2QCPX

1.0 a structure of cusf-ag(i) residues 10-88 from escherichia coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
MEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual Cu(I)/Ag(I) coordination of Escherichia coli CusF as revealed by atomic resolution crystallography and X-ray absorption spectroscopy
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Metal binding protein
molecule keywords Cation efflux system protein cusF
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qcpX01
2VB2X 3TDQA 1ZEQX 2VB3X 2L55A 3E6ZX 2QCPX
chains in the Genus database with same CATH superfamily
4OIJA 4ZKBB 1HH2P 2KEEA 2R3ZA 2F0IA 2F0LA 1RKNA 1PTOB 3SGIA 1CA6A 4GS3A 5C4XH 1PH6A 2D5DA 3GTOH 2D0OA 4PV1C 1ET6A 2ZM6Q 2UXDL 2JA7H 3GTGB 5JJKA 2BDNA 1QWYA 5AFWA 3HOXG 2GVAA 2B63B 4DR3Q 5LMNQ 4ZQ3A 4DUZQ 1VS0A 4RGTA 2CFMA 4FVMA 4P75A 2K33A 4LJZC 2UUBQ 1RTOA 2Q8TA 4OX9L 1KDBA 1Y1WG 1A2UA 3HKZE 4C2MB 2CH4A 1XWEA 4QUCA 4UHVA 3PO3G 4GNXA 5BN4A 1T5EA 4DR5L 5IP9H 3K5MA 1QOHA 1PH4A 1HA6A 2A69D 1A6XA 1E22A 2A68D 2EVBA 2WIIB 4JV5Q 1GM5A 1CFMA 4TVAB 2XIWA 4LFCL 2F1MA 3A8JE 5C5LA 5IGFA 4V190 3UDFA 3VA7A 3NBHA 4MHEA 4JI8Q 3CP0A 1CSQA 2MHVA 1YI2A 2UXDQ 2B8FA 1L0YB 2OF1A 1CKNA 1KD1C 3A8IE 1D5ZC 4A3JH 1X3EA 1Q7YC 3DM1A 1VQ5A 4UDUC 4BY1G 4DV4Q 4OIKA 1LV9A 4QCLA 1AE3A 4OWXB 1W6KA 1ASYA 1PYSB 4NP5A 1F9PA 2F4VQ 4C3JG 4ODGA 5BR8L 5AJ3Q 1V1OA 3T1YL 3SE0A 2EE1A 4P71A 1A3TA 4P2CB 4NXNL 4JVZA 3TS0A 1L0WA 1EU4A 1C8CA 1Q8IA 4PZ6A 1JB3A 1F2YA 3EBEA 2WV6D 5IP7H 1EWHA 2NVYH 3EJIA 2KEDA 1WJJA 1WD1A 1MGSA 4DPGA 4C3JB 2B63G 1EY7A 1OXTA 1CT1D 2YTXA 4N9PA 4LAAA 2F0FA 2EYOA 4A3IG 2RSOA 1V43A 3W5OA 4GNXB 3HP3A 3PUZA 3S15H 3OMCA 1JR0D 1SYGA 1WTPA 1D6EC 3LWUA 1FNUA 3CCMA 3LNNA 1I6VC 2IHEA 5EGTA 4IUQA 4WFN3 3NTKA 2K32A 4B3TL 1SYFA 2QEJC 3NBHB 4OL7A 3CPWA 4A3BH 2IPKD 3RN5A 5I9PA 1H9MA 1MSGA 2C9OA 1JB7A 1B44D 1SDFA 4R4TA 2E2HB 1W6JA 2CQAA 1CKNB 1E1TA 3IFTA 4X66L 1OXVA 4X62Q 2OWOA 1TWCB 1WYDA 1K73C 1B8AA 1HNWL 1IYVA 1ML0D 5CBEE 3VYUA 5JEAG 3LGJA 3HOYH 4A93H 3S14B 2DJGC 1A3UA 2LXJA 4QJFA 3MAQA 4BBRH 4B9WA 2ICIA 1O7LA 1SSOA 4K0KQ 4MIUA 1V9PA 3TP6A 4HJ5A 2ASBA 2R93G 4CKBA 4E6IA 4DV3L 1PVOA 3NP8A 1I4RA 5D65A 4ZRZA 2EYLA 3CC2A 1KL9A 4I65A 3S9WA 1EQVA 1TWGH 2VNUD 3N6RA 4J8QA 1VCIA 3NENA 3R93A 4TSSA 4ZAIA 4FXKC 4F8MA 4NXML 1XPRA 1B70B 1ZEQX 3T56B 2UXCL 4OHJA 1WCMB 1LUZA 2WINB 4AYBB 4CDFC 4KHPQ 2IW3A 5FLXL 4QGUA 1C4QA 4DV6Q 1EOTA 5IE8A 3CCJA 3MFYA 1HR0L 3QOJA 4EQNA 5GADC 2BA0A 2K4KA 3MEHA 2QW7A 1X3PA 4FDBA 5FK9C 1M1KC 2QF7A 3S2HB 1P16A 1F9SA 3GTJB 2A6HC 3K7AH 1LACA 1JJCB 4RG1A 2FMMA 2JYOA 4DV2Q 2WP8J 3K7AB 2EYPA 1G2TA 1Y1VB 3MEFA 2M00A 4FNFA 1G6PA 2OXPA 4BY7B 4RWSC 1XPOA 1JWUD 5C0XJ 2R93B 1I6HH 1B2TA 1X3QA 4B3MQ 3TP5A 3CRKC 1CZWA 1MBYA 3QJYA 1NNXA 2KHSA 4I7AA 4U68A 1HNXL 3RNUA 2VUMB 3AYHB 3S1RH 1D5MC 3IRBA 4LF8L 3GTPB 2XRQD 5IODA 1MJCA 2N78A 4RGMA 3QOLA 2XTIA 4CDEC 2VQFQ 4HIMA 5E4XA 1S3OA 3S1RB 4XT3B 1YIJA 1C0AA 4DR7L 4PMWA 4RKBA 3I4NG 1LTGD 4C3HB 4DK0A 2AWNA 3HOVG 5EBCA 2E2IH 1KLUD 3E6ZX 4RMFA 4U673 4X3UA 4KY7A 1XJVA 4QQBX 4ZUJA 1LABA 3ONAB 5C44B 3B6YA 3NWTA 2NN6I 2JA8H 4DR2L 3C46A 1BCPF 2JA7B 1BDOA 2JA8B 4JI0Q 3M3YH 1VQ6A 4KK7A 1G91A 2LS01 2NVTB 3OMGA 4HIOA 3QR8A 5CC4A 2F0GA 4A3CG 3M3YB 5J1ZA 4LF6L 3P7JA 3S1NB 5KYIA 2KCCA 3M4PA 3M85A 4BBSH 3AFPA 1N33L 4M1UB 4ZK9B 2Q8IB 2VS1A 5FOBB 2I0QA 4A3LH 2R93H 1CZGA 2L9HA 5DEHA 2PCFB 1PYBA 2XN9C 3J81L 4LFBL 5C6AA 2PZTA 4MZ9A 4KHZA 2D2CC 1WVLA 4DV2L 2EY5A 3FPUB 4A3EH 4EQPA 3TP7A 4LW1A 2WKCA 2TSSA 2HCCA 3VR5A 3HOXH 4KN4C 1IW7C 1Y8PB 1FR3A 2MP1A 2PZUA 3PIO3 3OTOQ 4G7OC 4DNIA 1IYUA 1HZCA 1Y8NB 2A73B 2WAQE 1P8LA 3K81C 4LK1C 2EYJA 3NQTA 2YTYA 4LMQD 4ZCKA 3OPOA 3BDOA 4R4OA 3AMUA 4HIKA 3AFQA 1SE8A 5C3EH 4WJ4A 3T1HQ 4NXMQ 5JJZA 4JI6L 1YNJD 4DR2Q 1KNAA 4A3BB 2HDMA 2NYZD 3R2IA 1XTDA 1Q90A 3IL8A 1Y1VG 2GA4B 1F2ZA 2M2LA 2Q8RE 1PTOF 1STNA 3CKIB 3HKZG 2F0TA 4OGQC 3I56A 4IZ8A 2CW0C 4LF5L 2BE5C 1M4VA 2R6GA 3JAMi 3KJOA 3FDTA 1BKBA 3L9AX 2E74C 2E2HH 3NTIA 2F0SA 5EJWA 3VR3A 1X9NA 4EVOA 2Q2IA 3PO3B 1EOVA 1O7YA 4QL5A 4DXFA 3CCRA 1GUNA 1KABA 2IX1A 5M5XH 3GTMH 1QB5D 1CHQD 4BA1I 1RCVD 1XMOQ 1EYCA 3HOZG 1VQJA 2B2VC 1HNXQ 2N55A 1QVGA 3ZJYC 3G6EA 1JC7A 3DWQA 4K5VA 3A5UA 1EIFA 1K3BC 5D14A 3TZDA 4IPCA 1I4QA 3RZDB 4JYAL 4GN5A 1GXDC 1PH2A 3A54A 4DUYQ 1GHKA 4IFDI 4QY7A 4UAIA 3I4NH 3P20A 5C44H 3F2UA 1V1QA 1YHQA 3HOVH 3H0GH 4YIJA 3CC4A 2IT1A 1I3QH 3VYRA 4EQ5A 4M8AA 3WWVA 1VQMA 2JA9A 4DF7A 4DV5Q 4IN3A 1A3VA 2PO4A 3STBD 5HURA 5A2QL 1KHIA 3CC7A 1FJGL 2VXWA 4KMUC 2Q2HA 4X64L 1AE2A 1VMPA 4B3SQ 3EQLC 4L5TA 2XVSA 2B2TC 3JC66 4HSPA 2RKSA 4G57A 2UUCL 2K01A 4DK6C 1TWHH 2A1AA 4K2KA 4R4IA 3NQIA 1PMRA 3TZUA 1IYJB 3E9HA 3AQQA 3T51B 5JAVA 2BOSA 2NVTH 2WAQG 3G71A 1BUVT 4NXNQ 2JA5H 2D9UA 4YCWA 5CV5A 2B2YA 4RA8A 1EEFD 2JA5B 1VQPA 3KK7A 2YV5A 4YHHL 2F4VL 4K8IA 2K5HA 1BVSA 2H5XA 4ZLTF 4ZYSA 3RN2A 3M4QA 3Q23A 3BYTB 1BR9A 1SN8A 3S17H 1BCPC 2KVMA 5EKKA 3RZOH 1EYAA 1O7IA 3W2DA 1LT6D 1DD2A 3QWNA 3K5LA 2PW5A 1HQRD 2Z0SA 4OO1I 4DGZA 4CJ1B 4X62L 1QUQB 1Y14B 5M5YB 3L2PA 2EPBA 3OYYA 3KDFB 2HQLA 1HZ9A 2ICEC 3J81c 5C4JH 1EY8A 3CMEA 1NUCA 2LSSA 2MFIA 5M5YH 1S5BD 2D62A 2PNHA 3H6MA 2BH8A 2J0TD 1EUJA 3EFXD 3HGBA 4AH6A 3BJUA 4B3TQ 4LFCQ 3RLOA 1E0BA 1QILA 2AQ1B 2NVXB 1B1ZA 2NZ1D 3FHWA 4XDXA 1DOKA 2WACA 2K05A 4YWLA 3PQIA 1SNDA 3TS2A 1CQFA 1F77A 5IYBG 3PF5A 1XXGA 4LNQA 3H91A 4Q5VA 1JQYD 5KEEA 3MZ5A 1AZPA 3U9OA 4IJHA 2Q2TA 1SYEA 2KJXA 4H0LC 3BZCA 4IFDJ 3CCSA 2XWJB 3I4MG 4BXXG 1TQOA 3MXNA 1KIXA 1MSHA 2N3SA 3K57A 4JI5Q 2E2JB 4R4CA 1S5DD 5LMNL 1VQDA 1QE6A 3GTPH 3P1HA 2F0JA 3J7AF 3G4SA 1TWAB 4A3IB 2HHHL 5TSSA 3KYHC 4A3IH 4RGOS 3EA6A 2JA6B 3H0GG 5BR8Q 3T1YQ 2ZXRA 2K14A 4PG3A 3T4AC 4DV7L 1Y8OB 4JI6Q 2YU9H 1WTVA 5C4HA 2E5LL 1EYDA 3CMAA 3S1MB 4IFDH 1HUNA 4CHTB 4JI2Q 4JI7L 3OHXC 4RFBA 2L11A 3CD6A 4LFAQ 3O13A 1J5EL 1JE5A 1UE1A 2K04A 4A3GH 1A63A 5M3FG 1ET9A 1HRJA 3A0JA 1N32Q 5J3BA 3MFGA 3U9SA 1AEXA 2B29A 1EZ6A 4TKOB 4HJ8A 4X3TA 4DXGA 1F2MA 4MN3A 2AQ3B 3BVZA 4LFBQ 1STBA 2ZXPA 4BY1B 1DZ1A 5T1IA 4ILWA 4KV6A 3D0FA 2RA4A 1D8LA 5J39A 1LTRD 5C4XG 1TY0A 1I4HA 4N9TA 1LTAD 1BO0A 4OX9Q 2KBNA 1VQAA 4LUOA 3H15A 4LF6Q 5M5WB 3UDXA 3F2CA 5IIFA 3KJPA 1S5FD 4H02A 2L0CA 4C56C 4RGNA 4DUZL 2QDLA 1KRSA 2DY7A 3MTSA 1SNMA 1VQFA 2QA4A 3J7ZC 1EWCA 1Q3LA 2NN6G 4B3RL 5F2DA 3C1EA 2PW7A 3WDNA 3J7A5 4NB3A 4LF5Q 3GQBA 3NUCA 3BZDB 2R7ZH 1D2BA 3NSWA 1H9RA 4GLXA 2ZJQA 2B3GA 2H4OA 2R7DA 2Z4IA 4A3EG 1VQ8A 5EPKA 1KAAA 1K3RA 2OQKA 5E1FA 5J22A 4XYQA 3I55A 2O5IC 1WTOA 2E75C 1HTPA 2LKVA 2EY6A 3MXNB 1TS3A 1I94L 1AZQA 1B3AA 4GN4B 1JOQA 5FLXE 3DHQA 4TQUS 4N8FA 3GP7A 5GAGC 3UI2A 2KA7A 4PNYA 1LT5D 2IJ0A 4YCVA 1CQVA 1E3PA 1UWVA 3PO2G 2EDGA 2SEBD 2Q2UA 5KGUA 3W1GA 2O5JC 1EIGA 2CWAA 1IL2A 2I07B 3MXPA 2X6GA 4UP7A 1HXYD 3TSSA 3HOVB 4C3HG 3I4NB 4NPSA 3D3RA 3D6CA 3NXWA 4LWCA 1N33Q 1TT2A 3S15B 2XWBB 1BF4A 3I4LA 4DV1L 1A2TA 1QNKA 3G6JB 4KD4A 2A6EC 4Y52H 4RH6A 5C4JB 4FXDA 4A3BG 1ZXTA 4CBVA 1DM0B 1GJXA 1VQIA 1WFQA 1B4OA 2MJ8A 1A0IA 1YHBA 5LL6X 2K28A 4DV0L 3CCLA 2DY8A 4A3FG 3KBXA 3K58A 1N34L 5GAHC 4A3GG 1EL0A 2SNSA 1YJNA 3GDEA 2KHIA 1QVCA 4F88A 4XT1B 3M7NA 4QMGA 1H95A 2F03A 4HSVA 2RSNA 4XIGS 2X69A 1XNQL 1E2ZA 1SE3A 2RBMA 4DR7Q 4JBJA 2PQAB 3E5SA 3SK8A 2R92G 4A75A 1IBKQ 2F0NA 3H09A 1CUKA 3CU7A 2K1BA 1WI5A 1N36Q 3M4OB 3G7LA 1KQSA 5IOCA 4BY7H 5CBAE 3M4OH 2F0EA 2KENA 2K6AA 4Z9CB 1HZBA 2ZTDA 4KY6A 4GKJQ 3Q8DA 1JJGA 4TRDA 2B39A 1EFID 1WTWA 4DV0Q 2XGTA 4NDXA 1GVPA 1UEBA 1UEAB 3ND9A 1Q12A 2F4IA 2HUGA 3BYYB 1QZHA 4WRDA 1LTLA 1FVIA 2UU9Q 3A5ZB 2R7FA 3GTKB 3AU7A 4RHRA 1HR0Q 2JK8A 5LMUQ 3DLLA 5EPJA 4A3KH 1G291 4PZ8A 3T13A 1PTOH 1PRTC 5JPNC 5BN5A 1TVXA 4XQNA 4B9XA 5M3MB 1K0SA 5JVH3 1CI3M 1NE3A 4RCOA 4UP8A 1I4PA 1EIHA 1Q82C 1H9SA 4YY3L 1PRTF 4A3JG 1PDQA 1AW7A 2F0KA 2K52A 5I6YA 2QILA 4DR4Q 1Z6HA 1NJIC 3VYSA 4OXPA 4P73A 4EX5A 3PO2H 3W1BA 4LF9Q 2ALYB 3I4MB 3FKIB 3I72A 4A76A 5EAYA 3ZYYX 3JAME 4C3HH 1U9RA 4A3DG 2PI2E 1DCZA 2K5VA 2TMPA 4A3MG 4UP9A 1SFOH 3DM3A 2A6HD 2L1BA 1PH5A 3S1QB 3CQZH 1PTOC 5IT9E 4FF4A 1EYGA 1FNWA 5CV6A 1BNZA 4X66Q 3HOUH 1NMGA 1K83B 5G3LD 1GKHA 2JE6I 2SNMA 3X3NA 4DA2A 3QG1A 2KCNA 2QDBA 3ICEA 3QB3A 3GTOB 4JI8L 1WCMG 2CQOA 3OIQA 5FO9B 2VB3X 1S4ZA 3CXCA 4G7HC 5I2YA 4GKKQ 2AHOB 3ERSX 1OXSC 4NMZA 4H13C 4JV5L 4BBSG 1W3SA 3F8TA 1OXXK 1LM0A 5G3LF 2PMZB 4HCSA 3DMUA 1XTCD 1ICWA 2WB1G 4DAYB 4GLAC 4R8IA 4ZKCB 1PXUA 3LWEA 1JJ2A 1VQBA 4IFDG 1XNRL 4CDCC 3J81j 1QCBD 2HCIA 1IKLA 5ELDA 2JA5G 3PCOB 1SR3A 2Z6KA 4A3EB 2BH2A 1YHAA 1D7QA 3HOYB 3RMHA 4YWMA 4A93B 1HFNA 1Z7TA 3ULLA 3J80i 2ID0A 1LTSD 1RHPA 3GTQB 3TMEA 5KYLA 3SK5A 2CWPA 1Q1EA 1ICFB 1B7YB 3WOEA 5M5WH 2ZM6L 3R3OA 1G6ZA 4H7BA 2JA6H 4HAEA 1QVFA 4JK1C 3KLSA 5ELFA 1BCPD 3VDYA 3GO5A 4JPBW 2CHBD 4GOPC 3Q24A 4JBWA 4IALA 2FINB 4X3SA 4PQXA 3CAMA 3S16H 2B2VA 3NHHA 5L37A 1QUQA 3J80L 1MJEA 1CTMA 1IKMA 1SNCA 2N88A 2L4NA 1EY6A 2F0OA 2JP1A 2KECA 3I90A 1JORA 4HJ7A 1IBML 2IX0A 3HS0C 4KKTA 2JXMB 1ONLA 1VF7A 4EQOA 5K36G 2K5NA 4Q0FA 1PLFA 3HOZH 3UDGA 4AQYL 1TS2A 3GTGH 3PUXA 4WJWA 2K5WA 3HOZB 4R8NA 1XNRQ 1EEID 3FVQA 5KRUA 5IYCG 1DJRD 1NR2A 2KCMA 4BWGB 3PUWA 1SNQA 1UE6A 2PMZE 3I73A 2L55A 2NBFA 1OO9B 5CV9A 2DJFC 2LY7A 2ZXOA 1Q46A 1R4QB 1X56A 5ELOA 3H0GB 5C5MA 4DR1L 4AQYQ 2UUAL 5C3EB 4ZUIA 1KNEA 2DNEA 1SE4A 4XQQA 1PYWD 1VDZA 4HJ9A 3K80C 1X6OA 2SOBA 4QF4A 2ZJRA 1SXTA 5JOBA 2NUCA 4KTAA 3J80E 4JW0A 1L1OC 2MUYA 3U4VA 4KI0A 5FO7B 1ZKOA 4RCNA 2C35B 3OW7A 1XYIA 1MHWC 3L7ZC 1U4PA 3URYA 4S3SA 3AB9A 2I46A 2A68C 3HOUB 4BBRG 2E5LQ 4GLVB 4LF7Q 2MNAA 4HJAA 4C3IG 3MVVA 4A3KB 1SROA 4OWTB 2QEXA 4JI3Q 2Z6KC 1UNSA 1R9TB 4XYOA 3PF4A 1GHJA 1LT3D 3ER0A 1JT8A 3FPPA 5FKAC 3S2DB 4OO1H 3EN2A 3BS1A 4JBMA 1B3QA 1PRTB 1KDCA 2WFWA 4JOIC 1EIYB 1SYDA 3QO2A 3TEHB 2VY3A 1SAPA 4UPAA 1K8OA 3DEOA 3C2PA 4JI5L 1C48A 1TWGB 4HMIA 4QIWB 2KCTA 1K9MC 1GUSA 1PV4A 3K0YA 3S17B 3HZXA 3Q22A 5IT9L 1ILQA 3RLFA 2JA6G 1HA5A 1T9HA 3UE0A 4ABNA 1VQNA 1Y1WH 4X64Q 1D5XC 5C0XH 5GQOA 4R1JA 4RHSA 2C5CA 2ZTEA 3D6WA 2A19A 1EY4A 1SFOB 4DV5L 1V8QA 3TREA 5KNCA 2RF4A 3S24A 1G8ZD 2OEOA 2RDFA 2UXBL 3RLNA 2P5ZX 4LF4L 4UY8C 3CRLC 3TQYA 4DNRB 1I3QB 1K83H 1LTID 1SMYD 3ULJA 3HRZC 1SEBD 4JYAQ 5I2XA 4DR6Q 1H9KA 1ZYRC 1L2FA 5E3FA 1QNUA 3UDIA 1RF2D 2RDGA 3VYTA 2Y0SE 2RVLA 2WKDA 5KNBA 1N36L 4BY1H 1STHA 2OT2A 4R4QA 2AUKA 2YTVA 3FKIH 3K59A 1G51A 1IBKL 1JE4A 2B8GA 1VQOA 1X3GA 1J9OA 1JOKA 2G5DA 4J6HA 1XNQQ 4CJ0B 1WD0A 4JCVE 3KFUA 2E2IB 2NTTA 1JWMD 2L12A 2WB1B 2KQ3A 5EBDA 1TWAH 2A69C 1WTHA 4P74A 3NTHA 5BN3A 1N8RC 1SJHD 1DYQA 3S1MH 5IP7G 2AKWB 3QIAA 3BVMA 4DAPA 2JA8G 4DNTB 2JA7G 3E0JA 5ELEA 2JEBI 4A3CH 1AFPA 1U0LA 2HQEA 2RCFA 1YNJC 4B3SL 1TS4A 4IUNA 4DV1Q 2WAQB 4FP5D 1DONA 3KLWA 3V2TA 3OTOL 1EQQA 2EY1A 1PH3A 3AEVA 2JN4A 2BE5D 2BDOA 5CMDA 2V4DA 1PZJD 3OIPA 2VW9A 4A3MB 1C7YA 2IY5B 1Q81C 1JWSD 2B2YC 2XSCA 1SYCA 3NPPA 3CCEA 3CCQA 3I2ZA 2VUMG 4DK3C 4CKEA 2K03A 2DN8A 5LL6S 1XX8A 5CORA 2L5TA 4DAYA 1YNXA 4FF2A 3D31A 4BY7G 4C2MH 3BZKA 1MD2D 5IYDG 4IPDA 3MWYW 5JEAH 2H1EA 1SNOA 2AMCB 1ENCA 1LTBD 2PYKA 1Z9FA 2MQHA 1WOCA 1GOZA 1UE7A 3I91A 1WTRA 4MNOA 2FJ2A 4N8X1 1HNZQ 1XMQL 3WOFA 2F0VA 2I5LX 1S5ED 5IWAQ 1YNND 1VQCA 3BDCA 1ENFA 3EVQA 5JJIA 2QCPX 5C4XB 4L8JA 5M9OA 3H3VC 1BQQT 1UUPA 4ME5A 4OWWB 2F0WA 1XMQQ 1EQTA 1EFWA 2EYMA 2Z9HA 4WJ3M 3SVMA 1TWFH 1STEA 1K28A 1BCPB 3VR6A 2NN6H 2EXZA 1PZID 1EQRA 3U4ZA 3CHBD 4GZYC 1EY5A 2EY2A 1HCZA 1TWHB 2F52A 4QUFA 2KOLA 5I9OA 2EIFA 1TS5A 4B3ML 2F0MA 1Q86C 3FKIG 4HR7B 4K8JA 4ULLA 1VQ7A 2IWHA 1JCKB 4BS9A 4GN3B 5I4DA 1IBLL 5C44G 4Y7NB 2FFKB 3F2DA 2MO1A 1IBLQ 5I6WA 1RTNA 1KC8C 1AH9A 3TDQA 4F7XA 4IUTA 1HQMC 4MTKA 3RZDH 3G48A 2R7ZB 1DOMA 2BCOA 3KLRA 4AIMA 4IJLA 5CR3A 1PFSA 1VQGA 2CW0D 2GVBA 4KHPL 3K0XA 1C9OA 3HOUG 3MXGA 1PTOD 5DAUA 1I94Q 2PI2A 3OWEB 5FJ8H 4JBKA 2R61A 4OONA 5COYA 3M7GA 3HOWB 5JJLA 4JI0L 3KBGA 1WCMH 2D0PA 1LTTD 2A74C 2HT1A 3BG3A 3KF6A 5DM63 3HKSA 3JAMc 1CKOA 1SRUA 2CVRA 2HHHQ 3PO3H 1JMCA 3EROA 3J7YW 4DK1A 1R9TH 1STYA 1M90C 4JC0A 2EJFC 4KKUA 1HNZL 2EYFA 3NK9A 5C3WA 1KXLA 1X32A 5LHY1 5E4WC 3D4RA 5DLQE 2EJGC 2VQFL 3A8KE 1CK1A 1F2LA 1OTCA 1AP0A 4LF8Q 3KUPA 5IY0A 1PFNA 3M9BA 3SXHA 2VZAA 4AYBG 4K14A 3E3XA 3PIOA 1HNWQ 4DFAA 3STBC 4KKSA 1H9JA 4DN4M 1B9MA 4A3LG 4L5RC 2VB2X 3KDFA 1YZ6A 1EU3A 1FD7D 4AYBE 5IGGA 1LYLA 2Z6BA 2F0QA 4I7ZC 2HIVA 3TP8A 1SMXA 2BA1A 4LF4Q 1II3A 1IXRA 1TR5A 3PGZA 3NWSA 1X55A 4FF1A 5HGQA 3KLSX 1HHVA 2PPBC 3NE5B 1BOSA 1BBXC 1J5EQ 4KJNA 4O42A 1SYBA 3MC0B 1IZ6A 4JI7Q 1NAPA 5IGCA 3SR1A 4IPHA 5ELNA 3M4YA 2RDHA 4R9WA 3GV3A 1QG7A 1U4LA 2UXCQ 3L3OC 3SHLA 2B2WC 3R2TA 3K8AA 4L5QA 5C3EG 2JQOA 1TXYA 3KOJA 2JEAI 4ID6A 3DWPA 2AUJD 3GV6A 1I6HB 1UAPA 3J7AV 5H1SE 4JI4Q 2Z4HA 2K7VA 1SNPA 3HG9A 1Y1VH 3I4OA 2L15A 1KDAA 3SEBA 5KIXA 5FLXc 1PA6A 2OCEA 2F3VA 2WB1E 1EY9A 1PH1A 1HFGA 5IYCH 1PHJA 4NKLA 4RAUC 2E2JH 1SE2A 5AJ3L 2JJQA 1YITA 5EKIA 5GROA 3H3VI 3H94A 3MA2B 2F3WA 5KNDA 3NELA 2QGQA 1LT4D 3HOXB 4X6AH 1IW7D 4K5XA 4DV4L 1RL2A 3GD7A 3HFZB 2B2UA 5D3DA 2PQEA 4L5SA 3TN2A 1NTGA 1KAWA 3ULPA 5FJ8G 1VQHA 4DR6L 1FJGQ 4POGA 4EGVA 4HIDA 3D4WA 4LUVA 3PMFA 1TIID 2F0PA 4HN7A 4NW2A 5CV7A 3E9IA 1GD7A 4YWKA 3W3AA 1RIPA 5T1GA 4A3MH 3H3VH 3S16B 2UUAQ 1XPUA 2F0DA 3A7AB 2MO0A 5K5PA 2IX3A 1ESRA 4PMCA 2ATWA 5E7NA 3OW2A 1CKMA 2HDLA 2LFNA 4O1NA 2KUMA 4A3DB 1B50A 4IUUA 4BBRB 3J81E 1Y69U 5ISRA 1XMOL 4KY5A 3T53B 1QZGA 3HOYG 3BVGA 1H9SB 3Q0AA 4A93G 3CPFA 2RHQB 2K5QA 4YHHQ 5DNFA 2B2UC 1TKWB 4H44C 4C1NI 2NWGA 2EQSA 4HTHA 2K5DA 2K75A 4GNXC 5EQ0A 4B08A 1GUTA 5IP9G 3PUYA 5ELCA 4JI4L 4JOIA 2R7ZG 5C4ZA 2EZVA 2VUMH 3VR4A 3PUVA 1GUOA 2A6ED 1TU2B 4POFA 5CGKA 3RZOB 5EPLA 2G9HD 4ME3A 3C1FA 3DUZA 1O80A 4FF3A 4LF7L 2NVQB 2UUCQ 1Y1WB 1MKHA 4XXEA 1LO5D 1NMFA 3HOWH 3F1ZA 1TWCH 3K7UC 5IGBA 2F3IA 3S2HH 2G9DA 5CV8A 1SMYC 4O2DA 4L63B 4DKAC 3DWAA 4IURA 3N52A 1ZYRD 1E2VA 5NUCA 5M3MH 4DAMA 1YJ9A 2FXQA 3GTJH 4DUYL 3KF6B 4RKLA 1NCVA 2LMCB 4MTNA 5ELBA 2N49A 4XTCS 1RODA 2DGYA 5JEAJ 1PFMA 5IYBH 2EYHA 3I4MH 2R92B 3GTLB 2B2TA 1JICA 1WTQA 3EIVA 2NZHA 4X65Q 2EOTA 1VQLA 1Q8KA 3ERQA 4DR3L 2Z8LA 1A8VA 5IGEA 1E7ZA 3OWFA 2K50A 3VA5A 3NBIA 1L1OA 3SDZA 2I5HA 1ENAA 2Z1CA 2YU9B 4V0BA 1MIUA 4O0AA 2ZJPA 1FNVA 1U4MA 1PRTD 1U5KA 4CDDC 2NVXH 3I70A 3T1HL 2RQXA 1NBWA 5HY6A 1V1PB 1HZAA 2PQAA 3CF5A 1ASZA 1W2BA 3J80c 1VQKA 1IL8A 1G2SA 1EY0A 3VR2A 1LLRD 3PV0A 1J6QA 4BBSB 2Y0SB 2ZTCA 4IO9A 1I4GA 4LF9L 2PZWA 1FGBD 3Q6SA 1CA5A 1U4RA 4XQJA 1RDPD 1RJTA 4DU9A 3F2BA 1MI2A 1X54A 4KLKA 2KHJA 3IAYA 4YCUA 4K6LA 4IOAA 1X65A 1M8AA 2J7ZA 1L0XB 1A15A 1Z47A 2F0UA 4PZ7A 2OTLA 1SJED 3K5NA 3CCVA 1F9QA 1HPCA 1CHPD 5C0XG 3C3LA 3A55A 4FXGC 1VQEA 2VQEL 2NVQH 1EWIA 1BXTA 2NB0A 4OO1G 2E76C 3HKZB 3FMCA 4DV6L 1PH8A 4PMBA 4C3JH 1FL0A 4X3KA 1A62A 2LXKA 1YNNC 1FYCA 2VL6A 2O2LD 3GTKH 4GKKL 4HCEA 3HOWG 5CYUA 1GO3E 1O7ZA 3T16A 5D3IB 3CCUA 3SK6A 2CH4W 3D8GA 3KF8B 4OELB 3S1NH 1L1OB 4K6DA 4A3JB 4GKJL 1E24A 1YEZA 3DXJC 4IOCA 1NSNS 5IWAL 3E0EA 2B63H 1VQ9A 5M3MG 4DV3Q 4GOPA 4P72A 1EZ8A 2MGSA 2YYZA 3NEMA 4A3DH 1NY4A 2OQ0A 3PO2B 4IUPA 4JI1Q 2RCNA 3U58A 1ESFA 4QB4A 2E8GA 5FO8B 4J1MA 1CM9A 4K2LA 2NTSA 5A35A 3MHBA 4KHVA 1RD9D 4JG2A 4KN7C 1CSPA 1K8AC 2HIXA 3I8ZA 4APVA 2DUDA 4DR4L 1TY2A 2EXDA 3PSIA 2Y0SG 5IGDA 2CKZB 4K5WA 1N34Q 1FGUA 4HMJA 5FLMH 3OSOA 4YY3Q 1I5FA 4BA2I 1STAA 5IT9c 4DAVA 2UXBQ 3FRPB 3DEPA 1I4XA 1R4PB 1E2WA 1KRTA 3P75A 2A5HA 5JVG3 1VF5C 2FMCA 3J81i 2NZOA 2FHTA 2PNRC 5LMUL 5A2QE 2JSOA 4G4KA 2UU9L 1PH9A 1KLGD 2XRSD 2X6LA 3IFDA 1D1IA 3RD4A 3RR5A 4L6TB 3JAML 1K0RA 3TBIB 2OTJA 4F87A 1OXUA 1TWFB 3A56A 3S14H 2I5MX 1E1OA 4A3FH 3V05A 3A74A 5GAEC 1Q1BA 5IYDH 5C3XA 4A4IA 1PZKD 1SLJA 3BU2A 1HR0W 4C3IH 4FO2A 1X3FA 1UE5A 1PFBA 5JPMC 2R92H 2N8NA 4GOPB 5HGTA 1N9WA 3UE1A 1K8GA 3GTQH 3L0OA 1VQ4A 1PH7A 1BBWA 1J8IA 4JI3L 3I7FA 4JI1L 3FP9A 4HEDA 1NR4A 1F9RA 1JOOA 4K0KL 2IHFA 1AN8A 2E2DC 1BBUA 3A7LA 2M9VA 1I50H 5M3FB 3RUZA 5LMNW 4IPGA 2MPMA 1GUGA 3KF8A 3TRZA 5C0XI 1KTKA 3IKJA 3D4DA 5EKLA 3LX0A 3S1QH 2ZT9C 3ITPA 4IUVA 2RHSB 2V1CC 4B3RQ 1S5CD 3R8BA 5K36H 4FYDA 1D1KA 2XNAC 1ILPA 4IQZA 4LUZA 2O4XA 3FEWX 1DOLA 2B2WA 3BDLA 4X65L 4DR1Q 3PIP3 2ES2A 1VMCA 3MXUA 3K5OA 5DM73 1T5XD 1IHZA 4C1NK 4DR5Q 5M5XB 3GTMB 4OEMB 1DGSA 4C3IB 4A3KG 1HJPA 2AQ2B 2F0HA 2VQEQ 4A3GB 4KD3A 1S72A 1WTXA 4A3FB 2ENBA 2SDFA 2NVYB 3V96A 4G7ZC 4KJOA 3K6OA 1B53A 2QKIC 2UUBL 3S2DH 1V1PA 1YBYA 1K8MA 2DNCA 4QIWE 1HTLD 4CKCA 1B9NA 4ALPA 3PIPA 4CGYB 3GTLH 4Y7NH 4BXXH 4J15A 1IBMQ 5CV4A 1I50B 2HD3A 3SK4A 1N32L 2EJMA 1YVCA 3HEJA 3I3CA 3CW2C 2J4XA 2AWOA 5FLMG 1SBBB 2IL8A 4CJ2C 2GN5A 3ND8A 4WORA 4LFAL 3CQZB 5M3FH 1S40A 2CCZA 1HUMA 4JI2L 1QJOA 2A8VA 3U50C 1GUWA 1DXMA 1YJWA 3OOCA 1O78A 3X3MA 4DV7Q 1STGA
chains in the Genus database with same CATH topology
4OIJA 4ZKBB 2KEEA 2R3ZA 2F0IA 2F0LA 1RKNA 1PTOB 1CA6A 2D5DA 4PV1C 1ET6A 3GTGB 2BDNA 1QWYA 5AFWA 2B63B 4ZQ3A 4RGTA 4FVMA 2K33A 4LJZC 1RTOA 2Q8TA 1KDBA 1A2UA 4C2MB 1XWEA 4QUCA 5BN4A 1T5EA 3K5MA 1QOHA 1HA6A 2A69D 1A6XA 2A68D 2WIIB 2EVBA 1CFMA 2XIWA 2F1MA 3A8JE 4V190 5C5LA 5IGFA 3VA7A 3NBHA 4MHEA 2MHVA 2B8FA 1L0YB 2OF1A 3A8IE 1D5ZC 3DM1A 4UDUC 4OIKA 1LV9A 4QCLA 1W6KA 4NP5A 1F9PA 4C3JG 4ODGA 1V1OA 3SE0A 2EE1A 1A3TA 4P2CB 1EU4A 1C8CA 1Q8IA 1JB3A 1F2YA 2WV6D 1EWHA 3EJIA 2KEDA 1WD1A 1MGSA 4C3JB 1EY7A 1OXTA 1CT1D 4N9PA 4LAAA 2F0FA 2EYOA 2RSOA 1V43A 3HP3A 3PUZA 3OMCA 1JR0D 1SYGA 1WTPA 1D6EC 3LWUA 1FNUA 3LNNA 1I6VC 5EGTA 4IUQA 4WFN3 3NTKA 2K32A 1SYFA 2QEJC 4OL7A 2IPKD 5I9PA 1H9MA 1MSGA 2C9OA 1B44D 1SDFA 2E2HB 1W6JA 2CQAA 3IFTA 1OXVA 1TWCB 1IYVA 1ML0D 5CBEE 3VYUA 5JEAG 3S14B 1A3UA 3MAQA 4B9WA 2ICIA 1O7LA 1SSOA 4MIUA 3TP6A 4CKBA 4E6IA 3NP8A 1I4RA 5D65A 4ZRZA 2EYLA 4I65A 3S9WA 1EQVA 2VNUD 3N6RA 4J8QA 1VCIA 3R93A 4TSSA 4ZAIA 4FXKC 4F8MA 1ZEQX 3T56B 4OHJA 1WCMB 2WINB 4AYBB 2IW3A 5FLXL 1C4QA 1EOTA 3MFYA 3QOJA 4EQNA 2BA0A 3MEHA 5FK9C 1X3PA 2QF7A 3S2HB 1F9SA 3GTJB 2A6HC 1LACA 2FMMA 2JYOA 2WP8J 3K7AB 2EYPA 1G2TA 1Y1VB 2M00A 4FNFA 2OXPA 4BY7B 4RWSC 1JWUD 5C0XJ 2R93B 1B2TA 1X3QA 3TP5A 3CRKC 1CZWA 1MBYA 3QJYA 2KHSA 4U68A 2VUMB 1D5MC 3GTPB 2XRQD 5IODA 4RGMA 3QOLA 5E4XA 3S1RB 4XT3B 4PMWA 4RKBA 1LTGD 4C3HB 4DK0A 2AWNA 5EBCA 1KLUD 3E6ZX 4U673 4X3UA 4KY7A 4ZUJA 1LABA 3ONAB 5C44B 3NWTA 2NN6I 3C46A 1BCPF 2JA7B 1BDOA 2JA8B 4KK7A 1G91A 2LS01 2NVTB 3OMGA 5CC4A 2F0GA 3M3YB 5J1ZA 3P7JA 3S1NB 5KYIA 2KCCA 3M85A 4M1UB 4ZK9B 2Q8IB 5FOBB 1CZGA 2L9HA 5DEHA 2PCFB 2XN9C 3J81L 5C6AA 2PZTA 4KHZA 2D2CC 1WVLA 2EY5A 3FPUB 4EQPA 3TP7A 2WKCA 2TSSA 3VR5A 2HCCA 4KN4C 1IW7C 1Y8PB 1FR3A 2MP1A 2PZUA 3PIO3 4G7OC 1IYUA 1Y8NB 2A73B 4LK1C 2EYJA 3NQTA 4LMQD 3OPOA 3BDOA 3AMUA 5JJZA 1YNJD 1KNAA 4A3BB 2HDMA 2NYZD 3R2IA 1Q90A 3IL8A 2GA4B 1F2ZA 2M2LA 2Q8RE 1PTOF 1STNA 3CKIB 2F0TA 4OGQC 4IZ8A 2CW0C 2BE5C 1M4VA 2R6GA 3FDTA 3L9AX 2E74C 3NTIA 2F0SA 5EJWA 3VR3A 4EVOA 3PO3B 1O7YA 4DXFA 1GUNA 1KABA 2IX1A 1QB5D 4BA1I 1CHQD 1RCVD 1EYCA 2B2VC 2N55A 1JC7A 3DWQA 4K5VA 5D14A 3TZDA 1I4QA 3RZDB 1GXDC 1GHKA 3A54A 4IFDI 4UAIA 3P20A 3F2UA 4YIJA 2IT1A 3VYRA 4M8AA 4DF7A 4IN3A 1A3VA 2PO4A 5A2QL 5HURA 2VXWA 4KMUC 1VMPA 3EQLC 2XVSA 2B2TC 4HSPA 2RKSA 4G57A 2K01A 4K2KA 3NQIA 1PMRA 3TZUA 3T51B 5JAVA 2BOSA 1BUVT 2D9UA 5CV5A 2B2YA 4RA8A 1EEFD 2JA5B 3KK7A 4K8IA 4ZLTF 4ZYSA 3Q23A 3BYTB 1BR9A 1BCPC 2KVMA 5EKKA 1EYAA 3W2DA 1DD2A 1LT6D 3QWNA 3K5LA 2PW5A 1HQRD 4OO1I 4DGZA 4CJ1B 5M5YB 2EPBA 2ICEC 1EY8A 1NUCA 1S5BD 2D62A 3H6MA 2J0TD 3EFXD 3HGBA 1E0BA 1QILA 2AQ1B 2NVXB 1B1ZA 2NZ1D 4XDXA 1DOKA 2WACA 2K05A 1SNDA 1CQFA 1F77A 1XXGA 3H91A 4Q5VA 1JQYD 5KEEA 3MZ5A 1AZPA 3U9OA 1SYEA 2KJXA 4H0LC 4IFDJ 2XWJB 1TQOA 3MXNA 1MSHA 3K57A 2E2JB 1S5DD 1QE6A 3P1HA 2F0JA 3J7AF 1TWAB 4A3IB 5TSSA 4RGOS 3EA6A 2JA6B 2ZXRA 3T4AC 1Y8OB 1WTVA 5C4HA 1EYDA 3S1MB 4IFDH 1HUNA 4CHTB 3OHXC 4RFBA 2L11A 3O13A 2K04A 1ET9A 1HRJA 3MFGA 3U9SA 1AEXA 1EZ6A 4TKOB 4X3TA 4DXGA 1F2MA 4MN3A 2AQ3B 3BVZA 1STBA 2ZXPA 4BY1B 1DZ1A 5T1IA 4ILWA 4KV6A 2RA4A 5J39A 1LTRD 1TY0A 1I4HA 4N9TA 1LTAD 1BO0A 5M5WB 5IIFA 1S5FD 2L0CA 4C56C 4RGNA 2DY7A 3MTSA 1SNMA 1EWCA 1Q3LA 2NN6G 5F2DA 3C1EA 2PW7A 3WDNA 3GQBA 3NUCA 3BZDB 1D2BA 3NSWA 1H9RA 2H4OA 2Z4IA 5EPKA 1KAAA 2O5IC 5E1FA 4XYQA 5J22A 1WTOA 2E75C 1HTPA 2LKVA 2EY6A 1TS3A 1AZQA 1B3AA 1JOQA 5FLXE 3DHQA 4TQUS 3GP7A 3UI2A 2KA7A 4PNYA 1LT5D 2IJ0A 1CQVA 2EDGA 2SEBD 5KGUA 2O5JC 1EIGA 2I07B 3MXPA 2X6GA 1HXYD 3TSSA 3HOVB 4C3HG 3I4NB 3D3RA 3D6CA 3NXWA 1TT2A 3S15B 2XWBB 1BF4A 3I4LA 1A2TA 1QNKA 3G6JB 4KD4A 2A6EC 4RH6A 5C4JB 4FXDA 1ZXTA 4CBVA 1DM0B 1GJXA 1B4OA 2MJ8A 5LL6X 2K28A 2DY8A 3KBXA 3K58A 1EL0A 2SNSA 4F88A 4XT1B 3M7NA 4QMGA 2F03A 4HSVA 2RSNA 4XIGS 2X69A 1E2ZA 1SE3A 2RBMA 3E5SA 3SK8A 2F0NA 3H09A 3CU7A 2K1BA 3M4OB 3G7LA 5IOCA 5CBAE 2F0EA 2K6AA 4Z9CB 4KY6A 4TRDA 2B39A 1EFID 1WTWA 4NDXA 1UEAB 3ND9A 1Q12A 2F4IA 2HUGA 3BYYB 4WRDA 3GTKB 3AU7A 4RHRA 5EPJA 1G291 3T13A 1PTOH 1PRTC 5JPNC 5BN5A 1TVXA 4XQNA 4B9XA 5M3MB 5JVH3 1CI3M 4RCOA 1I4PA 1EIHA 1H9SA 1PRTF 1PDQA 1AW7A 2F0KA 5I6YA 2QILA 1Z6HA 3VYSA 3I4MB 3FKIB 3I72A 3ZYYX 3JAME 1U9RA 1DCZA 2TMPA 2A6HD 2L1BA 3S1QB 1PTOC 5IT9E 4FF4A 1FNWA 5CV6A 1BNZA 1K83B 5G3LD 2JE6I 2SNMA 3X3NA 4DA2A 3QG1A 2KCNA 2QDBA 3QB3A 3GTOB 3OIQA 5FO9B 2VB3X 1S4ZA 4G7HC 5I2YA 1OXSC 4NMZA 4H13C 1OXXK 5G3LF 2PMZB 4HCSA 3DMUA 1XTCD 1ICWA 4R8IA 4ZKCB 1PXUA 3LWEA 4IFDG 1QCBD 2HCIA 1IKLA 5ELDA 4A3EB 3HOYB 3RMHA 4A93B 1HFNA 1Z7TA 2ID0A 1LTSD 1RHPA 3GTQB 3TMEA 5KYLA 3SK5A 1Q1EA 3WOEA 3R3OA 1G6ZA 4H7BA 4HAEA 4JK1C 3KLSA 5ELFA 1BCPD 3GO5A 2CHBD 3Q24A 4JBWA 4IALA 2FINB 4X3SA 4PQXA 2B2VA 3NHHA 3J80L 1CTMA 1IKMA 1SNCA 2N88A 2L4NA 1EY6A 2F0OA 2JP1A 2KECA 3I90A 1JORA 2IX0A 3HS0C 4KKTA 2JXMB 1ONLA 1VF7A 4EQOA 5K36G 4Q0FA 1PLFA 1TS2A 3PUXA 4WJWA 2K5WA 3HOZB 4R8NA 1EEID 3FVQA 5KRUA 1DJRD 1NR2A 4BWGB 3PUWA 1SNQA 3I73A 2L55A 2NBFA 1OO9B 5CV9A 2LY7A 2ZXOA 1R4QB 5C5MA 3H0GB 5C3EB 4ZUIA 1KNEA 2DNEA 1SE4A 4XQQA 1PYWD 1VDZA 2SOBA 4QF4A 1SXTA 5JOBA 2NUCA 4KTAA 3J80E 2MUYA 4KI0A 5FO7B 1ZKOA 4RCNA 3OW7A 1XYIA 3L7ZC 1U4PA 3URYA 4S3SA 3AB9A 2I46A 2A68C 3HOUB 4C3IG 3MVVA 4A3KB 1UNSA 1R9TB 4XYOA 1GHJA 1LT3D 3FPPA 5FKAC 3S2DB 4OO1H 3BS1A 1PRTB 1KDCA 1SYDA 3QO2A 1SAPA 1K8OA 3DEOA 3C2PA 1C48A 1TWGB 4HMIA 4QIWB 1GUSA 3K0YA 3S17B 3HZXA 3Q22A 5IT9L 1ILQA 3RLFA 1HA5A 4ABNA 1D5XC 5C0XH 4RHSA 2C5CA 3D6WA 1EY4A 1SFOB 1V8QA 5KNCA 1G8ZD 2OEOA 2RDFA 3CRLC 4DNRB 1I3QB 1SMYD 1LTID 3HRZC 1SEBD 5I2XA 1H9KA 5E3FA 1ZYRC 1QNUA 1RF2D 2RDGA 3VYTA 2RVLA 2WKDA 5KNBA 1STHA 2OT2A 2AUKA 3K59A 1JE4A 2B8GA 1J9OA 1JOKA 4J6HA 4CJ0B 1WD0A 2E2IB 2NTTA 1JWMD 2L12A 2WB1B 2KQ3A 5EBDA 2A69C 3NTHA 5BN3A 1SJHD 1DYQA 3QIAA 3BVMA 4DAPA 4DNTB 3E0JA 5ELEA 2JEBI 1AFPA 2HQEA 1YNJC 1TS4A 4IUNA 2WAQB 4FP5D 1DONA 3V2TA 2EY1A 2BE5D 2BDOA 5CMDA 2V4DA 1PZJD 3OIPA 4A3MB 1JWSD 2B2YC 2XSCA 1SYCA 3NPPA 4CKEA 2K03A 2DN8A 5LL6S 1XX8A 5CORA 2L5TA 4DAYA 4FF2A 3D31A 1MD2D 3MWYW 5JEAH 2H1EA 1SNOA 1ENCA 1LTBD 2PYKA 1GOZA 3I91A 1WTRA 2FJ2A 3WOFA 2F0VA 1S5ED 1YNND 3BDCA 1ENFA 3EVQA 2QCPX 5C4XB 4L8JA 5M9OA 3H3VC 1BQQT 1UUPA 4ME5A 2F0WA 1EQTA 2EYMA 3SVMA 1STEA 1BCPB 3VR6A 2NN6H 2EXZA 1PZID 3CHBD 4GZYC 1EY5A 2EY2A 1HCZA 1TWHB 4QUFA 2KOLA 5I9OA 1TS5A 2F0MA 4HR7B 4K8JA 4ULLA 2IWHA 1JCKB 4BS9A 5I4DA 4Y7NB 2FFKB 5I6WA 1RTNA 3TDQA 4F7XA 4IUTA 1HQMC 2R7ZB 1DOMA 2BCOA 3KLRA 5CR3A 2CW0D 3MXGA 1PTOD 5DAUA 3OWEB 2R61A 5COYA 3M7GA 3HOWB 3KBGA 1LTTD 2A74C 3BG3A 5DM63 2CVRA 3EROA 3J7YW 4DK1A 1STYA 2EJFC 4KKUA 2EYFA 3NK9A 5C3WA 1X32A 5LHY1 5E4WC 3D4RA 2EJGC 3A8KE 1CK1A 1F2LA 1AP0A 3KUPA 1PFNA 3SXHA 4K14A 4DFAA 1H9JA 4KKSA 4DN4M 1B9MA 2VB2X 1EU3A 1FD7D 5IGGA 4I7ZC 2F0QA 3TP8A 2BA1A 1II3A 1TR5A 3NWSA 4FF1A 3KLSX 1HHVA 2PPBC 3NE5B 1BOSA 1BBXC 4KJNA 4O42A 1SYBA 3MC0B 1NAPA 5IGCA 3SR1A 3M4YA 2RDHA 4R9WA 3GV3A 1QG7A 1U4LA 3L3OC 3SHLA 2B2WC 3R2TA 2JEAI 4ID6A 3DWPA 2AUJD 3GV6A 1I6HB 1UAPA 3J7AV 2Z4HA 2K7VA 1SNPA 3HG9A 1KDAA 3SEBA 5KIXA 2F3VA 1EY9A 1HFGA 4NKLA 4RAUC 1SE2A 5EKIA 3H94A 3MA2B 2F3WA 5KNDA 1LT4D 3HOXB 1IW7D 4K5XA 3GD7A 2B2UA 5D3DA 2PQEA 3TN2A 4EGVA 3D4WA 3PMFA 1TIID 2F0PA 4HN7A 4NW2A 5CV7A 3W3AA 5T1GA 3S16B 2F0DA 3A7AB 5K5PA 2IX3A 1ESRA 4PMCA 2HDLA 2LFNA 4O1NA 2KUMA 4A3DB 1B50A 4IUUA 4BBRB 3J81E 1Y69U 5ISRA 4KY5A 3T53B 3BVGA 1H9SB 3Q0AA 2K5QA 5DNFA 2B2UC 1TKWB 4H44C 4C1NI 2NWGA 4HTHA 2K5DA 5EQ0A 4B08A 1GUTA 3PUYA 5ELCA 5C4ZA 2EZVA 3VR4A 3PUVA 1GUOA 2A6ED 1TU2B 5CGKA 3RZOB 5EPLA 2G9HD 3C1FA 3DUZA 1O80A 4FF3A 2NVQB 1Y1WB 4XXEA 1LO5D 5IGBA 2G9DA 5CV8A 1SMYC 4L63B 3DWAA 4IURA 3N52A 1ZYRD 1E2VA 5NUCA 4RKLA 1NCVA 2LMCB 5ELBA 4XTCS 1RODA 5JEAJ 1PFMA 2EYHA 2R92B 3GTLB 2B2TA 1JICA 1WTQA 2EOTA 3ERQA 2Z8LA 5IGEA 3OWFA 3VA5A 3NBIA 3SDZA 1ENAA 2Z1CA 2YU9B 4V0BA 1FNVA 1U4MA 1PRTD 3I70A 2RQXA 1V1PB 1IL8A 1G2SA 1EY0A 3VR2A 1LLRD 3PV0A 4BBSB 2Y0SB 1I4GA 2PZWA 1FGBD 3Q6SA 1CA5A 1U4RA 4XQJA 1RDPD 1RJTA 4DU9A 1MI2A 3IAYA 4K6LA 2J7ZA 1M8AA 1L0XB 1A15A 1Z47A 2F0UA 1SJED 3K5NA 1F9QA 1HPCA 1CHPD 5C0XG 3C3LA 3A55A 4FXGC 1BXTA 2NB0A 4OO1G 2E76C 3HKZB 3FMCA 4PMBA 4X3KA 1YNNC 1FYCA 2O2LD 4HCEA 5CYUA 1O7ZA 3T16A 5D3IB 3SK6A 3D8GA 4K6DA 4A3JB 3DXJC 1NSNS 1EZ8A 2MGSA 2YYZA 3PO2B 4IUPA 1ESFA 4QB4A 5FO8B 4J1MA 1CM9A 4K2LA 2NTSA 5A35A 3MHBA 4KHVA 1RD9D 4KN7C 3I8ZA 1TY2A 5IGDA 4K5WA 4HMJA 3OSOA 4BA2I 1STAA 4DAVA 3FRPB 3DEPA 1I4XA 1R4PB 1E2WA 3P75A 2A5HA 5JVG3 1VF5C 2FMCA 2FHTA 2PNRC 5A2QE 2JSOA 4G4KA 1KLGD 2XRSD 2X6LA 3IFDA 1D1IA 3RD4A 4L6TB 3JAML 3TBIB 4F87A 1OXUA 1TWFB 3A56A 3V05A 1Q1BA 5C3XA 1PZKD 4FO2A 1PFBA 5JPMC 5HGTA 1J8IA 4HEDA 1NR4A 1F9RA 1JOOA 1AN8A 2E2DC 3A7LA 2M9VA 5M3FB 3RUZA 2MPMA 1GUGA 3KF8A 5C0XI 1KTKA 3IKJA 3D4DA 5EKLA 3LX0A 2ZT9C 3ITPA 4IUVA 1S5CD 3R8BA 5K36H 4FYDA 1D1KA 2XNAC 1ILPA 4IQZA 2O4XA 3FEWX 1DOLA 2B2WA 3BDLA 3PIP3 1VMCA 3MXUA 3K5OA 5DM73 1T5XD 1IHZA 4C1NK 5M5XB 3GTMB 4C3IB 2AQ2B 2F0HA 4A3GB 4KD3A 1WTXA 4A3FB 2ENBA 2SDFA 2NVYB 3V96A 4G7ZC 4KJOA 3K6OA 1B53A 2QKIC 1V1PA 1K8MA 2DNCA 4CKCA 1HTLD 1B9NA 4CGYB 5CV4A 1I50B 3SK4A 2EJMA 3HEJA 3I3CA 2J4XA 2AWOA 1SBBB 2IL8A 4CJ2C 3ND8A 4WORA 3CQZB 1HUMA 1QJOA 1GUWA 1DXMA 3OOCA 1O78A 3X3MA 1STGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB2 X;  3TDQ A;  1ZEQ X;  2VB3 X;  2L55 A;  3E6Z X;  2QCP X; 
#chains in the Genus database with same CATH topology
 4OIJ A;  4ZKB B;  1HH2 P;  2KEE A;  2R3Z A;  2F0I A;  2F0L A;  1RKN A;  1PTO B;  3SGI A;  1CA6 A;  4GS3 A;  5C4X H;  1PH6 A;  2D5D A;  3GTO H;  2D0O A;  4PV1 C;  1ET6 A;  2ZM6 Q;  2UXD L;  2JA7 H;  3GTG B;  5JJK A;  2BDN A;  1QWY A;  5AFW A;  3HOX G;  2GVA A;  2B63 B;  4DR3 Q;  5LMN Q;  4ZQ3 A;  4DUZ Q;  1VS0 A;  4RGT A;  2CFM A;  4FVM A;  4P75 A;  2K33 A;  4LJZ C;  2UUB Q;  1RTO A;  2Q8T A;  4OX9 L;  1KDB A;  1Y1W G;  1A2U A;  3HKZ E;  4C2M B;  2CH4 A;  1XWE A;  4QUC A;  4UHV A;  3PO3 G;  4GNX A;  5BN4 A;  1T5E A;  4DR5 L;  5IP9 H;  3K5M A;  1QOH A;  1PH4 A;  1HA6 A;  2A69 D;  1A6X A;  1E22 A;  2A68 D;  2EVB A;  2WII B;  4JV5 Q;  1GM5 A;  1CFM A;  4TVA B;  2XIW A;  4LFC L;  2F1M A;  3A8J E;  5C5L A;  5IGF A;  4V19 0;  3UDF A;  3VA7 A;  3NBH A;  4MHE A;  4JI8 Q;  3CP0 A;  1CSQ A;  2MHV A;  1YI2 A;  2UXD Q;  2B8F A;  1L0Y B;  2OF1 A;  1CKN A;  1KD1 C;  3A8I E;  1D5Z C;  4A3J H;  1X3E A;  1Q7Y C;  3DM1 A;  1VQ5 A;  4UDU C;  4BY1 G;  4DV4 Q;  4OIK A;  1LV9 A;  4QCL A;  1AE3 A;  4OWX B;  1W6K A;  1ASY A;  1PYS B;  4NP5 A;  1F9P A;  2F4V Q;  4C3J G;  4ODG A;  5BR8 L;  5AJ3 Q;  1V1O A;  3T1Y L;  3SE0 A;  2EE1 A;  4P71 A;  1A3T A;  4P2C B;  4NXN L;  4JVZ A;  3TS0 A;  1L0W A;  1EU4 A;  1C8C A;  1Q8I A;  4PZ6 A;  1JB3 A;  1F2Y A;  3EBE A;  2WV6 D;  5IP7 H;  1EWH A;  2NVY H;  3EJI A;  2KED A;  1WJJ A;  1WD1 A;  1MGS A;  4DPG A;  4C3J B;  2B63 G;  1EY7 A;  1OXT A;  1CT1 D;  2YTX A;  4N9P A;  4LAA A;  2F0F A;  2EYO A;  4A3I G;  2RSO A;  1V43 A;  3W5O A;  4GNX B;  3HP3 A;  3PUZ A;  3S15 H;  3OMC A;  1JR0 D;  1SYG A;  1WTP A;  1D6E C;  3LWU A;  1FNU A;  3CCM A;  3LNN A;  1I6V C;  2IHE A;  5EGT A;  4IUQ A;  4WFN 3;  3NTK A;  2K32 A;  4B3T L;  1SYF A;  2QEJ C;  3NBH B;  4OL7 A;  3CPW A;  4A3B H;  2IPK D;  3RN5 A;  5I9P A;  1H9M A;  1MSG A;  2C9O A;  1JB7 A;  1B44 D;  1SDF A;  4R4T A;  2E2H B;  1W6J A;  2CQA A;  1CKN B;  1E1T A;  3IFT A;  4X66 L;  1OXV A;  4X62 Q;  2OWO A;  1TWC B;  1WYD A;  1K73 C;  1B8A A;  1HNW L;  1IYV A;  1ML0 D;  5CBE E;  3VYU A;  5JEA G;  3LGJ A;  3HOY H;  4A93 H;  3S14 B;  2DJG C;  1A3U A;  2LXJ A;  4QJF A;  3MAQ A;  4BBR H;  4B9W A;  2ICI A;  1O7L A;  1SSO A;  4K0K Q;  4MIU A;  1V9P A;  3TP6 A;  4HJ5 A;  2ASB A;  2R93 G;  4CKB A;  4E6I A;  4DV3 L;  1PVO A;  3NP8 A;  1I4R A;  5D65 A;  4ZRZ A;  2EYL A;  3CC2 A;  1KL9 A;  4I65 A;  3S9W A;  1EQV A;  1TWG H;  2VNU D;  3N6R A;  4J8Q A;  1VCI A;  3NEN A;  3R93 A;  4TSS A;  4ZAI A;  4FXK C;  4F8M A;  4NXM L;  1XPR A;  1B70 B;  1ZEQ X;  3T56 B;  2UXC L;  4OHJ A;  1WCM B;  1LUZ A;  2WIN B;  4AYB B;  4CDF C;  4KHP Q;  2IW3 A;  5FLX L;  4QGU A;  1C4Q A;  4DV6 Q;  1EOT A;  5IE8 A;  3CCJ A;  3MFY A;  1HR0 L;  3QOJ A;  4EQN A;  5GAD C;  2BA0 A;  2K4K A;  3MEH A;  2QW7 A;  1X3P A;  4FDB A;  5FK9 C;  1M1K C;  2QF7 A;  3S2H B;  1P16 A;  1F9S A;  3GTJ B;  2A6H C;  3K7A H;  1LAC A;  1JJC B;  4RG1 A;  2FMM A;  2JYO A;  4DV2 Q;  2WP8 J;  3K7A B;  2EYP A;  1G2T A;  1Y1V B;  3MEF A;  2M00 A;  4FNF A;  1G6P A;  2OXP A;  4BY7 B;  4RWS C;  1XPO A;  1JWU D;  5C0X J;  2R93 B;  1I6H H;  1B2T A;  1X3Q A;  4B3M Q;  3TP5 A;  3CRK C;  1CZW A;  1MBY A;  3QJY A;  1NNX A;  2KHS A;  4I7A A;  4U68 A;  1HNX L;  3RNU A;  2VUM B;  3AYH B;  3S1R H;  1D5M C;  3IRB A;  4LF8 L;  3GTP B;  2XRQ D;  5IOD A;  1MJC A;  2N78 A;  4RGM A;  3QOL A;  2XTI A;  4CDE C;  2VQF Q;  4HIM A;  5E4X A;  1S3O A;  3S1R B;  4XT3 B;  1YIJ A;  1C0A A;  4DR7 L;  4PMW A;  4RKB A;  3I4N G;  1LTG D;  4C3H B;  4DK0 A;  2AWN A;  3HOV G;  5EBC A;  2E2I H;  1KLU D;  3E6Z X;  4RMF A;  4U67 3;  4X3U A;  4KY7 A;  1XJV A;  4QQB X;  4ZUJ A;  1LAB A;  3ONA B;  5C44 B;  3B6Y A;  3NWT A;  2NN6 I;  2JA8 H;  4DR2 L;  3C46 A;  1BCP F;  2JA7 B;  1BDO A;  2JA8 B;  4JI0 Q;  3M3Y H;  1VQ6 A;  4KK7 A;  1G91 A;  2LS0 1;  2NVT B;  3OMG A;  4HIO A;  3QR8 A;  5CC4 A;  2F0G A;  4A3C G;  3M3Y B;  5J1Z A;  4LF6 L;  3P7J A;  3S1N B;  5KYI A;  2KCC A;  3M4P A;  3M85 A;  4BBS H;  3AFP A;  1N33 L;  4M1U B;  4ZK9 B;  2Q8I B;  2VS1 A;  5FOB B;  2I0Q A;  4A3L H;  2R93 H;  1CZG A;  2L9H A;  5DEH A;  2PCF B;  1PYB A;  2XN9 C;  3J81 L;  4LFB L;  5C6A A;  2PZT A;  4MZ9 A;  4KHZ A;  2D2C C;  1WVL A;  4DV2 L;  2EY5 A;  3FPU B;  4A3E H;  4EQP A;  3TP7 A;  4LW1 A;  2WKC A;  2TSS A;  2HCC A;  3VR5 A;  3HOX H;  4KN4 C;  1IW7 C;  1Y8P B;  1FR3 A;  2MP1 A;  2PZU A;  3PIO 3;  3OTO Q;  4G7O C;  4DNI A;  1IYU A;  1HZC A;  1Y8N B;  2A73 B;  2WAQ E;  1P8L A;  3K81 C;  4LK1 C;  2EYJ A;  3NQT A;  2YTY A;  4LMQ D;  4ZCK A;  3OPO A;  3BDO A;  4R4O A;  3AMU A;  4HIK A;  3AFQ A;  1SE8 A;  5C3E H;  4WJ4 A;  3T1H Q;  4NXM Q;  5JJZ A;  4JI6 L;  1YNJ D;  4DR2 Q;  1KNA A;  4A3B B;  2HDM A;  2NYZ D;  3R2I A;  1XTD A;  1Q90 A;  3IL8 A;  1Y1V G;  2GA4 B;  1F2Z A;  2M2L A;  2Q8R E;  1PTO F;  1STN A;  3CKI B;  3HKZ G;  2F0T A;  4OGQ C;  3I56 A;  4IZ8 A;  2CW0 C;  4LF5 L;  2BE5 C;  1M4V A;  2R6G A;  3JAM i;  3KJO A;  3FDT A;  1BKB A;  3L9A X;  2E74 C;  2E2H H;  3NTI A;  2F0S A;  5EJW A;  3VR3 A;  1X9N A;  4EVO A;  2Q2I A;  3PO3 B;  1EOV A;  1O7Y A;  4QL5 A;  4DXF A;  3CCR A;  1GUN A;  1KAB A;  2IX1 A;  5M5X H;  3GTM H;  1QB5 D;  1CHQ D;  4BA1 I;  1RCV D;  1XMO Q;  1EYC A;  3HOZ G;  1VQJ A;  2B2V C;  1HNX Q;  2N55 A;  1QVG A;  3ZJY C;  3G6E A;  1JC7 A;  3DWQ A;  4K5V A;  3A5U A;  1EIF A;  1K3B C;  5D14 A;  3TZD A;  4IPC A;  1I4Q A;  3RZD B;  4JYA L;  4GN5 A;  1GXD C;  1PH2 A;  3A54 A;  4DUY Q;  1GHK A;  4IFD I;  4QY7 A;  4UAI A;  3I4N H;  3P20 A;  5C44 H;  3F2U A;  1V1Q A;  1YHQ A;  3HOV H;  3H0G H;  4YIJ A;  3CC4 A;  2IT1 A;  1I3Q H;  3VYR A;  4EQ5 A;  4M8A A;  3WWV A;  1VQM A;  2JA9 A;  4DF7 A;  4DV5 Q;  4IN3 A;  1A3V A;  2PO4 A;  3STB D;  5HUR A;  5A2Q L;  1KHI A;  3CC7 A;  1FJG L;  2VXW A;  4KMU C;  2Q2H A;  4X64 L;  1AE2 A;  1VMP A;  4B3S Q;  3EQL C;  4L5T A;  2XVS A;  2B2T C;  3JC6 6;  4HSP A;  2RKS A;  4G57 A;  2UUC L;  2K01 A;  4DK6 C;  1TWH H;  2A1A A;  4K2K A;  4R4I A;  3NQI A;  1PMR A;  3TZU A;  1IYJ B;  3E9H A;  3AQQ A;  3T51 B;  5JAV A;  2BOS A;  2NVT H;  2WAQ G;  3G71 A;  1BUV T;  4NXN Q;  2JA5 H;  2D9U A;  4YCW A;  5CV5 A;  2B2Y A;  4RA8 A;  1EEF D;  2JA5 B;  1VQP A;  3KK7 A;  2YV5 A;  4YHH L;  2F4V L;  4K8I A;  2K5H A;  1BVS A;  2H5X A;  4ZLT F;  4ZYS A;  3RN2 A;  3M4Q A;  3Q23 A;  3BYT B;  1BR9 A;  1SN8 A;  3S17 H;  1BCP C;  2KVM A;  5EKK A;  3RZO H;  1EYA A;  1O7I A;  3W2D A;  1LT6 D;  1DD2 A;  3QWN A;  3K5L A;  2PW5 A;  1HQR D;  2Z0S A;  4OO1 I;  4DGZ A;  4CJ1 B;  4X62 L;  1QUQ B;  1Y14 B;  5M5Y B;  3L2P A;  2EPB A;  3OYY A;  3KDF B;  2HQL A;  1HZ9 A;  2ICE C;  3J81 c;  5C4J H;  1EY8 A;  3CME A;  1NUC A;  2LSS A;  2MFI A;  5M5Y H;  1S5B D;  2D62 A;  2PNH A;  3H6M A;  2BH8 A;  2J0T D;  1EUJ A;  3EFX D;  3HGB A;  4AH6 A;  3BJU A;  4B3T Q;  4LFC Q;  3RLO A;  1E0B A;  1QIL A;  2AQ1 B;  2NVX B;  1B1Z A;  2NZ1 D;  3FHW A;  4XDX A;  1DOK A;  2WAC A;  2K05 A;  4YWL A;  3PQI A;  1SND A;  3TS2 A;  1CQF A;  1F77 A;  5IYB G;  3PF5 A;  1XXG A;  4LNQ A;  3H91 A;  4Q5V A;  1JQY D;  5KEE A;  3MZ5 A;  1AZP A;  3U9O A;  4IJH A;  2Q2T A;  1SYE A;  2KJX A;  4H0L C;  3BZC A;  4IFD J;  3CCS A;  2XWJ B;  3I4M G;  4BXX G;  1TQO A;  3MXN A;  1KIX A;  1MSH A;  2N3S A;  3K57 A;  4JI5 Q;  2E2J B;  4R4C A;  1S5D D;  5LMN L;  1VQD A;  1QE6 A;  3GTP H;  3P1H A;  2F0J A;  3J7A F;  3G4S A;  1TWA B;  4A3I B;  2HHH L;  5TSS A;  3KYH C;  4A3I H;  4RGO S;  3EA6 A;  2JA6 B;  3H0G G;  5BR8 Q;  3T1Y Q;  2ZXR A;  2K14 A;  4PG3 A;  3T4A C;  4DV7 L;  1Y8O B;  4JI6 Q;  2YU9 H;  1WTV A;  5C4H A;  2E5L L;  1EYD A;  3CMA A;  3S1M B;  4IFD H;  1HUN A;  4CHT B;  4JI2 Q;  4JI7 L;  3OHX C;  4RFB A;  2L11 A;  3CD6 A;  4LFA Q;  3O13 A;  1J5E L;  1JE5 A;  1UE1 A;  2K04 A;  4A3G H;  1A63 A;  5M3F G;  1ET9 A;  1HRJ A;  3A0J A;  1N32 Q;  5J3B A;  3MFG A;  3U9S A;  1AEX A;  2B29 A;  1EZ6 A;  4TKO B;  4HJ8 A;  4X3T A;  4DXG A;  1F2M A;  4MN3 A;  2AQ3 B;  3BVZ A;  4LFB Q;  1STB A;  2ZXP A;  4BY1 B;  1DZ1 A;  5T1I A;  4ILW A;  4KV6 A;  3D0F A;  2RA4 A;  1D8L A;  5J39 A;  1LTR D;  5C4X G;  1TY0 A;  1I4H A;  4N9T A;  1LTA D;  1BO0 A;  4OX9 Q;  2KBN A;  1VQA A;  4LUO A;  3H15 A;  4LF6 Q;  5M5W B;  3UDX A;  3F2C A;  5IIF A;  3KJP A;  1S5F D;  4H02 A;  2L0C A;  4C56 C;  4RGN A;  4DUZ L;  2QDL A;  1KRS A;  2DY7 A;  3MTS A;  1SNM A;  1VQF A;  2QA4 A;  3J7Z C;  1EWC A;  1Q3L A;  2NN6 G;  4B3R L;  5F2D A;  3C1E A;  2PW7 A;  3WDN A;  3J7A 5;  4NB3 A;  4LF5 Q;  3GQB A;  3NUC A;  3BZD B;  2R7Z H;  1D2B A;  3NSW A;  1H9R A;  4GLX A;  2ZJQ A;  2B3G A;  2H4O A;  2R7D A;  2Z4I A;  4A3E G;  1VQ8 A;  5EPK A;  1KAA A;  1K3R A;  2OQK A;  5E1F A;  5J22 A;  4XYQ A;  3I55 A;  2O5I C;  1WTO A;  2E75 C;  1HTP A;  2LKV A;  2EY6 A;  3MXN B;  1TS3 A;  1I94 L;  1AZQ A;  1B3A A;  4GN4 B;  1JOQ A;  5FLX E;  3DHQ A;  4TQU S;  4N8F A;  3GP7 A;  5GAG C;  3UI2 A;  2KA7 A;  4PNY A;  1LT5 D;  2IJ0 A;  4YCV A;  1CQV A;  1E3P A;  1UWV A;  3PO2 G;  2EDG A;  2SEB D;  2Q2U A;  5KGU A;  3W1G A;  2O5J C;  1EIG A;  2CWA A;  1IL2 A;  2I07 B;  3MXP A;  2X6G A;  4UP7 A;  1HXY D;  3TSS A;  3HOV B;  4C3H G;  3I4N B;  4NPS A;  3D3R A;  3D6C A;  3NXW A;  4LWC A;  1N33 Q;  1TT2 A;  3S15 B;  2XWB B;  1BF4 A;  3I4L A;  4DV1 L;  1A2T A;  1QNK A;  3G6J B;  4KD4 A;  2A6E C;  4Y52 H;  4RH6 A;  5C4J B;  4FXD A;  4A3B G;  1ZXT A;  4CBV A;  1DM0 B;  1GJX A;  1VQI A;  1WFQ A;  1B4O A;  2MJ8 A;  1A0I A;  1YHB A;  5LL6 X;  2K28 A;  4DV0 L;  3CCL A;  2DY8 A;  4A3F G;  3KBX A;  3K58 A;  1N34 L;  5GAH C;  4A3G G;  1EL0 A;  2SNS A;  1YJN A;  3GDE A;  2KHI A;  1QVC A;  4F88 A;  4XT1 B;  3M7N A;  4QMG A;  1H95 A;  2F03 A;  4HSV A;  2RSN A;  4XIG S;  2X69 A;  1XNQ L;  1E2Z A;  1SE3 A;  2RBM A;  4DR7 Q;  4JBJ A;  2PQA B;  3E5S A;  3SK8 A;  2R92 G;  4A75 A;  1IBK Q;  2F0N A;  3H09 A;  1CUK A;  3CU7 A;  2K1B A;  1WI5 A;  1N36 Q;  3M4O B;  3G7L A;  1KQS A;  5IOC A;  4BY7 H;  5CBA E;  3M4O H;  2F0E A;  2KEN A;  2K6A A;  4Z9C B;  1HZB A;  2ZTD A;  4KY6 A;  4GKJ Q;  3Q8D A;  1JJG A;  4TRD A;  2B39 A;  1EFI D;  1WTW A;  4DV0 Q;  2XGT A;  4NDX A;  1GVP A;  1UEB A;  1UEA B;  3ND9 A;  1Q12 A;  2F4I A;  2HUG A;  3BYY B;  1QZH A;  4WRD A;  1LTL A;  1FVI A;  2UU9 Q;  3A5Z B;  2R7F A;  3GTK B;  3AU7 A;  4RHR A;  1HR0 Q;  2JK8 A;  5LMU Q;  3DLL A;  5EPJ A;  4A3K H;  1G29 1;  4PZ8 A;  3T13 A;  1PTO H;  1PRT C;  5JPN C;  5BN5 A;  1TVX A;  4XQN A;  4B9X A;  5M3M B;  1K0S A;  5JVH 3;  1CI3 M;  1NE3 A;  4RCO A;  4UP8 A;  1I4P A;  1EIH A;  1Q82 C;  1H9S A;  4YY3 L;  1PRT F;  4A3J G;  1PDQ A;  1AW7 A;  2F0K A;  2K52 A;  5I6Y A;  2QIL A;  4DR4 Q;  1Z6H A;  1NJI C;  3VYS A;  4OXP A;  4P73 A;  4EX5 A;  3PO2 H;  3W1B A;  4LF9 Q;  2ALY B;  3I4M B;  3FKI B;  3I72 A;  4A76 A;  5EAY A;  3ZYY X;  3JAM E;  4C3H H;  1U9R A;  4A3D G;  2PI2 E;  1DCZ A;  2K5V A;  2TMP A;  4A3M G;  4UP9 A;  1SFO H;  3DM3 A;  2A6H D;  2L1B A;  1PH5 A;  3S1Q B;  3CQZ H;  1PTO C;  5IT9 E;  4FF4 A;  1EYG A;  1FNW A;  5CV6 A;  1BNZ A;  4X66 Q;  3HOU H;  1NMG A;  1K83 B;  5G3L D;  1GKH A;  2JE6 I;  2SNM A;  3X3N A;  4DA2 A;  3QG1 A;  2KCN A;  2QDB A;  3ICE A;  3QB3 A;  3GTO B;  4JI8 L;  1WCM G;  2CQO A;  3OIQ A;  5FO9 B;  2VB3 X;  1S4Z A;  3CXC A;  4G7H C;  5I2Y A;  4GKK Q;  2AHO B;  3ERS X;  1OXS C;  4NMZ A;  4H13 C;  4JV5 L;  4BBS G;  1W3S A;  3F8T A;  1OXX K;  1LM0 A;  5G3L F;  2PMZ B;  4HCS A;  3DMU A;  1XTC D;  1ICW A;  2WB1 G;  4DAY B;  4GLA C;  4R8I A;  4ZKC B;  1PXU A;  3LWE A;  1JJ2 A;  1VQB A;  4IFD G;  1XNR L;  4CDC C;  3J81 j;  1QCB D;  2HCI A;  1IKL A;  5ELD A;  2JA5 G;  3PCO B;  1SR3 A;  2Z6K A;  4A3E B;  2BH2 A;  1YHA A;  1D7Q A;  3HOY B;  3RMH A;  4YWM A;  4A93 B;  1HFN A;  1Z7T A;  3ULL A;  3J80 i;  2ID0 A;  1LTS D;  1RHP A;  3GTQ B;  3TME A;  5KYL A;  3SK5 A;  2CWP A;  1Q1E A;  1ICF B;  1B7Y B;  3WOE A;  5M5W H;  2ZM6 L;  3R3O A;  1G6Z A;  4H7B A;  2JA6 H;  4HAE A;  1QVF A;  4JK1 C;  3KLS A;  5ELF A;  1BCP D;  3VDY A;  3GO5 A;  4JPB W;  2CHB D;  4GOP C;  3Q24 A;  4JBW A;  4IAL A;  2FIN B;  4X3S A;  4PQX A;  3CAM A;  3S16 H;  2B2V A;  3NHH A;  5L37 A;  1QUQ A;  3J80 L;  1MJE A;  1CTM A;  1IKM A;  1SNC A;  2N88 A;  2L4N A;  1EY6 A;  2F0O A;  2JP1 A;  2KEC A;  3I90 A;  1JOR A;  4HJ7 A;  1IBM L;  2IX0 A;  3HS0 C;  4KKT A;  2JXM B;  1ONL A;  1VF7 A;  4EQO A;  5K36 G;  2K5N A;  4Q0F A;  1PLF A;  3HOZ H;  3UDG A;  4AQY L;  1TS2 A;  3GTG H;  3PUX A;  4WJW A;  2K5W A;  3HOZ B;  4R8N A;  1XNR Q;  1EEI D;  3FVQ A;  5KRU A;  5IYC G;  1DJR D;  1NR2 A;  2KCM A;  4BWG B;  3PUW A;  1SNQ A;  1UE6 A;  2PMZ E;  3I73 A;  2L55 A;  2NBF A;  1OO9 B;  5CV9 A;  2DJF C;  2LY7 A;  2ZXO A;  1Q46 A;  1R4Q B;  1X56 A;  5ELO A;  3H0G B;  5C5M A;  4DR1 L;  4AQY Q;  2UUA L;  5C3E B;  4ZUI A;  1KNE A;  2DNE A;  1SE4 A;  4XQQ A;  1PYW D;  1VDZ A;  4HJ9 A;  3K80 C;  1X6O A;  2SOB A;  4QF4 A;  2ZJR A;  1SXT A;  5JOB A;  2NUC A;  4KTA A;  3J80 E;  4JW0 A;  1L1O C;  2MUY A;  3U4V A;  4KI0 A;  5FO7 B;  1ZKO A;  4RCN A;  2C35 B;  3OW7 A;  1XYI A;  1MHW C;  3L7Z C;  1U4P A;  3URY A;  4S3S A;  3AB9 A;  2I46 A;  2A68 C;  3HOU B;  4BBR G;  2E5L Q;  4GLV B;  4LF7 Q;  2MNA A;  4HJA A;  4C3I G;  3MVV A;  4A3K B;  1SRO A;  4OWT B;  2QEX A;  4JI3 Q;  2Z6K C;  1UNS A;  1R9T B;  4XYO A;  3PF4 A;  1GHJ A;  1LT3 D;  3ER0 A;  1JT8 A;  3FPP A;  5FKA C;  3S2D B;  4OO1 H;  3EN2 A;  3BS1 A;  4JBM A;  1B3Q A;  1PRT B;  1KDC A;  2WFW A;  4JOI C;  1EIY B;  1SYD A;  3QO2 A;  3TEH B;  2VY3 A;  1SAP A;  4UPA A;  1K8O A;  3DEO A;  3C2P A;  4JI5 L;  1C48 A;  1TWG B;  4HMI A;  4QIW B;  2KCT A;  1K9M C;  1GUS A;  1PV4 A;  3K0Y A;  3S17 B;  3HZX A;  3Q22 A;  5IT9 L;  1ILQ A;  3RLF A;  2JA6 G;  1HA5 A;  1T9H A;  3UE0 A;  4ABN A;  1VQN A;  1Y1W H;  4X64 Q;  1D5X C;  5C0X H;  5GQO A;  4R1J A;  4RHS A;  2C5C A;  2ZTE A;  3D6W A;  2A19 A;  1EY4 A;  1SFO B;  4DV5 L;  1V8Q A;  3TRE A;  5KNC A;  2RF4 A;  3S24 A;  1G8Z D;  2OEO A;  2RDF A;  2UXB L;  3RLN A;  2P5Z X;  4LF4 L;  4UY8 C;  3CRL C;  3TQY A;  4DNR B;  1I3Q B;  1K83 H;  1LTI D;  1SMY D;  3ULJ A;  3HRZ C;  1SEB D;  4JYA Q;  5I2X A;  4DR6 Q;  1H9K A;  1ZYR C;  1L2F A;  5E3F A;  1QNU A;  3UDI A;  1RF2 D;  2RDG A;  3VYT A;  2Y0S E;  2RVL A;  2WKD A;  5KNB A;  1N36 L;  4BY1 H;  1STH A;  2OT2 A;  4R4Q A;  2AUK A;  2YTV A;  3FKI H;  3K59 A;  1G51 A;  1IBK L;  1JE4 A;  2B8G A;  1VQO A;  1X3G A;  1J9O A;  1JOK A;  2G5D A;  4J6H A;  1XNQ Q;  4CJ0 B;  1WD0 A;  4JCV E;  3KFU A;  2E2I B;  2NTT A;  1JWM D;  2L12 A;  2WB1 B;  2KQ3 A;  5EBD A;  1TWA H;  2A69 C;  1WTH A;  4P74 A;  3NTH A;  5BN3 A;  1N8R C;  1SJH D;  1DYQ A;  3S1M H;  5IP7 G;  2AKW B;  3QIA A;  3BVM A;  4DAP A;  2JA8 G;  4DNT B;  2JA7 G;  3E0J A;  5ELE A;  2JEB I;  4A3C H;  1AFP A;  1U0L A;  2HQE A;  2RCF A;  1YNJ C;  4B3S L;  1TS4 A;  4IUN A;  4DV1 Q;  2WAQ B;  4FP5 D;  1DON A;  3KLW A;  3V2T A;  3OTO L;  1EQQ A;  2EY1 A;  1PH3 A;  3AEV A;  2JN4 A;  2BE5 D;  2BDO A;  5CMD A;  2V4D A;  1PZJ D;  3OIP A;  2VW9 A;  4A3M B;  1C7Y A;  2IY5 B;  1Q81 C;  1JWS D;  2B2Y C;  2XSC A;  1SYC A;  3NPP A;  3CCE A;  3CCQ A;  3I2Z A;  2VUM G;  4DK3 C;  4CKE A;  2K03 A;  2DN8 A;  5LL6 S;  1XX8 A;  5COR A;  2L5T A;  4DAY A;  1YNX A;  4FF2 A;  3D31 A;  4BY7 G;  4C2M H;  3BZK A;  1MD2 D;  5IYD G;  4IPD A;  3MWY W;  5JEA H;  2H1E A;  1SNO A;  2AMC B;  1ENC A;  1LTB D;  2PYK A;  1Z9F A;  2MQH A;  1WOC A;  1GOZ A;  1UE7 A;  3I91 A;  1WTR A;  4MNO A;  2FJ2 A;  4N8X 1;  1HNZ Q;  1XMQ L;  3WOF A;  2F0V A;  2I5L X;  1S5E D;  5IWA Q;  1YNN D;  1VQC A;  3BDC A;  1ENF A;  3EVQ A;  5JJI A;  2QCP X;  5C4X B;  4L8J A;  5M9O A;  3H3V C;  1BQQ T;  1UUP A;  4ME5 A;  4OWW B;  2F0W A;  1XMQ Q;  1EQT A;  1EFW A;  2EYM A;  2Z9H A;  4WJ3 M;  3SVM A;  1TWF H;  1STE A;  1K28 A;  1BCP B;  3VR6 A;  2NN6 H;  2EXZ A;  1PZI D;  1EQR A;  3U4Z A;  3CHB D;  4GZY C;  1EY5 A;  2EY2 A;  1HCZ A;  1TWH B;  2F52 A;  4QUF A;  2KOL A;  5I9O A;  2EIF A;  1TS5 A;  4B3M L;  2F0M A;  1Q86 C;  3FKI G;  4HR7 B;  4K8J A;  4ULL A;  1VQ7 A;  2IWH A;  1JCK B;  4BS9 A;  4GN3 B;  5I4D A;  1IBL L;  5C44 G;  4Y7N B;  2FFK B;  3F2D A;  2MO1 A;  1IBL Q;  5I6W A;  1RTN A;  1KC8 C;  1AH9 A;  3TDQ A;  4F7X A;  4IUT A;  1HQM C;  4MTK A;  3RZD H;  3G48 A;  2R7Z B;  1DOM A;  2BCO A;  3KLR A;  4AIM A;  4IJL A;  5CR3 A;  1PFS A;  1VQG A;  2CW0 D;  2GVB A;  4KHP L;  3K0X A;  1C9O A;  3HOU G;  3MXG A;  1PTO D;  5DAU A;  1I94 Q;  2PI2 A;  3OWE B;  5FJ8 H;  4JBK A;  2R61 A;  4OON A;  5COY A;  3M7G A;  3HOW B;  5JJL A;  4JI0 L;  3KBG A;  1WCM H;  2D0P A;  1LTT D;  2A74 C;  2HT1 A;  3BG3 A;  3KF6 A;  5DM6 3;  3HKS A;  3JAM c;  1CKO A;  1SRU A;  2CVR A;  2HHH Q;  3PO3 H;  1JMC A;  3ERO A;  3J7Y W;  4DK1 A;  1R9T H;  1STY A;  1M90 C;  4JC0 A;  2EJF C;  4KKU A;  1HNZ L;  2EYF A;  3NK9 A;  5C3W A;  1KXL A;  1X32 A;  5LHY 1;  5E4W C;  3D4R A;  5DLQ E;  2EJG C;  2VQF L;  3A8K E;  1CK1 A;  1F2L A;  1OTC A;  1AP0 A;  4LF8 Q;  3KUP A;  5IY0 A;  1PFN A;  3M9B A;  3SXH A;  2VZA A;  4AYB G;  4K14 A;  3E3X A;  3PIO A;  1HNW Q;  4DFA A;  3STB C;  4KKS A;  1H9J A;  4DN4 M;  1B9M A;  4A3L G;  4L5R C;  2VB2 X;  3KDF A;  1YZ6 A;  1EU3 A;  1FD7 D;  4AYB E;  5IGG A;  1LYL A;  2Z6B A;  2F0Q A;  4I7Z C;  2HIV A;  3TP8 A;  1SMX A;  2BA1 A;  4LF4 Q;  1II3 A;  1IXR A;  1TR5 A;  3PGZ A;  3NWS A;  1X55 A;  4FF1 A;  5HGQ A;  3KLS X;  1HHV A;  2PPB C;  3NE5 B;  1BOS A;  1BBX C;  1J5E Q;  4KJN A;  4O42 A;  1SYB A;  3MC0 B;  1IZ6 A;  4JI7 Q;  1NAP A;  5IGC A;  3SR1 A;  4IPH A;  5ELN A;  3M4Y A;  2RDH A;  4R9W A;  3GV3 A;  1QG7 A;  1U4L A;  2UXC Q;  3L3O C;  3SHL A;  2B2W C;  3R2T A;  3K8A A;  4L5Q A;  5C3E G;  2JQO A;  1TXY A;  3KOJ A;  2JEA I;  4ID6 A;  3DWP A;  2AUJ D;  3GV6 A;  1I6H B;  1UAP A;  3J7A V;  5H1S E;  4JI4 Q;  2Z4H A;  2K7V A;  1SNP A;  3HG9 A;  1Y1V H;  3I4O A;  2L15 A;  1KDA A;  3SEB A;  5KIX A;  5FLX c;  1PA6 A;  2OCE A;  2F3V A;  2WB1 E;  1EY9 A;  1PH1 A;  1HFG A;  5IYC H;  1PHJ A;  4NKL A;  4RAU C;  2E2J H;  1SE2 A;  5AJ3 L;  2JJQ A;  1YIT A;  5EKI A;  5GRO A;  3H3V I;  3H94 A;  3MA2 B;  2F3W A;  5KND A;  3NEL A;  2QGQ A;  1LT4 D;  3HOX B;  4X6A H;  1IW7 D;  4K5X A;  4DV4 L;  1RL2 A;  3GD7 A;  3HFZ B;  2B2U A;  5D3D A;  2PQE A;  4L5S A;  3TN2 A;  1NTG A;  1KAW A;  3ULP A;  5FJ8 G;  1VQH A;  4DR6 L;  1FJG Q;  4POG A;  4EGV A;  4HID A;  3D4W A;  4LUV A;  3PMF A;  1TII D;  2F0P A;  4HN7 A;  4NW2 A;  5CV7 A;  3E9I A;  1GD7 A;  4YWK A;  3W3A A;  1RIP A;  5T1G A;  4A3M H;  3H3V H;  3S16 B;  2UUA Q;  1XPU A;  2F0D A;  3A7A B;  2MO0 A;  5K5P A;  2IX3 A;  1ESR A;  4PMC A;  2ATW A;  5E7N A;  3OW2 A;  1CKM A;  2HDL A;  2LFN A;  4O1N A;  2KUM A;  4A3D B;  1B50 A;  4IUU A;  4BBR B;  3J81 E;  1Y69 U;  5ISR A;  1XMO L;  4KY5 A;  3T53 B;  1QZG A;  3HOY G;  3BVG A;  1H9S B;  3Q0A A;  4A93 G;  3CPF A;  2RHQ B;  2K5Q A;  4YHH Q;  5DNF A;  2B2U C;  1TKW B;  4H44 C;  4C1N I;  2NWG A;  2EQS A;  4HTH A;  2K5D A;  2K75 A;  4GNX C;  5EQ0 A;  4B08 A;  1GUT A;  5IP9 G;  3PUY A;  5ELC A;  4JI4 L;  4JOI A;  2R7Z G;  5C4Z A;  2EZV A;  2VUM H;  3VR4 A;  3PUV A;  1GUO A;  2A6E D;  1TU2 B;  4POF A;  5CGK A;  3RZO B;  5EPL A;  2G9H D;  4ME3 A;  3C1F A;  3DUZ A;  1O80 A;  4FF3 A;  4LF7 L;  2NVQ B;  2UUC Q;  1Y1W B;  1MKH A;  4XXE A;  1LO5 D;  1NMF A;  3HOW H;  3F1Z A;  1TWC H;  3K7U C;  5IGB A;  2F3I A;  3S2H H;  2G9D A;  5CV8 A;  1SMY C;  4O2D A;  4L63 B;  4DKA C;  3DWA A;  4IUR A;  3N52 A;  1ZYR D;  1E2V A;  5NUC A;  5M3M H;  4DAM A;  1YJ9 A;  2FXQ A;  3GTJ H;  4DUY L;  3KF6 B;  4RKL A;  1NCV A;  2LMC B;  4MTN A;  5ELB A;  2N49 A;  4XTC S;  1ROD A;  2DGY A;  5JEA J;  1PFM A;  5IYB H;  2EYH A;  3I4M H;  2R92 B;  3GTL B;  2B2T A;  1JIC A;  1WTQ A;  3EIV A;  2NZH A;  4X65 Q;  2EOT A;  1VQL A;  1Q8K A;  3ERQ A;  4DR3 L;  2Z8L A;  1A8V A;  5IGE A;  1E7Z A;  3OWF A;  2K50 A;  3VA5 A;  3NBI A;  1L1O A;  3SDZ A;  2I5H A;  1ENA A;  2Z1C A;  2YU9 B;  4V0B A;  1MIU A;  4O0A A;  2ZJP A;  1FNV A;  1U4M A;  1PRT D;  1U5K A;  4CDD C;  2NVX H;  3I70 A;  3T1H L;  2RQX A;  1NBW A;  5HY6 A;  1V1P B;  1HZA A;  2PQA A;  3CF5 A;  1ASZ A;  1W2B A;  3J80 c;  1VQK A;  1IL8 A;  1G2S A;  1EY0 A;  3VR2 A;  1LLR D;  3PV0 A;  1J6Q A;  4BBS B;  2Y0S B;  2ZTC A;  4IO9 A;  1I4G A;  4LF9 L;  2PZW A;  1FGB D;  3Q6S A;  1CA5 A;  1U4R A;  4XQJ A;  1RDP D;  1RJT A;  4DU9 A;  3F2B A;  1MI2 A;  1X54 A;  4KLK A;  2KHJ A;  3IAY A;  4YCU A;  4K6L A;  4IOA A;  1X65 A;  1M8A A;  2J7Z A;  1L0X B;  1A15 A;  1Z47 A;  2F0U A;  4PZ7 A;  2OTL A;  1SJE D;  3K5N A;  3CCV A;  1F9Q A;  1HPC A;  1CHP D;  5C0X G;  3C3L A;  3A55 A;  4FXG C;  1VQE A;  2VQE L;  2NVQ H;  1EWI A;  1BXT A;  2NB0 A;  4OO1 G;  2E76 C;  3HKZ B;  3FMC A;  4DV6 L;  1PH8 A;  4PMB A;  4C3J H;  1FL0 A;  4X3K A;  1A62 A;  2LXK A;  1YNN C;  1FYC A;  2VL6 A;  2O2L D;  3GTK H;  4GKK L;  4HCE A;  3HOW G;  5CYU A;  1GO3 E;  1O7Z A;  3T16 A;  5D3I B;  3CCU A;  3SK6 A;  2CH4 W;  3D8G A;  3KF8 B;  4OEL B;  3S1N H;  1L1O B;  4K6D A;  4A3J B;  4GKJ L;  1E24 A;  1YEZ A;  3DXJ C;  4IOC A;  1NSN S;  5IWA L;  3E0E A;  2B63 H;  1VQ9 A;  5M3M G;  4DV3 Q;  4GOP A;  4P72 A;  1EZ8 A;  2MGS A;  2YYZ A;  3NEM A;  4A3D H;  1NY4 A;  2OQ0 A;  3PO2 B;  4IUP A;  4JI1 Q;  2RCN A;  3U58 A;  1ESF A;  4QB4 A;  2E8G A;  5FO8 B;  4J1M A;  1CM9 A;  4K2L A;  2NTS A;  5A35 A;  3MHB A;  4KHV A;  1RD9 D;  4JG2 A;  4KN7 C;  1CSP A;  1K8A C;  2HIX A;  3I8Z A;  4APV A;  2DUD A;  4DR4 L;  1TY2 A;  2EXD A;  3PSI A;  2Y0S G;  5IGD A;  2CKZ B;  4K5W A;  1N34 Q;  1FGU A;  4HMJ A;  5FLM H;  3OSO A;  4YY3 Q;  1I5F A;  4BA2 I;  1STA A;  5IT9 c;  4DAV A;  2UXB Q;  3FRP B;  3DEP A;  1I4X A;  1R4P B;  1E2W A;  1KRT A;  3P75 A;  2A5H A;  5JVG 3;  1VF5 C;  2FMC A;  3J81 i;  2NZO A;  2FHT A;  2PNR C;  5LMU L;  5A2Q E;  2JSO A;  4G4K A;  2UU9 L;  1PH9 A;  1KLG D;  2XRS D;  2X6L A;  3IFD A;  1D1I A;  3RD4 A;  3RR5 A;  4L6T B;  3JAM L;  1K0R A;  3TBI B;  2OTJ A;  4F87 A;  1OXU A;  1TWF B;  3A56 A;  3S14 H;  2I5M X;  1E1O A;  4A3F H;  3V05 A;  3A74 A;  5GAE C;  1Q1B A;  5IYD H;  5C3X A;  4A4I A;  1PZK D;  1SLJ A;  3BU2 A;  1HR0 W;  4C3I H;  4FO2 A;  1X3F A;  1UE5 A;  1PFB A;  5JPM C;  2R92 H;  2N8N A;  4GOP B;  5HGT A;  1N9W A;  3UE1 A;  1K8G A;  3GTQ H;  3L0O A;  1VQ4 A;  1PH7 A;  1BBW A;  1J8I A;  4JI3 L;  3I7F A;  4JI1 L;  3FP9 A;  4HED A;  1NR4 A;  1F9R A;  1JOO A;  4K0K L;  2IHF A;  1AN8 A;  2E2D C;  1BBU A;  3A7L A;  2M9V A;  1I50 H;  5M3F B;  3RUZ A;  5LMN W;  4IPG A;  2MPM A;  1GUG A;  3KF8 A;  3TRZ A;  5C0X I;  1KTK A;  3IKJ A;  3D4D A;  5EKL A;  3LX0 A;  3S1Q H;  2ZT9 C;  3ITP A;  4IUV A;  2RHS B;  2V1C C;  4B3R Q;  1S5C D;  3R8B A;  5K36 H;  4FYD A;  1D1K A;  2XNA C;  1ILP A;  4IQZ A;  4LUZ A;  2O4X A;  3FEW X;  1DOL A;  2B2W A;  3BDL A;  4X65 L;  4DR1 Q;  3PIP 3;  2ES2 A;  1VMC A;  3MXU A;  3K5O A;  5DM7 3;  1T5X D;  1IHZ A;  4C1N K;  4DR5 Q;  5M5X B;  3GTM B;  4OEM B;  1DGS A;  4C3I B;  4A3K G;  1HJP A;  2AQ2 B;  2F0H A;  2VQE Q;  4A3G B;  4KD3 A;  1S72 A;  1WTX A;  4A3F B;  2ENB A;  2SDF A;  2NVY B;  3V96 A;  4G7Z C;  4KJO A;  3K6O A;  1B53 A;  2QKI C;  2UUB L;  3S2D H;  1V1P A;  1YBY A;  1K8M A;  2DNC A;  4QIW E;  1HTL D;  4CKC A;  1B9N A;  4ALP A;  3PIP A;  4CGY B;  3GTL H;  4Y7N H;  4BXX H;  4J15 A;  1IBM Q;  5CV4 A;  1I50 B;  2HD3 A;  3SK4 A;  1N32 L;  2EJM A;  1YVC A;  3HEJ A;  3I3C A;  3CW2 C;  2J4X A;  2AWO A;  5FLM G;  1SBB B;  2IL8 A;  4CJ2 C;  2GN5 A;  3ND8 A;  4WOR A;  4LFA L;  3CQZ B;  5M3F H;  1S40 A;  2CCZ A;  1HUM A;  4JI2 L;  1QJO A;  2A8V A;  3U50 C;  1GUW A;  1DXM A;  1YJW A;  3OOC A;  1O78 A;  3X3M A;  4DV7 Q;  1STG A; 
#chains in the Genus database with same CATH homology
 4OIJ A;  4ZKB B;  2KEE A;  2R3Z A;  2F0I A;  2F0L A;  1RKN A;  1PTO B;  1CA6 A;  2D5D A;  4PV1 C;  1ET6 A;  3GTG B;  2BDN A;  1QWY A;  5AFW A;  2B63 B;  4ZQ3 A;  4RGT A;  4FVM A;  2K33 A;  4LJZ C;  1RTO A;  2Q8T A;  1KDB A;  1A2U A;  4C2M B;  1XWE A;  4QUC A;  5BN4 A;  1T5E A;  3K5M A;  1QOH A;  1HA6 A;  2A69 D;  1A6X A;  2A68 D;  2WII B;  2EVB A;  1CFM A;  2XIW A;  2F1M A;  3A8J E;  4V19 0;  5C5L A;  5IGF A;  3VA7 A;  3NBH A;  4MHE A;  2MHV A;  2B8F A;  1L0Y B;  2OF1 A;  3A8I E;  1D5Z C;  3DM1 A;  4UDU C;  4OIK A;  1LV9 A;  4QCL A;  1W6K A;  4NP5 A;  1F9P A;  4C3J G;  4ODG A;  1V1O A;  3SE0 A;  2EE1 A;  1A3T A;  4P2C B;  1EU4 A;  1C8C A;  1Q8I A;  1JB3 A;  1F2Y A;  2WV6 D;  1EWH A;  3EJI A;  2KED A;  1WD1 A;  1MGS A;  4C3J B;  1EY7 A;  1OXT A;  1CT1 D;  4N9P A;  4LAA A;  2F0F A;  2EYO A;  2RSO A;  1V43 A;  3HP3 A;  3PUZ A;  3OMC A;  1JR0 D;  1SYG A;  1WTP A;  1D6E C;  3LWU A;  1FNU A;  3LNN A;  1I6V C;  5EGT A;  4IUQ A;  4WFN 3;  3NTK A;  2K32 A;  1SYF A;  2QEJ C;  4OL7 A;  2IPK D;  5I9P A;  1H9M A;  1MSG A;  2C9O A;  1B44 D;  1SDF A;  2E2H B;  1W6J A;  2CQA A;  3IFT A;  1OXV A;  1TWC B;  1IYV A;  1ML0 D;  5CBE E;  3VYU A;  5JEA G;  3S14 B;  1A3U A;  3MAQ A;  4B9W A;  2ICI A;  1O7L A;  1SSO A;  4MIU A;  3TP6 A;  4CKB A;  4E6I A;  3NP8 A;  1I4R A;  5D65 A;  4ZRZ A;  2EYL A;  4I65 A;  3S9W A;  1EQV A;  2VNU D;  3N6R A;  4J8Q A;  1VCI A;  3R93 A;  4TSS A;  4ZAI A;  4FXK C;  4F8M A;  1ZEQ X;  3T56 B;  4OHJ A;  1WCM B;  2WIN B;  4AYB B;  2IW3 A;  5FLX L;  1C4Q A;  1EOT A;  3MFY A;  3QOJ A;  4EQN A;  2BA0 A;  3MEH A;  5FK9 C;  1X3P A;  2QF7 A;  3S2H B;  1F9S A;  3GTJ B;  2A6H C;  1LAC A;  2FMM A;  2JYO A;  2WP8 J;  3K7A B;  2EYP A;  1G2T A;  1Y1V B;  2M00 A;  4FNF A;  2OXP A;  4BY7 B;  4RWS C;  1JWU D;  5C0X J;  2R93 B;  1B2T A;  1X3Q A;  3TP5 A;  3CRK C;  1CZW A;  1MBY A;  3QJY A;  2KHS A;  4U68 A;  2VUM B;  1D5M C;  3GTP B;  2XRQ D;  5IOD A;  4RGM A;  3QOL A;  5E4X A;  3S1R B;  4XT3 B;  4PMW A;  4RKB A;  1LTG D;  4C3H B;  4DK0 A;  2AWN A;  5EBC A;  1KLU D;  3E6Z X;  4U67 3;  4X3U A;  4KY7 A;  4ZUJ A;  1LAB A;  3ONA B;  5C44 B;  3NWT A;  2NN6 I;  3C46 A;  1BCP F;  2JA7 B;  1BDO A;  2JA8 B;  4KK7 A;  1G91 A;  2LS0 1;  2NVT B;  3OMG A;  5CC4 A;  2F0G A;  3M3Y B;  5J1Z A;  3P7J A;  3S1N B;  5KYI A;  2KCC A;  3M85 A;  4M1U B;  4ZK9 B;  2Q8I B;  5FOB B;  1CZG A;  2L9H A;  5DEH A;  2PCF B;  2XN9 C;  3J81 L;  5C6A A;  2PZT A;  4KHZ A;  2D2C C;  1WVL A;  2EY5 A;  3FPU B;  4EQP A;  3TP7 A;  2WKC A;  2TSS A;  3VR5 A;  2HCC A;  4KN4 C;  1IW7 C;  1Y8P B;  1FR3 A;  2MP1 A;  2PZU A;  3PIO 3;  4G7O C;  1IYU A;  1Y8N B;  2A73 B;  4LK1 C;  2EYJ A;  3NQT A;  4LMQ D;  3OPO A;  3BDO A;  3AMU A;  5JJZ A;  1YNJ D;  1KNA A;  4A3B B;  2HDM A;  2NYZ D;  3R2I A;  1Q90 A;  3IL8 A;  2GA4 B;  1F2Z A;  2M2L A;  2Q8R E;  1PTO F;  1STN A;  3CKI B;  2F0T A;  4OGQ C;  4IZ8 A;  2CW0 C;  2BE5 C;  1M4V A;  2R6G A;  3FDT A;  3L9A X;  2E74 C;  3NTI A;  2F0S A;  5EJW A;  3VR3 A;  4EVO A;  3PO3 B;  1O7Y A;  4DXF A;  1GUN A;  1KAB A;  2IX1 A;  1QB5 D;  4BA1 I;  1CHQ D;  1RCV D;  1EYC A;  2B2V C;  2N55 A;  1JC7 A;  3DWQ A;  4K5V A;  5D14 A;  3TZD A;  1I4Q A;  3RZD B;  1GXD C;  1GHK A;  3A54 A;  4IFD I;  4UAI A;  3P20 A;  3F2U A;  4YIJ A;  2IT1 A;  3VYR A;  4M8A A;  4DF7 A;  4IN3 A;  1A3V A;  2PO4 A;  5A2Q L;  5HUR A;  2VXW A;  4KMU C;  1VMP A;  3EQL C;  2XVS A;  2B2T C;  4HSP A;  2RKS A;  4G57 A;  2K01 A;  4K2K A;  3NQI A;  1PMR A;  3TZU A;  3T51 B;  5JAV A;  2BOS A;  1BUV T;  2D9U A;  5CV5 A;  2B2Y A;  4RA8 A;  1EEF D;  2JA5 B;  3KK7 A;  4K8I A;  4ZLT F;  4ZYS A;  3Q23 A;  3BYT B;  1BR9 A;  1BCP C;  2KVM A;  5EKK A;  1EYA A;  3W2D A;  1DD2 A;  1LT6 D;  3QWN A;  3K5L A;  2PW5 A;  1HQR D;  4OO1 I;  4DGZ A;  4CJ1 B;  5M5Y B;  2EPB A;  2ICE C;  1EY8 A;  1NUC A;  1S5B D;  2D62 A;  3H6M A;  2J0T D;  3EFX D;  3HGB A;  1E0B A;  1QIL A;  2AQ1 B;  2NVX B;  1B1Z A;  2NZ1 D;  4XDX A;  1DOK A;  2WAC A;  2K05 A;  1SND A;  1CQF A;  1F77 A;  1XXG A;  3H91 A;  4Q5V A;  1JQY D;  5KEE A;  3MZ5 A;  1AZP A;  3U9O A;  1SYE A;  2KJX A;  4H0L C;  4IFD J;  2XWJ B;  1TQO A;  3MXN A;  1MSH A;  3K57 A;  2E2J B;  1S5D D;  1QE6 A;  3P1H A;  2F0J A;  3J7A F;  1TWA B;  4A3I B;  5TSS A;  4RGO S;  3EA6 A;  2JA6 B;  2ZXR A;  3T4A C;  1Y8O B;  1WTV A;  5C4H A;  1EYD A;  3S1M B;  4IFD H;  1HUN A;  4CHT B;  3OHX C;  4RFB A;  2L11 A;  3O13 A;  2K04 A;  1ET9 A;  1HRJ A;  3MFG A;  3U9S A;  1AEX A;  1EZ6 A;  4TKO B;  4X3T A;  4DXG A;  1F2M A;  4MN3 A;  2AQ3 B;  3BVZ A;  1STB A;  2ZXP A;  4BY1 B;  1DZ1 A;  5T1I A;  4ILW A;  4KV6 A;  2RA4 A;  5J39 A;  1LTR D;  1TY0 A;  1I4H A;  4N9T A;  1LTA D;  1BO0 A;  5M5W B;  5IIF A;  1S5F D;  2L0C A;  4C56 C;  4RGN A;  2DY7 A;  3MTS A;  1SNM A;  1EWC A;  1Q3L A;  2NN6 G;  5F2D A;  3C1E A;  2PW7 A;  3WDN A;  3GQB A;  3NUC A;  3BZD B;  1D2B A;  3NSW A;  1H9R A;  2H4O A;  2Z4I A;  5EPK A;  1KAA A;  2O5I C;  5E1F A;  4XYQ A;  5J22 A;  1WTO A;  2E75 C;  1HTP A;  2LKV A;  2EY6 A;  1TS3 A;  1AZQ A;  1B3A A;  1JOQ A;  5FLX E;  3DHQ A;  4TQU S;  3GP7 A;  3UI2 A;  2KA7 A;  4PNY A;  1LT5 D;  2IJ0 A;  1CQV A;  2EDG A;  2SEB D;  5KGU A;  2O5J C;  1EIG A;  2I07 B;  3MXP A;  2X6G A;  1HXY D;  3TSS A;  3HOV B;  4C3H G;  3I4N B;  3D3R A;  3D6C A;  3NXW A;  1TT2 A;  3S15 B;  2XWB B;  1BF4 A;  3I4L A;  1A2T A;  1QNK A;  3G6J B;  4KD4 A;  2A6E C;  4RH6 A;  5C4J B;  4FXD A;  1ZXT A;  4CBV A;  1DM0 B;  1GJX A;  1B4O A;  2MJ8 A;  5LL6 X;  2K28 A;  2DY8 A;  3KBX A;  3K58 A;  1EL0 A;  2SNS A;  4F88 A;  4XT1 B;  3M7N A;  4QMG A;  2F03 A;  4HSV A;  2RSN A;  4XIG S;  2X69 A;  1E2Z A;  1SE3 A;  2RBM A;  3E5S A;  3SK8 A;  2F0N A;  3H09 A;  3CU7 A;  2K1B A;  3M4O B;  3G7L A;  5IOC A;  5CBA E;  2F0E A;  2K6A A;  4Z9C B;  4KY6 A;  4TRD A;  2B39 A;  1EFI D;  1WTW A;  4NDX A;  1UEA B;  3ND9 A;  1Q12 A;  2F4I A;  2HUG A;  3BYY B;  4WRD A;  3GTK B;  3AU7 A;  4RHR A;  5EPJ A;  1G29 1;  3T13 A;  1PTO H;  1PRT C;  5JPN C;  5BN5 A;  1TVX A;  4XQN A;  4B9X A;  5M3M B;  5JVH 3;  1CI3 M;  4RCO A;  1I4P A;  1EIH A;  1H9S A;  1PRT F;  1PDQ A;  1AW7 A;  2F0K A;  5I6Y A;  2QIL A;  1Z6H A;  3VYS A;  3I4M B;  3FKI B;  3I72 A;  3ZYY X;  3JAM E;  1U9R A;  1DCZ A;  2TMP A;  2A6H D;  2L1B A;  3S1Q B;  1PTO C;  5IT9 E;  4FF4 A;  1FNW A;  5CV6 A;  1BNZ A;  1K83 B;  5G3L D;  2JE6 I;  2SNM A;  3X3N A;  4DA2 A;  3QG1 A;  2KCN A;  2QDB A;  3QB3 A;  3GTO B;  3OIQ A;  5FO9 B;  2VB3 X;  1S4Z A;  4G7H C;  5I2Y A;  1OXS C;  4NMZ A;  4H13 C;  1OXX K;  5G3L F;  2PMZ B;  4HCS A;  3DMU A;  1XTC D;  1ICW A;  4R8I A;  4ZKC B;  1PXU A;  3LWE A;  4IFD G;  1QCB D;  2HCI A;  1IKL A;  5ELD A;  4A3E B;  3HOY B;  3RMH A;  4A93 B;  1HFN A;  1Z7T A;  2ID0 A;  1LTS D;  1RHP A;  3GTQ B;  3TME A;  5KYL A;  3SK5 A;  1Q1E A;  3WOE A;  3R3O A;  1G6Z A;  4H7B A;  4HAE A;  4JK1 C;  3KLS A;  5ELF A;  1BCP D;  3GO5 A;  2CHB D;  3Q24 A;  4JBW A;  4IAL A;  2FIN B;  4X3S A;  4PQX A;  2B2V A;  3NHH A;  3J80 L;  1CTM A;  1IKM A;  1SNC A;  2N88 A;  2L4N A;  1EY6 A;  2F0O A;  2JP1 A;  2KEC A;  3I90 A;  1JOR A;  2IX0 A;  3HS0 C;  4KKT A;  2JXM B;  1ONL A;  1VF7 A;  4EQO A;  5K36 G;  4Q0F A;  1PLF A;  1TS2 A;  3PUX A;  4WJW A;  2K5W A;  3HOZ B;  4R8N A;  1EEI D;  3FVQ A;  5KRU A;  1DJR D;  1NR2 A;  4BWG B;  3PUW A;  1SNQ A;  3I73 A;  2L55 A;  2NBF A;  1OO9 B;  5CV9 A;  2LY7 A;  2ZXO A;  1R4Q B;  5C5M A;  3H0G B;  5C3E B;  4ZUI A;  1KNE A;  2DNE A;  1SE4 A;  4XQQ A;  1PYW D;  1VDZ A;  2SOB A;  4QF4 A;  1SXT A;  5JOB A;  2NUC A;  4KTA A;  3J80 E;  2MUY A;  4KI0 A;  5FO7 B;  1ZKO A;  4RCN A;  3OW7 A;  1XYI A;  3L7Z C;  1U4P A;  3URY A;  4S3S A;  3AB9 A;  2I46 A;  2A68 C;  3HOU B;  4C3I G;  3MVV A;  4A3K B;  1UNS A;  1R9T B;  4XYO A;  1GHJ A;  1LT3 D;  3FPP A;  5FKA C;  3S2D B;  4OO1 H;  3BS1 A;  1PRT B;  1KDC A;  1SYD A;  3QO2 A;  1SAP A;  1K8O A;  3DEO A;  3C2P A;  1C48 A;  1TWG B;  4HMI A;  4QIW B;  1GUS A;  3K0Y A;  3S17 B;  3HZX A;  3Q22 A;  5IT9 L;  1ILQ A;  3RLF A;  1HA5 A;  4ABN A;  1D5X C;  5C0X H;  4RHS A;  2C5C A;  3D6W A;  1EY4 A;  1SFO B;  1V8Q A;  5KNC A;  1G8Z D;  2OEO A;  2RDF A;  3CRL C;  4DNR B;  1I3Q B;  1SMY D;  1LTI D;  3HRZ C;  1SEB D;  5I2X A;  1H9K A;  5E3F A;  1ZYR C;  1QNU A;  1RF2 D;  2RDG A;  3VYT A;  2RVL A;  2WKD A;  5KNB A;  1STH A;  2OT2 A;  2AUK A;  3K59 A;  1JE4 A;  2B8G A;  1J9O A;  1JOK A;  4J6H A;  4CJ0 B;  1WD0 A;  2E2I B;  2NTT A;  1JWM D;  2L12 A;  2WB1 B;  2KQ3 A;  5EBD A;  2A69 C;  3NTH A;  5BN3 A;  1SJH D;  1DYQ A;  3QIA A;  3BVM A;  4DAP A;  4DNT B;  3E0J A;  5ELE A;  2JEB I;  1AFP A;  2HQE A;  1YNJ C;  1TS4 A;  4IUN A;  2WAQ B;  4FP5 D;  1DON A;  3V2T A;  2EY1 A;  2BE5 D;  2BDO A;  5CMD A;  2V4D A;  1PZJ D;  3OIP A;  4A3M B;  1JWS D;  2B2Y C;  2XSC A;  1SYC A;  3NPP A;  4CKE A;  2K03 A;  2DN8 A;  5LL6 S;  1XX8 A;  5COR A;  2L5T A;  4DAY A;  4FF2 A;  3D31 A;  1MD2 D;  3MWY W;  5JEA H;  2H1E A;  1SNO A;  1ENC A;  1LTB D;  2PYK A;  1GOZ A;  3I91 A;  1WTR A;  2FJ2 A;  3WOF A;  2F0V A;  1S5E D;  1YNN D;  3BDC A;  1ENF A;  3EVQ A;  2QCP X;  5C4X B;  4L8J A;  5M9O A;  3H3V C;  1BQQ T;  1UUP A;  4ME5 A;  2F0W A;  1EQT A;  2EYM A;  3SVM A;  1STE A;  1BCP B;  3VR6 A;  2NN6 H;  2EXZ A;  1PZI D;  3CHB D;  4GZY C;  1EY5 A;  2EY2 A;  1HCZ A;  1TWH B;  4QUF A;  2KOL A;  5I9O A;  1TS5 A;  2F0M A;  4HR7 B;  4K8J A;  4ULL A;  2IWH A;  1JCK B;  4BS9 A;  5I4D A;  4Y7N B;  2FFK B;  5I6W A;  1RTN A;  3TDQ A;  4F7X A;  4IUT A;  1HQM C;  2R7Z B;  1DOM A;  2BCO A;  3KLR A;  5CR3 A;  2CW0 D;  3MXG A;  1PTO D;  5DAU A;  3OWE B;  2R61 A;  5COY A;  3M7G A;  3HOW B;  3KBG A;  1LTT D;  2A74 C;  3BG3 A;  5DM6 3;  2CVR A;  3ERO A;  3J7Y W;  4DK1 A;  1STY A;  2EJF C;  4KKU A;  2EYF A;  3NK9 A;  5C3W A;  1X32 A;  5LHY 1;  5E4W C;  3D4R A;  2EJG C;  3A8K E;  1CK1 A;  1F2L A;  1AP0 A;  3KUP A;  1PFN A;  3SXH A;  4K14 A;  4DFA A;  1H9J A;  4KKS A;  4DN4 M;  1B9M A;  2VB2 X;  1EU3 A;  1FD7 D;  5IGG A;  4I7Z C;  2F0Q A;  3TP8 A;  2BA1 A;  1II3 A;  1TR5 A;  3NWS A;  4FF1 A;  3KLS X;  1HHV A;  2PPB C;  3NE5 B;  1BOS A;  1BBX C;  4KJN A;  4O42 A;  1SYB A;  3MC0 B;  1NAP A;  5IGC A;  3SR1 A;  3M4Y A;  2RDH A;  4R9W A;  3GV3 A;  1QG7 A;  1U4L A;  3L3O C;  3SHL A;  2B2W C;  3R2T A;  2JEA I;  4ID6 A;  3DWP A;  2AUJ D;  3GV6 A;  1I6H B;  1UAP A;  3J7A V;  2Z4H A;  2K7V A;  1SNP A;  3HG9 A;  1KDA A;  3SEB A;  5KIX A;  2F3V A;  1EY9 A;  1HFG A;  4NKL A;  4RAU C;  1SE2 A;  5EKI A;  3H94 A;  3MA2 B;  2F3W A;  5KND A;  1LT4 D;  3HOX B;  1IW7 D;  4K5X A;  3GD7 A;  2B2U A;  5D3D A;  2PQE A;  3TN2 A;  4EGV A;  3D4W A;  3PMF A;  1TII D;  2F0P A;  4HN7 A;  4NW2 A;  5CV7 A;  3W3A A;  5T1G A;  3S16 B;  2F0D A;  3A7A B;  5K5P A;  2IX3 A;  1ESR A;  4PMC A;  2HDL A;  2LFN A;  4O1N A;  2KUM A;  4A3D B;  1B50 A;  4IUU A;  4BBR B;  3J81 E;  1Y69 U;  5ISR A;  4KY5 A;  3T53 B;  3BVG A;  1H9S B;  3Q0A A;  2K5Q A;  5DNF A;  2B2U C;  1TKW B;  4H44 C;  4C1N I;  2NWG A;  4HTH A;  2K5D A;  5EQ0 A;  4B08 A;  1GUT A;  3PUY A;  5ELC A;  5C4Z A;  2EZV A;  3VR4 A;  3PUV A;  1GUO A;  2A6E D;  1TU2 B;  5CGK A;  3RZO B;  5EPL A;  2G9H D;  3C1F A;  3DUZ A;  1O80 A;  4FF3 A;  2NVQ B;  1Y1W B;  4XXE A;  1LO5 D;  5IGB A;  2G9D A;  5CV8 A;  1SMY C;  4L63 B;  3DWA A;  4IUR A;  3N52 A;  1ZYR D;  1E2V A;  5NUC A;  4RKL A;  1NCV A;  2LMC B;  5ELB A;  4XTC S;  1ROD A;  5JEA J;  1PFM A;  2EYH A;  2R92 B;  3GTL B;  2B2T A;  1JIC A;  1WTQ A;  2EOT A;  3ERQ A;  2Z8L A;  5IGE A;  3OWF A;  3VA5 A;  3NBI A;  3SDZ A;  1ENA A;  2Z1C A;  2YU9 B;  4V0B A;  1FNV A;  1U4M A;  1PRT D;  3I70 A;  2RQX A;  1V1P B;  1IL8 A;  1G2S A;  1EY0 A;  3VR2 A;  1LLR D;  3PV0 A;  4BBS B;  2Y0S B;  1I4G A;  2PZW A;  1FGB D;  3Q6S A;  1CA5 A;  1U4R A;  4XQJ A;  1RDP D;  1RJT A;  4DU9 A;  1MI2 A;  3IAY A;  4K6L A;  2J7Z A;  1M8A A;  1L0X B;  1A15 A;  1Z47 A;  2F0U A;  1SJE D;  3K5N A;  1F9Q A;  1HPC A;  1CHP D;  5C0X G;  3C3L A;  3A55 A;  4FXG C;  1BXT A;  2NB0 A;  4OO1 G;  2E76 C;  3HKZ B;  3FMC A;  4PMB A;  4X3K A;  1YNN C;  1FYC A;  2O2L D;  4HCE A;  5CYU A;  1O7Z A;  3T16 A;  5D3I B;  3SK6 A;  3D8G A;  4K6D A;  4A3J B;  3DXJ C;  1NSN S;  1EZ8 A;  2MGS A;  2YYZ A;  3PO2 B;  4IUP A;  1ESF A;  4QB4 A;  5FO8 B;  4J1M A;  1CM9 A;  4K2L A;  2NTS A;  5A35 A;  3MHB A;  4KHV A;  1RD9 D;  4KN7 C;  3I8Z A;  1TY2 A;  5IGD A;  4K5W A;  4HMJ A;  3OSO A;  4BA2 I;  1STA A;  4DAV A;  3FRP B;  3DEP A;  1I4X A;  1R4P B;  1E2W A;  3P75 A;  2A5H A;  5JVG 3;  1VF5 C;  2FMC A;  2FHT A;  2PNR C;  5A2Q E;  2JSO A;  4G4K A;  1KLG D;  2XRS D;  2X6L A;  3IFD A;  1D1I A;  3RD4 A;  4L6T B;  3JAM L;  3TBI B;  4F87 A;  1OXU A;  1TWF B;  3A56 A;  3V05 A;  1Q1B A;  5C3X A;  1PZK D;  4FO2 A;  1PFB A;  5JPM C;  5HGT A;  1J8I A;  4HED A;  1NR4 A;  1F9R A;  1JOO A;  1AN8 A;  2E2D C;  3A7L A;  2M9V A;  5M3F B;  3RUZ A;  2MPM A;  1GUG A;  3KF8 A;  5C0X I;  1KTK A;  3IKJ A;  3D4D A;  5EKL A;  3LX0 A;  2ZT9 C;  3ITP A;  4IUV A;  1S5C D;  3R8B A;  5K36 H;  4FYD A;  1D1K A;  2XNA C;  1ILP A;  4IQZ A;  2O4X A;  3FEW X;  1DOL A;  2B2W A;  3BDL A;  3PIP 3;  1VMC A;  3MXU A;  3K5O A;  5DM7 3;  1T5X D;  1IHZ A;  4C1N K;  5M5X B;  3GTM B;  4C3I B;  2AQ2 B;  2F0H A;  4A3G B;  4KD3 A;  1WTX A;  4A3F B;  2ENB A;  2SDF A;  2NVY B;  3V96 A;  4G7Z C;  4KJO A;  3K6O A;  1B53 A;  2QKI C;  1V1P A;  1K8M A;  2DNC A;  4CKC A;  1HTL D;  1B9N A;  4CGY B;  5CV4 A;  1I50 B;  3SK4 A;  2EJM A;  3HEJ A;  3I3C A;  2J4X A;  2AWO A;  1SBB B;  2IL8 A;  4CJ2 C;  3ND8 A;  4WOR A;  3CQZ B;  1HUM A;  1QJO A;  1GUW A;  1DXM A;  3OOC A;  1O78 A;  3X3M A;  1STG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...