4B3RQ

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3rQ00
5IT9c 4X66L 2ZTEA 4AYBG 4OX9L 1XJVA 1V1QA 1TWFH 3RZDH 2UUBQ 4A3MG 1LM0A 1AE2A 2VL6A 4POGA 2F52A 2HHHL 2JA5H 4GKKQ 4DV2Q 3S2DH 4PZ6A 1IL2A 2R92G 4P75A 1N34Q 2WAQE 4R4OA 4BA2I 1NJIC 4NXMQ 1HR0Q 4DKAC 1KD1C 5IYDG 2PNHA 4OWXB 4DAMA 5M3MH 1VQMA 4IJHA 4L5RC 3K8AA 3CCVA 1L0WA 4DR3Q 2UXDQ 1FJGQ 1U5KA 2JE6I 1MKHA 1VQDA 3PIOA 1VQJA 5IYCG 5JJLA 2A19A 1Z47A 1Q1BA 4A3IH 2E2IH 1KRSA 3W5OA 2VY3A 5EAYA 1EFWA 4LF4L 3FKIH 4P73A 3F2DA 2K50A 1PH3A 4JI4L 4NXNL 3DLLA 3OTOL 3KDFA 1R9TH 1VQ5A 4IFDG 5ELOA 4JV5Q 2K5VA 2E5LQ 4HIDA 4LNQA 3STBD 1I94Q 5JJIA 3ULLA 1KAWA 1FL0A 5M5WH 3GTMH 4DV4L 4A3LG 2R7FA 4BY1G 1G51A 1WCMH 3M3YH 4A3LH 3G48A 5FLXc 2ZJPA 1K9MC 1PHJA 1IBMQ 3FP9A 4GNXA 2PI2A 1VQLA 1EQRA 1VQCA 2BA1A 2AHOB 4LF8Q 5C44G 3I4OA 1PH5A 1UE7A 3F2BA 2OTJA 2K5HA 1W3SA 3F1ZA 3GDEA 4JOIC 3PO2G 2UXCQ 2Y0SG 1N36Q 2F3IA 1QVGA 4JBMA 1PVOA 1IZ6A 1YJWA 2R7ZG 2JA6H 2KENA 1VQBA 1GKHA 3PF5A 1VQOA 4JI6L 3HOUG 1JMCA 4DK6C 4P72A 4BY7H 1X54A 2V1CC 1HZ9A 3ULPA 1X6OA 3T1YL 4GN5A 1XMQQ 3U4VA 2KHIA 2VS1A 2BH2A 3M9BA 4YHHL 4DV3Q 1JJ2A 3TREA 4LFCQ 2KCMA 3S1NH 5FLMH 2IHFA 3HKZG 1LTLA 2NVYH 1JJGA 3I2ZA 3T1HL 1TXYA 5IWAQ 1UWVA 3CCMA 1UE1A 4DV0Q 4APVA 4QQBX 2AMCB 3HOWH 1JJCB 2NN6G 1PYBA 2JK8A 3J81j 1NMGA 1YZ6A 3RN5A 1Q86C 3HOZG 3PO3H 1S72A 4JI3Q 4BXXG 3M4PA 4A3CG 2KCTA 5GAEC 2K75A 2Q2IA 4HIMA 2ZM6Q 4AQYQ 1Q7YC 2OWOA 1WI5A 3K81C 4IO9A 4A3EH 3HOXG 4A93H 1J6QA 4LW1A 5HGQA 5DLQE 3J7ZC 3UDXA 5M3FH 2R93H 1SR3A 1XPUA 3CCRA 4GLVB 2B63G 1X3FA 1CSPA 3HKSA 1JE5A 4LF5L 5GADC 2LXJA 4A3GH 2PQAB 5IYBG 1XMOQ 2QGQA 3H0GG 2E2HH 4DV5Q 2IT1A 4UP9A 4JI5Q 2AWOA 4OO1I 1Z9FA 4JI1Q 5BR8Q 2R7ZH 2VUMH 2N3SA 1UEBA 3A5ZB 1XNRQ 4C3IH 3CMAA 1Q82C 1QZGA 4KHZA 1B7YB 1WCMG 1E1TA 4HIKA 3TS2A 2R7DA 2R6GA 4DUYQ 2A1AA 3ULJA 5LMNQ 3ZJYC 4HIOA 2YYZA 4LUZA 1YHQA 2IX1A 2A8VA 4XIGS 2D0OA 1A0IA 1N33Q 2F4VQ 2MO0A 3AFQA 3W1GA 4DV6Q 4GNXC 3D0FA 1KHIA 4AIMA 5C4JH 1XNQL 1SROA 4KI0A 4WJ3M 3H15A 1YITA 1QVCA 2FXQA 3A0JA 1E22A 3CCEA 1C0AA 5M3MG 4LF8L 4RMFA 4OXPA 2E2JH 1NBWA 3CCUA 1OXSC 4GKKL 2UXBL 4H02A 1C7YA 1GVPA 1PA6A 2N49A 5ELNA 3M4QA 3IRBA 2IX0A 3G4SA 5IP7H 4XTCS 3U58A 1S3OA 3E9IA 1X3EA 3BZCA 4JI7L 1XMOL 3LGJA 1PH1A 3CPFA 1YVCA 4R4TA 1I94L 5M5YH 1V43A 1Q12A 1PH7A 3NELA 5C4XG 3I55A 4DUZL 1VQPA 2Q2TA 4A3JH 2VUMG 2GVBA 2WAQG 3GTPH 3PIPA 1KIXA 1W2BA 1UE5A 3GTLH 2RHQB 4DV7L 1PH6A 2ZTCA 2NVXH 1X56A 5LMUQ 1YHAA 1J5EQ 3M85A 2ZM6L 4AQYL 4DAYB 4DR5Q 1XNQQ 3CXCA 1A62A 2ATWA 2LSSA 3BU2A 4B3ML 4IOAA 4DR6Q 3RLNA 1PH2A 4RG1A 5J3BA 1VQIA 4QJFA 1TWAH 3A5UA 1L1OA 3FHWA 1T9HA 5IP9G 4DR7L 3CAMA 3HOYH 3I4MH 4GKJQ 1BKBA 2YTXA 1O7IA 1PV4A 4IPCA 3RLFA 4JBJA 4OONA 4JI0Q 4X62Q 2WFWA 4IPHA 2NN6I 1Y14B 2PI2E 3JC66 2I5LX 3WWVA 1VQGA 3RN2A 1YJ9A 2JA6G 2HHHQ 5JJKA 3U4ZA 3HOXH 3PF4A 1VQ8A 4TQUS 4LFBQ 1OXVA 4UP7A 4LF6L 4JC0A 4OX9Q 2I0QA 3NENA 2NVQH 4JCVE 2B63H 5C44H 1QVFA 1N36L 3L7ZC 3H3VH 2KBNA 2VZAA 3ER0A 3PUZA 1HNZQ 1EWIA 2JA8G 1Q46A 3GD7A 2YV5A 3GTQH 1HNWQ 4LUVA 4DV6L 3I7FA 1WFQA 3KDFB 3EBEA 2K4KA 4A3JG 2Y0SE 1NY4A 3K7UC 5GAHC 4HJ5A 2N78A 3KYHC 3SGIA 3S1RH 2GN5A 1VQHA 1J5EL 2JA7G 4OO1G 1TWCH 4GLAC 4YWLA 1K73C 1KXLA 5FLMG 1VCIA 4MTNA 2CQOA 3KJOA 4IOCA 1VQ7A 4DUZQ 4JV5L 3HKZE 2JEBI 3PO2H 1PYSB 2WP8J 4PG3A 3CC4A 5E7NA 1Y1WG 4L5QA 2ZJRA 1X3GA 4JI4Q 3RZOH 1YIJA 1H95A 1X55A 3EN2A 1M1KC 3S1MH 3KF6B 3I56A 4WJ4A 1HR0W 4LF5Q 1XMQL 3TEHB 2HIVA 1L2FA 4C3JH 1EOVA 5C3EH 3PUYA 4IFDJ 3CCJA 3NEMA 5IE8A 1M90C 2XTIA 2Z6KC 2HT1A 4LFAQ 4JI2L 1B70B 3Q8DA 5GQOA 1CSQA 3AQQA 4GN4B 3GTOH 2DUDA 1HH2P 3L2PA 2ALYB 4HJ9A 2ASBA 1K8GA 4OWTB 1N33L 2F4VL 3I4MG 2Z6KA 3K80C 5H1SE 2CCZA 2UUBL 1KRTA 1L1OB 3OYYA 1UE6A 5IWAL 4BXXH 1CKMA 4P74A 1Y1VG 2L15A 4X62L 5C0XI 1B8AA 3TQYA 4YWMA 4LFCL 4GLXA 4JI0L 4DR1L 1AE3A 4DK3C 4UY8C 4A3DG 2I5MX 1HZAA 4Y52H 1SE8A 2OCEA 2E5LL 2NVTH 1DGSA 4NPSA 1HZCA 1BBWA 4NXNQ 3G71A 4MNOA 4B3TL 4DR6L 2JA5G 1X65A 4DV5L 4JYAQ 1EYGA 2CFMA 2WB1E 4PZ7A 1I6HH 1PH8A 3HOWG 4DNIA 2H5XA 1BBUA 5C4XH 1IXRA 1MJCA 2GVAA 1HZBA 3K0XA 5JEAJ 3UE0A 1KL9A 3CCSA 3J7A5 1A63A 3M7NA 1VQ6A 2D62A 1HJPA 1OTCA 4X64L 3S17H 1I50H 1Q1EA 3CC2A 4BBRH 1N9WA 1SN8A 4BBSG 2ID0A 4JBWA 3S15H 4DR4L 2Q2HA 4ME3A 4QIWE 2QA4A 4GN3B 3J81c 1IBKQ 2UUCQ 3S16H 1D7QA 4KHPQ 5LMNW 4YCUA 2D0PA 4JI3L 4DPGA 1FGUA 3CQZH 3KF6A 3HOVG 4LFBL 2UXBQ 3PO3G 3D31A 3HOZH 3PV0A 3OTOQ 5IP9H 3T1HQ 4R4QA 1QUQA 3UE1A 4DR2L 1LUZA 4LF7L 2WB1G 1Y1VH 3J80i 4DV3L 2HQLA 1AH9A 1GD7A 1NTGA 4A76A 3S14H 2RHSB 4BA1I 1G6PA 5IY0A 1X9NA 5GROA 3CW2C 4JI6Q 2HIXA 1OXUA 2UUAL 3B6YA 4ALPA 5C3EG 4DR3L 1ASYA 2JEAI 2EIFA 3BJUA 2YU9H 4GOPC 4OWWB 3G6EA 3CCLA 4R4CA 1SMXA 3CPWA 1YHBA 1HR0L 2B29A 3AYHB 5LMNL 4DR5L 1QZHA 5LMUL 4LF7Q 3L0OA 2JJQA 2VQEQ 5C0XJ 4DUYL 4DV7Q 1N34L 3CD6A 2CWPA 3KJPA 3EIVA 2VQFQ 4YY3L 1GO3E 4QGUA 3JAMc 4GOPA 1XNRL 1N8RC 2N8NA 1VQEA 2MFIA 4X65L 3CF5A 4L5SA 5BR8L 1HNXQ 4JI5L 1FVIA 2R93G 2NZHA 4UP8A 4X66Q 1G291 1VQ4A 1CKNB 4KLKA 3E0EA 4A3KH 4JI7Q 1PH4A 3JAMi 4A3MH 1VQKA 5AJ3L 3H3VI 2ZJQA 1VQ9A 2JA8H 1IBKL 1RIPA 2UUCL 1I5FA 4X65Q 2PMZE 3FKIG 2EQSA 1CKNA 1K8AC 2YTVA 4GNXB 2R92H 3HOVH 1YNXA 1Y1WH 4YY3Q 4A75A 4AH6A 4A4IA 1S40A 2VQEL 5K36G 4X6AH 1JB7A 5IYDH 4A3BH 1CKOA 4LF9L 4JOIA 2MNAA 4GOPB 1KC8C 1EIFA 3F2CA 2JA7H 3AFPA 3MEFA 1WOCA 1YEZA 3I4NG 2K52A 2XGTA 3PUVA 1XPRA 3J80c 5IYCH 1P8LA 3A74A 3RNUA 4NXML 3S2HH 1L1OC 3ERSX 1SRUA 3GO5A 4DR1Q 1K83H 4DR2Q 2VW9A 4UPAA 4Y7NH 1QUQB 4JI8L 4HJ7A 4B3SQ 4YCVA 3MXNB 3T1YQ 4A3CH 3E9HA 1XPOA 1EUJA 1NMFA 4JI1L 2MO1A 4K0KL 1MJEA 5HY6A 1TWGH 2BH8A 4LUOA 3J81i 4BBSH 1N32L 1XTDA 1KQSA 1E1OA 4KHPL 3HOUH 1WJJA 2LXKA 4P71A 5M3FG 4A3FH 4R1JA 4LF9Q 3TS0A 3I4NH 2CWAA 1LYLA 1U0LA 3CC7A 2JA9A 3OW2A 1EIYB 1CUKA 5IP7G 4JBKA 3HFZB 1E3PA 5FJ8G 1OXTA 2QEXA 2EXDA 1TWHH 3HOYG 1ASZA 2RF4A 1PH9A 3PUXA 3CMEA 1OXXK 1VQAA 2C35B 2NZOA 4PMWA 2B3GA 4JG2A 1NE3A 4GS3A 4POFA 3CCQA 1K3RA 1Q81C 1IBLQ 2UU9L 1N32Q 4B3TQ 4LWCA 3TRZA 4K0KQ 4A3DH 1HNXL 3GTJH 4BY1H 4BY7G 3KLWA 4TVAB 4DV0L 4A3KG 2AWNA 3S24A 4HJ8A 1SFOH 4PZ8A 2VQFL 4IFDI 1YI2A 1EQQA 1IBLL 2UU9Q 2KHJA 3DM3A 1VS0A 4JYAL 1YBYA 4YHHQ 1E24A 2Q2UA 1JT8A 2OQKA 2AKWB 1VQFA 3KF8B 2Z0SA 4IPDA 2K5NA 5M5XH 2ES2A 2UXDL 3ICEA 3UDIA 1PFSA 1HNWL 4J15A 4DV1Q 1Q8KA 2E8GA 4DR7Q 3RLOA 1GM5A 1HNZL 2UXCL 4O2DA 2I5HA 2K14A 4C2MH 4DV1L 3NBHB 4JI2Q 2DGYA 4LFAL 3AEVA 4R4IA 4YCWA 2YTYA 5GAGC 1C9OA 5C0XG 4LF6Q 1MIUA 4DV2L 1IBML 4O0AA 4EX5A 3BZKA 1WYDA 1BVSA 2PQAA 3KOJA 4AYBE 3PUWA 3GTGH 5FJ8H 2IY5B 4HJAA 4B3SL 4A3GG 5AJ3Q 4JI8Q 5JEAG 3UDFA 4DV4Q 4BBRG 3H0GH 1VQNA 3KFUA 4C3HH 3K7AH 2RCNA 4IJLA 3PCOB 4GKJL 3PSIA 1D8LA 2MQHA 3STBC 2OQ0A 4QL5A 3PGZA 1V9PA 4A3EG 4DR4Q 4A93G 1IYJB 4YWKA 4A3FG 4A3IG 4L5TA 1I3QH 4B3MQ 3RR5A 4X64Q 3M4OH 2JQOA 4B3RQ 1RL2A 3F8TA 4LF4Q 3CP0A 4IPGA 4EQ5A 4MZ9A 3VDYA 4B3RL 1P16A 1YJNA 5IYBH 1FJGL 1SLJA 2UUAQ 4NB3A 3UDGA 3S1QH 4A3BG 1K0RA 2ZTDA 4FDBA 4QY7A 2OTLA 2IHEA 3GTKH 2BA0A 3W1BA 1E7ZA 2VNUD 3U50C 1A8VA 2CKZB
chains in the Genus database with same CATH superfamily
5BN4A 1IKMA 1XJVA 1GUNA 4A3MG 2HUGA 4POGA 2F52A 1I4PA 1H9KA 5ELEA 4DV2Q 4KY5A 1EIHA 4KKUA 2R92G 2A5HA 1N34Q 3GTOB 4V190 1Q90A 4ABNA 2J7ZA 4TRDA 5M3MH 4L5RC 2UXDQ 4DR3Q 4FF2A 1U5KA 2JE6I 1VQDA 1VQJA 2A19A 5A2QE 3PQIA 1KRSA 5EAYA 2F0UA 1PH3A 1EQVA 4NXNL 3KDFA 4F88A 2DJFC 2E5LQ 4HIDA 1VMCA 3MZ5A 3STBD 3TBIB 3ULLA 2F0SA 3Q24A 4BS9A 3QOLA 4XT1B 3K6OA 3FKIB 1A6XA 1IBMQ 4GNXA 1VQLA 3HG9A 5I9OA 1WTHA 2BA1A 2AHOB 1KDCA 1PH5A 2B8GA 2EDGA 2Y0SG 3KF8A 1N36Q 3LX0A 2RVLA 5IGFA 1YJWA 1VQBA 5EPKA 3PF5A 1VQOA 3FPUB 4DK6C 4BY7H 3T1YL 4KN4C 1HZ9A 3ULPA 1XMQQ 4GN5A 3SK5A 2BH2A 2F0GA 4U673 3M9BA 3MA2B 3G7LA 2KCMA 4UDUC 2IHFA 2XIWA 2NVYH 1B3QA 3T1HL 1TXYA 1UWVA 1Y8OB 3CCMA 3HOWH 3RN5A 1PYBA 2B2UC 1K8MA 1S5ED 1S72A 4PNYA 4K2LA 5GAEC 4A3CG 3BDCA 3HOWB 1T5EA 4FXGC 4HIMA 1UUPA 2OWOA 4A3EH 4QCLA 3I3CA 4LW1A 4R8NA 3J7ZC 3NBHA 3KK7A 2F4IA 4DF7A 3CCRA 2PPBC 1EY9A 2PW7A 4LF5L 2LXJA 4A3GH 2A6EC 2IT1A 4YIJA 4UP9A 2HQEA 2XNAC 1BF4A 2KOLA 2AWOA 4JI1Q 2K7VA 3A5ZB 1XNRQ 4C3IH 3CMAA 1QZGA 4EQNA 4KHZA 1WCMG 1YNNC 1AZQA 4DUYQ 2WB1B 4OIJA 1YHQA 4J8QA 4H7BA 2IX1A 2D0OA 1N33Q 3AFQA 1KHIA 3VYTA 4AIMA 1EFID 5C4JH 1RDPD 5KYIA 1SROA 1O7ZA 3P7JA 4K6LA 2FXQA 1C0AA 5M3MG 4LF8L 4KMUC 4OXPA 1A3VA 3NSWA 1OXSC 2N88A 4GKKL 4H02A 3RUZA 5ELNA 3MHBA 1TS2A 2IX0A 4JI7L 1PYWD 4R4TA 1I94L 2MUYA 3NELA 3EA6A 3GTLH 4MTKA 2NVXH 1X56A 5LMUQ 1J5EQ 3M85A 4DR5Q 1XNQQ 3A8IE 1HFGA 3MXNA 2DNCA 3D3RA 2EVBA 5D14A 2K5QA 4XQNA 2I07B 5IP9G 3QG1A 4XYOA 1O7IA 1GUTA 1STHA 4OONA 4RGMA 3DUZA 4X62Q 4IPHA 1Y14B 3JC66 4HSVA 3WWVA 5JJKA 2E2HB 1VF5C 2PNRC 3HOXH 3PF4A 4LFBQ 1G6ZA 3MXPA 3NWTA 4TQUS 5IGEA 1ET6A 5D3DA 5BN3A 4LF6L 2QKIC 1STYA 3NENA 3TP6A 4EQPA 4ZK9B 2B63H 1QVFA 2NVTB 4HAEA 3D6WA 3ER0A 1TS5A 2C5CA 4LUVA 2QILA 3I70A 2WKDA 2F0NA 1NR4A 3S1RH 3R2IA 2GN5A 4JVZA 1Y8PB 1J5EL 1A2UA 1TWCH 3C1EA 4H13C 1Q8IA 1VCIA 2CQOA 2ICEC 4IOCA 4JV5L 5T1IA 4A3KB 2JEBI 5C4HA 5E7NA 4L5QA 3GTPB 3VR2A 2XN9C 4DAVA 1KABA 1M1KC 3S1MH 3NQIA 2HIVA 4CDDC 1EOVA 2L4NA 2A6ED 3PUYA 4IFDJ 3KLRA 1M90C 2Z6KC 4PV1C 2HT1A 1STBA 4LFAQ 1HUNA 1B44D 1CSQA 1B1ZA 2F0MA 1HH2P 2CH4A 4HJ9A 2FMCA 4OWTB 3T56B 3I4MG 1CT1D 1STGA 2Z6KA 4XDXA 3CQZB 3TMEA 2UUBL 1L1OB 1UE6A 1S5FD 1YNND 3SDZA 2BDNA 5IYDH 4YWMA 4LFCL 2O4XA 2X6LA 2I5MX 1SE8A 4KD3A 2E5LL 1JWMD 4MIUA 1FNUA 1QB5D 2JA5G 1H9JA 5FLXL 3QWNA 1I6HH 1PH8A 4DNIA 2H5XA 3D6CA 3K0XA 1BNZA 2XRQD 1A63A 1DM0B 1KL9A 4X64L 4BBSG 1SN8A 1A3TA 2ID0A 4FP5D 4JBWA 3S15H 1RKNA 4QIWE 4HSPA 1QE6A 2UUCQ 2G9DA 3S16H 1SNDA 5FO7B 5JVG3 3WDNA 2JA7B 2D0PA 3KBXA 1PZKD 2LY7A 3CQZH 3HOVG 1CQVA 3OHXC 1RHPA 2A6HC 3D31A 3PV0A 3TZDA 5IP9H 4Q0FA 5KNDA 3BVZA 1QUQA 3UE1A 1LUZA 1A3UA 1Y1VH 1TY2A 2WB1G 1KNAA 2HQLA 3NQTA 5JVH3 4DV3L 1NTGA 3S14H 4BA1I 5IY0A 1X9NA 1F9QA 5GROA 2HIXA 1SMYD 1OXUA 1TIID 1U4MA 1ASYA 2EIFA 3O13A 4OWWB 4R4CA 4NP5A 1HR0L 1ZYRD 3AYHB 5IGCA 1QZHA 2RDHA 5LMUL 2PCFB 4LF7Q 3L0OA 1BCPF 4DUYL 5C0XJ 2PO4A 2ZT9C 1RJTA 4EQOA 3JAMc 4GOPA 4OL7A 2N8NA 1VQEA 4X65L 1XX8A 2NZHA 3SXHA 1G291 1CKNB 2IL8A 1VQKA 1STNA 1BUVT 1IBKL 1YNJD 3HS0C 1K8AC 3D4WA 4GNXB 1YNXA 1TQOA 1LTGD 1BO0A 1SNOA 4AH6A 1IL8A 2VQEL 2HCCA 1JB7A 2EY5A 4LF9L 1I4HA 2F03A 4K2KA 3F2CA 4I7AA 3MEFA 1YEZA 3I4NG 1V1PA 3VYUA 3S2HH 5G3LD 3ERSX 4CHTB 4WJWA 3GO5A 5CV4A 4BBRB 4OIKA 4DR1Q 1QUQB 4B3SQ 2JA6B 4XXEA 4DU9A 3T1YQ 2D5DA 1LO5D 1MJEA 1BCPC 3W2DA 1UAPA 2PW5A 2M2LA 3HOUH 2LXKA 5M3FG 4LF9Q 3I4NH 2CWAA 2DNEA 2EY1A 1KNEA 3OW2A 1CUKA 5IP7G 4Y7NB 4JBKA 3HFZB 4EVOA 5HGTA 4A3JB 1OXTA 2QEXA 1TWHH 2ZXRA 3CMEA 4I7ZC 1OXXK 4JYAQ 4PMWA 3I90A 5IGBA 1K3RA 2Z9HA 4B3TQ 4IQZA 4K0KQ 3SK8A 3GTJH 4A3MB 1JOKA 3KLWA 1LT6D 2EJGC 3IFDA 3R2TA 2VQFL 2RCFA 1YI2A 1EQQA 3VA5A 2UU9Q 2FFKB 2P5ZX 2EOTA 3ZYYX 2OQKA 2K33A 1VQFA 3BVMA 3KF8B 2K5NA 3NWSA 5M5XH 3RZOB 1TS3A 1AN8A 1W6JA 3OWEB 4DR7Q 2E8GA 1HNZL 2UXCL 2K6AA 3VA7A 1FNWA 2QW7A 5C0XG 1JB3A 4EX5A 2F0JA 1KLUD 4UHVA 2PQAA 1X32A 3KOJA 5CBEE 1DYQA 3GTGH 3UI2A 4A3GG 2XSCA 1PLFA 3KFUA 2R3ZA 4C3HH 3WOEA 1SE2A 2RCNA 4IJLA 4GKJL 2V4DA 3PSIA 4RHSA 4IALA 2OQ0A 1IW7D 2F0HA 4A3EG 5CGKA 1IYJB 2RBMA 4L5TA 2KCCA 3RR5A 2O5JC 4B3RQ 1BR9A 2PQEA 3CP0A 4LF4Q 4QB4A 1JOOA 2MP1A 1DD2A 2F0DA 5IYBH 1D5MC 1FJGL 1B4OA 2ZTDA 4DNRB 2OTLA 2GA4B 3W1BA 4CJ0B 1LT5D 1PFBA 5IT9c 1V1QA 2K05A 2UUBQ 1STAA 1AE2A 2IX3A 2B2YC 5EPJA 1HA5A 4M1UB 5F2DA 1TU2B 2KA7A 5EGTA 1JWSD 1TT2A 2QDBA 2WAQE 4R4OA 2Q8RE 3C46A 5KEEA 1E2WA 2JA8B 4BA2I 3NP8A 4DKAC 4OWXB 4DAMA 1ML0D 1VQMA 1B2TA 1HRJA 4IJHA 4G57A 3CCVA 2G9HD 1L0WA 1FJGQ 1I4XA 3HZXA 5ISRA 1AFPA 1Z47A 4A3IH 1EFWA 4LF4L 1MGSA 4OEMB 4FYDA 4P73A 1HHVA 2K50A 3DLLA 3QO2A 2KUMA 2A69C 2K1BA 4JV5Q 1Y1WB 1SNMA 2B2VA 4LAAA 1KAWA 3D4RA 2KQ3A 1SJHD 1IKLA 4BY1G 1G51A 3M3YH 5LL6X 4A3LH 3I73A 3GTQB 2PI2A 1D1IA 3EJIA 3MWYW 3X3MA 1EQRA 4EGVA 4IUPA 3T16A 3I4OA 2K5HA 3I72A 5CV9A 3GDEA 1QVGA 1WTPA 2JP1A 4CDEC 4OGQC 2OXPA 1GKHA 3GTMB 4JI6L 1JMCA 1X54A 2A68D 2V1CC 2SOBA 3NK9A 1IW7C 2KHIA 2OT2A 2F0EA 5FLMH 2FMMA 2A68C 1K8OA 2N55A 3A54A 4B9XA 5IWAQ 1O7LA 1ESRA 4QQBX 1DOMA 2NN6G 2JK8A 1Q86C 1NMGA 3PO3H 4JI3Q 3GTGB 4BXXG 2K75A 1G2SA 4AQYQ 2D2CC 4A93H 4IO9A 4U68A 3H94A 5DLQE 1KAAA 5M3FH 3NBIA 2X6GA 1JE5A 4IUNA 5GADC 1HTLD 4KKTA 4DXFA 1CM9A 4DV5Q 5BR8Q 2R7ZH 5C3XA 1B7YB 4HIKA 3C1FA 4C3JB 5EKKA 3IFTA 1DOLA 1L0XB 4XIGS 1A0IA 1GUWA 2MO0A 3D0FA 2SEBD 1RF2D 4ULLA 2OF1A 4N8X1 1YITA 1DXMA 1C48A 4ZUJA 1LT3D 4RMFA 1NBWA 2C9OA 5JPMC 2L12A 2UXBL 3CHBD 3A56A 4X3TA 2N49A 2EPBA 3G4SA 3BZDB 1SE3A 3HKZB 1PMRA 2B2TC 1LABA 1PH7A 3L9AX 1PTOC 4CKCA 3I55A 2Q2TA 2VUMG 4A3EB 3S2DB 3PIPA 1KIXA 1W2BA 4Q5VA 1PH6A 1BOSA 1XNQL 4AQYL 2F0KA 1K28A 3VYSA 3CXCA 1FNVA 4B3ML 1JCKB 4IOAA 1OO9B 3I4MB 3EROA 3RLNA 5D65A 1XYIA 4E6IA 2IW3A 5KNBA 3AMUA 1SYBA 1VQIA 4QJFA 2FINB 3I4MH 4GKJQ 2YTXA 2F0LA 4IPCA 3RLFA 4LMQD 2Z4IA 4KY7A 1B50A 4HMJA 1I6VC 1YJ9A 3U4ZA 1VQ8A 4OX9Q 3M4YA 2JA5B 2AQ2B 2NVQH 4JCVE 1TY0A 2KBNA 2VZAA 3PUZA 1EWIA 1Q46A 2YV5A 2KHSA 3SK6A 2B39A 3M3YB 2K4KA 2CHBD 2Y0SE 5GAHC 2N78A 1F77A 4QIWB 1V1PB 2JA7G 4OO1G 1DOKA 4MN3A 4ZYSA 2EY6A 1O7YA 2DY7A 3OSOA 3ITPA 4LJZC 5FLMG 5CV5A 3KJOA 3HOVB 2NWGA 3HKZE 1XWEA 3QB3A 4JI4Q 1HTPA 3I56A 4WJ4A 1HR0W 4X3UA 1XMQL 2LKVA 3FDTA 2A73B 1L2FA 2YU9B 3K59A 1BXTA 3SVMA 2NVQB 3NEMA 3BS1A 2XTIA 4ZKBB 3MEHA 5GQOA 5KRUA 2B2WA 4DNTB 3PO2B 3GTOH 1S4ZA 2F4VL 2AUKA 3K80C 5H1SE 2CCZA 1K3BC 3DM1A 4C1NI 1CKMA 5C0XI 1MSGA 3TZUA 5IGDA 4UY8C 4GLXA 4P2CB 1EYCA 4DK3C 1U4RA 4QUFA 1B3AA 1SBBB 5LL6S 3R3OA 2NVTH 1DGSA 1PZID 1HZCA 4R9WA 4FF1A 1BBWA 3G71A 4A3FB 1EYGA 4DA2A 4DAYA 2Q8TA 1JC7A 3J7A5 1X3PA 1CZGA 2AQ3B 4K8JA 3OW7A 2D62A 4MHEA 1OTCA 3S17H 4BBRH 3NTIA 2JSOA 1TWCB 3ERQA 2PZWA 4GN3B 1FD7D 3J81c 1EOTA 2QF7A 3S1RB 4JW0A 4DPGA 2WV6D 3OOCA 2EYHA 5J22A 5JPNC 3S1MB 1XTCD 1E2VA 2UXBQ 3OTOQ 4CJ1B 1LTID 4ODGA 4DR2L 4LF7L 3J80i 1LLRD 3DHQA 4C2MB 4ZLTF 3MAQA 1EQTA 1EU3A 4A76A 2RHSB 1U4PA 1PTOH 1G6PA 1DJRD 5C3EG 5E1FA 1GUSA 3G6EA 3CPWA 5I4DA 3P20A 3GV3A 1YNJC 4RWSC 1KDAA 1N34L 3OIQA 4YY3L 5A35A 1XNRL 1CHQD 3KUPA 1BBXC 3OWFA 4S3SA 4JI5L 3SK4A 2ZXOA 4UP8A 1WD0A 5T1GA 4N9PA 4JI7Q 1ENFA 4KLKA 4A3KH 1PH4A 3H3VI 4KD4A 2UUCL 1PZJD 3U9SA 2XRSD 5EKIA 3FKIG 1CKNA 3HOVH 2YTVA 5ELDA 3CU7A 4YY3Q 1CKOA 2MNAA 3K5LA 1KC8C 2BOSA 3OPOA 2JA7H 4RA8A 3PUVA 4DAPA 4G7OC 1JICA 3Q23A 3BDLA 4H44C 4IUUA 5JOBA 1EY7A 2EE1A 2SNSA 4KTAA 5DM63 3FVQA 1CTMA 4A3CH 3IL8A 4C3HG 1XPOA 1EY4A 5HY6A 1TWGH 4BBSH 4C1NK 1N32L 1XTDA 1G2TA 3VR6A 1Z7TA 2B2YA 1U0LA 2JA9A 4DGZA 2NN6H 2B63B 1MD2D 2RF4A 2JN4A 1MHWC 1VQAA 2NZOA 2NVXB 2CVRA 3OIPA 4JG2A 3CRKC 4UAIA 4POFA 3J80E 1A2TA 3CCQA 1N32Q 5I2XA 4AYBB 3VR3A 4LWCA 1F2YA 1SYGA 1HNXL 2J0TD 4TVAB 4HCSA 4PZ8A 4M8AA 1S5BD 1IBLL 2KHJA 1TKWB 3V2TA 1YBYA 2Q2UA 1ET9A 2MJ8A 4IFDH 2X69A 4IPDA 3H3VC 1CI3M 2ES2A 2TSSA 2B2VC 1GJXA 4OO1H 3RLOA 2IPKD 3BVGA 4O1NA 4X3KA 4C2MH 4C3IG 4LFAL 2DGYA 4YCWA 2KEDA 4LF6Q 3BZKA 1WYDA 3J7AV 1CK1A 4B9WA 1JORA 3PUWA 1PFMA 2L5TA 3MXGA 3UDFA 3H0GH 4KJOA 2NTTA 1PRTC 4ME5A 1D8LA 2FJ2A 2MQHA 1V9PA 3GTLB 1C8CA 3S15B 4B3MQ 4X64Q 5C4JB 3K0YA 5TSSA 4HTHA 4EQ5A 5I2YA 2F0QA 3EVQA 4MZ9A 3Q6SA 4HR7B 4B3RL 5JJZA 3TSSA 1K0RA 2IHEA 4ZAIA 5ELCA 1ENAA 1EWHA 4FXKC 1S5CD 2JXMB 4C56C 2CKZB 5JEAG 4X66L 3MVVA 1F9RA 1TWFH 3RZDH 1LM0A 2VL6A 4L6TB 2B2UA 4CKEA 4GKKQ 4X3SA 3T4AC 4PZ6A 5M5XB 1IL2A 5ELBA 1BDOA 1NJIC 4NXMQ 1F2ZA 1HR0Q 1QWYA 1ONLA 1KD1C 5IYDG 3K8AA 4HMIA 5C3EB 1Z6HA 3PIOA 5IYCG 1Q1BA 1LV9A 2E2IH 2VY3A 5C0XH 3FKIH 1JWUD 1WD1A 3F2DA 1GHKA 1NR2A 3OTOL 1R9TH 1IHZA 5C4ZA 4IFDG 5M5WB 1UNSA 2K5VA 3QR8A 4LNQA 1I94Q 5JJIA 1LTBD 1FL0A 5M5WH 4DV4L 2R7FA 1AEXA 5FLXc 5IODA 1K9MC 1PHJA 2CQAA 2D9UA 4I65A 4K14A 5C44G 4NW2A 2CW0D 2AUJD 2OTJA 3F1ZA 4JOIC 1PVOA 3S14B 2R7ZG 2JA6H 2KENA 3HP3A 3CRLC 1X6OA 1JQYD 2VS1A 3EFXD 4YHHL 1IYVA 3S1NH 1R9TB 3HKZG 1JJGA 1H9RA 2RSOA 4NDXA 1UE1A 5C3WA 4APVA 4DV0Q 4C3HB 1YZ6A 4CDFC 2QCPX 5LHY1 3HOZG 1H9SB 1ZYRC 5CYUA 3A7LA 5EBDA 1WI5A 3HOXG 3BG3A 1SMYC 2CW0C 3UDXA 1SR3A 1XPUA 1ICWA 1K0SA 4GLVB 4FO2A 1FYCA 1CSPA 1GHJA 1X3FA 2F3VA 3HKSA 2B63G 2F0WA 3SEBA 3HOYB 2PQAB 5IYBG 2NZ1D 2QGQA 5A2QL 3KBGA 4JI5Q 1Z9FA 1TWAB 3KLSX 2VUMH 1UEBA 4K5VA 1VDZA 2A69D 2R6GA 3BDOA 4WORA 5DAUA 2A1AA 5J1ZA 1SDFA 3K58A 2YYZA 4LUZA 2A8VA 2L0CA 4TSSA 3W1GA 4DV6Q 4GNXC 4QF4A 4KI0A 2L9HA 4WJ3M 3FEWX 3T53B 1E22A 4C3IB 3N6RA 2E2JH 1B53A 1XXGA 3CCUA 4ZQ3A 3P1HA 3I8ZA 1GVPA 3GTKB 3K5NA 1PA6A 3M4QA 5FO8B 2VB2X 5IP7H 4XTCS 5FKAC 3U58A 1F9PA 3E9IA 1X3EA 3BZCA 1PH1A 1CA5A 1YVCA 2LFNA 3J7YW 3RD4A 4DUZL 1EIGA 1VQPA 2WAQG 4A93B 2K03A 2L1BA 1UE5A 2RHQB 4LK1C 4DAYB 2L11A 1ZXTA 2E2DC 1SNPA 1A62A 2ATWA 1MBYA 1WTXA 1PH2A 4JK1C 2VB3X 5J3BA 1M8AA 1L1OA 1PTOD 1T9HA 3OMCA 1MSHA 3CAMA 1BKBA 2NTSA 4JI0Q 1D2BA 3J81L 4J1MA 2WFWA 2NN6I 2JA6G 4RKBA 2R61A 2HHHQ 4PQXA 1BCPB 1OXVA 4G4KA 2EYJA 4NKLA 4UP7A 4JC0A 1O80A 2ENBA 1N36L 3DWPA 4QMGA 3GD7A 3IAYA 2XWJB 4DV6L 3Q22A 1WFQA 4FVMA 4FNFA 3EBEA 4A3JG 4IUVA 1F2MA 1NNXA 2F1MA 4JPBW 3ONAB 3SGIA 1G91A 4BWGB 1PFNA 4GLAC 4YWLA 1VQ7A 2EJMA 4BY7B 1PYSB 2WP8J 4PG3A 3CC4A 1X3GA 1H95A 1YIJA 1QOHA 4CDCC 3SHLA 2Q8IB 4RGOS 4B08A 2RDGA 3TEHB 5FLXE 4C3JH 2VUMB 3H6MA 3SE0A 5C3EH 1SFOB 3H91A 3CCJA 4CJ2C 5IE8A 4JI2L 1B70B 3T51B 3AQQA 1HA6A 2Y0SB 3K5OA 2DUDA 3L2PA 5DM73 1N33L 2WKCA 2EYMA 1BCPD 4K6DA 2F3WA 1EEID 1KRTA 5IT9L 5IWAL 4BXXH 4P74A 1EZ8A 1B9MA 4JI0L 4A3DG 1AE3A 2A6HD 1HZAA 4RCNA 2NVYB 3CKIB 4NPSA 4DR6L 4NXNQ 3NTKA 2F0PA 1LTTD 1X65A 4DV5L 4PZ7A 3HOWG 2PZUA 1BBUA 5C4XH 1IXRA 2GVAA 5DEHA 5EJWA 3UE0A 3S9WA 1WTRA 3M7NA 2G5DA 1VQ6A 2NB0A 1I50H 1JE4A 1N9WA 1R4QB 3A7AB 4DR4L 4DXGA 2EXZA 4F87A 4PMCA 4KHPQ 1D7QA 5LMNW 1TS4A 2O5IC 5E3FA 3X3NA 4LFBL 1CFMA 3HOZH 1A15A 4R4QA 4IN3A 3WOFA 2RSNA 2HDMA 1FR3A 1SAPA 1HPCA 3B6YA 1L0YB 4DR3L 3V05A 3NPPA 2YU9H 1GUOA 4GOPC 4IZ8A 1SMXA 2B29A 3Q0AA 5LMNL 5D3IB 2DY8A 2EY2A 3JAML 1Q3LA 3CD6A 5M3MB 1HCZA 2EZVA 3EIVA 1RODA 5CBAE 1O78A 1N8RC 3MC0B 2DN8A 4F8MA 3CF5A 4L5SA 5BR8L 1HNXQ 1R4PB 1FVIA 1HFNA 2R93G 4Z9CB 4X66Q 3NUCA 1PRTD 3JAMi 4BY1B 2DJGC 2JA8H 1RIPA 4X65Q 2PMZE 2EQSA 4RGTA 3E0JA 3I91A 3PMFA 4ZRZA 1KTKA 1QG7A 4A4IA 1S40A 5K36G 2LMCB 4X6AH 4A3BH 4JOIA 2B2TA 3E5SA 4GOPB 5EPLA 5IIFA 2BDOA 1EIFA 3IKJA 1CHPD 4K5XA 3OMGA 2E2JB 2KJXA 2K52A 1XPRA 3J80c 3HOUB 5IYCH 1J8IA 1ZEQX 3RNUA 1ENCA 4NXML 1LTRD 1SRUA 1CZWA 1K83H 4DR2Q 1EWCA 3FRPB 3GP7A 4Y7NH 4HJ7A 4YCVA 2E74C 4XQJA 3MXNB 5K36H 1PRTB 3PO3B 3E6ZX 1NMFA 3J81i 2BH8A 4LUOA 5E4XA 1E1OA 1WJJA 4P71A 4A3FH 3TS0A 1RCVD 2QDLA 3KLSA 1V1OA 1SYDA 1Y8NB 1E3PA 5FJ8G 1SEBD 4A3BB 4KV6A 2EXDA 1ASZA 2Z1CA 2OEOA 2Z4HA 3PUXA 1Y69U 2K28A 1E0BA 1VF7A 2C35B 2B3GA 1Q81C 2UU9L 3TRZA 1CA6A 4A3DH 5CV8A 4BY7G 4DV0L 4A3KG 2AWNA 3S24A 1LTSD 3DM3A 1VS0A 1GUGA 1WTOA 3AU7A 1QNKA 2BE5C 3DWAA 1JT8A 3QJYA 2AKWB 2Z0SA 3DEOA 4ZUIA 3K57A 3T13A 3NHHA 4FXDA 5IGGA 2HD3A 3ICEA 3UDIA 1HUMA 1PFSA 1HNWL 3TP8A 4J15A 1Q8KA 1GM5A 4O2DA 2I5HA 4DV1L 3NBHB 3AEVA 2YTYA 5GAGC 1C9OA 1X3QA 1MIUA 4DV2L 1IBML 1ILQA 4AYBE 2L55A 2IY5B 4B3SL 4JI8Q 1VQNA 4A3DB 1SYEA 1UEAB 4RFBA 3STBC 3S17B 4DR4Q 3PGZA 5ELFA 2PMZB 4YWKA 1I3QH 3M4OH 3TP5A 2JQOA 2KEEA 5C44B 1RL2A 2F0VA 1I4QA 2RKSA 3G6JB 3VDYA 5EKLA 1DONA 4HN7A 5AFWA 1PTOF 2EYFA 4FF4A 3S1QH 4NB3A 3UDGA 1QCBD 1M4VA 4DFAA 3J81E 1F9SA 3U50C 3W3AA 1FGBD 2WINB 2XWBB 2ZTEA 4OHJA 4AYBG 4OX9L 1PRTF 3GV6A 2SDFA 2SNMA 1LTAD 2HHHL 2JA5H 3S2DH 5BN5A 4RKLA 1EU4A 4P75A 4RCOA 3PIO3 2J4XA 3HOXB 1II3A 2PNHA 1I3QB 4G7HC 3M4OB 1WTQA 5C5LA 1MKHA 5JJLA 4O42A 3W5OA 1ICFB 3NXWA 3URYA 2H4OA 1RD9D 4XQQA 3R8BA 1SNCA 4JI4L 3QIAA 1VQ5A 3EQLC 2KVMA 5ELOA 1EYDA 1TVXA 1WCMB 1HQRD 4XYQA 1AZPA 3GTMH 4A3LG 5L37A 1WCMH 5CV7A 2NUCA 3G48A 2ZJPA 3FP9A 3K7AB 1VQCA 4LF8Q 1UE7A 3F2BA 1W3SA 2UXCQ 3PO2G 5CC4A 2F3IA 2EYOA 5FO9B 4JBMA 1IZ6A 1EEFD 1IYUA 3MTSA 1MI2A 3HOUG 1U4LA 4P72A 5JEAH 5KGUA 3U4VA 3JAME 4DV3Q 1Y1VB 1AW7A 1JJ2A 3S2HB 5M9OA 3TREA 4LFCQ 4DK0A 1DCZA 1LTLA 3I2ZA 2O2LD 2MPMA 2F0OA 2AMCB 1JJCB 3J81j 2RQXA 3M4PA 2KCTA 3C2PA 2LS01 2Q2IA 1SXTA 2ZM6Q 1Q7YC 3S16B 4KY6A 3K81C 1J6QA 5HGQA 2R93H 1GOZA 1I6HB 2F0TA 4V0BA 1XMOQ 3H0GG 2VXWA 2E2HH 4OO1I 3TDQA 2N3SA 1Q82C 4KJNA 1E1TA 3TS2A 3NE5B 2R7DA 1TR5A 3MXUA 3ULJA 1PTOB 5LMNQ 3ZJYC 5JAVA 4HIOA 3FMCA 2F4VQ 1QILA 2WACA 3DEPA 5EQ0A 3N52A 3H15A 1QVCA 3A0JA 3CCEA 4ID6A 2EJFC 1W6KA 3A8JE 4XT3B 4KKSA 4F7XA 1QNUA 1C7YA 4PMBA 3HGBA 3IRBA 1S3OA 2M00A 1XMOL 1G8ZD 3LGJA 3CPFA 5M5YH 1V43A 1Q12A 5C4XG 2K5DA 1HQMC 1JR0D 4J6HA 4A3JH 2GVBA 3GTPH 4DK1A 3TN2A 2KCNA 1T5XD 5E4WC 4DV7L 2ZTCA 1YHAA 3A55A 2ZM6L 4ILWA 1AP0A 2LSSA 3BU2A 5CV6A 4DR6Q 1STEA 5G3LF 4RG1A 1BQQT 1ESFA 1SE4A 1SNQA 3BYYB 1TWAH 4IURA 3A5UA 3FHWA 3HOYH 1SJED 1PV4A 2XVSA 4JBJA 2PI2E 4KN7C 2I5LX 3RN2A 1VQGA 2K5WA 2IJ0A 1I50B 2I0QA 1D1KA 4K5WA 5C44H 2E75C 3L7ZC 3H3VH 1HNZQ 1KDBA 2JA8G 4WRDA 1WVLA 3GTQH 5CR3A 5HURA 1HNWQ 1EY8A 3I7FA 3KDFB 1SSOA 5C6AA 1QJOA 4HJ5A 1NY4A 3K7UC 3KYHC 1VQHA 1C4QA 1LT4D 1EYAA 5C5MA 1K73C 1KXLA 4IUQA 4MTNA 4DUZQ 1TWHB 3PO2H 2JYOA 1Y1WG 2ZJRA 3RZOH 1X55A 1D5XC 3EN2A 3H09A 3KF6B 4N9TA 4LF5Q 1H9MA 2EYLA 3M7GA 5K5PA 3Q8DA 3F2UA 4KK7A 4G7ZC 5J39A 4GN4B 2BE5D 3A8KE 4ZCKA 5NUCA 4WFN3 2ALYB 1ILPA 3TP7A 2ASBA 1K8GA 1J9OA 3L3OC 3OYYA 3AB9A 2R93B 1HXYD 3J80L 4X62L 1Y1VG 2L15A 1B8AA 3TQYA 5FK9C 4DR1L 2I46A 2F0IA 4NMZA 3QOJA 4CKBA 4Y52H 2OCEA 1ZKOA 2EYPA 3MFYA 4MNOA 4B3TL 4A3IB 1DZ1A 2ZXPA 2FHTA 4GZYC 2CFMA 2WB1E 4CGYB 3NTHA 1MJCA 5JEAJ 1HZBA 3CCSA 4RH6A 1HJPA 1SYFA 3P75A 1Q1EA 3CC2A 1K83B 2Q2HA 4ME3A 1EY5A 1WTVA 2QA4A 1IBKQ 2F0FA 3RMHA 3VR5A 4ZKCB 3C3LA 3I4LA 3H0GB 4N8FA 4YCUA 4JI3L 1FGUA 3KF6A 1V8QA 5COYA 3PO3G 4CBVA 3T1HQ 1RTOA 2R92B 3J7AF 4C3JG 5CORA 4K8IA 1AH9A 1GD7A 4HEDA 3CW2C 3R93A 4JI6Q 2UUAL 4ALPA 1U9RA 1I4RA 3BJUA 2JEAI 2E2IB 3CCLA 1YHBA 3VYRA 2K32A 4DR5L 2B2WC 1D6EC 1NSNS 2JJQA 2VQEQ 4DV7Q 2CWPA 3KJPA 3GTJB 2VQFQ 1GO3E 4QGUA 2MFIA 1PDQA 2H1EA 1EY0A 4RGNA 5EBCA 2IWHA 1VQ4A 3E0EA 4L63B 2K04A 4A3MH 5AJ3L 2ZJQA 1VQ9A 4DN4M 3DMUA 3HEJA 5C4XB 1I5FA 1JOQA 2R92H 1Y1WH 4A75A 1H9SA 2M9VA 2AQ1B 3K5MA 3VR4A 5IT9E 1TWGB 1EZ6A 1CQFA 3AFPA 4BBSB 2R7ZB 1WOCA 2HCIA 1S5DD 3E3XA 2XGTA 1EL0A 1P8LA 3PIP3 3V96A 3A74A 3LNNA 1EY6A 1L1OC 5KYLA 2MHVA 2Z8LA 3GQBA 4A3GB 5KIXA 2VW9A 4UPAA 4HCEA 5FOBB 1GXDC 4JI8L 5CMDA 2PYKA 5M5YB 4KHVA 3E9HA 1EUJA 4JI1L 4K0KL 2MO1A 1WTWA 3HOZB 1D5ZC 1KQSA 3S1QB 4KHPL 4IUTA 4R1JA 3U9OA 2B8FA 2NYZD 1LYLA 3CC7A 3D8GA 1EIYB 3BYTB 5I6WA 1I4GA 3FPPA 3HOYG 2PZTA 1PH9A 5DNFA 3MFGA 1NCVA 5IOCA 4H0LC 1NE3A 4GS3A 1IBLQ 3S1NB 1VMPA 4BY1H 1F2LA 4HJ8A 2QEJC 1SFOH 4IFDI 1B9NA 2NBFA 4TKOB 1NUCA 4JYAL 4YHHQ 1E24A 3DXJC 2UXDL 4FF3A 1LACA 2A74C 1NAPA 4DV1Q 4RAUC 2RDFA 2K14A 4DR7L 5I9PA 4JI2Q 2BCOA 2TMPA 4R4IA 3I4NB 3HRZC 4O0AA 1PXUA 3D4DA 1BVSA 5KNCA 2KECA 1KLGD 5FJ8H 2RA4A 4HJAA 5AJ3Q 4DV4Q 4BBRG 3LWEA 3K7AH 3PCOB 1RTNA 2MGSA 2ICIA 2Z6BA 3DWQA 3ND9A 4L8JA 4QL5A 1SYCA 2WAQB 5I6YA 4A93G 4OELB 4A3FG 4A3IG 3F8TA 1TWFB 3RZDB 3ND8A 5M3FB 4IPGA 4R8IA 1P16A 4QUCA 1YJNA 2E76C 1E2ZA 1SLJA 2UUAQ 3SR1A 4A3BG 4FDBA 3LWUA 4QY7A 3GTKH 2BA0A 2WIIB 1E7ZA 2CH4W 2VNUD 2HDLA 2K01A 1A8VA 4RHRA
chains in the Genus database with same CATH topology
5IT9c 4X66L 2ZTEA 4AYBG 4OX9L 1XJVA 1V1QA 1TWFH 3RZDH 2UUBQ 4A3MG 1LM0A 1AE2A 2VL6A 4POGA 2F52A 2HHHL 2JA5H 4GKKQ 4DV2Q 3S2DH 4PZ6A 1IL2A 2R92G 4P75A 1N34Q 2WAQE 4R4OA 4BA2I 1NJIC 4NXMQ 1HR0Q 4DKAC 1KD1C 5IYDG 2PNHA 4OWXB 4DAMA 5M3MH 1VQMA 4IJHA 4L5RC 3K8AA 3CCVA 1L0WA 4DR3Q 2UXDQ 1FJGQ 1U5KA 2JE6I 1MKHA 1VQDA 3PIOA 1VQJA 5IYCG 5JJLA 2A19A 1Z47A 1Q1BA 4A3IH 2E2IH 1KRSA 3W5OA 2VY3A 5EAYA 1EFWA 4LF4L 3FKIH 4P73A 3F2DA 2K50A 1PH3A 4JI4L 4NXNL 3DLLA 3OTOL 3KDFA 1R9TH 1VQ5A 4IFDG 5ELOA 4JV5Q 2K5VA 2E5LQ 4HIDA 4LNQA 3STBD 1I94Q 5JJIA 3ULLA 1KAWA 1FL0A 5M5WH 3GTMH 4DV4L 4A3LG 2R7FA 4BY1G 1G51A 1WCMH 3M3YH 4A3LH 3G48A 5FLXc 2ZJPA 1K9MC 1PHJA 1IBMQ 3FP9A 4GNXA 2PI2A 1VQLA 1EQRA 1VQCA 2BA1A 2AHOB 4LF8Q 5C44G 3I4OA 1PH5A 1UE7A 3F2BA 2OTJA 2K5HA 1W3SA 3F1ZA 3GDEA 4JOIC 3PO2G 2UXCQ 2Y0SG 1N36Q 2F3IA 1QVGA 4JBMA 1PVOA 1IZ6A 1YJWA 2R7ZG 2JA6H 2KENA 1VQBA 1GKHA 3PF5A 1VQOA 4JI6L 3HOUG 1JMCA 4DK6C 4P72A 4BY7H 1X54A 2V1CC 1HZ9A 3ULPA 1X6OA 3T1YL 4GN5A 1XMQQ 3U4VA 2KHIA 2VS1A 2BH2A 3M9BA 4YHHL 4DV3Q 1JJ2A 3TREA 4LFCQ 2KCMA 3S1NH 5FLMH 2IHFA 3HKZG 1LTLA 2NVYH 1JJGA 3I2ZA 3T1HL 1TXYA 5IWAQ 1UWVA 3CCMA 1UE1A 4DV0Q 4APVA 4QQBX 2AMCB 3HOWH 1JJCB 2NN6G 1PYBA 2JK8A 3J81j 1NMGA 1YZ6A 3RN5A 1Q86C 3HOZG 3PO3H 1S72A 4JI3Q 4BXXG 3M4PA 4A3CG 2KCTA 5GAEC 2K75A 2Q2IA 4HIMA 2ZM6Q 4AQYQ 1Q7YC 2OWOA 1WI5A 3K81C 4IO9A 4A3EH 3HOXG 4A93H 1J6QA 4LW1A 5HGQA 5DLQE 3J7ZC 3UDXA 5M3FH 2R93H 1SR3A 1XPUA 3CCRA 4GLVB 2B63G 1X3FA 1CSPA 3HKSA 1JE5A 4LF5L 5GADC 2LXJA 4A3GH 2PQAB 5IYBG 1XMOQ 2QGQA 3H0GG 2E2HH 4DV5Q 2IT1A 4UP9A 4JI5Q 2AWOA 4OO1I 1Z9FA 4JI1Q 5BR8Q 2R7ZH 2VUMH 2N3SA 1UEBA 3A5ZB 1XNRQ 4C3IH 3CMAA 1Q82C 1QZGA 4KHZA 1B7YB 1WCMG 1E1TA 4HIKA 3TS2A 2R7DA 2R6GA 4DUYQ 2A1AA 3ULJA 5LMNQ 3ZJYC 4HIOA 2YYZA 4LUZA 1YHQA 2IX1A 2A8VA 4XIGS 2D0OA 1A0IA 1N33Q 2F4VQ 2MO0A 3AFQA 3W1GA 4DV6Q 4GNXC 3D0FA 1KHIA 4AIMA 5C4JH 1XNQL 1SROA 4KI0A 4WJ3M 3H15A 1YITA 1QVCA 2FXQA 3A0JA 1E22A 3CCEA 1C0AA 5M3MG 4LF8L 4RMFA 4OXPA 2E2JH 1NBWA 3CCUA 1OXSC 4GKKL 2UXBL 4H02A 1C7YA 1GVPA 1PA6A 2N49A 5ELNA 3M4QA 3IRBA 2IX0A 3G4SA 5IP7H 4XTCS 3U58A 1S3OA 3E9IA 1X3EA 3BZCA 4JI7L 1XMOL 3LGJA 1PH1A 3CPFA 1YVCA 4R4TA 1I94L 5M5YH 1V43A 1Q12A 1PH7A 3NELA 5C4XG 3I55A 4DUZL 1VQPA 2Q2TA 4A3JH 2VUMG 2GVBA 2WAQG 3GTPH 3PIPA 1KIXA 1W2BA 1UE5A 3GTLH 2RHQB 4DV7L 1PH6A 2ZTCA 2NVXH 1X56A 5LMUQ 1YHAA 1J5EQ 3M85A 2ZM6L 4AQYL 4DAYB 4DR5Q 1XNQQ 3CXCA 1A62A 2ATWA 2LSSA 3BU2A 4B3ML 4IOAA 4DR6Q 3RLNA 1PH2A 4RG1A 5J3BA 1VQIA 4QJFA 1TWAH 3A5UA 1L1OA 3FHWA 1T9HA 5IP9G 4DR7L 3CAMA 3HOYH 3I4MH 4GKJQ 1BKBA 2YTXA 1O7IA 1PV4A 4IPCA 3RLFA 4JBJA 4OONA 4JI0Q 4X62Q 2WFWA 4IPHA 2NN6I 1Y14B 2PI2E 3JC66 2I5LX 3WWVA 1VQGA 3RN2A 1YJ9A 2JA6G 2HHHQ 5JJKA 3U4ZA 3HOXH 3PF4A 1VQ8A 4TQUS 4LFBQ 1OXVA 4UP7A 4LF6L 4JC0A 4OX9Q 2I0QA 3NENA 2NVQH 4JCVE 2B63H 5C44H 1QVFA 1N36L 3L7ZC 3H3VH 2KBNA 2VZAA 3ER0A 3PUZA 1HNZQ 1EWIA 2JA8G 1Q46A 3GD7A 2YV5A 3GTQH 1HNWQ 4LUVA 4DV6L 3I7FA 1WFQA 3KDFB 3EBEA 2K4KA 4A3JG 2Y0SE 1NY4A 3K7UC 5GAHC 4HJ5A 2N78A 3KYHC 3SGIA 3S1RH 2GN5A 1VQHA 1J5EL 2JA7G 4OO1G 1TWCH 4GLAC 4YWLA 1K73C 1KXLA 5FLMG 1VCIA 4MTNA 2CQOA 3KJOA 4IOCA 1VQ7A 4DUZQ 4JV5L 3HKZE 2JEBI 3PO2H 1PYSB 2WP8J 4PG3A 3CC4A 5E7NA 1Y1WG 4L5QA 2ZJRA 1X3GA 4JI4Q 3RZOH 1YIJA 1H95A 1X55A 3EN2A 1M1KC 3S1MH 3KF6B 3I56A 4WJ4A 1HR0W 4LF5Q 1XMQL 3TEHB 2HIVA 1L2FA 4C3JH 1EOVA 5C3EH 3PUYA 4IFDJ 3CCJA 3NEMA 5IE8A 1M90C 2XTIA 2Z6KC 2HT1A 4LFAQ 4JI2L 1B70B 3Q8DA 5GQOA 1CSQA 3AQQA 4GN4B 3GTOH 2DUDA 1HH2P 3L2PA 2ALYB 4HJ9A 2ASBA 1K8GA 4OWTB 1N33L 2F4VL 3I4MG 2Z6KA 3K80C 5H1SE 2CCZA 2UUBL 1KRTA 1L1OB 3OYYA 1UE6A 5IWAL 4BXXH 1CKMA 4P74A 1Y1VG 2L15A 4X62L 5C0XI 1B8AA 3TQYA 4YWMA 4LFCL 4GLXA 4JI0L 4DR1L 1AE3A 4DK3C 4UY8C 4A3DG 2I5MX 1HZAA 4Y52H 1SE8A 2OCEA 2E5LL 2NVTH 1DGSA 4NPSA 1HZCA 1BBWA 4NXNQ 3G71A 4MNOA 4B3TL 4DR6L 2JA5G 1X65A 4DV5L 4JYAQ 1EYGA 2CFMA 2WB1E 4PZ7A 1I6HH 1PH8A 3HOWG 4DNIA 2H5XA 1BBUA 5C4XH 1IXRA 1MJCA 2GVAA 1HZBA 3K0XA 5JEAJ 3UE0A 1KL9A 3CCSA 3J7A5 1A63A 3M7NA 1VQ6A 2D62A 1HJPA 1OTCA 4X64L 3S17H 1I50H 1Q1EA 3CC2A 4BBRH 1N9WA 1SN8A 4BBSG 2ID0A 4JBWA 3S15H 4DR4L 2Q2HA 4ME3A 4QIWE 2QA4A 4GN3B 3J81c 1IBKQ 2UUCQ 3S16H 1D7QA 4KHPQ 5LMNW 4YCUA 2D0PA 4JI3L 4DPGA 1FGUA 3CQZH 3KF6A 3HOVG 4LFBL 2UXBQ 3PO3G 3D31A 3HOZH 3PV0A 3OTOQ 5IP9H 3T1HQ 4R4QA 1QUQA 3UE1A 4DR2L 1LUZA 4LF7L 2WB1G 1Y1VH 3J80i 4DV3L 2HQLA 1AH9A 1GD7A 1NTGA 4A76A 3S14H 2RHSB 4BA1I 1G6PA 5IY0A 1X9NA 5GROA 3CW2C 4JI6Q 2HIXA 1OXUA 2UUAL 3B6YA 4ALPA 5C3EG 4DR3L 1ASYA 2JEAI 2EIFA 3BJUA 2YU9H 4GOPC 4OWWB 3G6EA 3CCLA 4R4CA 1SMXA 3CPWA 1YHBA 1HR0L 2B29A 3AYHB 5LMNL 4DR5L 1QZHA 5LMUL 4LF7Q 3L0OA 2JJQA 2VQEQ 5C0XJ 4DUYL 4DV7Q 1N34L 3CD6A 2CWPA 3KJPA 3EIVA 2VQFQ 4YY3L 1GO3E 4QGUA 3JAMc 4GOPA 1XNRL 1N8RC 2N8NA 1VQEA 2MFIA 4X65L 3CF5A 4L5SA 5BR8L 1HNXQ 4JI5L 1FVIA 2R93G 2NZHA 4UP8A 4X66Q 1G291 1VQ4A 1CKNB 4KLKA 3E0EA 4A3KH 4JI7Q 1PH4A 3JAMi 4A3MH 1VQKA 5AJ3L 3H3VI 2ZJQA 1VQ9A 2JA8H 1IBKL 1RIPA 2UUCL 1I5FA 4X65Q 2PMZE 3FKIG 2EQSA 1CKNA 1K8AC 2YTVA 4GNXB 2R92H 3HOVH 1YNXA 1Y1WH 4YY3Q 4A75A 4AH6A 4A4IA 1S40A 2VQEL 5K36G 4X6AH 1JB7A 5IYDH 4A3BH 1CKOA 4LF9L 4JOIA 2MNAA 4GOPB 1KC8C 1EIFA 3F2CA 2JA7H 3AFPA 3MEFA 1WOCA 1YEZA 3I4NG 2K52A 2XGTA 3PUVA 1XPRA 3J80c 5IYCH 1P8LA 3A74A 3RNUA 4NXML 3S2HH 1L1OC 3ERSX 1SRUA 3GO5A 4DR1Q 1K83H 4DR2Q 2VW9A 4UPAA 4Y7NH 1QUQB 4JI8L 4HJ7A 4B3SQ 4YCVA 3MXNB 3T1YQ 4A3CH 3E9HA 1XPOA 1EUJA 1NMFA 4JI1L 2MO1A 4K0KL 1MJEA 5HY6A 1TWGH 2BH8A 4LUOA 3J81i 4BBSH 1N32L 1XTDA 1KQSA 1E1OA 4KHPL 3HOUH 1WJJA 2LXKA 4P71A 5M3FG 4A3FH 4R1JA 4LF9Q 3TS0A 3I4NH 2CWAA 1LYLA 1U0LA 3CC7A 2JA9A 3OW2A 1EIYB 1CUKA 5IP7G 4JBKA 3HFZB 1E3PA 5FJ8G 1OXTA 2QEXA 2EXDA 1TWHH 3HOYG 1ASZA 2RF4A 1PH9A 3PUXA 3CMEA 1OXXK 1VQAA 2C35B 2NZOA 4PMWA 2B3GA 4JG2A 1NE3A 4GS3A 4POFA 3CCQA 1K3RA 1Q81C 1IBLQ 2UU9L 1N32Q 4B3TQ 4LWCA 3TRZA 4K0KQ 4A3DH 1HNXL 3GTJH 4BY1H 4BY7G 3KLWA 4TVAB 4DV0L 4A3KG 2AWNA 3S24A 4HJ8A 1SFOH 4PZ8A 2VQFL 4IFDI 1YI2A 1EQQA 1IBLL 2UU9Q 2KHJA 3DM3A 1VS0A 4JYAL 1YBYA 4YHHQ 1E24A 2Q2UA 1JT8A 2OQKA 2AKWB 1VQFA 3KF8B 2Z0SA 4IPDA 2K5NA 5M5XH 2ES2A 2UXDL 3ICEA 3UDIA 1PFSA 1HNWL 4J15A 4DV1Q 1Q8KA 2E8GA 4DR7Q 3RLOA 1GM5A 1HNZL 2UXCL 4O2DA 2I5HA 2K14A 4C2MH 4DV1L 3NBHB 4JI2Q 2DGYA 4LFAL 3AEVA 4R4IA 4YCWA 2YTYA 5GAGC 1C9OA 5C0XG 4LF6Q 1MIUA 4DV2L 1IBML 4O0AA 4EX5A 3BZKA 1WYDA 1BVSA 2PQAA 3KOJA 4AYBE 3PUWA 3GTGH 5FJ8H 2IY5B 4HJAA 4B3SL 4A3GG 5AJ3Q 4JI8Q 5JEAG 3UDFA 4DV4Q 4BBRG 3H0GH 1VQNA 3KFUA 4C3HH 3K7AH 2RCNA 4IJLA 3PCOB 4GKJL 3PSIA 1D8LA 2MQHA 3STBC 2OQ0A 4QL5A 3PGZA 1V9PA 4A3EG 4DR4Q 4A93G 1IYJB 4YWKA 4A3FG 4A3IG 4L5TA 1I3QH 4B3MQ 3RR5A 4X64Q 3M4OH 2JQOA 4B3RQ 1RL2A 3F8TA 4LF4Q 3CP0A 4IPGA 4EQ5A 4MZ9A 3VDYA 4B3RL 1P16A 1YJNA 5IYBH 1FJGL 1SLJA 2UUAQ 4NB3A 3UDGA 3S1QH 4A3BG 1K0RA 2ZTDA 4FDBA 4QY7A 2OTLA 2IHEA 3GTKH 2BA0A 3W1BA 1E7ZA 2VNUD 3U50C 1A8VA 2CKZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 c;  4X66 L;  2ZTE A;  4AYB G;  4OX9 L;  1XJV A;  1V1Q A;  1TWF H;  3RZD H;  2UUB Q;  4A3M G;  1LM0 A;  1AE2 A;  2VL6 A;  4POG A;  2F52 A;  2HHH L;  2JA5 H;  4GKK Q;  4DV2 Q;  3S2D H;  4PZ6 A;  1IL2 A;  2R92 G;  4P75 A;  1N34 Q;  2WAQ E;  4R4O A;  4BA2 I;  1NJI C;  4NXM Q;  1HR0 Q;  4DKA C;  1KD1 C;  5IYD G;  2PNH A;  4OWX B;  4DAM A;  5M3M H;  1VQM A;  4IJH A;  4L5R C;  3K8A A;  3CCV A;  1L0W A;  4DR3 Q;  2UXD Q;  1FJG Q;  1U5K A;  2JE6 I;  1MKH A;  1VQD A;  3PIO A;  1VQJ A;  5IYC G;  5JJL A;  2A19 A;  1Z47 A;  1Q1B A;  4A3I H;  2E2I H;  1KRS A;  3W5O A;  2VY3 A;  5EAY A;  1EFW A;  4LF4 L;  3FKI H;  4P73 A;  3F2D A;  2K50 A;  1PH3 A;  4JI4 L;  4NXN L;  3DLL A;  3OTO L;  3KDF A;  1R9T H;  1VQ5 A;  4IFD G;  5ELO A;  4JV5 Q;  2K5V A;  2E5L Q;  4HID A;  4LNQ A;  3STB D;  1I94 Q;  5JJI A;  3ULL A;  1KAW A;  1FL0 A;  5M5W H;  3GTM H;  4DV4 L;  4A3L G;  2R7F A;  4BY1 G;  1G51 A;  1WCM H;  3M3Y H;  4A3L H;  3G48 A;  5FLX c;  2ZJP A;  1K9M C;  1PHJ A;  1IBM Q;  3FP9 A;  4GNX A;  2PI2 A;  1VQL A;  1EQR A;  1VQC A;  2BA1 A;  2AHO B;  4LF8 Q;  5C44 G;  3I4O A;  1PH5 A;  1UE7 A;  3F2B A;  2OTJ A;  2K5H A;  1W3S A;  3F1Z A;  3GDE A;  4JOI C;  3PO2 G;  2UXC Q;  2Y0S G;  1N36 Q;  2F3I A;  1QVG A;  4JBM A;  1PVO A;  1IZ6 A;  1YJW A;  2R7Z G;  2JA6 H;  2KEN A;  1VQB A;  1GKH A;  3PF5 A;  1VQO A;  4JI6 L;  3HOU G;  1JMC A;  4DK6 C;  4P72 A;  4BY7 H;  1X54 A;  2V1C C;  1HZ9 A;  3ULP A;  1X6O A;  3T1Y L;  4GN5 A;  1XMQ Q;  3U4V A;  2KHI A;  2VS1 A;  2BH2 A;  3M9B A;  4YHH L;  4DV3 Q;  1JJ2 A;  3TRE A;  4LFC Q;  2KCM A;  3S1N H;  5FLM H;  2IHF A;  3HKZ G;  1LTL A;  2NVY H;  1JJG A;  3I2Z A;  3T1H L;  1TXY A;  5IWA Q;  1UWV A;  3CCM A;  1UE1 A;  4DV0 Q;  4APV A;  4QQB X;  2AMC B;  3HOW H;  1JJC B;  2NN6 G;  1PYB A;  2JK8 A;  3J81 j;  1NMG A;  1YZ6 A;  3RN5 A;  1Q86 C;  3HOZ G;  3PO3 H;  1S72 A;  4JI3 Q;  4BXX G;  3M4P A;  4A3C G;  2KCT A;  5GAE C;  2K75 A;  2Q2I A;  4HIM A;  2ZM6 Q;  4AQY Q;  1Q7Y C;  2OWO A;  1WI5 A;  3K81 C;  4IO9 A;  4A3E H;  3HOX G;  4A93 H;  1J6Q A;  4LW1 A;  5HGQ A;  5DLQ E;  3J7Z C;  3UDX A;  5M3F H;  2R93 H;  1SR3 A;  1XPU A;  3CCR A;  4GLV B;  2B63 G;  1X3F A;  1CSP A;  3HKS A;  1JE5 A;  4LF5 L;  5GAD C;  2LXJ A;  4A3G H;  2PQA B;  5IYB G;  1XMO Q;  2QGQ A;  3H0G G;  2E2H H;  4DV5 Q;  2IT1 A;  4UP9 A;  4JI5 Q;  2AWO A;  4OO1 I;  1Z9F A;  4JI1 Q;  5BR8 Q;  2R7Z H;  2VUM H;  2N3S A;  1UEB A;  3A5Z B;  1XNR Q;  4C3I H;  3CMA A;  1Q82 C;  1QZG A;  4KHZ A;  1B7Y B;  1WCM G;  1E1T A;  4HIK A;  3TS2 A;  2R7D A;  2R6G A;  4DUY Q;  2A1A A;  3ULJ A;  5LMN Q;  3ZJY C;  4HIO A;  2YYZ A;  4LUZ A;  1YHQ A;  2IX1 A;  2A8V A;  4XIG S;  2D0O A;  1A0I A;  1N33 Q;  2F4V Q;  2MO0 A;  3AFQ A;  3W1G A;  4DV6 Q;  4GNX C;  3D0F A;  1KHI A;  4AIM A;  5C4J H;  1XNQ L;  1SRO A;  4KI0 A;  4WJ3 M;  3H15 A;  1YIT A;  1QVC A;  2FXQ A;  3A0J A;  1E22 A;  3CCE A;  1C0A A;  5M3M G;  4LF8 L;  4RMF A;  4OXP A;  2E2J H;  1NBW A;  3CCU A;  1OXS C;  4GKK L;  2UXB L;  4H02 A;  1C7Y A;  1GVP A;  1PA6 A;  2N49 A;  5ELN A;  3M4Q A;  3IRB A;  2IX0 A;  3G4S A;  5IP7 H;  4XTC S;  3U58 A;  1S3O A;  3E9I A;  1X3E A;  3BZC A;  4JI7 L;  1XMO L;  3LGJ A;  1PH1 A;  3CPF A;  1YVC A;  4R4T A;  1I94 L;  5M5Y H;  1V43 A;  1Q12 A;  1PH7 A;  3NEL A;  5C4X G;  3I55 A;  4DUZ L;  1VQP A;  2Q2T A;  4A3J H;  2VUM G;  2GVB A;  2WAQ G;  3GTP H;  3PIP A;  1KIX A;  1W2B A;  1UE5 A;  3GTL H;  2RHQ B;  4DV7 L;  1PH6 A;  2ZTC A;  2NVX H;  1X56 A;  5LMU Q;  1YHA A;  1J5E Q;  3M85 A;  2ZM6 L;  4AQY L;  4DAY B;  4DR5 Q;  1XNQ Q;  3CXC A;  1A62 A;  2ATW A;  2LSS A;  3BU2 A;  4B3M L;  4IOA A;  4DR6 Q;  3RLN A;  1PH2 A;  4RG1 A;  5J3B A;  1VQI A;  4QJF A;  1TWA H;  3A5U A;  1L1O A;  3FHW A;  1T9H A;  5IP9 G;  4DR7 L;  3CAM A;  3HOY H;  3I4M H;  4GKJ Q;  1BKB A;  2YTX A;  1O7I A;  1PV4 A;  4IPC A;  3RLF A;  4JBJ A;  4OON A;  4JI0 Q;  4X62 Q;  2WFW A;  4IPH A;  2NN6 I;  1Y14 B;  2PI2 E;  3JC6 6;  2I5L X;  3WWV A;  1VQG A;  3RN2 A;  1YJ9 A;  2JA6 G;  2HHH Q;  5JJK A;  3U4Z A;  3HOX H;  3PF4 A;  1VQ8 A;  4TQU S;  4LFB Q;  1OXV A;  4UP7 A;  4LF6 L;  4JC0 A;  4OX9 Q;  2I0Q A;  3NEN A;  2NVQ H;  4JCV E;  2B63 H;  5C44 H;  1QVF A;  1N36 L;  3L7Z C;  3H3V H;  2KBN A;  2VZA A;  3ER0 A;  3PUZ A;  1HNZ Q;  1EWI A;  2JA8 G;  1Q46 A;  3GD7 A;  2YV5 A;  3GTQ H;  1HNW Q;  4LUV A;  4DV6 L;  3I7F A;  1WFQ A;  3KDF B;  3EBE A;  2K4K A;  4A3J G;  2Y0S E;  1NY4 A;  3K7U C;  5GAH C;  4HJ5 A;  2N78 A;  3KYH C;  3SGI A;  3S1R H;  2GN5 A;  1VQH A;  1J5E L;  2JA7 G;  4OO1 G;  1TWC H;  4GLA C;  4YWL A;  1K73 C;  1KXL A;  5FLM G;  1VCI A;  4MTN A;  2CQO A;  3KJO A;  4IOC A;  1VQ7 A;  4DUZ Q;  4JV5 L;  3HKZ E;  2JEB I;  3PO2 H;  1PYS B;  2WP8 J;  4PG3 A;  3CC4 A;  5E7N A;  1Y1W G;  4L5Q A;  2ZJR A;  1X3G A;  4JI4 Q;  3RZO H;  1YIJ A;  1H95 A;  1X55 A;  3EN2 A;  1M1K C;  3S1M H;  3KF6 B;  3I56 A;  4WJ4 A;  1HR0 W;  4LF5 Q;  1XMQ L;  3TEH B;  2HIV A;  1L2F A;  4C3J H;  1EOV A;  5C3E H;  3PUY A;  4IFD J;  3CCJ A;  3NEM A;  5IE8 A;  1M90 C;  2XTI A;  2Z6K C;  2HT1 A;  4LFA Q;  4JI2 L;  1B70 B;  3Q8D A;  5GQO A;  1CSQ A;  3AQQ A;  4GN4 B;  3GTO H;  2DUD A;  1HH2 P;  3L2P A;  2ALY B;  4HJ9 A;  2ASB A;  1K8G A;  4OWT B;  1N33 L;  2F4V L;  3I4M G;  2Z6K A;  3K80 C;  5H1S E;  2CCZ A;  2UUB L;  1KRT A;  1L1O B;  3OYY A;  1UE6 A;  5IWA L;  4BXX H;  1CKM A;  4P74 A;  1Y1V G;  2L15 A;  4X62 L;  5C0X I;  1B8A A;  3TQY A;  4YWM A;  4LFC L;  4GLX A;  4JI0 L;  4DR1 L;  1AE3 A;  4DK3 C;  4UY8 C;  4A3D G;  2I5M X;  1HZA A;  4Y52 H;  1SE8 A;  2OCE A;  2E5L L;  2NVT H;  1DGS A;  4NPS A;  1HZC A;  1BBW A;  4NXN Q;  3G71 A;  4MNO A;  4B3T L;  4DR6 L;  2JA5 G;  1X65 A;  4DV5 L;  4JYA Q;  1EYG A;  2CFM A;  2WB1 E;  4PZ7 A;  1I6H H;  1PH8 A;  3HOW G;  4DNI A;  2H5X A;  1BBU A;  5C4X H;  1IXR A;  1MJC A;  2GVA A;  1HZB A;  3K0X A;  5JEA J;  3UE0 A;  1KL9 A;  3CCS A;  3J7A 5;  1A63 A;  3M7N A;  1VQ6 A;  2D62 A;  1HJP A;  1OTC A;  4X64 L;  3S17 H;  1I50 H;  1Q1E A;  3CC2 A;  4BBR H;  1N9W A;  1SN8 A;  4BBS G;  2ID0 A;  4JBW A;  3S15 H;  4DR4 L;  2Q2H A;  4ME3 A;  4QIW E;  2QA4 A;  4GN3 B;  3J81 c;  1IBK Q;  2UUC Q;  3S16 H;  1D7Q A;  4KHP Q;  5LMN W;  4YCU A;  2D0P A;  4JI3 L;  4DPG A;  1FGU A;  3CQZ H;  3KF6 A;  3HOV G;  4LFB L;  2UXB Q;  3PO3 G;  3D31 A;  3HOZ H;  3PV0 A;  3OTO Q;  5IP9 H;  3T1H Q;  4R4Q A;  1QUQ A;  3UE1 A;  4DR2 L;  1LUZ A;  4LF7 L;  2WB1 G;  1Y1V H;  3J80 i;  4DV3 L;  2HQL A;  1AH9 A;  1GD7 A;  1NTG A;  4A76 A;  3S14 H;  2RHS B;  4BA1 I;  1G6P A;  5IY0 A;  1X9N A;  5GRO A;  3CW2 C;  4JI6 Q;  2HIX A;  1OXU A;  2UUA L;  3B6Y A;  4ALP A;  5C3E G;  4DR3 L;  1ASY A;  2JEA I;  2EIF A;  3BJU A;  2YU9 H;  4GOP C;  4OWW B;  3G6E A;  3CCL A;  4R4C A;  1SMX A;  3CPW A;  1YHB A;  1HR0 L;  2B29 A;  3AYH B;  5LMN L;  4DR5 L;  1QZH A;  5LMU L;  4LF7 Q;  3L0O A;  2JJQ A;  2VQE Q;  5C0X J;  4DUY L;  4DV7 Q;  1N34 L;  3CD6 A;  2CWP A;  3KJP A;  3EIV A;  2VQF Q;  4YY3 L;  1GO3 E;  4QGU A;  3JAM c;  4GOP A;  1XNR L;  1N8R C;  2N8N A;  1VQE A;  2MFI A;  4X65 L;  3CF5 A;  4L5S A;  5BR8 L;  1HNX Q;  4JI5 L;  1FVI A;  2R93 G;  2NZH A;  4UP8 A;  4X66 Q;  1G29 1;  1VQ4 A;  1CKN B;  4KLK A;  3E0E A;  4A3K H;  4JI7 Q;  1PH4 A;  3JAM i;  4A3M H;  1VQK A;  5AJ3 L;  3H3V I;  2ZJQ A;  1VQ9 A;  2JA8 H;  1IBK L;  1RIP A;  2UUC L;  1I5F A;  4X65 Q;  2PMZ E;  3FKI G;  2EQS A;  1CKN A;  1K8A C;  2YTV A;  4GNX B;  2R92 H;  3HOV H;  1YNX A;  1Y1W H;  4YY3 Q;  4A75 A;  4AH6 A;  4A4I A;  1S40 A;  2VQE L;  5K36 G;  4X6A H;  1JB7 A;  5IYD H;  4A3B H;  1CKO A;  4LF9 L;  4JOI A;  2MNA A;  4GOP B;  1KC8 C;  1EIF A;  3F2C A;  2JA7 H;  3AFP A;  3MEF A;  1WOC A;  1YEZ A;  3I4N G;  2K52 A;  2XGT A;  3PUV A;  1XPR A;  3J80 c;  5IYC H;  1P8L A;  3A74 A;  3RNU A;  4NXM L;  3S2H H;  1L1O C;  3ERS X;  1SRU A;  3GO5 A;  4DR1 Q;  1K83 H;  4DR2 Q;  2VW9 A;  4UPA A;  4Y7N H;  1QUQ B;  4JI8 L;  4HJ7 A;  4B3S Q;  4YCV A;  3MXN B;  3T1Y Q;  4A3C H;  3E9H A;  1XPO A;  1EUJ A;  1NMF A;  4JI1 L;  2MO1 A;  4K0K L;  1MJE A;  5HY6 A;  1TWG H;  2BH8 A;  4LUO A;  3J81 i;  4BBS H;  1N32 L;  1XTD A;  1KQS A;  1E1O A;  4KHP L;  3HOU H;  1WJJ A;  2LXK A;  4P71 A;  5M3F G;  4A3F H;  4R1J A;  4LF9 Q;  3TS0 A;  3I4N H;  2CWA A;  1LYL A;  1U0L A;  3CC7 A;  2JA9 A;  3OW2 A;  1EIY B;  1CUK A;  5IP7 G;  4JBK A;  3HFZ B;  1E3P A;  5FJ8 G;  1OXT A;  2QEX A;  2EXD A;  1TWH H;  3HOY G;  1ASZ A;  2RF4 A;  1PH9 A;  3PUX A;  3CME A;  1OXX K;  1VQA A;  2C35 B;  2NZO A;  4PMW A;  2B3G A;  4JG2 A;  1NE3 A;  4GS3 A;  4POF A;  3CCQ A;  1K3R A;  1Q81 C;  1IBL Q;  2UU9 L;  1N32 Q;  4B3T Q;  4LWC A;  3TRZ A;  4K0K Q;  4A3D H;  1HNX L;  3GTJ H;  4BY1 H;  4BY7 G;  3KLW A;  4TVA B;  4DV0 L;  4A3K G;  2AWN A;  3S24 A;  4HJ8 A;  1SFO H;  4PZ8 A;  2VQF L;  4IFD I;  1YI2 A;  1EQQ A;  1IBL L;  2UU9 Q;  2KHJ A;  3DM3 A;  1VS0 A;  4JYA L;  1YBY A;  4YHH Q;  1E24 A;  2Q2U A;  1JT8 A;  2OQK A;  2AKW B;  1VQF A;  3KF8 B;  2Z0S A;  4IPD A;  2K5N A;  5M5X H;  2ES2 A;  2UXD L;  3ICE A;  3UDI A;  1PFS A;  1HNW L;  4J15 A;  4DV1 Q;  1Q8K A;  2E8G A;  4DR7 Q;  3RLO A;  1GM5 A;  1HNZ L;  2UXC L;  4O2D A;  2I5H A;  2K14 A;  4C2M H;  4DV1 L;  3NBH B;  4JI2 Q;  2DGY A;  4LFA L;  3AEV A;  4R4I A;  4YCW A;  2YTY A;  5GAG C;  1C9O A;  5C0X G;  4LF6 Q;  1MIU A;  4DV2 L;  1IBM L;  4O0A A;  4EX5 A;  3BZK A;  1WYD A;  1BVS A;  2PQA A;  3KOJ A;  4AYB E;  3PUW A;  3GTG H;  5FJ8 H;  2IY5 B;  4HJA A;  4B3S L;  4A3G G;  5AJ3 Q;  4JI8 Q;  5JEA G;  3UDF A;  4DV4 Q;  4BBR G;  3H0G H;  1VQN A;  3KFU A;  4C3H H;  3K7A H;  2RCN A;  4IJL A;  3PCO B;  4GKJ L;  3PSI A;  1D8L A;  2MQH A;  3STB C;  2OQ0 A;  4QL5 A;  3PGZ A;  1V9P A;  4A3E G;  4DR4 Q;  4A93 G;  1IYJ B;  4YWK A;  4A3F G;  4A3I G;  4L5T A;  1I3Q H;  4B3M Q;  3RR5 A;  4X64 Q;  3M4O H;  2JQO A;  4B3R Q;  1RL2 A;  3F8T A;  4LF4 Q;  3CP0 A;  4IPG A;  4EQ5 A;  4MZ9 A;  3VDY A;  4B3R L;  1P16 A;  1YJN A;  5IYB H;  1FJG L;  1SLJ A;  2UUA Q;  4NB3 A;  3UDG A;  3S1Q H;  4A3B G;  1K0R A;  2ZTD A;  4FDB A;  4QY7 A;  2OTL A;  2IHE A;  3GTK H;  2BA0 A;  3W1B A;  1E7Z A;  2VNU D;  3U50 C;  1A8V A;  2CKZ B; 
#chains in the Genus database with same CATH topology
 5BN4 A;  1IKM A;  1XJV A;  1GUN A;  4A3M G;  2HUG A;  4POG A;  2F52 A;  1I4P A;  1H9K A;  5ELE A;  4DV2 Q;  4KY5 A;  1EIH A;  4KKU A;  2R92 G;  2A5H A;  1N34 Q;  3GTO B;  4V19 0;  1Q90 A;  4ABN A;  2J7Z A;  4TRD A;  5M3M H;  4L5R C;  2UXD Q;  4DR3 Q;  4FF2 A;  1U5K A;  2JE6 I;  1VQD A;  1VQJ A;  2A19 A;  5A2Q E;  3PQI A;  1KRS A;  5EAY A;  2F0U A;  1PH3 A;  1EQV A;  4NXN L;  3KDF A;  4F88 A;  2DJF C;  2E5L Q;  4HID A;  1VMC A;  3MZ5 A;  3STB D;  3TBI B;  3ULL A;  2F0S A;  3Q24 A;  4BS9 A;  3QOL A;  4XT1 B;  3K6O A;  3FKI B;  1A6X A;  1IBM Q;  4GNX A;  1VQL A;  3HG9 A;  5I9O A;  1WTH A;  2BA1 A;  2AHO B;  1KDC A;  1PH5 A;  2B8G A;  2EDG A;  2Y0S G;  3KF8 A;  1N36 Q;  3LX0 A;  2RVL A;  5IGF A;  1YJW A;  1VQB A;  5EPK A;  3PF5 A;  1VQO A;  3FPU B;  4DK6 C;  4BY7 H;  3T1Y L;  4KN4 C;  1HZ9 A;  3ULP A;  1XMQ Q;  4GN5 A;  3SK5 A;  2BH2 A;  2F0G A;  4U67 3;  3M9B A;  3MA2 B;  3G7L A;  2KCM A;  4UDU C;  2IHF A;  2XIW A;  2NVY H;  1B3Q A;  3T1H L;  1TXY A;  1UWV A;  1Y8O B;  3CCM A;  3HOW H;  3RN5 A;  1PYB A;  2B2U C;  1K8M A;  1S5E D;  1S72 A;  4PNY A;  4K2L A;  5GAE C;  4A3C G;  3BDC A;  3HOW B;  1T5E A;  4FXG C;  4HIM A;  1UUP A;  2OWO A;  4A3E H;  4QCL A;  3I3C A;  4LW1 A;  4R8N A;  3J7Z C;  3NBH A;  3KK7 A;  2F4I A;  4DF7 A;  3CCR A;  2PPB C;  1EY9 A;  2PW7 A;  4LF5 L;  2LXJ A;  4A3G H;  2A6E C;  2IT1 A;  4YIJ A;  4UP9 A;  2HQE A;  2XNA C;  1BF4 A;  2KOL A;  2AWO A;  4JI1 Q;  2K7V A;  3A5Z B;  1XNR Q;  4C3I H;  3CMA A;  1QZG A;  4EQN A;  4KHZ A;  1WCM G;  1YNN C;  1AZQ A;  4DUY Q;  2WB1 B;  4OIJ A;  1YHQ A;  4J8Q A;  4H7B A;  2IX1 A;  2D0O A;  1N33 Q;  3AFQ A;  1KHI A;  3VYT A;  4AIM A;  1EFI D;  5C4J H;  1RDP D;  5KYI A;  1SRO A;  1O7Z A;  3P7J A;  4K6L A;  2FXQ A;  1C0A A;  5M3M G;  4LF8 L;  4KMU C;  4OXP A;  1A3V A;  3NSW A;  1OXS C;  2N88 A;  4GKK L;  4H02 A;  3RUZ A;  5ELN A;  3MHB A;  1TS2 A;  2IX0 A;  4JI7 L;  1PYW D;  4R4T A;  1I94 L;  2MUY A;  3NEL A;  3EA6 A;  3GTL H;  4MTK A;  2NVX H;  1X56 A;  5LMU Q;  1J5E Q;  3M85 A;  4DR5 Q;  1XNQ Q;  3A8I E;  1HFG A;  3MXN A;  2DNC A;  3D3R A;  2EVB A;  5D14 A;  2K5Q A;  4XQN A;  2I07 B;  5IP9 G;  3QG1 A;  4XYO A;  1O7I A;  1GUT A;  1STH A;  4OON A;  4RGM A;  3DUZ A;  4X62 Q;  4IPH A;  1Y14 B;  3JC6 6;  4HSV A;  3WWV A;  5JJK A;  2E2H B;  1VF5 C;  2PNR C;  3HOX H;  3PF4 A;  4LFB Q;  1G6Z A;  3MXP A;  3NWT A;  4TQU S;  5IGE A;  1ET6 A;  5D3D A;  5BN3 A;  4LF6 L;  2QKI C;  1STY A;  3NEN A;  3TP6 A;  4EQP A;  4ZK9 B;  2B63 H;  1QVF A;  2NVT B;  4HAE A;  3D6W A;  3ER0 A;  1TS5 A;  2C5C A;  4LUV A;  2QIL A;  3I70 A;  2WKD A;  2F0N A;  1NR4 A;  3S1R H;  3R2I A;  2GN5 A;  4JVZ A;  1Y8P B;  1J5E L;  1A2U A;  1TWC H;  3C1E A;  4H13 C;  1Q8I A;  1VCI A;  2CQO A;  2ICE C;  4IOC A;  4JV5 L;  5T1I A;  4A3K B;  2JEB I;  5C4H A;  5E7N A;  4L5Q A;  3GTP B;  3VR2 A;  2XN9 C;  4DAV A;  1KAB A;  1M1K C;  3S1M H;  3NQI A;  2HIV A;  4CDD C;  1EOV A;  2L4N A;  2A6E D;  3PUY A;  4IFD J;  3KLR A;  1M90 C;  2Z6K C;  4PV1 C;  2HT1 A;  1STB A;  4LFA Q;  1HUN A;  1B44 D;  1CSQ A;  1B1Z A;  2F0M A;  1HH2 P;  2CH4 A;  4HJ9 A;  2FMC A;  4OWT B;  3T56 B;  3I4M G;  1CT1 D;  1STG A;  2Z6K A;  4XDX A;  3CQZ B;  3TME A;  2UUB L;  1L1O B;  1UE6 A;  1S5F D;  1YNN D;  3SDZ A;  2BDN A;  5IYD H;  4YWM A;  4LFC L;  2O4X A;  2X6L A;  2I5M X;  1SE8 A;  4KD3 A;  2E5L L;  1JWM D;  4MIU A;  1FNU A;  1QB5 D;  2JA5 G;  1H9J A;  5FLX L;  3QWN A;  1I6H H;  1PH8 A;  4DNI A;  2H5X A;  3D6C A;  3K0X A;  1BNZ A;  2XRQ D;  1A63 A;  1DM0 B;  1KL9 A;  4X64 L;  4BBS G;  1SN8 A;  1A3T A;  2ID0 A;  4FP5 D;  4JBW A;  3S15 H;  1RKN A;  4QIW E;  4HSP A;  1QE6 A;  2UUC Q;  2G9D A;  3S16 H;  1SND A;  5FO7 B;  5JVG 3;  3WDN A;  2JA7 B;  2D0P A;  3KBX A;  1PZK D;  2LY7 A;  3CQZ H;  3HOV G;  1CQV A;  3OHX C;  1RHP A;  2A6H C;  3D31 A;  3PV0 A;  3TZD A;  5IP9 H;  4Q0F A;  5KND A;  3BVZ A;  1QUQ A;  3UE1 A;  1LUZ A;  1A3U A;  1Y1V H;  1TY2 A;  2WB1 G;  1KNA A;  2HQL A;  3NQT A;  5JVH 3;  4DV3 L;  1NTG A;  3S14 H;  4BA1 I;  5IY0 A;  1X9N A;  1F9Q A;  5GRO A;  2HIX A;  1SMY D;  1OXU A;  1TII D;  1U4M A;  1ASY A;  2EIF A;  3O13 A;  4OWW B;  4R4C A;  4NP5 A;  1HR0 L;  1ZYR D;  3AYH B;  5IGC A;  1QZH A;  2RDH A;  5LMU L;  2PCF B;  4LF7 Q;  3L0O A;  1BCP F;  4DUY L;  5C0X J;  2PO4 A;  2ZT9 C;  1RJT A;  4EQO A;  3JAM c;  4GOP A;  4OL7 A;  2N8N A;  1VQE A;  4X65 L;  1XX8 A;  2NZH A;  3SXH A;  1G29 1;  1CKN B;  2IL8 A;  1VQK A;  1STN A;  1BUV T;  1IBK L;  1YNJ D;  3HS0 C;  1K8A C;  3D4W A;  4GNX B;  1YNX A;  1TQO A;  1LTG D;  1BO0 A;  1SNO A;  4AH6 A;  1IL8 A;  2VQE L;  2HCC A;  1JB7 A;  2EY5 A;  4LF9 L;  1I4H A;  2F03 A;  4K2K A;  3F2C A;  4I7A A;  3MEF A;  1YEZ A;  3I4N G;  1V1P A;  3VYU A;  3S2H H;  5G3L D;  3ERS X;  4CHT B;  4WJW A;  3GO5 A;  5CV4 A;  4BBR B;  4OIK A;  4DR1 Q;  1QUQ B;  4B3S Q;  2JA6 B;  4XXE A;  4DU9 A;  3T1Y Q;  2D5D A;  1LO5 D;  1MJE A;  1BCP C;  3W2D A;  1UAP A;  2PW5 A;  2M2L A;  3HOU H;  2LXK A;  5M3F G;  4LF9 Q;  3I4N H;  2CWA A;  2DNE A;  2EY1 A;  1KNE A;  3OW2 A;  1CUK A;  5IP7 G;  4Y7N B;  4JBK A;  3HFZ B;  4EVO A;  5HGT A;  4A3J B;  1OXT A;  2QEX A;  1TWH H;  2ZXR A;  3CME A;  4I7Z C;  1OXX K;  4JYA Q;  4PMW A;  3I90 A;  5IGB A;  1K3R A;  2Z9H A;  4B3T Q;  4IQZ A;  4K0K Q;  3SK8 A;  3GTJ H;  4A3M B;  1JOK A;  3KLW A;  1LT6 D;  2EJG C;  3IFD A;  3R2T A;  2VQF L;  2RCF A;  1YI2 A;  1EQQ A;  3VA5 A;  2UU9 Q;  2FFK B;  2P5Z X;  2EOT A;  3ZYY X;  2OQK A;  2K33 A;  1VQF A;  3BVM A;  3KF8 B;  2K5N A;  3NWS A;  5M5X H;  3RZO B;  1TS3 A;  1AN8 A;  1W6J A;  3OWE B;  4DR7 Q;  2E8G A;  1HNZ L;  2UXC L;  2K6A A;  3VA7 A;  1FNW A;  2QW7 A;  5C0X G;  1JB3 A;  4EX5 A;  2F0J A;  1KLU D;  4UHV A;  2PQA A;  1X32 A;  3KOJ A;  5CBE E;  1DYQ A;  3GTG H;  3UI2 A;  4A3G G;  2XSC A;  1PLF A;  3KFU A;  2R3Z A;  4C3H H;  3WOE A;  1SE2 A;  2RCN A;  4IJL A;  4GKJ L;  2V4D A;  3PSI A;  4RHS A;  4IAL A;  2OQ0 A;  1IW7 D;  2F0H A;  4A3E G;  5CGK A;  1IYJ B;  2RBM A;  4L5T A;  2KCC A;  3RR5 A;  2O5J C;  4B3R Q;  1BR9 A;  2PQE A;  3CP0 A;  4LF4 Q;  4QB4 A;  1JOO A;  2MP1 A;  1DD2 A;  2F0D A;  5IYB H;  1D5M C;  1FJG L;  1B4O A;  2ZTD A;  4DNR B;  2OTL A;  2GA4 B;  3W1B A;  4CJ0 B;  1LT5 D;  1PFB A;  5IT9 c;  1V1Q A;  2K05 A;  2UUB Q;  1STA A;  1AE2 A;  2IX3 A;  2B2Y C;  5EPJ A;  1HA5 A;  4M1U B;  5F2D A;  1TU2 B;  2KA7 A;  5EGT A;  1JWS D;  1TT2 A;  2QDB A;  2WAQ E;  4R4O A;  2Q8R E;  3C46 A;  5KEE A;  1E2W A;  2JA8 B;  4BA2 I;  3NP8 A;  4DKA C;  4OWX B;  4DAM A;  1ML0 D;  1VQM A;  1B2T A;  1HRJ A;  4IJH A;  4G57 A;  3CCV A;  2G9H D;  1L0W A;  1FJG Q;  1I4X A;  3HZX A;  5ISR A;  1AFP A;  1Z47 A;  4A3I H;  1EFW A;  4LF4 L;  1MGS A;  4OEM B;  4FYD A;  4P73 A;  1HHV A;  2K50 A;  3DLL A;  3QO2 A;  2KUM A;  2A69 C;  2K1B A;  4JV5 Q;  1Y1W B;  1SNM A;  2B2V A;  4LAA A;  1KAW A;  3D4R A;  2KQ3 A;  1SJH D;  1IKL A;  4BY1 G;  1G51 A;  3M3Y H;  5LL6 X;  4A3L H;  3I73 A;  3GTQ B;  2PI2 A;  1D1I A;  3EJI A;  3MWY W;  3X3M A;  1EQR A;  4EGV A;  4IUP A;  3T16 A;  3I4O A;  2K5H A;  3I72 A;  5CV9 A;  3GDE A;  1QVG A;  1WTP A;  2JP1 A;  4CDE C;  4OGQ C;  2OXP A;  1GKH A;  3GTM B;  4JI6 L;  1JMC A;  1X54 A;  2A68 D;  2V1C C;  2SOB A;  3NK9 A;  1IW7 C;  2KHI A;  2OT2 A;  2F0E A;  5FLM H;  2FMM A;  2A68 C;  1K8O A;  2N55 A;  3A54 A;  4B9X A;  5IWA Q;  1O7L A;  1ESR A;  4QQB X;  1DOM A;  2NN6 G;  2JK8 A;  1Q86 C;  1NMG A;  3PO3 H;  4JI3 Q;  3GTG B;  4BXX G;  2K75 A;  1G2S A;  4AQY Q;  2D2C C;  4A93 H;  4IO9 A;  4U68 A;  3H94 A;  5DLQ E;  1KAA A;  5M3F H;  3NBI A;  2X6G A;  1JE5 A;  4IUN A;  5GAD C;  1HTL D;  4KKT A;  4DXF A;  1CM9 A;  4DV5 Q;  5BR8 Q;  2R7Z H;  5C3X A;  1B7Y B;  4HIK A;  3C1F A;  4C3J B;  5EKK A;  3IFT A;  1DOL A;  1L0X B;  4XIG S;  1A0I A;  1GUW A;  2MO0 A;  3D0F A;  2SEB D;  1RF2 D;  4ULL A;  2OF1 A;  4N8X 1;  1YIT A;  1DXM A;  1C48 A;  4ZUJ A;  1LT3 D;  4RMF A;  1NBW A;  2C9O A;  5JPM C;  2L12 A;  2UXB L;  3CHB D;  3A56 A;  4X3T A;  2N49 A;  2EPB A;  3G4S A;  3BZD B;  1SE3 A;  3HKZ B;  1PMR A;  2B2T C;  1LAB A;  1PH7 A;  3L9A X;  1PTO C;  4CKC A;  3I55 A;  2Q2T A;  2VUM G;  4A3E B;  3S2D B;  3PIP A;  1KIX A;  1W2B A;  4Q5V A;  1PH6 A;  1BOS A;  1XNQ L;  4AQY L;  2F0K A;  1K28 A;  3VYS A;  3CXC A;  1FNV A;  4B3M L;  1JCK B;  4IOA A;  1OO9 B;  3I4M B;  3ERO A;  3RLN A;  5D65 A;  1XYI A;  4E6I A;  2IW3 A;  5KNB A;  3AMU A;  1SYB A;  1VQI A;  4QJF A;  2FIN B;  3I4M H;  4GKJ Q;  2YTX A;  2F0L A;  4IPC A;  3RLF A;  4LMQ D;  2Z4I A;  4KY7 A;  1B50 A;  4HMJ A;  1I6V C;  1YJ9 A;  3U4Z A;  1VQ8 A;  4OX9 Q;  3M4Y A;  2JA5 B;  2AQ2 B;  2NVQ H;  4JCV E;  1TY0 A;  2KBN A;  2VZA A;  3PUZ A;  1EWI A;  1Q46 A;  2YV5 A;  2KHS A;  3SK6 A;  2B39 A;  3M3Y B;  2K4K A;  2CHB D;  2Y0S E;  5GAH C;  2N78 A;  1F77 A;  4QIW B;  1V1P B;  2JA7 G;  4OO1 G;  1DOK A;  4MN3 A;  4ZYS A;  2EY6 A;  1O7Y A;  2DY7 A;  3OSO A;  3ITP A;  4LJZ C;  5FLM G;  5CV5 A;  3KJO A;  3HOV B;  2NWG A;  3HKZ E;  1XWE A;  3QB3 A;  4JI4 Q;  1HTP A;  3I56 A;  4WJ4 A;  1HR0 W;  4X3U A;  1XMQ L;  2LKV A;  3FDT A;  2A73 B;  1L2F A;  2YU9 B;  3K59 A;  1BXT A;  3SVM A;  2NVQ B;  3NEM A;  3BS1 A;  2XTI A;  4ZKB B;  3MEH A;  5GQO A;  5KRU A;  2B2W A;  4DNT B;  3PO2 B;  3GTO H;  1S4Z A;  2F4V L;  2AUK A;  3K80 C;  5H1S E;  2CCZ A;  1K3B C;  3DM1 A;  4C1N I;  1CKM A;  5C0X I;  1MSG A;  3TZU A;  5IGD A;  4UY8 C;  4GLX A;  4P2C B;  1EYC A;  4DK3 C;  1U4R A;  4QUF A;  1B3A A;  1SBB B;  5LL6 S;  3R3O A;  2NVT H;  1DGS A;  1PZI D;  1HZC A;  4R9W A;  4FF1 A;  1BBW A;  3G71 A;  4A3F B;  1EYG A;  4DA2 A;  4DAY A;  2Q8T A;  1JC7 A;  3J7A 5;  1X3P A;  1CZG A;  2AQ3 B;  4K8J A;  3OW7 A;  2D62 A;  4MHE A;  1OTC A;  3S17 H;  4BBR H;  3NTI A;  2JSO A;  1TWC B;  3ERQ A;  2PZW A;  4GN3 B;  1FD7 D;  3J81 c;  1EOT A;  2QF7 A;  3S1R B;  4JW0 A;  4DPG A;  2WV6 D;  3OOC A;  2EYH A;  5J22 A;  5JPN C;  3S1M B;  1XTC D;  1E2V A;  2UXB Q;  3OTO Q;  4CJ1 B;  1LTI D;  4ODG A;  4DR2 L;  4LF7 L;  3J80 i;  1LLR D;  3DHQ A;  4C2M B;  4ZLT F;  3MAQ A;  1EQT A;  1EU3 A;  4A76 A;  2RHS B;  1U4P A;  1PTO H;  1G6P A;  1DJR D;  5C3E G;  5E1F A;  1GUS A;  3G6E A;  3CPW A;  5I4D A;  3P20 A;  3GV3 A;  1YNJ C;  4RWS C;  1KDA A;  1N34 L;  3OIQ A;  4YY3 L;  5A35 A;  1XNR L;  1CHQ D;  3KUP A;  1BBX C;  3OWF A;  4S3S A;  4JI5 L;  3SK4 A;  2ZXO A;  4UP8 A;  1WD0 A;  5T1G A;  4N9P A;  4JI7 Q;  1ENF A;  4KLK A;  4A3K H;  1PH4 A;  3H3V I;  4KD4 A;  2UUC L;  1PZJ D;  3U9S A;  2XRS D;  5EKI A;  3FKI G;  1CKN A;  3HOV H;  2YTV A;  5ELD A;  3CU7 A;  4YY3 Q;  1CKO A;  2MNA A;  3K5L A;  1KC8 C;  2BOS A;  3OPO A;  2JA7 H;  4RA8 A;  3PUV A;  4DAP A;  4G7O C;  1JIC A;  3Q23 A;  3BDL A;  4H44 C;  4IUU A;  5JOB A;  1EY7 A;  2EE1 A;  2SNS A;  4KTA A;  5DM6 3;  3FVQ A;  1CTM A;  4A3C H;  3IL8 A;  4C3H G;  1XPO A;  1EY4 A;  5HY6 A;  1TWG H;  4BBS H;  4C1N K;  1N32 L;  1XTD A;  1G2T A;  3VR6 A;  1Z7T A;  2B2Y A;  1U0L A;  2JA9 A;  4DGZ A;  2NN6 H;  2B63 B;  1MD2 D;  2RF4 A;  2JN4 A;  1MHW C;  1VQA A;  2NZO A;  2NVX B;  2CVR A;  3OIP A;  4JG2 A;  3CRK C;  4UAI A;  4POF A;  3J80 E;  1A2T A;  3CCQ A;  1N32 Q;  5I2X A;  4AYB B;  3VR3 A;  4LWC A;  1F2Y A;  1SYG A;  1HNX L;  2J0T D;  4TVA B;  4HCS A;  4PZ8 A;  4M8A A;  1S5B D;  1IBL L;  2KHJ A;  1TKW B;  3V2T A;  1YBY A;  2Q2U A;  1ET9 A;  2MJ8 A;  4IFD H;  2X69 A;  4IPD A;  3H3V C;  1CI3 M;  2ES2 A;  2TSS A;  2B2V C;  1GJX A;  4OO1 H;  3RLO A;  2IPK D;  3BVG A;  4O1N A;  4X3K A;  4C2M H;  4C3I G;  4LFA L;  2DGY A;  4YCW A;  2KED A;  4LF6 Q;  3BZK A;  1WYD A;  3J7A V;  1CK1 A;  4B9W A;  1JOR A;  3PUW A;  1PFM A;  2L5T A;  3MXG A;  3UDF A;  3H0G H;  4KJO A;  2NTT A;  1PRT C;  4ME5 A;  1D8L A;  2FJ2 A;  2MQH A;  1V9P A;  3GTL B;  1C8C A;  3S15 B;  4B3M Q;  4X64 Q;  5C4J B;  3K0Y A;  5TSS A;  4HTH A;  4EQ5 A;  5I2Y A;  2F0Q A;  3EVQ A;  4MZ9 A;  3Q6S A;  4HR7 B;  4B3R L;  5JJZ A;  3TSS A;  1K0R A;  2IHE A;  4ZAI A;  5ELC A;  1ENA A;  1EWH A;  4FXK C;  1S5C D;  2JXM B;  4C56 C;  2CKZ B;  5JEA G;  4X66 L;  3MVV A;  1F9R A;  1TWF H;  3RZD H;  1LM0 A;  2VL6 A;  4L6T B;  2B2U A;  4CKE A;  4GKK Q;  4X3S A;  3T4A C;  4PZ6 A;  5M5X B;  1IL2 A;  5ELB A;  1BDO A;  1NJI C;  4NXM Q;  1F2Z A;  1HR0 Q;  1QWY A;  1ONL A;  1KD1 C;  5IYD G;  3K8A A;  4HMI A;  5C3E B;  1Z6H A;  3PIO A;  5IYC G;  1Q1B A;  1LV9 A;  2E2I H;  2VY3 A;  5C0X H;  3FKI H;  1JWU D;  1WD1 A;  3F2D A;  1GHK A;  1NR2 A;  3OTO L;  1R9T H;  1IHZ A;  5C4Z A;  4IFD G;  5M5W B;  1UNS A;  2K5V A;  3QR8 A;  4LNQ A;  1I94 Q;  5JJI A;  1LTB D;  1FL0 A;  5M5W H;  4DV4 L;  2R7F A;  1AEX A;  5FLX c;  5IOD A;  1K9M C;  1PHJ A;  2CQA A;  2D9U A;  4I65 A;  4K14 A;  5C44 G;  4NW2 A;  2CW0 D;  2AUJ D;  2OTJ A;  3F1Z A;  4JOI C;  1PVO A;  3S14 B;  2R7Z G;  2JA6 H;  2KEN A;  3HP3 A;  3CRL C;  1X6O A;  1JQY D;  2VS1 A;  3EFX D;  4YHH L;  1IYV A;  3S1N H;  1R9T B;  3HKZ G;  1JJG A;  1H9R A;  2RSO A;  4NDX A;  1UE1 A;  5C3W A;  4APV A;  4DV0 Q;  4C3H B;  1YZ6 A;  4CDF C;  2QCP X;  5LHY 1;  3HOZ G;  1H9S B;  1ZYR C;  5CYU A;  3A7L A;  5EBD A;  1WI5 A;  3HOX G;  3BG3 A;  1SMY C;  2CW0 C;  3UDX A;  1SR3 A;  1XPU A;  1ICW A;  1K0S A;  4GLV B;  4FO2 A;  1FYC A;  1CSP A;  1GHJ A;  1X3F A;  2F3V A;  3HKS A;  2B63 G;  2F0W A;  3SEB A;  3HOY B;  2PQA B;  5IYB G;  2NZ1 D;  2QGQ A;  5A2Q L;  3KBG A;  4JI5 Q;  1Z9F A;  1TWA B;  3KLS X;  2VUM H;  1UEB A;  4K5V A;  1VDZ A;  2A69 D;  2R6G A;  3BDO A;  4WOR A;  5DAU A;  2A1A A;  5J1Z A;  1SDF A;  3K58 A;  2YYZ A;  4LUZ A;  2A8V A;  2L0C A;  4TSS A;  3W1G A;  4DV6 Q;  4GNX C;  4QF4 A;  4KI0 A;  2L9H A;  4WJ3 M;  3FEW X;  3T53 B;  1E22 A;  4C3I B;  3N6R A;  2E2J H;  1B53 A;  1XXG A;  3CCU A;  4ZQ3 A;  3P1H A;  3I8Z A;  1GVP A;  3GTK B;  3K5N A;  1PA6 A;  3M4Q A;  5FO8 B;  2VB2 X;  5IP7 H;  4XTC S;  5FKA C;  3U58 A;  1F9P A;  3E9I A;  1X3E A;  3BZC A;  1PH1 A;  1CA5 A;  1YVC A;  2LFN A;  3J7Y W;  3RD4 A;  4DUZ L;  1EIG A;  1VQP A;  2WAQ G;  4A93 B;  2K03 A;  2L1B A;  1UE5 A;  2RHQ B;  4LK1 C;  4DAY B;  2L11 A;  1ZXT A;  2E2D C;  1SNP A;  1A62 A;  2ATW A;  1MBY A;  1WTX A;  1PH2 A;  4JK1 C;  2VB3 X;  5J3B A;  1M8A A;  1L1O A;  1PTO D;  1T9H A;  3OMC A;  1MSH A;  3CAM A;  1BKB A;  2NTS A;  4JI0 Q;  1D2B A;  3J81 L;  4J1M A;  2WFW A;  2NN6 I;  2JA6 G;  4RKB A;  2R61 A;  2HHH Q;  4PQX A;  1BCP B;  1OXV A;  4G4K A;  2EYJ A;  4NKL A;  4UP7 A;  4JC0 A;  1O80 A;  2ENB A;  1N36 L;  3DWP A;  4QMG A;  3GD7 A;  3IAY A;  2XWJ B;  4DV6 L;  3Q22 A;  1WFQ A;  4FVM A;  4FNF A;  3EBE A;  4A3J G;  4IUV A;  1F2M A;  1NNX A;  2F1M A;  4JPB W;  3ONA B;  3SGI A;  1G91 A;  4BWG B;  1PFN A;  4GLA C;  4YWL A;  1VQ7 A;  2EJM A;  4BY7 B;  1PYS B;  2WP8 J;  4PG3 A;  3CC4 A;  1X3G A;  1H95 A;  1YIJ A;  1QOH A;  4CDC C;  3SHL A;  2Q8I B;  4RGO S;  4B08 A;  2RDG A;  3TEH B;  5FLX E;  4C3J H;  2VUM B;  3H6M A;  3SE0 A;  5C3E H;  1SFO B;  3H91 A;  3CCJ A;  4CJ2 C;  5IE8 A;  4JI2 L;  1B70 B;  3T51 B;  3AQQ A;  1HA6 A;  2Y0S B;  3K5O A;  2DUD A;  3L2P A;  5DM7 3;  1N33 L;  2WKC A;  2EYM A;  1BCP D;  4K6D A;  2F3W A;  1EEI D;  1KRT A;  5IT9 L;  5IWA L;  4BXX H;  4P74 A;  1EZ8 A;  1B9M A;  4JI0 L;  4A3D G;  1AE3 A;  2A6H D;  1HZA A;  4RCN A;  2NVY B;  3CKI B;  4NPS A;  4DR6 L;  4NXN Q;  3NTK A;  2F0P A;  1LTT D;  1X65 A;  4DV5 L;  4PZ7 A;  3HOW G;  2PZU A;  1BBU A;  5C4X H;  1IXR A;  2GVA A;  5DEH A;  5EJW A;  3UE0 A;  3S9W A;  1WTR A;  3M7N A;  2G5D A;  1VQ6 A;  2NB0 A;  1I50 H;  1JE4 A;  1N9W A;  1R4Q B;  3A7A B;  4DR4 L;  4DXG A;  2EXZ A;  4F87 A;  4PMC A;  4KHP Q;  1D7Q A;  5LMN W;  1TS4 A;  2O5I C;  5E3F A;  3X3N A;  4LFB L;  1CFM A;  3HOZ H;  1A15 A;  4R4Q A;  4IN3 A;  3WOF A;  2RSN A;  2HDM A;  1FR3 A;  1SAP A;  1HPC A;  3B6Y A;  1L0Y B;  4DR3 L;  3V05 A;  3NPP A;  2YU9 H;  1GUO A;  4GOP C;  4IZ8 A;  1SMX A;  2B29 A;  3Q0A A;  5LMN L;  5D3I B;  2DY8 A;  2EY2 A;  3JAM L;  1Q3L A;  3CD6 A;  5M3M B;  1HCZ A;  2EZV A;  3EIV A;  1ROD A;  5CBA E;  1O78 A;  1N8R C;  3MC0 B;  2DN8 A;  4F8M A;  3CF5 A;  4L5S A;  5BR8 L;  1HNX Q;  1R4P B;  1FVI A;  1HFN A;  2R93 G;  4Z9C B;  4X66 Q;  3NUC A;  1PRT D;  3JAM i;  4BY1 B;  2DJG C;  2JA8 H;  1RIP A;  4X65 Q;  2PMZ E;  2EQS A;  4RGT A;  3E0J A;  3I91 A;  3PMF A;  4ZRZ A;  1KTK A;  1QG7 A;  4A4I A;  1S40 A;  5K36 G;  2LMC B;  4X6A H;  4A3B H;  4JOI A;  2B2T A;  3E5S A;  4GOP B;  5EPL A;  5IIF A;  2BDO A;  1EIF A;  3IKJ A;  1CHP D;  4K5X A;  3OMG A;  2E2J B;  2KJX A;  2K52 A;  1XPR A;  3J80 c;  3HOU B;  5IYC H;  1J8I A;  1ZEQ X;  3RNU A;  1ENC A;  4NXM L;  1LTR D;  1SRU A;  1CZW A;  1K83 H;  4DR2 Q;  1EWC A;  3FRP B;  3GP7 A;  4Y7N H;  4HJ7 A;  4YCV A;  2E74 C;  4XQJ A;  3MXN B;  5K36 H;  1PRT B;  3PO3 B;  3E6Z X;  1NMF A;  3J81 i;  2BH8 A;  4LUO A;  5E4X A;  1E1O A;  1WJJ A;  4P71 A;  4A3F H;  3TS0 A;  1RCV D;  2QDL A;  3KLS A;  1V1O A;  1SYD A;  1Y8N B;  1E3P A;  5FJ8 G;  1SEB D;  4A3B B;  4KV6 A;  2EXD A;  1ASZ A;  2Z1C A;  2OEO A;  2Z4H A;  3PUX A;  1Y69 U;  2K28 A;  1E0B A;  1VF7 A;  2C35 B;  2B3G A;  1Q81 C;  2UU9 L;  3TRZ A;  1CA6 A;  4A3D H;  5CV8 A;  4BY7 G;  4DV0 L;  4A3K G;  2AWN A;  3S24 A;  1LTS D;  3DM3 A;  1VS0 A;  1GUG A;  1WTO A;  3AU7 A;  1QNK A;  2BE5 C;  3DWA A;  1JT8 A;  3QJY A;  2AKW B;  2Z0S A;  3DEO A;  4ZUI A;  3K57 A;  3T13 A;  3NHH A;  4FXD A;  5IGG A;  2HD3 A;  3ICE A;  3UDI A;  1HUM A;  1PFS A;  1HNW L;  3TP8 A;  4J15 A;  1Q8K A;  1GM5 A;  4O2D A;  2I5H A;  4DV1 L;  3NBH B;  3AEV A;  2YTY A;  5GAG C;  1C9O A;  1X3Q A;  1MIU A;  4DV2 L;  1IBM L;  1ILQ A;  4AYB E;  2L55 A;  2IY5 B;  4B3S L;  4JI8 Q;  1VQN A;  4A3D B;  1SYE A;  1UEA B;  4RFB A;  3STB C;  3S17 B;  4DR4 Q;  3PGZ A;  5ELF A;  2PMZ B;  4YWK A;  1I3Q H;  3M4O H;  3TP5 A;  2JQO A;  2KEE A;  5C44 B;  1RL2 A;  2F0V A;  1I4Q A;  2RKS A;  3G6J B;  3VDY A;  5EKL A;  1DON A;  4HN7 A;  5AFW A;  1PTO F;  2EYF A;  4FF4 A;  3S1Q H;  4NB3 A;  3UDG A;  1QCB D;  1M4V A;  4DFA A;  3J81 E;  1F9S A;  3U50 C;  3W3A A;  1FGB D;  2WIN B;  2XWB B;  2ZTE A;  4OHJ A;  4AYB G;  4OX9 L;  1PRT F;  3GV6 A;  2SDF A;  2SNM A;  1LTA D;  2HHH L;  2JA5 H;  3S2D H;  5BN5 A;  4RKL A;  1EU4 A;  4P75 A;  4RCO A;  3PIO 3;  2J4X A;  3HOX B;  1II3 A;  2PNH A;  1I3Q B;  4G7H C;  3M4O B;  1WTQ A;  5C5L A;  1MKH A;  5JJL A;  4O42 A;  3W5O A;  1ICF B;  3NXW A;  3URY A;  2H4O A;  1RD9 D;  4XQQ A;  3R8B A;  1SNC A;  4JI4 L;  3QIA A;  1VQ5 A;  3EQL C;  2KVM A;  5ELO A;  1EYD A;  1TVX A;  1WCM B;  1HQR D;  4XYQ A;  1AZP A;  3GTM H;  4A3L G;  5L37 A;  1WCM H;  5CV7 A;  2NUC A;  3G48 A;  2ZJP A;  3FP9 A;  3K7A B;  1VQC A;  4LF8 Q;  1UE7 A;  3F2B A;  1W3S A;  2UXC Q;  3PO2 G;  5CC4 A;  2F3I A;  2EYO A;  5FO9 B;  4JBM A;  1IZ6 A;  1EEF D;  1IYU A;  3MTS A;  1MI2 A;  3HOU G;  1U4L A;  4P72 A;  5JEA H;  5KGU A;  3U4V A;  3JAM E;  4DV3 Q;  1Y1V B;  1AW7 A;  1JJ2 A;  3S2H B;  5M9O A;  3TRE A;  4LFC Q;  4DK0 A;  1DCZ A;  1LTL A;  3I2Z A;  2O2L D;  2MPM A;  2F0O A;  2AMC B;  1JJC B;  3J81 j;  2RQX A;  3M4P A;  2KCT A;  3C2P A;  2LS0 1;  2Q2I A;  1SXT A;  2ZM6 Q;  1Q7Y C;  3S16 B;  4KY6 A;  3K81 C;  1J6Q A;  5HGQ A;  2R93 H;  1GOZ A;  1I6H B;  2F0T A;  4V0B A;  1XMO Q;  3H0G G;  2VXW A;  2E2H H;  4OO1 I;  3TDQ A;  2N3S A;  1Q82 C;  4KJN A;  1E1T A;  3TS2 A;  3NE5 B;  2R7D A;  1TR5 A;  3MXU A;  3ULJ A;  1PTO B;  5LMN Q;  3ZJY C;  5JAV A;  4HIO A;  3FMC A;  2F4V Q;  1QIL A;  2WAC A;  3DEP A;  5EQ0 A;  3N52 A;  3H15 A;  1QVC A;  3A0J A;  3CCE A;  4ID6 A;  2EJF C;  1W6K A;  3A8J E;  4XT3 B;  4KKS A;  4F7X A;  1QNU A;  1C7Y A;  4PMB A;  3HGB A;  3IRB A;  1S3O A;  2M00 A;  1XMO L;  1G8Z D;  3LGJ A;  3CPF A;  5M5Y H;  1V43 A;  1Q12 A;  5C4X G;  2K5D A;  1HQM C;  1JR0 D;  4J6H A;  4A3J H;  2GVB A;  3GTP H;  4DK1 A;  3TN2 A;  2KCN A;  1T5X D;  5E4W C;  4DV7 L;  2ZTC A;  1YHA A;  3A55 A;  2ZM6 L;  4ILW A;  1AP0 A;  2LSS A;  3BU2 A;  5CV6 A;  4DR6 Q;  1STE A;  5G3L F;  4RG1 A;  1BQQ T;  1ESF A;  1SE4 A;  1SNQ A;  3BYY B;  1TWA H;  4IUR A;  3A5U A;  3FHW A;  3HOY H;  1SJE D;  1PV4 A;  2XVS A;  4JBJ A;  2PI2 E;  4KN7 C;  2I5L X;  3RN2 A;  1VQG A;  2K5W A;  2IJ0 A;  1I50 B;  2I0Q A;  1D1K A;  4K5W A;  5C44 H;  2E75 C;  3L7Z C;  3H3V H;  1HNZ Q;  1KDB A;  2JA8 G;  4WRD A;  1WVL A;  3GTQ H;  5CR3 A;  5HUR A;  1HNW Q;  1EY8 A;  3I7F A;  3KDF B;  1SSO A;  5C6A A;  1QJO A;  4HJ5 A;  1NY4 A;  3K7U C;  3KYH C;  1VQH A;  1C4Q A;  1LT4 D;  1EYA A;  5C5M A;  1K73 C;  1KXL A;  4IUQ A;  4MTN A;  4DUZ Q;  1TWH B;  3PO2 H;  2JYO A;  1Y1W G;  2ZJR A;  3RZO H;  1X55 A;  1D5X C;  3EN2 A;  3H09 A;  3KF6 B;  4N9T A;  4LF5 Q;  1H9M A;  2EYL A;  3M7G A;  5K5P A;  3Q8D A;  3F2U A;  4KK7 A;  4G7Z C;  5J39 A;  4GN4 B;  2BE5 D;  3A8K E;  4ZCK A;  5NUC A;  4WFN 3;  2ALY B;  1ILP A;  3TP7 A;  2ASB A;  1K8G A;  1J9O A;  3L3O C;  3OYY A;  3AB9 A;  2R93 B;  1HXY D;  3J80 L;  4X62 L;  1Y1V G;  2L15 A;  1B8A A;  3TQY A;  5FK9 C;  4DR1 L;  2I46 A;  2F0I A;  4NMZ A;  3QOJ A;  4CKB A;  4Y52 H;  2OCE A;  1ZKO A;  2EYP A;  3MFY A;  4MNO A;  4B3T L;  4A3I B;  1DZ1 A;  2ZXP A;  2FHT A;  4GZY C;  2CFM A;  2WB1 E;  4CGY B;  3NTH A;  1MJC A;  5JEA J;  1HZB A;  3CCS A;  4RH6 A;  1HJP A;  1SYF A;  3P75 A;  1Q1E A;  3CC2 A;  1K83 B;  2Q2H A;  4ME3 A;  1EY5 A;  1WTV A;  2QA4 A;  1IBK Q;  2F0F A;  3RMH A;  3VR5 A;  4ZKC B;  3C3L A;  3I4L A;  3H0G B;  4N8F A;  4YCU A;  4JI3 L;  1FGU A;  3KF6 A;  1V8Q A;  5COY A;  3PO3 G;  4CBV A;  3T1H Q;  1RTO A;  2R92 B;  3J7A F;  4C3J G;  5COR A;  4K8I A;  1AH9 A;  1GD7 A;  4HED A;  3CW2 C;  3R93 A;  4JI6 Q;  2UUA L;  4ALP A;  1U9R A;  1I4R A;  3BJU A;  2JEA I;  2E2I B;  3CCL A;  1YHB A;  3VYR A;  2K32 A;  4DR5 L;  2B2W C;  1D6E C;  1NSN S;  2JJQ A;  2VQE Q;  4DV7 Q;  2CWP A;  3KJP A;  3GTJ B;  2VQF Q;  1GO3 E;  4QGU A;  2MFI A;  1PDQ A;  2H1E A;  1EY0 A;  4RGN A;  5EBC A;  2IWH A;  1VQ4 A;  3E0E A;  4L63 B;  2K04 A;  4A3M H;  5AJ3 L;  2ZJQ A;  1VQ9 A;  4DN4 M;  3DMU A;  3HEJ A;  5C4X B;  1I5F A;  1JOQ A;  2R92 H;  1Y1W H;  4A75 A;  1H9S A;  2M9V A;  2AQ1 B;  3K5M A;  3VR4 A;  5IT9 E;  1TWG B;  1EZ6 A;  1CQF A;  3AFP A;  4BBS B;  2R7Z B;  1WOC A;  2HCI A;  1S5D D;  3E3X A;  2XGT A;  1EL0 A;  1P8L A;  3PIP 3;  3V96 A;  3A74 A;  3LNN A;  1EY6 A;  1L1O C;  5KYL A;  2MHV A;  2Z8L A;  3GQB A;  4A3G B;  5KIX A;  2VW9 A;  4UPA A;  4HCE A;  5FOB B;  1GXD C;  4JI8 L;  5CMD A;  2PYK A;  5M5Y B;  4KHV A;  3E9H A;  1EUJ A;  4JI1 L;  4K0K L;  2MO1 A;  1WTW A;  3HOZ B;  1D5Z C;  1KQS A;  3S1Q B;  4KHP L;  4IUT A;  4R1J A;  3U9O A;  2B8F A;  2NYZ D;  1LYL A;  3CC7 A;  3D8G A;  1EIY B;  3BYT B;  5I6W A;  1I4G A;  3FPP A;  3HOY G;  2PZT A;  1PH9 A;  5DNF A;  3MFG A;  1NCV A;  5IOC A;  4H0L C;  1NE3 A;  4GS3 A;  1IBL Q;  3S1N B;  1VMP A;  4BY1 H;  1F2L A;  4HJ8 A;  2QEJ C;  1SFO H;  4IFD I;  1B9N A;  2NBF A;  4TKO B;  1NUC A;  4JYA L;  4YHH Q;  1E24 A;  3DXJ C;  2UXD L;  4FF3 A;  1LAC A;  2A74 C;  1NAP A;  4DV1 Q;  4RAU C;  2RDF A;  2K14 A;  4DR7 L;  5I9P A;  4JI2 Q;  2BCO A;  2TMP A;  4R4I A;  3I4N B;  3HRZ C;  4O0A A;  1PXU A;  3D4D A;  1BVS A;  5KNC A;  2KEC A;  1KLG D;  5FJ8 H;  2RA4 A;  4HJA A;  5AJ3 Q;  4DV4 Q;  4BBR G;  3LWE A;  3K7A H;  3PCO B;  1RTN A;  2MGS A;  2ICI A;  2Z6B A;  3DWQ A;  3ND9 A;  4L8J A;  4QL5 A;  1SYC A;  2WAQ B;  5I6Y A;  4A93 G;  4OEL B;  4A3F G;  4A3I G;  3F8T A;  1TWF B;  3RZD B;  3ND8 A;  5M3F B;  4IPG A;  4R8I A;  1P16 A;  4QUC A;  1YJN A;  2E76 C;  1E2Z A;  1SLJ A;  2UUA Q;  3SR1 A;  4A3B G;  4FDB A;  3LWU A;  4QY7 A;  3GTK H;  2BA0 A;  2WII B;  1E7Z A;  2CH4 W;  2VNU D;  2HDL A;  2K01 A;  1A8V A;  4RHR A; 
#chains in the Genus database with same CATH homology
 5IT9 c;  4X66 L;  2ZTE A;  4AYB G;  4OX9 L;  1XJV A;  1V1Q A;  1TWF H;  3RZD H;  2UUB Q;  4A3M G;  1LM0 A;  1AE2 A;  2VL6 A;  4POG A;  2F52 A;  2HHH L;  2JA5 H;  4GKK Q;  4DV2 Q;  3S2D H;  4PZ6 A;  1IL2 A;  2R92 G;  4P75 A;  1N34 Q;  2WAQ E;  4R4O A;  4BA2 I;  1NJI C;  4NXM Q;  1HR0 Q;  4DKA C;  1KD1 C;  5IYD G;  2PNH A;  4OWX B;  4DAM A;  5M3M H;  1VQM A;  4IJH A;  4L5R C;  3K8A A;  3CCV A;  1L0W A;  4DR3 Q;  2UXD Q;  1FJG Q;  1U5K A;  2JE6 I;  1MKH A;  1VQD A;  3PIO A;  1VQJ A;  5IYC G;  5JJL A;  2A19 A;  1Z47 A;  1Q1B A;  4A3I H;  2E2I H;  1KRS A;  3W5O A;  2VY3 A;  5EAY A;  1EFW A;  4LF4 L;  3FKI H;  4P73 A;  3F2D A;  2K50 A;  1PH3 A;  4JI4 L;  4NXN L;  3DLL A;  3OTO L;  3KDF A;  1R9T H;  1VQ5 A;  4IFD G;  5ELO A;  4JV5 Q;  2K5V A;  2E5L Q;  4HID A;  4LNQ A;  3STB D;  1I94 Q;  5JJI A;  3ULL A;  1KAW A;  1FL0 A;  5M5W H;  3GTM H;  4DV4 L;  4A3L G;  2R7F A;  4BY1 G;  1G51 A;  1WCM H;  3M3Y H;  4A3L H;  3G48 A;  5FLX c;  2ZJP A;  1K9M C;  1PHJ A;  1IBM Q;  3FP9 A;  4GNX A;  2PI2 A;  1VQL A;  1EQR A;  1VQC A;  2BA1 A;  2AHO B;  4LF8 Q;  5C44 G;  3I4O A;  1PH5 A;  1UE7 A;  3F2B A;  2OTJ A;  2K5H A;  1W3S A;  3F1Z A;  3GDE A;  4JOI C;  3PO2 G;  2UXC Q;  2Y0S G;  1N36 Q;  2F3I A;  1QVG A;  4JBM A;  1PVO A;  1IZ6 A;  1YJW A;  2R7Z G;  2JA6 H;  2KEN A;  1VQB A;  1GKH A;  3PF5 A;  1VQO A;  4JI6 L;  3HOU G;  1JMC A;  4DK6 C;  4P72 A;  4BY7 H;  1X54 A;  2V1C C;  1HZ9 A;  3ULP A;  1X6O A;  3T1Y L;  4GN5 A;  1XMQ Q;  3U4V A;  2KHI A;  2VS1 A;  2BH2 A;  3M9B A;  4YHH L;  4DV3 Q;  1JJ2 A;  3TRE A;  4LFC Q;  2KCM A;  3S1N H;  5FLM H;  2IHF A;  3HKZ G;  1LTL A;  2NVY H;  1JJG A;  3I2Z A;  3T1H L;  1TXY A;  5IWA Q;  1UWV A;  3CCM A;  1UE1 A;  4DV0 Q;  4APV A;  4QQB X;  2AMC B;  3HOW H;  1JJC B;  2NN6 G;  1PYB A;  2JK8 A;  3J81 j;  1NMG A;  1YZ6 A;  3RN5 A;  1Q86 C;  3HOZ G;  3PO3 H;  1S72 A;  4JI3 Q;  4BXX G;  3M4P A;  4A3C G;  2KCT A;  5GAE C;  2K75 A;  2Q2I A;  4HIM A;  2ZM6 Q;  4AQY Q;  1Q7Y C;  2OWO A;  1WI5 A;  3K81 C;  4IO9 A;  4A3E H;  3HOX G;  4A93 H;  1J6Q A;  4LW1 A;  5HGQ A;  5DLQ E;  3J7Z C;  3UDX A;  5M3F H;  2R93 H;  1SR3 A;  1XPU A;  3CCR A;  4GLV B;  2B63 G;  1X3F A;  1CSP A;  3HKS A;  1JE5 A;  4LF5 L;  5GAD C;  2LXJ A;  4A3G H;  2PQA B;  5IYB G;  1XMO Q;  2QGQ A;  3H0G G;  2E2H H;  4DV5 Q;  2IT1 A;  4UP9 A;  4JI5 Q;  2AWO A;  4OO1 I;  1Z9F A;  4JI1 Q;  5BR8 Q;  2R7Z H;  2VUM H;  2N3S A;  1UEB A;  3A5Z B;  1XNR Q;  4C3I H;  3CMA A;  1Q82 C;  1QZG A;  4KHZ A;  1B7Y B;  1WCM G;  1E1T A;  4HIK A;  3TS2 A;  2R7D A;  2R6G A;  4DUY Q;  2A1A A;  3ULJ A;  5LMN Q;  3ZJY C;  4HIO A;  2YYZ A;  4LUZ A;  1YHQ A;  2IX1 A;  2A8V A;  4XIG S;  2D0O A;  1A0I A;  1N33 Q;  2F4V Q;  2MO0 A;  3AFQ A;  3W1G A;  4DV6 Q;  4GNX C;  3D0F A;  1KHI A;  4AIM A;  5C4J H;  1XNQ L;  1SRO A;  4KI0 A;  4WJ3 M;  3H15 A;  1YIT A;  1QVC A;  2FXQ A;  3A0J A;  1E22 A;  3CCE A;  1C0A A;  5M3M G;  4LF8 L;  4RMF A;  4OXP A;  2E2J H;  1NBW A;  3CCU A;  1OXS C;  4GKK L;  2UXB L;  4H02 A;  1C7Y A;  1GVP A;  1PA6 A;  2N49 A;  5ELN A;  3M4Q A;  3IRB A;  2IX0 A;  3G4S A;  5IP7 H;  4XTC S;  3U58 A;  1S3O A;  3E9I A;  1X3E A;  3BZC A;  4JI7 L;  1XMO L;  3LGJ A;  1PH1 A;  3CPF A;  1YVC A;  4R4T A;  1I94 L;  5M5Y H;  1V43 A;  1Q12 A;  1PH7 A;  3NEL A;  5C4X G;  3I55 A;  4DUZ L;  1VQP A;  2Q2T A;  4A3J H;  2VUM G;  2GVB A;  2WAQ G;  3GTP H;  3PIP A;  1KIX A;  1W2B A;  1UE5 A;  3GTL H;  2RHQ B;  4DV7 L;  1PH6 A;  2ZTC A;  2NVX H;  1X56 A;  5LMU Q;  1YHA A;  1J5E Q;  3M85 A;  2ZM6 L;  4AQY L;  4DAY B;  4DR5 Q;  1XNQ Q;  3CXC A;  1A62 A;  2ATW A;  2LSS A;  3BU2 A;  4B3M L;  4IOA A;  4DR6 Q;  3RLN A;  1PH2 A;  4RG1 A;  5J3B A;  1VQI A;  4QJF A;  1TWA H;  3A5U A;  1L1O A;  3FHW A;  1T9H A;  5IP9 G;  4DR7 L;  3CAM A;  3HOY H;  3I4M H;  4GKJ Q;  1BKB A;  2YTX A;  1O7I A;  1PV4 A;  4IPC A;  3RLF A;  4JBJ A;  4OON A;  4JI0 Q;  4X62 Q;  2WFW A;  4IPH A;  2NN6 I;  1Y14 B;  2PI2 E;  3JC6 6;  2I5L X;  3WWV A;  1VQG A;  3RN2 A;  1YJ9 A;  2JA6 G;  2HHH Q;  5JJK A;  3U4Z A;  3HOX H;  3PF4 A;  1VQ8 A;  4TQU S;  4LFB Q;  1OXV A;  4UP7 A;  4LF6 L;  4JC0 A;  4OX9 Q;  2I0Q A;  3NEN A;  2NVQ H;  4JCV E;  2B63 H;  5C44 H;  1QVF A;  1N36 L;  3L7Z C;  3H3V H;  2KBN A;  2VZA A;  3ER0 A;  3PUZ A;  1HNZ Q;  1EWI A;  2JA8 G;  1Q46 A;  3GD7 A;  2YV5 A;  3GTQ H;  1HNW Q;  4LUV A;  4DV6 L;  3I7F A;  1WFQ A;  3KDF B;  3EBE A;  2K4K A;  4A3J G;  2Y0S E;  1NY4 A;  3K7U C;  5GAH C;  4HJ5 A;  2N78 A;  3KYH C;  3SGI A;  3S1R H;  2GN5 A;  1VQH A;  1J5E L;  2JA7 G;  4OO1 G;  1TWC H;  4GLA C;  4YWL A;  1K73 C;  1KXL A;  5FLM G;  1VCI A;  4MTN A;  2CQO A;  3KJO A;  4IOC A;  1VQ7 A;  4DUZ Q;  4JV5 L;  3HKZ E;  2JEB I;  3PO2 H;  1PYS B;  2WP8 J;  4PG3 A;  3CC4 A;  5E7N A;  1Y1W G;  4L5Q A;  2ZJR A;  1X3G A;  4JI4 Q;  3RZO H;  1YIJ A;  1H95 A;  1X55 A;  3EN2 A;  1M1K C;  3S1M H;  3KF6 B;  3I56 A;  4WJ4 A;  1HR0 W;  4LF5 Q;  1XMQ L;  3TEH B;  2HIV A;  1L2F A;  4C3J H;  1EOV A;  5C3E H;  3PUY A;  4IFD J;  3CCJ A;  3NEM A;  5IE8 A;  1M90 C;  2XTI A;  2Z6K C;  2HT1 A;  4LFA Q;  4JI2 L;  1B70 B;  3Q8D A;  5GQO A;  1CSQ A;  3AQQ A;  4GN4 B;  3GTO H;  2DUD A;  1HH2 P;  3L2P A;  2ALY B;  4HJ9 A;  2ASB A;  1K8G A;  4OWT B;  1N33 L;  2F4V L;  3I4M G;  2Z6K A;  3K80 C;  5H1S E;  2CCZ A;  2UUB L;  1KRT A;  1L1O B;  3OYY A;  1UE6 A;  5IWA L;  4BXX H;  1CKM A;  4P74 A;  1Y1V G;  2L15 A;  4X62 L;  5C0X I;  1B8A A;  3TQY A;  4YWM A;  4LFC L;  4GLX A;  4JI0 L;  4DR1 L;  1AE3 A;  4DK3 C;  4UY8 C;  4A3D G;  2I5M X;  1HZA A;  4Y52 H;  1SE8 A;  2OCE A;  2E5L L;  2NVT H;  1DGS A;  4NPS A;  1HZC A;  1BBW A;  4NXN Q;  3G71 A;  4MNO A;  4B3T L;  4DR6 L;  2JA5 G;  1X65 A;  4DV5 L;  4JYA Q;  1EYG A;  2CFM A;  2WB1 E;  4PZ7 A;  1I6H H;  1PH8 A;  3HOW G;  4DNI A;  2H5X A;  1BBU A;  5C4X H;  1IXR A;  1MJC A;  2GVA A;  1HZB A;  3K0X A;  5JEA J;  3UE0 A;  1KL9 A;  3CCS A;  3J7A 5;  1A63 A;  3M7N A;  1VQ6 A;  2D62 A;  1HJP A;  1OTC A;  4X64 L;  3S17 H;  1I50 H;  1Q1E A;  3CC2 A;  4BBR H;  1N9W A;  1SN8 A;  4BBS G;  2ID0 A;  4JBW A;  3S15 H;  4DR4 L;  2Q2H A;  4ME3 A;  4QIW E;  2QA4 A;  4GN3 B;  3J81 c;  1IBK Q;  2UUC Q;  3S16 H;  1D7Q A;  4KHP Q;  5LMN W;  4YCU A;  2D0P A;  4JI3 L;  4DPG A;  1FGU A;  3CQZ H;  3KF6 A;  3HOV G;  4LFB L;  2UXB Q;  3PO3 G;  3D31 A;  3HOZ H;  3PV0 A;  3OTO Q;  5IP9 H;  3T1H Q;  4R4Q A;  1QUQ A;  3UE1 A;  4DR2 L;  1LUZ A;  4LF7 L;  2WB1 G;  1Y1V H;  3J80 i;  4DV3 L;  2HQL A;  1AH9 A;  1GD7 A;  1NTG A;  4A76 A;  3S14 H;  2RHS B;  4BA1 I;  1G6P A;  5IY0 A;  1X9N A;  5GRO A;  3CW2 C;  4JI6 Q;  2HIX A;  1OXU A;  2UUA L;  3B6Y A;  4ALP A;  5C3E G;  4DR3 L;  1ASY A;  2JEA I;  2EIF A;  3BJU A;  2YU9 H;  4GOP C;  4OWW B;  3G6E A;  3CCL A;  4R4C A;  1SMX A;  3CPW A;  1YHB A;  1HR0 L;  2B29 A;  3AYH B;  5LMN L;  4DR5 L;  1QZH A;  5LMU L;  4LF7 Q;  3L0O A;  2JJQ A;  2VQE Q;  5C0X J;  4DUY L;  4DV7 Q;  1N34 L;  3CD6 A;  2CWP A;  3KJP A;  3EIV A;  2VQF Q;  4YY3 L;  1GO3 E;  4QGU A;  3JAM c;  4GOP A;  1XNR L;  1N8R C;  2N8N A;  1VQE A;  2MFI A;  4X65 L;  3CF5 A;  4L5S A;  5BR8 L;  1HNX Q;  4JI5 L;  1FVI A;  2R93 G;  2NZH A;  4UP8 A;  4X66 Q;  1G29 1;  1VQ4 A;  1CKN B;  4KLK A;  3E0E A;  4A3K H;  4JI7 Q;  1PH4 A;  3JAM i;  4A3M H;  1VQK A;  5AJ3 L;  3H3V I;  2ZJQ A;  1VQ9 A;  2JA8 H;  1IBK L;  1RIP A;  2UUC L;  1I5F A;  4X65 Q;  2PMZ E;  3FKI G;  2EQS A;  1CKN A;  1K8A C;  2YTV A;  4GNX B;  2R92 H;  3HOV H;  1YNX A;  1Y1W H;  4YY3 Q;  4A75 A;  4AH6 A;  4A4I A;  1S40 A;  2VQE L;  5K36 G;  4X6A H;  1JB7 A;  5IYD H;  4A3B H;  1CKO A;  4LF9 L;  4JOI A;  2MNA A;  4GOP B;  1KC8 C;  1EIF A;  3F2C A;  2JA7 H;  3AFP A;  3MEF A;  1WOC A;  1YEZ A;  3I4N G;  2K52 A;  2XGT A;  3PUV A;  1XPR A;  3J80 c;  5IYC H;  1P8L A;  3A74 A;  3RNU A;  4NXM L;  3S2H H;  1L1O C;  3ERS X;  1SRU A;  3GO5 A;  4DR1 Q;  1K83 H;  4DR2 Q;  2VW9 A;  4UPA A;  4Y7N H;  1QUQ B;  4JI8 L;  4HJ7 A;  4B3S Q;  4YCV A;  3MXN B;  3T1Y Q;  4A3C H;  3E9H A;  1XPO A;  1EUJ A;  1NMF A;  4JI1 L;  2MO1 A;  4K0K L;  1MJE A;  5HY6 A;  1TWG H;  2BH8 A;  4LUO A;  3J81 i;  4BBS H;  1N32 L;  1XTD A;  1KQS A;  1E1O A;  4KHP L;  3HOU H;  1WJJ A;  2LXK A;  4P71 A;  5M3F G;  4A3F H;  4R1J A;  4LF9 Q;  3TS0 A;  3I4N H;  2CWA A;  1LYL A;  1U0L A;  3CC7 A;  2JA9 A;  3OW2 A;  1EIY B;  1CUK A;  5IP7 G;  4JBK A;  3HFZ B;  1E3P A;  5FJ8 G;  1OXT A;  2QEX A;  2EXD A;  1TWH H;  3HOY G;  1ASZ A;  2RF4 A;  1PH9 A;  3PUX A;  3CME A;  1OXX K;  1VQA A;  2C35 B;  2NZO A;  4PMW A;  2B3G A;  4JG2 A;  1NE3 A;  4GS3 A;  4POF A;  3CCQ A;  1K3R A;  1Q81 C;  1IBL Q;  2UU9 L;  1N32 Q;  4B3T Q;  4LWC A;  3TRZ A;  4K0K Q;  4A3D H;  1HNX L;  3GTJ H;  4BY1 H;  4BY7 G;  3KLW A;  4TVA B;  4DV0 L;  4A3K G;  2AWN A;  3S24 A;  4HJ8 A;  1SFO H;  4PZ8 A;  2VQF L;  4IFD I;  1YI2 A;  1EQQ A;  1IBL L;  2UU9 Q;  2KHJ A;  3DM3 A;  1VS0 A;  4JYA L;  1YBY A;  4YHH Q;  1E24 A;  2Q2U A;  1JT8 A;  2OQK A;  2AKW B;  1VQF A;  3KF8 B;  2Z0S A;  4IPD A;  2K5N A;  5M5X H;  2ES2 A;  2UXD L;  3ICE A;  3UDI A;  1PFS A;  1HNW L;  4J15 A;  4DV1 Q;  1Q8K A;  2E8G A;  4DR7 Q;  3RLO A;  1GM5 A;  1HNZ L;  2UXC L;  4O2D A;  2I5H A;  2K14 A;  4C2M H;  4DV1 L;  3NBH B;  4JI2 Q;  2DGY A;  4LFA L;  3AEV A;  4R4I A;  4YCW A;  2YTY A;  5GAG C;  1C9O A;  5C0X G;  4LF6 Q;  1MIU A;  4DV2 L;  1IBM L;  4O0A A;  4EX5 A;  3BZK A;  1WYD A;  1BVS A;  2PQA A;  3KOJ A;  4AYB E;  3PUW A;  3GTG H;  5FJ8 H;  2IY5 B;  4HJA A;  4B3S L;  4A3G G;  5AJ3 Q;  4JI8 Q;  5JEA G;  3UDF A;  4DV4 Q;  4BBR G;  3H0G H;  1VQN A;  3KFU A;  4C3H H;  3K7A H;  2RCN A;  4IJL A;  3PCO B;  4GKJ L;  3PSI A;  1D8L A;  2MQH A;  3STB C;  2OQ0 A;  4QL5 A;  3PGZ A;  1V9P A;  4A3E G;  4DR4 Q;  4A93 G;  1IYJ B;  4YWK A;  4A3F G;  4A3I G;  4L5T A;  1I3Q H;  4B3M Q;  3RR5 A;  4X64 Q;  3M4O H;  2JQO A;  4B3R Q;  1RL2 A;  3F8T A;  4LF4 Q;  3CP0 A;  4IPG A;  4EQ5 A;  4MZ9 A;  3VDY A;  4B3R L;  1P16 A;  1YJN A;  5IYB H;  1FJG L;  1SLJ A;  2UUA Q;  4NB3 A;  3UDG A;  3S1Q H;  4A3B G;  1K0R A;  2ZTD A;  4FDB A;  4QY7 A;  2OTL A;  2IHE A;  3GTK H;  2BA0 A;  3W1B A;  1E7Z A;  2VNU D;  3U50 C;  1A8V A;  2CKZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...