2ENBA

Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Crystal structures of the binary Ca2+ and pdTp complexes and the ternary complex of the Asp21-->Glu mutant of staphylococcal nuclease. Implications for catalysis and ligand binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2enbA00
5IGBA 5I9PA 1EY8A 2EY5A 5CR3A 4S3SA 1EY5A 1STGA 3QOJA 3HEJA 1A3UA 2KQ3A 5CV7A 3BDCA 5DAUA 1STAA 1SYGA 4HMIA 4YIJA 1A3TA 5E3FA 1II3A 1STYA 4K2LA 4DGZA 4ODGA 1STNA 3P1HA 3SXHA 5EKLA 2EYPA 5KGUA 3EROA 4QB4A 1F2MA 3LX0A 5C5MA 4K8JA 3SR1A 4K5XA 3SHLA 4NDXA 2F3VA 2RBMA 4EQOA 3EVQA 3SK4A 1SYDA 4R8NA 1JOQA 2F0FA 4IZ8A 5C3WA 5IGGA 5IGDA 4J6HA 3C1FA 2PZTA 1KABA 2F0IA 3QOLA 3SK8A 5M9OA 1SYEA 4NKLA 5IIFA 4ZUJA 3EJIA 1EYDA 3NXWA 4N9TA 5E1FA 4J1MA 1EY7A 2SNSA 1JOOA 4H7BA 2F0OA 1TQOA 3U9OA 4RKBA 5IGCA 3MZ5A 3OWFA 1JOKA 2EY2A 1EYCA 1SYBA 2F0QA 4K5VA 4DU9A 5CV9A 4EQNA 5KEEA 2EY1A 1EYAA 4HMJA 1ENCA 2F0NA 3RUZA 2QDBA 1NUCA 4B9WA 5J22A 1SNOA 2F0MA 4KY5A 1EY4A 5HGTA 1KDAA 4K6DA 2EY6A 3VA5A 1SNPA 4G57A 2F0GA 4HTHA 3TMEA 2EYJA 3D4DA 1SNMA 1RKNA 1A2TA 1AEXA 3D4WA 4K2KA 5I6WA 1A3VA 4N9PA 3D6CA 3DMUA 2LKVA 2F0KA 1NSNS 5I6YA 2F0HA 2F0PA 4TRDA 2F3WA 4I65A 2PYKA 3T16A 3NUCA 5IGFA 3NP8A 5KIXA 3SK5A 4KV6A 5J1ZA 2F0TA 1ENAA 1SYFA 2EYOA 3OMGA 2ENBA 2O4XA 3HZXA 2OF1A 3E5SA 5C5LA 4KHVA 4K8IA 4IALA 3TP6A 2F0JA 4WORA 2F0LA 3DHQA 1EY0A 3S9WA 3T13A 1F2ZA 2F0SA 3MHBA 4F7XA 1SNDA 2EYMA 2PZUA 1STHA 5ISRA 3NQTA 1SNCA 1TT2A 2F0DA 3NHHA 4ZUIA 5CC4A 5KRUA 3OSOA 2F0UA 2F0VA 2WACA 4K14A 3ITPA 1F2YA 1SNQA 2RKSA 3P75A 4RKLA 5HURA 1TR5A 5F2DA 2PZWA 2HQEA 1EZ6A 1IHZA 3MXPA 5CGKA 5KYIA 1EQVA 2EYHA 4MIUA 4PNYA 4KTAA 4IUNA 4DFAA 5I9OA 5IGEA 5CV6A 3V2TA 2F0EA 4ID6A 4OL7A 1STBA 5NUCA 5JOBA 5C4HA 1EY9A 5CV8A 2PW5A 3TP5A 3BDLA 3NK9A 4B9XA 2SOBA 3SK6A 5CV5A 4PMBA 2PQEA 4NMZA 4QF4A 1EY6A 5K5PA 5DEHA 1A2UA 2OEOA 3C1EA 4EQPA 1KAAA 4NP5A 5C4ZA 5CV4A 4KJOA 2M00A 2RDFA 4WRDA 2EYLA 2PW7A 4F8MA 4EVOA 3H6MA 3MVVA 3MEHA 4KJNA 4QMGA 4DF7A 5C3XA 1KDCA 5IOCA 1U9RA 4PMCA 3OMCA 5KYLA 3PMFA 2OXPA 3D8GA 4ZQ3A 5IODA 5JAVA 5EKKA 4E6IA 1SYCA 2EYFA 4KD3A 4KD4A 4LAAA 3ERQA 4KY6A 3TP7A 2F0WA 2SNMA 4KY7A 5EGTA 4ME5A 1JORA 3QB3A 4K5WA 3R3OA 2KHSA 5J39A 3TP8A 2EXZA 1KDBA 2NUCA 1EZ8A 5C6AA
chains in the Genus database with same CATH superfamily
5M3FB 1EY8A 2LXJA 3QOJA 3H0GG 3HEJA 2E8GA 3HOWB 3BZKA 1GD7A 2L55A 2IY5B 3OWEB 4R4IA 3ULJA 1KXLA 1ICWA 3NWSA 3SR1A 3C46A 2K7VA 3J80c 4FYDA 1SROA 4JVZA 1QVGA 4JBWA 4FDBA 3VYSA 3C1FA 1V8QA 1NE3A 1PTOB 2QGQA 1B4OA 2YTVA 4A3MG 4A3BH 2WP8J 1TQOA 2VUMH 2R93B 5JVG3 3K0YA 2Z6KA 3CRLC 4IUVA 1E24A 2F0MA 1PTOC 1EY4A 1Q1BA 3NE5B 3S14B 1JWSD 2QA4A 4GKJQ 3I70A 4A3DB 4IJHA 4XIGS 1A3VA 1V1PB 4JI2Q 4KMUC 3NP8A 3HOYB 1FNVA 4PMWA 2EYOA 1TXYA 1NMGA 2F4IA 3CC4A 4JV5Q 1EY0A 5C4XG 3SGIA 2ZJPA 1NJIC 3TS0A 5H1SE 1TT2A 4A3JG 2RCFA 2UUAL 1SFOB 3KF6B 1QB5D 4CKCA 4GOPA 2FHTA 2EZVA 1I5FA 1HR0Q 3V05A 1RTNA 1GUOA 3S15B 2EYHA 5M5XB 3CRKC 1V1PA 4ID6A 2K01A 3R93A 3FPUB 2F4VQ 2RQXA 5EBDA 2G9HD 3S1RB 5G3LD 3KDFA 3PUZA 1HXYD 4IN3A 4EVOA 3K59A 4QMGA 4A3KH 4A3IB 4R4OA 1YITA 1J9OA 5EPKA 2VW9A 3ZYYX 2OXPA 4EX5A 3F2BA 2VB3X 1CA6A 3IL8A 4DAYB 1ML0D 2EYFA 1WYDA 1PDQA 2SNMA 5LMNW 5EGTA 1XNRL 1XYIA 1GXDC 3PUVA 5IGBA 2QEJC 1ESRA 3BDCA 3MXNA 5I2YA 1STYA 3PF5A 1Y69U 3AFQA 1BXTA 3P1HA 1DOKA 1B53A 2JA8B 4L5RC 1HJPA 4MN3A 4PZ7A 4C2MB 2R61A 4OWWB 3HOZH 4DAYA 1HUMA 2RA4A 2F0IA 2JA5B 4GNXA 4NKLA 1NR2A 4Y7NH 2E2HH 5E1FA 3GTJB 5M5YB 1GKHA 2CW0D 1B7YB 3T1HQ 3MZ5A 2OCEA 2UUAQ 3HOWG 1Y8PB 4LF6L 1I4GA 2F0NA 3GDEA 4TKOB 5ELDA 1NNXA 5HGTA 3M9BA 1TWHB 4QUCA 1AW7A 1ZYRC 1A15A 5I6YA 2F0HA 4TRDA 2C35B 4G7HC 5IGFA 3NUCA 3A8JE 2A69D 2R3ZA 4A3EH 1SMYC 1MJCA 1SYFA 4OO1H 2R93G 3DHQA 1MD2D 2Z4IA 4C1NI 3JAMi 4DR7Q 4A3CG 1QE6A 1SNCA 1S5ED 4F87A 1H9KA 1JE5A 1B70B 4A3DG 2IX0A 4RGMA 1KNEA 2WACA 4JBKA 1BF4A 2A68D 5BN3A 1IXRA 1GUSA 2HQEA 2YV5A 1XNRQ 1EQVA 1EWIA 2JQOA 2K05A 2P5ZX 3AU7A 4DFAA 2BCOA 2KCNA 3HOYG 2F0EA 1SE4A 4L8JA 5C4HA 2KVMA 4X62L 1SSOA 5K36G 3NELA 2E2JB 3PUXA 2RDGA 5BN5A 4HSPA 1UEAB 1BCPD 2Z9HA 2Z1CA 1J6QA 1U5KA 3BG3A 2EYLA 3MVVA 3S2DB 1PZID 1K0SA 1SR3A 4DAMA 1F9PA 2EOTA 2DNCA 4A3LH 1XXGA 1DONA 4V190 2HDMA 1WJJA 1JORA 3QB3A 1ILPA 1EFID 2EDGA 1HFNA 4JOIC 3VA7A 1OXTA 5C0XG 1K3BC 1VQ5A 5JOBA 2KEDA 1A3UA 1U4LA 1YNND 3EN2A 3HOUH 4HMIA 1ZXTA 3FKIB 1A3TA 3NBHA 4DR2L 2UUCL 2XRQD 3GTLH 1O80A 4JG2A 1KIXA 4RCNA 4QB4A 1IW7C 4LF5L 1X65A 2I5HA 3M3YH 5EQ0A 4JOIA 2KCMA 3EVQA 5JJIA 1SYDA 1G291 5JJLA 5FJ8G 5C3WA 2K6AA 1VF5C 1G2SA 2E2IH 2UXDL 1DOMA 4MZ9A 1I4RA 5IIFA 1EYDA 3I72A 1L0XB 1PH5A 3HOXH 3SVMA 5FO9B 1HNZL 4IFDI 4CDCC 1H9RA 5IYBG 4B9WA 1PH7A 5CBEE 1B50A 2XVSA 1HCZA 2JA8G 3UI2A 4LF8L 1KHIA 2UU9Q 3FEWX 4HIKA 4KHPQ 4N9PA 4X62Q 3DMUA 3FP9A 3K7AH 4FF2A 2JA5G 2B2TC 3CXCA 2N78A 1WTRA 5IYDG 2F0TA 1YNJD 5AJ3Q 1R9TH 1JICA 3TP6A 2G5DA 4K8IA 4OWXB 1LTRD 1PH4A 4A76A 3KLRA 2OQKA 4J15A 4FXDA 4TVAB 3S1MB 4Q0FA 3I8ZA 5IT9E 2D9UA 1WD1A 3URYA 5C44H 3DEPA 4U673 2TMPA 1MI2A 4O42A 5ELBA 3S2HH 2KJXA 4RKLA 2PQAA 1SE3A 1AH9A 1IHZA 1GOZA 3VR2A 1F9SA 2HDLA 4HCSA 1H9JA 3HOVB 2BDOA 3DM1A 4GN5A 1GVPA 4FF4A 4A3GH 1HFGA 1XPOA 4B9XA 3MXUA 4YWKA 4JI4L 4RAUC 5CV5A 2UUCQ 4DR2Q 3R2TA 1GO3E 2BA0A 1SAPA 4RMFA 1PRTF 1Q3LA 1C4QA 4NP5A 3BVZA 5CV4A 4HJAA 4WRDA 3CMEA 1IBKL 2Q8TA 3E3XA 3W2DA 3T4AC 2UXDQ 2N55A 1VQ6A 1E2VA 1LTGD 1SXTA 4Y7NB 2PPBC 4KD4A 3TP7A 3E9HA 4GKKL 5HY6A 1SMXA 3OOCA 4UY8C 1IKLA 1B3AA 1Y14B 2DGYA 1WCMB 1HNZQ 3K58A 4CKBA 3T53B 4DV3L 1QUQA 2VNUD 2DY7A 4YIJA 1MGSA 1KNAA 3KF8B 1FR3A 1CSQA 3MC0B 1NBWA 3FVQA 1M4VA 2IHFA 3OTOQ 1KLUD 2WFWA 3MA2B 4OXPA 2B2UC 5KNDA 4XDXA 4A3BG 3M7NA 1AZPA 2K5WA 2VL6A 2WAQB 1P16A 3GP7A 1P8LA 5DLQE 4NW2A 4KKTA 4LJZC 3RLFA 4JI5L 3JAML 5LL6S 1JOKA 3FKIG 4ALPA 4X6AH 4HMJA 1YEZA 1LT6D 4JBJA 3CQZH 3MXGA 4R8IA 5GQOA 1KC8C 3D4DA 2JE6I 1V9PA 3L9AX 4KKUA 1FNWA 1CI3M 4O0AA 3J7ZC 4JI4Q 1D1KA 1XTCD 1W6JA 1V1OA 2K5HA 4KK7A 3BYYB 2XWBB 3C3LA 5DNFA 2L0CA 1E2ZA 1F9RA 1LLRD 2FFKB 4YY3L 2B39A 3E9IA 4RG1A 1LTTD 1TWAH 3G6EA 1Y1WB 2AHOB 3RZDH 3VR3A 3G71A 4LWCA 1JMCA 1UE5A 3IKJA 4LK1C 5GAGC 4DK0A 4MIUA 4XXEA 2B3GA 3U4ZA 2K33A 2R7ZB 4RGNA 4CDDC 4DV3Q 4X3KA 3L0OA 1LTBD 4R4QA 2IWHA 4NMZA 4A3KG 3I91A 3LWEA 3G6JB 1VQLA 4BBSH 1LTID 2KA7A 5C4ZA 2E76C 1W6KA 1VDZA 1X32A 4B3TL 2PW7A 1RCVD 2A68C 4Q5VA 4R9WA 1BCPB 5C0XJ 4G7OC 2L9HA 1VMCA 5IODA 4DV5L 2E2IB 1BBXC 3HOVG 4HIMA 1HNXL 3A54A 2UUBQ 2JEBI 2GN5A 2NN6I 3NTKA 3PSIA 4JI7Q 4JI1L 2MPMA 4JI0Q 1ET6A 2K5QA 3BU2A 2A6EC 1V1QA 4DR3L 4X64L 4BXXH 4LFBL 3KUPA 2R6GA 2FMMA 2MUYA 1HHVA 2UXBQ 5C5MA 4LF7L 5JPMC 1YHAA 4IFDH 3H3VI 1I4QA 3U4VA 3K0XA 3UDFA 1KABA 1WCMG 4BWGB 5I2XA 4YY3Q 4DV0L 2VZAA 4IURA 1EY7A 2SNSA 4ILWA 4DA2A 1Q7YC 4M1UB 5C44B 3GTQB 1VS0A 4PQXA 3S2HB 4DNRB 2I5LX 4CGYB 1KDAA 4L5SA 1TU2B 2F0GA 1Q86C 2QCPX 4NXMQ 1Q81C 4WJ4A 2HQLA 4UAIA 2CQOA 2WAQG 1UNSA 2ZXOA 3BS1A 5EJWA 3EFXD 1PFNA 1ZYRD 2KHIA 3T16A 2EJFC 2LY7A 4APVA 3GV3A 1RODA 1VQIA 4B3TQ 1AN8A 3TEHB 4BY1H 2ZT9C 4DUZL 2HIXA 1F2ZA 2F0SA 4HSVA 3J81j 1EIHA 2HCCA 5C4XB 1VQKA 4WJ3M 3JAMc 4DV5Q 1Q8IA 2A73B 1F9QA 4LFAL 1G91A 1HNXQ 1TVXA 4DN4M 1TS4A 3F8TA 2PZWA 2L12A 3MXPA 5CGKA 1GUGA 1TWCH 4OL7A 5NUCA 3VR4A 3KFUA 4QUFA 4XYOA 1DJRD 1O7IA 3IFTA 3PCOB 2SOBA 4KKSA 1B2TA 5IP7H 1VQ4A 1L1OA 1N34L 1GUNA 5DEHA 1HZCA 1Z9FA 2OTLA 4GLAC 5FLXE 2ZTCA 4GN4B 5JEAH 1Y1WG 4LF7Q 1QVFA 4XQNA 1X3PA 3Q22A 3T1YL 2F1MA 1KDCA 4CHTB 1DM0B 1MKHA 2E74C 4PMCA 1G8ZD 4DV0Q 4KN7C 1KL9A 2R7ZG 3I2ZA 1I3QB 1B8AA 3F1ZA 3KJOA 3DUZA 1XMQQ 1EU3A 1WTXA 1OXUA 4XT3B 4JI2L 1B9NA 3CQZB 4JI8L 2NVXH 1E0BA 2KQ3A 3J7AF 3KBGA 4DGZA 1IYVA 1EOTA 3RLOA 1N36L 2XWJB 2K4KA 2KEEA 1KRTA 4BA2I 3SXHA 4PG3A 4B3RQ 2NB0A 1L0YB 2RBMA 4ZCKA 3GTKB 4H13C 1Z47A 1PYWD 4HCEA 3QO2A 3P20A 4DR4Q 4R8NA 1IW7D 4U68A 1JWMD 3NTIA 4J6HA 2YTXA 2JA6B 4HAEA 2AWNA 4DUYL 3EJIA 1Q90A 2EPBA 1QWYA 1HUNA 4P73A 2EIFA 2C9OA 4KI0A 4C3HB 3CP0A 2RHSB 4RKBA 4LFAQ 5KEEA 5CV9A 1N9WA 4AH6A 2F4VL 3MFYA 4L63B 1PFMA 4LNQA 3ZJYC 3VYUA 3KJPA 4GLXA 3F2DA 1IBLL 2B8GA 2JN4A 5I6WA 2B29A 2LKVA 2F0PA 2Z6KC 1C0AA 1TY0A 5LMNQ 1N34Q 3SDZA 1FGBD 4QIWE 2E2DC 4BBSB 1F2LA 3CCSA 4RHRA 4DV7L 2O4XA 2GA4B 5C44G 3LGJA 4X65L 3T1YQ 1K83B 2Z4HA 3CHBD 1V43A 4C1NK 3A8IE 1MJEA 4BBRB 2B2YA 4GOPB 3AB9A 3GV6A 3Q8DA 2B63B 4UP8A 4A3FH 1BQQT 4KTAA 2PNRC 4GLVB 2BH2A 3WOEA 4IQZA 4JI8Q 3NWTA 1ZKOA 3TP5A 3F2UA 1YJWA 4GOPC 1S40A 2QF7A 1N36Q 5K5PA 3IAYA 3I55A 4DK6C 1TWGB 2NN6H 2NVQH 2B8FA 1EUJA 3GTPH 1Y8NB 1EFWA 3KDFB 2A8VA 2CVRA 4YCWA 3J81i 5T1GA 3T1HL 1O7YA 1X56A 2R7DA 3CAMA 4DUYQ 1VQ7A 2K5DA 4KY6A 1L2FA 4RGTA 2QDLA 5JJZA 4X3TA 4UPAA 3H3VH 2K14A 2VXWA 3CCRA 3DWPA 5CMDA 3MXNB 1CQVA 1Q82C 4K2LA 1IBLQ 1GUWA 3M4PA 3LX0A 5IT9L 1GUTA 4DR7L 1EIFA 2QILA 2VB2X 2ZM6L 2N49A 3TSSA 1BVSA 4DV7Q 5IP9H 5CYUA 1BBUA 4GNXB 2ZXRA 4X65Q 4UDUC 5EPJA 4ZUJA 1R4PB 2DNEA 1PH9A 4LF4L 2L15A 2EY2A 2CWPA 2M2LA 1TWFH 2I07B 3H91A 1JJ2A 1NUCA 1K73C 3K7UC 1BUVT 4KY5A 4GNXC 2NVTH 4K6DA 3TS2A 2EY6A 1I6VC 3QG1A 4JK1C 1LYLA 4UHVA 1BBWA 2WAQE 2X69A 1U4PA 2AQ3B 3D4RA 2JA6G 3ULPA 1PVOA 5KIXA 3K5OA 4CJ0B 3HS0C 1FJGL 4ABNA 1DYQA 1CFMA 4ULLA 3OMGA 4C3HG 5I9OA 4HN7A 3Q23A 3I4NB 3T13A 1QZGA 2VQFL 2BE5C 5CC4A 2H4OA 2GVAA 1KAWA 4QJFA 3P75A 1VCIA 1A62A 3S24A 3ERSX 3CD6A 4BBSG 1CA5A 1N33L 3GTOB 3I4MH 1WTQA 3OW7A 1XWEA 3U9SA 2YYZA 1JB7A 1E1OA 1D1IA 1X3GA 3GTGB 1K8AC 4C3JH 5M3MB 1JR0D 5GAEC 1WTPA 5M5WH 2ZM6Q 4BBRG 1W2BA 2XTIA 3MEHA 2LXKA 1PH6A 1IYJB 2B63G 2MJ8A 2FINB 1W3SA 5KYLA 3D8GA 4ZQ3A 3U58A 2Q2TA 4UP7A 4CJ2C 4RHSA 5JAVA 4WJWA 2MO1A 2Q2IA 2JEAI 2F0WA 4AYBE 4LF4Q 2UU9L 1X3FA 4O1NA 4UP9A 4KHPL 1DGSA 4A4IA 2AKWB 4ZKBB 4IOAA 3PO3H 1KDBA 4RCOA 1JC7A 2RSOA 4S3SA 5KNCA 3NBHB 4MTNA 3A5ZB 4IFDG 5AJ3L 1S5CD 1STNA 4ODGA 1PXUA 1F77A 1SN8A 2A6ED 2MP1A 3J7YW 4K5XA 2F3VA 1I6HH 1GHJA 1FJGQ 2BDNA 4A3BB 3PIOA 4OGQC 2LMCB 3PQIA 1B44D 2VQFQ 2VUMB 4DNTB 1I50H 4G7ZC 1JQYD 1RHPA 2KBNA 3S1NH 4DU9A 2J0TD 5FLMG 1S3OA 3I4LA 3QR8A 1G6PA 5C4JH 4DV2Q 1K28A 2JA7H 1H9SA 4TQUS 3D6CA 3SE0A 3M4YA 5IT9c 1N33Q 1LUZA 2NVYH 2F3WA 2PYKA 2OQ0A 2NVQB 2CWAA 3HZXA 5BR8Q 2KHJA 4QIWB 4WORA 3PF4A 1PTOF 1DCZA 1PZJD 3G7LA 3MAQA 1D5ZC 1CHQD 4JYAQ 4C56C 1OTCA 2F0UA 4HR7B 1IBML 2R92H 4B3ML 2PQAB 5TSSA 1SLJA 4IPDA 1VQCA 5IP7G 3OTOL 1JT8A 2UXCL 5JEAG 3Q24A 4DV1L 3DLLA 3NENA 4ZLTF 4QF4A 4YWLA 3I4NG 1HQMC 1E2WA 2J7ZA 3RLNA 2L1BA 4A3KB 3GTMH 3AYHB 1N8RC 1D7QA 4F8MA 2F03A 3S16H 4KJNA 3H0GH 3UE0A 5GAHC 3T56B 5IY0A 3AMUA 1QG7A 1RF2D 1K8MA 1IYUA 1BO0A 3ERQA 1DD2A 3MWYW 5CORA 3GD7A 1LT5D 1TWFB 1KLGD 1QUQB 2NVTB 4GN3B 5M3MG 4A3MH 1WD0A 2H5XA 1STAA 4DNIA 2KECA 3CCMA 5EKLA 1ET9A 1XMOQ 3HOZB 5IYCG 2EJMA 3PGZA 4JCVE 2E2HB 1CZWA 2ZJRA 3E0EA 1GM5A 1HTPA 3LNNA 2IX1A 1B9MA 1I94Q 3S1QH 2JXMB 5FO7B 5IGCA 1PV4A 3OW2A 5LMUQ 1CT1D 4A93H 1IBMQ 2QW7A 1SBBB 2I46A 1HH2P 4B3MQ 3A8KE 5FLXL 2PI2A 5ELFA 1VQNA 2K28A 3MTSA 1SNPA 2O2LD 3ND8A 2IX3A 1OXSC 3K57A 2UXCQ 1MSGA 4DV1Q 4A3EB 4ME3A 1JJGA 1HNWQ 2VUMG 2RDHA 1HA5A 3PV0A 4KHZA 1ENAA 4DXGA 2XN9C 4C3JB 2UUBL 3VYRA 3O13A 3D0FA 4JI7L 1AFPA 1WTOA 3BDOA 4A3FG 3NQTA 2K52A 4ZUIA 4JI0L 4LW1A 2IW3A 3OSOA 2NTTA 4QGUA 1CM9A 3RN2A 1SNQA 2RKSA 2K5VA 3RZOH 4KN4C 3I4OA 1EZ6A 5J39A 3H09A 3KBXA 2UXBL 1G6ZA 3CCQA 1EY9A 3A0JA 4L6TB 3Q6SA 1TY2A 1CKOA 2K04A 2QKIC 4L5QA 2NBFA 1UAPA 2SEBD 1Y1VH 2EE1A 1B3QA 1TS2A 4EQ5A 3DM3A 4EQPA 3A5UA 1T9HA 4HJ7A 1XPRA 1LT3D 1K8GA 2HCIA 1I6HB 2MNAA 3G48A 1CZGA 1PYSB 2XNAC 1ESFA 3G4SA 4IFDJ 3JC66 5L37A 2O5IC 1IL2A 4KY7A 1K3RA 1I50B 1VQOA 3PIO3 4NXML 4L5TA 2B2VC 2KHSA 1M90C 4AYBB 4AQYQ 3HOUB 1VQHA 4MNOA 3VYTA 3GTLB 3CW2C 1STGA 5E3FA 1YJ9A 2KOLA 5M3FH 3D31A 2JA7B 3M3YB 2WV6D 2B2VA 1VQBA 4IUPA 3HOWH 5D65A 1PYBA 1PFSA 2NZHA 4IPGA 3NEMA 4DPGA 1CK1A 4OX9L 2RF4A 3UDIA 2E75C 1SYEA 3HOXB 4J1MA 2K32A 1C9OA 1PTOH 3WOFA 4H7BA 3RD4A 3J81E 2VS1A 3CC7A 2JJQA 2EY1A 4B3SL 5FKAC 3HOZG 1VQEA 3K7AB 3STBC 2EYJA 2Q2UA 2I5MX 3K81C 4A3CH 3D4WA 1D5XC 3S14H 1NSNS 4A3DH 5E7NA 3DWQA 1R9TB 2BA1A 3GTMB 1PH3A 4A75A 2E5LL 4Y52H 1D2BA 3HOYH 1HZAA 4HJ9A 5D3DA 4F7XA 2L4NA 4K0KQ 1VF7A 1WOCA 2PZUA 3M7GA 5ELCA 4NXNL 5JEAJ 1XMQL 5K36H 5ISRA 3NHHA 4LUVA 1IL8A 1JJCB 2K50A 2HUGA 3I3CA 3KOJA 2BE5D 1F2YA 1CQFA 4YHHL 1FGUA 5FLXc 4A3EG 3K80C 4A3GB 5KRUA 1MHWC 4OO1G 3X3MA 4B3RL 4LFCL 3S15H 4FNFA 4J8QA 2R7FA 4C3JG 3BYTB 5M5XH 2PCFB 2WIIB 3U50C 2N8NA 4DR4L 1HQRD 1L1OB 5FOBB 4QQBX 1PZKD 4CDFC 1JE4A 1WTHA 4ZK9B 1TIID 1ENFA 3MFGA 3R2IA 3DXJC 1Z6HA 5JPNC 3S1RH 1GHKA 5D14A 4P71A 4A3IH 4OX9Q 1DXMA 1L1OC 3NQIA 2CH4A 1HRJA 1LTLA 1SJED 4FXGC 4IPCA 3OHXC 3TN2A 3V96A 2ICEC 2IJ0A 5FK9C 1NCVA 1UEBA 2EQSA 4OELB 4B3SQ 5CR3A 5LMNL 1EY5A 1G51A 1N32L 1SYGA 1IKMA 4DR6L 4A3LG 1L0WA 3D6WA 4PZ8A 4YCUA 3GO5A 3HRZC 3SHLA 1U4RA 2X6GA 3N6RA 4IZ8A 5IGGA 5IGDA 2E5LQ 4LF9L 5G3LF 4C2MH 1PH8A 4AYBG 3PIPA 1YBYA 3HOUG 2MQHA 3PUWA 4NXNQ 4DK1A 2F0OA 3ND9A 4H02A 4K5VA 3GTJH 5IYDH 2JA7G 5M5YH 1HA6A 1ENCA 2N3SA 1SDFA 5J22A 2QDBA 4YHHQ 2A1AA 3QIAA 4C3IH 3VA5A 1HTLD 3TMEA 4LFCQ 1UWVA 2IPKD 1A8VA 1TWHH 4X66Q 1PH2A 1ILQA 1Y1VB 4I65A 3HOXG 4DR1L 1FYCA 3PO2H 1BDOA 3IRBA 2WINB 1TWAB 2F0JA 1OXXK 4RH6A 4XTCS 4TSSA 1YNXA 3RZDB 2EYMA 2K75A 4H44C 4P75A 2GVBA 3ICEA 1EOVA 5GROA 3W5OA 4DV4Q 1BNZA 4DAVA 3CF5A 3CMAA 4DAPA 2IL8A 4CJ1B 2DN8A 4IOCA 3TZDA 5IGEA 1EU4A 3V2TA 1STBA 3P7JA 3FRPB 3RR5A 4HJ8A 5EAYA 1EWHA 1N32Q 2YTYA 2B2YC 2Q8RE 4DR6Q 3HKZE 2E2JH 1KAAA 1LV9A 2MFIA 2K1BA 2JSOA 1J5EL 3W1GA 2JP1A 1KD1C 2PNHA 4LF9Q 3S2DH 4A3GG 3DEOA 1NY4A 4KD3A 3A7AB 4DXFA 5C3EH 1YIJA 1TS3A 4EGVA 4K5WA 5LL6X 1SE2A 5EKIA 4HIOA 4NPSA 3M4OH 1D5MC 1VQJA 1PHJA 2EY5A 2HT1A 2H1EA 4CBVA 3CPFA 3FKIH 3ER0A 4JBMA 4B08A 4DR1Q 1RJTA 4EQOA 1PFBA 1CKNB 1BCPF 4LUZA 1OXVA 1DZ1A 2J4XA 1YZ6A 3QOLA 1WTVA 3KYHC 1XX8A 2MO0A 4A93G 4IUQA 4N9TA 1BKBA 4M8AA 3J80E 2ALYB 2NWGA 1KQSA 2PI2E 1VMPA 3EBEA 4KLKA 1EYAA 3TRZA 4G57A 4HTHA 2BOSA 2ZXPA 3EA6A 2OTJA 2F0KA 1WTWA 1CKNA 2DUDA 4V0BA 1E22A 2WB1E 1KRSA 3ULLA 4IO9A 1O7LA 3SK5A 1PRTB 4BY1B 3E0JA 1MIUA 3I73A 1A0IA 5ELEA 1IZ6A 1J5EQ 3J7A5 4RWSC 3OYYA 5AFWA 3RMHA 2ZTEA 3A7LA 1YVCA 1WFQA 5A2QE 2NTSA 3S1MH 1H9MA 1PRTC 1Q46A 3KF6A 2AUJD 2A74C 2LFNA 2Q2HA 3HG9A 1TWCB 4ZKCB 4WFN3 1T5EA 3CKIB 1Y1VG 3NBIA 2KCTA 1S4ZA 5CV6A 1QJOA 4CKEA 1LO5D 1PMRA 3FDTA 1FVIA 4DR5L 3HOVH 5IWAL 2M9VA 1BR9A 3HKSA 2AMCB 3KLSX 3T51B 2HHHL 5E4WC 3CU7A 1EQQA 3C1EA 3OIQA 3TQYA 4KJOA 1ICFB 3CCUA 3EIVA 5C3XA 5IOCA 1VQDA 1U9RA 4R4TA 3H15A 1CTMA 4JI3L 4DV2L 3L7ZC 2CHBD 1DOLA 3OPOA 1RD9D 5M3FG 2NVXB 3PIP3 2XIWA 1M1KC 3I90A 3RNUA 1WCMH 5JJKA 4OONA 4C3IB 5I9PA 2G9DA 1EIYB 3R8BA 4POFA 1II3A 3A74A 5BR8L 2LSSA 1C7YA 1ZEQX 4R4CA 3K6OA 4FVMA 5KGUA 2RSNA 2K5NA 3FHWA 3VR6A 1YHBA 3GQBA 1HR0W 1RL2A 3PO2B 4JYAL 4GS3A 2L11A 2F0FA 4H0LC 5BN4A 2XGTA 4HIDA 4BXXG 1S5DD 4IUUA 4JW0A 4RFBA 2A6HD 2PO4A 4OIJA 2MGSA 2PMZE 3A56A 4EQNA 2F0QA 2NZ1D 3B6YA 2NZOA 3NTHA 4PZ6A 2A19A 5ELOA 5J3BA 4BY7H 3UDXA 1RKNA 1MBYA 3MEFA 1H9SB 4K2KA 2CQAA 4LUOA 4AIMA 4DR5Q 1HPCA 3STBD 5IWAQ 2HHHQ 2WKDA 3S17H 1PA6A 4OIKA 3E5SA 3A55A 4ZYSA 3K5MA 3CCVA 1QZHA 2YU9H 2BH8A 1STHA 4O2DA 2F0DA 2CH4W 1RIPA 1U0LA 2VY3A 3TBIB 4A3FB 2EVBA 4JI3Q 2K03A 2QEXA 2SDFA 2Z6BA 5C3EB 1Y1WH 1FD7D 1O78A 1TR5A 5F2DA 1YI2A 2MHVA 1X3QA 4ZAIA 1BOSA 1MSHA 3HP3A 3M4OB 2D0OA 2AQ2B 1XMOL 2Y0SB 4BY1G 5CV8A 1X55A 4LF6Q 2R7ZH 2PQEA 3GTPB 1LABA 4A3IG 3EQLC 3HKZB 3J81L 1I94L 1HZ9A 1AE3A 4DF7A 4GZYC 3I7FA 5LMUL 2AWOA 2XSCA 5EBCA 3ONAB 3HFZB 1WI5A 4IPHA 5CBAE 1U4MA 2CCZA 3LWUA 1OO9B 5E4XA 4YCVA 1JCKB 1XTDA 4FXKC 5C6AA 4P72A 1HNWL 4JC0A 1M8AA 4I7ZC 4HJ5A 4FF1A 3TREA 4IUTA 3H3VC 3J80i 4FF3A 1FNUA 2AUKA 4K8JA 1SRUA 1E1TA 3L3OC 1ASYA 1I4XA 3SK8A 1FL0A 3BVMA 4CDEC 1QCBD 3FPPA 5C0XI 1T5XD 4C3IG 1Q12A 2HIVA 1SYBA 1XPUA 5A35A 2B2TA 2LS01 4OWTB 1XNQL 2F3IA 2TSSA 4MTKA 1YJNA 3GTQH 1HZBA 4N8FA 1EIGA 2V4DA 4RA8A 2FXQA 1VQAA 1SNMA 4OHJA 4FO2A 2HD3A 3E6ZX 3PO2G 1K0RA 1AE2A 3I56A 3F2CA 2IHEA 4QL5A 1A6XA 4DV6L 1QOHA 3BJUA 4KV6A 1EEFD 2WB1B 2ENBA 5C5LA 2RVLA 4KHVA 4POGA 4IALA 3AFPA 1Y8OB 4LF5Q 2N88A 1KTKA 4HEDA 4BS9A 2D62A 4XQQA 4AQYL 1WVLA 1PH1A 5C4XH 1S72A 4K14A 3ITPA 3TDQA 2Z8LA 5COYA 4A3JH 1EWCA 3I4MB 4BA1I 1SEBD 2DY8A 3BDLA 3CPWA 1NTGA 1B1ZA 2DJGC 3K5LA 3N52A 1EY6A 5M5WB 1I4PA 4Z9CB 1A2UA 2OEOA 1VQFA 4LF8Q 3QJYA 4P74A 2RDFA 1A63A 2VQEL 3NPPA 3H6MA 3D3RA 1J8IA 5C3EG 2D2CC 3KLWA 1CHPD 1SYCA 4JI6L 4F88A 2IT1A 2Y0SG 2Q8IB 5T1IA 5KNBA 2A5HA 1Q1EA 3PO3B 4ME5A 3R3OA 2NN6G 3BVGA 1EL0A 4N8X1 2B2UA 1XNQQ 3KLSA 4QY7A 1EZ8A 1QNUA 1I3QH 2B2WC 3X3NA 3M4QA 1LTSD 5CV7A 5DAUA 1H95A 1TS5A 1YHQA 4BY7B 3HKZG 3IFDA 2KUMA 3KF8A 2ID0A 2EYPA 5ELNA 1VQ9A 1F2MA 1CKMA 4K0KL 4NDXA 3K8AA 3J81c 2B2WA 4DV6Q 2RCNA 1LT4D 1PTOD 3BZCA 3SK4A 2FJ2A 2OWOA 3FMCA 2ICIA 3CCLA 1NMFA 3S17B 3GTKH 2PZTA 2DJFC 2CW0C 3AQQA 5I4DA 3BZDB 2YU9B 2JYOA 3S1NB 3NSWA 3NXWA 3W1BA 5EPLA 1UUPA 1IBKQ 2JA6H 1O7ZA 3HGBA 5LHY1 1VQ8A 1EYCA 1ONLA 2F52A 2AQ1B 2PMZB 1VQMA 5C4JB 4C3HH 3Q0AA 1LTAD 1SNOA 2ZJQA 2JK8A 3RN5A 2V1CC 4GKKQ 3KK7A 1STEA 1S5FD 5IP9G 1GJXA 2OT2A 1A2TA 2NVYB 2ASBA 3H94A 1AEXA 2A69C 4ZRZA 4I7AA 4P2CB 2KCCA 3UDGA 5JVH3 2A6HC 2ATWA 1LACA 3S9WA 2VQEQ 2F0LA 3VDYA 1E3PA 3MHBA 1SNDA 2ES2A 4OEMB 2R92B 1K83H 2R93H 4JI6Q 4XQJA 1VQGA 1X3EA 5HURA 1QVCA 2WKCA 5DM63 4BBRH 1PRTD 4MHEA 1SE8A 1UE1A 2B63H 4JI5Q 2WB1G 1CSPA 1XJVA 3W3AA 1BCPC 2C5CA 2ZTDA 1NR4A 2EXDA 1Z7TA 1D8LA 4IJLA 3S16B 3VR5A 3H0GB 2L5TA 3J80L 1TWGH 3AEVA 3CCEA 1C8CA 3WDNA 2EJGC 3OMCA 3PMFA 5HGQA 4XT1B 2D5DA 5EKKA 1EQTA 5IE8A 1SFOH 3I4MG 3J7AV 4K6LA 5FO8B 2FMCA 4G4KA 1YNNC 3TP8A 2EXZA 4A3MB 2NUCA 4X66L 3TZUA 1R4QB 1RDPD 3DWAA 1EYGA 4X3UA 1LM0A 3EROA 4NB3A 5C0XH 2JA9A 4PV1C 3QWNA 5A2QL 5FLMH 4DV4L 5GADC 3PO3G 1JOQA 1X54A 5M9OA 3S1QB 3C2PA 1QNKA 1G2TA 1JOOA 4A93B 5FJ8H 1E7ZA 1SMYD 3U9OA 1NAPA 1UE6A 3OWFA 4BY7G 4DKAC 1AZQA 1K8OA 1X9NA 3RUZA 3SEBA 1I4HA 4A3JB 2Z0SA 5IYBH 2RHQB 4JI1Q 1AP0A 4X3SA 2NYZD 1YNJC 2JA8H 2X6LA 1D6EC 1C48A 4DR3Q 1TKWB 4X64Q 5J1ZA 4JPBW 4LFBQ 3PUYA 2OF1A 2JA5H 2I0QA 4LMQD 1JWUD 4FP5D 2KENA 3I4NH 1K9MC 3WWVA 3RZOB 2F0VA 4OO1I 1ASZA 1PLFA 1CUKA 5KYIA 1Q8KA 4PNYA 4IUNA 4GKJL 2CFMA 3M85A 1SJHD 5D3IB 3JAME 2PW5A 3NK9A 3SK6A 1UE7A 4PMBA 3K5NA 1X6OA 5DM73 1VQPA 3GTOH 2R92G 1EEID 2M00A 1QILA 4JV5L 4YWMA 2CKZB 3GTGH 4XYQA 1JB3A 5M3MH 1S5BD 2O5JC 3UE1A 1RTOA 2XRSD 4E6IA 3OIPA 2Y0SE 3CCJA 4RGOS 4LAAA 3CC2A 1EQRA 5IYCH 4DUZQ 1HR0L 3L2PA 4QCLA 2D0PA 4R1JA 4DK3C
chains in the Genus database with same CATH topology
5M3FB 1EY8A 3QOJA 3HEJA 3HOWB 2L55A 3OWEB 1ICWA 3NWSA 3SR1A 3C46A 2K7VA 4FYDA 4JBWA 3VYSA 3C1FA 1V8QA 1PTOB 1B4OA 2WP8J 1TQOA 2R93B 5JVG3 3K0YA 3CRLC 4IUVA 2F0MA 1PTOC 1EY4A 1Q1BA 3NE5B 3S14B 1JWSD 3I70A 4A3DB 4XIGS 1A3VA 1V1PB 4KMUC 3NP8A 3HOYB 1FNVA 4PMWA 2EYOA 2F4IA 1EY0A 1TT2A 1SFOB 1QB5D 4CKCA 2FHTA 2EZVA 3V05A 1RTNA 1GUOA 3S15B 2EYHA 5M5XB 3CRKC 1V1PA 4ID6A 2K01A 3R93A 3FPUB 2RQXA 5EBDA 2G9HD 3S1RB 5G3LD 4A3IB 3PUZA 1HXYD 4IN3A 4EVOA 3K59A 4QMGA 1J9OA 5EPKA 3ZYYX 2OXPA 2VB3X 1CA6A 3IL8A 1ML0D 2EYFA 1PDQA 2SNMA 5EGTA 1XYIA 1GXDC 3PUVA 5IGBA 2QEJC 1ESRA 3BDCA 3MXNA 5I2YA 1STYA 1Y69U 1BXTA 3P1HA 1DOKA 1B53A 2JA8B 4MN3A 4C2MB 2R61A 4DAYA 1HUMA 2RA4A 2F0IA 2JA5B 4NKLA 1NR2A 5E1FA 3GTJB 5M5YB 2CW0D 3MZ5A 1Y8PB 1I4GA 2F0NA 4TKOB 5ELDA 5HGTA 1TWHB 4QUCA 1AW7A 1ZYRC 1A15A 5I6YA 2F0HA 4TRDA 4G7HC 5IGFA 3NUCA 3A8JE 2A69D 2R3ZA 1SMYC 1SYFA 4OO1H 3DHQA 1MD2D 2Z4IA 4C1NI 1QE6A 1SNCA 1S5ED 4F87A 1H9KA 2IX0A 4RGMA 1KNEA 2WACA 1BF4A 2A68D 5BN3A 1GUSA 2HQEA 1EQVA 2K05A 3AU7A 4DFAA 2BCOA 2KCNA 2F0EA 1SE4A 4L8JA 5C4HA 2KVMA 1SSOA 5K36G 2E2JB 3PUXA 2RDGA 5BN5A 4HSPA 1UEAB 1BCPD 2Z1CA 3BG3A 2EYLA 3MVVA 3S2DB 1PZID 1F9PA 2EOTA 2DNCA 1XXGA 1DONA 4V190 2HDMA 1JORA 3QB3A 1ILPA 1EFID 2EDGA 1HFNA 3VA7A 1OXTA 5C0XG 5JOBA 2KEDA 1A3UA 1U4LA 1YNND 4HMIA 1ZXTA 3FKIB 1A3TA 3NBHA 2XRQD 1O80A 4RCNA 4QB4A 1IW7C 5EQ0A 3EVQA 1SYDA 1G291 5C3WA 2K6AA 1VF5C 1G2SA 1DOMA 1I4RA 5IIFA 1EYDA 3I72A 1L0XB 3SVMA 5FO9B 4IFDI 1H9RA 4B9WA 5CBEE 1B50A 2XVSA 1HCZA 3UI2A 3FEWX 4N9PA 3DMUA 4FF2A 2B2TC 1WTRA 2F0TA 1YNJD 1JICA 3TP6A 4K8IA 1LTRD 3KLRA 4FXDA 3S1MB 4Q0FA 3I8ZA 5IT9E 2D9UA 1WD1A 3URYA 3DEPA 4U673 2TMPA 1MI2A 4O42A 5ELBA 2KJXA 4RKLA 1SE3A 1IHZA 1GOZA 3VR2A 1F9SA 2HDLA 4HCSA 1H9JA 3HOVB 2BDOA 3DM1A 4FF4A 1HFGA 4B9XA 3MXUA 4RAUC 5CV5A 3R2TA 2BA0A 1SAPA 1PRTF 1Q3LA 1C4QA 4NP5A 3BVZA 5CV4A 4WRDA 2Q8TA 3W2DA 3T4AC 2N55A 1E2VA 1LTGD 1SXTA 4Y7NB 2PPBC 4KD4A 3TP7A 3OOCA 1IKLA 1B3AA 1WCMB 3K58A 4CKBA 3T53B 2VNUD 2DY7A 4YIJA 1MGSA 1KNAA 1FR3A 3MC0B 3FVQA 1M4VA 1KLUD 3MA2B 2B2UC 5KNDA 4XDXA 3M7NA 1AZPA 2K5WA 2WAQB 3GP7A 4NW2A 4KKTA 4LJZC 3RLFA 3JAML 5LL6S 1JOKA 4HMJA 1LT6D 3MXGA 4R8IA 3D4DA 2JE6I 3L9AX 4KKUA 1FNWA 1CI3M 1D1KA 1XTCD 1W6JA 1V1OA 4KK7A 3BYYB 2XWBB 3C3LA 5DNFA 2L0CA 1E2ZA 1F9RA 1LLRD 2FFKB 2B39A 1LTTD 1Y1WB 3VR3A 3IKJA 4LK1C 4DK0A 4MIUA 4XXEA 2K33A 2R7ZB 4RGNA 4X3KA 1LTBD 2IWHA 4NMZA 3I91A 3LWEA 3G6JB 1LTID 2KA7A 5C4ZA 2E76C 1W6KA 1VDZA 1X32A 2PW7A 1RCVD 2A68C 4Q5VA 4R9WA 1BCPB 5C0XJ 4G7OC 2L9HA 1VMCA 5IODA 2E2IB 1BBXC 3A54A 2JEBI 2NN6I 3NTKA 2MPMA 1ET6A 2K5QA 2A6EC 3KUPA 2R6GA 2FMMA 2MUYA 1HHVA 5C5MA 5JPMC 4IFDH 1I4QA 1KABA 4BWGB 5I2XA 4IURA 1EY7A 2SNSA 4ILWA 4DA2A 4M1UB 5C44B 3GTQB 4PQXA 3S2HB 4DNRB 4CGYB 1KDAA 1TU2B 2F0GA 2QCPX 4UAIA 1UNSA 2ZXOA 3BS1A 5EJWA 3EFXD 1PFNA 1ZYRD 3T16A 2EJFC 2LY7A 3GV3A 1RODA 1AN8A 2ZT9C 4HSVA 1F2ZA 2F0SA 1EIHA 2HCCA 5C4XB 1Q8IA 2A73B 1F9QA 1G91A 1TVXA 4DN4M 1TS4A 2PZWA 2L12A 3MXPA 5CGKA 1GUGA 4OL7A 5NUCA 3VR4A 4QUFA 4XYOA 1DJRD 3IFTA 1B2TA 2SOBA 4KKSA 1GUNA 5DEHA 5FLXE 5JEAH 4XQNA 1X3PA 3Q22A 2F1MA 1KDCA 4CHTB 1DM0B 2E74C 4PMCA 1G8ZD 4KN7C 1I3QB 3DUZA 1EU3A 1WTXA 1OXUA 4XT3B 1B9NA 3CQZB 1E0BA 2KQ3A 3J7AF 3KBGA 4DGZA 1IYVA 1EOTA 2XWJB 2KEEA 4BA2I 3SXHA 2NB0A 1L0YB 2RBMA 3GTKB 4H13C 1Z47A 1PYWD 4HCEA 3QO2A 3P20A 4R8NA 1IW7D 4U68A 1JWMD 3NTIA 4J6HA 2JA6B 4HAEA 2AWNA 3EJIA 1Q90A 2EPBA 1QWYA 1HUNA 2C9OA 4KI0A 4C3HB 4RKBA 5KEEA 5CV9A 3MFYA 4L63B 1PFMA 3VYUA 2B8GA 5I6WA 2LKVA 2F0PA 1TY0A 3SDZA 1FGBD 2E2DC 4BBSB 1F2LA 4RHRA 2O4XA 2GA4B 1K83B 2Z4HA 3CHBD 1V43A 4C1NK 3A8IE 4BBRB 2B2YA 3AB9A 3GV6A 2B63B 1BQQT 4KTAA 2PNRC 3WOEA 4IQZA 3NWTA 1ZKOA 3TP5A 3F2UA 2QF7A 5K5PA 3IAYA 1TWGB 2NN6H 2B8FA 1Y8NB 2CVRA 5T1GA 1O7YA 2K5DA 4KY6A 4RGTA 5JJZA 4X3TA 2VXWA 3DWPA 5CMDA 1CQVA 4K2LA 1GUWA 3LX0A 5IT9L 1GUTA 2QILA 2VB2X 3TSSA 5CYUA 2ZXRA 4UDUC 5EPJA 4ZUJA 1R4PB 2DNEA 2EY2A 2M2LA 2I07B 3H91A 1NUCA 1BUVT 4KY5A 4K6DA 2EY6A 1I6VC 3QG1A 4JK1C 2X69A 1U4PA 2AQ3B 3D4RA 5KIXA 3K5OA 4CJ0B 3HS0C 4ABNA 1DYQA 1CFMA 4ULLA 3OMGA 4C3HG 5I9OA 4HN7A 3Q23A 3I4NB 3T13A 2BE5C 5CC4A 2H4OA 3P75A 1VCIA 1CA5A 3GTOB 1WTQA 3OW7A 1XWEA 3U9SA 2YYZA 1D1IA 3GTGB 5M3MB 1JR0D 1WTPA 3MEHA 2MJ8A 2FINB 5KYLA 3D8GA 4ZQ3A 5JAVA 4CJ2C 4RHSA 4WJWA 2JEAI 2F0WA 4O1NA 4ZKBB 1KDBA 4RCOA 1JC7A 2RSOA 4S3SA 5KNCA 4IFDG 1S5CD 1STNA 4ODGA 1PXUA 1F77A 2A6ED 2MP1A 3J7YW 4K5XA 2F3VA 1GHJA 2BDNA 4A3BB 4OGQC 2LMCB 1B44D 2VUMB 4DNTB 4G7ZC 1JQYD 1RHPA 4DU9A 2J0TD 3I4LA 1H9SA 4TQUS 3D6CA 3SE0A 3M4YA 2F3WA 2PYKA 2NVQB 3HZXA 4QIWB 4WORA 1PTOF 1DCZA 1PZJD 3G7LA 3MAQA 1D5ZC 1CHQD 4C56C 2F0UA 4HR7B 5TSSA 5JEAG 3Q24A 4ZLTF 4QF4A 1HQMC 1E2WA 2J7ZA 2L1BA 4A3KB 4F8MA 2F03A 4KJNA 3T56B 3AMUA 1QG7A 1RF2D 1K8MA 1IYUA 1BO0A 3ERQA 1DD2A 3MWYW 5CORA 3GD7A 1LT5D 1TWFB 1KLGD 2NVTB 1WD0A 1STAA 2KECA 5EKLA 1ET9A 3HOZB 2EJMA 2E2HB 1CZWA 1HTPA 3LNNA 2IX1A 1B9MA 2JXMB 5FO7B 5IGCA 1CT1D 1SBBB 2I46A 3A8KE 5FLXL 5ELFA 2K28A 3MTSA 1SNPA 2O2LD 3ND8A 2IX3A 1OXSC 3K57A 1MSGA 4A3EB 2RDHA 1HA5A 3PV0A 4KHZA 1ENAA 4DXGA 2XN9C 4C3JB 3VYRA 3O13A 1AFPA 1WTOA 3BDOA 3NQTA 4ZUIA 2IW3A 3OSOA 2NTTA 1CM9A 1SNQA 2RKSA 4KN4C 5J39A 1EZ6A 3H09A 3KBXA 1G6ZA 1EY9A 4L6TB 3Q6SA 1TY2A 2K04A 2QKIC 2NBFA 1UAPA 2SEBD 2EE1A 1TS2A 4EQPA 1LT3D 2HCIA 1I6HB 1CZGA 2XNAC 1ESFA 4IFDJ 2O5IC 4KY7A 1I50B 3PIO3 2B2VC 2KHSA 4AYBB 3HOUB 3VYTA 3GTLB 1STGA 5E3FA 2KOLA 3D31A 2JA7B 3M3YB 2WV6D 2B2VA 4IUPA 5D65A 1CK1A 2E75C 1SYEA 3HOXB 4J1MA 2K32A 1PTOH 3WOFA 4H7BA 3RD4A 3J81E 2EY1A 5FKAC 3K7AB 2EYJA 3D4WA 1D5XC 1NSNS 3DWQA 1R9TB 2BA1A 3GTMB 1D2BA 5D3DA 4F7XA 2L4NA 1VF7A 3M7GA 2PZUA 5ELCA 5JEAJ 5K36H 5ISRA 3NHHA 1IL8A 2HUGA 3I3CA 2BE5D 1F2YA 1CQFA 4A3GB 5KRUA 4OO1G 3X3MA 4FNFA 4J8QA 4C3JG 3BYTB 2PCFB 2WIIB 1HQRD 5FOBB 1PZKD 1JE4A 4ZK9B 1TIID 1ENFA 3MFGA 3R2IA 3DXJC 1Z6HA 5JPNC 1GHKA 5D14A 1DXMA 3NQIA 1HRJA 1SJED 4FXGC 3OHXC 3TN2A 3V96A 2ICEC 2IJ0A 5FK9C 1NCVA 5CR3A 1EY5A 1SYGA 1IKMA 3D6WA 3GO5A 3HRZC 3SHLA 1U4RA 2X6GA 3N6RA 4IZ8A 5IGGA 5IGDA 5G3LF 3PUWA 4DK1A 2F0OA 3ND9A 4K5VA 1HA6A 1ENCA 1SDFA 5J22A 2QDBA 3QIAA 3VA5A 1HTLD 3TMEA 2IPKD 1ILQA 1Y1VB 4I65A 1FYCA 1BDOA 2WINB 1TWAB 2F0JA 1OXXK 4RH6A 4XTCS 4TSSA 3RZDB 2EYMA 4H44C 1BNZA 4DAVA 4DAPA 2IL8A 4CJ1B 2DN8A 3TZDA 5IGEA 1EU4A 3V2TA 1STBA 3P7JA 3FRPB 1EWHA 2B2YC 2Q8RE 1KAAA 1LV9A 2K1BA 2JSOA 2JP1A 3DEOA 4KD3A 3A7AB 4DXFA 1TS3A 4EGVA 4K5WA 5LL6X 1SE2A 5EKIA 1D5MC 2EY5A 2H1EA 4CBVA 4B08A 1RJTA 4EQOA 1PFBA 1BCPF 1OXVA 1DZ1A 2J4XA 3QOLA 1WTVA 1XX8A 4IUQA 4N9TA 4M8AA 3J80E 2NWGA 1VMPA 1EYAA 4G57A 4HTHA 2BOSA 2ZXPA 3EA6A 2F0KA 1WTWA 4V0BA 1O7LA 3SK5A 1PRTB 4BY1B 3E0JA 3I73A 5ELEA 4RWSC 3RMHA 5AFWA 3A7LA 5A2QE 2NTSA 1H9MA 1PRTC 2AUJD 2A74C 2LFNA 3HG9A 1TWCB 4ZKCB 4WFN3 1T5EA 3CKIB 3NBIA 1S4ZA 5CV6A 1QJOA 4CKEA 1LO5D 1PMRA 3FDTA 2M9VA 1BR9A 3KLSX 3T51B 5E4WC 3CU7A 3C1EA 3OIQA 4KJOA 5C3XA 5IOCA 1U9RA 1CTMA 3L7ZC 2CHBD 1DOLA 3OPOA 1RD9D 2NVXB 3PIP3 2XIWA 3I90A 4C3IB 5I9PA 2G9DA 3R8BA 1II3A 1ZEQX 3K6OA 4FVMA 5KGUA 2RSNA 3VR6A 3GQBA 3PO2B 2L11A 2F0FA 4H0LC 5BN4A 1S5DD 4IUUA 4RFBA 2A6HD 2PO4A 4OIJA 2MGSA 3A56A 4EQNA 2F0QA 2NZ1D 3NTHA 1RKNA 1MBYA 1H9SB 4K2KA 2CQAA 1HPCA 2WKDA 4OIKA 3E5SA 3A55A 4ZYSA 3K5MA 1STHA 2F0DA 4A3FB 3TBIB 2EVBA 2K03A 2SDFA 5C3EB 1FD7D 1O78A 1TR5A 5F2DA 2MHVA 1X3QA 4ZAIA 1BOSA 1MSHA 3HP3A 3M4OB 2AQ2B 2Y0SB 5CV8A 2PQEA 3GTPB 1LABA 3EQLC 3HKZB 3J81L 4DF7A 4GZYC 2AWOA 2XSCA 5EBCA 3ONAB 5CBAE 1U4MA 3LWUA 1OO9B 5E4XA 1JCKB 4FXKC 5C6AA 1M8AA 4I7ZC 4FF1A 4IUTA 3H3VC 4FF3A 1FNUA 2AUKA 4K8JA 3L3OC 1I4XA 3SK8A 3BVMA 1QCBD 3FPPA 5C0XI 1T5XD 4C3IG 1Q12A 1SYBA 5A35A 2B2TA 2LS01 2TSSA 1EIGA 2V4DA 4RA8A 1SNMA 4OHJA 4FO2A 3E6ZX 1A6XA 1QOHA 4KV6A 1EEFD 2WB1B 2ENBA 5C5LA 2RVLA 4KHVA 4IALA 1Y8OB 2N88A 1KTKA 4HEDA 4BS9A 2D62A 4XQQA 1WVLA 4K14A 3ITPA 3TDQA 2Z8LA 5COYA 1EWCA 3I4MB 4BA1I 1SEBD 2DY8A 3BDLA 1B1ZA 3K5LA 3N52A 1EY6A 5M5WB 1I4PA 4Z9CB 1A2UA 2OEOA 3QJYA 2RDFA 3NPPA 3H6MA 3D3RA 1J8IA 2D2CC 1CHPD 1SYCA 4F88A 5KNBA 2IT1A 2Q8IB 5T1IA 2A5HA 1Q1EA 3PO3B 4ME5A 3R3OA 2NN6G 3BVGA 1EL0A 2B2UA 3KLSA 1EZ8A 1QNUA 2B2WC 3X3NA 1LTSD 5CV7A 5DAUA 1TS5A 4BY7B 3IFDA 2KUMA 3KF8A 2ID0A 2EYPA 1F2MA 4NDXA 2B2WA 1LT4D 1PTOD 3SK4A 2FJ2A 3FMCA 2ICIA 3S17B 2PZTA 2CW0C 5I4DA 3BZDB 2YU9B 2JYOA 3S1NB 3NSWA 3NXWA 5EPLA 1UUPA 1O7ZA 3HGBA 5LHY1 1EYCA 1ONLA 2AQ1B 2PMZB 5C4JB 3Q0AA 1LTAD 1SNOA 3KK7A 1STEA 1S5FD 1GJXA 2OT2A 1A2TA 2NVYB 3H94A 1AEXA 2A69C 4ZRZA 4P2CB 2KCCA 5JVH3 2A6HC 1LACA 3S9WA 2F0LA 3MHBA 1SNDA 2R92B 4XQJA 5HURA 2WKCA 5DM63 1PRTD 4MHEA 3W3AA 1BCPC 2C5CA 1NR4A 1Z7TA 3S16B 3VR5A 3H0GB 2L5TA 3J80L 1C8CA 3WDNA 2EJGC 3OMCA 3PMFA 4XT1B 2D5DA 5EKKA 1EQTA 3J7AV 4K6LA 5FO8B 2FMCA 4G4KA 1YNNC 3TP8A 2EXZA 4A3MB 2NUCA 3TZUA 1R4QB 1RDPD 3DWAA 4X3UA 3EROA 5C0XH 4PV1C 3QWNA 5A2QL 1JOQA 5M9OA 3S1QB 3C2PA 1QNKA 1G2TA 1JOOA 4A93B 3U9OA 1SMYD 1NAPA 3OWFA 1AZQA 1K8OA 3RUZA 3SEBA 1I4HA 4A3JB 1AP0A 4X3SA 2NYZD 1YNJC 2X6LA 1D6EC 1C48A 1TKWB 5J1ZA 3PUYA 2OF1A 4LMQD 1JWUD 4FP5D 3RZOB 2F0VA 4OO1I 1PLFA 5KYIA 4PNYA 4IUNA 3M85A 1SJHD 5D3IB 3JAME 2PW5A 3NK9A 3SK6A 4PMBA 3K5NA 5DM73 1EEID 2M00A 1QILA 4XYQA 1JB3A 1S5BD 2O5JC 1RTOA 2XRSD 4E6IA 3OIPA 4RGOS 4LAAA 4QCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGB A;  5I9P A;  1EY8 A;  2EY5 A;  5CR3 A;  4S3S A;  1EY5 A;  1STG A;  3QOJ A;  3HEJ A;  1A3U A;  2KQ3 A;  5CV7 A;  3BDC A;  5DAU A;  1STA A;  1SYG A;  4HMI A;  4YIJ A;  1A3T A;  5E3F A;  1II3 A;  1STY A;  4K2L A;  4DGZ A;  4ODG A;  1STN A;  3P1H A;  3SXH A;  5EKL A;  2EYP A;  5KGU A;  3ERO A;  4QB4 A;  1F2M A;  3LX0 A;  5C5M A;  4K8J A;  3SR1 A;  4K5X A;  3SHL A;  4NDX A;  2F3V A;  2RBM A;  4EQO A;  3EVQ A;  3SK4 A;  1SYD A;  4R8N A;  1JOQ A;  2F0F A;  4IZ8 A;  5C3W A;  5IGG A;  5IGD A;  4J6H A;  3C1F A;  2PZT A;  1KAB A;  2F0I A;  3QOL A;  3SK8 A;  5M9O A;  1SYE A;  4NKL A;  5IIF A;  4ZUJ A;  3EJI A;  1EYD A;  3NXW A;  4N9T A;  5E1F A;  4J1M A;  1EY7 A;  2SNS A;  1JOO A;  4H7B A;  2F0O A;  1TQO A;  3U9O A;  4RKB A;  5IGC A;  3MZ5 A;  3OWF A;  1JOK A;  2EY2 A;  1EYC A;  1SYB A;  2F0Q A;  4K5V A;  4DU9 A;  5CV9 A;  4EQN A;  5KEE A;  2EY1 A;  1EYA A;  4HMJ A;  1ENC A;  2F0N A;  3RUZ A;  2QDB A;  1NUC A;  4B9W A;  5J22 A;  1SNO A;  2F0M A;  4KY5 A;  1EY4 A;  5HGT A;  1KDA A;  4K6D A;  2EY6 A;  3VA5 A;  1SNP A;  4G57 A;  2F0G A;  4HTH A;  3TME A;  2EYJ A;  3D4D A;  1SNM A;  1RKN A;  1A2T A;  1AEX A;  3D4W A;  4K2K A;  5I6W A;  1A3V A;  4N9P A;  3D6C A;  3DMU A;  2LKV A;  2F0K A;  1NSN S;  5I6Y A;  2F0H A;  2F0P A;  4TRD A;  2F3W A;  4I65 A;  2PYK A;  3T16 A;  3NUC A;  5IGF A;  3NP8 A;  5KIX A;  3SK5 A;  4KV6 A;  5J1Z A;  2F0T A;  1ENA A;  1SYF A;  2EYO A;  3OMG A;  2ENB A;  2O4X A;  3HZX A;  2OF1 A;  3E5S A;  5C5L A;  4KHV A;  4K8I A;  4IAL A;  3TP6 A;  2F0J A;  4WOR A;  2F0L A;  3DHQ A;  1EY0 A;  3S9W A;  3T13 A;  1F2Z A;  2F0S A;  3MHB A;  4F7X A;  1SND A;  2EYM A;  2PZU A;  1STH A;  5ISR A;  3NQT A;  1SNC A;  1TT2 A;  2F0D A;  3NHH A;  4ZUI A;  5CC4 A;  5KRU A;  3OSO A;  2F0U A;  2F0V A;  2WAC A;  4K14 A;  3ITP A;  1F2Y A;  1SNQ A;  2RKS A;  3P75 A;  4RKL A;  5HUR A;  1TR5 A;  5F2D A;  2PZW A;  2HQE A;  1EZ6 A;  1IHZ A;  3MXP A;  5CGK A;  5KYI A;  1EQV A;  2EYH A;  4MIU A;  4PNY A;  4KTA A;  4IUN A;  4DFA A;  5I9O A;  5IGE A;  5CV6 A;  3V2T A;  2F0E A;  4ID6 A;  4OL7 A;  1STB A;  5NUC A;  5JOB A;  5C4H A;  1EY9 A;  5CV8 A;  2PW5 A;  3TP5 A;  3BDL A;  3NK9 A;  4B9X A;  2SOB A;  3SK6 A;  5CV5 A;  4PMB A;  2PQE A;  4NMZ A;  4QF4 A;  1EY6 A;  5K5P A;  5DEH A;  1A2U A;  2OEO A;  3C1E A;  4EQP A;  1KAA A;  4NP5 A;  5C4Z A;  5CV4 A;  4KJO A;  2M00 A;  2RDF A;  4WRD A;  2EYL A;  2PW7 A;  4F8M A;  4EVO A;  3H6M A;  3MVV A;  3MEH A;  4KJN A;  4QMG A;  4DF7 A;  5C3X A;  1KDC A;  5IOC A;  1U9R A;  4PMC A;  3OMC A;  5KYL A;  3PMF A;  2OXP A;  3D8G A;  4ZQ3 A;  5IOD A;  5JAV A;  5EKK A;  4E6I A;  1SYC A;  2EYF A;  4KD3 A;  4KD4 A;  4LAA A;  3ERQ A;  4KY6 A;  3TP7 A;  2F0W A;  2SNM A;  4KY7 A;  5EGT A;  4ME5 A;  1JOR A;  3QB3 A;  4K5W A;  3R3O A;  2KHS A;  5J39 A;  3TP8 A;  2EXZ A;  1KDB A;  2NUC A;  1EZ8 A;  5C6A A; 
#chains in the Genus database with same CATH topology
 5M3F B;  1EY8 A;  2LXJ A;  3QOJ A;  3H0G G;  3HEJ A;  2E8G A;  3HOW B;  3BZK A;  1GD7 A;  2L55 A;  2IY5 B;  3OWE B;  4R4I A;  3ULJ A;  1KXL A;  1ICW A;  3NWS A;  3SR1 A;  3C46 A;  2K7V A;  3J80 c;  4FYD A;  1SRO A;  4JVZ A;  1QVG A;  4JBW A;  4FDB A;  3VYS A;  3C1F A;  1V8Q A;  1NE3 A;  1PTO B;  2QGQ A;  1B4O A;  2YTV A;  4A3M G;  4A3B H;  2WP8 J;  1TQO A;  2VUM H;  2R93 B;  5JVG 3;  3K0Y A;  2Z6K A;  3CRL C;  4IUV A;  1E24 A;  2F0M A;  1PTO C;  1EY4 A;  1Q1B A;  3NE5 B;  3S14 B;  1JWS D;  2QA4 A;  4GKJ Q;  3I70 A;  4A3D B;  4IJH A;  4XIG S;  1A3V A;  1V1P B;  4JI2 Q;  4KMU C;  3NP8 A;  3HOY B;  1FNV A;  4PMW A;  2EYO A;  1TXY A;  1NMG A;  2F4I A;  3CC4 A;  4JV5 Q;  1EY0 A;  5C4X G;  3SGI A;  2ZJP A;  1NJI C;  3TS0 A;  5H1S E;  1TT2 A;  4A3J G;  2RCF A;  2UUA L;  1SFO B;  3KF6 B;  1QB5 D;  4CKC A;  4GOP A;  2FHT A;  2EZV A;  1I5F A;  1HR0 Q;  3V05 A;  1RTN A;  1GUO A;  3S15 B;  2EYH A;  5M5X B;  3CRK C;  1V1P A;  4ID6 A;  2K01 A;  3R93 A;  3FPU B;  2F4V Q;  2RQX A;  5EBD A;  2G9H D;  3S1R B;  5G3L D;  3KDF A;  3PUZ A;  1HXY D;  4IN3 A;  4EVO A;  3K59 A;  4QMG A;  4A3K H;  4A3I B;  4R4O A;  1YIT A;  1J9O A;  5EPK A;  2VW9 A;  3ZYY X;  2OXP A;  4EX5 A;  3F2B A;  2VB3 X;  1CA6 A;  3IL8 A;  4DAY B;  1ML0 D;  2EYF A;  1WYD A;  1PDQ A;  2SNM A;  5LMN W;  5EGT A;  1XNR L;  1XYI A;  1GXD C;  3PUV A;  5IGB A;  2QEJ C;  1ESR A;  3BDC A;  3MXN A;  5I2Y A;  1STY A;  3PF5 A;  1Y69 U;  3AFQ A;  1BXT A;  3P1H A;  1DOK A;  1B53 A;  2JA8 B;  4L5R C;  1HJP A;  4MN3 A;  4PZ7 A;  4C2M B;  2R61 A;  4OWW B;  3HOZ H;  4DAY A;  1HUM A;  2RA4 A;  2F0I A;  2JA5 B;  4GNX A;  4NKL A;  1NR2 A;  4Y7N H;  2E2H H;  5E1F A;  3GTJ B;  5M5Y B;  1GKH A;  2CW0 D;  1B7Y B;  3T1H Q;  3MZ5 A;  2OCE A;  2UUA Q;  3HOW G;  1Y8P B;  4LF6 L;  1I4G A;  2F0N A;  3GDE A;  4TKO B;  5ELD A;  1NNX A;  5HGT A;  3M9B A;  1TWH B;  4QUC A;  1AW7 A;  1ZYR C;  1A15 A;  5I6Y A;  2F0H A;  4TRD A;  2C35 B;  4G7H C;  5IGF A;  3NUC A;  3A8J E;  2A69 D;  2R3Z A;  4A3E H;  1SMY C;  1MJC A;  1SYF A;  4OO1 H;  2R93 G;  3DHQ A;  1MD2 D;  2Z4I A;  4C1N I;  3JAM i;  4DR7 Q;  4A3C G;  1QE6 A;  1SNC A;  1S5E D;  4F87 A;  1H9K A;  1JE5 A;  1B70 B;  4A3D G;  2IX0 A;  4RGM A;  1KNE A;  2WAC A;  4JBK A;  1BF4 A;  2A68 D;  5BN3 A;  1IXR A;  1GUS A;  2HQE A;  2YV5 A;  1XNR Q;  1EQV A;  1EWI A;  2JQO A;  2K05 A;  2P5Z X;  3AU7 A;  4DFA A;  2BCO A;  2KCN A;  3HOY G;  2F0E A;  1SE4 A;  4L8J A;  5C4H A;  2KVM A;  4X62 L;  1SSO A;  5K36 G;  3NEL A;  2E2J B;  3PUX A;  2RDG A;  5BN5 A;  4HSP A;  1UEA B;  1BCP D;  2Z9H A;  2Z1C A;  1J6Q A;  1U5K A;  3BG3 A;  2EYL A;  3MVV A;  3S2D B;  1PZI D;  1K0S A;  1SR3 A;  4DAM A;  1F9P A;  2EOT A;  2DNC A;  4A3L H;  1XXG A;  1DON A;  4V19 0;  2HDM A;  1WJJ A;  1JOR A;  3QB3 A;  1ILP A;  1EFI D;  2EDG A;  1HFN A;  4JOI C;  3VA7 A;  1OXT A;  5C0X G;  1K3B C;  1VQ5 A;  5JOB A;  2KED A;  1A3U A;  1U4L A;  1YNN D;  3EN2 A;  3HOU H;  4HMI A;  1ZXT A;  3FKI B;  1A3T A;  3NBH A;  4DR2 L;  2UUC L;  2XRQ D;  3GTL H;  1O80 A;  4JG2 A;  1KIX A;  4RCN A;  4QB4 A;  1IW7 C;  4LF5 L;  1X65 A;  2I5H A;  3M3Y H;  5EQ0 A;  4JOI A;  2KCM A;  3EVQ A;  5JJI A;  1SYD A;  1G29 1;  5JJL A;  5FJ8 G;  5C3W A;  2K6A A;  1VF5 C;  1G2S A;  2E2I H;  2UXD L;  1DOM A;  4MZ9 A;  1I4R A;  5IIF A;  1EYD A;  3I72 A;  1L0X B;  1PH5 A;  3HOX H;  3SVM A;  5FO9 B;  1HNZ L;  4IFD I;  4CDC C;  1H9R A;  5IYB G;  4B9W A;  1PH7 A;  5CBE E;  1B50 A;  2XVS A;  1HCZ A;  2JA8 G;  3UI2 A;  4LF8 L;  1KHI A;  2UU9 Q;  3FEW X;  4HIK A;  4KHP Q;  4N9P A;  4X62 Q;  3DMU A;  3FP9 A;  3K7A H;  4FF2 A;  2JA5 G;  2B2T C;  3CXC A;  2N78 A;  1WTR A;  5IYD G;  2F0T A;  1YNJ D;  5AJ3 Q;  1R9T H;  1JIC A;  3TP6 A;  2G5D A;  4K8I A;  4OWX B;  1LTR D;  1PH4 A;  4A76 A;  3KLR A;  2OQK A;  4J15 A;  4FXD A;  4TVA B;  3S1M B;  4Q0F A;  3I8Z A;  5IT9 E;  2D9U A;  1WD1 A;  3URY A;  5C44 H;  3DEP A;  4U67 3;  2TMP A;  1MI2 A;  4O42 A;  5ELB A;  3S2H H;  2KJX A;  4RKL A;  2PQA A;  1SE3 A;  1AH9 A;  1IHZ A;  1GOZ A;  3VR2 A;  1F9S A;  2HDL A;  4HCS A;  1H9J A;  3HOV B;  2BDO A;  3DM1 A;  4GN5 A;  1GVP A;  4FF4 A;  4A3G H;  1HFG A;  1XPO A;  4B9X A;  3MXU A;  4YWK A;  4JI4 L;  4RAU C;  5CV5 A;  2UUC Q;  4DR2 Q;  3R2T A;  1GO3 E;  2BA0 A;  1SAP A;  4RMF A;  1PRT F;  1Q3L A;  1C4Q A;  4NP5 A;  3BVZ A;  5CV4 A;  4HJA A;  4WRD A;  3CME A;  1IBK L;  2Q8T A;  3E3X A;  3W2D A;  3T4A C;  2UXD Q;  2N55 A;  1VQ6 A;  1E2V A;  1LTG D;  1SXT A;  4Y7N B;  2PPB C;  4KD4 A;  3TP7 A;  3E9H A;  4GKK L;  5HY6 A;  1SMX A;  3OOC A;  4UY8 C;  1IKL A;  1B3A A;  1Y14 B;  2DGY A;  1WCM B;  1HNZ Q;  3K58 A;  4CKB A;  3T53 B;  4DV3 L;  1QUQ A;  2VNU D;  2DY7 A;  4YIJ A;  1MGS A;  1KNA A;  3KF8 B;  1FR3 A;  1CSQ A;  3MC0 B;  1NBW A;  3FVQ A;  1M4V A;  2IHF A;  3OTO Q;  1KLU D;  2WFW A;  3MA2 B;  4OXP A;  2B2U C;  5KND A;  4XDX A;  4A3B G;  3M7N A;  1AZP A;  2K5W A;  2VL6 A;  2WAQ B;  1P16 A;  3GP7 A;  1P8L A;  5DLQ E;  4NW2 A;  4KKT A;  4LJZ C;  3RLF A;  4JI5 L;  3JAM L;  5LL6 S;  1JOK A;  3FKI G;  4ALP A;  4X6A H;  4HMJ A;  1YEZ A;  1LT6 D;  4JBJ A;  3CQZ H;  3MXG A;  4R8I A;  5GQO A;  1KC8 C;  3D4D A;  2JE6 I;  1V9P A;  3L9A X;  4KKU A;  1FNW A;  1CI3 M;  4O0A A;  3J7Z C;  4JI4 Q;  1D1K A;  1XTC D;  1W6J A;  1V1O A;  2K5H A;  4KK7 A;  3BYY B;  2XWB B;  3C3L A;  5DNF A;  2L0C A;  1E2Z A;  1F9R A;  1LLR D;  2FFK B;  4YY3 L;  2B39 A;  3E9I A;  4RG1 A;  1LTT D;  1TWA H;  3G6E A;  1Y1W B;  2AHO B;  3RZD H;  3VR3 A;  3G71 A;  4LWC A;  1JMC A;  1UE5 A;  3IKJ A;  4LK1 C;  5GAG C;  4DK0 A;  4MIU A;  4XXE A;  2B3G A;  3U4Z A;  2K33 A;  2R7Z B;  4RGN A;  4CDD C;  4DV3 Q;  4X3K A;  3L0O A;  1LTB D;  4R4Q A;  2IWH A;  4NMZ A;  4A3K G;  3I91 A;  3LWE A;  3G6J B;  1VQL A;  4BBS H;  1LTI D;  2KA7 A;  5C4Z A;  2E76 C;  1W6K A;  1VDZ A;  1X32 A;  4B3T L;  2PW7 A;  1RCV D;  2A68 C;  4Q5V A;  4R9W A;  1BCP B;  5C0X J;  4G7O C;  2L9H A;  1VMC A;  5IOD A;  4DV5 L;  2E2I B;  1BBX C;  3HOV G;  4HIM A;  1HNX L;  3A54 A;  2UUB Q;  2JEB I;  2GN5 A;  2NN6 I;  3NTK A;  3PSI A;  4JI7 Q;  4JI1 L;  2MPM A;  4JI0 Q;  1ET6 A;  2K5Q A;  3BU2 A;  2A6E C;  1V1Q A;  4DR3 L;  4X64 L;  4BXX H;  4LFB L;  3KUP A;  2R6G A;  2FMM A;  2MUY A;  1HHV A;  2UXB Q;  5C5M A;  4LF7 L;  5JPM C;  1YHA A;  4IFD H;  3H3V I;  1I4Q A;  3U4V A;  3K0X A;  3UDF A;  1KAB A;  1WCM G;  4BWG B;  5I2X A;  4YY3 Q;  4DV0 L;  2VZA A;  4IUR A;  1EY7 A;  2SNS A;  4ILW A;  4DA2 A;  1Q7Y C;  4M1U B;  5C44 B;  3GTQ B;  1VS0 A;  4PQX A;  3S2H B;  4DNR B;  2I5L X;  4CGY B;  1KDA A;  4L5S A;  1TU2 B;  2F0G A;  1Q86 C;  2QCP X;  4NXM Q;  1Q81 C;  4WJ4 A;  2HQL A;  4UAI A;  2CQO A;  2WAQ G;  1UNS A;  2ZXO A;  3BS1 A;  5EJW A;  3EFX D;  1PFN A;  1ZYR D;  2KHI A;  3T16 A;  2EJF C;  2LY7 A;  4APV A;  3GV3 A;  1ROD A;  1VQI A;  4B3T Q;  1AN8 A;  3TEH B;  4BY1 H;  2ZT9 C;  4DUZ L;  2HIX A;  1F2Z A;  2F0S A;  4HSV A;  3J81 j;  1EIH A;  2HCC A;  5C4X B;  1VQK A;  4WJ3 M;  3JAM c;  4DV5 Q;  1Q8I A;  2A73 B;  1F9Q A;  4LFA L;  1G91 A;  1HNX Q;  1TVX A;  4DN4 M;  1TS4 A;  3F8T A;  2PZW A;  2L12 A;  3MXP A;  5CGK A;  1GUG A;  1TWC H;  4OL7 A;  5NUC A;  3VR4 A;  3KFU A;  4QUF A;  4XYO A;  1DJR D;  1O7I A;  3IFT A;  3PCO B;  2SOB A;  4KKS A;  1B2T A;  5IP7 H;  1VQ4 A;  1L1O A;  1N34 L;  1GUN A;  5DEH A;  1HZC A;  1Z9F A;  2OTL A;  4GLA C;  5FLX E;  2ZTC A;  4GN4 B;  5JEA H;  1Y1W G;  4LF7 Q;  1QVF A;  4XQN A;  1X3P A;  3Q22 A;  3T1Y L;  2F1M A;  1KDC A;  4CHT B;  1DM0 B;  1MKH A;  2E74 C;  4PMC A;  1G8Z D;  4DV0 Q;  4KN7 C;  1KL9 A;  2R7Z G;  3I2Z A;  1I3Q B;  1B8A A;  3F1Z A;  3KJO A;  3DUZ A;  1XMQ Q;  1EU3 A;  1WTX A;  1OXU A;  4XT3 B;  4JI2 L;  1B9N A;  3CQZ B;  4JI8 L;  2NVX H;  1E0B A;  2KQ3 A;  3J7A F;  3KBG A;  4DGZ A;  1IYV A;  1EOT A;  3RLO A;  1N36 L;  2XWJ B;  2K4K A;  2KEE A;  1KRT A;  4BA2 I;  3SXH A;  4PG3 A;  4B3R Q;  2NB0 A;  1L0Y B;  2RBM A;  4ZCK A;  3GTK B;  4H13 C;  1Z47 A;  1PYW D;  4HCE A;  3QO2 A;  3P20 A;  4DR4 Q;  4R8N A;  1IW7 D;  4U68 A;  1JWM D;  3NTI A;  4J6H A;  2YTX A;  2JA6 B;  4HAE A;  2AWN A;  4DUY L;  3EJI A;  1Q90 A;  2EPB A;  1QWY A;  1HUN A;  4P73 A;  2EIF A;  2C9O A;  4KI0 A;  4C3H B;  3CP0 A;  2RHS B;  4RKB A;  4LFA Q;  5KEE A;  5CV9 A;  1N9W A;  4AH6 A;  2F4V L;  3MFY A;  4L63 B;  1PFM A;  4LNQ A;  3ZJY C;  3VYU A;  3KJP A;  4GLX A;  3F2D A;  1IBL L;  2B8G A;  2JN4 A;  5I6W A;  2B29 A;  2LKV A;  2F0P A;  2Z6K C;  1C0A A;  1TY0 A;  5LMN Q;  1N34 Q;  3SDZ A;  1FGB D;  4QIW E;  2E2D C;  4BBS B;  1F2L A;  3CCS A;  4RHR A;  4DV7 L;  2O4X A;  2GA4 B;  5C44 G;  3LGJ A;  4X65 L;  3T1Y Q;  1K83 B;  2Z4H A;  3CHB D;  1V43 A;  4C1N K;  3A8I E;  1MJE A;  4BBR B;  2B2Y A;  4GOP B;  3AB9 A;  3GV6 A;  3Q8D A;  2B63 B;  4UP8 A;  4A3F H;  1BQQ T;  4KTA A;  2PNR C;  4GLV B;  2BH2 A;  3WOE A;  4IQZ A;  4JI8 Q;  3NWT A;  1ZKO A;  3TP5 A;  3F2U A;  1YJW A;  4GOP C;  1S40 A;  2QF7 A;  1N36 Q;  5K5P A;  3IAY A;  3I55 A;  4DK6 C;  1TWG B;  2NN6 H;  2NVQ H;  2B8F A;  1EUJ A;  3GTP H;  1Y8N B;  1EFW A;  3KDF B;  2A8V A;  2CVR A;  4YCW A;  3J81 i;  5T1G A;  3T1H L;  1O7Y A;  1X56 A;  2R7D A;  3CAM A;  4DUY Q;  1VQ7 A;  2K5D A;  4KY6 A;  1L2F A;  4RGT A;  2QDL A;  5JJZ A;  4X3T A;  4UPA A;  3H3V H;  2K14 A;  2VXW A;  3CCR A;  3DWP A;  5CMD A;  3MXN B;  1CQV A;  1Q82 C;  4K2L A;  1IBL Q;  1GUW A;  3M4P A;  3LX0 A;  5IT9 L;  1GUT A;  4DR7 L;  1EIF A;  2QIL A;  2VB2 X;  2ZM6 L;  2N49 A;  3TSS A;  1BVS A;  4DV7 Q;  5IP9 H;  5CYU A;  1BBU A;  4GNX B;  2ZXR A;  4X65 Q;  4UDU C;  5EPJ A;  4ZUJ A;  1R4P B;  2DNE A;  1PH9 A;  4LF4 L;  2L15 A;  2EY2 A;  2CWP A;  2M2L A;  1TWF H;  2I07 B;  3H91 A;  1JJ2 A;  1NUC A;  1K73 C;  3K7U C;  1BUV T;  4KY5 A;  4GNX C;  2NVT H;  4K6D A;  3TS2 A;  2EY6 A;  1I6V C;  3QG1 A;  4JK1 C;  1LYL A;  4UHV A;  1BBW A;  2WAQ E;  2X69 A;  1U4P A;  2AQ3 B;  3D4R A;  2JA6 G;  3ULP A;  1PVO A;  5KIX A;  3K5O A;  4CJ0 B;  3HS0 C;  1FJG L;  4ABN A;  1DYQ A;  1CFM A;  4ULL A;  3OMG A;  4C3H G;  5I9O A;  4HN7 A;  3Q23 A;  3I4N B;  3T13 A;  1QZG A;  2VQF L;  2BE5 C;  5CC4 A;  2H4O A;  2GVA A;  1KAW A;  4QJF A;  3P75 A;  1VCI A;  1A62 A;  3S24 A;  3ERS X;  3CD6 A;  4BBS G;  1CA5 A;  1N33 L;  3GTO B;  3I4M H;  1WTQ A;  3OW7 A;  1XWE A;  3U9S A;  2YYZ A;  1JB7 A;  1E1O A;  1D1I A;  1X3G A;  3GTG B;  1K8A C;  4C3J H;  5M3M B;  1JR0 D;  5GAE C;  1WTP A;  5M5W H;  2ZM6 Q;  4BBR G;  1W2B A;  2XTI A;  3MEH A;  2LXK A;  1PH6 A;  1IYJ B;  2B63 G;  2MJ8 A;  2FIN B;  1W3S A;  5KYL A;  3D8G A;  4ZQ3 A;  3U58 A;  2Q2T A;  4UP7 A;  4CJ2 C;  4RHS A;  5JAV A;  4WJW A;  2MO1 A;  2Q2I A;  2JEA I;  2F0W A;  4AYB E;  4LF4 Q;  2UU9 L;  1X3F A;  4O1N A;  4UP9 A;  4KHP L;  1DGS A;  4A4I A;  2AKW B;  4ZKB B;  4IOA A;  3PO3 H;  1KDB A;  4RCO A;  1JC7 A;  2RSO A;  4S3S A;  5KNC A;  3NBH B;  4MTN A;  3A5Z B;  4IFD G;  5AJ3 L;  1S5C D;  1STN A;  4ODG A;  1PXU A;  1F77 A;  1SN8 A;  2A6E D;  2MP1 A;  3J7Y W;  4K5X A;  2F3V A;  1I6H H;  1GHJ A;  1FJG Q;  2BDN A;  4A3B B;  3PIO A;  4OGQ C;  2LMC B;  3PQI A;  1B44 D;  2VQF Q;  2VUM B;  4DNT B;  1I50 H;  4G7Z C;  1JQY D;  1RHP A;  2KBN A;  3S1N H;  4DU9 A;  2J0T D;  5FLM G;  1S3O A;  3I4L A;  3QR8 A;  1G6P A;  5C4J H;  4DV2 Q;  1K28 A;  2JA7 H;  1H9S A;  4TQU S;  3D6C A;  3SE0 A;  3M4Y A;  5IT9 c;  1N33 Q;  1LUZ A;  2NVY H;  2F3W A;  2PYK A;  2OQ0 A;  2NVQ B;  2CWA A;  3HZX A;  5BR8 Q;  2KHJ A;  4QIW B;  4WOR A;  3PF4 A;  1PTO F;  1DCZ A;  1PZJ D;  3G7L A;  3MAQ A;  1D5Z C;  1CHQ D;  4JYA Q;  4C56 C;  1OTC A;  2F0U A;  4HR7 B;  1IBM L;  2R92 H;  4B3M L;  2PQA B;  5TSS A;  1SLJ A;  4IPD A;  1VQC A;  5IP7 G;  3OTO L;  1JT8 A;  2UXC L;  5JEA G;  3Q24 A;  4DV1 L;  3DLL A;  3NEN A;  4ZLT F;  4QF4 A;  4YWL A;  3I4N G;  1HQM C;  1E2W A;  2J7Z A;  3RLN A;  2L1B A;  4A3K B;  3GTM H;  3AYH B;  1N8R C;  1D7Q A;  4F8M A;  2F03 A;  3S16 H;  4KJN A;  3H0G H;  3UE0 A;  5GAH C;  3T56 B;  5IY0 A;  3AMU A;  1QG7 A;  1RF2 D;  1K8M A;  1IYU A;  1BO0 A;  3ERQ A;  1DD2 A;  3MWY W;  5COR A;  3GD7 A;  1LT5 D;  1TWF B;  1KLG D;  1QUQ B;  2NVT B;  4GN3 B;  5M3M G;  4A3M H;  1WD0 A;  2H5X A;  1STA A;  4DNI A;  2KEC A;  3CCM A;  5EKL A;  1ET9 A;  1XMO Q;  3HOZ B;  5IYC G;  2EJM A;  3PGZ A;  4JCV E;  2E2H B;  1CZW A;  2ZJR A;  3E0E A;  1GM5 A;  1HTP A;  3LNN A;  2IX1 A;  1B9M A;  1I94 Q;  3S1Q H;  2JXM B;  5FO7 B;  5IGC A;  1PV4 A;  3OW2 A;  5LMU Q;  1CT1 D;  4A93 H;  1IBM Q;  2QW7 A;  1SBB B;  2I46 A;  1HH2 P;  4B3M Q;  3A8K E;  5FLX L;  2PI2 A;  5ELF A;  1VQN A;  2K28 A;  3MTS A;  1SNP A;  2O2L D;  3ND8 A;  2IX3 A;  1OXS C;  3K57 A;  2UXC Q;  1MSG A;  4DV1 Q;  4A3E B;  4ME3 A;  1JJG A;  1HNW Q;  2VUM G;  2RDH A;  1HA5 A;  3PV0 A;  4KHZ A;  1ENA A;  4DXG A;  2XN9 C;  4C3J B;  2UUB L;  3VYR A;  3O13 A;  3D0F A;  4JI7 L;  1AFP A;  1WTO A;  3BDO A;  4A3F G;  3NQT A;  2K52 A;  4ZUI A;  4JI0 L;  4LW1 A;  2IW3 A;  3OSO A;  2NTT A;  4QGU A;  1CM9 A;  3RN2 A;  1SNQ A;  2RKS A;  2K5V A;  3RZO H;  4KN4 C;  3I4O A;  1EZ6 A;  5J39 A;  3H09 A;  3KBX A;  2UXB L;  1G6Z A;  3CCQ A;  1EY9 A;  3A0J A;  4L6T B;  3Q6S A;  1TY2 A;  1CKO A;  2K04 A;  2QKI C;  4L5Q A;  2NBF A;  1UAP A;  2SEB D;  1Y1V H;  2EE1 A;  1B3Q A;  1TS2 A;  4EQ5 A;  3DM3 A;  4EQP A;  3A5U A;  1T9H A;  4HJ7 A;  1XPR A;  1LT3 D;  1K8G A;  2HCI A;  1I6H B;  2MNA A;  3G48 A;  1CZG A;  1PYS B;  2XNA C;  1ESF A;  3G4S A;  4IFD J;  3JC6 6;  5L37 A;  2O5I C;  1IL2 A;  4KY7 A;  1K3R A;  1I50 B;  1VQO A;  3PIO 3;  4NXM L;  4L5T A;  2B2V C;  2KHS A;  1M90 C;  4AYB B;  4AQY Q;  3HOU B;  1VQH A;  4MNO A;  3VYT A;  3GTL B;  3CW2 C;  1STG A;  5E3F A;  1YJ9 A;  2KOL A;  5M3F H;  3D31 A;  2JA7 B;  3M3Y B;  2WV6 D;  2B2V A;  1VQB A;  4IUP A;  3HOW H;  5D65 A;  1PYB A;  1PFS A;  2NZH A;  4IPG A;  3NEM A;  4DPG A;  1CK1 A;  4OX9 L;  2RF4 A;  3UDI A;  2E75 C;  1SYE A;  3HOX B;  4J1M A;  2K32 A;  1C9O A;  1PTO H;  3WOF A;  4H7B A;  3RD4 A;  3J81 E;  2VS1 A;  3CC7 A;  2JJQ A;  2EY1 A;  4B3S L;  5FKA C;  3HOZ G;  1VQE A;  3K7A B;  3STB C;  2EYJ A;  2Q2U A;  2I5M X;  3K81 C;  4A3C H;  3D4W A;  1D5X C;  3S14 H;  1NSN S;  4A3D H;  5E7N A;  3DWQ A;  1R9T B;  2BA1 A;  3GTM B;  1PH3 A;  4A75 A;  2E5L L;  4Y52 H;  1D2B A;  3HOY H;  1HZA A;  4HJ9 A;  5D3D A;  4F7X A;  2L4N A;  4K0K Q;  1VF7 A;  1WOC A;  2PZU A;  3M7G A;  5ELC A;  4NXN L;  5JEA J;  1XMQ L;  5K36 H;  5ISR A;  3NHH A;  4LUV A;  1IL8 A;  1JJC B;  2K50 A;  2HUG A;  3I3C A;  3KOJ A;  2BE5 D;  1F2Y A;  1CQF A;  4YHH L;  1FGU A;  5FLX c;  4A3E G;  3K80 C;  4A3G B;  5KRU A;  1MHW C;  4OO1 G;  3X3M A;  4B3R L;  4LFC L;  3S15 H;  4FNF A;  4J8Q A;  2R7F A;  4C3J G;  3BYT B;  5M5X H;  2PCF B;  2WII B;  3U50 C;  2N8N A;  4DR4 L;  1HQR D;  1L1O B;  5FOB B;  4QQB X;  1PZK D;  4CDF C;  1JE4 A;  1WTH A;  4ZK9 B;  1TII D;  1ENF A;  3MFG A;  3R2I A;  3DXJ C;  1Z6H A;  5JPN C;  3S1R H;  1GHK A;  5D14 A;  4P71 A;  4A3I H;  4OX9 Q;  1DXM A;  1L1O C;  3NQI A;  2CH4 A;  1HRJ A;  1LTL A;  1SJE D;  4FXG C;  4IPC A;  3OHX C;  3TN2 A;  3V96 A;  2ICE C;  2IJ0 A;  5FK9 C;  1NCV A;  1UEB A;  2EQS A;  4OEL B;  4B3S Q;  5CR3 A;  5LMN L;  1EY5 A;  1G51 A;  1N32 L;  1SYG A;  1IKM A;  4DR6 L;  4A3L G;  1L0W A;  3D6W A;  4PZ8 A;  4YCU A;  3GO5 A;  3HRZ C;  3SHL A;  1U4R A;  2X6G A;  3N6R A;  4IZ8 A;  5IGG A;  5IGD A;  2E5L Q;  4LF9 L;  5G3L F;  4C2M H;  1PH8 A;  4AYB G;  3PIP A;  1YBY A;  3HOU G;  2MQH A;  3PUW A;  4NXN Q;  4DK1 A;  2F0O A;  3ND9 A;  4H02 A;  4K5V A;  3GTJ H;  5IYD H;  2JA7 G;  5M5Y H;  1HA6 A;  1ENC A;  2N3S A;  1SDF A;  5J22 A;  2QDB A;  4YHH Q;  2A1A A;  3QIA A;  4C3I H;  3VA5 A;  1HTL D;  3TME A;  4LFC Q;  1UWV A;  2IPK D;  1A8V A;  1TWH H;  4X66 Q;  1PH2 A;  1ILQ A;  1Y1V B;  4I65 A;  3HOX G;  4DR1 L;  1FYC A;  3PO2 H;  1BDO A;  3IRB A;  2WIN B;  1TWA B;  2F0J A;  1OXX K;  4RH6 A;  4XTC S;  4TSS A;  1YNX A;  3RZD B;  2EYM A;  2K75 A;  4H44 C;  4P75 A;  2GVB A;  3ICE A;  1EOV A;  5GRO A;  3W5O A;  4DV4 Q;  1BNZ A;  4DAV A;  3CF5 A;  3CMA A;  4DAP A;  2IL8 A;  4CJ1 B;  2DN8 A;  4IOC A;  3TZD A;  5IGE A;  1EU4 A;  3V2T A;  1STB A;  3P7J A;  3FRP B;  3RR5 A;  4HJ8 A;  5EAY A;  1EWH A;  1N32 Q;  2YTY A;  2B2Y C;  2Q8R E;  4DR6 Q;  3HKZ E;  2E2J H;  1KAA A;  1LV9 A;  2MFI A;  2K1B A;  2JSO A;  1J5E L;  3W1G A;  2JP1 A;  1KD1 C;  2PNH A;  4LF9 Q;  3S2D H;  4A3G G;  3DEO A;  1NY4 A;  4KD3 A;  3A7A B;  4DXF A;  5C3E H;  1YIJ A;  1TS3 A;  4EGV A;  4K5W A;  5LL6 X;  1SE2 A;  5EKI A;  4HIO A;  4NPS A;  3M4O H;  1D5M C;  1VQJ A;  1PHJ A;  2EY5 A;  2HT1 A;  2H1E A;  4CBV A;  3CPF A;  3FKI H;  3ER0 A;  4JBM A;  4B08 A;  4DR1 Q;  1RJT A;  4EQO A;  1PFB A;  1CKN B;  1BCP F;  4LUZ A;  1OXV A;  1DZ1 A;  2J4X A;  1YZ6 A;  3QOL A;  1WTV A;  3KYH C;  1XX8 A;  2MO0 A;  4A93 G;  4IUQ A;  4N9T A;  1BKB A;  4M8A A;  3J80 E;  2ALY B;  2NWG A;  1KQS A;  2PI2 E;  1VMP A;  3EBE A;  4KLK A;  1EYA A;  3TRZ A;  4G57 A;  4HTH A;  2BOS A;  2ZXP A;  3EA6 A;  2OTJ A;  2F0K A;  1WTW A;  1CKN A;  2DUD A;  4V0B A;  1E22 A;  2WB1 E;  1KRS A;  3ULL A;  4IO9 A;  1O7L A;  3SK5 A;  1PRT B;  4BY1 B;  3E0J A;  1MIU A;  3I73 A;  1A0I A;  5ELE A;  1IZ6 A;  1J5E Q;  3J7A 5;  4RWS C;  3OYY A;  5AFW A;  3RMH A;  2ZTE A;  3A7L A;  1YVC A;  1WFQ A;  5A2Q E;  2NTS A;  3S1M H;  1H9M A;  1PRT C;  1Q46 A;  3KF6 A;  2AUJ D;  2A74 C;  2LFN A;  2Q2H A;  3HG9 A;  1TWC B;  4ZKC B;  4WFN 3;  1T5E A;  3CKI B;  1Y1V G;  3NBI A;  2KCT A;  1S4Z A;  5CV6 A;  1QJO A;  4CKE A;  1LO5 D;  1PMR A;  3FDT A;  1FVI A;  4DR5 L;  3HOV H;  5IWA L;  2M9V A;  1BR9 A;  3HKS A;  2AMC B;  3KLS X;  3T51 B;  2HHH L;  5E4W C;  3CU7 A;  1EQQ A;  3C1E A;  3OIQ A;  3TQY A;  4KJO A;  1ICF B;  3CCU A;  3EIV A;  5C3X A;  5IOC A;  1VQD A;  1U9R A;  4R4T A;  3H15 A;  1CTM A;  4JI3 L;  4DV2 L;  3L7Z C;  2CHB D;  1DOL A;  3OPO A;  1RD9 D;  5M3F G;  2NVX B;  3PIP 3;  2XIW A;  1M1K C;  3I90 A;  3RNU A;  1WCM H;  5JJK A;  4OON A;  4C3I B;  5I9P A;  2G9D A;  1EIY B;  3R8B A;  4POF A;  1II3 A;  3A74 A;  5BR8 L;  2LSS A;  1C7Y A;  1ZEQ X;  4R4C A;  3K6O A;  4FVM A;  5KGU A;  2RSN A;  2K5N A;  3FHW A;  3VR6 A;  1YHB A;  3GQB A;  1HR0 W;  1RL2 A;  3PO2 B;  4JYA L;  4GS3 A;  2L11 A;  2F0F A;  4H0L C;  5BN4 A;  2XGT A;  4HID A;  4BXX G;  1S5D D;  4IUU A;  4JW0 A;  4RFB A;  2A6H D;  2PO4 A;  4OIJ A;  2MGS A;  2PMZ E;  3A56 A;  4EQN A;  2F0Q A;  2NZ1 D;  3B6Y A;  2NZO A;  3NTH A;  4PZ6 A;  2A19 A;  5ELO A;  5J3B A;  4BY7 H;  3UDX A;  1RKN A;  1MBY A;  3MEF A;  1H9S B;  4K2K A;  2CQA A;  4LUO A;  4AIM A;  4DR5 Q;  1HPC A;  3STB D;  5IWA Q;  2HHH Q;  2WKD A;  3S17 H;  1PA6 A;  4OIK A;  3E5S A;  3A55 A;  4ZYS A;  3K5M A;  3CCV A;  1QZH A;  2YU9 H;  2BH8 A;  1STH A;  4O2D A;  2F0D A;  2CH4 W;  1RIP A;  1U0L A;  2VY3 A;  3TBI B;  4A3F B;  2EVB A;  4JI3 Q;  2K03 A;  2QEX A;  2SDF A;  2Z6B A;  5C3E B;  1Y1W H;  1FD7 D;  1O78 A;  1TR5 A;  5F2D A;  1YI2 A;  2MHV A;  1X3Q A;  4ZAI A;  1BOS A;  1MSH A;  3HP3 A;  3M4O B;  2D0O A;  2AQ2 B;  1XMO L;  2Y0S B;  4BY1 G;  5CV8 A;  1X55 A;  4LF6 Q;  2R7Z H;  2PQE A;  3GTP B;  1LAB A;  4A3I G;  3EQL C;  3HKZ B;  3J81 L;  1I94 L;  1HZ9 A;  1AE3 A;  4DF7 A;  4GZY C;  3I7F A;  5LMU L;  2AWO A;  2XSC A;  5EBC A;  3ONA B;  3HFZ B;  1WI5 A;  4IPH A;  5CBA E;  1U4M A;  2CCZ A;  3LWU A;  1OO9 B;  5E4X A;  4YCV A;  1JCK B;  1XTD A;  4FXK C;  5C6A A;  4P72 A;  1HNW L;  4JC0 A;  1M8A A;  4I7Z C;  4HJ5 A;  4FF1 A;  3TRE A;  4IUT A;  3H3V C;  3J80 i;  4FF3 A;  1FNU A;  2AUK A;  4K8J A;  1SRU A;  1E1T A;  3L3O C;  1ASY A;  1I4X A;  3SK8 A;  1FL0 A;  3BVM A;  4CDE C;  1QCB D;  3FPP A;  5C0X I;  1T5X D;  4C3I G;  1Q12 A;  2HIV A;  1SYB A;  1XPU A;  5A35 A;  2B2T A;  2LS0 1;  4OWT B;  1XNQ L;  2F3I A;  2TSS A;  4MTK A;  1YJN A;  3GTQ H;  1HZB A;  4N8F A;  1EIG A;  2V4D A;  4RA8 A;  2FXQ A;  1VQA A;  1SNM A;  4OHJ A;  4FO2 A;  2HD3 A;  3E6Z X;  3PO2 G;  1K0R A;  1AE2 A;  3I56 A;  3F2C A;  2IHE A;  4QL5 A;  1A6X A;  4DV6 L;  1QOH A;  3BJU A;  4KV6 A;  1EEF D;  2WB1 B;  2ENB A;  5C5L A;  2RVL A;  4KHV A;  4POG A;  4IAL A;  3AFP A;  1Y8O B;  4LF5 Q;  2N88 A;  1KTK A;  4HED A;  4BS9 A;  2D62 A;  4XQQ A;  4AQY L;  1WVL A;  1PH1 A;  5C4X H;  1S72 A;  4K14 A;  3ITP A;  3TDQ A;  2Z8L A;  5COY A;  4A3J H;  1EWC A;  3I4M B;  4BA1 I;  1SEB D;  2DY8 A;  3BDL A;  3CPW A;  1NTG A;  1B1Z A;  2DJG C;  3K5L A;  3N52 A;  1EY6 A;  5M5W B;  1I4P A;  4Z9C B;  1A2U A;  2OEO A;  1VQF A;  4LF8 Q;  3QJY A;  4P74 A;  2RDF A;  1A63 A;  2VQE L;  3NPP A;  3H6M A;  3D3R A;  1J8I A;  5C3E G;  2D2C C;  3KLW A;  1CHP D;  1SYC A;  4JI6 L;  4F88 A;  2IT1 A;  2Y0S G;  2Q8I B;  5T1I A;  5KNB A;  2A5H A;  1Q1E A;  3PO3 B;  4ME5 A;  3R3O A;  2NN6 G;  3BVG A;  1EL0 A;  4N8X 1;  2B2U A;  1XNQ Q;  3KLS A;  4QY7 A;  1EZ8 A;  1QNU A;  1I3Q H;  2B2W C;  3X3N A;  3M4Q A;  1LTS D;  5CV7 A;  5DAU A;  1H95 A;  1TS5 A;  1YHQ A;  4BY7 B;  3HKZ G;  3IFD A;  2KUM A;  3KF8 A;  2ID0 A;  2EYP A;  5ELN A;  1VQ9 A;  1F2M A;  1CKM A;  4K0K L;  4NDX A;  3K8A A;  3J81 c;  2B2W A;  4DV6 Q;  2RCN A;  1LT4 D;  1PTO D;  3BZC A;  3SK4 A;  2FJ2 A;  2OWO A;  3FMC A;  2ICI A;  3CCL A;  1NMF A;  3S17 B;  3GTK H;  2PZT A;  2DJF C;  2CW0 C;  3AQQ A;  5I4D A;  3BZD B;  2YU9 B;  2JYO A;  3S1N B;  3NSW A;  3NXW A;  3W1B A;  5EPL A;  1UUP A;  1IBK Q;  2JA6 H;  1O7Z A;  3HGB A;  5LHY 1;  1VQ8 A;  1EYC A;  1ONL A;  2F52 A;  2AQ1 B;  2PMZ B;  1VQM A;  5C4J B;  4C3H H;  3Q0A A;  1LTA D;  1SNO A;  2ZJQ A;  2JK8 A;  3RN5 A;  2V1C C;  4GKK Q;  3KK7 A;  1STE A;  1S5F D;  5IP9 G;  1GJX A;  2OT2 A;  1A2T A;  2NVY B;  2ASB A;  3H94 A;  1AEX A;  2A69 C;  4ZRZ A;  4I7A A;  4P2C B;  2KCC A;  3UDG A;  5JVH 3;  2A6H C;  2ATW A;  1LAC A;  3S9W A;  2VQE Q;  2F0L A;  3VDY A;  1E3P A;  3MHB A;  1SND A;  2ES2 A;  4OEM B;  2R92 B;  1K83 H;  2R93 H;  4JI6 Q;  4XQJ A;  1VQG A;  1X3E A;  5HUR A;  1QVC A;  2WKC A;  5DM6 3;  4BBR H;  1PRT D;  4MHE A;  1SE8 A;  1UE1 A;  2B63 H;  4JI5 Q;  2WB1 G;  1CSP A;  1XJV A;  3W3A A;  1BCP C;  2C5C A;  2ZTD A;  1NR4 A;  2EXD A;  1Z7T A;  1D8L A;  4IJL A;  3S16 B;  3VR5 A;  3H0G B;  2L5T A;  3J80 L;  1TWG H;  3AEV A;  3CCE A;  1C8C A;  3WDN A;  2EJG C;  3OMC A;  3PMF A;  5HGQ A;  4XT1 B;  2D5D A;  5EKK A;  1EQT A;  5IE8 A;  1SFO H;  3I4M G;  3J7A V;  4K6L A;  5FO8 B;  2FMC A;  4G4K A;  1YNN C;  3TP8 A;  2EXZ A;  4A3M B;  2NUC A;  4X66 L;  3TZU A;  1R4Q B;  1RDP D;  3DWA A;  1EYG A;  4X3U A;  1LM0 A;  3ERO A;  4NB3 A;  5C0X H;  2JA9 A;  4PV1 C;  3QWN A;  5A2Q L;  5FLM H;  4DV4 L;  5GAD C;  3PO3 G;  1JOQ A;  1X54 A;  5M9O A;  3S1Q B;  3C2P A;  1QNK A;  1G2T A;  1JOO A;  4A93 B;  5FJ8 H;  1E7Z A;  1SMY D;  3U9O A;  1NAP A;  1UE6 A;  3OWF A;  4BY7 G;  4DKA C;  1AZQ A;  1K8O A;  1X9N A;  3RUZ A;  3SEB A;  1I4H A;  4A3J B;  2Z0S A;  5IYB H;  2RHQ B;  4JI1 Q;  1AP0 A;  4X3S A;  2NYZ D;  1YNJ C;  2JA8 H;  2X6L A;  1D6E C;  1C48 A;  4DR3 Q;  1TKW B;  4X64 Q;  5J1Z A;  4JPB W;  4LFB Q;  3PUY A;  2OF1 A;  2JA5 H;  2I0Q A;  4LMQ D;  1JWU D;  4FP5 D;  2KEN A;  3I4N H;  1K9M C;  3WWV A;  3RZO B;  2F0V A;  4OO1 I;  1ASZ A;  1PLF A;  1CUK A;  5KYI A;  1Q8K A;  4PNY A;  4IUN A;  4GKJ L;  2CFM A;  3M85 A;  1SJH D;  5D3I B;  3JAM E;  2PW5 A;  3NK9 A;  3SK6 A;  1UE7 A;  4PMB A;  3K5N A;  1X6O A;  5DM7 3;  1VQP A;  3GTO H;  2R92 G;  1EEI D;  2M00 A;  1QIL A;  4JV5 L;  4YWM A;  2CKZ B;  3GTG H;  4XYQ A;  1JB3 A;  5M3M H;  1S5B D;  2O5J C;  3UE1 A;  1RTO A;  2XRS D;  4E6I A;  3OIP A;  2Y0S E;  3CCJ A;  4RGO S;  4LAA A;  3CC2 A;  1EQR A;  5IYC H;  4DUZ Q;  1HR0 L;  3L2P A;  4QCL A;  2D0P A;  4R1J A;  4DK3 C; 
#chains in the Genus database with same CATH homology
 5M3F B;  1EY8 A;  3QOJ A;  3HEJ A;  3HOW B;  2L55 A;  3OWE B;  1ICW A;  3NWS A;  3SR1 A;  3C46 A;  2K7V A;  4FYD A;  4JBW A;  3VYS A;  3C1F A;  1V8Q A;  1PTO B;  1B4O A;  2WP8 J;  1TQO A;  2R93 B;  5JVG 3;  3K0Y A;  3CRL C;  4IUV A;  2F0M A;  1PTO C;  1EY4 A;  1Q1B A;  3NE5 B;  3S14 B;  1JWS D;  3I70 A;  4A3D B;  4XIG S;  1A3V A;  1V1P B;  4KMU C;  3NP8 A;  3HOY B;  1FNV A;  4PMW A;  2EYO A;  2F4I A;  1EY0 A;  1TT2 A;  1SFO B;  1QB5 D;  4CKC A;  2FHT A;  2EZV A;  3V05 A;  1RTN A;  1GUO A;  3S15 B;  2EYH A;  5M5X B;  3CRK C;  1V1P A;  4ID6 A;  2K01 A;  3R93 A;  3FPU B;  2RQX A;  5EBD A;  2G9H D;  3S1R B;  5G3L D;  4A3I B;  3PUZ A;  1HXY D;  4IN3 A;  4EVO A;  3K59 A;  4QMG A;  1J9O A;  5EPK A;  3ZYY X;  2OXP A;  2VB3 X;  1CA6 A;  3IL8 A;  1ML0 D;  2EYF A;  1PDQ A;  2SNM A;  5EGT A;  1XYI A;  1GXD C;  3PUV A;  5IGB A;  2QEJ C;  1ESR A;  3BDC A;  3MXN A;  5I2Y A;  1STY A;  1Y69 U;  1BXT A;  3P1H A;  1DOK A;  1B53 A;  2JA8 B;  4MN3 A;  4C2M B;  2R61 A;  4DAY A;  1HUM A;  2RA4 A;  2F0I A;  2JA5 B;  4NKL A;  1NR2 A;  5E1F A;  3GTJ B;  5M5Y B;  2CW0 D;  3MZ5 A;  1Y8P B;  1I4G A;  2F0N A;  4TKO B;  5ELD A;  5HGT A;  1TWH B;  4QUC A;  1AW7 A;  1ZYR C;  1A15 A;  5I6Y A;  2F0H A;  4TRD A;  4G7H C;  5IGF A;  3NUC A;  3A8J E;  2A69 D;  2R3Z A;  1SMY C;  1SYF A;  4OO1 H;  3DHQ A;  1MD2 D;  2Z4I A;  4C1N I;  1QE6 A;  1SNC A;  1S5E D;  4F87 A;  1H9K A;  2IX0 A;  4RGM A;  1KNE A;  2WAC A;  1BF4 A;  2A68 D;  5BN3 A;  1GUS A;  2HQE A;  1EQV A;  2K05 A;  3AU7 A;  4DFA A;  2BCO A;  2KCN A;  2F0E A;  1SE4 A;  4L8J A;  5C4H A;  2KVM A;  1SSO A;  5K36 G;  2E2J B;  3PUX A;  2RDG A;  5BN5 A;  4HSP A;  1UEA B;  1BCP D;  2Z1C A;  3BG3 A;  2EYL A;  3MVV A;  3S2D B;  1PZI D;  1F9P A;  2EOT A;  2DNC A;  1XXG A;  1DON A;  4V19 0;  2HDM A;  1JOR A;  3QB3 A;  1ILP A;  1EFI D;  2EDG A;  1HFN A;  3VA7 A;  1OXT A;  5C0X G;  5JOB A;  2KED A;  1A3U A;  1U4L A;  1YNN D;  4HMI A;  1ZXT A;  3FKI B;  1A3T A;  3NBH A;  2XRQ D;  1O80 A;  4RCN A;  4QB4 A;  1IW7 C;  5EQ0 A;  3EVQ A;  1SYD A;  1G29 1;  5C3W A;  2K6A A;  1VF5 C;  1G2S A;  1DOM A;  1I4R A;  5IIF A;  1EYD A;  3I72 A;  1L0X B;  3SVM A;  5FO9 B;  4IFD I;  1H9R A;  4B9W A;  5CBE E;  1B50 A;  2XVS A;  1HCZ A;  3UI2 A;  3FEW X;  4N9P A;  3DMU A;  4FF2 A;  2B2T C;  1WTR A;  2F0T A;  1YNJ D;  1JIC A;  3TP6 A;  4K8I A;  1LTR D;  3KLR A;  4FXD A;  3S1M B;  4Q0F A;  3I8Z A;  5IT9 E;  2D9U A;  1WD1 A;  3URY A;  3DEP A;  4U67 3;  2TMP A;  1MI2 A;  4O42 A;  5ELB A;  2KJX A;  4RKL A;  1SE3 A;  1IHZ A;  1GOZ A;  3VR2 A;  1F9S A;  2HDL A;  4HCS A;  1H9J A;  3HOV B;  2BDO A;  3DM1 A;  4FF4 A;  1HFG A;  4B9X A;  3MXU A;  4RAU C;  5CV5 A;  3R2T A;  2BA0 A;  1SAP A;  1PRT F;  1Q3L A;  1C4Q A;  4NP5 A;  3BVZ A;  5CV4 A;  4WRD A;  2Q8T A;  3W2D A;  3T4A C;  2N55 A;  1E2V A;  1LTG D;  1SXT A;  4Y7N B;  2PPB C;  4KD4 A;  3TP7 A;  3OOC A;  1IKL A;  1B3A A;  1WCM B;  3K58 A;  4CKB A;  3T53 B;  2VNU D;  2DY7 A;  4YIJ A;  1MGS A;  1KNA A;  1FR3 A;  3MC0 B;  3FVQ A;  1M4V A;  1KLU D;  3MA2 B;  2B2U C;  5KND A;  4XDX A;  3M7N A;  1AZP A;  2K5W A;  2WAQ B;  3GP7 A;  4NW2 A;  4KKT A;  4LJZ C;  3RLF A;  3JAM L;  5LL6 S;  1JOK A;  4HMJ A;  1LT6 D;  3MXG A;  4R8I A;  3D4D A;  2JE6 I;  3L9A X;  4KKU A;  1FNW A;  1CI3 M;  1D1K A;  1XTC D;  1W6J A;  1V1O A;  4KK7 A;  3BYY B;  2XWB B;  3C3L A;  5DNF A;  2L0C A;  1E2Z A;  1F9R A;  1LLR D;  2FFK B;  2B39 A;  1LTT D;  1Y1W B;  3VR3 A;  3IKJ A;  4LK1 C;  4DK0 A;  4MIU A;  4XXE A;  2K33 A;  2R7Z B;  4RGN A;  4X3K A;  1LTB D;  2IWH A;  4NMZ A;  3I91 A;  3LWE A;  3G6J B;  1LTI D;  2KA7 A;  5C4Z A;  2E76 C;  1W6K A;  1VDZ A;  1X32 A;  2PW7 A;  1RCV D;  2A68 C;  4Q5V A;  4R9W A;  1BCP B;  5C0X J;  4G7O C;  2L9H A;  1VMC A;  5IOD A;  2E2I B;  1BBX C;  3A54 A;  2JEB I;  2NN6 I;  3NTK A;  2MPM A;  1ET6 A;  2K5Q A;  2A6E C;  3KUP A;  2R6G A;  2FMM A;  2MUY A;  1HHV A;  5C5M A;  5JPM C;  4IFD H;  1I4Q A;  1KAB A;  4BWG B;  5I2X A;  4IUR A;  1EY7 A;  2SNS A;  4ILW A;  4DA2 A;  4M1U B;  5C44 B;  3GTQ B;  4PQX A;  3S2H B;  4DNR B;  4CGY B;  1KDA A;  1TU2 B;  2F0G A;  2QCP X;  4UAI A;  1UNS A;  2ZXO A;  3BS1 A;  5EJW A;  3EFX D;  1PFN A;  1ZYR D;  3T16 A;  2EJF C;  2LY7 A;  3GV3 A;  1ROD A;  1AN8 A;  2ZT9 C;  4HSV A;  1F2Z A;  2F0S A;  1EIH A;  2HCC A;  5C4X B;  1Q8I A;  2A73 B;  1F9Q A;  1G91 A;  1TVX A;  4DN4 M;  1TS4 A;  2PZW A;  2L12 A;  3MXP A;  5CGK A;  1GUG A;  4OL7 A;  5NUC A;  3VR4 A;  4QUF A;  4XYO A;  1DJR D;  3IFT A;  1B2T A;  2SOB A;  4KKS A;  1GUN A;  5DEH A;  5FLX E;  5JEA H;  4XQN A;  1X3P A;  3Q22 A;  2F1M A;  1KDC A;  4CHT B;  1DM0 B;  2E74 C;  4PMC A;  1G8Z D;  4KN7 C;  1I3Q B;  3DUZ A;  1EU3 A;  1WTX A;  1OXU A;  4XT3 B;  1B9N A;  3CQZ B;  1E0B A;  2KQ3 A;  3J7A F;  3KBG A;  4DGZ A;  1IYV A;  1EOT A;  2XWJ B;  2KEE A;  4BA2 I;  3SXH A;  2NB0 A;  1L0Y B;  2RBM A;  3GTK B;  4H13 C;  1Z47 A;  1PYW D;  4HCE A;  3QO2 A;  3P20 A;  4R8N A;  1IW7 D;  4U68 A;  1JWM D;  3NTI A;  4J6H A;  2JA6 B;  4HAE A;  2AWN A;  3EJI A;  1Q90 A;  2EPB A;  1QWY A;  1HUN A;  2C9O A;  4KI0 A;  4C3H B;  4RKB A;  5KEE A;  5CV9 A;  3MFY A;  4L63 B;  1PFM A;  3VYU A;  2B8G A;  5I6W A;  2LKV A;  2F0P A;  1TY0 A;  3SDZ A;  1FGB D;  2E2D C;  4BBS B;  1F2L A;  4RHR A;  2O4X A;  2GA4 B;  1K83 B;  2Z4H A;  3CHB D;  1V43 A;  4C1N K;  3A8I E;  4BBR B;  2B2Y A;  3AB9 A;  3GV6 A;  2B63 B;  1BQQ T;  4KTA A;  2PNR C;  3WOE A;  4IQZ A;  3NWT A;  1ZKO A;  3TP5 A;  3F2U A;  2QF7 A;  5K5P A;  3IAY A;  1TWG B;  2NN6 H;  2B8F A;  1Y8N B;  2CVR A;  5T1G A;  1O7Y A;  2K5D A;  4KY6 A;  4RGT A;  5JJZ A;  4X3T A;  2VXW A;  3DWP A;  5CMD A;  1CQV A;  4K2L A;  1GUW A;  3LX0 A;  5IT9 L;  1GUT A;  2QIL A;  2VB2 X;  3TSS A;  5CYU A;  2ZXR A;  4UDU C;  5EPJ A;  4ZUJ A;  1R4P B;  2DNE A;  2EY2 A;  2M2L A;  2I07 B;  3H91 A;  1NUC A;  1BUV T;  4KY5 A;  4K6D A;  2EY6 A;  1I6V C;  3QG1 A;  4JK1 C;  2X69 A;  1U4P A;  2AQ3 B;  3D4R A;  5KIX A;  3K5O A;  4CJ0 B;  3HS0 C;  4ABN A;  1DYQ A;  1CFM A;  4ULL A;  3OMG A;  4C3H G;  5I9O A;  4HN7 A;  3Q23 A;  3I4N B;  3T13 A;  2BE5 C;  5CC4 A;  2H4O A;  3P75 A;  1VCI A;  1CA5 A;  3GTO B;  1WTQ A;  3OW7 A;  1XWE A;  3U9S A;  2YYZ A;  1D1I A;  3GTG B;  5M3M B;  1JR0 D;  1WTP A;  3MEH A;  2MJ8 A;  2FIN B;  5KYL A;  3D8G A;  4ZQ3 A;  5JAV A;  4CJ2 C;  4RHS A;  4WJW A;  2JEA I;  2F0W A;  4O1N A;  4ZKB B;  1KDB A;  4RCO A;  1JC7 A;  2RSO A;  4S3S A;  5KNC A;  4IFD G;  1S5C D;  1STN A;  4ODG A;  1PXU A;  1F77 A;  2A6E D;  2MP1 A;  3J7Y W;  4K5X A;  2F3V A;  1GHJ A;  2BDN A;  4A3B B;  4OGQ C;  2LMC B;  1B44 D;  2VUM B;  4DNT B;  4G7Z C;  1JQY D;  1RHP A;  4DU9 A;  2J0T D;  3I4L A;  1H9S A;  4TQU S;  3D6C A;  3SE0 A;  3M4Y A;  2F3W A;  2PYK A;  2NVQ B;  3HZX A;  4QIW B;  4WOR A;  1PTO F;  1DCZ A;  1PZJ D;  3G7L A;  3MAQ A;  1D5Z C;  1CHQ D;  4C56 C;  2F0U A;  4HR7 B;  5TSS A;  5JEA G;  3Q24 A;  4ZLT F;  4QF4 A;  1HQM C;  1E2W A;  2J7Z A;  2L1B A;  4A3K B;  4F8M A;  2F03 A;  4KJN A;  3T56 B;  3AMU A;  1QG7 A;  1RF2 D;  1K8M A;  1IYU A;  1BO0 A;  3ERQ A;  1DD2 A;  3MWY W;  5COR A;  3GD7 A;  1LT5 D;  1TWF B;  1KLG D;  2NVT B;  1WD0 A;  1STA A;  2KEC A;  5EKL A;  1ET9 A;  3HOZ B;  2EJM A;  2E2H B;  1CZW A;  1HTP A;  3LNN A;  2IX1 A;  1B9M A;  2JXM B;  5FO7 B;  5IGC A;  1CT1 D;  1SBB B;  2I46 A;  3A8K E;  5FLX L;  5ELF A;  2K28 A;  3MTS A;  1SNP A;  2O2L D;  3ND8 A;  2IX3 A;  1OXS C;  3K57 A;  1MSG A;  4A3E B;  2RDH A;  1HA5 A;  3PV0 A;  4KHZ A;  1ENA A;  4DXG A;  2XN9 C;  4C3J B;  3VYR A;  3O13 A;  1AFP A;  1WTO A;  3BDO A;  3NQT A;  4ZUI A;  2IW3 A;  3OSO A;  2NTT A;  1CM9 A;  1SNQ A;  2RKS A;  4KN4 C;  5J39 A;  1EZ6 A;  3H09 A;  3KBX A;  1G6Z A;  1EY9 A;  4L6T B;  3Q6S A;  1TY2 A;  2K04 A;  2QKI C;  2NBF A;  1UAP A;  2SEB D;  2EE1 A;  1TS2 A;  4EQP A;  1LT3 D;  2HCI A;  1I6H B;  1CZG A;  2XNA C;  1ESF A;  4IFD J;  2O5I C;  4KY7 A;  1I50 B;  3PIO 3;  2B2V C;  2KHS A;  4AYB B;  3HOU B;  3VYT A;  3GTL B;  1STG A;  5E3F A;  2KOL A;  3D31 A;  2JA7 B;  3M3Y B;  2WV6 D;  2B2V A;  4IUP A;  5D65 A;  1CK1 A;  2E75 C;  1SYE A;  3HOX B;  4J1M A;  2K32 A;  1PTO H;  3WOF A;  4H7B A;  3RD4 A;  3J81 E;  2EY1 A;  5FKA C;  3K7A B;  2EYJ A;  3D4W A;  1D5X C;  1NSN S;  3DWQ A;  1R9T B;  2BA1 A;  3GTM B;  1D2B A;  5D3D A;  4F7X A;  2L4N A;  1VF7 A;  3M7G A;  2PZU A;  5ELC A;  5JEA J;  5K36 H;  5ISR A;  3NHH A;  1IL8 A;  2HUG A;  3I3C A;  2BE5 D;  1F2Y A;  1CQF A;  4A3G B;  5KRU A;  4OO1 G;  3X3M A;  4FNF A;  4J8Q A;  4C3J G;  3BYT B;  2PCF B;  2WII B;  1HQR D;  5FOB B;  1PZK D;  1JE4 A;  4ZK9 B;  1TII D;  1ENF A;  3MFG A;  3R2I A;  3DXJ C;  1Z6H A;  5JPN C;  1GHK A;  5D14 A;  1DXM A;  3NQI A;  1HRJ A;  1SJE D;  4FXG C;  3OHX C;  3TN2 A;  3V96 A;  2ICE C;  2IJ0 A;  5FK9 C;  1NCV A;  5CR3 A;  1EY5 A;  1SYG A;  1IKM A;  3D6W A;  3GO5 A;  3HRZ C;  3SHL A;  1U4R A;  2X6G A;  3N6R A;  4IZ8 A;  5IGG A;  5IGD A;  5G3L F;  3PUW A;  4DK1 A;  2F0O A;  3ND9 A;  4K5V A;  1HA6 A;  1ENC A;  1SDF A;  5J22 A;  2QDB A;  3QIA A;  3VA5 A;  1HTL D;  3TME A;  2IPK D;  1ILQ A;  1Y1V B;  4I65 A;  1FYC A;  1BDO A;  2WIN B;  1TWA B;  2F0J A;  1OXX K;  4RH6 A;  4XTC S;  4TSS A;  3RZD B;  2EYM A;  4H44 C;  1BNZ A;  4DAV A;  4DAP A;  2IL8 A;  4CJ1 B;  2DN8 A;  3TZD A;  5IGE A;  1EU4 A;  3V2T A;  1STB A;  3P7J A;  3FRP B;  1EWH A;  2B2Y C;  2Q8R E;  1KAA A;  1LV9 A;  2K1B A;  2JSO A;  2JP1 A;  3DEO A;  4KD3 A;  3A7A B;  4DXF A;  1TS3 A;  4EGV A;  4K5W A;  5LL6 X;  1SE2 A;  5EKI A;  1D5M C;  2EY5 A;  2H1E A;  4CBV A;  4B08 A;  1RJT A;  4EQO A;  1PFB A;  1BCP F;  1OXV A;  1DZ1 A;  2J4X A;  3QOL A;  1WTV A;  1XX8 A;  4IUQ A;  4N9T A;  4M8A A;  3J80 E;  2NWG A;  1VMP A;  1EYA A;  4G57 A;  4HTH A;  2BOS A;  2ZXP A;  3EA6 A;  2F0K A;  1WTW A;  4V0B A;  1O7L A;  3SK5 A;  1PRT B;  4BY1 B;  3E0J A;  3I73 A;  5ELE A;  4RWS C;  3RMH A;  5AFW A;  3A7L A;  5A2Q E;  2NTS A;  1H9M A;  1PRT C;  2AUJ D;  2A74 C;  2LFN A;  3HG9 A;  1TWC B;  4ZKC B;  4WFN 3;  1T5E A;  3CKI B;  3NBI A;  1S4Z A;  5CV6 A;  1QJO A;  4CKE A;  1LO5 D;  1PMR A;  3FDT A;  2M9V A;  1BR9 A;  3KLS X;  3T51 B;  5E4W C;  3CU7 A;  3C1E A;  3OIQ A;  4KJO A;  5C3X A;  5IOC A;  1U9R A;  1CTM A;  3L7Z C;  2CHB D;  1DOL A;  3OPO A;  1RD9 D;  2NVX B;  3PIP 3;  2XIW A;  3I90 A;  4C3I B;  5I9P A;  2G9D A;  3R8B A;  1II3 A;  1ZEQ X;  3K6O A;  4FVM A;  5KGU A;  2RSN A;  3VR6 A;  3GQB A;  3PO2 B;  2L11 A;  2F0F A;  4H0L C;  5BN4 A;  1S5D D;  4IUU A;  4RFB A;  2A6H D;  2PO4 A;  4OIJ A;  2MGS A;  3A56 A;  4EQN A;  2F0Q A;  2NZ1 D;  3NTH A;  1RKN A;  1MBY A;  1H9S B;  4K2K A;  2CQA A;  1HPC A;  2WKD A;  4OIK A;  3E5S A;  3A55 A;  4ZYS A;  3K5M A;  1STH A;  2F0D A;  4A3F B;  3TBI B;  2EVB A;  2K03 A;  2SDF A;  5C3E B;  1FD7 D;  1O78 A;  1TR5 A;  5F2D A;  2MHV A;  1X3Q A;  4ZAI A;  1BOS A;  1MSH A;  3HP3 A;  3M4O B;  2AQ2 B;  2Y0S B;  5CV8 A;  2PQE A;  3GTP B;  1LAB A;  3EQL C;  3HKZ B;  3J81 L;  4DF7 A;  4GZY C;  2AWO A;  2XSC A;  5EBC A;  3ONA B;  5CBA E;  1U4M A;  3LWU A;  1OO9 B;  5E4X A;  1JCK B;  4FXK C;  5C6A A;  1M8A A;  4I7Z C;  4FF1 A;  4IUT A;  3H3V C;  4FF3 A;  1FNU A;  2AUK A;  4K8J A;  3L3O C;  1I4X A;  3SK8 A;  3BVM A;  1QCB D;  3FPP A;  5C0X I;  1T5X D;  4C3I G;  1Q12 A;  1SYB A;  5A35 A;  2B2T A;  2LS0 1;  2TSS A;  1EIG A;  2V4D A;  4RA8 A;  1SNM A;  4OHJ A;  4FO2 A;  3E6Z X;  1A6X A;  1QOH A;  4KV6 A;  1EEF D;  2WB1 B;  2ENB A;  5C5L A;  2RVL A;  4KHV A;  4IAL A;  1Y8O B;  2N88 A;  1KTK A;  4HED A;  4BS9 A;  2D62 A;  4XQQ A;  1WVL A;  4K14 A;  3ITP A;  3TDQ A;  2Z8L A;  5COY A;  1EWC A;  3I4M B;  4BA1 I;  1SEB D;  2DY8 A;  3BDL A;  1B1Z A;  3K5L A;  3N52 A;  1EY6 A;  5M5W B;  1I4P A;  4Z9C B;  1A2U A;  2OEO A;  3QJY A;  2RDF A;  3NPP A;  3H6M A;  3D3R A;  1J8I A;  2D2C C;  1CHP D;  1SYC A;  4F88 A;  5KNB A;  2IT1 A;  2Q8I B;  5T1I A;  2A5H A;  1Q1E A;  3PO3 B;  4ME5 A;  3R3O A;  2NN6 G;  3BVG A;  1EL0 A;  2B2U A;  3KLS A;  1EZ8 A;  1QNU A;  2B2W C;  3X3N A;  1LTS D;  5CV7 A;  5DAU A;  1TS5 A;  4BY7 B;  3IFD A;  2KUM A;  3KF8 A;  2ID0 A;  2EYP A;  1F2M A;  4NDX A;  2B2W A;  1LT4 D;  1PTO D;  3SK4 A;  2FJ2 A;  3FMC A;  2ICI A;  3S17 B;  2PZT A;  2CW0 C;  5I4D A;  3BZD B;  2YU9 B;  2JYO A;  3S1N B;  3NSW A;  3NXW A;  5EPL A;  1UUP A;  1O7Z A;  3HGB A;  5LHY 1;  1EYC A;  1ONL A;  2AQ1 B;  2PMZ B;  5C4J B;  3Q0A A;  1LTA D;  1SNO A;  3KK7 A;  1STE A;  1S5F D;  1GJX A;  2OT2 A;  1A2T A;  2NVY B;  3H94 A;  1AEX A;  2A69 C;  4ZRZ A;  4P2C B;  2KCC A;  5JVH 3;  2A6H C;  1LAC A;  3S9W A;  2F0L A;  3MHB A;  1SND A;  2R92 B;  4XQJ A;  5HUR A;  2WKC A;  5DM6 3;  1PRT D;  4MHE A;  3W3A A;  1BCP C;  2C5C A;  1NR4 A;  1Z7T A;  3S16 B;  3VR5 A;  3H0G B;  2L5T A;  3J80 L;  1C8C A;  3WDN A;  2EJG C;  3OMC A;  3PMF A;  4XT1 B;  2D5D A;  5EKK A;  1EQT A;  3J7A V;  4K6L A;  5FO8 B;  2FMC A;  4G4K A;  1YNN C;  3TP8 A;  2EXZ A;  4A3M B;  2NUC A;  3TZU A;  1R4Q B;  1RDP D;  3DWA A;  4X3U A;  3ERO A;  5C0X H;  4PV1 C;  3QWN A;  5A2Q L;  1JOQ A;  5M9O A;  3S1Q B;  3C2P A;  1QNK A;  1G2T A;  1JOO A;  4A93 B;  3U9O A;  1SMY D;  1NAP A;  3OWF A;  1AZQ A;  1K8O A;  3RUZ A;  3SEB A;  1I4H A;  4A3J B;  1AP0 A;  4X3S A;  2NYZ D;  1YNJ C;  2X6L A;  1D6E C;  1C48 A;  1TKW B;  5J1Z A;  3PUY A;  2OF1 A;  4LMQ D;  1JWU D;  4FP5 D;  3RZO B;  2F0V A;  4OO1 I;  1PLF A;  5KYI A;  4PNY A;  4IUN A;  3M85 A;  1SJH D;  5D3I B;  3JAM E;  2PW5 A;  3NK9 A;  3SK6 A;  4PMB A;  3K5N A;  5DM7 3;  1EEI D;  2M00 A;  1QIL A;  4XYQ A;  1JB3 A;  1S5B D;  2O5J C;  1RTO A;  2XRS D;  4E6I A;  3OIP A;  4RGO S;  4LAA A;  4QCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...