4B3RQ

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3rQ00
3H0GH 3CCEA 3BZKA 3EN2A 1YJNA 3M3YH 4DR7Q 4QQBX 1VQ9A 3PSIA 5ELOA 1Z9FA 2AKWB 2NN6G 4NB3A 4UY8C 3HOYH 1WYDA 4DR4Q 3GTLH 4A3DH 2MNAA 2R93G 2WFWA 4JI0L 1VQBA 5LMUQ 4A3LG 4OO1G 3PUYA 3HOZG 1C7YA 4YCWA 5C3EH 3D0FA 1E24A 1KAWA 2CCZA 3KOJA 4R4OA 3TRZA 1ASZA 1X3EA 1PH1A 2WAQG 3MXNB 4DV2L 5IP7H 3M7NA 4DR4L 2DUDA 1HZAA 1BKBA 3I7FA 1LM0A 4LFAL 1NMGA 1LTLA 1PYSB 1D7QA 4YCVA 2UUBQ 4YCUA 4DR5L 1HH2P 4LF6Q 3T1YQ 1VQ7A 3TQYA 1VQNA 2VZAA 1CSPA 5E7NA 2ZJQA 3RLFA 2VY3A 1B8AA 1HNWQ 4WJ3M 4B3SL 2GVBA 1YNXA 4O2DA 4J15A 2E5LL 3S15H 2NZOA 1O7IA 5IP7G 2K4KA 3NENA 3S14H 5JJKA 5C0XI 2VQEL 3S1NH 1IL2A 2AWNA 1L1OB 1N36L 2Q2UA 1YHQA 1EYGA 1IYJB 2UU9Q 4BA1I 4LF6L 3KF6A 4KI0A 4IOAA 4PMWA 1AH9A 1FVIA 4HIDA 3PO2H 5BR8L 1VQPA 2LXJA 4DV5Q 4HJAA 1PH3A 4LWCA 4A3JH 4EX5A 1AE3A 3W1GA 4LF8Q 1UE6A 1YVCA 1K8AC 4JI4Q 4OX9Q 3RLOA 5K36G 3CCJA 1YJ9A 1VQMA 1NTGA 4DR1L 4APVA 1IBMQ 4BBRH 2CQOA 1MJEA 3CCQA 5IYDH 2MO1A 4BA2I 2K75A 2E5LQ 4JYAL 4DUYL 3CQZH 4L5RC 2F4VL 4UP9A 1HNWL 1JE5A 1SROA 4JG2A 4GNXB 4A3JG 1N34Q 4JI6L 4LF9L 3F2BA 3PO3G 4WJ4A 3A5ZB 3T1YL 1VQDA 2OQ0A 4GNXC 3LGJA 3RR5A 3UE0A 1Q81C 4PZ7A 3CMEA 1YITA 4GS3A 1WJJA 1NJIC 1GM5A 2R6GA 2HHHL 3UDFA 4Y52H 1MKHA 1X56A 1JJGA 2RHQB 2GVAA 3OYYA 2UXBL 2E2JH 3S24A 1R9TH 5C4XG 3GO5A 3F1ZA 3CXCA 5C44H 4DR1Q 1IBML 2R7DA 4X62Q 1JJ2A 1IXRA 4JI4L 2Z6KC 3GDEA 4OX9L 2A8VA 3CD6A 2VS1A 2UXCQ 2V1CC 1SE8A 2E8GA 1SR3A 5M5YH 4DV5L 1PH8A 4H02A 4BBSH 5LMNW 3F2DA 2AMCB 3U58A 4IPHA 2PNHA 3OTOL 1LUZA 4AQYL 3KLWA 4DV0L 2K14A 2OCEA 4GLVB 4BXXG 4K0KL 2I5MX 5C4XH 1XMOL 2JA7G 4B3ML 2ZTCA 5JJLA 3ER0A 3CCLA 1A8VA 4GN5A 4X65L 4GN3B 3JAMi 2EQSA 3M9BA 4BBSG 1HZBA 3GTOH 3OW2A 5GAHC 3NELA 4JBMA 4GKJQ 2UXDQ 2Z6KA 1BVSA 4JC0A 1VQCA 4DPGA 4L5SA 5C0XG 4YHHL 4NXMQ 1FL0A 3PIPA 5GAEC 5C3EG 1XNQQ 1TWFH 4A75A 1EQQA 1EFWA 2ASBA 3SGIA 3H3VI 2L15A 2IT1A 1N32L 3KF8B 1A62A 1G51A 2HT1A 4A3BG 3UDXA 4DV4L 2Y0SE 4GNXA 4A3FG 1JB7A 2K50A 4JCVE 2Z0SA 3CF5A 3CC2A 2IX1A 3STBD 2IHEA 4A3EG 2QEXA 1VQLA 1Q12A 3RLNA 3S1RH 1PV4A 1CUKA 3I55A 1Q1EA 1N8RC 3GTQH 4GKKQ 1KC8C 3CCUA 1JT8A 2HIXA 4A3FH 3S2DH 1TWHH 1X65A 3VDYA 3STBC 3CCRA 1XNRL 1C9OA 1VQOA 1HR0Q 2R7ZH 2N49A 4X66L 4AYBE 4GLXA 2D0OA 1SRUA 3PO2G 3F8TA 2UXCL 2NN6I 2K5NA 1XJVA 5M5XH 1PH7A 3S16H 3HKZG 2OQKA 4DV4Q 4QJFA 4A3CG 3J81c 4DUZQ 1VQ5A 1NY4A 3T1HL 4LFBQ 2IY5B 1U0LA 2KHIA 4DR5Q 2KHJA 1XPRA 2UUCQ 1QUQA 1X55A 4IFDG 1I5FA 4NPSA 3K81C 1CSQA 1VQEA 2I5HA 1TXYA 2H5XA 3PV0A 4FDBA 4JI2Q 1LYLA 1HNXQ 5GAGC 2ZJRA 1KQSA 2CFMA 2LXKA 4DR6L 3GTPH 1SLJA 4JBJA 3RN2A 3PUWA 4X6AH 1J5EL 5AJ3Q 1IBLQ 2F4VQ 4R4TA 4R4QA 5M3FH 5HGQA 1QZHA 1E1OA 4O0AA 3S1MH 4YY3Q 2JE6I 5ELNA 5IP9G 1A63A 4P71A 4C3IH 2ZM6Q 2MO0A 1VS0A 1IZ6A 3J81i 1HNXL 2NVTH 3CPFA 3S1QH 4JI3L 2PQAB 4JI2L 5C44G 2F3IA 4B3RL 2D0PA 2FXQA 3FKIG 2BA0A 2N8NA 4EQ5A 3T1HQ 5JEAJ 2K5HA 2VNUD 4C3HH 4HJ8A 5IYCG 1M90C 4LF4L 1I6HH 1W2BA 2Q2HA 5DLQE 2VQFL 4LF7Q 3F2CA 1XTDA 1GVPA 1KXLA 2JEBI 4RMFA 1ASYA 4LF4Q 2JA7H 3HKSA 1IBKQ 1KRSA 5IYBG 2NVXH 3FKIH 1YJWA 1VQAA 3PIOA 1B70B 1PH9A 2PMZE 2HHHQ 5IYCH 5IWAQ 5J3BA 1Z47A 4LUVA 4BY7H 2JEAI 1H95A 4HIMA 3KFUA 3PGZA 1A0IA 1Y1VG 2K52A 1HR0W 4A3IG 2YYZA 2I0QA 4IPGA 4LF9Q 3G48A 3M4OH 4C2MH 4X64L 4DV2Q 1VQIA 4DUYQ 1UE5A 4PZ6A 3I4OA 4OWTB 1QZGA 1WOCA 3AFQA 1OXTA 2JK8A 4GOPC 1EUJA 4DR6Q 4BY7G 5JEAG 4A3BH 1SN8A 1CKOA 4DR2Q 1Y1VH 1N32Q 4OONA 3NEMA 5EAYA 2ID0A 2WB1G 5HY6A 4JV5Q 3J7ZC 4JI7L 4A3MG 2R7FA 3MEFA 2RHSB 4DK6C 3JAMc 4A3EH 2KBNA 5FJ8H 3ULPA 1S72A 1QVGA 2B63H 1HJPA 3KYHC 3CCVA 2C35B 2HQLA 1L2FA 2B29A 2PI2A 4LNQA 4LFCL 2ES2A 1VQ6A 3CC4A 3AEVA 4IFDI 4DV7Q 2OTJA 4HJ5A 4UP8A 1WCMH 4C3JH 4KHZA 2R7ZG 5C4JH 1VQJA 1I50H 2N78A 3H3VH 2WAQE 2AHOB 1E22A 2OWOA 4JBKA 3W5OA 4AYBG 3J81j 3ICEA 2PQAA 4DV0Q 3W1BA 4JI5Q 3CW2C 1NE3A 4AQYQ 1JMCA 3CCSA 1HNZQ 4A3CH 3PF5A 4OWWB 2QA4A 4JI7Q 1WCMG 4QIWE 3CC7A 3RZDH 4JI8Q 4KHPQ 3NBHB 1T9HA 4HIOA 4P73A 3IRBA 2Y0SG 1JJCB 3HOVH 2UXBQ 4JI8L 2BA1A 5LMUL 1UWVA 1VQFA 4YWKA 2ZTDA 3RNUA 2YV5A 2XGTA 4R1JA 3Q8DA 1SFOH 1XNQL 3BJUA 1PA6A 1QUQB 5M3FG 1Q8KA 4KLKA 2VL6A 3H15A 4DR7L 4A76A 2KENA 5IP9H 1C0AA 4YWMA 5FLXc 5IWAL 2WP8J 2UXDL 3GTGH 3HOVG 1GO3E 2ATWA 2MQHA 1MJCA 1OXSC 2MFIA 3GD7A 4OO1I 1S3OA 4ALPA 3A0JA 3ZJYC 2JA8H 2VW9A 2VUMG 2R92H 4GOPB 4DR3L 3K0XA 2EIFA 3KDFB 1X3GA 2BH8A 3GTJH 4AIMA 1K83H 1PH5A 3M85A 1RL2A 2JA5G 3RZOH 4LF7L 1EWIA 2CWPA 1K9MC 1B7YB 4L5TA 3HOUH 4K0KQ 1XPUA 1WI5A 3DLLA 1XPOA 1E1TA 1UE1A 4P72A 5GROA 1N33L 2UUAL 3CPWA 1PHJA 1N9WA 1EOVA 4JI5L 4B3RQ 2ZJPA 4R4IA 4OWXB 3AQQA 5IYBH 2BH2A 3L2PA 4X62L 4IO9A 2JA5H 3G71A 1UE7A 3G6EA 2KCMA 4JI3Q 3HOWG 4JI1Q 2CKZB 1VQGA 2JJQA 1Q1BA 3TS0A 3FP9A 3HOUG 2AWOA 1KIXA 4LF5L 3I4MG 3M4QA 1W3SA 4A3IH 4QL5A 3J80i 1Y1WG 4ME3A 4BY1H 4X64Q 3CP0A 1J5EQ 1GKHA 3TREA 3I56A 3B6YA 1NBWA 4HJ7A 1OXVA 1EQRA 3KF6B 4B3TQ 4POGA 1CKNB 1X3FA 3PUXA 3PUZA 1UEBA 4JOIA 4LFAQ 3KJPA 4JI6Q 1OXUA 1K73C 3I4MH 3UDGA 1FGUA 1PH2A 3HOXH 4BY1G 3U4ZA 4GLAC 2NVQH 1KRTA 2HIVA 3K7UC 4A3MH 1CKNA 1IBKL 2K5VA 4A93G 5FJ8G 2B63G 4DV3Q 2YTVA 4IOCA 3K8AA 5IT9c 3I4NH 4KHPL 2NZHA 2YTYA 1Q82C 4JOIC 1D8LA 2ALYB 4A3KH 4JI0Q 4IPDA 4HIKA 2YTXA 3E9IA 1PH6A 5BR8Q 3ERSX 3HOXG 1HNZL 4XIGS 2JA9A 1PFSA 4IJHA 1XNRQ 1QVFA 1L0WA 3ULJA 2YU9H 4LW1A 4QY7A 2JQOA 3BU2A 1OTCA 2UU9L 4A93H 1XMQQ 4IJLA 1TWGH 2JA6H 4A3KG 1AE2A 3WWVA 5LMNL 1I94L 2I5LX 1Y14B 4DV7L 4P75A 3A74A 4LFCQ 3S2HH 4MNOA 4B3SQ 4DAMA 1VQKA 2PI2E 5IY0A 2VQFQ 1DGSA 3H0GG 1G291 5M3MG 1K0RA 2UUBL 2NVYH 2IX0A 3KJOA 4DV1L 3BZCA 2R93H 1PH4A 1QVCA 1J6QA 5FLMG 1EIFA 1X6OA 2UUCL 3HOZH 1KL9A 4JV5L 4POFA 1YBYA 4DV1Q 3EBEA 1EIYB 4DR2L 4QGUA 3E9HA 3TS2A 4UPAA 2EXDA 3S17H 4A3GH 4MTNA 5M3MH 3M4PA 5H1SE 2F52A 1BBWA 4HJ9A 2E2HH 1YEZA 4OXPA 3CMAA 1Q7YC 3HKZE 4LUZA 5FLMH 4LUOA 2VUMH 2GN5A 2WB1E 3AFPA 5LMNQ 1I94Q 2CWAA 4X65Q 2JA8G 2R92G 4JI1L 3RN5A 4PG3A 4UP7A 4A3GG 3FHWA 5JJIA 4DV6Q 3CAMA 1I3QH 1L1OA 1VCIA 1OXXK 3EIVA 4TQUS 3OTOQ 1VQ4A 4MZ9A 2UUAQ 4RG1A 1CKMA 1P8LA 1GD7A 4LFBL 2OTLA 1PVOA 4A4IA 3K80C 4IFDJ 1FJGL 1NMFA 1WFQA 2RF4A 4TVAB 5GQOA 5C0XJ 1HZ9A 4DV3L 4JBWA 4DNIA 3HOWH 4IPCA 4DR3Q 3GTMH 3PCOB 1HR0L 5M5WH 2E2IH 1SMXA 1E3PA 2ZTEA 4R4CA 4Y7NH 2IHFA 1Y1WH 3GTKH 4DK3C 3U4VA 3CCMA 4BBRG 4DAYB 2KCTA 4YHHQ 3AYHB 4NXML 2A1AA 1V9PA 2LSSA 4NXNQ 1YZ6A 1Q46A 2A19A 1RIPA 2D62A 5IYDG 2ZM6L 4B3TL 3TEHB 1N34L 4YY3L 3UE1A 1YI2A 2Q2TA 3ULLA 4JYAQ 3HFZB 5AJ3L 1IBLL 3PO3H 1VQ8A 1HZCA 2Q2IA 1G6PA 3UDIA 4YWLA 4LF5Q 1TWCH 2N3SA 4NXNL 3E0EA 1L1OC 3KDFA 1YHBA 4GOPA 1TWAH 3U50C 2DGYA 4LF8L 1VQHA 1YHAA 3I4NG 1P16A 1U5KA 3J80c 2QGQA 1Q86C 3PF4A 1KHIA 1N33Q 4L5QA 4DUZL 4DKAC 1X9NA 2RCNA 4PZ8A 1FJGQ 4GKJL 1N36Q 4XTCS 5GADC 3G4SA 2JA6G 3L0OA 3K7AH 4AH6A 2VQEQ 3A5UA 3PUVA 4X66Q 3HOYG 4BXXH 3JC66 3J7A5 2XTIA 4A3DG 1KD1C 1V1QA 4P74A 4A3LH 4DV6L 1K8GA 1K3RA 1MIUA 1PYBA 2B3GA 1V43A 1XMQL 4B3MQ 1XMOQ 3I2ZA 3DM3A 3L7ZC 1E7ZA 4GN4B 1YIJA 1M1KC 5IE8A 1S40A 4GKKL 3D31A 1X54A 1BBUA
chains in the Genus database with same CATH superfamily
3BZKA 1RF2D 1WD0A 4QQBX 2JXMB 2NN6G 4UY8C 3HOYH 1WYDA 5IGFA 3GTLH 4A3DH 2MNAA 4A3LG 1AZPA 1ONLA 1C7YA 3NTIA 2FJ2A 5C3EH 5D14A 1KAWA 3TRZA 3BYYB 2MHVA 1FNWA 2E2HB 4FF3A 4DV2L 5IP7H 5M3MB 1BKBA 4H13C 1NMGA 3FKIB 1PYSB 1SJED 2EY6A 1IW7C 1GUTA 1VMCA 3RLFA 2ICIA 2VY3A 3I3CA 1HNWQ 2E76C 5IP7G 2K4KA 1QB5D 3FPUB 5M9OA 3S14H 4QIWB 5I9PA 2B8GA 5E4WC 5K36H 1SYCA 2Q2UA 1YHQA 1ET6A 4KJOA 1AH9A 1FVIA 2AQ2B 4C3IB 5BR8L 2EDGA 1A2TA 4J8QA 3W1GA 4LF8Q 1UE6A 1H9JA 5K36G 5KEEA 1VQMA 4DR1L 1IBMQ 4APVA 4ZAIA 3CCQA 5IYDH 4L5RC 3FRPB 1U4PA 5JVG3 1HNWL 1JE5A 1SROA 3F2BA 1VQDA 3J80E 3RR5A 1NJIC 3CMEA 1YITA 1EY4A 4GS3A 4E6IA 3HOXB 2R6GA 2PPBC 2DNCA 1EY5A 3LX0A 1A3VA 3M4YA 4DF7A 2UXBL 1RCVD 1R9TH 5DM63 2R7ZB 5C4HA 1SMYC 3F1ZA 4JI4L 2A8VA 3CD6A 4X3TA 1BDOA 4DV5L 1PH8A 1DZ1A 1Q90A 1JOKA 1DM0B 3OTOL 3LNNA 1G2SA 5ELFA 4H44C 4IZ8A 2K01A 4GN5A 2KEEA 1H9RA 2KOLA 2D2CC 4K14A 4K5WA 3M9BA 1EYCA 5AFWA 5DM73 3ERQA 2UXDQ 2Z6KA 1BVSA 1TQOA 5EPKA 4CKBA 2JA8B 4KMUC 2OEOA 4R8IA 4XQNA 1XNQQ 1K8MA 1EFWA 1EQQA 1MSGA 3SK5A 2XNAC 1EU4A 4DV4L 4A3FG 2E74C 4M8AA 3CF5A 3STBD 2IHEA 3DMUA 2QEXA 1VQLA 1Q12A 3RLNA 4KK7A 4OELB 3CCUA 4DAPA 4A3FH 1TWHH 5CBAE 2JSOA 3VDYA 5JPNC 3STBC 1XNRL 4CBVA 2R7ZH 5T1GA 4AYBE 2PW7A 1SRUA 3F8TA 1CI3M 1XJVA 4QJFA 2KHJA 1XPRA 1G8ZD 1TVXA 1I5FA 4F7XA 4KV6A 2I5HA 2H5XA 2JP1A 3PV0A 4RGTA 3L3OC 4A3EB 1KQSA 4DR6L 4K8JA 3KK7A 5M3FH 1Y1VB 5HGQA 1QZHA 3S1MH 4YY3Q 2JE6I 1U4LA 2L1BA 4C3IH 2ZM6Q 2MO0A 3J81i 3S1QH 1LTID 1L0XB 1TR5A 1YNND 4F88A 4G57A 4JI2L 2PZUA 4RWSC 1S5FD 3FKIG 4JK1C 1STYA 5JEAJ 4BY7B 4HJ8A 1M90C 4LF4L 4C3IG 1GUGA 1I6HH 1W2BA 4LF7Q 3F2CA 2K6AA 1XTDA 1GVPA 5EQ0A 2PZTA 1ASYA 4RMFA 4LF4Q 2A6EC 3FKIH 3SXHA 3PIOA 1B70B 1PH9A 4DXFA 1I6HB 5J3BA 4LUVA 4BY7H 1MHWC 3KFUA 1I4HA 1SEBD 1Y1VG 2K52A 1DXMA 4IQZA 5C3EB 1HR0W 2YYZA 1B50A 3C2PA 2B2TC 4DUYQ 3GTLB 1UE5A 4PZ6A 3S1QB 3I4OA 3HOYB 2JK8A 1EUJA 1ICFB 4BY7G 3T16A 3S1MB 5C6AA 1Y1VH 5M3FB 4TKOB 1JWUD 3FMCA 3R3OA 4FF1A 3J7ZC 2F0KA 2RDHA 3MEFA 1KLUD 4A3EH 5FJ8H 1QVGA 2B63H 5JAVA 5KGUA 3KYHC 2DY8A 3K7AB 3TZUA 2L5TA 1JOQA 1PTOF 1VQ6A 3AEVA 4DV7Q 2OTJA 2D9UA 2WACA 2F0PA 2XN9C 4HCEA 1EWHA 1B1ZA 1F2MA 4JBKA 3J81j 2PQAA 4DV0Q 4JI5Q 1ET9A 1NE3A 4AQYQ 3CCSA 4A3CH 1TWHB 4A3FB 2K7VA 1K28A 4QIWE 1UWVA 3RNUA 1XNQL 4Y7NB 3BJUA 1Q8KA 2PQEA 2VL6A 3J81E 4RKLA 1O7ZA 2KENA 2RDGA 4A76A 5ELDA 1C0AA 3GTMB 4YWMA 3E3XA 3TSSA 5FLXc 3Q0AA 2X6GA 3HOWB 5IWAL 2WP8J 2UXDL 1GO3E 3GD7A 4OO1I 1X3QA 3A0JA 2RVLA 3ZJYC 2JA8H 2R92H 3IAYA 4GOPB 3KDFB 4BA2I 5C5LA 3MFYA 1I3QB 2QDLA 1K9MC 1XPUA 1XPOA 1ZKOA 4P72A 1N33L 4JPBW 3CPWA 1N9WA 2NTSA 2F0NA 3AQQA 1JC7A 4J6HA 4JI3Q 3BVZA 4HN7A 3TS0A 2WAQB 3FP9A 2AWOA 1KIXA 1PZKD 1RTOA 3J7AF 1NSNS 3J80i 2VB3X 2Z8LA 1D6EC 2K28A 3TREA 3B6YA 1F9QA 1RTNA 3KF6B 1A3TA 5A2QE 1R9TB 4POGA 3Q23A 3PUZA 3MWYW 5I2XA 1LTBD 3UDGA 3NXWA 3HOXH 3D4WA 5BN3A 3S2HB 4IUVA 2HIVA 2K5VA 4DV3Q 5IT9c 2NZHA 4A93B 4XYQA 5IT9E 1PH6A 3ERSX 1HA6A 4TRDA 1QVFA 2G9HD 2UU9L 3CRLC 2A68D 1EQVA 1BO0A 5DAUA 1AE2A 4ODGA 4DV7L 4LFCQ 4DAMA 1VQKA 5CYUA 3FPPA 5IY0A 2VQFQ 1CM9A 3EA6A 3S14B 2UUBL 4ABNA 5G3LF 3A56A 3HP3A 1EIFA 1RD9D 1X6OA 2B39A 1B53A 4LMQD 4POFA 1EIYB 4DR2L 4QGUA 1FYCA 3E9HA 4BY1B 4ZCKA 1QOHA 2EXDA 2JYOA 1SNCA 4MTNA 5M3MH 5H1SE 1EY0A 2E2HH 4OXPA 3CMAA 4DXGA 5EBDA 3HKZE 2QCPX 2FMMA 4LUOA 3NBHA 4NP5A 4A3DB 4PG3A 4WORA 3FHWA 4RGNA 5JJIA 4TQUS 3EIVA 1K83B 2UUAQ 4RG1A 1IKLA 1GD7A 4QUFA 2ZXOA 2CH4A 3K80C 4IFDJ 1WFQA 5GQOA 4HAEA 1HZ9A 1S5ED 4DNIA 3W2DA 3PMFA 4TSSA 2E2IH 1TS2A 3U4VA 4BBRG 4DAYB 1V9PA 1PFMA 2ZM6L 1RIPA 2D62A 4B3TL 1MBYA 3RZDB 1TWAB 1YI2A 3TZDA 2Q2TA 1VQ8A 1G6PA 1TWCB 4YWLA 4N9TA 4G7OC 2K32A 4MTKA 1YHBA 3U50C 2BDOA 2DGYA 3EROA 1VQHA 1YHAA 3I4NG 3D3RA 1P16A 1U5KA 1Q86C 4QF4A 5EJWA 1EY7A 1KHIA 1N33Q 1QE6A 4L5QA 3GTKB 2L0CA 2F3VA 3I4LA 3CHBD 5BN4A 2LFNA 3DWQA 2DN8A 1K8GA 1MIUA 2B3GA 4B3MQ 4C1NK 1KLGD 1M1KC 1E7ZA 3D31A 5CMDA 1GUSA 3EN2A 1YJNA 3VYTA 1VQ9A 5ELOA 2AKWB 2IW3A 4NB3A 3AB9A 2WFWA 4JI0L 1KNEA 1EIGA 1EU3A 3OIQA 5C0XH 3NBIA 4NDXA 5DNFA 2K03A 4YCWA 2CCZA 1ASZA 1X3EA 4DR4L 2KUMA 4ZK9B 3M7NA 4GZYC 1LTLA 1D7QA 1E0BA 4DR5L 3NSWA 3HOZB 2VZAA 5E7NA 4KY6A 3DM1A 2FMCA 4K2LA 4WJ3M 4B3SL 3S15H 1O7IA 4O42A 4CDFC 3FEWX 1IL2A 3H09A 2HDLA 4WRDA 1IYJB 2B2VA 4BA1I 1AZQA 4LF6L 4PMWA 3K5MA 2EY1A 2LXJA 4DV5Q 4HJAA 1TWGB 4JI4Q 3RLOA 3CCJA 3EVQA 5I4DA 2LKVA 5CV8A 2MO1A 4A3KB 1ZYRD 4NW2A 1SXTA 3CQZH 4UP9A 4B08A 4JG2A 1SE3A 3PO3G 5K5PA 1AEXA 4CJ2C 4GNXC 5FO7B 3W3AA 4PZ7A 4IUUA 3K6OA 4G7ZC 1GM5A 1XYIA 3I4MB 4Y52H 2CHBD 1CA6A 1JJGA 2EZVA 1PLFA 4FXKC 2A73B 3K58A 1D5XC 3CXCA 5C44H 4DR1Q 1IBML 2R7DA 1IXRA 1D5ZC 2A68C 2UXCQ 2V1CC 1SR3A 5M5YH 4XXEA 2NTTA 2PNHA 4DNTB 4AQYL 1XXGA 1GJXA 4GLVB 1WD1A 5JJLA 4OL7A 1O7YA 2A5HA 5EKIA 1HZBA 3OW2A 5GAHC 3GTJB 1TWFB 2TSSA 1IW7D 4L5SA 1KABA 3NE5B 3SE0A 3QOLA 1ZXTA 1FL0A 5GAEC 4ZQ3A 3QB3A 3SGIA 3H3VI 2L15A 2IT1A 3GTOB 1PTOD 3KF8B 1DYQA 2HT1A 3P75A 4PV1C 1BUVT 2GA4B 2EJMA 1E2WA 4JCVE 1VDZA 2Z0SA 3CC2A 4A3EG 5A2QL 1GXDC 5E1FA 1PV4A 1QILA 1CUKA 3GTQH 1KC8C 5ELCA 1LT5D 3S2DH 1C9OA 4C1NI 2LS01 5IGDA 1WTWA 1LACA 2UXCL 2C5CA 4DGZA 5M5XH 1I50B 3S16H 3HKZG 3K59A 3OW7A 4DV4Q 4DUZQ 1BCPB 1VQ5A 4LFBQ 3SK4A 5CV9A 4FF4A 1QUQA 1SYDA 3R93A 1TXYA 4JI2Q 2RCFA 5D3DA 4JW0A 3JAME 1J9OA 3CRKC 5GAGC 2CFMA 2LXKA 3GTPH 1SLJA 3RN2A 1STEA 4X6AH 1IBLQ 4R4TA 3URYA 1S5CD 1E1OA 2G5DA 2B2WA 2ICEC 4A3JB 2E2DC 2NVTH 2RSNA 1CK1A 1KTKA 2F3IA 2D0PA 4IUPA 2FXQA 1IL8A 2N8NA 4IALA 1U9RA 2VNUD 2K5HA 1XWEA 4C3HH 1BR9A 5DLQE 2ZXRA 5FO9B 1KXLA 3HKSA 2KVMA 2SDFA 1KRSA 5E4XA 2QDBA 3MC0B 1BNZA 5IYBG 1AW7A 2NVXH 1K8OA 4LJZC 1VQAA 4LK1C 2PCFB 2OXPA 1V1PB 5IWAQ 2MPMA 1TIID 1A6XA 4F87A 1SNDA 4IPGA 1D1KA 3SK6A 1JICA 3G48A 4C2MH 2PW5A 3H91A 3K5NA 2MGSA 2L11A 1WOCA 5I6YA 1D1IA 3AFQA 3A8JE 1QG7A 4GOPC 2AQ3B 5JEAG 3M3YB 4A3BH 1SN8A 1CKOA 5EPJA 3NEMA 2ID0A 2WB1G 5HY6A 2K33A 1AFPA 4JI7L 2R7FA 2RHSB 2WINB 3A8IE 3KLRA 4XQJA 3CCVA 2N88A 3DXJC 4EQNA 2KHSA 3P20A 3QO2A 4FYDA 2LY7A 4C3JH 5C4JH 1CFMA 3DWPA 2N78A 1B44D 1ENAA 1ICWA 2A6ED 4DAVA 3W1BA 1EY9A 5CR3A 2O2LD 1I4QA 4KTAA 4OWWB 3K0YA 4CDDC 1WTXA 4IFDH 4KHPQ 1T9HA 3S1RB 1DCZA 4HIOA 1HFNA 4PMBA 3IRBA 2Y0SG 3G6JB 3ZYYX 3HOVH 2UXBQ 1E2ZA 1VQFA 2ZTDA 3WOEA 5FLXL 1YNJD 1QUQB 2CW0C 5M5WB 5IP9H 4QB4A 3AU7A 4RH6A 5KIXA 2BOSA 5NUCA 2BE5D 2ATWA 2MQHA 4K2KA 1MJCA 1OXSC 1EIHA 4ALPA 2VW9A 2B2UA 2XVSA 4DR3L 3K0XA 1X3GA 4HMJA 2JA5G 1PH5A 1BXTA 1QCBD 5EBCA 4LF7L 4KHVA 1EWIA 3NPPA 3OSOA 4K0KQ 1ILQA 3DLLA 1EOTA 3K5LA 1PHJA 1UAPA 3IL8A 4K6DA 4B3RQ 2EVBA 3L2PA 4XT3B 4IO9A 4DK0A 3H6MA 3G6EA 2KCMA 3HOWG 2JJQA 1VQGA 2F0LA 1Q1BA 4A3GB 4LF5L 4BBSB 1FR3A 1W3SA 4A3IH 4QL5A 1EYDA 2IWHA 4X64Q 3CP0A 1GKHA 1JQYD 1S5DD 1Z6HA 1NBWA 1EQRA 2R93B 2E2JB 1CKNB 2Z4IA 3IKJA 4X3KA 3PUXA 3K57A 1F2YA 1UEBA 3E5SA 4JOIA 3C3LA 4JI6Q 2PZWA 3TMEA 1PH2A 5EKKA 2NVQH 1U4RA 4N9PA 4A3MH 1STGA 1UUPA 2YTVA 3BDCA 4IOCA 2QKIC 2YTYA 1Q82C 1C4QA 2ALYB 2F0UA 1VF5C 2FFKB 1GHKA 2YU9B 3HOXG 1HNZL 4XIGS 3TP7A 4BBRB 4Q0FA 1PFSA 1RODA 3A7AB 1XNRQ 2PNRC 2KQ3A 4LW1A 4QY7A 1TY0A 2JQOA 2EJFC 2MJ8A 3BU2A 1XMQQ 2JA6H 2P5ZX 2DJGC 3I4NB 3PO2B 4J1MA 1I94L 4KKUA 4RCOA 1Y14B 1WTQA 4P75A 1ILPA 1JWSD 1CT1D 3OMGA 4QUCA 3S1NB 5JJZA 2VB2X 2L12A 1RKNA 2NVYH 3BVGA 2IX0A 5IIFA 4EVOA 4UAIA 1J6QA 2IPKD 2UUCL 1BCPD 1SJHD 3BZDB 4UPAA 3C1FA 2CH4W 3S17H 3O13A 4HJ9A 3M4PA 1BBWA 4KY5A 1YEZA 2JA5B 4LUZA 3M7GA 5CC4A 3K5OA 1NUCA 2DNEA 3LWEA 1BOSA 1FGBD 2VUMH 2GN5A 2WB1E 1I94Q 2CWAA 4JI1L 5ISRA 2QILA 3HOUB 1MGSA 1STBA 4DV6Q 2Z1CA 1L1OA 1VCIA 1AP0A 3RZOB 1VQ4A 5C4ZA 4IUNA 1P8LA 1PVOA 4A4IA 1NMFA 3VR5A 2A74C 2Y0SB 3GV3A 2Z4HA 1IKMA 1SAPA 4PNYA 2ZTEA 1Y1WH 4DFAA 3MZ5A 4YIJA 2XRSD 2A1AA 4PMCA 5IYDG 1Q46A 3AMUA 3HS0C 3DUZA 2B2WC 3UE1A 1CZGA 2CQAA 1PTOH 2EJGC 3HFZB 5LL6S 4DNRB 1IBLL 3PO3H 3TDQA 4HR7B 2Z6BA 4NXNL 4FVMA 3KBXA 1B2TA 1K0SA 1QWYA 2AUJD 4FNFA 4GOPA 4U68A 4IUTA 3J80c 4MN3A 1PRTF 1STNA 4CJ0B 1SYEA 1BF4A 1B3QA 1WCMB 5ELEA 4DUZL 3TBIB 2SNSA 1A2UA 1SYBA 2WB1B 4FO2A 3C46A 1F9RA 3NQTA 4ZYSA 4AH6A 3A5UA 3CU7A 4X66Q 4O1NA 3J7A5 2XTIA 1CTMA 4OO1H 1K3RA 1PYBA 1V43A 1XMQL 3I72A 1DOKA 1LT6D 1XMOQ 4GKKL 3L7ZC 1F2LA 1S40A 3H0GH 1SYFA 2EY5A 3PSIA 4V0BA 1H9SA 1Z9FA 2R93G 1VQBA 3PUYA 2KJXA 3M4OB 1SBBB 2HUGA 2BDNA 1I4XA 2F4IA 3X3MA 3ITPA 2B8FA 3D4DA 4DAYA 1PH1A 4WFN3 3MXNB 2ZT9C 1LM0A 5IT9L 1GUOA 2UUBQ 4YCUA 5FLXE 3DHQA 1HH2P 4LF6Q 5KYLA 2ZJQA 2JA7B 2PYKA 1B8AA 2EYOA 2GVBA 4O2DA 2E5LL 2CW0D 5KNBA 3VR6A 5JJKA 5C0XI 1L1OB 1N36L 4HSVA 2F1MA 2UU9Q 4KN7C 4IOAA 4KI0A 3IFTA 5EPLA 1PH3A 4LWCA 4EX5A 1YVCA 2RSOA 1XX8A 5CORA 4CDEC 2VXWA 1TS3A 1R4QB 5I2YA 2K75A 4L8JA 2E5LQ 4WJ4A 3SHLA 3A5ZB 2NZ1D 2IJ0A 3RMHA 3UE0A 1Q81C 1I4GA 1TS4A 3OOCA 3IFDA 3VYSA 1MKHA 1KDCA 3SR1A 1DD2A 5C4XG 1D5MC 4OX9L 3GDEA 2VS1A 2AQ1B 2B2YC 4H02A 5LMNW 2O5IC 1LUZA 4BXXG 2K14A 3GV6A 1TU2B 3DWAA 5C4XH 1XMOL 2ZTCA 1G91A 3HG9A 1CZWA 4DN4M 4GN3B 4Z9CB 3JAMi 2EQSA 1HUNA 1EZ6A 3BG3A 2Q8IB 5I6WA 3OWFA 4N8FA 2F0JA 4ZKBB 2NN6H 4GKJQ 3NELA 1O78A 1PZID 1LTTD 2XWJB 2I07B 4NXMQ 3WOFA 1LTAD 4A75A 3GTGB 2F0SA 2ASBA 1X3PA 1N32L 5JEAH 4A3BG 1A62A 2L4NA 3CKIB 3QIAA 3UDXA 4GNXA 1SFOB 1JB7A 2K50A 3R2TA 5C4XB 3I8ZA 3QOJA 1HXYD 1EWCA 3R8BA 1Y8PB 2HIXA 1EQTA 5C3XA 3CCRA 2B2UC 1HR0Q 3BDLA 2D0OA 2RA4A 3PO2G 3D8GA 2TMPA 2NN6I 2K5NA 4R8NA 1LTRD 1STAA 3EFXD 3MTSA 5CBEE 1Y69U 4A3CG 1VMPA 1NY4A 4KN4C 1X55A 1WTOA 3Q24A 3K81C 1CSQA 4RKBA 2H1EA 1LYLA 4V190 3QG1A 3LWUA 1VF7A 5EGTA 4CDCC 2OF1A 2G9DA 3E0JA 4R4QA 3NHHA 4O0AA 4X3UA 5IP9G 2PMZB 4P71A 1CHPD 2QW7A 1IZ6A 1SNQA 3NP8A 4B9XA 3CPFA 3TP8A 1HNXL 2CVRA 2HQEA 2EPBA 5CV7A 2HDMA 1H9KA 4B3RL 5IOCA 1NNXA 4EQ5A 3T1HQ 1HHVA 1X32A 2Q2HA 4RGOS 3J7AV 4DU9A 1PDQA 2JA7H 3H94A 1DOMA 1R4PB 1ENCA 2HHHQ 4RGMA 1FD7D 2F0IA 1H95A 4ZUJA 1SDFA 3PGZA 3ND9A 2O5JC 4LF9Q 3M4OH 4UHVA 1F9PA 4DV2Q 1VQIA 4L6TB 4FXDA 1QZGA 4IUQA 1OXTA 2J7ZA 1EZ8A 4JVZA 1Y8OB 2OT2A 4DR6Q 2Z9HA 2I46A 4DR2Q 2B2YA 2F0QA 3KLSA 2DJFC 4JV5Q 1IHZA 4A3MG 4KKSA 3RD4A 1AN8A 3HKZB 4DK6C 3JAMc 2KBNA 3ULPA 1HJPA 2HQLA 4OIKA 1L2FA 4RA8A 2PI2A 1NAPA 4LNQA 4LFCL 2ES2A 3CC4A 2F0WA 2F0OA 1WCMH 2R7ZG 1VQJA 5FK9C 1T5EA 4I7ZC 2AHOB 3W5OA 2EYJA 2RBMA 5IGGA 4EGVA 1LTSD 2HD3A 4KY7A 3PF5A 3S9WA 3OPOA 4JI7Q 1WCMG 3PO3B 2X6LA 3CC7A 3I70A 5I9OA 4CKCA 2PO4A 4MHEA 2BA1A 1Q3LA 5LMUL 4YWKA 3R2IA 3VA7A 4K6LA 4R1JA 1SFOH 1PA6A 3GP7A 5M3FG 4DR7L 1K3BC 1EEFD 1SMYD 3FVQA 3GTGH 3HOVG 5LHY1 2XWBB 2MFIA 3MXGA 2VUMG 2F0FA 4IURA 2MUYA 1RDPD 2BH8A 3M85A 1RL2A 3RZOH 1TT2A 4BWGB 1PXUA 1HRJA 2CWPA 1B7YB 3HOUH 1WI5A 4OHJA 1IYUA 1UE1A 5GROA 5C3WA 2EYPA 3D6CA 5D65A 2VUMB 4OWXB 1FNVA 2JA5H 1YNNC 3G71A 1PRTB 1W6KA 4JI1Q 2CKZB 4NMZA 3S17B 4Q5VA 3I4MG 1HA5A 3M4QA 1Y1WG 5D3IB 2NWGA 2E75C 2EYFA 5FKAC 1J5EQ 3I56A 3F2UA 4DK1A 3NTKA 4B3TQ 1PRTD 1X3FA 3KJPA 4LFAQ 1K73C 3E6ZX 1KDBA 3U4ZA 4GLAC 1KRTA 3V2TA 2HCCA 3K7UC 1CKNA 4CHTB 5FJ8G 2B63G 3K8AA 3I4NH 4JI0Q 2M2LA 4JOIC 1UEAB 4IPDA 1JCKB 4HIKA 3E9IA 1DOLA 5BR8Q 4DA2A 2JA9A 3MXNA 1NCVA 1EY6A 4IJHA 1L0WA 3ULJA 2YU9H 4RCNA 4IJLA 1SE2A 2XIWA 3RUZA 1OO9B 2SNMA 3WWVA 5LMNL 4KD3A 2I5LX 4A3MB 2C9OA 3MXPA 4MNOA 3VR2A 2NVQB 1DGSA 1G291 1MI2A 3I90A 1SNOA 3BYTB 4R9WA 3KJOA 4DV1L 2R93H 5BN5A 3MHBA 4FF2A 5FLMG 4JV5L 4DV1Q 1YBYA 2F03A 3EBEA 4A3IB 2DY7A 2L55A 3OHXC 1GUWA 1SE4A 4A3GH 5ELBA 1FNUA 3NTHA 2KECA 2JA8G 3AFPA 5LMNQ 2R92G 4X65Q 1JWMD 2F0DA 3T53B 3CAMA 4XQQA 3H0GB 1ZYRC 4MZ9A 4U673 1B3AA 1CKMA 4LFBL 2RQXA 1FJGL 1D2BA 5C0XJ 1HTLD 3Q6SA 4DV3L 2F3WA 2QEJC 4DR3Q 2F0TA 3PCOB 5M5WH 5J39A 1SMXA 1E3PA 4ZRZA 3D6WA 3Q22A 2A6HC 3SK8A 3CCMA 5CV5A 2K1BA 4MIUA 4ZKCB 2KCTA 4NXML 3AYHB 4NXNQ 3HOVB 1STHA 1N34L 5HGTA 4YY3L 4B9WA 1I4PA 2WIIB 4JYAQ 4HSPA 5FO8B 1HZCA 2Q2IA 4ULLA 1H9MA 3GQBA 2J0TD 5CV4A 4F8MA 1PTOB 1ESFA 1PZJD 3G7LA 3PF4A 3OMCA 4C3JB 4DKAC 1Y1WB 4ILWA 3KUPA 5GADC 2ZXPA 3G4SA 4OGQC 3L0OA 2VQEQ 3MFGA 3HOYG 4A3DG 1V1QA 4P74A 2M00A 4DV6L 4A3LH 4I65A 1LT4D 1CQFA 3I2ZA 3DM3A 4GN4B 1YIJA 2EXZA 4DR5Q 1JE4A 3CCEA 4A3BB 4DR7Q 3M3YH 3OWEB 4DR4Q 1NR4A 2HCIA 1V1OA 5LMUQ 4OO1G 2K05A 3HOZG 2EE1A 1LLRD 2KCNA 3OIPA 3ONAB 3D0FA 1C8CA 1E24A 3KOJA 4R4OA 3HRZC 1ML0D 2WAQG 1MD2D 4P2CB 3J81L 2DUDA 1HZAA 3I7FA 4ID6A 2SOBA 4LFAL 2F0MA 2NVXB 4YCVA 1WTRA 3T1YQ 1VQ7A 3TQYA 4QMGA 3NQIA 1CSPA 1VQNA 2SEBD 1YNXA 4J15A 2NVYB 2NZOA 3PQIA 1ZEQX 3NENA 2VQEL 3S1NH 1SNMA 2B2VC 2L9HA 2AWNA 3NK9A 3A55A 3D4RA 1EYGA 1O7LA 3X3NA 3I91A 3KF6A 4HIDA 3PO2H 1QNUA 1VQPA 4BS9A 2JA6B 4A3JH 1AE3A 4OX9Q 1K8AC 4ZUIA 1U4MA 1YJ9A 1NTGA 2WV6D 4BBRH 2CQOA 3EQLC 1MJEA 2NUCA 3VR3A 4DUYL 4JYAL 2F4VL 4N8X1 4OIJA 4LF9L 4A3JG 4GNXB 4JI6L 1N34Q 3BVMA 2N55A 3T1YL 2OQ0A 3V05A 4H7BA 3LGJA 3H3VC 1WJJA 3MAQA 2LMCB 1G2TA 3A8KE 4IN3A 3UDFA 2HHHL 5M5XB 5A35A 1X56A 1LABA 1YNJC 2RHQB 1M4VA 2GVAA 3OYYA 5C5MA 3S24A 1PRTC 1TS5A 2E2JH 1G6ZA 3MEHA 3GO5A 1WTHA 2EY2A 1HPCA 4X62Q 1JJ2A 3S2DB 1RJTA 2Z6KC 4HTHA 3UI2A 1SE8A 2E8GA 3GTQB 3ND8A 4BBSH 3F2DA 2AMCB 4C3HG 3U58A 4IPHA 3KLWA 4DV0L 1WTVA 2OCEA 4K0KL 1BBXC 1RHPA 2I5MX 3NWTA 2JA7G 4B3ML 2BCOA 3ER0A 3CCLA 1A8VA 1E2VA 4X65L 4RAUC 4BBSG 3GTOH 5KYIA 2F0GA 3SEBA 4JBMA 1CHQD 3V96A 3N52A 4JC0A 1VQCA 4DPGA 1KAAA 1O80A 5C0XG 4YHHL 1W6JA 3PIPA 5C3EG 1TWFH 2JN4A 3VYRA 1JOOA 1LTGD 1DONA 1G51A 2F0HA 3SVMA 2Y0SE 2X69A 2IX1A 1CA5A 1TY2A 5IGCA 1JB3A 5JVH3 3P1HA 3T56B 4RHSA 3S1RH 3I55A 1Q1EA 1N8RC 2Q8TA 4GKKQ 1JT8A 3TP6A 5DEHA 1X65A 1B9NA 3QJYA 4H0LC 2IX3A 1VQOA 1HQRD 2N49A 4X66L 5L37A 4GLXA 2IL8A 1F2ZA 1LV9A 1A3UA 1PH7A 1BCPC 3VYUA 5C4JB 2OQKA 4HMIA 3J81c 3T1HL 2IY5B 1U0LA 2KHIA 1B4OA 1EYAA 2UUCQ 4IFDG 4NPSA 1VQEA 4FDBA 2RKSA 1SNPA 1HNXQ 2ZJRA 4JBJA 3PUWA 1J5EL 5AJ3Q 2D5DA 2F4VQ 3SDZA 4HCSA 2H4OA 5ELNA 1A63A 1VS0A 1PFNA 4UDUC 3DEOA 4WJWA 4JI3L 2PQAB 4C2MB 5C44G 1UNSA 5LL6X 3PIP3 2BA0A 3PIO3 3I73A 5IYCG 3S15B 1BQQT 2VQFL 2EYMA 5IODA 1ESRA 2JEBI 1M8AA 1IBKQ 5J22A 1YJWA 2EOTA 2PMZE 1IYVA 1PFBA 5IYCH 2A69C 5KNCA 1Z47A 4C3HB 2JEAI 1T5XD 4HIMA 2O4XA 1A0IA 4X3SA 4A3IG 2QF7A 4RHRA 3KBGA 5TSSA 2I0QA 4L63B 4X64L 1LO5D 2NVTB 4OWTB 4K5XA 4KD4A 3HEJA 1WTPA 1J8IA 5HURA 1N32Q 5CV6A 4OONA 5EAYA 3FDTA 1KNAA 3GTPB 3T4AC 5FOBB 3C1EA 2V4DA 1NR2A 3HZXA 1S72A 2C35B 1TKWB 1I6VC 2B29A 1HCZA 2K5WA 3DEPA 5COYA 1SSOA 3T13A 4IFDI 1HUMA 4HJ5A 4UP8A 4KHZA 3S16B 4PQXA 1I50H 4AYBB 1V8QA 1ENFA 3H3VH 2WAQE 1E22A 2OWOA 4AYBG 3ICEA 3NWSA 1Q8IA 2MP1A 3CW2C 3J80L 1JMCA 1HNZQ 2QA4A 4CKEA 2NBFA 3RZDH 4JI8Q 3NBHB 3QR8A 4G7HC 2FINB 3MVVA 1F77A 2F0EA 4P73A 3WDNA 5JPMC 1JJCB 1CQVA 4JI8L 4M1UB 1GHJA 2YV5A 2XGTA 3Q8DA 4KLKA 4EQOA 4LAAA 3H15A 2E2IB 5JOBA 1EY8A 5IGEA 1LT3D 5IGBA 2Q8RE 1DJRD 2KCCA 5J1ZA 1S3OA 1H9SB 1QNKA 2EIFA 3GTJH 4AIMA 1K83H 1A15A 4L5TA 4XYOA 1E1TA 3MXUA 2UUAL 1EOVA 4JI5L 2ZJPA 4R4IA 2EYLA 4QCLA 2NYZD 4ME5A 5IYBH 2EYHA 3BS1A 2BH2A 4X62L 5F2DA 1JORA 4ZLTF 1UE7A 3HGBA 3EJIA 3HOUG 3J7YW 1BCPF 5M5YB 1PMRA 5G3LD 4BY1H 4ME3A 1MSHA 5C44B 2ENBA 1HFGA 4HJ7A 1OXVA 1OXUA 2B2TA 3I4MH 1FGUA 5E3FA 4BY1G 2R61A 2K5QA 1IBKL 2A69D 2R3ZA 4A93G 4HEDA 3P7JA 5T1IA 4KHPL 3CQZB 1D8LA 4S3SA 4A3KH 1GOZA 2J4XA 4XDXA 2YTXA 4RFBA 5KRUA 4C3JG 3A7LA 3N6RA 1OTCA 4A93H 1TWGH 4I7AA 2FHTA 1II3A 3MA2B 4A3KG 4CJ1B 3T51B 1EEID 1L0YB 3KLSX 2XRQD 2WKCA 3A74A 4C56C 3S2HH 4B3SQ 2A6HD 3L9AX 1XTCD 2PI2E 3H0GG 5EKLA 5M3MG 1K0RA 1F9SA 4FP5D 3BZCA 1PH4A 2AUKA 1QVCA 3HOZH 1KL9A 1JR0D 1V1PA 3TS2A 5KNDA 2F52A 3JAML 1Q7YC 1EL0A 5FLMH 2XSCA 3VA5A 3RN5A 4UP7A 1S5BD 4A3GG 3TN2A 1HTPA 2F0VA 1QJOA 1I3QH 3NUCA 1OXXK 3OTOQ 5IE8A 2KA7A 2R92B 2OTLA 4KJNA 1SYGA 2RF4A 4TVAB 1I4RA 4JBWA 4OEMB 4FXGC 1WVLA 2BE5C 3HOWH 4IPCA 3GTMH 1HR0L 2RDFA 1S4ZA 4R4CA 4Y7NH 2IHFA 3GTKH 4KKTA 4DK3C 4YHHQ 2WKDA 2LSSA 3BDOA 1YZ6A 2A19A 3U9OA 3TEHB 4G4KA 3ULLA 4K5VA 1C48A 5AJ3L 2KEDA 3UDIA 2K04A 4LF5Q 1PYWD 1TWCH 2N3SA 1HQMC 1KDAA 3E0EA 1L1OC 3KDFA 1TWAH 4K8IA 4NKLA 1GUNA 4LF8L 1Z7TA 3VR4A 2QGQA 1X9NA 3TP5A 4CGYB 2RCNA 4EQPA 3A54A 4PZ8A 1FJGQ 4GKJL 1N36Q 1EFID 4XTCS 2JA6G 3K7AH 1B9MA 1Y8NB 3PUVA 2M9VA 4BXXH 3JC66 2K5DA 3U9SA 2B63B 4XT1B 1KD1C 1PTOC 2NB0A 3KF8A 5CGKA 3QWNA 1X54A 1BBUA
chains in the Genus database with same CATH topology
3H0GH 3CCEA 3BZKA 3EN2A 1YJNA 3M3YH 4DR7Q 4QQBX 1VQ9A 3PSIA 5ELOA 1Z9FA 2AKWB 2NN6G 4NB3A 4UY8C 3HOYH 1WYDA 4DR4Q 3GTLH 4A3DH 2MNAA 2R93G 2WFWA 4JI0L 1VQBA 5LMUQ 4A3LG 4OO1G 3PUYA 3HOZG 1C7YA 4YCWA 5C3EH 3D0FA 1E24A 1KAWA 2CCZA 3KOJA 4R4OA 3TRZA 1ASZA 1X3EA 1PH1A 2WAQG 3MXNB 4DV2L 5IP7H 3M7NA 4DR4L 2DUDA 1HZAA 1BKBA 3I7FA 1LM0A 4LFAL 1NMGA 1LTLA 1PYSB 1D7QA 4YCVA 2UUBQ 4YCUA 4DR5L 1HH2P 4LF6Q 3T1YQ 1VQ7A 3TQYA 1VQNA 2VZAA 1CSPA 5E7NA 2ZJQA 3RLFA 2VY3A 1B8AA 1HNWQ 4WJ3M 4B3SL 2GVBA 1YNXA 4O2DA 4J15A 2E5LL 3S15H 2NZOA 1O7IA 5IP7G 2K4KA 3NENA 3S14H 5JJKA 5C0XI 2VQEL 3S1NH 1IL2A 2AWNA 1L1OB 1N36L 2Q2UA 1YHQA 1EYGA 1IYJB 2UU9Q 4BA1I 4LF6L 3KF6A 4KI0A 4IOAA 4PMWA 1AH9A 1FVIA 4HIDA 3PO2H 5BR8L 1VQPA 2LXJA 4DV5Q 4HJAA 1PH3A 4LWCA 4A3JH 4EX5A 1AE3A 3W1GA 4LF8Q 1UE6A 1YVCA 1K8AC 4JI4Q 4OX9Q 3RLOA 5K36G 3CCJA 1YJ9A 1VQMA 1NTGA 4DR1L 4APVA 1IBMQ 4BBRH 2CQOA 1MJEA 3CCQA 5IYDH 2MO1A 4BA2I 2K75A 2E5LQ 4JYAL 4DUYL 3CQZH 4L5RC 2F4VL 4UP9A 1HNWL 1JE5A 1SROA 4JG2A 4GNXB 4A3JG 1N34Q 4JI6L 4LF9L 3F2BA 3PO3G 4WJ4A 3A5ZB 3T1YL 1VQDA 2OQ0A 4GNXC 3LGJA 3RR5A 3UE0A 1Q81C 4PZ7A 3CMEA 1YITA 4GS3A 1WJJA 1NJIC 1GM5A 2R6GA 2HHHL 3UDFA 4Y52H 1MKHA 1X56A 1JJGA 2RHQB 2GVAA 3OYYA 2UXBL 2E2JH 3S24A 1R9TH 5C4XG 3GO5A 3F1ZA 3CXCA 5C44H 4DR1Q 1IBML 2R7DA 4X62Q 1JJ2A 1IXRA 4JI4L 2Z6KC 3GDEA 4OX9L 2A8VA 3CD6A 2VS1A 2UXCQ 2V1CC 1SE8A 2E8GA 1SR3A 5M5YH 4DV5L 1PH8A 4H02A 4BBSH 5LMNW 3F2DA 2AMCB 3U58A 4IPHA 2PNHA 3OTOL 1LUZA 4AQYL 3KLWA 4DV0L 2K14A 2OCEA 4GLVB 4BXXG 4K0KL 2I5MX 5C4XH 1XMOL 2JA7G 4B3ML 2ZTCA 5JJLA 3ER0A 3CCLA 1A8VA 4GN5A 4X65L 4GN3B 3JAMi 2EQSA 3M9BA 4BBSG 1HZBA 3GTOH 3OW2A 5GAHC 3NELA 4JBMA 4GKJQ 2UXDQ 2Z6KA 1BVSA 4JC0A 1VQCA 4DPGA 4L5SA 5C0XG 4YHHL 4NXMQ 1FL0A 3PIPA 5GAEC 5C3EG 1XNQQ 1TWFH 4A75A 1EQQA 1EFWA 2ASBA 3SGIA 3H3VI 2L15A 2IT1A 1N32L 3KF8B 1A62A 1G51A 2HT1A 4A3BG 3UDXA 4DV4L 2Y0SE 4GNXA 4A3FG 1JB7A 2K50A 4JCVE 2Z0SA 3CF5A 3CC2A 2IX1A 3STBD 2IHEA 4A3EG 2QEXA 1VQLA 1Q12A 3RLNA 3S1RH 1PV4A 1CUKA 3I55A 1Q1EA 1N8RC 3GTQH 4GKKQ 1KC8C 3CCUA 1JT8A 2HIXA 4A3FH 3S2DH 1TWHH 1X65A 3VDYA 3STBC 3CCRA 1XNRL 1C9OA 1VQOA 1HR0Q 2R7ZH 2N49A 4X66L 4AYBE 4GLXA 2D0OA 1SRUA 3PO2G 3F8TA 2UXCL 2NN6I 2K5NA 1XJVA 5M5XH 1PH7A 3S16H 3HKZG 2OQKA 4DV4Q 4QJFA 4A3CG 3J81c 4DUZQ 1VQ5A 1NY4A 3T1HL 4LFBQ 2IY5B 1U0LA 2KHIA 4DR5Q 2KHJA 1XPRA 2UUCQ 1QUQA 1X55A 4IFDG 1I5FA 4NPSA 3K81C 1CSQA 1VQEA 2I5HA 1TXYA 2H5XA 3PV0A 4FDBA 4JI2Q 1LYLA 1HNXQ 5GAGC 2ZJRA 1KQSA 2CFMA 2LXKA 4DR6L 3GTPH 1SLJA 4JBJA 3RN2A 3PUWA 4X6AH 1J5EL 5AJ3Q 1IBLQ 2F4VQ 4R4TA 4R4QA 5M3FH 5HGQA 1QZHA 1E1OA 4O0AA 3S1MH 4YY3Q 2JE6I 5ELNA 5IP9G 1A63A 4P71A 4C3IH 2ZM6Q 2MO0A 1VS0A 1IZ6A 3J81i 1HNXL 2NVTH 3CPFA 3S1QH 4JI3L 2PQAB 4JI2L 5C44G 2F3IA 4B3RL 2D0PA 2FXQA 3FKIG 2BA0A 2N8NA 4EQ5A 3T1HQ 5JEAJ 2K5HA 2VNUD 4C3HH 4HJ8A 5IYCG 1M90C 4LF4L 1I6HH 1W2BA 2Q2HA 5DLQE 2VQFL 4LF7Q 3F2CA 1XTDA 1GVPA 1KXLA 2JEBI 4RMFA 1ASYA 4LF4Q 2JA7H 3HKSA 1IBKQ 1KRSA 5IYBG 2NVXH 3FKIH 1YJWA 1VQAA 3PIOA 1B70B 1PH9A 2PMZE 2HHHQ 5IYCH 5IWAQ 5J3BA 1Z47A 4LUVA 4BY7H 2JEAI 1H95A 4HIMA 3KFUA 3PGZA 1A0IA 1Y1VG 2K52A 1HR0W 4A3IG 2YYZA 2I0QA 4IPGA 4LF9Q 3G48A 3M4OH 4C2MH 4X64L 4DV2Q 1VQIA 4DUYQ 1UE5A 4PZ6A 3I4OA 4OWTB 1QZGA 1WOCA 3AFQA 1OXTA 2JK8A 4GOPC 1EUJA 4DR6Q 4BY7G 5JEAG 4A3BH 1SN8A 1CKOA 4DR2Q 1Y1VH 1N32Q 4OONA 3NEMA 5EAYA 2ID0A 2WB1G 5HY6A 4JV5Q 3J7ZC 4JI7L 4A3MG 2R7FA 3MEFA 2RHSB 4DK6C 3JAMc 4A3EH 2KBNA 5FJ8H 3ULPA 1S72A 1QVGA 2B63H 1HJPA 3KYHC 3CCVA 2C35B 2HQLA 1L2FA 2B29A 2PI2A 4LNQA 4LFCL 2ES2A 1VQ6A 3CC4A 3AEVA 4IFDI 4DV7Q 2OTJA 4HJ5A 4UP8A 1WCMH 4C3JH 4KHZA 2R7ZG 5C4JH 1VQJA 1I50H 2N78A 3H3VH 2WAQE 2AHOB 1E22A 2OWOA 4JBKA 3W5OA 4AYBG 3J81j 3ICEA 2PQAA 4DV0Q 3W1BA 4JI5Q 3CW2C 1NE3A 4AQYQ 1JMCA 3CCSA 1HNZQ 4A3CH 3PF5A 4OWWB 2QA4A 4JI7Q 1WCMG 4QIWE 3CC7A 3RZDH 4JI8Q 4KHPQ 3NBHB 1T9HA 4HIOA 4P73A 3IRBA 2Y0SG 1JJCB 3HOVH 2UXBQ 4JI8L 2BA1A 5LMUL 1UWVA 1VQFA 4YWKA 2ZTDA 3RNUA 2YV5A 2XGTA 4R1JA 3Q8DA 1SFOH 1XNQL 3BJUA 1PA6A 1QUQB 5M3FG 1Q8KA 4KLKA 2VL6A 3H15A 4DR7L 4A76A 2KENA 5IP9H 1C0AA 4YWMA 5FLXc 5IWAL 2WP8J 2UXDL 3GTGH 3HOVG 1GO3E 2ATWA 2MQHA 1MJCA 1OXSC 2MFIA 3GD7A 4OO1I 1S3OA 4ALPA 3A0JA 3ZJYC 2JA8H 2VW9A 2VUMG 2R92H 4GOPB 4DR3L 3K0XA 2EIFA 3KDFB 1X3GA 2BH8A 3GTJH 4AIMA 1K83H 1PH5A 3M85A 1RL2A 2JA5G 3RZOH 4LF7L 1EWIA 2CWPA 1K9MC 1B7YB 4L5TA 3HOUH 4K0KQ 1XPUA 1WI5A 3DLLA 1XPOA 1E1TA 1UE1A 4P72A 5GROA 1N33L 2UUAL 3CPWA 1PHJA 1N9WA 1EOVA 4JI5L 4B3RQ 2ZJPA 4R4IA 4OWXB 3AQQA 5IYBH 2BH2A 3L2PA 4X62L 4IO9A 2JA5H 3G71A 1UE7A 3G6EA 2KCMA 4JI3Q 3HOWG 4JI1Q 2CKZB 1VQGA 2JJQA 1Q1BA 3TS0A 3FP9A 3HOUG 2AWOA 1KIXA 4LF5L 3I4MG 3M4QA 1W3SA 4A3IH 4QL5A 3J80i 1Y1WG 4ME3A 4BY1H 4X64Q 3CP0A 1J5EQ 1GKHA 3TREA 3I56A 3B6YA 1NBWA 4HJ7A 1OXVA 1EQRA 3KF6B 4B3TQ 4POGA 1CKNB 1X3FA 3PUXA 3PUZA 1UEBA 4JOIA 4LFAQ 3KJPA 4JI6Q 1OXUA 1K73C 3I4MH 3UDGA 1FGUA 1PH2A 3HOXH 4BY1G 3U4ZA 4GLAC 2NVQH 1KRTA 2HIVA 3K7UC 4A3MH 1CKNA 1IBKL 2K5VA 4A93G 5FJ8G 2B63G 4DV3Q 2YTVA 4IOCA 3K8AA 5IT9c 3I4NH 4KHPL 2NZHA 2YTYA 1Q82C 4JOIC 1D8LA 2ALYB 4A3KH 4JI0Q 4IPDA 4HIKA 2YTXA 3E9IA 1PH6A 5BR8Q 3ERSX 3HOXG 1HNZL 4XIGS 2JA9A 1PFSA 4IJHA 1XNRQ 1QVFA 1L0WA 3ULJA 2YU9H 4LW1A 4QY7A 2JQOA 3BU2A 1OTCA 2UU9L 4A93H 1XMQQ 4IJLA 1TWGH 2JA6H 4A3KG 1AE2A 3WWVA 5LMNL 1I94L 2I5LX 1Y14B 4DV7L 4P75A 3A74A 4LFCQ 3S2HH 4MNOA 4B3SQ 4DAMA 1VQKA 2PI2E 5IY0A 2VQFQ 1DGSA 3H0GG 1G291 5M3MG 1K0RA 2UUBL 2NVYH 2IX0A 3KJOA 4DV1L 3BZCA 2R93H 1PH4A 1QVCA 1J6QA 5FLMG 1EIFA 1X6OA 2UUCL 3HOZH 1KL9A 4JV5L 4POFA 1YBYA 4DV1Q 3EBEA 1EIYB 4DR2L 4QGUA 3E9HA 3TS2A 4UPAA 2EXDA 3S17H 4A3GH 4MTNA 5M3MH 3M4PA 5H1SE 2F52A 1BBWA 4HJ9A 2E2HH 1YEZA 4OXPA 3CMAA 1Q7YC 3HKZE 4LUZA 5FLMH 4LUOA 2VUMH 2GN5A 2WB1E 3AFPA 5LMNQ 1I94Q 2CWAA 4X65Q 2JA8G 2R92G 4JI1L 3RN5A 4PG3A 4UP7A 4A3GG 3FHWA 5JJIA 4DV6Q 3CAMA 1I3QH 1L1OA 1VCIA 1OXXK 3EIVA 4TQUS 3OTOQ 1VQ4A 4MZ9A 2UUAQ 4RG1A 1CKMA 1P8LA 1GD7A 4LFBL 2OTLA 1PVOA 4A4IA 3K80C 4IFDJ 1FJGL 1NMFA 1WFQA 2RF4A 4TVAB 5GQOA 5C0XJ 1HZ9A 4DV3L 4JBWA 4DNIA 3HOWH 4IPCA 4DR3Q 3GTMH 3PCOB 1HR0L 5M5WH 2E2IH 1SMXA 1E3PA 2ZTEA 4R4CA 4Y7NH 2IHFA 1Y1WH 3GTKH 4DK3C 3U4VA 3CCMA 4BBRG 4DAYB 2KCTA 4YHHQ 3AYHB 4NXML 2A1AA 1V9PA 2LSSA 4NXNQ 1YZ6A 1Q46A 2A19A 1RIPA 2D62A 5IYDG 2ZM6L 4B3TL 3TEHB 1N34L 4YY3L 3UE1A 1YI2A 2Q2TA 3ULLA 4JYAQ 3HFZB 5AJ3L 1IBLL 3PO3H 1VQ8A 1HZCA 2Q2IA 1G6PA 3UDIA 4YWLA 4LF5Q 1TWCH 2N3SA 4NXNL 3E0EA 1L1OC 3KDFA 1YHBA 4GOPA 1TWAH 3U50C 2DGYA 4LF8L 1VQHA 1YHAA 3I4NG 1P16A 1U5KA 3J80c 2QGQA 1Q86C 3PF4A 1KHIA 1N33Q 4L5QA 4DUZL 4DKAC 1X9NA 2RCNA 4PZ8A 1FJGQ 4GKJL 1N36Q 4XTCS 5GADC 3G4SA 2JA6G 3L0OA 3K7AH 4AH6A 2VQEQ 3A5UA 3PUVA 4X66Q 3HOYG 4BXXH 3JC66 3J7A5 2XTIA 4A3DG 1KD1C 1V1QA 4P74A 4A3LH 4DV6L 1K8GA 1K3RA 1MIUA 1PYBA 2B3GA 1V43A 1XMQL 4B3MQ 1XMOQ 3I2ZA 3DM3A 3L7ZC 1E7ZA 4GN4B 1YIJA 1M1KC 5IE8A 1S40A 4GKKL 3D31A 1X54A 1BBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G H;  3CCE A;  3BZK A;  3EN2 A;  1YJN A;  3M3Y H;  4DR7 Q;  4QQB X;  1VQ9 A;  3PSI A;  5ELO A;  1Z9F A;  2AKW B;  2NN6 G;  4NB3 A;  4UY8 C;  3HOY H;  1WYD A;  4DR4 Q;  3GTL H;  4A3D H;  2MNA A;  2R93 G;  2WFW A;  4JI0 L;  1VQB A;  5LMU Q;  4A3L G;  4OO1 G;  3PUY A;  3HOZ G;  1C7Y A;  4YCW A;  5C3E H;  3D0F A;  1E24 A;  1KAW A;  2CCZ A;  3KOJ A;  4R4O A;  3TRZ A;  1ASZ A;  1X3E A;  1PH1 A;  2WAQ G;  3MXN B;  4DV2 L;  5IP7 H;  3M7N A;  4DR4 L;  2DUD A;  1HZA A;  1BKB A;  3I7F A;  1LM0 A;  4LFA L;  1NMG A;  1LTL A;  1PYS B;  1D7Q A;  4YCV A;  2UUB Q;  4YCU A;  4DR5 L;  1HH2 P;  4LF6 Q;  3T1Y Q;  1VQ7 A;  3TQY A;  1VQN A;  2VZA A;  1CSP A;  5E7N A;  2ZJQ A;  3RLF A;  2VY3 A;  1B8A A;  1HNW Q;  4WJ3 M;  4B3S L;  2GVB A;  1YNX A;  4O2D A;  4J15 A;  2E5L L;  3S15 H;  2NZO A;  1O7I A;  5IP7 G;  2K4K A;  3NEN A;  3S14 H;  5JJK A;  5C0X I;  2VQE L;  3S1N H;  1IL2 A;  2AWN A;  1L1O B;  1N36 L;  2Q2U A;  1YHQ A;  1EYG A;  1IYJ B;  2UU9 Q;  4BA1 I;  4LF6 L;  3KF6 A;  4KI0 A;  4IOA A;  4PMW A;  1AH9 A;  1FVI A;  4HID A;  3PO2 H;  5BR8 L;  1VQP A;  2LXJ A;  4DV5 Q;  4HJA A;  1PH3 A;  4LWC A;  4A3J H;  4EX5 A;  1AE3 A;  3W1G A;  4LF8 Q;  1UE6 A;  1YVC A;  1K8A C;  4JI4 Q;  4OX9 Q;  3RLO A;  5K36 G;  3CCJ A;  1YJ9 A;  1VQM A;  1NTG A;  4DR1 L;  4APV A;  1IBM Q;  4BBR H;  2CQO A;  1MJE A;  3CCQ A;  5IYD H;  2MO1 A;  4BA2 I;  2K75 A;  2E5L Q;  4JYA L;  4DUY L;  3CQZ H;  4L5R C;  2F4V L;  4UP9 A;  1HNW L;  1JE5 A;  1SRO A;  4JG2 A;  4GNX B;  4A3J G;  1N34 Q;  4JI6 L;  4LF9 L;  3F2B A;  3PO3 G;  4WJ4 A;  3A5Z B;  3T1Y L;  1VQD A;  2OQ0 A;  4GNX C;  3LGJ A;  3RR5 A;  3UE0 A;  1Q81 C;  4PZ7 A;  3CME A;  1YIT A;  4GS3 A;  1WJJ A;  1NJI C;  1GM5 A;  2R6G A;  2HHH L;  3UDF A;  4Y52 H;  1MKH A;  1X56 A;  1JJG A;  2RHQ B;  2GVA A;  3OYY A;  2UXB L;  2E2J H;  3S24 A;  1R9T H;  5C4X G;  3GO5 A;  3F1Z A;  3CXC A;  5C44 H;  4DR1 Q;  1IBM L;  2R7D A;  4X62 Q;  1JJ2 A;  1IXR A;  4JI4 L;  2Z6K C;  3GDE A;  4OX9 L;  2A8V A;  3CD6 A;  2VS1 A;  2UXC Q;  2V1C C;  1SE8 A;  2E8G A;  1SR3 A;  5M5Y H;  4DV5 L;  1PH8 A;  4H02 A;  4BBS H;  5LMN W;  3F2D A;  2AMC B;  3U58 A;  4IPH A;  2PNH A;  3OTO L;  1LUZ A;  4AQY L;  3KLW A;  4DV0 L;  2K14 A;  2OCE A;  4GLV B;  4BXX G;  4K0K L;  2I5M X;  5C4X H;  1XMO L;  2JA7 G;  4B3M L;  2ZTC A;  5JJL A;  3ER0 A;  3CCL A;  1A8V A;  4GN5 A;  4X65 L;  4GN3 B;  3JAM i;  2EQS A;  3M9B A;  4BBS G;  1HZB A;  3GTO H;  3OW2 A;  5GAH C;  3NEL A;  4JBM A;  4GKJ Q;  2UXD Q;  2Z6K A;  1BVS A;  4JC0 A;  1VQC A;  4DPG A;  4L5S A;  5C0X G;  4YHH L;  4NXM Q;  1FL0 A;  3PIP A;  5GAE C;  5C3E G;  1XNQ Q;  1TWF H;  4A75 A;  1EQQ A;  1EFW A;  2ASB A;  3SGI A;  3H3V I;  2L15 A;  2IT1 A;  1N32 L;  3KF8 B;  1A62 A;  1G51 A;  2HT1 A;  4A3B G;  3UDX A;  4DV4 L;  2Y0S E;  4GNX A;  4A3F G;  1JB7 A;  2K50 A;  4JCV E;  2Z0S A;  3CF5 A;  3CC2 A;  2IX1 A;  3STB D;  2IHE A;  4A3E G;  2QEX A;  1VQL A;  1Q12 A;  3RLN A;  3S1R H;  1PV4 A;  1CUK A;  3I55 A;  1Q1E A;  1N8R C;  3GTQ H;  4GKK Q;  1KC8 C;  3CCU A;  1JT8 A;  2HIX A;  4A3F H;  3S2D H;  1TWH H;  1X65 A;  3VDY A;  3STB C;  3CCR A;  1XNR L;  1C9O A;  1VQO A;  1HR0 Q;  2R7Z H;  2N49 A;  4X66 L;  4AYB E;  4GLX A;  2D0O A;  1SRU A;  3PO2 G;  3F8T A;  2UXC L;  2NN6 I;  2K5N A;  1XJV A;  5M5X H;  1PH7 A;  3S16 H;  3HKZ G;  2OQK A;  4DV4 Q;  4QJF A;  4A3C G;  3J81 c;  4DUZ Q;  1VQ5 A;  1NY4 A;  3T1H L;  4LFB Q;  2IY5 B;  1U0L A;  2KHI A;  4DR5 Q;  2KHJ A;  1XPR A;  2UUC Q;  1QUQ A;  1X55 A;  4IFD G;  1I5F A;  4NPS A;  3K81 C;  1CSQ A;  1VQE A;  2I5H A;  1TXY A;  2H5X A;  3PV0 A;  4FDB A;  4JI2 Q;  1LYL A;  1HNX Q;  5GAG C;  2ZJR A;  1KQS A;  2CFM A;  2LXK A;  4DR6 L;  3GTP H;  1SLJ A;  4JBJ A;  3RN2 A;  3PUW A;  4X6A H;  1J5E L;  5AJ3 Q;  1IBL Q;  2F4V Q;  4R4T A;  4R4Q A;  5M3F H;  5HGQ A;  1QZH A;  1E1O A;  4O0A A;  3S1M H;  4YY3 Q;  2JE6 I;  5ELN A;  5IP9 G;  1A63 A;  4P71 A;  4C3I H;  2ZM6 Q;  2MO0 A;  1VS0 A;  1IZ6 A;  3J81 i;  1HNX L;  2NVT H;  3CPF A;  3S1Q H;  4JI3 L;  2PQA B;  4JI2 L;  5C44 G;  2F3I A;  4B3R L;  2D0P A;  2FXQ A;  3FKI G;  2BA0 A;  2N8N A;  4EQ5 A;  3T1H Q;  5JEA J;  2K5H A;  2VNU D;  4C3H H;  4HJ8 A;  5IYC G;  1M90 C;  4LF4 L;  1I6H H;  1W2B A;  2Q2H A;  5DLQ E;  2VQF L;  4LF7 Q;  3F2C A;  1XTD A;  1GVP A;  1KXL A;  2JEB I;  4RMF A;  1ASY A;  4LF4 Q;  2JA7 H;  3HKS A;  1IBK Q;  1KRS A;  5IYB G;  2NVX H;  3FKI H;  1YJW A;  1VQA A;  3PIO A;  1B70 B;  1PH9 A;  2PMZ E;  2HHH Q;  5IYC H;  5IWA Q;  5J3B A;  1Z47 A;  4LUV A;  4BY7 H;  2JEA I;  1H95 A;  4HIM A;  3KFU A;  3PGZ A;  1A0I A;  1Y1V G;  2K52 A;  1HR0 W;  4A3I G;  2YYZ A;  2I0Q A;  4IPG A;  4LF9 Q;  3G48 A;  3M4O H;  4C2M H;  4X64 L;  4DV2 Q;  1VQI A;  4DUY Q;  1UE5 A;  4PZ6 A;  3I4O A;  4OWT B;  1QZG A;  1WOC A;  3AFQ A;  1OXT A;  2JK8 A;  4GOP C;  1EUJ A;  4DR6 Q;  4BY7 G;  5JEA G;  4A3B H;  1SN8 A;  1CKO A;  4DR2 Q;  1Y1V H;  1N32 Q;  4OON A;  3NEM A;  5EAY A;  2ID0 A;  2WB1 G;  5HY6 A;  4JV5 Q;  3J7Z C;  4JI7 L;  4A3M G;  2R7F A;  3MEF A;  2RHS B;  4DK6 C;  3JAM c;  4A3E H;  2KBN A;  5FJ8 H;  3ULP A;  1S72 A;  1QVG A;  2B63 H;  1HJP A;  3KYH C;  3CCV A;  2C35 B;  2HQL A;  1L2F A;  2B29 A;  2PI2 A;  4LNQ A;  4LFC L;  2ES2 A;  1VQ6 A;  3CC4 A;  3AEV A;  4IFD I;  4DV7 Q;  2OTJ A;  4HJ5 A;  4UP8 A;  1WCM H;  4C3J H;  4KHZ A;  2R7Z G;  5C4J H;  1VQJ A;  1I50 H;  2N78 A;  3H3V H;  2WAQ E;  2AHO B;  1E22 A;  2OWO A;  4JBK A;  3W5O A;  4AYB G;  3J81 j;  3ICE A;  2PQA A;  4DV0 Q;  3W1B A;  4JI5 Q;  3CW2 C;  1NE3 A;  4AQY Q;  1JMC A;  3CCS A;  1HNZ Q;  4A3C H;  3PF5 A;  4OWW B;  2QA4 A;  4JI7 Q;  1WCM G;  4QIW E;  3CC7 A;  3RZD H;  4JI8 Q;  4KHP Q;  3NBH B;  1T9H A;  4HIO A;  4P73 A;  3IRB A;  2Y0S G;  1JJC B;  3HOV H;  2UXB Q;  4JI8 L;  2BA1 A;  5LMU L;  1UWV A;  1VQF A;  4YWK A;  2ZTD A;  3RNU A;  2YV5 A;  2XGT A;  4R1J A;  3Q8D A;  1SFO H;  1XNQ L;  3BJU A;  1PA6 A;  1QUQ B;  5M3F G;  1Q8K A;  4KLK A;  2VL6 A;  3H15 A;  4DR7 L;  4A76 A;  2KEN A;  5IP9 H;  1C0A A;  4YWM A;  5FLX c;  5IWA L;  2WP8 J;  2UXD L;  3GTG H;  3HOV G;  1GO3 E;  2ATW A;  2MQH A;  1MJC A;  1OXS C;  2MFI A;  3GD7 A;  4OO1 I;  1S3O A;  4ALP A;  3A0J A;  3ZJY C;  2JA8 H;  2VW9 A;  2VUM G;  2R92 H;  4GOP B;  4DR3 L;  3K0X A;  2EIF A;  3KDF B;  1X3G A;  2BH8 A;  3GTJ H;  4AIM A;  1K83 H;  1PH5 A;  3M85 A;  1RL2 A;  2JA5 G;  3RZO H;  4LF7 L;  1EWI A;  2CWP A;  1K9M C;  1B7Y B;  4L5T A;  3HOU H;  4K0K Q;  1XPU A;  1WI5 A;  3DLL A;  1XPO A;  1E1T A;  1UE1 A;  4P72 A;  5GRO A;  1N33 L;  2UUA L;  3CPW A;  1PHJ A;  1N9W A;  1EOV A;  4JI5 L;  4B3R Q;  2ZJP A;  4R4I A;  4OWX B;  3AQQ A;  5IYB H;  2BH2 A;  3L2P A;  4X62 L;  4IO9 A;  2JA5 H;  3G71 A;  1UE7 A;  3G6E A;  2KCM A;  4JI3 Q;  3HOW G;  4JI1 Q;  2CKZ B;  1VQG A;  2JJQ A;  1Q1B A;  3TS0 A;  3FP9 A;  3HOU G;  2AWO A;  1KIX A;  4LF5 L;  3I4M G;  3M4Q A;  1W3S A;  4A3I H;  4QL5 A;  3J80 i;  1Y1W G;  4ME3 A;  4BY1 H;  4X64 Q;  3CP0 A;  1J5E Q;  1GKH A;  3TRE A;  3I56 A;  3B6Y A;  1NBW A;  4HJ7 A;  1OXV A;  1EQR A;  3KF6 B;  4B3T Q;  4POG A;  1CKN B;  1X3F A;  3PUX A;  3PUZ A;  1UEB A;  4JOI A;  4LFA Q;  3KJP A;  4JI6 Q;  1OXU A;  1K73 C;  3I4M H;  3UDG A;  1FGU A;  1PH2 A;  3HOX H;  4BY1 G;  3U4Z A;  4GLA C;  2NVQ H;  1KRT A;  2HIV A;  3K7U C;  4A3M H;  1CKN A;  1IBK L;  2K5V A;  4A93 G;  5FJ8 G;  2B63 G;  4DV3 Q;  2YTV A;  4IOC A;  3K8A A;  5IT9 c;  3I4N H;  4KHP L;  2NZH A;  2YTY A;  1Q82 C;  4JOI C;  1D8L A;  2ALY B;  4A3K H;  4JI0 Q;  4IPD A;  4HIK A;  2YTX A;  3E9I A;  1PH6 A;  5BR8 Q;  3ERS X;  3HOX G;  1HNZ L;  4XIG S;  2JA9 A;  1PFS A;  4IJH A;  1XNR Q;  1QVF A;  1L0W A;  3ULJ A;  2YU9 H;  4LW1 A;  4QY7 A;  2JQO A;  3BU2 A;  1OTC A;  2UU9 L;  4A93 H;  1XMQ Q;  4IJL A;  1TWG H;  2JA6 H;  4A3K G;  1AE2 A;  3WWV A;  5LMN L;  1I94 L;  2I5L X;  1Y14 B;  4DV7 L;  4P75 A;  3A74 A;  4LFC Q;  3S2H H;  4MNO A;  4B3S Q;  4DAM A;  1VQK A;  2PI2 E;  5IY0 A;  2VQF Q;  1DGS A;  3H0G G;  1G29 1;  5M3M G;  1K0R A;  2UUB L;  2NVY H;  2IX0 A;  3KJO A;  4DV1 L;  3BZC A;  2R93 H;  1PH4 A;  1QVC A;  1J6Q A;  5FLM G;  1EIF A;  1X6O A;  2UUC L;  3HOZ H;  1KL9 A;  4JV5 L;  4POF A;  1YBY A;  4DV1 Q;  3EBE A;  1EIY B;  4DR2 L;  4QGU A;  3E9H A;  3TS2 A;  4UPA A;  2EXD A;  3S17 H;  4A3G H;  4MTN A;  5M3M H;  3M4P A;  5H1S E;  2F52 A;  1BBW A;  4HJ9 A;  2E2H H;  1YEZ A;  4OXP A;  3CMA A;  1Q7Y C;  3HKZ E;  4LUZ A;  5FLM H;  4LUO A;  2VUM H;  2GN5 A;  2WB1 E;  3AFP A;  5LMN Q;  1I94 Q;  2CWA A;  4X65 Q;  2JA8 G;  2R92 G;  4JI1 L;  3RN5 A;  4PG3 A;  4UP7 A;  4A3G G;  3FHW A;  5JJI A;  4DV6 Q;  3CAM A;  1I3Q H;  1L1O A;  1VCI A;  1OXX K;  3EIV A;  4TQU S;  3OTO Q;  1VQ4 A;  4MZ9 A;  2UUA Q;  4RG1 A;  1CKM A;  1P8L A;  1GD7 A;  4LFB L;  2OTL A;  1PVO A;  4A4I A;  3K80 C;  4IFD J;  1FJG L;  1NMF A;  1WFQ A;  2RF4 A;  4TVA B;  5GQO A;  5C0X J;  1HZ9 A;  4DV3 L;  4JBW A;  4DNI A;  3HOW H;  4IPC A;  4DR3 Q;  3GTM H;  3PCO B;  1HR0 L;  5M5W H;  2E2I H;  1SMX A;  1E3P A;  2ZTE A;  4R4C A;  4Y7N H;  2IHF A;  1Y1W H;  3GTK H;  4DK3 C;  3U4V A;  3CCM A;  4BBR G;  4DAY B;  2KCT A;  4YHH Q;  3AYH B;  4NXM L;  2A1A A;  1V9P A;  2LSS A;  4NXN Q;  1YZ6 A;  1Q46 A;  2A19 A;  1RIP A;  2D62 A;  5IYD G;  2ZM6 L;  4B3T L;  3TEH B;  1N34 L;  4YY3 L;  3UE1 A;  1YI2 A;  2Q2T A;  3ULL A;  4JYA Q;  3HFZ B;  5AJ3 L;  1IBL L;  3PO3 H;  1VQ8 A;  1HZC A;  2Q2I A;  1G6P A;  3UDI A;  4YWL A;  4LF5 Q;  1TWC H;  2N3S A;  4NXN L;  3E0E A;  1L1O C;  3KDF A;  1YHB A;  4GOP A;  1TWA H;  3U50 C;  2DGY A;  4LF8 L;  1VQH A;  1YHA A;  3I4N G;  1P16 A;  1U5K A;  3J80 c;  2QGQ A;  1Q86 C;  3PF4 A;  1KHI A;  1N33 Q;  4L5Q A;  4DUZ L;  4DKA C;  1X9N A;  2RCN A;  4PZ8 A;  1FJG Q;  4GKJ L;  1N36 Q;  4XTC S;  5GAD C;  3G4S A;  2JA6 G;  3L0O A;  3K7A H;  4AH6 A;  2VQE Q;  3A5U A;  3PUV A;  4X66 Q;  3HOY G;  4BXX H;  3JC6 6;  3J7A 5;  2XTI A;  4A3D G;  1KD1 C;  1V1Q A;  4P74 A;  4A3L H;  4DV6 L;  1K8G A;  1K3R A;  1MIU A;  1PYB A;  2B3G A;  1V43 A;  1XMQ L;  4B3M Q;  1XMO Q;  3I2Z A;  3DM3 A;  3L7Z C;  1E7Z A;  4GN4 B;  1YIJ A;  1M1K C;  5IE8 A;  1S40 A;  4GKK L;  3D31 A;  1X54 A;  1BBU A; 
#chains in the Genus database with same CATH topology
 3BZK A;  1RF2 D;  1WD0 A;  4QQB X;  2JXM B;  2NN6 G;  4UY8 C;  3HOY H;  1WYD A;  5IGF A;  3GTL H;  4A3D H;  2MNA A;  4A3L G;  1AZP A;  1ONL A;  1C7Y A;  3NTI A;  2FJ2 A;  5C3E H;  5D14 A;  1KAW A;  3TRZ A;  3BYY B;  2MHV A;  1FNW A;  2E2H B;  4FF3 A;  4DV2 L;  5IP7 H;  5M3M B;  1BKB A;  4H13 C;  1NMG A;  3FKI B;  1PYS B;  1SJE D;  2EY6 A;  1IW7 C;  1GUT A;  1VMC A;  3RLF A;  2ICI A;  2VY3 A;  3I3C A;  1HNW Q;  2E76 C;  5IP7 G;  2K4K A;  1QB5 D;  3FPU B;  5M9O A;  3S14 H;  4QIW B;  5I9P A;  2B8G A;  5E4W C;  5K36 H;  1SYC A;  2Q2U A;  1YHQ A;  1ET6 A;  4KJO A;  1AH9 A;  1FVI A;  2AQ2 B;  4C3I B;  5BR8 L;  2EDG A;  1A2T A;  4J8Q A;  3W1G A;  4LF8 Q;  1UE6 A;  1H9J A;  5K36 G;  5KEE A;  1VQM A;  4DR1 L;  1IBM Q;  4APV A;  4ZAI A;  3CCQ A;  5IYD H;  4L5R C;  3FRP B;  1U4P A;  5JVG 3;  1HNW L;  1JE5 A;  1SRO A;  3F2B A;  1VQD A;  3J80 E;  3RR5 A;  1NJI C;  3CME A;  1YIT A;  1EY4 A;  4GS3 A;  4E6I A;  3HOX B;  2R6G A;  2PPB C;  2DNC A;  1EY5 A;  3LX0 A;  1A3V A;  3M4Y A;  4DF7 A;  2UXB L;  1RCV D;  1R9T H;  5DM6 3;  2R7Z B;  5C4H A;  1SMY C;  3F1Z A;  4JI4 L;  2A8V A;  3CD6 A;  4X3T A;  1BDO A;  4DV5 L;  1PH8 A;  1DZ1 A;  1Q90 A;  1JOK A;  1DM0 B;  3OTO L;  3LNN A;  1G2S A;  5ELF A;  4H44 C;  4IZ8 A;  2K01 A;  4GN5 A;  2KEE A;  1H9R A;  2KOL A;  2D2C C;  4K14 A;  4K5W A;  3M9B A;  1EYC A;  5AFW A;  5DM7 3;  3ERQ A;  2UXD Q;  2Z6K A;  1BVS A;  1TQO A;  5EPK A;  4CKB A;  2JA8 B;  4KMU C;  2OEO A;  4R8I A;  4XQN A;  1XNQ Q;  1K8M A;  1EFW A;  1EQQ A;  1MSG A;  3SK5 A;  2XNA C;  1EU4 A;  4DV4 L;  4A3F G;  2E74 C;  4M8A A;  3CF5 A;  3STB D;  2IHE A;  3DMU A;  2QEX A;  1VQL A;  1Q12 A;  3RLN A;  4KK7 A;  4OEL B;  3CCU A;  4DAP A;  4A3F H;  1TWH H;  5CBA E;  2JSO A;  3VDY A;  5JPN C;  3STB C;  1XNR L;  4CBV A;  2R7Z H;  5T1G A;  4AYB E;  2PW7 A;  1SRU A;  3F8T A;  1CI3 M;  1XJV A;  4QJF A;  2KHJ A;  1XPR A;  1G8Z D;  1TVX A;  1I5F A;  4F7X A;  4KV6 A;  2I5H A;  2H5X A;  2JP1 A;  3PV0 A;  4RGT A;  3L3O C;  4A3E B;  1KQS A;  4DR6 L;  4K8J A;  3KK7 A;  5M3F H;  1Y1V B;  5HGQ A;  1QZH A;  3S1M H;  4YY3 Q;  2JE6 I;  1U4L A;  2L1B A;  4C3I H;  2ZM6 Q;  2MO0 A;  3J81 i;  3S1Q H;  1LTI D;  1L0X B;  1TR5 A;  1YNN D;  4F88 A;  4G57 A;  4JI2 L;  2PZU A;  4RWS C;  1S5F D;  3FKI G;  4JK1 C;  1STY A;  5JEA J;  4BY7 B;  4HJ8 A;  1M90 C;  4LF4 L;  4C3I G;  1GUG A;  1I6H H;  1W2B A;  4LF7 Q;  3F2C A;  2K6A A;  1XTD A;  1GVP A;  5EQ0 A;  2PZT A;  1ASY A;  4RMF A;  4LF4 Q;  2A6E C;  3FKI H;  3SXH A;  3PIO A;  1B70 B;  1PH9 A;  4DXF A;  1I6H B;  5J3B A;  4LUV A;  4BY7 H;  1MHW C;  3KFU A;  1I4H A;  1SEB D;  1Y1V G;  2K52 A;  1DXM A;  4IQZ A;  5C3E B;  1HR0 W;  2YYZ A;  1B50 A;  3C2P A;  2B2T C;  4DUY Q;  3GTL B;  1UE5 A;  4PZ6 A;  3S1Q B;  3I4O A;  3HOY B;  2JK8 A;  1EUJ A;  1ICF B;  4BY7 G;  3T16 A;  3S1M B;  5C6A A;  1Y1V H;  5M3F B;  4TKO B;  1JWU D;  3FMC A;  3R3O A;  4FF1 A;  3J7Z C;  2F0K A;  2RDH A;  3MEF A;  1KLU D;  4A3E H;  5FJ8 H;  1QVG A;  2B63 H;  5JAV A;  5KGU A;  3KYH C;  2DY8 A;  3K7A B;  3TZU A;  2L5T A;  1JOQ A;  1PTO F;  1VQ6 A;  3AEV A;  4DV7 Q;  2OTJ A;  2D9U A;  2WAC A;  2F0P A;  2XN9 C;  4HCE A;  1EWH A;  1B1Z A;  1F2M A;  4JBK A;  3J81 j;  2PQA A;  4DV0 Q;  4JI5 Q;  1ET9 A;  1NE3 A;  4AQY Q;  3CCS A;  4A3C H;  1TWH B;  4A3F B;  2K7V A;  1K28 A;  4QIW E;  1UWV A;  3RNU A;  1XNQ L;  4Y7N B;  3BJU A;  1Q8K A;  2PQE A;  2VL6 A;  3J81 E;  4RKL A;  1O7Z A;  2KEN A;  2RDG A;  4A76 A;  5ELD A;  1C0A A;  3GTM B;  4YWM A;  3E3X A;  3TSS A;  5FLX c;  3Q0A A;  2X6G A;  3HOW B;  5IWA L;  2WP8 J;  2UXD L;  1GO3 E;  3GD7 A;  4OO1 I;  1X3Q A;  3A0J A;  2RVL A;  3ZJY C;  2JA8 H;  2R92 H;  3IAY A;  4GOP B;  3KDF B;  4BA2 I;  5C5L A;  3MFY A;  1I3Q B;  2QDL A;  1K9M C;  1XPU A;  1XPO A;  1ZKO A;  4P72 A;  1N33 L;  4JPB W;  3CPW A;  1N9W A;  2NTS A;  2F0N A;  3AQQ A;  1JC7 A;  4J6H A;  4JI3 Q;  3BVZ A;  4HN7 A;  3TS0 A;  2WAQ B;  3FP9 A;  2AWO A;  1KIX A;  1PZK D;  1RTO A;  3J7A F;  1NSN S;  3J80 i;  2VB3 X;  2Z8L A;  1D6E C;  2K28 A;  3TRE A;  3B6Y A;  1F9Q A;  1RTN A;  3KF6 B;  1A3T A;  5A2Q E;  1R9T B;  4POG A;  3Q23 A;  3PUZ A;  3MWY W;  5I2X A;  1LTB D;  3UDG A;  3NXW A;  3HOX H;  3D4W A;  5BN3 A;  3S2H B;  4IUV A;  2HIV A;  2K5V A;  4DV3 Q;  5IT9 c;  2NZH A;  4A93 B;  4XYQ A;  5IT9 E;  1PH6 A;  3ERS X;  1HA6 A;  4TRD A;  1QVF A;  2G9H D;  2UU9 L;  3CRL C;  2A68 D;  1EQV A;  1BO0 A;  5DAU A;  1AE2 A;  4ODG A;  4DV7 L;  4LFC Q;  4DAM A;  1VQK A;  5CYU A;  3FPP A;  5IY0 A;  2VQF Q;  1CM9 A;  3EA6 A;  3S14 B;  2UUB L;  4ABN A;  5G3L F;  3A56 A;  3HP3 A;  1EIF A;  1RD9 D;  1X6O A;  2B39 A;  1B53 A;  4LMQ D;  4POF A;  1EIY B;  4DR2 L;  4QGU A;  1FYC A;  3E9H A;  4BY1 B;  4ZCK A;  1QOH A;  2EXD A;  2JYO A;  1SNC A;  4MTN A;  5M3M H;  5H1S E;  1EY0 A;  2E2H H;  4OXP A;  3CMA A;  4DXG A;  5EBD A;  3HKZ E;  2QCP X;  2FMM A;  4LUO A;  3NBH A;  4NP5 A;  4A3D B;  4PG3 A;  4WOR A;  3FHW A;  4RGN A;  5JJI A;  4TQU S;  3EIV A;  1K83 B;  2UUA Q;  4RG1 A;  1IKL A;  1GD7 A;  4QUF A;  2ZXO A;  2CH4 A;  3K80 C;  4IFD J;  1WFQ A;  5GQO A;  4HAE A;  1HZ9 A;  1S5E D;  4DNI A;  3W2D A;  3PMF A;  4TSS A;  2E2I H;  1TS2 A;  3U4V A;  4BBR G;  4DAY B;  1V9P A;  1PFM A;  2ZM6 L;  1RIP A;  2D62 A;  4B3T L;  1MBY A;  3RZD B;  1TWA B;  1YI2 A;  3TZD A;  2Q2T A;  1VQ8 A;  1G6P A;  1TWC B;  4YWL A;  4N9T A;  4G7O C;  2K32 A;  4MTK A;  1YHB A;  3U50 C;  2BDO A;  2DGY A;  3ERO A;  1VQH A;  1YHA A;  3I4N G;  3D3R A;  1P16 A;  1U5K A;  1Q86 C;  4QF4 A;  5EJW A;  1EY7 A;  1KHI A;  1N33 Q;  1QE6 A;  4L5Q A;  3GTK B;  2L0C A;  2F3V A;  3I4L A;  3CHB D;  5BN4 A;  2LFN A;  3DWQ A;  2DN8 A;  1K8G A;  1MIU A;  2B3G A;  4B3M Q;  4C1N K;  1KLG D;  1M1K C;  1E7Z A;  3D31 A;  5CMD A;  1GUS A;  3EN2 A;  1YJN A;  3VYT A;  1VQ9 A;  5ELO A;  2AKW B;  2IW3 A;  4NB3 A;  3AB9 A;  2WFW A;  4JI0 L;  1KNE A;  1EIG A;  1EU3 A;  3OIQ A;  5C0X H;  3NBI A;  4NDX A;  5DNF A;  2K03 A;  4YCW A;  2CCZ A;  1ASZ A;  1X3E A;  4DR4 L;  2KUM A;  4ZK9 B;  3M7N A;  4GZY C;  1LTL A;  1D7Q A;  1E0B A;  4DR5 L;  3NSW A;  3HOZ B;  2VZA A;  5E7N A;  4KY6 A;  3DM1 A;  2FMC A;  4K2L A;  4WJ3 M;  4B3S L;  3S15 H;  1O7I A;  4O42 A;  4CDF C;  3FEW X;  1IL2 A;  3H09 A;  2HDL A;  4WRD A;  1IYJ B;  2B2V A;  4BA1 I;  1AZQ A;  4LF6 L;  4PMW A;  3K5M A;  2EY1 A;  2LXJ A;  4DV5 Q;  4HJA A;  1TWG B;  4JI4 Q;  3RLO A;  3CCJ A;  3EVQ A;  5I4D A;  2LKV A;  5CV8 A;  2MO1 A;  4A3K B;  1ZYR D;  4NW2 A;  1SXT A;  3CQZ H;  4UP9 A;  4B08 A;  4JG2 A;  1SE3 A;  3PO3 G;  5K5P A;  1AEX A;  4CJ2 C;  4GNX C;  5FO7 B;  3W3A A;  4PZ7 A;  4IUU A;  3K6O A;  4G7Z C;  1GM5 A;  1XYI A;  3I4M B;  4Y52 H;  2CHB D;  1CA6 A;  1JJG A;  2EZV A;  1PLF A;  4FXK C;  2A73 B;  3K58 A;  1D5X C;  3CXC A;  5C44 H;  4DR1 Q;  1IBM L;  2R7D A;  1IXR A;  1D5Z C;  2A68 C;  2UXC Q;  2V1C C;  1SR3 A;  5M5Y H;  4XXE A;  2NTT A;  2PNH A;  4DNT B;  4AQY L;  1XXG A;  1GJX A;  4GLV B;  1WD1 A;  5JJL A;  4OL7 A;  1O7Y A;  2A5H A;  5EKI A;  1HZB A;  3OW2 A;  5GAH C;  3GTJ B;  1TWF B;  2TSS A;  1IW7 D;  4L5S A;  1KAB A;  3NE5 B;  3SE0 A;  3QOL A;  1ZXT A;  1FL0 A;  5GAE C;  4ZQ3 A;  3QB3 A;  3SGI A;  3H3V I;  2L15 A;  2IT1 A;  3GTO B;  1PTO D;  3KF8 B;  1DYQ A;  2HT1 A;  3P75 A;  4PV1 C;  1BUV T;  2GA4 B;  2EJM A;  1E2W A;  4JCV E;  1VDZ A;  2Z0S A;  3CC2 A;  4A3E G;  5A2Q L;  1GXD C;  5E1F A;  1PV4 A;  1QIL A;  1CUK A;  3GTQ H;  1KC8 C;  5ELC A;  1LT5 D;  3S2D H;  1C9O A;  4C1N I;  2LS0 1;  5IGD A;  1WTW A;  1LAC A;  2UXC L;  2C5C A;  4DGZ A;  5M5X H;  1I50 B;  3S16 H;  3HKZ G;  3K59 A;  3OW7 A;  4DV4 Q;  4DUZ Q;  1BCP B;  1VQ5 A;  4LFB Q;  3SK4 A;  5CV9 A;  4FF4 A;  1QUQ A;  1SYD A;  3R93 A;  1TXY A;  4JI2 Q;  2RCF A;  5D3D A;  4JW0 A;  3JAM E;  1J9O A;  3CRK C;  5GAG C;  2CFM A;  2LXK A;  3GTP H;  1SLJ A;  3RN2 A;  1STE A;  4X6A H;  1IBL Q;  4R4T A;  3URY A;  1S5C D;  1E1O A;  2G5D A;  2B2W A;  2ICE C;  4A3J B;  2E2D C;  2NVT H;  2RSN A;  1CK1 A;  1KTK A;  2F3I A;  2D0P A;  4IUP A;  2FXQ A;  1IL8 A;  2N8N A;  4IAL A;  1U9R A;  2VNU D;  2K5H A;  1XWE A;  4C3H H;  1BR9 A;  5DLQ E;  2ZXR A;  5FO9 B;  1KXL A;  3HKS A;  2KVM A;  2SDF A;  1KRS A;  5E4X A;  2QDB A;  3MC0 B;  1BNZ A;  5IYB G;  1AW7 A;  2NVX H;  1K8O A;  4LJZ C;  1VQA A;  4LK1 C;  2PCF B;  2OXP A;  1V1P B;  5IWA Q;  2MPM A;  1TII D;  1A6X A;  4F87 A;  1SND A;  4IPG A;  1D1K A;  3SK6 A;  1JIC A;  3G48 A;  4C2M H;  2PW5 A;  3H91 A;  3K5N A;  2MGS A;  2L11 A;  1WOC A;  5I6Y A;  1D1I A;  3AFQ A;  3A8J E;  1QG7 A;  4GOP C;  2AQ3 B;  5JEA G;  3M3Y B;  4A3B H;  1SN8 A;  1CKO A;  5EPJ A;  3NEM A;  2ID0 A;  2WB1 G;  5HY6 A;  2K33 A;  1AFP A;  4JI7 L;  2R7F A;  2RHS B;  2WIN B;  3A8I E;  3KLR A;  4XQJ A;  3CCV A;  2N88 A;  3DXJ C;  4EQN A;  2KHS A;  3P20 A;  3QO2 A;  4FYD A;  2LY7 A;  4C3J H;  5C4J H;  1CFM A;  3DWP A;  2N78 A;  1B44 D;  1ENA A;  1ICW A;  2A6E D;  4DAV A;  3W1B A;  1EY9 A;  5CR3 A;  2O2L D;  1I4Q A;  4KTA A;  4OWW B;  3K0Y A;  4CDD C;  1WTX A;  4IFD H;  4KHP Q;  1T9H A;  3S1R B;  1DCZ A;  4HIO A;  1HFN A;  4PMB A;  3IRB A;  2Y0S G;  3G6J B;  3ZYY X;  3HOV H;  2UXB Q;  1E2Z A;  1VQF A;  2ZTD A;  3WOE A;  5FLX L;  1YNJ D;  1QUQ B;  2CW0 C;  5M5W B;  5IP9 H;  4QB4 A;  3AU7 A;  4RH6 A;  5KIX A;  2BOS A;  5NUC A;  2BE5 D;  2ATW A;  2MQH A;  4K2K A;  1MJC A;  1OXS C;  1EIH A;  4ALP A;  2VW9 A;  2B2U A;  2XVS A;  4DR3 L;  3K0X A;  1X3G A;  4HMJ A;  2JA5 G;  1PH5 A;  1BXT A;  1QCB D;  5EBC A;  4LF7 L;  4KHV A;  1EWI A;  3NPP A;  3OSO A;  4K0K Q;  1ILQ A;  3DLL A;  1EOT A;  3K5L A;  1PHJ A;  1UAP A;  3IL8 A;  4K6D A;  4B3R Q;  2EVB A;  3L2P A;  4XT3 B;  4IO9 A;  4DK0 A;  3H6M A;  3G6E A;  2KCM A;  3HOW G;  2JJQ A;  1VQG A;  2F0L A;  1Q1B A;  4A3G B;  4LF5 L;  4BBS B;  1FR3 A;  1W3S A;  4A3I H;  4QL5 A;  1EYD A;  2IWH A;  4X64 Q;  3CP0 A;  1GKH A;  1JQY D;  1S5D D;  1Z6H A;  1NBW A;  1EQR A;  2R93 B;  2E2J B;  1CKN B;  2Z4I A;  3IKJ A;  4X3K A;  3PUX A;  3K57 A;  1F2Y A;  1UEB A;  3E5S A;  4JOI A;  3C3L A;  4JI6 Q;  2PZW A;  3TME A;  1PH2 A;  5EKK A;  2NVQ H;  1U4R A;  4N9P A;  4A3M H;  1STG A;  1UUP A;  2YTV A;  3BDC A;  4IOC A;  2QKI C;  2YTY A;  1Q82 C;  1C4Q A;  2ALY B;  2F0U A;  1VF5 C;  2FFK B;  1GHK A;  2YU9 B;  3HOX G;  1HNZ L;  4XIG S;  3TP7 A;  4BBR B;  4Q0F A;  1PFS A;  1ROD A;  3A7A B;  1XNR Q;  2PNR C;  2KQ3 A;  4LW1 A;  4QY7 A;  1TY0 A;  2JQO A;  2EJF C;  2MJ8 A;  3BU2 A;  1XMQ Q;  2JA6 H;  2P5Z X;  2DJG C;  3I4N B;  3PO2 B;  4J1M A;  1I94 L;  4KKU A;  4RCO A;  1Y14 B;  1WTQ A;  4P75 A;  1ILP A;  1JWS D;  1CT1 D;  3OMG A;  4QUC A;  3S1N B;  5JJZ A;  2VB2 X;  2L12 A;  1RKN A;  2NVY H;  3BVG A;  2IX0 A;  5IIF A;  4EVO A;  4UAI A;  1J6Q A;  2IPK D;  2UUC L;  1BCP D;  1SJH D;  3BZD B;  4UPA A;  3C1F A;  2CH4 W;  3S17 H;  3O13 A;  4HJ9 A;  3M4P A;  1BBW A;  4KY5 A;  1YEZ A;  2JA5 B;  4LUZ A;  3M7G A;  5CC4 A;  3K5O A;  1NUC A;  2DNE A;  3LWE A;  1BOS A;  1FGB D;  2VUM H;  2GN5 A;  2WB1 E;  1I94 Q;  2CWA A;  4JI1 L;  5ISR A;  2QIL A;  3HOU B;  1MGS A;  1STB A;  4DV6 Q;  2Z1C A;  1L1O A;  1VCI A;  1AP0 A;  3RZO B;  1VQ4 A;  5C4Z A;  4IUN A;  1P8L A;  1PVO A;  4A4I A;  1NMF A;  3VR5 A;  2A74 C;  2Y0S B;  3GV3 A;  2Z4H A;  1IKM A;  1SAP A;  4PNY A;  2ZTE A;  1Y1W H;  4DFA A;  3MZ5 A;  4YIJ A;  2XRS D;  2A1A A;  4PMC A;  5IYD G;  1Q46 A;  3AMU A;  3HS0 C;  3DUZ A;  2B2W C;  3UE1 A;  1CZG A;  2CQA A;  1PTO H;  2EJG C;  3HFZ B;  5LL6 S;  4DNR B;  1IBL L;  3PO3 H;  3TDQ A;  4HR7 B;  2Z6B A;  4NXN L;  4FVM A;  3KBX A;  1B2T A;  1K0S A;  1QWY A;  2AUJ D;  4FNF A;  4GOP A;  4U68 A;  4IUT A;  3J80 c;  4MN3 A;  1PRT F;  1STN A;  4CJ0 B;  1SYE A;  1BF4 A;  1B3Q A;  1WCM B;  5ELE A;  4DUZ L;  3TBI B;  2SNS A;  1A2U A;  1SYB A;  2WB1 B;  4FO2 A;  3C46 A;  1F9R A;  3NQT A;  4ZYS A;  4AH6 A;  3A5U A;  3CU7 A;  4X66 Q;  4O1N A;  3J7A 5;  2XTI A;  1CTM A;  4OO1 H;  1K3R A;  1PYB A;  1V43 A;  1XMQ L;  3I72 A;  1DOK A;  1LT6 D;  1XMO Q;  4GKK L;  3L7Z C;  1F2L A;  1S40 A;  3H0G H;  1SYF A;  2EY5 A;  3PSI A;  4V0B A;  1H9S A;  1Z9F A;  2R93 G;  1VQB A;  3PUY A;  2KJX A;  3M4O B;  1SBB B;  2HUG A;  2BDN A;  1I4X A;  2F4I A;  3X3M A;  3ITP A;  2B8F A;  3D4D A;  4DAY A;  1PH1 A;  4WFN 3;  3MXN B;  2ZT9 C;  1LM0 A;  5IT9 L;  1GUO A;  2UUB Q;  4YCU A;  5FLX E;  3DHQ A;  1HH2 P;  4LF6 Q;  5KYL A;  2ZJQ A;  2JA7 B;  2PYK A;  1B8A A;  2EYO A;  2GVB A;  4O2D A;  2E5L L;  2CW0 D;  5KNB A;  3VR6 A;  5JJK A;  5C0X I;  1L1O B;  1N36 L;  4HSV A;  2F1M A;  2UU9 Q;  4KN7 C;  4IOA A;  4KI0 A;  3IFT A;  5EPL A;  1PH3 A;  4LWC A;  4EX5 A;  1YVC A;  2RSO A;  1XX8 A;  5COR A;  4CDE C;  2VXW A;  1TS3 A;  1R4Q B;  5I2Y A;  2K75 A;  4L8J A;  2E5L Q;  4WJ4 A;  3SHL A;  3A5Z B;  2NZ1 D;  2IJ0 A;  3RMH A;  3UE0 A;  1Q81 C;  1I4G A;  1TS4 A;  3OOC A;  3IFD A;  3VYS A;  1MKH A;  1KDC A;  3SR1 A;  1DD2 A;  5C4X G;  1D5M C;  4OX9 L;  3GDE A;  2VS1 A;  2AQ1 B;  2B2Y C;  4H02 A;  5LMN W;  2O5I C;  1LUZ A;  4BXX G;  2K14 A;  3GV6 A;  1TU2 B;  3DWA A;  5C4X H;  1XMO L;  2ZTC A;  1G91 A;  3HG9 A;  1CZW A;  4DN4 M;  4GN3 B;  4Z9C B;  3JAM i;  2EQS A;  1HUN A;  1EZ6 A;  3BG3 A;  2Q8I B;  5I6W A;  3OWF A;  4N8F A;  2F0J A;  4ZKB B;  2NN6 H;  4GKJ Q;  3NEL A;  1O78 A;  1PZI D;  1LTT D;  2XWJ B;  2I07 B;  4NXM Q;  3WOF A;  1LTA D;  4A75 A;  3GTG B;  2F0S A;  2ASB A;  1X3P A;  1N32 L;  5JEA H;  4A3B G;  1A62 A;  2L4N A;  3CKI B;  3QIA A;  3UDX A;  4GNX A;  1SFO B;  1JB7 A;  2K50 A;  3R2T A;  5C4X B;  3I8Z A;  3QOJ A;  1HXY D;  1EWC A;  3R8B A;  1Y8P B;  2HIX A;  1EQT A;  5C3X A;  3CCR A;  2B2U C;  1HR0 Q;  3BDL A;  2D0O A;  2RA4 A;  3PO2 G;  3D8G A;  2TMP A;  2NN6 I;  2K5N A;  4R8N A;  1LTR D;  1STA A;  3EFX D;  3MTS A;  5CBE E;  1Y69 U;  4A3C G;  1VMP A;  1NY4 A;  4KN4 C;  1X55 A;  1WTO A;  3Q24 A;  3K81 C;  1CSQ A;  4RKB A;  2H1E A;  1LYL A;  4V19 0;  3QG1 A;  3LWU A;  1VF7 A;  5EGT A;  4CDC C;  2OF1 A;  2G9D A;  3E0J A;  4R4Q A;  3NHH A;  4O0A A;  4X3U A;  5IP9 G;  2PMZ B;  4P71 A;  1CHP D;  2QW7 A;  1IZ6 A;  1SNQ A;  3NP8 A;  4B9X A;  3CPF A;  3TP8 A;  1HNX L;  2CVR A;  2HQE A;  2EPB A;  5CV7 A;  2HDM A;  1H9K A;  4B3R L;  5IOC A;  1NNX A;  4EQ5 A;  3T1H Q;  1HHV A;  1X32 A;  2Q2H A;  4RGO S;  3J7A V;  4DU9 A;  1PDQ A;  2JA7 H;  3H94 A;  1DOM A;  1R4P B;  1ENC A;  2HHH Q;  4RGM A;  1FD7 D;  2F0I A;  1H95 A;  4ZUJ A;  1SDF A;  3PGZ A;  3ND9 A;  2O5J C;  4LF9 Q;  3M4O H;  4UHV A;  1F9P A;  4DV2 Q;  1VQI A;  4L6T B;  4FXD A;  1QZG A;  4IUQ A;  1OXT A;  2J7Z A;  1EZ8 A;  4JVZ A;  1Y8O B;  2OT2 A;  4DR6 Q;  2Z9H A;  2I46 A;  4DR2 Q;  2B2Y A;  2F0Q A;  3KLS A;  2DJF C;  4JV5 Q;  1IHZ A;  4A3M G;  4KKS A;  3RD4 A;  1AN8 A;  3HKZ B;  4DK6 C;  3JAM c;  2KBN A;  3ULP A;  1HJP A;  2HQL A;  4OIK A;  1L2F A;  4RA8 A;  2PI2 A;  1NAP A;  4LNQ A;  4LFC L;  2ES2 A;  3CC4 A;  2F0W A;  2F0O A;  1WCM H;  2R7Z G;  1VQJ A;  5FK9 C;  1T5E A;  4I7Z C;  2AHO B;  3W5O A;  2EYJ A;  2RBM A;  5IGG A;  4EGV A;  1LTS D;  2HD3 A;  4KY7 A;  3PF5 A;  3S9W A;  3OPO A;  4JI7 Q;  1WCM G;  3PO3 B;  2X6L A;  3CC7 A;  3I70 A;  5I9O A;  4CKC A;  2PO4 A;  4MHE A;  2BA1 A;  1Q3L A;  5LMU L;  4YWK A;  3R2I A;  3VA7 A;  4K6L A;  4R1J A;  1SFO H;  1PA6 A;  3GP7 A;  5M3F G;  4DR7 L;  1K3B C;  1EEF D;  1SMY D;  3FVQ A;  3GTG H;  3HOV G;  5LHY 1;  2XWB B;  2MFI A;  3MXG A;  2VUM G;  2F0F A;  4IUR A;  2MUY A;  1RDP D;  2BH8 A;  3M85 A;  1RL2 A;  3RZO H;  1TT2 A;  4BWG B;  1PXU A;  1HRJ A;  2CWP A;  1B7Y B;  3HOU H;  1WI5 A;  4OHJ A;  1IYU A;  1UE1 A;  5GRO A;  5C3W A;  2EYP A;  3D6C A;  5D65 A;  2VUM B;  4OWX B;  1FNV A;  2JA5 H;  1YNN C;  3G71 A;  1PRT B;  1W6K A;  4JI1 Q;  2CKZ B;  4NMZ A;  3S17 B;  4Q5V A;  3I4M G;  1HA5 A;  3M4Q A;  1Y1W G;  5D3I B;  2NWG A;  2E75 C;  2EYF A;  5FKA C;  1J5E Q;  3I56 A;  3F2U A;  4DK1 A;  3NTK A;  4B3T Q;  1PRT D;  1X3F A;  3KJP A;  4LFA Q;  1K73 C;  3E6Z X;  1KDB A;  3U4Z A;  4GLA C;  1KRT A;  3V2T A;  2HCC A;  3K7U C;  1CKN A;  4CHT B;  5FJ8 G;  2B63 G;  3K8A A;  3I4N H;  4JI0 Q;  2M2L A;  4JOI C;  1UEA B;  4IPD A;  1JCK B;  4HIK A;  3E9I A;  1DOL A;  5BR8 Q;  4DA2 A;  2JA9 A;  3MXN A;  1NCV A;  1EY6 A;  4IJH A;  1L0W A;  3ULJ A;  2YU9 H;  4RCN A;  4IJL A;  1SE2 A;  2XIW A;  3RUZ A;  1OO9 B;  2SNM A;  3WWV A;  5LMN L;  4KD3 A;  2I5L X;  4A3M B;  2C9O A;  3MXP A;  4MNO A;  3VR2 A;  2NVQ B;  1DGS A;  1G29 1;  1MI2 A;  3I90 A;  1SNO A;  3BYT B;  4R9W A;  3KJO A;  4DV1 L;  2R93 H;  5BN5 A;  3MHB A;  4FF2 A;  5FLM G;  4JV5 L;  4DV1 Q;  1YBY A;  2F03 A;  3EBE A;  4A3I B;  2DY7 A;  2L55 A;  3OHX C;  1GUW A;  1SE4 A;  4A3G H;  5ELB A;  1FNU A;  3NTH A;  2KEC A;  2JA8 G;  3AFP A;  5LMN Q;  2R92 G;  4X65 Q;  1JWM D;  2F0D A;  3T53 B;  3CAM A;  4XQQ A;  3H0G B;  1ZYR C;  4MZ9 A;  4U67 3;  1B3A A;  1CKM A;  4LFB L;  2RQX A;  1FJG L;  1D2B A;  5C0X J;  1HTL D;  3Q6S A;  4DV3 L;  2F3W A;  2QEJ C;  4DR3 Q;  2F0T A;  3PCO B;  5M5W H;  5J39 A;  1SMX A;  1E3P A;  4ZRZ A;  3D6W A;  3Q22 A;  2A6H C;  3SK8 A;  3CCM A;  5CV5 A;  2K1B A;  4MIU A;  4ZKC B;  2KCT A;  4NXM L;  3AYH B;  4NXN Q;  3HOV B;  1STH A;  1N34 L;  5HGT A;  4YY3 L;  4B9W A;  1I4P A;  2WII B;  4JYA Q;  4HSP A;  5FO8 B;  1HZC A;  2Q2I A;  4ULL A;  1H9M A;  3GQB A;  2J0T D;  5CV4 A;  4F8M A;  1PTO B;  1ESF A;  1PZJ D;  3G7L A;  3PF4 A;  3OMC A;  4C3J B;  4DKA C;  1Y1W B;  4ILW A;  3KUP A;  5GAD C;  2ZXP A;  3G4S A;  4OGQ C;  3L0O A;  2VQE Q;  3MFG A;  3HOY G;  4A3D G;  1V1Q A;  4P74 A;  2M00 A;  4DV6 L;  4A3L H;  4I65 A;  1LT4 D;  1CQF A;  3I2Z A;  3DM3 A;  4GN4 B;  1YIJ A;  2EXZ A;  4DR5 Q;  1JE4 A;  3CCE A;  4A3B B;  4DR7 Q;  3M3Y H;  3OWE B;  4DR4 Q;  1NR4 A;  2HCI A;  1V1O A;  5LMU Q;  4OO1 G;  2K05 A;  3HOZ G;  2EE1 A;  1LLR D;  2KCN A;  3OIP A;  3ONA B;  3D0F A;  1C8C A;  1E24 A;  3KOJ A;  4R4O A;  3HRZ C;  1ML0 D;  2WAQ G;  1MD2 D;  4P2C B;  3J81 L;  2DUD A;  1HZA A;  3I7F A;  4ID6 A;  2SOB A;  4LFA L;  2F0M A;  2NVX B;  4YCV A;  1WTR A;  3T1Y Q;  1VQ7 A;  3TQY A;  4QMG A;  3NQI A;  1CSP A;  1VQN A;  2SEB D;  1YNX A;  4J15 A;  2NVY B;  2NZO A;  3PQI A;  1ZEQ X;  3NEN A;  2VQE L;  3S1N H;  1SNM A;  2B2V C;  2L9H A;  2AWN A;  3NK9 A;  3A55 A;  3D4R A;  1EYG A;  1O7L A;  3X3N A;  3I91 A;  3KF6 A;  4HID A;  3PO2 H;  1QNU A;  1VQP A;  4BS9 A;  2JA6 B;  4A3J H;  1AE3 A;  4OX9 Q;  1K8A C;  4ZUI A;  1U4M A;  1YJ9 A;  1NTG A;  2WV6 D;  4BBR H;  2CQO A;  3EQL C;  1MJE A;  2NUC A;  3VR3 A;  4DUY L;  4JYA L;  2F4V L;  4N8X 1;  4OIJ A;  4LF9 L;  4A3J G;  4GNX B;  4JI6 L;  1N34 Q;  3BVM A;  2N55 A;  3T1Y L;  2OQ0 A;  3V05 A;  4H7B A;  3LGJ A;  3H3V C;  1WJJ A;  3MAQ A;  2LMC B;  1G2T A;  3A8K E;  4IN3 A;  3UDF A;  2HHH L;  5M5X B;  5A35 A;  1X56 A;  1LAB A;  1YNJ C;  2RHQ B;  1M4V A;  2GVA A;  3OYY A;  5C5M A;  3S24 A;  1PRT C;  1TS5 A;  2E2J H;  1G6Z A;  3MEH A;  3GO5 A;  1WTH A;  2EY2 A;  1HPC A;  4X62 Q;  1JJ2 A;  3S2D B;  1RJT A;  2Z6K C;  4HTH A;  3UI2 A;  1SE8 A;  2E8G A;  3GTQ B;  3ND8 A;  4BBS H;  3F2D A;  2AMC B;  4C3H G;  3U58 A;  4IPH A;  3KLW A;  4DV0 L;  1WTV A;  2OCE A;  4K0K L;  1BBX C;  1RHP A;  2I5M X;  3NWT A;  2JA7 G;  4B3M L;  2BCO A;  3ER0 A;  3CCL A;  1A8V A;  1E2V A;  4X65 L;  4RAU C;  4BBS G;  3GTO H;  5KYI A;  2F0G A;  3SEB A;  4JBM A;  1CHQ D;  3V96 A;  3N52 A;  4JC0 A;  1VQC A;  4DPG A;  1KAA A;  1O80 A;  5C0X G;  4YHH L;  1W6J A;  3PIP A;  5C3E G;  1TWF H;  2JN4 A;  3VYR A;  1JOO A;  1LTG D;  1DON A;  1G51 A;  2F0H A;  3SVM A;  2Y0S E;  2X69 A;  2IX1 A;  1CA5 A;  1TY2 A;  5IGC A;  1JB3 A;  5JVH 3;  3P1H A;  3T56 B;  4RHS A;  3S1R H;  3I55 A;  1Q1E A;  1N8R C;  2Q8T A;  4GKK Q;  1JT8 A;  3TP6 A;  5DEH A;  1X65 A;  1B9N A;  3QJY A;  4H0L C;  2IX3 A;  1VQO A;  1HQR D;  2N49 A;  4X66 L;  5L37 A;  4GLX A;  2IL8 A;  1F2Z A;  1LV9 A;  1A3U A;  1PH7 A;  1BCP C;  3VYU A;  5C4J B;  2OQK A;  4HMI A;  3J81 c;  3T1H L;  2IY5 B;  1U0L A;  2KHI A;  1B4O A;  1EYA A;  2UUC Q;  4IFD G;  4NPS A;  1VQE A;  4FDB A;  2RKS A;  1SNP A;  1HNX Q;  2ZJR A;  4JBJ A;  3PUW A;  1J5E L;  5AJ3 Q;  2D5D A;  2F4V Q;  3SDZ A;  4HCS A;  2H4O A;  5ELN A;  1A63 A;  1VS0 A;  1PFN A;  4UDU C;  3DEO A;  4WJW A;  4JI3 L;  2PQA B;  4C2M B;  5C44 G;  1UNS A;  5LL6 X;  3PIP 3;  2BA0 A;  3PIO 3;  3I73 A;  5IYC G;  3S15 B;  1BQQ T;  2VQF L;  2EYM A;  5IOD A;  1ESR A;  2JEB I;  1M8A A;  1IBK Q;  5J22 A;  1YJW A;  2EOT A;  2PMZ E;  1IYV A;  1PFB A;  5IYC H;  2A69 C;  5KNC A;  1Z47 A;  4C3H B;  2JEA I;  1T5X D;  4HIM A;  2O4X A;  1A0I A;  4X3S A;  4A3I G;  2QF7 A;  4RHR A;  3KBG A;  5TSS A;  2I0Q A;  4L63 B;  4X64 L;  1LO5 D;  2NVT B;  4OWT B;  4K5X A;  4KD4 A;  3HEJ A;  1WTP A;  1J8I A;  5HUR A;  1N32 Q;  5CV6 A;  4OON A;  5EAY A;  3FDT A;  1KNA A;  3GTP B;  3T4A C;  5FOB B;  3C1E A;  2V4D A;  1NR2 A;  3HZX A;  1S72 A;  2C35 B;  1TKW B;  1I6V C;  2B29 A;  1HCZ A;  2K5W A;  3DEP A;  5COY A;  1SSO A;  3T13 A;  4IFD I;  1HUM A;  4HJ5 A;  4UP8 A;  4KHZ A;  3S16 B;  4PQX A;  1I50 H;  4AYB B;  1V8Q A;  1ENF A;  3H3V H;  2WAQ E;  1E22 A;  2OWO A;  4AYB G;  3ICE A;  3NWS A;  1Q8I A;  2MP1 A;  3CW2 C;  3J80 L;  1JMC A;  1HNZ Q;  2QA4 A;  4CKE A;  2NBF A;  3RZD H;  4JI8 Q;  3NBH B;  3QR8 A;  4G7H C;  2FIN B;  3MVV A;  1F77 A;  2F0E A;  4P73 A;  3WDN A;  5JPM C;  1JJC B;  1CQV A;  4JI8 L;  4M1U B;  1GHJ A;  2YV5 A;  2XGT A;  3Q8D A;  4KLK A;  4EQO A;  4LAA A;  3H15 A;  2E2I B;  5JOB A;  1EY8 A;  5IGE A;  1LT3 D;  5IGB A;  2Q8R E;  1DJR D;  2KCC A;  5J1Z A;  1S3O A;  1H9S B;  1QNK A;  2EIF A;  3GTJ H;  4AIM A;  1K83 H;  1A15 A;  4L5T A;  4XYO A;  1E1T A;  3MXU A;  2UUA L;  1EOV A;  4JI5 L;  2ZJP A;  4R4I A;  2EYL A;  4QCL A;  2NYZ D;  4ME5 A;  5IYB H;  2EYH A;  3BS1 A;  2BH2 A;  4X62 L;  5F2D A;  1JOR A;  4ZLT F;  1UE7 A;  3HGB A;  3EJI A;  3HOU G;  3J7Y W;  1BCP F;  5M5Y B;  1PMR A;  5G3L D;  4BY1 H;  4ME3 A;  1MSH A;  5C44 B;  2ENB A;  1HFG A;  4HJ7 A;  1OXV A;  1OXU A;  2B2T A;  3I4M H;  1FGU A;  5E3F A;  4BY1 G;  2R61 A;  2K5Q A;  1IBK L;  2A69 D;  2R3Z A;  4A93 G;  4HED A;  3P7J A;  5T1I A;  4KHP L;  3CQZ B;  1D8L A;  4S3S A;  4A3K H;  1GOZ A;  2J4X A;  4XDX A;  2YTX A;  4RFB A;  5KRU A;  4C3J G;  3A7L A;  3N6R A;  1OTC A;  4A93 H;  1TWG H;  4I7A A;  2FHT A;  1II3 A;  3MA2 B;  4A3K G;  4CJ1 B;  3T51 B;  1EEI D;  1L0Y B;  3KLS X;  2XRQ D;  2WKC A;  3A74 A;  4C56 C;  3S2H H;  4B3S Q;  2A6H D;  3L9A X;  1XTC D;  2PI2 E;  3H0G G;  5EKL A;  5M3M G;  1K0R A;  1F9S A;  4FP5 D;  3BZC A;  1PH4 A;  2AUK A;  1QVC A;  3HOZ H;  1KL9 A;  1JR0 D;  1V1P A;  3TS2 A;  5KND A;  2F52 A;  3JAM L;  1Q7Y C;  1EL0 A;  5FLM H;  2XSC A;  3VA5 A;  3RN5 A;  4UP7 A;  1S5B D;  4A3G G;  3TN2 A;  1HTP A;  2F0V A;  1QJO A;  1I3Q H;  3NUC A;  1OXX K;  3OTO Q;  5IE8 A;  2KA7 A;  2R92 B;  2OTL A;  4KJN A;  1SYG A;  2RF4 A;  4TVA B;  1I4R A;  4JBW A;  4OEM B;  4FXG C;  1WVL A;  2BE5 C;  3HOW H;  4IPC A;  3GTM H;  1HR0 L;  2RDF A;  1S4Z A;  4R4C A;  4Y7N H;  2IHF A;  3GTK H;  4KKT A;  4DK3 C;  4YHH Q;  2WKD A;  2LSS A;  3BDO A;  1YZ6 A;  2A19 A;  3U9O A;  3TEH B;  4G4K A;  3ULL A;  4K5V A;  1C48 A;  5AJ3 L;  2KED A;  3UDI A;  2K04 A;  4LF5 Q;  1PYW D;  1TWC H;  2N3S A;  1HQM C;  1KDA A;  3E0E A;  1L1O C;  3KDF A;  1TWA H;  4K8I A;  4NKL A;  1GUN A;  4LF8 L;  1Z7T A;  3VR4 A;  2QGQ A;  1X9N A;  3TP5 A;  4CGY B;  2RCN A;  4EQP A;  3A54 A;  4PZ8 A;  1FJG Q;  4GKJ L;  1N36 Q;  1EFI D;  4XTC S;  2JA6 G;  3K7A H;  1B9M A;  1Y8N B;  3PUV A;  2M9V A;  4BXX H;  3JC6 6;  2K5D A;  3U9S A;  2B63 B;  4XT1 B;  1KD1 C;  1PTO C;  2NB0 A;  3KF8 A;  5CGK A;  3QWN A;  1X54 A;  1BBU A; 
#chains in the Genus database with same CATH homology
 3H0G H;  3CCE A;  3BZK A;  3EN2 A;  1YJN A;  3M3Y H;  4DR7 Q;  4QQB X;  1VQ9 A;  3PSI A;  5ELO A;  1Z9F A;  2AKW B;  2NN6 G;  4NB3 A;  4UY8 C;  3HOY H;  1WYD A;  4DR4 Q;  3GTL H;  4A3D H;  2MNA A;  2R93 G;  2WFW A;  4JI0 L;  1VQB A;  5LMU Q;  4A3L G;  4OO1 G;  3PUY A;  3HOZ G;  1C7Y A;  4YCW A;  5C3E H;  3D0F A;  1E24 A;  1KAW A;  2CCZ A;  3KOJ A;  4R4O A;  3TRZ A;  1ASZ A;  1X3E A;  1PH1 A;  2WAQ G;  3MXN B;  4DV2 L;  5IP7 H;  3M7N A;  4DR4 L;  2DUD A;  1HZA A;  1BKB A;  3I7F A;  1LM0 A;  4LFA L;  1NMG A;  1LTL A;  1PYS B;  1D7Q A;  4YCV A;  2UUB Q;  4YCU A;  4DR5 L;  1HH2 P;  4LF6 Q;  3T1Y Q;  1VQ7 A;  3TQY A;  1VQN A;  2VZA A;  1CSP A;  5E7N A;  2ZJQ A;  3RLF A;  2VY3 A;  1B8A A;  1HNW Q;  4WJ3 M;  4B3S L;  2GVB A;  1YNX A;  4O2D A;  4J15 A;  2E5L L;  3S15 H;  2NZO A;  1O7I A;  5IP7 G;  2K4K A;  3NEN A;  3S14 H;  5JJK A;  5C0X I;  2VQE L;  3S1N H;  1IL2 A;  2AWN A;  1L1O B;  1N36 L;  2Q2U A;  1YHQ A;  1EYG A;  1IYJ B;  2UU9 Q;  4BA1 I;  4LF6 L;  3KF6 A;  4KI0 A;  4IOA A;  4PMW A;  1AH9 A;  1FVI A;  4HID A;  3PO2 H;  5BR8 L;  1VQP A;  2LXJ A;  4DV5 Q;  4HJA A;  1PH3 A;  4LWC A;  4A3J H;  4EX5 A;  1AE3 A;  3W1G A;  4LF8 Q;  1UE6 A;  1YVC A;  1K8A C;  4JI4 Q;  4OX9 Q;  3RLO A;  5K36 G;  3CCJ A;  1YJ9 A;  1VQM A;  1NTG A;  4DR1 L;  4APV A;  1IBM Q;  4BBR H;  2CQO A;  1MJE A;  3CCQ A;  5IYD H;  2MO1 A;  4BA2 I;  2K75 A;  2E5L Q;  4JYA L;  4DUY L;  3CQZ H;  4L5R C;  2F4V L;  4UP9 A;  1HNW L;  1JE5 A;  1SRO A;  4JG2 A;  4GNX B;  4A3J G;  1N34 Q;  4JI6 L;  4LF9 L;  3F2B A;  3PO3 G;  4WJ4 A;  3A5Z B;  3T1Y L;  1VQD A;  2OQ0 A;  4GNX C;  3LGJ A;  3RR5 A;  3UE0 A;  1Q81 C;  4PZ7 A;  3CME A;  1YIT A;  4GS3 A;  1WJJ A;  1NJI C;  1GM5 A;  2R6G A;  2HHH L;  3UDF A;  4Y52 H;  1MKH A;  1X56 A;  1JJG A;  2RHQ B;  2GVA A;  3OYY A;  2UXB L;  2E2J H;  3S24 A;  1R9T H;  5C4X G;  3GO5 A;  3F1Z A;  3CXC A;  5C44 H;  4DR1 Q;  1IBM L;  2R7D A;  4X62 Q;  1JJ2 A;  1IXR A;  4JI4 L;  2Z6K C;  3GDE A;  4OX9 L;  2A8V A;  3CD6 A;  2VS1 A;  2UXC Q;  2V1C C;  1SE8 A;  2E8G A;  1SR3 A;  5M5Y H;  4DV5 L;  1PH8 A;  4H02 A;  4BBS H;  5LMN W;  3F2D A;  2AMC B;  3U58 A;  4IPH A;  2PNH A;  3OTO L;  1LUZ A;  4AQY L;  3KLW A;  4DV0 L;  2K14 A;  2OCE A;  4GLV B;  4BXX G;  4K0K L;  2I5M X;  5C4X H;  1XMO L;  2JA7 G;  4B3M L;  2ZTC A;  5JJL A;  3ER0 A;  3CCL A;  1A8V A;  4GN5 A;  4X65 L;  4GN3 B;  3JAM i;  2EQS A;  3M9B A;  4BBS G;  1HZB A;  3GTO H;  3OW2 A;  5GAH C;  3NEL A;  4JBM A;  4GKJ Q;  2UXD Q;  2Z6K A;  1BVS A;  4JC0 A;  1VQC A;  4DPG A;  4L5S A;  5C0X G;  4YHH L;  4NXM Q;  1FL0 A;  3PIP A;  5GAE C;  5C3E G;  1XNQ Q;  1TWF H;  4A75 A;  1EQQ A;  1EFW A;  2ASB A;  3SGI A;  3H3V I;  2L15 A;  2IT1 A;  1N32 L;  3KF8 B;  1A62 A;  1G51 A;  2HT1 A;  4A3B G;  3UDX A;  4DV4 L;  2Y0S E;  4GNX A;  4A3F G;  1JB7 A;  2K50 A;  4JCV E;  2Z0S A;  3CF5 A;  3CC2 A;  2IX1 A;  3STB D;  2IHE A;  4A3E G;  2QEX A;  1VQL A;  1Q12 A;  3RLN A;  3S1R H;  1PV4 A;  1CUK A;  3I55 A;  1Q1E A;  1N8R C;  3GTQ H;  4GKK Q;  1KC8 C;  3CCU A;  1JT8 A;  2HIX A;  4A3F H;  3S2D H;  1TWH H;  1X65 A;  3VDY A;  3STB C;  3CCR A;  1XNR L;  1C9O A;  1VQO A;  1HR0 Q;  2R7Z H;  2N49 A;  4X66 L;  4AYB E;  4GLX A;  2D0O A;  1SRU A;  3PO2 G;  3F8T A;  2UXC L;  2NN6 I;  2K5N A;  1XJV A;  5M5X H;  1PH7 A;  3S16 H;  3HKZ G;  2OQK A;  4DV4 Q;  4QJF A;  4A3C G;  3J81 c;  4DUZ Q;  1VQ5 A;  1NY4 A;  3T1H L;  4LFB Q;  2IY5 B;  1U0L A;  2KHI A;  4DR5 Q;  2KHJ A;  1XPR A;  2UUC Q;  1QUQ A;  1X55 A;  4IFD G;  1I5F A;  4NPS A;  3K81 C;  1CSQ A;  1VQE A;  2I5H A;  1TXY A;  2H5X A;  3PV0 A;  4FDB A;  4JI2 Q;  1LYL A;  1HNX Q;  5GAG C;  2ZJR A;  1KQS A;  2CFM A;  2LXK A;  4DR6 L;  3GTP H;  1SLJ A;  4JBJ A;  3RN2 A;  3PUW A;  4X6A H;  1J5E L;  5AJ3 Q;  1IBL Q;  2F4V Q;  4R4T A;  4R4Q A;  5M3F H;  5HGQ A;  1QZH A;  1E1O A;  4O0A A;  3S1M H;  4YY3 Q;  2JE6 I;  5ELN A;  5IP9 G;  1A63 A;  4P71 A;  4C3I H;  2ZM6 Q;  2MO0 A;  1VS0 A;  1IZ6 A;  3J81 i;  1HNX L;  2NVT H;  3CPF A;  3S1Q H;  4JI3 L;  2PQA B;  4JI2 L;  5C44 G;  2F3I A;  4B3R L;  2D0P A;  2FXQ A;  3FKI G;  2BA0 A;  2N8N A;  4EQ5 A;  3T1H Q;  5JEA J;  2K5H A;  2VNU D;  4C3H H;  4HJ8 A;  5IYC G;  1M90 C;  4LF4 L;  1I6H H;  1W2B A;  2Q2H A;  5DLQ E;  2VQF L;  4LF7 Q;  3F2C A;  1XTD A;  1GVP A;  1KXL A;  2JEB I;  4RMF A;  1ASY A;  4LF4 Q;  2JA7 H;  3HKS A;  1IBK Q;  1KRS A;  5IYB G;  2NVX H;  3FKI H;  1YJW A;  1VQA A;  3PIO A;  1B70 B;  1PH9 A;  2PMZ E;  2HHH Q;  5IYC H;  5IWA Q;  5J3B A;  1Z47 A;  4LUV A;  4BY7 H;  2JEA I;  1H95 A;  4HIM A;  3KFU A;  3PGZ A;  1A0I A;  1Y1V G;  2K52 A;  1HR0 W;  4A3I G;  2YYZ A;  2I0Q A;  4IPG A;  4LF9 Q;  3G48 A;  3M4O H;  4C2M H;  4X64 L;  4DV2 Q;  1VQI A;  4DUY Q;  1UE5 A;  4PZ6 A;  3I4O A;  4OWT B;  1QZG A;  1WOC A;  3AFQ A;  1OXT A;  2JK8 A;  4GOP C;  1EUJ A;  4DR6 Q;  4BY7 G;  5JEA G;  4A3B H;  1SN8 A;  1CKO A;  4DR2 Q;  1Y1V H;  1N32 Q;  4OON A;  3NEM A;  5EAY A;  2ID0 A;  2WB1 G;  5HY6 A;  4JV5 Q;  3J7Z C;  4JI7 L;  4A3M G;  2R7F A;  3MEF A;  2RHS B;  4DK6 C;  3JAM c;  4A3E H;  2KBN A;  5FJ8 H;  3ULP A;  1S72 A;  1QVG A;  2B63 H;  1HJP A;  3KYH C;  3CCV A;  2C35 B;  2HQL A;  1L2F A;  2B29 A;  2PI2 A;  4LNQ A;  4LFC L;  2ES2 A;  1VQ6 A;  3CC4 A;  3AEV A;  4IFD I;  4DV7 Q;  2OTJ A;  4HJ5 A;  4UP8 A;  1WCM H;  4C3J H;  4KHZ A;  2R7Z G;  5C4J H;  1VQJ A;  1I50 H;  2N78 A;  3H3V H;  2WAQ E;  2AHO B;  1E22 A;  2OWO A;  4JBK A;  3W5O A;  4AYB G;  3J81 j;  3ICE A;  2PQA A;  4DV0 Q;  3W1B A;  4JI5 Q;  3CW2 C;  1NE3 A;  4AQY Q;  1JMC A;  3CCS A;  1HNZ Q;  4A3C H;  3PF5 A;  4OWW B;  2QA4 A;  4JI7 Q;  1WCM G;  4QIW E;  3CC7 A;  3RZD H;  4JI8 Q;  4KHP Q;  3NBH B;  1T9H A;  4HIO A;  4P73 A;  3IRB A;  2Y0S G;  1JJC B;  3HOV H;  2UXB Q;  4JI8 L;  2BA1 A;  5LMU L;  1UWV A;  1VQF A;  4YWK A;  2ZTD A;  3RNU A;  2YV5 A;  2XGT A;  4R1J A;  3Q8D A;  1SFO H;  1XNQ L;  3BJU A;  1PA6 A;  1QUQ B;  5M3F G;  1Q8K A;  4KLK A;  2VL6 A;  3H15 A;  4DR7 L;  4A76 A;  2KEN A;  5IP9 H;  1C0A A;  4YWM A;  5FLX c;  5IWA L;  2WP8 J;  2UXD L;  3GTG H;  3HOV G;  1GO3 E;  2ATW A;  2MQH A;  1MJC A;  1OXS C;  2MFI A;  3GD7 A;  4OO1 I;  1S3O A;  4ALP A;  3A0J A;  3ZJY C;  2JA8 H;  2VW9 A;  2VUM G;  2R92 H;  4GOP B;  4DR3 L;  3K0X A;  2EIF A;  3KDF B;  1X3G A;  2BH8 A;  3GTJ H;  4AIM A;  1K83 H;  1PH5 A;  3M85 A;  1RL2 A;  2JA5 G;  3RZO H;  4LF7 L;  1EWI A;  2CWP A;  1K9M C;  1B7Y B;  4L5T A;  3HOU H;  4K0K Q;  1XPU A;  1WI5 A;  3DLL A;  1XPO A;  1E1T A;  1UE1 A;  4P72 A;  5GRO A;  1N33 L;  2UUA L;  3CPW A;  1PHJ A;  1N9W A;  1EOV A;  4JI5 L;  4B3R Q;  2ZJP A;  4R4I A;  4OWX B;  3AQQ A;  5IYB H;  2BH2 A;  3L2P A;  4X62 L;  4IO9 A;  2JA5 H;  3G71 A;  1UE7 A;  3G6E A;  2KCM A;  4JI3 Q;  3HOW G;  4JI1 Q;  2CKZ B;  1VQG A;  2JJQ A;  1Q1B A;  3TS0 A;  3FP9 A;  3HOU G;  2AWO A;  1KIX A;  4LF5 L;  3I4M G;  3M4Q A;  1W3S A;  4A3I H;  4QL5 A;  3J80 i;  1Y1W G;  4ME3 A;  4BY1 H;  4X64 Q;  3CP0 A;  1J5E Q;  1GKH A;  3TRE A;  3I56 A;  3B6Y A;  1NBW A;  4HJ7 A;  1OXV A;  1EQR A;  3KF6 B;  4B3T Q;  4POG A;  1CKN B;  1X3F A;  3PUX A;  3PUZ A;  1UEB A;  4JOI A;  4LFA Q;  3KJP A;  4JI6 Q;  1OXU A;  1K73 C;  3I4M H;  3UDG A;  1FGU A;  1PH2 A;  3HOX H;  4BY1 G;  3U4Z A;  4GLA C;  2NVQ H;  1KRT A;  2HIV A;  3K7U C;  4A3M H;  1CKN A;  1IBK L;  2K5V A;  4A93 G;  5FJ8 G;  2B63 G;  4DV3 Q;  2YTV A;  4IOC A;  3K8A A;  5IT9 c;  3I4N H;  4KHP L;  2NZH A;  2YTY A;  1Q82 C;  4JOI C;  1D8L A;  2ALY B;  4A3K H;  4JI0 Q;  4IPD A;  4HIK A;  2YTX A;  3E9I A;  1PH6 A;  5BR8 Q;  3ERS X;  3HOX G;  1HNZ L;  4XIG S;  2JA9 A;  1PFS A;  4IJH A;  1XNR Q;  1QVF A;  1L0W A;  3ULJ A;  2YU9 H;  4LW1 A;  4QY7 A;  2JQO A;  3BU2 A;  1OTC A;  2UU9 L;  4A93 H;  1XMQ Q;  4IJL A;  1TWG H;  2JA6 H;  4A3K G;  1AE2 A;  3WWV A;  5LMN L;  1I94 L;  2I5L X;  1Y14 B;  4DV7 L;  4P75 A;  3A74 A;  4LFC Q;  3S2H H;  4MNO A;  4B3S Q;  4DAM A;  1VQK A;  2PI2 E;  5IY0 A;  2VQF Q;  1DGS A;  3H0G G;  1G29 1;  5M3M G;  1K0R A;  2UUB L;  2NVY H;  2IX0 A;  3KJO A;  4DV1 L;  3BZC A;  2R93 H;  1PH4 A;  1QVC A;  1J6Q A;  5FLM G;  1EIF A;  1X6O A;  2UUC L;  3HOZ H;  1KL9 A;  4JV5 L;  4POF A;  1YBY A;  4DV1 Q;  3EBE A;  1EIY B;  4DR2 L;  4QGU A;  3E9H A;  3TS2 A;  4UPA A;  2EXD A;  3S17 H;  4A3G H;  4MTN A;  5M3M H;  3M4P A;  5H1S E;  2F52 A;  1BBW A;  4HJ9 A;  2E2H H;  1YEZ A;  4OXP A;  3CMA A;  1Q7Y C;  3HKZ E;  4LUZ A;  5FLM H;  4LUO A;  2VUM H;  2GN5 A;  2WB1 E;  3AFP A;  5LMN Q;  1I94 Q;  2CWA A;  4X65 Q;  2JA8 G;  2R92 G;  4JI1 L;  3RN5 A;  4PG3 A;  4UP7 A;  4A3G G;  3FHW A;  5JJI A;  4DV6 Q;  3CAM A;  1I3Q H;  1L1O A;  1VCI A;  1OXX K;  3EIV A;  4TQU S;  3OTO Q;  1VQ4 A;  4MZ9 A;  2UUA Q;  4RG1 A;  1CKM A;  1P8L A;  1GD7 A;  4LFB L;  2OTL A;  1PVO A;  4A4I A;  3K80 C;  4IFD J;  1FJG L;  1NMF A;  1WFQ A;  2RF4 A;  4TVA B;  5GQO A;  5C0X J;  1HZ9 A;  4DV3 L;  4JBW A;  4DNI A;  3HOW H;  4IPC A;  4DR3 Q;  3GTM H;  3PCO B;  1HR0 L;  5M5W H;  2E2I H;  1SMX A;  1E3P A;  2ZTE A;  4R4C A;  4Y7N H;  2IHF A;  1Y1W H;  3GTK H;  4DK3 C;  3U4V A;  3CCM A;  4BBR G;  4DAY B;  2KCT A;  4YHH Q;  3AYH B;  4NXM L;  2A1A A;  1V9P A;  2LSS A;  4NXN Q;  1YZ6 A;  1Q46 A;  2A19 A;  1RIP A;  2D62 A;  5IYD G;  2ZM6 L;  4B3T L;  3TEH B;  1N34 L;  4YY3 L;  3UE1 A;  1YI2 A;  2Q2T A;  3ULL A;  4JYA Q;  3HFZ B;  5AJ3 L;  1IBL L;  3PO3 H;  1VQ8 A;  1HZC A;  2Q2I A;  1G6P A;  3UDI A;  4YWL A;  4LF5 Q;  1TWC H;  2N3S A;  4NXN L;  3E0E A;  1L1O C;  3KDF A;  1YHB A;  4GOP A;  1TWA H;  3U50 C;  2DGY A;  4LF8 L;  1VQH A;  1YHA A;  3I4N G;  1P16 A;  1U5K A;  3J80 c;  2QGQ A;  1Q86 C;  3PF4 A;  1KHI A;  1N33 Q;  4L5Q A;  4DUZ L;  4DKA C;  1X9N A;  2RCN A;  4PZ8 A;  1FJG Q;  4GKJ L;  1N36 Q;  4XTC S;  5GAD C;  3G4S A;  2JA6 G;  3L0O A;  3K7A H;  4AH6 A;  2VQE Q;  3A5U A;  3PUV A;  4X66 Q;  3HOY G;  4BXX H;  3JC6 6;  3J7A 5;  2XTI A;  4A3D G;  1KD1 C;  1V1Q A;  4P74 A;  4A3L H;  4DV6 L;  1K8G A;  1K3R A;  1MIU A;  1PYB A;  2B3G A;  1V43 A;  1XMQ L;  4B3M Q;  1XMO Q;  3I2Z A;  3DM3 A;  3L7Z C;  1E7Z A;  4GN4 B;  1YIJ A;  1M1K C;  5IE8 A;  1S40 A;  4GKK L;  3D31 A;  1X54 A;  1BBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...