4JW0A

Structure of gloeobacter violaceus ccml
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
b'MQIGRVRGTVVSSQKEPSMVGVKFLLLQLIDEAGQPLPQYEVAADGVGAGLDEWVLFSRGSAARQVAGSEKRPVDAVVIGIIDTVSVDNRPLYSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Two new high-resolution crystal structures of carboxysome pentamer proteins reveal high structural conservation of CcmL orthologs among distantly related cyanobacterial species.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Structural protein
total genus 15
structure length 95
sequence length 95
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4jw0A00
4JW0A 4I7AA 5L37A 2Z9HA 4JVZA 4N8FA 2QW7A 4N8X1 2HD3A 2RCFA
chains in the Genus database with same CATH superfamily
1TY2A 1EU3A 4OWTB 1VQKA 5ISRA 1JJCB 4A3EG 3D6CA 2NWGA 2Q2TA 3KK7A 3RLFA 4ZUIA 3HKZG 1YBYA 2ATWA 1Z47A 4ZK9B 1EWHA 1UE6A 1PH7A 4HTHA 3KOJA 2HT1A 1E2WA 1PH6A 3HG9A 4CDDC 1STGA 2K75A 1EYGA 3OTOL 4LFBQ 1N34Q 4FF1A 4A3KG 3T1YQ 5IP7G 1XJVA 4H13C 1AP0A 1QNKA 1QVCA 4HMIA 2WB1G 2R3ZA 3K5OA 1VQ7A 4C1NK 3ICEA 2V1CC 2Q2IA 1MGSA 1GUWA 4DR3L 1G6ZA 4LF6Q 4PZ6A 1N33Q 3MXPA 1FJGL 2EJGC 1M8AA 5C3WA 5GAHC 1L1OA 1FNWA 1Z7TA 2AUKA 1KRSA 4DXGA 1C7YA 3NUCA 3KDFA 1PTOH 2FXQA 4DV7L 1HNZQ 2GN5A 1PFSA 3HEJA 3T53B 3PIP3 1RHPA 2VUMG 2QGQA 1E22A 1NAPA 4K0KQ 4C2MH 5FLXE 3ULPA 2HD3A 2O5JC 3OIQA 5I2XA 1A3UA 3TN2A 1VQJA 2N8NA 3GQBA 4KHPL 1DYQA 2TSSA 3O13A 1EY6A 4A3EB 2C35B 1C9OA 3R2IA 1EZ6A 1JOQA 1SSOA 4KTAA 1CKNB 4X3KA 3HKZB 1RF2D 1D1IA 2JK8A 2G5DA 4FP5D 4GS3A 2PNHA 4AYBG 4PMWA 2K50A 4GN3B 5A2QE 4DF7A 4KD4A 5L37A 3PIOA 1VQ6A 4K2KA 4HJ5A 1E0BA 4DUZQ 1Q1EA 3FMCA 2WB1B 4TQUS 2I07B 1GXDC 2A74C 1ASZA 2UUBQ 4A3BG 1EYCA 3NTKA 2JA8H 1F9RA 3JAML 2K03A 1GJXA 3J80i 1JWMD 2F0IA 3K5MA 1I4HA 1PH9A 1BBXC 1KDCA 1O7ZA 1G2TA 1PH1A 4DV3L 3QOLA 1VQOA 1EFWA 1PRTB 1FGUA 3S15B 1I94Q 1NUCA 2F0TA 3FKIG 2LSSA 1VQMA 2RSOA 1Y1WB 4IFDH 4GNXA 1NR4A 1CQFA 1KLUD 1TS4A 2ICIA 4FNFA 2ASBA 4GKJQ 4OO1H 5G3LF 2KEEA 3AYHB 4V190 1TWGH 4BY1H 5I4DA 3DEOA 4DR1L 5C44H 4FYDA 5FJ8G 4LF9Q 4DR2L 4ZUJA 4OIJA 4IOCA 3C1EA 1SMYC 2ZM6L 4CHTB 4ID6A 2EYJA 4DK6C 4DR7L 5K36G 3OW2A 5DNFA 2YU9B 4DV0L 1PXUA 1XMOQ 3EN2A 4WJ3M 4XT3B 3JAMc 4JI2L 1TXYA 1U4MA 4R4IA 2F0DA 1GKHA 1X3QA 2NYZD 3D4WA 4JYAQ 1KDAA 5KNCA 1DJRD 1STAA 4A93G 1S4ZA 1ZYRD 4DV4Q 2NN6G 3F2DA 3S1MB 3AB9A 4QIWB 3T13A 1EY5A 1GHKA 5CV9A 1G2SA 5DLQE 2BDOA 3MFGA 5C0XJ 3K59A 1TWHB 3ZYYX 2EYOA 1R9TB 2ZTDA 2A1AA 4LF4L 1YI2A 2EOTA 2OCEA 2K52A 5DAUA 2NVXH 1VQPA 4FXDA 3BDOA 2B8GA 2RA4A 1RTNA 3QB3A 3VYTA 2AKWB 3CAMA 4JI6Q 3DWPA 3PV0A 2UXCQ 2QCPX 4X66L 3M4QA 3EVQA 1GUGA 1RIPA 4A3MH 2K5DA 2FMCA 2QDBA 4GN5A 3D8GA 1LV9A 2R7DA 2E2DC 2ALYB 3T16A 5IIFA 1KDBA 3SGIA 3PO3H 4KHVA 1JB7A 5LMNW 1TWAH 4HIOA 4JI5Q 3ERQA 1RKNA 2KA7A 2RCFA 2JA5H 2AMCB 4HMJA 5IGBA 1Q81C 1JJGA 3L9AX 4R4QA 1I50B 3MXGA 5COYA 3WDNA 3S9WA 1KAAA 3TREA 3T51B 1PVOA 1HFNA 3J81j 3W5OA 4L5RC 3U4ZA 4QCLA 3NTIA 2D9UA 1BCPC 2H5XA 1WYDA 4POGA 2F0MA 4NP5A 5C4XG 4IPHA 1KQSA 4A3GH 1JB3A 2B63H 1NJIC 3OIPA 2CVRA 4X64L 1B3QA 3A7AB 1SYFA 1B3AA 4R4CA 3HOVG 4AQYL 5D65A 4I7AA 4X62L 1VQ9A 5M3FH 1CA5A 1WD0A 1E1TA 1DXMA 4DUYL 1I4QA 2OXPA 1LM0A 2F4VL 1TIID 1TU2B 1M1KC 4N9PA 2B2UA 5JVG3 1BNZA 4JI4Q 3VA7A 3HOUG 2C5CA 2ID0A 3BVMA 3H94A 1W3SA 4DR5Q 3SDZA 2FFKB 1M4VA 2PZTA 4HAEA 3GDEA 2CWAA 3VR2A 5E4WC 2PI2E 3TS0A 4JVZA 5DM73 4CJ2C 3U58A 4NMZA 4L5TA 4P75A 3BS1A 5AJ3L 3M7NA 5JOBA 2UU9Q 2J0TD 1K83H 1Q46A 4IUNA 4ODGA 3NE5B 3F1ZA 3PGZA 4APVA 5JAVA 3STBD 4MNOA 3RD4A 1CHQD 4LF7Q 4QIWE 4QMGA 1LTBD 2MQHA 3PO2H 2LFNA 1Y8NB 2YTXA 3ND8A 1K8MA 3KDFB 1TT2A 5IWAQ 2KVMA 4UDUC 5D14A 2A69D 1D7QA 3S1NH 5C4XB 1CKMA 3E6ZX 1HR0L 2WFWA 1HNWL 3NBHB 1AH9A 1WFQA 4X65L 1NMGA 3A7LA 2F0UA 4I65A 1IW7C 2X6LA 1LT5D 4HJAA 3HOVB 2NZ1D 1OXVA 4YY3L 3J81E 1O78A 4OELB 1U4LA 1SNPA 3L2PA 1EL0A 4C2MB 1STHA 4YCVA 1Q12A 5IYDG 2QDLA 5IGFA 4JOIA 1WTXA 4X3TA 1WVLA 1FJGQ 3HOUB 4IQZA 3X3MA 4HN7A 5EBDA 4DV2L 5JEAJ 3K57A 5CGKA 4OXPA 1DONA 2Z8LA 1D5XC 2K32A 4DK1A 3RZDH 3CCLA 1J8IA 4KJNA 4P74A 3W2DA 3CC4A 3X3NA 1KIXA 2BE5C 2FMMA 5M3MG 1O7YA 1IXRA 1EWCA 4O2DA 4HIDA 1K9MC 4JCVE 4UY8C 3M85A 2L5TA 3GTQH 4A3JG 1TY0A 2HQLA 4X6AH 2B8FA 4YCWA 5FKAC 5E4XA 4KY7A 4AH6A 1LTTD 4KHPQ 1WTOA 3I4LA 4B3SL 2KCTA 2JSOA 5FO9B 3HS0C 4Y7NB 1MD2D 2Z6KC 1PTOD 2JA8B 2VW9A 1X3GA 4LF5Q 4QJFA 1X3EA 1Y1VG 4CJ1B 2EQSA 2RCNA 5EGTA 4ULLA 4GNXB 4HCEA 3GTPH 1QCBD 2CHBD 1LYLA 4JW0A 2E75C 3D31A 4KKSA 2B3GA 3UE0A 2NZHA 3S16H 5LMUL 4PNYA 3CXCA 2RSNA 1QVGA 1D8LA 3K0YA 3S1QB 3DM3A 4LFCL 3ZJYC 5FLMH 4NKLA 4ZAIA 1A2UA 3PO3G 2L0CA 4BWGB 3RN2A 2KCCA 1VQHA 3BZKA 2K33A 4KLKA 1TWGB 4UP7A 4BY1B 1A3TA 2E2JH 2ZT9C 1GO3E 4NPSA 3QG1A 1II3A 2K7VA 3K80C 3A74A 1HUMA 4JI7L 4DV3Q 4FF4A 3QIAA 1EQRA 4JI8Q 5IYBH 2XRSD 4IUPA 1TR5A 2KCNA 3D0FA 1SYEA 2XSCA 3BYTB 3S1RH 1Q8IA 1JWSD 1P8LA 2AUJD 2A6EC 1YVCA 1YJNA 3KBXA 4CDEC 1Q8KA 4IJLA 4C56C 5M3MB 2QEXA 5IGDA 1D6EC 2K6AA 4DR1Q 2DGYA 3Q24A 4DR2Q 2N3SA 4A3JB 2E2HH 2OTLA 1U5KA 2BH8A 1AN8A 1GHJA 1K0RA 2ZM6Q 1STBA 3HOZG 1JC7A 2L15A 1HHVA 4DR7Q 1WI5A 4WFN3 4DFAA 1PRTF 3GTMH 4LUZA 4DV0Q 1Y1VB 1HA5A 2PW7A 1YHBA 2KCMA 3KF8B 4LUVA 2JEBI 4JI2Q 3UDXA 1B1ZA 3AFPA 2BH2A 2R7FA 4C3JH 4A3DG 5D3IB 3TZDA 5C0XI 3KYHC 5FO8B 1N8RC 2K5VA 4XT1B 1IBLL 1TS5A 3IKJA 4IZ8A 3G6JB 2SOBA 3T1HL 3NQTA 3PO3B 2AWNA 2EE1A 3VA5A 1DM0B 3NWTA 2EYPA 4B08A 2D62A 1FYCA 1Q1BA 3MXUA 4XTCS 1U9RA 1PZJD 4LMQD 3DXJC 3H3VI 3ITPA 3CRKC 3I90A 2Q2UA 3EFXD 1G291 1GVPA 4OWWB 1A63A 1AE3A 1VQGA 1H9RA 2WP8J 3S2DB 2M2LA 1KNAA 3GTKH 2NVYH 2L1BA 4LFAL 3J7YW 2IX3A 1T5EA 4DAYB 3M4OH 1N36Q 4XDXA 5EPLA 5LHY1 4A76A 1QZHA 1HJPA 1CSQA 1NR2A 1AEXA 1DGSA 1SAPA 1DOKA 2OT2A 1JCKB 2F0HA 2NVQH 4G7HC 4F87A 5C4JH 1HPCA 2IW3A 5ELDA 2EYHA 3NEMA 4R8IA 2Q8RE 3HOZB 4GOPA 3BVZA 1OO9B 3K6OA 2P5ZX 3N6RA 1WTPA 1AW7A 4C3IH 3VR6A 1Q7YC 4A75A 4A3DB 2KENA 2E76C 4G4KA 1PA6A 1MIUA 3A8KE 1SNOA 1NE3A 2XRQD 3I55A 4DV6L 2MFIA 4XXEA 1EOVA 1EQVA 5ELCA 1HZCA 4TKOB 2MJ8A 3RN5A 1X56A 1S3OA 3JAME 2TMPA 3I91A 1K83B 4NW2A 2QKIC 5GQOA 1D2BA 2F4VQ 5M5XB 2RHQB 4U68A 3PO2B 2BA0A 4J15A 4OONA 1CK1A 4R4OA 3AQQA 3DEPA 2AHOB 3P75A 2ZXOA 2EPBA 3S1NB 1SMYD 3PUXA 4IJHA 5AJ3Q 5FOBB 1SYGA 1QZGA 1ENCA 4K5VA 4IURA 5C0XH 4HSVA 1K3BC 2B2YA 1YHQA 1GM5A 1BOSA 5HGQA 1LTGD 2R7ZG 1S5FD 2NZOA 3NELA 1L2FA 2G9HD 1WTQA 1N32Q 1QNUA 5EKLA 1EYDA 4RGTA 3CRLC 3KJPA 2CH4A 4WJ4A 4HEDA 3E0EA 5IP9G 3HOXH 1IBKL 1X6OA 2A6HC 1HR0Q 5E3FA 3TDQA 4S3SA 1HNWQ 4TSSA 4DR4L 4OEMB 5C4HA 3H3VH 2K05A 5HURA 1Q90A 1IYJB 3Q0AA 4OX9L 2XVSA 2R92H 4C3HH 4B3ML 3RZDB 3BJUA 1HZBA 2GA4B 2IX1A 3BVGA 2VQEL 5JJZA 1A62A 1GD7A 2LKVA 2JXMB 2O2LD 2IHFA 2F0NA 4XQNA 4BXXG 1TKWB 1WTVA 3S2HB 5NUCA 1B9MA 2OQ0A 4K2LA 4B9WA 3GTQB 4RCOA 3BG3A 1SMXA 4DV2Q 2B2VC 4B3TL 1JOKA 5HY6A 2K5QA 1Y1WG 2HIVA 2OF1A 4L5SA 3HOWG 5CBAE 1JR0D 4CBVA 4HJ7A 1EQQA 1AFPA 3A8IE 5CYUA 5JJLA 2WIIB 1G6PA 2EDGA 3GTPB 4C3JG 5IT9L 1BCPD 1EIGA 1EYAA 1HZ9A 4RGOS 1RODA 1B9NA 4NXNL 5BR8L 1ASYA 2ES2A 4BBRG 2D0PA 2R7ZB 1JWUD 1VQNA 4BBSG 5F2DA 1U0LA 2ZXRA 5DEHA 4DAMA 2NUCA 2F52A 4B3SQ 2PQAB 2JA7H 1T5XD 4JV5Q 4JG2A 4NB3A 2E2JB 1OXTA 3TZUA 2EY5A 4RFBA 1QUQB 1XMQL 5M5WH 4L8JA 3VYUA 4CKEA 2JJQA 2DNEA 3IFDA 5LL6S 1M90C 4L5QA 5E7NA 1XYIA 4LFCQ 3S1RB 4IO9A 1A6XA 2RDHA 3HP3A 3I56A 2JP1A 1UUPA 5EJWA 2RBMA 1KABA 4BY7H 5IT9c 5IGEA 1ONLA 3D4RA 3SHLA 1IKLA 1PYSB 5IYCG 4RKBA 2JA9A 3CCSA 2E2HB 1YNNC 5ELOA 1EIYB 4PZ8A 3V05A 3HOYH 4A3CH 1K0SA 1SE2A 2FHTA 3WOEA 1I6HH 4H0LC 1HQMC 3GTMB 3E9IA 1IZ6A 4HIMA 3MC0B 3I4MH 3HOWB 3S14H 3LNNA 4JC0A 3GTOH 5M9OA 1LT4D 3NTHA 5GAGC 1MKHA 4C3JB 2UUAQ 2WAQE 2VQFQ 3TP8A 2NBFA 5T1GA 2BCOA 1Y69U 1WTHA 2YYZA 5M5YH 4BBRB 4A3LG 4BBSB 3QJYA 1DZ1A 1F9SA 4HJ8A 3D4DA 5EQ0A 2F3WA 2VS1A 4J8QA 1TS3A 5JEAH 3WWVA 3MXNB 1VQEA 3EQLC 2MGSA 1V8QA 1F2LA 5J3BA 2I5MX 1BUVT 1XNQL 4GZYC 3TEHB 4F7XA 1D5ZC 2R61A 5KEEA 2Z0SA 1FR3A 5CMDA 2F0SA 1IBLQ 1A8VA 1O7LA 3G6EA 3RZOH 1I4GA 3DWQA 3M4OB 3KUPA 5IGCA 2DJGC 2L55A 5CR3A 4RGNA 5C3EH 2UXDQ 3TP6A 4Q5VA 3GTLH 3OSOA 3URYA 4LNQA 1K28A 5C4JB 2N55A 3H0GH 1XNRL 3TP5A 2BE5D 3K5LA 2JYOA 3LX0A 3RR5A 1JT8A 1I3QH 5EKKA 5KNBA 4IALA 3TQYA 1ET6A 4JBMA 4C3IB 4H02A 4IPGA 5EPKA 3QO2A 2CCZA 2BOSA 3OW7A 1Z6HA 1AE2A 3P7JA 3T4AC 2WV6D 1Y8PB 4IPDA 1E2VA 3IFTA 1E3PA 1SYBA 4UAIA 1K3RA 1ILQA 1RD9D 2MO0A 1CQVA 1CZGA 1X65A 4CDFC 2GVAA 2QILA 1XWEA 3KLWA 5CV8A 1PH3A 1JOOA 4K6DA 3VR4A 3RNUA 1HR0W 4QQBX 3RMHA 4CKBA 1E2ZA 2F0LA 2FJ2A 3W1GA 1EY8A 4JI0Q 2A19A 4OL7A 2JA6H 4UHVA 3PUVA 2B2TC 3TS2A 2HCCA 1TWFB 2JN4A 1MHWC 1V9PA 1WCMH 2A8VA 3K81C 2E5LL 4P71A 1RTOA 4KMUC 1KHIA 3M4YA 4E6IA 3A0JA 3PUZA 3NXWA 4RGMA 4DR6Q 3FEWX 3P20A 2A6ED 5IODA 1HNXQ 5T1IA 1UE5A 4N8FA 1EY4A 1TQOA 2B2WC 1S5DD 2CFMA 3HOXB 1OXSC 1XTCD 3NP8A 5ELFA 2Z4IA 1F9QA 1L1OB 1STNA 1DOLA 3I7FA 3J81i 1UAPA 3MTSA 2JA8G 1JE5A 3TMEA 4C3HB 3EIVA 4DV1L 4ZQ3A 2R93H 4R9WA 1E1OA 2FINB 4PG3A 5GADC 3OWEB 3J80L 4DU9A 1V1PA 4C1NI 4DKAC 1F2MA 5JVH3 4XYOA 4LJZC 1I4PA 1JE4A 4R1JA 1VQIA 1U4PA 1VCIA 2F0PA 3OTOQ 1YNXA 4JBKA 4B3RL 1PTOB 1IYUA 2IL8A 3IRBA 2EYMA 2PW5A 4IFDG 1DOMA 1X3FA 4U673 4OO1G 2IHEA 4DR3Q 1A3VA 2QEJC 1EU4A 2MHVA 4BY1G 1VF7A 5C44G 2NVTH 1HA6A 2GVBA 4IFDJ 3UI2A 5C5MA 3H09A 1JMCA 2CW0D 1LTID 4LF6L 3T56B 1DCZA 1I5FA 3ULLA 1ZYRC 4QGUA 3I72A 4DV7Q 1PH8A 1F77A 2RDFA 4QUFA 1PLFA 3J80c 4DNIA 1SE3A 3D3RA 2IX0A 4A3IH 1G91A 3PQIA 1PRTC 3CC7A 3CCMA 4WRDA 1Q86C 3VR3A 3I4NH 1L0YB 5BR8Q 4LWCA 1ICFB 1S5ED 1HFGA 1Z9FA 3PUYA 3PCOB 2YTYA 2K5NA 4YHHL 2NB0A 4ZRZA 3UDIA 4DK0A 4EQPA 1TWCH 1PFBA 2ZTCA 3PUWA 4R4TA 3DHQA 3UE1A 2EXDA 1CZWA 5KGUA 1CA6A 2F3IA 1XMQQ 4A3MG 1XPOA 1BO0A 2XWBB 4RHRA 4IUUA 5I9PA 2I5LX 1QJOA 1CI3M 4EQOA 3MHBA 3GP7A 2L12A 2JA5G 3M7GA 3SK5A 1HUNA 4RH6A 3B6YA 2K28A 5C44B 4DUZL 3CPWA 3A56A 1IL8A 5CBEE 4IPCA 2UUBL 4A3EH 4DV5L 5M5YB 3VYSA 4JI1L 3MAQA 3PIPA 1H95A 4FXKC 4ABNA 4A3GG 1XTDA 2X69A 5EPJA 2QW7A 2B63G 1HTPA 4PQXA 1BXTA 1LACA 2D0OA 4UP8A 5J22A 3CCEA 1X3PA 1PZID 1SNDA 3CMAA 2F0QA 4A3KH 1PH4A 5IP7H 3LWEA 1I94L 3MFYA 1YIJA 4FF2A 3R8BA 1J9OA 2EY2A 1KNEA 5M3FG 2MP1A 1WTWA 2LMCB 3VDYA 1K73C 1T9HA 4LF9L 2CH4W 2KUMA 3CCJA 5KIXA 3RZOB 5BN4A 2NVXB 1SROA 2F0OA 2AWOA 2F0EA 3A54A 2K01A 4V0BA 2NN6I 1XNQQ 2KECA 3H0GB 3S15H 4A3MB 1B53A 1SE8A 2VUMH 3ER0A 2EXZA 3L0OA 3PF4A 1E7ZA 3STBC 3G71A 1V1OA 5G3LD 4DN4M 1TWAB 1QG7A 4ZLTF 1FNVA 1MJCA 3HFZB 2Q8IB 2JA5B 1GUNA 4LF4Q 1EY0A 2E8GA 4QY7A 1BBUA 1G51A 3K7AH 3F2BA 3PO2G 1SJHD 3FP9A 3S17H 3K5NA 1SYCA 1EIHA 4FXGC 1R4PB 4RG1A 4X66Q 2Y0SE 2Z6KA 1XNRQ 3I4OA 5CC4A 1CM9A 4A3GB 2ZJPA 1G8ZD 2B63B 4WJWA 4JI6L 3W3AA 2QF7A 3OHXC 1ZXTA 1YNJC 2RKSA 1VQ5A 2UXCL 3FPPA 5IT9E 3CQZH 4MTKA 3F2UA 5EAYA 5LL6X 2JA6B 1PDQA 2ZJRA 2ZXPA 5ELEA 4A3BH 1JICA 5IGGA 1TWHH 4JI5L 1XPRA 2QA4A 3G48A 1HH2P 3JAMi 5M3FB 1R9TH 1WCMB 2PCFB 1EZ8A 1IKMA 5EKIA 4IUTA 1ENAA 4DXFA 3NHHA 4JPBW 3SK8A 1SR3A 5IY0A 5GAEC 1L1OC 1QOHA 2A68C 3KLSA 2WAQG 2AQ2B 1VQFA 5JJIA 1K8OA 3GV3A 2K5HA 4CJ0B 2HHHL 4X64Q 2H1EA 2EJFC 1F2YA 2D2CC 4NXML 1V1QA 4AQYQ 1VQBA 3K0XA 3FKIH 3HGBA 1BKBA 4K8IA 1OXXK 1PHJA 4X62Q 1H9SA 4OGQC 5J39A 1IL2A 3U9SA 1YNND 4G7OC 1UWVA 3UDGA 4YWMA 4DUYQ 1VMPA 1PTOC 2E5LQ 5FJ8H 1V1PB 1EY9A 4POFA 4BA2I 4A3FH 5I6YA 4ME3A 3KFUA 5K36H 3A5UA 4MZ9A 1BQQT 4ILWA 3OYYA 3P1HA 4M8AA 4KN7C 1S5CD 3R2TA 3TBIB 2I5HA 1H9MA 1EQTA 3EROA 4A93H 2KQ3A 1CHPD 2VB3X 2NN6H 2KHSA 1KTKA 1GUTA 2MO1A 4PMCA 3PSIA 4P2CB 4FF3A 5FLMG 3NPPA 2UU9L 1BR9A 3BU2A 4CKCA 4KY6A 4DV1Q 1MBYA 1X32A 1S72A 1BCPB 3GD7A 3A55A 4KV6A 1EFID 3KLSX 4PMBA 4ALPA 2WAQB 2HCIA 4X65Q 3DLLA 2IWHA 1FL0A 2F0FA 5IWAL 1GOZA 1SEBD 5DM63 4LF8L 1WJJA 5IYBG 1HCZA 4KKUA 3TRZA 4B3RQ 2L9HA 4DPGA 4GNXC 4J1MA 2O4XA 1XPUA 4IFDI 1HRJA 1I4XA 4YY3Q 4OO1I 3N52A 3KLRA 2LXKA 1ESFA 1BVSA 3R93A 4JI3L 3HZXA 2RHSB 4A3IB 3CF5A 4PV1C 5CORA 4KKTA 1BBWA 4QUCA 3I4NB 4QL5A 1PYWD 1LUZA 2F3VA 4G57A 4JBJA 2UXBL 3MEHA 1U4RA 1SDFA 2SDFA 4FO2A 1H9KA 1C4QA 1NCVA 1PMRA 4IN3A 4F8MA 1CKOA 1PTOF 2BA1A 5C4XH 1AZPA 4X3UA 3VR5A 1GUOA 5J1ZA 3DMUA 1PYBA 4RWSC 3C1FA 1KXLA 1TWCB 2K1BA 1W2BA 4CDCC 2AQ3B 1RDPD 2HQEA 1PH2A 2KBNA 3S16B 2C9OA 1FD7D 3HOVH 3AEVA 3EBEA 1GUSA 1LTLA 4Q0FA 2XGTA 1VF5C 2RF4A 3NBHA 1PFNA 1SFOH 4EVOA 1SYDA 1YJ9A 3LWUA 1QVFA 2SNMA 3S24A 1NY4A 1P16A 2EVBA 4YHHQ 4DNRB 1S40A 3HOUH 1SBBB 1C8CA 1SJED 2J7ZA 4RKLA 4LF5L 5LMUQ 2M00A 4DAVA 1Y8OB 4DAPA 1UE7A 4MIUA 2L11A 4HCSA 4OIKA 3J7AV 3EJIA 1YITA 1WOCA 1J6QA 2LY7A 4A3KB 1VMCA 4O1NA 1ILPA 1KRTA 3DWAA 3CCUA 1UNSA 1LTSD 4KHZA 1EEID 2ZTEA 1IBML 3I70A 4GKKL 3M3YH 4Y7NH 4RAUC 4DV5Q 1Y14B 4JI1Q 2IT1A 2ENBA 4GLVB 4JI7Q 4R8NA 2E2IH 3KJOA 1ICWA 1CSPA 2K04A 2SNSA 4ZCKA 4C3IG 2Q8TA 1HXYD 1L0WA 3CHBD 2CQOA 1CUKA 3RUZA 2V4DA 3C2PA 4JI8L 3GTGH 3UDFA 2B29A 2J4XA 3RLOA 4ZKBB 4L6TB 3S1QH 2CKZB 3FPUB 3NK9A 2VUMB 1D1KA 1SLJA 1IW7D 4KD3A 3U4VA 1TS2A 2MNAA 5IYDH 2B2UC 2ZJQA 4DNTB 3J80E 4O0AA 4HIKA 3HKSA 3K7AB 2DJFC 4A3FG 1LABA 2VY3A 3CPFA 2DNCA 3S17B 4A4IA 2SEBD 1R4QB 2B2VA 3GO5A 5CV4A 3Q22A 2Z4HA 3C46A 3GTKB 2NVYB 1C48A 3BYYB 3J7ZC 3FHWA 4GOPB 5KNDA 4AYBB 3T1HQ 2E74C 3KF6A 3E5SA 2VNUD 2X6GA 4KJOA 5C0XG 5M3MH 3CQZB 3I73A 1CFMA 4K5WA 4A3JH 2NVQB 3L3OC 5EBCA 2OEOA 3BZDB 4LUOA 5FK9C 1W6KA 4A3BB 1PRTD 3NENA 2RVLA 4AIMA 1Y1VH 3HOXG 1SXTA 5JJKA 3SR1A 5A35A 4MHEA 1NTGA 3Q6SA 1H9SB 4LFAQ 3Q8DA 5CV5A 4BS9A 2OWOA 4N9TA 2K14A 2PPBC 3GTJH 2HIXA 3CMEA 1IYVA 3EA6A 2LS01 1YHAA 3M9BA 2R92G 4C3HG 2UUCL 2EYLA 1SNQA 2L4NA 3KF8A 3FKIB 3HKZE 4EX5A 5FLXL 5GROA 1S5BD 1N9WA 4X3SA 3PF5A 4RCNA 1N36L 1LLRD 3K8AA 4JOIC 3K7UC 1PH5A 5KYIA 2O5IC 1LO5D 3MZ5A 4UPAA 4N8X1 3CU7A 4F88A 4A3FB 2YV5A 4K8JA 1AZQA 2WB1E 2HHHQ 5C3XA 5C6AA 2HDMA 1FNUA 3S2DH 2VL6A 2F1MA 3KBGA 3BDLA 4NXMQ 4FDBA 4DV6Q 3C3LA 3BZCA 2PQEA 5A2QL 1ET9A 4EGVA 1YJWA 1B7YB 4A93B 5ELBA 3NWSA 3E0JA 4XQJA 1EWIA 2ICEC 2XN9C 3HOZH 1CTMA 3H15A 5FLXc 2MPMA 4DAYA 2RDGA 2EZVA 4LK1C 2JA7G 5H1SE 1JQYD 1J5EL 1SNMA 2PZUA 4A3DH 1EIFA 1K8AC 4IOAA 3AFQA 1V43A 3A8JE 4IUQA 4DA2A 4EQNA 4KI0A 4CGYB 2R92B 3SEBA 5LMNL 4G7ZC 2Y0SG 1VQ8A 1TVXA 5KYLA 1VQLA 4GLXA 4AYBE 4HSPA 1NMFA 3ERSX 4RA8A 1IBKQ 2I46A 3F8TA 5K5PA 4BY7G 4PZ7A 1N32L 1YEZA 3VYRA 2KHJA 2N88A 5M5XH 4DR4Q 2EY6A 1XXGA 3HOYG 4M1UB 1F9PA 4A3CG 3LGJA 4OX9Q 2EIFA 4O42A 2HUGA 4LF8Q 2PMZB 1UEBA 3I4MG 4B3MQ 4NDXA 2DY8A 4LFBL 1N34L 2VQEQ 4P72A 4HJ9A 3V96A 3T1YL 1HQRD 2XWJB 3F2CA 2F0WA 1MJEA 1ZEQX 1BCPF 2D5DA 3U50C 2IJ0A 4GN4B 4JI3Q 4JK1C 4KY5A 2EY1A 1ZKOA 3NQIA 3PIO3 3I3CA 3CCRA 1N33L 1YNJD 1SFOB 2UXBQ 3E9HA 4Y52H 2VB2X 5JEAG 4B3TQ 3TP7A 4ZKCB 2JA7B 3H91A 2F4IA 3CP0A 2MUYA 3OPOA 1A0IA 1JORA 3FRPB 1DD2A 1X54A 2B39A 5FO7B 2EYFA 4MTNA 1FGBD 5HGTA 1HTLD 1VQAA 1HNZL 1WD1A 5M5WB 2A73B 4NXNQ 2IPKD 2A68D 4K0KL 3OMCA 2B2TA 3ONAB 3W1BA 1H9JA 2Y0SB 3FDTA 3IL8A 3NSWA 2LXJA 4MN3A 4XQQA 3BDCA 3S2HH 2IY5B 5C3EG 4BY7B 2BDNA 5TSSA 3CW2C 2EJMA 1BF4A 2WKDA 5E1FA 1EOTA 1LTRD 1BDOA 4Z9CB 4TRDA 3H0GG 2WACA 3HOYB 3M3YB 1RL2A 3E3XA 3RLNA 1I6HB 4HR7B 5ELNA 3SK4A 5BN3A 4QB4A 4JV5L 2E2IB 5BN5A 2B2WA 2F03A 1JJ2A 1Q82C 3I4MB 3S14B 4DGZA 2JQOA 3SK6A 1VQ4A 1STYA 3GTOB 1QB5D 3GTGB 2R7ZH 3WOFA 5JPNC 2AQ1B 1O7IA 2K4KA 4GOPC 3G7LA 5I6WA 1IBMQ 1D5MC 5C5LA 4GKKQ 5IP9H 2RQXA 2G9DA 2PYKA 4XIGS 5C4ZA 2NTTA 4RMFA 3I8ZA 2WINB 4L63B 2Z6BA 3KF6B 4TVAB 3K58A 2VXWA 3CCQA 2KJXA 1CKNA 2JA6G 2A6HD 1OXUA 4K14A 3Q23A 1PZKD 1KAWA 1RJTA 2N49A 2PQAA 2F0KA 4ZYSA 4GKJL 4B9XA 2Z1CA 3M4PA 2PMZE 1MSGA 3CC2A 1WCMG 1B8AA 1F2ZA 1VDZA 1NNXA 2KOLA 1ESRA 2UUAL 4K6LA 1C0AA 2VQFL 1X55A 1YZ6A 2WKCA 4GLAC 4BXXH 1QUQA 1VS0A 1KC8C 1W6JA 4K5XA 5C3EB 3MA2B 3GTLB 2JE6I 1QWYA 3QWNA 4JBWA 3NBIA 4YCUA 1I4RA 3TSSA 3U9OA 2PNRC 3SE0A 1QILA 1XMOL 4I7ZC 3D6WA 3PMFA 2K5WA 1A15A 1Y1WH 1EEFD 2Q2HA 3QOJA 1I3QB 1B50A 1NBWA 5I2YA 5CV6A 3HOWH 3AMUA 2R6GA 4JYAL 1B2TA 1WTRA 3G4SA 1VQDA 4DV4L 2B2YC 3HRZC 2KHIA 4XYQA 2CWPA 4EQ5A 2A69C 3CKIB 2XNAC 3GTJB 4BBRH 1EUJA 2NTSA 4BBSH 2A5HA 3J81L 4J6HA 1SE4A 1EY7A 2YU9H 1KD1C 5I9OA 2R93G 3R3OA 3J7AF 1K8GA 4BA1I 1KLGD 3CCVA 1O80A 2UXDL 1MI2A 4IUVA 1LT3D 2PI2A 1OTCA 3SVMA 2OQKA 1X9NA 3S1MH 3ULJA 3JC66 2DN8A 3CD6A 3QR8A 1HZAA 4QF4A 1Q3LA 2Z9HA 4OWXB 2F0VA 1L0XB 1A2TA 3MXNA 2UUCQ 1IHZA 2KEDA 2CW0C 2HDLA 3H3VC 3OOCA 4KK7A 1CT1D 4YWLA 5D3DA 4H44C 1B4OA 2PO4A 2PZWA 5IYCH 3J81c 1ML0D 3OWFA 4LW1A 4WORA 2DY7A 4ME5A 4KN4C 5IE8A 1E24A 2VZAA 3V2TA 3AU7A 1MSHA 1QE6A 1LT6D 3A5ZB 5JPMC 4A3IG 1STEA 1I6VC 3IAYA 4JI0L 1I50H 1VQCA 3I4NG 3MEFA 1XX8A 4A3LH 1KL9A 3FVQA 2M9VA 3MVVA 2R93B 3OMGA 3I2ZA 1UE1A 1SN8A 5CV7A 4JI4L 2OTJA 1B70B 4DR5L 2CQAA 1NSNS 1SNCA 1FVIA 3MWYW 2XIWA 4DR6L 3J7A5 3DUZA 4YWKA 3DM1A 1J5EQ 2I0QA 2F0GA 3L7ZC 2F0JA 1HNXL 2DUDA 4RHSA 4YIJA 5KRUA 1PV4A 2N78A 4P73A 2XTIA 4LAAA 5IOCA 1RCVD 4H7BA 1LTAD 2YTVA 4FVMA 1TWFH 2H4OA 5LMNQ 2JEAI 3SXHA 1B44D 1SRUA 3GV6A 5AFWA 1PFMA 4OHJA 3H6MA 1UEAB 4UP9A 4DK3C 1ENFA 4LF7L 3ND9A 2NVTB
chains in the Genus database with same CATH topology
4JW0A 4I7AA 5L37A 2Z9HA 4JVZA 4N8FA 2QW7A 4N8X1 2HD3A 2RCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW0 A;  4I7A A;  5L37 A;  2Z9H A;  4JVZ A;  4N8F A;  2QW7 A;  4N8X 1;  2HD3 A;  2RCF A; 
#chains in the Genus database with same CATH topology
 1TY2 A;  1EU3 A;  4OWT B;  1VQK A;  5ISR A;  1JJC B;  4A3E G;  3D6C A;  2NWG A;  2Q2T A;  3KK7 A;  3RLF A;  4ZUI A;  3HKZ G;  1YBY A;  2ATW A;  1Z47 A;  4ZK9 B;  1EWH A;  1UE6 A;  1PH7 A;  4HTH A;  3KOJ A;  2HT1 A;  1E2W A;  1PH6 A;  3HG9 A;  4CDD C;  1STG A;  2K75 A;  1EYG A;  3OTO L;  4LFB Q;  1N34 Q;  4FF1 A;  4A3K G;  3T1Y Q;  5IP7 G;  1XJV A;  4H13 C;  1AP0 A;  1QNK A;  1QVC A;  4HMI A;  2WB1 G;  2R3Z A;  3K5O A;  1VQ7 A;  4C1N K;  3ICE A;  2V1C C;  2Q2I A;  1MGS A;  1GUW A;  4DR3 L;  1G6Z A;  4LF6 Q;  4PZ6 A;  1N33 Q;  3MXP A;  1FJG L;  2EJG C;  1M8A A;  5C3W A;  5GAH C;  1L1O A;  1FNW A;  1Z7T A;  2AUK A;  1KRS A;  4DXG A;  1C7Y A;  3NUC A;  3KDF A;  1PTO H;  2FXQ A;  4DV7 L;  1HNZ Q;  2GN5 A;  1PFS A;  3HEJ A;  3T53 B;  3PIP 3;  1RHP A;  2VUM G;  2QGQ A;  1E22 A;  1NAP A;  4K0K Q;  4C2M H;  5FLX E;  3ULP A;  2HD3 A;  2O5J C;  3OIQ A;  5I2X A;  1A3U A;  3TN2 A;  1VQJ A;  2N8N A;  3GQB A;  4KHP L;  1DYQ A;  2TSS A;  3O13 A;  1EY6 A;  4A3E B;  2C35 B;  1C9O A;  3R2I A;  1EZ6 A;  1JOQ A;  1SSO A;  4KTA A;  1CKN B;  4X3K A;  3HKZ B;  1RF2 D;  1D1I A;  2JK8 A;  2G5D A;  4FP5 D;  4GS3 A;  2PNH A;  4AYB G;  4PMW A;  2K50 A;  4GN3 B;  5A2Q E;  4DF7 A;  4KD4 A;  5L37 A;  3PIO A;  1VQ6 A;  4K2K A;  4HJ5 A;  1E0B A;  4DUZ Q;  1Q1E A;  3FMC A;  2WB1 B;  4TQU S;  2I07 B;  1GXD C;  2A74 C;  1ASZ A;  2UUB Q;  4A3B G;  1EYC A;  3NTK A;  2JA8 H;  1F9R A;  3JAM L;  2K03 A;  1GJX A;  3J80 i;  1JWM D;  2F0I A;  3K5M A;  1I4H A;  1PH9 A;  1BBX C;  1KDC A;  1O7Z A;  1G2T A;  1PH1 A;  4DV3 L;  3QOL A;  1VQO A;  1EFW A;  1PRT B;  1FGU A;  3S15 B;  1I94 Q;  1NUC A;  2F0T A;  3FKI G;  2LSS A;  1VQM A;  2RSO A;  1Y1W B;  4IFD H;  4GNX A;  1NR4 A;  1CQF A;  1KLU D;  1TS4 A;  2ICI A;  4FNF A;  2ASB A;  4GKJ Q;  4OO1 H;  5G3L F;  2KEE A;  3AYH B;  4V19 0;  1TWG H;  4BY1 H;  5I4D A;  3DEO A;  4DR1 L;  5C44 H;  4FYD A;  5FJ8 G;  4LF9 Q;  4DR2 L;  4ZUJ A;  4OIJ A;  4IOC A;  3C1E A;  1SMY C;  2ZM6 L;  4CHT B;  4ID6 A;  2EYJ A;  4DK6 C;  4DR7 L;  5K36 G;  3OW2 A;  5DNF A;  2YU9 B;  4DV0 L;  1PXU A;  1XMO Q;  3EN2 A;  4WJ3 M;  4XT3 B;  3JAM c;  4JI2 L;  1TXY A;  1U4M A;  4R4I A;  2F0D A;  1GKH A;  1X3Q A;  2NYZ D;  3D4W A;  4JYA Q;  1KDA A;  5KNC A;  1DJR D;  1STA A;  4A93 G;  1S4Z A;  1ZYR D;  4DV4 Q;  2NN6 G;  3F2D A;  3S1M B;  3AB9 A;  4QIW B;  3T13 A;  1EY5 A;  1GHK A;  5CV9 A;  1G2S A;  5DLQ E;  2BDO A;  3MFG A;  5C0X J;  3K59 A;  1TWH B;  3ZYY X;  2EYO A;  1R9T B;  2ZTD A;  2A1A A;  4LF4 L;  1YI2 A;  2EOT A;  2OCE A;  2K52 A;  5DAU A;  2NVX H;  1VQP A;  4FXD A;  3BDO A;  2B8G A;  2RA4 A;  1RTN A;  3QB3 A;  3VYT A;  2AKW B;  3CAM A;  4JI6 Q;  3DWP A;  3PV0 A;  2UXC Q;  2QCP X;  4X66 L;  3M4Q A;  3EVQ A;  1GUG A;  1RIP A;  4A3M H;  2K5D A;  2FMC A;  2QDB A;  4GN5 A;  3D8G A;  1LV9 A;  2R7D A;  2E2D C;  2ALY B;  3T16 A;  5IIF A;  1KDB A;  3SGI A;  3PO3 H;  4KHV A;  1JB7 A;  5LMN W;  1TWA H;  4HIO A;  4JI5 Q;  3ERQ A;  1RKN A;  2KA7 A;  2RCF A;  2JA5 H;  2AMC B;  4HMJ A;  5IGB A;  1Q81 C;  1JJG A;  3L9A X;  4R4Q A;  1I50 B;  3MXG A;  5COY A;  3WDN A;  3S9W A;  1KAA A;  3TRE A;  3T51 B;  1PVO A;  1HFN A;  3J81 j;  3W5O A;  4L5R C;  3U4Z A;  4QCL A;  3NTI A;  2D9U A;  1BCP C;  2H5X A;  1WYD A;  4POG A;  2F0M A;  4NP5 A;  5C4X G;  4IPH A;  1KQS A;  4A3G H;  1JB3 A;  2B63 H;  1NJI C;  3OIP A;  2CVR A;  4X64 L;  1B3Q A;  3A7A B;  1SYF A;  1B3A A;  4R4C A;  3HOV G;  4AQY L;  5D65 A;  4I7A A;  4X62 L;  1VQ9 A;  5M3F H;  1CA5 A;  1WD0 A;  1E1T A;  1DXM A;  4DUY L;  1I4Q A;  2OXP A;  1LM0 A;  2F4V L;  1TII D;  1TU2 B;  1M1K C;  4N9P A;  2B2U A;  5JVG 3;  1BNZ A;  4JI4 Q;  3VA7 A;  3HOU G;  2C5C A;  2ID0 A;  3BVM A;  3H94 A;  1W3S A;  4DR5 Q;  3SDZ A;  2FFK B;  1M4V A;  2PZT A;  4HAE A;  3GDE A;  2CWA A;  3VR2 A;  5E4W C;  2PI2 E;  3TS0 A;  4JVZ A;  5DM7 3;  4CJ2 C;  3U58 A;  4NMZ A;  4L5T A;  4P75 A;  3BS1 A;  5AJ3 L;  3M7N A;  5JOB A;  2UU9 Q;  2J0T D;  1K83 H;  1Q46 A;  4IUN A;  4ODG A;  3NE5 B;  3F1Z A;  3PGZ A;  4APV A;  5JAV A;  3STB D;  4MNO A;  3RD4 A;  1CHQ D;  4LF7 Q;  4QIW E;  4QMG A;  1LTB D;  2MQH A;  3PO2 H;  2LFN A;  1Y8N B;  2YTX A;  3ND8 A;  1K8M A;  3KDF B;  1TT2 A;  5IWA Q;  2KVM A;  4UDU C;  5D14 A;  2A69 D;  1D7Q A;  3S1N H;  5C4X B;  1CKM A;  3E6Z X;  1HR0 L;  2WFW A;  1HNW L;  3NBH B;  1AH9 A;  1WFQ A;  4X65 L;  1NMG A;  3A7L A;  2F0U A;  4I65 A;  1IW7 C;  2X6L A;  1LT5 D;  4HJA A;  3HOV B;  2NZ1 D;  1OXV A;  4YY3 L;  3J81 E;  1O78 A;  4OEL B;  1U4L A;  1SNP A;  3L2P A;  1EL0 A;  4C2M B;  1STH A;  4YCV A;  1Q12 A;  5IYD G;  2QDL A;  5IGF A;  4JOI A;  1WTX A;  4X3T A;  1WVL A;  1FJG Q;  3HOU B;  4IQZ A;  3X3M A;  4HN7 A;  5EBD A;  4DV2 L;  5JEA J;  3K57 A;  5CGK A;  4OXP A;  1DON A;  2Z8L A;  1D5X C;  2K32 A;  4DK1 A;  3RZD H;  3CCL A;  1J8I A;  4KJN A;  4P74 A;  3W2D A;  3CC4 A;  3X3N A;  1KIX A;  2BE5 C;  2FMM A;  5M3M G;  1O7Y A;  1IXR A;  1EWC A;  4O2D A;  4HID A;  1K9M C;  4JCV E;  4UY8 C;  3M85 A;  2L5T A;  3GTQ H;  4A3J G;  1TY0 A;  2HQL A;  4X6A H;  2B8F A;  4YCW A;  5FKA C;  5E4X A;  4KY7 A;  4AH6 A;  1LTT D;  4KHP Q;  1WTO A;  3I4L A;  4B3S L;  2KCT A;  2JSO A;  5FO9 B;  3HS0 C;  4Y7N B;  1MD2 D;  2Z6K C;  1PTO D;  2JA8 B;  2VW9 A;  1X3G A;  4LF5 Q;  4QJF A;  1X3E A;  1Y1V G;  4CJ1 B;  2EQS A;  2RCN A;  5EGT A;  4ULL A;  4GNX B;  4HCE A;  3GTP H;  1QCB D;  2CHB D;  1LYL A;  4JW0 A;  2E75 C;  3D31 A;  4KKS A;  2B3G A;  3UE0 A;  2NZH A;  3S16 H;  5LMU L;  4PNY A;  3CXC A;  2RSN A;  1QVG A;  1D8L A;  3K0Y A;  3S1Q B;  3DM3 A;  4LFC L;  3ZJY C;  5FLM H;  4NKL A;  4ZAI A;  1A2U A;  3PO3 G;  2L0C A;  4BWG B;  3RN2 A;  2KCC A;  1VQH A;  3BZK A;  2K33 A;  4KLK A;  1TWG B;  4UP7 A;  4BY1 B;  1A3T A;  2E2J H;  2ZT9 C;  1GO3 E;  4NPS A;  3QG1 A;  1II3 A;  2K7V A;  3K80 C;  3A74 A;  1HUM A;  4JI7 L;  4DV3 Q;  4FF4 A;  3QIA A;  1EQR A;  4JI8 Q;  5IYB H;  2XRS D;  4IUP A;  1TR5 A;  2KCN A;  3D0F A;  1SYE A;  2XSC A;  3BYT B;  3S1R H;  1Q8I A;  1JWS D;  1P8L A;  2AUJ D;  2A6E C;  1YVC A;  1YJN A;  3KBX A;  4CDE C;  1Q8K A;  4IJL A;  4C56 C;  5M3M B;  2QEX A;  5IGD A;  1D6E C;  2K6A A;  4DR1 Q;  2DGY A;  3Q24 A;  4DR2 Q;  2N3S A;  4A3J B;  2E2H H;  2OTL A;  1U5K A;  2BH8 A;  1AN8 A;  1GHJ A;  1K0R A;  2ZM6 Q;  1STB A;  3HOZ G;  1JC7 A;  2L15 A;  1HHV A;  4DR7 Q;  1WI5 A;  4WFN 3;  4DFA A;  1PRT F;  3GTM H;  4LUZ A;  4DV0 Q;  1Y1V B;  1HA5 A;  2PW7 A;  1YHB A;  2KCM A;  3KF8 B;  4LUV A;  2JEB I;  4JI2 Q;  3UDX A;  1B1Z A;  3AFP A;  2BH2 A;  2R7F A;  4C3J H;  4A3D G;  5D3I B;  3TZD A;  5C0X I;  3KYH C;  5FO8 B;  1N8R C;  2K5V A;  4XT1 B;  1IBL L;  1TS5 A;  3IKJ A;  4IZ8 A;  3G6J B;  2SOB A;  3T1H L;  3NQT A;  3PO3 B;  2AWN A;  2EE1 A;  3VA5 A;  1DM0 B;  3NWT A;  2EYP A;  4B08 A;  2D62 A;  1FYC A;  1Q1B A;  3MXU A;  4XTC S;  1U9R A;  1PZJ D;  4LMQ D;  3DXJ C;  3H3V I;  3ITP A;  3CRK C;  3I90 A;  2Q2U A;  3EFX D;  1G29 1;  1GVP A;  4OWW B;  1A63 A;  1AE3 A;  1VQG A;  1H9R A;  2WP8 J;  3S2D B;  2M2L A;  1KNA A;  3GTK H;  2NVY H;  2L1B A;  4LFA L;  3J7Y W;  2IX3 A;  1T5E A;  4DAY B;  3M4O H;  1N36 Q;  4XDX A;  5EPL A;  5LHY 1;  4A76 A;  1QZH A;  1HJP A;  1CSQ A;  1NR2 A;  1AEX A;  1DGS A;  1SAP A;  1DOK A;  2OT2 A;  1JCK B;  2F0H A;  2NVQ H;  4G7H C;  4F87 A;  5C4J H;  1HPC A;  2IW3 A;  5ELD A;  2EYH A;  3NEM A;  4R8I A;  2Q8R E;  3HOZ B;  4GOP A;  3BVZ A;  1OO9 B;  3K6O A;  2P5Z X;  3N6R A;  1WTP A;  1AW7 A;  4C3I H;  3VR6 A;  1Q7Y C;  4A75 A;  4A3D B;  2KEN A;  2E76 C;  4G4K A;  1PA6 A;  1MIU A;  3A8K E;  1SNO A;  1NE3 A;  2XRQ D;  3I55 A;  4DV6 L;  2MFI A;  4XXE A;  1EOV A;  1EQV A;  5ELC A;  1HZC A;  4TKO B;  2MJ8 A;  3RN5 A;  1X56 A;  1S3O A;  3JAM E;  2TMP A;  3I91 A;  1K83 B;  4NW2 A;  2QKI C;  5GQO A;  1D2B A;  2F4V Q;  5M5X B;  2RHQ B;  4U68 A;  3PO2 B;  2BA0 A;  4J15 A;  4OON A;  1CK1 A;  4R4O A;  3AQQ A;  3DEP A;  2AHO B;  3P75 A;  2ZXO A;  2EPB A;  3S1N B;  1SMY D;  3PUX A;  4IJH A;  5AJ3 Q;  5FOB B;  1SYG A;  1QZG A;  1ENC A;  4K5V A;  4IUR A;  5C0X H;  4HSV A;  1K3B C;  2B2Y A;  1YHQ A;  1GM5 A;  1BOS A;  5HGQ A;  1LTG D;  2R7Z G;  1S5F D;  2NZO A;  3NEL A;  1L2F A;  2G9H D;  1WTQ A;  1N32 Q;  1QNU A;  5EKL A;  1EYD A;  4RGT A;  3CRL C;  3KJP A;  2CH4 A;  4WJ4 A;  4HED A;  3E0E A;  5IP9 G;  3HOX H;  1IBK L;  1X6O A;  2A6H C;  1HR0 Q;  5E3F A;  3TDQ A;  4S3S A;  1HNW Q;  4TSS A;  4DR4 L;  4OEM B;  5C4H A;  3H3V H;  2K05 A;  5HUR A;  1Q90 A;  1IYJ B;  3Q0A A;  4OX9 L;  2XVS A;  2R92 H;  4C3H H;  4B3M L;  3RZD B;  3BJU A;  1HZB A;  2GA4 B;  2IX1 A;  3BVG A;  2VQE L;  5JJZ A;  1A62 A;  1GD7 A;  2LKV A;  2JXM B;  2O2L D;  2IHF A;  2F0N A;  4XQN A;  4BXX G;  1TKW B;  1WTV A;  3S2H B;  5NUC A;  1B9M A;  2OQ0 A;  4K2L A;  4B9W A;  3GTQ B;  4RCO A;  3BG3 A;  1SMX A;  4DV2 Q;  2B2V C;  4B3T L;  1JOK A;  5HY6 A;  2K5Q A;  1Y1W G;  2HIV A;  2OF1 A;  4L5S A;  3HOW G;  5CBA E;  1JR0 D;  4CBV A;  4HJ7 A;  1EQQ A;  1AFP A;  3A8I E;  5CYU A;  5JJL A;  2WII B;  1G6P A;  2EDG A;  3GTP B;  4C3J G;  5IT9 L;  1BCP D;  1EIG A;  1EYA A;  1HZ9 A;  4RGO S;  1ROD A;  1B9N A;  4NXN L;  5BR8 L;  1ASY A;  2ES2 A;  4BBR G;  2D0P A;  2R7Z B;  1JWU D;  1VQN A;  4BBS G;  5F2D A;  1U0L A;  2ZXR A;  5DEH A;  4DAM A;  2NUC A;  2F52 A;  4B3S Q;  2PQA B;  2JA7 H;  1T5X D;  4JV5 Q;  4JG2 A;  4NB3 A;  2E2J B;  1OXT A;  3TZU A;  2EY5 A;  4RFB A;  1QUQ B;  1XMQ L;  5M5W H;  4L8J A;  3VYU A;  4CKE A;  2JJQ A;  2DNE A;  3IFD A;  5LL6 S;  1M90 C;  4L5Q A;  5E7N A;  1XYI A;  4LFC Q;  3S1R B;  4IO9 A;  1A6X A;  2RDH A;  3HP3 A;  3I56 A;  2JP1 A;  1UUP A;  5EJW A;  2RBM A;  1KAB A;  4BY7 H;  5IT9 c;  5IGE A;  1ONL A;  3D4R A;  3SHL A;  1IKL A;  1PYS B;  5IYC G;  4RKB A;  2JA9 A;  3CCS A;  2E2H B;  1YNN C;  5ELO A;  1EIY B;  4PZ8 A;  3V05 A;  3HOY H;  4A3C H;  1K0S A;  1SE2 A;  2FHT A;  3WOE A;  1I6H H;  4H0L C;  1HQM C;  3GTM B;  3E9I A;  1IZ6 A;  4HIM A;  3MC0 B;  3I4M H;  3HOW B;  3S14 H;  3LNN A;  4JC0 A;  3GTO H;  5M9O A;  1LT4 D;  3NTH A;  5GAG C;  1MKH A;  4C3J B;  2UUA Q;  2WAQ E;  2VQF Q;  3TP8 A;  2NBF A;  5T1G A;  2BCO A;  1Y69 U;  1WTH A;  2YYZ A;  5M5Y H;  4BBR B;  4A3L G;  4BBS B;  3QJY A;  1DZ1 A;  1F9S A;  4HJ8 A;  3D4D A;  5EQ0 A;  2F3W A;  2VS1 A;  4J8Q A;  1TS3 A;  5JEA H;  3WWV A;  3MXN B;  1VQE A;  3EQL C;  2MGS A;  1V8Q A;  1F2L A;  5J3B A;  2I5M X;  1BUV T;  1XNQ L;  4GZY C;  3TEH B;  4F7X A;  1D5Z C;  2R61 A;  5KEE A;  2Z0S A;  1FR3 A;  5CMD A;  2F0S A;  1IBL Q;  1A8V A;  1O7L A;  3G6E A;  3RZO H;  1I4G A;  3DWQ A;  3M4O B;  3KUP A;  5IGC A;  2DJG C;  2L55 A;  5CR3 A;  4RGN A;  5C3E H;  2UXD Q;  3TP6 A;  4Q5V A;  3GTL H;  3OSO A;  3URY A;  4LNQ A;  1K28 A;  5C4J B;  2N55 A;  3H0G H;  1XNR L;  3TP5 A;  2BE5 D;  3K5L A;  2JYO A;  3LX0 A;  3RR5 A;  1JT8 A;  1I3Q H;  5EKK A;  5KNB A;  4IAL A;  3TQY A;  1ET6 A;  4JBM A;  4C3I B;  4H02 A;  4IPG A;  5EPK A;  3QO2 A;  2CCZ A;  2BOS A;  3OW7 A;  1Z6H A;  1AE2 A;  3P7J A;  3T4A C;  2WV6 D;  1Y8P B;  4IPD A;  1E2V A;  3IFT A;  1E3P A;  1SYB A;  4UAI A;  1K3R A;  1ILQ A;  1RD9 D;  2MO0 A;  1CQV A;  1CZG A;  1X65 A;  4CDF C;  2GVA A;  2QIL A;  1XWE A;  3KLW A;  5CV8 A;  1PH3 A;  1JOO A;  4K6D A;  3VR4 A;  3RNU A;  1HR0 W;  4QQB X;  3RMH A;  4CKB A;  1E2Z A;  2F0L A;  2FJ2 A;  3W1G A;  1EY8 A;  4JI0 Q;  2A19 A;  4OL7 A;  2JA6 H;  4UHV A;  3PUV A;  2B2T C;  3TS2 A;  2HCC A;  1TWF B;  2JN4 A;  1MHW C;  1V9P A;  1WCM H;  2A8V A;  3K81 C;  2E5L L;  4P71 A;  1RTO A;  4KMU C;  1KHI A;  3M4Y A;  4E6I A;  3A0J A;  3PUZ A;  3NXW A;  4RGM A;  4DR6 Q;  3FEW X;  3P20 A;  2A6E D;  5IOD A;  1HNX Q;  5T1I A;  1UE5 A;  4N8F A;  1EY4 A;  1TQO A;  2B2W C;  1S5D D;  2CFM A;  3HOX B;  1OXS C;  1XTC D;  3NP8 A;  5ELF A;  2Z4I A;  1F9Q A;  1L1O B;  1STN A;  1DOL A;  3I7F A;  3J81 i;  1UAP A;  3MTS A;  2JA8 G;  1JE5 A;  3TME A;  4C3H B;  3EIV A;  4DV1 L;  4ZQ3 A;  2R93 H;  4R9W A;  1E1O A;  2FIN B;  4PG3 A;  5GAD C;  3OWE B;  3J80 L;  4DU9 A;  1V1P A;  4C1N I;  4DKA C;  1F2M A;  5JVH 3;  4XYO A;  4LJZ C;  1I4P A;  1JE4 A;  4R1J A;  1VQI A;  1U4P A;  1VCI A;  2F0P A;  3OTO Q;  1YNX A;  4JBK A;  4B3R L;  1PTO B;  1IYU A;  2IL8 A;  3IRB A;  2EYM A;  2PW5 A;  4IFD G;  1DOM A;  1X3F A;  4U67 3;  4OO1 G;  2IHE A;  4DR3 Q;  1A3V A;  2QEJ C;  1EU4 A;  2MHV A;  4BY1 G;  1VF7 A;  5C44 G;  2NVT H;  1HA6 A;  2GVB A;  4IFD J;  3UI2 A;  5C5M A;  3H09 A;  1JMC A;  2CW0 D;  1LTI D;  4LF6 L;  3T56 B;  1DCZ A;  1I5F A;  3ULL A;  1ZYR C;  4QGU A;  3I72 A;  4DV7 Q;  1PH8 A;  1F77 A;  2RDF A;  4QUF A;  1PLF A;  3J80 c;  4DNI A;  1SE3 A;  3D3R A;  2IX0 A;  4A3I H;  1G91 A;  3PQI A;  1PRT C;  3CC7 A;  3CCM A;  4WRD A;  1Q86 C;  3VR3 A;  3I4N H;  1L0Y B;  5BR8 Q;  4LWC A;  1ICF B;  1S5E D;  1HFG A;  1Z9F A;  3PUY A;  3PCO B;  2YTY A;  2K5N A;  4YHH L;  2NB0 A;  4ZRZ A;  3UDI A;  4DK0 A;  4EQP A;  1TWC H;  1PFB A;  2ZTC A;  3PUW A;  4R4T A;  3DHQ A;  3UE1 A;  2EXD A;  1CZW A;  5KGU A;  1CA6 A;  2F3I A;  1XMQ Q;  4A3M G;  1XPO A;  1BO0 A;  2XWB B;  4RHR A;  4IUU A;  5I9P A;  2I5L X;  1QJO A;  1CI3 M;  4EQO A;  3MHB A;  3GP7 A;  2L12 A;  2JA5 G;  3M7G A;  3SK5 A;  1HUN A;  4RH6 A;  3B6Y A;  2K28 A;  5C44 B;  4DUZ L;  3CPW A;  3A56 A;  1IL8 A;  5CBE E;  4IPC A;  2UUB L;  4A3E H;  4DV5 L;  5M5Y B;  3VYS A;  4JI1 L;  3MAQ A;  3PIP A;  1H95 A;  4FXK C;  4ABN A;  4A3G G;  1XTD A;  2X69 A;  5EPJ A;  2QW7 A;  2B63 G;  1HTP A;  4PQX A;  1BXT A;  1LAC A;  2D0O A;  4UP8 A;  5J22 A;  3CCE A;  1X3P A;  1PZI D;  1SND A;  3CMA A;  2F0Q A;  4A3K H;  1PH4 A;  5IP7 H;  3LWE A;  1I94 L;  3MFY A;  1YIJ A;  4FF2 A;  3R8B A;  1J9O A;  2EY2 A;  1KNE A;  5M3F G;  2MP1 A;  1WTW A;  2LMC B;  3VDY A;  1K73 C;  1T9H A;  4LF9 L;  2CH4 W;  2KUM A;  3CCJ A;  5KIX A;  3RZO B;  5BN4 A;  2NVX B;  1SRO A;  2F0O A;  2AWO A;  2F0E A;  3A54 A;  2K01 A;  4V0B A;  2NN6 I;  1XNQ Q;  2KEC A;  3H0G B;  3S15 H;  4A3M B;  1B53 A;  1SE8 A;  2VUM H;  3ER0 A;  2EXZ A;  3L0O A;  3PF4 A;  1E7Z A;  3STB C;  3G71 A;  1V1O A;  5G3L D;  4DN4 M;  1TWA B;  1QG7 A;  4ZLT F;  1FNV A;  1MJC A;  3HFZ B;  2Q8I B;  2JA5 B;  1GUN A;  4LF4 Q;  1EY0 A;  2E8G A;  4QY7 A;  1BBU A;  1G51 A;  3K7A H;  3F2B A;  3PO2 G;  1SJH D;  3FP9 A;  3S17 H;  3K5N A;  1SYC A;  1EIH A;  4FXG C;  1R4P B;  4RG1 A;  4X66 Q;  2Y0S E;  2Z6K A;  1XNR Q;  3I4O A;  5CC4 A;  1CM9 A;  4A3G B;  2ZJP A;  1G8Z D;  2B63 B;  4WJW A;  4JI6 L;  3W3A A;  2QF7 A;  3OHX C;  1ZXT A;  1YNJ C;  2RKS A;  1VQ5 A;  2UXC L;  3FPP A;  5IT9 E;  3CQZ H;  4MTK A;  3F2U A;  5EAY A;  5LL6 X;  2JA6 B;  1PDQ A;  2ZJR A;  2ZXP A;  5ELE A;  4A3B H;  1JIC A;  5IGG A;  1TWH H;  4JI5 L;  1XPR A;  2QA4 A;  3G48 A;  1HH2 P;  3JAM i;  5M3F B;  1R9T H;  1WCM B;  2PCF B;  1EZ8 A;  1IKM A;  5EKI A;  4IUT A;  1ENA A;  4DXF A;  3NHH A;  4JPB W;  3SK8 A;  1SR3 A;  5IY0 A;  5GAE C;  1L1O C;  1QOH A;  2A68 C;  3KLS A;  2WAQ G;  2AQ2 B;  1VQF A;  5JJI A;  1K8O A;  3GV3 A;  2K5H A;  4CJ0 B;  2HHH L;  4X64 Q;  2H1E A;  2EJF C;  1F2Y A;  2D2C C;  4NXM L;  1V1Q A;  4AQY Q;  1VQB A;  3K0X A;  3FKI H;  3HGB A;  1BKB A;  4K8I A;  1OXX K;  1PHJ A;  4X62 Q;  1H9S A;  4OGQ C;  5J39 A;  1IL2 A;  3U9S A;  1YNN D;  4G7O C;  1UWV A;  3UDG A;  4YWM A;  4DUY Q;  1VMP A;  1PTO C;  2E5L Q;  5FJ8 H;  1V1P B;  1EY9 A;  4POF A;  4BA2 I;  4A3F H;  5I6Y A;  4ME3 A;  3KFU A;  5K36 H;  3A5U A;  4MZ9 A;  1BQQ T;  4ILW A;  3OYY A;  3P1H A;  4M8A A;  4KN7 C;  1S5C D;  3R2T A;  3TBI B;  2I5H A;  1H9M A;  1EQT A;  3ERO A;  4A93 H;  2KQ3 A;  1CHP D;  2VB3 X;  2NN6 H;  2KHS A;  1KTK A;  1GUT A;  2MO1 A;  4PMC A;  3PSI A;  4P2C B;  4FF3 A;  5FLM G;  3NPP A;  2UU9 L;  1BR9 A;  3BU2 A;  4CKC A;  4KY6 A;  4DV1 Q;  1MBY A;  1X32 A;  1S72 A;  1BCP B;  3GD7 A;  3A55 A;  4KV6 A;  1EFI D;  3KLS X;  4PMB A;  4ALP A;  2WAQ B;  2HCI A;  4X65 Q;  3DLL A;  2IWH A;  1FL0 A;  2F0F A;  5IWA L;  1GOZ A;  1SEB D;  5DM6 3;  4LF8 L;  1WJJ A;  5IYB G;  1HCZ A;  4KKU A;  3TRZ A;  4B3R Q;  2L9H A;  4DPG A;  4GNX C;  4J1M A;  2O4X A;  1XPU A;  4IFD I;  1HRJ A;  1I4X A;  4YY3 Q;  4OO1 I;  3N52 A;  3KLR A;  2LXK A;  1ESF A;  1BVS A;  3R93 A;  4JI3 L;  3HZX A;  2RHS B;  4A3I B;  3CF5 A;  4PV1 C;  5COR A;  4KKT A;  1BBW A;  4QUC A;  3I4N B;  4QL5 A;  1PYW D;  1LUZ A;  2F3V A;  4G57 A;  4JBJ A;  2UXB L;  3MEH A;  1U4R A;  1SDF A;  2SDF A;  4FO2 A;  1H9K A;  1C4Q A;  1NCV A;  1PMR A;  4IN3 A;  4F8M A;  1CKO A;  1PTO F;  2BA1 A;  5C4X H;  1AZP A;  4X3U A;  3VR5 A;  1GUO A;  5J1Z A;  3DMU A;  1PYB A;  4RWS C;  3C1F A;  1KXL A;  1TWC B;  2K1B A;  1W2B A;  4CDC C;  2AQ3 B;  1RDP D;  2HQE A;  1PH2 A;  2KBN A;  3S16 B;  2C9O A;  1FD7 D;  3HOV H;  3AEV A;  3EBE A;  1GUS A;  1LTL A;  4Q0F A;  2XGT A;  1VF5 C;  2RF4 A;  3NBH A;  1PFN A;  1SFO H;  4EVO A;  1SYD A;  1YJ9 A;  3LWU A;  1QVF A;  2SNM A;  3S24 A;  1NY4 A;  1P16 A;  2EVB A;  4YHH Q;  4DNR B;  1S40 A;  3HOU H;  1SBB B;  1C8C A;  1SJE D;  2J7Z A;  4RKL A;  4LF5 L;  5LMU Q;  2M00 A;  4DAV A;  1Y8O B;  4DAP A;  1UE7 A;  4MIU A;  2L11 A;  4HCS A;  4OIK A;  3J7A V;  3EJI A;  1YIT A;  1WOC A;  1J6Q A;  2LY7 A;  4A3K B;  1VMC A;  4O1N A;  1ILP A;  1KRT A;  3DWA A;  3CCU A;  1UNS A;  1LTS D;  4KHZ A;  1EEI D;  2ZTE A;  1IBM L;  3I70 A;  4GKK L;  3M3Y H;  4Y7N H;  4RAU C;  4DV5 Q;  1Y14 B;  4JI1 Q;  2IT1 A;  2ENB A;  4GLV B;  4JI7 Q;  4R8N A;  2E2I H;  3KJO A;  1ICW A;  1CSP A;  2K04 A;  2SNS A;  4ZCK A;  4C3I G;  2Q8T A;  1HXY D;  1L0W A;  3CHB D;  2CQO A;  1CUK A;  3RUZ A;  2V4D A;  3C2P A;  4JI8 L;  3GTG H;  3UDF A;  2B29 A;  2J4X A;  3RLO A;  4ZKB B;  4L6T B;  3S1Q H;  2CKZ B;  3FPU B;  3NK9 A;  2VUM B;  1D1K A;  1SLJ A;  1IW7 D;  4KD3 A;  3U4V A;  1TS2 A;  2MNA A;  5IYD H;  2B2U C;  2ZJQ A;  4DNT B;  3J80 E;  4O0A A;  4HIK A;  3HKS A;  3K7A B;  2DJF C;  4A3F G;  1LAB A;  2VY3 A;  3CPF A;  2DNC A;  3S17 B;  4A4I A;  2SEB D;  1R4Q B;  2B2V A;  3GO5 A;  5CV4 A;  3Q22 A;  2Z4H A;  3C46 A;  3GTK B;  2NVY B;  1C48 A;  3BYY B;  3J7Z C;  3FHW A;  4GOP B;  5KND A;  4AYB B;  3T1H Q;  2E74 C;  3KF6 A;  3E5S A;  2VNU D;  2X6G A;  4KJO A;  5C0X G;  5M3M H;  3CQZ B;  3I73 A;  1CFM A;  4K5W A;  4A3J H;  2NVQ B;  3L3O C;  5EBC A;  2OEO A;  3BZD B;  4LUO A;  5FK9 C;  1W6K A;  4A3B B;  1PRT D;  3NEN A;  2RVL A;  4AIM A;  1Y1V H;  3HOX G;  1SXT A;  5JJK A;  3SR1 A;  5A35 A;  4MHE A;  1NTG A;  3Q6S A;  1H9S B;  4LFA Q;  3Q8D A;  5CV5 A;  4BS9 A;  2OWO A;  4N9T A;  2K14 A;  2PPB C;  3GTJ H;  2HIX A;  3CME A;  1IYV A;  3EA6 A;  2LS0 1;  1YHA A;  3M9B A;  2R92 G;  4C3H G;  2UUC L;  2EYL A;  1SNQ A;  2L4N A;  3KF8 A;  3FKI B;  3HKZ E;  4EX5 A;  5FLX L;  5GRO A;  1S5B D;  1N9W A;  4X3S A;  3PF5 A;  4RCN A;  1N36 L;  1LLR D;  3K8A A;  4JOI C;  3K7U C;  1PH5 A;  5KYI A;  2O5I C;  1LO5 D;  3MZ5 A;  4UPA A;  4N8X 1;  3CU7 A;  4F88 A;  4A3F B;  2YV5 A;  4K8J A;  1AZQ A;  2WB1 E;  2HHH Q;  5C3X A;  5C6A A;  2HDM A;  1FNU A;  3S2D H;  2VL6 A;  2F1M A;  3KBG A;  3BDL A;  4NXM Q;  4FDB A;  4DV6 Q;  3C3L A;  3BZC A;  2PQE A;  5A2Q L;  1ET9 A;  4EGV A;  1YJW A;  1B7Y B;  4A93 B;  5ELB A;  3NWS A;  3E0J A;  4XQJ A;  1EWI A;  2ICE C;  2XN9 C;  3HOZ H;  1CTM A;  3H15 A;  5FLX c;  2MPM A;  4DAY A;  2RDG A;  2EZV A;  4LK1 C;  2JA7 G;  5H1S E;  1JQY D;  1J5E L;  1SNM A;  2PZU A;  4A3D H;  1EIF A;  1K8A C;  4IOA A;  3AFQ A;  1V43 A;  3A8J E;  4IUQ A;  4DA2 A;  4EQN A;  4KI0 A;  4CGY B;  2R92 B;  3SEB A;  5LMN L;  4G7Z C;  2Y0S G;  1VQ8 A;  1TVX A;  5KYL A;  1VQL A;  4GLX A;  4AYB E;  4HSP A;  1NMF A;  3ERS X;  4RA8 A;  1IBK Q;  2I46 A;  3F8T A;  5K5P A;  4BY7 G;  4PZ7 A;  1N32 L;  1YEZ A;  3VYR A;  2KHJ A;  2N88 A;  5M5X H;  4DR4 Q;  2EY6 A;  1XXG A;  3HOY G;  4M1U B;  1F9P A;  4A3C G;  3LGJ A;  4OX9 Q;  2EIF A;  4O42 A;  2HUG A;  4LF8 Q;  2PMZ B;  1UEB A;  3I4M G;  4B3M Q;  4NDX A;  2DY8 A;  4LFB L;  1N34 L;  2VQE Q;  4P72 A;  4HJ9 A;  3V96 A;  3T1Y L;  1HQR D;  2XWJ B;  3F2C A;  2F0W A;  1MJE A;  1ZEQ X;  1BCP F;  2D5D A;  3U50 C;  2IJ0 A;  4GN4 B;  4JI3 Q;  4JK1 C;  4KY5 A;  2EY1 A;  1ZKO A;  3NQI A;  3PIO 3;  3I3C A;  3CCR A;  1N33 L;  1YNJ D;  1SFO B;  2UXB Q;  3E9H A;  4Y52 H;  2VB2 X;  5JEA G;  4B3T Q;  3TP7 A;  4ZKC B;  2JA7 B;  3H91 A;  2F4I A;  3CP0 A;  2MUY A;  3OPO A;  1A0I A;  1JOR A;  3FRP B;  1DD2 A;  1X54 A;  2B39 A;  5FO7 B;  2EYF A;  4MTN A;  1FGB D;  5HGT A;  1HTL D;  1VQA A;  1HNZ L;  1WD1 A;  5M5W B;  2A73 B;  4NXN Q;  2IPK D;  2A68 D;  4K0K L;  3OMC A;  2B2T A;  3ONA B;  3W1B A;  1H9J A;  2Y0S B;  3FDT A;  3IL8 A;  3NSW A;  2LXJ A;  4MN3 A;  4XQQ A;  3BDC A;  3S2H H;  2IY5 B;  5C3E G;  4BY7 B;  2BDN A;  5TSS A;  3CW2 C;  2EJM A;  1BF4 A;  2WKD A;  5E1F A;  1EOT A;  1LTR D;  1BDO A;  4Z9C B;  4TRD A;  3H0G G;  2WAC A;  3HOY B;  3M3Y B;  1RL2 A;  3E3X A;  3RLN A;  1I6H B;  4HR7 B;  5ELN A;  3SK4 A;  5BN3 A;  4QB4 A;  4JV5 L;  2E2I B;  5BN5 A;  2B2W A;  2F03 A;  1JJ2 A;  1Q82 C;  3I4M B;  3S14 B;  4DGZ A;  2JQO A;  3SK6 A;  1VQ4 A;  1STY A;  3GTO B;  1QB5 D;  3GTG B;  2R7Z H;  3WOF A;  5JPN C;  2AQ1 B;  1O7I A;  2K4K A;  4GOP C;  3G7L A;  5I6W A;  1IBM Q;  1D5M C;  5C5L A;  4GKK Q;  5IP9 H;  2RQX A;  2G9D A;  2PYK A;  4XIG S;  5C4Z A;  2NTT A;  4RMF A;  3I8Z A;  2WIN B;  4L63 B;  2Z6B A;  3KF6 B;  4TVA B;  3K58 A;  2VXW A;  3CCQ A;  2KJX A;  1CKN A;  2JA6 G;  2A6H D;  1OXU A;  4K14 A;  3Q23 A;  1PZK D;  1KAW A;  1RJT A;  2N49 A;  2PQA A;  2F0K A;  4ZYS A;  4GKJ L;  4B9X A;  2Z1C A;  3M4P A;  2PMZ E;  1MSG A;  3CC2 A;  1WCM G;  1B8A A;  1F2Z A;  1VDZ A;  1NNX A;  2KOL A;  1ESR A;  2UUA L;  4K6L A;  1C0A A;  2VQF L;  1X55 A;  1YZ6 A;  2WKC A;  4GLA C;  4BXX H;  1QUQ A;  1VS0 A;  1KC8 C;  1W6J A;  4K5X A;  5C3E B;  3MA2 B;  3GTL B;  2JE6 I;  1QWY A;  3QWN A;  4JBW A;  3NBI A;  4YCU A;  1I4R A;  3TSS A;  3U9O A;  2PNR C;  3SE0 A;  1QIL A;  1XMO L;  4I7Z C;  3D6W A;  3PMF A;  2K5W A;  1A15 A;  1Y1W H;  1EEF D;  2Q2H A;  3QOJ A;  1I3Q B;  1B50 A;  1NBW A;  5I2Y A;  5CV6 A;  3HOW H;  3AMU A;  2R6G A;  4JYA L;  1B2T A;  1WTR A;  3G4S A;  1VQD A;  4DV4 L;  2B2Y C;  3HRZ C;  2KHI A;  4XYQ A;  2CWP A;  4EQ5 A;  2A69 C;  3CKI B;  2XNA C;  3GTJ B;  4BBR H;  1EUJ A;  2NTS A;  4BBS H;  2A5H A;  3J81 L;  4J6H A;  1SE4 A;  1EY7 A;  2YU9 H;  1KD1 C;  5I9O A;  2R93 G;  3R3O A;  3J7A F;  1K8G A;  4BA1 I;  1KLG D;  3CCV A;  1O80 A;  2UXD L;  1MI2 A;  4IUV A;  1LT3 D;  2PI2 A;  1OTC A;  3SVM A;  2OQK A;  1X9N A;  3S1M H;  3ULJ A;  3JC6 6;  2DN8 A;  3CD6 A;  3QR8 A;  1HZA A;  4QF4 A;  1Q3L A;  2Z9H A;  4OWX B;  2F0V A;  1L0X B;  1A2T A;  3MXN A;  2UUC Q;  1IHZ A;  2KED A;  2CW0 C;  2HDL A;  3H3V C;  3OOC A;  4KK7 A;  1CT1 D;  4YWL A;  5D3D A;  4H44 C;  1B4O A;  2PO4 A;  2PZW A;  5IYC H;  3J81 c;  1ML0 D;  3OWF A;  4LW1 A;  4WOR A;  2DY7 A;  4ME5 A;  4KN4 C;  5IE8 A;  1E24 A;  2VZA A;  3V2T A;  3AU7 A;  1MSH A;  1QE6 A;  1LT6 D;  3A5Z B;  5JPM C;  4A3I G;  1STE A;  1I6V C;  3IAY A;  4JI0 L;  1I50 H;  1VQC A;  3I4N G;  3MEF A;  1XX8 A;  4A3L H;  1KL9 A;  3FVQ A;  2M9V A;  3MVV A;  2R93 B;  3OMG A;  3I2Z A;  1UE1 A;  1SN8 A;  5CV7 A;  4JI4 L;  2OTJ A;  1B70 B;  4DR5 L;  2CQA A;  1NSN S;  1SNC A;  1FVI A;  3MWY W;  2XIW A;  4DR6 L;  3J7A 5;  3DUZ A;  4YWK A;  3DM1 A;  1J5E Q;  2I0Q A;  2F0G A;  3L7Z C;  2F0J A;  1HNX L;  2DUD A;  4RHS A;  4YIJ A;  5KRU A;  1PV4 A;  2N78 A;  4P73 A;  2XTI A;  4LAA A;  5IOC A;  1RCV D;  4H7B A;  1LTA D;  2YTV A;  4FVM A;  1TWF H;  2H4O A;  5LMN Q;  2JEA I;  3SXH A;  1B44 D;  1SRU A;  3GV6 A;  5AFW A;  1PFM A;  4OHJ A;  3H6M A;  1UEA B;  4UP9 A;  4DK3 C;  1ENF A;  4LF7 L;  3ND9 A;  2NVT B; 
#chains in the Genus database with same CATH homology
 4JW0 A;  4I7A A;  5L37 A;  2Z9H A;  4JVZ A;  4N8F A;  2QW7 A;  4N8X 1;  2HD3 A;  2RCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...