4JV5L

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 12
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jv5L00
2D0PA 1FL0A 4R4OA 2UXCQ 4X6AH 1PHJA 4GKJL 1Q81C 1IBKL 4DV5Q 1KD1C 3AFQA 5IE8A 5IYBH 3CPWA 4HIKA 3HKZG 3UDGA 1KAWA 1XMOQ 3I4NH 4JG2A 5FJ8G 1VQDA 5IP7G 4BY7H 2IY5B 1CKOA 1X3FA 4JBKA 1K73C 3RLFA 3I4NG 2K4KA 3BZKA 3UE1A 1HJPA 3TS0A 3K7AH 4LF5Q 4OONA 4OWWB 4DR7Q 1HNZQ 1DGSA 2XTIA 1N32Q 5M3MG 2E2JH 1E1OA 3J81i 4OX9Q 4DR6Q 1AH9A 1Q8KA 5BR8Q 4DR5Q 3U50C 3K0XA 4DV4L 1OXXK 2K75A 3HOUH 1N36L 4KHPQ 2YYZA 4PZ6A 3OTOQ 1EYGA 4LF9L 1TWFH 1Q46A 3RNUA 2NN6I 1PH5A 3PF4A 1YNXA 1YHBA 3KFUA 4A3CH 1N34L 4X62L 1YJ9A 4R4IA 4HJ8A 1PH2A 1VQLA 1QVFA 1OXVA 3S16H 2I5MX 1Y1VH 5LMNW 2CWPA 1W3SA 1J5EL 2JEAI 1PYSB 3KF6A 4IPCA 1QVGA 5HGQA 3FKIG 3HOYG 4GNXB 2IX1A 1JMCA 1VQOA 4B3RL 1JB7A 1C0AA 4PZ8A 4P73A 4JBWA 4BY1H 4DR3L 1XNQL 5DLQE 2R7ZG 4LUZA 4UP7A 5IYCH 1IBLL 4JYAQ 4HJ5A 4R1JA 1HNWQ 4DR2L 5K36G 3I7FA 1YIJA 1C9OA 3FP9A 3ZJYC 3H15A 2HHHL 2I0QA 2VY3A 4B3RQ 2UXBQ 1NTGA 5M5YH 5H1SE 5C4XH 3CMAA 2ES2A 5LMUQ 3H0GG 2MO0A 1X6OA 3KDFB 4BBSH 1VQGA 3RR5A 4FDBA 4HIMA 1IZ6A 2NVYH 3KYHC 3PGZA 4UP8A 1Y1WG 1RL2A 2C35B 2IHEA 4JI4Q 3S1MH 4DR4L 3F2DA 2GVAA 3GTOH 3BU2A 2Z0SA 2E2IH 4H02A 1C7YA 2DUDA 2HQLA 3HFZB 1PH6A 1QUQA 3M4OH 1IXRA 4GNXA 1Q82C 1NJIC 1K83H 1VQBA 1YZ6A 3OW2A 2WP8J 3GTQH 1J6QA 4JI5Q 1N32L 3A5UA 2PQAA 3CCUA 2RCNA 3M3YH 2OTJA 1FVIA 4DR7L 4P72A 4IOCA 1NY4A 2N8NA 2Q2HA 3HOXG 4LF5L 1FJGQ 2VNUD 3CC2A 1A62A 4JOIC 4YWKA 5C3EG 2BA0A 3G48A 1A0IA 4LFBL 4A3KH 3WWVA 1SLJA 2A8VA 3GTGH 3RZOH 1GD7A 2UUCQ 4AQYL 1RIPA 4IFDG 1LTLA 3S14H 1EIFA 3KF8B 4IPGA 3HKZE 4X66L 2VQEQ 2B63H 3CCEA 1HNXL 4RG1A 1IBLQ 4DV5L 4MNOA 3H3VH 3A0JA 2I5HA 4L5TA 4XTCS 1PH9A 2VUMH 1VQNA 4GKJQ 4A3DG 4JI8Q 1EWIA 2MFIA 1GKHA 3F8TA 1VQ6A 4JI3Q 4NXMQ 5JEAJ 2VZAA 2DGYA 4MTNA 2WB1E 4A3LH 1CSQA 3PIPA 1FGUA 1N33Q 4LNQA 1KRSA 1N9WA 2PMZE 2R7DA 2VW9A 1VQFA 4X66Q 5IWAQ 4DR1Q 1AE2A 2VUMG 1KHIA 3K80C 2IX0A 2JEBI 1XPUA 1E22A 2UUCL 1XPOA 3ULPA 4Y52H 1BKBA 2H5XA 4NB3A 3NEMA 1K8GA 1E3PA 3PO3H 4UP9A 3KJPA 4OWTB 5BR8L 1FJGL 3S2DH 4GLXA 4QGUA 2ATWA 3KLWA 4IJHA 4YCVA 1TXYA 4A93G 3I2ZA 4RMFA 1Y1WH 1R9TH 1VQ4A 4LF7Q 4JI5L 1VQPA 4JI2L 1HNZL 2K50A 2PNHA 2ZTCA 3CAMA 1HR0W 2EIFA 4BBSG 1TWHH 3AYHB 2VL6A 1G6PA 2L15A 2Q2TA 5JJIA 2ZTEA 1WYDA 5J3BA 2OCEA 1YHQA 1HH2P 3GD7A 2YTVA 3E9IA 3STBD 5FLMH 1GVPA 2OQKA 4DV0Q 1QUQB 1X54A 4ALPA 1XMOL 2R93G 3TEHB 3AFPA 2R92H 4POFA 3D31A 3UDFA 4IOAA 5M3FG 1H95A 5GADC 4GN5A 4NPSA 1N33L 1YI2A 4LF8L 5M3FH 2JK8A 2WAQE 2KCMA 3EN2A 3PV0A 4LUVA 4JI0L 1IL2A 2UUBL 4GKKL 2UXBL 4LFCQ 1M90C 1EOVA 1X55A 3G4SA 1K0RA 3F2BA 1HR0Q 4JYAL 1I94L 5IY0A 2K5VA 2AWNA 3E9HA 4LW1A 4JI1Q 1XNQQ 4HJAA 1L1OB 1WCMG 2F3IA 2VQFL 4DPGA 1V43A 2F52A 3NENA 4UPAA 4HJ9A 4GOPC 1YITA 4A3MH 1JJ2A 4JI0Q 1YBYA 4BY1G 2R7ZH 3CF5A 2IHFA 4AQYQ 1PH8A 2JE6I 4K0KL 4DK6C 4LFAL 4B3SQ 4A3BH 1PYBA 1UE1A 4R4TA 3KJOA 3GTKH 3M7NA 4L5SA 4KLKA 1XNRL 3PO3G 1A63A 1TWAH 4UY8C 2B29A 1E7ZA 4YY3Q 1Y1VG 4DNIA 1S72A 1WI5A 1SN8A 1WOCA 4IJLA 4O2DA 4HIDA 4Y7NH 2R7FA 2V1CC 1SRUA 1UE6A 1KQSA 1TWCH 1B7YB 4GS3A 4X65Q 3PUVA 2EXDA 3T1YQ 2UUAL 2GVBA 4JCVE 4PMWA 4DKAC 4A3CG 1VQHA 4OX9L 1NE3A 4JI2Q 5C0XG 1BBUA 4A3LG 2HT1A 3UDXA 4A3GH 4JI6Q 3IRBA 1Q12A 2JQOA 4YY3L 1XTDA 2YTYA 4B3TQ 2D0OA 3B6YA 4LF4L 4HIOA 4A3IG 2WB1G 3S24A 3OYYA 2OWOA 1EQRA 1YJNA 4LF6L 4A76A 2B63G 1AE3A 1WFQA 1EIYB 1U0LA 4P74A 1X3GA 3CCQA 3I55A 3W5OA 5C0XJ 5GAHC 3I4MH 3I4OA 3AEVA 1WJJA 3K81C 3F1ZA 4DV6L 2JA6G 1JJGA 2K5NA 4YHHQ 5JEAG 4A3KG 1W2BA 3PUYA 4OO1I 2R6GA 2ZJQA 2ZTDA 3T1HQ 1NMGA 2NZOA 1PV4A 2K52A 1MIUA 1V9PA 4LFCL 4JI3L 4AIMA 4NXML 1I3QH 4TVAB 4JI8L 3PUZA 4C3HH 2QA4A 4LF8Q 1EFWA 1WCMH 3CXCA 3CCMA 1VQMA 2R92G 5IYDH 4NXNL 4R4CA 1CKNB 3HKSA 4DUZQ 5C4XG 2R93H 2HIXA 4DV6Q 3TREA 2RF4A 3DM3A 3S1RH 4BBRG 4X64Q 2PI2E 2NVQH 3MEFA 1E24A 1N34Q 2ID0A 1YJWA 4DK3C 4APVA 3BZCA 1CUKA 1X3EA 3ULJA 3PUWA 3I56A 4LFBQ 4WJ4A 4KI0A 1OXSC 4LF6Q 1VQKA 3J81j 1VCIA 4PZ7A 3M9BA 3J81c 4DR6L 4J15A 1Q1BA 4JC0A 1K9MC 1QVCA 2ZM6Q 3K7UC 1MJEA 1UWVA 4BBRH 4LF7L 5FLMG 1X9NA 4POGA 1M1KC 4IPHA 4AYBE 4YWMA 3Q8DA 4ME3A 1I5FA 4GN4B 3CW2C 5E7NA 4KHZA 2YTXA 3UDIA 3RN5A 1D7QA 4GN3B 4LWCA 1PH1A 1O7IA 4C3JH 2GN5A 1G51A 4C2MH 2JA5H 1SROA 2N78A 4AH6A 3M4PA 4JOIA 4IO9A 4A3EG 4A93H 1XMQL 2RHQB 1SR3A 3HOYH 3HOUG 3PO2G 4X64L 4DR1L 5HY6A 2JA6H 4IFDI 1XJVA 1PH7A 1OTCA 4YCWA 2N49A 4DV2Q 4BXXH 1IBKQ 3CP0A 5LMUL 4JI7L 4L5QA 3RLNA 4K0KQ 1IBMQ 4A3DH 3A74A 3RN2A 1HR0L 4WJ3M 3KDFA 1ASZA 1D8LA 4GLVB 4DR2Q 2UU9Q 3EBEA 4JI1L 1U5KA 1S40A 3SGIA 2WFWA 3CD6A 3TQYA 2VQEL 3KOJA 4A3GG 3RZDH 5LMNQ 3GTMH 4IFDJ 3A5ZB 5IYBG 1OXTA 2IT1A 3ICEA 3ERSX 2D62A 3PF5A 1Q1EA 3KF6B 1J5EQ 2VS1A 3PUXA 4PG3A 1UE7A 1PVOA 4QY7A 1VQEA 5IP9G 2PQAB 3JAMi 2CCZA 1VQCA 1Q86C 5C0XI 3M85A 2WAQG 2Y0SE 4X62Q 1VQ5A 4YWLA 2QEXA 4B3TL 1K3RA 2A1AA 1EQQA 3M4QA 5GAGC 1YHAA 4BY7G 4DV1Q 2F4VL 1HZCA 2QGQA 4A3BG 4DV4Q 1Y14B 3S2HH 5C3EH 4JV5Q 2KBNA 1I6HH 5C4JH 1UEBA 2KENA 3T1YL 3HOXH 2Q2IA 3U4ZA 1PFSA 3G71A 4BXXG 2AHOB 1HZAA 4DV1L 2F4VQ 1Q7YC 4DR4Q 4L5RC 4A3JH 4C3IH 1LM0A 3L7ZC 4TQUS 3J80c 3CCRA 4A3EH 2NN6G 3FHWA 2FXQA 2Y0SG 3GTJH 2LXJA 3CQZH 1KL9A 4B3ML 1BBWA 2CKZB 4GLAC 3U58A 3CCSA 5GQOA 2YV5A 1Z9FA 4QQBX 5LMNL 3CPFA 2E5LQ 3STBC 4YCUA 2JA7G 1LYLA 3H0GH 5JJKA 1OXUA 1P16A 2EQSA 4DV7Q 1VS0A 4BA2I 4QL5A 3HOVH 5JJLA 1P8LA 2CWAA 3UE0A 2CQOA 3JAMc 1MJCA 3K8AA 2JA9A 4A75A 3T1HL 4DV7L 1SMXA 4JI7Q 2BH2A 3J7ZC 1HNXQ 3HOZH 3HOVG 1NMFA 3GTPH 4BA1I 2E5LL 5ELOA 3NBHB 3EIVA 3LGJA 3PCOB 4P71A 2JA8G 4JBJA 1S3OA 5IT9c 1XMQQ 5IYDG 3D0FA 1A8VA 2AMCB 3FKIH 4A3JG 3TRZA 3PSIA 4DV0L 1L0WA 4QIWE 2AKWB 4LF9Q 1L2FA 4B3MQ 5AJ3L 5M3MH 4A3FH 2NZHA 2UXDQ 5C44G 1KRTA 1EUJA 4LF4Q 1KC8C 2JJQA 2OTLA 2LXKA 1GM5A 4JI6L 1I50H 4EX5A 1JE5A 2XGTA 3I4MG 1SE8A 3NELA 2ZM6L 3U4VA 1B8AA 3L0OA 4OWXB 3S1NH 2B3GA 1E1TA 3AQQA 5IP9H 5M5WH 2KCTA 3CMEA 1K8AC 3S15H 4LUOA 4HJ7A 3BJUA 4A3IH 2Q2UA 4JI4L 1B70B 1KIXA 2E2HH 2I5LX 1KXLA 1SFOH 1L1OA 1YEZA 1XNRQ 1N8RC 2AWOA 2HIVA 3S17H 5GAEC 1ASYA 1XPRA 5IP7H 2PI2A 1VQAA 2ALYB 2K5HA 4LFAQ 1VQ9A 2A19A 5FJ8H 2UXCL 1CSPA 1HZBA 3W1GA 4EQ5A 4AYBG 2Z6KC 2NVTH 2MO1A 4DV3Q 1MKHA 1QZHA 1LUZA 1PH4A 3E0EA 5C44H 4OO1G 2UUBQ 2VQFQ 4GOPB 4A3FG 2E8GA 2KHJA 4DR3Q 3GTLH 2N3SA 3MXNB 2UU9L 1IYJB 4YHHL 3RLOA 2MNAA 4JBMA 3GDEA 2YU9H 4DV3L 4O0AA 4GKKQ 4GNXC 2JA8H 1IBML 3HOZG 2JA5G 1TWGH 4DV2L 4A3MG 3H3VI 3GO5A 5EAYA 2Z6KA 5ELNA 5FLXc 1HZ9A 1T9HA 3J80i 1PA6A 1V1QA 3HOWG 1UE5A 4DUYQ 2CFMA 3CCLA 2LSSA 3PO2H 3OTOL 1N36Q 4KHPL 1QZGA 1NBWA 2NVXH 4DAMA 4JV5L 4DAYB 4DR5L 1VQ8A 1G291 2BA1A 3CC7A 4X65L 4A4IA 2UUAQ 3HOWH 3ULLA 4GOPA 2MQHA 3G6EA 2RHSB 4IPDA 4P75A 3L2PA 3F2CA 5IYCG 3JC66 2ZJPA 4DUYL 3CC4A 3S1QH 4OXPA 5M5XH 3J7A5 1PH3A 1JT8A 2UXDL 1CKMA 5AJ3Q 4QJFA 1YVCA 1GO3E 3TS2A 2JA7H 1VQIA 4XIGS 4B3SL 1X56A 3CCJA 3W1BA 1VQ7A 2K14A 1Z47A 1CKNA 1JJCB 2ZJRA 2OQ0A 2HHHQ 5IWAL 1HNWL 1L1OC 4DUZL 3PIOA 4MZ9A 4NXNQ 1I94Q 4R4QA 1VQJA 1X65A 1BVSA 2BH8A 3ER0A 2ASBA 3CCVA 3DLLA 3VDYA 2KHIA 5GROA
chains in the Genus database with same CATH superfamily
4R4OA 1FL0A 1FD7D 4GKJL 3AFQA 1RDPD 3SHLA 4BY1B 1HPCA 4FF2A 3CPWA 4HIKA 3HKZG 1XMOQ 3I4NH 4JG2A 1I4HA 1SJHD 5IP7G 3LWEA 4TRDA 4JBKA 3RLFA 3BZKA 1HJPA 2R92B 4DR7Q 1HNZQ 2NUCA 1I3QB 1LTID 5M3MG 3V96A 4IFDH 1AH9A 2F0FA 4DR5Q 3U50C 1OXXK 3HOUH 1PFMA 5C5MA 1EYGA 4FF1A 2EYJA 1TWFH 3RNUA 2XSCA 1LT5D 2QDBA 3KFUA 4A3CH 3P7JA 1SFOB 1QVFA 3C3LA 3K6OA 1J5EL 1JICA 4IUUA 2LFNA 4P2CB 3FKIG 1JMCA 3D4RA 1JB7A 1WD1A 4P73A 4H7BA 4BY1H 2R7ZG 4TKOB 5DLQE 2F0SA 5IYCH 4Z9CB 4R1JA 4RHSA 5K36G 2NBFA 4B3RQ 1C9OA 2I0QA 2L5TA 3H15A 2UXBQ 2KUMA 5EBCA 1NTGA 3GQBA 5C4XH 3CMAA 3H0GG 2MO0A 3KDFB 3U9SA 2R61A 3SE0A 3RR5A 1XX8A 2CVRA 4HIMA 4UP8A 2IHEA 1ET9A 2GVAA 4IQZA 4RGTA 1K8OA 3A54A 2Z0SA 4JW0A 3M4OH 4Q5VA 1IXRA 1PDQA 1Q82C 1DD2A 5T1GA 4OHJA 1TWGB 3M3YH 2PQAA 3CCUA 1HTLD 2Q2HA 1WTRA 2VNUD 3CC2A 2BA0A 4C3HB 3RZOH 3WWVA 4RWSC 3GTGH 1PZID 5HGTA 2EJGC 1DXMA 5C4HA 4F88A 5C0XH 1LTLA 3S14H 1KTKA 3CCEA 1IBLQ 2K6AA 3A0JA 2LMCB 3AU7A 4JI8Q 3N52A 2HDMA 1SDFA 3N6RA 1VQ6A 2J0TD 4JI3Q 2QDLA 2ZXOA 1HTPA 2L9HA 1KRSA 2PMZE 4LNQA 3GTJB 4NKLA 5IWAQ 4DNTB 1EWHA 4Y52H 1BKBA 2K04A 5AFWA 3PO3H 2HCCA 3S2DH 4QGUA 4IUPA 2ATWA 3KLWA 2Q8IB 4A93G 4RMFA 1EY8A 3K5MA 5C44B 1IL8A 1HR0W 3RZOB 1TWHH 3AYHB 1B1ZA 2WB1B 1HH2P 4ABNA 3GD7A 5FLMH 1GVPA 1KNAA 2K5DA 1X54A 2LY7A 2K7VA 3KLRA 2X6GA 1WTHA 2H1EA 2WIIB 4DK0A 5GADC 1NR2A 1YI2A 3M7GA 4LF8L 2KCMA 1K3BC 4GKKL 2UXBL 3SK4A 1SAPA 2IX3A 1BO0A 1XNQQ 1L1OB 1QWYA 4PV1C 4DPGA 1YITA 4HJ9A 2N88A 1YBYA 4BY1G 2R7ZH 5CBEE 2IHFA 4AQYQ 1PH8A 4G57A 1X3QA 4K0KL 2F0HA 4G4KA 4B3SQ 4R4TA 2F0TA 3PO3G 4UY8C 4DFAA 1M8AA 1WI5A 4O2DA 1G8ZD 1B3AA 1TWHB 1UE6A 1KQSA 1TWCH 1B7YB 3IKJA 3PUVA 4PMWA 3CKIB 3H6MA 1I4RA 4B9XA 2JQOA 4B3TQ 4HR7B 1T5EA 4A3IG 4KJNA 2F1MA 3HGBA 4PMBA 5KYIA 1YJNA 2Z6BA 1BUVT 5E3FA 5CBAE 1AE3A 2B63G 2EXZA 4KKSA 3LWUA 5GAHC 3AMUA 3F1ZA 1SNPA 2JA6G 5JEAG 2RA4A 1JC7A 2R6GA 2ZJQA 1U4LA 2IJ0A 4JI3L 4AIMA 4RCOA 4WRDA 2MPMA 1LTSD 3PUZA 2HDLA 4LF8Q 1EFWA 3C46A 1M4VA 5I4DA 5CV4A 2KEDA 3ND8A 3S1RH 2NVQH 4RFBA 2F0VA 1N34Q 4EVOA 3BZCA 1CUKA 1KDAA 3S15B 4WJ4A 2DJFC 5KRUA 3J81j 3M9BA 3HKZB 4K5VA 1K9MC 1Q1BA 4BS9A 1SEBD 3P20A 2ZM6Q 2WKDA 3S1NB 4POGA 1HUMA 2DNEA 3Q8DA 5IGDA 2HQEA 1C4QA 3CW2C 4FO2A 2YTXA 1T5XD 3RN5A 4LWCA 1PH1A 1O7IA 1QJOA 2N78A 2KVMA 4AH6A 3M4PA 4A3EG 1EYAA 4G7ZC 4UDUC 2RHQB 1XMQL 1SR3A 1GOZA 3PO2G 4X64L 5CV5A 1EZ8A 1OTCA 4DV2Q 5KGUA 1IBKQ 3CP0A 2BDOA 4L5QA 3DHQA 1IBMQ 4A3DH 1HA6A 1UAPA 4WJ3M 2RBMA 1TKWB 1ASZA 4DR2Q 2R93B 3EBEA 2NVQB 4JI1L 1H9SB 4XQNA 3X3MA 3TQYA 3RZDH 4DGZA 1A3VA 1B9NA 3FEWX 3NTIA 1J5EQ 4PG3A 3PUXA 2K5WA 4KN4C 4QY7A 2PQAB 4BBRB 5C0XI 2WAQG 2Y0SE 4X62Q 2F0KA 5FLXE 3M85A 3J7YW 1EL0A 4NMZA 2R7ZB 1Y14B 3L9AX 3S2HH 1UEBA 5I6WA 3T1YL 2O5JC 3G71A 2PPBC 1QNUA 3BVGA 1V1PB 4DR4Q 2KCNA 1Q7YC 1B44D 4TQUS 3SK8A 3SK6A 4A3EH 2NN6G 1ESRA 1ZKOA 1F9RA 4F7XA 2BE5D 3K59A 1TS2A 4HEDA 2L12A 3CPFA 2E5LQ 1JOKA 5CORA 4YCUA 2JA7G 5ISRA 5JJKA 2EQSA 1K83B 1SYGA 1IKLA 1Q90A 2CQOA 3NPPA 3T1HL 2EE1A 1SMXA 4JI7Q 1HNXQ 3GTPH 1A3TA 4BA1I 5ELOA 3LGJA 4P71A 2JA8G 3GTGB 3FKIH 3NSWA 3S2HB 1RF2D 4QIWE 5AJ3L 5M3MH 4A3FH 4HCEA 4QIWB 2OTLA 2J7ZA 4JI6L 1SE4A 1G91A 2B2VC 2XGTA 1EY4A 3BS1A 3HOUB 4ZKBB 1E1TA 1GUOA 1LV9A 5M5WH 1L0YB 3T51B 2KCTA 3CMEA 1K8AC 3S15H 1PRTC 1Q8IA 1B70B 2OXPA 1KXLA 2XWBB 3D6WA 3NP8A 2A68D 3NBHA 3EROA 4DK1A 1MSHA 1B50A 3J80E 1ENCA 4LFAQ 1SYFA 3TZDA 1HZBA 3W1GA 4AYBG 4B08A 5IGBA 5C44H 4OO1G 2PZUA 3A8IE 2E8GA 4ODGA 3GTLH 1SYBA 4YHHL 3RLOA 2MNAA 1JR0D 3GDEA 4JBMA 1R4PB 4O0AA 2JA8H 1OO9B 1IBML 2SDFA 2KECA 2JA5G 4IUNA 4HTHA 5HURA 1PFNA 2CQAA 1V1QA 3HOWG 5T1IA 4ZUIA 4K2LA 2LSSA 2NYZD 4OIJA 1QZGA 1IHZA 1DJRD 2NVXH 4JV5L 4DAYB 4DR5L 1GUGA 2BA1A 1D6EC 5C4JB 4C3JG 4GOPA 3Q0AA 2MQHA 3G6EA 2EY1A 1WTVA 2ZJPA 3CC4A 1SNQA 1FYCA 5AJ3Q 1F2LA 1DYQA 1HFGA 2P5ZX 5J1ZA 2HUGA 3ERQA 1GXDC 3R3OA 1VQ7A 1K8MA 4R8NA 5E4WC 3R2IA 2EJMA 4XQQA 2OQ0A 2HHHQ 1TWCB 4DUZL 4FYDA 5KNDA 2WINB 4R4QA 1VQJA 1BVSA 2BH8A 2XVSA 3ER0A 3DLLA 4BWGB 1AP0A 3VDYA 2EY2A 1O7YA 2D0PA 1PLFA 2B2WC 2UXCQ 2B8GA 4X6AH 2X6LA 4JPBW 2EOTA 4C3JB 3QIAA 2L11A 5IYBH 1H9MA 3OOCA 3H0GB 3OIPA 5M5YB 2IY5B 5ELBA 1K73C 3I4NG 3TS0A 3O13A 4LF5Q 5EQ0A 4N8FA 1E1OA 1U9RA 4OX9Q 4DR6Q 1Q8KA 3GV3A 2RDFA 2YYZA 4PZ6A 2MUYA 5ELDA 2NN6I 4A3FB 4B9WA 1YNXA 3PF4A 1N34L 4ME5A 4HJ8A 2VB2X 1QOHA 1I50B 3TMEA 1QB5D 2I5MX 1Y1VH 2CH4W 3Q23A 2CWPA 1AN8A 1PYSB 2A68C 4GNXB 3A7AB 3P1HA 1VQOA 1JE4A 1WVLA 1C0AA 4FF3A 4O42A 5C3EB 3SR1A 1STBA 1YIJA 3PIP3 4DU9A 1U4RA 1CA6A 1GUSA 4BY7B 3D4WA 5H1SE 2ES2A 5EPLA 1D2BA 3M4YA 3E5SA 3KYHC 1H9RA 4LJZC 3PGZA 3VA5A 1Y1WG 3S1MH 3F2DA 1PRTD 1NNXA 3BU2A 4H02A 2SNMA 2C9OA 1YZ6A 2WP8J 3GTQH 1GUTA 2OTJA 2EZVA 4DR7L 1X32A 3A8KE 3MFGA 4IOCA 2N8NA 3HOXG 4K8JA 1PTOD 3KLSX 1JWMD 4N8X1 3BDCA 4JOIC 4YWKA 3TN2A 5C3EG 1JOQA 1PTOH 3BDOA 4A3KH 1SLJA 2A8VA 5JEAH 1ICWA 1XWEA 4AQYL 1RIPA 2F0UA 3BDLA 1EIGA 5D3IB 2FJ2A 2K03A 4X66L 2B63H 1HNXL 3H3VH 2VUMH 2A73B 2RVLA 1GKHA 3F8TA 5JEAJ 2VZAA 3FDTA 2WB1E 1CSQA 3PIPA 3H94A 4BBSB 4QUCA 1SSOA 4DR1Q 3RUZA 4KY7A 1KHIA 2IX0A 1E22A 1ZXTA 4A3MB 4NB3A 1K8GA 1E3PA 1VF7A 1ESFA 3KJPA 5BR8L 1FJGL 2I46A 4YCVA 3I2ZA 1Y1WH 4LF7Q 1VQ4A 4MN3A 4JI2L 1HNZL 1XYIA 2FFKB 1EZ6A 1PTOB 1VDZA 2ZTCA 3CAMA 3W3AA 2EIFA 3H91A 4Y7NB 2L15A 4EQNA 2L0CA 2EYMA 5J3BA 5A2QE 2YU9B 3NWTA 2YTVA 3R8BA 4ALPA 1QUQB 3EJIA 1D5ZC 1O7ZA 5JPMC 3D31A 1WTWA 4IOAA 2NZ1D 1HCZA 4NPSA 1WTPA 1N33L 1BCPF 1BDOA 3GV6A 4FP5D 4DNRB 4LUVA 3OMCA 4LAAA 4LK1C 1EOVA 1X55A 2WAQB 2F0PA 2NN6H 2JSOA 2K5VA 1B9MA 1RTOA 1ONLA 3AB9A 1WCMG 1V43A 1Y1VB 3CF5A 1TT2A 1A6XA 4DK6C 3K57A 4LFAL 1PYBA 1UE1A 4KLKA 2B2UC 2JXMB 1SNDA 1TWAH 1E7ZA 1F2YA 4G7HC 5CV9A 3MXNA 4ZYSA 4QCLA 4HIDA 1ML0D 4QMGA 2R7FA 2V1CC 4S3SA 4GS3A 1IW7D 3MZ5A 5M9OA 1SYEA 5C0XG 4CKBA 4A3LG 5IGCA 2HT1A 4A3EB 2F3VA 4YY3L 3B6YA 2DN8A 4DAVA 4RCNA 2WB1G 5IODA 2OWOA 5IGFA 4U673 1U0LA 4P74A 1ENAA 1X3GA 4UHVA 3I55A 2XIWA 3K81C 4DV6L 4K5XA 3PUYA 1IKMA 3T1HQ 2UUBL 2NZOA 3MTSA 2K52A 2K32A 1I3QH 4JI8L 2HCIA 1WCMH 3HOZB 1GHKA 4NXNL 1CT1D 1CKNB 3DEPA 1G2TA 1EIHA 4BBRG 4X64Q 2PI2E 1WTXA 2ID0A 2ICIA 3SVMA 1YJWA 1X3PA 2D5DA 1DM0B 1X3EA 3I56A 3SEBA 2E2HB 1ZEQX 5C3XA 4PZ7A 3PO3B 4J15A 2F0NA 1QVCA 1SXTA 1UWVA 3T4AC 1CHQD 1SYDA 1IW7C 4KMUC 1K28A 1I5FA 4GN4B 2QILA 1D7QA 4GN3B 3RMHA 4C3JH 2GN5A 1G51A 1S5DD 4KKUA 2JA5H 2MHVA 2BOSA 4JOIA 1MSGA 3OPOA 4A93H 2R3ZA 2D2CC 3HOYH 1B4OA 3EFXD 5HY6A 4M8AA 5KNCA 5LMUL 2NVTB 3EA6A 1U4MA 5DNFA 3BVZA 2TMPA 5JVH3 3VYUA 3MA2B 2HD3A 3E3XA 3MC0B 4XDXA 3KOJA 2JA8B 2F0EA 1HUNA 3D3RA 2QF7A 5C6AA 1Z7TA 1Q1EA 1LABA 1QILA 3I73A 1PMRA 1D1KA 1HQMC 1UE7A 4H0LC 2BDNA 2QW7A 1DONA 2QEXA 1EQQA 3M4QA 1YHAA 4CDCC 4DV1Q 5DM73 2F4VL 1RJTA 1EYCA 4L63B 1YNJD 2FMMA 5C3EH 2KBNA 3HOXH 3GP7A 4DV1L 2F4VQ 4ZCKA 1PYWD 5M5XB 3NQIA 4A3JH 5ELCA 3CCRA 3FHWA 2B8FA 3A56A 3IFDA 3CQZH 1A2UA 1KL9A 2LXJA 3GTJH 4GLAC 4B3ML 3A8JE 3CCSA 3MWYW 2YV5A 3NBIA 3NUCA 5JOBA 5IT9L 3WDNA 1EY7A 3I72A 1LYLA 4OIKA 2F0IA 3EVQA 1CZWA 3IFTA 4QL5A 3HOVH 1P8LA 3UE0A 2CHBD 4ZRZA 2JA9A 3HS0C 3K0YA 3K7AB 3J7ZC 3HOVG 5K5PA 3NBHB 5A35A 2DY8A 5IT9c 4C3IG 1LACA 3KUPA 3D0FA 4A3JG 2AMCB 4LMQD 3PSIA 5ELEA 2AKWB 2ZT9C 4LF9Q 3E6ZX 4XYOA 4B3MQ 5C44G 4OO1H 4QB4A 1VMPA 1BCPD 1EUJA 1D5MC 4C3IB 1KDCA 3I91A 1GM5A 3QWNA 1I6VC 1SE8A 3NELA 5E1FA 2ZM6L 2K1BA 3HEJA 3U4VA 1B8AA 1VMCA 3CQZB 4RKLA 1ZYRC 3AQQA 5IP9H 4HJ7A 3BJUA 4I7AA 2E2HH 3KLSA 2PO4A 1QE6A 1AW7A 1Z6HA 1YEZA 1N8RC 3S1QB 3S17H 3L3OC 3OIQA 2LS01 3QG1A 5IP7H 2ALYB 1VQ9A 1CSPA 4EQ5A 4PNYA 3K5OA 1Y1WB 1JQYD 3E0EA 3MVVA 4GOPB 3TSSA 4DR3Q 3MXNB 1A3UA 3BYTB 2YU9H 1KNEA 4GKKQ 3HOZG 1STYA 3T13A 3H3VI 5ELNA 3X3NA 1PA6A 1UE5A 4DUYQ 1RCVD 2F0OA 3GTOB 5LL6S 1AEXA 1N36Q 4KHPL 1STHA 3LX0A 4DAMA 1VQ8A 3CC7A 4X65L 2UUAQ 3HOWH 3IL8A 1TVXA 4CJ1B 5DM63 3L2PA 5IYCG 3JC66 5COYA 2XRQD 4CKEA 1PH3A 2UXDL 3KBGA 1CKMA 3GTKB 4QJFA 1YVCA 3CHBD 3LNNA 5EGTA 1QNKA 1X56A 4ZAIA 4X3KA 3W1BA 1F9QA 4J1MA 1S5CD 4H44C 1FNUA 3PIOA 3NWSA 1LT4D 4XYQA 3CCVA 2ENBA 2A6ED 5D14A 3J80L 1PZJD 2KQ3A 3MHBA 5ELFA 1DOMA 5IE8A 1RKNA 5NUCA 3VR4A 4KD3A 3UDGA 2MGSA 4FXKC 5FJ8G 1VQDA 5FO8B 1FNWA 5EKKA 1X3FA 1O80A 3K7AH 1ICFB 4OONA 4OWWB 1TS3A 1DGSA 2XTIA 3QJYA 1O78A 2E2JH 3J81i 1CK1A 4HMIA 3VR3A 2XN9C 4DV4L 1LT3D 5C3WA 4LF9L 4DF7A 5M5WB 1Q46A 1PH5A 5CC4A 1V8QA 4WORA 3DWQA 1YHBA 1YJ9A 2NWGA 3BZDB 4R4IA 1PH2A 1VQLA 2EYLA 3S16H 1FNVA 1OXVA 2Y0SB 5F2DA 4OGQC 5LMNW 1W3SA 1EU3A 3TP6A 5HGQA 4DXFA 3HOYG 3H3VC 3C2PA 4B3RL 3T16A 3VYRA 1NAPA 4N9TA 4JBWA 4L8JA 1IBLL 2B2TA 2OT2A 4HJ5A 1CTMA 4DR2L 1EEID 3I7FA 3FP9A 2KOLA 3ZJYC 1CI3M 1DZ1A 3I90A 5FO7B 4R9WA 1MHWC 5J22A 1VF5C 1UEAB 5LMUQ 1CA5A 5K36H 1VQGA 2AQ3B 4FDBA 1GUWA 1IZ6A 2NVYH 4H13C 4CHTB 4JI4Q 5KYLA 3I8ZA 1C7YA 2DUDA 2HQLA 3HFZB 2DJGC 4GNXA 1K83H 1VQBA 2Q8RE 2RKSA 1J6QA 3S2DB 2WKCA 3A5UA 1N32L 1AZQA 4GZYC 1YNJC 3J7AV 4XT1B 2Q8TA 2QKIC 1A0IA 1STEA 4X3SA 4LFBL 3Q22A 2MJ8A 1GD7A 4K14A 3QOLA 1BF4A 2JA7B 2OF1A 3FKIB 2F4IA 3KF8B 4RHRA 2IL8A 1V1PA 1SNOA 5CGKA 2VQEQ 5FK9C 1CQVA 2FHTA 4MNOA 4GKJQ 2I5HA 1S4ZA 4L5TA 4XTCS 1PH9A 1VQNA 4A3DG 3A55A 4IUTA 3OMGA 1EWIA 2PW5A 1S5BD 1BQQT 2PCFB 5FKAC 4A3LH 1EY5A 1N9WA 4JVZA 1AE2A 1PXUA 1G6ZA 4DN4M 3K80C 2JEBI 2UUCL 3ULPA 2O5IC 3NEMA 1LTBD 4MHEA 3Q24A 4KY5A 4UP9A 4FF4A 4XT3B 4F8MA 3M3YB 2PQEA 1Y8NB 4IJHA 3QR8A 1R9TH 1PTOF 4JI5L 4WFN3 2K50A 1DCZA 1BBXC 1KAAA 4BBSG 1Y8OB 3GTLB 1TIID 1ZYRD 5C4ZA 4X3UA 1WYDA 2OCEA 3ITPA 1TU2B 1O7LA 4K6DA 3E0JA 3E9IA 1JWSD 4DV0Q 1XMOL 2M2LA 1A15A 3TZUA 3TEHB 3D4DA 3AFPA 2R92H 2E75C 2H4OA 3UDFA 4POFA 3RZDB 5M3FG 2K01A 1H95A 5D65A 2RDHA 1LO5D 4GN5A 4RGMA 2M00A 2JK8A 4IUQA 4JI0L 5BN3A 2AQ1B 1IL2A 4LFCQ 1M90C 3G4SA 1SMYC 3PMFA 1CZGA 1I94L 4JYAL 2NVXB 2AWNA 4LW1A 2F3IA 4GOPC 4WJWA 4UPAA 1JJ2A 4JI0Q 2NTTA 2F0DA 2A74C 2JE6I 2KHSA 4K2KA 3KJOA 3S17B 4L5SA 3EQLC 2RSOA 1XNRL 1R9TB 1A2TA 5FLXL 2B29A 2WV6D 4DNIA 1S72A 1TY2A 3KK7A 1WOCA 4IJLA 2VXWA 1RHPA 1LT6D 4X65Q 2UUAL 2MP1A 2X69A 2GVBA 4JCVE 1HA5A 5CR3A 1H9KA 5C4XB 4JI2Q 4JI6Q 2YTYA 2D0OA 4LF4L 4HIOA 1EWCA 3S24A 5EBDA 3OYYA 1HHVA 4LF6L 5I2XA 4L6TB 4HSVA 5EKLA 2TSSA 4NW2A 1H9SA 5C0XJ 1WJJA 1JJGA 4A3KG 2B63B 3HOVB 3HOWB 1NMGA 5I9OA 1PV4A 1MIUA 1V9PA 5I9PA 5KIXA 4C3HH 2QA4A 1AFPA 1F9SA 1VQMA 3CCMA 1EY9A 5G3LF 1NR4A 5C4XG 2R93H 2HIXA 3Q6SA 4DA2A 3URYA 4APVA 4HSPA 3ULJA 5CMDA 1OXSC 4LF6Q 4RGNA 2K5QA 4FVMA 2IWHA 4KY6A 3VYTA 4JC0A 2Z9HA 3K7UC 2PW7A 4BBRH 2JP1A 2A5HA 5FLMG 4LF7L 1M1KC 4YWMA 4ME3A 5E7NA 4K5WA 4KHZA 3C1FA 2M9VA 1KABA 4C2MH 1CHPD 1HFNA 2BE5C 4KD4A 3HOUG 2QEJC 3SXHA 4DR1L 4YIJA 2E74C 4YCWA 4JI7L 4K0KQ 3OWEB 2EYOA 1HR0L 3RN2A 3KDFA 1J9OA 2E2IB 2UU9Q 1U5KA 1S40A 1NUCA 4Q0FA 3CD6A 2IW3A 2VQEL 4A3GG 5LMNQ 3GTMH 2A69C 4IFDJ 1TWFB 3A5ZB 1OXTA 2IT1A 3ICEA 3ERSX 3PF5A 1EY6A 3KF6B 2VS1A 1PVOA 4A3BB 1Q86C 2IPKD 1K3RA 2A1AA 2WACA 1AZPA 5GAGC 3GTPB 3PO2B 3FMCA 1HZCA 2GA4B 1YNND 1DOKA 4ZKCB 4DV4Q 3NHHA 4OELB 4HMJA 5FO9B 2Q2IA 3ND9A 1PFSA 2B2UA 3U4ZA 2AHOB 3NTHA 1RODA 1JCKB 1Q3LA 3J81E 3L7ZC 1QG7A 2FXQA 1PFBA 3A7LA 2CKZB 3FPPA 3U58A 3DWPA 4M1UB 1MD2D 5GQOA 1BCPB 4A3IB 1Z9FA 4DXGA 5LMNL 5D3DA 2B2VA 3STBC 2E76C 2V4DA 3NTKA 3M4OB 2NTSA 2XRSD 3H0GH 1OXUA 3TP7A 4KTAA 1VS0A 3J7AF 3P75A 2RCFA 1BR9A 3JAMc 3K8AA 1I4GA 4A75A 4DV7L 2BH2A 4OL7A 2RDGA 3HOZH 1NMFA 3J81L 2E5LL 4KV6A 4JBJA 4CDEC 5EJWA 5IYDG 1CQFA 1L0WA 2B2YC 4IN3A 3UI2A 2NZHA 1KRTA 4LF4Q 2JJQA 1B3QA 1STAA 2LXKA 1BXTA 2ZXRA 1I50H 1JE5A 3I4MG 3S1RB 2DY7A 2D9UA 3L0OA 2A6EC 4LUOA 3DXJC 2Q2UA 2G5DA 4A3IH 4ILWA 1F9PA 4JI4L 3T56B 1KIXA 1SFOH 3S16B 1L1OA 2CW0C 1XNRQ 2AWOA 4XXEA 1ASYA 4MIUA 3VR6A 2JA6B 1VQAA 2UXCL 2A19A 1JB3A 5FOBB 4CKCA 3MAQA 2Z6KC 2NVTH 2MO1A 4DV3Q 1MGSA 2AUKA 1LUZA 1QZHA 1KLGD 4A3FG 5CV8A 1STGA 2KHJA 3NQTA 1TR5A 2N3SA 1IYJB 2K33A 4DV3L 1QCBD 2I07B 1F2ZA 1SYCA 4DV2L 4A3MG 1C8CA 5EAYA 5FLXc 2NVYB 3MXPA 1HZ9A 1T9HA 2EY6A 2DNCA 1PRTF 3CCLA 3I4MB 3GTMB 3OTOL 3TBIB 3QB3A 1I4QA 2F0GA 2Z8LA 1BNZA 1G291 5EKIA 1PTOC 4A4IA 1XTCD 4CJ0B 2RHSB 2ZXPA 5LHY1 4P75A 3F2CA 1JWUD 1SBBB 5M5XH 4A3JB 3J7A5 1LTRD 2JA7H 1ILQA 3V2TA 3CCJA 3S14B 2K14A 1JJCB 2ZJRA 1Y69U 2L1BA 2O4XA 1HNWL 4IZ8A 4IURA 4MZ9A 1I94Q 4QF4A 1TS5A 1X65A 2E2DC 4EQPA 3G6JB 4F87A 5GROA 5IGGA 4KHVA 1L0XB 1PHJA 1Q81C 1IBKL 4DV5Q 1KD1C 1EOTA 1E0BA 1GJXA 4ZK9B 2EYHA 4K8IA 1LLRD 4HAEA 4A93B 1KAWA 3BYYB 4TSSA 2O2LD 4BY7H 1CKOA 2K4KA 3SDZA 3UE1A 5BN5A 5E4XA 1U4PA 1N32Q 4ZQ3A 5I2YA 4NP5A 5BR8Q 3S1MB 3K0XA 3U9OA 1SNMA 2K75A 3H09A 1CM9A 1N36L 3OTOQ 4KHPQ 3I3CA 3CU7A 5IT9E 3ONAB 4ULLA 1B2TA 2B2WA 4X62L 4AYBB 2SOBA 2JEAI 4ID6A 3KF6A 4IPCA 3TP8A 3JAML 1QVGA 5IIFA 1WD0A 2A6HC 2IX1A 1SMYD 4IUVA 3VR2A 1TWAB 4FXGC 4PZ8A 3WOEA 4DR3L 1XNQL 1I6HB 4LUZA 4UP7A 4JYAQ 1IYUA 1EQTA 3VA7A 1HNWQ 1J8IA 2HHHL 3TP5A 2RQXA 2VY3A 3NXWA 3OW7A 5M5YH 4KK7A 4KN7C 1ET6A 2Z1CA 1X6OA 4A3GB 4BBSH 2K05A 1II3A 2SEBD 1C48A 1RL2A 1Y8PB 2C35B 4DR4L 2EY5A 2F0WA 3GTOH 3FVQA 1FR3A 4CDFC 2E2IH 1K0SA 2AUJD 4PMCA 4V0BA 1QUQA 1PH6A 2B39A 1NJIC 3OW2A 4JI5Q 2PMZB 2RCNA 1FVIA 2G9HD 4P72A 1NY4A 2AQ2B 4LF5L 2LKVA 4NDXA 1D5XC 1FJGQ 1A62A 3DUZA 3G48A 2OEOA 2VB3X 2PNRC 4G7OC 4JK1C 2UUCQ 3W2DA 5LL6X 3D8GA 4IFDG 4MTKA 1EIFA 4IPGA 3HKZE 3MFYA 4RG1A 4DV5L 3HP3A 1STNA 4N9PA 2F0MA 2MFIA 4NXMQ 2DGYA 4MTNA 5JAVA 4X3TA 1FGUA 1N33Q 2K28A 4C56C 1MI2A 2VW9A 2R7DA 1VQFA 4X66Q 4HCSA 2VUMG 1LTGD 3NE5B 1YNNC 1XPUA 1XPOA 3G7LA 2JA5B 2H5XA 4OWTB 1I4XA 1H9JA 1JORA 4GLXA 1UNSA 1SE2A 3CRKC 2PZTA 1TXYA 2NB0A 5I6YA 3F2UA 1VQPA 1WTOA 2JYOA 2PNHA 2EYPA 1JOOA 2E2JB 4A3KB 1F77A 2VL6A 1G6PA 2Q2TA 5JJIA 2ZTEA 1YHQA 5CV7A 3STBD 2R93G 2KA7A 2OQKA 1RD9D 3MXUA 4C3HG 4E6IA 5M3MB 4PQXA 4R8IA 3D6CA 5IGEA 3C1EA 5JJZA 5M3FH 1D1IA 2WAQE 3EN2A 3PV0A 2A69D 1K0RA 3F2BA 1HR0Q 5IY0A 3E9HA 4JI1Q 4HJAA 1GHJA 2VQFL 2ICEC 2F52A 3NENA 4KKTA 4A3MH 4EQOA 4I65A 2F3WA 3HRZC 4A3BH 3GTKH 3M7NA 4HN7A 1EQVA 1A63A 4YY3Q 1Y1VG 3FPUB 1SN8A 5JVG3 1V1OA 5CV6A 4Y7NH 1SRUA 1WTQA 3T1YQ 2EXDA 3ZYYX 4A3CG 4DKAC 1VQHA 4OX9L 1NE3A 1S5ED 2FINB 1BBUA 1E2WA 3UDXA 4A3GH 3I70A 3IRBA 1Q12A 3JAME 1E2VA 1XTDA 2KEEA 2EJFC 1S5FD 5EPJA 3KF8A 5M3FB 1EQRA 1HQRD 2KCCA 4A76A 1WFQA 1EIYB 3CCQA 3W5OA 3I4MH 3I4OA 3AEVA 2K5NA 2C5CA 4YHHQ 1IYVA 1W2BA 1ENFA 4OO1I 2ZTDA 4NXML 4LFCL 4K6LA 3FRPB 3VYSA 4TVAB 4FXDA 1KDBA 3CXCA 5IYDH 2R92G 4R4CA 1ILPA 1RTNA 3HKSA 5KNBA 4DUZQ 1DOLA 4UAIA 4CGYB 4ZUJA 4DV6Q 3TREA 2RF4A 3DM3A 2BCOA 3MEFA 1E24A 4RGOS 4DK3C 2JN4A 3PUWA 1SJED 4OEMB 1NSNS 4LFBQ 4KI0A 3TDQA 3NK9A 1VQKA 1TY0A 1VCIA 3J81c 4DR6L 3BG3A 5DAUA 1MJEA 1X9NA 2B2YA 4IPHA 4RAUC 4AYBE 1EFID 3UDIA 2EDGA 4CDDC 5IOCA 1SROA 5EPKA 1G2SA 4IO9A 3HOXB 4RA8A 4J6HA 3K58A 1HXYD 2JA6H 4IFDI 1XJVA 4J8QA 1PH7A 4BXXH 2N49A 2L4NA 3KBXA 4I7ZC 4EGVA 3RLNA 2KJXA 2F03A 2EVBA 1W6KA 3A74A 3DM1A 5G3LD 1D8LA 4GLVB 4DAPA 3SGIA 2FMCA 2WFWA 5DEHA 1MBYA 3I4LA 2Z4HA 1EEFD 5IYBG 2D62A 4C1NI 4FNFA 1VQEA 5IP9G 4XQJA 3JAMi 2CCZA 1VQCA 3OHXC 1VQ5A 4B3TL 4YWLA 4BY7G 2PZWA 5JPNC 1PRTB 3VR5A 2QGQA 4A3BG 1NCVA 4JV5Q 1I6HH 5C4JH 2EYFA 2KENA 4BXXG 3HOYB 1HZAA 4L5RC 4C3IH 3QO2A 1LM0A 3J80c 3V05A 1LTAD 2Y0SG 1BBWA 2F0LA 3MXGA 1FGBD 5BN4A 4QQBX 5L37A 3I4NB 1P16A 4DV7Q 3MEHA 4BA2I 5C5LA 1F2MA 5JJLA 2CWAA 3K5LA 1MJCA 2XWJB 3T53B 1BOSA 1KLUD 2SNSA 5CYUA 3EIVA 3PCOB 3SK5A 3K5NA 1LTTD 1S3OA 1XMQQ 3TRZA 1W6JA 1A8VA 4DV0L 4RH6A 2EPBA 4CBVA 3PIO3 1L2FA 2F0QA 2UXDQ 1WCMB 1KC8C 1EY0A 4EX5A 2XNAC 4OWXB 3S1NH 2B3GA 3DMUA 4O1NA 1I4PA 4C2MB 2I5LX 1XXGA 3R93A 2HIVA 5GAEC 1XPRA 3CRLC 2PI2A 2K5HA 4QUFA 1PZKD 5FJ8H 5J39A 2J4XA 4RKBA 2L55A 4A3DB 1PH4A 1MKHA 1CFMA 1R4QB 2UUBQ 2VQFQ 3HG9A 4U68A 3QOJA 2UU9L 2CW0D 3BVMA 4GNXC 1BCPC 3DEOA 3DWAA 1TWGH 3R2TA 3GO5A 2N55A 2Z6KA 4V190 3J80i 1TS4A 3RD4A 2B2TC 5TSSA 3OWFA 2CFMA 1HRJA 4CJ2C 3PO2H 2A6HD 1UUPA 3WOFA 1GUNA 1NBWA 3S9WA 1TQOA 1SE3A 3GTQB 3ULLA 3IAYA 4ZLTF 4IPDA 2RSNA 3S1QH 4DUYL 4C1NK 4OXPA 1JT8A 3TS2A 1GO3E 2PYKA 1SNCA 1VQIA 2Z4IA 4XIGS 5KEEA 4B3SL 2G9DA 4KJOA 1EYDA 1Z47A 2F0JA 1EU4A 1CKNA 1B53A 2CH4A 5A2QL 5IWAL 1L1OC 4IALA 2VUMB 1E2ZA 4NXNQ 2QCPX 3PQIA 3OSOA 3HZXA 2ASBA 2KHIA 4DAYA
chains in the Genus database with same CATH topology
2D0PA 1FL0A 4R4OA 2UXCQ 4X6AH 1PHJA 4GKJL 1Q81C 1IBKL 4DV5Q 1KD1C 3AFQA 5IE8A 5IYBH 3CPWA 4HIKA 3HKZG 3UDGA 1KAWA 1XMOQ 3I4NH 4JG2A 5FJ8G 1VQDA 5IP7G 4BY7H 2IY5B 1CKOA 1X3FA 4JBKA 1K73C 3RLFA 3I4NG 2K4KA 3BZKA 3UE1A 1HJPA 3TS0A 3K7AH 4LF5Q 4OONA 4OWWB 4DR7Q 1HNZQ 1DGSA 2XTIA 1N32Q 5M3MG 2E2JH 1E1OA 3J81i 4OX9Q 4DR6Q 1AH9A 1Q8KA 5BR8Q 4DR5Q 3U50C 3K0XA 4DV4L 1OXXK 2K75A 3HOUH 1N36L 4KHPQ 2YYZA 4PZ6A 3OTOQ 1EYGA 4LF9L 1TWFH 1Q46A 3RNUA 2NN6I 1PH5A 3PF4A 1YNXA 1YHBA 3KFUA 4A3CH 1N34L 4X62L 1YJ9A 4R4IA 4HJ8A 1PH2A 1VQLA 1QVFA 1OXVA 3S16H 2I5MX 1Y1VH 5LMNW 2CWPA 1W3SA 1J5EL 2JEAI 1PYSB 3KF6A 4IPCA 1QVGA 5HGQA 3FKIG 3HOYG 4GNXB 2IX1A 1JMCA 1VQOA 4B3RL 1JB7A 1C0AA 4PZ8A 4P73A 4JBWA 4BY1H 4DR3L 1XNQL 5DLQE 2R7ZG 4LUZA 4UP7A 5IYCH 1IBLL 4JYAQ 4HJ5A 4R1JA 1HNWQ 4DR2L 5K36G 3I7FA 1YIJA 1C9OA 3FP9A 3ZJYC 3H15A 2HHHL 2I0QA 2VY3A 4B3RQ 2UXBQ 1NTGA 5M5YH 5H1SE 5C4XH 3CMAA 2ES2A 5LMUQ 3H0GG 2MO0A 1X6OA 3KDFB 4BBSH 1VQGA 3RR5A 4FDBA 4HIMA 1IZ6A 2NVYH 3KYHC 3PGZA 4UP8A 1Y1WG 1RL2A 2C35B 2IHEA 4JI4Q 3S1MH 4DR4L 3F2DA 2GVAA 3GTOH 3BU2A 2Z0SA 2E2IH 4H02A 1C7YA 2DUDA 2HQLA 3HFZB 1PH6A 1QUQA 3M4OH 1IXRA 4GNXA 1Q82C 1NJIC 1K83H 1VQBA 1YZ6A 3OW2A 2WP8J 3GTQH 1J6QA 4JI5Q 1N32L 3A5UA 2PQAA 3CCUA 2RCNA 3M3YH 2OTJA 1FVIA 4DR7L 4P72A 4IOCA 1NY4A 2N8NA 2Q2HA 3HOXG 4LF5L 1FJGQ 2VNUD 3CC2A 1A62A 4JOIC 4YWKA 5C3EG 2BA0A 3G48A 1A0IA 4LFBL 4A3KH 3WWVA 1SLJA 2A8VA 3GTGH 3RZOH 1GD7A 2UUCQ 4AQYL 1RIPA 4IFDG 1LTLA 3S14H 1EIFA 3KF8B 4IPGA 3HKZE 4X66L 2VQEQ 2B63H 3CCEA 1HNXL 4RG1A 1IBLQ 4DV5L 4MNOA 3H3VH 3A0JA 2I5HA 4L5TA 4XTCS 1PH9A 2VUMH 1VQNA 4GKJQ 4A3DG 4JI8Q 1EWIA 2MFIA 1GKHA 3F8TA 1VQ6A 4JI3Q 4NXMQ 5JEAJ 2VZAA 2DGYA 4MTNA 2WB1E 4A3LH 1CSQA 3PIPA 1FGUA 1N33Q 4LNQA 1KRSA 1N9WA 2PMZE 2R7DA 2VW9A 1VQFA 4X66Q 5IWAQ 4DR1Q 1AE2A 2VUMG 1KHIA 3K80C 2IX0A 2JEBI 1XPUA 1E22A 2UUCL 1XPOA 3ULPA 4Y52H 1BKBA 2H5XA 4NB3A 3NEMA 1K8GA 1E3PA 3PO3H 4UP9A 3KJPA 4OWTB 5BR8L 1FJGL 3S2DH 4GLXA 4QGUA 2ATWA 3KLWA 4IJHA 4YCVA 1TXYA 4A93G 3I2ZA 4RMFA 1Y1WH 1R9TH 1VQ4A 4LF7Q 4JI5L 1VQPA 4JI2L 1HNZL 2K50A 2PNHA 2ZTCA 3CAMA 1HR0W 2EIFA 4BBSG 1TWHH 3AYHB 2VL6A 1G6PA 2L15A 2Q2TA 5JJIA 2ZTEA 1WYDA 5J3BA 2OCEA 1YHQA 1HH2P 3GD7A 2YTVA 3E9IA 3STBD 5FLMH 1GVPA 2OQKA 4DV0Q 1QUQB 1X54A 4ALPA 1XMOL 2R93G 3TEHB 3AFPA 2R92H 4POFA 3D31A 3UDFA 4IOAA 5M3FG 1H95A 5GADC 4GN5A 4NPSA 1N33L 1YI2A 4LF8L 5M3FH 2JK8A 2WAQE 2KCMA 3EN2A 3PV0A 4LUVA 4JI0L 1IL2A 2UUBL 4GKKL 2UXBL 4LFCQ 1M90C 1EOVA 1X55A 3G4SA 1K0RA 3F2BA 1HR0Q 4JYAL 1I94L 5IY0A 2K5VA 2AWNA 3E9HA 4LW1A 4JI1Q 1XNQQ 4HJAA 1L1OB 1WCMG 2F3IA 2VQFL 4DPGA 1V43A 2F52A 3NENA 4UPAA 4HJ9A 4GOPC 1YITA 4A3MH 1JJ2A 4JI0Q 1YBYA 4BY1G 2R7ZH 3CF5A 2IHFA 4AQYQ 1PH8A 2JE6I 4K0KL 4DK6C 4LFAL 4B3SQ 4A3BH 1PYBA 1UE1A 4R4TA 3KJOA 3GTKH 3M7NA 4L5SA 4KLKA 1XNRL 3PO3G 1A63A 1TWAH 4UY8C 2B29A 1E7ZA 4YY3Q 1Y1VG 4DNIA 1S72A 1WI5A 1SN8A 1WOCA 4IJLA 4O2DA 4HIDA 4Y7NH 2R7FA 2V1CC 1SRUA 1UE6A 1KQSA 1TWCH 1B7YB 4GS3A 4X65Q 3PUVA 2EXDA 3T1YQ 2UUAL 2GVBA 4JCVE 4PMWA 4DKAC 4A3CG 1VQHA 4OX9L 1NE3A 4JI2Q 5C0XG 1BBUA 4A3LG 2HT1A 3UDXA 4A3GH 4JI6Q 3IRBA 1Q12A 2JQOA 4YY3L 1XTDA 2YTYA 4B3TQ 2D0OA 3B6YA 4LF4L 4HIOA 4A3IG 2WB1G 3S24A 3OYYA 2OWOA 1EQRA 1YJNA 4LF6L 4A76A 2B63G 1AE3A 1WFQA 1EIYB 1U0LA 4P74A 1X3GA 3CCQA 3I55A 3W5OA 5C0XJ 5GAHC 3I4MH 3I4OA 3AEVA 1WJJA 3K81C 3F1ZA 4DV6L 2JA6G 1JJGA 2K5NA 4YHHQ 5JEAG 4A3KG 1W2BA 3PUYA 4OO1I 2R6GA 2ZJQA 2ZTDA 3T1HQ 1NMGA 2NZOA 1PV4A 2K52A 1MIUA 1V9PA 4LFCL 4JI3L 4AIMA 4NXML 1I3QH 4TVAB 4JI8L 3PUZA 4C3HH 2QA4A 4LF8Q 1EFWA 1WCMH 3CXCA 3CCMA 1VQMA 2R92G 5IYDH 4NXNL 4R4CA 1CKNB 3HKSA 4DUZQ 5C4XG 2R93H 2HIXA 4DV6Q 3TREA 2RF4A 3DM3A 3S1RH 4BBRG 4X64Q 2PI2E 2NVQH 3MEFA 1E24A 1N34Q 2ID0A 1YJWA 4DK3C 4APVA 3BZCA 1CUKA 1X3EA 3ULJA 3PUWA 3I56A 4LFBQ 4WJ4A 4KI0A 1OXSC 4LF6Q 1VQKA 3J81j 1VCIA 4PZ7A 3M9BA 3J81c 4DR6L 4J15A 1Q1BA 4JC0A 1K9MC 1QVCA 2ZM6Q 3K7UC 1MJEA 1UWVA 4BBRH 4LF7L 5FLMG 1X9NA 4POGA 1M1KC 4IPHA 4AYBE 4YWMA 3Q8DA 4ME3A 1I5FA 4GN4B 3CW2C 5E7NA 4KHZA 2YTXA 3UDIA 3RN5A 1D7QA 4GN3B 4LWCA 1PH1A 1O7IA 4C3JH 2GN5A 1G51A 4C2MH 2JA5H 1SROA 2N78A 4AH6A 3M4PA 4JOIA 4IO9A 4A3EG 4A93H 1XMQL 2RHQB 1SR3A 3HOYH 3HOUG 3PO2G 4X64L 4DR1L 5HY6A 2JA6H 4IFDI 1XJVA 1PH7A 1OTCA 4YCWA 2N49A 4DV2Q 4BXXH 1IBKQ 3CP0A 5LMUL 4JI7L 4L5QA 3RLNA 4K0KQ 1IBMQ 4A3DH 3A74A 3RN2A 1HR0L 4WJ3M 3KDFA 1ASZA 1D8LA 4GLVB 4DR2Q 2UU9Q 3EBEA 4JI1L 1U5KA 1S40A 3SGIA 2WFWA 3CD6A 3TQYA 2VQEL 3KOJA 4A3GG 3RZDH 5LMNQ 3GTMH 4IFDJ 3A5ZB 5IYBG 1OXTA 2IT1A 3ICEA 3ERSX 2D62A 3PF5A 1Q1EA 3KF6B 1J5EQ 2VS1A 3PUXA 4PG3A 1UE7A 1PVOA 4QY7A 1VQEA 5IP9G 2PQAB 3JAMi 2CCZA 1VQCA 1Q86C 5C0XI 3M85A 2WAQG 2Y0SE 4X62Q 1VQ5A 4YWLA 2QEXA 4B3TL 1K3RA 2A1AA 1EQQA 3M4QA 5GAGC 1YHAA 4BY7G 4DV1Q 2F4VL 1HZCA 2QGQA 4A3BG 4DV4Q 1Y14B 3S2HH 5C3EH 4JV5Q 2KBNA 1I6HH 5C4JH 1UEBA 2KENA 3T1YL 3HOXH 2Q2IA 3U4ZA 1PFSA 3G71A 4BXXG 2AHOB 1HZAA 4DV1L 2F4VQ 1Q7YC 4DR4Q 4L5RC 4A3JH 4C3IH 1LM0A 3L7ZC 4TQUS 3J80c 3CCRA 4A3EH 2NN6G 3FHWA 2FXQA 2Y0SG 3GTJH 2LXJA 3CQZH 1KL9A 4B3ML 1BBWA 2CKZB 4GLAC 3U58A 3CCSA 5GQOA 2YV5A 1Z9FA 4QQBX 5LMNL 3CPFA 2E5LQ 3STBC 4YCUA 2JA7G 1LYLA 3H0GH 5JJKA 1OXUA 1P16A 2EQSA 4DV7Q 1VS0A 4BA2I 4QL5A 3HOVH 5JJLA 1P8LA 2CWAA 3UE0A 2CQOA 3JAMc 1MJCA 3K8AA 2JA9A 4A75A 3T1HL 4DV7L 1SMXA 4JI7Q 2BH2A 3J7ZC 1HNXQ 3HOZH 3HOVG 1NMFA 3GTPH 4BA1I 2E5LL 5ELOA 3NBHB 3EIVA 3LGJA 3PCOB 4P71A 2JA8G 4JBJA 1S3OA 5IT9c 1XMQQ 5IYDG 3D0FA 1A8VA 2AMCB 3FKIH 4A3JG 3TRZA 3PSIA 4DV0L 1L0WA 4QIWE 2AKWB 4LF9Q 1L2FA 4B3MQ 5AJ3L 5M3MH 4A3FH 2NZHA 2UXDQ 5C44G 1KRTA 1EUJA 4LF4Q 1KC8C 2JJQA 2OTLA 2LXKA 1GM5A 4JI6L 1I50H 4EX5A 1JE5A 2XGTA 3I4MG 1SE8A 3NELA 2ZM6L 3U4VA 1B8AA 3L0OA 4OWXB 3S1NH 2B3GA 1E1TA 3AQQA 5IP9H 5M5WH 2KCTA 3CMEA 1K8AC 3S15H 4LUOA 4HJ7A 3BJUA 4A3IH 2Q2UA 4JI4L 1B70B 1KIXA 2E2HH 2I5LX 1KXLA 1SFOH 1L1OA 1YEZA 1XNRQ 1N8RC 2AWOA 2HIVA 3S17H 5GAEC 1ASYA 1XPRA 5IP7H 2PI2A 1VQAA 2ALYB 2K5HA 4LFAQ 1VQ9A 2A19A 5FJ8H 2UXCL 1CSPA 1HZBA 3W1GA 4EQ5A 4AYBG 2Z6KC 2NVTH 2MO1A 4DV3Q 1MKHA 1QZHA 1LUZA 1PH4A 3E0EA 5C44H 4OO1G 2UUBQ 2VQFQ 4GOPB 4A3FG 2E8GA 2KHJA 4DR3Q 3GTLH 2N3SA 3MXNB 2UU9L 1IYJB 4YHHL 3RLOA 2MNAA 4JBMA 3GDEA 2YU9H 4DV3L 4O0AA 4GKKQ 4GNXC 2JA8H 1IBML 3HOZG 2JA5G 1TWGH 4DV2L 4A3MG 3H3VI 3GO5A 5EAYA 2Z6KA 5ELNA 5FLXc 1HZ9A 1T9HA 3J80i 1PA6A 1V1QA 3HOWG 1UE5A 4DUYQ 2CFMA 3CCLA 2LSSA 3PO2H 3OTOL 1N36Q 4KHPL 1QZGA 1NBWA 2NVXH 4DAMA 4JV5L 4DAYB 4DR5L 1VQ8A 1G291 2BA1A 3CC7A 4X65L 4A4IA 2UUAQ 3HOWH 3ULLA 4GOPA 2MQHA 3G6EA 2RHSB 4IPDA 4P75A 3L2PA 3F2CA 5IYCG 3JC66 2ZJPA 4DUYL 3CC4A 3S1QH 4OXPA 5M5XH 3J7A5 1PH3A 1JT8A 2UXDL 1CKMA 5AJ3Q 4QJFA 1YVCA 1GO3E 3TS2A 2JA7H 1VQIA 4XIGS 4B3SL 1X56A 3CCJA 3W1BA 1VQ7A 2K14A 1Z47A 1CKNA 1JJCB 2ZJRA 2OQ0A 2HHHQ 5IWAL 1HNWL 1L1OC 4DUZL 3PIOA 4MZ9A 4NXNQ 1I94Q 4R4QA 1VQJA 1X65A 1BVSA 2BH8A 3ER0A 2ASBA 3CCVA 3DLLA 3VDYA 2KHIA 5GROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0P A;  1FL0 A;  4R4O A;  2UXC Q;  4X6A H;  1PHJ A;  4GKJ L;  1Q81 C;  1IBK L;  4DV5 Q;  1KD1 C;  3AFQ A;  5IE8 A;  5IYB H;  3CPW A;  4HIK A;  3HKZ G;  3UDG A;  1KAW A;  1XMO Q;  3I4N H;  4JG2 A;  5FJ8 G;  1VQD A;  5IP7 G;  4BY7 H;  2IY5 B;  1CKO A;  1X3F A;  4JBK A;  1K73 C;  3RLF A;  3I4N G;  2K4K A;  3BZK A;  3UE1 A;  1HJP A;  3TS0 A;  3K7A H;  4LF5 Q;  4OON A;  4OWW B;  4DR7 Q;  1HNZ Q;  1DGS A;  2XTI A;  1N32 Q;  5M3M G;  2E2J H;  1E1O A;  3J81 i;  4OX9 Q;  4DR6 Q;  1AH9 A;  1Q8K A;  5BR8 Q;  4DR5 Q;  3U50 C;  3K0X A;  4DV4 L;  1OXX K;  2K75 A;  3HOU H;  1N36 L;  4KHP Q;  2YYZ A;  4PZ6 A;  3OTO Q;  1EYG A;  4LF9 L;  1TWF H;  1Q46 A;  3RNU A;  2NN6 I;  1PH5 A;  3PF4 A;  1YNX A;  1YHB A;  3KFU A;  4A3C H;  1N34 L;  4X62 L;  1YJ9 A;  4R4I A;  4HJ8 A;  1PH2 A;  1VQL A;  1QVF A;  1OXV A;  3S16 H;  2I5M X;  1Y1V H;  5LMN W;  2CWP A;  1W3S A;  1J5E L;  2JEA I;  1PYS B;  3KF6 A;  4IPC A;  1QVG A;  5HGQ A;  3FKI G;  3HOY G;  4GNX B;  2IX1 A;  1JMC A;  1VQO A;  4B3R L;  1JB7 A;  1C0A A;  4PZ8 A;  4P73 A;  4JBW A;  4BY1 H;  4DR3 L;  1XNQ L;  5DLQ E;  2R7Z G;  4LUZ A;  4UP7 A;  5IYC H;  1IBL L;  4JYA Q;  4HJ5 A;  4R1J A;  1HNW Q;  4DR2 L;  5K36 G;  3I7F A;  1YIJ A;  1C9O A;  3FP9 A;  3ZJY C;  3H15 A;  2HHH L;  2I0Q A;  2VY3 A;  4B3R Q;  2UXB Q;  1NTG A;  5M5Y H;  5H1S E;  5C4X H;  3CMA A;  2ES2 A;  5LMU Q;  3H0G G;  2MO0 A;  1X6O A;  3KDF B;  4BBS H;  1VQG A;  3RR5 A;  4FDB A;  4HIM A;  1IZ6 A;  2NVY H;  3KYH C;  3PGZ A;  4UP8 A;  1Y1W G;  1RL2 A;  2C35 B;  2IHE A;  4JI4 Q;  3S1M H;  4DR4 L;  3F2D A;  2GVA A;  3GTO H;  3BU2 A;  2Z0S A;  2E2I H;  4H02 A;  1C7Y A;  2DUD A;  2HQL A;  3HFZ B;  1PH6 A;  1QUQ A;  3M4O H;  1IXR A;  4GNX A;  1Q82 C;  1NJI C;  1K83 H;  1VQB A;  1YZ6 A;  3OW2 A;  2WP8 J;  3GTQ H;  1J6Q A;  4JI5 Q;  1N32 L;  3A5U A;  2PQA A;  3CCU A;  2RCN A;  3M3Y H;  2OTJ A;  1FVI A;  4DR7 L;  4P72 A;  4IOC A;  1NY4 A;  2N8N A;  2Q2H A;  3HOX G;  4LF5 L;  1FJG Q;  2VNU D;  3CC2 A;  1A62 A;  4JOI C;  4YWK A;  5C3E G;  2BA0 A;  3G48 A;  1A0I A;  4LFB L;  4A3K H;  3WWV A;  1SLJ A;  2A8V A;  3GTG H;  3RZO H;  1GD7 A;  2UUC Q;  4AQY L;  1RIP A;  4IFD G;  1LTL A;  3S14 H;  1EIF A;  3KF8 B;  4IPG A;  3HKZ E;  4X66 L;  2VQE Q;  2B63 H;  3CCE A;  1HNX L;  4RG1 A;  1IBL Q;  4DV5 L;  4MNO A;  3H3V H;  3A0J A;  2I5H A;  4L5T A;  4XTC S;  1PH9 A;  2VUM H;  1VQN A;  4GKJ Q;  4A3D G;  4JI8 Q;  1EWI A;  2MFI A;  1GKH A;  3F8T A;  1VQ6 A;  4JI3 Q;  4NXM Q;  5JEA J;  2VZA A;  2DGY A;  4MTN A;  2WB1 E;  4A3L H;  1CSQ A;  3PIP A;  1FGU A;  1N33 Q;  4LNQ A;  1KRS A;  1N9W A;  2PMZ E;  2R7D A;  2VW9 A;  1VQF A;  4X66 Q;  5IWA Q;  4DR1 Q;  1AE2 A;  2VUM G;  1KHI A;  3K80 C;  2IX0 A;  2JEB I;  1XPU A;  1E22 A;  2UUC L;  1XPO A;  3ULP A;  4Y52 H;  1BKB A;  2H5X A;  4NB3 A;  3NEM A;  1K8G A;  1E3P A;  3PO3 H;  4UP9 A;  3KJP A;  4OWT B;  5BR8 L;  1FJG L;  3S2D H;  4GLX A;  4QGU A;  2ATW A;  3KLW A;  4IJH A;  4YCV A;  1TXY A;  4A93 G;  3I2Z A;  4RMF A;  1Y1W H;  1R9T H;  1VQ4 A;  4LF7 Q;  4JI5 L;  1VQP A;  4JI2 L;  1HNZ L;  2K50 A;  2PNH A;  2ZTC A;  3CAM A;  1HR0 W;  2EIF A;  4BBS G;  1TWH H;  3AYH B;  2VL6 A;  1G6P A;  2L15 A;  2Q2T A;  5JJI A;  2ZTE A;  1WYD A;  5J3B A;  2OCE A;  1YHQ A;  1HH2 P;  3GD7 A;  2YTV A;  3E9I A;  3STB D;  5FLM H;  1GVP A;  2OQK A;  4DV0 Q;  1QUQ B;  1X54 A;  4ALP A;  1XMO L;  2R93 G;  3TEH B;  3AFP A;  2R92 H;  4POF A;  3D31 A;  3UDF A;  4IOA A;  5M3F G;  1H95 A;  5GAD C;  4GN5 A;  4NPS A;  1N33 L;  1YI2 A;  4LF8 L;  5M3F H;  2JK8 A;  2WAQ E;  2KCM A;  3EN2 A;  3PV0 A;  4LUV A;  4JI0 L;  1IL2 A;  2UUB L;  4GKK L;  2UXB L;  4LFC Q;  1M90 C;  1EOV A;  1X55 A;  3G4S A;  1K0R A;  3F2B A;  1HR0 Q;  4JYA L;  1I94 L;  5IY0 A;  2K5V A;  2AWN A;  3E9H A;  4LW1 A;  4JI1 Q;  1XNQ Q;  4HJA A;  1L1O B;  1WCM G;  2F3I A;  2VQF L;  4DPG A;  1V43 A;  2F52 A;  3NEN A;  4UPA A;  4HJ9 A;  4GOP C;  1YIT A;  4A3M H;  1JJ2 A;  4JI0 Q;  1YBY A;  4BY1 G;  2R7Z H;  3CF5 A;  2IHF A;  4AQY Q;  1PH8 A;  2JE6 I;  4K0K L;  4DK6 C;  4LFA L;  4B3S Q;  4A3B H;  1PYB A;  1UE1 A;  4R4T A;  3KJO A;  3GTK H;  3M7N A;  4L5S A;  4KLK A;  1XNR L;  3PO3 G;  1A63 A;  1TWA H;  4UY8 C;  2B29 A;  1E7Z A;  4YY3 Q;  1Y1V G;  4DNI A;  1S72 A;  1WI5 A;  1SN8 A;  1WOC A;  4IJL A;  4O2D A;  4HID A;  4Y7N H;  2R7F A;  2V1C C;  1SRU A;  1UE6 A;  1KQS A;  1TWC H;  1B7Y B;  4GS3 A;  4X65 Q;  3PUV A;  2EXD A;  3T1Y Q;  2UUA L;  2GVB A;  4JCV E;  4PMW A;  4DKA C;  4A3C G;  1VQH A;  4OX9 L;  1NE3 A;  4JI2 Q;  5C0X G;  1BBU A;  4A3L G;  2HT1 A;  3UDX A;  4A3G H;  4JI6 Q;  3IRB A;  1Q12 A;  2JQO A;  4YY3 L;  1XTD A;  2YTY A;  4B3T Q;  2D0O A;  3B6Y A;  4LF4 L;  4HIO A;  4A3I G;  2WB1 G;  3S24 A;  3OYY A;  2OWO A;  1EQR A;  1YJN A;  4LF6 L;  4A76 A;  2B63 G;  1AE3 A;  1WFQ A;  1EIY B;  1U0L A;  4P74 A;  1X3G A;  3CCQ A;  3I55 A;  3W5O A;  5C0X J;  5GAH C;  3I4M H;  3I4O A;  3AEV A;  1WJJ A;  3K81 C;  3F1Z A;  4DV6 L;  2JA6 G;  1JJG A;  2K5N A;  4YHH Q;  5JEA G;  4A3K G;  1W2B A;  3PUY A;  4OO1 I;  2R6G A;  2ZJQ A;  2ZTD A;  3T1H Q;  1NMG A;  2NZO A;  1PV4 A;  2K52 A;  1MIU A;  1V9P A;  4LFC L;  4JI3 L;  4AIM A;  4NXM L;  1I3Q H;  4TVA B;  4JI8 L;  3PUZ A;  4C3H H;  2QA4 A;  4LF8 Q;  1EFW A;  1WCM H;  3CXC A;  3CCM A;  1VQM A;  2R92 G;  5IYD H;  4NXN L;  4R4C A;  1CKN B;  3HKS A;  4DUZ Q;  5C4X G;  2R93 H;  2HIX A;  4DV6 Q;  3TRE A;  2RF4 A;  3DM3 A;  3S1R H;  4BBR G;  4X64 Q;  2PI2 E;  2NVQ H;  3MEF A;  1E24 A;  1N34 Q;  2ID0 A;  1YJW A;  4DK3 C;  4APV A;  3BZC A;  1CUK A;  1X3E A;  3ULJ A;  3PUW A;  3I56 A;  4LFB Q;  4WJ4 A;  4KI0 A;  1OXS C;  4LF6 Q;  1VQK A;  3J81 j;  1VCI A;  4PZ7 A;  3M9B A;  3J81 c;  4DR6 L;  4J15 A;  1Q1B A;  4JC0 A;  1K9M C;  1QVC A;  2ZM6 Q;  3K7U C;  1MJE A;  1UWV A;  4BBR H;  4LF7 L;  5FLM G;  1X9N A;  4POG A;  1M1K C;  4IPH A;  4AYB E;  4YWM A;  3Q8D A;  4ME3 A;  1I5F A;  4GN4 B;  3CW2 C;  5E7N A;  4KHZ A;  2YTX A;  3UDI A;  3RN5 A;  1D7Q A;  4GN3 B;  4LWC A;  1PH1 A;  1O7I A;  4C3J H;  2GN5 A;  1G51 A;  4C2M H;  2JA5 H;  1SRO A;  2N78 A;  4AH6 A;  3M4P A;  4JOI A;  4IO9 A;  4A3E G;  4A93 H;  1XMQ L;  2RHQ B;  1SR3 A;  3HOY H;  3HOU G;  3PO2 G;  4X64 L;  4DR1 L;  5HY6 A;  2JA6 H;  4IFD I;  1XJV A;  1PH7 A;  1OTC A;  4YCW A;  2N49 A;  4DV2 Q;  4BXX H;  1IBK Q;  3CP0 A;  5LMU L;  4JI7 L;  4L5Q A;  3RLN A;  4K0K Q;  1IBM Q;  4A3D H;  3A74 A;  3RN2 A;  1HR0 L;  4WJ3 M;  3KDF A;  1ASZ A;  1D8L A;  4GLV B;  4DR2 Q;  2UU9 Q;  3EBE A;  4JI1 L;  1U5K A;  1S40 A;  3SGI A;  2WFW A;  3CD6 A;  3TQY A;  2VQE L;  3KOJ A;  4A3G G;  3RZD H;  5LMN Q;  3GTM H;  4IFD J;  3A5Z B;  5IYB G;  1OXT A;  2IT1 A;  3ICE A;  3ERS X;  2D62 A;  3PF5 A;  1Q1E A;  3KF6 B;  1J5E Q;  2VS1 A;  3PUX A;  4PG3 A;  1UE7 A;  1PVO A;  4QY7 A;  1VQE A;  5IP9 G;  2PQA B;  3JAM i;  2CCZ A;  1VQC A;  1Q86 C;  5C0X I;  3M85 A;  2WAQ G;  2Y0S E;  4X62 Q;  1VQ5 A;  4YWL A;  2QEX A;  4B3T L;  1K3R A;  2A1A A;  1EQQ A;  3M4Q A;  5GAG C;  1YHA A;  4BY7 G;  4DV1 Q;  2F4V L;  1HZC A;  2QGQ A;  4A3B G;  4DV4 Q;  1Y14 B;  3S2H H;  5C3E H;  4JV5 Q;  2KBN A;  1I6H H;  5C4J H;  1UEB A;  2KEN A;  3T1Y L;  3HOX H;  2Q2I A;  3U4Z A;  1PFS A;  3G71 A;  4BXX G;  2AHO B;  1HZA A;  4DV1 L;  2F4V Q;  1Q7Y C;  4DR4 Q;  4L5R C;  4A3J H;  4C3I H;  1LM0 A;  3L7Z C;  4TQU S;  3J80 c;  3CCR A;  4A3E H;  2NN6 G;  3FHW A;  2FXQ A;  2Y0S G;  3GTJ H;  2LXJ A;  3CQZ H;  1KL9 A;  4B3M L;  1BBW A;  2CKZ B;  4GLA C;  3U58 A;  3CCS A;  5GQO A;  2YV5 A;  1Z9F A;  4QQB X;  5LMN L;  3CPF A;  2E5L Q;  3STB C;  4YCU A;  2JA7 G;  1LYL A;  3H0G H;  5JJK A;  1OXU A;  1P16 A;  2EQS A;  4DV7 Q;  1VS0 A;  4BA2 I;  4QL5 A;  3HOV H;  5JJL A;  1P8L A;  2CWA A;  3UE0 A;  2CQO A;  3JAM c;  1MJC A;  3K8A A;  2JA9 A;  4A75 A;  3T1H L;  4DV7 L;  1SMX A;  4JI7 Q;  2BH2 A;  3J7Z C;  1HNX Q;  3HOZ H;  3HOV G;  1NMF A;  3GTP H;  4BA1 I;  2E5L L;  5ELO A;  3NBH B;  3EIV A;  3LGJ A;  3PCO B;  4P71 A;  2JA8 G;  4JBJ A;  1S3O A;  5IT9 c;  1XMQ Q;  5IYD G;  3D0F A;  1A8V A;  2AMC B;  3FKI H;  4A3J G;  3TRZ A;  3PSI A;  4DV0 L;  1L0W A;  4QIW E;  2AKW B;  4LF9 Q;  1L2F A;  4B3M Q;  5AJ3 L;  5M3M H;  4A3F H;  2NZH A;  2UXD Q;  5C44 G;  1KRT A;  1EUJ A;  4LF4 Q;  1KC8 C;  2JJQ A;  2OTL A;  2LXK A;  1GM5 A;  4JI6 L;  1I50 H;  4EX5 A;  1JE5 A;  2XGT A;  3I4M G;  1SE8 A;  3NEL A;  2ZM6 L;  3U4V A;  1B8A A;  3L0O A;  4OWX B;  3S1N H;  2B3G A;  1E1T A;  3AQQ A;  5IP9 H;  5M5W H;  2KCT A;  3CME A;  1K8A C;  3S15 H;  4LUO A;  4HJ7 A;  3BJU A;  4A3I H;  2Q2U A;  4JI4 L;  1B70 B;  1KIX A;  2E2H H;  2I5L X;  1KXL A;  1SFO H;  1L1O A;  1YEZ A;  1XNR Q;  1N8R C;  2AWO A;  2HIV A;  3S17 H;  5GAE C;  1ASY A;  1XPR A;  5IP7 H;  2PI2 A;  1VQA A;  2ALY B;  2K5H A;  4LFA Q;  1VQ9 A;  2A19 A;  5FJ8 H;  2UXC L;  1CSP A;  1HZB A;  3W1G A;  4EQ5 A;  4AYB G;  2Z6K C;  2NVT H;  2MO1 A;  4DV3 Q;  1MKH A;  1QZH A;  1LUZ A;  1PH4 A;  3E0E A;  5C44 H;  4OO1 G;  2UUB Q;  2VQF Q;  4GOP B;  4A3F G;  2E8G A;  2KHJ A;  4DR3 Q;  3GTL H;  2N3S A;  3MXN B;  2UU9 L;  1IYJ B;  4YHH L;  3RLO A;  2MNA A;  4JBM A;  3GDE A;  2YU9 H;  4DV3 L;  4O0A A;  4GKK Q;  4GNX C;  2JA8 H;  1IBM L;  3HOZ G;  2JA5 G;  1TWG H;  4DV2 L;  4A3M G;  3H3V I;  3GO5 A;  5EAY A;  2Z6K A;  5ELN A;  5FLX c;  1HZ9 A;  1T9H A;  3J80 i;  1PA6 A;  1V1Q A;  3HOW G;  1UE5 A;  4DUY Q;  2CFM A;  3CCL A;  2LSS A;  3PO2 H;  3OTO L;  1N36 Q;  4KHP L;  1QZG A;  1NBW A;  2NVX H;  4DAM A;  4JV5 L;  4DAY B;  4DR5 L;  1VQ8 A;  1G29 1;  2BA1 A;  3CC7 A;  4X65 L;  4A4I A;  2UUA Q;  3HOW H;  3ULL A;  4GOP A;  2MQH A;  3G6E A;  2RHS B;  4IPD A;  4P75 A;  3L2P A;  3F2C A;  5IYC G;  3JC6 6;  2ZJP A;  4DUY L;  3CC4 A;  3S1Q H;  4OXP A;  5M5X H;  3J7A 5;  1PH3 A;  1JT8 A;  2UXD L;  1CKM A;  5AJ3 Q;  4QJF A;  1YVC A;  1GO3 E;  3TS2 A;  2JA7 H;  1VQI A;  4XIG S;  4B3S L;  1X56 A;  3CCJ A;  3W1B A;  1VQ7 A;  2K14 A;  1Z47 A;  1CKN A;  1JJC B;  2ZJR A;  2OQ0 A;  2HHH Q;  5IWA L;  1HNW L;  1L1O C;  4DUZ L;  3PIO A;  4MZ9 A;  4NXN Q;  1I94 Q;  4R4Q A;  1VQJ A;  1X65 A;  1BVS A;  2BH8 A;  3ER0 A;  2ASB A;  3CCV A;  3DLL A;  3VDY A;  2KHI A;  5GRO A; 
#chains in the Genus database with same CATH topology
 4R4O A;  1FL0 A;  1FD7 D;  4GKJ L;  3AFQ A;  1RDP D;  3SHL A;  4BY1 B;  1HPC A;  4FF2 A;  3CPW A;  4HIK A;  3HKZ G;  1XMO Q;  3I4N H;  4JG2 A;  1I4H A;  1SJH D;  5IP7 G;  3LWE A;  4TRD A;  4JBK A;  3RLF A;  3BZK A;  1HJP A;  2R92 B;  4DR7 Q;  1HNZ Q;  2NUC A;  1I3Q B;  1LTI D;  5M3M G;  3V96 A;  4IFD H;  1AH9 A;  2F0F A;  4DR5 Q;  3U50 C;  1OXX K;  3HOU H;  1PFM A;  5C5M A;  1EYG A;  4FF1 A;  2EYJ A;  1TWF H;  3RNU A;  2XSC A;  1LT5 D;  2QDB A;  3KFU A;  4A3C H;  3P7J A;  1SFO B;  1QVF A;  3C3L A;  3K6O A;  1J5E L;  1JIC A;  4IUU A;  2LFN A;  4P2C B;  3FKI G;  1JMC A;  3D4R A;  1JB7 A;  1WD1 A;  4P73 A;  4H7B A;  4BY1 H;  2R7Z G;  4TKO B;  5DLQ E;  2F0S A;  5IYC H;  4Z9C B;  4R1J A;  4RHS A;  5K36 G;  2NBF A;  4B3R Q;  1C9O A;  2I0Q A;  2L5T A;  3H15 A;  2UXB Q;  2KUM A;  5EBC A;  1NTG A;  3GQB A;  5C4X H;  3CMA A;  3H0G G;  2MO0 A;  3KDF B;  3U9S A;  2R61 A;  3SE0 A;  3RR5 A;  1XX8 A;  2CVR A;  4HIM A;  4UP8 A;  2IHE A;  1ET9 A;  2GVA A;  4IQZ A;  4RGT A;  1K8O A;  3A54 A;  2Z0S A;  4JW0 A;  3M4O H;  4Q5V A;  1IXR A;  1PDQ A;  1Q82 C;  1DD2 A;  5T1G A;  4OHJ A;  1TWG B;  3M3Y H;  2PQA A;  3CCU A;  1HTL D;  2Q2H A;  1WTR A;  2VNU D;  3CC2 A;  2BA0 A;  4C3H B;  3RZO H;  3WWV A;  4RWS C;  3GTG H;  1PZI D;  5HGT A;  2EJG C;  1DXM A;  5C4H A;  4F88 A;  5C0X H;  1LTL A;  3S14 H;  1KTK A;  3CCE A;  1IBL Q;  2K6A A;  3A0J A;  2LMC B;  3AU7 A;  4JI8 Q;  3N52 A;  2HDM A;  1SDF A;  3N6R A;  1VQ6 A;  2J0T D;  4JI3 Q;  2QDL A;  2ZXO A;  1HTP A;  2L9H A;  1KRS A;  2PMZ E;  4LNQ A;  3GTJ B;  4NKL A;  5IWA Q;  4DNT B;  1EWH A;  4Y52 H;  1BKB A;  2K04 A;  5AFW A;  3PO3 H;  2HCC A;  3S2D H;  4QGU A;  4IUP A;  2ATW A;  3KLW A;  2Q8I B;  4A93 G;  4RMF A;  1EY8 A;  3K5M A;  5C44 B;  1IL8 A;  1HR0 W;  3RZO B;  1TWH H;  3AYH B;  1B1Z A;  2WB1 B;  1HH2 P;  4ABN A;  3GD7 A;  5FLM H;  1GVP A;  1KNA A;  2K5D A;  1X54 A;  2LY7 A;  2K7V A;  3KLR A;  2X6G A;  1WTH A;  2H1E A;  2WII B;  4DK0 A;  5GAD C;  1NR2 A;  1YI2 A;  3M7G A;  4LF8 L;  2KCM A;  1K3B C;  4GKK L;  2UXB L;  3SK4 A;  1SAP A;  2IX3 A;  1BO0 A;  1XNQ Q;  1L1O B;  1QWY A;  4PV1 C;  4DPG A;  1YIT A;  4HJ9 A;  2N88 A;  1YBY A;  4BY1 G;  2R7Z H;  5CBE E;  2IHF A;  4AQY Q;  1PH8 A;  4G57 A;  1X3Q A;  4K0K L;  2F0H A;  4G4K A;  4B3S Q;  4R4T A;  2F0T A;  3PO3 G;  4UY8 C;  4DFA A;  1M8A A;  1WI5 A;  4O2D A;  1G8Z D;  1B3A A;  1TWH B;  1UE6 A;  1KQS A;  1TWC H;  1B7Y B;  3IKJ A;  3PUV A;  4PMW A;  3CKI B;  3H6M A;  1I4R A;  4B9X A;  2JQO A;  4B3T Q;  4HR7 B;  1T5E A;  4A3I G;  4KJN A;  2F1M A;  3HGB A;  4PMB A;  5KYI A;  1YJN A;  2Z6B A;  1BUV T;  5E3F A;  5CBA E;  1AE3 A;  2B63 G;  2EXZ A;  4KKS A;  3LWU A;  5GAH C;  3AMU A;  3F1Z A;  1SNP A;  2JA6 G;  5JEA G;  2RA4 A;  1JC7 A;  2R6G A;  2ZJQ A;  1U4L A;  2IJ0 A;  4JI3 L;  4AIM A;  4RCO A;  4WRD A;  2MPM A;  1LTS D;  3PUZ A;  2HDL A;  4LF8 Q;  1EFW A;  3C46 A;  1M4V A;  5I4D A;  5CV4 A;  2KED A;  3ND8 A;  3S1R H;  2NVQ H;  4RFB A;  2F0V A;  1N34 Q;  4EVO A;  3BZC A;  1CUK A;  1KDA A;  3S15 B;  4WJ4 A;  2DJF C;  5KRU A;  3J81 j;  3M9B A;  3HKZ B;  4K5V A;  1K9M C;  1Q1B A;  4BS9 A;  1SEB D;  3P20 A;  2ZM6 Q;  2WKD A;  3S1N B;  4POG A;  1HUM A;  2DNE A;  3Q8D A;  5IGD A;  2HQE A;  1C4Q A;  3CW2 C;  4FO2 A;  2YTX A;  1T5X D;  3RN5 A;  4LWC A;  1PH1 A;  1O7I A;  1QJO A;  2N78 A;  2KVM A;  4AH6 A;  3M4P A;  4A3E G;  1EYA A;  4G7Z C;  4UDU C;  2RHQ B;  1XMQ L;  1SR3 A;  1GOZ A;  3PO2 G;  4X64 L;  5CV5 A;  1EZ8 A;  1OTC A;  4DV2 Q;  5KGU A;  1IBK Q;  3CP0 A;  2BDO A;  4L5Q A;  3DHQ A;  1IBM Q;  4A3D H;  1HA6 A;  1UAP A;  4WJ3 M;  2RBM A;  1TKW B;  1ASZ A;  4DR2 Q;  2R93 B;  3EBE A;  2NVQ B;  4JI1 L;  1H9S B;  4XQN A;  3X3M A;  3TQY A;  3RZD H;  4DGZ A;  1A3V A;  1B9N A;  3FEW X;  3NTI A;  1J5E Q;  4PG3 A;  3PUX A;  2K5W A;  4KN4 C;  4QY7 A;  2PQA B;  4BBR B;  5C0X I;  2WAQ G;  2Y0S E;  4X62 Q;  2F0K A;  5FLX E;  3M85 A;  3J7Y W;  1EL0 A;  4NMZ A;  2R7Z B;  1Y14 B;  3L9A X;  3S2H H;  1UEB A;  5I6W A;  3T1Y L;  2O5J C;  3G71 A;  2PPB C;  1QNU A;  3BVG A;  1V1P B;  4DR4 Q;  2KCN A;  1Q7Y C;  1B44 D;  4TQU S;  3SK8 A;  3SK6 A;  4A3E H;  2NN6 G;  1ESR A;  1ZKO A;  1F9R A;  4F7X A;  2BE5 D;  3K59 A;  1TS2 A;  4HED A;  2L12 A;  3CPF A;  2E5L Q;  1JOK A;  5COR A;  4YCU A;  2JA7 G;  5ISR A;  5JJK A;  2EQS A;  1K83 B;  1SYG A;  1IKL A;  1Q90 A;  2CQO A;  3NPP A;  3T1H L;  2EE1 A;  1SMX A;  4JI7 Q;  1HNX Q;  3GTP H;  1A3T A;  4BA1 I;  5ELO A;  3LGJ A;  4P71 A;  2JA8 G;  3GTG B;  3FKI H;  3NSW A;  3S2H B;  1RF2 D;  4QIW E;  5AJ3 L;  5M3M H;  4A3F H;  4HCE A;  4QIW B;  2OTL A;  2J7Z A;  4JI6 L;  1SE4 A;  1G91 A;  2B2V C;  2XGT A;  1EY4 A;  3BS1 A;  3HOU B;  4ZKB B;  1E1T A;  1GUO A;  1LV9 A;  5M5W H;  1L0Y B;  3T51 B;  2KCT A;  3CME A;  1K8A C;  3S15 H;  1PRT C;  1Q8I A;  1B70 B;  2OXP A;  1KXL A;  2XWB B;  3D6W A;  3NP8 A;  2A68 D;  3NBH A;  3ERO A;  4DK1 A;  1MSH A;  1B50 A;  3J80 E;  1ENC A;  4LFA Q;  1SYF A;  3TZD A;  1HZB A;  3W1G A;  4AYB G;  4B08 A;  5IGB A;  5C44 H;  4OO1 G;  2PZU A;  3A8I E;  2E8G A;  4ODG A;  3GTL H;  1SYB A;  4YHH L;  3RLO A;  2MNA A;  1JR0 D;  3GDE A;  4JBM A;  1R4P B;  4O0A A;  2JA8 H;  1OO9 B;  1IBM L;  2SDF A;  2KEC A;  2JA5 G;  4IUN A;  4HTH A;  5HUR A;  1PFN A;  2CQA A;  1V1Q A;  3HOW G;  5T1I A;  4ZUI A;  4K2L A;  2LSS A;  2NYZ D;  4OIJ A;  1QZG A;  1IHZ A;  1DJR D;  2NVX H;  4JV5 L;  4DAY B;  4DR5 L;  1GUG A;  2BA1 A;  1D6E C;  5C4J B;  4C3J G;  4GOP A;  3Q0A A;  2MQH A;  3G6E A;  2EY1 A;  1WTV A;  2ZJP A;  3CC4 A;  1SNQ A;  1FYC A;  5AJ3 Q;  1F2L A;  1DYQ A;  1HFG A;  2P5Z X;  5J1Z A;  2HUG A;  3ERQ A;  1GXD C;  3R3O A;  1VQ7 A;  1K8M A;  4R8N A;  5E4W C;  3R2I A;  2EJM A;  4XQQ A;  2OQ0 A;  2HHH Q;  1TWC B;  4DUZ L;  4FYD A;  5KND A;  2WIN B;  4R4Q A;  1VQJ A;  1BVS A;  2BH8 A;  2XVS A;  3ER0 A;  3DLL A;  4BWG B;  1AP0 A;  3VDY A;  2EY2 A;  1O7Y A;  2D0P A;  1PLF A;  2B2W C;  2UXC Q;  2B8G A;  4X6A H;  2X6L A;  4JPB W;  2EOT A;  4C3J B;  3QIA A;  2L11 A;  5IYB H;  1H9M A;  3OOC A;  3H0G B;  3OIP A;  5M5Y B;  2IY5 B;  5ELB A;  1K73 C;  3I4N G;  3TS0 A;  3O13 A;  4LF5 Q;  5EQ0 A;  4N8F A;  1E1O A;  1U9R A;  4OX9 Q;  4DR6 Q;  1Q8K A;  3GV3 A;  2RDF A;  2YYZ A;  4PZ6 A;  2MUY A;  5ELD A;  2NN6 I;  4A3F B;  4B9W A;  1YNX A;  3PF4 A;  1N34 L;  4ME5 A;  4HJ8 A;  2VB2 X;  1QOH A;  1I50 B;  3TME A;  1QB5 D;  2I5M X;  1Y1V H;  2CH4 W;  3Q23 A;  2CWP A;  1AN8 A;  1PYS B;  2A68 C;  4GNX B;  3A7A B;  3P1H A;  1VQO A;  1JE4 A;  1WVL A;  1C0A A;  4FF3 A;  4O42 A;  5C3E B;  3SR1 A;  1STB A;  1YIJ A;  3PIP 3;  4DU9 A;  1U4R A;  1CA6 A;  1GUS A;  4BY7 B;  3D4W A;  5H1S E;  2ES2 A;  5EPL A;  1D2B A;  3M4Y A;  3E5S A;  3KYH C;  1H9R A;  4LJZ C;  3PGZ A;  3VA5 A;  1Y1W G;  3S1M H;  3F2D A;  1PRT D;  1NNX A;  3BU2 A;  4H02 A;  2SNM A;  2C9O A;  1YZ6 A;  2WP8 J;  3GTQ H;  1GUT A;  2OTJ A;  2EZV A;  4DR7 L;  1X32 A;  3A8K E;  3MFG A;  4IOC A;  2N8N A;  3HOX G;  4K8J A;  1PTO D;  3KLS X;  1JWM D;  4N8X 1;  3BDC A;  4JOI C;  4YWK A;  3TN2 A;  5C3E G;  1JOQ A;  1PTO H;  3BDO A;  4A3K H;  1SLJ A;  2A8V A;  5JEA H;  1ICW A;  1XWE A;  4AQY L;  1RIP A;  2F0U A;  3BDL A;  1EIG A;  5D3I B;  2FJ2 A;  2K03 A;  4X66 L;  2B63 H;  1HNX L;  3H3V H;  2VUM H;  2A73 B;  2RVL A;  1GKH A;  3F8T A;  5JEA J;  2VZA A;  3FDT A;  2WB1 E;  1CSQ A;  3PIP A;  3H94 A;  4BBS B;  4QUC A;  1SSO A;  4DR1 Q;  3RUZ A;  4KY7 A;  1KHI A;  2IX0 A;  1E22 A;  1ZXT A;  4A3M B;  4NB3 A;  1K8G A;  1E3P A;  1VF7 A;  1ESF A;  3KJP A;  5BR8 L;  1FJG L;  2I46 A;  4YCV A;  3I2Z A;  1Y1W H;  4LF7 Q;  1VQ4 A;  4MN3 A;  4JI2 L;  1HNZ L;  1XYI A;  2FFK B;  1EZ6 A;  1PTO B;  1VDZ A;  2ZTC A;  3CAM A;  3W3A A;  2EIF A;  3H91 A;  4Y7N B;  2L15 A;  4EQN A;  2L0C A;  2EYM A;  5J3B A;  5A2Q E;  2YU9 B;  3NWT A;  2YTV A;  3R8B A;  4ALP A;  1QUQ B;  3EJI A;  1D5Z C;  1O7Z A;  5JPM C;  3D31 A;  1WTW A;  4IOA A;  2NZ1 D;  1HCZ A;  4NPS A;  1WTP A;  1N33 L;  1BCP F;  1BDO A;  3GV6 A;  4FP5 D;  4DNR B;  4LUV A;  3OMC A;  4LAA A;  4LK1 C;  1EOV A;  1X55 A;  2WAQ B;  2F0P A;  2NN6 H;  2JSO A;  2K5V A;  1B9M A;  1RTO A;  1ONL A;  3AB9 A;  1WCM G;  1V43 A;  1Y1V B;  3CF5 A;  1TT2 A;  1A6X A;  4DK6 C;  3K57 A;  4LFA L;  1PYB A;  1UE1 A;  4KLK A;  2B2U C;  2JXM B;  1SND A;  1TWA H;  1E7Z A;  1F2Y A;  4G7H C;  5CV9 A;  3MXN A;  4ZYS A;  4QCL A;  4HID A;  1ML0 D;  4QMG A;  2R7F A;  2V1C C;  4S3S A;  4GS3 A;  1IW7 D;  3MZ5 A;  5M9O A;  1SYE A;  5C0X G;  4CKB A;  4A3L G;  5IGC A;  2HT1 A;  4A3E B;  2F3V A;  4YY3 L;  3B6Y A;  2DN8 A;  4DAV A;  4RCN A;  2WB1 G;  5IOD A;  2OWO A;  5IGF A;  4U67 3;  1U0L A;  4P74 A;  1ENA A;  1X3G A;  4UHV A;  3I55 A;  2XIW A;  3K81 C;  4DV6 L;  4K5X A;  3PUY A;  1IKM A;  3T1H Q;  2UUB L;  2NZO A;  3MTS A;  2K52 A;  2K32 A;  1I3Q H;  4JI8 L;  2HCI A;  1WCM H;  3HOZ B;  1GHK A;  4NXN L;  1CT1 D;  1CKN B;  3DEP A;  1G2T A;  1EIH A;  4BBR G;  4X64 Q;  2PI2 E;  1WTX A;  2ID0 A;  2ICI A;  3SVM A;  1YJW A;  1X3P A;  2D5D A;  1DM0 B;  1X3E A;  3I56 A;  3SEB A;  2E2H B;  1ZEQ X;  5C3X A;  4PZ7 A;  3PO3 B;  4J15 A;  2F0N A;  1QVC A;  1SXT A;  1UWV A;  3T4A C;  1CHQ D;  1SYD A;  1IW7 C;  4KMU C;  1K28 A;  1I5F A;  4GN4 B;  2QIL A;  1D7Q A;  4GN3 B;  3RMH A;  4C3J H;  2GN5 A;  1G51 A;  1S5D D;  4KKU A;  2JA5 H;  2MHV A;  2BOS A;  4JOI A;  1MSG A;  3OPO A;  4A93 H;  2R3Z A;  2D2C C;  3HOY H;  1B4O A;  3EFX D;  5HY6 A;  4M8A A;  5KNC A;  5LMU L;  2NVT B;  3EA6 A;  1U4M A;  5DNF A;  3BVZ A;  2TMP A;  5JVH 3;  3VYU A;  3MA2 B;  2HD3 A;  3E3X A;  3MC0 B;  4XDX A;  3KOJ A;  2JA8 B;  2F0E A;  1HUN A;  3D3R A;  2QF7 A;  5C6A A;  1Z7T A;  1Q1E A;  1LAB A;  1QIL A;  3I73 A;  1PMR A;  1D1K A;  1HQM C;  1UE7 A;  4H0L C;  2BDN A;  2QW7 A;  1DON A;  2QEX A;  1EQQ A;  3M4Q A;  1YHA A;  4CDC C;  4DV1 Q;  5DM7 3;  2F4V L;  1RJT A;  1EYC A;  4L63 B;  1YNJ D;  2FMM A;  5C3E H;  2KBN A;  3HOX H;  3GP7 A;  4DV1 L;  2F4V Q;  4ZCK A;  1PYW D;  5M5X B;  3NQI A;  4A3J H;  5ELC A;  3CCR A;  3FHW A;  2B8F A;  3A56 A;  3IFD A;  3CQZ H;  1A2U A;  1KL9 A;  2LXJ A;  3GTJ H;  4GLA C;  4B3M L;  3A8J E;  3CCS A;  3MWY W;  2YV5 A;  3NBI A;  3NUC A;  5JOB A;  5IT9 L;  3WDN A;  1EY7 A;  3I72 A;  1LYL A;  4OIK A;  2F0I A;  3EVQ A;  1CZW A;  3IFT A;  4QL5 A;  3HOV H;  1P8L A;  3UE0 A;  2CHB D;  4ZRZ A;  2JA9 A;  3HS0 C;  3K0Y A;  3K7A B;  3J7Z C;  3HOV G;  5K5P A;  3NBH B;  5A35 A;  2DY8 A;  5IT9 c;  4C3I G;  1LAC A;  3KUP A;  3D0F A;  4A3J G;  2AMC B;  4LMQ D;  3PSI A;  5ELE A;  2AKW B;  2ZT9 C;  4LF9 Q;  3E6Z X;  4XYO A;  4B3M Q;  5C44 G;  4OO1 H;  4QB4 A;  1VMP A;  1BCP D;  1EUJ A;  1D5M C;  4C3I B;  1KDC A;  3I91 A;  1GM5 A;  3QWN A;  1I6V C;  1SE8 A;  3NEL A;  5E1F A;  2ZM6 L;  2K1B A;  3HEJ A;  3U4V A;  1B8A A;  1VMC A;  3CQZ B;  4RKL A;  1ZYR C;  3AQQ A;  5IP9 H;  4HJ7 A;  3BJU A;  4I7A A;  2E2H H;  3KLS A;  2PO4 A;  1QE6 A;  1AW7 A;  1Z6H A;  1YEZ A;  1N8R C;  3S1Q B;  3S17 H;  3L3O C;  3OIQ A;  2LS0 1;  3QG1 A;  5IP7 H;  2ALY B;  1VQ9 A;  1CSP A;  4EQ5 A;  4PNY A;  3K5O A;  1Y1W B;  1JQY D;  3E0E A;  3MVV A;  4GOP B;  3TSS A;  4DR3 Q;  3MXN B;  1A3U A;  3BYT B;  2YU9 H;  1KNE A;  4GKK Q;  3HOZ G;  1STY A;  3T13 A;  3H3V I;  5ELN A;  3X3N A;  1PA6 A;  1UE5 A;  4DUY Q;  1RCV D;  2F0O A;  3GTO B;  5LL6 S;  1AEX A;  1N36 Q;  4KHP L;  1STH A;  3LX0 A;  4DAM A;  1VQ8 A;  3CC7 A;  4X65 L;  2UUA Q;  3HOW H;  3IL8 A;  1TVX A;  4CJ1 B;  5DM6 3;  3L2P A;  5IYC G;  3JC6 6;  5COY A;  2XRQ D;  4CKE A;  1PH3 A;  2UXD L;  3KBG A;  1CKM A;  3GTK B;  4QJF A;  1YVC A;  3CHB D;  3LNN A;  5EGT A;  1QNK A;  1X56 A;  4ZAI A;  4X3K A;  3W1B A;  1F9Q A;  4J1M A;  1S5C D;  4H44 C;  1FNU A;  3PIO A;  3NWS A;  1LT4 D;  4XYQ A;  3CCV A;  2ENB A;  2A6E D;  5D14 A;  3J80 L;  1PZJ D;  2KQ3 A;  3MHB A;  5ELF A;  1DOM A;  5IE8 A;  1RKN A;  5NUC A;  3VR4 A;  4KD3 A;  3UDG A;  2MGS A;  4FXK C;  5FJ8 G;  1VQD A;  5FO8 B;  1FNW A;  5EKK A;  1X3F A;  1O80 A;  3K7A H;  1ICF B;  4OON A;  4OWW B;  1TS3 A;  1DGS A;  2XTI A;  3QJY A;  1O78 A;  2E2J H;  3J81 i;  1CK1 A;  4HMI A;  3VR3 A;  2XN9 C;  4DV4 L;  1LT3 D;  5C3W A;  4LF9 L;  4DF7 A;  5M5W B;  1Q46 A;  1PH5 A;  5CC4 A;  1V8Q A;  4WOR A;  3DWQ A;  1YHB A;  1YJ9 A;  2NWG A;  3BZD B;  4R4I A;  1PH2 A;  1VQL A;  2EYL A;  3S16 H;  1FNV A;  1OXV A;  2Y0S B;  5F2D A;  4OGQ C;  5LMN W;  1W3S A;  1EU3 A;  3TP6 A;  5HGQ A;  4DXF A;  3HOY G;  3H3V C;  3C2P A;  4B3R L;  3T16 A;  3VYR A;  1NAP A;  4N9T A;  4JBW A;  4L8J A;  1IBL L;  2B2T A;  2OT2 A;  4HJ5 A;  1CTM A;  4DR2 L;  1EEI D;  3I7F A;  3FP9 A;  2KOL A;  3ZJY C;  1CI3 M;  1DZ1 A;  3I90 A;  5FO7 B;  4R9W A;  1MHW C;  5J22 A;  1VF5 C;  1UEA B;  5LMU Q;  1CA5 A;  5K36 H;  1VQG A;  2AQ3 B;  4FDB A;  1GUW A;  1IZ6 A;  2NVY H;  4H13 C;  4CHT B;  4JI4 Q;  5KYL A;  3I8Z A;  1C7Y A;  2DUD A;  2HQL A;  3HFZ B;  2DJG C;  4GNX A;  1K83 H;  1VQB A;  2Q8R E;  2RKS A;  1J6Q A;  3S2D B;  2WKC A;  3A5U A;  1N32 L;  1AZQ A;  4GZY C;  1YNJ C;  3J7A V;  4XT1 B;  2Q8T A;  2QKI C;  1A0I A;  1STE A;  4X3S A;  4LFB L;  3Q22 A;  2MJ8 A;  1GD7 A;  4K14 A;  3QOL A;  1BF4 A;  2JA7 B;  2OF1 A;  3FKI B;  2F4I A;  3KF8 B;  4RHR A;  2IL8 A;  1V1P A;  1SNO A;  5CGK A;  2VQE Q;  5FK9 C;  1CQV A;  2FHT A;  4MNO A;  4GKJ Q;  2I5H A;  1S4Z A;  4L5T A;  4XTC S;  1PH9 A;  1VQN A;  4A3D G;  3A55 A;  4IUT A;  3OMG A;  1EWI A;  2PW5 A;  1S5B D;  1BQQ T;  2PCF B;  5FKA C;  4A3L H;  1EY5 A;  1N9W A;  4JVZ A;  1AE2 A;  1PXU A;  1G6Z A;  4DN4 M;  3K80 C;  2JEB I;  2UUC L;  3ULP A;  2O5I C;  3NEM A;  1LTB D;  4MHE A;  3Q24 A;  4KY5 A;  4UP9 A;  4FF4 A;  4XT3 B;  4F8M A;  3M3Y B;  2PQE A;  1Y8N B;  4IJH A;  3QR8 A;  1R9T H;  1PTO F;  4JI5 L;  4WFN 3;  2K50 A;  1DCZ A;  1BBX C;  1KAA A;  4BBS G;  1Y8O B;  3GTL B;  1TII D;  1ZYR D;  5C4Z A;  4X3U A;  1WYD A;  2OCE A;  3ITP A;  1TU2 B;  1O7L A;  4K6D A;  3E0J A;  3E9I A;  1JWS D;  4DV0 Q;  1XMO L;  2M2L A;  1A15 A;  3TZU A;  3TEH B;  3D4D A;  3AFP A;  2R92 H;  2E75 C;  2H4O A;  3UDF A;  4POF A;  3RZD B;  5M3F G;  2K01 A;  1H95 A;  5D65 A;  2RDH A;  1LO5 D;  4GN5 A;  4RGM A;  2M00 A;  2JK8 A;  4IUQ A;  4JI0 L;  5BN3 A;  2AQ1 B;  1IL2 A;  4LFC Q;  1M90 C;  3G4S A;  1SMY C;  3PMF A;  1CZG A;  1I94 L;  4JYA L;  2NVX B;  2AWN A;  4LW1 A;  2F3I A;  4GOP C;  4WJW A;  4UPA A;  1JJ2 A;  4JI0 Q;  2NTT A;  2F0D A;  2A74 C;  2JE6 I;  2KHS A;  4K2K A;  3KJO A;  3S17 B;  4L5S A;  3EQL C;  2RSO A;  1XNR L;  1R9T B;  1A2T A;  5FLX L;  2B29 A;  2WV6 D;  4DNI A;  1S72 A;  1TY2 A;  3KK7 A;  1WOC A;  4IJL A;  2VXW A;  1RHP A;  1LT6 D;  4X65 Q;  2UUA L;  2MP1 A;  2X69 A;  2GVB A;  4JCV E;  1HA5 A;  5CR3 A;  1H9K A;  5C4X B;  4JI2 Q;  4JI6 Q;  2YTY A;  2D0O A;  4LF4 L;  4HIO A;  1EWC A;  3S24 A;  5EBD A;  3OYY A;  1HHV A;  4LF6 L;  5I2X A;  4L6T B;  4HSV A;  5EKL A;  2TSS A;  4NW2 A;  1H9S A;  5C0X J;  1WJJ A;  1JJG A;  4A3K G;  2B63 B;  3HOV B;  3HOW B;  1NMG A;  5I9O A;  1PV4 A;  1MIU A;  1V9P A;  5I9P A;  5KIX A;  4C3H H;  2QA4 A;  1AFP A;  1F9S A;  1VQM A;  3CCM A;  1EY9 A;  5G3L F;  1NR4 A;  5C4X G;  2R93 H;  2HIX A;  3Q6S A;  4DA2 A;  3URY A;  4APV A;  4HSP A;  3ULJ A;  5CMD A;  1OXS C;  4LF6 Q;  4RGN A;  2K5Q A;  4FVM A;  2IWH A;  4KY6 A;  3VYT A;  4JC0 A;  2Z9H A;  3K7U C;  2PW7 A;  4BBR H;  2JP1 A;  2A5H A;  5FLM G;  4LF7 L;  1M1K C;  4YWM A;  4ME3 A;  5E7N A;  4K5W A;  4KHZ A;  3C1F A;  2M9V A;  1KAB A;  4C2M H;  1CHP D;  1HFN A;  2BE5 C;  4KD4 A;  3HOU G;  2QEJ C;  3SXH A;  4DR1 L;  4YIJ A;  2E74 C;  4YCW A;  4JI7 L;  4K0K Q;  3OWE B;  2EYO A;  1HR0 L;  3RN2 A;  3KDF A;  1J9O A;  2E2I B;  2UU9 Q;  1U5K A;  1S40 A;  1NUC A;  4Q0F A;  3CD6 A;  2IW3 A;  2VQE L;  4A3G G;  5LMN Q;  3GTM H;  2A69 C;  4IFD J;  1TWF B;  3A5Z B;  1OXT A;  2IT1 A;  3ICE A;  3ERS X;  3PF5 A;  1EY6 A;  3KF6 B;  2VS1 A;  1PVO A;  4A3B B;  1Q86 C;  2IPK D;  1K3R A;  2A1A A;  2WAC A;  1AZP A;  5GAG C;  3GTP B;  3PO2 B;  3FMC A;  1HZC A;  2GA4 B;  1YNN D;  1DOK A;  4ZKC B;  4DV4 Q;  3NHH A;  4OEL B;  4HMJ A;  5FO9 B;  2Q2I A;  3ND9 A;  1PFS A;  2B2U A;  3U4Z A;  2AHO B;  3NTH A;  1ROD A;  1JCK B;  1Q3L A;  3J81 E;  3L7Z C;  1QG7 A;  2FXQ A;  1PFB A;  3A7L A;  2CKZ B;  3FPP A;  3U58 A;  3DWP A;  4M1U B;  1MD2 D;  5GQO A;  1BCP B;  4A3I B;  1Z9F A;  4DXG A;  5LMN L;  5D3D A;  2B2V A;  3STB C;  2E76 C;  2V4D A;  3NTK A;  3M4O B;  2NTS A;  2XRS D;  3H0G H;  1OXU A;  3TP7 A;  4KTA A;  1VS0 A;  3J7A F;  3P75 A;  2RCF A;  1BR9 A;  3JAM c;  3K8A A;  1I4G A;  4A75 A;  4DV7 L;  2BH2 A;  4OL7 A;  2RDG A;  3HOZ H;  1NMF A;  3J81 L;  2E5L L;  4KV6 A;  4JBJ A;  4CDE C;  5EJW A;  5IYD G;  1CQF A;  1L0W A;  2B2Y C;  4IN3 A;  3UI2 A;  2NZH A;  1KRT A;  4LF4 Q;  2JJQ A;  1B3Q A;  1STA A;  2LXK A;  1BXT A;  2ZXR A;  1I50 H;  1JE5 A;  3I4M G;  3S1R B;  2DY7 A;  2D9U A;  3L0O A;  2A6E C;  4LUO A;  3DXJ C;  2Q2U A;  2G5D A;  4A3I H;  4ILW A;  1F9P A;  4JI4 L;  3T56 B;  1KIX A;  1SFO H;  3S16 B;  1L1O A;  2CW0 C;  1XNR Q;  2AWO A;  4XXE A;  1ASY A;  4MIU A;  3VR6 A;  2JA6 B;  1VQA A;  2UXC L;  2A19 A;  1JB3 A;  5FOB B;  4CKC A;  3MAQ A;  2Z6K C;  2NVT H;  2MO1 A;  4DV3 Q;  1MGS A;  2AUK A;  1LUZ A;  1QZH A;  1KLG D;  4A3F G;  5CV8 A;  1STG A;  2KHJ A;  3NQT A;  1TR5 A;  2N3S A;  1IYJ B;  2K33 A;  4DV3 L;  1QCB D;  2I07 B;  1F2Z A;  1SYC A;  4DV2 L;  4A3M G;  1C8C A;  5EAY A;  5FLX c;  2NVY B;  3MXP A;  1HZ9 A;  1T9H A;  2EY6 A;  2DNC A;  1PRT F;  3CCL A;  3I4M B;  3GTM B;  3OTO L;  3TBI B;  3QB3 A;  1I4Q A;  2F0G A;  2Z8L A;  1BNZ A;  1G29 1;  5EKI A;  1PTO C;  4A4I A;  1XTC D;  4CJ0 B;  2RHS B;  2ZXP A;  5LHY 1;  4P75 A;  3F2C A;  1JWU D;  1SBB B;  5M5X H;  4A3J B;  3J7A 5;  1LTR D;  2JA7 H;  1ILQ A;  3V2T A;  3CCJ A;  3S14 B;  2K14 A;  1JJC B;  2ZJR A;  1Y69 U;  2L1B A;  2O4X A;  1HNW L;  4IZ8 A;  4IUR A;  4MZ9 A;  1I94 Q;  4QF4 A;  1TS5 A;  1X65 A;  2E2D C;  4EQP A;  3G6J B;  4F87 A;  5GRO A;  5IGG A;  4KHV A;  1L0X B;  1PHJ A;  1Q81 C;  1IBK L;  4DV5 Q;  1KD1 C;  1EOT A;  1E0B A;  1GJX A;  4ZK9 B;  2EYH A;  4K8I A;  1LLR D;  4HAE A;  4A93 B;  1KAW A;  3BYY B;  4TSS A;  2O2L D;  4BY7 H;  1CKO A;  2K4K A;  3SDZ A;  3UE1 A;  5BN5 A;  5E4X A;  1U4P A;  1N32 Q;  4ZQ3 A;  5I2Y A;  4NP5 A;  5BR8 Q;  3S1M B;  3K0X A;  3U9O A;  1SNM A;  2K75 A;  3H09 A;  1CM9 A;  1N36 L;  3OTO Q;  4KHP Q;  3I3C A;  3CU7 A;  5IT9 E;  3ONA B;  4ULL A;  1B2T A;  2B2W A;  4X62 L;  4AYB B;  2SOB A;  2JEA I;  4ID6 A;  3KF6 A;  4IPC A;  3TP8 A;  3JAM L;  1QVG A;  5IIF A;  1WD0 A;  2A6H C;  2IX1 A;  1SMY D;  4IUV A;  3VR2 A;  1TWA B;  4FXG C;  4PZ8 A;  3WOE A;  4DR3 L;  1XNQ L;  1I6H B;  4LUZ A;  4UP7 A;  4JYA Q;  1IYU A;  1EQT A;  3VA7 A;  1HNW Q;  1J8I A;  2HHH L;  3TP5 A;  2RQX A;  2VY3 A;  3NXW A;  3OW7 A;  5M5Y H;  4KK7 A;  4KN7 C;  1ET6 A;  2Z1C A;  1X6O A;  4A3G B;  4BBS H;  2K05 A;  1II3 A;  2SEB D;  1C48 A;  1RL2 A;  1Y8P B;  2C35 B;  4DR4 L;  2EY5 A;  2F0W A;  3GTO H;  3FVQ A;  1FR3 A;  4CDF C;  2E2I H;  1K0S A;  2AUJ D;  4PMC A;  4V0B A;  1QUQ A;  1PH6 A;  2B39 A;  1NJI C;  3OW2 A;  4JI5 Q;  2PMZ B;  2RCN A;  1FVI A;  2G9H D;  4P72 A;  1NY4 A;  2AQ2 B;  4LF5 L;  2LKV A;  4NDX A;  1D5X C;  1FJG Q;  1A62 A;  3DUZ A;  3G48 A;  2OEO A;  2VB3 X;  2PNR C;  4G7O C;  4JK1 C;  2UUC Q;  3W2D A;  5LL6 X;  3D8G A;  4IFD G;  4MTK A;  1EIF A;  4IPG A;  3HKZ E;  3MFY A;  4RG1 A;  4DV5 L;  3HP3 A;  1STN A;  4N9P A;  2F0M A;  2MFI A;  4NXM Q;  2DGY A;  4MTN A;  5JAV A;  4X3T A;  1FGU A;  1N33 Q;  2K28 A;  4C56 C;  1MI2 A;  2VW9 A;  2R7D A;  1VQF A;  4X66 Q;  4HCS A;  2VUM G;  1LTG D;  3NE5 B;  1YNN C;  1XPU A;  1XPO A;  3G7L A;  2JA5 B;  2H5X A;  4OWT B;  1I4X A;  1H9J A;  1JOR A;  4GLX A;  1UNS A;  1SE2 A;  3CRK C;  2PZT A;  1TXY A;  2NB0 A;  5I6Y A;  3F2U A;  1VQP A;  1WTO A;  2JYO A;  2PNH A;  2EYP A;  1JOO A;  2E2J B;  4A3K B;  1F77 A;  2VL6 A;  1G6P A;  2Q2T A;  5JJI A;  2ZTE A;  1YHQ A;  5CV7 A;  3STB D;  2R93 G;  2KA7 A;  2OQK A;  1RD9 D;  3MXU A;  4C3H G;  4E6I A;  5M3M B;  4PQX A;  4R8I A;  3D6C A;  5IGE A;  3C1E A;  5JJZ A;  5M3F H;  1D1I A;  2WAQ E;  3EN2 A;  3PV0 A;  2A69 D;  1K0R A;  3F2B A;  1HR0 Q;  5IY0 A;  3E9H A;  4JI1 Q;  4HJA A;  1GHJ A;  2VQF L;  2ICE C;  2F52 A;  3NEN A;  4KKT A;  4A3M H;  4EQO A;  4I65 A;  2F3W A;  3HRZ C;  4A3B H;  3GTK H;  3M7N A;  4HN7 A;  1EQV A;  1A63 A;  4YY3 Q;  1Y1V G;  3FPU B;  1SN8 A;  5JVG 3;  1V1O A;  5CV6 A;  4Y7N H;  1SRU A;  1WTQ A;  3T1Y Q;  2EXD A;  3ZYY X;  4A3C G;  4DKA C;  1VQH A;  4OX9 L;  1NE3 A;  1S5E D;  2FIN B;  1BBU A;  1E2W A;  3UDX A;  4A3G H;  3I70 A;  3IRB A;  1Q12 A;  3JAM E;  1E2V A;  1XTD A;  2KEE A;  2EJF C;  1S5F D;  5EPJ A;  3KF8 A;  5M3F B;  1EQR A;  1HQR D;  2KCC A;  4A76 A;  1WFQ A;  1EIY B;  3CCQ A;  3W5O A;  3I4M H;  3I4O A;  3AEV A;  2K5N A;  2C5C A;  4YHH Q;  1IYV A;  1W2B A;  1ENF A;  4OO1 I;  2ZTD A;  4NXM L;  4LFC L;  4K6L A;  3FRP B;  3VYS A;  4TVA B;  4FXD A;  1KDB A;  3CXC A;  5IYD H;  2R92 G;  4R4C A;  1ILP A;  1RTN A;  3HKS A;  5KNB A;  4DUZ Q;  1DOL A;  4UAI A;  4CGY B;  4ZUJ A;  4DV6 Q;  3TRE A;  2RF4 A;  3DM3 A;  2BCO A;  3MEF A;  1E24 A;  4RGO S;  4DK3 C;  2JN4 A;  3PUW A;  1SJE D;  4OEM B;  1NSN S;  4LFB Q;  4KI0 A;  3TDQ A;  3NK9 A;  1VQK A;  1TY0 A;  1VCI A;  3J81 c;  4DR6 L;  3BG3 A;  5DAU A;  1MJE A;  1X9N A;  2B2Y A;  4IPH A;  4RAU C;  4AYB E;  1EFI D;  3UDI A;  2EDG A;  4CDD C;  5IOC A;  1SRO A;  5EPK A;  1G2S A;  4IO9 A;  3HOX B;  4RA8 A;  4J6H A;  3K58 A;  1HXY D;  2JA6 H;  4IFD I;  1XJV A;  4J8Q A;  1PH7 A;  4BXX H;  2N49 A;  2L4N A;  3KBX A;  4I7Z C;  4EGV A;  3RLN A;  2KJX A;  2F03 A;  2EVB A;  1W6K A;  3A74 A;  3DM1 A;  5G3L D;  1D8L A;  4GLV B;  4DAP A;  3SGI A;  2FMC A;  2WFW A;  5DEH A;  1MBY A;  3I4L A;  2Z4H A;  1EEF D;  5IYB G;  2D62 A;  4C1N I;  4FNF A;  1VQE A;  5IP9 G;  4XQJ A;  3JAM i;  2CCZ A;  1VQC A;  3OHX C;  1VQ5 A;  4B3T L;  4YWL A;  4BY7 G;  2PZW A;  5JPN C;  1PRT B;  3VR5 A;  2QGQ A;  4A3B G;  1NCV A;  4JV5 Q;  1I6H H;  5C4J H;  2EYF A;  2KEN A;  4BXX G;  3HOY B;  1HZA A;  4L5R C;  4C3I H;  3QO2 A;  1LM0 A;  3J80 c;  3V05 A;  1LTA D;  2Y0S G;  1BBW A;  2F0L A;  3MXG A;  1FGB D;  5BN4 A;  4QQB X;  5L37 A;  3I4N B;  1P16 A;  4DV7 Q;  3MEH A;  4BA2 I;  5C5L A;  1F2M A;  5JJL A;  2CWA A;  3K5L A;  1MJC A;  2XWJ B;  3T53 B;  1BOS A;  1KLU D;  2SNS A;  5CYU A;  3EIV A;  3PCO B;  3SK5 A;  3K5N A;  1LTT D;  1S3O A;  1XMQ Q;  3TRZ A;  1W6J A;  1A8V A;  4DV0 L;  4RH6 A;  2EPB A;  4CBV A;  3PIO 3;  1L2F A;  2F0Q A;  2UXD Q;  1WCM B;  1KC8 C;  1EY0 A;  4EX5 A;  2XNA C;  4OWX B;  3S1N H;  2B3G A;  3DMU A;  4O1N A;  1I4P A;  4C2M B;  2I5L X;  1XXG A;  3R93 A;  2HIV A;  5GAE C;  1XPR A;  3CRL C;  2PI2 A;  2K5H A;  4QUF A;  1PZK D;  5FJ8 H;  5J39 A;  2J4X A;  4RKB A;  2L55 A;  4A3D B;  1PH4 A;  1MKH A;  1CFM A;  1R4Q B;  2UUB Q;  2VQF Q;  3HG9 A;  4U68 A;  3QOJ A;  2UU9 L;  2CW0 D;  3BVM A;  4GNX C;  1BCP C;  3DEO A;  3DWA A;  1TWG H;  3R2T A;  3GO5 A;  2N55 A;  2Z6K A;  4V19 0;  3J80 i;  1TS4 A;  3RD4 A;  2B2T C;  5TSS A;  3OWF A;  2CFM A;  1HRJ A;  4CJ2 C;  3PO2 H;  2A6H D;  1UUP A;  3WOF A;  1GUN A;  1NBW A;  3S9W A;  1TQO A;  1SE3 A;  3GTQ B;  3ULL A;  3IAY A;  4ZLT F;  4IPD A;  2RSN A;  3S1Q H;  4DUY L;  4C1N K;  4OXP A;  1JT8 A;  3TS2 A;  1GO3 E;  2PYK A;  1SNC A;  1VQI A;  2Z4I A;  4XIG S;  5KEE A;  4B3S L;  2G9D A;  4KJO A;  1EYD A;  1Z47 A;  2F0J A;  1EU4 A;  1CKN A;  1B53 A;  2CH4 A;  5A2Q L;  5IWA L;  1L1O C;  4IAL A;  2VUM B;  1E2Z A;  4NXN Q;  2QCP X;  3PQI A;  3OSO A;  3HZX A;  2ASB A;  2KHI A;  4DAY A; 
#chains in the Genus database with same CATH homology
 2D0P A;  1FL0 A;  4R4O A;  2UXC Q;  4X6A H;  1PHJ A;  4GKJ L;  1Q81 C;  1IBK L;  4DV5 Q;  1KD1 C;  3AFQ A;  5IE8 A;  5IYB H;  3CPW A;  4HIK A;  3HKZ G;  3UDG A;  1KAW A;  1XMO Q;  3I4N H;  4JG2 A;  5FJ8 G;  1VQD A;  5IP7 G;  4BY7 H;  2IY5 B;  1CKO A;  1X3F A;  4JBK A;  1K73 C;  3RLF A;  3I4N G;  2K4K A;  3BZK A;  3UE1 A;  1HJP A;  3TS0 A;  3K7A H;  4LF5 Q;  4OON A;  4OWW B;  4DR7 Q;  1HNZ Q;  1DGS A;  2XTI A;  1N32 Q;  5M3M G;  2E2J H;  1E1O A;  3J81 i;  4OX9 Q;  4DR6 Q;  1AH9 A;  1Q8K A;  5BR8 Q;  4DR5 Q;  3U50 C;  3K0X A;  4DV4 L;  1OXX K;  2K75 A;  3HOU H;  1N36 L;  4KHP Q;  2YYZ A;  4PZ6 A;  3OTO Q;  1EYG A;  4LF9 L;  1TWF H;  1Q46 A;  3RNU A;  2NN6 I;  1PH5 A;  3PF4 A;  1YNX A;  1YHB A;  3KFU A;  4A3C H;  1N34 L;  4X62 L;  1YJ9 A;  4R4I A;  4HJ8 A;  1PH2 A;  1VQL A;  1QVF A;  1OXV A;  3S16 H;  2I5M X;  1Y1V H;  5LMN W;  2CWP A;  1W3S A;  1J5E L;  2JEA I;  1PYS B;  3KF6 A;  4IPC A;  1QVG A;  5HGQ A;  3FKI G;  3HOY G;  4GNX B;  2IX1 A;  1JMC A;  1VQO A;  4B3R L;  1JB7 A;  1C0A A;  4PZ8 A;  4P73 A;  4JBW A;  4BY1 H;  4DR3 L;  1XNQ L;  5DLQ E;  2R7Z G;  4LUZ A;  4UP7 A;  5IYC H;  1IBL L;  4JYA Q;  4HJ5 A;  4R1J A;  1HNW Q;  4DR2 L;  5K36 G;  3I7F A;  1YIJ A;  1C9O A;  3FP9 A;  3ZJY C;  3H15 A;  2HHH L;  2I0Q A;  2VY3 A;  4B3R Q;  2UXB Q;  1NTG A;  5M5Y H;  5H1S E;  5C4X H;  3CMA A;  2ES2 A;  5LMU Q;  3H0G G;  2MO0 A;  1X6O A;  3KDF B;  4BBS H;  1VQG A;  3RR5 A;  4FDB A;  4HIM A;  1IZ6 A;  2NVY H;  3KYH C;  3PGZ A;  4UP8 A;  1Y1W G;  1RL2 A;  2C35 B;  2IHE A;  4JI4 Q;  3S1M H;  4DR4 L;  3F2D A;  2GVA A;  3GTO H;  3BU2 A;  2Z0S A;  2E2I H;  4H02 A;  1C7Y A;  2DUD A;  2HQL A;  3HFZ B;  1PH6 A;  1QUQ A;  3M4O H;  1IXR A;  4GNX A;  1Q82 C;  1NJI C;  1K83 H;  1VQB A;  1YZ6 A;  3OW2 A;  2WP8 J;  3GTQ H;  1J6Q A;  4JI5 Q;  1N32 L;  3A5U A;  2PQA A;  3CCU A;  2RCN A;  3M3Y H;  2OTJ A;  1FVI A;  4DR7 L;  4P72 A;  4IOC A;  1NY4 A;  2N8N A;  2Q2H A;  3HOX G;  4LF5 L;  1FJG Q;  2VNU D;  3CC2 A;  1A62 A;  4JOI C;  4YWK A;  5C3E G;  2BA0 A;  3G48 A;  1A0I A;  4LFB L;  4A3K H;  3WWV A;  1SLJ A;  2A8V A;  3GTG H;  3RZO H;  1GD7 A;  2UUC Q;  4AQY L;  1RIP A;  4IFD G;  1LTL A;  3S14 H;  1EIF A;  3KF8 B;  4IPG A;  3HKZ E;  4X66 L;  2VQE Q;  2B63 H;  3CCE A;  1HNX L;  4RG1 A;  1IBL Q;  4DV5 L;  4MNO A;  3H3V H;  3A0J A;  2I5H A;  4L5T A;  4XTC S;  1PH9 A;  2VUM H;  1VQN A;  4GKJ Q;  4A3D G;  4JI8 Q;  1EWI A;  2MFI A;  1GKH A;  3F8T A;  1VQ6 A;  4JI3 Q;  4NXM Q;  5JEA J;  2VZA A;  2DGY A;  4MTN A;  2WB1 E;  4A3L H;  1CSQ A;  3PIP A;  1FGU A;  1N33 Q;  4LNQ A;  1KRS A;  1N9W A;  2PMZ E;  2R7D A;  2VW9 A;  1VQF A;  4X66 Q;  5IWA Q;  4DR1 Q;  1AE2 A;  2VUM G;  1KHI A;  3K80 C;  2IX0 A;  2JEB I;  1XPU A;  1E22 A;  2UUC L;  1XPO A;  3ULP A;  4Y52 H;  1BKB A;  2H5X A;  4NB3 A;  3NEM A;  1K8G A;  1E3P A;  3PO3 H;  4UP9 A;  3KJP A;  4OWT B;  5BR8 L;  1FJG L;  3S2D H;  4GLX A;  4QGU A;  2ATW A;  3KLW A;  4IJH A;  4YCV A;  1TXY A;  4A93 G;  3I2Z A;  4RMF A;  1Y1W H;  1R9T H;  1VQ4 A;  4LF7 Q;  4JI5 L;  1VQP A;  4JI2 L;  1HNZ L;  2K50 A;  2PNH A;  2ZTC A;  3CAM A;  1HR0 W;  2EIF A;  4BBS G;  1TWH H;  3AYH B;  2VL6 A;  1G6P A;  2L15 A;  2Q2T A;  5JJI A;  2ZTE A;  1WYD A;  5J3B A;  2OCE A;  1YHQ A;  1HH2 P;  3GD7 A;  2YTV A;  3E9I A;  3STB D;  5FLM H;  1GVP A;  2OQK A;  4DV0 Q;  1QUQ B;  1X54 A;  4ALP A;  1XMO L;  2R93 G;  3TEH B;  3AFP A;  2R92 H;  4POF A;  3D31 A;  3UDF A;  4IOA A;  5M3F G;  1H95 A;  5GAD C;  4GN5 A;  4NPS A;  1N33 L;  1YI2 A;  4LF8 L;  5M3F H;  2JK8 A;  2WAQ E;  2KCM A;  3EN2 A;  3PV0 A;  4LUV A;  4JI0 L;  1IL2 A;  2UUB L;  4GKK L;  2UXB L;  4LFC Q;  1M90 C;  1EOV A;  1X55 A;  3G4S A;  1K0R A;  3F2B A;  1HR0 Q;  4JYA L;  1I94 L;  5IY0 A;  2K5V A;  2AWN A;  3E9H A;  4LW1 A;  4JI1 Q;  1XNQ Q;  4HJA A;  1L1O B;  1WCM G;  2F3I A;  2VQF L;  4DPG A;  1V43 A;  2F52 A;  3NEN A;  4UPA A;  4HJ9 A;  4GOP C;  1YIT A;  4A3M H;  1JJ2 A;  4JI0 Q;  1YBY A;  4BY1 G;  2R7Z H;  3CF5 A;  2IHF A;  4AQY Q;  1PH8 A;  2JE6 I;  4K0K L;  4DK6 C;  4LFA L;  4B3S Q;  4A3B H;  1PYB A;  1UE1 A;  4R4T A;  3KJO A;  3GTK H;  3M7N A;  4L5S A;  4KLK A;  1XNR L;  3PO3 G;  1A63 A;  1TWA H;  4UY8 C;  2B29 A;  1E7Z A;  4YY3 Q;  1Y1V G;  4DNI A;  1S72 A;  1WI5 A;  1SN8 A;  1WOC A;  4IJL A;  4O2D A;  4HID A;  4Y7N H;  2R7F A;  2V1C C;  1SRU A;  1UE6 A;  1KQS A;  1TWC H;  1B7Y B;  4GS3 A;  4X65 Q;  3PUV A;  2EXD A;  3T1Y Q;  2UUA L;  2GVB A;  4JCV E;  4PMW A;  4DKA C;  4A3C G;  1VQH A;  4OX9 L;  1NE3 A;  4JI2 Q;  5C0X G;  1BBU A;  4A3L G;  2HT1 A;  3UDX A;  4A3G H;  4JI6 Q;  3IRB A;  1Q12 A;  2JQO A;  4YY3 L;  1XTD A;  2YTY A;  4B3T Q;  2D0O A;  3B6Y A;  4LF4 L;  4HIO A;  4A3I G;  2WB1 G;  3S24 A;  3OYY A;  2OWO A;  1EQR A;  1YJN A;  4LF6 L;  4A76 A;  2B63 G;  1AE3 A;  1WFQ A;  1EIY B;  1U0L A;  4P74 A;  1X3G A;  3CCQ A;  3I55 A;  3W5O A;  5C0X J;  5GAH C;  3I4M H;  3I4O A;  3AEV A;  1WJJ A;  3K81 C;  3F1Z A;  4DV6 L;  2JA6 G;  1JJG A;  2K5N A;  4YHH Q;  5JEA G;  4A3K G;  1W2B A;  3PUY A;  4OO1 I;  2R6G A;  2ZJQ A;  2ZTD A;  3T1H Q;  1NMG A;  2NZO A;  1PV4 A;  2K52 A;  1MIU A;  1V9P A;  4LFC L;  4JI3 L;  4AIM A;  4NXM L;  1I3Q H;  4TVA B;  4JI8 L;  3PUZ A;  4C3H H;  2QA4 A;  4LF8 Q;  1EFW A;  1WCM H;  3CXC A;  3CCM A;  1VQM A;  2R92 G;  5IYD H;  4NXN L;  4R4C A;  1CKN B;  3HKS A;  4DUZ Q;  5C4X G;  2R93 H;  2HIX A;  4DV6 Q;  3TRE A;  2RF4 A;  3DM3 A;  3S1R H;  4BBR G;  4X64 Q;  2PI2 E;  2NVQ H;  3MEF A;  1E24 A;  1N34 Q;  2ID0 A;  1YJW A;  4DK3 C;  4APV A;  3BZC A;  1CUK A;  1X3E A;  3ULJ A;  3PUW A;  3I56 A;  4LFB Q;  4WJ4 A;  4KI0 A;  1OXS C;  4LF6 Q;  1VQK A;  3J81 j;  1VCI A;  4PZ7 A;  3M9B A;  3J81 c;  4DR6 L;  4J15 A;  1Q1B A;  4JC0 A;  1K9M C;  1QVC A;  2ZM6 Q;  3K7U C;  1MJE A;  1UWV A;  4BBR H;  4LF7 L;  5FLM G;  1X9N A;  4POG A;  1M1K C;  4IPH A;  4AYB E;  4YWM A;  3Q8D A;  4ME3 A;  1I5F A;  4GN4 B;  3CW2 C;  5E7N A;  4KHZ A;  2YTX A;  3UDI A;  3RN5 A;  1D7Q A;  4GN3 B;  4LWC A;  1PH1 A;  1O7I A;  4C3J H;  2GN5 A;  1G51 A;  4C2M H;  2JA5 H;  1SRO A;  2N78 A;  4AH6 A;  3M4P A;  4JOI A;  4IO9 A;  4A3E G;  4A93 H;  1XMQ L;  2RHQ B;  1SR3 A;  3HOY H;  3HOU G;  3PO2 G;  4X64 L;  4DR1 L;  5HY6 A;  2JA6 H;  4IFD I;  1XJV A;  1PH7 A;  1OTC A;  4YCW A;  2N49 A;  4DV2 Q;  4BXX H;  1IBK Q;  3CP0 A;  5LMU L;  4JI7 L;  4L5Q A;  3RLN A;  4K0K Q;  1IBM Q;  4A3D H;  3A74 A;  3RN2 A;  1HR0 L;  4WJ3 M;  3KDF A;  1ASZ A;  1D8L A;  4GLV B;  4DR2 Q;  2UU9 Q;  3EBE A;  4JI1 L;  1U5K A;  1S40 A;  3SGI A;  2WFW A;  3CD6 A;  3TQY A;  2VQE L;  3KOJ A;  4A3G G;  3RZD H;  5LMN Q;  3GTM H;  4IFD J;  3A5Z B;  5IYB G;  1OXT A;  2IT1 A;  3ICE A;  3ERS X;  2D62 A;  3PF5 A;  1Q1E A;  3KF6 B;  1J5E Q;  2VS1 A;  3PUX A;  4PG3 A;  1UE7 A;  1PVO A;  4QY7 A;  1VQE A;  5IP9 G;  2PQA B;  3JAM i;  2CCZ A;  1VQC A;  1Q86 C;  5C0X I;  3M85 A;  2WAQ G;  2Y0S E;  4X62 Q;  1VQ5 A;  4YWL A;  2QEX A;  4B3T L;  1K3R A;  2A1A A;  1EQQ A;  3M4Q A;  5GAG C;  1YHA A;  4BY7 G;  4DV1 Q;  2F4V L;  1HZC A;  2QGQ A;  4A3B G;  4DV4 Q;  1Y14 B;  3S2H H;  5C3E H;  4JV5 Q;  2KBN A;  1I6H H;  5C4J H;  1UEB A;  2KEN A;  3T1Y L;  3HOX H;  2Q2I A;  3U4Z A;  1PFS A;  3G71 A;  4BXX G;  2AHO B;  1HZA A;  4DV1 L;  2F4V Q;  1Q7Y C;  4DR4 Q;  4L5R C;  4A3J H;  4C3I H;  1LM0 A;  3L7Z C;  4TQU S;  3J80 c;  3CCR A;  4A3E H;  2NN6 G;  3FHW A;  2FXQ A;  2Y0S G;  3GTJ H;  2LXJ A;  3CQZ H;  1KL9 A;  4B3M L;  1BBW A;  2CKZ B;  4GLA C;  3U58 A;  3CCS A;  5GQO A;  2YV5 A;  1Z9F A;  4QQB X;  5LMN L;  3CPF A;  2E5L Q;  3STB C;  4YCU A;  2JA7 G;  1LYL A;  3H0G H;  5JJK A;  1OXU A;  1P16 A;  2EQS A;  4DV7 Q;  1VS0 A;  4BA2 I;  4QL5 A;  3HOV H;  5JJL A;  1P8L A;  2CWA A;  3UE0 A;  2CQO A;  3JAM c;  1MJC A;  3K8A A;  2JA9 A;  4A75 A;  3T1H L;  4DV7 L;  1SMX A;  4JI7 Q;  2BH2 A;  3J7Z C;  1HNX Q;  3HOZ H;  3HOV G;  1NMF A;  3GTP H;  4BA1 I;  2E5L L;  5ELO A;  3NBH B;  3EIV A;  3LGJ A;  3PCO B;  4P71 A;  2JA8 G;  4JBJ A;  1S3O A;  5IT9 c;  1XMQ Q;  5IYD G;  3D0F A;  1A8V A;  2AMC B;  3FKI H;  4A3J G;  3TRZ A;  3PSI A;  4DV0 L;  1L0W A;  4QIW E;  2AKW B;  4LF9 Q;  1L2F A;  4B3M Q;  5AJ3 L;  5M3M H;  4A3F H;  2NZH A;  2UXD Q;  5C44 G;  1KRT A;  1EUJ A;  4LF4 Q;  1KC8 C;  2JJQ A;  2OTL A;  2LXK A;  1GM5 A;  4JI6 L;  1I50 H;  4EX5 A;  1JE5 A;  2XGT A;  3I4M G;  1SE8 A;  3NEL A;  2ZM6 L;  3U4V A;  1B8A A;  3L0O A;  4OWX B;  3S1N H;  2B3G A;  1E1T A;  3AQQ A;  5IP9 H;  5M5W H;  2KCT A;  3CME A;  1K8A C;  3S15 H;  4LUO A;  4HJ7 A;  3BJU A;  4A3I H;  2Q2U A;  4JI4 L;  1B70 B;  1KIX A;  2E2H H;  2I5L X;  1KXL A;  1SFO H;  1L1O A;  1YEZ A;  1XNR Q;  1N8R C;  2AWO A;  2HIV A;  3S17 H;  5GAE C;  1ASY A;  1XPR A;  5IP7 H;  2PI2 A;  1VQA A;  2ALY B;  2K5H A;  4LFA Q;  1VQ9 A;  2A19 A;  5FJ8 H;  2UXC L;  1CSP A;  1HZB A;  3W1G A;  4EQ5 A;  4AYB G;  2Z6K C;  2NVT H;  2MO1 A;  4DV3 Q;  1MKH A;  1QZH A;  1LUZ A;  1PH4 A;  3E0E A;  5C44 H;  4OO1 G;  2UUB Q;  2VQF Q;  4GOP B;  4A3F G;  2E8G A;  2KHJ A;  4DR3 Q;  3GTL H;  2N3S A;  3MXN B;  2UU9 L;  1IYJ B;  4YHH L;  3RLO A;  2MNA A;  4JBM A;  3GDE A;  2YU9 H;  4DV3 L;  4O0A A;  4GKK Q;  4GNX C;  2JA8 H;  1IBM L;  3HOZ G;  2JA5 G;  1TWG H;  4DV2 L;  4A3M G;  3H3V I;  3GO5 A;  5EAY A;  2Z6K A;  5ELN A;  5FLX c;  1HZ9 A;  1T9H A;  3J80 i;  1PA6 A;  1V1Q A;  3HOW G;  1UE5 A;  4DUY Q;  2CFM A;  3CCL A;  2LSS A;  3PO2 H;  3OTO L;  1N36 Q;  4KHP L;  1QZG A;  1NBW A;  2NVX H;  4DAM A;  4JV5 L;  4DAY B;  4DR5 L;  1VQ8 A;  1G29 1;  2BA1 A;  3CC7 A;  4X65 L;  4A4I A;  2UUA Q;  3HOW H;  3ULL A;  4GOP A;  2MQH A;  3G6E A;  2RHS B;  4IPD A;  4P75 A;  3L2P A;  3F2C A;  5IYC G;  3JC6 6;  2ZJP A;  4DUY L;  3CC4 A;  3S1Q H;  4OXP A;  5M5X H;  3J7A 5;  1PH3 A;  1JT8 A;  2UXD L;  1CKM A;  5AJ3 Q;  4QJF A;  1YVC A;  1GO3 E;  3TS2 A;  2JA7 H;  1VQI A;  4XIG S;  4B3S L;  1X56 A;  3CCJ A;  3W1B A;  1VQ7 A;  2K14 A;  1Z47 A;  1CKN A;  1JJC B;  2ZJR A;  2OQ0 A;  2HHH Q;  5IWA L;  1HNW L;  1L1O C;  4DUZ L;  3PIO A;  4MZ9 A;  4NXN Q;  1I94 Q;  4R4Q A;  1VQJ A;  1X65 A;  1BVS A;  2BH8 A;  3ER0 A;  2ASB A;  3CCV A;  3DLL A;  3VDY A;  2KHI A;  5GRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...