4JW0A

Structure of gloeobacter violaceus ccml
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
MQIGRVRGTVVSSQKEPSMVGVKFLLLQLIDEAGQPLPQYEVAADGVGAGLDEWVLFSRGSAARQVAGSEKRPVDAVVIGIIDTVSVDNRPLYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Two new high-resolution crystal structures of carboxysome pentamer proteins reveal high structural conservation of CcmL orthologs among distantly related cyanobacterial species.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Structural protein
total genus 15
structure length 95
sequence length 95
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4jw0A00
2QW7A 4I7AA 2RCFA 4JVZA 4N8FA 2HD3A 4N8X1 4JW0A 5L37A 2Z9HA
chains in the Genus database with same CATH superfamily
4IFDH 1ENAA 1SE4A 3S9WA 4IOAA 2BE5D 4UHVA 2F0NA 2B63H 2QGQA 2OXPA 4JI0L 2XVSA 4RMFA 2H4OA 1D5MC 1F2LA 4LF9Q 3BZDB 4CJ0B 1JQYD 4QJFA 2B2VC 5FK9C 5C4HA 5IYCG 4KKUA 2RA4A 4NW2A 1Y1WG 2VL6A 4A3IH 1IW7D 2B39A 2BA1A 4G7OC 5JJIA 3SK8A 5FOBB 3K7UC 4MTNA 4HIDA 5JJZA 5IODA 3CCVA 5IYCH 2D0PA 5E7NA 1Y1WH 3PUWA 2D62A 4NMZA 1ICFB 2EYPA 1MJEA 5FLMG 1XJVA 5M5XB 4AQYL 1EU3A 3VYTA 1C9OA 4DR5L 3TP7A 2JN4A 4OXPA 1KRSA 4IJLA 2MNAA 5KYIA 1C8CA 4OIJA 2KECA 2YU9B 2AQ2B 4P72A 2E2JB 5IGDA 5FLMH 1B44D 2JYOA 3I70A 2A74C 1SEBD 4O1NA 4B3RL 4A3BB 5KEEA 1OXUA 4BY7G 2F0GA 4A3JB 2JA6G 2H5XA 4J15A 3X3MA 4R8NA 4CDCC 3HOWG 4MIUA 4L5QA 1Q81C 3A54A 3Q24A 4O2DA 1HH2P 3PQIA 1HNXQ 3KLSA 4K2LA 4DR1L 1TY2A 1R9TH 1VF5C 1QILA 4FP5D 3UE1A 1IXRA 2I5MX 2F0SA 5A35A 2DJGC 1K8AC 1D7QA 2G5DA 3HOWH 1HNZQ 1JWUD 1S3OA 3PO2G 4ZK9B 4DU9A 4L6TB 3FP9A 1E3PA 1TKWB 1EIHA 2CQOA 4JI2L 4GKJL 2VQEQ 2NWGA 4N8FA 2EYMA 3BYTB 4KKSA 1G6ZA 5CGKA 5ELNA 2AMCB 1NR2A 4YWKA 3PO2H 5C5LA 1KXLA 5JPMC 3E5SA 4HJ8A 4KJOA 2Q2TA 2N3SA 3GTMH 2UUAQ 2KEDA 4OX9Q 3ND9A 1ENFA 2E2HB 2PZTA 5LMNQ 3H0GG 5CR3A 3CC4A 1TWHH 1VDZA 2CH4W 3BS1A 3A5UA 2F0EA 3KDFA 2B8GA 1II3A 3H0GH 4AYBE 2B2WA 1OXXK 1SYFA 1UE6A 4GN5A 1H95A 5CYUA 1QJOA 4ZUJA 2ENBA 1BCPB 1SBBB 1J5EQ 3P20A 1JC7A 1JJGA 5IP7H 1ENCA 3JAME 3RZDH 3RZOH 1WTOA 1WI5A 3IRBA 3OYYA 2RDFA 2BH2A 1Q8KA 1DOMA 3M9BA 4V0BA 5M3FH 1I94L 1RD9D 2KHSA 4DV1L 3DMUA 1EY9A 3FKIG 4CHTB 2F0QA 5J22A 2RCNA 3QWNA 1RCVD 3TZUA 3AMUA 1IYUA 2F4VL 3K7AH 4C1NK 1NMFA 4XYQA 4KLKA 4QUCA 2A5HA 1PTOC 4C3HG 4EGVA 2QDBA 1M8AA 1TS3A 1EYCA 2RCFA 5ELOA 4K0KQ 1Q1EA 2PZUA 4GOPA 5J1ZA 3S2DH 2BA0A 2K05A 2K14A 1PDQA 3GTPH 5KGUA 1VQOA 3RN5A 1FNUA 1E2WA 3M7GA 1B2TA 1V1PB 3V2TA 3CHBD 1PZKD 4B3TL 1B1ZA 1VQMA 2B29A 3CCSA 4BY7B 2LY7A 3RUZA 1J8IA 1LABA 3FMCA 4JI3Q 1VQPA 2JA6B 1PTOF 4A3CG 1D5ZC 3A55A 4AYBB 3CW2C 1BBXC 1FD7D 2IPKD 3M4YA 3CC7A 2YTYA 1E1OA 3IKJA 1WFQA 5GAGC 3S17B 1K83H 4FXGC 2NTTA 1B9MA 3U58A 1S5FD 2PCFB 1DONA 2ICIA 5GAEC 4K8JA 4DXGA 2JJQA 3KLSX 1GUWA 4GN4B 1F9PA 1HJPA 3C1FA 4IJHA 4KV6A 3UE0A 5COYA 4MZ9A 3NTKA 1GHKA 1TIID 2VZAA 3QJYA 1UAPA 3AYHB 4A3FB 5IP9H 1LLRD 1A3UA 2DUDA 3A74A 3D6CA 1A2UA 3BDLA 1ESFA 4JBKA 2HQLA 2FHTA 2E76C 3KF6A 4N9PA 4C3JG 2EXDA 1K9MC 4A3KB 2F0KA 4OWXB 1NCVA 1GUNA 5IYDG 2OCEA 3GP7A 1NBWA 3MA2B 2VNUD 2ZTEA 2AQ1B 2IX0A 1D1IA 1HFNA 2PQAA 4DNRB 1K73C 4DR7L 4LF4Q 4C3JH 5CV9A 3CP0A 1S5CD 4E6IA 5IYDH 1OO9B 1GUGA 2E2IB 4Q5VA 1HTLD 2ZXRA 3LWEA 5EKKA 3KBGA 3CF5A 1G2TA 5C6AA 5JVH3 2Z8LA 1A15A 1SAPA 2ID0A 3KYHC 5JOBA 1U4PA 1PFMA 4IO9A 2L9HA 2ATWA 4JI1Q 4JYAL 1E24A 1K3BC 4DUYQ 1PZJD 4DR6Q 1VQJA 1ASYA 1SNQA 1XPRA 3GQBA 4YWMA 2R3ZA 1K0RA 5H1SE 3K59A 4RGMA 3TSSA 4LFCL 1KD1C 3FKIB 1QUQA 4R9WA 5C3EG 4LJZC 2NVYH 1PXUA 1QOHA 3J7ZC 4RCNA 1I4QA 3PSIA 5G3LF 3VR3A 4C3HB 4DAMA 3UDGA 3SK4A 3TS2A 2MJ8A 4JI6Q 1SNOA 1OTCA 1EIGA 3WOEA 1RF2D 2EY1A 4KHZA 1WCMG 5J39A 3M3YB 1XNQQ 1PRTC 1SNPA 4POFA 1PH1A 3SGIA 1I6VC 1JOOA 1IL8A 4QMGA 1HUMA 4QIWB 5EPJA 4BY1H 1X55A 1WCMH 4DR4Q 3I91A 4NP5A 1LT3D 3DWQA 3CU7A 2UUCQ 4LFAL 4J6HA 2B2YA 2C9OA 3BU2A 2F0TA 3QOLA 2KBNA 4TQUS 1PRTF 2ASBA 4XT1B 3VA5A 4X3UA 3CQZB 2QKIC 3HG9A 3KBXA 4B3MQ 2A68C 1B9NA 4JBMA 3NEMA 2VB3X 3STBC 4HMIA 1ZXTA 1X3FA 4LUOA 3Q8DA 1YITA 2BDNA 2PMZE 4GKKL 4IPCA 3JAMc 3A5ZB 3DXJC 1PA6A 2UXBL 1EU4A 1HZAA 1STYA 3NSWA 5GADC 5BR8Q 2UXDL 1DOLA 3E6ZX 5LHY1 1EWCA 1F77A 1L1OC 1E2VA 3NQIA 2RQXA 4C56C 3L3OC 5IGFA 1YJ9A 1TQOA 2HHHL 1OXTA 3V96A 4XQQA 4P2CB 4HIKA 1SE2A 1FJGQ 5EBDA 3HOVH 1XMQQ 1GUSA 2HUGA 3TMEA 3G71A 5KNDA 5IYBG 2RF4A 5IGCA 1A6XA 3ONAB 4DN4M 4PMWA 2LMCB 3GTQB 4WJWA 5EJWA 2KJXA 1LUZA 5JEAG 5BN3A 4CKCA 2R93G 3G6EA 4C3IB 4CGYB 3HGBA 2NVXH 3SK5A 5C44H 3Q22A 1S5DD 3KDFB 3S15H 5JEAH 1N32L 1KHIA 3OIPA 1IL2A 3G4SA 4DV6Q 4TVAB 2EYFA 3QIAA 1NAPA 1JICA 2PMZB 4YIJA 1NR4A 3VYRA 2LXJA 4F7XA 4OL7A 2SEBD 1TU2B 4DK0A 1WTXA 3GDEA 1A2TA 3CAMA 3J81j 5C0XI 1XMOL 3NXWA 3QB3A 2R7ZG 2JSOA 2A1AA 1SMYC 2XRSD 3W3AA 1L0WA 4DAYA 1HR0Q 4BBSG 1PLFA 5K5PA 1PTOD 1C0AA 2SDFA 3VYUA 3ITPA 2LSSA 2D5DA 1AZPA 2N55A 1HUNA 4NXNQ 1N33Q 4DV7Q 2B3GA 1E1TA 2NVTH 5KRUA 5ELEA 4S3SA 2KEEA 5ELCA 3TP5A 1MGSA 1P8LA 5M5WH 4O0AA 5JVG3 4DV0L 4KMUC 3L9AX 4HSVA 2HD3A 1T9HA 4JW0A 3RMHA 3T4AC 1Y69U 2VS1A 3BZCA 1TWAB 1CA6A 3MFGA 2K03A 4IPDA 3W1BA 1I50H 1DM0B 2FINB 2K1BA 2L4NA 3R8BA 1G2SA 3D0FA 5K36G 2Z0SA 3ZJYC 3D8GA 1PMRA 2F0OA 3MHBA 3J7AF 3D4RA 3ULPA 3PO3G 1YHQA 1HHVA 1SLJA 1BBWA 3RN2A 2A6HC 4JG2A 1I4RA 4DV3L 4PZ8A 4KN7C 4X65Q 2O5JC 4UY8C 3UDIA 2M9VA 2IY5B 2WFWA 1Y1VH 2V4DA 3TN2A 3PO3H 3OWEB 2NZOA 1STAA 3D3RA 1M1KC 5FO9B 3LWUA 5M3MH 5IT9E 1QVFA 1EY5A 1H9RA 1TXYA 1PTOH 4OELB 3K0YA 1M90C 2SNMA 4IUPA 4JI7Q 4ZKBB 4DV2L 4LNQA 1RL2A 1VQ6A 4GLAC 3S2HB 4HN7A 1EIYB 5I6YA 1SR3A 2SNSA 4KTAA 5HY6A 4DKAC 3K58A 2NVQB 3Q0AA 5LMUL 2Q8IB 2O5IC 4HJAA 1LTID 2I5LX 3GTKH 2BCOA 2EY6A 3HOXB 4XDXA 1B7YB 3KF6B 2RSNA 2DGYA 1HQMC 4UPAA 3GTOH 1NMGA 2ZM6Q 4KKTA 2KHJA 4LUZA 4U68A 3G48A 4LFBL 2WB1E 4QY7A 1KL9A 4K14A 2F0DA 5CC4A 4LF6Q 2F0LA 3T1HQ 2R93B 1KNAA 1FGUA 2K52A 3PIPA 1X54A 3PMFA 3I90A 1IKMA 2OT2A 4OO1I 4H44C 4DAPA 3MXNA 5KYLA 4ZUIA 4HJ7A 1K3RA 5NUCA 4ID6A 1O7ZA 5G3LD 2PPBC 1SYEA 2DJFC 1LM0A 3D4DA 2CKZB 3S1MH 4Y7NB 4HR7B 1SNCA 2EIFA 4LF9L 2K33A 2AHOB 1I6HB 5C0XJ 1GM5A 1AFPA 1WTWA 1DYQA 1EQRA 2HT1A 3CKIB 1UE5A 2VQFQ 1WTQA 1GO3E 3H3VI 4ZLTF 1NY4A 2R7ZB 4A3IG 4L5SA 3EA6A 1CKOA 4IUUA 3GTGH 3DEPA 1AZQA 4BBSB 1B50A 1KQSA 4DF7A 1XX8A 4PV1C 3S1NB 4KY5A 3H09A 1JB7A 4HTHA 4CDDC 4K6LA 4QCLA 1QUQB 1JCKB 4QL5A 2K32A 1AH9A 3CCMA 4JV5Q 3BVZA 3I4MB 2EVBA 2K4KA 4DNIA 1Q8IA 1LV9A 1ESRA 3MEHA 1PRTD 2EYHA 5KIXA 4A3GB 1GJXA 3HOYG 3L0OA 3U4ZA 1A3TA 1HA6A 5AJ3Q 1QNKA 4HIOA 1N8RC 4NXML 2OQ0A 5CV8A 4CDEC 2CWPA 2K04A 2WB1B 3TP8A 4P71A 4GNXA 4LAAA 1OXVA 4GOPC 1DOKA 2NTSA 1SE8A 5M5YB 2JA8H 2F0WA 1SYCA 5IGGA 3HOYH 1W2BA 1STBA 4B3SQ 1LTGD 1X3GA 4HMJA 3F2CA 3URYA 4C2MH 1ZYRC 2GA4B 4CBVA 1Z47A 2EYJA 4PMBA 1I3QB 1CM9A 4K5WA 1WJJA 3ERSX 2F52A 5C4JH 3K0XA 2A68D 2GVAA 2PI2A 3CRKC 2JA9A 2XN9C 4RKLA 3STBD 1JORA 1E0BA 1X3EA 1YVCA 4IUNA 2KCMA 4EQNA 5CBEE 2B2UC 2YTXA 1PH4A 2K5QA 5A2QE 4WJ4A 1DGSA 3U9SA 4RHSA 3PF5A 3RLOA 4ZQ3A 2R7DA 3KLRA 3A7AB 3DWPA 2VQEL 2QDLA 5DLQE 2NZHA 1CKMA 5C3WA 2PNRC 1JR0D 5I2YA 2MP1A 4HJ5A 1G8ZD 4A4IA 4IUQA 2Z1CA 3E0EA 3D31A 2CQAA 1D8LA 1H9SA 2UUAL 4C1NI 5JJKA 1EUJA 1VCIA 4CKEA 3FVQA 3I2ZA 1KIXA 1AE2A 5LMNL 2Z6KC 3H3VC 3E9IA 1JT8A 1O7IA 3S14B 1A3VA 1VMCA 4KI0A 4DUZQ 2EYLA 4IPHA 3NHHA 4MTKA 1N34L 1EEFD 2F0JA 1ZKOA 1KRTA 1IHZA 2Z9HA 4RCOA 1GD7A 3TS0A 1EYGA 3NELA 3KF8A 4G7HC 2PZWA 3NP8A 3K5OA 3T1YL 3AFPA 5EAYA 2B63B 4F87A 3SR1A 2XSCA 4DV4L 3N52A 3SDZA 5IP7G 2X6GA 3EN2A 1IBKL 3I55A 3CCUA 2IWHA 1DD2A 1M4VA 1HNWL 2K5NA 4A3IB 1LT4D 3D6WA 4KN4C 4I7ZC 3TREA 2N8NA 4JK1C 5I9PA 2VUMH 1HRJA 5LMNW 5EKIA 1F2ZA 3EIVA 4BWGB 5M3FG 2D0OA 2ZTDA 1SMYD 3CMAA 1NE3A 3PUYA 1Y1WB 1JWSD 1V1OA 4IFDI 4JC0A 2B2TA 1SRUA 4GN3B 4K0KL 1SYDA 5IT9c 4YCUA 2YYZA 1STEA 2JA5G 1O7LA 2ZXOA 3EJIA 1SFOH 3M7NA 1IBMQ 1XYIA 3JC66 1YBYA 2KA7A 4DAYB 2X6LA 1VF7A 1OXSC 1WTHA 1W3SA 3PUZA 1S5BD 1TS2A 2XWJB 4JBWA 2AUJD 1BDOA 4H02A 1KDAA 2JA5H 3P7JA 3N6RA 1PH2A 4JI3L 3IFDA 3TQYA 4RFBA 3QO2A 5IGEA 1Z9FA 3QR8A 4QQBX 1WOCA 3UDFA 5BN4A 4DR3L 1TR5A 1TWFH 2IHFA 1R9TB 1HZBA 2A6HD 2WAQG 1HZCA 1RTOA 3A8KE 3OPOA 5I9OA 1NSNS 2DY8A 4L5RC 3S1RH 2A6ED 3OTOL 4OWTB 3OW2A 3HOWB 2HDLA 1Q82C 1XNRQ 5FO7B 2RKSA 1EIFA 4GLVB 3K81C 2R92G 2K5WA 4K6DA 1ASZA 2HCIA 3JAMi 3BYYB 2KVMA 1LTRD 1UNSA 5IP9G 2Q8TA 4A3MH 1V1QA 3PO2B 3PUVA 1HFGA 2R92H 4TSSA 1EY6A 2FXQA 3P1HA 1FNVA 4BXXG 4A93G 1TY0A 3GTMB 1VQCA 3MWYW 1E2ZA 2R61A 4YWLA 4JI8Q 4LF7Q 3T56B 4WJ3M 4LF4L 4FVMA 3I4OA 4IZ8A 1TWHB 2QCPX 3D4WA 2RBMA 4BXXH 4A93H 1VS0A 1D2BA 1FL0A 2ZTCA 3R2IA 5DEHA 4ABNA 2F0HA 3F8TA 5JJLA 2CFMA 2E75C 4R1JA 2FFKB 3T16A 4WFN3 1PH5A 2F1MA 3H0GB 1BQQT 2KHIA 4K8IA 4ZYSA 4JI1L 4DUYL 3S1QH 4DR6L 3K8AA 4DK1A 4QIWE 3HOUG 4FNFA 4R4IA 1BF4A 4ULLA 1X32A 5E1FA 3PIO3 3KOJA 5EKLA 3RZDB 3RZOB 1B4OA 1C48A 3MXNB 3GTLH 1I4GA 1X6OA 4BBRG 3HEJA 4POGA 2MUYA 5M3FB 3I3CA 1B70B 2WINB 3HOUH 1UEAB 3I4LA 1BCPC 4IFDJ 2MO1A 4DK6C 1U9RA 3Q6SA 2JP1A 3Q23A 1SJED 1X9NA 2JEAI 3K7AB 4IOCA 4ODGA 3I56A 1Q12A 2PI2E 1IKLA 4BBRH 3CCLA 1VQKA 3QOJA 1PH8A 4IUTA 1S5ED 4JI6L 4CDFC 1Q90A 3TZDA 4H0LC 2L0CA 5LL6X 1JB3A 3SEBA 3S2DB 1O7YA 3GTPB 2RSOA 4JPBW 1XNQL 1BCPF 2M2LA 1LYLA 2C5CA 3O13A 4KD4A 3GTJH 3M4QA 5EGTA 4V190 4DR4L 3CMEA 4PQXA 4BY1G 2E74C 1YHBA 2UUCL 2Y0SG 2EJGC 2Q2HA 4DV5L 1PFBA 1YEZA 1K83B 1ZYRD 5FJ8G 1EY7A 1QZGA 3CXCA 1PH3A 4GNXB 3MZ5A 4JI4Q 3HOZG 4B3ML 5AFWA 1Q1BA 4FF3A 2NN6G 5IY0A 1I4XA 4H7BA 4UP8A 1VQLA 4LFCQ 1IW7C 5FJ8H 1WTPA 3JAML 3HKZG 1R4QB 1CFMA 4X64L 1O80A 1HXYD 3HOZH 1KAAA 1IZ6A 2NN6H 1JOQA 5BR8L 3PUXA 1LTLA 4QF4A 4LF8L 2FMMA 4A3EH 1J9OA 2EJMA 1TWGH 5GAHC 1IBLQ 3I72A 1RIPA 1EQTA 2OTLA 2PO4A 5D65A 5E4XA 3J7YW 1FJGL 3HS0C 1XMQL 1KDCA 4ZAIA 4PZ7A 2NUCA 4C3JB 3HOVG 1SNMA 1EY0A 2CHBD 2F4IA 1N9WA 1X56A 1EWIA 3DLLA 5FLXE 2UXCL 1SNDA 4HAEA 3CCJA 4FXDA 2CWAA 2MPMA 1VQEA 1H9SB 1J6QA 2Y0SE 4K2KA 4DR2Q 1G51A 5C4XH 2AUKA 1W6JA 1CSQA 3I8ZA 1H9MA 4DNTB 1K0SA 3NENA 4KJNA 1S40A 4QUFA 2IW3A 2Q8RE 3K57A 1PH6A 1R4PB 5M9OA 2RDGA 4YY3L 1NNXA 1X3PA 1Q7YC 1VQAA 2G9DA 2HCCA 3GV6A 4YCVA 1PHJA 4JI5Q 1MIUA 1PYSB 3P75A 2VY3A 3C1EA 2F0VA 2YV5A 5C44G 4X62Q 3KF8B 4LF5L 5EQ0A 3J80E 2Q2UA 3G6JB 3I4NH 4LMQD 1X3QA 4JOIA 2TMPA 2K01A 2UXBQ 4X3SA 1B53A 4OO1H 1QVGA 1K8GA 2L1BA 2NVYB 4IALA 3TBIB 4FF2A 5EPKA 3EFXD 2JA7G 2X69A 4F88A 5F2DA 1NUCA 3A7LA 1YZ6A 2WACA 3EROA 4P75A 1CHPD 2XIWA 2J4XA 4UDUC 4CJ1B 1TS5A 3M4OH 4YCWA 5C3EB 4KY6A 1MSGA 1YNNC 1F9RA 2JA7H 2GN5A 4OONA 4NXNL 3H3VH 1N33L 4KD3A 1QWYA 4DV7L 3CC2A 2R7FA 1L0YB 4B08A 1EYAA 2ZJPA 3NBHA 3MTSA 1FYCA 3PV0A 2IT1A 5T1GA 3K80C 3DM1A 1V43A 4GS3A 4BY1B 1WCMB 1VMPA 4PZ6A 2PW7A 1TWCH 2Y0SB 1LTSD 2XWBB 3K6OA 1PV4A 2Z6BA 4HJ9A 1HCZA 1STHA 2O4XA 2KENA 4LK1C 2L15A 3TDQA 1LTAD 1MJCA 4A3DH 2O2LD 5ELFA 3S16H 2KCTA 2ES2A 1HR0W 1QG7A 2HIVA 4QB4A 3QG1A 4H13C 3HKZB 2EXZA 4X66L 3J80i 4UP7A 4LUVA 2HQEA 2M00A 1YJWA 2EJFC 1Y1VG 1A63A 1F2YA 3VYSA 1BKBA 1CI3M 1YI2A 2IX3A 4QGUA 4G4KA 4AIMA 5JAVA 3A8JE 5M3MG 3FPUB 3DEOA 1JJCB 1F9SA 1GUOA 2UU9Q 1FVIA 5JPNC 2XRQD 4A3LH 4KHPQ 4OWWB 1VQHA 3HOVB 1GOZA 2XTIA 1KLGD 4WRDA 3A8IE 1Y8PB 2MGSA 3DWAA 2RVLA 5IWAQ 5M5XH 2ZM6L 1QNUA 4EQOA 2P5ZX 3R93A 3DUZA 4NDXA 1PVOA 1EYDA 1UE7A 4ZCKA 4LF6L 1VQFA 2YU9H 2E5LL 5I6WA 1P16A 2E2JH 2D2CC 3R2TA 4LWCA 2MFIA 3BVMA 1V8QA 4OIKA 3RD4A 4I65A 4A3BH 4WORA 1N36Q 2LFNA 4NB3A 1KNEA 1L1OA 2NVXB 5C44B 4A3JH 3S15B 4IPGA 4XYOA 2K75A 4R4CA 2K5VA 2F3IA 1STGA 1SXTA 4MNOA 1EFWA 4ZRZA 2VQFL 1DCZA 4XXEA 4RA8A 4HEDA 4N9TA 1C4QA 3VR2A 4DV2Q 1XPOA 2WV6D 4EX5A 4OEMB 1HTPA 2B2WC 2K5HA 1PYWD 2HIXA 1G6PA 5TSSA 1Q3LA 3E0JA 3J81E 4JV5L 2PNHA 1B3QA 2RDHA 2NVTB 5IOCA 1AE3A 5FKAC 1SROA 2UUBQ 5M5WB 1PZID 4HCSA 5AJ3L 5CBAE 4YHHQ 1VQ8A 3RNUA 1Y8OB 4A75A 1I50B 3V05A 2V1CC 2E2HH 5DM63 2N78A 4B3SL 2OQKA 2JA8G 5FLXc 2VB2X 4OGQC 3AQQA 2ICEC 2K6AA 3F2UA 3OW7A 2LS01 3J80L 2Z4IA 4R4QA 1D6EC 5HGTA 4U673 2K28A 5DM73 4EQ5A 3FEWX 1VQNA 2SOBA 4JI0Q 1Y1VB 1QE6A 5C4ZA 3PO3B 4ME5A 1D5XC 2FJ2A 2F03A 1EZ8A 1KDBA 5M3MB 1EEID 1TT2A 1HNXL 3J80c 4KHVA 1PTOB 2EYOA 2KOLA 1U4LA 5DNFA 3J81i 3KLWA 1MD2D 3NWSA 2WP8J 4GLXA 2A19A 1HNZL 1CZGA 2ALYB 1LTTD 4ILWA 1HQRD 3GV3A 1I4PA 3VDYA 4NXMQ 3G7LA 4R4TA 2JQOA 1SN8A 3GTKB 3J7A5 1L0XB 2XNAC 4FDBA 1UE1A 1MBYA 3GTOB 4AQYQ 1CQVA 2L55A 1RODA 1X65A 3UDXA 4DUZL 3SE0A 2ZT9C 4DR5Q 4R4OA 2K5DA 1JMCA 2EE1A 4AYBG 4JBJA 2KUMA 3WWVA 4OX9L 1C7YA 2IJ0A 2PQEA 1HZ9A 4BY7H 4B3RQ 2JA6H 3VA7A 3S1MB 1PH9A 2EDGA 1BOSA 1VQIA 2KQ3A 1KLUD 1SJHD 3S17H 3WDNA 2I46A 1KTKA 1RDPD 4B9WA 4G7ZC 3ULLA 3MXUA 2WKCA 4M1UB 4DR1Q 1J5EL 4A3FG 1U4MA 3PIP3 2VUMG 1LACA 1AEXA 2N88A 3GTGB 3HFZB 1EY8A 1NTGA 4A3KG 1WVLA 5IT9L 5JEAJ 1KAWA 2OEOA 5D3DA 1CKNA 3BDOA 2K7VA 3AU7A 4A3FH 1BUVT 3MC0B 1YNND 4JI2Q 1AN8A 3PIOA 4GKJQ 2OWOA 3A56A 3NK9A 2YTVA 2AWNA 1IBML 3MXPA 3M85A 3CCEA 4A3KH 1RJTA 1N34Q 1PYBA 2ZXPA 1A0IA 5EPLA 2A69C 1JWMD 3HRZC 1U4RA 4RGOS 2K50A 1U0LA 1YNJC 3ERQA 4NKLA 2JA8B 1BXTA 1RTNA 1K8OA 2QF7A 3T51B 5ELBA 1WTRA 3T1YQ 3HOYB 4RH6A 3RR5A 4P73A 2QEXA 1CZWA 3NBHB 4C2MB 1MHWC 3T13A 4JVZA 4DV4Q 2E2IH 4RGNA 4BA2I 4JCVE 1IBKQ 4IQZA 1VQ5A 5C4JB 2L12A 2F3VA 2RHSB 3MEFA 4XT3B 2B2VA 5KNBA 1XTCD 2L5TA 1HNWQ 1JJ2A 4Y52H 3CPWA 3ND8A 2I0QA 3R3OA 1BBUA 1XNRL 1EZ6A 1CTMA 3E9HA 3NTHA 5T1IA 2C35B 4DK3C 3T53B 3J81L 4F8MA 1ILQA 1I4HA 4PNYA 1GHJA 5CV5A 3SK6A 4DFAA 1VQ7A 1F2MA 1EOTA 2B8FA 1SMXA 1I94Q 1E22A 1Q46A 2B2YC 3FKIH 4DV1Q 4IUVA 2XGTA 4IN3A 4A3MG 1I5FA 2DY7A 3ER0A 2QILA 3L7ZC 4EQPA 3KUPA 1NJIC 1BVSA 1PRTB 4RWSC 2F4VQ 4L5TA 4JI8L 4C3HH 3FRPB 3UI2A 2J0TD 4LF7L 1W6KA 3PF4A 4ALPA 3J81c 2IX1A 4CKBA 3MVVA 4K5XA 3NWTA 4GZYC 1SDFA 3ULJA 4K5VA 3M3YH 1QVCA 4UP9A 4FF1A 3VR6A 1T5EA 3OOCA 1YIJA 2JE6I 1Q86C 2TSSA 4B3TQ 2B2UA 1JE5A 5C3XA 2EPBA 4B9XA 4DR3Q 3C2PA 1L2FA 1KC8C 1ILPA 4A3CH 1A62A 4DGZA 1XWEA 3J7AV 2EY5A 3TP6A 5C5MA 2LXKA 5D3IB 1FR3A 3OTOQ 5ISRA 3FDTA 4PMCA 1Z6HA 5BN5A 3ICEA 3H94A 3IL8A 2I5HA 1YNXA 2E8GA 3MXGA 1LT5D 2RHQB 2CH4A 3CCRA 2VUMB 3E3XA 3CQZH 1H9KA 2F0IA 4X3TA 1L1OB 1CQFA 2JK8A 2Z6KA 1JE4A 2WAQE 3OMGA 1PFSA 3CRLC 3FHWA 1HPCA 5A2QL 3NE5B 1EQQA 2NB0A 3ZYYX 3AB9A 3W1GA 4JOIC 2ZJRA 1TVXA 3L2PA 3U9OA 1MI2A 4APVA 1SFOB 1ET9A 2EY2A 4R8IA 1ONLA 4X6AH 2EQSA 4A76A 2D9UA 1CUKA 4KK7A 2CW0C 1EY4A 5C0XG 2JA5B 2WIIB 1DZ1A 1SSOA 2N49A 4DR7Q 3BVGA 3I7FA 5I2XA 4MN3A 2F0MA 4BA1I 4C3IG 5C0XH 4XQNA 1VQBA 5IE8A 4KY7A 1V9PA 2QA4A 3GTQH 1TWFB 1EOVA 4CJ2C 4JI4L 3OIQA 2CVRA 2H1EA 3H15A 3BJUA 5EBCA 1D1KA 3BZKA 3M4PA 4JYAQ 1GKHA 4OHJA 4C3IH 3S1RB 2BE5C 2JXMB 2VXWA 3F2BA 1CT1D 1EFID 4N8X1 3C3LA 2AWOA 4IURA 4TRDA 3OMCA 2WAQB 5HURA 3OSOA 4FF4A 4BS9A 2AKWB 3OWFA 3H6MA 5C3EH 3GD7A 1A8VA 4A3MB 1IBLL 4A3EG 2R92B 1SE3A 1LO5D 3U50C 2F0PA 1IYJB 3RLFA 4UAIA 4DAVA 2F3WA 3H91A 5FO8B 3CPFA 4HCEA 1B8AA 4XQJA 4FXKC 3SVMA 4A93B 1WYDA 2PYKA 4DV5Q 2MHVA 4RAUC 2E2DC 2OTJA 2NZ1D 4DR2L 3EBEA 3B6YA 4MHEA 3KJOA 4M8AA 5C4XG 3S24A 3S1QB 1TWAH 5CV7A 1QCBD 4FO2A 2G9HD 2BH8A 4LFAQ 1YHAA 2QEJC 1GVPA 4ME3A 4JI5L 4LW1A 1GUTA 4X64Q 5KNCA 3GTLB 4X62L 1IYVA 1ZEQX 5L37A 3K5MA 3I4NG 3HOUB 5HGQA 1WTVA 4LF8Q 5GQOA 4OO1G 4HSPA 1FNWA 3NUCA 1ML0D 4ZKCB 4BBRB 4RKBA 1WD0A 4GKKQ 3HKZE 1STNA 3OHXC 5E4WC 2LKVA 4DV6L 1UUPA 1BNZA 1XXGA 2UXDQ 2L11A 1KABA 4XTCS 2AQ3B 4J1MA 5IIFA 5CMDA 2UXCQ 3BG3A 3HOXG 2HHHQ 4FYDA 2DN8A 3EQLC 2A69D 3GTJB 1HR0L 1VQ9A 2KCCA 3S2HH 3AEVA 1CKNB 1YNJD 3FPPA 1G291 1K8MA 2NVQH 5IYBH 3RLNA 2FMCA 3LX0A 1VQ4A 1BR9A 3HOXH 1XPUA 4DPGA 3NQTA 2HDMA 4YY3Q 1CA5A 4J8QA 5I4DA 1DXMA 5GROA 4A3DG 4Q0FA 2F0UA 2R93H 4LF5Q 3LGJA 4L63B 4L8JA 4EVOA 1DJRD 3PCOB 1WD1A 4X3KA 3AFQA 4O42A 3KJPA 3LNNA 3W2DA 4Y7NH 5CV4A 3I73A 3HOZB 2I07B 4GNXC 1N32Q 1I6HH 3DM3A 5CORA 5IGBA 1QZHA 3NTIA 3BDCA 2Z4HA 4A3EB 1LTBD 1TWGB 1MKHA 3HKSA 3SHLA 1VQDA 2MQHA 4X65L 1FGBD 3A0JA 3SXHA 1EL0A 2R7ZH 2UU9L 1PH7A 1XMOQ 3I4MG 1CHQD 4XIGS 5ELDA 4KHPL 1Y14B 4BBSH 1S72A 2NBFA 4A3LG 4A3GG 2R6GA 2PW5A 3S1NH 1JOKA 1V1PA 1O78A 3CD6A 3IFTA 3F1ZA 4GOPB 5IWAL 1RHPA 3WOFA 2WB1G 4JI7L 4I7AA 3KFUA 3I4MH 1HA5A 3MFYA 2DNCA 1S4ZA 4A3GH 5J3BA 1MSHA 3U4VA 3C46A 2BDOA 5C4XB 4DV0Q 2NN6I 2DNEA 1VQGA 1E7ZA 2A73B 1B3AA 1TS4A 1UWVA 3X3NA 1SYGA 1UEBA 4RHRA 2F0FA 4P74A 5M5YH 2VW9A 1N36L 5K36H 4X66Q 2WKDA 4A3BG 1AP0A 2BOSA 2Q2IA 2A6EC 5LL6S 1ET6A 2MO0A 3T1HL 4NPSA 4PG3A 3VR4A 4A3JG 3I4NB 1I3QH 1ICWA 4G57A 4DXFA 5D14A 3NPPA 3KK7A 2OF1A 1CSPA 1EQVA 1SYBA 4HIMA 1LT6D 4DV3Q 1CK1A 1H9JA 1YJNA 3F2DA 5DAUA 2QW7A 3M4OB 4RGTA 2IL8A 2EZVA 2A8VA 3K5NA 3VR5A 3NBIA 3GO5A 1GXDC 1BO0A 1BCPD 1Z7TA 2JA7B 3EVQA 1PFNA 2NYZD 1G91A 3DHQA 3MAQA 5CV6A 2UUBL 2CCZA 3HZXA 1AW7A 1QB5D 1T5XD 4RG1A 2CW0D 4YHHL 2E5LQ 2PQAB 3TEHB 5LMUQ 2GVBA 1TWCB 3HP3A 1EWHA 5FLXL 4TKOB 1K28A 4Z9CB 2ZJQA 5E3FA 4IFDG 3S14H 1F9QA 4AH6A 4LFBQ 3W5OA 2B63G 4A3DB 1RKNA 2JEBI 3S16B 2EOTA 3CCQA 3IAYA 2B2TC 1U5KA 2IHEA 3K5LA 2J7ZA 3PGZA 1Y8NB 3TRZA 4DA2A 1XTDA 2KCNA
chains in the Genus database with same CATH topology
2QW7A 4I7AA 2RCFA 4JVZA 4N8FA 2HD3A 4N8X1 4JW0A 5L37A 2Z9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QW7 A;  4I7A A;  2RCF A;  4JVZ A;  4N8F A;  2HD3 A;  4N8X 1;  4JW0 A;  5L37 A;  2Z9H A; 
#chains in the Genus database with same CATH topology
 4IFD H;  1ENA A;  1SE4 A;  3S9W A;  4IOA A;  2BE5 D;  4UHV A;  2F0N A;  2B63 H;  2QGQ A;  2OXP A;  4JI0 L;  2XVS A;  4RMF A;  2H4O A;  1D5M C;  1F2L A;  4LF9 Q;  3BZD B;  4CJ0 B;  1JQY D;  4QJF A;  2B2V C;  5FK9 C;  5C4H A;  5IYC G;  4KKU A;  2RA4 A;  4NW2 A;  1Y1W G;  2VL6 A;  4A3I H;  1IW7 D;  2B39 A;  2BA1 A;  4G7O C;  5JJI A;  3SK8 A;  5FOB B;  3K7U C;  4MTN A;  4HID A;  5JJZ A;  5IOD A;  3CCV A;  5IYC H;  2D0P A;  5E7N A;  1Y1W H;  3PUW A;  2D62 A;  4NMZ A;  1ICF B;  2EYP A;  1MJE A;  5FLM G;  1XJV A;  5M5X B;  4AQY L;  1EU3 A;  3VYT A;  1C9O A;  4DR5 L;  3TP7 A;  2JN4 A;  4OXP A;  1KRS A;  4IJL A;  2MNA A;  5KYI A;  1C8C A;  4OIJ A;  2KEC A;  2YU9 B;  2AQ2 B;  4P72 A;  2E2J B;  5IGD A;  5FLM H;  1B44 D;  2JYO A;  3I70 A;  2A74 C;  1SEB D;  4O1N A;  4B3R L;  4A3B B;  5KEE A;  1OXU A;  4BY7 G;  2F0G A;  4A3J B;  2JA6 G;  2H5X A;  4J15 A;  3X3M A;  4R8N A;  4CDC C;  3HOW G;  4MIU A;  4L5Q A;  1Q81 C;  3A54 A;  3Q24 A;  4O2D A;  1HH2 P;  3PQI A;  1HNX Q;  3KLS A;  4K2L A;  4DR1 L;  1TY2 A;  1R9T H;  1VF5 C;  1QIL A;  4FP5 D;  3UE1 A;  1IXR A;  2I5M X;  2F0S A;  5A35 A;  2DJG C;  1K8A C;  1D7Q A;  2G5D A;  3HOW H;  1HNZ Q;  1JWU D;  1S3O A;  3PO2 G;  4ZK9 B;  4DU9 A;  4L6T B;  3FP9 A;  1E3P A;  1TKW B;  1EIH A;  2CQO A;  4JI2 L;  4GKJ L;  2VQE Q;  2NWG A;  4N8F A;  2EYM A;  3BYT B;  4KKS A;  1G6Z A;  5CGK A;  5ELN A;  2AMC B;  1NR2 A;  4YWK A;  3PO2 H;  5C5L A;  1KXL A;  5JPM C;  3E5S A;  4HJ8 A;  4KJO A;  2Q2T A;  2N3S A;  3GTM H;  2UUA Q;  2KED A;  4OX9 Q;  3ND9 A;  1ENF A;  2E2H B;  2PZT A;  5LMN Q;  3H0G G;  5CR3 A;  3CC4 A;  1TWH H;  1VDZ A;  2CH4 W;  3BS1 A;  3A5U A;  2F0E A;  3KDF A;  2B8G A;  1II3 A;  3H0G H;  4AYB E;  2B2W A;  1OXX K;  1SYF A;  1UE6 A;  4GN5 A;  1H95 A;  5CYU A;  1QJO A;  4ZUJ A;  2ENB A;  1BCP B;  1SBB B;  1J5E Q;  3P20 A;  1JC7 A;  1JJG A;  5IP7 H;  1ENC A;  3JAM E;  3RZD H;  3RZO H;  1WTO A;  1WI5 A;  3IRB A;  3OYY A;  2RDF A;  2BH2 A;  1Q8K A;  1DOM A;  3M9B A;  4V0B A;  5M3F H;  1I94 L;  1RD9 D;  2KHS A;  4DV1 L;  3DMU A;  1EY9 A;  3FKI G;  4CHT B;  2F0Q A;  5J22 A;  2RCN A;  3QWN A;  1RCV D;  3TZU A;  3AMU A;  1IYU A;  2F4V L;  3K7A H;  4C1N K;  1NMF A;  4XYQ A;  4KLK A;  4QUC A;  2A5H A;  1PTO C;  4C3H G;  4EGV A;  2QDB A;  1M8A A;  1TS3 A;  1EYC A;  2RCF A;  5ELO A;  4K0K Q;  1Q1E A;  2PZU A;  4GOP A;  5J1Z A;  3S2D H;  2BA0 A;  2K05 A;  2K14 A;  1PDQ A;  3GTP H;  5KGU A;  1VQO A;  3RN5 A;  1FNU A;  1E2W A;  3M7G A;  1B2T A;  1V1P B;  3V2T A;  3CHB D;  1PZK D;  4B3T L;  1B1Z A;  1VQM A;  2B29 A;  3CCS A;  4BY7 B;  2LY7 A;  3RUZ A;  1J8I A;  1LAB A;  3FMC A;  4JI3 Q;  1VQP A;  2JA6 B;  1PTO F;  4A3C G;  1D5Z C;  3A55 A;  4AYB B;  3CW2 C;  1BBX C;  1FD7 D;  2IPK D;  3M4Y A;  3CC7 A;  2YTY A;  1E1O A;  3IKJ A;  1WFQ A;  5GAG C;  3S17 B;  1K83 H;  4FXG C;  2NTT A;  1B9M A;  3U58 A;  1S5F D;  2PCF B;  1DON A;  2ICI A;  5GAE C;  4K8J A;  4DXG A;  2JJQ A;  3KLS X;  1GUW A;  4GN4 B;  1F9P A;  1HJP A;  3C1F A;  4IJH A;  4KV6 A;  3UE0 A;  5COY A;  4MZ9 A;  3NTK A;  1GHK A;  1TII D;  2VZA A;  3QJY A;  1UAP A;  3AYH B;  4A3F B;  5IP9 H;  1LLR D;  1A3U A;  2DUD A;  3A74 A;  3D6C A;  1A2U A;  3BDL A;  1ESF A;  4JBK A;  2HQL A;  2FHT A;  2E76 C;  3KF6 A;  4N9P A;  4C3J G;  2EXD A;  1K9M C;  4A3K B;  2F0K A;  4OWX B;  1NCV A;  1GUN A;  5IYD G;  2OCE A;  3GP7 A;  1NBW A;  3MA2 B;  2VNU D;  2ZTE A;  2AQ1 B;  2IX0 A;  1D1I A;  1HFN A;  2PQA A;  4DNR B;  1K73 C;  4DR7 L;  4LF4 Q;  4C3J H;  5CV9 A;  3CP0 A;  1S5C D;  4E6I A;  5IYD H;  1OO9 B;  1GUG A;  2E2I B;  4Q5V A;  1HTL D;  2ZXR A;  3LWE A;  5EKK A;  3KBG A;  3CF5 A;  1G2T A;  5C6A A;  5JVH 3;  2Z8L A;  1A15 A;  1SAP A;  2ID0 A;  3KYH C;  5JOB A;  1U4P A;  1PFM A;  4IO9 A;  2L9H A;  2ATW A;  4JI1 Q;  4JYA L;  1E24 A;  1K3B C;  4DUY Q;  1PZJ D;  4DR6 Q;  1VQJ A;  1ASY A;  1SNQ A;  1XPR A;  3GQB A;  4YWM A;  2R3Z A;  1K0R A;  5H1S E;  3K59 A;  4RGM A;  3TSS A;  4LFC L;  1KD1 C;  3FKI B;  1QUQ A;  4R9W A;  5C3E G;  4LJZ C;  2NVY H;  1PXU A;  1QOH A;  3J7Z C;  4RCN A;  1I4Q A;  3PSI A;  5G3L F;  3VR3 A;  4C3H B;  4DAM A;  3UDG A;  3SK4 A;  3TS2 A;  2MJ8 A;  4JI6 Q;  1SNO A;  1OTC A;  1EIG A;  3WOE A;  1RF2 D;  2EY1 A;  4KHZ A;  1WCM G;  5J39 A;  3M3Y B;  1XNQ Q;  1PRT C;  1SNP A;  4POF A;  1PH1 A;  3SGI A;  1I6V C;  1JOO A;  1IL8 A;  4QMG A;  1HUM A;  4QIW B;  5EPJ A;  4BY1 H;  1X55 A;  1WCM H;  4DR4 Q;  3I91 A;  4NP5 A;  1LT3 D;  3DWQ A;  3CU7 A;  2UUC Q;  4LFA L;  4J6H A;  2B2Y A;  2C9O A;  3BU2 A;  2F0T A;  3QOL A;  2KBN A;  4TQU S;  1PRT F;  2ASB A;  4XT1 B;  3VA5 A;  4X3U A;  3CQZ B;  2QKI C;  3HG9 A;  3KBX A;  4B3M Q;  2A68 C;  1B9N A;  4JBM A;  3NEM A;  2VB3 X;  3STB C;  4HMI A;  1ZXT A;  1X3F A;  4LUO A;  3Q8D A;  1YIT A;  2BDN A;  2PMZ E;  4GKK L;  4IPC A;  3JAM c;  3A5Z B;  3DXJ C;  1PA6 A;  2UXB L;  1EU4 A;  1HZA A;  1STY A;  3NSW A;  5GAD C;  5BR8 Q;  2UXD L;  1DOL A;  3E6Z X;  5LHY 1;  1EWC A;  1F77 A;  1L1O C;  1E2V A;  3NQI A;  2RQX A;  4C56 C;  3L3O C;  5IGF A;  1YJ9 A;  1TQO A;  2HHH L;  1OXT A;  3V96 A;  4XQQ A;  4P2C B;  4HIK A;  1SE2 A;  1FJG Q;  5EBD A;  3HOV H;  1XMQ Q;  1GUS A;  2HUG A;  3TME A;  3G71 A;  5KND A;  5IYB G;  2RF4 A;  5IGC A;  1A6X A;  3ONA B;  4DN4 M;  4PMW A;  2LMC B;  3GTQ B;  4WJW A;  5EJW A;  2KJX A;  1LUZ A;  5JEA G;  5BN3 A;  4CKC A;  2R93 G;  3G6E A;  4C3I B;  4CGY B;  3HGB A;  2NVX H;  3SK5 A;  5C44 H;  3Q22 A;  1S5D D;  3KDF B;  3S15 H;  5JEA H;  1N32 L;  1KHI A;  3OIP A;  1IL2 A;  3G4S A;  4DV6 Q;  4TVA B;  2EYF A;  3QIA A;  1NAP A;  1JIC A;  2PMZ B;  4YIJ A;  1NR4 A;  3VYR A;  2LXJ A;  4F7X A;  4OL7 A;  2SEB D;  1TU2 B;  4DK0 A;  1WTX A;  3GDE A;  1A2T A;  3CAM A;  3J81 j;  5C0X I;  1XMO L;  3NXW A;  3QB3 A;  2R7Z G;  2JSO A;  2A1A A;  1SMY C;  2XRS D;  3W3A A;  1L0W A;  4DAY A;  1HR0 Q;  4BBS G;  1PLF A;  5K5P A;  1PTO D;  1C0A A;  2SDF A;  3VYU A;  3ITP A;  2LSS A;  2D5D A;  1AZP A;  2N55 A;  1HUN A;  4NXN Q;  1N33 Q;  4DV7 Q;  2B3G A;  1E1T A;  2NVT H;  5KRU A;  5ELE A;  4S3S A;  2KEE A;  5ELC A;  3TP5 A;  1MGS A;  1P8L A;  5M5W H;  4O0A A;  5JVG 3;  4DV0 L;  4KMU C;  3L9A X;  4HSV A;  2HD3 A;  1T9H A;  4JW0 A;  3RMH A;  3T4A C;  1Y69 U;  2VS1 A;  3BZC A;  1TWA B;  1CA6 A;  3MFG A;  2K03 A;  4IPD A;  3W1B A;  1I50 H;  1DM0 B;  2FIN B;  2K1B A;  2L4N A;  3R8B A;  1G2S A;  3D0F A;  5K36 G;  2Z0S A;  3ZJY C;  3D8G A;  1PMR A;  2F0O A;  3MHB A;  3J7A F;  3D4R A;  3ULP A;  3PO3 G;  1YHQ A;  1HHV A;  1SLJ A;  1BBW A;  3RN2 A;  2A6H C;  4JG2 A;  1I4R A;  4DV3 L;  4PZ8 A;  4KN7 C;  4X65 Q;  2O5J C;  4UY8 C;  3UDI A;  2M9V A;  2IY5 B;  2WFW A;  1Y1V H;  2V4D A;  3TN2 A;  3PO3 H;  3OWE B;  2NZO A;  1STA A;  3D3R A;  1M1K C;  5FO9 B;  3LWU A;  5M3M H;  5IT9 E;  1QVF A;  1EY5 A;  1H9R A;  1TXY A;  1PTO H;  4OEL B;  3K0Y A;  1M90 C;  2SNM A;  4IUP A;  4JI7 Q;  4ZKB B;  4DV2 L;  4LNQ A;  1RL2 A;  1VQ6 A;  4GLA C;  3S2H B;  4HN7 A;  1EIY B;  5I6Y A;  1SR3 A;  2SNS A;  4KTA A;  5HY6 A;  4DKA C;  3K58 A;  2NVQ B;  3Q0A A;  5LMU L;  2Q8I B;  2O5I C;  4HJA A;  1LTI D;  2I5L X;  3GTK H;  2BCO A;  2EY6 A;  3HOX B;  4XDX A;  1B7Y B;  3KF6 B;  2RSN A;  2DGY A;  1HQM C;  4UPA A;  3GTO H;  1NMG A;  2ZM6 Q;  4KKT A;  2KHJ A;  4LUZ A;  4U68 A;  3G48 A;  4LFB L;  2WB1 E;  4QY7 A;  1KL9 A;  4K14 A;  2F0D A;  5CC4 A;  4LF6 Q;  2F0L A;  3T1H Q;  2R93 B;  1KNA A;  1FGU A;  2K52 A;  3PIP A;  1X54 A;  3PMF A;  3I90 A;  1IKM A;  2OT2 A;  4OO1 I;  4H44 C;  4DAP A;  3MXN A;  5KYL A;  4ZUI A;  4HJ7 A;  1K3R A;  5NUC A;  4ID6 A;  1O7Z A;  5G3L D;  2PPB C;  1SYE A;  2DJF C;  1LM0 A;  3D4D A;  2CKZ B;  3S1M H;  4Y7N B;  4HR7 B;  1SNC A;  2EIF A;  4LF9 L;  2K33 A;  2AHO B;  1I6H B;  5C0X J;  1GM5 A;  1AFP A;  1WTW A;  1DYQ A;  1EQR A;  2HT1 A;  3CKI B;  1UE5 A;  2VQF Q;  1WTQ A;  1GO3 E;  3H3V I;  4ZLT F;  1NY4 A;  2R7Z B;  4A3I G;  4L5S A;  3EA6 A;  1CKO A;  4IUU A;  3GTG H;  3DEP A;  1AZQ A;  4BBS B;  1B50 A;  1KQS A;  4DF7 A;  1XX8 A;  4PV1 C;  3S1N B;  4KY5 A;  3H09 A;  1JB7 A;  4HTH A;  4CDD C;  4K6L A;  4QCL A;  1QUQ B;  1JCK B;  4QL5 A;  2K32 A;  1AH9 A;  3CCM A;  4JV5 Q;  3BVZ A;  3I4M B;  2EVB A;  2K4K A;  4DNI A;  1Q8I A;  1LV9 A;  1ESR A;  3MEH A;  1PRT D;  2EYH A;  5KIX A;  4A3G B;  1GJX A;  3HOY G;  3L0O A;  3U4Z A;  1A3T A;  1HA6 A;  5AJ3 Q;  1QNK A;  4HIO A;  1N8R C;  4NXM L;  2OQ0 A;  5CV8 A;  4CDE C;  2CWP A;  2K04 A;  2WB1 B;  3TP8 A;  4P71 A;  4GNX A;  4LAA A;  1OXV A;  4GOP C;  1DOK A;  2NTS A;  1SE8 A;  5M5Y B;  2JA8 H;  2F0W A;  1SYC A;  5IGG A;  3HOY H;  1W2B A;  1STB A;  4B3S Q;  1LTG D;  1X3G A;  4HMJ A;  3F2C A;  3URY A;  4C2M H;  1ZYR C;  2GA4 B;  4CBV A;  1Z47 A;  2EYJ A;  4PMB A;  1I3Q B;  1CM9 A;  4K5W A;  1WJJ A;  3ERS X;  2F52 A;  5C4J H;  3K0X A;  2A68 D;  2GVA A;  2PI2 A;  3CRK C;  2JA9 A;  2XN9 C;  4RKL A;  3STB D;  1JOR A;  1E0B A;  1X3E A;  1YVC A;  4IUN A;  2KCM A;  4EQN A;  5CBE E;  2B2U C;  2YTX A;  1PH4 A;  2K5Q A;  5A2Q E;  4WJ4 A;  1DGS A;  3U9S A;  4RHS A;  3PF5 A;  3RLO A;  4ZQ3 A;  2R7D A;  3KLR A;  3A7A B;  3DWP A;  2VQE L;  2QDL A;  5DLQ E;  2NZH A;  1CKM A;  5C3W A;  2PNR C;  1JR0 D;  5I2Y A;  2MP1 A;  4HJ5 A;  1G8Z D;  4A4I A;  4IUQ A;  2Z1C A;  3E0E A;  3D31 A;  2CQA A;  1D8L A;  1H9S A;  2UUA L;  4C1N I;  5JJK A;  1EUJ A;  1VCI A;  4CKE A;  3FVQ A;  3I2Z A;  1KIX A;  1AE2 A;  5LMN L;  2Z6K C;  3H3V C;  3E9I A;  1JT8 A;  1O7I A;  3S14 B;  1A3V A;  1VMC A;  4KI0 A;  4DUZ Q;  2EYL A;  4IPH A;  3NHH A;  4MTK A;  1N34 L;  1EEF D;  2F0J A;  1ZKO A;  1KRT A;  1IHZ A;  2Z9H A;  4RCO A;  1GD7 A;  3TS0 A;  1EYG A;  3NEL A;  3KF8 A;  4G7H C;  2PZW A;  3NP8 A;  3K5O A;  3T1Y L;  3AFP A;  5EAY A;  2B63 B;  4F87 A;  3SR1 A;  2XSC A;  4DV4 L;  3N52 A;  3SDZ A;  5IP7 G;  2X6G A;  3EN2 A;  1IBK L;  3I55 A;  3CCU A;  2IWH A;  1DD2 A;  1M4V A;  1HNW L;  2K5N A;  4A3I B;  1LT4 D;  3D6W A;  4KN4 C;  4I7Z C;  3TRE A;  2N8N A;  4JK1 C;  5I9P A;  2VUM H;  1HRJ A;  5LMN W;  5EKI A;  1F2Z A;  3EIV A;  4BWG B;  5M3F G;  2D0O A;  2ZTD A;  1SMY D;  3CMA A;  1NE3 A;  3PUY A;  1Y1W B;  1JWS D;  1V1O A;  4IFD I;  4JC0 A;  2B2T A;  1SRU A;  4GN3 B;  4K0K L;  1SYD A;  5IT9 c;  4YCU A;  2YYZ A;  1STE A;  2JA5 G;  1O7L A;  2ZXO A;  3EJI A;  1SFO H;  3M7N A;  1IBM Q;  1XYI A;  3JC6 6;  1YBY A;  2KA7 A;  4DAY B;  2X6L A;  1VF7 A;  1OXS C;  1WTH A;  1W3S A;  3PUZ A;  1S5B D;  1TS2 A;  2XWJ B;  4JBW A;  2AUJ D;  1BDO A;  4H02 A;  1KDA A;  2JA5 H;  3P7J A;  3N6R A;  1PH2 A;  4JI3 L;  3IFD A;  3TQY A;  4RFB A;  3QO2 A;  5IGE A;  1Z9F A;  3QR8 A;  4QQB X;  1WOC A;  3UDF A;  5BN4 A;  4DR3 L;  1TR5 A;  1TWF H;  2IHF A;  1R9T B;  1HZB A;  2A6H D;  2WAQ G;  1HZC A;  1RTO A;  3A8K E;  3OPO A;  5I9O A;  1NSN S;  2DY8 A;  4L5R C;  3S1R H;  2A6E D;  3OTO L;  4OWT B;  3OW2 A;  3HOW B;  2HDL A;  1Q82 C;  1XNR Q;  5FO7 B;  2RKS A;  1EIF A;  4GLV B;  3K81 C;  2R92 G;  2K5W A;  4K6D A;  1ASZ A;  2HCI A;  3JAM i;  3BYY B;  2KVM A;  1LTR D;  1UNS A;  5IP9 G;  2Q8T A;  4A3M H;  1V1Q A;  3PO2 B;  3PUV A;  1HFG A;  2R92 H;  4TSS A;  1EY6 A;  2FXQ A;  3P1H A;  1FNV A;  4BXX G;  4A93 G;  1TY0 A;  3GTM B;  1VQC A;  3MWY W;  1E2Z A;  2R61 A;  4YWL A;  4JI8 Q;  4LF7 Q;  3T56 B;  4WJ3 M;  4LF4 L;  4FVM A;  3I4O A;  4IZ8 A;  1TWH B;  2QCP X;  3D4W A;  2RBM A;  4BXX H;  4A93 H;  1VS0 A;  1D2B A;  1FL0 A;  2ZTC A;  3R2I A;  5DEH A;  4ABN A;  2F0H A;  3F8T A;  5JJL A;  2CFM A;  2E75 C;  4R1J A;  2FFK B;  3T16 A;  4WFN 3;  1PH5 A;  2F1M A;  3H0G B;  1BQQ T;  2KHI A;  4K8I A;  4ZYS A;  4JI1 L;  4DUY L;  3S1Q H;  4DR6 L;  3K8A A;  4DK1 A;  4QIW E;  3HOU G;  4FNF A;  4R4I A;  1BF4 A;  4ULL A;  1X32 A;  5E1F A;  3PIO 3;  3KOJ A;  5EKL A;  3RZD B;  3RZO B;  1B4O A;  1C48 A;  3MXN B;  3GTL H;  1I4G A;  1X6O A;  4BBR G;  3HEJ A;  4POG A;  2MUY A;  5M3F B;  3I3C A;  1B70 B;  2WIN B;  3HOU H;  1UEA B;  3I4L A;  1BCP C;  4IFD J;  2MO1 A;  4DK6 C;  1U9R A;  3Q6S A;  2JP1 A;  3Q23 A;  1SJE D;  1X9N A;  2JEA I;  3K7A B;  4IOC A;  4ODG A;  3I56 A;  1Q12 A;  2PI2 E;  1IKL A;  4BBR H;  3CCL A;  1VQK A;  3QOJ A;  1PH8 A;  4IUT A;  1S5E D;  4JI6 L;  4CDF C;  1Q90 A;  3TZD A;  4H0L C;  2L0C A;  5LL6 X;  1JB3 A;  3SEB A;  3S2D B;  1O7Y A;  3GTP B;  2RSO A;  4JPB W;  1XNQ L;  1BCP F;  2M2L A;  1LYL A;  2C5C A;  3O13 A;  4KD4 A;  3GTJ H;  3M4Q A;  5EGT A;  4V19 0;  4DR4 L;  3CME A;  4PQX A;  4BY1 G;  2E74 C;  1YHB A;  2UUC L;  2Y0S G;  2EJG C;  2Q2H A;  4DV5 L;  1PFB A;  1YEZ A;  1K83 B;  1ZYR D;  5FJ8 G;  1EY7 A;  1QZG A;  3CXC A;  1PH3 A;  4GNX B;  3MZ5 A;  4JI4 Q;  3HOZ G;  4B3M L;  5AFW A;  1Q1B A;  4FF3 A;  2NN6 G;  5IY0 A;  1I4X A;  4H7B A;  4UP8 A;  1VQL A;  4LFC Q;  1IW7 C;  5FJ8 H;  1WTP A;  3JAM L;  3HKZ G;  1R4Q B;  1CFM A;  4X64 L;  1O80 A;  1HXY D;  3HOZ H;  1KAA A;  1IZ6 A;  2NN6 H;  1JOQ A;  5BR8 L;  3PUX A;  1LTL A;  4QF4 A;  4LF8 L;  2FMM A;  4A3E H;  1J9O A;  2EJM A;  1TWG H;  5GAH C;  1IBL Q;  3I72 A;  1RIP A;  1EQT A;  2OTL A;  2PO4 A;  5D65 A;  5E4X A;  3J7Y W;  1FJG L;  3HS0 C;  1XMQ L;  1KDC A;  4ZAI A;  4PZ7 A;  2NUC A;  4C3J B;  3HOV G;  1SNM A;  1EY0 A;  2CHB D;  2F4I A;  1N9W A;  1X56 A;  1EWI A;  3DLL A;  5FLX E;  2UXC L;  1SND A;  4HAE A;  3CCJ A;  4FXD A;  2CWA A;  2MPM A;  1VQE A;  1H9S B;  1J6Q A;  2Y0S E;  4K2K A;  4DR2 Q;  1G51 A;  5C4X H;  2AUK A;  1W6J A;  1CSQ A;  3I8Z A;  1H9M A;  4DNT B;  1K0S A;  3NEN A;  4KJN A;  1S40 A;  4QUF A;  2IW3 A;  2Q8R E;  3K57 A;  1PH6 A;  1R4P B;  5M9O A;  2RDG A;  4YY3 L;  1NNX A;  1X3P A;  1Q7Y C;  1VQA A;  2G9D A;  2HCC A;  3GV6 A;  4YCV A;  1PHJ A;  4JI5 Q;  1MIU A;  1PYS B;  3P75 A;  2VY3 A;  3C1E A;  2F0V A;  2YV5 A;  5C44 G;  4X62 Q;  3KF8 B;  4LF5 L;  5EQ0 A;  3J80 E;  2Q2U A;  3G6J B;  3I4N H;  4LMQ D;  1X3Q A;  4JOI A;  2TMP A;  2K01 A;  2UXB Q;  4X3S A;  1B53 A;  4OO1 H;  1QVG A;  1K8G A;  2L1B A;  2NVY B;  4IAL A;  3TBI B;  4FF2 A;  5EPK A;  3EFX D;  2JA7 G;  2X69 A;  4F88 A;  5F2D A;  1NUC A;  3A7L A;  1YZ6 A;  2WAC A;  3ERO A;  4P75 A;  1CHP D;  2XIW A;  2J4X A;  4UDU C;  4CJ1 B;  1TS5 A;  3M4O H;  4YCW A;  5C3E B;  4KY6 A;  1MSG A;  1YNN C;  1F9R A;  2JA7 H;  2GN5 A;  4OON A;  4NXN L;  3H3V H;  1N33 L;  4KD3 A;  1QWY A;  4DV7 L;  3CC2 A;  2R7F A;  1L0Y B;  4B08 A;  1EYA A;  2ZJP A;  3NBH A;  3MTS A;  1FYC A;  3PV0 A;  2IT1 A;  5T1G A;  3K80 C;  3DM1 A;  1V43 A;  4GS3 A;  4BY1 B;  1WCM B;  1VMP A;  4PZ6 A;  2PW7 A;  1TWC H;  2Y0S B;  1LTS D;  2XWB B;  3K6O A;  1PV4 A;  2Z6B A;  4HJ9 A;  1HCZ A;  1STH A;  2O4X A;  2KEN A;  4LK1 C;  2L15 A;  3TDQ A;  1LTA D;  1MJC A;  4A3D H;  2O2L D;  5ELF A;  3S16 H;  2KCT A;  2ES2 A;  1HR0 W;  1QG7 A;  2HIV A;  4QB4 A;  3QG1 A;  4H13 C;  3HKZ B;  2EXZ A;  4X66 L;  3J80 i;  4UP7 A;  4LUV A;  2HQE A;  2M00 A;  1YJW A;  2EJF C;  1Y1V G;  1A63 A;  1F2Y A;  3VYS A;  1BKB A;  1CI3 M;  1YI2 A;  2IX3 A;  4QGU A;  4G4K A;  4AIM A;  5JAV A;  3A8J E;  5M3M G;  3FPU B;  3DEO A;  1JJC B;  1F9S A;  1GUO A;  2UU9 Q;  1FVI A;  5JPN C;  2XRQ D;  4A3L H;  4KHP Q;  4OWW B;  1VQH A;  3HOV B;  1GOZ A;  2XTI A;  1KLG D;  4WRD A;  3A8I E;  1Y8P B;  2MGS A;  3DWA A;  2RVL A;  5IWA Q;  5M5X H;  2ZM6 L;  1QNU A;  4EQO A;  2P5Z X;  3R93 A;  3DUZ A;  4NDX A;  1PVO A;  1EYD A;  1UE7 A;  4ZCK A;  4LF6 L;  1VQF A;  2YU9 H;  2E5L L;  5I6W A;  1P16 A;  2E2J H;  2D2C C;  3R2T A;  4LWC A;  2MFI A;  3BVM A;  1V8Q A;  4OIK A;  3RD4 A;  4I65 A;  4A3B H;  4WOR A;  1N36 Q;  2LFN A;  4NB3 A;  1KNE A;  1L1O A;  2NVX B;  5C44 B;  4A3J H;  3S15 B;  4IPG A;  4XYO A;  2K75 A;  4R4C A;  2K5V A;  2F3I A;  1STG A;  1SXT A;  4MNO A;  1EFW A;  4ZRZ A;  2VQF L;  1DCZ A;  4XXE A;  4RA8 A;  4HED A;  4N9T A;  1C4Q A;  3VR2 A;  4DV2 Q;  1XPO A;  2WV6 D;  4EX5 A;  4OEM B;  1HTP A;  2B2W C;  2K5H A;  1PYW D;  2HIX A;  1G6P A;  5TSS A;  1Q3L A;  3E0J A;  3J81 E;  4JV5 L;  2PNH A;  1B3Q A;  2RDH A;  2NVT B;  5IOC A;  1AE3 A;  5FKA C;  1SRO A;  2UUB Q;  5M5W B;  1PZI D;  4HCS A;  5AJ3 L;  5CBA E;  4YHH Q;  1VQ8 A;  3RNU A;  1Y8O B;  4A75 A;  1I50 B;  3V05 A;  2V1C C;  2E2H H;  5DM6 3;  2N78 A;  4B3S L;  2OQK A;  2JA8 G;  5FLX c;  2VB2 X;  4OGQ C;  3AQQ A;  2ICE C;  2K6A A;  3F2U A;  3OW7 A;  2LS0 1;  3J80 L;  2Z4I A;  4R4Q A;  1D6E C;  5HGT A;  4U67 3;  2K28 A;  5DM7 3;  4EQ5 A;  3FEW X;  1VQN A;  2SOB A;  4JI0 Q;  1Y1V B;  1QE6 A;  5C4Z A;  3PO3 B;  4ME5 A;  1D5X C;  2FJ2 A;  2F03 A;  1EZ8 A;  1KDB A;  5M3M B;  1EEI D;  1TT2 A;  1HNX L;  3J80 c;  4KHV A;  1PTO B;  2EYO A;  2KOL A;  1U4L A;  5DNF A;  3J81 i;  3KLW A;  1MD2 D;  3NWS A;  2WP8 J;  4GLX A;  2A19 A;  1HNZ L;  1CZG A;  2ALY B;  1LTT D;  4ILW A;  1HQR D;  3GV3 A;  1I4P A;  3VDY A;  4NXM Q;  3G7L A;  4R4T A;  2JQO A;  1SN8 A;  3GTK B;  3J7A 5;  1L0X B;  2XNA C;  4FDB A;  1UE1 A;  1MBY A;  3GTO B;  4AQY Q;  1CQV A;  2L55 A;  1ROD A;  1X65 A;  3UDX A;  4DUZ L;  3SE0 A;  2ZT9 C;  4DR5 Q;  4R4O A;  2K5D A;  1JMC A;  2EE1 A;  4AYB G;  4JBJ A;  2KUM A;  3WWV A;  4OX9 L;  1C7Y A;  2IJ0 A;  2PQE A;  1HZ9 A;  4BY7 H;  4B3R Q;  2JA6 H;  3VA7 A;  3S1M B;  1PH9 A;  2EDG A;  1BOS A;  1VQI A;  2KQ3 A;  1KLU D;  1SJH D;  3S17 H;  3WDN A;  2I46 A;  1KTK A;  1RDP D;  4B9W A;  4G7Z C;  3ULL A;  3MXU A;  2WKC A;  4M1U B;  4DR1 Q;  1J5E L;  4A3F G;  1U4M A;  3PIP 3;  2VUM G;  1LAC A;  1AEX A;  2N88 A;  3GTG B;  3HFZ B;  1EY8 A;  1NTG A;  4A3K G;  1WVL A;  5IT9 L;  5JEA J;  1KAW A;  2OEO A;  5D3D A;  1CKN A;  3BDO A;  2K7V A;  3AU7 A;  4A3F H;  1BUV T;  3MC0 B;  1YNN D;  4JI2 Q;  1AN8 A;  3PIO A;  4GKJ Q;  2OWO A;  3A56 A;  3NK9 A;  2YTV A;  2AWN A;  1IBM L;  3MXP A;  3M85 A;  3CCE A;  4A3K H;  1RJT A;  1N34 Q;  1PYB A;  2ZXP A;  1A0I A;  5EPL A;  2A69 C;  1JWM D;  3HRZ C;  1U4R A;  4RGO S;  2K50 A;  1U0L A;  1YNJ C;  3ERQ A;  4NKL A;  2JA8 B;  1BXT A;  1RTN A;  1K8O A;  2QF7 A;  3T51 B;  5ELB A;  1WTR A;  3T1Y Q;  3HOY B;  4RH6 A;  3RR5 A;  4P73 A;  2QEX A;  1CZW A;  3NBH B;  4C2M B;  1MHW C;  3T13 A;  4JVZ A;  4DV4 Q;  2E2I H;  4RGN A;  4BA2 I;  4JCV E;  1IBK Q;  4IQZ A;  1VQ5 A;  5C4J B;  2L12 A;  2F3V A;  2RHS B;  3MEF A;  4XT3 B;  2B2V A;  5KNB A;  1XTC D;  2L5T A;  1HNW Q;  1JJ2 A;  4Y52 H;  3CPW A;  3ND8 A;  2I0Q A;  3R3O A;  1BBU A;  1XNR L;  1EZ6 A;  1CTM A;  3E9H A;  3NTH A;  5T1I A;  2C35 B;  4DK3 C;  3T53 B;  3J81 L;  4F8M A;  1ILQ A;  1I4H A;  4PNY A;  1GHJ A;  5CV5 A;  3SK6 A;  4DFA A;  1VQ7 A;  1F2M A;  1EOT A;  2B8F A;  1SMX A;  1I94 Q;  1E22 A;  1Q46 A;  2B2Y C;  3FKI H;  4DV1 Q;  4IUV A;  2XGT A;  4IN3 A;  4A3M G;  1I5F A;  2DY7 A;  3ER0 A;  2QIL A;  3L7Z C;  4EQP A;  3KUP A;  1NJI C;  1BVS A;  1PRT B;  4RWS C;  2F4V Q;  4L5T A;  4JI8 L;  4C3H H;  3FRP B;  3UI2 A;  2J0T D;  4LF7 L;  1W6K A;  3PF4 A;  4ALP A;  3J81 c;  2IX1 A;  4CKB A;  3MVV A;  4K5X A;  3NWT A;  4GZY C;  1SDF A;  3ULJ A;  4K5V A;  3M3Y H;  1QVC A;  4UP9 A;  4FF1 A;  3VR6 A;  1T5E A;  3OOC A;  1YIJ A;  2JE6 I;  1Q86 C;  2TSS A;  4B3T Q;  2B2U A;  1JE5 A;  5C3X A;  2EPB A;  4B9X A;  4DR3 Q;  3C2P A;  1L2F A;  1KC8 C;  1ILP A;  4A3C H;  1A62 A;  4DGZ A;  1XWE A;  3J7A V;  2EY5 A;  3TP6 A;  5C5M A;  2LXK A;  5D3I B;  1FR3 A;  3OTO Q;  5ISR A;  3FDT A;  4PMC A;  1Z6H A;  5BN5 A;  3ICE A;  3H94 A;  3IL8 A;  2I5H A;  1YNX A;  2E8G A;  3MXG A;  1LT5 D;  2RHQ B;  2CH4 A;  3CCR A;  2VUM B;  3E3X A;  3CQZ H;  1H9K A;  2F0I A;  4X3T A;  1L1O B;  1CQF A;  2JK8 A;  2Z6K A;  1JE4 A;  2WAQ E;  3OMG A;  1PFS A;  3CRL C;  3FHW A;  1HPC A;  5A2Q L;  3NE5 B;  1EQQ A;  2NB0 A;  3ZYY X;  3AB9 A;  3W1G A;  4JOI C;  2ZJR A;  1TVX A;  3L2P A;  3U9O A;  1MI2 A;  4APV A;  1SFO B;  1ET9 A;  2EY2 A;  4R8I A;  1ONL A;  4X6A H;  2EQS A;  4A76 A;  2D9U A;  1CUK A;  4KK7 A;  2CW0 C;  1EY4 A;  5C0X G;  2JA5 B;  2WII B;  1DZ1 A;  1SSO A;  2N49 A;  4DR7 Q;  3BVG A;  3I7F A;  5I2X A;  4MN3 A;  2F0M A;  4BA1 I;  4C3I G;  5C0X H;  4XQN A;  1VQB A;  5IE8 A;  4KY7 A;  1V9P A;  2QA4 A;  3GTQ H;  1TWF B;  1EOV A;  4CJ2 C;  4JI4 L;  3OIQ A;  2CVR A;  2H1E A;  3H15 A;  3BJU A;  5EBC A;  1D1K A;  3BZK A;  3M4P A;  4JYA Q;  1GKH A;  4OHJ A;  4C3I H;  3S1R B;  2BE5 C;  2JXM B;  2VXW A;  3F2B A;  1CT1 D;  1EFI D;  4N8X 1;  3C3L A;  2AWO A;  4IUR A;  4TRD A;  3OMC A;  2WAQ B;  5HUR A;  3OSO A;  4FF4 A;  4BS9 A;  2AKW B;  3OWF A;  3H6M A;  5C3E H;  3GD7 A;  1A8V A;  4A3M B;  1IBL L;  4A3E G;  2R92 B;  1SE3 A;  1LO5 D;  3U50 C;  2F0P A;  1IYJ B;  3RLF A;  4UAI A;  4DAV A;  2F3W A;  3H91 A;  5FO8 B;  3CPF A;  4HCE A;  1B8A A;  4XQJ A;  4FXK C;  3SVM A;  4A93 B;  1WYD A;  2PYK A;  4DV5 Q;  2MHV A;  4RAU C;  2E2D C;  2OTJ A;  2NZ1 D;  4DR2 L;  3EBE A;  3B6Y A;  4MHE A;  3KJO A;  4M8A A;  5C4X G;  3S24 A;  3S1Q B;  1TWA H;  5CV7 A;  1QCB D;  4FO2 A;  2G9H D;  2BH8 A;  4LFA Q;  1YHA A;  2QEJ C;  1GVP A;  4ME3 A;  4JI5 L;  4LW1 A;  1GUT A;  4X64 Q;  5KNC A;  3GTL B;  4X62 L;  1IYV A;  1ZEQ X;  5L37 A;  3K5M A;  3I4N G;  3HOU B;  5HGQ A;  1WTV A;  4LF8 Q;  5GQO A;  4OO1 G;  4HSP A;  1FNW A;  3NUC A;  1ML0 D;  4ZKC B;  4BBR B;  4RKB A;  1WD0 A;  4GKK Q;  3HKZ E;  1STN A;  3OHX C;  5E4W C;  2LKV A;  4DV6 L;  1UUP A;  1BNZ A;  1XXG A;  2UXD Q;  2L11 A;  1KAB A;  4XTC S;  2AQ3 B;  4J1M A;  5IIF A;  5CMD A;  2UXC Q;  3BG3 A;  3HOX G;  2HHH Q;  4FYD A;  2DN8 A;  3EQL C;  2A69 D;  3GTJ B;  1HR0 L;  1VQ9 A;  2KCC A;  3S2H H;  3AEV A;  1CKN B;  1YNJ D;  3FPP A;  1G29 1;  1K8M A;  2NVQ H;  5IYB H;  3RLN A;  2FMC A;  3LX0 A;  1VQ4 A;  1BR9 A;  3HOX H;  1XPU A;  4DPG A;  3NQT A;  2HDM A;  4YY3 Q;  1CA5 A;  4J8Q A;  5I4D A;  1DXM A;  5GRO A;  4A3D G;  4Q0F A;  2F0U A;  2R93 H;  4LF5 Q;  3LGJ A;  4L63 B;  4L8J A;  4EVO A;  1DJR D;  3PCO B;  1WD1 A;  4X3K A;  3AFQ A;  4O42 A;  3KJP A;  3LNN A;  3W2D A;  4Y7N H;  5CV4 A;  3I73 A;  3HOZ B;  2I07 B;  4GNX C;  1N32 Q;  1I6H H;  3DM3 A;  5COR A;  5IGB A;  1QZH A;  3NTI A;  3BDC A;  2Z4H A;  4A3E B;  1LTB D;  1TWG B;  1MKH A;  3HKS A;  3SHL A;  1VQD A;  2MQH A;  4X65 L;  1FGB D;  3A0J A;  3SXH A;  1EL0 A;  2R7Z H;  2UU9 L;  1PH7 A;  1XMO Q;  3I4M G;  1CHQ D;  4XIG S;  5ELD A;  4KHP L;  1Y14 B;  4BBS H;  1S72 A;  2NBF A;  4A3L G;  4A3G G;  2R6G A;  2PW5 A;  3S1N H;  1JOK A;  1V1P A;  1O78 A;  3CD6 A;  3IFT A;  3F1Z A;  4GOP B;  5IWA L;  1RHP A;  3WOF A;  2WB1 G;  4JI7 L;  4I7A A;  3KFU A;  3I4M H;  1HA5 A;  3MFY A;  2DNC A;  1S4Z A;  4A3G H;  5J3B A;  1MSH A;  3U4V A;  3C46 A;  2BDO A;  5C4X B;  4DV0 Q;  2NN6 I;  2DNE A;  1VQG A;  1E7Z A;  2A73 B;  1B3A A;  1TS4 A;  1UWV A;  3X3N A;  1SYG A;  1UEB A;  4RHR A;  2F0F A;  4P74 A;  5M5Y H;  2VW9 A;  1N36 L;  5K36 H;  4X66 Q;  2WKD A;  4A3B G;  1AP0 A;  2BOS A;  2Q2I A;  2A6E C;  5LL6 S;  1ET6 A;  2MO0 A;  3T1H L;  4NPS A;  4PG3 A;  3VR4 A;  4A3J G;  3I4N B;  1I3Q H;  1ICW A;  4G57 A;  4DXF A;  5D14 A;  3NPP A;  3KK7 A;  2OF1 A;  1CSP A;  1EQV A;  1SYB A;  4HIM A;  1LT6 D;  4DV3 Q;  1CK1 A;  1H9J A;  1YJN A;  3F2D A;  5DAU A;  2QW7 A;  3M4O B;  4RGT A;  2IL8 A;  2EZV A;  2A8V A;  3K5N A;  3VR5 A;  3NBI A;  3GO5 A;  1GXD C;  1BO0 A;  1BCP D;  1Z7T A;  2JA7 B;  3EVQ A;  1PFN A;  2NYZ D;  1G91 A;  3DHQ A;  3MAQ A;  5CV6 A;  2UUB L;  2CCZ A;  3HZX A;  1AW7 A;  1QB5 D;  1T5X D;  4RG1 A;  2CW0 D;  4YHH L;  2E5L Q;  2PQA B;  3TEH B;  5LMU Q;  2GVB A;  1TWC B;  3HP3 A;  1EWH A;  5FLX L;  4TKO B;  1K28 A;  4Z9C B;  2ZJQ A;  5E3F A;  4IFD G;  3S14 H;  1F9Q A;  4AH6 A;  4LFB Q;  3W5O A;  2B63 G;  4A3D B;  1RKN A;  2JEB I;  3S16 B;  2EOT A;  3CCQ A;  3IAY A;  2B2T C;  1U5K A;  2IHE A;  3K5L A;  2J7Z A;  3PGZ A;  1Y8N B;  3TRZ A;  4DA2 A;  1XTD A;  2KCN A; 
#chains in the Genus database with same CATH homology
 2QW7 A;  4I7A A;  2RCF A;  4JVZ A;  4N8F A;  2HD3 A;  4N8X 1;  4JW0 A;  5L37 A;  2Z9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...