4JV5L

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jv5L00
3GTJH 1CUKA 4DNIA 4A3JH 1BBWA 5LMNW 1QVFA 1KC8C 3UDFA 3CCLA 2B63H 1YITA 1TWFH 2L15A 3CF5A 1Q86C 2E5LQ 4DUZQ 4LF9Q 2K75A 1WYDA 1YVCA 5IYDG 4Y7NH 3TREA 3CMAA 4DAMA 4GS3A 4GNXB 1YIJA 1VQOA 3OYYA 3CCSA 1P8LA 4X66Q 3B6YA 1W2BA 2Q2HA 3EIVA 3KF6B 1VQKA 2UUCL 3J81i 2QGQA 3I2ZA 1JJCB 2N3SA 1SROA 4AH6A 1SMXA 2PI2A 1HNWL 1C9OA 4ALPA 1SN8A 1FGUA 3ERSX 3GTMH 1YHAA 4YWMA 5JJLA 3CCEA 4A3BG 3HOXH 2I5MX 4GKJL 4JI5L 4JI8L 4YHHL 2GVAA 5LMUL 2UUCQ 3UE1A 2AHOB 4DV2L 2BA0A 2HT1A 2R92G 5LMNL 4JI6L 3NBHB 3RLFA 1PH1A 2B29A 1FJGL 4LF4L 1H95A 3CAMA 2JA5H 3S17H 1KD1C 1ASYA 1VQFA 1LTLA 1VQ4A 3HOWG 4P72A 4OO1I 3UE0A 1W3SA 2K5HA 2KENA 2ZJQA 3PO2G 2UU9L 4K0KL 4GKJQ 4JI8Q 4YHHQ 5LMUQ 4JI5Q 4X6AH 4DV2Q 5IYCG 4HIMA 5LMNQ 4DUYL 4JI6Q 4YWLA 4O0AA 1Q1BA 3W1BA 1FJGQ 4LF4Q 2ASBA 5M3FH 3PF5A 4BY7H 2R93G 3I56A 1VQHA 3J80i 3RLOA 3TS2A 1G291 3G48A 4K0KQ 3M9BA 1YNXA 2UU9Q 5K36G 2JEAI 1NMGA 2CFMA 4GN3B 1ASZA 4WJ4A 1V1QA 2V1CC 4DUYQ 4J15A 4HJAA 3CP0A 4AIMA 4WJ3M 5AJ3L 3LGJA 2BH2A 2JQOA 4GLVB 5GAHC 4AQYL 1WFQA 3PUVA 2Q2UA 2OTJA 1KAWA 3BZCA 4OWXB 4GLXA 3S2HH 3S1MH 4P71A 3S1RH 1XPUA 1UE5A 2A19A 1YJWA 4LF7L 5GQOA 5AJ3Q 4JBMA 3E0EA 4EQ5A 3S2DH 3MEFA 1MJEA 2JK8A 4AQYQ 3U50C 3HOUG 3M7NA 3K7UC 4OO1G 2KCTA 2CQOA 3K0XA 4GOPC 4BBSH 2BH8A 2ID0A 1X56A 4BXXG 3PUXA 3KJPA 1TXYA 1OXUA 2VW9A 1X54A 3FKIH 4QJFA 3GTOH 5JEAJ 4GNXA 1X3FA 1VQ5A 2VNUD 4LUZA 3D31A 2ZM6L 2VQEL 1TWGH 4LF7Q 2CWAA 4GLAC 2YTYA 5IE8A 5J3BA 2E2IH 3I4MG 1NTGA 1V9PA 3KF6A 3PUZA 3OW2A 4IPGA 4A3DG 3M85A 1FVIA 1XTDA 3RNUA 3GTLH 1PYBA 2NVYH 4IPHA 2JA7H 2PNHA 1HNXL 5C4JH 3GTQH 4IJLA 4DR6Q 3H0GH 1SLJA 2VQEQ 3GTGH 3CCRA 1J6QA 3I4NH 1Y1WG 4ME3A 2N49A 4LNQA 4PZ7A 5GADC 4X65L 3T1HL 1T9HA 1HJPA 2R7DA 4XTCS 1DGSA 1EYGA 3ULPA 4PMWA 1XPOA 1HNXQ 3A0JA 4IPDA 3I7FA 4JOIC 2QA4A 4UP8A 3S16H 1XJVA 4IFDG 1QVGA 4DV0L 3K7AH 1N8RC 2AWOA 2OTLA 2K5VA 3F1ZA 4JI7L 4X65Q 2N78A 3I55A 3T1HQ 1AH9A 1GVPA 4YCWA 3IRBA 3RZOH 1E7ZA 4EX5A 1EQQA 1XNQL 4Y52H 1NE3A 1LYLA 4UPAA 5C3EG 4DV0Q 4A3EG 2CCZA 3GD7A 3A5ZB 3A74A 1HR0W 3M4OH 4JI7Q 1EOVA 2NZHA 1OXVA 1CKNA 3FKIG 1MKHA 1G51A 4TVAB 2VS1A 3SGIA 5C44H 4A3MH 2E2JH 5HGQA 2I0QA 4O2DA 1XNQQ 4B3RL 5M5WH 3CD6A 2OQKA 1E22A 2R7ZH 3NENA 5FLMG 2QEXA 1N34L 5IT9c 1L1OC 1M1KC 1UWVA 4DR7L 5JEAG 4B3RQ 3STBC 5IWAL 1QUQA 3CC7A 4BY1H 4A93H 1X55A 3TEHB 1QZGA 4PZ6A 3JAMc 3TS0A 5IYBH 1E1TA 2JEBI 1VQDA 3CCMA 1N34Q 5C0XI 1VQBA 4A3CH 1LM0A 2YTXA 4DR7Q 1HR0L 3PO3G 2YYZA 4JBWA 5IP7H 5IWAQ 1JJGA 4QY7A 2NVTH 2AMCB 3HOVH 2JJQA 3PIPA 4GOPA 4IJHA 3Q8DA 2IT1A 1HH2P 4DV3L 4DR4L 4JG2A 1VQGA 1HR0Q 3HKZG 1SFOH 4NXML 4GKKL 5M5YH 2VL6A 1MJCA 3CPFA 1VS0A 3STBD 2KBNA 2DGYA 3F2CA 4A3IH 4JBKA 4JI0L 4A3LH 3S14H 3PUYA 1WCMH 3OTOL 1VQ8A 5M3MG 4DV3Q 2IHFA 1YJNA 2JA6H 3CXCA 3S1NH 4YWKA 4DR4Q 4BBRG 4FDBA 2N8NA 4PG3A 4JV5Q 4NXMQ 2JA8H 3L0OA 4GKKQ 2RCNA 4C3IH 1IXRA 2VQFL 3HOYH 1YZ6A 4A3JG 2BA1A 4LFAL 4KHPL 2B63G 5FLXc 1HZBA 2VUMH 1HNWQ 4NPSA 5C0XG 2NVXH 1K3RA 5M5XH 3OTOQ 1EIYB 4JI0Q 1Y14B 2NZOA 3H15A 1VQ9A 3GTKH 2MO0A 1Y1VH 1KXLA 4JOIA 1CKNB 1IBLL 1PA6A 1PH8A 4A3KH 1D8LA 1N9WA 4XIGS 4LWCA 1E1OA 1B7YB 3HKZE 3U4ZA 2VQFQ 1TWAH 2RHQB 1N36L 1OTCA 2HHHL 1NBWA 1U5KA 4LFAQ 3ULJA 3AFQA 4QGUA 4BA2I 1JMCA 4KHPQ 1I94L 1UE1A 4KHZA 2UXDL 1A0IA 3M4QA 4OWWB 1XPRA 2GVBA 3TQYA 4A3FH 3CCJA 4IPCA 1IBLQ 4MZ9A 4R4QA 2D0PA 1AE2A 2Z6KC 1LUZA 1QUQB 2YTVA 1VQAA 3F8TA 4TQUS 3HOXG 3RN5A 1XMOL 1X65A 1N36Q 4JI2L 4R4OA 1I94Q 3EN2A 2DUDA 2UXDQ 2IX1A 1B70B 3BZKA 4DV4L 4APVA 1PH2A 1UE7A 5FJ8H 1VQPA 3J81c 2JA5G 1K83H 3PSIA 4RMFA 1Q12A 1SE8A 2FXQA 4A3GH 2RHSB 2Q2IA 1L1OA 1CKOA 1VQJA 1XMQL 5C4XH 4JI2Q 4B3TL 4GOPB 3F2BA 2F4VL 2EXDA 2NVQH 5GROA 2K52A 1G6PA 4DV4Q 5JJIA 3HOYG 3KF8B 3L2PA 2OWOA 5M3FG 4DK3C 1VQ7A 1UEBA 4BY7G 2I5LX 2ZM6Q 1K8GA 4LF6L 1HZ9A 2NN6I 1KIXA 1PH7A 3GO5A 4JC0A 4B3TQ 2MFIA 3L7ZC 4DR5L 2F4VQ 3PF4A 4JCVE 4A3KG 3K81C 2Z0SA 2R6GA 1WOCA 3CMEA 3HOZH 1Q1EA 3KLWA 1Z47A 4YY3L 3BU2A 4OONA 1TWCH 2EIFA 1J5EL 3J7ZC 4P74A 4IFDJ 4LF6Q 3T1YL 1PHJA 3J81j 2D0OA 2YV5A 1O7IA 4MTNA 4JI1L 4DK6C 1JE5A 3J80c 4DR2L 3UDGA 4DR5Q 1E24A 4LF5L 3UDIA 2R7FA 4A76A 1P16A 1X3GA 4YY3Q 1J5EQ 5HY6A 5IYDH 4L5RC 2C35B 3ZJYC 2LXKA 3T1YQ 3HFZB 4BBSG 4POGA 4DR2Q 3M4PA 1VQLA 3PUWA 4JI1Q 2A8VA 1N32Q 2KCMA 4MNOA 4LF5Q 1RL2A 2K5NA 1PV4A 1YI2A 4A3GG 1IBKL 3PV0A 2IHEA 3CW2C 2ATWA 4X66L 1QZHA 3HKSA 1S40A 1X6OA 4JI3L 4GN4B 3ULLA 1L0WA 3M3YH 1NJIC 1AE3A 4HIDA 1KQSA 1Q46A 2NN6G 4JYAL 1EWIA 1FL0A 2JA7G 1VQNA 4NB3A 1V43A 1VQMA 4A3BH 4C3HH 3DLLA 3K80C 4UY8C 1PYSB 3H0GG 1IBKQ 3I4NG 2R92H 2F52A 3U4VA 3H3VH 4LF8L 3DM3A 4PZ8A 4R4CA 4JI3Q 4HJ7A 1Q82C 2UXBL 1L1OB 2H5XA 1PFSA 3RLNA 4JYAQ 3K8AA 3G71A 2D62A 1PH6A 1VQCA 3PO2H 2LXJA 2UUAL 2KHIA 3NELA 2WP8J 2Z6KA 4YCUA 4C2MH 5IYCH 1UE6A 4IOAA 1C0AA 2WB1G 4GNXC 4LF8Q 3G6EA 1PVOA 1CKMA 1A8VA 1NY4A 2K14A 5ELOA 1JJ2A 4DV7L 2UXBQ 2R93H 2K50A 3A5UA 3EBEA 4LUVA 4HJ5A 4IOCA 3RZDH 1S72A 3CC2A 4POFA 3ICEA 2UUAQ 2XTIA 1K8AC 2AWNA 1I50H 2F3IA 5C44G 1K73C 3KJOA 4A3MG 4DV7Q 2Y0SG 3F2DA 1R9TH 3CC4A 1OXXK 1XNRL 3NEMA 3S24A 2R7ZG 1Q8KA 1Z9FA 3RN2A 4R4IA 4RG1A 1I3QH 2CKZB 1Q81C 1K0RA 2WB1E 5DLQE 4H02A 4KI0A 3G4SA 3KDFA 4HJ8A 3HOUH 2E2HH 1OXSC 1KL9A 4BY1G 4A93G 2PQAB 4B3SL 1B8AA 1XNRQ 4BXXH 3E9IA 5IYBG 1PH5A 4UP7A 4L5TA 3JC66 3I4MH 2E8GA 1IYJB 4A3CG 1JB7A 3KFUA 2WAQG 1BKBA 5IP7G 2HIVA 4L5QA 3ER0A 1CSQA 1TWHH 4A3DH 4QQBX 4B3SQ 3HOVG 2Y0SE 3CCVA 4NXNL 2ZJRA 1VQEA 4LW1A 2OQ0A 1EFWA 1NMFA 1YBYA 3W1GA 1IL2A 2KHJA 3S15H 3S1QH 5IY0A 2HHHQ 3D0FA 2ZTEA 2LSSA 3GDEA 1Y1WH 1MIUA 5IP9H 1X9NA 3WWVA 2OCEA 3CQZH 2A1AA 4LUOA 4P73A 4B3ML 3KOJA 1VCIA 2JE6I 2UUBL 1KRSA 4NXNQ 4A3IG 4A3LG 2HQLA 1OXTA 2MQHA 1WCMG 1XMOQ 3PCOB 2ES2A 3RR5A 2JA6G 2XGTA 2VZAA 1GKHA 4JI4L 5E7NA 1GD7A 5GAGC 2B3GA 2MO1A 1KRTA 2JA8G 1N32L 2WAQE 2IY5B 5GAEC 4X62L 4B3MQ 1HZCA 1EUJA 2YU9H 1D7QA 4DV1L 3I4OA 2UUBQ 3CCUA 2VUMG 1EIFA 2ZTCA 4JBJA 5C3EH 3MXNB 2WFWA 1XMQQ 4BA1I 1Y1VG 4A3EH 1BVSA 4JI4Q 1C7YA 3J7A5 1L2FA 4GN5A 4AYBG 3U58A 2EQSA 4DV5L 5ELNA 1HNZL 4DR6L 1KHIA 4X62Q 1EQRA 1SRUA 4DV6L 3JAMi 4DV1Q 3W5OA 1CSPA 2I5HA 4OXPA 1U0LA 2PI2E 4UP9A 4R4TA 3VDYA 5FLMH 1I5FA 2GN5A 4QL5A 4C3JH 4A3FG 4OX9L 1A63A 4L5SA 2ALYB 3KDFB 4DV5Q 4HIOA 4KLKA 4QIWE 1HNZQ 5JJKA 1YJ9A 4HJ9A 1S3OA 3E9HA 5BR8L 4DAYB 4DV6Q 1SR3A 1QVCA 1RIPA 1PH9A 1WI5A 2RF4A 3CCQA 5IP9G 3CPWA 1PH3A 3BJUA 1VQIA 3AFPA 4P75A 2UXCL 3KYHC 5FJ8G 4OX9Q 2PQAA 1N33L 3AEVA 4YCVA 3AYHB 1BBUA 5EAYA 1Q7YC 4DPGA 2ZTDA 4IFDI 4AYBE 1X3EA 3FP9A 4A4IA 2JA9A 1YEZA 3PO3H 1A62A 5BR8Q 1K9MC 1E3PA 5C4XG 3TRZA 3PGZA 1YHQA 1PH4A 4R1JA 4A75A 1IBML 2UXCQ 1M90C 3PIOA 4DR3L 4DR1L 1N33Q 1I6HH 3GTPH 4LFCL 4X64L 4LFBL 1YHBA 3UDXA 4IO9A 2HIXA 2VY3A 5H1SE 1WJJA 1IZ6A 2AKWB 1HZAA 3HOZG 4OWTB 2CWPA 1GO3E 3FHWA 1IBMQ 2Q2TA 3HOWH 1JT8A 5C0XJ 2E5LL 4DUZL 4LF9L 4DR3Q 4DR1Q 2PMZE 5M3MH 2MNAA 1GM5A 3AQQA 3H3VI 4JV5L 4LFCQ 4BBRH 2IX0A 4X64Q 2ZJPA 1VQ6A 4LFBQ 4HIKA 2K4KA 4DKAC
chains in the Genus database with same CATH superfamily
4DNIA 4C3JG 1IKLA 2SNMA 3EJIA 3NBIA 2PW7A 2NVYB 2JA7B 2K75A 4Y7NH 3TREA 1YNND 3H0GB 1PTOF 3MXNA 1P8LA 3N6RA 3CCSA 1EOTA 1W2BA 3KF6B 3BYTB 5IOCA 2RQXA 4DXGA 1IKMA 2QGQA 1JJCB 2R61A 2F3WA 4ALPA 3UI2A 3S16B 3GTMH 1FGUA 3ERSX 1MHWC 1YHAA 4XYQA 4V0BA 1A6XA 2WB1B 3HOXH 2GVAA 3I8ZA 4DV2L 2BA0A 1BUVT 3RZOB 1HHVA 1KNAA 1PH1A 1KLUD 1H95A 3I73A 1KD1C 4RGMA 4OO1I 3EFXD 1W3SA 4K0KL 3M4OB 4GKJQ 4JI8Q 4YHHQ 4JI5Q 2F0QA 4JPBW 1UAPA 5C44B 4JI6Q 4YWLA 4O0AA 1FJGQ 1UUPA 4L63B 4BY7H 2R93G 4I7ZC 3TS2A 1G291 1TY2A 2A73B 1YNXA 2UU9Q 2CFMA 4WJ4A 4RKBA 2EXZA 5CC4A 3CP0A 4KJNA 4RKLA 4DA2A 5AJ3L 2JQOA 4GLVB 1WFQA 2Q2UA 5I2XA 4RFBA 4K8IA 4OWXB 4GLXA 3D6CA 3S2HH 2AQ2B 3S1MH 3S1RH 1XPUA 2A19A 2WAQB 4FF3A 1ENCA 1SYFA 1E2VA 2NVTB 4AQYQ 3HOUG 3K7UC 4OO1G 2BH8A 2DY7A 1X3FA 1ZYRD 1J8IA 4LUZA 1YNJD 2Q8RE 5M5YB 4GLAC 5IE8A 1V9PA 3KF6A 3J7YW 3TP7A 1NCVA 2WINB 1XTDA 3RNUA 2NN6H 2NVYH 2JA7H 2JA6B 2I07B 2PNHA 2MUYA 5JEAH 3H0GH 4KV6A 1CT1D 2VQEQ 4YIJA 1XWEA 3W2DA 1AZQA 5LL6X 4WFN3 1HJPA 4XTCS 3QJYA 5M5XB 3GTKB 1HNXQ 2BDNA 2PQEA 2F0FA 4UP8A 4A3KB 3S16H 1XJVA 3OPOA 4DV0L 1N8RC 2V4DA 3S9WA 1GVPA 4YCWA 3E5SA 3RZOH 4EX5A 2L4NA 1RKNA 4A3FB 1LYLA 2FMCA 2EOTA 3DWPA 3M4OH 2M00A 1EOVA 3SGIA 1CKNA 5C44H 1G51A 4OHJA 1PRTB 2XRSD 3MHBA 1K83B 3I72A 2XN9C 2TSSA 5IT9c 1L1OC 2RVLA 4G7OC 5C4XB 4DNTB 2EJFC 5JEAG 1JICA 2ZXPA 4EQOA 4KY7A 2AQ3B 1QUQA 1F2YA 1LT3D 2CH4A 4PNYA 4PZ6A 4DU9A 4DGZA 3JAMc 2BE5D 2F0VA 1EY5A 1VQDA 2F0UA 5C3WA 1QE6A 3SR1A 1EYDA 4FO2A 4DR7Q 1HR0L 2YYZA 5E3FA 2KEEA 3SHLA 3VYSA 2NVTH 5D3DA 5ELEA 3PIPA 4GOPA 2F0HA 1HH2P 4FVMA 1Q90A 1VQGA 2PCFB 1E2WA 1ILQA 5M5YH 2IX3A 3I90A 2DGYA 2K05A 4A3LH 4JI0L 3PUYA 4DV3Q 1YJNA 2JA6H 1TS2A 2KA7A 2AUKA 2RCNA 3ND9A 1SNOA 4CJ0B 2VQFL 1YZ6A 1I4HA 1JWSD 1HZBA 1HNWQ 3PIO3 4NPSA 5L37A 5M5XH 1EU4A 1TT2A 3OTOQ 1Y14B 3GTKH 1ICFB 3NQIA 1KXLA 1U4LA 1DOMA 1IBLL 4C3HB 1PA6A 4A3BB 4A3KH 2HUGA 4OGQC 4QCLA 2R92B 2OT2A 4QGUA 4LFAQ 3AFQA 1JMCA 4KHZA 2UXDL 4OWWB 1J9OA 5JVG3 4A3FH 2D0PA 2YTVA 4RCOA 2KHSA 1N36Q 4JI2L 1I94Q 2DUDA 3BZKA 4DV4L 1KDCA 4APVA 3J81c 1K83H 1Q8IA 3PSIA 4RMFA 2K5QA 2Q2IA 1EY0A 3VYTA 3NQTA 1CKOA 5C4XH 1FYCA 2K52A 1G6PA 3L2PA 4PMCA 5M3FG 1VQ7A 3IKJA 1SE4A 3P1HA 5DM63 1X32A 2EY6A 3L7ZC 3E6ZX 2F4VQ 1OO9B 4JCVE 5I9PA 3K81C 4A3KG 1ML0D 3CMEA 2Z4HA 3X3MA 3KLWA 4ME5A 3SK5A 4UAIA 4LF6Q 2EZVA 1DCZA 3OHXC 3RUZA 1PHJA 3QR8A 3J80c 4DK6C 4DR2L 3I4MB 2KUMA 4DR5Q 2EJGC 3UDIA 4C1NI 2TMPA 4A76A 4K5WA 1G6ZA 1B3QA 2F0SA 1CA5A 4IFDH 1O7YA 5HY6A 4BBSG 2C35B 3ZJYC 3HFZB 3S15B 2A8VA 4MNOA 1ICWA 3PV0A 1A3UA 4MTKA 4KKUA 4NW2A 2ZT9C 1X6OA 3ULLA 1L0WA 3DUZA 1EWIA 1FL0A 1MGSA 3J7AV 2B8GA 4C3HH 4A3BH 5I2YA 3I4NG 2R92H 2J7ZA 3H3VH 1VF5C 4C56C 4X3TA 2DN8A 1L1OB 1A3TA 1PFSA 2D62A 4A3EB 3MTSA 1BXTA 5CV7A 3NELA 1FNUA 1EEFD 3TDQA 1C0AA 1L0YB 1PXUA 4LF8Q 2O5IC 3P7JA 4FNFA 3D8GA 1B3AA 2JSOA 1PVOA 1A8VA 2KEDA 1NY4A 1B9MA 2K14A 3NXWA 5ELOA 4DV7L 5K36G 2EY5A 1TVXA 1STGA 2H1EA 1S72A 4Q0FA 3ICEA 2UUAQ 4RHSA 4O42A 1SBBB 2AWNA 2CVRA 4KKTA 2EYHA 3LNNA 1QWYA 3KJOA 4CDDC 3K57A 2CHBD 2Y0SG 1JOOA 1OXXK 2R7ZG 3S24A 1AN8A 1QNUA 3A7LA 2F0WA 2KCNA 2XWBB 1K0RA 2K5DA 1ILPA 4A93G 4KY5A 4DAYA 5CYUA 2KJXA 1SE2A 3CRKC 4UP7A 4L5TA 4KTAA 3I4MH 3KFUA 4L5QA 2B2UC 2WKDA 3K5OA 1STEA 4NXNL 5TSSA 4BBRB 4EQPA 3S15H 5IY0A 1ZYRC 5IP9H 2OCEA 3M7GA 2F0IA 5FKAC 4P73A 4ZQ3A 2K28A 1B9NA 2UUBL 4KN7C 2M9VA 1IYUA 3X3NA 1WCMG 2J4XA 2D9UA 3HS0C 4B3MQ 2B2YA 2A6HC 1VMCA 1D1IA 1EIFA 1Y1VG 4A3EH 1BVSA 4JI4Q 1PZKD 1BBXC 1C7YA 5JPNC 2EQSA 1H9KA 2NBFA 1EQRA 1STNA 3W5OA 3S17B 1R4QB 1I4GA 4OX9L 1NNXA 4R8NA 1DYQA 1JWMD 2ALYB 2K03A 4ULLA 4TSSA 2K1BA 4OELB 4QIWE 4DV5Q 4HIOA 1YJ9A 4DV6Q 3E9HA 4IUVA 1NSNS 5ELDA 1GUSA 1WTWA 1PH9A 2RF4A 5IP9G 3J7AF 3BJUA 3Q22A 3AFPA 4P75A 1GHJA 2ZTDA 4A4IA 1JOQA 3MWYW 1A2TA 3TRZA 1K8OA 3VYRA 1YHQA 2ENBA 2PZWA 4DR3L 1KDAA 5J39A 5H1SE 1IZ6A 2AKWB 1HZAA 3S2DB 4B9WA 1GO3E 3DM1A 5C0XJ 1E0BA 5M9OA 4DR1Q 1GM5A 1SE3A 3TN2A 3PQIA 4BBRH 4X64Q 4ZKCB 2K4KA 1AEXA 5G3LF 2E2IB 4KK7A 3FRPB 1QVFA 3CCLA 1TWFH 1LABA 3CF5A 1Q86C 2A5HA 2B2VA 1SYEA 5DM73 2EDGA 1YVCA 4XT1B 3CMAA 4GS3A 3OYYA 3QOLA 1I4QA 2IL8A 1W6JA 2P5ZX 2NB0A 2Q2HA 4HSVA 2KOLA 3FDTA 3BVGA 4HCSA 1JWUD 2F0DA 5CV9A 3HRZC 3ND8A 1AP0A 1C9OA 4K8JA 2G5DA 1I4RA 5JJLA 3C46A 2I5MX 4GKJL 4JI5L 4JI8L 4YHHL 2UUCQ 2N88A 1S5ED 2HT1A 2PZUA 3NBHB 4JI6L 1K0SA 1FJGL 4ODGA 1PTOD 4G7ZC 3S17H 5D3IB 3MA2B 4P72A 1LT4D 3UE0A 2EPBA 2KENA 2ZJQA 2UU9L 3U9SA 5LMUQ 3A54A 4X6AH 5IYCG 4HIMA 5LMNQ 2E2JB 1Q1BA 3W1BA 4LF4Q 2ASBA 4WRDA 3PF5A 2FHTA 2F4IA 4UDUC 3I56A 3NP8A 1VQHA 1KDBA 1RHPA 3M9BA 4OIJA 3QIAA 2JEAI 4FXDA 4DUYQ 3LGJA 2BH2A 4AQYL 3D3RA 2BCOA 2PNRC 1KAWA 2EYPA 1WTQA 3TBIB 1XYIA 3FPUB 1QILA 1EIHA 4JBMA 3S2DH 1MJEA 5IGFA 2EYOA 2A68D 4GOPC 1TU2B 4KHVA 1SNQA 3PUXA 1EY7A 4QJFA 5IODA 5EKLA 1B53A 2BDOA 2VQEL 3DWQA 1H9JA 2YTYA 3CRLC 1D5XC 1CTMA 5J3BA 2E2IH 1NTGA 4RHRA 3OW2A 4Z9CB 1MI2A 4A3IB 4IUQA 5ELCA 3NHHA 1FNWA 5CV8A 4X3KA 1PYBA 3S14B 4J8QA 1HNXL 5FO8B 4FF2A 3S1NB 4QIWB 1BCPC 2EYJA 1QCBD 2JA8B 1IW7D 3CCRA 1J6QA 3T13A 4LNQA 3SXHA 3HOYB 5FK9C 4DK1A 1T9HA 2R7DA 1DGSA 1EYGA 3NBHA 2NVXB 4KJOA 4PMWA 1XPOA 3OWFA 3I7FA 1RF2D 1LV9A 2AWOA 2F0JA 2K5VA 3F1ZA 5KIXA 3T1HQ 3OSOA 5EJWA 1D1KA 2XSCA 1BOSA 4ZKBB 1E7ZA 3IAYA 1NE3A 1TR5A 4DNRB 1ET6A 4UPAA 2Z6BA 4L6TB 3H09A 1F9QA 2JP1A 1HR0W 4LJZC 2NTSA 2L0CA 2MGSA 1QVGA 4JI7Q 1OXVA 3K5MA 4UY8C 2VS1A 5IGCA 2E2JH 1XNQQ 4O2DA 1LLRD 4ZLTF 3CHBD 3NENA 1C48A 4A3GB 5I6WA 1M1KC 1ENAA 2DNCA 1UWVA 3WOFA 4DR7L 2CW0C 1A3VA 4B3RQ 2NVQB 4I7AA 1SMYD 3TEHB 4IUNA 1QZGA 1EU3A 3TS0A 4DFAA 2G9HD 2C9OA 2Z8LA 1N34Q 4A3CH 2YTXA 4RGTA 5CR3A 4F88A 4XQNA 5CMDA 1KNEA 2NYZD 5IP7H 1JJGA 1HPCA 1GJXA 3Q8DA 1PFMA 2RBMA 4CJ2C 2L55A 4DV3L 2FINB 2VL6A 4RCNA 1MJCA 3CPFA 4HCEA 4LMQD 4DK0A 2PYKA 1VS0A 3STBD 4A3IH 1HNWL 1TS4A 1A15A 3S14H 3OTOL 1VQ8A 5J22A 3S1NH 4CKEA 3P75A 4FDBA 1Y8NB 2JA8H 5EQ0A 3HOYH 5IIFA 4LFAL 1QG7A 1HQMC 3H3VC 5BN3A 4CKBA 5HGTA 2NVXH 1K3RA 1VQ9A 3I4LA 1Y8PB 4JOIA 1CKNB 4U68A 1MD2D 3VR5A 1DM0B 1D8LA 3LWEA 1E1OA 3HKZE 3U4ZA 1OTCA 3NTKA 1N36L 4PQXA 1LTRD 3ULJA 1SNDA 1I94L 4N9TA 2X69A 3Q6SA 1NR2A 4B08A 1XPRA 1IHZA 2GVBA 3TQYA 5FLXL 4HSPA 4IPCA 3CCJA 3PO2B 3TP5A 1ZKOA 1QUQB 3HOXG 4R9WA 4F87A 4R4OA 4XT3B 2IX1A 4FXGC 1B70B 1DD2A 3VA7A 1R4PB 4ZUIA 2FMMA 3RZDB 1F9RA 2B8FA 1Q12A 2FXQA 4A3GH 1VQJA 1STAA 4K5VA 5EPKA 3O13A 2FFKB 4GOPB 2F4VL 2EXDA 5CV5A 2NVQH 5GROA 4KN4C 3HOYG 4FF1A 1R9TB 4BY7G 1K8GA 3T16A 5ISRA 4LF6L 2AUJD 5ELFA 1HZ9A 2NN6I 1PH7A 4DR5L 1G2TA 2Z0SA 1WOCA 2E2HB 2DY8A 1BCPB 5EKKA 3J7ZC 1DZ1A 2D0OA 1JE5A 3UDGA 1E24A 2R7FA 5D65A 1P16A 4A3DB 1J5EQ 4JW0A 2LS01 5IYDH 4L5RC 3T1YQ 2O2LD 1N32Q 1VQLA 4JI1Q 1Y1WB 5FLXE 4LF5Q 1PV4A 1YI2A 4A3GG 3CW2C 2ATWA 1RTOA 3HKSA 4ZCKA 4H44C 4ZRZA 4GN4B 1X3QA 1KQSA 4HIDA 4H13C 2NN6G 2JA7G 1WTRA 4G4KA 1CI3M 4CDFC 3DLLA 3K80C 1PYSB 2EY1A 3H0GG 1IBKQ 1HQRD 4HR7B 4XQJA 1HFNA 2F52A 2YU9B 4LF8L 2Z1CA 3A7AB 5CV4A 4R4CA 4JI3Q 4HJ7A 1XX8A 2B2YC 2KCCA 2H5XA 5C3EB 3RLNA 4JYAQ 2RA4A 4M1UB 3G71A 4ZUJA 3PO2H 2UUAL 2Z6KA 4IOAA 2WB1G 4ZYSA 2F03A 1CKMA 1V1PA 1EQVA 2UXBQ 1PTOC 2XRQD 2K50A 3EBEA 4LUVA 5KNDA 4HJ5A 3RZDH 1E2ZA 3CC2A 1SEBD 5CGKA 3SEBA 5C44G 4IZ8A 1WD0A 1BR9A 1R9TH 2B2TA 3DEOA 3AU7A 2A69D 3PMFA 3PO3B 5ELBA 2E2DC 1Q81C 3QWNA 3AB9A 4ZK9B 4H02A 1SYBA 4HJ8A 2E2HH 1OXSC 1KL9A 2X6GA 3A8JE 1I6HB 1I4XA 3OMCA 4BXXH 3E9IA 3GTPB 1PH5A 3HKZB 2VB2X 2E8GA 1LTGD 1JB7A 2WAQG 2PW5A 3ER0A 1CSQA 4A3DH 3HOWB 2F0GA 4B3SQ 5M3MB 2DJGC 2ZJRA 1DONA 3SK6A 1HCZA 1VQEA 4LW1A 1EFWA 3W1GA 3LX0A 1PMRA 3DXJC 3GTJB 3SDZA 1Y1WH 1MIUA 3R93A 4A3JB 2EJMA 2B63B 3GQBA 4LUOA 4B3ML 3KOJA 2JE6I 2B2VC 4A3LG 1Z6HA 2HQLA 1C4QA 3K59A 2MQHA 3PCOB 3GV3A 2L1BA 2JA6G 4JI4L 4CKCA 5E7NA 5GAEC 1HZCA 2YU9H 1D7QA 4CDCC 2ZTCA 5C3EH 3TMEA 4IURA 4IUUA 1LACA 1L2FA 4GN5A 2HDMA 4DV5L 5ELNA 5JVH3 4DR6L 1KHIA 5I9OA 1SRUA 2EE1A 4RWSC 4DV6L 3JAMi 1K3BC 1X3PA 2EVBA 2JA5B 3HGBA 3VDYA 1RODA 5FLMH 1EY6A 4A3FG 2RSNA 4L5SA 1HNZQ 1GUNA 1SDFA 4DAYB 1EWCA 1WI5A 1RCVD 3CPWA 3AEVA 3AYHB 1BBUA 1KABA 1S5BD 5HURA 4IFDI 4AYBE 3PO3H 5F2DA 5BR8Q 3AMUA 5C4XG 5E4WC 1SMYC 4R1JA 1PH4A 4HEDA 2UXCQ 1YNNC 4DR1L 1I6HH 5NUCA 1LTAD 3GTPH 5I4DA 1W6KA 4X64L 2CH4W 1ESRA 1YHBA 4HTHA 3UDXA 1EFID 2HIXA 1BO0A 4J6HA 4OWTB 3T56B 3HOWH 1DJRD 4N8X1 2PMZE 5M3MH 3H3VI 3D4DA 4H7BA 4LFCQ 3FKIB 2ZJPA 3GTOB 1WTVA 4HIKA 2NZ1D 4DKAC 3GTJH 1CUKA 1X9NA 4GZYC 4A3JH 1BBWA 3UDFA 3OMGA 2B63H 1YITA 1F9SA 5C0XH 1JORA 4LF9Q 3GTLB 1WYDA 4IFDG 4JV5Q 4DAMA 1YIJA 3GTQB 1VQOA 1PRTD 3GTGB 1VF7A 3B6YA 1HTPA 1PTOB 1VQKA 2ICEC 2UUCL 3OW7A 3J81i 1SSOA 3F2UA 1SROA 3R8BA 5G3LD 1SMXA 1U4PA 2PI2A 4YWMA 3K7AB 3KLRA 5IGEA 4A3BG 4C3HG 5LMUL 3OIPA 2AHOB 2R92G 5LMNL 4NDXA 5KYIA 4LF4L 2JA5H 2E76C 1VQ4A 3HOWG 2K5HA 1EIGA 2O5JC 1BDOA 4RAUC 3U9OA 1H9SA 4A3MB 4DUYL 1HXYD 1GHKA 1WTPA 1G8ZD 4P2CB 3J80i 3RLOA 1XXGA 1YNJC 4GN3B 1V1QA 1TWFB 2V1CC 1NAPA 4HJAA 4AIMA 4BY1B 3TZUA 1STHA 5GAHC 3PUVA 1XTCD 3WDNA 3SK4A 1NR4A 1QNKA 2OTJA 3BZCA 4XYOA 1LTBD 1UE5A 3TP8A 1JE4A 3H94A 2XVSA 5GQOA 5BN5A 2ICIA 3MEFA 3M7NA 2JK8A 3HOVB 3U50C 2M2LA 1EYCA 1GUWA 2KCTA 2L5TA 3BDLA 3K0XA 4Q5VA 4FF4A 1CFMA 2ID0A 1X56A 4MN3A 3GV6A 1TXYA 2XIWA 4CHTB 2EYMA 1X54A 3E0JA 3FKIH 2VW9A 3GTOH 1VQ5A 3D31A 4LF7Q 3I4MG 1Y8OB 5C4ZA 2E75C 4H0LC 4IPGA 4V190 1FVIA 3GTLH 4IPHA 3NTIA 2LKVA 4IJLA 2K01A 2R3ZA 3H6MA 3GTQH 4DR6Q 1SLJA 1KTKA 1EWHA 3GTGH 1JOKA 4C3IB 2N49A 1PTOH 4PZ7A 5GADC 3T1HL 3N52A 1WD1A 2VUMB 2F0PA 3ULPA 5EPJA 3G6JB 1WTHA 3VR4A 3A0JA 4JOIC 2QA4A 4AYBB 1HUNA 3K7AH 3OWEB 2OTLA 5KNCA 3HP3A 4JI7L 4X65Q 3I55A 3IRBA 2BE5C 2N55A 1XNQL 3ERQA 1SNCA 3NK9A 4BWGB 1SNMA 4A3EG 2CCZA 2GA4B 2F1MA 3A74A 1JB3A 4X3SA 1PRTF 3FKIG 4B3RL 4QF4A 4A3MH 2QILA 3MEHA 2PMZB 3CD6A 2OQKA 2QW7A 1E22A 1IYVA 1N34L 4NP5A 1EEID 3I91A 3FMCA 3CC7A 4BY1H 1X55A 4K6LA 1S5DD 2F0LA 5IYBH 4QMGA 1B44D 1EY8A 3CCMA 1VQBA 2EYLA 1LM0A 1FNVA 2K7VA 3KBXA 1STYA 3HOZB 5IWAQ 3BVZA 2FJ2A 3HOVH 2JJQA 2WKCA 2IT1A 1ONLA 3KF8A 4OL7A 4IN3A 4XXEA 3EROA 4OEMB 2K04A 1LO5D 2IHFA 1RTNA 3CXCA 4DR4Q 5AFWA 4YWKA 4BBRG 2N8NA 1MSHA 4NXMQ 4GKKQ 4C3IH 1IXRA 2BA1A 4ZAIA 5FLXc 2VUMH 3M3YB 1EIYB 2D2CC 3H15A 2NZOA 2VB3X 1N9WA 3D4RA 1CHQD 4XIGS 5KYLA 5KNBA 1U5KA 2KECA 4KHPQ 1UE1A 2HDLA 1A0IA 3M4QA 4MZ9A 5E1FA 3QG1A 4DAVA 2Z6KC 1LUZA 1XMOL 1VQAA 3RN5A 1O78A 1X65A 3NE5B 3HG9A 1U4RA 5EBDA 1PZJD 2L9HA 3BVMA 2SNSA 2R93B 1PH2A 1UE7A 5FJ8H 1VQPA 1JR0D 3BYYB 1XMQL 1I50B 3F2BA 1FGBD 1FR3A 5JJIA 2OWOA 2WV6D 1PFNA 2B2TC 2I5LX 2F3VA 4IQZA 1KIXA 1I3QB 1BQQT 1II3A 2MFIA 4B3TQ 3PF4A 2H4OA 3HOZH 2R6GA 3HOUB 4OONA 3GP7A 1J5EL 2G9DA 3K6OA 4P74A 4N8FA 3T1YL 3J81j 2BOSA 3NWSA 1GUGA 4MTNA 1PFBA 1O7IA 2IJ0A 3QO2A 4NMZA 4JI1L 1N32L 1HTLD 4LF5L 1QJOA 4X3UA 1K28A 3R2TA 1EZ6A 1X3GA 4YY3Q 1D6EC 3ZYYX 2LXKA 4POGA 1AW7A 3PUWA 1HRJA 1IBKL 3CQZB 2Q8TA 4JI3L 2DNEA 3M3YH 1NJIC 1B50A 4JYAL 1V1OA 4WORA 4NB3A 3NUCA 3FEWX 1VQNA 3R2IA 2F0MA 5C4HA 3HZXA 4R8IA 1DOLA 5C3XA 1VMPA 3V05A 2UXBL 2NUCA 2RDFA 3K8AA 1PH6A 1VQCA 1UEAB 2LXJA 2WP8J 4YCUA 2B2WA 1UE6A 5IGGA 4GNXC 3MFYA 3BDOA 4MHEA 2F0TA 1JJ2A 2R93H 4C1NK 2F0OA 5CORA 4IOCA 4POFA 4OIKA 4RA8A 3QOJA 4NKLA 1KLGD 2QKIC 3MC0B 1I50H 3NWTA 3F2DA 1Q3LA 1UNSA 3CC4A 4PMBA 1Q8KA 1TIID 1Z9FA 4R4IA 3K5NA 1I3QH 2CKZB 5DLQE 4KI0A 3G4SA 3KDFA 1LT6D 3HOUH 4OO1H 1U9RA 2PQAB 1C8CA 1I6VC 4B3SL 1B8AA 1XNRQ 1ZXTA 1EYAA 3JC66 2PPBC 1F2LA 2J0TD 1IYJB 1PDQA 4A3CG 1BKBA 5IP7G 2HIVA 4QQBX 2Y0SE 3CCVA 4XQQA 1NMFA 1YBYA 4KD3A 2KHJA 5C5LA 2MHVA 3D0FA 3GDEA 3WWVA 3MXUA 3CQZH 1D5ZC 4G57A 1KAAA 1KRSA 2JYOA 4A3IG 1GXDC 1G2SA 1XMOQ 3RR5A 1SYDA 1GKHA 1U4MA 1F77A 1V1PB 5GAGC 2B3GA 1CK1A 2NWGA 2JA8G 4L8JA 5CV6A 3I4OA 4IUPA 2RDGA 1XMQQ 5COYA 3J7A5 3SE0A 1EL0A 1HNZL 4X62Q 2B39A 4DV1Q 1JQYD 1CSPA 1H9MA 4OXPA 5LL6S 2PI2E 1HA6A 3MXPA 1I5FA 2L11A 4QL5A 1F2MA 4KLKA 5JJZA 3Q23A 5JJKA 4HJ9A 1S3OA 5BR8L 1GUOA 1PH3A 3CCQA 4DAPA 5M3FB 1VQIA 1LTSD 2UXCL 2A6HD 2PQAA 1AFPA 4YCVA 5EAYA 2Q8IB 5A35A 5C6AA 1X3EA 3FP9A 2JA9A 1A62A 1K9MC 1E3PA 3IL8A 3PGZA 4KMUC 1SJHD 1N33Q 1S4ZA 1TS5A 2OEOA 4LFCL 4IO9A 3EVQA 2VY3A 2CWPA 2PO4A 3D4WA 2WACA 3FHWA 1IBMQ 2Q2TA 3KBGA 3FVQA 4BBSB 4LF9L 3EA6A 2CQAA 3ONAB 2MNAA 4JV5L 2IX0A 4LFBQ 4RH6A 2SDFA 1TWGB 5LMNW 1DXMA 1KC8C 2OF1A 3BG3A 4KD4A 1WTOA 2L15A 5KEEA 1BF4A 4HMIA 4DUZQ 2E5LQ 5BN4A 3LWUA 3M4YA 5IYDG 5C4JB 1Y69U 1TQOA 5CBAE 4GNXB 3L3OC 4G7HC 3VR6A 4X66Q 3I4NB 1S5FD 3EIVA 3SVMA 3BZDB 2PZTA 3BS1A 1ENFA 3G7LA 2F0NA 3I2ZA 2N3SA 4AH6A 2KQ3A 2RCFA 3OIQA 1SN8A 3CCEA 2K6AA 3UE1A 3RLFA 4MIUA 2B29A 4HAEA 1EY9A 2LY7A 1IL8A 3A8IE 3CAMA 1STBA 1ASYA 1VQFA 1LTLA 2EYFA 2LFNA 2AQ1B 3PO2G 2HQEA 4DV2Q 4EGVA 2K5WA 2A68C 5M5WB 2Y0SB 5M3FH 1T5XD 2R7ZB 3G48A 4K0KQ 1K8MA 3BDCA 1NMGA 1ASZA 5IGDA 2HCIA 4WJ3M 4J15A 4UHVA 2X6LA 3I3CA 4A93B 4J1MA 1H9RA 1SAPA 1TY0A 3IFDA 1IW7C 2DJFC 4P71A 2VXWA 3H91A 4KY6A 1YJWA 1MSGA 3I70A 4LF7L 3DHQA 5AJ3Q 3E0EA 4EQ5A 1QOHA 4BBSH 2CQOA 4M8AA 1RJTA 4BXXG 3KJPA 1OXUA 1B1ZA 1PYWD 5JEAJ 4GNXA 3D6WA 2VNUD 2ZM6L 3K58A 1SFOB 1TWGH 3QB3A 2CWAA 4K2LA 3PUZA 5KGUA 4S3SA 1T5EA 4A3DG 3M85A 1EY4A 1WCMB 1S5CD 5C4JH 4CJ1B 1QB5D 3I4NH 1Y1WG 4ME3A 4X65L 3TZDA 4FP5D 1HA5A 1Y1VB 4IPDA 1ZEQX 1H9SB 1TWAB 1AH9A 2N78A 1ESFA 1WVLA 1EQQA 4Y52H 1HUMA 5K36H 2QCPX 1DOKA 2SEBD 5C3EG 1MBYA 1SJED 4DV0Q 4U673 3GD7A 3A5ZB 1BCPD 4HN7A 2NZHA 1MKHA 4TVAB 2I0QA 5HGQA 3IFTA 5FO9B 5M5WH 4DF7A 4QUCA 5LHY1 2R7ZH 3Q24A 5FLMG 5I6YA 2QEXA 3VA5A 1LTTD 3NPPA 3STBC 1GUTA 5IWAL 4A93H 1TS3A 2IPKD 3DWAA 4E6IA 1CQVA 3KLSA 4F8MA 1E1TA 2JEBI 3RMHA 5C0XI 4PV1C 3VR3A 1CZGA 3PO3G 4JBWA 5A2QL 2RKSA 2LMCB 5IT9L 3P20A 5DEHA 4QY7A 2AMCB 1TWCB 2A6ED 4IJHA 2MJ8A 3CU7A 5EPLA 5K5PA 3JAML 4DR4L 4JG2A 2IWHA 1HR0Q 3HKZG 1SFOH 3DEPA 4NXML 4GKKL 1F9PA 2CW0D 2F0EA 1CM9A 3RD4A 2JN4A 2KBNA 3F2CA 4JBKA 1WCMH 4F7XA 5EKIA 5M3MG 4PG3A 3L0OA 5JAVA 4A3JG 2QDBA 2XWJB 3MAQA 2B63G 4KHPL 2O4XA 5C0XG 1SYGA 3URYA 4JI0Q 4I65A 2XNAC 2MO0A 1Y1VH 1PH8A 5KRUA 2QDLA 4LWCA 1B7YB 4JVZA 2VQFQ 1TWAH 2RHQB 5T1GA 2HHHL 1NBWA 4BA2I 1SNPA 4RGNA 4O1NA 1GOZA 2E74C 4DXFA 1IBLQ 4R4QA 1AE2A 1JC7A 5EBCA 4C2MB 4TQUS 3F8TA 2B2WC 1SYCA 3C1EA 1O80A 3MVVA 5J1ZA 3OOCA 3EN2A 2UXDQ 1B2TA 5A2QE 5IT9E 2JA5G 1ET9A 1SE8A 2RHSB 2D5DA 1L1OA 1B4OA 5E4XA 4JI2Q 3JAME 4B3TL 1VDZA 4DV4Q 2JXMB 2WIIB 3KF8B 3PIP3 4DK3C 1UEBA 3T51B 2ZM6Q 3ITPA 3KLSX 2C5CA 3VYUA 3J81L 3GO5A 3V96A 4JC0A 4K5XA 4N9PA 1BCPF 1Q1EA 1Z47A 4YY3L 3BU2A 1TWCH 2EIFA 1HFGA 4IFDJ 1FD7D 4EQNA 1O7LA 2YV5A 1RD9D 2K33A 4TKOB 1TWHB 3HEJA 3K5LA 3MXGA 5C5MA 3W3AA 3S1QB 2HD3A 4DR2Q 3M4PA 3T4AC 2KCMA 4WJWA 1RL2A 2K5NA 1CQFA 2IHEA 3R3OA 4K6DA 1QZHA 3J80L 3A55A 2MPMA 1S40A 3MZ5A 3L9AX 1AE3A 1Q46A 1RDPD 1V43A 1VQMA 1A2UA 1D2BA 5D14A 3CKIB 3SK8A 3K0YA 3T53B 3U4VA 4CDEC 3DM3A 1TKWB 4PZ8A 1CA6A 1Q82C 2A69C 2KHIA 4BS9A 4C2MH 3FPPA 5IYCH 4K14A 3J81E 3G6EA 2Z4IA 3NSWA 1LTID 1M8AA 4QUFA 1WTXA 3NTHA 3A5UA 5IGBA 4KKSA 4C3JB 2XTIA 2NTTA 1K8AC 2F3IA 4K2KA 4FYDA 3DMUA 1K73C 4A3MG 4DV7Q 3KK7A 1JCKB 1XNRL 3NEMA 2MP1A 5T1IA 2QEJC 3RN2A 4RG1A 1I4PA 3VR2A 2WB1E 5JOBA 4FXKC 4CGYB 2ZXRA 4QB4A 2I46A 4BY1G 4LAAA 2L12A 3J80E 4ABNA 3MFGA 3Q0AA 5IYBG 4HMJA 2F0KA 3C3LA 1TWHH 1LT5D 3HOVG 4JK1C 2OQ0A 1IL2A 3S1QH 2HHHQ 1EQTA 2ZTEA 2LSSA 1D5MC 3A8KE 2A1AA 4CBVA 1VCIA 4RGOS 4NXNQ 4Y7NB 1OXTA 2ES2A 1PZID 2XGTA 2VZAA 1GD7A 2EY2A 2MO1A 1KRTA 5DNFA 4IUTA 2IY5B 2WAQE 4C3IG 5JPMC 4X62L 1EUJA 4B9XA 4DV1L 2UUBQ 3EQLC 3CCUA 2VUMG 4JBJA 1V8QA 1EZ8A 3MXNB 3E3XA 5FOBB 2WFWA 3GTMB 4BA1I 3HOXB 3WOEA 4AYBG 3U58A 4LK1C 1NUCA 4EVOA 2I5HA 1U0LA 4UP9A 4R4TA 2Z9HA 2GN5A 2SOBA 4IALA 4C3JH 1A63A 1AZPA 1O7ZA 2K32A 5EGTA 3KDFB 5FO7B 2RSOA 1SR3A 1QVCA 2RDHA 1L0XB 1RIPA 1BNZA 2IW3A 4BY7B 1Z7TA 3KYHC 1G91A 5FJ8G 4OX9Q 1N33L 1Q7YC 4DPGA 3C2PA 3TP6A 1YEZA 5DAUA 1CZWA 5CBEE 1PLFA 1CHPD 2QF7A 4A75A 1IBML 3A56A 1M90C 3PIOA 1PRTC 3S2HB 4DN4M 3S1MB 2A74C 3S1RB 1F2ZA 2HCCA 4LFBL 1M4VA 1SXTA 4XDXA 3KUPA 4ILWA 4ID6A 1WJJA 2ZXOA 2OXPA 3HOZG 2B2UA 1JT8A 2A6EC 2E5LL 4DUZL 4DR3Q 4TRDA 3AQQA 3C1FA 3V2TA 1VQ6A 2KVMA 3TSSA 4X66L
chains in the Genus database with same CATH topology
3GTJH 1CUKA 4DNIA 4A3JH 1BBWA 5LMNW 1QVFA 1KC8C 3UDFA 3CCLA 2B63H 1YITA 1TWFH 2L15A 3CF5A 1Q86C 2E5LQ 4DUZQ 4LF9Q 2K75A 1WYDA 1YVCA 5IYDG 4Y7NH 3TREA 3CMAA 4DAMA 4GS3A 4GNXB 1YIJA 1VQOA 3OYYA 3CCSA 1P8LA 4X66Q 3B6YA 1W2BA 2Q2HA 3EIVA 3KF6B 1VQKA 2UUCL 3J81i 2QGQA 3I2ZA 1JJCB 2N3SA 1SROA 4AH6A 1SMXA 2PI2A 1HNWL 1C9OA 4ALPA 1SN8A 1FGUA 3ERSX 3GTMH 1YHAA 4YWMA 5JJLA 3CCEA 4A3BG 3HOXH 2I5MX 4GKJL 4JI5L 4JI8L 4YHHL 2GVAA 5LMUL 2UUCQ 3UE1A 2AHOB 4DV2L 2BA0A 2HT1A 2R92G 5LMNL 4JI6L 3NBHB 3RLFA 1PH1A 2B29A 1FJGL 4LF4L 1H95A 3CAMA 2JA5H 3S17H 1KD1C 1ASYA 1VQFA 1LTLA 1VQ4A 3HOWG 4P72A 4OO1I 3UE0A 1W3SA 2K5HA 2KENA 2ZJQA 3PO2G 2UU9L 4K0KL 4GKJQ 4JI8Q 4YHHQ 5LMUQ 4JI5Q 4X6AH 4DV2Q 5IYCG 4HIMA 5LMNQ 4DUYL 4JI6Q 4YWLA 4O0AA 1Q1BA 3W1BA 1FJGQ 4LF4Q 2ASBA 5M3FH 3PF5A 4BY7H 2R93G 3I56A 1VQHA 3J80i 3RLOA 3TS2A 1G291 3G48A 4K0KQ 3M9BA 1YNXA 2UU9Q 5K36G 2JEAI 1NMGA 2CFMA 4GN3B 1ASZA 4WJ4A 1V1QA 2V1CC 4DUYQ 4J15A 4HJAA 3CP0A 4AIMA 4WJ3M 5AJ3L 3LGJA 2BH2A 2JQOA 4GLVB 5GAHC 4AQYL 1WFQA 3PUVA 2Q2UA 2OTJA 1KAWA 3BZCA 4OWXB 4GLXA 3S2HH 3S1MH 4P71A 3S1RH 1XPUA 1UE5A 2A19A 1YJWA 4LF7L 5GQOA 5AJ3Q 4JBMA 3E0EA 4EQ5A 3S2DH 3MEFA 1MJEA 2JK8A 4AQYQ 3U50C 3HOUG 3M7NA 3K7UC 4OO1G 2KCTA 2CQOA 3K0XA 4GOPC 4BBSH 2BH8A 2ID0A 1X56A 4BXXG 3PUXA 3KJPA 1TXYA 1OXUA 2VW9A 1X54A 3FKIH 4QJFA 3GTOH 5JEAJ 4GNXA 1X3FA 1VQ5A 2VNUD 4LUZA 3D31A 2ZM6L 2VQEL 1TWGH 4LF7Q 2CWAA 4GLAC 2YTYA 5IE8A 5J3BA 2E2IH 3I4MG 1NTGA 1V9PA 3KF6A 3PUZA 3OW2A 4IPGA 4A3DG 3M85A 1FVIA 1XTDA 3RNUA 3GTLH 1PYBA 2NVYH 4IPHA 2JA7H 2PNHA 1HNXL 5C4JH 3GTQH 4IJLA 4DR6Q 3H0GH 1SLJA 2VQEQ 3GTGH 3CCRA 1J6QA 3I4NH 1Y1WG 4ME3A 2N49A 4LNQA 4PZ7A 5GADC 4X65L 3T1HL 1T9HA 1HJPA 2R7DA 4XTCS 1DGSA 1EYGA 3ULPA 4PMWA 1XPOA 1HNXQ 3A0JA 4IPDA 3I7FA 4JOIC 2QA4A 4UP8A 3S16H 1XJVA 4IFDG 1QVGA 4DV0L 3K7AH 1N8RC 2AWOA 2OTLA 2K5VA 3F1ZA 4JI7L 4X65Q 2N78A 3I55A 3T1HQ 1AH9A 1GVPA 4YCWA 3IRBA 3RZOH 1E7ZA 4EX5A 1EQQA 1XNQL 4Y52H 1NE3A 1LYLA 4UPAA 5C3EG 4DV0Q 4A3EG 2CCZA 3GD7A 3A5ZB 3A74A 1HR0W 3M4OH 4JI7Q 1EOVA 2NZHA 1OXVA 1CKNA 3FKIG 1MKHA 1G51A 4TVAB 2VS1A 3SGIA 5C44H 4A3MH 2E2JH 5HGQA 2I0QA 4O2DA 1XNQQ 4B3RL 5M5WH 3CD6A 2OQKA 1E22A 2R7ZH 3NENA 5FLMG 2QEXA 1N34L 5IT9c 1L1OC 1M1KC 1UWVA 4DR7L 5JEAG 4B3RQ 3STBC 5IWAL 1QUQA 3CC7A 4BY1H 4A93H 1X55A 3TEHB 1QZGA 4PZ6A 3JAMc 3TS0A 5IYBH 1E1TA 2JEBI 1VQDA 3CCMA 1N34Q 5C0XI 1VQBA 4A3CH 1LM0A 2YTXA 4DR7Q 1HR0L 3PO3G 2YYZA 4JBWA 5IP7H 5IWAQ 1JJGA 4QY7A 2NVTH 2AMCB 3HOVH 2JJQA 3PIPA 4GOPA 4IJHA 3Q8DA 2IT1A 1HH2P 4DV3L 4DR4L 4JG2A 1VQGA 1HR0Q 3HKZG 1SFOH 4NXML 4GKKL 5M5YH 2VL6A 1MJCA 3CPFA 1VS0A 3STBD 2KBNA 2DGYA 3F2CA 4A3IH 4JBKA 4JI0L 4A3LH 3S14H 3PUYA 1WCMH 3OTOL 1VQ8A 5M3MG 4DV3Q 2IHFA 1YJNA 2JA6H 3CXCA 3S1NH 4YWKA 4DR4Q 4BBRG 4FDBA 2N8NA 4PG3A 4JV5Q 4NXMQ 2JA8H 3L0OA 4GKKQ 2RCNA 4C3IH 1IXRA 2VQFL 3HOYH 1YZ6A 4A3JG 2BA1A 4LFAL 4KHPL 2B63G 5FLXc 1HZBA 2VUMH 1HNWQ 4NPSA 5C0XG 2NVXH 1K3RA 5M5XH 3OTOQ 1EIYB 4JI0Q 1Y14B 2NZOA 3H15A 1VQ9A 3GTKH 2MO0A 1Y1VH 1KXLA 4JOIA 1CKNB 1IBLL 1PA6A 1PH8A 4A3KH 1D8LA 1N9WA 4XIGS 4LWCA 1E1OA 1B7YB 3HKZE 3U4ZA 2VQFQ 1TWAH 2RHQB 1N36L 1OTCA 2HHHL 1NBWA 1U5KA 4LFAQ 3ULJA 3AFQA 4QGUA 4BA2I 1JMCA 4KHPQ 1I94L 1UE1A 4KHZA 2UXDL 1A0IA 3M4QA 4OWWB 1XPRA 2GVBA 3TQYA 4A3FH 3CCJA 4IPCA 1IBLQ 4MZ9A 4R4QA 2D0PA 1AE2A 2Z6KC 1LUZA 1QUQB 2YTVA 1VQAA 3F8TA 4TQUS 3HOXG 3RN5A 1XMOL 1X65A 1N36Q 4JI2L 4R4OA 1I94Q 3EN2A 2DUDA 2UXDQ 2IX1A 1B70B 3BZKA 4DV4L 4APVA 1PH2A 1UE7A 5FJ8H 1VQPA 3J81c 2JA5G 1K83H 3PSIA 4RMFA 1Q12A 1SE8A 2FXQA 4A3GH 2RHSB 2Q2IA 1L1OA 1CKOA 1VQJA 1XMQL 5C4XH 4JI2Q 4B3TL 4GOPB 3F2BA 2F4VL 2EXDA 2NVQH 5GROA 2K52A 1G6PA 4DV4Q 5JJIA 3HOYG 3KF8B 3L2PA 2OWOA 5M3FG 4DK3C 1VQ7A 1UEBA 4BY7G 2I5LX 2ZM6Q 1K8GA 4LF6L 1HZ9A 2NN6I 1KIXA 1PH7A 3GO5A 4JC0A 4B3TQ 2MFIA 3L7ZC 4DR5L 2F4VQ 3PF4A 4JCVE 4A3KG 3K81C 2Z0SA 2R6GA 1WOCA 3CMEA 3HOZH 1Q1EA 3KLWA 1Z47A 4YY3L 3BU2A 4OONA 1TWCH 2EIFA 1J5EL 3J7ZC 4P74A 4IFDJ 4LF6Q 3T1YL 1PHJA 3J81j 2D0OA 2YV5A 1O7IA 4MTNA 4JI1L 4DK6C 1JE5A 3J80c 4DR2L 3UDGA 4DR5Q 1E24A 4LF5L 3UDIA 2R7FA 4A76A 1P16A 1X3GA 4YY3Q 1J5EQ 5HY6A 5IYDH 4L5RC 2C35B 3ZJYC 2LXKA 3T1YQ 3HFZB 4BBSG 4POGA 4DR2Q 3M4PA 1VQLA 3PUWA 4JI1Q 2A8VA 1N32Q 2KCMA 4MNOA 4LF5Q 1RL2A 2K5NA 1PV4A 1YI2A 4A3GG 1IBKL 3PV0A 2IHEA 3CW2C 2ATWA 4X66L 1QZHA 3HKSA 1S40A 1X6OA 4JI3L 4GN4B 3ULLA 1L0WA 3M3YH 1NJIC 1AE3A 4HIDA 1KQSA 1Q46A 2NN6G 4JYAL 1EWIA 1FL0A 2JA7G 1VQNA 4NB3A 1V43A 1VQMA 4A3BH 4C3HH 3DLLA 3K80C 4UY8C 1PYSB 3H0GG 1IBKQ 3I4NG 2R92H 2F52A 3U4VA 3H3VH 4LF8L 3DM3A 4PZ8A 4R4CA 4JI3Q 4HJ7A 1Q82C 2UXBL 1L1OB 2H5XA 1PFSA 3RLNA 4JYAQ 3K8AA 3G71A 2D62A 1PH6A 1VQCA 3PO2H 2LXJA 2UUAL 2KHIA 3NELA 2WP8J 2Z6KA 4YCUA 4C2MH 5IYCH 1UE6A 4IOAA 1C0AA 2WB1G 4GNXC 4LF8Q 3G6EA 1PVOA 1CKMA 1A8VA 1NY4A 2K14A 5ELOA 1JJ2A 4DV7L 2UXBQ 2R93H 2K50A 3A5UA 3EBEA 4LUVA 4HJ5A 4IOCA 3RZDH 1S72A 3CC2A 4POFA 3ICEA 2UUAQ 2XTIA 1K8AC 2AWNA 1I50H 2F3IA 5C44G 1K73C 3KJOA 4A3MG 4DV7Q 2Y0SG 3F2DA 1R9TH 3CC4A 1OXXK 1XNRL 3NEMA 3S24A 2R7ZG 1Q8KA 1Z9FA 3RN2A 4R4IA 4RG1A 1I3QH 2CKZB 1Q81C 1K0RA 2WB1E 5DLQE 4H02A 4KI0A 3G4SA 3KDFA 4HJ8A 3HOUH 2E2HH 1OXSC 1KL9A 4BY1G 4A93G 2PQAB 4B3SL 1B8AA 1XNRQ 4BXXH 3E9IA 5IYBG 1PH5A 4UP7A 4L5TA 3JC66 3I4MH 2E8GA 1IYJB 4A3CG 1JB7A 3KFUA 2WAQG 1BKBA 5IP7G 2HIVA 4L5QA 3ER0A 1CSQA 1TWHH 4A3DH 4QQBX 4B3SQ 3HOVG 2Y0SE 3CCVA 4NXNL 2ZJRA 1VQEA 4LW1A 2OQ0A 1EFWA 1NMFA 1YBYA 3W1GA 1IL2A 2KHJA 3S15H 3S1QH 5IY0A 2HHHQ 3D0FA 2ZTEA 2LSSA 3GDEA 1Y1WH 1MIUA 5IP9H 1X9NA 3WWVA 2OCEA 3CQZH 2A1AA 4LUOA 4P73A 4B3ML 3KOJA 1VCIA 2JE6I 2UUBL 1KRSA 4NXNQ 4A3IG 4A3LG 2HQLA 1OXTA 2MQHA 1WCMG 1XMOQ 3PCOB 2ES2A 3RR5A 2JA6G 2XGTA 2VZAA 1GKHA 4JI4L 5E7NA 1GD7A 5GAGC 2B3GA 2MO1A 1KRTA 2JA8G 1N32L 2WAQE 2IY5B 5GAEC 4X62L 4B3MQ 1HZCA 1EUJA 2YU9H 1D7QA 4DV1L 3I4OA 2UUBQ 3CCUA 2VUMG 1EIFA 2ZTCA 4JBJA 5C3EH 3MXNB 2WFWA 1XMQQ 4BA1I 1Y1VG 4A3EH 1BVSA 4JI4Q 1C7YA 3J7A5 1L2FA 4GN5A 4AYBG 3U58A 2EQSA 4DV5L 5ELNA 1HNZL 4DR6L 1KHIA 4X62Q 1EQRA 1SRUA 4DV6L 3JAMi 4DV1Q 3W5OA 1CSPA 2I5HA 4OXPA 1U0LA 2PI2E 4UP9A 4R4TA 3VDYA 5FLMH 1I5FA 2GN5A 4QL5A 4C3JH 4A3FG 4OX9L 1A63A 4L5SA 2ALYB 3KDFB 4DV5Q 4HIOA 4KLKA 4QIWE 1HNZQ 5JJKA 1YJ9A 4HJ9A 1S3OA 3E9HA 5BR8L 4DAYB 4DV6Q 1SR3A 1QVCA 1RIPA 1PH9A 1WI5A 2RF4A 3CCQA 5IP9G 3CPWA 1PH3A 3BJUA 1VQIA 3AFPA 4P75A 2UXCL 3KYHC 5FJ8G 4OX9Q 2PQAA 1N33L 3AEVA 4YCVA 3AYHB 1BBUA 5EAYA 1Q7YC 4DPGA 2ZTDA 4IFDI 4AYBE 1X3EA 3FP9A 4A4IA 2JA9A 1YEZA 3PO3H 1A62A 5BR8Q 1K9MC 1E3PA 5C4XG 3TRZA 3PGZA 1YHQA 1PH4A 4R1JA 4A75A 1IBML 2UXCQ 1M90C 3PIOA 4DR3L 4DR1L 1N33Q 1I6HH 3GTPH 4LFCL 4X64L 4LFBL 1YHBA 3UDXA 4IO9A 2HIXA 2VY3A 5H1SE 1WJJA 1IZ6A 2AKWB 1HZAA 3HOZG 4OWTB 2CWPA 1GO3E 3FHWA 1IBMQ 2Q2TA 3HOWH 1JT8A 5C0XJ 2E5LL 4DUZL 4LF9L 4DR3Q 4DR1Q 2PMZE 5M3MH 2MNAA 1GM5A 3AQQA 3H3VI 4JV5L 4LFCQ 4BBRH 2IX0A 4X64Q 2ZJPA 1VQ6A 4LFBQ 4HIKA 2K4KA 4DKAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ H;  1CUK A;  4DNI A;  4A3J H;  1BBW A;  5LMN W;  1QVF A;  1KC8 C;  3UDF A;  3CCL A;  2B63 H;  1YIT A;  1TWF H;  2L15 A;  3CF5 A;  1Q86 C;  2E5L Q;  4DUZ Q;  4LF9 Q;  2K75 A;  1WYD A;  1YVC A;  5IYD G;  4Y7N H;  3TRE A;  3CMA A;  4DAM A;  4GS3 A;  4GNX B;  1YIJ A;  1VQO A;  3OYY A;  3CCS A;  1P8L A;  4X66 Q;  3B6Y A;  1W2B A;  2Q2H A;  3EIV A;  3KF6 B;  1VQK A;  2UUC L;  3J81 i;  2QGQ A;  3I2Z A;  1JJC B;  2N3S A;  1SRO A;  4AH6 A;  1SMX A;  2PI2 A;  1HNW L;  1C9O A;  4ALP A;  1SN8 A;  1FGU A;  3ERS X;  3GTM H;  1YHA A;  4YWM A;  5JJL A;  3CCE A;  4A3B G;  3HOX H;  2I5M X;  4GKJ L;  4JI5 L;  4JI8 L;  4YHH L;  2GVA A;  5LMU L;  2UUC Q;  3UE1 A;  2AHO B;  4DV2 L;  2BA0 A;  2HT1 A;  2R92 G;  5LMN L;  4JI6 L;  3NBH B;  3RLF A;  1PH1 A;  2B29 A;  1FJG L;  4LF4 L;  1H95 A;  3CAM A;  2JA5 H;  3S17 H;  1KD1 C;  1ASY A;  1VQF A;  1LTL A;  1VQ4 A;  3HOW G;  4P72 A;  4OO1 I;  3UE0 A;  1W3S A;  2K5H A;  2KEN A;  2ZJQ A;  3PO2 G;  2UU9 L;  4K0K L;  4GKJ Q;  4JI8 Q;  4YHH Q;  5LMU Q;  4JI5 Q;  4X6A H;  4DV2 Q;  5IYC G;  4HIM A;  5LMN Q;  4DUY L;  4JI6 Q;  4YWL A;  4O0A A;  1Q1B A;  3W1B A;  1FJG Q;  4LF4 Q;  2ASB A;  5M3F H;  3PF5 A;  4BY7 H;  2R93 G;  3I56 A;  1VQH A;  3J80 i;  3RLO A;  3TS2 A;  1G29 1;  3G48 A;  4K0K Q;  3M9B A;  1YNX A;  2UU9 Q;  5K36 G;  2JEA I;  1NMG A;  2CFM A;  4GN3 B;  1ASZ A;  4WJ4 A;  1V1Q A;  2V1C C;  4DUY Q;  4J15 A;  4HJA A;  3CP0 A;  4AIM A;  4WJ3 M;  5AJ3 L;  3LGJ A;  2BH2 A;  2JQO A;  4GLV B;  5GAH C;  4AQY L;  1WFQ A;  3PUV A;  2Q2U A;  2OTJ A;  1KAW A;  3BZC A;  4OWX B;  4GLX A;  3S2H H;  3S1M H;  4P71 A;  3S1R H;  1XPU A;  1UE5 A;  2A19 A;  1YJW A;  4LF7 L;  5GQO A;  5AJ3 Q;  4JBM A;  3E0E A;  4EQ5 A;  3S2D H;  3MEF A;  1MJE A;  2JK8 A;  4AQY Q;  3U50 C;  3HOU G;  3M7N A;  3K7U C;  4OO1 G;  2KCT A;  2CQO A;  3K0X A;  4GOP C;  4BBS H;  2BH8 A;  2ID0 A;  1X56 A;  4BXX G;  3PUX A;  3KJP A;  1TXY A;  1OXU A;  2VW9 A;  1X54 A;  3FKI H;  4QJF A;  3GTO H;  5JEA J;  4GNX A;  1X3F A;  1VQ5 A;  2VNU D;  4LUZ A;  3D31 A;  2ZM6 L;  2VQE L;  1TWG H;  4LF7 Q;  2CWA A;  4GLA C;  2YTY A;  5IE8 A;  5J3B A;  2E2I H;  3I4M G;  1NTG A;  1V9P A;  3KF6 A;  3PUZ A;  3OW2 A;  4IPG A;  4A3D G;  3M85 A;  1FVI A;  1XTD A;  3RNU A;  3GTL H;  1PYB A;  2NVY H;  4IPH A;  2JA7 H;  2PNH A;  1HNX L;  5C4J H;  3GTQ H;  4IJL A;  4DR6 Q;  3H0G H;  1SLJ A;  2VQE Q;  3GTG H;  3CCR A;  1J6Q A;  3I4N H;  1Y1W G;  4ME3 A;  2N49 A;  4LNQ A;  4PZ7 A;  5GAD C;  4X65 L;  3T1H L;  1T9H A;  1HJP A;  2R7D A;  4XTC S;  1DGS A;  1EYG A;  3ULP A;  4PMW A;  1XPO A;  1HNX Q;  3A0J A;  4IPD A;  3I7F A;  4JOI C;  2QA4 A;  4UP8 A;  3S16 H;  1XJV A;  4IFD G;  1QVG A;  4DV0 L;  3K7A H;  1N8R C;  2AWO A;  2OTL A;  2K5V A;  3F1Z A;  4JI7 L;  4X65 Q;  2N78 A;  3I55 A;  3T1H Q;  1AH9 A;  1GVP A;  4YCW A;  3IRB A;  3RZO H;  1E7Z A;  4EX5 A;  1EQQ A;  1XNQ L;  4Y52 H;  1NE3 A;  1LYL A;  4UPA A;  5C3E G;  4DV0 Q;  4A3E G;  2CCZ A;  3GD7 A;  3A5Z B;  3A74 A;  1HR0 W;  3M4O H;  4JI7 Q;  1EOV A;  2NZH A;  1OXV A;  1CKN A;  3FKI G;  1MKH A;  1G51 A;  4TVA B;  2VS1 A;  3SGI A;  5C44 H;  4A3M H;  2E2J H;  5HGQ A;  2I0Q A;  4O2D A;  1XNQ Q;  4B3R L;  5M5W H;  3CD6 A;  2OQK A;  1E22 A;  2R7Z H;  3NEN A;  5FLM G;  2QEX A;  1N34 L;  5IT9 c;  1L1O C;  1M1K C;  1UWV A;  4DR7 L;  5JEA G;  4B3R Q;  3STB C;  5IWA L;  1QUQ A;  3CC7 A;  4BY1 H;  4A93 H;  1X55 A;  3TEH B;  1QZG A;  4PZ6 A;  3JAM c;  3TS0 A;  5IYB H;  1E1T A;  2JEB I;  1VQD A;  3CCM A;  1N34 Q;  5C0X I;  1VQB A;  4A3C H;  1LM0 A;  2YTX A;  4DR7 Q;  1HR0 L;  3PO3 G;  2YYZ A;  4JBW A;  5IP7 H;  5IWA Q;  1JJG A;  4QY7 A;  2NVT H;  2AMC B;  3HOV H;  2JJQ A;  3PIP A;  4GOP A;  4IJH A;  3Q8D A;  2IT1 A;  1HH2 P;  4DV3 L;  4DR4 L;  4JG2 A;  1VQG A;  1HR0 Q;  3HKZ G;  1SFO H;  4NXM L;  4GKK L;  5M5Y H;  2VL6 A;  1MJC A;  3CPF A;  1VS0 A;  3STB D;  2KBN A;  2DGY A;  3F2C A;  4A3I H;  4JBK A;  4JI0 L;  4A3L H;  3S14 H;  3PUY A;  1WCM H;  3OTO L;  1VQ8 A;  5M3M G;  4DV3 Q;  2IHF A;  1YJN A;  2JA6 H;  3CXC A;  3S1N H;  4YWK A;  4DR4 Q;  4BBR G;  4FDB A;  2N8N A;  4PG3 A;  4JV5 Q;  4NXM Q;  2JA8 H;  3L0O A;  4GKK Q;  2RCN A;  4C3I H;  1IXR A;  2VQF L;  3HOY H;  1YZ6 A;  4A3J G;  2BA1 A;  4LFA L;  4KHP L;  2B63 G;  5FLX c;  1HZB A;  2VUM H;  1HNW Q;  4NPS A;  5C0X G;  2NVX H;  1K3R A;  5M5X H;  3OTO Q;  1EIY B;  4JI0 Q;  1Y14 B;  2NZO A;  3H15 A;  1VQ9 A;  3GTK H;  2MO0 A;  1Y1V H;  1KXL A;  4JOI A;  1CKN B;  1IBL L;  1PA6 A;  1PH8 A;  4A3K H;  1D8L A;  1N9W A;  4XIG S;  4LWC A;  1E1O A;  1B7Y B;  3HKZ E;  3U4Z A;  2VQF Q;  1TWA H;  2RHQ B;  1N36 L;  1OTC A;  2HHH L;  1NBW A;  1U5K A;  4LFA Q;  3ULJ A;  3AFQ A;  4QGU A;  4BA2 I;  1JMC A;  4KHP Q;  1I94 L;  1UE1 A;  4KHZ A;  2UXD L;  1A0I A;  3M4Q A;  4OWW B;  1XPR A;  2GVB A;  3TQY A;  4A3F H;  3CCJ A;  4IPC A;  1IBL Q;  4MZ9 A;  4R4Q A;  2D0P A;  1AE2 A;  2Z6K C;  1LUZ A;  1QUQ B;  2YTV A;  1VQA A;  3F8T A;  4TQU S;  3HOX G;  3RN5 A;  1XMO L;  1X65 A;  1N36 Q;  4JI2 L;  4R4O A;  1I94 Q;  3EN2 A;  2DUD A;  2UXD Q;  2IX1 A;  1B70 B;  3BZK A;  4DV4 L;  4APV A;  1PH2 A;  1UE7 A;  5FJ8 H;  1VQP A;  3J81 c;  2JA5 G;  1K83 H;  3PSI A;  4RMF A;  1Q12 A;  1SE8 A;  2FXQ A;  4A3G H;  2RHS B;  2Q2I A;  1L1O A;  1CKO A;  1VQJ A;  1XMQ L;  5C4X H;  4JI2 Q;  4B3T L;  4GOP B;  3F2B A;  2F4V L;  2EXD A;  2NVQ H;  5GRO A;  2K52 A;  1G6P A;  4DV4 Q;  5JJI A;  3HOY G;  3KF8 B;  3L2P A;  2OWO A;  5M3F G;  4DK3 C;  1VQ7 A;  1UEB A;  4BY7 G;  2I5L X;  2ZM6 Q;  1K8G A;  4LF6 L;  1HZ9 A;  2NN6 I;  1KIX A;  1PH7 A;  3GO5 A;  4JC0 A;  4B3T Q;  2MFI A;  3L7Z C;  4DR5 L;  2F4V Q;  3PF4 A;  4JCV E;  4A3K G;  3K81 C;  2Z0S A;  2R6G A;  1WOC A;  3CME A;  3HOZ H;  1Q1E A;  3KLW A;  1Z47 A;  4YY3 L;  3BU2 A;  4OON A;  1TWC H;  2EIF A;  1J5E L;  3J7Z C;  4P74 A;  4IFD J;  4LF6 Q;  3T1Y L;  1PHJ A;  3J81 j;  2D0O A;  2YV5 A;  1O7I A;  4MTN A;  4JI1 L;  4DK6 C;  1JE5 A;  3J80 c;  4DR2 L;  3UDG A;  4DR5 Q;  1E24 A;  4LF5 L;  3UDI A;  2R7F A;  4A76 A;  1P16 A;  1X3G A;  4YY3 Q;  1J5E Q;  5HY6 A;  5IYD H;  4L5R C;  2C35 B;  3ZJY C;  2LXK A;  3T1Y Q;  3HFZ B;  4BBS G;  4POG A;  4DR2 Q;  3M4P A;  1VQL A;  3PUW A;  4JI1 Q;  2A8V A;  1N32 Q;  2KCM A;  4MNO A;  4LF5 Q;  1RL2 A;  2K5N A;  1PV4 A;  1YI2 A;  4A3G G;  1IBK L;  3PV0 A;  2IHE A;  3CW2 C;  2ATW A;  4X66 L;  1QZH A;  3HKS A;  1S40 A;  1X6O A;  4JI3 L;  4GN4 B;  3ULL A;  1L0W A;  3M3Y H;  1NJI C;  1AE3 A;  4HID A;  1KQS A;  1Q46 A;  2NN6 G;  4JYA L;  1EWI A;  1FL0 A;  2JA7 G;  1VQN A;  4NB3 A;  1V43 A;  1VQM A;  4A3B H;  4C3H H;  3DLL A;  3K80 C;  4UY8 C;  1PYS B;  3H0G G;  1IBK Q;  3I4N G;  2R92 H;  2F52 A;  3U4V A;  3H3V H;  4LF8 L;  3DM3 A;  4PZ8 A;  4R4C A;  4JI3 Q;  4HJ7 A;  1Q82 C;  2UXB L;  1L1O B;  2H5X A;  1PFS A;  3RLN A;  4JYA Q;  3K8A A;  3G71 A;  2D62 A;  1PH6 A;  1VQC A;  3PO2 H;  2LXJ A;  2UUA L;  2KHI A;  3NEL A;  2WP8 J;  2Z6K A;  4YCU A;  4C2M H;  5IYC H;  1UE6 A;  4IOA A;  1C0A A;  2WB1 G;  4GNX C;  4LF8 Q;  3G6E A;  1PVO A;  1CKM A;  1A8V A;  1NY4 A;  2K14 A;  5ELO A;  1JJ2 A;  4DV7 L;  2UXB Q;  2R93 H;  2K50 A;  3A5U A;  3EBE A;  4LUV A;  4HJ5 A;  4IOC A;  3RZD H;  1S72 A;  3CC2 A;  4POF A;  3ICE A;  2UUA Q;  2XTI A;  1K8A C;  2AWN A;  1I50 H;  2F3I A;  5C44 G;  1K73 C;  3KJO A;  4A3M G;  4DV7 Q;  2Y0S G;  3F2D A;  1R9T H;  3CC4 A;  1OXX K;  1XNR L;  3NEM A;  3S24 A;  2R7Z G;  1Q8K A;  1Z9F A;  3RN2 A;  4R4I A;  4RG1 A;  1I3Q H;  2CKZ B;  1Q81 C;  1K0R A;  2WB1 E;  5DLQ E;  4H02 A;  4KI0 A;  3G4S A;  3KDF A;  4HJ8 A;  3HOU H;  2E2H H;  1OXS C;  1KL9 A;  4BY1 G;  4A93 G;  2PQA B;  4B3S L;  1B8A A;  1XNR Q;  4BXX H;  3E9I A;  5IYB G;  1PH5 A;  4UP7 A;  4L5T A;  3JC6 6;  3I4M H;  2E8G A;  1IYJ B;  4A3C G;  1JB7 A;  3KFU A;  2WAQ G;  1BKB A;  5IP7 G;  2HIV A;  4L5Q A;  3ER0 A;  1CSQ A;  1TWH H;  4A3D H;  4QQB X;  4B3S Q;  3HOV G;  2Y0S E;  3CCV A;  4NXN L;  2ZJR A;  1VQE A;  4LW1 A;  2OQ0 A;  1EFW A;  1NMF A;  1YBY A;  3W1G A;  1IL2 A;  2KHJ A;  3S15 H;  3S1Q H;  5IY0 A;  2HHH Q;  3D0F A;  2ZTE A;  2LSS A;  3GDE A;  1Y1W H;  1MIU A;  5IP9 H;  1X9N A;  3WWV A;  2OCE A;  3CQZ H;  2A1A A;  4LUO A;  4P73 A;  4B3M L;  3KOJ A;  1VCI A;  2JE6 I;  2UUB L;  1KRS A;  4NXN Q;  4A3I G;  4A3L G;  2HQL A;  1OXT A;  2MQH A;  1WCM G;  1XMO Q;  3PCO B;  2ES2 A;  3RR5 A;  2JA6 G;  2XGT A;  2VZA A;  1GKH A;  4JI4 L;  5E7N A;  1GD7 A;  5GAG C;  2B3G A;  2MO1 A;  1KRT A;  2JA8 G;  1N32 L;  2WAQ E;  2IY5 B;  5GAE C;  4X62 L;  4B3M Q;  1HZC A;  1EUJ A;  2YU9 H;  1D7Q A;  4DV1 L;  3I4O A;  2UUB Q;  3CCU A;  2VUM G;  1EIF A;  2ZTC A;  4JBJ A;  5C3E H;  3MXN B;  2WFW A;  1XMQ Q;  4BA1 I;  1Y1V G;  4A3E H;  1BVS A;  4JI4 Q;  1C7Y A;  3J7A 5;  1L2F A;  4GN5 A;  4AYB G;  3U58 A;  2EQS A;  4DV5 L;  5ELN A;  1HNZ L;  4DR6 L;  1KHI A;  4X62 Q;  1EQR A;  1SRU A;  4DV6 L;  3JAM i;  4DV1 Q;  3W5O A;  1CSP A;  2I5H A;  4OXP A;  1U0L A;  2PI2 E;  4UP9 A;  4R4T A;  3VDY A;  5FLM H;  1I5F A;  2GN5 A;  4QL5 A;  4C3J H;  4A3F G;  4OX9 L;  1A63 A;  4L5S A;  2ALY B;  3KDF B;  4DV5 Q;  4HIO A;  4KLK A;  4QIW E;  1HNZ Q;  5JJK A;  1YJ9 A;  4HJ9 A;  1S3O A;  3E9H A;  5BR8 L;  4DAY B;  4DV6 Q;  1SR3 A;  1QVC A;  1RIP A;  1PH9 A;  1WI5 A;  2RF4 A;  3CCQ A;  5IP9 G;  3CPW A;  1PH3 A;  3BJU A;  1VQI A;  3AFP A;  4P75 A;  2UXC L;  3KYH C;  5FJ8 G;  4OX9 Q;  2PQA A;  1N33 L;  3AEV A;  4YCV A;  3AYH B;  1BBU A;  5EAY A;  1Q7Y C;  4DPG A;  2ZTD A;  4IFD I;  4AYB E;  1X3E A;  3FP9 A;  4A4I A;  2JA9 A;  1YEZ A;  3PO3 H;  1A62 A;  5BR8 Q;  1K9M C;  1E3P A;  5C4X G;  3TRZ A;  3PGZ A;  1YHQ A;  1PH4 A;  4R1J A;  4A75 A;  1IBM L;  2UXC Q;  1M90 C;  3PIO A;  4DR3 L;  4DR1 L;  1N33 Q;  1I6H H;  3GTP H;  4LFC L;  4X64 L;  4LFB L;  1YHB A;  3UDX A;  4IO9 A;  2HIX A;  2VY3 A;  5H1S E;  1WJJ A;  1IZ6 A;  2AKW B;  1HZA A;  3HOZ G;  4OWT B;  2CWP A;  1GO3 E;  3FHW A;  1IBM Q;  2Q2T A;  3HOW H;  1JT8 A;  5C0X J;  2E5L L;  4DUZ L;  4LF9 L;  4DR3 Q;  4DR1 Q;  2PMZ E;  5M3M H;  2MNA A;  1GM5 A;  3AQQ A;  3H3V I;  4JV5 L;  4LFC Q;  4BBR H;  2IX0 A;  4X64 Q;  2ZJP A;  1VQ6 A;  4LFB Q;  4HIK A;  2K4K A;  4DKA C; 
#chains in the Genus database with same CATH topology
 4DNI A;  4C3J G;  1IKL A;  2SNM A;  3EJI A;  3NBI A;  2PW7 A;  2NVY B;  2JA7 B;  2K75 A;  4Y7N H;  3TRE A;  1YNN D;  3H0G B;  1PTO F;  3MXN A;  1P8L A;  3N6R A;  3CCS A;  1EOT A;  1W2B A;  3KF6 B;  3BYT B;  5IOC A;  2RQX A;  4DXG A;  1IKM A;  2QGQ A;  1JJC B;  2R61 A;  2F3W A;  4ALP A;  3UI2 A;  3S16 B;  3GTM H;  1FGU A;  3ERS X;  1MHW C;  1YHA A;  4XYQ A;  4V0B A;  1A6X A;  2WB1 B;  3HOX H;  2GVA A;  3I8Z A;  4DV2 L;  2BA0 A;  1BUV T;  3RZO B;  1HHV A;  1KNA A;  1PH1 A;  1KLU D;  1H95 A;  3I73 A;  1KD1 C;  4RGM A;  4OO1 I;  3EFX D;  1W3S A;  4K0K L;  3M4O B;  4GKJ Q;  4JI8 Q;  4YHH Q;  4JI5 Q;  2F0Q A;  4JPB W;  1UAP A;  5C44 B;  4JI6 Q;  4YWL A;  4O0A A;  1FJG Q;  1UUP A;  4L63 B;  4BY7 H;  2R93 G;  4I7Z C;  3TS2 A;  1G29 1;  1TY2 A;  2A73 B;  1YNX A;  2UU9 Q;  2CFM A;  4WJ4 A;  4RKB A;  2EXZ A;  5CC4 A;  3CP0 A;  4KJN A;  4RKL A;  4DA2 A;  5AJ3 L;  2JQO A;  4GLV B;  1WFQ A;  2Q2U A;  5I2X A;  4RFB A;  4K8I A;  4OWX B;  4GLX A;  3D6C A;  3S2H H;  2AQ2 B;  3S1M H;  3S1R H;  1XPU A;  2A19 A;  2WAQ B;  4FF3 A;  1ENC A;  1SYF A;  1E2V A;  2NVT B;  4AQY Q;  3HOU G;  3K7U C;  4OO1 G;  2BH8 A;  2DY7 A;  1X3F A;  1ZYR D;  1J8I A;  4LUZ A;  1YNJ D;  2Q8R E;  5M5Y B;  4GLA C;  5IE8 A;  1V9P A;  3KF6 A;  3J7Y W;  3TP7 A;  1NCV A;  2WIN B;  1XTD A;  3RNU A;  2NN6 H;  2NVY H;  2JA7 H;  2JA6 B;  2I07 B;  2PNH A;  2MUY A;  5JEA H;  3H0G H;  4KV6 A;  1CT1 D;  2VQE Q;  4YIJ A;  1XWE A;  3W2D A;  1AZQ A;  5LL6 X;  4WFN 3;  1HJP A;  4XTC S;  3QJY A;  5M5X B;  3GTK B;  1HNX Q;  2BDN A;  2PQE A;  2F0F A;  4UP8 A;  4A3K B;  3S16 H;  1XJV A;  3OPO A;  4DV0 L;  1N8R C;  2V4D A;  3S9W A;  1GVP A;  4YCW A;  3E5S A;  3RZO H;  4EX5 A;  2L4N A;  1RKN A;  4A3F B;  1LYL A;  2FMC A;  2EOT A;  3DWP A;  3M4O H;  2M00 A;  1EOV A;  3SGI A;  1CKN A;  5C44 H;  1G51 A;  4OHJ A;  1PRT B;  2XRS D;  3MHB A;  1K83 B;  3I72 A;  2XN9 C;  2TSS A;  5IT9 c;  1L1O C;  2RVL A;  4G7O C;  5C4X B;  4DNT B;  2EJF C;  5JEA G;  1JIC A;  2ZXP A;  4EQO A;  4KY7 A;  2AQ3 B;  1QUQ A;  1F2Y A;  1LT3 D;  2CH4 A;  4PNY A;  4PZ6 A;  4DU9 A;  4DGZ A;  3JAM c;  2BE5 D;  2F0V A;  1EY5 A;  1VQD A;  2F0U A;  5C3W A;  1QE6 A;  3SR1 A;  1EYD A;  4FO2 A;  4DR7 Q;  1HR0 L;  2YYZ A;  5E3F A;  2KEE A;  3SHL A;  3VYS A;  2NVT H;  5D3D A;  5ELE A;  3PIP A;  4GOP A;  2F0H A;  1HH2 P;  4FVM A;  1Q90 A;  1VQG A;  2PCF B;  1E2W A;  1ILQ A;  5M5Y H;  2IX3 A;  3I90 A;  2DGY A;  2K05 A;  4A3L H;  4JI0 L;  3PUY A;  4DV3 Q;  1YJN A;  2JA6 H;  1TS2 A;  2KA7 A;  2AUK A;  2RCN A;  3ND9 A;  1SNO A;  4CJ0 B;  2VQF L;  1YZ6 A;  1I4H A;  1JWS D;  1HZB A;  1HNW Q;  3PIO 3;  4NPS A;  5L37 A;  5M5X H;  1EU4 A;  1TT2 A;  3OTO Q;  1Y14 B;  3GTK H;  1ICF B;  3NQI A;  1KXL A;  1U4L A;  1DOM A;  1IBL L;  4C3H B;  1PA6 A;  4A3B B;  4A3K H;  2HUG A;  4OGQ C;  4QCL A;  2R92 B;  2OT2 A;  4QGU A;  4LFA Q;  3AFQ A;  1JMC A;  4KHZ A;  2UXD L;  4OWW B;  1J9O A;  5JVG 3;  4A3F H;  2D0P A;  2YTV A;  4RCO A;  2KHS A;  1N36 Q;  4JI2 L;  1I94 Q;  2DUD A;  3BZK A;  4DV4 L;  1KDC A;  4APV A;  3J81 c;  1K83 H;  1Q8I A;  3PSI A;  4RMF A;  2K5Q A;  2Q2I A;  1EY0 A;  3VYT A;  3NQT A;  1CKO A;  5C4X H;  1FYC A;  2K52 A;  1G6P A;  3L2P A;  4PMC A;  5M3F G;  1VQ7 A;  3IKJ A;  1SE4 A;  3P1H A;  5DM6 3;  1X32 A;  2EY6 A;  3L7Z C;  3E6Z X;  2F4V Q;  1OO9 B;  4JCV E;  5I9P A;  3K81 C;  4A3K G;  1ML0 D;  3CME A;  2Z4H A;  3X3M A;  3KLW A;  4ME5 A;  3SK5 A;  4UAI A;  4LF6 Q;  2EZV A;  1DCZ A;  3OHX C;  3RUZ A;  1PHJ A;  3QR8 A;  3J80 c;  4DK6 C;  4DR2 L;  3I4M B;  2KUM A;  4DR5 Q;  2EJG C;  3UDI A;  4C1N I;  2TMP A;  4A76 A;  4K5W A;  1G6Z A;  1B3Q A;  2F0S A;  1CA5 A;  4IFD H;  1O7Y A;  5HY6 A;  4BBS G;  2C35 B;  3ZJY C;  3HFZ B;  3S15 B;  2A8V A;  4MNO A;  1ICW A;  3PV0 A;  1A3U A;  4MTK A;  4KKU A;  4NW2 A;  2ZT9 C;  1X6O A;  3ULL A;  1L0W A;  3DUZ A;  1EWI A;  1FL0 A;  1MGS A;  3J7A V;  2B8G A;  4C3H H;  4A3B H;  5I2Y A;  3I4N G;  2R92 H;  2J7Z A;  3H3V H;  1VF5 C;  4C56 C;  4X3T A;  2DN8 A;  1L1O B;  1A3T A;  1PFS A;  2D62 A;  4A3E B;  3MTS A;  1BXT A;  5CV7 A;  3NEL A;  1FNU A;  1EEF D;  3TDQ A;  1C0A A;  1L0Y B;  1PXU A;  4LF8 Q;  2O5I C;  3P7J A;  4FNF A;  3D8G A;  1B3A A;  2JSO A;  1PVO A;  1A8V A;  2KED A;  1NY4 A;  1B9M A;  2K14 A;  3NXW A;  5ELO A;  4DV7 L;  5K36 G;  2EY5 A;  1TVX A;  1STG A;  2H1E A;  1S72 A;  4Q0F A;  3ICE A;  2UUA Q;  4RHS A;  4O42 A;  1SBB B;  2AWN A;  2CVR A;  4KKT A;  2EYH A;  3LNN A;  1QWY A;  3KJO A;  4CDD C;  3K57 A;  2CHB D;  2Y0S G;  1JOO A;  1OXX K;  2R7Z G;  3S24 A;  1AN8 A;  1QNU A;  3A7L A;  2F0W A;  2KCN A;  2XWB B;  1K0R A;  2K5D A;  1ILP A;  4A93 G;  4KY5 A;  4DAY A;  5CYU A;  2KJX A;  1SE2 A;  3CRK C;  4UP7 A;  4L5T A;  4KTA A;  3I4M H;  3KFU A;  4L5Q A;  2B2U C;  2WKD A;  3K5O A;  1STE A;  4NXN L;  5TSS A;  4BBR B;  4EQP A;  3S15 H;  5IY0 A;  1ZYR C;  5IP9 H;  2OCE A;  3M7G A;  2F0I A;  5FKA C;  4P73 A;  4ZQ3 A;  2K28 A;  1B9N A;  2UUB L;  4KN7 C;  2M9V A;  1IYU A;  3X3N A;  1WCM G;  2J4X A;  2D9U A;  3HS0 C;  4B3M Q;  2B2Y A;  2A6H C;  1VMC A;  1D1I A;  1EIF A;  1Y1V G;  4A3E H;  1BVS A;  4JI4 Q;  1PZK D;  1BBX C;  1C7Y A;  5JPN C;  2EQS A;  1H9K A;  2NBF A;  1EQR A;  1STN A;  3W5O A;  3S17 B;  1R4Q B;  1I4G A;  4OX9 L;  1NNX A;  4R8N A;  1DYQ A;  1JWM D;  2ALY B;  2K03 A;  4ULL A;  4TSS A;  2K1B A;  4OEL B;  4QIW E;  4DV5 Q;  4HIO A;  1YJ9 A;  4DV6 Q;  3E9H A;  4IUV A;  1NSN S;  5ELD A;  1GUS A;  1WTW A;  1PH9 A;  2RF4 A;  5IP9 G;  3J7A F;  3BJU A;  3Q22 A;  3AFP A;  4P75 A;  1GHJ A;  2ZTD A;  4A4I A;  1JOQ A;  3MWY W;  1A2T A;  3TRZ A;  1K8O A;  3VYR A;  1YHQ A;  2ENB A;  2PZW A;  4DR3 L;  1KDA A;  5J39 A;  5H1S E;  1IZ6 A;  2AKW B;  1HZA A;  3S2D B;  4B9W A;  1GO3 E;  3DM1 A;  5C0X J;  1E0B A;  5M9O A;  4DR1 Q;  1GM5 A;  1SE3 A;  3TN2 A;  3PQI A;  4BBR H;  4X64 Q;  4ZKC B;  2K4K A;  1AEX A;  5G3L F;  2E2I B;  4KK7 A;  3FRP B;  1QVF A;  3CCL A;  1TWF H;  1LAB A;  3CF5 A;  1Q86 C;  2A5H A;  2B2V A;  1SYE A;  5DM7 3;  2EDG A;  1YVC A;  4XT1 B;  3CMA A;  4GS3 A;  3OYY A;  3QOL A;  1I4Q A;  2IL8 A;  1W6J A;  2P5Z X;  2NB0 A;  2Q2H A;  4HSV A;  2KOL A;  3FDT A;  3BVG A;  4HCS A;  1JWU D;  2F0D A;  5CV9 A;  3HRZ C;  3ND8 A;  1AP0 A;  1C9O A;  4K8J A;  2G5D A;  1I4R A;  5JJL A;  3C46 A;  2I5M X;  4GKJ L;  4JI5 L;  4JI8 L;  4YHH L;  2UUC Q;  2N88 A;  1S5E D;  2HT1 A;  2PZU A;  3NBH B;  4JI6 L;  1K0S A;  1FJG L;  4ODG A;  1PTO D;  4G7Z C;  3S17 H;  5D3I B;  3MA2 B;  4P72 A;  1LT4 D;  3UE0 A;  2EPB A;  2KEN A;  2ZJQ A;  2UU9 L;  3U9S A;  5LMU Q;  3A54 A;  4X6A H;  5IYC G;  4HIM A;  5LMN Q;  2E2J B;  1Q1B A;  3W1B A;  4LF4 Q;  2ASB A;  4WRD A;  3PF5 A;  2FHT A;  2F4I A;  4UDU C;  3I56 A;  3NP8 A;  1VQH A;  1KDB A;  1RHP A;  3M9B A;  4OIJ A;  3QIA A;  2JEA I;  4FXD A;  4DUY Q;  3LGJ A;  2BH2 A;  4AQY L;  3D3R A;  2BCO A;  2PNR C;  1KAW A;  2EYP A;  1WTQ A;  3TBI B;  1XYI A;  3FPU B;  1QIL A;  1EIH A;  4JBM A;  3S2D H;  1MJE A;  5IGF A;  2EYO A;  2A68 D;  4GOP C;  1TU2 B;  4KHV A;  1SNQ A;  3PUX A;  1EY7 A;  4QJF A;  5IOD A;  5EKL A;  1B53 A;  2BDO A;  2VQE L;  3DWQ A;  1H9J A;  2YTY A;  3CRL C;  1D5X C;  1CTM A;  5J3B A;  2E2I H;  1NTG A;  4RHR A;  3OW2 A;  4Z9C B;  1MI2 A;  4A3I B;  4IUQ A;  5ELC A;  3NHH A;  1FNW A;  5CV8 A;  4X3K A;  1PYB A;  3S14 B;  4J8Q A;  1HNX L;  5FO8 B;  4FF2 A;  3S1N B;  4QIW B;  1BCP C;  2EYJ A;  1QCB D;  2JA8 B;  1IW7 D;  3CCR A;  1J6Q A;  3T13 A;  4LNQ A;  3SXH A;  3HOY B;  5FK9 C;  4DK1 A;  1T9H A;  2R7D A;  1DGS A;  1EYG A;  3NBH A;  2NVX B;  4KJO A;  4PMW A;  1XPO A;  3OWF A;  3I7F A;  1RF2 D;  1LV9 A;  2AWO A;  2F0J A;  2K5V A;  3F1Z A;  5KIX A;  3T1H Q;  3OSO A;  5EJW A;  1D1K A;  2XSC A;  1BOS A;  4ZKB B;  1E7Z A;  3IAY A;  1NE3 A;  1TR5 A;  4DNR B;  1ET6 A;  4UPA A;  2Z6B A;  4L6T B;  3H09 A;  1F9Q A;  2JP1 A;  1HR0 W;  4LJZ C;  2NTS A;  2L0C A;  2MGS A;  1QVG A;  4JI7 Q;  1OXV A;  3K5M A;  4UY8 C;  2VS1 A;  5IGC A;  2E2J H;  1XNQ Q;  4O2D A;  1LLR D;  4ZLT F;  3CHB D;  3NEN A;  1C48 A;  4A3G B;  5I6W A;  1M1K C;  1ENA A;  2DNC A;  1UWV A;  3WOF A;  4DR7 L;  2CW0 C;  1A3V A;  4B3R Q;  2NVQ B;  4I7A A;  1SMY D;  3TEH B;  4IUN A;  1QZG A;  1EU3 A;  3TS0 A;  4DFA A;  2G9H D;  2C9O A;  2Z8L A;  1N34 Q;  4A3C H;  2YTX A;  4RGT A;  5CR3 A;  4F88 A;  4XQN A;  5CMD A;  1KNE A;  2NYZ D;  5IP7 H;  1JJG A;  1HPC A;  1GJX A;  3Q8D A;  1PFM A;  2RBM A;  4CJ2 C;  2L55 A;  4DV3 L;  2FIN B;  2VL6 A;  4RCN A;  1MJC A;  3CPF A;  4HCE A;  4LMQ D;  4DK0 A;  2PYK A;  1VS0 A;  3STB D;  4A3I H;  1HNW L;  1TS4 A;  1A15 A;  3S14 H;  3OTO L;  1VQ8 A;  5J22 A;  3S1N H;  4CKE A;  3P75 A;  4FDB A;  1Y8N B;  2JA8 H;  5EQ0 A;  3HOY H;  5IIF A;  4LFA L;  1QG7 A;  1HQM C;  3H3V C;  5BN3 A;  4CKB A;  5HGT A;  2NVX H;  1K3R A;  1VQ9 A;  3I4L A;  1Y8P B;  4JOI A;  1CKN B;  4U68 A;  1MD2 D;  3VR5 A;  1DM0 B;  1D8L A;  3LWE A;  1E1O A;  3HKZ E;  3U4Z A;  1OTC A;  3NTK A;  1N36 L;  4PQX A;  1LTR D;  3ULJ A;  1SND A;  1I94 L;  4N9T A;  2X69 A;  3Q6S A;  1NR2 A;  4B08 A;  1XPR A;  1IHZ A;  2GVB A;  3TQY A;  5FLX L;  4HSP A;  4IPC A;  3CCJ A;  3PO2 B;  3TP5 A;  1ZKO A;  1QUQ B;  3HOX G;  4R9W A;  4F87 A;  4R4O A;  4XT3 B;  2IX1 A;  4FXG C;  1B70 B;  1DD2 A;  3VA7 A;  1R4P B;  4ZUI A;  2FMM A;  3RZD B;  1F9R A;  2B8F A;  1Q12 A;  2FXQ A;  4A3G H;  1VQJ A;  1STA A;  4K5V A;  5EPK A;  3O13 A;  2FFK B;  4GOP B;  2F4V L;  2EXD A;  5CV5 A;  2NVQ H;  5GRO A;  4KN4 C;  3HOY G;  4FF1 A;  1R9T B;  4BY7 G;  1K8G A;  3T16 A;  5ISR A;  4LF6 L;  2AUJ D;  5ELF A;  1HZ9 A;  2NN6 I;  1PH7 A;  4DR5 L;  1G2T A;  2Z0S A;  1WOC A;  2E2H B;  2DY8 A;  1BCP B;  5EKK A;  3J7Z C;  1DZ1 A;  2D0O A;  1JE5 A;  3UDG A;  1E24 A;  2R7F A;  5D65 A;  1P16 A;  4A3D B;  1J5E Q;  4JW0 A;  2LS0 1;  5IYD H;  4L5R C;  3T1Y Q;  2O2L D;  1N32 Q;  1VQL A;  4JI1 Q;  1Y1W B;  5FLX E;  4LF5 Q;  1PV4 A;  1YI2 A;  4A3G G;  3CW2 C;  2ATW A;  1RTO A;  3HKS A;  4ZCK A;  4H44 C;  4ZRZ A;  4GN4 B;  1X3Q A;  1KQS A;  4HID A;  4H13 C;  2NN6 G;  2JA7 G;  1WTR A;  4G4K A;  1CI3 M;  4CDF C;  3DLL A;  3K80 C;  1PYS B;  2EY1 A;  3H0G G;  1IBK Q;  1HQR D;  4HR7 B;  4XQJ A;  1HFN A;  2F52 A;  2YU9 B;  4LF8 L;  2Z1C A;  3A7A B;  5CV4 A;  4R4C A;  4JI3 Q;  4HJ7 A;  1XX8 A;  2B2Y C;  2KCC A;  2H5X A;  5C3E B;  3RLN A;  4JYA Q;  2RA4 A;  4M1U B;  3G71 A;  4ZUJ A;  3PO2 H;  2UUA L;  2Z6K A;  4IOA A;  2WB1 G;  4ZYS A;  2F03 A;  1CKM A;  1V1P A;  1EQV A;  2UXB Q;  1PTO C;  2XRQ D;  2K50 A;  3EBE A;  4LUV A;  5KND A;  4HJ5 A;  3RZD H;  1E2Z A;  3CC2 A;  1SEB D;  5CGK A;  3SEB A;  5C44 G;  4IZ8 A;  1WD0 A;  1BR9 A;  1R9T H;  2B2T A;  3DEO A;  3AU7 A;  2A69 D;  3PMF A;  3PO3 B;  5ELB A;  2E2D C;  1Q81 C;  3QWN A;  3AB9 A;  4ZK9 B;  4H02 A;  1SYB A;  4HJ8 A;  2E2H H;  1OXS C;  1KL9 A;  2X6G A;  3A8J E;  1I6H B;  1I4X A;  3OMC A;  4BXX H;  3E9I A;  3GTP B;  1PH5 A;  3HKZ B;  2VB2 X;  2E8G A;  1LTG D;  1JB7 A;  2WAQ G;  2PW5 A;  3ER0 A;  1CSQ A;  4A3D H;  3HOW B;  2F0G A;  4B3S Q;  5M3M B;  2DJG C;  2ZJR A;  1DON A;  3SK6 A;  1HCZ A;  1VQE A;  4LW1 A;  1EFW A;  3W1G A;  3LX0 A;  1PMR A;  3DXJ C;  3GTJ B;  3SDZ A;  1Y1W H;  1MIU A;  3R93 A;  4A3J B;  2EJM A;  2B63 B;  3GQB A;  4LUO A;  4B3M L;  3KOJ A;  2JE6 I;  2B2V C;  4A3L G;  1Z6H A;  2HQL A;  1C4Q A;  3K59 A;  2MQH A;  3PCO B;  3GV3 A;  2L1B A;  2JA6 G;  4JI4 L;  4CKC A;  5E7N A;  5GAE C;  1HZC A;  2YU9 H;  1D7Q A;  4CDC C;  2ZTC A;  5C3E H;  3TME A;  4IUR A;  4IUU A;  1LAC A;  1L2F A;  4GN5 A;  2HDM A;  4DV5 L;  5ELN A;  5JVH 3;  4DR6 L;  1KHI A;  5I9O A;  1SRU A;  2EE1 A;  4RWS C;  4DV6 L;  3JAM i;  1K3B C;  1X3P A;  2EVB A;  2JA5 B;  3HGB A;  3VDY A;  1ROD A;  5FLM H;  1EY6 A;  4A3F G;  2RSN A;  4L5S A;  1HNZ Q;  1GUN A;  1SDF A;  4DAY B;  1EWC A;  1WI5 A;  1RCV D;  3CPW A;  3AEV A;  3AYH B;  1BBU A;  1KAB A;  1S5B D;  5HUR A;  4IFD I;  4AYB E;  3PO3 H;  5F2D A;  5BR8 Q;  3AMU A;  5C4X G;  5E4W C;  1SMY C;  4R1J A;  1PH4 A;  4HED A;  2UXC Q;  1YNN C;  4DR1 L;  1I6H H;  5NUC A;  1LTA D;  3GTP H;  5I4D A;  1W6K A;  4X64 L;  2CH4 W;  1ESR A;  1YHB A;  4HTH A;  3UDX A;  1EFI D;  2HIX A;  1BO0 A;  4J6H A;  4OWT B;  3T56 B;  3HOW H;  1DJR D;  4N8X 1;  2PMZ E;  5M3M H;  3H3V I;  3D4D A;  4H7B A;  4LFC Q;  3FKI B;  2ZJP A;  3GTO B;  1WTV A;  4HIK A;  2NZ1 D;  4DKA C;  3GTJ H;  1CUK A;  1X9N A;  4GZY C;  4A3J H;  1BBW A;  3UDF A;  3OMG A;  2B63 H;  1YIT A;  1F9S A;  5C0X H;  1JOR A;  4LF9 Q;  3GTL B;  1WYD A;  4IFD G;  4JV5 Q;  4DAM A;  1YIJ A;  3GTQ B;  1VQO A;  1PRT D;  3GTG B;  1VF7 A;  3B6Y A;  1HTP A;  1PTO B;  1VQK A;  2ICE C;  2UUC L;  3OW7 A;  3J81 i;  1SSO A;  3F2U A;  1SRO A;  3R8B A;  5G3L D;  1SMX A;  1U4P A;  2PI2 A;  4YWM A;  3K7A B;  3KLR A;  5IGE A;  4A3B G;  4C3H G;  5LMU L;  3OIP A;  2AHO B;  2R92 G;  5LMN L;  4NDX A;  5KYI A;  4LF4 L;  2JA5 H;  2E76 C;  1VQ4 A;  3HOW G;  2K5H A;  1EIG A;  2O5J C;  1BDO A;  4RAU C;  3U9O A;  1H9S A;  4A3M B;  4DUY L;  1HXY D;  1GHK A;  1WTP A;  1G8Z D;  4P2C B;  3J80 i;  3RLO A;  1XXG A;  1YNJ C;  4GN3 B;  1V1Q A;  1TWF B;  2V1C C;  1NAP A;  4HJA A;  4AIM A;  4BY1 B;  3TZU A;  1STH A;  5GAH C;  3PUV A;  1XTC D;  3WDN A;  3SK4 A;  1NR4 A;  1QNK A;  2OTJ A;  3BZC A;  4XYO A;  1LTB D;  1UE5 A;  3TP8 A;  1JE4 A;  3H94 A;  2XVS A;  5GQO A;  5BN5 A;  2ICI A;  3MEF A;  3M7N A;  2JK8 A;  3HOV B;  3U50 C;  2M2L A;  1EYC A;  1GUW A;  2KCT A;  2L5T A;  3BDL A;  3K0X A;  4Q5V A;  4FF4 A;  1CFM A;  2ID0 A;  1X56 A;  4MN3 A;  3GV6 A;  1TXY A;  2XIW A;  4CHT B;  2EYM A;  1X54 A;  3E0J A;  3FKI H;  2VW9 A;  3GTO H;  1VQ5 A;  3D31 A;  4LF7 Q;  3I4M G;  1Y8O B;  5C4Z A;  2E75 C;  4H0L C;  4IPG A;  4V19 0;  1FVI A;  3GTL H;  4IPH A;  3NTI A;  2LKV A;  4IJL A;  2K01 A;  2R3Z A;  3H6M A;  3GTQ H;  4DR6 Q;  1SLJ A;  1KTK A;  1EWH A;  3GTG H;  1JOK A;  4C3I B;  2N49 A;  1PTO H;  4PZ7 A;  5GAD C;  3T1H L;  3N52 A;  1WD1 A;  2VUM B;  2F0P A;  3ULP A;  5EPJ A;  3G6J B;  1WTH A;  3VR4 A;  3A0J A;  4JOI C;  2QA4 A;  4AYB B;  1HUN A;  3K7A H;  3OWE B;  2OTL A;  5KNC A;  3HP3 A;  4JI7 L;  4X65 Q;  3I55 A;  3IRB A;  2BE5 C;  2N55 A;  1XNQ L;  3ERQ A;  1SNC A;  3NK9 A;  4BWG B;  1SNM A;  4A3E G;  2CCZ A;  2GA4 B;  2F1M A;  3A74 A;  1JB3 A;  4X3S A;  1PRT F;  3FKI G;  4B3R L;  4QF4 A;  4A3M H;  2QIL A;  3MEH A;  2PMZ B;  3CD6 A;  2OQK A;  2QW7 A;  1E22 A;  1IYV A;  1N34 L;  4NP5 A;  1EEI D;  3I91 A;  3FMC A;  3CC7 A;  4BY1 H;  1X55 A;  4K6L A;  1S5D D;  2F0L A;  5IYB H;  4QMG A;  1B44 D;  1EY8 A;  3CCM A;  1VQB A;  2EYL A;  1LM0 A;  1FNV A;  2K7V A;  3KBX A;  1STY A;  3HOZ B;  5IWA Q;  3BVZ A;  2FJ2 A;  3HOV H;  2JJQ A;  2WKC A;  2IT1 A;  1ONL A;  3KF8 A;  4OL7 A;  4IN3 A;  4XXE A;  3ERO A;  4OEM B;  2K04 A;  1LO5 D;  2IHF A;  1RTN A;  3CXC A;  4DR4 Q;  5AFW A;  4YWK A;  4BBR G;  2N8N A;  1MSH A;  4NXM Q;  4GKK Q;  4C3I H;  1IXR A;  2BA1 A;  4ZAI A;  5FLX c;  2VUM H;  3M3Y B;  1EIY B;  2D2C C;  3H15 A;  2NZO A;  2VB3 X;  1N9W A;  3D4R A;  1CHQ D;  4XIG S;  5KYL A;  5KNB A;  1U5K A;  2KEC A;  4KHP Q;  1UE1 A;  2HDL A;  1A0I A;  3M4Q A;  4MZ9 A;  5E1F A;  3QG1 A;  4DAV A;  2Z6K C;  1LUZ A;  1XMO L;  1VQA A;  3RN5 A;  1O78 A;  1X65 A;  3NE5 B;  3HG9 A;  1U4R A;  5EBD A;  1PZJ D;  2L9H A;  3BVM A;  2SNS A;  2R93 B;  1PH2 A;  1UE7 A;  5FJ8 H;  1VQP A;  1JR0 D;  3BYY B;  1XMQ L;  1I50 B;  3F2B A;  1FGB D;  1FR3 A;  5JJI A;  2OWO A;  2WV6 D;  1PFN A;  2B2T C;  2I5L X;  2F3V A;  4IQZ A;  1KIX A;  1I3Q B;  1BQQ T;  1II3 A;  2MFI A;  4B3T Q;  3PF4 A;  2H4O A;  3HOZ H;  2R6G A;  3HOU B;  4OON A;  3GP7 A;  1J5E L;  2G9D A;  3K6O A;  4P74 A;  4N8F A;  3T1Y L;  3J81 j;  2BOS A;  3NWS A;  1GUG A;  4MTN A;  1PFB A;  1O7I A;  2IJ0 A;  3QO2 A;  4NMZ A;  4JI1 L;  1N32 L;  1HTL D;  4LF5 L;  1QJO A;  4X3U A;  1K28 A;  3R2T A;  1EZ6 A;  1X3G A;  4YY3 Q;  1D6E C;  3ZYY X;  2LXK A;  4POG A;  1AW7 A;  3PUW A;  1HRJ A;  1IBK L;  3CQZ B;  2Q8T A;  4JI3 L;  2DNE A;  3M3Y H;  1NJI C;  1B50 A;  4JYA L;  1V1O A;  4WOR A;  4NB3 A;  3NUC A;  3FEW X;  1VQN A;  3R2I A;  2F0M A;  5C4H A;  3HZX A;  4R8I A;  1DOL A;  5C3X A;  1VMP A;  3V05 A;  2UXB L;  2NUC A;  2RDF A;  3K8A A;  1PH6 A;  1VQC A;  1UEA B;  2LXJ A;  2WP8 J;  4YCU A;  2B2W A;  1UE6 A;  5IGG A;  4GNX C;  3MFY A;  3BDO A;  4MHE A;  2F0T A;  1JJ2 A;  2R93 H;  4C1N K;  2F0O A;  5COR A;  4IOC A;  4POF A;  4OIK A;  4RA8 A;  3QOJ A;  4NKL A;  1KLG D;  2QKI C;  3MC0 B;  1I50 H;  3NWT A;  3F2D A;  1Q3L A;  1UNS A;  3CC4 A;  4PMB A;  1Q8K A;  1TII D;  1Z9F A;  4R4I A;  3K5N A;  1I3Q H;  2CKZ B;  5DLQ E;  4KI0 A;  3G4S A;  3KDF A;  1LT6 D;  3HOU H;  4OO1 H;  1U9R A;  2PQA B;  1C8C A;  1I6V C;  4B3S L;  1B8A A;  1XNR Q;  1ZXT A;  1EYA A;  3JC6 6;  2PPB C;  1F2L A;  2J0T D;  1IYJ B;  1PDQ A;  4A3C G;  1BKB A;  5IP7 G;  2HIV A;  4QQB X;  2Y0S E;  3CCV A;  4XQQ A;  1NMF A;  1YBY A;  4KD3 A;  2KHJ A;  5C5L A;  2MHV A;  3D0F A;  3GDE A;  3WWV A;  3MXU A;  3CQZ H;  1D5Z C;  4G57 A;  1KAA A;  1KRS A;  2JYO A;  4A3I G;  1GXD C;  1G2S A;  1XMO Q;  3RR5 A;  1SYD A;  1GKH A;  1U4M A;  1F77 A;  1V1P B;  5GAG C;  2B3G A;  1CK1 A;  2NWG A;  2JA8 G;  4L8J A;  5CV6 A;  3I4O A;  4IUP A;  2RDG A;  1XMQ Q;  5COY A;  3J7A 5;  3SE0 A;  1EL0 A;  1HNZ L;  4X62 Q;  2B39 A;  4DV1 Q;  1JQY D;  1CSP A;  1H9M A;  4OXP A;  5LL6 S;  2PI2 E;  1HA6 A;  3MXP A;  1I5F A;  2L11 A;  4QL5 A;  1F2M A;  4KLK A;  5JJZ A;  3Q23 A;  5JJK A;  4HJ9 A;  1S3O A;  5BR8 L;  1GUO A;  1PH3 A;  3CCQ A;  4DAP A;  5M3F B;  1VQI A;  1LTS D;  2UXC L;  2A6H D;  2PQA A;  1AFP A;  4YCV A;  5EAY A;  2Q8I B;  5A35 A;  5C6A A;  1X3E A;  3FP9 A;  2JA9 A;  1A62 A;  1K9M C;  1E3P A;  3IL8 A;  3PGZ A;  4KMU C;  1SJH D;  1N33 Q;  1S4Z A;  1TS5 A;  2OEO A;  4LFC L;  4IO9 A;  3EVQ A;  2VY3 A;  2CWP A;  2PO4 A;  3D4W A;  2WAC A;  3FHW A;  1IBM Q;  2Q2T A;  3KBG A;  3FVQ A;  4BBS B;  4LF9 L;  3EA6 A;  2CQA A;  3ONA B;  2MNA A;  4JV5 L;  2IX0 A;  4LFB Q;  4RH6 A;  2SDF A;  1TWG B;  5LMN W;  1DXM A;  1KC8 C;  2OF1 A;  3BG3 A;  4KD4 A;  1WTO A;  2L15 A;  5KEE A;  1BF4 A;  4HMI A;  4DUZ Q;  2E5L Q;  5BN4 A;  3LWU A;  3M4Y A;  5IYD G;  5C4J B;  1Y69 U;  1TQO A;  5CBA E;  4GNX B;  3L3O C;  4G7H C;  3VR6 A;  4X66 Q;  3I4N B;  1S5F D;  3EIV A;  3SVM A;  3BZD B;  2PZT A;  3BS1 A;  1ENF A;  3G7L A;  2F0N A;  3I2Z A;  2N3S A;  4AH6 A;  2KQ3 A;  2RCF A;  3OIQ A;  1SN8 A;  3CCE A;  2K6A A;  3UE1 A;  3RLF A;  4MIU A;  2B29 A;  4HAE A;  1EY9 A;  2LY7 A;  1IL8 A;  3A8I E;  3CAM A;  1STB A;  1ASY A;  1VQF A;  1LTL A;  2EYF A;  2LFN A;  2AQ1 B;  3PO2 G;  2HQE A;  4DV2 Q;  4EGV A;  2K5W A;  2A68 C;  5M5W B;  2Y0S B;  5M3F H;  1T5X D;  2R7Z B;  3G48 A;  4K0K Q;  1K8M A;  3BDC A;  1NMG A;  1ASZ A;  5IGD A;  2HCI A;  4WJ3 M;  4J15 A;  4UHV A;  2X6L A;  3I3C A;  4A93 B;  4J1M A;  1H9R A;  1SAP A;  1TY0 A;  3IFD A;  1IW7 C;  2DJF C;  4P71 A;  2VXW A;  3H91 A;  4KY6 A;  1YJW A;  1MSG A;  3I70 A;  4LF7 L;  3DHQ A;  5AJ3 Q;  3E0E A;  4EQ5 A;  1QOH A;  4BBS H;  2CQO A;  4M8A A;  1RJT A;  4BXX G;  3KJP A;  1OXU A;  1B1Z A;  1PYW D;  5JEA J;  4GNX A;  3D6W A;  2VNU D;  2ZM6 L;  3K58 A;  1SFO B;  1TWG H;  3QB3 A;  2CWA A;  4K2L A;  3PUZ A;  5KGU A;  4S3S A;  1T5E A;  4A3D G;  3M85 A;  1EY4 A;  1WCM B;  1S5C D;  5C4J H;  4CJ1 B;  1QB5 D;  3I4N H;  1Y1W G;  4ME3 A;  4X65 L;  3TZD A;  4FP5 D;  1HA5 A;  1Y1V B;  4IPD A;  1ZEQ X;  1H9S B;  1TWA B;  1AH9 A;  2N78 A;  1ESF A;  1WVL A;  1EQQ A;  4Y52 H;  1HUM A;  5K36 H;  2QCP X;  1DOK A;  2SEB D;  5C3E G;  1MBY A;  1SJE D;  4DV0 Q;  4U67 3;  3GD7 A;  3A5Z B;  1BCP D;  4HN7 A;  2NZH A;  1MKH A;  4TVA B;  2I0Q A;  5HGQ A;  3IFT A;  5FO9 B;  5M5W H;  4DF7 A;  4QUC A;  5LHY 1;  2R7Z H;  3Q24 A;  5FLM G;  5I6Y A;  2QEX A;  3VA5 A;  1LTT D;  3NPP A;  3STB C;  1GUT A;  5IWA L;  4A93 H;  1TS3 A;  2IPK D;  3DWA A;  4E6I A;  1CQV A;  3KLS A;  4F8M A;  1E1T A;  2JEB I;  3RMH A;  5C0X I;  4PV1 C;  3VR3 A;  1CZG A;  3PO3 G;  4JBW A;  5A2Q L;  2RKS A;  2LMC B;  5IT9 L;  3P20 A;  5DEH A;  4QY7 A;  2AMC B;  1TWC B;  2A6E D;  4IJH A;  2MJ8 A;  3CU7 A;  5EPL A;  5K5P A;  3JAM L;  4DR4 L;  4JG2 A;  2IWH A;  1HR0 Q;  3HKZ G;  1SFO H;  3DEP A;  4NXM L;  4GKK L;  1F9P A;  2CW0 D;  2F0E A;  1CM9 A;  3RD4 A;  2JN4 A;  2KBN A;  3F2C A;  4JBK A;  1WCM H;  4F7X A;  5EKI A;  5M3M G;  4PG3 A;  3L0O A;  5JAV A;  4A3J G;  2QDB A;  2XWJ B;  3MAQ A;  2B63 G;  4KHP L;  2O4X A;  5C0X G;  1SYG A;  3URY A;  4JI0 Q;  4I65 A;  2XNA C;  2MO0 A;  1Y1V H;  1PH8 A;  5KRU A;  2QDL A;  4LWC A;  1B7Y B;  4JVZ A;  2VQF Q;  1TWA H;  2RHQ B;  5T1G A;  2HHH L;  1NBW A;  4BA2 I;  1SNP A;  4RGN A;  4O1N A;  1GOZ A;  2E74 C;  4DXF A;  1IBL Q;  4R4Q A;  1AE2 A;  1JC7 A;  5EBC A;  4C2M B;  4TQU S;  3F8T A;  2B2W C;  1SYC A;  3C1E A;  1O80 A;  3MVV A;  5J1Z A;  3OOC A;  3EN2 A;  2UXD Q;  1B2T A;  5A2Q E;  5IT9 E;  2JA5 G;  1ET9 A;  1SE8 A;  2RHS B;  2D5D A;  1L1O A;  1B4O A;  5E4X A;  4JI2 Q;  3JAM E;  4B3T L;  1VDZ A;  4DV4 Q;  2JXM B;  2WII B;  3KF8 B;  3PIP 3;  4DK3 C;  1UEB A;  3T51 B;  2ZM6 Q;  3ITP A;  3KLS X;  2C5C A;  3VYU A;  3J81 L;  3GO5 A;  3V96 A;  4JC0 A;  4K5X A;  4N9P A;  1BCP F;  1Q1E A;  1Z47 A;  4YY3 L;  3BU2 A;  1TWC H;  2EIF A;  1HFG A;  4IFD J;  1FD7 D;  4EQN A;  1O7L A;  2YV5 A;  1RD9 D;  2K33 A;  4TKO B;  1TWH B;  3HEJ A;  3K5L A;  3MXG A;  5C5M A;  3W3A A;  3S1Q B;  2HD3 A;  4DR2 Q;  3M4P A;  3T4A C;  2KCM A;  4WJW A;  1RL2 A;  2K5N A;  1CQF A;  2IHE A;  3R3O A;  4K6D A;  1QZH A;  3J80 L;  3A55 A;  2MPM A;  1S40 A;  3MZ5 A;  3L9A X;  1AE3 A;  1Q46 A;  1RDP D;  1V43 A;  1VQM A;  1A2U A;  1D2B A;  5D14 A;  3CKI B;  3SK8 A;  3K0Y A;  3T53 B;  3U4V A;  4CDE C;  3DM3 A;  1TKW B;  4PZ8 A;  1CA6 A;  1Q82 C;  2A69 C;  2KHI A;  4BS9 A;  4C2M H;  3FPP A;  5IYC H;  4K14 A;  3J81 E;  3G6E A;  2Z4I A;  3NSW A;  1LTI D;  1M8A A;  4QUF A;  1WTX A;  3NTH A;  3A5U A;  5IGB A;  4KKS A;  4C3J B;  2XTI A;  2NTT A;  1K8A C;  2F3I A;  4K2K A;  4FYD A;  3DMU A;  1K73 C;  4A3M G;  4DV7 Q;  3KK7 A;  1JCK B;  1XNR L;  3NEM A;  2MP1 A;  5T1I A;  2QEJ C;  3RN2 A;  4RG1 A;  1I4P A;  3VR2 A;  2WB1 E;  5JOB A;  4FXK C;  4CGY B;  2ZXR A;  4QB4 A;  2I46 A;  4BY1 G;  4LAA A;  2L12 A;  3J80 E;  4ABN A;  3MFG A;  3Q0A A;  5IYB G;  4HMJ A;  2F0K A;  3C3L A;  1TWH H;  1LT5 D;  3HOV G;  4JK1 C;  2OQ0 A;  1IL2 A;  3S1Q H;  2HHH Q;  1EQT A;  2ZTE A;  2LSS A;  1D5M C;  3A8K E;  2A1A A;  4CBV A;  1VCI A;  4RGO S;  4NXN Q;  4Y7N B;  1OXT A;  2ES2 A;  1PZI D;  2XGT A;  2VZA A;  1GD7 A;  2EY2 A;  2MO1 A;  1KRT A;  5DNF A;  4IUT A;  2IY5 B;  2WAQ E;  4C3I G;  5JPM C;  4X62 L;  1EUJ A;  4B9X A;  4DV1 L;  2UUB Q;  3EQL C;  3CCU A;  2VUM G;  4JBJ A;  1V8Q A;  1EZ8 A;  3MXN B;  3E3X A;  5FOB B;  2WFW A;  3GTM B;  4BA1 I;  3HOX B;  3WOE A;  4AYB G;  3U58 A;  4LK1 C;  1NUC A;  4EVO A;  2I5H A;  1U0L A;  4UP9 A;  4R4T A;  2Z9H A;  2GN5 A;  2SOB A;  4IAL A;  4C3J H;  1A63 A;  1AZP A;  1O7Z A;  2K32 A;  5EGT A;  3KDF B;  5FO7 B;  2RSO A;  1SR3 A;  1QVC A;  2RDH A;  1L0X B;  1RIP A;  1BNZ A;  2IW3 A;  4BY7 B;  1Z7T A;  3KYH C;  1G91 A;  5FJ8 G;  4OX9 Q;  1N33 L;  1Q7Y C;  4DPG A;  3C2P A;  3TP6 A;  1YEZ A;  5DAU A;  1CZW A;  5CBE E;  1PLF A;  1CHP D;  2QF7 A;  4A75 A;  1IBM L;  3A56 A;  1M90 C;  3PIO A;  1PRT C;  3S2H B;  4DN4 M;  3S1M B;  2A74 C;  3S1R B;  1F2Z A;  2HCC A;  4LFB L;  1M4V A;  1SXT A;  4XDX A;  3KUP A;  4ILW A;  4ID6 A;  1WJJ A;  2ZXO A;  2OXP A;  3HOZ G;  2B2U A;  1JT8 A;  2A6E C;  2E5L L;  4DUZ L;  4DR3 Q;  4TRD A;  3AQQ A;  3C1F A;  3V2T A;  1VQ6 A;  2KVM A;  3TSS A;  4X66 L; 
#chains in the Genus database with same CATH homology
 3GTJ H;  1CUK A;  4DNI A;  4A3J H;  1BBW A;  5LMN W;  1QVF A;  1KC8 C;  3UDF A;  3CCL A;  2B63 H;  1YIT A;  1TWF H;  2L15 A;  3CF5 A;  1Q86 C;  2E5L Q;  4DUZ Q;  4LF9 Q;  2K75 A;  1WYD A;  1YVC A;  5IYD G;  4Y7N H;  3TRE A;  3CMA A;  4DAM A;  4GS3 A;  4GNX B;  1YIJ A;  1VQO A;  3OYY A;  3CCS A;  1P8L A;  4X66 Q;  3B6Y A;  1W2B A;  2Q2H A;  3EIV A;  3KF6 B;  1VQK A;  2UUC L;  3J81 i;  2QGQ A;  3I2Z A;  1JJC B;  2N3S A;  1SRO A;  4AH6 A;  1SMX A;  2PI2 A;  1HNW L;  1C9O A;  4ALP A;  1SN8 A;  1FGU A;  3ERS X;  3GTM H;  1YHA A;  4YWM A;  5JJL A;  3CCE A;  4A3B G;  3HOX H;  2I5M X;  4GKJ L;  4JI5 L;  4JI8 L;  4YHH L;  2GVA A;  5LMU L;  2UUC Q;  3UE1 A;  2AHO B;  4DV2 L;  2BA0 A;  2HT1 A;  2R92 G;  5LMN L;  4JI6 L;  3NBH B;  3RLF A;  1PH1 A;  2B29 A;  1FJG L;  4LF4 L;  1H95 A;  3CAM A;  2JA5 H;  3S17 H;  1KD1 C;  1ASY A;  1VQF A;  1LTL A;  1VQ4 A;  3HOW G;  4P72 A;  4OO1 I;  3UE0 A;  1W3S A;  2K5H A;  2KEN A;  2ZJQ A;  3PO2 G;  2UU9 L;  4K0K L;  4GKJ Q;  4JI8 Q;  4YHH Q;  5LMU Q;  4JI5 Q;  4X6A H;  4DV2 Q;  5IYC G;  4HIM A;  5LMN Q;  4DUY L;  4JI6 Q;  4YWL A;  4O0A A;  1Q1B A;  3W1B A;  1FJG Q;  4LF4 Q;  2ASB A;  5M3F H;  3PF5 A;  4BY7 H;  2R93 G;  3I56 A;  1VQH A;  3J80 i;  3RLO A;  3TS2 A;  1G29 1;  3G48 A;  4K0K Q;  3M9B A;  1YNX A;  2UU9 Q;  5K36 G;  2JEA I;  1NMG A;  2CFM A;  4GN3 B;  1ASZ A;  4WJ4 A;  1V1Q A;  2V1C C;  4DUY Q;  4J15 A;  4HJA A;  3CP0 A;  4AIM A;  4WJ3 M;  5AJ3 L;  3LGJ A;  2BH2 A;  2JQO A;  4GLV B;  5GAH C;  4AQY L;  1WFQ A;  3PUV A;  2Q2U A;  2OTJ A;  1KAW A;  3BZC A;  4OWX B;  4GLX A;  3S2H H;  3S1M H;  4P71 A;  3S1R H;  1XPU A;  1UE5 A;  2A19 A;  1YJW A;  4LF7 L;  5GQO A;  5AJ3 Q;  4JBM A;  3E0E A;  4EQ5 A;  3S2D H;  3MEF A;  1MJE A;  2JK8 A;  4AQY Q;  3U50 C;  3HOU G;  3M7N A;  3K7U C;  4OO1 G;  2KCT A;  2CQO A;  3K0X A;  4GOP C;  4BBS H;  2BH8 A;  2ID0 A;  1X56 A;  4BXX G;  3PUX A;  3KJP A;  1TXY A;  1OXU A;  2VW9 A;  1X54 A;  3FKI H;  4QJF A;  3GTO H;  5JEA J;  4GNX A;  1X3F A;  1VQ5 A;  2VNU D;  4LUZ A;  3D31 A;  2ZM6 L;  2VQE L;  1TWG H;  4LF7 Q;  2CWA A;  4GLA C;  2YTY A;  5IE8 A;  5J3B A;  2E2I H;  3I4M G;  1NTG A;  1V9P A;  3KF6 A;  3PUZ A;  3OW2 A;  4IPG A;  4A3D G;  3M85 A;  1FVI A;  1XTD A;  3RNU A;  3GTL H;  1PYB A;  2NVY H;  4IPH A;  2JA7 H;  2PNH A;  1HNX L;  5C4J H;  3GTQ H;  4IJL A;  4DR6 Q;  3H0G H;  1SLJ A;  2VQE Q;  3GTG H;  3CCR A;  1J6Q A;  3I4N H;  1Y1W G;  4ME3 A;  2N49 A;  4LNQ A;  4PZ7 A;  5GAD C;  4X65 L;  3T1H L;  1T9H A;  1HJP A;  2R7D A;  4XTC S;  1DGS A;  1EYG A;  3ULP A;  4PMW A;  1XPO A;  1HNX Q;  3A0J A;  4IPD A;  3I7F A;  4JOI C;  2QA4 A;  4UP8 A;  3S16 H;  1XJV A;  4IFD G;  1QVG A;  4DV0 L;  3K7A H;  1N8R C;  2AWO A;  2OTL A;  2K5V A;  3F1Z A;  4JI7 L;  4X65 Q;  2N78 A;  3I55 A;  3T1H Q;  1AH9 A;  1GVP A;  4YCW A;  3IRB A;  3RZO H;  1E7Z A;  4EX5 A;  1EQQ A;  1XNQ L;  4Y52 H;  1NE3 A;  1LYL A;  4UPA A;  5C3E G;  4DV0 Q;  4A3E G;  2CCZ A;  3GD7 A;  3A5Z B;  3A74 A;  1HR0 W;  3M4O H;  4JI7 Q;  1EOV A;  2NZH A;  1OXV A;  1CKN A;  3FKI G;  1MKH A;  1G51 A;  4TVA B;  2VS1 A;  3SGI A;  5C44 H;  4A3M H;  2E2J H;  5HGQ A;  2I0Q A;  4O2D A;  1XNQ Q;  4B3R L;  5M5W H;  3CD6 A;  2OQK A;  1E22 A;  2R7Z H;  3NEN A;  5FLM G;  2QEX A;  1N34 L;  5IT9 c;  1L1O C;  1M1K C;  1UWV A;  4DR7 L;  5JEA G;  4B3R Q;  3STB C;  5IWA L;  1QUQ A;  3CC7 A;  4BY1 H;  4A93 H;  1X55 A;  3TEH B;  1QZG A;  4PZ6 A;  3JAM c;  3TS0 A;  5IYB H;  1E1T A;  2JEB I;  1VQD A;  3CCM A;  1N34 Q;  5C0X I;  1VQB A;  4A3C H;  1LM0 A;  2YTX A;  4DR7 Q;  1HR0 L;  3PO3 G;  2YYZ A;  4JBW A;  5IP7 H;  5IWA Q;  1JJG A;  4QY7 A;  2NVT H;  2AMC B;  3HOV H;  2JJQ A;  3PIP A;  4GOP A;  4IJH A;  3Q8D A;  2IT1 A;  1HH2 P;  4DV3 L;  4DR4 L;  4JG2 A;  1VQG A;  1HR0 Q;  3HKZ G;  1SFO H;  4NXM L;  4GKK L;  5M5Y H;  2VL6 A;  1MJC A;  3CPF A;  1VS0 A;  3STB D;  2KBN A;  2DGY A;  3F2C A;  4A3I H;  4JBK A;  4JI0 L;  4A3L H;  3S14 H;  3PUY A;  1WCM H;  3OTO L;  1VQ8 A;  5M3M G;  4DV3 Q;  2IHF A;  1YJN A;  2JA6 H;  3CXC A;  3S1N H;  4YWK A;  4DR4 Q;  4BBR G;  4FDB A;  2N8N A;  4PG3 A;  4JV5 Q;  4NXM Q;  2JA8 H;  3L0O A;  4GKK Q;  2RCN A;  4C3I H;  1IXR A;  2VQF L;  3HOY H;  1YZ6 A;  4A3J G;  2BA1 A;  4LFA L;  4KHP L;  2B63 G;  5FLX c;  1HZB A;  2VUM H;  1HNW Q;  4NPS A;  5C0X G;  2NVX H;  1K3R A;  5M5X H;  3OTO Q;  1EIY B;  4JI0 Q;  1Y14 B;  2NZO A;  3H15 A;  1VQ9 A;  3GTK H;  2MO0 A;  1Y1V H;  1KXL A;  4JOI A;  1CKN B;  1IBL L;  1PA6 A;  1PH8 A;  4A3K H;  1D8L A;  1N9W A;  4XIG S;  4LWC A;  1E1O A;  1B7Y B;  3HKZ E;  3U4Z A;  2VQF Q;  1TWA H;  2RHQ B;  1N36 L;  1OTC A;  2HHH L;  1NBW A;  1U5K A;  4LFA Q;  3ULJ A;  3AFQ A;  4QGU A;  4BA2 I;  1JMC A;  4KHP Q;  1I94 L;  1UE1 A;  4KHZ A;  2UXD L;  1A0I A;  3M4Q A;  4OWW B;  1XPR A;  2GVB A;  3TQY A;  4A3F H;  3CCJ A;  4IPC A;  1IBL Q;  4MZ9 A;  4R4Q A;  2D0P A;  1AE2 A;  2Z6K C;  1LUZ A;  1QUQ B;  2YTV A;  1VQA A;  3F8T A;  4TQU S;  3HOX G;  3RN5 A;  1XMO L;  1X65 A;  1N36 Q;  4JI2 L;  4R4O A;  1I94 Q;  3EN2 A;  2DUD A;  2UXD Q;  2IX1 A;  1B70 B;  3BZK A;  4DV4 L;  4APV A;  1PH2 A;  1UE7 A;  5FJ8 H;  1VQP A;  3J81 c;  2JA5 G;  1K83 H;  3PSI A;  4RMF A;  1Q12 A;  1SE8 A;  2FXQ A;  4A3G H;  2RHS B;  2Q2I A;  1L1O A;  1CKO A;  1VQJ A;  1XMQ L;  5C4X H;  4JI2 Q;  4B3T L;  4GOP B;  3F2B A;  2F4V L;  2EXD A;  2NVQ H;  5GRO A;  2K52 A;  1G6P A;  4DV4 Q;  5JJI A;  3HOY G;  3KF8 B;  3L2P A;  2OWO A;  5M3F G;  4DK3 C;  1VQ7 A;  1UEB A;  4BY7 G;  2I5L X;  2ZM6 Q;  1K8G A;  4LF6 L;  1HZ9 A;  2NN6 I;  1KIX A;  1PH7 A;  3GO5 A;  4JC0 A;  4B3T Q;  2MFI A;  3L7Z C;  4DR5 L;  2F4V Q;  3PF4 A;  4JCV E;  4A3K G;  3K81 C;  2Z0S A;  2R6G A;  1WOC A;  3CME A;  3HOZ H;  1Q1E A;  3KLW A;  1Z47 A;  4YY3 L;  3BU2 A;  4OON A;  1TWC H;  2EIF A;  1J5E L;  3J7Z C;  4P74 A;  4IFD J;  4LF6 Q;  3T1Y L;  1PHJ A;  3J81 j;  2D0O A;  2YV5 A;  1O7I A;  4MTN A;  4JI1 L;  4DK6 C;  1JE5 A;  3J80 c;  4DR2 L;  3UDG A;  4DR5 Q;  1E24 A;  4LF5 L;  3UDI A;  2R7F A;  4A76 A;  1P16 A;  1X3G A;  4YY3 Q;  1J5E Q;  5HY6 A;  5IYD H;  4L5R C;  2C35 B;  3ZJY C;  2LXK A;  3T1Y Q;  3HFZ B;  4BBS G;  4POG A;  4DR2 Q;  3M4P A;  1VQL A;  3PUW A;  4JI1 Q;  2A8V A;  1N32 Q;  2KCM A;  4MNO A;  4LF5 Q;  1RL2 A;  2K5N A;  1PV4 A;  1YI2 A;  4A3G G;  1IBK L;  3PV0 A;  2IHE A;  3CW2 C;  2ATW A;  4X66 L;  1QZH A;  3HKS A;  1S40 A;  1X6O A;  4JI3 L;  4GN4 B;  3ULL A;  1L0W A;  3M3Y H;  1NJI C;  1AE3 A;  4HID A;  1KQS A;  1Q46 A;  2NN6 G;  4JYA L;  1EWI A;  1FL0 A;  2JA7 G;  1VQN A;  4NB3 A;  1V43 A;  1VQM A;  4A3B H;  4C3H H;  3DLL A;  3K80 C;  4UY8 C;  1PYS B;  3H0G G;  1IBK Q;  3I4N G;  2R92 H;  2F52 A;  3U4V A;  3H3V H;  4LF8 L;  3DM3 A;  4PZ8 A;  4R4C A;  4JI3 Q;  4HJ7 A;  1Q82 C;  2UXB L;  1L1O B;  2H5X A;  1PFS A;  3RLN A;  4JYA Q;  3K8A A;  3G71 A;  2D62 A;  1PH6 A;  1VQC A;  3PO2 H;  2LXJ A;  2UUA L;  2KHI A;  3NEL A;  2WP8 J;  2Z6K A;  4YCU A;  4C2M H;  5IYC H;  1UE6 A;  4IOA A;  1C0A A;  2WB1 G;  4GNX C;  4LF8 Q;  3G6E A;  1PVO A;  1CKM A;  1A8V A;  1NY4 A;  2K14 A;  5ELO A;  1JJ2 A;  4DV7 L;  2UXB Q;  2R93 H;  2K50 A;  3A5U A;  3EBE A;  4LUV A;  4HJ5 A;  4IOC A;  3RZD H;  1S72 A;  3CC2 A;  4POF A;  3ICE A;  2UUA Q;  2XTI A;  1K8A C;  2AWN A;  1I50 H;  2F3I A;  5C44 G;  1K73 C;  3KJO A;  4A3M G;  4DV7 Q;  2Y0S G;  3F2D A;  1R9T H;  3CC4 A;  1OXX K;  1XNR L;  3NEM A;  3S24 A;  2R7Z G;  1Q8K A;  1Z9F A;  3RN2 A;  4R4I A;  4RG1 A;  1I3Q H;  2CKZ B;  1Q81 C;  1K0R A;  2WB1 E;  5DLQ E;  4H02 A;  4KI0 A;  3G4S A;  3KDF A;  4HJ8 A;  3HOU H;  2E2H H;  1OXS C;  1KL9 A;  4BY1 G;  4A93 G;  2PQA B;  4B3S L;  1B8A A;  1XNR Q;  4BXX H;  3E9I A;  5IYB G;  1PH5 A;  4UP7 A;  4L5T A;  3JC6 6;  3I4M H;  2E8G A;  1IYJ B;  4A3C G;  1JB7 A;  3KFU A;  2WAQ G;  1BKB A;  5IP7 G;  2HIV A;  4L5Q A;  3ER0 A;  1CSQ A;  1TWH H;  4A3D H;  4QQB X;  4B3S Q;  3HOV G;  2Y0S E;  3CCV A;  4NXN L;  2ZJR A;  1VQE A;  4LW1 A;  2OQ0 A;  1EFW A;  1NMF A;  1YBY A;  3W1G A;  1IL2 A;  2KHJ A;  3S15 H;  3S1Q H;  5IY0 A;  2HHH Q;  3D0F A;  2ZTE A;  2LSS A;  3GDE A;  1Y1W H;  1MIU A;  5IP9 H;  1X9N A;  3WWV A;  2OCE A;  3CQZ H;  2A1A A;  4LUO A;  4P73 A;  4B3M L;  3KOJ A;  1VCI A;  2JE6 I;  2UUB L;  1KRS A;  4NXN Q;  4A3I G;  4A3L G;  2HQL A;  1OXT A;  2MQH A;  1WCM G;  1XMO Q;  3PCO B;  2ES2 A;  3RR5 A;  2JA6 G;  2XGT A;  2VZA A;  1GKH A;  4JI4 L;  5E7N A;  1GD7 A;  5GAG C;  2B3G A;  2MO1 A;  1KRT A;  2JA8 G;  1N32 L;  2WAQ E;  2IY5 B;  5GAE C;  4X62 L;  4B3M Q;  1HZC A;  1EUJ A;  2YU9 H;  1D7Q A;  4DV1 L;  3I4O A;  2UUB Q;  3CCU A;  2VUM G;  1EIF A;  2ZTC A;  4JBJ A;  5C3E H;  3MXN B;  2WFW A;  1XMQ Q;  4BA1 I;  1Y1V G;  4A3E H;  1BVS A;  4JI4 Q;  1C7Y A;  3J7A 5;  1L2F A;  4GN5 A;  4AYB G;  3U58 A;  2EQS A;  4DV5 L;  5ELN A;  1HNZ L;  4DR6 L;  1KHI A;  4X62 Q;  1EQR A;  1SRU A;  4DV6 L;  3JAM i;  4DV1 Q;  3W5O A;  1CSP A;  2I5H A;  4OXP A;  1U0L A;  2PI2 E;  4UP9 A;  4R4T A;  3VDY A;  5FLM H;  1I5F A;  2GN5 A;  4QL5 A;  4C3J H;  4A3F G;  4OX9 L;  1A63 A;  4L5S A;  2ALY B;  3KDF B;  4DV5 Q;  4HIO A;  4KLK A;  4QIW E;  1HNZ Q;  5JJK A;  1YJ9 A;  4HJ9 A;  1S3O A;  3E9H A;  5BR8 L;  4DAY B;  4DV6 Q;  1SR3 A;  1QVC A;  1RIP A;  1PH9 A;  1WI5 A;  2RF4 A;  3CCQ A;  5IP9 G;  3CPW A;  1PH3 A;  3BJU A;  1VQI A;  3AFP A;  4P75 A;  2UXC L;  3KYH C;  5FJ8 G;  4OX9 Q;  2PQA A;  1N33 L;  3AEV A;  4YCV A;  3AYH B;  1BBU A;  5EAY A;  1Q7Y C;  4DPG A;  2ZTD A;  4IFD I;  4AYB E;  1X3E A;  3FP9 A;  4A4I A;  2JA9 A;  1YEZ A;  3PO3 H;  1A62 A;  5BR8 Q;  1K9M C;  1E3P A;  5C4X G;  3TRZ A;  3PGZ A;  1YHQ A;  1PH4 A;  4R1J A;  4A75 A;  1IBM L;  2UXC Q;  1M90 C;  3PIO A;  4DR3 L;  4DR1 L;  1N33 Q;  1I6H H;  3GTP H;  4LFC L;  4X64 L;  4LFB L;  1YHB A;  3UDX A;  4IO9 A;  2HIX A;  2VY3 A;  5H1S E;  1WJJ A;  1IZ6 A;  2AKW B;  1HZA A;  3HOZ G;  4OWT B;  2CWP A;  1GO3 E;  3FHW A;  1IBM Q;  2Q2T A;  3HOW H;  1JT8 A;  5C0X J;  2E5L L;  4DUZ L;  4LF9 L;  4DR3 Q;  4DR1 Q;  2PMZ E;  5M3M H;  2MNA A;  1GM5 A;  3AQQ A;  3H3V I;  4JV5 L;  4LFC Q;  4BBR H;  2IX0 A;  4X64 Q;  2ZJP A;  1VQ6 A;  4LFB Q;  4HIK A;  2K4K A;  4DKA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...