4JV5L

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
125
structure length
125
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jv5L00
3PO3H 2LXKA 5DLQE 2R7FA 1VQIA 2K4KA 1SRUA 2IX0A 3JAMi 2WB1E 4JI3Q 3M3YH 2Y0SG 1KRSA 3I4NH 4JI1Q 1X55A 4J15A 3I2ZA 4GOPB 1Y1WH 3HOZH 1Y1VH 4L5QA 4X66Q 2B29A 2R6GA 4JI3L 3L2PA 2N3SA 1V9PA 3SGIA 5IP9G 1EYGA 1AE3A 4GKKQ 4PZ7A 2MO0A 4JI1L 4GNXA 3M4QA 3IRBA 1QVGA 2VL6A 4P73A 3AQQA 3OTOQ 2JA7G 1SE8A 2LXJA 4GKKL 2K5NA 2BA1A 2MO1A 3HFZB 3PUVA 4HJAA 1B70B 2HHHQ 3A74A 2JA8G 4P72A 1J6QA 3STBD 4A3KH 2JEBI 2I5MX 1HR0W 4WJ3M 2Z6KC 1HR0Q 2UXBQ 1K9MC 1EQRA 2ZJQA 1IBKQ 4QL5A 1JE5A 1BVSA 3FP9A 4BBRH 1UE1A 4ALPA 1YHQA 3ERSX 2MQHA 4H02A 5ELNA 2ZM6Q 4JI8Q 1PHJA 1HR0L 3EN2A 1NMGA 1CUKA 1YZ6A 2K52A 2UXBL 2PQAB 4ME3A 5C3EG 2YYZA 3FKIG 3F2BA 1EQQA 1N34Q 1IBKL 2OTLA 1Q82C 4LFBQ 2CFMA 3PCOB 4YCUA 2OQ0A 4DV3L 1K0RA 1TWFH 3K0XA 4JI8L 4NB3A 5C4XH 2JA6H 4OWTB 5FLXc 1N34L 3K8AA 1YIJA 4LFBL 1CSQA 3CQZH 1TWAH 1WJJA 1VQPA 3I7FA 4IPDA 3S1RH 3CCJA 5IP7H 4GLAC 3D31A 3HKSA 1NJIC 2L15A 4IJHA 2AWOA 4A3CH 3G6EA 2JA5H 5IY0A 5GQOA 4X64Q 4C3JH 4A3EH 4JYAQ 3H15A 5IYBG 1VQ8A 1MIUA 1H95A 1OTCA 4B3MQ 1VQ6A 2HIXA 4DKAC 5M3MH 5IYCH 4X64L 1YITA 2E2JH 4LUZA 1Q46A 2JJQA 1N9WA 4DV0Q 5JJKA 3ULJA 4JYAL 3HKZE 3CMAA 4C2MH 3CW2C 5JJIA 5IE8A 4B3ML 2Z0SA 4B3SL 1OXTA 3G4SA 3I4NG 4DV0L 5EAYA 4JOIA 3ULPA 1Y1VG 4P74A 5C4JH 4NXMQ 3Q8DA 4R4CA 3RN5A 3PIPA 3S17H 2OTJA 1KRTA 4HJ7A 4YCVA 1AE2A 2JE6I 1VQHA 2VZAA 2VQFQ 1I50H 4BXXG 5IYDH 3PUZA 1NE3A 3KF8B 4KHZA 4NXML 3CD6A 3UE1A 2KBNA 4KI0A 1A62A 4APVA 4GNXB 1HNZQ 2R92H 2E2IH 2N49A 4GOPA 4A3DG 5JEAJ 4BY7H 2HQLA 1MJEA 4R4QA 1UE5A 4AYBG 4P71A 4A76A 1HNZL 1UEBA 4PZ8A 4DV5Q 1UE7A 3HOYH 2K5HA 3J80c 1T9HA 1PH5A 1QVCA 3I4MH 1EFWA 4BBRG 3CCUA 2OQKA 1VQ7A 3S1MH 3GTMH 3GTOH 4NXNL 2B63H 1G291 3TRZA 2NVYH 2IY5B 3CMEA 3RLOA 1QVFA 3H0GH 5C4XG 1NY4A 2B3GA 4UP9A 3K7UC 1VQ5A 4A4IA 4IJLA 1LTLA 3E0EA 4HIDA 4L5TA 2CKZB 1SMXA 4MTNA 1WI5A 3S24A 5E7NA 2Q2UA 1R9TH 3D0FA 4OWWB 2JK8A 3NENA 3GTQH 1PFSA 1C7YA 3S1QH 2R93H 4GLVB 2UUBQ 2ASBA 1VQCA 2BA0A 2WAQG 3S14H 1JJGA 4XIGS 5LMNW 3U50C 5C44G 5LMNQ 3HKZG 4QJFA 5AJ3Q 1I94Q 4L5SA 5IWAL 4Y52H 3T1YQ 2PI2E 2UUBL 4IFDJ 4HIOA 4JI4L 2PI2A 4PMWA 2RHQB 4DR1Q 4BY1H 1RL2A 3S2HH 5AJ3L 1FJGQ 4DV7Q 5M3MG 3KOJA 5IYCG 1HJPA 3RN2A 1YEZA 1U0LA 3CXCA 4B3RQ 1HZBA 1O7IA 4POFA 4DR3L 1WYDA 4KLKA 1CKNA 4DR1L 1FJGL 4DV7L 2ZTDA 1C9OA 4DR5Q 4LF6Q 1BBWA 2AWNA 1Q81C 1P16A 4DUYQ 4DK3C 3BZKA 3K7AH 4YHHQ 4TVAB 1XPOA 5J3BA 4HIKA 4DR5L 1PH8A 4LF6L 5BR8Q 2ES2A 3HOWG 2DGYA 4DUYL 4A93H 2CWPA 5GAHC 3HOUH 1GD7A 3ER0A 3K81C 3NELA 4GN5A 5C0XG 2QEXA 1M1KC 1QUQB 1KL9A 1U5KA 5BR8L 3WWVA 3W1GA 1NTGA 4OO1I 2YV5A 1SN8A 4BY7G 2I0QA 2VW9A 2VUMH 3PF5A 4OXPA 1XPUA 3CCRA 3F2DA 1VQDA 1DGSA 4GN4B 1TXYA 1K83H 1B8AA 1PH9A 2F52A 3CC4A 4OO1G 2A19A 4BA1I 1VQNA 5LMUQ 4IO9A 2JEAI 3CCQA 5M3FH 4JOIC 4JBMA 4A3GG 3A0JA 3FHWA 4R4TA 1VQLA 4JBKA 4LW1A 2B63G 2HT1A 1FGUA 4X65Q 5LMUL 1G6PA 3GTKH 4K0KQ 3E9HA 4DR4L 1YVCA 4L5RC 4X65L 5GROA 2UU9Q 2K14A 4K0KL 4GOPC 4IOAA 3PSIA 4JCVE 4A3IH 2EIFA 1YHBA 2R93G 1AH9A 2N8NA 5FLMG 2UU9L 3RZDH 4AYBE 1ASYA 4DR6Q 3J80i 1NBWA 3J81c 4LNQA 3CC2A 2IHFA 1GO3E 1K73C 4IOCA 3G71A 1PH6A 3HOVG 3KLWA 4IFDI 1L1OB 1E1TA 4DR6L 1K3RA 5M5XH 1YJWA 4A3BG 1VQAA 4A3MH 1IL2A 3CPFA 4IFDG 1N36Q 2JA9A 5M5WH 2MNAA 1XJVA 1E22A 2PMZE 4RG1A 1X56A 3CP0A 1GKHA 1N8RC 4POGA 3PO2G 4BBSH 1WFQA 4LUVA 4LFCQ 3GTPH 1WCMH 4JG2A 1N36L 2F4VQ 2BH8A 3BJUA 1CKNB 2WFWA 1PVOA 4WJ4A 2QA4A 2D0PA 3CCEA 4LFCL 4LUOA 2NZOA 2F4VL 1IXRA 2N78A 3U4ZA 4B3SQ 3HOUG 4DR2L 2WAQE 3F1ZA 2GVAA 4AIMA 2RHSB 1VQBA 4DAYB 3S15H 2Q2TA 4QIWE 3PO3G 1L2FA 4IPHA 1S40A 3U58A 4X6AH 1VQFA 3RNUA 1HNXL 4YWMA 3OW2A 2C35B 1I3QH 3EBEA 1PH1A 1Y1WG 3HOZG 4LF8Q 5HGQA 2KCMA 1IBLQ 4JV5Q 3PF4A 1VQOA 1TWGH 1LYLA 1VQ9A 2R7ZH 1QUQA 2VNUD 1A0IA 4LF8L 2IT1A 1IBLL 1CKOA 4JV5L 4GKJQ 1JT8A 3KJPA 3MXNB 4RMFA 2JQOA 3KJOA 2ZTCA 4Y7NH 4A3KG 4GKJL 3L7ZC 1W3SA 4UY8C 4A3JH 4NXNQ 4DV1Q 3CCMA 4DNIA 2RCNA 5GAGC 4AH6A 4JI0Q 1CKMA 1A8VA 1XMOQ 1EOVA 3KF6B 3L0OA 1VS0A 4DV1L 1MKHA 4KHPQ 2JA6G 1S3OA 4GNXC 4JI0L 4IPCA 4QQBX 1XMOL 2Z6KA 3MEFA 1PH7A 1VQGA 1EIYB 3NBHB 4KHPL 4O0AA 1UE6A 4EQ5A 2NVQH 3GTJH 1OXSC 1S72A 1VQJA 2CWAA 5IP7G 4BBSG 3M9BA 5IWAQ 1V43A 3S16H 4JI4Q 1JJCB 1L1OA 4A3CG 3DM3A 5IP9H 2JA5G 1IYJB 2DUDA 4YWKA 4JBJA 3LGJA 3RLNA 3K80C 4A3EG 3M4PA 3CPWA 4DR3Q 2JA7H 4DPGA 4PG3A 4UP7A 4OX9L 3J81i 1PH2A 1LUZA 2UUAQ 2KENA 1YJ9A 2JA8H 4DAMA 2WP8J 4GS3A 1IZ6A 1J5EL 2UUAL 1XNRQ 2VY3A 1E24A 4YY3L 4OONA 4LF5Q 1I6HH 1N32L 2EQSA 4B3TQ 2K5VA 3PIOA 1XNRL 1RIPA 3EIVA 3PUYA 5C3EH 3UDGA 4LF5L 4LF7Q 4B3TL 3KDFA 5M5YH 2R7ZG 5IYDG 3W5OA 3NEMA 3KYHC 4BA2I 2I5LX 1X54A 1YNXA 4JI5Q 4LF7L 1X3EA 5FJ8H 2R92G 4A3LG 3UE0A 1JMCA 4MNOA 1D8LA 2UUCL 1HZCA 5K36G 2HIVA 4JI5L 3RR5A 3A5UA 4NPSA 3HOYG 5JEAG 1HZ9A 3VDYA 5ELOA 3I4MG 1W2BA 2IX1A 1K8GA 4DR4Q 3TS0A 5IYBH 1SROA 1OXVA 1KHIA 3JC66 3H0GG 4DUZQ 2ID0A 1I5FA 2YTYA 4DUZL 3KF6A 1HH2P 3I56A 1X9NA 3U4VA 1EUJA 2MFIA 4XTCS 2YTVA 1KAWA 4P75A 3AFQA 1PYSB 2XGTA 1Q12A 4BXXH 3J7ZC 1HZAA 4X66L 2CCZA 1VQMA 1G51A 2IHEA 4BY1G 4UP8A 2E5LQ 4OWXB 3CF5A 2YU9H 4A3DH 3UDFA 1VCIA 4O2DA 3OTOL 2UXDQ 1JB7A 1KQSA 1FL0A 1E3PA 2QGQA 4EX5A 2E5LL 4AQYQ 1PA6A 3AYHB 1PH4A 2HHHL 3GTGH 2NVXH 1VQ4A 2UXDL 1E7ZA 2F3IA 2E8GA 4DR2Q 4GN3B 3J81j 3T1HQ 1SFOH 3M85A 1YBYA 4AQYL 2ATWA 1PV4A 3GTLH 1L1OC 4A93G 2KHJA 2Q2IA 1E1OA 1HNXQ 2ZM6L 3T1HL 3TS2A 1TWCH 2UXCQ 1OXXK 4HJ8A 2VQEQ 4R1JA 3KDFB 4HJ9A 5FJ8G 2KCTA 1VQEA 4MZ9A 4QY7A 2CQOA 3TQYA 2UXCL 2VS1A 2VUMG 2VQEL 1L0WA 1KXLA 4JC0A 3HOXH 1SLJA 2ZJPA 3I4OA 3CAMA 2K75A 2V1CC 4YWLA 1YI2A 4PZ6A 5C44H 1FVIA 1MJCA 2D0OA 2ZTEA 3A5ZB 4YCWA 5M3FG 2A1AA 4DV6Q 3G48A 3PUWA 2WB1G 4LWCA 2YTXA 1PH3A 3JAMc 3H3VH 3J7A5 1X65A 2D62A 1QZGA 2NN6I 1TWHH 3ZJYC 4DV6L 1Y14B 3M4OH 1QZHA 2A8VA 1GVPA 1X3GA 3AFPA 3GDEA 1YJNA 1M90C 2NN6G 4TQUS 1V1QA 3DLLA 3CCSA 4DV2Q 1ASZA 4X62Q 1Q86C 1VQKA 4DK6C 4A3IG 2RF4A 3B6YA 4A3FH 1XMQQ 5C0XJ 3S2DH 3PUXA 4DR7Q 3HOWH 1Z47A 4DV2L 4X62L 5GADC 1XNQQ 1XMQL 1EIFA 2AMCB 4DR7L 1X3FA 3OYYA 3TREA 1Q1BA 4A3MG 4JBWA 2VQFL 4GLXA 1BKBA 1XNQL 3AEVA 3CCLA 1UWVA 3M7NA 1CSPA 1Z9FA 2H5XA 3UDIA 5H1SE 4A3LH 1HNWQ 1PYBA 1WCMG 1XPRA 1Q8KA 4LFAQ 4OX9Q 3STBC 1EWIA 4IPGA 5GAEC 4DV5L 2Y0SE 1N33Q 3RZOH 1GM5A 2R7DA 4A3GH 1HNWL 3S1NH 4LFAL 1BBUA 4DV4Q 3RLFA 1J5EQ 2AKWB 4YY3Q 2NZHA 1N33L 1N32Q 3CC7A 1X6OA 1KD1C 2GVBA 4JI6Q 2I5HA 3E9IA 4DV4L 4HIMA 2E2HH 1C0AA 4A75A 1OXUA 2NVTH 1A63A 3ULLA 2Q2HA 3F2CA 2PQAA 4JI6L 3CCVA 1YHAA 3HOXG 1Q7YC 3I55A 2ZJRA 5FLMH 1JJ2A 2XTIA 4QGUA 3FKIH 3H3VI 4JI2Q 3HOVH 2UUCQ 3PGZA 1WOCA 4UPAA 1LM0A 2K50A 3BU2A 1P8LA 2PNHA 4A3BH 5LMNL 4C3HH 4JI2L 4R4IA 1SR3A 1I94L 4LF9Q 2FXQA 4HJ5A 3TEHB 5HY6A 1KIXA 3T1YL 4LF4Q 2OCEA 1K8AC 3PO2H 1Q1EA 4C3IH 4JI7Q 3GD7A 3KFUA 4LF9L 4A3JG 1XTDA 4LF4L 2GN5A 3GO5A 2EXDA 1IBMQ 4B3RL 3W1BA 5IT9c 4JI7L 2KHIA 4A3FG 2OWOA 5C0XI 1NMFA 5JJLA 1D7QA 4DV3Q 1KC8C 1IBML 2LSSA 4R4OA 3BZCA 3PV0A 2BH2A 3UDXA 1B7YB 2AHOB 3F8TA 4FDBA 4YHHL 3ICEA 2ALYB
chains in the Genus database with same CATH superfamily
5DLQE 2R7FA 3JAMi 4JI3Q 1SRUA 4ZCKA 1KRSA 1PZKD 3I4MB 1O78A 1Y1WH 3OMCA 1ILQA 2R6GA 1V9PA 1D2BA 3C3LA 1CHQD 2J0TD 4PZ7A 3HGBA 3OTOQ 1SE8A 2ENBA 2LXJA 3EFXD 1HHVA 2K5NA 1TY0A 1EWCA 3A74A 3GTJB 4KV6A 4P72A 5FO9B 4A3KH 1LO5D 2KCCA 1BVSA 1UE1A 4ALPA 2ZM6Q 1EFID 3EN2A 1NMGA 2K52A 1A6XA 2PQAB 4ME3A 2OTLA 1EIGA 3F2BA 4QMGA 1HTPA 2CFMA 3PCOB 3S2HB 3BDLA 4J1MA 2K03A 3X3MA 3K0XA 2SEBD 1YIJA 3BYTB 1NJIC 1F2LA 4IJHA 1GUSA 1O7LA 2B8FA 3A55A 3EROA 3FMCA 5IY0A 1TVXA 4U68A 4X64Q 4JYAQ 4H13C 3H15A 1MIUA 4QUCA 1VQ6A 4DKAC 4KTAA 2E2JH 1Q46A 2RDHA 4DV0Q 3ULJA 1YNND 4B3ML 2NB0A 3K57A 3G4SA 2M00A 3I4NG 5EAYA 4JOIA 1Y1VG 2WB1B 1ZYRD 3NHHA 1F9RA 2JE6I 5E4WC 3D6CA 4GNXB 4KI0A 2R92H 2N49A 5I2YA 1MJEA 1UE5A 5K36H 4A76A 1HNZL 4PZ8A 5JEAH 3I72A 3I4MH 1EFWA 4BBRG 4HCSA 3OHXC 2B63H 4Q0FA 3RLOA 3J80L 1PFMA 1BXTA 4JPBW 2YU9B 4A4IA 4L5TA 2CKZB 3S24A 3NXWA 2Q2UA 1R9TH 3IKJA 3IAYA 2NVXB 2JK8A 1WTVA 1C7YA 2R93H 4GLVB 2ASBA 2BA0A 4DNRB 5ELDA 4RKBA 3GTLB 4L5SA 3VR6A 1I94Q 4K6LA 2B2UC 4IFDJ 4HIOA 4JI4L 2RHQB 3S2HH 4DV7Q 3OMGA 3RN2A 1RCVD 4POFA 2XN9C 4DR1L 3BVZA 3HOXB 4HCEA 4ZUJA 1UAPA 1C9OA 2ZTDA 4X3TA 4DR5Q 2AWNA 5C5LA 2TMPA 3HKZB 3K7AH 4YHHQ 1QG7A 4LF6L 1XX8A 1PH8A 3HOWG 5BR8Q 2PNRC 3D4RA 1TWHB 5C0XG 2QEXA 1KTKA 3KBGA 5KNDA 1U5KA 5CV4A 4BY7G 1SN8A 2I0QA 3CCRA 4F7XA 5JOBA 4I65A 4A3FB 3SK5A 1B8AA 1QJOA 4ZAIA 2A19A 1S5CD 1VQNA 5M3FH 4JBMA 4JOIC 3ND9A 2HT1A 1IW7D 4DR4L 4L5RC 2K14A 1ZKOA 1DOLA 2L11A 3I70A 5EKIA 4ABNA 1GUOA 4JCVE 5EQ0A 2EIFA 1YHBA 1BCPC 3SR1A 2UU9L 4AYBE 1SE3A 3J81c 1YNJD 4LNQA 1OO9B 2QCPX 1PH6A 2HDMA 2PYKA 4A3BG 3TN2A 4C3HG 2RVLA 1BBXC 2F0VA 1BNZA 1N36Q 4IFDG 3SVMA 2PMZE 3VYTA 1DXMA 2NZ1D 3A54A 4R8IA 3R8BA 3H09A 3GTPH 5FLXE 2HCIA 2XRSD 2SDFA 2QDBA 4DAPA 4LUOA 2F4VL 3HOUG 1F9QA 2WAQE 2GVAA 2BDOA 5KEEA 5ELBA 1VQBA 4DAYB 3S15H 4QIWE 5DM73 1L2FA 4UAIA 3U58A 4X6AH 1VQFA 2L1BA 3OW7A 4XQNA 3RNUA 2EYOA 1I3QH 1JWUD 3QOLA 3JAME 1Y8OB 1IBLQ 2F0UA 3TP7A 1VQOA 1LYLA 1VQ9A 2EZVA 3MXGA 2VNUD 2IX3A 2F0DA 4GKJQ 2F0IA 1L0XB 1Y8NB 1XXGA 3I4NB 2JQOA 5DNFA 2ZTCA 1PDQA 4KKUA 2DY7A 3DWQA 1Y1VB 3VR5A 2ZXPA 3PMFA 4NXNQ 2L9HA 3CCMA 1A3UA 1K28A 4DNIA 5GAGC 1WD1A 1A2UA 4JI0Q 1STEA 2K33A 3MWYW 2EJMA 3L0OA 2ICEC 2EJGC 4G4KA 4ME5A 2Z6KA 4PMCA 3T56B 1YNJC 3T51B 1Q3LA 4CDCC 4O0AA 1UE6A 2BOSA 2NVQH 1TS2A 4C56C 4H44C 2CWAA 4BBRB 4BBSG 5IWAQ 2B8GA 1V43A 3S16H 1L1OA 2BCOA 2LFNA 3DM3A 2DUDA 2B2VA 1I4XA 3LGJA 4KN4C 2MGSA 1GJXA 4IALA 4DR3Q 4EVOA 3J81i 1PH2A 3CQZB 2SNSA 1TWAB 4CJ0B 3M4YA 1PFBA 3S1RB 3W3AA 3TP8A 2XRQD 1PTOB 1E24A 1I6HH 2AQ2B 4WFN3 4B3TQ 2K5VA 3PIOA 5J39A 4A3EB 3PUYA 3UDGA 1GUGA 1SYFA 5M5YH 5IYDG 1X54A 4JI5Q 3T13A 5KIXA 3UE0A 4MNOA 3VDYA 5CGKA 1CT1D 1U4PA 5ELOA 1RDPD 3HOWB 3NPPA 3S17B 1I4QA 1SXTA 5D14A 3MXNA 3H0GG 1HA6A 4BY7B 3U9OA 2PZTA 3EVQA 1I5FA 2KJXA 4DUZL 1VMPA 1CFMA 1EYDA 2XNAC 3U4VA 4XTCS 2YTVA 4P75A 1PYSB 2XGTA 1Q12A 3FEWX 3NBHA 2CCZA 4OEMB 5FO8B 3OWEB 5KNBA 1AZQA 3OTOL 2UXDQ 4UDUC 3K6OA 1JB7A 2F1MA 5JVG3 1EY8A 1QILA 3A7LA 2E8GA 3BZDB 3J81j 2PO4A 3M85A 4AQYL 2JSOA 4A3BB 1L1OC 1ILPA 4BY1B 2Q2IA 2EYFA 2ZM6L 5JPMC 3T1HL 2B2VC 3N52A 1OXXK 2VQEQ 2NUCA 2KCTA 1GOZA 2A6HD 3G7LA 2KUMA 2VUMG 1L0WA 2ZJPA 2IW3A 4GZYC 3CAMA 1I6VC 1Z6HA 2K75A 4MN3A 4YWLA 4ZYSA 1YI2A 1BR9A 2ZTEA 3HOUB 4DV6Q 3PUWA 4BS9A 3HZXA 1PH3A 2L0CA 2D62A 4IUQA 3ZJYC 1STGA 1F77A 3M4OH 4K8JA 3AFPA 1YJNA 3GDEA 1M90C 1V1QA 1VQKA 4A3IG 4FXDA 3S9WA 1XMQQ 4OL7A 3S2DH 4DR7Q 3HOWH 4DV2L 4HN7A 1PTOF 4X62L 5GADC 1UUPA 3GTKB 5C0XH 4ZQ3A 3PQIA 4B9WA 2LKVA 1X3FA 4A3MG 1Q1BA 1S5DD 4ZKBB 3BYYB 1H9JA 1KAAA 4ZLTF 4N8FA 3HG9A 3M7NA 4WJWA 1LT6D 4X3KA 1BOSA 1Q8KA 4OX9Q 3STBC 1EWIA 4IPGA 5GAEC 1GUTA 1GM5A 2HD3A 1ML0D 4LFAL 1EYAA 1J5EQ 2NZHA 1SDFA 2EOTA 1N32Q 1KD1C 4JI6Q 2I5HA 3E9IA 4HIMA 4BBSB 1MGSA 1M8AA 1OXUA 4ZKCB 4DXGA 1PMRA 3MZ5A 2A6HC 3EJIA 3MFGA 2ZJRA 5IIFA 3ZYYX 1U4RA 1BUVT 2GA4B 1P8LA 4A3BH 4C3HH 1SR3A 1JE4A 1I94L 3NTKA 1KIXA 4LF4Q 4JI7Q 2FMCA 3KFUA 1NCVA 4LF9L 4A3JG 2EXDA 1I4RA 1TWGB 3SK6A 4CHTB 4K5XA 1NMFA 5CC4A 5C0XI 4DV3Q 2OWOA 2F0MA 2LSSA 3PV0A 3UDXA 2E2IB 3ICEA 4YHHL 4LK1C 5I6WA 2F0GA 4K2KA 1IYUA 2F0OA 2IX0A 3KK7A 4JI1Q 1X55A 3FPUB 4X66Q 3GTMB 3SGIA 1BCPB 3KF8A 2NVYB 4GKKQ 1QVGA 3H0GB 3AQQA 3NQTA 4KKTA 2FINB 4MTKA 1QOHA 2BA1A 2MO1A 1Q8IA 3HFZB 4Q5VA 2Y0SB 2CHBD 2D9UA 4WJ3M 3J81E 4K2LA 2J4XA 1PHJA 4RCOA 3ERSX 4H02A 5ELNA 4JI8Q 1SJED 1HR0L 2EXZA 2UXBL 2KOLA 5C3EG 1QB5D 2YYZA 3FKIG 4TKOB 1IBKL 4LFBQ 4DU9A 1X3QA 3CRKC 5FLXc 1N34L 1CSQA 4IPDA 3VYRA 3CCJA 4GLAC 2AWOA 1S5FD 2E75C 4HSPA 1IL8A 1F2YA 3N6RA 4FF1A 2G9DA 2MJ8A 5EPKA 1PTOD 5IYBG 2QW7A 1H95A 1M4VA 2HIXA 5IYCH 1YITA 1ONLA 1EY9A 4LUZA 1E0BA 5ELEA 5JJKA 2DNEA 3CMAA 3CW2C 2Z4IA 5IE8A 1OXTA 5TSSA 2O2LD 3A7AB 4P74A 4E6IA 5C4JH 4R4CA 1JB3A 3RN5A 3PIPA 1SYDA 1KRTA 2KECA 4RCNA 4YCVA 2VQFQ 5IYDH 4NXML 3QOJA 4ODGA 1A62A 5E1FA 2E2IH 3MXUA 4N8X1 4P71A 5EBCA 1CQVA 4TRDA 2K5HA 1T9HA 1PH5A 1QVCA 1HCZA 3CCUA 1B4OA 3GTMH 3GTOH 4NXNL 2NVYH 5IODA 1QVFA 3H0GH 4A3DB 5C4XG 1NY4A 4L63B 2B3GA 2K28A 3K7UC 1VQ5A 3EA6A 4IJLA 1LTLA 2ZXOA 5E7NA 4OWWB 3NENA 5IT9L 3S14H 5C44G 3SHLA 2PMZB 3HKZG 5AJ3Q 5IWAL 3T1YQ 5J1ZA 2UUBL 4DA2A 2QKIC 1BCPF 5M3MG 1HJPA 1NSNS 4XT1B 4DR3L 1WYDA 1CKNA 4ZK9B 1FJGL 1VF5C 1JOOA 1Q81C 4DUYQ 1H9SA 4DK3C 5J3BA 5KGUA 3RD4A 2CH4W 4K5WA 1GD7A 3ER0A 3NELA 1DYQA 4A3JB 2VW9A 2VUMH 3F2DA 2K04A 1K83H 4OO1G 1J8IA 5LMUQ 4IO9A 2JEAI 3CCQA 4A3GG 3A0JA 4R4TA 1RTOA 2F0FA 2QDLA 4X65Q 4K8IA 1JORA 2L55A 3QWNA 1E2WA 4ULLA 5ISRA 4K0KL 3NP8A 3PSIA 4A3IH 1R4PB 5FLMG 3RZDH 1ASYA 4FF3A 1NBWA 4EQOA 1GXDC 3G71A 4RGNA 1L1OB 4DR6L 2KA7A 1K3RA 5M5XH 3MVVA 1PZID 1IL2A 4A3MH 2EPBA 1VF7A 5M5WH 2MNAA 4RG1A 3ND8A 5BN3A 5J22A 4LFCQ 5C3EB 3FKIB 4WJ4A 1RD9D 2F0QA 1PVOA 3K5LA 2QA4A 3U4ZA 3Q6SA 4B3SQ 4CDFC 5I6YA 3F1ZA 4AIMA 1UEAB 1HPCA 1TS3A 1ET9A 3PO3G 2O5IC 4LF8Q 4MIUA 3DWAA 1DCZA 4JV5Q 1QUQA 1XTCD 4K6DA 2E74C 1JT8A 3MXNB 1PXUA 4RMFA 5L37A 3KJOA 4Y7NH 2A69C 1SYGA 4UY8C 4A3JH 4DV1Q 4OHJA 5C3XA 3NSWA 1CKMA 1XMOQ 1EOVA 2EY2A 1RTNA 4DK0A 1IKLA 2N55A 1GUWA 1KNEA 4KHPQ 1JOQA 2KEDA 3HEJA 1EIYB 1BCPD 1EZ8A 3NBHB 4B9XA 4EQ5A 3GTJH 1QNKA 1VQJA 3CRLC 1BF4A 2K1BA 3M9BA 1SFOB 2MUYA 2XWJB 3P7JA 3BVGA 2L4NA 1TWFB 4C3JG 3OOCA 4A3EG 3M4PA 2JA6B 5C4XB 5EKLA 4OX9L 2UUAQ 4JK1C 4G7OC 3RUZA 1YJ9A 2ZXRA 3W2DA 1XNRQ 1J5EL 2VY3A 1LTAD 4OONA 5KYLA 4LF5Q 1N32L 2EQSA 3KLSX 1NUCA 5C44B 2JA5B 5FK9C 1RIPA 5C3EH 3D4WA 3P75A 3DXJC 2R7ZG 1DONA 2HUGA 5M3MB 2I5LX 4LF7L 1YNXA 1JMCA 1D8LA 1G2TA 2HIVA 2H1EA 3RR5A 5CBEE 1U4MA 1B9MA 2I07B 1K8MA 1W2BA 3V2TA 1K8GA 1KDCA 3I4LA 1W6JA 5IYBH 1SROA 1OXVA 4XDXA 2ID0A 3HOYB 1CA5A 2YTYA 1LT3D 2EDGA 3KF6A 1WTRA 3RZOB 2MFIA 4A3GB 2CW0C 3S1NB 1WTXA 5BN5A 3AFQA 1CI3M 3SXHA 4X66L 1VQMA 1G51A 3A8JE 4BY1G 4J6HA 1SSOA 2K6AA 4OWXB 3CF5A 1ENAA 2YU9H 1B44D 2C9OA 1VCIA 1FGBD 2E5LL 1EOTA 2BE5D 2NVXH 1SFOH 4DR2Q 1A3VA 4GN3B 1STBA 4CBVA 1PV4A 3GTLH 1JCKB 1D5ZC 2ICIA 5D3DA 1EIHA 4R1JA 3KDFB 3TZUA 5FJ8G 1B50A 4MZ9A 1VQEA 4ZUIA 4QY7A 2CQOA 3DWPA 2SOBA 5EGTA 2UXCL 4EQPA 1KXLA 4OIJA 4JC0A 4OELB 3H6MA 3HOXH 3I4OA 2V1CC 3E0JA 2QEJC 1KLUD 5AFWA 5C44H 3LX0A 2X6LA 2A1AA 3X3NA 2E76C 3PO3B 3J7A5 3M3YB 1X65A 3R3OA 1TWHH 1PRTB 5CV5A 4CKEA 1SAPA 2NN6G 3JAML 4CKBA 1C48A 1Q86C 4DK6C 2RF4A 4A3FH 3PUXA 1EY6A 2AUKA 1HTLD 5C5MA 1EIFA 1Q90A 4JBWA 2F0WA 2VQFL 4RAUC 5IGCA 1XNQL 3CCLA 3BDOA 5E3FA 2H5XA 1HNWQ 2EYJA 1PYBA 3OWFA 1WCMG 3A8KE 1H9MA 3HRZC 1N33Q 3RZOH 2NWGA 2R7DA 4A3GH 3S1NH 4DV4Q 1BO0A 2BE5C 4QF4A 1SEBD 3U9SA 1JR0D 3K5NA 1U9RA 2PPBC 1EY4A 3SE0A 2F0NA 1AP0A 3BS1A 4A75A 1A63A 2Q2HA 3F2CA 2PQAA 4R8NA 3V96A 1YHAA 1Q7YC 4C3JB 5FLMH 4QGUA 4JI2Q 4RHSA 2KEEA 2UUCQ 4UPAA 2K50A 2A5HA 4C2MB 4R4IA 5T1IA 3T1YL 4FVMA 3MAQA 1Q1EA 2CH4A 1LV9A 1I4PA 3NUCA 4QB4A 1WTWA 1IBMQ 4DF7A 2R7ZB 5IT9c 4KY7A 1FR3A 2B2WA 4RA8A 3WOEA 1D7QA 1HA5A 4KD4A 1KC8C 1SYEA 1STNA 3BZCA 4FDBA 3F2UA 1JICA 2ALYB 5NUCA 5K5PA 3PO3H 3M3YH 1VQIA 4NW2A 1SE2A 2WB1E 5EPJA 2Y0SG 1HRJA 5CYUA 3I4NH 4A3LG 1Y1VH 4L5QA 3S1MB 2B29A 4JI3L 1JC7A 1U4LA 3AU7A 5IP9G 1AE3A 5IGGA 4GNXA 4IUPA 3IRBA 4P73A 4B08A 3D4DA 1FNUA 3PUVA 5C4ZA 1B70B 4XYQA 2JA8G 1B9NA 1J6QA 3STBD 4EQNA 2JEBI 3GTQB 2Z6KC 3S1QB 1EQRA 4IN3A 1YHQA 4BBRH 2MQHA 3CKIB 1PRTF 1SBBB 5IGBA 2Q8TA 1EQQA 3L9AX 3I91A 1Q82C 4YCUA 2OQ0A 1K0RA 4OWTB 1MI2A 3CQZH 1TWAH 1HQRD 4RGOS 3S1RH 4NP5A 2HDLA 4HEDA 3HKSA 1PTOH 2FFKB 5GQOA 1O7YA 4C3JH 4A3EH 1WVLA 2K7VA 1H9SB 1I4GA 2DJFC 3D8GA 1OTCA 4B3MQ 2QILA 4X64L 5JPNC 1N9WA 3IFTA 4JYAL 2Z9HA 3HKZE 3C1FA 4C2MH 5JJIA 4B3SL 3K0YA 4DV0L 4K14A 1Z7TA 3J7AV 1LTBD 3ITPA 3NK9A 1S5ED 3Q8DA 1G8ZD 3S17H 2OTJA 2Z6BA 1AE2A 3Q22A 1VQHA 2F3VA 4KD3A 4BXXG 4KHZA 3KUPA 1HNZQ 2KBNA 1JWSD 2L12A 1V1OA 4GOPA 4A3DG 5JEAJ 4BY7H 4R4QA 3SDZA 4AYBG 3Q0AA 1UEBA 1UE7A 3J80c 4RWSC 4DXFA 4FNFA 1A15A 3S1MH 1EY5A 1G291 5C6AA 4LAAA 3TRZA 3FPPA 3CMEA 1ESFA 4MTNA 1WCMB 3GTGB 3D0FA 3GTQH 1D1KA 3S1QH 4F8MA 2WAQG 1JJGA 5LMNW 3U50C 5LMNQ 4Y52H 1ZEQX 3VA5A 2PI2E 3URYA 2PI2A 1DOMA 4ILWA 4DR1Q 1RL2A 3DEOA 4BY1H 5JAVA 3KOJA 4IFDH 1YEZA 4NMZA 4OGQC 4XQQA 4CGYB 2O5JC 3HOZH 4DV7L 4LF6Q 4HSVA 1BBWA 3BZKA 1XPOA 1V8QA 1SNMA 4DR5L 5DM63 4YIJA 2ES2A 3Q24A 1KLGD 2DGYA 3HOUH 4C1NI 3K81C 1M1KC 2F0EA 4RKLA 4RH6A 2F0LA 2D5DA 1QUQB 1KL9A 5BR8L 3WWVA 3FVQA 3W1GA 5JVH3 1GHKA 5F2DA 2XWBB 3PF5A 1DJRD 3SEBA 4OXPA 1WTOA 1VQDA 4GN4B 1PH9A 3MHBA 3CC4A 1SYCA 4BA1I 4IUUA 1PRTD 4M1UB 4N9PA 3FHWA 3UI2A 4LW1A 2B63G 1B1ZA 1FGUA 1A3TA 3GTKH 1NAPA 5D3IB 2Z8LA 3LWUA 4FXKC 5GROA 2UU9Q 2NN6H 4GOPC 2WKDA 4FYDA 2OXPA 2R93G 1O80A 3K5OA 3J80i 3CC2A 2IHFA 1K73C 3KLSA 4IOCA 3HOVG 1TS4A 4IFDI 1E1TA 2JA8B 4ZRZA 2RDGA 1VQAA 5LL6X 1T5XD 1PLFA 3CPFA 3VR4A 4G57A 3J81L 1X56A 3CP0A 4BBSH 4HMIA 4C3IG 1WCMH 4JG2A 5IOCA 1LT5D 2BH8A 1N36L 2F4VQ 1AZPA 2WFWA 4EGVA 2D0PA 3TP6A 1IXRA 2N78A 4DR2L 1CHPD 3QJYA 1S40A 4YWMA 2C35B 2RSOA 3EBEA 1PH1A 3HOZG 4JW0A 5HGQA 1D6EC 1TWGH 3P1HA 3VYUA 2P5ZX 1K0SA 2K5QA 2IT1A 1IBLL 2J7ZA 1PRTC 4DFAA 3HP3A 1V1PA 4LMQD 4GKJL 3L7ZC 1Y1WB 1W3SA 2KHSA 1UNSA 3TMEA 1G91A 2V4DA 4RHRA 1A8VA 3KF6B 2LY7A 1EU3A 3DUZA 2JP1A 2JA6G 4JI0L 2FMMA 4IPCA 2EYMA 4AYBB 1FNWA 3MEFA 4A3KB 1PH7A 3MXPA 5E4XA 1EY0A 1XWEA 5IP7G 3TZDA 3C2PA 2OT2A 1TQOA 3NTHA 1ZXTA 1JJCB 4A3CG 5IP9H 2JA5G 1LTSD 1IYJB 3BG3A 4OIKA 1SMYC 3K80C 1TWCB 3K5MA 2B39A 3NTIA 4PG3A 4NKLA 3GV6A 2JA8H 3VYSA 3PIO3 1EQVA 1IZ6A 1VMCA 2EYLA 2WAQB 2F03A 2NTSA 2RCFA 3MA2B 4QIWB 4TSSA 5A2QE 3EIVA 1DZ1A 4B3TL 2F0PA 4KHVA 1F2ZA 3W5OA 5BN4A 2E2JB 4BA2I 1B53A 1DOKA 5EJWA 5IT9E 2UUCL 2WKCA 1HZCA 5T1GA 3K58A 4JI5L 3A5UA 3HOYG 1JOKA 1RKNA 1HZ9A 5LHY1 5COYA 2KCNA 1SNQA 2HQEA 2K05A 3D6WA 2IX1A 3TS0A 2WACA 2A69D 3NBIA 1KHIA 3JC66 4DUZQ 3WOFA 5LL6S 1W6KA 2Z4HA 4O42A 2K5DA 1HH2P 1BDOA 3I56A 1X9NA 2FHTA 3RMHA 1KAWA 2B63B 4FO2A 4BXXH 2A73B 1HZAA 1QNUA 1TKWB 2H4OA 1S4ZA 5KYIA 1DD2A 4A3DH 5CV9A 2NVTB 3I90A 1R9TB 4RFBA 1KQSA 3A8IE 4QCLA 1E3PA 2R93B 5HGTA 4AQYQ 1PA6A 1VQ4A 2B2UA 5CV6A 2UXDL 3NWSA 2F3IA 3HOVB 3T1HQ 1RJTA 2MPMA 2OEOA 3I8ZA 3KBXA 2ATWA 4A93G 3J7AF 1R4QB 4C1NK 1HNXQ 5CV7A 1TWCH 1II3A 4CJ2C 4HJ9A 1LTTD 2IJ0A 4C3IB 2R3ZA 4L8JA 4FF2A 2VQEL 3K7AB 3P20A 3MFYA 4PZ6A 1FVIA 1MJCA 3A5ZB 1C4QA 2A6EC 1LTID 4LWCA 2YTXA 2E2DC 3NWTA 2G9HD 1QZGA 4DV6L 3HOZB 4TQUS 3DLLA 4XYOA 5M9OA 4DV2Q 1ASZA 4X62Q 3B6YA 1E2VA 5M3FB 3LNNA 5C0XJ 4PV1C 4O1NA 1XMQL 3J80E 2AMCB 4DR7L 3TREA 3OYYA 2CW0D 3MEHA 2LMCB 1XPRA 3NE5B 4LFAQ 1S5BD 2MP1A 2PCFB 2RDFA 2Y0SE 1KDAA 2XIWA 3QR8A 4U673 1BBUA 2A68D 3GQBA 4YY3Q 1CK1A 2GVBA 5EBDA 3E3XA 2NVTH 1X3PA 1CZWA 3GTPB 3ULLA 2RA4A 4JI6L 3CCVA 3FKIH 4KKSA 3HOVH 2PZUA 4IZ8A 3PGZA 1LM0A 2PNHA 2F0HA 1IHZA 3S15B 5LMNL 3V05A 1MSHA 4LF9Q 1FNVA 2FXQA 3TEHB 1HXYD 2F4IA 1I3QB 3E5SA 1K8AC 4G7ZC 2K01A 4C3IH 3GD7A 2X6GA 1B2TA 4LF4L 2GN5A 3AB9A 1SNCA 3A56A 1JQYD 1YNNC 5CBAE 4JI7L 2KHIA 2WINB 1I50B 3H3VC 4S3SA 4N9TA 2AUJD 4R4OA 2BH2A 1LABA 3Q23A 2AHOB 3F8TA 4M8AA 1LLRD 4DV3L 1ZYRC 4X3SA 2LXKA 2JYOA 2K4KA 1KNAA 1WD0A 5CORA 4J15A 3I2ZA 4GOPB 1EYCA 4Z9CB 1T5EA 3H91A 3WDNA 3L2PA 3KLRA 1E2ZA 2DJGC 2N3SA 3FRPB 1CA6A 2RKSA 3I3CA 1EYGA 3L3OC 4QUFA 4JI1L 2MO0A 1HFGA 3M4QA 2VL6A 2QF7A 3I73A 1IYVA 3NQIA 2JA7G 3OIQA 4GKKL 4PQXA 4HJAA 2HHHQ 2NVQB 3LWEA 2B2TA 1ET6A 2A68C 2I5MX 1HR0W 3AMUA 1HR0Q 2UXBQ 1K9MC 4V0BA 2EY1A 3S16B 2ZJQA 1IBKQ 4QL5A 1JE5A 3FP9A 3C46A 2O4XA 2RQXA 5CMDA 1CUKA 1YZ6A 1F9PA 1N34Q 2Q8IB 4KK7A 1TWFH 4JI8L 5C4XH 2JA6H 4NB3A 3IL8A 3DMUA 3K8AA 4LFBL 1HUNA 1EWHA 1WJJA 2IL8A 1VQPA 3I7FA 1QWYA 1I6HB 1TY2A 5I4DA 2VB2X 5IP7H 3D31A 1L0YB 2L15A 1TR5A 5FLXL 3J7YW 4A3CH 3G6EA 3R2IA 2JA5H 5C4HA 4A93B 5M5YB 5DAUA 4KMUC 1VQ8A 1EY7A 5M3MH 1D1IA 2JJQA 1B3AA 3O13A 2Z0SA 3PIP3 2F0KA 1IKMA 3SK8A 3ULPA 2F0SA 4NXMQ 3ERQA 4HJ7A 2VZAA 1I50H 1HUMA 3T16A 3PUZA 1NE3A 1PFNA 3KF8B 3CD6A 3T4AC 3UE1A 3HS0C 4APVA 5HURA 1RHPA 1WTHA 2HQLA 2RSNA 4DV5Q 1IW7C 3HOYH 4I7AA 2CVRA 4OO1H 1PYWD 1SNDA 5I2XA 2OQKA 4IURA 4J8QA 1VQ7A 2F0TA 2PQEA 5DEHA 2IPKD 2IY5B 1BQQT 1NNXA 4KJNA 4UHVA 4UP9A 3E0EA 4HIDA 3DM1A 1SMXA 1WI5A 4XQJA 1AFPA 1NR4A 1HQMC 1PFSA 2B2YA 2B2TC 2UUBQ 1VQCA 4DK1A 1C8CA 4XIGS 4QJFA 5JJZA 2X69A 3VA7A 4PMWA 1LACA 5AJ3L 2BDNA 1FJGQ 5IYCG 1AW7A 4B3RQ 5FO7B 1U0LA 3VR3A 3CXCA 1HZBA 1O7IA 2A74C 4HMJA 4KLKA 1D5MC 2DY8A 1TIID 4X3UA 4KJOA 1P16A 4TVAB 3OSOA 4HIKA 4DGZA 1CZGA 4KY5A 5EKKA 4DUYL 4A93H 2CWPA 5GAHC 4GN5A 3M4OB 1ENCA 1QE6A 1NTGA 4OO1I 2YV5A 2AQ1B 5KNCA 1XPUA 3D3RA 5IGFA 3TDQA 1DGSA 1TXYA 1V1PB 2F52A 3S2DB 2Q8RE 1KDBA 4DAVA 3T53B 5IGDA 1VQLA 4JBKA 5LMUL 1EQTA 1G6PA 1Y8PB 2TSSA 4K0KQ 3GV3A 3E9HA 1YVCA 1DM0B 2R61A 4X65L 2PW7A 2DNCA 2VB3X 3M7GA 4IOAA 4G7HC 4XXEA 1AH9A 2N8NA 4DR6Q 2JA7B 1GHJA 1GO3E 5I9PA 3KLWA 5KRUA 1ESRA 2EYHA 4MHEA 1YJWA 1F9SA 4L6TB 5ELFA 1NR2A 2JA9A 4BWGB 1XJVA 1E22A 1SNPA 1FD7D 2HCCA 1N8RC 1GKHA 1GUNA 2JN4A 4XT3B 4POGA 3PO2G 1WFQA 4LUVA 2RBMA 3BJUA 1CKNB 5FOBB 5G3LF 2Z1CA 4CKCA 1B3QA 2EY5A 2F3WA 2IWHA 2B2YC 3CCEA 1TU2B 4LFCL 2NZOA 4KY6A 4CDDC 2K32A 4C3HB 3VR2A 4LJZC 4RGMA 1EL0A 1RODA 1ENFA 2RHSB 3OIPA 4JVZA 2Q2TA 4IPHA 1H9RA 1HNXL 1EEID 3OW2A 1K3BC 1Y1WG 1STHA 5EPLA 2KCMA 5A35A 2MHVA 3PF4A 2R7ZH 2XSCA 1A0IA 1A2TA 4LF8L 2B2WC 1CKOA 4JV5L 3IFDA 3KJPA 2EY6A 1G6ZA 2I46A 4RGTA 2G5DA 4A3KG 3TBIB 1K8OA 2C5CA 1H9KA 1ICWA 2EYPA 2RCNA 1O7ZA 4AH6A 4IUVA 1VS0A 4DV1L 3R2TA 1MKHA 1S3OA 3R93A 5I9OA 4GNXC 4QQBX 1XMOL 1VQGA 3FDTA 3EQLC 4KHPL 1LT4D 1OXSC 1S72A 4JI4Q 1STYA 4DN4M 4YWKA 4JBJA 3RLNA 3E6ZX 1EZ6A 3CPWA 2CQAA 2JA7H 4DPGA 1WTPA 4UP7A 1LUZA 2VXWA 2D2CC 2KENA 2NTTA 3CU7A 4V190 2M9VA 1X32A 1STAA 4DAMA 2WP8J 4GS3A 2UUAL 4YY3L 2EVBA 3DHQA 4R9WA 1XNRL 4LF7Q 4LF5L 4DAYA 3KDFA 4HAEA 3MTSA 3NEMA 3KYHC 1X3EA 5FJ8H 2R92G 2K5WA 2F0JA 4H7BA 3BDCA 5K36G 4NPSA 5JEAG 5C4JB 3I4MG 3OPOA 1D5XC 2EE1A 3TSSA 2ZT9C 3GP7A 4DR4Q 4I7ZC 4FXGC 2XVSA 1CM9A 4DNTB 1TS5A 1MSGA 4HTHA 4ID6A 3QIAA 1QCBD 1EUJA 2DN8A 3GTOB 5G3LD 3J7ZC 3QG1A 1SYBA 1VDZA 3MC0B 2IHEA 4UP8A 4PNYA 1XYIA 2E5LQ 1EEFD 2E2HB 5CV8A 4FP5D 1KABA 5C3WA 3UDFA 4O2DA 1SMYD 1FL0A 1AEXA 2LS01 2N88A 2QGQA 4WORA 4EX5A 3GTGH 2AQ3B 3AYHB 1PH4A 2HHHL 3S14B 1E7ZA 5FKAC 1YBYA 2KHJA 1E1OA 2UXCQ 4HJ8A 3QO2A 1I4HA 3PO2B 2M2LA 2NYZD 3QB3A 3TQYA 5CR3A 2VS1A 4KN7C 1F2MA 1SLJA 4CDEC 1CQFA 4IUNA 2D0OA 4YCWA 3H94A 5M3FG 3G48A 2FJ2A 2WB1G 3BVMA 3H3VH 3JAMc 1JWMD 1LTGD 2NN6I 1Y14B 2VUMB 1QZHA 2A8VA 1J9OA 1GVPA 4FF4A 1X3GA 1K83B 3CCSA 3C1EA 5IGEA 2JXMB 3DEPA 2PW5A 1Z47A 1MHWC 4F87A 1XNQQ 4H0LC 1RF2D 4GLXA 1BKBA 1CTMA 4F88A 3AEVA 1UWVA 3CHBD 1CSPA 1Z9FA 5H1SE 3UDIA 4A3IB 4A3LH 1HFNA 1AN8A 2KVMA 1LTRD 5D65A 3RZDB 2L5TA 4DV5L 1HNWL 2KQ3A 5M5XB 3RLFA 4A3MB 2AKWB 1N33L 2WV6D 5M5WB 1Y69U 3CC7A 1X6OA 4K5VA 4DV4L 2E2HH 1C0AA 1FYCA 2SNMA 1SE4A 2NBFA 3HOXG 3I55A 2PZWA 1SNOA 1JJ2A 4IUTA 2XTIA 4WRDA 3K59A 1MD2D 3H3VI 3G6JB 4CJ1B 1WOCA 2OF1A 3BU2A 4IQZA 4JI2L 1PZJD 1TT2A 3TS2A 4HJ5A 5HY6A 4P2CB 2OCEA 3ONAB 3PO2H 1PTOC 1SJHD 4NDXA 2WIIB 4HR7B 2A6ED 1XTDA 4B3RL 3GO5A 3W1BA 5A2QL 4A3FG 1G2SA 3SK4A 5JJLA 4PMBA 1MBYA 2R92B 1IBML 1EU4A 1ICFB 1B7YB 5ELCA 1WTQA 3TP5A 4Y7NB 2EJFC
chains in the Genus database with same CATH topology
3PO3H 2LXKA 5DLQE 2R7FA 1VQIA 2K4KA 1SRUA 2IX0A 3JAMi 2WB1E 4JI3Q 3M3YH 2Y0SG 1KRSA 3I4NH 4JI1Q 1X55A 4J15A 3I2ZA 4GOPB 1Y1WH 3HOZH 1Y1VH 4L5QA 4X66Q 2B29A 2R6GA 4JI3L 3L2PA 2N3SA 1V9PA 3SGIA 5IP9G 1EYGA 1AE3A 4GKKQ 4PZ7A 2MO0A 4JI1L 4GNXA 3M4QA 3IRBA 1QVGA 2VL6A 4P73A 3AQQA 3OTOQ 2JA7G 1SE8A 2LXJA 4GKKL 2K5NA 2BA1A 2MO1A 3HFZB 3PUVA 4HJAA 1B70B 2HHHQ 3A74A 2JA8G 4P72A 1J6QA 3STBD 4A3KH 2JEBI 2I5MX 1HR0W 4WJ3M 2Z6KC 1HR0Q 2UXBQ 1K9MC 1EQRA 2ZJQA 1IBKQ 4QL5A 1JE5A 1BVSA 3FP9A 4BBRH 1UE1A 4ALPA 1YHQA 3ERSX 2MQHA 4H02A 5ELNA 2ZM6Q 4JI8Q 1PHJA 1HR0L 3EN2A 1NMGA 1CUKA 1YZ6A 2K52A 2UXBL 2PQAB 4ME3A 5C3EG 2YYZA 3FKIG 3F2BA 1EQQA 1N34Q 1IBKL 2OTLA 1Q82C 4LFBQ 2CFMA 3PCOB 4YCUA 2OQ0A 4DV3L 1K0RA 1TWFH 3K0XA 4JI8L 4NB3A 5C4XH 2JA6H 4OWTB 5FLXc 1N34L 3K8AA 1YIJA 4LFBL 1CSQA 3CQZH 1TWAH 1WJJA 1VQPA 3I7FA 4IPDA 3S1RH 3CCJA 5IP7H 4GLAC 3D31A 3HKSA 1NJIC 2L15A 4IJHA 2AWOA 4A3CH 3G6EA 2JA5H 5IY0A 5GQOA 4X64Q 4C3JH 4A3EH 4JYAQ 3H15A 5IYBG 1VQ8A 1MIUA 1H95A 1OTCA 4B3MQ 1VQ6A 2HIXA 4DKAC 5M3MH 5IYCH 4X64L 1YITA 2E2JH 4LUZA 1Q46A 2JJQA 1N9WA 4DV0Q 5JJKA 3ULJA 4JYAL 3HKZE 3CMAA 4C2MH 3CW2C 5JJIA 5IE8A 4B3ML 2Z0SA 4B3SL 1OXTA 3G4SA 3I4NG 4DV0L 5EAYA 4JOIA 3ULPA 1Y1VG 4P74A 5C4JH 4NXMQ 3Q8DA 4R4CA 3RN5A 3PIPA 3S17H 2OTJA 1KRTA 4HJ7A 4YCVA 1AE2A 2JE6I 1VQHA 2VZAA 2VQFQ 1I50H 4BXXG 5IYDH 3PUZA 1NE3A 3KF8B 4KHZA 4NXML 3CD6A 3UE1A 2KBNA 4KI0A 1A62A 4APVA 4GNXB 1HNZQ 2R92H 2E2IH 2N49A 4GOPA 4A3DG 5JEAJ 4BY7H 2HQLA 1MJEA 4R4QA 1UE5A 4AYBG 4P71A 4A76A 1HNZL 1UEBA 4PZ8A 4DV5Q 1UE7A 3HOYH 2K5HA 3J80c 1T9HA 1PH5A 1QVCA 3I4MH 1EFWA 4BBRG 3CCUA 2OQKA 1VQ7A 3S1MH 3GTMH 3GTOH 4NXNL 2B63H 1G291 3TRZA 2NVYH 2IY5B 3CMEA 3RLOA 1QVFA 3H0GH 5C4XG 1NY4A 2B3GA 4UP9A 3K7UC 1VQ5A 4A4IA 4IJLA 1LTLA 3E0EA 4HIDA 4L5TA 2CKZB 1SMXA 4MTNA 1WI5A 3S24A 5E7NA 2Q2UA 1R9TH 3D0FA 4OWWB 2JK8A 3NENA 3GTQH 1PFSA 1C7YA 3S1QH 2R93H 4GLVB 2UUBQ 2ASBA 1VQCA 2BA0A 2WAQG 3S14H 1JJGA 4XIGS 5LMNW 3U50C 5C44G 5LMNQ 3HKZG 4QJFA 5AJ3Q 1I94Q 4L5SA 5IWAL 4Y52H 3T1YQ 2PI2E 2UUBL 4IFDJ 4HIOA 4JI4L 2PI2A 4PMWA 2RHQB 4DR1Q 4BY1H 1RL2A 3S2HH 5AJ3L 1FJGQ 4DV7Q 5M3MG 3KOJA 5IYCG 1HJPA 3RN2A 1YEZA 1U0LA 3CXCA 4B3RQ 1HZBA 1O7IA 4POFA 4DR3L 1WYDA 4KLKA 1CKNA 4DR1L 1FJGL 4DV7L 2ZTDA 1C9OA 4DR5Q 4LF6Q 1BBWA 2AWNA 1Q81C 1P16A 4DUYQ 4DK3C 3BZKA 3K7AH 4YHHQ 4TVAB 1XPOA 5J3BA 4HIKA 4DR5L 1PH8A 4LF6L 5BR8Q 2ES2A 3HOWG 2DGYA 4DUYL 4A93H 2CWPA 5GAHC 3HOUH 1GD7A 3ER0A 3K81C 3NELA 4GN5A 5C0XG 2QEXA 1M1KC 1QUQB 1KL9A 1U5KA 5BR8L 3WWVA 3W1GA 1NTGA 4OO1I 2YV5A 1SN8A 4BY7G 2I0QA 2VW9A 2VUMH 3PF5A 4OXPA 1XPUA 3CCRA 3F2DA 1VQDA 1DGSA 4GN4B 1TXYA 1K83H 1B8AA 1PH9A 2F52A 3CC4A 4OO1G 2A19A 4BA1I 1VQNA 5LMUQ 4IO9A 2JEAI 3CCQA 5M3FH 4JOIC 4JBMA 4A3GG 3A0JA 3FHWA 4R4TA 1VQLA 4JBKA 4LW1A 2B63G 2HT1A 1FGUA 4X65Q 5LMUL 1G6PA 3GTKH 4K0KQ 3E9HA 4DR4L 1YVCA 4L5RC 4X65L 5GROA 2UU9Q 2K14A 4K0KL 4GOPC 4IOAA 3PSIA 4JCVE 4A3IH 2EIFA 1YHBA 2R93G 1AH9A 2N8NA 5FLMG 2UU9L 3RZDH 4AYBE 1ASYA 4DR6Q 3J80i 1NBWA 3J81c 4LNQA 3CC2A 2IHFA 1GO3E 1K73C 4IOCA 3G71A 1PH6A 3HOVG 3KLWA 4IFDI 1L1OB 1E1TA 4DR6L 1K3RA 5M5XH 1YJWA 4A3BG 1VQAA 4A3MH 1IL2A 3CPFA 4IFDG 1N36Q 2JA9A 5M5WH 2MNAA 1XJVA 1E22A 2PMZE 4RG1A 1X56A 3CP0A 1GKHA 1N8RC 4POGA 3PO2G 4BBSH 1WFQA 4LUVA 4LFCQ 3GTPH 1WCMH 4JG2A 1N36L 2F4VQ 2BH8A 3BJUA 1CKNB 2WFWA 1PVOA 4WJ4A 2QA4A 2D0PA 3CCEA 4LFCL 4LUOA 2NZOA 2F4VL 1IXRA 2N78A 3U4ZA 4B3SQ 3HOUG 4DR2L 2WAQE 3F1ZA 2GVAA 4AIMA 2RHSB 1VQBA 4DAYB 3S15H 2Q2TA 4QIWE 3PO3G 1L2FA 4IPHA 1S40A 3U58A 4X6AH 1VQFA 3RNUA 1HNXL 4YWMA 3OW2A 2C35B 1I3QH 3EBEA 1PH1A 1Y1WG 3HOZG 4LF8Q 5HGQA 2KCMA 1IBLQ 4JV5Q 3PF4A 1VQOA 1TWGH 1LYLA 1VQ9A 2R7ZH 1QUQA 2VNUD 1A0IA 4LF8L 2IT1A 1IBLL 1CKOA 4JV5L 4GKJQ 1JT8A 3KJPA 3MXNB 4RMFA 2JQOA 3KJOA 2ZTCA 4Y7NH 4A3KG 4GKJL 3L7ZC 1W3SA 4UY8C 4A3JH 4NXNQ 4DV1Q 3CCMA 4DNIA 2RCNA 5GAGC 4AH6A 4JI0Q 1CKMA 1A8VA 1XMOQ 1EOVA 3KF6B 3L0OA 1VS0A 4DV1L 1MKHA 4KHPQ 2JA6G 1S3OA 4GNXC 4JI0L 4IPCA 4QQBX 1XMOL 2Z6KA 3MEFA 1PH7A 1VQGA 1EIYB 3NBHB 4KHPL 4O0AA 1UE6A 4EQ5A 2NVQH 3GTJH 1OXSC 1S72A 1VQJA 2CWAA 5IP7G 4BBSG 3M9BA 5IWAQ 1V43A 3S16H 4JI4Q 1JJCB 1L1OA 4A3CG 3DM3A 5IP9H 2JA5G 1IYJB 2DUDA 4YWKA 4JBJA 3LGJA 3RLNA 3K80C 4A3EG 3M4PA 3CPWA 4DR3Q 2JA7H 4DPGA 4PG3A 4UP7A 4OX9L 3J81i 1PH2A 1LUZA 2UUAQ 2KENA 1YJ9A 2JA8H 4DAMA 2WP8J 4GS3A 1IZ6A 1J5EL 2UUAL 1XNRQ 2VY3A 1E24A 4YY3L 4OONA 4LF5Q 1I6HH 1N32L 2EQSA 4B3TQ 2K5VA 3PIOA 1XNRL 1RIPA 3EIVA 3PUYA 5C3EH 3UDGA 4LF5L 4LF7Q 4B3TL 3KDFA 5M5YH 2R7ZG 5IYDG 3W5OA 3NEMA 3KYHC 4BA2I 2I5LX 1X54A 1YNXA 4JI5Q 4LF7L 1X3EA 5FJ8H 2R92G 4A3LG 3UE0A 1JMCA 4MNOA 1D8LA 2UUCL 1HZCA 5K36G 2HIVA 4JI5L 3RR5A 3A5UA 4NPSA 3HOYG 5JEAG 1HZ9A 3VDYA 5ELOA 3I4MG 1W2BA 2IX1A 1K8GA 4DR4Q 3TS0A 5IYBH 1SROA 1OXVA 1KHIA 3JC66 3H0GG 4DUZQ 2ID0A 1I5FA 2YTYA 4DUZL 3KF6A 1HH2P 3I56A 1X9NA 3U4VA 1EUJA 2MFIA 4XTCS 2YTVA 1KAWA 4P75A 3AFQA 1PYSB 2XGTA 1Q12A 4BXXH 3J7ZC 1HZAA 4X66L 2CCZA 1VQMA 1G51A 2IHEA 4BY1G 4UP8A 2E5LQ 4OWXB 3CF5A 2YU9H 4A3DH 3UDFA 1VCIA 4O2DA 3OTOL 2UXDQ 1JB7A 1KQSA 1FL0A 1E3PA 2QGQA 4EX5A 2E5LL 4AQYQ 1PA6A 3AYHB 1PH4A 2HHHL 3GTGH 2NVXH 1VQ4A 2UXDL 1E7ZA 2F3IA 2E8GA 4DR2Q 4GN3B 3J81j 3T1HQ 1SFOH 3M85A 1YBYA 4AQYL 2ATWA 1PV4A 3GTLH 1L1OC 4A93G 2KHJA 2Q2IA 1E1OA 1HNXQ 2ZM6L 3T1HL 3TS2A 1TWCH 2UXCQ 1OXXK 4HJ8A 2VQEQ 4R1JA 3KDFB 4HJ9A 5FJ8G 2KCTA 1VQEA 4MZ9A 4QY7A 2CQOA 3TQYA 2UXCL 2VS1A 2VUMG 2VQEL 1L0WA 1KXLA 4JC0A 3HOXH 1SLJA 2ZJPA 3I4OA 3CAMA 2K75A 2V1CC 4YWLA 1YI2A 4PZ6A 5C44H 1FVIA 1MJCA 2D0OA 2ZTEA 3A5ZB 4YCWA 5M3FG 2A1AA 4DV6Q 3G48A 3PUWA 2WB1G 4LWCA 2YTXA 1PH3A 3JAMc 3H3VH 3J7A5 1X65A 2D62A 1QZGA 2NN6I 1TWHH 3ZJYC 4DV6L 1Y14B 3M4OH 1QZHA 2A8VA 1GVPA 1X3GA 3AFPA 3GDEA 1YJNA 1M90C 2NN6G 4TQUS 1V1QA 3DLLA 3CCSA 4DV2Q 1ASZA 4X62Q 1Q86C 1VQKA 4DK6C 4A3IG 2RF4A 3B6YA 4A3FH 1XMQQ 5C0XJ 3S2DH 3PUXA 4DR7Q 3HOWH 1Z47A 4DV2L 4X62L 5GADC 1XNQQ 1XMQL 1EIFA 2AMCB 4DR7L 1X3FA 3OYYA 3TREA 1Q1BA 4A3MG 4JBWA 2VQFL 4GLXA 1BKBA 1XNQL 3AEVA 3CCLA 1UWVA 3M7NA 1CSPA 1Z9FA 2H5XA 3UDIA 5H1SE 4A3LH 1HNWQ 1PYBA 1WCMG 1XPRA 1Q8KA 4LFAQ 4OX9Q 3STBC 1EWIA 4IPGA 5GAEC 4DV5L 2Y0SE 1N33Q 3RZOH 1GM5A 2R7DA 4A3GH 1HNWL 3S1NH 4LFAL 1BBUA 4DV4Q 3RLFA 1J5EQ 2AKWB 4YY3Q 2NZHA 1N33L 1N32Q 3CC7A 1X6OA 1KD1C 2GVBA 4JI6Q 2I5HA 3E9IA 4DV4L 4HIMA 2E2HH 1C0AA 4A75A 1OXUA 2NVTH 1A63A 3ULLA 2Q2HA 3F2CA 2PQAA 4JI6L 3CCVA 1YHAA 3HOXG 1Q7YC 3I55A 2ZJRA 5FLMH 1JJ2A 2XTIA 4QGUA 3FKIH 3H3VI 4JI2Q 3HOVH 2UUCQ 3PGZA 1WOCA 4UPAA 1LM0A 2K50A 3BU2A 1P8LA 2PNHA 4A3BH 5LMNL 4C3HH 4JI2L 4R4IA 1SR3A 1I94L 4LF9Q 2FXQA 4HJ5A 3TEHB 5HY6A 1KIXA 3T1YL 4LF4Q 2OCEA 1K8AC 3PO2H 1Q1EA 4C3IH 4JI7Q 3GD7A 3KFUA 4LF9L 4A3JG 1XTDA 4LF4L 2GN5A 3GO5A 2EXDA 1IBMQ 4B3RL 3W1BA 5IT9c 4JI7L 2KHIA 4A3FG 2OWOA 5C0XI 1NMFA 5JJLA 1D7QA 4DV3Q 1KC8C 1IBML 2LSSA 4R4OA 3BZCA 3PV0A 2BH2A 3UDXA 1B7YB 2AHOB 3F8TA 4FDBA 4YHHL 3ICEA 2ALYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 H;  2LXK A;  5DLQ E;  2R7F A;  1VQI A;  2K4K A;  1SRU A;  2IX0 A;  3JAM i;  2WB1 E;  4JI3 Q;  3M3Y H;  2Y0S G;  1KRS A;  3I4N H;  4JI1 Q;  1X55 A;  4J15 A;  3I2Z A;  4GOP B;  1Y1W H;  3HOZ H;  1Y1V H;  4L5Q A;  4X66 Q;  2B29 A;  2R6G A;  4JI3 L;  3L2P A;  2N3S A;  1V9P A;  3SGI A;  5IP9 G;  1EYG A;  1AE3 A;  4GKK Q;  4PZ7 A;  2MO0 A;  4JI1 L;  4GNX A;  3M4Q A;  3IRB A;  1QVG A;  2VL6 A;  4P73 A;  3AQQ A;  3OTO Q;  2JA7 G;  1SE8 A;  2LXJ A;  4GKK L;  2K5N A;  2BA1 A;  2MO1 A;  3HFZ B;  3PUV A;  4HJA A;  1B70 B;  2HHH Q;  3A74 A;  2JA8 G;  4P72 A;  1J6Q A;  3STB D;  4A3K H;  2JEB I;  2I5M X;  1HR0 W;  4WJ3 M;  2Z6K C;  1HR0 Q;  2UXB Q;  1K9M C;  1EQR A;  2ZJQ A;  1IBK Q;  4QL5 A;  1JE5 A;  1BVS A;  3FP9 A;  4BBR H;  1UE1 A;  4ALP A;  1YHQ A;  3ERS X;  2MQH A;  4H02 A;  5ELN A;  2ZM6 Q;  4JI8 Q;  1PHJ A;  1HR0 L;  3EN2 A;  1NMG A;  1CUK A;  1YZ6 A;  2K52 A;  2UXB L;  2PQA B;  4ME3 A;  5C3E G;  2YYZ A;  3FKI G;  3F2B A;  1EQQ A;  1N34 Q;  1IBK L;  2OTL A;  1Q82 C;  4LFB Q;  2CFM A;  3PCO B;  4YCU A;  2OQ0 A;  4DV3 L;  1K0R A;  1TWF H;  3K0X A;  4JI8 L;  4NB3 A;  5C4X H;  2JA6 H;  4OWT B;  5FLX c;  1N34 L;  3K8A A;  1YIJ A;  4LFB L;  1CSQ A;  3CQZ H;  1TWA H;  1WJJ A;  1VQP A;  3I7F A;  4IPD A;  3S1R H;  3CCJ A;  5IP7 H;  4GLA C;  3D31 A;  3HKS A;  1NJI C;  2L15 A;  4IJH A;  2AWO A;  4A3C H;  3G6E A;  2JA5 H;  5IY0 A;  5GQO A;  4X64 Q;  4C3J H;  4A3E H;  4JYA Q;  3H15 A;  5IYB G;  1VQ8 A;  1MIU A;  1H95 A;  1OTC A;  4B3M Q;  1VQ6 A;  2HIX A;  4DKA C;  5M3M H;  5IYC H;  4X64 L;  1YIT A;  2E2J H;  4LUZ A;  1Q46 A;  2JJQ A;  1N9W A;  4DV0 Q;  5JJK A;  3ULJ A;  4JYA L;  3HKZ E;  3CMA A;  4C2M H;  3CW2 C;  5JJI A;  5IE8 A;  4B3M L;  2Z0S A;  4B3S L;  1OXT A;  3G4S A;  3I4N G;  4DV0 L;  5EAY A;  4JOI A;  3ULP A;  1Y1V G;  4P74 A;  5C4J H;  4NXM Q;  3Q8D A;  4R4C A;  3RN5 A;  3PIP A;  3S17 H;  2OTJ A;  1KRT A;  4HJ7 A;  4YCV A;  1AE2 A;  2JE6 I;  1VQH A;  2VZA A;  2VQF Q;  1I50 H;  4BXX G;  5IYD H;  3PUZ A;  1NE3 A;  3KF8 B;  4KHZ A;  4NXM L;  3CD6 A;  3UE1 A;  2KBN A;  4KI0 A;  1A62 A;  4APV A;  4GNX B;  1HNZ Q;  2R92 H;  2E2I H;  2N49 A;  4GOP A;  4A3D G;  5JEA J;  4BY7 H;  2HQL A;  1MJE A;  4R4Q A;  1UE5 A;  4AYB G;  4P71 A;  4A76 A;  1HNZ L;  1UEB A;  4PZ8 A;  4DV5 Q;  1UE7 A;  3HOY H;  2K5H A;  3J80 c;  1T9H A;  1PH5 A;  1QVC A;  3I4M H;  1EFW A;  4BBR G;  3CCU A;  2OQK A;  1VQ7 A;  3S1M H;  3GTM H;  3GTO H;  4NXN L;  2B63 H;  1G29 1;  3TRZ A;  2NVY H;  2IY5 B;  3CME A;  3RLO A;  1QVF A;  3H0G H;  5C4X G;  1NY4 A;  2B3G A;  4UP9 A;  3K7U C;  1VQ5 A;  4A4I A;  4IJL A;  1LTL A;  3E0E A;  4HID A;  4L5T A;  2CKZ B;  1SMX A;  4MTN A;  1WI5 A;  3S24 A;  5E7N A;  2Q2U A;  1R9T H;  3D0F A;  4OWW B;  2JK8 A;  3NEN A;  3GTQ H;  1PFS A;  1C7Y A;  3S1Q H;  2R93 H;  4GLV B;  2UUB Q;  2ASB A;  1VQC A;  2BA0 A;  2WAQ G;  3S14 H;  1JJG A;  4XIG S;  5LMN W;  3U50 C;  5C44 G;  5LMN Q;  3HKZ G;  4QJF A;  5AJ3 Q;  1I94 Q;  4L5S A;  5IWA L;  4Y52 H;  3T1Y Q;  2PI2 E;  2UUB L;  4IFD J;  4HIO A;  4JI4 L;  2PI2 A;  4PMW A;  2RHQ B;  4DR1 Q;  4BY1 H;  1RL2 A;  3S2H H;  5AJ3 L;  1FJG Q;  4DV7 Q;  5M3M G;  3KOJ A;  5IYC G;  1HJP A;  3RN2 A;  1YEZ A;  1U0L A;  3CXC A;  4B3R Q;  1HZB A;  1O7I A;  4POF A;  4DR3 L;  1WYD A;  4KLK A;  1CKN A;  4DR1 L;  1FJG L;  4DV7 L;  2ZTD A;  1C9O A;  4DR5 Q;  4LF6 Q;  1BBW A;  2AWN A;  1Q81 C;  1P16 A;  4DUY Q;  4DK3 C;  3BZK A;  3K7A H;  4YHH Q;  4TVA B;  1XPO A;  5J3B A;  4HIK A;  4DR5 L;  1PH8 A;  4LF6 L;  5BR8 Q;  2ES2 A;  3HOW G;  2DGY A;  4DUY L;  4A93 H;  2CWP A;  5GAH C;  3HOU H;  1GD7 A;  3ER0 A;  3K81 C;  3NEL A;  4GN5 A;  5C0X G;  2QEX A;  1M1K C;  1QUQ B;  1KL9 A;  1U5K A;  5BR8 L;  3WWV A;  3W1G A;  1NTG A;  4OO1 I;  2YV5 A;  1SN8 A;  4BY7 G;  2I0Q A;  2VW9 A;  2VUM H;  3PF5 A;  4OXP A;  1XPU A;  3CCR A;  3F2D A;  1VQD A;  1DGS A;  4GN4 B;  1TXY A;  1K83 H;  1B8A A;  1PH9 A;  2F52 A;  3CC4 A;  4OO1 G;  2A19 A;  4BA1 I;  1VQN A;  5LMU Q;  4IO9 A;  2JEA I;  3CCQ A;  5M3F H;  4JOI C;  4JBM A;  4A3G G;  3A0J A;  3FHW A;  4R4T A;  1VQL A;  4JBK A;  4LW1 A;  2B63 G;  2HT1 A;  1FGU A;  4X65 Q;  5LMU L;  1G6P A;  3GTK H;  4K0K Q;  3E9H A;  4DR4 L;  1YVC A;  4L5R C;  4X65 L;  5GRO A;  2UU9 Q;  2K14 A;  4K0K L;  4GOP C;  4IOA A;  3PSI A;  4JCV E;  4A3I H;  2EIF A;  1YHB A;  2R93 G;  1AH9 A;  2N8N A;  5FLM G;  2UU9 L;  3RZD H;  4AYB E;  1ASY A;  4DR6 Q;  3J80 i;  1NBW A;  3J81 c;  4LNQ A;  3CC2 A;  2IHF A;  1GO3 E;  1K73 C;  4IOC A;  3G71 A;  1PH6 A;  3HOV G;  3KLW A;  4IFD I;  1L1O B;  1E1T A;  4DR6 L;  1K3R A;  5M5X H;  1YJW A;  4A3B G;  1VQA A;  4A3M H;  1IL2 A;  3CPF A;  4IFD G;  1N36 Q;  2JA9 A;  5M5W H;  2MNA A;  1XJV A;  1E22 A;  2PMZ E;  4RG1 A;  1X56 A;  3CP0 A;  1GKH A;  1N8R C;  4POG A;  3PO2 G;  4BBS H;  1WFQ A;  4LUV A;  4LFC Q;  3GTP H;  1WCM H;  4JG2 A;  1N36 L;  2F4V Q;  2BH8 A;  3BJU A;  1CKN B;  2WFW A;  1PVO A;  4WJ4 A;  2QA4 A;  2D0P A;  3CCE A;  4LFC L;  4LUO A;  2NZO A;  2F4V L;  1IXR A;  2N78 A;  3U4Z A;  4B3S Q;  3HOU G;  4DR2 L;  2WAQ E;  3F1Z A;  2GVA A;  4AIM A;  2RHS B;  1VQB A;  4DAY B;  3S15 H;  2Q2T A;  4QIW E;  3PO3 G;  1L2F A;  4IPH A;  1S40 A;  3U58 A;  4X6A H;  1VQF A;  3RNU A;  1HNX L;  4YWM A;  3OW2 A;  2C35 B;  1I3Q H;  3EBE A;  1PH1 A;  1Y1W G;  3HOZ G;  4LF8 Q;  5HGQ A;  2KCM A;  1IBL Q;  4JV5 Q;  3PF4 A;  1VQO A;  1TWG H;  1LYL A;  1VQ9 A;  2R7Z H;  1QUQ A;  2VNU D;  1A0I A;  4LF8 L;  2IT1 A;  1IBL L;  1CKO A;  4JV5 L;  4GKJ Q;  1JT8 A;  3KJP A;  3MXN B;  4RMF A;  2JQO A;  3KJO A;  2ZTC A;  4Y7N H;  4A3K G;  4GKJ L;  3L7Z C;  1W3S A;  4UY8 C;  4A3J H;  4NXN Q;  4DV1 Q;  3CCM A;  4DNI A;  2RCN A;  5GAG C;  4AH6 A;  4JI0 Q;  1CKM A;  1A8V A;  1XMO Q;  1EOV A;  3KF6 B;  3L0O A;  1VS0 A;  4DV1 L;  1MKH A;  4KHP Q;  2JA6 G;  1S3O A;  4GNX C;  4JI0 L;  4IPC A;  4QQB X;  1XMO L;  2Z6K A;  3MEF A;  1PH7 A;  1VQG A;  1EIY B;  3NBH B;  4KHP L;  4O0A A;  1UE6 A;  4EQ5 A;  2NVQ H;  3GTJ H;  1OXS C;  1S72 A;  1VQJ A;  2CWA A;  5IP7 G;  4BBS G;  3M9B A;  5IWA Q;  1V43 A;  3S16 H;  4JI4 Q;  1JJC B;  1L1O A;  4A3C G;  3DM3 A;  5IP9 H;  2JA5 G;  1IYJ B;  2DUD A;  4YWK A;  4JBJ A;  3LGJ A;  3RLN A;  3K80 C;  4A3E G;  3M4P A;  3CPW A;  4DR3 Q;  2JA7 H;  4DPG A;  4PG3 A;  4UP7 A;  4OX9 L;  3J81 i;  1PH2 A;  1LUZ A;  2UUA Q;  2KEN A;  1YJ9 A;  2JA8 H;  4DAM A;  2WP8 J;  4GS3 A;  1IZ6 A;  1J5E L;  2UUA L;  1XNR Q;  2VY3 A;  1E24 A;  4YY3 L;  4OON A;  4LF5 Q;  1I6H H;  1N32 L;  2EQS A;  4B3T Q;  2K5V A;  3PIO A;  1XNR L;  1RIP A;  3EIV A;  3PUY A;  5C3E H;  3UDG A;  4LF5 L;  4LF7 Q;  4B3T L;  3KDF A;  5M5Y H;  2R7Z G;  5IYD G;  3W5O A;  3NEM A;  3KYH C;  4BA2 I;  2I5L X;  1X54 A;  1YNX A;  4JI5 Q;  4LF7 L;  1X3E A;  5FJ8 H;  2R92 G;  4A3L G;  3UE0 A;  1JMC A;  4MNO A;  1D8L A;  2UUC L;  1HZC A;  5K36 G;  2HIV A;  4JI5 L;  3RR5 A;  3A5U A;  4NPS A;  3HOY G;  5JEA G;  1HZ9 A;  3VDY A;  5ELO A;  3I4M G;  1W2B A;  2IX1 A;  1K8G A;  4DR4 Q;  3TS0 A;  5IYB H;  1SRO A;  1OXV A;  1KHI A;  3JC6 6;  3H0G G;  4DUZ Q;  2ID0 A;  1I5F A;  2YTY A;  4DUZ L;  3KF6 A;  1HH2 P;  3I56 A;  1X9N A;  3U4V A;  1EUJ A;  2MFI A;  4XTC S;  2YTV A;  1KAW A;  4P75 A;  3AFQ A;  1PYS B;  2XGT A;  1Q12 A;  4BXX H;  3J7Z C;  1HZA A;  4X66 L;  2CCZ A;  1VQM A;  1G51 A;  2IHE A;  4BY1 G;  4UP8 A;  2E5L Q;  4OWX B;  3CF5 A;  2YU9 H;  4A3D H;  3UDF A;  1VCI A;  4O2D A;  3OTO L;  2UXD Q;  1JB7 A;  1KQS A;  1FL0 A;  1E3P A;  2QGQ A;  4EX5 A;  2E5L L;  4AQY Q;  1PA6 A;  3AYH B;  1PH4 A;  2HHH L;  3GTG H;  2NVX H;  1VQ4 A;  2UXD L;  1E7Z A;  2F3I A;  2E8G A;  4DR2 Q;  4GN3 B;  3J81 j;  3T1H Q;  1SFO H;  3M85 A;  1YBY A;  4AQY L;  2ATW A;  1PV4 A;  3GTL H;  1L1O C;  4A93 G;  2KHJ A;  2Q2I A;  1E1O A;  1HNX Q;  2ZM6 L;  3T1H L;  3TS2 A;  1TWC H;  2UXC Q;  1OXX K;  4HJ8 A;  2VQE Q;  4R1J A;  3KDF B;  4HJ9 A;  5FJ8 G;  2KCT A;  1VQE A;  4MZ9 A;  4QY7 A;  2CQO A;  3TQY A;  2UXC L;  2VS1 A;  2VUM G;  2VQE L;  1L0W A;  1KXL A;  4JC0 A;  3HOX H;  1SLJ A;  2ZJP A;  3I4O A;  3CAM A;  2K75 A;  2V1C C;  4YWL A;  1YI2 A;  4PZ6 A;  5C44 H;  1FVI A;  1MJC A;  2D0O A;  2ZTE A;  3A5Z B;  4YCW A;  5M3F G;  2A1A A;  4DV6 Q;  3G48 A;  3PUW A;  2WB1 G;  4LWC A;  2YTX A;  1PH3 A;  3JAM c;  3H3V H;  3J7A 5;  1X65 A;  2D62 A;  1QZG A;  2NN6 I;  1TWH H;  3ZJY C;  4DV6 L;  1Y14 B;  3M4O H;  1QZH A;  2A8V A;  1GVP A;  1X3G A;  3AFP A;  3GDE A;  1YJN A;  1M90 C;  2NN6 G;  4TQU S;  1V1Q A;  3DLL A;  3CCS A;  4DV2 Q;  1ASZ A;  4X62 Q;  1Q86 C;  1VQK A;  4DK6 C;  4A3I G;  2RF4 A;  3B6Y A;  4A3F H;  1XMQ Q;  5C0X J;  3S2D H;  3PUX A;  4DR7 Q;  3HOW H;  1Z47 A;  4DV2 L;  4X62 L;  5GAD C;  1XNQ Q;  1XMQ L;  1EIF A;  2AMC B;  4DR7 L;  1X3F A;  3OYY A;  3TRE A;  1Q1B A;  4A3M G;  4JBW A;  2VQF L;  4GLX A;  1BKB A;  1XNQ L;  3AEV A;  3CCL A;  1UWV A;  3M7N A;  1CSP A;  1Z9F A;  2H5X A;  3UDI A;  5H1S E;  4A3L H;  1HNW Q;  1PYB A;  1WCM G;  1XPR A;  1Q8K A;  4LFA Q;  4OX9 Q;  3STB C;  1EWI A;  4IPG A;  5GAE C;  4DV5 L;  2Y0S E;  1N33 Q;  3RZO H;  1GM5 A;  2R7D A;  4A3G H;  1HNW L;  3S1N H;  4LFA L;  1BBU A;  4DV4 Q;  3RLF A;  1J5E Q;  2AKW B;  4YY3 Q;  2NZH A;  1N33 L;  1N32 Q;  3CC7 A;  1X6O A;  1KD1 C;  2GVB A;  4JI6 Q;  2I5H A;  3E9I A;  4DV4 L;  4HIM A;  2E2H H;  1C0A A;  4A75 A;  1OXU A;  2NVT H;  1A63 A;  3ULL A;  2Q2H A;  3F2C A;  2PQA A;  4JI6 L;  3CCV A;  1YHA A;  3HOX G;  1Q7Y C;  3I55 A;  2ZJR A;  5FLM H;  1JJ2 A;  2XTI A;  4QGU A;  3FKI H;  3H3V I;  4JI2 Q;  3HOV H;  2UUC Q;  3PGZ A;  1WOC A;  4UPA A;  1LM0 A;  2K50 A;  3BU2 A;  1P8L A;  2PNH A;  4A3B H;  5LMN L;  4C3H H;  4JI2 L;  4R4I A;  1SR3 A;  1I94 L;  4LF9 Q;  2FXQ A;  4HJ5 A;  3TEH B;  5HY6 A;  1KIX A;  3T1Y L;  4LF4 Q;  2OCE A;  1K8A C;  3PO2 H;  1Q1E A;  4C3I H;  4JI7 Q;  3GD7 A;  3KFU A;  4LF9 L;  4A3J G;  1XTD A;  4LF4 L;  2GN5 A;  3GO5 A;  2EXD A;  1IBM Q;  4B3R L;  3W1B A;  5IT9 c;  4JI7 L;  2KHI A;  4A3F G;  2OWO A;  5C0X I;  1NMF A;  5JJL A;  1D7Q A;  4DV3 Q;  1KC8 C;  1IBM L;  2LSS A;  4R4O A;  3BZC A;  3PV0 A;  2BH2 A;  3UDX A;  1B7Y B;  2AHO B;  3F8T A;  4FDB A;  4YHH L;  3ICE A;  2ALY B; 
#chains in the Genus database with same CATH topology
 5DLQ E;  2R7F A;  3JAM i;  4JI3 Q;  1SRU A;  4ZCK A;  1KRS A;  1PZK D;  3I4M B;  1O78 A;  1Y1W H;  3OMC A;  1ILQ A;  2R6G A;  1V9P A;  1D2B A;  3C3L A;  1CHQ D;  2J0T D;  4PZ7 A;  3HGB A;  3OTO Q;  1SE8 A;  2ENB A;  2LXJ A;  3EFX D;  1HHV A;  2K5N A;  1TY0 A;  1EWC A;  3A74 A;  3GTJ B;  4KV6 A;  4P72 A;  5FO9 B;  4A3K H;  1LO5 D;  2KCC A;  1BVS A;  1UE1 A;  4ALP A;  2ZM6 Q;  1EFI D;  3EN2 A;  1NMG A;  2K52 A;  1A6X A;  2PQA B;  4ME3 A;  2OTL A;  1EIG A;  3F2B A;  4QMG A;  1HTP A;  2CFM A;  3PCO B;  3S2H B;  3BDL A;  4J1M A;  2K03 A;  3X3M A;  3K0X A;  2SEB D;  1YIJ A;  3BYT B;  1NJI C;  1F2L A;  4IJH A;  1GUS A;  1O7L A;  2B8F A;  3A55 A;  3ERO A;  3FMC A;  5IY0 A;  1TVX A;  4U68 A;  4X64 Q;  4JYA Q;  4H13 C;  3H15 A;  1MIU A;  4QUC A;  1VQ6 A;  4DKA C;  4KTA A;  2E2J H;  1Q46 A;  2RDH A;  4DV0 Q;  3ULJ A;  1YNN D;  4B3M L;  2NB0 A;  3K57 A;  3G4S A;  2M00 A;  3I4N G;  5EAY A;  4JOI A;  1Y1V G;  2WB1 B;  1ZYR D;  3NHH A;  1F9R A;  2JE6 I;  5E4W C;  3D6C A;  4GNX B;  4KI0 A;  2R92 H;  2N49 A;  5I2Y A;  1MJE A;  1UE5 A;  5K36 H;  4A76 A;  1HNZ L;  4PZ8 A;  5JEA H;  3I72 A;  3I4M H;  1EFW A;  4BBR G;  4HCS A;  3OHX C;  2B63 H;  4Q0F A;  3RLO A;  3J80 L;  1PFM A;  1BXT A;  4JPB W;  2YU9 B;  4A4I A;  4L5T A;  2CKZ B;  3S24 A;  3NXW A;  2Q2U A;  1R9T H;  3IKJ A;  3IAY A;  2NVX B;  2JK8 A;  1WTV A;  1C7Y A;  2R93 H;  4GLV B;  2ASB A;  2BA0 A;  4DNR B;  5ELD A;  4RKB A;  3GTL B;  4L5S A;  3VR6 A;  1I94 Q;  4K6L A;  2B2U C;  4IFD J;  4HIO A;  4JI4 L;  2RHQ B;  3S2H H;  4DV7 Q;  3OMG A;  3RN2 A;  1RCV D;  4POF A;  2XN9 C;  4DR1 L;  3BVZ A;  3HOX B;  4HCE A;  4ZUJ A;  1UAP A;  1C9O A;  2ZTD A;  4X3T A;  4DR5 Q;  2AWN A;  5C5L A;  2TMP A;  3HKZ B;  3K7A H;  4YHH Q;  1QG7 A;  4LF6 L;  1XX8 A;  1PH8 A;  3HOW G;  5BR8 Q;  2PNR C;  3D4R A;  1TWH B;  5C0X G;  2QEX A;  1KTK A;  3KBG A;  5KND A;  1U5K A;  5CV4 A;  4BY7 G;  1SN8 A;  2I0Q A;  3CCR A;  4F7X A;  5JOB A;  4I65 A;  4A3F B;  3SK5 A;  1B8A A;  1QJO A;  4ZAI A;  2A19 A;  1S5C D;  1VQN A;  5M3F H;  4JBM A;  4JOI C;  3ND9 A;  2HT1 A;  1IW7 D;  4DR4 L;  4L5R C;  2K14 A;  1ZKO A;  1DOL A;  2L11 A;  3I70 A;  5EKI A;  4ABN A;  1GUO A;  4JCV E;  5EQ0 A;  2EIF A;  1YHB A;  1BCP C;  3SR1 A;  2UU9 L;  4AYB E;  1SE3 A;  3J81 c;  1YNJ D;  4LNQ A;  1OO9 B;  2QCP X;  1PH6 A;  2HDM A;  2PYK A;  4A3B G;  3TN2 A;  4C3H G;  2RVL A;  1BBX C;  2F0V A;  1BNZ A;  1N36 Q;  4IFD G;  3SVM A;  2PMZ E;  3VYT A;  1DXM A;  2NZ1 D;  3A54 A;  4R8I A;  3R8B A;  3H09 A;  3GTP H;  5FLX E;  2HCI A;  2XRS D;  2SDF A;  2QDB A;  4DAP A;  4LUO A;  2F4V L;  3HOU G;  1F9Q A;  2WAQ E;  2GVA A;  2BDO A;  5KEE A;  5ELB A;  1VQB A;  4DAY B;  3S15 H;  4QIW E;  5DM7 3;  1L2F A;  4UAI A;  3U58 A;  4X6A H;  1VQF A;  2L1B A;  3OW7 A;  4XQN A;  3RNU A;  2EYO A;  1I3Q H;  1JWU D;  3QOL A;  3JAM E;  1Y8O B;  1IBL Q;  2F0U A;  3TP7 A;  1VQO A;  1LYL A;  1VQ9 A;  2EZV A;  3MXG A;  2VNU D;  2IX3 A;  2F0D A;  4GKJ Q;  2F0I A;  1L0X B;  1Y8N B;  1XXG A;  3I4N B;  2JQO A;  5DNF A;  2ZTC A;  1PDQ A;  4KKU A;  2DY7 A;  3DWQ A;  1Y1V B;  3VR5 A;  2ZXP A;  3PMF A;  4NXN Q;  2L9H A;  3CCM A;  1A3U A;  1K28 A;  4DNI A;  5GAG C;  1WD1 A;  1A2U A;  4JI0 Q;  1STE A;  2K33 A;  3MWY W;  2EJM A;  3L0O A;  2ICE C;  2EJG C;  4G4K A;  4ME5 A;  2Z6K A;  4PMC A;  3T56 B;  1YNJ C;  3T51 B;  1Q3L A;  4CDC C;  4O0A A;  1UE6 A;  2BOS A;  2NVQ H;  1TS2 A;  4C56 C;  4H44 C;  2CWA A;  4BBR B;  4BBS G;  5IWA Q;  2B8G A;  1V43 A;  3S16 H;  1L1O A;  2BCO A;  2LFN A;  3DM3 A;  2DUD A;  2B2V A;  1I4X A;  3LGJ A;  4KN4 C;  2MGS A;  1GJX A;  4IAL A;  4DR3 Q;  4EVO A;  3J81 i;  1PH2 A;  3CQZ B;  2SNS A;  1TWA B;  4CJ0 B;  3M4Y A;  1PFB A;  3S1R B;  3W3A A;  3TP8 A;  2XRQ D;  1PTO B;  1E24 A;  1I6H H;  2AQ2 B;  4WFN 3;  4B3T Q;  2K5V A;  3PIO A;  5J39 A;  4A3E B;  3PUY A;  3UDG A;  1GUG A;  1SYF A;  5M5Y H;  5IYD G;  1X54 A;  4JI5 Q;  3T13 A;  5KIX A;  3UE0 A;  4MNO A;  3VDY A;  5CGK A;  1CT1 D;  1U4P A;  5ELO A;  1RDP D;  3HOW B;  3NPP A;  3S17 B;  1I4Q A;  1SXT A;  5D14 A;  3MXN A;  3H0G G;  1HA6 A;  4BY7 B;  3U9O A;  2PZT A;  3EVQ A;  1I5F A;  2KJX A;  4DUZ L;  1VMP A;  1CFM A;  1EYD A;  2XNA C;  3U4V A;  4XTC S;  2YTV A;  4P75 A;  1PYS B;  2XGT A;  1Q12 A;  3FEW X;  3NBH A;  2CCZ A;  4OEM B;  5FO8 B;  3OWE B;  5KNB A;  1AZQ A;  3OTO L;  2UXD Q;  4UDU C;  3K6O A;  1JB7 A;  2F1M A;  5JVG 3;  1EY8 A;  1QIL A;  3A7L A;  2E8G A;  3BZD B;  3J81 j;  2PO4 A;  3M85 A;  4AQY L;  2JSO A;  4A3B B;  1L1O C;  1ILP A;  4BY1 B;  2Q2I A;  2EYF A;  2ZM6 L;  5JPM C;  3T1H L;  2B2V C;  3N52 A;  1OXX K;  2VQE Q;  2NUC A;  2KCT A;  1GOZ A;  2A6H D;  3G7L A;  2KUM A;  2VUM G;  1L0W A;  2ZJP A;  2IW3 A;  4GZY C;  3CAM A;  1I6V C;  1Z6H A;  2K75 A;  4MN3 A;  4YWL A;  4ZYS A;  1YI2 A;  1BR9 A;  2ZTE A;  3HOU B;  4DV6 Q;  3PUW A;  4BS9 A;  3HZX A;  1PH3 A;  2L0C A;  2D62 A;  4IUQ A;  3ZJY C;  1STG A;  1F77 A;  3M4O H;  4K8J A;  3AFP A;  1YJN A;  3GDE A;  1M90 C;  1V1Q A;  1VQK A;  4A3I G;  4FXD A;  3S9W A;  1XMQ Q;  4OL7 A;  3S2D H;  4DR7 Q;  3HOW H;  4DV2 L;  4HN7 A;  1PTO F;  4X62 L;  5GAD C;  1UUP A;  3GTK B;  5C0X H;  4ZQ3 A;  3PQI A;  4B9W A;  2LKV A;  1X3F A;  4A3M G;  1Q1B A;  1S5D D;  4ZKB B;  3BYY B;  1H9J A;  1KAA A;  4ZLT F;  4N8F A;  3HG9 A;  3M7N A;  4WJW A;  1LT6 D;  4X3K A;  1BOS A;  1Q8K A;  4OX9 Q;  3STB C;  1EWI A;  4IPG A;  5GAE C;  1GUT A;  1GM5 A;  2HD3 A;  1ML0 D;  4LFA L;  1EYA A;  1J5E Q;  2NZH A;  1SDF A;  2EOT A;  1N32 Q;  1KD1 C;  4JI6 Q;  2I5H A;  3E9I A;  4HIM A;  4BBS B;  1MGS A;  1M8A A;  1OXU A;  4ZKC B;  4DXG A;  1PMR A;  3MZ5 A;  2A6H C;  3EJI A;  3MFG A;  2ZJR A;  5IIF A;  3ZYY X;  1U4R A;  1BUV T;  2GA4 B;  1P8L A;  4A3B H;  4C3H H;  1SR3 A;  1JE4 A;  1I94 L;  3NTK A;  1KIX A;  4LF4 Q;  4JI7 Q;  2FMC A;  3KFU A;  1NCV A;  4LF9 L;  4A3J G;  2EXD A;  1I4R A;  1TWG B;  3SK6 A;  4CHT B;  4K5X A;  1NMF A;  5CC4 A;  5C0X I;  4DV3 Q;  2OWO A;  2F0M A;  2LSS A;  3PV0 A;  3UDX A;  2E2I B;  3ICE A;  4YHH L;  4LK1 C;  5I6W A;  2F0G A;  4K2K A;  1IYU A;  2F0O A;  2IX0 A;  3KK7 A;  4JI1 Q;  1X55 A;  3FPU B;  4X66 Q;  3GTM B;  3SGI A;  1BCP B;  3KF8 A;  2NVY B;  4GKK Q;  1QVG A;  3H0G B;  3AQQ A;  3NQT A;  4KKT A;  2FIN B;  4MTK A;  1QOH A;  2BA1 A;  2MO1 A;  1Q8I A;  3HFZ B;  4Q5V A;  2Y0S B;  2CHB D;  2D9U A;  4WJ3 M;  3J81 E;  4K2L A;  2J4X A;  1PHJ A;  4RCO A;  3ERS X;  4H02 A;  5ELN A;  4JI8 Q;  1SJE D;  1HR0 L;  2EXZ A;  2UXB L;  2KOL A;  5C3E G;  1QB5 D;  2YYZ A;  3FKI G;  4TKO B;  1IBK L;  4LFB Q;  4DU9 A;  1X3Q A;  3CRK C;  5FLX c;  1N34 L;  1CSQ A;  4IPD A;  3VYR A;  3CCJ A;  4GLA C;  2AWO A;  1S5F D;  2E75 C;  4HSP A;  1IL8 A;  1F2Y A;  3N6R A;  4FF1 A;  2G9D A;  2MJ8 A;  5EPK A;  1PTO D;  5IYB G;  2QW7 A;  1H95 A;  1M4V A;  2HIX A;  5IYC H;  1YIT A;  1ONL A;  1EY9 A;  4LUZ A;  1E0B A;  5ELE A;  5JJK A;  2DNE A;  3CMA A;  3CW2 C;  2Z4I A;  5IE8 A;  1OXT A;  5TSS A;  2O2L D;  3A7A B;  4P74 A;  4E6I A;  5C4J H;  4R4C A;  1JB3 A;  3RN5 A;  3PIP A;  1SYD A;  1KRT A;  2KEC A;  4RCN A;  4YCV A;  2VQF Q;  5IYD H;  4NXM L;  3QOJ A;  4ODG A;  1A62 A;  5E1F A;  2E2I H;  3MXU A;  4N8X 1;  4P71 A;  5EBC A;  1CQV A;  4TRD A;  2K5H A;  1T9H A;  1PH5 A;  1QVC A;  1HCZ A;  3CCU A;  1B4O A;  3GTM H;  3GTO H;  4NXN L;  2NVY H;  5IOD A;  1QVF A;  3H0G H;  4A3D B;  5C4X G;  1NY4 A;  4L63 B;  2B3G A;  2K28 A;  3K7U C;  1VQ5 A;  3EA6 A;  4IJL A;  1LTL A;  2ZXO A;  5E7N A;  4OWW B;  3NEN A;  5IT9 L;  3S14 H;  5C44 G;  3SHL A;  2PMZ B;  3HKZ G;  5AJ3 Q;  5IWA L;  3T1Y Q;  5J1Z A;  2UUB L;  4DA2 A;  2QKI C;  1BCP F;  5M3M G;  1HJP A;  1NSN S;  4XT1 B;  4DR3 L;  1WYD A;  1CKN A;  4ZK9 B;  1FJG L;  1VF5 C;  1JOO A;  1Q81 C;  4DUY Q;  1H9S A;  4DK3 C;  5J3B A;  5KGU A;  3RD4 A;  2CH4 W;  4K5W A;  1GD7 A;  3ER0 A;  3NEL A;  1DYQ A;  4A3J B;  2VW9 A;  2VUM H;  3F2D A;  2K04 A;  1K83 H;  4OO1 G;  1J8I A;  5LMU Q;  4IO9 A;  2JEA I;  3CCQ A;  4A3G G;  3A0J A;  4R4T A;  1RTO A;  2F0F A;  2QDL A;  4X65 Q;  4K8I A;  1JOR A;  2L55 A;  3QWN A;  1E2W A;  4ULL A;  5ISR A;  4K0K L;  3NP8 A;  3PSI A;  4A3I H;  1R4P B;  5FLM G;  3RZD H;  1ASY A;  4FF3 A;  1NBW A;  4EQO A;  1GXD C;  3G71 A;  4RGN A;  1L1O B;  4DR6 L;  2KA7 A;  1K3R A;  5M5X H;  3MVV A;  1PZI D;  1IL2 A;  4A3M H;  2EPB A;  1VF7 A;  5M5W H;  2MNA A;  4RG1 A;  3ND8 A;  5BN3 A;  5J22 A;  4LFC Q;  5C3E B;  3FKI B;  4WJ4 A;  1RD9 D;  2F0Q A;  1PVO A;  3K5L A;  2QA4 A;  3U4Z A;  3Q6S A;  4B3S Q;  4CDF C;  5I6Y A;  3F1Z A;  4AIM A;  1UEA B;  1HPC A;  1TS3 A;  1ET9 A;  3PO3 G;  2O5I C;  4LF8 Q;  4MIU A;  3DWA A;  1DCZ A;  4JV5 Q;  1QUQ A;  1XTC D;  4K6D A;  2E74 C;  1JT8 A;  3MXN B;  1PXU A;  4RMF A;  5L37 A;  3KJO A;  4Y7N H;  2A69 C;  1SYG A;  4UY8 C;  4A3J H;  4DV1 Q;  4OHJ A;  5C3X A;  3NSW A;  1CKM A;  1XMO Q;  1EOV A;  2EY2 A;  1RTN A;  4DK0 A;  1IKL A;  2N55 A;  1GUW A;  1KNE A;  4KHP Q;  1JOQ A;  2KED A;  3HEJ A;  1EIY B;  1BCP D;  1EZ8 A;  3NBH B;  4B9X A;  4EQ5 A;  3GTJ H;  1QNK A;  1VQJ A;  3CRL C;  1BF4 A;  2K1B A;  3M9B A;  1SFO B;  2MUY A;  2XWJ B;  3P7J A;  3BVG A;  2L4N A;  1TWF B;  4C3J G;  3OOC A;  4A3E G;  3M4P A;  2JA6 B;  5C4X B;  5EKL A;  4OX9 L;  2UUA Q;  4JK1 C;  4G7O C;  3RUZ A;  1YJ9 A;  2ZXR A;  3W2D A;  1XNR Q;  1J5E L;  2VY3 A;  1LTA D;  4OON A;  5KYL A;  4LF5 Q;  1N32 L;  2EQS A;  3KLS X;  1NUC A;  5C44 B;  2JA5 B;  5FK9 C;  1RIP A;  5C3E H;  3D4W A;  3P75 A;  3DXJ C;  2R7Z G;  1DON A;  2HUG A;  5M3M B;  2I5L X;  4LF7 L;  1YNX A;  1JMC A;  1D8L A;  1G2T A;  2HIV A;  2H1E A;  3RR5 A;  5CBE E;  1U4M A;  1B9M A;  2I07 B;  1K8M A;  1W2B A;  3V2T A;  1K8G A;  1KDC A;  3I4L A;  1W6J A;  5IYB H;  1SRO A;  1OXV A;  4XDX A;  2ID0 A;  3HOY B;  1CA5 A;  2YTY A;  1LT3 D;  2EDG A;  3KF6 A;  1WTR A;  3RZO B;  2MFI A;  4A3G B;  2CW0 C;  3S1N B;  1WTX A;  5BN5 A;  3AFQ A;  1CI3 M;  3SXH A;  4X66 L;  1VQM A;  1G51 A;  3A8J E;  4BY1 G;  4J6H A;  1SSO A;  2K6A A;  4OWX B;  3CF5 A;  1ENA A;  2YU9 H;  1B44 D;  2C9O A;  1VCI A;  1FGB D;  2E5L L;  1EOT A;  2BE5 D;  2NVX H;  1SFO H;  4DR2 Q;  1A3V A;  4GN3 B;  1STB A;  4CBV A;  1PV4 A;  3GTL H;  1JCK B;  1D5Z C;  2ICI A;  5D3D A;  1EIH A;  4R1J A;  3KDF B;  3TZU A;  5FJ8 G;  1B50 A;  4MZ9 A;  1VQE A;  4ZUI A;  4QY7 A;  2CQO A;  3DWP A;  2SOB A;  5EGT A;  2UXC L;  4EQP A;  1KXL A;  4OIJ A;  4JC0 A;  4OEL B;  3H6M A;  3HOX H;  3I4O A;  2V1C C;  3E0J A;  2QEJ C;  1KLU D;  5AFW A;  5C44 H;  3LX0 A;  2X6L A;  2A1A A;  3X3N A;  2E76 C;  3PO3 B;  3J7A 5;  3M3Y B;  1X65 A;  3R3O A;  1TWH H;  1PRT B;  5CV5 A;  4CKE A;  1SAP A;  2NN6 G;  3JAM L;  4CKB A;  1C48 A;  1Q86 C;  4DK6 C;  2RF4 A;  4A3F H;  3PUX A;  1EY6 A;  2AUK A;  1HTL D;  5C5M A;  1EIF A;  1Q90 A;  4JBW A;  2F0W A;  2VQF L;  4RAU C;  5IGC A;  1XNQ L;  3CCL A;  3BDO A;  5E3F A;  2H5X A;  1HNW Q;  2EYJ A;  1PYB A;  3OWF A;  1WCM G;  3A8K E;  1H9M A;  3HRZ C;  1N33 Q;  3RZO H;  2NWG A;  2R7D A;  4A3G H;  3S1N H;  4DV4 Q;  1BO0 A;  2BE5 C;  4QF4 A;  1SEB D;  3U9S A;  1JR0 D;  3K5N A;  1U9R A;  2PPB C;  1EY4 A;  3SE0 A;  2F0N A;  1AP0 A;  3BS1 A;  4A75 A;  1A63 A;  2Q2H A;  3F2C A;  2PQA A;  4R8N A;  3V96 A;  1YHA A;  1Q7Y C;  4C3J B;  5FLM H;  4QGU A;  4JI2 Q;  4RHS A;  2KEE A;  2UUC Q;  4UPA A;  2K50 A;  2A5H A;  4C2M B;  4R4I A;  5T1I A;  3T1Y L;  4FVM A;  3MAQ A;  1Q1E A;  2CH4 A;  1LV9 A;  1I4P A;  3NUC A;  4QB4 A;  1WTW A;  1IBM Q;  4DF7 A;  2R7Z B;  5IT9 c;  4KY7 A;  1FR3 A;  2B2W A;  4RA8 A;  3WOE A;  1D7Q A;  1HA5 A;  4KD4 A;  1KC8 C;  1SYE A;  1STN A;  3BZC A;  4FDB A;  3F2U A;  1JIC A;  2ALY B;  5NUC A;  5K5P A;  3PO3 H;  3M3Y H;  1VQI A;  4NW2 A;  1SE2 A;  2WB1 E;  5EPJ A;  2Y0S G;  1HRJ A;  5CYU A;  3I4N H;  4A3L G;  1Y1V H;  4L5Q A;  3S1M B;  2B29 A;  4JI3 L;  1JC7 A;  1U4L A;  3AU7 A;  5IP9 G;  1AE3 A;  5IGG A;  4GNX A;  4IUP A;  3IRB A;  4P73 A;  4B08 A;  3D4D A;  1FNU A;  3PUV A;  5C4Z A;  1B70 B;  4XYQ A;  2JA8 G;  1B9N A;  1J6Q A;  3STB D;  4EQN A;  2JEB I;  3GTQ B;  2Z6K C;  3S1Q B;  1EQR A;  4IN3 A;  1YHQ A;  4BBR H;  2MQH A;  3CKI B;  1PRT F;  1SBB B;  5IGB A;  2Q8T A;  1EQQ A;  3L9A X;  3I91 A;  1Q82 C;  4YCU A;  2OQ0 A;  1K0R A;  4OWT B;  1MI2 A;  3CQZ H;  1TWA H;  1HQR D;  4RGO S;  3S1R H;  4NP5 A;  2HDL A;  4HED A;  3HKS A;  1PTO H;  2FFK B;  5GQO A;  1O7Y A;  4C3J H;  4A3E H;  1WVL A;  2K7V A;  1H9S B;  1I4G A;  2DJF C;  3D8G A;  1OTC A;  4B3M Q;  2QIL A;  4X64 L;  5JPN C;  1N9W A;  3IFT A;  4JYA L;  2Z9H A;  3HKZ E;  3C1F A;  4C2M H;  5JJI A;  4B3S L;  3K0Y A;  4DV0 L;  4K14 A;  1Z7T A;  3J7A V;  1LTB D;  3ITP A;  3NK9 A;  1S5E D;  3Q8D A;  1G8Z D;  3S17 H;  2OTJ A;  2Z6B A;  1AE2 A;  3Q22 A;  1VQH A;  2F3V A;  4KD3 A;  4BXX G;  4KHZ A;  3KUP A;  1HNZ Q;  2KBN A;  1JWS D;  2L12 A;  1V1O A;  4GOP A;  4A3D G;  5JEA J;  4BY7 H;  4R4Q A;  3SDZ A;  4AYB G;  3Q0A A;  1UEB A;  1UE7 A;  3J80 c;  4RWS C;  4DXF A;  4FNF A;  1A15 A;  3S1M H;  1EY5 A;  1G29 1;  5C6A A;  4LAA A;  3TRZ A;  3FPP A;  3CME A;  1ESF A;  4MTN A;  1WCM B;  3GTG B;  3D0F A;  3GTQ H;  1D1K A;  3S1Q H;  4F8M A;  2WAQ G;  1JJG A;  5LMN W;  3U50 C;  5LMN Q;  4Y52 H;  1ZEQ X;  3VA5 A;  2PI2 E;  3URY A;  2PI2 A;  1DOM A;  4ILW A;  4DR1 Q;  1RL2 A;  3DEO A;  4BY1 H;  5JAV A;  3KOJ A;  4IFD H;  1YEZ A;  4NMZ A;  4OGQ C;  4XQQ A;  4CGY B;  2O5J C;  3HOZ H;  4DV7 L;  4LF6 Q;  4HSV A;  1BBW A;  3BZK A;  1XPO A;  1V8Q A;  1SNM A;  4DR5 L;  5DM6 3;  4YIJ A;  2ES2 A;  3Q24 A;  1KLG D;  2DGY A;  3HOU H;  4C1N I;  3K81 C;  1M1K C;  2F0E A;  4RKL A;  4RH6 A;  2F0L A;  2D5D A;  1QUQ B;  1KL9 A;  5BR8 L;  3WWV A;  3FVQ A;  3W1G A;  5JVH 3;  1GHK A;  5F2D A;  2XWB B;  3PF5 A;  1DJR D;  3SEB A;  4OXP A;  1WTO A;  1VQD A;  4GN4 B;  1PH9 A;  3MHB A;  3CC4 A;  1SYC A;  4BA1 I;  4IUU A;  1PRT D;  4M1U B;  4N9P A;  3FHW A;  3UI2 A;  4LW1 A;  2B63 G;  1B1Z A;  1FGU A;  1A3T A;  3GTK H;  1NAP A;  5D3I B;  2Z8L A;  3LWU A;  4FXK C;  5GRO A;  2UU9 Q;  2NN6 H;  4GOP C;  2WKD A;  4FYD A;  2OXP A;  2R93 G;  1O80 A;  3K5O A;  3J80 i;  3CC2 A;  2IHF A;  1K73 C;  3KLS A;  4IOC A;  3HOV G;  1TS4 A;  4IFD I;  1E1T A;  2JA8 B;  4ZRZ A;  2RDG A;  1VQA A;  5LL6 X;  1T5X D;  1PLF A;  3CPF A;  3VR4 A;  4G57 A;  3J81 L;  1X56 A;  3CP0 A;  4BBS H;  4HMI A;  4C3I G;  1WCM H;  4JG2 A;  5IOC A;  1LT5 D;  2BH8 A;  1N36 L;  2F4V Q;  1AZP A;  2WFW A;  4EGV A;  2D0P A;  3TP6 A;  1IXR A;  2N78 A;  4DR2 L;  1CHP D;  3QJY A;  1S40 A;  4YWM A;  2C35 B;  2RSO A;  3EBE A;  1PH1 A;  3HOZ G;  4JW0 A;  5HGQ A;  1D6E C;  1TWG H;  3P1H A;  3VYU A;  2P5Z X;  1K0S A;  2K5Q A;  2IT1 A;  1IBL L;  2J7Z A;  1PRT C;  4DFA A;  3HP3 A;  1V1P A;  4LMQ D;  4GKJ L;  3L7Z C;  1Y1W B;  1W3S A;  2KHS A;  1UNS A;  3TME A;  1G91 A;  2V4D A;  4RHR A;  1A8V A;  3KF6 B;  2LY7 A;  1EU3 A;  3DUZ A;  2JP1 A;  2JA6 G;  4JI0 L;  2FMM A;  4IPC A;  2EYM A;  4AYB B;  1FNW A;  3MEF A;  4A3K B;  1PH7 A;  3MXP A;  5E4X A;  1EY0 A;  1XWE A;  5IP7 G;  3TZD A;  3C2P A;  2OT2 A;  1TQO A;  3NTH A;  1ZXT A;  1JJC B;  4A3C G;  5IP9 H;  2JA5 G;  1LTS D;  1IYJ B;  3BG3 A;  4OIK A;  1SMY C;  3K80 C;  1TWC B;  3K5M A;  2B39 A;  3NTI A;  4PG3 A;  4NKL A;  3GV6 A;  2JA8 H;  3VYS A;  3PIO 3;  1EQV A;  1IZ6 A;  1VMC A;  2EYL A;  2WAQ B;  2F03 A;  2NTS A;  2RCF A;  3MA2 B;  4QIW B;  4TSS A;  5A2Q E;  3EIV A;  1DZ1 A;  4B3T L;  2F0P A;  4KHV A;  1F2Z A;  3W5O A;  5BN4 A;  2E2J B;  4BA2 I;  1B53 A;  1DOK A;  5EJW A;  5IT9 E;  2UUC L;  2WKC A;  1HZC A;  5T1G A;  3K58 A;  4JI5 L;  3A5U A;  3HOY G;  1JOK A;  1RKN A;  1HZ9 A;  5LHY 1;  5COY A;  2KCN A;  1SNQ A;  2HQE A;  2K05 A;  3D6W A;  2IX1 A;  3TS0 A;  2WAC A;  2A69 D;  3NBI A;  1KHI A;  3JC6 6;  4DUZ Q;  3WOF A;  5LL6 S;  1W6K A;  2Z4H A;  4O42 A;  2K5D A;  1HH2 P;  1BDO A;  3I56 A;  1X9N A;  2FHT A;  3RMH A;  1KAW A;  2B63 B;  4FO2 A;  4BXX H;  2A73 B;  1HZA A;  1QNU A;  1TKW B;  2H4O A;  1S4Z A;  5KYI A;  1DD2 A;  4A3D H;  5CV9 A;  2NVT B;  3I90 A;  1R9T B;  4RFB A;  1KQS A;  3A8I E;  4QCL A;  1E3P A;  2R93 B;  5HGT A;  4AQY Q;  1PA6 A;  1VQ4 A;  2B2U A;  5CV6 A;  2UXD L;  3NWS A;  2F3I A;  3HOV B;  3T1H Q;  1RJT A;  2MPM A;  2OEO A;  3I8Z A;  3KBX A;  2ATW A;  4A93 G;  3J7A F;  1R4Q B;  4C1N K;  1HNX Q;  5CV7 A;  1TWC H;  1II3 A;  4CJ2 C;  4HJ9 A;  1LTT D;  2IJ0 A;  4C3I B;  2R3Z A;  4L8J A;  4FF2 A;  2VQE L;  3K7A B;  3P20 A;  3MFY A;  4PZ6 A;  1FVI A;  1MJC A;  3A5Z B;  1C4Q A;  2A6E C;  1LTI D;  4LWC A;  2YTX A;  2E2D C;  3NWT A;  2G9H D;  1QZG A;  4DV6 L;  3HOZ B;  4TQU S;  3DLL A;  4XYO A;  5M9O A;  4DV2 Q;  1ASZ A;  4X62 Q;  3B6Y A;  1E2V A;  5M3F B;  3LNN A;  5C0X J;  4PV1 C;  4O1N A;  1XMQ L;  3J80 E;  2AMC B;  4DR7 L;  3TRE A;  3OYY A;  2CW0 D;  3MEH A;  2LMC B;  1XPR A;  3NE5 B;  4LFA Q;  1S5B D;  2MP1 A;  2PCF B;  2RDF A;  2Y0S E;  1KDA A;  2XIW A;  3QR8 A;  4U67 3;  1BBU A;  2A68 D;  3GQB A;  4YY3 Q;  1CK1 A;  2GVB A;  5EBD A;  3E3X A;  2NVT H;  1X3P A;  1CZW A;  3GTP B;  3ULL A;  2RA4 A;  4JI6 L;  3CCV A;  3FKI H;  4KKS A;  3HOV H;  2PZU A;  4IZ8 A;  3PGZ A;  1LM0 A;  2PNH A;  2F0H A;  1IHZ A;  3S15 B;  5LMN L;  3V05 A;  1MSH A;  4LF9 Q;  1FNV A;  2FXQ A;  3TEH B;  1HXY D;  2F4I A;  1I3Q B;  3E5S A;  1K8A C;  4G7Z C;  2K01 A;  4C3I H;  3GD7 A;  2X6G A;  1B2T A;  4LF4 L;  2GN5 A;  3AB9 A;  1SNC A;  3A56 A;  1JQY D;  1YNN C;  5CBA E;  4JI7 L;  2KHI A;  2WIN B;  1I50 B;  3H3V C;  4S3S A;  4N9T A;  2AUJ D;  4R4O A;  2BH2 A;  1LAB A;  3Q23 A;  2AHO B;  3F8T A;  4M8A A;  1LLR D;  4DV3 L;  1ZYR C;  4X3S A;  2LXK A;  2JYO A;  2K4K A;  1KNA A;  1WD0 A;  5COR A;  4J15 A;  3I2Z A;  4GOP B;  1EYC A;  4Z9C B;  1T5E A;  3H91 A;  3WDN A;  3L2P A;  3KLR A;  1E2Z A;  2DJG C;  2N3S A;  3FRP B;  1CA6 A;  2RKS A;  3I3C A;  1EYG A;  3L3O C;  4QUF A;  4JI1 L;  2MO0 A;  1HFG A;  3M4Q A;  2VL6 A;  2QF7 A;  3I73 A;  1IYV A;  3NQI A;  2JA7 G;  3OIQ A;  4GKK L;  4PQX A;  4HJA A;  2HHH Q;  2NVQ B;  3LWE A;  2B2T A;  1ET6 A;  2A68 C;  2I5M X;  1HR0 W;  3AMU A;  1HR0 Q;  2UXB Q;  1K9M C;  4V0B A;  2EY1 A;  3S16 B;  2ZJQ A;  1IBK Q;  4QL5 A;  1JE5 A;  3FP9 A;  3C46 A;  2O4X A;  2RQX A;  5CMD A;  1CUK A;  1YZ6 A;  1F9P A;  1N34 Q;  2Q8I B;  4KK7 A;  1TWF H;  4JI8 L;  5C4X H;  2JA6 H;  4NB3 A;  3IL8 A;  3DMU A;  3K8A A;  4LFB L;  1HUN A;  1EWH A;  1WJJ A;  2IL8 A;  1VQP A;  3I7F A;  1QWY A;  1I6H B;  1TY2 A;  5I4D A;  2VB2 X;  5IP7 H;  3D31 A;  1L0Y B;  2L15 A;  1TR5 A;  5FLX L;  3J7Y W;  4A3C H;  3G6E A;  3R2I A;  2JA5 H;  5C4H A;  4A93 B;  5M5Y B;  5DAU A;  4KMU C;  1VQ8 A;  1EY7 A;  5M3M H;  1D1I A;  2JJQ A;  1B3A A;  3O13 A;  2Z0S A;  3PIP 3;  2F0K A;  1IKM A;  3SK8 A;  3ULP A;  2F0S A;  4NXM Q;  3ERQ A;  4HJ7 A;  2VZA A;  1I50 H;  1HUM A;  3T16 A;  3PUZ A;  1NE3 A;  1PFN A;  3KF8 B;  3CD6 A;  3T4A C;  3UE1 A;  3HS0 C;  4APV A;  5HUR A;  1RHP A;  1WTH A;  2HQL A;  2RSN A;  4DV5 Q;  1IW7 C;  3HOY H;  4I7A A;  2CVR A;  4OO1 H;  1PYW D;  1SND A;  5I2X A;  2OQK A;  4IUR A;  4J8Q A;  1VQ7 A;  2F0T A;  2PQE A;  5DEH A;  2IPK D;  2IY5 B;  1BQQ T;  1NNX A;  4KJN A;  4UHV A;  4UP9 A;  3E0E A;  4HID A;  3DM1 A;  1SMX A;  1WI5 A;  4XQJ A;  1AFP A;  1NR4 A;  1HQM C;  1PFS A;  2B2Y A;  2B2T C;  2UUB Q;  1VQC A;  4DK1 A;  1C8C A;  4XIG S;  4QJF A;  5JJZ A;  2X69 A;  3VA7 A;  4PMW A;  1LAC A;  5AJ3 L;  2BDN A;  1FJG Q;  5IYC G;  1AW7 A;  4B3R Q;  5FO7 B;  1U0L A;  3VR3 A;  3CXC A;  1HZB A;  1O7I A;  2A74 C;  4HMJ A;  4KLK A;  1D5M C;  2DY8 A;  1TII D;  4X3U A;  4KJO A;  1P16 A;  4TVA B;  3OSO A;  4HIK A;  4DGZ A;  1CZG A;  4KY5 A;  5EKK A;  4DUY L;  4A93 H;  2CWP A;  5GAH C;  4GN5 A;  3M4O B;  1ENC A;  1QE6 A;  1NTG A;  4OO1 I;  2YV5 A;  2AQ1 B;  5KNC A;  1XPU A;  3D3R A;  5IGF A;  3TDQ A;  1DGS A;  1TXY A;  1V1P B;  2F52 A;  3S2D B;  2Q8R E;  1KDB A;  4DAV A;  3T53 B;  5IGD A;  1VQL A;  4JBK A;  5LMU L;  1EQT A;  1G6P A;  1Y8P B;  2TSS A;  4K0K Q;  3GV3 A;  3E9H A;  1YVC A;  1DM0 B;  2R61 A;  4X65 L;  2PW7 A;  2DNC A;  2VB3 X;  3M7G A;  4IOA A;  4G7H C;  4XXE A;  1AH9 A;  2N8N A;  4DR6 Q;  2JA7 B;  1GHJ A;  1GO3 E;  5I9P A;  3KLW A;  5KRU A;  1ESR A;  2EYH A;  4MHE A;  1YJW A;  1F9S A;  4L6T B;  5ELF A;  1NR2 A;  2JA9 A;  4BWG B;  1XJV A;  1E22 A;  1SNP A;  1FD7 D;  2HCC A;  1N8R C;  1GKH A;  1GUN A;  2JN4 A;  4XT3 B;  4POG A;  3PO2 G;  1WFQ A;  4LUV A;  2RBM A;  3BJU A;  1CKN B;  5FOB B;  5G3L F;  2Z1C A;  4CKC A;  1B3Q A;  2EY5 A;  2F3W A;  2IWH A;  2B2Y C;  3CCE A;  1TU2 B;  4LFC L;  2NZO A;  4KY6 A;  4CDD C;  2K32 A;  4C3H B;  3VR2 A;  4LJZ C;  4RGM A;  1EL0 A;  1ROD A;  1ENF A;  2RHS B;  3OIP A;  4JVZ A;  2Q2T A;  4IPH A;  1H9R A;  1HNX L;  1EEI D;  3OW2 A;  1K3B C;  1Y1W G;  1STH A;  5EPL A;  2KCM A;  5A35 A;  2MHV A;  3PF4 A;  2R7Z H;  2XSC A;  1A0I A;  1A2T A;  4LF8 L;  2B2W C;  1CKO A;  4JV5 L;  3IFD A;  3KJP A;  2EY6 A;  1G6Z A;  2I46 A;  4RGT A;  2G5D A;  4A3K G;  3TBI B;  1K8O A;  2C5C A;  1H9K A;  1ICW A;  2EYP A;  2RCN A;  1O7Z A;  4AH6 A;  4IUV A;  1VS0 A;  4DV1 L;  3R2T A;  1MKH A;  1S3O A;  3R93 A;  5I9O A;  4GNX C;  4QQB X;  1XMO L;  1VQG A;  3FDT A;  3EQL C;  4KHP L;  1LT4 D;  1OXS C;  1S72 A;  4JI4 Q;  1STY A;  4DN4 M;  4YWK A;  4JBJ A;  3RLN A;  3E6Z X;  1EZ6 A;  3CPW A;  2CQA A;  2JA7 H;  4DPG A;  1WTP A;  4UP7 A;  1LUZ A;  2VXW A;  2D2C C;  2KEN A;  2NTT A;  3CU7 A;  4V19 0;  2M9V A;  1X32 A;  1STA A;  4DAM A;  2WP8 J;  4GS3 A;  2UUA L;  4YY3 L;  2EVB A;  3DHQ A;  4R9W A;  1XNR L;  4LF7 Q;  4LF5 L;  4DAY A;  3KDF A;  4HAE A;  3MTS A;  3NEM A;  3KYH C;  1X3E A;  5FJ8 H;  2R92 G;  2K5W A;  2F0J A;  4H7B A;  3BDC A;  5K36 G;  4NPS A;  5JEA G;  5C4J B;  3I4M G;  3OPO A;  1D5X C;  2EE1 A;  3TSS A;  2ZT9 C;  3GP7 A;  4DR4 Q;  4I7Z C;  4FXG C;  2XVS A;  1CM9 A;  4DNT B;  1TS5 A;  1MSG A;  4HTH A;  4ID6 A;  3QIA A;  1QCB D;  1EUJ A;  2DN8 A;  3GTO B;  5G3L D;  3J7Z C;  3QG1 A;  1SYB A;  1VDZ A;  3MC0 B;  2IHE A;  4UP8 A;  4PNY A;  1XYI A;  2E5L Q;  1EEF D;  2E2H B;  5CV8 A;  4FP5 D;  1KAB A;  5C3W A;  3UDF A;  4O2D A;  1SMY D;  1FL0 A;  1AEX A;  2LS0 1;  2N88 A;  2QGQ A;  4WOR A;  4EX5 A;  3GTG H;  2AQ3 B;  3AYH B;  1PH4 A;  2HHH L;  3S14 B;  1E7Z A;  5FKA C;  1YBY A;  2KHJ A;  1E1O A;  2UXC Q;  4HJ8 A;  3QO2 A;  1I4H A;  3PO2 B;  2M2L A;  2NYZ D;  3QB3 A;  3TQY A;  5CR3 A;  2VS1 A;  4KN7 C;  1F2M A;  1SLJ A;  4CDE C;  1CQF A;  4IUN A;  2D0O A;  4YCW A;  3H94 A;  5M3F G;  3G48 A;  2FJ2 A;  2WB1 G;  3BVM A;  3H3V H;  3JAM c;  1JWM D;  1LTG D;  2NN6 I;  1Y14 B;  2VUM B;  1QZH A;  2A8V A;  1J9O A;  1GVP A;  4FF4 A;  1X3G A;  1K83 B;  3CCS A;  3C1E A;  5IGE A;  2JXM B;  3DEP A;  2PW5 A;  1Z47 A;  1MHW C;  4F87 A;  1XNQ Q;  4H0L C;  1RF2 D;  4GLX A;  1BKB A;  1CTM A;  4F88 A;  3AEV A;  1UWV A;  3CHB D;  1CSP A;  1Z9F A;  5H1S E;  3UDI A;  4A3I B;  4A3L H;  1HFN A;  1AN8 A;  2KVM A;  1LTR D;  5D65 A;  3RZD B;  2L5T A;  4DV5 L;  1HNW L;  2KQ3 A;  5M5X B;  3RLF A;  4A3M B;  2AKW B;  1N33 L;  2WV6 D;  5M5W B;  1Y69 U;  3CC7 A;  1X6O A;  4K5V A;  4DV4 L;  2E2H H;  1C0A A;  1FYC A;  2SNM A;  1SE4 A;  2NBF A;  3HOX G;  3I55 A;  2PZW A;  1SNO A;  1JJ2 A;  4IUT A;  2XTI A;  4WRD A;  3K59 A;  1MD2 D;  3H3V I;  3G6J B;  4CJ1 B;  1WOC A;  2OF1 A;  3BU2 A;  4IQZ A;  4JI2 L;  1PZJ D;  1TT2 A;  3TS2 A;  4HJ5 A;  5HY6 A;  4P2C B;  2OCE A;  3ONA B;  3PO2 H;  1PTO C;  1SJH D;  4NDX A;  2WII B;  4HR7 B;  2A6E D;  1XTD A;  4B3R L;  3GO5 A;  3W1B A;  5A2Q L;  4A3F G;  1G2S A;  3SK4 A;  5JJL A;  4PMB A;  1MBY A;  2R92 B;  1IBM L;  1EU4 A;  1ICF B;  1B7Y B;  5ELC A;  1WTQ A;  3TP5 A;  4Y7N B;  2EJF C; 
#chains in the Genus database with same CATH homology
 3PO3 H;  2LXK A;  5DLQ E;  2R7F A;  1VQI A;  2K4K A;  1SRU A;  2IX0 A;  3JAM i;  2WB1 E;  4JI3 Q;  3M3Y H;  2Y0S G;  1KRS A;  3I4N H;  4JI1 Q;  1X55 A;  4J15 A;  3I2Z A;  4GOP B;  1Y1W H;  3HOZ H;  1Y1V H;  4L5Q A;  4X66 Q;  2B29 A;  2R6G A;  4JI3 L;  3L2P A;  2N3S A;  1V9P A;  3SGI A;  5IP9 G;  1EYG A;  1AE3 A;  4GKK Q;  4PZ7 A;  2MO0 A;  4JI1 L;  4GNX A;  3M4Q A;  3IRB A;  1QVG A;  2VL6 A;  4P73 A;  3AQQ A;  3OTO Q;  2JA7 G;  1SE8 A;  2LXJ A;  4GKK L;  2K5N A;  2BA1 A;  2MO1 A;  3HFZ B;  3PUV A;  4HJA A;  1B70 B;  2HHH Q;  3A74 A;  2JA8 G;  4P72 A;  1J6Q A;  3STB D;  4A3K H;  2JEB I;  2I5M X;  1HR0 W;  4WJ3 M;  2Z6K C;  1HR0 Q;  2UXB Q;  1K9M C;  1EQR A;  2ZJQ A;  1IBK Q;  4QL5 A;  1JE5 A;  1BVS A;  3FP9 A;  4BBR H;  1UE1 A;  4ALP A;  1YHQ A;  3ERS X;  2MQH A;  4H02 A;  5ELN A;  2ZM6 Q;  4JI8 Q;  1PHJ A;  1HR0 L;  3EN2 A;  1NMG A;  1CUK A;  1YZ6 A;  2K52 A;  2UXB L;  2PQA B;  4ME3 A;  5C3E G;  2YYZ A;  3FKI G;  3F2B A;  1EQQ A;  1N34 Q;  1IBK L;  2OTL A;  1Q82 C;  4LFB Q;  2CFM A;  3PCO B;  4YCU A;  2OQ0 A;  4DV3 L;  1K0R A;  1TWF H;  3K0X A;  4JI8 L;  4NB3 A;  5C4X H;  2JA6 H;  4OWT B;  5FLX c;  1N34 L;  3K8A A;  1YIJ A;  4LFB L;  1CSQ A;  3CQZ H;  1TWA H;  1WJJ A;  1VQP A;  3I7F A;  4IPD A;  3S1R H;  3CCJ A;  5IP7 H;  4GLA C;  3D31 A;  3HKS A;  1NJI C;  2L15 A;  4IJH A;  2AWO A;  4A3C H;  3G6E A;  2JA5 H;  5IY0 A;  5GQO A;  4X64 Q;  4C3J H;  4A3E H;  4JYA Q;  3H15 A;  5IYB G;  1VQ8 A;  1MIU A;  1H95 A;  1OTC A;  4B3M Q;  1VQ6 A;  2HIX A;  4DKA C;  5M3M H;  5IYC H;  4X64 L;  1YIT A;  2E2J H;  4LUZ A;  1Q46 A;  2JJQ A;  1N9W A;  4DV0 Q;  5JJK A;  3ULJ A;  4JYA L;  3HKZ E;  3CMA A;  4C2M H;  3CW2 C;  5JJI A;  5IE8 A;  4B3M L;  2Z0S A;  4B3S L;  1OXT A;  3G4S A;  3I4N G;  4DV0 L;  5EAY A;  4JOI A;  3ULP A;  1Y1V G;  4P74 A;  5C4J H;  4NXM Q;  3Q8D A;  4R4C A;  3RN5 A;  3PIP A;  3S17 H;  2OTJ A;  1KRT A;  4HJ7 A;  4YCV A;  1AE2 A;  2JE6 I;  1VQH A;  2VZA A;  2VQF Q;  1I50 H;  4BXX G;  5IYD H;  3PUZ A;  1NE3 A;  3KF8 B;  4KHZ A;  4NXM L;  3CD6 A;  3UE1 A;  2KBN A;  4KI0 A;  1A62 A;  4APV A;  4GNX B;  1HNZ Q;  2R92 H;  2E2I H;  2N49 A;  4GOP A;  4A3D G;  5JEA J;  4BY7 H;  2HQL A;  1MJE A;  4R4Q A;  1UE5 A;  4AYB G;  4P71 A;  4A76 A;  1HNZ L;  1UEB A;  4PZ8 A;  4DV5 Q;  1UE7 A;  3HOY H;  2K5H A;  3J80 c;  1T9H A;  1PH5 A;  1QVC A;  3I4M H;  1EFW A;  4BBR G;  3CCU A;  2OQK A;  1VQ7 A;  3S1M H;  3GTM H;  3GTO H;  4NXN L;  2B63 H;  1G29 1;  3TRZ A;  2NVY H;  2IY5 B;  3CME A;  3RLO A;  1QVF A;  3H0G H;  5C4X G;  1NY4 A;  2B3G A;  4UP9 A;  3K7U C;  1VQ5 A;  4A4I A;  4IJL A;  1LTL A;  3E0E A;  4HID A;  4L5T A;  2CKZ B;  1SMX A;  4MTN A;  1WI5 A;  3S24 A;  5E7N A;  2Q2U A;  1R9T H;  3D0F A;  4OWW B;  2JK8 A;  3NEN A;  3GTQ H;  1PFS A;  1C7Y A;  3S1Q H;  2R93 H;  4GLV B;  2UUB Q;  2ASB A;  1VQC A;  2BA0 A;  2WAQ G;  3S14 H;  1JJG A;  4XIG S;  5LMN W;  3U50 C;  5C44 G;  5LMN Q;  3HKZ G;  4QJF A;  5AJ3 Q;  1I94 Q;  4L5S A;  5IWA L;  4Y52 H;  3T1Y Q;  2PI2 E;  2UUB L;  4IFD J;  4HIO A;  4JI4 L;  2PI2 A;  4PMW A;  2RHQ B;  4DR1 Q;  4BY1 H;  1RL2 A;  3S2H H;  5AJ3 L;  1FJG Q;  4DV7 Q;  5M3M G;  3KOJ A;  5IYC G;  1HJP A;  3RN2 A;  1YEZ A;  1U0L A;  3CXC A;  4B3R Q;  1HZB A;  1O7I A;  4POF A;  4DR3 L;  1WYD A;  4KLK A;  1CKN A;  4DR1 L;  1FJG L;  4DV7 L;  2ZTD A;  1C9O A;  4DR5 Q;  4LF6 Q;  1BBW A;  2AWN A;  1Q81 C;  1P16 A;  4DUY Q;  4DK3 C;  3BZK A;  3K7A H;  4YHH Q;  4TVA B;  1XPO A;  5J3B A;  4HIK A;  4DR5 L;  1PH8 A;  4LF6 L;  5BR8 Q;  2ES2 A;  3HOW G;  2DGY A;  4DUY L;  4A93 H;  2CWP A;  5GAH C;  3HOU H;  1GD7 A;  3ER0 A;  3K81 C;  3NEL A;  4GN5 A;  5C0X G;  2QEX A;  1M1K C;  1QUQ B;  1KL9 A;  1U5K A;  5BR8 L;  3WWV A;  3W1G A;  1NTG A;  4OO1 I;  2YV5 A;  1SN8 A;  4BY7 G;  2I0Q A;  2VW9 A;  2VUM H;  3PF5 A;  4OXP A;  1XPU A;  3CCR A;  3F2D A;  1VQD A;  1DGS A;  4GN4 B;  1TXY A;  1K83 H;  1B8A A;  1PH9 A;  2F52 A;  3CC4 A;  4OO1 G;  2A19 A;  4BA1 I;  1VQN A;  5LMU Q;  4IO9 A;  2JEA I;  3CCQ A;  5M3F H;  4JOI C;  4JBM A;  4A3G G;  3A0J A;  3FHW A;  4R4T A;  1VQL A;  4JBK A;  4LW1 A;  2B63 G;  2HT1 A;  1FGU A;  4X65 Q;  5LMU L;  1G6P A;  3GTK H;  4K0K Q;  3E9H A;  4DR4 L;  1YVC A;  4L5R C;  4X65 L;  5GRO A;  2UU9 Q;  2K14 A;  4K0K L;  4GOP C;  4IOA A;  3PSI A;  4JCV E;  4A3I H;  2EIF A;  1YHB A;  2R93 G;  1AH9 A;  2N8N A;  5FLM G;  2UU9 L;  3RZD H;  4AYB E;  1ASY A;  4DR6 Q;  3J80 i;  1NBW A;  3J81 c;  4LNQ A;  3CC2 A;  2IHF A;  1GO3 E;  1K73 C;  4IOC A;  3G71 A;  1PH6 A;  3HOV G;  3KLW A;  4IFD I;  1L1O B;  1E1T A;  4DR6 L;  1K3R A;  5M5X H;  1YJW A;  4A3B G;  1VQA A;  4A3M H;  1IL2 A;  3CPF A;  4IFD G;  1N36 Q;  2JA9 A;  5M5W H;  2MNA A;  1XJV A;  1E22 A;  2PMZ E;  4RG1 A;  1X56 A;  3CP0 A;  1GKH A;  1N8R C;  4POG A;  3PO2 G;  4BBS H;  1WFQ A;  4LUV A;  4LFC Q;  3GTP H;  1WCM H;  4JG2 A;  1N36 L;  2F4V Q;  2BH8 A;  3BJU A;  1CKN B;  2WFW A;  1PVO A;  4WJ4 A;  2QA4 A;  2D0P A;  3CCE A;  4LFC L;  4LUO A;  2NZO A;  2F4V L;  1IXR A;  2N78 A;  3U4Z A;  4B3S Q;  3HOU G;  4DR2 L;  2WAQ E;  3F1Z A;  2GVA A;  4AIM A;  2RHS B;  1VQB A;  4DAY B;  3S15 H;  2Q2T A;  4QIW E;  3PO3 G;  1L2F A;  4IPH A;  1S40 A;  3U58 A;  4X6A H;  1VQF A;  3RNU A;  1HNX L;  4YWM A;  3OW2 A;  2C35 B;  1I3Q H;  3EBE A;  1PH1 A;  1Y1W G;  3HOZ G;  4LF8 Q;  5HGQ A;  2KCM A;  1IBL Q;  4JV5 Q;  3PF4 A;  1VQO A;  1TWG H;  1LYL A;  1VQ9 A;  2R7Z H;  1QUQ A;  2VNU D;  1A0I A;  4LF8 L;  2IT1 A;  1IBL L;  1CKO A;  4JV5 L;  4GKJ Q;  1JT8 A;  3KJP A;  3MXN B;  4RMF A;  2JQO A;  3KJO A;  2ZTC A;  4Y7N H;  4A3K G;  4GKJ L;  3L7Z C;  1W3S A;  4UY8 C;  4A3J H;  4NXN Q;  4DV1 Q;  3CCM A;  4DNI A;  2RCN A;  5GAG C;  4AH6 A;  4JI0 Q;  1CKM A;  1A8V A;  1XMO Q;  1EOV A;  3KF6 B;  3L0O A;  1VS0 A;  4DV1 L;  1MKH A;  4KHP Q;  2JA6 G;  1S3O A;  4GNX C;  4JI0 L;  4IPC A;  4QQB X;  1XMO L;  2Z6K A;  3MEF A;  1PH7 A;  1VQG A;  1EIY B;  3NBH B;  4KHP L;  4O0A A;  1UE6 A;  4EQ5 A;  2NVQ H;  3GTJ H;  1OXS C;  1S72 A;  1VQJ A;  2CWA A;  5IP7 G;  4BBS G;  3M9B A;  5IWA Q;  1V43 A;  3S16 H;  4JI4 Q;  1JJC B;  1L1O A;  4A3C G;  3DM3 A;  5IP9 H;  2JA5 G;  1IYJ B;  2DUD A;  4YWK A;  4JBJ A;  3LGJ A;  3RLN A;  3K80 C;  4A3E G;  3M4P A;  3CPW A;  4DR3 Q;  2JA7 H;  4DPG A;  4PG3 A;  4UP7 A;  4OX9 L;  3J81 i;  1PH2 A;  1LUZ A;  2UUA Q;  2KEN A;  1YJ9 A;  2JA8 H;  4DAM A;  2WP8 J;  4GS3 A;  1IZ6 A;  1J5E L;  2UUA L;  1XNR Q;  2VY3 A;  1E24 A;  4YY3 L;  4OON A;  4LF5 Q;  1I6H H;  1N32 L;  2EQS A;  4B3T Q;  2K5V A;  3PIO A;  1XNR L;  1RIP A;  3EIV A;  3PUY A;  5C3E H;  3UDG A;  4LF5 L;  4LF7 Q;  4B3T L;  3KDF A;  5M5Y H;  2R7Z G;  5IYD G;  3W5O A;  3NEM A;  3KYH C;  4BA2 I;  2I5L X;  1X54 A;  1YNX A;  4JI5 Q;  4LF7 L;  1X3E A;  5FJ8 H;  2R92 G;  4A3L G;  3UE0 A;  1JMC A;  4MNO A;  1D8L A;  2UUC L;  1HZC A;  5K36 G;  2HIV A;  4JI5 L;  3RR5 A;  3A5U A;  4NPS A;  3HOY G;  5JEA G;  1HZ9 A;  3VDY A;  5ELO A;  3I4M G;  1W2B A;  2IX1 A;  1K8G A;  4DR4 Q;  3TS0 A;  5IYB H;  1SRO A;  1OXV A;  1KHI A;  3JC6 6;  3H0G G;  4DUZ Q;  2ID0 A;  1I5F A;  2YTY A;  4DUZ L;  3KF6 A;  1HH2 P;  3I56 A;  1X9N A;  3U4V A;  1EUJ A;  2MFI A;  4XTC S;  2YTV A;  1KAW A;  4P75 A;  3AFQ A;  1PYS B;  2XGT A;  1Q12 A;  4BXX H;  3J7Z C;  1HZA A;  4X66 L;  2CCZ A;  1VQM A;  1G51 A;  2IHE A;  4BY1 G;  4UP8 A;  2E5L Q;  4OWX B;  3CF5 A;  2YU9 H;  4A3D H;  3UDF A;  1VCI A;  4O2D A;  3OTO L;  2UXD Q;  1JB7 A;  1KQS A;  1FL0 A;  1E3P A;  2QGQ A;  4EX5 A;  2E5L L;  4AQY Q;  1PA6 A;  3AYH B;  1PH4 A;  2HHH L;  3GTG H;  2NVX H;  1VQ4 A;  2UXD L;  1E7Z A;  2F3I A;  2E8G A;  4DR2 Q;  4GN3 B;  3J81 j;  3T1H Q;  1SFO H;  3M85 A;  1YBY A;  4AQY L;  2ATW A;  1PV4 A;  3GTL H;  1L1O C;  4A93 G;  2KHJ A;  2Q2I A;  1E1O A;  1HNX Q;  2ZM6 L;  3T1H L;  3TS2 A;  1TWC H;  2UXC Q;  1OXX K;  4HJ8 A;  2VQE Q;  4R1J A;  3KDF B;  4HJ9 A;  5FJ8 G;  2KCT A;  1VQE A;  4MZ9 A;  4QY7 A;  2CQO A;  3TQY A;  2UXC L;  2VS1 A;  2VUM G;  2VQE L;  1L0W A;  1KXL A;  4JC0 A;  3HOX H;  1SLJ A;  2ZJP A;  3I4O A;  3CAM A;  2K75 A;  2V1C C;  4YWL A;  1YI2 A;  4PZ6 A;  5C44 H;  1FVI A;  1MJC A;  2D0O A;  2ZTE A;  3A5Z B;  4YCW A;  5M3F G;  2A1A A;  4DV6 Q;  3G48 A;  3PUW A;  2WB1 G;  4LWC A;  2YTX A;  1PH3 A;  3JAM c;  3H3V H;  3J7A 5;  1X65 A;  2D62 A;  1QZG A;  2NN6 I;  1TWH H;  3ZJY C;  4DV6 L;  1Y14 B;  3M4O H;  1QZH A;  2A8V A;  1GVP A;  1X3G A;  3AFP A;  3GDE A;  1YJN A;  1M90 C;  2NN6 G;  4TQU S;  1V1Q A;  3DLL A;  3CCS A;  4DV2 Q;  1ASZ A;  4X62 Q;  1Q86 C;  1VQK A;  4DK6 C;  4A3I G;  2RF4 A;  3B6Y A;  4A3F H;  1XMQ Q;  5C0X J;  3S2D H;  3PUX A;  4DR7 Q;  3HOW H;  1Z47 A;  4DV2 L;  4X62 L;  5GAD C;  1XNQ Q;  1XMQ L;  1EIF A;  2AMC B;  4DR7 L;  1X3F A;  3OYY A;  3TRE A;  1Q1B A;  4A3M G;  4JBW A;  2VQF L;  4GLX A;  1BKB A;  1XNQ L;  3AEV A;  3CCL A;  1UWV A;  3M7N A;  1CSP A;  1Z9F A;  2H5X A;  3UDI A;  5H1S E;  4A3L H;  1HNW Q;  1PYB A;  1WCM G;  1XPR A;  1Q8K A;  4LFA Q;  4OX9 Q;  3STB C;  1EWI A;  4IPG A;  5GAE C;  4DV5 L;  2Y0S E;  1N33 Q;  3RZO H;  1GM5 A;  2R7D A;  4A3G H;  1HNW L;  3S1N H;  4LFA L;  1BBU A;  4DV4 Q;  3RLF A;  1J5E Q;  2AKW B;  4YY3 Q;  2NZH A;  1N33 L;  1N32 Q;  3CC7 A;  1X6O A;  1KD1 C;  2GVB A;  4JI6 Q;  2I5H A;  3E9I A;  4DV4 L;  4HIM A;  2E2H H;  1C0A A;  4A75 A;  1OXU A;  2NVT H;  1A63 A;  3ULL A;  2Q2H A;  3F2C A;  2PQA A;  4JI6 L;  3CCV A;  1YHA A;  3HOX G;  1Q7Y C;  3I55 A;  2ZJR A;  5FLM H;  1JJ2 A;  2XTI A;  4QGU A;  3FKI H;  3H3V I;  4JI2 Q;  3HOV H;  2UUC Q;  3PGZ A;  1WOC A;  4UPA A;  1LM0 A;  2K50 A;  3BU2 A;  1P8L A;  2PNH A;  4A3B H;  5LMN L;  4C3H H;  4JI2 L;  4R4I A;  1SR3 A;  1I94 L;  4LF9 Q;  2FXQ A;  4HJ5 A;  3TEH B;  5HY6 A;  1KIX A;  3T1Y L;  4LF4 Q;  2OCE A;  1K8A C;  3PO2 H;  1Q1E A;  4C3I H;  4JI7 Q;  3GD7 A;  3KFU A;  4LF9 L;  4A3J G;  1XTD A;  4LF4 L;  2GN5 A;  3GO5 A;  2EXD A;  1IBM Q;  4B3R L;  3W1B A;  5IT9 c;  4JI7 L;  2KHI A;  4A3F G;  2OWO A;  5C0X I;  1NMF A;  5JJL A;  1D7Q A;  4DV3 Q;  1KC8 C;  1IBM L;  2LSS A;  4R4O A;  3BZC A;  3PV0 A;  2BH2 A;  3UDX A;  1B7Y B;  2AHO B;  3F8T A;  4FDB A;  4YHH L;  3ICE A;  2ALY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...