4JV5L

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 12
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jv5L00
3UDGA 3W1GA 4DV7L 4LW1A 1QVGA 2QGQA 4LUVA 3AEVA 4A3EH 1KL9A 1VQMA 4K0KQ 1X3GA 2D0PA 1TWHH 3M9BA 3ULJA 1SN8A 4NXML 4JYAL 2R7ZG 3F1ZA 2L15A 4DR2L 1XNRQ 3CAMA 4AH6A 3S16H 1EYGA 5IYCH 4C3HH 3GTJH 4A3CG 1E3PA 5C3EH 5IYBH 4DR7Q 3UDFA 4DV2L 4P75A 2Z6KA 2AWOA 4DR4Q 3A0JA 3STBC 2EQSA 1CUKA 3PUVA 2IHEA 4GOPA 3KF6A 1VQ7A 3KFUA 3BZCA 5LMNQ 1VQGA 4BY1H 3RLFA 2B63G 3CC7A 4NPSA 1JMCA 4QY7A 3GTMH 4HIKA 4LNQA 2Q2UA 2BH8A 5M3MG 4YHHL 2F4VL 4JOIC 4QL5A 1V1QA 1K0RA 4J15A 4A3IG 1AE2A 3KJOA 3GTKH 2IX0A 1HNZQ 1I6HH 2VNUD 1XTDA 5IT9c 4X6AH 1VQBA 2UUCQ 4DR5L 2VQEQ 4LF9L 2JQOA 4DV1Q 4JI1Q 2ZTEA 4A76A 4A3KH 2AMCB 2YV5A 1VQAA 4GN5A 2HIXA 1XMOQ 4B3TQ 1SE8A 4QJFA 1KHIA 4A3LH 2EIFA 3S1NH 4UPAA 4B3SL 1L1OA 4H02A 4PZ8A 1FVIA 1BKBA 4P73A 4R4QA 4HJAA 5GADC 3A74A 2R92G 4FDBA 4R1JA 3RNUA 2R7ZH 3PIOA 1PH1A 3TS2A 2YTVA 3HOWG 1XPOA 3H3VH 5IP7H 4LF7L 4DV6L 3PCOB 1FJGQ 3T1HQ 4A3CH 4MNOA 1SRUA 2WAQG 4YCWA 4X62Q 4HJ7A 1Q12A 2KHJA 4A3FG 3FP9A 1PH7A 4A3DH 1N32Q 2OQKA 2K5HA 3KDFB 4HIDA 3K80C 3CCLA 3M85A 4DAMA 1WJJA 4OO1I 4PMWA 1QVFA 3S2DH 3OTOQ 1YI2A 4JBJA 1AE3A 5IE8A 2DGYA 2UXBL 1PH4A 2K5VA 1RL2A 5JJKA 3PGZA 4BBSH 2BH2A 3HOYH 4JI0L 1NTGA 4A3IH 5M5XH 1ASYA 1UE6A 1UE1A 2AWNA 3E0EA 4JOIA 3KJPA 3CPWA 3CCMA 4LF4Q 4A3JG 1Q82C 2OTLA 1B8AA 3J7A5 4JI8Q 4DK6C 3AQQA 1N9WA 3ER0A 3HKSA 4C3IH 4DUYQ 2ES2A 1N8RC 2AHOB 1CSQA 2XTIA 4B3ML 2JA5H 4DUZL 1MIUA 3W5OA 2OWOA 3S15H 5E7NA 5EAYA 3S1RH 2ZJPA 5DLQE 4C2MH 5IY0A 1G6PA 4L5SA 1X6OA 4JBWA 2VL6A 5C44H 1Z47A 4LFBL 3EN2A 1BVSA 1VS0A 2WB1E 5J3BA 5M5WH 5GAHC 3PIPA 4DK3C 3GDEA 4PZ6A 1N36L 1WI5A 2XGTA 1TWFH 2R92H 1P16A 4GS3A 4X66L 1Q7YC 2UXDL 3CCJA 1HNWL 5HY6A 1Q46A 3AFPA 3ERSX 3I55A 1C7YA 4BA2I 5LMUQ 4UP9A 5C0XJ 5IWAQ 1IBLL 3GTPH 1XMQQ 1IL2A 1EIYB 3HOUH 2R6GA 1HR0L 2NVQH 1Y1VG 2JK8A 1JB7A 1DGSA 4A93G 4O2DA 1XPUA 3PO3H 4GKJQ 2I5MX 1PH2A 4LF6Q 4HIOA 5BR8L 1QUQA 1IBKQ 3CC2A 4Y52H 1Q1EA 1UE7A 2UU9Q 1T9HA 2E8GA 1VQ5A 2YTXA 4APVA 1YHAA 3RZDH 3I7FA 2UUBQ 3L7ZC 3M4PA 2HHHQ 2B3GA 5C4XG 2N78A 2IX1A 1X3EA 4HIMA 2KENA 1QZHA 3S24A 3BU2A 1EFWA 2OQ0A 3OYYA 3PSIA 1VQ4A 4B3RL 2CCZA 1W2BA 4JI6Q 4O0AA 3MXNB 2UUAL 4IPDA 4DV7Q 1Q86C 4AQYL 1E1TA 1PH8A 1N33Q 2R93H 1YZ6A 3HOZH 4L5QA 1EQRA 4BBRH 4DV4L 2K5NA 3PF5A 3S14H 3TRZA 4NXMQ 3STBD 1HNXL 4JI2L 5AJ3L 1PA6A 1GO3E 1BBUA 4LF8Q 4BY7H 4DR6L 3HKZG 5GROA 5IYDG 3TEHB 3TS0A 1YBYA 2IY5B 1JJ2A 2QEXA 1VQJA 1WCMH 4DV2Q 3CCUA 4KHPL 4AYBE 4YWLA 1JT8A 1CKOA 2KHIA 3E9IA 2ALYB 3CMAA 1LYLA 4X65L 1CSPA 2RHQB 4K0KL 3GD7A 1N34Q 4IFDJ 4R4CA 2RHSB 3D0FA 4JI3L 4DNIA 1IBML 1HJPA 4P74A 1I3QH 4NXNQ 1I5FA 4HJ5A 3HOVH 2OCEA 4A3GG 3G48A 2VY3A 1S72A 2UXCQ 3Q8DA 4DR7L 2I5HA 4YHHQ 4JI4L 1KRTA 1U5KA 2E2IH 2F4VQ 3PO2G 4A3BG 2Z0SA 4LUZA 2EXDA 1D7QA 1VQDA 2Y0SE 4DV3Q 4OWWB 3K0XA 4YCVA 4R4IA 1UE5A 4YY3L 3I4MG 2ZM6L 1XPRA 3GTQH 2MO0A 3CCQA 4OO1G 4LF9Q 4OX9L 1VQPA 2CWPA 3GO5A 1HZAA 1FGUA 1JE5A 1X3FA 3CPFA 2A8VA 3SGIA 1GD7A 1AH9A 4A3MG 1TWCH 1FL0A 1NE3A 1UWVA 5FJ8G 4GOPB 4GNXB 3T1YQ 4B3SQ 1E24A 1VQLA 1K83H 1HNZL 4AIMA 1LTLA 4DR1Q 1VQ9A 3RZOH 3KDFA 1KXLA 3H3VI 2V1CC 4C3JH 1O7IA 2UUCL 4ME3A 1Q1BA 1YIJA 3AYHB 2E2JH 1PHJA 4DV1L 3PUXA 2ZTCA 3NBHB 4KLKA 4L5TA 4OWXB 1HH2P 1HR0W 2GN5A 4DV6Q 4R4OA 3DLLA 1B7YB 3ZJYC 1XMOL 4B3TL 3RN5A 4UY8C 4GN3B 3WWVA 1M90C 2D62A 4HJ9A 4IPHA 2NZHA 1L2FA 4BA1I 2R7FA 3M7NA 4DV5Q 3KOJA 3H0GG 1VQFA 4P72A 3J81i 3HOXG 4LF5Q 2B63H 3NENA 1CKNB 3DM3A 2PQAB 1HZBA 1XNQQ 3M4OH 1QZGA 1PVOA 1TWGH 3EIVA 3GTOH 1FJGL 5M3MH 4DR3Q 4PZ7A 4EX5A 1J5EQ 1L1OB 1G291 1OTCA 4LUOA 4JI7Q 1KAWA 1RIPA 2VQFQ 3CF5A 1K9MC 1K8GA 3PO2H 4A3BH 1SFOH 2R7DA 4QQBX 3G4SA 1E7ZA 1X54A 4TQUS 4GKKQ 3RLOA 3FKIG 3OTOL 2PI2E 1I94Q 1Q8KA 2B29A 4KI0A 4QGUA 3CCSA 1TXYA 4B3MQ 3U58A 3D31A 1OXXK 5JEAG 1U0LA 1R9TH 2E5LL 1VQIA 4A75A 2NVXH 2VZAA 1PV4A 1IYJB 1EQQA 4BXXG 1WFQA 2RF4A 4X64L 2F3IA 4LFBQ 2AKWB 4LF4L 4L5RC 1SR3A 3K8AA 2OTJA 1K3RA 4JI8L 3HOWH 4DUYL 1GVPA 2D0OA 1KIXA 3CP0A 5JJLA 5C4JH 4A3FH 2I0QA 4DV0L 1LUZA 4A3EG 2NZOA 4YWMA 1I50H 2N49A 2Q2IA 3BZKA 5HGQA 3F2BA 1CKMA 1NY4A 1X9NA 3J81j 3M3YH 3CD6A 5ELOA 2C35B 2CQOA 4JV5L 1W3SA 3H0GH 2JA9A 3PUYA 2NVTH 1OXSC 1VQCA 2PI2A 2WB1G 3CQZH 3F2CA 3GTLH 4JI5Q 1LM0A 3HOXH 1S3OA 4LFAL 3K7UC 5LMNW 4OONA 1TWAH 3U4VA 2ZTDA 1SMXA 4GNXC 1IXRA 3J81c 3CW2C 1X65A 2KCTA 3F2DA 2CWAA 1UEBA 5IWAL 3TQYA 2K75A 1OXTA 2ZJRA 1D8LA 3BJUA 3UE1A 1HZ9A 4A3JH 4GKJL 1C0AA 2E2HH 2JEBI 1A63A 2K4KA 3FKIH 2MFIA 4LF6L 2JA7G 4IJHA 1IBKL 4R4TA 4IO9A 1VQHA 4LFCL 2ID0A 4POFA 2CKZB 1VQEA 1PH6A 4AQYQ 4JYAQ 2A19A 1YVCA 3A5UA 4DV4Q 4IOCA 2UUBL 4JBKA 2N3SA 4DR2Q 3E9HA 4RG1A 4ALPA 4P71A 1Y14B 4JI2Q 1PYBA 3ULLA 4TVAB 3KLWA 5M5YH 5IP9G 1VQKA 1Q81C 1E1OA 4OX9Q 1JJCB 3G6EA 1SROA 1YJ9A 4KHPQ 3S17H 2IT1A 3J7ZC 1N33L 5JJIA 4NB3A 5H1SE 2HQLA 4X65Q 1ASZA 1Y1VH 4A93H 1C9OA 2ZJQA 5IYDH 1XNRL 2VUMG 1VCIA 4JI3Q 4JBMA 1J6QA 3PUWA 5GQOA 1IBMQ 4LF8L 1VQ6A 5IP7G 5FLXc 4DR4L 4XIGS 5GAGC 3FHWA 3LGJA 2VW9A 2JA8G 4A3DG 4IFDI 4Y7NH 3RN2A 4JI4Q 1A62A 2LXJA 1OXVA 4AYBG 2MNAA 3CC4A 5LMNL 1EOVA 2N8NA 3GTGH 4XTCS 5K36G 1KQSA 3UDXA 5C4XH 2K50A 1N34L 4GNXA 4DR5Q 2K14A 1V43A 2KBNA 2NN6G 4YY3Q 1KRSA 2H5XA 4NXNL 5ELNA 3J80i 3U50C 2ZM6Q 3H15A 2A1AA 2I5LX 5M3FG 3CCVA 3F8TA 3B6YA 3K7AH 2BA0A 3VDYA 2JA7H 4IOAA 3L2PA 2UXCL 2PNHA 3KF6B 4JCVE 3I4OA 4DPGA 3HOYG 4BBSG 1H95A 2LXKA 2LSSA 3A5ZB 4MTNA 2HIVA 2BA1A 4DV3L 2VQEL 2Y0SG 4JC0A 3CMEA 2YYZA 3CCEA 4JI1L 4WJ4A 4A4IA 4LF7Q 3ULPA 1A8VA 5GAEC 2WAQE 2Q2TA 1VQNA 2JA6G 1CKNA 2JA5G 2PQAA 5IP9H 1A0IA 4GLXA 2F52A 5FLMG 2WFWA 2NN6I 3K81C 3T1YL 1G51A 1VQ8A 3ICEA 3JAMi 5C44G 4DR1L 1YHQA 3I4NG 3S2HH 2CFMA 2ATWA 1VQOA 2UXBQ 1IZ6A 2VUMH 2JE6I 1KC8C 3PUZA 3T1HL 4A3GH 1EUJA 4X62L 3KF8B 4BY7G 3NELA 1N32L 2VS1A 4JI0Q 3M4QA 4UP7A 2JA8H 1Y1WG 1PH3A 3HOUG 4OWTB 4DV5L 1Z9FA 1KD1C 2YTYA 2GVBA 4QIWE 3PO3G 3I4MH 2DUDA 3NEMA 2PMZE 2JJQA 4LF5L 4HJ8A 3RR5A 1MKHA 3TREA 4DKAC 3CXCA 3S1QH 1XNQL 4DUZQ 1QVCA 1NBWA 5M3FH 1OXUA 4DR3L 2RCNA 3UDIA 4A3MH 1J5EL 3PF4A 1SLJA 1YHBA 3I2ZA 5C0XG 5FJ8H 3J80c 4JI7L 2E5LQ 2VQFL 2NVYH 1PYSB 1NJIC 3W1BA 4DAYB 4X64Q 1N36Q 4GKKL 2Q2HA 2HT1A 2WP8J 1JJGA 4RMFA 4MZ9A 4X66Q 1I94L 4YCUA 3HFZB 1WOCA 2MQHA 1HNWQ 2UXDQ 4YWKA 4LWCA 3UE0A 1PH5A 2JA6H 3AFQA 2R93G 4GLAC 2GVAA 1IBLQ 4DV0Q 3HOZG 4BBRG 1HR0Q 4GLVB 3MEFA 5FLMH 1YJWA 4WJ3M 4IJLA 4PG3A 1X56A 4JV5Q 1GKHA 4OXPA 5IYCG 1P8LA 3I56A 2Z6KC 1YJNA 1K73C 3I4NH 3G71A 1YEZA 5IYBG 1YNXA 5BR8Q 5C3EG 2JEAI 2K52A 4JG2A 1HZCA 3JAMc 5C0XI 1NMGA 4GOPC 4LFAQ 1WCMG 1L0WA 5LMUL 1PH9A 5JEAJ 1K8AC 1EIFA 4KHZA 1XMQL 4EQ5A 4POGA 3KYHC 4BY1G 2FXQA 3CCRA 1Y1WH 1E22A 1MJEA 1GM5A 4UP8A 2KCMA 4B3RQ 3HOVG 4JI5L 3S1MH 1BBWA 1B70B 1PFSA 2UU9L 1S40A 1MJCA 3OW2A 4GN4B 2UUAQ 1M1KC 4LFCQ 1NMFA 1XJVA 1X55A 3IRBA 2HHHL 4IPCA 3L0OA 4BXXH 2IHFA 4IFDG 1HNXQ 3U4ZA 2MO1A 1YITA 2ASBA 5AJ3Q 1QUQB 1EWIA 3PV0A 3HKZE 1V9PA 3JC66 3RLNA 2QA4A 1L1OC 4A3KG 2YU9H 4IPGA 3EBEA 4JI6L 4DR6Q 1WYDA 4A3LG
chains in the Genus database with same CATH superfamily
1G8ZD 3W1GA 4DV7L 1D5MC 4EGVA 5DM63 2QGQA 5F2DA 4A3EH 1Q90A 1KL9A 2AQ2B 1VQMA 1X3GA 1QCBD 3M9BA 1SN8A 2Z8LA 4XT3B 1EIGA 4Y7NB 1G91A 2KHSA 1XNRQ 1EYGA 1TS5A 2HUGA 5C3EH 4DV2L 2AWOA 4HAEA 5I2YA 3STBC 1CUKA 3BG3A 3TMEA 3NTHA 1VQ7A 2B63G 3CC7A 4NPSA 1JMCA 4DAVA 1D1IA 4QY7A 2H1EA 3GTMH 4LNQA 3NBHA 5M3MG 1ZYRC 2F4VL 1STAA 4JOIC 5DM73 3GTKH 1SJHD 2IJ0A 1XTDA 5DAUA 5IT9c 4A76A 3FEWX 1VQAA 4B3TQ 2HIXA 2QF7A 1SE8A 4QB4A 2K5QA 5EJWA 2EIFA 3BDLA 3GQBA 4B3SL 4A3GB 3KF8A 4R4QA 3DUZA 3A74A 5J39A 3RNUA 3PIOA 1PH1A 2YTVA 3HOWG 2ZXRA 5IP7H 3T1HQ 1ICWA 4MNOA 4Q5VA 4A3FG 3P7JA 4KY7A 5I9PA 2K5HA 1DZ1A 2RCFA 3KDFB 3M85A 1WJJA 1BO0A 2PYKA 4OO1I 3S2DH 2O4XA 4UHVA 2NN6H 1LTRD 4X3UA 3HOYB 1F2MA 2DGYA 2UXBL 1QE6A 2NVYB 2KJXA 1SE4A 2BH2A 2X6LA 2EDGA 2EYHA 4ILWA 5M5XH 1UE6A 2AWNA 1PRTB 3E0EA 4JOIA 3CPWA 4DGZA 1Q82C 1B8AA 1B2TA 3J7A5 3VR4A 4DK6C 4C3IH 3ER0A 2ES2A 1CSQA 4DK1A 4B3ML 3Q0AA 3I8ZA 4C2MH 3MAQA 1QB5D 2VL6A 4LFBL 1RDPD 2WB1E 5J3BA 4BY7G 4DK3C 4PZ6A 1WI5A 1P16A 2EYMA 3N6RA 1VF7A 1Y1WB 2O5IC 1Q7YC 2UXDL 3X3MA 3TZUA 2F0QA 4JW0A 1JWUD 4UP9A 3GTPH 1XMQQ 1HR0L 4A93G 1JB7A 3RUZA 1DCZA 4DAPA 1MHWC 5BR8L 3CC2A 1EOTA 1UE7A 1FGBD 2E8GA 1S5DD 3EJIA 3M4PA 4E6IA 2IX1A 4A3EB 2KENA 1QZHA 5FKAC 3S24A 1A2TA 1W2BA 1WTOA 2R93H 1J9OA 5C3EB 4L5QA 4DV4L 4BBRH 2K5NA 3DXJC 5EPLA 4PQXA 2EYOA 2F0WA 1PA6A 2O2LD 1BBUA 1BCPD 4BY7H 3HKZG 1C48A 3VR5A 3GTMB 5I2XA 3WOEA 1CSPA 2RHQB 4J6HA 3GD7A 4X3SA 1GUOA 4QCLA 5C3WA 4FF3A 3D0FA 3NQTA 5C4ZA 3GTKB 4C1NI 4NXNQ 3MEHA 4MHEA 2ZXOA 1AN8A 4IUVA 4DR7L 2I5HA 5A2QL 4JI4L 2E2IH 2K7VA 4A3BG 1RKNA 4CDCC 2RSOA 1FNVA 1TKWB 4DV3Q 2PQEA 3I4MG 3GTQH 1XPRA 1UAPA 4LF9Q 2LMCB 2CWPA 1FGUA 3CPFA 2A8VA 1AH9A 1FL0A 3T1YQ 1E0BA 2L55A 1E24A 1VQLA 1K83H 1VQ9A 4DR1Q 2EPBA 2DJFC 1HPCA 3HEJA 3LWUA 1Q1BA 1YIJA 1PHJA 1SNDA 3A8IE 1HR0W 3S2DB 1YNND 4UY8C 3ZJYC 2MJ8A 4GN3B 3D6CA 1HCZA 2EJMA 3K5LA 2NZHA 3P75A 3R3OA 4BA1I 2R7FA 4KJNA 4DV5Q 3H0GG 3J7YW 1S5BD 4XYOA 3HOXG 1H9KA 3BVZA 3NENA 3OMGA 5M5XB 1HZBA 1SYGA 1TWGH 1FJGL 3LNNA 4EX5A 3VYTA 1G291 4C3IB 1EY4A 4LUOA 3HP3A 1LLRD 4A3BH 2R7DA 4QQBX 4XQJA 4C2MB 3FKIG 3TBIB 5LL6X 4ZUIA 2B29A 4KI0A 1TY0A 4QGUA 4WJWA 2G9DA 5NUCA 4A75A 1PV4A 2EXZA 5CBAE 2EJFC 4LF4L 4L5RC 3GTPB 3NPPA 4JI8L 2DNEA 2WV6D 5HURA 1LV9A 2D0OA 1KIXA 5JJZA 1B44D 5C4JH 4DV0L 1I50H 3OMCA 1NY4A 3HZXA 3M3YH 2C35B 2CQOA 3H0GH 1IW7D 1VQCA 3F2CA 2WB1G 3FRPB 4C3HG 4JI5Q 4HSVA 3HOXH 3DEOA 1KLUD 5J1ZA 4LFAL 3P1HA 2ZT9C 3J81c 1B3QA 1JOKA 1STHA 1CFMA 3F2DA 1UEBA 2PMZB 1WTWA 2RA4A 2R93B 1CM9A 2K75A 1PYWD 1OXTA 4A3JH 5C5LA 2E2HH 1EQVA 1QOHA 3FKIH 3L9AX 4FXKC 4LF6L 4R4TA 4ZK9B 2RBMA 3NK9A 4BY7B 2WINB 1RODA 4AQYQ 3I70A 1YVCA 3A5UA 1Y14B 1A6XA 4DNRB 5IP9G 1JJCB 4M8AA 4KKSA 1YJ9A 2CVRA 4NB3A 1B4OA 4X65Q 1Y1VH 1C9OA 1SYCA 2ZJQA 4CDEC 2E2IB 1XNRL 2VUMG 2L5TA 1IBMQ 4LF8L 1VQ6A 3GTGB 5E3FA 2SNSA 3SK8A 5CV7A 3GTQB 4H13C 3FHWA 1STGA 1EY7A 5JOBA 1OXVA 2MHVA 4IUQA 1EOVA 1BCPC 1LT6D 3ND8A 5ELDA 1WTHA 1V43A 1K83B 2EYPA 2H5XA 1RF2D 2OF1A 3U50C 3CCVA 3F8TA 4V0BA 2BA0A 1CZWA 3TSSA 3FVQA 3L2PA 1H95A 2LXKA 3HKZB 2AUKA 3CCEA 2YYZA 5CV6A 3ULPA 1O78A 2EY1A 5D3IB 1CKNA 1UUPA 2PQAA 1AW7A 5IP9H 1A0IA 2F52A 1TWGB 3SVMA 1ESRA 5C44G 2Z1CA 3S2HH 2PZTA 2UXBQ 1PMRA 4A3BB 2VUMH 5BN3A 3R2TA 2EY6A 3T1HL 3BYYB 3KF8B 2VS1A 4Q0FA 2H4OA 3M4QA 1F9RA 1O80A 3HG9A 3HOUG 1CTMA 5BN4A 1ESFA 1EU4A 1Q8IA 1HQRD 1W6KA 1YNNC 2JJQA 4HTHA 3S1QH 1MKHA 3TREA 1MSHA 1BDOA 2F03A 4WFN3 4DR3L 4A3MH 1L0XB 3UDIA 3DWPA 2PNRC 1ICFB 3J80c 3V05A 4JI7L 2E5LQ 2EYLA 2DN8A 2Z4IA 1PYSB 5C4JB 2JP1A 1HUMA 1I50B 1LTGD 3AU7A 2Q2HA 2WP8J 3M3YB 2JN4A 1I94L 2UXDQ 3H0GB 2MQHA 1LTBD 2TSSA 3AFQA 3HOXB 1AFPA 4DFAA 2F0HA 3EROA 1HR0Q 3NQIA 1YJWA 4IJLA 2MPMA 1E2VA 5IYCG 3I56A 1YJNA 3TP5A 2PPBC 1SYFA 1YNXA 5BR8Q 2A68D 4JG2A 4F8MA 3BVMA 1SNOA 2M00A 4A3JB 1JR0D 1CI3M 2F0JA 3C1EA 2E2HB 3FKIB 1PH9A 4KHZA 1XMQL 4EQ5A 4ZYSA 2Z9HA 4BY1G 3IAYA 2FXQA 3CCRA 4KD3A 2K6AA 3HOVG 1BBWA 5KRUA 1BNZA 3OW2A 1PZKD 4LFCQ 5KYIA 1X55A 3IRBA 1X32A 1IW7C 4IFDG 1YITA 4S3SA 3I73A 3G7LA 2YU9H 3RLNA 2QA4A 1Y1VB 4IPGA 4A3LG 1SYBA 3UDGA 1AP0A 1MI2A 1FR3A 4LW1A 3K5OA 2WB1B 2D0PA 4CDFC 1EY5A 2R7ZG 4LK1C 3F1ZA 1I4HA 3CAMA 4AH6A 5IYCH 3GTJH 4IQZA 4A3CG 4DR7Q 1NAPA 4P75A 5LL6S 1BOSA 1O7YA 4HEDA 1NR2A 1SXTA 2IHEA 3OPOA 3BZCA 1Y69U 1STYA 1VQGA 4BY1H 1ILPA 3RLFA 3NHHA 3OOCA 4HIKA 5ELCA 2QEJC 4QF4A 1KDAA 4XQNA 4QL5A 4J15A 1AE2A 1U4LA 3KJOA 4L63B 3GP7A 2I07B 5IGFA 1CQFA 2DY7A 3QOLA 4IFDH 1NR4A 3E6ZX 2JQOA 3ONAB 4LF9L 4JI1Q 3S2HB 4ZCKA 2AMCB 1WD0A 1V1OA 1KHIA 2RDFA 3QB3A 4A3LH 2VUMB 2A73B 1CHQD 3MHBA 4F88A 4P73A 4CKEA 4HJAA 2R7ZH 2K1BA 1TIID 3PCOB 1VDZA 1FJGQ 4A3CH 1K0SA 5JPNC 1SRUA 5IGGA 4YCWA 1E2WA 2PCFB 1F9PA 4HJ7A 2KHJA 3FP9A 4A3DH 3S1QB 1L0YB 4HIDA 3VR6A 1DOKA 1SEBD 3DMUA 4PMWA 3C46A 1YI2A 4ZLTF 5ELBA 4JBJA 1RD9D 5IE8A 2K5VA 1RL2A 1JOQA 1PRTF 5CGKA 2XWJB 3HOYH 4JI0L 3LWEA 4O42A 3NTIA 2ZXPA 4RHRA 1T5EA 3OW7A 4LF4Q 3A56A 3L3OC 4JI8Q 1N8RC 3OWFA 1HXYD 2JA5H 2FHTA 4DUZL 1MIUA 2HD3A 5EAYA 3K5MA 1G6PA 5IY0A 1NUCA 3M7GA 1X6OA 1Z47A 3MC0B 3K59A 2XGTA 1A3UA 3TN2A 5KGUA 3CCJA 1YNJD 3ERSX 1C7YA 2ENBA 3DM1A 2HCIA 1EIYB 2VB3X 2NVQH 2JK8A 3PO3H 3H6MA 3T4AC 1ET6A 4LF6Q 1KNAA 1QUQA 1WD1A 3LX0A 1Q1EA 4UDUC 2YU9B 5C6AA 2F0SA 2YTXA 2FFKB 1KABA 1EY8A 3I7FA 2HHHQ 5C4XG 3J7AV 1X3EA 3I72A 1WTRA 2A68C 2OT2A 3U9OA 3BU2A 1EFWA 2OQ0A 3PSIA 4FF2A 5FO9B 1IYUA 1MSGA 4NMZA 3RD4A 3IL8A 5M9OA 3HRZC 3GTJB 4AQYL 3S14H 2F0LA 4NW2A 4WRDA 1G2TA 1HNXL 5AJ3L 4G4KA 4LF8Q 2X69A 2Z6BA 3CHBD 1LT4D 4BY1B 3TEHB 1XWEA 2L9HA 1JJ2A 1VQJA 1WCMH 4V190 4AYBE 4YWLA 1JT8A 3URYA 3E9IA 3HOVB 4X65L 4K0KL 1V1PA 4R4CA 2RHSB 4QUFA 4DNIA 1IBML 5FO7B 1I3QH 4HJ5A 1GUGA 2EY2A 3X3NA 2VY3A 3PIO3 1S72A 1EU3A 3Q8DA 4YHHQ 3SK4A 1U5KA 3PO2G 3OIQA 1VQDA 1BUVT 2Y0SE 4OWWB 3K0XA 2TMPA 4HCSA 3CCQA 4OO1G 2IW3A 1KTKA 2EYJA 3GO5A 1X3FA 2J7ZA 2R7ZB 2K5DA 1F2YA 1B1ZA 5FJ8G 1R4PB 5FO8B 1DYQA 1I4XA 3RZOH 2EOTA 4A3DB 2HDLA 2K03A 3F2UA 1O7IA 2UUCL 1PTOD 4ME3A 4IALA 3PUXA 2QDBA 4FXDA 4TRDA 2AQ3B 1XMOL 4HJ9A 5EPKA 3M7NA 1TS3A 1U9RA 1TVXA 1VQFA 2CH4W 2B63H 1CKNB 2E74C 3DM3A 2PQAB 2N88A 5EQ0A 1PVOA 2RVLA 5M3MH 4DR3Q 1S4ZA 1L1OB 5G3LF 3QIAA 4JI7Q 1K8GA 1U4RA 3PO2H 2JA5B 5FLXL 2PZUA 1E7ZA 1X54A 3NSWA 3RLOA 1WTPA 2AUJD 2PI2E 1I94Q 2RSNA 1Q8KA 3V96A 4OO1H 3CCSA 1TXYA 3U58A 1OXXK 1LTID 1EFID 2E5LL 2XRQD 4DXFA 1XX8A 1IYJB 4BXXG 2IWHA 1GUTA 3D6WA 1BCPB 1SR3A 3K8AA 2OTJA 2NVQB 3HOWH 3PO3B 4HCEA 2KCCA 4PMCA 3KLSX 2OEOA 3CP0A 5JJLA 4A3FH 4YWMA 2N49A 5E1FA 5HGQA 3CD6A 1JOOA 5ELOA 2WACA 3EQLC 2JA9A 3PUYA 3A8JE 2PI2A 3M4YA 1LM0A 1S3OA 3H3VC 5LMNW 4OONA 1TWAH 2SOBA 1X65A 3SXHA 3RMHA 3SE0A 5IWAL 2ZJRA 3S14B 1EEFD 1QG7A 1A63A 1YNJC 1BBXC 4YIJA 3A55A 2MFIA 2JA7G 5CV8A 4LFCL 3KK7A 2CKZB 1PH6A 2HQEA 1UNSA 1WCMB 1T5XD 2UUBL 2Q8IB 3T16A 1TQOA 3KLWA 4H7BA 4MN3A 1V8QA 1LTSD 1I3QB 5I4DA 4KHPQ 2IT1A 1N33L 5JJIA 2A69D 4A93H 1FNWA 2NZ1D 3KLSA 4R9WA 1J6QA 3PUWA 2QILA 4I7ZC 2M2LA 4NKLA 1JORA 2B2TC 1S5FD 4XIGS 3LGJA 4EQPA 4OELB 2LXJA 4AYBG 3CC4A 3GTGH 4XTCS 3UDXA 1N34L 2J0TD 2K50A 4CJ0B 3RZOB 1EY9A 4I7AA 5ELNA 1RCVD 2F0FA 5M3FG 2A1AA 4OX9Q 3WDNA 2JA7H 1GUNA 3TP7A 2PNHA 3EVQA 4JCVE 4BBSG 4DPGA 3A5ZB 1MBYA 2A6HD 4XDXA 2Y0SG 1AZPA 4F87A 4JI1L 4WJ4A 1SSOA 4A4IA 4XXEA 2XVSA 4CGYB 2A74C 2KOLA 3QO2A 1QNKA 2B63B 5DNFA 4K6LA 4FP5D 2FINB 1VQ8A 5M3MB 2XIWA 3J81E 1HUNA 4ZKCB 2CFMA 2ICEC 4Z9CB 3PIP3 2RQXA 5CMDA 3PO2B 5HGTA 1IZ6A 3MXGA 3PUZA 1KC8C 2C9OA 1EUJA 1R4QB 1G6ZA 3NELA 1G2SA 3VR3A 4JI0Q 5IGBA 5EKIA 4UP7A 3SEBA 4OWTB 1PTOC 2B2TA 1TS2A 1Z9FA 1KD1C 2KUMA 2YTYA 3I4MH 3RR5A 4DKAC 3KBGA 1SNCA 4DUZQ 1QVCA 3H09A 5M3FH 1OXUA 3T53B 3HOWB 3I4LA 3MWYW 5C0XG 2EZVA 5CC4A 4N8FA 4A3FB 4K8IA 4K5XA 2HT1A 2B8FA 2L0CA 1JJGA 2DJGC 4YCUA 1WOCA 1D2BA 2Q8RE 5IT9L 5EBCA 1EIHA 2GVAA 2RDHA 1LABA 3HOZG 3G6JB 1TWAB 4WJ3M 3SK6A 2Z6KC 3A7LA 5C0XI 1QILA 3JAMc 4KKTA 3NUCA 4QIWB 2DY8A 1L0WA 4FYDA 1K8AC 1EIFA 1EWHA 4RGTA 5C4HA 2LFNA 3C2PA 1GM5A 1MJEA 5IGDA 4FF1A 3S1MH 4H44C 2F0TA 2Q8TA 1S40A 3I91A 4BS9A 4KKUA 5CV9A 1XJVA 2HHHL 3L0OA 1HNXQ 1EZ6A 2ASBA 5AJ3Q 1QUQB 2KQ3A 3PV0A 1V9PA 4R8IA 1L1OC 4K2KA 4A93B 3EBEA 5JJKA 4LUVA 3AEVA 3I90A 4K0KQ 3O13A 4JYAL 3ULJA 1JWMD 2F0MA 4KHVA 2LY7A 3FPPA 1ZXTA 2L15A 2XWBB 1RHPA 4C1NK 4K6DA 4C3HH 4N8X1 3UDFA 1HTPA 2Z6KA 4DR4Q 4K14A 3A0JA 2EQSA 3K0YA 3PUVA 2XSCA 4IN3A 2F0EA 2JA7B 3KF6A 4ME5A 3KFUA 5LMNQ 1ET9A 2CH4A 3J80E 1EY0A 2FJ2A 2Q2UA 2BH8A 4YHHL 2A69C 2RKSA 3SHLA 1K0RA 1V1PB 4A3IG 1I6HH 2VXWA 2VNUD 1ML0D 1PFMA 1VQBA 3I3CA 1WTXA 2UUCQ 1Y8OB 1GUWA 2EYFA 1XMOQ 4QJFA 3S9WA 1L1OA 4KY5A 4H02A 4PZ8A 1BKBA 5GADC 2PO4A 2R92G 4FDBA 4R1JA 3TS2A 3H94A 2JYOA 3GV3A 4N9TA 4AYBB 3H3VH 2E2DC 3I4MB 3MA2B 4X62Q 2A6HC 1SE2A 1PH7A 4B08A 4ZRZA 3V2TA 3CCLA 3K80C 1SNPA 2F0VA 5M3FB 4DAMA 1PH4A 3PGZA 2BOSA 2QCPX 2Y0SB 2KA7A 4A3IH 1ASYA 2OTLA 4PV1C 3AQQA 1N9WA 2AHOB 2NTTA 3NBIA 4L8JA 5FLXE 2A5HA 5M5WB 2OWOA 1HA5A 4LMQD 4CJ2C 3S1RH 5DLQE 1CZGA 5C44H 3CRLC 3GTOH 1BVSA 2G5DA 3OHXC 1SJED 3TDQA 1N36L 2R92H 1TWFH 1J8IA 1PXUA 4X66L 3TZDA 1HNWL 5HY6A 1KLGD 3Q23A 5LMUQ 3S1MB 2I46A 4DA2A 5IWAQ 3VYRA 3HOUH 2SDFA 4N9PA 1K8OA 2XNAC 2FMMA 3U9SA 5KYLA 2UU9Q 1SBBB 1VQ5A 2B2YC 1A15A 4XT1B 1YHAA 4PMBA 1EY6A 1M8AA 3RZDH 2UUBQ 1JE4A 2N78A 2D5DA 1Y8NB 3OYYA 1VQ4A 1SNQA 1FD7D 4JI6Q 5JAVA 1RTNA 4C3HB 1PH8A 1E1TA 1N33Q 3MFYA 3TRZA 4NXMQ 4C3JG 3STBD 3R93A 3OSOA 4RKBA 3NE5B 1YBYA 2QEXA 4KHPL 2KHIA 1PTOH 2XRSD 1LYLA 1N34Q 3FMCA 4IFDJ 1I6HB 1HA6A 3BDCA 3HOVH 2OCEA 4A3GG 3G48A 1B50A 4M1UB 3BS1A 2B2UC 3MXPA 1DM0B 1KRTA 1GXDC 2EXDA 4J8QA 1D7QA 4R4IA 4OL7A 1UE5A 2B2YA 1I4RA 1IYVA 2MO0A 3J81L 4CDDC 4OX9L 1VQPA 1HZAA 4TSSA 1JE5A 1B9NA 1M4VA 3SGIA 1I4QA 1TWCH 1ZKOA 1AEXA 1SNMA 1UWVA 1NE3A 2XN9C 4GOPB 2F1MA 1HNZL 4AIMA 1LTLA 3EA6A 2V1CC 3D3RA 1BXTA 4C3JH 3AYHB 1VMCA 4DV1L 2ZTCA 4L5TA 1HH2P 2GN5A 3EFXD 4DV6Q 4R4OA 1CK1A 2L11A 3DLLA 1Z6HA 3WWVA 4FVMA 2D62A 4IUTA 4RCOA 4IPHA 1L2FA 4P72A 3J81i 4ID6A 4A3IB 3R8BA 3WOFA 5E4XA 1QZGA 3EIVA 5LHY1 1SFOB 4FF4A 3KLRA 1OTCA 1RIPA 3HGBA 3CF5A 1K9MC 3D4RA 1S5CD 2M9VA 2B2UA 2SNMA 4K2LA 4TQUS 3S1RB 3K57A 3OTOL 1CA6A 2BE5D 5C44B 4B9XA 3GTOB 2GA4B 1HFGA 2R92B 1TWFB 4KD4A 2FMCA 5JEAG 1U0LA 1BCPF 1R9TH 1SE3A 1LACA 2VZAA 2RF4A 2F3IA 2AKWB 3MFGA 3HOUB 1K3RA 4DUYL 1GVPA 5KNCA 2I0QA 1LUZA 4XQQA 2NZOA 4A3EG 3BZKA 1DD2A 3MZ5A 4GZYC 2K05A 3GTLH 2NVTH 1OXSC 3RZDB 3CQZH 4MTKA 5IT9E 4ODGA 3W2DA 4X3KA 3K7UC 1U4PA 5EKKA 2ZTDA 1SMXA 4GNXC 2KCTA 1UEAB 5TSSA 3TQYA 5EGTA 2E75C 3NWTA 3BJUA 3UE1A 1D5ZC 1HZ9A 4GKJL 2MUYA 2K4KA 4RKLA 4LAAA 1HRJA 4DF7A 1IBKL 4IO9A 3CRKC 2KCNA 4KMUC 2ID0A 4POFA 1VQEA 2KVMA 3DHQA 4JYAQ 1IL8A 3MXUA 5JEAH 4FXGC 4JBKA 4ABNA 4RG1A 4ALPA 5CR3A 4ZAIA 1PTOB 4JI2Q 1GJXA 3ULLA 4TVAB 5M5YH 3J80L 1VQKA 4G57A 3VYUA 5IODA 3E3XA 2QKIC 3S17H 2F3WA 3TP6A 1ILQA 4EQOA 3A8KE 1ASZA 1WVLA 1VCIA 4JI3Q 4JBMA 4DNTB 5IP7G 3A7AB 4CJ1B 5J22A 4DR4L 5GAGC 5EBDA 2JA8G 4B9WA 5ISRA 5LMNL 2N8NA 5K36G 5C4XH 1TWCB 1X3QA 4GNXA 2K14A 2KBNA 2NN6G 3VA7A 4YY3Q 2J4XA 3J80i 2ZM6Q 1JWSD 3H15A 4C3JB 3B6YA 3K7AH 4IOAA 2UXCL 5BN5A 2F0OA 3KF6B 1TT2A 2LSSA 2DNCA 1AZQA 1VF5C 4JC0A 3CMEA 4C3IG 1A8VA 1I4GA 2WAQE 2JA6G 3TP8A 2NYZD 1F9SA 3DEPA 4JVZA 5FLMG 2NN6I 3K81C 3J7AF 1K8MA 1G51A 3ICEA 1YHQA 3I4NG 2K32A 2ATWA 1D1KA 3D4DA 4X62L 4HN7A 2F0GA 2L1BA 1TR5A 3K58A 2JA8H 1PH3A 1IKLA 1JC7A 5K36H 1R9TB 5EKLA 1KDBA 1TU2B 4LF5L 4HJ8A 1XNQL 2IX3A 1NBWA 1JICA 4CKCA 2RCNA 1J5EL 1SLJA 1VMPA 2PW5A 5FJ8H 1CA5A 2OXPA 2VQFL 4RH6A 3W1BA 4DAYB 4QMGA 4X64Q 3Q24A 5D14A 1N36Q 4GKKL 5FK9C 2P5ZX 4X66Q 3VA5A 3HFZB 1HNWQ 4PNYA 3GTLB 1B9MA 2NVTB 3CQZB 3UE0A 2C5CA 2JA6H 2R93G 4GLAC 2K5WA 1JQYD 4BBRG 4GLVB 1CHPD 3MEFA 5FLMH 2BE5C 4JV5Q 1X3PA 1P8LA 1K73C 3I4NH 3G71A 1D6EC 4RFBA 5IYBG 2K52A 4KY6A 1HZCA 4GOPC 3C3LA 3MTSA 5KNBA 5LMUL 1F9QA 4K5VA 4POGA 2AQ1B 2B2WC 3T13A 5KIXA 1H9SA 3KYHC 1O7LA 2K01A 1E22A 4UP8A 3HS0C 2EVBA 3AMUA 5E4WC 3ND9A 2IPKD 1PFSA 2UU9L 2EJGC 1MJCA 4GN4B 2D2CC 1XXGA 5M5YB 4RGNA 3MVVA 4IPCA 4BXXH 2F4IA 2IHFA 5ELEA 1PRTD 3S17B 1EWIA 4A3KG 3JC66 4JI6L 1WYDA 4WORA 4TKOB 1NCVA 1ZEQX 1QVGA 5EPJA 1PFNA 2R3ZA 3QR8A 4NXML 1TWHH 4QUCA 2L12A 4J1MA 4RGMA 4DR2L 2NUCA 5DEHA 1MD2D 4KK7A 3S16H 5C5MA 1E3PA 5C4XB 4G7HC 5IYBH 4IZ8A 2JXMB 1SDFA 1DOLA 1KDCA 4GOPA 3K7AB 3DWQA 4U673 1O7ZA 2WIIB 1RJTA 2B2WA 5K5PA 4HMJA 2N55A 1MGSA 4CKBA 1QNUA 1V1QA 3W3AA 2IX0A 1HNZQ 2X6GA 4X6AH 1LTTD 2VB2X 4DR5L 2VQEQ 1OO9B 4DV1Q 2ZTEA 3E0JA 4IUNA 4A3KH 2B8GA 2YV5A 4GN5A 2CHBD 1D5XC 3S1NH 4UPAA 3JAME 3FPUB 1FVIA 5I6WA 1ENCA 2JA8B 3NTKA 1S5ED 1NSNS 3IKJA 1XPOA 2EE1A 4LF7L 1A2UA 2LS01 4DV6L 3IFDA 5JVG3 4HR7B 2WAQG 1Q12A 1N32Q 2OQKA 1GOZA 2K28A 4G7OC 1H9RA 1A3TA 3E5SA 4ULLA 5D65A 1QVFA 3OTOQ 1AE3A 3H91A 1HTLD 2HCCA 4BBSH 4KTAA 1NTGA 2JA6B 1UE1A 3KJPA 3CCMA 4A3JG 4RCNA 1H9JA 4DUYQ 3HKSA 2XTIA 3I4NB 5CYUA 3W5OA 3Q6SA 3S15H 1DJRD 5E7NA 2ZJPA 2K33A 2QW7A 4FNFA 4L5SA 4JBWA 3D4WA 3EN2A 1VS0A 3PIPA 5M5WH 5GAHC 1K3BC 3GDEA 4CBVA 1C8CA 4DXGA 4GS3A 5KEEA 4IUPA 3BYTB 4EQNA 1EL0A 1Q46A 3AFPA 5AFWA 2NB0A 3I55A 4BA2I 5JPMC 4FO2A 5I6YA 5C0XJ 5IGEA 1IBLL 1IL2A 1STEA 2R6GA 1Y1VG 1DGSA 4O2DA 1XPUA 1LO5D 4GKJQ 4UAIA 2I5MX 4CHTB 3FDTA 1PH2A 4HIOA 1IBKQ 4Y52H 1T9HA 1W6JA 1DXMA 2PW7A 3IFTA 4APVA 5C0XH 3R2IA 3L7ZC 2B3GA 4HIMA 4K5WA 5G3LD 1TWHB 4B3RL 1QWYA 3KUPA 2CCZA 4BBRB 2NWGA 4O0AA 3MXNB 4LJZC 3S16B 4RA8A 4HMIA 4IPDA 4DV7Q 1Q86C 2D9UA 2UUAL 1YZ6A 3HOZH 1EQRA 3PF5A 1ENFA 2KEDA 1H9MA 1STNA 2F0IA 4JI2L 3VYSA 1Y8PB 3P20A 1GO3E 4DR6L 5GROA 5IYDG 3TS0A 3QOJA 2IY5B 4DV2Q 3CCUA 1EZ8A 2WKCA 1CKOA 2B2VC 2ALYB 4DU9A 1PRTC 3CMAA 1PFBA 2F0UA 4C56C 4JI3L 2MP1A 1PZJD 1SYEA 1HJPA 4P74A 1I5FA 2L4NA 2MGSA 4KN4C 2UXCQ 2F4VQ 2B39A 4R8NA 2F0KA 4A3KB 2Z0SA 4IURA 4LUZA 2R61A 5D3DA 5T1IA 1CT1D 3S1NB 1EEID 1JB3A 4YCVA 2CW0D 3NP8A 4YY3L 2LKVA 4OIJA 2WKDA 2ZM6L 3Q22A 4KV6A 1XYIA 2JSOA 1GD7A 5CV4A 2CQAA 3A54A 4A3MG 5FOBB 1PZID 4RAUC 3T51B 4I65A 4B3SQ 4GNXB 1FYCA 3QJYA 3KDFA 1KXLA 4NP5A 3H3VI 4K8JA 2E2JH 4U68A 5I9OA 4IUUA 3NBHB 1EQTA 4KLKA 4OWXB 4P2CB 4O1NA 3ERQA 4B3TL 5IYDH 1B7YB 4RGOS 3RN5A 1M90C 4KN7C 1HFNA 3KOJA 4BBSB 1GHJA 4XYQA 4DAYA 1ENAA 2B2VA 1EWCA 5C3XA 4LF5Q 2IL8A 1XNQQ 3M4OH 1DONA 4PZ7A 1J5EQ 4KJOA 1KAWA 2VQFQ 1CQVA 3S15B 1SFOH 3G4SA 5CBEE 3CU7A 4GKKQ 3OWEB 3BDOA 1B53A 2A6ED 4B3MQ 3D31A 1VQIA 2NVXH 1EQQA 1WFQA 1F77A 2WAQB 4X64L 4LFBQ 1PDQA 1SMYD 3SDZA 2O5JC 2KEEA 2Z4HA 3QG1A 1QJOA 3F2BA 2Q2IA 1X9NA 1CKMA 4RWSC 3J81j 2BDOA 3K6OA 4JV5L 1W3SA 5KNDA 1TY2A 2EY5A 2F3VA 2NTSA 1BQQT 3U4VA 1IXRA 3K5NA 3CW2C 4G7ZC 1GHKA 2CWAA 5JVH3 1D8LA 3HOZB 1C0AA 5L37A 2JEBI 1WTQA 4IJHA 1LT3D 1VQHA 1E2ZA 1EYAA 1H9SB 1PTOF 2A19A 4DV4Q 4IOCA 2N3SA 4DR2Q 3E9HA 4P71A 2PZWA 1PYBA 3PQIA 1K28A 4HSPA 1Q81C 1E1OA 3G6EA 1SROA 3VR2A 3J7ZC 1F2LA 1ZYRD 4OEMB 4EVOA 1SYDA 2HQLA 5H1SE 1HHVA 1TS4A 3ZYYX 3BVGA 1I4PA 1IHZA 1BR9A 3BZDB 5CV5A 1PLFA 5IGCA 5GQOA 2KECA 5FLXc 4OHJA 3UI2A 1BF4A 2VW9A 4ZQ3A 4A3DG 4IFDI 4Y7NH 3RN2A 4JI4Q 1A62A 4MIUA 2MNAA 1KQSA 3JAML 4DR5Q 1KRSA 4NXNL 1ONLA 2HDMA 2F0PA 2I5LX 3VDYA 4DN4M 1F2ZA 2E2JB 2BCOA 1JCKB 1GUSA 3I4OA 3HOYG 3GV6A 4MTNA 5IOCA 2HIVA 4X3TA 2BA1A 1B3AA 2VQEL 4DV3L 4F7XA 4H0LC 4NDXA 5A2QE 5COYA 4LF7Q 5GAEC 2K04A 1A3VA 2Q2TA 1VQNA 3OIPA 4BWGB 2JA5G 4GLXA 3M4OB 2WFWA 2CW0C 3CKIB 3T1YL 2RDGA 3JAMi 4DR1L 1FNUA 2F0NA 3QWNA 1VQOA 1KAAA 2ICIA 2JE6I 4A3GH 3N52A 1II3A 3SK5A 3PMFA 5A35A 1N32L 1EYCA 4L6TB 3NXWA 1Y1WG 3AB9A 4DV5L 4QIWE 2GVBA 3PO3G 4A3MB 2DUDA 1I6VC 2NVXB 3NEMA 2PMZE 1STBA 5ELFA 1LTAD 1WTVA 3CXCA 2V4DA 2G9HD 2BDNA 2F0DA 3PF4A 1U4MA 1YHBA 3I2ZA 2SEBD 2NVYH 1LT5D 1NJIC 4OIKA 2E76C 4RMFA 3C1FA 4MZ9A 2QDLA 1DOMA 4YWKA 4LWCA 1RTOA 1PH5A 5CORA 3DWAA 1IBLQ 4DV0Q 1Z7TA 4PG3A 1NNXA 1X56A 1GKHA 4OXPA 1YEZA 5C3EG 1EYDA 3D8GA 2JEAI 2A6EC 4DK0A 1NMGA 3ITPA 4LFAQ 3MXNA 5T1GA 1WCMG 1Q3LA 5JEAJ 1IKMA 1XTCD 1SMYC 4ZUJA 1Y1WH 5IIFA 1SAPA 2KCMA 4B3RQ 3T56B 3SR1A 4JI5L 1B70B 4JPBW 1HQMC 1C4QA 4OGQC 4ZKBB 2UUAQ 1KNEA 1M1KC 2NBFA 1NMFA 3KBXA 3NWSA 3U4ZA 2MO1A 4RHSA 3HKZE 4DR6Q 4JK1C
chains in the Genus database with same CATH topology
3UDGA 3W1GA 4DV7L 4LW1A 1QVGA 2QGQA 4LUVA 3AEVA 4A3EH 1KL9A 1VQMA 4K0KQ 1X3GA 2D0PA 1TWHH 3M9BA 3ULJA 1SN8A 4NXML 4JYAL 2R7ZG 3F1ZA 2L15A 4DR2L 1XNRQ 3CAMA 4AH6A 3S16H 1EYGA 5IYCH 4C3HH 3GTJH 4A3CG 1E3PA 5C3EH 5IYBH 4DR7Q 3UDFA 4DV2L 4P75A 2Z6KA 2AWOA 4DR4Q 3A0JA 3STBC 2EQSA 1CUKA 3PUVA 2IHEA 4GOPA 3KF6A 1VQ7A 3KFUA 3BZCA 5LMNQ 1VQGA 4BY1H 3RLFA 2B63G 3CC7A 4NPSA 1JMCA 4QY7A 3GTMH 4HIKA 4LNQA 2Q2UA 2BH8A 5M3MG 4YHHL 2F4VL 4JOIC 4QL5A 1V1QA 1K0RA 4J15A 4A3IG 1AE2A 3KJOA 3GTKH 2IX0A 1HNZQ 1I6HH 2VNUD 1XTDA 5IT9c 4X6AH 1VQBA 2UUCQ 4DR5L 2VQEQ 4LF9L 2JQOA 4DV1Q 4JI1Q 2ZTEA 4A76A 4A3KH 2AMCB 2YV5A 1VQAA 4GN5A 2HIXA 1XMOQ 4B3TQ 1SE8A 4QJFA 1KHIA 4A3LH 2EIFA 3S1NH 4UPAA 4B3SL 1L1OA 4H02A 4PZ8A 1FVIA 1BKBA 4P73A 4R4QA 4HJAA 5GADC 3A74A 2R92G 4FDBA 4R1JA 3RNUA 2R7ZH 3PIOA 1PH1A 3TS2A 2YTVA 3HOWG 1XPOA 3H3VH 5IP7H 4LF7L 4DV6L 3PCOB 1FJGQ 3T1HQ 4A3CH 4MNOA 1SRUA 2WAQG 4YCWA 4X62Q 4HJ7A 1Q12A 2KHJA 4A3FG 3FP9A 1PH7A 4A3DH 1N32Q 2OQKA 2K5HA 3KDFB 4HIDA 3K80C 3CCLA 3M85A 4DAMA 1WJJA 4OO1I 4PMWA 1QVFA 3S2DH 3OTOQ 1YI2A 4JBJA 1AE3A 5IE8A 2DGYA 2UXBL 1PH4A 2K5VA 1RL2A 5JJKA 3PGZA 4BBSH 2BH2A 3HOYH 4JI0L 1NTGA 4A3IH 5M5XH 1ASYA 1UE6A 1UE1A 2AWNA 3E0EA 4JOIA 3KJPA 3CPWA 3CCMA 4LF4Q 4A3JG 1Q82C 2OTLA 1B8AA 3J7A5 4JI8Q 4DK6C 3AQQA 1N9WA 3ER0A 3HKSA 4C3IH 4DUYQ 2ES2A 1N8RC 2AHOB 1CSQA 2XTIA 4B3ML 2JA5H 4DUZL 1MIUA 3W5OA 2OWOA 3S15H 5E7NA 5EAYA 3S1RH 2ZJPA 5DLQE 4C2MH 5IY0A 1G6PA 4L5SA 1X6OA 4JBWA 2VL6A 5C44H 1Z47A 4LFBL 3EN2A 1BVSA 1VS0A 2WB1E 5J3BA 5M5WH 5GAHC 3PIPA 4DK3C 3GDEA 4PZ6A 1N36L 1WI5A 2XGTA 1TWFH 2R92H 1P16A 4GS3A 4X66L 1Q7YC 2UXDL 3CCJA 1HNWL 5HY6A 1Q46A 3AFPA 3ERSX 3I55A 1C7YA 4BA2I 5LMUQ 4UP9A 5C0XJ 5IWAQ 1IBLL 3GTPH 1XMQQ 1IL2A 1EIYB 3HOUH 2R6GA 1HR0L 2NVQH 1Y1VG 2JK8A 1JB7A 1DGSA 4A93G 4O2DA 1XPUA 3PO3H 4GKJQ 2I5MX 1PH2A 4LF6Q 4HIOA 5BR8L 1QUQA 1IBKQ 3CC2A 4Y52H 1Q1EA 1UE7A 2UU9Q 1T9HA 2E8GA 1VQ5A 2YTXA 4APVA 1YHAA 3RZDH 3I7FA 2UUBQ 3L7ZC 3M4PA 2HHHQ 2B3GA 5C4XG 2N78A 2IX1A 1X3EA 4HIMA 2KENA 1QZHA 3S24A 3BU2A 1EFWA 2OQ0A 3OYYA 3PSIA 1VQ4A 4B3RL 2CCZA 1W2BA 4JI6Q 4O0AA 3MXNB 2UUAL 4IPDA 4DV7Q 1Q86C 4AQYL 1E1TA 1PH8A 1N33Q 2R93H 1YZ6A 3HOZH 4L5QA 1EQRA 4BBRH 4DV4L 2K5NA 3PF5A 3S14H 3TRZA 4NXMQ 3STBD 1HNXL 4JI2L 5AJ3L 1PA6A 1GO3E 1BBUA 4LF8Q 4BY7H 4DR6L 3HKZG 5GROA 5IYDG 3TEHB 3TS0A 1YBYA 2IY5B 1JJ2A 2QEXA 1VQJA 1WCMH 4DV2Q 3CCUA 4KHPL 4AYBE 4YWLA 1JT8A 1CKOA 2KHIA 3E9IA 2ALYB 3CMAA 1LYLA 4X65L 1CSPA 2RHQB 4K0KL 3GD7A 1N34Q 4IFDJ 4R4CA 2RHSB 3D0FA 4JI3L 4DNIA 1IBML 1HJPA 4P74A 1I3QH 4NXNQ 1I5FA 4HJ5A 3HOVH 2OCEA 4A3GG 3G48A 2VY3A 1S72A 2UXCQ 3Q8DA 4DR7L 2I5HA 4YHHQ 4JI4L 1KRTA 1U5KA 2E2IH 2F4VQ 3PO2G 4A3BG 2Z0SA 4LUZA 2EXDA 1D7QA 1VQDA 2Y0SE 4DV3Q 4OWWB 3K0XA 4YCVA 4R4IA 1UE5A 4YY3L 3I4MG 2ZM6L 1XPRA 3GTQH 2MO0A 3CCQA 4OO1G 4LF9Q 4OX9L 1VQPA 2CWPA 3GO5A 1HZAA 1FGUA 1JE5A 1X3FA 3CPFA 2A8VA 3SGIA 1GD7A 1AH9A 4A3MG 1TWCH 1FL0A 1NE3A 1UWVA 5FJ8G 4GOPB 4GNXB 3T1YQ 4B3SQ 1E24A 1VQLA 1K83H 1HNZL 4AIMA 1LTLA 4DR1Q 1VQ9A 3RZOH 3KDFA 1KXLA 3H3VI 2V1CC 4C3JH 1O7IA 2UUCL 4ME3A 1Q1BA 1YIJA 3AYHB 2E2JH 1PHJA 4DV1L 3PUXA 2ZTCA 3NBHB 4KLKA 4L5TA 4OWXB 1HH2P 1HR0W 2GN5A 4DV6Q 4R4OA 3DLLA 1B7YB 3ZJYC 1XMOL 4B3TL 3RN5A 4UY8C 4GN3B 3WWVA 1M90C 2D62A 4HJ9A 4IPHA 2NZHA 1L2FA 4BA1I 2R7FA 3M7NA 4DV5Q 3KOJA 3H0GG 1VQFA 4P72A 3J81i 3HOXG 4LF5Q 2B63H 3NENA 1CKNB 3DM3A 2PQAB 1HZBA 1XNQQ 3M4OH 1QZGA 1PVOA 1TWGH 3EIVA 3GTOH 1FJGL 5M3MH 4DR3Q 4PZ7A 4EX5A 1J5EQ 1L1OB 1G291 1OTCA 4LUOA 4JI7Q 1KAWA 1RIPA 2VQFQ 3CF5A 1K9MC 1K8GA 3PO2H 4A3BH 1SFOH 2R7DA 4QQBX 3G4SA 1E7ZA 1X54A 4TQUS 4GKKQ 3RLOA 3FKIG 3OTOL 2PI2E 1I94Q 1Q8KA 2B29A 4KI0A 4QGUA 3CCSA 1TXYA 4B3MQ 3U58A 3D31A 1OXXK 5JEAG 1U0LA 1R9TH 2E5LL 1VQIA 4A75A 2NVXH 2VZAA 1PV4A 1IYJB 1EQQA 4BXXG 1WFQA 2RF4A 4X64L 2F3IA 4LFBQ 2AKWB 4LF4L 4L5RC 1SR3A 3K8AA 2OTJA 1K3RA 4JI8L 3HOWH 4DUYL 1GVPA 2D0OA 1KIXA 3CP0A 5JJLA 5C4JH 4A3FH 2I0QA 4DV0L 1LUZA 4A3EG 2NZOA 4YWMA 1I50H 2N49A 2Q2IA 3BZKA 5HGQA 3F2BA 1CKMA 1NY4A 1X9NA 3J81j 3M3YH 3CD6A 5ELOA 2C35B 2CQOA 4JV5L 1W3SA 3H0GH 2JA9A 3PUYA 2NVTH 1OXSC 1VQCA 2PI2A 2WB1G 3CQZH 3F2CA 3GTLH 4JI5Q 1LM0A 3HOXH 1S3OA 4LFAL 3K7UC 5LMNW 4OONA 1TWAH 3U4VA 2ZTDA 1SMXA 4GNXC 1IXRA 3J81c 3CW2C 1X65A 2KCTA 3F2DA 2CWAA 1UEBA 5IWAL 3TQYA 2K75A 1OXTA 2ZJRA 1D8LA 3BJUA 3UE1A 1HZ9A 4A3JH 4GKJL 1C0AA 2E2HH 2JEBI 1A63A 2K4KA 3FKIH 2MFIA 4LF6L 2JA7G 4IJHA 1IBKL 4R4TA 4IO9A 1VQHA 4LFCL 2ID0A 4POFA 2CKZB 1VQEA 1PH6A 4AQYQ 4JYAQ 2A19A 1YVCA 3A5UA 4DV4Q 4IOCA 2UUBL 4JBKA 2N3SA 4DR2Q 3E9HA 4RG1A 4ALPA 4P71A 1Y14B 4JI2Q 1PYBA 3ULLA 4TVAB 3KLWA 5M5YH 5IP9G 1VQKA 1Q81C 1E1OA 4OX9Q 1JJCB 3G6EA 1SROA 1YJ9A 4KHPQ 3S17H 2IT1A 3J7ZC 1N33L 5JJIA 4NB3A 5H1SE 2HQLA 4X65Q 1ASZA 1Y1VH 4A93H 1C9OA 2ZJQA 5IYDH 1XNRL 2VUMG 1VCIA 4JI3Q 4JBMA 1J6QA 3PUWA 5GQOA 1IBMQ 4LF8L 1VQ6A 5IP7G 5FLXc 4DR4L 4XIGS 5GAGC 3FHWA 3LGJA 2VW9A 2JA8G 4A3DG 4IFDI 4Y7NH 3RN2A 4JI4Q 1A62A 2LXJA 1OXVA 4AYBG 2MNAA 3CC4A 5LMNL 1EOVA 2N8NA 3GTGH 4XTCS 5K36G 1KQSA 3UDXA 5C4XH 2K50A 1N34L 4GNXA 4DR5Q 2K14A 1V43A 2KBNA 2NN6G 4YY3Q 1KRSA 2H5XA 4NXNL 5ELNA 3J80i 3U50C 2ZM6Q 3H15A 2A1AA 2I5LX 5M3FG 3CCVA 3F8TA 3B6YA 3K7AH 2BA0A 3VDYA 2JA7H 4IOAA 3L2PA 2UXCL 2PNHA 3KF6B 4JCVE 3I4OA 4DPGA 3HOYG 4BBSG 1H95A 2LXKA 2LSSA 3A5ZB 4MTNA 2HIVA 2BA1A 4DV3L 2VQEL 2Y0SG 4JC0A 3CMEA 2YYZA 3CCEA 4JI1L 4WJ4A 4A4IA 4LF7Q 3ULPA 1A8VA 5GAEC 2WAQE 2Q2TA 1VQNA 2JA6G 1CKNA 2JA5G 2PQAA 5IP9H 1A0IA 4GLXA 2F52A 5FLMG 2WFWA 2NN6I 3K81C 3T1YL 1G51A 1VQ8A 3ICEA 3JAMi 5C44G 4DR1L 1YHQA 3I4NG 3S2HH 2CFMA 2ATWA 1VQOA 2UXBQ 1IZ6A 2VUMH 2JE6I 1KC8C 3PUZA 3T1HL 4A3GH 1EUJA 4X62L 3KF8B 4BY7G 3NELA 1N32L 2VS1A 4JI0Q 3M4QA 4UP7A 2JA8H 1Y1WG 1PH3A 3HOUG 4OWTB 4DV5L 1Z9FA 1KD1C 2YTYA 2GVBA 4QIWE 3PO3G 3I4MH 2DUDA 3NEMA 2PMZE 2JJQA 4LF5L 4HJ8A 3RR5A 1MKHA 3TREA 4DKAC 3CXCA 3S1QH 1XNQL 4DUZQ 1QVCA 1NBWA 5M3FH 1OXUA 4DR3L 2RCNA 3UDIA 4A3MH 1J5EL 3PF4A 1SLJA 1YHBA 3I2ZA 5C0XG 5FJ8H 3J80c 4JI7L 2E5LQ 2VQFL 2NVYH 1PYSB 1NJIC 3W1BA 4DAYB 4X64Q 1N36Q 4GKKL 2Q2HA 2HT1A 2WP8J 1JJGA 4RMFA 4MZ9A 4X66Q 1I94L 4YCUA 3HFZB 1WOCA 2MQHA 1HNWQ 2UXDQ 4YWKA 4LWCA 3UE0A 1PH5A 2JA6H 3AFQA 2R93G 4GLAC 2GVAA 1IBLQ 4DV0Q 3HOZG 4BBRG 1HR0Q 4GLVB 3MEFA 5FLMH 1YJWA 4WJ3M 4IJLA 4PG3A 1X56A 4JV5Q 1GKHA 4OXPA 5IYCG 1P8LA 3I56A 2Z6KC 1YJNA 1K73C 3I4NH 3G71A 1YEZA 5IYBG 1YNXA 5BR8Q 5C3EG 2JEAI 2K52A 4JG2A 1HZCA 3JAMc 5C0XI 1NMGA 4GOPC 4LFAQ 1WCMG 1L0WA 5LMUL 1PH9A 5JEAJ 1K8AC 1EIFA 4KHZA 1XMQL 4EQ5A 4POGA 3KYHC 4BY1G 2FXQA 3CCRA 1Y1WH 1E22A 1MJEA 1GM5A 4UP8A 2KCMA 4B3RQ 3HOVG 4JI5L 3S1MH 1BBWA 1B70B 1PFSA 2UU9L 1S40A 1MJCA 3OW2A 4GN4B 2UUAQ 1M1KC 4LFCQ 1NMFA 1XJVA 1X55A 3IRBA 2HHHL 4IPCA 3L0OA 4BXXH 2IHFA 4IFDG 1HNXQ 3U4ZA 2MO1A 1YITA 2ASBA 5AJ3Q 1QUQB 1EWIA 3PV0A 3HKZE 1V9PA 3JC66 3RLNA 2QA4A 1L1OC 4A3KG 2YU9H 4IPGA 3EBEA 4JI6L 4DR6Q 1WYDA 4A3LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDG A;  3W1G A;  4DV7 L;  4LW1 A;  1QVG A;  2QGQ A;  4LUV A;  3AEV A;  4A3E H;  1KL9 A;  1VQM A;  4K0K Q;  1X3G A;  2D0P A;  1TWH H;  3M9B A;  3ULJ A;  1SN8 A;  4NXM L;  4JYA L;  2R7Z G;  3F1Z A;  2L15 A;  4DR2 L;  1XNR Q;  3CAM A;  4AH6 A;  3S16 H;  1EYG A;  5IYC H;  4C3H H;  3GTJ H;  4A3C G;  1E3P A;  5C3E H;  5IYB H;  4DR7 Q;  3UDF A;  4DV2 L;  4P75 A;  2Z6K A;  2AWO A;  4DR4 Q;  3A0J A;  3STB C;  2EQS A;  1CUK A;  3PUV A;  2IHE A;  4GOP A;  3KF6 A;  1VQ7 A;  3KFU A;  3BZC A;  5LMN Q;  1VQG A;  4BY1 H;  3RLF A;  2B63 G;  3CC7 A;  4NPS A;  1JMC A;  4QY7 A;  3GTM H;  4HIK A;  4LNQ A;  2Q2U A;  2BH8 A;  5M3M G;  4YHH L;  2F4V L;  4JOI C;  4QL5 A;  1V1Q A;  1K0R A;  4J15 A;  4A3I G;  1AE2 A;  3KJO A;  3GTK H;  2IX0 A;  1HNZ Q;  1I6H H;  2VNU D;  1XTD A;  5IT9 c;  4X6A H;  1VQB A;  2UUC Q;  4DR5 L;  2VQE Q;  4LF9 L;  2JQO A;  4DV1 Q;  4JI1 Q;  2ZTE A;  4A76 A;  4A3K H;  2AMC B;  2YV5 A;  1VQA A;  4GN5 A;  2HIX A;  1XMO Q;  4B3T Q;  1SE8 A;  4QJF A;  1KHI A;  4A3L H;  2EIF A;  3S1N H;  4UPA A;  4B3S L;  1L1O A;  4H02 A;  4PZ8 A;  1FVI A;  1BKB A;  4P73 A;  4R4Q A;  4HJA A;  5GAD C;  3A74 A;  2R92 G;  4FDB A;  4R1J A;  3RNU A;  2R7Z H;  3PIO A;  1PH1 A;  3TS2 A;  2YTV A;  3HOW G;  1XPO A;  3H3V H;  5IP7 H;  4LF7 L;  4DV6 L;  3PCO B;  1FJG Q;  3T1H Q;  4A3C H;  4MNO A;  1SRU A;  2WAQ G;  4YCW A;  4X62 Q;  4HJ7 A;  1Q12 A;  2KHJ A;  4A3F G;  3FP9 A;  1PH7 A;  4A3D H;  1N32 Q;  2OQK A;  2K5H A;  3KDF B;  4HID A;  3K80 C;  3CCL A;  3M85 A;  4DAM A;  1WJJ A;  4OO1 I;  4PMW A;  1QVF A;  3S2D H;  3OTO Q;  1YI2 A;  4JBJ A;  1AE3 A;  5IE8 A;  2DGY A;  2UXB L;  1PH4 A;  2K5V A;  1RL2 A;  5JJK A;  3PGZ A;  4BBS H;  2BH2 A;  3HOY H;  4JI0 L;  1NTG A;  4A3I H;  5M5X H;  1ASY A;  1UE6 A;  1UE1 A;  2AWN A;  3E0E A;  4JOI A;  3KJP A;  3CPW A;  3CCM A;  4LF4 Q;  4A3J G;  1Q82 C;  2OTL A;  1B8A A;  3J7A 5;  4JI8 Q;  4DK6 C;  3AQQ A;  1N9W A;  3ER0 A;  3HKS A;  4C3I H;  4DUY Q;  2ES2 A;  1N8R C;  2AHO B;  1CSQ A;  2XTI A;  4B3M L;  2JA5 H;  4DUZ L;  1MIU A;  3W5O A;  2OWO A;  3S15 H;  5E7N A;  5EAY A;  3S1R H;  2ZJP A;  5DLQ E;  4C2M H;  5IY0 A;  1G6P A;  4L5S A;  1X6O A;  4JBW A;  2VL6 A;  5C44 H;  1Z47 A;  4LFB L;  3EN2 A;  1BVS A;  1VS0 A;  2WB1 E;  5J3B A;  5M5W H;  5GAH C;  3PIP A;  4DK3 C;  3GDE A;  4PZ6 A;  1N36 L;  1WI5 A;  2XGT A;  1TWF H;  2R92 H;  1P16 A;  4GS3 A;  4X66 L;  1Q7Y C;  2UXD L;  3CCJ A;  1HNW L;  5HY6 A;  1Q46 A;  3AFP A;  3ERS X;  3I55 A;  1C7Y A;  4BA2 I;  5LMU Q;  4UP9 A;  5C0X J;  5IWA Q;  1IBL L;  3GTP H;  1XMQ Q;  1IL2 A;  1EIY B;  3HOU H;  2R6G A;  1HR0 L;  2NVQ H;  1Y1V G;  2JK8 A;  1JB7 A;  1DGS A;  4A93 G;  4O2D A;  1XPU A;  3PO3 H;  4GKJ Q;  2I5M X;  1PH2 A;  4LF6 Q;  4HIO A;  5BR8 L;  1QUQ A;  1IBK Q;  3CC2 A;  4Y52 H;  1Q1E A;  1UE7 A;  2UU9 Q;  1T9H A;  2E8G A;  1VQ5 A;  2YTX A;  4APV A;  1YHA A;  3RZD H;  3I7F A;  2UUB Q;  3L7Z C;  3M4P A;  2HHH Q;  2B3G A;  5C4X G;  2N78 A;  2IX1 A;  1X3E A;  4HIM A;  2KEN A;  1QZH A;  3S24 A;  3BU2 A;  1EFW A;  2OQ0 A;  3OYY A;  3PSI A;  1VQ4 A;  4B3R L;  2CCZ A;  1W2B A;  4JI6 Q;  4O0A A;  3MXN B;  2UUA L;  4IPD A;  4DV7 Q;  1Q86 C;  4AQY L;  1E1T A;  1PH8 A;  1N33 Q;  2R93 H;  1YZ6 A;  3HOZ H;  4L5Q A;  1EQR A;  4BBR H;  4DV4 L;  2K5N A;  3PF5 A;  3S14 H;  3TRZ A;  4NXM Q;  3STB D;  1HNX L;  4JI2 L;  5AJ3 L;  1PA6 A;  1GO3 E;  1BBU A;  4LF8 Q;  4BY7 H;  4DR6 L;  3HKZ G;  5GRO A;  5IYD G;  3TEH B;  3TS0 A;  1YBY A;  2IY5 B;  1JJ2 A;  2QEX A;  1VQJ A;  1WCM H;  4DV2 Q;  3CCU A;  4KHP L;  4AYB E;  4YWL A;  1JT8 A;  1CKO A;  2KHI A;  3E9I A;  2ALY B;  3CMA A;  1LYL A;  4X65 L;  1CSP A;  2RHQ B;  4K0K L;  3GD7 A;  1N34 Q;  4IFD J;  4R4C A;  2RHS B;  3D0F A;  4JI3 L;  4DNI A;  1IBM L;  1HJP A;  4P74 A;  1I3Q H;  4NXN Q;  1I5F A;  4HJ5 A;  3HOV H;  2OCE A;  4A3G G;  3G48 A;  2VY3 A;  1S72 A;  2UXC Q;  3Q8D A;  4DR7 L;  2I5H A;  4YHH Q;  4JI4 L;  1KRT A;  1U5K A;  2E2I H;  2F4V Q;  3PO2 G;  4A3B G;  2Z0S A;  4LUZ A;  2EXD A;  1D7Q A;  1VQD A;  2Y0S E;  4DV3 Q;  4OWW B;  3K0X A;  4YCV A;  4R4I A;  1UE5 A;  4YY3 L;  3I4M G;  2ZM6 L;  1XPR A;  3GTQ H;  2MO0 A;  3CCQ A;  4OO1 G;  4LF9 Q;  4OX9 L;  1VQP A;  2CWP A;  3GO5 A;  1HZA A;  1FGU A;  1JE5 A;  1X3F A;  3CPF A;  2A8V A;  3SGI A;  1GD7 A;  1AH9 A;  4A3M G;  1TWC H;  1FL0 A;  1NE3 A;  1UWV A;  5FJ8 G;  4GOP B;  4GNX B;  3T1Y Q;  4B3S Q;  1E24 A;  1VQL A;  1K83 H;  1HNZ L;  4AIM A;  1LTL A;  4DR1 Q;  1VQ9 A;  3RZO H;  3KDF A;  1KXL A;  3H3V I;  2V1C C;  4C3J H;  1O7I A;  2UUC L;  4ME3 A;  1Q1B A;  1YIJ A;  3AYH B;  2E2J H;  1PHJ A;  4DV1 L;  3PUX A;  2ZTC A;  3NBH B;  4KLK A;  4L5T A;  4OWX B;  1HH2 P;  1HR0 W;  2GN5 A;  4DV6 Q;  4R4O A;  3DLL A;  1B7Y B;  3ZJY C;  1XMO L;  4B3T L;  3RN5 A;  4UY8 C;  4GN3 B;  3WWV A;  1M90 C;  2D62 A;  4HJ9 A;  4IPH A;  2NZH A;  1L2F A;  4BA1 I;  2R7F A;  3M7N A;  4DV5 Q;  3KOJ A;  3H0G G;  1VQF A;  4P72 A;  3J81 i;  3HOX G;  4LF5 Q;  2B63 H;  3NEN A;  1CKN B;  3DM3 A;  2PQA B;  1HZB A;  1XNQ Q;  3M4O H;  1QZG A;  1PVO A;  1TWG H;  3EIV A;  3GTO H;  1FJG L;  5M3M H;  4DR3 Q;  4PZ7 A;  4EX5 A;  1J5E Q;  1L1O B;  1G29 1;  1OTC A;  4LUO A;  4JI7 Q;  1KAW A;  1RIP A;  2VQF Q;  3CF5 A;  1K9M C;  1K8G A;  3PO2 H;  4A3B H;  1SFO H;  2R7D A;  4QQB X;  3G4S A;  1E7Z A;  1X54 A;  4TQU S;  4GKK Q;  3RLO A;  3FKI G;  3OTO L;  2PI2 E;  1I94 Q;  1Q8K A;  2B29 A;  4KI0 A;  4QGU A;  3CCS A;  1TXY A;  4B3M Q;  3U58 A;  3D31 A;  1OXX K;  5JEA G;  1U0L A;  1R9T H;  2E5L L;  1VQI A;  4A75 A;  2NVX H;  2VZA A;  1PV4 A;  1IYJ B;  1EQQ A;  4BXX G;  1WFQ A;  2RF4 A;  4X64 L;  2F3I A;  4LFB Q;  2AKW B;  4LF4 L;  4L5R C;  1SR3 A;  3K8A A;  2OTJ A;  1K3R A;  4JI8 L;  3HOW H;  4DUY L;  1GVP A;  2D0O A;  1KIX A;  3CP0 A;  5JJL A;  5C4J H;  4A3F H;  2I0Q A;  4DV0 L;  1LUZ A;  4A3E G;  2NZO A;  4YWM A;  1I50 H;  2N49 A;  2Q2I A;  3BZK A;  5HGQ A;  3F2B A;  1CKM A;  1NY4 A;  1X9N A;  3J81 j;  3M3Y H;  3CD6 A;  5ELO A;  2C35 B;  2CQO A;  4JV5 L;  1W3S A;  3H0G H;  2JA9 A;  3PUY A;  2NVT H;  1OXS C;  1VQC A;  2PI2 A;  2WB1 G;  3CQZ H;  3F2C A;  3GTL H;  4JI5 Q;  1LM0 A;  3HOX H;  1S3O A;  4LFA L;  3K7U C;  5LMN W;  4OON A;  1TWA H;  3U4V A;  2ZTD A;  1SMX A;  4GNX C;  1IXR A;  3J81 c;  3CW2 C;  1X65 A;  2KCT A;  3F2D A;  2CWA A;  1UEB A;  5IWA L;  3TQY A;  2K75 A;  1OXT A;  2ZJR A;  1D8L A;  3BJU A;  3UE1 A;  1HZ9 A;  4A3J H;  4GKJ L;  1C0A A;  2E2H H;  2JEB I;  1A63 A;  2K4K A;  3FKI H;  2MFI A;  4LF6 L;  2JA7 G;  4IJH A;  1IBK L;  4R4T A;  4IO9 A;  1VQH A;  4LFC L;  2ID0 A;  4POF A;  2CKZ B;  1VQE A;  1PH6 A;  4AQY Q;  4JYA Q;  2A19 A;  1YVC A;  3A5U A;  4DV4 Q;  4IOC A;  2UUB L;  4JBK A;  2N3S A;  4DR2 Q;  3E9H A;  4RG1 A;  4ALP A;  4P71 A;  1Y14 B;  4JI2 Q;  1PYB A;  3ULL A;  4TVA B;  3KLW A;  5M5Y H;  5IP9 G;  1VQK A;  1Q81 C;  1E1O A;  4OX9 Q;  1JJC B;  3G6E A;  1SRO A;  1YJ9 A;  4KHP Q;  3S17 H;  2IT1 A;  3J7Z C;  1N33 L;  5JJI A;  4NB3 A;  5H1S E;  2HQL A;  4X65 Q;  1ASZ A;  1Y1V H;  4A93 H;  1C9O A;  2ZJQ A;  5IYD H;  1XNR L;  2VUM G;  1VCI A;  4JI3 Q;  4JBM A;  1J6Q A;  3PUW A;  5GQO A;  1IBM Q;  4LF8 L;  1VQ6 A;  5IP7 G;  5FLX c;  4DR4 L;  4XIG S;  5GAG C;  3FHW A;  3LGJ A;  2VW9 A;  2JA8 G;  4A3D G;  4IFD I;  4Y7N H;  3RN2 A;  4JI4 Q;  1A62 A;  2LXJ A;  1OXV A;  4AYB G;  2MNA A;  3CC4 A;  5LMN L;  1EOV A;  2N8N A;  3GTG H;  4XTC S;  5K36 G;  1KQS A;  3UDX A;  5C4X H;  2K50 A;  1N34 L;  4GNX A;  4DR5 Q;  2K14 A;  1V43 A;  2KBN A;  2NN6 G;  4YY3 Q;  1KRS A;  2H5X A;  4NXN L;  5ELN A;  3J80 i;  3U50 C;  2ZM6 Q;  3H15 A;  2A1A A;  2I5L X;  5M3F G;  3CCV A;  3F8T A;  3B6Y A;  3K7A H;  2BA0 A;  3VDY A;  2JA7 H;  4IOA A;  3L2P A;  2UXC L;  2PNH A;  3KF6 B;  4JCV E;  3I4O A;  4DPG A;  3HOY G;  4BBS G;  1H95 A;  2LXK A;  2LSS A;  3A5Z B;  4MTN A;  2HIV A;  2BA1 A;  4DV3 L;  2VQE L;  2Y0S G;  4JC0 A;  3CME A;  2YYZ A;  3CCE A;  4JI1 L;  4WJ4 A;  4A4I A;  4LF7 Q;  3ULP A;  1A8V A;  5GAE C;  2WAQ E;  2Q2T A;  1VQN A;  2JA6 G;  1CKN A;  2JA5 G;  2PQA A;  5IP9 H;  1A0I A;  4GLX A;  2F52 A;  5FLM G;  2WFW A;  2NN6 I;  3K81 C;  3T1Y L;  1G51 A;  1VQ8 A;  3ICE A;  3JAM i;  5C44 G;  4DR1 L;  1YHQ A;  3I4N G;  3S2H H;  2CFM A;  2ATW A;  1VQO A;  2UXB Q;  1IZ6 A;  2VUM H;  2JE6 I;  1KC8 C;  3PUZ A;  3T1H L;  4A3G H;  1EUJ A;  4X62 L;  3KF8 B;  4BY7 G;  3NEL A;  1N32 L;  2VS1 A;  4JI0 Q;  3M4Q A;  4UP7 A;  2JA8 H;  1Y1W G;  1PH3 A;  3HOU G;  4OWT B;  4DV5 L;  1Z9F A;  1KD1 C;  2YTY A;  2GVB A;  4QIW E;  3PO3 G;  3I4M H;  2DUD A;  3NEM A;  2PMZ E;  2JJQ A;  4LF5 L;  4HJ8 A;  3RR5 A;  1MKH A;  3TRE A;  4DKA C;  3CXC A;  3S1Q H;  1XNQ L;  4DUZ Q;  1QVC A;  1NBW A;  5M3F H;  1OXU A;  4DR3 L;  2RCN A;  3UDI A;  4A3M H;  1J5E L;  3PF4 A;  1SLJ A;  1YHB A;  3I2Z A;  5C0X G;  5FJ8 H;  3J80 c;  4JI7 L;  2E5L Q;  2VQF L;  2NVY H;  1PYS B;  1NJI C;  3W1B A;  4DAY B;  4X64 Q;  1N36 Q;  4GKK L;  2Q2H A;  2HT1 A;  2WP8 J;  1JJG A;  4RMF A;  4MZ9 A;  4X66 Q;  1I94 L;  4YCU A;  3HFZ B;  1WOC A;  2MQH A;  1HNW Q;  2UXD Q;  4YWK A;  4LWC A;  3UE0 A;  1PH5 A;  2JA6 H;  3AFQ A;  2R93 G;  4GLA C;  2GVA A;  1IBL Q;  4DV0 Q;  3HOZ G;  4BBR G;  1HR0 Q;  4GLV B;  3MEF A;  5FLM H;  1YJW A;  4WJ3 M;  4IJL A;  4PG3 A;  1X56 A;  4JV5 Q;  1GKH A;  4OXP A;  5IYC G;  1P8L A;  3I56 A;  2Z6K C;  1YJN A;  1K73 C;  3I4N H;  3G71 A;  1YEZ A;  5IYB G;  1YNX A;  5BR8 Q;  5C3E G;  2JEA I;  2K52 A;  4JG2 A;  1HZC A;  3JAM c;  5C0X I;  1NMG A;  4GOP C;  4LFA Q;  1WCM G;  1L0W A;  5LMU L;  1PH9 A;  5JEA J;  1K8A C;  1EIF A;  4KHZ A;  1XMQ L;  4EQ5 A;  4POG A;  3KYH C;  4BY1 G;  2FXQ A;  3CCR A;  1Y1W H;  1E22 A;  1MJE A;  1GM5 A;  4UP8 A;  2KCM A;  4B3R Q;  3HOV G;  4JI5 L;  3S1M H;  1BBW A;  1B70 B;  1PFS A;  2UU9 L;  1S40 A;  1MJC A;  3OW2 A;  4GN4 B;  2UUA Q;  1M1K C;  4LFC Q;  1NMF A;  1XJV A;  1X55 A;  3IRB A;  2HHH L;  4IPC A;  3L0O A;  4BXX H;  2IHF A;  4IFD G;  1HNX Q;  3U4Z A;  2MO1 A;  1YIT A;  2ASB A;  5AJ3 Q;  1QUQ B;  1EWI A;  3PV0 A;  3HKZ E;  1V9P A;  3JC6 6;  3RLN A;  2QA4 A;  1L1O C;  4A3K G;  2YU9 H;  4IPG A;  3EBE A;  4JI6 L;  4DR6 Q;  1WYD A;  4A3L G; 
#chains in the Genus database with same CATH topology
 1G8Z D;  3W1G A;  4DV7 L;  1D5M C;  4EGV A;  5DM6 3;  2QGQ A;  5F2D A;  4A3E H;  1Q90 A;  1KL9 A;  2AQ2 B;  1VQM A;  1X3G A;  1QCB D;  3M9B A;  1SN8 A;  2Z8L A;  4XT3 B;  1EIG A;  4Y7N B;  1G91 A;  2KHS A;  1XNR Q;  1EYG A;  1TS5 A;  2HUG A;  5C3E H;  4DV2 L;  2AWO A;  4HAE A;  5I2Y A;  3STB C;  1CUK A;  3BG3 A;  3TME A;  3NTH A;  1VQ7 A;  2B63 G;  3CC7 A;  4NPS A;  1JMC A;  4DAV A;  1D1I A;  4QY7 A;  2H1E A;  3GTM H;  4LNQ A;  3NBH A;  5M3M G;  1ZYR C;  2F4V L;  1STA A;  4JOI C;  5DM7 3;  3GTK H;  1SJH D;  2IJ0 A;  1XTD A;  5DAU A;  5IT9 c;  4A76 A;  3FEW X;  1VQA A;  4B3T Q;  2HIX A;  2QF7 A;  1SE8 A;  4QB4 A;  2K5Q A;  5EJW A;  2EIF A;  3BDL A;  3GQB A;  4B3S L;  4A3G B;  3KF8 A;  4R4Q A;  3DUZ A;  3A74 A;  5J39 A;  3RNU A;  3PIO A;  1PH1 A;  2YTV A;  3HOW G;  2ZXR A;  5IP7 H;  3T1H Q;  1ICW A;  4MNO A;  4Q5V A;  4A3F G;  3P7J A;  4KY7 A;  5I9P A;  2K5H A;  1DZ1 A;  2RCF A;  3KDF B;  3M85 A;  1WJJ A;  1BO0 A;  2PYK A;  4OO1 I;  3S2D H;  2O4X A;  4UHV A;  2NN6 H;  1LTR D;  4X3U A;  3HOY B;  1F2M A;  2DGY A;  2UXB L;  1QE6 A;  2NVY B;  2KJX A;  1SE4 A;  2BH2 A;  2X6L A;  2EDG A;  2EYH A;  4ILW A;  5M5X H;  1UE6 A;  2AWN A;  1PRT B;  3E0E A;  4JOI A;  3CPW A;  4DGZ A;  1Q82 C;  1B8A A;  1B2T A;  3J7A 5;  3VR4 A;  4DK6 C;  4C3I H;  3ER0 A;  2ES2 A;  1CSQ A;  4DK1 A;  4B3M L;  3Q0A A;  3I8Z A;  4C2M H;  3MAQ A;  1QB5 D;  2VL6 A;  4LFB L;  1RDP D;  2WB1 E;  5J3B A;  4BY7 G;  4DK3 C;  4PZ6 A;  1WI5 A;  1P16 A;  2EYM A;  3N6R A;  1VF7 A;  1Y1W B;  2O5I C;  1Q7Y C;  2UXD L;  3X3M A;  3TZU A;  2F0Q A;  4JW0 A;  1JWU D;  4UP9 A;  3GTP H;  1XMQ Q;  1HR0 L;  4A93 G;  1JB7 A;  3RUZ A;  1DCZ A;  4DAP A;  1MHW C;  5BR8 L;  3CC2 A;  1EOT A;  1UE7 A;  1FGB D;  2E8G A;  1S5D D;  3EJI A;  3M4P A;  4E6I A;  2IX1 A;  4A3E B;  2KEN A;  1QZH A;  5FKA C;  3S24 A;  1A2T A;  1W2B A;  1WTO A;  2R93 H;  1J9O A;  5C3E B;  4L5Q A;  4DV4 L;  4BBR H;  2K5N A;  3DXJ C;  5EPL A;  4PQX A;  2EYO A;  2F0W A;  1PA6 A;  2O2L D;  1BBU A;  1BCP D;  4BY7 H;  3HKZ G;  1C48 A;  3VR5 A;  3GTM B;  5I2X A;  3WOE A;  1CSP A;  2RHQ B;  4J6H A;  3GD7 A;  4X3S A;  1GUO A;  4QCL A;  5C3W A;  4FF3 A;  3D0F A;  3NQT A;  5C4Z A;  3GTK B;  4C1N I;  4NXN Q;  3MEH A;  4MHE A;  2ZXO A;  1AN8 A;  4IUV A;  4DR7 L;  2I5H A;  5A2Q L;  4JI4 L;  2E2I H;  2K7V A;  4A3B G;  1RKN A;  4CDC C;  2RSO A;  1FNV A;  1TKW B;  4DV3 Q;  2PQE A;  3I4M G;  3GTQ H;  1XPR A;  1UAP A;  4LF9 Q;  2LMC B;  2CWP A;  1FGU A;  3CPF A;  2A8V A;  1AH9 A;  1FL0 A;  3T1Y Q;  1E0B A;  2L55 A;  1E24 A;  1VQL A;  1K83 H;  1VQ9 A;  4DR1 Q;  2EPB A;  2DJF C;  1HPC A;  3HEJ A;  3LWU A;  1Q1B A;  1YIJ A;  1PHJ A;  1SND A;  3A8I E;  1HR0 W;  3S2D B;  1YNN D;  4UY8 C;  3ZJY C;  2MJ8 A;  4GN3 B;  3D6C A;  1HCZ A;  2EJM A;  3K5L A;  2NZH A;  3P75 A;  3R3O A;  4BA1 I;  2R7F A;  4KJN A;  4DV5 Q;  3H0G G;  3J7Y W;  1S5B D;  4XYO A;  3HOX G;  1H9K A;  3BVZ A;  3NEN A;  3OMG A;  5M5X B;  1HZB A;  1SYG A;  1TWG H;  1FJG L;  3LNN A;  4EX5 A;  3VYT A;  1G29 1;  4C3I B;  1EY4 A;  4LUO A;  3HP3 A;  1LLR D;  4A3B H;  2R7D A;  4QQB X;  4XQJ A;  4C2M B;  3FKI G;  3TBI B;  5LL6 X;  4ZUI A;  2B29 A;  4KI0 A;  1TY0 A;  4QGU A;  4WJW A;  2G9D A;  5NUC A;  4A75 A;  1PV4 A;  2EXZ A;  5CBA E;  2EJF C;  4LF4 L;  4L5R C;  3GTP B;  3NPP A;  4JI8 L;  2DNE A;  2WV6 D;  5HUR A;  1LV9 A;  2D0O A;  1KIX A;  5JJZ A;  1B44 D;  5C4J H;  4DV0 L;  1I50 H;  3OMC A;  1NY4 A;  3HZX A;  3M3Y H;  2C35 B;  2CQO A;  3H0G H;  1IW7 D;  1VQC A;  3F2C A;  2WB1 G;  3FRP B;  4C3H G;  4JI5 Q;  4HSV A;  3HOX H;  3DEO A;  1KLU D;  5J1Z A;  4LFA L;  3P1H A;  2ZT9 C;  3J81 c;  1B3Q A;  1JOK A;  1STH A;  1CFM A;  3F2D A;  1UEB A;  2PMZ B;  1WTW A;  2RA4 A;  2R93 B;  1CM9 A;  2K75 A;  1PYW D;  1OXT A;  4A3J H;  5C5L A;  2E2H H;  1EQV A;  1QOH A;  3FKI H;  3L9A X;  4FXK C;  4LF6 L;  4R4T A;  4ZK9 B;  2RBM A;  3NK9 A;  4BY7 B;  2WIN B;  1ROD A;  4AQY Q;  3I70 A;  1YVC A;  3A5U A;  1Y14 B;  1A6X A;  4DNR B;  5IP9 G;  1JJC B;  4M8A A;  4KKS A;  1YJ9 A;  2CVR A;  4NB3 A;  1B4O A;  4X65 Q;  1Y1V H;  1C9O A;  1SYC A;  2ZJQ A;  4CDE C;  2E2I B;  1XNR L;  2VUM G;  2L5T A;  1IBM Q;  4LF8 L;  1VQ6 A;  3GTG B;  5E3F A;  2SNS A;  3SK8 A;  5CV7 A;  3GTQ B;  4H13 C;  3FHW A;  1STG A;  1EY7 A;  5JOB A;  1OXV A;  2MHV A;  4IUQ A;  1EOV A;  1BCP C;  1LT6 D;  3ND8 A;  5ELD A;  1WTH A;  1V43 A;  1K83 B;  2EYP A;  2H5X A;  1RF2 D;  2OF1 A;  3U50 C;  3CCV A;  3F8T A;  4V0B A;  2BA0 A;  1CZW A;  3TSS A;  3FVQ A;  3L2P A;  1H95 A;  2LXK A;  3HKZ B;  2AUK A;  3CCE A;  2YYZ A;  5CV6 A;  3ULP A;  1O78 A;  2EY1 A;  5D3I B;  1CKN A;  1UUP A;  2PQA A;  1AW7 A;  5IP9 H;  1A0I A;  2F52 A;  1TWG B;  3SVM A;  1ESR A;  5C44 G;  2Z1C A;  3S2H H;  2PZT A;  2UXB Q;  1PMR A;  4A3B B;  2VUM H;  5BN3 A;  3R2T A;  2EY6 A;  3T1H L;  3BYY B;  3KF8 B;  2VS1 A;  4Q0F A;  2H4O A;  3M4Q A;  1F9R A;  1O80 A;  3HG9 A;  3HOU G;  1CTM A;  5BN4 A;  1ESF A;  1EU4 A;  1Q8I A;  1HQR D;  1W6K A;  1YNN C;  2JJQ A;  4HTH A;  3S1Q H;  1MKH A;  3TRE A;  1MSH A;  1BDO A;  2F03 A;  4WFN 3;  4DR3 L;  4A3M H;  1L0X B;  3UDI A;  3DWP A;  2PNR C;  1ICF B;  3J80 c;  3V05 A;  4JI7 L;  2E5L Q;  2EYL A;  2DN8 A;  2Z4I A;  1PYS B;  5C4J B;  2JP1 A;  1HUM A;  1I50 B;  1LTG D;  3AU7 A;  2Q2H A;  2WP8 J;  3M3Y B;  2JN4 A;  1I94 L;  2UXD Q;  3H0G B;  2MQH A;  1LTB D;  2TSS A;  3AFQ A;  3HOX B;  1AFP A;  4DFA A;  2F0H A;  3ERO A;  1HR0 Q;  3NQI A;  1YJW A;  4IJL A;  2MPM A;  1E2V A;  5IYC G;  3I56 A;  1YJN A;  3TP5 A;  2PPB C;  1SYF A;  1YNX A;  5BR8 Q;  2A68 D;  4JG2 A;  4F8M A;  3BVM A;  1SNO A;  2M00 A;  4A3J B;  1JR0 D;  1CI3 M;  2F0J A;  3C1E A;  2E2H B;  3FKI B;  1PH9 A;  4KHZ A;  1XMQ L;  4EQ5 A;  4ZYS A;  2Z9H A;  4BY1 G;  3IAY A;  2FXQ A;  3CCR A;  4KD3 A;  2K6A A;  3HOV G;  1BBW A;  5KRU A;  1BNZ A;  3OW2 A;  1PZK D;  4LFC Q;  5KYI A;  1X55 A;  3IRB A;  1X32 A;  1IW7 C;  4IFD G;  1YIT A;  4S3S A;  3I73 A;  3G7L A;  2YU9 H;  3RLN A;  2QA4 A;  1Y1V B;  4IPG A;  4A3L G;  1SYB A;  3UDG A;  1AP0 A;  1MI2 A;  1FR3 A;  4LW1 A;  3K5O A;  2WB1 B;  2D0P A;  4CDF C;  1EY5 A;  2R7Z G;  4LK1 C;  3F1Z A;  1I4H A;  3CAM A;  4AH6 A;  5IYC H;  3GTJ H;  4IQZ A;  4A3C G;  4DR7 Q;  1NAP A;  4P75 A;  5LL6 S;  1BOS A;  1O7Y A;  4HED A;  1NR2 A;  1SXT A;  2IHE A;  3OPO A;  3BZC A;  1Y69 U;  1STY A;  1VQG A;  4BY1 H;  1ILP A;  3RLF A;  3NHH A;  3OOC A;  4HIK A;  5ELC A;  2QEJ C;  4QF4 A;  1KDA A;  4XQN A;  4QL5 A;  4J15 A;  1AE2 A;  1U4L A;  3KJO A;  4L63 B;  3GP7 A;  2I07 B;  5IGF A;  1CQF A;  2DY7 A;  3QOL A;  4IFD H;  1NR4 A;  3E6Z X;  2JQO A;  3ONA B;  4LF9 L;  4JI1 Q;  3S2H B;  4ZCK A;  2AMC B;  1WD0 A;  1V1O A;  1KHI A;  2RDF A;  3QB3 A;  4A3L H;  2VUM B;  2A73 B;  1CHQ D;  3MHB A;  4F88 A;  4P73 A;  4CKE A;  4HJA A;  2R7Z H;  2K1B A;  1TII D;  3PCO B;  1VDZ A;  1FJG Q;  4A3C H;  1K0S A;  5JPN C;  1SRU A;  5IGG A;  4YCW A;  1E2W A;  2PCF B;  1F9P A;  4HJ7 A;  2KHJ A;  3FP9 A;  4A3D H;  3S1Q B;  1L0Y B;  4HID A;  3VR6 A;  1DOK A;  1SEB D;  3DMU A;  4PMW A;  3C46 A;  1YI2 A;  4ZLT F;  5ELB A;  4JBJ A;  1RD9 D;  5IE8 A;  2K5V A;  1RL2 A;  1JOQ A;  1PRT F;  5CGK A;  2XWJ B;  3HOY H;  4JI0 L;  3LWE A;  4O42 A;  3NTI A;  2ZXP A;  4RHR A;  1T5E A;  3OW7 A;  4LF4 Q;  3A56 A;  3L3O C;  4JI8 Q;  1N8R C;  3OWF A;  1HXY D;  2JA5 H;  2FHT A;  4DUZ L;  1MIU A;  2HD3 A;  5EAY A;  3K5M A;  1G6P A;  5IY0 A;  1NUC A;  3M7G A;  1X6O A;  1Z47 A;  3MC0 B;  3K59 A;  2XGT A;  1A3U A;  3TN2 A;  5KGU A;  3CCJ A;  1YNJ D;  3ERS X;  1C7Y A;  2ENB A;  3DM1 A;  2HCI A;  1EIY B;  2VB3 X;  2NVQ H;  2JK8 A;  3PO3 H;  3H6M A;  3T4A C;  1ET6 A;  4LF6 Q;  1KNA A;  1QUQ A;  1WD1 A;  3LX0 A;  1Q1E A;  4UDU C;  2YU9 B;  5C6A A;  2F0S A;  2YTX A;  2FFK B;  1KAB A;  1EY8 A;  3I7F A;  2HHH Q;  5C4X G;  3J7A V;  1X3E A;  3I72 A;  1WTR A;  2A68 C;  2OT2 A;  3U9O A;  3BU2 A;  1EFW A;  2OQ0 A;  3PSI A;  4FF2 A;  5FO9 B;  1IYU A;  1MSG A;  4NMZ A;  3RD4 A;  3IL8 A;  5M9O A;  3HRZ C;  3GTJ B;  4AQY L;  3S14 H;  2F0L A;  4NW2 A;  4WRD A;  1G2T A;  1HNX L;  5AJ3 L;  4G4K A;  4LF8 Q;  2X69 A;  2Z6B A;  3CHB D;  1LT4 D;  4BY1 B;  3TEH B;  1XWE A;  2L9H A;  1JJ2 A;  1VQJ A;  1WCM H;  4V19 0;  4AYB E;  4YWL A;  1JT8 A;  3URY A;  3E9I A;  3HOV B;  4X65 L;  4K0K L;  1V1P A;  4R4C A;  2RHS B;  4QUF A;  4DNI A;  1IBM L;  5FO7 B;  1I3Q H;  4HJ5 A;  1GUG A;  2EY2 A;  3X3N A;  2VY3 A;  3PIO 3;  1S72 A;  1EU3 A;  3Q8D A;  4YHH Q;  3SK4 A;  1U5K A;  3PO2 G;  3OIQ A;  1VQD A;  1BUV T;  2Y0S E;  4OWW B;  3K0X A;  2TMP A;  4HCS A;  3CCQ A;  4OO1 G;  2IW3 A;  1KTK A;  2EYJ A;  3GO5 A;  1X3F A;  2J7Z A;  2R7Z B;  2K5D A;  1F2Y A;  1B1Z A;  5FJ8 G;  1R4P B;  5FO8 B;  1DYQ A;  1I4X A;  3RZO H;  2EOT A;  4A3D B;  2HDL A;  2K03 A;  3F2U A;  1O7I A;  2UUC L;  1PTO D;  4ME3 A;  4IAL A;  3PUX A;  2QDB A;  4FXD A;  4TRD A;  2AQ3 B;  1XMO L;  4HJ9 A;  5EPK A;  3M7N A;  1TS3 A;  1U9R A;  1TVX A;  1VQF A;  2CH4 W;  2B63 H;  1CKN B;  2E74 C;  3DM3 A;  2PQA B;  2N88 A;  5EQ0 A;  1PVO A;  2RVL A;  5M3M H;  4DR3 Q;  1S4Z A;  1L1O B;  5G3L F;  3QIA A;  4JI7 Q;  1K8G A;  1U4R A;  3PO2 H;  2JA5 B;  5FLX L;  2PZU A;  1E7Z A;  1X54 A;  3NSW A;  3RLO A;  1WTP A;  2AUJ D;  2PI2 E;  1I94 Q;  2RSN A;  1Q8K A;  3V96 A;  4OO1 H;  3CCS A;  1TXY A;  3U58 A;  1OXX K;  1LTI D;  1EFI D;  2E5L L;  2XRQ D;  4DXF A;  1XX8 A;  1IYJ B;  4BXX G;  2IWH A;  1GUT A;  3D6W A;  1BCP B;  1SR3 A;  3K8A A;  2OTJ A;  2NVQ B;  3HOW H;  3PO3 B;  4HCE A;  2KCC A;  4PMC A;  3KLS X;  2OEO A;  3CP0 A;  5JJL A;  4A3F H;  4YWM A;  2N49 A;  5E1F A;  5HGQ A;  3CD6 A;  1JOO A;  5ELO A;  2WAC A;  3EQL C;  2JA9 A;  3PUY A;  3A8J E;  2PI2 A;  3M4Y A;  1LM0 A;  1S3O A;  3H3V C;  5LMN W;  4OON A;  1TWA H;  2SOB A;  1X65 A;  3SXH A;  3RMH A;  3SE0 A;  5IWA L;  2ZJR A;  3S14 B;  1EEF D;  1QG7 A;  1A63 A;  1YNJ C;  1BBX C;  4YIJ A;  3A55 A;  2MFI A;  2JA7 G;  5CV8 A;  4LFC L;  3KK7 A;  2CKZ B;  1PH6 A;  2HQE A;  1UNS A;  1WCM B;  1T5X D;  2UUB L;  2Q8I B;  3T16 A;  1TQO A;  3KLW A;  4H7B A;  4MN3 A;  1V8Q A;  1LTS D;  1I3Q B;  5I4D A;  4KHP Q;  2IT1 A;  1N33 L;  5JJI A;  2A69 D;  4A93 H;  1FNW A;  2NZ1 D;  3KLS A;  4R9W A;  1J6Q A;  3PUW A;  2QIL A;  4I7Z C;  2M2L A;  4NKL A;  1JOR A;  2B2T C;  1S5F D;  4XIG S;  3LGJ A;  4EQP A;  4OEL B;  2LXJ A;  4AYB G;  3CC4 A;  3GTG H;  4XTC S;  3UDX A;  1N34 L;  2J0T D;  2K50 A;  4CJ0 B;  3RZO B;  1EY9 A;  4I7A A;  5ELN A;  1RCV D;  2F0F A;  5M3F G;  2A1A A;  4OX9 Q;  3WDN A;  2JA7 H;  1GUN A;  3TP7 A;  2PNH A;  3EVQ A;  4JCV E;  4BBS G;  4DPG A;  3A5Z B;  1MBY A;  2A6H D;  4XDX A;  2Y0S G;  1AZP A;  4F87 A;  4JI1 L;  4WJ4 A;  1SSO A;  4A4I A;  4XXE A;  2XVS A;  4CGY B;  2A74 C;  2KOL A;  3QO2 A;  1QNK A;  2B63 B;  5DNF A;  4K6L A;  4FP5 D;  2FIN B;  1VQ8 A;  5M3M B;  2XIW A;  3J81 E;  1HUN A;  4ZKC B;  2CFM A;  2ICE C;  4Z9C B;  3PIP 3;  2RQX A;  5CMD A;  3PO2 B;  5HGT A;  1IZ6 A;  3MXG A;  3PUZ A;  1KC8 C;  2C9O A;  1EUJ A;  1R4Q B;  1G6Z A;  3NEL A;  1G2S A;  3VR3 A;  4JI0 Q;  5IGB A;  5EKI A;  4UP7 A;  3SEB A;  4OWT B;  1PTO C;  2B2T A;  1TS2 A;  1Z9F A;  1KD1 C;  2KUM A;  2YTY A;  3I4M H;  3RR5 A;  4DKA C;  3KBG A;  1SNC A;  4DUZ Q;  1QVC A;  3H09 A;  5M3F H;  1OXU A;  3T53 B;  3HOW B;  3I4L A;  3MWY W;  5C0X G;  2EZV A;  5CC4 A;  4N8F A;  4A3F B;  4K8I A;  4K5X A;  2HT1 A;  2B8F A;  2L0C A;  1JJG A;  2DJG C;  4YCU A;  1WOC A;  1D2B A;  2Q8R E;  5IT9 L;  5EBC A;  1EIH A;  2GVA A;  2RDH A;  1LAB A;  3HOZ G;  3G6J B;  1TWA B;  4WJ3 M;  3SK6 A;  2Z6K C;  3A7L A;  5C0X I;  1QIL A;  3JAM c;  4KKT A;  3NUC A;  4QIW B;  2DY8 A;  1L0W A;  4FYD A;  1K8A C;  1EIF A;  1EWH A;  4RGT A;  5C4H A;  2LFN A;  3C2P A;  1GM5 A;  1MJE A;  5IGD A;  4FF1 A;  3S1M H;  4H44 C;  2F0T A;  2Q8T A;  1S40 A;  3I91 A;  4BS9 A;  4KKU A;  5CV9 A;  1XJV A;  2HHH L;  3L0O A;  1HNX Q;  1EZ6 A;  2ASB A;  5AJ3 Q;  1QUQ B;  2KQ3 A;  3PV0 A;  1V9P A;  4R8I A;  1L1O C;  4K2K A;  4A93 B;  3EBE A;  5JJK A;  4LUV A;  3AEV A;  3I90 A;  4K0K Q;  3O13 A;  4JYA L;  3ULJ A;  1JWM D;  2F0M A;  4KHV A;  2LY7 A;  3FPP A;  1ZXT A;  2L15 A;  2XWB B;  1RHP A;  4C1N K;  4K6D A;  4C3H H;  4N8X 1;  3UDF A;  1HTP A;  2Z6K A;  4DR4 Q;  4K14 A;  3A0J A;  2EQS A;  3K0Y A;  3PUV A;  2XSC A;  4IN3 A;  2F0E A;  2JA7 B;  3KF6 A;  4ME5 A;  3KFU A;  5LMN Q;  1ET9 A;  2CH4 A;  3J80 E;  1EY0 A;  2FJ2 A;  2Q2U A;  2BH8 A;  4YHH L;  2A69 C;  2RKS A;  3SHL A;  1K0R A;  1V1P B;  4A3I G;  1I6H H;  2VXW A;  2VNU D;  1ML0 D;  1PFM A;  1VQB A;  3I3C A;  1WTX A;  2UUC Q;  1Y8O B;  1GUW A;  2EYF A;  1XMO Q;  4QJF A;  3S9W A;  1L1O A;  4KY5 A;  4H02 A;  4PZ8 A;  1BKB A;  5GAD C;  2PO4 A;  2R92 G;  4FDB A;  4R1J A;  3TS2 A;  3H94 A;  2JYO A;  3GV3 A;  4N9T A;  4AYB B;  3H3V H;  2E2D C;  3I4M B;  3MA2 B;  4X62 Q;  2A6H C;  1SE2 A;  1PH7 A;  4B08 A;  4ZRZ A;  3V2T A;  3CCL A;  3K80 C;  1SNP A;  2F0V A;  5M3F B;  4DAM A;  1PH4 A;  3PGZ A;  2BOS A;  2QCP X;  2Y0S B;  2KA7 A;  4A3I H;  1ASY A;  2OTL A;  4PV1 C;  3AQQ A;  1N9W A;  2AHO B;  2NTT A;  3NBI A;  4L8J A;  5FLX E;  2A5H A;  5M5W B;  2OWO A;  1HA5 A;  4LMQ D;  4CJ2 C;  3S1R H;  5DLQ E;  1CZG A;  5C44 H;  3CRL C;  3GTO H;  1BVS A;  2G5D A;  3OHX C;  1SJE D;  3TDQ A;  1N36 L;  2R92 H;  1TWF H;  1J8I A;  1PXU A;  4X66 L;  3TZD A;  1HNW L;  5HY6 A;  1KLG D;  3Q23 A;  5LMU Q;  3S1M B;  2I46 A;  4DA2 A;  5IWA Q;  3VYR A;  3HOU H;  2SDF A;  4N9P A;  1K8O A;  2XNA C;  2FMM A;  3U9S A;  5KYL A;  2UU9 Q;  1SBB B;  1VQ5 A;  2B2Y C;  1A15 A;  4XT1 B;  1YHA A;  4PMB A;  1EY6 A;  1M8A A;  3RZD H;  2UUB Q;  1JE4 A;  2N78 A;  2D5D A;  1Y8N B;  3OYY A;  1VQ4 A;  1SNQ A;  1FD7 D;  4JI6 Q;  5JAV A;  1RTN A;  4C3H B;  1PH8 A;  1E1T A;  1N33 Q;  3MFY A;  3TRZ A;  4NXM Q;  4C3J G;  3STB D;  3R93 A;  3OSO A;  4RKB A;  3NE5 B;  1YBY A;  2QEX A;  4KHP L;  2KHI A;  1PTO H;  2XRS D;  1LYL A;  1N34 Q;  3FMC A;  4IFD J;  1I6H B;  1HA6 A;  3BDC A;  3HOV H;  2OCE A;  4A3G G;  3G48 A;  1B50 A;  4M1U B;  3BS1 A;  2B2U C;  3MXP A;  1DM0 B;  1KRT A;  1GXD C;  2EXD A;  4J8Q A;  1D7Q A;  4R4I A;  4OL7 A;  1UE5 A;  2B2Y A;  1I4R A;  1IYV A;  2MO0 A;  3J81 L;  4CDD C;  4OX9 L;  1VQP A;  1HZA A;  4TSS A;  1JE5 A;  1B9N A;  1M4V A;  3SGI A;  1I4Q A;  1TWC H;  1ZKO A;  1AEX A;  1SNM A;  1UWV A;  1NE3 A;  2XN9 C;  4GOP B;  2F1M A;  1HNZ L;  4AIM A;  1LTL A;  3EA6 A;  2V1C C;  3D3R A;  1BXT A;  4C3J H;  3AYH B;  1VMC A;  4DV1 L;  2ZTC A;  4L5T A;  1HH2 P;  2GN5 A;  3EFX D;  4DV6 Q;  4R4O A;  1CK1 A;  2L11 A;  3DLL A;  1Z6H A;  3WWV A;  4FVM A;  2D62 A;  4IUT A;  4RCO A;  4IPH A;  1L2F A;  4P72 A;  3J81 i;  4ID6 A;  4A3I B;  3R8B A;  3WOF A;  5E4X A;  1QZG A;  3EIV A;  5LHY 1;  1SFO B;  4FF4 A;  3KLR A;  1OTC A;  1RIP A;  3HGB A;  3CF5 A;  1K9M C;  3D4R A;  1S5C D;  2M9V A;  2B2U A;  2SNM A;  4K2L A;  4TQU S;  3S1R B;  3K57 A;  3OTO L;  1CA6 A;  2BE5 D;  5C44 B;  4B9X A;  3GTO B;  2GA4 B;  1HFG A;  2R92 B;  1TWF B;  4KD4 A;  2FMC A;  5JEA G;  1U0L A;  1BCP F;  1R9T H;  1SE3 A;  1LAC A;  2VZA A;  2RF4 A;  2F3I A;  2AKW B;  3MFG A;  3HOU B;  1K3R A;  4DUY L;  1GVP A;  5KNC A;  2I0Q A;  1LUZ A;  4XQQ A;  2NZO A;  4A3E G;  3BZK A;  1DD2 A;  3MZ5 A;  4GZY C;  2K05 A;  3GTL H;  2NVT H;  1OXS C;  3RZD B;  3CQZ H;  4MTK A;  5IT9 E;  4ODG A;  3W2D A;  4X3K A;  3K7U C;  1U4P A;  5EKK A;  2ZTD A;  1SMX A;  4GNX C;  2KCT A;  1UEA B;  5TSS A;  3TQY A;  5EGT A;  2E75 C;  3NWT A;  3BJU A;  3UE1 A;  1D5Z C;  1HZ9 A;  4GKJ L;  2MUY A;  2K4K A;  4RKL A;  4LAA A;  1HRJ A;  4DF7 A;  1IBK L;  4IO9 A;  3CRK C;  2KCN A;  4KMU C;  2ID0 A;  4POF A;  1VQE A;  2KVM A;  3DHQ A;  4JYA Q;  1IL8 A;  3MXU A;  5JEA H;  4FXG C;  4JBK A;  4ABN A;  4RG1 A;  4ALP A;  5CR3 A;  4ZAI A;  1PTO B;  4JI2 Q;  1GJX A;  3ULL A;  4TVA B;  5M5Y H;  3J80 L;  1VQK A;  4G57 A;  3VYU A;  5IOD A;  3E3X A;  2QKI C;  3S17 H;  2F3W A;  3TP6 A;  1ILQ A;  4EQO A;  3A8K E;  1ASZ A;  1WVL A;  1VCI A;  4JI3 Q;  4JBM A;  4DNT B;  5IP7 G;  3A7A B;  4CJ1 B;  5J22 A;  4DR4 L;  5GAG C;  5EBD A;  2JA8 G;  4B9W A;  5ISR A;  5LMN L;  2N8N A;  5K36 G;  5C4X H;  1TWC B;  1X3Q A;  4GNX A;  2K14 A;  2KBN A;  2NN6 G;  3VA7 A;  4YY3 Q;  2J4X A;  3J80 i;  2ZM6 Q;  1JWS D;  3H15 A;  4C3J B;  3B6Y A;  3K7A H;  4IOA A;  2UXC L;  5BN5 A;  2F0O A;  3KF6 B;  1TT2 A;  2LSS A;  2DNC A;  1AZQ A;  1VF5 C;  4JC0 A;  3CME A;  4C3I G;  1A8V A;  1I4G A;  2WAQ E;  2JA6 G;  3TP8 A;  2NYZ D;  1F9S A;  3DEP A;  4JVZ A;  5FLM G;  2NN6 I;  3K81 C;  3J7A F;  1K8M A;  1G51 A;  3ICE A;  1YHQ A;  3I4N G;  2K32 A;  2ATW A;  1D1K A;  3D4D A;  4X62 L;  4HN7 A;  2F0G A;  2L1B A;  1TR5 A;  3K58 A;  2JA8 H;  1PH3 A;  1IKL A;  1JC7 A;  5K36 H;  1R9T B;  5EKL A;  1KDB A;  1TU2 B;  4LF5 L;  4HJ8 A;  1XNQ L;  2IX3 A;  1NBW A;  1JIC A;  4CKC A;  2RCN A;  1J5E L;  1SLJ A;  1VMP A;  2PW5 A;  5FJ8 H;  1CA5 A;  2OXP A;  2VQF L;  4RH6 A;  3W1B A;  4DAY B;  4QMG A;  4X64 Q;  3Q24 A;  5D14 A;  1N36 Q;  4GKK L;  5FK9 C;  2P5Z X;  4X66 Q;  3VA5 A;  3HFZ B;  1HNW Q;  4PNY A;  3GTL B;  1B9M A;  2NVT B;  3CQZ B;  3UE0 A;  2C5C A;  2JA6 H;  2R93 G;  4GLA C;  2K5W A;  1JQY D;  4BBR G;  4GLV B;  1CHP D;  3MEF A;  5FLM H;  2BE5 C;  4JV5 Q;  1X3P A;  1P8L A;  1K73 C;  3I4N H;  3G71 A;  1D6E C;  4RFB A;  5IYB G;  2K52 A;  4KY6 A;  1HZC A;  4GOP C;  3C3L A;  3MTS A;  5KNB A;  5LMU L;  1F9Q A;  4K5V A;  4POG A;  2AQ1 B;  2B2W C;  3T13 A;  5KIX A;  1H9S A;  3KYH C;  1O7L A;  2K01 A;  1E22 A;  4UP8 A;  3HS0 C;  2EVB A;  3AMU A;  5E4W C;  3ND9 A;  2IPK D;  1PFS A;  2UU9 L;  2EJG C;  1MJC A;  4GN4 B;  2D2C C;  1XXG A;  5M5Y B;  4RGN A;  3MVV A;  4IPC A;  4BXX H;  2F4I A;  2IHF A;  5ELE A;  1PRT D;  3S17 B;  1EWI A;  4A3K G;  3JC6 6;  4JI6 L;  1WYD A;  4WOR A;  4TKO B;  1NCV A;  1ZEQ X;  1QVG A;  5EPJ A;  1PFN A;  2R3Z A;  3QR8 A;  4NXM L;  1TWH H;  4QUC A;  2L12 A;  4J1M A;  4RGM A;  4DR2 L;  2NUC A;  5DEH A;  1MD2 D;  4KK7 A;  3S16 H;  5C5M A;  1E3P A;  5C4X B;  4G7H C;  5IYB H;  4IZ8 A;  2JXM B;  1SDF A;  1DOL A;  1KDC A;  4GOP A;  3K7A B;  3DWQ A;  4U67 3;  1O7Z A;  2WII B;  1RJT A;  2B2W A;  5K5P A;  4HMJ A;  2N55 A;  1MGS A;  4CKB A;  1QNU A;  1V1Q A;  3W3A A;  2IX0 A;  1HNZ Q;  2X6G A;  4X6A H;  1LTT D;  2VB2 X;  4DR5 L;  2VQE Q;  1OO9 B;  4DV1 Q;  2ZTE A;  3E0J A;  4IUN A;  4A3K H;  2B8G A;  2YV5 A;  4GN5 A;  2CHB D;  1D5X C;  3S1N H;  4UPA A;  3JAM E;  3FPU B;  1FVI A;  5I6W A;  1ENC A;  2JA8 B;  3NTK A;  1S5E D;  1NSN S;  3IKJ A;  1XPO A;  2EE1 A;  4LF7 L;  1A2U A;  2LS0 1;  4DV6 L;  3IFD A;  5JVG 3;  4HR7 B;  2WAQ G;  1Q12 A;  1N32 Q;  2OQK A;  1GOZ A;  2K28 A;  4G7O C;  1H9R A;  1A3T A;  3E5S A;  4ULL A;  5D65 A;  1QVF A;  3OTO Q;  1AE3 A;  3H91 A;  1HTL D;  2HCC A;  4BBS H;  4KTA A;  1NTG A;  2JA6 B;  1UE1 A;  3KJP A;  3CCM A;  4A3J G;  4RCN A;  1H9J A;  4DUY Q;  3HKS A;  2XTI A;  3I4N B;  5CYU A;  3W5O A;  3Q6S A;  3S15 H;  1DJR D;  5E7N A;  2ZJP A;  2K33 A;  2QW7 A;  4FNF A;  4L5S A;  4JBW A;  3D4W A;  3EN2 A;  1VS0 A;  3PIP A;  5M5W H;  5GAH C;  1K3B C;  3GDE A;  4CBV A;  1C8C A;  4DXG A;  4GS3 A;  5KEE A;  4IUP A;  3BYT B;  4EQN A;  1EL0 A;  1Q46 A;  3AFP A;  5AFW A;  2NB0 A;  3I55 A;  4BA2 I;  5JPM C;  4FO2 A;  5I6Y A;  5C0X J;  5IGE A;  1IBL L;  1IL2 A;  1STE A;  2R6G A;  1Y1V G;  1DGS A;  4O2D A;  1XPU A;  1LO5 D;  4GKJ Q;  4UAI A;  2I5M X;  4CHT B;  3FDT A;  1PH2 A;  4HIO A;  1IBK Q;  4Y52 H;  1T9H A;  1W6J A;  1DXM A;  2PW7 A;  3IFT A;  4APV A;  5C0X H;  3R2I A;  3L7Z C;  2B3G A;  4HIM A;  4K5W A;  5G3L D;  1TWH B;  4B3R L;  1QWY A;  3KUP A;  2CCZ A;  4BBR B;  2NWG A;  4O0A A;  3MXN B;  4LJZ C;  3S16 B;  4RA8 A;  4HMI A;  4IPD A;  4DV7 Q;  1Q86 C;  2D9U A;  2UUA L;  1YZ6 A;  3HOZ H;  1EQR A;  3PF5 A;  1ENF A;  2KED A;  1H9M A;  1STN A;  2F0I A;  4JI2 L;  3VYS A;  1Y8P B;  3P20 A;  1GO3 E;  4DR6 L;  5GRO A;  5IYD G;  3TS0 A;  3QOJ A;  2IY5 B;  4DV2 Q;  3CCU A;  1EZ8 A;  2WKC A;  1CKO A;  2B2V C;  2ALY B;  4DU9 A;  1PRT C;  3CMA A;  1PFB A;  2F0U A;  4C56 C;  4JI3 L;  2MP1 A;  1PZJ D;  1SYE A;  1HJP A;  4P74 A;  1I5F A;  2L4N A;  2MGS A;  4KN4 C;  2UXC Q;  2F4V Q;  2B39 A;  4R8N A;  2F0K A;  4A3K B;  2Z0S A;  4IUR A;  4LUZ A;  2R61 A;  5D3D A;  5T1I A;  1CT1 D;  3S1N B;  1EEI D;  1JB3 A;  4YCV A;  2CW0 D;  3NP8 A;  4YY3 L;  2LKV A;  4OIJ A;  2WKD A;  2ZM6 L;  3Q22 A;  4KV6 A;  1XYI A;  2JSO A;  1GD7 A;  5CV4 A;  2CQA A;  3A54 A;  4A3M G;  5FOB B;  1PZI D;  4RAU C;  3T51 B;  4I65 A;  4B3S Q;  4GNX B;  1FYC A;  3QJY A;  3KDF A;  1KXL A;  4NP5 A;  3H3V I;  4K8J A;  2E2J H;  4U68 A;  5I9O A;  4IUU A;  3NBH B;  1EQT A;  4KLK A;  4OWX B;  4P2C B;  4O1N A;  3ERQ A;  4B3T L;  5IYD H;  1B7Y B;  4RGO S;  3RN5 A;  1M90 C;  4KN7 C;  1HFN A;  3KOJ A;  4BBS B;  1GHJ A;  4XYQ A;  4DAY A;  1ENA A;  2B2V A;  1EWC A;  5C3X A;  4LF5 Q;  2IL8 A;  1XNQ Q;  3M4O H;  1DON A;  4PZ7 A;  1J5E Q;  4KJO A;  1KAW A;  2VQF Q;  1CQV A;  3S15 B;  1SFO H;  3G4S A;  5CBE E;  3CU7 A;  4GKK Q;  3OWE B;  3BDO A;  1B53 A;  2A6E D;  4B3M Q;  3D31 A;  1VQI A;  2NVX H;  1EQQ A;  1WFQ A;  1F77 A;  2WAQ B;  4X64 L;  4LFB Q;  1PDQ A;  1SMY D;  3SDZ A;  2O5J C;  2KEE A;  2Z4H A;  3QG1 A;  1QJO A;  3F2B A;  2Q2I A;  1X9N A;  1CKM A;  4RWS C;  3J81 j;  2BDO A;  3K6O A;  4JV5 L;  1W3S A;  5KND A;  1TY2 A;  2EY5 A;  2F3V A;  2NTS A;  1BQQ T;  3U4V A;  1IXR A;  3K5N A;  3CW2 C;  4G7Z C;  1GHK A;  2CWA A;  5JVH 3;  1D8L A;  3HOZ B;  1C0A A;  5L37 A;  2JEB I;  1WTQ A;  4IJH A;  1LT3 D;  1VQH A;  1E2Z A;  1EYA A;  1H9S B;  1PTO F;  2A19 A;  4DV4 Q;  4IOC A;  2N3S A;  4DR2 Q;  3E9H A;  4P71 A;  2PZW A;  1PYB A;  3PQI A;  1K28 A;  4HSP A;  1Q81 C;  1E1O A;  3G6E A;  1SRO A;  3VR2 A;  3J7Z C;  1F2L A;  1ZYR D;  4OEM B;  4EVO A;  1SYD A;  2HQL A;  5H1S E;  1HHV A;  1TS4 A;  3ZYY X;  3BVG A;  1I4P A;  1IHZ A;  1BR9 A;  3BZD B;  5CV5 A;  1PLF A;  5IGC A;  5GQO A;  2KEC A;  5FLX c;  4OHJ A;  3UI2 A;  1BF4 A;  2VW9 A;  4ZQ3 A;  4A3D G;  4IFD I;  4Y7N H;  3RN2 A;  4JI4 Q;  1A62 A;  4MIU A;  2MNA A;  1KQS A;  3JAM L;  4DR5 Q;  1KRS A;  4NXN L;  1ONL A;  2HDM A;  2F0P A;  2I5L X;  3VDY A;  4DN4 M;  1F2Z A;  2E2J B;  2BCO A;  1JCK B;  1GUS A;  3I4O A;  3HOY G;  3GV6 A;  4MTN A;  5IOC A;  2HIV A;  4X3T A;  2BA1 A;  1B3A A;  2VQE L;  4DV3 L;  4F7X A;  4H0L C;  4NDX A;  5A2Q E;  5COY A;  4LF7 Q;  5GAE C;  2K04 A;  1A3V A;  2Q2T A;  1VQN A;  3OIP A;  4BWG B;  2JA5 G;  4GLX A;  3M4O B;  2WFW A;  2CW0 C;  3CKI B;  3T1Y L;  2RDG A;  3JAM i;  4DR1 L;  1FNU A;  2F0N A;  3QWN A;  1VQO A;  1KAA A;  2ICI A;  2JE6 I;  4A3G H;  3N52 A;  1II3 A;  3SK5 A;  3PMF A;  5A35 A;  1N32 L;  1EYC A;  4L6T B;  3NXW A;  1Y1W G;  3AB9 A;  4DV5 L;  4QIW E;  2GVB A;  3PO3 G;  4A3M B;  2DUD A;  1I6V C;  2NVX B;  3NEM A;  2PMZ E;  1STB A;  5ELF A;  1LTA D;  1WTV A;  3CXC A;  2V4D A;  2G9H D;  2BDN A;  2F0D A;  3PF4 A;  1U4M A;  1YHB A;  3I2Z A;  2SEB D;  2NVY H;  1LT5 D;  1NJI C;  4OIK A;  2E76 C;  4RMF A;  3C1F A;  4MZ9 A;  2QDL A;  1DOM A;  4YWK A;  4LWC A;  1RTO A;  1PH5 A;  5COR A;  3DWA A;  1IBL Q;  4DV0 Q;  1Z7T A;  4PG3 A;  1NNX A;  1X56 A;  1GKH A;  4OXP A;  1YEZ A;  5C3E G;  1EYD A;  3D8G A;  2JEA I;  2A6E C;  4DK0 A;  1NMG A;  3ITP A;  4LFA Q;  3MXN A;  5T1G A;  1WCM G;  1Q3L A;  5JEA J;  1IKM A;  1XTC D;  1SMY C;  4ZUJ A;  1Y1W H;  5IIF A;  1SAP A;  2KCM A;  4B3R Q;  3T56 B;  3SR1 A;  4JI5 L;  1B70 B;  4JPB W;  1HQM C;  1C4Q A;  4OGQ C;  4ZKB B;  2UUA Q;  1KNE A;  1M1K C;  2NBF A;  1NMF A;  3KBX A;  3NWS A;  3U4Z A;  2MO1 A;  4RHS A;  3HKZ E;  4DR6 Q;  4JK1 C; 
#chains in the Genus database with same CATH homology
 3UDG A;  3W1G A;  4DV7 L;  4LW1 A;  1QVG A;  2QGQ A;  4LUV A;  3AEV A;  4A3E H;  1KL9 A;  1VQM A;  4K0K Q;  1X3G A;  2D0P A;  1TWH H;  3M9B A;  3ULJ A;  1SN8 A;  4NXM L;  4JYA L;  2R7Z G;  3F1Z A;  2L15 A;  4DR2 L;  1XNR Q;  3CAM A;  4AH6 A;  3S16 H;  1EYG A;  5IYC H;  4C3H H;  3GTJ H;  4A3C G;  1E3P A;  5C3E H;  5IYB H;  4DR7 Q;  3UDF A;  4DV2 L;  4P75 A;  2Z6K A;  2AWO A;  4DR4 Q;  3A0J A;  3STB C;  2EQS A;  1CUK A;  3PUV A;  2IHE A;  4GOP A;  3KF6 A;  1VQ7 A;  3KFU A;  3BZC A;  5LMN Q;  1VQG A;  4BY1 H;  3RLF A;  2B63 G;  3CC7 A;  4NPS A;  1JMC A;  4QY7 A;  3GTM H;  4HIK A;  4LNQ A;  2Q2U A;  2BH8 A;  5M3M G;  4YHH L;  2F4V L;  4JOI C;  4QL5 A;  1V1Q A;  1K0R A;  4J15 A;  4A3I G;  1AE2 A;  3KJO A;  3GTK H;  2IX0 A;  1HNZ Q;  1I6H H;  2VNU D;  1XTD A;  5IT9 c;  4X6A H;  1VQB A;  2UUC Q;  4DR5 L;  2VQE Q;  4LF9 L;  2JQO A;  4DV1 Q;  4JI1 Q;  2ZTE A;  4A76 A;  4A3K H;  2AMC B;  2YV5 A;  1VQA A;  4GN5 A;  2HIX A;  1XMO Q;  4B3T Q;  1SE8 A;  4QJF A;  1KHI A;  4A3L H;  2EIF A;  3S1N H;  4UPA A;  4B3S L;  1L1O A;  4H02 A;  4PZ8 A;  1FVI A;  1BKB A;  4P73 A;  4R4Q A;  4HJA A;  5GAD C;  3A74 A;  2R92 G;  4FDB A;  4R1J A;  3RNU A;  2R7Z H;  3PIO A;  1PH1 A;  3TS2 A;  2YTV A;  3HOW G;  1XPO A;  3H3V H;  5IP7 H;  4LF7 L;  4DV6 L;  3PCO B;  1FJG Q;  3T1H Q;  4A3C H;  4MNO A;  1SRU A;  2WAQ G;  4YCW A;  4X62 Q;  4HJ7 A;  1Q12 A;  2KHJ A;  4A3F G;  3FP9 A;  1PH7 A;  4A3D H;  1N32 Q;  2OQK A;  2K5H A;  3KDF B;  4HID A;  3K80 C;  3CCL A;  3M85 A;  4DAM A;  1WJJ A;  4OO1 I;  4PMW A;  1QVF A;  3S2D H;  3OTO Q;  1YI2 A;  4JBJ A;  1AE3 A;  5IE8 A;  2DGY A;  2UXB L;  1PH4 A;  2K5V A;  1RL2 A;  5JJK A;  3PGZ A;  4BBS H;  2BH2 A;  3HOY H;  4JI0 L;  1NTG A;  4A3I H;  5M5X H;  1ASY A;  1UE6 A;  1UE1 A;  2AWN A;  3E0E A;  4JOI A;  3KJP A;  3CPW A;  3CCM A;  4LF4 Q;  4A3J G;  1Q82 C;  2OTL A;  1B8A A;  3J7A 5;  4JI8 Q;  4DK6 C;  3AQQ A;  1N9W A;  3ER0 A;  3HKS A;  4C3I H;  4DUY Q;  2ES2 A;  1N8R C;  2AHO B;  1CSQ A;  2XTI A;  4B3M L;  2JA5 H;  4DUZ L;  1MIU A;  3W5O A;  2OWO A;  3S15 H;  5E7N A;  5EAY A;  3S1R H;  2ZJP A;  5DLQ E;  4C2M H;  5IY0 A;  1G6P A;  4L5S A;  1X6O A;  4JBW A;  2VL6 A;  5C44 H;  1Z47 A;  4LFB L;  3EN2 A;  1BVS A;  1VS0 A;  2WB1 E;  5J3B A;  5M5W H;  5GAH C;  3PIP A;  4DK3 C;  3GDE A;  4PZ6 A;  1N36 L;  1WI5 A;  2XGT A;  1TWF H;  2R92 H;  1P16 A;  4GS3 A;  4X66 L;  1Q7Y C;  2UXD L;  3CCJ A;  1HNW L;  5HY6 A;  1Q46 A;  3AFP A;  3ERS X;  3I55 A;  1C7Y A;  4BA2 I;  5LMU Q;  4UP9 A;  5C0X J;  5IWA Q;  1IBL L;  3GTP H;  1XMQ Q;  1IL2 A;  1EIY B;  3HOU H;  2R6G A;  1HR0 L;  2NVQ H;  1Y1V G;  2JK8 A;  1JB7 A;  1DGS A;  4A93 G;  4O2D A;  1XPU A;  3PO3 H;  4GKJ Q;  2I5M X;  1PH2 A;  4LF6 Q;  4HIO A;  5BR8 L;  1QUQ A;  1IBK Q;  3CC2 A;  4Y52 H;  1Q1E A;  1UE7 A;  2UU9 Q;  1T9H A;  2E8G A;  1VQ5 A;  2YTX A;  4APV A;  1YHA A;  3RZD H;  3I7F A;  2UUB Q;  3L7Z C;  3M4P A;  2HHH Q;  2B3G A;  5C4X G;  2N78 A;  2IX1 A;  1X3E A;  4HIM A;  2KEN A;  1QZH A;  3S24 A;  3BU2 A;  1EFW A;  2OQ0 A;  3OYY A;  3PSI A;  1VQ4 A;  4B3R L;  2CCZ A;  1W2B A;  4JI6 Q;  4O0A A;  3MXN B;  2UUA L;  4IPD A;  4DV7 Q;  1Q86 C;  4AQY L;  1E1T A;  1PH8 A;  1N33 Q;  2R93 H;  1YZ6 A;  3HOZ H;  4L5Q A;  1EQR A;  4BBR H;  4DV4 L;  2K5N A;  3PF5 A;  3S14 H;  3TRZ A;  4NXM Q;  3STB D;  1HNX L;  4JI2 L;  5AJ3 L;  1PA6 A;  1GO3 E;  1BBU A;  4LF8 Q;  4BY7 H;  4DR6 L;  3HKZ G;  5GRO A;  5IYD G;  3TEH B;  3TS0 A;  1YBY A;  2IY5 B;  1JJ2 A;  2QEX A;  1VQJ A;  1WCM H;  4DV2 Q;  3CCU A;  4KHP L;  4AYB E;  4YWL A;  1JT8 A;  1CKO A;  2KHI A;  3E9I A;  2ALY B;  3CMA A;  1LYL A;  4X65 L;  1CSP A;  2RHQ B;  4K0K L;  3GD7 A;  1N34 Q;  4IFD J;  4R4C A;  2RHS B;  3D0F A;  4JI3 L;  4DNI A;  1IBM L;  1HJP A;  4P74 A;  1I3Q H;  4NXN Q;  1I5F A;  4HJ5 A;  3HOV H;  2OCE A;  4A3G G;  3G48 A;  2VY3 A;  1S72 A;  2UXC Q;  3Q8D A;  4DR7 L;  2I5H A;  4YHH Q;  4JI4 L;  1KRT A;  1U5K A;  2E2I H;  2F4V Q;  3PO2 G;  4A3B G;  2Z0S A;  4LUZ A;  2EXD A;  1D7Q A;  1VQD A;  2Y0S E;  4DV3 Q;  4OWW B;  3K0X A;  4YCV A;  4R4I A;  1UE5 A;  4YY3 L;  3I4M G;  2ZM6 L;  1XPR A;  3GTQ H;  2MO0 A;  3CCQ A;  4OO1 G;  4LF9 Q;  4OX9 L;  1VQP A;  2CWP A;  3GO5 A;  1HZA A;  1FGU A;  1JE5 A;  1X3F A;  3CPF A;  2A8V A;  3SGI A;  1GD7 A;  1AH9 A;  4A3M G;  1TWC H;  1FL0 A;  1NE3 A;  1UWV A;  5FJ8 G;  4GOP B;  4GNX B;  3T1Y Q;  4B3S Q;  1E24 A;  1VQL A;  1K83 H;  1HNZ L;  4AIM A;  1LTL A;  4DR1 Q;  1VQ9 A;  3RZO H;  3KDF A;  1KXL A;  3H3V I;  2V1C C;  4C3J H;  1O7I A;  2UUC L;  4ME3 A;  1Q1B A;  1YIJ A;  3AYH B;  2E2J H;  1PHJ A;  4DV1 L;  3PUX A;  2ZTC A;  3NBH B;  4KLK A;  4L5T A;  4OWX B;  1HH2 P;  1HR0 W;  2GN5 A;  4DV6 Q;  4R4O A;  3DLL A;  1B7Y B;  3ZJY C;  1XMO L;  4B3T L;  3RN5 A;  4UY8 C;  4GN3 B;  3WWV A;  1M90 C;  2D62 A;  4HJ9 A;  4IPH A;  2NZH A;  1L2F A;  4BA1 I;  2R7F A;  3M7N A;  4DV5 Q;  3KOJ A;  3H0G G;  1VQF A;  4P72 A;  3J81 i;  3HOX G;  4LF5 Q;  2B63 H;  3NEN A;  1CKN B;  3DM3 A;  2PQA B;  1HZB A;  1XNQ Q;  3M4O H;  1QZG A;  1PVO A;  1TWG H;  3EIV A;  3GTO H;  1FJG L;  5M3M H;  4DR3 Q;  4PZ7 A;  4EX5 A;  1J5E Q;  1L1O B;  1G29 1;  1OTC A;  4LUO A;  4JI7 Q;  1KAW A;  1RIP A;  2VQF Q;  3CF5 A;  1K9M C;  1K8G A;  3PO2 H;  4A3B H;  1SFO H;  2R7D A;  4QQB X;  3G4S A;  1E7Z A;  1X54 A;  4TQU S;  4GKK Q;  3RLO A;  3FKI G;  3OTO L;  2PI2 E;  1I94 Q;  1Q8K A;  2B29 A;  4KI0 A;  4QGU A;  3CCS A;  1TXY A;  4B3M Q;  3U58 A;  3D31 A;  1OXX K;  5JEA G;  1U0L A;  1R9T H;  2E5L L;  1VQI A;  4A75 A;  2NVX H;  2VZA A;  1PV4 A;  1IYJ B;  1EQQ A;  4BXX G;  1WFQ A;  2RF4 A;  4X64 L;  2F3I A;  4LFB Q;  2AKW B;  4LF4 L;  4L5R C;  1SR3 A;  3K8A A;  2OTJ A;  1K3R A;  4JI8 L;  3HOW H;  4DUY L;  1GVP A;  2D0O A;  1KIX A;  3CP0 A;  5JJL A;  5C4J H;  4A3F H;  2I0Q A;  4DV0 L;  1LUZ A;  4A3E G;  2NZO A;  4YWM A;  1I50 H;  2N49 A;  2Q2I A;  3BZK A;  5HGQ A;  3F2B A;  1CKM A;  1NY4 A;  1X9N A;  3J81 j;  3M3Y H;  3CD6 A;  5ELO A;  2C35 B;  2CQO A;  4JV5 L;  1W3S A;  3H0G H;  2JA9 A;  3PUY A;  2NVT H;  1OXS C;  1VQC A;  2PI2 A;  2WB1 G;  3CQZ H;  3F2C A;  3GTL H;  4JI5 Q;  1LM0 A;  3HOX H;  1S3O A;  4LFA L;  3K7U C;  5LMN W;  4OON A;  1TWA H;  3U4V A;  2ZTD A;  1SMX A;  4GNX C;  1IXR A;  3J81 c;  3CW2 C;  1X65 A;  2KCT A;  3F2D A;  2CWA A;  1UEB A;  5IWA L;  3TQY A;  2K75 A;  1OXT A;  2ZJR A;  1D8L A;  3BJU A;  3UE1 A;  1HZ9 A;  4A3J H;  4GKJ L;  1C0A A;  2E2H H;  2JEB I;  1A63 A;  2K4K A;  3FKI H;  2MFI A;  4LF6 L;  2JA7 G;  4IJH A;  1IBK L;  4R4T A;  4IO9 A;  1VQH A;  4LFC L;  2ID0 A;  4POF A;  2CKZ B;  1VQE A;  1PH6 A;  4AQY Q;  4JYA Q;  2A19 A;  1YVC A;  3A5U A;  4DV4 Q;  4IOC A;  2UUB L;  4JBK A;  2N3S A;  4DR2 Q;  3E9H A;  4RG1 A;  4ALP A;  4P71 A;  1Y14 B;  4JI2 Q;  1PYB A;  3ULL A;  4TVA B;  3KLW A;  5M5Y H;  5IP9 G;  1VQK A;  1Q81 C;  1E1O A;  4OX9 Q;  1JJC B;  3G6E A;  1SRO A;  1YJ9 A;  4KHP Q;  3S17 H;  2IT1 A;  3J7Z C;  1N33 L;  5JJI A;  4NB3 A;  5H1S E;  2HQL A;  4X65 Q;  1ASZ A;  1Y1V H;  4A93 H;  1C9O A;  2ZJQ A;  5IYD H;  1XNR L;  2VUM G;  1VCI A;  4JI3 Q;  4JBM A;  1J6Q A;  3PUW A;  5GQO A;  1IBM Q;  4LF8 L;  1VQ6 A;  5IP7 G;  5FLX c;  4DR4 L;  4XIG S;  5GAG C;  3FHW A;  3LGJ A;  2VW9 A;  2JA8 G;  4A3D G;  4IFD I;  4Y7N H;  3RN2 A;  4JI4 Q;  1A62 A;  2LXJ A;  1OXV A;  4AYB G;  2MNA A;  3CC4 A;  5LMN L;  1EOV A;  2N8N A;  3GTG H;  4XTC S;  5K36 G;  1KQS A;  3UDX A;  5C4X H;  2K50 A;  1N34 L;  4GNX A;  4DR5 Q;  2K14 A;  1V43 A;  2KBN A;  2NN6 G;  4YY3 Q;  1KRS A;  2H5X A;  4NXN L;  5ELN A;  3J80 i;  3U50 C;  2ZM6 Q;  3H15 A;  2A1A A;  2I5L X;  5M3F G;  3CCV A;  3F8T A;  3B6Y A;  3K7A H;  2BA0 A;  3VDY A;  2JA7 H;  4IOA A;  3L2P A;  2UXC L;  2PNH A;  3KF6 B;  4JCV E;  3I4O A;  4DPG A;  3HOY G;  4BBS G;  1H95 A;  2LXK A;  2LSS A;  3A5Z B;  4MTN A;  2HIV A;  2BA1 A;  4DV3 L;  2VQE L;  2Y0S G;  4JC0 A;  3CME A;  2YYZ A;  3CCE A;  4JI1 L;  4WJ4 A;  4A4I A;  4LF7 Q;  3ULP A;  1A8V A;  5GAE C;  2WAQ E;  2Q2T A;  1VQN A;  2JA6 G;  1CKN A;  2JA5 G;  2PQA A;  5IP9 H;  1A0I A;  4GLX A;  2F52 A;  5FLM G;  2WFW A;  2NN6 I;  3K81 C;  3T1Y L;  1G51 A;  1VQ8 A;  3ICE A;  3JAM i;  5C44 G;  4DR1 L;  1YHQ A;  3I4N G;  3S2H H;  2CFM A;  2ATW A;  1VQO A;  2UXB Q;  1IZ6 A;  2VUM H;  2JE6 I;  1KC8 C;  3PUZ A;  3T1H L;  4A3G H;  1EUJ A;  4X62 L;  3KF8 B;  4BY7 G;  3NEL A;  1N32 L;  2VS1 A;  4JI0 Q;  3M4Q A;  4UP7 A;  2JA8 H;  1Y1W G;  1PH3 A;  3HOU G;  4OWT B;  4DV5 L;  1Z9F A;  1KD1 C;  2YTY A;  2GVB A;  4QIW E;  3PO3 G;  3I4M H;  2DUD A;  3NEM A;  2PMZ E;  2JJQ A;  4LF5 L;  4HJ8 A;  3RR5 A;  1MKH A;  3TRE A;  4DKA C;  3CXC A;  3S1Q H;  1XNQ L;  4DUZ Q;  1QVC A;  1NBW A;  5M3F H;  1OXU A;  4DR3 L;  2RCN A;  3UDI A;  4A3M H;  1J5E L;  3PF4 A;  1SLJ A;  1YHB A;  3I2Z A;  5C0X G;  5FJ8 H;  3J80 c;  4JI7 L;  2E5L Q;  2VQF L;  2NVY H;  1PYS B;  1NJI C;  3W1B A;  4DAY B;  4X64 Q;  1N36 Q;  4GKK L;  2Q2H A;  2HT1 A;  2WP8 J;  1JJG A;  4RMF A;  4MZ9 A;  4X66 Q;  1I94 L;  4YCU A;  3HFZ B;  1WOC A;  2MQH A;  1HNW Q;  2UXD Q;  4YWK A;  4LWC A;  3UE0 A;  1PH5 A;  2JA6 H;  3AFQ A;  2R93 G;  4GLA C;  2GVA A;  1IBL Q;  4DV0 Q;  3HOZ G;  4BBR G;  1HR0 Q;  4GLV B;  3MEF A;  5FLM H;  1YJW A;  4WJ3 M;  4IJL A;  4PG3 A;  1X56 A;  4JV5 Q;  1GKH A;  4OXP A;  5IYC G;  1P8L A;  3I56 A;  2Z6K C;  1YJN A;  1K73 C;  3I4N H;  3G71 A;  1YEZ A;  5IYB G;  1YNX A;  5BR8 Q;  5C3E G;  2JEA I;  2K52 A;  4JG2 A;  1HZC A;  3JAM c;  5C0X I;  1NMG A;  4GOP C;  4LFA Q;  1WCM G;  1L0W A;  5LMU L;  1PH9 A;  5JEA J;  1K8A C;  1EIF A;  4KHZ A;  1XMQ L;  4EQ5 A;  4POG A;  3KYH C;  4BY1 G;  2FXQ A;  3CCR A;  1Y1W H;  1E22 A;  1MJE A;  1GM5 A;  4UP8 A;  2KCM A;  4B3R Q;  3HOV G;  4JI5 L;  3S1M H;  1BBW A;  1B70 B;  1PFS A;  2UU9 L;  1S40 A;  1MJC A;  3OW2 A;  4GN4 B;  2UUA Q;  1M1K C;  4LFC Q;  1NMF A;  1XJV A;  1X55 A;  3IRB A;  2HHH L;  4IPC A;  3L0O A;  4BXX H;  2IHF A;  4IFD G;  1HNX Q;  3U4Z A;  2MO1 A;  1YIT A;  2ASB A;  5AJ3 Q;  1QUQ B;  1EWI A;  3PV0 A;  3HKZ E;  1V9P A;  3JC6 6;  3RLN A;  2QA4 A;  1L1O C;  4A3K G;  2YU9 H;  4IPG A;  3EBE A;  4JI6 L;  4DR6 Q;  1WYD A;  4A3L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...