1L1OB

Structure of the human replication protein a (rpa) trimerization core
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
123
Chain Sequence
QHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDNTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Replication protein A 14 kDa subunit
publication title Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 123
sequence length 128
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1l1oB00
1JJCB 2VS1A 1VQOA 2I5HA 2ZTDA 1QVFA 1IXRA 2K5HA 1A0IA 4B3ML 4A3BG 1WFQA 3CCUA 1VQFA 4YWLA 2ZM6Q 2UUAL 3GTOH 4A93H 4QY7A 4LF9Q 5FLMG 2Q2TA 1RIPA 3D31A 4HJAA 4DV2Q 4GLXA 3T1HQ 4IJLA 1N9WA 2IT1A 1PH6A 1P16A 1Y14B 5IP7G 4BY1H 2V1CC 1S3OA 4OWXB 1GKHA 3ULPA 1Q81C 1IL2A 3EIVA 3TEHB 2WFWA 1X3EA 4LW1A 2JK8A 1VQJA 3A5UA 4X66Q 1BVSA 1EIFA 3K81C 5C3EH 1Q12A 5GROA 2PI2E 2IY5B 1AE3A 4UP7A 4DK3C 4AYBE 2R6GA 3I2ZA 4DR7Q 3S1QH 3KF6A 5C0XI 3BJUA 2WAQE 4MTNA 4DV6Q 4LF5Q 1HNXQ 5LMUQ 3F2DA 1XJVA 1LUZA 1SRUA 3B6YA 2BA0A 2NN6I 1BBUA 1UE6A 1SFOH 4WJ4A 2B3GA 1Y1VH 1T9HA 3CCQA 1N32L 1HR0Q 3S1RH 4JYAL 3CQZH 1WCMH 3E0EA 3M9BA 4XIGS 2ID0A 2JEBI 2NVYH 5M5YH 3M85A 1VCIA 3GTJH 2RHQB 3M4OH 4DR6Q 4H02A 4OO1I 2K5VA 2YTVA 4ALPA 2ASBA 3PIOA 3NENA 1A62A 1RL2A 2VQFL 2DUDA 5HY6A 4OXPA 4A3KH 1Q86C 4IPDA 3UE1A 4NB3A 1X56A 3CPFA 1IYJB 4JI4Q 3H0GG 4JI1Q 2K75A 1K0RA 1XPOA 4B3TL 3I4MG 2E2HH 4KHPL 3PUVA 1NBWA 2BH8A 3G6EA 4J15A 2H5XA 5GAGC 1SLJA 1KL9A 2ALYB 2PI2A 2R7FA 5BR8Q 4DUZQ 4GOPC 1PA6A 3GTPH 1D7QA 1X65A 3FKIG 4A3GG 3PGZA 3DLLA 3TS2A 4HJ5A 4POFA 5H1SE 4LF7L 1MJEA 3HOYG 4A3LH 3U58A 1K8AC 2RF4A 5JJIA 4JI6L 3STBC 2WB1E 4DR2L 2UUCL 2F3IA 3NBHB 3CMEA 3UE0A 2JA9A 3I4OA 4B3RL 1TWFH 2GN5A 3GTMH 1E22A 3J80i 2PQAB 3KOJA 1CKOA 1P8LA 1YITA 4IFDJ 3OTOL 1Q82C 4O0AA 4AH6A 1PH9A 3CCRA 4OX9L 4A75A 1IBLQ 1JE5A 3S2DH 1C0AA 4GKKQ 4IJHA 1V1QA 1S40A 3H3VI 4NXNQ 4IPGA 1QVGA 2JA8H 4QGUA 1KAWA 2RHSB 1U5KA 5IYCH 2ZM6L 1SN8A 4DKAC 1K3RA 2VZAA 3G71A 3HOUH 4DV0L 2R7ZH 2HQLA 5GAEC 5GQOA 1VQEA 2E8GA 3EBEA 3K7UC 4GN5A 5M3FH 4DV2L 2JA5G 3H3VH 1VQGA 3KJOA 1JT8A 4LFCQ 4PMWA 2ES2A 3PCOB 3PUYA 1L1OC 2E5LL 4BA2I 3G4SA 1YVCA 2OTJA 3KLWA 1N36L 1PH8A 1EIYB 1YEZA 1FVIA 4IOAA 1GVPA 4X66L 3I55A 3W5OA 5IYDH 2D62A 1CSPA 1QZGA 2CCZA 1OXTA 1VQBA 3M3YH 1JJ2A 4A3BH 1J5EQ 3HOXG 4BBSG 2JJQA 4LF5L 1X3GA 2B63H 1O7IA 3GO5A 5LMUL 2N3SA 1HZ9A 3HKSA 4GS3A 4L5TA 4JI6Q 2UUBL 3RLOA 1WYDA 2L15A 3TQYA 2UUCQ 1NMFA 3L2PA 1QVCA 2NZHA 5IP7H 2CQOA 1HR0L 4OWWB 2HT1A 4B3RQ 3E9HA 4A3JH 2AHOB 1VS0A 3JAMc 2JQOA 4HJ7A 2QA4A 4GNXA 3KYHC 3CCLA 4DR6L 2ZJQA 3K8AA 2HIXA 1KHIA 4YWMA 1AH9A 3RN2A 3KDFA 4OX9Q 5IY0A 4X65L 3PUWA 2JA7G 2GVAA 4LFAQ 4Y7NH 2YTXA 2Z6KA 3A0JA 4JI1L 4JI4L 2N78A 1IBKQ 2K4KA 4YCUA 4LFBL 2R92G 1HZCA 4APVA 2HHHQ 1VQNA 1G51A 4RG1A 2Q2IA 3J7A5 2MO1A 5JEAJ 1NY4A 4JI8Q 4DV0Q 2NVXH 2IX1A 4DV7L 4B3SQ 3VDYA 1S72A 4LF6Q 4DUZL 5BR8L 1V43A 3EN2A 2E2IH 2RCNA 4IO9A 1CKNB 1HZAA 4GOPB 1ASYA 3I56A 2KHJA 3HOWG 2E5LQ 4TQUS 5ELOA 1CSQA 2UXBL 4R4TA 1N36Q 1YZ6A 1Q46A 4LWCA 1YHAA 5IWAL 5FJ8G 1D8LA 2UXCL 4DR5Q 2OQ0A 1Q8KA 1OXVA 3ERSX 4JBWA 2JA6H 3H0GH 3GTLH 4DAYB 3RNUA 3I4MH 1VQMA 5IT9c 4JC0A 4R4OA 3RLFA 2VUMG 3MXNB 1PH7A 1UEBA 2UUBQ 2UXDL 4Y52H 1N8RC 1PH1A 4C3JH 2KHIA 2UU9L 2ZTCA 1IBLL 1PYBA 5C4XG 4A3IG 3L0OA 3FKIH 4GNXC 4GKKL 2Y0SE 3I4NG 1AE2A 1PVOA 1K9MC 4NXNL 3RZOH 3J7ZC 1LYLA 3HOYH 4LUVA 1EYGA 1PYSB 1TWGH 2VW9A 4JG2A 1NTGA 1XMOL 3TREA 1VQ6A 5M5XH 3GD7A 3PUXA 4X65Q 2GVBA 4LFCL 4LF8L 1L0WA 4IFDG 2DGYA 3KF8B 1J6QA 3CP0A 2EXDA 3S14H 4LFBQ 1V9PA 2OQKA 1HJPA 5FLXc 3J81c 1JB7A 3F1ZA 4IPCA 1E24A 3ER0A 3G48A 4DV7Q 1HR0W 3PO3H 1G291 5IYBG 3U4VA 3W1GA 3RLNA 3CC4A 3F8TA 2QEXA 1Q7YC 1J5EL 1PH4A 3HKZE 2UXBQ 3A5ZB 1I94L 1YHBA 1YHQA 2MQHA 3HFZB 3M7NA 2OTLA 1N33Q 3HOZG 4IPHA 5IWAQ 1A8VA 4YHHQ 2UXCQ 3GDEA 2JA5H 3NEMA 4R4IA 1EWIA 4LF4L 3RZDH 5JJKA 1KRTA 4OWTB 3OW2A 1EQQA 2A8VA 2JE6I 4QQBX 4JI5Q 3BZCA 3CCSA 4DV4L 4P75A 3H15A 2UXDQ 1ASZA 1KQSA 4MZ9A 5AJ3Q 3PF4A 1YI2A 2QGQA 2UU9Q 4TVAB 1XTDA 1SE8A 5IP9G 1PH2A 1KIXA 3T1YQ 1JMCA 1M90C 2LSSA 4LFAL 3HOXH 4BBSH 1VQ5A 1X54A 4JBJA 2KCTA 3PV0A 1NE3A 1IBKL 3M4QA 3SGIA 2ATWA 2HHHL 2PMZE 3K7AH 4O2DA 4JI8L 1XMOQ 4A4IA 1I5FA 4L5QA 3AYHB 4P74A 1HNZL 4PZ8A 4B3SL 4JBMA 4LF6L 5C4JH 4LF8Q 4A3MG 3K0XA 3CCMA 4JV5Q 2PQAA 4UP8A 4BY7G 1LTLA 2ZJPA 1K83H 1UE7A 2CWPA 1GD7A 1Y1WG 4GLAC 1XNQQ 4AYBG 4DR5L 4QL5A 4DAMA 2KENA 2JA7H 4BBRG 1XMQQ 5C0XJ 1VQ9A 4A3DG 1OXXK 2WAQG 4UP9A 5LMNQ 3WWVA 2R92H 1N34Q 1I94Q 5FLMH 4R4QA 2CWAA 4GN3B 3F2BA 1FJGL 3PO2G 2F4VL 3S15H 4PZ6A 5C44G 1SR3A 2I5MX 4LF4Q 1I50H 3CCEA 4GN4B 3HOWH 2R93G 4WJ3M 3FHWA 1XPRA 1UWVA 1OTCA 4DV4Q 2K50A 3GTGH 3CC7A 4GKJL 4LUOA 2EQSA 3I7FA 2AWNA 2KBNA 5FJ8H 1G6PA 2MFIA 2ZJRA 4DV3Q 1B70B 1U0LA 3ZJYC 1NJIC 1BKBA 3RN5A 4P71A 1H95A 3K80C 4LNQA 5LMNW 2PNHA 2BA1A 3U4ZA 3TS0A 4K0KQ 2VUMH 3KFUA 1WJJA 2R7ZG 2E2JH 1VQIA 2VQEL 1HNZQ 1KXLA 1MJCA 5C4XH 4A3IH 1VQ7A 2AMCB 4AQYQ 1C7YA 5GADC 4A76A 3ULJA 2Q2UA 5E7NA 4YY3Q 3I4NH 4A3CG 4BA1I 3J80c 4JI2Q 2VL6A 4DUYQ 4IFDI 2WB1G 4HIDA 2MNAA 1N33L 4YWKA 4DPGA 1EOVA 4YHHL 4DV5L 4A3EG 1C9OA 2ZTEA 1CKMA 4DV1L 3D0FA 3DM3A 3KF6B 4YCWA 4DR4Q 4P73A 4DR1L 4JI5L 5M3MG 2B63G 1SMXA 1QUQB 4R1JA 3CCJA 2IX0A 1PHJA 4L5SA 4JI3L 4LUZA 1FJGQ 5AJ3L 5IYBH 2F4VQ 1YJNA 3HOVG 1KRSA 4HJ9A 3RR5A 4GLVB 4HIKA 4A3JG 1CKNA 4GOPA 3T1YL 1TWHH 4A3FG 2JEAI 3CC2A 3F2CA 1E7ZA 4A3GH 4JI7L 2D0OA 4XTCS 4QJFA 3GTQH 3OYYA 2FXQA 3HOZH 4GKJQ 4X64L 3IRBA 1TXYA 2K52A 4RMFA 1QZHA 3AEVA 2NVQH 4DR3L 4BXXG 3STBD 3S2HH 2F52A 2Z6KC 3JC66 3CMAA 3NELA 1NMGA 5ELNA 1X55A 4ME3A 1VQ8A 3CF5A 1X6OA 2WP8J 2IHEA 4JV5L 2B29A 3L7ZC 1HNWL 1L1OB 1QUQA 2Q2HA 3M4PA 1VQKA 4A93G 4X62L 1VQ4A 4NXMQ 1UE1A 1TWCH 3CXCA 2VY3A 5IP9H 2VQEQ 1XNQL 4BY1G 3UDGA 3U50C 3UDXA 3UDIA 1XMQL 1I6HH 1XPUA 2XTIA 4OONA 5LMNL 1KD1C 1N34L 1A63A 1YIJA 2C35B 2XGTA 1VQLA 2BH2A 4HIMA 4JBKA 3W1BA 1E1OA 1WOCA 4EQ5A 2CFMA 5C3EG 1IBML 4DV5Q 2AKWB 1FL0A 4P72A 1B8AA 4PZ7A 1VQHA 5IE8A 4DV1Q 1XNRL 4B3MQ 5M5WH 4A3MH 2JA6G 3JAMi 4HJ8A 4QIWE 2MO0A 3CPWA 4JI0L 2UUAQ 4JCVE 4DR1Q 4BY7H 1L1OA 3PUZA 1Y1WH 3S16H 1Q1BA 2YYZA 2YU9H 2K5NA 4JI3Q 3CCVA 1Y1VG 4DV3L 4DK6C 4BBRH 5C0XG 1YJWA 3AQQA 3TRZA 4A3DH 1WCMG 2YTYA 4X6AH 4KI0A 1UE5A 1FGUA 1YNXA 2A19A 1E3PA 4JI7Q 3A74A 3S1MH 2NN6G 5J3BA 2K14A 4K0KL 4DNIA 2CKZB 2OCEA 2Z0SA 1Q1EA 3CW2C 4X64Q 3PO2H 4C2MH 4DR3Q 4JOIA 1SROA 5C44H 5EAYA 4A3KG 1GM5A 5K36G 3LGJA 4AQYL 1W2BA 4OO1G 3UDFA 2NZOA 2R93H 1L2FA 1I3QH 4YY3L 3FP9A 1OXUA 3PSIA 3PIPA 1HNWQ 1EQRA 4JI2L 4DUYL 1PV4A 1WI5A 1HH2P 4X62Q 2N8NA 1IZ6A 1CUKA 1N32Q 4KHZA 1KC8C 4L5RC 2OWOA 3PO3G 4JYAQ 3E9IA 2YV5A 3KJPA 4NPSA 1PFSA 4EX5A 1K8GA 3BZKA 4DR4L 3CD6A 2A1AA 1K73C 2R7DA 4LF9L 4A3LG 5JEAG 1B7YB 2VQFQ 2HIVA 2KCMA 3PF5A 4POGA 3Q8DA 1E1TA 3T1HL 1IBMQ 4PG3A 1VQAA 1YBYA 3GTKH 2VNUD 1Z9FA 1LM0A 2Y0SG 3ULLA 1XNRQ 4UPAA 1PH5A 1MKHA 4A3CH 1X3FA 2LXKA 4B3TQ 1M1KC 1BBWA 4AIMA 4GNXB 4JI0Q 4KHPQ 3MEFA 2I5LX 3S1NH 4FDBA 3KDFB 4A3EH 2NVTH 2LXJA 1PH3A 1VQCA 4C3HH 2D0PA 4MNOA 1R9TH 4YCVA 1VQPA 3AFPA 4DR7L 1MIUA 3BU2A 4R4CA 5M3MH 4DV6L 2I0QA 4LF7Q 2JA8G 1HNXL 5IYCG 3J81i 4HIOA 3HOUG 4JOIC 4C3IH 4DR2Q 3ICEA 1JJGA 5GAHC 1EUJA 4NXML 4IOCA 3HOVH 3CAMA 1OXSC 1Z47A 5M3FG 2EIFA 1YJ9A 3HKZG 1W3SA 1DGSA 1VQDA 4A3FH 1X9NA 3AFQA 4KLKA 1EFWA 5DLQE 3J81j 3OTOQ 1GO3E 3S24A 5JJLA 2IHFA 3S17H 4UY8C 4BXXH 2AWOA 5IYDG 1TWAH 2N49A 1HZBA 5HGQA
chains in the Genus database with same CATH superfamily
2AUKA 1JJCB 4CDCC 1QVFA 3CU7A 2KEEA 3EJIA 1RCVD 2JP1A 3Q24A 1VQFA 4YWLA 2JA6B 1EY0A 4DAVA 3GTOH 1AZPA 1HQRD 1S4ZA 1I6VC 3D31A 3Q0AA 4FXDA 4JW0A 1N9WA 1C8CA 5C4ZA 1Y1VB 2Z6BA 1VF5C 2NWGA 4X3SA 4OWXB 3CQZB 2O5JC 1HXYD 4PMCA 5G3LD 1VQJA 4X66Q 2BOSA 5IGFA 5C4HA 1Q12A 4EQPA 3J7AV 4WRDA 4JPBW 2IY5B 3R93A 4DK3C 2HCIA 4KKSA 3I2ZA 4DR7Q 5JPMC 1WTHA 4KN7C 5A35A 2WAQE 4MTNA 1FNWA 4QF4A 1IL8A 4HSVA 1EQVA 3S1RH 4JYAL 1JE4A 5JPNC 3PO3B 1TKWB 2CH4W 1MGSA 2NVYH 5M5YH 1HA6A 2NN6H 2K5VA 2YTVA 1A3VA 1H9RA 4CDFC 2PNRC 4A3KH 4NB3A 1E2WA 3BDLA 1JOKA 1XPOA 2V4DA 2SNSA 3I4MG 4KHPL 1NBWA 1LTTD 2FMCA 2L4NA 4J15A 1PFMA 4C3JG 2KOLA 2R7FA 3K58A 1HFNA 4G7ZC 3FKIG 5DEHA 2EYMA 3PGZA 4ABNA 1FR3A 5H1SE 3G7LA 1MJEA 4ULLA 3STBC 1V1OA 4KD3A 2UUCL 2OXPA 3T4AC 1ZYRD 4IQZA 3HS0C 4OEMB 5ELEA 4IFDJ 1Q82C 3P20A 3DXJC 3BYTB 1S5BD 4Q5VA 4A75A 1STEA 1C0AA 4IJHA 5C3XA 4ZRZA 2F0VA 4QGUA 4OELB 1U5KA 1WTRA 2R92B 1ET6A 2VZAA 2E8GA 3SXHA 3EBEA 5M3FH 2B2WA 4LFCQ 2R61A 2L11A 1L1OC 2E5LL 3G4SA 1G2TA 1EIYB 1FVIA 1GUWA 4X66L 5LL6X 3GTGB 4H44C 1D5XC 3AU7A 2CCZA 4M8AA 3M3YH 1VQBA 2HQEA 3KK7A 3HOXG 1JQYD 3I90A 2B63H 1M4VA 3GO5A 4BWGB 1HZ9A 1WYDA 3TQYA 3NSWA 1NMFA 4DK0A 5CBAE 5IGEA 3SDZA 2NZHA 2K6AA 3TN2A 2AHOB 3JAMc 1FYCA 1BQQT 3FMCA 2QA4A 4GNXA 1HHVA 1DOMA 5CMDA 1AH9A 4K8IA 1ZEQX 4OX9Q 4X65L 2GVAA 4LFAQ 4Y7NH 3I72A 4OHJA 3A0JA 4TSSA 4YCUA 3H0GB 2R92G 4APVA 2HHHQ 5D65A 2BE5C 3J7A5 2MO1A 5JEAJ 2RBMA 2EJMA 4LF6Q 3SR1A 4OL7A 2A69D 1ASYA 5EKKA 3I56A 3KLSX 3HOWG 4TQUS 4A3GB 1S5DD 1STGA 2KJXA 1TVXA 4LWCA 1TWGB 3TP6A 4DR5Q 2QILA 2OQ0A 1RF2D 1Q8KA 1JWMD 1I4XA 2XN9C 3ERSX 4JBWA 5CYUA 2JA6H 4RCNA 4DAYB 3I4MH 1VQMA 5IT9c 4R4OA 2VUMG 3K57A 2UXDL 1DD2A 4Y52H 1UNSA 2AQ2B 4C3JH 2KHIA 1F2MA 2ZTCA 3MWYW 5DM73 3FKIH 1SDFA 1I6HB 3SVMA 3RZOH 4EGVA 1XMOL 5M5XH 3PUXA 1KTKA 4FF1A 2JA5B 4LFCL 5TSSA 1DM0B 4LFBQ 2O4XA 3R2TA 3DUZA 1JB7A 3VYUA 3ER0A 3MAQA 1ENAA 3PO3H 5IYBG 4CJ0B 3U4VA 3W1GA 5FLXL 3OW7A 2L55A 4BBSB 1H9MA 4IPHA 2UXCQ 1BCPC 1PDQA 4R4IA 5JJKA 1EQQA 2K5DA 5KIXA 1E2VA 2JE6I 1I3QB 1Q90A 4CHTB 1PTOD 3HZXA 4ZKBB 1QILA 1YI2A 2QGQA 1KIXA 1PFBA 4LFAL 4JVZA 3HOXH 2KHSA 5CORA 1NE3A 2HHHL 2PMZE 2B2UC 1PTOF 4LF6L 5ELFA 4N8FA 4LF8Q 5COYA 1ONLA 2PQAA 4JV5Q 2F0SA 1K83H 1BBXC 2CWPA 5ELCA 2D9UA 3W3AA 4GLAC 2KCNA 4AYBG 4DR5L 4DAMA 2K7VA 1VQ9A 4A3DG 1MD2D 4UP9A 1PZID 2R92H 4ZKCB 2PPBC 2RSOA 4R4QA 3F2UA 1SE3A 3F2BA 4S3SA 2MGSA 4UAIA 3S15H 4PZ6A 2PYKA 2C9OA 2I5MX 1QE6A 1I50H 4OIJA 3HOWH 1K28A 4WJ3M 3FHWA 5I6WA 1XPRA 1OTCA 3BZDB 2QW7A 3GTGH 1KDBA 1ILPA 2SNMA 2KBNA 3NTKA 3S17B 4DV3Q 3RN5A 4P71A 1H95A 4L63B 4LNQA 1RJTA 1Y8OB 2F0MA 3VR4A 3VYTA 2VUMH 3KFUA 2E2JH 1I4HA 2G5DA 3OOCA 5GADC 2Q2UA 5E7NA 1D2BA 1SJED 4IFDI 1U4PA 1EYAA 4DV5L 2I07B 4N8X1 1Z6HA 1CKMA 2ZTEA 2MJ8A 4C3HG 4DV1L 1IW7D 2NVQB 4Z9CB 3KF6B 3QWNA 3EA6A 4P73A 2N88A 5M3MG 5KNBA 1J8IA 3BYYB 2XSCA 1CA6A 4L5SA 5IYBH 5C6AA 1YJNA 5EPLA 4HJ9A 4XYOA 4IUVA 4A3GH 1E7ZA 2XRQD 2D0OA 1S5ED 1AEXA 3OYYA 3M4OB 2FXQA 4HN7A 1QZHA 4RMFA 2RDHA 1EU3A 1NMGA 5ELNA 5FK9C 1VQ8A 3TDQA 4A3MB 4JV5L 4L8JA 5FO7B 2B29A 3MTSA 1L1OB 3CKIB 1QUQA 1SYFA 2A68D 1JWSD 3GP7A 4NXMQ 1YNJD 3U50C 1I6HH 4BBRB 2KECA 2B39A 3ND9A 2WAQB 4OONA 4NW2A 1WTQA 2XGTA 1KNAA 1CTMA 5LL6S 2CFMA 1A3TA 4PNYA 1FL0A 4P72A 3PO2B 3C2PA 5C44B 1TWFB 2L0CA 1KAAA 1CQVA 4I65A 2K5NA 3CCVA 4DV3L 1YJWA 2N55A 1RD9D 1WTVA 2Z8LA 4A3DH 2YTYA 1KDAA 2RSNA 4QIWB 5J3BA 2R3ZA 4F88A 5CV5A 1Q1EA 3VA5A 4DR3Q 4JOIA 2R7ZB 4OO1G 5EJWA 1I3QH 2F0QA 2F0GA 5I9OA 3PIPA 3L3OC 5FLXE 5CR3A 1EWCA 1SE4A 1PV4A 4X62Q 1CUKA 1N32Q 3CRLC 1EY8A 2EYOA 2OWOA 3E9IA 2K5QA 4ZCKA 1R9TB 3BZKA 4B9XA 4A3LG 5JEAG 2FHTA 1B7YB 2VQFQ 3PF5A 3Q8DA 3T1HL 1GOZA 3VR2A 4C3IB 1B9NA 2F0PA 2RKSA 1XNRQ 1MKHA 1X3FA 4A3JB 1XX8A 1M1KC 1BBWA 4JI0Q 1O80A 1BUVT 3RUZA 2I46A 4DA2A 2NVTH 2F0IA 4C3HH 1CI3M 4MNOA 1VQPA 5M3MH 1PRTD 5IYCG 3J81i 3HOUG 4DR2Q 3GTOB 1EUJA 4NXML 2NVXB 4DNTB 3CAMA 1Z47A 2EIFA 1YJ9A 1W3SA 1X9NA 5ISRA 1WD1A 2KUMA 4ZYSA 1ESFA 3J81j 1YNND 2SEBD 1PRTF 3S24A 5JJLA 3S17H 5HURA 1X32A 2AWOA 5IYDG 1RTNA 2N49A 5HGQA 2DNEA 2TMPA 3E3XA 1V1PA 4KY6A 4DXGA 1BCPB 2I5HA 1IXRA 3WOFA 2EY2A 3E0JA 2ZM6Q 1CHPD 4QY7A 4LF9Q 5FLMG 1AFPA 3TP8A 1AZQA 4FXKC 3V96A 1J9OA 5IP7G 1R4PB 3S1RB 1TS2A 1S3OA 3JAME 4X3TA 3C46A 1B50A 1DCZA 1TIID 3EIVA 3TEHB 2NVYB 2WFWA 3A5UA 1NUCA 3KBGA 5GROA 4UP7A 4A3KB 4AYBE 2G9DA 3BJUA 4LF5Q 3S14B 1XJVA 1LUZA 4MHEA 2NN6I 1BBUA 1DONA 3CCQA 1N32L 1M8AA 3GQBA 3E0EA 3A7LA 3M9BA 3M4OH 1VCIA 3PIOA 2E75C 3NENA 3BG3A 2VQFL 3MEHA 5IIFA 4OXPA 1K8OA 1NCVA 3ZYYX 4OO1H 3J7YW 1TT2A 1Q8IA 1PXUA 4F7XA 5A2QL 2K75A 1K0RA 4IUTA 1AW7A 1GUTA 3PUVA 2BH8A 2H5XA 3D4DA 4YIJA 1SLJA 2ALYB 4DUZQ 1ML0D 1D7QA 1PA6A 4KTAA 3WOEA 1X65A 3TS2A 3MVVA 4ZAIA 4POFA 3K5NA 2NZ1D 3A8KE 3OIPA 4RGOS 3HOYG 5JEAH 3U58A 4A3LH 2ZT9C 4DNRB 1EFID 2EYHA 3K7AB 4DR2L 3NBHB 2JA9A 2EPBA 3EVQA 1TWFH 1NSNS 2GN5A 5M3FB 4EQNA 3GTMH 3VR5A 4ILWA 1E2ZA 1PH9A 1TR5A 3DWPA 4U673 1EY5A 5EGTA 4GKKQ 1S40A 3PMFA 3M3YB 2BDOA 3CHBD 2ZM6L 5IYCH 5E4XA 1SN8A 2XIWA 4DKAC 3HOUH 2R7ZH 5GAEC 1VQEA 4DGZA 4IN3A 5J39A 3P1HA 3H3VH 3MXPA 1JT8A 3PUYA 3C1FA 2HD3A 1EL0A 3MHBA 2OTJA 1N36L 1PH8A 2PMZB 1GVPA 1EY6A 5IYDH 2D62A 1QZGA 1EY7A 1JJ2A 1SMYD 3DEOA 2AUJD 4LF5L 1IYVA 1ZYRC 4GS3A 4RHSA 2UUCQ 4ODGA 5BN4A 5IP7H 4OWWB 1A6XA 1B53A 4A3JH 1VS0A 4K5WA 4HJ7A 3K8AA 2WV6D 1CHQD 4F87A 3RN2A 3KDFA 1II3A 2JA7G 3BDOA 5EKIA 2K28A 2N78A 5KEEA 2K4KA 1HZCA 3I4MB 4RG1A 2IX3A 2DN8A 2NVXH 4DV7L 2B2WC 3VDYA 1S72A 1SE2A 2HCCA 4DUZL 1KLGD 4C3JB 1V43A 4F8MA 3S9WA 2E2IH 4IO9A 4LK1C 4GOPB 1JOQA 1CZWA 2E5LQ 3FKIB 3D8GA 1O7ZA 1YZ6A 3RZOB 3TP7A 2PO4A 1QG7A 1D5MC 5IWAL 2HDLA 4FF3A 3BVMA 5M5XB 3GTLH 2FINB 5FO8B 3URYA 3MXNB 1PH7A 3FVQA 4H7BA 1ET9A 3L0OA 4GNXC 4V190 4GKKL 3I4NG 1AE2A 3I3CA 3J7ZC 3HOYH 4DN4M 1TY0A 2CH4A 4JG2A 1NTGA 4X65Q 1JICA 2K1BA 2GVBA 1D1IA 1C48A 1J6QA 3S14H 4UHVA 1V9PA 1HJPA 1PMRA 5FLXc 1K0SA 1HR0W 1F9PA 3RLNA 4DAPA 5T1IA 3TP5A 2QDLA 4KK7A 1Q7YC 1PH4A 3HOXB 3M4YA 4FVMA 3HOZG 4RGMA 4YHHQ 1A8VA 3DM1A 3NEMA 2B2VA 1EWIA 4LF4L 3I70A 2G9HD 4QQBX 4DV4L 1A15A 2UXDQ 1K83B 3PF4A 1L0XB 3P75A 1STNA 2F0UA 1XTDA 1EIGA 5D3IB 1RDPD 3T1YQ 2LSSA 3L9AX 2CW0C 1X54A 4JBJA 2IW3A 3M4QA 2K05A 3K7AH 5A2QE 1XMOQ 4A4IA 1I5FA 4HCEA 4L5QA 4P74A 3S15B 5C4JH 1I50B 2NTTA 3HOWB 4BY7G 1GD7A 2EY5A 1XNQQ 3GV3A 2JA7H 2XVSA 3QIAA 1NR4A 3K5LA 5LMNQ 1N34Q 4K5XA 3NXWA 2CWAA 2Q8RE 2VUMB 3K6OA 2E2JB 3CCEA 2R93G 2WKCA 1UWVA 4GKJL 4LUOA 2AWNA 1NAPA 1B70B 3ZJYC 1G91A 2GA4B 1MBYA 4UDUC 3K80C 1T5EA 3HEJA 2KA7A 2BA1A 3U4ZA 1WJJA 2MP1A 4KN4C 5I9PA 1RTOA 1A3UA 1NNXA 1OO9B 3H3VC 1KXLA 3I4NH 2EE1A 4A3CG 4YY3Q 1ENFA 2RDFA 5JAVA 2WB1G 3VYSA 4HIDA 1CQFA 2Q8IB 2MNAA 1EOVA 2AQ3B 4YHHL 5ELDA 1C9OA 3N52A 4PV1C 4DR4Q 4DR1L 3FRPB 3DHQA 3LNNA 4R1JA 3CCJA 4QUCA 1A2UA 3QJYA 2K04A 4JI3L 1B2TA 1F2YA 3HOVG 1C4QA 1CKNA 3R8BA 3T1YL 2A6HD 2H1EA 3F2CA 4JI7L 1JB3A 2P5ZX 4XTCS 3NP8A 3HOZH 3AEVA 4RCOA 1LABA 3STBD 2A73B 2F52A 2Z6KC 3CMAA 1X55A 4ME3A 1G8ZD 1HNWL 4NKLA 1VQKA 3M4PA 2E2HB 4IZ8A 3BVGA 1XNQL 3IAYA 1QCBD 2QEJC 4BY1G 4LMQD 3UDXA 4AYBB 1XPUA 5JVG3 3GTPB 4CKEA 3O13A 4A3DB 2CQAA 1FNUA 5LMNL 1N34L 2NTSA 1EQTA 4I7AA 1WTWA 2BH2A 4JBKA 3A54A 1WOCA 3W1BA 4EQ5A 5C3EG 1IBML 5IOCA 4PZ7A 4DV5Q 3NHHA 3D6WA 5IE8A 4DV1Q 4B3MQ 3TZDA 2F0KA 2PW7A 1EU4A 3KF8A 4BY7H 1L1OA 3PUZA 3PIO3 3S16H 2YYZA 2YU9H 1F9RA 3H6MA 3NPPA 2FFKB 5C0XG 4KJNA 4DF7A 2D2CC 3AQQA 3TRZA 1WCMG 4KI0A 1FGUA 2A19A 2VXWA 2XWJB 3A74A 5JVH3 2JA8B 2K14A 4DNIA 3TMEA 3CW2C 3QB3A 1SROA 5K36G 1TS5A 5EPKA 4OGQC 2JXMB 3SK4A 3HGBA 2R93H 4DFAA 2WKDA 2M2LA 4YY3L 3FP9A 1OXUA 4XQNA 2N8NA 1LTGD 1QJOA 4KHZA 5CV4A 2LKVA 4MN3A 5JOBA 1WTOA 2YV5A 5E3FA 3KJPA 2NVTB 4EX5A 4C3HB 4LJZC 3T53B 1K8GA 4DR4L 4A3BB 3NWTA 2K32A 3T56B 5M3MB 1B3AA 2BE5D 1I4QA 4PG3A 1HA5A 5E4WC 3GTKH 2Y0SG 4K2KA 1PH5A 4A3CH 2LXKA 2LY7A 4AIMA 5C3WA 4GNXB 1GUSA 3MEFA 1IYUA 2ICEC 1PH3A 2VB2X 4FP5D 2LS01 2D0PA 4R4CA 4DV6L 4R8IA 2JA8G 4KJOA 1HNXL 1H9SB 3W2DA 4JOIC 1JJGA 2RCFA 3SK6A 3HOVH 1VF7A 3A7AB 1OXSC 3T51B 3OWFA 4EQOA 1BNZA 1S5CD 3HKZG 1VQDA 1EFWA 3AFQA 2IJ0A 5DLQE 4RH6A 5EKLA 1PYWD 2IHFA 3BS1A 2PQEA 1HZBA 1LTAD 2VS1A 4J8QA 2K5HA 4B3ML 1A0IA 4A3BG 3VA7A 3CCUA 1BOSA 2BCOA 4K2LA 2Q2TA 4GLXA 3T1HQ 4BY1H 2IT1A 1PH6A 1P16A 1Y14B 2V1CC 5J22A 4KKTA 1BXTA 1PLFA 4ME5A 3U9OA 1CT1D 4LW1A 3UI2A 1EYDA 1BVSA 1F77A 5C3EH 1TQOA 3S1QH 5LMUQ 5FOBB 1SRUA 1UE6A 4WJ4A 1T9HA 3EQLC 5C0XH 1LT5D 4QUFA 1WCMH 2AQ1B 5FKAC 2ID0A 1L0YB 2JEBI 3M85A 1BCPF 3GTJH 4DR6Q 2RHQB 2ZXOA 4H02A 4OO1I 2ICIA 1LTBD 1HUMA 2QKIC 2DUDA 5HY6A 5K36H 4K6DA 1Q86C 1BR9A 2B2UA 3UE1A 1LV9A 3CPFA 3RZDB 1IYJB 4JI1Q 3GTMB 2E2HH 3G6EA 4KMUC 3Q23A 3A55A 2PI2A 5BR8Q 4GOPC 3GTPH 1JWUD 3DLLA 4J6HA 2NB0A 4KD4A 4JI6L 2WB1E 3HOUB 3CMEA 2B2YC 3UE0A 4B3RL 1UAPA 3C1EA 1E22A 3J80i 2PQAB 3KOJA 3TBIB 4O0AA 2A6EC 1HRJA 1XTCD 1IBLQ 2L12A 3S2DH 3H3VI 4IPGA 2HDMA 1QVGA 2JA8H 3SK8A 1KAWA 3DWQA 2EY1A 1K3RA 4DV0L 3K7UC 4GN5A 4KV6A 3KJOA 4PMWA 2ES2A 2A5HA 1O78A 4BA2I 2IL8A 2X6GA 3KLWA 4IOAA 4WORA 3GV6A 3SHLA 1OXTA 3RMHA 4A3BH 1J5EQ 2F0NA 2JJQA 1K3BC 1ZXTA 4RA8A 1O7IA 5LMUL 2F1MA 2CHBD 2UUBL 3RLOA 2L15A 3L2PA 2JYOA 5IODA 4R9WA 2CQOA 3D3RA 4N9PA 2M00A 2HT1A 2JN4A 5BN5A 2F0JA 2JQOA 2E2IB 4RGNA 4DR6L 2ZJQA 1RHPA 4C1NI 1GHJA 1SNPA 3QG1A 1KHIA 4YWMA 3H91A 2WIIB 2PZTA 2EJGC 4OIKA 2LMCB 2YTXA 2PZWA 4JI1L 1IBKQ 2QDBA 4HAEA 3GTLB 1VQNA 3E5SA 2Q2IA 4O42A 1V8QA 1NY4A 3OWEB 4JI8Q 2IX1A 4B3SQ 5BR8L 3D6CA 2RCNA 3RD4A 2PCFB 2KHJA 1ESRA 2UXBL 3TSSA 2XNAC 4R4TA 1N36Q 1D1KA 1Q46A 1CK1A 1HTPA 3HOYB 2B2TC 1D8LA 2KQ3A 3M7GA 5D3DA 1OXVA 1Y8PB 4XQJA 2EY6A 1JR0D 3RNUA 1LTRD 4JC0A 3RLFA 5ELBA 2EYLA 1STAA 1N8RC 1PH1A 2UU9L 1QOHA 5KNDA 1IBLL 3V05A 5C4XG 4A3IG 4E6IA 1XXGA 2Y0SE 1HPCA 2LFNA 3T13A 1PVOA 1K9MC 5KRUA 1LYLA 4LUVA 1PYSB 2CVRA 2VW9A 2IPKD 2NYZD 3TREA 3GD7A 2DJGC 1SNQA 1L0WA 2QF7A 2DGYA 2KEDA 4M1UB 3CP0A 1CA5A 2EXDA 2OQKA 3PQIA 5C5LA 4H13C 3J81c 3MXNA 2Z4HA 1QNKA 4IPCA 1E24A 1QB5D 2BDNA 1D5ZC 4DV7Q 1A2TA 1G291 1LLRD 1F9QA 1B4OA 2QEXA 2F0EA 1J5EL 3HKZE 3OMGA 3A5ZB 1MSHA 1I94L 2MQHA 3I91A 3M7NA 2OTLA 1N33Q 2OT2A 5IWAQ 2E74C 3I8ZA 3RZDH 2X69A 1KRTA 4OWTB 3OW2A 1WVLA 4HMJA 2A8VA 5C4JB 4RGTA 3CCSA 4CDDC 1PTOH 4G57A 1ASZA 2F0HA 4MZ9A 5AJ3Q 4TVAB 5IP9G 1PH2A 2JA7B 1M90C 1SAPA 1W6KA 1VQ5A 4O1NA 2VB3X 2KCTA 5M9OA 1IBKL 3R2IA 3SGIA 2ATWA 3KLRA 3D4WA 4JK1C 4O2DA 3V2TA 4JI8L 2QCPX 2L5TA 4B3SL 4RWSC 2F3WA 3AYHB 4K8JA 4PZ8A 4CGYB 1T5XD 1HNZL 2K03A 1MSGA 3K59A 3K0XA 3CCMA 1LTID 4NMZA 4CDEC 4UP8A 1CM9A 1CZGA 2ZJPA 1UE7A 1Y1WG 4QL5A 5C0XJ 1SEBD 4FO2A 1OXXK 4HMIA 4K14A 1Q3LA 1EWHA 2SOBA 5FLMH 2RDGA 1VMCA 2B2VC 4GN3B 1FJGL 2F4VL 2F0OA 1SR3A 4LF4Q 2D5DA 3IKJA 4GN4B 1LACA 1SBBB 2FJ2A 3I4NB 4HR7B 1Y8NB 4KY7A 4DV4Q 1DJRD 3I7FA 1EZ8A 1BKBA 4X3KA 5LMNW 1X3PA 3TS0A 1XYIA 4K0KQ 1O7YA 3U9SA 1VQIA 2VQEL 5C4XH 4A3IH 1VQ7A 1C7YA 2HUGA 1PZJD 3ULJA 2F4IA 1UUPA 2EYFA 2VL6A 3FPPA 1ZKOA 3NWSA 3KLSA 4YWKA 1N33L 3J80L 3HOZB 4A3EG 3DM3A 4YCWA 1SYCA 3VYRA 2B63G 1SMXA 5IGDA 2IX0A 3HP3A 1WTPA 2ENBA 5AJ3L 1SFOB 4TRDA 1KRSA 1GHKA 2JEAI 1TWHH 2O5IC 4MIUA 4KKUA 2F03A 1GUOA 4XXEA 4GKJQ 4X64L 1KLUD 4BXXG 4V0BA 5NUCA 1DXMA 1I4PA 4HSPA 3CF5A 4DAYA 1X6OA 3L7ZC 3T16A 5G3LF 2Q2HA 4A93G 1F2LA 3MFYA 4BY7B 5FO9B 3NTIA 2A69C 2J7ZA 1TWCH 3S16B 5IP9H 1EZ6A 5F2DA 2YU9B 1KNEA 3J81L 3CRKC 1A63A 3K5OA 1KD1C 1YIJA 1VQLA 4HIMA 1JORA 2AKWB 1VQHA 5E1FA 5M5WH 2JA6G 3JAMi 4QIWE 3CPWA 2UUAQ 4JCVE 4DR1Q 2R93B 3NK9A 1Y1WH 1Q1BA 2F0FA 4JI3Q 1SJHD 5KYIA 1Y1VG 2A6HC 3FEWX 4DK6C 1SNOA 4X6AH 2RQXA 4JI7Q 1E3PA 3S1MH 2Z9HA 4K0KL 2WACA 4ZUJA 1SYBA 1VMPA 2EJFC 4C2MH 5I4DA 5EBCA 5EAYA 3VR6A 3UDFA 2NZOA 3GTKB 3D4RA 3PSIA 1HNWQ 1EQRA 1GXDC 1WI5A 4FXGC 2F0TA 3OIQA 2WB1B 4L5RC 1KC8C 3PO3G 4ZLTF 5AFWA 1ICFB 1PFSA 4NPSA 1F9SA 5C5MA 2Q8TA 3CD6A 2A1AA 4KHVA 1K73C 3PIP3 2R7DA 4B08A 4POGA 1IBMQ 2MHVA 1LM0A 1DZ1A 1GUGA 3ULLA 3HOVB 1DOKA 5CGKA 4L6TB 5BN3A 4B3TQ 5I2XA 2F3VA 1JC7A 1PTOC 2FMMA 2M9VA 2PZUA 2I5LX 3S1NH 4FDBA 3KDFB 4A3EH 1VQCA 4YCVA 3AFPA 4DR7L 1GUNA 3BU2A 2I0QA 4LF7Q 4G7OC 1STYA 1HTLD 1ICWA 4FF2A 3KUPA 3ICEA 5GAHC 1SNCA 4R8NA 4BY1B 4KLKA 1BDOA 1TS4A 3OTOQ 1KDCA 4K5VA 2L9HA 4BXXH 4UY8C 3QOLA 1BF4A 5C3EB 1VQOA 2ZTDA 3MC0B 1WFQA 4HCSA 2UUAL 3S1QB 4A93H 1H9SA 4CKBA 1RIPA 1EEFD 4HJAA 4DV2Q 2NUCA 4IJLA 2EDGA 2K01A 1GKHA 3ULPA 1WCMB 2DJFC 1Q81C 1SSOA 5CC4A 1IL2A 1X3EA 2B8GA 2JK8A 3GTJB 1SYDA 1H9JA 1EIFA 3K81C 5KNCA 4RHRA 2PI2E 3DWAA 1AE3A 4J1MA 2H4OA 2R6GA 1EY4A 3KF6A 2DY7A 5C0XI 1HQMC 4DV6Q 1QNUA 1X3QA 1HNXQ 4FYDA 3F2DA 3B6YA 2BA0A 1SFOH 4ZUIA 2B3GA 1Y1VH 1HR0Q 4Q0FA 3CQZH 2XRSD 1GJXA 4XIGS 1AN8A 2X6LA 3J80E 2ASBA 3I73A 1NR2A 3X3MA 2CW0D 4ALPA 4QB4A 2KVMA 1A62A 1RL2A 2EVBA 3X3NA 1XWEA 1IW7C 4DU9A 4IPDA 1E0BA 1X56A 2Y0SB 2JSOA 3H0GG 5DNFA 4JI4Q 4B3TL 1TU2B 4MTKA 1H9KA 3A8IE 4HEDA 5GAGC 3OMCA 1KL9A 1WTXA 3Q6SA 4A3GG 3S2DB 1QWYA 4HJ5A 4LF7L 5JJIA 1K8AC 2RF4A 3IFTA 2OEOA 5CV6A 2F3IA 5KGUA 1I4GA 3BVZA 3I4OA 1IHZA 2A68C 3HKZB 1CKOA 1P8LA 1YITA 3OTOL 3J81E 1YNJC 1FNVA 4AH6A 3CCRA 4OX9L 1JE5A 2RA4A 1V1QA 4NXNQ 2KCCA 2RHSB 3IL8A 4HTHA 3FPUB 3G71A 1STBA 2MPMA 2HQLA 4IALA 5GQOA 4DV2L 2B8FA 1SYEA 5I6YA 2JA5G 3C3LA 1VQGA 3PCOB 2C5CA 1EIHA 1YVCA 1BO0A 1YEZA 1CFMA 3I55A 3W5OA 4RFBA 4QMGA 3MA2B 2SDFA 1CSPA 3A56A 1RODA 4BBSG 1X3GA 2N3SA 3OSOA 3HKSA 4L5TA 4JI6Q 5DAUA 1QVCA 5CBEE 1HR0L 3NTHA 4C1NK 4B3RQ 3E9HA 4P2CB 1U9RA 2J4XA 4TKOB 3CCLA 3KYHC 1TS3A 2HIXA 3QO2A 2ZXRA 3JAML 4K6LA 4ZK9B 4XYQA 5IY0A 5IGGA 3PUWA 5L37A 3NQIA 2Z6KA 3IFDA 4JI4L 1B3QA 1SYGA 2EXZA 3J7AF 4LFBL 1EY9A 2TSSA 1FGBD 1G51A 2J0TD 4DV0Q 1Z7TA 4DXFA 1RKNA 1EYCA 3EN2A 1CKNB 1HZAA 5LHY1 2ZXPA 1CSQA 5ELOA 1HUNA 4LAAA 3GTQB 3FDTA 1YHAA 4CJ2C 5FJ8G 2UXCL 1FD7D 4IUQA 1LT3D 3S2HB 4H0LC 1PRTC 3H0GH 1BCPD 2EYJA 3HG9A 4DK1A 1UEBA 2UUBQ 2K5WA 1LT6D 3K5MA 5IT9L 1PYBA 1YNNC 5EQ0A 2L1BA 1EOTA 3A8JE 2E2DC 4NXNL 1EYGA 1TWGH 4IURA 3OPOA 4WJWA 1VQ6A 4I7ZC 4B9WA 1IKLA 3ITPA 4LF8L 4IFDG 3KF8B 4IUPA 2Z4IA 2NBFA 3MXGA 3I4LA 3F1ZA 1HFGA 4GZYC 4PQXA 1PTOB 3G48A 5T1GA 3LX0A 2A74C 3CC4A 3F8TA 2UXBQ 1YHBA 5HGTA 1YHQA 3HFZB 1G6ZA 4ZQ3A 5IGBA 3AMUA 3GDEA 2JA5H 3EFXD 1K8MA 4JI5Q 4IUNA 3BZCA 2Z1CA 3N6RA 4P75A 1DYQA 3H15A 1VDZA 1KQSA 4RKLA 2UU9Q 1SE8A 2IWHA 3SE0A 1JMCA 3QR8A 2E76C 4WFN3 4BBSH 3PV0A 3MZ5A 3NBHA 4JBMA 1JCKB 3NBIA 4RAUC 4A3MG 1LTLA 4KY5A 2RVLA 2KENA 3LWEA 4BBRG 5DM63 1XMQQ 2PW5A 3Q22A 2WAQG 2EYPA 3WWVA 1I94Q 1STHA 1U4RA 3MFGA 1D6EC 3PO2G 5J1ZA 5I2YA 5C44G 1LTSD 2DY8A 4RKBA 5C4XB 4A3IB 4A3FB 2K50A 2F0LA 2XWBB 4CKCA 3CC7A 4QCLA 2EQSA 5FJ8H 4G4KA 1G6PA 2MFIA 2ZJRA 3OHXC 4BS9A 3H09A 1U0LA 1NJIC 1TWAB 3QOJA 5CV7A 1PZKD 5EBDA 2PNHA 4CBVA 3AB9A 2R7ZG 1ILQA 2DNCA 1HNZQ 4PMBA 3K0YA 4NP5A 1MJCA 2AMCB 4AQYQ 4A76A 4BA1I 3J80c 1TWHB 4G7HC 4JI2Q 4DUYQ 3H94A 4DPGA 4XDXA 4FF4A 4FNFA 5K5PA 1SMYC 3TZUA 1U4LA 3LWUA 4N9TA 4EVOA 3SK5A 3D0FA 4IFDH 1B1ZA 1MHWC 1S5FD 2K33A 4JI5L 1QUQB 1B9MA 1PHJA 4C3IG 3EROA 4LUZA 1FJGQ 4CJ1B 2F4VQ 1TWCB 3RR5A 4GLVB 4HIKA 1I4RA 4A3JG 4GOPA 4A3FG 3NQTA 3CC2A 3BDCA 4QJFA 3GTQH 5M5YB 1F2ZA 3IRBA 1TXYA 2K52A 3ONAB 2NVQH 4DR3L 3S2HH 1O7LA 2B2YA 3JC66 3NELA 5M5WB 2WP8J 2IHEA 3ERQA 3KBXA 1EEID 4X62L 1VQ4A 3DMUA 1DOLA 1TY2A 1UE1A 3CXCA 2VY3A 2VQEQ 2A6ED 1Y1WB 2O2LD 3UDIA 3UDGA 1XMQL 2XTIA 4C56C 2C35B 3S1MB 1Y69U 1E1OA 4X3UA 4ID6A 4XT1B 1B8AA 4C2MB 1XNRL 1JOOA 5JJZA 4A3MH 4HJ8A 2MO0A 4JI0L 2F0DA 3ND8A 5IT9E 1HCZA 1LO5D 4BBRH 3HRZC 1B44D 1UE5A 1YNXA 1MI2A 2NN6G 3VR3A 2CKZB 2OCEA 2Z0SA 2WINB 4X64Q 2EOTA 3PO2H 3WDNA 5C44H 4A3KG 4NDXA 1GM5A 3LGJA 4AQYL 1W2BA 5KYLA 4XQQA 1L2FA 3SEBA 4XT3B 4U68A 1SNDA 5IGCA 2MUYA 2EZVA 4JI2L 4DUYL 3DEPA 5EPJA 1HH2P 3P7JA 1IZ6A 3E6ZX 2F0WA 4JYAQ 3S1NB 1ENCA 4A3EB 1G2SA 1PRTB 3NE5B 4IUUA 1LT4D 4LF9L 1IKMA 1U4MA 1UEAB 2B63B 2HIVA 2KCMA 1E1TA 1VQAA 1YBYA 1SXTA 1Z9FA 2VNUD 4UPAA 1PFNA 4KHPQ 3R3OA 1WD0A 2B2TA 2LXJA 1R9TH 1V1PB 1MIUA 3NUCA 4Y7NB 3G6JB 4HIOA 1SNMA 4C3IH 4A93B 4IOCA 5M3FG 3MXUA 5CV9A 4A3FH 1DGSA 2OF1A 1GO3E 1R4QB 5D14A 5CV8A 1KABA 1TWAH 1W6JA 1AP0A
chains in the Genus database with same CATH topology
1JJCB 2VS1A 1VQOA 2I5HA 2ZTDA 1QVFA 1IXRA 2K5HA 1A0IA 4B3ML 4A3BG 1WFQA 3CCUA 1VQFA 4YWLA 2ZM6Q 2UUAL 3GTOH 4A93H 4QY7A 4LF9Q 5FLMG 2Q2TA 1RIPA 3D31A 4HJAA 4DV2Q 4GLXA 3T1HQ 4IJLA 1N9WA 2IT1A 1PH6A 1P16A 1Y14B 5IP7G 4BY1H 2V1CC 1S3OA 4OWXB 1GKHA 3ULPA 1Q81C 1IL2A 3EIVA 3TEHB 2WFWA 1X3EA 4LW1A 2JK8A 1VQJA 3A5UA 4X66Q 1BVSA 1EIFA 3K81C 5C3EH 1Q12A 5GROA 2PI2E 2IY5B 1AE3A 4UP7A 4DK3C 4AYBE 2R6GA 3I2ZA 4DR7Q 3S1QH 3KF6A 5C0XI 3BJUA 2WAQE 4MTNA 4DV6Q 4LF5Q 1HNXQ 5LMUQ 3F2DA 1XJVA 1LUZA 1SRUA 3B6YA 2BA0A 2NN6I 1BBUA 1UE6A 1SFOH 4WJ4A 2B3GA 1Y1VH 1T9HA 3CCQA 1N32L 1HR0Q 3S1RH 4JYAL 3CQZH 1WCMH 3E0EA 3M9BA 4XIGS 2ID0A 2JEBI 2NVYH 5M5YH 3M85A 1VCIA 3GTJH 2RHQB 3M4OH 4DR6Q 4H02A 4OO1I 2K5VA 2YTVA 4ALPA 2ASBA 3PIOA 3NENA 1A62A 1RL2A 2VQFL 2DUDA 5HY6A 4OXPA 4A3KH 1Q86C 4IPDA 3UE1A 4NB3A 1X56A 3CPFA 1IYJB 4JI4Q 3H0GG 4JI1Q 2K75A 1K0RA 1XPOA 4B3TL 3I4MG 2E2HH 4KHPL 3PUVA 1NBWA 2BH8A 3G6EA 4J15A 2H5XA 5GAGC 1SLJA 1KL9A 2ALYB 2PI2A 2R7FA 5BR8Q 4DUZQ 4GOPC 1PA6A 3GTPH 1D7QA 1X65A 3FKIG 4A3GG 3PGZA 3DLLA 3TS2A 4HJ5A 4POFA 5H1SE 4LF7L 1MJEA 3HOYG 4A3LH 3U58A 1K8AC 2RF4A 5JJIA 4JI6L 3STBC 2WB1E 4DR2L 2UUCL 2F3IA 3NBHB 3CMEA 3UE0A 2JA9A 3I4OA 4B3RL 1TWFH 2GN5A 3GTMH 1E22A 3J80i 2PQAB 3KOJA 1CKOA 1P8LA 1YITA 4IFDJ 3OTOL 1Q82C 4O0AA 4AH6A 1PH9A 3CCRA 4OX9L 4A75A 1IBLQ 1JE5A 3S2DH 1C0AA 4GKKQ 4IJHA 1V1QA 1S40A 3H3VI 4NXNQ 4IPGA 1QVGA 2JA8H 4QGUA 1KAWA 2RHSB 1U5KA 5IYCH 2ZM6L 1SN8A 4DKAC 1K3RA 2VZAA 3G71A 3HOUH 4DV0L 2R7ZH 2HQLA 5GAEC 5GQOA 1VQEA 2E8GA 3EBEA 3K7UC 4GN5A 5M3FH 4DV2L 2JA5G 3H3VH 1VQGA 3KJOA 1JT8A 4LFCQ 4PMWA 2ES2A 3PCOB 3PUYA 1L1OC 2E5LL 4BA2I 3G4SA 1YVCA 2OTJA 3KLWA 1N36L 1PH8A 1EIYB 1YEZA 1FVIA 4IOAA 1GVPA 4X66L 3I55A 3W5OA 5IYDH 2D62A 1CSPA 1QZGA 2CCZA 1OXTA 1VQBA 3M3YH 1JJ2A 4A3BH 1J5EQ 3HOXG 4BBSG 2JJQA 4LF5L 1X3GA 2B63H 1O7IA 3GO5A 5LMUL 2N3SA 1HZ9A 3HKSA 4GS3A 4L5TA 4JI6Q 2UUBL 3RLOA 1WYDA 2L15A 3TQYA 2UUCQ 1NMFA 3L2PA 1QVCA 2NZHA 5IP7H 2CQOA 1HR0L 4OWWB 2HT1A 4B3RQ 3E9HA 4A3JH 2AHOB 1VS0A 3JAMc 2JQOA 4HJ7A 2QA4A 4GNXA 3KYHC 3CCLA 4DR6L 2ZJQA 3K8AA 2HIXA 1KHIA 4YWMA 1AH9A 3RN2A 3KDFA 4OX9Q 5IY0A 4X65L 3PUWA 2JA7G 2GVAA 4LFAQ 4Y7NH 2YTXA 2Z6KA 3A0JA 4JI1L 4JI4L 2N78A 1IBKQ 2K4KA 4YCUA 4LFBL 2R92G 1HZCA 4APVA 2HHHQ 1VQNA 1G51A 4RG1A 2Q2IA 3J7A5 2MO1A 5JEAJ 1NY4A 4JI8Q 4DV0Q 2NVXH 2IX1A 4DV7L 4B3SQ 3VDYA 1S72A 4LF6Q 4DUZL 5BR8L 1V43A 3EN2A 2E2IH 2RCNA 4IO9A 1CKNB 1HZAA 4GOPB 1ASYA 3I56A 2KHJA 3HOWG 2E5LQ 4TQUS 5ELOA 1CSQA 2UXBL 4R4TA 1N36Q 1YZ6A 1Q46A 4LWCA 1YHAA 5IWAL 5FJ8G 1D8LA 2UXCL 4DR5Q 2OQ0A 1Q8KA 1OXVA 3ERSX 4JBWA 2JA6H 3H0GH 3GTLH 4DAYB 3RNUA 3I4MH 1VQMA 5IT9c 4JC0A 4R4OA 3RLFA 2VUMG 3MXNB 1PH7A 1UEBA 2UUBQ 2UXDL 4Y52H 1N8RC 1PH1A 4C3JH 2KHIA 2UU9L 2ZTCA 1IBLL 1PYBA 5C4XG 4A3IG 3L0OA 3FKIH 4GNXC 4GKKL 2Y0SE 3I4NG 1AE2A 1PVOA 1K9MC 4NXNL 3RZOH 3J7ZC 1LYLA 3HOYH 4LUVA 1EYGA 1PYSB 1TWGH 2VW9A 4JG2A 1NTGA 1XMOL 3TREA 1VQ6A 5M5XH 3GD7A 3PUXA 4X65Q 2GVBA 4LFCL 4LF8L 1L0WA 4IFDG 2DGYA 3KF8B 1J6QA 3CP0A 2EXDA 3S14H 4LFBQ 1V9PA 2OQKA 1HJPA 5FLXc 3J81c 1JB7A 3F1ZA 4IPCA 1E24A 3ER0A 3G48A 4DV7Q 1HR0W 3PO3H 1G291 5IYBG 3U4VA 3W1GA 3RLNA 3CC4A 3F8TA 2QEXA 1Q7YC 1J5EL 1PH4A 3HKZE 2UXBQ 3A5ZB 1I94L 1YHBA 1YHQA 2MQHA 3HFZB 3M7NA 2OTLA 1N33Q 3HOZG 4IPHA 5IWAQ 1A8VA 4YHHQ 2UXCQ 3GDEA 2JA5H 3NEMA 4R4IA 1EWIA 4LF4L 3RZDH 5JJKA 1KRTA 4OWTB 3OW2A 1EQQA 2A8VA 2JE6I 4QQBX 4JI5Q 3BZCA 3CCSA 4DV4L 4P75A 3H15A 2UXDQ 1ASZA 1KQSA 4MZ9A 5AJ3Q 3PF4A 1YI2A 2QGQA 2UU9Q 4TVAB 1XTDA 1SE8A 5IP9G 1PH2A 1KIXA 3T1YQ 1JMCA 1M90C 2LSSA 4LFAL 3HOXH 4BBSH 1VQ5A 1X54A 4JBJA 2KCTA 3PV0A 1NE3A 1IBKL 3M4QA 3SGIA 2ATWA 2HHHL 2PMZE 3K7AH 4O2DA 4JI8L 1XMOQ 4A4IA 1I5FA 4L5QA 3AYHB 4P74A 1HNZL 4PZ8A 4B3SL 4JBMA 4LF6L 5C4JH 4LF8Q 4A3MG 3K0XA 3CCMA 4JV5Q 2PQAA 4UP8A 4BY7G 1LTLA 2ZJPA 1K83H 1UE7A 2CWPA 1GD7A 1Y1WG 4GLAC 1XNQQ 4AYBG 4DR5L 4QL5A 4DAMA 2KENA 2JA7H 4BBRG 1XMQQ 5C0XJ 1VQ9A 4A3DG 1OXXK 2WAQG 4UP9A 5LMNQ 3WWVA 2R92H 1N34Q 1I94Q 5FLMH 4R4QA 2CWAA 4GN3B 3F2BA 1FJGL 3PO2G 2F4VL 3S15H 4PZ6A 5C44G 1SR3A 2I5MX 4LF4Q 1I50H 3CCEA 4GN4B 3HOWH 2R93G 4WJ3M 3FHWA 1XPRA 1UWVA 1OTCA 4DV4Q 2K50A 3GTGH 3CC7A 4GKJL 4LUOA 2EQSA 3I7FA 2AWNA 2KBNA 5FJ8H 1G6PA 2MFIA 2ZJRA 4DV3Q 1B70B 1U0LA 3ZJYC 1NJIC 1BKBA 3RN5A 4P71A 1H95A 3K80C 4LNQA 5LMNW 2PNHA 2BA1A 3U4ZA 3TS0A 4K0KQ 2VUMH 3KFUA 1WJJA 2R7ZG 2E2JH 1VQIA 2VQEL 1HNZQ 1KXLA 1MJCA 5C4XH 4A3IH 1VQ7A 2AMCB 4AQYQ 1C7YA 5GADC 4A76A 3ULJA 2Q2UA 5E7NA 4YY3Q 3I4NH 4A3CG 4BA1I 3J80c 4JI2Q 2VL6A 4DUYQ 4IFDI 2WB1G 4HIDA 2MNAA 1N33L 4YWKA 4DPGA 1EOVA 4YHHL 4DV5L 4A3EG 1C9OA 2ZTEA 1CKMA 4DV1L 3D0FA 3DM3A 3KF6B 4YCWA 4DR4Q 4P73A 4DR1L 4JI5L 5M3MG 2B63G 1SMXA 1QUQB 4R1JA 3CCJA 2IX0A 1PHJA 4L5SA 4JI3L 4LUZA 1FJGQ 5AJ3L 5IYBH 2F4VQ 1YJNA 3HOVG 1KRSA 4HJ9A 3RR5A 4GLVB 4HIKA 4A3JG 1CKNA 4GOPA 3T1YL 1TWHH 4A3FG 2JEAI 3CC2A 3F2CA 1E7ZA 4A3GH 4JI7L 2D0OA 4XTCS 4QJFA 3GTQH 3OYYA 2FXQA 3HOZH 4GKJQ 4X64L 3IRBA 1TXYA 2K52A 4RMFA 1QZHA 3AEVA 2NVQH 4DR3L 4BXXG 3STBD 3S2HH 2F52A 2Z6KC 3JC66 3CMAA 3NELA 1NMGA 5ELNA 1X55A 4ME3A 1VQ8A 3CF5A 1X6OA 2WP8J 2IHEA 4JV5L 2B29A 3L7ZC 1HNWL 1L1OB 1QUQA 2Q2HA 3M4PA 1VQKA 4A93G 4X62L 1VQ4A 4NXMQ 1UE1A 1TWCH 3CXCA 2VY3A 5IP9H 2VQEQ 1XNQL 4BY1G 3UDGA 3U50C 3UDXA 3UDIA 1XMQL 1I6HH 1XPUA 2XTIA 4OONA 5LMNL 1KD1C 1N34L 1A63A 1YIJA 2C35B 2XGTA 1VQLA 2BH2A 4HIMA 4JBKA 3W1BA 1E1OA 1WOCA 4EQ5A 2CFMA 5C3EG 1IBML 4DV5Q 2AKWB 1FL0A 4P72A 1B8AA 4PZ7A 1VQHA 5IE8A 4DV1Q 1XNRL 4B3MQ 5M5WH 4A3MH 2JA6G 3JAMi 4HJ8A 4QIWE 2MO0A 3CPWA 4JI0L 2UUAQ 4JCVE 4DR1Q 4BY7H 1L1OA 3PUZA 1Y1WH 3S16H 1Q1BA 2YYZA 2YU9H 2K5NA 4JI3Q 3CCVA 1Y1VG 4DV3L 4DK6C 4BBRH 5C0XG 1YJWA 3AQQA 3TRZA 4A3DH 1WCMG 2YTYA 4X6AH 4KI0A 1UE5A 1FGUA 1YNXA 2A19A 1E3PA 4JI7Q 3A74A 3S1MH 2NN6G 5J3BA 2K14A 4K0KL 4DNIA 2CKZB 2OCEA 2Z0SA 1Q1EA 3CW2C 4X64Q 3PO2H 4C2MH 4DR3Q 4JOIA 1SROA 5C44H 5EAYA 4A3KG 1GM5A 5K36G 3LGJA 4AQYL 1W2BA 4OO1G 3UDFA 2NZOA 2R93H 1L2FA 1I3QH 4YY3L 3FP9A 1OXUA 3PSIA 3PIPA 1HNWQ 1EQRA 4JI2L 4DUYL 1PV4A 1WI5A 1HH2P 4X62Q 2N8NA 1IZ6A 1CUKA 1N32Q 4KHZA 1KC8C 4L5RC 2OWOA 3PO3G 4JYAQ 3E9IA 2YV5A 3KJPA 4NPSA 1PFSA 4EX5A 1K8GA 3BZKA 4DR4L 3CD6A 2A1AA 1K73C 2R7DA 4LF9L 4A3LG 5JEAG 1B7YB 2VQFQ 2HIVA 2KCMA 3PF5A 4POGA 3Q8DA 1E1TA 3T1HL 1IBMQ 4PG3A 1VQAA 1YBYA 3GTKH 2VNUD 1Z9FA 1LM0A 2Y0SG 3ULLA 1XNRQ 4UPAA 1PH5A 1MKHA 4A3CH 1X3FA 2LXKA 4B3TQ 1M1KC 1BBWA 4AIMA 4GNXB 4JI0Q 4KHPQ 3MEFA 2I5LX 3S1NH 4FDBA 3KDFB 4A3EH 2NVTH 2LXJA 1PH3A 1VQCA 4C3HH 2D0PA 4MNOA 1R9TH 4YCVA 1VQPA 3AFPA 4DR7L 1MIUA 3BU2A 4R4CA 5M3MH 4DV6L 2I0QA 4LF7Q 2JA8G 1HNXL 5IYCG 3J81i 4HIOA 3HOUG 4JOIC 4C3IH 4DR2Q 3ICEA 1JJGA 5GAHC 1EUJA 4NXML 4IOCA 3HOVH 3CAMA 1OXSC 1Z47A 5M3FG 2EIFA 1YJ9A 3HKZG 1W3SA 1DGSA 1VQDA 4A3FH 1X9NA 3AFQA 4KLKA 1EFWA 5DLQE 3J81j 3OTOQ 1GO3E 3S24A 5JJLA 2IHFA 3S17H 4UY8C 4BXXH 2AWOA 5IYDG 1TWAH 2N49A 1HZBA 5HGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJC B;  2VS1 A;  1VQO A;  2I5H A;  2ZTD A;  1QVF A;  1IXR A;  2K5H A;  1A0I A;  4B3M L;  4A3B G;  1WFQ A;  3CCU A;  1VQF A;  4YWL A;  2ZM6 Q;  2UUA L;  3GTO H;  4A93 H;  4QY7 A;  4LF9 Q;  5FLM G;  2Q2T A;  1RIP A;  3D31 A;  4HJA A;  4DV2 Q;  4GLX A;  3T1H Q;  4IJL A;  1N9W A;  2IT1 A;  1PH6 A;  1P16 A;  1Y14 B;  5IP7 G;  4BY1 H;  2V1C C;  1S3O A;  4OWX B;  1GKH A;  3ULP A;  1Q81 C;  1IL2 A;  3EIV A;  3TEH B;  2WFW A;  1X3E A;  4LW1 A;  2JK8 A;  1VQJ A;  3A5U A;  4X66 Q;  1BVS A;  1EIF A;  3K81 C;  5C3E H;  1Q12 A;  5GRO A;  2PI2 E;  2IY5 B;  1AE3 A;  4UP7 A;  4DK3 C;  4AYB E;  2R6G A;  3I2Z A;  4DR7 Q;  3S1Q H;  3KF6 A;  5C0X I;  3BJU A;  2WAQ E;  4MTN A;  4DV6 Q;  4LF5 Q;  1HNX Q;  5LMU Q;  3F2D A;  1XJV A;  1LUZ A;  1SRU A;  3B6Y A;  2BA0 A;  2NN6 I;  1BBU A;  1UE6 A;  1SFO H;  4WJ4 A;  2B3G A;  1Y1V H;  1T9H A;  3CCQ A;  1N32 L;  1HR0 Q;  3S1R H;  4JYA L;  3CQZ H;  1WCM H;  3E0E A;  3M9B A;  4XIG S;  2ID0 A;  2JEB I;  2NVY H;  5M5Y H;  3M85 A;  1VCI A;  3GTJ H;  2RHQ B;  3M4O H;  4DR6 Q;  4H02 A;  4OO1 I;  2K5V A;  2YTV A;  4ALP A;  2ASB A;  3PIO A;  3NEN A;  1A62 A;  1RL2 A;  2VQF L;  2DUD A;  5HY6 A;  4OXP A;  4A3K H;  1Q86 C;  4IPD A;  3UE1 A;  4NB3 A;  1X56 A;  3CPF A;  1IYJ B;  4JI4 Q;  3H0G G;  4JI1 Q;  2K75 A;  1K0R A;  1XPO A;  4B3T L;  3I4M G;  2E2H H;  4KHP L;  3PUV A;  1NBW A;  2BH8 A;  3G6E A;  4J15 A;  2H5X A;  5GAG C;  1SLJ A;  1KL9 A;  2ALY B;  2PI2 A;  2R7F A;  5BR8 Q;  4DUZ Q;  4GOP C;  1PA6 A;  3GTP H;  1D7Q A;  1X65 A;  3FKI G;  4A3G G;  3PGZ A;  3DLL A;  3TS2 A;  4HJ5 A;  4POF A;  5H1S E;  4LF7 L;  1MJE A;  3HOY G;  4A3L H;  3U58 A;  1K8A C;  2RF4 A;  5JJI A;  4JI6 L;  3STB C;  2WB1 E;  4DR2 L;  2UUC L;  2F3I A;  3NBH B;  3CME A;  3UE0 A;  2JA9 A;  3I4O A;  4B3R L;  1TWF H;  2GN5 A;  3GTM H;  1E22 A;  3J80 i;  2PQA B;  3KOJ A;  1CKO A;  1P8L A;  1YIT A;  4IFD J;  3OTO L;  1Q82 C;  4O0A A;  4AH6 A;  1PH9 A;  3CCR A;  4OX9 L;  4A75 A;  1IBL Q;  1JE5 A;  3S2D H;  1C0A A;  4GKK Q;  4IJH A;  1V1Q A;  1S40 A;  3H3V I;  4NXN Q;  4IPG A;  1QVG A;  2JA8 H;  4QGU A;  1KAW A;  2RHS B;  1U5K A;  5IYC H;  2ZM6 L;  1SN8 A;  4DKA C;  1K3R A;  2VZA A;  3G71 A;  3HOU H;  4DV0 L;  2R7Z H;  2HQL A;  5GAE C;  5GQO A;  1VQE A;  2E8G A;  3EBE A;  3K7U C;  4GN5 A;  5M3F H;  4DV2 L;  2JA5 G;  3H3V H;  1VQG A;  3KJO A;  1JT8 A;  4LFC Q;  4PMW A;  2ES2 A;  3PCO B;  3PUY A;  1L1O C;  2E5L L;  4BA2 I;  3G4S A;  1YVC A;  2OTJ A;  3KLW A;  1N36 L;  1PH8 A;  1EIY B;  1YEZ A;  1FVI A;  4IOA A;  1GVP A;  4X66 L;  3I55 A;  3W5O A;  5IYD H;  2D62 A;  1CSP A;  1QZG A;  2CCZ A;  1OXT A;  1VQB A;  3M3Y H;  1JJ2 A;  4A3B H;  1J5E Q;  3HOX G;  4BBS G;  2JJQ A;  4LF5 L;  1X3G A;  2B63 H;  1O7I A;  3GO5 A;  5LMU L;  2N3S A;  1HZ9 A;  3HKS A;  4GS3 A;  4L5T A;  4JI6 Q;  2UUB L;  3RLO A;  1WYD A;  2L15 A;  3TQY A;  2UUC Q;  1NMF A;  3L2P A;  1QVC A;  2NZH A;  5IP7 H;  2CQO A;  1HR0 L;  4OWW B;  2HT1 A;  4B3R Q;  3E9H A;  4A3J H;  2AHO B;  1VS0 A;  3JAM c;  2JQO A;  4HJ7 A;  2QA4 A;  4GNX A;  3KYH C;  3CCL A;  4DR6 L;  2ZJQ A;  3K8A A;  2HIX A;  1KHI A;  4YWM A;  1AH9 A;  3RN2 A;  3KDF A;  4OX9 Q;  5IY0 A;  4X65 L;  3PUW A;  2JA7 G;  2GVA A;  4LFA Q;  4Y7N H;  2YTX A;  2Z6K A;  3A0J A;  4JI1 L;  4JI4 L;  2N78 A;  1IBK Q;  2K4K A;  4YCU A;  4LFB L;  2R92 G;  1HZC A;  4APV A;  2HHH Q;  1VQN A;  1G51 A;  4RG1 A;  2Q2I A;  3J7A 5;  2MO1 A;  5JEA J;  1NY4 A;  4JI8 Q;  4DV0 Q;  2NVX H;  2IX1 A;  4DV7 L;  4B3S Q;  3VDY A;  1S72 A;  4LF6 Q;  4DUZ L;  5BR8 L;  1V43 A;  3EN2 A;  2E2I H;  2RCN A;  4IO9 A;  1CKN B;  1HZA A;  4GOP B;  1ASY A;  3I56 A;  2KHJ A;  3HOW G;  2E5L Q;  4TQU S;  5ELO A;  1CSQ A;  2UXB L;  4R4T A;  1N36 Q;  1YZ6 A;  1Q46 A;  4LWC A;  1YHA A;  5IWA L;  5FJ8 G;  1D8L A;  2UXC L;  4DR5 Q;  2OQ0 A;  1Q8K A;  1OXV A;  3ERS X;  4JBW A;  2JA6 H;  3H0G H;  3GTL H;  4DAY B;  3RNU A;  3I4M H;  1VQM A;  5IT9 c;  4JC0 A;  4R4O A;  3RLF A;  2VUM G;  3MXN B;  1PH7 A;  1UEB A;  2UUB Q;  2UXD L;  4Y52 H;  1N8R C;  1PH1 A;  4C3J H;  2KHI A;  2UU9 L;  2ZTC A;  1IBL L;  1PYB A;  5C4X G;  4A3I G;  3L0O A;  3FKI H;  4GNX C;  4GKK L;  2Y0S E;  3I4N G;  1AE2 A;  1PVO A;  1K9M C;  4NXN L;  3RZO H;  3J7Z C;  1LYL A;  3HOY H;  4LUV A;  1EYG A;  1PYS B;  1TWG H;  2VW9 A;  4JG2 A;  1NTG A;  1XMO L;  3TRE A;  1VQ6 A;  5M5X H;  3GD7 A;  3PUX A;  4X65 Q;  2GVB A;  4LFC L;  4LF8 L;  1L0W A;  4IFD G;  2DGY A;  3KF8 B;  1J6Q A;  3CP0 A;  2EXD A;  3S14 H;  4LFB Q;  1V9P A;  2OQK A;  1HJP A;  5FLX c;  3J81 c;  1JB7 A;  3F1Z A;  4IPC A;  1E24 A;  3ER0 A;  3G48 A;  4DV7 Q;  1HR0 W;  3PO3 H;  1G29 1;  5IYB G;  3U4V A;  3W1G A;  3RLN A;  3CC4 A;  3F8T A;  2QEX A;  1Q7Y C;  1J5E L;  1PH4 A;  3HKZ E;  2UXB Q;  3A5Z B;  1I94 L;  1YHB A;  1YHQ A;  2MQH A;  3HFZ B;  3M7N A;  2OTL A;  1N33 Q;  3HOZ G;  4IPH A;  5IWA Q;  1A8V A;  4YHH Q;  2UXC Q;  3GDE A;  2JA5 H;  3NEM A;  4R4I A;  1EWI A;  4LF4 L;  3RZD H;  5JJK A;  1KRT A;  4OWT B;  3OW2 A;  1EQQ A;  2A8V A;  2JE6 I;  4QQB X;  4JI5 Q;  3BZC A;  3CCS A;  4DV4 L;  4P75 A;  3H15 A;  2UXD Q;  1ASZ A;  1KQS A;  4MZ9 A;  5AJ3 Q;  3PF4 A;  1YI2 A;  2QGQ A;  2UU9 Q;  4TVA B;  1XTD A;  1SE8 A;  5IP9 G;  1PH2 A;  1KIX A;  3T1Y Q;  1JMC A;  1M90 C;  2LSS A;  4LFA L;  3HOX H;  4BBS H;  1VQ5 A;  1X54 A;  4JBJ A;  2KCT A;  3PV0 A;  1NE3 A;  1IBK L;  3M4Q A;  3SGI A;  2ATW A;  2HHH L;  2PMZ E;  3K7A H;  4O2D A;  4JI8 L;  1XMO Q;  4A4I A;  1I5F A;  4L5Q A;  3AYH B;  4P74 A;  1HNZ L;  4PZ8 A;  4B3S L;  4JBM A;  4LF6 L;  5C4J H;  4LF8 Q;  4A3M G;  3K0X A;  3CCM A;  4JV5 Q;  2PQA A;  4UP8 A;  4BY7 G;  1LTL A;  2ZJP A;  1K83 H;  1UE7 A;  2CWP A;  1GD7 A;  1Y1W G;  4GLA C;  1XNQ Q;  4AYB G;  4DR5 L;  4QL5 A;  4DAM A;  2KEN A;  2JA7 H;  4BBR G;  1XMQ Q;  5C0X J;  1VQ9 A;  4A3D G;  1OXX K;  2WAQ G;  4UP9 A;  5LMN Q;  3WWV A;  2R92 H;  1N34 Q;  1I94 Q;  5FLM H;  4R4Q A;  2CWA A;  4GN3 B;  3F2B A;  1FJG L;  3PO2 G;  2F4V L;  3S15 H;  4PZ6 A;  5C44 G;  1SR3 A;  2I5M X;  4LF4 Q;  1I50 H;  3CCE A;  4GN4 B;  3HOW H;  2R93 G;  4WJ3 M;  3FHW A;  1XPR A;  1UWV A;  1OTC A;  4DV4 Q;  2K50 A;  3GTG H;  3CC7 A;  4GKJ L;  4LUO A;  2EQS A;  3I7F A;  2AWN A;  2KBN A;  5FJ8 H;  1G6P A;  2MFI A;  2ZJR A;  4DV3 Q;  1B70 B;  1U0L A;  3ZJY C;  1NJI C;  1BKB A;  3RN5 A;  4P71 A;  1H95 A;  3K80 C;  4LNQ A;  5LMN W;  2PNH A;  2BA1 A;  3U4Z A;  3TS0 A;  4K0K Q;  2VUM H;  3KFU A;  1WJJ A;  2R7Z G;  2E2J H;  1VQI A;  2VQE L;  1HNZ Q;  1KXL A;  1MJC A;  5C4X H;  4A3I H;  1VQ7 A;  2AMC B;  4AQY Q;  1C7Y A;  5GAD C;  4A76 A;  3ULJ A;  2Q2U A;  5E7N A;  4YY3 Q;  3I4N H;  4A3C G;  4BA1 I;  3J80 c;  4JI2 Q;  2VL6 A;  4DUY Q;  4IFD I;  2WB1 G;  4HID A;  2MNA A;  1N33 L;  4YWK A;  4DPG A;  1EOV A;  4YHH L;  4DV5 L;  4A3E G;  1C9O A;  2ZTE A;  1CKM A;  4DV1 L;  3D0F A;  3DM3 A;  3KF6 B;  4YCW A;  4DR4 Q;  4P73 A;  4DR1 L;  4JI5 L;  5M3M G;  2B63 G;  1SMX A;  1QUQ B;  4R1J A;  3CCJ A;  2IX0 A;  1PHJ A;  4L5S A;  4JI3 L;  4LUZ A;  1FJG Q;  5AJ3 L;  5IYB H;  2F4V Q;  1YJN A;  3HOV G;  1KRS A;  4HJ9 A;  3RR5 A;  4GLV B;  4HIK A;  4A3J G;  1CKN A;  4GOP A;  3T1Y L;  1TWH H;  4A3F G;  2JEA I;  3CC2 A;  3F2C A;  1E7Z A;  4A3G H;  4JI7 L;  2D0O A;  4XTC S;  4QJF A;  3GTQ H;  3OYY A;  2FXQ A;  3HOZ H;  4GKJ Q;  4X64 L;  3IRB A;  1TXY A;  2K52 A;  4RMF A;  1QZH A;  3AEV A;  2NVQ H;  4DR3 L;  4BXX G;  3STB D;  3S2H H;  2F52 A;  2Z6K C;  3JC6 6;  3CMA A;  3NEL A;  1NMG A;  5ELN A;  1X55 A;  4ME3 A;  1VQ8 A;  3CF5 A;  1X6O A;  2WP8 J;  2IHE A;  4JV5 L;  2B29 A;  3L7Z C;  1HNW L;  1L1O B;  1QUQ A;  2Q2H A;  3M4P A;  1VQK A;  4A93 G;  4X62 L;  1VQ4 A;  4NXM Q;  1UE1 A;  1TWC H;  3CXC A;  2VY3 A;  5IP9 H;  2VQE Q;  1XNQ L;  4BY1 G;  3UDG A;  3U50 C;  3UDX A;  3UDI A;  1XMQ L;  1I6H H;  1XPU A;  2XTI A;  4OON A;  5LMN L;  1KD1 C;  1N34 L;  1A63 A;  1YIJ A;  2C35 B;  2XGT A;  1VQL A;  2BH2 A;  4HIM A;  4JBK A;  3W1B A;  1E1O A;  1WOC A;  4EQ5 A;  2CFM A;  5C3E G;  1IBM L;  4DV5 Q;  2AKW B;  1FL0 A;  4P72 A;  1B8A A;  4PZ7 A;  1VQH A;  5IE8 A;  4DV1 Q;  1XNR L;  4B3M Q;  5M5W H;  4A3M H;  2JA6 G;  3JAM i;  4HJ8 A;  4QIW E;  2MO0 A;  3CPW A;  4JI0 L;  2UUA Q;  4JCV E;  4DR1 Q;  4BY7 H;  1L1O A;  3PUZ A;  1Y1W H;  3S16 H;  1Q1B A;  2YYZ A;  2YU9 H;  2K5N A;  4JI3 Q;  3CCV A;  1Y1V G;  4DV3 L;  4DK6 C;  4BBR H;  5C0X G;  1YJW A;  3AQQ A;  3TRZ A;  4A3D H;  1WCM G;  2YTY A;  4X6A H;  4KI0 A;  1UE5 A;  1FGU A;  1YNX A;  2A19 A;  1E3P A;  4JI7 Q;  3A74 A;  3S1M H;  2NN6 G;  5J3B A;  2K14 A;  4K0K L;  4DNI A;  2CKZ B;  2OCE A;  2Z0S A;  1Q1E A;  3CW2 C;  4X64 Q;  3PO2 H;  4C2M H;  4DR3 Q;  4JOI A;  1SRO A;  5C44 H;  5EAY A;  4A3K G;  1GM5 A;  5K36 G;  3LGJ A;  4AQY L;  1W2B A;  4OO1 G;  3UDF A;  2NZO A;  2R93 H;  1L2F A;  1I3Q H;  4YY3 L;  3FP9 A;  1OXU A;  3PSI A;  3PIP A;  1HNW Q;  1EQR A;  4JI2 L;  4DUY L;  1PV4 A;  1WI5 A;  1HH2 P;  4X62 Q;  2N8N A;  1IZ6 A;  1CUK A;  1N32 Q;  4KHZ A;  1KC8 C;  4L5R C;  2OWO A;  3PO3 G;  4JYA Q;  3E9I A;  2YV5 A;  3KJP A;  4NPS A;  1PFS A;  4EX5 A;  1K8G A;  3BZK A;  4DR4 L;  3CD6 A;  2A1A A;  1K73 C;  2R7D A;  4LF9 L;  4A3L G;  5JEA G;  1B7Y B;  2VQF Q;  2HIV A;  2KCM A;  3PF5 A;  4POG A;  3Q8D A;  1E1T A;  3T1H L;  1IBM Q;  4PG3 A;  1VQA A;  1YBY A;  3GTK H;  2VNU D;  1Z9F A;  1LM0 A;  2Y0S G;  3ULL A;  1XNR Q;  4UPA A;  1PH5 A;  1MKH A;  4A3C H;  1X3F A;  2LXK A;  4B3T Q;  1M1K C;  1BBW A;  4AIM A;  4GNX B;  4JI0 Q;  4KHP Q;  3MEF A;  2I5L X;  3S1N H;  4FDB A;  3KDF B;  4A3E H;  2NVT H;  2LXJ A;  1PH3 A;  1VQC A;  4C3H H;  2D0P A;  4MNO A;  1R9T H;  4YCV A;  1VQP A;  3AFP A;  4DR7 L;  1MIU A;  3BU2 A;  4R4C A;  5M3M H;  4DV6 L;  2I0Q A;  4LF7 Q;  2JA8 G;  1HNX L;  5IYC G;  3J81 i;  4HIO A;  3HOU G;  4JOI C;  4C3I H;  4DR2 Q;  3ICE A;  1JJG A;  5GAH C;  1EUJ A;  4NXM L;  4IOC A;  3HOV H;  3CAM A;  1OXS C;  1Z47 A;  5M3F G;  2EIF A;  1YJ9 A;  3HKZ G;  1W3S A;  1DGS A;  1VQD A;  4A3F H;  1X9N A;  3AFQ A;  4KLK A;  1EFW A;  5DLQ E;  3J81 j;  3OTO Q;  1GO3 E;  3S24 A;  5JJL A;  2IHF A;  3S17 H;  4UY8 C;  4BXX H;  2AWO A;  5IYD G;  1TWA H;  2N49 A;  1HZB A;  5HGQ A; 
#chains in the Genus database with same CATH topology
 2AUK A;  1JJC B;  4CDC C;  1QVF A;  3CU7 A;  2KEE A;  3EJI A;  1RCV D;  2JP1 A;  3Q24 A;  1VQF A;  4YWL A;  2JA6 B;  1EY0 A;  4DAV A;  3GTO H;  1AZP A;  1HQR D;  1S4Z A;  1I6V C;  3D31 A;  3Q0A A;  4FXD A;  4JW0 A;  1N9W A;  1C8C A;  5C4Z A;  1Y1V B;  2Z6B A;  1VF5 C;  2NWG A;  4X3S A;  4OWX B;  3CQZ B;  2O5J C;  1HXY D;  4PMC A;  5G3L D;  1VQJ A;  4X66 Q;  2BOS A;  5IGF A;  5C4H A;  1Q12 A;  4EQP A;  3J7A V;  4WRD A;  4JPB W;  2IY5 B;  3R93 A;  4DK3 C;  2HCI A;  4KKS A;  3I2Z A;  4DR7 Q;  5JPM C;  1WTH A;  4KN7 C;  5A35 A;  2WAQ E;  4MTN A;  1FNW A;  4QF4 A;  1IL8 A;  4HSV A;  1EQV A;  3S1R H;  4JYA L;  1JE4 A;  5JPN C;  3PO3 B;  1TKW B;  2CH4 W;  1MGS A;  2NVY H;  5M5Y H;  1HA6 A;  2NN6 H;  2K5V A;  2YTV A;  1A3V A;  1H9R A;  4CDF C;  2PNR C;  4A3K H;  4NB3 A;  1E2W A;  3BDL A;  1JOK A;  1XPO A;  2V4D A;  2SNS A;  3I4M G;  4KHP L;  1NBW A;  1LTT D;  2FMC A;  2L4N A;  4J15 A;  1PFM A;  4C3J G;  2KOL A;  2R7F A;  3K58 A;  1HFN A;  4G7Z C;  3FKI G;  5DEH A;  2EYM A;  3PGZ A;  4ABN A;  1FR3 A;  5H1S E;  3G7L A;  1MJE A;  4ULL A;  3STB C;  1V1O A;  4KD3 A;  2UUC L;  2OXP A;  3T4A C;  1ZYR D;  4IQZ A;  3HS0 C;  4OEM B;  5ELE A;  4IFD J;  1Q82 C;  3P20 A;  3DXJ C;  3BYT B;  1S5B D;  4Q5V A;  4A75 A;  1STE A;  1C0A A;  4IJH A;  5C3X A;  4ZRZ A;  2F0V A;  4QGU A;  4OEL B;  1U5K A;  1WTR A;  2R92 B;  1ET6 A;  2VZA A;  2E8G A;  3SXH A;  3EBE A;  5M3F H;  2B2W A;  4LFC Q;  2R61 A;  2L11 A;  1L1O C;  2E5L L;  3G4S A;  1G2T A;  1EIY B;  1FVI A;  1GUW A;  4X66 L;  5LL6 X;  3GTG B;  4H44 C;  1D5X C;  3AU7 A;  2CCZ A;  4M8A A;  3M3Y H;  1VQB A;  2HQE A;  3KK7 A;  3HOX G;  1JQY D;  3I90 A;  2B63 H;  1M4V A;  3GO5 A;  4BWG B;  1HZ9 A;  1WYD A;  3TQY A;  3NSW A;  1NMF A;  4DK0 A;  5CBA E;  5IGE A;  3SDZ A;  2NZH A;  2K6A A;  3TN2 A;  2AHO B;  3JAM c;  1FYC A;  1BQQ T;  3FMC A;  2QA4 A;  4GNX A;  1HHV A;  1DOM A;  5CMD A;  1AH9 A;  4K8I A;  1ZEQ X;  4OX9 Q;  4X65 L;  2GVA A;  4LFA Q;  4Y7N H;  3I72 A;  4OHJ A;  3A0J A;  4TSS A;  4YCU A;  3H0G B;  2R92 G;  4APV A;  2HHH Q;  5D65 A;  2BE5 C;  3J7A 5;  2MO1 A;  5JEA J;  2RBM A;  2EJM A;  4LF6 Q;  3SR1 A;  4OL7 A;  2A69 D;  1ASY A;  5EKK A;  3I56 A;  3KLS X;  3HOW G;  4TQU S;  4A3G B;  1S5D D;  1STG A;  2KJX A;  1TVX A;  4LWC A;  1TWG B;  3TP6 A;  4DR5 Q;  2QIL A;  2OQ0 A;  1RF2 D;  1Q8K A;  1JWM D;  1I4X A;  2XN9 C;  3ERS X;  4JBW A;  5CYU A;  2JA6 H;  4RCN A;  4DAY B;  3I4M H;  1VQM A;  5IT9 c;  4R4O A;  2VUM G;  3K57 A;  2UXD L;  1DD2 A;  4Y52 H;  1UNS A;  2AQ2 B;  4C3J H;  2KHI A;  1F2M A;  2ZTC A;  3MWY W;  5DM7 3;  3FKI H;  1SDF A;  1I6H B;  3SVM A;  3RZO H;  4EGV A;  1XMO L;  5M5X H;  3PUX A;  1KTK A;  4FF1 A;  2JA5 B;  4LFC L;  5TSS A;  1DM0 B;  4LFB Q;  2O4X A;  3R2T A;  3DUZ A;  1JB7 A;  3VYU A;  3ER0 A;  3MAQ A;  1ENA A;  3PO3 H;  5IYB G;  4CJ0 B;  3U4V A;  3W1G A;  5FLX L;  3OW7 A;  2L55 A;  4BBS B;  1H9M A;  4IPH A;  2UXC Q;  1BCP C;  1PDQ A;  4R4I A;  5JJK A;  1EQQ A;  2K5D A;  5KIX A;  1E2V A;  2JE6 I;  1I3Q B;  1Q90 A;  4CHT B;  1PTO D;  3HZX A;  4ZKB B;  1QIL A;  1YI2 A;  2QGQ A;  1KIX A;  1PFB A;  4LFA L;  4JVZ A;  3HOX H;  2KHS A;  5COR A;  1NE3 A;  2HHH L;  2PMZ E;  2B2U C;  1PTO F;  4LF6 L;  5ELF A;  4N8F A;  4LF8 Q;  5COY A;  1ONL A;  2PQA A;  4JV5 Q;  2F0S A;  1K83 H;  1BBX C;  2CWP A;  5ELC A;  2D9U A;  3W3A A;  4GLA C;  2KCN A;  4AYB G;  4DR5 L;  4DAM A;  2K7V A;  1VQ9 A;  4A3D G;  1MD2 D;  4UP9 A;  1PZI D;  2R92 H;  4ZKC B;  2PPB C;  2RSO A;  4R4Q A;  3F2U A;  1SE3 A;  3F2B A;  4S3S A;  2MGS A;  4UAI A;  3S15 H;  4PZ6 A;  2PYK A;  2C9O A;  2I5M X;  1QE6 A;  1I50 H;  4OIJ A;  3HOW H;  1K28 A;  4WJ3 M;  3FHW A;  5I6W A;  1XPR A;  1OTC A;  3BZD B;  2QW7 A;  3GTG H;  1KDB A;  1ILP A;  2SNM A;  2KBN A;  3NTK A;  3S17 B;  4DV3 Q;  3RN5 A;  4P71 A;  1H95 A;  4L63 B;  4LNQ A;  1RJT A;  1Y8O B;  2F0M A;  3VR4 A;  3VYT A;  2VUM H;  3KFU A;  2E2J H;  1I4H A;  2G5D A;  3OOC A;  5GAD C;  2Q2U A;  5E7N A;  1D2B A;  1SJE D;  4IFD I;  1U4P A;  1EYA A;  4DV5 L;  2I07 B;  4N8X 1;  1Z6H A;  1CKM A;  2ZTE A;  2MJ8 A;  4C3H G;  4DV1 L;  1IW7 D;  2NVQ B;  4Z9C B;  3KF6 B;  3QWN A;  3EA6 A;  4P73 A;  2N88 A;  5M3M G;  5KNB A;  1J8I A;  3BYY B;  2XSC A;  1CA6 A;  4L5S A;  5IYB H;  5C6A A;  1YJN A;  5EPL A;  4HJ9 A;  4XYO A;  4IUV A;  4A3G H;  1E7Z A;  2XRQ D;  2D0O A;  1S5E D;  1AEX A;  3OYY A;  3M4O B;  2FXQ A;  4HN7 A;  1QZH A;  4RMF A;  2RDH A;  1EU3 A;  1NMG A;  5ELN A;  5FK9 C;  1VQ8 A;  3TDQ A;  4A3M B;  4JV5 L;  4L8J A;  5FO7 B;  2B29 A;  3MTS A;  1L1O B;  3CKI B;  1QUQ A;  1SYF A;  2A68 D;  1JWS D;  3GP7 A;  4NXM Q;  1YNJ D;  3U50 C;  1I6H H;  4BBR B;  2KEC A;  2B39 A;  3ND9 A;  2WAQ B;  4OON A;  4NW2 A;  1WTQ A;  2XGT A;  1KNA A;  1CTM A;  5LL6 S;  2CFM A;  1A3T A;  4PNY A;  1FL0 A;  4P72 A;  3PO2 B;  3C2P A;  5C44 B;  1TWF B;  2L0C A;  1KAA A;  1CQV A;  4I65 A;  2K5N A;  3CCV A;  4DV3 L;  1YJW A;  2N55 A;  1RD9 D;  1WTV A;  2Z8L A;  4A3D H;  2YTY A;  1KDA A;  2RSN A;  4QIW B;  5J3B A;  2R3Z A;  4F88 A;  5CV5 A;  1Q1E A;  3VA5 A;  4DR3 Q;  4JOI A;  2R7Z B;  4OO1 G;  5EJW A;  1I3Q H;  2F0Q A;  2F0G A;  5I9O A;  3PIP A;  3L3O C;  5FLX E;  5CR3 A;  1EWC A;  1SE4 A;  1PV4 A;  4X62 Q;  1CUK A;  1N32 Q;  3CRL C;  1EY8 A;  2EYO A;  2OWO A;  3E9I A;  2K5Q A;  4ZCK A;  1R9T B;  3BZK A;  4B9X A;  4A3L G;  5JEA G;  2FHT A;  1B7Y B;  2VQF Q;  3PF5 A;  3Q8D A;  3T1H L;  1GOZ A;  3VR2 A;  4C3I B;  1B9N A;  2F0P A;  2RKS A;  1XNR Q;  1MKH A;  1X3F A;  4A3J B;  1XX8 A;  1M1K C;  1BBW A;  4JI0 Q;  1O80 A;  1BUV T;  3RUZ A;  2I46 A;  4DA2 A;  2NVT H;  2F0I A;  4C3H H;  1CI3 M;  4MNO A;  1VQP A;  5M3M H;  1PRT D;  5IYC G;  3J81 i;  3HOU G;  4DR2 Q;  3GTO B;  1EUJ A;  4NXM L;  2NVX B;  4DNT B;  3CAM A;  1Z47 A;  2EIF A;  1YJ9 A;  1W3S A;  1X9N A;  5ISR A;  1WD1 A;  2KUM A;  4ZYS A;  1ESF A;  3J81 j;  1YNN D;  2SEB D;  1PRT F;  3S24 A;  5JJL A;  3S17 H;  5HUR A;  1X32 A;  2AWO A;  5IYD G;  1RTN A;  2N49 A;  5HGQ A;  2DNE A;  2TMP A;  3E3X A;  1V1P A;  4KY6 A;  4DXG A;  1BCP B;  2I5H A;  1IXR A;  3WOF A;  2EY2 A;  3E0J A;  2ZM6 Q;  1CHP D;  4QY7 A;  4LF9 Q;  5FLM G;  1AFP A;  3TP8 A;  1AZQ A;  4FXK C;  3V96 A;  1J9O A;  5IP7 G;  1R4P B;  3S1R B;  1TS2 A;  1S3O A;  3JAM E;  4X3T A;  3C46 A;  1B50 A;  1DCZ A;  1TII D;  3EIV A;  3TEH B;  2NVY B;  2WFW A;  3A5U A;  1NUC A;  3KBG A;  5GRO A;  4UP7 A;  4A3K B;  4AYB E;  2G9D A;  3BJU A;  4LF5 Q;  3S14 B;  1XJV A;  1LUZ A;  4MHE A;  2NN6 I;  1BBU A;  1DON A;  3CCQ A;  1N32 L;  1M8A A;  3GQB A;  3E0E A;  3A7L A;  3M9B A;  3M4O H;  1VCI A;  3PIO A;  2E75 C;  3NEN A;  3BG3 A;  2VQF L;  3MEH A;  5IIF A;  4OXP A;  1K8O A;  1NCV A;  3ZYY X;  4OO1 H;  3J7Y W;  1TT2 A;  1Q8I A;  1PXU A;  4F7X A;  5A2Q L;  2K75 A;  1K0R A;  4IUT A;  1AW7 A;  1GUT A;  3PUV A;  2BH8 A;  2H5X A;  3D4D A;  4YIJ A;  1SLJ A;  2ALY B;  4DUZ Q;  1ML0 D;  1D7Q A;  1PA6 A;  4KTA A;  3WOE A;  1X65 A;  3TS2 A;  3MVV A;  4ZAI A;  4POF A;  3K5N A;  2NZ1 D;  3A8K E;  3OIP A;  4RGO S;  3HOY G;  5JEA H;  3U58 A;  4A3L H;  2ZT9 C;  4DNR B;  1EFI D;  2EYH A;  3K7A B;  4DR2 L;  3NBH B;  2JA9 A;  2EPB A;  3EVQ A;  1TWF H;  1NSN S;  2GN5 A;  5M3F B;  4EQN A;  3GTM H;  3VR5 A;  4ILW A;  1E2Z A;  1PH9 A;  1TR5 A;  3DWP A;  4U67 3;  1EY5 A;  5EGT A;  4GKK Q;  1S40 A;  3PMF A;  3M3Y B;  2BDO A;  3CHB D;  2ZM6 L;  5IYC H;  5E4X A;  1SN8 A;  2XIW A;  4DKA C;  3HOU H;  2R7Z H;  5GAE C;  1VQE A;  4DGZ A;  4IN3 A;  5J39 A;  3P1H A;  3H3V H;  3MXP A;  1JT8 A;  3PUY A;  3C1F A;  2HD3 A;  1EL0 A;  3MHB A;  2OTJ A;  1N36 L;  1PH8 A;  2PMZ B;  1GVP A;  1EY6 A;  5IYD H;  2D62 A;  1QZG A;  1EY7 A;  1JJ2 A;  1SMY D;  3DEO A;  2AUJ D;  4LF5 L;  1IYV A;  1ZYR C;  4GS3 A;  4RHS A;  2UUC Q;  4ODG A;  5BN4 A;  5IP7 H;  4OWW B;  1A6X A;  1B53 A;  4A3J H;  1VS0 A;  4K5W A;  4HJ7 A;  3K8A A;  2WV6 D;  1CHQ D;  4F87 A;  3RN2 A;  3KDF A;  1II3 A;  2JA7 G;  3BDO A;  5EKI A;  2K28 A;  2N78 A;  5KEE A;  2K4K A;  1HZC A;  3I4M B;  4RG1 A;  2IX3 A;  2DN8 A;  2NVX H;  4DV7 L;  2B2W C;  3VDY A;  1S72 A;  1SE2 A;  2HCC A;  4DUZ L;  1KLG D;  4C3J B;  1V43 A;  4F8M A;  3S9W A;  2E2I H;  4IO9 A;  4LK1 C;  4GOP B;  1JOQ A;  1CZW A;  2E5L Q;  3FKI B;  3D8G A;  1O7Z A;  1YZ6 A;  3RZO B;  3TP7 A;  2PO4 A;  1QG7 A;  1D5M C;  5IWA L;  2HDL A;  4FF3 A;  3BVM A;  5M5X B;  3GTL H;  2FIN B;  5FO8 B;  3URY A;  3MXN B;  1PH7 A;  3FVQ A;  4H7B A;  1ET9 A;  3L0O A;  4GNX C;  4V19 0;  4GKK L;  3I4N G;  1AE2 A;  3I3C A;  3J7Z C;  3HOY H;  4DN4 M;  1TY0 A;  2CH4 A;  4JG2 A;  1NTG A;  4X65 Q;  1JIC A;  2K1B A;  2GVB A;  1D1I A;  1C48 A;  1J6Q A;  3S14 H;  4UHV A;  1V9P A;  1HJP A;  1PMR A;  5FLX c;  1K0S A;  1HR0 W;  1F9P A;  3RLN A;  4DAP A;  5T1I A;  3TP5 A;  2QDL A;  4KK7 A;  1Q7Y C;  1PH4 A;  3HOX B;  3M4Y A;  4FVM A;  3HOZ G;  4RGM A;  4YHH Q;  1A8V A;  3DM1 A;  3NEM A;  2B2V A;  1EWI A;  4LF4 L;  3I70 A;  2G9H D;  4QQB X;  4DV4 L;  1A15 A;  2UXD Q;  1K83 B;  3PF4 A;  1L0X B;  3P75 A;  1STN A;  2F0U A;  1XTD A;  1EIG A;  5D3I B;  1RDP D;  3T1Y Q;  2LSS A;  3L9A X;  2CW0 C;  1X54 A;  4JBJ A;  2IW3 A;  3M4Q A;  2K05 A;  3K7A H;  5A2Q E;  1XMO Q;  4A4I A;  1I5F A;  4HCE A;  4L5Q A;  4P74 A;  3S15 B;  5C4J H;  1I50 B;  2NTT A;  3HOW B;  4BY7 G;  1GD7 A;  2EY5 A;  1XNQ Q;  3GV3 A;  2JA7 H;  2XVS A;  3QIA A;  1NR4 A;  3K5L A;  5LMN Q;  1N34 Q;  4K5X A;  3NXW A;  2CWA A;  2Q8R E;  2VUM B;  3K6O A;  2E2J B;  3CCE A;  2R93 G;  2WKC A;  1UWV A;  4GKJ L;  4LUO A;  2AWN A;  1NAP A;  1B70 B;  3ZJY C;  1G91 A;  2GA4 B;  1MBY A;  4UDU C;  3K80 C;  1T5E A;  3HEJ A;  2KA7 A;  2BA1 A;  3U4Z A;  1WJJ A;  2MP1 A;  4KN4 C;  5I9P A;  1RTO A;  1A3U A;  1NNX A;  1OO9 B;  3H3V C;  1KXL A;  3I4N H;  2EE1 A;  4A3C G;  4YY3 Q;  1ENF A;  2RDF A;  5JAV A;  2WB1 G;  3VYS A;  4HID A;  1CQF A;  2Q8I B;  2MNA A;  1EOV A;  2AQ3 B;  4YHH L;  5ELD A;  1C9O A;  3N52 A;  4PV1 C;  4DR4 Q;  4DR1 L;  3FRP B;  3DHQ A;  3LNN A;  4R1J A;  3CCJ A;  4QUC A;  1A2U A;  3QJY A;  2K04 A;  4JI3 L;  1B2T A;  1F2Y A;  3HOV G;  1C4Q A;  1CKN A;  3R8B A;  3T1Y L;  2A6H D;  2H1E A;  3F2C A;  4JI7 L;  1JB3 A;  2P5Z X;  4XTC S;  3NP8 A;  3HOZ H;  3AEV A;  4RCO A;  1LAB A;  3STB D;  2A73 B;  2F52 A;  2Z6K C;  3CMA A;  1X55 A;  4ME3 A;  1G8Z D;  1HNW L;  4NKL A;  1VQK A;  3M4P A;  2E2H B;  4IZ8 A;  3BVG A;  1XNQ L;  3IAY A;  1QCB D;  2QEJ C;  4BY1 G;  4LMQ D;  3UDX A;  4AYB B;  1XPU A;  5JVG 3;  3GTP B;  4CKE A;  3O13 A;  4A3D B;  2CQA A;  1FNU A;  5LMN L;  1N34 L;  2NTS A;  1EQT A;  4I7A A;  1WTW A;  2BH2 A;  4JBK A;  3A54 A;  1WOC A;  3W1B A;  4EQ5 A;  5C3E G;  1IBM L;  5IOC A;  4PZ7 A;  4DV5 Q;  3NHH A;  3D6W A;  5IE8 A;  4DV1 Q;  4B3M Q;  3TZD A;  2F0K A;  2PW7 A;  1EU4 A;  3KF8 A;  4BY7 H;  1L1O A;  3PUZ A;  3PIO 3;  3S16 H;  2YYZ A;  2YU9 H;  1F9R A;  3H6M A;  3NPP A;  2FFK B;  5C0X G;  4KJN A;  4DF7 A;  2D2C C;  3AQQ A;  3TRZ A;  1WCM G;  4KI0 A;  1FGU A;  2A19 A;  2VXW A;  2XWJ B;  3A74 A;  5JVH 3;  2JA8 B;  2K14 A;  4DNI A;  3TME A;  3CW2 C;  3QB3 A;  1SRO A;  5K36 G;  1TS5 A;  5EPK A;  4OGQ C;  2JXM B;  3SK4 A;  3HGB A;  2R93 H;  4DFA A;  2WKD A;  2M2L A;  4YY3 L;  3FP9 A;  1OXU A;  4XQN A;  2N8N A;  1LTG D;  1QJO A;  4KHZ A;  5CV4 A;  2LKV A;  4MN3 A;  5JOB A;  1WTO A;  2YV5 A;  5E3F A;  3KJP A;  2NVT B;  4EX5 A;  4C3H B;  4LJZ C;  3T53 B;  1K8G A;  4DR4 L;  4A3B B;  3NWT A;  2K32 A;  3T56 B;  5M3M B;  1B3A A;  2BE5 D;  1I4Q A;  4PG3 A;  1HA5 A;  5E4W C;  3GTK H;  2Y0S G;  4K2K A;  1PH5 A;  4A3C H;  2LXK A;  2LY7 A;  4AIM A;  5C3W A;  4GNX B;  1GUS A;  3MEF A;  1IYU A;  2ICE C;  1PH3 A;  2VB2 X;  4FP5 D;  2LS0 1;  2D0P A;  4R4C A;  4DV6 L;  4R8I A;  2JA8 G;  4KJO A;  1HNX L;  1H9S B;  3W2D A;  4JOI C;  1JJG A;  2RCF A;  3SK6 A;  3HOV H;  1VF7 A;  3A7A B;  1OXS C;  3T51 B;  3OWF A;  4EQO A;  1BNZ A;  1S5C D;  3HKZ G;  1VQD A;  1EFW A;  3AFQ A;  2IJ0 A;  5DLQ E;  4RH6 A;  5EKL A;  1PYW D;  2IHF A;  3BS1 A;  2PQE A;  1HZB A;  1LTA D;  2VS1 A;  4J8Q A;  2K5H A;  4B3M L;  1A0I A;  4A3B G;  3VA7 A;  3CCU A;  1BOS A;  2BCO A;  4K2L A;  2Q2T A;  4GLX A;  3T1H Q;  4BY1 H;  2IT1 A;  1PH6 A;  1P16 A;  1Y14 B;  2V1C C;  5J22 A;  4KKT A;  1BXT A;  1PLF A;  4ME5 A;  3U9O A;  1CT1 D;  4LW1 A;  3UI2 A;  1EYD A;  1BVS A;  1F77 A;  5C3E H;  1TQO A;  3S1Q H;  5LMU Q;  5FOB B;  1SRU A;  1UE6 A;  4WJ4 A;  1T9H A;  3EQL C;  5C0X H;  1LT5 D;  4QUF A;  1WCM H;  2AQ1 B;  5FKA C;  2ID0 A;  1L0Y B;  2JEB I;  3M85 A;  1BCP F;  3GTJ H;  4DR6 Q;  2RHQ B;  2ZXO A;  4H02 A;  4OO1 I;  2ICI A;  1LTB D;  1HUM A;  2QKI C;  2DUD A;  5HY6 A;  5K36 H;  4K6D A;  1Q86 C;  1BR9 A;  2B2U A;  3UE1 A;  1LV9 A;  3CPF A;  3RZD B;  1IYJ B;  4JI1 Q;  3GTM B;  2E2H H;  3G6E A;  4KMU C;  3Q23 A;  3A55 A;  2PI2 A;  5BR8 Q;  4GOP C;  3GTP H;  1JWU D;  3DLL A;  4J6H A;  2NB0 A;  4KD4 A;  4JI6 L;  2WB1 E;  3HOU B;  3CME A;  2B2Y C;  3UE0 A;  4B3R L;  1UAP A;  3C1E A;  1E22 A;  3J80 i;  2PQA B;  3KOJ A;  3TBI B;  4O0A A;  2A6E C;  1HRJ A;  1XTC D;  1IBL Q;  2L12 A;  3S2D H;  3H3V I;  4IPG A;  2HDM A;  1QVG A;  2JA8 H;  3SK8 A;  1KAW A;  3DWQ A;  2EY1 A;  1K3R A;  4DV0 L;  3K7U C;  4GN5 A;  4KV6 A;  3KJO A;  4PMW A;  2ES2 A;  2A5H A;  1O78 A;  4BA2 I;  2IL8 A;  2X6G A;  3KLW A;  4IOA A;  4WOR A;  3GV6 A;  3SHL A;  1OXT A;  3RMH A;  4A3B H;  1J5E Q;  2F0N A;  2JJQ A;  1K3B C;  1ZXT A;  4RA8 A;  1O7I A;  5LMU L;  2F1M A;  2CHB D;  2UUB L;  3RLO A;  2L15 A;  3L2P A;  2JYO A;  5IOD A;  4R9W A;  2CQO A;  3D3R A;  4N9P A;  2M00 A;  2HT1 A;  2JN4 A;  5BN5 A;  2F0J A;  2JQO A;  2E2I B;  4RGN A;  4DR6 L;  2ZJQ A;  1RHP A;  4C1N I;  1GHJ A;  1SNP A;  3QG1 A;  1KHI A;  4YWM A;  3H91 A;  2WII B;  2PZT A;  2EJG C;  4OIK A;  2LMC B;  2YTX A;  2PZW A;  4JI1 L;  1IBK Q;  2QDB A;  4HAE A;  3GTL B;  1VQN A;  3E5S A;  2Q2I A;  4O42 A;  1V8Q A;  1NY4 A;  3OWE B;  4JI8 Q;  2IX1 A;  4B3S Q;  5BR8 L;  3D6C A;  2RCN A;  3RD4 A;  2PCF B;  2KHJ A;  1ESR A;  2UXB L;  3TSS A;  2XNA C;  4R4T A;  1N36 Q;  1D1K A;  1Q46 A;  1CK1 A;  1HTP A;  3HOY B;  2B2T C;  1D8L A;  2KQ3 A;  3M7G A;  5D3D A;  1OXV A;  1Y8P B;  4XQJ A;  2EY6 A;  1JR0 D;  3RNU A;  1LTR D;  4JC0 A;  3RLF A;  5ELB A;  2EYL A;  1STA A;  1N8R C;  1PH1 A;  2UU9 L;  1QOH A;  5KND A;  1IBL L;  3V05 A;  5C4X G;  4A3I G;  4E6I A;  1XXG A;  2Y0S E;  1HPC A;  2LFN A;  3T13 A;  1PVO A;  1K9M C;  5KRU A;  1LYL A;  4LUV A;  1PYS B;  2CVR A;  2VW9 A;  2IPK D;  2NYZ D;  3TRE A;  3GD7 A;  2DJG C;  1SNQ A;  1L0W A;  2QF7 A;  2DGY A;  2KED A;  4M1U B;  3CP0 A;  1CA5 A;  2EXD A;  2OQK A;  3PQI A;  5C5L A;  4H13 C;  3J81 c;  3MXN A;  2Z4H A;  1QNK A;  4IPC A;  1E24 A;  1QB5 D;  2BDN A;  1D5Z C;  4DV7 Q;  1A2T A;  1G29 1;  1LLR D;  1F9Q A;  1B4O A;  2QEX A;  2F0E A;  1J5E L;  3HKZ E;  3OMG A;  3A5Z B;  1MSH A;  1I94 L;  2MQH A;  3I91 A;  3M7N A;  2OTL A;  1N33 Q;  2OT2 A;  5IWA Q;  2E74 C;  3I8Z A;  3RZD H;  2X69 A;  1KRT A;  4OWT B;  3OW2 A;  1WVL A;  4HMJ A;  2A8V A;  5C4J B;  4RGT A;  3CCS A;  4CDD C;  1PTO H;  4G57 A;  1ASZ A;  2F0H A;  4MZ9 A;  5AJ3 Q;  4TVA B;  5IP9 G;  1PH2 A;  2JA7 B;  1M90 C;  1SAP A;  1W6K A;  1VQ5 A;  4O1N A;  2VB3 X;  2KCT A;  5M9O A;  1IBK L;  3R2I A;  3SGI A;  2ATW A;  3KLR A;  3D4W A;  4JK1 C;  4O2D A;  3V2T A;  4JI8 L;  2QCP X;  2L5T A;  4B3S L;  4RWS C;  2F3W A;  3AYH B;  4K8J A;  4PZ8 A;  4CGY B;  1T5X D;  1HNZ L;  2K03 A;  1MSG A;  3K59 A;  3K0X A;  3CCM A;  1LTI D;  4NMZ A;  4CDE C;  4UP8 A;  1CM9 A;  1CZG A;  2ZJP A;  1UE7 A;  1Y1W G;  4QL5 A;  5C0X J;  1SEB D;  4FO2 A;  1OXX K;  4HMI A;  4K14 A;  1Q3L A;  1EWH A;  2SOB A;  5FLM H;  2RDG A;  1VMC A;  2B2V C;  4GN3 B;  1FJG L;  2F4V L;  2F0O A;  1SR3 A;  4LF4 Q;  2D5D A;  3IKJ A;  4GN4 B;  1LAC A;  1SBB B;  2FJ2 A;  3I4N B;  4HR7 B;  1Y8N B;  4KY7 A;  4DV4 Q;  1DJR D;  3I7F A;  1EZ8 A;  1BKB A;  4X3K A;  5LMN W;  1X3P A;  3TS0 A;  1XYI A;  4K0K Q;  1O7Y A;  3U9S A;  1VQI A;  2VQE L;  5C4X H;  4A3I H;  1VQ7 A;  1C7Y A;  2HUG A;  1PZJ D;  3ULJ A;  2F4I A;  1UUP A;  2EYF A;  2VL6 A;  3FPP A;  1ZKO A;  3NWS A;  3KLS A;  4YWK A;  1N33 L;  3J80 L;  3HOZ B;  4A3E G;  3DM3 A;  4YCW A;  1SYC A;  3VYR A;  2B63 G;  1SMX A;  5IGD A;  2IX0 A;  3HP3 A;  1WTP A;  2ENB A;  5AJ3 L;  1SFO B;  4TRD A;  1KRS A;  1GHK A;  2JEA I;  1TWH H;  2O5I C;  4MIU A;  4KKU A;  2F03 A;  1GUO A;  4XXE A;  4GKJ Q;  4X64 L;  1KLU D;  4BXX G;  4V0B A;  5NUC A;  1DXM A;  1I4P A;  4HSP A;  3CF5 A;  4DAY A;  1X6O A;  3L7Z C;  3T16 A;  5G3L F;  2Q2H A;  4A93 G;  1F2L A;  3MFY A;  4BY7 B;  5FO9 B;  3NTI A;  2A69 C;  2J7Z A;  1TWC H;  3S16 B;  5IP9 H;  1EZ6 A;  5F2D A;  2YU9 B;  1KNE A;  3J81 L;  3CRK C;  1A63 A;  3K5O A;  1KD1 C;  1YIJ A;  1VQL A;  4HIM A;  1JOR A;  2AKW B;  1VQH A;  5E1F A;  5M5W H;  2JA6 G;  3JAM i;  4QIW E;  3CPW A;  2UUA Q;  4JCV E;  4DR1 Q;  2R93 B;  3NK9 A;  1Y1W H;  1Q1B A;  2F0F A;  4JI3 Q;  1SJH D;  5KYI A;  1Y1V G;  2A6H C;  3FEW X;  4DK6 C;  1SNO A;  4X6A H;  2RQX A;  4JI7 Q;  1E3P A;  3S1M H;  2Z9H A;  4K0K L;  2WAC A;  4ZUJ A;  1SYB A;  1VMP A;  2EJF C;  4C2M H;  5I4D A;  5EBC A;  5EAY A;  3VR6 A;  3UDF A;  2NZO A;  3GTK B;  3D4R A;  3PSI A;  1HNW Q;  1EQR A;  1GXD C;  1WI5 A;  4FXG C;  2F0T A;  3OIQ A;  2WB1 B;  4L5R C;  1KC8 C;  3PO3 G;  4ZLT F;  5AFW A;  1ICF B;  1PFS A;  4NPS A;  1F9S A;  5C5M A;  2Q8T A;  3CD6 A;  2A1A A;  4KHV A;  1K73 C;  3PIP 3;  2R7D A;  4B08 A;  4POG A;  1IBM Q;  2MHV A;  1LM0 A;  1DZ1 A;  1GUG A;  3ULL A;  3HOV B;  1DOK A;  5CGK A;  4L6T B;  5BN3 A;  4B3T Q;  5I2X A;  2F3V A;  1JC7 A;  1PTO C;  2FMM A;  2M9V A;  2PZU A;  2I5L X;  3S1N H;  4FDB A;  3KDF B;  4A3E H;  1VQC A;  4YCV A;  3AFP A;  4DR7 L;  1GUN A;  3BU2 A;  2I0Q A;  4LF7 Q;  4G7O C;  1STY A;  1HTL D;  1ICW A;  4FF2 A;  3KUP A;  3ICE A;  5GAH C;  1SNC A;  4R8N A;  4BY1 B;  4KLK A;  1BDO A;  1TS4 A;  3OTO Q;  1KDC A;  4K5V A;  2L9H A;  4BXX H;  4UY8 C;  3QOL A;  1BF4 A;  5C3E B;  1VQO A;  2ZTD A;  3MC0 B;  1WFQ A;  4HCS A;  2UUA L;  3S1Q B;  4A93 H;  1H9S A;  4CKB A;  1RIP A;  1EEF D;  4HJA A;  4DV2 Q;  2NUC A;  4IJL A;  2EDG A;  2K01 A;  1GKH A;  3ULP A;  1WCM B;  2DJF C;  1Q81 C;  1SSO A;  5CC4 A;  1IL2 A;  1X3E A;  2B8G A;  2JK8 A;  3GTJ B;  1SYD A;  1H9J A;  1EIF A;  3K81 C;  5KNC A;  4RHR A;  2PI2 E;  3DWA A;  1AE3 A;  4J1M A;  2H4O A;  2R6G A;  1EY4 A;  3KF6 A;  2DY7 A;  5C0X I;  1HQM C;  4DV6 Q;  1QNU A;  1X3Q A;  1HNX Q;  4FYD A;  3F2D A;  3B6Y A;  2BA0 A;  1SFO H;  4ZUI A;  2B3G A;  1Y1V H;  1HR0 Q;  4Q0F A;  3CQZ H;  2XRS D;  1GJX A;  4XIG S;  1AN8 A;  2X6L A;  3J80 E;  2ASB A;  3I73 A;  1NR2 A;  3X3M A;  2CW0 D;  4ALP A;  4QB4 A;  2KVM A;  1A62 A;  1RL2 A;  2EVB A;  3X3N A;  1XWE A;  1IW7 C;  4DU9 A;  4IPD A;  1E0B A;  1X56 A;  2Y0S B;  2JSO A;  3H0G G;  5DNF A;  4JI4 Q;  4B3T L;  1TU2 B;  4MTK A;  1H9K A;  3A8I E;  4HED A;  5GAG C;  3OMC A;  1KL9 A;  1WTX A;  3Q6S A;  4A3G G;  3S2D B;  1QWY A;  4HJ5 A;  4LF7 L;  5JJI A;  1K8A C;  2RF4 A;  3IFT A;  2OEO A;  5CV6 A;  2F3I A;  5KGU A;  1I4G A;  3BVZ A;  3I4O A;  1IHZ A;  2A68 C;  3HKZ B;  1CKO A;  1P8L A;  1YIT A;  3OTO L;  3J81 E;  1YNJ C;  1FNV A;  4AH6 A;  3CCR A;  4OX9 L;  1JE5 A;  2RA4 A;  1V1Q A;  4NXN Q;  2KCC A;  2RHS B;  3IL8 A;  4HTH A;  3FPU B;  3G71 A;  1STB A;  2MPM A;  2HQL A;  4IAL A;  5GQO A;  4DV2 L;  2B8F A;  1SYE A;  5I6Y A;  2JA5 G;  3C3L A;  1VQG A;  3PCO B;  2C5C A;  1EIH A;  1YVC A;  1BO0 A;  1YEZ A;  1CFM A;  3I55 A;  3W5O A;  4RFB A;  4QMG A;  3MA2 B;  2SDF A;  1CSP A;  3A56 A;  1ROD A;  4BBS G;  1X3G A;  2N3S A;  3OSO A;  3HKS A;  4L5T A;  4JI6 Q;  5DAU A;  1QVC A;  5CBE E;  1HR0 L;  3NTH A;  4C1N K;  4B3R Q;  3E9H A;  4P2C B;  1U9R A;  2J4X A;  4TKO B;  3CCL A;  3KYH C;  1TS3 A;  2HIX A;  3QO2 A;  2ZXR A;  3JAM L;  4K6L A;  4ZK9 B;  4XYQ A;  5IY0 A;  5IGG A;  3PUW A;  5L37 A;  3NQI A;  2Z6K A;  3IFD A;  4JI4 L;  1B3Q A;  1SYG A;  2EXZ A;  3J7A F;  4LFB L;  1EY9 A;  2TSS A;  1FGB D;  1G51 A;  2J0T D;  4DV0 Q;  1Z7T A;  4DXF A;  1RKN A;  1EYC A;  3EN2 A;  1CKN B;  1HZA A;  5LHY 1;  2ZXP A;  1CSQ A;  5ELO A;  1HUN A;  4LAA A;  3GTQ B;  3FDT A;  1YHA A;  4CJ2 C;  5FJ8 G;  2UXC L;  1FD7 D;  4IUQ A;  1LT3 D;  3S2H B;  4H0L C;  1PRT C;  3H0G H;  1BCP D;  2EYJ A;  3HG9 A;  4DK1 A;  1UEB A;  2UUB Q;  2K5W A;  1LT6 D;  3K5M A;  5IT9 L;  1PYB A;  1YNN C;  5EQ0 A;  2L1B A;  1EOT A;  3A8J E;  2E2D C;  4NXN L;  1EYG A;  1TWG H;  4IUR A;  3OPO A;  4WJW A;  1VQ6 A;  4I7Z C;  4B9W A;  1IKL A;  3ITP A;  4LF8 L;  4IFD G;  3KF8 B;  4IUP A;  2Z4I A;  2NBF A;  3MXG A;  3I4L A;  3F1Z A;  1HFG A;  4GZY C;  4PQX A;  1PTO B;  3G48 A;  5T1G A;  3LX0 A;  2A74 C;  3CC4 A;  3F8T A;  2UXB Q;  1YHB A;  5HGT A;  1YHQ A;  3HFZ B;  1G6Z A;  4ZQ3 A;  5IGB A;  3AMU A;  3GDE A;  2JA5 H;  3EFX D;  1K8M A;  4JI5 Q;  4IUN A;  3BZC A;  2Z1C A;  3N6R A;  4P75 A;  1DYQ A;  3H15 A;  1VDZ A;  1KQS A;  4RKL A;  2UU9 Q;  1SE8 A;  2IWH A;  3SE0 A;  1JMC A;  3QR8 A;  2E76 C;  4WFN 3;  4BBS H;  3PV0 A;  3MZ5 A;  3NBH A;  4JBM A;  1JCK B;  3NBI A;  4RAU C;  4A3M G;  1LTL A;  4KY5 A;  2RVL A;  2KEN A;  3LWE A;  4BBR G;  5DM6 3;  1XMQ Q;  2PW5 A;  3Q22 A;  2WAQ G;  2EYP A;  3WWV A;  1I94 Q;  1STH A;  1U4R A;  3MFG A;  1D6E C;  3PO2 G;  5J1Z A;  5I2Y A;  5C44 G;  1LTS D;  2DY8 A;  4RKB A;  5C4X B;  4A3I B;  4A3F B;  2K50 A;  2F0L A;  2XWB B;  4CKC A;  3CC7 A;  4QCL A;  2EQS A;  5FJ8 H;  4G4K A;  1G6P A;  2MFI A;  2ZJR A;  3OHX C;  4BS9 A;  3H09 A;  1U0L A;  1NJI C;  1TWA B;  3QOJ A;  5CV7 A;  1PZK D;  5EBD A;  2PNH A;  4CBV A;  3AB9 A;  2R7Z G;  1ILQ A;  2DNC A;  1HNZ Q;  4PMB A;  3K0Y A;  4NP5 A;  1MJC A;  2AMC B;  4AQY Q;  4A76 A;  4BA1 I;  3J80 c;  1TWH B;  4G7H C;  4JI2 Q;  4DUY Q;  3H94 A;  4DPG A;  4XDX A;  4FF4 A;  4FNF A;  5K5P A;  1SMY C;  3TZU A;  1U4L A;  3LWU A;  4N9T A;  4EVO A;  3SK5 A;  3D0F A;  4IFD H;  1B1Z A;  1MHW C;  1S5F D;  2K33 A;  4JI5 L;  1QUQ B;  1B9M A;  1PHJ A;  4C3I G;  3ERO A;  4LUZ A;  1FJG Q;  4CJ1 B;  2F4V Q;  1TWC B;  3RR5 A;  4GLV B;  4HIK A;  1I4R A;  4A3J G;  4GOP A;  4A3F G;  3NQT A;  3CC2 A;  3BDC A;  4QJF A;  3GTQ H;  5M5Y B;  1F2Z A;  3IRB A;  1TXY A;  2K52 A;  3ONA B;  2NVQ H;  4DR3 L;  3S2H H;  1O7L A;  2B2Y A;  3JC6 6;  3NEL A;  5M5W B;  2WP8 J;  2IHE A;  3ERQ A;  3KBX A;  1EEI D;  4X62 L;  1VQ4 A;  3DMU A;  1DOL A;  1TY2 A;  1UE1 A;  3CXC A;  2VY3 A;  2VQE Q;  2A6E D;  1Y1W B;  2O2L D;  3UDI A;  3UDG A;  1XMQ L;  2XTI A;  4C56 C;  2C35 B;  3S1M B;  1Y69 U;  1E1O A;  4X3U A;  4ID6 A;  4XT1 B;  1B8A A;  4C2M B;  1XNR L;  1JOO A;  5JJZ A;  4A3M H;  4HJ8 A;  2MO0 A;  4JI0 L;  2F0D A;  3ND8 A;  5IT9 E;  1HCZ A;  1LO5 D;  4BBR H;  3HRZ C;  1B44 D;  1UE5 A;  1YNX A;  1MI2 A;  2NN6 G;  3VR3 A;  2CKZ B;  2OCE A;  2Z0S A;  2WIN B;  4X64 Q;  2EOT A;  3PO2 H;  3WDN A;  5C44 H;  4A3K G;  4NDX A;  1GM5 A;  3LGJ A;  4AQY L;  1W2B A;  5KYL A;  4XQQ A;  1L2F A;  3SEB A;  4XT3 B;  4U68 A;  1SND A;  5IGC A;  2MUY A;  2EZV A;  4JI2 L;  4DUY L;  3DEP A;  5EPJ A;  1HH2 P;  3P7J A;  1IZ6 A;  3E6Z X;  2F0W A;  4JYA Q;  3S1N B;  1ENC A;  4A3E B;  1G2S A;  1PRT B;  3NE5 B;  4IUU A;  1LT4 D;  4LF9 L;  1IKM A;  1U4M A;  1UEA B;  2B63 B;  2HIV A;  2KCM A;  1E1T A;  1VQA A;  1YBY A;  1SXT A;  1Z9F A;  2VNU D;  4UPA A;  1PFN A;  4KHP Q;  3R3O A;  1WD0 A;  2B2T A;  2LXJ A;  1R9T H;  1V1P B;  1MIU A;  3NUC A;  4Y7N B;  3G6J B;  4HIO A;  1SNM A;  4C3I H;  4A93 B;  4IOC A;  5M3F G;  3MXU A;  5CV9 A;  4A3F H;  1DGS A;  2OF1 A;  1GO3 E;  1R4Q B;  5D14 A;  5CV8 A;  1KAB A;  1TWA H;  1W6J A;  1AP0 A; 
#chains in the Genus database with same CATH homology
 1JJC B;  2VS1 A;  1VQO A;  2I5H A;  2ZTD A;  1QVF A;  1IXR A;  2K5H A;  1A0I A;  4B3M L;  4A3B G;  1WFQ A;  3CCU A;  1VQF A;  4YWL A;  2ZM6 Q;  2UUA L;  3GTO H;  4A93 H;  4QY7 A;  4LF9 Q;  5FLM G;  2Q2T A;  1RIP A;  3D31 A;  4HJA A;  4DV2 Q;  4GLX A;  3T1H Q;  4IJL A;  1N9W A;  2IT1 A;  1PH6 A;  1P16 A;  1Y14 B;  5IP7 G;  4BY1 H;  2V1C C;  1S3O A;  4OWX B;  1GKH A;  3ULP A;  1Q81 C;  1IL2 A;  3EIV A;  3TEH B;  2WFW A;  1X3E A;  4LW1 A;  2JK8 A;  1VQJ A;  3A5U A;  4X66 Q;  1BVS A;  1EIF A;  3K81 C;  5C3E H;  1Q12 A;  5GRO A;  2PI2 E;  2IY5 B;  1AE3 A;  4UP7 A;  4DK3 C;  4AYB E;  2R6G A;  3I2Z A;  4DR7 Q;  3S1Q H;  3KF6 A;  5C0X I;  3BJU A;  2WAQ E;  4MTN A;  4DV6 Q;  4LF5 Q;  1HNX Q;  5LMU Q;  3F2D A;  1XJV A;  1LUZ A;  1SRU A;  3B6Y A;  2BA0 A;  2NN6 I;  1BBU A;  1UE6 A;  1SFO H;  4WJ4 A;  2B3G A;  1Y1V H;  1T9H A;  3CCQ A;  1N32 L;  1HR0 Q;  3S1R H;  4JYA L;  3CQZ H;  1WCM H;  3E0E A;  3M9B A;  4XIG S;  2ID0 A;  2JEB I;  2NVY H;  5M5Y H;  3M85 A;  1VCI A;  3GTJ H;  2RHQ B;  3M4O H;  4DR6 Q;  4H02 A;  4OO1 I;  2K5V A;  2YTV A;  4ALP A;  2ASB A;  3PIO A;  3NEN A;  1A62 A;  1RL2 A;  2VQF L;  2DUD A;  5HY6 A;  4OXP A;  4A3K H;  1Q86 C;  4IPD A;  3UE1 A;  4NB3 A;  1X56 A;  3CPF A;  1IYJ B;  4JI4 Q;  3H0G G;  4JI1 Q;  2K75 A;  1K0R A;  1XPO A;  4B3T L;  3I4M G;  2E2H H;  4KHP L;  3PUV A;  1NBW A;  2BH8 A;  3G6E A;  4J15 A;  2H5X A;  5GAG C;  1SLJ A;  1KL9 A;  2ALY B;  2PI2 A;  2R7F A;  5BR8 Q;  4DUZ Q;  4GOP C;  1PA6 A;  3GTP H;  1D7Q A;  1X65 A;  3FKI G;  4A3G G;  3PGZ A;  3DLL A;  3TS2 A;  4HJ5 A;  4POF A;  5H1S E;  4LF7 L;  1MJE A;  3HOY G;  4A3L H;  3U58 A;  1K8A C;  2RF4 A;  5JJI A;  4JI6 L;  3STB C;  2WB1 E;  4DR2 L;  2UUC L;  2F3I A;  3NBH B;  3CME A;  3UE0 A;  2JA9 A;  3I4O A;  4B3R L;  1TWF H;  2GN5 A;  3GTM H;  1E22 A;  3J80 i;  2PQA B;  3KOJ A;  1CKO A;  1P8L A;  1YIT A;  4IFD J;  3OTO L;  1Q82 C;  4O0A A;  4AH6 A;  1PH9 A;  3CCR A;  4OX9 L;  4A75 A;  1IBL Q;  1JE5 A;  3S2D H;  1C0A A;  4GKK Q;  4IJH A;  1V1Q A;  1S40 A;  3H3V I;  4NXN Q;  4IPG A;  1QVG A;  2JA8 H;  4QGU A;  1KAW A;  2RHS B;  1U5K A;  5IYC H;  2ZM6 L;  1SN8 A;  4DKA C;  1K3R A;  2VZA A;  3G71 A;  3HOU H;  4DV0 L;  2R7Z H;  2HQL A;  5GAE C;  5GQO A;  1VQE A;  2E8G A;  3EBE A;  3K7U C;  4GN5 A;  5M3F H;  4DV2 L;  2JA5 G;  3H3V H;  1VQG A;  3KJO A;  1JT8 A;  4LFC Q;  4PMW A;  2ES2 A;  3PCO B;  3PUY A;  1L1O C;  2E5L L;  4BA2 I;  3G4S A;  1YVC A;  2OTJ A;  3KLW A;  1N36 L;  1PH8 A;  1EIY B;  1YEZ A;  1FVI A;  4IOA A;  1GVP A;  4X66 L;  3I55 A;  3W5O A;  5IYD H;  2D62 A;  1CSP A;  1QZG A;  2CCZ A;  1OXT A;  1VQB A;  3M3Y H;  1JJ2 A;  4A3B H;  1J5E Q;  3HOX G;  4BBS G;  2JJQ A;  4LF5 L;  1X3G A;  2B63 H;  1O7I A;  3GO5 A;  5LMU L;  2N3S A;  1HZ9 A;  3HKS A;  4GS3 A;  4L5T A;  4JI6 Q;  2UUB L;  3RLO A;  1WYD A;  2L15 A;  3TQY A;  2UUC Q;  1NMF A;  3L2P A;  1QVC A;  2NZH A;  5IP7 H;  2CQO A;  1HR0 L;  4OWW B;  2HT1 A;  4B3R Q;  3E9H A;  4A3J H;  2AHO B;  1VS0 A;  3JAM c;  2JQO A;  4HJ7 A;  2QA4 A;  4GNX A;  3KYH C;  3CCL A;  4DR6 L;  2ZJQ A;  3K8A A;  2HIX A;  1KHI A;  4YWM A;  1AH9 A;  3RN2 A;  3KDF A;  4OX9 Q;  5IY0 A;  4X65 L;  3PUW A;  2JA7 G;  2GVA A;  4LFA Q;  4Y7N H;  2YTX A;  2Z6K A;  3A0J A;  4JI1 L;  4JI4 L;  2N78 A;  1IBK Q;  2K4K A;  4YCU A;  4LFB L;  2R92 G;  1HZC A;  4APV A;  2HHH Q;  1VQN A;  1G51 A;  4RG1 A;  2Q2I A;  3J7A 5;  2MO1 A;  5JEA J;  1NY4 A;  4JI8 Q;  4DV0 Q;  2NVX H;  2IX1 A;  4DV7 L;  4B3S Q;  3VDY A;  1S72 A;  4LF6 Q;  4DUZ L;  5BR8 L;  1V43 A;  3EN2 A;  2E2I H;  2RCN A;  4IO9 A;  1CKN B;  1HZA A;  4GOP B;  1ASY A;  3I56 A;  2KHJ A;  3HOW G;  2E5L Q;  4TQU S;  5ELO A;  1CSQ A;  2UXB L;  4R4T A;  1N36 Q;  1YZ6 A;  1Q46 A;  4LWC A;  1YHA A;  5IWA L;  5FJ8 G;  1D8L A;  2UXC L;  4DR5 Q;  2OQ0 A;  1Q8K A;  1OXV A;  3ERS X;  4JBW A;  2JA6 H;  3H0G H;  3GTL H;  4DAY B;  3RNU A;  3I4M H;  1VQM A;  5IT9 c;  4JC0 A;  4R4O A;  3RLF A;  2VUM G;  3MXN B;  1PH7 A;  1UEB A;  2UUB Q;  2UXD L;  4Y52 H;  1N8R C;  1PH1 A;  4C3J H;  2KHI A;  2UU9 L;  2ZTC A;  1IBL L;  1PYB A;  5C4X G;  4A3I G;  3L0O A;  3FKI H;  4GNX C;  4GKK L;  2Y0S E;  3I4N G;  1AE2 A;  1PVO A;  1K9M C;  4NXN L;  3RZO H;  3J7Z C;  1LYL A;  3HOY H;  4LUV A;  1EYG A;  1PYS B;  1TWG H;  2VW9 A;  4JG2 A;  1NTG A;  1XMO L;  3TRE A;  1VQ6 A;  5M5X H;  3GD7 A;  3PUX A;  4X65 Q;  2GVB A;  4LFC L;  4LF8 L;  1L0W A;  4IFD G;  2DGY A;  3KF8 B;  1J6Q A;  3CP0 A;  2EXD A;  3S14 H;  4LFB Q;  1V9P A;  2OQK A;  1HJP A;  5FLX c;  3J81 c;  1JB7 A;  3F1Z A;  4IPC A;  1E24 A;  3ER0 A;  3G48 A;  4DV7 Q;  1HR0 W;  3PO3 H;  1G29 1;  5IYB G;  3U4V A;  3W1G A;  3RLN A;  3CC4 A;  3F8T A;  2QEX A;  1Q7Y C;  1J5E L;  1PH4 A;  3HKZ E;  2UXB Q;  3A5Z B;  1I94 L;  1YHB A;  1YHQ A;  2MQH A;  3HFZ B;  3M7N A;  2OTL A;  1N33 Q;  3HOZ G;  4IPH A;  5IWA Q;  1A8V A;  4YHH Q;  2UXC Q;  3GDE A;  2JA5 H;  3NEM A;  4R4I A;  1EWI A;  4LF4 L;  3RZD H;  5JJK A;  1KRT A;  4OWT B;  3OW2 A;  1EQQ A;  2A8V A;  2JE6 I;  4QQB X;  4JI5 Q;  3BZC A;  3CCS A;  4DV4 L;  4P75 A;  3H15 A;  2UXD Q;  1ASZ A;  1KQS A;  4MZ9 A;  5AJ3 Q;  3PF4 A;  1YI2 A;  2QGQ A;  2UU9 Q;  4TVA B;  1XTD A;  1SE8 A;  5IP9 G;  1PH2 A;  1KIX A;  3T1Y Q;  1JMC A;  1M90 C;  2LSS A;  4LFA L;  3HOX H;  4BBS H;  1VQ5 A;  1X54 A;  4JBJ A;  2KCT A;  3PV0 A;  1NE3 A;  1IBK L;  3M4Q A;  3SGI A;  2ATW A;  2HHH L;  2PMZ E;  3K7A H;  4O2D A;  4JI8 L;  1XMO Q;  4A4I A;  1I5F A;  4L5Q A;  3AYH B;  4P74 A;  1HNZ L;  4PZ8 A;  4B3S L;  4JBM A;  4LF6 L;  5C4J H;  4LF8 Q;  4A3M G;  3K0X A;  3CCM A;  4JV5 Q;  2PQA A;  4UP8 A;  4BY7 G;  1LTL A;  2ZJP A;  1K83 H;  1UE7 A;  2CWP A;  1GD7 A;  1Y1W G;  4GLA C;  1XNQ Q;  4AYB G;  4DR5 L;  4QL5 A;  4DAM A;  2KEN A;  2JA7 H;  4BBR G;  1XMQ Q;  5C0X J;  1VQ9 A;  4A3D G;  1OXX K;  2WAQ G;  4UP9 A;  5LMN Q;  3WWV A;  2R92 H;  1N34 Q;  1I94 Q;  5FLM H;  4R4Q A;  2CWA A;  4GN3 B;  3F2B A;  1FJG L;  3PO2 G;  2F4V L;  3S15 H;  4PZ6 A;  5C44 G;  1SR3 A;  2I5M X;  4LF4 Q;  1I50 H;  3CCE A;  4GN4 B;  3HOW H;  2R93 G;  4WJ3 M;  3FHW A;  1XPR A;  1UWV A;  1OTC A;  4DV4 Q;  2K50 A;  3GTG H;  3CC7 A;  4GKJ L;  4LUO A;  2EQS A;  3I7F A;  2AWN A;  2KBN A;  5FJ8 H;  1G6P A;  2MFI A;  2ZJR A;  4DV3 Q;  1B70 B;  1U0L A;  3ZJY C;  1NJI C;  1BKB A;  3RN5 A;  4P71 A;  1H95 A;  3K80 C;  4LNQ A;  5LMN W;  2PNH A;  2BA1 A;  3U4Z A;  3TS0 A;  4K0K Q;  2VUM H;  3KFU A;  1WJJ A;  2R7Z G;  2E2J H;  1VQI A;  2VQE L;  1HNZ Q;  1KXL A;  1MJC A;  5C4X H;  4A3I H;  1VQ7 A;  2AMC B;  4AQY Q;  1C7Y A;  5GAD C;  4A76 A;  3ULJ A;  2Q2U A;  5E7N A;  4YY3 Q;  3I4N H;  4A3C G;  4BA1 I;  3J80 c;  4JI2 Q;  2VL6 A;  4DUY Q;  4IFD I;  2WB1 G;  4HID A;  2MNA A;  1N33 L;  4YWK A;  4DPG A;  1EOV A;  4YHH L;  4DV5 L;  4A3E G;  1C9O A;  2ZTE A;  1CKM A;  4DV1 L;  3D0F A;  3DM3 A;  3KF6 B;  4YCW A;  4DR4 Q;  4P73 A;  4DR1 L;  4JI5 L;  5M3M G;  2B63 G;  1SMX A;  1QUQ B;  4R1J A;  3CCJ A;  2IX0 A;  1PHJ A;  4L5S A;  4JI3 L;  4LUZ A;  1FJG Q;  5AJ3 L;  5IYB H;  2F4V Q;  1YJN A;  3HOV G;  1KRS A;  4HJ9 A;  3RR5 A;  4GLV B;  4HIK A;  4A3J G;  1CKN A;  4GOP A;  3T1Y L;  1TWH H;  4A3F G;  2JEA I;  3CC2 A;  3F2C A;  1E7Z A;  4A3G H;  4JI7 L;  2D0O A;  4XTC S;  4QJF A;  3GTQ H;  3OYY A;  2FXQ A;  3HOZ H;  4GKJ Q;  4X64 L;  3IRB A;  1TXY A;  2K52 A;  4RMF A;  1QZH A;  3AEV A;  2NVQ H;  4DR3 L;  4BXX G;  3STB D;  3S2H H;  2F52 A;  2Z6K C;  3JC6 6;  3CMA A;  3NEL A;  1NMG A;  5ELN A;  1X55 A;  4ME3 A;  1VQ8 A;  3CF5 A;  1X6O A;  2WP8 J;  2IHE A;  4JV5 L;  2B29 A;  3L7Z C;  1HNW L;  1L1O B;  1QUQ A;  2Q2H A;  3M4P A;  1VQK A;  4A93 G;  4X62 L;  1VQ4 A;  4NXM Q;  1UE1 A;  1TWC H;  3CXC A;  2VY3 A;  5IP9 H;  2VQE Q;  1XNQ L;  4BY1 G;  3UDG A;  3U50 C;  3UDX A;  3UDI A;  1XMQ L;  1I6H H;  1XPU A;  2XTI A;  4OON A;  5LMN L;  1KD1 C;  1N34 L;  1A63 A;  1YIJ A;  2C35 B;  2XGT A;  1VQL A;  2BH2 A;  4HIM A;  4JBK A;  3W1B A;  1E1O A;  1WOC A;  4EQ5 A;  2CFM A;  5C3E G;  1IBM L;  4DV5 Q;  2AKW B;  1FL0 A;  4P72 A;  1B8A A;  4PZ7 A;  1VQH A;  5IE8 A;  4DV1 Q;  1XNR L;  4B3M Q;  5M5W H;  4A3M H;  2JA6 G;  3JAM i;  4HJ8 A;  4QIW E;  2MO0 A;  3CPW A;  4JI0 L;  2UUA Q;  4JCV E;  4DR1 Q;  4BY7 H;  1L1O A;  3PUZ A;  1Y1W H;  3S16 H;  1Q1B A;  2YYZ A;  2YU9 H;  2K5N A;  4JI3 Q;  3CCV A;  1Y1V G;  4DV3 L;  4DK6 C;  4BBR H;  5C0X G;  1YJW A;  3AQQ A;  3TRZ A;  4A3D H;  1WCM G;  2YTY A;  4X6A H;  4KI0 A;  1UE5 A;  1FGU A;  1YNX A;  2A19 A;  1E3P A;  4JI7 Q;  3A74 A;  3S1M H;  2NN6 G;  5J3B A;  2K14 A;  4K0K L;  4DNI A;  2CKZ B;  2OCE A;  2Z0S A;  1Q1E A;  3CW2 C;  4X64 Q;  3PO2 H;  4C2M H;  4DR3 Q;  4JOI A;  1SRO A;  5C44 H;  5EAY A;  4A3K G;  1GM5 A;  5K36 G;  3LGJ A;  4AQY L;  1W2B A;  4OO1 G;  3UDF A;  2NZO A;  2R93 H;  1L2F A;  1I3Q H;  4YY3 L;  3FP9 A;  1OXU A;  3PSI A;  3PIP A;  1HNW Q;  1EQR A;  4JI2 L;  4DUY L;  1PV4 A;  1WI5 A;  1HH2 P;  4X62 Q;  2N8N A;  1IZ6 A;  1CUK A;  1N32 Q;  4KHZ A;  1KC8 C;  4L5R C;  2OWO A;  3PO3 G;  4JYA Q;  3E9I A;  2YV5 A;  3KJP A;  4NPS A;  1PFS A;  4EX5 A;  1K8G A;  3BZK A;  4DR4 L;  3CD6 A;  2A1A A;  1K73 C;  2R7D A;  4LF9 L;  4A3L G;  5JEA G;  1B7Y B;  2VQF Q;  2HIV A;  2KCM A;  3PF5 A;  4POG A;  3Q8D A;  1E1T A;  3T1H L;  1IBM Q;  4PG3 A;  1VQA A;  1YBY A;  3GTK H;  2VNU D;  1Z9F A;  1LM0 A;  2Y0S G;  3ULL A;  1XNR Q;  4UPA A;  1PH5 A;  1MKH A;  4A3C H;  1X3F A;  2LXK A;  4B3T Q;  1M1K C;  1BBW A;  4AIM A;  4GNX B;  4JI0 Q;  4KHP Q;  3MEF A;  2I5L X;  3S1N H;  4FDB A;  3KDF B;  4A3E H;  2NVT H;  2LXJ A;  1PH3 A;  1VQC A;  4C3H H;  2D0P A;  4MNO A;  1R9T H;  4YCV A;  1VQP A;  3AFP A;  4DR7 L;  1MIU A;  3BU2 A;  4R4C A;  5M3M H;  4DV6 L;  2I0Q A;  4LF7 Q;  2JA8 G;  1HNX L;  5IYC G;  3J81 i;  4HIO A;  3HOU G;  4JOI C;  4C3I H;  4DR2 Q;  3ICE A;  1JJG A;  5GAH C;  1EUJ A;  4NXM L;  4IOC A;  3HOV H;  3CAM A;  1OXS C;  1Z47 A;  5M3F G;  2EIF A;  1YJ9 A;  3HKZ G;  1W3S A;  1DGS A;  1VQD A;  4A3F H;  1X9N A;  3AFQ A;  4KLK A;  1EFW A;  5DLQ E;  3J81 j;  3OTO Q;  1GO3 E;  3S24 A;  5JJL A;  2IHF A;  3S17 H;  4UY8 C;  4BXX H;  2AWO A;  5IYD G;  1TWA H;  2N49 A;  1HZB A;  5HGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...