HOVG 4BA1I 4DR2L 3CMAA 3UDGA 3KF6A 4JYAL 4QJFA 4X64Q 1UE1A 2D62A 4JBWA 4LF7Q 3S15H 1D8LA 1B8AA 4A3JH 3G4SA 4DR5Q 4BY7G 4LF4L 1X3GA 4K0KQ 1VQCA 4R4IA 3TREA 5M3MG 1N34Q 5HGQA 4K0KL 3HOXG 3RZDH 1CKOA 3PO3H 1QUQB 1N36Q 1XMOL 4JI2Q 3CP0A 3H0GG 2JA9A 3J80c 1UE7A 5M3FH 2K5NA 1GVPA 4IFDI 4YHHL 1PH2A 2D0PA 2N49A 4A3JG 1NBWA 4X64L 2ASBA 4BY7H 2DGYA 3G71A 1I94Q 3M4OH 3DLLA 1L1OC 4JI1Q 1XJVA 4A3DG 1KC8C 4LF9L 1VS0A 1PH3A 2UXBQ 1AE2A 2KHJA 1K8AC 1Q8KA 3HOWH 3GTJH 5C0XI 1Q81C 1S40A 1VQJA 5BR8L 1V9PA 1Q86C 4YHHQ 3AEVA 1W3SA 2JA8H 2PMZE 5M3FG 5JJKA 1SE8A 4GNXC 1VQ9A 4JI6Q 4JI2L 1BVSA 3RR5A 4X66L 1B7YB 1X56A 2UXCQ 1SROA 2BA0A 1S3OA 1JB7A 4B3MQ 2HIVA 3G48A 4OX9Q 3I4NH 3S2DH 2QGQA 4A3BH 1HR0W 4L5QA 3RLOA 3GTMH 2NZHA 5GADC 3STBC 3BZKA 1K8GA 1PYBA 4UP9A 3F2DA 1IBML 4NPSA 1WJJA 1X55A 2NN6G 3E0EA 1VQNA 4JV5L 3NELA 3PV0A 2FXQA 3HOVH 3HOYG 1DGSA 1KL9A 2JQOA 2UXDQ 4JI4Q 1VQHA 4A3CH 4DK3C 2UXBL 3KYHC 4DV2L 3CCVA 1N32Q 1VQBA 3A0JA 1V43A 4UP7A 1VCIA 4A3GH 1Q1BA 4BBSH 4BY1H 1CSQA 1VQ7A 4GN3B 2WB1E 3HKZE 2B63H 4IPCA 3F2BA 1J6QA 4YWLA 3CC7A 4DUZL 2YU9H 4DUYQ 4DPGA 1EUJA 1MJEA 3BZCA 4A3MH 2UXDL 1X3FA 2JEBI 3AFQA 2DUDA 1YHAA 5C0XJ 2N8NA 4GKKQ 4GN5A 2OQ0A 1K9MC 4LFBL 4R4CA 2AWOA 5LMNQ 2YTYA 1I5FA 1Q1EA 3I55A 1JE5A 4BBRH 4HIKA 2NVXH 2OTLA 3HOZH 4IOAA 4BXXG 1TWFH 3DM3A 2CFMA 2MQHA 5IP7G 4A3MG 1SRUA 4NB3A 1W2BA 4B3ML 4IJLA 1KHIA 4DV6L 1OXXK 3E9HA 1HZAA 2QA4A 1PH9A 1U0LA 5IP9G 3PF5A 2YTXA 4DV5Q 1R9TH 1L0WA 1YI2A 2NN6I 3RNUA 4IJHA 1QZGA 2E5LL 3MXNB 2Q2TA 3UE0A 2IHEA 1VQPA 4JCVE 4PMWA 2VQFL 1X9NA 3PCOB 1JT8A 1HNXL 1NJIC 3AYHB 3CCQA 2Q2HA 3FP9A 4JI4L 2D0OA 4GOPC 4IPGA 4ALPA 2C35B 2K4KA 4PZ6A 5AJ3Q 1PHJA 2R7DA 2ZTDA 1M1KC 2UU9Q 2KCTA 4XIGS 4PG3A 2K14A 4DV4L 4GLVB 4B3SL 1VQOA 4POFA 1XPOA 1HNXQ 1YBYA 1UEBA 4PZ8A 4APVA 5ELOA 1N36L 3UDIA 1J5EQ 3LGJA 4L5RC 2A19A 3WWVA 2JEAI 3OYYA 1NMFA 4YCVA 5C3EG 1VQ5A 1P8LA 3CCLA 2EXDA 4KI0A 1S72A 4AQYL 3PO2G 2B63G 4NXML 1QVCA 2A1AA 4DV1Q 1JJCB 4A3KG 3HOWG 4NXMQ 3K80C 1PYSB 4QL5A 2BH2A 4AYBE 4JYAQ 4LF6Q 3A74A 3KF6B 3J7A5 5ELNA 3U58A 3TS2A 3ULLA 5IYBH 1X6OA 3PO3G 3CD6A 4DV0Q 1BBUA 4JC0A 1HZBA 2LXKA 4LFBQ 4LFCL 1LUZA 2JA5H 4POGA 2GN5A 3AQQA 3FKIG 5IP7H 3H3VI 2KENA 4DR7L 4OX9L 5M5XH 3TRZA 1VQMA 2RCNA 3H15A 1XMOQ 4A75A 1IBMQ 4JI0L 4A3LG 2ZJRA 3IRBA 1TXYA 1YHQA 1GKHA 2E5LQ 2UUBL 2YTVA 5E7NA 5C0XG 1XNRL 1EOVA 1GO3E 1QVGA 4BXXH 3RLNA 3W1GA 4AIMA 4YCWA 1D7QA 3EIVA 3A5ZB 3L0OA 1VQ8A 2UXCL 3M85A 1XMQL 1PH1A 4A93G 1RIPA 4GKJL 4KHZA 3G6EA 4DV2Q 2KHIA 1PVOA 2AMCB 1U5KA 3ZJYC 4YY3L 4HJ8A 3VDYA 4P71A 5M5WH 1YJNA 2IT1A 3CC4A 5J3BA 1EIFA 2ZJPA 2MNAA 1Q82C 4LNQA 1QVFA 1IYJB 3PIPA 5JEAG 1Q12A 1X3EA 3CCMA 5LMNL 2LXJA 1XMQQ 4DV1L 1VQEA 2HQLA 2I5LX 4JI1L 1YEZA 3F8TA 3I4OA 3CW2C 4JOIA 2ALYB 5M3MH 1M90C 1O7IA 2BH8A 2L15A 4GOPA 4IO9A 1EQQA 1QUQA 5IWAQ 4DR3L 1N8RC 1Q46A 4DR5L 3H0GH 3KFUA 1OXSC 4GNXA 5IWAL 3JAMi 1UE5A 3CCEA 2JA7G 5FJ8G 5FLMG 1K73C 4JI6L 1QZHA 4IOCA 4JI7L 3KF8B 2JK8A 2LSSA 2PI2E 1NMGA 2VZAA 2CWAA 2GVBA 4UPAA 1HZ9A 4JI5L 4DV0L 3TS0A 3S1NH 1KAWA 4JBKA 3PUXA 4JI5Q 2NVTH 5JEAJ 1I6HH 2B29A 3OTOL 1ASZA 4Y7NH 4DR2Q 2UUAL 4DV3L 1EWIA 3PGZA 3TEHB 3HOUH 2AKWB 4X6AH 5C3EH 4LUOA 3PUZA 4LUZA 1YVCA 2Y0SE 3GTPH 1XTDA 5EAYA 3PO2H 1X65A 1HNWQ 3GTOH 2CWPA 2VNUD 3BJUA 1A8VA 2I5HA 1FGUA 4BBRG 3HOZG 3S1MH 1Q7YC 3CAMA 3S14H 1VQGA 1Y1WG 1N34L 2R93G 4B3RQ 1IZ6A 1IXRA 3K8AA 2KCMA 1HR0L 2Z0SA 4DV4Q 1VQKA 4AH6A 4QQBX 1E7ZA 1P16A 4X62L 1Y1VG 4X62Q 1LM0A 4QY7A 2UUCQ 3CCUA 1HH2P 3KDFA 3GTLH 4HJ5A 2VQFQ 1SFOH 4P73A 4JG2A 1JJGA 1JMCA 4KHPL 2R93H 2BA1A 2N3SA 3S2HH 4DUZQ 1OXUA 2YV5A 4HIOA 4BBSG 4EX5A 2CKZB 1Z9FA 4DV6Q 3U4ZA 4LF5Q 1EQRA 3GDEA 2WAQE 4JI8Q 2MO0A 3S16H 1A63A 3HFZB 1YIJA 2VUMG 1L2FA 4GN4B 3RLFA 4RG1A 3CMEA 2AHOB 3E9IA 4HJ7A 4GLXA 2YYZA 3T1YL 4LFCQ 2K50A 1KRTA 5C44G 3PUWA 4GNXB 4A3IG 1IBLQ 1WYDA 1KD1C 3HOXH 3I2ZA 2WAQG 4A3BG 3S17H 4NXNL 1IBLL 4B3RL 2XTIA 2ZM6L 2R92H 1L1OB 1PV4A 1L1OA 1NE3A 1C9OA 2PQAA 2PQAB 4DAYB 3KJOA 1EIYB 2HIXA 4LF6L 2ZTEA 1VQFA 4P74A 5HY6A 4HIMA 1HNWL 1C0AA 5IYDH 3S24A 4DNIA 2ID0A 2VS1A 1FL0A 2JJQA 3RZOH 1OXVA 5LMNW 3ER0A 4A3EG 5IP9H 4DUYL 4JI3L 3GD7A 2AWNA 4A4IA 2VQEQ 4DR6L 4DV5L 2RHSB 2CCZA 2R7ZG 4QIWE 2K52A 4JOIC 5IT9c 1N32L 5IYDG 3RN5A 1HNZL 2UUCL 4B3TL 4OXPA 4DR1L 2EQSA 4B3SQ 4DR4Q 4A76A 3CCJA 1TWAH 2Q2UA 1Z47A 3EN2A 1I50H 3PUVA 4P72A 1KRSA 3SGIA 4C3HH 4X65Q 1XNQQ 2MFIA 4RMFA 2JA5G 4TQUS 1NTGA 2OQKA 2Z6KC 5M5YH 5FLMH 1TWHH 4DR3Q 4R4TA 1PH4A 2ATWA 2PNHA 2PI2A 5C4XH 3CCSA 1IBKQ 5LMUQ 1XNRQ 4KLKA 1IBKL 4DKAC 4JI0Q 5JJLA 2R6GA 4OWTB 4JI8L 3CXCA 5GQOA 2EIFA 3I7FA 1VQ4A 4DR7Q 4FDBA 1LYLA 3ULJA 3HOUG 2Q2IA 2CQOA 3B6YA 1A62A 2UUAQ 1CSPA 5C4JH 4O2DA 3U4VA 3OTOQ 4LF9Q 1YNXA 4BY1G 5IYBG 4GS3A 4A3DH 1Y1VH 2H5XA 5DLQE 3RN2A 2E2IH 1N33Q 5GROA 1PH8A 1I94L 3BU2A 4JI7Q 1YITA 3M4QA 1FJGQ 5FLXc 2R92G 4R1JA 3PSIA 3KLWA 5FJ8H 4Y52H 2GVAA 3K81C 3M4PA 4HIDA 2NVQH 1G6PA 3CPFA 1MKHA 1OXTA 3PUYA 4AYBG 5GAGC 1WOCA 1E3PA 4AQYQ 4YWMA 4OO1G 1GD7A 1TWCH 2RHQB 1E1TA 4DV7L 4JBMA 4GOPB 1MIUA 1J5EL 4LF4Q 4MTNA 4XTCS 3D31A 2HHHQ 4WJ4A 2ZM6Q 3I56A 1G291 1SLJA 3W1BA 3KDFB 1LTLA 2ES2A 3HKSA 1K0RA 5H1SE 3Q8DA 3K7UC 3NEMA 3TQYA 3JC66 3NBHB 4DV3Q 2UU9L 1YHBA 4DK6C 3S1QH 1ASYA 1WFQA 5BR8Q 4R4OA 4A3KH 4GKJQ 4QGUA 4UY8C 1NY4A 2A8VA 4OWXB 1N33L 2E2HH 3F2CA 2JA8G 1BKBA 1EFWA 4YWKA 4O0AA 1AE3A 3AFPA 1T9HA 2ZJQA 3GO5A 1VQLA 1CKNA 1CKNB 1A0IA 1UWVA 1BBWA 2IX0A 4LFAQ 2JA6H 2HHHL 2JE6I 4LUVA 4A3EH 1PH6A 3FHWA 2B3GA 5IY0A 4C3IH 1PH7A 3L2PA 2WFWA 3J7ZC 4KHPQ 4IPDA 4GLAC 2NVYH 3H3VH 1VQIA 2JA7H 2F3IA 1FVIA 4X65L 1H95A 1JJ2A 1K3RA 3W5OA 2OTJA 4LFAL 4P75A 4NXNQ 2WP8J 2OWOA 4A3LH 1G51A 1YZ6A 1PH5A 1FJGL 3J81j 4YCUA 1XNQL 4PZ7A 1UE6A 4GKKL 3JAMc 3UDXA 2V1CC 1VQDA 4L5SA 4OO1I 5GAHC 2VUMH 2VQEL 4DR6Q 4DR4L 1E1OA 4JI3Q 1RL2A 4A93H 3UDFA 1N9WA 1MJCA 1TWGH 2I5MX 2R7FA 1KQSA 3OW2A 3I4MH 3A5UA 1XPRA 1SMXA 3J81i 1PFSA 3M3YH 4R4QA 2Z6KA 4JBJA 4LW1A 4LWCA 2F52A 2K5VA 3GTGH 4HJAA 3T1HL 3CPWA 3FKIH 5GAEC 2MO1A 3U50C 1YJWA 3M7NA 4ME3A 3GTQH 3S1RH 1IL2A 2IHFA 1SN8A 3UE1A 1PA6A 2KBNA 1I3QH 1X54A 3CF5A 5C44H 4A3IH 4C3JH 3K7AH 4BA2I 4JV5Q 1HR0Q 1E22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 Q;  2R7Z H;  3D0F A;  2N78 A;  1KXL A;  1HNZ Q;  4UP8 A;  1WCM G;  2K75 A;  3ERS X;  3CQZ H;  3F1Z A;  4A3F H;  1KIX A;  4B3T Q;  4HJ9 A;  4L5T A;  3PF4 A;  2VW9 A;  1VQ6 A;  5IYC G;  3M9B A;  4X66 Q;  2E8G A;  2RF4 A;  4OON A;  3STB D;  3GTK H;  3CCR A;  5JJI A;  4LF5 L;  2F4V L;  2NZO A;  3MEF A;  5IE8 A;  2ZTC A;  1HJP A;  1VQA A;  1WCM H;  5LMU L;  4A3F G;  3PIO A;  4H02 A;  4A3G G;  4WJ3 M;  4C2M H;  2VY3 A;  3EBE A;  3ICE A;  3KJP A;  1K83 H;  1EYG A;  1E24 A;  2Y0S G;  5IYC H;  3ULP A;  1OTC A;  4LF8 L;  1XPU A;  4IFD G;  4OWW B;  2OCE A;  3HOY H;  1WI5 A;  1C7Y A;  3J81 c;  4LF8 Q;  4A3C G;  3J80 i;  1Y1W H;  2WB1 G;  1SR3 A;  3HKZ G;  5AJ3 L;  3T1Y Q;  3L7Z C;  1YJ9 A;  2I0Q A;  4IFD J;  5K36 G;  4DV7 Q;  1AH9 A;  2UUB Q;  4DAM A;  1CUK A;  2VL6 A;  2E2J H;  2JA6 G;  5C4X G;  1V1Q A;  2F4V Q;  2K5H A;  3T1H Q;  1B70 B;  3I4N G;  1CKM A;  3K0X A;  3I4M G;  2HT1 A;  3KOJ A;  1Y14 B;  2QEX A;  4J15 A;  4EQ5 A;  4IPH A;  4MNO A;  4LF7 L;  2XGT A;  4TVA B;  3CC2 A;  2IY5 B;  3NEN A;  2IX1 A;  1HZC A;  4MZ9 A;  1GM5 A;  4YY3 Q;  3HOV G;  4BA1 I;  4DR2 L;  3CMA A;  3UDG A;  3KF6 A;  4JYA L;  4QJF A;  4X64 Q;  1UE1 A;  2D62 A;  4JBW A;  4LF7 Q;  3S15 H;  1D8L A;  1B8A A;  4A3J H;  3G4S A;  4DR5 Q;  4BY7 G;  4LF4 L;  1X3G A;  4K0K Q;  1VQC A;  4R4I A;  3TRE A;  5M3M G;  1N34 Q;  5HGQ A;  4K0K L;  3HOX G;  3RZD H;  1CKO A;  3PO3 H;  1QUQ B;  1N36 Q;  1XMO L;  4JI2 Q;  3CP0 A;  3H0G G;  2JA9 A;  3J80 c;  1UE7 A;  5M3F H;  2K5N A;  1GVP A;  4IFD I;  4YHH L;  1PH2 A;  2D0P A;  2N49 A;  4A3J G;  1NBW A;  4X64 L;  2ASB A;  4BY7 H;  2DGY A;  3G71 A;  1I94 Q;  3M4O H;  3DLL A;  1L1O C;  4JI1 Q;  1XJV A;  4A3D G;  1KC8 C;  4LF9 L;  1VS0 A;  1PH3 A;  2UXB Q;  1AE2 A;  2KHJ A;  1K8A C;  1Q8K A;  3HOW H;  3GTJ H;  5C0X I;  1Q81 C;  1S40 A;  1VQJ A;  5BR8 L;  1V9P A;  1Q86 C;  4YHH Q;  3AEV A;  1W3S A;  2JA8 H;  2PMZ E;  5M3F G;  5JJK A;  1SE8 A;  4GNX C;  1VQ9 A;  4JI6 Q;  4JI2 L;  1BVS A;  3RR5 A;  4X66 L;  1B7Y B;  1X56 A;  2UXC Q;  1SRO A;  2BA0 A;  1S3O A;  1JB7 A;  4B3M Q;  2HIV A;  3G48 A;  4OX9 Q;  3I4N H;  3S2D H;  2QGQ A;  4A3B H;  1HR0 W;  4L5Q A;  3RLO A;  3GTM H;  2NZH A;  5GAD C;  3STB C;  3BZK A;  1K8G A;  1PYB A;  4UP9 A;  3F2D A;  1IBM L;  4NPS A;  1WJJ A;  1X55 A;  2NN6 G;  3E0E A;  1VQN A;  4JV5 L;  3NEL A;  3PV0 A;  2FXQ A;  3HOV H;  3HOY G;  1DGS A;  1KL9 A;  2JQO A;  2UXD Q;  4JI4 Q;  1VQH A;  4A3C H;  4DK3 C;  2UXB L;  3KYH C;  4DV2 L;  3CCV A;  1N32 Q;  1VQB A;  3A0J A;  1V43 A;  4UP7 A;  1VCI A;  4A3G H;  1Q1B A;  4BBS H;  4BY1 H;  1CSQ A;  1VQ7 A;  4GN3 B;  2WB1 E;  3HKZ E;  2B63 H;  4IPC A;  3F2B A;  1J6Q A;  4YWL A;  3CC7 A;  4DUZ L;  2YU9 H;  4DUY Q;  4DPG A;  1EUJ A;  1MJE A;  3BZC A;  4A3M H;  2UXD L;  1X3F A;  2JEB I;  3AFQ A;  2DUD A;  1YHA A;  5C0X J;  2N8N A;  4GKK Q;  4GN5 A;  2OQ0 A;  1K9M C;  4LFB L;  4R4C A;  2AWO A;  5LMN Q;  2YTY A;  1I5F A;  1Q1E A;  3I55 A;  1JE5 A;  4BBR H;  4HIK A;  2NVX H;  2OTL A;  3HOZ H;  4IOA A;  4BXX G;  1TWF H;  3DM3 A;  2CFM A;  2MQH A;  5IP7 G;  4A3M G;  1SRU A;  4NB3 A;  1W2B A;  4B3M L;  4IJL A;  1KHI A;  4DV6 L;  1OXX K;  3E9H A;  1HZA A;  2QA4 A;  1PH9 A;  1U0L A;  5IP9 G;  3PF5 A;  2YTX A;  4DV5 Q;  1R9T H;  1L0W A;  1YI2 A;  2NN6 I;  3RNU A;  4IJH A;  1QZG A;  2E5L L;  3MXN B;  2Q2T A;  3UE0 A;  2IHE A;  1VQP A;  4JCV E;  4PMW A;  2VQF L;  1X9N A;  3PCO B;  1JT8 A;  1HNX L;  1NJI C;  3AYH B;  3CCQ A;  2Q2H A;  3FP9 A;  4JI4 L;  2D0O A;  4GOP C;  4IPG A;  4ALP A;  2C35 B;  2K4K A;  4PZ6 A;  5AJ3 Q;  1PHJ A;  2R7D A;  2ZTD A;  1M1K C;  2UU9 Q;  2KCT A;  4XIG S;  4PG3 A;  2K14 A;  4DV4 L;  4GLV B;  4B3S L;  1VQO A;  4POF A;  1XPO A;  1HNX Q;  1YBY A;  1UEB A;  4PZ8 A;  4APV A;  5ELO A;  1N36 L;  3UDI A;  1J5E Q;  3LGJ A;  4L5R C;  2A19 A;  3WWV A;  2JEA I;  3OYY A;  1NMF A;  4YCV A;  5C3E G;  1VQ5 A;  1P8L A;  3CCL A;  2EXD A;  4KI0 A;  1S72 A;  4AQY L;  3PO2 G;  2B63 G;  4NXM L;  1QVC A;  2A1A A;  4DV1 Q;  1JJC B;  4A3K G;  3HOW G;  4NXM Q;  3K80 C;  1PYS B;  4QL5 A;  2BH2 A;  4AYB E;  4JYA Q;  4LF6 Q;  3A74 A;  3KF6 B;  3J7A 5;  5ELN A;  3U58 A;  3TS2 A;  3ULL A;  5IYB H;  1X6O A;  3PO3 G;  3CD6 A;  4DV0 Q;  1BBU A;  4JC0 A;  1HZB A;  2LXK A;  4LFB Q;  4LFC L;  1LUZ A;  2JA5 H;  4POG A;  2GN5 A;  3AQQ A;  3FKI G;  5IP7 H;  3H3V I;  2KEN A;  4DR7 L;  4OX9 L;  5M5X H;  3TRZ A;  1VQM A;  2RCN A;  3H15 A;  1XMO Q;  4A75 A;  1IBM Q;  4JI0 L;  4A3L G;  2ZJR A;  3IRB A;  1TXY A;  1YHQ A;  1GKH A;  2E5L Q;  2UUB L;  2YTV A;  5E7N A;  5C0X G;  1XNR L;  1EOV A;  1GO3 E;  1QVG A;  4BXX H;  3RLN A;  3W1G A;  4AIM A;  4YCW A;  1D7Q A;  3EIV A;  3A5Z B;  3L0O A;  1VQ8 A;  2UXC L;  3M85 A;  1XMQ L;  1PH1 A;  4A93 G;  1RIP A;  4GKJ L;  4KHZ A;  3G6E A;  4DV2 Q;  2KHI A;  1PVO A;  2AMC B;  1U5K A;  3ZJY C;  4YY3 L;  4HJ8 A;  3VDY A;  4P71 A;  5M5W H;  1YJN A;  2IT1 A;  3CC4 A;  5J3B A;  1EIF A;  2ZJP A;  2MNA A;  1Q82 C;  4LNQ A;  1QVF A;  1IYJ B;  3PIP A;  5JEA G;  1Q12 A;  1X3E A;  3CCM A;  5LMN L;  2LXJ A;  1XMQ Q;  4DV1 L;  1VQE A;  2HQL A;  2I5L X;  4JI1 L;  1YEZ A;  3F8T A;  3I4O A;  3CW2 C;  4JOI A;  2ALY B;  5M3M H;  1M90 C;  1O7I A;  2BH8 A;  2L15 A;  4GOP A;  4IO9 A;  1EQQ A;  1QUQ A;  5IWA Q;  4DR3 L;  1N8R C;  1Q46 A;  4DR5 L;  3H0G H;  3KFU A;  1OXS C;  4GNX A;  5IWA L;  3JAM i;  1UE5 A;  3CCE A;  2JA7 G;  5FJ8 G;  5FLM G;  1K73 C;  4JI6 L;  1QZH A;  4IOC A;  4JI7 L;  3KF8 B;  2JK8 A;  2LSS A;  2PI2 E;  1NMG A;  2VZA A;  2CWA A;  2GVB A;  4UPA A;  1HZ9 A;  4JI5 L;  4DV0 L;  3TS0 A;  3S1N H;  1KAW A;  4JBK A;  3PUX A;  4JI5 Q;  2NVT H;  5JEA J;  1I6H H;  2B29 A;  3OTO L;  1ASZ A;  4Y7N H;  4DR2 Q;  2UUA L;  4DV3 L;  1EWI A;  3PGZ A;  3TEH B;  3HOU H;  2AKW B;  4X6A H;  5C3E H;  4LUO A;  3PUZ A;  4LUZ A;  1YVC A;  2Y0S E;  3GTP H;  1XTD A;  5EAY A;  3PO2 H;  1X65 A;  1HNW Q;  3GTO H;  2CWP A;  2VNU D;  3BJU A;  1A8V A;  2I5H A;  1FGU A;  4BBR G;  3HOZ G;  3S1M H;  1Q7Y C;  3CAM A;  3S14 H;  1VQG A;  1Y1W G;  1N34 L;  2R93 G;  4B3R Q;  1IZ6 A;  1IXR A;  3K8A A;  2KCM A;  1HR0 L;  2Z0S A;  4DV4 Q;  1VQK A;  4AH6 A;  4QQB X;  1E7Z A;  1P16 A;  4X62 L;  1Y1V G;  4X62 Q;  1LM0 A;  4QY7 A;  2UUC Q;  3CCU A;  1HH2 P;  3KDF A;  3GTL H;  4HJ5 A;  2VQF Q;  1SFO H;  4P73 A;  4JG2 A;  1JJG A;  1JMC A;  4KHP L;  2R93 H;  2BA1 A;  2N3S A;  3S2H H;  4DUZ Q;  1OXU A;  2YV5 A;  4HIO A;  4BBS G;  4EX5 A;  2CKZ B;  1Z9F A;  4DV6 Q;  3U4Z A;  4LF5 Q;  1EQR A;  3GDE A;  2WAQ E;  4JI8 Q;  2MO0 A;  3S16 H;  1A63 A;  3HFZ B;  1YIJ A;  2VUM G;  1L2F A;  4GN4 B;  3RLF A;  4RG1 A;  3CME A;  2AHO B;  3E9I A;  4HJ7 A;  4GLX A;  2YYZ A;  3T1Y L;  4LFC Q;  2K50 A;  1KRT A;  5C44 G;  3PUW A;  4GNX B;  4A3I G;  1IBL Q;  1WYD A;  1KD1 C;  3HOX H;  3I2Z A;  2WAQ G;  4A3B G;  3S17 H;  4NXN L;  1IBL L;  4B3R L;  2XTI A;  2ZM6 L;  2R92 H;  1L1O B;  1PV4 A;  1L1O A;  1NE3 A;  1C9O A;  2PQA A;  2PQA B;  4DAY B;  3KJO A;  1EIY B;  2HIX A;  4LF6 L;  2ZTE A;  1VQF A;  4P74 A;  5HY6 A;  4HIM A;  1HNW L;  1C0A A;  5IYD H;  3S24 A;  4DNI A;  2ID0 A;  2VS1 A;  1FL0 A;  2JJQ A;  3RZO H;  1OXV A;  5LMN W;  3ER0 A;  4A3E G;  5IP9 H;  4DUY L;  4JI3 L;  3GD7 A;  2AWN A;  4A4I A;  2VQE Q;  4DR6 L;  4DV5 L;  2RHS B;  2CCZ A;  2R7Z G;  4QIW E;  2K52 A;  4JOI C;  5IT9 c;  1N32 L;  5IYD G;  3RN5 A;  1HNZ L;  2UUC L;  4B3T L;  4OXP A;  4DR1 L;  2EQS A;  4B3S Q;  4DR4 Q;  4A76 A;  3CCJ A;  1TWA H;  2Q2U A;  1Z47 A;  3EN2 A;  1I50 H;  3PUV A;  4P72 A;  1KRS A;  3SGI A;  4C3H H;  4X65 Q;  1XNQ Q;  2MFI A;  4RMF A;  2JA5 G;  4TQU S;  1NTG A;  2OQK A;  2Z6K C;  5M5Y H;  5FLM H;  1TWH H;  4DR3 Q;  4R4T A;  1PH4 A;  2ATW A;  2PNH A;  2PI2 A;  5C4X H;  3CCS A;  1IBK Q;  5LMU Q;  1XNR Q;  4KLK A;  1IBK L;  4DKA C;  4JI0 Q;  5JJL A;  2R6G A;  4OWT B;  4JI8 L;  3CXC A;  5GQO A;  2EIF A;  3I7F A;  1VQ4 A;  4DR7 Q;  4FDB A;  1LYL A;  3ULJ A;  3HOU G;  2Q2I A;  2CQO A;  3B6Y A;  1A62 A;  2UUA Q;  1CSP A;  5C4J H;  4O2D A;  3U4V A;  3OTO Q;  4LF9 Q;  1YNX A;  4BY1 G;  5IYB G;  4GS3 A;  4A3D H;  1Y1V H;  2H5X A;  5DLQ E;  3RN2 A;  2E2I H;  1N33 Q;  5GRO A;  1PH8 A;  1I94 L;  3BU2 A;  4JI7 Q;  1YIT A;  3M4Q A;  1FJG Q;  5FLX c;  2R92 G;  4R1J A;  3PSI A;  3KLW A;  5FJ8 H;  4Y52 H;  2GVA A;  3K81 C;  3M4P A;  4HID A;  2NVQ H;  1G6P A;  3CPF A;  1MKH A;  1OXT A;  3PUY A;  4AYB G;  5GAG C;  1WOC A;  1E3P A;  4AQY Q;  4YWM A;  4OO1 G;  1GD7 A;  1TWC H;  2RHQ B;  1E1T A;  4DV7 L;  4JBM A;  4GOP B;  1MIU A;  1J5E L;  4LF4 Q;  4MTN A;  4XTC S;  3D31 A;  2HHH Q;  4WJ4 A;  2ZM6 Q;  3I56 A;  1G29 1;  1SLJ A;  3W1B A;  3KDF B;  1LTL A;  2ES2 A;  3HKS A;  1K0R A;  5H1S E;  3Q8D A;  3K7U C;  3NEM A;  3TQY A;  3JC6 6;  3NBH B;  4DV3 Q;  2UU9 L;  1YHB A;  4DK6 C;  3S1Q H;  1ASY A;  1WFQ A;  5BR8 Q;  4R4O A;  4A3K H;  4GKJ Q;  4QGU A;  4UY8 C;  1NY4 A;  2A8V A;  4OWX B;  1N33 L;  2E2H H;  3F2C A;  2JA8 G;  1BKB A;  1EFW A;  4YWK A;  4O0A A;  1AE3 A;  3AFP A;  1T9H A;  2ZJQ A;  3GO5 A;  1VQL A;  1CKN A;  1CKN B;  1A0I A;  1UWV A;  1BBW A;  2IX0 A;  4LFA Q;  2JA6 H;  2HHH L;  2JE6 I;  4LUV A;  4A3E H;  1PH6 A;  3FHW A;  2B3G A;  5IY0 A;  4C3I H;  1PH7 A;  3L2P A;  2WFW A;  3J7Z C;  4KHP Q;  4IPD A;  4GLA C;  2NVY H;  3H3V H;  1VQI A;  2JA7 H;  2F3I A;  1FVI A;  4X65 L;  1H95 A;  1JJ2 A;  1K3R A;  3W5O A;  2OTJ A;  4LFA L;  4P75 A;  4NXN Q;  2WP8 J;  2OWO A;  4A3L H;  1G51 A;  1YZ6 A;  1PH5 A;  1FJG L;  3J81 j;  4YCU A;  1XNQ L;  4PZ7 A;  1UE6 A;  4GKK L;  3JAM c;  3UDX A;  2V1C C;  1VQD A;  4L5S A;  4OO1 I;  5GAH C;  2VUM H;  2VQE L;  4DR6 Q;  4DR4 L;  1E1O A;  4JI3 Q;  1RL2 A;  4A93 H;  3UDF A;  1N9W A;  1MJC A;  1TWG H;  2I5M X;  2R7F A;  1KQS A;  3OW2 A;  3I4M H;  3A5U A;  1XPR A;  1SMX A;  3J81 i;  1PFS A;  3M3Y H;  4R4Q A;  2Z6K A;  4JBJ A;  4LW1 A;  4LWC A;  2F52 A;  2K5V A;  3GTG H;  4HJA A;  3T1H L;  3CPW A;  3FKI H;  5GAE C;  2MO1 A;  3U50 C;  1YJW A;  3M7N A;  4ME3 A;  3GTQ H;  3S1R H;  1IL2 A;  2IHF A;  1SN8 A;  3UE1 A;  1PA6 A;  2KBN A;  1I3Q H;  1X54 A;  3CF5 A;  5C44 H;  4A3I H;  4C3J H;  3K7A H;  4BA2 I;  4JV5 Q;  1HR0 Q;  1E22 A; 
#chains in the Genus database with same CATH topology
 2LKV A;  4DR1 Q;  3D0F A;  4B3T Q;  1S5F D;  1WCM G;  1U4L A;  1SE3 A;  3PF4 A;  4HSP A;  3M9B A;  1KLU D;  1TWC B;  4ZAI A;  3T51 B;  3MXP A;  3MEH A;  2ZTC A;  4A3F G;  4IZ8 A;  4H02 A;  5E3F A;  3KJP A;  2Y0S G;  4R8I A;  3ULP A;  4WOR A;  3NQI A;  1Y1W H;  2WB1 G;  5AJ3 L;  1BF4 A;  1YJ9 A;  2I0Q A;  2KEC A;  2UUB Q;  3SXH A;  1A3T A;  2K5H A;  1B70 B;  1SMY D;  2MJ8 A;  3T56 B;  1CKM A;  3I4M G;  2HT1 A;  1Y14 B;  5EBC A;  3IAY A;  4MNO A;  2XGT A;  4TVA B;  1XYI A;  1Y8O B;  1SE2 A;  3VR6 A;  4YY3 Q;  4KK7 A;  3HOV G;  4BA1 I;  4DR2 L;  1WTH A;  1F2Z A;  3KF6 A;  5L37 A;  1HXY D;  4RKB A;  1UE1 A;  4Z9C B;  3J80 E;  5CV9 A;  2TMP A;  2A69 C;  2FMC A;  2PZU A;  3MXU A;  3G4S A;  1O7Z A;  4BY7 G;  1GHJ A;  3L3O C;  4KN7 C;  1CI3 M;  2K6A A;  4R4I A;  1N34 Q;  5M3M G;  2X6L A;  4TKO B;  3CP0 A;  2JA9 A;  3J80 c;  5M3F H;  2MPM A;  1PH2 A;  4A3J G;  2F0N A;  4F87 A;  1FD7 D;  1I94 Q;  1L1O C;  1X3Q A;  3OMC A;  1BCP F;  3NE5 B;  3PO3 B;  1PH3 A;  3GTJ H;  1Q81 C;  1S40 A;  2KJX A;  1V9P A;  3LNN A;  3AEV A;  3J7A F;  1KDA A;  4UAI A;  4JI2 L;  4FF3 A;  1SRO A;  1S3O A;  1STG A;  2QGQ A;  1IW7 D;  1EEI D;  1LT3 D;  5CMD A;  3BZK A;  4IUR A;  1EL0 A;  1K8G A;  5AFW A;  1PDQ A;  4NPS A;  3DXJ C;  3S17 B;  3PV0 A;  2FXQ A;  1EFI D;  3FPP A;  1HTL D;  3A7L A;  3HOY G;  2JQO A;  4JI4 Q;  2F0W A;  3A56 A;  3J7Y W;  4DK3 C;  3CCV A;  1TWH B;  3QB3 A;  1Q8I A;  3A8J E;  1N32 Q;  3TBI B;  3MFG A;  5IIF A;  3FRP B;  2F03 A;  5TSS A;  4BBS H;  5K5P A;  4GN3 B;  3HKZ E;  1J6Q A;  1E2W A;  3DEP A;  4FP5 D;  4HMI A;  1QE6 A;  1MJE A;  3BZC A;  1UNS A;  4A3M B;  4K2L A;  1X3F A;  4GKK Q;  5C0X J;  1WD1 A;  1K9M C;  4R4C A;  1B44 D;  1Y8N B;  1PRT D;  1EYC A;  3OMG A;  4IUP A;  3HOZ H;  4QMG A;  2NVX H;  3DM3 A;  4A3M G;  1I4Q A;  2BE5 C;  4KY5 A;  3ITP A;  1HZA A;  4C3I B;  3RNU A;  2K04 A;  1VDZ A;  3D6W A;  4PMW A;  2VQF L;  3PCO B;  1HNX L;  4GZY C;  3AYH B;  3LWE A;  3CCQ A;  2Q2H A;  5C4Z A;  2KHS A;  3D6C A;  1BOS A;  3WOE A;  3K6O A;  4PG3 A;  4XQJ A;  1HA6 A;  2WV6 D;  1CT1 D;  1XPO A;  2QCP X;  2RSN A;  5ELO A;  3LGJ A;  2A19 A;  3WWV A;  1VQ5 A;  1U4R A;  1P8L A;  1QG7 A;  1S72 A;  4A3K G;  2R61 A;  2A6H C;  2BH2 A;  5M3F B;  2K7V A;  1LTS D;  4KMU C;  1X6O A;  5C44 B;  2AQ3 B;  2PCF B;  2B2W A;  4DV0 Q;  2LXK A;  4LFB Q;  1LUZ A;  4POG A;  3AQQ A;  3FKI G;  4DR7 L;  2K5D A;  1VQM A;  1EOT A;  1KLG D;  4OIK A;  2ZJR A;  3IRB A;  3D4R A;  1CQF A;  2QKI C;  1ILQ A;  5C0X G;  4KY6 A;  3W1G A;  1SDF A;  4AIM A;  3EIV A;  3M85 A;  1PH1 A;  4KKU A;  4A93 G;  2F0K A;  4GKJ L;  1DD2 A;  2AMC B;  4HAE A;  4R9W A;  1Y1V B;  4YY3 L;  2E2I B;  4HJ8 A;  4P71 A;  2K1B A;  2IT1 A;  2ZJP A;  2KCN A;  1WTV A;  4RH6 A;  1Q82 C;  2EVB A;  3CCM A;  1EQV A;  2EPB A;  1EYA A;  1SMY C;  3I4O A;  4JOI A;  1V8Q A;  2L15 A;  1CHQ D;  4CGY B;  1EQQ A;  1QUQ A;  1D6E C;  4C3J G;  1OO9 B;  3DWQ A;  4BS9 A;  3QIA A;  5EPJ A;  1UE5 A;  3CCE A;  2JA7 G;  1H9M A;  5FJ8 G;  2NB0 A;  4A3B B;  2CWA A;  4UPA A;  1WTQ A;  2M00 A;  2B29 A;  1ASZ A;  2XVS A;  1EY8 A;  4DR2 Q;  2UUA L;  5E4X A;  3PGZ A;  4PQX A;  1K8M A;  4LUZ A;  2DJF C;  1T5E A;  3P1H A;  3RZO B;  1B3A A;  2I5H A;  3S1M H;  4LJZ C;  3S14 H;  3CAM A;  1N34 L;  1IZ6 A;  5F2D A;  1IXR A;  3A54 A;  2Z0S A;  3DM1 A;  4X62 L;  1KAA A;  2CW0 C;  3PIO 3;  4FF2 A;  2XNA C;  4HJ5 A;  2F0Q A;  4JG2 A;  5EKL A;  4KHP L;  2R93 H;  4DUZ Q;  2YV5 A;  4EQP A;  1B50 A;  4HIO A;  2O5I C;  2EYF A;  1C48 A;  4EX5 A;  1IW7 C;  2HQE A;  1ML0 D;  5C0X H;  3MC0 B;  1PXU A;  2XRS D;  2FJ2 A;  1YIJ A;  2EJG C;  2VUM G;  4CDE C;  4RG1 A;  2F3W A;  3E9I A;  4GLX A;  4G7H C;  1PZK D;  3T1Y L;  1ET9 A;  2A74 C;  2K50 A;  5C3X A;  5C44 G;  1IBL Q;  1TWA B;  1WYD A;  2PMZ B;  2WIN B;  3FPU B;  2XTI A;  3N52 A;  5CR3 A;  1L1O A;  2PQA B;  1C9O A;  2PQA A;  2G9H D;  3NWT A;  4DAY A;  4DAY B;  1D5Z C;  5IYD H;  1SNO A;  3S24 A;  4DNI A;  1SFO B;  1HA5 A;  2ID0 A;  2VS1 A;  4A3K B;  3CRL C;  5LMN W;  4DUY L;  1EZ8 A;  3K5L A;  5I6W A;  3Q6S A;  1E2Z A;  4H44 C;  4ZYS A;  3BVM A;  3MVV A;  3RN5 A;  2ZXR A;  3HZX A;  4A76 A;  1YNN D;  2F1M A;  4ZLT F;  3T16 A;  3PUV A;  3SGI A;  1KRS A;  2IPK D;  1XNQ Q;  1IYV A;  4RMF A;  2B2V C;  2OQK A;  5CBA E;  5M5Y H;  1TWH H;  4R4T A;  3A8I E;  4ZQ3 A;  2ATW A;  2EJM A;  1H9S A;  1EY0 A;  5C4X H;  4KLK A;  1ENC A;  4DKA C;  4JI0 Q;  3CXC A;  4RCO A;  1LYL A;  3ULJ A;  3HOU G;  2Q2I A;  3B6Y A;  3I70 A;  2RCF A;  3PMF A;  5IYB G;  4GS3 A;  4A3D H;  2DY7 A;  1SSO A;  4JI7 Q;  3QO2 A;  4CDF C;  1K0S A;  4Y52 H;  2BDN A;  3D3R A;  2AQ2 B;  3G6J B;  3K81 C;  4IN3 A;  3SK5 A;  3TP5 A;  1MKH A;  1XTC D;  1STN A;  1W6J A;  4YWM A;  5BN3 A;  1TWC H;  4ZKC B;  1GUO A;  1BXT A;  3KBG A;  2HHH Q;  3GV3 A;  3I56 A;  3NPP A;  3W1B A;  4OEL B;  3K57 A;  2PYK A;  2JA8 B;  4G7O C;  1PZJ D;  2UU9 L;  4DV3 Q;  1ASY A;  4R4O A;  4N9T A;  2EYH A;  4QGU A;  3ZYY X;  4OWX B;  4KD3 A;  3S1R B;  4YWK A;  2F0H A;  3AFP A;  3LWU A;  1B4O A;  1K28 A;  4LUV A;  3GTK B;  3A7A B;  3KUP A;  4C3I H;  2VB3 X;  3L2P A;  3GQB A;  2F0M A;  5KNC A;  1VQI A;  2JA7 H;  5CV6 A;  5DM7 3;  1B53 A;  1JJ2 A;  5J39 A;  4RCN A;  3P75 A;  1QIL A;  1V1O A;  2NTS A;  4A3L H;  1G51 A;  1YZ6 A;  4IUQ A;  1PH5 A;  4IFD H;  1CA5 A;  1PTO H;  1DOL A;  1L0Y B;  1UE6 A;  3CU7 A;  2VQE L;  1RL2 A;  3T53 B;  5C3W A;  2OF1 A;  5CV5 A;  2D9U A;  3K5M A;  3H0G B;  4DK1 A;  2I5M X;  3OW2 A;  4X3K A;  3BDO A;  1PFS A;  4QB4 A;  1GUN A;  4R4Q A;  3OHX C;  4K5X A;  4IAL A;  1IL8 A;  2Z6K A;  4LW1 A;  1G91 A;  2H4O A;  1Z7T A;  3T1H L;  3CPW A;  4P2C B;  5GAE C;  3GTG B;  2F0U A;  2IHF A;  3UE1 A;  1CM9 A;  2KBN A;  1X54 A;  4V0B A;  3NXW A;  3KLS A;  4G7Z C;  4G4K A;  3K7A H;  5FO9 B;  1VMC A;  1K83 B;  1F9S A;  2QEJ C;  2R7Z H;  1HNZ Q;  2WAC A;  4ABN A;  3ERS X;  1SYE A;  3E6Z X;  4RAU C;  4L5T A;  3CCR A;  4KKS A;  1D5M C;  5IE8 A;  1VQA A;  1PRT B;  2V4D A;  5LMU L;  5BN4 A;  1I4H A;  1ZYR C;  4WJ3 M;  3EBE A;  3TME A;  4IQZ A;  1K83 H;  1S5E D;  4IFD G;  2F0P A;  1XPU A;  4OWW B;  5CBE E;  3MFY A;  1LTT D;  1C7Y A;  4LF8 Q;  1SR3 A;  4KJN A;  3L7Z C;  5K36 G;  3NUC A;  2M9V A;  2IJ0 A;  1CUK A;  2VL6 A;  3I72 A;  3DHQ A;  3NP8 A;  4DAM A;  2F4V Q;  3GTP B;  3T1H Q;  4DFA A;  3K0X A;  2B2V A;  4K6D A;  1JIC A;  3KOJ A;  1X3P A;  4RGM A;  2QEX A;  4EQ5 A;  3D4W A;  4FF1 A;  2IY5 B;  2IX1 A;  1HZC A;  1RCV D;  1GM5 A;  1STY A;  1VF7 A;  2KED A;  1ESF A;  2B2T A;  3CHB D;  1BQQ T;  4LF7 Q;  2XWJ B;  5JPM C;  4A3J H;  1PRT F;  4WFN 3;  2R93 B;  2A6H D;  4LF4 L;  3TP8 A;  1X3G A;  3FDT A;  1VQC A;  3TRE A;  1PFN A;  5HGQ A;  3HP3 A;  3S9W A;  3AB9 A;  1N36 Q;  4KKT A;  2AUK A;  3H0G G;  5C4X B;  4DAP A;  3GTQ B;  3HG9 A;  4IFD I;  1GVP A;  4YHH L;  4BY7 H;  4X64 L;  2ASB A;  3G71 A;  4JI1 Q;  2QW7 A;  1JWS D;  2P5Z X;  4NDX A;  1GOZ A;  1AE2 A;  2KHJ A;  1K8A C;  1F77 A;  3KK7 A;  5C0X I;  4BXX H;  1QB5 D;  1VQJ A;  5BR8 L;  1W3S A;  4EVO A;  5M3F G;  2QF7 A;  1SE8 A;  2EE1 A;  4GNX C;  1BVS A;  4X66 L;  5IGF A;  4A3B H;  1HR0 W;  4L8J A;  4C3H G;  3GTM H;  4RFB A;  3STB C;  1HCZ A;  1PYB A;  4Q0F A;  2HDM A;  1I4X A;  1WJJ A;  1X55 A;  4FXK C;  1EYD A;  1O78 A;  3NEL A;  1G8Z D;  1DGS A;  1KL9 A;  1XWE A;  2MP1 A;  5LHY 1;  2UXD Q;  2X69 A;  1VQH A;  2XWB B;  3QR8 A;  3NQT A;  4A93 B;  4DV2 L;  1M8A A;  1FR3 A;  2B2U A;  4K5V A;  4NW2 A;  5C5L A;  4K2K A;  4XYO A;  2K32 A;  4BY1 H;  1VQ7 A;  2B63 H;  4ODG A;  5D3I B;  3F2B A;  4YWL A;  1DYQ A;  1S5B D;  3CC7 A;  2YU9 H;  4DPG A;  3CQZ B;  1LLR D;  2DY8 A;  2IWH A;  2JEB I;  2DUD A;  1YHA A;  2Z4H A;  3S1N B;  1UAP A;  1EEF D;  3R2I A;  4BBR H;  2OTL A;  2CFM A;  1SRU A;  3CKI B;  3P20 A;  1EWC A;  1W2B A;  4EQN A;  4QF4 A;  3TDQ A;  1AFP A;  1OXX K;  2CQA A;  1RD9 D;  3S1Q B;  1U0L A;  2CHB D;  2VB2 X;  1PFB A;  2Q2T A;  1X9N A;  1VQP A;  3OIQ A;  1QWY A;  4JI4 L;  4CKC A;  2D0O A;  4IPG A;  4ALP A;  2C35 B;  2B39 A;  4O42 A;  4PZ6 A;  1PHJ A;  2R7D A;  2ZTD A;  1M1K C;  4HMJ A;  2UU9 Q;  3HOY B;  4XIG S;  4DV4 L;  1B1Z A;  1VQO A;  3BZD B;  4L5R C;  1N36 L;  2R7Z B;  5I6Y A;  1I4G A;  2RQX A;  1NMF A;  4C3H B;  5C3E G;  2EXD A;  3PO2 G;  3NSW A;  3BYY B;  2B63 G;  1QVC A;  4DV1 Q;  1JJC B;  4LAA A;  4NXM Q;  1PYS B;  3J80 L;  4CJ1 B;  2DNC A;  1MSH A;  2LMC B;  2XN9 C;  3A74 A;  1AZQ A;  1MSG A;  1BBU A;  1AZP A;  5KIX A;  3TRZ A;  1KAB A;  4A75 A;  3S14 B;  1IBM Q;  3NHH A;  1PLF A;  2UUB L;  1O80 A;  5ELC A;  1QNK A;  1GO3 E;  1QVG A;  4ME5 A;  1D7Q A;  3A5Z B;  2UXC L;  1PTO F;  1RIP A;  4DV2 Q;  2L4N A;  3VDY A;  1YJN A;  2X6G A;  1IYJ B;  1EY6 A;  3PIP A;  1TT2 A;  5JEA G;  1Q12 A;  1X3E A;  5T1I A;  1XMQ Q;  4DV1 L;  2HD3 A;  1VMP A;  5KEE A;  1M90 C;  2B8G A;  4GOP A;  2F0E A;  4DR3 L;  3GP7 A;  4DR5 L;  1OXS C;  5IWA L;  1Y69 U;  1I6V C;  3C1E A;  3HS0 C;  4JI6 L;  1V1P A;  2MUY A;  3D4D A;  1LTB D;  2PI2 E;  2VZA A;  2WAQ B;  5IGE A;  2Z1C A;  4DV0 L;  3TS0 A;  2F4I A;  3PUX A;  5NUC A;  4KTA A;  5JEA J;  5M9O A;  3BS1 A;  4JI5 Q;  1I6H H;  2AQ1 B;  4A3F B;  1EWI A;  2L0C A;  3TEH B;  3EFX D;  4LUO A;  4C3J B;  5EAY A;  4RKL A;  2CWP A;  1F9R A;  3MAQ A;  3BJU A;  1TKW B;  1FGU A;  2NTT A;  4G57 A;  3K8A A;  2R3Z A;  2KCM A;  2WKD A;  3HEJ A;  1XXG A;  1A3U A;  4AH6 A;  4DV4 Q;  1HR0 L;  1P16 A;  4QQB X;  4I65 A;  2Z8L A;  1Y1V G;  1SBB B;  1LM0 A;  2UUC Q;  4DAV A;  3BVZ A;  5G3L D;  3GTL H;  1JOK A;  3U9S A;  4P73 A;  1JJG A;  1JMC A;  2BA1 A;  2JSO A;  2N3S A;  3TZU A;  1OXU A;  1I6H B;  1TWF B;  1EU3 A;  2DNE A;  2BOS A;  3SVM A;  2A68 D;  2CKZ B;  2Q8I B;  3GTO B;  4DV6 Q;  3U4Z A;  1Y8P B;  3S16 H;  3MZ5 A;  4X3U A;  2RDF A;  3RLF A;  2K5W A;  5A35 A;  2WB1 B;  3CME A;  4HJ7 A;  3I73 A;  2YYZ A;  2RBM A;  3FVQ A;  4FNF A;  1KRT A;  2KEE A;  3HOX H;  1TS4 A;  2EY6 A;  3S17 H;  2A6E C;  4NXN L;  2J0T D;  2ZM6 L;  4A3G B;  3ND8 A;  3V05 A;  1L1O B;  5JEA H;  1NE3 A;  1EIY B;  4LF6 L;  2ZT9 C;  4HIM A;  5IT9 E;  2JJQ A;  3RZO H;  3TSS A;  1ZKO A;  3GD7 A;  2AWN A;  2N88 A;  4QIW B;  2VQE Q;  1EIH A;  4C2M B;  2R7Z G;  4QIW E;  1GUG A;  4JOI C;  3JAM L;  4CHT B;  5IYD G;  4B3T L;  4OXP A;  4DR1 L;  5ELF A;  2Q2U A;  2A68 C;  1Z47 A;  1CA6 A;  3EN2 A;  5EKK A;  4P72 A;  1G2T A;  4DF7 A;  5JOB A;  4TQU S;  5EKI A;  4EGV A;  4DR3 Q;  1GUS A;  4MTK A;  3MHB A;  1PH4 A;  1EU4 A;  3CCS A;  2HCC A;  1IBK L;  1BCP B;  4E6I A;  4OWT B;  5GQO A;  3AU7 A;  1ENF A;  3R8B A;  3X3N A;  1VQ4 A;  1RKN A;  1QCB D;  1SNM A;  5FLX E;  4FDB A;  5D65 A;  2CQO A;  4R8N A;  2R92 B;  4LF9 Q;  1YNX A;  1Y1V H;  5DLQ E;  2E2I H;  2ICE C;  2NYZ D;  1N33 Q;  5GRO A;  1PH8 A;  3K5O A;  3BU2 A;  1YIT A;  2N55 A;  1FJG Q;  2R92 G;  1DOM A;  3H3V C;  5JVG 3;  2DN8 A;  3HOU B;  2GVA A;  3M4P A;  4HID A;  2NZ1 D;  5G3L F;  5GAG C;  4OO1 G;  1E3P A;  1HHV A;  1SEB D;  1E1T A;  2Z6B A;  4JBM A;  5T1G A;  4ID6 A;  4GOP B;  1S5D D;  1JOO A;  1ZYR D;  2G9D A;  2ZM6 Q;  1GJX A;  1G29 1;  3KDF B;  1LTL A;  1LTR D;  4OIJ A;  5H1S E;  3Q8D A;  4H13 C;  1SYF A;  4DA2 A;  1YHB A;  4DK6 C;  3S1Q H;  4GKJ Q;  1FYC A;  4Q5V A;  1TS5 A;  2E2J B;  1BKB A;  4WRD A;  1CKN A;  3SE0 A;  1UWV A;  4LFA Q;  2IX0 A;  2JE6 I;  1MD2 D;  5IY0 A;  4XT1 B;  1A6X A;  1PH7 A;  1PMR A;  1TU2 B;  4GLA C;  1H95 A;  1H9S B;  1EZ6 A;  2B2W C;  1G2S A;  3W5O A;  1GUW A;  4NXN Q;  2WP8 J;  3J81 j;  4YCU A;  4BY1 B;  1HTP A;  4HTH A;  2QIL A;  4OO1 I;  3VYU A;  5GAH C;  5IGB A;  4DR6 Q;  2Q8T A;  1VF5 C;  2L9H A;  4A93 H;  2TSS A;  4KHV A;  1TWG H;  3I4M H;  5M3M B;  1JE4 A;  1ESR A;  1RF2 D;  4LWC A;  4TRD A;  2K5V A;  3IFT A;  4MIU A;  1JR0 D;  2B2T C;  3GTG H;  3URY A;  4ME3 A;  5EGT A;  1IL2 A;  5CGK A;  3CF5 A;  4LMQ D;  2OEO A;  4C3J H;  2KUM A;  4RGO S;  4BA2 I;  1DM0 B;  1KXL A;  1DOK A;  4RGN A;  2K75 A;  3CQZ H;  3F1Z A;  1EQT A;  2KA7 A;  2RVL A;  2VW9 A;  4ZKB B;  1VQ6 A;  2QDL A;  5IYC G;  1KDC A;  5LL6 X;  2EY1 A;  3MA2 B;  4X66 Q;  2E8G A;  2RF4 A;  3GTK H;  3I4N B;  5JJI A;  4ZUI A;  2NZO A;  3MEF A;  5JVH 3;  2EYP A;  1NAP A;  2PNR C;  3VR3 A;  3QOL A;  1EYG A;  1E24 A;  2EZV A;  4LF8 L;  1JQY D;  3HOY H;  1WI5 A;  3J81 c;  1NCV A;  2ZXP A;  4A3C G;  3J80 i;  1QOH A;  1SYB A;  2FHT A;  3HKZ G;  1F9Q A;  4IFD J;  5ELE A;  1AH9 A;  3OIP A;  2E2J H;  3NTH A;  2JA6 G;  3GTM B;  4N9P A;  3DEO A;  3QOJ A;  2EXZ A;  2FFK B;  4YIJ A;  2XSC A;  3NEN A;  3WOF A;  1R4Q B;  2WII B;  1GXD C;  4MZ9 A;  4CBV A;  2NVX B;  2IL8 A;  3UDG A;  1MHW C;  1B3Q A;  2HDL A;  3SHL A;  1I3Q B;  1MGS A;  2ENB A;  5FOB B;  1II3 A;  4JBW A;  3S15 H;  1D8L A;  1B8A A;  3M3Y B;  4F8M A;  1EY4 A;  4K0K L;  4ZK9 B;  3RZD H;  1CKO A;  1QUQ B;  1DON A;  2PPB C;  2BCO A;  1QNU A;  1UE7 A;  2K5N A;  4H7B A;  2D0P A;  2N49 A;  3FKI B;  1YNN C;  2DGY A;  3M4O H;  3DLL A;  4X3S A;  4FXG C;  3V2T A;  1XJV A;  4KY7 A;  1SYD A;  1HUM A;  4LF9 L;  1VS0 A;  4N8X 1;  2UXB Q;  2Y0S B;  3ND9 A;  3HOW H;  1SJE D;  4OL7 A;  5A2Q L;  2JA8 H;  3EVQ A;  1NUC A;  5M5Y B;  1VQ9 A;  4OO1 H;  3RR5 A;  1B7Y B;  1X56 A;  4B3M Q;  2HIV A;  1STB A;  4L5Q A;  3RUZ A;  5GAD C;  3KF8 A;  4UP9 A;  4CDD C;  1IBM L;  1A3V A;  5KND A;  3E0E A;  1VQN A;  4BWG B;  3HOV H;  4N8F A;  5DEH A;  5COY A;  4A3C H;  3Q22 A;  3H94 A;  1K3B C;  4A3G H;  3I8Z A;  1Q1B A;  2E2H B;  1CSQ A;  3MXN A;  1IYU A;  2WB1 E;  5M5W B;  4IPC A;  1J8I A;  5D14 A;  1H9R A;  1AP0 A;  4JW0 A;  4DU9 A;  2NVQ B;  1B9N A;  1PYW D;  2N8N A;  1I50 B;  2AWO A;  5LMN Q;  2YTY A;  1LT6 D;  1Q1E A;  4QUF A;  1JE5 A;  4IOA A;  3N6R A;  1TWF H;  2JN4 A;  2K05 A;  1SYC A;  2MQH A;  2F3V A;  1NR2 A;  4UHV A;  2A69 D;  4IJL A;  3TP7 A;  3WDN A;  3E9H A;  4ULL A;  1PH9 A;  3PF5 A;  1EY7 A;  4DV5 Q;  1QZG A;  3IFD A;  2B2Y A;  2E5L L;  3MXN B;  5COR A;  2NWG A;  3OSO A;  3UE0 A;  5K36 H;  4JCV E;  2D5D A;  3RMH A;  1JT8 A;  1NJI C;  3FP9 A;  1Q3L A;  4I7A A;  2K4K A;  3MTS A;  1NNX A;  1SAP A;  2KCT A;  5DNF A;  2K14 A;  1DXM A;  1ZEQ X;  4B3S L;  4POF A;  3S2H B;  1HNX Q;  1YBY A;  1UEB A;  4APV A;  3ERQ A;  3UDI A;  1J5E Q;  4YCV A;  3E5S A;  3R2T A;  4AQY L;  5FK9 C;  4A3E B;  1PTO B;  2B2U C;  5KGU A;  4NXM L;  2A1A A;  1GHK A;  4K8J A;  4AYB B;  3K80 C;  1YNJ D;  4JYA Q;  1ET6 A;  3KF6 B;  4CJ2 C;  5HUR A;  5ELN A;  1JB3 A;  1XX8 A;  2EDG A;  3ULL A;  5IYB H;  3U58 A;  5EPL A;  3PO3 G;  3CD6 A;  1SNQ A;  4JC0 A;  4LFC L;  4A3J B;  3H3V I;  1A2T A;  1STH A;  2VUM B;  5M5X H;  1DCZ A;  1XMO Q;  4JI0 L;  3K5N A;  1TXY A;  3DUZ A;  1GKH A;  1YHQ A;  2YTV A;  5E7N A;  3G7L A;  1EOV A;  3M7G A;  2A5H A;  1LV9 A;  4ZRZ A;  5LL6 S;  1BO0 A;  1YNJ C;  4YCW A;  1CK1 A;  1VQ8 A;  4H0L C;  4RHS A;  3QWN A;  3GTL B;  3G6E A;  2KHI A;  3SDZ A;  3ZJY C;  5E1F A;  5M5W H;  1JOQ A;  2RSO A;  5LMN L;  3C1F A;  2HQL A;  5JAV A;  3F8T A;  5IOC A;  3CRK C;  5M3M H;  1FNV A;  4QCL A;  2BH8 A;  3I4M B;  4IO9 A;  5IWA Q;  3EA6 A;  1Q46 A;  1LAB A;  3KFU A;  4GNX A;  3JAM i;  2DJG C;  1MI2 A;  1WTO A;  1K73 C;  4JI7 L;  2LSS A;  1NMG A;  3PQI A;  1HZ9 A;  4O1N A;  4JI5 L;  1PRT C;  1F2Y A;  1KAW A;  2NVT H;  2A6E D;  5BN5 A;  3OTO L;  2SDF A;  4DV3 L;  1HUN A;  4X6A H;  1YVC A;  2Y0S E;  2K33 A;  4HED A;  1XTD A;  1X65 A;  1HNW Q;  2VNU D;  4BBR G;  1LAC A;  1Y1W G;  4B3R Q;  1W6K A;  2HUG A;  3VR4 A;  2EYL A;  1ROD A;  2F0D A;  1JWU D;  4CKB A;  1WTX A;  1C4Q A;  1D1I A;  5J1Z A;  4OGQ C;  4QY7 A;  3HOV B;  3CCU A;  4B9X A;  3K58 A;  2VQF Q;  1TS3 A;  1SFO H;  4K8I A;  5FO8 B;  1R4P B;  3S2H H;  3L9A X;  4BBS G;  1STE A;  4BBR B;  1BDO A;  3I90 A;  1Z9F A;  2FMM A;  4LF5 Q;  3GDE A;  2WAQ E;  4HCS A;  4JI8 Q;  2MO0 A;  2L11 A;  1A63 A;  1IHZ A;  1PTO D;  1LTA D;  4PMB A;  2EYJ A;  1WVL A;  4LFC Q;  1SYG A;  3PUW A;  2QDB A;  4A3I G;  1KD1 C;  3VA7 A;  4A3B G;  1SJH D;  4B3R L;  1STA A;  1PTO C;  3KJO A;  1LO5 D;  2HIX A;  2ZTE A;  5HY6 A;  1C0A A;  1D5X C;  2ICI A;  1FL0 A;  1OXV A;  3DMU A;  3RZD B;  4MHE A;  4JI3 L;  5KNB A;  4DR6 L;  3EQL C;  5C4H A;  5C3E B;  4U67 3;  4DV5 L;  2CCZ A;  3VA5 A;  2BE5 D;  2SEB D;  2MGS A;  3D8G A;  4IUV A;  5IT9 c;  1HNZ L;  2UUC L;  5I9O A;  2EQS A;  3CCJ A;  1H9K A;  1TWA H;  3M4Y A;  4WJW A;  3VYS A;  2L12 A;  2LS0 1;  2Z6K C;  5FLM H;  4B08 A;  1CQV A;  1BNZ A;  1IBK Q;  1XNR Q;  5LMU Q;  4DNR B;  3DWA A;  4C3I G;  2NUC A;  5JJL A;  1WTW A;  2EIF A;  4DR7 Q;  1MBY A;  3BVG A;  5JJZ A;  3TZD A;  5EBD A;  1CSP A;  4I7Z C;  1SNP A;  2F0T A;  3OTO Q;  2B8F A;  5IOD A;  2H5X A;  2O4X A;  1X32 A;  1I94 L;  2M2L A;  5FLX c;  3KLW A;  2RKS A;  1G6P A;  2NVQ H;  4JK1 C;  3R93 A;  3CPF A;  1OXT A;  1U4P A;  4DN4 M;  1AW7 A;  2RHQ B;  4DV7 L;  3A55 A;  1J5E L;  4LF4 Q;  1RTO A;  4XTC S;  3D31 A;  1SLJ A;  3W3A A;  1JWM D;  3K7U C;  2XIW A;  3H91 A;  3JC6 6;  3NBH B;  3TQY A;  3GTJ B;  1WFQ A;  5BR8 Q;  1JOR A;  1AEX A;  4UY8 C;  1NY4 A;  2A8V A;  1N33 L;  3VR5 A;  4O0A A;  3W2D A;  2ZJQ A;  1HFG A;  3NTI A;  1CKN B;  2PW5 A;  1BBW A;  2HHH L;  2B3G A;  3JAM E;  2WFW A;  1B9M A;  3J7Z C;  4KHP Q;  4F7X A;  2CH4 W;  5IGG A;  1EWH A;  2F3I A;  1E2V A;  2SNS A;  3BYT B;  1K3R A;  2CH4 A;  2OTJ A;  2NN6 H;  4P75 A;  2F0F A;  4FYD A;  3VYT A;  1F2M A;  4V19 0;  1FJG L;  5FO7 B;  4GKK L;  3JAM c;  2V1C C;  1VQD A;  3BG3 A;  3SEB A;  2KCC A;  4JI3 Q;  3UDF A;  1N9W A;  1R9T B;  4XYQ A;  2R7F A;  3R3O A;  3A5U A;  2D2C C;  1KDB A;  3M3Y H;  4XXE A;  3C2P A;  1UEA B;  4JBJ A;  2F52 A;  3FKI H;  3SK8 A;  4CDC C;  2MO1 A;  3U50 C;  4JVZ A;  3S1R H;  3S1M B;  5EPK A;  1SN8 A;  1PA6 A;  1I3Q H;  5C44 H;  4A3I H;  4JV5 Q;  1E22 A;  4IUN A;  2N78 A;  4UP8 A;  4A3F H;  4C1N I;  1KIX A;  4K14 A;  4HJ9 A;  1TY2 A;  4J6H A;  4L6T B;  3FEW X;  3I91 A;  5A2Q E;  3STB D;  4OON A;  3LX0 A;  3P7J A;  4ZUJ A;  2EJF C;  4LF5 L;  2RDH A;  4M1U B;  2F4V L;  1SE4 A;  1HJP A;  3KLR A;  2ZXO A;  1PZI D;  1WCM H;  3PIO A;  3J7A V;  4A3G G;  2KVM A;  2JXM B;  4C2M H;  2VY3 A;  3O13 A;  4FO2 A;  4C56 C;  3ICE A;  5IYC H;  1OTC A;  2YU9 B;  4A3I B;  2F0S A;  2OCE A;  3HRZ C;  4J8Q A;  4A3D B;  1D2B A;  4M8A A;  3T1Y Q;  4XDX A;  1KNA A;  1ONL A;  2HCI A;  3BDC A;  3ERO A;  4DV7 Q;  5C4X G;  1V1Q A;  3NK9 A;  2L55 A;  3I4N G;  3OPO A;  4J15 A;  3SR1 A;  1TQO A;  3E3X A;  4IPH A;  3KBX A;  4LF7 L;  1WCM B;  3CC2 A;  1HQR D;  1DZ1 A;  2E2D C;  1IKL A;  3F2U A;  3CMA A;  3IKJ A;  4JYA L;  4QJF A;  4X64 Q;  2EYM A;  1IKM A;  5ELD A;  2D62 A;  3A8K E;  4ZCK A;  1TVX A;  4FVM A;  4DR5 Q;  4K5W A;  5JPN C;  4K0K Q;  3T4A C;  4F88 A;  1G6Z A;  2K01 A;  3Q23 A;  3HOX G;  3PO3 H;  1XMO L;  5C5M A;  1GUT A;  4JI2 Q;  1TY0 A;  4B9W A;  1NBW A;  2A73 B;  4A3D G;  1KC8 C;  3PIP 3;  4LK1 C;  1Q8K A;  1Q86 C;  4YHH Q;  2PMZ E;  3OW7 A;  4NKL A;  5JJK A;  1K8O A;  4XT3 B;  4JI6 Q;  2UXC Q;  1M4V A;  4NMZ A;  1D1K A;  2BA0 A;  1JB7 A;  3I4N H;  3G48 A;  1I4R A;  2KQ3 A;  4OX9 Q;  3S2D H;  3RLO A;  5IT9 L;  2EY5 A;  2NZH A;  1Q90 A;  3J81 E;  5HGT A;  2E74 C;  3F2D A;  2NN6 G;  4JV5 L;  3BDL A;  1BBX C;  1PFM A;  4NP5 A;  2UXB L;  1LTI D;  3KYH C;  2PZW A;  2L1B A;  2F0G A;  1VQB A;  3A0J A;  3S15 B;  1V43 A;  4UP7 A;  1VCI A;  4HSV A;  4QUC A;  2F0O A;  1O7Y A;  5CC4 A;  4HR7 B;  4DXF A;  3DWP A;  4DUZ L;  4DUY Q;  1EUJ A;  1TWG B;  4DGZ A;  1FNU A;  4A3M H;  3I4L A;  1FNW A;  2L5T A;  2UXD L;  1BCP C;  3AFQ A;  1QJO A;  5I9P A;  4GN5 A;  2OQ0 A;  5CV4 A;  4LFB L;  4OEM B;  1I5F A;  5I2Y A;  3I55 A;  3RD4 A;  4CJ0 B;  3H6M A;  4HIK A;  1CTM A;  3M4O B;  4BXX G;  3I3C A;  5IP7 G;  3C3L A;  5DM6 3;  4NB3 A;  4B3M L;  1ENA A;  1KHI A;  4U68 A;  4DV6 L;  1UUP A;  4TSS A;  2QA4 A;  3ONA B;  2CW0 D;  5IP9 G;  1KTK A;  2YTX A;  2FIN B;  1R9T H;  1L0W A;  1LT5 D;  1YI2 A;  2NN6 I;  3PO2 B;  4IJH A;  3QJY A;  2IHE A;  4IUT A;  1BR9 A;  2WKC A;  4GOP C;  1T5X D;  1CZG A;  5AJ3 Q;  1H9J A;  1LT4 D;  4GLV B;  3UI2 A;  1TR5 A;  3SK6 A;  4ILW A;  3TN2 A;  4PZ8 A;  5ELB A;  4PMC A;  1Z6H A;  2JEA I;  3OYY A;  3CCL A;  2OT2 A;  1B2T A;  4UDU C;  2I07 B;  4K6L A;  4KI0 A;  2E75 C;  5CV8 A;  3NBI A;  5C4J B;  3HOW G;  1JCK B;  4HN7 A;  4S3S A;  4QL5 A;  1CFM A;  1HQM C;  4AYB E;  2O2L D;  3T13 A;  1S4Z A;  4LF6 Q;  1EY5 A;  1F2L A;  3IL8 A;  4RGT A;  2PQE A;  3J7A 5;  3TS2 A;  2NBF A;  3Q24 A;  5E4W C;  3MXG A;  1HZB A;  1I4P A;  2JA5 H;  2GN5 A;  3V96 A;  5IP7 H;  2KEN A;  4OX9 L;  1ICF B;  2E76 C;  2RCN A;  2XRQ D;  4RA8 A;  4CKE A;  3H15 A;  4A3L G;  5FLX L;  2E5L Q;  3HOX B;  1XNR L;  2EY2 A;  2PZT A;  3RLN A;  1ICW A;  3L0O A;  1XMQ L;  4Y7N B;  4KHZ A;  1U4M A;  2EOT A;  1PVO A;  4MN3 A;  1U5K A;  3CC4 A;  1BUV T;  1RDP D;  4LNQ A;  1QVF A;  3GTP H;  5J3B A;  1EIF A;  1WTR A;  2MNA A;  5CYU A;  1LTG D;  1RJT A;  5KYL A;  2LFN A;  2LXJ A;  1VQE A;  2I5L X;  4JI1 L;  1YEZ A;  1Y1W B;  4EQO A;  3J81 L;  2NVY B;  3CW2 C;  2ALY B;  1O7I A;  2C9O A;  3GV6 A;  1AN8 A;  1N8R C;  3H0G H;  1RTN A;  2JA6 B;  1C8C A;  5IGC A;  1CZW A;  5FLM G;  1QZH A;  4IOC A;  3KF8 B;  2JK8 A;  1WD0 A;  2GVB A;  5DAU A;  2IX3 A;  3K0Y A;  3S1N H;  5I4D A;  4JBK A;  2B2Y C;  2F0J A;  5M5X B;  4Y7N H;  1BCP D;  3HOU H;  2AKW B;  3SK4 A;  2JA7 B;  5C3E H;  4KJO A;  3PUZ A;  3PO2 H;  3EJI A;  2SNM A;  4PNY A;  1SNC A;  3GTO H;  3HOZ G;  1A8V A;  4DK0 A;  5ISR A;  4BBS B;  1Q7Y C;  1VQG A;  2R93 G;  1VQK A;  1TS2 A;  1E7Z A;  5EJW A;  2F0I A;  2K5Q A;  3QG1 A;  4X62 Q;  5KYI A;  1HH2 P;  3KDF A;  1ILP A;  4KN4 C;  4RHR A;  4KD4 A;  3NTK A;  4XQN A;  1RHP A;  2BDO A;  3HOZ B;  3E0J A;  2IW3 A;  3OWF A;  1EQR A;  5IGD A;  4PV1 C;  3HFZ B;  2LY7 A;  1L2F A;  4GN4 B;  3HKZ B;  2AHO B;  3NWS A;  4IUU A;  4GNX B;  3C46 A;  4JPB W;  3I2Z A;  2WAQ G;  2OXP A;  1ZXT A;  1IBL L;  2R92 H;  1PV4 A;  3FMC A;  2J4X A;  1VQF A;  4P74 A;  1HNW L;  2RDG A;  1HFN A;  4C1N K;  3U9O A;  3ER0 A;  3KLS X;  4A3E G;  5IP9 H;  2K03 A;  4FF4 A;  4X3T A;  4A4I A;  2RA4 A;  2RHS B;  1E0B A;  1FGB D;  2K52 A;  1N32 L;  3S16 B;  1A15 A;  4B3S Q;  4DR4 Q;  3S2D B;  4L63 B;  1I50 H;  2F0L A;  4C3H H;  4X65 Q;  2MFI A;  2JA5 G;  3Q0A A;  3HGB A;  1NTG A;  2VXW A;  2EYO A;  2PNH A;  2PI2 A;  3TP6 A;  1NR4 A;  2R6G A;  4JI8 L;  2JYO A;  3I7F A;  4KV6 A;  5D3D A;  1A62 A;  2UUA Q;  5C4J H;  4O2D A;  4XQQ A;  1WTP A;  3U4V A;  1NSN S;  4BY1 G;  1DJR D;  2SOB A;  3OOC A;  3RN2 A;  4J1M A;  5CV7 A;  1S5C D;  3M4Q A;  5FKA C;  4R1J A;  3PSI A;  2C5C A;  1SND A;  5FJ8 H;  3MWY W;  5C6A A;  4HCE A;  3PUY A;  4AYB G;  3HOW B;  1WOC A;  2H1E A;  4AQY Q;  1J9O A;  2B63 B;  2O5J C;  1GD7 A;  1MIU A;  2CVR A;  4MTN A;  1V1P B;  4WJ4 A;  4FXD A;  1A2U A;  1TII D;  1F9P A;  2ES2 A;  2JA5 B;  3HKS A;  1K0R A;  1JC7 A;  3NEM A;  3X3M A;  2NVT B;  3K7A B;  1HRJ A;  4A3K H;  4OHJ A;  2E2H H;  3F2C A;  2JA8 G;  1EFW A;  2GA4 B;  1AE3 A;  1HPC A;  1T9H A;  3GO5 A;  1VQL A;  1A0I A;  5KRU A;  2JA6 H;  3K59 A;  1PH6 A;  1SXT A;  4A3E H;  3FHW A;  2Z9H A;  4IPD A;  2MHV A;  2NVY H;  4DNT B;  3H3V H;  1L0X B;  4X65 L;  1FVI A;  5J22 A;  1O7L A;  1CHP D;  3OWE B;  4LFA L;  3AMU A;  2J7Z A;  2OWO A;  2Z4I A;  1KNE A;  1EIG A;  5I2X A;  2KOL A;  1XNQ L;  4PZ7 A;  3UDX A;  4L5S A;  3VYR A;  2G5D A;  3NBH A;  2VUM H;  4DR4 L;  1E1O A;  2K28 A;  1MJC A;  2I46 A;  1KQS A;  2PW7 A;  1XPR A;  1EY9 A;  1SMX A;  3J81 i;  2JP1 A;  5EQ0 A;  4HJA A;  4BY7 B;  1YJW A;  1U9R A;  2F0V A;  3M7N A;  3GTQ H;  4DXG A;  4RWS C;  3H09 A;  2AUJ D;  2Q8R E;  2PO4 A;  3VR2 A;  1HR0 Q; 
#chains in the Genus database with same CATH homology
 4DR1 Q;  2R7Z H;  3D0F A;  2N78 A;  1KXL A;  1HNZ Q;  4UP8 A;  1WCM G;  2K75 A;  3ERS X;  3CQZ H;  3F1Z A;  4A3F H;  1KIX A;  4B3T Q;  4HJ9 A;  4L5T A;  3PF4 A;  2VW9 A;  1VQ6 A;  5IYC G;  3M9B A;  4X66 Q;  2E8G A;  2RF4 A;  4OON A;  3STB D;  3GTK H;  3CCR A;  5JJI A;  4LF5 L;  2F4V L;  2NZO A;  3MEF A;  5IE8 A;  2ZTC A;  1HJP A;  1VQA A;  1WCM H;  5LMU L;  4A3F G;  3PIO A;  4H02 A;  4A3G G;  4WJ3 M;  4C2M H;  2VY3 A;  3EBE A;  3ICE A;  3KJP A;  1K83 H;  1EYG A;  1E24 A;  2Y0S G;  5IYC H;  3ULP A;  1OTC A;  4LF8 L;  1XPU A;  4IFD G;  4OWW B;  2OCE A;  3HOY H;  1WI5 A;  1C7Y A;  3J81 c;  4LF8 Q;  4A3C G;  3J80 i;  1Y1W H;  2WB1 G;  1SR3 A;  3HKZ G;  5AJ3 L;  3T1Y Q;  3L7Z C;  1YJ9 A;  2I0Q A;  4IFD J;  5K36 G;  4DV7 Q;  1AH9 A;  2UUB Q;  4DAM A;  1CUK A;  2VL6 A;  2E2J H;  2JA6 G;  5C4X G;  1V1Q A;  2F4V Q;  2K5H A;  3T1H Q;  1B70 B;  3I4N G;  1CKM A;  3K0X A;  3I4M G;  2HT1 A;  3KOJ A;  1Y14 B;  2QEX A;  4J15 A;  4EQ5 A;  4IPH A;  4MNO A;  4LF7 L;  2XGT A;  4TVA B;  3CC2 A;  2IY5 B;  3NEN A;  2IX1 A;  1HZC A;  4MZ9 A;  1GM5 A;  4YY3 Q;  3HOV G;  4BA1 I;  4DR2 L;  3CMA A;  3UDG A;  3KF6 A;  4JYA L;  4QJF A;  4X64 Q;  1UE1 A;  2D62 A;  4JBW A;  4LF7 Q;  3S15 H;  1D8L A;  1B8A A;  4A3J H;  3G4S A;  4DR5 Q;  4BY7 G;  4LF4 L;  1X3G A;  4K0K Q;  1VQC A;  4R4I A;  3TRE A;  5M3M G;  1N34 Q;  5HGQ A;  4K0K L;  3HOX G;  3RZD H;  1CKO A;  3PO3 H;  1QUQ B;  1N36 Q;  1XMO L;  4JI2 Q;  3CP0 A;  3H0G G;  2JA9 A;  3J80 c;  1UE7 A;  5M3F H;  2K5N A;  1GVP A;  4IFD I;  4YHH L;  1PH2 A;  2D0P A;  2N49 A;  4A3J G;  1NBW A;  4X64 L;  2ASB A;  4BY7 H;  2DGY A;  3G71 A;  1I94 Q;  3M4O H;  3DLL A;  1L1O C;  4JI1 Q;  1XJV A;  4A3D G;  1KC8 C;  4LF9 L;  1VS0 A;  1PH3 A;  2UXB Q;  1AE2 A;  2KHJ A;  1K8A C;  1Q8K A;  3HOW H;  3GTJ H;  5C0X I;  1Q81 C;  1S40 A;  1VQJ A;  5BR8 L;  1V9P A;  1Q86 C;  4YHH Q;  3AEV A;  1W3S A;  2JA8 H;  2PMZ E;  5M3F G;  5JJK A;  1SE8 A;  4GNX C;  1VQ9 A;  4JI6 Q;  4JI2 L;  1BVS A;  3RR5 A;  4X66 L;  1B7Y B;  1X56 A;  2UXC Q;  1SRO A;  2BA0 A;  1S3O A;  1JB7 A;  4B3M Q;  2HIV A;  3G48 A;  4OX9 Q;  3I4N H;  3S2D H;  2QGQ A;  4A3B H;  1HR0 W;  4L5Q A;  3RLO A;  3GTM H;  2NZH A;  5GAD C;  3STB C;  3BZK A;  1K8G A;  1PYB A;  4UP9 A;  3F2D A;  1IBM L;  4NPS A;  1WJJ A;  1X55 A;  2NN6 G;  3E0E A;  1VQN A;  4JV5 L;  3NEL A;  3PV0 A;  2FXQ A;  3HOV H;  3HOY G;  1DGS A;  1KL9 A;  2JQO A;  2UXD Q;  4JI4 Q;  1VQH A;  4A3C H;  4DK3 C;  2UXB L;  3KYH C;  4DV2 L;  3CCV A;  1N32 Q;  1VQB A;  3A0J A;  1V43 A;  4UP7 A;  1VCI A;  4A3G H;  1Q1B A;  4BBS H;  4BY1 H;  1CSQ A;  1VQ7 A;  4GN3 B;  2WB1 E;  3HKZ E;  2B63 H;  4IPC A;  3F2B A;  1J6Q A;  4YWL A;  3CC7 A;  4DUZ L;  2YU9 H;  4DUY Q;  4DPG A;  1EUJ A;  1MJE A;  3BZC A;  4A3M H;  2UXD L;  1X3F A;  2JEB I;  3AFQ A;  2DUD A;  1YHA A;  5C0X J;  2N8N A;  4GKK Q;  4GN5 A;  2OQ0 A;  1K9M C;  4LFB L;  4R4C A;  2AWO A;  5LMN Q;  2YTY A;  1I5F A;  1Q1E A;  3I55 A;  1JE5 A;  4BBR H;  4HIK A;  2NVX H;  2OTL A;  3HOZ H;  4IOA A;  4BXX G;  1TWF H;  3DM3 A;  2CFM A;  2MQH A;  5IP7 G;  4A3M G;  1SRU A;  4NB3 A;  1W2B A;  4B3M L;  4IJL A;  1KHI A;  4DV6 L;  1OXX K;  3E9H A;  1HZA A;  2QA4 A;  1PH9 A;  1U0L A;  5IP9 G;  3PF5 A;  2YTX A;  4DV5 Q;  1R9T H;  1L0W A;  1YI2 A;  2NN6 I;  3RNU A;  4IJH A;  1QZG A;  2E5L L;  3MXN B;  2Q2T A;  3UE0 A;  2IHE A;  1VQP A;  4JCV E;  4PMW A;  2VQF L;  1X9N A;  3PCO B;  1JT8 A;  1HNX L;  1NJI C;  3AYH B;  3CCQ A;  2Q2H A;  3FP9 A;  4JI4 L;  2D0O A;  4GOP C;  4IPG A;  4ALP A;  2C35 B;  2K4K A;  4PZ6 A;  5AJ3 Q;  1PHJ A;  2R7D A;  2ZTD A;  1M1K C;  2UU9 Q;  2KCT A;  4XIG S;  4PG3 A;  2K14 A;  4DV4 L;  4GLV B;  4B3S L;  1VQO A;  4POF A;  1XPO A;  1HNX Q;  1YBY A;  1UEB A;  4PZ8 A;  4APV A;  5ELO A;  1N36 L;  3UDI A;  1J5E Q;  3LGJ A;  4L5R C;  2A19 A;  3WWV A;  2JEA I;  3OYY A;  1NMF A;  4YCV A;  5C3E G;  1VQ5 A;  1P8L A;  3CCL A;  2EXD A;  4KI0 A;  1S72 A;  4AQY L;  3PO2 G;  2B63 G;  4NXM L;  1QVC A;  2A1A A;  4DV1 Q;  1JJC B;  4A3K G;  3HOW G;  4NXM Q;  3K80 C;  1PYS B;  4QL5 A;  2BH2 A;  4AYB E;  4JYA Q;  4LF6 Q;  3A74 A;  3KF6 B;  3J7A 5;  5ELN A;  3U58 A;  3TS2 A;  3ULL A;  5IYB H;  1X6O A;  3PO3 G;  3CD6 A;  4DV0 Q;  1BBU A;  4JC0 A;  1HZB A;  2LXK A;  4LFB Q;  4LFC L;  1LUZ A;  2JA5 H;  4POG A;  2GN5 A;  3AQQ A;  3FKI G;  5IP7 H;  3H3V I;  2KEN A;  4DR7 L;  4OX9 L;  5M5X H;  3TRZ A;  1VQM A;  2RCN A;  3H15 A;  1XMO Q;  4A75 A;  1IBM Q;  4JI0 L;  4A3L G;  2ZJR A;  3IRB A;  1TXY A;  1YHQ A;  1GKH A;  2E5L Q;  2UUB L;  2YTV A;  5E7N A;  5C0X G;  1XNR L;  1EOV A;  1GO3 E;  1QVG A;  4BXX H;  3RLN A;  3W1G A;  4AIM A;  4YCW A;  1D7Q A;  3EIV A;  3A5Z B;  3L0O A;  1VQ8 A;  2UXC L;  3M85 A;  1XMQ L;  1PH1 A;  4A93 G;  1RIP A;  4GKJ L;  4KHZ A;  3G6E A;  4DV2 Q;  2KHI A;  1PVO A;  2AMC B;  1U5K A;  3ZJY C;  4YY3 L;  4HJ8 A;  3VDY A;  4P71 A;  5M5W H;  1YJN A;  2IT1 A;  3CC4 A;  5J3B A;  1EIF A;  2ZJP A;  2MNA A;  1Q82 C;  4LNQ A;  1QVF A;  1IYJ B;  3PIP A;  5JEA G;  1Q12 A;  1X3E A;  3CCM A;  5LMN L;  2LXJ A;  1XMQ Q;  4DV1 L;  1VQE A;  2HQL A;  2I5L X;  4JI1 L;  1YEZ A;  3F8T A;  3I4O A;  3CW2 C;  4JOI A;  2ALY B;  5M3M H;  1M90 C;  1O7I A;  2BH8 A;  2L15 A;  4GOP A;  4IO9 A;  1EQQ A;  1QUQ A;  5IWA Q;  4DR3 L;  1N8R C;  1Q46 A;  4DR5 L;  3H0G H;  3KFU A;  1OXS C;  4GNX A;  5IWA L;  3JAM i;  1UE5 A;  3CCE A;  2JA7 G;  5FJ8 G;  5FLM G;  1K73 C;  4JI6 L;  1QZH A;  4IOC A;  4JI7 L;  3KF8 B;  2JK8 A;  2LSS A;  2PI2 E;  1NMG A;  2VZA A;  2CWA A;  2GVB A;  4UPA A;  1HZ9 A;  4JI5 L;  4DV0 L;  3TS0 A;  3S1N H;  1KAW A;  4JBK A;  3PUX A;  4JI5 Q;  2NVT H;  5JEA J;  1I6H H;  2B29 A;  3OTO L;  1ASZ A;  4Y7N H;  4DR2 Q;  2UUA L;  4DV3 L;  1EWI A;  3PGZ A;  3TEH B;  3HOU H;  2AKW B;  4X6A H;  5C3E H;  4LUO A;  3PUZ A;  4LUZ A;  1YVC A;  2Y0S E;  3GTP H;  1XTD A;  5EAY A;  3PO2 H;  1X65 A;  1HNW Q;  3GTO H;  2CWP A;  2VNU D;  3BJU A;  1A8V A;  2I5H A;  1FGU A;  4BBR G;  3HOZ G;  3S1M H;  1Q7Y C;  3CAM A;  3S14 H;  1VQG A;  1Y1W G;  1N34 L;  2R93 G;  4B3R Q;  1IZ6 A;  1IXR A;  3K8A A;  2KCM A;  1HR0 L;  2Z0S A;  4DV4 Q;  1VQK A;  4AH6 A;  4QQB X;  1E7Z A;  1P16 A;  4X62 L;  1Y1V G;  4X62 Q;  1LM0 A;  4QY7 A;  2UUC Q;  3CCU A;  1HH2 P;  3KDF A;  3GTL H;  4HJ5 A;  2VQF Q;  1SFO H;  4P73 A;  4JG2 A;  1JJG A;  1JMC A;  4KHP L;  2R93 H;  2BA1 A;  2N3S A;  3S2H H;  4DUZ Q;  1OXU A;  2YV5 A;  4HIO A;  4BBS G;  4EX5 A;  2CKZ B;  1Z9F A;  4DV6 Q;  3U4Z A;  4LF5 Q;  1EQR A;  3GDE A;  2WAQ E;  4JI8 Q;  2MO0 A;  3S16 H;  1A63 A;  3HFZ B;  1YIJ A;  2VUM G;  1L2F A;  4GN4 B;  3RLF A;  4RG1 A;  3CME A;  2AHO B;  3E9I A;  4HJ7 A;  4GLX A;  2YYZ A;  3T1Y L;  4LFC Q;  2K50 A;  1KRT A;  5C44 G;  3PUW A;  4GNX B;  4A3I G;  1IBL Q;  1WYD A;  1KD1 C;  3HOX H;  3I2Z A;  2WAQ G;  4A3B G;  3S17 H;  4NXN L;  1IBL L;  4B3R L;  2XTI A;  2ZM6 L;  2R92 H;  1L1O B;  1PV4 A;  1L1O A;  1NE3 A;  1C9O A;  2PQA A;  2PQA B;  4DAY B;  3KJO A;  1EIY B;  2HIX A;  4LF6 L;  2ZTE A;  1VQF A;  4P74 A;  5HY6 A;  4HIM A;  1HNW L;  1C0A A;  5IYD H;  3S24 A;  4DNI A;  2ID0 A;  2VS1 A;  1FL0 A;  2JJQ A;  3RZO H;  1OXV A;  5LMN W;  3ER0 A;  4A3E G;  5IP9 H;  4DUY L;  4JI3 L;  3GD7 A;  2AWN A;  4A4I A;  2VQE Q;  4DR6 L;  4DV5 L;  2RHS B;  2CCZ A;  2R7Z G;  4QIW E;  2K52 A;  4JOI C;  5IT9 c;  1N32 L;  5IYD G;  3RN5 A;  1HNZ L;  2UUC L;  4B3T L;  4OXP A;  4DR1 L;  2EQS A;  4B3S Q;  4DR4 Q;  4A76 A;  3CCJ A;  1TWA H;  2Q2U A;  1Z47 A;  3EN2 A;  1I50 H;  3PUV A;  4P72 A;  1KRS A;  3SGI A;  4C3H H;  4X65 Q;  1XNQ Q;  2MFI A;  4RMF A;  2JA5 G;  4TQU S;  1NTG A;  2OQK A;  2Z6K C;  5M5Y H;  5FLM H;  1TWH H;  4DR3 Q;  4R4T A;  1PH4 A;  2ATW A;  2PNH A;  2PI2 A;  5C4X H;  3CCS A;  1IBK Q;  5LMU Q;  1XNR Q;  4KLK A;  1IBK L;  4DKA C;  4JI0 Q;  5JJL A;  2R6G A;  4OWT B;  4JI8 L;  3CXC A;  5GQO A;  2EIF A;  3I7F A;  1VQ4 A;  4DR7 Q;  4FDB A;  1LYL A;  3ULJ A;  3HOU G;  2Q2I A;  2CQO A;  3B6Y A;  1A62 A;  2UUA Q;  1CSP A;  5C4J H;  4O2D A;  3U4V A;  3OTO Q;  4LF9 Q;  1YNX A;  4BY1 G;  5IYB G;  4GS3 A;  4A3D H;  1Y1V H;  2H5X A;  5DLQ E;  3RN2 A;  2E2I H;  1N33 Q;  5GRO A;  1PH8 A;  1I94 L;  3BU2 A;  4JI7 Q;  1YIT A;  3M4Q A;  1FJG Q;  5FLX c;  2R92 G;  4R1J A;  3PSI A;  3KLW A;  5FJ8 H;  4Y52 H;  2GVA A;  3K81 C;  3M4P A;  4HID A;  2NVQ H;  1G6P A;  3CPF A;  1MKH A;  1OXT A;  3PUY A;  4AYB G;  5GAG C;  1WOC A;  1E3P A;  4AQY Q;  4YWM A;  4OO1 G;  1GD7 A;  1TWC H;  2RHQ B;  1E1T A;  4DV7 L;  4JBM A;  4GOP B;  1MIU A;  1J5E L;  4LF4 Q;  4MTN A;  4XTC S;  3D31 A;  2HHH Q;  4WJ4 A;  2ZM6 Q;  3I56 A;  1G29 1;  1SLJ A;  3W1B A;  3KDF B;  1LTL A;  2ES2 A;  3HKS A;  1K0R A;  5H1S E;  3Q8D A;  3K7U C;  3NEM A;  3TQY A;  3JC6 6;  3NBH B;  4DV3 Q;  2UU9 L;  1YHB A;  4DK6 C;  3S1Q H;  1ASY A;  1WFQ A;  5BR8 Q;  4R4O A;  4A3K H;  4GKJ Q;  4QGU A;  4UY8 C;  1NY4 A;  2A8V A;  4OWX B;  1N33 L;  2E2H H;  3F2C A;  2JA8 G;  1BKB A;  1EFW A;  4YWK A;  4O0A A;  1AE3 A;  3AFP A;  1T9H A;  2ZJQ A;  3GO5 A;  1VQL A;  1CKN A;  1CKN B;  1A0I A;  1UWV A;  1BBW A;  2IX0 A;  4LFA Q;  2JA6 H;  2HHH L;  2JE6 I;  4LUV A;  4A3E H;  1PH6 A;  3FHW A;  2B3G A;  5IY0 A;  4C3I H;  1PH7 A;  3L2P A;  2WFW A;  3J7Z C;  4KHP Q;  4IPD A;  4GLA C;  2NVY H;  3H3V H;  1VQI A;  2JA7 H;  2F3I A;  1FVI A;  4X65 L;  1H95 A;  1JJ2 A;  1K3R A;  3W5O A;  2OTJ A;  4LFA L;  4P75 A;  4NXN Q;  2WP8 J;  2OWO A;  4A3L H;  1G51 A;  1YZ6 A;  1PH5 A;  1FJG L;  3J81 j;  4YCU A;  1XNQ L;  4PZ7 A;  1UE6 A;  4GKK L;  3JAM c;  3UDX A;  2V1C C;  1VQD A;  4L5S A;  4OO1 I;  5GAH C;  2VUM H;  2VQE L;  4DR6 Q;  4DR4 L;  1E1O A;  4JI3 Q;  1RL2 A;  4A93 H;  3UDF A;  1N9W A;  1MJC A;  1TWG H;  2I5M X;  2R7F A;  1KQS A;  3OW2 A;  3I4M H;  3A5U A;  1XPR A;  1SMX A;  3J81 i;  1PFS A;  3M3Y H;  4R4Q A;  2Z6K A;  4JBJ A;  4LW1 A;  4LWC A;  2F52 A;  2K5V A;  3GTG H;  4HJA A;  3T1H L;  3CPW A;  3FKI H;  5GAE C;  2MO1 A;  3U50 C;  1YJW A;  3M7N A;  4ME3 A;  3GTQ H;  3S1R H;  1IL2 A;  2IHF A;  1SN8 A;  3UE1 A;  1PA6 A;  2KBN A;  1I3Q H;  1X54 A;  3CF5 A;  5C44 H;  4A3I H;  4C3J H;  3K7A H;  4BA2 I;  4JV5 Q;  1HR0 Q;  1E22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...