4JW0A

Structure of gloeobacter violaceus ccml
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
MQIGRVRGTVVSSQKEPSMVGVKFLLLQLIDEAGQPLPQYEVAADGVGAGLDEWVLFSRGSAARQVAGSEKRPVDAVVIGIIDTVSVDNRPLYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Two new high-resolution crystal structures of carboxysome pentamer proteins reveal high structural conservation of CcmL orthologs among distantly related cyanobacterial species.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Structural protein
total genus 15
structure length 95
sequence length 95
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4jw0A00
4N8X1 4JW0A 4I7AA 2Z9HA 4JVZA 5L37A 2QW7A 2RCFA 2HD3A 4N8FA
chains in the Genus database with same CATH superfamily
3A5ZB 3NBHA 2CFMA 4XQNA 1LTGD 1SDFA 2F0PA 4X66L 2HHHL 3IAYA 3Q24A 4TRDA 1HRJA 2D62A 4JI1L 3QOLA 3OMCA 4DV3Q 4FP5D 4XYQA 4DUZL 1JOQA 3GTJB 1VQCA 2NN6G 5T1IA 1HUNA 3E0JA 1YEZA 2AHOB 1OO9B 4LWCA 3VA5A 2M2LA 1Y8PB 1U0LA 4BY7G 5C4ZA 3K8AA 5C4JH 1E1OA 3U4VA 3FVQA 3KDFA 2K50A 3R93A 3OMGA 3Q23A 4CKBA 3K58A 1D5ZC 2B2UA 3S16H 3BDCA 4NMZA 1LACA 3S1QH 2DY7A 4LF5Q 4RCOA 3OWFA 2B29A 4QJFA 4DR4Q 1A6XA 3U50C 5JPMC 1YI2A 2Q2HA 4CDEC 2VQFQ 2MJ8A 1QE6A 1A62A 1EYDA 1X3EA 2EXDA 3S17H 5JPNC 1J9OA 3L3OC 3T1HQ 2OWOA 1VQ6A 2EJGC 2BE5C 3IFDA 3T1YQ 2NTTA 5FO7B 3G4SA 1R4QB 4RH6A 1PH9A 5I9PA 2K4KA 1XTCD 3CCSA 4A3MH 2HT1A 3PUXA 2EQSA 1AP0A 1BVSA 3O13A 4JBWA 4A3CH 2NZ1D 4N9PA 4NB3A 4XTCS 3R2TA 4K6LA 2A69C 4L5TA 2V4DA 4L5SA 3DHQA 2NVXB 1RHPA 1TY0A 1FVIA 4XIGS 3M9BA 1HZ9A 1RIPA 1XNRL 5EKIA 4DNTB 5KEEA 4P2CB 1BBWA 1UNSA 4DK1A 1H9RA 1BR9A 3OTOL 3C1FA 5M3FH 1MI2A 4B3ML 3TBIB 3D6CA 2QEJC 1YNNC 3W5OA 1ML0D 1F77A 2D9UA 4KN4C 1EQVA 4ZQ3A 1QILA 4XQJA 1F2MA 4FF4A 3S1RH 2JA7B 4ME5A 4IPDA 1JT8A 2CVRA 2QGQA 5T1GA 5C44H 1Q90A 5BN3A 1Y1VH 1B9NA 4FF1A 4DR6L 1P8LA 4C1NI 5ELBA 2E5LL 2C9OA 3C46A 4PZ6A 1WTWA 1LTTD 2MGSA 3NWTA 2G9HD 2WB1E 2R92G 2Q8TA 1E2WA 5C0XJ 2R7FA 1FR3A 1D5MC 2QDLA 1NMFA 4K5VA 2WAQE 5FKAC 1Q8KA 1N36Q 2UXCQ 2RQXA 1O80A 1PLFA 3TEHB 4QUCA 3FP9A 5IODA 4FF2A 1SJED 1SLJA 1FNUA 3HOZH 1R4PB 1QWYA 2ALYB 3RZDH 2J4XA 3TP5A 3WDNA 1X54A 2F4IA 4B3SQ 4OWWB 4KTAA 4KY6A 3D0FA 2M9VA 4DNRB 3RN5A 2X6GA 2EY5A 1TS2A 1N9WA 2RDGA 4LFAL 4EQPA 1BF4A 2RA4A 3K7AB 2F4VL 3HKZB 1E1TA 1VQFA 4LAAA 3MEHA 4C3JB 2CH4A 3TSSA 5IOCA 4HJ7A 2E74C 4L5RC 2K7VA 2AWOA 2IW3A 4X3UA 1YNJD 1N33L 2K75A 1B70B 3VR2A 3GDEA 1HZCA 1LT6D 3W1BA 1HHVA 1NAPA 1EIGA 3RZOH 2BE5D 1JQYD 4B3TL 3MVVA 1LM0A 3GTMB 1VQ5A 1HJPA 3FKIH 1YHBA 1M4VA 2ICEC 2KUMA 4LUVA 3VA7A 4CDCC 2MNAA 5HURA 2KHSA 1KHIA 4HAEA 3URYA 4OHJA 1I4RA 1STGA 1DGSA 1JWSD 1JCKB 4K8JA 4KI0A 4OIJA 1LTID 5E4WC 4POFA 4CJ0B 2WB1G 2WV6D 1SRUA 1I4HA 3CW2C 3QJYA 1SYCA 1NJIC 1SYDA 1IZ6A 1SE8A 1EZ8A 1VS0A 1HNXQ 4A3IG 1VF5C 3TS2A 4X64L 1DD2A 2Q8RE 2PW5A 3I2ZA 4UPAA 2F0WA 4BWGB 1SEBD 3E6ZX 4OWTB 1I94L 3F2BA 2N49A 2B2WA 3QR8A 1ESFA 1UUPA 1SNPA 1PH4A 3TZUA 3NWSA 1WCMH 2B2TC 4YWKA 2BOSA 4F88A 3S2HH 4DK3C 4JI7L 1JORA 1EYCA 2F1MA 1S4ZA 1X32A 3GTLH 2JA5B 3I4LA 1B8AA 4GLAC 3ONAB 5ELOA 2V1CC 3K80C 5C3XA 1UE1A 3MFGA 3S9WA 4ME3A 3CF5A 3TQYA 2O5IC 5EJWA 1CQVA 2RDFA 1HZBA 5GADC 4C2MH 2PNHA 2Q8IB 4WJ4A 2O2LD 4A3FH 5C5LA 3K5NA 1DM0B 4KHVA 4DXGA 5HY6A 3KF8B 1QNUA 2ZJQA 2KEEA 4J6HA 3BDLA 4A3JH 5GQOA 4DV3L 1ZYRD 5IYBG 3OW7A 3N6RA 3SDZA 2E2DC 3NK9A 4FVMA 3HOXH 4IPCA 3CCEA 3D4WA 2KHJA 4FF3A 1TWAB 3PO3B 1QJOA 3AYHB 1TWHB 3C1EA 2NN6I 2K5NA 1RCVD 3DEPA 4A3DB 4PV1C 4P71A 1DCZA 1JE4A 3ZJYC 1EU4A 2F0IA 2K6AA 3KLRA 5EQ0A 3HOUB 1L2FA 1U4PA 4MZ9A 4RHRA 4C3IH 1JB7A 3J81L 4A3GH 4LF5L 3J7AF 2FINB 2DNCA 5M3MB 5IGFA 3CD6A 4UAIA 5L37A 1VQLA 4GOPB 1YVCA 1F9SA 1X56A 1SMYC 4A3BB 1SROA 1Y8NB 2L9HA 1G2SA 4AYBB 3BZCA 2MPMA 4KHZA 3HGBA 1B1ZA 3OOCA 3KF8A 5IIFA 5KYIA 2LKVA 4U68A 2JA7G 3W1GA 4YWLA 1M90C 4BS9A 3P7JA 1KDAA 3SK4A 2DY8A 2HQEA 3TZDA 1A3VA 3J80i 4GN4B 2VY3A 3LWUA 3M4PA 4WFN3 4GKJQ 2BDNA 1MBYA 4B3RQ 1YBYA 2KJXA 2PMZB 4AH6A 1L1OC 1FGUA 3NE5B 1AEXA 1HPCA 4BBSH 4GNXB 4IURA 3PUWA 4DF7A 1JE5A 5FJ8H 1RTOA 3BDOA 4L5QA 1G291 1QVFA 5G3LF 4DA2A 1WI5A 2HD3A 3BJUA 5LMNW 4C3HH 1KRSA 4ZK9B 1TKWB 4PZ7A 3UE1A 2UXDL 4JK1C 1FD7D 1A8VA 3L9AX 2B2VA 5C3EH 3K5OA 1RD9D 1DZ1A 4PZ8A 3NPPA 4NXMQ 3ZYYX 1HCZA 2JN4A 4EX5A 1TU2B 1EQQA 3HKZG 1KLGD 3M4QA 4JI3Q 2F0GA 1K9MC 4C3JG 2ZTDA 3A5UA 2G5DA 2Z6KC 1K83H 1Q1BA 2NVTH 1SE4A 5I6WA 3K59A 1XMOL 3UDFA 3T4AC 1PTOF 2UUAQ 2AUJD 2UXCL 1RL2A 1GXDC 4PMWA 1F9RA 1ET9A 5JJZA 4QGUA 1TY2A 3PO2H 3CCVA 3J81c 1KAAA 3SK5A 4IZ8A 4ULLA 2A1AA 1IBMQ 1XX8A 2XSCA 5EKKA 2A74C 5IYDG 2ZTCA 3DWPA 3GD7A 4DN4M 5FO8B 2R7ZH 4DAYB 5IP7G 4A4IA 3ND8A 4MNOA 4IUVA 1NR2A 3S1RB 4JV5L 2L11A 2B2YC 2RDHA 3UE0A 4IFDG 1EY0A 2EYFA 3MFYA 5IYCH 1PH8A 4DV1Q 5A2QL 3A8KE 3LGJA 4DR1L 1Y1VB 4GLXA 1L0XB 1CHPD 2FXQA 1J5EL 2UUBL 1EL0A 4K5WA 4BXXH 1JJCB 1CHQD 4JI6L 2G9DA 4JI2L 2KQ3A 3H0GH 2MUYA 4R4QA 5FOBB 4DV6Q 2B63B 1S5BD 3HKSA 1SNQA 2NVYH 1MJEA 2ICIA 1YJ9A 3NBIA 5CV7A 2NVQB 1E3PA 2XRQD 4K5XA 1EWHA 4JOIC 3BVZA 1YITA 3ICEA 4OO1H 4ILWA 3J80E 2ZXRA 2JA5G 3GV3A 1CSQA 1GO3E 3S14B 1GUTA 2PZTA 3TN2A 4H7BA 4DAYA 1A15A 4H0LC 1PRTB 1GD7A 3H6MA 3J7ZC 1G6PA 1S3OA 4EQ5A 1EY9A 4R4OA 1HFNA 1WD1A 3EA6A 1VQBA 3HRZC 4HEDA 4R8IA 2WKCA 2E2JH 5AJ3Q 4YIJA 5C4XG 1CSPA 4PQXA 5DNFA 4CDDC 4WRDA 1AFPA 3GTOH 1W6KA 3GTKB 2XWJB 5K36H 1MSGA 1TVXA 4HSVA 5AFWA 4JI5Q 5IP9G 3G6EA 2QEXA 1G8ZD 3HS0C 2QCPX 5CBAE 1O78A 3HEJA 2F0JA 1BCPB 2VB3X 4QCLA 2ZXPA 3PF5A 5COYA 3PO3G 4A3KB 3T53B 2OXPA 2PI2E 4ZAIA 2WINB 3RLNA 4BY1B 3I4OA 4A3DG 1PZID 1U5KA 3FKIB 3CRLC 4XYOA 1PVOA 2F52A 1HA5A 1K8MA 2IPKD 2DJGC 3D31A 3CP0A 1EUJA 4Q5VA 1TS3A 4J15A 3C2PA 3ULLA 1U4LA 5LMNQ 1ICFB 2JQOA 4DV2Q 5M3MG 4NPSA 1H9KA 3VYTA 1DXMA 4P74A 3P20A 1PH6A 3BVGA 2BH8A 3M7NA 4A3BG 4LFCQ 1ILQA 3GV6A 2XNAC 4YCUA 2FHTA 4X65L 5CV6A 4AYBG 1NE3A 2OTJA 1UE5A 4KK7A 2EZVA 1AZPA 4LF8Q 1LABA 1SYFA 4KN7C 4POGA 1PH1A 3I4MH 2K01A 1RKNA 2HUGA 5HGTA 5JJKA 3S2DB 4Q0FA 2ASBA 2LY7A 4JC0A 5JAVA 1SNOA 1JJGA 1NR4A 4IOAA 1HNWL 2K28A 5F2DA 2Q2UA 3HOWH 2XVSA 1GJXA 5ELNA 3V2TA 3TMEA 2VQEL 3CRKC 5IGCA 1K8OA 1TR5A 3T16A 3I73A 3NEMA 3PIOA 1N34L 1VQ9A 4HCEA 1HH2P 4IJHA 3I55A 3BZDB 4KKUA 4O1NA 4LF9L 4I65A 4RGNA 3X3MA 1TS4A 3FPPA 1OXTA 1HTLD 3OHXC 1PDQA 3JAMi 1A63A 1CFMA 2JA6H 4DUYQ 3GTQB 1EY4A 4MTKA 3AU7A 3JAML 4CKCA 1LTBD 3VYSA 4A3JB 3RN2A 4R1JA 2K5DA 4DV0Q 1PTOD 4GKJL 4X3TA 3I90A 3HOXB 1EOVA 5IT9L 1H9MA 1NUCA 4LFBQ 3MC0B 4DV7Q 3EFXD 2LMCB 1LT3D 2HDLA 2VS1A 2Z4IA 2IX0A 3M3YB 3KUPA 1F9QA 1FJGQ 2ZM6Q 5C0XG 2A6EC 4TKOB 2E2IB 3QOJA 5BN4A 3F2CA 5HGQA 5EKLA 2IHEA 1X3PA 1PYSB 4A3LG 4Y7NB 1CI3M 2Z1CA 4LMQD 4JI4Q 5KNBA 2I5MX 1E7ZA 5IE8A 1D2BA 1YNJC 4GKKL 1TWCH 2Y0SB 1XNQQ 2MP1A 1I50H 3CPFA 3HZXA 5CYUA 5IWAQ 1HQRD 2VZAA 5D3IB 1PH3A 1MSHA 1JICA 4OONA 1JB3A 1TWFH 2K14A 1PMRA 1Y1WB 5EBDA 4ZKCB 3KYHC 1AN8A 4OWXB 5K5PA 2QW7A 1V1PB 1Y1VG 3Q8DA 3K6OA 2CKZB 3NELA 4FYDA 4CJ2C 2IT1A 1X65A 2NN6H 2L55A 2BDOA 4YCVA 1TWGH 1PH2A 3GTGH 2B63G 4BY7H 4IUNA 3EIVA 2YTXA 2Z0SA 5GAGC 2F0VA 3PUVA 1GUGA 2YYZA 3D6WA 3ND9A 2NTSA 1MD2D 1ENCA 3B6YA 3TP8A 3SE0A 4DR7Q 4K14A 4JI8Q 4OX9Q 3K0YA 5C3EB 3CC4A 3RLFA 3JAMc 2JA9A 4DV1L 1UE6A 2KCCA 4E6IA 1F2ZA 1Z9FA 2NYZD 2I0QA 4IFDI 1V1PA 2K32A 1HR0L 1N32L 4OELB 1VQIA 1B44D 1KIXA 3S15H 4BBRB 2VUMG 1CA6A 5IT9c 1K3RA 3EBEA 1V8QA 1IBLL 5KRUA 5EPJA 4Y52H 1CKNB 3JAME 5M5YH 4F7XA 2HCIA 3CKIB 4RGOS 2BA1A 5JVG3 3DM1A 4I7AA 3NHHA 4P73A 5J39A 4LF6Q 3HFZB 3TS0A 1XMQQ 5FLXL 3M4OB 4A3KG 4DV4Q 2EE1A 4LUOA 4UHVA 4BY1G 1IYJB 3FKIG 4YCWA 3PV0A 1D7QA 2K52A 1JOKA 1ZYRC 4O0AA 5CC4A 1M8AA 1VDZA 2RCFA 1EOTA 4TSSA 2R7ZB 4N9TA 5I2XA 1J6QA 5GAHC 5JJLA 2A6ED 1W6JA 4H13C 1NBWA 4EQNA 1XWEA 4YWMA 1B4OA 4JCVE 2KA7A 4QIWB 1I3QH 2CHBD 3S1NB 1QOHA 4JI0L 4UP8A 1HXYD 3EROA 2AQ2B 2BCOA 2RVLA 2UXBL 3Q22A 1CKNA 2ID0A 5J3BA 1PZJD 1EWIA 3H0GB 4DK0A 4YHHQ 1KD1C 4CDFC 4PNYA 3EVQA 2JXMB 2H1EA 4L6TB 2R92H 1BQQT 5M9OA 3OIQA 3BYYB 2AQ3B 2IX1A 2R93H 1CQFA 1HZAA 2AQ1B 2M00A 3J7YW 1WFQA 5D3DA 2F3VA 3HOYB 2F0QA 3CQZB 1JC7A 4F8MA 1EYGA 1EY6A 1XPRA 1AZQA 1EQRA 1BBXC 3GP7A 4X62L 4A93B 2L12A 3CC2A 2F0DA 1B7YB 3NP8A 1UEBA 1Y8OB 4X6AH 5M5WB 2E8GA 1RDPD 3KK7A 2E2JB 4NW2A 1HNZL 2JA8B 3T13A 4GZYC 2UU9L 4K0KQ 3TREA 3DWAA 3MA2B 4AQYL 4A3JG 3I91A 1EEID 3GTPB 2ENBA 1CK1A 1GKHA 4ALPA 1LTRD 4IUTA 1F2LA 5FLXc 2CQAA 3K81C 3NTHA 2VW9A 5LMUQ 2EY2A 3KJOA 3E9HA 1B3QA 3RUZA 4KHPQ 1DOMA 5KIXA 2E2HH 4FNFA 4LF7L 2QILA 4DR3L 1XPOA 4DR2L 4XDXA 1II3A 1U9RA 5M5XH 1CZWA 1I6HH 1QUQA 4DV5Q 2Y0SG 4DR5Q 4TQUS 1CZGA 1PTOH 1A3UA 2EIFA 2P5ZX 4A3IH 3DMUA 1SAPA 1Z47A 2F0EA 2KVMA 2MO1A 3TRZA 4KD4A 5KNCA 3K7UC 2F0LA 4P72A 1E2VA 1OXVA 3X3NA 1Y1WG 1YJWA 3OSOA 4LFBL 2EJMA 4RAUC 1PRTF 1B53A 5CORA 3J81i 3DLLA 4QY7A 4OIKA 1FJGL 1KAWA 3HOWB 2Z6BA 3HKZE 3FDTA 1SNDA 1DJRD 4DAPA 4K2LA 3MHBA 4DR4L 5C0XI 2CH4W 3P75A 4JG2A 2N3SA 1WJJA 4FXDA 1Z6HA 1EWCA 2EXZA 5FJ8G 3VDYA 4O2DA 3PIO3 1STBA 2VQFL 4J1MA 3U9OA 2Z4HA 1BCPF 1CUKA 2F0KA 3I4NB 3T1HL 2RHSB 4B9XA 2KCNA 1I4GA 5NUCA 3T1YL 4ABNA 1SBBB 4IPHA 2EJFC 1SJHD 2NB0A 5E1FA 1SE3A 5EGTA 4HTHA 5IYBH 1D1IA 2F03A 1KL9A 1FYCA 2D5DA 4X66Q 4G7ZC 2HHHQ 4BBRG 1VQEA 2PYKA 3OWEB 1RJTA 5C4JB 4DAMA 4JI1Q 2XN9C 4DUZQ 1QVCA 1STEA 2GVBA 5DEHA 3D4RA 3S16B 2F0MA 4JW0A 2NVXH 1SNMA 3S1QB 1B50A 1V1QA 4DFAA 1VQOA 1BO0A 1WYDA 1B9MA 3PSIA 3STBC 4DR7L 4ID6A 2GVAA 1G51A 4JI8L 3PQIA 1GUSA 4RKLA 1HFGA 5I9OA 3S17B 1WD0A 2R7ZG 1SR3A 3KLSA 1VQ7A 2MQHA 1LT4D 2PZUA 3TP7A 1IBKQ 3ERQA 5CMDA 3EJIA 1BBUA 2KBNA 3A55A 4JVZA 2JA7H 1K8AC 3PF4A 5JVH3 5C5MA 3H09A 4A3MB 2PCFB 5IYCG 2KHIA 2FFKB 3D8GA 4PMCA 1AH9A 3PGZA 1LTSD 1NMGA 1D6EC 3A54A 4CJ1B 4BXXG 1N36L 3H3VI 4J8QA 3E9IA 1SSOA 1STYA 2RBMA 3GTGB 3A56A 2B2TA 2HIXA 2EVBA 2KEDA 2KCTA 1ZKOA 2EDGA 2R7DA 3W3AA 4M8AA 4R4IA 4KV6A 3MWYW 5M3FB 5IGEA 4B3SL 1STAA 1EIFA 4RGTA 3HOYG 1YZ6A 4OO1G 1XNRQ 1ZEQX 2EYJA 3FEWX 3Q0AA 4IO9A 3H91A 3J81E 1GUWA 3DUZA 1L0YB 3SGIA 2BA0A 2H4OA 4A93G 2AUKA 2RKSA 1NSNS 3OTOQ 1UAPA 4IALA 1PFSA 3KLWA 4B3MQ 5C44B 1J8IA 1KTKA 1H95A 2JA8G 3K7AH 2MFIA 3R8BA 3M7GA 1IYUA 4C3JH 3S15B 4ZLTF 3I3CA 1CT1D 1V43A 2IWHA 2EYLA 2RF4A 5E3FA 4L63B 1S5CD 2ZXOA 5M5YB 2ZTEA 1BXTA 2CW0C 2E5LQ 3NENA 4AYBE 1E0BA 1WTHA 2YTYA 3A7LA 1ONLA 4HIDA 1L1OB 5I2YA 3HOZB 2OCEA 1C0AA 2ES2A 3RZDB 1IYVA 1KNEA 2B2UC 4C1NK 5KYLA 1G6ZA 5ELFA 3MEFA 3HOVH 4IUUA 4N8FA 3SXHA 1PTOC 1UE7A 1ENAA 3KBXA 1HNXL 2CQOA 4ZUIA 3VYRA 5IYDH 4QMGA 5LL6S 1ET6A 4PMBA 5IP7H 2PMZE 1TS5A 2FMCA 2HQLA 1PH5A 4FO2A 3STBD 1I3QB 4IFDH 2R61A 4KLKA 3AB9A 1D5XC 1K28A 3HG9A 4DPGA 4H02A 1DONA 4LFAQ 2MHVA 3V05A 3R2IA 3I72A 2MO0A 2L1BA 3K5LA 2UUCQ 3KOJA 1OXUA 2TMPA 4A75A 3RZOB 4AIMA 5D14A 1A2UA 2K5HA 2PQAB 3HP3A 2YU9H 2R93B 1L1OA 1GUNA 1N33Q 4K6DA 5LMUL 1XYIA 1SYEA 4IUQA 3HOUG 5I4DA 1EU3A 1A3TA 3PIPA 1V1OA 3HOWG 2L0CA 4ZRZA 2O4XA 1BCPD 2JA5H 2K04A 4B3TQ 2K5VA 2HDMA 4MIUA 5ELEA 5LL6X 4WORA 5C4HA 4APVA 4RGMA 3DM3A 4U673 3BVMA 3G71A 2VL6A 3QG1A 4DR5L 3A8JE 3KF6B 1FNWA 3I4NG 5LHY1 1X55A 2NUCA 3H15A 2F3WA 5C4XH 5JEAH 1XPUA 5D65A 3NTIA 4MTNA 3I56A 1A0IA 3T56B 4LF4Q 1JWUD 4CGYB 1NCVA 4X64Q 3R3OA 5IP9H 5KGUA 5A2QE 1VQDA 4ODGA 3F8TA 1WCMB 1JJ2A 3S2HB 2Z6KA 2AWNA 1WTPA 2PQAA 1U4RA 3T51B 5G3LD 3GTLB 4O42A 4EVOA 1SN8A 3H94A 4G7OC 1IW7C 1D1KA 1TWAH 4HJ8A 2JE6I 1I94Q 3PO3H 1TQOA 3J7AV 1TWHH 4IOCA 1ICWA 2LFNA 2A6HC 1P16A 3RD4A 4A3DH 5BR8Q 2A68C 1TXYA 1STHA 4JI7Q 5CV8A 2E2HB 1KDBA 3VR5A 4JPBW 4C2MB 3KJPA 2CW0D 1DOLA 3IL8A 3NTKA 3D4DA 1GHKA 2X6LA 1VCIA 4A3FB 5M3MH 3KF6A 2WB1B 5IGBA 2AMCB 3VYUA 2QF7A 2YV5A 1Y69U 4B9WA 1I6HB 1PFNA 1LO5D 4G7HC 2QKIC 1OXSC 4A3BH 1E24A 2WAQB 2B2YA 2JEBI 4LNQA 3RLOA 1MKHA 4GN5A 2NZOA 2XWBB 1LV9A 1RODA 4B3RL 3PMFA 1VQAA 4KMUC 2B8GA 1IXRA 2ZT9C 1PHJA 4A3MG 4LUZA 4LW1A 4FDBA 4A3CG 2J0TD 3V96A 2HCCA 4DKAC 3UDGA 4KKTA 2N8NA 1AW7A 1TT2A 1BKBA 4TVAB 4A3EH 3SK6A 1S5DD 1Q8IA 1TIID 2A5HA 3CHBD 4C3IB 4RWSC 2OF1A 3WWVA 1U4MA 4A3GB 5FLMH 2EYPA 1GUOA 4I7ZC 4JOIA 2EYHA 3G7LA 3AFPA 3E5SA 3U9SA 5H1SE 1K0SA 5M3FG 1MHWC 1YJNA 3IRBA 1OXXK 4NXML 1QZHA 3I8ZA 1Q86C 4IPGA 1ILPA 1G91A 1IBKL 3CPWA 1WTXA 1OTCA 4JBMA 4JI3L 3UDXA 1VQGA 3VR3A 5C44G 2A8VA 2DJFC 1E2ZA 3ULJA 5JJIA 1Q3LA 3K5MA 2IX3A 2UUAL 2EPBA 2KENA 4RKBA 4QF4A 1Q1EA 4K2KA 3KBGA 3VR4A 2B2WC 1I4XA 2R3ZA 2K05A 4BBSB 4V190 2WKDA 3D3RA 2DNEA 4B08A 2N55A 1GHJA 4DU9A 4R4CA 3ULPA 1IBML 5C0XH 3RMHA 3F2DA 1VQKA 4C3HB 1KXLA 4X3SA 3MZ5A 3HOZG 1BNZA 4A3LH 2X69A 1S5FD 2GA4B 1G2TA 1AE3A 4BA2I 1EFWA 4G4KA 2IL8A 2B3GA 1IW7D 2I5HA 4OO1I 4BA1I 5ELDA 4L8JA 2R6GA 2ZJPA 2A6HD 1M1KC 2FMMA 5E4XA 1MJCA 1IL8A 2A68D 4UP9A 3L7ZC 2JEAI 2UXDQ 3IFTA 1WTRA 3U4ZA 1KDCA 4DV6L 4N8X1 1MIUA 3K0XA 1K83B 2NVTB 4QQBX 5BN5A 3QWNA 3KFUA 5J1ZA 3BU2A 2LS01 4FXGC 3NQIA 1QZGA 3N52A 5J22A 1NTGA 4HN7A 3PO2B 2AKWB 5IT9E 3JC66 2B63H 3LX0A 1UWVA 2PPBC 5FK9C 3UI2A 3QB3A 2R93G 1XMOQ 1BDOA 2F3IA 3LNNA 2NBFA 4C56C 1HTPA 4R4TA 4NXNQ 2NVQH 1RF2D 1PZKD 1CKOA 2Z8LA 4S3SA 4NDXA 4G57A 3DXJC 1LYLA 5AJ3L 3K57A 2F0UA 3S14H 1PFBA 3MTSA 1VQNA 2EYOA 1ESRA 2WP8J 1WTQA 2KECA 2CWAA 3BS1A 4JI5L 2YTVA 4LJZC 4DGZA 2EYMA 3CXCA 1H9SB 1X3FA 3S1MH 2F0HA 4YY3Q 4JV5Q 3AQQA 3BYTB 4KJOA 1K3BC 3QIAA 2F0NA 2NVYB 2PQEA 3NSWA 5IGGA 2UUCL 3AMUA 2KOLA 3GTKH 2LXKA 3H3VH 2VUMH 1QB5D 1R9TH 4DR1Q 2PO4A 4P75A 2Y0SE 4A76A 3AFQA 2DUDA 1J5EQ 2UUBQ 1WCMG 2SOBA 3FPUB 4JI6Q 4JI2Q 3NUCA 2RCNA 1UEAB 4OEMB 4A3KH 5LMNL 4DV2L 2XRSD 2FJ2A 3G6JB 3UDIA 4BY1H 4GOPC 4KJNA 3HOVB 4IUPA 1W3SA 4LFCL 2RSOA 4JBKA 1C8CA 1QUQB 1VQHA 2A69D 2J7ZA 2B2VC 2JSOA 3FMCA 3IKJA 5E7NA 4UY8C 3PUZA 4A3FG 2N88A 4LF8L 3GTOB 4JYAQ 2O5JC 1SE2A 1H9SA 3EN2A 3L2PA 1DOKA 3MXUA 3QO2A 4HSPA 2WAQG 4LF4L 4RHSA 3CU7A 2K5QA 2ZJRA 5JOBA 3VR6A 1PFMA 3HOXG 3OIPA 1YNND 2L5TA 1VQPA 3Q6SA 1KABA 3C3LA 4GNXC 1ASYA 2YU9B 3S2DH 2F0TA 4GS3A 3I7FA 1LT5D 1ZXTA 4DNIA 3I70A 4IQZA 1EIHA 5BR8L 4C3IG 5A35A 4CHTB 3S24A 4A3GG 4OGQC 4NP5A 3PIP3 3KLSX 1IKLA 5FLXE 2OT2A 2CWPA 4DUYL 1ASZA 4F87A 2XTIA 1I4PA 1SFOH 2LSSA 1E22A 1I6VC 2VXWA 2SEBD 1EEFD 4DV0L 4HJ5A 2LXJA 5C4XB 1QNKA 1T9HA 1PH7A 2SDFA 1KC8C 3I4MB 5EPKA 2SNSA 1FGBD 3CCRA 3GTQH 1CTMA 4DV7L 2OQKA 3CAMA 1D8LA 3CMEA 2E75C 4X65Q 1HR0W 1CA5A 2WIIB 4HIOA 2ZM6L 1Q81C 1C48A 2JJQA 3GTJH 3A0JA 5I6YA 3CCMA 1A2TA 4NKLA 4IJLA 4K8IA 1VMPA 4BBSG 3SR1A 4GN3B 4KKSA 1EQTA 1S40A 3GO5A 3EQLC 4QIWE 4RFBA 1F9PA 3RNUA 4JI4L 1I5FA 3M3YH 5CV5A 3AEVA 1SNCA 4ZKBB 2I5LX 4WJ3M 1XNQL 4IN3A 2E2IH 1PXUA 1VQJA 1XXGA 4UDUC 4C3HG 1HNWQ 5CR3A 4QB4A 1SYGA 2VQEQ 5IWAL 4RA8A 2JP1A 4Y7NH 2JA6B 1FL0A 5C3EG 1N34Q 5FO9B 1NNXA 3FRPB 3SK8A 2E76C 4HMJA 1F2YA 4LF9Q 1EY8A 1IL2A 4WJWA 2EY6A 1EY5A 1T5XD 4RG1A 2TSSA 2D2CC 2ATWA 1T5EA 2K33A 5EAYA 1KQSA 1Y1WH 4HIKA 2PW7A 1I4QA 1LTLA 2GN5A 2VB2X 1LUZA 5CV4A 2IJ0A 4A3EB 2F0SA 2B39A 3J80L 3ER0A 1NY4A 1EYAA 1O7YA 3E3XA 3M4YA 3MXGA 3PO2G 3OYYA 3A7AB 3NXWA 1Q12A 4M1UB 4OX9L 1ENFA 4EGVA 1X6OA 1TWCB 2C35B 1PRTC 1EZ6A 1QVGA 1I50B 2CCZA 4OL7A 1L0WA 3A74A 4X3KA 4FXKC 4GOPA 3PCOB 1EY7A 1TWFB 3SEBA 2Q2TA 3PUYA 4CKEA 2XGTA 1IHZA 4R9WA 4RMFA 4GKKQ 5DM63 1LTAD 3H3VC 4RCNA 1K8GA 5CV9A 4HR7B 1WVLA 1PYBA 1Y14B 2WFWA 5IY0A 1YHAA 1BCPC 3OW2A 1TWGB 4KY7A 3H0GG 1YIJA 4LF6L 1XMQL 4QUFA 1VQ4A 2A73B 4DV4L 3TP6A 4DK6C 4BY7B 4DXFA 5DLQE 4BBRH 5C3WA 3CCQA 1PA6A 1H9JA 4GLVB 3P1HA 1B2TA 3NQTA 2JYOA 1O7LA 4ZYSA 1RTNA 4NXNL 2OQ0A 4GNXA 4MHEA 1AE2A 5EPLA 4HIMA 3L0OA 1VQ8A 3CCJA 3M4OH 1JMCA 1WOCA 1SYBA 2Z9HA 5ELCA 2JK8A 3HOVG 3GQBA 3U58A 3FHWA 2PI2A 1SXTA 4H44C 1N8RC 1VQMA 4XQQA 2RHQB 2KCMA 1Z7TA 1JOOA 1X3GA 3DEOA 4R8NA 5K36G 1CM9A 1IKMA 4YY3L 2K03A 4PG3A 1Q7YC 2OTLA 4YHHL 1EFID 2WACA 2OEOA 1YHQA 3J7A5 4DR6Q 1EIYB 1Q46A 3S1NH 2NWGA 1SMYD 3LWEA 1N32Q 1HR0Q 3J80c 3M85A 1SMXA 4KD3A 4HMIA 3WOFA 3GTMH 1XJVA 1IBLQ 1GM5A 3ITPA 3F2UA 1DYQA 1HUMA 1YNXA 3MXPA 1K73C 3DWQA 3HOYH 1C4QA 1K0RA 3CQZH 3CMAA 4DAVA 2L4NA 5ISRA 1KNAA 3E0EA 3SVMA 5IGDA 4A93H 4JYAL 1LLRD 4MN3A 4K0KL 2NZHA 1QCBD 3F1ZA 4XT3B 1X3QA 3MXNB 1PRTD 5C6AA 4KY5A 5M5WH 1W2BA 4UP7A 1KLUD 2F4VQ 2BH2A 3S1MB 4CBVA 1BUVT 1S72A 5JEAG 4HCSA 2JA8H 4Z9CB 2PZWA 3I4MG 4HJAA 2F0OA 4EQOA 1WTOA 2R92B 1JR0D 3MAQA 2VUMB 4JI0Q 4LK1C 1R9TB 4XT1B 1GOZA 1WTVA 5CBEE 2L15A 3CC7A 1O7IA 2UXBQ 3SHLA 1S5ED 1STNA 4KHPL 3GTPH 1JWMD 1HQMC 3CCLA 2SNMA 5DM73 3W2DA 3ERSX 1C9OA 1C7YA 2D0OA 3J81j 2K1BA 4HJ9A 1XTDA 1BOSA 5GAEC 4JBJA 5EBCA 4DV5L 2H5XA 2C5CA 2A19A 2HIVA 1VF7A 2DGYA 3WOEA 2F0FA 4IFDJ 1QG7A 1B3AA 2DN8A 2RSNA 5GROA 2JA6G 3MXNA 4X62Q 2IY5B 2EOTA 3BZKA 2K5WA 3G48A 1PV4A 1KRTA 3A8IE 3NBHB 3RR5A 1FNVA 5KNDA 2QA4A 1GVPA 1MGSA 5CGKA 1V9PA 2PNRC 1HNZQ 4ZCKA 1CKMA 1O7ZA 2Q2IA 2UU9Q 4AQYQ 3CCUA 4V0BA 3TDQA 5DAUA 2QDBA 4A3EG 1HA6A 3HOUH 2N78A 2B8FA 3KDFB 4OXPA 4ZUJA 5FLMG 3OPOA 2IHFA 5M5XB 2EY1A 1VMCA 2XIWA 3BG3A 2I07B 1PYWD 1PTOB 4QL5A 1SFOB 4A3IB 4XXEA 2I46A 5JEAJ 2D0PA 5TSSA 4LF7Q 4DR3Q 2VNUD 1Q82C 3I4NH 4DR2Q 1X9NA
chains in the Genus database with same CATH topology
4N8X1 4JW0A 4I7AA 2Z9HA 4JVZA 5L37A 2QW7A 2RCFA 2HD3A 4N8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N8X 1;  4JW0 A;  4I7A A;  2Z9H A;  4JVZ A;  5L37 A;  2QW7 A;  2RCF A;  2HD3 A;  4N8F A; 
#chains in the Genus database with same CATH topology
 3A5Z B;  3NBH A;  2CFM A;  4XQN A;  1LTG D;  1SDF A;  2F0P A;  4X66 L;  2HHH L;  3IAY A;  3Q24 A;  4TRD A;  1HRJ A;  2D62 A;  4JI1 L;  3QOL A;  3OMC A;  4DV3 Q;  4FP5 D;  4XYQ A;  4DUZ L;  1JOQ A;  3GTJ B;  1VQC A;  2NN6 G;  5T1I A;  1HUN A;  3E0J A;  1YEZ A;  2AHO B;  1OO9 B;  4LWC A;  3VA5 A;  2M2L A;  1Y8P B;  1U0L A;  4BY7 G;  5C4Z A;  3K8A A;  5C4J H;  1E1O A;  3U4V A;  3FVQ A;  3KDF A;  2K50 A;  3R93 A;  3OMG A;  3Q23 A;  4CKB A;  3K58 A;  1D5Z C;  2B2U A;  3S16 H;  3BDC A;  4NMZ A;  1LAC A;  3S1Q H;  2DY7 A;  4LF5 Q;  4RCO A;  3OWF A;  2B29 A;  4QJF A;  4DR4 Q;  1A6X A;  3U50 C;  5JPM C;  1YI2 A;  2Q2H A;  4CDE C;  2VQF Q;  2MJ8 A;  1QE6 A;  1A62 A;  1EYD A;  1X3E A;  2EXD A;  3S17 H;  5JPN C;  1J9O A;  3L3O C;  3T1H Q;  2OWO A;  1VQ6 A;  2EJG C;  2BE5 C;  3IFD A;  3T1Y Q;  2NTT A;  5FO7 B;  3G4S A;  1R4Q B;  4RH6 A;  1PH9 A;  5I9P A;  2K4K A;  1XTC D;  3CCS A;  4A3M H;  2HT1 A;  3PUX A;  2EQS A;  1AP0 A;  1BVS A;  3O13 A;  4JBW A;  4A3C H;  2NZ1 D;  4N9P A;  4NB3 A;  4XTC S;  3R2T A;  4K6L A;  2A69 C;  4L5T A;  2V4D A;  4L5S A;  3DHQ A;  2NVX B;  1RHP A;  1TY0 A;  1FVI A;  4XIG S;  3M9B A;  1HZ9 A;  1RIP A;  1XNR L;  5EKI A;  4DNT B;  5KEE A;  4P2C B;  1BBW A;  1UNS A;  4DK1 A;  1H9R A;  1BR9 A;  3OTO L;  3C1F A;  5M3F H;  1MI2 A;  4B3M L;  3TBI B;  3D6C A;  2QEJ C;  1YNN C;  3W5O A;  1ML0 D;  1F77 A;  2D9U A;  4KN4 C;  1EQV A;  4ZQ3 A;  1QIL A;  4XQJ A;  1F2M A;  4FF4 A;  3S1R H;  2JA7 B;  4ME5 A;  4IPD A;  1JT8 A;  2CVR A;  2QGQ A;  5T1G A;  5C44 H;  1Q90 A;  5BN3 A;  1Y1V H;  1B9N A;  4FF1 A;  4DR6 L;  1P8L A;  4C1N I;  5ELB A;  2E5L L;  2C9O A;  3C46 A;  4PZ6 A;  1WTW A;  1LTT D;  2MGS A;  3NWT A;  2G9H D;  2WB1 E;  2R92 G;  2Q8T A;  1E2W A;  5C0X J;  2R7F A;  1FR3 A;  1D5M C;  2QDL A;  1NMF A;  4K5V A;  2WAQ E;  5FKA C;  1Q8K A;  1N36 Q;  2UXC Q;  2RQX A;  1O80 A;  1PLF A;  3TEH B;  4QUC A;  3FP9 A;  5IOD A;  4FF2 A;  1SJE D;  1SLJ A;  1FNU A;  3HOZ H;  1R4P B;  1QWY A;  2ALY B;  3RZD H;  2J4X A;  3TP5 A;  3WDN A;  1X54 A;  2F4I A;  4B3S Q;  4OWW B;  4KTA A;  4KY6 A;  3D0F A;  2M9V A;  4DNR B;  3RN5 A;  2X6G A;  2EY5 A;  1TS2 A;  1N9W A;  2RDG A;  4LFA L;  4EQP A;  1BF4 A;  2RA4 A;  3K7A B;  2F4V L;  3HKZ B;  1E1T A;  1VQF A;  4LAA A;  3MEH A;  4C3J B;  2CH4 A;  3TSS A;  5IOC A;  4HJ7 A;  2E74 C;  4L5R C;  2K7V A;  2AWO A;  2IW3 A;  4X3U A;  1YNJ D;  1N33 L;  2K75 A;  1B70 B;  3VR2 A;  3GDE A;  1HZC A;  1LT6 D;  3W1B A;  1HHV A;  1NAP A;  1EIG A;  3RZO H;  2BE5 D;  1JQY D;  4B3T L;  3MVV A;  1LM0 A;  3GTM B;  1VQ5 A;  1HJP A;  3FKI H;  1YHB A;  1M4V A;  2ICE C;  2KUM A;  4LUV A;  3VA7 A;  4CDC C;  2MNA A;  5HUR A;  2KHS A;  1KHI A;  4HAE A;  3URY A;  4OHJ A;  1I4R A;  1STG A;  1DGS A;  1JWS D;  1JCK B;  4K8J A;  4KI0 A;  4OIJ A;  1LTI D;  5E4W C;  4POF A;  4CJ0 B;  2WB1 G;  2WV6 D;  1SRU A;  1I4H A;  3CW2 C;  3QJY A;  1SYC A;  1NJI C;  1SYD A;  1IZ6 A;  1SE8 A;  1EZ8 A;  1VS0 A;  1HNX Q;  4A3I G;  1VF5 C;  3TS2 A;  4X64 L;  1DD2 A;  2Q8R E;  2PW5 A;  3I2Z A;  4UPA A;  2F0W A;  4BWG B;  1SEB D;  3E6Z X;  4OWT B;  1I94 L;  3F2B A;  2N49 A;  2B2W A;  3QR8 A;  1ESF A;  1UUP A;  1SNP A;  1PH4 A;  3TZU A;  3NWS A;  1WCM H;  2B2T C;  4YWK A;  2BOS A;  4F88 A;  3S2H H;  4DK3 C;  4JI7 L;  1JOR A;  1EYC A;  2F1M A;  1S4Z A;  1X32 A;  3GTL H;  2JA5 B;  3I4L A;  1B8A A;  4GLA C;  3ONA B;  5ELO A;  2V1C C;  3K80 C;  5C3X A;  1UE1 A;  3MFG A;  3S9W A;  4ME3 A;  3CF5 A;  3TQY A;  2O5I C;  5EJW A;  1CQV A;  2RDF A;  1HZB A;  5GAD C;  4C2M H;  2PNH A;  2Q8I B;  4WJ4 A;  2O2L D;  4A3F H;  5C5L A;  3K5N A;  1DM0 B;  4KHV A;  4DXG A;  5HY6 A;  3KF8 B;  1QNU A;  2ZJQ A;  2KEE A;  4J6H A;  3BDL A;  4A3J H;  5GQO A;  4DV3 L;  1ZYR D;  5IYB G;  3OW7 A;  3N6R A;  3SDZ A;  2E2D C;  3NK9 A;  4FVM A;  3HOX H;  4IPC A;  3CCE A;  3D4W A;  2KHJ A;  4FF3 A;  1TWA B;  3PO3 B;  1QJO A;  3AYH B;  1TWH B;  3C1E A;  2NN6 I;  2K5N A;  1RCV D;  3DEP A;  4A3D B;  4PV1 C;  4P71 A;  1DCZ A;  1JE4 A;  3ZJY C;  1EU4 A;  2F0I A;  2K6A A;  3KLR A;  5EQ0 A;  3HOU B;  1L2F A;  1U4P A;  4MZ9 A;  4RHR A;  4C3I H;  1JB7 A;  3J81 L;  4A3G H;  4LF5 L;  3J7A F;  2FIN B;  2DNC A;  5M3M B;  5IGF A;  3CD6 A;  4UAI A;  5L37 A;  1VQL A;  4GOP B;  1YVC A;  1F9S A;  1X56 A;  1SMY C;  4A3B B;  1SRO A;  1Y8N B;  2L9H A;  1G2S A;  4AYB B;  3BZC A;  2MPM A;  4KHZ A;  3HGB A;  1B1Z A;  3OOC A;  3KF8 A;  5IIF A;  5KYI A;  2LKV A;  4U68 A;  2JA7 G;  3W1G A;  4YWL A;  1M90 C;  4BS9 A;  3P7J A;  1KDA A;  3SK4 A;  2DY8 A;  2HQE A;  3TZD A;  1A3V A;  3J80 i;  4GN4 B;  2VY3 A;  3LWU A;  3M4P A;  4WFN 3;  4GKJ Q;  2BDN A;  1MBY A;  4B3R Q;  1YBY A;  2KJX A;  2PMZ B;  4AH6 A;  1L1O C;  1FGU A;  3NE5 B;  1AEX A;  1HPC A;  4BBS H;  4GNX B;  4IUR A;  3PUW A;  4DF7 A;  1JE5 A;  5FJ8 H;  1RTO A;  3BDO A;  4L5Q A;  1G29 1;  1QVF A;  5G3L F;  4DA2 A;  1WI5 A;  2HD3 A;  3BJU A;  5LMN W;  4C3H H;  1KRS A;  4ZK9 B;  1TKW B;  4PZ7 A;  3UE1 A;  2UXD L;  4JK1 C;  1FD7 D;  1A8V A;  3L9A X;  2B2V A;  5C3E H;  3K5O A;  1RD9 D;  1DZ1 A;  4PZ8 A;  3NPP A;  4NXM Q;  3ZYY X;  1HCZ A;  2JN4 A;  4EX5 A;  1TU2 B;  1EQQ A;  3HKZ G;  1KLG D;  3M4Q A;  4JI3 Q;  2F0G A;  1K9M C;  4C3J G;  2ZTD A;  3A5U A;  2G5D A;  2Z6K C;  1K83 H;  1Q1B A;  2NVT H;  1SE4 A;  5I6W A;  3K59 A;  1XMO L;  3UDF A;  3T4A C;  1PTO F;  2UUA Q;  2AUJ D;  2UXC L;  1RL2 A;  1GXD C;  4PMW A;  1F9R A;  1ET9 A;  5JJZ A;  4QGU A;  1TY2 A;  3PO2 H;  3CCV A;  3J81 c;  1KAA A;  3SK5 A;  4IZ8 A;  4ULL A;  2A1A A;  1IBM Q;  1XX8 A;  2XSC A;  5EKK A;  2A74 C;  5IYD G;  2ZTC A;  3DWP A;  3GD7 A;  4DN4 M;  5FO8 B;  2R7Z H;  4DAY B;  5IP7 G;  4A4I A;  3ND8 A;  4MNO A;  4IUV A;  1NR2 A;  3S1R B;  4JV5 L;  2L11 A;  2B2Y C;  2RDH A;  3UE0 A;  4IFD G;  1EY0 A;  2EYF A;  3MFY A;  5IYC H;  1PH8 A;  4DV1 Q;  5A2Q L;  3A8K E;  3LGJ A;  4DR1 L;  1Y1V B;  4GLX A;  1L0X B;  1CHP D;  2FXQ A;  1J5E L;  2UUB L;  1EL0 A;  4K5W A;  4BXX H;  1JJC B;  1CHQ D;  4JI6 L;  2G9D A;  4JI2 L;  2KQ3 A;  3H0G H;  2MUY A;  4R4Q A;  5FOB B;  4DV6 Q;  2B63 B;  1S5B D;  3HKS A;  1SNQ A;  2NVY H;  1MJE A;  2ICI A;  1YJ9 A;  3NBI A;  5CV7 A;  2NVQ B;  1E3P A;  2XRQ D;  4K5X A;  1EWH A;  4JOI C;  3BVZ A;  1YIT A;  3ICE A;  4OO1 H;  4ILW A;  3J80 E;  2ZXR A;  2JA5 G;  3GV3 A;  1CSQ A;  1GO3 E;  3S14 B;  1GUT A;  2PZT A;  3TN2 A;  4H7B A;  4DAY A;  1A15 A;  4H0L C;  1PRT B;  1GD7 A;  3H6M A;  3J7Z C;  1G6P A;  1S3O A;  4EQ5 A;  1EY9 A;  4R4O A;  1HFN A;  1WD1 A;  3EA6 A;  1VQB A;  3HRZ C;  4HED A;  4R8I A;  2WKC A;  2E2J H;  5AJ3 Q;  4YIJ A;  5C4X G;  1CSP A;  4PQX A;  5DNF A;  4CDD C;  4WRD A;  1AFP A;  3GTO H;  1W6K A;  3GTK B;  2XWJ B;  5K36 H;  1MSG A;  1TVX A;  4HSV A;  5AFW A;  4JI5 Q;  5IP9 G;  3G6E A;  2QEX A;  1G8Z D;  3HS0 C;  2QCP X;  5CBA E;  1O78 A;  3HEJ A;  2F0J A;  1BCP B;  2VB3 X;  4QCL A;  2ZXP A;  3PF5 A;  5COY A;  3PO3 G;  4A3K B;  3T53 B;  2OXP A;  2PI2 E;  4ZAI A;  2WIN B;  3RLN A;  4BY1 B;  3I4O A;  4A3D G;  1PZI D;  1U5K A;  3FKI B;  3CRL C;  4XYO A;  1PVO A;  2F52 A;  1HA5 A;  1K8M A;  2IPK D;  2DJG C;  3D31 A;  3CP0 A;  1EUJ A;  4Q5V A;  1TS3 A;  4J15 A;  3C2P A;  3ULL A;  1U4L A;  5LMN Q;  1ICF B;  2JQO A;  4DV2 Q;  5M3M G;  4NPS A;  1H9K A;  3VYT A;  1DXM A;  4P74 A;  3P20 A;  1PH6 A;  3BVG A;  2BH8 A;  3M7N A;  4A3B G;  4LFC Q;  1ILQ A;  3GV6 A;  2XNA C;  4YCU A;  2FHT A;  4X65 L;  5CV6 A;  4AYB G;  1NE3 A;  2OTJ A;  1UE5 A;  4KK7 A;  2EZV A;  1AZP A;  4LF8 Q;  1LAB A;  1SYF A;  4KN7 C;  4POG A;  1PH1 A;  3I4M H;  2K01 A;  1RKN A;  2HUG A;  5HGT A;  5JJK A;  3S2D B;  4Q0F A;  2ASB A;  2LY7 A;  4JC0 A;  5JAV A;  1SNO A;  1JJG A;  1NR4 A;  4IOA A;  1HNW L;  2K28 A;  5F2D A;  2Q2U A;  3HOW H;  2XVS A;  1GJX A;  5ELN A;  3V2T A;  3TME A;  2VQE L;  3CRK C;  5IGC A;  1K8O A;  1TR5 A;  3T16 A;  3I73 A;  3NEM A;  3PIO A;  1N34 L;  1VQ9 A;  4HCE A;  1HH2 P;  4IJH A;  3I55 A;  3BZD B;  4KKU A;  4O1N A;  4LF9 L;  4I65 A;  4RGN A;  3X3M A;  1TS4 A;  3FPP A;  1OXT A;  1HTL D;  3OHX C;  1PDQ A;  3JAM i;  1A63 A;  1CFM A;  2JA6 H;  4DUY Q;  3GTQ B;  1EY4 A;  4MTK A;  3AU7 A;  3JAM L;  4CKC A;  1LTB D;  3VYS A;  4A3J B;  3RN2 A;  4R1J A;  2K5D A;  4DV0 Q;  1PTO D;  4GKJ L;  4X3T A;  3I90 A;  3HOX B;  1EOV A;  5IT9 L;  1H9M A;  1NUC A;  4LFB Q;  3MC0 B;  4DV7 Q;  3EFX D;  2LMC B;  1LT3 D;  2HDL A;  2VS1 A;  2Z4I A;  2IX0 A;  3M3Y B;  3KUP A;  1F9Q A;  1FJG Q;  2ZM6 Q;  5C0X G;  2A6E C;  4TKO B;  2E2I B;  3QOJ A;  5BN4 A;  3F2C A;  5HGQ A;  5EKL A;  2IHE A;  1X3P A;  1PYS B;  4A3L G;  4Y7N B;  1CI3 M;  2Z1C A;  4LMQ D;  4JI4 Q;  5KNB A;  2I5M X;  1E7Z A;  5IE8 A;  1D2B A;  1YNJ C;  4GKK L;  1TWC H;  2Y0S B;  1XNQ Q;  2MP1 A;  1I50 H;  3CPF A;  3HZX A;  5CYU A;  5IWA Q;  1HQR D;  2VZA A;  5D3I B;  1PH3 A;  1MSH A;  1JIC A;  4OON A;  1JB3 A;  1TWF H;  2K14 A;  1PMR A;  1Y1W B;  5EBD A;  4ZKC B;  3KYH C;  1AN8 A;  4OWX B;  5K5P A;  2QW7 A;  1V1P B;  1Y1V G;  3Q8D A;  3K6O A;  2CKZ B;  3NEL A;  4FYD A;  4CJ2 C;  2IT1 A;  1X65 A;  2NN6 H;  2L55 A;  2BDO A;  4YCV A;  1TWG H;  1PH2 A;  3GTG H;  2B63 G;  4BY7 H;  4IUN A;  3EIV A;  2YTX A;  2Z0S A;  5GAG C;  2F0V A;  3PUV A;  1GUG A;  2YYZ A;  3D6W A;  3ND9 A;  2NTS A;  1MD2 D;  1ENC A;  3B6Y A;  3TP8 A;  3SE0 A;  4DR7 Q;  4K14 A;  4JI8 Q;  4OX9 Q;  3K0Y A;  5C3E B;  3CC4 A;  3RLF A;  3JAM c;  2JA9 A;  4DV1 L;  1UE6 A;  2KCC A;  4E6I A;  1F2Z A;  1Z9F A;  2NYZ D;  2I0Q A;  4IFD I;  1V1P A;  2K32 A;  1HR0 L;  1N32 L;  4OEL B;  1VQI A;  1B44 D;  1KIX A;  3S15 H;  4BBR B;  2VUM G;  1CA6 A;  5IT9 c;  1K3R A;  3EBE A;  1V8Q A;  1IBL L;  5KRU A;  5EPJ A;  4Y52 H;  1CKN B;  3JAM E;  5M5Y H;  4F7X A;  2HCI A;  3CKI B;  4RGO S;  2BA1 A;  5JVG 3;  3DM1 A;  4I7A A;  3NHH A;  4P73 A;  5J39 A;  4LF6 Q;  3HFZ B;  3TS0 A;  1XMQ Q;  5FLX L;  3M4O B;  4A3K G;  4DV4 Q;  2EE1 A;  4LUO A;  4UHV A;  4BY1 G;  1IYJ B;  3FKI G;  4YCW A;  3PV0 A;  1D7Q A;  2K52 A;  1JOK A;  1ZYR C;  4O0A A;  5CC4 A;  1M8A A;  1VDZ A;  2RCF A;  1EOT A;  4TSS A;  2R7Z B;  4N9T A;  5I2X A;  1J6Q A;  5GAH C;  5JJL A;  2A6E D;  1W6J A;  4H13 C;  1NBW A;  4EQN A;  1XWE A;  4YWM A;  1B4O A;  4JCV E;  2KA7 A;  4QIW B;  1I3Q H;  2CHB D;  3S1N B;  1QOH A;  4JI0 L;  4UP8 A;  1HXY D;  3ERO A;  2AQ2 B;  2BCO A;  2RVL A;  2UXB L;  3Q22 A;  1CKN A;  2ID0 A;  5J3B A;  1PZJ D;  1EWI A;  3H0G B;  4DK0 A;  4YHH Q;  1KD1 C;  4CDF C;  4PNY A;  3EVQ A;  2JXM B;  2H1E A;  4L6T B;  2R92 H;  1BQQ T;  5M9O A;  3OIQ A;  3BYY B;  2AQ3 B;  2IX1 A;  2R93 H;  1CQF A;  1HZA A;  2AQ1 B;  2M00 A;  3J7Y W;  1WFQ A;  5D3D A;  2F3V A;  3HOY B;  2F0Q A;  3CQZ B;  1JC7 A;  4F8M A;  1EYG A;  1EY6 A;  1XPR A;  1AZQ A;  1EQR A;  1BBX C;  3GP7 A;  4X62 L;  4A93 B;  2L12 A;  3CC2 A;  2F0D A;  1B7Y B;  3NP8 A;  1UEB A;  1Y8O B;  4X6A H;  5M5W B;  2E8G A;  1RDP D;  3KK7 A;  2E2J B;  4NW2 A;  1HNZ L;  2JA8 B;  3T13 A;  4GZY C;  2UU9 L;  4K0K Q;  3TRE A;  3DWA A;  3MA2 B;  4AQY L;  4A3J G;  3I91 A;  1EEI D;  3GTP B;  2ENB A;  1CK1 A;  1GKH A;  4ALP A;  1LTR D;  4IUT A;  1F2L A;  5FLX c;  2CQA A;  3K81 C;  3NTH A;  2VW9 A;  5LMU Q;  2EY2 A;  3KJO A;  3E9H A;  1B3Q A;  3RUZ A;  4KHP Q;  1DOM A;  5KIX A;  2E2H H;  4FNF A;  4LF7 L;  2QIL A;  4DR3 L;  1XPO A;  4DR2 L;  4XDX A;  1II3 A;  1U9R A;  5M5X H;  1CZW A;  1I6H H;  1QUQ A;  4DV5 Q;  2Y0S G;  4DR5 Q;  4TQU S;  1CZG A;  1PTO H;  1A3U A;  2EIF A;  2P5Z X;  4A3I H;  3DMU A;  1SAP A;  1Z47 A;  2F0E A;  2KVM A;  2MO1 A;  3TRZ A;  4KD4 A;  5KNC A;  3K7U C;  2F0L A;  4P72 A;  1E2V A;  1OXV A;  3X3N A;  1Y1W G;  1YJW A;  3OSO A;  4LFB L;  2EJM A;  4RAU C;  1PRT F;  1B53 A;  5COR A;  3J81 i;  3DLL A;  4QY7 A;  4OIK A;  1FJG L;  1KAW A;  3HOW B;  2Z6B A;  3HKZ E;  3FDT A;  1SND A;  1DJR D;  4DAP A;  4K2L A;  3MHB A;  4DR4 L;  5C0X I;  2CH4 W;  3P75 A;  4JG2 A;  2N3S A;  1WJJ A;  4FXD A;  1Z6H A;  1EWC A;  2EXZ A;  5FJ8 G;  3VDY A;  4O2D A;  3PIO 3;  1STB A;  2VQF L;  4J1M A;  3U9O A;  2Z4H A;  1BCP F;  1CUK A;  2F0K A;  3I4N B;  3T1H L;  2RHS B;  4B9X A;  2KCN A;  1I4G A;  5NUC A;  3T1Y L;  4ABN A;  1SBB B;  4IPH A;  2EJF C;  1SJH D;  2NB0 A;  5E1F A;  1SE3 A;  5EGT A;  4HTH A;  5IYB H;  1D1I A;  2F03 A;  1KL9 A;  1FYC A;  2D5D A;  4X66 Q;  4G7Z C;  2HHH Q;  4BBR G;  1VQE A;  2PYK A;  3OWE B;  1RJT A;  5C4J B;  4DAM A;  4JI1 Q;  2XN9 C;  4DUZ Q;  1QVC A;  1STE A;  2GVB A;  5DEH A;  3D4R A;  3S16 B;  2F0M A;  4JW0 A;  2NVX H;  1SNM A;  3S1Q B;  1B50 A;  1V1Q A;  4DFA A;  1VQO A;  1BO0 A;  1WYD A;  1B9M A;  3PSI A;  3STB C;  4DR7 L;  4ID6 A;  2GVA A;  1G51 A;  4JI8 L;  3PQI A;  1GUS A;  4RKL A;  1HFG A;  5I9O A;  3S17 B;  1WD0 A;  2R7Z G;  1SR3 A;  3KLS A;  1VQ7 A;  2MQH A;  1LT4 D;  2PZU A;  3TP7 A;  1IBK Q;  3ERQ A;  5CMD A;  3EJI A;  1BBU A;  2KBN A;  3A55 A;  4JVZ A;  2JA7 H;  1K8A C;  3PF4 A;  5JVH 3;  5C5M A;  3H09 A;  4A3M B;  2PCF B;  5IYC G;  2KHI A;  2FFK B;  3D8G A;  4PMC A;  1AH9 A;  3PGZ A;  1LTS D;  1NMG A;  1D6E C;  3A54 A;  4CJ1 B;  4BXX G;  1N36 L;  3H3V I;  4J8Q A;  3E9I A;  1SSO A;  1STY A;  2RBM A;  3GTG B;  3A56 A;  2B2T A;  2HIX A;  2EVB A;  2KED A;  2KCT A;  1ZKO A;  2EDG A;  2R7D A;  3W3A A;  4M8A A;  4R4I A;  4KV6 A;  3MWY W;  5M3F B;  5IGE A;  4B3S L;  1STA A;  1EIF A;  4RGT A;  3HOY G;  1YZ6 A;  4OO1 G;  1XNR Q;  1ZEQ X;  2EYJ A;  3FEW X;  3Q0A A;  4IO9 A;  3H91 A;  3J81 E;  1GUW A;  3DUZ A;  1L0Y B;  3SGI A;  2BA0 A;  2H4O A;  4A93 G;  2AUK A;  2RKS A;  1NSN S;  3OTO Q;  1UAP A;  4IAL A;  1PFS A;  3KLW A;  4B3M Q;  5C44 B;  1J8I A;  1KTK A;  1H95 A;  2JA8 G;  3K7A H;  2MFI A;  3R8B A;  3M7G A;  1IYU A;  4C3J H;  3S15 B;  4ZLT F;  3I3C A;  1CT1 D;  1V43 A;  2IWH A;  2EYL A;  2RF4 A;  5E3F A;  4L63 B;  1S5C D;  2ZXO A;  5M5Y B;  2ZTE A;  1BXT A;  2CW0 C;  2E5L Q;  3NEN A;  4AYB E;  1E0B A;  1WTH A;  2YTY A;  3A7L A;  1ONL A;  4HID A;  1L1O B;  5I2Y A;  3HOZ B;  2OCE A;  1C0A A;  2ES2 A;  3RZD B;  1IYV A;  1KNE A;  2B2U C;  4C1N K;  5KYL A;  1G6Z A;  5ELF A;  3MEF A;  3HOV H;  4IUU A;  4N8F A;  3SXH A;  1PTO C;  1UE7 A;  1ENA A;  3KBX A;  1HNX L;  2CQO A;  4ZUI A;  3VYR A;  5IYD H;  4QMG A;  5LL6 S;  1ET6 A;  4PMB A;  5IP7 H;  2PMZ E;  1TS5 A;  2FMC A;  2HQL A;  1PH5 A;  4FO2 A;  3STB D;  1I3Q B;  4IFD H;  2R61 A;  4KLK A;  3AB9 A;  1D5X C;  1K28 A;  3HG9 A;  4DPG A;  4H02 A;  1DON A;  4LFA Q;  2MHV A;  3V05 A;  3R2I A;  3I72 A;  2MO0 A;  2L1B A;  3K5L A;  2UUC Q;  3KOJ A;  1OXU A;  2TMP A;  4A75 A;  3RZO B;  4AIM A;  5D14 A;  1A2U A;  2K5H A;  2PQA B;  3HP3 A;  2YU9 H;  2R93 B;  1L1O A;  1GUN A;  1N33 Q;  4K6D A;  5LMU L;  1XYI A;  1SYE A;  4IUQ A;  3HOU G;  5I4D A;  1EU3 A;  1A3T A;  3PIP A;  1V1O A;  3HOW G;  2L0C A;  4ZRZ A;  2O4X A;  1BCP D;  2JA5 H;  2K04 A;  4B3T Q;  2K5V A;  2HDM A;  4MIU A;  5ELE A;  5LL6 X;  4WOR A;  5C4H A;  4APV A;  4RGM A;  3DM3 A;  4U67 3;  3BVM A;  3G71 A;  2VL6 A;  3QG1 A;  4DR5 L;  3A8J E;  3KF6 B;  1FNW A;  3I4N G;  5LHY 1;  1X55 A;  2NUC A;  3H15 A;  2F3W A;  5C4X H;  5JEA H;  1XPU A;  5D65 A;  3NTI A;  4MTN A;  3I56 A;  1A0I A;  3T56 B;  4LF4 Q;  1JWU D;  4CGY B;  1NCV A;  4X64 Q;  3R3O A;  5IP9 H;  5KGU A;  5A2Q E;  1VQD A;  4ODG A;  3F8T A;  1WCM B;  1JJ2 A;  3S2H B;  2Z6K A;  2AWN A;  1WTP A;  2PQA A;  1U4R A;  3T51 B;  5G3L D;  3GTL B;  4O42 A;  4EVO A;  1SN8 A;  3H94 A;  4G7O C;  1IW7 C;  1D1K A;  1TWA H;  4HJ8 A;  2JE6 I;  1I94 Q;  3PO3 H;  1TQO A;  3J7A V;  1TWH H;  4IOC A;  1ICW A;  2LFN A;  2A6H C;  1P16 A;  3RD4 A;  4A3D H;  5BR8 Q;  2A68 C;  1TXY A;  1STH A;  4JI7 Q;  5CV8 A;  2E2H B;  1KDB A;  3VR5 A;  4JPB W;  4C2M B;  3KJP A;  2CW0 D;  1DOL A;  3IL8 A;  3NTK A;  3D4D A;  1GHK A;  2X6L A;  1VCI A;  4A3F B;  5M3M H;  3KF6 A;  2WB1 B;  5IGB A;  2AMC B;  3VYU A;  2QF7 A;  2YV5 A;  1Y69 U;  4B9W A;  1I6H B;  1PFN A;  1LO5 D;  4G7H C;  2QKI C;  1OXS C;  4A3B H;  1E24 A;  2WAQ B;  2B2Y A;  2JEB I;  4LNQ A;  3RLO A;  1MKH A;  4GN5 A;  2NZO A;  2XWB B;  1LV9 A;  1ROD A;  4B3R L;  3PMF A;  1VQA A;  4KMU C;  2B8G A;  1IXR A;  2ZT9 C;  1PHJ A;  4A3M G;  4LUZ A;  4LW1 A;  4FDB A;  4A3C G;  2J0T D;  3V96 A;  2HCC A;  4DKA C;  3UDG A;  4KKT A;  2N8N A;  1AW7 A;  1TT2 A;  1BKB A;  4TVA B;  4A3E H;  3SK6 A;  1S5D D;  1Q8I A;  1TII D;  2A5H A;  3CHB D;  4C3I B;  4RWS C;  2OF1 A;  3WWV A;  1U4M A;  4A3G B;  5FLM H;  2EYP A;  1GUO A;  4I7Z C;  4JOI A;  2EYH A;  3G7L A;  3AFP A;  3E5S A;  3U9S A;  5H1S E;  1K0S A;  5M3F G;  1MHW C;  1YJN A;  3IRB A;  1OXX K;  4NXM L;  1QZH A;  3I8Z A;  1Q86 C;  4IPG A;  1ILP A;  1G91 A;  1IBK L;  3CPW A;  1WTX A;  1OTC A;  4JBM A;  4JI3 L;  3UDX A;  1VQG A;  3VR3 A;  5C44 G;  2A8V A;  2DJF C;  1E2Z A;  3ULJ A;  5JJI A;  1Q3L A;  3K5M A;  2IX3 A;  2UUA L;  2EPB A;  2KEN A;  4RKB A;  4QF4 A;  1Q1E A;  4K2K A;  3KBG A;  3VR4 A;  2B2W C;  1I4X A;  2R3Z A;  2K05 A;  4BBS B;  4V19 0;  2WKD A;  3D3R A;  2DNE A;  4B08 A;  2N55 A;  1GHJ A;  4DU9 A;  4R4C A;  3ULP A;  1IBM L;  5C0X H;  3RMH A;  3F2D A;  1VQK A;  4C3H B;  1KXL A;  4X3S A;  3MZ5 A;  3HOZ G;  1BNZ A;  4A3L H;  2X69 A;  1S5F D;  2GA4 B;  1G2T A;  1AE3 A;  4BA2 I;  1EFW A;  4G4K A;  2IL8 A;  2B3G A;  1IW7 D;  2I5H A;  4OO1 I;  4BA1 I;  5ELD A;  4L8J A;  2R6G A;  2ZJP A;  2A6H D;  1M1K C;  2FMM A;  5E4X A;  1MJC A;  1IL8 A;  2A68 D;  4UP9 A;  3L7Z C;  2JEA I;  2UXD Q;  3IFT A;  1WTR A;  3U4Z A;  1KDC A;  4DV6 L;  4N8X 1;  1MIU A;  3K0X A;  1K83 B;  2NVT B;  4QQB X;  5BN5 A;  3QWN A;  3KFU A;  5J1Z A;  3BU2 A;  2LS0 1;  4FXG C;  3NQI A;  1QZG A;  3N52 A;  5J22 A;  1NTG A;  4HN7 A;  3PO2 B;  2AKW B;  5IT9 E;  3JC6 6;  2B63 H;  3LX0 A;  1UWV A;  2PPB C;  5FK9 C;  3UI2 A;  3QB3 A;  2R93 G;  1XMO Q;  1BDO A;  2F3I A;  3LNN A;  2NBF A;  4C56 C;  1HTP A;  4R4T A;  4NXN Q;  2NVQ H;  1RF2 D;  1PZK D;  1CKO A;  2Z8L A;  4S3S A;  4NDX A;  4G57 A;  3DXJ C;  1LYL A;  5AJ3 L;  3K57 A;  2F0U A;  3S14 H;  1PFB A;  3MTS A;  1VQN A;  2EYO A;  1ESR A;  2WP8 J;  1WTQ A;  2KEC A;  2CWA A;  3BS1 A;  4JI5 L;  2YTV A;  4LJZ C;  4DGZ A;  2EYM A;  3CXC A;  1H9S B;  1X3F A;  3S1M H;  2F0H A;  4YY3 Q;  4JV5 Q;  3AQQ A;  3BYT B;  4KJO A;  1K3B C;  3QIA A;  2F0N A;  2NVY B;  2PQE A;  3NSW A;  5IGG A;  2UUC L;  3AMU A;  2KOL A;  3GTK H;  2LXK A;  3H3V H;  2VUM H;  1QB5 D;  1R9T H;  4DR1 Q;  2PO4 A;  4P75 A;  2Y0S E;  4A76 A;  3AFQ A;  2DUD A;  1J5E Q;  2UUB Q;  1WCM G;  2SOB A;  3FPU B;  4JI6 Q;  4JI2 Q;  3NUC A;  2RCN A;  1UEA B;  4OEM B;  4A3K H;  5LMN L;  4DV2 L;  2XRS D;  2FJ2 A;  3G6J B;  3UDI A;  4BY1 H;  4GOP C;  4KJN A;  3HOV B;  4IUP A;  1W3S A;  4LFC L;  2RSO A;  4JBK A;  1C8C A;  1QUQ B;  1VQH A;  2A69 D;  2J7Z A;  2B2V C;  2JSO A;  3FMC A;  3IKJ A;  5E7N A;  4UY8 C;  3PUZ A;  4A3F G;  2N88 A;  4LF8 L;  3GTO B;  4JYA Q;  2O5J C;  1SE2 A;  1H9S A;  3EN2 A;  3L2P A;  1DOK A;  3MXU A;  3QO2 A;  4HSP A;  2WAQ G;  4LF4 L;  4RHS A;  3CU7 A;  2K5Q A;  2ZJR A;  5JOB A;  3VR6 A;  1PFM A;  3HOX G;  3OIP A;  1YNN D;  2L5T A;  1VQP A;  3Q6S A;  1KAB A;  3C3L A;  4GNX C;  1ASY A;  2YU9 B;  3S2D H;  2F0T A;  4GS3 A;  3I7F A;  1LT5 D;  1ZXT A;  4DNI A;  3I70 A;  4IQZ A;  1EIH A;  5BR8 L;  4C3I G;  5A35 A;  4CHT B;  3S24 A;  4A3G G;  4OGQ C;  4NP5 A;  3PIP 3;  3KLS X;  1IKL A;  5FLX E;  2OT2 A;  2CWP A;  4DUY L;  1ASZ A;  4F87 A;  2XTI A;  1I4P A;  1SFO H;  2LSS A;  1E22 A;  1I6V C;  2VXW A;  2SEB D;  1EEF D;  4DV0 L;  4HJ5 A;  2LXJ A;  5C4X B;  1QNK A;  1T9H A;  1PH7 A;  2SDF A;  1KC8 C;  3I4M B;  5EPK A;  2SNS A;  1FGB D;  3CCR A;  3GTQ H;  1CTM A;  4DV7 L;  2OQK A;  3CAM A;  1D8L A;  3CME A;  2E75 C;  4X65 Q;  1HR0 W;  1CA5 A;  2WII B;  4HIO A;  2ZM6 L;  1Q81 C;  1C48 A;  2JJQ A;  3GTJ H;  3A0J A;  5I6Y A;  3CCM A;  1A2T A;  4NKL A;  4IJL A;  4K8I A;  1VMP A;  4BBS G;  3SR1 A;  4GN3 B;  4KKS A;  1EQT A;  1S40 A;  3GO5 A;  3EQL C;  4QIW E;  4RFB A;  1F9P A;  3RNU A;  4JI4 L;  1I5F A;  3M3Y H;  5CV5 A;  3AEV A;  1SNC A;  4ZKB B;  2I5L X;  4WJ3 M;  1XNQ L;  4IN3 A;  2E2I H;  1PXU A;  1VQJ A;  1XXG A;  4UDU C;  4C3H G;  1HNW Q;  5CR3 A;  4QB4 A;  1SYG A;  2VQE Q;  5IWA L;  4RA8 A;  2JP1 A;  4Y7N H;  2JA6 B;  1FL0 A;  5C3E G;  1N34 Q;  5FO9 B;  1NNX A;  3FRP B;  3SK8 A;  2E76 C;  4HMJ A;  1F2Y A;  4LF9 Q;  1EY8 A;  1IL2 A;  4WJW A;  2EY6 A;  1EY5 A;  1T5X D;  4RG1 A;  2TSS A;  2D2C C;  2ATW A;  1T5E A;  2K33 A;  5EAY A;  1KQS A;  1Y1W H;  4HIK A;  2PW7 A;  1I4Q A;  1LTL A;  2GN5 A;  2VB2 X;  1LUZ A;  5CV4 A;  2IJ0 A;  4A3E B;  2F0S A;  2B39 A;  3J80 L;  3ER0 A;  1NY4 A;  1EYA A;  1O7Y A;  3E3X A;  3M4Y A;  3MXG A;  3PO2 G;  3OYY A;  3A7A B;  3NXW A;  1Q12 A;  4M1U B;  4OX9 L;  1ENF A;  4EGV A;  1X6O A;  1TWC B;  2C35 B;  1PRT C;  1EZ6 A;  1QVG A;  1I50 B;  2CCZ A;  4OL7 A;  1L0W A;  3A74 A;  4X3K A;  4FXK C;  4GOP A;  3PCO B;  1EY7 A;  1TWF B;  3SEB A;  2Q2T A;  3PUY A;  4CKE A;  2XGT A;  1IHZ A;  4R9W A;  4RMF A;  4GKK Q;  5DM6 3;  1LTA D;  3H3V C;  4RCN A;  1K8G A;  5CV9 A;  4HR7 B;  1WVL A;  1PYB A;  1Y14 B;  2WFW A;  5IY0 A;  1YHA A;  1BCP C;  3OW2 A;  1TWG B;  4KY7 A;  3H0G G;  1YIJ A;  4LF6 L;  1XMQ L;  4QUF A;  1VQ4 A;  2A73 B;  4DV4 L;  3TP6 A;  4DK6 C;  4BY7 B;  4DXF A;  5DLQ E;  4BBR H;  5C3W A;  3CCQ A;  1PA6 A;  1H9J A;  4GLV B;  3P1H A;  1B2T A;  3NQT A;  2JYO A;  1O7L A;  4ZYS A;  1RTN A;  4NXN L;  2OQ0 A;  4GNX A;  4MHE A;  1AE2 A;  5EPL A;  4HIM A;  3L0O A;  1VQ8 A;  3CCJ A;  3M4O H;  1JMC A;  1WOC A;  1SYB A;  2Z9H A;  5ELC A;  2JK8 A;  3HOV G;  3GQB A;  3U58 A;  3FHW A;  2PI2 A;  1SXT A;  4H44 C;  1N8R C;  1VQM A;  4XQQ A;  2RHQ B;  2KCM A;  1Z7T A;  1JOO A;  1X3G A;  3DEO A;  4R8N A;  5K36 G;  1CM9 A;  1IKM A;  4YY3 L;  2K03 A;  4PG3 A;  1Q7Y C;  2OTL A;  4YHH L;  1EFI D;  2WAC A;  2OEO A;  1YHQ A;  3J7A 5;  4DR6 Q;  1EIY B;  1Q46 A;  3S1N H;  2NWG A;  1SMY D;  3LWE A;  1N32 Q;  1HR0 Q;  3J80 c;  3M85 A;  1SMX A;  4KD3 A;  4HMI A;  3WOF A;  3GTM H;  1XJV A;  1IBL Q;  1GM5 A;  3ITP A;  3F2U A;  1DYQ A;  1HUM A;  1YNX A;  3MXP A;  1K73 C;  3DWQ A;  3HOY H;  1C4Q A;  1K0R A;  3CQZ H;  3CMA A;  4DAV A;  2L4N A;  5ISR A;  1KNA A;  3E0E A;  3SVM A;  5IGD A;  4A93 H;  4JYA L;  1LLR D;  4MN3 A;  4K0K L;  2NZH A;  1QCB D;  3F1Z A;  4XT3 B;  1X3Q A;  3MXN B;  1PRT D;  5C6A A;  4KY5 A;  5M5W H;  1W2B A;  4UP7 A;  1KLU D;  2F4V Q;  2BH2 A;  3S1M B;  4CBV A;  1BUV T;  1S72 A;  5JEA G;  4HCS A;  2JA8 H;  4Z9C B;  2PZW A;  3I4M G;  4HJA A;  2F0O A;  4EQO A;  1WTO A;  2R92 B;  1JR0 D;  3MAQ A;  2VUM B;  4JI0 Q;  4LK1 C;  1R9T B;  4XT1 B;  1GOZ A;  1WTV A;  5CBE E;  2L15 A;  3CC7 A;  1O7I A;  2UXB Q;  3SHL A;  1S5E D;  1STN A;  4KHP L;  3GTP H;  1JWM D;  1HQM C;  3CCL A;  2SNM A;  5DM7 3;  3W2D A;  3ERS X;  1C9O A;  1C7Y A;  2D0O A;  3J81 j;  2K1B A;  4HJ9 A;  1XTD A;  1BOS A;  5GAE C;  4JBJ A;  5EBC A;  4DV5 L;  2H5X A;  2C5C A;  2A19 A;  2HIV A;  1VF7 A;  2DGY A;  3WOE A;  2F0F A;  4IFD J;  1QG7 A;  1B3A A;  2DN8 A;  2RSN A;  5GRO A;  2JA6 G;  3MXN A;  4X62 Q;  2IY5 B;  2EOT A;  3BZK A;  2K5W A;  3G48 A;  1PV4 A;  1KRT A;  3A8I E;  3NBH B;  3RR5 A;  1FNV A;  5KND A;  2QA4 A;  1GVP A;  1MGS A;  5CGK A;  1V9P A;  2PNR C;  1HNZ Q;  4ZCK A;  1CKM A;  1O7Z A;  2Q2I A;  2UU9 Q;  4AQY Q;  3CCU A;  4V0B A;  3TDQ A;  5DAU A;  2QDB A;  4A3E G;  1HA6 A;  3HOU H;  2N78 A;  2B8F A;  3KDF B;  4OXP A;  4ZUJ A;  5FLM G;  3OPO A;  2IHF A;  5M5X B;  2EY1 A;  1VMC A;  2XIW A;  3BG3 A;  2I07 B;  1PYW D;  1PTO B;  4QL5 A;  1SFO B;  4A3I B;  4XXE A;  2I46 A;  5JEA J;  2D0P A;  5TSS A;  4LF7 Q;  4DR3 Q;  2VNU D;  1Q82 C;  3I4N H;  4DR2 Q;  1X9N A; 
#chains in the Genus database with same CATH homology
 4N8X 1;  4JW0 A;  4I7A A;  2Z9H A;  4JVZ A;  5L37 A;  2QW7 A;  2RCF A;  2HD3 A;  4N8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...