3PF4A

Crystal structure of bs-cspb in complex with r(gucuuua)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
b'MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock protein cspB
publication title RNA single strands bind to a conserved surface of the major cold shock protein in crystals and solution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/rna
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pf4A00
3RLOA 4X65L 3J81i 1UE5A 1MJCA 5IWAQ 4A76A 2JA8H 1D7QA 1HNWL 2OCEA 4IJLA 3G71A 3M4QA 1XNQQ 4GN3B 2I5LX 3GTMH 1VCIA 4WJ4A 2K14A 5ELOA 4BBSH 2MO1A 1PH7A 4IFDJ 5LMNW 4UY8C 2V1CC 3KJPA 4A3LG 4YCWA 1V9PA 3G48A 2Z6KC 4JBKA 4DPGA 4JI6L 2F4VL 3HOWG 3CCVA 3J81j 1IBMQ 5JEAJ 1HR0Q 1HR0W 2WP8J 2BA0A 4GKJQ 5ELNA 3FHWA 3B6YA 3RLNA 1IZ6A 4B3RL 1V43A 1U0LA 4MNOA 5C0XJ 3S1QH 1C9OA 5HGQA 4A3FH 1E1TA 3S1RH 4GNXA 2UU9L 3G6EA 4NXNL 4JOIC 3U4VA 1EIFA 2VQFQ 1EIYB 4JI2Q 1K73C 1X56A 4O0AA 1OXUA 3CCRA 4JI3Q 1KAWA 2JA6H 1IXRA 4IO9A 1N36L 4DR5Q 4OX9Q 3HOUG 2UXDQ 1W3SA 3PUZA 4MZ9A 4LNQA 4OO1G 3UE1A 4Y7NH 1FJGL 3S16H 1PH3A 1K0RA 4BY7G 2JA7G 1CKMA 4P72A 3L7ZC 4LFAQ 1SRUA 1VQNA 1AE3A 1N32Q 4QL5A 4X62Q 4LF4L 3UDIA 1G6PA 1CSQA 1RIPA 3KOJA 4L5QA 2PMZE 4IFDG 1CKNB 4JI7L 4DR4Q 2UXBQ 1VQ5A 1I5FA 1T9HA 1PH1A 4JI4L 4B3SL 4OWTB 3HKZE 4P71A 3J80i 3CW2C 5JEAG 5IP7G 1HZ9A 2R7ZH 1OXVA 1WCMH 4A3GG 4A3IG 4LF7L 3JAMc 2UXCL 4ME3A 1PFSA 2UUCL 4DR7Q 1XJVA 2XTIA 2ZTEA 3PGZA 2ZTCA 2GVAA 4IPHA 3HOVH 5M5XH 3GDEA 3I56A 1I3QH 1BBWA 3STBD 1SN8A 1B70B 4YWLA 4GOPB 2A1AA 2NVYH 4OWWB 1XNRQ 2PQAB 5IY0A 3PO3H 4OWXB 1IBLQ 1VS0A 5GADC 1P8LA 1QUQA 1SMXA 2IX0A 3IRBA 2B29A 2Z6KA 3BZCA 3K0XA 4AH6A 5IYCH 2HHHQ 1VQMA 1Q7YC 2NVXH 3I4NG 4NXML 3HOYH 1J5EL 1SR3A 2HIXA 4AYBG 4AQYQ 1HNZL 4GKKQ 1VQAA 4A3JG 1PVOA 3A74A 3F1ZA 1PH9A 3PF5A 2KHJA 3W1GA 1EUJA 4K0KQ 2EQSA 2IHEA 3CCMA 2ZTDA 4LFCQ 1UE6A 4A3CG 3UDXA 2WAQE 4LUOA 1SLJA 4QY7A 1YHBA 1D8LA 2Y0SG 1UE7A 4QGUA 4DR3Q 4AYBE 4A3JH 4HIKA 3NEMA 1A8VA 1JB7A 3S24A 1Z9FA 3HKSA 3J81c 4JBJA 4NPSA 3JC66 1A0IA 4GLAC 4UPAA 3CC7A 4JV5Q 4GS3A 4LF6L 1XMQQ 3T1YQ 4LF8L 2UUAL 4LFBL 2KENA 2A8VA 3H0GG 4R4IA 1N33Q 4JI1Q 4PZ8A 1E24A 5E7NA 3W5OA 4C2MH 2Y0SE 4YHHL 5DLQE 1FL0A 4IJHA 1Q12A 4R4OA 5BR8Q 5IYDH 4GN4B 5M3MG 1I94Q 5C3EH 1PHJA 1ASYA 4DR1L 3GTQH 2VUMH 1GVPA 4HJ8A 1N34Q 2E5LL 3EBEA 4DV3L 1HNXL 4C3HH 4GOPC 1Q82C 3CPWA 2AWNA 5FLMG 3M7NA 2OTJA 3CCLA 1EQRA 3NELA 2OQ0A 1X54A 4DUZL 2KBNA 1Y1WG 3E0EA 1UE1A 3HFZB 4LF5L 2JA9A 2F4VQ 2WB1G 4YCVA 2JQOA 3NENA 1MKHA 1VQLA 2JA8G 3H15A 2L15A 2ZJRA 4HJ7A 1UEBA 4C3IH 2E8GA 4O2DA 1VQKA 3A5UA 3I7FA 4POGA 4BBSG 2MQHA 2QGQA 1Q46A 1VQPA 4DK3C 1YIJA 3MEFA 3F8TA 4C3JH 1Y1WH 1QZGA 5AJ3Q 4B3TL 1WOCA 3S2HH 1YI2A 2XGTA 4DK6C 2UU9Q 2WB1E 4PG3A 3RN2A 3ULPA 1IBKL 2I0QA 2D0OA 3GTLH 4EQ5A 2JE6I 2Q2UA 3U50C 4RG1A 3ULJA 2I5MX 2WFWA 1XMOQ 1N36Q 5LMNQ 4A93H 4JBWA 3I4MG 2K5HA 4ALPA 4B3MQ 1I50H 1X3FA 3CCEA 3CCJA 2N3SA 4GLXA 1YITA 2HIVA 3J80c 1FJGQ 4A3FG 1TWHH 5C44H 3K81C 4YWMA 1LTLA 4OXPA 1VQDA 4YY3Q 2FXQA 3FKIG 4BXXH 4DR6L 1PYBA 2JA6G 1NTGA 3KF6B 1NY4A 5J3BA 4JI5L 3I4MH 4WJ3M 3UDFA 1C0AA 2N8NA 2OWOA 1CKNA 1A62A 4DAMA 1PA6A 2DUDA 1VQOA 1EWIA 5LMUL 3FKIH 4GLVB 4BY1H 2RCNA 2VZAA 4RMFA 2IHFA 4LF7Q 4A3DG 2UXCQ 2VW9A 3PSIA 4X66Q 4LW1A 3KYHC 1HJPA 1Q8KA 4DR2L 2VNUD 4JI0L 4DV4L 2ES2A 4R4CA 4BBRH 3H3VH 2Q2HA 2B3GA 1L1OB 1EYGA 2JJQA 3ERSX 4GOPA 4A3DH 3BZKA 3GTJH 2R7ZG 4MTNA 1WCMG 4UP9A 2KCMA 4DV7Q 3TS0A 3OTOQ 2R92H 1PH2A 1L2FA 2AHOB 2IT1A 4QJFA 5IWAL 4IOCA 1VQ8A 3HOVG 2YYZA 4IPGA 1YJNA 2CCZA 4TQUS 5M3FG 1HNZQ 3PO3G 1XNQL 5GROA 4DV1Q 1CUKA 2YTXA 2DGYA 4A3EH 3J7A5 2BH2A 1NMGA 2AMCB 1TXYA 3M3YH 4DUYQ 1G291 1Y14B 4LF9Q 5IYCG 3KJOA 1X65A 1IBML 1HZAA 3HOZG 3HOYG 2R93H 5M3FH 2K5NA 4DAYB 4HJ5A 4X6AH 3GO5A 1J6QA 1VQ9A 3RR5A 3UE0A 3ICEA 4GKJL 3CMEA 2D62A 1V1QA 3RLFA 2CWPA 5GAGC 4JYAQ 3PIOA 3PV0A 1HZBA 3F2DA 1KQSA 3S17H 1VQ4A 3HOZH 3EN2A 4POFA 1JMCA 2UUAQ 2KHIA 2LXJA 4H02A 3GTOH 3GD7A 3H3VI 2YU9H 4XIGS 1KL9A 2VQEL 2VQFL 2UUBQ 4JI2L 4JI3L 1YJ9A 1Q81C 1IL2A 3K7AH 1VQBA 1K9MC 4OX9L 4KHPL 4JI8Q 4DR5L 3A5ZB 1O7IA 2EXDA 2LSSA 3AYHB 3PCOB 4IPCA 1GO3E 5GQOA 1W2BA 3CMAA 1VQHA 1X55A 3RZOH 1H95A 4JOIA 4P74A 1XPUA 2JEBI 4LFAL 1HNXQ 3HOXH 1GKHA 1N32L 1G51A 4PMWA 1L1OC 1HZCA 3W1BA 1AE2A 1SFOH 2OTLA 3Q8DA 3MXNB 1S72A 2JA5H 2ZM6Q 2NVTH 2IY5B 3CF5A 5K36G 1PYSB 3L2PA 1S40A 4DR4L 2UXBL 5IYDG 2BA1A 2NVQH 1YVCA 2AWOA 2GN5A 3AQQA 2NN6G 1QVFA 1R9TH 5C3EG 5JJKA 2VUMG 1MJEA 5FJ8H 4JG2A 3I55A 3SGIA 1OXTA 4DV6Q 4HIOA 1VQIA 1OXXK 4TVAB 1I94L 4NB3A 4DR7L 4BA2I 1TWFH 1JJ2A 1FGUA 3GTKH 1BVSA 2OQKA 4DV4Q 3TQYA 3ER0A 4X65Q 4A3MH 4B3TQ 2RHQB 1JT8A 2E2JH 3D0FA 1JJCB 1AH9A 1E3PA 1HNWQ 4KI0A 1TWCH 4DKAC 2F52A 1IBLL 4L5TA 1QVGA 3AEVA 2A19A 1IBKQ 2B63H 4DV5L 4A3KH 4QIWE 4FDBA 4APVA 5GAHC 1JE5A 1WI5A 3D31A 2R7DA 4JBMA 2K50A 4JI6Q 4GKKL 4AQYL 1X3EA 3CC2A 3S15H 1K8AC 3M85A 3K80C 4J15A 2NZOA 2CKZB 3AFQA 4DR6Q 1YHAA 1OTCA 1WFQA 4UP8A 3CQZH 3TREA 4K0KL 1P16A 1QZHA 1KRTA 2N78A 3TEHB 4B3RQ 3CP0A 3KF6A 4LFCL 3S14H 3AFPA 4A93G 1KC8C 3F2CA 1SE8A 2JEAI 4PZ7A 2BH8A 1EFWA 1VQEA 4DR3L 3S1NH 2VS1A 5C44G 3F2BA 2NZHA 4NXNQ 3PF4A 3PUVA 1BKBA 4BXXG 4IOAA 4LUVA 4DR2Q 3PUYA 4JI0Q 1YZ6A 2RF4A 3T1YL 1M1KC 1CSPA 2E2HH 4DV2L 3CD6A 1LYLA 1VQFA 3A0JA 1N33L 2NN6I 4JI1L 1L1OA 1TWAH 1E1OA 4BY1G 3KDFB 1LUZA 1RL2A 4LF4Q 5BR8L 1BBUA 4HIMA 4YCUA 3CCUA 4DV0L 1HH2P 1B8AA 3FP9A 2GVBA 4P73A 4JI7Q 3CCSA 4JI4Q 1VQJA 4BBRG 2Z0SA 3K8AA 1N34L 2YTYA 4B3SQ 3STBC 3VDYA 4HIDA 2K75A 1X6OA 3NBHB 4R4TA 2UUCQ 5IYBG 2R92G 3TS2A 1PH6A 2E2IH 5M5YH 3PO2G 3GTPH 5JJLA 2N49A 1JJGA 1DGSA 5IP9G 4X64L 4L5RC 2EIFA 1EOVA 2PQAA 1XTDA 3T1HL 3J7ZC 1Q1BA 4A3LH 5IYBH 4A3EG 2PI2A 2YTVA 3CCQA 3PO2H 5AJ3L 3HOWH 2K4KA 3K7UC 3L0OA 3LGJA 3CAMA 4NXMQ 1J5EQ 5IP9H 1M90C 4IPDA 2R93G 1XPOA 2VQEQ 2RHSB 1X9NA 1IYJB 2LXKA 4HJAA 4KHPQ 5IT9c 1YJWA 1XMOL 4UP7A 4DNIA 2Q2IA 4JCVE 5LMNL 4L5SA 4B3ML 4P75A 5C4JH 1Q1EA 4JC0A 3HKZG 5FLXc 5EAYA 1KHIA 4A4IA 2PI2E 1YHQA 2D0PA 3KFUA 1KXLA 1WYDA 3M4PA 4YY3L 1B7YB 3M4OH 2ATWA 1HR0L 1A63A 3RN5A 3RNUA 3HOUH 2HQLA 1NJIC 1TWGH 2ALYB 3OYYA 3EIVA 1NMFA 4OONA 4GNXB 4BY7H 4LF6Q 4LF8Q 2JA7H 4LFBQ 3E9HA 4R1JA 1PH4A 4YHHQ 3PIPA 4X66L 3U4ZA 1MIUA 1X3GA 1KRSA 1YNXA 3I2ZA 3ULLA 3HOXG 3UDGA 3U58A 5C4XG 1Z47A 4A75A 1GD7A 2JA5G 4A3BG 2UXDL 4R4QA 3PUWA 3CXCA 1N9WA 5C0XG 1PH5A 2H5XA 1OXSC 2ZJQA 2MFIA 4LUZA 5IP7H 4HJ9A 4DR1Q 1YBYA 4A3GH 1C7YA 2E5LQ 2K52A 4DV3Q 4A3IH 4GN5A 5IE8A 5FJ8G 3BJUA 4DV7L 1QVCA 2YV5A 3GTGH 4X62L 3OTOL 4DV5Q 1LM0A 5C4XH 4A3BH 3KF8B 1L0WA 4DUZQ 2KCTA 1VQCA 2AKWB 2WAQG 3CPFA 3DM3A 4A3MG 2Q2TA 2IX1A 3TRZA 5JJIA 4LF5Q 2CQOA 1U5KA 1S3OA 4DV1L 4KLKA 2CWAA 3PUXA 1K8GA 4KHZA 2B63G 4A3KG 4DUYL 2ID0A 3E9IA 4LF9L 1Y1VG 3I4NH 2ASBA 1CKOA 1N8RC 4OO1I 1NBWA 1XNRL 4QQBX 1QUQB 2I5HA 4AIMA 2QEXA 4JYAL 3OW2A 1K3RA 5M5WH 3JAMi 2F3IA 2PNHA 1PH8A 1FVIA 1Y1VH 4IFDI 3ZJYC 2HHHL 4A3CH 1PV4A 4PZ6A 4DV2Q 3WWVA 2HT1A 1KD1C 4Y52H 1GM5A 3CC4A 1KIXA 2R6GA 2UUBL 2ZJPA 4GNXC 4YWKA 4EX5A 2VL6A 3KDFA 4JI8L 1WJJA 1VQ6A 4DV0Q 1VQ7A 1UWVA 1SROA 4LWCA 4JI5Q 5GAEC 3DLLA 2R7FA 5C0XI 5HY6A 3BU2A 3H0GH 4XTCS 1Q86C 1ASZA 1I6HH 2C35B 5LMUQ 2MO0A 5H1SE 2ZM6L 1XPRA 5M3MH 3KLWA 3S2DH 3S1MH 4JV5L 4BA1I 1NE3A 1VQGA 3M9BA 1XMQL 3I4OA 1E22A 2CFMA 2K5VA 4X64Q 1K83H 4DV6L 2QA4A 3G4SA 1EQQA 1E7ZA 3RZDH 2VY3A 3T1HQ 5FLMH 2MNAA 1YEZA 2JK8A
chains in the Genus database with same CATH superfamily
3RLOA 1ILPA 1K83B 2AQ1B 1O80A 3RZDB 2OCEA 2B2TC 4GN3B 1S5CD 2K14A 4N8FA 4IFDJ 1D2BA 3ND9A 4N8X1 2L0CA 4UAIA 2XRQD 2Z6KC 4DPGA 3CCVA 4KY5A 5JEAJ 4XQQA 2BA0A 1XYIA 1O78A 3Q0AA 4RHRA 5IGDA 1JE4A 1PMRA 3S1QH 1Q8IA 1C9OA 3GP7A 5G3LF 3S1RH 1F9SA 3WOEA 2VQFQ 1EIYB 5KYLA 3S1QB 2RA4A 1I4PA 3S1RB 4O42A 1EEFD 3Q23A 4L63B 1PH3A 2F3VA 1EL0A 3L7ZC 4FYDA 1N32Q 4X62Q 4RA8A 1CSQA 1RIPA 3KOJA 4HR7B 2JN4A 2WIIB 3C1EA 1A15A 4KMUC 1CKNB 2KUMA 3NHHA 1I5FA 1PH1A 3M4OB 3M7GA 4RGOS 4OWTB 4ZCKA 4A3GG 4DK0A 1HZ9A 4BS9A 4A3IG 5L37A 4ME3A 1PFSA 4KKSA 1TWGB 2XTIA 3PGZA 2GVAA 3HOVH 5DM73 5M5XH 1CI3M 2ASBA 4YWLA 2ZT9C 4DNRB 3P7JA 2K6AA 3K58A 2F0PA 1EYDA 3K0XA 3BZCA 1Q90A 3I4NG 1Q7YC 1C8CA 5COYA 1J5EL 4CGYB 1IKLA 1HNZL 4A3JG 1PVOA 1PH9A 3TP5A 3Q6SA 2KHJA 4QUCA 3J7AF 2EDGA 2ZTDA 1QNKA 3UDXA 4LUOA 1D8LA 2O5IC 4CDEC 4JBJA 1YNJD 4LAAA 2O4XA 4UPAA 2MGSA 3A8KE 3T1YQ 2KENA 5EKKA 1LO5D 1N33Q 2WACA 3JAML 4C2MH 3MFGA 4U68A 4YHHL 5DLQE 4IJHA 1MD2D 2F0TA 5K36H 4R4OA 2A74C 3NUCA 4C2MB 2VUMH 1N34Q 5IIFA 4DV3L 5IGBA 3ZYYX 1SJHD 4C1NI 3M7NA 2QCPX 4M1UB 4FF3A 2OQ0A 2VUMB 2IWHA 2KBNA 1I6HB 3HFZB 4IN3A 2JA9A 4YCVA 2JQOA 2A6HC 2GA4B 1VQKA 1LABA 3I7FA 3S1MB 4POGA 3T4AC 4PMCA 4BBSG 3Q22A 2MQHA 2QGQA 3S2HH 2L9HA 1RKNA 3MXPA 5TSSA 2EE1A 3RN2A 2I0QA 2JE6I 2Q2UA 3S2HB 1O7YA 2WFWA 2X69A 4J6HA 1EY4A 1RJTA 5LL6X 4B3MQ 1G8ZD 3CCEA 3J80c 1D1IA 4A3FG 1L0YB 1TWHH 5C44H 4OGQC 4YY3Q 4DR6L 1PYBA 1NY4A 4JI5L 1EY9A 1TWHB 5T1GA 5C44B 2N8NA 4EVOA 1EWIA 2E74C 1JQYD 3FKIH 4RMFA 1VF5C 2B8GA 1G91A 1I4RA 1IW7D 3FKIB 2IW3A 2Q2HA 3VR3A 3NTHA 1TY0A 2R7ZG 4MTNA 4UP9A 5JAVA 1X3PA 1PH2A 3MWYW 1L2FA 1SYBA 5IWAL 1YJNA 4DU9A 2TSSA 3PO3G 1XNQL 2YTXA 2XWBB 2EYJA 3M3YH 1G291 4LF9Q 2PYKA 5IYCG 1X65A 1IBML 3AMUA 2RDFA 4MTKA 1K28A 5M3FH 4HJ5A 4X6AH 1KNEA 2PW5A 3M3YB 2D62A 4JYAQ 3DHQA 1HZBA 3F2DA 5M3FB 3H09A 1VQ4A 1BDOA 3EN2A 1JMCA 3T56B 1HA5A 3GD7A 2EJGC 4XIGS 2VQEL 1U4MA 4ILWA 2UUBQ 4JI3L 1YJ9A 4KHPL 4DR5L 3AU7A 1O7IA 4IPCA 1SYFA 5GQOA 1GO3E 3PMFA 2EYMA 4HMIA 5KNCA 1G51A 4PMWA 2KECA 3W1BA 2IY5B 1S72A 2ZM6Q 1IYVA 3H6MA 3L2PA 3AQQA 2NN6G 1QVFA 3H3VC 1R9TH 5C3EG 1ESRA 5JJKA 4JVZA 2A69C 4DR7L 1JJ2A 1EU4A 3WOFA 2X6LA 1R9TB 1DM0B 5HGTA 2RHQB 4KHVA 1JJCB 1I4QA 1TWCH 4KI0A 4DKAC 4L5TA 3AEVA 1IBKQ 1JOKA 4QIWE 4HAEA 1TWCB 2R7DA 2K50A 2KA7A 4C3JG 2BE5D 1X3EA 3GV3A 2I46A 2NZOA 1LTID 1YHAA 4QMGA 4UP8A 5D65A 4K0KL 1KRTA 4K6LA 3TEHB 1BCPC 1EY0A 1SE8A 4PZ7A 4M8AA 4DR3L 2VS1A 3F2BA 3N52A 4K6DA 4IOAA 1VMCA 2A6ED 2FHTA 3PUYA 3VYTA 2ICIA 1M1KC 3CD6A 3QO2A 2NN6I 3OWFA 2F03A 1TWAH 4ABNA 4X3SA 3A55A 4IZ8A 4BY1G 3C2PA 1RL2A 3LWEA 5BR8L 4HIMA 4Q0FA 1GHKA 5G3LD 2GVBA 1SYGA 1TWAB 3TBIB 1SYDA 1CM9A 1STHA 3HGBA 1Q3LA 1HCZA 4ZRZA 1G2TA 1LTGD 4WRDA 1T5XD 3Q24A 2A68D 2KEEA 5JJLA 4H13C 1PDQA 3MXUA 4A3LH 5IYBH 4OL7A 1Z6HA 2PI2A 3A8IE 5CMDA 5IOCA 5AJ3L 1SNPA 1J9OA 1GOZA 3CKIB 3LGJA 3IL8A 1J5EQ 1XPOA 2R92B 2RHSB 4HJAA 1XMOL 3HG9A 4JCVE 4DNIA 3QWNA 5LMNL 3HKZG 4A4IA 2PI2E 2L1BA 4DNTB 3H91A 5KYIA 3RN5A 3RNUA 1TIID 4IUTA 1EQVA 3MXNA 4FP5D 4OO1H 2M00A 3T13A 1NMFA 4GNXB 4BY7H 1QJOA 3E9HA 1ILQA 4R1JA 3VR5A 4YHHQ 3PIPA 1I94Q 2B2WC 3UDGA 5C4XG 1A6XA 4A75A 1GD7A 4R4QA 1IL8A 1TS5A 2J4XA 1MHWC 5CV8A 2ZJQA 5IT9E 1ZKOA 4LUZA 1L0XB 1JWUD 4XQJA 2L11A 2L55A 4DV3Q 3BYTB 5IE8A 4X62L 5KGUA 5FLXE 1LM0A 4A3BH 1A3VA 4HN7A 2AKWB 3DM3A 1QWYA 1U5KA 1Z7TA 4DV1L 4A3BB 2CWAA 3PUXA 2B63G 1SNMA 3NE5B 1NBWA 5KEEA 3EQLC 1QUQB 4PMBA 2QEXA 2WAQB 1K3RA 1EFID 1PH8A 1Y1VH 4AYBB 3ZJYC 2QEJC 4L6TB 3A7AB 2HT1A 4EQNA 1GM5A 1KLGD 3P1HA 4A3KB 1C4QA 4EX5A 2F0JA 1Y1VB 3SEBA 4JI8L 4TKOB 1UWVA 4JI5Q 2R7FA 1VDZA 3BU2A 4XTCS 1CFMA 4RGMA 2C35B 2MO0A 1U4LA 3CQZB 1XPRA 2KCCA 5M3MH 1TQOA 3TZDA 4BA1I 3M9BA 2TMPA 5CGKA 2CFMA 2QA4A 5M3MB 4JPBW 5E1FA 3URYA 4HJ8A 2JYOA 2JK8A 4DV4L 2F0QA 1K8OA 1LT3D 3J81i 1EWCA 3I73A 1FGBD 1MJCA 5IWAQ 4A76A 5EPJA 1RCVD 1HNWL 4IJLA 1XNQQ 2R61A 4CDDC 2I5LX 1VCIA 5ELOA 4UY8C 3KJPA 3SK5A 1IBMQ 2M9VA 1I4XA 3T16A 1JOOA 2XRSD 2B2UC 3HRZC 1HR0Q 5CYUA 5ELNA 1ZXTA 1M4VA 2RVLA 3B6YA 3IFDA 1IZ6A 1V43A 1HTLD 2JSOA 3G6EA 2KCNA 3MHBA 4NW2A 4NXNL 4JI3Q 1X56A 1KAWA 4XXEA 1QCBD 2OT2A 2UXDQ 4DR5Q 3HOWB 4LNQA 4OHJA 2PO4A 4EGVA 1K0RA 2SDFA 2V4DA 3LX0A 3CU7A 1YNND 1VQNA 1F9QA 1BUVT 1G6PA 4IQZA 1EYCA 4IFDG 3KF8A 4X3TA 1T9HA 3TP8A 2HDLA 1BOSA 4B3SL 5JEAG 3DWPA 1OXVA 3JAMc 2UUCL 4DR7Q 2ZXPA 4JW0A 2JA7B 3GDEA 1I3QH 3STBD 1EWHA 1JCKB 4DXGA 1DONA 1P8LA 2IX0A 3IRBA 1TR5A 4P2CB 4KK7A 5NUCA 1I3QB 2B29A 4NXML 2DY7A 3HOYH 2KJXA 1H9RA 4S3SA 2VXWA 3A74A 1ET9A 1KTKA 2PZTA 4G57A 5K5PA 2EYLA 3T51B 1LLRD 3HOYB 4K0KQ 3KUPA 2EQSA 2F0FA 3OOCA 3CCMA 4A3CG 2Y0SG 4QGUA 1UE7A 4DR3Q 1JB7A 2F0IA 1HTPA 3NEMA 2F0NA 2KOLA 2WINB 5DM63 2HUGA 2JXMB 4NPSA 1WD0A 5E4WC 3EVQA 4O1NA 2BDOA 4LF6L 1EY6A 3SVMA 2A8VA 5CV5A 2IJ0A 1AFPA 4DF7A 2Y0SE 3RD4A 1ONLA 4RCNA 5BR8Q 1A2UA 4KD3A 5IYDH 4GN4B 5I2YA 2O2LD 1PHJA 1ASYA 3EBEA 3VA5A 1TY2A 4C3HH 2B2WA 5DEHA 1R4QB 3NELA 4DUZL 2FINB 2JA8G 2WB1G 3FVQA 4C3HB 3NENA 1MKHA 3J81E 2F0EA 1ENFA 1GUTA 3A56A 5JOBA 2DJGC 1Q46A 1D5XC 1VQPA 1YIJA 3MEFA 1QZGA 1EQTA 5AJ3Q 1IHZA 1LV9A 2XGTA 4FNFA 4LMQD 2WB1E 4PG3A 1PRTF 5EJWA 3SK8A 1IBKL 3GTLH 1IKMA 4IUPA 4RG1A 3U50C 1XMOQ 1N36Q 5LMNQ 1I50H 4GLXA 2Q8TA 2K05A 1JC7A 1FJGQ 5CV7A 3GTLB 4YWMA 4OXPA 1VQDA 2KQ3A 4CHTB 2FXQA 3FKIG 4L8JA 4BXXH 1CA5A 3MA2B 2JA6G 5D14A 2Z9HA 1HXYD 3KF6B 3I4MH 2MP1A 1PTOC 1KDBA 3UDFA 1PA6A 1PRTB 2DUDA 4ID6A 4GLVB 1EEID 2RCNA 2UXCQ 4LF7Q 3J7AV 3I4MB 4LW1A 5E4XA 1Q8KA 1KLUD 2KHSA 2VNUD 2HCIA 1JWSD 3H3VH 3DUZA 1EYGA 3ERSX 1DYQA 4GOPA 3GTJH 1WD1A 1PFNA 1WCMG 3TS0A 5IGCA 2BCOA 5DAUA 2AHOB 2IT1A 4IOCA 2YYZA 5FKAC 3GTJB 4TQUS 3VR6A 3F2UA 3EJIA 5M3FG 4DV1Q 3J7A5 1STBA 4ZYSA 1TXYA 2R93H 5IGEA 3GO5A 1VQ9A 3RR5A 3UE0A 3CMEA 5GAGC 4ZKCB 3PIOA 3HOVB 3PV0A 5M5XB 5I2XA 2R93B 3S17H 4J8QA 3HOZH 2HDMA 2EY1A 4POFA 2UUAQ 2KHIA 2B2UA 4H02A 2YU9H 1KL9A 2EXZA 1B2TA 1IL2A 3K7AH 4OX9L 3S17B 1BCPB 4JI8Q 3HOZB 2EXDA 3WDNA 1AEXA 2D5DA 1H9SA 1DOKA 2YU9B 5J22A 1X55A 2NTSA 4P74A 1R4PB 4LFAL 4X3KA 1SDFA 1HZCA 2OTLA 2JA5H 2NVTH 3D3RA 1S40A 4DR4L 2PQEA 3TZUA 3MC0B 1UEAB 1S5DD 1JWMD 2F0LA 4LK1C 1JB3A 1MJEA 2FFKB 2JA5B 2NVTB 4HIOA 1VQIA 4XYQA 1I94L 4KN7C 4BA2I 4RGTA 3GTKH 1BVSA 4DV4Q 1Y8NB 4A3MH 3D0FA 3IFTA 1B50A 4G7ZC 1AH9A 1E3PA 1HNWQ 1IBLL 1V1OA 3GTKB 3BDLA 3K57A 2SOBA 4A3MB 2ICEC 1F77A 1LTSD 5GAHC 3PQIA 1QILA 4JBMA 4I7ZC 5ELCA 4AQYL 1K8AC 3OIPA 2K04A 2DN8A 3K80C 3M85A 5JVH3 1EIHA 2C9OA 1OTCA 1WFQA 1I4HA 4A93G 1SMYC 3S14H 4N9TA 1EY5A 2K03A 4ZQ3A 2JEAI 3BVZA 1IW7C 2BH8A 5AFWA 3KLRA 4QUFA 2NZHA 4NXNQ 2K32A 4LUVA 3S14B 4JI0Q 1YZ6A 1MSGA 5E3FA 3W3AA 1GXDC 1SNQA 1L1OA 3S9WA 1I4GA 3KDFB 3OWEB 1B44D 2QILA 1BBUA 4R9WA 1MGSA 1U4PA 1ZYRC 4NP5A 4BBRG 2DNCA 5F2DA 1ET6A 1MI2A 4B3SQ 1TVXA 4HIDA 3QB3A 2F0KA 1LT4D 4BWGB 2UUCQ 5IYBG 3I72A 2R92G 1AZPA 3TP6A 4E6IA 3GTPH 1U4RA 4KY7A 5ELEA 3BZDB 2F0SA 1DGSA 4L5RC 3G6JB 3KLSA 4DAYA 3J7ZC 5C5LA 1D5MC 1Q1BA 4A3EG 2YTVA 2MPMA 3E0JA 3PO2H 2A6HD 4CJ0B 4NXMQ 3CAMA 1M90C 1IYJB 3PO2B 2OXPA 2Q2IA 4L5SA 4QF4A 2LY7A 1KHIA 2EJFC 3M4PA 1XTCD 3R93A 1HR0L 1F2ZA 1G2SA 4KJOA 3OYYA 4FO2A 4LF6Q 3BDOA 5CORA 2MHVA 1D6EC 4XDXA 1WTRA 3HOXG 2FMCA 3U4ZA 3I2ZA 4X66L 3U58A 1H9KA 4A3BG 4V0BA 5EKLA 2UXDL 5ELBA 3PUWA 1QOHA 1PH5A 2H5XA 2G9HD 1OXSC 2EYHA 2MFIA 4HJ9A 4A3GH 3I91A 4A3IH 3GTGH 4GN5A 3NPPA 4CBVA 3BJUA 1SE4A 2YV5A 1RTOA 3QR8A 5FJ8G 3OTOL 2J7ZA 5C0XH 4DUZQ 2KCTA 1VQCA 2WAQG 3N6RA 2Q2TA 3MXGA 5JJIA 5A2QE 4A3IB 4FVMA 3GTGB 5CV6A 1S3OA 4KLKA 3I70A 1DOMA 1DZ1A 1TT2A 4J1MA 2RCFA 4A3KG 4DUYL 2ID0A 3I4NH 1Y1VG 1O7ZA 1S5FD 5FLXL 1CKOA 4IURA 3VYSA 4OO1I 1NAPA 3DXJC 1BF4A 4CKCA 2CW0D 2I5HA 4AIMA 2M2LA 3I4NB 3PIP3 3OW2A 5CBEE 1FVIA 1DJRD 4PZ6A 1QNUA 4Y52H 5I9PA 5I4DA 1BO0A 2NWGA 3P20A 4DV0Q 4CJ1B 1VQ7A 4EQOA 1XX8A 2F1MA 2Z4IA 1PZID 4QCLA 3FPUB 3RUZA 1EZ8A 1PRTD 1ASZA 4H0LC 3TP7A 2PNRC 2HCCA 3HZXA 2KEDA 5EPKA 1HFNA 1NE3A 3CHBD 1SXTA 2X6GA 3I4OA 3D8GA 4X64Q 3G4SA 1EQQA 1E7ZA 2VY3A 3T1HQ 2XNAC 1YEZA 2MNAA 3NQIA 4X65L 4U673 4XT3B 2A69D 1F9PA 2XN9C 1WTQA 3MVVA 1B3AA 3M4QA 3TSSA 3FMCA 3GTMH 3SK4A 4WJ4A 4ZLTF 4BBSH 1LTRD 5LMNW 2EY6A 2V1CC 1V9PA 3G48A 4FXDA 3HOWG 3J81j 3QOJA 3GTMB 1WTXA 2QF7A 1AW7A 3FHWA 1KABA 3RLNA 1WTPA 1CA6A 4MNOA 3AB9A 3U9SA 4F7XA 1WTOA 3ND8A 4A3FH 1SSOA 3MEHA 3UI2A 2K5QA 3U4VA 2CHBD 1K73C 4O0AA 1STEA 3K59A 1BCPD 1N36L 2PZUA 4OX9Q 3HOUG 3BYYB 3PUZA 4MZ9A 3T53B 3VR2A 3UE1A 2ZXOA 1FJGL 1MBYA 2RBMA 1CKMA 2E76C 2JA7G 4R8NA 2XIWA 4LFAQ 1AE3A 3X3MA 4LF4L 3UDIA 3L3OC 2PMZE 1G6ZA 4DR4Q 1VQ5A 3HKZE 3J80i 2EOTA 5IP7G 2R7ZH 2UXCL 4LF7L 1LACA 1EY7A 5T1IA 2F0UA 1NNXA 2ZTEA 5KNDA 4V190 4BY7B 4IPHA 5EQ0A 3I56A 1BBWA 1SN8A 1B70B 3PO3H 1VF7A 2NVYH 5IY0A 2R3ZA 3K6OA 1GJXA 2Z6BA 4DAPA 1IBLQ 4CDFC 1VS0A 5GADC 4G7OC 2WKDA 3PO3B 2NVYB 4IUVA 5IYCH 2NVXH 1D5ZC 1SR3A 1FNVA 2HIXA 4AQYQ 1A2TA 5I6WA 2J0TD 3F1ZA 3PF5A 2NVXB 5BN5A 1EUJA 2IHEA 4C56C 3A54A 3NK9A 1DOLA 4RAUC 1DCZA 1A8VA 1HUMA 1GUOA 2NBFA 3JC66 1PTOH 1J8IA 4GLAC 4JV5Q 4GS3A 5ELFA 4HTHA 2UUAL 3H0GG 1E24A 3W5OA 4G7HC 2K5WA 3SXHA 4C3HG 1FL0A 1PTOB 4OELB 2O5JC 4I65A 4IUNA 1XXGA 5C3EH 4DR1L 3GTQH 5JPNC 5EPLA 2E5LL 4GOPC 1Q82C 5FLMG 5CV9A 1UUPA 5C3EB 3NSWA 1EQRA 3GTQB 3NBHA 1X54A 1K0SA 1TS3A 1UE1A 2F4VQ 4QIWB 4LF5L 1H9MA 1LTAD 2L15A 1NUCA 4C3IH 1AN8A 2E8GA 4O2DA 3KLSX 3MTSA 3V05A 3LWUA 3OHXC 4DK3C 3RMHA 1CQVA 4C3JH 1Y1WH 3P75A 3KBXA 1WOCA 2F0GA 2WKCA 1YI2A 3NBIA 4C3IB 2N55A 4DK6C 2UU9Q 3V2TA 2EJMA 4HCEA 1TKWB 3J81L 1Y1WB 4C3JB 3I4MG 2K5HA 1X3FA 1YITA 2N3SA 2QKIC 2HIVA 4MN3A 1E2VA 3K81C 1LTLA 4KV6A 1ESFA 1NTGA 5J3BA 4WJ3M 1C0AA 2OWOA 1CKNA 5EBCA 4DAMA 4K5VA 1K3BC 4IUUA 4KD4A 1VQOA 2XVSA 1HRJA 1CK1A 4BY1H 2VZAA 2VW9A 4X66Q 5C3WA 2PZWA 2H4OA 3KYHC 2RQXA 3MZ5A 1HJPA 1QB5D 4JI0L 5FOBB 2ES2A 3OIQA 5HURA 4R4CA 4KTAA 4OEMB 4BY1B 3MAQA 1SNOA 4A3DH 4ZUJA 3VA7A 1GUSA 3OTOQ 3J80E 2B2VA 4H44C 3K5OA 4QJFA 1VQ8A 3OW7A 4TRDA 3HOVG 4A3DB 2CCZA 4NKLA 3W2DA 1CUKA 1JICA 4HCSA 1BXTA 4DUYQ 1AP0A 1HFGA 3HOZG 2K5NA 3ICEA 4GKJL 3BDCA 1K8MA 1V1QA 2Z8LA 3RLFA 2P5ZX 4KN4C 2F0MA 2AUKA 1KQSA 4HSPA 1C48A 1PZJD 3GTOH 3H3VI 2BOSA 2RDGA 4JI2L 3QOLA 3HKZB 3OMCA 3A5ZB 3PCOB 3AYHB 2L5TA 3NXWA 1VQHA 3RZOH 1H95A 1HNXQ 1L1OC 4Q5VA 3MXNB 5K36G 1PYSB 2UXBL 1B9MA 1QG7A 3RZOB 1YVCA 2AWOA 3J7YW 3C1FA 1RTNA 2XSCA 2VUMG 5CV4A 4JG2A 3I55A 3SGIA 4TVAB 1FGUA 4PV1C 2OQKA 3PIO3 3TQYA 4X65Q 2CVRA 4B3TQ 2E2JH 1SE2A 3ONAB 1STGA 2F52A 3DMUA 5BN3A 1QVGA 2B63H 1UNSA 2E2JB 4FDBA 4APVA 4MHEA 4GKKL 2EZVA 1CZWA 3CC2A 3S15H 3HP3A 2MJ8A 2CH4W 2CKZB 2E75C 2F0WA 5FK9C 3TREA 1HUNA 2G9DA 3SK6A 2D9UA 3CP0A 1EIGA 4LFCL 3S15B 3F2CA 1EFWA 3D6WA 3SR1A 3S1NH 1CT1D 5C44G 2HD3A 4FF2A 4XYOA 1F2YA 3PUVA 3X3NA 1XWEA 4HMJA 3OMGA 4DR2Q 2RF4A 3S1NB 1KNAA 1CSPA 1F9RA 5JVG3 1LYLA 3A0JA 4JI1L 3QG1A 4Z9CB 4LF4Q 1I50B 4YCUA 4DV0L 1B8AA 3FP9A 4P73A 1IYUA 1VQJA 2Z0SA 3K8AA 5C4ZA 2B39A 1RD9D 3VDYA 3I90A 1H9JA 2NUCA 1X6OA 1E2WA 3NBHB 4R4TA 1PH6A 3DM1A 5C3XA 3PO2G 2NZ1D 5KNBA 2A5HA 4X64L 2EIFA 2PQAA 1XTDA 4B08A 3T1HL 2DJFC 3CCQA 1ML0D 4DA2A 3K7UC 2EY2A 3L0OA 1CZGA 4RWSC 5IP9H 5JPMC 1NR2A 3EA6A 4KKTA 3OSOA 4UDUC 1X9NA 5IT9c 1YJWA 3NWSA 4P75A 1Q1EA 4JC0A 1GUWA 1YNJC 1BCPF 5FLXc 1Y69U 3KFUA 1WYDA 1F2MA 3M4OH 1LT5D 3CRLC 2HQLA 4ZK9B 1TWGH 3VYUA 3DWAA 5EGTA 1WTWA 3EIVA 2D2CC 1CQFA 3D4WA 4NDXA 1PH4A 3GV6A 1MIUA 1X3GA 1KRSA 1LTBD 1PTOD 3ULLA 4IFDH 3BS1A 4F87A 3IAYA 1N9WA 5C0XG 2NYZD 1V8QA 4DR1Q 1RDPD 4XT1B 5JEAH 1YBYA 3HS0C 4NMZA 1C7YA 2K52A 2Z1CA 3K7AB 2E5LQ 3R3OA 4DV7L 1B1ZA 1QVCA 3EROA 4DV5Q 3KF8B 1EY8A 3CPFA 4CKBA 3TRZA 1KDCA 2H1EA 4LF5Q 2CQOA 2QW7A 1LTTD 1K8GA 1DD2A 4K14A 4RHSA 2LKVA 3L9AX 3NWTA 1STNA 2NB0A 1EYAA 4QQBX 5A2QL 3DWQA 3VR4A 1EU3A 2Z4HA 2F3IA 3JAMi 1B3QA 1B53A 4A3CH 3NTKA 4DV2Q 3WWVA 3E3XA 1ENCA 1KIXA 1TU2B 2ZJPA 4WORA 4CJ2C 4YWKA 2EYOA 1E2ZA 2JP1A 1SJED 2WV6D 2Y0SB 2IX3A 5GAEC 5C0XI 5HY6A 2K01A 3NQTA 1I6HH 2KVMA 2SNMA 5H1SE 1PFBA 4UHVA 1PFMA 2CH4A 2QDBA 2EYFA 3FDTA 3KLWA 3S1MH 3S2DH 4JV5L 4RCOA 1VQGA 1E22A 2K5VA 2HQEA 4DV6L 1QE6A 3S2DB 2NTTA 3CCRA 3CXCA 1UE5A 2N88A 2JA8H 1PZKD 1D7QA 4N9PA 5EBDA 3G71A 1PXUA 4FXKC 2RSOA 2MO1A 3QJYA 1PH7A 2JA8B 2WB1B 4A3LG 4K5XA 2L12A 4YCWA 1PLFA 4JBKA 1SAPA 4KJNA 4JI6L 2F4VL 3TN2A 1EOTA 1GUGA 1HR0W 2WP8J 4GKJQ 2EY5A 1X32A 3GTPB 1FNWA 1ICWA 1KAAA 3K5NA 4B3RL 1U0LA 5C0XJ 1GHJA 5HGQA 1E1TA 1STAA 2PPBC 3O13A 4GNXA 2UU9L 2IL8A 4JOIC 2VB3X 1EIFA 4JI2Q 1OXUA 2LS01 2JA6H 1SMYD 2E2DC 1IXRA 2IPKD 4IO9A 1W3SA 3I8ZA 2K1BA 4RH6A 4OO1G 4Y7NH 3S16H 1HQRD 2G5DA 4K2KA 4BY7G 2JA6B 3KBGA 4P72A 1SRUA 4QL5A 4L5QA 2K5DA 4Y7NB 2RSNA 3S16B 4YIJA 4JI7L 2UXBQ 4JI4L 4P71A 3CW2C 1WCMH 2CW0C 1XJVA 1ZYRD 4G4KA 2ZTCA 4R8IA 1WCMB 1XNRQ 4GOPB 1BQQT 2A1AA 2B2TA 4OWWB 2PQAB 4DN4M 4OWXB 2BE5C 1QUQA 1SMXA 2Z6KA 4AH6A 2HHHQ 1VQMA 1DXMA 4A3GB 1HHVA 1O7LA 4AYBG 1NSNS 4GKKQ 1VQAA 2Q8RE 1PRTC 3CRKC 1HQMC 4OIJA 5IT9L 3W1GA 1ZEQX 2A6EC 3JAME 1ENAA 1UE6A 4LFCQ 2WAQE 4K2LA 1RHPA 1SLJA 4QY7A 1YHBA 1I6VC 2VB2X 4A3JH 1NJIC 4C1NK 4AYBE 4HIKA 3S24A 1Z9FA 3HKSA 3J81c 4ULLA 2B2YC 1A0IA 3CC7A 4RKLA 4A3JB 1XMQQ 4LF8L 3EFXD 3MFYA 5EKIA 4LFBL 1LT6D 1TS2A 3IKJA 4R4IA 4JI1Q 4PZ8A 5E7NA 3D4DA 1FR3A 1KDAA 2SNSA 1Q12A 1PYWD 3NP8A 1H9SB 5M3MG 1S5ED 2A68C 1GVPA 4H7BA 5I9OA 1HNXL 4C3IG 5ISRA 3CPWA 2AWNA 3C46A 2OTJA 1SNCA 3CCLA 2B2VC 1Y1WG 3E0EA 4EQPA 1VQLA 3H15A 2ZJRA 4HJ7A 1UEBA 2FJ2A 5A35A 3A5UA 1SNDA 1U9RA 4B3TL 3F8TA 4CDCC 3SDZA 4LJZC 3ULPA 2C5CA 2D0OA 3D6CA 4EQ5A 1WTVA 3ULJA 2F0VA 2I5MX 5LL6S 4A93H 4JBWA 3OPOA 4ALPA 1CHQD 3CCJA 3SHLA 4BBSB 4IUQA 4A93B 4JK1C 4TSSA 1S5BD 4QB4A 1A62A 5ELDA 2LFNA 5D3DA 5LMUL 4A3DG 2IHFA 3PSIA 2ENBA 4DR2L 4A3FB 2AUJD 3KK7A 5J1ZA 4BBRH 2B3GA 1L1OB 2JJQA 3DEPA 3BZKA 1T5EA 1Y8PB 4DV7Q 2KCMA 3NTIA 1BR9A 2R92H 4BBRB 1V1PA 4IPGA 5CBAE 1HNZQ 5GROA 2K33A 2DGYA 1E0BA 1EZ6A 4A3EH 2BH2A 1NMGA 4B9WA 2AMCB 1A3UA 1GUNA 1JOQA 1Y14B 3J80L 4DFAA 3KJOA 1HZAA 2R7ZB 3HOYG 4DAYB 4A3EB 2I07B 3BVGA 1J6QA 5C5MA 4DGZA 1BBXC 4ZAIA 2CWPA 4WFN3 2F0HA 1SEBD 2PCFB 2LXJA 2OEOA 1NCVA 2VQFL 1Q81C 1VQBA 1K9MC 4GZYC 1STYA 2CQAA 1HA6A 2LSSA 4CKEA 3K5LA 3C3LA 1W2BA 1PTOF 2FMMA 3BG3A 3CMAA 1RF2D 4JOIA 1XPUA 2JEBI 1N32L 3HOXH 1GKHA 4RKBA 3M4YA 1AE2A 1SFOH 2F0OA 3Q8DA 3CF5A 4F88A 1S4ZA 2ZXRA 3E5SA 2BA1A 5IYDG 2GN5A 2NVQH 2K7VA 1OO9B 3HOXB 1MSHA 1W6JA 1SFOB 5FJ8H 4DV6Q 1OXTA 1OXXK 4NB3A 1TWFH 2NVQB 2B8FA 4XQNA 2A73B 5C4HA 3ER0A 1JT8A 3D4RA 1AZQA 2NN6H 2BDNA 5FO7B 4K8JA 5KIXA 1TWFB 4ZUIA 2A19A 4DV5L 4A3KH 4FF4A 2DNEA 1JE5A 1WI5A 3D31A 4JI6Q 1JORA 1D1KA 4B9XA 3U9OA 4J15A 5D3IB 3AFQA 1B4OA 4DR6Q 2RDHA 2RKSA 3R8BA 3CQZH 1P16A 1QZHA 2N78A 4B3RQ 3KF6A 3AFPA 1KC8C 5IGFA 4PQXA 4HEDA 1VQEA 3PF4A 1Y8OB 1BKBA 2PW7A 4BXXG 1YNNC 3R2IA 4K8IA 5CR3A 3TDQA 4WJWA 3SE0A 2DY8A 3LNNA 5I6YA 3T1YL 3A8JE 2E2HH 4DV2L 1VQFA 1N33L 1CTMA 1F2LA 1E1OA 3R2TA 1LUZA 1WVLA 3E6ZX 2B2YA 3CCUA 2E2HB 1HH2P 1SBBB 2K28A 4JI7Q 4K5WA 3CCSA 4JI4Q 1N34L 1WTHA 2YTYA 4ME5A 4ODGA 3STBC 4X3UA 2K75A 4FF1A 4F8MA 1VMPA 3TS2A 2E2IH 5M5YH 4RGNA 1W6KA 2N49A 1JJGA 5IP9G 1SYEA 1EOVA 2E2IB 5M5YB 3GQBA 3HOWH 2K4KA 2AQ3B 4IPDA 2R93G 2VQEQ 2LXKA 4KY6A 4KHPQ 1SYCA 2F4IA 4UP7A 5FO9B 4B3ML 1X3QA 5C4JH 5EAYA 1YHQA 2D0PA 1KXLA 4YY3L 1B7YB 1BNZA 2ATWA 1CHPD 2L4NA 4HSVA 3DEOA 3HEJA 5C4JB 1A63A 1SE3A 2Q8IB 3HOUH 3I4LA 5FO8B 2ALYB 3A7LA 1JR0D 4DAVA 4OONA 4LF8Q 2PMZB 2JA7H 4LFBQ 5J39A 2SEBD 3HOUB 1YNXA 1Z47A 5C6AA 2JA5G 2OF1A 5M9OA 3V96A 2XWJB 3GTOB 3VYRA 3K0YA 5IP7H 1UAPA 4PNYA 1A3TA 5BN4A 5C4XH 3FEWX 5IODA 1V1PB 1TS4A 4I7AA 1L0WA 2IX1A 1NR4A 4A3MG 2EVBA 3I3CA 1RODA 2QDLA 5KRUA 5C4XB 1ICFB 3BVMA 4KHZA 4MIUA 3ERQA 4DK1A 3E9IA 4LF9L 4FXGC 1N8RC 1FD7D 1XNRL 5LHY1 2AQ2B 1HPCA 3ITPA 4JYAL 5M5WH 2PNHA 2MUYA 3QIAA 3K5MA 5IGGA 4IFDI 2HHHL 3G7LA 3FRPB 1PV4A 5JJZA 2F0DA 4RFBA 1KD1C 3CC4A 4KKUA 2B63B 4ZKBB 2R6GA 2EPBA 5M5WB 3FPPA 2UUBL 4GNXC 3TMEA 1M8AA 1FYCA 2VL6A 3KDFA 1WJJA 1VQ6A 2F3WA 4LWCA 1SROA 3DLLA 4DXFA 5DNFA 1Q86C 3H0GH 5CC4A 4OIKA 5LMUQ 2ZM6L 1B9NA 4IALA 1FNUA 3H94A 3H0GB 2LMCB 1XMQL 1II3A 1K83H 2EYPA 3RZDH 5FLMH
chains in the Genus database with same CATH topology
3RLOA 4X65L 3J81i 1UE5A 1MJCA 5IWAQ 4A76A 2JA8H 1D7QA 1HNWL 2OCEA 4IJLA 3G71A 3M4QA 1XNQQ 4GN3B 2I5LX 3GTMH 1VCIA 4WJ4A 2K14A 5ELOA 4BBSH 2MO1A 1PH7A 4IFDJ 5LMNW 4UY8C 2V1CC 3KJPA 4A3LG 4YCWA 1V9PA 3G48A 2Z6KC 4JBKA 4DPGA 4JI6L 2F4VL 3HOWG 3CCVA 3J81j 1IBMQ 5JEAJ 1HR0Q 1HR0W 2WP8J 2BA0A 4GKJQ 5ELNA 3FHWA 3B6YA 3RLNA 1IZ6A 4B3RL 1V43A 1U0LA 4MNOA 5C0XJ 3S1QH 1C9OA 5HGQA 4A3FH 1E1TA 3S1RH 4GNXA 2UU9L 3G6EA 4NXNL 4JOIC 3U4VA 1EIFA 2VQFQ 1EIYB 4JI2Q 1K73C 1X56A 4O0AA 1OXUA 3CCRA 4JI3Q 1KAWA 2JA6H 1IXRA 4IO9A 1N36L 4DR5Q 4OX9Q 3HOUG 2UXDQ 1W3SA 3PUZA 4MZ9A 4LNQA 4OO1G 3UE1A 4Y7NH 1FJGL 3S16H 1PH3A 1K0RA 4BY7G 2JA7G 1CKMA 4P72A 3L7ZC 4LFAQ 1SRUA 1VQNA 1AE3A 1N32Q 4QL5A 4X62Q 4LF4L 3UDIA 1G6PA 1CSQA 1RIPA 3KOJA 4L5QA 2PMZE 4IFDG 1CKNB 4JI7L 4DR4Q 2UXBQ 1VQ5A 1I5FA 1T9HA 1PH1A 4JI4L 4B3SL 4OWTB 3HKZE 4P71A 3J80i 3CW2C 5JEAG 5IP7G 1HZ9A 2R7ZH 1OXVA 1WCMH 4A3GG 4A3IG 4LF7L 3JAMc 2UXCL 4ME3A 1PFSA 2UUCL 4DR7Q 1XJVA 2XTIA 2ZTEA 3PGZA 2ZTCA 2GVAA 4IPHA 3HOVH 5M5XH 3GDEA 3I56A 1I3QH 1BBWA 3STBD 1SN8A 1B70B 4YWLA 4GOPB 2A1AA 2NVYH 4OWWB 1XNRQ 2PQAB 5IY0A 3PO3H 4OWXB 1IBLQ 1VS0A 5GADC 1P8LA 1QUQA 1SMXA 2IX0A 3IRBA 2B29A 2Z6KA 3BZCA 3K0XA 4AH6A 5IYCH 2HHHQ 1VQMA 1Q7YC 2NVXH 3I4NG 4NXML 3HOYH 1J5EL 1SR3A 2HIXA 4AYBG 4AQYQ 1HNZL 4GKKQ 1VQAA 4A3JG 1PVOA 3A74A 3F1ZA 1PH9A 3PF5A 2KHJA 3W1GA 1EUJA 4K0KQ 2EQSA 2IHEA 3CCMA 2ZTDA 4LFCQ 1UE6A 4A3CG 3UDXA 2WAQE 4LUOA 1SLJA 4QY7A 1YHBA 1D8LA 2Y0SG 1UE7A 4QGUA 4DR3Q 4AYBE 4A3JH 4HIKA 3NEMA 1A8VA 1JB7A 3S24A 1Z9FA 3HKSA 3J81c 4JBJA 4NPSA 3JC66 1A0IA 4GLAC 4UPAA 3CC7A 4JV5Q 4GS3A 4LF6L 1XMQQ 3T1YQ 4LF8L 2UUAL 4LFBL 2KENA 2A8VA 3H0GG 4R4IA 1N33Q 4JI1Q 4PZ8A 1E24A 5E7NA 3W5OA 4C2MH 2Y0SE 4YHHL 5DLQE 1FL0A 4IJHA 1Q12A 4R4OA 5BR8Q 5IYDH 4GN4B 5M3MG 1I94Q 5C3EH 1PHJA 1ASYA 4DR1L 3GTQH 2VUMH 1GVPA 4HJ8A 1N34Q 2E5LL 3EBEA 4DV3L 1HNXL 4C3HH 4GOPC 1Q82C 3CPWA 2AWNA 5FLMG 3M7NA 2OTJA 3CCLA 1EQRA 3NELA 2OQ0A 1X54A 4DUZL 2KBNA 1Y1WG 3E0EA 1UE1A 3HFZB 4LF5L 2JA9A 2F4VQ 2WB1G 4YCVA 2JQOA 3NENA 1MKHA 1VQLA 2JA8G 3H15A 2L15A 2ZJRA 4HJ7A 1UEBA 4C3IH 2E8GA 4O2DA 1VQKA 3A5UA 3I7FA 4POGA 4BBSG 2MQHA 2QGQA 1Q46A 1VQPA 4DK3C 1YIJA 3MEFA 3F8TA 4C3JH 1Y1WH 1QZGA 5AJ3Q 4B3TL 1WOCA 3S2HH 1YI2A 2XGTA 4DK6C 2UU9Q 2WB1E 4PG3A 3RN2A 3ULPA 1IBKL 2I0QA 2D0OA 3GTLH 4EQ5A 2JE6I 2Q2UA 3U50C 4RG1A 3ULJA 2I5MX 2WFWA 1XMOQ 1N36Q 5LMNQ 4A93H 4JBWA 3I4MG 2K5HA 4ALPA 4B3MQ 1I50H 1X3FA 3CCEA 3CCJA 2N3SA 4GLXA 1YITA 2HIVA 3J80c 1FJGQ 4A3FG 1TWHH 5C44H 3K81C 4YWMA 1LTLA 4OXPA 1VQDA 4YY3Q 2FXQA 3FKIG 4BXXH 4DR6L 1PYBA 2JA6G 1NTGA 3KF6B 1NY4A 5J3BA 4JI5L 3I4MH 4WJ3M 3UDFA 1C0AA 2N8NA 2OWOA 1CKNA 1A62A 4DAMA 1PA6A 2DUDA 1VQOA 1EWIA 5LMUL 3FKIH 4GLVB 4BY1H 2RCNA 2VZAA 4RMFA 2IHFA 4LF7Q 4A3DG 2UXCQ 2VW9A 3PSIA 4X66Q 4LW1A 3KYHC 1HJPA 1Q8KA 4DR2L 2VNUD 4JI0L 4DV4L 2ES2A 4R4CA 4BBRH 3H3VH 2Q2HA 2B3GA 1L1OB 1EYGA 2JJQA 3ERSX 4GOPA 4A3DH 3BZKA 3GTJH 2R7ZG 4MTNA 1WCMG 4UP9A 2KCMA 4DV7Q 3TS0A 3OTOQ 2R92H 1PH2A 1L2FA 2AHOB 2IT1A 4QJFA 5IWAL 4IOCA 1VQ8A 3HOVG 2YYZA 4IPGA 1YJNA 2CCZA 4TQUS 5M3FG 1HNZQ 3PO3G 1XNQL 5GROA 4DV1Q 1CUKA 2YTXA 2DGYA 4A3EH 3J7A5 2BH2A 1NMGA 2AMCB 1TXYA 3M3YH 4DUYQ 1G291 1Y14B 4LF9Q 5IYCG 3KJOA 1X65A 1IBML 1HZAA 3HOZG 3HOYG 2R93H 5M3FH 2K5NA 4DAYB 4HJ5A 4X6AH 3GO5A 1J6QA 1VQ9A 3RR5A 3UE0A 3ICEA 4GKJL 3CMEA 2D62A 1V1QA 3RLFA 2CWPA 5GAGC 4JYAQ 3PIOA 3PV0A 1HZBA 3F2DA 1KQSA 3S17H 1VQ4A 3HOZH 3EN2A 4POFA 1JMCA 2UUAQ 2KHIA 2LXJA 4H02A 3GTOH 3GD7A 3H3VI 2YU9H 4XIGS 1KL9A 2VQEL 2VQFL 2UUBQ 4JI2L 4JI3L 1YJ9A 1Q81C 1IL2A 3K7AH 1VQBA 1K9MC 4OX9L 4KHPL 4JI8Q 4DR5L 3A5ZB 1O7IA 2EXDA 2LSSA 3AYHB 3PCOB 4IPCA 1GO3E 5GQOA 1W2BA 3CMAA 1VQHA 1X55A 3RZOH 1H95A 4JOIA 4P74A 1XPUA 2JEBI 4LFAL 1HNXQ 3HOXH 1GKHA 1N32L 1G51A 4PMWA 1L1OC 1HZCA 3W1BA 1AE2A 1SFOH 2OTLA 3Q8DA 3MXNB 1S72A 2JA5H 2ZM6Q 2NVTH 2IY5B 3CF5A 5K36G 1PYSB 3L2PA 1S40A 4DR4L 2UXBL 5IYDG 2BA1A 2NVQH 1YVCA 2AWOA 2GN5A 3AQQA 2NN6G 1QVFA 1R9TH 5C3EG 5JJKA 2VUMG 1MJEA 5FJ8H 4JG2A 3I55A 3SGIA 1OXTA 4DV6Q 4HIOA 1VQIA 1OXXK 4TVAB 1I94L 4NB3A 4DR7L 4BA2I 1TWFH 1JJ2A 1FGUA 3GTKH 1BVSA 2OQKA 4DV4Q 3TQYA 3ER0A 4X65Q 4A3MH 4B3TQ 2RHQB 1JT8A 2E2JH 3D0FA 1JJCB 1AH9A 1E3PA 1HNWQ 4KI0A 1TWCH 4DKAC 2F52A 1IBLL 4L5TA 1QVGA 3AEVA 2A19A 1IBKQ 2B63H 4DV5L 4A3KH 4QIWE 4FDBA 4APVA 5GAHC 1JE5A 1WI5A 3D31A 2R7DA 4JBMA 2K50A 4JI6Q 4GKKL 4AQYL 1X3EA 3CC2A 3S15H 1K8AC 3M85A 3K80C 4J15A 2NZOA 2CKZB 3AFQA 4DR6Q 1YHAA 1OTCA 1WFQA 4UP8A 3CQZH 3TREA 4K0KL 1P16A 1QZHA 1KRTA 2N78A 3TEHB 4B3RQ 3CP0A 3KF6A 4LFCL 3S14H 3AFPA 4A93G 1KC8C 3F2CA 1SE8A 2JEAI 4PZ7A 2BH8A 1EFWA 1VQEA 4DR3L 3S1NH 2VS1A 5C44G 3F2BA 2NZHA 4NXNQ 3PF4A 3PUVA 1BKBA 4BXXG 4IOAA 4LUVA 4DR2Q 3PUYA 4JI0Q 1YZ6A 2RF4A 3T1YL 1M1KC 1CSPA 2E2HH 4DV2L 3CD6A 1LYLA 1VQFA 3A0JA 1N33L 2NN6I 4JI1L 1L1OA 1TWAH 1E1OA 4BY1G 3KDFB 1LUZA 1RL2A 4LF4Q 5BR8L 1BBUA 4HIMA 4YCUA 3CCUA 4DV0L 1HH2P 1B8AA 3FP9A 2GVBA 4P73A 4JI7Q 3CCSA 4JI4Q 1VQJA 4BBRG 2Z0SA 3K8AA 1N34L 2YTYA 4B3SQ 3STBC 3VDYA 4HIDA 2K75A 1X6OA 3NBHB 4R4TA 2UUCQ 5IYBG 2R92G 3TS2A 1PH6A 2E2IH 5M5YH 3PO2G 3GTPH 5JJLA 2N49A 1JJGA 1DGSA 5IP9G 4X64L 4L5RC 2EIFA 1EOVA 2PQAA 1XTDA 3T1HL 3J7ZC 1Q1BA 4A3LH 5IYBH 4A3EG 2PI2A 2YTVA 3CCQA 3PO2H 5AJ3L 3HOWH 2K4KA 3K7UC 3L0OA 3LGJA 3CAMA 4NXMQ 1J5EQ 5IP9H 1M90C 4IPDA 2R93G 1XPOA 2VQEQ 2RHSB 1X9NA 1IYJB 2LXKA 4HJAA 4KHPQ 5IT9c 1YJWA 1XMOL 4UP7A 4DNIA 2Q2IA 4JCVE 5LMNL 4L5SA 4B3ML 4P75A 5C4JH 1Q1EA 4JC0A 3HKZG 5FLXc 5EAYA 1KHIA 4A4IA 2PI2E 1YHQA 2D0PA 3KFUA 1KXLA 1WYDA 3M4PA 4YY3L 1B7YB 3M4OH 2ATWA 1HR0L 1A63A 3RN5A 3RNUA 3HOUH 2HQLA 1NJIC 1TWGH 2ALYB 3OYYA 3EIVA 1NMFA 4OONA 4GNXB 4BY7H 4LF6Q 4LF8Q 2JA7H 4LFBQ 3E9HA 4R1JA 1PH4A 4YHHQ 3PIPA 4X66L 3U4ZA 1MIUA 1X3GA 1KRSA 1YNXA 3I2ZA 3ULLA 3HOXG 3UDGA 3U58A 5C4XG 1Z47A 4A75A 1GD7A 2JA5G 4A3BG 2UXDL 4R4QA 3PUWA 3CXCA 1N9WA 5C0XG 1PH5A 2H5XA 1OXSC 2ZJQA 2MFIA 4LUZA 5IP7H 4HJ9A 4DR1Q 1YBYA 4A3GH 1C7YA 2E5LQ 2K52A 4DV3Q 4A3IH 4GN5A 5IE8A 5FJ8G 3BJUA 4DV7L 1QVCA 2YV5A 3GTGH 4X62L 3OTOL 4DV5Q 1LM0A 5C4XH 4A3BH 3KF8B 1L0WA 4DUZQ 2KCTA 1VQCA 2AKWB 2WAQG 3CPFA 3DM3A 4A3MG 2Q2TA 2IX1A 3TRZA 5JJIA 4LF5Q 2CQOA 1U5KA 1S3OA 4DV1L 4KLKA 2CWAA 3PUXA 1K8GA 4KHZA 2B63G 4A3KG 4DUYL 2ID0A 3E9IA 4LF9L 1Y1VG 3I4NH 2ASBA 1CKOA 1N8RC 4OO1I 1NBWA 1XNRL 4QQBX 1QUQB 2I5HA 4AIMA 2QEXA 4JYAL 3OW2A 1K3RA 5M5WH 3JAMi 2F3IA 2PNHA 1PH8A 1FVIA 1Y1VH 4IFDI 3ZJYC 2HHHL 4A3CH 1PV4A 4PZ6A 4DV2Q 3WWVA 2HT1A 1KD1C 4Y52H 1GM5A 3CC4A 1KIXA 2R6GA 2UUBL 2ZJPA 4GNXC 4YWKA 4EX5A 2VL6A 3KDFA 4JI8L 1WJJA 1VQ6A 4DV0Q 1VQ7A 1UWVA 1SROA 4LWCA 4JI5Q 5GAEC 3DLLA 2R7FA 5C0XI 5HY6A 3BU2A 3H0GH 4XTCS 1Q86C 1ASZA 1I6HH 2C35B 5LMUQ 2MO0A 5H1SE 2ZM6L 1XPRA 5M3MH 3KLWA 3S2DH 3S1MH 4JV5L 4BA1I 1NE3A 1VQGA 3M9BA 1XMQL 3I4OA 1E22A 2CFMA 2K5VA 4X64Q 1K83H 4DV6L 2QA4A 3G4SA 1EQQA 1E7ZA 3RZDH 2VY3A 3T1HQ 5FLMH 2MNAA 1YEZA 2JK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLO A;  4X65 L;  3J81 i;  1UE5 A;  1MJC A;  5IWA Q;  4A76 A;  2JA8 H;  1D7Q A;  1HNW L;  2OCE A;  4IJL A;  3G71 A;  3M4Q A;  1XNQ Q;  4GN3 B;  2I5L X;  3GTM H;  1VCI A;  4WJ4 A;  2K14 A;  5ELO A;  4BBS H;  2MO1 A;  1PH7 A;  4IFD J;  5LMN W;  4UY8 C;  2V1C C;  3KJP A;  4A3L G;  4YCW A;  1V9P A;  3G48 A;  2Z6K C;  4JBK A;  4DPG A;  4JI6 L;  2F4V L;  3HOW G;  3CCV A;  3J81 j;  1IBM Q;  5JEA J;  1HR0 Q;  1HR0 W;  2WP8 J;  2BA0 A;  4GKJ Q;  5ELN A;  3FHW A;  3B6Y A;  3RLN A;  1IZ6 A;  4B3R L;  1V43 A;  1U0L A;  4MNO A;  5C0X J;  3S1Q H;  1C9O A;  5HGQ A;  4A3F H;  1E1T A;  3S1R H;  4GNX A;  2UU9 L;  3G6E A;  4NXN L;  4JOI C;  3U4V A;  1EIF A;  2VQF Q;  1EIY B;  4JI2 Q;  1K73 C;  1X56 A;  4O0A A;  1OXU A;  3CCR A;  4JI3 Q;  1KAW A;  2JA6 H;  1IXR A;  4IO9 A;  1N36 L;  4DR5 Q;  4OX9 Q;  3HOU G;  2UXD Q;  1W3S A;  3PUZ A;  4MZ9 A;  4LNQ A;  4OO1 G;  3UE1 A;  4Y7N H;  1FJG L;  3S16 H;  1PH3 A;  1K0R A;  4BY7 G;  2JA7 G;  1CKM A;  4P72 A;  3L7Z C;  4LFA Q;  1SRU A;  1VQN A;  1AE3 A;  1N32 Q;  4QL5 A;  4X62 Q;  4LF4 L;  3UDI A;  1G6P A;  1CSQ A;  1RIP A;  3KOJ A;  4L5Q A;  2PMZ E;  4IFD G;  1CKN B;  4JI7 L;  4DR4 Q;  2UXB Q;  1VQ5 A;  1I5F A;  1T9H A;  1PH1 A;  4JI4 L;  4B3S L;  4OWT B;  3HKZ E;  4P71 A;  3J80 i;  3CW2 C;  5JEA G;  5IP7 G;  1HZ9 A;  2R7Z H;  1OXV A;  1WCM H;  4A3G G;  4A3I G;  4LF7 L;  3JAM c;  2UXC L;  4ME3 A;  1PFS A;  2UUC L;  4DR7 Q;  1XJV A;  2XTI A;  2ZTE A;  3PGZ A;  2ZTC A;  2GVA A;  4IPH A;  3HOV H;  5M5X H;  3GDE A;  3I56 A;  1I3Q H;  1BBW A;  3STB D;  1SN8 A;  1B70 B;  4YWL A;  4GOP B;  2A1A A;  2NVY H;  4OWW B;  1XNR Q;  2PQA B;  5IY0 A;  3PO3 H;  4OWX B;  1IBL Q;  1VS0 A;  5GAD C;  1P8L A;  1QUQ A;  1SMX A;  2IX0 A;  3IRB A;  2B29 A;  2Z6K A;  3BZC A;  3K0X A;  4AH6 A;  5IYC H;  2HHH Q;  1VQM A;  1Q7Y C;  2NVX H;  3I4N G;  4NXM L;  3HOY H;  1J5E L;  1SR3 A;  2HIX A;  4AYB G;  4AQY Q;  1HNZ L;  4GKK Q;  1VQA A;  4A3J G;  1PVO A;  3A74 A;  3F1Z A;  1PH9 A;  3PF5 A;  2KHJ A;  3W1G A;  1EUJ A;  4K0K Q;  2EQS A;  2IHE A;  3CCM A;  2ZTD A;  4LFC Q;  1UE6 A;  4A3C G;  3UDX A;  2WAQ E;  4LUO A;  1SLJ A;  4QY7 A;  1YHB A;  1D8L A;  2Y0S G;  1UE7 A;  4QGU A;  4DR3 Q;  4AYB E;  4A3J H;  4HIK A;  3NEM A;  1A8V A;  1JB7 A;  3S24 A;  1Z9F A;  3HKS A;  3J81 c;  4JBJ A;  4NPS A;  3JC6 6;  1A0I A;  4GLA C;  4UPA A;  3CC7 A;  4JV5 Q;  4GS3 A;  4LF6 L;  1XMQ Q;  3T1Y Q;  4LF8 L;  2UUA L;  4LFB L;  2KEN A;  2A8V A;  3H0G G;  4R4I A;  1N33 Q;  4JI1 Q;  4PZ8 A;  1E24 A;  5E7N A;  3W5O A;  4C2M H;  2Y0S E;  4YHH L;  5DLQ E;  1FL0 A;  4IJH A;  1Q12 A;  4R4O A;  5BR8 Q;  5IYD H;  4GN4 B;  5M3M G;  1I94 Q;  5C3E H;  1PHJ A;  1ASY A;  4DR1 L;  3GTQ H;  2VUM H;  1GVP A;  4HJ8 A;  1N34 Q;  2E5L L;  3EBE A;  4DV3 L;  1HNX L;  4C3H H;  4GOP C;  1Q82 C;  3CPW A;  2AWN A;  5FLM G;  3M7N A;  2OTJ A;  3CCL A;  1EQR A;  3NEL A;  2OQ0 A;  1X54 A;  4DUZ L;  2KBN A;  1Y1W G;  3E0E A;  1UE1 A;  3HFZ B;  4LF5 L;  2JA9 A;  2F4V Q;  2WB1 G;  4YCV A;  2JQO A;  3NEN A;  1MKH A;  1VQL A;  2JA8 G;  3H15 A;  2L15 A;  2ZJR A;  4HJ7 A;  1UEB A;  4C3I H;  2E8G A;  4O2D A;  1VQK A;  3A5U A;  3I7F A;  4POG A;  4BBS G;  2MQH A;  2QGQ A;  1Q46 A;  1VQP A;  4DK3 C;  1YIJ A;  3MEF A;  3F8T A;  4C3J H;  1Y1W H;  1QZG A;  5AJ3 Q;  4B3T L;  1WOC A;  3S2H H;  1YI2 A;  2XGT A;  4DK6 C;  2UU9 Q;  2WB1 E;  4PG3 A;  3RN2 A;  3ULP A;  1IBK L;  2I0Q A;  2D0O A;  3GTL H;  4EQ5 A;  2JE6 I;  2Q2U A;  3U50 C;  4RG1 A;  3ULJ A;  2I5M X;  2WFW A;  1XMO Q;  1N36 Q;  5LMN Q;  4A93 H;  4JBW A;  3I4M G;  2K5H A;  4ALP A;  4B3M Q;  1I50 H;  1X3F A;  3CCE A;  3CCJ A;  2N3S A;  4GLX A;  1YIT A;  2HIV A;  3J80 c;  1FJG Q;  4A3F G;  1TWH H;  5C44 H;  3K81 C;  4YWM A;  1LTL A;  4OXP A;  1VQD A;  4YY3 Q;  2FXQ A;  3FKI G;  4BXX H;  4DR6 L;  1PYB A;  2JA6 G;  1NTG A;  3KF6 B;  1NY4 A;  5J3B A;  4JI5 L;  3I4M H;  4WJ3 M;  3UDF A;  1C0A A;  2N8N A;  2OWO A;  1CKN A;  1A62 A;  4DAM A;  1PA6 A;  2DUD A;  1VQO A;  1EWI A;  5LMU L;  3FKI H;  4GLV B;  4BY1 H;  2RCN A;  2VZA A;  4RMF A;  2IHF A;  4LF7 Q;  4A3D G;  2UXC Q;  2VW9 A;  3PSI A;  4X66 Q;  4LW1 A;  3KYH C;  1HJP A;  1Q8K A;  4DR2 L;  2VNU D;  4JI0 L;  4DV4 L;  2ES2 A;  4R4C A;  4BBR H;  3H3V H;  2Q2H A;  2B3G A;  1L1O B;  1EYG A;  2JJQ A;  3ERS X;  4GOP A;  4A3D H;  3BZK A;  3GTJ H;  2R7Z G;  4MTN A;  1WCM G;  4UP9 A;  2KCM A;  4DV7 Q;  3TS0 A;  3OTO Q;  2R92 H;  1PH2 A;  1L2F A;  2AHO B;  2IT1 A;  4QJF A;  5IWA L;  4IOC A;  1VQ8 A;  3HOV G;  2YYZ A;  4IPG A;  1YJN A;  2CCZ A;  4TQU S;  5M3F G;  1HNZ Q;  3PO3 G;  1XNQ L;  5GRO A;  4DV1 Q;  1CUK A;  2YTX A;  2DGY A;  4A3E H;  3J7A 5;  2BH2 A;  1NMG A;  2AMC B;  1TXY A;  3M3Y H;  4DUY Q;  1G29 1;  1Y14 B;  4LF9 Q;  5IYC G;  3KJO A;  1X65 A;  1IBM L;  1HZA A;  3HOZ G;  3HOY G;  2R93 H;  5M3F H;  2K5N A;  4DAY B;  4HJ5 A;  4X6A H;  3GO5 A;  1J6Q A;  1VQ9 A;  3RR5 A;  3UE0 A;  3ICE A;  4GKJ L;  3CME A;  2D62 A;  1V1Q A;  3RLF A;  2CWP A;  5GAG C;  4JYA Q;  3PIO A;  3PV0 A;  1HZB A;  3F2D A;  1KQS A;  3S17 H;  1VQ4 A;  3HOZ H;  3EN2 A;  4POF A;  1JMC A;  2UUA Q;  2KHI A;  2LXJ A;  4H02 A;  3GTO H;  3GD7 A;  3H3V I;  2YU9 H;  4XIG S;  1KL9 A;  2VQE L;  2VQF L;  2UUB Q;  4JI2 L;  4JI3 L;  1YJ9 A;  1Q81 C;  1IL2 A;  3K7A H;  1VQB A;  1K9M C;  4OX9 L;  4KHP L;  4JI8 Q;  4DR5 L;  3A5Z B;  1O7I A;  2EXD A;  2LSS A;  3AYH B;  3PCO B;  4IPC A;  1GO3 E;  5GQO A;  1W2B A;  3CMA A;  1VQH A;  1X55 A;  3RZO H;  1H95 A;  4JOI A;  4P74 A;  1XPU A;  2JEB I;  4LFA L;  1HNX Q;  3HOX H;  1GKH A;  1N32 L;  1G51 A;  4PMW A;  1L1O C;  1HZC A;  3W1B A;  1AE2 A;  1SFO H;  2OTL A;  3Q8D A;  3MXN B;  1S72 A;  2JA5 H;  2ZM6 Q;  2NVT H;  2IY5 B;  3CF5 A;  5K36 G;  1PYS B;  3L2P A;  1S40 A;  4DR4 L;  2UXB L;  5IYD G;  2BA1 A;  2NVQ H;  1YVC A;  2AWO A;  2GN5 A;  3AQQ A;  2NN6 G;  1QVF A;  1R9T H;  5C3E G;  5JJK A;  2VUM G;  1MJE A;  5FJ8 H;  4JG2 A;  3I55 A;  3SGI A;  1OXT A;  4DV6 Q;  4HIO A;  1VQI A;  1OXX K;  4TVA B;  1I94 L;  4NB3 A;  4DR7 L;  4BA2 I;  1TWF H;  1JJ2 A;  1FGU A;  3GTK H;  1BVS A;  2OQK A;  4DV4 Q;  3TQY A;  3ER0 A;  4X65 Q;  4A3M H;  4B3T Q;  2RHQ B;  1JT8 A;  2E2J H;  3D0F A;  1JJC B;  1AH9 A;  1E3P A;  1HNW Q;  4KI0 A;  1TWC H;  4DKA C;  2F52 A;  1IBL L;  4L5T A;  1QVG A;  3AEV A;  2A19 A;  1IBK Q;  2B63 H;  4DV5 L;  4A3K H;  4QIW E;  4FDB A;  4APV A;  5GAH C;  1JE5 A;  1WI5 A;  3D31 A;  2R7D A;  4JBM A;  2K50 A;  4JI6 Q;  4GKK L;  4AQY L;  1X3E A;  3CC2 A;  3S15 H;  1K8A C;  3M85 A;  3K80 C;  4J15 A;  2NZO A;  2CKZ B;  3AFQ A;  4DR6 Q;  1YHA A;  1OTC A;  1WFQ A;  4UP8 A;  3CQZ H;  3TRE A;  4K0K L;  1P16 A;  1QZH A;  1KRT A;  2N78 A;  3TEH B;  4B3R Q;  3CP0 A;  3KF6 A;  4LFC L;  3S14 H;  3AFP A;  4A93 G;  1KC8 C;  3F2C A;  1SE8 A;  2JEA I;  4PZ7 A;  2BH8 A;  1EFW A;  1VQE A;  4DR3 L;  3S1N H;  2VS1 A;  5C44 G;  3F2B A;  2NZH A;  4NXN Q;  3PF4 A;  3PUV A;  1BKB A;  4BXX G;  4IOA A;  4LUV A;  4DR2 Q;  3PUY A;  4JI0 Q;  1YZ6 A;  2RF4 A;  3T1Y L;  1M1K C;  1CSP A;  2E2H H;  4DV2 L;  3CD6 A;  1LYL A;  1VQF A;  3A0J A;  1N33 L;  2NN6 I;  4JI1 L;  1L1O A;  1TWA H;  1E1O A;  4BY1 G;  3KDF B;  1LUZ A;  1RL2 A;  4LF4 Q;  5BR8 L;  1BBU A;  4HIM A;  4YCU A;  3CCU A;  4DV0 L;  1HH2 P;  1B8A A;  3FP9 A;  2GVB A;  4P73 A;  4JI7 Q;  3CCS A;  4JI4 Q;  1VQJ A;  4BBR G;  2Z0S A;  3K8A A;  1N34 L;  2YTY A;  4B3S Q;  3STB C;  3VDY A;  4HID A;  2K75 A;  1X6O A;  3NBH B;  4R4T A;  2UUC Q;  5IYB G;  2R92 G;  3TS2 A;  1PH6 A;  2E2I H;  5M5Y H;  3PO2 G;  3GTP H;  5JJL A;  2N49 A;  1JJG A;  1DGS A;  5IP9 G;  4X64 L;  4L5R C;  2EIF A;  1EOV A;  2PQA A;  1XTD A;  3T1H L;  3J7Z C;  1Q1B A;  4A3L H;  5IYB H;  4A3E G;  2PI2 A;  2YTV A;  3CCQ A;  3PO2 H;  5AJ3 L;  3HOW H;  2K4K A;  3K7U C;  3L0O A;  3LGJ A;  3CAM A;  4NXM Q;  1J5E Q;  5IP9 H;  1M90 C;  4IPD A;  2R93 G;  1XPO A;  2VQE Q;  2RHS B;  1X9N A;  1IYJ B;  2LXK A;  4HJA A;  4KHP Q;  5IT9 c;  1YJW A;  1XMO L;  4UP7 A;  4DNI A;  2Q2I A;  4JCV E;  5LMN L;  4L5S A;  4B3M L;  4P75 A;  5C4J H;  1Q1E A;  4JC0 A;  3HKZ G;  5FLX c;  5EAY A;  1KHI A;  4A4I A;  2PI2 E;  1YHQ A;  2D0P A;  3KFU A;  1KXL A;  1WYD A;  3M4P A;  4YY3 L;  1B7Y B;  3M4O H;  2ATW A;  1HR0 L;  1A63 A;  3RN5 A;  3RNU A;  3HOU H;  2HQL A;  1NJI C;  1TWG H;  2ALY B;  3OYY A;  3EIV A;  1NMF A;  4OON A;  4GNX B;  4BY7 H;  4LF6 Q;  4LF8 Q;  2JA7 H;  4LFB Q;  3E9H A;  4R1J A;  1PH4 A;  4YHH Q;  3PIP A;  4X66 L;  3U4Z A;  1MIU A;  1X3G A;  1KRS A;  1YNX A;  3I2Z A;  3ULL A;  3HOX G;  3UDG A;  3U58 A;  5C4X G;  1Z47 A;  4A75 A;  1GD7 A;  2JA5 G;  4A3B G;  2UXD L;  4R4Q A;  3PUW A;  3CXC A;  1N9W A;  5C0X G;  1PH5 A;  2H5X A;  1OXS C;  2ZJQ A;  2MFI A;  4LUZ A;  5IP7 H;  4HJ9 A;  4DR1 Q;  1YBY A;  4A3G H;  1C7Y A;  2E5L Q;  2K52 A;  4DV3 Q;  4A3I H;  4GN5 A;  5IE8 A;  5FJ8 G;  3BJU A;  4DV7 L;  1QVC A;  2YV5 A;  3GTG H;  4X62 L;  3OTO L;  4DV5 Q;  1LM0 A;  5C4X H;  4A3B H;  3KF8 B;  1L0W A;  4DUZ Q;  2KCT A;  1VQC A;  2AKW B;  2WAQ G;  3CPF A;  3DM3 A;  4A3M G;  2Q2T A;  2IX1 A;  3TRZ A;  5JJI A;  4LF5 Q;  2CQO A;  1U5K A;  1S3O A;  4DV1 L;  4KLK A;  2CWA A;  3PUX A;  1K8G A;  4KHZ A;  2B63 G;  4A3K G;  4DUY L;  2ID0 A;  3E9I A;  4LF9 L;  1Y1V G;  3I4N H;  2ASB A;  1CKO A;  1N8R C;  4OO1 I;  1NBW A;  1XNR L;  4QQB X;  1QUQ B;  2I5H A;  4AIM A;  2QEX A;  4JYA L;  3OW2 A;  1K3R A;  5M5W H;  3JAM i;  2F3I A;  2PNH A;  1PH8 A;  1FVI A;  1Y1V H;  4IFD I;  3ZJY C;  2HHH L;  4A3C H;  1PV4 A;  4PZ6 A;  4DV2 Q;  3WWV A;  2HT1 A;  1KD1 C;  4Y52 H;  1GM5 A;  3CC4 A;  1KIX A;  2R6G A;  2UUB L;  2ZJP A;  4GNX C;  4YWK A;  4EX5 A;  2VL6 A;  3KDF A;  4JI8 L;  1WJJ A;  1VQ6 A;  4DV0 Q;  1VQ7 A;  1UWV A;  1SRO A;  4LWC A;  4JI5 Q;  5GAE C;  3DLL A;  2R7F A;  5C0X I;  5HY6 A;  3BU2 A;  3H0G H;  4XTC S;  1Q86 C;  1ASZ A;  1I6H H;  2C35 B;  5LMU Q;  2MO0 A;  5H1S E;  2ZM6 L;  1XPR A;  5M3M H;  3KLW A;  3S2D H;  3S1M H;  4JV5 L;  4BA1 I;  1NE3 A;  1VQG A;  3M9B A;  1XMQ L;  3I4O A;  1E22 A;  2CFM A;  2K5V A;  4X64 Q;  1K83 H;  4DV6 L;  2QA4 A;  3G4S A;  1EQQ A;  1E7Z A;  3RZD H;  2VY3 A;  3T1H Q;  5FLM H;  2MNA A;  1YEZ A;  2JK8 A; 
#chains in the Genus database with same CATH topology
 3RLO A;  1ILP A;  1K83 B;  2AQ1 B;  1O80 A;  3RZD B;  2OCE A;  2B2T C;  4GN3 B;  1S5C D;  2K14 A;  4N8F A;  4IFD J;  1D2B A;  3ND9 A;  4N8X 1;  2L0C A;  4UAI A;  2XRQ D;  2Z6K C;  4DPG A;  3CCV A;  4KY5 A;  5JEA J;  4XQQ A;  2BA0 A;  1XYI A;  1O78 A;  3Q0A A;  4RHR A;  5IGD A;  1JE4 A;  1PMR A;  3S1Q H;  1Q8I A;  1C9O A;  3GP7 A;  5G3L F;  3S1R H;  1F9S A;  3WOE A;  2VQF Q;  1EIY B;  5KYL A;  3S1Q B;  2RA4 A;  1I4P A;  3S1R B;  4O42 A;  1EEF D;  3Q23 A;  4L63 B;  1PH3 A;  2F3V A;  1EL0 A;  3L7Z C;  4FYD A;  1N32 Q;  4X62 Q;  4RA8 A;  1CSQ A;  1RIP A;  3KOJ A;  4HR7 B;  2JN4 A;  2WII B;  3C1E A;  1A15 A;  4KMU C;  1CKN B;  2KUM A;  3NHH A;  1I5F A;  1PH1 A;  3M4O B;  3M7G A;  4RGO S;  4OWT B;  4ZCK A;  4A3G G;  4DK0 A;  1HZ9 A;  4BS9 A;  4A3I G;  5L37 A;  4ME3 A;  1PFS A;  4KKS A;  1TWG B;  2XTI A;  3PGZ A;  2GVA A;  3HOV H;  5DM7 3;  5M5X H;  1CI3 M;  2ASB A;  4YWL A;  2ZT9 C;  4DNR B;  3P7J A;  2K6A A;  3K58 A;  2F0P A;  1EYD A;  3K0X A;  3BZC A;  1Q90 A;  3I4N G;  1Q7Y C;  1C8C A;  5COY A;  1J5E L;  4CGY B;  1IKL A;  1HNZ L;  4A3J G;  1PVO A;  1PH9 A;  3TP5 A;  3Q6S A;  2KHJ A;  4QUC A;  3J7A F;  2EDG A;  2ZTD A;  1QNK A;  3UDX A;  4LUO A;  1D8L A;  2O5I C;  4CDE C;  4JBJ A;  1YNJ D;  4LAA A;  2O4X A;  4UPA A;  2MGS A;  3A8K E;  3T1Y Q;  2KEN A;  5EKK A;  1LO5 D;  1N33 Q;  2WAC A;  3JAM L;  4C2M H;  3MFG A;  4U68 A;  4YHH L;  5DLQ E;  4IJH A;  1MD2 D;  2F0T A;  5K36 H;  4R4O A;  2A74 C;  3NUC A;  4C2M B;  2VUM H;  1N34 Q;  5IIF A;  4DV3 L;  5IGB A;  3ZYY X;  1SJH D;  4C1N I;  3M7N A;  2QCP X;  4M1U B;  4FF3 A;  2OQ0 A;  2VUM B;  2IWH A;  2KBN A;  1I6H B;  3HFZ B;  4IN3 A;  2JA9 A;  4YCV A;  2JQO A;  2A6H C;  2GA4 B;  1VQK A;  1LAB A;  3I7F A;  3S1M B;  4POG A;  3T4A C;  4PMC A;  4BBS G;  3Q22 A;  2MQH A;  2QGQ A;  3S2H H;  2L9H A;  1RKN A;  3MXP A;  5TSS A;  2EE1 A;  3RN2 A;  2I0Q A;  2JE6 I;  2Q2U A;  3S2H B;  1O7Y A;  2WFW A;  2X69 A;  4J6H A;  1EY4 A;  1RJT A;  5LL6 X;  4B3M Q;  1G8Z D;  3CCE A;  3J80 c;  1D1I A;  4A3F G;  1L0Y B;  1TWH H;  5C44 H;  4OGQ C;  4YY3 Q;  4DR6 L;  1PYB A;  1NY4 A;  4JI5 L;  1EY9 A;  1TWH B;  5T1G A;  5C44 B;  2N8N A;  4EVO A;  1EWI A;  2E74 C;  1JQY D;  3FKI H;  4RMF A;  1VF5 C;  2B8G A;  1G91 A;  1I4R A;  1IW7 D;  3FKI B;  2IW3 A;  2Q2H A;  3VR3 A;  3NTH A;  1TY0 A;  2R7Z G;  4MTN A;  4UP9 A;  5JAV A;  1X3P A;  1PH2 A;  3MWY W;  1L2F A;  1SYB A;  5IWA L;  1YJN A;  4DU9 A;  2TSS A;  3PO3 G;  1XNQ L;  2YTX A;  2XWB B;  2EYJ A;  3M3Y H;  1G29 1;  4LF9 Q;  2PYK A;  5IYC G;  1X65 A;  1IBM L;  3AMU A;  2RDF A;  4MTK A;  1K28 A;  5M3F H;  4HJ5 A;  4X6A H;  1KNE A;  2PW5 A;  3M3Y B;  2D62 A;  4JYA Q;  3DHQ A;  1HZB A;  3F2D A;  5M3F B;  3H09 A;  1VQ4 A;  1BDO A;  3EN2 A;  1JMC A;  3T56 B;  1HA5 A;  3GD7 A;  2EJG C;  4XIG S;  2VQE L;  1U4M A;  4ILW A;  2UUB Q;  4JI3 L;  1YJ9 A;  4KHP L;  4DR5 L;  3AU7 A;  1O7I A;  4IPC A;  1SYF A;  5GQO A;  1GO3 E;  3PMF A;  2EYM A;  4HMI A;  5KNC A;  1G51 A;  4PMW A;  2KEC A;  3W1B A;  2IY5 B;  1S72 A;  2ZM6 Q;  1IYV A;  3H6M A;  3L2P A;  3AQQ A;  2NN6 G;  1QVF A;  3H3V C;  1R9T H;  5C3E G;  1ESR A;  5JJK A;  4JVZ A;  2A69 C;  4DR7 L;  1JJ2 A;  1EU4 A;  3WOF A;  2X6L A;  1R9T B;  1DM0 B;  5HGT A;  2RHQ B;  4KHV A;  1JJC B;  1I4Q A;  1TWC H;  4KI0 A;  4DKA C;  4L5T A;  3AEV A;  1IBK Q;  1JOK A;  4QIW E;  4HAE A;  1TWC B;  2R7D A;  2K50 A;  2KA7 A;  4C3J G;  2BE5 D;  1X3E A;  3GV3 A;  2I46 A;  2NZO A;  1LTI D;  1YHA A;  4QMG A;  4UP8 A;  5D65 A;  4K0K L;  1KRT A;  4K6L A;  3TEH B;  1BCP C;  1EY0 A;  1SE8 A;  4PZ7 A;  4M8A A;  4DR3 L;  2VS1 A;  3F2B A;  3N52 A;  4K6D A;  4IOA A;  1VMC A;  2A6E D;  2FHT A;  3PUY A;  3VYT A;  2ICI A;  1M1K C;  3CD6 A;  3QO2 A;  2NN6 I;  3OWF A;  2F03 A;  1TWA H;  4ABN A;  4X3S A;  3A55 A;  4IZ8 A;  4BY1 G;  3C2P A;  1RL2 A;  3LWE A;  5BR8 L;  4HIM A;  4Q0F A;  1GHK A;  5G3L D;  2GVB A;  1SYG A;  1TWA B;  3TBI B;  1SYD A;  1CM9 A;  1STH A;  3HGB A;  1Q3L A;  1HCZ A;  4ZRZ A;  1G2T A;  1LTG D;  4WRD A;  1T5X D;  3Q24 A;  2A68 D;  2KEE A;  5JJL A;  4H13 C;  1PDQ A;  3MXU A;  4A3L H;  5IYB H;  4OL7 A;  1Z6H A;  2PI2 A;  3A8I E;  5CMD A;  5IOC A;  5AJ3 L;  1SNP A;  1J9O A;  1GOZ A;  3CKI B;  3LGJ A;  3IL8 A;  1J5E Q;  1XPO A;  2R92 B;  2RHS B;  4HJA A;  1XMO L;  3HG9 A;  4JCV E;  4DNI A;  3QWN A;  5LMN L;  3HKZ G;  4A4I A;  2PI2 E;  2L1B A;  4DNT B;  3H91 A;  5KYI A;  3RN5 A;  3RNU A;  1TII D;  4IUT A;  1EQV A;  3MXN A;  4FP5 D;  4OO1 H;  2M00 A;  3T13 A;  1NMF A;  4GNX B;  4BY7 H;  1QJO A;  3E9H A;  1ILQ A;  4R1J A;  3VR5 A;  4YHH Q;  3PIP A;  1I94 Q;  2B2W C;  3UDG A;  5C4X G;  1A6X A;  4A75 A;  1GD7 A;  4R4Q A;  1IL8 A;  1TS5 A;  2J4X A;  1MHW C;  5CV8 A;  2ZJQ A;  5IT9 E;  1ZKO A;  4LUZ A;  1L0X B;  1JWU D;  4XQJ A;  2L11 A;  2L55 A;  4DV3 Q;  3BYT B;  5IE8 A;  4X62 L;  5KGU A;  5FLX E;  1LM0 A;  4A3B H;  1A3V A;  4HN7 A;  2AKW B;  3DM3 A;  1QWY A;  1U5K A;  1Z7T A;  4DV1 L;  4A3B B;  2CWA A;  3PUX A;  2B63 G;  1SNM A;  3NE5 B;  1NBW A;  5KEE A;  3EQL C;  1QUQ B;  4PMB A;  2QEX A;  2WAQ B;  1K3R A;  1EFI D;  1PH8 A;  1Y1V H;  4AYB B;  3ZJY C;  2QEJ C;  4L6T B;  3A7A B;  2HT1 A;  4EQN A;  1GM5 A;  1KLG D;  3P1H A;  4A3K B;  1C4Q A;  4EX5 A;  2F0J A;  1Y1V B;  3SEB A;  4JI8 L;  4TKO B;  1UWV A;  4JI5 Q;  2R7F A;  1VDZ A;  3BU2 A;  4XTC S;  1CFM A;  4RGM A;  2C35 B;  2MO0 A;  1U4L A;  3CQZ B;  1XPR A;  2KCC A;  5M3M H;  1TQO A;  3TZD A;  4BA1 I;  3M9B A;  2TMP A;  5CGK A;  2CFM A;  2QA4 A;  5M3M B;  4JPB W;  5E1F A;  3URY A;  4HJ8 A;  2JYO A;  2JK8 A;  4DV4 L;  2F0Q A;  1K8O A;  1LT3 D;  3J81 i;  1EWC A;  3I73 A;  1FGB D;  1MJC A;  5IWA Q;  4A76 A;  5EPJ A;  1RCV D;  1HNW L;  4IJL A;  1XNQ Q;  2R61 A;  4CDD C;  2I5L X;  1VCI A;  5ELO A;  4UY8 C;  3KJP A;  3SK5 A;  1IBM Q;  2M9V A;  1I4X A;  3T16 A;  1JOO A;  2XRS D;  2B2U C;  3HRZ C;  1HR0 Q;  5CYU A;  5ELN A;  1ZXT A;  1M4V A;  2RVL A;  3B6Y A;  3IFD A;  1IZ6 A;  1V43 A;  1HTL D;  2JSO A;  3G6E A;  2KCN A;  3MHB A;  4NW2 A;  4NXN L;  4JI3 Q;  1X56 A;  1KAW A;  4XXE A;  1QCB D;  2OT2 A;  2UXD Q;  4DR5 Q;  3HOW B;  4LNQ A;  4OHJ A;  2PO4 A;  4EGV A;  1K0R A;  2SDF A;  2V4D A;  3LX0 A;  3CU7 A;  1YNN D;  1VQN A;  1F9Q A;  1BUV T;  1G6P A;  4IQZ A;  1EYC A;  4IFD G;  3KF8 A;  4X3T A;  1T9H A;  3TP8 A;  2HDL A;  1BOS A;  4B3S L;  5JEA G;  3DWP A;  1OXV A;  3JAM c;  2UUC L;  4DR7 Q;  2ZXP A;  4JW0 A;  2JA7 B;  3GDE A;  1I3Q H;  3STB D;  1EWH A;  1JCK B;  4DXG A;  1DON A;  1P8L A;  2IX0 A;  3IRB A;  1TR5 A;  4P2C B;  4KK7 A;  5NUC A;  1I3Q B;  2B29 A;  4NXM L;  2DY7 A;  3HOY H;  2KJX A;  1H9R A;  4S3S A;  2VXW A;  3A74 A;  1ET9 A;  1KTK A;  2PZT A;  4G57 A;  5K5P A;  2EYL A;  3T51 B;  1LLR D;  3HOY B;  4K0K Q;  3KUP A;  2EQS A;  2F0F A;  3OOC A;  3CCM A;  4A3C G;  2Y0S G;  4QGU A;  1UE7 A;  4DR3 Q;  1JB7 A;  2F0I A;  1HTP A;  3NEM A;  2F0N A;  2KOL A;  2WIN B;  5DM6 3;  2HUG A;  2JXM B;  4NPS A;  1WD0 A;  5E4W C;  3EVQ A;  4O1N A;  2BDO A;  4LF6 L;  1EY6 A;  3SVM A;  2A8V A;  5CV5 A;  2IJ0 A;  1AFP A;  4DF7 A;  2Y0S E;  3RD4 A;  1ONL A;  4RCN A;  5BR8 Q;  1A2U A;  4KD3 A;  5IYD H;  4GN4 B;  5I2Y A;  2O2L D;  1PHJ A;  1ASY A;  3EBE A;  3VA5 A;  1TY2 A;  4C3H H;  2B2W A;  5DEH A;  1R4Q B;  3NEL A;  4DUZ L;  2FIN B;  2JA8 G;  2WB1 G;  3FVQ A;  4C3H B;  3NEN A;  1MKH A;  3J81 E;  2F0E A;  1ENF A;  1GUT A;  3A56 A;  5JOB A;  2DJG C;  1Q46 A;  1D5X C;  1VQP A;  1YIJ A;  3MEF A;  1QZG A;  1EQT A;  5AJ3 Q;  1IHZ A;  1LV9 A;  2XGT A;  4FNF A;  4LMQ D;  2WB1 E;  4PG3 A;  1PRT F;  5EJW A;  3SK8 A;  1IBK L;  3GTL H;  1IKM A;  4IUP A;  4RG1 A;  3U50 C;  1XMO Q;  1N36 Q;  5LMN Q;  1I50 H;  4GLX A;  2Q8T A;  2K05 A;  1JC7 A;  1FJG Q;  5CV7 A;  3GTL B;  4YWM A;  4OXP A;  1VQD A;  2KQ3 A;  4CHT B;  2FXQ A;  3FKI G;  4L8J A;  4BXX H;  1CA5 A;  3MA2 B;  2JA6 G;  5D14 A;  2Z9H A;  1HXY D;  3KF6 B;  3I4M H;  2MP1 A;  1PTO C;  1KDB A;  3UDF A;  1PA6 A;  1PRT B;  2DUD A;  4ID6 A;  4GLV B;  1EEI D;  2RCN A;  2UXC Q;  4LF7 Q;  3J7A V;  3I4M B;  4LW1 A;  5E4X A;  1Q8K A;  1KLU D;  2KHS A;  2VNU D;  2HCI A;  1JWS D;  3H3V H;  3DUZ A;  1EYG A;  3ERS X;  1DYQ A;  4GOP A;  3GTJ H;  1WD1 A;  1PFN A;  1WCM G;  3TS0 A;  5IGC A;  2BCO A;  5DAU A;  2AHO B;  2IT1 A;  4IOC A;  2YYZ A;  5FKA C;  3GTJ B;  4TQU S;  3VR6 A;  3F2U A;  3EJI A;  5M3F G;  4DV1 Q;  3J7A 5;  1STB A;  4ZYS A;  1TXY A;  2R93 H;  5IGE A;  3GO5 A;  1VQ9 A;  3RR5 A;  3UE0 A;  3CME A;  5GAG C;  4ZKC B;  3PIO A;  3HOV B;  3PV0 A;  5M5X B;  5I2X A;  2R93 B;  3S17 H;  4J8Q A;  3HOZ H;  2HDM A;  2EY1 A;  4POF A;  2UUA Q;  2KHI A;  2B2U A;  4H02 A;  2YU9 H;  1KL9 A;  2EXZ A;  1B2T A;  1IL2 A;  3K7A H;  4OX9 L;  3S17 B;  1BCP B;  4JI8 Q;  3HOZ B;  2EXD A;  3WDN A;  1AEX A;  2D5D A;  1H9S A;  1DOK A;  2YU9 B;  5J22 A;  1X55 A;  2NTS A;  4P74 A;  1R4P B;  4LFA L;  4X3K A;  1SDF A;  1HZC A;  2OTL A;  2JA5 H;  2NVT H;  3D3R A;  1S40 A;  4DR4 L;  2PQE A;  3TZU A;  3MC0 B;  1UEA B;  1S5D D;  1JWM D;  2F0L A;  4LK1 C;  1JB3 A;  1MJE A;  2FFK B;  2JA5 B;  2NVT B;  4HIO A;  1VQI A;  4XYQ A;  1I94 L;  4KN7 C;  4BA2 I;  4RGT A;  3GTK H;  1BVS A;  4DV4 Q;  1Y8N B;  4A3M H;  3D0F A;  3IFT A;  1B50 A;  4G7Z C;  1AH9 A;  1E3P A;  1HNW Q;  1IBL L;  1V1O A;  3GTK B;  3BDL A;  3K57 A;  2SOB A;  4A3M B;  2ICE C;  1F77 A;  1LTS D;  5GAH C;  3PQI A;  1QIL A;  4JBM A;  4I7Z C;  5ELC A;  4AQY L;  1K8A C;  3OIP A;  2K04 A;  2DN8 A;  3K80 C;  3M85 A;  5JVH 3;  1EIH A;  2C9O A;  1OTC A;  1WFQ A;  1I4H A;  4A93 G;  1SMY C;  3S14 H;  4N9T A;  1EY5 A;  2K03 A;  4ZQ3 A;  2JEA I;  3BVZ A;  1IW7 C;  2BH8 A;  5AFW A;  3KLR A;  4QUF A;  2NZH A;  4NXN Q;  2K32 A;  4LUV A;  3S14 B;  4JI0 Q;  1YZ6 A;  1MSG A;  5E3F A;  3W3A A;  1GXD C;  1SNQ A;  1L1O A;  3S9W A;  1I4G A;  3KDF B;  3OWE B;  1B44 D;  2QIL A;  1BBU A;  4R9W A;  1MGS A;  1U4P A;  1ZYR C;  4NP5 A;  4BBR G;  2DNC A;  5F2D A;  1ET6 A;  1MI2 A;  4B3S Q;  1TVX A;  4HID A;  3QB3 A;  2F0K A;  1LT4 D;  4BWG B;  2UUC Q;  5IYB G;  3I72 A;  2R92 G;  1AZP A;  3TP6 A;  4E6I A;  3GTP H;  1U4R A;  4KY7 A;  5ELE A;  3BZD B;  2F0S A;  1DGS A;  4L5R C;  3G6J B;  3KLS A;  4DAY A;  3J7Z C;  5C5L A;  1D5M C;  1Q1B A;  4A3E G;  2YTV A;  2MPM A;  3E0J A;  3PO2 H;  2A6H D;  4CJ0 B;  4NXM Q;  3CAM A;  1M90 C;  1IYJ B;  3PO2 B;  2OXP A;  2Q2I A;  4L5S A;  4QF4 A;  2LY7 A;  1KHI A;  2EJF C;  3M4P A;  1XTC D;  3R93 A;  1HR0 L;  1F2Z A;  1G2S A;  4KJO A;  3OYY A;  4FO2 A;  4LF6 Q;  3BDO A;  5COR A;  2MHV A;  1D6E C;  4XDX A;  1WTR A;  3HOX G;  2FMC A;  3U4Z A;  3I2Z A;  4X66 L;  3U58 A;  1H9K A;  4A3B G;  4V0B A;  5EKL A;  2UXD L;  5ELB A;  3PUW A;  1QOH A;  1PH5 A;  2H5X A;  2G9H D;  1OXS C;  2EYH A;  2MFI A;  4HJ9 A;  4A3G H;  3I91 A;  4A3I H;  3GTG H;  4GN5 A;  3NPP A;  4CBV A;  3BJU A;  1SE4 A;  2YV5 A;  1RTO A;  3QR8 A;  5FJ8 G;  3OTO L;  2J7Z A;  5C0X H;  4DUZ Q;  2KCT A;  1VQC A;  2WAQ G;  3N6R A;  2Q2T A;  3MXG A;  5JJI A;  5A2Q E;  4A3I B;  4FVM A;  3GTG B;  5CV6 A;  1S3O A;  4KLK A;  3I70 A;  1DOM A;  1DZ1 A;  1TT2 A;  4J1M A;  2RCF A;  4A3K G;  4DUY L;  2ID0 A;  3I4N H;  1Y1V G;  1O7Z A;  1S5F D;  5FLX L;  1CKO A;  4IUR A;  3VYS A;  4OO1 I;  1NAP A;  3DXJ C;  1BF4 A;  4CKC A;  2CW0 D;  2I5H A;  4AIM A;  2M2L A;  3I4N B;  3PIP 3;  3OW2 A;  5CBE E;  1FVI A;  1DJR D;  4PZ6 A;  1QNU A;  4Y52 H;  5I9P A;  5I4D A;  1BO0 A;  2NWG A;  3P20 A;  4DV0 Q;  4CJ1 B;  1VQ7 A;  4EQO A;  1XX8 A;  2F1M A;  2Z4I A;  1PZI D;  4QCL A;  3FPU B;  3RUZ A;  1EZ8 A;  1PRT D;  1ASZ A;  4H0L C;  3TP7 A;  2PNR C;  2HCC A;  3HZX A;  2KED A;  5EPK A;  1HFN A;  1NE3 A;  3CHB D;  1SXT A;  2X6G A;  3I4O A;  3D8G A;  4X64 Q;  3G4S A;  1EQQ A;  1E7Z A;  2VY3 A;  3T1H Q;  2XNA C;  1YEZ A;  2MNA A;  3NQI A;  4X65 L;  4U67 3;  4XT3 B;  2A69 D;  1F9P A;  2XN9 C;  1WTQ A;  3MVV A;  1B3A A;  3M4Q A;  3TSS A;  3FMC A;  3GTM H;  3SK4 A;  4WJ4 A;  4ZLT F;  4BBS H;  1LTR D;  5LMN W;  2EY6 A;  2V1C C;  1V9P A;  3G48 A;  4FXD A;  3HOW G;  3J81 j;  3QOJ A;  3GTM B;  1WTX A;  2QF7 A;  1AW7 A;  3FHW A;  1KAB A;  3RLN A;  1WTP A;  1CA6 A;  4MNO A;  3AB9 A;  3U9S A;  4F7X A;  1WTO A;  3ND8 A;  4A3F H;  1SSO A;  3MEH A;  3UI2 A;  2K5Q A;  3U4V A;  2CHB D;  1K73 C;  4O0A A;  1STE A;  3K59 A;  1BCP D;  1N36 L;  2PZU A;  4OX9 Q;  3HOU G;  3BYY B;  3PUZ A;  4MZ9 A;  3T53 B;  3VR2 A;  3UE1 A;  2ZXO A;  1FJG L;  1MBY A;  2RBM A;  1CKM A;  2E76 C;  2JA7 G;  4R8N A;  2XIW A;  4LFA Q;  1AE3 A;  3X3M A;  4LF4 L;  3UDI A;  3L3O C;  2PMZ E;  1G6Z A;  4DR4 Q;  1VQ5 A;  3HKZ E;  3J80 i;  2EOT A;  5IP7 G;  2R7Z H;  2UXC L;  4LF7 L;  1LAC A;  1EY7 A;  5T1I A;  2F0U A;  1NNX A;  2ZTE A;  5KND A;  4V19 0;  4BY7 B;  4IPH A;  5EQ0 A;  3I56 A;  1BBW A;  1SN8 A;  1B70 B;  3PO3 H;  1VF7 A;  2NVY H;  5IY0 A;  2R3Z A;  3K6O A;  1GJX A;  2Z6B A;  4DAP A;  1IBL Q;  4CDF C;  1VS0 A;  5GAD C;  4G7O C;  2WKD A;  3PO3 B;  2NVY B;  4IUV A;  5IYC H;  2NVX H;  1D5Z C;  1SR3 A;  1FNV A;  2HIX A;  4AQY Q;  1A2T A;  5I6W A;  2J0T D;  3F1Z A;  3PF5 A;  2NVX B;  5BN5 A;  1EUJ A;  2IHE A;  4C56 C;  3A54 A;  3NK9 A;  1DOL A;  4RAU C;  1DCZ A;  1A8V A;  1HUM A;  1GUO A;  2NBF A;  3JC6 6;  1PTO H;  1J8I A;  4GLA C;  4JV5 Q;  4GS3 A;  5ELF A;  4HTH A;  2UUA L;  3H0G G;  1E24 A;  3W5O A;  4G7H C;  2K5W A;  3SXH A;  4C3H G;  1FL0 A;  1PTO B;  4OEL B;  2O5J C;  4I65 A;  4IUN A;  1XXG A;  5C3E H;  4DR1 L;  3GTQ H;  5JPN C;  5EPL A;  2E5L L;  4GOP C;  1Q82 C;  5FLM G;  5CV9 A;  1UUP A;  5C3E B;  3NSW A;  1EQR A;  3GTQ B;  3NBH A;  1X54 A;  1K0S A;  1TS3 A;  1UE1 A;  2F4V Q;  4QIW B;  4LF5 L;  1H9M A;  1LTA D;  2L15 A;  1NUC A;  4C3I H;  1AN8 A;  2E8G A;  4O2D A;  3KLS X;  3MTS A;  3V05 A;  3LWU A;  3OHX C;  4DK3 C;  3RMH A;  1CQV A;  4C3J H;  1Y1W H;  3P75 A;  3KBX A;  1WOC A;  2F0G A;  2WKC A;  1YI2 A;  3NBI A;  4C3I B;  2N55 A;  4DK6 C;  2UU9 Q;  3V2T A;  2EJM A;  4HCE A;  1TKW B;  3J81 L;  1Y1W B;  4C3J B;  3I4M G;  2K5H A;  1X3F A;  1YIT A;  2N3S A;  2QKI C;  2HIV A;  4MN3 A;  1E2V A;  3K81 C;  1LTL A;  4KV6 A;  1ESF A;  1NTG A;  5J3B A;  4WJ3 M;  1C0A A;  2OWO A;  1CKN A;  5EBC A;  4DAM A;  4K5V A;  1K3B C;  4IUU A;  4KD4 A;  1VQO A;  2XVS A;  1HRJ A;  1CK1 A;  4BY1 H;  2VZA A;  2VW9 A;  4X66 Q;  5C3W A;  2PZW A;  2H4O A;  3KYH C;  2RQX A;  3MZ5 A;  1HJP A;  1QB5 D;  4JI0 L;  5FOB B;  2ES2 A;  3OIQ A;  5HUR A;  4R4C A;  4KTA A;  4OEM B;  4BY1 B;  3MAQ A;  1SNO A;  4A3D H;  4ZUJ A;  3VA7 A;  1GUS A;  3OTO Q;  3J80 E;  2B2V A;  4H44 C;  3K5O A;  4QJF A;  1VQ8 A;  3OW7 A;  4TRD A;  3HOV G;  4A3D B;  2CCZ A;  4NKL A;  3W2D A;  1CUK A;  1JIC A;  4HCS A;  1BXT A;  4DUY Q;  1AP0 A;  1HFG A;  3HOZ G;  2K5N A;  3ICE A;  4GKJ L;  3BDC A;  1K8M A;  1V1Q A;  2Z8L A;  3RLF A;  2P5Z X;  4KN4 C;  2F0M A;  2AUK A;  1KQS A;  4HSP A;  1C48 A;  1PZJ D;  3GTO H;  3H3V I;  2BOS A;  2RDG A;  4JI2 L;  3QOL A;  3HKZ B;  3OMC A;  3A5Z B;  3PCO B;  3AYH B;  2L5T A;  3NXW A;  1VQH A;  3RZO H;  1H95 A;  1HNX Q;  1L1O C;  4Q5V A;  3MXN B;  5K36 G;  1PYS B;  2UXB L;  1B9M A;  1QG7 A;  3RZO B;  1YVC A;  2AWO A;  3J7Y W;  3C1F A;  1RTN A;  2XSC A;  2VUM G;  5CV4 A;  4JG2 A;  3I55 A;  3SGI A;  4TVA B;  1FGU A;  4PV1 C;  2OQK A;  3PIO 3;  3TQY A;  4X65 Q;  2CVR A;  4B3T Q;  2E2J H;  1SE2 A;  3ONA B;  1STG A;  2F52 A;  3DMU A;  5BN3 A;  1QVG A;  2B63 H;  1UNS A;  2E2J B;  4FDB A;  4APV A;  4MHE A;  4GKK L;  2EZV A;  1CZW A;  3CC2 A;  3S15 H;  3HP3 A;  2MJ8 A;  2CH4 W;  2CKZ B;  2E75 C;  2F0W A;  5FK9 C;  3TRE A;  1HUN A;  2G9D A;  3SK6 A;  2D9U A;  3CP0 A;  1EIG A;  4LFC L;  3S15 B;  3F2C A;  1EFW A;  3D6W A;  3SR1 A;  3S1N H;  1CT1 D;  5C44 G;  2HD3 A;  4FF2 A;  4XYO A;  1F2Y A;  3PUV A;  3X3N A;  1XWE A;  4HMJ A;  3OMG A;  4DR2 Q;  2RF4 A;  3S1N B;  1KNA A;  1CSP A;  1F9R A;  5JVG 3;  1LYL A;  3A0J A;  4JI1 L;  3QG1 A;  4Z9C B;  4LF4 Q;  1I50 B;  4YCU A;  4DV0 L;  1B8A A;  3FP9 A;  4P73 A;  1IYU A;  1VQJ A;  2Z0S A;  3K8A A;  5C4Z A;  2B39 A;  1RD9 D;  3VDY A;  3I90 A;  1H9J A;  2NUC A;  1X6O A;  1E2W A;  3NBH B;  4R4T A;  1PH6 A;  3DM1 A;  5C3X A;  3PO2 G;  2NZ1 D;  5KNB A;  2A5H A;  4X64 L;  2EIF A;  2PQA A;  1XTD A;  4B08 A;  3T1H L;  2DJF C;  3CCQ A;  1ML0 D;  4DA2 A;  3K7U C;  2EY2 A;  3L0O A;  1CZG A;  4RWS C;  5IP9 H;  5JPM C;  1NR2 A;  3EA6 A;  4KKT A;  3OSO A;  4UDU C;  1X9N A;  5IT9 c;  1YJW A;  3NWS A;  4P75 A;  1Q1E A;  4JC0 A;  1GUW A;  1YNJ C;  1BCP F;  5FLX c;  1Y69 U;  3KFU A;  1WYD A;  1F2M A;  3M4O H;  1LT5 D;  3CRL C;  2HQL A;  4ZK9 B;  1TWG H;  3VYU A;  3DWA A;  5EGT A;  1WTW A;  3EIV A;  2D2C C;  1CQF A;  3D4W A;  4NDX A;  1PH4 A;  3GV6 A;  1MIU A;  1X3G A;  1KRS A;  1LTB D;  1PTO D;  3ULL A;  4IFD H;  3BS1 A;  4F87 A;  3IAY A;  1N9W A;  5C0X G;  2NYZ D;  1V8Q A;  4DR1 Q;  1RDP D;  4XT1 B;  5JEA H;  1YBY A;  3HS0 C;  4NMZ A;  1C7Y A;  2K52 A;  2Z1C A;  3K7A B;  2E5L Q;  3R3O A;  4DV7 L;  1B1Z A;  1QVC A;  3ERO A;  4DV5 Q;  3KF8 B;  1EY8 A;  3CPF A;  4CKB A;  3TRZ A;  1KDC A;  2H1E A;  4LF5 Q;  2CQO A;  2QW7 A;  1LTT D;  1K8G A;  1DD2 A;  4K14 A;  4RHS A;  2LKV A;  3L9A X;  3NWT A;  1STN A;  2NB0 A;  1EYA A;  4QQB X;  5A2Q L;  3DWQ A;  3VR4 A;  1EU3 A;  2Z4H A;  2F3I A;  3JAM i;  1B3Q A;  1B53 A;  4A3C H;  3NTK A;  4DV2 Q;  3WWV A;  3E3X A;  1ENC A;  1KIX A;  1TU2 B;  2ZJP A;  4WOR A;  4CJ2 C;  4YWK A;  2EYO A;  1E2Z A;  2JP1 A;  1SJE D;  2WV6 D;  2Y0S B;  2IX3 A;  5GAE C;  5C0X I;  5HY6 A;  2K01 A;  3NQT A;  1I6H H;  2KVM A;  2SNM A;  5H1S E;  1PFB A;  4UHV A;  1PFM A;  2CH4 A;  2QDB A;  2EYF A;  3FDT A;  3KLW A;  3S1M H;  3S2D H;  4JV5 L;  4RCO A;  1VQG A;  1E22 A;  2K5V A;  2HQE A;  4DV6 L;  1QE6 A;  3S2D B;  2NTT A;  3CCR A;  3CXC A;  1UE5 A;  2N88 A;  2JA8 H;  1PZK D;  1D7Q A;  4N9P A;  5EBD A;  3G71 A;  1PXU A;  4FXK C;  2RSO A;  2MO1 A;  3QJY A;  1PH7 A;  2JA8 B;  2WB1 B;  4A3L G;  4K5X A;  2L12 A;  4YCW A;  1PLF A;  4JBK A;  1SAP A;  4KJN A;  4JI6 L;  2F4V L;  3TN2 A;  1EOT A;  1GUG A;  1HR0 W;  2WP8 J;  4GKJ Q;  2EY5 A;  1X32 A;  3GTP B;  1FNW A;  1ICW A;  1KAA A;  3K5N A;  4B3R L;  1U0L A;  5C0X J;  1GHJ A;  5HGQ A;  1E1T A;  1STA A;  2PPB C;  3O13 A;  4GNX A;  2UU9 L;  2IL8 A;  4JOI C;  2VB3 X;  1EIF A;  4JI2 Q;  1OXU A;  2LS0 1;  2JA6 H;  1SMY D;  2E2D C;  1IXR A;  2IPK D;  4IO9 A;  1W3S A;  3I8Z A;  2K1B A;  4RH6 A;  4OO1 G;  4Y7N H;  3S16 H;  1HQR D;  2G5D A;  4K2K A;  4BY7 G;  2JA6 B;  3KBG A;  4P72 A;  1SRU A;  4QL5 A;  4L5Q A;  2K5D A;  4Y7N B;  2RSN A;  3S16 B;  4YIJ A;  4JI7 L;  2UXB Q;  4JI4 L;  4P71 A;  3CW2 C;  1WCM H;  2CW0 C;  1XJV A;  1ZYR D;  4G4K A;  2ZTC A;  4R8I A;  1WCM B;  1XNR Q;  4GOP B;  1BQQ T;  2A1A A;  2B2T A;  4OWW B;  2PQA B;  4DN4 M;  4OWX B;  2BE5 C;  1QUQ A;  1SMX A;  2Z6K A;  4AH6 A;  2HHH Q;  1VQM A;  1DXM A;  4A3G B;  1HHV A;  1O7L A;  4AYB G;  1NSN S;  4GKK Q;  1VQA A;  2Q8R E;  1PRT C;  3CRK C;  1HQM C;  4OIJ A;  5IT9 L;  3W1G A;  1ZEQ X;  2A6E C;  3JAM E;  1ENA A;  1UE6 A;  4LFC Q;  2WAQ E;  4K2L A;  1RHP A;  1SLJ A;  4QY7 A;  1YHB A;  1I6V C;  2VB2 X;  4A3J H;  1NJI C;  4C1N K;  4AYB E;  4HIK A;  3S24 A;  1Z9F A;  3HKS A;  3J81 c;  4ULL A;  2B2Y C;  1A0I A;  3CC7 A;  4RKL A;  4A3J B;  1XMQ Q;  4LF8 L;  3EFX D;  3MFY A;  5EKI A;  4LFB L;  1LT6 D;  1TS2 A;  3IKJ A;  4R4I A;  4JI1 Q;  4PZ8 A;  5E7N A;  3D4D A;  1FR3 A;  1KDA A;  2SNS A;  1Q12 A;  1PYW D;  3NP8 A;  1H9S B;  5M3M G;  1S5E D;  2A68 C;  1GVP A;  4H7B A;  5I9O A;  1HNX L;  4C3I G;  5ISR A;  3CPW A;  2AWN A;  3C46 A;  2OTJ A;  1SNC A;  3CCL A;  2B2V C;  1Y1W G;  3E0E A;  4EQP A;  1VQL A;  3H15 A;  2ZJR A;  4HJ7 A;  1UEB A;  2FJ2 A;  5A35 A;  3A5U A;  1SND A;  1U9R A;  4B3T L;  3F8T A;  4CDC C;  3SDZ A;  4LJZ C;  3ULP A;  2C5C A;  2D0O A;  3D6C A;  4EQ5 A;  1WTV A;  3ULJ A;  2F0V A;  2I5M X;  5LL6 S;  4A93 H;  4JBW A;  3OPO A;  4ALP A;  1CHQ D;  3CCJ A;  3SHL A;  4BBS B;  4IUQ A;  4A93 B;  4JK1 C;  4TSS A;  1S5B D;  4QB4 A;  1A62 A;  5ELD A;  2LFN A;  5D3D A;  5LMU L;  4A3D G;  2IHF A;  3PSI A;  2ENB A;  4DR2 L;  4A3F B;  2AUJ D;  3KK7 A;  5J1Z A;  4BBR H;  2B3G A;  1L1O B;  2JJQ A;  3DEP A;  3BZK A;  1T5E A;  1Y8P B;  4DV7 Q;  2KCM A;  3NTI A;  1BR9 A;  2R92 H;  4BBR B;  1V1P A;  4IPG A;  5CBA E;  1HNZ Q;  5GRO A;  2K33 A;  2DGY A;  1E0B A;  1EZ6 A;  4A3E H;  2BH2 A;  1NMG A;  4B9W A;  2AMC B;  1A3U A;  1GUN A;  1JOQ A;  1Y14 B;  3J80 L;  4DFA A;  3KJO A;  1HZA A;  2R7Z B;  3HOY G;  4DAY B;  4A3E B;  2I07 B;  3BVG A;  1J6Q A;  5C5M A;  4DGZ A;  1BBX C;  4ZAI A;  2CWP A;  4WFN 3;  2F0H A;  1SEB D;  2PCF B;  2LXJ A;  2OEO A;  1NCV A;  2VQF L;  1Q81 C;  1VQB A;  1K9M C;  4GZY C;  1STY A;  2CQA A;  1HA6 A;  2LSS A;  4CKE A;  3K5L A;  3C3L A;  1W2B A;  1PTO F;  2FMM A;  3BG3 A;  3CMA A;  1RF2 D;  4JOI A;  1XPU A;  2JEB I;  1N32 L;  3HOX H;  1GKH A;  4RKB A;  3M4Y A;  1AE2 A;  1SFO H;  2F0O A;  3Q8D A;  3CF5 A;  4F88 A;  1S4Z A;  2ZXR A;  3E5S A;  2BA1 A;  5IYD G;  2GN5 A;  2NVQ H;  2K7V A;  1OO9 B;  3HOX B;  1MSH A;  1W6J A;  1SFO B;  5FJ8 H;  4DV6 Q;  1OXT A;  1OXX K;  4NB3 A;  1TWF H;  2NVQ B;  2B8F A;  4XQN A;  2A73 B;  5C4H A;  3ER0 A;  1JT8 A;  3D4R A;  1AZQ A;  2NN6 H;  2BDN A;  5FO7 B;  4K8J A;  5KIX A;  1TWF B;  4ZUI A;  2A19 A;  4DV5 L;  4A3K H;  4FF4 A;  2DNE A;  1JE5 A;  1WI5 A;  3D31 A;  4JI6 Q;  1JOR A;  1D1K A;  4B9X A;  3U9O A;  4J15 A;  5D3I B;  3AFQ A;  1B4O A;  4DR6 Q;  2RDH A;  2RKS A;  3R8B A;  3CQZ H;  1P16 A;  1QZH A;  2N78 A;  4B3R Q;  3KF6 A;  3AFP A;  1KC8 C;  5IGF A;  4PQX A;  4HED A;  1VQE A;  3PF4 A;  1Y8O B;  1BKB A;  2PW7 A;  4BXX G;  1YNN C;  3R2I A;  4K8I A;  5CR3 A;  3TDQ A;  4WJW A;  3SE0 A;  2DY8 A;  3LNN A;  5I6Y A;  3T1Y L;  3A8J E;  2E2H H;  4DV2 L;  1VQF A;  1N33 L;  1CTM A;  1F2L A;  1E1O A;  3R2T A;  1LUZ A;  1WVL A;  3E6Z X;  2B2Y A;  3CCU A;  2E2H B;  1HH2 P;  1SBB B;  2K28 A;  4JI7 Q;  4K5W A;  3CCS A;  4JI4 Q;  1N34 L;  1WTH A;  2YTY A;  4ME5 A;  4ODG A;  3STB C;  4X3U A;  2K75 A;  4FF1 A;  4F8M A;  1VMP A;  3TS2 A;  2E2I H;  5M5Y H;  4RGN A;  1W6K A;  2N49 A;  1JJG A;  5IP9 G;  1SYE A;  1EOV A;  2E2I B;  5M5Y B;  3GQB A;  3HOW H;  2K4K A;  2AQ3 B;  4IPD A;  2R93 G;  2VQE Q;  2LXK A;  4KY6 A;  4KHP Q;  1SYC A;  2F4I A;  4UP7 A;  5FO9 B;  4B3M L;  1X3Q A;  5C4J H;  5EAY A;  1YHQ A;  2D0P A;  1KXL A;  4YY3 L;  1B7Y B;  1BNZ A;  2ATW A;  1CHP D;  2L4N A;  4HSV A;  3DEO A;  3HEJ A;  5C4J B;  1A63 A;  1SE3 A;  2Q8I B;  3HOU H;  3I4L A;  5FO8 B;  2ALY B;  3A7L A;  1JR0 D;  4DAV A;  4OON A;  4LF8 Q;  2PMZ B;  2JA7 H;  4LFB Q;  5J39 A;  2SEB D;  3HOU B;  1YNX A;  1Z47 A;  5C6A A;  2JA5 G;  2OF1 A;  5M9O A;  3V96 A;  2XWJ B;  3GTO B;  3VYR A;  3K0Y A;  5IP7 H;  1UAP A;  4PNY A;  1A3T A;  5BN4 A;  5C4X H;  3FEW X;  5IOD A;  1V1P B;  1TS4 A;  4I7A A;  1L0W A;  2IX1 A;  1NR4 A;  4A3M G;  2EVB A;  3I3C A;  1ROD A;  2QDL A;  5KRU A;  5C4X B;  1ICF B;  3BVM A;  4KHZ A;  4MIU A;  3ERQ A;  4DK1 A;  3E9I A;  4LF9 L;  4FXG C;  1N8R C;  1FD7 D;  1XNR L;  5LHY 1;  2AQ2 B;  1HPC A;  3ITP A;  4JYA L;  5M5W H;  2PNH A;  2MUY A;  3QIA A;  3K5M A;  5IGG A;  4IFD I;  2HHH L;  3G7L A;  3FRP B;  1PV4 A;  5JJZ A;  2F0D A;  4RFB A;  1KD1 C;  3CC4 A;  4KKU A;  2B63 B;  4ZKB B;  2R6G A;  2EPB A;  5M5W B;  3FPP A;  2UUB L;  4GNX C;  3TME A;  1M8A A;  1FYC A;  2VL6 A;  3KDF A;  1WJJ A;  1VQ6 A;  2F3W A;  4LWC A;  1SRO A;  3DLL A;  4DXF A;  5DNF A;  1Q86 C;  3H0G H;  5CC4 A;  4OIK A;  5LMU Q;  2ZM6 L;  1B9N A;  4IAL A;  1FNU A;  3H94 A;  3H0G B;  2LMC B;  1XMQ L;  1II3 A;  1K83 H;  2EYP A;  3RZD H;  5FLM H; 
#chains in the Genus database with same CATH homology
 3RLO A;  4X65 L;  3J81 i;  1UE5 A;  1MJC A;  5IWA Q;  4A76 A;  2JA8 H;  1D7Q A;  1HNW L;  2OCE A;  4IJL A;  3G71 A;  3M4Q A;  1XNQ Q;  4GN3 B;  2I5L X;  3GTM H;  1VCI A;  4WJ4 A;  2K14 A;  5ELO A;  4BBS H;  2MO1 A;  1PH7 A;  4IFD J;  5LMN W;  4UY8 C;  2V1C C;  3KJP A;  4A3L G;  4YCW A;  1V9P A;  3G48 A;  2Z6K C;  4JBK A;  4DPG A;  4JI6 L;  2F4V L;  3HOW G;  3CCV A;  3J81 j;  1IBM Q;  5JEA J;  1HR0 Q;  1HR0 W;  2WP8 J;  2BA0 A;  4GKJ Q;  5ELN A;  3FHW A;  3B6Y A;  3RLN A;  1IZ6 A;  4B3R L;  1V43 A;  1U0L A;  4MNO A;  5C0X J;  3S1Q H;  1C9O A;  5HGQ A;  4A3F H;  1E1T A;  3S1R H;  4GNX A;  2UU9 L;  3G6E A;  4NXN L;  4JOI C;  3U4V A;  1EIF A;  2VQF Q;  1EIY B;  4JI2 Q;  1K73 C;  1X56 A;  4O0A A;  1OXU A;  3CCR A;  4JI3 Q;  1KAW A;  2JA6 H;  1IXR A;  4IO9 A;  1N36 L;  4DR5 Q;  4OX9 Q;  3HOU G;  2UXD Q;  1W3S A;  3PUZ A;  4MZ9 A;  4LNQ A;  4OO1 G;  3UE1 A;  4Y7N H;  1FJG L;  3S16 H;  1PH3 A;  1K0R A;  4BY7 G;  2JA7 G;  1CKM A;  4P72 A;  3L7Z C;  4LFA Q;  1SRU A;  1VQN A;  1AE3 A;  1N32 Q;  4QL5 A;  4X62 Q;  4LF4 L;  3UDI A;  1G6P A;  1CSQ A;  1RIP A;  3KOJ A;  4L5Q A;  2PMZ E;  4IFD G;  1CKN B;  4JI7 L;  4DR4 Q;  2UXB Q;  1VQ5 A;  1I5F A;  1T9H A;  1PH1 A;  4JI4 L;  4B3S L;  4OWT B;  3HKZ E;  4P71 A;  3J80 i;  3CW2 C;  5JEA G;  5IP7 G;  1HZ9 A;  2R7Z H;  1OXV A;  1WCM H;  4A3G G;  4A3I G;  4LF7 L;  3JAM c;  2UXC L;  4ME3 A;  1PFS A;  2UUC L;  4DR7 Q;  1XJV A;  2XTI A;  2ZTE A;  3PGZ A;  2ZTC A;  2GVA A;  4IPH A;  3HOV H;  5M5X H;  3GDE A;  3I56 A;  1I3Q H;  1BBW A;  3STB D;  1SN8 A;  1B70 B;  4YWL A;  4GOP B;  2A1A A;  2NVY H;  4OWW B;  1XNR Q;  2PQA B;  5IY0 A;  3PO3 H;  4OWX B;  1IBL Q;  1VS0 A;  5GAD C;  1P8L A;  1QUQ A;  1SMX A;  2IX0 A;  3IRB A;  2B29 A;  2Z6K A;  3BZC A;  3K0X A;  4AH6 A;  5IYC H;  2HHH Q;  1VQM A;  1Q7Y C;  2NVX H;  3I4N G;  4NXM L;  3HOY H;  1J5E L;  1SR3 A;  2HIX A;  4AYB G;  4AQY Q;  1HNZ L;  4GKK Q;  1VQA A;  4A3J G;  1PVO A;  3A74 A;  3F1Z A;  1PH9 A;  3PF5 A;  2KHJ A;  3W1G A;  1EUJ A;  4K0K Q;  2EQS A;  2IHE A;  3CCM A;  2ZTD A;  4LFC Q;  1UE6 A;  4A3C G;  3UDX A;  2WAQ E;  4LUO A;  1SLJ A;  4QY7 A;  1YHB A;  1D8L A;  2Y0S G;  1UE7 A;  4QGU A;  4DR3 Q;  4AYB E;  4A3J H;  4HIK A;  3NEM A;  1A8V A;  1JB7 A;  3S24 A;  1Z9F A;  3HKS A;  3J81 c;  4JBJ A;  4NPS A;  3JC6 6;  1A0I A;  4GLA C;  4UPA A;  3CC7 A;  4JV5 Q;  4GS3 A;  4LF6 L;  1XMQ Q;  3T1Y Q;  4LF8 L;  2UUA L;  4LFB L;  2KEN A;  2A8V A;  3H0G G;  4R4I A;  1N33 Q;  4JI1 Q;  4PZ8 A;  1E24 A;  5E7N A;  3W5O A;  4C2M H;  2Y0S E;  4YHH L;  5DLQ E;  1FL0 A;  4IJH A;  1Q12 A;  4R4O A;  5BR8 Q;  5IYD H;  4GN4 B;  5M3M G;  1I94 Q;  5C3E H;  1PHJ A;  1ASY A;  4DR1 L;  3GTQ H;  2VUM H;  1GVP A;  4HJ8 A;  1N34 Q;  2E5L L;  3EBE A;  4DV3 L;  1HNX L;  4C3H H;  4GOP C;  1Q82 C;  3CPW A;  2AWN A;  5FLM G;  3M7N A;  2OTJ A;  3CCL A;  1EQR A;  3NEL A;  2OQ0 A;  1X54 A;  4DUZ L;  2KBN A;  1Y1W G;  3E0E A;  1UE1 A;  3HFZ B;  4LF5 L;  2JA9 A;  2F4V Q;  2WB1 G;  4YCV A;  2JQO A;  3NEN A;  1MKH A;  1VQL A;  2JA8 G;  3H15 A;  2L15 A;  2ZJR A;  4HJ7 A;  1UEB A;  4C3I H;  2E8G A;  4O2D A;  1VQK A;  3A5U A;  3I7F A;  4POG A;  4BBS G;  2MQH A;  2QGQ A;  1Q46 A;  1VQP A;  4DK3 C;  1YIJ A;  3MEF A;  3F8T A;  4C3J H;  1Y1W H;  1QZG A;  5AJ3 Q;  4B3T L;  1WOC A;  3S2H H;  1YI2 A;  2XGT A;  4DK6 C;  2UU9 Q;  2WB1 E;  4PG3 A;  3RN2 A;  3ULP A;  1IBK L;  2I0Q A;  2D0O A;  3GTL H;  4EQ5 A;  2JE6 I;  2Q2U A;  3U50 C;  4RG1 A;  3ULJ A;  2I5M X;  2WFW A;  1XMO Q;  1N36 Q;  5LMN Q;  4A93 H;  4JBW A;  3I4M G;  2K5H A;  4ALP A;  4B3M Q;  1I50 H;  1X3F A;  3CCE A;  3CCJ A;  2N3S A;  4GLX A;  1YIT A;  2HIV A;  3J80 c;  1FJG Q;  4A3F G;  1TWH H;  5C44 H;  3K81 C;  4YWM A;  1LTL A;  4OXP A;  1VQD A;  4YY3 Q;  2FXQ A;  3FKI G;  4BXX H;  4DR6 L;  1PYB A;  2JA6 G;  1NTG A;  3KF6 B;  1NY4 A;  5J3B A;  4JI5 L;  3I4M H;  4WJ3 M;  3UDF A;  1C0A A;  2N8N A;  2OWO A;  1CKN A;  1A62 A;  4DAM A;  1PA6 A;  2DUD A;  1VQO A;  1EWI A;  5LMU L;  3FKI H;  4GLV B;  4BY1 H;  2RCN A;  2VZA A;  4RMF A;  2IHF A;  4LF7 Q;  4A3D G;  2UXC Q;  2VW9 A;  3PSI A;  4X66 Q;  4LW1 A;  3KYH C;  1HJP A;  1Q8K A;  4DR2 L;  2VNU D;  4JI0 L;  4DV4 L;  2ES2 A;  4R4C A;  4BBR H;  3H3V H;  2Q2H A;  2B3G A;  1L1O B;  1EYG A;  2JJQ A;  3ERS X;  4GOP A;  4A3D H;  3BZK A;  3GTJ H;  2R7Z G;  4MTN A;  1WCM G;  4UP9 A;  2KCM A;  4DV7 Q;  3TS0 A;  3OTO Q;  2R92 H;  1PH2 A;  1L2F A;  2AHO B;  2IT1 A;  4QJF A;  5IWA L;  4IOC A;  1VQ8 A;  3HOV G;  2YYZ A;  4IPG A;  1YJN A;  2CCZ A;  4TQU S;  5M3F G;  1HNZ Q;  3PO3 G;  1XNQ L;  5GRO A;  4DV1 Q;  1CUK A;  2YTX A;  2DGY A;  4A3E H;  3J7A 5;  2BH2 A;  1NMG A;  2AMC B;  1TXY A;  3M3Y H;  4DUY Q;  1G29 1;  1Y14 B;  4LF9 Q;  5IYC G;  3KJO A;  1X65 A;  1IBM L;  1HZA A;  3HOZ G;  3HOY G;  2R93 H;  5M3F H;  2K5N A;  4DAY B;  4HJ5 A;  4X6A H;  3GO5 A;  1J6Q A;  1VQ9 A;  3RR5 A;  3UE0 A;  3ICE A;  4GKJ L;  3CME A;  2D62 A;  1V1Q A;  3RLF A;  2CWP A;  5GAG C;  4JYA Q;  3PIO A;  3PV0 A;  1HZB A;  3F2D A;  1KQS A;  3S17 H;  1VQ4 A;  3HOZ H;  3EN2 A;  4POF A;  1JMC A;  2UUA Q;  2KHI A;  2LXJ A;  4H02 A;  3GTO H;  3GD7 A;  3H3V I;  2YU9 H;  4XIG S;  1KL9 A;  2VQE L;  2VQF L;  2UUB Q;  4JI2 L;  4JI3 L;  1YJ9 A;  1Q81 C;  1IL2 A;  3K7A H;  1VQB A;  1K9M C;  4OX9 L;  4KHP L;  4JI8 Q;  4DR5 L;  3A5Z B;  1O7I A;  2EXD A;  2LSS A;  3AYH B;  3PCO B;  4IPC A;  1GO3 E;  5GQO A;  1W2B A;  3CMA A;  1VQH A;  1X55 A;  3RZO H;  1H95 A;  4JOI A;  4P74 A;  1XPU A;  2JEB I;  4LFA L;  1HNX Q;  3HOX H;  1GKH A;  1N32 L;  1G51 A;  4PMW A;  1L1O C;  1HZC A;  3W1B A;  1AE2 A;  1SFO H;  2OTL A;  3Q8D A;  3MXN B;  1S72 A;  2JA5 H;  2ZM6 Q;  2NVT H;  2IY5 B;  3CF5 A;  5K36 G;  1PYS B;  3L2P A;  1S40 A;  4DR4 L;  2UXB L;  5IYD G;  2BA1 A;  2NVQ H;  1YVC A;  2AWO A;  2GN5 A;  3AQQ A;  2NN6 G;  1QVF A;  1R9T H;  5C3E G;  5JJK A;  2VUM G;  1MJE A;  5FJ8 H;  4JG2 A;  3I55 A;  3SGI A;  1OXT A;  4DV6 Q;  4HIO A;  1VQI A;  1OXX K;  4TVA B;  1I94 L;  4NB3 A;  4DR7 L;  4BA2 I;  1TWF H;  1JJ2 A;  1FGU A;  3GTK H;  1BVS A;  2OQK A;  4DV4 Q;  3TQY A;  3ER0 A;  4X65 Q;  4A3M H;  4B3T Q;  2RHQ B;  1JT8 A;  2E2J H;  3D0F A;  1JJC B;  1AH9 A;  1E3P A;  1HNW Q;  4KI0 A;  1TWC H;  4DKA C;  2F52 A;  1IBL L;  4L5T A;  1QVG A;  3AEV A;  2A19 A;  1IBK Q;  2B63 H;  4DV5 L;  4A3K H;  4QIW E;  4FDB A;  4APV A;  5GAH C;  1JE5 A;  1WI5 A;  3D31 A;  2R7D A;  4JBM A;  2K50 A;  4JI6 Q;  4GKK L;  4AQY L;  1X3E A;  3CC2 A;  3S15 H;  1K8A C;  3M85 A;  3K80 C;  4J15 A;  2NZO A;  2CKZ B;  3AFQ A;  4DR6 Q;  1YHA A;  1OTC A;  1WFQ A;  4UP8 A;  3CQZ H;  3TRE A;  4K0K L;  1P16 A;  1QZH A;  1KRT A;  2N78 A;  3TEH B;  4B3R Q;  3CP0 A;  3KF6 A;  4LFC L;  3S14 H;  3AFP A;  4A93 G;  1KC8 C;  3F2C A;  1SE8 A;  2JEA I;  4PZ7 A;  2BH8 A;  1EFW A;  1VQE A;  4DR3 L;  3S1N H;  2VS1 A;  5C44 G;  3F2B A;  2NZH A;  4NXN Q;  3PF4 A;  3PUV A;  1BKB A;  4BXX G;  4IOA A;  4LUV A;  4DR2 Q;  3PUY A;  4JI0 Q;  1YZ6 A;  2RF4 A;  3T1Y L;  1M1K C;  1CSP A;  2E2H H;  4DV2 L;  3CD6 A;  1LYL A;  1VQF A;  3A0J A;  1N33 L;  2NN6 I;  4JI1 L;  1L1O A;  1TWA H;  1E1O A;  4BY1 G;  3KDF B;  1LUZ A;  1RL2 A;  4LF4 Q;  5BR8 L;  1BBU A;  4HIM A;  4YCU A;  3CCU A;  4DV0 L;  1HH2 P;  1B8A A;  3FP9 A;  2GVB A;  4P73 A;  4JI7 Q;  3CCS A;  4JI4 Q;  1VQJ A;  4BBR G;  2Z0S A;  3K8A A;  1N34 L;  2YTY A;  4B3S Q;  3STB C;  3VDY A;  4HID A;  2K75 A;  1X6O A;  3NBH B;  4R4T A;  2UUC Q;  5IYB G;  2R92 G;  3TS2 A;  1PH6 A;  2E2I H;  5M5Y H;  3PO2 G;  3GTP H;  5JJL A;  2N49 A;  1JJG A;  1DGS A;  5IP9 G;  4X64 L;  4L5R C;  2EIF A;  1EOV A;  2PQA A;  1XTD A;  3T1H L;  3J7Z C;  1Q1B A;  4A3L H;  5IYB H;  4A3E G;  2PI2 A;  2YTV A;  3CCQ A;  3PO2 H;  5AJ3 L;  3HOW H;  2K4K A;  3K7U C;  3L0O A;  3LGJ A;  3CAM A;  4NXM Q;  1J5E Q;  5IP9 H;  1M90 C;  4IPD A;  2R93 G;  1XPO A;  2VQE Q;  2RHS B;  1X9N A;  1IYJ B;  2LXK A;  4HJA A;  4KHP Q;  5IT9 c;  1YJW A;  1XMO L;  4UP7 A;  4DNI A;  2Q2I A;  4JCV E;  5LMN L;  4L5S A;  4B3M L;  4P75 A;  5C4J H;  1Q1E A;  4JC0 A;  3HKZ G;  5FLX c;  5EAY A;  1KHI A;  4A4I A;  2PI2 E;  1YHQ A;  2D0P A;  3KFU A;  1KXL A;  1WYD A;  3M4P A;  4YY3 L;  1B7Y B;  3M4O H;  2ATW A;  1HR0 L;  1A63 A;  3RN5 A;  3RNU A;  3HOU H;  2HQL A;  1NJI C;  1TWG H;  2ALY B;  3OYY A;  3EIV A;  1NMF A;  4OON A;  4GNX B;  4BY7 H;  4LF6 Q;  4LF8 Q;  2JA7 H;  4LFB Q;  3E9H A;  4R1J A;  1PH4 A;  4YHH Q;  3PIP A;  4X66 L;  3U4Z A;  1MIU A;  1X3G A;  1KRS A;  1YNX A;  3I2Z A;  3ULL A;  3HOX G;  3UDG A;  3U58 A;  5C4X G;  1Z47 A;  4A75 A;  1GD7 A;  2JA5 G;  4A3B G;  2UXD L;  4R4Q A;  3PUW A;  3CXC A;  1N9W A;  5C0X G;  1PH5 A;  2H5X A;  1OXS C;  2ZJQ A;  2MFI A;  4LUZ A;  5IP7 H;  4HJ9 A;  4DR1 Q;  1YBY A;  4A3G H;  1C7Y A;  2E5L Q;  2K52 A;  4DV3 Q;  4A3I H;  4GN5 A;  5IE8 A;  5FJ8 G;  3BJU A;  4DV7 L;  1QVC A;  2YV5 A;  3GTG H;  4X62 L;  3OTO L;  4DV5 Q;  1LM0 A;  5C4X H;  4A3B H;  3KF8 B;  1L0W A;  4DUZ Q;  2KCT A;  1VQC A;  2AKW B;  2WAQ G;  3CPF A;  3DM3 A;  4A3M G;  2Q2T A;  2IX1 A;  3TRZ A;  5JJI A;  4LF5 Q;  2CQO A;  1U5K A;  1S3O A;  4DV1 L;  4KLK A;  2CWA A;  3PUX A;  1K8G A;  4KHZ A;  2B63 G;  4A3K G;  4DUY L;  2ID0 A;  3E9I A;  4LF9 L;  1Y1V G;  3I4N H;  2ASB A;  1CKO A;  1N8R C;  4OO1 I;  1NBW A;  1XNR L;  4QQB X;  1QUQ B;  2I5H A;  4AIM A;  2QEX A;  4JYA L;  3OW2 A;  1K3R A;  5M5W H;  3JAM i;  2F3I A;  2PNH A;  1PH8 A;  1FVI A;  1Y1V H;  4IFD I;  3ZJY C;  2HHH L;  4A3C H;  1PV4 A;  4PZ6 A;  4DV2 Q;  3WWV A;  2HT1 A;  1KD1 C;  4Y52 H;  1GM5 A;  3CC4 A;  1KIX A;  2R6G A;  2UUB L;  2ZJP A;  4GNX C;  4YWK A;  4EX5 A;  2VL6 A;  3KDF A;  4JI8 L;  1WJJ A;  1VQ6 A;  4DV0 Q;  1VQ7 A;  1UWV A;  1SRO A;  4LWC A;  4JI5 Q;  5GAE C;  3DLL A;  2R7F A;  5C0X I;  5HY6 A;  3BU2 A;  3H0G H;  4XTC S;  1Q86 C;  1ASZ A;  1I6H H;  2C35 B;  5LMU Q;  2MO0 A;  5H1S E;  2ZM6 L;  1XPR A;  5M3M H;  3KLW A;  3S2D H;  3S1M H;  4JV5 L;  4BA1 I;  1NE3 A;  1VQG A;  3M9B A;  1XMQ L;  3I4O A;  1E22 A;  2CFM A;  2K5V A;  4X64 Q;  1K83 H;  4DV6 L;  2QA4 A;  3G4S A;  1EQQ A;  1E7Z A;  3RZD H;  2VY3 A;  3T1H Q;  5FLM H;  2MNA A;  1YEZ A;  2JK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...