1L1OB

Structure of the human replication protein a (rpa) trimerization core
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
123
Chain Sequence
b'QHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDNTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 14 kDa subunit
publication title Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 29
structure length 123
sequence length 128
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1l1oB00
2BA0A 4DUYQ 4OWTB 3PSIA 5E7NA 2LXKA 4X64L 4BXXG 2HT1A 3CC4A 3CCRA 2UU9L 2MQHA 2OQKA 3KF6B 5C0XG 4JI3Q 4QQBX 4BY7H 2R93G 1MJEA 4KLKA 1VQEA 1ASYA 4NXMQ 4NXNQ 1NE3A 2QEXA 4JBMA 2I5HA 3GDEA 2R7ZG 3SGIA 3H3VH 1TWCH 4B3TL 4R4QA 4YWMA 1PH1A 4RMFA 3CPWA 5IYCH 1HZBA 3KJOA 1IBML 2HIXA 1VQNA 3RLOA 4J15A 1PH5A 4K0KL 4BY1H 1PH6A 4DUZL 1KC8C 1Z47A 4B3MQ 1YHBA 2E5LL 4JI7Q 5LMNW 1JE5A 3STBD 3W5OA 4HJAA 3JAMc 3L2PA 2Z6KC 3GTLH 3RLFA 4DV1L 3A74A 5IYBG 2E2HH 4IO9A 1M90C 4YCVA 1LM0A 1UWVA 4R4CA 4BBRH 4HIDA 1D7QA 2K14A 2VQFL 1P8LA 1KIXA 1EYGA 2JA6G 1TWHH 1X65A 1HZ9A 2I5MX 3RR5A 2F4VQ 1V43A 3S14H 2CQOA 2YTVA 4YY3L 3S16H 1VQJA 1YHAA 4JI8Q 1HNXQ 4IOAA 2AWOA 1TWAH 1Q7YC 1JB7A 4LWCA 1HNZQ 4JI6L 3PIOA 2UXBQ 3E9HA 4DR3Q 4IPDA 1AE3A 1X3EA 4GKJQ 5JJKA 3TRZA 4LFBL 1QVGA 1HZAA 2N3SA 2JA5H 1VS0A 1AE2A 1YNXA 5IYDG 5GAHC 4A3IG 1N36L 2AMCB 3JC66 4GN5A 4X64Q 1YIJA 3PF4A 4DV5Q 1WCMG 2EXDA 2UU9Q 2JEAI 1VQLA 1JT8A 2K50A 2IX0A 2K5VA 4A3MG 4DV4L 3UDFA 2QA4A 1PA6A 3CCUA 1V1QA 5GAGC 1WFQA 5FLMH 1E1OA 2NVTH 3S1MH 3J81c 3RLNA 1B70B 1C7YA 4B3TQ 2OQ0A 3ER0A 2UUCQ 2B3GA 5FLXc 5DLQE 3HOXG 4C2MH 2KHJA 1BBUA 3EN2A 4JYAL 4IFDI 4X66Q 2RCNA 1MKHA 4JBWA 1XPUA 5HY6A 4A75A 4JV5L 4AQYL 3S15H 2DGYA 4DR2L 2E5LQ 1VQFA 1CUKA 1PYSB 2JEBI 4QY7A 4DV1Q 2UUAQ 3IRBA 4LFAL 5IP9G 3L0OA 3HOYG 3M9BA 1CKNB 4A3DG 3KF8B 5LMUL 3J80i 3KFUA 2VQFQ 3HOVH 1KXLA 1TWGH 3TREA 2L15A 2IHEA 1PVOA 1G51A 1K3RA 2GN5A 1YEZA 4LF5Q 3PO3G 3KDFA 2RF4A 4TQUS 3HOUH 1DGSA 3EIVA 2WAQE 3GD7A 3MEFA 3UE0A 1GM5A 4WJ3M 1XMQL 4L5QA 4GOPC 5C3EG 2Z0SA 1WI5A 3CD6A 2A1AA 4X62Q 1X55A 1A63A 4PZ7A 2BA1A 4APVA 1I94Q 1IL2A 1YITA 1L1OC 1I3QH 2I5LX 2VY3A 3ULJA 2D62A 2MNAA 2UXDL 2JQOA 2V1CC 1VQIA 1PH9A 1UE6A 4DV0L 4DR5Q 4DV4Q 4IPGA 4GOPB 4A3GG 1HR0L 3HOWG 2K5HA 1IBLL 1C0AA 3PUZA 2Y0SG 1K0RA 1HR0W 1NY4A 3I2ZA 2WFWA 2YYZA 4IPHA 1QVCA 3DLLA 2IY5B 5AJ3L 3T1HL 4GLXA 1NJIC 5ELNA 4JI5L 1XNQL 4JYAQ 1K9MC 4XIGS 1S3OA 2RHQB 1Q46A 1X3GA 3MXNB 2AHOB 2NVXH 2DUDA 1YJNA 4A3BH 1QVFA 1OXVA 3J7A5 4KI0A 3TQYA 2ZM6L 3ICEA 4POGA 2WB1G 5LMUQ 2VUMH 2B63H 1X6OA 4RG1A 2GVBA 3UE1A 4A3KG 4GKKQ 1N34Q 1I5FA 3CW2C 2ES2A 1GD7A 2LSSA 4R4OA 4GLAC 3FKIG 3M4QA 4A3CH 1IBKQ 1NTGA 1A0IA 2NZHA 5GROA 3T1YL 1Y1WG 1EQQA 2Q2UA 3GTMH 4BA1I 5C0XJ 4A3EH 4HIOA 5M5WH 4A3FH 4LF6L 3I4NH 1EUJA 2NN6I 1A8VA 3HKZG 4LF9L 3H3VI 4YWKA 2F3IA 2CCZA 3M3YH 1N8RC 5IT9c 3GTQH 4JI4Q 1N9WA 4JI2L 3UDIA 4BXXH 4JOIA 1E7ZA 2MFIA 2ALYB 4DR1Q 3STBC 2AKWB 4MZ9A 2UUBL 3RZOH 4X6AH 5BR8L 1A62A 1SLJA 2R93H 3KYHC 4QJFA 5LMNL 3CCEA 4JI1L 1SFOH 3CCMA 1I50H 3A5UA 3K7AH 3CXCA 4DV7L 4KHPQ 1TXYA 2ID0A 2ZTEA 4P73A 1VQ5A 4DV3L 2R7ZH 4IJLA 1D8LA 1SRUA 3AFPA 2PQAB 1YZ6A 1XMOQ 3GO5A 1EIYB 5AJ3Q 3T1HQ 4IOCA 1VQDA 3H0GG 1XNQQ 1XJVA 1WYDA 3NELA 3CMAA 3AFQA 3DM3A 4PZ6A 1FL0A 1RL2A 2ASBA 1GVPA 3M4PA 4GLVB 1B7YB 4HJ9A 1HH2P 1LUZA 4AYBG 1Q8KA 5IYBH 3ZJYC 2ZM6Q 3CCSA 2HHHL 3HOZG 1T9HA 2R92G 1K8GA 2JA6H 4C3IH 4YHHL 1Q1BA 5C44H 2NVQH 4XTCS 2B29A 3ULLA 3T1YQ 5C4JH 4JV5Q 3ERSX 4LF7L 5M3MG 1S40A 2K5NA 4B3RL 2E2JH 4WJ4A 4P74A 4UPAA 4LF8L 4LF9Q 3BZCA 4B3SL 4Y7NH 3E0EA 3FHWA 1QUQB 4A3IH 5IYDH 1CSPA 4JI2Q 2N78A 1PYBA 1IYJB 4BBSG 1WCMH 1IBMQ 3K8AA 3ULPA 4DR4L 4GNXA 5IWAL 3PO2G 4R4IA 4UP7A 4A3MH 1R9TH 4DNIA 4K0KQ 5LMNQ 4DUZQ 4JI1Q 1ASZA 3G48A 4JBJA 2YTXA 1UE5A 2E8GA 1JMCA 4KHZA 1KAWA 2UXCL 4MTNA 1N33L 3KF6A 1HZCA 1RIPA 4IPCA 4DR7Q 3HOXH 5K36G 5FJ8H 3K80C 3U4ZA 4OWWB 3CCQA 4IFDG 4JI0L 1WJJA 4C3JH 1XPOA 4OONA 2A8VA 1YVCA 2CWAA 4HIKA 4YY3Q 1E24A 1C9OA 1J5EL 3FP9A 4EX5A 3CC2A 4JI6Q 4OX9L 1NMFA 5IP9H 3HOYH 3I55A 4UY8C 3HOVG 1FJGL 4A3DH 4EQ5A 3I56A 4LFBQ 3OTOL 1KHIA 3TS0A 5JEAG 4YHHQ 1VQ4A 4QIWE 1YBYA 2VW9A 1N36Q 3GTJH 4LF4L 3PO3H 4GN3B 2GVAA 3RNUA 4DAMA 4HIMA 5IP7G 1N32L 3H15A 4LFCL 4DUYL 4B3RQ 1E3PA 2I0QA 1PH4A 5C3EH 4B3SQ 1QZHA 4A3LH 3TEHB 2JA7G 4DK6C 2Z6KA 2FXQA 5M3FG 4JI3L 4OXPA 2PMZE 4FDBA 4JCVE 1LTLA 1BKBA 1CKOA 2HQLA 4OWXB 3CMEA 3VDYA 3J7ZC 1VQMA 4L5RC 4P71A 4NXML 3BU2A 4BA2I 1Z9FA 1H95A 2BH8A 1Q82C 4YWLA 1PH7A 3CPFA 2EQSA 4O0AA 4A3GH 5GAEC 1VQBA 3CC7A 3HOWH 3PUYA 4A3JG 1CKMA 4AQYQ 1I6HH 4DR2Q 2JE6I 1N33Q 3S2DH 2WP8J 4TVAB 4LFAQ 3BZKA 1OXTA 2IHFA 4GN4B 4B3ML 1XNRL 4JI7L 4DR6L 1Q12A 4NPSA 1VCIA 1QZGA 1UE7A 1HJPA 1Y1VG 4JG2A 2KCMA 2ZJQA 3GTKH 2PNHA 1SN8A 2A19A 4R4TA 3AYHB 4YCWA 3I4MG 1J5EQ 2JA8G 3PCOB 5C4XG 1WOCA 2VL6A 4OX9Q 4A93G 3PUWA 2KENA 1O7IA 1FJGQ 3PV0A 2YU9H 2F4VL 2VZAA 1XMQQ 3RN5A 1W2BA 4YCUA 4A3KH 1BVSA 2KHIA 4JI8L 3OTOQ 3HFZB 4DV2L 1HNZL 1AH9A 3FKIH 3PGZA 5C0XI 4DR3L 4A3FG 1G291 4LF4Q 3J81j 1Y1WH 4BY7G 2Q2IA 1CKNA 4GNXB 1X54A 3GTPH 4GKJL 4UP8A 1M1KC 2UXDQ 2OCEA 3M4OH 4A4IA 2NN6G 1UEBA 3UDXA 2WAQG 3WWVA 3U50C 4AIMA 4DV0Q 4LFCQ 2IX1A 5GADC 3RN2A 1HR0Q 4DV5L 1S72A 1IBLQ 3GTGH 5IYCG 1PV4A 3K0XA 1FGUA 1EWIA 1Q81C 3PF5A 3KJPA 4BY1G 3NEMA 4LUOA 4DPGA 1XTDA 1Q1EA 4JI5Q 2C35B 3F8TA 1X9NA 4L5TA 2UUCL 4LW1A 1E22A 1K8AC 2AWNA 3KDFB 2D0OA 4BBRG 3U4VA 4X66L 4HJ7A 1YI2A 4R1JA 2IT1A 2XTIA 1K83H 4QL5A 3G4SA 2N8NA 3I4OA 3H0GH 4GOPA 1VQ6A 3M7NA 1XNRQ 3GTOH 2XGTA 4H02A 5EAYA 4DR6Q 1VQ7A 1X56A 2JJQA 3LGJA 1OTCA 1UE1A 2UUAL 1L1OA 1OXXK 1L0WA 4DAYB 2NVYH 1B8AA 1IXRA 4LF6Q 3D0FA 2PI2E 3HOZH 2JA5G 1Y14B 2Q2TA 2ATWA 3A0JA 2R92H 1VQOA 5C44G 4DKAC 1JJGA 2ZJRA 1SMXA 1SR3A 4LF5L 3D31A 1EOVA 1L2FA 4DV2Q 4PMWA 3S1RH 4OO1I 3J80c 1YJWA 5M5XH 2VNUD 4AH6A 5HGQA 5M5YH 5IE8A 2UUBQ 3JAMi 2CFMA 3AQQA 2R6GA 5BR8Q 5M3MH 2Y0SE 5FLMG 2KBNA 3HKSA 1VQPA 1BBWA 1VQGA 3E9IA 4X62L 1PH8A 2MO1A 2R7DA 4DV7Q 5ELOA 1HNWL 1I94L 2ZTDA 1VQHA 4DV3Q 1G6PA 3CCLA 2KCTA 4LNQA 4OO1G 1SROA 2YV5A 3UDGA 3CCVA 1VQ8A 4BBSH 4DR5L 1KQSA 4Y52H 4PZ8A 2LXJA 4NB3A 3PO2H 1VQCA 4IFDJ 3F2DA 3TS2A 1SE8A 2Q2HA 3CAMA 4A93H 3G71A 1FVIA 1U0LA 2K75A 1KL9A 2F52A 4JC0A 2ZTCA 2N49A 3BJUA 2HIVA 1JJCB 5H1SE 3EBEA 1CSQA 2VQEL 3M85A 2WB1E 3PUXA 5GQOA 1JJ2A 4JOIC 5FJ8G 4HJ8A 2D0PA 2E2IH 2OTJA 3NBHB 2NZOA 1OXSC 2K52A 1YHQA 2HHHQ 4X65L 3KLWA 3CCJA 4JBKA 4IJHA 1KRTA 5JEAJ 1VQ9A 3S1QH 4A76A 3L7ZC 2MO0A 2CWPA 1U5KA 2PQAA 3HOUG 3HKZE 4PG3A 4DV6L 3J81i 3S17H 1OXUA 3Q8DA 1TWFH 4ME3A 4C3HH 3OW2A 3U58A 4LF7Q 4GKKL 5JJIA 2ZJPA 1N34L 1GKHA 2PI2A 3W1GA 2K4KA 4LUZA 1V9PA 4ALPA 4L5SA 4LF8Q 3F1ZA 1GO3E 2BH2A 3F2BA 1NBWA 1IBKL 1EQRA 2YTYA 2RHSB 1PFSA 3G6EA 4HJ5A 1KD1C 4GS3A 5J3BA 3F2CA 1NMGA 4LUVA 1K73C 4DR4Q 4NXNL 5IP7H 5IWAQ 2EIFA 1PH3A 4JI4L 3CQZH 4A3LG 1Q86C 2CKZB 3PUVA 2JA7H 4DR1L 1HNWQ 3AEVA 5M3FH 2UXCQ 3KOJA 1KRSA 3W1BA 2OWOA 1X3FA 3CP0A 4P75A 4KHPL 2OTLA 2VS1A 4JI0Q 1E1TA 1QUQA 1MIUA 4AYBE 4DK3C 3RZDH 1YJ9A 4A3JH 1XMOL 2JA9A 4QGUA 4A3BG 1XPRA 3PIPA 1L1OB 4POFA 2VQEQ 4DR7L 5JJLA 3K81C 5IY0A 2QGQA 4UP9A 4GNXC 3K7UC 3OYYA 2B63G 2VUMG 1MJCA 1EFWA 1PH2A 1LYLA 4X65Q 1EIFA 4MNOA 3A5ZB 1HNXL 4O2DA 2H5XA 4A3CG 2R7FA 1Y1VH 1VQKA 3I4NG 2UXBL 4P72A 3S1NH 3NENA 3CF5A 3I7FA 4A3EG 1IZ6A 3I4MH 3S2HH 3S24A 2JK8A 4DV6Q 1P16A 2JA8H 5C4XH 1VQAA 1J6QA 1N32Q 3B6YA 1PHJA 1W3SA
chains in the Genus database with same CATH superfamily
4DUYQ 3PSIA 3CRKC 2LXKA 4X64L 5EGTA 4BXXG 1KABA 1LTGD 3CCRA 2B2TA 3KF6B 4BY7H 3U9OA 2OEOA 4NXMQ 4NXNQ 4H7BA 4QB4A 3GDEA 1FNUA 4K2KA 4U68A 4NMZA 4B3TL 1T5XD 1K0SA 5IYCH 3U9SA 4IUPA 1E2ZA 2Q8IB 1PH6A 4FF3A 3BVGA 1CZWA 5KYIA 1JE5A 2QEJC 3JAMc 2EVBA 5IYBG 2E2HH 4IO9A 4BBRH 2K14A 2VQFL 1KIXA 3T13A 1TWHH 1HZ9A 4C3IG 1HUMA 5BN3A 4F7XA 3MXNA 4JI8Q 1XYIA 1NCVA 1TWAH 1HNZQ 2B2WC 2UXBQ 1X3EA 4FO2A 3NK9A 4LFBL 3PIP3 3V05A 5GAHC 1N36L 1PTOF 5D3IB 1JOQA 1WCMG 2EXDA 1JT8A 2K5VA 4FXDA 3NTHA 5GAGC 1E1OA 2NVTH 4I7AA 2Z6BA 3RLNA 5IOCA 1HRJA 4DAVA 1C7YA 4A3EB 2H1EA 2OQ0A 3ER0A 1QNUA 5EBCA 2XN9C 2BDOA 5DLQE 4OO1H 1E0BA 1IKLA 4UHVA 3EJIA 4CKBA 2F0EA 1I4HA 1XPUA 5HY6A 3QO2A 4A75A 1LV9A 3I70A 4OGQC 1PMRA 1PYSB 4JK1C 4QY7A 2PZTA 4QIWB 4XXEA 4DV1Q 5IP9G 1QWYA 4A3DG 1CKNB 5LMUL 1B44D 4ODGA 2EZVA 3GTGB 5IT9E 2IHEA 3W3AA 4OL7A 1G8ZD 2GN5A 3EROA 2RF4A 4TQUS 1JWMD 4U673 3X3MA 1XMQL 3H94A 5C3EG 1WI5A 3CD6A 3TZDA 3FRPB 4X3KA 3JAME 1V8QA 1K3BC 1I3QH 1SYEA 2D62A 3H0GB 2JQOA 2MNAA 3DXJC 3I72A 1PH9A 4A3GG 3OHXC 1I4QA 2Y0SG 4XYQA 1NY4A 2WFWA 2YYZA 4IPHA 3DLLA 4CKCA 2EPBA 2E2JB 1ZYRC 2A5HA 1Y8OB 2F0HA 2NTSA 4H13C 1S3OA 2CW0C 2AHOB 4CDEC 2NVXH 1B50A 3OIQA 1RDPD 1QVFA 1BBXC 1OXVA 3J7A5 2K6AA 3ICEA 2L4NA 2B63H 4N8X1 4A3KG 2Z1CA 3A7LA 1GD7A 1RHPA 2LSSA 3M4QA 5CBEE 2Q2UA 2NZHA 3T1YL 4OELB 4ZKBB 4C1NK 1R4PB 5EKIA 3J81L 3H3VI 4YWKA 1D2BA 2F3IA 1B9NA 2JN4A 4B9XA 1N9WA 5FLXL 5J1ZA 5COYA 4HMIA 3QOLA 3HOYB 2HQEA 2AKWB 3QWNA 3K58A 3RZOH 5BR8L 5C0XH 1STYA 3A8KE 1SNDA 3G6JB 1I50H 3K6OA 4KHPQ 2R7ZH 3AFPA 5JJZA 1EIYB 3NSWA 2D9UA 3W2DA 3NELA 3AFQA 4KY5A 3NWSA 3BDLA 4DU9A 3M4PA 3MVVA 3P1HA 4X3TA 1B7YB 2VB2X 2EY2A 3HOZG 3CCSA 2HHHL 5C4HA 5E4WC 4Z9CB 1PDQA 5FOBB 4G4KA 5C4JH 3ERSX 2H4OA 1ENAA 3LWEA 3URYA 4UPAA 3RZDB 3RUZA 3BZCA 4Y7NH 4R8NA 1QUQB 5IYDH 4JI2Q 3Q24A 1PYBA 3ONAB 1IYJB 1JWSD 3K8AA 4IUUA 5IWAL 1R9TH 4A3MH 4DNIA 5LMNQ 4K6DA 4JI1Q 2K05A 3TZUA 1JMCA 4KHZA 1KAWA 2JA8B 1G2TA 2I46A 3FDTA 5KNDA 4YIJA 3HOXH 2OF1A 4FF4A 4C3JH 2A8VA 2NTTA 1ENFA 2EJGC 3CC2A 4JI6Q 1MSHA 4C3HG 2WAQB 4ABNA 1JCKB 2TSSA 3OTOL 3K0YA 4CDCC 3HP3A 3LX0A 3PO3H 3DEPA 4ME5A 3R8BA 1STNA 1LTBD 2LKVA 5IP7G 3H15A 3E3XA 1CA5A 4B3RQ 1E3PA 4B3SQ 1Y8PB 4CJ0B 2JA7G 4DK6C 1SJED 2FXQA 4K5WA 2AQ1B 1KAAA 2KCNA 5IGCA 4JI3L 4OXPA 1LTLA 1XWEA 4OWXB 5L37A 4P71A 5ELBA 1H95A 5IIFA 4XT1B 1I4GA 3CPFA 3S1RB 3HOWH 4A3JG 2G9HD 2JE6I 2NYZD 2BE5D 4PMBA 5G3LD 4OIJA 1Y69U 1M4VA 1CK1A 3J7YW 3BZKA 1RODA 1XNRL 3MXUA 4DR6L 1VCIA 5CC4A 4E6IA 4JG2A 2A19A 4YCWA 2RSNA 1ZKOA 1CQVA 3PCOB 5D65A 3S1MB 1WOCA 3NBHA 1O7IA 3PV0A 2F4VL 2E76C 2VZAA 5E4XA 2F0MA 1BVSA 1PZID 3HFZB 2LMCB 3DWQA 4C2MB 3TBIB 5A2QE 4G57A 2EY6A 1JOKA 4BY7G 3J81j 1M1KC 3S15B 1S4ZA 4LFCQ 1S5DD 3WWVA 1O80A 1F9PA 5GADC 3RN2A 2HCCA 2RCFA 3S17B 5EKLA 5IYCG 3HOVB 3N6RA 3LNNA 2R61A 2C35B 3E6ZX 3HOUB 2MP1A 4L5TA 4LW1A 1JQYD 1PFNA 2AWNA 2E75C 4BBRG 4X66L 1BCPC 1A6XA 1K83H 2DNCA 4GOPA 2N8NA 1X32A 3GTOH 5M3FB 1GJXA 3NTIA 1D6EC 2UUAL 1L0WA 5LL6S 1D5ZC 2GA4B 1B8AA 2K5QA 3D0FA 3A54A 4R9WA 2R92H 1VQOA 2RDHA 5C44G 4K8JA 1DM0B 3OIPA 4LMQD 4DV2Q 1L2FA 3KLSX 4PMWA 3J80c 5M5XH 5M5YH 1HPCA 3AQQA 1LT4D 2F0JA 1Z7TA 2L12A 2R6GA 1QCBD 1HA6A 1VQGA 1Y1VB 3BS1A 3S1NB 3J7AF 2JSOA 4DV7Q 1HNWL 4Q5VA 1I94L 3IAYA 4M8AA 4OO1G 4BBSH 4DR5L 4FYDA 3PO2H 4IFDJ 3TS2A 1PTOH 3G71A 1EEID 1KL9A 4A3FB 2HIVA 5M5WB 1TR5A 2DJFC 1PRTB 5FJ8G 2WKCA 3M3YB 2IW3A 3SR1A 1YHQA 3GTQB 4PQXA 4X65L 1R4QB 3DUZA 1KRTA 4ILWA 5JEAJ 1A2TA 1VQ9A 4A76A 3ERQA 3L7ZC 2CWPA 1U5KA 2PQAA 3HKZE 4PG3A 3TN2A 1OXUA 3Q8DA 2ZJPA 4ZUIA 1GKHA 3PQIA 1V9PA 4LF8Q 1IYVA 1EQRA 1AP0A 2RHSB 3QR8A 2CVRA 4EQPA 2PMZB 5J3BA 1LTAD 1NMGA 4LUVA 5CV9A 3F2CA 3R2TA 1O7LA 2B2UA 4RCNA 3PUVA 4DR1L 5KEEA 1SYBA 1KDAA 3N52A 2JA5B 2A68D 1IL8A 3GP7A 1JE4A 1HFNA 2WV6D 2NVQB 2VS1A 1UEAB 4G7HC 4AYBE 2QKIC 5C3WA 4O42A 3PIPA 3OYYA 2B63G 1B3QA 1PH2A 1G2SA 1KNEA 1HNXL 4O2DA 1VQKA 1WD1A 3I7FA 3S2HH 1IZ6A 5C4XH 3KF8A 3HZXA 4CDFC 3R2IA 2BA0A 4OWTB 1EY8A 2HT1A 3CC4A 2OQKA 5C0XG 1MJEA 4QUFA 1ASYA 3I4LA 2QEXA 2NN6H 5NUCA 2R7ZG 3Q22A 1TWCH 1PH1A 4BS9A 1STHA 3CPWA 1VQNA 4K0KL 4BY1H 2Z9HA 4DUZL 4K8IA 3GTJB 4B3MQ 4JI7Q 5LMNW 3STBD 4HJAA 2L11A 3GTLH 1LM0A 5EQ0A 5C3EB 1P8LA 4V0BA 1X65A 2I5MX 2LY7A 1JORA 1KNAA 3S14H 2YTVA 4YY3L 3S16H 1VQJA 1JB7A 4LWCA 1SNPA 1TKWB 5JPMC 1F2YA 4A3GB 1AE3A 4GKJQ 5I4DA 1HZAA 2N3SA 4V190 1I6HB 1AE2A 1YNXA 2EYLA 5IYDG 1EZ8A 1MI2A 2AMCB 2F0KA 3JC66 3MWYW 3PMFA 4X64Q 5D14A 1TIID 4DV5Q 2K50A 4A3MG 4DV4L 3CCUA 1V1QA 3GTKB 3GTMB 3I4NB 5CV7A 1B70B 4B3TQ 3CRLC 4B9WA 2F0NA 2UUCQ 1B9MA 5C3XA 3HOXG 1AN8A 4IFDI 2RCNA 1MKHA 4KV6A 1UUPA 4C3JG 1WTXA 4QUCA 1MGSA 4AQYL 4DR2L 2Q8TA 2F0LA 1CUKA 1SMYD 3Q23A 1WTQA 4LFAL 3M4OB 5IGEA 3L0OA 2V4DA 1TS3A 2KUMA 2VQFQ 2PZWA 3TREA 1A3TA 1BF4A 1PVOA 1G51A 1K3RA 4FF1A 3PO3G 3EIVA 1GM5A 2ZXOA 3FPPA 1JR0D 1IKMA 2BOSA 1W6KA 1SEBD 2Z8LA 4GOPC 3L3OC 3AMUA 2A1AA 3NE5B 1A63A 5AFWA 2E74C 4DAYA 2JYOA 5DNFA 2DY8A 5EPJA 1J8IA 3HOWG 4RGNA 2NVYB 1K8MA 3D6CA 3VR6A 1CQFA 3SK8A 4GLXA 3T1HL 1NJIC 4JI5L 4A3IB 1K9MC 1B2TA 1Q46A 1X3GA 1Q3LA 3MXNB 3K5OA 2DUDA 2ZM6L 5LMUQ 2VUMH 5CORA 4GKKQ 2GVBA 3UE1A 1N34Q 3CW2C 1UNSA 4R4OA 1H9JA 1A0IA 5GROA 3WDNA 4JV5L 4A3EH 4HIOA 3GQBA 1RTOA 3NHHA 1A8VA 2L9HA 3HKZG 3T56B 1DCZA 4JW0A 3QIAA 5IT9c 4FNFA 2AUKA 2EY1A 4MZ9A 1HTPA 3NPPA 2R93H 2F03A 1RJTA 3S1QB 3MAQA 3A5UA 3K7AH 3CXCA 2E2DC 2FMCA 1TXYA 2ID0A 2ZTEA 1BQQT 4P73A 4DV3L 1D8LA 1TWFB 3GO5A 5CMDA 2PNRC 2F0QA 1DD2A 1VQDA 1WYDA 3CMAA 4RWSC 2DJGC 1EY0A 2B2UC 4PZ6A 5G3LF 5J22A 2IX3A 5FKAC 4AYBG 4X3UA 2IPKD 5C5LA 2R92G 1K8GA 2JA7B 2JA6H 5C44H 3K5LA 2B29A 2F0TA 3ULLA 3T1YQ 2FFKB 4LF7L 2K5NA 2E2JH 4P74A 3E0EA 3ND8A 1VF7A 1UAPA 2B8FA 4BBSG 1IBMQ 2R3ZA 4DR4L 1TVXA 2WB1B 2K33A 3PO2G 4R4IA 1LLRD 1L0YB 1ASZA 3FKIB 1UE5A 2SEBD 4XQJA 4MTNA 1EY5A 2B2VA 3KF6A 1HZCA 2EYHA 2F0WA 1C8CA 1V1PB 4DR7Q 3NUCA 5FJ8H 2RA4A 4OONA 1YVCA 2CWAA 4XYOA 4HIKA 1C9OA 2NWGA 4EX5A 4CBVA 4IUTA 2L55A 3HOYH 1RCVD 4TSSA 1FJGL 4XDXA 1KHIA 1VQ4A 4QIWE 4LK1C 4PMCA 3RNUA 4ZKCB 1HQMC 4DUYL 2I0QA 1PH4A 5CV6A 1FD7D 2E2HB 4RGMA 2CH4W 2Z6KA 1EOTA 4FDBA 3OPOA 3VDYA 1SE2A 1STBA 4OEMB 4L5RC 4NXML 1Z9FA 1QNKA 4YWLA 1PH7A 1TS4A 1TWAB 5GAEC 2PYKA 4JPBW 1CKMA 3TP7A 1TT2A 5CR3A 3S2DH 2WP8J 3NTKA 1F9QA 1PTOC 1OXTA 2HCIA 2IHFA 4GN4B 5FK9C 3SXHA 4G7ZC 4NPSA 1HJPA 1G6ZA 2A74C 2KCMA 4FVMA 1C4QA 5C4XG 1JC7A 2NVTB 1EY7A 2VL6A 2B2YA 2SOBA 1WTOA 2A6ED 2EE1A 3RN5A 1W2BA 4YCUA 4ZRZA 4JI8L 2KHIA 3J80L 3OTOQ 1HNZL 3FEWX 1EFID 1G291 1Y1WH 2Q2IA 1CKNA 4I7ZC 3GTPH 1DOKA 2UXDQ 3A7AB 2OCEA 4A4IA 2NN6G 2EYJA 4DV0Q 1NR2A 3U50C 1HR0Q 1S72A 1IBLQ 3BDOA 3K0XA 1FGUA 3PF5A 5EBDA 1ZEQX 3KJPA 4BY1G 4LUOA 2J7ZA 2K7VA 1Q1EA 3RMHA 4HCSA 5FO9B 2M00A 5CV5A 1PYWD 1E22A 4HSVA 2JP1A 3KDFB 3CU7A 1SNOA 3K5MA 4KJOA 1I4XA 5BN4A 1SYFA 2QCPX 4R1JA 1EYCA 2XWJB 4WJWA 1GXDC 1XNRQ 2X6GA 3MHBA 5EAYA 4DR6Q 1I3QB 1VQ7A 4CGYB 1VF5C 1OXXK 2KCCA 4IZ8A 4LF6Q 2PI2E 1Y14B 2Q2TA 2ATWA 2B39A 1SXTA 1SNCA 4KK7A 1VMCA 1AFPA 1EOVA 4H44C 3S1RH 2C5CA 5DM73 5HGQA 3IKJA 2UUBQ 4WFN3 2KA7A 5M3MH 2KBNA 1EYAA 2R7DA 5IGFA 3I4MB 5ELOA 1YNNC 1G6PA 1GUTA 3CCLA 1ILQA 2M2LA 3UDGA 2YV5A 1VQ8A 4A93B 1EY9A 2F0FA 2Q2HA 1HQRD 1FVIA 1U0LA 1PRTD 3BJUA 2EYMA 2K32A 2MJ8A 4K2LA 2OTJA 3NBHB 1OXSC 2K52A 1HHVA 2A6HC 3KLWA 1JB3A 3CCJA 4IJHA 1O7ZA 4IURA 3VR2A 5LHY1 2A69C 1EU3A 3J81i 4DV6L 3S17H 1I50B 5CBAE 4ME3A 4PV1C 3U58A 4KKSA 5JJIA 3UI2A 2PI2A 3CHBD 2K4KA 1ZXTA 4KD4A 3TSSA 3EA6A 2PPBC 1WTPA 3SDZA 1PFSA 3G6EA 3MXPA 1CM9A 2XRSD 1K73C 1S5FD 4KTAA 3CQZH 1O7YA 1Q86C 1CT1D 2OXPA 2CKZB 1HNWQ 2EY5A 5E1FA 3AEVA 5M3FH 1CTMA 2UXCQ 3OMGA 3KOJA 4MIUA 3SK6A 4P75A 4KHPL 4JI0Q 1E1TA 1QUQA 3IFDA 5C4JB 1BNZA 4DXFA 2JA9A 3I3CA 4J1MA 4QGUA 1ONLA 5IY0A 4Y7NB 3K7UC 2VUMG 1EFWA 4X65Q 1EIFA 3EFXD 3A56A 4MNOA 1Y1VH 3S1NH 2CH4A 4A3EG 2B2VC 4C56C 3S24A 1WD0A 1P16A 5I9OA 5CYUA 2PZUA 4HN7A 1N32Q 3B6YA 3C1EA 2CW0D 1WTRA 3C46A 4EQOA 2KOLA 2F3WA 5KIXA 3HOXB 2UU9L 1JICA 1DYQA 2MQHA 4QQBX 2R93G 1A15A 4KLKA 4KN7C 1H9SA 2EXZA 2HDLA 1EY6A 4JBMA 2I5HA 3F2UA 3SGIA 3H3VH 4YWMA 3BZDB 3KJOA 2HIXA 4RKLA 3K57A 2PW5A 1PH5A 4IALA 1U4PA 2NB0A 1Z47A 2P5ZX 2E5LL 3W5OA 2Z6KC 3BVZA 3P20A 2JXMB 4YCVA 1HXYD 1HA5A 1II3A 4RGTA 2PW7A 4OHJA 2JA6G 2K03A 1ICWA 2K04A 1S5ED 1V43A 2CQOA 4DFAA 4IOAA 1HNXQ 2J0TD 3QJYA 4JI6L 2ZXPA 2QDBA 3PIOA 1EWHA 5JVG3 5C4ZA 3E9HA 4DR3Q 3DMUA 5F2DA 3HOWB 1EWCA 3NXWA 1QVGA 2JA5H 2O5IC 1VS0A 3HGBA 2Z4IA 4A3BB 1BXTA 1EZ6A 3D8GA 1TU2B 4GN5A 4BWGB 3D4RA 4ZYSA 1IW7C 2I07B 2IX0A 4UDUC 2QA4A 2B2YC 5EPLA 5FLMH 3J81c 3SVMA 3C1FA 2B3GA 5FLXc 2KHJA 1BBUA 1I4PA 4JYAL 4F87A 2CHBD 2XNAC 2X69A 2RVLA 4JBWA 4O1NA 4XQNA 1T5EA 3IRBA 4L63B 1Z6HA 2EYFA 3HOYG 4S3SA 3KF8B 1QOHA 1KXLA 2XSCA 4UAIA 1TWGH 2L15A 1KLGD 2MUYA 3V2TA 1YEZA 3AB9A 4LF5Q 5DAUA 2SNSA 4IQZA 1DGSA 1SYDA 3UE0A 3GD7A 5T1GA 4KJNA 1H9RA 3O13A 4X62Q 4PZ7A 1K83B 1IL2A 1KTKA 4JVZA 1VQIA 1UE6A 4C3IB 2K1BA 4DV4Q 4IPGA 1O78A 3JAML 4IUNA 1C0AA 3H6MA 4FXGC 2F0GA 1HR0W 5TSSA 3I2ZA 3FVQA 3E5SA 2R92B 3OWFA 1CHQD 5AJ3L 1MBYA 5ELNA 1XNQL 3IL8A 4XIGS 2N55A 4HSPA 1PFMA 2RHQB 4CHTB 1WVLA 4XT3B 5M5XB 1WCMB 3K59A 5M5YB 5KNCA 1YJNA 1WTWA 3NP8A 4KI0A 3TQYA 4POGA 2AQ3B 3T4AC 2MHVA 1X6OA 1GHKA 1I5FA 3J81E 1S5CD 2ES2A 1IBKQ 2FJ2A 3GTMH 4TKOB 1Y1WG 3I4NH 5FLXE 5C0XJ 2QILA 4LF9L 1F77A 2RBMA 4DNTB 2F4IA 5C5MA 4JI4Q 3UDIA 3DWAA 2B8GA 1SYGA 5J39A 1E7ZA 1OO9B 2ALYB 2MFIA 4RA8A 3S9WA 4A3DB 4X6AH 4HTHA 3KYHC 1SFOH 2DNEA 3BVMA 4DV7L 4J8QA 1SRUA 3OWEB 1XMOQ 3T1HQ 1HFGA 4DK1A 1XJVA 3VYUA 1D5XC 1YNJD 2FINB 2HD3A 1FL0A 1RL2A 2ASBA 3OSOA 1HH2P 1LUZA 3VR3A 2ZM6Q 1T9HA 1VMPA 3CKIB 2Y0SB 4K5VA 1Q1BA 4YHHL 3EVQA 1F2ZA 3ND9A 1BCPD 4XTCS 2NZ1D 4JV5Q 5M3MG 2A73B 4WJ4A 4LF8L 5DEHA 3FHWA 4I65A 3MEHA 5I9PA 1B53A 4A3IH 1CHPD 2N78A 5FO7B 4CKEA 3ULPA 2YU9B 5ELFA 4GNXA 4A3KB 1EL0A 1AZQA 3ZYYX 3TP5A 1LT3D 2G9DA 5C4XB 1N33L 1RIPA 2WACA 4N9PA 1KDCA 4RH6A 1LT6D 1MHWC 3K80C 4ZLTF 1K28A 2ZT9C 1WJJA 1XPOA 1RF2D 1SNMA 1E24A 1J5EL 4L8JA 5M9OA 1GUGA 1NMFA 5T1IA 4OX9L 3I55A 3HOVG 3M4YA 3I56A 5JOBA 3BG3A 1TQOA 4LFBQ 4CDDC 3TS0A 4G7OC 1N36Q 1RKNA 4ZUJA 2VW9A 4LF4L 2GVAA 2CQAA 1EEFD 2ENBA 2F1MA 4ZK9B 3PIO3 3GTLB 2XVSA 1C48A 1NUCA 5M3FG 4JCVE 1STAA 1BKBA 3CMEA 1CKOA 5IGBA 3HOZB 4HCEA 2QDLA 4BA2I 2ZXRA 3S16B 4DNRB 3DEOA 4O0AA 4RKBA 3CC7A 4KN4C 3D4WA 2J4XA 3OOCA 3QG1A 4TVAB 4B3ML 3C2PA 1EY4A 1PRTF 4JI7L 2L0CA 3BDCA 3SK5A 1Y1VG 2ZJQA 5CGKA 1SN8A 4R4TA 3AYHB 3ITPA 2PO4A 3MZ5A 2L1BA 1FNVA 4HEDA 1TS2A 2KENA 1FJGQ 3NBIA 4K14A 1FNWA 1XMQQ 3J7AV 3D4DA 2E2IB 4HAEA 3FKIH 3PGZA 3SK4A 5C0XI 4A3FG 1AH9A 4GKJL 1X54A 4UP8A 5DM63 5A2QL 4DV5L 1RD9D 5D3DA 1PV4A 3GTGH 2EOTA 4C3HB 1EWIA 2WIIB 1ET6A 3MFGA 3MFYA 1A3VA 3NEMA 4FF2A 2C9OA 4DPGA 4P2CB 3C3LA 4C1NI 2UUCL 1K8AC 1XX8A 2D0OA 2RSOA 4H0LC 3T53B 1YI2A 3G4SA 1VQ6A 3M7NA 3I4OA 3H0GH 2K5DA 3DM1A 3MC0B 4H02A 1G91A 2JJQA 3FPUB 3LGJA 1UE1A 1L1OA 1BCPB 3IFTA 4DK0A 1J9OA 2JA5G 3A0JA 1W6JA 4A3JB 4DAPA 2ZJRA 1SMXA 1SR3A 3HEJA 2F0PA 2WINB 1YJWA 3D6WA 2KEEA 3KUPA 2CFMA 5BR8Q 5FLMG 5CV8A 1VQPA 1BBWA 1SYCA 1U4MA 5EPKA 3HRZC 2ZTDA 4OIKA 1DZ1A 1PRTC 2KCTA 4LNQA 1SROA 1TS5A 2VUMB 2MPMA 2VXWA 1KQSA 2LXJA 4NB3A 2F0DA 3QB3A 3VYTA 3H3VC 2D5DA 1SE8A 1SBBB 1LTRD 2K75A 1K8OA 4JC0A 2ZTCA 2FMMA 1JJCB 4KHVA 5H1SE 4BY7B 1CSQA 3TDQA 3M85A 2WB1E 3PUXA 2VQEL 1JJ2A 4KMUC 1STGA 2D0PA 1XXGA 5K36H 4GZYC 2HHHQ 4IFDH 1ENCA 2K5WA 4CJ2C 5BN5A 4LJZC 2MO0A 4KY6A 2KEDA 2R93B 4EGVA 3K7AB 3T16A 3OW2A 4GKKL 1N34L 3WOEA 3WOFA 4L5SA 1E2WA 4ALPA 2BH2A 3F1ZA 1GO3E 1NBWA 3A55A 3R93A 5JEAH 2YTYA 2VB3X 4BBRB 4RFBA 1SDFA 1BUVT 5I6YA 4HJ5A 1KD1C 1TWHB 1EQVA 5JPNC 2BE5C 4NXNL 3T51B 2EIFA 5IWAQ 4A3LG 2ICIA 2JA6B 3KLSA 5C44B 3CP0A 3NQTA 2OTLA 2OT2A 3RZDH 5JJLA 4POFA 3K81C 3AU7A 2QGQA 5EKKA 4GNXC 1DONA 3I8ZA 5IGGA 2H5XA 1ML0D 2R7FA 2UXBL 1ESRA 3I4NG 2O4XA 4P72A 3NENA 1ILPA 3I4MH 1V1PA 2JK8A 4DV6Q 2JA8H 5JAVA 1VQAA 1J6QA 5KYLA 4A93H 1PHJA 3FMCA 1W3SA 4HR7B 1LTSD 3NWTA 5E7NA 4RHRA 4L6TB 2NUCA 4JI3Q 1VQEA 2N88A 4F8MA 1NE3A 1H9MA 1NR4A 4R4QA 4RMFA 2TMPA 1IBML 1HZBA 1A2UA 5IGDA 3M7GA 3MA2B 3RLOA 4J15A 1BOSA 5I6WA 1KC8C 1U9RA 2D2CC 1YHBA 3L2PA 3RLFA 4DV1L 3A74A 5IODA 4DR7L 1M90C 4R4CA 1UWVA 1PXUA 4HIDA 1D7QA 2EJFC 1NAPA 1EYGA 3Q6SA 3RR5A 2F4VQ 1QILA 1U4LA 1YHAA 2AWOA 1Q7YC 1ET9A 4IPDA 2KQ3A 3MXGA 2K28A 2X6LA 5JJKA 2NVXB 4A3IG 3S2DB 4MN3A 1YIJA 3PF4A 3EQLC 2NBFA 3OMCA 2WKDA 3P75A 2UU9Q 2JEAI 1VQLA 2B63B 1B1ZA 3UDFA 1PA6A 1TY2A 4RHSA 1WFQA 4FXKC 4IN3A 3OW7A 5KRUA 1I4RA 1X3QA 3S1MH 2KJXA 1GUNA 4C2MH 3EN2A 4X66Q 1F9RA 2AUJD 2HDMA 4TRDA 3S15H 1Y1WB 2DGYA 2E5LQ 3RZOB 1VQFA 3GTPB 3GV3A 2JEBI 2B2TC 5JVH3 2UUAQ 4MTKA 3M9BA 3K5NA 3KFUA 3J80i 2AQ2B 2K01A 3HOVH 2LFNA 1NNXA 2R7ZB 2F0VA 3KDFA 3HOUH 3MEFA 2WAQE 1A3UA 4WJ3M 5C6AA 5CV4A 1H9SB 4L5QA 2A68C 2Z0SA 1BCPF 1IYUA 2Q8RE 1S5BD 1EIGA 1X55A 4APVA 2BA1A 1I94Q 4J6HA 1L1OC 2I5LX 2VY3A 1KLUD 3ULJA 1QE6A 1YITA 2UXDL 1JWUD 2V1CC 4DV0L 4DR5Q 1X3PA 4NW2A 4GOPB 1HR0L 2K5HA 2L5TA 1BR9A 1IBLL 5I2XA 3PUZA 1K0RA 1EU4A 1QVCA 3GV6A 2IY5B 4KD3A 4ZQ3A 5FO8B 4JYAQ 2M9VA 1U4RA 4NKLA 3KK7A 1ZYRD 4A3BH 5M3MB 1R9TB 4A3MB 1RTNA 2WB1G 1SSOA 4ID6A 4RG1A 3TP6A 2KHSA 1PLFA 4GLAC 2LS01 3FKIG 1GHJA 4A3CH 1NTGA 1PTOD 3TRZA 1EQQA 4BA1I 4LF6L 2KVMA 4IUQA 5M5WH 4A3FH 3Q0AA 1V1OA 1EUJA 2NN6I 3SEBA 4C3JB 1LACA 2CCZA 3M3YH 1N8RC 2F0UA 4N9TA 5LL6X 3GTQH 4JI2L 4QCLA 3I91A 4BXXH 4JOIA 4N8FA 4DR1Q 2UUBL 3STBC 3VA7A 1A62A 4QF4A 1SLJA 2EDGA 4QJFA 5LMNL 3A8IE 4JI1L 3CCEA 3CCMA 3TMEA 2HUGA 1VQ5A 3PO3B 4IJLA 2PQAB 1YZ6A 1YNJC 1L0XB 2BCOA 5AJ3Q 4IOCA 3H0GG 2SNMA 1ESFA 1XNQQ 3DHQA 3DM3A 1F9SA 1GVPA 4GLVB 4HJ9A 5IYBH 1Q8KA 1D1KA 3CQZB 3KBXA 3ZJYC 1GUSA 4DF7A 4ULLA 4C3IH 5ELDA 1SNQA 3P7JA 1PZJD 2NVQH 2Z4HA 4NP5A 4Q0FA 3LWUA 1BDOA 4QMGA 1S40A 4RCOA 4B3RL 1B3AA 3TP8A 4LF9Q 4B3SL 1FR3A 2DN8A 3R3OA 2KECA 1CSPA 2F0SA 3HG9A 2QF7A 1WCMH 1XTCD 4DGZA 4R8IA 4UP7A 1SMYC 4K0KQ 1CZGA 3VYRA 4DUZQ 3G48A 2F0IA 4JBJA 2YTXA 2E8GA 5E3FA 4ZCKA 2UXCL 2XIWA 4DA2A 5ELEA 1EIHA 4IPCA 3HKZB 5K36G 1LTTD 1F2MA 5ELCA 4X3SA 1SAPA 3SE0A 3U4ZA 3CCQA 4JI0L 1YNND 4OWWB 4IFDG 4MHEA 2XRQD 4YY3Q 3FP9A 3L9AX 1LABA 2RQXA 5IP9H 3D3RA 4UY8C 3RD4A 1FGBD 2MGSA 4A3DH 5IT9L 4EQ5A 4WRDA 1I6VC 3DWPA 4KY7A 5JEAG 4YHHQ 1YBYA 3X3NA 3GTJH 1SE3A 4WORA 1Q90A 2O2LD 2RDFA 1STEA 4GN3B 2A6HD 2PQEA 4DAMA 4HIMA 1N32L 3GTOB 4LFCL 1BO0A 2A69D 5C3EH 1QZHA 1AZPA 4A3LH 3TEHB 4EQNA 4AYBB 2PMZE 1H9KA 2HQLA 1VQMA 3BYTB 3J7ZC 5A35A 3BU2A 2BH8A 1WTHA 1Y8NB 1Q82C 2EQSA 4A3GH 1VQBA 3PUYA 1FYCA 3I73A 4AQYQ 2B2WA 1I6HH 3E0JA 4DR2Q 4PNYA 4ZAIA 1N33Q 3VYSA 2EYOA 4K6LA 4LFAQ 5K5PA 1GUWA 1QJOA 2FHTA 1DOMA 1Q12A 1QZGA 4LAAA 1UE7A 3GTKH 1GOZA 4BBSB 2PNHA 3I4MG 3J80E 1J5EQ 2JA8G 3PO2B 3HS0C 4DN4M 1PTOB 3V96A 4OX9Q 4A93G 1KDBA 3PUWA 2QW7A 2YU9H 4A3KH 1HCZA 4DV2L 5ISRA 2IWHA 4DR3L 3I90A 4LF4Q 1QB5D 2O5JC 1WTVA 4GNXB 4B08A 3M4OH 4AIMA 1UEBA 1D1IA 1PZKD 2WAQG 3UDXA 2IX1A 2RKSA 3NQIA 1SJHD 3VA5A 1Q81C 1VDZA 1TWGB 1HTLD 1XTDA 4JI5Q 1JOOA 3F8TA 1X9NA 1PFBA 4RGOS 4M1UB 3U4VA 4HJ7A 2IT1A 2XTIA 3VR4A 1EYDA 4QL5A 1TY0A 4F88A 3H09A 5EJWA 2XGTA 2PCFB 1X56A 1OTCA 1GUOA 2IJ0A 4DAYB 2BDNA 2NVYH 1IXRA 3VR5A 3HOZH 1JJGA 4DKAC 5KGUA 4LF5L 3D31A 3G7LA 4HMJA 1SE4A 4OO1I 4NDXA 2VNUD 4AH6A 5HGTA 5IE8A 3JAMi 1AEXA 1AW7A 2EJMA 3A8JE 2Y0SE 3HKSA 3E9IA 4X62L 1PH8A 3S2HB 2MO1A 1VQHA 4DV3Q 3H91A 1LT5D 3CCVA 4Y52H 4PZ8A 1IHZA 1VQCA 1MD2D 2DY7A 5KNBA 3F2DA 3CAMA 1IW7D 2EYPA 2F52A 2N49A 1CA6A 1M8AA 3EBEA 5GQOA 4JOIC 5I2YA 4HJ8A 2E2IH 2NZOA 1TWCB 4JBKA 1DXMA 1LO5D 4CJ1B 1Q8IA 3S1QH 1DJRD 2G5DA 3HOUG 1MSGA 4BY1B 1SFOB 1TWFH 4C3HH 4LF7Q 3BYYB 3SHLA 4KKUA 4LUZA 3W1GA 1E2VA 1F2LA 3F2BA 1IBKL 4DXGA 1CI3M 2F3VA 4FP5D 4GS3A 4EVOA 4XQQA 1CFMA 4DR4Q 5IP7H 3S14B 1PH3A 4RAUC 4JI4L 3MTSA 4K5XA 1D5MC 1B4OA 2JA7H 3KLRA 2SDFA 1KRSA 2IL8A 3KBGA 2XWBB 3W1BA 2OWOA 1DOLA 1X3FA 5HURA 2ICEC 1MIUA 4DK3C 2A6EC 4A3BG 1EQTA 4A3JH 1YJ9A 1XMOL 1XPRA 1L1OB 2VQEQ 1NSNS 3QOJA 4UP9A 1MJCA 1LYLA 4KKTA 3A5ZB 4A3CG 2F0OA 3CF5A 1HUNA 2RDGA 1LTID 1QG7A 4IUVA 1ICFB
chains in the Genus database with same CATH topology
2BA0A 4DUYQ 4OWTB 3PSIA 5E7NA 2LXKA 4X64L 4BXXG 2HT1A 3CC4A 3CCRA 2UU9L 2MQHA 2OQKA 3KF6B 5C0XG 4JI3Q 4QQBX 4BY7H 2R93G 1MJEA 4KLKA 1VQEA 1ASYA 4NXMQ 4NXNQ 1NE3A 2QEXA 4JBMA 2I5HA 3GDEA 2R7ZG 3SGIA 3H3VH 1TWCH 4B3TL 4R4QA 4YWMA 1PH1A 4RMFA 3CPWA 5IYCH 1HZBA 3KJOA 1IBML 2HIXA 1VQNA 3RLOA 4J15A 1PH5A 4K0KL 4BY1H 1PH6A 4DUZL 1KC8C 1Z47A 4B3MQ 1YHBA 2E5LL 4JI7Q 5LMNW 1JE5A 3STBD 3W5OA 4HJAA 3JAMc 3L2PA 2Z6KC 3GTLH 3RLFA 4DV1L 3A74A 5IYBG 2E2HH 4IO9A 1M90C 4YCVA 1LM0A 1UWVA 4R4CA 4BBRH 4HIDA 1D7QA 2K14A 2VQFL 1P8LA 1KIXA 1EYGA 2JA6G 1TWHH 1X65A 1HZ9A 2I5MX 3RR5A 2F4VQ 1V43A 3S14H 2CQOA 2YTVA 4YY3L 3S16H 1VQJA 1YHAA 4JI8Q 1HNXQ 4IOAA 2AWOA 1TWAH 1Q7YC 1JB7A 4LWCA 1HNZQ 4JI6L 3PIOA 2UXBQ 3E9HA 4DR3Q 4IPDA 1AE3A 1X3EA 4GKJQ 5JJKA 3TRZA 4LFBL 1QVGA 1HZAA 2N3SA 2JA5H 1VS0A 1AE2A 1YNXA 5IYDG 5GAHC 4A3IG 1N36L 2AMCB 3JC66 4GN5A 4X64Q 1YIJA 3PF4A 4DV5Q 1WCMG 2EXDA 2UU9Q 2JEAI 1VQLA 1JT8A 2K50A 2IX0A 2K5VA 4A3MG 4DV4L 3UDFA 2QA4A 1PA6A 3CCUA 1V1QA 5GAGC 1WFQA 5FLMH 1E1OA 2NVTH 3S1MH 3J81c 3RLNA 1B70B 1C7YA 4B3TQ 2OQ0A 3ER0A 2UUCQ 2B3GA 5FLXc 5DLQE 3HOXG 4C2MH 2KHJA 1BBUA 3EN2A 4JYAL 4IFDI 4X66Q 2RCNA 1MKHA 4JBWA 1XPUA 5HY6A 4A75A 4JV5L 4AQYL 3S15H 2DGYA 4DR2L 2E5LQ 1VQFA 1CUKA 1PYSB 2JEBI 4QY7A 4DV1Q 2UUAQ 3IRBA 4LFAL 5IP9G 3L0OA 3HOYG 3M9BA 1CKNB 4A3DG 3KF8B 5LMUL 3J80i 3KFUA 2VQFQ 3HOVH 1KXLA 1TWGH 3TREA 2L15A 2IHEA 1PVOA 1G51A 1K3RA 2GN5A 1YEZA 4LF5Q 3PO3G 3KDFA 2RF4A 4TQUS 3HOUH 1DGSA 3EIVA 2WAQE 3GD7A 3MEFA 3UE0A 1GM5A 4WJ3M 1XMQL 4L5QA 4GOPC 5C3EG 2Z0SA 1WI5A 3CD6A 2A1AA 4X62Q 1X55A 1A63A 4PZ7A 2BA1A 4APVA 1I94Q 1IL2A 1YITA 1L1OC 1I3QH 2I5LX 2VY3A 3ULJA 2D62A 2MNAA 2UXDL 2JQOA 2V1CC 1VQIA 1PH9A 1UE6A 4DV0L 4DR5Q 4DV4Q 4IPGA 4GOPB 4A3GG 1HR0L 3HOWG 2K5HA 1IBLL 1C0AA 3PUZA 2Y0SG 1K0RA 1HR0W 1NY4A 3I2ZA 2WFWA 2YYZA 4IPHA 1QVCA 3DLLA 2IY5B 5AJ3L 3T1HL 4GLXA 1NJIC 5ELNA 4JI5L 1XNQL 4JYAQ 1K9MC 4XIGS 1S3OA 2RHQB 1Q46A 1X3GA 3MXNB 2AHOB 2NVXH 2DUDA 1YJNA 4A3BH 1QVFA 1OXVA 3J7A5 4KI0A 3TQYA 2ZM6L 3ICEA 4POGA 2WB1G 5LMUQ 2VUMH 2B63H 1X6OA 4RG1A 2GVBA 3UE1A 4A3KG 4GKKQ 1N34Q 1I5FA 3CW2C 2ES2A 1GD7A 2LSSA 4R4OA 4GLAC 3FKIG 3M4QA 4A3CH 1IBKQ 1NTGA 1A0IA 2NZHA 5GROA 3T1YL 1Y1WG 1EQQA 2Q2UA 3GTMH 4BA1I 5C0XJ 4A3EH 4HIOA 5M5WH 4A3FH 4LF6L 3I4NH 1EUJA 2NN6I 1A8VA 3HKZG 4LF9L 3H3VI 4YWKA 2F3IA 2CCZA 3M3YH 1N8RC 5IT9c 3GTQH 4JI4Q 1N9WA 4JI2L 3UDIA 4BXXH 4JOIA 1E7ZA 2MFIA 2ALYB 4DR1Q 3STBC 2AKWB 4MZ9A 2UUBL 3RZOH 4X6AH 5BR8L 1A62A 1SLJA 2R93H 3KYHC 4QJFA 5LMNL 3CCEA 4JI1L 1SFOH 3CCMA 1I50H 3A5UA 3K7AH 3CXCA 4DV7L 4KHPQ 1TXYA 2ID0A 2ZTEA 4P73A 1VQ5A 4DV3L 2R7ZH 4IJLA 1D8LA 1SRUA 3AFPA 2PQAB 1YZ6A 1XMOQ 3GO5A 1EIYB 5AJ3Q 3T1HQ 4IOCA 1VQDA 3H0GG 1XNQQ 1XJVA 1WYDA 3NELA 3CMAA 3AFQA 3DM3A 4PZ6A 1FL0A 1RL2A 2ASBA 1GVPA 3M4PA 4GLVB 1B7YB 4HJ9A 1HH2P 1LUZA 4AYBG 1Q8KA 5IYBH 3ZJYC 2ZM6Q 3CCSA 2HHHL 3HOZG 1T9HA 2R92G 1K8GA 2JA6H 4C3IH 4YHHL 1Q1BA 5C44H 2NVQH 4XTCS 2B29A 3ULLA 3T1YQ 5C4JH 4JV5Q 3ERSX 4LF7L 5M3MG 1S40A 2K5NA 4B3RL 2E2JH 4WJ4A 4P74A 4UPAA 4LF8L 4LF9Q 3BZCA 4B3SL 4Y7NH 3E0EA 3FHWA 1QUQB 4A3IH 5IYDH 1CSPA 4JI2Q 2N78A 1PYBA 1IYJB 4BBSG 1WCMH 1IBMQ 3K8AA 3ULPA 4DR4L 4GNXA 5IWAL 3PO2G 4R4IA 4UP7A 4A3MH 1R9TH 4DNIA 4K0KQ 5LMNQ 4DUZQ 4JI1Q 1ASZA 3G48A 4JBJA 2YTXA 1UE5A 2E8GA 1JMCA 4KHZA 1KAWA 2UXCL 4MTNA 1N33L 3KF6A 1HZCA 1RIPA 4IPCA 4DR7Q 3HOXH 5K36G 5FJ8H 3K80C 3U4ZA 4OWWB 3CCQA 4IFDG 4JI0L 1WJJA 4C3JH 1XPOA 4OONA 2A8VA 1YVCA 2CWAA 4HIKA 4YY3Q 1E24A 1C9OA 1J5EL 3FP9A 4EX5A 3CC2A 4JI6Q 4OX9L 1NMFA 5IP9H 3HOYH 3I55A 4UY8C 3HOVG 1FJGL 4A3DH 4EQ5A 3I56A 4LFBQ 3OTOL 1KHIA 3TS0A 5JEAG 4YHHQ 1VQ4A 4QIWE 1YBYA 2VW9A 1N36Q 3GTJH 4LF4L 3PO3H 4GN3B 2GVAA 3RNUA 4DAMA 4HIMA 5IP7G 1N32L 3H15A 4LFCL 4DUYL 4B3RQ 1E3PA 2I0QA 1PH4A 5C3EH 4B3SQ 1QZHA 4A3LH 3TEHB 2JA7G 4DK6C 2Z6KA 2FXQA 5M3FG 4JI3L 4OXPA 2PMZE 4FDBA 4JCVE 1LTLA 1BKBA 1CKOA 2HQLA 4OWXB 3CMEA 3VDYA 3J7ZC 1VQMA 4L5RC 4P71A 4NXML 3BU2A 4BA2I 1Z9FA 1H95A 2BH8A 1Q82C 4YWLA 1PH7A 3CPFA 2EQSA 4O0AA 4A3GH 5GAEC 1VQBA 3CC7A 3HOWH 3PUYA 4A3JG 1CKMA 4AQYQ 1I6HH 4DR2Q 2JE6I 1N33Q 3S2DH 2WP8J 4TVAB 4LFAQ 3BZKA 1OXTA 2IHFA 4GN4B 4B3ML 1XNRL 4JI7L 4DR6L 1Q12A 4NPSA 1VCIA 1QZGA 1UE7A 1HJPA 1Y1VG 4JG2A 2KCMA 2ZJQA 3GTKH 2PNHA 1SN8A 2A19A 4R4TA 3AYHB 4YCWA 3I4MG 1J5EQ 2JA8G 3PCOB 5C4XG 1WOCA 2VL6A 4OX9Q 4A93G 3PUWA 2KENA 1O7IA 1FJGQ 3PV0A 2YU9H 2F4VL 2VZAA 1XMQQ 3RN5A 1W2BA 4YCUA 4A3KH 1BVSA 2KHIA 4JI8L 3OTOQ 3HFZB 4DV2L 1HNZL 1AH9A 3FKIH 3PGZA 5C0XI 4DR3L 4A3FG 1G291 4LF4Q 3J81j 1Y1WH 4BY7G 2Q2IA 1CKNA 4GNXB 1X54A 3GTPH 4GKJL 4UP8A 1M1KC 2UXDQ 2OCEA 3M4OH 4A4IA 2NN6G 1UEBA 3UDXA 2WAQG 3WWVA 3U50C 4AIMA 4DV0Q 4LFCQ 2IX1A 5GADC 3RN2A 1HR0Q 4DV5L 1S72A 1IBLQ 3GTGH 5IYCG 1PV4A 3K0XA 1FGUA 1EWIA 1Q81C 3PF5A 3KJPA 4BY1G 3NEMA 4LUOA 4DPGA 1XTDA 1Q1EA 4JI5Q 2C35B 3F8TA 1X9NA 4L5TA 2UUCL 4LW1A 1E22A 1K8AC 2AWNA 3KDFB 2D0OA 4BBRG 3U4VA 4X66L 4HJ7A 1YI2A 4R1JA 2IT1A 2XTIA 1K83H 4QL5A 3G4SA 2N8NA 3I4OA 3H0GH 4GOPA 1VQ6A 3M7NA 1XNRQ 3GTOH 2XGTA 4H02A 5EAYA 4DR6Q 1VQ7A 1X56A 2JJQA 3LGJA 1OTCA 1UE1A 2UUAL 1L1OA 1OXXK 1L0WA 4DAYB 2NVYH 1B8AA 1IXRA 4LF6Q 3D0FA 2PI2E 3HOZH 2JA5G 1Y14B 2Q2TA 2ATWA 3A0JA 2R92H 1VQOA 5C44G 4DKAC 1JJGA 2ZJRA 1SMXA 1SR3A 4LF5L 3D31A 1EOVA 1L2FA 4DV2Q 4PMWA 3S1RH 4OO1I 3J80c 1YJWA 5M5XH 2VNUD 4AH6A 5HGQA 5M5YH 5IE8A 2UUBQ 3JAMi 2CFMA 3AQQA 2R6GA 5BR8Q 5M3MH 2Y0SE 5FLMG 2KBNA 3HKSA 1VQPA 1BBWA 1VQGA 3E9IA 4X62L 1PH8A 2MO1A 2R7DA 4DV7Q 5ELOA 1HNWL 1I94L 2ZTDA 1VQHA 4DV3Q 1G6PA 3CCLA 2KCTA 4LNQA 4OO1G 1SROA 2YV5A 3UDGA 3CCVA 1VQ8A 4BBSH 4DR5L 1KQSA 4Y52H 4PZ8A 2LXJA 4NB3A 3PO2H 1VQCA 4IFDJ 3F2DA 3TS2A 1SE8A 2Q2HA 3CAMA 4A93H 3G71A 1FVIA 1U0LA 2K75A 1KL9A 2F52A 4JC0A 2ZTCA 2N49A 3BJUA 2HIVA 1JJCB 5H1SE 3EBEA 1CSQA 2VQEL 3M85A 2WB1E 3PUXA 5GQOA 1JJ2A 4JOIC 5FJ8G 4HJ8A 2D0PA 2E2IH 2OTJA 3NBHB 2NZOA 1OXSC 2K52A 1YHQA 2HHHQ 4X65L 3KLWA 3CCJA 4JBKA 4IJHA 1KRTA 5JEAJ 1VQ9A 3S1QH 4A76A 3L7ZC 2MO0A 2CWPA 1U5KA 2PQAA 3HOUG 3HKZE 4PG3A 4DV6L 3J81i 3S17H 1OXUA 3Q8DA 1TWFH 4ME3A 4C3HH 3OW2A 3U58A 4LF7Q 4GKKL 5JJIA 2ZJPA 1N34L 1GKHA 2PI2A 3W1GA 2K4KA 4LUZA 1V9PA 4ALPA 4L5SA 4LF8Q 3F1ZA 1GO3E 2BH2A 3F2BA 1NBWA 1IBKL 1EQRA 2YTYA 2RHSB 1PFSA 3G6EA 4HJ5A 1KD1C 4GS3A 5J3BA 3F2CA 1NMGA 4LUVA 1K73C 4DR4Q 4NXNL 5IP7H 5IWAQ 2EIFA 1PH3A 4JI4L 3CQZH 4A3LG 1Q86C 2CKZB 3PUVA 2JA7H 4DR1L 1HNWQ 3AEVA 5M3FH 2UXCQ 3KOJA 1KRSA 3W1BA 2OWOA 1X3FA 3CP0A 4P75A 4KHPL 2OTLA 2VS1A 4JI0Q 1E1TA 1QUQA 1MIUA 4AYBE 4DK3C 3RZDH 1YJ9A 4A3JH 1XMOL 2JA9A 4QGUA 4A3BG 1XPRA 3PIPA 1L1OB 4POFA 2VQEQ 4DR7L 5JJLA 3K81C 5IY0A 2QGQA 4UP9A 4GNXC 3K7UC 3OYYA 2B63G 2VUMG 1MJCA 1EFWA 1PH2A 1LYLA 4X65Q 1EIFA 4MNOA 3A5ZB 1HNXL 4O2DA 2H5XA 4A3CG 2R7FA 1Y1VH 1VQKA 3I4NG 2UXBL 4P72A 3S1NH 3NENA 3CF5A 3I7FA 4A3EG 1IZ6A 3I4MH 3S2HH 3S24A 2JK8A 4DV6Q 1P16A 2JA8H 5C4XH 1VQAA 1J6QA 1N32Q 3B6YA 1PHJA 1W3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 A;  4DUY Q;  4OWT B;  3PSI A;  5E7N A;  2LXK A;  4X64 L;  4BXX G;  2HT1 A;  3CC4 A;  3CCR A;  2UU9 L;  2MQH A;  2OQK A;  3KF6 B;  5C0X G;  4JI3 Q;  4QQB X;  4BY7 H;  2R93 G;  1MJE A;  4KLK A;  1VQE A;  1ASY A;  4NXM Q;  4NXN Q;  1NE3 A;  2QEX A;  4JBM A;  2I5H A;  3GDE A;  2R7Z G;  3SGI A;  3H3V H;  1TWC H;  4B3T L;  4R4Q A;  4YWM A;  1PH1 A;  4RMF A;  3CPW A;  5IYC H;  1HZB A;  3KJO A;  1IBM L;  2HIX A;  1VQN A;  3RLO A;  4J15 A;  1PH5 A;  4K0K L;  4BY1 H;  1PH6 A;  4DUZ L;  1KC8 C;  1Z47 A;  4B3M Q;  1YHB A;  2E5L L;  4JI7 Q;  5LMN W;  1JE5 A;  3STB D;  3W5O A;  4HJA A;  3JAM c;  3L2P A;  2Z6K C;  3GTL H;  3RLF A;  4DV1 L;  3A74 A;  5IYB G;  2E2H H;  4IO9 A;  1M90 C;  4YCV A;  1LM0 A;  1UWV A;  4R4C A;  4BBR H;  4HID A;  1D7Q A;  2K14 A;  2VQF L;  1P8L A;  1KIX A;  1EYG A;  2JA6 G;  1TWH H;  1X65 A;  1HZ9 A;  2I5M X;  3RR5 A;  2F4V Q;  1V43 A;  3S14 H;  2CQO A;  2YTV A;  4YY3 L;  3S16 H;  1VQJ A;  1YHA A;  4JI8 Q;  1HNX Q;  4IOA A;  2AWO A;  1TWA H;  1Q7Y C;  1JB7 A;  4LWC A;  1HNZ Q;  4JI6 L;  3PIO A;  2UXB Q;  3E9H A;  4DR3 Q;  4IPD A;  1AE3 A;  1X3E A;  4GKJ Q;  5JJK A;  3TRZ A;  4LFB L;  1QVG A;  1HZA A;  2N3S A;  2JA5 H;  1VS0 A;  1AE2 A;  1YNX A;  5IYD G;  5GAH C;  4A3I G;  1N36 L;  2AMC B;  3JC6 6;  4GN5 A;  4X64 Q;  1YIJ A;  3PF4 A;  4DV5 Q;  1WCM G;  2EXD A;  2UU9 Q;  2JEA I;  1VQL A;  1JT8 A;  2K50 A;  2IX0 A;  2K5V A;  4A3M G;  4DV4 L;  3UDF A;  2QA4 A;  1PA6 A;  3CCU A;  1V1Q A;  5GAG C;  1WFQ A;  5FLM H;  1E1O A;  2NVT H;  3S1M H;  3J81 c;  3RLN A;  1B70 B;  1C7Y A;  4B3T Q;  2OQ0 A;  3ER0 A;  2UUC Q;  2B3G A;  5FLX c;  5DLQ E;  3HOX G;  4C2M H;  2KHJ A;  1BBU A;  3EN2 A;  4JYA L;  4IFD I;  4X66 Q;  2RCN A;  1MKH A;  4JBW A;  1XPU A;  5HY6 A;  4A75 A;  4JV5 L;  4AQY L;  3S15 H;  2DGY A;  4DR2 L;  2E5L Q;  1VQF A;  1CUK A;  1PYS B;  2JEB I;  4QY7 A;  4DV1 Q;  2UUA Q;  3IRB A;  4LFA L;  5IP9 G;  3L0O A;  3HOY G;  3M9B A;  1CKN B;  4A3D G;  3KF8 B;  5LMU L;  3J80 i;  3KFU A;  2VQF Q;  3HOV H;  1KXL A;  1TWG H;  3TRE A;  2L15 A;  2IHE A;  1PVO A;  1G51 A;  1K3R A;  2GN5 A;  1YEZ A;  4LF5 Q;  3PO3 G;  3KDF A;  2RF4 A;  4TQU S;  3HOU H;  1DGS A;  3EIV A;  2WAQ E;  3GD7 A;  3MEF A;  3UE0 A;  1GM5 A;  4WJ3 M;  1XMQ L;  4L5Q A;  4GOP C;  5C3E G;  2Z0S A;  1WI5 A;  3CD6 A;  2A1A A;  4X62 Q;  1X55 A;  1A63 A;  4PZ7 A;  2BA1 A;  4APV A;  1I94 Q;  1IL2 A;  1YIT A;  1L1O C;  1I3Q H;  2I5L X;  2VY3 A;  3ULJ A;  2D62 A;  2MNA A;  2UXD L;  2JQO A;  2V1C C;  1VQI A;  1PH9 A;  1UE6 A;  4DV0 L;  4DR5 Q;  4DV4 Q;  4IPG A;  4GOP B;  4A3G G;  1HR0 L;  3HOW G;  2K5H A;  1IBL L;  1C0A A;  3PUZ A;  2Y0S G;  1K0R A;  1HR0 W;  1NY4 A;  3I2Z A;  2WFW A;  2YYZ A;  4IPH A;  1QVC A;  3DLL A;  2IY5 B;  5AJ3 L;  3T1H L;  4GLX A;  1NJI C;  5ELN A;  4JI5 L;  1XNQ L;  4JYA Q;  1K9M C;  4XIG S;  1S3O A;  2RHQ B;  1Q46 A;  1X3G A;  3MXN B;  2AHO B;  2NVX H;  2DUD A;  1YJN A;  4A3B H;  1QVF A;  1OXV A;  3J7A 5;  4KI0 A;  3TQY A;  2ZM6 L;  3ICE A;  4POG A;  2WB1 G;  5LMU Q;  2VUM H;  2B63 H;  1X6O A;  4RG1 A;  2GVB A;  3UE1 A;  4A3K G;  4GKK Q;  1N34 Q;  1I5F A;  3CW2 C;  2ES2 A;  1GD7 A;  2LSS A;  4R4O A;  4GLA C;  3FKI G;  3M4Q A;  4A3C H;  1IBK Q;  1NTG A;  1A0I A;  2NZH A;  5GRO A;  3T1Y L;  1Y1W G;  1EQQ A;  2Q2U A;  3GTM H;  4BA1 I;  5C0X J;  4A3E H;  4HIO A;  5M5W H;  4A3F H;  4LF6 L;  3I4N H;  1EUJ A;  2NN6 I;  1A8V A;  3HKZ G;  4LF9 L;  3H3V I;  4YWK A;  2F3I A;  2CCZ A;  3M3Y H;  1N8R C;  5IT9 c;  3GTQ H;  4JI4 Q;  1N9W A;  4JI2 L;  3UDI A;  4BXX H;  4JOI A;  1E7Z A;  2MFI A;  2ALY B;  4DR1 Q;  3STB C;  2AKW B;  4MZ9 A;  2UUB L;  3RZO H;  4X6A H;  5BR8 L;  1A62 A;  1SLJ A;  2R93 H;  3KYH C;  4QJF A;  5LMN L;  3CCE A;  4JI1 L;  1SFO H;  3CCM A;  1I50 H;  3A5U A;  3K7A H;  3CXC A;  4DV7 L;  4KHP Q;  1TXY A;  2ID0 A;  2ZTE A;  4P73 A;  1VQ5 A;  4DV3 L;  2R7Z H;  4IJL A;  1D8L A;  1SRU A;  3AFP A;  2PQA B;  1YZ6 A;  1XMO Q;  3GO5 A;  1EIY B;  5AJ3 Q;  3T1H Q;  4IOC A;  1VQD A;  3H0G G;  1XNQ Q;  1XJV A;  1WYD A;  3NEL A;  3CMA A;  3AFQ A;  3DM3 A;  4PZ6 A;  1FL0 A;  1RL2 A;  2ASB A;  1GVP A;  3M4P A;  4GLV B;  1B7Y B;  4HJ9 A;  1HH2 P;  1LUZ A;  4AYB G;  1Q8K A;  5IYB H;  3ZJY C;  2ZM6 Q;  3CCS A;  2HHH L;  3HOZ G;  1T9H A;  2R92 G;  1K8G A;  2JA6 H;  4C3I H;  4YHH L;  1Q1B A;  5C44 H;  2NVQ H;  4XTC S;  2B29 A;  3ULL A;  3T1Y Q;  5C4J H;  4JV5 Q;  3ERS X;  4LF7 L;  5M3M G;  1S40 A;  2K5N A;  4B3R L;  2E2J H;  4WJ4 A;  4P74 A;  4UPA A;  4LF8 L;  4LF9 Q;  3BZC A;  4B3S L;  4Y7N H;  3E0E A;  3FHW A;  1QUQ B;  4A3I H;  5IYD H;  1CSP A;  4JI2 Q;  2N78 A;  1PYB A;  1IYJ B;  4BBS G;  1WCM H;  1IBM Q;  3K8A A;  3ULP A;  4DR4 L;  4GNX A;  5IWA L;  3PO2 G;  4R4I A;  4UP7 A;  4A3M H;  1R9T H;  4DNI A;  4K0K Q;  5LMN Q;  4DUZ Q;  4JI1 Q;  1ASZ A;  3G48 A;  4JBJ A;  2YTX A;  1UE5 A;  2E8G A;  1JMC A;  4KHZ A;  1KAW A;  2UXC L;  4MTN A;  1N33 L;  3KF6 A;  1HZC A;  1RIP A;  4IPC A;  4DR7 Q;  3HOX H;  5K36 G;  5FJ8 H;  3K80 C;  3U4Z A;  4OWW B;  3CCQ A;  4IFD G;  4JI0 L;  1WJJ A;  4C3J H;  1XPO A;  4OON A;  2A8V A;  1YVC A;  2CWA A;  4HIK A;  4YY3 Q;  1E24 A;  1C9O A;  1J5E L;  3FP9 A;  4EX5 A;  3CC2 A;  4JI6 Q;  4OX9 L;  1NMF A;  5IP9 H;  3HOY H;  3I55 A;  4UY8 C;  3HOV G;  1FJG L;  4A3D H;  4EQ5 A;  3I56 A;  4LFB Q;  3OTO L;  1KHI A;  3TS0 A;  5JEA G;  4YHH Q;  1VQ4 A;  4QIW E;  1YBY A;  2VW9 A;  1N36 Q;  3GTJ H;  4LF4 L;  3PO3 H;  4GN3 B;  2GVA A;  3RNU A;  4DAM A;  4HIM A;  5IP7 G;  1N32 L;  3H15 A;  4LFC L;  4DUY L;  4B3R Q;  1E3P A;  2I0Q A;  1PH4 A;  5C3E H;  4B3S Q;  1QZH A;  4A3L H;  3TEH B;  2JA7 G;  4DK6 C;  2Z6K A;  2FXQ A;  5M3F G;  4JI3 L;  4OXP A;  2PMZ E;  4FDB A;  4JCV E;  1LTL A;  1BKB A;  1CKO A;  2HQL A;  4OWX B;  3CME A;  3VDY A;  3J7Z C;  1VQM A;  4L5R C;  4P71 A;  4NXM L;  3BU2 A;  4BA2 I;  1Z9F A;  1H95 A;  2BH8 A;  1Q82 C;  4YWL A;  1PH7 A;  3CPF A;  2EQS A;  4O0A A;  4A3G H;  5GAE C;  1VQB A;  3CC7 A;  3HOW H;  3PUY A;  4A3J G;  1CKM A;  4AQY Q;  1I6H H;  4DR2 Q;  2JE6 I;  1N33 Q;  3S2D H;  2WP8 J;  4TVA B;  4LFA Q;  3BZK A;  1OXT A;  2IHF A;  4GN4 B;  4B3M L;  1XNR L;  4JI7 L;  4DR6 L;  1Q12 A;  4NPS A;  1VCI A;  1QZG A;  1UE7 A;  1HJP A;  1Y1V G;  4JG2 A;  2KCM A;  2ZJQ A;  3GTK H;  2PNH A;  1SN8 A;  2A19 A;  4R4T A;  3AYH B;  4YCW A;  3I4M G;  1J5E Q;  2JA8 G;  3PCO B;  5C4X G;  1WOC A;  2VL6 A;  4OX9 Q;  4A93 G;  3PUW A;  2KEN A;  1O7I A;  1FJG Q;  3PV0 A;  2YU9 H;  2F4V L;  2VZA A;  1XMQ Q;  3RN5 A;  1W2B A;  4YCU A;  4A3K H;  1BVS A;  2KHI A;  4JI8 L;  3OTO Q;  3HFZ B;  4DV2 L;  1HNZ L;  1AH9 A;  3FKI H;  3PGZ A;  5C0X I;  4DR3 L;  4A3F G;  1G29 1;  4LF4 Q;  3J81 j;  1Y1W H;  4BY7 G;  2Q2I A;  1CKN A;  4GNX B;  1X54 A;  3GTP H;  4GKJ L;  4UP8 A;  1M1K C;  2UXD Q;  2OCE A;  3M4O H;  4A4I A;  2NN6 G;  1UEB A;  3UDX A;  2WAQ G;  3WWV A;  3U50 C;  4AIM A;  4DV0 Q;  4LFC Q;  2IX1 A;  5GAD C;  3RN2 A;  1HR0 Q;  4DV5 L;  1S72 A;  1IBL Q;  3GTG H;  5IYC G;  1PV4 A;  3K0X A;  1FGU A;  1EWI A;  1Q81 C;  3PF5 A;  3KJP A;  4BY1 G;  3NEM A;  4LUO A;  4DPG A;  1XTD A;  1Q1E A;  4JI5 Q;  2C35 B;  3F8T A;  1X9N A;  4L5T A;  2UUC L;  4LW1 A;  1E22 A;  1K8A C;  2AWN A;  3KDF B;  2D0O A;  4BBR G;  3U4V A;  4X66 L;  4HJ7 A;  1YI2 A;  4R1J A;  2IT1 A;  2XTI A;  1K83 H;  4QL5 A;  3G4S A;  2N8N A;  3I4O A;  3H0G H;  4GOP A;  1VQ6 A;  3M7N A;  1XNR Q;  3GTO H;  2XGT A;  4H02 A;  5EAY A;  4DR6 Q;  1VQ7 A;  1X56 A;  2JJQ A;  3LGJ A;  1OTC A;  1UE1 A;  2UUA L;  1L1O A;  1OXX K;  1L0W A;  4DAY B;  2NVY H;  1B8A A;  1IXR A;  4LF6 Q;  3D0F A;  2PI2 E;  3HOZ H;  2JA5 G;  1Y14 B;  2Q2T A;  2ATW A;  3A0J A;  2R92 H;  1VQO A;  5C44 G;  4DKA C;  1JJG A;  2ZJR A;  1SMX A;  1SR3 A;  4LF5 L;  3D31 A;  1EOV A;  1L2F A;  4DV2 Q;  4PMW A;  3S1R H;  4OO1 I;  3J80 c;  1YJW A;  5M5X H;  2VNU D;  4AH6 A;  5HGQ A;  5M5Y H;  5IE8 A;  2UUB Q;  3JAM i;  2CFM A;  3AQQ A;  2R6G A;  5BR8 Q;  5M3M H;  2Y0S E;  5FLM G;  2KBN A;  3HKS A;  1VQP A;  1BBW A;  1VQG A;  3E9I A;  4X62 L;  1PH8 A;  2MO1 A;  2R7D A;  4DV7 Q;  5ELO A;  1HNW L;  1I94 L;  2ZTD A;  1VQH A;  4DV3 Q;  1G6P A;  3CCL A;  2KCT A;  4LNQ A;  4OO1 G;  1SRO A;  2YV5 A;  3UDG A;  3CCV A;  1VQ8 A;  4BBS H;  4DR5 L;  1KQS A;  4Y52 H;  4PZ8 A;  2LXJ A;  4NB3 A;  3PO2 H;  1VQC A;  4IFD J;  3F2D A;  3TS2 A;  1SE8 A;  2Q2H A;  3CAM A;  4A93 H;  3G71 A;  1FVI A;  1U0L A;  2K75 A;  1KL9 A;  2F52 A;  4JC0 A;  2ZTC A;  2N49 A;  3BJU A;  2HIV A;  1JJC B;  5H1S E;  3EBE A;  1CSQ A;  2VQE L;  3M85 A;  2WB1 E;  3PUX A;  5GQO A;  1JJ2 A;  4JOI C;  5FJ8 G;  4HJ8 A;  2D0P A;  2E2I H;  2OTJ A;  3NBH B;  2NZO A;  1OXS C;  2K52 A;  1YHQ A;  2HHH Q;  4X65 L;  3KLW A;  3CCJ A;  4JBK A;  4IJH A;  1KRT A;  5JEA J;  1VQ9 A;  3S1Q H;  4A76 A;  3L7Z C;  2MO0 A;  2CWP A;  1U5K A;  2PQA A;  3HOU G;  3HKZ E;  4PG3 A;  4DV6 L;  3J81 i;  3S17 H;  1OXU A;  3Q8D A;  1TWF H;  4ME3 A;  4C3H H;  3OW2 A;  3U58 A;  4LF7 Q;  4GKK L;  5JJI A;  2ZJP A;  1N34 L;  1GKH A;  2PI2 A;  3W1G A;  2K4K A;  4LUZ A;  1V9P A;  4ALP A;  4L5S A;  4LF8 Q;  3F1Z A;  1GO3 E;  2BH2 A;  3F2B A;  1NBW A;  1IBK L;  1EQR A;  2YTY A;  2RHS B;  1PFS A;  3G6E A;  4HJ5 A;  1KD1 C;  4GS3 A;  5J3B A;  3F2C A;  1NMG A;  4LUV A;  1K73 C;  4DR4 Q;  4NXN L;  5IP7 H;  5IWA Q;  2EIF A;  1PH3 A;  4JI4 L;  3CQZ H;  4A3L G;  1Q86 C;  2CKZ B;  3PUV A;  2JA7 H;  4DR1 L;  1HNW Q;  3AEV A;  5M3F H;  2UXC Q;  3KOJ A;  1KRS A;  3W1B A;  2OWO A;  1X3F A;  3CP0 A;  4P75 A;  4KHP L;  2OTL A;  2VS1 A;  4JI0 Q;  1E1T A;  1QUQ A;  1MIU A;  4AYB E;  4DK3 C;  3RZD H;  1YJ9 A;  4A3J H;  1XMO L;  2JA9 A;  4QGU A;  4A3B G;  1XPR A;  3PIP A;  1L1O B;  4POF A;  2VQE Q;  4DR7 L;  5JJL A;  3K81 C;  5IY0 A;  2QGQ A;  4UP9 A;  4GNX C;  3K7U C;  3OYY A;  2B63 G;  2VUM G;  1MJC A;  1EFW A;  1PH2 A;  1LYL A;  4X65 Q;  1EIF A;  4MNO A;  3A5Z B;  1HNX L;  4O2D A;  2H5X A;  4A3C G;  2R7F A;  1Y1V H;  1VQK A;  3I4N G;  2UXB L;  4P72 A;  3S1N H;  3NEN A;  3CF5 A;  3I7F A;  4A3E G;  1IZ6 A;  3I4M H;  3S2H H;  3S24 A;  2JK8 A;  4DV6 Q;  1P16 A;  2JA8 H;  5C4X H;  1VQA A;  1J6Q A;  1N32 Q;  3B6Y A;  1PHJ A;  1W3S A; 
#chains in the Genus database with same CATH topology
 4DUY Q;  3PSI A;  3CRK C;  2LXK A;  4X64 L;  5EGT A;  4BXX G;  1KAB A;  1LTG D;  3CCR A;  2B2T A;  3KF6 B;  4BY7 H;  3U9O A;  2OEO A;  4NXM Q;  4NXN Q;  4H7B A;  4QB4 A;  3GDE A;  1FNU A;  4K2K A;  4U68 A;  4NMZ A;  4B3T L;  1T5X D;  1K0S A;  5IYC H;  3U9S A;  4IUP A;  1E2Z A;  2Q8I B;  1PH6 A;  4FF3 A;  3BVG A;  1CZW A;  5KYI A;  1JE5 A;  2QEJ C;  3JAM c;  2EVB A;  5IYB G;  2E2H H;  4IO9 A;  4BBR H;  2K14 A;  2VQF L;  1KIX A;  3T13 A;  1TWH H;  1HZ9 A;  4C3I G;  1HUM A;  5BN3 A;  4F7X A;  3MXN A;  4JI8 Q;  1XYI A;  1NCV A;  1TWA H;  1HNZ Q;  2B2W C;  2UXB Q;  1X3E A;  4FO2 A;  3NK9 A;  4LFB L;  3PIP 3;  3V05 A;  5GAH C;  1N36 L;  1PTO F;  5D3I B;  1JOQ A;  1WCM G;  2EXD A;  1JT8 A;  2K5V A;  4FXD A;  3NTH A;  5GAG C;  1E1O A;  2NVT H;  4I7A A;  2Z6B A;  3RLN A;  5IOC A;  1HRJ A;  4DAV A;  1C7Y A;  4A3E B;  2H1E A;  2OQ0 A;  3ER0 A;  1QNU A;  5EBC A;  2XN9 C;  2BDO A;  5DLQ E;  4OO1 H;  1E0B A;  1IKL A;  4UHV A;  3EJI A;  4CKB A;  2F0E A;  1I4H A;  1XPU A;  5HY6 A;  3QO2 A;  4A75 A;  1LV9 A;  3I70 A;  4OGQ C;  1PMR A;  1PYS B;  4JK1 C;  4QY7 A;  2PZT A;  4QIW B;  4XXE A;  4DV1 Q;  5IP9 G;  1QWY A;  4A3D G;  1CKN B;  5LMU L;  1B44 D;  4ODG A;  2EZV A;  3GTG B;  5IT9 E;  2IHE A;  3W3A A;  4OL7 A;  1G8Z D;  2GN5 A;  3ERO A;  2RF4 A;  4TQU S;  1JWM D;  4U67 3;  3X3M A;  1XMQ L;  3H94 A;  5C3E G;  1WI5 A;  3CD6 A;  3TZD A;  3FRP B;  4X3K A;  3JAM E;  1V8Q A;  1K3B C;  1I3Q H;  1SYE A;  2D62 A;  3H0G B;  2JQO A;  2MNA A;  3DXJ C;  3I72 A;  1PH9 A;  4A3G G;  3OHX C;  1I4Q A;  2Y0S G;  4XYQ A;  1NY4 A;  2WFW A;  2YYZ A;  4IPH A;  3DLL A;  4CKC A;  2EPB A;  2E2J B;  1ZYR C;  2A5H A;  1Y8O B;  2F0H A;  2NTS A;  4H13 C;  1S3O A;  2CW0 C;  2AHO B;  4CDE C;  2NVX H;  1B50 A;  3OIQ A;  1RDP D;  1QVF A;  1BBX C;  1OXV A;  3J7A 5;  2K6A A;  3ICE A;  2L4N A;  2B63 H;  4N8X 1;  4A3K G;  2Z1C A;  3A7L A;  1GD7 A;  1RHP A;  2LSS A;  3M4Q A;  5CBE E;  2Q2U A;  2NZH A;  3T1Y L;  4OEL B;  4ZKB B;  4C1N K;  1R4P B;  5EKI A;  3J81 L;  3H3V I;  4YWK A;  1D2B A;  2F3I A;  1B9N A;  2JN4 A;  4B9X A;  1N9W A;  5FLX L;  5J1Z A;  5COY A;  4HMI A;  3QOL A;  3HOY B;  2HQE A;  2AKW B;  3QWN A;  3K58 A;  3RZO H;  5BR8 L;  5C0X H;  1STY A;  3A8K E;  1SND A;  3G6J B;  1I50 H;  3K6O A;  4KHP Q;  2R7Z H;  3AFP A;  5JJZ A;  1EIY B;  3NSW A;  2D9U A;  3W2D A;  3NEL A;  3AFQ A;  4KY5 A;  3NWS A;  3BDL A;  4DU9 A;  3M4P A;  3MVV A;  3P1H A;  4X3T A;  1B7Y B;  2VB2 X;  2EY2 A;  3HOZ G;  3CCS A;  2HHH L;  5C4H A;  5E4W C;  4Z9C B;  1PDQ A;  5FOB B;  4G4K A;  5C4J H;  3ERS X;  2H4O A;  1ENA A;  3LWE A;  3URY A;  4UPA A;  3RZD B;  3RUZ A;  3BZC A;  4Y7N H;  4R8N A;  1QUQ B;  5IYD H;  4JI2 Q;  3Q24 A;  1PYB A;  3ONA B;  1IYJ B;  1JWS D;  3K8A A;  4IUU A;  5IWA L;  1R9T H;  4A3M H;  4DNI A;  5LMN Q;  4K6D A;  4JI1 Q;  2K05 A;  3TZU A;  1JMC A;  4KHZ A;  1KAW A;  2JA8 B;  1G2T A;  2I46 A;  3FDT A;  5KND A;  4YIJ A;  3HOX H;  2OF1 A;  4FF4 A;  4C3J H;  2A8V A;  2NTT A;  1ENF A;  2EJG C;  3CC2 A;  4JI6 Q;  1MSH A;  4C3H G;  2WAQ B;  4ABN A;  1JCK B;  2TSS A;  3OTO L;  3K0Y A;  4CDC C;  3HP3 A;  3LX0 A;  3PO3 H;  3DEP A;  4ME5 A;  3R8B A;  1STN A;  1LTB D;  2LKV A;  5IP7 G;  3H15 A;  3E3X A;  1CA5 A;  4B3R Q;  1E3P A;  4B3S Q;  1Y8P B;  4CJ0 B;  2JA7 G;  4DK6 C;  1SJE D;  2FXQ A;  4K5W A;  2AQ1 B;  1KAA A;  2KCN A;  5IGC A;  4JI3 L;  4OXP A;  1LTL A;  1XWE A;  4OWX B;  5L37 A;  4P71 A;  5ELB A;  1H95 A;  5IIF A;  4XT1 B;  1I4G A;  3CPF A;  3S1R B;  3HOW H;  4A3J G;  2G9H D;  2JE6 I;  2NYZ D;  2BE5 D;  4PMB A;  5G3L D;  4OIJ A;  1Y69 U;  1M4V A;  1CK1 A;  3J7Y W;  3BZK A;  1ROD A;  1XNR L;  3MXU A;  4DR6 L;  1VCI A;  5CC4 A;  4E6I A;  4JG2 A;  2A19 A;  4YCW A;  2RSN A;  1ZKO A;  1CQV A;  3PCO B;  5D65 A;  3S1M B;  1WOC A;  3NBH A;  1O7I A;  3PV0 A;  2F4V L;  2E76 C;  2VZA A;  5E4X A;  2F0M A;  1BVS A;  1PZI D;  3HFZ B;  2LMC B;  3DWQ A;  4C2M B;  3TBI B;  5A2Q E;  4G57 A;  2EY6 A;  1JOK A;  4BY7 G;  3J81 j;  1M1K C;  3S15 B;  1S4Z A;  4LFC Q;  1S5D D;  3WWV A;  1O80 A;  1F9P A;  5GAD C;  3RN2 A;  2HCC A;  2RCF A;  3S17 B;  5EKL A;  5IYC G;  3HOV B;  3N6R A;  3LNN A;  2R61 A;  2C35 B;  3E6Z X;  3HOU B;  2MP1 A;  4L5T A;  4LW1 A;  1JQY D;  1PFN A;  2AWN A;  2E75 C;  4BBR G;  4X66 L;  1BCP C;  1A6X A;  1K83 H;  2DNC A;  4GOP A;  2N8N A;  1X32 A;  3GTO H;  5M3F B;  1GJX A;  3NTI A;  1D6E C;  2UUA L;  1L0W A;  5LL6 S;  1D5Z C;  2GA4 B;  1B8A A;  2K5Q A;  3D0F A;  3A54 A;  4R9W A;  2R92 H;  1VQO A;  2RDH A;  5C44 G;  4K8J A;  1DM0 B;  3OIP A;  4LMQ D;  4DV2 Q;  1L2F A;  3KLS X;  4PMW A;  3J80 c;  5M5X H;  5M5Y H;  1HPC A;  3AQQ A;  1LT4 D;  2F0J A;  1Z7T A;  2L12 A;  2R6G A;  1QCB D;  1HA6 A;  1VQG A;  1Y1V B;  3BS1 A;  3S1N B;  3J7A F;  2JSO A;  4DV7 Q;  1HNW L;  4Q5V A;  1I94 L;  3IAY A;  4M8A A;  4OO1 G;  4BBS H;  4DR5 L;  4FYD A;  3PO2 H;  4IFD J;  3TS2 A;  1PTO H;  3G71 A;  1EEI D;  1KL9 A;  4A3F B;  2HIV A;  5M5W B;  1TR5 A;  2DJF C;  1PRT B;  5FJ8 G;  2WKC A;  3M3Y B;  2IW3 A;  3SR1 A;  1YHQ A;  3GTQ B;  4PQX A;  4X65 L;  1R4Q B;  3DUZ A;  1KRT A;  4ILW A;  5JEA J;  1A2T A;  1VQ9 A;  4A76 A;  3ERQ A;  3L7Z C;  2CWP A;  1U5K A;  2PQA A;  3HKZ E;  4PG3 A;  3TN2 A;  1OXU A;  3Q8D A;  2ZJP A;  4ZUI A;  1GKH A;  3PQI A;  1V9P A;  4LF8 Q;  1IYV A;  1EQR A;  1AP0 A;  2RHS B;  3QR8 A;  2CVR A;  4EQP A;  2PMZ B;  5J3B A;  1LTA D;  1NMG A;  4LUV A;  5CV9 A;  3F2C A;  3R2T A;  1O7L A;  2B2U A;  4RCN A;  3PUV A;  4DR1 L;  5KEE A;  1SYB A;  1KDA A;  3N52 A;  2JA5 B;  2A68 D;  1IL8 A;  3GP7 A;  1JE4 A;  1HFN A;  2WV6 D;  2NVQ B;  2VS1 A;  1UEA B;  4G7H C;  4AYB E;  2QKI C;  5C3W A;  4O42 A;  3PIP A;  3OYY A;  2B63 G;  1B3Q A;  1PH2 A;  1G2S A;  1KNE A;  1HNX L;  4O2D A;  1VQK A;  1WD1 A;  3I7F A;  3S2H H;  1IZ6 A;  5C4X H;  3KF8 A;  3HZX A;  4CDF C;  3R2I A;  2BA0 A;  4OWT B;  1EY8 A;  2HT1 A;  3CC4 A;  2OQK A;  5C0X G;  1MJE A;  4QUF A;  1ASY A;  3I4L A;  2QEX A;  2NN6 H;  5NUC A;  2R7Z G;  3Q22 A;  1TWC H;  1PH1 A;  4BS9 A;  1STH A;  3CPW A;  1VQN A;  4K0K L;  4BY1 H;  2Z9H A;  4DUZ L;  4K8I A;  3GTJ B;  4B3M Q;  4JI7 Q;  5LMN W;  3STB D;  4HJA A;  2L11 A;  3GTL H;  1LM0 A;  5EQ0 A;  5C3E B;  1P8L A;  4V0B A;  1X65 A;  2I5M X;  2LY7 A;  1JOR A;  1KNA A;  3S14 H;  2YTV A;  4YY3 L;  3S16 H;  1VQJ A;  1JB7 A;  4LWC A;  1SNP A;  1TKW B;  5JPM C;  1F2Y A;  4A3G B;  1AE3 A;  4GKJ Q;  5I4D A;  1HZA A;  2N3S A;  4V19 0;  1I6H B;  1AE2 A;  1YNX A;  2EYL A;  5IYD G;  1EZ8 A;  1MI2 A;  2AMC B;  2F0K A;  3JC6 6;  3MWY W;  3PMF A;  4X64 Q;  5D14 A;  1TII D;  4DV5 Q;  2K50 A;  4A3M G;  4DV4 L;  3CCU A;  1V1Q A;  3GTK B;  3GTM B;  3I4N B;  5CV7 A;  1B70 B;  4B3T Q;  3CRL C;  4B9W A;  2F0N A;  2UUC Q;  1B9M A;  5C3X A;  3HOX G;  1AN8 A;  4IFD I;  2RCN A;  1MKH A;  4KV6 A;  1UUP A;  4C3J G;  1WTX A;  4QUC A;  1MGS A;  4AQY L;  4DR2 L;  2Q8T A;  2F0L A;  1CUK A;  1SMY D;  3Q23 A;  1WTQ A;  4LFA L;  3M4O B;  5IGE A;  3L0O A;  2V4D A;  1TS3 A;  2KUM A;  2VQF Q;  2PZW A;  3TRE A;  1A3T A;  1BF4 A;  1PVO A;  1G51 A;  1K3R A;  4FF1 A;  3PO3 G;  3EIV A;  1GM5 A;  2ZXO A;  3FPP A;  1JR0 D;  1IKM A;  2BOS A;  1W6K A;  1SEB D;  2Z8L A;  4GOP C;  3L3O C;  3AMU A;  2A1A A;  3NE5 B;  1A63 A;  5AFW A;  2E74 C;  4DAY A;  2JYO A;  5DNF A;  2DY8 A;  5EPJ A;  1J8I A;  3HOW G;  4RGN A;  2NVY B;  1K8M A;  3D6C A;  3VR6 A;  1CQF A;  3SK8 A;  4GLX A;  3T1H L;  1NJI C;  4JI5 L;  4A3I B;  1K9M C;  1B2T A;  1Q46 A;  1X3G A;  1Q3L A;  3MXN B;  3K5O A;  2DUD A;  2ZM6 L;  5LMU Q;  2VUM H;  5COR A;  4GKK Q;  2GVB A;  3UE1 A;  1N34 Q;  3CW2 C;  1UNS A;  4R4O A;  1H9J A;  1A0I A;  5GRO A;  3WDN A;  4JV5 L;  4A3E H;  4HIO A;  3GQB A;  1RTO A;  3NHH A;  1A8V A;  2L9H A;  3HKZ G;  3T56 B;  1DCZ A;  4JW0 A;  3QIA A;  5IT9 c;  4FNF A;  2AUK A;  2EY1 A;  4MZ9 A;  1HTP A;  3NPP A;  2R93 H;  2F03 A;  1RJT A;  3S1Q B;  3MAQ A;  3A5U A;  3K7A H;  3CXC A;  2E2D C;  2FMC A;  1TXY A;  2ID0 A;  2ZTE A;  1BQQ T;  4P73 A;  4DV3 L;  1D8L A;  1TWF B;  3GO5 A;  5CMD A;  2PNR C;  2F0Q A;  1DD2 A;  1VQD A;  1WYD A;  3CMA A;  4RWS C;  2DJG C;  1EY0 A;  2B2U C;  4PZ6 A;  5G3L F;  5J22 A;  2IX3 A;  5FKA C;  4AYB G;  4X3U A;  2IPK D;  5C5L A;  2R92 G;  1K8G A;  2JA7 B;  2JA6 H;  5C44 H;  3K5L A;  2B29 A;  2F0T A;  3ULL A;  3T1Y Q;  2FFK B;  4LF7 L;  2K5N A;  2E2J H;  4P74 A;  3E0E A;  3ND8 A;  1VF7 A;  1UAP A;  2B8F A;  4BBS G;  1IBM Q;  2R3Z A;  4DR4 L;  1TVX A;  2WB1 B;  2K33 A;  3PO2 G;  4R4I A;  1LLR D;  1L0Y B;  1ASZ A;  3FKI B;  1UE5 A;  2SEB D;  4XQJ A;  4MTN A;  1EY5 A;  2B2V A;  3KF6 A;  1HZC A;  2EYH A;  2F0W A;  1C8C A;  1V1P B;  4DR7 Q;  3NUC A;  5FJ8 H;  2RA4 A;  4OON A;  1YVC A;  2CWA A;  4XYO A;  4HIK A;  1C9O A;  2NWG A;  4EX5 A;  4CBV A;  4IUT A;  2L55 A;  3HOY H;  1RCV D;  4TSS A;  1FJG L;  4XDX A;  1KHI A;  1VQ4 A;  4QIW E;  4LK1 C;  4PMC A;  3RNU A;  4ZKC B;  1HQM C;  4DUY L;  2I0Q A;  1PH4 A;  5CV6 A;  1FD7 D;  2E2H B;  4RGM A;  2CH4 W;  2Z6K A;  1EOT A;  4FDB A;  3OPO A;  3VDY A;  1SE2 A;  1STB A;  4OEM B;  4L5R C;  4NXM L;  1Z9F A;  1QNK A;  4YWL A;  1PH7 A;  1TS4 A;  1TWA B;  5GAE C;  2PYK A;  4JPB W;  1CKM A;  3TP7 A;  1TT2 A;  5CR3 A;  3S2D H;  2WP8 J;  3NTK A;  1F9Q A;  1PTO C;  1OXT A;  2HCI A;  2IHF A;  4GN4 B;  5FK9 C;  3SXH A;  4G7Z C;  4NPS A;  1HJP A;  1G6Z A;  2A74 C;  2KCM A;  4FVM A;  1C4Q A;  5C4X G;  1JC7 A;  2NVT B;  1EY7 A;  2VL6 A;  2B2Y A;  2SOB A;  1WTO A;  2A6E D;  2EE1 A;  3RN5 A;  1W2B A;  4YCU A;  4ZRZ A;  4JI8 L;  2KHI A;  3J80 L;  3OTO Q;  1HNZ L;  3FEW X;  1EFI D;  1G29 1;  1Y1W H;  2Q2I A;  1CKN A;  4I7Z C;  3GTP H;  1DOK A;  2UXD Q;  3A7A B;  2OCE A;  4A4I A;  2NN6 G;  2EYJ A;  4DV0 Q;  1NR2 A;  3U50 C;  1HR0 Q;  1S72 A;  1IBL Q;  3BDO A;  3K0X A;  1FGU A;  3PF5 A;  5EBD A;  1ZEQ X;  3KJP A;  4BY1 G;  4LUO A;  2J7Z A;  2K7V A;  1Q1E A;  3RMH A;  4HCS A;  5FO9 B;  2M00 A;  5CV5 A;  1PYW D;  1E22 A;  4HSV A;  2JP1 A;  3KDF B;  3CU7 A;  1SNO A;  3K5M A;  4KJO A;  1I4X A;  5BN4 A;  1SYF A;  2QCP X;  4R1J A;  1EYC A;  2XWJ B;  4WJW A;  1GXD C;  1XNR Q;  2X6G A;  3MHB A;  5EAY A;  4DR6 Q;  1I3Q B;  1VQ7 A;  4CGY B;  1VF5 C;  1OXX K;  2KCC A;  4IZ8 A;  4LF6 Q;  2PI2 E;  1Y14 B;  2Q2T A;  2ATW A;  2B39 A;  1SXT A;  1SNC A;  4KK7 A;  1VMC A;  1AFP A;  1EOV A;  4H44 C;  3S1R H;  2C5C A;  5DM7 3;  5HGQ A;  3IKJ A;  2UUB Q;  4WFN 3;  2KA7 A;  5M3M H;  2KBN A;  1EYA A;  2R7D A;  5IGF A;  3I4M B;  5ELO A;  1YNN C;  1G6P A;  1GUT A;  3CCL A;  1ILQ A;  2M2L A;  3UDG A;  2YV5 A;  1VQ8 A;  4A93 B;  1EY9 A;  2F0F A;  2Q2H A;  1HQR D;  1FVI A;  1U0L A;  1PRT D;  3BJU A;  2EYM A;  2K32 A;  2MJ8 A;  4K2L A;  2OTJ A;  3NBH B;  1OXS C;  2K52 A;  1HHV A;  2A6H C;  3KLW A;  1JB3 A;  3CCJ A;  4IJH A;  1O7Z A;  4IUR A;  3VR2 A;  5LHY 1;  2A69 C;  1EU3 A;  3J81 i;  4DV6 L;  3S17 H;  1I50 B;  5CBA E;  4ME3 A;  4PV1 C;  3U58 A;  4KKS A;  5JJI A;  3UI2 A;  2PI2 A;  3CHB D;  2K4K A;  1ZXT A;  4KD4 A;  3TSS A;  3EA6 A;  2PPB C;  1WTP A;  3SDZ A;  1PFS A;  3G6E A;  3MXP A;  1CM9 A;  2XRS D;  1K73 C;  1S5F D;  4KTA A;  3CQZ H;  1O7Y A;  1Q86 C;  1CT1 D;  2OXP A;  2CKZ B;  1HNW Q;  2EY5 A;  5E1F A;  3AEV A;  5M3F H;  1CTM A;  2UXC Q;  3OMG A;  3KOJ A;  4MIU A;  3SK6 A;  4P75 A;  4KHP L;  4JI0 Q;  1E1T A;  1QUQ A;  3IFD A;  5C4J B;  1BNZ A;  4DXF A;  2JA9 A;  3I3C A;  4J1M A;  4QGU A;  1ONL A;  5IY0 A;  4Y7N B;  3K7U C;  2VUM G;  1EFW A;  4X65 Q;  1EIF A;  3EFX D;  3A56 A;  4MNO A;  1Y1V H;  3S1N H;  2CH4 A;  4A3E G;  2B2V C;  4C56 C;  3S24 A;  1WD0 A;  1P16 A;  5I9O A;  5CYU A;  2PZU A;  4HN7 A;  1N32 Q;  3B6Y A;  3C1E A;  2CW0 D;  1WTR A;  3C46 A;  4EQO A;  2KOL A;  2F3W A;  5KIX A;  3HOX B;  2UU9 L;  1JIC A;  1DYQ A;  2MQH A;  4QQB X;  2R93 G;  1A15 A;  4KLK A;  4KN7 C;  1H9S A;  2EXZ A;  2HDL A;  1EY6 A;  4JBM A;  2I5H A;  3F2U A;  3SGI A;  3H3V H;  4YWM A;  3BZD B;  3KJO A;  2HIX A;  4RKL A;  3K57 A;  2PW5 A;  1PH5 A;  4IAL A;  1U4P A;  2NB0 A;  1Z47 A;  2P5Z X;  2E5L L;  3W5O A;  2Z6K C;  3BVZ A;  3P20 A;  2JXM B;  4YCV A;  1HXY D;  1HA5 A;  1II3 A;  4RGT A;  2PW7 A;  4OHJ A;  2JA6 G;  2K03 A;  1ICW A;  2K04 A;  1S5E D;  1V43 A;  2CQO A;  4DFA A;  4IOA A;  1HNX Q;  2J0T D;  3QJY A;  4JI6 L;  2ZXP A;  2QDB A;  3PIO A;  1EWH A;  5JVG 3;  5C4Z A;  3E9H A;  4DR3 Q;  3DMU A;  5F2D A;  3HOW B;  1EWC A;  3NXW A;  1QVG A;  2JA5 H;  2O5I C;  1VS0 A;  3HGB A;  2Z4I A;  4A3B B;  1BXT A;  1EZ6 A;  3D8G A;  1TU2 B;  4GN5 A;  4BWG B;  3D4R A;  4ZYS A;  1IW7 C;  2I07 B;  2IX0 A;  4UDU C;  2QA4 A;  2B2Y C;  5EPL A;  5FLM H;  3J81 c;  3SVM A;  3C1F A;  2B3G A;  5FLX c;  2KHJ A;  1BBU A;  1I4P A;  4JYA L;  4F87 A;  2CHB D;  2XNA C;  2X69 A;  2RVL A;  4JBW A;  4O1N A;  4XQN A;  1T5E A;  3IRB A;  4L63 B;  1Z6H A;  2EYF A;  3HOY G;  4S3S A;  3KF8 B;  1QOH A;  1KXL A;  2XSC A;  4UAI A;  1TWG H;  2L15 A;  1KLG D;  2MUY A;  3V2T A;  1YEZ A;  3AB9 A;  4LF5 Q;  5DAU A;  2SNS A;  4IQZ A;  1DGS A;  1SYD A;  3UE0 A;  3GD7 A;  5T1G A;  4KJN A;  1H9R A;  3O13 A;  4X62 Q;  4PZ7 A;  1K83 B;  1IL2 A;  1KTK A;  4JVZ A;  1VQI A;  1UE6 A;  4C3I B;  2K1B A;  4DV4 Q;  4IPG A;  1O78 A;  3JAM L;  4IUN A;  1C0A A;  3H6M A;  4FXG C;  2F0G A;  1HR0 W;  5TSS A;  3I2Z A;  3FVQ A;  3E5S A;  2R92 B;  3OWF A;  1CHQ D;  5AJ3 L;  1MBY A;  5ELN A;  1XNQ L;  3IL8 A;  4XIG S;  2N55 A;  4HSP A;  1PFM A;  2RHQ B;  4CHT B;  1WVL A;  4XT3 B;  5M5X B;  1WCM B;  3K59 A;  5M5Y B;  5KNC A;  1YJN A;  1WTW A;  3NP8 A;  4KI0 A;  3TQY A;  4POG A;  2AQ3 B;  3T4A C;  2MHV A;  1X6O A;  1GHK A;  1I5F A;  3J81 E;  1S5C D;  2ES2 A;  1IBK Q;  2FJ2 A;  3GTM H;  4TKO B;  1Y1W G;  3I4N H;  5FLX E;  5C0X J;  2QIL A;  4LF9 L;  1F77 A;  2RBM A;  4DNT B;  2F4I A;  5C5M A;  4JI4 Q;  3UDI A;  3DWA A;  2B8G A;  1SYG A;  5J39 A;  1E7Z A;  1OO9 B;  2ALY B;  2MFI A;  4RA8 A;  3S9W A;  4A3D B;  4X6A H;  4HTH A;  3KYH C;  1SFO H;  2DNE A;  3BVM A;  4DV7 L;  4J8Q A;  1SRU A;  3OWE B;  1XMO Q;  3T1H Q;  1HFG A;  4DK1 A;  1XJV A;  3VYU A;  1D5X C;  1YNJ D;  2FIN B;  2HD3 A;  1FL0 A;  1RL2 A;  2ASB A;  3OSO A;  1HH2 P;  1LUZ A;  3VR3 A;  2ZM6 Q;  1T9H A;  1VMP A;  3CKI B;  2Y0S B;  4K5V A;  1Q1B A;  4YHH L;  3EVQ A;  1F2Z A;  3ND9 A;  1BCP D;  4XTC S;  2NZ1 D;  4JV5 Q;  5M3M G;  2A73 B;  4WJ4 A;  4LF8 L;  5DEH A;  3FHW A;  4I65 A;  3MEH A;  5I9P A;  1B53 A;  4A3I H;  1CHP D;  2N78 A;  5FO7 B;  4CKE A;  3ULP A;  2YU9 B;  5ELF A;  4GNX A;  4A3K B;  1EL0 A;  1AZQ A;  3ZYY X;  3TP5 A;  1LT3 D;  2G9D A;  5C4X B;  1N33 L;  1RIP A;  2WAC A;  4N9P A;  1KDC A;  4RH6 A;  1LT6 D;  1MHW C;  3K80 C;  4ZLT F;  1K28 A;  2ZT9 C;  1WJJ A;  1XPO A;  1RF2 D;  1SNM A;  1E24 A;  1J5E L;  4L8J A;  5M9O A;  1GUG A;  1NMF A;  5T1I A;  4OX9 L;  3I55 A;  3HOV G;  3M4Y A;  3I56 A;  5JOB A;  3BG3 A;  1TQO A;  4LFB Q;  4CDD C;  3TS0 A;  4G7O C;  1N36 Q;  1RKN A;  4ZUJ A;  2VW9 A;  4LF4 L;  2GVA A;  2CQA A;  1EEF D;  2ENB A;  2F1M A;  4ZK9 B;  3PIO 3;  3GTL B;  2XVS A;  1C48 A;  1NUC A;  5M3F G;  4JCV E;  1STA A;  1BKB A;  3CME A;  1CKO A;  5IGB A;  3HOZ B;  4HCE A;  2QDL A;  4BA2 I;  2ZXR A;  3S16 B;  4DNR B;  3DEO A;  4O0A A;  4RKB A;  3CC7 A;  4KN4 C;  3D4W A;  2J4X A;  3OOC A;  3QG1 A;  4TVA B;  4B3M L;  3C2P A;  1EY4 A;  1PRT F;  4JI7 L;  2L0C A;  3BDC A;  3SK5 A;  1Y1V G;  2ZJQ A;  5CGK A;  1SN8 A;  4R4T A;  3AYH B;  3ITP A;  2PO4 A;  3MZ5 A;  2L1B A;  1FNV A;  4HED A;  1TS2 A;  2KEN A;  1FJG Q;  3NBI A;  4K14 A;  1FNW A;  1XMQ Q;  3J7A V;  3D4D A;  2E2I B;  4HAE A;  3FKI H;  3PGZ A;  3SK4 A;  5C0X I;  4A3F G;  1AH9 A;  4GKJ L;  1X54 A;  4UP8 A;  5DM6 3;  5A2Q L;  4DV5 L;  1RD9 D;  5D3D A;  1PV4 A;  3GTG H;  2EOT A;  4C3H B;  1EWI A;  2WII B;  1ET6 A;  3MFG A;  3MFY A;  1A3V A;  3NEM A;  4FF2 A;  2C9O A;  4DPG A;  4P2C B;  3C3L A;  4C1N I;  2UUC L;  1K8A C;  1XX8 A;  2D0O A;  2RSO A;  4H0L C;  3T53 B;  1YI2 A;  3G4S A;  1VQ6 A;  3M7N A;  3I4O A;  3H0G H;  2K5D A;  3DM1 A;  3MC0 B;  4H02 A;  1G91 A;  2JJQ A;  3FPU B;  3LGJ A;  1UE1 A;  1L1O A;  1BCP B;  3IFT A;  4DK0 A;  1J9O A;  2JA5 G;  3A0J A;  1W6J A;  4A3J B;  4DAP A;  2ZJR A;  1SMX A;  1SR3 A;  3HEJ A;  2F0P A;  2WIN B;  1YJW A;  3D6W A;  2KEE A;  3KUP A;  2CFM A;  5BR8 Q;  5FLM G;  5CV8 A;  1VQP A;  1BBW A;  1SYC A;  1U4M A;  5EPK A;  3HRZ C;  2ZTD A;  4OIK A;  1DZ1 A;  1PRT C;  2KCT A;  4LNQ A;  1SRO A;  1TS5 A;  2VUM B;  2MPM A;  2VXW A;  1KQS A;  2LXJ A;  4NB3 A;  2F0D A;  3QB3 A;  3VYT A;  3H3V C;  2D5D A;  1SE8 A;  1SBB B;  1LTR D;  2K75 A;  1K8O A;  4JC0 A;  2ZTC A;  2FMM A;  1JJC B;  4KHV A;  5H1S E;  4BY7 B;  1CSQ A;  3TDQ A;  3M85 A;  2WB1 E;  3PUX A;  2VQE L;  1JJ2 A;  4KMU C;  1STG A;  2D0P A;  1XXG A;  5K36 H;  4GZY C;  2HHH Q;  4IFD H;  1ENC A;  2K5W A;  4CJ2 C;  5BN5 A;  4LJZ C;  2MO0 A;  4KY6 A;  2KED A;  2R93 B;  4EGV A;  3K7A B;  3T16 A;  3OW2 A;  4GKK L;  1N34 L;  3WOE A;  3WOF A;  4L5S A;  1E2W A;  4ALP A;  2BH2 A;  3F1Z A;  1GO3 E;  1NBW A;  3A55 A;  3R93 A;  5JEA H;  2YTY A;  2VB3 X;  4BBR B;  4RFB A;  1SDF A;  1BUV T;  5I6Y A;  4HJ5 A;  1KD1 C;  1TWH B;  1EQV A;  5JPN C;  2BE5 C;  4NXN L;  3T51 B;  2EIF A;  5IWA Q;  4A3L G;  2ICI A;  2JA6 B;  3KLS A;  5C44 B;  3CP0 A;  3NQT A;  2OTL A;  2OT2 A;  3RZD H;  5JJL A;  4POF A;  3K81 C;  3AU7 A;  2QGQ A;  5EKK A;  4GNX C;  1DON A;  3I8Z A;  5IGG A;  2H5X A;  1ML0 D;  2R7F A;  2UXB L;  1ESR A;  3I4N G;  2O4X A;  4P72 A;  3NEN A;  1ILP A;  3I4M H;  1V1P A;  2JK8 A;  4DV6 Q;  2JA8 H;  5JAV A;  1VQA A;  1J6Q A;  5KYL A;  4A93 H;  1PHJ A;  3FMC A;  1W3S A;  4HR7 B;  1LTS D;  3NWT A;  5E7N A;  4RHR A;  4L6T B;  2NUC A;  4JI3 Q;  1VQE A;  2N88 A;  4F8M A;  1NE3 A;  1H9M A;  1NR4 A;  4R4Q A;  4RMF A;  2TMP A;  1IBM L;  1HZB A;  1A2U A;  5IGD A;  3M7G A;  3MA2 B;  3RLO A;  4J15 A;  1BOS A;  5I6W A;  1KC8 C;  1U9R A;  2D2C C;  1YHB A;  3L2P A;  3RLF A;  4DV1 L;  3A74 A;  5IOD A;  4DR7 L;  1M90 C;  4R4C A;  1UWV A;  1PXU A;  4HID A;  1D7Q A;  2EJF C;  1NAP A;  1EYG A;  3Q6S A;  3RR5 A;  2F4V Q;  1QIL A;  1U4L A;  1YHA A;  2AWO A;  1Q7Y C;  1ET9 A;  4IPD A;  2KQ3 A;  3MXG A;  2K28 A;  2X6L A;  5JJK A;  2NVX B;  4A3I G;  3S2D B;  4MN3 A;  1YIJ A;  3PF4 A;  3EQL C;  2NBF A;  3OMC A;  2WKD A;  3P75 A;  2UU9 Q;  2JEA I;  1VQL A;  2B63 B;  1B1Z A;  3UDF A;  1PA6 A;  1TY2 A;  4RHS A;  1WFQ A;  4FXK C;  4IN3 A;  3OW7 A;  5KRU A;  1I4R A;  1X3Q A;  3S1M H;  2KJX A;  1GUN A;  4C2M H;  3EN2 A;  4X66 Q;  1F9R A;  2AUJ D;  2HDM A;  4TRD A;  3S15 H;  1Y1W B;  2DGY A;  2E5L Q;  3RZO B;  1VQF A;  3GTP B;  3GV3 A;  2JEB I;  2B2T C;  5JVH 3;  2UUA Q;  4MTK A;  3M9B A;  3K5N A;  3KFU A;  3J80 i;  2AQ2 B;  2K01 A;  3HOV H;  2LFN A;  1NNX A;  2R7Z B;  2F0V A;  3KDF A;  3HOU H;  3MEF A;  2WAQ E;  1A3U A;  4WJ3 M;  5C6A A;  5CV4 A;  1H9S B;  4L5Q A;  2A68 C;  2Z0S A;  1BCP F;  1IYU A;  2Q8R E;  1S5B D;  1EIG A;  1X55 A;  4APV A;  2BA1 A;  1I94 Q;  4J6H A;  1L1O C;  2I5L X;  2VY3 A;  1KLU D;  3ULJ A;  1QE6 A;  1YIT A;  2UXD L;  1JWU D;  2V1C C;  4DV0 L;  4DR5 Q;  1X3P A;  4NW2 A;  4GOP B;  1HR0 L;  2K5H A;  2L5T A;  1BR9 A;  1IBL L;  5I2X A;  3PUZ A;  1K0R A;  1EU4 A;  1QVC A;  3GV6 A;  2IY5 B;  4KD3 A;  4ZQ3 A;  5FO8 B;  4JYA Q;  2M9V A;  1U4R A;  4NKL A;  3KK7 A;  1ZYR D;  4A3B H;  5M3M B;  1R9T B;  4A3M B;  1RTN A;  2WB1 G;  1SSO A;  4ID6 A;  4RG1 A;  3TP6 A;  2KHS A;  1PLF A;  4GLA C;  2LS0 1;  3FKI G;  1GHJ A;  4A3C H;  1NTG A;  1PTO D;  3TRZ A;  1EQQ A;  4BA1 I;  4LF6 L;  2KVM A;  4IUQ A;  5M5W H;  4A3F H;  3Q0A A;  1V1O A;  1EUJ A;  2NN6 I;  3SEB A;  4C3J B;  1LAC A;  2CCZ A;  3M3Y H;  1N8R C;  2F0U A;  4N9T A;  5LL6 X;  3GTQ H;  4JI2 L;  4QCL A;  3I91 A;  4BXX H;  4JOI A;  4N8F A;  4DR1 Q;  2UUB L;  3STB C;  3VA7 A;  1A62 A;  4QF4 A;  1SLJ A;  2EDG A;  4QJF A;  5LMN L;  3A8I E;  4JI1 L;  3CCE A;  3CCM A;  3TME A;  2HUG A;  1VQ5 A;  3PO3 B;  4IJL A;  2PQA B;  1YZ6 A;  1YNJ C;  1L0X B;  2BCO A;  5AJ3 Q;  4IOC A;  3H0G G;  2SNM A;  1ESF A;  1XNQ Q;  3DHQ A;  3DM3 A;  1F9S A;  1GVP A;  4GLV B;  4HJ9 A;  5IYB H;  1Q8K A;  1D1K A;  3CQZ B;  3KBX A;  3ZJY C;  1GUS A;  4DF7 A;  4ULL A;  4C3I H;  5ELD A;  1SNQ A;  3P7J A;  1PZJ D;  2NVQ H;  2Z4H A;  4NP5 A;  4Q0F A;  3LWU A;  1BDO A;  4QMG A;  1S40 A;  4RCO A;  4B3R L;  1B3A A;  3TP8 A;  4LF9 Q;  4B3S L;  1FR3 A;  2DN8 A;  3R3O A;  2KEC A;  1CSP A;  2F0S A;  3HG9 A;  2QF7 A;  1WCM H;  1XTC D;  4DGZ A;  4R8I A;  4UP7 A;  1SMY C;  4K0K Q;  1CZG A;  3VYR A;  4DUZ Q;  3G48 A;  2F0I A;  4JBJ A;  2YTX A;  2E8G A;  5E3F A;  4ZCK A;  2UXC L;  2XIW A;  4DA2 A;  5ELE A;  1EIH A;  4IPC A;  3HKZ B;  5K36 G;  1LTT D;  1F2M A;  5ELC A;  4X3S A;  1SAP A;  3SE0 A;  3U4Z A;  3CCQ A;  4JI0 L;  1YNN D;  4OWW B;  4IFD G;  4MHE A;  2XRQ D;  4YY3 Q;  3FP9 A;  3L9A X;  1LAB A;  2RQX A;  5IP9 H;  3D3R A;  4UY8 C;  3RD4 A;  1FGB D;  2MGS A;  4A3D H;  5IT9 L;  4EQ5 A;  4WRD A;  1I6V C;  3DWP A;  4KY7 A;  5JEA G;  4YHH Q;  1YBY A;  3X3N A;  3GTJ H;  1SE3 A;  4WOR A;  1Q90 A;  2O2L D;  2RDF A;  1STE A;  4GN3 B;  2A6H D;  2PQE A;  4DAM A;  4HIM A;  1N32 L;  3GTO B;  4LFC L;  1BO0 A;  2A69 D;  5C3E H;  1QZH A;  1AZP A;  4A3L H;  3TEH B;  4EQN A;  4AYB B;  2PMZ E;  1H9K A;  2HQL A;  1VQM A;  3BYT B;  3J7Z C;  5A35 A;  3BU2 A;  2BH8 A;  1WTH A;  1Y8N B;  1Q82 C;  2EQS A;  4A3G H;  1VQB A;  3PUY A;  1FYC A;  3I73 A;  4AQY Q;  2B2W A;  1I6H H;  3E0J A;  4DR2 Q;  4PNY A;  4ZAI A;  1N33 Q;  3VYS A;  2EYO A;  4K6L A;  4LFA Q;  5K5P A;  1GUW A;  1QJO A;  2FHT A;  1DOM A;  1Q12 A;  1QZG A;  4LAA A;  1UE7 A;  3GTK H;  1GOZ A;  4BBS B;  2PNH A;  3I4M G;  3J80 E;  1J5E Q;  2JA8 G;  3PO2 B;  3HS0 C;  4DN4 M;  1PTO B;  3V96 A;  4OX9 Q;  4A93 G;  1KDB A;  3PUW A;  2QW7 A;  2YU9 H;  4A3K H;  1HCZ A;  4DV2 L;  5ISR A;  2IWH A;  4DR3 L;  3I90 A;  4LF4 Q;  1QB5 D;  2O5J C;  1WTV A;  4GNX B;  4B08 A;  3M4O H;  4AIM A;  1UEB A;  1D1I A;  1PZK D;  2WAQ G;  3UDX A;  2IX1 A;  2RKS A;  3NQI A;  1SJH D;  3VA5 A;  1Q81 C;  1VDZ A;  1TWG B;  1HTL D;  1XTD A;  4JI5 Q;  1JOO A;  3F8T A;  1X9N A;  1PFB A;  4RGO S;  4M1U B;  3U4V A;  4HJ7 A;  2IT1 A;  2XTI A;  3VR4 A;  1EYD A;  4QL5 A;  1TY0 A;  4F88 A;  3H09 A;  5EJW A;  2XGT A;  2PCF B;  1X56 A;  1OTC A;  1GUO A;  2IJ0 A;  4DAY B;  2BDN A;  2NVY H;  1IXR A;  3VR5 A;  3HOZ H;  1JJG A;  4DKA C;  5KGU A;  4LF5 L;  3D31 A;  3G7L A;  4HMJ A;  1SE4 A;  4OO1 I;  4NDX A;  2VNU D;  4AH6 A;  5HGT A;  5IE8 A;  3JAM i;  1AEX A;  1AW7 A;  2EJM A;  3A8J E;  2Y0S E;  3HKS A;  3E9I A;  4X62 L;  1PH8 A;  3S2H B;  2MO1 A;  1VQH A;  4DV3 Q;  3H91 A;  1LT5 D;  3CCV A;  4Y52 H;  4PZ8 A;  1IHZ A;  1VQC A;  1MD2 D;  2DY7 A;  5KNB A;  3F2D A;  3CAM A;  1IW7 D;  2EYP A;  2F52 A;  2N49 A;  1CA6 A;  1M8A A;  3EBE A;  5GQO A;  4JOI C;  5I2Y A;  4HJ8 A;  2E2I H;  2NZO A;  1TWC B;  4JBK A;  1DXM A;  1LO5 D;  4CJ1 B;  1Q8I A;  3S1Q H;  1DJR D;  2G5D A;  3HOU G;  1MSG A;  4BY1 B;  1SFO B;  1TWF H;  4C3H H;  4LF7 Q;  3BYY B;  3SHL A;  4KKU A;  4LUZ A;  3W1G A;  1E2V A;  1F2L A;  3F2B A;  1IBK L;  4DXG A;  1CI3 M;  2F3V A;  4FP5 D;  4GS3 A;  4EVO A;  4XQQ A;  1CFM A;  4DR4 Q;  5IP7 H;  3S14 B;  1PH3 A;  4RAU C;  4JI4 L;  3MTS A;  4K5X A;  1D5M C;  1B4O A;  2JA7 H;  3KLR A;  2SDF A;  1KRS A;  2IL8 A;  3KBG A;  2XWB B;  3W1B A;  2OWO A;  1DOL A;  1X3F A;  5HUR A;  2ICE C;  1MIU A;  4DK3 C;  2A6E C;  4A3B G;  1EQT A;  4A3J H;  1YJ9 A;  1XMO L;  1XPR A;  1L1O B;  2VQE Q;  1NSN S;  3QOJ A;  4UP9 A;  1MJC A;  1LYL A;  4KKT A;  3A5Z B;  4A3C G;  2F0O A;  3CF5 A;  1HUN A;  2RDG A;  1LTI D;  1QG7 A;  4IUV A;  1ICF B; 
#chains in the Genus database with same CATH homology
 2BA0 A;  4DUY Q;  4OWT B;  3PSI A;  5E7N A;  2LXK A;  4X64 L;  4BXX G;  2HT1 A;  3CC4 A;  3CCR A;  2UU9 L;  2MQH A;  2OQK A;  3KF6 B;  5C0X G;  4JI3 Q;  4QQB X;  4BY7 H;  2R93 G;  1MJE A;  4KLK A;  1VQE A;  1ASY A;  4NXM Q;  4NXN Q;  1NE3 A;  2QEX A;  4JBM A;  2I5H A;  3GDE A;  2R7Z G;  3SGI A;  3H3V H;  1TWC H;  4B3T L;  4R4Q A;  4YWM A;  1PH1 A;  4RMF A;  3CPW A;  5IYC H;  1HZB A;  3KJO A;  1IBM L;  2HIX A;  1VQN A;  3RLO A;  4J15 A;  1PH5 A;  4K0K L;  4BY1 H;  1PH6 A;  4DUZ L;  1KC8 C;  1Z47 A;  4B3M Q;  1YHB A;  2E5L L;  4JI7 Q;  5LMN W;  1JE5 A;  3STB D;  3W5O A;  4HJA A;  3JAM c;  3L2P A;  2Z6K C;  3GTL H;  3RLF A;  4DV1 L;  3A74 A;  5IYB G;  2E2H H;  4IO9 A;  1M90 C;  4YCV A;  1LM0 A;  1UWV A;  4R4C A;  4BBR H;  4HID A;  1D7Q A;  2K14 A;  2VQF L;  1P8L A;  1KIX A;  1EYG A;  2JA6 G;  1TWH H;  1X65 A;  1HZ9 A;  2I5M X;  3RR5 A;  2F4V Q;  1V43 A;  3S14 H;  2CQO A;  2YTV A;  4YY3 L;  3S16 H;  1VQJ A;  1YHA A;  4JI8 Q;  1HNX Q;  4IOA A;  2AWO A;  1TWA H;  1Q7Y C;  1JB7 A;  4LWC A;  1HNZ Q;  4JI6 L;  3PIO A;  2UXB Q;  3E9H A;  4DR3 Q;  4IPD A;  1AE3 A;  1X3E A;  4GKJ Q;  5JJK A;  3TRZ A;  4LFB L;  1QVG A;  1HZA A;  2N3S A;  2JA5 H;  1VS0 A;  1AE2 A;  1YNX A;  5IYD G;  5GAH C;  4A3I G;  1N36 L;  2AMC B;  3JC6 6;  4GN5 A;  4X64 Q;  1YIJ A;  3PF4 A;  4DV5 Q;  1WCM G;  2EXD A;  2UU9 Q;  2JEA I;  1VQL A;  1JT8 A;  2K50 A;  2IX0 A;  2K5V A;  4A3M G;  4DV4 L;  3UDF A;  2QA4 A;  1PA6 A;  3CCU A;  1V1Q A;  5GAG C;  1WFQ A;  5FLM H;  1E1O A;  2NVT H;  3S1M H;  3J81 c;  3RLN A;  1B70 B;  1C7Y A;  4B3T Q;  2OQ0 A;  3ER0 A;  2UUC Q;  2B3G A;  5FLX c;  5DLQ E;  3HOX G;  4C2M H;  2KHJ A;  1BBU A;  3EN2 A;  4JYA L;  4IFD I;  4X66 Q;  2RCN A;  1MKH A;  4JBW A;  1XPU A;  5HY6 A;  4A75 A;  4JV5 L;  4AQY L;  3S15 H;  2DGY A;  4DR2 L;  2E5L Q;  1VQF A;  1CUK A;  1PYS B;  2JEB I;  4QY7 A;  4DV1 Q;  2UUA Q;  3IRB A;  4LFA L;  5IP9 G;  3L0O A;  3HOY G;  3M9B A;  1CKN B;  4A3D G;  3KF8 B;  5LMU L;  3J80 i;  3KFU A;  2VQF Q;  3HOV H;  1KXL A;  1TWG H;  3TRE A;  2L15 A;  2IHE A;  1PVO A;  1G51 A;  1K3R A;  2GN5 A;  1YEZ A;  4LF5 Q;  3PO3 G;  3KDF A;  2RF4 A;  4TQU S;  3HOU H;  1DGS A;  3EIV A;  2WAQ E;  3GD7 A;  3MEF A;  3UE0 A;  1GM5 A;  4WJ3 M;  1XMQ L;  4L5Q A;  4GOP C;  5C3E G;  2Z0S A;  1WI5 A;  3CD6 A;  2A1A A;  4X62 Q;  1X55 A;  1A63 A;  4PZ7 A;  2BA1 A;  4APV A;  1I94 Q;  1IL2 A;  1YIT A;  1L1O C;  1I3Q H;  2I5L X;  2VY3 A;  3ULJ A;  2D62 A;  2MNA A;  2UXD L;  2JQO A;  2V1C C;  1VQI A;  1PH9 A;  1UE6 A;  4DV0 L;  4DR5 Q;  4DV4 Q;  4IPG A;  4GOP B;  4A3G G;  1HR0 L;  3HOW G;  2K5H A;  1IBL L;  1C0A A;  3PUZ A;  2Y0S G;  1K0R A;  1HR0 W;  1NY4 A;  3I2Z A;  2WFW A;  2YYZ A;  4IPH A;  1QVC A;  3DLL A;  2IY5 B;  5AJ3 L;  3T1H L;  4GLX A;  1NJI C;  5ELN A;  4JI5 L;  1XNQ L;  4JYA Q;  1K9M C;  4XIG S;  1S3O A;  2RHQ B;  1Q46 A;  1X3G A;  3MXN B;  2AHO B;  2NVX H;  2DUD A;  1YJN A;  4A3B H;  1QVF A;  1OXV A;  3J7A 5;  4KI0 A;  3TQY A;  2ZM6 L;  3ICE A;  4POG A;  2WB1 G;  5LMU Q;  2VUM H;  2B63 H;  1X6O A;  4RG1 A;  2GVB A;  3UE1 A;  4A3K G;  4GKK Q;  1N34 Q;  1I5F A;  3CW2 C;  2ES2 A;  1GD7 A;  2LSS A;  4R4O A;  4GLA C;  3FKI G;  3M4Q A;  4A3C H;  1IBK Q;  1NTG A;  1A0I A;  2NZH A;  5GRO A;  3T1Y L;  1Y1W G;  1EQQ A;  2Q2U A;  3GTM H;  4BA1 I;  5C0X J;  4A3E H;  4HIO A;  5M5W H;  4A3F H;  4LF6 L;  3I4N H;  1EUJ A;  2NN6 I;  1A8V A;  3HKZ G;  4LF9 L;  3H3V I;  4YWK A;  2F3I A;  2CCZ A;  3M3Y H;  1N8R C;  5IT9 c;  3GTQ H;  4JI4 Q;  1N9W A;  4JI2 L;  3UDI A;  4BXX H;  4JOI A;  1E7Z A;  2MFI A;  2ALY B;  4DR1 Q;  3STB C;  2AKW B;  4MZ9 A;  2UUB L;  3RZO H;  4X6A H;  5BR8 L;  1A62 A;  1SLJ A;  2R93 H;  3KYH C;  4QJF A;  5LMN L;  3CCE A;  4JI1 L;  1SFO H;  3CCM A;  1I50 H;  3A5U A;  3K7A H;  3CXC A;  4DV7 L;  4KHP Q;  1TXY A;  2ID0 A;  2ZTE A;  4P73 A;  1VQ5 A;  4DV3 L;  2R7Z H;  4IJL A;  1D8L A;  1SRU A;  3AFP A;  2PQA B;  1YZ6 A;  1XMO Q;  3GO5 A;  1EIY B;  5AJ3 Q;  3T1H Q;  4IOC A;  1VQD A;  3H0G G;  1XNQ Q;  1XJV A;  1WYD A;  3NEL A;  3CMA A;  3AFQ A;  3DM3 A;  4PZ6 A;  1FL0 A;  1RL2 A;  2ASB A;  1GVP A;  3M4P A;  4GLV B;  1B7Y B;  4HJ9 A;  1HH2 P;  1LUZ A;  4AYB G;  1Q8K A;  5IYB H;  3ZJY C;  2ZM6 Q;  3CCS A;  2HHH L;  3HOZ G;  1T9H A;  2R92 G;  1K8G A;  2JA6 H;  4C3I H;  4YHH L;  1Q1B A;  5C44 H;  2NVQ H;  4XTC S;  2B29 A;  3ULL A;  3T1Y Q;  5C4J H;  4JV5 Q;  3ERS X;  4LF7 L;  5M3M G;  1S40 A;  2K5N A;  4B3R L;  2E2J H;  4WJ4 A;  4P74 A;  4UPA A;  4LF8 L;  4LF9 Q;  3BZC A;  4B3S L;  4Y7N H;  3E0E A;  3FHW A;  1QUQ B;  4A3I H;  5IYD H;  1CSP A;  4JI2 Q;  2N78 A;  1PYB A;  1IYJ B;  4BBS G;  1WCM H;  1IBM Q;  3K8A A;  3ULP A;  4DR4 L;  4GNX A;  5IWA L;  3PO2 G;  4R4I A;  4UP7 A;  4A3M H;  1R9T H;  4DNI A;  4K0K Q;  5LMN Q;  4DUZ Q;  4JI1 Q;  1ASZ A;  3G48 A;  4JBJ A;  2YTX A;  1UE5 A;  2E8G A;  1JMC A;  4KHZ A;  1KAW A;  2UXC L;  4MTN A;  1N33 L;  3KF6 A;  1HZC A;  1RIP A;  4IPC A;  4DR7 Q;  3HOX H;  5K36 G;  5FJ8 H;  3K80 C;  3U4Z A;  4OWW B;  3CCQ A;  4IFD G;  4JI0 L;  1WJJ A;  4C3J H;  1XPO A;  4OON A;  2A8V A;  1YVC A;  2CWA A;  4HIK A;  4YY3 Q;  1E24 A;  1C9O A;  1J5E L;  3FP9 A;  4EX5 A;  3CC2 A;  4JI6 Q;  4OX9 L;  1NMF A;  5IP9 H;  3HOY H;  3I55 A;  4UY8 C;  3HOV G;  1FJG L;  4A3D H;  4EQ5 A;  3I56 A;  4LFB Q;  3OTO L;  1KHI A;  3TS0 A;  5JEA G;  4YHH Q;  1VQ4 A;  4QIW E;  1YBY A;  2VW9 A;  1N36 Q;  3GTJ H;  4LF4 L;  3PO3 H;  4GN3 B;  2GVA A;  3RNU A;  4DAM A;  4HIM A;  5IP7 G;  1N32 L;  3H15 A;  4LFC L;  4DUY L;  4B3R Q;  1E3P A;  2I0Q A;  1PH4 A;  5C3E H;  4B3S Q;  1QZH A;  4A3L H;  3TEH B;  2JA7 G;  4DK6 C;  2Z6K A;  2FXQ A;  5M3F G;  4JI3 L;  4OXP A;  2PMZ E;  4FDB A;  4JCV E;  1LTL A;  1BKB A;  1CKO A;  2HQL A;  4OWX B;  3CME A;  3VDY A;  3J7Z C;  1VQM A;  4L5R C;  4P71 A;  4NXM L;  3BU2 A;  4BA2 I;  1Z9F A;  1H95 A;  2BH8 A;  1Q82 C;  4YWL A;  1PH7 A;  3CPF A;  2EQS A;  4O0A A;  4A3G H;  5GAE C;  1VQB A;  3CC7 A;  3HOW H;  3PUY A;  4A3J G;  1CKM A;  4AQY Q;  1I6H H;  4DR2 Q;  2JE6 I;  1N33 Q;  3S2D H;  2WP8 J;  4TVA B;  4LFA Q;  3BZK A;  1OXT A;  2IHF A;  4GN4 B;  4B3M L;  1XNR L;  4JI7 L;  4DR6 L;  1Q12 A;  4NPS A;  1VCI A;  1QZG A;  1UE7 A;  1HJP A;  1Y1V G;  4JG2 A;  2KCM A;  2ZJQ A;  3GTK H;  2PNH A;  1SN8 A;  2A19 A;  4R4T A;  3AYH B;  4YCW A;  3I4M G;  1J5E Q;  2JA8 G;  3PCO B;  5C4X G;  1WOC A;  2VL6 A;  4OX9 Q;  4A93 G;  3PUW A;  2KEN A;  1O7I A;  1FJG Q;  3PV0 A;  2YU9 H;  2F4V L;  2VZA A;  1XMQ Q;  3RN5 A;  1W2B A;  4YCU A;  4A3K H;  1BVS A;  2KHI A;  4JI8 L;  3OTO Q;  3HFZ B;  4DV2 L;  1HNZ L;  1AH9 A;  3FKI H;  3PGZ A;  5C0X I;  4DR3 L;  4A3F G;  1G29 1;  4LF4 Q;  3J81 j;  1Y1W H;  4BY7 G;  2Q2I A;  1CKN A;  4GNX B;  1X54 A;  3GTP H;  4GKJ L;  4UP8 A;  1M1K C;  2UXD Q;  2OCE A;  3M4O H;  4A4I A;  2NN6 G;  1UEB A;  3UDX A;  2WAQ G;  3WWV A;  3U50 C;  4AIM A;  4DV0 Q;  4LFC Q;  2IX1 A;  5GAD C;  3RN2 A;  1HR0 Q;  4DV5 L;  1S72 A;  1IBL Q;  3GTG H;  5IYC G;  1PV4 A;  3K0X A;  1FGU A;  1EWI A;  1Q81 C;  3PF5 A;  3KJP A;  4BY1 G;  3NEM A;  4LUO A;  4DPG A;  1XTD A;  1Q1E A;  4JI5 Q;  2C35 B;  3F8T A;  1X9N A;  4L5T A;  2UUC L;  4LW1 A;  1E22 A;  1K8A C;  2AWN A;  3KDF B;  2D0O A;  4BBR G;  3U4V A;  4X66 L;  4HJ7 A;  1YI2 A;  4R1J A;  2IT1 A;  2XTI A;  1K83 H;  4QL5 A;  3G4S A;  2N8N A;  3I4O A;  3H0G H;  4GOP A;  1VQ6 A;  3M7N A;  1XNR Q;  3GTO H;  2XGT A;  4H02 A;  5EAY A;  4DR6 Q;  1VQ7 A;  1X56 A;  2JJQ A;  3LGJ A;  1OTC A;  1UE1 A;  2UUA L;  1L1O A;  1OXX K;  1L0W A;  4DAY B;  2NVY H;  1B8A A;  1IXR A;  4LF6 Q;  3D0F A;  2PI2 E;  3HOZ H;  2JA5 G;  1Y14 B;  2Q2T A;  2ATW A;  3A0J A;  2R92 H;  1VQO A;  5C44 G;  4DKA C;  1JJG A;  2ZJR A;  1SMX A;  1SR3 A;  4LF5 L;  3D31 A;  1EOV A;  1L2F A;  4DV2 Q;  4PMW A;  3S1R H;  4OO1 I;  3J80 c;  1YJW A;  5M5X H;  2VNU D;  4AH6 A;  5HGQ A;  5M5Y H;  5IE8 A;  2UUB Q;  3JAM i;  2CFM A;  3AQQ A;  2R6G A;  5BR8 Q;  5M3M H;  2Y0S E;  5FLM G;  2KBN A;  3HKS A;  1VQP A;  1BBW A;  1VQG A;  3E9I A;  4X62 L;  1PH8 A;  2MO1 A;  2R7D A;  4DV7 Q;  5ELO A;  1HNW L;  1I94 L;  2ZTD A;  1VQH A;  4DV3 Q;  1G6P A;  3CCL A;  2KCT A;  4LNQ A;  4OO1 G;  1SRO A;  2YV5 A;  3UDG A;  3CCV A;  1VQ8 A;  4BBS H;  4DR5 L;  1KQS A;  4Y52 H;  4PZ8 A;  2LXJ A;  4NB3 A;  3PO2 H;  1VQC A;  4IFD J;  3F2D A;  3TS2 A;  1SE8 A;  2Q2H A;  3CAM A;  4A93 H;  3G71 A;  1FVI A;  1U0L A;  2K75 A;  1KL9 A;  2F52 A;  4JC0 A;  2ZTC A;  2N49 A;  3BJU A;  2HIV A;  1JJC B;  5H1S E;  3EBE A;  1CSQ A;  2VQE L;  3M85 A;  2WB1 E;  3PUX A;  5GQO A;  1JJ2 A;  4JOI C;  5FJ8 G;  4HJ8 A;  2D0P A;  2E2I H;  2OTJ A;  3NBH B;  2NZO A;  1OXS C;  2K52 A;  1YHQ A;  2HHH Q;  4X65 L;  3KLW A;  3CCJ A;  4JBK A;  4IJH A;  1KRT A;  5JEA J;  1VQ9 A;  3S1Q H;  4A76 A;  3L7Z C;  2MO0 A;  2CWP A;  1U5K A;  2PQA A;  3HOU G;  3HKZ E;  4PG3 A;  4DV6 L;  3J81 i;  3S17 H;  1OXU A;  3Q8D A;  1TWF H;  4ME3 A;  4C3H H;  3OW2 A;  3U58 A;  4LF7 Q;  4GKK L;  5JJI A;  2ZJP A;  1N34 L;  1GKH A;  2PI2 A;  3W1G A;  2K4K A;  4LUZ A;  1V9P A;  4ALP A;  4L5S A;  4LF8 Q;  3F1Z A;  1GO3 E;  2BH2 A;  3F2B A;  1NBW A;  1IBK L;  1EQR A;  2YTY A;  2RHS B;  1PFS A;  3G6E A;  4HJ5 A;  1KD1 C;  4GS3 A;  5J3B A;  3F2C A;  1NMG A;  4LUV A;  1K73 C;  4DR4 Q;  4NXN L;  5IP7 H;  5IWA Q;  2EIF A;  1PH3 A;  4JI4 L;  3CQZ H;  4A3L G;  1Q86 C;  2CKZ B;  3PUV A;  2JA7 H;  4DR1 L;  1HNW Q;  3AEV A;  5M3F H;  2UXC Q;  3KOJ A;  1KRS A;  3W1B A;  2OWO A;  1X3F A;  3CP0 A;  4P75 A;  4KHP L;  2OTL A;  2VS1 A;  4JI0 Q;  1E1T A;  1QUQ A;  1MIU A;  4AYB E;  4DK3 C;  3RZD H;  1YJ9 A;  4A3J H;  1XMO L;  2JA9 A;  4QGU A;  4A3B G;  1XPR A;  3PIP A;  1L1O B;  4POF A;  2VQE Q;  4DR7 L;  5JJL A;  3K81 C;  5IY0 A;  2QGQ A;  4UP9 A;  4GNX C;  3K7U C;  3OYY A;  2B63 G;  2VUM G;  1MJC A;  1EFW A;  1PH2 A;  1LYL A;  4X65 Q;  1EIF A;  4MNO A;  3A5Z B;  1HNX L;  4O2D A;  2H5X A;  4A3C G;  2R7F A;  1Y1V H;  1VQK A;  3I4N G;  2UXB L;  4P72 A;  3S1N H;  3NEN A;  3CF5 A;  3I7F A;  4A3E G;  1IZ6 A;  3I4M H;  3S2H H;  3S24 A;  2JK8 A;  4DV6 Q;  1P16 A;  2JA8 H;  5C4X H;  1VQA A;  1J6Q A;  1N32 Q;  3B6Y A;  1PHJ A;  1W3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...