2ENBA

Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Crystal structures of the binary Ca2+ and pdTp complexes and the ternary complex of the Asp21-->Glu mutant of staphylococcal nuclease. Implications for catalysis and ligand binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2enbA00
4K5XA 5I9OA 1A2TA 5EKLA 4DGZA 1STAA 3BDLA 1SYEA 5F2DA 2F0WA 1STHA 2F0KA 5C5MA 5EGTA 1RKNA 3T16A 3EJIA 3OMGA 5C6AA 2EYPA 4ODGA 4KHVA 4QB4A 5KYIA 2F0TA 2F0LA 2RKSA 4KV6A 5DAUA 4EQPA 5CV9A 4B9WA 2EYLA 1NUCA 5CV5A 1A3VA 2PZWA 2F0NA 2F3VA 1SYDA 1SNQA 5CV6A 5I6WA 3E5SA 3ERQA 4IZ8A 4TRDA 4RKBA 4PMBA 5C3XA 1TQOA 2F0IA 5IIFA 4KTAA 5DEHA 4ME5A 5HURA 5KRUA 4IUNA 2F0DA 5E1FA 2F0UA 3VA5A 2EYJA 2OXPA 5C4ZA 4J1MA 5KIXA 5K5PA 4MIUA 2M00A 4NDXA 4ZUJA 2EY1A 4F7XA 1U9RA 4KD3A 5HGTA 1EZ6A 4K5WA 3R3OA 5KGUA 1EY6A 4WRDA 4EQOA 3P75A 3RUZA 2PYKA 3BDCA 2WACA 4QMGA 3H6MA 2O4XA 2EY6A 3TMEA 3SHLA 2EY5A 3TP5A 3T13A 5KYLA 5CGKA 5M9OA 3LX0A 5C3WA 4B9XA 1IHZA 3OMCA 4G57A 2F0GA 3D4DA 5IODA 5CC4A 4OL7A 1SYBA 2PW7A 4KJOA 3MHBA 4KY5A 3DMUA 3NUCA 3PMFA 2EYHA 3MEHA 4EQNA 3NK9A 4HMJA 4H7BA 2EYOA 3MZ5A 5EKKA 2SOBA 3SK5A 4LAAA 5JAVA 2F0EA 3EVQA 2PZUA 1JORA 2RDFA 3D8GA 3C1EA 4E6IA 1EY7A 2PQEA 3SR1A 5IGFA 2NUCA 3D4WA 1A2UA 4J6HA 3HEJA 4K5VA 1KDAA 1EY4A 4EVOA 2RBMA 3DHQA 5E3FA 4N9PA 2F0PA 2KQ3A 2SNSA 5CV4A 4KD4A 4WORA 2F0SA 4K6DA 3SK4A 5IGCA 5ISRA 2F0FA 2F0JA 1F2YA 3MVVA 1EY0A 3OWFA 3TP7A 1SYGA 1KABA 3TP8A 5C4HA 4DFAA 5J39A 3QB3A 4F8MA 1EY5A 4KJNA 3NHHA 4NKLA 1SYCA 2F0MA 5J1ZA 1SNCA 4K8JA 1EYDA 2F0QA 1SNOA 1SYFA 4NP5A 4K2LA 2EXZA 4ZQ3A 1STYA 3ITPA 4ID6A 5J22A 3TP6A 5CV8A 4PNYA 5CR3A 2KHSA 4N9TA 3SK8A 1EYAA 1TR5A 3OSOA 1JOKA 4NMZA 4QF4A 3SXHA 5CV7A 1KDBA 2F0OA 2EYMA 4HMIA 1EYCA 3QOJA 1F2ZA 4K2KA 4PMCA 4HTHA 4RKLA 4YIJA 1STGA 1AEXA 1TT2A 5C5LA 2F0HA 3NP8A 1JOQA 1STNA 3C1FA 3NXWA 1A3TA 3U9OA 4R8NA 1SNDA 1ENAA 3QOLA 4IALA 4K14A 3MXPA 2ENBA 5KEEA 5IOCA 1EQVA 1EY8A 4K8IA 2QDBA 3SK6A 1F2MA 2F3WA 5NUCA 1SNMA 2SNMA 5I6YA 1KAAA 2LKVA 2OF1A 4KY6A 1ENCA 2PZTA 5JOBA 1KDCA 2F0VA 2OEOA 3D6CA 5I9PA 5IGBA 2HQEA 1SNPA 2PW5A 1NSNS 4I65A 4ZUIA 5IGEA 3V2TA 3EROA 4S3SA 2EY2A 4DF7A 1EY9A 5IGDA 1EZ8A 5IGGA 1JOOA 3HZXA 2EYFA 3NQTA 1A3UA 1II3A 4DU9A 1STBA 3P1HA 3S9WA 4KY7A
chains in the Genus database with same CATH superfamily
2VNUD 4N8X1 3VR6A 4X66Q 3DM3A 2EJGC 3HOUG 2K52A 2N8NA 3PIO3 3A5UA 3V05A 4EQPA 3T1YQ 3ND8A 2IW3A 1BXTA 1SMYC 3P7JA 1HR0Q 1EL0A 1NBWA 2RA4A 2E2IH 1ET9A 1HUMA 3MA2B 4R4IA 3AU7A 4IFDG 1Q86C 2BDNA 4IURA 2YTXA 4FF4A 1N32L 1WJJA 2F0DA 4RCNA 2HCCA 1LTSD 3GTKH 4K0KQ 2KCMA 4ZKCB 2ZTDA 1NMGA 1Q3LA 3CQZH 3M7NA 2MO1A 4UP8A 1D5MC 2JA5G 4G57A 1LACA 2HUGA 3HGBA 1K83H 4OL7A 4DV1L 4LF4Q 1SDFA 1WFQA 5A35A 1I3QH 4EQNA 1U4RA 2MNAA 4YWKA 5EJWA 1VQ8A 3NTIA 3FPUB 1RDPD 5D3DA 2D0OA 3K5OA 1VQ4A 4BXXG 4IPCA 2L5TA 1IKMA 3DLLA 4N9PA 2Z8LA 4YY3L 4K6DA 5H1SE 1B44D 3H94A 2XGTA 3I2ZA 1KD1C 4LFAL 2B2WA 1ESFA 4DR1Q 4EQ5A 1EY5A 3M4YA 3DM1A 2X69A 2K01A 1C0AA 3V96A 5C4JB 1UWVA 2QDLA 3C3LA 1JJGA 2UUAQ 1E2WA 4PZ7A 2HIXA 5CV8A 3TP6A 4APVA 5M3FB 2WV6D 1LT4D 5FLXL 3HOXH 4NMZA 1OXSC 3QO2A 2C5CA 2R7ZH 2B2UA 2A69C 1HPCA 1K8MA 3MFYA 4TSSA 1DM0B 1YJWA 1HXYD 2QA4A 1L0YB 4HJAA 4R8NA 1EWIA 2EJMA 3MXPA 3CU7A 2DGYA 2V4DA 4X64Q 2K5VA 5E4XA 4DUZL 2Z4IA 5BN3A 5ELDA 4DK0A 4QIWE 1I4RA 2UXCL 3E9IA 1WI5A 4ZUIA 1SN8A 4S3SA 4AH6A 4LF4L 2EYFA 2ZXPA 4MNOA 3S9WA 4L6TB 5I4DA 3TQYA 1JWMD 3T16A 4DR4L 4JI3Q 3OMGA 3OWEB 4QL5A 1OXUA 3I7FA 1ASYA 2A6HD 1CHQD 4KV6A 4MN3A 5K36G 2FHTA 1VQKA 4FO2A 1X32A 1SNQA 5M3FG 3HG9A 3W1BA 4IFDI 4KTAA 4ME5A 5IP7H 3VYRA 1DONA 4DAVA 3BS1A 1D5XC 2UUAL 1LTID 3BZDB 1SAPA 3I3CA 5ELOA 2UXDQ 1UEBA 3S1MB 2PYKA 2NTSA 3GTLB 4A93B 3S1RH 2EY6A 1WTRA 3SHLA 3MXNA 2KCCA 2A73B 3PIOA 1FVIA 1HNWL 1TS5A 2M2LA 4ZKBB 1AH9A 4H7BA 2NWGA 5E7NA 5JAVA 1KL9A 2PZUA 4A3BH 2RDFA 4GKKQ 1MJEA 1W3SA 1N33L 5CV4A 2L9HA 1SEBD 1K3BC 1X56A 2IHFA 2K32A 3GV3A 1BVSA 1D6EC 2CCZA 1X54A 2VUMH 3EFXD 4JVZA 1TWAB 5J3BA 3X3NA 3CMEA 2AUKA 2YU9H 5BN4A 1BF4A 3KDFA 1P8LA 4XQQA 1LT5D 2Q2TA 4YIJA 1STGA 1FJGQ 1LABA 4OWWB 1KLUD 2OT2A 4BY7B 1SSOA 1HZAA 2QF7A 3NEMA 1YJNA 2B2WC 2AWOA 1B70B 2N88A 4C3JH 1SBBB 2LXJA 5BR8Q 2JE6I 2UXDL 1KAAA 1NCVA 1G91A 3NQIA 2NVXH 1ENCA 2Q8RE 1T5XD 2D5DA 3KK7A 3K58A 5I9PA 4A3FH 4I65A 5LL6S 1VQLA 4ZYSA 2B2UC 3EN2A 1X3PA 4H0LC 1PRTD 1TWHB 1CSQA 4POFA 2E76C 4DGZA 4C3IH 1LTAD 1FL0A 1DGSA 5GQOA 1X3GA 4GKKL 1XNRQ 2CWPA 3A7LA 1IYUA 3J81E 3J80E 3GTQB 1MBYA 2XWBB 3JC66 2NZ1D 5DM63 5DEHA 3Q0AA 2K50A 1AFPA 3HOWH 2HQLA 2WFWA 3H3VI 4PZ6A 4ZUJA 1B9NA 2K03A 1D2BA 4IO9A 5JVG3 1O7ZA 2VZAA 3R93A 1EY6A 4DR5L 2B2VA 4RH6A 4QQBX 4A3IH 1V1OA 4QY7A 3ONAB 5C0XG 4Y7NB 1TWFH 4KMUC 3RLOA 5M9OA 1BBXC 5DM73 4B9XA 4B3ML 1QG7A 4KI0A 4JI5Q 1NR2A 4CDDC 3U9SA 2PI2E 5HGQA 3STBC 3MXNB 2F03A 3E9HA 5FJ8H 1IW7C 4LAAA 5BR8L 2F0EA 3KYHC 3K7UC 1M4VA 3GTGH 1DZ1A 3D8GA 4CJ0B 1FD7D 3CRKC 4EVOA 1BOSA 3WWVA 1XPOA 1YHBA 1CA6A 2SNSA 5IYDG 3VYUA 2KHIA 4OIJA 1ZYRD 1Y1VH 2JXMB 2FMCA 3HOYB 1CA5A 1PFNA 4KJNA 1PH2A 1QVGA 1H9JA 2I5LX 1S3OA 3K7AH 5FLMG 4GKJL 2F0QA 4K2LA 5A2QL 2XSCA 5CYUA 1MJCA 5M5WB 2LY7A 1I6VC 1K3RA 1EYAA 2P5ZX 4IUTA 4ILWA 4LF7Q 2NVQH 1PA6A 4DR3Q 1E2ZA 3URYA 1PTOH 5DLQE 3E6ZX 3KDFB 3VYTA 1HNZQ 1L0XB 1WYDA 4HIKA 4CBVA 2HCIA 1PDQA 2ENBA 1X3FA 2JSOA 4DV6L 1EY8A 3MTSA 3PUYA 3M85A 3L0OA 3S2DB 5I6YA 4QJFA 2ZJRA 4XTCS 2ZXRA 2E2IB 5IGBA 1DOKA 1NAPA 2Y0SG 4LFBL 4K5XA 4KHZA 4RAUC 1HFGA 4A75A 1RIPA 2J4XA 1YNJD 2D62A 5IYCH 3BZCA 1STHA 4U68A 3HOYG 2FJ2A 3I4MB 4DK1A 1HR0W 1B1ZA 4KKUA 3M4OH 2E74C 1WTOA 2F4IA 3ULPA 1K83B 3K59A 2IPKD 4X6AH 1I3QB 1S40A 5IIFA 2CVRA 3BVMA 1EEFD 1H9MA 5HURA 1Q82C 4IUNA 3I73A 4A3LH 1XPUA 2RDGA 3FP9A 5JJZA 4N8FA 1YIJA 1N36Q 2R93H 1EZ6A 1S5BD 4DR7L 3IL8A 4YHHQ 3PGZA 3FMCA 1B8AA 3TS0A 2CHBD 1GM5A 2N49A 1MI2A 4CJ2C 5IODA 4A3JH 1LT6D 2K5QA 3I90A 3HOVH 4JYAQ 1K73C 4DV7Q 2WINB 1XXGA 4B3SQ 1S4ZA 3W2DA 1MSGA 2R7ZB 1SMXA 1KIXA 1C9OA 2IJ0A 3I4MG 2CFMA 2Q8TA 1F2YA 1WTVA 4LUZA 4NXNL 2WB1B 2YTYA 1I50H 2KEDA 1AW7A 2M9VA 4NP5A 1XNQL 4A3DH 1BBWA 4XYQA 1MD2D 4RG1A 5D3IB 1MSHA 2L55A 5CR3A 3MXGA 3OTOL 1QNUA 4CDFC 3GTPH 1EUJA 2K5NA 1VQNA 4LF9Q 1I94Q 4JI2Q 1LV9A 4YCWA 3P20A 2CW0C 5M3MH 2WKDA 3D0FA 4GN3B 1N36L 1HZCA 3EA6A 5NUCA 4JI6L 3SEBA 4WJ4A 3J7ZC 5IT9E 4P2CB 4DN4M 3DWQA 2JA6G 1WTQA 3PIP3 3T4AC 3OIQA 4PQXA 4DR2Q 1STBA 1A8VA 5I9OA 2JA7H 3SE0A 4C2MB 1GOZA 2NN6H 3CKIB 5EGTA 1GKHA 2WB1G 1M1KC 4B3SL 2B3GA 1AN8A 1MKHA 4ME3A 4QB4A 2OWOA 3S1RB 1TS4A 2UU9Q 1AZPA 4JI4Q 2EYLA 1IKLA 2MPMA 4OO1H 3FKIH 1EYGA 1TKWB 2LFNA 1N34Q 4IPDA 4IOAA 4FF1A 4A3GB 4IUQA 4A3BB 3VA5A 3B6YA 5IWAL 1PH3A 2A68D 2JP1A 1ZXTA 3LGJA 1GHKA 1BCPF 2WACA 2O2LD 1M8AA 1DOMA 4A3KH 4OWXB 1EOTA 4JI2L 2F1MA 2F0GA 1BNZA 4K6LA 5CC4A 4YCUA 3A74A 1GUTA 4KY5A 1SR3A 1EQQA 2I46A 2K5HA 2JA8H 3HP3A 2NYZD 4LUOA 1VMCA 1HQRD 2BA1A 3KLRA 2BE5C 3WOFA 3AMUA 5GADC 1WTXA 5JJLA 1VQ6A 4C3JB 1SYGA 1QZGA 4RHRA 1KABA 1JT8A 1VQEA 5J39A 3H0GH 1R9TB 4R8IA 3KJOA 5J1ZA 3AQQA 4IPGA 2ATWA 4A3GG 1XWEA 1XYIA 3I55A 4A3FB 3BU2A 1WCMH 2R92H 1QOHA 2B63H 3OSOA 3GTOH 4CKEA 3HOZH 2XIWA 2VB3X 4HCEA 4RKLA 1EYCA 2DJGC 2LS01 3QOJA 2B2YA 3AEVA 3K5NA 3KJPA 1DCZA 4IUVA 4C3IB 2BOSA 5T1IA 1G51A 3LNNA 1JOQA 4R4QA 1BCPB 5GAGC 1X6OA 3QOLA 4K14A 4BY1H 4B3TQ 3E3XA 3SK6A 2C9OA 5IYBG 1Q90A 1BO0A 2O5JC 2F0VA 3L2PA 2SDFA 5IGEA 3S17B 5C4XB 4H44C 4HJ5A 3U50C 3U4VA 4XQJA 3C2PA 1BCPC 1O7LA 3TDQA 3X3MA 5IGGA 1JOOA 1STEA 4DAMA 3BZKA 3TREA 2ICEC 1KNEA 2TMPA 3QJYA 3A56A 1SYEA 2B8FA 4GNXC 1OXVA 4C3JG 2Y0SE 3MFGA 1DXMA 1CZWA 4KHVA 1ONLA 1TWFB 5DAUA 1IYJB 1TS2A 2XN9C 2ZT9C 3M4QA 4IUPA 3CC2A 2Q8IB 5TSSA 1TVXA 4RKBA 1IBLQ 1JWSD 2VQFL 5EPJA 2F0UA 2OXPA 3T51B 1Q81C 4RFBA 4QCLA 4DXFA 4C1NI 5IE8A 4WRDA 2CH4W 4HJ9A 3KF6A 4G7OC 4DPGA 5C4XG 1SYBA 2PW7A 4C3HB 1N8RC 2UUBQ 1JQYD 2K6AA 4PMWA 2WP8J 4DAYA 4KN4C 2EYOA 3CCMA 2MFIA 2SOBA 3LWEA 2R7DA 1C8CA 3O13A 4HJ8A 3SR1A 3CPFA 1VQDA 1NE3A 1OXTA 1GJXA 2NB0A 1B7YB 1VMPA 1SRUA 1Q1BA 4NXML 2SEBD 5CORA 2JYOA 1B2TA 1I6HH 4R4TA 2GVAA 1MHWC 1HNXL 1IXRA 4EX5A 4FXGC 1A6XA 3D4RA 1FGUA 2MGSA 1KAWA 5JEAH 1TXYA 1B9MA 3SVMA 3I4NB 2EYMA 4K2KA 2K05A 4RA8A 2C35B 2BCOA 1IBLL 2A8VA 1J5EQ 5IT9c 3OOCA 1MIUA 1RCVD 2ES2A 3FRPB 1TWGH 2RQXA 3CXCA 3M4OB 3CCQA 3I4LA 4RGNA 1VQBA 3M9BA 4C3HG 4K8IA 2L4NA 1I4HA 4X66L 1PZKD 2AKWB 3RZOH 1EIFA 5JOBA 1U4PA 1GXDC 4TKOB 2KENA 5ELNA 4GOPA 1CHPD 1K0SA 3T1YL 3EROA 4A3EH 4OONA 1VQMA 5ELCA 3PSIA 1KRTA 1HR0L 1SFOB 2FINB 1VQJA 4A3MH 3BDLA 2R93B 2D0PA 4O1NA 5C44H 1PH4A 2EYPA 1K8AC 5M5XH 1YVCA 4HIMA 4Y52H 5ELEA 3TBIB 1TWCB 4K0KL 1AP0A 1GUSA 2WB1E 3NTHA 1PYWD 4HEDA 2LSSA 2BH8A 3I91A 1PTOD 4H02A 1Y14B 2XRSD 2NZHA 3I4NG 3T56B 5KRUA 3H3VC 4BBSH 3A5ZB 2CWAA 1WD1A 2F4VQ 3H09A 3S2HH 5AJ3Q 4K5WA 4XQNA 1XPRA 1EQRA 2QEJC 3JAME 3TMEA 4XIGS 3PO2H 1Y8OB 3IFTA 3LX0A 2ALYB 3R2TA 1I50B 2MUYA 4CKCA 1NJIC 1J5EL 2DN8A 3F2BA 1VQFA 2E5LQ 3S1NH 3DMUA 3PUXA 2EYHA 3Q6SA 3A0JA 5EKKA 3KF6B 4DR1L 3A8IE 4DAYB 2IHEA 4LJZC 2VXWA 4HAEA 4JI1Q 4JK1C 1C4QA 2E2HH 2IT1A 4DNTB 1Y8NB 3M3YB 2NVYH 3PUWA 1EY0A 3TP7A 2KJXA 4TVAB 5I2XA 5M3MB 1PRTB 2GVBA 3A7AB 3NWTA 4K8JA 4P74A 2H4OA 4KHPQ 3KFUA 2K7VA 2EPBA 2X6LA 3OYYA 1GUOA 3AB9A 4R4OA 3OIPA 5EAYA 4X64L 3GDEA 1JOKA 4X3SA 2LMCB 2OTLA 2A69D 2F0OA 1Y1WB 1PRTC 5M5YB 1E3PA 2JQOA 4ZLTF 1TT2A 4NW2A 1BUVT 1A3TA 3CRLC 3U9OA 2UXBQ 4ZK9B 1HZBA 4BA2I 1A63A 5IOCA 2HDLA 2KHJA 2BDOA 2F3WA 2O5IC 1U4MA 1JJ2A 4KY6A 3A8KE 3GTMB 4JI3L 2X6GA 4OXPA 2OEOA 3QR8A 2K5DA 1LUZA 1YHAA 1A3UA 2LXKA 1L2FA 3P1HA 2Z1CA 3CC7A 3HKSA 4GOPB 1NR4A 4OIKA 1IZ6A 2WIIB 1S5ED 4A93G 4UAIA 5KYIA 1TIID 1RHPA 1UNSA 4BBRH 1ML0D 2KVMA 1C48A 4A3KB 4GZYC 2AQ3B 1JR0D 5C3EH 1LLRD 5CV6A 3E5SA 1T9HA 2KECA 1Y1WG 1FR3A 1LT3D 4UDUC 1YNXA 2MQHA 1YNND 2DY8A 1J9OA 2EOTA 3PF5A 1CKMA 1UEAB 4PV1C 2CQAA 3VR4A 1ZYRC 4CDEC 2VQEQ 1FGBD 2K04A 1D5ZC 3TP5A 4A3CH 1D7QA 3K6OA 2ZXOA 1A15A 3ND9A 1EIHA 3KUPA 3VA7A 4DV4Q 1D1KA 1XTDA 4FP5D 3MZ5A 1TY2A 5LMNQ 4C1NK 2B63B 4MHEA 1JORA 3CF5A 2GA4B 3C1EA 4Q5VA 2NUCA 4J6HA 2Z6BA 3PF4A 4BY7G 3CCSA 4AYBB 2F52A 3SK4A 3UDIA 2NZOA 3OWFA 3S14B 2JN4A 1PZJD 2EXDA 4BY1B 1SE4A 4G7ZC 1FJGL 1OTCA 2F0MA 5FKAC 1B50A 5C0XJ 4BWGB 2HT1A 3J81j 2A6EC 4O2DA 4IFDH 1NY4A 3S15H 3FEWX 4JBMA 1E1OA 4LWCA 4MZ9A 1CM9A 4HTHA 3CD6A 2F0HA 4ZCKA 1DOLA 3RLNA 2OQKA 2WAQB 2YYZA 1O7IA 2I5HA 3ULJA 2A19A 5IP9G 1I5FA 2QW7A 1HCZA 4LF8Q 2R61A 2HHHQ 2JA5H 3LWUA 2B63G 1HA5A 2RCFA 2JJQA 1ASZA 1XMOQ 1XNRL 4DV5Q 2H1EA 4G7HC 5LHY1 3T1HQ 3HZXA 4AYBG 3NTKA 4EGVA 5LMNL 1LTBD 4LUVA 4BA1I 1CK1A 1RKNA 3OW7A 3VR2A 2DNCA 1UE6A 3G48A 2RSNA 4IJLA 2D2CC 2TSSA 1G8ZD 2FFKB 4V190 3AFQA 4IJHA 5JJIA 1RF2D 4IN3A 2EVBA 3HFZB 2AMCB 1SE2A 4DKAC 4OGQC 2L11A 3N52A 1I4XA 2EJFC 1V1QA 2KOLA 1L0WA 1CSPA 2DUDA 1EWHA 3JAMc 1F9RA 4JI5L 2NN6I 4FNFA 2ZM6Q 4L5SA 4KD3A 3GTKB 2WAQG 1HH2P 3HKZB 4P75A 3RUZA 2IWHA 4R1JA 3CQZB 4HN7A 4X65Q 2PMZB 1IBMQ 4FDBA 4OO1I 5CGKA 3PO3H 2KA7A 3STBD 1B53A 4KJOA 1IW7D 3SK5A 2HDMA 4GS3A 4G4KA 2J7ZA 1EY7A 2Z0SA 4YWMA 2VB2X 3R2IA 3VR3A 4DV5L 5E3FA 4CKBA 2KCNA 4WORA 1AE3A 2PNRC 2F0JA 3I8ZA 2ZTEA 4C56C 1V1PA 4LF7L 4DR3L 3CW2C 4JI8Q 4DFAA 2MP1A 2JA9A 3NHHA 5I2YA 1OXXK 5C4JH 1HNZL 1ZKOA 2CKZB 1HA6A 5M3FH 1GUGA 1PXUA 2G9DA 1F9SA 4A3EB 1SROA 3SK8A 4DA2A 3HOXB 1CQFA 3HKZG 1KDBA 3RN2A 3K5MA 1ICFB 4A3MB 5JEAJ 4WJ3M 1XMQQ 2DNEA 3M4PA 2B2VC 2Z4HA 4R4CA 1LO5D 5C44B 1E22A 2H5XA 5M5XB 2MHVA 4CHTB 4OX9Q 2ZM6L 4JV5Q 2CQOA 5CMDA 3H91A 4LF6Q 5JPMC 1GHJA 1NSNS 3IKJA 1S5CD 2E8GA 2R7FA 4BBSB 4AQYQ 1J8IA 3J7AF 1EU3A 1LM0A 1B4OA 3CPWA 3J7AV 4BS9A 4IUUA 1UUPA 4OHJA 1A0IA 1NUCA 1S5FD 2KEEA 1R4PB 4JOIA 2F0NA 2F3VA 3UDFA 1F77A 4YHHL 1KRSA 5ELFA 3ERQA 3JAML 3HOXG 2R7ZG 3RNUA 3I72A 4A3MG 2E2JH 4J1MA 5KIXA 5G3LF 4RCOA 4F7XA 1U9RA 3D3RA 5HGTA 2Z6KA 1JB3A 4JG2A 4DV7L 3TRZA 4JYAL 3J81c 3J80c 3P75A 1CQVA 1RJTA 3KLSX 1PH7A 1KXLA 2J0TD 3D4DA 4UHVA 3SGIA 1QWYA 1BKBA 2I07B 1CT1D 3NUCA 1BBUA 3NK9A 4BBSG 4V0BA 3Q8DA 1HUNA 3QWNA 1GUNA 3FVQA 1KDAA 2A5HA 1D1IA 1PH1A 4KD4A 1QVCA 2R3ZA 3BVGA 1QE6A 1PHJA 1UAPA 4AQYL 2WKCA 1SJHD 5C4HA 2OTJA 1Y8PB 2PPBC 2VUMB 4LF9L 1I94L 2N3SA 3D31A 3BYTB 1V1PB 1SNOA 2YU9B 2Q2IA 4RHSA 5IP7G 1HZ9A 2E75C 5E4WC 1YBYA 1RD9D 1TR5A 4HMIA 5EPLA 2K28A 5C5LA 2CW0D 3C1FA 5EBCA 1KHIA 1L1OA 3Q22A 1O80A 4DR2L 1LYLA 1ENAA 3Q24A 3A54A 1KLGD 5C0XH 1IBKQ 3DUZA 3FHWA 5KNBA 4OEMB 5C3EB 2NVXB 4JBJA 1W6JA 4OWTB 4A3BG 3KF8A 2QEXA 2UU9L 2EY2A 4JI4L 1CKOA 2I5MX 1TWHH 3PCOB 2K1BA 1M90C 1F9PA 2K5WA 3UE0A 5EKLA 3U58A 2EZVA 1N34L 4DK3C 4CGYB 2VUMG 5IYDH 3RR5A 2HD3A 4AYBE 4DNIA 1PLFA 2L15A 2QCPX 3NPPA 1K9MC 2RKSA 2B8GA 2PO4A 4FXKC 5CV9A 4DV2Q 4XDXA 2MJ8A 1PZID 4O42A 1P16A 3AFPA 1SYDA 4IZ8A 1OO9B 3I56A 5FLMH 1NNXA 1PYBA 3IRBA 4TRDA 5C3XA 3CC4A 2BH2A 2B29A 4DNRB 1PFSA 3NELA 1JWUD 1G291 4UP9A 3HOWB 2VW9A 4NDXA 4GLVB 3J81L 3J80L 4FF2A 4L5QA 5LMUQ 3BDCA 4KKTA 4QMGA 1QVFA 3F8TA 1S5DD 5D65A 4B08A 4A3IB 5C3EG 1EWCA 4JOIC 1CKNA 2RSOA 4IQZA 2WAQE 1ILQA 2A1AA 5LMNW 4JCVE 3RLFA 4A3FG 1VQGA 3MHBA 1WTHA 2K4KA 2BE5D 4L8JA 2XVSA 4JPBW 3EVQA 2QGQA 3MC0B 5IGFA 3GTGB 3D4WA 1A2UA 4C3IG 2QILA 1PFBA 2BA0A 3EQLC 1EFID 3K0XA 3G4SA 2RBMA 1N9WA 3PIPA 5A2QE 1VQ9A 3RD4A 3CMAA 3HOYH 1VF5C 1Y1VB 2I0QA 1X3QA 3PUZA 2ZTCA 3PV0A 3RMHA 4HCSA 3GTJH 1QCBD 1SYCA 4DK6C 4UY8C 1PVOA 2FXQA 3K81C 3K7AB 2PCFB 3L7ZC 1VQCA 4HIOA 1YITA 4B3TL 1T5EA 3HOWG 5L37A 4QF4A 2N78A 4LFAQ 2NVQB 1VDZA 4IFDJ 1PTOB 4HR7B 3G71A 4A3IG 4LW1A 4U673 3HKZE 3S2DH 3NWSA 5FO9B 2PMZE 5FJ8G 1L1OB 5COYA 5LMUL 2PZTA 3NBHA 4PG3A 3D6CA 1PTOC 1BCPD 1I4PA 2PW5A 1VQOA 4DF7A 3DXJC 1KNAA 4DV3Q 2E2DC 4KY7A 1A2TA 3EBEA 3KF8B 4DUZQ 3KOJA 5JVH3 1Y1VG 2F0KA 1EFWA 3I4MH 1L1OC 1GD7A 2RVLA 2UXCQ 3K5LA 1UE1A 2A6HC 3K57A 3PO3B 5CV5A 4DUYQ 3C46A 3IAYA 1HRJA 3G6EA 1R4QB 1FYCA 1TQOA 3VDYA 4DR4Q 3I70A 4YCVA 3UE1A 3ZJYC 5LL6X 4GLXA 1F9QA 2B2YC 2M00A 1EQTA 2UUBL 2YTVA 4FF3A 5KGUA 4LF5Q 2O4XA 2RHSB 2KBNA 4LK1C 1SMYD 4P71A 1PRTF 1LTLA 3OMCA 1PV4A 1DYQA 4A3JB 3K0YA 3PMFA 3MEHA 3UDGA 5D14A 1PH6A 1CKNB 1E0BA 4X3TA 3HOVB 4XT3B 2JA6H 1ICWA 4E6IA 1DD2A 2R6GA 5IYCG 2N55A 1WVLA 1HNWQ 4B3RQ 5CBAE 4XYOA 4DV3L 3NENA 3PO3G 1D8LA 4Z9CB 5JPNC 3TEHB 1QILA 1HHVA 1Q12A 1QUQA 2ZJQA 2KUMA 4NKLA 1VQ7A 3KLWA 3QIAA 3TS2A 4ZQ3A 3F2CA 4A3DB 4J15A 3R8BA 3KLSA 1N33Q 2NVTH 4A3LG 2PNHA 4PNYA 4DUYL 4X3KA 1U5KA 4MTKA 1CTMA 1UE7A 1G2TA 2R93G 4YWLA 1F2ZA 3GTPB 5JJKA 4ZRZA 4DV0Q 4JW0A 3S1QH 2NTTA 1X3EA 1SE8A 1B3QA 1SNDA 4X62Q 1F2MA 4A3JG 1SNMA 1ET6A 2SNMA 2OF1A 2LKVA 3VYSA 4LF5L 3HOVG 1W2BA 1K28A 1V8QA 5IGDA 1Z47A 2JK8A 2E2JB 3T53B 1II3A 3NBHB 1BQQT 4RGMA 1YNNC 1I4GA 4C2MH 2JA7B 5IT9L 4KN7C 5F2DA 2F0WA 4XT1B 2GN5A 3WOEA 3PQIA 4L5RC 4R9WA 2F4VL 4B9WA 1SXTA 5AJ3L 3DWPA 1K8OA 2IX3A 3U4ZA 1A3VA 4A3DG 2PZWA 4B3RL 4JBWA 2DJFC 3FKIB 3W3AA 1Q7YC 1JE5A 2XTIA 3G6JB 4A3GH 2L12A 3MXUA 3TZUA 1IYVA 4NB3A 1VCIA 2E5LL 1H9RA 4QUFA 3R3OA 2V1CC 3CAMA 1TU2B 5M3MG 3ERSX 1CI3M 2EY5A 1ZEQX 4RGTA 1HJPA 4JI1L 1EEID 4KK7A 4DV0L 1DJRD 3KBXA 3GV6A 3GO5A 4I7AA 1NTGA 5IYBH 3RZDH 4GOPC 4JI0Q 4X62L 2JA8B 4DR5Q 3GD7A 2XRQD 1JC7A 4ULLA 2JA7G 2CH4A 3M7GA 3TZDA 3HEJA 5CBEE 5GAEC 1B3AA 2NN6G 1JMCA 4KHPL 4DXGA 4B3MQ 5IGCA 2FMMA 1J6QA 4AIMA 1TY0A 1E2VA 2IX1A 1Q46A 1RTNA 3E0JA 3TSSA 1R9TH 4F8MA 4DR6Q 1E24A 3FKIG 4OO1G 3H0GB 2EXZA 2UXBL 1QUQB 1YJ9A 1WCMB 2R92B 1LTTD 2K14A 2Z9HA 3GTOB 4WFN3 3HOZB 3K8AA 1AEXA 4GKJQ 3OPOA 1CUKA 1X65A 3CCEA 1GUWA 3PUVA 4A3KG 3HOUH 3QG1A 2ASBA 5KEEA 1EQVA 2L0CA 3JAMi 1EIYB 2JA8G 4FVMA 4RWSC 1HFNA 5C4XH 3S17H 4F88A 1CZGA 1RL2A 5C3WA 2AQ2B 1X55A 4DV6Q 4HSPA 4ABNA 4JI0L 4I7ZC 3S16H 1UE5A 1YNJC 5C6AA 2ZJPA 2F0TA 2ICIA 1KQSA 3H0GG 1F2LA 3S24A 4LFBQ 1O78A 3SDZA 5T1GA 1YEZA 2AUJD 2ID0A 2D9UA 5I6WA 1WCMG 2R92G 1Q8KA 1VQAA 3FPPA 2VQEL 3J7A5 4PMBA 1AE2A 3HOZG 4WJWA 1WD0A 2K33A 4DR6L 5KNCA 3NE5B 2Y0SB 5C4ZA 1G6PA 4MIUA 4DV4L 1U0LA 1BDOA 3BG3A 3DEPA 4FXDA 4BXXH 4BY1G 1Z6HA 5FOBB 3T13A 3GTJB 2OQ0A 1Z7TA 4C3HH 3F2DA 3D6WA 2B2TA 4KKSA 2G5DA 2G9HD 3HRZC 4HMJA 4PZ8A 3MAQA 4DR7Q 2AWNA 2L1BA 1JE4A 3F1ZA 1XX8A 1G6ZA 2OCEA 2QKIC 3K80C 4LFCQ 1FNVA 2F0FA 3MVVA 3CCVA 4POGA 3WDNA 1I6HB 2VS1A 1SNCA 2AQ1B 1YZ6A 4RMFA 3ITPA 2A6ED 4ID6A 4JC0A 5J22A 1KC8C 4UP7A 2MO0A 1W6KA 4GN5A 4N9TA 2PQAA 3I4NH 4MTNA 4LF8L 3SXHA 4NXNQ 1FNUA 4ALPA 2HHHL 2Q2UA 2XWJB 1XMOL 1MGSA 1H9SA 4P72A 3T1HL 1XNQQ 4DAPA 4IALA 3BYYB 1TWGB 5FLXE 3OTOQ 1PMRA 4LNQA 1O7YA 2KCTA 5K36H 1GO3E 3IFDA 1ENFA 3RZOB 1KDCA 1BR9A 1SLJA 1PYSB 1Y69U 5EBDA 3V2TA 3J81i 1EY9A 3J80i 1EZ8A 4TQUS 4JI7Q 3W1GA 3F2UA 1SFOH 5EPKA 1E7ZA 3W5OA 1IL8A 1STAA 2RCNA 4JI6Q 2EDGA 1RODA 3H3VH 3EJIA 1V9PA 5C0XI 2K75A 1FNWA 4F87A 1TWCH 3VR5A 4LFCL 2NBFA 5DNFA 1WTPA 4JBKA 4KLKA 1EOVA 1VQPA 4X65L 1HTPA 5JEAG 1IBML 1TS3A 4A76A 4P73A 2JA6B 1H95A 5E1FA 3H15A 3ZYYX 2EY1A 4GN4B 1S72A 2VL6A 3S2HB 1V43A 1XTCD 5FO8B 2B39A 2A68C 4CJ1B 3L3OC 3PO2B 1JICA 4QIWB 1IHZA 3J7YW 3BJUA 4IOCA 1SE3A 4M8AA 4A4IA 5IWAQ 1XJVA 4A3EG 1QZHA 3S1NB 1K8GA 1PH9A 4FYDA 2NVTB 4JI8L 3UDXA 3MEFA 4HJ7A 2PQEA 4J8QA 3DHQA 5C44G 5GAHC 4HIDA 2KQ3A 5ISRA 4UPAA 4GNXA 3M3YH 3S1MH 4M1UB 4JI7L 3S1QB 2E2HB 3TN2A 3GTLH 1EU4A 3DEOA 4O0AA 4A93H 2NVYB 2DY7A 4IPHA 5AFWA 1SJED 1XMQL 3DWAA 1LTRD 2B2TC 1PFMA 1EYDA 1SYFA 1EIGA 1STYA 2VY3A 4OX9L 1X9NA 1Z9FA 5BN5A 4JV5L 1Y1WH 3CCJA 5CV7A 3BVZA 3L9AX 5M5YH 1Q1EA 3BDOA 5EQ0A 4LF6L 4RGOS 4GLAC 3OW2A 1IL2A 2PI2A 1AZQA 2PQAB 3KBGA 3NP8A 3NXWA 3PO2G 1VS0A 2AHOB 5IY0A 2YV5A 3A55A 1Q8IA 1TWAH 3GTMH 1H9SB 3CCLA 3ULLA 3CHBD 3I4OA 2HQEA 3RN5A 3OHXC 1JB7A 1JCKB 1QJOA 4DU9A 3NSWA 2XNAC 5C5MA 1LTGD 5FO7B 1YI2A 3A8JE 4BY7H 2EQSA 2IY5B 1CFMA 4ODGA 3FDTA 2F0LA 4BBRB 1VF7A 5ELBA 3ER0A 3MWYW 2RF4A 1HTLD 3RZDB 5FK9C 2JEAI 1U4LA 2F0IA 1PH8A 4HSVA 2EYJA 2HIVA 1G2SA 1RTOA 5K5PA 2RHQB 4OELB 2UUCQ 4L63B 3EIVA 4EQOA 5EKIA 1ILPA 3H6MA 4NPSA 3CCUA 5KYLA 3GP7A 2VQFQ 3G7LA 1VQIA 4X3UA 3Q23A 5IP9H 1WTWA 3GTQH 2IL8A 4ZAIA 1A62A 1WOCA 3NBIA 1QB5D 4XXEA 3E0EA 4K5VA 5KNDA 1EY4A 4CDCC 4LMQD 4QUCA 1YHQA 2F0PA 1PTOF 4QGUA 2F0SA 3S14H 4BBRG 1E1TA 4Y7NH 3HOUB 1ESRA 3TP8A 2A74C 3QB3A 3CCRA 3ICEA 4Q0FA 2RDHA 4GNXB 1N32Q 3HS0C 5HY6A 1HQMC 1PH5A 2EE1A 2EIFA 1I4QA 2KHSA 1IBKL 4NXMQ 2JEBI 5FLXc 3S15B 4PMCA 1VQ5A 1JJCB 2Z6KC 3N6RA 3S16B 1K0RA 1HNXQ 1STNA 4DV1Q 2F3IA 1GVPA 3GQBA 4A3CG 3CP0A 3AYHB 2UUCL 2IX0A 2QDBA 5G3LD 4H13C 1KTKA 1C7YA 1VQHA 3UI2A 1H9KA 2JA5B 1SNPA 5M5WH 1NMFA 2Q2HA 4DV2L 4L5TA 4YY3Q 3NQTA 1QNKA 5GROA
chains in the Genus database with same CATH topology
2VNUD 3VR6A 2EJGC 3PIO3 3V05A 4EQPA 3ND8A 2IW3A 1BXTA 1SMYC 3P7JA 1EL0A 2RA4A 1ET9A 1HUMA 3MA2B 3AU7A 4IFDG 2BDNA 4IURA 4FF4A 2F0DA 4RCNA 2HCCA 1LTSD 4ZKCB 3M7NA 1Q3LA 1D5MC 4G57A 1LACA 2HUGA 3HGBA 4OL7A 1SDFA 5A35A 4EQNA 1U4RA 5EJWA 3NTIA 3FPUB 1RDPD 5D3DA 3K5OA 2L5TA 1IKMA 4N9PA 2Z8LA 4K6DA 1B44D 3H94A 2B2WA 1ESFA 1EY5A 3M4YA 3DM1A 2X69A 2K01A 3V96A 5C4JB 3C3LA 1E2WA 3TP6A 5CV8A 5M3FB 2WV6D 1LT4D 5FLXL 4NMZA 1OXSC 3QO2A 2C5CA 2B2UA 2A69C 1HPCA 1K8MA 3MFYA 4TSSA 1DM0B 1HXYD 1L0YB 4R8NA 2EJMA 3MXPA 3CU7A 2V4DA 5E4XA 2Z4IA 5BN3A 5ELDA 4DK0A 1I4RA 4ZUIA 4S3SA 2EYFA 2ZXPA 3S9WA 4L6TB 5I4DA 1JWMD 3T16A 3OMGA 3OWEB 1OXUA 2A6HD 1CHQD 4KV6A 4MN3A 5K36G 2FHTA 4FO2A 1X32A 1SNQA 3HG9A 4IFDI 4KTAA 4ME5A 3VYRA 1DONA 4DAVA 3BS1A 1D5XC 1LTID 3BZDB 1SAPA 3I3CA 3S1MB 2PYKA 2NTSA 3GTLB 4A93B 2EY6A 1WTRA 3SHLA 3MXNA 2KCCA 2A73B 1TS5A 2M2LA 4ZKBB 4H7BA 2NWGA 5JAVA 2PZUA 2RDFA 5CV4A 1SEBD 2L9HA 2K32A 3GV3A 1D6EC 3EFXD 1TWAB 3X3NA 2AUKA 5BN4A 1BF4A 4XQQA 1LT5D 4YIJA 1STGA 1LABA 1KLUD 2OT2A 4BY7B 1SSOA 2QF7A 2B2WC 2AWOA 2N88A 1SBBB 2JE6I 1KAAA 1NCVA 1G91A 3NQIA 1ENCA 2Q8RE 1T5XD 2D5DA 3KK7A 3K58A 5I9PA 4I65A 5LL6S 4ZYSA 2B2UC 1X3PA 4H0LC 1PRTD 1TWHB 2E76C 4DGZA 1LTAD 3A7LA 1IYUA 3J81E 3J80E 3GTQB 1MBYA 2XWBB 2NZ1D 5DM63 5DEHA 3Q0AA 1AFPA 4ZUJA 1B9NA 2K03A 1D2BA 5JVG3 1O7ZA 3R93A 1EY6A 2B2VA 4RH6A 1V1OA 3ONAB 5C0XG 4Y7NB 4KMUC 5M9OA 1BBXC 5DM73 4B9XA 1QG7A 4KI0A 1NR2A 3U9SA 2F03A 1IW7C 4LAAA 2F0EA 1M4VA 1DZ1A 3D8GA 4CJ0B 1FD7D 3CRKC 4EVOA 1BOSA 1CA6A 2SNSA 3VYUA 4OIJA 1ZYRD 2JXMB 2FMCA 3HOYB 1CA5A 1PFNA 4KJNA 1H9JA 2F0QA 4K2LA 5A2QL 2XSCA 5CYUA 5M5WB 2LY7A 1I6VC 1EYAA 4IUTA 4ILWA 1E2ZA 3URYA 1PTOH 3E6ZX 3VYTA 1L0XB 4CBVA 2HCIA 1PDQA 2ENBA 2JSOA 1EY8A 3MTSA 3PUYA 3M85A 3S2DB 5I6YA 4XTCS 2ZXRA 2E2IB 5IGBA 1DOKA 4K5XA 4KHZA 4RAUC 1HFGA 2J4XA 1YNJD 2D62A 1STHA 4U68A 2FJ2A 3I4MB 4DK1A 1B1ZA 4KKUA 2E74C 1WTOA 2F4IA 1K83B 3K59A 2IPKD 1I3QB 5IIFA 2CVRA 3BVMA 1EEFD 1H9MA 5HURA 4IUNA 3I73A 2RDGA 5JJZA 1EZ6A 1S5BD 3IL8A 3FMCA 2CHBD 1MI2A 4CJ2C 5IODA 1LT6D 2K5QA 3I90A 2WINB 1XXGA 1S4ZA 3W2DA 1MSGA 2R7ZB 2IJ0A 2Q8TA 1F2YA 1WTVA 2WB1B 2KEDA 1AW7A 2M9VA 4NP5A 4XYQA 1MD2D 5D3IB 1MSHA 2L55A 5CR3A 3MXGA 1QNUA 1LV9A 2CW0C 3P20A 2WKDA 3EA6A 5NUCA 3SEBA 5IT9E 4P2CB 4DN4M 3DWQA 1WTQA 3PIP3 3T4AC 3OIQA 4PQXA 1STBA 5I9OA 3SE0A 4C2MB 1GOZA 2NN6H 3CKIB 5EGTA 1AN8A 4QB4A 3S1RB 1TS4A 1AZPA 2EYLA 1IKLA 2MPMA 4OO1H 1TKWB 2LFNA 4FF1A 4A3GB 4IUQA 4A3BB 3VA5A 2A68D 2JP1A 1ZXTA 1GHKA 1BCPF 2WACA 2O2LD 1M8AA 1DOMA 1EOTA 2F1MA 2F0GA 1BNZA 4K6LA 5CC4A 1GUTA 4KY5A 2I46A 3HP3A 2NYZD 1VMCA 1HQRD 2BA1A 3KLRA 2BE5C 3WOFA 3AMUA 1WTXA 4C3JB 1SYGA 4RHRA 1KABA 5J39A 1R9TB 4R8IA 5J1ZA 1XWEA 1XYIA 4A3FB 1QOHA 3OSOA 4CKEA 2XIWA 2VB3X 4HCEA 4RKLA 1EYCA 3QOJA 2LS01 2B2YA 3K5NA 1DCZA 4IUVA 4C3IB 2BOSA 5T1IA 3LNNA 1JOQA 1BCPB 3QOLA 4K14A 3SK6A 2C9OA 1Q90A 1BO0A 2O5JC 2F0VA 2SDFA 5IGEA 3S17B 5C4XB 4H44C 3C2PA 4XQJA 1BCPC 1O7LA 3TDQA 3X3MA 5IGGA 1JOOA 1STEA 2ICEC 1KNEA 2TMPA 3QJYA 3A56A 1SYEA 2B8FA 1OXVA 4C3JG 3MFGA 1DXMA 1CZWA 4KHVA 1ONLA 1TWFB 5DAUA 1TS2A 2XN9C 2ZT9C 4IUPA 2Q8IB 5TSSA 1TVXA 4RKBA 1JWSD 5EPJA 2F0UA 2OXPA 3T51B 4RFBA 4QCLA 4DXFA 4C1NI 4WRDA 4G7OC 1SYBA 2PW7A 4C3HB 1JQYD 2K6AA 4PMWA 4DAYA 2WP8J 4KN4C 2EYOA 2SOBA 3LWEA 1C8CA 3O13A 3SR1A 1OXTA 1GJXA 2NB0A 1VMPA 1Q1BA 2SEBD 5CORA 2JYOA 1B2TA 4FXGC 1A6XA 3D4RA 2MGSA 5JEAH 1B9MA 3SVMA 3I4NB 2EYMA 4K2KA 2K05A 4RA8A 2BCOA 3OOCA 1RCVD 3FRPB 2RQXA 3M4OB 3I4LA 4RGNA 4C3HG 4K8IA 2L4NA 1I4HA 1PZKD 5JOBA 1U4PA 1GXDC 4TKOB 1CHPD 3EROA 5ELCA 1SFOB 2FINB 3BDLA 2R93B 4O1NA 2EYPA 5ELEA 3TBIB 1TWCB 1AP0A 1GUSA 3NTHA 4HEDA 1PYWD 3I91A 1PTOD 2XRSD 3T56B 5KRUA 3H3VC 1WD1A 3H09A 4K5WA 4XQNA 2QEJC 3JAME 3TMEA 4XIGS 1Y8OB 3IFTA 3LX0A 3R2TA 1I50B 2MUYA 4CKCA 2DN8A 3DMUA 3PUXA 2EYHA 3Q6SA 5EKKA 1QNKA 3A8IE 4LJZC 2VXWA 4HAEA 4JK1C 1C4QA 2IT1A 4DNTB 1Y8NB 3M3YB 3PUWA 1EY0A 3TP7A 2KJXA 5I2XA 5M3MB 1PRTB 3A7AB 3NWTA 4K8JA 2H4OA 2K7VA 2EPBA 2X6LA 1GUOA 3AB9A 3OIPA 1JOKA 4X3SA 2LMCB 2A69D 2F0OA 1Y1WB 1PRTC 5M5YB 4ZLTF 1TT2A 4NW2A 1BUVT 1A3TA 3CRLC 3U9OA 4ZK9B 4BA2I 5IOCA 2HDLA 2BDOA 2F3WA 2O5IC 1U4MA 4KY6A 3A8KE 3GTMB 2X6GA 2OEOA 2K5DA 1A3UA 3P1HA 2Z1CA 1NR4A 4OIKA 2WIIB 1S5ED 4UAIA 5KYIA 1TIID 1RHPA 1UNSA 1ML0D 2KVMA 1C48A 4A3KB 4GZYC 2AQ3B 1JR0D 1LLRD 5CV6A 3E5SA 2KECA 1FR3A 1LT3D 4UDUC 1YNND 2DY8A 1J9OA 2EOTA 1UEAB 4PV1C 2CQAA 3VR4A 1ZYRC 1FGBD 2K04A 1D5ZC 3TP5A 3K6OA 2ZXOA 1A15A 3ND9A 1EIHA 3KUPA 3VA7A 1D1KA 4FP5D 3MZ5A 1TY2A 4C1NK 2B63B 4MHEA 1JORA 2GA4B 3C1EA 4Q5VA 2NUCA 4J6HA 4AYBB 3SK4A 3OWFA 3S14B 1PZJD 4BY1B 1SE4A 4G7ZC 2F0MA 5FKAC 1B50A 5C0XJ 4BWGB 2A6EC 4IFDH 3FEWX 1CM9A 4HTHA 2F0HA 1DOLA 2WAQB 2YYZA 1HCZA 2R61A 3LWUA 1HA5A 2H1EA 4G7HC 5LHY1 3HZXA 3NTKA 4EGVA 1LTBD 4BA1I 1CK1A 1RKNA 3OW7A 3VR2A 2DNCA 2RSNA 2D2CC 2TSSA 1G8ZD 2FFKB 4V190 1RF2D 4IN3A 2EVBA 1SE2A 4OGQC 2L11A 3N52A 1I4XA 2EJFC 2KOLA 1EWHA 1F9RA 2NN6I 4FNFA 4KD3A 3GTKB 3HKZB 3RUZA 2IWHA 3CQZB 4HN7A 2PMZB 4OO1I 5CGKA 2KA7A 1B53A 4KJOA 1IW7D 3SK5A 2HDMA 4G4KA 2J7ZA 1EY7A 2VB2X 3R2IA 3VR3A 5E3FA 4CKBA 2KCNA 4WORA 2PNRC 2F0JA 3I8ZA 4C56C 1V1PA 4DFAA 2MP1A 3NHHA 5I2YA 1OXXK 1ZKOA 1HA6A 1GUGA 1PXUA 2G9DA 1F9SA 4A3EB 3SK8A 4DA2A 3HOXB 1CQFA 1KDBA 3K5MA 4A3MB 5JEAJ 2DNEA 2B2VC 2Z4HA 5C44B 1LO5D 5M5XB 2MHVA 4CHTB 5CMDA 3H91A 5JPMC 1GHJA 1NSNS 3IKJA 1S5CD 4BBSB 1J8IA 3J7AF 1EU3A 1B4OA 3J7AV 4BS9A 4IUUA 1UUPA 4OHJA 2KEEA 1NUCA 1S5FD 1R4PB 2F0NA 2F3VA 1F77A 5ELFA 3ERQA 3JAML 3I72A 4J1MA 5KIXA 5G3LF 4RCOA 4F7XA 1U9RA 3D3RA 5HGTA 1JB3A 3P75A 1CQVA 1RJTA 3KLSX 2J0TD 3D4DA 1QWYA 2I07B 1CT1D 3NUCA 3NK9A 4V0BA 1HUNA 3QWNA 1GUNA 3FVQA 1KDAA 2A5HA 1D1IA 4KD4A 2R3ZA 3BVGA 1QE6A 1UAPA 2WKCA 1SJHD 5C4HA 1Y8PB 2PPBC 2VUMB 3D31A 3BYTB 1V1PB 1SNOA 2YU9B 4RHSA 2E75C 5E4WC 1RD9D 1TR5A 4HMIA 5EPLA 2K28A 5C5LA 2CW0D 3C1FA 5EBCA 3Q22A 1O80A 1ENAA 3Q24A 3A54A 1KLGD 5C0XH 3DUZA 5KNBA 5C3EB 2NVXB 1W6JA 3KF8A 2EY2A 2K1BA 1F9PA 2K5WA 5EKLA 2EZVA 4CGYB 1PLFA 2QCPX 3NPPA 2RKSA 2B8GA 2PO4A 4FXKC 5CV9A 4XDXA 2MJ8A 1PZID 4O42A 1SYDA 4IZ8A 1OO9B 4TRDA 5C3XA 4DNRB 1JWUD 1G291 3HOWB 4NDXA 3J81L 3J80L 4FF2A 3BDCA 4KKTA 4QMGA 1S5DD 5D65A 4B08A 4A3IB 1EWCA 2RSOA 4IQZA 1ILQA 3RLFA 3MHBA 2BE5D 4L8JA 2XVSA 3EVQA 3MC0B 5IGFA 3GTGB 3D4WA 1A2UA 4C3IG 2QILA 1PFBA 2BA0A 3EQLC 1EFID 2RBMA 5A2QE 3RD4A 1VF5C 1Y1VB 1X3QA 3PUZA 3PV0A 3RMHA 4HCSA 1QCBD 1SYCA 3K7AB 2PCFB 3L7ZC 1T5EA 4QF4A 2NVQB 1VDZA 4IFDJ 1PTOB 4HR7B 4U673 3NWSA 5FO9B 5COYA 2PZTA 3NBHA 3D6CA 1PTOC 1BCPD 1I4PA 2PW5A 4DF7A 3DXJC 1KNAA 2E2DC 4KY7A 1A2TA 5JVH3 2F0KA 2RVLA 3K5LA 2A6HC 3K57A 3PO3B 5CV5A 3C46A 3IAYA 1HRJA 1R4QB 1FYCA 1TQOA 3I70A 5LL6X 1F9QA 2B2YC 2M00A 1EQTA 4FF3A 5KGUA 2O4XA 4LK1C 1SMYD 1PRTF 3OMCA 1DYQA 4A3JB 3K0YA 3PMFA 3MEHA 5D14A 1E0BA 4X3TA 3HOVB 4XT3B 1ICWA 4E6IA 1DD2A 2R6GA 2N55A 1WVLA 5CBAE 4XYOA 4Z9CB 5JPNC 1QILA 1HHVA 1Q12A 2KUMA 4NKLA 3QIAA 4ZQ3A 4A3DB 3R8BA 3KLSA 4PNYA 4X3KA 1CTMA 1G2TA 1F2ZA 3GTPB 4ZRZA 2NTTA 1SNDA 1F2MA 1SNMA 1ET6A 2SNMA 2OF1A 2LKVA 3VYSA 1V8QA 5IGDA 1Z47A 2E2JB 3T53B 1II3A 1BQQT 4RGMA 1YNNC 1I4GA 2JA7B 5IT9L 4KN7C 5F2DA 2F0WA 4XT1B 3WOEA 4R9WA 4B9WA 1SXTA 3DWPA 1K8OA 2IX3A 1A3VA 2PZWA 4JBWA 3FKIB 3W3AA 3G6JB 2L12A 3MXUA 3TZUA 1IYVA 1VCIA 1H9RA 4QUFA 3R3OA 1TU2B 1CI3M 2EY5A 1ZEQX 4RGTA 1EEID 4KK7A 1DJRD 3KBXA 3GV6A 3GO5A 2JA8B 3GD7A 2XRQD 1JC7A 4ULLA 3M7GA 3TZDA 3HEJA 5CBEE 1B3AA 2NN6G 4DXGA 5IGCA 2FMMA 1TY0A 1E2VA 2IX1A 1RTNA 3E0JA 3TSSA 4F8MA 4OO1G 3H0GB 2EXZA 1WCMB 2R92B 1LTTD 3GTOB 4WFN3 3HOZB 1AEXA 3OPOA 1GUWA 3PUVA 3QG1A 5KEEA 1EQVA 2L0CA 4FVMA 4RWSC 1HFNA 4F88A 1CZGA 5C3WA 2AQ2B 4HSPA 4ABNA 4I7ZC 1YNJC 5C6AA 2F0TA 2ICIA 1F2LA 1O78A 3SDZA 5T1GA 2AUJD 2ID0A 2D9UA 5I6WA 3FPPA 4PMBA 4WJWA 1WD0A 2K33A 5KNCA 3NE5B 2Y0SB 5C4ZA 4MIUA 1BDOA 3BG3A 3DEPA 4FXDA 1Z6HA 5FOBB 3T13A 3GTJB 1Z7TA 3D6WA 2B2TA 4KKSA 2G9HD 3HRZC 4HMJA 3MAQA 2AWNA 2L1BA 1JE4A 1XX8A 1G6ZA 2QKIC 1FNVA 2F0FA 3MVVA 3WDNA 1I6HB 1SNCA 2AQ1B 3ITPA 2A6ED 4ID6A 5J22A 1W6KA 4N9TA 3SXHA 1FNUA 2XWJB 1MGSA 1H9SA 4DAPA 4IALA 3BYYB 1TWGB 5FLXE 1PMRA 1O7YA 5K36H 3IFDA 1ENFA 3RZOB 1KDCA 1BR9A 1Y69U 5EBDA 3V2TA 1EY9A 1EZ8A 4TQUS 3F2UA 5EPKA 1IL8A 1STAA 2EDGA 1RODA 3EJIA 5C0XI 1FNWA 4F87A 3VR5A 2NBFA 5DNFA 1WTPA 1HTPA 5JEAG 1TS3A 2JA6B 5E1FA 3ZYYX 2EY1A 3S2HB 1V43A 1XTCD 5FO8B 2B39A 2A68C 4CJ1B 3L3OC 3PO2B 1JICA 4QIWB 1IHZA 3J7YW 1SE3A 4M8AA 3S1NB 4FYDA 2NVTB 2PQEA 4J8QA 3DHQA 2KQ3A 5ISRA 4M1UB 3S1QB 2E2HB 3TN2A 1EU4A 3DEOA 2NVYB 2DY7A 5AFWA 1SJED 3DWAA 1LTRD 2B2TC 1PFMA 1EYDA 1SYFA 1EIGA 1STYA 5BN5A 5CV7A 3BVZA 3L9AX 1Q1EA 3BDOA 5EQ0A 4RGOS 1AZQA 3KBGA 3NP8A 3NXWA 3A55A 1Q8IA 1H9SB 3CHBD 2HQEA 3OHXC 1JCKB 1QJOA 4DU9A 3NSWA 2XNAC 5C5MA 1LTGD 5FO7B 3A8JE 1CFMA 4ODGA 3FDTA 2F0LA 4BBRB 1VF7A 5ELBA 3MWYW 1HTLD 3RZDB 5FK9C 2JEAI 1U4LA 2F0IA 4HSVA 2EYJA 1G2SA 1RTOA 5K5PA 4L63B 4EQOA 5EKIA 1ILPA 3H6MA 5KYLA 3GP7A 3G7LA 4X3UA 3Q23A 1WTWA 2IL8A 4ZAIA 3NBIA 1QB5D 4XXEA 4K5VA 5KNDA 1EY4A 4LMQD 4QUCA 2F0PA 1PTOF 2F0SA 3HOUB 1ESRA 3TP8A 2A74C 3QB3A 4Q0FA 2RDHA 3HS0C 1HQMC 2EE1A 1I4QA 2KHSA 2JEBI 3S15B 4PMCA 3N6RA 3S16B 1STNA 3GQBA 2IX0A 2QDBA 5G3LD 4H13C 1KTKA 3UI2A 1H9KA 2JA5B 1SNPA 3NQTA 1NAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5X A;  5I9O A;  1A2T A;  5EKL A;  4DGZ A;  1STA A;  3BDL A;  1SYE A;  5F2D A;  2F0W A;  1STH A;  2F0K A;  5C5M A;  5EGT A;  1RKN A;  3T16 A;  3EJI A;  3OMG A;  5C6A A;  2EYP A;  4ODG A;  4KHV A;  4QB4 A;  5KYI A;  2F0T A;  2F0L A;  2RKS A;  4KV6 A;  5DAU A;  4EQP A;  5CV9 A;  4B9W A;  2EYL A;  1NUC A;  5CV5 A;  1A3V A;  2PZW A;  2F0N A;  2F3V A;  1SYD A;  1SNQ A;  5CV6 A;  5I6W A;  3E5S A;  3ERQ A;  4IZ8 A;  4TRD A;  4RKB A;  4PMB A;  5C3X A;  1TQO A;  2F0I A;  5IIF A;  4KTA A;  5DEH A;  4ME5 A;  5HUR A;  5KRU A;  4IUN A;  2F0D A;  5E1F A;  2F0U A;  3VA5 A;  2EYJ A;  2OXP A;  5C4Z A;  4J1M A;  5KIX A;  5K5P A;  4MIU A;  2M00 A;  4NDX A;  4ZUJ A;  2EY1 A;  4F7X A;  1U9R A;  4KD3 A;  5HGT A;  1EZ6 A;  4K5W A;  3R3O A;  5KGU A;  1EY6 A;  4WRD A;  4EQO A;  3P75 A;  3RUZ A;  2PYK A;  3BDC A;  2WAC A;  4QMG A;  3H6M A;  2O4X A;  2EY6 A;  3TME A;  3SHL A;  2EY5 A;  3TP5 A;  3T13 A;  5KYL A;  5CGK A;  5M9O A;  3LX0 A;  5C3W A;  4B9X A;  1IHZ A;  3OMC A;  4G57 A;  2F0G A;  3D4D A;  5IOD A;  5CC4 A;  4OL7 A;  1SYB A;  2PW7 A;  4KJO A;  3MHB A;  4KY5 A;  3DMU A;  3NUC A;  3PMF A;  2EYH A;  3MEH A;  4EQN A;  3NK9 A;  4HMJ A;  4H7B A;  2EYO A;  3MZ5 A;  5EKK A;  2SOB A;  3SK5 A;  4LAA A;  5JAV A;  2F0E A;  3EVQ A;  2PZU A;  1JOR A;  2RDF A;  3D8G A;  3C1E A;  4E6I A;  1EY7 A;  2PQE A;  3SR1 A;  5IGF A;  2NUC A;  3D4W A;  1A2U A;  4J6H A;  3HEJ A;  4K5V A;  1KDA A;  1EY4 A;  4EVO A;  2RBM A;  3DHQ A;  5E3F A;  4N9P A;  2F0P A;  2KQ3 A;  2SNS A;  5CV4 A;  4KD4 A;  4WOR A;  2F0S A;  4K6D A;  3SK4 A;  5IGC A;  5ISR A;  2F0F A;  2F0J A;  1F2Y A;  3MVV A;  1EY0 A;  3OWF A;  3TP7 A;  1SYG A;  1KAB A;  3TP8 A;  5C4H A;  4DFA A;  5J39 A;  3QB3 A;  4F8M A;  1EY5 A;  4KJN A;  3NHH A;  4NKL A;  1SYC A;  2F0M A;  5J1Z A;  1SNC A;  4K8J A;  1EYD A;  2F0Q A;  1SNO A;  1SYF A;  4NP5 A;  4K2L A;  2EXZ A;  4ZQ3 A;  1STY A;  3ITP A;  4ID6 A;  5J22 A;  3TP6 A;  5CV8 A;  4PNY A;  5CR3 A;  2KHS A;  4N9T A;  3SK8 A;  1EYA A;  1TR5 A;  3OSO A;  1JOK A;  4NMZ A;  4QF4 A;  3SXH A;  5CV7 A;  1KDB A;  2F0O A;  2EYM A;  4HMI A;  1EYC A;  3QOJ A;  1F2Z A;  4K2K A;  4PMC A;  4HTH A;  4RKL A;  4YIJ A;  1STG A;  1AEX A;  1TT2 A;  5C5L A;  2F0H A;  3NP8 A;  1JOQ A;  1STN A;  3C1F A;  3NXW A;  1A3T A;  3U9O A;  4R8N A;  1SND A;  1ENA A;  3QOL A;  4IAL A;  4K14 A;  3MXP A;  2ENB A;  5KEE A;  5IOC A;  1EQV A;  1EY8 A;  4K8I A;  2QDB A;  3SK6 A;  1F2M A;  2F3W A;  5NUC A;  1SNM A;  2SNM A;  5I6Y A;  1KAA A;  2LKV A;  2OF1 A;  4KY6 A;  1ENC A;  2PZT A;  5JOB A;  1KDC A;  2F0V A;  2OEO A;  3D6C A;  5I9P A;  5IGB A;  2HQE A;  1SNP A;  2PW5 A;  1NSN S;  4I65 A;  4ZUI A;  5IGE A;  3V2T A;  3ERO A;  4S3S A;  2EY2 A;  4DF7 A;  1EY9 A;  5IGD A;  1EZ8 A;  5IGG A;  1JOO A;  3HZX A;  2EYF A;  3NQT A;  1A3U A;  1II3 A;  4DU9 A;  1STB A;  3P1H A;  3S9W A;  4KY7 A; 
#chains in the Genus database with same CATH topology
 2VNU D;  4N8X 1;  3VR6 A;  4X66 Q;  3DM3 A;  2EJG C;  3HOU G;  2K52 A;  2N8N A;  3PIO 3;  3A5U A;  3V05 A;  4EQP A;  3T1Y Q;  3ND8 A;  2IW3 A;  1BXT A;  1SMY C;  3P7J A;  1HR0 Q;  1EL0 A;  1NBW A;  2RA4 A;  2E2I H;  1ET9 A;  1HUM A;  3MA2 B;  4R4I A;  3AU7 A;  4IFD G;  1Q86 C;  2BDN A;  4IUR A;  2YTX A;  4FF4 A;  1N32 L;  1WJJ A;  2F0D A;  4RCN A;  2HCC A;  1LTS D;  3GTK H;  4K0K Q;  2KCM A;  4ZKC B;  2ZTD A;  1NMG A;  1Q3L A;  3CQZ H;  3M7N A;  2MO1 A;  4UP8 A;  1D5M C;  2JA5 G;  4G57 A;  1LAC A;  2HUG A;  3HGB A;  1K83 H;  4OL7 A;  4DV1 L;  4LF4 Q;  1SDF A;  1WFQ A;  5A35 A;  1I3Q H;  4EQN A;  1U4R A;  2MNA A;  4YWK A;  5EJW A;  1VQ8 A;  3NTI A;  3FPU B;  1RDP D;  5D3D A;  2D0O A;  3K5O A;  1VQ4 A;  4BXX G;  4IPC A;  2L5T A;  1IKM A;  3DLL A;  4N9P A;  2Z8L A;  4YY3 L;  4K6D A;  5H1S E;  1B44 D;  3H94 A;  2XGT A;  3I2Z A;  1KD1 C;  4LFA L;  2B2W A;  1ESF A;  4DR1 Q;  4EQ5 A;  1EY5 A;  3M4Y A;  3DM1 A;  2X69 A;  2K01 A;  1C0A A;  3V96 A;  5C4J B;  1UWV A;  2QDL A;  3C3L A;  1JJG A;  2UUA Q;  1E2W A;  4PZ7 A;  2HIX A;  5CV8 A;  3TP6 A;  4APV A;  5M3F B;  2WV6 D;  1LT4 D;  5FLX L;  3HOX H;  4NMZ A;  1OXS C;  3QO2 A;  2C5C A;  2R7Z H;  2B2U A;  2A69 C;  1HPC A;  1K8M A;  3MFY A;  4TSS A;  1DM0 B;  1YJW A;  1HXY D;  2QA4 A;  1L0Y B;  4HJA A;  4R8N A;  1EWI A;  2EJM A;  3MXP A;  3CU7 A;  2DGY A;  2V4D A;  4X64 Q;  2K5V A;  5E4X A;  4DUZ L;  2Z4I A;  5BN3 A;  5ELD A;  4DK0 A;  4QIW E;  1I4R A;  2UXC L;  3E9I A;  1WI5 A;  4ZUI A;  1SN8 A;  4S3S A;  4AH6 A;  4LF4 L;  2EYF A;  2ZXP A;  4MNO A;  3S9W A;  4L6T B;  5I4D A;  3TQY A;  1JWM D;  3T16 A;  4DR4 L;  4JI3 Q;  3OMG A;  3OWE B;  4QL5 A;  1OXU A;  3I7F A;  1ASY A;  2A6H D;  1CHQ D;  4KV6 A;  4MN3 A;  5K36 G;  2FHT A;  1VQK A;  4FO2 A;  1X32 A;  1SNQ A;  5M3F G;  3HG9 A;  3W1B A;  4IFD I;  4KTA A;  4ME5 A;  5IP7 H;  3VYR A;  1DON A;  4DAV A;  3BS1 A;  1D5X C;  2UUA L;  1LTI D;  3BZD B;  1SAP A;  3I3C A;  5ELO A;  2UXD Q;  1UEB A;  3S1M B;  2PYK A;  2NTS A;  3GTL B;  4A93 B;  3S1R H;  2EY6 A;  1WTR A;  3SHL A;  3MXN A;  2KCC A;  2A73 B;  3PIO A;  1FVI A;  1HNW L;  1TS5 A;  2M2L A;  4ZKB B;  1AH9 A;  4H7B A;  2NWG A;  5E7N A;  5JAV A;  1KL9 A;  2PZU A;  4A3B H;  2RDF A;  4GKK Q;  1MJE A;  1W3S A;  1N33 L;  5CV4 A;  2L9H A;  1SEB D;  1K3B C;  1X56 A;  2IHF A;  2K32 A;  3GV3 A;  1BVS A;  1D6E C;  2CCZ A;  1X54 A;  2VUM H;  3EFX D;  4JVZ A;  1TWA B;  5J3B A;  3X3N A;  3CME A;  2AUK A;  2YU9 H;  5BN4 A;  1BF4 A;  3KDF A;  1P8L A;  4XQQ A;  1LT5 D;  2Q2T A;  4YIJ A;  1STG A;  1FJG Q;  1LAB A;  4OWW B;  1KLU D;  2OT2 A;  4BY7 B;  1SSO A;  1HZA A;  2QF7 A;  3NEM A;  1YJN A;  2B2W C;  2AWO A;  1B70 B;  2N88 A;  4C3J H;  1SBB B;  2LXJ A;  5BR8 Q;  2JE6 I;  2UXD L;  1KAA A;  1NCV A;  1G91 A;  3NQI A;  2NVX H;  1ENC A;  2Q8R E;  1T5X D;  2D5D A;  3KK7 A;  3K58 A;  5I9P A;  4A3F H;  4I65 A;  5LL6 S;  1VQL A;  4ZYS A;  2B2U C;  3EN2 A;  1X3P A;  4H0L C;  1PRT D;  1TWH B;  1CSQ A;  4POF A;  2E76 C;  4DGZ A;  4C3I H;  1LTA D;  1FL0 A;  1DGS A;  5GQO A;  1X3G A;  4GKK L;  1XNR Q;  2CWP A;  3A7L A;  1IYU A;  3J81 E;  3J80 E;  3GTQ B;  1MBY A;  2XWB B;  3JC6 6;  2NZ1 D;  5DM6 3;  5DEH A;  3Q0A A;  2K50 A;  1AFP A;  3HOW H;  2HQL A;  2WFW A;  3H3V I;  4PZ6 A;  4ZUJ A;  1B9N A;  2K03 A;  1D2B A;  4IO9 A;  5JVG 3;  1O7Z A;  2VZA A;  3R93 A;  1EY6 A;  4DR5 L;  2B2V A;  4RH6 A;  4QQB X;  4A3I H;  1V1O A;  4QY7 A;  3ONA B;  5C0X G;  4Y7N B;  1TWF H;  4KMU C;  3RLO A;  5M9O A;  1BBX C;  5DM7 3;  4B9X A;  4B3M L;  1QG7 A;  4KI0 A;  4JI5 Q;  1NR2 A;  4CDD C;  3U9S A;  2PI2 E;  5HGQ A;  3STB C;  3MXN B;  2F03 A;  3E9H A;  5FJ8 H;  1IW7 C;  4LAA A;  5BR8 L;  2F0E A;  3KYH C;  3K7U C;  1M4V A;  3GTG H;  1DZ1 A;  3D8G A;  4CJ0 B;  1FD7 D;  3CRK C;  4EVO A;  1BOS A;  3WWV A;  1XPO A;  1YHB A;  1CA6 A;  2SNS A;  5IYD G;  3VYU A;  2KHI A;  4OIJ A;  1ZYR D;  1Y1V H;  2JXM B;  2FMC A;  3HOY B;  1CA5 A;  1PFN A;  4KJN A;  1PH2 A;  1QVG A;  1H9J A;  2I5L X;  1S3O A;  3K7A H;  5FLM G;  4GKJ L;  2F0Q A;  4K2L A;  5A2Q L;  2XSC A;  5CYU A;  1MJC A;  5M5W B;  2LY7 A;  1I6V C;  1K3R A;  1EYA A;  2P5Z X;  4IUT A;  4ILW A;  4LF7 Q;  2NVQ H;  1PA6 A;  4DR3 Q;  1E2Z A;  3URY A;  1PTO H;  5DLQ E;  3E6Z X;  3KDF B;  3VYT A;  1HNZ Q;  1L0X B;  1WYD A;  4HIK A;  4CBV A;  2HCI A;  1PDQ A;  2ENB A;  1X3F A;  2JSO A;  4DV6 L;  1EY8 A;  3MTS A;  3PUY A;  3M85 A;  3L0O A;  3S2D B;  5I6Y A;  4QJF A;  2ZJR A;  4XTC S;  2ZXR A;  2E2I B;  5IGB A;  1DOK A;  1NAP A;  2Y0S G;  4LFB L;  4K5X A;  4KHZ A;  4RAU C;  1HFG A;  4A75 A;  1RIP A;  2J4X A;  1YNJ D;  2D62 A;  5IYC H;  3BZC A;  1STH A;  4U68 A;  3HOY G;  2FJ2 A;  3I4M B;  4DK1 A;  1HR0 W;  1B1Z A;  4KKU A;  3M4O H;  2E74 C;  1WTO A;  2F4I A;  3ULP A;  1K83 B;  3K59 A;  2IPK D;  4X6A H;  1I3Q B;  1S40 A;  5IIF A;  2CVR A;  3BVM A;  1EEF D;  1H9M A;  5HUR A;  1Q82 C;  4IUN A;  3I73 A;  4A3L H;  1XPU A;  2RDG A;  3FP9 A;  5JJZ A;  4N8F A;  1YIJ A;  1N36 Q;  2R93 H;  1EZ6 A;  1S5B D;  4DR7 L;  3IL8 A;  4YHH Q;  3PGZ A;  3FMC A;  1B8A A;  3TS0 A;  2CHB D;  1GM5 A;  2N49 A;  1MI2 A;  4CJ2 C;  5IOD A;  4A3J H;  1LT6 D;  2K5Q A;  3I90 A;  3HOV H;  4JYA Q;  1K73 C;  4DV7 Q;  2WIN B;  1XXG A;  4B3S Q;  1S4Z A;  3W2D A;  1MSG A;  2R7Z B;  1SMX A;  1KIX A;  1C9O A;  2IJ0 A;  3I4M G;  2CFM A;  2Q8T A;  1F2Y A;  1WTV A;  4LUZ A;  4NXN L;  2WB1 B;  2YTY A;  1I50 H;  2KED A;  1AW7 A;  2M9V A;  4NP5 A;  1XNQ L;  4A3D H;  1BBW A;  4XYQ A;  1MD2 D;  4RG1 A;  5D3I B;  1MSH A;  2L55 A;  5CR3 A;  3MXG A;  3OTO L;  1QNU A;  4CDF C;  3GTP H;  1EUJ A;  2K5N A;  1VQN A;  4LF9 Q;  1I94 Q;  4JI2 Q;  1LV9 A;  4YCW A;  3P20 A;  2CW0 C;  5M3M H;  2WKD A;  3D0F A;  4GN3 B;  1N36 L;  1HZC A;  3EA6 A;  5NUC A;  4JI6 L;  3SEB A;  4WJ4 A;  3J7Z C;  5IT9 E;  4P2C B;  4DN4 M;  3DWQ A;  2JA6 G;  1WTQ A;  3PIP 3;  3T4A C;  3OIQ A;  4PQX A;  4DR2 Q;  1STB A;  1A8V A;  5I9O A;  2JA7 H;  3SE0 A;  4C2M B;  1GOZ A;  2NN6 H;  3CKI B;  5EGT A;  1GKH A;  2WB1 G;  1M1K C;  4B3S L;  2B3G A;  1AN8 A;  1MKH A;  4ME3 A;  4QB4 A;  2OWO A;  3S1R B;  1TS4 A;  2UU9 Q;  1AZP A;  4JI4 Q;  2EYL A;  1IKL A;  2MPM A;  4OO1 H;  3FKI H;  1EYG A;  1TKW B;  2LFN A;  1N34 Q;  4IPD A;  4IOA A;  4FF1 A;  4A3G B;  4IUQ A;  4A3B B;  3VA5 A;  3B6Y A;  5IWA L;  1PH3 A;  2A68 D;  2JP1 A;  1ZXT A;  3LGJ A;  1GHK A;  1BCP F;  2WAC A;  2O2L D;  1M8A A;  1DOM A;  4A3K H;  4OWX B;  1EOT A;  4JI2 L;  2F1M A;  2F0G A;  1BNZ A;  4K6L A;  5CC4 A;  4YCU A;  3A74 A;  1GUT A;  4KY5 A;  1SR3 A;  1EQQ A;  2I46 A;  2K5H A;  2JA8 H;  3HP3 A;  2NYZ D;  4LUO A;  1VMC A;  1HQR D;  2BA1 A;  3KLR A;  2BE5 C;  3WOF A;  3AMU A;  5GAD C;  1WTX A;  5JJL A;  1VQ6 A;  4C3J B;  1SYG A;  1QZG A;  4RHR A;  1KAB A;  1JT8 A;  1VQE A;  5J39 A;  3H0G H;  1R9T B;  4R8I A;  3KJO A;  5J1Z A;  3AQQ A;  4IPG A;  2ATW A;  4A3G G;  1XWE A;  1XYI A;  3I55 A;  4A3F B;  3BU2 A;  1WCM H;  2R92 H;  1QOH A;  2B63 H;  3OSO A;  3GTO H;  4CKE A;  3HOZ H;  2XIW A;  2VB3 X;  4HCE A;  4RKL A;  1EYC A;  2DJG C;  2LS0 1;  3QOJ A;  2B2Y A;  3AEV A;  3K5N A;  3KJP A;  1DCZ A;  4IUV A;  4C3I B;  2BOS A;  5T1I A;  1G51 A;  3LNN A;  1JOQ A;  4R4Q A;  1BCP B;  5GAG C;  1X6O A;  3QOL A;  4K14 A;  4BY1 H;  4B3T Q;  3E3X A;  3SK6 A;  2C9O A;  5IYB G;  1Q90 A;  1BO0 A;  2O5J C;  2F0V A;  3L2P A;  2SDF A;  5IGE A;  3S17 B;  5C4X B;  4H44 C;  4HJ5 A;  3U50 C;  3U4V A;  4XQJ A;  3C2P A;  1BCP C;  1O7L A;  3TDQ A;  3X3M A;  5IGG A;  1JOO A;  1STE A;  4DAM A;  3BZK A;  3TRE A;  2ICE C;  1KNE A;  2TMP A;  3QJY A;  3A56 A;  1SYE A;  2B8F A;  4GNX C;  1OXV A;  4C3J G;  2Y0S E;  3MFG A;  1DXM A;  1CZW A;  4KHV A;  1ONL A;  1TWF B;  5DAU A;  1IYJ B;  1TS2 A;  2XN9 C;  2ZT9 C;  3M4Q A;  4IUP A;  3CC2 A;  2Q8I B;  5TSS A;  1TVX A;  4RKB A;  1IBL Q;  1JWS D;  2VQF L;  5EPJ A;  2F0U A;  2OXP A;  3T51 B;  1Q81 C;  4RFB A;  4QCL A;  4DXF A;  4C1N I;  5IE8 A;  4WRD A;  2CH4 W;  4HJ9 A;  3KF6 A;  4G7O C;  4DPG A;  5C4X G;  1SYB A;  2PW7 A;  4C3H B;  1N8R C;  2UUB Q;  1JQY D;  2K6A A;  4PMW A;  2WP8 J;  4DAY A;  4KN4 C;  2EYO A;  3CCM A;  2MFI A;  2SOB A;  3LWE A;  2R7D A;  1C8C A;  3O13 A;  4HJ8 A;  3SR1 A;  3CPF A;  1VQD A;  1NE3 A;  1OXT A;  1GJX A;  2NB0 A;  1B7Y B;  1VMP A;  1SRU A;  1Q1B A;  4NXM L;  2SEB D;  5COR A;  2JYO A;  1B2T A;  1I6H H;  4R4T A;  2GVA A;  1MHW C;  1HNX L;  1IXR A;  4EX5 A;  4FXG C;  1A6X A;  3D4R A;  1FGU A;  2MGS A;  1KAW A;  5JEA H;  1TXY A;  1B9M A;  3SVM A;  3I4N B;  2EYM A;  4K2K A;  2K05 A;  4RA8 A;  2C35 B;  2BCO A;  1IBL L;  2A8V A;  1J5E Q;  5IT9 c;  3OOC A;  1MIU A;  1RCV D;  2ES2 A;  3FRP B;  1TWG H;  2RQX A;  3CXC A;  3M4O B;  3CCQ A;  3I4L A;  4RGN A;  1VQB A;  3M9B A;  4C3H G;  4K8I A;  2L4N A;  1I4H A;  4X66 L;  1PZK D;  2AKW B;  3RZO H;  1EIF A;  5JOB A;  1U4P A;  1GXD C;  4TKO B;  2KEN A;  5ELN A;  4GOP A;  1CHP D;  1K0S A;  3T1Y L;  3ERO A;  4A3E H;  4OON A;  1VQM A;  5ELC A;  3PSI A;  1KRT A;  1HR0 L;  1SFO B;  2FIN B;  1VQJ A;  4A3M H;  3BDL A;  2R93 B;  2D0P A;  4O1N A;  5C44 H;  1PH4 A;  2EYP A;  1K8A C;  5M5X H;  1YVC A;  4HIM A;  4Y52 H;  5ELE A;  3TBI B;  1TWC B;  4K0K L;  1AP0 A;  1GUS A;  2WB1 E;  3NTH A;  1PYW D;  4HED A;  2LSS A;  2BH8 A;  3I91 A;  1PTO D;  4H02 A;  1Y14 B;  2XRS D;  2NZH A;  3I4N G;  3T56 B;  5KRU A;  3H3V C;  4BBS H;  3A5Z B;  2CWA A;  1WD1 A;  2F4V Q;  3H09 A;  3S2H H;  5AJ3 Q;  4K5W A;  4XQN A;  1XPR A;  1EQR A;  2QEJ C;  3JAM E;  3TME A;  4XIG S;  3PO2 H;  1Y8O B;  3IFT A;  3LX0 A;  2ALY B;  3R2T A;  1I50 B;  2MUY A;  4CKC A;  1NJI C;  1J5E L;  2DN8 A;  3F2B A;  1VQF A;  2E5L Q;  3S1N H;  3DMU A;  3PUX A;  2EYH A;  3Q6S A;  3A0J A;  5EKK A;  3KF6 B;  4DR1 L;  3A8I E;  4DAY B;  2IHE A;  4LJZ C;  2VXW A;  4HAE A;  4JI1 Q;  4JK1 C;  1C4Q A;  2E2H H;  2IT1 A;  4DNT B;  1Y8N B;  3M3Y B;  2NVY H;  3PUW A;  1EY0 A;  3TP7 A;  2KJX A;  4TVA B;  5I2X A;  5M3M B;  1PRT B;  2GVB A;  3A7A B;  3NWT A;  4K8J A;  4P74 A;  2H4O A;  4KHP Q;  3KFU A;  2K7V A;  2EPB A;  2X6L A;  3OYY A;  1GUO A;  3AB9 A;  4R4O A;  3OIP A;  5EAY A;  4X64 L;  3GDE A;  1JOK A;  4X3S A;  2LMC B;  2OTL A;  2A69 D;  2F0O A;  1Y1W B;  1PRT C;  5M5Y B;  1E3P A;  2JQO A;  4ZLT F;  1TT2 A;  4NW2 A;  1BUV T;  1A3T A;  3CRL C;  3U9O A;  2UXB Q;  4ZK9 B;  1HZB A;  4BA2 I;  1A63 A;  5IOC A;  2HDL A;  2KHJ A;  2BDO A;  2F3W A;  2O5I C;  1U4M A;  1JJ2 A;  4KY6 A;  3A8K E;  3GTM B;  4JI3 L;  2X6G A;  4OXP A;  2OEO A;  3QR8 A;  2K5D A;  1LUZ A;  1YHA A;  1A3U A;  2LXK A;  1L2F A;  3P1H A;  2Z1C A;  3CC7 A;  3HKS A;  4GOP B;  1NR4 A;  4OIK A;  1IZ6 A;  2WII B;  1S5E D;  4A93 G;  4UAI A;  5KYI A;  1TII D;  1RHP A;  1UNS A;  4BBR H;  1ML0 D;  2KVM A;  1C48 A;  4A3K B;  4GZY C;  2AQ3 B;  1JR0 D;  5C3E H;  1LLR D;  5CV6 A;  3E5S A;  1T9H A;  2KEC A;  1Y1W G;  1FR3 A;  1LT3 D;  4UDU C;  1YNX A;  2MQH A;  1YNN D;  2DY8 A;  1J9O A;  2EOT A;  3PF5 A;  1CKM A;  1UEA B;  4PV1 C;  2CQA A;  3VR4 A;  1ZYR C;  4CDE C;  2VQE Q;  1FGB D;  2K04 A;  1D5Z C;  3TP5 A;  4A3C H;  1D7Q A;  3K6O A;  2ZXO A;  1A15 A;  3ND9 A;  1EIH A;  3KUP A;  3VA7 A;  4DV4 Q;  1D1K A;  1XTD A;  4FP5 D;  3MZ5 A;  1TY2 A;  5LMN Q;  4C1N K;  2B63 B;  4MHE A;  1JOR A;  3CF5 A;  2GA4 B;  3C1E A;  4Q5V A;  2NUC A;  4J6H A;  2Z6B A;  3PF4 A;  4BY7 G;  3CCS A;  4AYB B;  2F52 A;  3SK4 A;  3UDI A;  2NZO A;  3OWF A;  3S14 B;  2JN4 A;  1PZJ D;  2EXD A;  4BY1 B;  1SE4 A;  4G7Z C;  1FJG L;  1OTC A;  2F0M A;  5FKA C;  1B50 A;  5C0X J;  4BWG B;  2HT1 A;  3J81 j;  2A6E C;  4O2D A;  4IFD H;  1NY4 A;  3S15 H;  3FEW X;  4JBM A;  1E1O A;  4LWC A;  4MZ9 A;  1CM9 A;  4HTH A;  3CD6 A;  2F0H A;  4ZCK A;  1DOL A;  3RLN A;  2OQK A;  2WAQ B;  2YYZ A;  1O7I A;  2I5H A;  3ULJ A;  2A19 A;  5IP9 G;  1I5F A;  2QW7 A;  1HCZ A;  4LF8 Q;  2R61 A;  2HHH Q;  2JA5 H;  3LWU A;  2B63 G;  1HA5 A;  2RCF A;  2JJQ A;  1ASZ A;  1XMO Q;  1XNR L;  4DV5 Q;  2H1E A;  4G7H C;  5LHY 1;  3T1H Q;  3HZX A;  4AYB G;  3NTK A;  4EGV A;  5LMN L;  1LTB D;  4LUV A;  4BA1 I;  1CK1 A;  1RKN A;  3OW7 A;  3VR2 A;  2DNC A;  1UE6 A;  3G48 A;  2RSN A;  4IJL A;  2D2C C;  2TSS A;  1G8Z D;  2FFK B;  4V19 0;  3AFQ A;  4IJH A;  5JJI A;  1RF2 D;  4IN3 A;  2EVB A;  3HFZ B;  2AMC B;  1SE2 A;  4DKA C;  4OGQ C;  2L11 A;  3N52 A;  1I4X A;  2EJF C;  1V1Q A;  2KOL A;  1L0W A;  1CSP A;  2DUD A;  1EWH A;  3JAM c;  1F9R A;  4JI5 L;  2NN6 I;  4FNF A;  2ZM6 Q;  4L5S A;  4KD3 A;  3GTK B;  2WAQ G;  1HH2 P;  3HKZ B;  4P75 A;  3RUZ A;  2IWH A;  4R1J A;  3CQZ B;  4HN7 A;  4X65 Q;  2PMZ B;  1IBM Q;  4FDB A;  4OO1 I;  5CGK A;  3PO3 H;  2KA7 A;  3STB D;  1B53 A;  4KJO A;  1IW7 D;  3SK5 A;  2HDM A;  4GS3 A;  4G4K A;  2J7Z A;  1EY7 A;  2Z0S A;  4YWM A;  2VB2 X;  3R2I A;  3VR3 A;  4DV5 L;  5E3F A;  4CKB A;  2KCN A;  4WOR A;  1AE3 A;  2PNR C;  2F0J A;  3I8Z A;  2ZTE A;  4C56 C;  1V1P A;  4LF7 L;  4DR3 L;  3CW2 C;  4JI8 Q;  4DFA A;  2MP1 A;  2JA9 A;  3NHH A;  5I2Y A;  1OXX K;  5C4J H;  1HNZ L;  1ZKO A;  2CKZ B;  1HA6 A;  5M3F H;  1GUG A;  1PXU A;  2G9D A;  1F9S A;  4A3E B;  1SRO A;  3SK8 A;  4DA2 A;  3HOX B;  1CQF A;  3HKZ G;  1KDB A;  3RN2 A;  3K5M A;  1ICF B;  4A3M B;  5JEA J;  4WJ3 M;  1XMQ Q;  2DNE A;  3M4P A;  2B2V C;  2Z4H A;  4R4C A;  1LO5 D;  5C44 B;  1E22 A;  2H5X A;  5M5X B;  2MHV A;  4CHT B;  4OX9 Q;  2ZM6 L;  4JV5 Q;  2CQO A;  5CMD A;  3H91 A;  4LF6 Q;  5JPM C;  1GHJ A;  1NSN S;  3IKJ A;  1S5C D;  2E8G A;  2R7F A;  4BBS B;  4AQY Q;  1J8I A;  3J7A F;  1EU3 A;  1LM0 A;  1B4O A;  3CPW A;  3J7A V;  4BS9 A;  4IUU A;  1UUP A;  4OHJ A;  1A0I A;  1NUC A;  1S5F D;  2KEE A;  1R4P B;  4JOI A;  2F0N A;  2F3V A;  3UDF A;  1F77 A;  4YHH L;  1KRS A;  5ELF A;  3ERQ A;  3JAM L;  3HOX G;  2R7Z G;  3RNU A;  3I72 A;  4A3M G;  2E2J H;  4J1M A;  5KIX A;  5G3L F;  4RCO A;  4F7X A;  1U9R A;  3D3R A;  5HGT A;  2Z6K A;  1JB3 A;  4JG2 A;  4DV7 L;  3TRZ A;  4JYA L;  3J81 c;  3J80 c;  3P75 A;  1CQV A;  1RJT A;  3KLS X;  1PH7 A;  1KXL A;  2J0T D;  3D4D A;  4UHV A;  3SGI A;  1QWY A;  1BKB A;  2I07 B;  1CT1 D;  3NUC A;  1BBU A;  3NK9 A;  4BBS G;  4V0B A;  3Q8D A;  1HUN A;  3QWN A;  1GUN A;  3FVQ A;  1KDA A;  2A5H A;  1D1I A;  1PH1 A;  4KD4 A;  1QVC A;  2R3Z A;  3BVG A;  1QE6 A;  1PHJ A;  1UAP A;  4AQY L;  2WKC A;  1SJH D;  5C4H A;  2OTJ A;  1Y8P B;  2PPB C;  2VUM B;  4LF9 L;  1I94 L;  2N3S A;  3D31 A;  3BYT B;  1V1P B;  1SNO A;  2YU9 B;  2Q2I A;  4RHS A;  5IP7 G;  1HZ9 A;  2E75 C;  5E4W C;  1YBY A;  1RD9 D;  1TR5 A;  4HMI A;  5EPL A;  2K28 A;  5C5L A;  2CW0 D;  3C1F A;  5EBC A;  1KHI A;  1L1O A;  3Q22 A;  1O80 A;  4DR2 L;  1LYL A;  1ENA A;  3Q24 A;  3A54 A;  1KLG D;  5C0X H;  1IBK Q;  3DUZ A;  3FHW A;  5KNB A;  4OEM B;  5C3E B;  2NVX B;  4JBJ A;  1W6J A;  4OWT B;  4A3B G;  3KF8 A;  2QEX A;  2UU9 L;  2EY2 A;  4JI4 L;  1CKO A;  2I5M X;  1TWH H;  3PCO B;  2K1B A;  1M90 C;  1F9P A;  2K5W A;  3UE0 A;  5EKL A;  3U58 A;  2EZV A;  1N34 L;  4DK3 C;  4CGY B;  2VUM G;  5IYD H;  3RR5 A;  2HD3 A;  4AYB E;  4DNI A;  1PLF A;  2L15 A;  2QCP X;  3NPP A;  1K9M C;  2RKS A;  2B8G A;  2PO4 A;  4FXK C;  5CV9 A;  4DV2 Q;  4XDX A;  2MJ8 A;  1PZI D;  4O42 A;  1P16 A;  3AFP A;  1SYD A;  4IZ8 A;  1OO9 B;  3I56 A;  5FLM H;  1NNX A;  1PYB A;  3IRB A;  4TRD A;  5C3X A;  3CC4 A;  2BH2 A;  2B29 A;  4DNR B;  1PFS A;  3NEL A;  1JWU D;  1G29 1;  4UP9 A;  3HOW B;  2VW9 A;  4NDX A;  4GLV B;  3J81 L;  3J80 L;  4FF2 A;  4L5Q A;  5LMU Q;  3BDC A;  4KKT A;  4QMG A;  1QVF A;  3F8T A;  1S5D D;  5D65 A;  4B08 A;  4A3I B;  5C3E G;  1EWC A;  4JOI C;  1CKN A;  2RSO A;  4IQZ A;  2WAQ E;  1ILQ A;  2A1A A;  5LMN W;  4JCV E;  3RLF A;  4A3F G;  1VQG A;  3MHB A;  1WTH A;  2K4K A;  2BE5 D;  4L8J A;  2XVS A;  4JPB W;  3EVQ A;  2QGQ A;  3MC0 B;  5IGF A;  3GTG B;  3D4W A;  1A2U A;  4C3I G;  2QIL A;  1PFB A;  2BA0 A;  3EQL C;  1EFI D;  3K0X A;  3G4S A;  2RBM A;  1N9W A;  3PIP A;  5A2Q E;  1VQ9 A;  3RD4 A;  3CMA A;  3HOY H;  1VF5 C;  1Y1V B;  2I0Q A;  1X3Q A;  3PUZ A;  2ZTC A;  3PV0 A;  3RMH A;  4HCS A;  3GTJ H;  1QCB D;  1SYC A;  4DK6 C;  4UY8 C;  1PVO A;  2FXQ A;  3K81 C;  3K7A B;  2PCF B;  3L7Z C;  1VQC A;  4HIO A;  1YIT A;  4B3T L;  1T5E A;  3HOW G;  5L37 A;  4QF4 A;  2N78 A;  4LFA Q;  2NVQ B;  1VDZ A;  4IFD J;  1PTO B;  4HR7 B;  3G71 A;  4A3I G;  4LW1 A;  4U67 3;  3HKZ E;  3S2D H;  3NWS A;  5FO9 B;  2PMZ E;  5FJ8 G;  1L1O B;  5COY A;  5LMU L;  2PZT A;  3NBH A;  4PG3 A;  3D6C A;  1PTO C;  1BCP D;  1I4P A;  2PW5 A;  1VQO A;  4DF7 A;  3DXJ C;  1KNA A;  4DV3 Q;  2E2D C;  4KY7 A;  1A2T A;  3EBE A;  3KF8 B;  4DUZ Q;  3KOJ A;  5JVH 3;  1Y1V G;  2F0K A;  1EFW A;  3I4M H;  1L1O C;  1GD7 A;  2RVL A;  2UXC Q;  3K5L A;  1UE1 A;  2A6H C;  3K57 A;  3PO3 B;  5CV5 A;  4DUY Q;  3C46 A;  3IAY A;  1HRJ A;  3G6E A;  1R4Q B;  1FYC A;  1TQO A;  3VDY A;  4DR4 Q;  3I70 A;  4YCV A;  3UE1 A;  3ZJY C;  5LL6 X;  4GLX A;  1F9Q A;  2B2Y C;  2M00 A;  1EQT A;  2UUB L;  2YTV A;  4FF3 A;  5KGU A;  4LF5 Q;  2O4X A;  2RHS B;  2KBN A;  4LK1 C;  1SMY D;  4P71 A;  1PRT F;  1LTL A;  3OMC A;  1PV4 A;  1DYQ A;  4A3J B;  3K0Y A;  3PMF A;  3MEH A;  3UDG A;  5D14 A;  1PH6 A;  1CKN B;  1E0B A;  4X3T A;  3HOV B;  4XT3 B;  2JA6 H;  1ICW A;  4E6I A;  1DD2 A;  2R6G A;  5IYC G;  2N55 A;  1WVL A;  1HNW Q;  4B3R Q;  5CBA E;  4XYO A;  4DV3 L;  3NEN A;  3PO3 G;  1D8L A;  4Z9C B;  5JPN C;  3TEH B;  1QIL A;  1HHV A;  1Q12 A;  1QUQ A;  2ZJQ A;  2KUM A;  4NKL A;  1VQ7 A;  3KLW A;  3QIA A;  3TS2 A;  4ZQ3 A;  3F2C A;  4A3D B;  4J15 A;  3R8B A;  3KLS A;  1N33 Q;  2NVT H;  4A3L G;  2PNH A;  4PNY A;  4DUY L;  4X3K A;  1U5K A;  4MTK A;  1CTM A;  1UE7 A;  1G2T A;  2R93 G;  4YWL A;  1F2Z A;  3GTP B;  5JJK A;  4ZRZ A;  4DV0 Q;  4JW0 A;  3S1Q H;  2NTT A;  1X3E A;  1SE8 A;  1B3Q A;  1SND A;  4X62 Q;  1F2M A;  4A3J G;  1SNM A;  1ET6 A;  2SNM A;  2OF1 A;  2LKV A;  3VYS A;  4LF5 L;  3HOV G;  1W2B A;  1K28 A;  1V8Q A;  5IGD A;  1Z47 A;  2JK8 A;  2E2J B;  3T53 B;  1II3 A;  3NBH B;  1BQQ T;  4RGM A;  1YNN C;  1I4G A;  4C2M H;  2JA7 B;  5IT9 L;  4KN7 C;  5F2D A;  2F0W A;  4XT1 B;  2GN5 A;  3WOE A;  3PQI A;  4L5R C;  4R9W A;  2F4V L;  4B9W A;  1SXT A;  5AJ3 L;  3DWP A;  1K8O A;  2IX3 A;  3U4Z A;  1A3V A;  4A3D G;  2PZW A;  4B3R L;  4JBW A;  2DJF C;  3FKI B;  3W3A A;  1Q7Y C;  1JE5 A;  2XTI A;  3G6J B;  4A3G H;  2L12 A;  3MXU A;  3TZU A;  1IYV A;  4NB3 A;  1VCI A;  2E5L L;  1H9R A;  4QUF A;  3R3O A;  2V1C C;  3CAM A;  1TU2 B;  5M3M G;  3ERS X;  1CI3 M;  2EY5 A;  1ZEQ X;  4RGT A;  1HJP A;  4JI1 L;  1EEI D;  4KK7 A;  4DV0 L;  1DJR D;  3KBX A;  3GV6 A;  3GO5 A;  4I7A A;  1NTG A;  5IYB H;  3RZD H;  4GOP C;  4JI0 Q;  4X62 L;  2JA8 B;  4DR5 Q;  3GD7 A;  2XRQ D;  1JC7 A;  4ULL A;  2JA7 G;  2CH4 A;  3M7G A;  3TZD A;  3HEJ A;  5CBE E;  5GAE C;  1B3A A;  2NN6 G;  1JMC A;  4KHP L;  4DXG A;  4B3M Q;  5IGC A;  2FMM A;  1J6Q A;  4AIM A;  1TY0 A;  1E2V A;  2IX1 A;  1Q46 A;  1RTN A;  3E0J A;  3TSS A;  1R9T H;  4F8M A;  4DR6 Q;  1E24 A;  3FKI G;  4OO1 G;  3H0G B;  2EXZ A;  2UXB L;  1QUQ B;  1YJ9 A;  1WCM B;  2R92 B;  1LTT D;  2K14 A;  2Z9H A;  3GTO B;  4WFN 3;  3HOZ B;  3K8A A;  1AEX A;  4GKJ Q;  3OPO A;  1CUK A;  1X65 A;  3CCE A;  1GUW A;  3PUV A;  4A3K G;  3HOU H;  3QG1 A;  2ASB A;  5KEE A;  1EQV A;  2L0C A;  3JAM i;  1EIY B;  2JA8 G;  4FVM A;  4RWS C;  1HFN A;  5C4X H;  3S17 H;  4F88 A;  1CZG A;  1RL2 A;  5C3W A;  2AQ2 B;  1X55 A;  4DV6 Q;  4HSP A;  4ABN A;  4JI0 L;  4I7Z C;  3S16 H;  1UE5 A;  1YNJ C;  5C6A A;  2ZJP A;  2F0T A;  2ICI A;  1KQS A;  3H0G G;  1F2L A;  3S24 A;  4LFB Q;  1O78 A;  3SDZ A;  5T1G A;  1YEZ A;  2AUJ D;  2ID0 A;  2D9U A;  5I6W A;  1WCM G;  2R92 G;  1Q8K A;  1VQA A;  3FPP A;  2VQE L;  3J7A 5;  4PMB A;  1AE2 A;  3HOZ G;  4WJW A;  1WD0 A;  2K33 A;  4DR6 L;  5KNC A;  3NE5 B;  2Y0S B;  5C4Z A;  1G6P A;  4MIU A;  4DV4 L;  1U0L A;  1BDO A;  3BG3 A;  3DEP A;  4FXD A;  4BXX H;  4BY1 G;  1Z6H A;  5FOB B;  3T13 A;  3GTJ B;  2OQ0 A;  1Z7T A;  4C3H H;  3F2D A;  3D6W A;  2B2T A;  4KKS A;  2G5D A;  2G9H D;  3HRZ C;  4HMJ A;  4PZ8 A;  3MAQ A;  4DR7 Q;  2AWN A;  2L1B A;  1JE4 A;  3F1Z A;  1XX8 A;  1G6Z A;  2OCE A;  2QKI C;  3K80 C;  4LFC Q;  1FNV A;  2F0F A;  3MVV A;  3CCV A;  4POG A;  3WDN A;  1I6H B;  2VS1 A;  1SNC A;  2AQ1 B;  1YZ6 A;  4RMF A;  3ITP A;  2A6E D;  4ID6 A;  4JC0 A;  5J22 A;  1KC8 C;  4UP7 A;  2MO0 A;  1W6K A;  4GN5 A;  4N9T A;  2PQA A;  3I4N H;  4MTN A;  4LF8 L;  3SXH A;  4NXN Q;  1FNU A;  4ALP A;  2HHH L;  2Q2U A;  2XWJ B;  1XMO L;  1MGS A;  1H9S A;  4P72 A;  3T1H L;  1XNQ Q;  4DAP A;  4IAL A;  3BYY B;  1TWG B;  5FLX E;  3OTO Q;  1PMR A;  4LNQ A;  1O7Y A;  2KCT A;  5K36 H;  1GO3 E;  3IFD A;  1ENF A;  3RZO B;  1KDC A;  1BR9 A;  1SLJ A;  1PYS B;  1Y69 U;  5EBD A;  3V2T A;  3J81 i;  1EY9 A;  3J80 i;  1EZ8 A;  4TQU S;  4JI7 Q;  3W1G A;  3F2U A;  1SFO H;  5EPK A;  1E7Z A;  3W5O A;  1IL8 A;  1STA A;  2RCN A;  4JI6 Q;  2EDG A;  1ROD A;  3H3V H;  3EJI A;  1V9P A;  5C0X I;  2K75 A;  1FNW A;  4F87 A;  1TWC H;  3VR5 A;  4LFC L;  2NBF A;  5DNF A;  1WTP A;  4JBK A;  4KLK A;  1EOV A;  1VQP A;  4X65 L;  1HTP A;  5JEA G;  1IBM L;  1TS3 A;  4A76 A;  4P73 A;  2JA6 B;  1H95 A;  5E1F A;  3H15 A;  3ZYY X;  2EY1 A;  4GN4 B;  1S72 A;  2VL6 A;  3S2H B;  1V43 A;  1XTC D;  5FO8 B;  2B39 A;  2A68 C;  4CJ1 B;  3L3O C;  3PO2 B;  1JIC A;  4QIW B;  1IHZ A;  3J7Y W;  3BJU A;  4IOC A;  1SE3 A;  4M8A A;  4A4I A;  5IWA Q;  1XJV A;  4A3E G;  1QZH A;  3S1N B;  1K8G A;  1PH9 A;  4FYD A;  2NVT B;  4JI8 L;  3UDX A;  3MEF A;  4HJ7 A;  2PQE A;  4J8Q A;  3DHQ A;  5C44 G;  5GAH C;  4HID A;  2KQ3 A;  5ISR A;  4UPA A;  4GNX A;  3M3Y H;  3S1M H;  4M1U B;  4JI7 L;  3S1Q B;  2E2H B;  3TN2 A;  3GTL H;  1EU4 A;  3DEO A;  4O0A A;  4A93 H;  2NVY B;  2DY7 A;  4IPH A;  5AFW A;  1SJE D;  1XMQ L;  3DWA A;  1LTR D;  2B2T C;  1PFM A;  1EYD A;  1SYF A;  1EIG A;  1STY A;  2VY3 A;  4OX9 L;  1X9N A;  1Z9F A;  5BN5 A;  4JV5 L;  1Y1W H;  3CCJ A;  5CV7 A;  3BVZ A;  3L9A X;  5M5Y H;  1Q1E A;  3BDO A;  5EQ0 A;  4LF6 L;  4RGO S;  4GLA C;  3OW2 A;  1IL2 A;  2PI2 A;  1AZQ A;  2PQA B;  3KBG A;  3NP8 A;  3NXW A;  3PO2 G;  1VS0 A;  2AHO B;  5IY0 A;  2YV5 A;  3A55 A;  1Q8I A;  1TWA H;  3GTM H;  1H9S B;  3CCL A;  3ULL A;  3CHB D;  3I4O A;  2HQE A;  3RN5 A;  3OHX C;  1JB7 A;  1JCK B;  1QJO A;  4DU9 A;  3NSW A;  2XNA C;  5C5M A;  1LTG D;  5FO7 B;  1YI2 A;  3A8J E;  4BY7 H;  2EQS A;  2IY5 B;  1CFM A;  4ODG A;  3FDT A;  2F0L A;  4BBR B;  1VF7 A;  5ELB A;  3ER0 A;  3MWY W;  2RF4 A;  1HTL D;  3RZD B;  5FK9 C;  2JEA I;  1U4L A;  2F0I A;  1PH8 A;  4HSV A;  2EYJ A;  2HIV A;  1G2S A;  1RTO A;  5K5P A;  2RHQ B;  4OEL B;  2UUC Q;  4L63 B;  3EIV A;  4EQO A;  5EKI A;  1ILP A;  3H6M A;  4NPS A;  3CCU A;  5KYL A;  3GP7 A;  2VQF Q;  3G7L A;  1VQI A;  4X3U A;  3Q23 A;  5IP9 H;  1WTW A;  3GTQ H;  2IL8 A;  4ZAI A;  1A62 A;  1WOC A;  3NBI A;  1QB5 D;  4XXE A;  3E0E A;  4K5V A;  5KND A;  1EY4 A;  4CDC C;  4LMQ D;  4QUC A;  1YHQ A;  2F0P A;  1PTO F;  4QGU A;  2F0S A;  3S14 H;  4BBR G;  1E1T A;  4Y7N H;  3HOU B;  1ESR A;  3TP8 A;  2A74 C;  3QB3 A;  3CCR A;  3ICE A;  4Q0F A;  2RDH A;  4GNX B;  1N32 Q;  3HS0 C;  5HY6 A;  1HQM C;  1PH5 A;  2EE1 A;  2EIF A;  1I4Q A;  2KHS A;  1IBK L;  4NXM Q;  2JEB I;  5FLX c;  3S15 B;  4PMC A;  1VQ5 A;  1JJC B;  2Z6K C;  3N6R A;  3S16 B;  1K0R A;  1HNX Q;  1STN A;  4DV1 Q;  2F3I A;  1GVP A;  3GQB A;  4A3C G;  3CP0 A;  3AYH B;  2UUC L;  2IX0 A;  2QDB A;  5G3L D;  4H13 C;  1KTK A;  1C7Y A;  1VQH A;  3UI2 A;  1H9K A;  2JA5 B;  1SNP A;  5M5W H;  1NMF A;  2Q2H A;  4DV2 L;  4L5T A;  4YY3 Q;  3NQT A;  1QNK A;  5GRO A; 
#chains in the Genus database with same CATH homology
 2VNU D;  3VR6 A;  2EJG C;  3PIO 3;  3V05 A;  4EQP A;  3ND8 A;  2IW3 A;  1BXT A;  1SMY C;  3P7J A;  1EL0 A;  2RA4 A;  1ET9 A;  1HUM A;  3MA2 B;  3AU7 A;  4IFD G;  2BDN A;  4IUR A;  4FF4 A;  2F0D A;  4RCN A;  2HCC A;  1LTS D;  4ZKC B;  3M7N A;  1Q3L A;  1D5M C;  4G57 A;  1LAC A;  2HUG A;  3HGB A;  4OL7 A;  1SDF A;  5A35 A;  4EQN A;  1U4R A;  5EJW A;  3NTI A;  3FPU B;  1RDP D;  5D3D A;  3K5O A;  2L5T A;  1IKM A;  4N9P A;  2Z8L A;  4K6D A;  1B44 D;  3H94 A;  2B2W A;  1ESF A;  1EY5 A;  3M4Y A;  3DM1 A;  2X69 A;  2K01 A;  3V96 A;  5C4J B;  3C3L A;  1E2W A;  3TP6 A;  5CV8 A;  5M3F B;  2WV6 D;  1LT4 D;  5FLX L;  4NMZ A;  1OXS C;  3QO2 A;  2C5C A;  2B2U A;  2A69 C;  1HPC A;  1K8M A;  3MFY A;  4TSS A;  1DM0 B;  1HXY D;  1L0Y B;  4R8N A;  2EJM A;  3MXP A;  3CU7 A;  2V4D A;  5E4X A;  2Z4I A;  5BN3 A;  5ELD A;  4DK0 A;  1I4R A;  4ZUI A;  4S3S A;  2EYF A;  2ZXP A;  3S9W A;  4L6T B;  5I4D A;  1JWM D;  3T16 A;  3OMG A;  3OWE B;  1OXU A;  2A6H D;  1CHQ D;  4KV6 A;  4MN3 A;  5K36 G;  2FHT A;  4FO2 A;  1X32 A;  1SNQ A;  3HG9 A;  4IFD I;  4KTA A;  4ME5 A;  3VYR A;  1DON A;  4DAV A;  3BS1 A;  1D5X C;  1LTI D;  3BZD B;  1SAP A;  3I3C A;  3S1M B;  2PYK A;  2NTS A;  3GTL B;  4A93 B;  2EY6 A;  1WTR A;  3SHL A;  3MXN A;  2KCC A;  2A73 B;  1TS5 A;  2M2L A;  4ZKB B;  4H7B A;  2NWG A;  5JAV A;  2PZU A;  2RDF A;  5CV4 A;  1SEB D;  2L9H A;  2K32 A;  3GV3 A;  1D6E C;  3EFX D;  1TWA B;  3X3N A;  2AUK A;  5BN4 A;  1BF4 A;  4XQQ A;  1LT5 D;  4YIJ A;  1STG A;  1LAB A;  1KLU D;  2OT2 A;  4BY7 B;  1SSO A;  2QF7 A;  2B2W C;  2AWO A;  2N88 A;  1SBB B;  2JE6 I;  1KAA A;  1NCV A;  1G91 A;  3NQI A;  1ENC A;  2Q8R E;  1T5X D;  2D5D A;  3KK7 A;  3K58 A;  5I9P A;  4I65 A;  5LL6 S;  4ZYS A;  2B2U C;  1X3P A;  4H0L C;  1PRT D;  1TWH B;  2E76 C;  4DGZ A;  1LTA D;  3A7L A;  1IYU A;  3J81 E;  3J80 E;  3GTQ B;  1MBY A;  2XWB B;  2NZ1 D;  5DM6 3;  5DEH A;  3Q0A A;  1AFP A;  4ZUJ A;  1B9N A;  2K03 A;  1D2B A;  5JVG 3;  1O7Z A;  3R93 A;  1EY6 A;  2B2V A;  4RH6 A;  1V1O A;  3ONA B;  5C0X G;  4Y7N B;  4KMU C;  5M9O A;  1BBX C;  5DM7 3;  4B9X A;  1QG7 A;  4KI0 A;  1NR2 A;  3U9S A;  2F03 A;  1IW7 C;  4LAA A;  2F0E A;  1M4V A;  1DZ1 A;  3D8G A;  4CJ0 B;  1FD7 D;  3CRK C;  4EVO A;  1BOS A;  1CA6 A;  2SNS A;  3VYU A;  4OIJ A;  1ZYR D;  2JXM B;  2FMC A;  3HOY B;  1CA5 A;  1PFN A;  4KJN A;  1H9J A;  2F0Q A;  4K2L A;  5A2Q L;  2XSC A;  5CYU A;  5M5W B;  2LY7 A;  1I6V C;  1EYA A;  4IUT A;  4ILW A;  1E2Z A;  3URY A;  1PTO H;  3E6Z X;  3VYT A;  1L0X B;  4CBV A;  2HCI A;  1PDQ A;  2ENB A;  2JSO A;  1EY8 A;  3MTS A;  3PUY A;  3M85 A;  3S2D B;  5I6Y A;  4XTC S;  2ZXR A;  2E2I B;  5IGB A;  1DOK A;  4K5X A;  4KHZ A;  4RAU C;  1HFG A;  2J4X A;  1YNJ D;  2D62 A;  1STH A;  4U68 A;  2FJ2 A;  3I4M B;  4DK1 A;  1B1Z A;  4KKU A;  2E74 C;  1WTO A;  2F4I A;  1K83 B;  3K59 A;  2IPK D;  1I3Q B;  5IIF A;  2CVR A;  3BVM A;  1EEF D;  1H9M A;  5HUR A;  4IUN A;  3I73 A;  2RDG A;  5JJZ A;  1EZ6 A;  1S5B D;  3IL8 A;  3FMC A;  2CHB D;  1MI2 A;  4CJ2 C;  5IOD A;  1LT6 D;  2K5Q A;  3I90 A;  2WIN B;  1XXG A;  1S4Z A;  3W2D A;  1MSG A;  2R7Z B;  2IJ0 A;  2Q8T A;  1F2Y A;  1WTV A;  2WB1 B;  2KED A;  1AW7 A;  2M9V A;  4NP5 A;  4XYQ A;  1MD2 D;  5D3I B;  1MSH A;  2L55 A;  5CR3 A;  3MXG A;  1QNU A;  1LV9 A;  2CW0 C;  3P20 A;  2WKD A;  3EA6 A;  5NUC A;  3SEB A;  5IT9 E;  4P2C B;  4DN4 M;  3DWQ A;  1WTQ A;  3PIP 3;  3T4A C;  3OIQ A;  4PQX A;  1STB A;  5I9O A;  3SE0 A;  4C2M B;  1GOZ A;  2NN6 H;  3CKI B;  5EGT A;  1AN8 A;  4QB4 A;  3S1R B;  1TS4 A;  1AZP A;  2EYL A;  1IKL A;  2MPM A;  4OO1 H;  1TKW B;  2LFN A;  4FF1 A;  4A3G B;  4IUQ A;  4A3B B;  3VA5 A;  2A68 D;  2JP1 A;  1ZXT A;  1GHK A;  1BCP F;  2WAC A;  2O2L D;  1M8A A;  1DOM A;  1EOT A;  2F1M A;  2F0G A;  1BNZ A;  4K6L A;  5CC4 A;  1GUT A;  4KY5 A;  2I46 A;  3HP3 A;  2NYZ D;  1VMC A;  1HQR D;  2BA1 A;  3KLR A;  2BE5 C;  3WOF A;  3AMU A;  1WTX A;  4C3J B;  1SYG A;  4RHR A;  1KAB A;  5J39 A;  1R9T B;  4R8I A;  5J1Z A;  1XWE A;  1XYI A;  4A3F B;  1QOH A;  3OSO A;  4CKE A;  2XIW A;  2VB3 X;  4HCE A;  4RKL A;  1EYC A;  3QOJ A;  2LS0 1;  2B2Y A;  3K5N A;  1DCZ A;  4IUV A;  4C3I B;  2BOS A;  5T1I A;  3LNN A;  1JOQ A;  1BCP B;  3QOL A;  4K14 A;  3SK6 A;  2C9O A;  1Q90 A;  1BO0 A;  2O5J C;  2F0V A;  2SDF A;  5IGE A;  3S17 B;  5C4X B;  4H44 C;  3C2P A;  4XQJ A;  1BCP C;  1O7L A;  3TDQ A;  3X3M A;  5IGG A;  1JOO A;  1STE A;  2ICE C;  1KNE A;  2TMP A;  3QJY A;  3A56 A;  1SYE A;  2B8F A;  1OXV A;  4C3J G;  3MFG A;  1DXM A;  1CZW A;  4KHV A;  1ONL A;  1TWF B;  5DAU A;  1TS2 A;  2XN9 C;  2ZT9 C;  4IUP A;  2Q8I B;  5TSS A;  1TVX A;  4RKB A;  1JWS D;  5EPJ A;  2F0U A;  2OXP A;  3T51 B;  4RFB A;  4QCL A;  4DXF A;  4C1N I;  4WRD A;  4G7O C;  1SYB A;  2PW7 A;  4C3H B;  1JQY D;  2K6A A;  4PMW A;  4DAY A;  2WP8 J;  4KN4 C;  2EYO A;  2SOB A;  3LWE A;  1C8C A;  3O13 A;  3SR1 A;  1OXT A;  1GJX A;  2NB0 A;  1VMP A;  1Q1B A;  2SEB D;  5COR A;  2JYO A;  1B2T A;  4FXG C;  1A6X A;  3D4R A;  2MGS A;  5JEA H;  1B9M A;  3SVM A;  3I4N B;  2EYM A;  4K2K A;  2K05 A;  4RA8 A;  2BCO A;  3OOC A;  1RCV D;  3FRP B;  2RQX A;  3M4O B;  3I4L A;  4RGN A;  4C3H G;  4K8I A;  2L4N A;  1I4H A;  1PZK D;  5JOB A;  1U4P A;  1GXD C;  4TKO B;  1CHP D;  3ERO A;  5ELC A;  1SFO B;  2FIN B;  3BDL A;  2R93 B;  4O1N A;  2EYP A;  5ELE A;  3TBI B;  1TWC B;  1AP0 A;  1GUS A;  3NTH A;  4HED A;  1PYW D;  3I91 A;  1PTO D;  2XRS D;  3T56 B;  5KRU A;  3H3V C;  1WD1 A;  3H09 A;  4K5W A;  4XQN A;  2QEJ C;  3JAM E;  3TME A;  4XIG S;  1Y8O B;  3IFT A;  3LX0 A;  3R2T A;  1I50 B;  2MUY A;  4CKC A;  2DN8 A;  3DMU A;  3PUX A;  2EYH A;  3Q6S A;  5EKK A;  1QNK A;  3A8I E;  4LJZ C;  2VXW A;  4HAE A;  4JK1 C;  1C4Q A;  2IT1 A;  4DNT B;  1Y8N B;  3M3Y B;  3PUW A;  1EY0 A;  3TP7 A;  2KJX A;  5I2X A;  5M3M B;  1PRT B;  3A7A B;  3NWT A;  4K8J A;  2H4O A;  2K7V A;  2EPB A;  2X6L A;  1GUO A;  3AB9 A;  3OIP A;  1JOK A;  4X3S A;  2LMC B;  2A69 D;  2F0O A;  1Y1W B;  1PRT C;  5M5Y B;  4ZLT F;  1TT2 A;  4NW2 A;  1BUV T;  1A3T A;  3CRL C;  3U9O A;  4ZK9 B;  4BA2 I;  5IOC A;  2HDL A;  2BDO A;  2F3W A;  2O5I C;  1U4M A;  4KY6 A;  3A8K E;  3GTM B;  2X6G A;  2OEO A;  2K5D A;  1A3U A;  3P1H A;  2Z1C A;  1NR4 A;  4OIK A;  2WII B;  1S5E D;  4UAI A;  5KYI A;  1TII D;  1RHP A;  1UNS A;  1ML0 D;  2KVM A;  1C48 A;  4A3K B;  4GZY C;  2AQ3 B;  1JR0 D;  1LLR D;  5CV6 A;  3E5S A;  2KEC A;  1FR3 A;  1LT3 D;  4UDU C;  1YNN D;  2DY8 A;  1J9O A;  2EOT A;  1UEA B;  4PV1 C;  2CQA A;  3VR4 A;  1ZYR C;  1FGB D;  2K04 A;  1D5Z C;  3TP5 A;  3K6O A;  2ZXO A;  1A15 A;  3ND9 A;  1EIH A;  3KUP A;  3VA7 A;  1D1K A;  4FP5 D;  3MZ5 A;  1TY2 A;  4C1N K;  2B63 B;  4MHE A;  1JOR A;  2GA4 B;  3C1E A;  4Q5V A;  2NUC A;  4J6H A;  4AYB B;  3SK4 A;  3OWF A;  3S14 B;  1PZJ D;  4BY1 B;  1SE4 A;  4G7Z C;  2F0M A;  5FKA C;  1B50 A;  5C0X J;  4BWG B;  2A6E C;  4IFD H;  3FEW X;  1CM9 A;  4HTH A;  2F0H A;  1DOL A;  2WAQ B;  2YYZ A;  1HCZ A;  2R61 A;  3LWU A;  1HA5 A;  2H1E A;  4G7H C;  5LHY 1;  3HZX A;  3NTK A;  4EGV A;  1LTB D;  4BA1 I;  1CK1 A;  1RKN A;  3OW7 A;  3VR2 A;  2DNC A;  2RSN A;  2D2C C;  2TSS A;  1G8Z D;  2FFK B;  4V19 0;  1RF2 D;  4IN3 A;  2EVB A;  1SE2 A;  4OGQ C;  2L11 A;  3N52 A;  1I4X A;  2EJF C;  2KOL A;  1EWH A;  1F9R A;  2NN6 I;  4FNF A;  4KD3 A;  3GTK B;  3HKZ B;  3RUZ A;  2IWH A;  3CQZ B;  4HN7 A;  2PMZ B;  4OO1 I;  5CGK A;  2KA7 A;  1B53 A;  4KJO A;  1IW7 D;  3SK5 A;  2HDM A;  4G4K A;  2J7Z A;  1EY7 A;  2VB2 X;  3R2I A;  3VR3 A;  5E3F A;  4CKB A;  2KCN A;  4WOR A;  2PNR C;  2F0J A;  3I8Z A;  4C56 C;  1V1P A;  4DFA A;  2MP1 A;  3NHH A;  5I2Y A;  1OXX K;  1ZKO A;  1HA6 A;  1GUG A;  1PXU A;  2G9D A;  1F9S A;  4A3E B;  3SK8 A;  4DA2 A;  3HOX B;  1CQF A;  1KDB A;  3K5M A;  4A3M B;  5JEA J;  2DNE A;  2B2V C;  2Z4H A;  5C44 B;  1LO5 D;  5M5X B;  2MHV A;  4CHT B;  5CMD A;  3H91 A;  5JPM C;  1GHJ A;  1NSN S;  3IKJ A;  1S5C D;  4BBS B;  1J8I A;  3J7A F;  1EU3 A;  1B4O A;  3J7A V;  4BS9 A;  4IUU A;  1UUP A;  4OHJ A;  2KEE A;  1NUC A;  1S5F D;  1R4P B;  2F0N A;  2F3V A;  1F77 A;  5ELF A;  3ERQ A;  3JAM L;  3I72 A;  4J1M A;  5KIX A;  5G3L F;  4RCO A;  4F7X A;  1U9R A;  3D3R A;  5HGT A;  1JB3 A;  3P75 A;  1CQV A;  1RJT A;  3KLS X;  2J0T D;  3D4D A;  1QWY A;  2I07 B;  1CT1 D;  3NUC A;  3NK9 A;  4V0B A;  1HUN A;  3QWN A;  1GUN A;  3FVQ A;  1KDA A;  2A5H A;  1D1I A;  4KD4 A;  2R3Z A;  3BVG A;  1QE6 A;  1UAP A;  2WKC A;  1SJH D;  5C4H A;  1Y8P B;  2PPB C;  2VUM B;  3D31 A;  3BYT B;  1V1P B;  1SNO A;  2YU9 B;  4RHS A;  2E75 C;  5E4W C;  1RD9 D;  1TR5 A;  4HMI A;  5EPL A;  2K28 A;  5C5L A;  2CW0 D;  3C1F A;  5EBC A;  3Q22 A;  1O80 A;  1ENA A;  3Q24 A;  3A54 A;  1KLG D;  5C0X H;  3DUZ A;  5KNB A;  5C3E B;  2NVX B;  1W6J A;  3KF8 A;  2EY2 A;  2K1B A;  1F9P A;  2K5W A;  5EKL A;  2EZV A;  4CGY B;  1PLF A;  2QCP X;  3NPP A;  2RKS A;  2B8G A;  2PO4 A;  4FXK C;  5CV9 A;  4XDX A;  2MJ8 A;  1PZI D;  4O42 A;  1SYD A;  4IZ8 A;  1OO9 B;  4TRD A;  5C3X A;  4DNR B;  1JWU D;  1G29 1;  3HOW B;  4NDX A;  3J81 L;  3J80 L;  4FF2 A;  3BDC A;  4KKT A;  4QMG A;  1S5D D;  5D65 A;  4B08 A;  4A3I B;  1EWC A;  2RSO A;  4IQZ A;  1ILQ A;  3RLF A;  3MHB A;  2BE5 D;  4L8J A;  2XVS A;  3EVQ A;  3MC0 B;  5IGF A;  3GTG B;  3D4W A;  1A2U A;  4C3I G;  2QIL A;  1PFB A;  2BA0 A;  3EQL C;  1EFI D;  2RBM A;  5A2Q E;  3RD4 A;  1VF5 C;  1Y1V B;  1X3Q A;  3PUZ A;  3PV0 A;  3RMH A;  4HCS A;  1QCB D;  1SYC A;  3K7A B;  2PCF B;  3L7Z C;  1T5E A;  4QF4 A;  2NVQ B;  1VDZ A;  4IFD J;  1PTO B;  4HR7 B;  4U67 3;  3NWS A;  5FO9 B;  5COY A;  2PZT A;  3NBH A;  3D6C A;  1PTO C;  1BCP D;  1I4P A;  2PW5 A;  4DF7 A;  3DXJ C;  1KNA A;  2E2D C;  4KY7 A;  1A2T A;  5JVH 3;  2F0K A;  2RVL A;  3K5L A;  2A6H C;  3K57 A;  3PO3 B;  5CV5 A;  3C46 A;  3IAY A;  1HRJ A;  1R4Q B;  1FYC A;  1TQO A;  3I70 A;  5LL6 X;  1F9Q A;  2B2Y C;  2M00 A;  1EQT A;  4FF3 A;  5KGU A;  2O4X A;  4LK1 C;  1SMY D;  1PRT F;  3OMC A;  1DYQ A;  4A3J B;  3K0Y A;  3PMF A;  3MEH A;  5D14 A;  1E0B A;  4X3T A;  3HOV B;  4XT3 B;  1ICW A;  4E6I A;  1DD2 A;  2R6G A;  2N55 A;  1WVL A;  5CBA E;  4XYO A;  4Z9C B;  5JPN C;  1QIL A;  1HHV A;  1Q12 A;  2KUM A;  4NKL A;  3QIA A;  4ZQ3 A;  4A3D B;  3R8B A;  3KLS A;  4PNY A;  4X3K A;  1CTM A;  1G2T A;  1F2Z A;  3GTP B;  4ZRZ A;  2NTT A;  1SND A;  1F2M A;  1SNM A;  1ET6 A;  2SNM A;  2OF1 A;  2LKV A;  3VYS A;  1V8Q A;  5IGD A;  1Z47 A;  2E2J B;  3T53 B;  1II3 A;  1BQQ T;  4RGM A;  1YNN C;  1I4G A;  2JA7 B;  5IT9 L;  4KN7 C;  5F2D A;  2F0W A;  4XT1 B;  3WOE A;  4R9W A;  4B9W A;  1SXT A;  3DWP A;  1K8O A;  2IX3 A;  1A3V A;  2PZW A;  4JBW A;  3FKI B;  3W3A A;  3G6J B;  2L12 A;  3MXU A;  3TZU A;  1IYV A;  1VCI A;  1H9R A;  4QUF A;  3R3O A;  1TU2 B;  1CI3 M;  2EY5 A;  1ZEQ X;  4RGT A;  1EEI D;  4KK7 A;  1DJR D;  3KBX A;  3GV6 A;  3GO5 A;  2JA8 B;  3GD7 A;  2XRQ D;  1JC7 A;  4ULL A;  3M7G A;  3TZD A;  3HEJ A;  5CBE E;  1B3A A;  2NN6 G;  4DXG A;  5IGC A;  2FMM A;  1TY0 A;  1E2V A;  2IX1 A;  1RTN A;  3E0J A;  3TSS A;  4F8M A;  4OO1 G;  3H0G B;  2EXZ A;  1WCM B;  2R92 B;  1LTT D;  3GTO B;  4WFN 3;  3HOZ B;  1AEX A;  3OPO A;  1GUW A;  3PUV A;  3QG1 A;  5KEE A;  1EQV A;  2L0C A;  4FVM A;  4RWS C;  1HFN A;  4F88 A;  1CZG A;  5C3W A;  2AQ2 B;  4HSP A;  4ABN A;  4I7Z C;  1YNJ C;  5C6A A;  2F0T A;  2ICI A;  1F2L A;  1O78 A;  3SDZ A;  5T1G A;  2AUJ D;  2ID0 A;  2D9U A;  5I6W A;  3FPP A;  4PMB A;  4WJW A;  1WD0 A;  2K33 A;  5KNC A;  3NE5 B;  2Y0S B;  5C4Z A;  4MIU A;  1BDO A;  3BG3 A;  3DEP A;  4FXD A;  1Z6H A;  5FOB B;  3T13 A;  3GTJ B;  1Z7T A;  3D6W A;  2B2T A;  4KKS A;  2G9H D;  3HRZ C;  4HMJ A;  3MAQ A;  2AWN A;  2L1B A;  1JE4 A;  1XX8 A;  1G6Z A;  2QKI C;  1FNV A;  2F0F A;  3MVV A;  3WDN A;  1I6H B;  1SNC A;  2AQ1 B;  3ITP A;  2A6E D;  4ID6 A;  5J22 A;  1W6K A;  4N9T A;  3SXH A;  1FNU A;  2XWJ B;  1MGS A;  1H9S A;  4DAP A;  4IAL A;  3BYY B;  1TWG B;  5FLX E;  1PMR A;  1O7Y A;  5K36 H;  3IFD A;  1ENF A;  3RZO B;  1KDC A;  1BR9 A;  1Y69 U;  5EBD A;  3V2T A;  1EY9 A;  1EZ8 A;  4TQU S;  3F2U A;  5EPK A;  1IL8 A;  1STA A;  2EDG A;  1ROD A;  3EJI A;  5C0X I;  1FNW A;  4F87 A;  3VR5 A;  2NBF A;  5DNF A;  1WTP A;  1HTP A;  5JEA G;  1TS3 A;  2JA6 B;  5E1F A;  3ZYY X;  2EY1 A;  3S2H B;  1V43 A;  1XTC D;  5FO8 B;  2B39 A;  2A68 C;  4CJ1 B;  3L3O C;  3PO2 B;  1JIC A;  4QIW B;  1IHZ A;  3J7Y W;  1SE3 A;  4M8A A;  3S1N B;  4FYD A;  2NVT B;  2PQE A;  4J8Q A;  3DHQ A;  2KQ3 A;  5ISR A;  4M1U B;  3S1Q B;  2E2H B;  3TN2 A;  1EU4 A;  3DEO A;  2NVY B;  2DY7 A;  5AFW A;  1SJE D;  3DWA A;  1LTR D;  2B2T C;  1PFM A;  1EYD A;  1SYF A;  1EIG A;  1STY A;  5BN5 A;  5CV7 A;  3BVZ A;  3L9A X;  1Q1E A;  3BDO A;  5EQ0 A;  4RGO S;  1AZQ A;  3KBG A;  3NP8 A;  3NXW A;  3A55 A;  1Q8I A;  1H9S B;  3CHB D;  2HQE A;  3OHX C;  1JCK B;  1QJO A;  4DU9 A;  3NSW A;  2XNA C;  5C5M A;  1LTG D;  5FO7 B;  3A8J E;  1CFM A;  4ODG A;  3FDT A;  2F0L A;  4BBR B;  1VF7 A;  5ELB A;  3MWY W;  1HTL D;  3RZD B;  5FK9 C;  2JEA I;  1U4L A;  2F0I A;  4HSV A;  2EYJ A;  1G2S A;  1RTO A;  5K5P A;  4L63 B;  4EQO A;  5EKI A;  1ILP A;  3H6M A;  5KYL A;  3GP7 A;  3G7L A;  4X3U A;  3Q23 A;  1WTW A;  2IL8 A;  4ZAI A;  3NBI A;  1QB5 D;  4XXE A;  4K5V A;  5KND A;  1EY4 A;  4LMQ D;  4QUC A;  2F0P A;  1PTO F;  2F0S A;  3HOU B;  1ESR A;  3TP8 A;  2A74 C;  3QB3 A;  4Q0F A;  2RDH A;  3HS0 C;  1HQM C;  2EE1 A;  1I4Q A;  2KHS A;  2JEB I;  3S15 B;  4PMC A;  3N6R A;  3S16 B;  1STN A;  3GQB A;  2IX0 A;  2QDB A;  5G3L D;  4H13 C;  1KTK A;  3UI2 A;  1H9K A;  2JA5 B;  1SNP A;  3NQT A;  1NAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...