4B3RQ

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3rQ00
3HOZG 4A93G 1D7QA 2CFMA 4JI3L 2DUDA 3U4VA 1PH9A 4DAYB 3F1ZA 5M3FH 1PYBA 4A3JG 3CC4A 4OWTB 1OXVA 1L0WA 2JK8A 5IYDH 1DGSA 4Y52H 1L2FA 1YZ6A 1Z9FA 2QA4A 3CMAA 4FDBA 4B3RL 1K0RA 4A3GG 5IP9H 3PUVA 3F8TA 5H1SE 3OTOL 3U4ZA 1O7IA 1P16A 2I0QA 1Z47A 4DR4Q 1EUJA 1LTLA 2C35B 4GN4B 1N34L 1VS0A 3D31A 1IBML 1PA6A 5IYBH 2I5LX 4DR3L 2UXDL 5ELOA 2UUCL 4X65Q 1AE2A 5E7NA 1BBUA 3M7NA 1VQKA 2UU9Q 4LFBL 2K5HA 4YHHQ 1JJGA 1PH3A 3GTJH 3CW2C 1E24A 1T9HA 4A3LH 2MNAA 3ULLA 2NZHA 4JYAQ 2YYZA 2K4KA 1HJPA 1KAWA 3RR5A 1L1OC 3JAMi 2BH8A 2AHOB 3G48A 4POGA 3HOWH 1HNWL 5AJ3L 3DLLA 3PIPA 2CWPA 1VQ9A 1J6QA 3CPWA 2A8VA 2IT1A 4A3FG 1PH2A 1I94L 2JA6H 1PYSB 2I5HA 2RHSB 4B3SL 2NN6G 1FGUA 4DR6L 1CSQA 1PV4A 3G6EA 5GAHC 3T1YL 4DUYQ 1IYJB 3PUZA 3W1BA 1TXYA 1WOCA 2OCEA 2K52A 3H0GH 4DNIA 4GNXA 4QQBX 5FJ8G 1TWGH 3PUYA 3ULJA 1YEZA 2GN5A 2HIVA 3K81C 4KLKA 4JI0L 3PCOB 2HT1A 1VQ6A 1EFWA 3PO3G 2MFIA 4JOIC 4A3DH 4LF4L 3PUWA 1Q12A 2VQFL 1EWIA 4BBRH 2K5VA 1E3PA 2OQ0A 3J81i 4DUZL 1HNXL 4NXNL 2CKZB 4LFAL 1IL2A 1N36Q 2UUAQ 1HZCA 4LF9L 3KDFB 5JEAG 1K9MC 4GKJL 2PNHA 4JI7L 3A74A 3KDFA 1Q86C 4IFDG 3T1HL 2OTLA 1X65A 1K3RA 1G6PA 2WFWA 4DV7L 1C9OA 4L5RC 1TWCH 4LWCA 1CUKA 5C3EH 2NVQH 2ZTDA 1X54A 2OQKA 1XNQQ 1X3EA 4B3TL 3S1NH 2JA8H 2JEAI 2Z6KA 1VQDA 3CCQA 4JBMA 2IHEA 5LMUQ 2Q2TA 2KENA 1X56A 1B8AA 2N8NA 1VQHA 4PG3A 4DV0Q 2BH2A 4JV5L 1U5KA 2AKWB 2ZM6Q 2K14A 1GD7A 4LF7Q 4R4OA 2JQOA 1IBLL 1CSPA 4R1JA 1YBYA 5FLMH 4A76A 3CCUA 1N32Q 5C4XG 1FJGL 1SE8A 1LYLA 3TEHB 2F4VL 4X64L 1HNZQ 1A0IA 1YHQA 4LUOA 4UP8A 1GO3E 2VQEL 3CC2A 3S2HH 3GTLH 4KI0A 1QVGA 1UWVA 4L5QA 4AYBE 1E1TA 1JJ2A 1PH5A 2IX1A 4DV4L 5C0XG 4IPGA 2MO1A 1BKBA 4BY1G 5IYCH 2NVYH 2JA7H 1MKHA 2ZJRA 1MJEA 3HOVG 3D0FA 2B29A 3PSIA 3IRBA 4DR5L 2VZAA 3STBC 1J5EL 2B3GA 4LF8L 2BA0A 2B63H 3HOUH 3HOYH 1QVFA 3HOXH 4HIMA 3CCSA 2Q2IA 1GM5A 1XPOA 5C0XI 1YIJA 3J81j 3CMEA 2XTIA 4X62Q 4IO9A 1M90C 2NVTH 5JJIA 4AIMA 4BA1I 5GAEC 3KF6B 3E9IA 3HKZG 1XMQQ 1N33Q 4C3JH 3JC66 3I4NH 1VQIA 1E7ZA 4YCVA 1JB7A 4A3IH 1TWFH 5K36G 3L2PA 4AQYQ 4A4IA 1YJ9A 2EIFA 3S14H 4JI1Q 2NZOA 2UXCL 3K0XA 3MXNB 1W3SA 2JA5G 4DV1L 1G51A 3TS2A 2ES2A 3ERSX 4GS3A 5IT9c 4HIKA 4DPGA 4QY7A 3RLNA 3UE1A 4JC0A 2HHHQ 4GKKQ 1YI2A 3CCRA 1SN8A 1I3QH 1FL0A 4DR1Q 1YNXA 4LF6Q 4BY7H 1LM0A 3K7AH 1VQFA 1PH8A 2Y0SG 3M4PA 2KCMA 2XGTA 4QL5A 5M3FG 3VDYA 1VQMA 2JE6I 3ULPA 3LGJA 2MO0A 4R4TA 1Q8KA 5IYDG 1Y1WG 3FHWA 3NBHB 4R4CA 4C2MH 1XJVA 2VS1A 2R7ZH 2LXKA 4DR4L 4GN5A 3CCLA 3M9BA 1H95A 5IP9G 1MJCA 2WB1G 3A0JA 4KHPQ 2IX0A 1QZHA 1PH6A 4BA2I 1AE3A 2ZTCA 4X65L 3I56A 4IPCA 4A3GH 2UU9L 5EAYA 1WI5A 3RZOH 3U50C 4X6AH 2R7FA 4UP7A 4YHHL 5IYBG 1C7YA 2E5LQ 4K0KQ 1WCMH 1VQJA 1K8AC 3CCEA 4JYAL 1OXXK 1V43A 2N49A 2PI2E 3S1RH 1VCIA 4A3LG 1KD1C 1YJWA 4IPHA 1SRUA 4IPDA 5M5YH 4OONA 2GVAA 5IY0A 1VQAA 1Y1VH 2KHIA 4PMWA 1ASYA 3HOWG 5ELNA 4GNXB 3GTPH 3K80C 4JI5Q 4DUYL 3DM3A 2JA6G 4OX9L 1I50H 3RLFA 4OWXB 1M1KC 4DAMA 2EQSA 5GROA 4IOCA 3M4OH 1R9TH 1S3OA 1SR3A 1Q82C 2VY3A 2PQAB 1JT8A 2NN6I 1NE3A 1S72A 2YU9H 2H5XA 1NMFA 4OO1G 3H0GG 1HZBA 2PQAA 3BJUA 3KOJA 4UPAA 3PO2H 4A3EH 4A3BH 3RNUA 1A8VA 3A5ZB 1NJIC 3HOUG 3OW2A 1PFSA 4QIWE 4JI4Q 4JI2Q 1YITA 3RZDH 1UE5A 4JCVE 4A3DG 1N36L 2UUAL 3EN2A 4BBRG 1GKHA 1YVCA 2Z6KC 5DLQE 3UE0A 4X66Q 3JAMc 1XMOQ 4MZ9A 5IWAQ 3Q8DA 3S1MH 1PH7A 2A1AA 2KHJA 2RHQB 3B6YA 4A3CH 1XNQL 2WP8J 5IP7G 4IJHA 1UE1A 2N3SA 4DV3Q 2YTVA 2GVBA 2MQHA 5LMUL 3NELA 4IFDI 3PUXA 4WJ4A 5C3EG 3J80i 3S17H 3KYHC 2ASBA 4JBJA 4DV0L 1HR0Q 2JA8G 3KFUA 4R4QA 3PV0A 5C4JH 2ZM6L 4LF7L 1PH4A 4A3KH 1Q7YC 3HKZE 2UUBQ 1HH2P 3BU2A 3G71A 1EOVA 4JBWA 2Z0SA 1Q46A 3E0EA 4A3MH 1VQ4A 1Y14B 1ASZA 1N32L 4DK3C 1XTDA 4NXMQ 2IHFA 1HNZL 3GTOH 2WAQG 3GDEA 4GOPA 5HY6A 4LUZA 2KCTA 4TQUS 5LMNQ 5FLMG 4IOAA 3PIOA 2AWNA 1IXRA 2VNUD 5M3MH 1N9WA 3KLWA 1VQPA 4MNOA 2PMZE 4HJ7A 3H3VI 1NTGA 3E9HA 3I4MH 3GTQH 3S16H 1CKMA 4JI6Q 3CC7A 1UE7A 1UE6A 1U0LA 4LF5Q 4MTNA 3GO5A 2Y0SE 2OTJA 2JA7G 3HKSA 2R93G 5IYCG 4P73A 3I2ZA 4DV5Q 1VQOA 4B3MQ 4HJ5A 2VUMH 3S2DH 2I5MX 4X62L 2B63G 3HOYG 1K8GA 4YCWA 4AH6A 3RLOA 4PZ8A 4YY3Q 3H15A 4RG1A 3HOXG 3BZCA 4APVA 4BY1H 2ZJQA 2ZJPA 1XMQL 1N33L 2AMCB 3KF8B 2WB1E 5BR8Q 2HQLA 3SGIA 1XNRL 4HIOA 3CXCA 3UDIA 4C3IH 4AQYL 1J5EQ 5J3BA 4JI1L 1WYDA 4DV6Q 1K73C 1HR0W 3GTKH 4A3IG 1HZ9A 4ME3A 4GLVB 4XTCS 4DV2Q 4JI8Q 1X3FA 1E1OA 2JA9A 4GKKL 2HHHL 3M85A 5C44H 3I7FA 4BBSH 4DR7Q 3J7ZC 1P8LA 1QUQB 5M5XH 4DR2Q 1X9NA 1B7YB 4DR1L 2YTYA 3U58A 1QUQA 4GLAC 1Q81C 1KC8C 4LF6L 2R92H 1IBKQ 2UXBQ 3J7A5 1PHJA 4LFCQ 3FKIH 4HIDA 3MEFA 1MIUA 4GLXA 2E2HH 3HOZH 4A93H 4BY7G 3CPFA 3AFQA 3CCVA 2E2IH 3GTGH 3TRZA 1VQCA 2CQOA 1OXTA 2Q2HA 4PZ6A 4A3JH 1A63A 5GQOA 1UEBA 2R6GA 4JI3Q 4KHPL 1W2BA 2Q2UA 2R7ZG 4QGUA 3K8AA 4NPSA 1OXUA 3NENA 3KJPA 1GVPA 5M5WH 4HJ8A 1TWHH 3TS0A 1Y1WH 4HJAA 4B3RQ 4K0KL 2E5LL 3CD6A 3UDFA 1EIFA 4R4IA 4QJFA 3OTOQ 1E22A 1QVCA 3TREA 3OYYA 3AEVA 4H02A 1SMXA 3I55A 4PZ7A 1N34Q 1WFQA 1WJJA 4J15A 1WCMG 3BZKA 3S24A 4YWMA 2D0PA 3CQZH 1IBMQ 2JJQA 4GNXC 2D62A 4HJ9A 1JMCA 4DR3Q 2UXDQ 1X55A 4EX5A 2UUCQ 4GN3B 4YCUA 2FXQA 4UP9A 4LFBQ 3CF5A 4O2DA 3ER0A 3RN5A 1QZGA 4JI5L 4KHZA 2BA1A 1KQSA 2A19A 1Y1VG 4P74A 3CP0A 1VQLA 2QEXA 2CWAA 2LSSA 5GADC 2NVXH 4WJ3M 4A3FH 1G291 1YJNA 3K7UC 5C0XJ 3CCMA 3F2CA 1VQ8A 1KXLA 3M3YH 1HNWQ 5AJ3Q 3I4OA 4NB3A 4P72A 1I94Q 1V9PA 1L1OB 3KJOA 3STBD 1VQBA 2PI2A 4O0AA 1VQ7A 1NMGA 2YV5A 3CAMA 3A5UA 3GTMH 5FJ8H 1L1OA 4B3SQ 1YHAA 3S1QH 1I5FA 4A3BG 2K50A 4JI4L 2WAQE 2V1CC 1N8RC 3T1YQ 4A3EG 4JI2L 3PO2G 4OO1I 4A75A 1KIXA 3S15H 4OX9Q 2CCZA 1KHIA 1XMOL 1S40A 3PO3H 4X66L 1IZ6A 3PF5A 1NY4A 5IWAL 3UDGA 4XIGS 4JI0Q 1XPRA 3W1GA 1JE5A 2HIXA 2K5NA 2DGYA 1VQNA 1Q1BA 1VQEA 3GD7A 3M4QA 4LF4Q 3AYHB 2VQFQ 4DV3L 1SFOH 1BVSA 2R7DA 4P75A 1EQQA 4P71A 1AH9A 3F2DA 4DUZQ 1V1QA 3L7ZC 1HNXQ 4A3CG 3HFZB 4NXNQ 4DKAC 4LFAQ 1HR0L 1D8LA 4OWWB 1RIPA 3TQYA 4LF9Q 4DR6Q 1SLJA 4JOIA 4LNQA 4GKJQ 4JI7Q 4TVAB 3T1HQ 4GOPC 5IP7H 3UDXA 4DV7Q 2L15A 1KRSA 1LUZA 3NEMA 2UUBL 1HZAA 1Q1EA 4GOPB 1EIYB 4B3TQ 1XPUA 3PF4A 3J81c 4NXML 1PH1A 4A3KG 4RMFA 1EYGA 3PGZA 1VQGA 3EIVA 5LMNL 4A3MG 2OWOA 2VL6A 2R93H 1C0AA 4LUVA 5FLXc 4JV5Q 5JJKA 5C4XH 1EQRA 2KBNA 4DK6C 5JJLA 3EBEA 4ALPA 1KL9A 2D0OA 2E2JH 4JI6L 3H3VH 1NBWA 5M3MG 1IBLQ 4UY8C 3F2BA 2EXDA 1FJGQ 3FP9A 1OXSC 4LF5L 2F4VQ 4X64Q 4BXXH 2RF4A 3I4MG 2VQEQ 3J80c 2ATWA 4JG2A 4DV5L 4B3ML 2RCNA 2QGQA 3AFPA 3HOVH 4JBKA 1OTCA 2JEBI 2E8GA 1B70B 1KRTA 4YY3L 1A62A 2VUMG 4EQ5A 4DV4Q 4YWKA 1FVIA 2VW9A 5BR8L 4LW1A 4BXXG 3ICEA 4DR5Q 4LF8Q 3I4NG 1X6OA 2LXJA 4DV6L 4DV2L 1JJCB 3WWVA 4JI8L 4L5SA 3G4SA 2ID0A 4DR7L 4YWLA 1CKOA 3W5OA 4DR2L 1VQ5A 3AQQA 2K75A 2YTXA 4L5TA 1RL2A 3KF6A 2JA5H 2UXBL 1IBKL 1XNRQ 1PVOA 2F52A 5C44G 4BBSG 4Y7NH 5LMNW 1CKNB 4LFCL 1TWAH 1BBWA 5JEAJ 4C3HH 4POFA 5HGQA 2UXCQ 5IE8A 2AWOA 1CKNA 3L0OA 4IFDJ 1X3GA 2R92G 4OXPA 4DV1Q 4IJLA 3ZJYC 1I6HH 2IY5B 3RN2A 1YHBA 4AYBG 2N78A 5GAGC 3FKIG 1K83H 1SROA 2F3IA 2ZTEA 3CCJA 2ALYB
chains in the Genus database with same CATH superfamily
1D7QA 4FXKC 4JI3L 1FNUA 3DXJC 1PTOC 3LNNA 1DGSA 4Y52H 1YZ6A 3MAQA 3CMAA 4G7ZC 4L6TB 4A3GG 5BN4A 1XWEA 1SYBA 3OTOL 3U4ZA 4DR4Q 1LTLA 3S1QB 4KY7A 1EL0A 3D31A 4RGMA 5IYBH 1CZGA 2UXDL 1AE2A 5E7NA 3PO3B 1VQKA 3DWQA 3VYSA 2K5HA 3MXPA 2NZHA 5LHY1 2K4KA 1HJPA 1JE4A 1B9NA 2AHOB 3J81E 3HS0C 2HUGA 3HP3A 2I5HA 3MTSA 1O78A 3WDNA 4B3SL 1IKLA 5FLXE 3G6EA 3T1YL 3PUZA 2EY2A 2B2VA 5FJ8G 1TWGH 2NVQB 5JJZA 3HEJA 1YEZA 2GN5A 4KLKA 3SE0A 1DONA 1EFWA 2MFIA 4JOIC 3PUWA 2E74C 1C48A 4QUCA 4BBRH 2KVMA 5AFWA 5C4XB 4ULLA 4DUZL 3J81i 1HNXL 2Z4HA 1A3UA 2CKZB 2E2JB 4L63B 1IL2A 2UUAQ 3KDFB 3PMFA 2F0FA 2B2WA 1KDCA 2OTLA 1X65A 1G6PA 1C9OA 4L5RC 5C3EH 2RCFA 1XNQQ 2G5DA 1X3EA 3FVQA 2JA8H 4IUTA 5LMUQ 1SMYC 2Q2TA 1EWCA 1XX8A 1JWUD 1U5KA 2ZM6Q 2K14A 1GD7A 2RSOA 5FO8B 2OXPA 1IBLL 4R1JA 4A76A 3MWYW 4PMCA 1Q90A 2L9HA 3OOCA 2VQEL 3D6CA 4RA8A 2L5TA 1A2TA 4KI0A 5LL6X 4AYBE 1BCPD 4Y7NB 1TWAB 1LT4D 2PMZB 3D4WA 3V96A 2MO1A 2JA7H 1HCZA 2R93H 1WTHA 2NVYH 1MKHA 5EGTA 1GUNA 1NSNS 3STBC 2BA0A 2B63H 2ZT9C 1GM5A 3D6WA 1XPOA 3Q23A 5C0XI 3T4AC 2XTIA 1M90C 2NVTH 2FINB 5I2YA 4BA1I 5GAEC 4KY5A 3E9IA 3JC66 1J9OA 3I4NH 4N8FA 4EVOA 3TP6A 2NZOA 1ZKOA 2R7ZB 3EJIA 3MXNB 1W3SA 2LS01 2JA5G 2NTSA 3TS2A 4GS3A 4FF2A 1Z7TA 1K3BC 1YNXA 4LF6Q 1O7ZA 3K7AH 2FFKB 1YNJC 2XGTA 4QL5A 1VQMA 2JE6I 4P2CB 5KIXA 1Q8KA 3FHWA 1WD0A 2HD3A 2EY5A 3M9BA 1W6JA 3A0JA 4KHPQ 1QZHA 3GTPB 2PZUA 4DNTB 3SR1A 4QB4A 4LAAA 4CDDC 3GQBA 1B50A 4A3GH 2K6AA 2R7FA 1TU2B 4K0KQ 2E5LQ 1WCMH 1VQJA 2O5IC 1TY0A 5DAUA 1STNA 4FNFA 4XQJA 1KD1C 1V1OA 4OONA 3RZDB 1Y1VH 2KHIA 5EBDA 3HOWG 5FKAC 5ELNA 1DXMA 3R3OA 4IUNA 1CFMA 3DEOA 3DM3A 2JA6G 1I50H 4KJOA 4OWXB 4DAMA 2EQSA 5C3EB 2J0TD 3NWTA 4RCNA 2XRQD 2JA8B 3FEWX 4OO1G 2K01A 3KOJA 4KKTA 3M4YA 3TP7A 1S4ZA 1HA5A 1QNUA 1A8VA 3CKIB 1JJGA 2A68D 5KNBA 1YITA 2O4XA 3HZXA 1LTRD 4A3KB 5DLQE 4X66Q 3JAMc 1IL8A 4MZ9A 3P1HA 3QJYA 3Q24A 2KOLA 2KECA 3QWNA 4QF4A 2MQHA 4IFDI 2MJ8A 1SNDA 3J80i 2H4OA 2ASBA 4JBJA 2A74C 1HR0Q 3I4MB 4R4QA 2JA7B 3S16B 3PV0A 2NVYB 1PZJD 3MHBA 4N8X1 2F0MA 3VYTA 1X32A 2B63B 2LFNA 1HPCA 1HH2P 3G71A 1EOVA 1PTOD 1Q46A 2FMMA 2NVTB 3GDEA 3AB9A 5T1IA 4LUZA 2KCTA 1IXRA 5M3MH 3I4NB 1SAPA 1ESRA 1EY6A 3GTQH 1DZ1A 1CKMA 1DCZA 1HHVA 2O5JC 1U0LA 1PFBA 4MTNA 1B4OA 2Y0SE 2J4XA 1VQOA 5C44B 1ONLA 5M5XB 1RD9D 3K7AB 3HOXG 4PZ8A 4O42A 1EFID 1RHPA 4JPBW 2AMCB 3KF8B 2WB1E 4HIOA 1MI2A 1J5EQ 4C3JG 1G2SA 5C5LA 4DV6Q 1R4PB 1K8OA 1HZ9A 5D3IB 4XTCS 4K2LA 4XDXA 4A3GB 2HHHL 4BBSH 1WCMB 1QUQA 5C5MA 1F9RA 2MUYA 1BO0A 4RKBA 4LFCQ 2LY7A 1MIUA 3TDQA 4A93H 4G4KA 3CPFA 3CCVA 2E2IH 3X3NA 3TRZA 2CQOA 1F2ZA 1Y1VB 4A3JH 5GQOA 4K8IA 3R93A 1S5ED 1UEBA 2NWGA 2R6GA 4XYOA 4JI3Q 1NR4A 1SEBD 3H09A 1SMYD 4RH6A 1GVPA 5M5WH 4HJ8A 1TWHH 3TS0A 3JAME 4HJAA 2EE1A 1IW7C 1EIFA 4R4IA 3M3YB 1QCBD 3OTOQ 1QVCA 1STEA 1ET9A 2EYHA 4H02A 3I90A 3I55A 5JPMC 1PMRA 1WFQA 1I6HH 3BZKA 3C3LA 4IUVA 4DN4M 2JJQA 2D62A 5CC4A 1JMCA 2UXDQ 4PV1C 4PMBA 1X55A 2HCCA 4EX5A 3OIPA 2F0LA 3RN5A 3TP8A 4P74A 1Y8PB 3CP0A 2QEXA 3KBXA 2LSSA 3KLSA 5BN3A 1G291 3VYRA 4OGQC 2CVRA 1L1OB 3STBD 1A3VA 1NMGA 2YV5A 4B3SQ 4JI4L 2WAQE 1N8RC 3T1YQ 4A3EG 2EDGA 2XIWA 4A75A 1KIXA 1PXUA 2CCZA 1KHIA 1XMOL 1LT5D 1M4VA 1R4QB 3S9WA 1IZ6A 3PF5A 1H9RA 1X3PA 5IWAL 4LMQD 4XIGS 5JVG3 1XPRA 3W1GA 2DGYA 4DV3L 5M3MB 4P75A 1EQQA 3F2DA 4DUZQ 1JWSD 1MHWC 3L7ZC 1HNXQ 4DKAC 3GTQB 4OWWB 1RIPA 3QOJA 4K5VA 1LACA 1OO9B 1SYEA 3UDXA 4ZQ3A 2EYPA 1K0SA 1HZAA 1PRTC 4XQNA 1YNJD 5CV4A 4FF1A 1EYGA 1PRTB 4UAIA 3BVMA 4F87A 1WTOA 2AQ2B 2A73B 4DK6C 5JJLA 3EBEA 4ALPA 1KL9A 2D0OA 3H3VH 2RDHA 4KTAA 1IBLQ 4HN7A 1OXSC 1CTMA 1MSHA 2VQEQ 1GHJA 4DV5L 4B3ML 3X3MA 2RCNA 1EIHA 4IN3A 3AFPA 3HOVH 2ZXOA 4YY3L 4X3SA 2VUMG 4MN3A 3KBGA 3ICEA 2E2IB 4A3JB 3VR3A 1KLGD 1K83B 2BE5C 2PYKA 4TSSA 3WWVA 2EXZA 5EPKA 3W2DA 4L5SA 5M5WB 1TWHB 2F0QA 4DR2L 1B44D 1SBBB 2ZXPA 1RL2A 1EIGA 1A2UA 4B9WA 1BBWA 1I6HB 3E3XA 2AWOA 2K04A 1WTXA 2IY5B 3ZJYC 4V0BA 4AYBG 2N78A 5KRUA 3FKIG 1SROA 1BR9A 1ILQA 2ZTEA 4CJ2C 1RTOA 2ALYB 2B2YC 1K9MC 3VR6A 1AN8A 2DUDA 1PH9A 1TS5A 1PYBA 4NKLA 4OWTB 1DYQA 5IYDH 1Z9FA 4ID6A 2ICEC 4FDBA 5IOCA 3K6OA 1AW7A 3PUVA 2IWHA 5J1ZA 3URYA 5H1SE 1V8QA 1Z47A 1N34L 1HTPA 3TMEA 3AMUA 2QCPX 4DR3L 5ELOA 2UUCL 4JW0A 1BBUA 3M7NA 4MTKA 1ET6A 1PH3A 1JOOA 3GTJH 3CW2C 4A3LH 1JOQA 1RKNA 1KLUD 1KAWA 3RR5A 2BH8A 3GV3A 3OPOA 3G48A 4POGA 1QG7A 2EOTA 1HNWL 3DLLA 1D5MC 3H6MA 2A8VA 1J6QA 2IT1A 4A3FG 1PH2A 1I94L 3BYYB 5IGBA 4TKOB 2NN6G 1FGUA 4DR6L 1PV4A 5GAHC 1SXTA 1LV9A 1WOCA 3H0GH 2B2UA 3DWAA 4RGNA 3D3RA 2F4IA 3ULJA 3K81C 1WVLA 4XT3B 2FMCA 4U673 4G7OC 4LF4L 2F0EA 1EWIA 2RQXA 3H3VC 2K5VA 4M8AA 4QMGA 4ZRZA 4QIWB 4PNYA 1HZCA 5JEAG 4E6IA 4GKJL 2PNHA 4JI7L 3KDFA 1Q86C 1TQOA 2X6LA 2PW5A 1FNWA 1K3RA 4DNRB 2Z9HA 2NVQH 1X54A 2OQKA 5I9OA 1RODA 1VQDA 4EQNA 1S5FD 3HOVB 2KENA 1WTQA 5IT9L 4PG3A 2BH2A 3MFGA 2AKWB 1SNQA 3ONAB 4R4OA 1YBYA 2TMPA 3QIAA 5CMDA 3CC2A 1GO3E 1LTGD 1ICFB 1W6KA 1IW7D 1UWVA 2F0JA 3EROA 1E1TA 4KJNA 3SXHA 1ML0D 1CK1A 5HGTA 4NW2A 4DV4L 2L4NA 1DOLA 5IODA 1B53A 2ZJRA 3D0FA 2B29A 1CA6A 3IRBA 1J5EL 1BCPF 1G6ZA 4LF8L 4J1MA 3HOUH 4ILWA 4HIMA 2Q2IA 1MGSA 1YIJA 3J81j 1WTPA 3NK9A 1EYCA 4WFN3 1VQIA 1LTSD 4A3IH 2KJXA 3QG1A 2K5QA 1YJ9A 2EIFA 2B2TC 2UXCL 2WKDA 3K0XA 4M1UB 2AUJD 1GJXA 3T56B 5ISRA 3ERSX 2A6ED 3BG3A 2ENBA 3RLNA 3UE1A 2HHHQ 1YI2A 3CCRA 2Z1CA 3GTJB 4CKEA 1CZWA 2A6HC 2Y0SG 5ELBA 5M3FG 5CV8A 3VDYA 4HR7B 4KY6A 5CYUA 3GP7A 3ERQA 5G3LF 1XJVA 4ZKCB 1SE4A 2EVBA 1D5XC 5DNFA 4GN5A 2R7ZH 2NZ1D 3MZ5A 1RDPD 2WB1G 3A55A 3HGBA 5IP9G 3DWPA 5FK9C 4BA2I 1PRTD 2ZTCA 3H0GB 4X65L 4IPCA 4J6HA 1BNZA 3U50C 4YHHL 1C7YA 3A8JE 4JYAL 2N49A 4A3EB 1TS4A 2PI2E 3S1RH 1VCIA 4X3TA 1SRUA 4IPDA 2DNCA 1ASYA 3EFXD 1ZXTA 3GTPH 4DUYL 5I9PA 1TT2A 5GROA 3M4OH 2JXMB 1SR3A 3CRKC 2VY3A 1QNKA 2J7ZA 2PQAB 1S72A 3OMGA 2H5XA 1NMFA 4ZUJA 4A3BH 3BJUA 1K28A 3PO2H 5EKKA 4F8MA 3N6RA 5KEEA 2K03A 5C4JB 2BE5D 3OW2A 4JI4Q 3RZDH 4A3DG 1HA6A 1N36L 1XMOQ 1GUWA 2DJFC 5IWAQ 2L0CA 2F0UA 4A3CH 4EQPA 1EYDA 2WP8J 4DV3Q 2YTVA 5K5PA 1Z6HA 5EKLA 2WIIB 3C2PA 1IYVA 4FF3A 3KFUA 2EYFA 2K7VA 2E2DC 3QB3A 4LF7L 4DAVA 3HOUB 4A3KH 1CA5A 1Q7YC 3HKZE 3BDOA 3BU2A 2K32A 4JBWA 2Z0SA 3E0EA 1Y14B 4DK3C 3FPPA 2WAQG 2HDLA 5FLMG 2AWNA 3KLRA 2VNUD 1VQPA 4A3IB 2JN4A 2PMZE 4HJ7A 3H3VI 3I4MH 4KN4C 3S16H 2BDNA 3NQTA 3TP5A 1UE7A 3TN2A 1UE6A 4HEDA 2KEEA 4ZUIA 5E1FA 2F0VA 5IYCG 4DV5Q 3I2ZA 4B3MQ 3S2DH 4X62L 4V190 3HOYG 4BXXH 4YCWA 3RLOA 4YY3Q 1IYUA 2RDGA 1XMQL 1N33L 1LTTD 4K8JA 3FKIB 3SGIA 3IFTA 3KF8A 1AP0A 1KNAA 2A69C 5M9OA 3H94A 3C46A 1IKMA 1HUMA 3U9SA 1G91A 3M85A 5C44H 2PPBC 4DR2Q 5M5XH 3O13A 3E5SA 4DR1L 2YTYA 4N9PA 2R92H 1CQFA 4OEMB 4HIDA 4RGOS 3S1RB 2E2HH 1STGA 2K28A 4BY7G 3ND9A 1VQCA 1SNMA 1HXYD 4KKUA 2VB2X 5D65A 3IAYA 5IGDA 5L37A 4GZYC 4QGUA 3K8AA 3QR8A 4FF4A 1OXUA 3J7AV 1MBYA 3M4OB 4QUFA 1T5EA 4HSVA 4DAYA 5CR3A 3UDFA 4A3BB 3PO2B 1E22A 4H13C 1SMXA 3MXGA 1A3TA 1N34Q 2R61A 4J15A 2QW7A 5BN5A 2WINB 2B2VC 3OWEB 4RWSC 4X3UA 4DR3Q 2UUCQ 4YCUA 2B8GA 3DMUA 3R8BA 3S15B 4ZKBB 2D9UA 1S5CD 3J7YW 4JI5L 2A19A 1UEAB 2OT2A 1VQLA 4WJ3M 3ND8A 1YJNA 3CCMA 3BZDB 3F2CA 3M3YH 1HNWQ 2F0TA 2B2WC 3I4OA 4XYQA 4NB3A 1I94Q 3FMCA 1VQBA 4O0AA 3J80L 1ZYRC 5FJ8H 1L1OA 1YHAA 3CHBD 1I5FA 1JCKB 2K50A 4DR6Q 4JI2L 2PW7A 2D5DA 5LL6S 2B39A 3UDGA 1EY0A 4DAPA 1JE5A 2XN9C 3M4QA 4LF4Q 1BVSA 3NHHA 3LWEA 4P71A 2X69A 3HFZB 3NWSA 4XT1B 1X3QA 2EJGC 4GKJQ 4JI7Q 2CW0C 4NP5A 2L15A 4B9XA 2ICIA 1MD2D 3S2DB 1Q1EA 1EIYB 3PF4A 2A6HD 3I4LA 3K5NA 2KUMA 4NXML 1G2TA 2CQAA 3PGZA 1FD7D 1VQGA 5LMNL 4A3MG 1WD1A 2OWOA 1TIID 4WJWA 1NUCA 4LUVA 1H9MA 1QJOA 1Y8NB 2F0IA 2Z8LA 2KBNA 2VB3X 5IGGA 2L55A 1NBWA 4UY8C 3F2BA 3FP9A 4LF5L 2SEBD 5EPLA 2ATWA 4JG2A 2KEDA 5HURA 4RAUC 2KCCA 4JBKA 1JICA 1QWYA 1BF4A 2E8GA 1B70B 2R92B 1F2LA 1A62A 4EQ5A 4DV4Q 2BOSA 1SNPA 1VDZA 1FVIA 2E2HB 3EA6A 2F0SA 2F0NA 4CJ1B 4LF8Q 4LJZC 2Y0SB 2MP1A 4FVMA 1EY9A 1V1PB 4DV2L 4JI8L 2MPMA 1KTKA 1EY4A 4DXGA 3AQQA 2YTXA 2EYJA 3KF6A 3MVVA 2JA5H 2EJMA 4Z9CB 2F52A 3U9OA 2XVSA 3D8GA 5JEAJ 2UXCQ 1JB3A 4RGTA 1YHBA 3RN2A 2PZWA 5GAGC 1K83H 2AQ1B 2F3IA 5ELDA 3HOZG 2CFMA 1O7LA 4H44C 4DAYB 3F1ZA 1TVXA 2GA4B 3CC4A 1I6VC 1OXVA 3A54A 2F0GA 2JK8A 2SNSA 4KKSA 1L2FA 2QA4A 1TY2A 1CHQD 1B9MA 4ZAIA 3F8TA 3K5OA 1O7IA 2C35B 2M2LA 4GN4B 5CGKA 1VS0A 2Z4IA 2CHBD 1BUVT 1GUSA 4KD3A 4X65Q 1HUNA 4IQZA 4FXDA 1EQTA 1SJED 3A8IE 3R2TA 4YHHQ 4IALA 2JYOA 4PQXA 1T9HA 2MHVA 3ULLA 4JYAQ 1ILPA 1C4QA 2EYLA 2RBMA 1L1OC 3JAMi 1PDQA 5KYLA 3HOWH 1SDFA 3WOEA 3SK8A 2PO4A 5AJ3L 2JA6H 1LT6D 2NTTA 1S5DD 1I4QA 1NCVA 4CGYB 2RHSB 1CSQA 1C8CA 4DUYQ 4DFAA 3W1BA 4OO1H 2B8FA 2K52A 1O80A 4GNXA 4QQBX 2C5CA 3PUYA 5JAVA 2HT1A 2HIVA 3PCOB 2DY8A 3PO3G 1SYGA 3OSOA 2VQFL 3SK4A 1GUTA 2A69D 1E3PA 4K5XA 4NXNL 3KK7A 2F0WA 4LFAL 3OW7A 1N36Q 1JR0D 3ITPA 2R3ZA 5I6WA 3A74A 4IFDG 3FRPB 3T1HL 2WFWA 4DV7L 1EEID 1GXDC 1CUKA 3S2HB 4B3TL 3CCQA 4JBMA 2IHEA 5E4XA 2IX3A 1B8AA 2N8NA 4WORA 2Q8TA 4JV5L 1EQVA 5I6YA 4LF7Q 3CU7A 3HOYB 3NE5B 1CSPA 3MC0B 5C4XG 2XRSD 4X64L 1A0IA 1F9SA 1TS3A 4KHVA 3GTLH 4R9WA 1Y8OB 3OMCA 4ZCKA 4KV6A 4NDXA 3E0JA 2JA5B 1LT3D 1PH5A 4G57A 4IPGA 3SHLA 1BKBA 4BY1G 5F2DA 2B3GA 5T1GA 3TZUA 4EGVA 1QVFA 3HOXH 4MHEA 4C3IG 4CKCA 4DK0A 3J7AF 4FP5D 3CMEA 2QILA 4X62Q 2RVLA 4BY7B 3KF6B 1E2VA 3HKZG 1XMQQ 1N33Q 4C3JH 1AZPA 3EQLC 2K1BA 1E7ZA 4U68A 1TWFH 1ZYRD 2K05A 5K36G 4FO2A 5J39A 4QCLA 4DV1L 3VR2A 1F77A 5IT9c 3ZYYX 2EPBA 4HIKA 4DPGA 4C3HG 2F3WA 4JC0A 4S3SA 1FR3A 1LTBD 5A2QL 4R8IA 3RZOB 5EQ0A 1FL0A 1STYA 2PQEA 4DR1Q 1VQFA 4ME5A 2JP1A 4G7HC 2KCMA 3HOWB 3ULPA 2MO0A 3NPPA 3G7LA 1Y1WG 2CW0D 2JA6B 4R4CA 4X3KA 4C56C 5M5YB 1O7YA 1H95A 1MJCA 2DN8A 5A2QE 2LMCB 1GHKA 1PH6A 1AE3A 1S5BD 3I56A 2UU9L 5EAYA 2PNRC 4X6AH 4UP7A 5IYBG 2RA4A 4H0LC 5CV5A 4EQOA 4K5WA 1K8AC 2YU9B 3CCEA 1OXXK 4O1NA 2QEJC 3T51B 3K5LA 2EYOA 1STHA 1BCPB 2WV6D 4BWGB 1B2TA 4GNXB 2L12A 4I7AA 4JI5Q 2C9OA 1E2WA 1M1KC 2KA7A 1L0XB 4JVZA 1JT8A 3NQIA 2QF7A 1H9SA 2PQAA 4UPAA 4A3EH 1UAPA 3A5ZB 1NJIC 4LK1C 4QIWE 4JI2Q 5IGCA 4JCVE 1D5ZC 4BBRG 3UE0A 3Q6SA 4A3MB 2NUCA 3A56A 3BVGA 3Q8DA 3S1MH 1WTRA 3GTLB 2A1AA 2RHQB 3B6YA 3K0YA 4OIJA 1UE1A 1HFGA 2N3SA 4DGZA 2GVBA 2RDFA 3NELA 4WJ4A 5C3EG 1AZQA 3S17H 4DV0L 2JA8G 1VMPA 5C6AA 5C4JH 5C3WA 1PH4A 3HOXB 1ENAA 1VQ4A 1ASZA 1N32L 4NXMQ 5NUCA 1HNZL 3GTOH 3UI2A 4GOPA 3H91A 5IT9E 5HY6A 4TQUS 5LMNQ 1G8ZD 1Q8IA 4C3JB 3PIOA 3KLWA 4MNOA 3AU7A 1TWFB 1NTGA 3E9HA 1PYWD 3SEBA 4ZK9B 4HCSA 5EKIA 4DXFA 4LF5Q 3D4RA 3GO5A 5EJWA 2JA7G 2QDBA 3HKSA 2R93G 4P73A 4XXEA 2VUMH 4HJ5A 2HDMA 2B63G 4AH6A 4BY1H 1QOHA 4RG1A 3BZCA 4APVA 3NTHA 2ZJQA 1DOKA 4R8NA 4C3IH 4AQYL 1CI3M 5J3BA 4JI1L 1U9RA 5FO9B 1F2MA 5JPNC 5JOBA 4ME3A 4GLVB 4DV2Q 4JI8Q 4I65A 1E1OA 1NAPA 4GKKL 2F3VA 3J7ZC 1PZKD 1X9NA 1B7YB 3U58A 1Q81C 4GLAC 4MIUA 1FGBD 2KHSA 3I3CA 3FKIH 3KLSX 1A15A 5TSSA 4CDFC 4IUUA 5E3FA 3RD4A 3T16A 5KYIA 2Q2UA 4NPSA 1QB5D 1Y1WH 3T13A 4C1NK 3CD6A 1EU3A 2HQEA 1PTOB 4QJFA 3TREA 1SJHD 3OYYA 2IL8A 2P5ZX 3E6ZX 4PZ7A 1WJJA 3MEHA 1WCMG 3A8KE 2D0PA 3GTMB 2B2UC 4NMZA 3J81L 5ELEA 2SNMA 4GN3B 2FXQA 4CDCC 1RTNA 5ELFA 1XYIA 1QZGA 5FLXL 2BA1A 2CH4A 5CBEE 1KQSA 1Y1VG 3S1MB 4JK1C 2N55A 1H9SB 2CWAA 2NVXH 4H7BA 4A3FH 3K7UC 5C0XJ 1VQ8A 1KXLA 2NN6H 5AJ3Q 2QKIC 4CDEC 3BYTB 3S17B 4P72A 4B08A 3NTIA 3N52A 1B3QA 3CAMA 2V1CC 4OO1I 1KDBA 1KABA 4OX9Q 3S15H 2M9VA 3GTOB 1D1KA 2HIXA 2BCOA 2CH4W 5CV6A 3AYHB 5EPJA 2VQFQ 1SFOH 2EZVA 5JEAH 1AH9A 1EWHA 5D3DA 4Q5VA 1V1QA 5JVH3 4NXNQ 4C1NI 4LFAQ 3TQYA 3SK5A 4LNQA 1JC7A 3G6JB 4KK7A 1I4XA 4TVAB 3T1HQ 4GOPC 1TR5A 3KUPA 4DV7Q 1KRSA 1LUZA 3L9AX 2UUBL 1ENCA 2MGSA 2VUMB 4CHTB 4GOPB 4B3TQ 1QE6A 1VF7A 4UHVA 1PH1A 2NYZD 4BY1B 3EIVA 1BOSA 1PTOF 2ZXRA 1VMCA 4JV5Q 3V2TA 4OL7A 1KDAA 4C3IB 3LX0A 1BBXC 4JI6L 3F2UA 2E76C 5M3MG 2EXDA 2EYMA 3HKZB 4X64Q 2RF4A 3J80c 2WKCA 5KGUA 3MFYA 2IW3A 4N9TA 2QGQA 1OTCA 2JEBI 4K2KA 4AYBB 2A5HA 4YWKA 4IZ8A 4C3HB 2VW9A 5BR8L 1H9KA 3K59A 2PCFB 1X6OA 4OELB 2F1MA 2L1BA 1V1PA 2E75C 2ID0A 4DR7L 2DNEA 1Y1WB 1VQ5A 2K75A 2UXBL 1IBKL 1XNRQ 1PVOA 4BBSG 2BDOA 5LMNW 1CKNB 4POFA 5IE8A 3L0OA 1B3AA 4IFDJ 1LTAD 1X3GA 3HRZC 4Q0FA 4IJLA 4DV1Q 1TKWB 1KAAA 3NENA 1SLJA 3CCJA 4A93G 5CV7A 3U4VA 1DD2A 5M3FH 1SYFA 4A3JG 1L0WA 3RMHA 2NVXB 1QILA 5G3LD 4A3FB 1SSOA 4IUPA 1D2BA 3PQIA 5CORA 4B3RL 5I2XA 1K0RA 1PFNA 4DK1A 5IP9H 1I4GA 2EY6A 2F0HA 3BDCA 1P16A 2I0QA 1I4RA 1EUJA 5C4HA 1A6XA 1F9PA 3NBHA 1IBML 1PA6A 1NR2A 4K6LA 2I5LX 1EU4A 5IGEA 3C1EA 2UU9Q 4L8JA 4LFBL 1JQYD 1TWGB 2I46A 1E24A 2MNAA 3NTKA 2YYZA 2RSNA 4UDUC 5CBAE 1SFOB 2F03A 1DJRD 1SNOA 1U4RA 4BBRB 3PIPA 2CWPA 1VQ9A 3CPWA 3QOLA 1PYSB 4HMIA 1IYJB 1TXYA 4DNIA 2OCEA 4CKBA 2EJFC 3K5MA 1VQ6A 1BXTA 4JI0L 4XQQA 1STBA 1ICWA 1U4LA 3J80E 2F0DA 4A3DH 1Q12A 1UNSA 3PIO3 2OQ0A 1D6EC 3M7GA 4LF9L 4CBVA 3R2IA 1FYCA 4RCOA 4F88A 1TWCH 3SDZA 4LWCA 1XTCD 2ZTDA 1LABA 3S1NH 1PFMA 2JEAI 2Z6KA 4F7XA 5FO7B 1X56A 1VQHA 2RKSA 4DV0Q 1F9QA 2XSCA 1LTID 1EY8A 2R93B 3I73A 1SE2A 3DUZA 5DM73 2JQOA 2XNAC 1ZEQX 5FLMH 3CCUA 1N32Q 4DU9A 1FJGL 1SE8A 1LYLA 2WACA 3TEHB 2F4VL 1YNNC 4RHSA 1YHQA 1HNZQ 4LUOA 4UP8A 3S2HH 1EZ8A 1HRJA 1RF2D 1QVGA 4YIJA 4L5QA 1ESFA 1JJ2A 2IX1A 5C0XG 1SNCA 3DHQA 5IYCH 3HOVG 2G9DA 1MJEA 1II3A 3I70A 3PSIA 1BQQT 4DR5L 2VZAA 3HOYH 3SK6A 3CCSA 3A7AB 1AFPA 4HCEA 5M3FB 4IO9A 5JJIA 4AIMA 2JSOA 3VR5A 5A35A 4YCVA 1JB7A 2K33A 2WB1B 3L2PA 3TZDA 4AQYQ 2X6GA 3FPUB 4A4IA 3T53B 3S14H 4JI1Q 2D2CC 1F2YA 2Q8RE 1G51A 2ES2A 5COYA 4QY7A 3WOFA 4GKKQ 3OIQA 1SN8A 1CQVA 1HFNA 1I3QH 3IL8A 4BY7H 1LM0A 1PH8A 1DOMA 3M4PA 3MXUA 1J8IA 1LO5D 3HG9A 1AEXA 3BS1A 5DM63 3JAML 3LGJA 4R4TA 4OHJA 3VYUA 3NBHB 5IYDG 4C2MH 2VS1A 2KCNA 2LXKA 4DR4L 3CCLA 2PZTA 3LWUA 2IX0A 1MSGA 1E2ZA 3K57A 1I50B 2LKVA 2OEOA 1GUOA 3RZOH 1WI5A 3A7LA 1STAA 1VF5C 2B2YA 2HCIA 1M8AA 3NP8A 4A3DB 1V43A 2O2LD 1EY7A 5C3XA 4J8QA 4A3LG 1YJWA 4IPHA 5KNDA 5M5YH 5IY0A 2GVAA 1WTWA 1B1ZA 1VQAA 4PMWA 2F0KA 3QO2A 3K80C 4OX9L 1TWCB 3RLFA 2FHTA 2AUKA 3L3OC 4IOCA 1R9TH 1S3OA 3S1NB 2L11A 1Q82C 3TBIB 1TS2A 1T5XD 2NN6I 1NE3A 5E4WC 2YU9H 3H0GG 1HZBA 3GV6A 1ENFA 1XXGA 3IKJA 3RNUA 1JORA 2NBFA 1WTVA 1LLRD 2SDFA 1PFSA 2DY7A 1UE5A 2WAQB 3I91A 1Y69U 2UUAL 3EN2A 4K6DA 1GKHA 1I4HA 1YVCA 2Z6KC 3V05A 2G9HD 2Q8IB 1U4PA 2A6EC 4HAEA 5CV9A 1PH7A 2KHJA 2I07B 1JOKA 3NUCA 1XNQL 5IP7G 4IJHA 2TSSA 5LMUL 3PUXA 2OF1A 3KYHC 1HTLD 3BDLA 1SE3A 4RKLA 2ZM6L 1PZID 3K58A 5FOBB 1RCVD 4KN7C 2UUBQ 5KNCA 1Q3LA 4A3MH 1XTDA 1UUPA 2IHFA 2F0OA 2Z6BA 4IOAA 3RUZA 1N9WA 3I72A 2M00A 3C1FA 4FXGC 3I8ZA 3S14B 4JI6Q 3CC7A 4CJ0B 5D14A 2OTJA 4KMUC 4ABNA 4ZLTF 3OHXC 4BBSB 1I3QB 5C0XH 2I5MX 3HOUG 2KQ3A 1K8GA 3H15A 2N88A 2ZJPA 5BR8Q 2HQLA 1XNRL 2EY1A 3CXCA 3VA7A 4A93B 2IPKD 3UDIA 4C2MB 2K5DA 2IJ0A 4IUQA 1WYDA 3GTKH 1K73C 1HR0W 1EY5A 4A3IG 3MA2B 1X3FA 5DEHA 2JA9A 1HQRD 4DR7Q 3I7FA 1P8LA 1QUQB 3OWFA 4KD4A 4LF6L 4HTHA 1KC8C 2UXBQ 1IBKQ 3J7A5 2NB0A 1PHJA 1L0YB 3DEPA 3MEFA 1PLFA 4GLXA 5ELCA 2XWJB 3HOZH 5IGFA 4K14A 3AFQA 1D1IA 3P7JA 3GTGH 1GUGA 1OXTA 2Q2HA 4PZ6A 1A63A 3PIP3 3D4DA 2VXWA 2B2TA 4KHPL 1W2BA 4HSPA 2R7ZG 1R9TB 3KJPA 4WRDA 1PRTF 4B3RQ 3P20A 2E5LL 4K0KL 3AEVA 3S24A 1BCPC 4YWMA 1IBMQ 3CQZH 3VR4A 4GNXC 4HJ9A 1DM0B 1YNND 2K5WA 4UP9A 4LFBQ 3CF5A 4O2DA 3ER0A 4KHZA 4ODGA 2QDLA 2AQ3B 5GADC 1K8MA 4RHRA 3Q22A 1PTOH 2H1EA 1V9PA 3KJOA 1VQ7A 2PI2A 3A5UA 3GTMH 3S1QH 4A3BG 3PO2G 4ZYSA 1E0BA 2F0PA 3CRLC 2V4DA 1S40A 3PO3H 4X66L 3NXWA 1NY4A 4JI0Q 2K5NA 1VQNA 1Q1BA 1VQEA 3GD7A 4BS9A 4DA2A 2R7DA 3DM1A 5EBCA 4IFDH 4A3CG 1HR0L 1D8LA 5IIFA 4LF9Q 3FDTA 4JOIA 1EZ6A 1H9JA 5I4DA 5IP7H 2SOBA 1BDOA 3VA5A 3NEMA 2DJGC 4FYDA 4OIKA 1XPUA 3Q0AA 3J81c 1CT1D 4A3KG 4RMFA 3BVZA 3EVQA 2VL6A 3NSWA 3NBIA 1C0AA 1JWMD 5JJKA 5FLXc 2XWBB 2FJ2A 5C4XH 1SYDA 1EQRA 1I4PA 1KNEA 2E2JH 3GTKB 1EEFD 1GOZA 1HQMC 1FJGQ 4I7ZC 2F4VQ 5C4ZA 1SYCA 3I4MG 1EYAA 3IFDA 5J22A 1FNVA 4TRDA 1KRTA 1NNXA 3W3AA 1U4MA 3TSSA 3HOZB 4LW1A 1CM9A 4BXXG 1IHZA 4DR5Q 3GTGB 3I4NG 2LXJA 4DV6L 2A68C 3P75A 1JJCB 4HMJA 4DF7A 1RJTA 3G4SA 5K36H 1EOTA 4YWLA 1CKOA 3W5OA 4L5TA 5C44G 4Y7NH 4LFCL 1TWAH 4C3HH 5HGQA 1CHPD 4IURA 1CKNA 4RFBA 3CQZB 2R92G 4OXPA 3SVMA 3MXNA
chains in the Genus database with same CATH topology
3HOZG 4A93G 1D7QA 2CFMA 4JI3L 2DUDA 3U4VA 1PH9A 4DAYB 3F1ZA 5M3FH 1PYBA 4A3JG 3CC4A 4OWTB 1OXVA 1L0WA 2JK8A 5IYDH 1DGSA 4Y52H 1L2FA 1YZ6A 1Z9FA 2QA4A 3CMAA 4FDBA 4B3RL 1K0RA 4A3GG 5IP9H 3PUVA 3F8TA 5H1SE 3OTOL 3U4ZA 1O7IA 1P16A 2I0QA 1Z47A 4DR4Q 1EUJA 1LTLA 2C35B 4GN4B 1N34L 1VS0A 3D31A 1IBML 1PA6A 5IYBH 2I5LX 4DR3L 2UXDL 5ELOA 2UUCL 4X65Q 1AE2A 5E7NA 1BBUA 3M7NA 1VQKA 2UU9Q 4LFBL 2K5HA 4YHHQ 1JJGA 1PH3A 3GTJH 3CW2C 1E24A 1T9HA 4A3LH 2MNAA 3ULLA 2NZHA 4JYAQ 2YYZA 2K4KA 1HJPA 1KAWA 3RR5A 1L1OC 3JAMi 2BH8A 2AHOB 3G48A 4POGA 3HOWH 1HNWL 5AJ3L 3DLLA 3PIPA 2CWPA 1VQ9A 1J6QA 3CPWA 2A8VA 2IT1A 4A3FG 1PH2A 1I94L 2JA6H 1PYSB 2I5HA 2RHSB 4B3SL 2NN6G 1FGUA 4DR6L 1CSQA 1PV4A 3G6EA 5GAHC 3T1YL 4DUYQ 1IYJB 3PUZA 3W1BA 1TXYA 1WOCA 2OCEA 2K52A 3H0GH 4DNIA 4GNXA 4QQBX 5FJ8G 1TWGH 3PUYA 3ULJA 1YEZA 2GN5A 2HIVA 3K81C 4KLKA 4JI0L 3PCOB 2HT1A 1VQ6A 1EFWA 3PO3G 2MFIA 4JOIC 4A3DH 4LF4L 3PUWA 1Q12A 2VQFL 1EWIA 4BBRH 2K5VA 1E3PA 2OQ0A 3J81i 4DUZL 1HNXL 4NXNL 2CKZB 4LFAL 1IL2A 1N36Q 2UUAQ 1HZCA 4LF9L 3KDFB 5JEAG 1K9MC 4GKJL 2PNHA 4JI7L 3A74A 3KDFA 1Q86C 4IFDG 3T1HL 2OTLA 1X65A 1K3RA 1G6PA 2WFWA 4DV7L 1C9OA 4L5RC 1TWCH 4LWCA 1CUKA 5C3EH 2NVQH 2ZTDA 1X54A 2OQKA 1XNQQ 1X3EA 4B3TL 3S1NH 2JA8H 2JEAI 2Z6KA 1VQDA 3CCQA 4JBMA 2IHEA 5LMUQ 2Q2TA 2KENA 1X56A 1B8AA 2N8NA 1VQHA 4PG3A 4DV0Q 2BH2A 4JV5L 1U5KA 2AKWB 2ZM6Q 2K14A 1GD7A 4LF7Q 4R4OA 2JQOA 1IBLL 1CSPA 4R1JA 1YBYA 5FLMH 4A76A 3CCUA 1N32Q 5C4XG 1FJGL 1SE8A 1LYLA 3TEHB 2F4VL 4X64L 1HNZQ 1A0IA 1YHQA 4LUOA 4UP8A 1GO3E 2VQEL 3CC2A 3S2HH 3GTLH 4KI0A 1QVGA 1UWVA 4L5QA 4AYBE 1E1TA 1JJ2A 1PH5A 2IX1A 4DV4L 5C0XG 4IPGA 2MO1A 1BKBA 4BY1G 5IYCH 2NVYH 2JA7H 1MKHA 2ZJRA 1MJEA 3HOVG 3D0FA 2B29A 3PSIA 3IRBA 4DR5L 2VZAA 3STBC 1J5EL 2B3GA 4LF8L 2BA0A 2B63H 3HOUH 3HOYH 1QVFA 3HOXH 4HIMA 3CCSA 2Q2IA 1GM5A 1XPOA 5C0XI 1YIJA 3J81j 3CMEA 2XTIA 4X62Q 4IO9A 1M90C 2NVTH 5JJIA 4AIMA 4BA1I 5GAEC 3KF6B 3E9IA 3HKZG 1XMQQ 1N33Q 4C3JH 3JC66 3I4NH 1VQIA 1E7ZA 4YCVA 1JB7A 4A3IH 1TWFH 5K36G 3L2PA 4AQYQ 4A4IA 1YJ9A 2EIFA 3S14H 4JI1Q 2NZOA 2UXCL 3K0XA 3MXNB 1W3SA 2JA5G 4DV1L 1G51A 3TS2A 2ES2A 3ERSX 4GS3A 5IT9c 4HIKA 4DPGA 4QY7A 3RLNA 3UE1A 4JC0A 2HHHQ 4GKKQ 1YI2A 3CCRA 1SN8A 1I3QH 1FL0A 4DR1Q 1YNXA 4LF6Q 4BY7H 1LM0A 3K7AH 1VQFA 1PH8A 2Y0SG 3M4PA 2KCMA 2XGTA 4QL5A 5M3FG 3VDYA 1VQMA 2JE6I 3ULPA 3LGJA 2MO0A 4R4TA 1Q8KA 5IYDG 1Y1WG 3FHWA 3NBHB 4R4CA 4C2MH 1XJVA 2VS1A 2R7ZH 2LXKA 4DR4L 4GN5A 3CCLA 3M9BA 1H95A 5IP9G 1MJCA 2WB1G 3A0JA 4KHPQ 2IX0A 1QZHA 1PH6A 4BA2I 1AE3A 2ZTCA 4X65L 3I56A 4IPCA 4A3GH 2UU9L 5EAYA 1WI5A 3RZOH 3U50C 4X6AH 2R7FA 4UP7A 4YHHL 5IYBG 1C7YA 2E5LQ 4K0KQ 1WCMH 1VQJA 1K8AC 3CCEA 4JYAL 1OXXK 1V43A 2N49A 2PI2E 3S1RH 1VCIA 4A3LG 1KD1C 1YJWA 4IPHA 1SRUA 4IPDA 5M5YH 4OONA 2GVAA 5IY0A 1VQAA 1Y1VH 2KHIA 4PMWA 1ASYA 3HOWG 5ELNA 4GNXB 3GTPH 3K80C 4JI5Q 4DUYL 3DM3A 2JA6G 4OX9L 1I50H 3RLFA 4OWXB 1M1KC 4DAMA 2EQSA 5GROA 4IOCA 3M4OH 1R9TH 1S3OA 1SR3A 1Q82C 2VY3A 2PQAB 1JT8A 2NN6I 1NE3A 1S72A 2YU9H 2H5XA 1NMFA 4OO1G 3H0GG 1HZBA 2PQAA 3BJUA 3KOJA 4UPAA 3PO2H 4A3EH 4A3BH 3RNUA 1A8VA 3A5ZB 1NJIC 3HOUG 3OW2A 1PFSA 4QIWE 4JI4Q 4JI2Q 1YITA 3RZDH 1UE5A 4JCVE 4A3DG 1N36L 2UUAL 3EN2A 4BBRG 1GKHA 1YVCA 2Z6KC 5DLQE 3UE0A 4X66Q 3JAMc 1XMOQ 4MZ9A 5IWAQ 3Q8DA 3S1MH 1PH7A 2A1AA 2KHJA 2RHQB 3B6YA 4A3CH 1XNQL 2WP8J 5IP7G 4IJHA 1UE1A 2N3SA 4DV3Q 2YTVA 2GVBA 2MQHA 5LMUL 3NELA 4IFDI 3PUXA 4WJ4A 5C3EG 3J80i 3S17H 3KYHC 2ASBA 4JBJA 4DV0L 1HR0Q 2JA8G 3KFUA 4R4QA 3PV0A 5C4JH 2ZM6L 4LF7L 1PH4A 4A3KH 1Q7YC 3HKZE 2UUBQ 1HH2P 3BU2A 3G71A 1EOVA 4JBWA 2Z0SA 1Q46A 3E0EA 4A3MH 1VQ4A 1Y14B 1ASZA 1N32L 4DK3C 1XTDA 4NXMQ 2IHFA 1HNZL 3GTOH 2WAQG 3GDEA 4GOPA 5HY6A 4LUZA 2KCTA 4TQUS 5LMNQ 5FLMG 4IOAA 3PIOA 2AWNA 1IXRA 2VNUD 5M3MH 1N9WA 3KLWA 1VQPA 4MNOA 2PMZE 4HJ7A 3H3VI 1NTGA 3E9HA 3I4MH 3GTQH 3S16H 1CKMA 4JI6Q 3CC7A 1UE7A 1UE6A 1U0LA 4LF5Q 4MTNA 3GO5A 2Y0SE 2OTJA 2JA7G 3HKSA 2R93G 5IYCG 4P73A 3I2ZA 4DV5Q 1VQOA 4B3MQ 4HJ5A 2VUMH 3S2DH 2I5MX 4X62L 2B63G 3HOYG 1K8GA 4YCWA 4AH6A 3RLOA 4PZ8A 4YY3Q 3H15A 4RG1A 3HOXG 3BZCA 4APVA 4BY1H 2ZJQA 2ZJPA 1XMQL 1N33L 2AMCB 3KF8B 2WB1E 5BR8Q 2HQLA 3SGIA 1XNRL 4HIOA 3CXCA 3UDIA 4C3IH 4AQYL 1J5EQ 5J3BA 4JI1L 1WYDA 4DV6Q 1K73C 1HR0W 3GTKH 4A3IG 1HZ9A 4ME3A 4GLVB 4XTCS 4DV2Q 4JI8Q 1X3FA 1E1OA 2JA9A 4GKKL 2HHHL 3M85A 5C44H 3I7FA 4BBSH 4DR7Q 3J7ZC 1P8LA 1QUQB 5M5XH 4DR2Q 1X9NA 1B7YB 4DR1L 2YTYA 3U58A 1QUQA 4GLAC 1Q81C 1KC8C 4LF6L 2R92H 1IBKQ 2UXBQ 3J7A5 1PHJA 4LFCQ 3FKIH 4HIDA 3MEFA 1MIUA 4GLXA 2E2HH 3HOZH 4A93H 4BY7G 3CPFA 3AFQA 3CCVA 2E2IH 3GTGH 3TRZA 1VQCA 2CQOA 1OXTA 2Q2HA 4PZ6A 4A3JH 1A63A 5GQOA 1UEBA 2R6GA 4JI3Q 4KHPL 1W2BA 2Q2UA 2R7ZG 4QGUA 3K8AA 4NPSA 1OXUA 3NENA 3KJPA 1GVPA 5M5WH 4HJ8A 1TWHH 3TS0A 1Y1WH 4HJAA 4B3RQ 4K0KL 2E5LL 3CD6A 3UDFA 1EIFA 4R4IA 4QJFA 3OTOQ 1E22A 1QVCA 3TREA 3OYYA 3AEVA 4H02A 1SMXA 3I55A 4PZ7A 1N34Q 1WFQA 1WJJA 4J15A 1WCMG 3BZKA 3S24A 4YWMA 2D0PA 3CQZH 1IBMQ 2JJQA 4GNXC 2D62A 4HJ9A 1JMCA 4DR3Q 2UXDQ 1X55A 4EX5A 2UUCQ 4GN3B 4YCUA 2FXQA 4UP9A 4LFBQ 3CF5A 4O2DA 3ER0A 3RN5A 1QZGA 4JI5L 4KHZA 2BA1A 1KQSA 2A19A 1Y1VG 4P74A 3CP0A 1VQLA 2QEXA 2CWAA 2LSSA 5GADC 2NVXH 4WJ3M 4A3FH 1G291 1YJNA 3K7UC 5C0XJ 3CCMA 3F2CA 1VQ8A 1KXLA 3M3YH 1HNWQ 5AJ3Q 3I4OA 4NB3A 4P72A 1I94Q 1V9PA 1L1OB 3KJOA 3STBD 1VQBA 2PI2A 4O0AA 1VQ7A 1NMGA 2YV5A 3CAMA 3A5UA 3GTMH 5FJ8H 1L1OA 4B3SQ 1YHAA 3S1QH 1I5FA 4A3BG 2K50A 4JI4L 2WAQE 2V1CC 1N8RC 3T1YQ 4A3EG 4JI2L 3PO2G 4OO1I 4A75A 1KIXA 3S15H 4OX9Q 2CCZA 1KHIA 1XMOL 1S40A 3PO3H 4X66L 1IZ6A 3PF5A 1NY4A 5IWAL 3UDGA 4XIGS 4JI0Q 1XPRA 3W1GA 1JE5A 2HIXA 2K5NA 2DGYA 1VQNA 1Q1BA 1VQEA 3GD7A 3M4QA 4LF4Q 3AYHB 2VQFQ 4DV3L 1SFOH 1BVSA 2R7DA 4P75A 1EQQA 4P71A 1AH9A 3F2DA 4DUZQ 1V1QA 3L7ZC 1HNXQ 4A3CG 3HFZB 4NXNQ 4DKAC 4LFAQ 1HR0L 1D8LA 4OWWB 1RIPA 3TQYA 4LF9Q 4DR6Q 1SLJA 4JOIA 4LNQA 4GKJQ 4JI7Q 4TVAB 3T1HQ 4GOPC 5IP7H 3UDXA 4DV7Q 2L15A 1KRSA 1LUZA 3NEMA 2UUBL 1HZAA 1Q1EA 4GOPB 1EIYB 4B3TQ 1XPUA 3PF4A 3J81c 4NXML 1PH1A 4A3KG 4RMFA 1EYGA 3PGZA 1VQGA 3EIVA 5LMNL 4A3MG 2OWOA 2VL6A 2R93H 1C0AA 4LUVA 5FLXc 4JV5Q 5JJKA 5C4XH 1EQRA 2KBNA 4DK6C 5JJLA 3EBEA 4ALPA 1KL9A 2D0OA 2E2JH 4JI6L 3H3VH 1NBWA 5M3MG 1IBLQ 4UY8C 3F2BA 2EXDA 1FJGQ 3FP9A 1OXSC 4LF5L 2F4VQ 4X64Q 4BXXH 2RF4A 3I4MG 2VQEQ 3J80c 2ATWA 4JG2A 4DV5L 4B3ML 2RCNA 2QGQA 3AFPA 3HOVH 4JBKA 1OTCA 2JEBI 2E8GA 1B70B 1KRTA 4YY3L 1A62A 2VUMG 4EQ5A 4DV4Q 4YWKA 1FVIA 2VW9A 5BR8L 4LW1A 4BXXG 3ICEA 4DR5Q 4LF8Q 3I4NG 1X6OA 2LXJA 4DV6L 4DV2L 1JJCB 3WWVA 4JI8L 4L5SA 3G4SA 2ID0A 4DR7L 4YWLA 1CKOA 3W5OA 4DR2L 1VQ5A 3AQQA 2K75A 2YTXA 4L5TA 1RL2A 3KF6A 2JA5H 2UXBL 1IBKL 1XNRQ 1PVOA 2F52A 5C44G 4BBSG 4Y7NH 5LMNW 1CKNB 4LFCL 1TWAH 1BBWA 5JEAJ 4C3HH 4POFA 5HGQA 2UXCQ 5IE8A 2AWOA 1CKNA 3L0OA 4IFDJ 1X3GA 2R92G 4OXPA 4DV1Q 4IJLA 3ZJYC 1I6HH 2IY5B 3RN2A 1YHBA 4AYBG 2N78A 5GAGC 3FKIG 1K83H 1SROA 2F3IA 2ZTEA 3CCJA 2ALYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ G;  4A93 G;  1D7Q A;  2CFM A;  4JI3 L;  2DUD A;  3U4V A;  1PH9 A;  4DAY B;  3F1Z A;  5M3F H;  1PYB A;  4A3J G;  3CC4 A;  4OWT B;  1OXV A;  1L0W A;  2JK8 A;  5IYD H;  1DGS A;  4Y52 H;  1L2F A;  1YZ6 A;  1Z9F A;  2QA4 A;  3CMA A;  4FDB A;  4B3R L;  1K0R A;  4A3G G;  5IP9 H;  3PUV A;  3F8T A;  5H1S E;  3OTO L;  3U4Z A;  1O7I A;  1P16 A;  2I0Q A;  1Z47 A;  4DR4 Q;  1EUJ A;  1LTL A;  2C35 B;  4GN4 B;  1N34 L;  1VS0 A;  3D31 A;  1IBM L;  1PA6 A;  5IYB H;  2I5L X;  4DR3 L;  2UXD L;  5ELO A;  2UUC L;  4X65 Q;  1AE2 A;  5E7N A;  1BBU A;  3M7N A;  1VQK A;  2UU9 Q;  4LFB L;  2K5H A;  4YHH Q;  1JJG A;  1PH3 A;  3GTJ H;  3CW2 C;  1E24 A;  1T9H A;  4A3L H;  2MNA A;  3ULL A;  2NZH A;  4JYA Q;  2YYZ A;  2K4K A;  1HJP A;  1KAW A;  3RR5 A;  1L1O C;  3JAM i;  2BH8 A;  2AHO B;  3G48 A;  4POG A;  3HOW H;  1HNW L;  5AJ3 L;  3DLL A;  3PIP A;  2CWP A;  1VQ9 A;  1J6Q A;  3CPW A;  2A8V A;  2IT1 A;  4A3F G;  1PH2 A;  1I94 L;  2JA6 H;  1PYS B;  2I5H A;  2RHS B;  4B3S L;  2NN6 G;  1FGU A;  4DR6 L;  1CSQ A;  1PV4 A;  3G6E A;  5GAH C;  3T1Y L;  4DUY Q;  1IYJ B;  3PUZ A;  3W1B A;  1TXY A;  1WOC A;  2OCE A;  2K52 A;  3H0G H;  4DNI A;  4GNX A;  4QQB X;  5FJ8 G;  1TWG H;  3PUY A;  3ULJ A;  1YEZ A;  2GN5 A;  2HIV A;  3K81 C;  4KLK A;  4JI0 L;  3PCO B;  2HT1 A;  1VQ6 A;  1EFW A;  3PO3 G;  2MFI A;  4JOI C;  4A3D H;  4LF4 L;  3PUW A;  1Q12 A;  2VQF L;  1EWI A;  4BBR H;  2K5V A;  1E3P A;  2OQ0 A;  3J81 i;  4DUZ L;  1HNX L;  4NXN L;  2CKZ B;  4LFA L;  1IL2 A;  1N36 Q;  2UUA Q;  1HZC A;  4LF9 L;  3KDF B;  5JEA G;  1K9M C;  4GKJ L;  2PNH A;  4JI7 L;  3A74 A;  3KDF A;  1Q86 C;  4IFD G;  3T1H L;  2OTL A;  1X65 A;  1K3R A;  1G6P A;  2WFW A;  4DV7 L;  1C9O A;  4L5R C;  1TWC H;  4LWC A;  1CUK A;  5C3E H;  2NVQ H;  2ZTD A;  1X54 A;  2OQK A;  1XNQ Q;  1X3E A;  4B3T L;  3S1N H;  2JA8 H;  2JEA I;  2Z6K A;  1VQD A;  3CCQ A;  4JBM A;  2IHE A;  5LMU Q;  2Q2T A;  2KEN A;  1X56 A;  1B8A A;  2N8N A;  1VQH A;  4PG3 A;  4DV0 Q;  2BH2 A;  4JV5 L;  1U5K A;  2AKW B;  2ZM6 Q;  2K14 A;  1GD7 A;  4LF7 Q;  4R4O A;  2JQO A;  1IBL L;  1CSP A;  4R1J A;  1YBY A;  5FLM H;  4A76 A;  3CCU A;  1N32 Q;  5C4X G;  1FJG L;  1SE8 A;  1LYL A;  3TEH B;  2F4V L;  4X64 L;  1HNZ Q;  1A0I A;  1YHQ A;  4LUO A;  4UP8 A;  1GO3 E;  2VQE L;  3CC2 A;  3S2H H;  3GTL H;  4KI0 A;  1QVG A;  1UWV A;  4L5Q A;  4AYB E;  1E1T A;  1JJ2 A;  1PH5 A;  2IX1 A;  4DV4 L;  5C0X G;  4IPG A;  2MO1 A;  1BKB A;  4BY1 G;  5IYC H;  2NVY H;  2JA7 H;  1MKH A;  2ZJR A;  1MJE A;  3HOV G;  3D0F A;  2B29 A;  3PSI A;  3IRB A;  4DR5 L;  2VZA A;  3STB C;  1J5E L;  2B3G A;  4LF8 L;  2BA0 A;  2B63 H;  3HOU H;  3HOY H;  1QVF A;  3HOX H;  4HIM A;  3CCS A;  2Q2I A;  1GM5 A;  1XPO A;  5C0X I;  1YIJ A;  3J81 j;  3CME A;  2XTI A;  4X62 Q;  4IO9 A;  1M90 C;  2NVT H;  5JJI A;  4AIM A;  4BA1 I;  5GAE C;  3KF6 B;  3E9I A;  3HKZ G;  1XMQ Q;  1N33 Q;  4C3J H;  3JC6 6;  3I4N H;  1VQI A;  1E7Z A;  4YCV A;  1JB7 A;  4A3I H;  1TWF H;  5K36 G;  3L2P A;  4AQY Q;  4A4I A;  1YJ9 A;  2EIF A;  3S14 H;  4JI1 Q;  2NZO A;  2UXC L;  3K0X A;  3MXN B;  1W3S A;  2JA5 G;  4DV1 L;  1G51 A;  3TS2 A;  2ES2 A;  3ERS X;  4GS3 A;  5IT9 c;  4HIK A;  4DPG A;  4QY7 A;  3RLN A;  3UE1 A;  4JC0 A;  2HHH Q;  4GKK Q;  1YI2 A;  3CCR A;  1SN8 A;  1I3Q H;  1FL0 A;  4DR1 Q;  1YNX A;  4LF6 Q;  4BY7 H;  1LM0 A;  3K7A H;  1VQF A;  1PH8 A;  2Y0S G;  3M4P A;  2KCM A;  2XGT A;  4QL5 A;  5M3F G;  3VDY A;  1VQM A;  2JE6 I;  3ULP A;  3LGJ A;  2MO0 A;  4R4T A;  1Q8K A;  5IYD G;  1Y1W G;  3FHW A;  3NBH B;  4R4C A;  4C2M H;  1XJV A;  2VS1 A;  2R7Z H;  2LXK A;  4DR4 L;  4GN5 A;  3CCL A;  3M9B A;  1H95 A;  5IP9 G;  1MJC A;  2WB1 G;  3A0J A;  4KHP Q;  2IX0 A;  1QZH A;  1PH6 A;  4BA2 I;  1AE3 A;  2ZTC A;  4X65 L;  3I56 A;  4IPC A;  4A3G H;  2UU9 L;  5EAY A;  1WI5 A;  3RZO H;  3U50 C;  4X6A H;  2R7F A;  4UP7 A;  4YHH L;  5IYB G;  1C7Y A;  2E5L Q;  4K0K Q;  1WCM H;  1VQJ A;  1K8A C;  3CCE A;  4JYA L;  1OXX K;  1V43 A;  2N49 A;  2PI2 E;  3S1R H;  1VCI A;  4A3L G;  1KD1 C;  1YJW A;  4IPH A;  1SRU A;  4IPD A;  5M5Y H;  4OON A;  2GVA A;  5IY0 A;  1VQA A;  1Y1V H;  2KHI A;  4PMW A;  1ASY A;  3HOW G;  5ELN A;  4GNX B;  3GTP H;  3K80 C;  4JI5 Q;  4DUY L;  3DM3 A;  2JA6 G;  4OX9 L;  1I50 H;  3RLF A;  4OWX B;  1M1K C;  4DAM A;  2EQS A;  5GRO A;  4IOC A;  3M4O H;  1R9T H;  1S3O A;  1SR3 A;  1Q82 C;  2VY3 A;  2PQA B;  1JT8 A;  2NN6 I;  1NE3 A;  1S72 A;  2YU9 H;  2H5X A;  1NMF A;  4OO1 G;  3H0G G;  1HZB A;  2PQA A;  3BJU A;  3KOJ A;  4UPA A;  3PO2 H;  4A3E H;  4A3B H;  3RNU A;  1A8V A;  3A5Z B;  1NJI C;  3HOU G;  3OW2 A;  1PFS A;  4QIW E;  4JI4 Q;  4JI2 Q;  1YIT A;  3RZD H;  1UE5 A;  4JCV E;  4A3D G;  1N36 L;  2UUA L;  3EN2 A;  4BBR G;  1GKH A;  1YVC A;  2Z6K C;  5DLQ E;  3UE0 A;  4X66 Q;  3JAM c;  1XMO Q;  4MZ9 A;  5IWA Q;  3Q8D A;  3S1M H;  1PH7 A;  2A1A A;  2KHJ A;  2RHQ B;  3B6Y A;  4A3C H;  1XNQ L;  2WP8 J;  5IP7 G;  4IJH A;  1UE1 A;  2N3S A;  4DV3 Q;  2YTV A;  2GVB A;  2MQH A;  5LMU L;  3NEL A;  4IFD I;  3PUX A;  4WJ4 A;  5C3E G;  3J80 i;  3S17 H;  3KYH C;  2ASB A;  4JBJ A;  4DV0 L;  1HR0 Q;  2JA8 G;  3KFU A;  4R4Q A;  3PV0 A;  5C4J H;  2ZM6 L;  4LF7 L;  1PH4 A;  4A3K H;  1Q7Y C;  3HKZ E;  2UUB Q;  1HH2 P;  3BU2 A;  3G71 A;  1EOV A;  4JBW A;  2Z0S A;  1Q46 A;  3E0E A;  4A3M H;  1VQ4 A;  1Y14 B;  1ASZ A;  1N32 L;  4DK3 C;  1XTD A;  4NXM Q;  2IHF A;  1HNZ L;  3GTO H;  2WAQ G;  3GDE A;  4GOP A;  5HY6 A;  4LUZ A;  2KCT A;  4TQU S;  5LMN Q;  5FLM G;  4IOA A;  3PIO A;  2AWN A;  1IXR A;  2VNU D;  5M3M H;  1N9W A;  3KLW A;  1VQP A;  4MNO A;  2PMZ E;  4HJ7 A;  3H3V I;  1NTG A;  3E9H A;  3I4M H;  3GTQ H;  3S16 H;  1CKM A;  4JI6 Q;  3CC7 A;  1UE7 A;  1UE6 A;  1U0L A;  4LF5 Q;  4MTN A;  3GO5 A;  2Y0S E;  2OTJ A;  2JA7 G;  3HKS A;  2R93 G;  5IYC G;  4P73 A;  3I2Z A;  4DV5 Q;  1VQO A;  4B3M Q;  4HJ5 A;  2VUM H;  3S2D H;  2I5M X;  4X62 L;  2B63 G;  3HOY G;  1K8G A;  4YCW A;  4AH6 A;  3RLO A;  4PZ8 A;  4YY3 Q;  3H15 A;  4RG1 A;  3HOX G;  3BZC A;  4APV A;  4BY1 H;  2ZJQ A;  2ZJP A;  1XMQ L;  1N33 L;  2AMC B;  3KF8 B;  2WB1 E;  5BR8 Q;  2HQL A;  3SGI A;  1XNR L;  4HIO A;  3CXC A;  3UDI A;  4C3I H;  4AQY L;  1J5E Q;  5J3B A;  4JI1 L;  1WYD A;  4DV6 Q;  1K73 C;  1HR0 W;  3GTK H;  4A3I G;  1HZ9 A;  4ME3 A;  4GLV B;  4XTC S;  4DV2 Q;  4JI8 Q;  1X3F A;  1E1O A;  2JA9 A;  4GKK L;  2HHH L;  3M85 A;  5C44 H;  3I7F A;  4BBS H;  4DR7 Q;  3J7Z C;  1P8L A;  1QUQ B;  5M5X H;  4DR2 Q;  1X9N A;  1B7Y B;  4DR1 L;  2YTY A;  3U58 A;  1QUQ A;  4GLA C;  1Q81 C;  1KC8 C;  4LF6 L;  2R92 H;  1IBK Q;  2UXB Q;  3J7A 5;  1PHJ A;  4LFC Q;  3FKI H;  4HID A;  3MEF A;  1MIU A;  4GLX A;  2E2H H;  3HOZ H;  4A93 H;  4BY7 G;  3CPF A;  3AFQ A;  3CCV A;  2E2I H;  3GTG H;  3TRZ A;  1VQC A;  2CQO A;  1OXT A;  2Q2H A;  4PZ6 A;  4A3J H;  1A63 A;  5GQO A;  1UEB A;  2R6G A;  4JI3 Q;  4KHP L;  1W2B A;  2Q2U A;  2R7Z G;  4QGU A;  3K8A A;  4NPS A;  1OXU A;  3NEN A;  3KJP A;  1GVP A;  5M5W H;  4HJ8 A;  1TWH H;  3TS0 A;  1Y1W H;  4HJA A;  4B3R Q;  4K0K L;  2E5L L;  3CD6 A;  3UDF A;  1EIF A;  4R4I A;  4QJF A;  3OTO Q;  1E22 A;  1QVC A;  3TRE A;  3OYY A;  3AEV A;  4H02 A;  1SMX A;  3I55 A;  4PZ7 A;  1N34 Q;  1WFQ A;  1WJJ A;  4J15 A;  1WCM G;  3BZK A;  3S24 A;  4YWM A;  2D0P A;  3CQZ H;  1IBM Q;  2JJQ A;  4GNX C;  2D62 A;  4HJ9 A;  1JMC A;  4DR3 Q;  2UXD Q;  1X55 A;  4EX5 A;  2UUC Q;  4GN3 B;  4YCU A;  2FXQ A;  4UP9 A;  4LFB Q;  3CF5 A;  4O2D A;  3ER0 A;  3RN5 A;  1QZG A;  4JI5 L;  4KHZ A;  2BA1 A;  1KQS A;  2A19 A;  1Y1V G;  4P74 A;  3CP0 A;  1VQL A;  2QEX A;  2CWA A;  2LSS A;  5GAD C;  2NVX H;  4WJ3 M;  4A3F H;  1G29 1;  1YJN A;  3K7U C;  5C0X J;  3CCM A;  3F2C A;  1VQ8 A;  1KXL A;  3M3Y H;  1HNW Q;  5AJ3 Q;  3I4O A;  4NB3 A;  4P72 A;  1I94 Q;  1V9P A;  1L1O B;  3KJO A;  3STB D;  1VQB A;  2PI2 A;  4O0A A;  1VQ7 A;  1NMG A;  2YV5 A;  3CAM A;  3A5U A;  3GTM H;  5FJ8 H;  1L1O A;  4B3S Q;  1YHA A;  3S1Q H;  1I5F A;  4A3B G;  2K50 A;  4JI4 L;  2WAQ E;  2V1C C;  1N8R C;  3T1Y Q;  4A3E G;  4JI2 L;  3PO2 G;  4OO1 I;  4A75 A;  1KIX A;  3S15 H;  4OX9 Q;  2CCZ A;  1KHI A;  1XMO L;  1S40 A;  3PO3 H;  4X66 L;  1IZ6 A;  3PF5 A;  1NY4 A;  5IWA L;  3UDG A;  4XIG S;  4JI0 Q;  1XPR A;  3W1G A;  1JE5 A;  2HIX A;  2K5N A;  2DGY A;  1VQN A;  1Q1B A;  1VQE A;  3GD7 A;  3M4Q A;  4LF4 Q;  3AYH B;  2VQF Q;  4DV3 L;  1SFO H;  1BVS A;  2R7D A;  4P75 A;  1EQQ A;  4P71 A;  1AH9 A;  3F2D A;  4DUZ Q;  1V1Q A;  3L7Z C;  1HNX Q;  4A3C G;  3HFZ B;  4NXN Q;  4DKA C;  4LFA Q;  1HR0 L;  1D8L A;  4OWW B;  1RIP A;  3TQY A;  4LF9 Q;  4DR6 Q;  1SLJ A;  4JOI A;  4LNQ A;  4GKJ Q;  4JI7 Q;  4TVA B;  3T1H Q;  4GOP C;  5IP7 H;  3UDX A;  4DV7 Q;  2L15 A;  1KRS A;  1LUZ A;  3NEM A;  2UUB L;  1HZA A;  1Q1E A;  4GOP B;  1EIY B;  4B3T Q;  1XPU A;  3PF4 A;  3J81 c;  4NXM L;  1PH1 A;  4A3K G;  4RMF A;  1EYG A;  3PGZ A;  1VQG A;  3EIV A;  5LMN L;  4A3M G;  2OWO A;  2VL6 A;  2R93 H;  1C0A A;  4LUV A;  5FLX c;  4JV5 Q;  5JJK A;  5C4X H;  1EQR A;  2KBN A;  4DK6 C;  5JJL A;  3EBE A;  4ALP A;  1KL9 A;  2D0O A;  2E2J H;  4JI6 L;  3H3V H;  1NBW A;  5M3M G;  1IBL Q;  4UY8 C;  3F2B A;  2EXD A;  1FJG Q;  3FP9 A;  1OXS C;  4LF5 L;  2F4V Q;  4X64 Q;  4BXX H;  2RF4 A;  3I4M G;  2VQE Q;  3J80 c;  2ATW A;  4JG2 A;  4DV5 L;  4B3M L;  2RCN A;  2QGQ A;  3AFP A;  3HOV H;  4JBK A;  1OTC A;  2JEB I;  2E8G A;  1B70 B;  1KRT A;  4YY3 L;  1A62 A;  2VUM G;  4EQ5 A;  4DV4 Q;  4YWK A;  1FVI A;  2VW9 A;  5BR8 L;  4LW1 A;  4BXX G;  3ICE A;  4DR5 Q;  4LF8 Q;  3I4N G;  1X6O A;  2LXJ A;  4DV6 L;  4DV2 L;  1JJC B;  3WWV A;  4JI8 L;  4L5S A;  3G4S A;  2ID0 A;  4DR7 L;  4YWL A;  1CKO A;  3W5O A;  4DR2 L;  1VQ5 A;  3AQQ A;  2K75 A;  2YTX A;  4L5T A;  1RL2 A;  3KF6 A;  2JA5 H;  2UXB L;  1IBK L;  1XNR Q;  1PVO A;  2F52 A;  5C44 G;  4BBS G;  4Y7N H;  5LMN W;  1CKN B;  4LFC L;  1TWA H;  1BBW A;  5JEA J;  4C3H H;  4POF A;  5HGQ A;  2UXC Q;  5IE8 A;  2AWO A;  1CKN A;  3L0O A;  4IFD J;  1X3G A;  2R92 G;  4OXP A;  4DV1 Q;  4IJL A;  3ZJY C;  1I6H H;  2IY5 B;  3RN2 A;  1YHB A;  4AYB G;  2N78 A;  5GAG C;  3FKI G;  1K83 H;  1SRO A;  2F3I A;  2ZTE A;  3CCJ A;  2ALY B; 
#chains in the Genus database with same CATH topology
 1D7Q A;  4FXK C;  4JI3 L;  1FNU A;  3DXJ C;  1PTO C;  3LNN A;  1DGS A;  4Y52 H;  1YZ6 A;  3MAQ A;  3CMA A;  4G7Z C;  4L6T B;  4A3G G;  5BN4 A;  1XWE A;  1SYB A;  3OTO L;  3U4Z A;  4DR4 Q;  1LTL A;  3S1Q B;  4KY7 A;  1EL0 A;  3D31 A;  4RGM A;  5IYB H;  1CZG A;  2UXD L;  1AE2 A;  5E7N A;  3PO3 B;  1VQK A;  3DWQ A;  3VYS A;  2K5H A;  3MXP A;  2NZH A;  5LHY 1;  2K4K A;  1HJP A;  1JE4 A;  1B9N A;  2AHO B;  3J81 E;  3HS0 C;  2HUG A;  3HP3 A;  2I5H A;  3MTS A;  1O78 A;  3WDN A;  4B3S L;  1IKL A;  5FLX E;  3G6E A;  3T1Y L;  3PUZ A;  2EY2 A;  2B2V A;  5FJ8 G;  1TWG H;  2NVQ B;  5JJZ A;  3HEJ A;  1YEZ A;  2GN5 A;  4KLK A;  3SE0 A;  1DON A;  1EFW A;  2MFI A;  4JOI C;  3PUW A;  2E74 C;  1C48 A;  4QUC A;  4BBR H;  2KVM A;  5AFW A;  5C4X B;  4ULL A;  4DUZ L;  3J81 i;  1HNX L;  2Z4H A;  1A3U A;  2CKZ B;  2E2J B;  4L63 B;  1IL2 A;  2UUA Q;  3KDF B;  3PMF A;  2F0F A;  2B2W A;  1KDC A;  2OTL A;  1X65 A;  1G6P A;  1C9O A;  4L5R C;  5C3E H;  2RCF A;  1XNQ Q;  2G5D A;  1X3E A;  3FVQ A;  2JA8 H;  4IUT A;  5LMU Q;  1SMY C;  2Q2T A;  1EWC A;  1XX8 A;  1JWU D;  1U5K A;  2ZM6 Q;  2K14 A;  1GD7 A;  2RSO A;  5FO8 B;  2OXP A;  1IBL L;  4R1J A;  4A76 A;  3MWY W;  4PMC A;  1Q90 A;  2L9H A;  3OOC A;  2VQE L;  3D6C A;  4RA8 A;  2L5T A;  1A2T A;  4KI0 A;  5LL6 X;  4AYB E;  1BCP D;  4Y7N B;  1TWA B;  1LT4 D;  2PMZ B;  3D4W A;  3V96 A;  2MO1 A;  2JA7 H;  1HCZ A;  2R93 H;  1WTH A;  2NVY H;  1MKH A;  5EGT A;  1GUN A;  1NSN S;  3STB C;  2BA0 A;  2B63 H;  2ZT9 C;  1GM5 A;  3D6W A;  1XPO A;  3Q23 A;  5C0X I;  3T4A C;  2XTI A;  1M90 C;  2NVT H;  2FIN B;  5I2Y A;  4BA1 I;  5GAE C;  4KY5 A;  3E9I A;  3JC6 6;  1J9O A;  3I4N H;  4N8F A;  4EVO A;  3TP6 A;  2NZO A;  1ZKO A;  2R7Z B;  3EJI A;  3MXN B;  1W3S A;  2LS0 1;  2JA5 G;  2NTS A;  3TS2 A;  4GS3 A;  4FF2 A;  1Z7T A;  1K3B C;  1YNX A;  4LF6 Q;  1O7Z A;  3K7A H;  2FFK B;  1YNJ C;  2XGT A;  4QL5 A;  1VQM A;  2JE6 I;  4P2C B;  5KIX A;  1Q8K A;  3FHW A;  1WD0 A;  2HD3 A;  2EY5 A;  3M9B A;  1W6J A;  3A0J A;  4KHP Q;  1QZH A;  3GTP B;  2PZU A;  4DNT B;  3SR1 A;  4QB4 A;  4LAA A;  4CDD C;  3GQB A;  1B50 A;  4A3G H;  2K6A A;  2R7F A;  1TU2 B;  4K0K Q;  2E5L Q;  1WCM H;  1VQJ A;  2O5I C;  1TY0 A;  5DAU A;  1STN A;  4FNF A;  4XQJ A;  1KD1 C;  1V1O A;  4OON A;  3RZD B;  1Y1V H;  2KHI A;  5EBD A;  3HOW G;  5FKA C;  5ELN A;  1DXM A;  3R3O A;  4IUN A;  1CFM A;  3DEO A;  3DM3 A;  2JA6 G;  1I50 H;  4KJO A;  4OWX B;  4DAM A;  2EQS A;  5C3E B;  2J0T D;  3NWT A;  4RCN A;  2XRQ D;  2JA8 B;  3FEW X;  4OO1 G;  2K01 A;  3KOJ A;  4KKT A;  3M4Y A;  3TP7 A;  1S4Z A;  1HA5 A;  1QNU A;  1A8V A;  3CKI B;  1JJG A;  2A68 D;  5KNB A;  1YIT A;  2O4X A;  3HZX A;  1LTR D;  4A3K B;  5DLQ E;  4X66 Q;  3JAM c;  1IL8 A;  4MZ9 A;  3P1H A;  3QJY A;  3Q24 A;  2KOL A;  2KEC A;  3QWN A;  4QF4 A;  2MQH A;  4IFD I;  2MJ8 A;  1SND A;  3J80 i;  2H4O A;  2ASB A;  4JBJ A;  2A74 C;  1HR0 Q;  3I4M B;  4R4Q A;  2JA7 B;  3S16 B;  3PV0 A;  2NVY B;  1PZJ D;  3MHB A;  4N8X 1;  2F0M A;  3VYT A;  1X32 A;  2B63 B;  2LFN A;  1HPC A;  1HH2 P;  3G71 A;  1EOV A;  1PTO D;  1Q46 A;  2FMM A;  2NVT B;  3GDE A;  3AB9 A;  5T1I A;  4LUZ A;  2KCT A;  1IXR A;  5M3M H;  3I4N B;  1SAP A;  1ESR A;  1EY6 A;  3GTQ H;  1DZ1 A;  1CKM A;  1DCZ A;  1HHV A;  2O5J C;  1U0L A;  1PFB A;  4MTN A;  1B4O A;  2Y0S E;  2J4X A;  1VQO A;  5C44 B;  1ONL A;  5M5X B;  1RD9 D;  3K7A B;  3HOX G;  4PZ8 A;  4O42 A;  1EFI D;  1RHP A;  4JPB W;  2AMC B;  3KF8 B;  2WB1 E;  4HIO A;  1MI2 A;  1J5E Q;  4C3J G;  1G2S A;  5C5L A;  4DV6 Q;  1R4P B;  1K8O A;  1HZ9 A;  5D3I B;  4XTC S;  4K2L A;  4XDX A;  4A3G B;  2HHH L;  4BBS H;  1WCM B;  1QUQ A;  5C5M A;  1F9R A;  2MUY A;  1BO0 A;  4RKB A;  4LFC Q;  2LY7 A;  1MIU A;  3TDQ A;  4A93 H;  4G4K A;  3CPF A;  3CCV A;  2E2I H;  3X3N A;  3TRZ A;  2CQO A;  1F2Z A;  1Y1V B;  4A3J H;  5GQO A;  4K8I A;  3R93 A;  1S5E D;  1UEB A;  2NWG A;  2R6G A;  4XYO A;  4JI3 Q;  1NR4 A;  1SEB D;  3H09 A;  1SMY D;  4RH6 A;  1GVP A;  5M5W H;  4HJ8 A;  1TWH H;  3TS0 A;  3JAM E;  4HJA A;  2EE1 A;  1IW7 C;  1EIF A;  4R4I A;  3M3Y B;  1QCB D;  3OTO Q;  1QVC A;  1STE A;  1ET9 A;  2EYH A;  4H02 A;  3I90 A;  3I55 A;  5JPM C;  1PMR A;  1WFQ A;  1I6H H;  3BZK A;  3C3L A;  4IUV A;  4DN4 M;  2JJQ A;  2D62 A;  5CC4 A;  1JMC A;  2UXD Q;  4PV1 C;  4PMB A;  1X55 A;  2HCC A;  4EX5 A;  3OIP A;  2F0L A;  3RN5 A;  3TP8 A;  4P74 A;  1Y8P B;  3CP0 A;  2QEX A;  3KBX A;  2LSS A;  3KLS A;  5BN3 A;  1G29 1;  3VYR A;  4OGQ C;  2CVR A;  1L1O B;  3STB D;  1A3V A;  1NMG A;  2YV5 A;  4B3S Q;  4JI4 L;  2WAQ E;  1N8R C;  3T1Y Q;  4A3E G;  2EDG A;  2XIW A;  4A75 A;  1KIX A;  1PXU A;  2CCZ A;  1KHI A;  1XMO L;  1LT5 D;  1M4V A;  1R4Q B;  3S9W A;  1IZ6 A;  3PF5 A;  1H9R A;  1X3P A;  5IWA L;  4LMQ D;  4XIG S;  5JVG 3;  1XPR A;  3W1G A;  2DGY A;  4DV3 L;  5M3M B;  4P75 A;  1EQQ A;  3F2D A;  4DUZ Q;  1JWS D;  1MHW C;  3L7Z C;  1HNX Q;  4DKA C;  3GTQ B;  4OWW B;  1RIP A;  3QOJ A;  4K5V A;  1LAC A;  1OO9 B;  1SYE A;  3UDX A;  4ZQ3 A;  2EYP A;  1K0S A;  1HZA A;  1PRT C;  4XQN A;  1YNJ D;  5CV4 A;  4FF1 A;  1EYG A;  1PRT B;  4UAI A;  3BVM A;  4F87 A;  1WTO A;  2AQ2 B;  2A73 B;  4DK6 C;  5JJL A;  3EBE A;  4ALP A;  1KL9 A;  2D0O A;  3H3V H;  2RDH A;  4KTA A;  1IBL Q;  4HN7 A;  1OXS C;  1CTM A;  1MSH A;  2VQE Q;  1GHJ A;  4DV5 L;  4B3M L;  3X3M A;  2RCN A;  1EIH A;  4IN3 A;  3AFP A;  3HOV H;  2ZXO A;  4YY3 L;  4X3S A;  2VUM G;  4MN3 A;  3KBG A;  3ICE A;  2E2I B;  4A3J B;  3VR3 A;  1KLG D;  1K83 B;  2BE5 C;  2PYK A;  4TSS A;  3WWV A;  2EXZ A;  5EPK A;  3W2D A;  4L5S A;  5M5W B;  1TWH B;  2F0Q A;  4DR2 L;  1B44 D;  1SBB B;  2ZXP A;  1RL2 A;  1EIG A;  1A2U A;  4B9W A;  1BBW A;  1I6H B;  3E3X A;  2AWO A;  2K04 A;  1WTX A;  2IY5 B;  3ZJY C;  4V0B A;  4AYB G;  2N78 A;  5KRU A;  3FKI G;  1SRO A;  1BR9 A;  1ILQ A;  2ZTE A;  4CJ2 C;  1RTO A;  2ALY B;  2B2Y C;  1K9M C;  3VR6 A;  1AN8 A;  2DUD A;  1PH9 A;  1TS5 A;  1PYB A;  4NKL A;  4OWT B;  1DYQ A;  5IYD H;  1Z9F A;  4ID6 A;  2ICE C;  4FDB A;  5IOC A;  3K6O A;  1AW7 A;  3PUV A;  2IWH A;  5J1Z A;  3URY A;  5H1S E;  1V8Q A;  1Z47 A;  1N34 L;  1HTP A;  3TME A;  3AMU A;  2QCP X;  4DR3 L;  5ELO A;  2UUC L;  4JW0 A;  1BBU A;  3M7N A;  4MTK A;  1ET6 A;  1PH3 A;  1JOO A;  3GTJ H;  3CW2 C;  4A3L H;  1JOQ A;  1RKN A;  1KLU D;  1KAW A;  3RR5 A;  2BH8 A;  3GV3 A;  3OPO A;  3G48 A;  4POG A;  1QG7 A;  2EOT A;  1HNW L;  3DLL A;  1D5M C;  3H6M A;  2A8V A;  1J6Q A;  2IT1 A;  4A3F G;  1PH2 A;  1I94 L;  3BYY B;  5IGB A;  4TKO B;  2NN6 G;  1FGU A;  4DR6 L;  1PV4 A;  5GAH C;  1SXT A;  1LV9 A;  1WOC A;  3H0G H;  2B2U A;  3DWA A;  4RGN A;  3D3R A;  2F4I A;  3ULJ A;  3K81 C;  1WVL A;  4XT3 B;  2FMC A;  4U67 3;  4G7O C;  4LF4 L;  2F0E A;  1EWI A;  2RQX A;  3H3V C;  2K5V A;  4M8A A;  4QMG A;  4ZRZ A;  4QIW B;  4PNY A;  1HZC A;  5JEA G;  4E6I A;  4GKJ L;  2PNH A;  4JI7 L;  3KDF A;  1Q86 C;  1TQO A;  2X6L A;  2PW5 A;  1FNW A;  1K3R A;  4DNR B;  2Z9H A;  2NVQ H;  1X54 A;  2OQK A;  5I9O A;  1ROD A;  1VQD A;  4EQN A;  1S5F D;  3HOV B;  2KEN A;  1WTQ A;  5IT9 L;  4PG3 A;  2BH2 A;  3MFG A;  2AKW B;  1SNQ A;  3ONA B;  4R4O A;  1YBY A;  2TMP A;  3QIA A;  5CMD A;  3CC2 A;  1GO3 E;  1LTG D;  1ICF B;  1W6K A;  1IW7 D;  1UWV A;  2F0J A;  3ERO A;  1E1T A;  4KJN A;  3SXH A;  1ML0 D;  1CK1 A;  5HGT A;  4NW2 A;  4DV4 L;  2L4N A;  1DOL A;  5IOD A;  1B53 A;  2ZJR A;  3D0F A;  2B29 A;  1CA6 A;  3IRB A;  1J5E L;  1BCP F;  1G6Z A;  4LF8 L;  4J1M A;  3HOU H;  4ILW A;  4HIM A;  2Q2I A;  1MGS A;  1YIJ A;  3J81 j;  1WTP A;  3NK9 A;  1EYC A;  4WFN 3;  1VQI A;  1LTS D;  4A3I H;  2KJX A;  3QG1 A;  2K5Q A;  1YJ9 A;  2EIF A;  2B2T C;  2UXC L;  2WKD A;  3K0X A;  4M1U B;  2AUJ D;  1GJX A;  3T56 B;  5ISR A;  3ERS X;  2A6E D;  3BG3 A;  2ENB A;  3RLN A;  3UE1 A;  2HHH Q;  1YI2 A;  3CCR A;  2Z1C A;  3GTJ B;  4CKE A;  1CZW A;  2A6H C;  2Y0S G;  5ELB A;  5M3F G;  5CV8 A;  3VDY A;  4HR7 B;  4KY6 A;  5CYU A;  3GP7 A;  3ERQ A;  5G3L F;  1XJV A;  4ZKC B;  1SE4 A;  2EVB A;  1D5X C;  5DNF A;  4GN5 A;  2R7Z H;  2NZ1 D;  3MZ5 A;  1RDP D;  2WB1 G;  3A55 A;  3HGB A;  5IP9 G;  3DWP A;  5FK9 C;  4BA2 I;  1PRT D;  2ZTC A;  3H0G B;  4X65 L;  4IPC A;  4J6H A;  1BNZ A;  3U50 C;  4YHH L;  1C7Y A;  3A8J E;  4JYA L;  2N49 A;  4A3E B;  1TS4 A;  2PI2 E;  3S1R H;  1VCI A;  4X3T A;  1SRU A;  4IPD A;  2DNC A;  1ASY A;  3EFX D;  1ZXT A;  3GTP H;  4DUY L;  5I9P A;  1TT2 A;  5GRO A;  3M4O H;  2JXM B;  1SR3 A;  3CRK C;  2VY3 A;  1QNK A;  2J7Z A;  2PQA B;  1S72 A;  3OMG A;  2H5X A;  1NMF A;  4ZUJ A;  4A3B H;  3BJU A;  1K28 A;  3PO2 H;  5EKK A;  4F8M A;  3N6R A;  5KEE A;  2K03 A;  5C4J B;  2BE5 D;  3OW2 A;  4JI4 Q;  3RZD H;  4A3D G;  1HA6 A;  1N36 L;  1XMO Q;  1GUW A;  2DJF C;  5IWA Q;  2L0C A;  2F0U A;  4A3C H;  4EQP A;  1EYD A;  2WP8 J;  4DV3 Q;  2YTV A;  5K5P A;  1Z6H A;  5EKL A;  2WII B;  3C2P A;  1IYV A;  4FF3 A;  3KFU A;  2EYF A;  2K7V A;  2E2D C;  3QB3 A;  4LF7 L;  4DAV A;  3HOU B;  4A3K H;  1CA5 A;  1Q7Y C;  3HKZ E;  3BDO A;  3BU2 A;  2K32 A;  4JBW A;  2Z0S A;  3E0E A;  1Y14 B;  4DK3 C;  3FPP A;  2WAQ G;  2HDL A;  5FLM G;  2AWN A;  3KLR A;  2VNU D;  1VQP A;  4A3I B;  2JN4 A;  2PMZ E;  4HJ7 A;  3H3V I;  3I4M H;  4KN4 C;  3S16 H;  2BDN A;  3NQT A;  3TP5 A;  1UE7 A;  3TN2 A;  1UE6 A;  4HED A;  2KEE A;  4ZUI A;  5E1F A;  2F0V A;  5IYC G;  4DV5 Q;  3I2Z A;  4B3M Q;  3S2D H;  4X62 L;  4V19 0;  3HOY G;  4BXX H;  4YCW A;  3RLO A;  4YY3 Q;  1IYU A;  2RDG A;  1XMQ L;  1N33 L;  1LTT D;  4K8J A;  3FKI B;  3SGI A;  3IFT A;  3KF8 A;  1AP0 A;  1KNA A;  2A69 C;  5M9O A;  3H94 A;  3C46 A;  1IKM A;  1HUM A;  3U9S A;  1G91 A;  3M85 A;  5C44 H;  2PPB C;  4DR2 Q;  5M5X H;  3O13 A;  3E5S A;  4DR1 L;  2YTY A;  4N9P A;  2R92 H;  1CQF A;  4OEM B;  4HID A;  4RGO S;  3S1R B;  2E2H H;  1STG A;  2K28 A;  4BY7 G;  3ND9 A;  1VQC A;  1SNM A;  1HXY D;  4KKU A;  2VB2 X;  5D65 A;  3IAY A;  5IGD A;  5L37 A;  4GZY C;  4QGU A;  3K8A A;  3QR8 A;  4FF4 A;  1OXU A;  3J7A V;  1MBY A;  3M4O B;  4QUF A;  1T5E A;  4HSV A;  4DAY A;  5CR3 A;  3UDF A;  4A3B B;  3PO2 B;  1E22 A;  4H13 C;  1SMX A;  3MXG A;  1A3T A;  1N34 Q;  2R61 A;  4J15 A;  2QW7 A;  5BN5 A;  2WIN B;  2B2V C;  3OWE B;  4RWS C;  4X3U A;  4DR3 Q;  2UUC Q;  4YCU A;  2B8G A;  3DMU A;  3R8B A;  3S15 B;  4ZKB B;  2D9U A;  1S5C D;  3J7Y W;  4JI5 L;  2A19 A;  1UEA B;  2OT2 A;  1VQL A;  4WJ3 M;  3ND8 A;  1YJN A;  3CCM A;  3BZD B;  3F2C A;  3M3Y H;  1HNW Q;  2F0T A;  2B2W C;  3I4O A;  4XYQ A;  4NB3 A;  1I94 Q;  3FMC A;  1VQB A;  4O0A A;  3J80 L;  1ZYR C;  5FJ8 H;  1L1O A;  1YHA A;  3CHB D;  1I5F A;  1JCK B;  2K50 A;  4DR6 Q;  4JI2 L;  2PW7 A;  2D5D A;  5LL6 S;  2B39 A;  3UDG A;  1EY0 A;  4DAP A;  1JE5 A;  2XN9 C;  3M4Q A;  4LF4 Q;  1BVS A;  3NHH A;  3LWE A;  4P71 A;  2X69 A;  3HFZ B;  3NWS A;  4XT1 B;  1X3Q A;  2EJG C;  4GKJ Q;  4JI7 Q;  2CW0 C;  4NP5 A;  2L15 A;  4B9X A;  2ICI A;  1MD2 D;  3S2D B;  1Q1E A;  1EIY B;  3PF4 A;  2A6H D;  3I4L A;  3K5N A;  2KUM A;  4NXM L;  1G2T A;  2CQA A;  3PGZ A;  1FD7 D;  1VQG A;  5LMN L;  4A3M G;  1WD1 A;  2OWO A;  1TII D;  4WJW A;  1NUC A;  4LUV A;  1H9M A;  1QJO A;  1Y8N B;  2F0I A;  2Z8L A;  2KBN A;  2VB3 X;  5IGG A;  2L55 A;  1NBW A;  4UY8 C;  3F2B A;  3FP9 A;  4LF5 L;  2SEB D;  5EPL A;  2ATW A;  4JG2 A;  2KED A;  5HUR A;  4RAU C;  2KCC A;  4JBK A;  1JIC A;  1QWY A;  1BF4 A;  2E8G A;  1B70 B;  2R92 B;  1F2L A;  1A62 A;  4EQ5 A;  4DV4 Q;  2BOS A;  1SNP A;  1VDZ A;  1FVI A;  2E2H B;  3EA6 A;  2F0S A;  2F0N A;  4CJ1 B;  4LF8 Q;  4LJZ C;  2Y0S B;  2MP1 A;  4FVM A;  1EY9 A;  1V1P B;  4DV2 L;  4JI8 L;  2MPM A;  1KTK A;  1EY4 A;  4DXG A;  3AQQ A;  2YTX A;  2EYJ A;  3KF6 A;  3MVV A;  2JA5 H;  2EJM A;  4Z9C B;  2F52 A;  3U9O A;  2XVS A;  3D8G A;  5JEA J;  2UXC Q;  1JB3 A;  4RGT A;  1YHB A;  3RN2 A;  2PZW A;  5GAG C;  1K83 H;  2AQ1 B;  2F3I A;  5ELD A;  3HOZ G;  2CFM A;  1O7L A;  4H44 C;  4DAY B;  3F1Z A;  1TVX A;  2GA4 B;  3CC4 A;  1I6V C;  1OXV A;  3A54 A;  2F0G A;  2JK8 A;  2SNS A;  4KKS A;  1L2F A;  2QA4 A;  1TY2 A;  1CHQ D;  1B9M A;  4ZAI A;  3F8T A;  3K5O A;  1O7I A;  2C35 B;  2M2L A;  4GN4 B;  5CGK A;  1VS0 A;  2Z4I A;  2CHB D;  1BUV T;  1GUS A;  4KD3 A;  4X65 Q;  1HUN A;  4IQZ A;  4FXD A;  1EQT A;  1SJE D;  3A8I E;  3R2T A;  4YHH Q;  4IAL A;  2JYO A;  4PQX A;  1T9H A;  2MHV A;  3ULL A;  4JYA Q;  1ILP A;  1C4Q A;  2EYL A;  2RBM A;  1L1O C;  3JAM i;  1PDQ A;  5KYL A;  3HOW H;  1SDF A;  3WOE A;  3SK8 A;  2PO4 A;  5AJ3 L;  2JA6 H;  1LT6 D;  2NTT A;  1S5D D;  1I4Q A;  1NCV A;  4CGY B;  2RHS B;  1CSQ A;  1C8C A;  4DUY Q;  4DFA A;  3W1B A;  4OO1 H;  2B8F A;  2K52 A;  1O80 A;  4GNX A;  4QQB X;  2C5C A;  3PUY A;  5JAV A;  2HT1 A;  2HIV A;  3PCO B;  2DY8 A;  3PO3 G;  1SYG A;  3OSO A;  2VQF L;  3SK4 A;  1GUT A;  2A69 D;  1E3P A;  4K5X A;  4NXN L;  3KK7 A;  2F0W A;  4LFA L;  3OW7 A;  1N36 Q;  1JR0 D;  3ITP A;  2R3Z A;  5I6W A;  3A74 A;  4IFD G;  3FRP B;  3T1H L;  2WFW A;  4DV7 L;  1EEI D;  1GXD C;  1CUK A;  3S2H B;  4B3T L;  3CCQ A;  4JBM A;  2IHE A;  5E4X A;  2IX3 A;  1B8A A;  2N8N A;  4WOR A;  2Q8T A;  4JV5 L;  1EQV A;  5I6Y A;  4LF7 Q;  3CU7 A;  3HOY B;  3NE5 B;  1CSP A;  3MC0 B;  5C4X G;  2XRS D;  4X64 L;  1A0I A;  1F9S A;  1TS3 A;  4KHV A;  3GTL H;  4R9W A;  1Y8O B;  3OMC A;  4ZCK A;  4KV6 A;  4NDX A;  3E0J A;  2JA5 B;  1LT3 D;  1PH5 A;  4G57 A;  4IPG A;  3SHL A;  1BKB A;  4BY1 G;  5F2D A;  2B3G A;  5T1G A;  3TZU A;  4EGV A;  1QVF A;  3HOX H;  4MHE A;  4C3I G;  4CKC A;  4DK0 A;  3J7A F;  4FP5 D;  3CME A;  2QIL A;  4X62 Q;  2RVL A;  4BY7 B;  3KF6 B;  1E2V A;  3HKZ G;  1XMQ Q;  1N33 Q;  4C3J H;  1AZP A;  3EQL C;  2K1B A;  1E7Z A;  4U68 A;  1TWF H;  1ZYR D;  2K05 A;  5K36 G;  4FO2 A;  5J39 A;  4QCL A;  4DV1 L;  3VR2 A;  1F77 A;  5IT9 c;  3ZYY X;  2EPB A;  4HIK A;  4DPG A;  4C3H G;  2F3W A;  4JC0 A;  4S3S A;  1FR3 A;  1LTB D;  5A2Q L;  4R8I A;  3RZO B;  5EQ0 A;  1FL0 A;  1STY A;  2PQE A;  4DR1 Q;  1VQF A;  4ME5 A;  2JP1 A;  4G7H C;  2KCM A;  3HOW B;  3ULP A;  2MO0 A;  3NPP A;  3G7L A;  1Y1W G;  2CW0 D;  2JA6 B;  4R4C A;  4X3K A;  4C56 C;  5M5Y B;  1O7Y A;  1H95 A;  1MJC A;  2DN8 A;  5A2Q E;  2LMC B;  1GHK A;  1PH6 A;  1AE3 A;  1S5B D;  3I56 A;  2UU9 L;  5EAY A;  2PNR C;  4X6A H;  4UP7 A;  5IYB G;  2RA4 A;  4H0L C;  5CV5 A;  4EQO A;  4K5W A;  1K8A C;  2YU9 B;  3CCE A;  1OXX K;  4O1N A;  2QEJ C;  3T51 B;  3K5L A;  2EYO A;  1STH A;  1BCP B;  2WV6 D;  4BWG B;  1B2T A;  4GNX B;  2L12 A;  4I7A A;  4JI5 Q;  2C9O A;  1E2W A;  1M1K C;  2KA7 A;  1L0X B;  4JVZ A;  1JT8 A;  3NQI A;  2QF7 A;  1H9S A;  2PQA A;  4UPA A;  4A3E H;  1UAP A;  3A5Z B;  1NJI C;  4LK1 C;  4QIW E;  4JI2 Q;  5IGC A;  4JCV E;  1D5Z C;  4BBR G;  3UE0 A;  3Q6S A;  4A3M B;  2NUC A;  3A56 A;  3BVG A;  3Q8D A;  3S1M H;  1WTR A;  3GTL B;  2A1A A;  2RHQ B;  3B6Y A;  3K0Y A;  4OIJ A;  1UE1 A;  1HFG A;  2N3S A;  4DGZ A;  2GVB A;  2RDF A;  3NEL A;  4WJ4 A;  5C3E G;  1AZQ A;  3S17 H;  4DV0 L;  2JA8 G;  1VMP A;  5C6A A;  5C4J H;  5C3W A;  1PH4 A;  3HOX B;  1ENA A;  1VQ4 A;  1ASZ A;  1N32 L;  4NXM Q;  5NUC A;  1HNZ L;  3GTO H;  3UI2 A;  4GOP A;  3H91 A;  5IT9 E;  5HY6 A;  4TQU S;  5LMN Q;  1G8Z D;  1Q8I A;  4C3J B;  3PIO A;  3KLW A;  4MNO A;  3AU7 A;  1TWF B;  1NTG A;  3E9H A;  1PYW D;  3SEB A;  4ZK9 B;  4HCS A;  5EKI A;  4DXF A;  4LF5 Q;  3D4R A;  3GO5 A;  5EJW A;  2JA7 G;  2QDB A;  3HKS A;  2R93 G;  4P73 A;  4XXE A;  2VUM H;  4HJ5 A;  2HDM A;  2B63 G;  4AH6 A;  4BY1 H;  1QOH A;  4RG1 A;  3BZC A;  4APV A;  3NTH A;  2ZJQ A;  1DOK A;  4R8N A;  4C3I H;  4AQY L;  1CI3 M;  5J3B A;  4JI1 L;  1U9R A;  5FO9 B;  1F2M A;  5JPN C;  5JOB A;  4ME3 A;  4GLV B;  4DV2 Q;  4JI8 Q;  4I65 A;  1E1O A;  1NAP A;  4GKK L;  2F3V A;  3J7Z C;  1PZK D;  1X9N A;  1B7Y B;  3U58 A;  1Q81 C;  4GLA C;  4MIU A;  1FGB D;  2KHS A;  3I3C A;  3FKI H;  3KLS X;  1A15 A;  5TSS A;  4CDF C;  4IUU A;  5E3F A;  3RD4 A;  3T16 A;  5KYI A;  2Q2U A;  4NPS A;  1QB5 D;  1Y1W H;  3T13 A;  4C1N K;  3CD6 A;  1EU3 A;  2HQE A;  1PTO B;  4QJF A;  3TRE A;  1SJH D;  3OYY A;  2IL8 A;  2P5Z X;  3E6Z X;  4PZ7 A;  1WJJ A;  3MEH A;  1WCM G;  3A8K E;  2D0P A;  3GTM B;  2B2U C;  4NMZ A;  3J81 L;  5ELE A;  2SNM A;  4GN3 B;  2FXQ A;  4CDC C;  1RTN A;  5ELF A;  1XYI A;  1QZG A;  5FLX L;  2BA1 A;  2CH4 A;  5CBE E;  1KQS A;  1Y1V G;  3S1M B;  4JK1 C;  2N55 A;  1H9S B;  2CWA A;  2NVX H;  4H7B A;  4A3F H;  3K7U C;  5C0X J;  1VQ8 A;  1KXL A;  2NN6 H;  5AJ3 Q;  2QKI C;  4CDE C;  3BYT B;  3S17 B;  4P72 A;  4B08 A;  3NTI A;  3N52 A;  1B3Q A;  3CAM A;  2V1C C;  4OO1 I;  1KDB A;  1KAB A;  4OX9 Q;  3S15 H;  2M9V A;  3GTO B;  1D1K A;  2HIX A;  2BCO A;  2CH4 W;  5CV6 A;  3AYH B;  5EPJ A;  2VQF Q;  1SFO H;  2EZV A;  5JEA H;  1AH9 A;  1EWH A;  5D3D A;  4Q5V A;  1V1Q A;  5JVH 3;  4NXN Q;  4C1N I;  4LFA Q;  3TQY A;  3SK5 A;  4LNQ A;  1JC7 A;  3G6J B;  4KK7 A;  1I4X A;  4TVA B;  3T1H Q;  4GOP C;  1TR5 A;  3KUP A;  4DV7 Q;  1KRS A;  1LUZ A;  3L9A X;  2UUB L;  1ENC A;  2MGS A;  2VUM B;  4CHT B;  4GOP B;  4B3T Q;  1QE6 A;  1VF7 A;  4UHV A;  1PH1 A;  2NYZ D;  4BY1 B;  3EIV A;  1BOS A;  1PTO F;  2ZXR A;  1VMC A;  4JV5 Q;  3V2T A;  4OL7 A;  1KDA A;  4C3I B;  3LX0 A;  1BBX C;  4JI6 L;  3F2U A;  2E76 C;  5M3M G;  2EXD A;  2EYM A;  3HKZ B;  4X64 Q;  2RF4 A;  3J80 c;  2WKC A;  5KGU A;  3MFY A;  2IW3 A;  4N9T A;  2QGQ A;  1OTC A;  2JEB I;  4K2K A;  4AYB B;  2A5H A;  4YWK A;  4IZ8 A;  4C3H B;  2VW9 A;  5BR8 L;  1H9K A;  3K59 A;  2PCF B;  1X6O A;  4OEL B;  2F1M A;  2L1B A;  1V1P A;  2E75 C;  2ID0 A;  4DR7 L;  2DNE A;  1Y1W B;  1VQ5 A;  2K75 A;  2UXB L;  1IBK L;  1XNR Q;  1PVO A;  4BBS G;  2BDO A;  5LMN W;  1CKN B;  4POF A;  5IE8 A;  3L0O A;  1B3A A;  4IFD J;  1LTA D;  1X3G A;  3HRZ C;  4Q0F A;  4IJL A;  4DV1 Q;  1TKW B;  1KAA A;  3NEN A;  1SLJ A;  3CCJ A;  4A93 G;  5CV7 A;  3U4V A;  1DD2 A;  5M3F H;  1SYF A;  4A3J G;  1L0W A;  3RMH A;  2NVX B;  1QIL A;  5G3L D;  4A3F B;  1SSO A;  4IUP A;  1D2B A;  3PQI A;  5COR A;  4B3R L;  5I2X A;  1K0R A;  1PFN A;  4DK1 A;  5IP9 H;  1I4G A;  2EY6 A;  2F0H A;  3BDC A;  1P16 A;  2I0Q A;  1I4R A;  1EUJ A;  5C4H A;  1A6X A;  1F9P A;  3NBH A;  1IBM L;  1PA6 A;  1NR2 A;  4K6L A;  2I5L X;  1EU4 A;  5IGE A;  3C1E A;  2UU9 Q;  4L8J A;  4LFB L;  1JQY D;  1TWG B;  2I46 A;  1E24 A;  2MNA A;  3NTK A;  2YYZ A;  2RSN A;  4UDU C;  5CBA E;  1SFO B;  2F03 A;  1DJR D;  1SNO A;  1U4R A;  4BBR B;  3PIP A;  2CWP A;  1VQ9 A;  3CPW A;  3QOL A;  1PYS B;  4HMI A;  1IYJ B;  1TXY A;  4DNI A;  2OCE A;  4CKB A;  2EJF C;  3K5M A;  1VQ6 A;  1BXT A;  4JI0 L;  4XQQ A;  1STB A;  1ICW A;  1U4L A;  3J80 E;  2F0D A;  4A3D H;  1Q12 A;  1UNS A;  3PIO 3;  2OQ0 A;  1D6E C;  3M7G A;  4LF9 L;  4CBV A;  3R2I A;  1FYC A;  4RCO A;  4F88 A;  1TWC H;  3SDZ A;  4LWC A;  1XTC D;  2ZTD A;  1LAB A;  3S1N H;  1PFM A;  2JEA I;  2Z6K A;  4F7X A;  5FO7 B;  1X56 A;  1VQH A;  2RKS A;  4DV0 Q;  1F9Q A;  2XSC A;  1LTI D;  1EY8 A;  2R93 B;  3I73 A;  1SE2 A;  3DUZ A;  5DM7 3;  2JQO A;  2XNA C;  1ZEQ X;  5FLM H;  3CCU A;  1N32 Q;  4DU9 A;  1FJG L;  1SE8 A;  1LYL A;  2WAC A;  3TEH B;  2F4V L;  1YNN C;  4RHS A;  1YHQ A;  1HNZ Q;  4LUO A;  4UP8 A;  3S2H H;  1EZ8 A;  1HRJ A;  1RF2 D;  1QVG A;  4YIJ A;  4L5Q A;  1ESF A;  1JJ2 A;  2IX1 A;  5C0X G;  1SNC A;  3DHQ A;  5IYC H;  3HOV G;  2G9D A;  1MJE A;  1II3 A;  3I70 A;  3PSI A;  1BQQ T;  4DR5 L;  2VZA A;  3HOY H;  3SK6 A;  3CCS A;  3A7A B;  1AFP A;  4HCE A;  5M3F B;  4IO9 A;  5JJI A;  4AIM A;  2JSO A;  3VR5 A;  5A35 A;  4YCV A;  1JB7 A;  2K33 A;  2WB1 B;  3L2P A;  3TZD A;  4AQY Q;  2X6G A;  3FPU B;  4A4I A;  3T53 B;  3S14 H;  4JI1 Q;  2D2C C;  1F2Y A;  2Q8R E;  1G51 A;  2ES2 A;  5COY A;  4QY7 A;  3WOF A;  4GKK Q;  3OIQ A;  1SN8 A;  1CQV A;  1HFN A;  1I3Q H;  3IL8 A;  4BY7 H;  1LM0 A;  1PH8 A;  1DOM A;  3M4P A;  3MXU A;  1J8I A;  1LO5 D;  3HG9 A;  1AEX A;  3BS1 A;  5DM6 3;  3JAM L;  3LGJ A;  4R4T A;  4OHJ A;  3VYU A;  3NBH B;  5IYD G;  4C2M H;  2VS1 A;  2KCN A;  2LXK A;  4DR4 L;  3CCL A;  2PZT A;  3LWU A;  2IX0 A;  1MSG A;  1E2Z A;  3K57 A;  1I50 B;  2LKV A;  2OEO A;  1GUO A;  3RZO H;  1WI5 A;  3A7L A;  1STA A;  1VF5 C;  2B2Y A;  2HCI A;  1M8A A;  3NP8 A;  4A3D B;  1V43 A;  2O2L D;  1EY7 A;  5C3X A;  4J8Q A;  4A3L G;  1YJW A;  4IPH A;  5KND A;  5M5Y H;  5IY0 A;  2GVA A;  1WTW A;  1B1Z A;  1VQA A;  4PMW A;  2F0K A;  3QO2 A;  3K80 C;  4OX9 L;  1TWC B;  3RLF A;  2FHT A;  2AUK A;  3L3O C;  4IOC A;  1R9T H;  1S3O A;  3S1N B;  2L11 A;  1Q82 C;  3TBI B;  1TS2 A;  1T5X D;  2NN6 I;  1NE3 A;  5E4W C;  2YU9 H;  3H0G G;  1HZB A;  3GV6 A;  1ENF A;  1XXG A;  3IKJ A;  3RNU A;  1JOR A;  2NBF A;  1WTV A;  1LLR D;  2SDF A;  1PFS A;  2DY7 A;  1UE5 A;  2WAQ B;  3I91 A;  1Y69 U;  2UUA L;  3EN2 A;  4K6D A;  1GKH A;  1I4H A;  1YVC A;  2Z6K C;  3V05 A;  2G9H D;  2Q8I B;  1U4P A;  2A6E C;  4HAE A;  5CV9 A;  1PH7 A;  2KHJ A;  2I07 B;  1JOK A;  3NUC A;  1XNQ L;  5IP7 G;  4IJH A;  2TSS A;  5LMU L;  3PUX A;  2OF1 A;  3KYH C;  1HTL D;  3BDL A;  1SE3 A;  4RKL A;  2ZM6 L;  1PZI D;  3K58 A;  5FOB B;  1RCV D;  4KN7 C;  2UUB Q;  5KNC A;  1Q3L A;  4A3M H;  1XTD A;  1UUP A;  2IHF A;  2F0O A;  2Z6B A;  4IOA A;  3RUZ A;  1N9W A;  3I72 A;  2M00 A;  3C1F A;  4FXG C;  3I8Z A;  3S14 B;  4JI6 Q;  3CC7 A;  4CJ0 B;  5D14 A;  2OTJ A;  4KMU C;  4ABN A;  4ZLT F;  3OHX C;  4BBS B;  1I3Q B;  5C0X H;  2I5M X;  3HOU G;  2KQ3 A;  1K8G A;  3H15 A;  2N88 A;  2ZJP A;  5BR8 Q;  2HQL A;  1XNR L;  2EY1 A;  3CXC A;  3VA7 A;  4A93 B;  2IPK D;  3UDI A;  4C2M B;  2K5D A;  2IJ0 A;  4IUQ A;  1WYD A;  3GTK H;  1K73 C;  1HR0 W;  1EY5 A;  4A3I G;  3MA2 B;  1X3F A;  5DEH A;  2JA9 A;  1HQR D;  4DR7 Q;  3I7F A;  1P8L A;  1QUQ B;  3OWF A;  4KD4 A;  4LF6 L;  4HTH A;  1KC8 C;  2UXB Q;  1IBK Q;  3J7A 5;  2NB0 A;  1PHJ A;  1L0Y B;  3DEP A;  3MEF A;  1PLF A;  4GLX A;  5ELC A;  2XWJ B;  3HOZ H;  5IGF A;  4K14 A;  3AFQ A;  1D1I A;  3P7J A;  3GTG H;  1GUG A;  1OXT A;  2Q2H A;  4PZ6 A;  1A63 A;  3PIP 3;  3D4D A;  2VXW A;  2B2T A;  4KHP L;  1W2B A;  4HSP A;  2R7Z G;  1R9T B;  3KJP A;  4WRD A;  1PRT F;  4B3R Q;  3P20 A;  2E5L L;  4K0K L;  3AEV A;  3S24 A;  1BCP C;  4YWM A;  1IBM Q;  3CQZ H;  3VR4 A;  4GNX C;  4HJ9 A;  1DM0 B;  1YNN D;  2K5W A;  4UP9 A;  4LFB Q;  3CF5 A;  4O2D A;  3ER0 A;  4KHZ A;  4ODG A;  2QDL A;  2AQ3 B;  5GAD C;  1K8M A;  4RHR A;  3Q22 A;  1PTO H;  2H1E A;  1V9P A;  3KJO A;  1VQ7 A;  2PI2 A;  3A5U A;  3GTM H;  3S1Q H;  4A3B G;  3PO2 G;  4ZYS A;  1E0B A;  2F0P A;  3CRL C;  2V4D A;  1S40 A;  3PO3 H;  4X66 L;  3NXW A;  1NY4 A;  4JI0 Q;  2K5N A;  1VQN A;  1Q1B A;  1VQE A;  3GD7 A;  4BS9 A;  4DA2 A;  2R7D A;  3DM1 A;  5EBC A;  4IFD H;  4A3C G;  1HR0 L;  1D8L A;  5IIF A;  4LF9 Q;  3FDT A;  4JOI A;  1EZ6 A;  1H9J A;  5I4D A;  5IP7 H;  2SOB A;  1BDO A;  3VA5 A;  3NEM A;  2DJG C;  4FYD A;  4OIK A;  1XPU A;  3Q0A A;  3J81 c;  1CT1 D;  4A3K G;  4RMF A;  3BVZ A;  3EVQ A;  2VL6 A;  3NSW A;  3NBI A;  1C0A A;  1JWM D;  5JJK A;  5FLX c;  2XWB B;  2FJ2 A;  5C4X H;  1SYD A;  1EQR A;  1I4P A;  1KNE A;  2E2J H;  3GTK B;  1EEF D;  1GOZ A;  1HQM C;  1FJG Q;  4I7Z C;  2F4V Q;  5C4Z A;  1SYC A;  3I4M G;  1EYA A;  3IFD A;  5J22 A;  1FNV A;  4TRD A;  1KRT A;  1NNX A;  3W3A A;  1U4M A;  3TSS A;  3HOZ B;  4LW1 A;  1CM9 A;  4BXX G;  1IHZ A;  4DR5 Q;  3GTG B;  3I4N G;  2LXJ A;  4DV6 L;  2A68 C;  3P75 A;  1JJC B;  4HMJ A;  4DF7 A;  1RJT A;  3G4S A;  5K36 H;  1EOT A;  4YWL A;  1CKO A;  3W5O A;  4L5T A;  5C44 G;  4Y7N H;  4LFC L;  1TWA H;  4C3H H;  5HGQ A;  1CHP D;  4IUR A;  1CKN A;  4RFB A;  3CQZ B;  2R92 G;  4OXP A;  3SVM A;  3MXN A; 
#chains in the Genus database with same CATH homology
 3HOZ G;  4A93 G;  1D7Q A;  2CFM A;  4JI3 L;  2DUD A;  3U4V A;  1PH9 A;  4DAY B;  3F1Z A;  5M3F H;  1PYB A;  4A3J G;  3CC4 A;  4OWT B;  1OXV A;  1L0W A;  2JK8 A;  5IYD H;  1DGS A;  4Y52 H;  1L2F A;  1YZ6 A;  1Z9F A;  2QA4 A;  3CMA A;  4FDB A;  4B3R L;  1K0R A;  4A3G G;  5IP9 H;  3PUV A;  3F8T A;  5H1S E;  3OTO L;  3U4Z A;  1O7I A;  1P16 A;  2I0Q A;  1Z47 A;  4DR4 Q;  1EUJ A;  1LTL A;  2C35 B;  4GN4 B;  1N34 L;  1VS0 A;  3D31 A;  1IBM L;  1PA6 A;  5IYB H;  2I5L X;  4DR3 L;  2UXD L;  5ELO A;  2UUC L;  4X65 Q;  1AE2 A;  5E7N A;  1BBU A;  3M7N A;  1VQK A;  2UU9 Q;  4LFB L;  2K5H A;  4YHH Q;  1JJG A;  1PH3 A;  3GTJ H;  3CW2 C;  1E24 A;  1T9H A;  4A3L H;  2MNA A;  3ULL A;  2NZH A;  4JYA Q;  2YYZ A;  2K4K A;  1HJP A;  1KAW A;  3RR5 A;  1L1O C;  3JAM i;  2BH8 A;  2AHO B;  3G48 A;  4POG A;  3HOW H;  1HNW L;  5AJ3 L;  3DLL A;  3PIP A;  2CWP A;  1VQ9 A;  1J6Q A;  3CPW A;  2A8V A;  2IT1 A;  4A3F G;  1PH2 A;  1I94 L;  2JA6 H;  1PYS B;  2I5H A;  2RHS B;  4B3S L;  2NN6 G;  1FGU A;  4DR6 L;  1CSQ A;  1PV4 A;  3G6E A;  5GAH C;  3T1Y L;  4DUY Q;  1IYJ B;  3PUZ A;  3W1B A;  1TXY A;  1WOC A;  2OCE A;  2K52 A;  3H0G H;  4DNI A;  4GNX A;  4QQB X;  5FJ8 G;  1TWG H;  3PUY A;  3ULJ A;  1YEZ A;  2GN5 A;  2HIV A;  3K81 C;  4KLK A;  4JI0 L;  3PCO B;  2HT1 A;  1VQ6 A;  1EFW A;  3PO3 G;  2MFI A;  4JOI C;  4A3D H;  4LF4 L;  3PUW A;  1Q12 A;  2VQF L;  1EWI A;  4BBR H;  2K5V A;  1E3P A;  2OQ0 A;  3J81 i;  4DUZ L;  1HNX L;  4NXN L;  2CKZ B;  4LFA L;  1IL2 A;  1N36 Q;  2UUA Q;  1HZC A;  4LF9 L;  3KDF B;  5JEA G;  1K9M C;  4GKJ L;  2PNH A;  4JI7 L;  3A74 A;  3KDF A;  1Q86 C;  4IFD G;  3T1H L;  2OTL A;  1X65 A;  1K3R A;  1G6P A;  2WFW A;  4DV7 L;  1C9O A;  4L5R C;  1TWC H;  4LWC A;  1CUK A;  5C3E H;  2NVQ H;  2ZTD A;  1X54 A;  2OQK A;  1XNQ Q;  1X3E A;  4B3T L;  3S1N H;  2JA8 H;  2JEA I;  2Z6K A;  1VQD A;  3CCQ A;  4JBM A;  2IHE A;  5LMU Q;  2Q2T A;  2KEN A;  1X56 A;  1B8A A;  2N8N A;  1VQH A;  4PG3 A;  4DV0 Q;  2BH2 A;  4JV5 L;  1U5K A;  2AKW B;  2ZM6 Q;  2K14 A;  1GD7 A;  4LF7 Q;  4R4O A;  2JQO A;  1IBL L;  1CSP A;  4R1J A;  1YBY A;  5FLM H;  4A76 A;  3CCU A;  1N32 Q;  5C4X G;  1FJG L;  1SE8 A;  1LYL A;  3TEH B;  2F4V L;  4X64 L;  1HNZ Q;  1A0I A;  1YHQ A;  4LUO A;  4UP8 A;  1GO3 E;  2VQE L;  3CC2 A;  3S2H H;  3GTL H;  4KI0 A;  1QVG A;  1UWV A;  4L5Q A;  4AYB E;  1E1T A;  1JJ2 A;  1PH5 A;  2IX1 A;  4DV4 L;  5C0X G;  4IPG A;  2MO1 A;  1BKB A;  4BY1 G;  5IYC H;  2NVY H;  2JA7 H;  1MKH A;  2ZJR A;  1MJE A;  3HOV G;  3D0F A;  2B29 A;  3PSI A;  3IRB A;  4DR5 L;  2VZA A;  3STB C;  1J5E L;  2B3G A;  4LF8 L;  2BA0 A;  2B63 H;  3HOU H;  3HOY H;  1QVF A;  3HOX H;  4HIM A;  3CCS A;  2Q2I A;  1GM5 A;  1XPO A;  5C0X I;  1YIJ A;  3J81 j;  3CME A;  2XTI A;  4X62 Q;  4IO9 A;  1M90 C;  2NVT H;  5JJI A;  4AIM A;  4BA1 I;  5GAE C;  3KF6 B;  3E9I A;  3HKZ G;  1XMQ Q;  1N33 Q;  4C3J H;  3JC6 6;  3I4N H;  1VQI A;  1E7Z A;  4YCV A;  1JB7 A;  4A3I H;  1TWF H;  5K36 G;  3L2P A;  4AQY Q;  4A4I A;  1YJ9 A;  2EIF A;  3S14 H;  4JI1 Q;  2NZO A;  2UXC L;  3K0X A;  3MXN B;  1W3S A;  2JA5 G;  4DV1 L;  1G51 A;  3TS2 A;  2ES2 A;  3ERS X;  4GS3 A;  5IT9 c;  4HIK A;  4DPG A;  4QY7 A;  3RLN A;  3UE1 A;  4JC0 A;  2HHH Q;  4GKK Q;  1YI2 A;  3CCR A;  1SN8 A;  1I3Q H;  1FL0 A;  4DR1 Q;  1YNX A;  4LF6 Q;  4BY7 H;  1LM0 A;  3K7A H;  1VQF A;  1PH8 A;  2Y0S G;  3M4P A;  2KCM A;  2XGT A;  4QL5 A;  5M3F G;  3VDY A;  1VQM A;  2JE6 I;  3ULP A;  3LGJ A;  2MO0 A;  4R4T A;  1Q8K A;  5IYD G;  1Y1W G;  3FHW A;  3NBH B;  4R4C A;  4C2M H;  1XJV A;  2VS1 A;  2R7Z H;  2LXK A;  4DR4 L;  4GN5 A;  3CCL A;  3M9B A;  1H95 A;  5IP9 G;  1MJC A;  2WB1 G;  3A0J A;  4KHP Q;  2IX0 A;  1QZH A;  1PH6 A;  4BA2 I;  1AE3 A;  2ZTC A;  4X65 L;  3I56 A;  4IPC A;  4A3G H;  2UU9 L;  5EAY A;  1WI5 A;  3RZO H;  3U50 C;  4X6A H;  2R7F A;  4UP7 A;  4YHH L;  5IYB G;  1C7Y A;  2E5L Q;  4K0K Q;  1WCM H;  1VQJ A;  1K8A C;  3CCE A;  4JYA L;  1OXX K;  1V43 A;  2N49 A;  2PI2 E;  3S1R H;  1VCI A;  4A3L G;  1KD1 C;  1YJW A;  4IPH A;  1SRU A;  4IPD A;  5M5Y H;  4OON A;  2GVA A;  5IY0 A;  1VQA A;  1Y1V H;  2KHI A;  4PMW A;  1ASY A;  3HOW G;  5ELN A;  4GNX B;  3GTP H;  3K80 C;  4JI5 Q;  4DUY L;  3DM3 A;  2JA6 G;  4OX9 L;  1I50 H;  3RLF A;  4OWX B;  1M1K C;  4DAM A;  2EQS A;  5GRO A;  4IOC A;  3M4O H;  1R9T H;  1S3O A;  1SR3 A;  1Q82 C;  2VY3 A;  2PQA B;  1JT8 A;  2NN6 I;  1NE3 A;  1S72 A;  2YU9 H;  2H5X A;  1NMF A;  4OO1 G;  3H0G G;  1HZB A;  2PQA A;  3BJU A;  3KOJ A;  4UPA A;  3PO2 H;  4A3E H;  4A3B H;  3RNU A;  1A8V A;  3A5Z B;  1NJI C;  3HOU G;  3OW2 A;  1PFS A;  4QIW E;  4JI4 Q;  4JI2 Q;  1YIT A;  3RZD H;  1UE5 A;  4JCV E;  4A3D G;  1N36 L;  2UUA L;  3EN2 A;  4BBR G;  1GKH A;  1YVC A;  2Z6K C;  5DLQ E;  3UE0 A;  4X66 Q;  3JAM c;  1XMO Q;  4MZ9 A;  5IWA Q;  3Q8D A;  3S1M H;  1PH7 A;  2A1A A;  2KHJ A;  2RHQ B;  3B6Y A;  4A3C H;  1XNQ L;  2WP8 J;  5IP7 G;  4IJH A;  1UE1 A;  2N3S A;  4DV3 Q;  2YTV A;  2GVB A;  2MQH A;  5LMU L;  3NEL A;  4IFD I;  3PUX A;  4WJ4 A;  5C3E G;  3J80 i;  3S17 H;  3KYH C;  2ASB A;  4JBJ A;  4DV0 L;  1HR0 Q;  2JA8 G;  3KFU A;  4R4Q A;  3PV0 A;  5C4J H;  2ZM6 L;  4LF7 L;  1PH4 A;  4A3K H;  1Q7Y C;  3HKZ E;  2UUB Q;  1HH2 P;  3BU2 A;  3G71 A;  1EOV A;  4JBW A;  2Z0S A;  1Q46 A;  3E0E A;  4A3M H;  1VQ4 A;  1Y14 B;  1ASZ A;  1N32 L;  4DK3 C;  1XTD A;  4NXM Q;  2IHF A;  1HNZ L;  3GTO H;  2WAQ G;  3GDE A;  4GOP A;  5HY6 A;  4LUZ A;  2KCT A;  4TQU S;  5LMN Q;  5FLM G;  4IOA A;  3PIO A;  2AWN A;  1IXR A;  2VNU D;  5M3M H;  1N9W A;  3KLW A;  1VQP A;  4MNO A;  2PMZ E;  4HJ7 A;  3H3V I;  1NTG A;  3E9H A;  3I4M H;  3GTQ H;  3S16 H;  1CKM A;  4JI6 Q;  3CC7 A;  1UE7 A;  1UE6 A;  1U0L A;  4LF5 Q;  4MTN A;  3GO5 A;  2Y0S E;  2OTJ A;  2JA7 G;  3HKS A;  2R93 G;  5IYC G;  4P73 A;  3I2Z A;  4DV5 Q;  1VQO A;  4B3M Q;  4HJ5 A;  2VUM H;  3S2D H;  2I5M X;  4X62 L;  2B63 G;  3HOY G;  1K8G A;  4YCW A;  4AH6 A;  3RLO A;  4PZ8 A;  4YY3 Q;  3H15 A;  4RG1 A;  3HOX G;  3BZC A;  4APV A;  4BY1 H;  2ZJQ A;  2ZJP A;  1XMQ L;  1N33 L;  2AMC B;  3KF8 B;  2WB1 E;  5BR8 Q;  2HQL A;  3SGI A;  1XNR L;  4HIO A;  3CXC A;  3UDI A;  4C3I H;  4AQY L;  1J5E Q;  5J3B A;  4JI1 L;  1WYD A;  4DV6 Q;  1K73 C;  1HR0 W;  3GTK H;  4A3I G;  1HZ9 A;  4ME3 A;  4GLV B;  4XTC S;  4DV2 Q;  4JI8 Q;  1X3F A;  1E1O A;  2JA9 A;  4GKK L;  2HHH L;  3M85 A;  5C44 H;  3I7F A;  4BBS H;  4DR7 Q;  3J7Z C;  1P8L A;  1QUQ B;  5M5X H;  4DR2 Q;  1X9N A;  1B7Y B;  4DR1 L;  2YTY A;  3U58 A;  1QUQ A;  4GLA C;  1Q81 C;  1KC8 C;  4LF6 L;  2R92 H;  1IBK Q;  2UXB Q;  3J7A 5;  1PHJ A;  4LFC Q;  3FKI H;  4HID A;  3MEF A;  1MIU A;  4GLX A;  2E2H H;  3HOZ H;  4A93 H;  4BY7 G;  3CPF A;  3AFQ A;  3CCV A;  2E2I H;  3GTG H;  3TRZ A;  1VQC A;  2CQO A;  1OXT A;  2Q2H A;  4PZ6 A;  4A3J H;  1A63 A;  5GQO A;  1UEB A;  2R6G A;  4JI3 Q;  4KHP L;  1W2B A;  2Q2U A;  2R7Z G;  4QGU A;  3K8A A;  4NPS A;  1OXU A;  3NEN A;  3KJP A;  1GVP A;  5M5W H;  4HJ8 A;  1TWH H;  3TS0 A;  1Y1W H;  4HJA A;  4B3R Q;  4K0K L;  2E5L L;  3CD6 A;  3UDF A;  1EIF A;  4R4I A;  4QJF A;  3OTO Q;  1E22 A;  1QVC A;  3TRE A;  3OYY A;  3AEV A;  4H02 A;  1SMX A;  3I55 A;  4PZ7 A;  1N34 Q;  1WFQ A;  1WJJ A;  4J15 A;  1WCM G;  3BZK A;  3S24 A;  4YWM A;  2D0P A;  3CQZ H;  1IBM Q;  2JJQ A;  4GNX C;  2D62 A;  4HJ9 A;  1JMC A;  4DR3 Q;  2UXD Q;  1X55 A;  4EX5 A;  2UUC Q;  4GN3 B;  4YCU A;  2FXQ A;  4UP9 A;  4LFB Q;  3CF5 A;  4O2D A;  3ER0 A;  3RN5 A;  1QZG A;  4JI5 L;  4KHZ A;  2BA1 A;  1KQS A;  2A19 A;  1Y1V G;  4P74 A;  3CP0 A;  1VQL A;  2QEX A;  2CWA A;  2LSS A;  5GAD C;  2NVX H;  4WJ3 M;  4A3F H;  1G29 1;  1YJN A;  3K7U C;  5C0X J;  3CCM A;  3F2C A;  1VQ8 A;  1KXL A;  3M3Y H;  1HNW Q;  5AJ3 Q;  3I4O A;  4NB3 A;  4P72 A;  1I94 Q;  1V9P A;  1L1O B;  3KJO A;  3STB D;  1VQB A;  2PI2 A;  4O0A A;  1VQ7 A;  1NMG A;  2YV5 A;  3CAM A;  3A5U A;  3GTM H;  5FJ8 H;  1L1O A;  4B3S Q;  1YHA A;  3S1Q H;  1I5F A;  4A3B G;  2K50 A;  4JI4 L;  2WAQ E;  2V1C C;  1N8R C;  3T1Y Q;  4A3E G;  4JI2 L;  3PO2 G;  4OO1 I;  4A75 A;  1KIX A;  3S15 H;  4OX9 Q;  2CCZ A;  1KHI A;  1XMO L;  1S40 A;  3PO3 H;  4X66 L;  1IZ6 A;  3PF5 A;  1NY4 A;  5IWA L;  3UDG A;  4XIG S;  4JI0 Q;  1XPR A;  3W1G A;  1JE5 A;  2HIX A;  2K5N A;  2DGY A;  1VQN A;  1Q1B A;  1VQE A;  3GD7 A;  3M4Q A;  4LF4 Q;  3AYH B;  2VQF Q;  4DV3 L;  1SFO H;  1BVS A;  2R7D A;  4P75 A;  1EQQ A;  4P71 A;  1AH9 A;  3F2D A;  4DUZ Q;  1V1Q A;  3L7Z C;  1HNX Q;  4A3C G;  3HFZ B;  4NXN Q;  4DKA C;  4LFA Q;  1HR0 L;  1D8L A;  4OWW B;  1RIP A;  3TQY A;  4LF9 Q;  4DR6 Q;  1SLJ A;  4JOI A;  4LNQ A;  4GKJ Q;  4JI7 Q;  4TVA B;  3T1H Q;  4GOP C;  5IP7 H;  3UDX A;  4DV7 Q;  2L15 A;  1KRS A;  1LUZ A;  3NEM A;  2UUB L;  1HZA A;  1Q1E A;  4GOP B;  1EIY B;  4B3T Q;  1XPU A;  3PF4 A;  3J81 c;  4NXM L;  1PH1 A;  4A3K G;  4RMF A;  1EYG A;  3PGZ A;  1VQG A;  3EIV A;  5LMN L;  4A3M G;  2OWO A;  2VL6 A;  2R93 H;  1C0A A;  4LUV A;  5FLX c;  4JV5 Q;  5JJK A;  5C4X H;  1EQR A;  2KBN A;  4DK6 C;  5JJL A;  3EBE A;  4ALP A;  1KL9 A;  2D0O A;  2E2J H;  4JI6 L;  3H3V H;  1NBW A;  5M3M G;  1IBL Q;  4UY8 C;  3F2B A;  2EXD A;  1FJG Q;  3FP9 A;  1OXS C;  4LF5 L;  2F4V Q;  4X64 Q;  4BXX H;  2RF4 A;  3I4M G;  2VQE Q;  3J80 c;  2ATW A;  4JG2 A;  4DV5 L;  4B3M L;  2RCN A;  2QGQ A;  3AFP A;  3HOV H;  4JBK A;  1OTC A;  2JEB I;  2E8G A;  1B70 B;  1KRT A;  4YY3 L;  1A62 A;  2VUM G;  4EQ5 A;  4DV4 Q;  4YWK A;  1FVI A;  2VW9 A;  5BR8 L;  4LW1 A;  4BXX G;  3ICE A;  4DR5 Q;  4LF8 Q;  3I4N G;  1X6O A;  2LXJ A;  4DV6 L;  4DV2 L;  1JJC B;  3WWV A;  4JI8 L;  4L5S A;  3G4S A;  2ID0 A;  4DR7 L;  4YWL A;  1CKO A;  3W5O A;  4DR2 L;  1VQ5 A;  3AQQ A;  2K75 A;  2YTX A;  4L5T A;  1RL2 A;  3KF6 A;  2JA5 H;  2UXB L;  1IBK L;  1XNR Q;  1PVO A;  2F52 A;  5C44 G;  4BBS G;  4Y7N H;  5LMN W;  1CKN B;  4LFC L;  1TWA H;  1BBW A;  5JEA J;  4C3H H;  4POF A;  5HGQ A;  2UXC Q;  5IE8 A;  2AWO A;  1CKN A;  3L0O A;  4IFD J;  1X3G A;  2R92 G;  4OXP A;  4DV1 Q;  4IJL A;  3ZJY C;  1I6H H;  2IY5 B;  3RN2 A;  1YHB A;  4AYB G;  2N78 A;  5GAG C;  3FKI G;  1K83 H;  1SRO A;  2F3I A;  2ZTE A;  3CCJ A;  2ALY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...