2ENBA

Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Crystal structures of the binary Ca2+ and pdTp complexes and the ternary complex of the Asp21-->Glu mutant of staphylococcal nuclease. Implications for catalysis and ligand binding.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2enbA00
3NK9A 4K2LA 5DEHA 4KV6A 1A3VA 4DFAA 1EY7A 5DAUA 1SYEA 3T16A 4OL7A 1TQOA 1EY8A 2EY5A 3SK5A 3C1FA 3LX0A 3MZ5A 4E6IA 4H7BA 3P1HA 3DHQA 4K8JA 4KJNA 2F0VA 3EVQA 2EYJA 2RDFA 3TP5A 1STNA 3MHBA 4J6HA 5C3XA 3D4DA 5E3FA 5KEEA 4IUNA 2PZWA 4EQPA 1ENCA 5IOCA 4K5XA 1A3UA 2PW7A 1KDBA 2RBMA 1STBA 3EJIA 3H6MA 3QB3A 5CV8A 3TP6A 5IGGA 5ISRA 4J1MA 4KD3A 3D8GA 4B9XA 1A2UA 4QF4A 1IHZA 1F2ZA 2ENBA 2WACA 2OEOA 5J22A 4K6DA 4QB4A 1SNMA 5CR3A 1RKNA 3QOJA 2EY2A 1STGA 4NKLA 5KIXA 1SYGA 2EYPA 5KYIA 4IZ8A 5HGTA 1EZ8A 2EYLA 4IALA 5I9PA 3TMEA 2F0HA 2PW5A 2M00A 4DU9A 4G57A 2F3WA 2PZTA 1JOKA 1EYAA 2RKSA 5F2DA 3SR1A 4EVOA 1KDAA 3SK4A 2F0FA 1SNDA 5HURA 4S3SA 4KTAA 4ODGA 3NHHA 4WRDA 2F0LA 4KJOA 3P75A 5IODA 2SNMA 4KD4A 1EYDA 1STYA 2F0KA 5NUCA 3MXPA 3SXHA 2F0DA 4I65A 4RKLA 2F0UA 5IGDA 1EY6A 5J39A 4EQNA 4LAAA 1ENAA 1SNCA 2EY1A 4KHVA 3SK6A 3ERQA 2EYFA 1JOQA 4PMCA 5J1ZA 2NUCA 3V2TA 3NXWA 4B9WA 2F0NA 5I9OA 3BDCA 5E1FA 4WORA 4N9TA 3EROA 1NSNS 2F0MA 2KQ3A 2F0PA 4KY5A 5C4HA 3DMUA 3RUZA 1SYFA 3MEHA 5CC4A 5C5MA 3D4WA 1F2MA 1U9RA 5CGKA 5I6YA 5IGCA 4HTHA 5M9OA 4ZQ3A 5KYLA 2PYKA 5CV4A 5CV5A 5IGBA 4ZUIA 1SYCA 5C6AA 4R8NA 1TT2A 1EQVA 4MIUA 4NMZA 5CV6A 1JORA 1EY9A 3NUCA 2PQEA 1JOOA 2EY6A 2EXZA 4NP5A 5IGEA 3S9WA 4N9PA 5IIFA 3C1EA 2SOBA 4HMIA 4F8MA 3OSOA 1F2YA 3E5SA 2OXPA 5EKKA 4EQOA 3SK8A 1SYBA 5K5PA 2F0JA 1KAAA 3TP7A 4K2KA 3OWFA 3BDLA 1EYCA 4K8IA 4RKBA 4ZUJA 1KDCA 3HEJA 5C4ZA 3NQTA 4TRDA 4ME5A 1EY0A 4NDXA 2EYHA 2F3VA 5C5LA 1II3A 5CV9A 3U9OA 5C3WA 3PMFA 3VA5A 1STAA 2QDBA 2KHSA 5I6WA 4PMBA 5KRUA 1AEXA 3D6CA 4PNYA 5EKLA 3SHLA 5JAVA 2F0SA 1EY4A 4QMGA 4DGZA 1A2TA 1SYDA 1A3TA 3NP8A 4K5VA 1STHA 2F0OA 2O4XA 2EYOA 2OF1A 3ITPA 2F0GA 1KABA 3OMCA 2HQEA 3MVVA 3QOLA 1SNOA 2F0IA 4ID6A 4YIJA 5CV7A 1TR5A 2F0EA 2F0TA 2PZUA 3OMGA 2SNSA 4KY7A 1SNPA 5EGTA 1EY5A 3TP8A 2EYMA 5IGFA 5KGUA 4F7XA 2F0QA 1SNQA 4HMJA 3HZXA 2LKVA 4K14A 3R3OA 4K5WA 4DF7A 1EZ6A 2F0WA 3T13A 1NUCA 4KY6A 5JOBA
chains in the Genus database with same CATH superfamily
1PZJD 4NW2A 4DFAA 1A3VA 4A93B 3JC66 1FD7D 3KYHC 4R4IA 3A55A 4BXXH 4UP9A 1WTOA 3EVQA 4A3BG 5GQOA 5EPJA 4DV3Q 1VQHA 1Z7TA 2EQSA 3ZJYC 1GUGA 2EOTA 3M7GA 5IGGA 4J1MA 1NR4A 4B9XA 5G3LD 3NELA 1R4PB 3QOJA 3UDXA 1STGA 2H4OA 1FVIA 3SE0A 1FGBD 3U58A 4DA2A 3J80E 2R7ZH 2OQKA 5C4JH 1PTOC 3CC2A 2N8NA 2F0FA 3H09A 5FO7B 2RDHA 1N33L 4IFDH 3NTHA 4ODGA 2HDLA 2KENA 1X32A 3CCLA 1B53A 4OO1H 3S15B 3CHBD 1DYQA 4PG3A 2VUMG 1JOQA 4GNXA 4ZKCB 4HJ7A 5IT9L 1ASYA 4A3GG 2BDOA 5C4HA 4F88A 3UE0A 3ULLA 1NMFA 2R7DA 1A63A 1PTOD 2B63G 3H3VC 4JYAL 4V190 3HOUG 4CDEC 4DK0A 1EIGA 1E3PA 2C35B 1M8AA 5DLQE 3HKZB 3PUXA 3SDZA 1EYCA 3GV6A 2IL8A 4BY1G 1QCBD 1Z9FA 4NDXA 4CJ2C 4MNOA 1E0BA 1G291 1Q7YC 3F2DA 5IE8A 4DUYQ 1B3AA 4H13C 2TMPA 3K7UC 3D3RA 5M3FH 3H0GB 1PH1A 1XPUA 1STHA 1KQSA 3SK4A 1K83B 1NR2A 1OXVA 1X3EA 2HCIA 3FRPB 4JBMA 1WCMG 1STEA 4LUVA 4A3MH 1I4PA 2A5HA 3S17B 2HIXA 4A3KG 4HMJA 3R3OA 1PZID 1TWHB 1F2LA 4A3JH 1UNSA 1K28A 1GUOA 1HNZL 1XX8A 1Y1VB 2RVLA 1FNUA 3N52A 4GNXC 1E1TA 1KD1C 5M5WB 1YNJC 5IYDH 2TSSA 4AH6A 1SR3A 3J81j 1JWMD 2M2LA 3FDTA 1HTPA 4JI2L 2F3IA 4YY3L 3GTMB 2OCEA 3CAMA 2JSOA 2MNAA 4X3SA 4UP8A 1PH9A 5GAGC 1Y1WB 4JI7Q 2JA7G 1SFOB 2NZ1D 1SXTA 4IZ8A 1HNZQ 1CSQA 2EYLA 3L2PA 4KN4C 1YBYA 4KHZA 4X3TA 3AB9A 5CBEE 1YNJD 1JWUD 2XGTA 1Y8NB 2Q8TA 1XMOQ 1LLRD 4A3LH 3OW2A 4JCVE 3R8BA 3V96A 1VQOA 4PZ7A 3G6JB 3JAMc 4POFA 4A93G 3WDNA 1RJTA 1LO5D 1UE6A 1PZKD 3VYTA 3L0OA 5CC4A 2Z4IA 2L4NA 3OTOL 4DUZL 4F87A 3RN5A 2R7ZB 2PQEA 5C4JB 1LV9A 2FINB 2I5LX 2A68C 4HMIA 4NXNL 5A2QL 4HAEA 4ILWA 1BO0A 5IYBG 1GD7A 3K0YA 2NZHA 1CTMA 2BH2A 1YHBA 2EYHA 2F3VA 4IUQA 1LT5D 3FVQA 4R4TA 4DV0L 2IX0A 2G9HD 1CK1A 3SGIA 3GTLH 4C2MH 2VQEQ 3OTOQ 2F0OA 3ITPA 4EGVA 1HFGA 1PH6A 2HQLA 3K7AH 1KHIA 2SNSA 2A68D 5GAHC 5JEAH 4K14A 3HZXA 4POGA 1C8CA 1NUCA 1YEZA 2D9UA 2I07B 5D3DA 2NVYH 1QG7A 1U4PA 3JAMi 4RAUC 3LX0A 3MZ5A 1PA6A 3A8IE 2EE1A 1BUVT 4K8JA 3PF4A 4DV0Q 3TP5A 5CYUA 1BKBA 4LUZA 5M3FB 4DK6C 2OWOA 2IHFA 1ENCA 5IOCA 3F8TA 2KVMA 1O7LA 3MEFA 4QY7A 1L1OC 1LABA 3OIQA 4A3MB 2Q8RE 4X3UA 3KBGA 1RF2D 4QF4A 1DGSA 2K4KA 2EJGC 2ENBA 5J22A 1XPRA 3M3YH 2YTXA 4DR6L 4P71A 4KLKA 5LMNW 4A3JB 2EYPA 1C9OA 4G4KA 3HKSA 2N49A 3GTPH 3A56A 3H0GG 3D4RA 3L9AX 2L1BA 2P5ZX 2K01A 3A54A 4WRDA 2WP8J 3VR2A 2SNMA 1YZ6A 3NEMA 1LTSD 1W3SA 1Z47A 2AQ1B 2AKWB 2F0KA 3S2DH 1LYLA 3RNUA 1I6VC 4C3HH 2UXCL 4HJ9A 5LMUL 3I91A 1PLFA 2E2IH 1HZAA 5JPNC 5M5XH 4LUOA 5IGBA 5C44H 1BCPB 3T1HL 2IJ0A 1A15A 4G7OC 5IIFA 2G9DA 4OWWB 5JJKA 5EKKA 3NBHB 3M4PA 4O2DA 3OWFA 1PHJA 1Y1WG 3T4AC 2QEJC 3TS2A 4TQUS 4TRDA 1QVCA 1G8ZD 4NXMQ 4ZYSA 1I50B 4KKTA 3STBC 2HCCA 2OTLA 2NTTA 4BXXG 3FMCA 5LMUQ 4OONA 1O7ZA 2KCNA 1IBMQ 3RR5A 3IFDA 3FPUB 2JE6I 1SNOA 4DV1Q 1N34Q 4QQBX 1VQ9A 1UWVA 1BXTA 1UEBA 5JJIA 5EAYA 2LKVA 1EZ6A 3URYA 3TEHB 1E2WA 3B6YA 3PUZA 4GKKL 3D6WA 4ZLTF 4FXKC 3T56B 3PQIA 3K59A 2L9HA 4CGYB 2QA4A 3T1YL 4YHHQ 2L5TA 4H7BA 1SMYD 1I5FA 2JYOA 4UP7A 2R7ZG 3H91A 3CMAA 1D1KA 1G2TA 2LY7A 4XT3B 3GTLB 4IUNA 1GUSA 4IFDG 2K5HA 2CH4W 3I55A 1VQMA 2L55A 5CV8A 1H9RA 3K7AB 3KK7A 4OO1G 2K28A 3JAME 1SNMA 3W2DA 3FEWX 4DAYB 1AZPA 4GKKQ 2A6EC 3E0JA 3K81C 2NVYB 2MQHA 3L7ZC 5EKIA 4CDCC 1G91A 4I7AA 4JI1L 2PZTA 3MXNB 5FO8B 2PO4A 4IFDJ 3UI2A 4WJ3M 3J80L 5LL6S 4ULLA 1FL0A 1HNWL 2F0LA 3LGJA 1PFMA 3TQYA 5CMDA 4C1NI 3VYUA 1X9NA 2NVQH 4OX9L 4H44C 4PMCA 1GM5A 1JJGA 3BVZA 3NXWA 4B9WA 1PH7A 3M3YB 2JEBI 4OWXB 1NMGA 4BA2I 1SYFA 4B3RQ 5CGKA 3E0EA 5I6YA 1A6XA 4DV6L 3TZDA 5M9OA 2A6ED 1J6QA 3GTPB 3NTIA 5M3FG 1EY9A 1UEAB 3PIP3 4DR1L 1XNRL 1SDFA 1I4QA 5EJWA 2K50A 2KOLA 1EOTA 4IPHA 2OXPA 4A3MG 4HIMA 1HNWQ 2NWGA 1EU3A 1U4MA 4K2KA 4XXEA 4IOCA 5FLXE 1VF7A 1HQRD 4A3JG 3NQTA 4C3HB 1JR0D 1L0XB 2AQ3B 4L63B 4ME5A 3KJOA 1FYCA 4OX9Q 1XNQQ 3U9OA 4DAVA 1Z6HA 3CCMA 3AMUA 3PMFA 3K5LA 2D2CC 2B2TC 5IP9H 1JMCA 1E7ZA 1EY4A 4QMGA 1SYDA 4AQYL 2E2IB 5IYDG 5M5XB 3PUWA 2F0GA 5C44B 2LSSA 3IRBA 1SJED 4A76A 1Y69U 4DR1Q 1TS5A 1XNRQ 2FJ2A 4F7XA 1SNQA 1BBWA 2M9VA 1EQQA 2X6LA 3T13A 4RGMA 2K32A 1RODA 4TVAB 1ZYRC 3PO3H 2EIFA 4LF6Q 2PQAB 2ZTEA 3C1FA 4CDDC 1MKHA 4DR4L 1TXYA 3E9HA 5ELFA 4Y7NH 3HOVH 3T51B 1TWCH 3D4DA 2K5DA 3TSSA 1LACA 4AIMA 1HZCA 1KDBA 2F52A 4A3LG 1TS4A 3CCSA 3K8AA 2LXKA 3Q0AA 1E22A 3M4YA 4YWKA 3CCJA 1VQDA 2VUMB 2MO0A 1ZYRD 3FHWA 2B2VC 2H1EA 4N8FA 3BZCA 4IALA 5I9PA 1BNZA 4G57A 1VCIA 1ONLA 5BN4A 1S3OA 2E2JH 1B4OA 4DR4Q 1WYDA 4GN4B 1L0WA 4X65Q 2WV6D 3I4OA 4X6AH 4FXDA 5IODA 4X64Q 1K8GA 3NBHA 3NBIA 2D5DA 4I65A 3CMEA 2QW7A 4KHVA 3NSWA 5D14A 4N9TA 1LTTD 4X66Q 3J81i 4XT1B 3K5NA 1BR9A 1S5DD 3LWEA 2JA6H 4DK1A 5C6AA 5CV6A 1TT2A 4GOPC 1B9MA 1MBYA 2EY6A 4LF8L 1PH4A 3IL8A 2CHBD 4HCSA 3J7YW 1NNXA 2E5LL 4B3TQ 4JI0L 4PZ6A 5JEAG 2ZM6L 3S1QH 3TP7A 3GTQH 2KECA 3CCEA 1VS0A 2Z6KA 4ME3A 2NVQB 3HS0C 3ONAB 4IPGA 2L11A 4JI3L 1IYUA 4DV4L 2K1BA 2A69C 1SE3A 2F0SA 3K6OA 3J7ZC 2OF1A 3U50C 4DV7L 4UPAA 4LF8Q 2BCOA 1N32L 2A73B 1W6KA 2NN6I 2E5LQ 1X3FA 1WTPA 4DXFA 2RSNA 1YI2A 4KMUC 1K3BC 4PZ8A 4C3IH 3VYSA 1VQNA 1I4XA 4DAYA 5BR8Q 4Y52H 1AP0A 2J0TD 5C3EH 2YYZA 4JI3Q 2A69D 4DV3L 3MXNA 1DOMA 3GO5A 3MHBA 1D5MC 2EPBA 1RIPA 1IKLA 1WD0A 3G6EA 1ESRA 1PRTB 3CPWA 1D7QA 3GTKH 4RHRA 1B50A 4L5RC 2K03A 5IYCH 3O13A 4C3HG 2Z4HA 3GTGH 2XRSD 4R4CA 5KNDA 5GADC 3PO3B 2VZAA 2F0HA 2M00A 2Z6KC 3J7AV 5C44G 1X6OA 2C9OA 4Y7NB 4MTNA 3RD4A 3HOVB 2NB0A 1TWCB 1V8QA 1J9OA 3Q8DA 1D6EC 2L12A 2EJFC 3BDCA 3CC4A 2Z6BA 1EYGA 1D2BA 2K75A 5C5MA 3D4WA 3U9SA 1WTXA 4HTHA 3I4NH 4QGUA 2GA4B 1HUNA 5JPMC 1DCZA 1EQVA 2HUGA 4Q0FA 3CQZH 2CKZB 2E2JB 1S4ZA 2VQFQ 3D0FA 1CT1D 4M8AA 2KA7A 2DGYA 4HIDA 2VL6A 4ABNA 1L0YB 1XYIA 1MHWC 1VQ7A 4LWCA 1G2SA 4QIWB 1KDCA 3J81E 1DZ1A 1IBLQ 2HHHL 1K73C 4DUYL 2QDBA 3NQIA 3WOFA 3SHLA 4JC0A 3NPPA 3MFYA 1B9NA 4K5VA 3A7AB 1A0IA 2JA6B 2UXDQ 5FO9B 1BBUA 2IT1A 1GHKA 4B3MQ 2KHIA 2B2UA 3RMHA 1PFSA 5LHY1 1RCVD 4CKCA 3S1QB 4CDFC 3GTQB 2HHHQ 1O78A 3K0XA 1SLJA 1HZBA 4FF2A 4NB3A 2UUAL 1LT3D 2EJMA 3CPFA 2KUMA 4QJFA 5LMNQ 2NZOA 2CFMA 3F2CA 1WD1A 4YCVA 2RCNA 4B08A 3VR5A 2NN6H 2Z1CA 2ZTDA 1KRTA 4R1JA 2A8VA 2K5WA 4OELB 2PNRC 4LF7L 4JI7L 3RLNA 1EEID 4QCLA 4JI6Q 4LFAQ 4RGTA 4C3IB 1AE3A 4LFCQ 1H9SB 1F9SA 2L0CA 2RKSA 5C3EB 3P7JA 1PYBA 3NWSA 2UUAQ 5BN3A 1Q82C 1K9MC 1PFNA 1JQYD 2RA4A 2V4DA 4KJOA 3P75A 1XMOL 2I5HA 1DJRD 1HZ9A 2F0DA 5IT9c 5I2YA 5T1GA 4N8X1 2N55A 3GTKB 3QWNA 2DNEA 3OW7A 1F9PA 3V2TA 2F0NA 4LF7Q 3H3VI 3GTGB 4QUCA 2B2YA 3LNNA 2RCFA 3KF8B 2B2UC 2EXDA 1XTCD 3U4VA 5IP9G 4X62L 3BU2A 2HDMA 4BWGB 4U68A 5IGEA 1IBKL 3VR4A 1SE4A 4C1NK 1GUTA 4APVA 4DR2L 2CCZA 5HY6A 1QB5D 5EQ0A 3BDLA 1WJJA 2CW0C 1FJGL 5FLXL 1II3A 3PO3G 1HJPA 5DNFA 1S72A 1CKMA 3AQQA 2YTVA 4LF9Q 2VQEL 1A2TA 2LS01 3I4NB 1VQBA 4DNIA 4X62Q 2GN5A 3HOVG 2WFWA 1I4HA 1HTLD 1V1PB 1TR5A 1BCPF 3CQZB 4IURA 5ELOA 1DOLA 1IBKQ 5JVG3 2XSCA 1KNAA 2VXWA 4DR2Q 1SN8A 5JVH3 4DF7A 3KFUA 4RGOS 1S5ED 4R4OA 4KY6A 1OTCA 2CW0D 5TSSA 2QDLA 1SYEA 1AN8A 1FJGQ 2K05A 5ELNA 3DHQA 1SEBD 1N9WA 1H95A 1FR3A 2XIWA 2YTYA 3E9IA 2A74C 2R7FA 3MA2B 5D3IB 1Y8PB 2PCFB 3D8GA 1NY4A 3T53B 1XMQL 1IHZA 4DKAC 4LF5Q 2CQOA 2Z9HA 5KYIA 5KNCA 4DR3Q 2B29A 3TMEA 4BBRH 1TWGH 2F3WA 1Q1BA 4OWTB 2JA6G 3KUPA 1SNDA 4PV1C 1UAPA 1IL2A 1LT4D 5IWAL 4IO9A 4JOIA 5C0XI 4KD4A 5NUCA 1WTQA 1SBBB 1PTOH 2BA1A 1E24A 2VB2X 4BBSH 1RHPA 1JB7A 5J1ZA 1XMQQ 1DM0B 5IP7H 2F0MA 2A6HC 3C2PA 1AFPA 3C46A 2UUCQ 3KDFB 5IGFA 4A3DH 3DWAA 4KHPQ 2NVTH 1KL9A 1S40A 4ZUIA 4R8IA 3CW2C 4C56C 1CSPA 5CORA 1EFWA 1TIID 2FHTA 4F8MA 3DLLA 5IWAQ 1JC7A 1KAWA 2X6GA 4EX5A 3H3VH 4OGQC 4C3IG 1KTKA 4NXML 4DV5Q 2A6HD 1KLGD 5C3EG 5H1SE 1K8AC 3S1RH 4HN7A 5BN5A 3PIPA 1IBML 4DV1L 1N34L 4CJ0B 1U5KA 1O80A 4GLAC 1EIFA 2C5CA 3D31A 2IWHA 3UDIA 2K5NA 1BOSA 2D0OA 5IYCG 1VQLA 3J7AF 2D0PA 4G7HC 3NK9A 4K2LA 5JJLA 5DAUA 4YHHL 4OL7A 1H9SA 4OIKA 2XTIA 4HIKA 1SMYC 3R2IA 1CQFA 4KJNA 2XWJB 2RF4A 1WTWA 1Q3LA 2PZWA 1K0RA 3BYYB 2JA5H 2K33A 4KD3A 3KJPA 2Z0SA 4QB4A 5CR3A 1RKNA 4UHVA 4NKLA 3F1ZA 4KI0A 5JJZA 3CF5A 3EQLC 1CA5A 4H0LC 4CKBA 1SYGA 3KF8A 3BZKA 3KLWA 1M4VA 1C48A 3I4NG 2KJXA 3KLSX 4HCEA 3H94A 1LTAD 2KEEA 1W2BA 3AYHB 2D62A 4IQZA 5C4XH 2GVAA 4A3IH 4C2MB 2FFKB 4DNRB 1DD2A 2PPBC 2IX1A 5D65A 3BG3A 3CD6A 1SSOA 1TY2A 4IOAA 1G6ZA 5ELEA 3EROA 4B3RL 3ICEA 1XJVA 1F2MA 1YIJA 4ZQ3A 1B3QA 2AHOB 3EA6A 3DEOA 2K6AA 1D1IA 5EPKA 4BBRB 1TWGB 2IW3A 5C0XH 1D8LA 4A3FH 1V1PA 1F2YA 3BDOA 4CBVA 2WIIB 4J8QA 5K5PA 1HH2P 2VW9A 3FKIH 1PTOB 1XNQL 5C4ZA 1EY0A 1TY0A 4BBSB 1STAA 1VQKA 3ND9A 4JVZA 3AFQA 1HR0W 1PVOA 1ZKOA 3W3AA 4A3DB 1CI3M 3G71A 2NVTB 4DAMA 2EYOA 3PUVA 3QOLA 4ID6A 3F2BA 3S1MH 4JI4L 5COYA 2F0EA 5EGTA 3OMGA 2NN6G 5KGUA 1WTVA 1NJIC 3M4OH 1YITA 2WAQE 2F0WA 2Q2TA 3BZDB 3S2DB 3KLRA 1SE8A 2KHJA 2MO1A 1UUPA 1QVFA 4LF6L 4JBKA 1LTID 2QKIC 2ICEC 1JWSD 4E6IA 3K58A 3P1HA 1TS2A 1XWEA 2MHVA 1CM9A 4LFBL 1STNA 3S1RB 1D5XC 1KNEA 4GLVB 1Y14B 3VYRA 1R9TH 1V1OA 1E2VA 1FNVA 2DJFC 1H9JA 4JI4Q 1S5BD 5FLMH 3VR3A 1A62A 1UE7A 3HG9A 3MTSA 5T1IA 1MIUA 4BA1I 4FVMA 5ELDA 5FOBB 3A8JE 3CKIB 4P2CB 4DR7L 3J80c 5GAEC 4MTKA 1TWFH 5F2DA 1ICWA 4X65L 3ND8A 2G5DA 4S3SA 4LFBQ 4X64L 1C0AA 1I4RA 1PH3A 4OIJA 2WAQB 3HOYH 2JA5B 5I4DA 3NE5B 1PRTF 3ERQA 4GNXB 4JBJA 1GXDC 3SVMA 1EWHA 4O0AA 4A3CH 2NUCA 3S24A 1KIXA 3E3XA 1NSNS 1YJ9A 4X66L 5AFWA 1C7YA 1KLUD 1U9RA 2B2WA 1X3GA 4DR7Q 3RZOH 2PYKA 2A1AA 1CZWA 1EOVA 3NUCA 4GZYC 1PXUA 1F77A 1BDOA 4WJ4A 4B3TL 1MSGA 1HNXL 1ML0D 3Q22A 2RHSB 4A3IB 4TSSA 2LMCB 3IFTA 2UU9Q 1KAAA 3ERSX 4OHJA 2K04A 5CBAE 4C3JH 2B3GA 5CV9A 5DM63 3RZDH 1VQEA 4LF4Q 3D6CA 4YCUA 1V43A 3OHXC 2MGSA 5ELBA 3J80i 2K5VA 4HJAA 3PUYA 1WVLA 1YNXA 2F0IA 2WB1E 2NVXH 3F2UA 4A3FB 3OOCA 4IUVA 1V9PA 1MD2D 1HNXQ 4FNFA 1P16A 1CKNB 3S14H 4LW1A 3W1GA 2OTJA 5BR8L 3FKIB 3DWPA 2EY5A 3SK5A 3I72A 3PIO3 2K7VA 4BBRG 2E8GA 1EWCA 1D5ZC 1HUMA 1MSHA 1HXYD 1CQVA 5C3XA 1JJCB 2ICIA 4CKEA 1X55A 3S1MB 3EJIA 1XPOA 3GDEA 5ISRA 1GUWA 1B7YB 5FJ8H 1FGUA 1BCPC 2WACA 4U673 4K6DA 3M4OB 4BBSG 1J8IA 4DV2L 4JV5L 4JI5L 5IP7G 2UUBQ 1QNKA 5J3BA 2BH8A 1RDPD 2F1MA 2QGQA 1IYJB 1QUQB 4A3DG 3SR1A 1N36Q 2ZXPA 4JPBW 2WB1B 2IX3A 2X69A 3CCUA 3I3CA 4P75A 5IY0A 3GTOH 1STYA 1DOKA 1R9TB 5E4XA 5E7NA 1BQQT 3SK6A 4QL5A 1BCPD 1HA5A 1O7YA 1J5EQ 1AE2A 4P74A 4DV2Q 4JV5Q 4JI5Q 1M90C 1L1OB 5KYLA 3QR8A 1R4QB 1UE5A 1TWFB 2VQFL 1JOOA 2JEAI 4N9PA 1HCZA 4ZKBB 2Y0SE 4RH6A 2AUKA 2QF7A 1SYBA 1MJEA 2JXMB 3ZYYX 2A19A 2BOSA 4ZCKA 4L5TA 1IBLL 4IUUA 4ZUJA 3HOYB 2I46A 4A4IA 3A7LA 4ALPA 3R93A 1GVPA 1EFID 5C3WA 4XQJA 3U4ZA 3HFZB 3KOJA 3Q6SA 3Q23A 4GLXA 3IAYA 2AQ2B 2VS1A 3M9BA 3S2HH 4RCOA 3RZOB 2UXDL 4YIJA 1F9QA 1RD9D 1VQ5A 4CHTB 4B3ML 1SNPA 1EY5A 2WAQG 2JA5G 1E2ZA 1EQRA 3HKZE 4GKJL 3GV3A 2PNHA 1QWYA 2ID0A 1OXSC 5M5YH 2ZXRA 1GUNA 1N8RC 5DEHA 3DEPA 4KKUA 1EY7A 2PQAA 4LK1C 3T16A 4C3JB 4XIGS 3RZDB 3FPPA 1ICFB 1OXTA 2OT2A 3I73A 5LMNL 2R92H 2RDFA 1IZ6A 5E3FA 2CWAA 5C4XG 2ZJPA 2MPMA 2Y0SB 2N78A 2ZXOA 4A3IG 3DM3A 4GN3B 2CH4A 3TP6A 2PW7A 1X54A 5M3MH 2NVXB 3TZUA 3H6MA 4KK7A 1A2UA 2HIVA 1K0SA 3EFXD 1GHJA 4JI6L 4GKJQ 4LFAL 3I7FA 1B2TA 1EEFD 1Q86C 3S14B 3HOWH 4LFCL 1YVCA 3N6RA 1Q90A 1SJHD 1YJWA 3TN2A 2PW5A 2BE5C 3K5MA 2KEDA 1V1QA 5C0XG 4A3FG 3CCRA 1JCKB 1YJNA 1N33Q 4A75A 2O5IC 2F0UA 5IGDA 3GTJH 2EY1A 3OYYA 1JJ2A 3HOZH 3FKIG 3Q24A 3CXCA 1TWAH 3I4MH 1QILA 5I9OA 2E74C 5E1FA 4WORA 1G6PA 1VF5C 2NTSA 4KY5A 4FDBA 3JAML 4OXPA 4RG1A 1SAPA 5CV5A 1SRUA 5C0XJ 2BE5D 4MIUA 1ET9A 4NP5A 2BA0A 2QCPX 2O2LD 1VQPA 4JYAQ 4R9WA 2VY3A 4EQOA 1Q8IA 3HRZC 4I7ZC 2Q2UA 3BVGA 1I3QH 1AH9A 3GTOB 4HIOA 2EDGA 1CKNA 4RKBA 3TS0A 1I94L 3CP0A 1DONA 1EUJA 1A8VA 4BY7H 2ATWA 3AU7A 1TS3A 2O5JC 2RHQB 1Q12A 3G48A 5EBCA 1KC8C 5KRUA 4B3SL 4LF9L 1NTGA 3E6ZX 2DUDA 1A3TA 2WB1G 3A5ZB 4MN3A 1KABA 3QO2A 3WWVA 2PZUA 2HD3A 3G4SA 4A3EH 4FO2A 2Q8IB 5FLMG 1ENFA 3OIPA 3OPOA 2J7ZA 3ULJA 2IHEA 4DNTB 5AJ3L 2KHSA 1VQIA 1IKMA 1I94Q 4KV6A 1ASZA 2DJGC 3S16H 5EPLA 1QUQA 1GOZA 2XWBB 2KCCA 1LTBD 3HP3A 2EYJA 2ZTCA 3UE1A 4B3SQ 3S2HB 4DPGA 1CHPD 2NBFA 1QJOA 3BVMA 4EQPA 1A3UA 1OO9B 2JK8A 4JBWA 4DR5L 2QILA 4HJ5A 4JI2Q 4YY3Q 3HOYG 4LF5L 1BVSA 1ESFA 1GJXA 1VQGA 4A3CG 5K36H 1I50H 2XRQD 4XYQA 5AJ3Q 4DR3L 4RHSA 5M5YB 1U0LA 1L1OA 1MI2A 1C4QA 1VMCA 1HHVA 1EWIA 1JOKA 1OXXK 2VB3X 4EQ5A 4FP5D 2R92B 2I5MX 3QG1A 3PO2H 4KTAA 1HR0L 2B2YC 3KBXA 3SXHA 1PH8A 1ZXTA 1U4LA 2RDGA 3I8ZA 3PCOB 4LAAA 5M3MB 4DR5Q 2DY7A 3VA7A 3EBEA 1WOCA 1DXMA 4C3JG 2UUCL 3DMUA 3MEHA 4KHPL 3HOWB 4R4QA 3HGBA 2JA8H 2L15A 1VQCA 3TRZA 4OEMB 4RFBA 4XYOA 3CCQA 1JORA 1JT8A 1U4RA 4DUZQ 2Y0SG 2Z8LA 2OQ0A 2EXZA 4HJ8A 5G3LF 4DK3C 3C1EA 1TVXA 2SOBA 1MGSA 1NE3A 3E5SA 4O42A 1PYWD 3KF6B 1YHQA 4PMWA 1HR0Q 2SEBD 4NXNQ 1M1KC 1X3QA 2JP1A 5FLXc 3GQBA 2XNAC 2VNUD 4DV5L 3GTJB 2B8GA 2JN4A 3HOZB 1TWAB 3I4MB 3VA5A 1PRTC 2B8FA 3HOXH 1XTDA 3FP9A 4PMBA 4XTCS 1SMXA 3I90A 3UDGA 2AMCB 5I2XA 3TDQA 3I4LA 4IN3A 1PMRA 2AWOA 2H5XA 4IUTA 5E4WC 4Q5VA 4GN5A 3MVVA 5FKAC 1EU4A 5CV7A 2CVRA 3AEVA 1HA6A 3HKZG 1ZEQX 3UDFA 4XQQA 2UXBL 1I3QB 4HSVA 5FJ8G 1AW7A 4KKSA 1LTGD 5DM73 4GOPB 2LXJA 5HURA 3X3NA 4AYBE 2R93H 4BY7B 1PTOF 1BF4A 4P72A 3PV0A 1PRTD 4LNQA 1GKHA 3MXUA 1QNUA 1VQFA 3VDYA 3CRLC 4FF3A 2E2HH 3NENA 5KEEA 3X3MA 1K3RA 3QIAA 3OWEB 4M1UB 4K5XA 4L8JA 1HQMC 1LM0A 2ASBA 4A3EB 2JQOA 2K52A 1W6JA 2UXBQ 1Y1VG 2EY2A 3I2ZA 4DR6Q 2R6GA 2DN8A 4JOIC 4UAIA 3I56A 5HGTA 3A74A 3S16B 1O7IA 4A3BH 3P20A 1EYAA 1JB3A 2ZT9C 2WKCA 4IPCA 1WI5A 1AZQA 3AFPA 2K14A 2RQXA 4FYDA 2MP1A 4HSPA 1S5FD 1F9RA 3GP7A 3MXPA 4NPSA 2FMMA 4L5QA 3MFGA 1ENAA 5IT9E 3W5OA 2UXCQ 4AYBB 3ER0A 2F4VL 3RUZA 1VQ6A 2PI2E 2N88A 3R2TA 4G7ZC 4NMZA 2JA9A 4DN4M 3QJYA 3BYTB 3T1HQ 4QUFA 3OSOA 3PO2B 1JE4A 2MUYA 2K5QA 2Q2IA 2IY5B 5LL6X 2F4IA 1LTLA 2F0JA 2DY8A 4FF1A 2VUMH 1VMPA 5A35A 1UE1A 3EIVA 4RA8A 4A3GH 3NTKA 4WJWA 5ELCA 2F4VQ 2JJQA 1CA6A 1GO3E 2RSOA 1YNNC 3V05A 2I0QA 3STBD 2F03A 4JW0A 3DXJC 3L3OC 4JG2A 1I6HH 2R92G 1K8OA 1Q46A 1TU2B 2JA8B 2B63H 1XXGA 1Q8KA 2HQEA 4O1NA 3HOUH 3PGZA 3S1NH 2F0TA 4KY7A 1RL2A 2ES2A 2EZVA 1FNWA 5M3MG 3BS1A 2CQAA 2B2TA 4ZK9B 1WTHA 4BY1H 4BS9A 3NP8A 3HOWG 1TQOA 4L6TB 1X65A 1EY8A 3J81L 4UY8C 3HOXB 1YNND 3T1YQ 3TBIB 2E2DC 4K6LA 2NYZD 2ALYB 3RLFA 1SROA 4J6HA 1VQ8A 4WFN3 1WCMH 3A5UA 2J4XA 4GS3A 2WINB 4HR7B 4A3KH 1STBA 1Y8OB 4H02A 2AUJD 4JI8L 1F2ZA 1QZGA 1IXRA 1Q1EA 4FXGC 3HOZG 4L5SA 4IJHA 3I4MG 4MZ9A 3K57A 3PF5A 1PH2A 4K0KL 1X56A 3PIOA 2R93B 1YHAA 1LUZA 3M7NA 1JICA 1JE5A 4RWSC 3PSIA 2YU9H 4JI1Q 4PQXA 1NBWA 2MJ8A 3MAQA 1VQJA 3CRKC 1PV4A 2V1CC 2E2HB 1H9MA 4LMQD 3KF6A 2B2VA 5L37A 4RKLA 3VR6A 1T5EA 5J39A 4EQNA 3J7A5 1SNCA 1L2FA 2ZJQA 4RCNA 2EYFA 1CZGA 2B39A 4JI8Q 4BY7G 3DUZA 2JA7H 1E1OA 1NAPA 3CU7A 2KQ3A 3H15A 1QVGA 3K80C 5IGCA 3KDFA 4K0KQ 2YV5A 3CC7A 5CV4A 4DV6Q 1SYCA 4R8NA 1IL8A 4A3BB 5A2QE 2KCTA 3S9WA 4JK1C 1PFBA 2R3ZA 3GD7A 1VQAA 1Q81C 1QZHA 2BDNA 1RTNA 3SK8A 4A3EG 2UU9L 1CKOA 3C3LA 1PDQA 4IJLA 5HGQA 1HPCA 4XDXA 3J81c 3TREA 2AWNA 4GOPA 4A93H 2FXQA 3SEBA 5C5LA 4LF4L 1WFQA 1LTRD 4PNYA 5EKLA 3K5OA 4YCWA 4J15A 1ET6A 3M4QA 4XQNA 3ULPA 4X3KA 4AQYQ 1S5CD 2E76C 1VDZA 2R61A 3MWYW 2EYMA 5IYBH 5C4XB 4DAPA 2PMZE 4RMFA 3G7LA 4TKOB 4AYBG 3WOEA 1B1ZA 4Z9CB 1CFMA 5K36G 3A8KE 3DWQA 2MFIA 4A3GB 4UDUC 4KN7C 1G51A 2E75C 3RLOA 4ZAIA 2DNCA 2F0VA 2SDFA 4IUPA 1QE6A 1I6HB 2KCMA 3LWUA 4MHEA 3PO2G 2B63B 1LT6D 3S15H 1ILPA 3HOUB 4IFDI 2RBMA 3QB3A 3S1NB 1QOHA 1IW7C 2CWPA 4CJ1B 2OEOA 4OO1I 2KBNA 1HRJA 1MJCA 1K8MA 2N3SA 2UUBL 1T9HA 1IYVA 1ILQA 1PYSB 5KIXA 1X3PA 4BY1B 2FMCA 1EZ8A 4LJZC 1WTRA 1KRSA 1N36L 1B70B 4DU9A 2JA8G 1OXUA 1EIHA 1HFNA 4EVOA 1KDAA 1KXLA 2Q2HA 4FF4A 1EIYB 3NHHA 1EYDA 3DM1A 1WCMB 3KLSA 2B2WC 2GVBA 1EY6A 1PH5A 1SE2A 2PMZB 4A3KB 1IW7D 1J5EL 1P8LA 1VQ4A 4DXGA 4HEDA 1H9KA 4V0BA 3MC0B 3M85A 3I70A 2F0PA 1CHQD 2HT1A 3HOXG 3IKJA 3H0GH 1RTOA 2ZJRA 1K83H 3A0JA 3W1BA 4RGNA 2YU9B 1BBXC 3EN2A 4IPDA 3S17H 5JEAJ 1CUKA 3MXGA 1TWHH 2WKDA 4YWMA 4JI0Q 5FK9C 2ZM6Q 2XVSA 4K8IA 3HEJA 2XN9C 1Y1VH 4ZRZA 2R93G 1NCVA 2PI2A 2JA7B 5GROA 2EVBA 5I6WA 5KNBA 1AEXA 1TKWB 2LFNA 5JAVA 5M5WH 4DV4Q 4DGZA 3BJUA 3RN2A 4YWLA 1EL0A 2O4XA 3OMCA 3CCVA 2IPKD 1T5XD 3GTMH 1EQTA 4P73A 1B44D 3NWTA 3TP8A 4DV7Q 2F0QA 5EBDA 1N32Q 4K5WA 1B8AA 1Y1WH 4QIWE 1I4GA 1SFOH 2QEXA 5JOBA
chains in the Genus database with same CATH topology
1PZJD 4NW2A 4DFAA 1A3VA 4A93B 1FD7D 3A55A 1WTOA 3EVQA 5EPJA 1Z7TA 1GUGA 2EOTA 3M7GA 5IGGA 4J1MA 1NR4A 4B9XA 5G3LD 1R4PB 3QOJA 1STGA 2H4OA 3SE0A 1FGBD 4DA2A 3J80E 1PTOC 2F0FA 3H09A 5FO7B 2RDHA 4IFDH 3NTHA 4ODGA 2HDLA 1X32A 1B53A 4OO1H 3S15B 3CHBD 1DYQA 1JOQA 4ZKCB 5IT9L 2BDOA 5C4HA 4F88A 1PTOD 3H3VC 4V190 4DK0A 1EIGA 1M8AA 3HKZB 3PUXA 3SDZA 1EYCA 3GV6A 2IL8A 1QCBD 4NDXA 4CJ2C 1E0BA 1G291 1B3AA 4H13C 2TMPA 3D3RA 3H0GB 1STHA 3SK4A 1K83B 1NR2A 1OXVA 2HCIA 3FRPB 1STEA 1I4PA 2A5HA 3S17B 4HMJA 3R3OA 1PZID 1TWHB 1F2LA 1UNSA 1GUOA 1XX8A 1Y1VB 2RVLA 1FNUA 3N52A 5M5WB 1YNJC 2TSSA 1JWMD 2M2LA 3FDTA 1HTPA 3GTMB 2JSOA 4X3SA 1Y1WB 1SFOB 2NZ1D 1SXTA 4IZ8A 2EYLA 4KN4C 4KHZA 4X3TA 3AB9A 5CBEE 1YNJD 1JWUD 1Y8NB 2Q8TA 1LLRD 3R8BA 3V96A 3G6JB 3WDNA 1RJTA 1LO5D 3VYTA 1PZKD 5CC4A 2Z4IA 2L4NA 4F87A 2R7ZB 2PQEA 5C4JB 1LV9A 2FINB 4HMIA 2A68C 5A2QL 4HAEA 4ILWA 1BO0A 3K0YA 1CTMA 2EYHA 2F3VA 4IUQA 1LT5D 3FVQA 2IX0A 2G9HD 1CK1A 2F0OA 3ITPA 4EGVA 1HFGA 2SNSA 2A68D 5JEAH 4K14A 3HZXA 1C8CA 1NUCA 2D9UA 2I07B 5D3DA 1QG7A 1U4PA 4RAUC 3LX0A 3MZ5A 3A8IE 2EE1A 1BUVT 4K8JA 3TP5A 5CYUA 5M3FB 1ENCA 5IOCA 2KVMA 1O7LA 1LABA 3OIQA 4A3MB 2Q8RE 4X3UA 3KBGA 1RF2D 4QF4A 5J22A 2EJGC 2ENBA 4A3JB 2EYPA 4G4KA 3A56A 3D4RA 3L9AX 2L1BA 2K01A 3A54A 4WRDA 2WP8J 3VR2A 2SNMA 2F0KA 1LTSD 1Z47A 2AQ1B 1I6VC 3I91A 1PLFA 5JPNC 5IGBA 1BCPB 2IJ0A 1A15A 4G7OC 5IIFA 2G9DA 5EKKA 3OWFA 3T4AC 2QEJC 4TQUS 4TRDA 1G8ZD 4ZYSA 1I50B 4KKTA 2HCCA 2NTTA 3FMCA 1O7ZA 2KCNA 3IFDA 3FPUB 2JE6I 1SNOA 1BXTA 2LKVA 1EZ6A 3URYA 1E2WA 3PUZA 3D6WA 4ZLTF 4FXKC 3T56B 3K59A 2L9HA 4CGYB 2L5TA 4H7BA 1SMYD 2JYOA 3H91A 1D1KA 1G2TA 2LY7A 4XT3B 3GTLB 4IUNA 1GUSA 4IFDG 2L55A 5CV8A 1H9RA 3K7AB 3KK7A 4OO1G 2K28A 3JAME 1SNMA 3W2DA 3FEWX 1AZPA 2A6EC 3E0JA 3L7ZC 2NVYB 5EKIA 1G91A 2PZTA 5FO8B 2PO4A 4IFDJ 3UI2A 3J80L 5LL6S 4ULLA 2F0LA 1PFMA 5CMDA 4C1NI 3VYUA 4H44C 4PMCA 4B9WA 3BVZA 3NXWA 3M3YB 2JEBI 4BA2I 1SYFA 5CGKA 5I6YA 1A6XA 3TZDA 5M9OA 2A6ED 3GTPB 3NTIA 1EY9A 1UEAB 3PIP3 1SDFA 1I4QA 5EJWA 2KOLA 1EOTA 2OXPA 2NWGA 1EU3A 1U4MA 4K2KA 4XXEA 5FLXE 1VF7A 1HQRD 3NQTA 4C3HB 1JR0D 1L0XB 2AQ3B 4L63B 4ME5A 1FYCA 3U9OA 4DAVA 1Z6HA 3AMUA 3PMFA 3K5LA 2D2CC 2B2TC 1EY4A 4QMGA 1SYDA 2E2IB 5M5XB 3PUWA 2F0GA 5C44B 1SJED 1Y69U 1TS5A 2FJ2A 4F7XA 1SNQA 2M9VA 2X6LA 3T13A 4RGMA 2K32A 1RODA 1ZYRC 3C1FA 5ELFA 3T51B 3D4DA 2K5DA 3TSSA 1LACA 1KDBA 1TS4A 3Q0AA 3M4YA 2VUMB 1ZYRD 2B2VC 2H1EA 4IALA 5I9PA 1BNZA 4G57A 1VCIA 1ONLA 5BN4A 1B4OA 2WV6D 4FXDA 5IODA 3NBHA 3NBIA 2D5DA 4I65A 4KHVA 3NSWA 5D14A 4N9TA 1LTTD 4XT1B 3K5NA 1BR9A 1S5DD 3LWEA 4DK1A 5C6AA 5CV6A 1TT2A 1B9MA 1MBYA 2EY6A 3IL8A 2CHBD 4HCSA 3J7YW 5JEAG 3TP7A 2KECA 2NVQB 3HS0C 3ONAB 2L11A 1IYUA 2K1BA 2A69C 1SE3A 2F0SA 3K6OA 2OF1A 2BCOA 2A73B 1W6KA 2NN6I 1WTPA 4DXFA 2RSNA 4KMUC 3VYSA 1I4XA 4DAYA 1AP0A 2J0TD 2YYZA 2A69D 3MXNA 1DOMA 3GO5A 3MHBA 1D5MC 2EPBA 1IKLA 1WD0A 1ESRA 1PRTB 1B50A 4RHRA 2K03A 3O13A 4C3HG 2Z4HA 2XRSD 5KNDA 3PO3B 2F0HA 2M00A 3J7AV 2C9OA 4Y7NB 3RD4A 3HOVB 2NB0A 1TWCB 1V8QA 1J9OA 1D6EC 2L12A 2EJFC 3BDCA 1D2BA 5C5MA 3D4WA 3U9SA 1WTXA 4HTHA 2GA4B 1HUNA 5JPMC 1DCZA 1EQVA 2HUGA 4Q0FA 2E2JB 1S4ZA 1CT1D 4M8AA 2KA7A 4ABNA 1L0YB 1XYIA 1G2SA 4QIWB 1KDCA 3J81E 1DZ1A 2QDBA 3NQIA 3WOFA 3SHLA 3NPPA 3MFYA 1B9NA 4K5VA 3A7AB 2JA6B 5FO9B 2IT1A 1GHKA 2B2UA 3RMHA 5LHY1 1RCVD 4CKCA 3S1QB 3GTQB 1O78A 4FF2A 1LT3D 2EJMA 2KUMA 1WD1A 4B08A 3VR5A 2NN6H 2Z1CA 2K5WA 2PNRC 1EEID 4QCLA 4RGTA 4C3IB 1H9SB 1F9SA 2L0CA 2RKSA 5C3EB 3P7JA 3NWSA 5BN3A 1PFNA 1JQYD 2RA4A 2V4DA 4KJOA 3P75A 1DJRD 2F0DA 5I2YA 5T1GA 2N55A 3GTKB 3QWNA 2DNEA 3OW7A 1F9PA 3V2TA 2F0NA 3GTGB 4QUCA 2B2YA 3LNNA 2B2UC 1XTCD 2HDMA 4BWGB 4U68A 5IGEA 3VR4A 1SE4A 4C1NK 1GUTA 1QB5D 5EQ0A 3BDLA 2CW0C 5FLXL 1II3A 5DNFA 1A2TA 2LS01 3I4NB 1I4HA 1HTLD 1V1PB 1TR5A 1BCPF 3CQZB 4IURA 1DOLA 5JVG3 2XSCA 1KNAA 2VXWA 5JVH3 4DF7A 4RGOS 1S5ED 4KY6A 2CW0D 5TSSA 1SYEA 1AN8A 2K05A 3DHQA 1SEBD 1FR3A 2XIWA 2A74C 3MA2B 5D3IB 1Y8PB 2PCFB 3D8GA 3T53B 1IHZA 5KYIA 5KNCA 3TMEA 2F3WA 1Q1BA 3KUPA 1SNDA 4PV1C 1UAPA 1LT4D 5C0XI 4KD4A 5NUCA 1WTQA 1SBBB 1PTOH 2BA1A 2VB2X 1RHPA 5J1ZA 1DM0B 2F0MA 2A6HC 3C2PA 1AFPA 3C46A 5IGFA 3DWAA 4ZUIA 4R8IA 4C56C 5CORA 1TIID 2FHTA 4F8MA 1JC7A 2X6GA 4OGQC 4C3IG 1KTKA 2A6HD 1KLGD 4HN7A 5BN5A 4CJ0B 1O80A 2IWHA 2C5CA 3D31A 1BOSA 3J7AF 4G7HC 3NK9A 4K2LA 5DAUA 4OL7A 1H9SA 4OIKA 1SMYC 3R2IA 1CQFA 4KJNA 2XWJB 1WTWA 1Q3LA 2PZWA 3BYYB 2K33A 4KD3A 4QB4A 5CR3A 1RKNA 4NKLA 4KI0A 5JJZA 1CA5A 3EQLC 4H0LC 4CKBA 1SYGA 3KF8A 1M4VA 1C48A 2KJXA 3KLSX 4HCEA 3H94A 1LTAD 2KEEA 2D62A 4IQZA 4C2MB 2FFKB 4DNRB 1DD2A 2PPBC 2IX1A 5D65A 3BG3A 1SSOA 1TY2A 1G6ZA 5ELEA 3EROA 1F2MA 4ZQ3A 3EA6A 3DEOA 2K6AA 1D1IA 5EPKA 4BBRB 1TWGB 2IW3A 5C0XH 1V1PA 1F2YA 3BDOA 4CBVA 2WIIB 4J8QA 5K5PA 1PTOB 5C4ZA 1EY0A 1TY0A 4BBSB 1STAA 3ND9A 1ZKOA 3W3AA 4A3DB 1CI3M 2NVTB 2EYOA 3PUVA 3QOLA 4ID6A 5COYA 2F0EA 5EGTA 3OMGA 2NN6G 5KGUA 1WTVA 2F0WA 3BZDB 3S2DB 3KLRA 1UUPA 1LTID 2QKIC 2ICEC 1JWSD 4E6IA 3K58A 3P1HA 1TS2A 1XWEA 2MHVA 1CM9A 1STNA 3S1RB 1D5XC 1KNEA 3VYRA 1V1OA 1E2VA 1FNVA 1H9JA 1S5BD 3VR3A 3HG9A 3MTSA 5T1IA 4BA1I 4FVMA 5ELDA 5FOBB 3A8JE 3CKIB 4P2CB 5F2DA 1ICWA 3ND8A 4S3SA 1I4RA 4OIJA 2WAQB 2JA5B 5I4DA 3NE5B 1PRTF 3ERQA 3SVMA 1GXDC 1EWHA 2NUCA 1NSNS 5AFWA 1KLUD 1U9RA 2B2WA 2PYKA 1CZWA 3NUCA 4GZYC 1PXUA 1F77A 1BDOA 1MSGA 1ML0D 3Q22A 4A3IB 4TSSA 2LMCB 3IFTA 1KAAA 4OHJA 2K04A 5CBAE 5CV9A 5DM63 3D6CA 1V43A 3OHXC 2MGSA 5ELBA 3PUYA 1WVLA 2F0IA 3F2UA 4A3FB 3OOCA 4IUVA 1MD2D 4FNFA 3FKIB 3DWPA 2EY5A 3SK5A 3I72A 3PIO3 2K7VA 1EWCA 1D5ZC 1HUMA 1MSHA 1HXYD 1CQVA 5C3XA 2ICIA 4CKEA 3S1MB 3EJIA 5ISRA 1GUWA 2WACA 1BCPC 4U673 4K6DA 3M4OB 1J8IA 1QNKA 1RDPD 2F1MA 3SR1A 2ZXPA 2WB1B 2IX3A 2X69A 3I3CA 1STYA 1DOKA 1R9TB 5E4XA 1BQQT 3SK6A 1BCPD 1HA5A 1O7YA 5KYLA 1R4QB 1TWFB 2JEAI 1JOOA 4N9PA 1HCZA 4ZKBB 4RH6A 2AUKA 2QF7A 1SYBA 2JXMB 3ZYYX 2BOSA 4IUUA 4ZUJA 3HOYB 2I46A 3A7LA 3R93A 1EFID 5C3WA 4XQJA 3Q6SA 3Q23A 3IAYA 2AQ2B 4RCOA 3RZOB 4YIJA 1F9QA 1RD9D 4CHTB 1SNPA 1EY5A 1E2ZA 3GV3A 1QWYA 2ID0A 1OXSC 2ZXRA 1GUNA 5DEHA 3DEPA 4KKUA 1EY7A 4LK1C 3T16A 4C3JB 4XIGS 3RZDB 3FPPA 1OXTA 2OT2A 3I73A 2RDFA 5E3FA 2MPMA 2Y0SB 2ZXOA 3TP6A 2PW7A 2NVXB 3TZUA 3H6MA 4KK7A 1A2UA 3EFXD 1GHJA 1B2TA 1EEFD 3S14B 3N6RA 1Q90A 1SJHD 3TN2A 2PW5A 2BE5C 3K5MA 2KEDA 5C0XG 1JCKB 2O5IC 2F0UA 5IGDA 2EY1A 3Q24A 1QILA 5I9OA 2E74C 5E1FA 4WORA 1VF5C 2NTSA 4KY5A 3JAML 1SAPA 5CV5A 5C0XJ 2BE5D 4MIUA 1ET9A 4NP5A 2BA0A 2QCPX 2O2LD 4R9WA 4EQOA 1Q8IA 3HRZC 4I7ZC 3BVGA 3GTOB 2EDGA 4RKBA 1DONA 3AU7A 1TS3A 2O5JC 1Q12A 5EBCA 5KRUA 3E6ZX 1A3TA 4MN3A 1KABA 3QO2A 2PZUA 4FO2A 2Q8IB 1ENFA 3OIPA 3OPOA 2J7ZA 4DNTB 2KHSA 1IKMA 4KV6A 5EPLA 1GOZA 2XWBB 2KCCA 1LTBD 3HP3A 2EYJA 3S2HB 1CHPD 2NBFA 1QJOA 3BVMA 4EQPA 1A3UA 1OO9B 4JBWA 2QILA 1ESFA 1GJXA 5K36H 2XRQD 4XYQA 4RHSA 5M5YB 1MI2A 1C4QA 1VMCA 1HHVA 1JOKA 1OXXK 2VB3X 4FP5D 2R92B 3QG1A 4KTAA 2B2YC 3KBXA 3SXHA 1ZXTA 1U4LA 2RDGA 3I8ZA 4LAAA 5M3MB 2DY7A 3VA7A 1DXMA 4C3JG 3DMUA 3MEHA 3HOWB 3HGBA 4RFBA 4XYOA 1JORA 1U4RA 2Z8LA 2EXZA 5G3LF 3C1EA 1TVXA 2SOBA 1MGSA 3E5SA 4O42A 1PYWD 4PMWA 2SEBD 1X3QA 2JP1A 3GQBA 2XNAC 2VNUD 3GTJB 2B8GA 3HOZB 1TWAB 3I4MB 3VA5A 1PRTC 2B8FA 4PMBA 4XTCS 3I90A 5I2XA 3TDQA 3I4LA 4IN3A 1PMRA 2AWOA 4IUTA 5E4WC 4Q5VA 3MVVA 5FKAC 1EU4A 5CV7A 2CVRA 1HA6A 1ZEQX 4XQQA 1I3QB 4HSVA 1AW7A 4KKSA 1LTGD 5DM73 5HURA 3X3NA 4BY7B 1PTOF 1BF4A 3PV0A 1PRTD 3MXUA 1QNUA 3CRLC 4FF3A 5KEEA 3X3MA 3QIAA 3OWEB 4M1UB 4K5XA 4L8JA 1HQMC 4A3EB 1W6JA 2EY2A 2R6GA 2DN8A 4UAIA 5HGTA 3S16B 3P20A 1EYAA 1JB3A 2ZT9C 2WKCA 1AZQA 2RQXA 4FYDA 2MP1A 4HSPA 1S5FD 1F9RA 3GP7A 3MXPA 2FMMA 3MFGA 1ENAA 5IT9E 4AYBB 3RUZA 2N88A 3R2TA 4G7ZC 4NMZA 4DN4M 3QJYA 3BYTB 4QUFA 3OSOA 3PO2B 1JE4A 2MUYA 2K5QA 5LL6X 2F4IA 2F0JA 2DY8A 4FF1A 1VMPA 5A35A 4RA8A 3NTKA 4WJWA 5ELCA 1CA6A 2RSOA 3V05A 1YNNC 2F03A 3DXJC 3L3OC 1K8OA 1TU2B 2JA8B 1XXGA 4O1NA 2HQEA 2F0TA 4KY7A 2EZVA 1FNWA 3BS1A 2CQAA 2B2TA 4ZK9B 4BS9A 3NP8A 1TQOA 4L6TB 3J81L 1EY8A 3HOXB 1YNND 3TBIB 2E2DC 4K6LA 2NYZD 3RLFA 4J6HA 4WFN3 2J4XA 4HR7B 2WINB 1STBA 1Y8OB 2AUJD 1F2ZA 1Q1EA 4FXGC 3K57A 2R93B 3M7NA 1JICA 4RWSC 4PQXA 2MJ8A 3MAQA 3CRKC 2E2HB 1H9MA 4LMQD 2B2VA 4RKLA 3VR6A 1T5EA 5J39A 4EQNA 1SNCA 4RCNA 2EYFA 1CZGA 2B39A 3DUZA 1NAPA 3CU7A 2KQ3A 5IGCA 5CV4A 1SYCA 4R8NA 1IL8A 4A3BB 5A2QE 3S9WA 4JK1C 1PFBA 2R3ZA 3GD7A 2BDNA 1RTNA 3SK8A 3C3LA 1PDQA 1HPCA 4XDXA 2AWNA 3SEBA 5C5LA 1LTRD 4PNYA 5EKLA 3K5OA 1ET6A 4XQNA 4X3KA 1S5CD 2E76C 1VDZA 2R61A 3MWYW 2EYMA 5C4XB 4DAPA 3G7LA 4TKOB 3WOEA 1B1ZA 4Z9CB 1CFMA 5K36G 3A8KE 3DWQA 4A3GB 4UDUC 4KN7C 2E75C 4ZAIA 2DNCA 2F0VA 2SDFA 4IUPA 1QE6A 1I6HB 3LWUA 4MHEA 2B63B 1LT6D 1ILPA 3HOUB 4IFDI 2RBMA 3QB3A 3S1NB 1QOHA 1IW7C 4CJ1B 2OEOA 4OO1I 1HRJA 1K8MA 1IYVA 1ILQA 4BY1B 5KIXA 1X3PA 2FMCA 1EZ8A 4LJZC 1WTRA 4DU9A 1OXUA 1EIHA 1HFNA 4EVOA 1KDAA 4FF4A 3NHHA 1EYDA 3DM1A 1WCMB 3KLSA 2B2WC 1EY6A 1SE2A 2PMZB 4A3KB 1IW7D 4DXGA 4HEDA 1H9KA 4V0BA 3MC0B 3M85A 3I70A 2F0PA 1CHQD 3IKJA 1RTOA 4RGNA 2YU9B 1BBXC 5JEAJ 3MXGA 2WKDA 5FK9C 2XVSA 4K8IA 3HEJA 2XN9C 4ZRZA 1NCVA 2JA7B 2EVBA 5I6WA 5KNBA 1AEXA 1TKWB 2LFNA 5JAVA 4DGZA 1EL0A 2O4XA 3OMCA 2IPKD 1T5XD 1EQTA 1B44D 3NWTA 3TP8A 2F0QA 5EBDA 4K5WA 1I4GA 5JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK9 A;  4K2L A;  5DEH A;  4KV6 A;  1A3V A;  4DFA A;  1EY7 A;  5DAU A;  1SYE A;  3T16 A;  4OL7 A;  1TQO A;  1EY8 A;  2EY5 A;  3SK5 A;  3C1F A;  3LX0 A;  3MZ5 A;  4E6I A;  4H7B A;  3P1H A;  3DHQ A;  4K8J A;  4KJN A;  2F0V A;  3EVQ A;  2EYJ A;  2RDF A;  3TP5 A;  1STN A;  3MHB A;  4J6H A;  5C3X A;  3D4D A;  5E3F A;  5KEE A;  4IUN A;  2PZW A;  4EQP A;  1ENC A;  5IOC A;  4K5X A;  1A3U A;  2PW7 A;  1KDB A;  2RBM A;  1STB A;  3EJI A;  3H6M A;  3QB3 A;  5CV8 A;  3TP6 A;  5IGG A;  5ISR A;  4J1M A;  4KD3 A;  3D8G A;  4B9X A;  1A2U A;  4QF4 A;  1IHZ A;  1F2Z A;  2ENB A;  2WAC A;  2OEO A;  5J22 A;  4K6D A;  4QB4 A;  1SNM A;  5CR3 A;  1RKN A;  3QOJ A;  2EY2 A;  1STG A;  4NKL A;  5KIX A;  1SYG A;  2EYP A;  5KYI A;  4IZ8 A;  5HGT A;  1EZ8 A;  2EYL A;  4IAL A;  5I9P A;  3TME A;  2F0H A;  2PW5 A;  2M00 A;  4DU9 A;  4G57 A;  2F3W A;  2PZT A;  1JOK A;  1EYA A;  2RKS A;  5F2D A;  3SR1 A;  4EVO A;  1KDA A;  3SK4 A;  2F0F A;  1SND A;  5HUR A;  4S3S A;  4KTA A;  4ODG A;  3NHH A;  4WRD A;  2F0L A;  4KJO A;  3P75 A;  5IOD A;  2SNM A;  4KD4 A;  1EYD A;  1STY A;  2F0K A;  5NUC A;  3MXP A;  3SXH A;  2F0D A;  4I65 A;  4RKL A;  2F0U A;  5IGD A;  1EY6 A;  5J39 A;  4EQN A;  4LAA A;  1ENA A;  1SNC A;  2EY1 A;  4KHV A;  3SK6 A;  3ERQ A;  2EYF A;  1JOQ A;  4PMC A;  5J1Z A;  2NUC A;  3V2T A;  3NXW A;  4B9W A;  2F0N A;  5I9O A;  3BDC A;  5E1F A;  4WOR A;  4N9T A;  3ERO A;  1NSN S;  2F0M A;  2KQ3 A;  2F0P A;  4KY5 A;  5C4H A;  3DMU A;  3RUZ A;  1SYF A;  3MEH A;  5CC4 A;  5C5M A;  3D4W A;  1F2M A;  1U9R A;  5CGK A;  5I6Y A;  5IGC A;  4HTH A;  5M9O A;  4ZQ3 A;  5KYL A;  2PYK A;  5CV4 A;  5CV5 A;  5IGB A;  4ZUI A;  1SYC A;  5C6A A;  4R8N A;  1TT2 A;  1EQV A;  4MIU A;  4NMZ A;  5CV6 A;  1JOR A;  1EY9 A;  3NUC A;  2PQE A;  1JOO A;  2EY6 A;  2EXZ A;  4NP5 A;  5IGE A;  3S9W A;  4N9P A;  5IIF A;  3C1E A;  2SOB A;  4HMI A;  4F8M A;  3OSO A;  1F2Y A;  3E5S A;  2OXP A;  5EKK A;  4EQO A;  3SK8 A;  1SYB A;  5K5P A;  2F0J A;  1KAA A;  3TP7 A;  4K2K A;  3OWF A;  3BDL A;  1EYC A;  4K8I A;  4RKB A;  4ZUJ A;  1KDC A;  3HEJ A;  5C4Z A;  3NQT A;  4TRD A;  4ME5 A;  1EY0 A;  4NDX A;  2EYH A;  2F3V A;  5C5L A;  1II3 A;  5CV9 A;  3U9O A;  5C3W A;  3PMF A;  3VA5 A;  1STA A;  2QDB A;  2KHS A;  5I6W A;  4PMB A;  5KRU A;  1AEX A;  3D6C A;  4PNY A;  5EKL A;  3SHL A;  5JAV A;  2F0S A;  1EY4 A;  4QMG A;  4DGZ A;  1A2T A;  1SYD A;  1A3T A;  3NP8 A;  4K5V A;  1STH A;  2F0O A;  2O4X A;  2EYO A;  2OF1 A;  3ITP A;  2F0G A;  1KAB A;  3OMC A;  2HQE A;  3MVV A;  3QOL A;  1SNO A;  2F0I A;  4ID6 A;  4YIJ A;  5CV7 A;  1TR5 A;  2F0E A;  2F0T A;  2PZU A;  3OMG A;  2SNS A;  4KY7 A;  1SNP A;  5EGT A;  1EY5 A;  3TP8 A;  2EYM A;  5IGF A;  5KGU A;  4F7X A;  2F0Q A;  1SNQ A;  4HMJ A;  3HZX A;  2LKV A;  4K14 A;  3R3O A;  4K5W A;  4DF7 A;  1EZ6 A;  2F0W A;  3T13 A;  1NUC A;  4KY6 A;  5JOB A; 
#chains in the Genus database with same CATH topology
 1PZJ D;  4NW2 A;  4DFA A;  1A3V A;  4A93 B;  3JC6 6;  1FD7 D;  3KYH C;  4R4I A;  3A55 A;  4BXX H;  4UP9 A;  1WTO A;  3EVQ A;  4A3B G;  5GQO A;  5EPJ A;  4DV3 Q;  1VQH A;  1Z7T A;  2EQS A;  3ZJY C;  1GUG A;  2EOT A;  3M7G A;  5IGG A;  4J1M A;  1NR4 A;  4B9X A;  5G3L D;  3NEL A;  1R4P B;  3QOJ A;  3UDX A;  1STG A;  2H4O A;  1FVI A;  3SE0 A;  1FGB D;  3U58 A;  4DA2 A;  3J80 E;  2R7Z H;  2OQK A;  5C4J H;  1PTO C;  3CC2 A;  2N8N A;  2F0F A;  3H09 A;  5FO7 B;  2RDH A;  1N33 L;  4IFD H;  3NTH A;  4ODG A;  2HDL A;  2KEN A;  1X32 A;  3CCL A;  1B53 A;  4OO1 H;  3S15 B;  3CHB D;  1DYQ A;  4PG3 A;  2VUM G;  1JOQ A;  4GNX A;  4ZKC B;  4HJ7 A;  5IT9 L;  1ASY A;  4A3G G;  2BDO A;  5C4H A;  4F88 A;  3UE0 A;  3ULL A;  1NMF A;  2R7D A;  1A63 A;  1PTO D;  2B63 G;  3H3V C;  4JYA L;  4V19 0;  3HOU G;  4CDE C;  4DK0 A;  1EIG A;  1E3P A;  2C35 B;  1M8A A;  5DLQ E;  3HKZ B;  3PUX A;  3SDZ A;  1EYC A;  3GV6 A;  2IL8 A;  4BY1 G;  1QCB D;  1Z9F A;  4NDX A;  4CJ2 C;  4MNO A;  1E0B A;  1G29 1;  1Q7Y C;  3F2D A;  5IE8 A;  4DUY Q;  1B3A A;  4H13 C;  2TMP A;  3K7U C;  3D3R A;  5M3F H;  3H0G B;  1PH1 A;  1XPU A;  1STH A;  1KQS A;  3SK4 A;  1K83 B;  1NR2 A;  1OXV A;  1X3E A;  2HCI A;  3FRP B;  4JBM A;  1WCM G;  1STE A;  4LUV A;  4A3M H;  1I4P A;  2A5H A;  3S17 B;  2HIX A;  4A3K G;  4HMJ A;  3R3O A;  1PZI D;  1TWH B;  1F2L A;  4A3J H;  1UNS A;  1K28 A;  1GUO A;  1HNZ L;  1XX8 A;  1Y1V B;  2RVL A;  1FNU A;  3N52 A;  4GNX C;  1E1T A;  1KD1 C;  5M5W B;  1YNJ C;  5IYD H;  2TSS A;  4AH6 A;  1SR3 A;  3J81 j;  1JWM D;  2M2L A;  3FDT A;  1HTP A;  4JI2 L;  2F3I A;  4YY3 L;  3GTM B;  2OCE A;  3CAM A;  2JSO A;  2MNA A;  4X3S A;  4UP8 A;  1PH9 A;  5GAG C;  1Y1W B;  4JI7 Q;  2JA7 G;  1SFO B;  2NZ1 D;  1SXT A;  4IZ8 A;  1HNZ Q;  1CSQ A;  2EYL A;  3L2P A;  4KN4 C;  1YBY A;  4KHZ A;  4X3T A;  3AB9 A;  5CBE E;  1YNJ D;  1JWU D;  2XGT A;  1Y8N B;  2Q8T A;  1XMO Q;  1LLR D;  4A3L H;  3OW2 A;  4JCV E;  3R8B A;  3V96 A;  1VQO A;  4PZ7 A;  3G6J B;  3JAM c;  4POF A;  4A93 G;  3WDN A;  1RJT A;  1LO5 D;  1UE6 A;  1PZK D;  3VYT A;  3L0O A;  5CC4 A;  2Z4I A;  2L4N A;  3OTO L;  4DUZ L;  4F87 A;  3RN5 A;  2R7Z B;  2PQE A;  5C4J B;  1LV9 A;  2FIN B;  2I5L X;  2A68 C;  4HMI A;  4NXN L;  5A2Q L;  4HAE A;  4ILW A;  1BO0 A;  5IYB G;  1GD7 A;  3K0Y A;  2NZH A;  1CTM A;  2BH2 A;  1YHB A;  2EYH A;  2F3V A;  4IUQ A;  1LT5 D;  3FVQ A;  4R4T A;  4DV0 L;  2IX0 A;  2G9H D;  1CK1 A;  3SGI A;  3GTL H;  4C2M H;  2VQE Q;  3OTO Q;  2F0O A;  3ITP A;  4EGV A;  1HFG A;  1PH6 A;  2HQL A;  3K7A H;  1KHI A;  2SNS A;  2A68 D;  5GAH C;  5JEA H;  4K14 A;  3HZX A;  4POG A;  1C8C A;  1NUC A;  1YEZ A;  2D9U A;  2I07 B;  5D3D A;  2NVY H;  1QG7 A;  1U4P A;  3JAM i;  4RAU C;  3LX0 A;  3MZ5 A;  1PA6 A;  3A8I E;  2EE1 A;  1BUV T;  4K8J A;  3PF4 A;  4DV0 Q;  3TP5 A;  5CYU A;  1BKB A;  4LUZ A;  5M3F B;  4DK6 C;  2OWO A;  2IHF A;  1ENC A;  5IOC A;  3F8T A;  2KVM A;  1O7L A;  3MEF A;  4QY7 A;  1L1O C;  1LAB A;  3OIQ A;  4A3M B;  2Q8R E;  4X3U A;  3KBG A;  1RF2 D;  4QF4 A;  1DGS A;  2K4K A;  2EJG C;  2ENB A;  5J22 A;  1XPR A;  3M3Y H;  2YTX A;  4DR6 L;  4P71 A;  4KLK A;  5LMN W;  4A3J B;  2EYP A;  1C9O A;  4G4K A;  3HKS A;  2N49 A;  3GTP H;  3A56 A;  3H0G G;  3D4R A;  3L9A X;  2L1B A;  2P5Z X;  2K01 A;  3A54 A;  4WRD A;  2WP8 J;  3VR2 A;  2SNM A;  1YZ6 A;  3NEM A;  1LTS D;  1W3S A;  1Z47 A;  2AQ1 B;  2AKW B;  2F0K A;  3S2D H;  1LYL A;  3RNU A;  1I6V C;  4C3H H;  2UXC L;  4HJ9 A;  5LMU L;  3I91 A;  1PLF A;  2E2I H;  1HZA A;  5JPN C;  5M5X H;  4LUO A;  5IGB A;  5C44 H;  1BCP B;  3T1H L;  2IJ0 A;  1A15 A;  4G7O C;  5IIF A;  2G9D A;  4OWW B;  5JJK A;  5EKK A;  3NBH B;  3M4P A;  4O2D A;  3OWF A;  1PHJ A;  1Y1W G;  3T4A C;  2QEJ C;  3TS2 A;  4TQU S;  4TRD A;  1QVC A;  1G8Z D;  4NXM Q;  4ZYS A;  1I50 B;  4KKT A;  3STB C;  2HCC A;  2OTL A;  2NTT A;  4BXX G;  3FMC A;  5LMU Q;  4OON A;  1O7Z A;  2KCN A;  1IBM Q;  3RR5 A;  3IFD A;  3FPU B;  2JE6 I;  1SNO A;  4DV1 Q;  1N34 Q;  4QQB X;  1VQ9 A;  1UWV A;  1BXT A;  1UEB A;  5JJI A;  5EAY A;  2LKV A;  1EZ6 A;  3URY A;  3TEH B;  1E2W A;  3B6Y A;  3PUZ A;  4GKK L;  3D6W A;  4ZLT F;  4FXK C;  3T56 B;  3PQI A;  3K59 A;  2L9H A;  4CGY B;  2QA4 A;  3T1Y L;  4YHH Q;  2L5T A;  4H7B A;  1SMY D;  1I5F A;  2JYO A;  4UP7 A;  2R7Z G;  3H91 A;  3CMA A;  1D1K A;  1G2T A;  2LY7 A;  4XT3 B;  3GTL B;  4IUN A;  1GUS A;  4IFD G;  2K5H A;  2CH4 W;  3I55 A;  1VQM A;  2L55 A;  5CV8 A;  1H9R A;  3K7A B;  3KK7 A;  4OO1 G;  2K28 A;  3JAM E;  1SNM A;  3W2D A;  3FEW X;  4DAY B;  1AZP A;  4GKK Q;  2A6E C;  3E0J A;  3K81 C;  2NVY B;  2MQH A;  3L7Z C;  5EKI A;  4CDC C;  1G91 A;  4I7A A;  4JI1 L;  2PZT A;  3MXN B;  5FO8 B;  2PO4 A;  4IFD J;  3UI2 A;  4WJ3 M;  3J80 L;  5LL6 S;  4ULL A;  1FL0 A;  1HNW L;  2F0L A;  3LGJ A;  1PFM A;  3TQY A;  5CMD A;  4C1N I;  3VYU A;  1X9N A;  2NVQ H;  4OX9 L;  4H44 C;  4PMC A;  1GM5 A;  1JJG A;  3BVZ A;  3NXW A;  4B9W A;  1PH7 A;  3M3Y B;  2JEB I;  4OWX B;  1NMG A;  4BA2 I;  1SYF A;  4B3R Q;  5CGK A;  3E0E A;  5I6Y A;  1A6X A;  4DV6 L;  3TZD A;  5M9O A;  2A6E D;  1J6Q A;  3GTP B;  3NTI A;  5M3F G;  1EY9 A;  1UEA B;  3PIP 3;  4DR1 L;  1XNR L;  1SDF A;  1I4Q A;  5EJW A;  2K50 A;  2KOL A;  1EOT A;  4IPH A;  2OXP A;  4A3M G;  4HIM A;  1HNW Q;  2NWG A;  1EU3 A;  1U4M A;  4K2K A;  4XXE A;  4IOC A;  5FLX E;  1VF7 A;  1HQR D;  4A3J G;  3NQT A;  4C3H B;  1JR0 D;  1L0X B;  2AQ3 B;  4L63 B;  4ME5 A;  3KJO A;  1FYC A;  4OX9 Q;  1XNQ Q;  3U9O A;  4DAV A;  1Z6H A;  3CCM A;  3AMU A;  3PMF A;  3K5L A;  2D2C C;  2B2T C;  5IP9 H;  1JMC A;  1E7Z A;  1EY4 A;  4QMG A;  1SYD A;  4AQY L;  2E2I B;  5IYD G;  5M5X B;  3PUW A;  2F0G A;  5C44 B;  2LSS A;  3IRB A;  1SJE D;  4A76 A;  1Y69 U;  4DR1 Q;  1TS5 A;  1XNR Q;  2FJ2 A;  4F7X A;  1SNQ A;  1BBW A;  2M9V A;  1EQQ A;  2X6L A;  3T13 A;  4RGM A;  2K32 A;  1ROD A;  4TVA B;  1ZYR C;  3PO3 H;  2EIF A;  4LF6 Q;  2PQA B;  2ZTE A;  3C1F A;  4CDD C;  1MKH A;  4DR4 L;  1TXY A;  3E9H A;  5ELF A;  4Y7N H;  3HOV H;  3T51 B;  1TWC H;  3D4D A;  2K5D A;  3TSS A;  1LAC A;  4AIM A;  1HZC A;  1KDB A;  2F52 A;  4A3L G;  1TS4 A;  3CCS A;  3K8A A;  2LXK A;  3Q0A A;  1E22 A;  3M4Y A;  4YWK A;  3CCJ A;  1VQD A;  2VUM B;  2MO0 A;  1ZYR D;  3FHW A;  2B2V C;  2H1E A;  4N8F A;  3BZC A;  4IAL A;  5I9P A;  1BNZ A;  4G57 A;  1VCI A;  1ONL A;  5BN4 A;  1S3O A;  2E2J H;  1B4O A;  4DR4 Q;  1WYD A;  4GN4 B;  1L0W A;  4X65 Q;  2WV6 D;  3I4O A;  4X6A H;  4FXD A;  5IOD A;  4X64 Q;  1K8G A;  3NBH A;  3NBI A;  2D5D A;  4I65 A;  3CME A;  2QW7 A;  4KHV A;  3NSW A;  5D14 A;  4N9T A;  1LTT D;  4X66 Q;  3J81 i;  4XT1 B;  3K5N A;  1BR9 A;  1S5D D;  3LWE A;  2JA6 H;  4DK1 A;  5C6A A;  5CV6 A;  1TT2 A;  4GOP C;  1B9M A;  1MBY A;  2EY6 A;  4LF8 L;  1PH4 A;  3IL8 A;  2CHB D;  4HCS A;  3J7Y W;  1NNX A;  2E5L L;  4B3T Q;  4JI0 L;  4PZ6 A;  5JEA G;  2ZM6 L;  3S1Q H;  3TP7 A;  3GTQ H;  2KEC A;  3CCE A;  1VS0 A;  2Z6K A;  4ME3 A;  2NVQ B;  3HS0 C;  3ONA B;  4IPG A;  2L11 A;  4JI3 L;  1IYU A;  4DV4 L;  2K1B A;  2A69 C;  1SE3 A;  2F0S A;  3K6O A;  3J7Z C;  2OF1 A;  3U50 C;  4DV7 L;  4UPA A;  4LF8 Q;  2BCO A;  1N32 L;  2A73 B;  1W6K A;  2NN6 I;  2E5L Q;  1X3F A;  1WTP A;  4DXF A;  2RSN A;  1YI2 A;  4KMU C;  1K3B C;  4PZ8 A;  4C3I H;  3VYS A;  1VQN A;  1I4X A;  4DAY A;  5BR8 Q;  4Y52 H;  1AP0 A;  2J0T D;  5C3E H;  2YYZ A;  4JI3 Q;  2A69 D;  4DV3 L;  3MXN A;  1DOM A;  3GO5 A;  3MHB A;  1D5M C;  2EPB A;  1RIP A;  1IKL A;  1WD0 A;  3G6E A;  1ESR A;  1PRT B;  3CPW A;  1D7Q A;  3GTK H;  4RHR A;  1B50 A;  4L5R C;  2K03 A;  5IYC H;  3O13 A;  4C3H G;  2Z4H A;  3GTG H;  2XRS D;  4R4C A;  5KND A;  5GAD C;  3PO3 B;  2VZA A;  2F0H A;  2M00 A;  2Z6K C;  3J7A V;  5C44 G;  1X6O A;  2C9O A;  4Y7N B;  4MTN A;  3RD4 A;  3HOV B;  2NB0 A;  1TWC B;  1V8Q A;  1J9O A;  3Q8D A;  1D6E C;  2L12 A;  2EJF C;  3BDC A;  3CC4 A;  2Z6B A;  1EYG A;  1D2B A;  2K75 A;  5C5M A;  3D4W A;  3U9S A;  1WTX A;  4HTH A;  3I4N H;  4QGU A;  2GA4 B;  1HUN A;  5JPM C;  1DCZ A;  1EQV A;  2HUG A;  4Q0F A;  3CQZ H;  2CKZ B;  2E2J B;  1S4Z A;  2VQF Q;  3D0F A;  1CT1 D;  4M8A A;  2KA7 A;  2DGY A;  4HID A;  2VL6 A;  4ABN A;  1L0Y B;  1XYI A;  1MHW C;  1VQ7 A;  4LWC A;  1G2S A;  4QIW B;  1KDC A;  3J81 E;  1DZ1 A;  1IBL Q;  2HHH L;  1K73 C;  4DUY L;  2QDB A;  3NQI A;  3WOF A;  3SHL A;  4JC0 A;  3NPP A;  3MFY A;  1B9N A;  4K5V A;  3A7A B;  1A0I A;  2JA6 B;  2UXD Q;  5FO9 B;  1BBU A;  2IT1 A;  1GHK A;  4B3M Q;  2KHI A;  2B2U A;  3RMH A;  1PFS A;  5LHY 1;  1RCV D;  4CKC A;  3S1Q B;  4CDF C;  3GTQ B;  2HHH Q;  1O78 A;  3K0X A;  1SLJ A;  1HZB A;  4FF2 A;  4NB3 A;  2UUA L;  1LT3 D;  2EJM A;  3CPF A;  2KUM A;  4QJF A;  5LMN Q;  2NZO A;  2CFM A;  3F2C A;  1WD1 A;  4YCV A;  2RCN A;  4B08 A;  3VR5 A;  2NN6 H;  2Z1C A;  2ZTD A;  1KRT A;  4R1J A;  2A8V A;  2K5W A;  4OEL B;  2PNR C;  4LF7 L;  4JI7 L;  3RLN A;  1EEI D;  4QCL A;  4JI6 Q;  4LFA Q;  4RGT A;  4C3I B;  1AE3 A;  4LFC Q;  1H9S B;  1F9S A;  2L0C A;  2RKS A;  5C3E B;  3P7J A;  1PYB A;  3NWS A;  2UUA Q;  5BN3 A;  1Q82 C;  1K9M C;  1PFN A;  1JQY D;  2RA4 A;  2V4D A;  4KJO A;  3P75 A;  1XMO L;  2I5H A;  1DJR D;  1HZ9 A;  2F0D A;  5IT9 c;  5I2Y A;  5T1G A;  4N8X 1;  2N55 A;  3GTK B;  3QWN A;  2DNE A;  3OW7 A;  1F9P A;  3V2T A;  2F0N A;  4LF7 Q;  3H3V I;  3GTG B;  4QUC A;  2B2Y A;  3LNN A;  2RCF A;  3KF8 B;  2B2U C;  2EXD A;  1XTC D;  3U4V A;  5IP9 G;  4X62 L;  3BU2 A;  2HDM A;  4BWG B;  4U68 A;  5IGE A;  1IBK L;  3VR4 A;  1SE4 A;  4C1N K;  1GUT A;  4APV A;  4DR2 L;  2CCZ A;  5HY6 A;  1QB5 D;  5EQ0 A;  3BDL A;  1WJJ A;  2CW0 C;  1FJG L;  5FLX L;  1II3 A;  3PO3 G;  1HJP A;  5DNF A;  1S72 A;  1CKM A;  3AQQ A;  2YTV A;  4LF9 Q;  2VQE L;  1A2T A;  2LS0 1;  3I4N B;  1VQB A;  4DNI A;  4X62 Q;  2GN5 A;  3HOV G;  2WFW A;  1I4H A;  1HTL D;  1V1P B;  1TR5 A;  1BCP F;  3CQZ B;  4IUR A;  5ELO A;  1DOL A;  1IBK Q;  5JVG 3;  2XSC A;  1KNA A;  2VXW A;  4DR2 Q;  1SN8 A;  5JVH 3;  4DF7 A;  3KFU A;  4RGO S;  1S5E D;  4R4O A;  4KY6 A;  1OTC A;  2CW0 D;  5TSS A;  2QDL A;  1SYE A;  1AN8 A;  1FJG Q;  2K05 A;  5ELN A;  3DHQ A;  1SEB D;  1N9W A;  1H95 A;  1FR3 A;  2XIW A;  2YTY A;  3E9I A;  2A74 C;  2R7F A;  3MA2 B;  5D3I B;  1Y8P B;  2PCF B;  3D8G A;  1NY4 A;  3T53 B;  1XMQ L;  1IHZ A;  4DKA C;  4LF5 Q;  2CQO A;  2Z9H A;  5KYI A;  5KNC A;  4DR3 Q;  2B29 A;  3TME A;  4BBR H;  1TWG H;  2F3W A;  1Q1B A;  4OWT B;  2JA6 G;  3KUP A;  1SND A;  4PV1 C;  1UAP A;  1IL2 A;  1LT4 D;  5IWA L;  4IO9 A;  4JOI A;  5C0X I;  4KD4 A;  5NUC A;  1WTQ A;  1SBB B;  1PTO H;  2BA1 A;  1E24 A;  2VB2 X;  4BBS H;  1RHP A;  1JB7 A;  5J1Z A;  1XMQ Q;  1DM0 B;  5IP7 H;  2F0M A;  2A6H C;  3C2P A;  1AFP A;  3C46 A;  2UUC Q;  3KDF B;  5IGF A;  4A3D H;  3DWA A;  4KHP Q;  2NVT H;  1KL9 A;  1S40 A;  4ZUI A;  4R8I A;  3CW2 C;  4C56 C;  1CSP A;  5COR A;  1EFW A;  1TII D;  2FHT A;  4F8M A;  3DLL A;  5IWA Q;  1JC7 A;  1KAW A;  2X6G A;  4EX5 A;  3H3V H;  4OGQ C;  4C3I G;  1KTK A;  4NXM L;  4DV5 Q;  2A6H D;  1KLG D;  5C3E G;  5H1S E;  1K8A C;  3S1R H;  4HN7 A;  5BN5 A;  3PIP A;  1IBM L;  4DV1 L;  1N34 L;  4CJ0 B;  1U5K A;  1O80 A;  4GLA C;  1EIF A;  2C5C A;  3D31 A;  2IWH A;  3UDI A;  2K5N A;  1BOS A;  2D0O A;  5IYC G;  1VQL A;  3J7A F;  2D0P A;  4G7H C;  3NK9 A;  4K2L A;  5JJL A;  5DAU A;  4YHH L;  4OL7 A;  1H9S A;  4OIK A;  2XTI A;  4HIK A;  1SMY C;  3R2I A;  1CQF A;  4KJN A;  2XWJ B;  2RF4 A;  1WTW A;  1Q3L A;  2PZW A;  1K0R A;  3BYY B;  2JA5 H;  2K33 A;  4KD3 A;  3KJP A;  2Z0S A;  4QB4 A;  5CR3 A;  1RKN A;  4UHV A;  4NKL A;  3F1Z A;  4KI0 A;  5JJZ A;  3CF5 A;  3EQL C;  1CA5 A;  4H0L C;  4CKB A;  1SYG A;  3KF8 A;  3BZK A;  3KLW A;  1M4V A;  1C48 A;  3I4N G;  2KJX A;  3KLS X;  4HCE A;  3H94 A;  1LTA D;  2KEE A;  1W2B A;  3AYH B;  2D62 A;  4IQZ A;  5C4X H;  2GVA A;  4A3I H;  4C2M B;  2FFK B;  4DNR B;  1DD2 A;  2PPB C;  2IX1 A;  5D65 A;  3BG3 A;  3CD6 A;  1SSO A;  1TY2 A;  4IOA A;  1G6Z A;  5ELE A;  3ERO A;  4B3R L;  3ICE A;  1XJV A;  1F2M A;  1YIJ A;  4ZQ3 A;  1B3Q A;  2AHO B;  3EA6 A;  3DEO A;  2K6A A;  1D1I A;  5EPK A;  4BBR B;  1TWG B;  2IW3 A;  5C0X H;  1D8L A;  4A3F H;  1V1P A;  1F2Y A;  3BDO A;  4CBV A;  2WII B;  4J8Q A;  5K5P A;  1HH2 P;  2VW9 A;  3FKI H;  1PTO B;  1XNQ L;  5C4Z A;  1EY0 A;  1TY0 A;  4BBS B;  1STA A;  1VQK A;  3ND9 A;  4JVZ A;  3AFQ A;  1HR0 W;  1PVO A;  1ZKO A;  3W3A A;  4A3D B;  1CI3 M;  3G71 A;  2NVT B;  4DAM A;  2EYO A;  3PUV A;  3QOL A;  4ID6 A;  3F2B A;  3S1M H;  4JI4 L;  5COY A;  2F0E A;  5EGT A;  3OMG A;  2NN6 G;  5KGU A;  1WTV A;  1NJI C;  3M4O H;  1YIT A;  2WAQ E;  2F0W A;  2Q2T A;  3BZD B;  3S2D B;  3KLR A;  1SE8 A;  2KHJ A;  2MO1 A;  1UUP A;  1QVF A;  4LF6 L;  4JBK A;  1LTI D;  2QKI C;  2ICE C;  1JWS D;  4E6I A;  3K58 A;  3P1H A;  1TS2 A;  1XWE A;  2MHV A;  1CM9 A;  4LFB L;  1STN A;  3S1R B;  1D5X C;  1KNE A;  4GLV B;  1Y14 B;  3VYR A;  1R9T H;  1V1O A;  1E2V A;  1FNV A;  2DJF C;  1H9J A;  4JI4 Q;  1S5B D;  5FLM H;  3VR3 A;  1A62 A;  1UE7 A;  3HG9 A;  3MTS A;  5T1I A;  1MIU A;  4BA1 I;  4FVM A;  5ELD A;  5FOB B;  3A8J E;  3CKI B;  4P2C B;  4DR7 L;  3J80 c;  5GAE C;  4MTK A;  1TWF H;  5F2D A;  1ICW A;  4X65 L;  3ND8 A;  2G5D A;  4S3S A;  4LFB Q;  4X64 L;  1C0A A;  1I4R A;  1PH3 A;  4OIJ A;  2WAQ B;  3HOY H;  2JA5 B;  5I4D A;  3NE5 B;  1PRT F;  3ERQ A;  4GNX B;  4JBJ A;  1GXD C;  3SVM A;  1EWH A;  4O0A A;  4A3C H;  2NUC A;  3S24 A;  1KIX A;  3E3X A;  1NSN S;  1YJ9 A;  4X66 L;  5AFW A;  1C7Y A;  1KLU D;  1U9R A;  2B2W A;  1X3G A;  4DR7 Q;  3RZO H;  2PYK A;  2A1A A;  1CZW A;  1EOV A;  3NUC A;  4GZY C;  1PXU A;  1F77 A;  1BDO A;  4WJ4 A;  4B3T L;  1MSG A;  1HNX L;  1ML0 D;  3Q22 A;  2RHS B;  4A3I B;  4TSS A;  2LMC B;  3IFT A;  2UU9 Q;  1KAA A;  3ERS X;  4OHJ A;  2K04 A;  5CBA E;  4C3J H;  2B3G A;  5CV9 A;  5DM6 3;  3RZD H;  1VQE A;  4LF4 Q;  3D6C A;  4YCU A;  1V43 A;  3OHX C;  2MGS A;  5ELB A;  3J80 i;  2K5V A;  4HJA A;  3PUY A;  1WVL A;  1YNX A;  2F0I A;  2WB1 E;  2NVX H;  3F2U A;  4A3F B;  3OOC A;  4IUV A;  1V9P A;  1MD2 D;  1HNX Q;  4FNF A;  1P16 A;  1CKN B;  3S14 H;  4LW1 A;  3W1G A;  2OTJ A;  5BR8 L;  3FKI B;  3DWP A;  2EY5 A;  3SK5 A;  3I72 A;  3PIO 3;  2K7V A;  4BBR G;  2E8G A;  1EWC A;  1D5Z C;  1HUM A;  1MSH A;  1HXY D;  1CQV A;  5C3X A;  1JJC B;  2ICI A;  4CKE A;  1X55 A;  3S1M B;  3EJI A;  1XPO A;  3GDE A;  5ISR A;  1GUW A;  1B7Y B;  5FJ8 H;  1FGU A;  1BCP C;  2WAC A;  4U67 3;  4K6D A;  3M4O B;  4BBS G;  1J8I A;  4DV2 L;  4JV5 L;  4JI5 L;  5IP7 G;  2UUB Q;  1QNK A;  5J3B A;  2BH8 A;  1RDP D;  2F1M A;  2QGQ A;  1IYJ B;  1QUQ B;  4A3D G;  3SR1 A;  1N36 Q;  2ZXP A;  4JPB W;  2WB1 B;  2IX3 A;  2X69 A;  3CCU A;  3I3C A;  4P75 A;  5IY0 A;  3GTO H;  1STY A;  1DOK A;  1R9T B;  5E4X A;  5E7N A;  1BQQ T;  3SK6 A;  4QL5 A;  1BCP D;  1HA5 A;  1O7Y A;  1J5E Q;  1AE2 A;  4P74 A;  4DV2 Q;  4JV5 Q;  4JI5 Q;  1M90 C;  1L1O B;  5KYL A;  3QR8 A;  1R4Q B;  1UE5 A;  1TWF B;  2VQF L;  1JOO A;  2JEA I;  4N9P A;  1HCZ A;  4ZKB B;  2Y0S E;  4RH6 A;  2AUK A;  2QF7 A;  1SYB A;  1MJE A;  2JXM B;  3ZYY X;  2A19 A;  2BOS A;  4ZCK A;  4L5T A;  1IBL L;  4IUU A;  4ZUJ A;  3HOY B;  2I46 A;  4A4I A;  3A7L A;  4ALP A;  3R93 A;  1GVP A;  1EFI D;  5C3W A;  4XQJ A;  3U4Z A;  3HFZ B;  3KOJ A;  3Q6S A;  3Q23 A;  4GLX A;  3IAY A;  2AQ2 B;  2VS1 A;  3M9B A;  3S2H H;  4RCO A;  3RZO B;  2UXD L;  4YIJ A;  1F9Q A;  1RD9 D;  1VQ5 A;  4CHT B;  4B3M L;  1SNP A;  1EY5 A;  2WAQ G;  2JA5 G;  1E2Z A;  1EQR A;  3HKZ E;  4GKJ L;  3GV3 A;  2PNH A;  1QWY A;  2ID0 A;  1OXS C;  5M5Y H;  2ZXR A;  1GUN A;  1N8R C;  5DEH A;  3DEP A;  4KKU A;  1EY7 A;  2PQA A;  4LK1 C;  3T16 A;  4C3J B;  4XIG S;  3RZD B;  3FPP A;  1ICF B;  1OXT A;  2OT2 A;  3I73 A;  5LMN L;  2R92 H;  2RDF A;  1IZ6 A;  5E3F A;  2CWA A;  5C4X G;  2ZJP A;  2MPM A;  2Y0S B;  2N78 A;  2ZXO A;  4A3I G;  3DM3 A;  4GN3 B;  2CH4 A;  3TP6 A;  2PW7 A;  1X54 A;  5M3M H;  2NVX B;  3TZU A;  3H6M A;  4KK7 A;  1A2U A;  2HIV A;  1K0S A;  3EFX D;  1GHJ A;  4JI6 L;  4GKJ Q;  4LFA L;  3I7F A;  1B2T A;  1EEF D;  1Q86 C;  3S14 B;  3HOW H;  4LFC L;  1YVC A;  3N6R A;  1Q90 A;  1SJH D;  1YJW A;  3TN2 A;  2PW5 A;  2BE5 C;  3K5M A;  2KED A;  1V1Q A;  5C0X G;  4A3F G;  3CCR A;  1JCK B;  1YJN A;  1N33 Q;  4A75 A;  2O5I C;  2F0U A;  5IGD A;  3GTJ H;  2EY1 A;  3OYY A;  1JJ2 A;  3HOZ H;  3FKI G;  3Q24 A;  3CXC A;  1TWA H;  3I4M H;  1QIL A;  5I9O A;  2E74 C;  5E1F A;  4WOR A;  1G6P A;  1VF5 C;  2NTS A;  4KY5 A;  4FDB A;  3JAM L;  4OXP A;  4RG1 A;  1SAP A;  5CV5 A;  1SRU A;  5C0X J;  2BE5 D;  4MIU A;  1ET9 A;  4NP5 A;  2BA0 A;  2QCP X;  2O2L D;  1VQP A;  4JYA Q;  4R9W A;  2VY3 A;  4EQO A;  1Q8I A;  3HRZ C;  4I7Z C;  2Q2U A;  3BVG A;  1I3Q H;  1AH9 A;  3GTO B;  4HIO A;  2EDG A;  1CKN A;  4RKB A;  3TS0 A;  1I94 L;  3CP0 A;  1DON A;  1EUJ A;  1A8V A;  4BY7 H;  2ATW A;  3AU7 A;  1TS3 A;  2O5J C;  2RHQ B;  1Q12 A;  3G48 A;  5EBC A;  1KC8 C;  5KRU A;  4B3S L;  4LF9 L;  1NTG A;  3E6Z X;  2DUD A;  1A3T A;  2WB1 G;  3A5Z B;  4MN3 A;  1KAB A;  3QO2 A;  3WWV A;  2PZU A;  2HD3 A;  3G4S A;  4A3E H;  4FO2 A;  2Q8I B;  5FLM G;  1ENF A;  3OIP A;  3OPO A;  2J7Z A;  3ULJ A;  2IHE A;  4DNT B;  5AJ3 L;  2KHS A;  1VQI A;  1IKM A;  1I94 Q;  4KV6 A;  1ASZ A;  2DJG C;  3S16 H;  5EPL A;  1QUQ A;  1GOZ A;  2XWB B;  2KCC A;  1LTB D;  3HP3 A;  2EYJ A;  2ZTC A;  3UE1 A;  4B3S Q;  3S2H B;  4DPG A;  1CHP D;  2NBF A;  1QJO A;  3BVM A;  4EQP A;  1A3U A;  1OO9 B;  2JK8 A;  4JBW A;  4DR5 L;  2QIL A;  4HJ5 A;  4JI2 Q;  4YY3 Q;  3HOY G;  4LF5 L;  1BVS A;  1ESF A;  1GJX A;  1VQG A;  4A3C G;  5K36 H;  1I50 H;  2XRQ D;  4XYQ A;  5AJ3 Q;  4DR3 L;  4RHS A;  5M5Y B;  1U0L A;  1L1O A;  1MI2 A;  1C4Q A;  1VMC A;  1HHV A;  1EWI A;  1JOK A;  1OXX K;  2VB3 X;  4EQ5 A;  4FP5 D;  2R92 B;  2I5M X;  3QG1 A;  3PO2 H;  4KTA A;  1HR0 L;  2B2Y C;  3KBX A;  3SXH A;  1PH8 A;  1ZXT A;  1U4L A;  2RDG A;  3I8Z A;  3PCO B;  4LAA A;  5M3M B;  4DR5 Q;  2DY7 A;  3VA7 A;  3EBE A;  1WOC A;  1DXM A;  4C3J G;  2UUC L;  3DMU A;  3MEH A;  4KHP L;  3HOW B;  4R4Q A;  3HGB A;  2JA8 H;  2L15 A;  1VQC A;  3TRZ A;  4OEM B;  4RFB A;  4XYO A;  3CCQ A;  1JOR A;  1JT8 A;  1U4R A;  4DUZ Q;  2Y0S G;  2Z8L A;  2OQ0 A;  2EXZ A;  4HJ8 A;  5G3L F;  4DK3 C;  3C1E A;  1TVX A;  2SOB A;  1MGS A;  1NE3 A;  3E5S A;  4O42 A;  1PYW D;  3KF6 B;  1YHQ A;  4PMW A;  1HR0 Q;  2SEB D;  4NXN Q;  1M1K C;  1X3Q A;  2JP1 A;  5FLX c;  3GQB A;  2XNA C;  2VNU D;  4DV5 L;  3GTJ B;  2B8G A;  2JN4 A;  3HOZ B;  1TWA B;  3I4M B;  3VA5 A;  1PRT C;  2B8F A;  3HOX H;  1XTD A;  3FP9 A;  4PMB A;  4XTC S;  1SMX A;  3I90 A;  3UDG A;  2AMC B;  5I2X A;  3TDQ A;  3I4L A;  4IN3 A;  1PMR A;  2AWO A;  2H5X A;  4IUT A;  5E4W C;  4Q5V A;  4GN5 A;  3MVV A;  5FKA C;  1EU4 A;  5CV7 A;  2CVR A;  3AEV A;  1HA6 A;  3HKZ G;  1ZEQ X;  3UDF A;  4XQQ A;  2UXB L;  1I3Q B;  4HSV A;  5FJ8 G;  1AW7 A;  4KKS A;  1LTG D;  5DM7 3;  4GOP B;  2LXJ A;  5HUR A;  3X3N A;  4AYB E;  2R93 H;  4BY7 B;  1PTO F;  1BF4 A;  4P72 A;  3PV0 A;  1PRT D;  4LNQ A;  1GKH A;  3MXU A;  1QNU A;  1VQF A;  3VDY A;  3CRL C;  4FF3 A;  2E2H H;  3NEN A;  5KEE A;  3X3M A;  1K3R A;  3QIA A;  3OWE B;  4M1U B;  4K5X A;  4L8J A;  1HQM C;  1LM0 A;  2ASB A;  4A3E B;  2JQO A;  2K52 A;  1W6J A;  2UXB Q;  1Y1V G;  2EY2 A;  3I2Z A;  4DR6 Q;  2R6G A;  2DN8 A;  4JOI C;  4UAI A;  3I56 A;  5HGT A;  3A74 A;  3S16 B;  1O7I A;  4A3B H;  3P20 A;  1EYA A;  1JB3 A;  2ZT9 C;  2WKC A;  4IPC A;  1WI5 A;  1AZQ A;  3AFP A;  2K14 A;  2RQX A;  4FYD A;  2MP1 A;  4HSP A;  1S5F D;  1F9R A;  3GP7 A;  3MXP A;  4NPS A;  2FMM A;  4L5Q A;  3MFG A;  1ENA A;  5IT9 E;  3W5O A;  2UXC Q;  4AYB B;  3ER0 A;  2F4V L;  3RUZ A;  1VQ6 A;  2PI2 E;  2N88 A;  3R2T A;  4G7Z C;  4NMZ A;  2JA9 A;  4DN4 M;  3QJY A;  3BYT B;  3T1H Q;  4QUF A;  3OSO A;  3PO2 B;  1JE4 A;  2MUY A;  2K5Q A;  2Q2I A;  2IY5 B;  5LL6 X;  2F4I A;  1LTL A;  2F0J A;  2DY8 A;  4FF1 A;  2VUM H;  1VMP A;  5A35 A;  1UE1 A;  3EIV A;  4RA8 A;  4A3G H;  3NTK A;  4WJW A;  5ELC A;  2F4V Q;  2JJQ A;  1CA6 A;  1GO3 E;  2RSO A;  1YNN C;  3V05 A;  2I0Q A;  3STB D;  2F03 A;  4JW0 A;  3DXJ C;  3L3O C;  4JG2 A;  1I6H H;  2R92 G;  1K8O A;  1Q46 A;  1TU2 B;  2JA8 B;  2B63 H;  1XXG A;  1Q8K A;  2HQE A;  4O1N A;  3HOU H;  3PGZ A;  3S1N H;  2F0T A;  4KY7 A;  1RL2 A;  2ES2 A;  2EZV A;  1FNW A;  5M3M G;  3BS1 A;  2CQA A;  2B2T A;  4ZK9 B;  1WTH A;  4BY1 H;  4BS9 A;  3NP8 A;  3HOW G;  1TQO A;  4L6T B;  1X65 A;  1EY8 A;  3J81 L;  4UY8 C;  3HOX B;  1YNN D;  3T1Y Q;  3TBI B;  2E2D C;  4K6L A;  2NYZ D;  2ALY B;  3RLF A;  1SRO A;  4J6H A;  1VQ8 A;  4WFN 3;  1WCM H;  3A5U A;  2J4X A;  4GS3 A;  2WIN B;  4HR7 B;  4A3K H;  1STB A;  1Y8O B;  4H02 A;  2AUJ D;  4JI8 L;  1F2Z A;  1QZG A;  1IXR A;  1Q1E A;  4FXG C;  3HOZ G;  4L5S A;  4IJH A;  3I4M G;  4MZ9 A;  3K57 A;  3PF5 A;  1PH2 A;  4K0K L;  1X56 A;  3PIO A;  2R93 B;  1YHA A;  1LUZ A;  3M7N A;  1JIC A;  1JE5 A;  4RWS C;  3PSI A;  2YU9 H;  4JI1 Q;  4PQX A;  1NBW A;  2MJ8 A;  3MAQ A;  1VQJ A;  3CRK C;  1PV4 A;  2V1C C;  2E2H B;  1H9M A;  4LMQ D;  3KF6 A;  2B2V A;  5L37 A;  4RKL A;  3VR6 A;  1T5E A;  5J39 A;  4EQN A;  3J7A 5;  1SNC A;  1L2F A;  2ZJQ A;  4RCN A;  2EYF A;  1CZG A;  2B39 A;  4JI8 Q;  4BY7 G;  3DUZ A;  2JA7 H;  1E1O A;  1NAP A;  3CU7 A;  2KQ3 A;  3H15 A;  1QVG A;  3K80 C;  5IGC A;  3KDF A;  4K0K Q;  2YV5 A;  3CC7 A;  5CV4 A;  4DV6 Q;  1SYC A;  4R8N A;  1IL8 A;  4A3B B;  5A2Q E;  2KCT A;  3S9W A;  4JK1 C;  1PFB A;  2R3Z A;  3GD7 A;  1VQA A;  1Q81 C;  1QZH A;  2BDN A;  1RTN A;  3SK8 A;  4A3E G;  2UU9 L;  1CKO A;  3C3L A;  1PDQ A;  4IJL A;  5HGQ A;  1HPC A;  4XDX A;  3J81 c;  3TRE A;  2AWN A;  4GOP A;  4A93 H;  2FXQ A;  3SEB A;  5C5L A;  4LF4 L;  1WFQ A;  1LTR D;  4PNY A;  5EKL A;  3K5O A;  4YCW A;  4J15 A;  1ET6 A;  3M4Q A;  4XQN A;  3ULP A;  4X3K A;  4AQY Q;  1S5C D;  2E76 C;  1VDZ A;  2R61 A;  3MWY W;  2EYM A;  5IYB H;  5C4X B;  4DAP A;  2PMZ E;  4RMF A;  3G7L A;  4TKO B;  4AYB G;  3WOE A;  1B1Z A;  4Z9C B;  1CFM A;  5K36 G;  3A8K E;  3DWQ A;  2MFI A;  4A3G B;  4UDU C;  4KN7 C;  1G51 A;  2E75 C;  3RLO A;  4ZAI A;  2DNC A;  2F0V A;  2SDF A;  4IUP A;  1QE6 A;  1I6H B;  2KCM A;  3LWU A;  4MHE A;  3PO2 G;  2B63 B;  1LT6 D;  3S15 H;  1ILP A;  3HOU B;  4IFD I;  2RBM A;  3QB3 A;  3S1N B;  1QOH A;  1IW7 C;  2CWP A;  4CJ1 B;  2OEO A;  4OO1 I;  2KBN A;  1HRJ A;  1MJC A;  1K8M A;  2N3S A;  2UUB L;  1T9H A;  1IYV A;  1ILQ A;  1PYS B;  5KIX A;  1X3P A;  4BY1 B;  2FMC A;  1EZ8 A;  4LJZ C;  1WTR A;  1KRS A;  1N36 L;  1B70 B;  4DU9 A;  2JA8 G;  1OXU A;  1EIH A;  1HFN A;  4EVO A;  1KDA A;  1KXL A;  2Q2H A;  4FF4 A;  1EIY B;  3NHH A;  1EYD A;  3DM1 A;  1WCM B;  3KLS A;  2B2W C;  2GVB A;  1EY6 A;  1PH5 A;  1SE2 A;  2PMZ B;  4A3K B;  1IW7 D;  1J5E L;  1P8L A;  1VQ4 A;  4DXG A;  4HED A;  1H9K A;  4V0B A;  3MC0 B;  3M85 A;  3I70 A;  2F0P A;  1CHQ D;  2HT1 A;  3HOX G;  3IKJ A;  3H0G H;  1RTO A;  2ZJR A;  1K83 H;  3A0J A;  3W1B A;  4RGN A;  2YU9 B;  1BBX C;  3EN2 A;  4IPD A;  3S17 H;  5JEA J;  1CUK A;  3MXG A;  1TWH H;  2WKD A;  4YWM A;  4JI0 Q;  5FK9 C;  2ZM6 Q;  2XVS A;  4K8I A;  3HEJ A;  2XN9 C;  1Y1V H;  4ZRZ A;  2R93 G;  1NCV A;  2PI2 A;  2JA7 B;  5GRO A;  2EVB A;  5I6W A;  5KNB A;  1AEX A;  1TKW B;  2LFN A;  5JAV A;  5M5W H;  4DV4 Q;  4DGZ A;  3BJU A;  3RN2 A;  4YWL A;  1EL0 A;  2O4X A;  3OMC A;  3CCV A;  2IPK D;  1T5X D;  3GTM H;  1EQT A;  4P73 A;  1B44 D;  3NWT A;  3TP8 A;  4DV7 Q;  2F0Q A;  5EBD A;  1N32 Q;  4K5W A;  1B8A A;  1Y1W H;  4QIW E;  1I4G A;  1SFO H;  2QEX A;  5JOB A; 
#chains in the Genus database with same CATH homology
 1PZJ D;  4NW2 A;  4DFA A;  1A3V A;  4A93 B;  1FD7 D;  3A55 A;  1WTO A;  3EVQ A;  5EPJ A;  1Z7T A;  1GUG A;  2EOT A;  3M7G A;  5IGG A;  4J1M A;  1NR4 A;  4B9X A;  5G3L D;  1R4P B;  3QOJ A;  1STG A;  2H4O A;  3SE0 A;  1FGB D;  4DA2 A;  3J80 E;  1PTO C;  2F0F A;  3H09 A;  5FO7 B;  2RDH A;  4IFD H;  3NTH A;  4ODG A;  2HDL A;  1X32 A;  1B53 A;  4OO1 H;  3S15 B;  3CHB D;  1DYQ A;  1JOQ A;  4ZKC B;  5IT9 L;  2BDO A;  5C4H A;  4F88 A;  1PTO D;  3H3V C;  4V19 0;  4DK0 A;  1EIG A;  1M8A A;  3HKZ B;  3PUX A;  3SDZ A;  1EYC A;  3GV6 A;  2IL8 A;  1QCB D;  4NDX A;  4CJ2 C;  1E0B A;  1G29 1;  1B3A A;  4H13 C;  2TMP A;  3D3R A;  3H0G B;  1STH A;  3SK4 A;  1K83 B;  1NR2 A;  1OXV A;  2HCI A;  3FRP B;  1STE A;  1I4P A;  2A5H A;  3S17 B;  4HMJ A;  3R3O A;  1PZI D;  1TWH B;  1F2L A;  1UNS A;  1GUO A;  1XX8 A;  1Y1V B;  2RVL A;  1FNU A;  3N52 A;  5M5W B;  1YNJ C;  2TSS A;  1JWM D;  2M2L A;  3FDT A;  1HTP A;  3GTM B;  2JSO A;  4X3S A;  1Y1W B;  1SFO B;  2NZ1 D;  1SXT A;  4IZ8 A;  2EYL A;  4KN4 C;  4KHZ A;  4X3T A;  3AB9 A;  5CBE E;  1YNJ D;  1JWU D;  1Y8N B;  2Q8T A;  1LLR D;  3R8B A;  3V96 A;  3G6J B;  3WDN A;  1RJT A;  1LO5 D;  3VYT A;  1PZK D;  5CC4 A;  2Z4I A;  2L4N A;  4F87 A;  2R7Z B;  2PQE A;  5C4J B;  1LV9 A;  2FIN B;  4HMI A;  2A68 C;  5A2Q L;  4HAE A;  4ILW A;  1BO0 A;  3K0Y A;  1CTM A;  2EYH A;  2F3V A;  4IUQ A;  1LT5 D;  3FVQ A;  2IX0 A;  2G9H D;  1CK1 A;  2F0O A;  3ITP A;  4EGV A;  1HFG A;  2SNS A;  2A68 D;  5JEA H;  4K14 A;  3HZX A;  1C8C A;  1NUC A;  2D9U A;  2I07 B;  5D3D A;  1QG7 A;  1U4P A;  4RAU C;  3LX0 A;  3MZ5 A;  3A8I E;  2EE1 A;  1BUV T;  4K8J A;  3TP5 A;  5CYU A;  5M3F B;  1ENC A;  5IOC A;  2KVM A;  1O7L A;  1LAB A;  3OIQ A;  4A3M B;  2Q8R E;  4X3U A;  3KBG A;  1RF2 D;  4QF4 A;  5J22 A;  2EJG C;  2ENB A;  4A3J B;  2EYP A;  4G4K A;  3A56 A;  3D4R A;  3L9A X;  2L1B A;  2K01 A;  3A54 A;  4WRD A;  2WP8 J;  3VR2 A;  2SNM A;  2F0K A;  1LTS D;  1Z47 A;  2AQ1 B;  1I6V C;  3I91 A;  1PLF A;  5JPN C;  5IGB A;  1BCP B;  2IJ0 A;  1A15 A;  4G7O C;  5IIF A;  2G9D A;  5EKK A;  3OWF A;  3T4A C;  2QEJ C;  4TQU S;  4TRD A;  1G8Z D;  4ZYS A;  1I50 B;  4KKT A;  2HCC A;  2NTT A;  3FMC A;  1O7Z A;  2KCN A;  3IFD A;  3FPU B;  2JE6 I;  1SNO A;  1BXT A;  2LKV A;  1EZ6 A;  3URY A;  1E2W A;  3PUZ A;  3D6W A;  4ZLT F;  4FXK C;  3T56 B;  3K59 A;  2L9H A;  4CGY B;  2L5T A;  4H7B A;  1SMY D;  2JYO A;  3H91 A;  1D1K A;  1G2T A;  2LY7 A;  4XT3 B;  3GTL B;  4IUN A;  1GUS A;  4IFD G;  2L55 A;  5CV8 A;  1H9R A;  3K7A B;  3KK7 A;  4OO1 G;  2K28 A;  3JAM E;  1SNM A;  3W2D A;  3FEW X;  1AZP A;  2A6E C;  3E0J A;  3L7Z C;  2NVY B;  5EKI A;  1G91 A;  2PZT A;  5FO8 B;  2PO4 A;  4IFD J;  3UI2 A;  3J80 L;  5LL6 S;  4ULL A;  2F0L A;  1PFM A;  5CMD A;  4C1N I;  3VYU A;  4H44 C;  4PMC A;  4B9W A;  3BVZ A;  3NXW A;  3M3Y B;  2JEB I;  4BA2 I;  1SYF A;  5CGK A;  5I6Y A;  1A6X A;  3TZD A;  5M9O A;  2A6E D;  3GTP B;  3NTI A;  1EY9 A;  1UEA B;  3PIP 3;  1SDF A;  1I4Q A;  5EJW A;  2KOL A;  1EOT A;  2OXP A;  2NWG A;  1EU3 A;  1U4M A;  4K2K A;  4XXE A;  5FLX E;  1VF7 A;  1HQR D;  3NQT A;  4C3H B;  1JR0 D;  1L0X B;  2AQ3 B;  4L63 B;  4ME5 A;  1FYC A;  3U9O A;  4DAV A;  1Z6H A;  3AMU A;  3PMF A;  3K5L A;  2D2C C;  2B2T C;  1EY4 A;  4QMG A;  1SYD A;  2E2I B;  5M5X B;  3PUW A;  2F0G A;  5C44 B;  1SJE D;  1Y69 U;  1TS5 A;  2FJ2 A;  4F7X A;  1SNQ A;  2M9V A;  2X6L A;  3T13 A;  4RGM A;  2K32 A;  1ROD A;  1ZYR C;  3C1F A;  5ELF A;  3T51 B;  3D4D A;  2K5D A;  3TSS A;  1LAC A;  1KDB A;  1TS4 A;  3Q0A A;  3M4Y A;  2VUM B;  1ZYR D;  2B2V C;  2H1E A;  4IAL A;  5I9P A;  1BNZ A;  4G57 A;  1VCI A;  1ONL A;  5BN4 A;  1B4O A;  2WV6 D;  4FXD A;  5IOD A;  3NBH A;  3NBI A;  2D5D A;  4I65 A;  4KHV A;  3NSW A;  5D14 A;  4N9T A;  1LTT D;  4XT1 B;  3K5N A;  1BR9 A;  1S5D D;  3LWE A;  4DK1 A;  5C6A A;  5CV6 A;  1TT2 A;  1B9M A;  1MBY A;  2EY6 A;  3IL8 A;  2CHB D;  4HCS A;  3J7Y W;  5JEA G;  3TP7 A;  2KEC A;  2NVQ B;  3HS0 C;  3ONA B;  2L11 A;  1IYU A;  2K1B A;  2A69 C;  1SE3 A;  2F0S A;  3K6O A;  2OF1 A;  2BCO A;  2A73 B;  1W6K A;  2NN6 I;  1WTP A;  4DXF A;  2RSN A;  4KMU C;  3VYS A;  1I4X A;  4DAY A;  1AP0 A;  2J0T D;  2YYZ A;  2A69 D;  3MXN A;  1DOM A;  3GO5 A;  3MHB A;  1D5M C;  2EPB A;  1IKL A;  1WD0 A;  1ESR A;  1PRT B;  1B50 A;  4RHR A;  2K03 A;  3O13 A;  4C3H G;  2Z4H A;  2XRS D;  5KND A;  3PO3 B;  2F0H A;  2M00 A;  3J7A V;  2C9O A;  4Y7N B;  3RD4 A;  3HOV B;  2NB0 A;  1TWC B;  1V8Q A;  1J9O A;  1D6E C;  2L12 A;  2EJF C;  3BDC A;  1D2B A;  5C5M A;  3D4W A;  3U9S A;  1WTX A;  4HTH A;  2GA4 B;  1HUN A;  5JPM C;  1DCZ A;  1EQV A;  2HUG A;  4Q0F A;  2E2J B;  1S4Z A;  1CT1 D;  4M8A A;  2KA7 A;  4ABN A;  1L0Y B;  1XYI A;  1G2S A;  4QIW B;  1KDC A;  3J81 E;  1DZ1 A;  2QDB A;  3NQI A;  3WOF A;  3SHL A;  3NPP A;  3MFY A;  1B9N A;  4K5V A;  3A7A B;  2JA6 B;  5FO9 B;  2IT1 A;  1GHK A;  2B2U A;  3RMH A;  5LHY 1;  1RCV D;  4CKC A;  3S1Q B;  3GTQ B;  1O78 A;  4FF2 A;  1LT3 D;  2EJM A;  2KUM A;  1WD1 A;  4B08 A;  3VR5 A;  2NN6 H;  2Z1C A;  2K5W A;  2PNR C;  1EEI D;  4QCL A;  4RGT A;  4C3I B;  1H9S B;  1F9S A;  2L0C A;  2RKS A;  5C3E B;  3P7J A;  3NWS A;  5BN3 A;  1PFN A;  1JQY D;  2RA4 A;  2V4D A;  4KJO A;  3P75 A;  1DJR D;  2F0D A;  5I2Y A;  5T1G A;  2N55 A;  3GTK B;  3QWN A;  2DNE A;  3OW7 A;  1F9P A;  3V2T A;  2F0N A;  3GTG B;  4QUC A;  2B2Y A;  3LNN A;  2B2U C;  1XTC D;  2HDM A;  4BWG B;  4U68 A;  5IGE A;  3VR4 A;  1SE4 A;  4C1N K;  1GUT A;  1QB5 D;  5EQ0 A;  3BDL A;  2CW0 C;  5FLX L;  1II3 A;  5DNF A;  1A2T A;  2LS0 1;  3I4N B;  1I4H A;  1HTL D;  1V1P B;  1TR5 A;  1BCP F;  3CQZ B;  4IUR A;  1DOL A;  5JVG 3;  2XSC A;  1KNA A;  2VXW A;  5JVH 3;  4DF7 A;  4RGO S;  1S5E D;  4KY6 A;  2CW0 D;  5TSS A;  1SYE A;  1AN8 A;  2K05 A;  3DHQ A;  1SEB D;  1FR3 A;  2XIW A;  2A74 C;  3MA2 B;  5D3I B;  1Y8P B;  2PCF B;  3D8G A;  3T53 B;  1IHZ A;  5KYI A;  5KNC A;  3TME A;  2F3W A;  1Q1B A;  3KUP A;  1SND A;  4PV1 C;  1UAP A;  1LT4 D;  5C0X I;  4KD4 A;  5NUC A;  1WTQ A;  1SBB B;  1PTO H;  2BA1 A;  2VB2 X;  1RHP A;  5J1Z A;  1DM0 B;  2F0M A;  2A6H C;  3C2P A;  1AFP A;  3C46 A;  5IGF A;  3DWA A;  4ZUI A;  4R8I A;  4C56 C;  5COR A;  1TII D;  2FHT A;  4F8M A;  1JC7 A;  2X6G A;  4OGQ C;  4C3I G;  1KTK A;  2A6H D;  1KLG D;  4HN7 A;  5BN5 A;  4CJ0 B;  1O80 A;  2IWH A;  2C5C A;  3D31 A;  1BOS A;  3J7A F;  4G7H C;  3NK9 A;  4K2L A;  5DAU A;  4OL7 A;  1H9S A;  4OIK A;  1SMY C;  3R2I A;  1CQF A;  4KJN A;  2XWJ B;  1WTW A;  1Q3L A;  2PZW A;  3BYY B;  2K33 A;  4KD3 A;  4QB4 A;  5CR3 A;  1RKN A;  4NKL A;  4KI0 A;  5JJZ A;  1CA5 A;  3EQL C;  4H0L C;  4CKB A;  1SYG A;  3KF8 A;  1M4V A;  1C48 A;  2KJX A;  3KLS X;  4HCE A;  3H94 A;  1LTA D;  2KEE A;  2D62 A;  4IQZ A;  4C2M B;  2FFK B;  4DNR B;  1DD2 A;  2PPB C;  2IX1 A;  5D65 A;  3BG3 A;  1SSO A;  1TY2 A;  1G6Z A;  5ELE A;  3ERO A;  1F2M A;  4ZQ3 A;  3EA6 A;  3DEO A;  2K6A A;  1D1I A;  5EPK A;  4BBR B;  1TWG B;  2IW3 A;  5C0X H;  1V1P A;  1F2Y A;  3BDO A;  4CBV A;  2WII B;  4J8Q A;  5K5P A;  1PTO B;  5C4Z A;  1EY0 A;  1TY0 A;  4BBS B;  1STA A;  3ND9 A;  1ZKO A;  3W3A A;  4A3D B;  1CI3 M;  2NVT B;  2EYO A;  3PUV A;  3QOL A;  4ID6 A;  5COY A;  2F0E A;  5EGT A;  3OMG A;  2NN6 G;  5KGU A;  1WTV A;  2F0W A;  3BZD B;  3S2D B;  3KLR A;  1UUP A;  1LTI D;  2QKI C;  2ICE C;  1JWS D;  4E6I A;  3K58 A;  3P1H A;  1TS2 A;  1XWE A;  2MHV A;  1CM9 A;  1STN A;  3S1R B;  1D5X C;  1KNE A;  3VYR A;  1V1O A;  1E2V A;  1FNV A;  1H9J A;  1S5B D;  3VR3 A;  3HG9 A;  3MTS A;  5T1I A;  4BA1 I;  4FVM A;  5ELD A;  5FOB B;  3A8J E;  3CKI B;  4P2C B;  5F2D A;  1ICW A;  3ND8 A;  4S3S A;  1I4R A;  4OIJ A;  2WAQ B;  2JA5 B;  5I4D A;  3NE5 B;  1PRT F;  3ERQ A;  3SVM A;  1GXD C;  1EWH A;  2NUC A;  1NSN S;  5AFW A;  1KLU D;  1U9R A;  2B2W A;  2PYK A;  1CZW A;  3NUC A;  4GZY C;  1PXU A;  1F77 A;  1BDO A;  1MSG A;  1ML0 D;  3Q22 A;  4A3I B;  4TSS A;  2LMC B;  3IFT A;  1KAA A;  4OHJ A;  2K04 A;  5CBA E;  5CV9 A;  5DM6 3;  3D6C A;  1V43 A;  3OHX C;  2MGS A;  5ELB A;  3PUY A;  1WVL A;  2F0I A;  3F2U A;  4A3F B;  3OOC A;  4IUV A;  1MD2 D;  4FNF A;  3FKI B;  3DWP A;  2EY5 A;  3SK5 A;  3I72 A;  3PIO 3;  2K7V A;  1EWC A;  1D5Z C;  1HUM A;  1MSH A;  1HXY D;  1CQV A;  5C3X A;  2ICI A;  4CKE A;  3S1M B;  3EJI A;  5ISR A;  1GUW A;  2WAC A;  1BCP C;  4U67 3;  4K6D A;  3M4O B;  1J8I A;  1QNK A;  1RDP D;  2F1M A;  3SR1 A;  2ZXP A;  2WB1 B;  2IX3 A;  2X69 A;  3I3C A;  1STY A;  1DOK A;  1R9T B;  5E4X A;  1BQQ T;  3SK6 A;  1BCP D;  1HA5 A;  1O7Y A;  5KYL A;  1R4Q B;  1TWF B;  2JEA I;  1JOO A;  4N9P A;  1HCZ A;  4ZKB B;  4RH6 A;  2AUK A;  2QF7 A;  1SYB A;  2JXM B;  3ZYY X;  2BOS A;  4IUU A;  4ZUJ A;  3HOY B;  2I46 A;  3A7L A;  3R93 A;  1EFI D;  5C3W A;  4XQJ A;  3Q6S A;  3Q23 A;  3IAY A;  2AQ2 B;  4RCO A;  3RZO B;  4YIJ A;  1F9Q A;  1RD9 D;  4CHT B;  1SNP A;  1EY5 A;  1E2Z A;  3GV3 A;  1QWY A;  2ID0 A;  1OXS C;  2ZXR A;  1GUN A;  5DEH A;  3DEP A;  4KKU A;  1EY7 A;  4LK1 C;  3T16 A;  4C3J B;  4XIG S;  3RZD B;  3FPP A;  1OXT A;  2OT2 A;  3I73 A;  2RDF A;  5E3F A;  2MPM A;  2Y0S B;  2ZXO A;  3TP6 A;  2PW7 A;  2NVX B;  3TZU A;  3H6M A;  4KK7 A;  1A2U A;  3EFX D;  1GHJ A;  1B2T A;  1EEF D;  3S14 B;  3N6R A;  1Q90 A;  1SJH D;  3TN2 A;  2PW5 A;  2BE5 C;  3K5M A;  2KED A;  5C0X G;  1JCK B;  2O5I C;  2F0U A;  5IGD A;  2EY1 A;  3Q24 A;  1QIL A;  5I9O A;  2E74 C;  5E1F A;  4WOR A;  1VF5 C;  2NTS A;  4KY5 A;  3JAM L;  1SAP A;  5CV5 A;  5C0X J;  2BE5 D;  4MIU A;  1ET9 A;  4NP5 A;  2BA0 A;  2QCP X;  2O2L D;  4R9W A;  4EQO A;  1Q8I A;  3HRZ C;  4I7Z C;  3BVG A;  3GTO B;  2EDG A;  4RKB A;  1DON A;  3AU7 A;  1TS3 A;  2O5J C;  1Q12 A;  5EBC A;  5KRU A;  3E6Z X;  1A3T A;  4MN3 A;  1KAB A;  3QO2 A;  2PZU A;  4FO2 A;  2Q8I B;  1ENF A;  3OIP A;  3OPO A;  2J7Z A;  4DNT B;  2KHS A;  1IKM A;  4KV6 A;  5EPL A;  1GOZ A;  2XWB B;  2KCC A;  1LTB D;  3HP3 A;  2EYJ A;  3S2H B;  1CHP D;  2NBF A;  1QJO A;  3BVM A;  4EQP A;  1A3U A;  1OO9 B;  4JBW A;  2QIL A;  1ESF A;  1GJX A;  5K36 H;  2XRQ D;  4XYQ A;  4RHS A;  5M5Y B;  1MI2 A;  1C4Q A;  1VMC A;  1HHV A;  1JOK A;  1OXX K;  2VB3 X;  4FP5 D;  2R92 B;  3QG1 A;  4KTA A;  2B2Y C;  3KBX A;  3SXH A;  1ZXT A;  1U4L A;  2RDG A;  3I8Z A;  4LAA A;  5M3M B;  2DY7 A;  3VA7 A;  1DXM A;  4C3J G;  3DMU A;  3MEH A;  3HOW B;  3HGB A;  4RFB A;  4XYO A;  1JOR A;  1U4R A;  2Z8L A;  2EXZ A;  5G3L F;  3C1E A;  1TVX A;  2SOB A;  1MGS A;  3E5S A;  4O42 A;  1PYW D;  4PMW A;  2SEB D;  1X3Q A;  2JP1 A;  3GQB A;  2XNA C;  2VNU D;  3GTJ B;  2B8G A;  3HOZ B;  1TWA B;  3I4M B;  3VA5 A;  1PRT C;  2B8F A;  4PMB A;  4XTC S;  3I90 A;  5I2X A;  3TDQ A;  3I4L A;  4IN3 A;  1PMR A;  2AWO A;  4IUT A;  5E4W C;  4Q5V A;  3MVV A;  5FKA C;  1EU4 A;  5CV7 A;  2CVR A;  1HA6 A;  1ZEQ X;  4XQQ A;  1I3Q B;  4HSV A;  1AW7 A;  4KKS A;  1LTG D;  5DM7 3;  5HUR A;  3X3N A;  4BY7 B;  1PTO F;  1BF4 A;  3PV0 A;  1PRT D;  3MXU A;  1QNU A;  3CRL C;  4FF3 A;  5KEE A;  3X3M A;  3QIA A;  3OWE B;  4M1U B;  4K5X A;  4L8J A;  1HQM C;  4A3E B;  1W6J A;  2EY2 A;  2R6G A;  2DN8 A;  4UAI A;  5HGT A;  3S16 B;  3P20 A;  1EYA A;  1JB3 A;  2ZT9 C;  2WKC A;  1AZQ A;  2RQX A;  4FYD A;  2MP1 A;  4HSP A;  1S5F D;  1F9R A;  3GP7 A;  3MXP A;  2FMM A;  3MFG A;  1ENA A;  5IT9 E;  4AYB B;  3RUZ A;  2N88 A;  3R2T A;  4G7Z C;  4NMZ A;  4DN4 M;  3QJY A;  3BYT B;  4QUF A;  3OSO A;  3PO2 B;  1JE4 A;  2MUY A;  2K5Q A;  5LL6 X;  2F4I A;  2F0J A;  2DY8 A;  4FF1 A;  1VMP A;  5A35 A;  4RA8 A;  3NTK A;  4WJW A;  5ELC A;  1CA6 A;  2RSO A;  3V05 A;  1YNN C;  2F03 A;  3DXJ C;  3L3O C;  1K8O A;  1TU2 B;  2JA8 B;  1XXG A;  4O1N A;  2HQE A;  2F0T A;  4KY7 A;  2EZV A;  1FNW A;  3BS1 A;  2CQA A;  2B2T A;  4ZK9 B;  4BS9 A;  3NP8 A;  1TQO A;  4L6T B;  3J81 L;  1EY8 A;  3HOX B;  1YNN D;  3TBI B;  2E2D C;  4K6L A;  2NYZ D;  3RLF A;  4J6H A;  4WFN 3;  2J4X A;  4HR7 B;  2WIN B;  1STB A;  1Y8O B;  2AUJ D;  1F2Z A;  1Q1E A;  4FXG C;  3K57 A;  2R93 B;  3M7N A;  1JIC A;  4RWS C;  4PQX A;  2MJ8 A;  3MAQ A;  3CRK C;  2E2H B;  1H9M A;  4LMQ D;  2B2V A;  4RKL A;  3VR6 A;  1T5E A;  5J39 A;  4EQN A;  1SNC A;  4RCN A;  2EYF A;  1CZG A;  2B39 A;  3DUZ A;  1NAP A;  3CU7 A;  2KQ3 A;  5IGC A;  5CV4 A;  1SYC A;  4R8N A;  1IL8 A;  4A3B B;  5A2Q E;  3S9W A;  4JK1 C;  1PFB A;  2R3Z A;  3GD7 A;  2BDN A;  1RTN A;  3SK8 A;  3C3L A;  1PDQ A;  1HPC A;  4XDX A;  2AWN A;  3SEB A;  5C5L A;  1LTR D;  4PNY A;  5EKL A;  3K5O A;  1ET6 A;  4XQN A;  4X3K A;  1S5C D;  2E76 C;  1VDZ A;  2R61 A;  3MWY W;  2EYM A;  5C4X B;  4DAP A;  3G7L A;  4TKO B;  3WOE A;  1B1Z A;  4Z9C B;  1CFM A;  5K36 G;  3A8K E;  3DWQ A;  4A3G B;  4UDU C;  4KN7 C;  2E75 C;  4ZAI A;  2DNC A;  2F0V A;  2SDF A;  4IUP A;  1QE6 A;  1I6H B;  3LWU A;  4MHE A;  2B63 B;  1LT6 D;  1ILP A;  3HOU B;  4IFD I;  2RBM A;  3QB3 A;  3S1N B;  1QOH A;  1IW7 C;  4CJ1 B;  2OEO A;  4OO1 I;  1HRJ A;  1K8M A;  1IYV A;  1ILQ A;  4BY1 B;  5KIX A;  1X3P A;  2FMC A;  1EZ8 A;  4LJZ C;  1WTR A;  4DU9 A;  1OXU A;  1EIH A;  1HFN A;  4EVO A;  1KDA A;  4FF4 A;  3NHH A;  1EYD A;  3DM1 A;  1WCM B;  3KLS A;  2B2W C;  1EY6 A;  1SE2 A;  2PMZ B;  4A3K B;  1IW7 D;  4DXG A;  4HED A;  1H9K A;  4V0B A;  3MC0 B;  3M85 A;  3I70 A;  2F0P A;  1CHQ D;  3IKJ A;  1RTO A;  4RGN A;  2YU9 B;  1BBX C;  5JEA J;  3MXG A;  2WKD A;  5FK9 C;  2XVS A;  4K8I A;  3HEJ A;  2XN9 C;  4ZRZ A;  1NCV A;  2JA7 B;  2EVB A;  5I6W A;  5KNB A;  1AEX A;  1TKW B;  2LFN A;  5JAV A;  4DGZ A;  1EL0 A;  2O4X A;  3OMC A;  2IPK D;  1T5X D;  1EQT A;  1B44 D;  3NWT A;  3TP8 A;  2F0Q A;  5EBD A;  4K5W A;  1I4G A;  5JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...