4JW0A

Structure of gloeobacter violaceus ccml
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
MQIGRVRGTVVSSQKEPSMVGVKFLLLQLIDEAGQPLPQYEVAADGVGAGLDEWVLFSRGSAARQVAGSEKRPVDAVVIGIIDTVSVDNRPLYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Two new high-resolution crystal structures of carboxysome pentamer proteins reveal high structural conservation of CcmL orthologs among distantly related cyanobacterial species.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 15
structure length 95
sequence length 95
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4jw0A00
4JW0A 5L37A 2Z9HA 4JVZA 4I7AA 2QW7A 2HD3A 4N8X1 2RCFA 4N8FA
chains in the Genus database with same CATH superfamily
1IBLQ 5EBCA 4JI2L 1ZKOA 1KNAA 2Z6KC 3HOZG 1XMOL 4A3BG 2MPMA 3LNNA 3DWPA 2NZ1D 3AFPA 1KRSA 4RCNA 3PO3B 2F4VL 3I4NG 2WACA 5DLQE 4TKOB 1QZHA 4R4IA 2M00A 3G6JB 3CCVA 5T1IA 2VY3A 2VB2X 2DGYA 3OSOA 2QDLA 1ZYRD 5EPLA 3IAYA 1PYBA 2Z8LA 2F0DA 1KTKA 4YWKA 3NE5B 2NN6G 4TQUS 4XTCS 4LF9L 1AH9A 4GLAC 4YCVA 4QB4A 2PQEA 1HHVA 4RHRA 5CORA 3C3LA 1CQFA 2F0GA 4QUFA 1Q46A 2F0SA 1BVSA 1KDCA 5E4WC 4EQPA 3Q6SA 2F0MA 3MXUA 1GHKA 1STAA 3I4MB 1PVOA 1K8OA 3BYYB 4DV0L 3PO3H 3NHHA 3J80i 1Y69U 3SK6A 3S15B 2BH8A 3HZXA 3A55A 3T51B 2HCIA 1I4PA 5FJ8H 2RQXA 4KK7A 4ZRZA 4LF7Q 5HY6A 1RKNA 2B2TA 1BNZA 3E9IA 4XQNA 1VQCA 5HURA 5IP9H 4OEMB 4JI7L 3HRZC 4YIJA 4JC0A 4R8IA 3AEVA 5EPJA 4B3SQ 5COYA 1SLJA 5M9OA 1DYQA 4IQZA 2FJ2A 1EIYB 2XRQD 4RG1A 1MI2A 3U4ZA 1A2TA 4ILWA 2Q8IB 4YHHL 2HCCA 2JXMB 2YV5A 1G291 3HKZB 2YTXA 1F9QA 1CQVA 2XTIA 1FNUA 3MXPA 2NVXH 1Z47A 5KNBA 2XVSA 4IJLA 1NSNS 3S15H 1MJEA 3OHXC 4X65Q 4P2CB 3M4OB 1N32Q 2HQEA 2QCPX 4C1NI 3H94A 3NWSA 2AMCB 1LTGD 1C4QA 1TY2A 4LF7L 1JE4A 5LMUQ 4PZ6A 3E0EA 3I4OA 1DCZA 2B2YC 3MAQA 2MHVA 3GO5A 1FL0A 1X3EA 1QZGA 3JAMi 3R93A 3J7YW 2NYZD 4DPGA 3R3OA 2JEAI 3SXHA 2E5LL 1IBML 2CQAA 1XTDA 3M85A 1BCPB 1FD7D 2NWGA 2JA7B 4C2MB 5GAGC 2PO4A 4JK1C 1STGA 3W3AA 4X3TA 4L5RC 1SJED 5D3IB 1KAAA 4PV1C 4L6TB 1KIXA 2JA5B 3CCQA 1I4RA 1EQQA 2A73B 2R6GA 3ERQA 3RN5A 3M4OH 4JI8L 1V43A 4F88A 2C35B 2EY1A 1XTCD 4NW2A 3OYYA 4A3KB 5I6YA 3CP0A 5IGCA 2I5HA 2A6HD 5DEHA 2HQLA 5CR3A 4BS9A 4HIKA 5D3DA 1Q7YC 1VQGA 4QQBX 1RD9D 2RHQB 2XRSD 3C1EA 3MC0B 4XIGS 2JA7H 4Y52H 2LKVA 4C2MH 4X66Q 3AQQA 1YIJA 5JJIA 1PTOD 2A68D 1CKOA 2JA5H 2RDGA 4LUZA 5FO9B 3I91A 4X3KA 1G8ZD 2IL8A 5JPNC 1K0RA 1CI3M 2GN5A 1UEAB 3NBIA 4L8JA 4GOPB 2RHSB 2JA6B 1XPRA 1S5ED 2KCTA 4HIDA 1OXTA 3GD7A 4DAVA 3GTLB 5JEAH 4A3KH 4JI5Q 5KIXA 1PH6A 1J9OA 4HJ5A 5CMDA 1RL2A 4HJAA 1WTWA 1E2ZA 5M5WB 3C2PA 1TWAB 2DY8A 1PDQA 1SN8A 2RF4A 4YCUA 5IGFA 3T16A 3DEOA 4NXMQ 5JJZA 2F0JA 3D4DA 3AU7A 4A93B 2UUBQ 1AE3A 1CUKA 1PXUA 1HJPA 1HQRD 2EXZA 4DV3Q 2EYFA 3BDLA 1MKHA 1EU3A 2N55A 4OIJA 3ERSX 1AEXA 2F0FA 4ULLA 1NR2A 5E4XA 4B3RL 2JA6H 3NENA 3T53B 2C9OA 3MXNB 3GTLH 4BY7B 3IRBA 1D1IA 1CKMA 2GVAA 2F3VA 2LY7A 5M5WH 1CK1A 1JORA 1TWAH 3W1BA 1B3QA 2WAQE 4K2LA 2OTLA 1B8AA 4A93H 3GTGB 3TN2A 4K6LA 4OELB 1LTAD 3AFQA 2K7VA 5JAVA 1YHAA 4BBRG 4GN4B 1K28A 3TS2A 1DONA 1HFNA 4FF3A 3QOLA 2A6EC 4HCEA 1A2UA 1I6VC 2EJFC 4JI1L 3K59A 5KNCA 1SEBD 2B3GA 1SJHD 5C4XB 4DGZA 1LUZA 2EPBA 2TSSA 3OTOQ 5EKIA 3S14H 2XNAC 3TP7A 5IWAL 3CW2C 1SSOA 3MWYW 1EEID 3HOYG 2Z1CA 2EQSA 4BY7H 4WJWA 4I65A 5IT9c 4DV1L 1VQMA 2QKIC 2GVBA 3H0GB 1HA6A 3DLLA 1PYSB 4DNRB 2H5XA 4C3JG 2PMZE 1SYCA 1X9NA 1ASZA 2MGSA 2HT1A 1DM0B 3C1FA 4P72A 5EQ0A 4CDEC 3GTGH 5GQOA 1Y1VB 3KLWA 2DJFC 3MFYA 4IUVA 1JB3A 4RGTA 3T1YQ 3HOVG 1G6PA 1QUQB 2KA7A 5L37A 1HR0W 1IW7C 4RFBA 4EX5A 4R9WA 2AUKA 2BA1A 3BDOA 5LL6X 5A35A 1PMRA 5C4XH 2ID0A 2H4OA 2HHHL 1NJIC 1I4HA 2FINB 3CAMA 1DOMA 3X3MA 4DR6L 3A7AB 1LT5D 2SNMA 2DN8A 2F0VA 4PMWA 4LF4L 1BCPD 4JI6Q 2MQHA 3CCJA 4JYAQ 4ABNA 3VDYA 3H0GH 4A3GB 5JVH3 4BBSG 5IGBA 3CKIB 1HNZQ 2X6GA 1HA5A 1VQJA 3UE0A 2B2UA 1LV9A 5CV5A 3WOFA 1K3BC 2RVLA 1CFMA 2F0IA 4N9TA 2MUYA 3CPWA 4CJ0B 1Y1VH 1AN8A 1B4OA 2R7FA 4J15A 3ULJA 1CKNB 4K8IA 5EKKA 3LX0A 4CDCC 2A19A 2ENBA 3K80C 5LMNW 2XSCA 4IUUA 2JEBI 4FO2A 1WTPA 2EYPA 2IPKD 4IUPA 2WV6D 2F0WA 4XXEA 4OWTB 2Q2TA 2LSSA 4DR3Q 1O78A 4ZYSA 3QWNA 4RGMA 2JJQA 3RLNA 1HNXL 1A3VA 5A2QL 2BH2A 5LL6S 4A3GH 2I5MX 1WTRA 3IKJA 3ULPA 4QF4A 1PH4A 5GAHC 3KF6B 4BXXH 4POFA 1PH3A 4OX9Q 3HS0C 1QVFA 4A3DB 4B3ML 4AYBG 3HOXB 1CTMA 2QEJC 3FDTA 5JJLA 1TS3A 3RD4A 1PFSA 1XNQQ 5FLMH 3TDQA 4GLVB 5FKAC 1L0WA 2IY5B 1CZGA 3BVMA 1HFGA 1WCMG 2H1EA 1LYLA 3RZDB 1EIGA 2EOTA 3EQLC 3K5NA 4DV6Q 1RIPA 4P71A 2KCCA 3VYRA 3JAML 2OCEA 1H9SB 2WAQG 4R4CA 4OIKA 5JPMC 3O13A 2VW9A 1U9RA 4A3FG 5K36G 2KHIA 3U9OA 2OWOA 1VQ6A 4C56C 4A3DH 1PTOF 2JK8A 3D8GA 3KF8B 2PNHA 1LM0A 1GUTA 3PUYA 3HOXH 3RR5A 2EYJA 3M7NA 5E3FA 4LFBL 5M3MG 4IJHA 4BY1B 4K0KQ 3PO2B 1SMYD 2RCNA 3SHLA 4EGVA 3CRKC 4A3MB 2EIFA 1OXXK 4F8MA 2MJ8A 1RJTA 1NR4A 1XWEA 3RZDH 1GKHA 3A0JA 1R9TB 5C0XJ 2JA8G 2Q2HA 1RTOA 4LWCA 2PW5A 2HIXA 4JV5L 2Z9HA 5G3LF 1LABA 1IBKQ 2IHFA 1SYFA 1TWHB 4IN3A 4DUZL 1N34Q 2KOLA 4O42A 2UXCQ 1SDFA 3ZJYC 3CC4A 5C3XA 3L0OA 3R2IA 3GP7A 4FNFA 4BY1H 4ZKCB 1SNDA 4HR7B 5HGQA 1H95A 3PO2H 5EKLA 4K0KL 2QF7A 4A3MH 5IYBH 3KOJA 4X62L 2M2LA 4DR4Q 1WOCA 3D0FA 3HGBA 2KUMA 1ZYRC 2DNCA 2FHTA 4GKJL 2VNUD 1ICFB 4R4QA 1PA6A 2UUAQ 1ZEQX 4PMBA 3H3VI 4OO1H 1CHQD 1V1PA 1R9TH 5J3BA 4DK6C 4LF6L 5AJ3Q 4QL5A 3CHBD 3NBHB 1Y1WB 1MHWC 4UP7A 2B8FA 1X65A 4ZUIA 4PQXA 5EPKA 2F4IA 3J81E 1WJJA 3D6CA 3N52A 4CJ1B 4WFN3 4LF5L 1O7LA 3I4MG 1XMQQ 2KHJA 1N34L 1OXVA 1MSHA 4GZYC 1B44D 1GUSA 2KCNA 4TRDA 1IXRA 1EWCA 1DGSA 4DR2Q 1M4VA 4DR5L 3HOUB 3NTKA 1DOLA 5CYUA 2OQ0A 4JOIA 1TVXA 5FLXE 1KC8C 4KY7A 5LHY1 1SXTA 3NP8A 4G7HC 1TXYA 1KDAA 2I5LX 5C0XI 4IALA 3TREA 3K57A 3DEPA 5J1ZA 1VCIA 1Q8IA 1B9MA 3S24A 1VF5C 3A54A 5IP7H 3T1HQ 1D1KA 1N36Q 1SNCA 1W2BA 4ID6A 2UU9L 5CC4A 1DXMA 1Y1WH 4YWMA 4JI2Q 2L55A 5ISRA 4NMZA 1XMOQ 2IX1A 3K5LA 4JVZA 2F4VQ 2Q8RE 2F03A 1F9RA 1R4PB 3I55A 3KFUA 4A3EB 3S1QB 1S5DD 5I9OA 3F2DA 1JOKA 4A3JG 4X3SA 2PW7A 3J80c 1E7ZA 4P73A 3PCOB 3HOUH 1FR3A 2Z6KA 3TP5A 4FYDA 4KHPQ 1PTOB 3G4SA 3LGJA 3BG3A 4JCVE 3TEHB 1BCPF 2V1CC 1SNPA 2A5HA 4LF9Q 1HR0L 3P1HA 2B63G 1CM9A 1LTTD 5IYDH 2R93B 2Q2UA 3UE1A 3K5OA 2AKWB 4FXKC 4CKCA 3K58A 2E2JB 2D62A 2Z4HA 3KUPA 2ZM6L 1B53A 4DAYA 2K6AA 4DV0Q 4RGNA 4RAUC 2F1MA 2G9HD 4DV2Q 4A3EH 3S1QH 1ICWA 5ELFA 5GAEC 4A3LG 2JA9A 3PIPA 1U5KA 2RSNA 1Q3LA 3I4LA 3KYHC 2Y0SB 2YTVA 1PTOH 4KHPL 3QOJA 5JEAG 3MA2B 4DUYL 4A3KG 1U4LA 1LTLA 4RKLA 4JI7Q 3G48A 5LMNL 4Q0FA 1JWMD 1GVPA 2BCOA 2R93H 3J81i 1EOVA 3CU7A 3GV6A 2D2CC 3HOWB 4K8JA 1Z6HA 4KD3A 3JAMc 4YHHQ 3OPOA 4RKBA 1RDPD 2KHSA 3Q23A 1UUPA 4LMQD 2E2JH 2WB1B 1A63A 3GQBA 1WTVA 1IZ6A 1YNND 1GO3E 2NVXB 2A1AA 2A68C 5C3EH 2ZTEA 5KNDA 4KV6A 3ND8A 4DV2L 3OWEB 4MTNA 1BDOA 2VQFL 3CCMA 1Q90A 1PH8A 1N8RC 1ESFA 1SBBB 3U4VA 5C3WA 3CQZB 2O5IC 1I4QA 4EVOA 1VQIA 1S5FD 2ASBA 2ZJPA 2UXBL 4JBJA 2ZJRA 1KABA 4C3HB 2E5LQ 3SEBA 1IBMQ 2G5DA 3HOWH 4X64L 5IYCG 1Y8NB 2VB3X 2K5VA 3ZYYX 5ELCA 1IKMA 2BOSA 3VA5A 2B2YA 3EROA 3CC7A 1BUVT 3PIO3 1MD2D 3VR4A 2A74C 2NVTB 4DV5L 3PF5A 4JI8Q 4RHSA 3NELA 1BO0A 1P16A 2K04A 4HTHA 1I4XA 1E2WA 4F87A 1XYIA 1LTID 2EJMA 3AB9A 1KQSA 2NUCA 1O7IA 1VMPA 1A15A 2CWAA 3H6MA 2I46A 4HEDA 1D5ZC 1YI2A 1AZPA 4HIOA 4XQJA 2B2VC 1HZ9A 3A5UA 4HSVA 4DN4M 3CQZH 1K3RA 3GTKB 1UE1A 2PNRC 2NTSA 5JEAJ 4C3HH 4K6DA 1P8LA 2B39A 2GA4B 4YCWA 4IFDG 4N8X1 1LTSD 1TU2B 1EY5A 2CW0C 2NVTH 1QVCA 3TP8A 1EEFD 2RDFA 3J7AV 2CVRA 3BZKA 2O2LD 3K81C 3DUZA 4B3TL 3Q0AA 2PQAA 3FHWA 2N78A 1K0SA 1EY6A 1L1OB 4GN3B 5CV8A 4DKAC 3GTKH 3HOZB 3N6RA 3PQIA 2QW7A 4A3BB 1IYUA 3CXCA 2MP1A 4R8NA 1DOKA 4IPGA 3MVVA 2R7DA 3VR2A 3LWEA 2B29A 1YNXA 2ES2A 2Q2IA 2D0PA 1B1ZA 4I7AA 5BN4A 1G91A 2BA0A 1Y1VG 4ME3A 4XT1B 4K5VA 2PZTA 2RSOA 4KN4C 2F3WA 3E6ZX 4KLKA 3J7A5 4B3RQ 5HGTA 1STBA 1ZXTA 4LNQA 4H0LC 2K5DA 1JC7A 3K5MA 1AFPA 1UAPA 1PLFA 2XIWA 5C44G 2BE5C 2XGTA 3NQIA 5DNFA 3HOZH 1BCPC 4A3BH 1Q12A 4AH6A 1FGUA 3PUZA 1GUNA 3A56A 4UP9A 4MN3A 1L0YB 1D8LA 4MTKA 4BXXG 5E7NA 5C4ZA 1XNRL 1EIFA 5I2YA 1HPCA 1DD2A 3K8AA 5C6AA 5EAYA 2K05A 1YJNA 1EY4A 2L0CA 5EBDA 3OMGA 3CMAA 1PZJD 4JI1Q 3KLSX 2NN6H 4IFDJ 1GJXA 4EQNA 2F0HA 4X3UA 1EY9A 2LFNA 2O5JC 3HP3A 5FLMG 4IPDA 1ONLA 5IWAQ 3S14B 2MNAA 3WOEA 5IGEA 4DV1Q 1E0BA 1EUJA 1NUCA 4A3IG 4DXGA 3I2ZA 3S17B 2PI2A 3QJYA 1B2TA 4LF8L 1VQ5A 5ELBA 1M8AA 4WJ3M 2L11A 3RMHA 3GTOH 3CRLC 1JWUD 4GOPC 3BU2A 3U50C 1I3QB 1KD1C 1Q1EA 5I9PA 4KI0A 2VXWA 5IT9E 4DK0A 2HHHQ 3FKIG 2IHEA 4DR6Q 1N9WA 3UDGA 4LF4Q 1YVCA 1B9NA 3MFGA 4XYOA 4GKKL 1FGBD 3FMCA 3D4RA 1EY0A 3PV0A 1PV4A 3S17H 2IW3A 4QUCA 5M3FG 4QGUA 1RTNA 1B3AA 2A69C 2EXDA 3OIPA 3PUWA 4KJOA 2AQ2B 5I6WA 1KL9A 1Q8KA 5IOCA 1C8CA 1OTCA 4K5WA 2E2IB 4YY3L 3BVGA 4NXNL 1WTOA 4IUNA 4LFAL 4CJ2C 4IFDI 5CV6A 3WDNA 1I3QH 2QGQA 2HDMA 1JR0D 1QWYA 4BY1G 4JI4L 2N3SA 2HD3A 1FVIA 2IJ0A 1YBYA 1OO9B 4CDDC 1VQ4A 4FP5D 1HNXQ 2ATWA 4JI3L 3I73A 4Y7NB 3GTPB 3VYTA 3OOCA 4J6HA 3J81L 4CKEA 5DAUA 3FPPA 4F7XA 4DV4L 2EY6A 2SNSA 5FO7B 5E1FA 4UHVA 4MZ9A 2WB1E 1SYDA 2E2IH 1O80A 3QB3A 4XDXA 3K7UC 3M3YB 1T5XD 3H09A 1QB5D 4B3MQ 1U4PA 5JVG3 2QA4A 1EYDA 1QUQA 5CV9A 1CSQA 1LACA 4KMUC 4C3IG 1NY4A 4Q5VA 4E6IA 2MO1A 1A0IA 3CCSA 2EY5A 1U4MA 1Q86C 4PMCA 1PH7A 3Q22A 5C0XG 4Y7NH 1YHBA 3AMUA 3GTPH 4ZKBB 3CMEA 4GNXB 2KENA 1EY8A 4KKTA 5IP7G 4HIMA 3GTQB 4DR1L 2F0LA 3MHBA 1W3SA 1PFMA 2J4XA 3CD6A 1SAPA 5K5PA 4LUVA 4R4TA 2MO0A 3HKZE 1TWFB 1ASYA 1E24A 1D7QA 4OL7A 1LLRD 3M3YH 1JJ2A 1ML0D 1Y14B 4RH6A 3SK5A 2FFKB 3BZDB 1NAPA 3ER0A 4LFBQ 1QE6A 4RA8A 1PH5A 1Z7TA 3VYUA 3MEFA 2LXJA 2VUMG 1LTBD 5EJWA 3T56B 2VL6A 1HUNA 3J81j 4UY8C 2UXDQ 1R4QB 4H44C 2WINB 1N33L 2AWOA 2A6ED 4JBMA 3W2DA 4DV7L 4QMGA 2AHOB 3GTQH 1I94L 1SE2A 3DHQA 1J5EL 3KBGA 1FJGQ 1IL2A 1PFBA 4JV5Q 1SNQA 2PYKA 4A3CG 1QNKA 1EY7A 1TWFH 2R3ZA 4DUZQ 4POGA 2OQKA 3QR8A 3HOYB 4R4OA 5BN3A 3FP9A 4LK1C 4KKSA 4FVMA 4KKUA 2B2WA 4X62Q 4GNXC 1PRTB 4C3JB 5DM73 4UDUC 2J7ZA 4GKJQ 3PMFA 5JOBA 2UXDL 3STBC 3CC2A 3SK8A 1W6JA 1GUOA 1IW7D 2R93G 1RCVD 1VQ7A 4LF6Q 4HSPA 1NMFA 3S2HB 1LT4D 3TP6A 1UE7A 5CBEE 2K14A 2XWJB 1ET6A 4A75A 1FJGL 3DWAA 1JB7A 3NUCA 1IYVA 2E2HB 4V0BA 4LF5Q 2B2WC 4M8AA 2K5HA 4I7ZC 3NEMA 3M9BA 3NTIA 3PO3G 3HOYH 1SR3A 4QY7A 5ELDA 4ME5A 3VR6A 4DR5Q 1BBWA 3KDFA 1TWCB 5FJ8G 1WVLA 3R2TA 4IOCA 4C3JH 2JYOA 1STHA 1II3A 2EYHA 1EQVA 3S1RB 1PHJA 4ZK9B 5IP9G 3DXJC 3I70A 3HOVH 4ALPA 3IFDA 3TZUA 1VQAA 4OO1I 3S2HH 3F2UA 2UU9Q 4L5TA 5I4DA 3M4QA 2ICEC 3CPFA 2EDGA 1GHJA 2R92B 2K1BA 3RN2A 2E2HH 3BS1A 4MHEA 4L5QA 1HXYD 1UE5A 3EA6A 1B7YB 3F2BA 4DK3C 3H3VH 1KLUD 3RZOB 3F2CA 1NBWA 2FMMA 3S16B 2VQEL 1TWCH 2NVYB 3SDZA 3D31A 4BA2I 4RMFA 1PZID 1CA6A 1HR0Q 1K8MA 3S1RH 3PSIA 4BA1I 1ENAA 2D5DA 2L4NA 2SOBA 4AYBB 5BR8L 2P5ZX 3TMEA 4C3HG 1A3TA 1D5MC 3TSSA 4MIUA 3J81c 3OW2A 3A8KE 2ZM6Q 3NBHA 3HKZG 3J80E 2R92H 2L1BA 1TY0A 3A7LA 2J0TD 4JPBW 1GM5A 2KQ3A 2OXPA 3RZOH 4Z9CB 5C5MA 3MXGA 3S16H 4GN5A 2R7ZB 3F1ZA 3J7AF 1NNXA 1HCZA 1HNWL 2NVYH 2KECA 3L7ZC 1SE8A 1V8QA 1EYCA 1SNOA 4DXFA 4DUYQ 1L2FA 1X3PA 1X54A 2K5QA 1HRJA 5LMNQ 4A3FB 1WD1A 2K5WA 2EYMA 4WORA 4JBWA 1X55A 1MBYA 1VF7A 4ZAIA 1SROA 5ELOA 1KNEA 2N49A 1M1KC 2CQOA 3SE0A 4R1JA 4IPCA 2JA7G 5M3MB 1WTXA 1Y8OB 1YEZA 2F0KA 4H7BA 1KXLA 4OWXB 1WD0A 5C5LA 3KLRA 1BXTA 2JA5G 4RCOA 4IUTA 2VS1A 2K4KA 1PH1A 4NB3A 4JI0Q 5C3EB 1CA5A 1VQNA 2LXKA 2K33A 4U68A 1WCMH 4OONA 1I5FA 4XYQA 4QIWB 3UDIA 2VQFQ 2UUCL 4BWGB 2R7ZH 4ODGA 2YYZA 2KBNA 3UI2A 2JA8B 3IFTA 1BKBA 3RNUA 5T1GA 2WKDA 3JAME 2UXBQ 1E2VA 1ENCA 4A3FH 5K36H 5IGDA 1IHZA 1LTRD 3BDCA 2WP8J 1YNJD 2X69A 2K03A 4G4KA 2IX3A 1MSGA 4JBKA 4X64Q 5C4HA 2A6HC 4O2DA 2D9UA 4TSSA 3OIQA 1HZAA 2KEDA 2EE1A 5M3MH 2VZAA 4B9XA 1ESRA 5EGTA 3K0XA 4G7ZC 1VQLA 1PRTD 5IIFA 5IY0A 1TT2A 4V190 1U0LA 4DV5Q 1PTOC 2IWHA 1TQOA 4DFAA 1XPOA 2JP1A 2X6LA 4JI0L 4LFCL 3M7GA 1SNMA 1X6OA 5J39A 5CV7A 2E76C 2JA8H 3ICEA 5GADC 1SYGA 4AIMA 2JA6G 3PUVA 2XN9C 4CHTB 2KVMA 1BF4A 4DR7L 1IBLL 1JJCB 1G6ZA 2ZXOA 3EBEA 4A76A 4ZLTF 1XX8A 3V05A 4GLXA 1WTHA 4QJFA 2DUDA 4QCLA 4WRDA 1BBXC 1M90C 2KEEA 3IL8A 1A8VA 2B2VA 2BDOA 1YJWA 2AQ1B 4A93G 1JT8A 4U673 4RWSC 1EL0A 2YU9B 4JG2A 1UWVA 1X3FA 1EYAA 1SE3A 2NZHA 5IT9L 1QJOA 4FDBA 2L12A 4TVAB 1K8GA 2WIIB 3SK4A 1G2TA 4CDFC 3H91A 4KTAA 2ALYB 4B3TQ 1X3GA 1ILQA 1VQOA 4LJZC 2PCFB 1KAWA 5KRUA 4BY7G 5I2XA 1VS0A 2B2TC 3I4MH 4LAAA 1Y8PB 2K75A 4FF1A 4FXGC 1MGSA 3TZDA 4A3JB 4WJ4A 2PPBC 1A3UA 2PQAB 3RUZA 3PIP3 2OTJA 2YU9H 1BOSA 3E5SA 4YWLA 1EQTA 1QOHA 1STYA 3BVZA 4CKBA 4AQYQ 5KYLA 2B63B 2F52A 3FRPB 1CHPD 1A62A 4ZUJA 2G9DA 5C4XG 1JMCA 4B3SL 2JQOA 1EOTA 1K8AC 4KHVA 1KRTA 3L2PA 1V1QA 3WWVA 2RBMA 1C48A 3HKSA 3ONAB 1IKLA 5FO8B 3H0GG 2F0OA 1EYGA 2CFMA 3I4NB 1F2LA 2WKCA 1TS5A 4A4IA 4A3JH 1XNRQ 1STNA 4X65L 1N32L 2L5TA 2Q8TA 3ULLA 3F8TA 2C5CA 1S5CD 3PGZA 1NMGA 4NKLA 1E22A 1PH2A 4O1NA 5LMUL 2B63H 3FEWX 4AQYL 2XWBB 2QDBA 2ZTDA 2CKZB 2L15A 3VR3A 1XJVA 1C9OA 5BN5A 3Q8DA 1F9PA 2EYLA 1PH9A 5M5YB 1L1OA 4A3GG 1I4GA 5GROA 4LF8Q 1KLGD 2E75C 3OW7A 2I0QA 3I4NH 1ILPA 4UP8A 1SFOB 2DNEA 4A3LH 4X6AH 3NWTA 3S2DB 1EWHA 1E1TA 1AW7A 3GTOB 4J1MA 1SMXA 1H9RA 5M5XB 3ND9A 5IGGA 1T9HA 1VQBA 3K7AB 1J8IA 5IODA 2L9HA 3B6YA 1X3QA 2PZUA 2NN6I 4O0AA 1L1OC 1E1OA 2K28A 4DNIA 2Z4IA 1QG7A 3U9SA 4OGQC 5D65A 2ZJQA 3GTJB 1H9JA 1LT3D 2LMCB 4GKKQ 4GOPA 3D3RA 3OMCA 5G3LD 1FNVA 4X66L 4K14A 3RLFA 4DNTB 2ICIA 1VDZA 5M5YH 4AYBE 1F2YA 3AYHB 3D6WA 2F3IA 1D2BA 2BDNA 2KCMA 3PF4A 1SFOH 1CZWA 3L3OC 3V2TA 3S2DH 4YY3Q 1S5BD 2FXQA 4LW1A 4NXNQ 4A3DG 5M5XH 3MTSA 2KJXA 4LFAQ 3DM1A 2TMPA 4HJ7A 3HOXG 2CHBD 3K7AH 1BBUA 1S72A 4PG3A 2HIVA 4JI5L 4DAMA 4NP5A 4JI4Q 5IYCH 3E9HA 4OWWB 3GTJH 4H02A 3ITPA 3P7JA 4NXML 3I7FA 4JI3Q 3P75A 4EQOA 2SDFA 2Z6BA 2ZXRA 3S1MB 3NXWA 2CW0D 2UUBL 2RKSA 1D5XC 4KY6A 3MXNA 3QIAA 1HH2P 1AP0A 4HMIA 1EZ6A 1TWGB 1TKWB 3LWUA 4KY5A 2K32A 4DV3L 4DV4Q 4EQ5A 5FOBB 1BQQT 2E8GA 3I72A 4HCSA 3CCEA 1JJGA 4L63B 1SRUA 1RF2D 1VQFA 2ZXPA 1Q1BA 1PRTF 2Z0SA 1AZQA 4PZ7A 1VQ8A 4QIWE 1WYDA 5D14A 3NTHA 5KYIA 3PO2G 1IL8A 4IZ8A 3CCRA 2Y0SE 3EFXD 4A3MG 5IYBG 2RA4A 2QEXA 2AUJD 1O7ZA 1FYCA 3NK9A 1SMYC 1QVGA 1S40A 2CH4W 3GV3A 3C46A 4RGOS 3S1MH 2IX0A 1G2SA 3OWFA 1SYBA 4IFDH 4OO1G 4LUOA 3QO2A 4G57A 4DR1Q 1VMCA 4APVA 1I50B 1TWGH 2A8VA 1UEBA 2OT2A 1YZ6A 3G71A 3I56A 4KJNA 4CGYB 2K50A 1RODA 1VQDA 1PZKD 4PNYA 3OTOL 2RCFA 4IUQA 4JW0A 2BE5D 3CCUA 1W6KA 1F9SA 3QG1A 1Q81C 3NSWA 4NDXA 1ENFA 5C44B 1JICA 4K2KA 3DWQA 5TSSA 1V1OA 4H13C 1CT1D 2AQ3B 1TIID 5FLXL 1S4ZA 3GDEA 4G7OC 3E3XA 5CV4A 4HN7A 1GUGA 1EZ8A 3W1GA 2QILA 1N33Q 1VQEA 1EFID 4DV7Q 3I3CA 1I94Q 3V96A 3T1YL 1J5EQ 3FVQA 1AE2A 3URYA 1I50H 5NUCA 3J80L 1ET9A 1Y1WG 4DU9A 1C0AA 2R92G 2CWPA 2AWNA 1V9PA 1VQKA 4HJ9A 1Q82C 4HJ8A 2B2UC 1HTLD 4HAEA 5C44H 1CKNA 4FF4A 4JI6L 4A3IB 4KHZA 2I07B 2NBFA 4M1UB 4JYAL 1BR9A 3S1NB 3JC66 3G6EA 3HOUG 2NVQB 4XQQA 3TS0A 1UE6A 3E0JA 1HNZL 5IE8A 1GUWA 3HEJA 1HUMA 2JN4A 3SVMA 2R61A 3EJIA 4BBRB 5IYDG 2EZVA 4B08A 1GOZA 2NZOA 4GNXA 4NPSA 1JOOA 3K6OA 1B70B 3CF5A 2LS01 4N9PA 3FKIB 1O7YA 3CCLA 2CCZA 2F0TA 1K83B 1NE3A 3KF6A 5JJKA 4DR3L 5J22A 1Z9FA 3DMUA 2NTTA 4ZQ3A 3K0YA 4A3EG 4A3IH 1TS4A 2A69D 2IT1A 3S1NH 2R7ZG 2F0UA 1WI5A 5M3FB 2NVQH 5KEEA 1EQRA 2WFWA 3PUXA 1F77A 2B8GA 4IURA 1CSPA 1DJRD 3G7LA 3DM3A 2JSOA 1EFWA 2E74C 4HMJA 1KDBA 2EJGC 5C4JB 3TRZA 2OF1A 4OX9L 4PZ8A 3TBIB 3HOVB 4BBRH 4KD4A 1FNWA 2PZWA 1JWSD 3VYSA 1QCBD 2E2DC 3KDFB 1SE4A 1VQHA 1TR5A 1L0XB 1H9SA 3FKIH 1U4RA 1PFNA 1K83H 1X56A 4KN7C 1F2ZA 1SYEA 1XNQL 2N8NA 2HUGA 1HTPA 5C3EG 1V1PB 2K52A 3KF8A 1A6XA 2VQEQ 5M3FH 4BBSB 1EU4A 3HG9A 4GS3A 1VQ9A 4P75A 4DV6L 2Y0SG 1JCKB 3UDXA 4S3SA 2EVBA 5KGUA 1I6HB 1GXDC 4XT3B 5C4JH 3KBXA 3M4YA 5ELNA 1JE5A 2JE6I 3NQTA 3Q24A 1GD7A 1H9MA 5BR8Q 2F0NA 4CBVA 1JQYD 3HOWG 2DJGC 4IOAA 1QILA 1YNJC 5ELEA 4C3IB 3BZCA 4OHJA 3VR5A 3KK7A 4FF2A 1LO5D 2WB1G 5H1SE 3RLOA 3TQYA 3P20A 1T5EA 3T4AC 3J7ZC 1HZCA 4ZCKA 1S3OA 2OEOA 3KLSA 1VQPA 1DZ1A 2PI2E 1PRTC 4UPAA 1NTGA 4J8QA 1IYJB 1MJCA 1YNNC 1C7YA 1HNWQ 3W5OA 2FMCA 2CH4A 2N88A 1B50A 4UAIA 3H15A 1WTQA 2ZT9C 4BBSH 4N8FA 3D4WA 1XXGA 4P74A 1HZBA 3KJOA 3U58A 2ZTCA 2NB0A 2RDHA 1HQMC 1TS2A 1WFQA 3EIVA 4IPHA 1YJ9A 1I6HH 3A74A 4C1NK 1QNUA 2V4DA 2YTYA 1TWHH 1IBKL 1NCVA 3M4PA 2UXCL 1F2MA 3T13A 1H9KA 3GTMB 2EY2A 1LT6D 4C3IH 1XPUA 3VA7A 5FK9C 3SGIA 3H3VC 1PYWD 4OXPA 5AFWA 4DAPA 2VUMB 4DF7A 3BYTB 4DK1A 3HFZB 1E3PA 5C0XH 3X3NA 5DM63 4DR4L 1D6EC 2M9VA 4DA2A 4IO9A 3A5ZB 2UUCQ 1WCMB 1K73C 2F0EA 1OXUA 3MEHA 3EN2A 5FLXc 2UUAL 5AJ3L 2WAQB 5A2QE 3SR1A 4DAYB 1RHPA 1JOQA 4B9WA 4JOIC 2SEBD 1MIUA 1KHIA 4FXDA 1YHQA 1XMQL 1EIHA 2D0OA 5CBAE 2F0PA 3GTMH 3KJPA 4MNOA 1J6QA 2MFIA 3MZ5A 3PIOA 1G51A 2K01A 3L9AX 4DR2L 1YITA 1UNSA 2VUMH 2O4XA 2F0QA 3STBD 1STEA 1X32A 2DY7A 3R8BA 2HDLA 1EWIA 5F2DA 4LFCQ 3NPPA 5CGKA 3BJUA 4K5XA 2K5NA 3UDFA 1K9MC 3I90A 2EYOA 3A8JE 3T1HL 4L5SA 3A8IE 1N36L 3S9WA 2PMZB 1OXSC 3FPUB 3EVQA 4DR7Q 4A3CH 3I8ZA
chains in the Genus database with same CATH topology
4JW0A 5L37A 2Z9HA 4JVZA 4I7AA 2QW7A 2HD3A 4N8X1 2RCFA 4N8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW0 A;  5L37 A;  2Z9H A;  4JVZ A;  4I7A A;  2QW7 A;  2HD3 A;  4N8X 1;  2RCF A;  4N8F A; 
#chains in the Genus database with same CATH topology
 1IBL Q;  5EBC A;  4JI2 L;  1ZKO A;  1KNA A;  2Z6K C;  3HOZ G;  1XMO L;  4A3B G;  2MPM A;  3LNN A;  3DWP A;  2NZ1 D;  3AFP A;  1KRS A;  4RCN A;  3PO3 B;  2F4V L;  3I4N G;  2WAC A;  5DLQ E;  4TKO B;  1QZH A;  4R4I A;  2M00 A;  3G6J B;  3CCV A;  5T1I A;  2VY3 A;  2VB2 X;  2DGY A;  3OSO A;  2QDL A;  1ZYR D;  5EPL A;  3IAY A;  1PYB A;  2Z8L A;  2F0D A;  1KTK A;  4YWK A;  3NE5 B;  2NN6 G;  4TQU S;  4XTC S;  4LF9 L;  1AH9 A;  4GLA C;  4YCV A;  4QB4 A;  2PQE A;  1HHV A;  4RHR A;  5COR A;  3C3L A;  1CQF A;  2F0G A;  4QUF A;  1Q46 A;  2F0S A;  1BVS A;  1KDC A;  5E4W C;  4EQP A;  3Q6S A;  2F0M A;  3MXU A;  1GHK A;  1STA A;  3I4M B;  1PVO A;  1K8O A;  3BYY B;  4DV0 L;  3PO3 H;  3NHH A;  3J80 i;  1Y69 U;  3SK6 A;  3S15 B;  2BH8 A;  3HZX A;  3A55 A;  3T51 B;  2HCI A;  1I4P A;  5FJ8 H;  2RQX A;  4KK7 A;  4ZRZ A;  4LF7 Q;  5HY6 A;  1RKN A;  2B2T A;  1BNZ A;  3E9I A;  4XQN A;  1VQC A;  5HUR A;  5IP9 H;  4OEM B;  4JI7 L;  3HRZ C;  4YIJ A;  4JC0 A;  4R8I A;  3AEV A;  5EPJ A;  4B3S Q;  5COY A;  1SLJ A;  5M9O A;  1DYQ A;  4IQZ A;  2FJ2 A;  1EIY B;  2XRQ D;  4RG1 A;  1MI2 A;  3U4Z A;  1A2T A;  4ILW A;  2Q8I B;  4YHH L;  2HCC A;  2JXM B;  2YV5 A;  1G29 1;  3HKZ B;  2YTX A;  1F9Q A;  1CQV A;  2XTI A;  1FNU A;  3MXP A;  2NVX H;  1Z47 A;  5KNB A;  2XVS A;  4IJL A;  1NSN S;  3S15 H;  1MJE A;  3OHX C;  4X65 Q;  4P2C B;  3M4O B;  1N32 Q;  2HQE A;  2QCP X;  4C1N I;  3H94 A;  3NWS A;  2AMC B;  1LTG D;  1C4Q A;  1TY2 A;  4LF7 L;  1JE4 A;  5LMU Q;  4PZ6 A;  3E0E A;  3I4O A;  1DCZ A;  2B2Y C;  3MAQ A;  2MHV A;  3GO5 A;  1FL0 A;  1X3E A;  1QZG A;  3JAM i;  3R93 A;  3J7Y W;  2NYZ D;  4DPG A;  3R3O A;  2JEA I;  3SXH A;  2E5L L;  1IBM L;  2CQA A;  1XTD A;  3M85 A;  1BCP B;  1FD7 D;  2NWG A;  2JA7 B;  4C2M B;  5GAG C;  2PO4 A;  4JK1 C;  1STG A;  3W3A A;  4X3T A;  4L5R C;  1SJE D;  5D3I B;  1KAA A;  4PV1 C;  4L6T B;  1KIX A;  2JA5 B;  3CCQ A;  1I4R A;  1EQQ A;  2A73 B;  2R6G A;  3ERQ A;  3RN5 A;  3M4O H;  4JI8 L;  1V43 A;  4F88 A;  2C35 B;  2EY1 A;  1XTC D;  4NW2 A;  3OYY A;  4A3K B;  5I6Y A;  3CP0 A;  5IGC A;  2I5H A;  2A6H D;  5DEH A;  2HQL A;  5CR3 A;  4BS9 A;  4HIK A;  5D3D A;  1Q7Y C;  1VQG A;  4QQB X;  1RD9 D;  2RHQ B;  2XRS D;  3C1E A;  3MC0 B;  4XIG S;  2JA7 H;  4Y52 H;  2LKV A;  4C2M H;  4X66 Q;  3AQQ A;  1YIJ A;  5JJI A;  1PTO D;  2A68 D;  1CKO A;  2JA5 H;  2RDG A;  4LUZ A;  5FO9 B;  3I91 A;  4X3K A;  1G8Z D;  2IL8 A;  5JPN C;  1K0R A;  1CI3 M;  2GN5 A;  1UEA B;  3NBI A;  4L8J A;  4GOP B;  2RHS B;  2JA6 B;  1XPR A;  1S5E D;  2KCT A;  4HID A;  1OXT A;  3GD7 A;  4DAV A;  3GTL B;  5JEA H;  4A3K H;  4JI5 Q;  5KIX A;  1PH6 A;  1J9O A;  4HJ5 A;  5CMD A;  1RL2 A;  4HJA A;  1WTW A;  1E2Z A;  5M5W B;  3C2P A;  1TWA B;  2DY8 A;  1PDQ A;  1SN8 A;  2RF4 A;  4YCU A;  5IGF A;  3T16 A;  3DEO A;  4NXM Q;  5JJZ A;  2F0J A;  3D4D A;  3AU7 A;  4A93 B;  2UUB Q;  1AE3 A;  1CUK A;  1PXU A;  1HJP A;  1HQR D;  2EXZ A;  4DV3 Q;  2EYF A;  3BDL A;  1MKH A;  1EU3 A;  2N55 A;  4OIJ A;  3ERS X;  1AEX A;  2F0F A;  4ULL A;  1NR2 A;  5E4X A;  4B3R L;  2JA6 H;  3NEN A;  3T53 B;  2C9O A;  3MXN B;  3GTL H;  4BY7 B;  3IRB A;  1D1I A;  1CKM A;  2GVA A;  2F3V A;  2LY7 A;  5M5W H;  1CK1 A;  1JOR A;  1TWA H;  3W1B A;  1B3Q A;  2WAQ E;  4K2L A;  2OTL A;  1B8A A;  4A93 H;  3GTG B;  3TN2 A;  4K6L A;  4OEL B;  1LTA D;  3AFQ A;  2K7V A;  5JAV A;  1YHA A;  4BBR G;  4GN4 B;  1K28 A;  3TS2 A;  1DON A;  1HFN A;  4FF3 A;  3QOL A;  2A6E C;  4HCE A;  1A2U A;  1I6V C;  2EJF C;  4JI1 L;  3K59 A;  5KNC A;  1SEB D;  2B3G A;  1SJH D;  5C4X B;  4DGZ A;  1LUZ A;  2EPB A;  2TSS A;  3OTO Q;  5EKI A;  3S14 H;  2XNA C;  3TP7 A;  5IWA L;  3CW2 C;  1SSO A;  3MWY W;  1EEI D;  3HOY G;  2Z1C A;  2EQS A;  4BY7 H;  4WJW A;  4I65 A;  5IT9 c;  4DV1 L;  1VQM A;  2QKI C;  2GVB A;  3H0G B;  1HA6 A;  3DLL A;  1PYS B;  4DNR B;  2H5X A;  4C3J G;  2PMZ E;  1SYC A;  1X9N A;  1ASZ A;  2MGS A;  2HT1 A;  1DM0 B;  3C1F A;  4P72 A;  5EQ0 A;  4CDE C;  3GTG H;  5GQO A;  1Y1V B;  3KLW A;  2DJF C;  3MFY A;  4IUV A;  1JB3 A;  4RGT A;  3T1Y Q;  3HOV G;  1G6P A;  1QUQ B;  2KA7 A;  5L37 A;  1HR0 W;  1IW7 C;  4RFB A;  4EX5 A;  4R9W A;  2AUK A;  2BA1 A;  3BDO A;  5LL6 X;  5A35 A;  1PMR A;  5C4X H;  2ID0 A;  2H4O A;  2HHH L;  1NJI C;  1I4H A;  2FIN B;  3CAM A;  1DOM A;  3X3M A;  4DR6 L;  3A7A B;  1LT5 D;  2SNM A;  2DN8 A;  2F0V A;  4PMW A;  4LF4 L;  1BCP D;  4JI6 Q;  2MQH A;  3CCJ A;  4JYA Q;  4ABN A;  3VDY A;  3H0G H;  4A3G B;  5JVH 3;  4BBS G;  5IGB A;  3CKI B;  1HNZ Q;  2X6G A;  1HA5 A;  1VQJ A;  3UE0 A;  2B2U A;  1LV9 A;  5CV5 A;  3WOF A;  1K3B C;  2RVL A;  1CFM A;  2F0I A;  4N9T A;  2MUY A;  3CPW A;  4CJ0 B;  1Y1V H;  1AN8 A;  1B4O A;  2R7F A;  4J15 A;  3ULJ A;  1CKN B;  4K8I A;  5EKK A;  3LX0 A;  4CDC C;  2A19 A;  2ENB A;  3K80 C;  5LMN W;  2XSC A;  4IUU A;  2JEB I;  4FO2 A;  1WTP A;  2EYP A;  2IPK D;  4IUP A;  2WV6 D;  2F0W A;  4XXE A;  4OWT B;  2Q2T A;  2LSS A;  4DR3 Q;  1O78 A;  4ZYS A;  3QWN A;  4RGM A;  2JJQ A;  3RLN A;  1HNX L;  1A3V A;  5A2Q L;  2BH2 A;  5LL6 S;  4A3G H;  2I5M X;  1WTR A;  3IKJ A;  3ULP A;  4QF4 A;  1PH4 A;  5GAH C;  3KF6 B;  4BXX H;  4POF A;  1PH3 A;  4OX9 Q;  3HS0 C;  1QVF A;  4A3D B;  4B3M L;  4AYB G;  3HOX B;  1CTM A;  2QEJ C;  3FDT A;  5JJL A;  1TS3 A;  3RD4 A;  1PFS A;  1XNQ Q;  5FLM H;  3TDQ A;  4GLV B;  5FKA C;  1L0W A;  2IY5 B;  1CZG A;  3BVM A;  1HFG A;  1WCM G;  2H1E A;  1LYL A;  3RZD B;  1EIG A;  2EOT A;  3EQL C;  3K5N A;  4DV6 Q;  1RIP A;  4P71 A;  2KCC A;  3VYR A;  3JAM L;  2OCE A;  1H9S B;  2WAQ G;  4R4C A;  4OIK A;  5JPM C;  3O13 A;  2VW9 A;  1U9R A;  4A3F G;  5K36 G;  2KHI A;  3U9O A;  2OWO A;  1VQ6 A;  4C56 C;  4A3D H;  1PTO F;  2JK8 A;  3D8G A;  3KF8 B;  2PNH A;  1LM0 A;  1GUT A;  3PUY A;  3HOX H;  3RR5 A;  2EYJ A;  3M7N A;  5E3F A;  4LFB L;  5M3M G;  4IJH A;  4BY1 B;  4K0K Q;  3PO2 B;  1SMY D;  2RCN A;  3SHL A;  4EGV A;  3CRK C;  4A3M B;  2EIF A;  1OXX K;  4F8M A;  2MJ8 A;  1RJT A;  1NR4 A;  1XWE A;  3RZD H;  1GKH A;  3A0J A;  1R9T B;  5C0X J;  2JA8 G;  2Q2H A;  1RTO A;  4LWC A;  2PW5 A;  2HIX A;  4JV5 L;  2Z9H A;  5G3L F;  1LAB A;  1IBK Q;  2IHF A;  1SYF A;  1TWH B;  4IN3 A;  4DUZ L;  1N34 Q;  2KOL A;  4O42 A;  2UXC Q;  1SDF A;  3ZJY C;  3CC4 A;  5C3X A;  3L0O A;  3R2I A;  3GP7 A;  4FNF A;  4BY1 H;  4ZKC B;  1SND A;  4HR7 B;  5HGQ A;  1H95 A;  3PO2 H;  5EKL A;  4K0K L;  2QF7 A;  4A3M H;  5IYB H;  3KOJ A;  4X62 L;  2M2L A;  4DR4 Q;  1WOC A;  3D0F A;  3HGB A;  2KUM A;  1ZYR C;  2DNC A;  2FHT A;  4GKJ L;  2VNU D;  1ICF B;  4R4Q A;  1PA6 A;  2UUA Q;  1ZEQ X;  4PMB A;  3H3V I;  4OO1 H;  1CHQ D;  1V1P A;  1R9T H;  5J3B A;  4DK6 C;  4LF6 L;  5AJ3 Q;  4QL5 A;  3CHB D;  3NBH B;  1Y1W B;  1MHW C;  4UP7 A;  2B8F A;  1X65 A;  4ZUI A;  4PQX A;  5EPK A;  2F4I A;  3J81 E;  1WJJ A;  3D6C A;  3N52 A;  4CJ1 B;  4WFN 3;  4LF5 L;  1O7L A;  3I4M G;  1XMQ Q;  2KHJ A;  1N34 L;  1OXV A;  1MSH A;  4GZY C;  1B44 D;  1GUS A;  2KCN A;  4TRD A;  1IXR A;  1EWC A;  1DGS A;  4DR2 Q;  1M4V A;  4DR5 L;  3HOU B;  3NTK A;  1DOL A;  5CYU A;  2OQ0 A;  4JOI A;  1TVX A;  5FLX E;  1KC8 C;  4KY7 A;  5LHY 1;  1SXT A;  3NP8 A;  4G7H C;  1TXY A;  1KDA A;  2I5L X;  5C0X I;  4IAL A;  3TRE A;  3K57 A;  3DEP A;  5J1Z A;  1VCI A;  1Q8I A;  1B9M A;  3S24 A;  1VF5 C;  3A54 A;  5IP7 H;  3T1H Q;  1D1K A;  1N36 Q;  1SNC A;  1W2B A;  4ID6 A;  2UU9 L;  5CC4 A;  1DXM A;  1Y1W H;  4YWM A;  4JI2 Q;  2L55 A;  5ISR A;  4NMZ A;  1XMO Q;  2IX1 A;  3K5L A;  4JVZ A;  2F4V Q;  2Q8R E;  2F03 A;  1F9R A;  1R4P B;  3I55 A;  3KFU A;  4A3E B;  3S1Q B;  1S5D D;  5I9O A;  3F2D A;  1JOK A;  4A3J G;  4X3S A;  2PW7 A;  3J80 c;  1E7Z A;  4P73 A;  3PCO B;  3HOU H;  1FR3 A;  2Z6K A;  3TP5 A;  4FYD A;  4KHP Q;  1PTO B;  3G4S A;  3LGJ A;  3BG3 A;  4JCV E;  3TEH B;  1BCP F;  2V1C C;  1SNP A;  2A5H A;  4LF9 Q;  1HR0 L;  3P1H A;  2B63 G;  1CM9 A;  1LTT D;  5IYD H;  2R93 B;  2Q2U A;  3UE1 A;  3K5O A;  2AKW B;  4FXK C;  4CKC A;  3K58 A;  2E2J B;  2D62 A;  2Z4H A;  3KUP A;  2ZM6 L;  1B53 A;  4DAY A;  2K6A A;  4DV0 Q;  4RGN A;  4RAU C;  2F1M A;  2G9H D;  4DV2 Q;  4A3E H;  3S1Q H;  1ICW A;  5ELF A;  5GAE C;  4A3L G;  2JA9 A;  3PIP A;  1U5K A;  2RSN A;  1Q3L A;  3I4L A;  3KYH C;  2Y0S B;  2YTV A;  1PTO H;  4KHP L;  3QOJ A;  5JEA G;  3MA2 B;  4DUY L;  4A3K G;  1U4L A;  1LTL A;  4RKL A;  4JI7 Q;  3G48 A;  5LMN L;  4Q0F A;  1JWM D;  1GVP A;  2BCO A;  2R93 H;  3J81 i;  1EOV A;  3CU7 A;  3GV6 A;  2D2C C;  3HOW B;  4K8J A;  1Z6H A;  4KD3 A;  3JAM c;  4YHH Q;  3OPO A;  4RKB A;  1RDP D;  2KHS A;  3Q23 A;  1UUP A;  4LMQ D;  2E2J H;  2WB1 B;  1A63 A;  3GQB A;  1WTV A;  1IZ6 A;  1YNN D;  1GO3 E;  2NVX B;  2A1A A;  2A68 C;  5C3E H;  2ZTE A;  5KND A;  4KV6 A;  3ND8 A;  4DV2 L;  3OWE B;  4MTN A;  1BDO A;  2VQF L;  3CCM A;  1Q90 A;  1PH8 A;  1N8R C;  1ESF A;  1SBB B;  3U4V A;  5C3W A;  3CQZ B;  2O5I C;  1I4Q A;  4EVO A;  1VQI A;  1S5F D;  2ASB A;  2ZJP A;  2UXB L;  4JBJ A;  2ZJR A;  1KAB A;  4C3H B;  2E5L Q;  3SEB A;  1IBM Q;  2G5D A;  3HOW H;  4X64 L;  5IYC G;  1Y8N B;  2VB3 X;  2K5V A;  3ZYY X;  5ELC A;  1IKM A;  2BOS A;  3VA5 A;  2B2Y A;  3ERO A;  3CC7 A;  1BUV T;  3PIO 3;  1MD2 D;  3VR4 A;  2A74 C;  2NVT B;  4DV5 L;  3PF5 A;  4JI8 Q;  4RHS A;  3NEL A;  1BO0 A;  1P16 A;  2K04 A;  4HTH A;  1I4X A;  1E2W A;  4F87 A;  1XYI A;  1LTI D;  2EJM A;  3AB9 A;  1KQS A;  2NUC A;  1O7I A;  1VMP A;  1A15 A;  2CWA A;  3H6M A;  2I46 A;  4HED A;  1D5Z C;  1YI2 A;  1AZP A;  4HIO A;  4XQJ A;  2B2V C;  1HZ9 A;  3A5U A;  4HSV A;  4DN4 M;  3CQZ H;  1K3R A;  3GTK B;  1UE1 A;  2PNR C;  2NTS A;  5JEA J;  4C3H H;  4K6D A;  1P8L A;  2B39 A;  2GA4 B;  4YCW A;  4IFD G;  4N8X 1;  1LTS D;  1TU2 B;  1EY5 A;  2CW0 C;  2NVT H;  1QVC A;  3TP8 A;  1EEF D;  2RDF A;  3J7A V;  2CVR A;  3BZK A;  2O2L D;  3K81 C;  3DUZ A;  4B3T L;  3Q0A A;  2PQA A;  3FHW A;  2N78 A;  1K0S A;  1EY6 A;  1L1O B;  4GN3 B;  5CV8 A;  4DKA C;  3GTK H;  3HOZ B;  3N6R A;  3PQI A;  2QW7 A;  4A3B B;  1IYU A;  3CXC A;  2MP1 A;  4R8N A;  1DOK A;  4IPG A;  3MVV A;  2R7D A;  3VR2 A;  3LWE A;  2B29 A;  1YNX A;  2ES2 A;  2Q2I A;  2D0P A;  1B1Z A;  4I7A A;  5BN4 A;  1G91 A;  2BA0 A;  1Y1V G;  4ME3 A;  4XT1 B;  4K5V A;  2PZT A;  2RSO A;  4KN4 C;  2F3W A;  3E6Z X;  4KLK A;  3J7A 5;  4B3R Q;  5HGT A;  1STB A;  1ZXT A;  4LNQ A;  4H0L C;  2K5D A;  1JC7 A;  3K5M A;  1AFP A;  1UAP A;  1PLF A;  2XIW A;  5C44 G;  2BE5 C;  2XGT A;  3NQI A;  5DNF A;  3HOZ H;  1BCP C;  4A3B H;  1Q12 A;  4AH6 A;  1FGU A;  3PUZ A;  1GUN A;  3A56 A;  4UP9 A;  4MN3 A;  1L0Y B;  1D8L A;  4MTK A;  4BXX G;  5E7N A;  5C4Z A;  1XNR L;  1EIF A;  5I2Y A;  1HPC A;  1DD2 A;  3K8A A;  5C6A A;  5EAY A;  2K05 A;  1YJN A;  1EY4 A;  2L0C A;  5EBD A;  3OMG A;  3CMA A;  1PZJ D;  4JI1 Q;  3KLS X;  2NN6 H;  4IFD J;  1GJX A;  4EQN A;  2F0H A;  4X3U A;  1EY9 A;  2LFN A;  2O5J C;  3HP3 A;  5FLM G;  4IPD A;  1ONL A;  5IWA Q;  3S14 B;  2MNA A;  3WOE A;  5IGE A;  4DV1 Q;  1E0B A;  1EUJ A;  1NUC A;  4A3I G;  4DXG A;  3I2Z A;  3S17 B;  2PI2 A;  3QJY A;  1B2T A;  4LF8 L;  1VQ5 A;  5ELB A;  1M8A A;  4WJ3 M;  2L11 A;  3RMH A;  3GTO H;  3CRL C;  1JWU D;  4GOP C;  3BU2 A;  3U50 C;  1I3Q B;  1KD1 C;  1Q1E A;  5I9P A;  4KI0 A;  2VXW A;  5IT9 E;  4DK0 A;  2HHH Q;  3FKI G;  2IHE A;  4DR6 Q;  1N9W A;  3UDG A;  4LF4 Q;  1YVC A;  1B9N A;  3MFG A;  4XYO A;  4GKK L;  1FGB D;  3FMC A;  3D4R A;  1EY0 A;  3PV0 A;  1PV4 A;  3S17 H;  2IW3 A;  4QUC A;  5M3F G;  4QGU A;  1RTN A;  1B3A A;  2A69 C;  2EXD A;  3OIP A;  3PUW A;  4KJO A;  2AQ2 B;  5I6W A;  1KL9 A;  1Q8K A;  5IOC A;  1C8C A;  1OTC A;  4K5W A;  2E2I B;  4YY3 L;  3BVG A;  4NXN L;  1WTO A;  4IUN A;  4LFA L;  4CJ2 C;  4IFD I;  5CV6 A;  3WDN A;  1I3Q H;  2QGQ A;  2HDM A;  1JR0 D;  1QWY A;  4BY1 G;  4JI4 L;  2N3S A;  2HD3 A;  1FVI A;  2IJ0 A;  1YBY A;  1OO9 B;  4CDD C;  1VQ4 A;  4FP5 D;  1HNX Q;  2ATW A;  4JI3 L;  3I73 A;  4Y7N B;  3GTP B;  3VYT A;  3OOC A;  4J6H A;  3J81 L;  4CKE A;  5DAU A;  3FPP A;  4F7X A;  4DV4 L;  2EY6 A;  2SNS A;  5FO7 B;  5E1F A;  4UHV A;  4MZ9 A;  2WB1 E;  1SYD A;  2E2I H;  1O80 A;  3QB3 A;  4XDX A;  3K7U C;  3M3Y B;  1T5X D;  3H09 A;  1QB5 D;  4B3M Q;  1U4P A;  5JVG 3;  2QA4 A;  1EYD A;  1QUQ A;  5CV9 A;  1CSQ A;  1LAC A;  4KMU C;  4C3I G;  1NY4 A;  4Q5V A;  4E6I A;  2MO1 A;  1A0I A;  3CCS A;  2EY5 A;  1U4M A;  1Q86 C;  4PMC A;  1PH7 A;  3Q22 A;  5C0X G;  4Y7N H;  1YHB A;  3AMU A;  3GTP H;  4ZKB B;  3CME A;  4GNX B;  2KEN A;  1EY8 A;  4KKT A;  5IP7 G;  4HIM A;  3GTQ B;  4DR1 L;  2F0L A;  3MHB A;  1W3S A;  1PFM A;  2J4X A;  3CD6 A;  1SAP A;  5K5P A;  4LUV A;  4R4T A;  2MO0 A;  3HKZ E;  1TWF B;  1ASY A;  1E24 A;  1D7Q A;  4OL7 A;  1LLR D;  3M3Y H;  1JJ2 A;  1ML0 D;  1Y14 B;  4RH6 A;  3SK5 A;  2FFK B;  3BZD B;  1NAP A;  3ER0 A;  4LFB Q;  1QE6 A;  4RA8 A;  1PH5 A;  1Z7T A;  3VYU A;  3MEF A;  2LXJ A;  2VUM G;  1LTB D;  5EJW A;  3T56 B;  2VL6 A;  1HUN A;  3J81 j;  4UY8 C;  2UXD Q;  1R4Q B;  4H44 C;  2WIN B;  1N33 L;  2AWO A;  2A6E D;  4JBM A;  3W2D A;  4DV7 L;  4QMG A;  2AHO B;  3GTQ H;  1I94 L;  1SE2 A;  3DHQ A;  1J5E L;  3KBG A;  1FJG Q;  1IL2 A;  1PFB A;  4JV5 Q;  1SNQ A;  2PYK A;  4A3C G;  1QNK A;  1EY7 A;  1TWF H;  2R3Z A;  4DUZ Q;  4POG A;  2OQK A;  3QR8 A;  3HOY B;  4R4O A;  5BN3 A;  3FP9 A;  4LK1 C;  4KKS A;  4FVM A;  4KKU A;  2B2W A;  4X62 Q;  4GNX C;  1PRT B;  4C3J B;  5DM7 3;  4UDU C;  2J7Z A;  4GKJ Q;  3PMF A;  5JOB A;  2UXD L;  3STB C;  3CC2 A;  3SK8 A;  1W6J A;  1GUO A;  1IW7 D;  2R93 G;  1RCV D;  1VQ7 A;  4LF6 Q;  4HSP A;  1NMF A;  3S2H B;  1LT4 D;  3TP6 A;  1UE7 A;  5CBE E;  2K14 A;  2XWJ B;  1ET6 A;  4A75 A;  1FJG L;  3DWA A;  1JB7 A;  3NUC A;  1IYV A;  2E2H B;  4V0B A;  4LF5 Q;  2B2W C;  4M8A A;  2K5H A;  4I7Z C;  3NEM A;  3M9B A;  3NTI A;  3PO3 G;  3HOY H;  1SR3 A;  4QY7 A;  5ELD A;  4ME5 A;  3VR6 A;  4DR5 Q;  1BBW A;  3KDF A;  1TWC B;  5FJ8 G;  1WVL A;  3R2T A;  4IOC A;  4C3J H;  2JYO A;  1STH A;  1II3 A;  2EYH A;  1EQV A;  3S1R B;  1PHJ A;  4ZK9 B;  5IP9 G;  3DXJ C;  3I70 A;  3HOV H;  4ALP A;  3IFD A;  3TZU A;  1VQA A;  4OO1 I;  3S2H H;  3F2U A;  2UU9 Q;  4L5T A;  5I4D A;  3M4Q A;  2ICE C;  3CPF A;  2EDG A;  1GHJ A;  2R92 B;  2K1B A;  3RN2 A;  2E2H H;  3BS1 A;  4MHE A;  4L5Q A;  1HXY D;  1UE5 A;  3EA6 A;  1B7Y B;  3F2B A;  4DK3 C;  3H3V H;  1KLU D;  3RZO B;  3F2C A;  1NBW A;  2FMM A;  3S16 B;  2VQE L;  1TWC H;  2NVY B;  3SDZ A;  3D31 A;  4BA2 I;  4RMF A;  1PZI D;  1CA6 A;  1HR0 Q;  1K8M A;  3S1R H;  3PSI A;  4BA1 I;  1ENA A;  2D5D A;  2L4N A;  2SOB A;  4AYB B;  5BR8 L;  2P5Z X;  3TME A;  4C3H G;  1A3T A;  1D5M C;  3TSS A;  4MIU A;  3J81 c;  3OW2 A;  3A8K E;  2ZM6 Q;  3NBH A;  3HKZ G;  3J80 E;  2R92 H;  2L1B A;  1TY0 A;  3A7L A;  2J0T D;  4JPB W;  1GM5 A;  2KQ3 A;  2OXP A;  3RZO H;  4Z9C B;  5C5M A;  3MXG A;  3S16 H;  4GN5 A;  2R7Z B;  3F1Z A;  3J7A F;  1NNX A;  1HCZ A;  1HNW L;  2NVY H;  2KEC A;  3L7Z C;  1SE8 A;  1V8Q A;  1EYC A;  1SNO A;  4DXF A;  4DUY Q;  1L2F A;  1X3P A;  1X54 A;  2K5Q A;  1HRJ A;  5LMN Q;  4A3F B;  1WD1 A;  2K5W A;  2EYM A;  4WOR A;  4JBW A;  1X55 A;  1MBY A;  1VF7 A;  4ZAI A;  1SRO A;  5ELO A;  1KNE A;  2N49 A;  1M1K C;  2CQO A;  3SE0 A;  4R1J A;  4IPC A;  2JA7 G;  5M3M B;  1WTX A;  1Y8O B;  1YEZ A;  2F0K A;  4H7B A;  1KXL A;  4OWX B;  1WD0 A;  5C5L A;  3KLR A;  1BXT A;  2JA5 G;  4RCO A;  4IUT A;  2VS1 A;  2K4K A;  1PH1 A;  4NB3 A;  4JI0 Q;  5C3E B;  1CA5 A;  1VQN A;  2LXK A;  2K33 A;  4U68 A;  1WCM H;  4OON A;  1I5F A;  4XYQ A;  4QIW B;  3UDI A;  2VQF Q;  2UUC L;  4BWG B;  2R7Z H;  4ODG A;  2YYZ A;  2KBN A;  3UI2 A;  2JA8 B;  3IFT A;  1BKB A;  3RNU A;  5T1G A;  2WKD A;  3JAM E;  2UXB Q;  1E2V A;  1ENC A;  4A3F H;  5K36 H;  5IGD A;  1IHZ A;  1LTR D;  3BDC A;  2WP8 J;  1YNJ D;  2X69 A;  2K03 A;  4G4K A;  2IX3 A;  1MSG A;  4JBK A;  4X64 Q;  5C4H A;  2A6H C;  4O2D A;  2D9U A;  4TSS A;  3OIQ A;  1HZA A;  2KED A;  2EE1 A;  5M3M H;  2VZA A;  4B9X A;  1ESR A;  5EGT A;  3K0X A;  4G7Z C;  1VQL A;  1PRT D;  5IIF A;  5IY0 A;  1TT2 A;  4V19 0;  1U0L A;  4DV5 Q;  1PTO C;  2IWH A;  1TQO A;  4DFA A;  1XPO A;  2JP1 A;  2X6L A;  4JI0 L;  4LFC L;  3M7G A;  1SNM A;  1X6O A;  5J39 A;  5CV7 A;  2E76 C;  2JA8 H;  3ICE A;  5GAD C;  1SYG A;  4AIM A;  2JA6 G;  3PUV A;  2XN9 C;  4CHT B;  2KVM A;  1BF4 A;  4DR7 L;  1IBL L;  1JJC B;  1G6Z A;  2ZXO A;  3EBE A;  4A76 A;  4ZLT F;  1XX8 A;  3V05 A;  4GLX A;  1WTH A;  4QJF A;  2DUD A;  4QCL A;  4WRD A;  1BBX C;  1M90 C;  2KEE A;  3IL8 A;  1A8V A;  2B2V A;  2BDO A;  1YJW A;  2AQ1 B;  4A93 G;  1JT8 A;  4U67 3;  4RWS C;  1EL0 A;  2YU9 B;  4JG2 A;  1UWV A;  1X3F A;  1EYA A;  1SE3 A;  2NZH A;  5IT9 L;  1QJO A;  4FDB A;  2L12 A;  4TVA B;  1K8G A;  2WII B;  3SK4 A;  1G2T A;  4CDF C;  3H91 A;  4KTA A;  2ALY B;  4B3T Q;  1X3G A;  1ILQ A;  1VQO A;  4LJZ C;  2PCF B;  1KAW A;  5KRU A;  4BY7 G;  5I2X A;  1VS0 A;  2B2T C;  3I4M H;  4LAA A;  1Y8P B;  2K75 A;  4FF1 A;  4FXG C;  1MGS A;  3TZD A;  4A3J B;  4WJ4 A;  2PPB C;  1A3U A;  2PQA B;  3RUZ A;  3PIP 3;  2OTJ A;  2YU9 H;  1BOS A;  3E5S A;  4YWL A;  1EQT A;  1QOH A;  1STY A;  3BVZ A;  4CKB A;  4AQY Q;  5KYL A;  2B63 B;  2F52 A;  3FRP B;  1CHP D;  1A62 A;  4ZUJ A;  2G9D A;  5C4X G;  1JMC A;  4B3S L;  2JQO A;  1EOT A;  1K8A C;  4KHV A;  1KRT A;  3L2P A;  1V1Q A;  3WWV A;  2RBM A;  1C48 A;  3HKS A;  3ONA B;  1IKL A;  5FO8 B;  3H0G G;  2F0O A;  1EYG A;  2CFM A;  3I4N B;  1F2L A;  2WKC A;  1TS5 A;  4A4I A;  4A3J H;  1XNR Q;  1STN A;  4X65 L;  1N32 L;  2L5T A;  2Q8T A;  3ULL A;  3F8T A;  2C5C A;  1S5C D;  3PGZ A;  1NMG A;  4NKL A;  1E22 A;  1PH2 A;  4O1N A;  5LMU L;  2B63 H;  3FEW X;  4AQY L;  2XWB B;  2QDB A;  2ZTD A;  2CKZ B;  2L15 A;  3VR3 A;  1XJV A;  1C9O A;  5BN5 A;  3Q8D A;  1F9P A;  2EYL A;  1PH9 A;  5M5Y B;  1L1O A;  4A3G G;  1I4G A;  5GRO A;  4LF8 Q;  1KLG D;  2E75 C;  3OW7 A;  2I0Q A;  3I4N H;  1ILP A;  4UP8 A;  1SFO B;  2DNE A;  4A3L H;  4X6A H;  3NWT A;  3S2D B;  1EWH A;  1E1T A;  1AW7 A;  3GTO B;  4J1M A;  1SMX A;  1H9R A;  5M5X B;  3ND9 A;  5IGG A;  1T9H A;  1VQB A;  3K7A B;  1J8I A;  5IOD A;  2L9H A;  3B6Y A;  1X3Q A;  2PZU A;  2NN6 I;  4O0A A;  1L1O C;  1E1O A;  2K28 A;  4DNI A;  2Z4I A;  1QG7 A;  3U9S A;  4OGQ C;  5D65 A;  2ZJQ A;  3GTJ B;  1H9J A;  1LT3 D;  2LMC B;  4GKK Q;  4GOP A;  3D3R A;  3OMC A;  5G3L D;  1FNV A;  4X66 L;  4K14 A;  3RLF A;  4DNT B;  2ICI A;  1VDZ A;  5M5Y H;  4AYB E;  1F2Y A;  3AYH B;  3D6W A;  2F3I A;  1D2B A;  2BDN A;  2KCM A;  3PF4 A;  1SFO H;  1CZW A;  3L3O C;  3V2T A;  3S2D H;  4YY3 Q;  1S5B D;  2FXQ A;  4LW1 A;  4NXN Q;  4A3D G;  5M5X H;  3MTS A;  2KJX A;  4LFA Q;  3DM1 A;  2TMP A;  4HJ7 A;  3HOX G;  2CHB D;  3K7A H;  1BBU A;  1S72 A;  4PG3 A;  2HIV A;  4JI5 L;  4DAM A;  4NP5 A;  4JI4 Q;  5IYC H;  3E9H A;  4OWW B;  3GTJ H;  4H02 A;  3ITP A;  3P7J A;  4NXM L;  3I7F A;  4JI3 Q;  3P75 A;  4EQO A;  2SDF A;  2Z6B A;  2ZXR A;  3S1M B;  3NXW A;  2CW0 D;  2UUB L;  2RKS A;  1D5X C;  4KY6 A;  3MXN A;  3QIA A;  1HH2 P;  1AP0 A;  4HMI A;  1EZ6 A;  1TWG B;  1TKW B;  3LWU A;  4KY5 A;  2K32 A;  4DV3 L;  4DV4 Q;  4EQ5 A;  5FOB B;  1BQQ T;  2E8G A;  3I72 A;  4HCS A;  3CCE A;  1JJG A;  4L63 B;  1SRU A;  1RF2 D;  1VQF A;  2ZXP A;  1Q1B A;  1PRT F;  2Z0S A;  1AZQ A;  4PZ7 A;  1VQ8 A;  4QIW E;  1WYD A;  5D14 A;  3NTH A;  5KYI A;  3PO2 G;  1IL8 A;  4IZ8 A;  3CCR A;  2Y0S E;  3EFX D;  4A3M G;  5IYB G;  2RA4 A;  2QEX A;  2AUJ D;  1O7Z A;  1FYC A;  3NK9 A;  1SMY C;  1QVG A;  1S40 A;  2CH4 W;  3GV3 A;  3C46 A;  4RGO S;  3S1M H;  2IX0 A;  1G2S A;  3OWF A;  1SYB A;  4IFD H;  4OO1 G;  4LUO A;  3QO2 A;  4G57 A;  4DR1 Q;  1VMC A;  4APV A;  1I50 B;  1TWG H;  2A8V A;  1UEB A;  2OT2 A;  1YZ6 A;  3G71 A;  3I56 A;  4KJN A;  4CGY B;  2K50 A;  1ROD A;  1VQD A;  1PZK D;  4PNY A;  3OTO L;  2RCF A;  4IUQ A;  4JW0 A;  2BE5 D;  3CCU A;  1W6K A;  1F9S A;  3QG1 A;  1Q81 C;  3NSW A;  4NDX A;  1ENF A;  5C44 B;  1JIC A;  4K2K A;  3DWQ A;  5TSS A;  1V1O A;  4H13 C;  1CT1 D;  2AQ3 B;  1TII D;  5FLX L;  1S4Z A;  3GDE A;  4G7O C;  3E3X A;  5CV4 A;  4HN7 A;  1GUG A;  1EZ8 A;  3W1G A;  2QIL A;  1N33 Q;  1VQE A;  1EFI D;  4DV7 Q;  3I3C A;  1I94 Q;  3V96 A;  3T1Y L;  1J5E Q;  3FVQ A;  1AE2 A;  3URY A;  1I50 H;  5NUC A;  3J80 L;  1ET9 A;  1Y1W G;  4DU9 A;  1C0A A;  2R92 G;  2CWP A;  2AWN A;  1V9P A;  1VQK A;  4HJ9 A;  1Q82 C;  4HJ8 A;  2B2U C;  1HTL D;  4HAE A;  5C44 H;  1CKN A;  4FF4 A;  4JI6 L;  4A3I B;  4KHZ A;  2I07 B;  2NBF A;  4M1U B;  4JYA L;  1BR9 A;  3S1N B;  3JC6 6;  3G6E A;  3HOU G;  2NVQ B;  4XQQ A;  3TS0 A;  1UE6 A;  3E0J A;  1HNZ L;  5IE8 A;  1GUW A;  3HEJ A;  1HUM A;  2JN4 A;  3SVM A;  2R61 A;  3EJI A;  4BBR B;  5IYD G;  2EZV A;  4B08 A;  1GOZ A;  2NZO A;  4GNX A;  4NPS A;  1JOO A;  3K6O A;  1B70 B;  3CF5 A;  2LS0 1;  4N9P A;  3FKI B;  1O7Y A;  3CCL A;  2CCZ A;  2F0T A;  1K83 B;  1NE3 A;  3KF6 A;  5JJK A;  4DR3 L;  5J22 A;  1Z9F A;  3DMU A;  2NTT A;  4ZQ3 A;  3K0Y A;  4A3E G;  4A3I H;  1TS4 A;  2A69 D;  2IT1 A;  3S1N H;  2R7Z G;  2F0U A;  1WI5 A;  5M3F B;  2NVQ H;  5KEE A;  1EQR A;  2WFW A;  3PUX A;  1F77 A;  2B8G A;  4IUR A;  1CSP A;  1DJR D;  3G7L A;  3DM3 A;  2JSO A;  1EFW A;  2E74 C;  4HMJ A;  1KDB A;  2EJG C;  5C4J B;  3TRZ A;  2OF1 A;  4OX9 L;  4PZ8 A;  3TBI B;  3HOV B;  4BBR H;  4KD4 A;  1FNW A;  2PZW A;  1JWS D;  3VYS A;  1QCB D;  2E2D C;  3KDF B;  1SE4 A;  1VQH A;  1TR5 A;  1L0X B;  1H9S A;  3FKI H;  1U4R A;  1PFN A;  1K83 H;  1X56 A;  4KN7 C;  1F2Z A;  1SYE A;  1XNQ L;  2N8N A;  2HUG A;  1HTP A;  5C3E G;  1V1P B;  2K52 A;  3KF8 A;  1A6X A;  2VQE Q;  5M3F H;  4BBS B;  1EU4 A;  3HG9 A;  4GS3 A;  1VQ9 A;  4P75 A;  4DV6 L;  2Y0S G;  1JCK B;  3UDX A;  4S3S A;  2EVB A;  5KGU A;  1I6H B;  1GXD C;  4XT3 B;  5C4J H;  3KBX A;  3M4Y A;  5ELN A;  1JE5 A;  2JE6 I;  3NQT A;  3Q24 A;  1GD7 A;  1H9M A;  5BR8 Q;  2F0N A;  4CBV A;  1JQY D;  3HOW G;  2DJG C;  4IOA A;  1QIL A;  1YNJ C;  5ELE A;  4C3I B;  3BZC A;  4OHJ A;  3VR5 A;  3KK7 A;  4FF2 A;  1LO5 D;  2WB1 G;  5H1S E;  3RLO A;  3TQY A;  3P20 A;  1T5E A;  3T4A C;  3J7Z C;  1HZC A;  4ZCK A;  1S3O A;  2OEO A;  3KLS A;  1VQP A;  1DZ1 A;  2PI2 E;  1PRT C;  4UPA A;  1NTG A;  4J8Q A;  1IYJ B;  1MJC A;  1YNN C;  1C7Y A;  1HNW Q;  3W5O A;  2FMC A;  2CH4 A;  2N88 A;  1B50 A;  4UAI A;  3H15 A;  1WTQ A;  2ZT9 C;  4BBS H;  4N8F A;  3D4W A;  1XXG A;  4P74 A;  1HZB A;  3KJO A;  3U58 A;  2ZTC A;  2NB0 A;  2RDH A;  1HQM C;  1TS2 A;  1WFQ A;  3EIV A;  4IPH A;  1YJ9 A;  1I6H H;  3A74 A;  4C1N K;  1QNU A;  2V4D A;  2YTY A;  1TWH H;  1IBK L;  1NCV A;  3M4P A;  2UXC L;  1F2M A;  3T13 A;  1H9K A;  3GTM B;  2EY2 A;  1LT6 D;  4C3I H;  1XPU A;  3VA7 A;  5FK9 C;  3SGI A;  3H3V C;  1PYW D;  4OXP A;  5AFW A;  4DAP A;  2VUM B;  4DF7 A;  3BYT B;  4DK1 A;  3HFZ B;  1E3P A;  5C0X H;  3X3N A;  5DM6 3;  4DR4 L;  1D6E C;  2M9V A;  4DA2 A;  4IO9 A;  3A5Z B;  2UUC Q;  1WCM B;  1K73 C;  2F0E A;  1OXU A;  3MEH A;  3EN2 A;  5FLX c;  2UUA L;  5AJ3 L;  2WAQ B;  5A2Q E;  3SR1 A;  4DAY B;  1RHP A;  1JOQ A;  4B9W A;  4JOI C;  2SEB D;  1MIU A;  1KHI A;  4FXD A;  1YHQ A;  1XMQ L;  1EIH A;  2D0O A;  5CBA E;  2F0P A;  3GTM H;  3KJP A;  4MNO A;  1J6Q A;  2MFI A;  3MZ5 A;  3PIO A;  1G51 A;  2K01 A;  3L9A X;  4DR2 L;  1YIT A;  1UNS A;  2VUM H;  2O4X A;  2F0Q A;  3STB D;  1STE A;  1X32 A;  2DY7 A;  3R8B A;  2HDL A;  1EWI A;  5F2D A;  4LFC Q;  3NPP A;  5CGK A;  3BJU A;  4K5X A;  2K5N A;  3UDF A;  1K9M C;  3I90 A;  2EYO A;  3A8J E;  3T1H L;  4L5S A;  3A8I E;  1N36 L;  3S9W A;  2PMZ B;  1OXS C;  3FPU B;  3EVQ A;  4DR7 Q;  4A3C H;  3I8Z A; 
#chains in the Genus database with same CATH homology
 4JW0 A;  5L37 A;  2Z9H A;  4JVZ A;  4I7A A;  2QW7 A;  2HD3 A;  4N8X 1;  2RCF A;  4N8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...