3PF4A

Crystal structure of bs-cspb in complex with r(gucuuua)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/rna
molecule keywords Cold shock protein cspB
publication title RNA single strands bind to a conserved surface of the major cold shock protein in crystals and solution.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pf4A00
1B7YB 4OONA 1I94L 2CWAA 1YVCA 5LMNL 2AMCB 4A3GG 1XPRA 4POFA 2JA9A 4YHHQ 4DV1L 1TWAH 3PV0A 1WJJA 3CMEA 1AE3A 1X55A 1VQGA 2JQOA 2NN6I 2QEXA 1P16A 1QVCA 4C2MH 3JAMc 4DV7Q 4LWCA 5M5XH 1A8VA 4DV6Q 3OW2A 1WCMH 4O0AA 1KQSA 4OO1G 4AYBE 5IYBH 2UXCQ 1KAWA 3TEHB 1L1OC 4DV5Q 3S2HH 2I5LX 3UE1A 1K9MC 1EIFA 1B70B 4LF8Q 2JA6G 2ZJRA 3RN2A 4IPCA 3PIPA 4B3SQ 3F2DA 4JV5Q 4DR4Q 3AFPA 3CCSA 2UUAL 1K3RA 1H95A 3I4NH 4DR3L 3UDIA 4A3LG 4PZ8A 4LFAL 2NVQH 4R4QA 1IYJB 5JJIA 1Z47A 4A3DH 3DLLA 1VQLA 4NXNQ 4GKJQ 3A74A 3TQYA 5LMUL 4A3KH 4A3MH 1VQKA 4EQ5A 4Y52H 1VQNA 4APVA 2GVAA 5C0XI 3RNUA 2ES2A 3H3VI 2R7ZG 1XPUA 3M4OH 1PA6A 4UY8C 3L2PA 4DR5L 3JAMi 1HR0Q 3GTPH 1S3OA 4B3ML 1ASYA 4K0KL 4A4IA 2HHHL 1JJGA 5IYDH 1I3QH 1GM5A 4DR7L 2AWNA 3HKZG 1IBMQ 4DUYL 2B63H 2FXQA 1MIUA 4QY7A 4A3JH 1QZGA 4B3TQ 4DAMA 1M90C 3ZJYC 1E7ZA 5JJLA 1K0RA 4GLXA 4DR1Q 4MZ9A 2ATWA 1FJGQ 1N32Q 4X62L 4GS3A 2QA4A 4A3EH 3KYHC 1K73C 3S2DH 1JJ2A 1E1TA 1OXSC 1VQFA 3H0GG 5GQOA 2K5VA 3HOZG 3CC7A 4C3JH 2JA7H 3ULPA 1DGSA 2E8GA 3FKIH 3HFZB 2R7FA 4BA2I 3BJUA 4JI8L 4JYAQ 4MNOA 4LF7Q 1CKNA 3Q8DA 4KHPQ 2ZM6Q 2WB1G 1P8LA 2ZTEA 2BH2A 5BR8L 3M3YH 1JJCB 4R4TA 3I4MH 1VQ6A 2UUCL 1VQMA 4YCVA 1CUKA 2JA8H 3U50C 5C3EH 5EAYA 4MTNA 1OXXK 4AQYQ 2Q2UA 5H1SE 3M4QA 5C0XJ 1NMGA 2UU9L 4LUZA 1N36Q 3EIVA 5JJKA 4H02A 3ULLA 4J15A 1WOCA 4PG3A 1KRSA 2IT1A 5C4JH 3CD6A 3JC66 4AH6A 1SLJA 2VQEL 1EQQA 2F4VQ 3A5ZB 1Y1VG 4YWKA 2EIFA 3F2BA 1HNZQ 2A1AA 4TVAB 3UDGA 4OWXB 3RR5A 3RZOH 2I5HA 3CC4A 1HZBA 1RL2A 4YCUA 4IFDG 4X66Q 4IPHA 4JI6L 4Y7NH 3T1HQ 1XMQQ 2WB1E 3KJOA 1EIYB 1PH9A 2XGTA 1XMOQ 1VQPA 3NENA 2K5NA 1SN8A 2I0QA 2D0OA 4LF9L 2CCZA 3H15A 4RG1A 3RLFA 1IBLQ 4BBRG 3S15H 1V43A 3CQZH 1I6HH 1IZ6A 4YWLA 3H3VH 3HOVG 4DV5L 1S40A 4YY3Q 1PYBA 3HOXG 1VQDA 4P74A 3W1BA 5IWAQ 3HOUH 1HNWQ 5ELNA 4JI5Q 3MXNB 1W3SA 1L0WA 2MNAA 4BY7H 4DV2Q 1VQIA 2XTIA 5JEAJ 5IYCG 3K81C 5GAGC 4A3IH 3WWVA 2MQHA 4JI1L 1VCIA 5E7NA 2GN5A 3F8TA 4LFBL 4JI3L 4NXNL 3DM3A 3G48A 1IBKL 2PMZE 3M85A 5J3BA 3U58A 1C7YA 4OX9Q 1FL0A 3PO2G 4BBSH 2K50A 4KLKA 4L5QA 4GNXB 2E2JH 1Q82C 5C4XG 1HR0L 1G291 1X56A 3CP0A 2ALYB 4JCVE 1N33Q 2R93H 3PUZA 1IBML 2K5HA 1YEZA 5C44H 3GTGH 1TWGH 4LNQA 4UP8A 2RCNA 1N34Q 4DNIA 2YTXA 1VQ9A 1YHQA 1FJGL 3KF8B 2Q2IA 1Q46A 1X6OA 5IYBG 1YHAA 4POGA 3RLNA 1NJIC 1PH8A 3PCOB 1K8GA 3F1ZA 2YTVA 4P75A 2JJQA 4QJFA 4X65L 4DKAC 5DLQE 3ULJA 2CQOA 2NVYH 4JI4Q 3B6YA 3J80c 4A3DG 4NXML 4BXXG 1Q8KA 4A75A 4XIGS 3PGZA 1J5EQ 3PUYA 4A3KG 5HGQA 3CAMA 4A3MG 2EQSA 2QGQA 4DR2L 1HNWL 4WJ3M 4GLVB 1C9OA 1XNQL 1W2BA 1YITA 1VQAA 3KOJA 1N36L 3TS2A 2R92G 1SRUA 2I5MX 3CCJA 4ALPA 1QVGA 3E9HA 4GNXA 4JI0L 4R1JA 4A3FG 2ZJQA 1I5FA 3CCRA 2OTLA 1U0LA 2BA1A 1XNRQ 4GOPB 1PVOA 1FVIA 3SGIA 1KIXA 5M5YH 1SE8A 3D0FA 5FJ8H 1E3PA 3KFUA 1VQEA 1VQJA 4A3EG 5IP9G 1E1OA 1MKHA 2KBNA 2N8NA 3J80i 4X66L 4X64Q 1Q12A 3FKIG 1I50H 3I55A 4IPDA 2VUMG 4DV3Q 5IP7H 4L5SA 4LF6L 1VQ4A 4GNXC 4LFCL 1K83H 4LF5L 4GKKQ 2OQKA 2E5LL 1IL2A 3BU2A 1TWFH 4JI2Q 4JBKA 4YCWA 2HT1A 1QUQB 4DV0L 3VDYA 4JBMA 3I4MG 1BVSA 3L7ZC 3RLOA 3FP9A 5C3EG 2BA0A 4DAYB 4B3RQ 2CKZB 3FHWA 2Z6KA 3HOYG 2RHQB 2JA6H 1VQ7A 2JA5H 4IFDI 3M9BA 4JBJA 3HOWG 1UE7A 4P71A 1NY4A 2VNUD 2EXDA 3S1NH 4A3LH 1TWHH 4R4IA 2D0PA 1LYLA 3T1YL 1UEBA 2RF4A 5GAEC 3G71A 1U5KA 2RHSB 2WFWA 2R6GA 5M3MG 1VS0A 4DUZL 1Y1WG 1Q7YC 1HR0W 1VQ8A 3HKSA 3UDFA 1HNXL 1CKOA 2YU9H 4PMWA 4DV4L 3S16H 2UXDQ 5AJ3Q 1VQCA 2A19A 4GOPA 3HKZE 4XTCS 1PH2A 1JMCA 2Z6KC 3GTMH 4HJAA 4UP9A 1I94Q 4UPAA 1PV4A 1GVPA 1HZCA 5LMNQ 3J81c 1EFWA 1Q86C 3G6EA 1EYGA 3PO3G 1JB7A 4DV1Q 2UUBL 4LW1A 4RMFA 4LF4Q 3STBC 2HQLA 5C0XG 4HIMA 3K0XA 5FLMH 2ZJPA 3LGJA 1KC8C 3HOUG 4GOPC 2H5XA 1QUQA 2DGYA 4BY7G 3D31A 4YHHL 1EOVA 2MO1A 3NELA 4QQBX 1SR3A 3E0EA 1OTCA 4JI7Q 2E2HH 2Q2HA 1CSQA 1EUJA 1HZ9A 3G4SA 3CCQA 4C3HH 2NVTH 4DV7L 2UUAQ 1YJNA 2ZTDA 4DV6L 1NTGA 4DR3Q 3TRZA 2JEBI 4A3CG 4LFAQ 3U4ZA 3GTOH 1HJPA 1YHBA 2UXCL 3PSIA 1SMXA 3CCMA 1YNXA 4BBSG 4LF8L 2KHJA 4KHZA 3J81i 1HZAA 1GD7A 3E9IA 1T9HA 3MEFA 5LMUQ 3GD7A 4B3SL 1KHIA 4O2DA 4L5RC 1NMFA 4JV5L 4DR4L 2R93G 4A3BH 4QL5A 4DR5Q 3S14H 2KCMA 2CFMA 4B3MQ 4K0KQ 2HHHQ 1Q1EA 4GKJL 3KDFB 3I56A 1XNRL 1L1OB 2LSSA 4DUYQ 2JE6I 2PQAB 4LUVA 3CCVA 3PF4A 3CMAA 2YV5A 3F2CA 1RIPA 5GROA 4OO1I 1Y1VH 1OXTA 2IHFA 1PH6A 1MJCA 3CPFA 3K80C 4JC0A 3U4VA 4X62Q 2K14A 4BY1H 1YBYA 5JEAG 3PUWA 1EQRA 4IOCA 1Y14B 4P72A 4EX5A 4B3TL 2KCTA 4NB3A 1V9PA 1N9WA 1LTLA 2KENA 4FDBA 4JI8Q 3J7ZC 4DR1L 4A93H 4GKKL 1BKBA 1N32L 1WCMG 5M3FH 4JBWA 5BR8Q 3I7FA 1WYDA 1L2FA 1VQHA 2CWPA 2UUCQ 3HOVH 1KD1C 1PH3A 1N8RC 3S1RH 4DR6Q 3PIOA 1OXVA 2Y0SG 5GAHC 1V1QA 2PI2A 5HY6A 4JYAL 4LF7L 4KHPL 2ZM6L 4OXPA 1O7IA 3I4NG 3J81j 5IYCH 4GN5A 3KJPA 2F52A 2HIVA 2JEAI 3A0JA 4JOIA 2VQFQ 4OWTB 3CCUA 1LM0A 4AQYL 2VQEQ 2ASBA 1SROA 4KI0A 4GN4B 5FLXc 5AJ3L 1BBUA 3PO2H 2UXDL 1D7QA 3KDFA 1A62A 4R4CA 5C4XH 2PQAA 4BA1I 2KHIA 1YJWA 5IYDG 3EN2A 1R9TH 3K8AA 4JI6Q 2B63G 5IP7G 2VZAA 4A3JG 1Q81C 2F4VL 1J6QA 5M5WH 1PH1A 4LUOA 2N78A 3K7UC 2V1CC 2OTJA 1PH5A 2D62A 3GTKH 4JOIC 1X65A 1HNZL 4LF4L 4GN3B 4LF9Q 2OQ0A 1X3FA 3S24A 1YJ9A 2Y0SE 1QVFA 1CKNB 3T1HL 5ELOA 1XMQL 2JA7G 1K8AC 1X3EA 3EBEA 3NBHB 1OXUA 1PHJA 4A3GH 2JA5G 4JI7L 3ER0A 2LXKA 3PF5A 1XMOL 2A8VA 1ASZA 1AH9A 4DK6C 1NBWA 3GO5A 3OTOQ 2B29A 2OWOA 1IBLL 4C3IH 3CC2A 4JI1Q 2AHOB 3W5OA 1NE3A 2MFIA 1X3GA 4HJ8A 4LFBQ 4JI3Q 2AWOA 1IBKQ 2JA8G 4BXXH 2C35B 4YY3L 2K52A 4DPGA 3K7AH 5IWAL 3BZCA 4JI5L 5IY0A 2LXJA 2N3SA 1Z9FA 4DV2L 4IJHA 1UWVA 2OCEA 2ZTCA 1PH4A 1D8LA 1G51A 3UE0A 2UXBQ 3CF5A 2R92H 2ID0A 1VQ5A 4A3FH 3CXCA 2NN6G 2AKWB 2E2IH 4OWWB 2VW9A 3CPWA 4OX9L 4L5TA 4PZ7A 4QIWE 1Q1BA 3CW2C 1UE1A 2WP8J 3RN5A 1YIJA 3BZKA 1AE2A 2R7ZH 2PNHA 5GADC 5IP9H 1N33L 3M7NA 5FLMG 2VS1A 3I2ZA 1HH2P 2NZOA 1N34L 2VUMH 2F3IA 1JE5A 4X65Q 4HJ7A 4R4OA 3PUVA 2B3GA 3OYYA 1FGUA 3S17H 3TREA 2VY3A 3NEMA 2BH8A 2K4KA 1JT8A 2IX1A 3IRBA 3J7A5 4IPGA 3H0GH 4NXMQ 2K75A 1GKHA 3CCLA 3GTLH 3W1GA 4DR6L 2GVBA 3HOZH 2VL6A 4DR2Q 4IOAA 1KRTA 1XNQQ 3HOYH 2Z0SA 4A3BG 4A3IG 1CKMA 4IFDJ 3HOWH 4JI4L 2NZHA 2YYZA 4X6AH 4JI0Q 3GTQH 2IHEA 3KF6B 2VQFL 1J5EL 3S1MH 1XJVA 1EWIA 3TS0A 1Y1WH 5M3MH 4TQUS 2WAQG 3L0OA 4HIOA 1LUZA 2Q2TA 4BY1G 1X54A 3PUXA 1VQOA 5LMNW 4DK3C 3ERSX 4ME3A 5C44G 4A76A 4DR7Q 1C0AA 4HIKA 4HJ9A 2IY5B 1UE5A 3STBD 3UDXA 4A93G 1PYSB 3GTJH 4LF6Q 4LFCQ 1PH7A 4LF5Q 3PO3H 1YZ6A 1B8AA 2MO0A 3AQQA 3M4PA 2E5LQ 5M3FG 1S72A 2PI2E 1E24A 3S1QH 4DV0Q 2N49A 4X64L 4GLAC 4DV3L 1CSPA 5IT9c 4IO9A 1TWCH 1WFQA 1UE6A 3AFQA 3ICEA 5IE8A 1E22A 3OTOL 4HJ5A 4WJ4A 5K36G 1QZHA 4AIMA 4JI2L 1A63A 1KXLA 4PZ6A 4A3CH 1XTDA 2WAQE 3T1YQ 4BBRH 4B3RL 4JG2A 2JK8A 4DUZQ 1MJEA 4UP7A 2YTYA 2HIXA 4YWMA 4AYBG 3HOXH 1YI2A 4QGUA 3KF6A 1SFOH 4DV4Q 2DUDA 1HNXQ 3AEVA 1G6PA 4NPSA 3GDEA 1X9NA 1TXYA 4IJLA 2UXBL 3AYHB 2NVXH 2UU9Q 2IX0A 4P73A 4HIDA 3KLWA 1XPOA 1VQBA 3CCEA 2R7DA 1PFSA 1WI5A 1IXRA 1A0IA 5FJ8G 1KL9A 3I4OA 2UUBQ 1GO3E 2L15A 1L1OA 1BBWA 1M1KC 3RZDH 3A5UA
chains in the Genus database with same CATH superfamily
1B7YB 1UEAB 4HSVA 1I94L 3WOFA 1JB3A 1AE3A 1VQGA 2JQOA 2NN6I 4C3IG 3JAMc 3OW2A 1HNWQ 1KDBA 2JN4A 2LY7A 1WCMH 4O0AA 1CK1A 4AYBE 5I9PA 1KAWA 1L1OC 3OSOA 3S2HH 5G3LF 1Q8IA 1EIFA 3F2DA 2F03A 4JV5Q 1H95A 2L1BA 1KAAA 4JPBW 2NBFA 3DLLA 4LK1C 3FMCA 4EQ5A 1VQNA 4APVA 5C0XI 3RNUA 2ES2A 3H3VI 1RF2D 5C6AA 4A3FB 4DNRB 3L2PA 1HR0Q 3JAMi 1SE4A 2SOBA 3GTPH 1S3OA 1FR3A 2E2IB 4H0LC 5CV4A 2EJMA 1JJGA 5IYDH 4B3TQ 1MIUA 3RMHA 2K6AA 3ZJYC 1GOZA 2ATWA 3S2DH 3HKZB 3KBXA 3HOZG 3ULPA 3HFZB 1LTTD 2FJ2A 1CKNA 1TT2A 1JORA 3H0GB 3W3AA 1P8LA 1EY5A 2BH2A 1JJCB 2X6LA 1VQ6A 3A7LA 1STNA 3HOYB 2JA8H 1QILA 2ICEC 4KJOA 4MTNA 5EAYA 2J0TD 4RAUC 5EKLA 3T16A 1WTVA 1NMGA 1KDCA 1Y1WB 5M3MB 1KRSA 3CD6A 1A2TA 1EQQA 5CMDA 1Y1VG 1R4QB 2A1AA 3UDGA 3RZOH 1SJHD 3KLSA 1AN8A 1RL2A 5JVH3 4JI6L 3J80L 2WB1E 4XQNA 4HSPA 4UHVA 1VQPA 3BVGA 2K5NA 4LF9L 3Q23A 4YWLA 3HOVG 2B2UA 1S40A 3HOXG 1A15A 1W3SA 1Y8PB 2WV6D 4DV2Q 5IYCG 5GAGC 2MQHA 4F88A 2F0HA 2GN5A 3F8TA 4JI3L 5FKAC 3DM3A 1SFOB 2PMZE 3M85A 1GUSA 2DJFC 3PO2G 3TDQA 5J22A 1HQRD 3WOEA 2EYJA 1SNOA 4XDXA 4GNXB 4V190 1HR0L 1X56A 1KLUD 1PZID 2ALYB 3A8JE 1G6ZA 1PRTB 2K5HA 1DONA 1TWGH 1HA5A 4LNQA 1SSOA 1N34Q 1H9SB 2N88A 4B08A 3KF8B 3RZDB 2PW5A 1X6OA 1ENFA 3MEHA 1YHAA 4HCEA 3SE0A 1PH8A 4RHRA 3PCOB 3DUZA 1K8GA 2OF1A 1CTMA 3F1ZA 4QUCA 4TRDA 1SYFA 4OGQC 4QJFA 1TQOA 2PZWA 3B6YA 1Q8KA 1J5EQ 3PGZA 3HG9A 3OOCA 5HGQA 2QGQA 4CJ0B 4GLVB 3I4NB 1YITA 2DNEA 3HRZC 1JOKA 3TS2A 3N52A 4JI0L 4GNXA 4A3MB 1SNPA 2EJFC 3M4OB 2BA1A 4KJNA 1PVOA 1E3PA 4O1NA 2D5DA 1D2BA 1I3QB 1STBA 3OWEB 2K01A 2B63B 2IX3A 1H9SA 1MKHA 2KBNA 3KF8A 1LTBD 4IPDA 1LABA 4A3EB 1TWFH 3NSWA 3K5LA 4JI2Q 1S5DD 1QUQB 4DV0L 3FKIB 1DOKA 3L7ZC 1JR0D 1G2TA 2F0PA 1GUTA 2CKZB 4U68A 4F87A 3IAYA 2JA5H 3M3YB 2IW3A 1SBBB 3BVMA 3HOWG 2VNUD 4P71A 5T1IA 2EXDA 4A3LH 4R4IA 2YU9H 1UAPA 1HNXL 2WKCA 4QF4A 2IWHA 2UXDQ 4JK1C 3MA2B 1JMCA 2Z6KC 4MTKA 3GTMH 2CW0C 1ESFA 4PNYA 1ET6A 2F4IA 4LW1A 1ONLA 4LAAA 4PQXA 3H6MA 2K05A 1KC8C 4GOPC 1QUQA 1EOVA 1PFBA 5EPKA 4XT3B 1EUJA 4C3HH 4RCOA 1PDQA 4DV6L 3EA6A 3U4ZA 4M8AA 2RSNA 2RDFA 4BY7B 3FPPA 2HDMA 2K28A 3R3OA 2Q8TA 5LMUQ 4B3SL 1PTOF 1NMFA 4DR4L 2CH4W 5EPLA 5KYIA 5CV5A 3Q0AA 3S14H 4B3MQ 3NTIA 4K0KQ 3KDFB 3J81E 1L1OB 4ZUJA 4DUYQ 2PQAB 1HTPA 4K6DA 3CMAA 3NWSA 1RIPA 4OO1I 2R93B 2KVMA 3I91A 1PZJD 1HXYD 2B8FA 4KKUA 5JEAG 3GTGB 1YNJD 4IFDH 2B2YC 1Y14B 4EX5A 2PZTA 4NB3A 3J7ZC 4DR1L 4OHJA 5D14A 3I7FA 1WYDA 3MFGA 1EFID 4CDFC 4ME5A 2CH4A 4DR6Q 3PIOA 2Y0SG 5GAHC 5HY6A 4JYAL 3HP3A 1SNQA 2NYZD 3J81j 1G2SA 2PPBC 2CVRA 5T1GA 2A6HD 3A0JA 1T5EA 4K8JA 3VR6A 2VQFQ 3C3LA 5EGTA 2UXDL 1F9PA 4GN4B 2A5HA 5FLXc 1BBUA 3KDFA 3MAQA 3BDOA 2PQAA 3DWAA 2R3ZA 4FXDA 1YJWA 3FPUB 1XTCD 2LS01 2O4XA 2F4VL 4LUOA 2E74C 2N78A 5KIXA 2V1CC 1C4QA 4JOIC 3Q6SA 4GN3B 4KV6A 1I50B 5FK9C 1YJ9A 1EY6A 1DD2A 4C3JG 2JA7G 3NBHB 3T51B 1OXUA 3IL8A 2JA5G 3PIO3 5I2YA 2WINB 3I70A 3MZ5A 1ASZA 1HPCA 1NBWA 4DK6C 5IGBA 1EU3A 2C9OA 2B29A 3OMCA 4JI1Q 1WTHA 1NE3A 2MFIA 4FXGC 1X3GA 2AWOA 1IBKQ 2C35B 3DHQA 4CKCA 4JI5L 1JWUD 5IY0A 2N3SA 1Z9FA 1TWHB 3DEPA 1A3TA 1UWVA 3BS1A 3UE0A 1U4PA 3TN2A 2K32A 4A3FH 1GUGA 2E2IH 3S16B 4OX9L 3CW2C 1BUVT 1YIJA 3NUCA 2A74C 2PNHA 1N33L 1STGA 3C2PA 2VS1A 1HH2P 4FF1A 1O7ZA 2KJXA 2HUGA 3D3RA 2F3IA 1STYA 4C3HG 3NBHA 1X3QA 2VY3A 1SYGA 1JT8A 2PCFB 3H0GH 4DR6L 2VL6A 2NVTB 2Z4IA 4NDXA 2BDOA 3HOYH 2QF7A 3NQIA 2Z0SA 3GTOB 4A3IG 1UUPA 2D2CC 3L9AX 4JI4L 2ICIA 1PTOB 1D1IA 2VQFL 1EWIA 1FNUA 1Y1WH 5M3MH 4KN4C 4A3BB 2WAQG 1KNEA 3TZUA 4JVZA 4ME3A 2JSOA 5E1FA 4LF6Q 4LFCQ 1H9KA 3AQQA 2E5LQ 1QJOA 5IODA 4X64L 5ELCA 1T5XD 1CSPA 1BO0A 3R93A 1WFQA 2BE5C 2KCCA 1ENAA 3ICEA 4AIMA 1A63A 2TSSA 1YNND 4PZ6A 4ZRZA 3BYTB 1B3AA 2RDHA 3TP5A 1M8AA 4IUNA 4DUZQ 5C3WA 2YTYA 2HIXA 1TS4A 1II3A 4AYBG 1M4VA 1SFOH 1X9NA 2WACA 4IJLA 3KLWA 1FNVA 2PNRC 3MTSA 5C4XB 3TP6A 5FJ8G 1GJXA 2L15A 3BYYB 3RZDH 3CXCA 1RTOA 5IT9E 4POFA 3KBGA 4YHHQ 1OO9B 4DV1L 1WJJA 3BG3A 1J8IA 4DV7Q 1KQSA 2D9UA 4A3GB 2UXCQ 4DV5Q 5ELBA 2AQ1B 2I5LX 4G4KA 4TSSA 4LF8Q 2JA6G 2ZJRA 3RN2A 3PIPA 3EVQA 1K3RA 1HUMA 3I4NH 4PZ8A 2HQEA 1Z47A 4GKJQ 5KGUA 3A74A 1JE4A 1SAPA 3TQYA 4A3MH 2L55A 1I4XA 3M4OH 1PZKD 1JOQA 1PA6A 1ICFB 4DR5L 1X3PA 4CDDC 2HHHL 1I3QH 1GM5A 2AWNA 3HKZG 2B63H 2K7VA 3E0JA 1STHA 4FVMA 1N32Q 1LT3D 4X62L 4GS3A 4A3EH 3KYHC 1SYCA 1I6VC 1OXSC 3H0GG 2VUMB 1RHPA 1DGSA 3FKIH 5D3IB 1HCZA 2B39A 1IW7D 1PRTD 3PIP3 4LF7Q 4CBVA 2ZM6Q 1D5XC 2WB1G 3TBIB 1BCPF 5BR8L 3M3YH 4R4TA 3ND9A 2UUCL 4YCVA 1CUKA 4AQYQ 4I7AA 3V05A 2Q2UA 1F9QA 1K0SA 4LUZA 4H02A 3R8BA 4PG3A 5G3LD 1STAA 4PMCA 2AQ3B 2NN6H 4AH6A 2VQEL 3A5ZB 3SVMA 2Z6BA 2F0FA 4K2LA 2K04A 1EY4A 4TVAB 1E2WA 1EZ8A 4OWXB 3RR5A 4WORA 4YCUA 3GTJB 2NTTA 3KJOA 3M7GA 3S15B 3S1QB 4DXGA 4RCNA 1Q90A 3RLFA 4XXEA 5COYA 2EY5A 1EYCA 3E3XA 3H3VH 5C0XH 2NWGA 4DV5L 1BBXC 4YY3Q 1QG7A 5ELNA 3MXNB 4BY7H 4HMIA 4NW2A 2MNAA 5JEAJ 2XTIA 4ZK9B 2DY8A 1CHPD 1CA5A 5M9OA 3ZYYX 3G48A 4DF7A 2A69C 4QB4A 1FL0A 4KLKA 1B4OA 3H94A 4HTHA 1G291 2R93H 2E2DC 2QCPX 3PUZA 1FYCA 4MIUA 3GTGH 1SXTA 4UP8A 2YTXA 3CU7A 4XYOA 5A2QL 2SNMA 4RFBA 4OEMB 1PRTF 1NJIC 1MSGA 1LTSD 2F0SA 2JJQA 5EPJA 4DK0A 4X65L 4DKAC 5DLQE 2CQOA 2L0CA 3NK9A 3T56B 2O5JC 5K36H 3MXNA 4BXXG 4XIGS 4A3MG 2EQSA 1C9OA 4DNTB 4O42A 1XNQL 2NVQB 3RUZA 1VQAA 2AUJD 2HCIA 3F2UA 2Z4HA 3VYRA 4A3DB 2R92G 1BXTA 4R1JA 4A3KB 2OTLA 1U0LA 2A68D 1FVIA 1U4RA 3SGIA 2RVLA 4A3EG 1KTKA 4BWGB 5IP9G 3EFXD 4A3JB 3O13A 3FKIG 1I50H 1X32A 2ZXPA 3R2TA 4L5SA 2OQKA 3BU2A 4XYQA 5CV6A 4YCWA 4JBMA 2EY2A 2FINB 1BCPB 4B3RQ 3H09A 3FHWA 3BVZA 5EJWA 2RHQB 3A7AB 1I4QA 1VQ7A 2F0EA 3I4MB 1NY4A 1TWHH 5C3EB 4KKSA 1UEBA 3G71A 2RHSB 3Q22A 2R6GA 2L9HA 1GHKA 3S16H 3A54A 1EYDA 2SNSA 1SYBA 3HKZE 1PH2A 4UP9A 1PV4A 5LMNQ 3J81c 1GHJA 1HQMC 3PO3G 2UUBL 3QO2A 5I2XA 1QCBD 4IURA 3STBC 4Y7NB 1Y8OB 5C0XG 2SEBD 4HIMA 5FLMH 2ZJPA 3LGJA 1MSHA 3ERQA 5JPMC 2H5XA 5EBDA 1L0XB 4Z9CB 4BY7G 3D31A 2MO1A 3NELA 4QQBX 1K8OA 1OTCA 1LTRD 1CSQA 2Q2HA 3CQZB 2NVTH 2BCOA 2UUAQ 5IGEA 1HNWL 2ZTDA 4DR3Q 1NTGA 4A3CG 4LFAQ 3GTOH 5DM63 4K5WA 1PTOH 1YNXA 2X69A 1A3VA 4KHZA 3J81i 1HZAA 5FO9B 1U4LA 1EYAA 4JV5L 2R93G 3NP8A 4A3BH 4QL5A 2KCMA 2PZUA 2X6GA 2E2JB 2G9HD 3CCVA 2IHFA 1XX8A 4OL7A 1PH6A 3CPFA 2K14A 5C44B 1IYVA 1EQRA 4IOCA 1BDOA 4B3TL 2A6ED 2XWBB 4DK1A 1RODA 4FDBA 4JI8Q 1EIHA 3LWEA 1BKBA 3MXGA 2L12A 1WCMG 3MC0B 3BDCA 1VQHA 4IUQA 3S1RH 2F0VA 5C5LA 1V1QA 4F7XA 3GQBA 4BS9A 1S5BD 1LO5D 1O7IA 2F52A 2QDBA 5JPNC 1GUNA 2OEOA 3CCUA 1LM0A 3HS0C 1RD9D 2MHVA 2ASBA 1HRJA 1V8QA 2Z8LA 5C4XH 3MWYW 2KHIA 2Q8RE 3P1HA 5IYDG 3K8AA 2L11A 4Q0FA 1J6QA 1PH1A 1PTOD 3K7UC 2OTJA 3A56A 3ITPA 4G7OC 3HZXA 4X3KA 5CYUA 3TSSA 3D6CA 1X3FA 1QVFA 1NUCA 1O7YA 3LNNA 1K83B 5ELOA 1GUOA 3J7AF 1TKWB 4A3GH 3QOJA 1BR9A 2PO4A 3PF5A 4FNFA 2A8VA 3IKJA 3GO5A 3I3CA 2AHOB 4LFBQ 4OO1H 5EKKA 2JA8G 4FO2A 1EWHA 2B2TA 4DV2L 2ZTCA 1PH4A 2RKSA 2UXBQ 3CF5A 3KK7A 1VQ5A 2RQXA 3EROA 1EY9A 1ZYRD 1O80A 3VR4A 4PZ7A 1Q1BA 1UE1A 3RN5A 2B2WC 1AE2A 4LMQD 5FLMG 1RCVD 1B1ZA 3FRPB 1K8MA 1N34L 5BN5A 2VUMH 1U4MA 3QR8A 4ZCKA 2XNAC 1FGUA 3CRKC 2K4KA 3OIQA 4QMGA 2IX1A 5IGCA 2CQAA 4NXMQ 2E2HB 1H9MA 4DR2Q 1F2ZA 4A3BG 1ML0D 2KCNA 1PLFA 1J5EL 5BN3A 1PXUA 4RGMA 3FVQA 4TQUS 3L0OA 3N6RA 4HIOA 3V96A 1AZPA 3R2IA 4N9PA 5ELDA 4K6LA 3SR1A 4DR7Q 1Y1VB 3A55A 4HJ9A 1NNXA 3UDXA 1YNJC 3GTJH 3KLRA 4LF5Q 1B8AA 2MO0A 3M4PA 2EYHA 1GUWA 2XN9C 2F0QA 1DYQA 1CM9A 1E24A 2BOSA 3P75A 3S1QH 2N49A 2QILA 4GLAC 4A93B 2EYOA 5IT9c 4IO9A 1UE6A 4U673 3K57A 1FNWA 5M3FB 3I4LA 1QZHA 4JI2L 3HOVB 2LFNA 5D65A 3FEWX 1XTDA 3T1YQ 4JG2A 2GA4B 4J1MA 4UP7A 2A6HC 4KKTA 1B9NA 4QGUA 4DV4Q 3AEVA 1G6PA 2EJGC 2EE1A 2UXBL 5CV9A 2UU9Q 2XWJB 4HIDA 3PO2B 3KUPA 5CBEE 1VQBA 2F0GA 5KNBA 1PFSA 1A0IA 1B50A 1V1PB 3RD4A 5I9OA 1L1OA 3G6JB 2F3VA 1BBWA 1H9RA 3OHXC 4HAEA 1M1KC 2B2VC 2CWAA 1YVCA 4A3GG 1WD0A 1MI2A 2EYLA 2JA9A 3CMEA 2K33A 1X55A 1QVCA 4LWCA 2QEJC 1EEID 4OO1G 4IN3A 3TEHB 1EEFD 2G5DA 1B70B 3AFPA 4A3LG 2E75C 1LV9A 3CRLC 3QOLA 5C4HA 2NVQH 4R4QA 1IYJB 2EYFA 1Z7TA 3GP7A 2NUCA 4A3DH 4NXNQ 1IL8A 3BDLA 5LMUL 4A3KH 1U9RA 2GVAA 2O5IC 3K0YA 4UY8C 4B3ML 1V1PA 4A4IA 4K0KL 4DR7L 4DUYL 2FXQA 4QY7A 4A3JH 3SXHA 2R7ZB 4FP5D 1E7ZA 5JJLA 2Z9HA 4GLXA 1I4GA 3DXJC 3NE5B 1K73C 2CHBD 1JJ2A 3SK8A 1VQFA 4ZLTF 5GQOA 3SK4A 4ZUIA 3CC7A 2VXWA 3S17B 4IUUA 3BJUA 4KHPQ 3Q8DA 4LJZC 4YIJA 3URYA 1C8CA 2ZTEA 3VA7A 3SHLA 3I4MH 1VQMA 1F2YA 3U50C 5C3EH 1OXXK 3HOWB 3T53B 1KLGD 4CDCC 4HR7B 3M4QA 5FO7B 5C0XJ 3GTQB 3S1MB 2UU9L 2F0NA 1TY2A 3VA5A 1WOCA 1O78A 3JC66 1EQVA 4FYDA 2G9DA 2I07B 5KYLA 1XWEA 2L5TA 3F2BA 1HNZQ 1A2UA 4RKBA 2I5HA 1HZBA 2QKIC 4IFDG 4X66Q 4IPHA 3JAML 4Y7NH 3T1HQ 1XMQQ 5A2QE 1JWMD 1EIYB 2XGTA 4HCSA 1XMOQ 3NENA 1PYWD 1SN8A 3EQLC 2I0QA 4RG1A 1IBLQ 1V43A 3CQZH 1IZ6A 4G57A 1VQDA 3AU7A 4P74A 3W1BA 5IWAQ 4IZ8A 1L0WA 2M00A 1VQIA 2K03A 3I72A 4PMBA 4BBRB 3WWVA 4JI1L 2LKVA 5E7NA 1I6HB 4NXNL 2BDNA 1IBKL 4H13C 2M9VA 5J3BA 4RH6A 1C7YA 2K50A 3DM1A 2NVXB 2E2JH 2B2UC 2FFKB 1BCPD 3LX0A 4FF2A 4L8JA 1WTRA 5C44H 1F9SA 2RCNA 4DGZA 1KNAA 1LLRD 3IFTA 4ZQ3A 3U9SA 4K5VA 4EQNA 2XRSD 1HFNA 3RLNA 2EPBA 1TWAB 5LL6S 4C2MB 3SDZA 3UI2A 5M5XB 4GZYC 1WTOA 1SMYD 5CV7A 1ENCA 1CQVA 2F0KA 4A3DG 2RA4A 4UAIA 4HEDA 2JP1A 1MD2D 4A75A 1EQTA 3C46A 3PUYA 4A3KG 3CAMA 4S3SA 4FF3A 3MVVA 4ZKBB 3J81L 3KOJA 4N9TA 2I5MX 3CCJA 4ALPA 3QWNA 4KY5A 3D8GA 3HEJA 4A3FG 3CCRA 2FHTA 4GOPB 1KIXA 1SE8A 3QJYA 3D0FA 1R4PB 1VQJA 4KY6A 4FF4A 4OIKA 4CKBA 2TMPA 4X66L 2XSCA 2IL8A 3I55A 4DV3Q 2F0OA 5IP7H 4LF6L 4GNXC 4LFCL 3E5SA 1K83H 4GKKQ 2E5LL 4JBKA 4C3JB 3J80E 2HT1A 2RBMA 3VDYA 3I4MG 2JA7B 3VYUA 1BVSA 1IW7C 1PRTC 2WKDA 5C3EG 4DAYB 1LTGD 1ILPA 5E4XA 2Z6KA 4ZYSA 3HOYG 3IFDA 2EXZA 2KQ3A 2DNCA 2KOLA 3HGBA 1LT5D 1LYLA 2RF4A 1U5KA 2WFWA 1Y1WG 5M3MG 1VQ8A 1VS0A 4DUZL 4IALA 1Q7YC 1HR0W 3HKSA 3UDFA 1CKOA 4PMWA 5KRUA 4RWSC 3OPOA 4GOPA 5C4JB 3LWUA 4HJAA 1I94Q 3G6EA 4KK7A 1JB7A 4RMFA 4LF4Q 3M4YA 2HQLA 2SDFA 3K0XA 2EVBA 1MBYA 5CR3A 4YHHL 2E2HH 4DV7L 1YJNA 3TRZA 1D5ZC 2JEBI 4CGYB 2EY6A 3HOUB 1HJPA 1YHBA 2UXCL 2MGSA 3CCMA 4RGOS 4LF8L 3I73A 4A3IB 3E9IA 1SYEA 3MEFA 4L5RC 1KHIA 4O2DA 2B2YA 5EQ0A 4OIJA 4RHSA 2KEDA 2CFMA 4BBSB 4GKJL 3I56A 1SJED 2WAQB 3PF4A 5I6YA 3E6ZX 4PV1C 2YV5A 5GROA 1Y1VH 1OXTA 1MJCA 3K80C 4JC0A 4KTAA 5E4WC 3VYSA 4EQPA 3D4WA 3PUWA 3DWQA 2KCTA 2AUKA 2KA7A 1V9PA 1N9WA 1LTLA 2KENA 4GKKL 1CQFA 4A93H 4QUFA 1N32L 1MHWC 4Q5VA 3S9WA 4L6TB 4JBWA 5M3FH 1QNKA 1V1OA 1L2FA 5KEEA 2EYMA 3HOVH 1PH3A 4DN4M 2NVYB 1JQYD 2PI2A 4LF7L 5CORA 2ZM6L 4OXPA 3I4NG 5IYCH 4GN5A 3KJPA 4KMUC 1EY8A 2JEAI 1DOMA 4DU9A 1I4RA 2J7ZA 4JOIA 3W2DA 3P7JA 4AQYL 3PO2H 4R8NA 3H3VC 4R4CA 4BA1I 1ICWA 3A8IE 4K14A 5M5YB 1K3BC 4JI6Q 2B63G 5IP7G 2VZAA 1Q81C 4CDEC 5ISRA 1WVLA 2D62A 1PH5A 1X65A 4V0BA 4RGTA 3PMFA 4LF4L 4LF9Q 2OQ0A 1ZKOA 1QNUA 1CKNB 1K8AC 1X3EA 2RDGA 1PHJA 1Z6HA 3ER0A 2LXKA 1CFMA 5IGGA 2F0IA 2LMCB 3C1FA 4QIWB 1BQQT 5I6WA 5DNFA 2F1MA 4KN7C 4HJ8A 4JI3Q 2JA6B 4DA2A 4YY3L 1VF7A 1STEA 3S1NB 1SE2A 4IJHA 2F0WA 1D8LA 1G51A 2ID0A 1SNCA 2NN6G 4OWWB 5ELEA 3CPWA 4QIWE 3TMEA 2B8GA 2M2LA 5IT9L 2K5QA 2R7ZH 1RKNA 5GADC 3DMUA 2F0DA 3GV3A 2NZOA 1FGBD 1EIGA 2F0UA 2EOTA 1JE5A 4R4OA 2ZXRA 3S17H 3TREA 1WTQA 2BH8A 1TIID 3P20A 3IRBA 1B2TA 3J7A5 4IPGA 4B9WA 1NCVA 5I4DA 4C56C 1ET9A 2WB1B 1A3UA 2EYPA 4IFDJ 2N55A 3HOWH 5FLXL 2C5CA 4JI0Q 3GTQH 1C48A 1WTWA 2XRQD 3S1MH 1CZWA 1SEBD 3DWPA 1CHQD 1B9MA 1LUZA 5KNDA 1A6XA 1VQOA 2F0TA 1LT4D 4WRDA 4IUPA 1C0AA 2IY5B 2PMZB 3STBD 1JOOA 4A93G 1PYSB 4BY1B 1DOLA 1YZ6A 5DM73 5M3FG 2A6EC 5DEHA 1S72A 5AFWA 1B44D 1RTNA 4DV0Q 4JW0A 3C1EA 3CHBD 1PFNA 4ILWA 5IE8A 1E22A 3ONAB 4HJ5A 5K36G 4OELB 1KXLA 2QW7A 1LT6D 3I90A 2FMCA 1WTPA 1L0YB 4BBRH 4XQJA 4B3RL 3A8KE 1EZ6A 2V4DA 5DAUA 2J4XA 1I6HH 4F8MA 1YI2A 1HNXQ 1UNSA 2DUDA 1QWYA 3GDEA 3CKIB 1K28A 3AYHB 2NVXH 3NXWA 2NTSA 2IX0A 4P73A 1XPOA 5IGDA 3CCEA 2R7DA 1WI5A 1IXRA 5ELFA 1KL9A 3EJIA 4NMZA 5EKIA 1GO3E 4XQQA 2EDGA 1R9TB 1EWCA 1PTOC 2DJGC 2F0JA 4MN3A 5M5WB 5JEAH 3A5UA 5CGKA 1F2MA 4OONA 1G91A 3GTKB 5LMNL 2AMCB 1AEXA 2K5WA 3V2TA 1XPRA 1DCZA 4NKLA 2E76C 1TWAH 3PV0A 4IQZA 1KDAA 1VMPA 4K2KA 1MGSA 2QEXA 1P16A 4C2MH 1ZXTA 3D4DA 5M5XH 1A8VA 4DV6Q 4C1NI 5IYBH 2DN8A 4ABNA 3OWFA 3UE1A 1K9MC 4P2CB 4C3IB 4IPCA 4B3SQ 4DR4Q 3CCSA 3J7AV 2UUAL 4DR3L 3UDIA 1PMRA 4LFAL 3K7AB 5JJIA 4B9XA 1VQLA 3K5NA 1NR4A 3X3MA 4Y52H 1VQKA 2JYOA 2R7ZG 2R92B 1ZYRC 1XPUA 1F2LA 1ASYA 1IBMQ 4RKLA 1QZGA 4DAMA 1M90C 1K0RA 4ODGA 4DR1Q 4MZ9A 3JAME 1FJGQ 4EVOA 2QA4A 1E1TA 5JAVA 2K5VA 4C3JH 2JA7H 2E8GA 2R7FA 4R9WA 4BA2I 4JI8L 1IHZA 4JYAQ 4MNOA 4WJWA 1AFPA 2RSOA 2K1BA 3GTLB 2R61A 3HOZB 4G7ZC 3D4RA 2F3WA 2IPKD 4CJ2C 2P5ZX 4C1NK 5H1SE 4TKOB 4N8FA 1N36Q 1S5CD 3EIVA 5JJKA 3ULLA 4J15A 1TS2A 2Q8IB 2IT1A 5HGTA 3VR2A 1QE6A 5C4JH 1XXGA 1TR5A 1SLJA 2F4VQ 4YWKA 2EIFA 3NWTA 2MUYA 5E3FA 2CW0D 5K5PA 4CJ1B 3CC4A 3T4AC 3DEOA 4QCLA 1BF4A 4HMJA 2K5DA 5CC4A 1NAPA 3PO3B 1PH9A 2AQ2B 3Q24A 3H91A 1D1KA 2D0OA 2CCZA 3H15A 4BBRG 3S15H 1TWCB 5J1ZA 4R8IA 4E6IA 1PYBA 3HOUH 4JI5Q 3K81C 4A3IH 3WDNA 2Z1CA 1VCIA 2KECA 4LFBL 3HOXB 3U58A 4OX9Q 5C3XA 4BBSH 1E2ZA 4L5QA 1JC7A 1HA6A 1Q82C 1LTAD 5C4XG 3CP0A 4JCVE 1N33Q 4DXFA 2EZVA 5BN4A 4CKEA 1IBML 4N8X1 1YEZA 1WTXA 1IKMA 4X3SA 4DNIA 1VQ9A 1QOHA 1YHQA 1FJGL 1SYDA 1HFGA 2Q2IA 1Q46A 5CV8A 5IYBG 4POGA 1W6KA 1ESRA 1BOSA 1XYIA 2YTVA 4P75A 4NP5A 3FDTA 1WCMB 3VR5A 3ULJA 1D6EC 2NVYH 4JI4Q 3S2HB 1EY7A 3J80c 4NXML 4WJ3M 4DR2L 5JOBA 2RCFA 1W2BA 2MJ8A 1N36L 1LTID 1SRUA 2VB3X 1QVGA 3E9HA 2ZJQA 1I5FA 3KLSX 5IGFA 1XNRQ 3NBIA 5M5YH 4I7ZC 3GTPB 5FJ8H 3KFUA 1VQEA 5D3DA 3D6WA 4ZKCB 3NQTA 1E1OA 2N8NA 3J80i 5J39A 4X64Q 1Q12A 3QIAA 5A35A 2VUMG 1TS3A 3OW7A 2ZXOA 5C4ZA 1VQ4A 4LF5L 3S2DB 1DJRD 1IL2A 4M1UB 1S4ZA 1SE3A 1IKLA 4CHTB 3RLOA 3FP9A 2BA0A 2ZT9C 2JA6H 1FD7D 4IFDI 3M9BA 4JBJA 1UE7A 3GV6A 2HCCA 3S1NH 2JA8B 2D0PA 3T1YL 5GAEC 1NSNS 3U9OA 3NTKA 2VB2X 4ULLA 1W6JA 4DV4L 3VR3A 1SDFA 1VQCA 5AJ3Q 4EGVA 2A19A 3T13A 4XTCS 3NPPA 1F9RA 3PQIA 4UPAA 1GVPA 1HZCA 1EFWA 1VF5C 1EYGA 1E0BA 4DV1Q 3RZOB 4ZAIA 3OMGA 3K58A 1DZ1A 4DAVA 3HOUG 4KD3A 4L63B 2DGYA 3G7LA 3L3OC 1SR3A 3E0EA 4JI7Q 2PYKA 1HZ9A 3G4SA 3CCQA 2NB0A 2DY7A 3PSIA 1SMXA 4BBSG 2KHJA 1YNNC 1Q86C 1HHVA 1GD7A 1T9HA 1IYUA 3GD7A 1CI3M 5CBAE 1B53A 1Y8NB 4DR5Q 3SK6A 1BCPC 3SK5A 2XVSA 1Q1EA 2HHHQ 1XNRL 2LSSA 4ID6A 2JE6I 4LUVA 4IUVA 3F2CA 4G7HC 1WD1A 1I4HA 2PQEA 1JCKB 2KUMA 3U4VA 3NTHA 4X62Q 3K59A 1YBYA 2QDLA 4BY1H 1TWGB 1S5FD 4WFN3 1HUNA 4P72A 1TU2B 5JVG3 2XIWA 1JICA 2O2LD 2OXPA 3QG1A 5NUCA 1VDZA 1E2VA 4J8QA 3AB9A 5BR8Q 3S1RB 2BE5D 2CWPA 1SMYC 2MPMA 2UUCQ 1KD1C 1H9JA 5F2DA 1F77A 1N8RC 1CZGA 1BNZA 1OXVA 4KHPL 5LL6X 5KNCA 1EY0A 1EU4A 2HIVA 2F0LA 2WIIB 4KD4A 4OWTB 2Y0SB 5JJZA 2VQEQ 1SROA 1LACA 4KI0A 5AJ3L 1D7QA 1A62A 3I8ZA 3EN2A 1R9TH 1EL0A 1JWSD 4A3JG 2OT2A 5M5WH 4RGNA 4J6HA 3K6OA 1CA6A 3GTKH 1HNZL 4FXKC 3S24A 1HTLD 5FOBB 1AZQA 2KHSA 4X3UA 2Y0SE 3T1HL 1XMQL 3EBEA 1J9OA 1TWFB 4DFAA 1KABA 4JI7L 1XMOL 2HD3A 1QB5D 1AH9A 3OTOQ 1RJTA 2OWOA 4H44C 1IBLL 4C3IH 3CC2A 1GXDC 1TS5A 3W5OA 4H7BA 3OIPA 2H1EA 3QB3A 2B2WA 4BXXH 2JA5B 2K52A 4DPGA 3K7AH 5FLXE 5IWAL 3BZCA 2LXJA 1VMCA 4K5XA 1G8ZD 2OCEA 2EY1A 3J7YW 2R92H 2YU9B 2NZ1D 2JXMB 3K5OA 2AKWB 1DM0B 2VW9A 1TY0A 4L5TA 5C5MA 1Y69U 2WP8J 4IUTA 3BZKA 1ILQA 2KEEA 4DAPA 3GTMB 1CT1D 1SNDA 5IP9H 3M7NA 3ND8A 2HDLA 3I2ZA 3AMUA 2B2TC 3TP7A 1RDPD 2I46A 4X65Q 4HJ7A 3PUVA 2B3GA 3MXUA 3OYYA 4EQOA 3NEMA 3NHHA 4KY7A 2K75A 1GKHA 3CCLA 3GTLH 3W1GA 2GVBA 3HOZH 1EOTA 1I4PA 3TP8A 1AP0A 3TZDA 4C3HB 4IOAA 1KRTA 1XNQQ 4K8IA 4DAYA 1CKMA 3K5MA 2NZHA 2YYZA 4X6AH 1NR2A 2IHEA 5L37A 3KF6B 2MP1A 1TVXA 5IIFA 1XJVA 2F0MA 3TS0A 5LHY1 3S14B 1Q3LA 4UDUC 1B3QA 3MFYA 2Q2TA 4BY1G 1X54A 3PUXA 5LMNW 4DK3C 3MHBA 3ERSX 2FMMA 5C44G 4A76A 2ENBA 4HIKA 1UE5A 3BZDB 3X3NA 1PH7A 3PO3H 1ZEQX 2PI2E 4RA8A 4DV3L 3VYTA 1TWCH 4XT1B 2H4OA 3AFQA 2PW7A 5IOCA 1PFMA 4HN7A 3OTOL 1S5ED 4WJ4A 2A73B 5TSSA 1D5MC 4A3CH 2WAQE 4KHVA 2JK8A 1MJEA 1DXMA 4YWMA 3HOXH 3KF6A 2B2VA 4NPSA 1TXYA 2L4NA 5EBCA 2A69D 1SNMA 5HURA 4MHEA 5FO8B 4AYBB 1AW7A 4I65A 2IJ0A 3I4OA 1O7LA 2UUBQ 3MXPA 2A68C 4X3TA 3SEBA
chains in the Genus database with same CATH topology
1B7YB 4OONA 1I94L 2CWAA 1YVCA 5LMNL 2AMCB 4A3GG 1XPRA 4POFA 2JA9A 4YHHQ 4DV1L 1TWAH 3PV0A 1WJJA 3CMEA 1AE3A 1X55A 1VQGA 2JQOA 2NN6I 2QEXA 1P16A 1QVCA 4C2MH 3JAMc 4DV7Q 4LWCA 5M5XH 1A8VA 4DV6Q 3OW2A 1WCMH 4O0AA 1KQSA 4OO1G 4AYBE 5IYBH 2UXCQ 1KAWA 3TEHB 1L1OC 4DV5Q 3S2HH 2I5LX 3UE1A 1K9MC 1EIFA 1B70B 4LF8Q 2JA6G 2ZJRA 3RN2A 4IPCA 3PIPA 4B3SQ 3F2DA 4JV5Q 4DR4Q 3AFPA 3CCSA 2UUAL 1K3RA 1H95A 3I4NH 4DR3L 3UDIA 4A3LG 4PZ8A 4LFAL 2NVQH 4R4QA 1IYJB 5JJIA 1Z47A 4A3DH 3DLLA 1VQLA 4NXNQ 4GKJQ 3A74A 3TQYA 5LMUL 4A3KH 4A3MH 1VQKA 4EQ5A 4Y52H 1VQNA 4APVA 2GVAA 5C0XI 3RNUA 2ES2A 3H3VI 2R7ZG 1XPUA 3M4OH 1PA6A 4UY8C 3L2PA 4DR5L 3JAMi 1HR0Q 3GTPH 1S3OA 4B3ML 1ASYA 4K0KL 4A4IA 2HHHL 1JJGA 5IYDH 1I3QH 1GM5A 4DR7L 2AWNA 3HKZG 1IBMQ 4DUYL 2B63H 2FXQA 1MIUA 4QY7A 4A3JH 1QZGA 4B3TQ 4DAMA 1M90C 3ZJYC 1E7ZA 5JJLA 1K0RA 4GLXA 4DR1Q 4MZ9A 2ATWA 1FJGQ 1N32Q 4X62L 4GS3A 2QA4A 4A3EH 3KYHC 1K73C 3S2DH 1JJ2A 1E1TA 1OXSC 1VQFA 3H0GG 5GQOA 2K5VA 3HOZG 3CC7A 4C3JH 2JA7H 3ULPA 1DGSA 2E8GA 3FKIH 3HFZB 2R7FA 4BA2I 3BJUA 4JI8L 4JYAQ 4MNOA 4LF7Q 1CKNA 3Q8DA 4KHPQ 2ZM6Q 2WB1G 1P8LA 2ZTEA 2BH2A 5BR8L 3M3YH 1JJCB 4R4TA 3I4MH 1VQ6A 2UUCL 1VQMA 4YCVA 1CUKA 2JA8H 3U50C 5C3EH 5EAYA 4MTNA 1OXXK 4AQYQ 2Q2UA 5H1SE 3M4QA 5C0XJ 1NMGA 2UU9L 4LUZA 1N36Q 3EIVA 5JJKA 4H02A 3ULLA 4J15A 1WOCA 4PG3A 1KRSA 2IT1A 5C4JH 3CD6A 3JC66 4AH6A 1SLJA 2VQEL 1EQQA 2F4VQ 3A5ZB 1Y1VG 4YWKA 2EIFA 3F2BA 1HNZQ 2A1AA 4TVAB 3UDGA 4OWXB 3RR5A 3RZOH 2I5HA 3CC4A 1HZBA 1RL2A 4YCUA 4IFDG 4X66Q 4IPHA 4JI6L 4Y7NH 3T1HQ 1XMQQ 2WB1E 3KJOA 1EIYB 1PH9A 2XGTA 1XMOQ 1VQPA 3NENA 2K5NA 1SN8A 2I0QA 2D0OA 4LF9L 2CCZA 3H15A 4RG1A 3RLFA 1IBLQ 4BBRG 3S15H 1V43A 3CQZH 1I6HH 1IZ6A 4YWLA 3H3VH 3HOVG 4DV5L 1S40A 4YY3Q 1PYBA 3HOXG 1VQDA 4P74A 3W1BA 5IWAQ 3HOUH 1HNWQ 5ELNA 4JI5Q 3MXNB 1W3SA 1L0WA 2MNAA 4BY7H 4DV2Q 1VQIA 2XTIA 5JEAJ 5IYCG 3K81C 5GAGC 4A3IH 3WWVA 2MQHA 4JI1L 1VCIA 5E7NA 2GN5A 3F8TA 4LFBL 4JI3L 4NXNL 3DM3A 3G48A 1IBKL 2PMZE 3M85A 5J3BA 3U58A 1C7YA 4OX9Q 1FL0A 3PO2G 4BBSH 2K50A 4KLKA 4L5QA 4GNXB 2E2JH 1Q82C 5C4XG 1HR0L 1G291 1X56A 3CP0A 2ALYB 4JCVE 1N33Q 2R93H 3PUZA 1IBML 2K5HA 1YEZA 5C44H 3GTGH 1TWGH 4LNQA 4UP8A 2RCNA 1N34Q 4DNIA 2YTXA 1VQ9A 1YHQA 1FJGL 3KF8B 2Q2IA 1Q46A 1X6OA 5IYBG 1YHAA 4POGA 3RLNA 1NJIC 1PH8A 3PCOB 1K8GA 3F1ZA 2YTVA 4P75A 2JJQA 4QJFA 4X65L 4DKAC 5DLQE 3ULJA 2CQOA 2NVYH 4JI4Q 3B6YA 3J80c 4A3DG 4NXML 4BXXG 1Q8KA 4A75A 4XIGS 3PGZA 1J5EQ 3PUYA 4A3KG 5HGQA 3CAMA 4A3MG 2EQSA 2QGQA 4DR2L 1HNWL 4WJ3M 4GLVB 1C9OA 1XNQL 1W2BA 1YITA 1VQAA 3KOJA 1N36L 3TS2A 2R92G 1SRUA 2I5MX 3CCJA 4ALPA 1QVGA 3E9HA 4GNXA 4JI0L 4R1JA 4A3FG 2ZJQA 1I5FA 3CCRA 2OTLA 1U0LA 2BA1A 1XNRQ 4GOPB 1PVOA 1FVIA 3SGIA 1KIXA 5M5YH 1SE8A 3D0FA 5FJ8H 1E3PA 3KFUA 1VQEA 1VQJA 4A3EG 5IP9G 1E1OA 1MKHA 2KBNA 2N8NA 3J80i 4X66L 4X64Q 1Q12A 3FKIG 1I50H 3I55A 4IPDA 2VUMG 4DV3Q 5IP7H 4L5SA 4LF6L 1VQ4A 4GNXC 4LFCL 1K83H 4LF5L 4GKKQ 2OQKA 2E5LL 1IL2A 3BU2A 1TWFH 4JI2Q 4JBKA 4YCWA 2HT1A 1QUQB 4DV0L 3VDYA 4JBMA 3I4MG 1BVSA 3L7ZC 3RLOA 3FP9A 5C3EG 2BA0A 4DAYB 4B3RQ 2CKZB 3FHWA 2Z6KA 3HOYG 2RHQB 2JA6H 1VQ7A 2JA5H 4IFDI 3M9BA 4JBJA 3HOWG 1UE7A 4P71A 1NY4A 2VNUD 2EXDA 3S1NH 4A3LH 1TWHH 4R4IA 2D0PA 1LYLA 3T1YL 1UEBA 2RF4A 5GAEC 3G71A 1U5KA 2RHSB 2WFWA 2R6GA 5M3MG 1VS0A 4DUZL 1Y1WG 1Q7YC 1HR0W 1VQ8A 3HKSA 3UDFA 1HNXL 1CKOA 2YU9H 4PMWA 4DV4L 3S16H 2UXDQ 5AJ3Q 1VQCA 2A19A 4GOPA 3HKZE 4XTCS 1PH2A 1JMCA 2Z6KC 3GTMH 4HJAA 4UP9A 1I94Q 4UPAA 1PV4A 1GVPA 1HZCA 5LMNQ 3J81c 1EFWA 1Q86C 3G6EA 1EYGA 3PO3G 1JB7A 4DV1Q 2UUBL 4LW1A 4RMFA 4LF4Q 3STBC 2HQLA 5C0XG 4HIMA 3K0XA 5FLMH 2ZJPA 3LGJA 1KC8C 3HOUG 4GOPC 2H5XA 1QUQA 2DGYA 4BY7G 3D31A 4YHHL 1EOVA 2MO1A 3NELA 4QQBX 1SR3A 3E0EA 1OTCA 4JI7Q 2E2HH 2Q2HA 1CSQA 1EUJA 1HZ9A 3G4SA 3CCQA 4C3HH 2NVTH 4DV7L 2UUAQ 1YJNA 2ZTDA 4DV6L 1NTGA 4DR3Q 3TRZA 2JEBI 4A3CG 4LFAQ 3U4ZA 3GTOH 1HJPA 1YHBA 2UXCL 3PSIA 1SMXA 3CCMA 1YNXA 4BBSG 4LF8L 2KHJA 4KHZA 3J81i 1HZAA 1GD7A 3E9IA 1T9HA 3MEFA 5LMUQ 3GD7A 4B3SL 1KHIA 4O2DA 4L5RC 1NMFA 4JV5L 4DR4L 2R93G 4A3BH 4QL5A 4DR5Q 3S14H 2KCMA 2CFMA 4B3MQ 4K0KQ 2HHHQ 1Q1EA 4GKJL 3KDFB 3I56A 1XNRL 1L1OB 2LSSA 4DUYQ 2JE6I 2PQAB 4LUVA 3CCVA 3PF4A 3CMAA 2YV5A 3F2CA 1RIPA 5GROA 4OO1I 1Y1VH 1OXTA 2IHFA 1PH6A 1MJCA 3CPFA 3K80C 4JC0A 3U4VA 4X62Q 2K14A 4BY1H 1YBYA 5JEAG 3PUWA 1EQRA 4IOCA 1Y14B 4P72A 4EX5A 4B3TL 2KCTA 4NB3A 1V9PA 1N9WA 1LTLA 2KENA 4FDBA 4JI8Q 3J7ZC 4DR1L 4A93H 4GKKL 1BKBA 1N32L 1WCMG 5M3FH 4JBWA 5BR8Q 3I7FA 1WYDA 1L2FA 1VQHA 2CWPA 2UUCQ 3HOVH 1KD1C 1PH3A 1N8RC 3S1RH 4DR6Q 3PIOA 1OXVA 2Y0SG 5GAHC 1V1QA 2PI2A 5HY6A 4JYAL 4LF7L 4KHPL 2ZM6L 4OXPA 1O7IA 3I4NG 3J81j 5IYCH 4GN5A 3KJPA 2F52A 2HIVA 2JEAI 3A0JA 4JOIA 2VQFQ 4OWTB 3CCUA 1LM0A 4AQYL 2VQEQ 2ASBA 1SROA 4KI0A 4GN4B 5FLXc 5AJ3L 1BBUA 3PO2H 2UXDL 1D7QA 3KDFA 1A62A 4R4CA 5C4XH 2PQAA 4BA1I 2KHIA 1YJWA 5IYDG 3EN2A 1R9TH 3K8AA 4JI6Q 2B63G 5IP7G 2VZAA 4A3JG 1Q81C 2F4VL 1J6QA 5M5WH 1PH1A 4LUOA 2N78A 3K7UC 2V1CC 2OTJA 1PH5A 2D62A 3GTKH 4JOIC 1X65A 1HNZL 4LF4L 4GN3B 4LF9Q 2OQ0A 1X3FA 3S24A 1YJ9A 2Y0SE 1QVFA 1CKNB 3T1HL 5ELOA 1XMQL 2JA7G 1K8AC 1X3EA 3EBEA 3NBHB 1OXUA 1PHJA 4A3GH 2JA5G 4JI7L 3ER0A 2LXKA 3PF5A 1XMOL 2A8VA 1ASZA 1AH9A 4DK6C 1NBWA 3GO5A 3OTOQ 2B29A 2OWOA 1IBLL 4C3IH 3CC2A 4JI1Q 2AHOB 3W5OA 1NE3A 2MFIA 1X3GA 4HJ8A 4LFBQ 4JI3Q 2AWOA 1IBKQ 2JA8G 4BXXH 2C35B 4YY3L 2K52A 4DPGA 3K7AH 5IWAL 3BZCA 4JI5L 5IY0A 2LXJA 2N3SA 1Z9FA 4DV2L 4IJHA 1UWVA 2OCEA 2ZTCA 1PH4A 1D8LA 1G51A 3UE0A 2UXBQ 3CF5A 2R92H 2ID0A 1VQ5A 4A3FH 3CXCA 2NN6G 2AKWB 2E2IH 4OWWB 2VW9A 3CPWA 4OX9L 4L5TA 4PZ7A 4QIWE 1Q1BA 3CW2C 1UE1A 2WP8J 3RN5A 1YIJA 3BZKA 1AE2A 2R7ZH 2PNHA 5GADC 5IP9H 1N33L 3M7NA 5FLMG 2VS1A 3I2ZA 1HH2P 2NZOA 1N34L 2VUMH 2F3IA 1JE5A 4X65Q 4HJ7A 4R4OA 3PUVA 2B3GA 3OYYA 1FGUA 3S17H 3TREA 2VY3A 3NEMA 2BH8A 2K4KA 1JT8A 2IX1A 3IRBA 3J7A5 4IPGA 3H0GH 4NXMQ 2K75A 1GKHA 3CCLA 3GTLH 3W1GA 4DR6L 2GVBA 3HOZH 2VL6A 4DR2Q 4IOAA 1KRTA 1XNQQ 3HOYH 2Z0SA 4A3BG 4A3IG 1CKMA 4IFDJ 3HOWH 4JI4L 2NZHA 2YYZA 4X6AH 4JI0Q 3GTQH 2IHEA 3KF6B 2VQFL 1J5EL 3S1MH 1XJVA 1EWIA 3TS0A 1Y1WH 5M3MH 4TQUS 2WAQG 3L0OA 4HIOA 1LUZA 2Q2TA 4BY1G 1X54A 3PUXA 1VQOA 5LMNW 4DK3C 3ERSX 4ME3A 5C44G 4A76A 4DR7Q 1C0AA 4HIKA 4HJ9A 2IY5B 1UE5A 3STBD 3UDXA 4A93G 1PYSB 3GTJH 4LF6Q 4LFCQ 1PH7A 4LF5Q 3PO3H 1YZ6A 1B8AA 2MO0A 3AQQA 3M4PA 2E5LQ 5M3FG 1S72A 2PI2E 1E24A 3S1QH 4DV0Q 2N49A 4X64L 4GLAC 4DV3L 1CSPA 5IT9c 4IO9A 1TWCH 1WFQA 1UE6A 3AFQA 3ICEA 5IE8A 1E22A 3OTOL 4HJ5A 4WJ4A 5K36G 1QZHA 4AIMA 4JI2L 1A63A 1KXLA 4PZ6A 4A3CH 1XTDA 2WAQE 3T1YQ 4BBRH 4B3RL 4JG2A 2JK8A 4DUZQ 1MJEA 4UP7A 2YTYA 2HIXA 4YWMA 4AYBG 3HOXH 1YI2A 4QGUA 3KF6A 1SFOH 4DV4Q 2DUDA 1HNXQ 3AEVA 1G6PA 4NPSA 3GDEA 1X9NA 1TXYA 4IJLA 2UXBL 3AYHB 2NVXH 2UU9Q 2IX0A 4P73A 4HIDA 3KLWA 1XPOA 1VQBA 3CCEA 2R7DA 1PFSA 1WI5A 1IXRA 1A0IA 5FJ8G 1KL9A 3I4OA 2UUBQ 1GO3E 2L15A 1L1OA 1BBWA 1M1KC 3RZDH 3A5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7Y B;  4OON A;  1I94 L;  2CWA A;  1YVC A;  5LMN L;  2AMC B;  4A3G G;  1XPR A;  4POF A;  2JA9 A;  4YHH Q;  4DV1 L;  1TWA H;  3PV0 A;  1WJJ A;  3CME A;  1AE3 A;  1X55 A;  1VQG A;  2JQO A;  2NN6 I;  2QEX A;  1P16 A;  1QVC A;  4C2M H;  3JAM c;  4DV7 Q;  4LWC A;  5M5X H;  1A8V A;  4DV6 Q;  3OW2 A;  1WCM H;  4O0A A;  1KQS A;  4OO1 G;  4AYB E;  5IYB H;  2UXC Q;  1KAW A;  3TEH B;  1L1O C;  4DV5 Q;  3S2H H;  2I5L X;  3UE1 A;  1K9M C;  1EIF A;  1B70 B;  4LF8 Q;  2JA6 G;  2ZJR A;  3RN2 A;  4IPC A;  3PIP A;  4B3S Q;  3F2D A;  4JV5 Q;  4DR4 Q;  3AFP A;  3CCS A;  2UUA L;  1K3R A;  1H95 A;  3I4N H;  4DR3 L;  3UDI A;  4A3L G;  4PZ8 A;  4LFA L;  2NVQ H;  4R4Q A;  1IYJ B;  5JJI A;  1Z47 A;  4A3D H;  3DLL A;  1VQL A;  4NXN Q;  4GKJ Q;  3A74 A;  3TQY A;  5LMU L;  4A3K H;  4A3M H;  1VQK A;  4EQ5 A;  4Y52 H;  1VQN A;  4APV A;  2GVA A;  5C0X I;  3RNU A;  2ES2 A;  3H3V I;  2R7Z G;  1XPU A;  3M4O H;  1PA6 A;  4UY8 C;  3L2P A;  4DR5 L;  3JAM i;  1HR0 Q;  3GTP H;  1S3O A;  4B3M L;  1ASY A;  4K0K L;  4A4I A;  2HHH L;  1JJG A;  5IYD H;  1I3Q H;  1GM5 A;  4DR7 L;  2AWN A;  3HKZ G;  1IBM Q;  4DUY L;  2B63 H;  2FXQ A;  1MIU A;  4QY7 A;  4A3J H;  1QZG A;  4B3T Q;  4DAM A;  1M90 C;  3ZJY C;  1E7Z A;  5JJL A;  1K0R A;  4GLX A;  4DR1 Q;  4MZ9 A;  2ATW A;  1FJG Q;  1N32 Q;  4X62 L;  4GS3 A;  2QA4 A;  4A3E H;  3KYH C;  1K73 C;  3S2D H;  1JJ2 A;  1E1T A;  1OXS C;  1VQF A;  3H0G G;  5GQO A;  2K5V A;  3HOZ G;  3CC7 A;  4C3J H;  2JA7 H;  3ULP A;  1DGS A;  2E8G A;  3FKI H;  3HFZ B;  2R7F A;  4BA2 I;  3BJU A;  4JI8 L;  4JYA Q;  4MNO A;  4LF7 Q;  1CKN A;  3Q8D A;  4KHP Q;  2ZM6 Q;  2WB1 G;  1P8L A;  2ZTE A;  2BH2 A;  5BR8 L;  3M3Y H;  1JJC B;  4R4T A;  3I4M H;  1VQ6 A;  2UUC L;  1VQM A;  4YCV A;  1CUK A;  2JA8 H;  3U50 C;  5C3E H;  5EAY A;  4MTN A;  1OXX K;  4AQY Q;  2Q2U A;  5H1S E;  3M4Q A;  5C0X J;  1NMG A;  2UU9 L;  4LUZ A;  1N36 Q;  3EIV A;  5JJK A;  4H02 A;  3ULL A;  4J15 A;  1WOC A;  4PG3 A;  1KRS A;  2IT1 A;  5C4J H;  3CD6 A;  3JC6 6;  4AH6 A;  1SLJ A;  2VQE L;  1EQQ A;  2F4V Q;  3A5Z B;  1Y1V G;  4YWK A;  2EIF A;  3F2B A;  1HNZ Q;  2A1A A;  4TVA B;  3UDG A;  4OWX B;  3RR5 A;  3RZO H;  2I5H A;  3CC4 A;  1HZB A;  1RL2 A;  4YCU A;  4IFD G;  4X66 Q;  4IPH A;  4JI6 L;  4Y7N H;  3T1H Q;  1XMQ Q;  2WB1 E;  3KJO A;  1EIY B;  1PH9 A;  2XGT A;  1XMO Q;  1VQP A;  3NEN A;  2K5N A;  1SN8 A;  2I0Q A;  2D0O A;  4LF9 L;  2CCZ A;  3H15 A;  4RG1 A;  3RLF A;  1IBL Q;  4BBR G;  3S15 H;  1V43 A;  3CQZ H;  1I6H H;  1IZ6 A;  4YWL A;  3H3V H;  3HOV G;  4DV5 L;  1S40 A;  4YY3 Q;  1PYB A;  3HOX G;  1VQD A;  4P74 A;  3W1B A;  5IWA Q;  3HOU H;  1HNW Q;  5ELN A;  4JI5 Q;  3MXN B;  1W3S A;  1L0W A;  2MNA A;  4BY7 H;  4DV2 Q;  1VQI A;  2XTI A;  5JEA J;  5IYC G;  3K81 C;  5GAG C;  4A3I H;  3WWV A;  2MQH A;  4JI1 L;  1VCI A;  5E7N A;  2GN5 A;  3F8T A;  4LFB L;  4JI3 L;  4NXN L;  3DM3 A;  3G48 A;  1IBK L;  2PMZ E;  3M85 A;  5J3B A;  3U58 A;  1C7Y A;  4OX9 Q;  1FL0 A;  3PO2 G;  4BBS H;  2K50 A;  4KLK A;  4L5Q A;  4GNX B;  2E2J H;  1Q82 C;  5C4X G;  1HR0 L;  1G29 1;  1X56 A;  3CP0 A;  2ALY B;  4JCV E;  1N33 Q;  2R93 H;  3PUZ A;  1IBM L;  2K5H A;  1YEZ A;  5C44 H;  3GTG H;  1TWG H;  4LNQ A;  4UP8 A;  2RCN A;  1N34 Q;  4DNI A;  2YTX A;  1VQ9 A;  1YHQ A;  1FJG L;  3KF8 B;  2Q2I A;  1Q46 A;  1X6O A;  5IYB G;  1YHA A;  4POG A;  3RLN A;  1NJI C;  1PH8 A;  3PCO B;  1K8G A;  3F1Z A;  2YTV A;  4P75 A;  2JJQ A;  4QJF A;  4X65 L;  4DKA C;  5DLQ E;  3ULJ A;  2CQO A;  2NVY H;  4JI4 Q;  3B6Y A;  3J80 c;  4A3D G;  4NXM L;  4BXX G;  1Q8K A;  4A75 A;  4XIG S;  3PGZ A;  1J5E Q;  3PUY A;  4A3K G;  5HGQ A;  3CAM A;  4A3M G;  2EQS A;  2QGQ A;  4DR2 L;  1HNW L;  4WJ3 M;  4GLV B;  1C9O A;  1XNQ L;  1W2B A;  1YIT A;  1VQA A;  3KOJ A;  1N36 L;  3TS2 A;  2R92 G;  1SRU A;  2I5M X;  3CCJ A;  4ALP A;  1QVG A;  3E9H A;  4GNX A;  4JI0 L;  4R1J A;  4A3F G;  2ZJQ A;  1I5F A;  3CCR A;  2OTL A;  1U0L A;  2BA1 A;  1XNR Q;  4GOP B;  1PVO A;  1FVI A;  3SGI A;  1KIX A;  5M5Y H;  1SE8 A;  3D0F A;  5FJ8 H;  1E3P A;  3KFU A;  1VQE A;  1VQJ A;  4A3E G;  5IP9 G;  1E1O A;  1MKH A;  2KBN A;  2N8N A;  3J80 i;  4X66 L;  4X64 Q;  1Q12 A;  3FKI G;  1I50 H;  3I55 A;  4IPD A;  2VUM G;  4DV3 Q;  5IP7 H;  4L5S A;  4LF6 L;  1VQ4 A;  4GNX C;  4LFC L;  1K83 H;  4LF5 L;  4GKK Q;  2OQK A;  2E5L L;  1IL2 A;  3BU2 A;  1TWF H;  4JI2 Q;  4JBK A;  4YCW A;  2HT1 A;  1QUQ B;  4DV0 L;  3VDY A;  4JBM A;  3I4M G;  1BVS A;  3L7Z C;  3RLO A;  3FP9 A;  5C3E G;  2BA0 A;  4DAY B;  4B3R Q;  2CKZ B;  3FHW A;  2Z6K A;  3HOY G;  2RHQ B;  2JA6 H;  1VQ7 A;  2JA5 H;  4IFD I;  3M9B A;  4JBJ A;  3HOW G;  1UE7 A;  4P71 A;  1NY4 A;  2VNU D;  2EXD A;  3S1N H;  4A3L H;  1TWH H;  4R4I A;  2D0P A;  1LYL A;  3T1Y L;  1UEB A;  2RF4 A;  5GAE C;  3G71 A;  1U5K A;  2RHS B;  2WFW A;  2R6G A;  5M3M G;  1VS0 A;  4DUZ L;  1Y1W G;  1Q7Y C;  1HR0 W;  1VQ8 A;  3HKS A;  3UDF A;  1HNX L;  1CKO A;  2YU9 H;  4PMW A;  4DV4 L;  3S16 H;  2UXD Q;  5AJ3 Q;  1VQC A;  2A19 A;  4GOP A;  3HKZ E;  4XTC S;  1PH2 A;  1JMC A;  2Z6K C;  3GTM H;  4HJA A;  4UP9 A;  1I94 Q;  4UPA A;  1PV4 A;  1GVP A;  1HZC A;  5LMN Q;  3J81 c;  1EFW A;  1Q86 C;  3G6E A;  1EYG A;  3PO3 G;  1JB7 A;  4DV1 Q;  2UUB L;  4LW1 A;  4RMF A;  4LF4 Q;  3STB C;  2HQL A;  5C0X G;  4HIM A;  3K0X A;  5FLM H;  2ZJP A;  3LGJ A;  1KC8 C;  3HOU G;  4GOP C;  2H5X A;  1QUQ A;  2DGY A;  4BY7 G;  3D31 A;  4YHH L;  1EOV A;  2MO1 A;  3NEL A;  4QQB X;  1SR3 A;  3E0E A;  1OTC A;  4JI7 Q;  2E2H H;  2Q2H A;  1CSQ A;  1EUJ A;  1HZ9 A;  3G4S A;  3CCQ A;  4C3H H;  2NVT H;  4DV7 L;  2UUA Q;  1YJN A;  2ZTD A;  4DV6 L;  1NTG A;  4DR3 Q;  3TRZ A;  2JEB I;  4A3C G;  4LFA Q;  3U4Z A;  3GTO H;  1HJP A;  1YHB A;  2UXC L;  3PSI A;  1SMX A;  3CCM A;  1YNX A;  4BBS G;  4LF8 L;  2KHJ A;  4KHZ A;  3J81 i;  1HZA A;  1GD7 A;  3E9I A;  1T9H A;  3MEF A;  5LMU Q;  3GD7 A;  4B3S L;  1KHI A;  4O2D A;  4L5R C;  1NMF A;  4JV5 L;  4DR4 L;  2R93 G;  4A3B H;  4QL5 A;  4DR5 Q;  3S14 H;  2KCM A;  2CFM A;  4B3M Q;  4K0K Q;  2HHH Q;  1Q1E A;  4GKJ L;  3KDF B;  3I56 A;  1XNR L;  1L1O B;  2LSS A;  4DUY Q;  2JE6 I;  2PQA B;  4LUV A;  3CCV A;  3PF4 A;  3CMA A;  2YV5 A;  3F2C A;  1RIP A;  5GRO A;  4OO1 I;  1Y1V H;  1OXT A;  2IHF A;  1PH6 A;  1MJC A;  3CPF A;  3K80 C;  4JC0 A;  3U4V A;  4X62 Q;  2K14 A;  4BY1 H;  1YBY A;  5JEA G;  3PUW A;  1EQR A;  4IOC A;  1Y14 B;  4P72 A;  4EX5 A;  4B3T L;  2KCT A;  4NB3 A;  1V9P A;  1N9W A;  1LTL A;  2KEN A;  4FDB A;  4JI8 Q;  3J7Z C;  4DR1 L;  4A93 H;  4GKK L;  1BKB A;  1N32 L;  1WCM G;  5M3F H;  4JBW A;  5BR8 Q;  3I7F A;  1WYD A;  1L2F A;  1VQH A;  2CWP A;  2UUC Q;  3HOV H;  1KD1 C;  1PH3 A;  1N8R C;  3S1R H;  4DR6 Q;  3PIO A;  1OXV A;  2Y0S G;  5GAH C;  1V1Q A;  2PI2 A;  5HY6 A;  4JYA L;  4LF7 L;  4KHP L;  2ZM6 L;  4OXP A;  1O7I A;  3I4N G;  3J81 j;  5IYC H;  4GN5 A;  3KJP A;  2F52 A;  2HIV A;  2JEA I;  3A0J A;  4JOI A;  2VQF Q;  4OWT B;  3CCU A;  1LM0 A;  4AQY L;  2VQE Q;  2ASB A;  1SRO A;  4KI0 A;  4GN4 B;  5FLX c;  5AJ3 L;  1BBU A;  3PO2 H;  2UXD L;  1D7Q A;  3KDF A;  1A62 A;  4R4C A;  5C4X H;  2PQA A;  4BA1 I;  2KHI A;  1YJW A;  5IYD G;  3EN2 A;  1R9T H;  3K8A A;  4JI6 Q;  2B63 G;  5IP7 G;  2VZA A;  4A3J G;  1Q81 C;  2F4V L;  1J6Q A;  5M5W H;  1PH1 A;  4LUO A;  2N78 A;  3K7U C;  2V1C C;  2OTJ A;  1PH5 A;  2D62 A;  3GTK H;  4JOI C;  1X65 A;  1HNZ L;  4LF4 L;  4GN3 B;  4LF9 Q;  2OQ0 A;  1X3F A;  3S24 A;  1YJ9 A;  2Y0S E;  1QVF A;  1CKN B;  3T1H L;  5ELO A;  1XMQ L;  2JA7 G;  1K8A C;  1X3E A;  3EBE A;  3NBH B;  1OXU A;  1PHJ A;  4A3G H;  2JA5 G;  4JI7 L;  3ER0 A;  2LXK A;  3PF5 A;  1XMO L;  2A8V A;  1ASZ A;  1AH9 A;  4DK6 C;  1NBW A;  3GO5 A;  3OTO Q;  2B29 A;  2OWO A;  1IBL L;  4C3I H;  3CC2 A;  4JI1 Q;  2AHO B;  3W5O A;  1NE3 A;  2MFI A;  1X3G A;  4HJ8 A;  4LFB Q;  4JI3 Q;  2AWO A;  1IBK Q;  2JA8 G;  4BXX H;  2C35 B;  4YY3 L;  2K52 A;  4DPG A;  3K7A H;  5IWA L;  3BZC A;  4JI5 L;  5IY0 A;  2LXJ A;  2N3S A;  1Z9F A;  4DV2 L;  4IJH A;  1UWV A;  2OCE A;  2ZTC A;  1PH4 A;  1D8L A;  1G51 A;  3UE0 A;  2UXB Q;  3CF5 A;  2R92 H;  2ID0 A;  1VQ5 A;  4A3F H;  3CXC A;  2NN6 G;  2AKW B;  2E2I H;  4OWW B;  2VW9 A;  3CPW A;  4OX9 L;  4L5T A;  4PZ7 A;  4QIW E;  1Q1B A;  3CW2 C;  1UE1 A;  2WP8 J;  3RN5 A;  1YIJ A;  3BZK A;  1AE2 A;  2R7Z H;  2PNH A;  5GAD C;  5IP9 H;  1N33 L;  3M7N A;  5FLM G;  2VS1 A;  3I2Z A;  1HH2 P;  2NZO A;  1N34 L;  2VUM H;  2F3I A;  1JE5 A;  4X65 Q;  4HJ7 A;  4R4O A;  3PUV A;  2B3G A;  3OYY A;  1FGU A;  3S17 H;  3TRE A;  2VY3 A;  3NEM A;  2BH8 A;  2K4K A;  1JT8 A;  2IX1 A;  3IRB A;  3J7A 5;  4IPG A;  3H0G H;  4NXM Q;  2K75 A;  1GKH A;  3CCL A;  3GTL H;  3W1G A;  4DR6 L;  2GVB A;  3HOZ H;  2VL6 A;  4DR2 Q;  4IOA A;  1KRT A;  1XNQ Q;  3HOY H;  2Z0S A;  4A3B G;  4A3I G;  1CKM A;  4IFD J;  3HOW H;  4JI4 L;  2NZH A;  2YYZ A;  4X6A H;  4JI0 Q;  3GTQ H;  2IHE A;  3KF6 B;  2VQF L;  1J5E L;  3S1M H;  1XJV A;  1EWI A;  3TS0 A;  1Y1W H;  5M3M H;  4TQU S;  2WAQ G;  3L0O A;  4HIO A;  1LUZ A;  2Q2T A;  4BY1 G;  1X54 A;  3PUX A;  1VQO A;  5LMN W;  4DK3 C;  3ERS X;  4ME3 A;  5C44 G;  4A76 A;  4DR7 Q;  1C0A A;  4HIK A;  4HJ9 A;  2IY5 B;  1UE5 A;  3STB D;  3UDX A;  4A93 G;  1PYS B;  3GTJ H;  4LF6 Q;  4LFC Q;  1PH7 A;  4LF5 Q;  3PO3 H;  1YZ6 A;  1B8A A;  2MO0 A;  3AQQ A;  3M4P A;  2E5L Q;  5M3F G;  1S72 A;  2PI2 E;  1E24 A;  3S1Q H;  4DV0 Q;  2N49 A;  4X64 L;  4GLA C;  4DV3 L;  1CSP A;  5IT9 c;  4IO9 A;  1TWC H;  1WFQ A;  1UE6 A;  3AFQ A;  3ICE A;  5IE8 A;  1E22 A;  3OTO L;  4HJ5 A;  4WJ4 A;  5K36 G;  1QZH A;  4AIM A;  4JI2 L;  1A63 A;  1KXL A;  4PZ6 A;  4A3C H;  1XTD A;  2WAQ E;  3T1Y Q;  4BBR H;  4B3R L;  4JG2 A;  2JK8 A;  4DUZ Q;  1MJE A;  4UP7 A;  2YTY A;  2HIX A;  4YWM A;  4AYB G;  3HOX H;  1YI2 A;  4QGU A;  3KF6 A;  1SFO H;  4DV4 Q;  2DUD A;  1HNX Q;  3AEV A;  1G6P A;  4NPS A;  3GDE A;  1X9N A;  1TXY A;  4IJL A;  2UXB L;  3AYH B;  2NVX H;  2UU9 Q;  2IX0 A;  4P73 A;  4HID A;  3KLW A;  1XPO A;  1VQB A;  3CCE A;  2R7D A;  1PFS A;  1WI5 A;  1IXR A;  1A0I A;  5FJ8 G;  1KL9 A;  3I4O A;  2UUB Q;  1GO3 E;  2L15 A;  1L1O A;  1BBW A;  1M1K C;  3RZD H;  3A5U A; 
#chains in the Genus database with same CATH topology
 1B7Y B;  1UEA B;  4HSV A;  1I94 L;  3WOF A;  1JB3 A;  1AE3 A;  1VQG A;  2JQO A;  2NN6 I;  4C3I G;  3JAM c;  3OW2 A;  1HNW Q;  1KDB A;  2JN4 A;  2LY7 A;  1WCM H;  4O0A A;  1CK1 A;  4AYB E;  5I9P A;  1KAW A;  1L1O C;  3OSO A;  3S2H H;  5G3L F;  1Q8I A;  1EIF A;  3F2D A;  2F03 A;  4JV5 Q;  1H95 A;  2L1B A;  1KAA A;  4JPB W;  2NBF A;  3DLL A;  4LK1 C;  3FMC A;  4EQ5 A;  1VQN A;  4APV A;  5C0X I;  3RNU A;  2ES2 A;  3H3V I;  1RF2 D;  5C6A A;  4A3F B;  4DNR B;  3L2P A;  1HR0 Q;  3JAM i;  1SE4 A;  2SOB A;  3GTP H;  1S3O A;  1FR3 A;  2E2I B;  4H0L C;  5CV4 A;  2EJM A;  1JJG A;  5IYD H;  4B3T Q;  1MIU A;  3RMH A;  2K6A A;  3ZJY C;  1GOZ A;  2ATW A;  3S2D H;  3HKZ B;  3KBX A;  3HOZ G;  3ULP A;  3HFZ B;  1LTT D;  2FJ2 A;  1CKN A;  1TT2 A;  1JOR A;  3H0G B;  3W3A A;  1P8L A;  1EY5 A;  2BH2 A;  1JJC B;  2X6L A;  1VQ6 A;  3A7L A;  1STN A;  3HOY B;  2JA8 H;  1QIL A;  2ICE C;  4KJO A;  4MTN A;  5EAY A;  2J0T D;  4RAU C;  5EKL A;  3T16 A;  1WTV A;  1NMG A;  1KDC A;  1Y1W B;  5M3M B;  1KRS A;  3CD6 A;  1A2T A;  1EQQ A;  5CMD A;  1Y1V G;  1R4Q B;  2A1A A;  3UDG A;  3RZO H;  1SJH D;  3KLS A;  1AN8 A;  1RL2 A;  5JVH 3;  4JI6 L;  3J80 L;  2WB1 E;  4XQN A;  4HSP A;  4UHV A;  1VQP A;  3BVG A;  2K5N A;  4LF9 L;  3Q23 A;  4YWL A;  3HOV G;  2B2U A;  1S40 A;  3HOX G;  1A15 A;  1W3S A;  1Y8P B;  2WV6 D;  4DV2 Q;  5IYC G;  5GAG C;  2MQH A;  4F88 A;  2F0H A;  2GN5 A;  3F8T A;  4JI3 L;  5FKA C;  3DM3 A;  1SFO B;  2PMZ E;  3M85 A;  1GUS A;  2DJF C;  3PO2 G;  3TDQ A;  5J22 A;  1HQR D;  3WOE A;  2EYJ A;  1SNO A;  4XDX A;  4GNX B;  4V19 0;  1HR0 L;  1X56 A;  1KLU D;  1PZI D;  2ALY B;  3A8J E;  1G6Z A;  1PRT B;  2K5H A;  1DON A;  1TWG H;  1HA5 A;  4LNQ A;  1SSO A;  1N34 Q;  1H9S B;  2N88 A;  4B08 A;  3KF8 B;  3RZD B;  2PW5 A;  1X6O A;  1ENF A;  3MEH A;  1YHA A;  4HCE A;  3SE0 A;  1PH8 A;  4RHR A;  3PCO B;  3DUZ A;  1K8G A;  2OF1 A;  1CTM A;  3F1Z A;  4QUC A;  4TRD A;  1SYF A;  4OGQ C;  4QJF A;  1TQO A;  2PZW A;  3B6Y A;  1Q8K A;  1J5E Q;  3PGZ A;  3HG9 A;  3OOC A;  5HGQ A;  2QGQ A;  4CJ0 B;  4GLV B;  3I4N B;  1YIT A;  2DNE A;  3HRZ C;  1JOK A;  3TS2 A;  3N52 A;  4JI0 L;  4GNX A;  4A3M B;  1SNP A;  2EJF C;  3M4O B;  2BA1 A;  4KJN A;  1PVO A;  1E3P A;  4O1N A;  2D5D A;  1D2B A;  1I3Q B;  1STB A;  3OWE B;  2K01 A;  2B63 B;  2IX3 A;  1H9S A;  1MKH A;  2KBN A;  3KF8 A;  1LTB D;  4IPD A;  1LAB A;  4A3E B;  1TWF H;  3NSW A;  3K5L A;  4JI2 Q;  1S5D D;  1QUQ B;  4DV0 L;  3FKI B;  1DOK A;  3L7Z C;  1JR0 D;  1G2T A;  2F0P A;  1GUT A;  2CKZ B;  4U68 A;  4F87 A;  3IAY A;  2JA5 H;  3M3Y B;  2IW3 A;  1SBB B;  3BVM A;  3HOW G;  2VNU D;  4P71 A;  5T1I A;  2EXD A;  4A3L H;  4R4I A;  2YU9 H;  1UAP A;  1HNX L;  2WKC A;  4QF4 A;  2IWH A;  2UXD Q;  4JK1 C;  3MA2 B;  1JMC A;  2Z6K C;  4MTK A;  3GTM H;  2CW0 C;  1ESF A;  4PNY A;  1ET6 A;  2F4I A;  4LW1 A;  1ONL A;  4LAA A;  4PQX A;  3H6M A;  2K05 A;  1KC8 C;  4GOP C;  1QUQ A;  1EOV A;  1PFB A;  5EPK A;  4XT3 B;  1EUJ A;  4C3H H;  4RCO A;  1PDQ A;  4DV6 L;  3EA6 A;  3U4Z A;  4M8A A;  2RSN A;  2RDF A;  4BY7 B;  3FPP A;  2HDM A;  2K28 A;  3R3O A;  2Q8T A;  5LMU Q;  4B3S L;  1PTO F;  1NMF A;  4DR4 L;  2CH4 W;  5EPL A;  5KYI A;  5CV5 A;  3Q0A A;  3S14 H;  4B3M Q;  3NTI A;  4K0K Q;  3KDF B;  3J81 E;  1L1O B;  4ZUJ A;  4DUY Q;  2PQA B;  1HTP A;  4K6D A;  3CMA A;  3NWS A;  1RIP A;  4OO1 I;  2R93 B;  2KVM A;  3I91 A;  1PZJ D;  1HXY D;  2B8F A;  4KKU A;  5JEA G;  3GTG B;  1YNJ D;  4IFD H;  2B2Y C;  1Y14 B;  4EX5 A;  2PZT A;  4NB3 A;  3J7Z C;  4DR1 L;  4OHJ A;  5D14 A;  3I7F A;  1WYD A;  3MFG A;  1EFI D;  4CDF C;  4ME5 A;  2CH4 A;  4DR6 Q;  3PIO A;  2Y0S G;  5GAH C;  5HY6 A;  4JYA L;  3HP3 A;  1SNQ A;  2NYZ D;  3J81 j;  1G2S A;  2PPB C;  2CVR A;  5T1G A;  2A6H D;  3A0J A;  1T5E A;  4K8J A;  3VR6 A;  2VQF Q;  3C3L A;  5EGT A;  2UXD L;  1F9P A;  4GN4 B;  2A5H A;  5FLX c;  1BBU A;  3KDF A;  3MAQ A;  3BDO A;  2PQA A;  3DWA A;  2R3Z A;  4FXD A;  1YJW A;  3FPU B;  1XTC D;  2LS0 1;  2O4X A;  2F4V L;  4LUO A;  2E74 C;  2N78 A;  5KIX A;  2V1C C;  1C4Q A;  4JOI C;  3Q6S A;  4GN3 B;  4KV6 A;  1I50 B;  5FK9 C;  1YJ9 A;  1EY6 A;  1DD2 A;  4C3J G;  2JA7 G;  3NBH B;  3T51 B;  1OXU A;  3IL8 A;  2JA5 G;  3PIO 3;  5I2Y A;  2WIN B;  3I70 A;  3MZ5 A;  1ASZ A;  1HPC A;  1NBW A;  4DK6 C;  5IGB A;  1EU3 A;  2C9O A;  2B29 A;  3OMC A;  4JI1 Q;  1WTH A;  1NE3 A;  2MFI A;  4FXG C;  1X3G A;  2AWO A;  1IBK Q;  2C35 B;  3DHQ A;  4CKC A;  4JI5 L;  1JWU D;  5IY0 A;  2N3S A;  1Z9F A;  1TWH B;  3DEP A;  1A3T A;  1UWV A;  3BS1 A;  3UE0 A;  1U4P A;  3TN2 A;  2K32 A;  4A3F H;  1GUG A;  2E2I H;  3S16 B;  4OX9 L;  3CW2 C;  1BUV T;  1YIJ A;  3NUC A;  2A74 C;  2PNH A;  1N33 L;  1STG A;  3C2P A;  2VS1 A;  1HH2 P;  4FF1 A;  1O7Z A;  2KJX A;  2HUG A;  3D3R A;  2F3I A;  1STY A;  4C3H G;  3NBH A;  1X3Q A;  2VY3 A;  1SYG A;  1JT8 A;  2PCF B;  3H0G H;  4DR6 L;  2VL6 A;  2NVT B;  2Z4I A;  4NDX A;  2BDO A;  3HOY H;  2QF7 A;  3NQI A;  2Z0S A;  3GTO B;  4A3I G;  1UUP A;  2D2C C;  3L9A X;  4JI4 L;  2ICI A;  1PTO B;  1D1I A;  2VQF L;  1EWI A;  1FNU A;  1Y1W H;  5M3M H;  4KN4 C;  4A3B B;  2WAQ G;  1KNE A;  3TZU A;  4JVZ A;  4ME3 A;  2JSO A;  5E1F A;  4LF6 Q;  4LFC Q;  1H9K A;  3AQQ A;  2E5L Q;  1QJO A;  5IOD A;  4X64 L;  5ELC A;  1T5X D;  1CSP A;  1BO0 A;  3R93 A;  1WFQ A;  2BE5 C;  2KCC A;  1ENA A;  3ICE A;  4AIM A;  1A63 A;  2TSS A;  1YNN D;  4PZ6 A;  4ZRZ A;  3BYT B;  1B3A A;  2RDH A;  3TP5 A;  1M8A A;  4IUN A;  4DUZ Q;  5C3W A;  2YTY A;  2HIX A;  1TS4 A;  1II3 A;  4AYB G;  1M4V A;  1SFO H;  1X9N A;  2WAC A;  4IJL A;  3KLW A;  1FNV A;  2PNR C;  3MTS A;  5C4X B;  3TP6 A;  5FJ8 G;  1GJX A;  2L15 A;  3BYY B;  3RZD H;  3CXC A;  1RTO A;  5IT9 E;  4POF A;  3KBG A;  4YHH Q;  1OO9 B;  4DV1 L;  1WJJ A;  3BG3 A;  1J8I A;  4DV7 Q;  1KQS A;  2D9U A;  4A3G B;  2UXC Q;  4DV5 Q;  5ELB A;  2AQ1 B;  2I5L X;  4G4K A;  4TSS A;  4LF8 Q;  2JA6 G;  2ZJR A;  3RN2 A;  3PIP A;  3EVQ A;  1K3R A;  1HUM A;  3I4N H;  4PZ8 A;  2HQE A;  1Z47 A;  4GKJ Q;  5KGU A;  3A74 A;  1JE4 A;  1SAP A;  3TQY A;  4A3M H;  2L55 A;  1I4X A;  3M4O H;  1PZK D;  1JOQ A;  1PA6 A;  1ICF B;  4DR5 L;  1X3P A;  4CDD C;  2HHH L;  1I3Q H;  1GM5 A;  2AWN A;  3HKZ G;  2B63 H;  2K7V A;  3E0J A;  1STH A;  4FVM A;  1N32 Q;  1LT3 D;  4X62 L;  4GS3 A;  4A3E H;  3KYH C;  1SYC A;  1I6V C;  1OXS C;  3H0G G;  2VUM B;  1RHP A;  1DGS A;  3FKI H;  5D3I B;  1HCZ A;  2B39 A;  1IW7 D;  1PRT D;  3PIP 3;  4LF7 Q;  4CBV A;  2ZM6 Q;  1D5X C;  2WB1 G;  3TBI B;  1BCP F;  5BR8 L;  3M3Y H;  4R4T A;  3ND9 A;  2UUC L;  4YCV A;  1CUK A;  4AQY Q;  4I7A A;  3V05 A;  2Q2U A;  1F9Q A;  1K0S A;  4LUZ A;  4H02 A;  3R8B A;  4PG3 A;  5G3L D;  1STA A;  4PMC A;  2AQ3 B;  2NN6 H;  4AH6 A;  2VQE L;  3A5Z B;  3SVM A;  2Z6B A;  2F0F A;  4K2L A;  2K04 A;  1EY4 A;  4TVA B;  1E2W A;  1EZ8 A;  4OWX B;  3RR5 A;  4WOR A;  4YCU A;  3GTJ B;  2NTT A;  3KJO A;  3M7G A;  3S15 B;  3S1Q B;  4DXG A;  4RCN A;  1Q90 A;  3RLF A;  4XXE A;  5COY A;  2EY5 A;  1EYC A;  3E3X A;  3H3V H;  5C0X H;  2NWG A;  4DV5 L;  1BBX C;  4YY3 Q;  1QG7 A;  5ELN A;  3MXN B;  4BY7 H;  4HMI A;  4NW2 A;  2MNA A;  5JEA J;  2XTI A;  4ZK9 B;  2DY8 A;  1CHP D;  1CA5 A;  5M9O A;  3ZYY X;  3G48 A;  4DF7 A;  2A69 C;  4QB4 A;  1FL0 A;  4KLK A;  1B4O A;  3H94 A;  4HTH A;  1G29 1;  2R93 H;  2E2D C;  2QCP X;  3PUZ A;  1FYC A;  4MIU A;  3GTG H;  1SXT A;  4UP8 A;  2YTX A;  3CU7 A;  4XYO A;  5A2Q L;  2SNM A;  4RFB A;  4OEM B;  1PRT F;  1NJI C;  1MSG A;  1LTS D;  2F0S A;  2JJQ A;  5EPJ A;  4DK0 A;  4X65 L;  4DKA C;  5DLQ E;  2CQO A;  2L0C A;  3NK9 A;  3T56 B;  2O5J C;  5K36 H;  3MXN A;  4BXX G;  4XIG S;  4A3M G;  2EQS A;  1C9O A;  4DNT B;  4O42 A;  1XNQ L;  2NVQ B;  3RUZ A;  1VQA A;  2AUJ D;  2HCI A;  3F2U A;  2Z4H A;  3VYR A;  4A3D B;  2R92 G;  1BXT A;  4R1J A;  4A3K B;  2OTL A;  1U0L A;  2A68 D;  1FVI A;  1U4R A;  3SGI A;  2RVL A;  4A3E G;  1KTK A;  4BWG B;  5IP9 G;  3EFX D;  4A3J B;  3O13 A;  3FKI G;  1I50 H;  1X32 A;  2ZXP A;  3R2T A;  4L5S A;  2OQK A;  3BU2 A;  4XYQ A;  5CV6 A;  4YCW A;  4JBM A;  2EY2 A;  2FIN B;  1BCP B;  4B3R Q;  3H09 A;  3FHW A;  3BVZ A;  5EJW A;  2RHQ B;  3A7A B;  1I4Q A;  1VQ7 A;  2F0E A;  3I4M B;  1NY4 A;  1TWH H;  5C3E B;  4KKS A;  1UEB A;  3G71 A;  2RHS B;  3Q22 A;  2R6G A;  2L9H A;  1GHK A;  3S16 H;  3A54 A;  1EYD A;  2SNS A;  1SYB A;  3HKZ E;  1PH2 A;  4UP9 A;  1PV4 A;  5LMN Q;  3J81 c;  1GHJ A;  1HQM C;  3PO3 G;  2UUB L;  3QO2 A;  5I2X A;  1QCB D;  4IUR A;  3STB C;  4Y7N B;  1Y8O B;  5C0X G;  2SEB D;  4HIM A;  5FLM H;  2ZJP A;  3LGJ A;  1MSH A;  3ERQ A;  5JPM C;  2H5X A;  5EBD A;  1L0X B;  4Z9C B;  4BY7 G;  3D31 A;  2MO1 A;  3NEL A;  4QQB X;  1K8O A;  1OTC A;  1LTR D;  1CSQ A;  2Q2H A;  3CQZ B;  2NVT H;  2BCO A;  2UUA Q;  5IGE A;  1HNW L;  2ZTD A;  4DR3 Q;  1NTG A;  4A3C G;  4LFA Q;  3GTO H;  5DM6 3;  4K5W A;  1PTO H;  1YNX A;  2X69 A;  1A3V A;  4KHZ A;  3J81 i;  1HZA A;  5FO9 B;  1U4L A;  1EYA A;  4JV5 L;  2R93 G;  3NP8 A;  4A3B H;  4QL5 A;  2KCM A;  2PZU A;  2X6G A;  2E2J B;  2G9H D;  3CCV A;  2IHF A;  1XX8 A;  4OL7 A;  1PH6 A;  3CPF A;  2K14 A;  5C44 B;  1IYV A;  1EQR A;  4IOC A;  1BDO A;  4B3T L;  2A6E D;  2XWB B;  4DK1 A;  1ROD A;  4FDB A;  4JI8 Q;  1EIH A;  3LWE A;  1BKB A;  3MXG A;  2L12 A;  1WCM G;  3MC0 B;  3BDC A;  1VQH A;  4IUQ A;  3S1R H;  2F0V A;  5C5L A;  1V1Q A;  4F7X A;  3GQB A;  4BS9 A;  1S5B D;  1LO5 D;  1O7I A;  2F52 A;  2QDB A;  5JPN C;  1GUN A;  2OEO A;  3CCU A;  1LM0 A;  3HS0 C;  1RD9 D;  2MHV A;  2ASB A;  1HRJ A;  1V8Q A;  2Z8L A;  5C4X H;  3MWY W;  2KHI A;  2Q8R E;  3P1H A;  5IYD G;  3K8A A;  2L11 A;  4Q0F A;  1J6Q A;  1PH1 A;  1PTO D;  3K7U C;  2OTJ A;  3A56 A;  3ITP A;  4G7O C;  3HZX A;  4X3K A;  5CYU A;  3TSS A;  3D6C A;  1X3F A;  1QVF A;  1NUC A;  1O7Y A;  3LNN A;  1K83 B;  5ELO A;  1GUO A;  3J7A F;  1TKW B;  4A3G H;  3QOJ A;  1BR9 A;  2PO4 A;  3PF5 A;  4FNF A;  2A8V A;  3IKJ A;  3GO5 A;  3I3C A;  2AHO B;  4LFB Q;  4OO1 H;  5EKK A;  2JA8 G;  4FO2 A;  1EWH A;  2B2T A;  4DV2 L;  2ZTC A;  1PH4 A;  2RKS A;  2UXB Q;  3CF5 A;  3KK7 A;  1VQ5 A;  2RQX A;  3ERO A;  1EY9 A;  1ZYR D;  1O80 A;  3VR4 A;  4PZ7 A;  1Q1B A;  1UE1 A;  3RN5 A;  2B2W C;  1AE2 A;  4LMQ D;  5FLM G;  1RCV D;  1B1Z A;  3FRP B;  1K8M A;  1N34 L;  5BN5 A;  2VUM H;  1U4M A;  3QR8 A;  4ZCK A;  2XNA C;  1FGU A;  3CRK C;  2K4K A;  3OIQ A;  4QMG A;  2IX1 A;  5IGC A;  2CQA A;  4NXM Q;  2E2H B;  1H9M A;  4DR2 Q;  1F2Z A;  4A3B G;  1ML0 D;  2KCN A;  1PLF A;  1J5E L;  5BN3 A;  1PXU A;  4RGM A;  3FVQ A;  4TQU S;  3L0O A;  3N6R A;  4HIO A;  3V96 A;  1AZP A;  3R2I A;  4N9P A;  5ELD A;  4K6L A;  3SR1 A;  4DR7 Q;  1Y1V B;  3A55 A;  4HJ9 A;  1NNX A;  3UDX A;  1YNJ C;  3GTJ H;  3KLR A;  4LF5 Q;  1B8A A;  2MO0 A;  3M4P A;  2EYH A;  1GUW A;  2XN9 C;  2F0Q A;  1DYQ A;  1CM9 A;  1E24 A;  2BOS A;  3P75 A;  3S1Q H;  2N49 A;  2QIL A;  4GLA C;  4A93 B;  2EYO A;  5IT9 c;  4IO9 A;  1UE6 A;  4U67 3;  3K57 A;  1FNW A;  5M3F B;  3I4L A;  1QZH A;  4JI2 L;  3HOV B;  2LFN A;  5D65 A;  3FEW X;  1XTD A;  3T1Y Q;  4JG2 A;  2GA4 B;  4J1M A;  4UP7 A;  2A6H C;  4KKT A;  1B9N A;  4QGU A;  4DV4 Q;  3AEV A;  1G6P A;  2EJG C;  2EE1 A;  2UXB L;  5CV9 A;  2UU9 Q;  2XWJ B;  4HID A;  3PO2 B;  3KUP A;  5CBE E;  1VQB A;  2F0G A;  5KNB A;  1PFS A;  1A0I A;  1B50 A;  1V1P B;  3RD4 A;  5I9O A;  1L1O A;  3G6J B;  2F3V A;  1BBW A;  1H9R A;  3OHX C;  4HAE A;  1M1K C;  2B2V C;  2CWA A;  1YVC A;  4A3G G;  1WD0 A;  1MI2 A;  2EYL A;  2JA9 A;  3CME A;  2K33 A;  1X55 A;  1QVC A;  4LWC A;  2QEJ C;  1EEI D;  4OO1 G;  4IN3 A;  3TEH B;  1EEF D;  2G5D A;  1B70 B;  3AFP A;  4A3L G;  2E75 C;  1LV9 A;  3CRL C;  3QOL A;  5C4H A;  2NVQ H;  4R4Q A;  1IYJ B;  2EYF A;  1Z7T A;  3GP7 A;  2NUC A;  4A3D H;  4NXN Q;  1IL8 A;  3BDL A;  5LMU L;  4A3K H;  1U9R A;  2GVA A;  2O5I C;  3K0Y A;  4UY8 C;  4B3M L;  1V1P A;  4A4I A;  4K0K L;  4DR7 L;  4DUY L;  2FXQ A;  4QY7 A;  4A3J H;  3SXH A;  2R7Z B;  4FP5 D;  1E7Z A;  5JJL A;  2Z9H A;  4GLX A;  1I4G A;  3DXJ C;  3NE5 B;  1K73 C;  2CHB D;  1JJ2 A;  3SK8 A;  1VQF A;  4ZLT F;  5GQO A;  3SK4 A;  4ZUI A;  3CC7 A;  2VXW A;  3S17 B;  4IUU A;  3BJU A;  4KHP Q;  3Q8D A;  4LJZ C;  4YIJ A;  3URY A;  1C8C A;  2ZTE A;  3VA7 A;  3SHL A;  3I4M H;  1VQM A;  1F2Y A;  3U50 C;  5C3E H;  1OXX K;  3HOW B;  3T53 B;  1KLG D;  4CDC C;  4HR7 B;  3M4Q A;  5FO7 B;  5C0X J;  3GTQ B;  3S1M B;  2UU9 L;  2F0N A;  1TY2 A;  3VA5 A;  1WOC A;  1O78 A;  3JC6 6;  1EQV A;  4FYD A;  2G9D A;  2I07 B;  5KYL A;  1XWE A;  2L5T A;  3F2B A;  1HNZ Q;  1A2U A;  4RKB A;  2I5H A;  1HZB A;  2QKI C;  4IFD G;  4X66 Q;  4IPH A;  3JAM L;  4Y7N H;  3T1H Q;  1XMQ Q;  5A2Q E;  1JWM D;  1EIY B;  2XGT A;  4HCS A;  1XMO Q;  3NEN A;  1PYW D;  1SN8 A;  3EQL C;  2I0Q A;  4RG1 A;  1IBL Q;  1V43 A;  3CQZ H;  1IZ6 A;  4G57 A;  1VQD A;  3AU7 A;  4P74 A;  3W1B A;  5IWA Q;  4IZ8 A;  1L0W A;  2M00 A;  1VQI A;  2K03 A;  3I72 A;  4PMB A;  4BBR B;  3WWV A;  4JI1 L;  2LKV A;  5E7N A;  1I6H B;  4NXN L;  2BDN A;  1IBK L;  4H13 C;  2M9V A;  5J3B A;  4RH6 A;  1C7Y A;  2K50 A;  3DM1 A;  2NVX B;  2E2J H;  2B2U C;  2FFK B;  1BCP D;  3LX0 A;  4FF2 A;  4L8J A;  1WTR A;  5C44 H;  1F9S A;  2RCN A;  4DGZ A;  1KNA A;  1LLR D;  3IFT A;  4ZQ3 A;  3U9S A;  4K5V A;  4EQN A;  2XRS D;  1HFN A;  3RLN A;  2EPB A;  1TWA B;  5LL6 S;  4C2M B;  3SDZ A;  3UI2 A;  5M5X B;  4GZY C;  1WTO A;  1SMY D;  5CV7 A;  1ENC A;  1CQV A;  2F0K A;  4A3D G;  2RA4 A;  4UAI A;  4HED A;  2JP1 A;  1MD2 D;  4A75 A;  1EQT A;  3C46 A;  3PUY A;  4A3K G;  3CAM A;  4S3S A;  4FF3 A;  3MVV A;  4ZKB B;  3J81 L;  3KOJ A;  4N9T A;  2I5M X;  3CCJ A;  4ALP A;  3QWN A;  4KY5 A;  3D8G A;  3HEJ A;  4A3F G;  3CCR A;  2FHT A;  4GOP B;  1KIX A;  1SE8 A;  3QJY A;  3D0F A;  1R4P B;  1VQJ A;  4KY6 A;  4FF4 A;  4OIK A;  4CKB A;  2TMP A;  4X66 L;  2XSC A;  2IL8 A;  3I55 A;  4DV3 Q;  2F0O A;  5IP7 H;  4LF6 L;  4GNX C;  4LFC L;  3E5S A;  1K83 H;  4GKK Q;  2E5L L;  4JBK A;  4C3J B;  3J80 E;  2HT1 A;  2RBM A;  3VDY A;  3I4M G;  2JA7 B;  3VYU A;  1BVS A;  1IW7 C;  1PRT C;  2WKD A;  5C3E G;  4DAY B;  1LTG D;  1ILP A;  5E4X A;  2Z6K A;  4ZYS A;  3HOY G;  3IFD A;  2EXZ A;  2KQ3 A;  2DNC A;  2KOL A;  3HGB A;  1LT5 D;  1LYL A;  2RF4 A;  1U5K A;  2WFW A;  1Y1W G;  5M3M G;  1VQ8 A;  1VS0 A;  4DUZ L;  4IAL A;  1Q7Y C;  1HR0 W;  3HKS A;  3UDF A;  1CKO A;  4PMW A;  5KRU A;  4RWS C;  3OPO A;  4GOP A;  5C4J B;  3LWU A;  4HJA A;  1I94 Q;  3G6E A;  4KK7 A;  1JB7 A;  4RMF A;  4LF4 Q;  3M4Y A;  2HQL A;  2SDF A;  3K0X A;  2EVB A;  1MBY A;  5CR3 A;  4YHH L;  2E2H H;  4DV7 L;  1YJN A;  3TRZ A;  1D5Z C;  2JEB I;  4CGY B;  2EY6 A;  3HOU B;  1HJP A;  1YHB A;  2UXC L;  2MGS A;  3CCM A;  4RGO S;  4LF8 L;  3I73 A;  4A3I B;  3E9I A;  1SYE A;  3MEF A;  4L5R C;  1KHI A;  4O2D A;  2B2Y A;  5EQ0 A;  4OIJ A;  4RHS A;  2KED A;  2CFM A;  4BBS B;  4GKJ L;  3I56 A;  1SJE D;  2WAQ B;  3PF4 A;  5I6Y A;  3E6Z X;  4PV1 C;  2YV5 A;  5GRO A;  1Y1V H;  1OXT A;  1MJC A;  3K80 C;  4JC0 A;  4KTA A;  5E4W C;  3VYS A;  4EQP A;  3D4W A;  3PUW A;  3DWQ A;  2KCT A;  2AUK A;  2KA7 A;  1V9P A;  1N9W A;  1LTL A;  2KEN A;  4GKK L;  1CQF A;  4A93 H;  4QUF A;  1N32 L;  1MHW C;  4Q5V A;  3S9W A;  4L6T B;  4JBW A;  5M3F H;  1QNK A;  1V1O A;  1L2F A;  5KEE A;  2EYM A;  3HOV H;  1PH3 A;  4DN4 M;  2NVY B;  1JQY D;  2PI2 A;  4LF7 L;  5COR A;  2ZM6 L;  4OXP A;  3I4N G;  5IYC H;  4GN5 A;  3KJP A;  4KMU C;  1EY8 A;  2JEA I;  1DOM A;  4DU9 A;  1I4R A;  2J7Z A;  4JOI A;  3W2D A;  3P7J A;  4AQY L;  3PO2 H;  4R8N A;  3H3V C;  4R4C A;  4BA1 I;  1ICW A;  3A8I E;  4K14 A;  5M5Y B;  1K3B C;  4JI6 Q;  2B63 G;  5IP7 G;  2VZA A;  1Q81 C;  4CDE C;  5ISR A;  1WVL A;  2D62 A;  1PH5 A;  1X65 A;  4V0B A;  4RGT A;  3PMF A;  4LF4 L;  4LF9 Q;  2OQ0 A;  1ZKO A;  1QNU A;  1CKN B;  1K8A C;  1X3E A;  2RDG A;  1PHJ A;  1Z6H A;  3ER0 A;  2LXK A;  1CFM A;  5IGG A;  2F0I A;  2LMC B;  3C1F A;  4QIW B;  1BQQ T;  5I6W A;  5DNF A;  2F1M A;  4KN7 C;  4HJ8 A;  4JI3 Q;  2JA6 B;  4DA2 A;  4YY3 L;  1VF7 A;  1STE A;  3S1N B;  1SE2 A;  4IJH A;  2F0W A;  1D8L A;  1G51 A;  2ID0 A;  1SNC A;  2NN6 G;  4OWW B;  5ELE A;  3CPW A;  4QIW E;  3TME A;  2B8G A;  2M2L A;  5IT9 L;  2K5Q A;  2R7Z H;  1RKN A;  5GAD C;  3DMU A;  2F0D A;  3GV3 A;  2NZO A;  1FGB D;  1EIG A;  2F0U A;  2EOT A;  1JE5 A;  4R4O A;  2ZXR A;  3S17 H;  3TRE A;  1WTQ A;  2BH8 A;  1TII D;  3P20 A;  3IRB A;  1B2T A;  3J7A 5;  4IPG A;  4B9W A;  1NCV A;  5I4D A;  4C56 C;  1ET9 A;  2WB1 B;  1A3U A;  2EYP A;  4IFD J;  2N55 A;  3HOW H;  5FLX L;  2C5C A;  4JI0 Q;  3GTQ H;  1C48 A;  1WTW A;  2XRQ D;  3S1M H;  1CZW A;  1SEB D;  3DWP A;  1CHQ D;  1B9M A;  1LUZ A;  5KND A;  1A6X A;  1VQO A;  2F0T A;  1LT4 D;  4WRD A;  4IUP A;  1C0A A;  2IY5 B;  2PMZ B;  3STB D;  1JOO A;  4A93 G;  1PYS B;  4BY1 B;  1DOL A;  1YZ6 A;  5DM7 3;  5M3F G;  2A6E C;  5DEH A;  1S72 A;  5AFW A;  1B44 D;  1RTN A;  4DV0 Q;  4JW0 A;  3C1E A;  3CHB D;  1PFN A;  4ILW A;  5IE8 A;  1E22 A;  3ONA B;  4HJ5 A;  5K36 G;  4OEL B;  1KXL A;  2QW7 A;  1LT6 D;  3I90 A;  2FMC A;  1WTP A;  1L0Y B;  4BBR H;  4XQJ A;  4B3R L;  3A8K E;  1EZ6 A;  2V4D A;  5DAU A;  2J4X A;  1I6H H;  4F8M A;  1YI2 A;  1HNX Q;  1UNS A;  2DUD A;  1QWY A;  3GDE A;  3CKI B;  1K28 A;  3AYH B;  2NVX H;  3NXW A;  2NTS A;  2IX0 A;  4P73 A;  1XPO A;  5IGD A;  3CCE A;  2R7D A;  1WI5 A;  1IXR A;  5ELF A;  1KL9 A;  3EJI A;  4NMZ A;  5EKI A;  1GO3 E;  4XQQ A;  2EDG A;  1R9T B;  1EWC A;  1PTO C;  2DJG C;  2F0J A;  4MN3 A;  5M5W B;  5JEA H;  3A5U A;  5CGK A;  1F2M A;  4OON A;  1G91 A;  3GTK B;  5LMN L;  2AMC B;  1AEX A;  2K5W A;  3V2T A;  1XPR A;  1DCZ A;  4NKL A;  2E76 C;  1TWA H;  3PV0 A;  4IQZ A;  1KDA A;  1VMP A;  4K2K A;  1MGS A;  2QEX A;  1P16 A;  4C2M H;  1ZXT A;  3D4D A;  5M5X H;  1A8V A;  4DV6 Q;  4C1N I;  5IYB H;  2DN8 A;  4ABN A;  3OWF A;  3UE1 A;  1K9M C;  4P2C B;  4C3I B;  4IPC A;  4B3S Q;  4DR4 Q;  3CCS A;  3J7A V;  2UUA L;  4DR3 L;  3UDI A;  1PMR A;  4LFA L;  3K7A B;  5JJI A;  4B9X A;  1VQL A;  3K5N A;  1NR4 A;  3X3M A;  4Y52 H;  1VQK A;  2JYO A;  2R7Z G;  2R92 B;  1ZYR C;  1XPU A;  1F2L A;  1ASY A;  1IBM Q;  4RKL A;  1QZG A;  4DAM A;  1M90 C;  1K0R A;  4ODG A;  4DR1 Q;  4MZ9 A;  3JAM E;  1FJG Q;  4EVO A;  2QA4 A;  1E1T A;  5JAV A;  2K5V A;  4C3J H;  2JA7 H;  2E8G A;  2R7F A;  4R9W A;  4BA2 I;  4JI8 L;  1IHZ A;  4JYA Q;  4MNO A;  4WJW A;  1AFP A;  2RSO A;  2K1B A;  3GTL B;  2R61 A;  3HOZ B;  4G7Z C;  3D4R A;  2F3W A;  2IPK D;  4CJ2 C;  2P5Z X;  4C1N K;  5H1S E;  4TKO B;  4N8F A;  1N36 Q;  1S5C D;  3EIV A;  5JJK A;  3ULL A;  4J15 A;  1TS2 A;  2Q8I B;  2IT1 A;  5HGT A;  3VR2 A;  1QE6 A;  5C4J H;  1XXG A;  1TR5 A;  1SLJ A;  2F4V Q;  4YWK A;  2EIF A;  3NWT A;  2MUY A;  5E3F A;  2CW0 D;  5K5P A;  4CJ1 B;  3CC4 A;  3T4A C;  3DEO A;  4QCL A;  1BF4 A;  4HMJ A;  2K5D A;  5CC4 A;  1NAP A;  3PO3 B;  1PH9 A;  2AQ2 B;  3Q24 A;  3H91 A;  1D1K A;  2D0O A;  2CCZ A;  3H15 A;  4BBR G;  3S15 H;  1TWC B;  5J1Z A;  4R8I A;  4E6I A;  1PYB A;  3HOU H;  4JI5 Q;  3K81 C;  4A3I H;  3WDN A;  2Z1C A;  1VCI A;  2KEC A;  4LFB L;  3HOX B;  3U58 A;  4OX9 Q;  5C3X A;  4BBS H;  1E2Z A;  4L5Q A;  1JC7 A;  1HA6 A;  1Q82 C;  1LTA D;  5C4X G;  3CP0 A;  4JCV E;  1N33 Q;  4DXF A;  2EZV A;  5BN4 A;  4CKE A;  1IBM L;  4N8X 1;  1YEZ A;  1WTX A;  1IKM A;  4X3S A;  4DNI A;  1VQ9 A;  1QOH A;  1YHQ A;  1FJG L;  1SYD A;  1HFG A;  2Q2I A;  1Q46 A;  5CV8 A;  5IYB G;  4POG A;  1W6K A;  1ESR A;  1BOS A;  1XYI A;  2YTV A;  4P75 A;  4NP5 A;  3FDT A;  1WCM B;  3VR5 A;  3ULJ A;  1D6E C;  2NVY H;  4JI4 Q;  3S2H B;  1EY7 A;  3J80 c;  4NXM L;  4WJ3 M;  4DR2 L;  5JOB A;  2RCF A;  1W2B A;  2MJ8 A;  1N36 L;  1LTI D;  1SRU A;  2VB3 X;  1QVG A;  3E9H A;  2ZJQ A;  1I5F A;  3KLS X;  5IGF A;  1XNR Q;  3NBI A;  5M5Y H;  4I7Z C;  3GTP B;  5FJ8 H;  3KFU A;  1VQE A;  5D3D A;  3D6W A;  4ZKC B;  3NQT A;  1E1O A;  2N8N A;  3J80 i;  5J39 A;  4X64 Q;  1Q12 A;  3QIA A;  5A35 A;  2VUM G;  1TS3 A;  3OW7 A;  2ZXO A;  5C4Z A;  1VQ4 A;  4LF5 L;  3S2D B;  1DJR D;  1IL2 A;  4M1U B;  1S4Z A;  1SE3 A;  1IKL A;  4CHT B;  3RLO A;  3FP9 A;  2BA0 A;  2ZT9 C;  2JA6 H;  1FD7 D;  4IFD I;  3M9B A;  4JBJ A;  1UE7 A;  3GV6 A;  2HCC A;  3S1N H;  2JA8 B;  2D0P A;  3T1Y L;  5GAE C;  1NSN S;  3U9O A;  3NTK A;  2VB2 X;  4ULL A;  1W6J A;  4DV4 L;  3VR3 A;  1SDF A;  1VQC A;  5AJ3 Q;  4EGV A;  2A19 A;  3T13 A;  4XTC S;  3NPP A;  1F9R A;  3PQI A;  4UPA A;  1GVP A;  1HZC A;  1EFW A;  1VF5 C;  1EYG A;  1E0B A;  4DV1 Q;  3RZO B;  4ZAI A;  3OMG A;  3K58 A;  1DZ1 A;  4DAV A;  3HOU G;  4KD3 A;  4L63 B;  2DGY A;  3G7L A;  3L3O C;  1SR3 A;  3E0E A;  4JI7 Q;  2PYK A;  1HZ9 A;  3G4S A;  3CCQ A;  2NB0 A;  2DY7 A;  3PSI A;  1SMX A;  4BBS G;  2KHJ A;  1YNN C;  1Q86 C;  1HHV A;  1GD7 A;  1T9H A;  1IYU A;  3GD7 A;  1CI3 M;  5CBA E;  1B53 A;  1Y8N B;  4DR5 Q;  3SK6 A;  1BCP C;  3SK5 A;  2XVS A;  1Q1E A;  2HHH Q;  1XNR L;  2LSS A;  4ID6 A;  2JE6 I;  4LUV A;  4IUV A;  3F2C A;  4G7H C;  1WD1 A;  1I4H A;  2PQE A;  1JCK B;  2KUM A;  3U4V A;  3NTH A;  4X62 Q;  3K59 A;  1YBY A;  2QDL A;  4BY1 H;  1TWG B;  1S5F D;  4WFN 3;  1HUN A;  4P72 A;  1TU2 B;  5JVG 3;  2XIW A;  1JIC A;  2O2L D;  2OXP A;  3QG1 A;  5NUC A;  1VDZ A;  1E2V A;  4J8Q A;  3AB9 A;  5BR8 Q;  3S1R B;  2BE5 D;  2CWP A;  1SMY C;  2MPM A;  2UUC Q;  1KD1 C;  1H9J A;  5F2D A;  1F77 A;  1N8R C;  1CZG A;  1BNZ A;  1OXV A;  4KHP L;  5LL6 X;  5KNC A;  1EY0 A;  1EU4 A;  2HIV A;  2F0L A;  2WII B;  4KD4 A;  4OWT B;  2Y0S B;  5JJZ A;  2VQE Q;  1SRO A;  1LAC A;  4KI0 A;  5AJ3 L;  1D7Q A;  1A62 A;  3I8Z A;  3EN2 A;  1R9T H;  1EL0 A;  1JWS D;  4A3J G;  2OT2 A;  5M5W H;  4RGN A;  4J6H A;  3K6O A;  1CA6 A;  3GTK H;  1HNZ L;  4FXK C;  3S24 A;  1HTL D;  5FOB B;  1AZQ A;  2KHS A;  4X3U A;  2Y0S E;  3T1H L;  1XMQ L;  3EBE A;  1J9O A;  1TWF B;  4DFA A;  1KAB A;  4JI7 L;  1XMO L;  2HD3 A;  1QB5 D;  1AH9 A;  3OTO Q;  1RJT A;  2OWO A;  4H44 C;  1IBL L;  4C3I H;  3CC2 A;  1GXD C;  1TS5 A;  3W5O A;  4H7B A;  3OIP A;  2H1E A;  3QB3 A;  2B2W A;  4BXX H;  2JA5 B;  2K52 A;  4DPG A;  3K7A H;  5FLX E;  5IWA L;  3BZC A;  2LXJ A;  1VMC A;  4K5X A;  1G8Z D;  2OCE A;  2EY1 A;  3J7Y W;  2R92 H;  2YU9 B;  2NZ1 D;  2JXM B;  3K5O A;  2AKW B;  1DM0 B;  2VW9 A;  1TY0 A;  4L5T A;  5C5M A;  1Y69 U;  2WP8 J;  4IUT A;  3BZK A;  1ILQ A;  2KEE A;  4DAP A;  3GTM B;  1CT1 D;  1SND A;  5IP9 H;  3M7N A;  3ND8 A;  2HDL A;  3I2Z A;  3AMU A;  2B2T C;  3TP7 A;  1RDP D;  2I46 A;  4X65 Q;  4HJ7 A;  3PUV A;  2B3G A;  3MXU A;  3OYY A;  4EQO A;  3NEM A;  3NHH A;  4KY7 A;  2K75 A;  1GKH A;  3CCL A;  3GTL H;  3W1G A;  2GVB A;  3HOZ H;  1EOT A;  1I4P A;  3TP8 A;  1AP0 A;  3TZD A;  4C3H B;  4IOA A;  1KRT A;  1XNQ Q;  4K8I A;  4DAY A;  1CKM A;  3K5M A;  2NZH A;  2YYZ A;  4X6A H;  1NR2 A;  2IHE A;  5L37 A;  3KF6 B;  2MP1 A;  1TVX A;  5IIF A;  1XJV A;  2F0M A;  3TS0 A;  5LHY 1;  3S14 B;  1Q3L A;  4UDU C;  1B3Q A;  3MFY A;  2Q2T A;  4BY1 G;  1X54 A;  3PUX A;  5LMN W;  4DK3 C;  3MHB A;  3ERS X;  2FMM A;  5C44 G;  4A76 A;  2ENB A;  4HIK A;  1UE5 A;  3BZD B;  3X3N A;  1PH7 A;  3PO3 H;  1ZEQ X;  2PI2 E;  4RA8 A;  4DV3 L;  3VYT A;  1TWC H;  4XT1 B;  2H4O A;  3AFQ A;  2PW7 A;  5IOC A;  1PFM A;  4HN7 A;  3OTO L;  1S5E D;  4WJ4 A;  2A73 B;  5TSS A;  1D5M C;  4A3C H;  2WAQ E;  4KHV A;  2JK8 A;  1MJE A;  1DXM A;  4YWM A;  3HOX H;  3KF6 A;  2B2V A;  4NPS A;  1TXY A;  2L4N A;  5EBC A;  2A69 D;  1SNM A;  5HUR A;  4MHE A;  5FO8 B;  4AYB B;  1AW7 A;  4I65 A;  2IJ0 A;  3I4O A;  1O7L A;  2UUB Q;  3MXP A;  2A68 C;  4X3T A;  3SEB A; 
#chains in the Genus database with same CATH homology
 1B7Y B;  4OON A;  1I94 L;  2CWA A;  1YVC A;  5LMN L;  2AMC B;  4A3G G;  1XPR A;  4POF A;  2JA9 A;  4YHH Q;  4DV1 L;  1TWA H;  3PV0 A;  1WJJ A;  3CME A;  1AE3 A;  1X55 A;  1VQG A;  2JQO A;  2NN6 I;  2QEX A;  1P16 A;  1QVC A;  4C2M H;  3JAM c;  4DV7 Q;  4LWC A;  5M5X H;  1A8V A;  4DV6 Q;  3OW2 A;  1WCM H;  4O0A A;  1KQS A;  4OO1 G;  4AYB E;  5IYB H;  2UXC Q;  1KAW A;  3TEH B;  1L1O C;  4DV5 Q;  3S2H H;  2I5L X;  3UE1 A;  1K9M C;  1EIF A;  1B70 B;  4LF8 Q;  2JA6 G;  2ZJR A;  3RN2 A;  4IPC A;  3PIP A;  4B3S Q;  3F2D A;  4JV5 Q;  4DR4 Q;  3AFP A;  3CCS A;  2UUA L;  1K3R A;  1H95 A;  3I4N H;  4DR3 L;  3UDI A;  4A3L G;  4PZ8 A;  4LFA L;  2NVQ H;  4R4Q A;  1IYJ B;  5JJI A;  1Z47 A;  4A3D H;  3DLL A;  1VQL A;  4NXN Q;  4GKJ Q;  3A74 A;  3TQY A;  5LMU L;  4A3K H;  4A3M H;  1VQK A;  4EQ5 A;  4Y52 H;  1VQN A;  4APV A;  2GVA A;  5C0X I;  3RNU A;  2ES2 A;  3H3V I;  2R7Z G;  1XPU A;  3M4O H;  1PA6 A;  4UY8 C;  3L2P A;  4DR5 L;  3JAM i;  1HR0 Q;  3GTP H;  1S3O A;  4B3M L;  1ASY A;  4K0K L;  4A4I A;  2HHH L;  1JJG A;  5IYD H;  1I3Q H;  1GM5 A;  4DR7 L;  2AWN A;  3HKZ G;  1IBM Q;  4DUY L;  2B63 H;  2FXQ A;  1MIU A;  4QY7 A;  4A3J H;  1QZG A;  4B3T Q;  4DAM A;  1M90 C;  3ZJY C;  1E7Z A;  5JJL A;  1K0R A;  4GLX A;  4DR1 Q;  4MZ9 A;  2ATW A;  1FJG Q;  1N32 Q;  4X62 L;  4GS3 A;  2QA4 A;  4A3E H;  3KYH C;  1K73 C;  3S2D H;  1JJ2 A;  1E1T A;  1OXS C;  1VQF A;  3H0G G;  5GQO A;  2K5V A;  3HOZ G;  3CC7 A;  4C3J H;  2JA7 H;  3ULP A;  1DGS A;  2E8G A;  3FKI H;  3HFZ B;  2R7F A;  4BA2 I;  3BJU A;  4JI8 L;  4JYA Q;  4MNO A;  4LF7 Q;  1CKN A;  3Q8D A;  4KHP Q;  2ZM6 Q;  2WB1 G;  1P8L A;  2ZTE A;  2BH2 A;  5BR8 L;  3M3Y H;  1JJC B;  4R4T A;  3I4M H;  1VQ6 A;  2UUC L;  1VQM A;  4YCV A;  1CUK A;  2JA8 H;  3U50 C;  5C3E H;  5EAY A;  4MTN A;  1OXX K;  4AQY Q;  2Q2U A;  5H1S E;  3M4Q A;  5C0X J;  1NMG A;  2UU9 L;  4LUZ A;  1N36 Q;  3EIV A;  5JJK A;  4H02 A;  3ULL A;  4J15 A;  1WOC A;  4PG3 A;  1KRS A;  2IT1 A;  5C4J H;  3CD6 A;  3JC6 6;  4AH6 A;  1SLJ A;  2VQE L;  1EQQ A;  2F4V Q;  3A5Z B;  1Y1V G;  4YWK A;  2EIF A;  3F2B A;  1HNZ Q;  2A1A A;  4TVA B;  3UDG A;  4OWX B;  3RR5 A;  3RZO H;  2I5H A;  3CC4 A;  1HZB A;  1RL2 A;  4YCU A;  4IFD G;  4X66 Q;  4IPH A;  4JI6 L;  4Y7N H;  3T1H Q;  1XMQ Q;  2WB1 E;  3KJO A;  1EIY B;  1PH9 A;  2XGT A;  1XMO Q;  1VQP A;  3NEN A;  2K5N A;  1SN8 A;  2I0Q A;  2D0O A;  4LF9 L;  2CCZ A;  3H15 A;  4RG1 A;  3RLF A;  1IBL Q;  4BBR G;  3S15 H;  1V43 A;  3CQZ H;  1I6H H;  1IZ6 A;  4YWL A;  3H3V H;  3HOV G;  4DV5 L;  1S40 A;  4YY3 Q;  1PYB A;  3HOX G;  1VQD A;  4P74 A;  3W1B A;  5IWA Q;  3HOU H;  1HNW Q;  5ELN A;  4JI5 Q;  3MXN B;  1W3S A;  1L0W A;  2MNA A;  4BY7 H;  4DV2 Q;  1VQI A;  2XTI A;  5JEA J;  5IYC G;  3K81 C;  5GAG C;  4A3I H;  3WWV A;  2MQH A;  4JI1 L;  1VCI A;  5E7N A;  2GN5 A;  3F8T A;  4LFB L;  4JI3 L;  4NXN L;  3DM3 A;  3G48 A;  1IBK L;  2PMZ E;  3M85 A;  5J3B A;  3U58 A;  1C7Y A;  4OX9 Q;  1FL0 A;  3PO2 G;  4BBS H;  2K50 A;  4KLK A;  4L5Q A;  4GNX B;  2E2J H;  1Q82 C;  5C4X G;  1HR0 L;  1G29 1;  1X56 A;  3CP0 A;  2ALY B;  4JCV E;  1N33 Q;  2R93 H;  3PUZ A;  1IBM L;  2K5H A;  1YEZ A;  5C44 H;  3GTG H;  1TWG H;  4LNQ A;  4UP8 A;  2RCN A;  1N34 Q;  4DNI A;  2YTX A;  1VQ9 A;  1YHQ A;  1FJG L;  3KF8 B;  2Q2I A;  1Q46 A;  1X6O A;  5IYB G;  1YHA A;  4POG A;  3RLN A;  1NJI C;  1PH8 A;  3PCO B;  1K8G A;  3F1Z A;  2YTV A;  4P75 A;  2JJQ A;  4QJF A;  4X65 L;  4DKA C;  5DLQ E;  3ULJ A;  2CQO A;  2NVY H;  4JI4 Q;  3B6Y A;  3J80 c;  4A3D G;  4NXM L;  4BXX G;  1Q8K A;  4A75 A;  4XIG S;  3PGZ A;  1J5E Q;  3PUY A;  4A3K G;  5HGQ A;  3CAM A;  4A3M G;  2EQS A;  2QGQ A;  4DR2 L;  1HNW L;  4WJ3 M;  4GLV B;  1C9O A;  1XNQ L;  1W2B A;  1YIT A;  1VQA A;  3KOJ A;  1N36 L;  3TS2 A;  2R92 G;  1SRU A;  2I5M X;  3CCJ A;  4ALP A;  1QVG A;  3E9H A;  4GNX A;  4JI0 L;  4R1J A;  4A3F G;  2ZJQ A;  1I5F A;  3CCR A;  2OTL A;  1U0L A;  2BA1 A;  1XNR Q;  4GOP B;  1PVO A;  1FVI A;  3SGI A;  1KIX A;  5M5Y H;  1SE8 A;  3D0F A;  5FJ8 H;  1E3P A;  3KFU A;  1VQE A;  1VQJ A;  4A3E G;  5IP9 G;  1E1O A;  1MKH A;  2KBN A;  2N8N A;  3J80 i;  4X66 L;  4X64 Q;  1Q12 A;  3FKI G;  1I50 H;  3I55 A;  4IPD A;  2VUM G;  4DV3 Q;  5IP7 H;  4L5S A;  4LF6 L;  1VQ4 A;  4GNX C;  4LFC L;  1K83 H;  4LF5 L;  4GKK Q;  2OQK A;  2E5L L;  1IL2 A;  3BU2 A;  1TWF H;  4JI2 Q;  4JBK A;  4YCW A;  2HT1 A;  1QUQ B;  4DV0 L;  3VDY A;  4JBM A;  3I4M G;  1BVS A;  3L7Z C;  3RLO A;  3FP9 A;  5C3E G;  2BA0 A;  4DAY B;  4B3R Q;  2CKZ B;  3FHW A;  2Z6K A;  3HOY G;  2RHQ B;  2JA6 H;  1VQ7 A;  2JA5 H;  4IFD I;  3M9B A;  4JBJ A;  3HOW G;  1UE7 A;  4P71 A;  1NY4 A;  2VNU D;  2EXD A;  3S1N H;  4A3L H;  1TWH H;  4R4I A;  2D0P A;  1LYL A;  3T1Y L;  1UEB A;  2RF4 A;  5GAE C;  3G71 A;  1U5K A;  2RHS B;  2WFW A;  2R6G A;  5M3M G;  1VS0 A;  4DUZ L;  1Y1W G;  1Q7Y C;  1HR0 W;  1VQ8 A;  3HKS A;  3UDF A;  1HNX L;  1CKO A;  2YU9 H;  4PMW A;  4DV4 L;  3S16 H;  2UXD Q;  5AJ3 Q;  1VQC A;  2A19 A;  4GOP A;  3HKZ E;  4XTC S;  1PH2 A;  1JMC A;  2Z6K C;  3GTM H;  4HJA A;  4UP9 A;  1I94 Q;  4UPA A;  1PV4 A;  1GVP A;  1HZC A;  5LMN Q;  3J81 c;  1EFW A;  1Q86 C;  3G6E A;  1EYG A;  3PO3 G;  1JB7 A;  4DV1 Q;  2UUB L;  4LW1 A;  4RMF A;  4LF4 Q;  3STB C;  2HQL A;  5C0X G;  4HIM A;  3K0X A;  5FLM H;  2ZJP A;  3LGJ A;  1KC8 C;  3HOU G;  4GOP C;  2H5X A;  1QUQ A;  2DGY A;  4BY7 G;  3D31 A;  4YHH L;  1EOV A;  2MO1 A;  3NEL A;  4QQB X;  1SR3 A;  3E0E A;  1OTC A;  4JI7 Q;  2E2H H;  2Q2H A;  1CSQ A;  1EUJ A;  1HZ9 A;  3G4S A;  3CCQ A;  4C3H H;  2NVT H;  4DV7 L;  2UUA Q;  1YJN A;  2ZTD A;  4DV6 L;  1NTG A;  4DR3 Q;  3TRZ A;  2JEB I;  4A3C G;  4LFA Q;  3U4Z A;  3GTO H;  1HJP A;  1YHB A;  2UXC L;  3PSI A;  1SMX A;  3CCM A;  1YNX A;  4BBS G;  4LF8 L;  2KHJ A;  4KHZ A;  3J81 i;  1HZA A;  1GD7 A;  3E9I A;  1T9H A;  3MEF A;  5LMU Q;  3GD7 A;  4B3S L;  1KHI A;  4O2D A;  4L5R C;  1NMF A;  4JV5 L;  4DR4 L;  2R93 G;  4A3B H;  4QL5 A;  4DR5 Q;  3S14 H;  2KCM A;  2CFM A;  4B3M Q;  4K0K Q;  2HHH Q;  1Q1E A;  4GKJ L;  3KDF B;  3I56 A;  1XNR L;  1L1O B;  2LSS A;  4DUY Q;  2JE6 I;  2PQA B;  4LUV A;  3CCV A;  3PF4 A;  3CMA A;  2YV5 A;  3F2C A;  1RIP A;  5GRO A;  4OO1 I;  1Y1V H;  1OXT A;  2IHF A;  1PH6 A;  1MJC A;  3CPF A;  3K80 C;  4JC0 A;  3U4V A;  4X62 Q;  2K14 A;  4BY1 H;  1YBY A;  5JEA G;  3PUW A;  1EQR A;  4IOC A;  1Y14 B;  4P72 A;  4EX5 A;  4B3T L;  2KCT A;  4NB3 A;  1V9P A;  1N9W A;  1LTL A;  2KEN A;  4FDB A;  4JI8 Q;  3J7Z C;  4DR1 L;  4A93 H;  4GKK L;  1BKB A;  1N32 L;  1WCM G;  5M3F H;  4JBW A;  5BR8 Q;  3I7F A;  1WYD A;  1L2F A;  1VQH A;  2CWP A;  2UUC Q;  3HOV H;  1KD1 C;  1PH3 A;  1N8R C;  3S1R H;  4DR6 Q;  3PIO A;  1OXV A;  2Y0S G;  5GAH C;  1V1Q A;  2PI2 A;  5HY6 A;  4JYA L;  4LF7 L;  4KHP L;  2ZM6 L;  4OXP A;  1O7I A;  3I4N G;  3J81 j;  5IYC H;  4GN5 A;  3KJP A;  2F52 A;  2HIV A;  2JEA I;  3A0J A;  4JOI A;  2VQF Q;  4OWT B;  3CCU A;  1LM0 A;  4AQY L;  2VQE Q;  2ASB A;  1SRO A;  4KI0 A;  4GN4 B;  5FLX c;  5AJ3 L;  1BBU A;  3PO2 H;  2UXD L;  1D7Q A;  3KDF A;  1A62 A;  4R4C A;  5C4X H;  2PQA A;  4BA1 I;  2KHI A;  1YJW A;  5IYD G;  3EN2 A;  1R9T H;  3K8A A;  4JI6 Q;  2B63 G;  5IP7 G;  2VZA A;  4A3J G;  1Q81 C;  2F4V L;  1J6Q A;  5M5W H;  1PH1 A;  4LUO A;  2N78 A;  3K7U C;  2V1C C;  2OTJ A;  1PH5 A;  2D62 A;  3GTK H;  4JOI C;  1X65 A;  1HNZ L;  4LF4 L;  4GN3 B;  4LF9 Q;  2OQ0 A;  1X3F A;  3S24 A;  1YJ9 A;  2Y0S E;  1QVF A;  1CKN B;  3T1H L;  5ELO A;  1XMQ L;  2JA7 G;  1K8A C;  1X3E A;  3EBE A;  3NBH B;  1OXU A;  1PHJ A;  4A3G H;  2JA5 G;  4JI7 L;  3ER0 A;  2LXK A;  3PF5 A;  1XMO L;  2A8V A;  1ASZ A;  1AH9 A;  4DK6 C;  1NBW A;  3GO5 A;  3OTO Q;  2B29 A;  2OWO A;  1IBL L;  4C3I H;  3CC2 A;  4JI1 Q;  2AHO B;  3W5O A;  1NE3 A;  2MFI A;  1X3G A;  4HJ8 A;  4LFB Q;  4JI3 Q;  2AWO A;  1IBK Q;  2JA8 G;  4BXX H;  2C35 B;  4YY3 L;  2K52 A;  4DPG A;  3K7A H;  5IWA L;  3BZC A;  4JI5 L;  5IY0 A;  2LXJ A;  2N3S A;  1Z9F A;  4DV2 L;  4IJH A;  1UWV A;  2OCE A;  2ZTC A;  1PH4 A;  1D8L A;  1G51 A;  3UE0 A;  2UXB Q;  3CF5 A;  2R92 H;  2ID0 A;  1VQ5 A;  4A3F H;  3CXC A;  2NN6 G;  2AKW B;  2E2I H;  4OWW B;  2VW9 A;  3CPW A;  4OX9 L;  4L5T A;  4PZ7 A;  4QIW E;  1Q1B A;  3CW2 C;  1UE1 A;  2WP8 J;  3RN5 A;  1YIJ A;  3BZK A;  1AE2 A;  2R7Z H;  2PNH A;  5GAD C;  5IP9 H;  1N33 L;  3M7N A;  5FLM G;  2VS1 A;  3I2Z A;  1HH2 P;  2NZO A;  1N34 L;  2VUM H;  2F3I A;  1JE5 A;  4X65 Q;  4HJ7 A;  4R4O A;  3PUV A;  2B3G A;  3OYY A;  1FGU A;  3S17 H;  3TRE A;  2VY3 A;  3NEM A;  2BH8 A;  2K4K A;  1JT8 A;  2IX1 A;  3IRB A;  3J7A 5;  4IPG A;  3H0G H;  4NXM Q;  2K75 A;  1GKH A;  3CCL A;  3GTL H;  3W1G A;  4DR6 L;  2GVB A;  3HOZ H;  2VL6 A;  4DR2 Q;  4IOA A;  1KRT A;  1XNQ Q;  3HOY H;  2Z0S A;  4A3B G;  4A3I G;  1CKM A;  4IFD J;  3HOW H;  4JI4 L;  2NZH A;  2YYZ A;  4X6A H;  4JI0 Q;  3GTQ H;  2IHE A;  3KF6 B;  2VQF L;  1J5E L;  3S1M H;  1XJV A;  1EWI A;  3TS0 A;  1Y1W H;  5M3M H;  4TQU S;  2WAQ G;  3L0O A;  4HIO A;  1LUZ A;  2Q2T A;  4BY1 G;  1X54 A;  3PUX A;  1VQO A;  5LMN W;  4DK3 C;  3ERS X;  4ME3 A;  5C44 G;  4A76 A;  4DR7 Q;  1C0A A;  4HIK A;  4HJ9 A;  2IY5 B;  1UE5 A;  3STB D;  3UDX A;  4A93 G;  1PYS B;  3GTJ H;  4LF6 Q;  4LFC Q;  1PH7 A;  4LF5 Q;  3PO3 H;  1YZ6 A;  1B8A A;  2MO0 A;  3AQQ A;  3M4P A;  2E5L Q;  5M3F G;  1S72 A;  2PI2 E;  1E24 A;  3S1Q H;  4DV0 Q;  2N49 A;  4X64 L;  4GLA C;  4DV3 L;  1CSP A;  5IT9 c;  4IO9 A;  1TWC H;  1WFQ A;  1UE6 A;  3AFQ A;  3ICE A;  5IE8 A;  1E22 A;  3OTO L;  4HJ5 A;  4WJ4 A;  5K36 G;  1QZH A;  4AIM A;  4JI2 L;  1A63 A;  1KXL A;  4PZ6 A;  4A3C H;  1XTD A;  2WAQ E;  3T1Y Q;  4BBR H;  4B3R L;  4JG2 A;  2JK8 A;  4DUZ Q;  1MJE A;  4UP7 A;  2YTY A;  2HIX A;  4YWM A;  4AYB G;  3HOX H;  1YI2 A;  4QGU A;  3KF6 A;  1SFO H;  4DV4 Q;  2DUD A;  1HNX Q;  3AEV A;  1G6P A;  4NPS A;  3GDE A;  1X9N A;  1TXY A;  4IJL A;  2UXB L;  3AYH B;  2NVX H;  2UU9 Q;  2IX0 A;  4P73 A;  4HID A;  3KLW A;  1XPO A;  1VQB A;  3CCE A;  2R7D A;  1PFS A;  1WI5 A;  1IXR A;  1A0I A;  5FJ8 G;  1KL9 A;  3I4O A;  2UUB Q;  1GO3 E;  2L15 A;  1L1O A;  1BBW A;  1M1K C;  3RZD H;  3A5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...