3PF4A

Crystal structure of bs-cspb in complex with r(gucuuua)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock protein cspB
publication title RNA single strands bind to a conserved surface of the major cold shock protein in crystals and solution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/rna
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pf4A00
2VNUD 5LMUQ 1VQIA 4KHPL 2PQAA 2C35B 2MO1A 4DV5Q 4GNXC 1PH3A 1K8GA 3GTLH 4DR4L 2VL6A 2JEBI 3CCUA 2E5LL 4Y52H 1VQFA 2E2JH 1K3RA 2K5VA 3PO2G 2BA0A 1W3SA 4QIWE 5AJ3L 1IBLL 2KCTA 4B3ML 1YZ6A 4A93H 2VUMH 2R92H 2IT1A 2XTIA 4LF7Q 3UDFA 2PNHA 1NY4A 4JI6L 1PH4A 4HIDA 2RCNA 2NVXH 3NENA 3UDXA 1IYJB 2DGYA 4LUVA 3U4ZA 4LF8Q 1TXYA 4KI0A 4GKKQ 4X65L 3I4MH 1J5EL 5C3EH 3S1NH 4YCWA 4JI8L 4DV0L 2R7ZG 3K81C 1EWIA 3T1YL 4JI3Q 3HOWG 3S15H 3AFPA 4B3RL 2MQHA 2LXKA 2YV5A 3J7ZC 1D8LA 1PYBA 4TVAB 1MJEA 2HIVA 2WFWA 4DKAC 4NPSA 3CMAA 2F4VL 1XPOA 3L2PA 1VQDA 1BBUA 3K7UC 4HIOA 1Y1WG 4BXXH 4DV7Q 3FKIG 4KHZA 3M4OH 2UXBL 1N36L 4NB3A 3STBD 4JI7L 4RMFA 1E22A 1KIXA 2BH8A 3J81c 4IO9A 4A3KH 3ERSX 3G48A 1ASZA 1AH9A 3CPWA 1Q1BA 2VUMG 4X6AH 2R92G 4MNOA 2EIFA 4YWMA 1CKNB 1XMOQ 1YBYA 3PGZA 4JOIC 4JV5L 1HR0L 2F52A 3KF6A 4OONA 3S2HH 5C0XJ 2WAQG 3PUZA 5M5XH 2OTJA 4LFAL 3I4MG 2WAQE 1U0LA 5C3EG 4X62L 2H5XA 2I5LX 2Z6KA 2CCZA 1HNWL 3KF8B 1K83H 4X66L 1N8RC 4DR6L 2Y0SG 1SFOH 3NBHB 4PG3A 2B63G 5IYDH 3AYHB 4AH6A 2Y0SE 4LUZA 5BR8L 4JI0L 1IXRA 4NXML 4BXXG 1S72A 3BJUA 1ASYA 5JEAG 1Q82C 4A3JH 4DV3L 1HZBA 5IWAL 2YU9H 1G291 2NVQH 4AQYL 2N78A 2OWOA 2RHQB 2LSSA 4YCVA 4JI1Q 1FJGQ 3M7NA 4A3DG 1UE7A 5M3FH 4YHHQ 1KXLA 1NE3A 1EUJA 1OXSC 1RL2A 2ZTEA 1SN8A 5FLXc 4Y7NH 3G71A 3F2BA 2ZJQA 1NJIC 2R7DA 1GM5A 4YWKA 3GTMH 5M5YH 1CKOA 1PYSB 2AWOA 2NN6I 3EBEA 5H1SE 1SMXA 3J81i 4H02A 1KL9A 2QEXA 4MZ9A 3D0FA 2VQEQ 1FVIA 3UDIA 5C4XH 3PUVA 1KD1C 2GN5A 1VQ8A 5IYDG 5M3MG 3T1HL 1JT8A 4O0AA 3TEHB 1EOVA 3RLFA 1XMQL 1XNRL 3U4VA 1GO3E 2WB1E 4HJ5A 1IZ6A 1K0RA 3W5OA 1NMFA 3MEFA 4YY3Q 3PIOA 2HHHL 4OWWB 3HOYG 4A3JG 1V43A 4GNXA 3RN2A 2E8GA 2RHSB 3H0GG 1UE5A 1LUZA 3A5ZB 3NEMA 4C2MH 5C4JH 2K75A 5GROA 4DUZQ 4OWTB 5M3FG 3AQQA 3PUXA 2UUCQ 4JI4L 1AE3A 3F1ZA 4C3JH 1PV4A 3I7FA 4QJFA 4IPGA 3L0OA 4DR5L 3A0JA 1A62A 2L15A 3E9HA 4UY8C 4R4TA 4BBSG 4GOPC 3PO2H 4LF6Q 4XIGS 1SE8A 3G4SA 1E7ZA 3ZJYC 4A75A 2CFMA 1M90C 4R1JA 2IX0A 2NZOA 4HJ8A 1VQ9A 5ELOA 4DR3L 3S14H 5C4XG 3KFUA 1OXUA 2K5HA 2KHIA 3GTGH 1SLJA 1CUKA 2E5LQ 4ME3A 2ALYB 1C7YA 4OX9L 2E2HH 1B8AA 1PH9A 4JI5L 1G51A 3KDFA 2UXCQ 4L5TA 5AJ3Q 1YI2A 1HZCA 1I94L 5DLQE 2ZTDA 2ZTCA 4DPGA 2UU9Q 3CC2A 4BA2I 4JI2Q 1XNQL 1MJCA 4A3CG 3GTJH 2MO0A 2CWAA 2ASBA 2K52A 4JBMA 3S16H 3W1GA 3M9BA 1V9PA 4UP9A 1Q7YC 1HNXQ 1Y1WH 2D62A 3FKIH 3JAMc 1KC8C 1VQPA 4X65Q 3J80c 4IFDI 2PMZE 2K14A 4LFCQ 1I3QH 3BU2A 3HOXH 3OTOQ 5GAHC 4MTNA 1QUQA 4JOIA 4DV0Q 1EIYB 4R4CA 2OQKA 4B3TL 4A3BG 4WJ3M 1CSQA 4OXPA 2AMCB 4P72A 1KHIA 4C3IH 4GKJL 2UUAL 1S40A 2AWNA 3KOJA 1PA6A 4A3GH 4A3LH 4LFBL 1N32L 5GAEC 1VQ5A 2RF4A 4PZ8A 2HT1A 4P71A 1GVPA 2I0QA 2UUBL 1YVCA 2JA5H 4DUYL 3TS2A 3FP9A 4DV1Q 3A74A 1U5KA 2Z0SA 2KHJA 2VQFQ 1VQOA 1Q81C 1IBKQ 1N33L 4JYAQ 3WWVA 1L1OB 3BZCA 1EQQA 3S17H 4APVA 1HZAA 3UE0A 4DR7Q 3CCSA 2VY3A 4LW1A 1HNZQ 2N49A 1CSPA 4HJ7A 2B63H 4JV5Q 2AHOB 2A1AA 5LMNL 4LF9L 3H3VI 4IOCA 1X54A 3UE1A 4C3HH 1N34L 4LF5L 1TWHH 3CAMA 3PF4A 2HQLA 3HOXG 5ELNA 3RLOA 5JJKA 2FXQA 5GADC 1YHBA 4DV2Q 1D7QA 2JJQA 5FJ8G 1P8LA 1VQHA 4A3DH 4DV5L 1KRSA 4BY1H 2CQOA 3F2CA 4OO1G 4A3GG 1E1TA 2R6GA 4A3LG 2PQAB 1X3FA 1E3PA 3JAMi 5IY0A 4HIKA 1WFQA 1EYGA 3J80i 4X64Q 1WI5A 3J7A5 2JA5G 1CKMA 3CP0A 4LF7L 4DR2Q 2K5NA 1YHAA 1SRUA 1Y14B 4B3SQ 2KCMA 1VQEA 4A3MH 3S1QH 3GTQH 2UXDQ 2IY5B 5M3MH 3A5UA 4DV4Q 4GKKL 2MNAA 1QVCA 1PHJA 1X65A 3ULPA 4POFA 4EQ5A 3H15A 3HOUH 3HOYH 4JI3L 3ULLA 5IYBG 1TWGH 3H0GH 1UEBA 3CCJA 2OQ0A 4OWXB 1A8VA 4A3IH 1V1QA 4BY1G 4QQBX 2N3SA 4DV7L 4GOPA 4LUOA 1PH1A 2IHEA 1HJPA 2B3GA 1LM0A 1G6PA 3J81j 4LF4Q 2PI2A 1A63A 4DV6L 5FLMG 1VQAA 2ATWA 5LMNW 3CC7A 4BBSH 1J6QA 3AFQA 4DK6C 3GTKH 1QVGA 3PV0A 3RR5A 1XMOL 2A19A 2K50A 2IX1A 3OYYA 1XPRA 2VS1A 4A3MG 1YIJA 1S3OA 4PZ7A 2D0OA 4POGA 1JJ2A 3TRZA 4K0KQ 2OCEA 3CCLA 3KF6B 4LNQA 1PVOA 4BBRH 2GVBA 2HIXA 1B70B 3HOUG 2EXDA 1QZHA 1HR0W 3PSIA 2Q2TA 4PMWA 3F8TA 1QZGA 4QY7A 4A3CH 4UPAA 1TWFH 1WCMH 5M5WH 4A3IG 2OTLA 1YJNA 2Q2IA 1L0WA 1OXTA 3CW2C 2QA4A 2QGQA 1UWVA 4JI1L 5IYCH 1FJGL 2VZAA 4IOAA 1VQKA 4A3BH 1KQSA 4NXNQ 2DUDA 2I5MX 2K4KA 2JK8A 2ZM6Q 3CQZH 2Z6KC 3D31A 3RZOH 4QL5A 4KHPQ 4DR4Q 2KENA 1X3GA 1VQ4A 3Q8DA 2ID0A 3RN5A 4BBRG 2VQEL 1K8AC 3GTPH 1O7IA 1IBLQ 4GLAC 1E1OA 4B3MQ 1PH2A 3DLLA 1LTLA 3AEVA 1TWAH 2EQSA 4LWCA 3U50C 1WCMG 4DR1L 4JI6Q 4GLVB 1Y1VH 2GVAA 4YWLA 1DGSA 4YY3L 5C0XG 1Q46A 3M3YH 3I4NG 3EN2A 1RIPA 4DAYB 4BY7G 3CPFA 2I5HA 4P73A 2NVTH 5IYCG 4DUZL 3S1RH 1J5EQ 3K7AH 4IJHA 4JI8Q 4GNXB 5GAGC 2UUCL 5FJ8H 3T1YQ 1L2FA 4WJ4A 2VW9A 3IRBA 2YTYA 1PH5A 4B3RQ 2LXJA 5IE8A 1IBML 4IPCA 2AKWB 5LMNQ 3M4PA 1AE2A 1X9NA 1TWCH 2JE6I 2F4VQ 3CCMA 2JA7H 3STBC 2CKZB 4LF6L 2UXBQ 4UP8A 1N36Q 2WP8J 1LYLA 1VQBA 1OXVA 3PF5A 4JI7Q 4HJAA 4J15A 1CKNA 2YTXA 1VQCA 1QVFA 2Q2UA 4JBKA 3PO3H 1I5FA 3TQYA 3HOVG 5GQOA 3S2DH 2UXCL 1Y1VG 3PUYA 3CC4A 4ALPA 1HR0Q 1EFWA 1YNXA 1I6HH 2UU9L 3E9IA 4DAMA 4JI2L 2JA8G 1VQGA 3KDFB 2JA9A 4LFAQ 1HH2P 5IYBH 4AYBG 4X62Q 1C9OA 1KRTA 1HNWQ 5LMUL 1M1KC 1HNXL 3HOZG 4AYBE 4X66Q 1L1OC 1IL2A 5HGQA 5IP7G 4DR6Q 1NBWA 1Q86C 4LFCL 5IP9G 2IHFA 1A0IA 5BR8Q 4JI0Q 3OTOL 4NXMQ 2JA7G 3CCEA 3GTOH 4A3EH 3RZDH 5FLMH 3KJPA 3RNUA 2JEAI 4DV3Q 5IWAQ 1P16A 1MIUA 2ZJRA 1QUQB 4P74A 3GO5A 4AQYQ 1K9MC 3JC66 5HY6A 1W2BA 5K36G 5JJIA 3PO3G 5C44H 1FGUA 3VDYA 4DK3C 2KBNA 4IFDJ 1PH7A 1JE5A 4LF8L 1VS0A 4DV1L 1IBKL 2YTVA 2VQFL 4JYAL 4A93G 4DV6Q 1PH8A 1GD7A 1OXXK 1VQNA 1VQ7A 3CCVA 1YJWA 3I4OA 2ES2A 1XPUA 4DR7L 4JG2A 4DNIA 4OO1I 1WYDA 1X6OA 2MFIA 1HNZL 2XGTA 1PH6A 5JJLA 3CCQA 4R4IA 1Q1EA 2YYZA 3S24A 1UE6A 4L5RC 4XTCS 4BA1I 1KAWA 1X3EA 1JJCB 4PZ6A 1MKHA 3T1HQ 4A3FH 3B6YA 1XMQQ 4R4QA 1E24A 1XNRQ 3CD6A 2HHHQ 4DV2L 2NN6G 4A3EG 3U58A 3TREA 1XJVA 4L5SA 3ULJA 4YCUA 4IPDA 3I56A 2CWPA 4JCVE 1EIFA 1Q8KA 1WOCA 3KLWA 3HFZB 5C44G 1N9WA 3ER0A 3W1BA 4X64L 1JMCA 4JI4Q 1JB7A 3GDEA 3CXCA 1FL0A 1YHQA 4JBWA 3DM3A 4O2DA 1SROA 4DR5Q 1NTGA 2R7FA 4QGUA 3OW2A 4A3KG 1T9HA 2D0PA 3K8AA 4AIMA 3PUWA 4DR2L 3I55A 1PFSA 4B3SL 3KYHC 4R4OA 3KJOA 2UXDL 1VQJA 2V1CC 4DV4L 3HKSA 4TQUS 5EAYA 4UP7A 1Z47A 2NVYH 4DR3Q 4GN4B 1K73C 1GKHA 1YEZA 4A3FG 3FHWA 3I4NH 4OX9Q 4KLKA 4GN5A 4BY7H 1WJJA 3I2ZA 3MXNB 4RG1A 4JI5Q 3K80C 3PCOB 3PIPA 2JA6H 1X56A 1I94Q 1X55A 3RLNA 4YHHL 3EIVA 4HJ9A 1YITA 1XNQQ 3LGJA 3ICEA 2WB1G 4GLXA 2BA1A 4DR1Q 2NZHA 3E0EA 5IT9c 4LF4L 2R93H 2F3IA 4GOPB 5J3BA 2JQOA 3S1MH 4A4IA 3TS0A 2B29A 3K0XA 1H95A 3M4QA 4HIMA 4JC0A 1BVSA 1BKBA 3BZKA 4B3TQ 3CMEA 1Q12A 4GKJQ 2UUAQ 1OTCA 4A76A 3NELA 4EX5A 1R9TH 1BBWA 1IBMQ 3HOVH 4LFBQ 4K0KL 2Q2HA 1N32Q 1JJGA 2N8NA 4JBJA 1VQ6A 5E7NA 4L5QA 2E2IH 3H3VH 2UUBQ 1VQLA 1L1OA 3L7ZC 3UDGA 2A8VA 4DUYQ 2JA8H 1HZ9A 4IJLA 5JEAJ 3G6EA 1N33Q 2JA6G 4IFDG 1Z9FA 3CCRA 4FDBA 1EQRA 4GS3A 3HKZG 3HOZH 3SGIA 1NMGA 5IP7H 1VQMA 3GD7A 3HKZE 4P75A 1YJ9A 2R93G 1XTDA 5IP9H 2ZJPA 4LF9Q 1B7YB 4IPHA 1VCIA 2BH2A 3M85A 1N34Q 4LF5Q 2R7ZH 4NXNL 3CF5A 3HOWH 2PI2E 2ZM6L 3F2DA 1I50H 4GN3B 1UE1A 1C0AA 1SR3A 5C0XI
chains in the Genus database with same CATH superfamily
1I50B 2PQAA 1C48A 4G4KA 3FEWX 2VL6A 4K5VA 3X3MA 4DK1A 5DNFA 1RCVD 1G2TA 1K3RA 1HUNA 1IBLL 1YZ6A 2C5CA 2B2WC 2R92H 2VUMB 5JPNC 4DAPA 1NR2A 4JI6L 2RCNA 2NVXH 3NENA 4LUVA 1SE3A 4KI0A 3N52A 5CYUA 1YNJD 4X65L 4TKOB 1J5EL 3S1NH 4YCWA 2R7ZG 3K81C 3T1YL 4JI3Q 3D4WA 1B9MA 4A3EB 3S15H 2MQHA 3J7ZC 2WINB 4NPSA 5ELDA 3K7UC 4DV7Q 2F0HA 4CBVA 3M4OH 1LT4D 2KCNA 4NB3A 3STBD 1TIID 3QWNA 1E22A 2QCPX 3J81c 2B2YC 4IO9A 1ASZA 1Q1BA 4YWMA 1ET9A 3A8KE 3SE0A 1YBYA 3PGZA 4JV5L 1AW7A 3KF6A 1Z6HA 3PUZA 2OTJA 1E2VA 1FGBD 2H4OA 5M5XB 1EQVA 1CT1D 2N88A 2CCZA 3DEOA 2QF7A 2EXZA 2KVMA 1HHVA 1V8QA 2Y0SG 1K83B 3NBHB 4M1UB 3AYHB 4AH6A 1U9RA 1IXRA 2WB1B 4NXML 4BXXG 4WORA 1ASYA 5JEAG 1Q82C 2CHBD 4A3JH 1HZBA 2LSSA 1KXLA 5M3FH 1NE3A 1OXSC 1RL2A 3F2BA 4ABNA 3VR3A 3A56A 3GTMH 5EJWA 1SMXA 1TR5A 3J81i 1LTTD 2SNMA 2NVYB 5CBAE 1A2TA 4TSSA 2VQEQ 2BCOA 4R9WA 1FVIA 3UDIA 5C4XH 5NUCA 3PUVA 1JORA 1D5XC 1KD1C 1VQ8A 3IAYA 4LJZC 3T1HL 2K1BA 2K28A 4DAYA 2FINB 1IYUA 3HKZB 1XNRL 4HJ5A 2WB1E 2ZT9C 1C4QA 1GUTA 1RF2D 2PZUA 4XDXA 2RHSB 3NEMA 1LUZA 3A5ZB 2L11A 4RAUC 3X3NA 5C4JH 3PMFA 3AQQA 1SNPA 1FYCA 1CZWA 4HSVA 2B2WA 3L0OA 4DU9A 1U4RA 1CK1A 1A62A 2L15A 2K5WA 4UY8C 4GOPC 4LF6Q 3ZJYC 1M90C 3PO2B 4R1JA 4XXEA 1GHJA 2NZOA 3FMCA 1B1ZA 4X3SA 3E6ZX 2F4IA 4U673 1Y8OB 1PH9A 1DONA 2C9OA 2NB0A 1XNQL 1MJCA 1WTWA 2MHVA 1F2LA 2K52A 4JBMA 2B2YA 1HNXQ 1YNJC 3VR5A 3JAML 1KC8C 4X65Q 3J80c 1Y69U 2PMZE 2IX3A 3UI2A 5KNBA 3A54A 4JPBW 2NZ1D 4R4CA 1EIYB 4B3TL 1HFGA 4P72A 4HAEA 1KHIA 2AWNA 3KOJA 1PA6A 2K5DA 4I65A 4LFBL 1N32L 2EYMA 2RF4A 4PZ8A 2HT1A 1HUMA 1YVCA 4DUYL 4DV1Q 3C1EA 2KHJA 1QCBD 4KHVA 3SHLA 2WAQB 2VQFQ 1Q81C 2LS01 3WWVA 1N33L 4JYAQ 4J8QA 3BZCA 1EQQA 3S17H 1GJXA 1HZAA 4J1MA 3TSSA 5C3EB 2LY7A 4JV5Q 3ERQA 5LMNL 3H3VI 4CJ2C 2L9HA 1B50A 3UE1A 4FXDA 5JEAH 3PF4A 2LMCB 2XN9C 3DM1A 5ELNA 3J81L 3HG9A 2QDBA 5JJKA 1D7QA 4K5WA 5FJ8G 2E2DC 4OO1G 1BQQT 4RGNA 4A3LG 5BN5A 3KLRA 2RDHA 1EYGA 1WFQA 3J80i 1WI5A 2MP1A 3J7A5 3BVZA 4LMQD 1CKMA 4B9XA 4V0BA 4ID6A 3MFYA 4K2LA 1YHAA 1Y14B 1LLRD 3EROA 3S1QH 4GKKL 4A3MB 1H9KA 3J7YW 1PHJA 3ULPA 3HOUH 3V05A 3HOYB 3CCJA 2YU9B 4BY1G 4GOPA 4A3IB 4ZYSA 1HJPA 3G6JB 2B3GA 2PI2A 1LTSD 1FD7D 5JPMC 1ESFA 1D1IA 2I07B 4ZCKA 4IUUA 1AEXA 4KKUA 2AUJD 5TSSA 4PZ7A 2Z6BA 3OWEB 3Q0AA 4POGA 3TRZA 2OCEA 3VR4A 4OHJA 4BBRH 2BDOA 2HIXA 2EXDA 3I8ZA 4WRDA 4QY7A 1TWFH 2Q2IA 5C0XH 1RHPA 5A2QE 3DHQA 1UWVA 1ESRA 4G7ZC 1PMRA 2VZAA 3VYTA 4E6IA 2M2LA 3CQZH 2Z6KC 1X3QA 4L8JA 3RZOB 2EYLA 3Q8DA 2ID0A 3RN5A 1B9NA 2F0NA 2E2HB 4B3MQ 1E1OA 5I2YA 1WD1A 1B44D 2EQSA 2IWHA 1WCMG 2E75C 1LACA 1Y1VH 1B4OA 4YWLA 1Q46A 3T16A 5DEHA 1S5BD 4BY7G 4P73A 4XT3B 2NVTH 3S1RH 3K5OA 3VA5A 5FJ8H 1D1KA 2VW9A 1A2UA 4B3RQ 4OO1H 5LMNQ 3M4PA 1AE2A 2F4VQ 1TWCH 2JE6I 2JA7H 2UXBQ 4UP8A 1N36Q 4JI7Q 1OXVA 1EZ6A 4HJAA 2JA5B 1CKNA 3TP6A 1VQCA 4JBKA 2PCFB 3TQYA 4CDEC 3S2DH 3J81E 3KLSA 4V190 2UXCL 5JAVA 1HR0Q 2UU9L 1I6HB 2A73B 3P75A 4LFAQ 2F03A 4X62Q 1C9OA 4RH6A 3TP5A 5LMUL 3HOZG 2PW5A 5BR8Q 4JI0Q 2K7VA 3OTOL 3CCEA 4X3UA 3U9OA 2NN6H 2E76C 4PMCA 4A3EH 1P16A 4FYDA 1W2BA 5JJIA 1ILQA 3Q22A 3VDYA 2K03A 2KBNA 4IFDJ 4LF8L 4A93G 1YJWA 2QKIC 4XQNA 2RA4A 2XGTA 2NUCA 1SXTA 1TWGB 4R4IA 3OW7A 2YYZA 5JVG3 5EPLA 4O42A 4L5RC 3A8IE 2P5ZX 1TS4A 1E2ZA 4NP5A 3CD6A 4DV2L 2O5IC 3U58A 3SK5A 4L5SA 1XJVA 4JVZA 2CWPA 1Q8KA 1WOCA 3K5LA 3KLWA 1I4QA 3HFZB 1N9WA 1KNAA 1TQOA 2FMMA 4HMIA 1YHQA 1KDBA 3E5SA 1EWHA 1SROA 2R7FA 3KLSX 5IGGA 3ZYYX 3OW2A 4AIMA 1HRJA 5IGEA 4P2CB 3PIO3 2WIIB 4DR2L 4B3SL 2XWJB 4F88A 3KJOA 1F9QA 1T5XD 2V1CC 4TQUS 3SK4A 2X6GA 4UP7A 2NVYH 1K73C 2J4XA 1YEZA 2F0GA 4A3FG 1C8CA 4OX9Q 2A6EC 4BY7H 1WJJA 2EOTA 1F9RA 3MXNB 2HD3A 3PIPA 1VF5C 4YHHL 1YITA 4HJ9A 2BA1A 5C4HA 4H44C 3E0EA 2F3VA 3K0XA 4HIMA 4JC0A 3MTSA 4K6DA 4FF2A 4F8MA 3GTPB 3CMEA 2FFKB 3J80E 2DNCA 3NELA 5G3LD 1R9TH 3EQLC 1EEID 2EYOA 1SNQA 4L5QA 4G57A 3UDGA 3V2TA 1PTOB 1EIHA 2JA6G 1X3PA 2F0MA 3HOZH 2EVBA 1AP0A 2RDFA 1VQMA 4BWGB 4ZAIA 1YNND 1VCIA 3N6RA 2KCCA 5J22A 2EYFA 2R7ZB 1F77A 5C0XI 1TS5A 3QOJA 3K58A 5LMUQ 4KHPL 4GNXC 4DR4L 3BYYB 1M4VA 3R3OA 4EQNA 4Y52H 1VQFA 1EOTA 2K5VA 1IL8A 4C1NK 5AJ3L 4A93H 3UDFA 3W3AA 2HDMA 1ENAA 2F0UA 2PYKA 1NY4A 3BVMA 1SJED 1IYJB 2DGYA 1B2TA 4LF8Q 4C56C 3T4AC 3I3CA 5C3EH 1EWCA 3NE5B 1CQFA 4N9TA 3RZDB 4UDUC 1D8LA 1J9OA 2HIVA 1EY0A 1B3AA 1BBUA 1QNUA 1HA5A 4HIOA 1Y1WG 3FKIG 5C44B 3K57A 4UAIA 1KIXA 1G8ZD 3CPWA 2F0FA 4A3KB 2R92G 4MNOA 1Y8PB 4B9WA 1WTHA 3FPPA 1XMOQ 4JOIC 5ELCA 3S2HH 2EY5A 1JWUD 2E74C 1O80A 2F0LA 1HNWL 4X66L 4DR6L 5E4WC 5I6YA 2B63G 5IYDH 1SFOB 2Y0SE 4LUZA 4ZLTF 4C3HG 1VF7A 4DV3L 2YU9H 1FR3A 2O5JC 4K5XA 5FOBB 1SYCA 4AQYL 2OWOA 1KNEA 2ZXRA 4YCVA 4YHHQ 1EUJA 2ZTEA 2EJGC 3QJYA 5KIXA 5FLXc 4Y7NH 3P1HA 2PZWA 5M5YH 2N55A 2NN6I 2AWOA 4HN7A 5H1SE 4H02A 1KL9A 2QEXA 3D0FA 1GUWA 1SNCA 3R2TA 4DXGA 2GN5A 4RHRA 5DM73 3BZDB 3TEHB 3RLFA 2HHHL 4FXGC 3NQIA 3W2DA 4IALA 4A3JG 3HEJA 4GNXA 3P20A 3G7LA 2XSCA 2EYPA 3KBXA 2A69D 4DUZQ 5M3FG 4HSPA 1U4MA 1STBA 5CV9A 1YNNC 3I7FA 4DR5L 3E9HA 4BBSG 4KTAA 3G4SA 1E7ZA 3P7JA 4A75A 2CFMA 1VQ9A 5C4XG 4DR3L 1KTKA 3KFUA 3S14B 1CUKA 1C7YA 2E2HH 3KDFA 4L6TB 5AJ3Q 2ZTDA 4BA2I 1RODA 4DPGA 1F2MA 3CC2A 1JICA 4JI2Q 4K6LA 2G9HD 3HOWB 1KAAA 1I4RA 2A68C 1S5FD 1Y1WH 3FKIH 2EE1A 3JAMc 3FVQA 4PQXA 1I3QH 4IFDI 1QUQA 4JOIA 5C5MA 1BR9A 4WJ3M 3KUPA 2UUAL 2Z1CA 1VQ5A 4P71A 2UUBL 2RSNA 2JA5H 1QG7A 1VQOA 1IBKQ 1U5KA 2Z0SA 3ONAB 2G5DA 4DN4M 4CGYB 3I4MB 5CV5A 4APVA 1EY8A 4LW1A 2BE5D 2B63H 1K3BC 2AHOB 4IOCA 3OIQA 4C3HH 1N34L 4LF5L 1TWHH 2FXQA 1YHBA 4N8X1 1FNWA 1CHQD 1VQHA 4DV5L 2L0CA 5J1ZA 2CQOA 4A3DB 1BCPB 2PQAB 1X3FA 3JAMi 4X64Q 1PFBA 5BN3A 3CP0A 4LF7L 1MHWC 1WTQA 3QR8A 4R8NA 2K5NA 2X6LA 2IY5B 1SYGA 2Q8IB 3A5UA 4DV4Q 3GTQB 2MNAA 5M3MB 3RMHA 4NW2A 2D9UA 2MJ8A 1TWGH 5IYBG 4RHSA 2GA4B 1UEBA 5LL6S 4OWXB 1E2WA 4RWSC 2NVQB 3H0GB 1V1QA 4IUVA 4IZ8A 2N3SA 5CMDA 5FLXL 4LUOA 1L0YB 2IHEA 1H9SA 1WTVA 1GUOA 1RTOA 3J81j 1A63A 5FKAC 1CTMA 3CC7A 4BBSH 3AFQA 2A69C 2IW3A 4DK6C 3GTKH 1QVGA 3PV0A 4RCOA 2HQEA 3RR5A 2IX1A 3OYYA 1XPRA 1S3OA 4DK0A 3KF6B 3HOUG 5T1GA 2PO4A 2B2VC 2Q2TA 4PMWA 1QZGA 4K8JA 4TRDA 4UPAA 2OTLA 1L0WA 1WCMB 3CW2C 2QGQA 4FF4A 5CV8A 3MXPA 4C3JB 2PMZB 4JI1L 5IYCH 1FJGL 4NXNQ 4A3BB 1HA6A 2K4KA 2ZM6Q 1GUGA 1PRTD 3V96A 1O7YA 3D31A 4RGMA 2QEJC 5IGFA 4BBRG 1K8AC 3GTPH 1JQYD 1IBLQ 4DXFA 1PH2A 3DLLA 1LTLA 1WD0A 2M9VA 3OOCA 4KJNA 1STNA 3U50C 3H3VC 4JI6Q 2GVAA 4NMZA 5C0XG 3GTJB 4YY3L 2OF1A 1PTOH 1Q8IA 3I4NG 1GOZA 3S16B 4DAYB 2I5HA 1HQRD 4XYOA 1J5EQ 1KLGD 4IJHA 5GAGC 2UUCL 3HOXB 5EKLA 3T1YQ 1PH5A 2YTYA 2LXJA 5ELFA 4C3IB 1MD2D 4A3GB 3STBC 2KJXA 2WP8J 5K5PA 2Q2UA 2XRSD 3HOVG 5GQOA 2EZVA 3HS0C 1Y1VG 3CC4A 3HP3A 3URYA 4KD3A 1EFWA 1LABA 2F0KA 4R8IA 3KF8A 1WTPA 2JA9A 1HH2P 4JK1C 5D14A 5IYBH 4AYBG 1M1KC 1PTOD 2VXWA 1L1OC 5I9PA 5IP7G 2NTTA 1NBWA 1STHA 4LFCL 1V1PA 2JA7G 4NXMQ 2BOSA 2KQ3A 4FNFA 3RZDH 5K36H 3KJPA 3PQIA 3GTOB 1MIUA 3NXWA 1K9MC 3I90A 4DAVA 5C44H 1FGUA 3ND8A 1JE5A 1PXUA 1S5ED 2B2VA 2XWBB 3MXUA 2YTVA 2NWGA 5EBDA 3M7GA 1OXXK 2F0VA 5FLXE 5ISRA 2ES2A 4DR7L 4JG2A 4DNIA 1EU4A 1HNZL 2DN8A 1WVLA 3I4LA 4MTKA 1KAWA 3T1HQ 1CQVA 3B6YA 3E3XA 4HTHA 1XNRQ 3C1FA 2NN6G 3OWFA 4A3EG 3I91A 1MSGA 4QUCA 4YCUA 4IPDA 4JCVE 1EY6A 3OMGA 1EIFA 3W1BA 1JMCA 3GDEA 3CXCA 1BNZA 4LK1C 5E1FA 3DM3A 5HGTA 1NTGA 5EBCA 2G9DA 1AZQA 3K8AA 3PUWA 1IHZA 3FDTA 3I55A 1PRTC 3H09A 3DWQA 2F3WA 4R4OA 2UXDL 1VQJA 1BBXC 1PYWD 5EAYA 1I4HA 1XXGA 1O7LA 1L0XB 1ENCA 3I4NH 3WDNA 1TVXA 3BG3A 3VR2A 3K5NA 5C4ZA 1X56A 3FPUB 1XNQQ 2WB1G 4GLXA 1A3VA 2OEOA 4LF4L 4GOPB 2JXMB 3H6MA 3S1MB 4UHVA 1H95A 3M4QA 3BVGA 1BVSA 1BKBA 4B3TQ 3JAME 4A76A 4EX5A 1J8IA 4K0KL 1BBWA 3HOVH 1JJGA 4LFBQ 1N32Q 1TWAB 1LTGD 2VB3X 4FVMA 1L1OA 2A8VA 4DUYQ 1STGA 1N33Q 2JA8B 1Z9FA 4IFDG 3CCRA 4FDBA 2F0EA 3HKZG 3K7AB 3SGIA 1NMGA 5IP7H 1XTDA 4F87A 2RDGA 1NNXA 2PI2E 3HOWH 1I50H 1UE1A 1PTOC 2VNUD 5I6WA 2C35B 2MO1A 1BF4A 4DFAA 1PH3A 3CRKC 1K8GA 3PO3B 2JEBI 3VYRA 2FHTA 3PO2G 1W3SA 4QIWE 2KCTA 1I4GA 2VUMH 1A3UA 2IT1A 2XTIA 1SAPA 3UDXA 2WKDA 2KA7A 3MFGA 3U4ZA 1RJTA 2NVXB 4K14A 1TXYA 4IUNA 1Q90A 4GKKQ 3I4MH 3NPPA 4JI8L 4DV0L 3EFXD 4N8FA 1VDZA 4RKLA 3S1NB 5I2XA 4EQOA 2LXKA 2YV5A 1AFPA 4TVAB 2WFWA 3CMAA 1XPOA 1VQDA 3K59A 2OT2A 5KYIA 3J7AF 3M4OB 4ILWA 1AH9A 1JCKB 3QO2A 3H94A 3R2IA 2JP1A 1HXYD 1K8OA 4DF7A 1V1OA 1CKNB 2F0SA 2QW7A 5LL6X 2WAQG 4EQPA 5M5XH 4EVOA 2LFNA 1U0LA 5C3EG 3NP8A 2I5LX 2Z6KA 1K83H 4H13C 1ZKOA 3CKIB 1N8RC 2Z9HA 2LKVA 2PQEA 3T51B 3DWAA 4FXKC 5IWAL 3VA7A 1G291 2NVQH 3EJIA 2N78A 3M7NA 2RHQB 4ZUJA 1UE7A 1D5MC 1MGSA 1SN8A 1NJIC 1EY9A 2PPBC 1D5ZC 3OSOA 3NTIA 3NBIA 4KKTA 1CKOA 1PYSB 3GTMB 1X32A 1BCPD 2QILA 3EA6A 4MZ9A 3IL8A 1IKMA 2CH4W 4IFDH 2K05A 5IYDG 2XVSA 4B08A 1EOVA 4QF4A 4BS9A 1HTLD 1XMQL 1GO3E 2EY1A 5EPJA 1IZ6A 1K0RA 2DJGC 3MEFA 4M8AA 3W5OA 3HOYG 1M8AA 2R93B 3BDOA 1SNMA 2E8GA 1UE5A 1W6KA 2K75A 1G91A 3PUXA 5C4JB 1ZYRD 4JI4L 3NUCA 4C3JH 1HTPA 4QJFA 2KHSA 3A0JA 4F7XA 3PO2H 1SE8A 2B2TC 3C46A 2WV6D 2F0TA 4HJ8A 1OXUA 2K5HA 1VMCA 2X69A 5C6AA 1WTRA 5ELBA 2OXPA 2UXCQ 4JI5L 1G51A 1U4LA 4L5TA 1HZCA 1I94L 2UU9Q 2ZTCA 2KEDA 4KN7C 1MI2A 4ME5A 4Z9CB 4A3CG 3GTJH 1SE4A 2KOLA 1PFNA 3S16H 3W1GA 5KEEA 3IKJA 1V9PA 3TN2A 2L4NA 2JN4A 1VQPA 3GTLB 2K14A 4DA2A 3BU2A 1IL2A 3HOXH 1ICFB 5GAHC 3OTOQ 4DV0Q 2E2JB 2OQKA 1CSQA 4OXPA 2AMCB 4C3IH 4GKJL 1S40A 4A3GH 5GAEC 2I0QA 3OMCA 5CV6A 4ZKBB 1SMYD 3TZDA 1SDFA 1JOQA 3UE0A 2ICIA 1ML0D 3S17B 3GP7A 2F0QA 2N49A 1CSPA 4HJ7A 4U68A 2A1AA 2Y0SB 3RUZA 4LF9L 2L55A 1X54A 2HUGA 4FO2A 3T53B 2D5DA 3CAMA 4IQZA 2HQLA 1PDQA 4X3TA 4DV2Q 1II3A 4KN4C 1P8LA 1LT3D 3M4YA 3F2CA 2R6GA 1E3PA 4I7AA 1QILA 1CFMA 2JA5G 4RFBA 2R61A 4KJOA 1NCVA 4DR2Q 4MHEA 1SRUA 4B3SQ 2KCMA 1VQEA 1EYAA 4A3MH 3S1QB 2EJFC 1QVCA 2EJMA 4XQJA 3HOYH 4JI3L 3ULLA 2CQAA 2F0OA 4IUQA 4A3IH 1EEFD 3QIAA 4DV7L 1B3QA 2B2TA 2DY8A 1DM0B 4Q0FA 3S9WA 5EPKA 1G6PA 4DV6L 2K5QA 5LMNW 2FMCA 3NWSA 5EKKA 1ZYRC 2A19A 5M9OA 2K50A 3PIP3 4CJ0B 1JJ2A 4LNQA 3CCLA 1PVOA 2GVBA 5E3FA 1HR0W 3GV6A 3F8TA 3WOEA 2RVLA 4QB4A 4A3CH 2CW0D 4IUPA 4C2MB 3MXGA 2QA4A 3OPOA 5HURA 2DY7A 1DXMA 1JC7A 5FO7B 1KQSA 3Q24A 2I5MX 1IYVA 3Q6SA 1O7ZA 3RZOH 4KHPQ 4RCNA 1SYFA 4DR4Q 1F9PA 2KENA 1X3GA 1VQ4A 3GTGB 2VQEL 3A7LA 1O7IA 2VB2X 3MWYW 4H0LC 1AN8A 3AEVA 1TWAH 4ZK9B 4LWCA 3K6OA 4DR1L 5EQ0A 1DGSA 3DEPA 1SMYC 5FO9B 4L63B 5C3XA 1HQMC 5IYCG 2JSOA 1K8MA 4ZQ3A 2J0TD 3K7AH 4GNXB 3S1RB 1NSNS 1L2FA 3T56B 1Y8NB 3IRBA 5IE8A 1IBML 1WTXA 4IPCA 1LTID 2AKWB 1QNKA 4LF6L 3WOFA 5G3LF 1LYLA 2L5TA 1VQBA 3HGBA 4ZKCB 3PO3H 1QVFA 1I5FA 1SYDA 4XYQA 2A5HA 1HCZA 1ENFA 1EFID 4HR7B 4ALPA 3S2DB 1I6HH 3AMUA 3DXJC 4LAAA 3MZ5A 4DAMA 1VQGA 4CKEA 3KDFB 1BO0A 1SNOA 3NBHA 3GV3A 3VR6A 2B8FA 1HNWQ 1HNXL 4AYBE 4X66Q 5HGQA 4DR6Q 4K8IA 4G7OC 1MBYA 1FNUA 4BY1B 2BDNA 2HCIA 1A0IA 3AB9A 1SYBA 4GZYC 3A55A 3AU7A 3RNUA 5IODA 2SOBA 4ZRZA 3MEHA 4DV3Q 1KABA 1QUQB 4P74A 4AQYQ 1R4PB 1RTNA 2ZXPA 5HY6A 4QMGA 1QWYA 2PNRC 1VS0A 4DV1L 2VQFL 4JYAL 4DV6Q 1SNDA 1GUSA 1GD7A 3OHXC 2HCCA 3CCVA 3I4OA 1UUPA 1BOSA 1WYDA 1X6OA 4CKBA 5JJLA 1Q1EA 3D6CA 1UE6A 3S24A 5C3WA 4BA1I 3NSWA 1X3EA 1TS3A 1MKHA 4CDCC 4CDDC 2HHHQ 4KY5A 3ULJA 4PNYA 3C2PA 2CW0C 1ONLA 1EY4A 5FK9C 1IW7D 1JWSD 5C44G 3NQTA 1SBBB 4A3KG 4DR5Q 1T9HA 1B53A 3J7AV 3BDCA 1ZXTA 4DNRB 4EGVA 1PFSA 3KK7A 4IN3A 3SEBA 3CHBD 3I73A 4MN3A 3HKSA 1G2SA 1JE4A 4OIJA 1Z47A 3D8GA 4DR3Q 1GHKA 5M5WB 1LT5D 3FHWA 4HEDA 2PZTA 4HCEA 1DD2A 4J6HA 3I2ZA 3K80C 2CH4A 4BY7B 1X55A 3RLNA 2KUMA 3EIVA 2D2CC 3A8JE 2TSSA 5IT9L 4DR1Q 2NZHA 5EKIA 1STYA 3DUZA 2R93H 2JQOA 1H9SB 1CA5A 1CHPD 3A7AB 5IGDA 1DCZA 1H9JA 2EYJA 1A3TA 4H7BA 2UUAQ 1OTCA 1IBMQ 1RD9D 2Q2HA 1JR0D 2N8NA 4JBJA 3Q23A 1R9TB 1VQ6A 5E7NA 2UUBQ 5A2QL 1VQLA 1CA6A 2K01A 3L7ZC 3M3YB 1W6JA 1Q3LA 1HZ9A 3TP8A 2A6HD 4IJLA 5JEAJ 3D6WA 2EPBA 5IIFA 2BE5C 3EVQA 3D4DA 3HOZB 3GD7A 3HKZE 1YJ9A 2WACA 1ZEQX 1QOHA 1B7YB 4IPHA 1EQTA 3M85A 1N34Q 1I4XA 4LF5Q 2R7ZH 5E4XA 3CF5A 5DM63 4GN3B 2F0JA 1SR3A 1FNVA 4MTNA 1EZ8A 1VQIA 2SEBD 4DV5Q 1LTAD 3GTLH 2E5LL 3CCUA 1VMPA 3QG1A 2E2JH 3BYTB 2BA0A 4B3ML 4A93B 2A74C 1STEA 4LF7Q 2PNHA 3D4RA 2FJ2A 1PH4A 4HIDA 2NYZD 4FF1A 4RGOS 4KK7A 1F2YA 3SDZA 1A15A 3K5MA 1EYDA 3CU7A 5COYA 1XTCD 1EWIA 3HOWG 5CBEE 3AFPA 4B3RL 1QJOA 1PYBA 1MJEA 4DKAC 1R4QB 1PLFA 3L3OC 2F4VL 3L2PA 4BXXH 2F1MA 2UXBL 4KHZA 3TBIB 1ET6A 2DJFC 1STAA 3SXHA 1N36L 4JI7L 4RMFA 1UAPA 2BH8A 4A3KH 3ERSX 3G48A 1AZPA 4X6AH 2VUMG 1DYQA 5AFWA 1IW7C 2EIFA 4PMBA 3I72A 2K04A 1HR0L 2J7ZA 1TU2B 2F52A 4K2KA 2R3ZA 4OONA 3MVVA 5C0XJ 3LWEA 1S5DD 3S2HB 4LFAL 3I4MG 2WAQE 4KMUC 5KRUA 4A3FB 4X62L 2H5XA 3KF8B 1SFOH 4PG3A 3OIPA 4YIJA 2F0PA 5BR8L 4JI0L 1S72A 3BJUA 1V1PB 1LO5D 3I70A 1QE6A 2B39A 4JI1Q 1S4ZA 4KV6A 5EGTA 1FJGQ 4A3DG 1DOLA 3NK9A 3G71A 2ZJQA 4OELB 2R7DA 1UNSA 3DMUA 3IFDA 4YWKA 4Y7NB 3SK6A 1GM5A 3EBEA 4RGTA 5M5YB 3QB3A 5KNDA 2ICEC 1T5EA 3QOLA 4O1NA 5IT9E 1OO9B 2B2UC 4QCLA 3MC0B 2JA6B 1JT8A 5M3MG 4O0AA 1PZJD 1XWEA 3U4VA 1KLUD 3PIOA 4YY3Q 3SVMA 1NMFA 4OWWB 2Z4HA 5DAUA 2A6HC 1V43A 2XNAC 4C2MH 3RN2A 3H0GG 1PH7A 5GROA 4OWTB 5L37A 2K33A 4CJ1B 1K28A 2UUCQ 1AE3A 4WFN3 1I4PA 3F1ZA 1PV4A 4IPGA 2RSOA 2TMPA 2NBFA 5JVH3 4R4TA 4QIWB 4XIGS 2E2IB 1NR4A 2IX0A 1D2BA 1KDAA 5ELOA 3S14H 2KHIA 2IPKD 3GTGH 1SLJA 4IURA 2E5LQ 4ME3A 1PZID 2ALYB 4OX9L 2RBMA 1B8AA 5LHY1 2A6ED 1YI2A 5CORA 5DLQE 2B8GA 5FO8B 2MO0A 4FF3A 2CWAA 2ASBA 1CI3M 3M9BA 3U9SA 4UP9A 5ELEA 3TP7A 1Q7YC 4C3JG 2D62A 3J80L 1PRTF 2I46A 1Y1WB 4LFCQ 3FKIB 1K0SA 4A3BG 1EU3A 1UEAB 1I3QB 1SEBD 3HZXA 3NHHA 4A3LH 2R92B 4KKSA 1GVPA 1JB3A 1JOOA 1ILPA 3TS2A 3FP9A 1NUCA 3A74A 5CGKA 5F2DA 2O2LD 4I7ZC 1L1OB 1G6ZA 4XQQA 3FRPB 5T1IA 4C1NI 3CCSA 2VY3A 3O13A 4DR7Q 2SDFA 1HNZQ 1JOKA 2EY2A 3S15B 2B63B 5D3DA 1F9SA 2Q8TA 3TMEA 1U4PA 5IOCA 4C3HB 1TWHB 3HOXG 3RLOA 1CZGA 5GADC 2JJQA 2CVRA 3E0JA 4S3SA 1RDPD 5JOBA 4C3IG 4A3DH 1KRSA 4BY1H 1E0BA 4CDFC 2H1EA 4A3GG 1E1TA 5CR3A 2B2UA 5IY0A 4HIKA 3KBGA 3RD4A 4CHTB 5I9OA 3T13A 1XYIA 2IL8A 1BXTA 4HMJA 2F0WA 2UXDQ 3GTQH 5M3MH 1ICWA 2JYOA 1PTOF 3MXNA 1X65A 4RKBA 4POFA 4EQ5A 3H15A 3SR1A 2RCFA 2Q8RE 4WJWA 3H0GH 4A3JB 2OQ0A 1A8VA 4ZUIA 4QQBX 1HFNA 1PH1A 2MUYA 5M3FB 1LTBD 1LM0A 1BDOA 4G7HC 4LF4Q 3H91A 5FLMG 1PRTB 1VQAA 2ATWA 1J6QA 1RKNA 1GXDC 4NKLA 4BBSB 3GTKB 1XMOL 5D65A 5KNCA 2VS1A 4DNTB 4A3MG 1YIJA 2D0OA 5C4XB 4K0KQ 3ITPA 5I4DA 1IKLA 1B70B 2KECA 2WKCA 1QZHA 1NAPA 3LNNA 3D3RA 3PSIA 4Q5VA 4NDXA 1WCMH 3LX0A 5M5WH 4A3IG 1YJNA 1OXTA 1CM9A 5IGBA 5CV4A 2K32A 4OEMB 3GQBA 1SSOA 4HCSA 4IOAA 2RKSA 1VQKA 4A3BH 5KGUA 1DOMA 2DUDA 2JK8A 5IGCA 3K0YA 4FP5D 4QL5A 2O4XA 2RQXA 3BS1A 1DJRD 1EIGA 2V4DA 2ZXOA 3MA2B 4ULLA 3DWPA 1PZKD 3F2UA 4GLAC 2SNSA 1GUNA 4GLVB 2ENBA 2MPMA 2IJ0A 3M3YH 4N9PA 3EN2A 1RIPA 3L9AX 3CPFA 2EY6A 2XIWA 5D3IB 1LV9A 4DUZL 1EY5A 4JI8Q 2M00A 4WJ4A 3R8BA 1DZ1A 3R93A 1X9NA 1LT6D 3CCMA 3IFTA 2CKZB 3PF5A 1EY7A 2XRQD 3BDLA 4J15A 2YTXA 2Z4IA 3MAQA 3VYUA 3PUYA 4RA8A 1YNXA 5C5LA 2K6AA 3E9IA 4JI2L 2JA8G 1TS2A 2EYHA 1HPCA 5J39A 3HRZC 1KRTA 3MHBA 2A68D 1Q86C 5IP9G 2IHFA 3GTOH 2KEEA 4KY6A 3TDQA 2F0DA 5FLMH 2AQ1B 2JEAI 4MIUA 5IWAQ 2AQ3B 2ZJRA 5K36G 3GO5A 3JC66 3PO3G 4OIKA 1S5CD 4DK3C 4OGQC 1SYEA 1IBKL 2DNEA 1BCPC 1PH8A 1VQNA 1VQ7A 1XPUA 2QDLA 4OO1I 1SJHD 2MFIA 3HOUB 1PH6A 3CCQA 2NTSA 1QB5D 2AUKA 4KY7A 4XTCS 4A3FH 1JJCB 4PZ6A 1H9RA 1XMQQ 3VYSA 4R4QA 1E24A 2MGSA 3SK8A 3TREA 4OL7A 3TZUA 3CRLC 3I56A 4CKCA 2HDLA 4JW0A 2L1BA 1O78A 3ER0A 4X64L 5CC4A 4JI4Q 1H9MA 1JB7A 1EYCA 1FL0A 4XT1B 4JBWA 1TY2A 4O2DA 4QGUA 1Z7TA 5KYLA 3C3LA 1TT2A 2D0PA 1KDCA 1D6EC 3KYHC 4BBRB 4DGZA 3NTHA 4ODGA 4X3KA 4DV4L 5CV7A 1MSHA 1XX8A 4GN4B 3NTKA 1GKHA 1PFMA 1TWFB 1F2ZA 1I6VC 4KLKA 1TY0A 4GN5A 4RG1A 4JI5Q 3I4NB 3PCOB 2JA6H 1I94Q 1JWMD 3ICEA 3LGJA 4KD4A 3NWTA 2PW7A 5IT9c 2F3IA 3CQZB 5J3BA 3S1MH 2EDGA 4A4IA 3TS0A 1TKWB 2B29A 2Z8LA 5BN4A 3BZKA 1BCPF 3LWUA 1Q12A 4PV1C 4GKJQ 2L12A 5A35A 3HOVB 2E2IH 3H3VH 1Y1VB 3ND9A 1A6XA 2JA8H 3G6EA 2NVTB 1EQRA 4GS3A 2F0IA 1BUVT 4AYBB 1LTRD 1SE2A 4P75A 2R93G 1DOKA 5IP9H 2ZJPA 1WTOA 4LF9Q 2BH2A 2JA7B 1TWCB 4NXNL 5JJZA 1EL0A 4IUTA 2ZM6L 4QUFA 3F2DA 1C0AA 2AQ2B
chains in the Genus database with same CATH topology
2VNUD 5LMUQ 1VQIA 4KHPL 2PQAA 2C35B 2MO1A 4DV5Q 4GNXC 1PH3A 1K8GA 3GTLH 4DR4L 2VL6A 2JEBI 3CCUA 2E5LL 4Y52H 1VQFA 2E2JH 1K3RA 2K5VA 3PO2G 2BA0A 1W3SA 4QIWE 5AJ3L 1IBLL 2KCTA 4B3ML 1YZ6A 4A93H 2VUMH 2R92H 2IT1A 2XTIA 4LF7Q 3UDFA 2PNHA 1NY4A 4JI6L 1PH4A 4HIDA 2RCNA 2NVXH 3NENA 3UDXA 1IYJB 2DGYA 4LUVA 3U4ZA 4LF8Q 1TXYA 4KI0A 4GKKQ 4X65L 3I4MH 1J5EL 5C3EH 3S1NH 4YCWA 4JI8L 4DV0L 2R7ZG 3K81C 1EWIA 3T1YL 4JI3Q 3HOWG 3S15H 3AFPA 4B3RL 2MQHA 2LXKA 2YV5A 3J7ZC 1D8LA 1PYBA 4TVAB 1MJEA 2HIVA 2WFWA 4DKAC 4NPSA 3CMAA 2F4VL 1XPOA 3L2PA 1VQDA 1BBUA 3K7UC 4HIOA 1Y1WG 4BXXH 4DV7Q 3FKIG 4KHZA 3M4OH 2UXBL 1N36L 4NB3A 3STBD 4JI7L 4RMFA 1E22A 1KIXA 2BH8A 3J81c 4IO9A 4A3KH 3ERSX 3G48A 1ASZA 1AH9A 3CPWA 1Q1BA 2VUMG 4X6AH 2R92G 4MNOA 2EIFA 4YWMA 1CKNB 1XMOQ 1YBYA 3PGZA 4JOIC 4JV5L 1HR0L 2F52A 3KF6A 4OONA 3S2HH 5C0XJ 2WAQG 3PUZA 5M5XH 2OTJA 4LFAL 3I4MG 2WAQE 1U0LA 5C3EG 4X62L 2H5XA 2I5LX 2Z6KA 2CCZA 1HNWL 3KF8B 1K83H 4X66L 1N8RC 4DR6L 2Y0SG 1SFOH 3NBHB 4PG3A 2B63G 5IYDH 3AYHB 4AH6A 2Y0SE 4LUZA 5BR8L 4JI0L 1IXRA 4NXML 4BXXG 1S72A 3BJUA 1ASYA 5JEAG 1Q82C 4A3JH 4DV3L 1HZBA 5IWAL 2YU9H 1G291 2NVQH 4AQYL 2N78A 2OWOA 2RHQB 2LSSA 4YCVA 4JI1Q 1FJGQ 3M7NA 4A3DG 1UE7A 5M3FH 4YHHQ 1KXLA 1NE3A 1EUJA 1OXSC 1RL2A 2ZTEA 1SN8A 5FLXc 4Y7NH 3G71A 3F2BA 2ZJQA 1NJIC 2R7DA 1GM5A 4YWKA 3GTMH 5M5YH 1CKOA 1PYSB 2AWOA 2NN6I 3EBEA 5H1SE 1SMXA 3J81i 4H02A 1KL9A 2QEXA 4MZ9A 3D0FA 2VQEQ 1FVIA 3UDIA 5C4XH 3PUVA 1KD1C 2GN5A 1VQ8A 5IYDG 5M3MG 3T1HL 1JT8A 4O0AA 3TEHB 1EOVA 3RLFA 1XMQL 1XNRL 3U4VA 1GO3E 2WB1E 4HJ5A 1IZ6A 1K0RA 3W5OA 1NMFA 3MEFA 4YY3Q 3PIOA 2HHHL 4OWWB 3HOYG 4A3JG 1V43A 4GNXA 3RN2A 2E8GA 2RHSB 3H0GG 1UE5A 1LUZA 3A5ZB 3NEMA 4C2MH 5C4JH 2K75A 5GROA 4DUZQ 4OWTB 5M3FG 3AQQA 3PUXA 2UUCQ 4JI4L 1AE3A 3F1ZA 4C3JH 1PV4A 3I7FA 4QJFA 4IPGA 3L0OA 4DR5L 3A0JA 1A62A 2L15A 3E9HA 4UY8C 4R4TA 4BBSG 4GOPC 3PO2H 4LF6Q 4XIGS 1SE8A 3G4SA 1E7ZA 3ZJYC 4A75A 2CFMA 1M90C 4R1JA 2IX0A 2NZOA 4HJ8A 1VQ9A 5ELOA 4DR3L 3S14H 5C4XG 3KFUA 1OXUA 2K5HA 2KHIA 3GTGH 1SLJA 1CUKA 2E5LQ 4ME3A 2ALYB 1C7YA 4OX9L 2E2HH 1B8AA 1PH9A 4JI5L 1G51A 3KDFA 2UXCQ 4L5TA 5AJ3Q 1YI2A 1HZCA 1I94L 5DLQE 2ZTDA 2ZTCA 4DPGA 2UU9Q 3CC2A 4BA2I 4JI2Q 1XNQL 1MJCA 4A3CG 3GTJH 2MO0A 2CWAA 2ASBA 2K52A 4JBMA 3S16H 3W1GA 3M9BA 1V9PA 4UP9A 1Q7YC 1HNXQ 1Y1WH 2D62A 3FKIH 3JAMc 1KC8C 1VQPA 4X65Q 3J80c 4IFDI 2PMZE 2K14A 4LFCQ 1I3QH 3BU2A 3HOXH 3OTOQ 5GAHC 4MTNA 1QUQA 4JOIA 4DV0Q 1EIYB 4R4CA 2OQKA 4B3TL 4A3BG 4WJ3M 1CSQA 4OXPA 2AMCB 4P72A 1KHIA 4C3IH 4GKJL 2UUAL 1S40A 2AWNA 3KOJA 1PA6A 4A3GH 4A3LH 4LFBL 1N32L 5GAEC 1VQ5A 2RF4A 4PZ8A 2HT1A 4P71A 1GVPA 2I0QA 2UUBL 1YVCA 2JA5H 4DUYL 3TS2A 3FP9A 4DV1Q 3A74A 1U5KA 2Z0SA 2KHJA 2VQFQ 1VQOA 1Q81C 1IBKQ 1N33L 4JYAQ 3WWVA 1L1OB 3BZCA 1EQQA 3S17H 4APVA 1HZAA 3UE0A 4DR7Q 3CCSA 2VY3A 4LW1A 1HNZQ 2N49A 1CSPA 4HJ7A 2B63H 4JV5Q 2AHOB 2A1AA 5LMNL 4LF9L 3H3VI 4IOCA 1X54A 3UE1A 4C3HH 1N34L 4LF5L 1TWHH 3CAMA 3PF4A 2HQLA 3HOXG 5ELNA 3RLOA 5JJKA 2FXQA 5GADC 1YHBA 4DV2Q 1D7QA 2JJQA 5FJ8G 1P8LA 1VQHA 4A3DH 4DV5L 1KRSA 4BY1H 2CQOA 3F2CA 4OO1G 4A3GG 1E1TA 2R6GA 4A3LG 2PQAB 1X3FA 1E3PA 3JAMi 5IY0A 4HIKA 1WFQA 1EYGA 3J80i 4X64Q 1WI5A 3J7A5 2JA5G 1CKMA 3CP0A 4LF7L 4DR2Q 2K5NA 1YHAA 1SRUA 1Y14B 4B3SQ 2KCMA 1VQEA 4A3MH 3S1QH 3GTQH 2UXDQ 2IY5B 5M3MH 3A5UA 4DV4Q 4GKKL 2MNAA 1QVCA 1PHJA 1X65A 3ULPA 4POFA 4EQ5A 3H15A 3HOUH 3HOYH 4JI3L 3ULLA 5IYBG 1TWGH 3H0GH 1UEBA 3CCJA 2OQ0A 4OWXB 1A8VA 4A3IH 1V1QA 4BY1G 4QQBX 2N3SA 4DV7L 4GOPA 4LUOA 1PH1A 2IHEA 1HJPA 2B3GA 1LM0A 1G6PA 3J81j 4LF4Q 2PI2A 1A63A 4DV6L 5FLMG 1VQAA 2ATWA 5LMNW 3CC7A 4BBSH 1J6QA 3AFQA 4DK6C 3GTKH 1QVGA 3PV0A 3RR5A 1XMOL 2A19A 2K50A 2IX1A 3OYYA 1XPRA 2VS1A 4A3MG 1YIJA 1S3OA 4PZ7A 2D0OA 4POGA 1JJ2A 3TRZA 4K0KQ 2OCEA 3CCLA 3KF6B 4LNQA 1PVOA 4BBRH 2GVBA 2HIXA 1B70B 3HOUG 2EXDA 1QZHA 1HR0W 3PSIA 2Q2TA 4PMWA 3F8TA 1QZGA 4QY7A 4A3CH 4UPAA 1TWFH 1WCMH 5M5WH 4A3IG 2OTLA 1YJNA 2Q2IA 1L0WA 1OXTA 3CW2C 2QA4A 2QGQA 1UWVA 4JI1L 5IYCH 1FJGL 2VZAA 4IOAA 1VQKA 4A3BH 1KQSA 4NXNQ 2DUDA 2I5MX 2K4KA 2JK8A 2ZM6Q 3CQZH 2Z6KC 3D31A 3RZOH 4QL5A 4KHPQ 4DR4Q 2KENA 1X3GA 1VQ4A 3Q8DA 2ID0A 3RN5A 4BBRG 2VQEL 1K8AC 3GTPH 1O7IA 1IBLQ 4GLAC 1E1OA 4B3MQ 1PH2A 3DLLA 1LTLA 3AEVA 1TWAH 2EQSA 4LWCA 3U50C 1WCMG 4DR1L 4JI6Q 4GLVB 1Y1VH 2GVAA 4YWLA 1DGSA 4YY3L 5C0XG 1Q46A 3M3YH 3I4NG 3EN2A 1RIPA 4DAYB 4BY7G 3CPFA 2I5HA 4P73A 2NVTH 5IYCG 4DUZL 3S1RH 1J5EQ 3K7AH 4IJHA 4JI8Q 4GNXB 5GAGC 2UUCL 5FJ8H 3T1YQ 1L2FA 4WJ4A 2VW9A 3IRBA 2YTYA 1PH5A 4B3RQ 2LXJA 5IE8A 1IBML 4IPCA 2AKWB 5LMNQ 3M4PA 1AE2A 1X9NA 1TWCH 2JE6I 2F4VQ 3CCMA 2JA7H 3STBC 2CKZB 4LF6L 2UXBQ 4UP8A 1N36Q 2WP8J 1LYLA 1VQBA 1OXVA 3PF5A 4JI7Q 4HJAA 4J15A 1CKNA 2YTXA 1VQCA 1QVFA 2Q2UA 4JBKA 3PO3H 1I5FA 3TQYA 3HOVG 5GQOA 3S2DH 2UXCL 1Y1VG 3PUYA 3CC4A 4ALPA 1HR0Q 1EFWA 1YNXA 1I6HH 2UU9L 3E9IA 4DAMA 4JI2L 2JA8G 1VQGA 3KDFB 2JA9A 4LFAQ 1HH2P 5IYBH 4AYBG 4X62Q 1C9OA 1KRTA 1HNWQ 5LMUL 1M1KC 1HNXL 3HOZG 4AYBE 4X66Q 1L1OC 1IL2A 5HGQA 5IP7G 4DR6Q 1NBWA 1Q86C 4LFCL 5IP9G 2IHFA 1A0IA 5BR8Q 4JI0Q 3OTOL 4NXMQ 2JA7G 3CCEA 3GTOH 4A3EH 3RZDH 5FLMH 3KJPA 3RNUA 2JEAI 4DV3Q 5IWAQ 1P16A 1MIUA 2ZJRA 1QUQB 4P74A 3GO5A 4AQYQ 1K9MC 3JC66 5HY6A 1W2BA 5K36G 5JJIA 3PO3G 5C44H 1FGUA 3VDYA 4DK3C 2KBNA 4IFDJ 1PH7A 1JE5A 4LF8L 1VS0A 4DV1L 1IBKL 2YTVA 2VQFL 4JYAL 4A93G 4DV6Q 1PH8A 1GD7A 1OXXK 1VQNA 1VQ7A 3CCVA 1YJWA 3I4OA 2ES2A 1XPUA 4DR7L 4JG2A 4DNIA 4OO1I 1WYDA 1X6OA 2MFIA 1HNZL 2XGTA 1PH6A 5JJLA 3CCQA 4R4IA 1Q1EA 2YYZA 3S24A 1UE6A 4L5RC 4XTCS 4BA1I 1KAWA 1X3EA 1JJCB 4PZ6A 1MKHA 3T1HQ 4A3FH 3B6YA 1XMQQ 4R4QA 1E24A 1XNRQ 3CD6A 2HHHQ 4DV2L 2NN6G 4A3EG 3U58A 3TREA 1XJVA 4L5SA 3ULJA 4YCUA 4IPDA 3I56A 2CWPA 4JCVE 1EIFA 1Q8KA 1WOCA 3KLWA 3HFZB 5C44G 1N9WA 3ER0A 3W1BA 4X64L 1JMCA 4JI4Q 1JB7A 3GDEA 3CXCA 1FL0A 1YHQA 4JBWA 3DM3A 4O2DA 1SROA 4DR5Q 1NTGA 2R7FA 4QGUA 3OW2A 4A3KG 1T9HA 2D0PA 3K8AA 4AIMA 3PUWA 4DR2L 3I55A 1PFSA 4B3SL 3KYHC 4R4OA 3KJOA 2UXDL 1VQJA 2V1CC 4DV4L 3HKSA 4TQUS 5EAYA 4UP7A 1Z47A 2NVYH 4DR3Q 4GN4B 1K73C 1GKHA 1YEZA 4A3FG 3FHWA 3I4NH 4OX9Q 4KLKA 4GN5A 4BY7H 1WJJA 3I2ZA 3MXNB 4RG1A 4JI5Q 3K80C 3PCOB 3PIPA 2JA6H 1X56A 1I94Q 1X55A 3RLNA 4YHHL 3EIVA 4HJ9A 1YITA 1XNQQ 3LGJA 3ICEA 2WB1G 4GLXA 2BA1A 4DR1Q 2NZHA 3E0EA 5IT9c 4LF4L 2R93H 2F3IA 4GOPB 5J3BA 2JQOA 3S1MH 4A4IA 3TS0A 2B29A 3K0XA 1H95A 3M4QA 4HIMA 4JC0A 1BVSA 1BKBA 3BZKA 4B3TQ 3CMEA 1Q12A 4GKJQ 2UUAQ 1OTCA 4A76A 3NELA 4EX5A 1R9TH 1BBWA 1IBMQ 3HOVH 4LFBQ 4K0KL 2Q2HA 1N32Q 1JJGA 2N8NA 4JBJA 1VQ6A 5E7NA 4L5QA 2E2IH 3H3VH 2UUBQ 1VQLA 1L1OA 3L7ZC 3UDGA 2A8VA 4DUYQ 2JA8H 1HZ9A 4IJLA 5JEAJ 3G6EA 1N33Q 2JA6G 4IFDG 1Z9FA 3CCRA 4FDBA 1EQRA 4GS3A 3HKZG 3HOZH 3SGIA 1NMGA 5IP7H 1VQMA 3GD7A 3HKZE 4P75A 1YJ9A 2R93G 1XTDA 5IP9H 2ZJPA 4LF9Q 1B7YB 4IPHA 1VCIA 2BH2A 3M85A 1N34Q 4LF5Q 2R7ZH 4NXNL 3CF5A 3HOWH 2PI2E 2ZM6L 3F2DA 1I50H 4GN3B 1UE1A 1C0AA 1SR3A 5C0XI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VNU D;  5LMU Q;  1VQI A;  4KHP L;  2PQA A;  2C35 B;  2MO1 A;  4DV5 Q;  4GNX C;  1PH3 A;  1K8G A;  3GTL H;  4DR4 L;  2VL6 A;  2JEB I;  3CCU A;  2E5L L;  4Y52 H;  1VQF A;  2E2J H;  1K3R A;  2K5V A;  3PO2 G;  2BA0 A;  1W3S A;  4QIW E;  5AJ3 L;  1IBL L;  2KCT A;  4B3M L;  1YZ6 A;  4A93 H;  2VUM H;  2R92 H;  2IT1 A;  2XTI A;  4LF7 Q;  3UDF A;  2PNH A;  1NY4 A;  4JI6 L;  1PH4 A;  4HID A;  2RCN A;  2NVX H;  3NEN A;  3UDX A;  1IYJ B;  2DGY A;  4LUV A;  3U4Z A;  4LF8 Q;  1TXY A;  4KI0 A;  4GKK Q;  4X65 L;  3I4M H;  1J5E L;  5C3E H;  3S1N H;  4YCW A;  4JI8 L;  4DV0 L;  2R7Z G;  3K81 C;  1EWI A;  3T1Y L;  4JI3 Q;  3HOW G;  3S15 H;  3AFP A;  4B3R L;  2MQH A;  2LXK A;  2YV5 A;  3J7Z C;  1D8L A;  1PYB A;  4TVA B;  1MJE A;  2HIV A;  2WFW A;  4DKA C;  4NPS A;  3CMA A;  2F4V L;  1XPO A;  3L2P A;  1VQD A;  1BBU A;  3K7U C;  4HIO A;  1Y1W G;  4BXX H;  4DV7 Q;  3FKI G;  4KHZ A;  3M4O H;  2UXB L;  1N36 L;  4NB3 A;  3STB D;  4JI7 L;  4RMF A;  1E22 A;  1KIX A;  2BH8 A;  3J81 c;  4IO9 A;  4A3K H;  3ERS X;  3G48 A;  1ASZ A;  1AH9 A;  3CPW A;  1Q1B A;  2VUM G;  4X6A H;  2R92 G;  4MNO A;  2EIF A;  4YWM A;  1CKN B;  1XMO Q;  1YBY A;  3PGZ A;  4JOI C;  4JV5 L;  1HR0 L;  2F52 A;  3KF6 A;  4OON A;  3S2H H;  5C0X J;  2WAQ G;  3PUZ A;  5M5X H;  2OTJ A;  4LFA L;  3I4M G;  2WAQ E;  1U0L A;  5C3E G;  4X62 L;  2H5X A;  2I5L X;  2Z6K A;  2CCZ A;  1HNW L;  3KF8 B;  1K83 H;  4X66 L;  1N8R C;  4DR6 L;  2Y0S G;  1SFO H;  3NBH B;  4PG3 A;  2B63 G;  5IYD H;  3AYH B;  4AH6 A;  2Y0S E;  4LUZ A;  5BR8 L;  4JI0 L;  1IXR A;  4NXM L;  4BXX G;  1S72 A;  3BJU A;  1ASY A;  5JEA G;  1Q82 C;  4A3J H;  4DV3 L;  1HZB A;  5IWA L;  2YU9 H;  1G29 1;  2NVQ H;  4AQY L;  2N78 A;  2OWO A;  2RHQ B;  2LSS A;  4YCV A;  4JI1 Q;  1FJG Q;  3M7N A;  4A3D G;  1UE7 A;  5M3F H;  4YHH Q;  1KXL A;  1NE3 A;  1EUJ A;  1OXS C;  1RL2 A;  2ZTE A;  1SN8 A;  5FLX c;  4Y7N H;  3G71 A;  3F2B A;  2ZJQ A;  1NJI C;  2R7D A;  1GM5 A;  4YWK A;  3GTM H;  5M5Y H;  1CKO A;  1PYS B;  2AWO A;  2NN6 I;  3EBE A;  5H1S E;  1SMX A;  3J81 i;  4H02 A;  1KL9 A;  2QEX A;  4MZ9 A;  3D0F A;  2VQE Q;  1FVI A;  3UDI A;  5C4X H;  3PUV A;  1KD1 C;  2GN5 A;  1VQ8 A;  5IYD G;  5M3M G;  3T1H L;  1JT8 A;  4O0A A;  3TEH B;  1EOV A;  3RLF A;  1XMQ L;  1XNR L;  3U4V A;  1GO3 E;  2WB1 E;  4HJ5 A;  1IZ6 A;  1K0R A;  3W5O A;  1NMF A;  3MEF A;  4YY3 Q;  3PIO A;  2HHH L;  4OWW B;  3HOY G;  4A3J G;  1V43 A;  4GNX A;  3RN2 A;  2E8G A;  2RHS B;  3H0G G;  1UE5 A;  1LUZ A;  3A5Z B;  3NEM A;  4C2M H;  5C4J H;  2K75 A;  5GRO A;  4DUZ Q;  4OWT B;  5M3F G;  3AQQ A;  3PUX A;  2UUC Q;  4JI4 L;  1AE3 A;  3F1Z A;  4C3J H;  1PV4 A;  3I7F A;  4QJF A;  4IPG A;  3L0O A;  4DR5 L;  3A0J A;  1A62 A;  2L15 A;  3E9H A;  4UY8 C;  4R4T A;  4BBS G;  4GOP C;  3PO2 H;  4LF6 Q;  4XIG S;  1SE8 A;  3G4S A;  1E7Z A;  3ZJY C;  4A75 A;  2CFM A;  1M90 C;  4R1J A;  2IX0 A;  2NZO A;  4HJ8 A;  1VQ9 A;  5ELO A;  4DR3 L;  3S14 H;  5C4X G;  3KFU A;  1OXU A;  2K5H A;  2KHI A;  3GTG H;  1SLJ A;  1CUK A;  2E5L Q;  4ME3 A;  2ALY B;  1C7Y A;  4OX9 L;  2E2H H;  1B8A A;  1PH9 A;  4JI5 L;  1G51 A;  3KDF A;  2UXC Q;  4L5T A;  5AJ3 Q;  1YI2 A;  1HZC A;  1I94 L;  5DLQ E;  2ZTD A;  2ZTC A;  4DPG A;  2UU9 Q;  3CC2 A;  4BA2 I;  4JI2 Q;  1XNQ L;  1MJC A;  4A3C G;  3GTJ H;  2MO0 A;  2CWA A;  2ASB A;  2K52 A;  4JBM A;  3S16 H;  3W1G A;  3M9B A;  1V9P A;  4UP9 A;  1Q7Y C;  1HNX Q;  1Y1W H;  2D62 A;  3FKI H;  3JAM c;  1KC8 C;  1VQP A;  4X65 Q;  3J80 c;  4IFD I;  2PMZ E;  2K14 A;  4LFC Q;  1I3Q H;  3BU2 A;  3HOX H;  3OTO Q;  5GAH C;  4MTN A;  1QUQ A;  4JOI A;  4DV0 Q;  1EIY B;  4R4C A;  2OQK A;  4B3T L;  4A3B G;  4WJ3 M;  1CSQ A;  4OXP A;  2AMC B;  4P72 A;  1KHI A;  4C3I H;  4GKJ L;  2UUA L;  1S40 A;  2AWN A;  3KOJ A;  1PA6 A;  4A3G H;  4A3L H;  4LFB L;  1N32 L;  5GAE C;  1VQ5 A;  2RF4 A;  4PZ8 A;  2HT1 A;  4P71 A;  1GVP A;  2I0Q A;  2UUB L;  1YVC A;  2JA5 H;  4DUY L;  3TS2 A;  3FP9 A;  4DV1 Q;  3A74 A;  1U5K A;  2Z0S A;  2KHJ A;  2VQF Q;  1VQO A;  1Q81 C;  1IBK Q;  1N33 L;  4JYA Q;  3WWV A;  1L1O B;  3BZC A;  1EQQ A;  3S17 H;  4APV A;  1HZA A;  3UE0 A;  4DR7 Q;  3CCS A;  2VY3 A;  4LW1 A;  1HNZ Q;  2N49 A;  1CSP A;  4HJ7 A;  2B63 H;  4JV5 Q;  2AHO B;  2A1A A;  5LMN L;  4LF9 L;  3H3V I;  4IOC A;  1X54 A;  3UE1 A;  4C3H H;  1N34 L;  4LF5 L;  1TWH H;  3CAM A;  3PF4 A;  2HQL A;  3HOX G;  5ELN A;  3RLO A;  5JJK A;  2FXQ A;  5GAD C;  1YHB A;  4DV2 Q;  1D7Q A;  2JJQ A;  5FJ8 G;  1P8L A;  1VQH A;  4A3D H;  4DV5 L;  1KRS A;  4BY1 H;  2CQO A;  3F2C A;  4OO1 G;  4A3G G;  1E1T A;  2R6G A;  4A3L G;  2PQA B;  1X3F A;  1E3P A;  3JAM i;  5IY0 A;  4HIK A;  1WFQ A;  1EYG A;  3J80 i;  4X64 Q;  1WI5 A;  3J7A 5;  2JA5 G;  1CKM A;  3CP0 A;  4LF7 L;  4DR2 Q;  2K5N A;  1YHA A;  1SRU A;  1Y14 B;  4B3S Q;  2KCM A;  1VQE A;  4A3M H;  3S1Q H;  3GTQ H;  2UXD Q;  2IY5 B;  5M3M H;  3A5U A;  4DV4 Q;  4GKK L;  2MNA A;  1QVC A;  1PHJ A;  1X65 A;  3ULP A;  4POF A;  4EQ5 A;  3H15 A;  3HOU H;  3HOY H;  4JI3 L;  3ULL A;  5IYB G;  1TWG H;  3H0G H;  1UEB A;  3CCJ A;  2OQ0 A;  4OWX B;  1A8V A;  4A3I H;  1V1Q A;  4BY1 G;  4QQB X;  2N3S A;  4DV7 L;  4GOP A;  4LUO A;  1PH1 A;  2IHE A;  1HJP A;  2B3G A;  1LM0 A;  1G6P A;  3J81 j;  4LF4 Q;  2PI2 A;  1A63 A;  4DV6 L;  5FLM G;  1VQA A;  2ATW A;  5LMN W;  3CC7 A;  4BBS H;  1J6Q A;  3AFQ A;  4DK6 C;  3GTK H;  1QVG A;  3PV0 A;  3RR5 A;  1XMO L;  2A19 A;  2K50 A;  2IX1 A;  3OYY A;  1XPR A;  2VS1 A;  4A3M G;  1YIJ A;  1S3O A;  4PZ7 A;  2D0O A;  4POG A;  1JJ2 A;  3TRZ A;  4K0K Q;  2OCE A;  3CCL A;  3KF6 B;  4LNQ A;  1PVO A;  4BBR H;  2GVB A;  2HIX A;  1B70 B;  3HOU G;  2EXD A;  1QZH A;  1HR0 W;  3PSI A;  2Q2T A;  4PMW A;  3F8T A;  1QZG A;  4QY7 A;  4A3C H;  4UPA A;  1TWF H;  1WCM H;  5M5W H;  4A3I G;  2OTL A;  1YJN A;  2Q2I A;  1L0W A;  1OXT A;  3CW2 C;  2QA4 A;  2QGQ A;  1UWV A;  4JI1 L;  5IYC H;  1FJG L;  2VZA A;  4IOA A;  1VQK A;  4A3B H;  1KQS A;  4NXN Q;  2DUD A;  2I5M X;  2K4K A;  2JK8 A;  2ZM6 Q;  3CQZ H;  2Z6K C;  3D31 A;  3RZO H;  4QL5 A;  4KHP Q;  4DR4 Q;  2KEN A;  1X3G A;  1VQ4 A;  3Q8D A;  2ID0 A;  3RN5 A;  4BBR G;  2VQE L;  1K8A C;  3GTP H;  1O7I A;  1IBL Q;  4GLA C;  1E1O A;  4B3M Q;  1PH2 A;  3DLL A;  1LTL A;  3AEV A;  1TWA H;  2EQS A;  4LWC A;  3U50 C;  1WCM G;  4DR1 L;  4JI6 Q;  4GLV B;  1Y1V H;  2GVA A;  4YWL A;  1DGS A;  4YY3 L;  5C0X G;  1Q46 A;  3M3Y H;  3I4N G;  3EN2 A;  1RIP A;  4DAY B;  4BY7 G;  3CPF A;  2I5H A;  4P73 A;  2NVT H;  5IYC G;  4DUZ L;  3S1R H;  1J5E Q;  3K7A H;  4IJH A;  4JI8 Q;  4GNX B;  5GAG C;  2UUC L;  5FJ8 H;  3T1Y Q;  1L2F A;  4WJ4 A;  2VW9 A;  3IRB A;  2YTY A;  1PH5 A;  4B3R Q;  2LXJ A;  5IE8 A;  1IBM L;  4IPC A;  2AKW B;  5LMN Q;  3M4P A;  1AE2 A;  1X9N A;  1TWC H;  2JE6 I;  2F4V Q;  3CCM A;  2JA7 H;  3STB C;  2CKZ B;  4LF6 L;  2UXB Q;  4UP8 A;  1N36 Q;  2WP8 J;  1LYL A;  1VQB A;  1OXV A;  3PF5 A;  4JI7 Q;  4HJA A;  4J15 A;  1CKN A;  2YTX A;  1VQC A;  1QVF A;  2Q2U A;  4JBK A;  3PO3 H;  1I5F A;  3TQY A;  3HOV G;  5GQO A;  3S2D H;  2UXC L;  1Y1V G;  3PUY A;  3CC4 A;  4ALP A;  1HR0 Q;  1EFW A;  1YNX A;  1I6H H;  2UU9 L;  3E9I A;  4DAM A;  4JI2 L;  2JA8 G;  1VQG A;  3KDF B;  2JA9 A;  4LFA Q;  1HH2 P;  5IYB H;  4AYB G;  4X62 Q;  1C9O A;  1KRT A;  1HNW Q;  5LMU L;  1M1K C;  1HNX L;  3HOZ G;  4AYB E;  4X66 Q;  1L1O C;  1IL2 A;  5HGQ A;  5IP7 G;  4DR6 Q;  1NBW A;  1Q86 C;  4LFC L;  5IP9 G;  2IHF A;  1A0I A;  5BR8 Q;  4JI0 Q;  3OTO L;  4NXM Q;  2JA7 G;  3CCE A;  3GTO H;  4A3E H;  3RZD H;  5FLM H;  3KJP A;  3RNU A;  2JEA I;  4DV3 Q;  5IWA Q;  1P16 A;  1MIU A;  2ZJR A;  1QUQ B;  4P74 A;  3GO5 A;  4AQY Q;  1K9M C;  3JC6 6;  5HY6 A;  1W2B A;  5K36 G;  5JJI A;  3PO3 G;  5C44 H;  1FGU A;  3VDY A;  4DK3 C;  2KBN A;  4IFD J;  1PH7 A;  1JE5 A;  4LF8 L;  1VS0 A;  4DV1 L;  1IBK L;  2YTV A;  2VQF L;  4JYA L;  4A93 G;  4DV6 Q;  1PH8 A;  1GD7 A;  1OXX K;  1VQN A;  1VQ7 A;  3CCV A;  1YJW A;  3I4O A;  2ES2 A;  1XPU A;  4DR7 L;  4JG2 A;  4DNI A;  4OO1 I;  1WYD A;  1X6O A;  2MFI A;  1HNZ L;  2XGT A;  1PH6 A;  5JJL A;  3CCQ A;  4R4I A;  1Q1E A;  2YYZ A;  3S24 A;  1UE6 A;  4L5R C;  4XTC S;  4BA1 I;  1KAW A;  1X3E A;  1JJC B;  4PZ6 A;  1MKH A;  3T1H Q;  4A3F H;  3B6Y A;  1XMQ Q;  4R4Q A;  1E24 A;  1XNR Q;  3CD6 A;  2HHH Q;  4DV2 L;  2NN6 G;  4A3E G;  3U58 A;  3TRE A;  1XJV A;  4L5S A;  3ULJ A;  4YCU A;  4IPD A;  3I56 A;  2CWP A;  4JCV E;  1EIF A;  1Q8K A;  1WOC A;  3KLW A;  3HFZ B;  5C44 G;  1N9W A;  3ER0 A;  3W1B A;  4X64 L;  1JMC A;  4JI4 Q;  1JB7 A;  3GDE A;  3CXC A;  1FL0 A;  1YHQ A;  4JBW A;  3DM3 A;  4O2D A;  1SRO A;  4DR5 Q;  1NTG A;  2R7F A;  4QGU A;  3OW2 A;  4A3K G;  1T9H A;  2D0P A;  3K8A A;  4AIM A;  3PUW A;  4DR2 L;  3I55 A;  1PFS A;  4B3S L;  3KYH C;  4R4O A;  3KJO A;  2UXD L;  1VQJ A;  2V1C C;  4DV4 L;  3HKS A;  4TQU S;  5EAY A;  4UP7 A;  1Z47 A;  2NVY H;  4DR3 Q;  4GN4 B;  1K73 C;  1GKH A;  1YEZ A;  4A3F G;  3FHW A;  3I4N H;  4OX9 Q;  4KLK A;  4GN5 A;  4BY7 H;  1WJJ A;  3I2Z A;  3MXN B;  4RG1 A;  4JI5 Q;  3K80 C;  3PCO B;  3PIP A;  2JA6 H;  1X56 A;  1I94 Q;  1X55 A;  3RLN A;  4YHH L;  3EIV A;  4HJ9 A;  1YIT A;  1XNQ Q;  3LGJ A;  3ICE A;  2WB1 G;  4GLX A;  2BA1 A;  4DR1 Q;  2NZH A;  3E0E A;  5IT9 c;  4LF4 L;  2R93 H;  2F3I A;  4GOP B;  5J3B A;  2JQO A;  3S1M H;  4A4I A;  3TS0 A;  2B29 A;  3K0X A;  1H95 A;  3M4Q A;  4HIM A;  4JC0 A;  1BVS A;  1BKB A;  3BZK A;  4B3T Q;  3CME A;  1Q12 A;  4GKJ Q;  2UUA Q;  1OTC A;  4A76 A;  3NEL A;  4EX5 A;  1R9T H;  1BBW A;  1IBM Q;  3HOV H;  4LFB Q;  4K0K L;  2Q2H A;  1N32 Q;  1JJG A;  2N8N A;  4JBJ A;  1VQ6 A;  5E7N A;  4L5Q A;  2E2I H;  3H3V H;  2UUB Q;  1VQL A;  1L1O A;  3L7Z C;  3UDG A;  2A8V A;  4DUY Q;  2JA8 H;  1HZ9 A;  4IJL A;  5JEA J;  3G6E A;  1N33 Q;  2JA6 G;  4IFD G;  1Z9F A;  3CCR A;  4FDB A;  1EQR A;  4GS3 A;  3HKZ G;  3HOZ H;  3SGI A;  1NMG A;  5IP7 H;  1VQM A;  3GD7 A;  3HKZ E;  4P75 A;  1YJ9 A;  2R93 G;  1XTD A;  5IP9 H;  2ZJP A;  4LF9 Q;  1B7Y B;  4IPH A;  1VCI A;  2BH2 A;  3M85 A;  1N34 Q;  4LF5 Q;  2R7Z H;  4NXN L;  3CF5 A;  3HOW H;  2PI2 E;  2ZM6 L;  3F2D A;  1I50 H;  4GN3 B;  1UE1 A;  1C0A A;  1SR3 A;  5C0X I; 
#chains in the Genus database with same CATH topology
 1I50 B;  2PQA A;  1C48 A;  4G4K A;  3FEW X;  2VL6 A;  4K5V A;  3X3M A;  4DK1 A;  5DNF A;  1RCV D;  1G2T A;  1K3R A;  1HUN A;  1IBL L;  1YZ6 A;  2C5C A;  2B2W C;  2R92 H;  2VUM B;  5JPN C;  4DAP A;  1NR2 A;  4JI6 L;  2RCN A;  2NVX H;  3NEN A;  4LUV A;  1SE3 A;  4KI0 A;  3N52 A;  5CYU A;  1YNJ D;  4X65 L;  4TKO B;  1J5E L;  3S1N H;  4YCW A;  2R7Z G;  3K81 C;  3T1Y L;  4JI3 Q;  3D4W A;  1B9M A;  4A3E B;  3S15 H;  2MQH A;  3J7Z C;  2WIN B;  4NPS A;  5ELD A;  3K7U C;  4DV7 Q;  2F0H A;  4CBV A;  3M4O H;  1LT4 D;  2KCN A;  4NB3 A;  3STB D;  1TII D;  3QWN A;  1E22 A;  2QCP X;  3J81 c;  2B2Y C;  4IO9 A;  1ASZ A;  1Q1B A;  4YWM A;  1ET9 A;  3A8K E;  3SE0 A;  1YBY A;  3PGZ A;  4JV5 L;  1AW7 A;  3KF6 A;  1Z6H A;  3PUZ A;  2OTJ A;  1E2V A;  1FGB D;  2H4O A;  5M5X B;  1EQV A;  1CT1 D;  2N88 A;  2CCZ A;  3DEO A;  2QF7 A;  2EXZ A;  2KVM A;  1HHV A;  1V8Q A;  2Y0S G;  1K83 B;  3NBH B;  4M1U B;  3AYH B;  4AH6 A;  1U9R A;  1IXR A;  2WB1 B;  4NXM L;  4BXX G;  4WOR A;  1ASY A;  5JEA G;  1Q82 C;  2CHB D;  4A3J H;  1HZB A;  2LSS A;  1KXL A;  5M3F H;  1NE3 A;  1OXS C;  1RL2 A;  3F2B A;  4ABN A;  3VR3 A;  3A56 A;  3GTM H;  5EJW A;  1SMX A;  1TR5 A;  3J81 i;  1LTT D;  2SNM A;  2NVY B;  5CBA E;  1A2T A;  4TSS A;  2VQE Q;  2BCO A;  4R9W A;  1FVI A;  3UDI A;  5C4X H;  5NUC A;  3PUV A;  1JOR A;  1D5X C;  1KD1 C;  1VQ8 A;  3IAY A;  4LJZ C;  3T1H L;  2K1B A;  2K28 A;  4DAY A;  2FIN B;  1IYU A;  3HKZ B;  1XNR L;  4HJ5 A;  2WB1 E;  2ZT9 C;  1C4Q A;  1GUT A;  1RF2 D;  2PZU A;  4XDX A;  2RHS B;  3NEM A;  1LUZ A;  3A5Z B;  2L11 A;  4RAU C;  3X3N A;  5C4J H;  3PMF A;  3AQQ A;  1SNP A;  1FYC A;  1CZW A;  4HSV A;  2B2W A;  3L0O A;  4DU9 A;  1U4R A;  1CK1 A;  1A62 A;  2L15 A;  2K5W A;  4UY8 C;  4GOP C;  4LF6 Q;  3ZJY C;  1M90 C;  3PO2 B;  4R1J A;  4XXE A;  1GHJ A;  2NZO A;  3FMC A;  1B1Z A;  4X3S A;  3E6Z X;  2F4I A;  4U67 3;  1Y8O B;  1PH9 A;  1DON A;  2C9O A;  2NB0 A;  1XNQ L;  1MJC A;  1WTW A;  2MHV A;  1F2L A;  2K52 A;  4JBM A;  2B2Y A;  1HNX Q;  1YNJ C;  3VR5 A;  3JAM L;  1KC8 C;  4X65 Q;  3J80 c;  1Y69 U;  2PMZ E;  2IX3 A;  3UI2 A;  5KNB A;  3A54 A;  4JPB W;  2NZ1 D;  4R4C A;  1EIY B;  4B3T L;  1HFG A;  4P72 A;  4HAE A;  1KHI A;  2AWN A;  3KOJ A;  1PA6 A;  2K5D A;  4I65 A;  4LFB L;  1N32 L;  2EYM A;  2RF4 A;  4PZ8 A;  2HT1 A;  1HUM A;  1YVC A;  4DUY L;  4DV1 Q;  3C1E A;  2KHJ A;  1QCB D;  4KHV A;  3SHL A;  2WAQ B;  2VQF Q;  1Q81 C;  2LS0 1;  3WWV A;  1N33 L;  4JYA Q;  4J8Q A;  3BZC A;  1EQQ A;  3S17 H;  1GJX A;  1HZA A;  4J1M A;  3TSS A;  5C3E B;  2LY7 A;  4JV5 Q;  3ERQ A;  5LMN L;  3H3V I;  4CJ2 C;  2L9H A;  1B50 A;  3UE1 A;  4FXD A;  5JEA H;  3PF4 A;  2LMC B;  2XN9 C;  3DM1 A;  5ELN A;  3J81 L;  3HG9 A;  2QDB A;  5JJK A;  1D7Q A;  4K5W A;  5FJ8 G;  2E2D C;  4OO1 G;  1BQQ T;  4RGN A;  4A3L G;  5BN5 A;  3KLR A;  2RDH A;  1EYG A;  1WFQ A;  3J80 i;  1WI5 A;  2MP1 A;  3J7A 5;  3BVZ A;  4LMQ D;  1CKM A;  4B9X A;  4V0B A;  4ID6 A;  3MFY A;  4K2L A;  1YHA A;  1Y14 B;  1LLR D;  3ERO A;  3S1Q H;  4GKK L;  4A3M B;  1H9K A;  3J7Y W;  1PHJ A;  3ULP A;  3HOU H;  3V05 A;  3HOY B;  3CCJ A;  2YU9 B;  4BY1 G;  4GOP A;  4A3I B;  4ZYS A;  1HJP A;  3G6J B;  2B3G A;  2PI2 A;  1LTS D;  1FD7 D;  5JPM C;  1ESF A;  1D1I A;  2I07 B;  4ZCK A;  4IUU A;  1AEX A;  4KKU A;  2AUJ D;  5TSS A;  4PZ7 A;  2Z6B A;  3OWE B;  3Q0A A;  4POG A;  3TRZ A;  2OCE A;  3VR4 A;  4OHJ A;  4BBR H;  2BDO A;  2HIX A;  2EXD A;  3I8Z A;  4WRD A;  4QY7 A;  1TWF H;  2Q2I A;  5C0X H;  1RHP A;  5A2Q E;  3DHQ A;  1UWV A;  1ESR A;  4G7Z C;  1PMR A;  2VZA A;  3VYT A;  4E6I A;  2M2L A;  3CQZ H;  2Z6K C;  1X3Q A;  4L8J A;  3RZO B;  2EYL A;  3Q8D A;  2ID0 A;  3RN5 A;  1B9N A;  2F0N A;  2E2H B;  4B3M Q;  1E1O A;  5I2Y A;  1WD1 A;  1B44 D;  2EQS A;  2IWH A;  1WCM G;  2E75 C;  1LAC A;  1Y1V H;  1B4O A;  4YWL A;  1Q46 A;  3T16 A;  5DEH A;  1S5B D;  4BY7 G;  4P73 A;  4XT3 B;  2NVT H;  3S1R H;  3K5O A;  3VA5 A;  5FJ8 H;  1D1K A;  2VW9 A;  1A2U A;  4B3R Q;  4OO1 H;  5LMN Q;  3M4P A;  1AE2 A;  2F4V Q;  1TWC H;  2JE6 I;  2JA7 H;  2UXB Q;  4UP8 A;  1N36 Q;  4JI7 Q;  1OXV A;  1EZ6 A;  4HJA A;  2JA5 B;  1CKN A;  3TP6 A;  1VQC A;  4JBK A;  2PCF B;  3TQY A;  4CDE C;  3S2D H;  3J81 E;  3KLS A;  4V19 0;  2UXC L;  5JAV A;  1HR0 Q;  2UU9 L;  1I6H B;  2A73 B;  3P75 A;  4LFA Q;  2F03 A;  4X62 Q;  1C9O A;  4RH6 A;  3TP5 A;  5LMU L;  3HOZ G;  2PW5 A;  5BR8 Q;  4JI0 Q;  2K7V A;  3OTO L;  3CCE A;  4X3U A;  3U9O A;  2NN6 H;  2E76 C;  4PMC A;  4A3E H;  1P16 A;  4FYD A;  1W2B A;  5JJI A;  1ILQ A;  3Q22 A;  3VDY A;  2K03 A;  2KBN A;  4IFD J;  4LF8 L;  4A93 G;  1YJW A;  2QKI C;  4XQN A;  2RA4 A;  2XGT A;  2NUC A;  1SXT A;  1TWG B;  4R4I A;  3OW7 A;  2YYZ A;  5JVG 3;  5EPL A;  4O42 A;  4L5R C;  3A8I E;  2P5Z X;  1TS4 A;  1E2Z A;  4NP5 A;  3CD6 A;  4DV2 L;  2O5I C;  3U58 A;  3SK5 A;  4L5S A;  1XJV A;  4JVZ A;  2CWP A;  1Q8K A;  1WOC A;  3K5L A;  3KLW A;  1I4Q A;  3HFZ B;  1N9W A;  1KNA A;  1TQO A;  2FMM A;  4HMI A;  1YHQ A;  1KDB A;  3E5S A;  1EWH A;  1SRO A;  2R7F A;  3KLS X;  5IGG A;  3ZYY X;  3OW2 A;  4AIM A;  1HRJ A;  5IGE A;  4P2C B;  3PIO 3;  2WII B;  4DR2 L;  4B3S L;  2XWJ B;  4F88 A;  3KJO A;  1F9Q A;  1T5X D;  2V1C C;  4TQU S;  3SK4 A;  2X6G A;  4UP7 A;  2NVY H;  1K73 C;  2J4X A;  1YEZ A;  2F0G A;  4A3F G;  1C8C A;  4OX9 Q;  2A6E C;  4BY7 H;  1WJJ A;  2EOT A;  1F9R A;  3MXN B;  2HD3 A;  3PIP A;  1VF5 C;  4YHH L;  1YIT A;  4HJ9 A;  2BA1 A;  5C4H A;  4H44 C;  3E0E A;  2F3V A;  3K0X A;  4HIM A;  4JC0 A;  3MTS A;  4K6D A;  4FF2 A;  4F8M A;  3GTP B;  3CME A;  2FFK B;  3J80 E;  2DNC A;  3NEL A;  5G3L D;  1R9T H;  3EQL C;  1EEI D;  2EYO A;  1SNQ A;  4L5Q A;  4G57 A;  3UDG A;  3V2T A;  1PTO B;  1EIH A;  2JA6 G;  1X3P A;  2F0M A;  3HOZ H;  2EVB A;  1AP0 A;  2RDF A;  1VQM A;  4BWG B;  4ZAI A;  1YNN D;  1VCI A;  3N6R A;  2KCC A;  5J22 A;  2EYF A;  2R7Z B;  1F77 A;  5C0X I;  1TS5 A;  3QOJ A;  3K58 A;  5LMU Q;  4KHP L;  4GNX C;  4DR4 L;  3BYY B;  1M4V A;  3R3O A;  4EQN A;  4Y52 H;  1VQF A;  1EOT A;  2K5V A;  1IL8 A;  4C1N K;  5AJ3 L;  4A93 H;  3UDF A;  3W3A A;  2HDM A;  1ENA A;  2F0U A;  2PYK A;  1NY4 A;  3BVM A;  1SJE D;  1IYJ B;  2DGY A;  1B2T A;  4LF8 Q;  4C56 C;  3T4A C;  3I3C A;  5C3E H;  1EWC A;  3NE5 B;  1CQF A;  4N9T A;  3RZD B;  4UDU C;  1D8L A;  1J9O A;  2HIV A;  1EY0 A;  1B3A A;  1BBU A;  1QNU A;  1HA5 A;  4HIO A;  1Y1W G;  3FKI G;  5C44 B;  3K57 A;  4UAI A;  1KIX A;  1G8Z D;  3CPW A;  2F0F A;  4A3K B;  2R92 G;  4MNO A;  1Y8P B;  4B9W A;  1WTH A;  3FPP A;  1XMO Q;  4JOI C;  5ELC A;  3S2H H;  2EY5 A;  1JWU D;  2E74 C;  1O80 A;  2F0L A;  1HNW L;  4X66 L;  4DR6 L;  5E4W C;  5I6Y A;  2B63 G;  5IYD H;  1SFO B;  2Y0S E;  4LUZ A;  4ZLT F;  4C3H G;  1VF7 A;  4DV3 L;  2YU9 H;  1FR3 A;  2O5J C;  4K5X A;  5FOB B;  1SYC A;  4AQY L;  2OWO A;  1KNE A;  2ZXR A;  4YCV A;  4YHH Q;  1EUJ A;  2ZTE A;  2EJG C;  3QJY A;  5KIX A;  5FLX c;  4Y7N H;  3P1H A;  2PZW A;  5M5Y H;  2N55 A;  2NN6 I;  2AWO A;  4HN7 A;  5H1S E;  4H02 A;  1KL9 A;  2QEX A;  3D0F A;  1GUW A;  1SNC A;  3R2T A;  4DXG A;  2GN5 A;  4RHR A;  5DM7 3;  3BZD B;  3TEH B;  3RLF A;  2HHH L;  4FXG C;  3NQI A;  3W2D A;  4IAL A;  4A3J G;  3HEJ A;  4GNX A;  3P20 A;  3G7L A;  2XSC A;  2EYP A;  3KBX A;  2A69 D;  4DUZ Q;  5M3F G;  4HSP A;  1U4M A;  1STB A;  5CV9 A;  1YNN C;  3I7F A;  4DR5 L;  3E9H A;  4BBS G;  4KTA A;  3G4S A;  1E7Z A;  3P7J A;  4A75 A;  2CFM A;  1VQ9 A;  5C4X G;  4DR3 L;  1KTK A;  3KFU A;  3S14 B;  1CUK A;  1C7Y A;  2E2H H;  3KDF A;  4L6T B;  5AJ3 Q;  2ZTD A;  4BA2 I;  1ROD A;  4DPG A;  1F2M A;  3CC2 A;  1JIC A;  4JI2 Q;  4K6L A;  2G9H D;  3HOW B;  1KAA A;  1I4R A;  2A68 C;  1S5F D;  1Y1W H;  3FKI H;  2EE1 A;  3JAM c;  3FVQ A;  4PQX A;  1I3Q H;  4IFD I;  1QUQ A;  4JOI A;  5C5M A;  1BR9 A;  4WJ3 M;  3KUP A;  2UUA L;  2Z1C A;  1VQ5 A;  4P71 A;  2UUB L;  2RSN A;  2JA5 H;  1QG7 A;  1VQO A;  1IBK Q;  1U5K A;  2Z0S A;  3ONA B;  2G5D A;  4DN4 M;  4CGY B;  3I4M B;  5CV5 A;  4APV A;  1EY8 A;  4LW1 A;  2BE5 D;  2B63 H;  1K3B C;  2AHO B;  4IOC A;  3OIQ A;  4C3H H;  1N34 L;  4LF5 L;  1TWH H;  2FXQ A;  1YHB A;  4N8X 1;  1FNW A;  1CHQ D;  1VQH A;  4DV5 L;  2L0C A;  5J1Z A;  2CQO A;  4A3D B;  1BCP B;  2PQA B;  1X3F A;  3JAM i;  4X64 Q;  1PFB A;  5BN3 A;  3CP0 A;  4LF7 L;  1MHW C;  1WTQ A;  3QR8 A;  4R8N A;  2K5N A;  2X6L A;  2IY5 B;  1SYG A;  2Q8I B;  3A5U A;  4DV4 Q;  3GTQ B;  2MNA A;  5M3M B;  3RMH A;  4NW2 A;  2D9U A;  2MJ8 A;  1TWG H;  5IYB G;  4RHS A;  2GA4 B;  1UEB A;  5LL6 S;  4OWX B;  1E2W A;  4RWS C;  2NVQ B;  3H0G B;  1V1Q A;  4IUV A;  4IZ8 A;  2N3S A;  5CMD A;  5FLX L;  4LUO A;  1L0Y B;  2IHE A;  1H9S A;  1WTV A;  1GUO A;  1RTO A;  3J81 j;  1A63 A;  5FKA C;  1CTM A;  3CC7 A;  4BBS H;  3AFQ A;  2A69 C;  2IW3 A;  4DK6 C;  3GTK H;  1QVG A;  3PV0 A;  4RCO A;  2HQE A;  3RR5 A;  2IX1 A;  3OYY A;  1XPR A;  1S3O A;  4DK0 A;  3KF6 B;  3HOU G;  5T1G A;  2PO4 A;  2B2V C;  2Q2T A;  4PMW A;  1QZG A;  4K8J A;  4TRD A;  4UPA A;  2OTL A;  1L0W A;  1WCM B;  3CW2 C;  2QGQ A;  4FF4 A;  5CV8 A;  3MXP A;  4C3J B;  2PMZ B;  4JI1 L;  5IYC H;  1FJG L;  4NXN Q;  4A3B B;  1HA6 A;  2K4K A;  2ZM6 Q;  1GUG A;  1PRT D;  3V96 A;  1O7Y A;  3D31 A;  4RGM A;  2QEJ C;  5IGF A;  4BBR G;  1K8A C;  3GTP H;  1JQY D;  1IBL Q;  4DXF A;  1PH2 A;  3DLL A;  1LTL A;  1WD0 A;  2M9V A;  3OOC A;  4KJN A;  1STN A;  3U50 C;  3H3V C;  4JI6 Q;  2GVA A;  4NMZ A;  5C0X G;  3GTJ B;  4YY3 L;  2OF1 A;  1PTO H;  1Q8I A;  3I4N G;  1GOZ A;  3S16 B;  4DAY B;  2I5H A;  1HQR D;  4XYO A;  1J5E Q;  1KLG D;  4IJH A;  5GAG C;  2UUC L;  3HOX B;  5EKL A;  3T1Y Q;  1PH5 A;  2YTY A;  2LXJ A;  5ELF A;  4C3I B;  1MD2 D;  4A3G B;  3STB C;  2KJX A;  2WP8 J;  5K5P A;  2Q2U A;  2XRS D;  3HOV G;  5GQO A;  2EZV A;  3HS0 C;  1Y1V G;  3CC4 A;  3HP3 A;  3URY A;  4KD3 A;  1EFW A;  1LAB A;  2F0K A;  4R8I A;  3KF8 A;  1WTP A;  2JA9 A;  1HH2 P;  4JK1 C;  5D14 A;  5IYB H;  4AYB G;  1M1K C;  1PTO D;  2VXW A;  1L1O C;  5I9P A;  5IP7 G;  2NTT A;  1NBW A;  1STH A;  4LFC L;  1V1P A;  2JA7 G;  4NXM Q;  2BOS A;  2KQ3 A;  4FNF A;  3RZD H;  5K36 H;  3KJP A;  3PQI A;  3GTO B;  1MIU A;  3NXW A;  1K9M C;  3I90 A;  4DAV A;  5C44 H;  1FGU A;  3ND8 A;  1JE5 A;  1PXU A;  1S5E D;  2B2V A;  2XWB B;  3MXU A;  2YTV A;  2NWG A;  5EBD A;  3M7G A;  1OXX K;  2F0V A;  5FLX E;  5ISR A;  2ES2 A;  4DR7 L;  4JG2 A;  4DNI A;  1EU4 A;  1HNZ L;  2DN8 A;  1WVL A;  3I4L A;  4MTK A;  1KAW A;  3T1H Q;  1CQV A;  3B6Y A;  3E3X A;  4HTH A;  1XNR Q;  3C1F A;  2NN6 G;  3OWF A;  4A3E G;  3I91 A;  1MSG A;  4QUC A;  4YCU A;  4IPD A;  4JCV E;  1EY6 A;  3OMG A;  1EIF A;  3W1B A;  1JMC A;  3GDE A;  3CXC A;  1BNZ A;  4LK1 C;  5E1F A;  3DM3 A;  5HGT A;  1NTG A;  5EBC A;  2G9D A;  1AZQ A;  3K8A A;  3PUW A;  1IHZ A;  3FDT A;  3I55 A;  1PRT C;  3H09 A;  3DWQ A;  2F3W A;  4R4O A;  2UXD L;  1VQJ A;  1BBX C;  1PYW D;  5EAY A;  1I4H A;  1XXG A;  1O7L A;  1L0X B;  1ENC A;  3I4N H;  3WDN A;  1TVX A;  3BG3 A;  3VR2 A;  3K5N A;  5C4Z A;  1X56 A;  3FPU B;  1XNQ Q;  2WB1 G;  4GLX A;  1A3V A;  2OEO A;  4LF4 L;  4GOP B;  2JXM B;  3H6M A;  3S1M B;  4UHV A;  1H95 A;  3M4Q A;  3BVG A;  1BVS A;  1BKB A;  4B3T Q;  3JAM E;  4A76 A;  4EX5 A;  1J8I A;  4K0K L;  1BBW A;  3HOV H;  1JJG A;  4LFB Q;  1N32 Q;  1TWA B;  1LTG D;  2VB3 X;  4FVM A;  1L1O A;  2A8V A;  4DUY Q;  1STG A;  1N33 Q;  2JA8 B;  1Z9F A;  4IFD G;  3CCR A;  4FDB A;  2F0E A;  3HKZ G;  3K7A B;  3SGI A;  1NMG A;  5IP7 H;  1XTD A;  4F87 A;  2RDG A;  1NNX A;  2PI2 E;  3HOW H;  1I50 H;  1UE1 A;  1PTO C;  2VNU D;  5I6W A;  2C35 B;  2MO1 A;  1BF4 A;  4DFA A;  1PH3 A;  3CRK C;  1K8G A;  3PO3 B;  2JEB I;  3VYR A;  2FHT A;  3PO2 G;  1W3S A;  4QIW E;  2KCT A;  1I4G A;  2VUM H;  1A3U A;  2IT1 A;  2XTI A;  1SAP A;  3UDX A;  2WKD A;  2KA7 A;  3MFG A;  3U4Z A;  1RJT A;  2NVX B;  4K14 A;  1TXY A;  4IUN A;  1Q90 A;  4GKK Q;  3I4M H;  3NPP A;  4JI8 L;  4DV0 L;  3EFX D;  4N8F A;  1VDZ A;  4RKL A;  3S1N B;  5I2X A;  4EQO A;  2LXK A;  2YV5 A;  1AFP A;  4TVA B;  2WFW A;  3CMA A;  1XPO A;  1VQD A;  3K59 A;  2OT2 A;  5KYI A;  3J7A F;  3M4O B;  4ILW A;  1AH9 A;  1JCK B;  3QO2 A;  3H94 A;  3R2I A;  2JP1 A;  1HXY D;  1K8O A;  4DF7 A;  1V1O A;  1CKN B;  2F0S A;  2QW7 A;  5LL6 X;  2WAQ G;  4EQP A;  5M5X H;  4EVO A;  2LFN A;  1U0L A;  5C3E G;  3NP8 A;  2I5L X;  2Z6K A;  1K83 H;  4H13 C;  1ZKO A;  3CKI B;  1N8R C;  2Z9H A;  2LKV A;  2PQE A;  3T51 B;  3DWA A;  4FXK C;  5IWA L;  3VA7 A;  1G29 1;  2NVQ H;  3EJI A;  2N78 A;  3M7N A;  2RHQ B;  4ZUJ A;  1UE7 A;  1D5M C;  1MGS A;  1SN8 A;  1NJI C;  1EY9 A;  2PPB C;  1D5Z C;  3OSO A;  3NTI A;  3NBI A;  4KKT A;  1CKO A;  1PYS B;  3GTM B;  1X32 A;  1BCP D;  2QIL A;  3EA6 A;  4MZ9 A;  3IL8 A;  1IKM A;  2CH4 W;  4IFD H;  2K05 A;  5IYD G;  2XVS A;  4B08 A;  1EOV A;  4QF4 A;  4BS9 A;  1HTL D;  1XMQ L;  1GO3 E;  2EY1 A;  5EPJ A;  1IZ6 A;  1K0R A;  2DJG C;  3MEF A;  4M8A A;  3W5O A;  3HOY G;  1M8A A;  2R93 B;  3BDO A;  1SNM A;  2E8G A;  1UE5 A;  1W6K A;  2K75 A;  1G91 A;  3PUX A;  5C4J B;  1ZYR D;  4JI4 L;  3NUC A;  4C3J H;  1HTP A;  4QJF A;  2KHS A;  3A0J A;  4F7X A;  3PO2 H;  1SE8 A;  2B2T C;  3C46 A;  2WV6 D;  2F0T A;  4HJ8 A;  1OXU A;  2K5H A;  1VMC A;  2X69 A;  5C6A A;  1WTR A;  5ELB A;  2OXP A;  2UXC Q;  4JI5 L;  1G51 A;  1U4L A;  4L5T A;  1HZC A;  1I94 L;  2UU9 Q;  2ZTC A;  2KED A;  4KN7 C;  1MI2 A;  4ME5 A;  4Z9C B;  4A3C G;  3GTJ H;  1SE4 A;  2KOL A;  1PFN A;  3S16 H;  3W1G A;  5KEE A;  3IKJ A;  1V9P A;  3TN2 A;  2L4N A;  2JN4 A;  1VQP A;  3GTL B;  2K14 A;  4DA2 A;  3BU2 A;  1IL2 A;  3HOX H;  1ICF B;  5GAH C;  3OTO Q;  4DV0 Q;  2E2J B;  2OQK A;  1CSQ A;  4OXP A;  2AMC B;  4C3I H;  4GKJ L;  1S40 A;  4A3G H;  5GAE C;  2I0Q A;  3OMC A;  5CV6 A;  4ZKB B;  1SMY D;  3TZD A;  1SDF A;  1JOQ A;  3UE0 A;  2ICI A;  1ML0 D;  3S17 B;  3GP7 A;  2F0Q A;  2N49 A;  1CSP A;  4HJ7 A;  4U68 A;  2A1A A;  2Y0S B;  3RUZ A;  4LF9 L;  2L55 A;  1X54 A;  2HUG A;  4FO2 A;  3T53 B;  2D5D A;  3CAM A;  4IQZ A;  2HQL A;  1PDQ A;  4X3T A;  4DV2 Q;  1II3 A;  4KN4 C;  1P8L A;  1LT3 D;  3M4Y A;  3F2C A;  2R6G A;  1E3P A;  4I7A A;  1QIL A;  1CFM A;  2JA5 G;  4RFB A;  2R61 A;  4KJO A;  1NCV A;  4DR2 Q;  4MHE A;  1SRU A;  4B3S Q;  2KCM A;  1VQE A;  1EYA A;  4A3M H;  3S1Q B;  2EJF C;  1QVC A;  2EJM A;  4XQJ A;  3HOY H;  4JI3 L;  3ULL A;  2CQA A;  2F0O A;  4IUQ A;  4A3I H;  1EEF D;  3QIA A;  4DV7 L;  1B3Q A;  2B2T A;  2DY8 A;  1DM0 B;  4Q0F A;  3S9W A;  5EPK A;  1G6P A;  4DV6 L;  2K5Q A;  5LMN W;  2FMC A;  3NWS A;  5EKK A;  1ZYR C;  2A19 A;  5M9O A;  2K50 A;  3PIP 3;  4CJ0 B;  1JJ2 A;  4LNQ A;  3CCL A;  1PVO A;  2GVB A;  5E3F A;  1HR0 W;  3GV6 A;  3F8T A;  3WOE A;  2RVL A;  4QB4 A;  4A3C H;  2CW0 D;  4IUP A;  4C2M B;  3MXG A;  2QA4 A;  3OPO A;  5HUR A;  2DY7 A;  1DXM A;  1JC7 A;  5FO7 B;  1KQS A;  3Q24 A;  2I5M X;  1IYV A;  3Q6S A;  1O7Z A;  3RZO H;  4KHP Q;  4RCN A;  1SYF A;  4DR4 Q;  1F9P A;  2KEN A;  1X3G A;  1VQ4 A;  3GTG B;  2VQE L;  3A7L A;  1O7I A;  2VB2 X;  3MWY W;  4H0L C;  1AN8 A;  3AEV A;  1TWA H;  4ZK9 B;  4LWC A;  3K6O A;  4DR1 L;  5EQ0 A;  1DGS A;  3DEP A;  1SMY C;  5FO9 B;  4L63 B;  5C3X A;  1HQM C;  5IYC G;  2JSO A;  1K8M A;  4ZQ3 A;  2J0T D;  3K7A H;  4GNX B;  3S1R B;  1NSN S;  1L2F A;  3T56 B;  1Y8N B;  3IRB A;  5IE8 A;  1IBM L;  1WTX A;  4IPC A;  1LTI D;  2AKW B;  1QNK A;  4LF6 L;  3WOF A;  5G3L F;  1LYL A;  2L5T A;  1VQB A;  3HGB A;  4ZKC B;  3PO3 H;  1QVF A;  1I5F A;  1SYD A;  4XYQ A;  2A5H A;  1HCZ A;  1ENF A;  1EFI D;  4HR7 B;  4ALP A;  3S2D B;  1I6H H;  3AMU A;  3DXJ C;  4LAA A;  3MZ5 A;  4DAM A;  1VQG A;  4CKE A;  3KDF B;  1BO0 A;  1SNO A;  3NBH A;  3GV3 A;  3VR6 A;  2B8F A;  1HNW Q;  1HNX L;  4AYB E;  4X66 Q;  5HGQ A;  4DR6 Q;  4K8I A;  4G7O C;  1MBY A;  1FNU A;  4BY1 B;  2BDN A;  2HCI A;  1A0I A;  3AB9 A;  1SYB A;  4GZY C;  3A55 A;  3AU7 A;  3RNU A;  5IOD A;  2SOB A;  4ZRZ A;  3MEH A;  4DV3 Q;  1KAB A;  1QUQ B;  4P74 A;  4AQY Q;  1R4P B;  1RTN A;  2ZXP A;  5HY6 A;  4QMG A;  1QWY A;  2PNR C;  1VS0 A;  4DV1 L;  2VQF L;  4JYA L;  4DV6 Q;  1SND A;  1GUS A;  1GD7 A;  3OHX C;  2HCC A;  3CCV A;  3I4O A;  1UUP A;  1BOS A;  1WYD A;  1X6O A;  4CKB A;  5JJL A;  1Q1E A;  3D6C A;  1UE6 A;  3S24 A;  5C3W A;  4BA1 I;  3NSW A;  1X3E A;  1TS3 A;  1MKH A;  4CDC C;  4CDD C;  2HHH Q;  4KY5 A;  3ULJ A;  4PNY A;  3C2P A;  2CW0 C;  1ONL A;  1EY4 A;  5FK9 C;  1IW7 D;  1JWS D;  5C44 G;  3NQT A;  1SBB B;  4A3K G;  4DR5 Q;  1T9H A;  1B53 A;  3J7A V;  3BDC A;  1ZXT A;  4DNR B;  4EGV A;  1PFS A;  3KK7 A;  4IN3 A;  3SEB A;  3CHB D;  3I73 A;  4MN3 A;  3HKS A;  1G2S A;  1JE4 A;  4OIJ A;  1Z47 A;  3D8G A;  4DR3 Q;  1GHK A;  5M5W B;  1LT5 D;  3FHW A;  4HED A;  2PZT A;  4HCE A;  1DD2 A;  4J6H A;  3I2Z A;  3K80 C;  2CH4 A;  4BY7 B;  1X55 A;  3RLN A;  2KUM A;  3EIV A;  2D2C C;  3A8J E;  2TSS A;  5IT9 L;  4DR1 Q;  2NZH A;  5EKI A;  1STY A;  3DUZ A;  2R93 H;  2JQO A;  1H9S B;  1CA5 A;  1CHP D;  3A7A B;  5IGD A;  1DCZ A;  1H9J A;  2EYJ A;  1A3T A;  4H7B A;  2UUA Q;  1OTC A;  1IBM Q;  1RD9 D;  2Q2H A;  1JR0 D;  2N8N A;  4JBJ A;  3Q23 A;  1R9T B;  1VQ6 A;  5E7N A;  2UUB Q;  5A2Q L;  1VQL A;  1CA6 A;  2K01 A;  3L7Z C;  3M3Y B;  1W6J A;  1Q3L A;  1HZ9 A;  3TP8 A;  2A6H D;  4IJL A;  5JEA J;  3D6W A;  2EPB A;  5IIF A;  2BE5 C;  3EVQ A;  3D4D A;  3HOZ B;  3GD7 A;  3HKZ E;  1YJ9 A;  2WAC A;  1ZEQ X;  1QOH A;  1B7Y B;  4IPH A;  1EQT A;  3M85 A;  1N34 Q;  1I4X A;  4LF5 Q;  2R7Z H;  5E4X A;  3CF5 A;  5DM6 3;  4GN3 B;  2F0J A;  1SR3 A;  1FNV A;  4MTN A;  1EZ8 A;  1VQI A;  2SEB D;  4DV5 Q;  1LTA D;  3GTL H;  2E5L L;  3CCU A;  1VMP A;  3QG1 A;  2E2J H;  3BYT B;  2BA0 A;  4B3M L;  4A93 B;  2A74 C;  1STE A;  4LF7 Q;  2PNH A;  3D4R A;  2FJ2 A;  1PH4 A;  4HID A;  2NYZ D;  4FF1 A;  4RGO S;  4KK7 A;  1F2Y A;  3SDZ A;  1A15 A;  3K5M A;  1EYD A;  3CU7 A;  5COY A;  1XTC D;  1EWI A;  3HOW G;  5CBE E;  3AFP A;  4B3R L;  1QJO A;  1PYB A;  1MJE A;  4DKA C;  1R4Q B;  1PLF A;  3L3O C;  2F4V L;  3L2P A;  4BXX H;  2F1M A;  2UXB L;  4KHZ A;  3TBI B;  1ET6 A;  2DJF C;  1STA A;  3SXH A;  1N36 L;  4JI7 L;  4RMF A;  1UAP A;  2BH8 A;  4A3K H;  3ERS X;  3G48 A;  1AZP A;  4X6A H;  2VUM G;  1DYQ A;  5AFW A;  1IW7 C;  2EIF A;  4PMB A;  3I72 A;  2K04 A;  1HR0 L;  2J7Z A;  1TU2 B;  2F52 A;  4K2K A;  2R3Z A;  4OON A;  3MVV A;  5C0X J;  3LWE A;  1S5D D;  3S2H B;  4LFA L;  3I4M G;  2WAQ E;  4KMU C;  5KRU A;  4A3F B;  4X62 L;  2H5X A;  3KF8 B;  1SFO H;  4PG3 A;  3OIP A;  4YIJ A;  2F0P A;  5BR8 L;  4JI0 L;  1S72 A;  3BJU A;  1V1P B;  1LO5 D;  3I70 A;  1QE6 A;  2B39 A;  4JI1 Q;  1S4Z A;  4KV6 A;  5EGT A;  1FJG Q;  4A3D G;  1DOL A;  3NK9 A;  3G71 A;  2ZJQ A;  4OEL B;  2R7D A;  1UNS A;  3DMU A;  3IFD A;  4YWK A;  4Y7N B;  3SK6 A;  1GM5 A;  3EBE A;  4RGT A;  5M5Y B;  3QB3 A;  5KND A;  2ICE C;  1T5E A;  3QOL A;  4O1N A;  5IT9 E;  1OO9 B;  2B2U C;  4QCL A;  3MC0 B;  2JA6 B;  1JT8 A;  5M3M G;  4O0A A;  1PZJ D;  1XWE A;  3U4V A;  1KLU D;  3PIO A;  4YY3 Q;  3SVM A;  1NMF A;  4OWW B;  2Z4H A;  5DAU A;  2A6H C;  1V43 A;  2XNA C;  4C2M H;  3RN2 A;  3H0G G;  1PH7 A;  5GRO A;  4OWT B;  5L37 A;  2K33 A;  4CJ1 B;  1K28 A;  2UUC Q;  1AE3 A;  4WFN 3;  1I4P A;  3F1Z A;  1PV4 A;  4IPG A;  2RSO A;  2TMP A;  2NBF A;  5JVH 3;  4R4T A;  4QIW B;  4XIG S;  2E2I B;  1NR4 A;  2IX0 A;  1D2B A;  1KDA A;  5ELO A;  3S14 H;  2KHI A;  2IPK D;  3GTG H;  1SLJ A;  4IUR A;  2E5L Q;  4ME3 A;  1PZI D;  2ALY B;  4OX9 L;  2RBM A;  1B8A A;  5LHY 1;  2A6E D;  1YI2 A;  5COR A;  5DLQ E;  2B8G A;  5FO8 B;  2MO0 A;  4FF3 A;  2CWA A;  2ASB A;  1CI3 M;  3M9B A;  3U9S A;  4UP9 A;  5ELE A;  3TP7 A;  1Q7Y C;  4C3J G;  2D62 A;  3J80 L;  1PRT F;  2I46 A;  1Y1W B;  4LFC Q;  3FKI B;  1K0S A;  4A3B G;  1EU3 A;  1UEA B;  1I3Q B;  1SEB D;  3HZX A;  3NHH A;  4A3L H;  2R92 B;  4KKS A;  1GVP A;  1JB3 A;  1JOO A;  1ILP A;  3TS2 A;  3FP9 A;  1NUC A;  3A74 A;  5CGK A;  5F2D A;  2O2L D;  4I7Z C;  1L1O B;  1G6Z A;  4XQQ A;  3FRP B;  5T1I A;  4C1N I;  3CCS A;  2VY3 A;  3O13 A;  4DR7 Q;  2SDF A;  1HNZ Q;  1JOK A;  2EY2 A;  3S15 B;  2B63 B;  5D3D A;  1F9S A;  2Q8T A;  3TME A;  1U4P A;  5IOC A;  4C3H B;  1TWH B;  3HOX G;  3RLO A;  1CZG A;  5GAD C;  2JJQ A;  2CVR A;  3E0J A;  4S3S A;  1RDP D;  5JOB A;  4C3I G;  4A3D H;  1KRS A;  4BY1 H;  1E0B A;  4CDF C;  2H1E A;  4A3G G;  1E1T A;  5CR3 A;  2B2U A;  5IY0 A;  4HIK A;  3KBG A;  3RD4 A;  4CHT B;  5I9O A;  3T13 A;  1XYI A;  2IL8 A;  1BXT A;  4HMJ A;  2F0W A;  2UXD Q;  3GTQ H;  5M3M H;  1ICW A;  2JYO A;  1PTO F;  3MXN A;  1X65 A;  4RKB A;  4POF A;  4EQ5 A;  3H15 A;  3SR1 A;  2RCF A;  2Q8R E;  4WJW A;  3H0G H;  4A3J B;  2OQ0 A;  1A8V A;  4ZUI A;  4QQB X;  1HFN A;  1PH1 A;  2MUY A;  5M3F B;  1LTB D;  1LM0 A;  1BDO A;  4G7H C;  4LF4 Q;  3H91 A;  5FLM G;  1PRT B;  1VQA A;  2ATW A;  1J6Q A;  1RKN A;  1GXD C;  4NKL A;  4BBS B;  3GTK B;  1XMO L;  5D65 A;  5KNC A;  2VS1 A;  4DNT B;  4A3M G;  1YIJ A;  2D0O A;  5C4X B;  4K0K Q;  3ITP A;  5I4D A;  1IKL A;  1B70 B;  2KEC A;  2WKC A;  1QZH A;  1NAP A;  3LNN A;  3D3R A;  3PSI A;  4Q5V A;  4NDX A;  1WCM H;  3LX0 A;  5M5W H;  4A3I G;  1YJN A;  1OXT A;  1CM9 A;  5IGB A;  5CV4 A;  2K32 A;  4OEM B;  3GQB A;  1SSO A;  4HCS A;  4IOA A;  2RKS A;  1VQK A;  4A3B H;  5KGU A;  1DOM A;  2DUD A;  2JK8 A;  5IGC A;  3K0Y A;  4FP5 D;  4QL5 A;  2O4X A;  2RQX A;  3BS1 A;  1DJR D;  1EIG A;  2V4D A;  2ZXO A;  3MA2 B;  4ULL A;  3DWP A;  1PZK D;  3F2U A;  4GLA C;  2SNS A;  1GUN A;  4GLV B;  2ENB A;  2MPM A;  2IJ0 A;  3M3Y H;  4N9P A;  3EN2 A;  1RIP A;  3L9A X;  3CPF A;  2EY6 A;  2XIW A;  5D3I B;  1LV9 A;  4DUZ L;  1EY5 A;  4JI8 Q;  2M00 A;  4WJ4 A;  3R8B A;  1DZ1 A;  3R93 A;  1X9N A;  1LT6 D;  3CCM A;  3IFT A;  2CKZ B;  3PF5 A;  1EY7 A;  2XRQ D;  3BDL A;  4J15 A;  2YTX A;  2Z4I A;  3MAQ A;  3VYU A;  3PUY A;  4RA8 A;  1YNX A;  5C5L A;  2K6A A;  3E9I A;  4JI2 L;  2JA8 G;  1TS2 A;  2EYH A;  1HPC A;  5J39 A;  3HRZ C;  1KRT A;  3MHB A;  2A68 D;  1Q86 C;  5IP9 G;  2IHF A;  3GTO H;  2KEE A;  4KY6 A;  3TDQ A;  2F0D A;  5FLM H;  2AQ1 B;  2JEA I;  4MIU A;  5IWA Q;  2AQ3 B;  2ZJR A;  5K36 G;  3GO5 A;  3JC6 6;  3PO3 G;  4OIK A;  1S5C D;  4DK3 C;  4OGQ C;  1SYE A;  1IBK L;  2DNE A;  1BCP C;  1PH8 A;  1VQN A;  1VQ7 A;  1XPU A;  2QDL A;  4OO1 I;  1SJH D;  2MFI A;  3HOU B;  1PH6 A;  3CCQ A;  2NTS A;  1QB5 D;  2AUK A;  4KY7 A;  4XTC S;  4A3F H;  1JJC B;  4PZ6 A;  1H9R A;  1XMQ Q;  3VYS A;  4R4Q A;  1E24 A;  2MGS A;  3SK8 A;  3TRE A;  4OL7 A;  3TZU A;  3CRL C;  3I56 A;  4CKC A;  2HDL A;  4JW0 A;  2L1B A;  1O78 A;  3ER0 A;  4X64 L;  5CC4 A;  4JI4 Q;  1H9M A;  1JB7 A;  1EYC A;  1FL0 A;  4XT1 B;  4JBW A;  1TY2 A;  4O2D A;  4QGU A;  1Z7T A;  5KYL A;  3C3L A;  1TT2 A;  2D0P A;  1KDC A;  1D6E C;  3KYH C;  4BBR B;  4DGZ A;  3NTH A;  4ODG A;  4X3K A;  4DV4 L;  5CV7 A;  1MSH A;  1XX8 A;  4GN4 B;  3NTK A;  1GKH A;  1PFM A;  1TWF B;  1F2Z A;  1I6V C;  4KLK A;  1TY0 A;  4GN5 A;  4RG1 A;  4JI5 Q;  3I4N B;  3PCO B;  2JA6 H;  1I94 Q;  1JWM D;  3ICE A;  3LGJ A;  4KD4 A;  3NWT A;  2PW7 A;  5IT9 c;  2F3I A;  3CQZ B;  5J3B A;  3S1M H;  2EDG A;  4A4I A;  3TS0 A;  1TKW B;  2B29 A;  2Z8L A;  5BN4 A;  3BZK A;  1BCP F;  3LWU A;  1Q12 A;  4PV1 C;  4GKJ Q;  2L12 A;  5A35 A;  3HOV B;  2E2I H;  3H3V H;  1Y1V B;  3ND9 A;  1A6X A;  2JA8 H;  3G6E A;  2NVT B;  1EQR A;  4GS3 A;  2F0I A;  1BUV T;  4AYB B;  1LTR D;  1SE2 A;  4P75 A;  2R93 G;  1DOK A;  5IP9 H;  2ZJP A;  1WTO A;  4LF9 Q;  2BH2 A;  2JA7 B;  1TWC B;  4NXN L;  5JJZ A;  1EL0 A;  4IUT A;  2ZM6 L;  4QUF A;  3F2D A;  1C0A A;  2AQ2 B; 
#chains in the Genus database with same CATH homology
 2VNU D;  5LMU Q;  1VQI A;  4KHP L;  2PQA A;  2C35 B;  2MO1 A;  4DV5 Q;  4GNX C;  1PH3 A;  1K8G A;  3GTL H;  4DR4 L;  2VL6 A;  2JEB I;  3CCU A;  2E5L L;  4Y52 H;  1VQF A;  2E2J H;  1K3R A;  2K5V A;  3PO2 G;  2BA0 A;  1W3S A;  4QIW E;  5AJ3 L;  1IBL L;  2KCT A;  4B3M L;  1YZ6 A;  4A93 H;  2VUM H;  2R92 H;  2IT1 A;  2XTI A;  4LF7 Q;  3UDF A;  2PNH A;  1NY4 A;  4JI6 L;  1PH4 A;  4HID A;  2RCN A;  2NVX H;  3NEN A;  3UDX A;  1IYJ B;  2DGY A;  4LUV A;  3U4Z A;  4LF8 Q;  1TXY A;  4KI0 A;  4GKK Q;  4X65 L;  3I4M H;  1J5E L;  5C3E H;  3S1N H;  4YCW A;  4JI8 L;  4DV0 L;  2R7Z G;  3K81 C;  1EWI A;  3T1Y L;  4JI3 Q;  3HOW G;  3S15 H;  3AFP A;  4B3R L;  2MQH A;  2LXK A;  2YV5 A;  3J7Z C;  1D8L A;  1PYB A;  4TVA B;  1MJE A;  2HIV A;  2WFW A;  4DKA C;  4NPS A;  3CMA A;  2F4V L;  1XPO A;  3L2P A;  1VQD A;  1BBU A;  3K7U C;  4HIO A;  1Y1W G;  4BXX H;  4DV7 Q;  3FKI G;  4KHZ A;  3M4O H;  2UXB L;  1N36 L;  4NB3 A;  3STB D;  4JI7 L;  4RMF A;  1E22 A;  1KIX A;  2BH8 A;  3J81 c;  4IO9 A;  4A3K H;  3ERS X;  3G48 A;  1ASZ A;  1AH9 A;  3CPW A;  1Q1B A;  2VUM G;  4X6A H;  2R92 G;  4MNO A;  2EIF A;  4YWM A;  1CKN B;  1XMO Q;  1YBY A;  3PGZ A;  4JOI C;  4JV5 L;  1HR0 L;  2F52 A;  3KF6 A;  4OON A;  3S2H H;  5C0X J;  2WAQ G;  3PUZ A;  5M5X H;  2OTJ A;  4LFA L;  3I4M G;  2WAQ E;  1U0L A;  5C3E G;  4X62 L;  2H5X A;  2I5L X;  2Z6K A;  2CCZ A;  1HNW L;  3KF8 B;  1K83 H;  4X66 L;  1N8R C;  4DR6 L;  2Y0S G;  1SFO H;  3NBH B;  4PG3 A;  2B63 G;  5IYD H;  3AYH B;  4AH6 A;  2Y0S E;  4LUZ A;  5BR8 L;  4JI0 L;  1IXR A;  4NXM L;  4BXX G;  1S72 A;  3BJU A;  1ASY A;  5JEA G;  1Q82 C;  4A3J H;  4DV3 L;  1HZB A;  5IWA L;  2YU9 H;  1G29 1;  2NVQ H;  4AQY L;  2N78 A;  2OWO A;  2RHQ B;  2LSS A;  4YCV A;  4JI1 Q;  1FJG Q;  3M7N A;  4A3D G;  1UE7 A;  5M3F H;  4YHH Q;  1KXL A;  1NE3 A;  1EUJ A;  1OXS C;  1RL2 A;  2ZTE A;  1SN8 A;  5FLX c;  4Y7N H;  3G71 A;  3F2B A;  2ZJQ A;  1NJI C;  2R7D A;  1GM5 A;  4YWK A;  3GTM H;  5M5Y H;  1CKO A;  1PYS B;  2AWO A;  2NN6 I;  3EBE A;  5H1S E;  1SMX A;  3J81 i;  4H02 A;  1KL9 A;  2QEX A;  4MZ9 A;  3D0F A;  2VQE Q;  1FVI A;  3UDI A;  5C4X H;  3PUV A;  1KD1 C;  2GN5 A;  1VQ8 A;  5IYD G;  5M3M G;  3T1H L;  1JT8 A;  4O0A A;  3TEH B;  1EOV A;  3RLF A;  1XMQ L;  1XNR L;  3U4V A;  1GO3 E;  2WB1 E;  4HJ5 A;  1IZ6 A;  1K0R A;  3W5O A;  1NMF A;  3MEF A;  4YY3 Q;  3PIO A;  2HHH L;  4OWW B;  3HOY G;  4A3J G;  1V43 A;  4GNX A;  3RN2 A;  2E8G A;  2RHS B;  3H0G G;  1UE5 A;  1LUZ A;  3A5Z B;  3NEM A;  4C2M H;  5C4J H;  2K75 A;  5GRO A;  4DUZ Q;  4OWT B;  5M3F G;  3AQQ A;  3PUX A;  2UUC Q;  4JI4 L;  1AE3 A;  3F1Z A;  4C3J H;  1PV4 A;  3I7F A;  4QJF A;  4IPG A;  3L0O A;  4DR5 L;  3A0J A;  1A62 A;  2L15 A;  3E9H A;  4UY8 C;  4R4T A;  4BBS G;  4GOP C;  3PO2 H;  4LF6 Q;  4XIG S;  1SE8 A;  3G4S A;  1E7Z A;  3ZJY C;  4A75 A;  2CFM A;  1M90 C;  4R1J A;  2IX0 A;  2NZO A;  4HJ8 A;  1VQ9 A;  5ELO A;  4DR3 L;  3S14 H;  5C4X G;  3KFU A;  1OXU A;  2K5H A;  2KHI A;  3GTG H;  1SLJ A;  1CUK A;  2E5L Q;  4ME3 A;  2ALY B;  1C7Y A;  4OX9 L;  2E2H H;  1B8A A;  1PH9 A;  4JI5 L;  1G51 A;  3KDF A;  2UXC Q;  4L5T A;  5AJ3 Q;  1YI2 A;  1HZC A;  1I94 L;  5DLQ E;  2ZTD A;  2ZTC A;  4DPG A;  2UU9 Q;  3CC2 A;  4BA2 I;  4JI2 Q;  1XNQ L;  1MJC A;  4A3C G;  3GTJ H;  2MO0 A;  2CWA A;  2ASB A;  2K52 A;  4JBM A;  3S16 H;  3W1G A;  3M9B A;  1V9P A;  4UP9 A;  1Q7Y C;  1HNX Q;  1Y1W H;  2D62 A;  3FKI H;  3JAM c;  1KC8 C;  1VQP A;  4X65 Q;  3J80 c;  4IFD I;  2PMZ E;  2K14 A;  4LFC Q;  1I3Q H;  3BU2 A;  3HOX H;  3OTO Q;  5GAH C;  4MTN A;  1QUQ A;  4JOI A;  4DV0 Q;  1EIY B;  4R4C A;  2OQK A;  4B3T L;  4A3B G;  4WJ3 M;  1CSQ A;  4OXP A;  2AMC B;  4P72 A;  1KHI A;  4C3I H;  4GKJ L;  2UUA L;  1S40 A;  2AWN A;  3KOJ A;  1PA6 A;  4A3G H;  4A3L H;  4LFB L;  1N32 L;  5GAE C;  1VQ5 A;  2RF4 A;  4PZ8 A;  2HT1 A;  4P71 A;  1GVP A;  2I0Q A;  2UUB L;  1YVC A;  2JA5 H;  4DUY L;  3TS2 A;  3FP9 A;  4DV1 Q;  3A74 A;  1U5K A;  2Z0S A;  2KHJ A;  2VQF Q;  1VQO A;  1Q81 C;  1IBK Q;  1N33 L;  4JYA Q;  3WWV A;  1L1O B;  3BZC A;  1EQQ A;  3S17 H;  4APV A;  1HZA A;  3UE0 A;  4DR7 Q;  3CCS A;  2VY3 A;  4LW1 A;  1HNZ Q;  2N49 A;  1CSP A;  4HJ7 A;  2B63 H;  4JV5 Q;  2AHO B;  2A1A A;  5LMN L;  4LF9 L;  3H3V I;  4IOC A;  1X54 A;  3UE1 A;  4C3H H;  1N34 L;  4LF5 L;  1TWH H;  3CAM A;  3PF4 A;  2HQL A;  3HOX G;  5ELN A;  3RLO A;  5JJK A;  2FXQ A;  5GAD C;  1YHB A;  4DV2 Q;  1D7Q A;  2JJQ A;  5FJ8 G;  1P8L A;  1VQH A;  4A3D H;  4DV5 L;  1KRS A;  4BY1 H;  2CQO A;  3F2C A;  4OO1 G;  4A3G G;  1E1T A;  2R6G A;  4A3L G;  2PQA B;  1X3F A;  1E3P A;  3JAM i;  5IY0 A;  4HIK A;  1WFQ A;  1EYG A;  3J80 i;  4X64 Q;  1WI5 A;  3J7A 5;  2JA5 G;  1CKM A;  3CP0 A;  4LF7 L;  4DR2 Q;  2K5N A;  1YHA A;  1SRU A;  1Y14 B;  4B3S Q;  2KCM A;  1VQE A;  4A3M H;  3S1Q H;  3GTQ H;  2UXD Q;  2IY5 B;  5M3M H;  3A5U A;  4DV4 Q;  4GKK L;  2MNA A;  1QVC A;  1PHJ A;  1X65 A;  3ULP A;  4POF A;  4EQ5 A;  3H15 A;  3HOU H;  3HOY H;  4JI3 L;  3ULL A;  5IYB G;  1TWG H;  3H0G H;  1UEB A;  3CCJ A;  2OQ0 A;  4OWX B;  1A8V A;  4A3I H;  1V1Q A;  4BY1 G;  4QQB X;  2N3S A;  4DV7 L;  4GOP A;  4LUO A;  1PH1 A;  2IHE A;  1HJP A;  2B3G A;  1LM0 A;  1G6P A;  3J81 j;  4LF4 Q;  2PI2 A;  1A63 A;  4DV6 L;  5FLM G;  1VQA A;  2ATW A;  5LMN W;  3CC7 A;  4BBS H;  1J6Q A;  3AFQ A;  4DK6 C;  3GTK H;  1QVG A;  3PV0 A;  3RR5 A;  1XMO L;  2A19 A;  2K50 A;  2IX1 A;  3OYY A;  1XPR A;  2VS1 A;  4A3M G;  1YIJ A;  1S3O A;  4PZ7 A;  2D0O A;  4POG A;  1JJ2 A;  3TRZ A;  4K0K Q;  2OCE A;  3CCL A;  3KF6 B;  4LNQ A;  1PVO A;  4BBR H;  2GVB A;  2HIX A;  1B70 B;  3HOU G;  2EXD A;  1QZH A;  1HR0 W;  3PSI A;  2Q2T A;  4PMW A;  3F8T A;  1QZG A;  4QY7 A;  4A3C H;  4UPA A;  1TWF H;  1WCM H;  5M5W H;  4A3I G;  2OTL A;  1YJN A;  2Q2I A;  1L0W A;  1OXT A;  3CW2 C;  2QA4 A;  2QGQ A;  1UWV A;  4JI1 L;  5IYC H;  1FJG L;  2VZA A;  4IOA A;  1VQK A;  4A3B H;  1KQS A;  4NXN Q;  2DUD A;  2I5M X;  2K4K A;  2JK8 A;  2ZM6 Q;  3CQZ H;  2Z6K C;  3D31 A;  3RZO H;  4QL5 A;  4KHP Q;  4DR4 Q;  2KEN A;  1X3G A;  1VQ4 A;  3Q8D A;  2ID0 A;  3RN5 A;  4BBR G;  2VQE L;  1K8A C;  3GTP H;  1O7I A;  1IBL Q;  4GLA C;  1E1O A;  4B3M Q;  1PH2 A;  3DLL A;  1LTL A;  3AEV A;  1TWA H;  2EQS A;  4LWC A;  3U50 C;  1WCM G;  4DR1 L;  4JI6 Q;  4GLV B;  1Y1V H;  2GVA A;  4YWL A;  1DGS A;  4YY3 L;  5C0X G;  1Q46 A;  3M3Y H;  3I4N G;  3EN2 A;  1RIP A;  4DAY B;  4BY7 G;  3CPF A;  2I5H A;  4P73 A;  2NVT H;  5IYC G;  4DUZ L;  3S1R H;  1J5E Q;  3K7A H;  4IJH A;  4JI8 Q;  4GNX B;  5GAG C;  2UUC L;  5FJ8 H;  3T1Y Q;  1L2F A;  4WJ4 A;  2VW9 A;  3IRB A;  2YTY A;  1PH5 A;  4B3R Q;  2LXJ A;  5IE8 A;  1IBM L;  4IPC A;  2AKW B;  5LMN Q;  3M4P A;  1AE2 A;  1X9N A;  1TWC H;  2JE6 I;  2F4V Q;  3CCM A;  2JA7 H;  3STB C;  2CKZ B;  4LF6 L;  2UXB Q;  4UP8 A;  1N36 Q;  2WP8 J;  1LYL A;  1VQB A;  1OXV A;  3PF5 A;  4JI7 Q;  4HJA A;  4J15 A;  1CKN A;  2YTX A;  1VQC A;  1QVF A;  2Q2U A;  4JBK A;  3PO3 H;  1I5F A;  3TQY A;  3HOV G;  5GQO A;  3S2D H;  2UXC L;  1Y1V G;  3PUY A;  3CC4 A;  4ALP A;  1HR0 Q;  1EFW A;  1YNX A;  1I6H H;  2UU9 L;  3E9I A;  4DAM A;  4JI2 L;  2JA8 G;  1VQG A;  3KDF B;  2JA9 A;  4LFA Q;  1HH2 P;  5IYB H;  4AYB G;  4X62 Q;  1C9O A;  1KRT A;  1HNW Q;  5LMU L;  1M1K C;  1HNX L;  3HOZ G;  4AYB E;  4X66 Q;  1L1O C;  1IL2 A;  5HGQ A;  5IP7 G;  4DR6 Q;  1NBW A;  1Q86 C;  4LFC L;  5IP9 G;  2IHF A;  1A0I A;  5BR8 Q;  4JI0 Q;  3OTO L;  4NXM Q;  2JA7 G;  3CCE A;  3GTO H;  4A3E H;  3RZD H;  5FLM H;  3KJP A;  3RNU A;  2JEA I;  4DV3 Q;  5IWA Q;  1P16 A;  1MIU A;  2ZJR A;  1QUQ B;  4P74 A;  3GO5 A;  4AQY Q;  1K9M C;  3JC6 6;  5HY6 A;  1W2B A;  5K36 G;  5JJI A;  3PO3 G;  5C44 H;  1FGU A;  3VDY A;  4DK3 C;  2KBN A;  4IFD J;  1PH7 A;  1JE5 A;  4LF8 L;  1VS0 A;  4DV1 L;  1IBK L;  2YTV A;  2VQF L;  4JYA L;  4A93 G;  4DV6 Q;  1PH8 A;  1GD7 A;  1OXX K;  1VQN A;  1VQ7 A;  3CCV A;  1YJW A;  3I4O A;  2ES2 A;  1XPU A;  4DR7 L;  4JG2 A;  4DNI A;  4OO1 I;  1WYD A;  1X6O A;  2MFI A;  1HNZ L;  2XGT A;  1PH6 A;  5JJL A;  3CCQ A;  4R4I A;  1Q1E A;  2YYZ A;  3S24 A;  1UE6 A;  4L5R C;  4XTC S;  4BA1 I;  1KAW A;  1X3E A;  1JJC B;  4PZ6 A;  1MKH A;  3T1H Q;  4A3F H;  3B6Y A;  1XMQ Q;  4R4Q A;  1E24 A;  1XNR Q;  3CD6 A;  2HHH Q;  4DV2 L;  2NN6 G;  4A3E G;  3U58 A;  3TRE A;  1XJV A;  4L5S A;  3ULJ A;  4YCU A;  4IPD A;  3I56 A;  2CWP A;  4JCV E;  1EIF A;  1Q8K A;  1WOC A;  3KLW A;  3HFZ B;  5C44 G;  1N9W A;  3ER0 A;  3W1B A;  4X64 L;  1JMC A;  4JI4 Q;  1JB7 A;  3GDE A;  3CXC A;  1FL0 A;  1YHQ A;  4JBW A;  3DM3 A;  4O2D A;  1SRO A;  4DR5 Q;  1NTG A;  2R7F A;  4QGU A;  3OW2 A;  4A3K G;  1T9H A;  2D0P A;  3K8A A;  4AIM A;  3PUW A;  4DR2 L;  3I55 A;  1PFS A;  4B3S L;  3KYH C;  4R4O A;  3KJO A;  2UXD L;  1VQJ A;  2V1C C;  4DV4 L;  3HKS A;  4TQU S;  5EAY A;  4UP7 A;  1Z47 A;  2NVY H;  4DR3 Q;  4GN4 B;  1K73 C;  1GKH A;  1YEZ A;  4A3F G;  3FHW A;  3I4N H;  4OX9 Q;  4KLK A;  4GN5 A;  4BY7 H;  1WJJ A;  3I2Z A;  3MXN B;  4RG1 A;  4JI5 Q;  3K80 C;  3PCO B;  3PIP A;  2JA6 H;  1X56 A;  1I94 Q;  1X55 A;  3RLN A;  4YHH L;  3EIV A;  4HJ9 A;  1YIT A;  1XNQ Q;  3LGJ A;  3ICE A;  2WB1 G;  4GLX A;  2BA1 A;  4DR1 Q;  2NZH A;  3E0E A;  5IT9 c;  4LF4 L;  2R93 H;  2F3I A;  4GOP B;  5J3B A;  2JQO A;  3S1M H;  4A4I A;  3TS0 A;  2B29 A;  3K0X A;  1H95 A;  3M4Q A;  4HIM A;  4JC0 A;  1BVS A;  1BKB A;  3BZK A;  4B3T Q;  3CME A;  1Q12 A;  4GKJ Q;  2UUA Q;  1OTC A;  4A76 A;  3NEL A;  4EX5 A;  1R9T H;  1BBW A;  1IBM Q;  3HOV H;  4LFB Q;  4K0K L;  2Q2H A;  1N32 Q;  1JJG A;  2N8N A;  4JBJ A;  1VQ6 A;  5E7N A;  4L5Q A;  2E2I H;  3H3V H;  2UUB Q;  1VQL A;  1L1O A;  3L7Z C;  3UDG A;  2A8V A;  4DUY Q;  2JA8 H;  1HZ9 A;  4IJL A;  5JEA J;  3G6E A;  1N33 Q;  2JA6 G;  4IFD G;  1Z9F A;  3CCR A;  4FDB A;  1EQR A;  4GS3 A;  3HKZ G;  3HOZ H;  3SGI A;  1NMG A;  5IP7 H;  1VQM A;  3GD7 A;  3HKZ E;  4P75 A;  1YJ9 A;  2R93 G;  1XTD A;  5IP9 H;  2ZJP A;  4LF9 Q;  1B7Y B;  4IPH A;  1VCI A;  2BH2 A;  3M85 A;  1N34 Q;  4LF5 Q;  2R7Z H;  4NXN L;  3CF5 A;  3HOW H;  2PI2 E;  2ZM6 L;  3F2D A;  1I50 H;  4GN3 B;  1UE1 A;  1C0A A;  1SR3 A;  5C0X I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...