4B3RQ

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3rQ00
3RLOA 4Y7NH 4DUYL 1P16A 1VQ4A 1XNQQ 2KCMA 3CAMA 2Y0SG 3TQYA 3MEFA 4EQ5A 1K0RA 2A8VA 4BA2I 3JAMi 3GTJH 1GD7A 4H02A 4LFAQ 1N36L 3EBEA 1IBLL 1CKNA 3S1QH 2B29A 1L1OC 4GOPC 5FLXc 2JA8H 3GTKH 4C3HH 1VQEA 1LTLA 4OXPA 4YWLA 5IP9G 3CMAA 3NBHB 3J7ZC 3OW2A 2HT1A 5IP7G 1VQKA 3AYHB 2ES2A 1Q81C 5FLMH 4DR1L 3VDYA 3K7UC 4R4IA 1VQCA 3CF5A 3PUZA 4IO9A 4A3BH 4TVAB 4J15A 3GTOH 4PZ7A 2I5MX 2E2IH 4GNXA 1TWHH 4A3KG 1VS0A 4NB3A 3G6EA 3J81j 2ZM6Q 3F2BA 1SROA 1YJNA 2WB1G 4IFDG 2UUCQ 3CCQA 3CCMA 2UUBL 2UXDL 4JI6L 3A74A 4NXNL 1N8RC 2KENA 1BBUA 4HJ7A 3F1ZA 4LF5Q 1MJCA 1OXSC 2I0QA 5M3FH 3M4QA 3S2DH 2KHJA 1NE3A 4IPHA 4JI8L 1VQPA 4B3RQ 3NENA 2K50A 5C0XI 1IBML 2NVXH 2N78A 1SFOH 2VZAA 3H0GG 1VQFA 4JI2Q 1XMOL 4JI0Q 4A3JH 1Y14B 3DM3A 3RLFA 4X6AH 3RN5A 4LF4L 3PO2G 2NN6G 1S40A 3RR5A 4BBRH 1QZHA 3UDIA 1UEBA 1HZ9A 3CXCA 2VUMH 3PCOB 4GNXC 4JBJA 4JG2A 4LFAL 4XIGS 5IYDH 1VQBA 4HIKA 5M3FG 1Q86C 2ZJQA 4JOIC 1HR0Q 3HKSA 3CMEA 3TREA 2PMZE 1QZGA 3D31A 1LYLA 1I50H 3BZCA 3UDGA 3CPFA 1I94L 4AYBE 1X6OA 4JI4Q 3F8TA 1KL9A 3UDFA 4R1JA 4A3KH 1QVCA 1WYDA 2QGQA 2E8GA 1JJ2A 1PYSB 3MXNB 1VQ9A 4DR7L 1PA6A 2GVBA 3HKZG 2UXBQ 3S1RH 3CCJA 4O0AA 3I4MG 3A5UA 4HIOA 3BZKA 1KXLA 4C3JH 4O2DA 5LMNQ 3BJUA 4GS3A 4QGUA 3I55A 1VQ5A 1MJEA 1QUQB 3J7A5 1VQOA 1TXYA 3H3VI 3K8AA 3I4OA 1VQAA 3KOJA 1IBLQ 5GADC 4GLVB 2K5HA 4DV4L 2WFWA 5FJ8H 1K83H 4ALPA 3HOWG 3KJPA 3CQZH 4DUZL 4DV4Q 1TWGH 2YU9H 2JEAI 3W5OA 1YEZA 2V1CC 4PMWA 4IFDJ 1WFQA 4A3IH 2Z6KA 3L7ZC 2XTIA 3S16H 1XMQQ 1BVSA 2HHHL 2BA0A 5LMNL 2UXCL 3GTQH 4YY3Q 4PZ6A 1E7ZA 4GN4B 4GNXB 2EIFA 4DR5Q 3GTPH 2IX0A 4A4IA 4A3MG 4KHZA 5JJIA 1I3QH 2F4VL 1D7QA 3U58A 4DR7Q 4X62Q 4QY7A 1K73C 2Q2IA 1W2BA 1EQRA 2H5XA 4DPGA 1PH1A 1H95A 1G6PA 1K9MC 1YJ9A 2AHOB 2VS1A 1DGSA 1V43A 1AE2A 2KHIA 1E24A 4DAMA 4X64L 1PH7A 2CFMA 2IY5B 2D62A 2NZOA 5DLQE 4DV2L 4Y52H 2ZJRA 1OXTA 3S1MH 3CCVA 1RIPA 2EQSA 1AE3A 1A62A 2MO1A 1R9TH 1PHJA 4DR4Q 2MFIA 4R4OA 2A19A 2B63G 1U5KA 3PUWA 1OXUA 2VQFQ 3B6YA 1VQLA 2PNHA 4GLAC 1KQSA 4JI3Q 3M7NA 4LWCA 4A3GG 2QEXA 3CW2C 1UE5A 1EYGA 4JI0L 2OCEA 1YNXA 3I7FA 4POFA 3J80c 1NBWA 2D0OA 3GTLH 4A3CG 3L2PA 2K75A 1X3EA 1HR0L 3K7AH 3A0JA 4B3TQ 3G4SA 4OO1I 1E1TA 4A3DG 1NMFA 4B3SL 3ICEA 2CWPA 4A3CH 2FXQA 2VL6A 4LUVA 2PQAB 3F2CA 3E0EA 4JI1Q 3Q8DA 3S2HH 2N8NA 4UP9A 1KRTA 2RHSB 2PI2A 1Q12A 4LF6Q 4LF7L 1YBYA 4WJ3M 2OQ0A 2KCTA 1CKNB 1TWFH 2JA7H 3G48A 4DV5Q 1VQDA 1VQHA 1VQGA 3H0GH 4HJ8A 3T1YL 3ULJA 1PH2A 1PH8A 4JI2L 4BY7H 2VQFL 1CKOA 3W1BA 4LF6L 5IWAQ 1EFWA 4UPAA 4L5TA 4B3RL 1N9WA 1X56A 3H15A 1LM0A 1P8LA 2BH8A 4B3SQ 1EUJA 1AH9A 2BA1A 3UE1A 4B3TL 1D8LA 3UDXA 5JJKA 1YIJA 1XNQL 2UUCL 4UP7A 3HOUG 2ZM6L 3K80C 1FL0A 3KDFB 4APVA 2QA4A 4IJHA 4QL5A 4LNQA 4NXMQ 3GTGH 3STBD 3NELA 1XNRL 3WWVA 2E2HH 2IX1A 1RL2A 1IBKQ 4A93H 5LMNW 4P73A 1SMXA 1Q7YC 4BXXH 4DR2Q 2LSSA 4HIMA 3J80i 3T1HQ 3HOZH 1HNZL 1Y1WH 3RN2A 2R93H 1C0AA 3HOVH 4LFCL 5C0XG 3J81c 2ATWA 4MNOA 1PYBA 3M4OH 2R93G 1PFSA 2R92G 2JE6I 3PIPA 1IXRA 4DV2Q 2MQHA 3CD6A 2ZTEA 1GM5A 3KF8B 4L5SA 2CKZB 3KYHC 3PUXA 3G71A 4NPSA 4PG3A 2VUMG 4DV0Q 1LUZA 3CCLA 3I4MH 1XPUA 2R7ZG 1MKHA 3ER0A 1Y1VH 3K0XA 2MNAA 2OTJA 4DV1Q 1A8VA 2JJQA 1PH4A 2F4VQ 2B3GA 4A3EG 1J6QA 3M4PA 2VQEL 3TRZA 4DR5L 2VW9A 3RLNA 1J5EL 4QIWE 1YITA 5GAGC 1PH6A 2HHHQ 4P72A 1VQ6A 2DGYA 4TQUS 5BR8Q 4A3MH 1L2FA 4A75A 2L15A 1PH9A 4DV0L 5GROA 1BBWA 5IYDG 3D0FA 1IZ6A 5C4XH 5IYCG 5EAYA 4RG1A 1VQNA 4B3ML 4EX5A 3S1NH 4GKJQ 4QQBX 4MZ9A 5IE8A 3JAMc 2E2JH 4OX9L 4LF8Q 4A3FG 2YV5A 4A76A 2WB1E 4IPGA 1YHQA 2JA6G 4JYAL 4DV6Q 1EIYB 1KRSA 1N33L 3HOWH 1B7YB 1CSQA 3K81C 4LF9L 3HOZG 3RZOH 4OWTB 4GLXA 5H1SE 1N34L 2XGTA 4LFCQ 3PO2H 1K8GA 1Q8KA 1HR0W 4X65Q 4JI5Q 5IWAL 1YJWA 4A93G 2F3IA 2DUDA 2Q2TA 1JB7A 1L0WA 1OXVA 1Q1EA 2NZHA 1X65A 3CCSA 4JI4L 3CCUA 2YTYA 4HJ5A 1XMOQ 1PH3A 1YHAA 3S17H 5ELOA 1C9OA 1U0LA 2ZTDA 1X54A 3L0OA 1JJCB 2F52A 3PIOA 3CPWA 3STBC 2IT1A 3M3YH 1JT8A 1OXXK 1HZCA 4P74A 5C0XJ 4NXNQ 2JA9A 4KI0A 2UU9L 1KHIA 4JI6Q 4JV5L 5JJLA 1V9PA 4R4CA 1CKMA 3ULPA 1EIFA 3AQQA 1G291 1I6HH 4JBWA 1IL2A 5IT9c 1M90C 1NJIC 1FVIA 3T1YQ 2JA7G 3HOXH 2R6GA 2K5NA 4DAYB 1ASZA 4AYBG 2K5VA 4DR1Q 1S72A 3HOXG 4DV3L 4A3JG 4OWWB 3HKZE 4A3FH 2UU9Q 4JV5Q 2AKWB 1SRUA 4KLKA 4PZ8A 3E9HA 1KD1C 4LF5L 2KBNA 2UUAL 5K36G 2WAQG 4JYAQ 5C4XG 2A1AA 2I5HA 2ID0A 5AJ3L 1Z47A 1M1KC 2OQKA 4LF8L 4IJLA 4XTCS 3PF4A 2NVTH 3PGZA 5C44G 1HH2P 2ZTCA 3I56A 1B8AA 1XJVA 1VQJA 1WCMH 5LMUL 4IPCA 4A3GH 4LUOA 3GDEA 5IY0A 2N3SA 5C4JH 4LFBQ 4A3EH 3CCEA 2JA5G 1HNWQ 4JI3L 4OO1G 2RHQB 2R7ZH 3TS0A 2NVYH 4P75A 4YWMA 2VQEQ 5IYBH 1HJPA 3S24A 3UE0A 4YY3L 4YCVA 4A3BG 4NXML 3PV0A 4DR4L 4DK6C 2ZJPA 1JE5A 4AH6A 1WOCA 1Q46A 4LF9Q 4MTNA 3RZDH 5IP7H 4JCVE 1N36Q 2JK8A 2R92H 3OYYA 4OX9Q 2GN5A 3S14H 1JMCA 3PSIA 3W1GA 4DUZQ 4GKJL 1L1OB 3U4ZA 4B3MQ 1E1OA 1QUQA 5HY6A 1OTCA 2AWOA 5M5WH 1Y1WG 3OTOL 3AEVA 4BBSG 3J81i 2NVQH 1NY4A 3TEHB 3DLLA 1XPRA 4DR6L 4GKKL 2N49A 2YTVA 3AFQA 1L1OA 1YZ6A 1V1QA 5M3MG 3I4NG 4L5QA 4WJ4A 2JQOA 1HNZQ 3KDFA 1E3PA 2JEBI 4GN3B 3HFZB 4C2MH 1JJGA 2CWAA 3KF6A 3FKIG 5M3MH 3I4NH 1N32L 3CP0A 2UXCQ 4YCWA 5GAHC 4YHHL 4BBSH 1VQ8A 1XMQL 3HOUH 2E5LQ 4IOCA 4DR6Q 4JC0A 1X3FA 1I94Q 1FJGL 1YHBA 1HNXL 1X3GA 3E9IA 5M5XH 3OTOQ 1NMGA 5LMUQ 3HOYG 1QVGA 1T9HA 2I5LX 1XPOA 2BH2A 4DNIA 5C3EG 1WCMG 3H3VH 3ERSX 1WJJA 1FGUA 5M5YH 1SLJA 2OTLA 3S15H 5C44H 2IHFA 1EWIA 2UUAQ 4YWKA 2K14A 1UWVA 2R7DA 1Q1BA 2EXDA 4BY7G 3T1HL 2JA5H 2ALYB 2LXKA 4GN5A 4DR2L 3HOVG 1O7IA 3EN2A 4DV7L 4LF4Q 3PO3H 4BBRG 1IBKL 2AMCB 2NN6I 4X66Q 1HZBA 4L5RC 1A0IA 1XNRQ 1X9NA 1EQQA 4RMFA 3TS2A 2Y0SE 1Q82C 1XTDA 1ASYA 1SR3A 1IBMQ 3GO5A 5J3BA 1X55A 3LGJA 1UE1A 1CSPA 2VY3A 3IRBA 4JI8Q 4AIMA 4JI1L 1YI2A 3KJOA 1PH5A 2K52A 5AJ3Q 1K8AC 3A5ZB 2C35B 4DR3L 1BKBA 4FDBA 2IHEA 1C7YA 4DKAC 3M85A 4BA1I 1VQ7A 4AQYQ 4POGA 4JOIA 4DV3Q 4K0KQ 4BY1H 3PO3G 4DK3C 1KIXA 4IFDI 1TWAH 2B63H 3CC7A 1Z9FA 2PQAA 2LXJA 4LUZA 4A3DH 3I2ZA 2K4KA 4DV5L 1SN8A 2YYZA 5GQOA 2CCZA 3EIVA 1MIUA 1IYJB 3CC2A 4LF7Q 3ZJYC 4GOPA 4X65L 4UY8C 4IPDA 4HJAA 4AQYL 3PUVA 1NTGA 5HGQA 4OWXB 3U4VA 1N34Q 5JEAG 4C3IH 4BY1G 3RNUA 1EOVA 2HQLA 3M9BA 3CC4A 1SE8A 4DR3Q 1KAWA 2YTXA 3NEMA 4GOPB 4IOAA 1QVFA 4LW1A 2MO0A 3F2DA 2UUBQ 4R4QA 1GVPA 2ASBA 1CUKA 3PUYA 3CCRA 4X64Q 1VQMA 4JI7L 2UXBL 2Z0SA 5E7NA 1A63A 3KF6B 1FJGQ 1KC8C 5IYCH 4X66L 2R7FA 5BR8L 2E5LL 2Q2UA 2Z6KC 5FLMG 2GVAA 2CQOA 4X62L 4YHHQ 4DV7Q 2D0PA 5IP9H 4JI5L 1TWCH 5JEAJ 4A3IG 2JA8G 4R4TA 2RF4A 4JBKA 3KFUA 1GO3E 4DV1L 4KHPQ 2WAQE 4UP8A 2PI2E 1B70B 2JA6H 3GTMH 4A3LG 4GKKQ 4K0KL 5FJ8G 1N33Q 3PF5A 2HIVA 4DV6L 1PV4A 1WI5A 3JC66 4LFBL 2RCNA 1E22A 4ME3A 4HIDA 3FP9A 4DUYQ 3AFPA 2Q2HA 5GAEC 4JBMA 1GKHA 1HNXQ 5C3EH 5IYBG 1S3OA 3U50C 1PVOA 4OONA 2VNUD 4P71A 2OWOA 3HOYH 4KHPL 2UXDQ 1N32Q 3GD7A 4A3LH 2AWNA 3KLWA 1J5EQ 1Y1VG 1YVCA 4YCUA 1HZAA 2HIXA 1W3SA 4HJ9A 1VQIA 1HNWL 3FHWA 1VCIA 3FKIH 1K3RA 3SGIA 3ULLA 4BXXG 3BU2A 4QJFA 1UE7A 2WP8J 4JI7Q 1I5FA 1G51A 1UE6A 5ELNA
chains in the Genus database with same CATH superfamily
2R93B 2JYOA 4DUYL 3SR1A 2KCMA 4BA2I 5I2XA 1K0RA 3NWTA 4H02A 2NUCA 2A73B 4KKTA 1CKNA 1DZ1A 2B29A 5EPLA 1LTLA 5IP9G 3NBHB 3J7ZC 3OW2A 1EY0A 1VQKA 3K7UC 3CF5A 3PUZA 3GTOH 1F9QA 1D6EC 1CI3M 2E2IH 5EBCA 1YJNA 3F2BA 2IJ0A 3BDLA 3QOJA 1N8RC 1F77A 3M4OB 4LF5Q 2NVQB 1MJCA 1MI2A 1SJED 1TY0A 3M4QA 4IPHA 1Y1WB 5FOBB 1H9SB 1TT2A 1I4RA 2B2VA 4JI2Q 1XMOL 4JI0Q 3E5SA 4X6AH 3PO2G 1TQOA 2PW7A 3RR5A 1FD7D 4FF4A 1ILPA 4K6LA 1HZ9A 2I46A 4GNXC 5E3FA 4ABNA 2E2HB 5CV9A 4LFAL 2JA6B 1VQBA 1Q86C 1G8ZD 4X3TA 3HKSA 2PMZE 1GHKA 1BCPD 1B3QA 3ERQA 2R7ZB 5IODA 1B53A 2QGQA 3MXNB 3PIP3 2JA7B 2GVBA 3I4MG 1RF2D 4HIOA 1BXTA 1VQ5A 2XRQD 3HOXB 1TXYA 3H3VI 3I4OA 1K83H 3D3RA 4DV4Q 2JEAI 3GTLB 4IFDJ 4FVMA 4RA8A 3X3NA 4A3IH 1KNEA 2EDGA 2WV6D 1XMQQ 2BA0A 5LMNL 3EJIA 3GTQH 4YY3Q 2K33A 2CH4A 1E7ZA 4PZ6A 3TZDA 4A4IA 4K8JA 2ZXPA 1A3UA 3U58A 1W2BA 1LTBD 4DPGA 4A3BB 1F9PA 1K9MC 1TWFB 4XT1B 2KHIA 4LK1C 1TVXA 3P7JA 2F0IA 2D62A 4Y52H 2A6EC 1OXTA 4B9XA 2OT2A 2ZJRA 3S1MH 1IW7C 1RIPA 4MN3A 1AE3A 3NTIA 2F0KA 1PHJA 1LTAD 3U9SA 1UAPA 3NXWA 1U5KA 1DOLA 1OXUA 4FNFA 1VQLA 1KQSA 3M7NA 1PTOH 3KBXA 2HDMA 3I7FA 3OIPA 4K5VA 4KKUA 3R2TA 3LNNA 1D5XC 3G4SA 1E1TA 4A3DG 4B3SL 2CWPA 5CR3A 2VL6A 4LUVA 3E0EA 2N8NA 4UP9A 2LY7A 3I4NB 4LF6Q 2KCTA 1CKNB 3G48A 1VQDA 1VQHA 1VQGA 1I4PA 2PZUA 3H0GH 5C4HA 2CW0D 4LF6L 4UPAA 4B3RL 4R9WA 5IGDA 2V4DA 1CT1D 4B3SQ 2QDBA 3J80E 3UDXA 2RDGA 1XNQL 4UP7A 3WOFA 1PFMA 2UXDQ 4NXMQ 1SNOA 2I07B 3STBD 4UDUC 3SEBA 3M4YA 3NTHA 2E2HH 1SYBA 4P73A 1SMXA 2EYHA 1XYIA 3J81E 4DGZA 3FRPB 3EA6A 4FO2A 4OHJA 4IALA 3PIPA 3A56A 3A7AB 2QCPX 1GM5A 4L5SA 2CKZB 4C3JG 4QUFA 1IKMA 4XYQA 3CCLA 1XPUA 1AP0A 1MKHA 3ER0A 3K0XA 2BDOA 1WTQA 2QF7A 2NVXB 4QIWE 2X6GA 1F9RA 4P72A 2DGYA 2Q8TA 4DV0L 5IGEA 1BBWA 3GTJB 1IZ6A 3S15B 1ZEQX 5IYCG 4RG1A 4WJWA 3S1NH 4GKJQ 4QQBX 4OX9L 2E2DC 1VF7A 4IPGA 4BS9A 1B50A 1EIYB 1N33L 1B7YB 5J1ZA 4OWTB 4GLXA 4UAIA 2XWJB 1ENAA 2CW0C 5IWAL 4A93G 4BWGB 2Z4IA 1GHJA 1OXVA 1Q1EA 2NZHA 3LX0A 3CCUA 3HZXA 1XMOQ 1YHAA 1SMYD 3S17H 5ELOA 1TWGB 1DCZA 5EPKA 1JJCB 2F52A 3CPWA 4GZYC 2R92B 3H6MA 2B2UC 1OXXK 1PRTC 2JA9A 3TBIB 4KI0A 2F0DA 4DAVA 4C1NK 5IT9E 4JV5L 4BBSB 1V9PA 4R4CA 1G291 5K36H 3Q22A 1DOMA 3V05A 5IT9c 5M5XB 3GTQB 2Q8IB 1WD1A 1FVIA 3MXUA 2K5NA 4DAYB 3JAML 3BZDB 2NN6H 2K5VA 1S72A 4DV3L 1SEBD 4HR7B 3W2DA 5JPNC 2AKWB 4DNRB 1F2MA 1KD1C 4LF5L 2KBNA 2LKVA 3N6RA 2WAQG 3MC0B 2A1AA 2ID0A 5ELEA 4DK1A 1Z47A 1M1KC 5C4XG 3PGZA 4G57A 5BN5A 1HH2P 3E6ZX 2L5TA 3QO2A 4HTHA 4FXKC 2HQEA 4I7ZC 2SNSA 3K0YA 1IW7D 2JA5G 5LL6S 4IURA 4Q0FA 2R7ZH 2P5ZX 3S24A 5CBEE 2PQEA 1JE5A 4MTNA 3VR2A 2JK8A 5I2YA 4R8IA 2GN5A 1JMCA 3W1GA 4DUZQ 3U4ZA 4B3MQ 5HY6A 1OTCA 5M5WH 3I90A 4O42A 3TEHB 1XPRA 4DR6L 2C5CA 3NQIA 3AFQA 3I4NG 1YZ6A 1TS3A 2JQOA 2B63B 4NMZA 1E3PA 4DK0A 2Z6BA 3JAME 1ILQA 1JJGA 2CWAA 1O7LA 3KF6A 5M3MH 1MGSA 4PV1C 2UXCQ 2K5WA 4YHHL 1VQ8A 4OL7A 1PRTD 4JC0A 1I94Q 4DR6Q 1FJGL 3HOYG 4BY1B 1QVGA 2I5LX 1UNSA 1WVLA 1WJJA 1CQVA 1SLJA 1C8CA 2OTLA 4X3KA 2IHFA 4LAAA 2K7VA 2E2IB 4YWKA 2R7DA 1H9MA 1S5DD 2ALYB 5TSSA 3PO3H 1RD9D 1IBKL 3PO2B 2AMCB 3BDOA 2KEEA 2NN6I 1A0IA 1TS2A 1WTRA 1XNRQ 1EQQA 1EY5A 2E75C 3I73A 2UXBQ 1XTDA 1IBMQ 1UE1A 4RWSC 4JI1L 4DU9A 3KJOA 2B2TC 2AQ3B 2A69C 1CA6A 5HURA 4DR3L 3J7AV 3HP3A 2IHEA 1C7YA 5CV5A 3M85A 1VQ7A 2NTSA 2H4OA 4DV3Q 1WTXA 1A15A 2K01A 4ZYSA 3PIO3 1KIXA 1TWAH 2B63H 1S4ZA 4A3MB 3I2ZA 3HKZB 2K4KA 4DV5L 5GQOA 1MIUA 4CDEC 4AQYL 2KCNA 1SDFA 5DNFA 4HSVA 4DN4M 5JEAG 4C3IH 3CC4A 3M9BA 1MBYA 1KAWA 4QF4A 3C3LA 3K59A 4IOAA 5IGCA 4DA2A 3CCRA 4X64Q 2Z0SA 1A3VA 2M2LA 1KC8C 2KQ3A 5IYCH 4BY7B 4X66L 2R7FA 2SOBA 5FLMG 2CQOA 4F7XA 3QWNA 3VYUA 5JEAJ 3T13A 1JWSD 1EY7A 2PI2E 2NYZD 1N33Q 1EWCA 2RCNA 3K5MA 1E22A 3ND8A 4QUCA 1IHZA 2EYJA 2DY8A 2Q2HA 3I91A 5GAEC 1GKHA 1GUNA 2NBFA 1HNXQ 5C3EH 3DWQA 2F0PA 2G9HD 5EKKA 3NUCA 1S5BD 1TS4A 4P71A 2OWOA 1CZWA 4A3LH 2PZTA 4YCUA 2HIXA 1W3SA 4IUNA 3FHWA 1VCIA 2A69D 1K3RA 3FKIH 3SGIA 5KYIA 4QJFA 3URYA 3T53B 3CU7A 1I5FA 2EY2A 1AEXA 3N52A 4Y7NH 2R93H 3PQIA 1AN8A 1SNQA 3CAMA 1H9RA 2A8VA 4K14A 5C0XH 1N36L 1IBLL 3EBEA 4G7ZC 3LWUA 5FLXc 2JA8H 4C3HH 5FO9B 4DR1L 3MWYW 4IO9A 4A3BH 4TVAB 2J7ZA 4CKCA 1E0BA 4PZ7A 3RD4A 2IL8A 4GNXA 5DM63 1TWHH 1VS0A 4CGYB 4K0KL 2UXDL 5L37A 3E3XA 2WB1G 4JI6L 3A74A 1HRJA 4N8X1 5JEAH 3DWPA 3OW7A 2Z8LA 2I0QA 3S2DH 1NE3A 4JI8L 4B3RQ 2K50A 2NVXH 1E2ZA 2VZAA 4IN3A 3H94A 1STHA 5CV4A 3RLFA 3RN5A 4LF4L 1S40A 4HN7A 1STGA 5KGUA 3CXCA 4XYOA 2K5DA 2E76C 4JBJA 2WINB 5M3FG 1JE4A 3T56B 3CMEA 5JVG3 2F3WA 2RA4A 2XRSD 2ZXOA 2F0HA 5DEHA 2OXPA 4AYBE 1T5EA 1X6OA 4HCEA 2NZ1D 4R1JA 1VQ9A 5C5LA 4K8IA 3S1RH 5E4XA 3I55A 1MJEA 1MHWC 3J7A5 3UI2A 2HUGA 3K8AA 1TWAB 1IBLQ 1VQAA 3KOJA 2MHVA 3GTGB 1MSGA 5FJ8H 4ALPA 3CQZH 2YU9H 1TWGH 3W5OA 1YEZA 3A8IE 5C6AA 3S16H 2HHHL 1FYCA 1Z7TA 2OF1A 4KY7A 3P75A 4G7OC 1JB3A 4GN4B 4DR5Q 1HHVA 4AYBB 4A3MG 2F4VL 1EY8A 4X62Q 3SK8A 2H5XA 1PH1A 2CHBD 3P20A 2OEOA 1G6PA 1DGSA 1V8QA 4DAMA 1B44D 4OELB 5DLQE 4I7AA 5C3WA 3U9OA 5D14A 3NQTA 4HMIA 1R9TH 1K28A 3TSSA 2A68C 2B2YC 2B63G 2BE5C 1EEID 4GLAC 4A3GG 4UHVA 2QEXA 3SHLA 4POFA 3J80c 2PNRC 1PMRA 3GV3A 1XWEA 1LACA 3CQZB 3QG1A 4A3CG 2K75A 5CV7A 3HOYB 1KLUD 1R4QB 2PW5A 1GUTA 3ICEA 2FXQA 2PQAB 5KNDA 3MAQA 3RMHA 2F03A 3S2HH 1ZYRC 3IFTA 3MXNA 3S1RB 1YBYA 1NAPA 4F87A 1BF4A 4DV5Q 3T1YL 1PH8A 4JI2L 1TS5A 3C1FA 3G6JB 4L5TA 1BOSA 1EZ6A 2QKIC 1N9WA 1P8LA 3VR6A 3KBGA 3J7YW 4RGOS 1AH9A 1F2ZA 4PNYA 4B3TL 5JJKA 5LHY1 3OWEB 4KKSA 4ZAIA 3HOUG 3K80C 1TKWB 1XNRL 1RL2A 1IBKQ 4A93H 1JC7A 2BCOA 4HIMA 3J80i 1EU3A 2L11A 3HOZH 1HNZL 4IUVA 2B2WA 2RDHA 3HOVH 1HA6A 5C0XG 1U4RA 3O13A 4DXFA 1EU4A 2R93G 4E6IA 2R92G 1PTOF 4RGNA 4U673 1EIHA 2PYKA 2ZTEA 3KF8B 4A3DB 2A68D 4KK7A 3KYHC 2WKDA 3G71A 4NPSA 3QOLA 3OSOA 4TRDA 3FEWX 1KABA 2OTJA 1PH4A 2VQEL 1JCKB 2H1EA 5I6YA 2VW9A 1J5EL 2VXWA 5GAGC 1PH6A 2RSOA 4FF3A 1AFPA 1L2FA 2L15A 4M1UB 5CV8A 1PH9A 1PYWD 1V1PA 5EBDA 5IYDG 5I6WA 3VR4A 1VQNA 3WOEA 4B3ML 5CMDA 4KMUC 5G3LD 3OIQA 4CJ0B 2RDFA 3S2HB 4MZ9A 5IE8A 2E2JH 1D2BA 4A3FG 2YV5A 2WB1E 4IUUA 3NWSA 4JYAL 2KEDA 1KRSA 1PTOC 3K81C 3RZOH 3PMFA 2HCIA 5H1SE 2XGTA 3TP8A 5D3DA 4JI5Q 1YJWA 4KN7C 2WACA 1JB7A 2KOLA 4C56C 4JI4L 3NSWA 2YTYA 4X3SA 1X3PA 1PH3A 3OMGA 2XSCA 2R3ZA 4YIJA 1PZJD 1A2UA 2ZTDA 1TU2B 2L55A 2O5IC 4K5XA 1XTCD 1JT8A 4HSPA 4P74A 1ESRA 1UUPA 4NXNQ 2HD3A 5JJLA 5FO7B 3AQQA 2O4XA 4JBWA 2F0QA 1JWMD 1I4QA 3SE0A 3VR5A 1NJIC 1J9OA 3T1YQ 2JA7G 2A6HD 1G2TA 1L0XB 2JN4A 3HOXG 2MJ8A 1B9NA 3HEJA 4A3JG 5I4DA 4JV5Q 1SRUA 4KLKA 3DXJC 4PZ8A 5C4JB 3H3VC 4JYAQ 4XQNA 2OQKA 1IL8A 4XTCS 5C44G 2ZTCA 1XJVA 1B8AA 1TWCB 3A55A 3R93A 4IPCA 5FLXE 3GDEA 1FNVA 4TSSA 3ZYYX 4KHVA 1HNWQ 1EQTA 4CBVA 1SNCA 4EQNA 2NVYB 2VQEQ 1HJPA 3ND9A 4YCVA 3PV0A 1CM9A 2DY7A 4EQOA 5D3IB 1Q46A 1STBA 3I72A 5IP7H 2K03A 3OYYA 4OX9Q 4N9TA 4GKJL 3Q24A 3I8ZA 5EKIA 1E1OA 2NTTA 1VMPA 1Y1WG 1NR4A 4KY5A 1NY4A 1ICFB 4DFAA 3KK7A 3LWEA 5M3MG 1V1QA 4WJ4A 5DM73 3MTSA 1HNZQ 3KDFA 2JEBI 3KLRA 4JVZA 4C2MH 3FKIG 3MFYA 4WRDA 2E5LQ 3F2UA 1X3FA 4RHRA 1X3GA 3E9IA 3OTOQ 3BS1A 3TZUA 1YNJC 1K8MA 1BUVT 4C3IG 4CDFC 1XPOA 2BH2A 1WCMG 3ERSX 5M5YH 2F0EA 1EWIA 2M9VA 4G7HC 2EXDA 4BY7G 3MEHA 1TWHB 4GN5A 2J0TD 3HOVG 1O7IA 3EN2A 4DV7L 3A8JE 1CHQD 4BBRG 5EQ0A 4WORA 1HZBA 1QWYA 2IPKD 1S5CD 4CDCC 2F0TA 2Y0SE 1Q82C 1ASYA 4OEMB 5J3BA 4A3DH 1PH5A 2VY3A 1U9RA 3TMEA 4AIMA 5IOCA 5JVH3 2K52A 1CZGA 3A5ZB 2C35B 1BBXC 4FDBA 1DM0B 5ELDA 1HUNA 4KD3A 4DKAC 3T16A 3Q0AA 1K83B 2DNCA 1S5FD 1F9SA 1U4LA 2PQAA 4A93B 1T5XD 3AU7A 1PRTF 5KEEA 4ID6A 2J4XA 3ZJYC 2G5DA 4UY8C 4HJAA 5LL6X 5EKLA 4RCNA 4OWXB 4BY1G 5BN3A 1EOVA 2HQLA 3RNUA 2EY6A 3QJYA 3NEMA 1JR0D 4C3JB 3PUYA 1HTPA 5CBAE 1A63A 3KF6B 4TKOB 2Q2UA 1YNNC 2GVAA 4X62L 2D0PA 5IP9H 1LTTD 1HFGA 4A3IG 1IYVA 4R4TA 4JBKA 3KFUA 1GO3E 4KHPQ 2X69A 4UP8A 1B70B 3GTMH 4A3LG 4GKKQ 3PF5A 2HIVA 4DV6L 1PV4A 1WI5A 4LFBL 2B2VC 4I65A 4HIDA 2EOTA 1QNUA 3K5OA 3AFPA 4JBMA 3KLSX 2F0UA 5IYBG 2EJMA 1DONA 3KF8A 4KJOA 1F2LA 1JOKA 1SJHD 4KHPL 1N32Q 2FJ2A 2AWNA 3KLWA 3SK6A 4IUQA 2F0VA 4HMJA 2RQXA 1KAAA 3ULLA 2B39A 4BXXG 3BU2A 1UE7A 3D4DA 4NXML 5ELNA 1K3BC 1P16A 1XNQQ 1KNAA 2K28A 4EGVA 3JAMi 3GTJH 1V1PB 1L1OC 1RTOA 5A2QL 2F4IA 1VQEA 2EYLA 2PMZB 3TN2A 2D9UA 1CQFA 3AYHB 2ES2A 4R4IA 1VQCA 3BVZA 1PLFA 2I5MX 3GTOB 2F0MA 4A3KG 1B2TA 1PZID 5FK9C 4NB3A 3GTPB 3J81j 4IFDG 2UUCQ 3CCQA 4X3UA 1KDCA 3TP5A 5ELBA 1BBUA 1LTID 3RZDB 3MXGA 4ZK9B 1OXSC 2IWHA 3M7GA 5M3FH 2KHJA 3KUPA 1VQPA 3NENA 2PZWA 2R61A 5C0XI 4RCOA 2N78A 2EYMA 3H0GG 2M00A 1VQFA 5HGTA 2B2UA 4V0BA 3NHHA 1Y14B 3S16B 3DM3A 3IAYA 4OIKA 2NN6G 5EJWA 1QZHA 3UDIA 2IW3A 3BVMA 5C4ZA 1EOTA 3KLSA 4JG2A 1CTMA 2KCCA 2DNEA 4IQZA 4XIGS 2ZJQA 4HIKA 3GTMB 4JOIC 1HR0Q 1QZGA 1X3QA 3TREA 3K6OA 3D31A 3Q23A 2TMPA 3BZCA 1LYLA 3UDGA 4FYDA 3CPFA 1CK1A 3TDQA 2EY5A 1KL9A 3UDFA 1C4QA 1QVCA 1JJ2A 2F3VA 2F1MA 4A3GB 3HKZG 5KNCA 5FLXL 2NWGA 1KXLA 4C3JH 5LMNQ 3BJUA 4QGUA 5JJZA 3BYYB 1SYGA 2F0FA 5JAVA 4IUTA 1H9KA 4GLVB 4C3HG 4ZUJA 2K5HA 4HEDA 2WFWA 4DV4L 3HOWG 3KJPA 2QW7A 1ESFA 4PMWA 1GJXA 1WFQA 3CHBD 3L7ZC 1SAPA 1BVSA 1KDAA 2UXCL 4GNXB 1D7QA 1RCVD 1BCPF 2FFKB 1SSOA 4KHZA 4QY7A 1K73C 3S2DB 1CA5A 2Q2IA 1EQVA 2JA8B 1YJ9A 1EWHA 2VS1A 2AUJD 4X64L 1PH7A 4XQJA 1G91A 2CFMA 2NZOA 3EVQA 4DV2L 4RAUC 2EQSA 1A62A 2L4NA 2MFIA 1LTSD 2CVRA 1HQMC 3R3OA 3PUWA 2VQFQ 2PNHA 2GA4B 1C48A 3HG9A 1UE5A 4JI0L 3MXPA 1CFMA 4A3IB 1IKLA 5M5YB 2D0OA 3GTLH 3OMCA 3WDNA 2E74C 4N8FA 3K7AH 1QB5D 2PO4A 4OO1I 1NMFA 5KNBA 5C44B 2VUMB 4JI1Q 3Q8DA 2RHSB 1Q12A 4LF7L 4WJ3M 2OQ0A 1BDOA 2JA7H 1X32A 4BY7H 3BVGA 2VQFL 5JPMC 3W1BA 1RODA 2NVTB 1X56A 5KYLA 1SE3A 4QB4A 1LM0A 2BH8A 1PDQA 3VA5A 1RTNA 1K8OA 1BR9A 3VR3A 2ZM6L 2QA4A 1FL0A 3GTGH 3NELA 4FXGC 4QIWB 1JOQA 3W3AA 2HCCA 1STYA 5LMNW 4L8JA 1Q7YC 2LSSA 2FMCA 1STEA 1I6HB 3T1HQ 1Y1WH 4JW0A 3SK5A 3M4OH 4J8QA 4PMCA 1JICA 1A6XA 4C3IB 1IXRA 1WCMB 4DV2Q 2MQHA 1ET9A 3A8KE 5M3FB 3PUXA 4DV0Q 1A2TA 1LUZA 2WKCA 3C1EA 3I4MH 3M3YB 2PPBC 2MNAA 1Y1VH 2N55A 3D8GA 4DV1Q 2JJQA 3MFGA 5CYUA 2B3GA 2RCFA 5J22A 2RBMA 1O80A 3FPPA 1XXGA 2EJFC 2VUMH 4OIJA 5BR8Q 4FF1A 3J81L 3IKJA 4A75A 3D0FA 4G4KA 1G2SA 1WD0A 1WTOA 4EX5A 3JAMc 1STNA 4A76A 2JA6G 4KJNA 1MD2D 1ZKOA 1YNND 3NPPA 3HOWH 1CSQA 3I3CA 4LF9L 3HOZG 2AQ1B 1N34L 3PO2H 1K8GA 1EYAA 4X65Q 4MTKA 1I6VC 2B8GA 2F0LA 2BOSA 3GQBA 2K5QA 3NBHA 4B08A 3I4MB 2L9HA 3K58A 4WFN3 1X54A 4QMGA 3PIOA 2IT1A 1B9MA 1A3TA 4CKEA 4HAEA 2UU9L 1KHIA 2D5DA 3ULPA 4H7BA 1CKMA 3NTKA 4L63B 1O78A 3R8BA 1I6HH 1IL2A 3K5LA 1M90C 3H09A 5T1GA 5CC4A 2TSSA 4J1MA 1GUGA 3D6CA 3NP8A 3E0JA 2R6GA 3I4LA 1G6ZA 2LMCB 1I50B 4OWWB 3K57A 1NSNS 1BNZA 1KDBA 3HKZE 4A3FH 2IX3A 5K36G 5C3EB 2I5HA 5AJ3L 3PF4A 1B4OA 3SK4A 2NVTH 2AUKA 4XT3B 2EPBA 2ICEC 5LMUL 1Y8PB 3P1HA 5IT9L 1LTRD 4A3GH 3MA2B 5IY0A 2O5JC 2N3SA 4IFDH 4A3EH 1STAA 4ZCKA 4KTAA 1JOOA 4OO1G 1V1OA 3TS0A 2NVYH 4P75A 4YWMA 3L9AX 5IYBH 4CKBA 1TR5A 1GXDC 4K2LA 3X3MA 4AH6A 2D2CC 4JCVE 2DN8A 2R92H 2F0WA 1Q3LA 3BG3A 1WTHA 4H0LC 1SNPA 5J39A 2AWOA 3HGBA 1KTKA 3MHBA 1EFID 4CHTB 1ICWA 3NK9A 1HCZA 4ME5A 3T4AC 4GKKL 2N49A 2XWBB 1SE4A 2F0OA 4GN3B 3HFZB 2B2WC 1N32L 3CP0A 1WTPA 1EYCA 4YCWA 4ULLA 4BBSH 1HA5A 2CH4W 5ELCA 1XMQL 3HOUH 3GTKB 1EYDA 1U4MA 3MVVA 1U4PA 1FNWA 3VYTA 4DNIA 4C3HB 3S15H 2UUAQ 5EPJA 4C1NI 1O7YA 1UWVA 1Q1BA 2MP1A 1IYUA 2Q8RE 4DR2L 4S3SA 4LF4Q 2WIIB 1SXTA 4N9PA 4L5RC 4KV6A 1X9NA 4RMFA 3TS2A 1SE2A 1X55A 1NR2A 3LGJA 4JI8Q 1FR3A 4J6HA 5AJ3Q 4IUPA 1K8AC 3HOUB 4RKBA 5C5MA 1HQRD 4JOIA 4K0KQ 4BY1H 4DK3C 4IFDI 4ODGA 1ENFA 4LUZA 2YYZA 1I3QB 5JOBA 3EIVA 3CC2A 4GOPA 2A6ED 2KUMA 3PUVA 1SNMA 5HGQA 3U4VA 1EIGA 1SE8A 4IZ8A 4ILWA 3IFDA 4GOPB 1QVFA 2MO0A 3F2DA 4RGTA 1GVPA 1CUKA 2B2TA 1VQMA 5E7NA 1HXYD 2E5LL 4A3EB 1PTOD 2CQAA 4DV7Q 5ELFA 3OWFA 2JP1A 4BBRB 5FO8B 2JA8G 2RF4A 3J7AF 2SEBD 4RHSA 5T1IA 3AB9A 1J8IA 4DAYA 2L12A 4A3JB 5FJ8G 2BDNA 5A2QE 1RJTA 2RVLA 3V96A 4ME3A 5A35A 3FP9A 4DUYQ 1W6KA 1HFNA 3A7LA 1S3OA 1XX8A 3DUZA 2FINB 4NP5A 3U50C 1PVOA 2FMMA 1DOKA 1D5ZC 3GD7A 4M8AA 1YVCA 1ONLA 2X6LA 4HJ9A 1VQIA 1HNWL 5D65A 3OHXC 2K05A 2WP8J 4XXEA 4RGMA 1UE6A 2LS01 2ZXRA 3CRLC 3RLOA 3BDCA 1VQ4A 1HTLD 1S5ED 2Y0SG 3MEFA 3TQYA 4EQ5A 2EE1A 1R4PB 3V2TA 1GD7A 4LFAQ 3S1QH 5KRUA 3TP6A 4GOPC 4KY6A 3GTKH 1PTOB 4OXPA 2E2JB 4YWLA 3CMAA 3VA7A 2Z1CA 3HRZC 3QB3A 2HT1A 2Z4HA 5IP7G 1Q81C 5FLMH 3VDYA 3S17B 4J15A 2K1BA 3DEOA 3BYTB 2ZM6Q 3G6EA 1F2YA 1FGBD 1SROA 1K0SA 3CCMA 2UUBL 4DAPA 4EQPA 1QILA 5NUCA 4NXNL 4LJZC 2KENA 4HJ7A 3F1ZA 4FP5D 1GOZA 1IBML 3C2PA 4C2MB 4JK1C 4DNTB 1SFOH 4KN4C 3D4RA 4A3JH 3HOVB 2L1BA 2XIWA 1Z6HA 4BBRH 5IGFA 1UEBA 2BE5D 3EROA 3PCOB 1TIID 5IYDH 3ITPA 1B1ZA 2YU9B 5E1FA 1YNJD 1QG7A 2K6AA 1D5MC 1MSHA 1I50H 5COYA 1I94L 4JI4Q 3A54A 3F8TA 4O1NA 2O2LD 4P2CB 2F0SA 4A3KH 1WYDA 4DR7L 2E8GA 1PYSB 2KA7A 4MIUA 1PA6A 3CCJA 4O0AA 3A5UA 3BZKA 3MZ5A 4O2DA 1QJOA 4GS3A 2EYOA 1QCBD 1QUQB 3VYRA 1VQOA 3NBIA 5E4WC 5GADC 2NB0A 1SBBB 2WAQB 3QIAA 4DUZL 3J80L 2V1CC 1ENCA 2Z6KA 2XTIA 3T51B 3I70A 3GTPH 1Q8IA 2EIFA 5JJIA 2IX0A 1I3QH 4DR7Q 2KECA 1EQRA 4Z9CB 1H95A 3H91A 1SNDA 2AHOB 3SVMA 1V43A 1AE2A 5I9OA 1E24A 2PCFB 3K7AB 2LFNA 1JQYD 1JWUD 2IY5B 1R9TB 3L3OC 2A74C 3CCVA 1DYQA 4OGQC 2MO1A 1QE6A 3PO3B 4DR4Q 5FKAC 4R4OA 4RKLA 5EGTA 1EY4A 2A19A 1Q90A 3B6YA 1SYDA 4JI3Q 1FNUA 1Y1VB 1NCVA 4LWCA 3CW2C 1EYGA 2EVBA 2OCEA 1YNXA 2EYFA 2HDLA 4V190 1NBWA 3HS0C 3L2PA 1X3EA 4B9WA 1HR0L 3A0JA 3DHQA 4B3TQ 2VB2X 4A3CH 4FF2A 3F2CA 1CHPD 4Y7NB 1KRTA 2PI2A 5M3MB 1NUCA 1TWFH 2AQ2B 2MPMA 5CV6A 4FXDA 3FKIB 2EY1A 4HJ8A 5BN4A 5CORA 3ULJA 1PH2A 1CKOA 5IWAQ 1EFWA 1LT6D 1ZXTA 1EL0A 1HUMA 5F2DA 3H15A 1EUJA 1EY9A 2BA1A 3UE1A 1D8LA 1ET6A 1YIJA 2UUCL 1I4XA 3HOZB 4APVA 3KDFB 4LNQA 4IJHA 4PMBA 4QL5A 3DMUA 1LT3D 1TY2A 3WWVA 2IX1A 4H13C 4BXXH 1LT5D 1RKNA 1SYCA 4DR2Q 5K5PA 1SFOB 1DXMA 2JXMB 2EXZA 3ONAB 3RN2A 1C0AA 4LFCL 2ZT9C 3J81c 2ATWA 4MNOA 1PYBA 1SYFA 2K04A 2A6HC 4NDXA 1PFSA 1PFBA 1RDPD 2JE6I 3CKIB 2MUYA 3CD6A 4PQXA 4PG3A 5M9OA 2VUMG 1LT4D 3QR8A 2R7ZG 5G3LF 1A8VA 2F4VQ 2KJXA 1J6QA 3M4PA 4A3EG 3TRZA 4DR5L 1E2WA 3RLNA 3G7LA 3FMCA 1YITA 2HHHQ 4ZRZA 4K5WA 5C3XA 1VQ6A 1LTGD 4TQUS 4A3MH 3RZOB 1PXUA 2F0JA 5GROA 1Y8NB 5C4XH 1M8AA 5EAYA 4XDXA 1ZYRD 2SNMA 4LF8Q 1YHQA 4LFBQ 3HOWB 4DV6Q 1LLRD 1VDZA 1D1IA 2A5HA 5IGBA 4LFCQ 1Q8KA 1HR0W 4H44C 2JA5B 4DXGA 4EVOA 2MGSA 2F3IA 2DUDA 2Q2TA 1BCPC 1L0WA 3CCSA 1X65A 4HJ5A 1I4HA 4CJ1B 1WTWA 2VB3X 1C9OA 1BCPB 1U0LA 2DJFC 3L0OA 3STBC 3M3YH 1HZCA 1DJRD 5C0XJ 4ZKBB 2EZVA 4ZQ3A 4JI6Q 1EIFA 3Q6SA 3C46A 2EYPA 4ZKCB 5IIFA 3HOXH 1ASZA 4QCLA 4XQQA 1KLGD 4AYBG 4R8NA 3DEPA 4DR1Q 1HPCA 2XN9C 2F0GA 5KIXA 2UU9Q 4RFBA 5IGGA 3E9HA 2UUAL 2ENBA 4F88A 2XVSA 4LF8L 4IJLA 1EEFD 3EQLC 3OPOA 3I56A 1VQJA 1WCMH 4DF7A 2QILA 4U68A 1DD2A 4LUOA 4ZLTF 5C4JH 2SDFA 1M4VA 3CCEA 4JI3L 1LABA 5DAUA 2RHQB 1L0YB 1PRTB 3UE0A 4YY3L 3DWAA 4A3BG 1GUOA 4A3KB 4DR4L 4DK6C 2ZJPA 1WOCA 4LF9Q 3RZDH 3CRKC 1N36Q 2Y0SB 3S14H 3PSIA 1L1OB 1QUQA 1LO5D 3OTOL 3OOCA 3AEVA 4BBSG 1SYEA 3J81i 2NVQH 3DLLA 2B8FA 3H0GB 2YTVA 3NE5B 1L1OA 4L5QA 4RH6A 1OO9B 2FHTA 3TP7A 4HCSA 1LV9A 2L0CA 3I4NH 2Z9HA 3DM1A 5GAHC 1B3AA 4IOCA 1YHBA 2WB1B 2DJGC 4K2KA 1HNXL 5AFWA 2XNAC 5M5XH 1NMGA 5LMUQ 4NKLA 4JPBW 1T9HA 2JSOA 3D4WA 5C3EG 1H9SA 3H3VH 4MHEA 2RSNA 1FGUA 5C4XB 5C44H 1JORA 2ICIA 1D1KA 1EZ8A 1H9JA 5I9PA 2K14A 3R2IA 3VYSA 3T1HL 4OO1H 2JA5H 2LXKA 1RHPA 2F0NA 3GP7A 3K5NA 4X66Q 1I4GA 2G9DA 3S9WA 4F8MA 3S1MB 1NNXA 1SR3A 3GO5A 3IRBA 1CSPA 1YI2A 4NW2A 1BKBA 3S1QB 1UEAB 4KD4A 5M5WB 4BA1I 4AQYQ 1GUSA 1BQQT 1VF5C 3RUZA 2N88A 4POGA 3S1NB 1QNKA 3GV6A 3PO3G 3D6WA 3CC7A 1Z9FA 2LXJA 5ISRA 2EJGC 1SN8A 1WTVA 4Q5VA 2CCZA 2KVMA 1IYJB 2C9OA 4LF7Q 4X65L 2QDLA 4IPDA 1NTGA 2QEJC 1N34Q 1QOHA 1PFNA 4DR3Q 2RKSA 4CDDC 2YTXA 4LW1A 2UUBQ 4LMQD 4R4QA 4A3FB 2ASBA 2KHSA 3FDTA 3IL8A 3S14B 1II3A 4JI7L 5CGKA 2UXBL 1FJGQ 1GUWA 5BR8L 1AZPA 2Z6KC 4YHHQ 2K32A 3EFXD 3AMUA 3FVQA 3FPUB 1TWCH 4JI5L 4DV1L 2WAQE 1E2VA 2JA6H 1AW7A 1Y69U 3JC66 1VMCA 1SMYC 1EY6A 4ZUIA 1BO0A 3SXHA 4OONA 2VNUD 1PZKD 3HOYH 4L6TB 4K6DA 1J5EQ 1O7ZA 1Y1VG 1HZAA 1AZQA 1ML0D 2B2YA 1Y8OB 4CJ2C 3SDZA 4JI7Q 1G51A 1W6JA
chains in the Genus database with same CATH topology
3RLOA 4Y7NH 4DUYL 1P16A 1VQ4A 1XNQQ 2KCMA 3CAMA 2Y0SG 3TQYA 3MEFA 4EQ5A 1K0RA 2A8VA 4BA2I 3JAMi 3GTJH 1GD7A 4H02A 4LFAQ 1N36L 3EBEA 1IBLL 1CKNA 3S1QH 2B29A 1L1OC 4GOPC 5FLXc 2JA8H 3GTKH 4C3HH 1VQEA 1LTLA 4OXPA 4YWLA 5IP9G 3CMAA 3NBHB 3J7ZC 3OW2A 2HT1A 5IP7G 1VQKA 3AYHB 2ES2A 1Q81C 5FLMH 4DR1L 3VDYA 3K7UC 4R4IA 1VQCA 3CF5A 3PUZA 4IO9A 4A3BH 4TVAB 4J15A 3GTOH 4PZ7A 2I5MX 2E2IH 4GNXA 1TWHH 4A3KG 1VS0A 4NB3A 3G6EA 3J81j 2ZM6Q 3F2BA 1SROA 1YJNA 2WB1G 4IFDG 2UUCQ 3CCQA 3CCMA 2UUBL 2UXDL 4JI6L 3A74A 4NXNL 1N8RC 2KENA 1BBUA 4HJ7A 3F1ZA 4LF5Q 1MJCA 1OXSC 2I0QA 5M3FH 3M4QA 3S2DH 2KHJA 1NE3A 4IPHA 4JI8L 1VQPA 4B3RQ 3NENA 2K50A 5C0XI 1IBML 2NVXH 2N78A 1SFOH 2VZAA 3H0GG 1VQFA 4JI2Q 1XMOL 4JI0Q 4A3JH 1Y14B 3DM3A 3RLFA 4X6AH 3RN5A 4LF4L 3PO2G 2NN6G 1S40A 3RR5A 4BBRH 1QZHA 3UDIA 1UEBA 1HZ9A 3CXCA 2VUMH 3PCOB 4GNXC 4JBJA 4JG2A 4LFAL 4XIGS 5IYDH 1VQBA 4HIKA 5M3FG 1Q86C 2ZJQA 4JOIC 1HR0Q 3HKSA 3CMEA 3TREA 2PMZE 1QZGA 3D31A 1LYLA 1I50H 3BZCA 3UDGA 3CPFA 1I94L 4AYBE 1X6OA 4JI4Q 3F8TA 1KL9A 3UDFA 4R1JA 4A3KH 1QVCA 1WYDA 2QGQA 2E8GA 1JJ2A 1PYSB 3MXNB 1VQ9A 4DR7L 1PA6A 2GVBA 3HKZG 2UXBQ 3S1RH 3CCJA 4O0AA 3I4MG 3A5UA 4HIOA 3BZKA 1KXLA 4C3JH 4O2DA 5LMNQ 3BJUA 4GS3A 4QGUA 3I55A 1VQ5A 1MJEA 1QUQB 3J7A5 1VQOA 1TXYA 3H3VI 3K8AA 3I4OA 1VQAA 3KOJA 1IBLQ 5GADC 4GLVB 2K5HA 4DV4L 2WFWA 5FJ8H 1K83H 4ALPA 3HOWG 3KJPA 3CQZH 4DUZL 4DV4Q 1TWGH 2YU9H 2JEAI 3W5OA 1YEZA 2V1CC 4PMWA 4IFDJ 1WFQA 4A3IH 2Z6KA 3L7ZC 2XTIA 3S16H 1XMQQ 1BVSA 2HHHL 2BA0A 5LMNL 2UXCL 3GTQH 4YY3Q 4PZ6A 1E7ZA 4GN4B 4GNXB 2EIFA 4DR5Q 3GTPH 2IX0A 4A4IA 4A3MG 4KHZA 5JJIA 1I3QH 2F4VL 1D7QA 3U58A 4DR7Q 4X62Q 4QY7A 1K73C 2Q2IA 1W2BA 1EQRA 2H5XA 4DPGA 1PH1A 1H95A 1G6PA 1K9MC 1YJ9A 2AHOB 2VS1A 1DGSA 1V43A 1AE2A 2KHIA 1E24A 4DAMA 4X64L 1PH7A 2CFMA 2IY5B 2D62A 2NZOA 5DLQE 4DV2L 4Y52H 2ZJRA 1OXTA 3S1MH 3CCVA 1RIPA 2EQSA 1AE3A 1A62A 2MO1A 1R9TH 1PHJA 4DR4Q 2MFIA 4R4OA 2A19A 2B63G 1U5KA 3PUWA 1OXUA 2VQFQ 3B6YA 1VQLA 2PNHA 4GLAC 1KQSA 4JI3Q 3M7NA 4LWCA 4A3GG 2QEXA 3CW2C 1UE5A 1EYGA 4JI0L 2OCEA 1YNXA 3I7FA 4POFA 3J80c 1NBWA 2D0OA 3GTLH 4A3CG 3L2PA 2K75A 1X3EA 1HR0L 3K7AH 3A0JA 4B3TQ 3G4SA 4OO1I 1E1TA 4A3DG 1NMFA 4B3SL 3ICEA 2CWPA 4A3CH 2FXQA 2VL6A 4LUVA 2PQAB 3F2CA 3E0EA 4JI1Q 3Q8DA 3S2HH 2N8NA 4UP9A 1KRTA 2RHSB 2PI2A 1Q12A 4LF6Q 4LF7L 1YBYA 4WJ3M 2OQ0A 2KCTA 1CKNB 1TWFH 2JA7H 3G48A 4DV5Q 1VQDA 1VQHA 1VQGA 3H0GH 4HJ8A 3T1YL 3ULJA 1PH2A 1PH8A 4JI2L 4BY7H 2VQFL 1CKOA 3W1BA 4LF6L 5IWAQ 1EFWA 4UPAA 4L5TA 4B3RL 1N9WA 1X56A 3H15A 1LM0A 1P8LA 2BH8A 4B3SQ 1EUJA 1AH9A 2BA1A 3UE1A 4B3TL 1D8LA 3UDXA 5JJKA 1YIJA 1XNQL 2UUCL 4UP7A 3HOUG 2ZM6L 3K80C 1FL0A 3KDFB 4APVA 2QA4A 4IJHA 4QL5A 4LNQA 4NXMQ 3GTGH 3STBD 3NELA 1XNRL 3WWVA 2E2HH 2IX1A 1RL2A 1IBKQ 4A93H 5LMNW 4P73A 1SMXA 1Q7YC 4BXXH 4DR2Q 2LSSA 4HIMA 3J80i 3T1HQ 3HOZH 1HNZL 1Y1WH 3RN2A 2R93H 1C0AA 3HOVH 4LFCL 5C0XG 3J81c 2ATWA 4MNOA 1PYBA 3M4OH 2R93G 1PFSA 2R92G 2JE6I 3PIPA 1IXRA 4DV2Q 2MQHA 3CD6A 2ZTEA 1GM5A 3KF8B 4L5SA 2CKZB 3KYHC 3PUXA 3G71A 4NPSA 4PG3A 2VUMG 4DV0Q 1LUZA 3CCLA 3I4MH 1XPUA 2R7ZG 1MKHA 3ER0A 1Y1VH 3K0XA 2MNAA 2OTJA 4DV1Q 1A8VA 2JJQA 1PH4A 2F4VQ 2B3GA 4A3EG 1J6QA 3M4PA 2VQEL 3TRZA 4DR5L 2VW9A 3RLNA 1J5EL 4QIWE 1YITA 5GAGC 1PH6A 2HHHQ 4P72A 1VQ6A 2DGYA 4TQUS 5BR8Q 4A3MH 1L2FA 4A75A 2L15A 1PH9A 4DV0L 5GROA 1BBWA 5IYDG 3D0FA 1IZ6A 5C4XH 5IYCG 5EAYA 4RG1A 1VQNA 4B3ML 4EX5A 3S1NH 4GKJQ 4QQBX 4MZ9A 5IE8A 3JAMc 2E2JH 4OX9L 4LF8Q 4A3FG 2YV5A 4A76A 2WB1E 4IPGA 1YHQA 2JA6G 4JYAL 4DV6Q 1EIYB 1KRSA 1N33L 3HOWH 1B7YB 1CSQA 3K81C 4LF9L 3HOZG 3RZOH 4OWTB 4GLXA 5H1SE 1N34L 2XGTA 4LFCQ 3PO2H 1K8GA 1Q8KA 1HR0W 4X65Q 4JI5Q 5IWAL 1YJWA 4A93G 2F3IA 2DUDA 2Q2TA 1JB7A 1L0WA 1OXVA 1Q1EA 2NZHA 1X65A 3CCSA 4JI4L 3CCUA 2YTYA 4HJ5A 1XMOQ 1PH3A 1YHAA 3S17H 5ELOA 1C9OA 1U0LA 2ZTDA 1X54A 3L0OA 1JJCB 2F52A 3PIOA 3CPWA 3STBC 2IT1A 3M3YH 1JT8A 1OXXK 1HZCA 4P74A 5C0XJ 4NXNQ 2JA9A 4KI0A 2UU9L 1KHIA 4JI6Q 4JV5L 5JJLA 1V9PA 4R4CA 1CKMA 3ULPA 1EIFA 3AQQA 1G291 1I6HH 4JBWA 1IL2A 5IT9c 1M90C 1NJIC 1FVIA 3T1YQ 2JA7G 3HOXH 2R6GA 2K5NA 4DAYB 1ASZA 4AYBG 2K5VA 4DR1Q 1S72A 3HOXG 4DV3L 4A3JG 4OWWB 3HKZE 4A3FH 2UU9Q 4JV5Q 2AKWB 1SRUA 4KLKA 4PZ8A 3E9HA 1KD1C 4LF5L 2KBNA 2UUAL 5K36G 2WAQG 4JYAQ 5C4XG 2A1AA 2I5HA 2ID0A 5AJ3L 1Z47A 1M1KC 2OQKA 4LF8L 4IJLA 4XTCS 3PF4A 2NVTH 3PGZA 5C44G 1HH2P 2ZTCA 3I56A 1B8AA 1XJVA 1VQJA 1WCMH 5LMUL 4IPCA 4A3GH 4LUOA 3GDEA 5IY0A 2N3SA 5C4JH 4LFBQ 4A3EH 3CCEA 2JA5G 1HNWQ 4JI3L 4OO1G 2RHQB 2R7ZH 3TS0A 2NVYH 4P75A 4YWMA 2VQEQ 5IYBH 1HJPA 3S24A 3UE0A 4YY3L 4YCVA 4A3BG 4NXML 3PV0A 4DR4L 4DK6C 2ZJPA 1JE5A 4AH6A 1WOCA 1Q46A 4LF9Q 4MTNA 3RZDH 5IP7H 4JCVE 1N36Q 2JK8A 2R92H 3OYYA 4OX9Q 2GN5A 3S14H 1JMCA 3PSIA 3W1GA 4DUZQ 4GKJL 1L1OB 3U4ZA 4B3MQ 1E1OA 1QUQA 5HY6A 1OTCA 2AWOA 5M5WH 1Y1WG 3OTOL 3AEVA 4BBSG 3J81i 2NVQH 1NY4A 3TEHB 3DLLA 1XPRA 4DR6L 4GKKL 2N49A 2YTVA 3AFQA 1L1OA 1YZ6A 1V1QA 5M3MG 3I4NG 4L5QA 4WJ4A 2JQOA 1HNZQ 3KDFA 1E3PA 2JEBI 4GN3B 3HFZB 4C2MH 1JJGA 2CWAA 3KF6A 3FKIG 5M3MH 3I4NH 1N32L 3CP0A 2UXCQ 4YCWA 5GAHC 4YHHL 4BBSH 1VQ8A 1XMQL 3HOUH 2E5LQ 4IOCA 4DR6Q 4JC0A 1X3FA 1I94Q 1FJGL 1YHBA 1HNXL 1X3GA 3E9IA 5M5XH 3OTOQ 1NMGA 5LMUQ 3HOYG 1QVGA 1T9HA 2I5LX 1XPOA 2BH2A 4DNIA 5C3EG 1WCMG 3H3VH 3ERSX 1WJJA 1FGUA 5M5YH 1SLJA 2OTLA 3S15H 5C44H 2IHFA 1EWIA 2UUAQ 4YWKA 2K14A 1UWVA 2R7DA 1Q1BA 2EXDA 4BY7G 3T1HL 2JA5H 2ALYB 2LXKA 4GN5A 4DR2L 3HOVG 1O7IA 3EN2A 4DV7L 4LF4Q 3PO3H 4BBRG 1IBKL 2AMCB 2NN6I 4X66Q 1HZBA 4L5RC 1A0IA 1XNRQ 1X9NA 1EQQA 4RMFA 3TS2A 2Y0SE 1Q82C 1XTDA 1ASYA 1SR3A 1IBMQ 3GO5A 5J3BA 1X55A 3LGJA 1UE1A 1CSPA 2VY3A 3IRBA 4JI8Q 4AIMA 4JI1L 1YI2A 3KJOA 1PH5A 2K52A 5AJ3Q 1K8AC 3A5ZB 2C35B 4DR3L 1BKBA 4FDBA 2IHEA 1C7YA 4DKAC 3M85A 4BA1I 1VQ7A 4AQYQ 4POGA 4JOIA 4DV3Q 4K0KQ 4BY1H 3PO3G 4DK3C 1KIXA 4IFDI 1TWAH 2B63H 3CC7A 1Z9FA 2PQAA 2LXJA 4LUZA 4A3DH 3I2ZA 2K4KA 4DV5L 1SN8A 2YYZA 5GQOA 2CCZA 3EIVA 1MIUA 1IYJB 3CC2A 4LF7Q 3ZJYC 4GOPA 4X65L 4UY8C 4IPDA 4HJAA 4AQYL 3PUVA 1NTGA 5HGQA 4OWXB 3U4VA 1N34Q 5JEAG 4C3IH 4BY1G 3RNUA 1EOVA 2HQLA 3M9BA 3CC4A 1SE8A 4DR3Q 1KAWA 2YTXA 3NEMA 4GOPB 4IOAA 1QVFA 4LW1A 2MO0A 3F2DA 2UUBQ 4R4QA 1GVPA 2ASBA 1CUKA 3PUYA 3CCRA 4X64Q 1VQMA 4JI7L 2UXBL 2Z0SA 5E7NA 1A63A 3KF6B 1FJGQ 1KC8C 5IYCH 4X66L 2R7FA 5BR8L 2E5LL 2Q2UA 2Z6KC 5FLMG 2GVAA 2CQOA 4X62L 4YHHQ 4DV7Q 2D0PA 5IP9H 4JI5L 1TWCH 5JEAJ 4A3IG 2JA8G 4R4TA 2RF4A 4JBKA 3KFUA 1GO3E 4DV1L 4KHPQ 2WAQE 4UP8A 2PI2E 1B70B 2JA6H 3GTMH 4A3LG 4GKKQ 4K0KL 5FJ8G 1N33Q 3PF5A 2HIVA 4DV6L 1PV4A 1WI5A 3JC66 4LFBL 2RCNA 1E22A 4ME3A 4HIDA 3FP9A 4DUYQ 3AFPA 2Q2HA 5GAEC 4JBMA 1GKHA 1HNXQ 5C3EH 5IYBG 1S3OA 3U50C 1PVOA 4OONA 2VNUD 4P71A 2OWOA 3HOYH 4KHPL 2UXDQ 1N32Q 3GD7A 4A3LH 2AWNA 3KLWA 1J5EQ 1Y1VG 1YVCA 4YCUA 1HZAA 2HIXA 1W3SA 4HJ9A 1VQIA 1HNWL 3FHWA 1VCIA 3FKIH 1K3RA 3SGIA 3ULLA 4BXXG 3BU2A 4QJFA 1UE7A 2WP8J 4JI7Q 1I5FA 1G51A 1UE6A 5ELNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLO A;  4Y7N H;  4DUY L;  1P16 A;  1VQ4 A;  1XNQ Q;  2KCM A;  3CAM A;  2Y0S G;  3TQY A;  3MEF A;  4EQ5 A;  1K0R A;  2A8V A;  4BA2 I;  3JAM i;  3GTJ H;  1GD7 A;  4H02 A;  4LFA Q;  1N36 L;  3EBE A;  1IBL L;  1CKN A;  3S1Q H;  2B29 A;  1L1O C;  4GOP C;  5FLX c;  2JA8 H;  3GTK H;  4C3H H;  1VQE A;  1LTL A;  4OXP A;  4YWL A;  5IP9 G;  3CMA A;  3NBH B;  3J7Z C;  3OW2 A;  2HT1 A;  5IP7 G;  1VQK A;  3AYH B;  2ES2 A;  1Q81 C;  5FLM H;  4DR1 L;  3VDY A;  3K7U C;  4R4I A;  1VQC A;  3CF5 A;  3PUZ A;  4IO9 A;  4A3B H;  4TVA B;  4J15 A;  3GTO H;  4PZ7 A;  2I5M X;  2E2I H;  4GNX A;  1TWH H;  4A3K G;  1VS0 A;  4NB3 A;  3G6E A;  3J81 j;  2ZM6 Q;  3F2B A;  1SRO A;  1YJN A;  2WB1 G;  4IFD G;  2UUC Q;  3CCQ A;  3CCM A;  2UUB L;  2UXD L;  4JI6 L;  3A74 A;  4NXN L;  1N8R C;  2KEN A;  1BBU A;  4HJ7 A;  3F1Z A;  4LF5 Q;  1MJC A;  1OXS C;  2I0Q A;  5M3F H;  3M4Q A;  3S2D H;  2KHJ A;  1NE3 A;  4IPH A;  4JI8 L;  1VQP A;  4B3R Q;  3NEN A;  2K50 A;  5C0X I;  1IBM L;  2NVX H;  2N78 A;  1SFO H;  2VZA A;  3H0G G;  1VQF A;  4JI2 Q;  1XMO L;  4JI0 Q;  4A3J H;  1Y14 B;  3DM3 A;  3RLF A;  4X6A H;  3RN5 A;  4LF4 L;  3PO2 G;  2NN6 G;  1S40 A;  3RR5 A;  4BBR H;  1QZH A;  3UDI A;  1UEB A;  1HZ9 A;  3CXC A;  2VUM H;  3PCO B;  4GNX C;  4JBJ A;  4JG2 A;  4LFA L;  4XIG S;  5IYD H;  1VQB A;  4HIK A;  5M3F G;  1Q86 C;  2ZJQ A;  4JOI C;  1HR0 Q;  3HKS A;  3CME A;  3TRE A;  2PMZ E;  1QZG A;  3D31 A;  1LYL A;  1I50 H;  3BZC A;  3UDG A;  3CPF A;  1I94 L;  4AYB E;  1X6O A;  4JI4 Q;  3F8T A;  1KL9 A;  3UDF A;  4R1J A;  4A3K H;  1QVC A;  1WYD A;  2QGQ A;  2E8G A;  1JJ2 A;  1PYS B;  3MXN B;  1VQ9 A;  4DR7 L;  1PA6 A;  2GVB A;  3HKZ G;  2UXB Q;  3S1R H;  3CCJ A;  4O0A A;  3I4M G;  3A5U A;  4HIO A;  3BZK A;  1KXL A;  4C3J H;  4O2D A;  5LMN Q;  3BJU A;  4GS3 A;  4QGU A;  3I55 A;  1VQ5 A;  1MJE A;  1QUQ B;  3J7A 5;  1VQO A;  1TXY A;  3H3V I;  3K8A A;  3I4O A;  1VQA A;  3KOJ A;  1IBL Q;  5GAD C;  4GLV B;  2K5H A;  4DV4 L;  2WFW A;  5FJ8 H;  1K83 H;  4ALP A;  3HOW G;  3KJP A;  3CQZ H;  4DUZ L;  4DV4 Q;  1TWG H;  2YU9 H;  2JEA I;  3W5O A;  1YEZ A;  2V1C C;  4PMW A;  4IFD J;  1WFQ A;  4A3I H;  2Z6K A;  3L7Z C;  2XTI A;  3S16 H;  1XMQ Q;  1BVS A;  2HHH L;  2BA0 A;  5LMN L;  2UXC L;  3GTQ H;  4YY3 Q;  4PZ6 A;  1E7Z A;  4GN4 B;  4GNX B;  2EIF A;  4DR5 Q;  3GTP H;  2IX0 A;  4A4I A;  4A3M G;  4KHZ A;  5JJI A;  1I3Q H;  2F4V L;  1D7Q A;  3U58 A;  4DR7 Q;  4X62 Q;  4QY7 A;  1K73 C;  2Q2I A;  1W2B A;  1EQR A;  2H5X A;  4DPG A;  1PH1 A;  1H95 A;  1G6P A;  1K9M C;  1YJ9 A;  2AHO B;  2VS1 A;  1DGS A;  1V43 A;  1AE2 A;  2KHI A;  1E24 A;  4DAM A;  4X64 L;  1PH7 A;  2CFM A;  2IY5 B;  2D62 A;  2NZO A;  5DLQ E;  4DV2 L;  4Y52 H;  2ZJR A;  1OXT A;  3S1M H;  3CCV A;  1RIP A;  2EQS A;  1AE3 A;  1A62 A;  2MO1 A;  1R9T H;  1PHJ A;  4DR4 Q;  2MFI A;  4R4O A;  2A19 A;  2B63 G;  1U5K A;  3PUW A;  1OXU A;  2VQF Q;  3B6Y A;  1VQL A;  2PNH A;  4GLA C;  1KQS A;  4JI3 Q;  3M7N A;  4LWC A;  4A3G G;  2QEX A;  3CW2 C;  1UE5 A;  1EYG A;  4JI0 L;  2OCE A;  1YNX A;  3I7F A;  4POF A;  3J80 c;  1NBW A;  2D0O A;  3GTL H;  4A3C G;  3L2P A;  2K75 A;  1X3E A;  1HR0 L;  3K7A H;  3A0J A;  4B3T Q;  3G4S A;  4OO1 I;  1E1T A;  4A3D G;  1NMF A;  4B3S L;  3ICE A;  2CWP A;  4A3C H;  2FXQ A;  2VL6 A;  4LUV A;  2PQA B;  3F2C A;  3E0E A;  4JI1 Q;  3Q8D A;  3S2H H;  2N8N A;  4UP9 A;  1KRT A;  2RHS B;  2PI2 A;  1Q12 A;  4LF6 Q;  4LF7 L;  1YBY A;  4WJ3 M;  2OQ0 A;  2KCT A;  1CKN B;  1TWF H;  2JA7 H;  3G48 A;  4DV5 Q;  1VQD A;  1VQH A;  1VQG A;  3H0G H;  4HJ8 A;  3T1Y L;  3ULJ A;  1PH2 A;  1PH8 A;  4JI2 L;  4BY7 H;  2VQF L;  1CKO A;  3W1B A;  4LF6 L;  5IWA Q;  1EFW A;  4UPA A;  4L5T A;  4B3R L;  1N9W A;  1X56 A;  3H15 A;  1LM0 A;  1P8L A;  2BH8 A;  4B3S Q;  1EUJ A;  1AH9 A;  2BA1 A;  3UE1 A;  4B3T L;  1D8L A;  3UDX A;  5JJK A;  1YIJ A;  1XNQ L;  2UUC L;  4UP7 A;  3HOU G;  2ZM6 L;  3K80 C;  1FL0 A;  3KDF B;  4APV A;  2QA4 A;  4IJH A;  4QL5 A;  4LNQ A;  4NXM Q;  3GTG H;  3STB D;  3NEL A;  1XNR L;  3WWV A;  2E2H H;  2IX1 A;  1RL2 A;  1IBK Q;  4A93 H;  5LMN W;  4P73 A;  1SMX A;  1Q7Y C;  4BXX H;  4DR2 Q;  2LSS A;  4HIM A;  3J80 i;  3T1H Q;  3HOZ H;  1HNZ L;  1Y1W H;  3RN2 A;  2R93 H;  1C0A A;  3HOV H;  4LFC L;  5C0X G;  3J81 c;  2ATW A;  4MNO A;  1PYB A;  3M4O H;  2R93 G;  1PFS A;  2R92 G;  2JE6 I;  3PIP A;  1IXR A;  4DV2 Q;  2MQH A;  3CD6 A;  2ZTE A;  1GM5 A;  3KF8 B;  4L5S A;  2CKZ B;  3KYH C;  3PUX A;  3G71 A;  4NPS A;  4PG3 A;  2VUM G;  4DV0 Q;  1LUZ A;  3CCL A;  3I4M H;  1XPU A;  2R7Z G;  1MKH A;  3ER0 A;  1Y1V H;  3K0X A;  2MNA A;  2OTJ A;  4DV1 Q;  1A8V A;  2JJQ A;  1PH4 A;  2F4V Q;  2B3G A;  4A3E G;  1J6Q A;  3M4P A;  2VQE L;  3TRZ A;  4DR5 L;  2VW9 A;  3RLN A;  1J5E L;  4QIW E;  1YIT A;  5GAG C;  1PH6 A;  2HHH Q;  4P72 A;  1VQ6 A;  2DGY A;  4TQU S;  5BR8 Q;  4A3M H;  1L2F A;  4A75 A;  2L15 A;  1PH9 A;  4DV0 L;  5GRO A;  1BBW A;  5IYD G;  3D0F A;  1IZ6 A;  5C4X H;  5IYC G;  5EAY A;  4RG1 A;  1VQN A;  4B3M L;  4EX5 A;  3S1N H;  4GKJ Q;  4QQB X;  4MZ9 A;  5IE8 A;  3JAM c;  2E2J H;  4OX9 L;  4LF8 Q;  4A3F G;  2YV5 A;  4A76 A;  2WB1 E;  4IPG A;  1YHQ A;  2JA6 G;  4JYA L;  4DV6 Q;  1EIY B;  1KRS A;  1N33 L;  3HOW H;  1B7Y B;  1CSQ A;  3K81 C;  4LF9 L;  3HOZ G;  3RZO H;  4OWT B;  4GLX A;  5H1S E;  1N34 L;  2XGT A;  4LFC Q;  3PO2 H;  1K8G A;  1Q8K A;  1HR0 W;  4X65 Q;  4JI5 Q;  5IWA L;  1YJW A;  4A93 G;  2F3I A;  2DUD A;  2Q2T A;  1JB7 A;  1L0W A;  1OXV A;  1Q1E A;  2NZH A;  1X65 A;  3CCS A;  4JI4 L;  3CCU A;  2YTY A;  4HJ5 A;  1XMO Q;  1PH3 A;  1YHA A;  3S17 H;  5ELO A;  1C9O A;  1U0L A;  2ZTD A;  1X54 A;  3L0O A;  1JJC B;  2F52 A;  3PIO A;  3CPW A;  3STB C;  2IT1 A;  3M3Y H;  1JT8 A;  1OXX K;  1HZC A;  4P74 A;  5C0X J;  4NXN Q;  2JA9 A;  4KI0 A;  2UU9 L;  1KHI A;  4JI6 Q;  4JV5 L;  5JJL A;  1V9P A;  4R4C A;  1CKM A;  3ULP A;  1EIF A;  3AQQ A;  1G29 1;  1I6H H;  4JBW A;  1IL2 A;  5IT9 c;  1M90 C;  1NJI C;  1FVI A;  3T1Y Q;  2JA7 G;  3HOX H;  2R6G A;  2K5N A;  4DAY B;  1ASZ A;  4AYB G;  2K5V A;  4DR1 Q;  1S72 A;  3HOX G;  4DV3 L;  4A3J G;  4OWW B;  3HKZ E;  4A3F H;  2UU9 Q;  4JV5 Q;  2AKW B;  1SRU A;  4KLK A;  4PZ8 A;  3E9H A;  1KD1 C;  4LF5 L;  2KBN A;  2UUA L;  5K36 G;  2WAQ G;  4JYA Q;  5C4X G;  2A1A A;  2I5H A;  2ID0 A;  5AJ3 L;  1Z47 A;  1M1K C;  2OQK A;  4LF8 L;  4IJL A;  4XTC S;  3PF4 A;  2NVT H;  3PGZ A;  5C44 G;  1HH2 P;  2ZTC A;  3I56 A;  1B8A A;  1XJV A;  1VQJ A;  1WCM H;  5LMU L;  4IPC A;  4A3G H;  4LUO A;  3GDE A;  5IY0 A;  2N3S A;  5C4J H;  4LFB Q;  4A3E H;  3CCE A;  2JA5 G;  1HNW Q;  4JI3 L;  4OO1 G;  2RHQ B;  2R7Z H;  3TS0 A;  2NVY H;  4P75 A;  4YWM A;  2VQE Q;  5IYB H;  1HJP A;  3S24 A;  3UE0 A;  4YY3 L;  4YCV A;  4A3B G;  4NXM L;  3PV0 A;  4DR4 L;  4DK6 C;  2ZJP A;  1JE5 A;  4AH6 A;  1WOC A;  1Q46 A;  4LF9 Q;  4MTN A;  3RZD H;  5IP7 H;  4JCV E;  1N36 Q;  2JK8 A;  2R92 H;  3OYY A;  4OX9 Q;  2GN5 A;  3S14 H;  1JMC A;  3PSI A;  3W1G A;  4DUZ Q;  4GKJ L;  1L1O B;  3U4Z A;  4B3M Q;  1E1O A;  1QUQ A;  5HY6 A;  1OTC A;  2AWO A;  5M5W H;  1Y1W G;  3OTO L;  3AEV A;  4BBS G;  3J81 i;  2NVQ H;  1NY4 A;  3TEH B;  3DLL A;  1XPR A;  4DR6 L;  4GKK L;  2N49 A;  2YTV A;  3AFQ A;  1L1O A;  1YZ6 A;  1V1Q A;  5M3M G;  3I4N G;  4L5Q A;  4WJ4 A;  2JQO A;  1HNZ Q;  3KDF A;  1E3P A;  2JEB I;  4GN3 B;  3HFZ B;  4C2M H;  1JJG A;  2CWA A;  3KF6 A;  3FKI G;  5M3M H;  3I4N H;  1N32 L;  3CP0 A;  2UXC Q;  4YCW A;  5GAH C;  4YHH L;  4BBS H;  1VQ8 A;  1XMQ L;  3HOU H;  2E5L Q;  4IOC A;  4DR6 Q;  4JC0 A;  1X3F A;  1I94 Q;  1FJG L;  1YHB A;  1HNX L;  1X3G A;  3E9I A;  5M5X H;  3OTO Q;  1NMG A;  5LMU Q;  3HOY G;  1QVG A;  1T9H A;  2I5L X;  1XPO A;  2BH2 A;  4DNI A;  5C3E G;  1WCM G;  3H3V H;  3ERS X;  1WJJ A;  1FGU A;  5M5Y H;  1SLJ A;  2OTL A;  3S15 H;  5C44 H;  2IHF A;  1EWI A;  2UUA Q;  4YWK A;  2K14 A;  1UWV A;  2R7D A;  1Q1B A;  2EXD A;  4BY7 G;  3T1H L;  2JA5 H;  2ALY B;  2LXK A;  4GN5 A;  4DR2 L;  3HOV G;  1O7I A;  3EN2 A;  4DV7 L;  4LF4 Q;  3PO3 H;  4BBR G;  1IBK L;  2AMC B;  2NN6 I;  4X66 Q;  1HZB A;  4L5R C;  1A0I A;  1XNR Q;  1X9N A;  1EQQ A;  4RMF A;  3TS2 A;  2Y0S E;  1Q82 C;  1XTD A;  1ASY A;  1SR3 A;  1IBM Q;  3GO5 A;  5J3B A;  1X55 A;  3LGJ A;  1UE1 A;  1CSP A;  2VY3 A;  3IRB A;  4JI8 Q;  4AIM A;  4JI1 L;  1YI2 A;  3KJO A;  1PH5 A;  2K52 A;  5AJ3 Q;  1K8A C;  3A5Z B;  2C35 B;  4DR3 L;  1BKB A;  4FDB A;  2IHE A;  1C7Y A;  4DKA C;  3M85 A;  4BA1 I;  1VQ7 A;  4AQY Q;  4POG A;  4JOI A;  4DV3 Q;  4K0K Q;  4BY1 H;  3PO3 G;  4DK3 C;  1KIX A;  4IFD I;  1TWA H;  2B63 H;  3CC7 A;  1Z9F A;  2PQA A;  2LXJ A;  4LUZ A;  4A3D H;  3I2Z A;  2K4K A;  4DV5 L;  1SN8 A;  2YYZ A;  5GQO A;  2CCZ A;  3EIV A;  1MIU A;  1IYJ B;  3CC2 A;  4LF7 Q;  3ZJY C;  4GOP A;  4X65 L;  4UY8 C;  4IPD A;  4HJA A;  4AQY L;  3PUV A;  1NTG A;  5HGQ A;  4OWX B;  3U4V A;  1N34 Q;  5JEA G;  4C3I H;  4BY1 G;  3RNU A;  1EOV A;  2HQL A;  3M9B A;  3CC4 A;  1SE8 A;  4DR3 Q;  1KAW A;  2YTX A;  3NEM A;  4GOP B;  4IOA A;  1QVF A;  4LW1 A;  2MO0 A;  3F2D A;  2UUB Q;  4R4Q A;  1GVP A;  2ASB A;  1CUK A;  3PUY A;  3CCR A;  4X64 Q;  1VQM A;  4JI7 L;  2UXB L;  2Z0S A;  5E7N A;  1A63 A;  3KF6 B;  1FJG Q;  1KC8 C;  5IYC H;  4X66 L;  2R7F A;  5BR8 L;  2E5L L;  2Q2U A;  2Z6K C;  5FLM G;  2GVA A;  2CQO A;  4X62 L;  4YHH Q;  4DV7 Q;  2D0P A;  5IP9 H;  4JI5 L;  1TWC H;  5JEA J;  4A3I G;  2JA8 G;  4R4T A;  2RF4 A;  4JBK A;  3KFU A;  1GO3 E;  4DV1 L;  4KHP Q;  2WAQ E;  4UP8 A;  2PI2 E;  1B70 B;  2JA6 H;  3GTM H;  4A3L G;  4GKK Q;  4K0K L;  5FJ8 G;  1N33 Q;  3PF5 A;  2HIV A;  4DV6 L;  1PV4 A;  1WI5 A;  3JC6 6;  4LFB L;  2RCN A;  1E22 A;  4ME3 A;  4HID A;  3FP9 A;  4DUY Q;  3AFP A;  2Q2H A;  5GAE C;  4JBM A;  1GKH A;  1HNX Q;  5C3E H;  5IYB G;  1S3O A;  3U50 C;  1PVO A;  4OON A;  2VNU D;  4P71 A;  2OWO A;  3HOY H;  4KHP L;  2UXD Q;  1N32 Q;  3GD7 A;  4A3L H;  2AWN A;  3KLW A;  1J5E Q;  1Y1V G;  1YVC A;  4YCU A;  1HZA A;  2HIX A;  1W3S A;  4HJ9 A;  1VQI A;  1HNW L;  3FHW A;  1VCI A;  3FKI H;  1K3R A;  3SGI A;  3ULL A;  4BXX G;  3BU2 A;  4QJF A;  1UE7 A;  2WP8 J;  4JI7 Q;  1I5F A;  1G51 A;  1UE6 A;  5ELN A; 
#chains in the Genus database with same CATH topology
 2R93 B;  2JYO A;  4DUY L;  3SR1 A;  2KCM A;  4BA2 I;  5I2X A;  1K0R A;  3NWT A;  4H02 A;  2NUC A;  2A73 B;  4KKT A;  1CKN A;  1DZ1 A;  2B29 A;  5EPL A;  1LTL A;  5IP9 G;  3NBH B;  3J7Z C;  3OW2 A;  1EY0 A;  1VQK A;  3K7U C;  3CF5 A;  3PUZ A;  3GTO H;  1F9Q A;  1D6E C;  1CI3 M;  2E2I H;  5EBC A;  1YJN A;  3F2B A;  2IJ0 A;  3BDL A;  3QOJ A;  1N8R C;  1F77 A;  3M4O B;  4LF5 Q;  2NVQ B;  1MJC A;  1MI2 A;  1SJE D;  1TY0 A;  3M4Q A;  4IPH A;  1Y1W B;  5FOB B;  1H9S B;  1TT2 A;  1I4R A;  2B2V A;  4JI2 Q;  1XMO L;  4JI0 Q;  3E5S A;  4X6A H;  3PO2 G;  1TQO A;  2PW7 A;  3RR5 A;  1FD7 D;  4FF4 A;  1ILP A;  4K6L A;  1HZ9 A;  2I46 A;  4GNX C;  5E3F A;  4ABN A;  2E2H B;  5CV9 A;  4LFA L;  2JA6 B;  1VQB A;  1Q86 C;  1G8Z D;  4X3T A;  3HKS A;  2PMZ E;  1GHK A;  1BCP D;  1B3Q A;  3ERQ A;  2R7Z B;  5IOD A;  1B53 A;  2QGQ A;  3MXN B;  3PIP 3;  2JA7 B;  2GVB A;  3I4M G;  1RF2 D;  4HIO A;  1BXT A;  1VQ5 A;  2XRQ D;  3HOX B;  1TXY A;  3H3V I;  3I4O A;  1K83 H;  3D3R A;  4DV4 Q;  2JEA I;  3GTL B;  4IFD J;  4FVM A;  4RA8 A;  3X3N A;  4A3I H;  1KNE A;  2EDG A;  2WV6 D;  1XMQ Q;  2BA0 A;  5LMN L;  3EJI A;  3GTQ H;  4YY3 Q;  2K33 A;  2CH4 A;  1E7Z A;  4PZ6 A;  3TZD A;  4A4I A;  4K8J A;  2ZXP A;  1A3U A;  3U58 A;  1W2B A;  1LTB D;  4DPG A;  4A3B B;  1F9P A;  1K9M C;  1TWF B;  4XT1 B;  2KHI A;  4LK1 C;  1TVX A;  3P7J A;  2F0I A;  2D62 A;  4Y52 H;  2A6E C;  1OXT A;  4B9X A;  2OT2 A;  2ZJR A;  3S1M H;  1IW7 C;  1RIP A;  4MN3 A;  1AE3 A;  3NTI A;  2F0K A;  1PHJ A;  1LTA D;  3U9S A;  1UAP A;  3NXW A;  1U5K A;  1DOL A;  1OXU A;  4FNF A;  1VQL A;  1KQS A;  3M7N A;  1PTO H;  3KBX A;  2HDM A;  3I7F A;  3OIP A;  4K5V A;  4KKU A;  3R2T A;  3LNN A;  1D5X C;  3G4S A;  1E1T A;  4A3D G;  4B3S L;  2CWP A;  5CR3 A;  2VL6 A;  4LUV A;  3E0E A;  2N8N A;  4UP9 A;  2LY7 A;  3I4N B;  4LF6 Q;  2KCT A;  1CKN B;  3G48 A;  1VQD A;  1VQH A;  1VQG A;  1I4P A;  2PZU A;  3H0G H;  5C4H A;  2CW0 D;  4LF6 L;  4UPA A;  4B3R L;  4R9W A;  5IGD A;  2V4D A;  1CT1 D;  4B3S Q;  2QDB A;  3J80 E;  3UDX A;  2RDG A;  1XNQ L;  4UP7 A;  3WOF A;  1PFM A;  2UXD Q;  4NXM Q;  1SNO A;  2I07 B;  3STB D;  4UDU C;  3SEB A;  3M4Y A;  3NTH A;  2E2H H;  1SYB A;  4P73 A;  1SMX A;  2EYH A;  1XYI A;  3J81 E;  4DGZ A;  3FRP B;  3EA6 A;  4FO2 A;  4OHJ A;  4IAL A;  3PIP A;  3A56 A;  3A7A B;  2QCP X;  1GM5 A;  4L5S A;  2CKZ B;  4C3J G;  4QUF A;  1IKM A;  4XYQ A;  3CCL A;  1XPU A;  1AP0 A;  1MKH A;  3ER0 A;  3K0X A;  2BDO A;  1WTQ A;  2QF7 A;  2NVX B;  4QIW E;  2X6G A;  1F9R A;  4P72 A;  2DGY A;  2Q8T A;  4DV0 L;  5IGE A;  1BBW A;  3GTJ B;  1IZ6 A;  3S15 B;  1ZEQ X;  5IYC G;  4RG1 A;  4WJW A;  3S1N H;  4GKJ Q;  4QQB X;  4OX9 L;  2E2D C;  1VF7 A;  4IPG A;  4BS9 A;  1B50 A;  1EIY B;  1N33 L;  1B7Y B;  5J1Z A;  4OWT B;  4GLX A;  4UAI A;  2XWJ B;  1ENA A;  2CW0 C;  5IWA L;  4A93 G;  4BWG B;  2Z4I A;  1GHJ A;  1OXV A;  1Q1E A;  2NZH A;  3LX0 A;  3CCU A;  3HZX A;  1XMO Q;  1YHA A;  1SMY D;  3S17 H;  5ELO A;  1TWG B;  1DCZ A;  5EPK A;  1JJC B;  2F52 A;  3CPW A;  4GZY C;  2R92 B;  3H6M A;  2B2U C;  1OXX K;  1PRT C;  2JA9 A;  3TBI B;  4KI0 A;  2F0D A;  4DAV A;  4C1N K;  5IT9 E;  4JV5 L;  4BBS B;  1V9P A;  4R4C A;  1G29 1;  5K36 H;  3Q22 A;  1DOM A;  3V05 A;  5IT9 c;  5M5X B;  3GTQ B;  2Q8I B;  1WD1 A;  1FVI A;  3MXU A;  2K5N A;  4DAY B;  3JAM L;  3BZD B;  2NN6 H;  2K5V A;  1S72 A;  4DV3 L;  1SEB D;  4HR7 B;  3W2D A;  5JPN C;  2AKW B;  4DNR B;  1F2M A;  1KD1 C;  4LF5 L;  2KBN A;  2LKV A;  3N6R A;  2WAQ G;  3MC0 B;  2A1A A;  2ID0 A;  5ELE A;  4DK1 A;  1Z47 A;  1M1K C;  5C4X G;  3PGZ A;  4G57 A;  5BN5 A;  1HH2 P;  3E6Z X;  2L5T A;  3QO2 A;  4HTH A;  4FXK C;  2HQE A;  4I7Z C;  2SNS A;  3K0Y A;  1IW7 D;  2JA5 G;  5LL6 S;  4IUR A;  4Q0F A;  2R7Z H;  2P5Z X;  3S24 A;  5CBE E;  2PQE A;  1JE5 A;  4MTN A;  3VR2 A;  2JK8 A;  5I2Y A;  4R8I A;  2GN5 A;  1JMC A;  3W1G A;  4DUZ Q;  3U4Z A;  4B3M Q;  5HY6 A;  1OTC A;  5M5W H;  3I90 A;  4O42 A;  3TEH B;  1XPR A;  4DR6 L;  2C5C A;  3NQI A;  3AFQ A;  3I4N G;  1YZ6 A;  1TS3 A;  2JQO A;  2B63 B;  4NMZ A;  1E3P A;  4DK0 A;  2Z6B A;  3JAM E;  1ILQ A;  1JJG A;  2CWA A;  1O7L A;  3KF6 A;  5M3M H;  1MGS A;  4PV1 C;  2UXC Q;  2K5W A;  4YHH L;  1VQ8 A;  4OL7 A;  1PRT D;  4JC0 A;  1I94 Q;  4DR6 Q;  1FJG L;  3HOY G;  4BY1 B;  1QVG A;  2I5L X;  1UNS A;  1WVL A;  1WJJ A;  1CQV A;  1SLJ A;  1C8C A;  2OTL A;  4X3K A;  2IHF A;  4LAA A;  2K7V A;  2E2I B;  4YWK A;  2R7D A;  1H9M A;  1S5D D;  2ALY B;  5TSS A;  3PO3 H;  1RD9 D;  1IBK L;  3PO2 B;  2AMC B;  3BDO A;  2KEE A;  2NN6 I;  1A0I A;  1TS2 A;  1WTR A;  1XNR Q;  1EQQ A;  1EY5 A;  2E75 C;  3I73 A;  2UXB Q;  1XTD A;  1IBM Q;  1UE1 A;  4RWS C;  4JI1 L;  4DU9 A;  3KJO A;  2B2T C;  2AQ3 B;  2A69 C;  1CA6 A;  5HUR A;  4DR3 L;  3J7A V;  3HP3 A;  2IHE A;  1C7Y A;  5CV5 A;  3M85 A;  1VQ7 A;  2NTS A;  2H4O A;  4DV3 Q;  1WTX A;  1A15 A;  2K01 A;  4ZYS A;  3PIO 3;  1KIX A;  1TWA H;  2B63 H;  1S4Z A;  4A3M B;  3I2Z A;  3HKZ B;  2K4K A;  4DV5 L;  5GQO A;  1MIU A;  4CDE C;  4AQY L;  2KCN A;  1SDF A;  5DNF A;  4HSV A;  4DN4 M;  5JEA G;  4C3I H;  3CC4 A;  3M9B A;  1MBY A;  1KAW A;  4QF4 A;  3C3L A;  3K59 A;  4IOA A;  5IGC A;  4DA2 A;  3CCR A;  4X64 Q;  2Z0S A;  1A3V A;  2M2L A;  1KC8 C;  2KQ3 A;  5IYC H;  4BY7 B;  4X66 L;  2R7F A;  2SOB A;  5FLM G;  2CQO A;  4F7X A;  3QWN A;  3VYU A;  5JEA J;  3T13 A;  1JWS D;  1EY7 A;  2PI2 E;  2NYZ D;  1N33 Q;  1EWC A;  2RCN A;  3K5M A;  1E22 A;  3ND8 A;  4QUC A;  1IHZ A;  2EYJ A;  2DY8 A;  2Q2H A;  3I91 A;  5GAE C;  1GKH A;  1GUN A;  2NBF A;  1HNX Q;  5C3E H;  3DWQ A;  2F0P A;  2G9H D;  5EKK A;  3NUC A;  1S5B D;  1TS4 A;  4P71 A;  2OWO A;  1CZW A;  4A3L H;  2PZT A;  4YCU A;  2HIX A;  1W3S A;  4IUN A;  3FHW A;  1VCI A;  2A69 D;  1K3R A;  3FKI H;  3SGI A;  5KYI A;  4QJF A;  3URY A;  3T53 B;  3CU7 A;  1I5F A;  2EY2 A;  1AEX A;  3N52 A;  4Y7N H;  2R93 H;  3PQI A;  1AN8 A;  1SNQ A;  3CAM A;  1H9R A;  2A8V A;  4K14 A;  5C0X H;  1N36 L;  1IBL L;  3EBE A;  4G7Z C;  3LWU A;  5FLX c;  2JA8 H;  4C3H H;  5FO9 B;  4DR1 L;  3MWY W;  4IO9 A;  4A3B H;  4TVA B;  2J7Z A;  4CKC A;  1E0B A;  4PZ7 A;  3RD4 A;  2IL8 A;  4GNX A;  5DM6 3;  1TWH H;  1VS0 A;  4CGY B;  4K0K L;  2UXD L;  5L37 A;  3E3X A;  2WB1 G;  4JI6 L;  3A74 A;  1HRJ A;  4N8X 1;  5JEA H;  3DWP A;  3OW7 A;  2Z8L A;  2I0Q A;  3S2D H;  1NE3 A;  4JI8 L;  4B3R Q;  2K50 A;  2NVX H;  1E2Z A;  2VZA A;  4IN3 A;  3H94 A;  1STH A;  5CV4 A;  3RLF A;  3RN5 A;  4LF4 L;  1S40 A;  4HN7 A;  1STG A;  5KGU A;  3CXC A;  4XYO A;  2K5D A;  2E76 C;  4JBJ A;  2WIN B;  5M3F G;  1JE4 A;  3T56 B;  3CME A;  5JVG 3;  2F3W A;  2RA4 A;  2XRS D;  2ZXO A;  2F0H A;  5DEH A;  2OXP A;  4AYB E;  1T5E A;  1X6O A;  4HCE A;  2NZ1 D;  4R1J A;  1VQ9 A;  5C5L A;  4K8I A;  3S1R H;  5E4X A;  3I55 A;  1MJE A;  1MHW C;  3J7A 5;  3UI2 A;  2HUG A;  3K8A A;  1TWA B;  1IBL Q;  1VQA A;  3KOJ A;  2MHV A;  3GTG B;  1MSG A;  5FJ8 H;  4ALP A;  3CQZ H;  2YU9 H;  1TWG H;  3W5O A;  1YEZ A;  3A8I E;  5C6A A;  3S16 H;  2HHH L;  1FYC A;  1Z7T A;  2OF1 A;  4KY7 A;  3P75 A;  4G7O C;  1JB3 A;  4GN4 B;  4DR5 Q;  1HHV A;  4AYB B;  4A3M G;  2F4V L;  1EY8 A;  4X62 Q;  3SK8 A;  2H5X A;  1PH1 A;  2CHB D;  3P20 A;  2OEO A;  1G6P A;  1DGS A;  1V8Q A;  4DAM A;  1B44 D;  4OEL B;  5DLQ E;  4I7A A;  5C3W A;  3U9O A;  5D14 A;  3NQT A;  4HMI A;  1R9T H;  1K28 A;  3TSS A;  2A68 C;  2B2Y C;  2B63 G;  2BE5 C;  1EEI D;  4GLA C;  4A3G G;  4UHV A;  2QEX A;  3SHL A;  4POF A;  3J80 c;  2PNR C;  1PMR A;  3GV3 A;  1XWE A;  1LAC A;  3CQZ B;  3QG1 A;  4A3C G;  2K75 A;  5CV7 A;  3HOY B;  1KLU D;  1R4Q B;  2PW5 A;  1GUT A;  3ICE A;  2FXQ A;  2PQA B;  5KND A;  3MAQ A;  3RMH A;  2F03 A;  3S2H H;  1ZYR C;  3IFT A;  3MXN A;  3S1R B;  1YBY A;  1NAP A;  4F87 A;  1BF4 A;  4DV5 Q;  3T1Y L;  1PH8 A;  4JI2 L;  1TS5 A;  3C1F A;  3G6J B;  4L5T A;  1BOS A;  1EZ6 A;  2QKI C;  1N9W A;  1P8L A;  3VR6 A;  3KBG A;  3J7Y W;  4RGO S;  1AH9 A;  1F2Z A;  4PNY A;  4B3T L;  5JJK A;  5LHY 1;  3OWE B;  4KKS A;  4ZAI A;  3HOU G;  3K80 C;  1TKW B;  1XNR L;  1RL2 A;  1IBK Q;  4A93 H;  1JC7 A;  2BCO A;  4HIM A;  3J80 i;  1EU3 A;  2L11 A;  3HOZ H;  1HNZ L;  4IUV A;  2B2W A;  2RDH A;  3HOV H;  1HA6 A;  5C0X G;  1U4R A;  3O13 A;  4DXF A;  1EU4 A;  2R93 G;  4E6I A;  2R92 G;  1PTO F;  4RGN A;  4U67 3;  1EIH A;  2PYK A;  2ZTE A;  3KF8 B;  4A3D B;  2A68 D;  4KK7 A;  3KYH C;  2WKD A;  3G71 A;  4NPS A;  3QOL A;  3OSO A;  4TRD A;  3FEW X;  1KAB A;  2OTJ A;  1PH4 A;  2VQE L;  1JCK B;  2H1E A;  5I6Y A;  2VW9 A;  1J5E L;  2VXW A;  5GAG C;  1PH6 A;  2RSO A;  4FF3 A;  1AFP A;  1L2F A;  2L15 A;  4M1U B;  5CV8 A;  1PH9 A;  1PYW D;  1V1P A;  5EBD A;  5IYD G;  5I6W A;  3VR4 A;  1VQN A;  3WOE A;  4B3M L;  5CMD A;  4KMU C;  5G3L D;  3OIQ A;  4CJ0 B;  2RDF A;  3S2H B;  4MZ9 A;  5IE8 A;  2E2J H;  1D2B A;  4A3F G;  2YV5 A;  2WB1 E;  4IUU A;  3NWS A;  4JYA L;  2KED A;  1KRS A;  1PTO C;  3K81 C;  3RZO H;  3PMF A;  2HCI A;  5H1S E;  2XGT A;  3TP8 A;  5D3D A;  4JI5 Q;  1YJW A;  4KN7 C;  2WAC A;  1JB7 A;  2KOL A;  4C56 C;  4JI4 L;  3NSW A;  2YTY A;  4X3S A;  1X3P A;  1PH3 A;  3OMG A;  2XSC A;  2R3Z A;  4YIJ A;  1PZJ D;  1A2U A;  2ZTD A;  1TU2 B;  2L55 A;  2O5I C;  4K5X A;  1XTC D;  1JT8 A;  4HSP A;  4P74 A;  1ESR A;  1UUP A;  4NXN Q;  2HD3 A;  5JJL A;  5FO7 B;  3AQQ A;  2O4X A;  4JBW A;  2F0Q A;  1JWM D;  1I4Q A;  3SE0 A;  3VR5 A;  1NJI C;  1J9O A;  3T1Y Q;  2JA7 G;  2A6H D;  1G2T A;  1L0X B;  2JN4 A;  3HOX G;  2MJ8 A;  1B9N A;  3HEJ A;  4A3J G;  5I4D A;  4JV5 Q;  1SRU A;  4KLK A;  3DXJ C;  4PZ8 A;  5C4J B;  3H3V C;  4JYA Q;  4XQN A;  2OQK A;  1IL8 A;  4XTC S;  5C44 G;  2ZTC A;  1XJV A;  1B8A A;  1TWC B;  3A55 A;  3R93 A;  4IPC A;  5FLX E;  3GDE A;  1FNV A;  4TSS A;  3ZYY X;  4KHV A;  1HNW Q;  1EQT A;  4CBV A;  1SNC A;  4EQN A;  2NVY B;  2VQE Q;  1HJP A;  3ND9 A;  4YCV A;  3PV0 A;  1CM9 A;  2DY7 A;  4EQO A;  5D3I B;  1Q46 A;  1STB A;  3I72 A;  5IP7 H;  2K03 A;  3OYY A;  4OX9 Q;  4N9T A;  4GKJ L;  3Q24 A;  3I8Z A;  5EKI A;  1E1O A;  2NTT A;  1VMP A;  1Y1W G;  1NR4 A;  4KY5 A;  1NY4 A;  1ICF B;  4DFA A;  3KK7 A;  3LWE A;  5M3M G;  1V1Q A;  4WJ4 A;  5DM7 3;  3MTS A;  1HNZ Q;  3KDF A;  2JEB I;  3KLR A;  4JVZ A;  4C2M H;  3FKI G;  3MFY A;  4WRD A;  2E5L Q;  3F2U A;  1X3F A;  4RHR A;  1X3G A;  3E9I A;  3OTO Q;  3BS1 A;  3TZU A;  1YNJ C;  1K8M A;  1BUV T;  4C3I G;  4CDF C;  1XPO A;  2BH2 A;  1WCM G;  3ERS X;  5M5Y H;  2F0E A;  1EWI A;  2M9V A;  4G7H C;  2EXD A;  4BY7 G;  3MEH A;  1TWH B;  4GN5 A;  2J0T D;  3HOV G;  1O7I A;  3EN2 A;  4DV7 L;  3A8J E;  1CHQ D;  4BBR G;  5EQ0 A;  4WOR A;  1HZB A;  1QWY A;  2IPK D;  1S5C D;  4CDC C;  2F0T A;  2Y0S E;  1Q82 C;  1ASY A;  4OEM B;  5J3B A;  4A3D H;  1PH5 A;  2VY3 A;  1U9R A;  3TME A;  4AIM A;  5IOC A;  5JVH 3;  2K52 A;  1CZG A;  3A5Z B;  2C35 B;  1BBX C;  4FDB A;  1DM0 B;  5ELD A;  1HUN A;  4KD3 A;  4DKA C;  3T16 A;  3Q0A A;  1K83 B;  2DNC A;  1S5F D;  1F9S A;  1U4L A;  2PQA A;  4A93 B;  1T5X D;  3AU7 A;  1PRT F;  5KEE A;  4ID6 A;  2J4X A;  3ZJY C;  2G5D A;  4UY8 C;  4HJA A;  5LL6 X;  5EKL A;  4RCN A;  4OWX B;  4BY1 G;  5BN3 A;  1EOV A;  2HQL A;  3RNU A;  2EY6 A;  3QJY A;  3NEM A;  1JR0 D;  4C3J B;  3PUY A;  1HTP A;  5CBA E;  1A63 A;  3KF6 B;  4TKO B;  2Q2U A;  1YNN C;  2GVA A;  4X62 L;  2D0P A;  5IP9 H;  1LTT D;  1HFG A;  4A3I G;  1IYV A;  4R4T A;  4JBK A;  3KFU A;  1GO3 E;  4KHP Q;  2X69 A;  4UP8 A;  1B70 B;  3GTM H;  4A3L G;  4GKK Q;  3PF5 A;  2HIV A;  4DV6 L;  1PV4 A;  1WI5 A;  4LFB L;  2B2V C;  4I65 A;  4HID A;  2EOT A;  1QNU A;  3K5O A;  3AFP A;  4JBM A;  3KLS X;  2F0U A;  5IYB G;  2EJM A;  1DON A;  3KF8 A;  4KJO A;  1F2L A;  1JOK A;  1SJH D;  4KHP L;  1N32 Q;  2FJ2 A;  2AWN A;  3KLW A;  3SK6 A;  4IUQ A;  2F0V A;  4HMJ A;  2RQX A;  1KAA A;  3ULL A;  2B39 A;  4BXX G;  3BU2 A;  1UE7 A;  3D4D A;  4NXM L;  5ELN A;  1K3B C;  1P16 A;  1XNQ Q;  1KNA A;  2K28 A;  4EGV A;  3JAM i;  3GTJ H;  1V1P B;  1L1O C;  1RTO A;  5A2Q L;  2F4I A;  1VQE A;  2EYL A;  2PMZ B;  3TN2 A;  2D9U A;  1CQF A;  3AYH B;  2ES2 A;  4R4I A;  1VQC A;  3BVZ A;  1PLF A;  2I5M X;  3GTO B;  2F0M A;  4A3K G;  1B2T A;  1PZI D;  5FK9 C;  4NB3 A;  3GTP B;  3J81 j;  4IFD G;  2UUC Q;  3CCQ A;  4X3U A;  1KDC A;  3TP5 A;  5ELB A;  1BBU A;  1LTI D;  3RZD B;  3MXG A;  4ZK9 B;  1OXS C;  2IWH A;  3M7G A;  5M3F H;  2KHJ A;  3KUP A;  1VQP A;  3NEN A;  2PZW A;  2R61 A;  5C0X I;  4RCO A;  2N78 A;  2EYM A;  3H0G G;  2M00 A;  1VQF A;  5HGT A;  2B2U A;  4V0B A;  3NHH A;  1Y14 B;  3S16 B;  3DM3 A;  3IAY A;  4OIK A;  2NN6 G;  5EJW A;  1QZH A;  3UDI A;  2IW3 A;  3BVM A;  5C4Z A;  1EOT A;  3KLS A;  4JG2 A;  1CTM A;  2KCC A;  2DNE A;  4IQZ A;  4XIG S;  2ZJQ A;  4HIK A;  3GTM B;  4JOI C;  1HR0 Q;  1QZG A;  1X3Q A;  3TRE A;  3K6O A;  3D31 A;  3Q23 A;  2TMP A;  3BZC A;  1LYL A;  3UDG A;  4FYD A;  3CPF A;  1CK1 A;  3TDQ A;  2EY5 A;  1KL9 A;  3UDF A;  1C4Q A;  1QVC A;  1JJ2 A;  2F3V A;  2F1M A;  4A3G B;  3HKZ G;  5KNC A;  5FLX L;  2NWG A;  1KXL A;  4C3J H;  5LMN Q;  3BJU A;  4QGU A;  5JJZ A;  3BYY B;  1SYG A;  2F0F A;  5JAV A;  4IUT A;  1H9K A;  4GLV B;  4C3H G;  4ZUJ A;  2K5H A;  4HED A;  2WFW A;  4DV4 L;  3HOW G;  3KJP A;  2QW7 A;  1ESF A;  4PMW A;  1GJX A;  1WFQ A;  3CHB D;  3L7Z C;  1SAP A;  1BVS A;  1KDA A;  2UXC L;  4GNX B;  1D7Q A;  1RCV D;  1BCP F;  2FFK B;  1SSO A;  4KHZ A;  4QY7 A;  1K73 C;  3S2D B;  1CA5 A;  2Q2I A;  1EQV A;  2JA8 B;  1YJ9 A;  1EWH A;  2VS1 A;  2AUJ D;  4X64 L;  1PH7 A;  4XQJ A;  1G91 A;  2CFM A;  2NZO A;  3EVQ A;  4DV2 L;  4RAU C;  2EQS A;  1A62 A;  2L4N A;  2MFI A;  1LTS D;  2CVR A;  1HQM C;  3R3O A;  3PUW A;  2VQF Q;  2PNH A;  2GA4 B;  1C48 A;  3HG9 A;  1UE5 A;  4JI0 L;  3MXP A;  1CFM A;  4A3I B;  1IKL A;  5M5Y B;  2D0O A;  3GTL H;  3OMC A;  3WDN A;  2E74 C;  4N8F A;  3K7A H;  1QB5 D;  2PO4 A;  4OO1 I;  1NMF A;  5KNB A;  5C44 B;  2VUM B;  4JI1 Q;  3Q8D A;  2RHS B;  1Q12 A;  4LF7 L;  4WJ3 M;  2OQ0 A;  1BDO A;  2JA7 H;  1X32 A;  4BY7 H;  3BVG A;  2VQF L;  5JPM C;  3W1B A;  1ROD A;  2NVT B;  1X56 A;  5KYL A;  1SE3 A;  4QB4 A;  1LM0 A;  2BH8 A;  1PDQ A;  3VA5 A;  1RTN A;  1K8O A;  1BR9 A;  3VR3 A;  2ZM6 L;  2QA4 A;  1FL0 A;  3GTG H;  3NEL A;  4FXG C;  4QIW B;  1JOQ A;  3W3A A;  2HCC A;  1STY A;  5LMN W;  4L8J A;  1Q7Y C;  2LSS A;  2FMC A;  1STE A;  1I6H B;  3T1H Q;  1Y1W H;  4JW0 A;  3SK5 A;  3M4O H;  4J8Q A;  4PMC A;  1JIC A;  1A6X A;  4C3I B;  1IXR A;  1WCM B;  4DV2 Q;  2MQH A;  1ET9 A;  3A8K E;  5M3F B;  3PUX A;  4DV0 Q;  1A2T A;  1LUZ A;  2WKC A;  3C1E A;  3I4M H;  3M3Y B;  2PPB C;  2MNA A;  1Y1V H;  2N55 A;  3D8G A;  4DV1 Q;  2JJQ A;  3MFG A;  5CYU A;  2B3G A;  2RCF A;  5J22 A;  2RBM A;  1O80 A;  3FPP A;  1XXG A;  2EJF C;  2VUM H;  4OIJ A;  5BR8 Q;  4FF1 A;  3J81 L;  3IKJ A;  4A75 A;  3D0F A;  4G4K A;  1G2S A;  1WD0 A;  1WTO A;  4EX5 A;  3JAM c;  1STN A;  4A76 A;  2JA6 G;  4KJN A;  1MD2 D;  1ZKO A;  1YNN D;  3NPP A;  3HOW H;  1CSQ A;  3I3C A;  4LF9 L;  3HOZ G;  2AQ1 B;  1N34 L;  3PO2 H;  1K8G A;  1EYA A;  4X65 Q;  4MTK A;  1I6V C;  2B8G A;  2F0L A;  2BOS A;  3GQB A;  2K5Q A;  3NBH A;  4B08 A;  3I4M B;  2L9H A;  3K58 A;  4WFN 3;  1X54 A;  4QMG A;  3PIO A;  2IT1 A;  1B9M A;  1A3T A;  4CKE A;  4HAE A;  2UU9 L;  1KHI A;  2D5D A;  3ULP A;  4H7B A;  1CKM A;  3NTK A;  4L63 B;  1O78 A;  3R8B A;  1I6H H;  1IL2 A;  3K5L A;  1M90 C;  3H09 A;  5T1G A;  5CC4 A;  2TSS A;  4J1M A;  1GUG A;  3D6C A;  3NP8 A;  3E0J A;  2R6G A;  3I4L A;  1G6Z A;  2LMC B;  1I50 B;  4OWW B;  3K57 A;  1NSN S;  1BNZ A;  1KDB A;  3HKZ E;  4A3F H;  2IX3 A;  5K36 G;  5C3E B;  2I5H A;  5AJ3 L;  3PF4 A;  1B4O A;  3SK4 A;  2NVT H;  2AUK A;  4XT3 B;  2EPB A;  2ICE C;  5LMU L;  1Y8P B;  3P1H A;  5IT9 L;  1LTR D;  4A3G H;  3MA2 B;  5IY0 A;  2O5J C;  2N3S A;  4IFD H;  4A3E H;  1STA A;  4ZCK A;  4KTA A;  1JOO A;  4OO1 G;  1V1O A;  3TS0 A;  2NVY H;  4P75 A;  4YWM A;  3L9A X;  5IYB H;  4CKB A;  1TR5 A;  1GXD C;  4K2L A;  3X3M A;  4AH6 A;  2D2C C;  4JCV E;  2DN8 A;  2R92 H;  2F0W A;  1Q3L A;  3BG3 A;  1WTH A;  4H0L C;  1SNP A;  5J39 A;  2AWO A;  3HGB A;  1KTK A;  3MHB A;  1EFI D;  4CHT B;  1ICW A;  3NK9 A;  1HCZ A;  4ME5 A;  3T4A C;  4GKK L;  2N49 A;  2XWB B;  1SE4 A;  2F0O A;  4GN3 B;  3HFZ B;  2B2W C;  1N32 L;  3CP0 A;  1WTP A;  1EYC A;  4YCW A;  4ULL A;  4BBS H;  1HA5 A;  2CH4 W;  5ELC A;  1XMQ L;  3HOU H;  3GTK B;  1EYD A;  1U4M A;  3MVV A;  1U4P A;  1FNW A;  3VYT A;  4DNI A;  4C3H B;  3S15 H;  2UUA Q;  5EPJ A;  4C1N I;  1O7Y A;  1UWV A;  1Q1B A;  2MP1 A;  1IYU A;  2Q8R E;  4DR2 L;  4S3S A;  4LF4 Q;  2WII B;  1SXT A;  4N9P A;  4L5R C;  4KV6 A;  1X9N A;  4RMF A;  3TS2 A;  1SE2 A;  1X55 A;  1NR2 A;  3LGJ A;  4JI8 Q;  1FR3 A;  4J6H A;  5AJ3 Q;  4IUP A;  1K8A C;  3HOU B;  4RKB A;  5C5M A;  1HQR D;  4JOI A;  4K0K Q;  4BY1 H;  4DK3 C;  4IFD I;  4ODG A;  1ENF A;  4LUZ A;  2YYZ A;  1I3Q B;  5JOB A;  3EIV A;  3CC2 A;  4GOP A;  2A6E D;  2KUM A;  3PUV A;  1SNM A;  5HGQ A;  3U4V A;  1EIG A;  1SE8 A;  4IZ8 A;  4ILW A;  3IFD A;  4GOP B;  1QVF A;  2MO0 A;  3F2D A;  4RGT A;  1GVP A;  1CUK A;  2B2T A;  1VQM A;  5E7N A;  1HXY D;  2E5L L;  4A3E B;  1PTO D;  2CQA A;  4DV7 Q;  5ELF A;  3OWF A;  2JP1 A;  4BBR B;  5FO8 B;  2JA8 G;  2RF4 A;  3J7A F;  2SEB D;  4RHS A;  5T1I A;  3AB9 A;  1J8I A;  4DAY A;  2L12 A;  4A3J B;  5FJ8 G;  2BDN A;  5A2Q E;  1RJT A;  2RVL A;  3V96 A;  4ME3 A;  5A35 A;  3FP9 A;  4DUY Q;  1W6K A;  1HFN A;  3A7L A;  1S3O A;  1XX8 A;  3DUZ A;  2FIN B;  4NP5 A;  3U50 C;  1PVO A;  2FMM A;  1DOK A;  1D5Z C;  3GD7 A;  4M8A A;  1YVC A;  1ONL A;  2X6L A;  4HJ9 A;  1VQI A;  1HNW L;  5D65 A;  3OHX C;  2K05 A;  2WP8 J;  4XXE A;  4RGM A;  1UE6 A;  2LS0 1;  2ZXR A;  3CRL C;  3RLO A;  3BDC A;  1VQ4 A;  1HTL D;  1S5E D;  2Y0S G;  3MEF A;  3TQY A;  4EQ5 A;  2EE1 A;  1R4P B;  3V2T A;  1GD7 A;  4LFA Q;  3S1Q H;  5KRU A;  3TP6 A;  4GOP C;  4KY6 A;  3GTK H;  1PTO B;  4OXP A;  2E2J B;  4YWL A;  3CMA A;  3VA7 A;  2Z1C A;  3HRZ C;  3QB3 A;  2HT1 A;  2Z4H A;  5IP7 G;  1Q81 C;  5FLM H;  3VDY A;  3S17 B;  4J15 A;  2K1B A;  3DEO A;  3BYT B;  2ZM6 Q;  3G6E A;  1F2Y A;  1FGB D;  1SRO A;  1K0S A;  3CCM A;  2UUB L;  4DAP A;  4EQP A;  1QIL A;  5NUC A;  4NXN L;  4LJZ C;  2KEN A;  4HJ7 A;  3F1Z A;  4FP5 D;  1GOZ A;  1IBM L;  3C2P A;  4C2M B;  4JK1 C;  4DNT B;  1SFO H;  4KN4 C;  3D4R A;  4A3J H;  3HOV B;  2L1B A;  2XIW A;  1Z6H A;  4BBR H;  5IGF A;  1UEB A;  2BE5 D;  3ERO A;  3PCO B;  1TII D;  5IYD H;  3ITP A;  1B1Z A;  2YU9 B;  5E1F A;  1YNJ D;  1QG7 A;  2K6A A;  1D5M C;  1MSH A;  1I50 H;  5COY A;  1I94 L;  4JI4 Q;  3A54 A;  3F8T A;  4O1N A;  2O2L D;  4P2C B;  2F0S A;  4A3K H;  1WYD A;  4DR7 L;  2E8G A;  1PYS B;  2KA7 A;  4MIU A;  1PA6 A;  3CCJ A;  4O0A A;  3A5U A;  3BZK A;  3MZ5 A;  4O2D A;  1QJO A;  4GS3 A;  2EYO A;  1QCB D;  1QUQ B;  3VYR A;  1VQO A;  3NBI A;  5E4W C;  5GAD C;  2NB0 A;  1SBB B;  2WAQ B;  3QIA A;  4DUZ L;  3J80 L;  2V1C C;  1ENC A;  2Z6K A;  2XTI A;  3T51 B;  3I70 A;  3GTP H;  1Q8I A;  2EIF A;  5JJI A;  2IX0 A;  1I3Q H;  4DR7 Q;  2KEC A;  1EQR A;  4Z9C B;  1H95 A;  3H91 A;  1SND A;  2AHO B;  3SVM A;  1V43 A;  1AE2 A;  5I9O A;  1E24 A;  2PCF B;  3K7A B;  2LFN A;  1JQY D;  1JWU D;  2IY5 B;  1R9T B;  3L3O C;  2A74 C;  3CCV A;  1DYQ A;  4OGQ C;  2MO1 A;  1QE6 A;  3PO3 B;  4DR4 Q;  5FKA C;  4R4O A;  4RKL A;  5EGT A;  1EY4 A;  2A19 A;  1Q90 A;  3B6Y A;  1SYD A;  4JI3 Q;  1FNU A;  1Y1V B;  1NCV A;  4LWC A;  3CW2 C;  1EYG A;  2EVB A;  2OCE A;  1YNX A;  2EYF A;  2HDL A;  4V19 0;  1NBW A;  3HS0 C;  3L2P A;  1X3E A;  4B9W A;  1HR0 L;  3A0J A;  3DHQ A;  4B3T Q;  2VB2 X;  4A3C H;  4FF2 A;  3F2C A;  1CHP D;  4Y7N B;  1KRT A;  2PI2 A;  5M3M B;  1NUC A;  1TWF H;  2AQ2 B;  2MPM A;  5CV6 A;  4FXD A;  3FKI B;  2EY1 A;  4HJ8 A;  5BN4 A;  5COR A;  3ULJ A;  1PH2 A;  1CKO A;  5IWA Q;  1EFW A;  1LT6 D;  1ZXT A;  1EL0 A;  1HUM A;  5F2D A;  3H15 A;  1EUJ A;  1EY9 A;  2BA1 A;  3UE1 A;  1D8L A;  1ET6 A;  1YIJ A;  2UUC L;  1I4X A;  3HOZ B;  4APV A;  3KDF B;  4LNQ A;  4IJH A;  4PMB A;  4QL5 A;  3DMU A;  1LT3 D;  1TY2 A;  3WWV A;  2IX1 A;  4H13 C;  4BXX H;  1LT5 D;  1RKN A;  1SYC A;  4DR2 Q;  5K5P A;  1SFO B;  1DXM A;  2JXM B;  2EXZ A;  3ONA B;  3RN2 A;  1C0A A;  4LFC L;  2ZT9 C;  3J81 c;  2ATW A;  4MNO A;  1PYB A;  1SYF A;  2K04 A;  2A6H C;  4NDX A;  1PFS A;  1PFB A;  1RDP D;  2JE6 I;  3CKI B;  2MUY A;  3CD6 A;  4PQX A;  4PG3 A;  5M9O A;  2VUM G;  1LT4 D;  3QR8 A;  2R7Z G;  5G3L F;  1A8V A;  2F4V Q;  2KJX A;  1J6Q A;  3M4P A;  4A3E G;  3TRZ A;  4DR5 L;  1E2W A;  3RLN A;  3G7L A;  3FMC A;  1YIT A;  2HHH Q;  4ZRZ A;  4K5W A;  5C3X A;  1VQ6 A;  1LTG D;  4TQU S;  4A3M H;  3RZO B;  1PXU A;  2F0J A;  5GRO A;  1Y8N B;  5C4X H;  1M8A A;  5EAY A;  4XDX A;  1ZYR D;  2SNM A;  4LF8 Q;  1YHQ A;  4LFB Q;  3HOW B;  4DV6 Q;  1LLR D;  1VDZ A;  1D1I A;  2A5H A;  5IGB A;  4LFC Q;  1Q8K A;  1HR0 W;  4H44 C;  2JA5 B;  4DXG A;  4EVO A;  2MGS A;  2F3I A;  2DUD A;  2Q2T A;  1BCP C;  1L0W A;  3CCS A;  1X65 A;  4HJ5 A;  1I4H A;  4CJ1 B;  1WTW A;  2VB3 X;  1C9O A;  1BCP B;  1U0L A;  2DJF C;  3L0O A;  3STB C;  3M3Y H;  1HZC A;  1DJR D;  5C0X J;  4ZKB B;  2EZV A;  4ZQ3 A;  4JI6 Q;  1EIF A;  3Q6S A;  3C46 A;  2EYP A;  4ZKC B;  5IIF A;  3HOX H;  1ASZ A;  4QCL A;  4XQQ A;  1KLG D;  4AYB G;  4R8N A;  3DEP A;  4DR1 Q;  1HPC A;  2XN9 C;  2F0G A;  5KIX A;  2UU9 Q;  4RFB A;  5IGG A;  3E9H A;  2UUA L;  2ENB A;  4F88 A;  2XVS A;  4LF8 L;  4IJL A;  1EEF D;  3EQL C;  3OPO A;  3I56 A;  1VQJ A;  1WCM H;  4DF7 A;  2QIL A;  4U68 A;  1DD2 A;  4LUO A;  4ZLT F;  5C4J H;  2SDF A;  1M4V A;  3CCE A;  4JI3 L;  1LAB A;  5DAU A;  2RHQ B;  1L0Y B;  1PRT B;  3UE0 A;  4YY3 L;  3DWA A;  4A3B G;  1GUO A;  4A3K B;  4DR4 L;  4DK6 C;  2ZJP A;  1WOC A;  4LF9 Q;  3RZD H;  3CRK C;  1N36 Q;  2Y0S B;  3S14 H;  3PSI A;  1L1O B;  1QUQ A;  1LO5 D;  3OTO L;  3OOC A;  3AEV A;  4BBS G;  1SYE A;  3J81 i;  2NVQ H;  3DLL A;  2B8F A;  3H0G B;  2YTV A;  3NE5 B;  1L1O A;  4L5Q A;  4RH6 A;  1OO9 B;  2FHT A;  3TP7 A;  4HCS A;  1LV9 A;  2L0C A;  3I4N H;  2Z9H A;  3DM1 A;  5GAH C;  1B3A A;  4IOC A;  1YHB A;  2WB1 B;  2DJG C;  4K2K A;  1HNX L;  5AFW A;  2XNA C;  5M5X H;  1NMG A;  5LMU Q;  4NKL A;  4JPB W;  1T9H A;  2JSO A;  3D4W A;  5C3E G;  1H9S A;  3H3V H;  4MHE A;  2RSN A;  1FGU A;  5C4X B;  5C44 H;  1JOR A;  2ICI A;  1D1K A;  1EZ8 A;  1H9J A;  5I9P A;  2K14 A;  3R2I A;  3VYS A;  3T1H L;  4OO1 H;  2JA5 H;  2LXK A;  1RHP A;  2F0N A;  3GP7 A;  3K5N A;  4X66 Q;  1I4G A;  2G9D A;  3S9W A;  4F8M A;  3S1M B;  1NNX A;  1SR3 A;  3GO5 A;  3IRB A;  1CSP A;  1YI2 A;  4NW2 A;  1BKB A;  3S1Q B;  1UEA B;  4KD4 A;  5M5W B;  4BA1 I;  4AQY Q;  1GUS A;  1BQQ T;  1VF5 C;  3RUZ A;  2N88 A;  4POG A;  3S1N B;  1QNK A;  3GV6 A;  3PO3 G;  3D6W A;  3CC7 A;  1Z9F A;  2LXJ A;  5ISR A;  2EJG C;  1SN8 A;  1WTV A;  4Q5V A;  2CCZ A;  2KVM A;  1IYJ B;  2C9O A;  4LF7 Q;  4X65 L;  2QDL A;  4IPD A;  1NTG A;  2QEJ C;  1N34 Q;  1QOH A;  1PFN A;  4DR3 Q;  2RKS A;  4CDD C;  2YTX A;  4LW1 A;  2UUB Q;  4LMQ D;  4R4Q A;  4A3F B;  2ASB A;  2KHS A;  3FDT A;  3IL8 A;  3S14 B;  1II3 A;  4JI7 L;  5CGK A;  2UXB L;  1FJG Q;  1GUW A;  5BR8 L;  1AZP A;  2Z6K C;  4YHH Q;  2K32 A;  3EFX D;  3AMU A;  3FVQ A;  3FPU B;  1TWC H;  4JI5 L;  4DV1 L;  2WAQ E;  1E2V A;  2JA6 H;  1AW7 A;  1Y69 U;  3JC6 6;  1VMC A;  1SMY C;  1EY6 A;  4ZUI A;  1BO0 A;  3SXH A;  4OON A;  2VNU D;  1PZK D;  3HOY H;  4L6T B;  4K6D A;  1J5E Q;  1O7Z A;  1Y1V G;  1HZA A;  1AZQ A;  1ML0 D;  2B2Y A;  1Y8O B;  4CJ2 C;  3SDZ A;  4JI7 Q;  1G51 A;  1W6J A; 
#chains in the Genus database with same CATH homology
 3RLO A;  4Y7N H;  4DUY L;  1P16 A;  1VQ4 A;  1XNQ Q;  2KCM A;  3CAM A;  2Y0S G;  3TQY A;  3MEF A;  4EQ5 A;  1K0R A;  2A8V A;  4BA2 I;  3JAM i;  3GTJ H;  1GD7 A;  4H02 A;  4LFA Q;  1N36 L;  3EBE A;  1IBL L;  1CKN A;  3S1Q H;  2B29 A;  1L1O C;  4GOP C;  5FLX c;  2JA8 H;  3GTK H;  4C3H H;  1VQE A;  1LTL A;  4OXP A;  4YWL A;  5IP9 G;  3CMA A;  3NBH B;  3J7Z C;  3OW2 A;  2HT1 A;  5IP7 G;  1VQK A;  3AYH B;  2ES2 A;  1Q81 C;  5FLM H;  4DR1 L;  3VDY A;  3K7U C;  4R4I A;  1VQC A;  3CF5 A;  3PUZ A;  4IO9 A;  4A3B H;  4TVA B;  4J15 A;  3GTO H;  4PZ7 A;  2I5M X;  2E2I H;  4GNX A;  1TWH H;  4A3K G;  1VS0 A;  4NB3 A;  3G6E A;  3J81 j;  2ZM6 Q;  3F2B A;  1SRO A;  1YJN A;  2WB1 G;  4IFD G;  2UUC Q;  3CCQ A;  3CCM A;  2UUB L;  2UXD L;  4JI6 L;  3A74 A;  4NXN L;  1N8R C;  2KEN A;  1BBU A;  4HJ7 A;  3F1Z A;  4LF5 Q;  1MJC A;  1OXS C;  2I0Q A;  5M3F H;  3M4Q A;  3S2D H;  2KHJ A;  1NE3 A;  4IPH A;  4JI8 L;  1VQP A;  4B3R Q;  3NEN A;  2K50 A;  5C0X I;  1IBM L;  2NVX H;  2N78 A;  1SFO H;  2VZA A;  3H0G G;  1VQF A;  4JI2 Q;  1XMO L;  4JI0 Q;  4A3J H;  1Y14 B;  3DM3 A;  3RLF A;  4X6A H;  3RN5 A;  4LF4 L;  3PO2 G;  2NN6 G;  1S40 A;  3RR5 A;  4BBR H;  1QZH A;  3UDI A;  1UEB A;  1HZ9 A;  3CXC A;  2VUM H;  3PCO B;  4GNX C;  4JBJ A;  4JG2 A;  4LFA L;  4XIG S;  5IYD H;  1VQB A;  4HIK A;  5M3F G;  1Q86 C;  2ZJQ A;  4JOI C;  1HR0 Q;  3HKS A;  3CME A;  3TRE A;  2PMZ E;  1QZG A;  3D31 A;  1LYL A;  1I50 H;  3BZC A;  3UDG A;  3CPF A;  1I94 L;  4AYB E;  1X6O A;  4JI4 Q;  3F8T A;  1KL9 A;  3UDF A;  4R1J A;  4A3K H;  1QVC A;  1WYD A;  2QGQ A;  2E8G A;  1JJ2 A;  1PYS B;  3MXN B;  1VQ9 A;  4DR7 L;  1PA6 A;  2GVB A;  3HKZ G;  2UXB Q;  3S1R H;  3CCJ A;  4O0A A;  3I4M G;  3A5U A;  4HIO A;  3BZK A;  1KXL A;  4C3J H;  4O2D A;  5LMN Q;  3BJU A;  4GS3 A;  4QGU A;  3I55 A;  1VQ5 A;  1MJE A;  1QUQ B;  3J7A 5;  1VQO A;  1TXY A;  3H3V I;  3K8A A;  3I4O A;  1VQA A;  3KOJ A;  1IBL Q;  5GAD C;  4GLV B;  2K5H A;  4DV4 L;  2WFW A;  5FJ8 H;  1K83 H;  4ALP A;  3HOW G;  3KJP A;  3CQZ H;  4DUZ L;  4DV4 Q;  1TWG H;  2YU9 H;  2JEA I;  3W5O A;  1YEZ A;  2V1C C;  4PMW A;  4IFD J;  1WFQ A;  4A3I H;  2Z6K A;  3L7Z C;  2XTI A;  3S16 H;  1XMQ Q;  1BVS A;  2HHH L;  2BA0 A;  5LMN L;  2UXC L;  3GTQ H;  4YY3 Q;  4PZ6 A;  1E7Z A;  4GN4 B;  4GNX B;  2EIF A;  4DR5 Q;  3GTP H;  2IX0 A;  4A4I A;  4A3M G;  4KHZ A;  5JJI A;  1I3Q H;  2F4V L;  1D7Q A;  3U58 A;  4DR7 Q;  4X62 Q;  4QY7 A;  1K73 C;  2Q2I A;  1W2B A;  1EQR A;  2H5X A;  4DPG A;  1PH1 A;  1H95 A;  1G6P A;  1K9M C;  1YJ9 A;  2AHO B;  2VS1 A;  1DGS A;  1V43 A;  1AE2 A;  2KHI A;  1E24 A;  4DAM A;  4X64 L;  1PH7 A;  2CFM A;  2IY5 B;  2D62 A;  2NZO A;  5DLQ E;  4DV2 L;  4Y52 H;  2ZJR A;  1OXT A;  3S1M H;  3CCV A;  1RIP A;  2EQS A;  1AE3 A;  1A62 A;  2MO1 A;  1R9T H;  1PHJ A;  4DR4 Q;  2MFI A;  4R4O A;  2A19 A;  2B63 G;  1U5K A;  3PUW A;  1OXU A;  2VQF Q;  3B6Y A;  1VQL A;  2PNH A;  4GLA C;  1KQS A;  4JI3 Q;  3M7N A;  4LWC A;  4A3G G;  2QEX A;  3CW2 C;  1UE5 A;  1EYG A;  4JI0 L;  2OCE A;  1YNX A;  3I7F A;  4POF A;  3J80 c;  1NBW A;  2D0O A;  3GTL H;  4A3C G;  3L2P A;  2K75 A;  1X3E A;  1HR0 L;  3K7A H;  3A0J A;  4B3T Q;  3G4S A;  4OO1 I;  1E1T A;  4A3D G;  1NMF A;  4B3S L;  3ICE A;  2CWP A;  4A3C H;  2FXQ A;  2VL6 A;  4LUV A;  2PQA B;  3F2C A;  3E0E A;  4JI1 Q;  3Q8D A;  3S2H H;  2N8N A;  4UP9 A;  1KRT A;  2RHS B;  2PI2 A;  1Q12 A;  4LF6 Q;  4LF7 L;  1YBY A;  4WJ3 M;  2OQ0 A;  2KCT A;  1CKN B;  1TWF H;  2JA7 H;  3G48 A;  4DV5 Q;  1VQD A;  1VQH A;  1VQG A;  3H0G H;  4HJ8 A;  3T1Y L;  3ULJ A;  1PH2 A;  1PH8 A;  4JI2 L;  4BY7 H;  2VQF L;  1CKO A;  3W1B A;  4LF6 L;  5IWA Q;  1EFW A;  4UPA A;  4L5T A;  4B3R L;  1N9W A;  1X56 A;  3H15 A;  1LM0 A;  1P8L A;  2BH8 A;  4B3S Q;  1EUJ A;  1AH9 A;  2BA1 A;  3UE1 A;  4B3T L;  1D8L A;  3UDX A;  5JJK A;  1YIJ A;  1XNQ L;  2UUC L;  4UP7 A;  3HOU G;  2ZM6 L;  3K80 C;  1FL0 A;  3KDF B;  4APV A;  2QA4 A;  4IJH A;  4QL5 A;  4LNQ A;  4NXM Q;  3GTG H;  3STB D;  3NEL A;  1XNR L;  3WWV A;  2E2H H;  2IX1 A;  1RL2 A;  1IBK Q;  4A93 H;  5LMN W;  4P73 A;  1SMX A;  1Q7Y C;  4BXX H;  4DR2 Q;  2LSS A;  4HIM A;  3J80 i;  3T1H Q;  3HOZ H;  1HNZ L;  1Y1W H;  3RN2 A;  2R93 H;  1C0A A;  3HOV H;  4LFC L;  5C0X G;  3J81 c;  2ATW A;  4MNO A;  1PYB A;  3M4O H;  2R93 G;  1PFS A;  2R92 G;  2JE6 I;  3PIP A;  1IXR A;  4DV2 Q;  2MQH A;  3CD6 A;  2ZTE A;  1GM5 A;  3KF8 B;  4L5S A;  2CKZ B;  3KYH C;  3PUX A;  3G71 A;  4NPS A;  4PG3 A;  2VUM G;  4DV0 Q;  1LUZ A;  3CCL A;  3I4M H;  1XPU A;  2R7Z G;  1MKH A;  3ER0 A;  1Y1V H;  3K0X A;  2MNA A;  2OTJ A;  4DV1 Q;  1A8V A;  2JJQ A;  1PH4 A;  2F4V Q;  2B3G A;  4A3E G;  1J6Q A;  3M4P A;  2VQE L;  3TRZ A;  4DR5 L;  2VW9 A;  3RLN A;  1J5E L;  4QIW E;  1YIT A;  5GAG C;  1PH6 A;  2HHH Q;  4P72 A;  1VQ6 A;  2DGY A;  4TQU S;  5BR8 Q;  4A3M H;  1L2F A;  4A75 A;  2L15 A;  1PH9 A;  4DV0 L;  5GRO A;  1BBW A;  5IYD G;  3D0F A;  1IZ6 A;  5C4X H;  5IYC G;  5EAY A;  4RG1 A;  1VQN A;  4B3M L;  4EX5 A;  3S1N H;  4GKJ Q;  4QQB X;  4MZ9 A;  5IE8 A;  3JAM c;  2E2J H;  4OX9 L;  4LF8 Q;  4A3F G;  2YV5 A;  4A76 A;  2WB1 E;  4IPG A;  1YHQ A;  2JA6 G;  4JYA L;  4DV6 Q;  1EIY B;  1KRS A;  1N33 L;  3HOW H;  1B7Y B;  1CSQ A;  3K81 C;  4LF9 L;  3HOZ G;  3RZO H;  4OWT B;  4GLX A;  5H1S E;  1N34 L;  2XGT A;  4LFC Q;  3PO2 H;  1K8G A;  1Q8K A;  1HR0 W;  4X65 Q;  4JI5 Q;  5IWA L;  1YJW A;  4A93 G;  2F3I A;  2DUD A;  2Q2T A;  1JB7 A;  1L0W A;  1OXV A;  1Q1E A;  2NZH A;  1X65 A;  3CCS A;  4JI4 L;  3CCU A;  2YTY A;  4HJ5 A;  1XMO Q;  1PH3 A;  1YHA A;  3S17 H;  5ELO A;  1C9O A;  1U0L A;  2ZTD A;  1X54 A;  3L0O A;  1JJC B;  2F52 A;  3PIO A;  3CPW A;  3STB C;  2IT1 A;  3M3Y H;  1JT8 A;  1OXX K;  1HZC A;  4P74 A;  5C0X J;  4NXN Q;  2JA9 A;  4KI0 A;  2UU9 L;  1KHI A;  4JI6 Q;  4JV5 L;  5JJL A;  1V9P A;  4R4C A;  1CKM A;  3ULP A;  1EIF A;  3AQQ A;  1G29 1;  1I6H H;  4JBW A;  1IL2 A;  5IT9 c;  1M90 C;  1NJI C;  1FVI A;  3T1Y Q;  2JA7 G;  3HOX H;  2R6G A;  2K5N A;  4DAY B;  1ASZ A;  4AYB G;  2K5V A;  4DR1 Q;  1S72 A;  3HOX G;  4DV3 L;  4A3J G;  4OWW B;  3HKZ E;  4A3F H;  2UU9 Q;  4JV5 Q;  2AKW B;  1SRU A;  4KLK A;  4PZ8 A;  3E9H A;  1KD1 C;  4LF5 L;  2KBN A;  2UUA L;  5K36 G;  2WAQ G;  4JYA Q;  5C4X G;  2A1A A;  2I5H A;  2ID0 A;  5AJ3 L;  1Z47 A;  1M1K C;  2OQK A;  4LF8 L;  4IJL A;  4XTC S;  3PF4 A;  2NVT H;  3PGZ A;  5C44 G;  1HH2 P;  2ZTC A;  3I56 A;  1B8A A;  1XJV A;  1VQJ A;  1WCM H;  5LMU L;  4IPC A;  4A3G H;  4LUO A;  3GDE A;  5IY0 A;  2N3S A;  5C4J H;  4LFB Q;  4A3E H;  3CCE A;  2JA5 G;  1HNW Q;  4JI3 L;  4OO1 G;  2RHQ B;  2R7Z H;  3TS0 A;  2NVY H;  4P75 A;  4YWM A;  2VQE Q;  5IYB H;  1HJP A;  3S24 A;  3UE0 A;  4YY3 L;  4YCV A;  4A3B G;  4NXM L;  3PV0 A;  4DR4 L;  4DK6 C;  2ZJP A;  1JE5 A;  4AH6 A;  1WOC A;  1Q46 A;  4LF9 Q;  4MTN A;  3RZD H;  5IP7 H;  4JCV E;  1N36 Q;  2JK8 A;  2R92 H;  3OYY A;  4OX9 Q;  2GN5 A;  3S14 H;  1JMC A;  3PSI A;  3W1G A;  4DUZ Q;  4GKJ L;  1L1O B;  3U4Z A;  4B3M Q;  1E1O A;  1QUQ A;  5HY6 A;  1OTC A;  2AWO A;  5M5W H;  1Y1W G;  3OTO L;  3AEV A;  4BBS G;  3J81 i;  2NVQ H;  1NY4 A;  3TEH B;  3DLL A;  1XPR A;  4DR6 L;  4GKK L;  2N49 A;  2YTV A;  3AFQ A;  1L1O A;  1YZ6 A;  1V1Q A;  5M3M G;  3I4N G;  4L5Q A;  4WJ4 A;  2JQO A;  1HNZ Q;  3KDF A;  1E3P A;  2JEB I;  4GN3 B;  3HFZ B;  4C2M H;  1JJG A;  2CWA A;  3KF6 A;  3FKI G;  5M3M H;  3I4N H;  1N32 L;  3CP0 A;  2UXC Q;  4YCW A;  5GAH C;  4YHH L;  4BBS H;  1VQ8 A;  1XMQ L;  3HOU H;  2E5L Q;  4IOC A;  4DR6 Q;  4JC0 A;  1X3F A;  1I94 Q;  1FJG L;  1YHB A;  1HNX L;  1X3G A;  3E9I A;  5M5X H;  3OTO Q;  1NMG A;  5LMU Q;  3HOY G;  1QVG A;  1T9H A;  2I5L X;  1XPO A;  2BH2 A;  4DNI A;  5C3E G;  1WCM G;  3H3V H;  3ERS X;  1WJJ A;  1FGU A;  5M5Y H;  1SLJ A;  2OTL A;  3S15 H;  5C44 H;  2IHF A;  1EWI A;  2UUA Q;  4YWK A;  2K14 A;  1UWV A;  2R7D A;  1Q1B A;  2EXD A;  4BY7 G;  3T1H L;  2JA5 H;  2ALY B;  2LXK A;  4GN5 A;  4DR2 L;  3HOV G;  1O7I A;  3EN2 A;  4DV7 L;  4LF4 Q;  3PO3 H;  4BBR G;  1IBK L;  2AMC B;  2NN6 I;  4X66 Q;  1HZB A;  4L5R C;  1A0I A;  1XNR Q;  1X9N A;  1EQQ A;  4RMF A;  3TS2 A;  2Y0S E;  1Q82 C;  1XTD A;  1ASY A;  1SR3 A;  1IBM Q;  3GO5 A;  5J3B A;  1X55 A;  3LGJ A;  1UE1 A;  1CSP A;  2VY3 A;  3IRB A;  4JI8 Q;  4AIM A;  4JI1 L;  1YI2 A;  3KJO A;  1PH5 A;  2K52 A;  5AJ3 Q;  1K8A C;  3A5Z B;  2C35 B;  4DR3 L;  1BKB A;  4FDB A;  2IHE A;  1C7Y A;  4DKA C;  3M85 A;  4BA1 I;  1VQ7 A;  4AQY Q;  4POG A;  4JOI A;  4DV3 Q;  4K0K Q;  4BY1 H;  3PO3 G;  4DK3 C;  1KIX A;  4IFD I;  1TWA H;  2B63 H;  3CC7 A;  1Z9F A;  2PQA A;  2LXJ A;  4LUZ A;  4A3D H;  3I2Z A;  2K4K A;  4DV5 L;  1SN8 A;  2YYZ A;  5GQO A;  2CCZ A;  3EIV A;  1MIU A;  1IYJ B;  3CC2 A;  4LF7 Q;  3ZJY C;  4GOP A;  4X65 L;  4UY8 C;  4IPD A;  4HJA A;  4AQY L;  3PUV A;  1NTG A;  5HGQ A;  4OWX B;  3U4V A;  1N34 Q;  5JEA G;  4C3I H;  4BY1 G;  3RNU A;  1EOV A;  2HQL A;  3M9B A;  3CC4 A;  1SE8 A;  4DR3 Q;  1KAW A;  2YTX A;  3NEM A;  4GOP B;  4IOA A;  1QVF A;  4LW1 A;  2MO0 A;  3F2D A;  2UUB Q;  4R4Q A;  1GVP A;  2ASB A;  1CUK A;  3PUY A;  3CCR A;  4X64 Q;  1VQM A;  4JI7 L;  2UXB L;  2Z0S A;  5E7N A;  1A63 A;  3KF6 B;  1FJG Q;  1KC8 C;  5IYC H;  4X66 L;  2R7F A;  5BR8 L;  2E5L L;  2Q2U A;  2Z6K C;  5FLM G;  2GVA A;  2CQO A;  4X62 L;  4YHH Q;  4DV7 Q;  2D0P A;  5IP9 H;  4JI5 L;  1TWC H;  5JEA J;  4A3I G;  2JA8 G;  4R4T A;  2RF4 A;  4JBK A;  3KFU A;  1GO3 E;  4DV1 L;  4KHP Q;  2WAQ E;  4UP8 A;  2PI2 E;  1B70 B;  2JA6 H;  3GTM H;  4A3L G;  4GKK Q;  4K0K L;  5FJ8 G;  1N33 Q;  3PF5 A;  2HIV A;  4DV6 L;  1PV4 A;  1WI5 A;  3JC6 6;  4LFB L;  2RCN A;  1E22 A;  4ME3 A;  4HID A;  3FP9 A;  4DUY Q;  3AFP A;  2Q2H A;  5GAE C;  4JBM A;  1GKH A;  1HNX Q;  5C3E H;  5IYB G;  1S3O A;  3U50 C;  1PVO A;  4OON A;  2VNU D;  4P71 A;  2OWO A;  3HOY H;  4KHP L;  2UXD Q;  1N32 Q;  3GD7 A;  4A3L H;  2AWN A;  3KLW A;  1J5E Q;  1Y1V G;  1YVC A;  4YCU A;  1HZA A;  2HIX A;  1W3S A;  4HJ9 A;  1VQI A;  1HNW L;  3FHW A;  1VCI A;  3FKI H;  1K3R A;  3SGI A;  3ULL A;  4BXX G;  3BU2 A;  4QJF A;  1UE7 A;  2WP8 J;  4JI7 Q;  1I5F A;  1G51 A;  1UE6 A;  5ELN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...