2QCPX

1.0 a structure of cusf-ag(i) residues 10-88 from escherichia coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
MEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual Cu(I)/Ag(I) coordination of Escherichia coli CusF as revealed by atomic resolution crystallography and X-ray absorption spectroscopy
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Metal binding protein
molecule keywords Cation efflux system protein cusF
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qcpX01
2VB3X 2VB2X 3TDQA 3E6ZX 2L55A 2QCPX 1ZEQX
chains in the Genus database with same CATH superfamily
2A6HD 4I7AA 1YHBA 4IUQA 1PFBA 1BKBA 3K0YA 3LX0A 3HOZG 4JG2A 3CU7A 4DAVA 2QW7A 2PQAB 3GTOH 1G6PA 2NZ1D 2Z8LA 2R61A 4JBKA 1VMPA 4RFBA 4GKKQ 1RCVD 2YU9B 1I94Q 1FNVA 5BN4A 1QUQB 2ENBA 1RL2A 4N8FA 3SK6A 5LL6S 4FXDA 1G6ZA 5EPKA 1EU3A 2EYMA 3S24A 3GD7A 3W5OA 1SRUA 3CCMA 1SNMA 1ENCA 3MFYA 2VY3A 4BY1G 1BCPD 3C46A 4UY8C 4A93G 3K81C 2OCEA 3PIP3 2P5ZX 1SYFA 1Y8NB 5C0XJ 1XPUA 5IGFA 1H9MA 5M3MG 3BJUA 4NXNL 1KD1C 3GTJB 4WJWA 5KYIA 4FYDA 3IRBA 4QUFA 3J81c 4DV7L 4HTHA 4R4TA 3AB9A 3I4MG 3PUVA 4DR2L 3SXHA 2VQFL 3PUXA 1UE5A 3U9SA 5C3EH 2SNSA 4LUOA 3SEBA 2B2VC 2MFIA 3I8ZA 3E6ZX 1V1OA 1O80A 3MXNB 1Q7YC 1KLGD 2NUCA 3D0FA 4OIKA 1OXSC 3J7AF 2B39A 1C48A 4OL7A 1SE8A 4JI6Q 3I4NG 1SYBA 4K8JA 2NBFA 1EOVA 3P7JA 4DGZA 1SE4A 1IBKQ 3NQIA 4DF7A 3G48A 3RMHA 4KKTA 1Z7TA 1N9WA 1PFSA 1PTOD 1TWCB 1UEBA 1K3RA 2I0QA 1FVIA 4NW2A 1B9MA 2D0OA 2ZJPA 2BA0A 2K50A 1SE3A 4AYBG 1VQ4A 2UXBQ 3ONAB 1PHJA 4RHRA 2B8FA 2IHFA 2R7ZB 1RHPA 3F8TA 4DA2A 2ID0A 1Q90A 1YNND 3BDLA 5EKKA 3UDGA 4B3RL 3T4AC 1SLJA 2QEJC 1A2UA 2VUMG 5DEHA 2GVAA 1AFPA 4PG3A 3S16B 3PIO3 1AN8A 3HG9A 1X65A 5E7NA 3VR3A 4K2KA 4IFDI 1KDCA 2PCFB 1GO3E 4IFDH 1AH9A 3D6WA 4KY6A 2F0NA 1KRSA 5C44H 2JYOA 4G7OC 1G8ZD 3U4VA 3UI2A 1BOSA 2EY6A 1JB7A 1E2ZA 2F0QA 1EFWA 4ID6A 1LT4D 2J7ZA 3U4ZA 3PQIA 2Z9HA 5BN3A 1CKOA 4LNQA 3GTMH 2EDGA 2K52A 4R4CA 3KJOA 1CK1A 1GUWA 1G51A 3C1EA 4OX9L 4BXXH 3S17H 3LWUA 1EY8A 1GHJA 1U4LA 3MHBA 5LMNW 1NR2A 5D3IB 3ULJA 2JEAI 1AZQA 4DU9A 4IUNA 1YI2A 1L1OA 3RR5A 2IWHA 1E0BA 3OSOA 5AJ3Q 3S15H 4BY7G 2DJGC 3KF6B 3I55A 4DR7Q 1N32L 1F9QA 1U9RA 2K6AA 1UAPA 1UE1A 1HXYD 2ZT9C 2R7DA 2RDFA 1LTGD 1EEFD 4LW1A 4LF9Q 1QVCA 4QF4A 1K83B 2EJGC 2OWOA 4DFAA 1GHKA 3CXCA 4AQYQ 1AE2A 3MC0B 2R6GA 1STHA 2OT2A 2K4KA 2R7ZH 1ENAA 5GAGC 1VQHA 2VQEQ 3VA7A 1KRTA 5JJLA 1CKNA 1ET6A 1X3GA 2O2LD 2XSCA 4GLAC 3NBIA 1PH9A 2B8GA 1HR0L 3GTQH 4A3IH 2LSSA 1SMXA 4APVA 3G4SA 2EXZA 2LXJA 1HZ9A 2YTYA 1YZ6A 2Q8IB 1MJEA 5IWAL 1I6HH 1LYLA 1K0SA 4XT3B 3H6MA 3QIAA 2N88A 4OGQC 4RGMA 4XTCS 4CDDC 1TXYA 1SFOB 3NXWA 4ZK9B 1STNA 4Q5VA 4IOCA 4RWSC 1QNKA 5E1FA 3KBGA 1JE4A 3MWYW 1I4HA 5BR8Q 5I6WA 5IIFA 5LMNQ 1DD2A 2K7VA 1V43A 5FLXE 3HS0C 3A7LA 2ZM6Q 1U0LA 1AEXA 3MTSA 3PGZA 1HJPA 5BN5A 3NTIA 3D31A 3M85A 4DV6Q 3RD4A 2JQOA 1B4OA 1W6KA 2RKSA 4HCSA 5C4JB 4KN7C 1PXUA 1ZYRD 5IYCG 1Q81C 2VS1A 3OPOA 3S1RB 3DEPA 1FD7D 1TWFB 1ONLA 5LMUQ 3HP3A 4G7HC 1N32Q 1HH2P 2UXBL 3VR2A 4DNRB 3V96A 3J7A5 2RSNA 1GUOA 1OXUA 4C3JB 1WTOA 2LXKA 3PUWA 3R3OA 2Z0SA 5J1ZA 4A93B 3J81j 3CCSA 5ELFA 2PNRC 4DV4L 1TWHH 4JI2Q 4X66Q 3EFXD 4AQYL 2B29A 2IPKD 1J9OA 2VB2X 4A3DB 3K80C 3I90A 3RLOA 1OXXK 1EY5A 4V0BA 5JJKA 2N78A 2F0KA 3CMEA 5CV8A 4IUUA 1PTOC 5G3LD 1YHQA 2JEBI 1K8GA 2Q2HA 1WVLA 1QWYA 1GUSA 1FGUA 3HOWG 1MGSA 3LGJA 3OIPA 1LT5D 2RCFA 2KJXA 4MN3A 3S14B 1PZKD 1TWFH 2CKZB 4OELB 2IHEA 2EPBA 3TZUA 2WIIB 2F0LA 3G7LA 2R92H 1VF7A 4A3BB 1B9NA 5LL6X 1L1OB 2ZJRA 4HJ8A 1TS2A 1FGBD 1TVXA 3M9BA 1NE3A 4QY7A 4S3SA 4JBMA 5FOBB 4DK1A 2PYKA 4L5QA 2F0TA 5IOCA 2XN9C 4DV0L 5IT9L 5IGCA 1EY7A 2EYLA 4ZAIA 4ZCKA 5C3EG 4DR7L 4H13C 3VYUA 3S1QH 1B2TA 4A3DG 4WORA 2E2JH 4X3UA 4CJ0B 4K2LA 4A3CG 4DKAC 4QB4A 3P75A 1MBYA 4UDUC 4DR5Q 1SJHD 1Q12A 4YY3L 5DNFA 5CYUA 2E5LL 1BXTA 2V4DA 2B2TC 2HT1A 4R9WA 1V9PA 3OTOQ 4AYBE 5A35A 1C7YA 1HHVA 1ESRA 2PZTA 5IYDH 1SSOA 2VB3X 4PMWA 1E3PA 1SNDA 5K36H 2X69A 4C2MB 2OQ0A 2KHIA 1NSNS 3FP9A 3VA5A 1SE2A 4A3MB 2IJ0A 1X56A 3IAYA 2EYPA 1HFNA 1YNJD 2AUKA 5J39A 2NVTB 4P2CB 4JYAQ 2B2UC 2F52A 2L15A 4IFDG 1GUGA 3HKZB 1I4RA 3K6OA 2F4VL 1VF5C 2RQXA 3OMGA 2Q2TA 3CKIB 2C9OA 3SK8A 4X62L 1SYGA 1LT3D 1RODA 3MXGA 4KI0A 3UE1A 3PCOB 4K14A 2H1EA 1RTOA 3GTMB 1VS0A 2GA4B 4CDFC 3SDZA 1HZBA 1MKHA 2F3VA 1A0IA 1PYWD 3T13A 1B70B 3K0XA 4AH6A 2L4NA 3PUYA 1I4GA 5I6YA 1F9SA 1JOOA 1PRTF 3D4RA 3HGBA 4HJAA 2B63G 3L7ZC 5DM63 2AWNA 1XWEA 2AUJD 4BBSG 1VDZA 3PO2G 1SMYD 2EIFA 4J8QA 3NENA 3W1GA 2JK8A 1SAPA 1MSGA 3JAME 4HJ5A 2R93B 2EYFA 3TN2A 4BBSH 1AW7A 2K1BA 2QDLA 4DAYA 4JI0Q 1F2MA 2ATWA 3ZJYC 1WJJA 1KXLA 5E4XA 2X6GA 4GKJQ 3M4OH 3TS0A 2R93G 1WTWA 4JW0A 1X3FA 2HQEA 1K8AC 1S40A 4FNFA 4POGA 3KF8A 4LF8Q 5GAEC 2RVLA 5FO9B 5ELNA 2SEBD 2V1CC 3I2ZA 1I4XA 4IFDJ 2MQHA 4KN4C 3H94A 1ET9A 4ZUIA 3HRZC 4JI5L 3IFTA 2OXPA 4LF7Q 4NKLA 4A75A 2WKCA 2TSSA 3NE5B 1TWHB 2L9HA 1PDQA 4QMGA 3S2DH 3M4YA 1LM0A 1SNOA 2QGQA 2FXQA 2F0JA 1I4QA 1X3QA 2NB0A 2OTJA 2VZAA 4K6DA 2VUMH 1OXVA 2RCNA 1NJIC 1SMYC 1FNUA 3SK5A 1SJED 2LY7A 4NPSA 1S5FD 4C3IH 2E5LQ 1B1ZA 1SNPA 2UUAL 1FNWA 1KL9A 1QE6A 4HMJA 1VQEA 2E74C 3NWTA 2E2IH 4WFN3 2CHBD 4X64Q 3ND8A 3Q22A 4P74A 5JOBA 3H0GH 4OX9Q 4A3FB 4JI7Q 3CF5A 4IOAA 3R93A 3GTGB 1NMGA 3NTHA 3CAMA 3S17B 5JJZA 1JR0D 1GM5A 1LABA 1HTLD 1D5ZC 3GP7A 1BUVT 1QJOA 2RF4A 2B2UA 4PZ7A 3K5MA 2EJFC 2F0EA 2X6LA 4JBJA 2YTVA 4ZKBB 2Y0SG 2CH4W 3K57A 4N8X1 1YJWA 3D4DA 4DR3Q 1P8LA 2Z6KA 4GOPC 1TIID 1E24A 2JA6H 2F0IA 4XYQA 4CJ1B 2NYZD 2F0SA 3WOFA 4FXGC 1XPRA 4B3SL 1LTRD 3C3LA 2RHQB 4Y7NB 2C5CA 1D1IA 3M4PA 4ME3A 2MO1A 3NK9A 1STEA 1QVFA 1SBBB 4HIMA 4WJ3M 1EOTA 3TDQA 2L1BA 2KCCA 3K5OA 3HZXA 3MXUA 4C56C 4DR4Q 1SN8A 1H9SA 4DV3L 4B3SQ 2F0WA 1BBWA 1EFID 3RZDH 3KLSX 4X3TA 1UUPA 3E0JA 5TSSA 2O5JC 4OO1H 2E8GA 2D9UA 3NUCA 5DM73 3QR8A 2JA6B 4GN5A 4NXNQ 2HCCA 4DV1L 2NTSA 4F7XA 1GD7A 2CW0C 2YTXA 4A3FH 5KYLA 3CPFA 1STBA 5FKAC 4GNXB 2EZVA 3VYRA 4RGOS 5IYDG 1QOHA 1TS5A 3HOXG 3RN2A 4DR1L 3VR4A 1D8LA 3S1NH 1NUCA 3I4NB 1Y1VH 3A74A 2A6HC 2QEXA 2PQAA 3G6EA 1VQPA 1BCPF 1TR5A 3A8IE 4OXPA 2XRQD 1KTKA 4CDCC 4L8JA 1QZGA 1WTQA 4A3JG 3T1YQ 2UUCL 3I4MB 4LUVA 2WINB 2UU9L 2J0TD 2NVYB 4B08A 5JEAH 4K8IA 2Q8TA 4DV6L 1B44D 3VR5A 1N34Q 3HKZG 1EYGA 3MA2B 2Q2IA 1KIXA 4YCUA 1Q82C 5FLMG 4LWCA 4KHZA 1VQMA 4DK3C 3S2HH 5KNBA 3GTPB 3T51B 3OW7A 2I07B 1IHZA 3EBEA 4R8IA 1XNQQ 3RN5A 2UXCQ 1SEBD 1KABA 1IYVA 1YNNC 4FXKC 2VXWA 1BR9A 1JC7A 5JPNC 2A19A 1X3PA 3S2DB 5KIXA 1TQOA 1X55A 4JYAL 3MEFA 1EWCA 3F2BA 1DONA 5CORA 4GZYC 3A7AB 1C0AA 2XWJB 4GOPB 1S3OA 3A54A 3NTKA 4BXXG 4MHEA 4LF8L 3DXJC 1IBLL 2B2TA 1X9NA 1W2BA 1DYQA 3A55A 2EY2A 4JI3Q 5EPLA 1XYIA 2IW3A 3EROA 4CGYB 3M3YH 4A3GB 1CFMA 4YIJA 1MSHA 2JA7G 1UNSA 1A8VA 1I5FA 2TMPA 2L0CA 1PFMA 5IT9E 2SDFA 3O13A 4ALPA 4LFAL 2KUMA 5CBAE 4XIGS 4A3KB 4XQQA 3ERSX 1XMOQ 5JAVA 1K8MA 1N8RC 3TRZA 1Z9FA 1TWCH 3E9IA 3TP6A 2R92G 3URYA 5M5WH 4DN4M 1LT6D 4O2DA 2PMZB 1CA6A 2G5DA 1A2TA 3GTQB 4KMUC 1B7YB 1X6OA 1VCIA 2LKVA 3HFZB 1TY2A 1A3TA 3BVMA 3BVZA 5EJWA 1BVSA 1HR0Q 1GXDC 1K3BC 3HOUB 1QB5D 2XTIA 4A3EB 2C35B 1UE7A 2NN6G 3T53B 5FLMH 1LTLA 5CV4A 3L0OA 2EXDA 1XXGA 2D5DA 1BQQT 4QIWB 2J4XA 3JAMi 4N9TA 4A3EG 2AWOA 3HOWB 1E2VA 3IL8A 4ZKCB 4QIWE 5I2YA 3W2DA 1XNRL 1JJ2A 3JAMc 1M90C 1A3UA 1JE5A 4NXML 1S5BD 5M5WB 4X65L 1H9KA 3K8AA 3KLWA 3CC2A 2ZM6L 1L2FA 3VR6A 3PO3G 3PUZA 1EZ8A 3SGIA 5FK9C 4TRDA 5M5YH 4ZRZA 4JPBW 2K05A 3U9OA 1I3QB 5C3WA 1BDOA 4A3GH 4A4IA 2A1AA 1PH6A 5HGTA 2A8VA 3EVQA 1S5ED 5HGQA 2QDBA 3DMUA 3E0EA 1IL8A 3ULPA 1VQAA 1SYCA 1N34L 4GS3A 5T1IA 1N33L 1HNZQ 1D1KA 5KEEA 1EWIA 4O0AA 2JP1A 5CR3A 2JA9A 4NP5A 2F0VA 1LLRD 4JI2L 4CDEC 4GKKL 5IWAQ 5COYA 4JI3L 3AMUA 2EYJA 4BY1H 1U4PA 5EKIA 4C1NK 5IODA 4IPCA 2E2JB 2F0FA 3FKIH 4K0KQ 2LS01 2A6ED 1TY0A 2M2LA 3SK4A 4HR7B 1EY6A 4OWTB 1IYUA 5I9PA 1WOCA 2HIXA 1BF4A 3I3CA 4MTNA 5I9OA 1CT1D 4YCWA 2MO0A 5C4XB 4OIJA 3KF6A 4TVAB 1EYAA 1X32A 3QB3A 4DR5L 1XMOL 1RKNA 2QILA 4K5WA 3S2HB 2JN4A 3H91A 2Z1CA 2CWPA 3CP0A 3IKJA 3NSWA 4HIKA 5KNDA 3T1HQ 4J6HA 2A74C 3CMAA 1LTTD 1XNRQ 2K04A 3B6YA 2PW5A 1HA6A 2PPBC 4J15A 1LTAD 3MAQA 4FF3A 1WTHA 2MPMA 2Z6KC 2B3GA 4POFA 1KLUD 2ZXOA 2JA8B 1F2YA 5FLXL 3D6CA 1EY0A 3K59A 4A3IG 1Q1BA 5IT9c 4FF1A 4GLVB 5IGEA 1HZAA 1KNEA 2BOSA 3MZ5A 3I4OA 4HJ9A 3RZOB 4HJ7A 3PSIA 1YIJA 2E2HH 4UP9A 1H9JA 2BDNA 4AYBB 3STBC 3F2UA 4H02A 4YY3Q 3P20A 1F9RA 2EYHA 1V1QA 3I56A 4JI4Q 3CC7A 1F2ZA 5D65A 4UAIA 2FJ2A 3VYSA 4X65Q 3L2PA 4RH6A 5C4XG 1Q1EA 3AYHB 3KDFB 3J81i 5CBEE 5JEAJ 5L37A 3A5UA 1RTNA 4H44C 1J5EL 3QWNA 1PH2A 4PZ8A 4JI8L 5ELBA 2Q8RE 3OIQA 4L6TB 2NZOA 4M1UB 3DM3A 4LJZC 1V1PB 4P71A 2FHTA 1SXTA 4HIDA 1WD0A 3PF4A 2EE1A 5AJ3L 3E5SA 4JCVE 1SROA 2R7FA 4BY7H 1HNZL 1BCPB 2QCPX 3PMFA 3RLFA 2XWBB 4IPGA 3KLSA 4CKEA 1VQ7A 2N8NA 1KAAA 2CCZA 1RD9D 3KOJA 2BH8A 2RBMA 3I72A 4QGUA 4RAUC 2RA4A 4OO1I 4EX5A 4IJHA 1A15A 1CI3M 1MJCA 1WTXA 1PZID 5I2XA 3RUZA 2WP8J 3CQZB 1ESFA 2PMZE 1EWHA 2YU9H 4JI0L 3J7ZC 1PRTD 1QG7A 2WB1E 1NAPA 4O42A 4BBRG 5KGUA 2BE5D 1HNXL 2PI2A 2F0UA 3FRPB 4G4KA 1BNZA 3M7NA 3H3VH 2K14A 1C9OA 5GADC 1DOLA 2SOBA 1PH3A 2JA7B 3GTLH 2K5VA 1V8QA 4A3LG 4IUVA 5AFWA 3FKIG 1VQ9A 4DV5Q 1PZJD 4X3KA 5IE8A 1PFNA 2L12A 1K0RA 2NWGA 3M7GA 5GQOA 1KQSA 1Y1WG 4GN4B 1M4VA 1CZWA 2ICEC 4Y52H 4KD3A 4NMZA 1QVGA 1I50B 1V1PA 2RDHA 4ZQ3A 4AIMA 4LF6Q 1HNWL 1VQJA 3H15A 1K9MC 1D5MC 2OEOA 1NTGA 2PO4A 3NP8A 4YWMA 3OYYA 3L3OC 4C1NI 4DV1Q 3S9WA 4C3IB 3CCEA 1EY9A 2F03A 1C4QA 2JA5H 4A3DH 2UU9Q 2XGTA 3WOEA 2B2YC 4H0LC 3I4MH 4KLKA 1WI5A 2K03A 3PO3B 4NDXA 4HCEA 2NTTA 1XJVA 3K7AH 4C3IG 4LMQD 4E6IA 1UWVA 1DZ1A 4DV2L 4JV5Q 1H9SB 1JB3A 3J80L 3GTPH 2LMCB 3OHXC 3N52A 4DPGA 1N36L 3STBD 1N33Q 3H3VC 4KHPL 1I50H 2WV6D 4R1JA 5ELDA 4M8AA 2F0MA 2I46A 1Y8OB 1O7ZA 4Y7NH 4B3RQ 3HOUG 4OWXB 4PMBA 2I5MX 4C3JG 4RA8A 2EY1A 1I3QH 1N36Q 4RCNA 2BH2A 1EY4A 3TBIB 2XVSA 2M9VA 4K0KL 4RHSA 1O7YA 1GOZA 4JK1C 4IUTA 1I94L 4QUCA 1B53A 1ILPA 2AQ2B 2YV5A 5EBCA 2JA6G 3MFGA 2JA8H 4PMCA 1DCZA 5T1GA 5CGKA 4WJ4A 4FF2A 3CCQA 1Q86C 1VQ5A 2K01A 2MGSA 1JQYD 1RJTA 2RDGA 4QL5A 4DV0Q 1IBKL 3HOZH 4XT1B 1B3AA 1WTRA 2FINB 3KUPA 1FJGL 1II3A 2DJFC 1JORA 2KENA 1QCBD 3V2TA 3CCJA 3J7AV 3H09A 2F0OA 5C4ZA 4A3MH 1PA6A 3CD6A 1HPCA 1H9RA 2D2CC 1IZ6A 3BDOA 5EKLA 4BBRH 2HUGA 2WACA 2VW9A 5FO8B 5FJ8G 3S1NB 4KHVA 4JI1Q 1IL2A 1HZCA 3E3XA 2ASBA 3GTOB 3FPUB 3PF5A 1F2LA 1EQRA 3F2CA 1PYSB 1A6XA 3OMCA 1IKLA 4G7ZC 3TREA 5C0XG 4DAPA 5IGBA 3E9HA 2IX3A 1EIYB 1JWUD 5EQ0A 1XTCD 1CKNB 3MEHA 1XMQQ 3HOYH 3RLNA 3ICEA 4V190 4NXMQ 3C1FA 2R7ZG 1UE6A 1HUNA 4BS9A 2NVQB 3EA6A 2M00A 2L11A 1SFOH 3NEMA 3TP7A 1TS4A 3AQQA 5M5YB 4LFCQ 4IQZA 3M4QA 2KVMA 2UUBQ 2E2IB 3K5NA 1PH5A 4TSSA 5H1SE 1DGSA 4B3MQ 1Q8KA 2KBNA 1X54A 4OHJA 4UP7A 3CQZH 2JA8G 4LFBQ 3D8GA 3GTLB 2UXDL 4YHHQ 1EQVA 5C44G 2F1MA 3DM1A 1XNQL 4A3GG 1YNJC 5M9OA 3A0JA 4H7BA 3TMEA 1CUKA 4DXGA 1D2BA 4LFBL 5DAUA 4HSVA 1A63A 1JT8A 3FMCA 1KHIA 5IGDA 3SVMA 5IYBH 2NVXH 5EBDA 4A93H 2K75A 1L0WA 1YBYA 2PNHA 3X3MA 3HOXB 3V05A 4EVOA 5ELOA 1WTPA 1GVPA 2KCTA 3F1ZA 2FMMA 1VQIA 3R2IA 4DV5L 4KTAA 1D6EC 4IZ8A 3A5ZB 3TP5A 1WFQA 2PZUA 1B50A 1TWGB 2E76C 1PTOF 3ERQA 3UDIA 1WYDA 4L5TA 5C5LA 4IO9A 3I70A 4IPHA 4JVZA 5M3FG 1E1TA 1VQLA 3JAML 4UP8A 4X62Q 1EQTA 5A2QL 3Q0AA 4BBSB 1GUTA 3PO2B 4LK1C 1C8CA 2DNCA 2F0DA 1NNXA 1HQRD 1GUNA 3KFUA 1Z47A 5K36G 3M4OB 4C2MH 1CHPD 3KYHC 2NVQH 4GNXA 5ISRA 2D62A 2VL6A 2KHJA 4GLXA 5JPMC 3TS2A 3Q6SA 1NR4A 1PRTC 3BVGA 4A3LH 2A69C 1Q46A 1Y8PB 2AKWB 3KK7A 3NWSA 1DOKA 1SYEA 1Y1WH 3T1YL 4FDBA 3J81E 4DV2Q 1VQOA 5FO7B 1YNXA 3NQTA 1TWGH 3KDFA 4EQPA 2I5HA 1I6HB 3S1RH 1EYCA 3BYYB 3U58A 3R8BA 1S5CD 5IGGA 4ZYSA 2E75C 4EQNA 3FVQA 3LNNA 2EJMA 5CV5A 4A3KH 1HNXQ 2JA5G 2QKIC 3FDTA 4FVMA 1XPOA 2Y0SE 4LUZA 1JWSD 3PV0A 2F0HA 5J3BA 4DUZL 3I7FA 4DR2Q 1DM0B 4A3FG 3J80i 2I5LX 1W3SA 2K5QA 1L0XB 2DY7A 2F4IA 4ME5A 1ASYA 1TWAH 1YJNA 3DWQA 4UPAA 4K6LA 2PI2E 4IJLA 4BA1I 4LF5L 5LMUL 1STYA 4CJ2C 3J7YW 2OQKA 4K5XA 3S1MB 3DHQA 1R9TH 1E2WA 2KOLA 3EJIA 4PNYA 3A8KE 3S16H 2ZTEA 2HD3A 4TKOB 3HOZB 4LF4Q 1IYJB 4MZ9A 5GROA 2KCMA 2K32A 4EQOA 2WKDA 3J80E 1K73C 4KKUA 3OOCA 4NB3A 1NCVA 4JI5Q 3LWEA 2HHHL 4LF5Q 3KLRA 1JCKB 3PIPA 1Z6HA 2UUBL 4CKCA 3EQLC 4JI8Q 5FLXc 4KK7A 2JA5B 1HCZA 1XTDA 3NHHA 4HEDA 5GAHC 3Q8DA 1JICA 3W3AA 3OW2A 4YHHL 1CKMA 4F88A 1JWMD 1I6VC 3CCLA 3S1MH 1IW7D 1MIUA 1EYDA 2KCNA 3HKZE 4HAEA 2MHVA 1R4PB 4IUPA 1KAWA 4X66L 4A76A 1RF2D 3BZDB 5ELCA 2G9DA 2IT1A 1UEAB 1EL0A 3C2PA 1U4MA 1K28A 2RSOA 1PTOH 3GO5A 4MIUA 4C3HH 3L9AX 4HSPA 5M3MH 3J81L 5EPJA 1IW7C 3MXNA 4DUYL 4A3BH 5M5XB 1X3EA 3KJPA 1LO5D 3BYTB 2FFKB 2L5TA 4QCLA 3F2DA 1VQFA 5LMNL 4DR3L 4YWKA 1CQVA 1Y69U 1VQNA 1SNCA 5J22A 4RGNA 4PV1C 1NBWA 4N9PA 3AU7A 4DUYQ 4OO1G 3NELA 1Q8IA 4EGVA 2ICIA 5F2DA 4RMFA 2CQAA 2HDMA 2K5NA 3HOVB 1G2TA 2DNEA 3TZDA 4OEMB 5C0XH 4GKJL 3VDYA 4A3EH 4LF9L 1TT2A 4TQUS 5CV7A 5C0XI 4DAYB 1P16A 1O7IA 5JJIA 1BO0A 1GKHA 1MI2A 2K5WA 5D14A 3EIVA 3T56B 4R8NA 1HA5A 2QA4A 3SR1A 4JC0A 3GV3A 5C3EB 1H95A 1HNWQ 5M3MB 1TKWB 3HEJA 3PIOA 1S5DD 1S72A 1R4QB 4A3KG 4RKLA 3CCVA 1IBML 3H0GB 4LF4L 3CW2C 1O78A 1VQ6A 2EVBA 1PH8A 1E1OA 1PLFA 3T16A 2WB1B 3D4WA 2F4VQ 4JOIC 5C4JH 3FHWA 1ZYRC 2VNUD 4RCOA 4A3JH 4IPDA 4DUZQ 4G57A 1TU2B 1G291 3TQYA 2EYOA 2IX1A 2AHOB 5C4XH 4DK0A 4DR1Q 1EIGA 2HDLA 1L0YB 1ML0D 4JOIA 2GVBA 2H5XA 1KDAA 1CZGA 4KJNA 1U5KA 1SYDA 5IP7G 1ICWA 5E3FA 3DLLA 2NVXB 5E4WC 2DGYA 1QNUA 2E2DC 3RNUA 1KC8C 1RIPA 1CA5A 1JOQA 3GQBA 2AQ3B 2XRSD 4RG1A 2GN5A 2UXCL 4B9XA 5KRUA 2BA1A 3MXPA 4P73A 3QJYA 3SHLA 4DR4L 2D0PA 2Z6BA 5C44B 1FYCA 1TS3A 1E22A 4BBRB 4U68A 4ULLA 2KEEA 4OONA 2O5IC 3OWEB 3NBHB 3BU2A 3X3NA 1YHAA 2AQ1B 2DUDA 1D7QA 1JOKA 3M3YB 4ODGA 1ENFA 2E2HB 4P75A 2R93H 3G71A 4JBWA 1DJRD 5FJ8H 3P1HA 3HOWH 4LAAA 2CFMA 5NUCA 4GN3B 2K5HA 3G6JB 1T9HA 2F3WA 3S15B 1IBMQ 3HKSA 1HUMA 4L5SA 4LF6L 1QZHA 3VYTA 1XMQL 3GTJH 4XXEA 1VQDA 2K5DA 5CV9A 3J80c 4P72A 4ILWA 4Z9CB 1K83H 2UUAQ 1VQCA 3HOYB 4QQBX 2HQLA 2EOTA 2OF1A 2F3IA 4X64L 2JJQA 3S1QB 1BBUA 1HTPA 1ILQA 4LFCL 1RDPD 4I65A 1Y1VB 4XQNA 3KBXA 5C4HA 2WAQE 1STGA 4B3ML 1WTVA 4HN7A 1JMCA 4L5RC 5D3DA 2HHHQ 4BA2I 3I91A 1CHQD 2B2VA 1EQQA 3EN2A 1VQKA 3A56A 1NY4A 1AE3A 2A68D 4F87A 2IL8A 3KF8B 4B3TL 2KECA 4KY7A 3CCUA 5JVH3 1K8OA 1LACA 4A3IB 5IY0A 1JJCB 3Q23A 1CQFA 4RKBA 5IYCH 4DNTB 3DWAA 3BDCA 3OTOL 3AEVA 3HOYG 5M3FH 5CC4A 3HOXH 1QUQA 1PRTB 2FMCA 1SNQA 2MJ8A 1S4ZA 1PH4A 2NN6I 4DAMA 2A73B 3GDEA 2LFNA 1PMRA 4JI4L 1OXTA 2VQFQ 2IY5B 4FF4A 4MNOA 4UHVA 1YJ9A 1IBLQ 1A3VA 4C3JH 2ES2A 5IP9G 3CRKC 3FEWX 4XYOA 1PV4A 4JI7L 1O7LA 2DY8A 2XNAC 1J5EQ 5IP7H 3QG1A 2XIWA 3CCRA 1HQMC 1EEID 2G9HD 4OWWB 3IFDA 3AFQA 1BCPC 2CVRA 1HRJA 3HOVH 5CV6A 3K5LA 1YEZA 1EU4A 5C6AA 2R3ZA 4X3SA 1MD2D 2A68C 3WDNA 4DV3Q 1JJGA 2NVTH 1F9PA 1D5XC 1PTOB 2A6EC 3TP8A 2IX0A 3HOVG 2KA7A 3DEOA 5HY6A 3CRLC 3R2TA 1J6QA 1FR3A 3GV6A 4C3HG 2B2WC 2K28A 3UE0A 3GTGH 2ALYB 1MHWC 4A3BG 1OTCA 3K7UC 4MTKA 2Q2UA 1F77A 3CHBD 3ND9A 4JI1L 3BZCA 2JXMB 2L55A 1T5EA 3DUZA 1M8AA 2N3SA 2MUYA 1B3QA 4CKBA 2PW7A 4GNXC 1VMCA 4YWLA 1A62A 2UUCQ 4GOPA 5EGTA 5C5MA 2EQSA 2B63B 1DOMA 2Z4HA 1DXMA 2BE5C 3TEHB 1VQBA 1CSPA 5EAYA 3GTKB 3T1HL 4YCVA 2ZTCA 4A3CH 4QJFA 2WB1G 3U50C 4B9WA 4R4IA 2VQEL 4ZUJA 4FO2A 2B2WA 4KY5A 4DXFA 4ZLTF 2CQOA 2EY5A 4KJOA 1WCMG 3PO3H 2DN8A 2HIVA 1Q3LA 1CSQA 2NZHA 2PQEA 2ZXPA 4O1NA 1PH1A 1LV9A 3MVVA 3QOJA 3DWPA 1WCMB 4PQXA 2RHSB 5K5PA 3CC4A 2BCOA 3HOUH 2SNMA 4C3HB 1Y14B 5JEAG 5LHY1 2KHSA 2QF7A 2VUMB 3TSSA 3CPWA 2Z4IA 3N6RA 1OO9B 3I4LA 2Y0SB 1GJXA 2CH4A 4DV4Q 1PH7A 1VQ8A 1T5XD 2JE6I 3ITPA 2PZWA 5G3LF 2H4OA 2OTLA 4BY7B 1LTID 4F8MA 2JSOA 4X6AH 2YYZA 4WRDA 1QILA 1SR3A 4IALA 4B3TQ 2MNAA 3BS1A 4DR6Q 5HURA 4R4QA 3ZYYX 4XDXA 1SDFA 2K33A 3H0GG 2UXDQ 4PZ6A 5C3XA 4DV7Q 3K58A 3BZKA 1ASZA 3PO2H 5M5XH 1I4PA 4A3MG 3GTKH 1U4RA 1EIFA 2MP1A 3FKIB 1CM9A 3ULLA 2BDOA 5IYBG 1W6JA 1EIHA 2O4XA 1HFGA 5ELEA 4CHTB 2B2YA 4RGTA 5IP9H 1AP0A 5KNCA 4EQ5A 1Y1WB 1M1KC 4U673 4DNIA 2JA7H 1LTSD 2A5HA 3NPPA 4HIOA 4A3JB 1ICFB 4FP5D 3Q24A 2ZJQA 1B8AA 1PYBA 3A8JE 4LFAQ 3SE0A 3OWFA 1ZEQX 4L63B 4J1MA 1WCMH 2N55A 3S14H 2WAQB 4KD4A 1G2SA 3UDFA 3RZOH 1FL0A 5M3FB 1IKMA 2A69D 1WD1A 1HR0W 5I4DA 1CTMA 1EZ6A 4DK6C 2R92B 1TWAB 3NBHA 4I7ZC 3W1BA 5A2QE 1FJGQ 1YITA 2WFWA 2WAQG 4BY1B 3FPPA 1XX8A 1EUJA 3AFPA 1ZXTA 3QO2A 2HCIA 2NN6H 4CBVA 3UDXA 4KV6A 2KQ3A 4IURA 4ABNA 4R4OA 5DLQE 3K7AB 2CW0D 1R9TB 5CMDA 1E7ZA 1G91A 2F0PA 1VQGA 1STAA 4K5VA 1J8IA 3I4NH 1YVCA 3RZDB 4LF7L 3JC66 3D3RA 1L1OC 2N49A 3QOLA 4HMIA 4XQJA 2F0GA 1ZKOA 1AZPA 2KEDA 1KNAA 4BWGB 2CWAA 1PVOA 4JI6L 3I73A 3H3VI 1LTBD 4JV5L 3WWVA 4IN3A 1LUZA 5JVG3 1Y1VG 1BBXC 2NVYH 2AMCB 1IXRA 2ZXRA 3BG3A 5BR8L 4KKSA 4KHPQ 2B63H 4DR6L 4Q0FA 1NMFA 1KDBA 2ZTDA 3ER0A
chains in the Genus database with same CATH topology
2A6HD 4IUQA 1PFBA 3K0YA 3LX0A 3CU7A 4DAVA 2NZ1D 2Z8LA 2R61A 1VMPA 4RFBA 1RCVD 2YU9B 1FNVA 5BN4A 2ENBA 3SK6A 5LL6S 4FXDA 1G6ZA 5EPKA 1EU3A 2EYMA 3GD7A 1SNMA 1ENCA 3MFYA 1BCPD 3C46A 3PIP3 1SYFA 1Y8NB 5C0XJ 5IGFA 1H9MA 3GTJB 4WJWA 5KYIA 4FYDA 4QUFA 4HTHA 3AB9A 3PUVA 3SXHA 3PUXA 3U9SA 2SNSA 3SEBA 2B2VC 3I8ZA 3E6ZX 1V1OA 1O80A 1KLGD 2NUCA 4OIKA 1OXSC 3J7AF 2B39A 1C48A 4OL7A 1SYBA 4K8JA 2NBFA 3P7JA 4DGZA 1SE4A 3NQIA 4DF7A 3RMHA 4KKTA 1Z7TA 1TWCB 1PTOD 4NW2A 1B9MA 2BA0A 1SE3A 3ONAB 4RHRA 2B8FA 2R7ZB 1RHPA 4DA2A 2ID0A 1Q90A 1YNND 3BDLA 5EKKA 3T4AC 2QEJC 1A2UA 5DEHA 1AFPA 3S16B 3PIO3 1AN8A 3HG9A 3VR3A 4K2KA 4IFDI 1KDCA 2PCFB 4IFDH 3D6WA 4KY6A 2F0NA 2JYOA 4G7OC 1G8ZD 3UI2A 1BOSA 2EY6A 1E2ZA 2F0QA 1LT4D 2J7ZA 4ID6A 5BN3A 2EDGA 1CK1A 1GUWA 3C1EA 3LWUA 1EY8A 1GHJA 1U4LA 3MHBA 1NR2A 5D3IB 2JEAI 1AZQA 4DU9A 4IUNA 2IWHA 1E0BA 3OSOA 1F9QA 1U9RA 2K6AA 1UAPA 1HXYD 2ZT9C 2RDFA 1LTGD 1EEFD 4QF4A 1K83B 2EJGC 4DFAA 1GHKA 3MC0B 2R6GA 1STHA 2OT2A 1ENAA 3VA7A 1ET6A 2O2LD 2XSCA 3NBIA 2B8GA 2EXZA 2Q8IB 4XT3B 3H6MA 3QIAA 2N88A 4OGQC 4RGMA 4XTCS 1SFOB 3NXWA 4ZK9B 1STNA 4Q5VA 5E1FA 4RWSC 1QNKA 3KBGA 1JE4A 3MWYW 1I4HA 5I6WA 5IIFA 1DD2A 2K7VA 1V43A 5FLXE 3HS0C 3A7LA 3MTSA 1AEXA 5BN5A 3NTIA 3D31A 3M85A 3RD4A 1B4OA 1W6KA 2RKSA 4HCSA 5C4JB 4KN7C 1PXUA 1ZYRD 3OPOA 3S1RB 3DEPA 1FD7D 1TWFB 1ONLA 3HP3A 4G7HC 3VR2A 4DNRB 3V96A 2RSNA 1GUOA 1OXUA 4C3JB 1WTOA 3R3OA 3PUWA 5J1ZA 4A93B 5ELFA 2PNRC 3EFXD 2IPKD 1J9OA 2VB2X 4A3DB 3I90A 1OXXK 1EY5A 4V0BA 2F0KA 5CV8A 4IUUA 1PTOC 5G3LD 2JEBI 1WVLA 1QWYA 1GUSA 1MGSA 3OIPA 1LT5D 2KJXA 4MN3A 3S14B 1PZKD 2EPBA 3TZUA 2WIIB 2F0LA 3G7LA 1VF7A 4A3BB 1B9NA 5LL6X 1TS2A 1FGBD 1TVXA 4S3SA 5FOBB 4DK1A 2PYKA 2F0TA 5IOCA 2XN9C 5IT9L 5IGCA 1EY7A 2EYLA 4ZAIA 4H13C 3VYUA 1B2TA 4WORA 4X3UA 4CJ0B 4K2LA 4QB4A 3P75A 1MBYA 4UDUC 1SJHD 1Q12A 5DNFA 5CYUA 1BXTA 2V4DA 2B2TC 4R9WA 5A35A 1HHVA 1ESRA 2PZTA 1SSOA 2VB3X 4PMWA 1SNDA 5K36H 2X69A 4C2MB 1NSNS 3VA5A 1SE2A 4A3MB 2IJ0A 3IAYA 2EYPA 1HFNA 1YNJD 2AUKA 5J39A 2NVTB 4P2CB 2B2UC 4IFDG 1GUGA 3HKZB 1I4RA 3K6OA 1VF5C 2RQXA 3OMGA 3CKIB 2C9OA 3SK8A 1SYGA 1LT3D 1RODA 3MXGA 4KI0A 4K14A 2H1EA 1RTOA 3GTMB 2GA4B 3SDZA 2F3VA 1PYWD 3T13A 2L4NA 3PUYA 1I4GA 5I6YA 1F9SA 1JOOA 1PRTF 3D4RA 3HGBA 3L7ZC 5DM63 2AWNA 1XWEA 2AUJD 1VDZA 1SMYD 4J8QA 1SAPA 1MSGA 3JAME 2R93B 2EYFA 3TN2A 1AW7A 2K1BA 4DAYA 1F2MA 5E4XA 2X6GA 1WTWA 2HQEA 4FNFA 3KF8A 2RVLA 5FO9B 2SEBD 1I4XA 4IFDJ 4KN4C 3H94A 1ET9A 4ZUIA 3HRZC 3IFTA 2OXPA 4NKLA 2WKCA 2TSSA 3NE5B 1TWHB 2L9HA 1PDQA 4QMGA 3M4YA 1SNOA 2F0JA 1I4QA 1X3QA 2NB0A 4K6DA 1OXVA 1SMYC 1FNUA 3SK5A 1SJED 2LY7A 1S5FD 1B1ZA 1SNPA 1FNWA 1QE6A 4HMJA 2E74C 3NWTA 4WFN3 2CHBD 3ND8A 3Q22A 5JOBA 4A3FB 3R93A 3GTGB 3NTHA 3S17B 5JJZA 1JR0D 1LABA 1HTLD 1D5ZC 3GP7A 1BUVT 1QJOA 2B2UA 3K5MA 2EJFC 2F0EA 2X6LA 4ZKBB 3K57A 3D4DA 1TIID 2F0IA 4XYQA 4CJ1B 2NYZD 2F0SA 3WOFA 4FXGC 3C3LA 1LTRD 4Y7NB 2C5CA 1D1IA 3NK9A 1STEA 1SBBB 1EOTA 3TDQA 2L1BA 2KCCA 3K5OA 3HZXA 3MXUA 4C56C 1H9SA 2F0WA 1EFID 3KLSX 4X3TA 1UUPA 5TSSA 3E0JA 2O5JC 4OO1H 2D9UA 3NUCA 5DM73 2JA6B 2HCCA 2NTSA 4F7XA 2CW0C 5KYLA 1STBA 5FKAC 2EZVA 3VYRA 4RGOS 1QOHA 1TS5A 3VR4A 1NUCA 3I4NB 2A6HC 1BCPF 1TR5A 3A8IE 2XRQD 1KTKA 4L8JA 1WTQA 3I4MB 2WINB 2J0TD 2NVYB 4B08A 5JEAH 4K8IA 2Q8TA 1B44D 3VR5A 3MA2B 4KHZA 5KNBA 3GTPB 3T51B 3OW7A 2I07B 1IHZA 4R8IA 1SEBD 1KABA 1IYVA 1YNNC 4FXKC 2VXWA 1BR9A 1JC7A 5JPNC 1X3PA 3S2DB 5KIXA 1TQOA 1EWCA 1DONA 5CORA 4GZYC 3A7AB 2XWJB 3A54A 3NTKA 4MHEA 3DXJC 2B2TA 1DYQA 3A55A 2EY2A 5EPLA 1XYIA 2IW3A 3EROA 4CGYB 4A3GB 1CFMA 4YIJA 1MSHA 1UNSA 2TMPA 2L0CA 1PFMA 5IT9E 2SDFA 3O13A 2KUMA 5CBAE 4XIGS 4A3KB 4XQQA 5JAVA 1K8MA 3TP6A 3URYA 4DN4M 1LT6D 2PMZB 1CA6A 1A2TA 3GTQB 4KMUC 1VCIA 2LKVA 1TY2A 1A3TA 3BVMA 3BVZA 5EJWA 1GXDC 3HOUB 1QB5D 4A3EB 2NN6G 3T53B 5CV4A 1XXGA 2D5DA 1BQQT 4QIWB 2J4XA 4N9TA 2AWOA 3HOWB 1E2VA 3IL8A 4ZKCB 5I2YA 3W2DA 1A3UA 1S5BD 5M5WB 1H9KA 3VR6A 3PUZA 1EZ8A 5FK9C 4TRDA 4ZRZA 2K05A 3U9OA 1I3QB 5C3WA 1BDOA 5HGTA 3EVQA 1S5ED 2QDBA 3DMUA 1IL8A 1SYCA 5T1IA 1D1KA 5KEEA 2JP1A 5CR3A 4NP5A 2F0VA 1LLRD 5COYA 3AMUA 2EYJA 1U4PA 5EKIA 4C1NK 5IODA 2E2JB 2F0FA 2LS01 2A6ED 1TY0A 2M2LA 3SK4A 4HR7B 1EY6A 5I9PA 1IYUA 1BF4A 3I3CA 5I9OA 1CT1D 5C4XB 4OIJA 1EYAA 1X32A 3QB3A 1RKNA 2QILA 4K5WA 3S2HB 3H91A 2Z1CA 3IKJA 3NSWA 5KNDA 4J6HA 2A74C 1LTTD 2K04A 2PW5A 1HA6A 2PPBC 1LTAD 3MAQA 4FF3A 2MPMA 1KLUD 2ZXOA 2JA8B 1F2YA 5FLXL 3D6CA 1EY0A 3K59A 1Q1BA 4FF1A 5IGEA 1KNEA 2BOSA 3MZ5A 3RZOB 1H9JA 2BDNA 4AYBB 3F2UA 3P20A 1F9RA 2EYHA 1F2ZA 5D65A 4UAIA 2FJ2A 3VYSA 4RH6A 1Q1EA 5CBEE 5JEAJ 1RTNA 4H44C 3QWNA 5ELBA 2Q8RE 3OIQA 4L6TB 4M1UB 4LJZC 1V1PB 2FHTA 1SXTA 1WD0A 2EE1A 3E5SA 1BCPB 2QCPX 3PMFA 3RLFA 2XWBB 3KLSA 4CKEA 1KAAA 1RD9D 2RBMA 3I72A 4RAUC 2RA4A 4OO1I 1A15A 1CI3M 1WTXA 1PZID 5I2XA 3RUZA 2WP8J 3CQZB 1ESFA 1EWHA 1PRTD 1QG7A 1NAPA 4O42A 5KGUA 2BE5D 3FRPB 2F0UA 4G4KA 1BNZA 3M7NA 1DOLA 2SOBA 2JA7B 1V8QA 4IUVA 5AFWA 1PZJD 4X3KA 1PFNA 2L12A 2NWGA 3M7GA 1M4VA 1CZWA 2ICEC 4KD3A 4NMZA 1I50B 1V1PA 2RDHA 4ZQ3A 1D5MC 2OEOA 2PO4A 3NP8A 4C1NI 3L3OC 3S9WA 4C3IB 1EY9A 2F03A 1C4QA 3WOEA 2B2YC 4H0LC 2K03A 3PO3B 4NDXA 4HCEA 2NTTA 4C3IG 4LMQD 4E6IA 1DZ1A 1H9SB 1JB3A 3J80L 2LMCB 3OHXC 3N52A 3H3VC 2WV6D 5ELDA 4M8AA 2F0MA 2I46A 1Y8OB 1O7ZA 4PMBA 4C3JG 4RA8A 2EY1A 4RCNA 1EY4A 3TBIB 2XVSA 2M9VA 4RHSA 1O7YA 1GOZA 4JK1C 4IUTA 4QUCA 1B53A 1ILPA 2AQ2B 5EBCA 3MFGA 4PMCA 1DCZA 5T1GA 5CGKA 4FF2A 2K01A 2MGSA 1JQYD 1RJTA 2RDGA 4XT1B 1B3AA 1WTRA 2FINB 3KUPA 1II3A 1JORA 1QCBD 3V2TA 3J7AV 3H09A 2F0OA 5C4ZA 1HPCA 1H9RA 2D2CC 3BDOA 5EKLA 2HUGA 2WACA 5FO8B 3S1NB 4KHVA 3GTOB 3FPUB 1F2LA 1A6XA 3OMCA 1IKLA 4G7ZC 5C0XG 4DAPA 5IGBA 2IX3A 1JWUD 5EQ0A 1XTCD 3MEHA 4V190 3C1FA 1HUNA 4BS9A 2NVQB 3EA6A 2M00A 2L11A 3TP7A 1TS4A 5M5YB 4IQZA 2KVMA 2E2IB 3K5NA 4TSSA 4OHJA 3D8GA 3GTLB 1EQVA 2F1MA 3DM1A 1YNJC 5M9OA 4H7BA 3TMEA 4DXGA 1D2BA 5DAUA 4HSVA 3FMCA 5IGDA 3SVMA 5EBDA 3X3MA 3HOXB 3V05A 4EVOA 1WTPA 2FMMA 3R2IA 1D6EC 4KTAA 4IZ8A 3TP5A 2PZUA 1B50A 1TWGB 2E76C 1PTOF 3ERQA 5C5LA 3I70A 3JAML 1EQTA 5A2QL 3Q0AA 4BBSB 1GUTA 3PO2B 4LK1C 1C8CA 2DNCA 2F0DA 1HQRD 1GUNA 1Z47A 5K36G 3M4OB 1CHPD 5ISRA 2D62A 5JPMC 3Q6SA 1NR4A 1PRTC 3BVGA 2A69C 1Y8PB 3NWSA 3KK7A 1DOKA 1SYEA 3J81E 5FO7B 3NQTA 4EQPA 1I6HB 1EYCA 3BYYB 3R8BA 1S5CD 5IGGA 4ZYSA 2E75C 4EQNA 3FVQA 3LNNA 2EJMA 5CV5A 2QKIC 3FDTA 4FVMA 1JWSD 3PV0A 2F0HA 1DM0B 2K5QA 1L0XB 2DY7A 2F4IA 4ME5A 3DWQA 4K6LA 4BA1I 1STYA 4CJ2C 3J7YW 4K5XA 3S1MB 3DHQA 1E2WA 2KOLA 3EJIA 4PNYA 3A8KE 4TKOB 3HOZB 2K32A 4EQOA 2WKDA 3J80E 4KKUA 3OOCA 1NCVA 3LWEA 3KLRA 1JCKB 1Z6HA 4CKCA 3EQLC 4KK7A 2JA5B 1HCZA 3NHHA 4HEDA 1JICA 3W3AA 4F88A 1JWMD 1I6VC 1IW7D 2KCNA 1EYDA 4HAEA 2MHVA 1R4PB 4IUPA 1RF2D 3BZDB 5ELCA 2G9DA 2IT1A 1UEAB 1EL0A 3C2PA 1U4MA 2RSOA 1PTOH 3GO5A 4MIUA 3L9AX 4HSPA 3J81L 5EPJA 1IW7C 3MXNA 5M5XB 1LO5D 3BYTB 2FFKB 2L5TA 4QCLA 1CQVA 1Y69U 1SNCA 5J22A 4RGNA 4PV1C 4N9PA 3AU7A 4OO1G 1Q8IA 4EGVA 2ICIA 5F2DA 2CQAA 2HDMA 3HOVB 1G2TA 2DNEA 3TZDA 5C0XH 1TT2A 4TQUS 5CV7A 5C0XI 1BO0A 1MI2A 2K5WA 5D14A 3T56B 4R8NA 1HA5A 3SR1A 3GV3A 5C3EB 5M3MB 1TKWB 3HEJA 1S5DD 1R4QB 4RKLA 3H0GB 1O78A 2EVBA 1PLFA 3T16A 2WB1B 3D4WA 1ZYRC 2VNUD 4RCOA 4G57A 1TU2B 1G291 2EYOA 2IX1A 4DK0A 1EIGA 2HDLA 1L0YB 1ML0D 1KDAA 1CZGA 4KJNA 1SYDA 1ICWA 5E3FA 2NVXB 5E4WC 1QNUA 2E2DC 1CA5A 1JOQA 3GQBA 2AQ3B 2XRSD 4B9XA 5KRUA 2BA1A 3MXPA 3QJYA 3SHLA 5C44B 1FYCA 1TS3A 4BBRB 4U68A 4ULLA 2KEEA 2O5IC 3OWEB 3X3NA 2AQ1B 1JOKA 3M3YB 4ODGA 1ENFA 2E2HB 4JBWA 1DJRD 3P1HA 4LAAA 5NUCA 3G6JB 2F3WA 3S15B 1HUMA 3VYTA 4XXEA 2K5DA 5CV9A 4Z9CB 4ILWA 3HOYB 2EOTA 2OF1A 3S1QB 1HTPA 1ILQA 4XQNA 1RDPD 4I65A 1Y1VB 3KBXA 5C4HA 1STGA 1WTVA 4HN7A 5D3DA 4BA2I 3I91A 1CHQD 2B2VA 3A56A 2A68D 4F87A 2IL8A 2KECA 4KY7A 5JVH3 1K8OA 1LACA 4A3IB 3Q23A 1CQFA 4RKBA 4DNTB 3DWAA 3BDCA 5CC4A 1PRTB 2FMCA 1SNQA 2MJ8A 1S4ZA 2NN6I 2A73B 2LFNA 1PMRA 1OXTA 4FF4A 1A3VA 3CRKC 3FEWX 4XYOA 1O7LA 2DY8A 2XNAC 3QG1A 2XIWA 1HQMC 1EEID 2G9HD 3IFDA 1BCPC 2CVRA 1HRJA 5CV6A 3K5LA 1EU4A 5C6AA 2R3ZA 4X3SA 1MD2D 2A68C 3WDNA 1F9PA 1D5XC 1PTOB 2A6EC 3TP8A 2IX0A 2KA7A 3DEOA 3CRLC 3R2TA 1FR3A 3GV6A 4C3HG 2B2WC 2K28A 1F77A 3CHBD 3ND9A 2JXMB 2L55A 1T5EA 3DUZA 1M8AA 2MUYA 4CKBA 2PW7A 1VMCA 5EGTA 5C5MA 2B63B 1DOMA 2Z4HA 1DXMA 2BE5C 3GTKB 4B9WA 4ZUJA 4FO2A 2B2WA 4KY5A 4DXFA 4ZLTF 2EY5A 4KJOA 2DN8A 1Q3LA 2PQEA 2ZXPA 4O1NA 1LV9A 3MVVA 3QOJA 3DWPA 1WCMB 4PQXA 5K5PA 2BCOA 2SNMA 4C3HB 5JEAG 5LHY1 2KHSA 2QF7A 2VUMB 3TSSA 2Z4IA 3N6RA 1OO9B 3I4LA 2Y0SB 1GJXA 1T5XD 2JE6I 3ITPA 2PZWA 5G3LF 2H4OA 4BY7B 1LTID 4F8MA 2JSOA 2YYZA 4WRDA 1QILA 4IALA 3BS1A 5HURA 3ZYYX 4XDXA 1SDFA 2K33A 5C3XA 3K58A 1I4PA 1U4RA 2MP1A 3FKIB 1CM9A 2BDOA 1W6JA 1EIHA 2O4XA 1HFGA 5ELEA 4CHTB 2B2YA 4RGTA 1AP0A 5KNCA 1Y1WB 4U673 1LTSD 2A5HA 3NPPA 4A3JB 4FP5D 3Q24A 3A8JE 3SE0A 3OWFA 1ZEQX 4L63B 4J1MA 2N55A 2WAQB 4KD4A 1G2SA 1IKMA 5M3FB 2A69D 1WD1A 5I4DA 1CTMA 1EZ6A 2R92B 1TWAB 3NBHA 4I7ZC 5A2QE 4BY1B 3FPPA 1XX8A 1ZXTA 3QO2A 2HCIA 2NN6H 4CBVA 4KV6A 2KQ3A 4IURA 4ABNA 3K7AB 2CW0D 1R9TB 5CMDA 1G91A 2F0PA 1STAA 4K5VA 1J8IA 3RZDB 3D3RA 3QOLA 4HMIA 4XQJA 2F0GA 1ZKOA 1AZPA 2KEDA 1KNAA 4BWGB 3I73A 1LTBD 4IN3A 5JVG3 1BBXC 2ZXRA 3BG3A 4KKSA 4Q0FA 1KDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB3 X;  2VB2 X;  3TDQ A;  3E6Z X;  2L55 A;  2QCP X;  1ZEQ X; 
#chains in the Genus database with same CATH topology
 2A6H D;  4I7A A;  1YHB A;  4IUQ A;  1PFB A;  1BKB A;  3K0Y A;  3LX0 A;  3HOZ G;  4JG2 A;  3CU7 A;  4DAV A;  2QW7 A;  2PQA B;  3GTO H;  1G6P A;  2NZ1 D;  2Z8L A;  2R61 A;  4JBK A;  1VMP A;  4RFB A;  4GKK Q;  1RCV D;  2YU9 B;  1I94 Q;  1FNV A;  5BN4 A;  1QUQ B;  2ENB A;  1RL2 A;  4N8F A;  3SK6 A;  5LL6 S;  4FXD A;  1G6Z A;  5EPK A;  1EU3 A;  2EYM A;  3S24 A;  3GD7 A;  3W5O A;  1SRU A;  3CCM A;  1SNM A;  1ENC A;  3MFY A;  2VY3 A;  4BY1 G;  1BCP D;  3C46 A;  4UY8 C;  4A93 G;  3K81 C;  2OCE A;  3PIP 3;  2P5Z X;  1SYF A;  1Y8N B;  5C0X J;  1XPU A;  5IGF A;  1H9M A;  5M3M G;  3BJU A;  4NXN L;  1KD1 C;  3GTJ B;  4WJW A;  5KYI A;  4FYD A;  3IRB A;  4QUF A;  3J81 c;  4DV7 L;  4HTH A;  4R4T A;  3AB9 A;  3I4M G;  3PUV A;  4DR2 L;  3SXH A;  2VQF L;  3PUX A;  1UE5 A;  3U9S A;  5C3E H;  2SNS A;  4LUO A;  3SEB A;  2B2V C;  2MFI A;  3I8Z A;  3E6Z X;  1V1O A;  1O80 A;  3MXN B;  1Q7Y C;  1KLG D;  2NUC A;  3D0F A;  4OIK A;  1OXS C;  3J7A F;  2B39 A;  1C48 A;  4OL7 A;  1SE8 A;  4JI6 Q;  3I4N G;  1SYB A;  4K8J A;  2NBF A;  1EOV A;  3P7J A;  4DGZ A;  1SE4 A;  1IBK Q;  3NQI A;  4DF7 A;  3G48 A;  3RMH A;  4KKT A;  1Z7T A;  1N9W A;  1PFS A;  1PTO D;  1TWC B;  1UEB A;  1K3R A;  2I0Q A;  1FVI A;  4NW2 A;  1B9M A;  2D0O A;  2ZJP A;  2BA0 A;  2K50 A;  1SE3 A;  4AYB G;  1VQ4 A;  2UXB Q;  3ONA B;  1PHJ A;  4RHR A;  2B8F A;  2IHF A;  2R7Z B;  1RHP A;  3F8T A;  4DA2 A;  2ID0 A;  1Q90 A;  1YNN D;  3BDL A;  5EKK A;  3UDG A;  4B3R L;  3T4A C;  1SLJ A;  2QEJ C;  1A2U A;  2VUM G;  5DEH A;  2GVA A;  1AFP A;  4PG3 A;  3S16 B;  3PIO 3;  1AN8 A;  3HG9 A;  1X65 A;  5E7N A;  3VR3 A;  4K2K A;  4IFD I;  1KDC A;  2PCF B;  1GO3 E;  4IFD H;  1AH9 A;  3D6W A;  4KY6 A;  2F0N A;  1KRS A;  5C44 H;  2JYO A;  4G7O C;  1G8Z D;  3U4V A;  3UI2 A;  1BOS A;  2EY6 A;  1JB7 A;  1E2Z A;  2F0Q A;  1EFW A;  4ID6 A;  1LT4 D;  2J7Z A;  3U4Z A;  3PQI A;  2Z9H A;  5BN3 A;  1CKO A;  4LNQ A;  3GTM H;  2EDG A;  2K52 A;  4R4C A;  3KJO A;  1CK1 A;  1GUW A;  1G51 A;  3C1E A;  4OX9 L;  4BXX H;  3S17 H;  3LWU A;  1EY8 A;  1GHJ A;  1U4L A;  3MHB A;  5LMN W;  1NR2 A;  5D3I B;  3ULJ A;  2JEA I;  1AZQ A;  4DU9 A;  4IUN A;  1YI2 A;  1L1O A;  3RR5 A;  2IWH A;  1E0B A;  3OSO A;  5AJ3 Q;  3S15 H;  4BY7 G;  2DJG C;  3KF6 B;  3I55 A;  4DR7 Q;  1N32 L;  1F9Q A;  1U9R A;  2K6A A;  1UAP A;  1UE1 A;  1HXY D;  2ZT9 C;  2R7D A;  2RDF A;  1LTG D;  1EEF D;  4LW1 A;  4LF9 Q;  1QVC A;  4QF4 A;  1K83 B;  2EJG C;  2OWO A;  4DFA A;  1GHK A;  3CXC A;  4AQY Q;  1AE2 A;  3MC0 B;  2R6G A;  1STH A;  2OT2 A;  2K4K A;  2R7Z H;  1ENA A;  5GAG C;  1VQH A;  2VQE Q;  3VA7 A;  1KRT A;  5JJL A;  1CKN A;  1ET6 A;  1X3G A;  2O2L D;  2XSC A;  4GLA C;  3NBI A;  1PH9 A;  2B8G A;  1HR0 L;  3GTQ H;  4A3I H;  2LSS A;  1SMX A;  4APV A;  3G4S A;  2EXZ A;  2LXJ A;  1HZ9 A;  2YTY A;  1YZ6 A;  2Q8I B;  1MJE A;  5IWA L;  1I6H H;  1LYL A;  1K0S A;  4XT3 B;  3H6M A;  3QIA A;  2N88 A;  4OGQ C;  4RGM A;  4XTC S;  4CDD C;  1TXY A;  1SFO B;  3NXW A;  4ZK9 B;  1STN A;  4Q5V A;  4IOC A;  4RWS C;  1QNK A;  5E1F A;  3KBG A;  1JE4 A;  3MWY W;  1I4H A;  5BR8 Q;  5I6W A;  5IIF A;  5LMN Q;  1DD2 A;  2K7V A;  1V43 A;  5FLX E;  3HS0 C;  3A7L A;  2ZM6 Q;  1U0L A;  1AEX A;  3MTS A;  3PGZ A;  1HJP A;  5BN5 A;  3NTI A;  3D31 A;  3M85 A;  4DV6 Q;  3RD4 A;  2JQO A;  1B4O A;  1W6K A;  2RKS A;  4HCS A;  5C4J B;  4KN7 C;  1PXU A;  1ZYR D;  5IYC G;  1Q81 C;  2VS1 A;  3OPO A;  3S1R B;  3DEP A;  1FD7 D;  1TWF B;  1ONL A;  5LMU Q;  3HP3 A;  4G7H C;  1N32 Q;  1HH2 P;  2UXB L;  3VR2 A;  4DNR B;  3V96 A;  3J7A 5;  2RSN A;  1GUO A;  1OXU A;  4C3J B;  1WTO A;  2LXK A;  3PUW A;  3R3O A;  2Z0S A;  5J1Z A;  4A93 B;  3J81 j;  3CCS A;  5ELF A;  2PNR C;  4DV4 L;  1TWH H;  4JI2 Q;  4X66 Q;  3EFX D;  4AQY L;  2B29 A;  2IPK D;  1J9O A;  2VB2 X;  4A3D B;  3K80 C;  3I90 A;  3RLO A;  1OXX K;  1EY5 A;  4V0B A;  5JJK A;  2N78 A;  2F0K A;  3CME A;  5CV8 A;  4IUU A;  1PTO C;  5G3L D;  1YHQ A;  2JEB I;  1K8G A;  2Q2H A;  1WVL A;  1QWY A;  1GUS A;  1FGU A;  3HOW G;  1MGS A;  3LGJ A;  3OIP A;  1LT5 D;  2RCF A;  2KJX A;  4MN3 A;  3S14 B;  1PZK D;  1TWF H;  2CKZ B;  4OEL B;  2IHE A;  2EPB A;  3TZU A;  2WII B;  2F0L A;  3G7L A;  2R92 H;  1VF7 A;  4A3B B;  1B9N A;  5LL6 X;  1L1O B;  2ZJR A;  4HJ8 A;  1TS2 A;  1FGB D;  1TVX A;  3M9B A;  1NE3 A;  4QY7 A;  4S3S A;  4JBM A;  5FOB B;  4DK1 A;  2PYK A;  4L5Q A;  2F0T A;  5IOC A;  2XN9 C;  4DV0 L;  5IT9 L;  5IGC A;  1EY7 A;  2EYL A;  4ZAI A;  4ZCK A;  5C3E G;  4DR7 L;  4H13 C;  3VYU A;  3S1Q H;  1B2T A;  4A3D G;  4WOR A;  2E2J H;  4X3U A;  4CJ0 B;  4K2L A;  4A3C G;  4DKA C;  4QB4 A;  3P75 A;  1MBY A;  4UDU C;  4DR5 Q;  1SJH D;  1Q12 A;  4YY3 L;  5DNF A;  5CYU A;  2E5L L;  1BXT A;  2V4D A;  2B2T C;  2HT1 A;  4R9W A;  1V9P A;  3OTO Q;  4AYB E;  5A35 A;  1C7Y A;  1HHV A;  1ESR A;  2PZT A;  5IYD H;  1SSO A;  2VB3 X;  4PMW A;  1E3P A;  1SND A;  5K36 H;  2X69 A;  4C2M B;  2OQ0 A;  2KHI A;  1NSN S;  3FP9 A;  3VA5 A;  1SE2 A;  4A3M B;  2IJ0 A;  1X56 A;  3IAY A;  2EYP A;  1HFN A;  1YNJ D;  2AUK A;  5J39 A;  2NVT B;  4P2C B;  4JYA Q;  2B2U C;  2F52 A;  2L15 A;  4IFD G;  1GUG A;  3HKZ B;  1I4R A;  3K6O A;  2F4V L;  1VF5 C;  2RQX A;  3OMG A;  2Q2T A;  3CKI B;  2C9O A;  3SK8 A;  4X62 L;  1SYG A;  1LT3 D;  1ROD A;  3MXG A;  4KI0 A;  3UE1 A;  3PCO B;  4K14 A;  2H1E A;  1RTO A;  3GTM B;  1VS0 A;  2GA4 B;  4CDF C;  3SDZ A;  1HZB A;  1MKH A;  2F3V A;  1A0I A;  1PYW D;  3T13 A;  1B70 B;  3K0X A;  4AH6 A;  2L4N A;  3PUY A;  1I4G A;  5I6Y A;  1F9S A;  1JOO A;  1PRT F;  3D4R A;  3HGB A;  4HJA A;  2B63 G;  3L7Z C;  5DM6 3;  2AWN A;  1XWE A;  2AUJ D;  4BBS G;  1VDZ A;  3PO2 G;  1SMY D;  2EIF A;  4J8Q A;  3NEN A;  3W1G A;  2JK8 A;  1SAP A;  1MSG A;  3JAM E;  4HJ5 A;  2R93 B;  2EYF A;  3TN2 A;  4BBS H;  1AW7 A;  2K1B A;  2QDL A;  4DAY A;  4JI0 Q;  1F2M A;  2ATW A;  3ZJY C;  1WJJ A;  1KXL A;  5E4X A;  2X6G A;  4GKJ Q;  3M4O H;  3TS0 A;  2R93 G;  1WTW A;  4JW0 A;  1X3F A;  2HQE A;  1K8A C;  1S40 A;  4FNF A;  4POG A;  3KF8 A;  4LF8 Q;  5GAE C;  2RVL A;  5FO9 B;  5ELN A;  2SEB D;  2V1C C;  3I2Z A;  1I4X A;  4IFD J;  2MQH A;  4KN4 C;  3H94 A;  1ET9 A;  4ZUI A;  3HRZ C;  4JI5 L;  3IFT A;  2OXP A;  4LF7 Q;  4NKL A;  4A75 A;  2WKC A;  2TSS A;  3NE5 B;  1TWH B;  2L9H A;  1PDQ A;  4QMG A;  3S2D H;  3M4Y A;  1LM0 A;  1SNO A;  2QGQ A;  2FXQ A;  2F0J A;  1I4Q A;  1X3Q A;  2NB0 A;  2OTJ A;  2VZA A;  4K6D A;  2VUM H;  1OXV A;  2RCN A;  1NJI C;  1SMY C;  1FNU A;  3SK5 A;  1SJE D;  2LY7 A;  4NPS A;  1S5F D;  4C3I H;  2E5L Q;  1B1Z A;  1SNP A;  2UUA L;  1FNW A;  1KL9 A;  1QE6 A;  4HMJ A;  1VQE A;  2E74 C;  3NWT A;  2E2I H;  4WFN 3;  2CHB D;  4X64 Q;  3ND8 A;  3Q22 A;  4P74 A;  5JOB A;  3H0G H;  4OX9 Q;  4A3F B;  4JI7 Q;  3CF5 A;  4IOA A;  3R93 A;  3GTG B;  1NMG A;  3NTH A;  3CAM A;  3S17 B;  5JJZ A;  1JR0 D;  1GM5 A;  1LAB A;  1HTL D;  1D5Z C;  3GP7 A;  1BUV T;  1QJO A;  2RF4 A;  2B2U A;  4PZ7 A;  3K5M A;  2EJF C;  2F0E A;  2X6L A;  4JBJ A;  2YTV A;  4ZKB B;  2Y0S G;  2CH4 W;  3K57 A;  4N8X 1;  1YJW A;  3D4D A;  4DR3 Q;  1P8L A;  2Z6K A;  4GOP C;  1TII D;  1E24 A;  2JA6 H;  2F0I A;  4XYQ A;  4CJ1 B;  2NYZ D;  2F0S A;  3WOF A;  4FXG C;  1XPR A;  4B3S L;  1LTR D;  3C3L A;  2RHQ B;  4Y7N B;  2C5C A;  1D1I A;  3M4P A;  4ME3 A;  2MO1 A;  3NK9 A;  1STE A;  1QVF A;  1SBB B;  4HIM A;  4WJ3 M;  1EOT A;  3TDQ A;  2L1B A;  2KCC A;  3K5O A;  3HZX A;  3MXU A;  4C56 C;  4DR4 Q;  1SN8 A;  1H9S A;  4DV3 L;  4B3S Q;  2F0W A;  1BBW A;  1EFI D;  3RZD H;  3KLS X;  4X3T A;  1UUP A;  3E0J A;  5TSS A;  2O5J C;  4OO1 H;  2E8G A;  2D9U A;  3NUC A;  5DM7 3;  3QR8 A;  2JA6 B;  4GN5 A;  4NXN Q;  2HCC A;  4DV1 L;  2NTS A;  4F7X A;  1GD7 A;  2CW0 C;  2YTX A;  4A3F H;  5KYL A;  3CPF A;  1STB A;  5FKA C;  4GNX B;  2EZV A;  3VYR A;  4RGO S;  5IYD G;  1QOH A;  1TS5 A;  3HOX G;  3RN2 A;  4DR1 L;  3VR4 A;  1D8L A;  3S1N H;  1NUC A;  3I4N B;  1Y1V H;  3A74 A;  2A6H C;  2QEX A;  2PQA A;  3G6E A;  1VQP A;  1BCP F;  1TR5 A;  3A8I E;  4OXP A;  2XRQ D;  1KTK A;  4CDC C;  4L8J A;  1QZG A;  1WTQ A;  4A3J G;  3T1Y Q;  2UUC L;  3I4M B;  4LUV A;  2WIN B;  2UU9 L;  2J0T D;  2NVY B;  4B08 A;  5JEA H;  4K8I A;  2Q8T A;  4DV6 L;  1B44 D;  3VR5 A;  1N34 Q;  3HKZ G;  1EYG A;  3MA2 B;  2Q2I A;  1KIX A;  4YCU A;  1Q82 C;  5FLM G;  4LWC A;  4KHZ A;  1VQM A;  4DK3 C;  3S2H H;  5KNB A;  3GTP B;  3T51 B;  3OW7 A;  2I07 B;  1IHZ A;  3EBE A;  4R8I A;  1XNQ Q;  3RN5 A;  2UXC Q;  1SEB D;  1KAB A;  1IYV A;  1YNN C;  4FXK C;  2VXW A;  1BR9 A;  1JC7 A;  5JPN C;  2A19 A;  1X3P A;  3S2D B;  5KIX A;  1TQO A;  1X55 A;  4JYA L;  3MEF A;  1EWC A;  3F2B A;  1DON A;  5COR A;  4GZY C;  3A7A B;  1C0A A;  2XWJ B;  4GOP B;  1S3O A;  3A54 A;  3NTK A;  4BXX G;  4MHE A;  4LF8 L;  3DXJ C;  1IBL L;  2B2T A;  1X9N A;  1W2B A;  1DYQ A;  3A55 A;  2EY2 A;  4JI3 Q;  5EPL A;  1XYI A;  2IW3 A;  3ERO A;  4CGY B;  3M3Y H;  4A3G B;  1CFM A;  4YIJ A;  1MSH A;  2JA7 G;  1UNS A;  1A8V A;  1I5F A;  2TMP A;  2L0C A;  1PFM A;  5IT9 E;  2SDF A;  3O13 A;  4ALP A;  4LFA L;  2KUM A;  5CBA E;  4XIG S;  4A3K B;  4XQQ A;  3ERS X;  1XMO Q;  5JAV A;  1K8M A;  1N8R C;  3TRZ A;  1Z9F A;  1TWC H;  3E9I A;  3TP6 A;  2R92 G;  3URY A;  5M5W H;  4DN4 M;  1LT6 D;  4O2D A;  2PMZ B;  1CA6 A;  2G5D A;  1A2T A;  3GTQ B;  4KMU C;  1B7Y B;  1X6O A;  1VCI A;  2LKV A;  3HFZ B;  1TY2 A;  1A3T A;  3BVM A;  3BVZ A;  5EJW A;  1BVS A;  1HR0 Q;  1GXD C;  1K3B C;  3HOU B;  1QB5 D;  2XTI A;  4A3E B;  2C35 B;  1UE7 A;  2NN6 G;  3T53 B;  5FLM H;  1LTL A;  5CV4 A;  3L0O A;  2EXD A;  1XXG A;  2D5D A;  1BQQ T;  4QIW B;  2J4X A;  3JAM i;  4N9T A;  4A3E G;  2AWO A;  3HOW B;  1E2V A;  3IL8 A;  4ZKC B;  4QIW E;  5I2Y A;  3W2D A;  1XNR L;  1JJ2 A;  3JAM c;  1M90 C;  1A3U A;  1JE5 A;  4NXM L;  1S5B D;  5M5W B;  4X65 L;  1H9K A;  3K8A A;  3KLW A;  3CC2 A;  2ZM6 L;  1L2F A;  3VR6 A;  3PO3 G;  3PUZ A;  1EZ8 A;  3SGI A;  5FK9 C;  4TRD A;  5M5Y H;  4ZRZ A;  4JPB W;  2K05 A;  3U9O A;  1I3Q B;  5C3W A;  1BDO A;  4A3G H;  4A4I A;  2A1A A;  1PH6 A;  5HGT A;  2A8V A;  3EVQ A;  1S5E D;  5HGQ A;  2QDB A;  3DMU A;  3E0E A;  1IL8 A;  3ULP A;  1VQA A;  1SYC A;  1N34 L;  4GS3 A;  5T1I A;  1N33 L;  1HNZ Q;  1D1K A;  5KEE A;  1EWI A;  4O0A A;  2JP1 A;  5CR3 A;  2JA9 A;  4NP5 A;  2F0V A;  1LLR D;  4JI2 L;  4CDE C;  4GKK L;  5IWA Q;  5COY A;  4JI3 L;  3AMU A;  2EYJ A;  4BY1 H;  1U4P A;  5EKI A;  4C1N K;  5IOD A;  4IPC A;  2E2J B;  2F0F A;  3FKI H;  4K0K Q;  2LS0 1;  2A6E D;  1TY0 A;  2M2L A;  3SK4 A;  4HR7 B;  1EY6 A;  4OWT B;  1IYU A;  5I9P A;  1WOC A;  2HIX A;  1BF4 A;  3I3C A;  4MTN A;  5I9O A;  1CT1 D;  4YCW A;  2MO0 A;  5C4X B;  4OIJ A;  3KF6 A;  4TVA B;  1EYA A;  1X32 A;  3QB3 A;  4DR5 L;  1XMO L;  1RKN A;  2QIL A;  4K5W A;  3S2H B;  2JN4 A;  3H91 A;  2Z1C A;  2CWP A;  3CP0 A;  3IKJ A;  3NSW A;  4HIK A;  5KND A;  3T1H Q;  4J6H A;  2A74 C;  3CMA A;  1LTT D;  1XNR Q;  2K04 A;  3B6Y A;  2PW5 A;  1HA6 A;  2PPB C;  4J15 A;  1LTA D;  3MAQ A;  4FF3 A;  1WTH A;  2MPM A;  2Z6K C;  2B3G A;  4POF A;  1KLU D;  2ZXO A;  2JA8 B;  1F2Y A;  5FLX L;  3D6C A;  1EY0 A;  3K59 A;  4A3I G;  1Q1B A;  5IT9 c;  4FF1 A;  4GLV B;  5IGE A;  1HZA A;  1KNE A;  2BOS A;  3MZ5 A;  3I4O A;  4HJ9 A;  3RZO B;  4HJ7 A;  3PSI A;  1YIJ A;  2E2H H;  4UP9 A;  1H9J A;  2BDN A;  4AYB B;  3STB C;  3F2U A;  4H02 A;  4YY3 Q;  3P20 A;  1F9R A;  2EYH A;  1V1Q A;  3I56 A;  4JI4 Q;  3CC7 A;  1F2Z A;  5D65 A;  4UAI A;  2FJ2 A;  3VYS A;  4X65 Q;  3L2P A;  4RH6 A;  5C4X G;  1Q1E A;  3AYH B;  3KDF B;  3J81 i;  5CBE E;  5JEA J;  5L37 A;  3A5U A;  1RTN A;  4H44 C;  1J5E L;  3QWN A;  1PH2 A;  4PZ8 A;  4JI8 L;  5ELB A;  2Q8R E;  3OIQ A;  4L6T B;  2NZO A;  4M1U B;  3DM3 A;  4LJZ C;  1V1P B;  4P71 A;  2FHT A;  1SXT A;  4HID A;  1WD0 A;  3PF4 A;  2EE1 A;  5AJ3 L;  3E5S A;  4JCV E;  1SRO A;  2R7F A;  4BY7 H;  1HNZ L;  1BCP B;  2QCP X;  3PMF A;  3RLF A;  2XWB B;  4IPG A;  3KLS A;  4CKE A;  1VQ7 A;  2N8N A;  1KAA A;  2CCZ A;  1RD9 D;  3KOJ A;  2BH8 A;  2RBM A;  3I72 A;  4QGU A;  4RAU C;  2RA4 A;  4OO1 I;  4EX5 A;  4IJH A;  1A15 A;  1CI3 M;  1MJC A;  1WTX A;  1PZI D;  5I2X A;  3RUZ A;  2WP8 J;  3CQZ B;  1ESF A;  2PMZ E;  1EWH A;  2YU9 H;  4JI0 L;  3J7Z C;  1PRT D;  1QG7 A;  2WB1 E;  1NAP A;  4O42 A;  4BBR G;  5KGU A;  2BE5 D;  1HNX L;  2PI2 A;  2F0U A;  3FRP B;  4G4K A;  1BNZ A;  3M7N A;  3H3V H;  2K14 A;  1C9O A;  5GAD C;  1DOL A;  2SOB A;  1PH3 A;  2JA7 B;  3GTL H;  2K5V A;  1V8Q A;  4A3L G;  4IUV A;  5AFW A;  3FKI G;  1VQ9 A;  4DV5 Q;  1PZJ D;  4X3K A;  5IE8 A;  1PFN A;  2L12 A;  1K0R A;  2NWG A;  3M7G A;  5GQO A;  1KQS A;  1Y1W G;  4GN4 B;  1M4V A;  1CZW A;  2ICE C;  4Y52 H;  4KD3 A;  4NMZ A;  1QVG A;  1I50 B;  1V1P A;  2RDH A;  4ZQ3 A;  4AIM A;  4LF6 Q;  1HNW L;  1VQJ A;  3H15 A;  1K9M C;  1D5M C;  2OEO A;  1NTG A;  2PO4 A;  3NP8 A;  4YWM A;  3OYY A;  3L3O C;  4C1N I;  4DV1 Q;  3S9W A;  4C3I B;  3CCE A;  1EY9 A;  2F03 A;  1C4Q A;  2JA5 H;  4A3D H;  2UU9 Q;  2XGT A;  3WOE A;  2B2Y C;  4H0L C;  3I4M H;  4KLK A;  1WI5 A;  2K03 A;  3PO3 B;  4NDX A;  4HCE A;  2NTT A;  1XJV A;  3K7A H;  4C3I G;  4LMQ D;  4E6I A;  1UWV A;  1DZ1 A;  4DV2 L;  4JV5 Q;  1H9S B;  1JB3 A;  3J80 L;  3GTP H;  2LMC B;  3OHX C;  3N52 A;  4DPG A;  1N36 L;  3STB D;  1N33 Q;  3H3V C;  4KHP L;  1I50 H;  2WV6 D;  4R1J A;  5ELD A;  4M8A A;  2F0M A;  2I46 A;  1Y8O B;  1O7Z A;  4Y7N H;  4B3R Q;  3HOU G;  4OWX B;  4PMB A;  2I5M X;  4C3J G;  4RA8 A;  2EY1 A;  1I3Q H;  1N36 Q;  4RCN A;  2BH2 A;  1EY4 A;  3TBI B;  2XVS A;  2M9V A;  4K0K L;  4RHS A;  1O7Y A;  1GOZ A;  4JK1 C;  4IUT A;  1I94 L;  4QUC A;  1B53 A;  1ILP A;  2AQ2 B;  2YV5 A;  5EBC A;  2JA6 G;  3MFG A;  2JA8 H;  4PMC A;  1DCZ A;  5T1G A;  5CGK A;  4WJ4 A;  4FF2 A;  3CCQ A;  1Q86 C;  1VQ5 A;  2K01 A;  2MGS A;  1JQY D;  1RJT A;  2RDG A;  4QL5 A;  4DV0 Q;  1IBK L;  3HOZ H;  4XT1 B;  1B3A A;  1WTR A;  2FIN B;  3KUP A;  1FJG L;  1II3 A;  2DJF C;  1JOR A;  2KEN A;  1QCB D;  3V2T A;  3CCJ A;  3J7A V;  3H09 A;  2F0O A;  5C4Z A;  4A3M H;  1PA6 A;  3CD6 A;  1HPC A;  1H9R A;  2D2C C;  1IZ6 A;  3BDO A;  5EKL A;  4BBR H;  2HUG A;  2WAC A;  2VW9 A;  5FO8 B;  5FJ8 G;  3S1N B;  4KHV A;  4JI1 Q;  1IL2 A;  1HZC A;  3E3X A;  2ASB A;  3GTO B;  3FPU B;  3PF5 A;  1F2L A;  1EQR A;  3F2C A;  1PYS B;  1A6X A;  3OMC A;  1IKL A;  4G7Z C;  3TRE A;  5C0X G;  4DAP A;  5IGB A;  3E9H A;  2IX3 A;  1EIY B;  1JWU D;  5EQ0 A;  1XTC D;  1CKN B;  3MEH A;  1XMQ Q;  3HOY H;  3RLN A;  3ICE A;  4V19 0;  4NXM Q;  3C1F A;  2R7Z G;  1UE6 A;  1HUN A;  4BS9 A;  2NVQ B;  3EA6 A;  2M00 A;  2L11 A;  1SFO H;  3NEM A;  3TP7 A;  1TS4 A;  3AQQ A;  5M5Y B;  4LFC Q;  4IQZ A;  3M4Q A;  2KVM A;  2UUB Q;  2E2I B;  3K5N A;  1PH5 A;  4TSS A;  5H1S E;  1DGS A;  4B3M Q;  1Q8K A;  2KBN A;  1X54 A;  4OHJ A;  4UP7 A;  3CQZ H;  2JA8 G;  4LFB Q;  3D8G A;  3GTL B;  2UXD L;  4YHH Q;  1EQV A;  5C44 G;  2F1M A;  3DM1 A;  1XNQ L;  4A3G G;  1YNJ C;  5M9O A;  3A0J A;  4H7B A;  3TME A;  1CUK A;  4DXG A;  1D2B A;  4LFB L;  5DAU A;  4HSV A;  1A63 A;  1JT8 A;  3FMC A;  1KHI A;  5IGD A;  3SVM A;  5IYB H;  2NVX H;  5EBD A;  4A93 H;  2K75 A;  1L0W A;  1YBY A;  2PNH A;  3X3M A;  3HOX B;  3V05 A;  4EVO A;  5ELO A;  1WTP A;  1GVP A;  2KCT A;  3F1Z A;  2FMM A;  1VQI A;  3R2I A;  4DV5 L;  4KTA A;  1D6E C;  4IZ8 A;  3A5Z B;  3TP5 A;  1WFQ A;  2PZU A;  1B50 A;  1TWG B;  2E76 C;  1PTO F;  3ERQ A;  3UDI A;  1WYD A;  4L5T A;  5C5L A;  4IO9 A;  3I70 A;  4IPH A;  4JVZ A;  5M3F G;  1E1T A;  1VQL A;  3JAM L;  4UP8 A;  4X62 Q;  1EQT A;  5A2Q L;  3Q0A A;  4BBS B;  1GUT A;  3PO2 B;  4LK1 C;  1C8C A;  2DNC A;  2F0D A;  1NNX A;  1HQR D;  1GUN A;  3KFU A;  1Z47 A;  5K36 G;  3M4O B;  4C2M H;  1CHP D;  3KYH C;  2NVQ H;  4GNX A;  5ISR A;  2D62 A;  2VL6 A;  2KHJ A;  4GLX A;  5JPM C;  3TS2 A;  3Q6S A;  1NR4 A;  1PRT C;  3BVG A;  4A3L H;  2A69 C;  1Q46 A;  1Y8P B;  2AKW B;  3KK7 A;  3NWS A;  1DOK A;  1SYE A;  1Y1W H;  3T1Y L;  4FDB A;  3J81 E;  4DV2 Q;  1VQO A;  5FO7 B;  1YNX A;  3NQT A;  1TWG H;  3KDF A;  4EQP A;  2I5H A;  1I6H B;  3S1R H;  1EYC A;  3BYY B;  3U58 A;  3R8B A;  1S5C D;  5IGG A;  4ZYS A;  2E75 C;  4EQN A;  3FVQ A;  3LNN A;  2EJM A;  5CV5 A;  4A3K H;  1HNX Q;  2JA5 G;  2QKI C;  3FDT A;  4FVM A;  1XPO A;  2Y0S E;  4LUZ A;  1JWS D;  3PV0 A;  2F0H A;  5J3B A;  4DUZ L;  3I7F A;  4DR2 Q;  1DM0 B;  4A3F G;  3J80 i;  2I5L X;  1W3S A;  2K5Q A;  1L0X B;  2DY7 A;  2F4I A;  4ME5 A;  1ASY A;  1TWA H;  1YJN A;  3DWQ A;  4UPA A;  4K6L A;  2PI2 E;  4IJL A;  4BA1 I;  4LF5 L;  5LMU L;  1STY A;  4CJ2 C;  3J7Y W;  2OQK A;  4K5X A;  3S1M B;  3DHQ A;  1R9T H;  1E2W A;  2KOL A;  3EJI A;  4PNY A;  3A8K E;  3S16 H;  2ZTE A;  2HD3 A;  4TKO B;  3HOZ B;  4LF4 Q;  1IYJ B;  4MZ9 A;  5GRO A;  2KCM A;  2K32 A;  4EQO A;  2WKD A;  3J80 E;  1K73 C;  4KKU A;  3OOC A;  4NB3 A;  1NCV A;  4JI5 Q;  3LWE A;  2HHH L;  4LF5 Q;  3KLR A;  1JCK B;  3PIP A;  1Z6H A;  2UUB L;  4CKC A;  3EQL C;  4JI8 Q;  5FLX c;  4KK7 A;  2JA5 B;  1HCZ A;  1XTD A;  3NHH A;  4HED A;  5GAH C;  3Q8D A;  1JIC A;  3W3A A;  3OW2 A;  4YHH L;  1CKM A;  4F88 A;  1JWM D;  1I6V C;  3CCL A;  3S1M H;  1IW7 D;  1MIU A;  1EYD A;  2KCN A;  3HKZ E;  4HAE A;  2MHV A;  1R4P B;  4IUP A;  1KAW A;  4X66 L;  4A76 A;  1RF2 D;  3BZD B;  5ELC A;  2G9D A;  2IT1 A;  1UEA B;  1EL0 A;  3C2P A;  1U4M A;  1K28 A;  2RSO A;  1PTO H;  3GO5 A;  4MIU A;  4C3H H;  3L9A X;  4HSP A;  5M3M H;  3J81 L;  5EPJ A;  1IW7 C;  3MXN A;  4DUY L;  4A3B H;  5M5X B;  1X3E A;  3KJP A;  1LO5 D;  3BYT B;  2FFK B;  2L5T A;  4QCL A;  3F2D A;  1VQF A;  5LMN L;  4DR3 L;  4YWK A;  1CQV A;  1Y69 U;  1VQN A;  1SNC A;  5J22 A;  4RGN A;  4PV1 C;  1NBW A;  4N9P A;  3AU7 A;  4DUY Q;  4OO1 G;  3NEL A;  1Q8I A;  4EGV A;  2ICI A;  5F2D A;  4RMF A;  2CQA A;  2HDM A;  2K5N A;  3HOV B;  1G2T A;  2DNE A;  3TZD A;  4OEM B;  5C0X H;  4GKJ L;  3VDY A;  4A3E H;  4LF9 L;  1TT2 A;  4TQU S;  5CV7 A;  5C0X I;  4DAY B;  1P16 A;  1O7I A;  5JJI A;  1BO0 A;  1GKH A;  1MI2 A;  2K5W A;  5D14 A;  3EIV A;  3T56 B;  4R8N A;  1HA5 A;  2QA4 A;  3SR1 A;  4JC0 A;  3GV3 A;  5C3E B;  1H95 A;  1HNW Q;  5M3M B;  1TKW B;  3HEJ A;  3PIO A;  1S5D D;  1S72 A;  1R4Q B;  4A3K G;  4RKL A;  3CCV A;  1IBM L;  3H0G B;  4LF4 L;  3CW2 C;  1O78 A;  1VQ6 A;  2EVB A;  1PH8 A;  1E1O A;  1PLF A;  3T16 A;  2WB1 B;  3D4W A;  2F4V Q;  4JOI C;  5C4J H;  3FHW A;  1ZYR C;  2VNU D;  4RCO A;  4A3J H;  4IPD A;  4DUZ Q;  4G57 A;  1TU2 B;  1G29 1;  3TQY A;  2EYO A;  2IX1 A;  2AHO B;  5C4X H;  4DK0 A;  4DR1 Q;  1EIG A;  2HDL A;  1L0Y B;  1ML0 D;  4JOI A;  2GVB A;  2H5X A;  1KDA A;  1CZG A;  4KJN A;  1U5K A;  1SYD A;  5IP7 G;  1ICW A;  5E3F A;  3DLL A;  2NVX B;  5E4W C;  2DGY A;  1QNU A;  2E2D C;  3RNU A;  1KC8 C;  1RIP A;  1CA5 A;  1JOQ A;  3GQB A;  2AQ3 B;  2XRS D;  4RG1 A;  2GN5 A;  2UXC L;  4B9X A;  5KRU A;  2BA1 A;  3MXP A;  4P73 A;  3QJY A;  3SHL A;  4DR4 L;  2D0P A;  2Z6B A;  5C44 B;  1FYC A;  1TS3 A;  1E22 A;  4BBR B;  4U68 A;  4ULL A;  2KEE A;  4OON A;  2O5I C;  3OWE B;  3NBH B;  3BU2 A;  3X3N A;  1YHA A;  2AQ1 B;  2DUD A;  1D7Q A;  1JOK A;  3M3Y B;  4ODG A;  1ENF A;  2E2H B;  4P75 A;  2R93 H;  3G71 A;  4JBW A;  1DJR D;  5FJ8 H;  3P1H A;  3HOW H;  4LAA A;  2CFM A;  5NUC A;  4GN3 B;  2K5H A;  3G6J B;  1T9H A;  2F3W A;  3S15 B;  1IBM Q;  3HKS A;  1HUM A;  4L5S A;  4LF6 L;  1QZH A;  3VYT A;  1XMQ L;  3GTJ H;  4XXE A;  1VQD A;  2K5D A;  5CV9 A;  3J80 c;  4P72 A;  4ILW A;  4Z9C B;  1K83 H;  2UUA Q;  1VQC A;  3HOY B;  4QQB X;  2HQL A;  2EOT A;  2OF1 A;  2F3I A;  4X64 L;  2JJQ A;  3S1Q B;  1BBU A;  1HTP A;  1ILQ A;  4LFC L;  1RDP D;  4I65 A;  1Y1V B;  4XQN A;  3KBX A;  5C4H A;  2WAQ E;  1STG A;  4B3M L;  1WTV A;  4HN7 A;  1JMC A;  4L5R C;  5D3D A;  2HHH Q;  4BA2 I;  3I91 A;  1CHQ D;  2B2V A;  1EQQ A;  3EN2 A;  1VQK A;  3A56 A;  1NY4 A;  1AE3 A;  2A68 D;  4F87 A;  2IL8 A;  3KF8 B;  4B3T L;  2KEC A;  4KY7 A;  3CCU A;  5JVH 3;  1K8O A;  1LAC A;  4A3I B;  5IY0 A;  1JJC B;  3Q23 A;  1CQF A;  4RKB A;  5IYC H;  4DNT B;  3DWA A;  3BDC A;  3OTO L;  3AEV A;  3HOY G;  5M3F H;  5CC4 A;  3HOX H;  1QUQ A;  1PRT B;  2FMC A;  1SNQ A;  2MJ8 A;  1S4Z A;  1PH4 A;  2NN6 I;  4DAM A;  2A73 B;  3GDE A;  2LFN A;  1PMR A;  4JI4 L;  1OXT A;  2VQF Q;  2IY5 B;  4FF4 A;  4MNO A;  4UHV A;  1YJ9 A;  1IBL Q;  1A3V A;  4C3J H;  2ES2 A;  5IP9 G;  3CRK C;  3FEW X;  4XYO A;  1PV4 A;  4JI7 L;  1O7L A;  2DY8 A;  2XNA C;  1J5E Q;  5IP7 H;  3QG1 A;  2XIW A;  3CCR A;  1HQM C;  1EEI D;  2G9H D;  4OWW B;  3IFD A;  3AFQ A;  1BCP C;  2CVR A;  1HRJ A;  3HOV H;  5CV6 A;  3K5L A;  1YEZ A;  1EU4 A;  5C6A A;  2R3Z A;  4X3S A;  1MD2 D;  2A68 C;  3WDN A;  4DV3 Q;  1JJG A;  2NVT H;  1F9P A;  1D5X C;  1PTO B;  2A6E C;  3TP8 A;  2IX0 A;  3HOV G;  2KA7 A;  3DEO A;  5HY6 A;  3CRL C;  3R2T A;  1J6Q A;  1FR3 A;  3GV6 A;  4C3H G;  2B2W C;  2K28 A;  3UE0 A;  3GTG H;  2ALY B;  1MHW C;  4A3B G;  1OTC A;  3K7U C;  4MTK A;  2Q2U A;  1F77 A;  3CHB D;  3ND9 A;  4JI1 L;  3BZC A;  2JXM B;  2L55 A;  1T5E A;  3DUZ A;  1M8A A;  2N3S A;  2MUY A;  1B3Q A;  4CKB A;  2PW7 A;  4GNX C;  1VMC A;  4YWL A;  1A62 A;  2UUC Q;  4GOP A;  5EGT A;  5C5M A;  2EQS A;  2B63 B;  1DOM A;  2Z4H A;  1DXM A;  2BE5 C;  3TEH B;  1VQB A;  1CSP A;  5EAY A;  3GTK B;  3T1H L;  4YCV A;  2ZTC A;  4A3C H;  4QJF A;  2WB1 G;  3U50 C;  4B9W A;  4R4I A;  2VQE L;  4ZUJ A;  4FO2 A;  2B2W A;  4KY5 A;  4DXF A;  4ZLT F;  2CQO A;  2EY5 A;  4KJO A;  1WCM G;  3PO3 H;  2DN8 A;  2HIV A;  1Q3L A;  1CSQ A;  2NZH A;  2PQE A;  2ZXP A;  4O1N A;  1PH1 A;  1LV9 A;  3MVV A;  3QOJ A;  3DWP A;  1WCM B;  4PQX A;  2RHS B;  5K5P A;  3CC4 A;  2BCO A;  3HOU H;  2SNM A;  4C3H B;  1Y14 B;  5JEA G;  5LHY 1;  2KHS A;  2QF7 A;  2VUM B;  3TSS A;  3CPW A;  2Z4I A;  3N6R A;  1OO9 B;  3I4L A;  2Y0S B;  1GJX A;  2CH4 A;  4DV4 Q;  1PH7 A;  1VQ8 A;  1T5X D;  2JE6 I;  3ITP A;  2PZW A;  5G3L F;  2H4O A;  2OTL A;  4BY7 B;  1LTI D;  4F8M A;  2JSO A;  4X6A H;  2YYZ A;  4WRD A;  1QIL A;  1SR3 A;  4IAL A;  4B3T Q;  2MNA A;  3BS1 A;  4DR6 Q;  5HUR A;  4R4Q A;  3ZYY X;  4XDX A;  1SDF A;  2K33 A;  3H0G G;  2UXD Q;  4PZ6 A;  5C3X A;  4DV7 Q;  3K58 A;  3BZK A;  1ASZ A;  3PO2 H;  5M5X H;  1I4P A;  4A3M G;  3GTK H;  1U4R A;  1EIF A;  2MP1 A;  3FKI B;  1CM9 A;  3ULL A;  2BDO A;  5IYB G;  1W6J A;  1EIH A;  2O4X A;  1HFG A;  5ELE A;  4CHT B;  2B2Y A;  4RGT A;  5IP9 H;  1AP0 A;  5KNC A;  4EQ5 A;  1Y1W B;  1M1K C;  4U67 3;  4DNI A;  2JA7 H;  1LTS D;  2A5H A;  3NPP A;  4HIO A;  4A3J B;  1ICF B;  4FP5 D;  3Q24 A;  2ZJQ A;  1B8A A;  1PYB A;  3A8J E;  4LFA Q;  3SE0 A;  3OWF A;  1ZEQ X;  4L63 B;  4J1M A;  1WCM H;  2N55 A;  3S14 H;  2WAQ B;  4KD4 A;  1G2S A;  3UDF A;  3RZO H;  1FL0 A;  5M3F B;  1IKM A;  2A69 D;  1WD1 A;  1HR0 W;  5I4D A;  1CTM A;  1EZ6 A;  4DK6 C;  2R92 B;  1TWA B;  3NBH A;  4I7Z C;  3W1B A;  5A2Q E;  1FJG Q;  1YIT A;  2WFW A;  2WAQ G;  4BY1 B;  3FPP A;  1XX8 A;  1EUJ A;  3AFP A;  1ZXT A;  3QO2 A;  2HCI A;  2NN6 H;  4CBV A;  3UDX A;  4KV6 A;  2KQ3 A;  4IUR A;  4ABN A;  4R4O A;  5DLQ E;  3K7A B;  2CW0 D;  1R9T B;  5CMD A;  1E7Z A;  1G91 A;  2F0P A;  1VQG A;  1STA A;  4K5V A;  1J8I A;  3I4N H;  1YVC A;  3RZD B;  4LF7 L;  3JC6 6;  3D3R A;  1L1O C;  2N49 A;  3QOL A;  4HMI A;  4XQJ A;  2F0G A;  1ZKO A;  1AZP A;  2KED A;  1KNA A;  4BWG B;  2CWA A;  1PVO A;  4JI6 L;  3I73 A;  3H3V I;  1LTB D;  4JV5 L;  3WWV A;  4IN3 A;  1LUZ A;  5JVG 3;  1Y1V G;  1BBX C;  2NVY H;  2AMC B;  1IXR A;  2ZXR A;  3BG3 A;  5BR8 L;  4KKS A;  4KHP Q;  2B63 H;  4DR6 L;  4Q0F A;  1NMF A;  1KDB A;  2ZTD A;  3ER0 A; 
#chains in the Genus database with same CATH homology
 2A6H D;  4IUQ A;  1PFB A;  3K0Y A;  3LX0 A;  3CU7 A;  4DAV A;  2NZ1 D;  2Z8L A;  2R61 A;  1VMP A;  4RFB A;  1RCV D;  2YU9 B;  1FNV A;  5BN4 A;  2ENB A;  3SK6 A;  5LL6 S;  4FXD A;  1G6Z A;  5EPK A;  1EU3 A;  2EYM A;  3GD7 A;  1SNM A;  1ENC A;  3MFY A;  1BCP D;  3C46 A;  3PIP 3;  1SYF A;  1Y8N B;  5C0X J;  5IGF A;  1H9M A;  3GTJ B;  4WJW A;  5KYI A;  4FYD A;  4QUF A;  4HTH A;  3AB9 A;  3PUV A;  3SXH A;  3PUX A;  3U9S A;  2SNS A;  3SEB A;  2B2V C;  3I8Z A;  3E6Z X;  1V1O A;  1O80 A;  1KLG D;  2NUC A;  4OIK A;  1OXS C;  3J7A F;  2B39 A;  1C48 A;  4OL7 A;  1SYB A;  4K8J A;  2NBF A;  3P7J A;  4DGZ A;  1SE4 A;  3NQI A;  4DF7 A;  3RMH A;  4KKT A;  1Z7T A;  1TWC B;  1PTO D;  4NW2 A;  1B9M A;  2BA0 A;  1SE3 A;  3ONA B;  4RHR A;  2B8F A;  2R7Z B;  1RHP A;  4DA2 A;  2ID0 A;  1Q90 A;  1YNN D;  3BDL A;  5EKK A;  3T4A C;  2QEJ C;  1A2U A;  5DEH A;  1AFP A;  3S16 B;  3PIO 3;  1AN8 A;  3HG9 A;  3VR3 A;  4K2K A;  4IFD I;  1KDC A;  2PCF B;  4IFD H;  3D6W A;  4KY6 A;  2F0N A;  2JYO A;  4G7O C;  1G8Z D;  3UI2 A;  1BOS A;  2EY6 A;  1E2Z A;  2F0Q A;  1LT4 D;  2J7Z A;  4ID6 A;  5BN3 A;  2EDG A;  1CK1 A;  1GUW A;  3C1E A;  3LWU A;  1EY8 A;  1GHJ A;  1U4L A;  3MHB A;  1NR2 A;  5D3I B;  2JEA I;  1AZQ A;  4DU9 A;  4IUN A;  2IWH A;  1E0B A;  3OSO A;  1F9Q A;  1U9R A;  2K6A A;  1UAP A;  1HXY D;  2ZT9 C;  2RDF A;  1LTG D;  1EEF D;  4QF4 A;  1K83 B;  2EJG C;  4DFA A;  1GHK A;  3MC0 B;  2R6G A;  1STH A;  2OT2 A;  1ENA A;  3VA7 A;  1ET6 A;  2O2L D;  2XSC A;  3NBI A;  2B8G A;  2EXZ A;  2Q8I B;  4XT3 B;  3H6M A;  3QIA A;  2N88 A;  4OGQ C;  4RGM A;  4XTC S;  1SFO B;  3NXW A;  4ZK9 B;  1STN A;  4Q5V A;  5E1F A;  4RWS C;  1QNK A;  3KBG A;  1JE4 A;  3MWY W;  1I4H A;  5I6W A;  5IIF A;  1DD2 A;  2K7V A;  1V43 A;  5FLX E;  3HS0 C;  3A7L A;  3MTS A;  1AEX A;  5BN5 A;  3NTI A;  3D31 A;  3M85 A;  3RD4 A;  1B4O A;  1W6K A;  2RKS A;  4HCS A;  5C4J B;  4KN7 C;  1PXU A;  1ZYR D;  3OPO A;  3S1R B;  3DEP A;  1FD7 D;  1TWF B;  1ONL A;  3HP3 A;  4G7H C;  3VR2 A;  4DNR B;  3V96 A;  2RSN A;  1GUO A;  1OXU A;  4C3J B;  1WTO A;  3R3O A;  3PUW A;  5J1Z A;  4A93 B;  5ELF A;  2PNR C;  3EFX D;  2IPK D;  1J9O A;  2VB2 X;  4A3D B;  3I90 A;  1OXX K;  1EY5 A;  4V0B A;  2F0K A;  5CV8 A;  4IUU A;  1PTO C;  5G3L D;  2JEB I;  1WVL A;  1QWY A;  1GUS A;  1MGS A;  3OIP A;  1LT5 D;  2KJX A;  4MN3 A;  3S14 B;  1PZK D;  2EPB A;  3TZU A;  2WII B;  2F0L A;  3G7L A;  1VF7 A;  4A3B B;  1B9N A;  5LL6 X;  1TS2 A;  1FGB D;  1TVX A;  4S3S A;  5FOB B;  4DK1 A;  2PYK A;  2F0T A;  5IOC A;  2XN9 C;  5IT9 L;  5IGC A;  1EY7 A;  2EYL A;  4ZAI A;  4H13 C;  3VYU A;  1B2T A;  4WOR A;  4X3U A;  4CJ0 B;  4K2L A;  4QB4 A;  3P75 A;  1MBY A;  4UDU C;  1SJH D;  1Q12 A;  5DNF A;  5CYU A;  1BXT A;  2V4D A;  2B2T C;  4R9W A;  5A35 A;  1HHV A;  1ESR A;  2PZT A;  1SSO A;  2VB3 X;  4PMW A;  1SND A;  5K36 H;  2X69 A;  4C2M B;  1NSN S;  3VA5 A;  1SE2 A;  4A3M B;  2IJ0 A;  3IAY A;  2EYP A;  1HFN A;  1YNJ D;  2AUK A;  5J39 A;  2NVT B;  4P2C B;  2B2U C;  4IFD G;  1GUG A;  3HKZ B;  1I4R A;  3K6O A;  1VF5 C;  2RQX A;  3OMG A;  3CKI B;  2C9O A;  3SK8 A;  1SYG A;  1LT3 D;  1ROD A;  3MXG A;  4KI0 A;  4K14 A;  2H1E A;  1RTO A;  3GTM B;  2GA4 B;  3SDZ A;  2F3V A;  1PYW D;  3T13 A;  2L4N A;  3PUY A;  1I4G A;  5I6Y A;  1F9S A;  1JOO A;  1PRT F;  3D4R A;  3HGB A;  3L7Z C;  5DM6 3;  2AWN A;  1XWE A;  2AUJ D;  1VDZ A;  1SMY D;  4J8Q A;  1SAP A;  1MSG A;  3JAM E;  2R93 B;  2EYF A;  3TN2 A;  1AW7 A;  2K1B A;  4DAY A;  1F2M A;  5E4X A;  2X6G A;  1WTW A;  2HQE A;  4FNF A;  3KF8 A;  2RVL A;  5FO9 B;  2SEB D;  1I4X A;  4IFD J;  4KN4 C;  3H94 A;  1ET9 A;  4ZUI A;  3HRZ C;  3IFT A;  2OXP A;  4NKL A;  2WKC A;  2TSS A;  3NE5 B;  1TWH B;  2L9H A;  1PDQ A;  4QMG A;  3M4Y A;  1SNO A;  2F0J A;  1I4Q A;  1X3Q A;  2NB0 A;  4K6D A;  1OXV A;  1SMY C;  1FNU A;  3SK5 A;  1SJE D;  2LY7 A;  1S5F D;  1B1Z A;  1SNP A;  1FNW A;  1QE6 A;  4HMJ A;  2E74 C;  3NWT A;  4WFN 3;  2CHB D;  3ND8 A;  3Q22 A;  5JOB A;  4A3F B;  3R93 A;  3GTG B;  3NTH A;  3S17 B;  5JJZ A;  1JR0 D;  1LAB A;  1HTL D;  1D5Z C;  3GP7 A;  1BUV T;  1QJO A;  2B2U A;  3K5M A;  2EJF C;  2F0E A;  2X6L A;  4ZKB B;  3K57 A;  3D4D A;  1TII D;  2F0I A;  4XYQ A;  4CJ1 B;  2NYZ D;  2F0S A;  3WOF A;  4FXG C;  3C3L A;  1LTR D;  4Y7N B;  2C5C A;  1D1I A;  3NK9 A;  1STE A;  1SBB B;  1EOT A;  3TDQ A;  2L1B A;  2KCC A;  3K5O A;  3HZX A;  3MXU A;  4C56 C;  1H9S A;  2F0W A;  1EFI D;  3KLS X;  4X3T A;  1UUP A;  5TSS A;  3E0J A;  2O5J C;  4OO1 H;  2D9U A;  3NUC A;  5DM7 3;  2JA6 B;  2HCC A;  2NTS A;  4F7X A;  2CW0 C;  5KYL A;  1STB A;  5FKA C;  2EZV A;  3VYR A;  4RGO S;  1QOH A;  1TS5 A;  3VR4 A;  1NUC A;  3I4N B;  2A6H C;  1BCP F;  1TR5 A;  3A8I E;  2XRQ D;  1KTK A;  4L8J A;  1WTQ A;  3I4M B;  2WIN B;  2J0T D;  2NVY B;  4B08 A;  5JEA H;  4K8I A;  2Q8T A;  1B44 D;  3VR5 A;  3MA2 B;  4KHZ A;  5KNB A;  3GTP B;  3T51 B;  3OW7 A;  2I07 B;  1IHZ A;  4R8I A;  1SEB D;  1KAB A;  1IYV A;  1YNN C;  4FXK C;  2VXW A;  1BR9 A;  1JC7 A;  5JPN C;  1X3P A;  3S2D B;  5KIX A;  1TQO A;  1EWC A;  1DON A;  5COR A;  4GZY C;  3A7A B;  2XWJ B;  3A54 A;  3NTK A;  4MHE A;  3DXJ C;  2B2T A;  1DYQ A;  3A55 A;  2EY2 A;  5EPL A;  1XYI A;  2IW3 A;  3ERO A;  4CGY B;  4A3G B;  1CFM A;  4YIJ A;  1MSH A;  1UNS A;  2TMP A;  2L0C A;  1PFM A;  5IT9 E;  2SDF A;  3O13 A;  2KUM A;  5CBA E;  4XIG S;  4A3K B;  4XQQ A;  5JAV A;  1K8M A;  3TP6 A;  3URY A;  4DN4 M;  1LT6 D;  2PMZ B;  1CA6 A;  1A2T A;  3GTQ B;  4KMU C;  1VCI A;  2LKV A;  1TY2 A;  1A3T A;  3BVM A;  3BVZ A;  5EJW A;  1GXD C;  3HOU B;  1QB5 D;  4A3E B;  2NN6 G;  3T53 B;  5CV4 A;  1XXG A;  2D5D A;  1BQQ T;  4QIW B;  2J4X A;  4N9T A;  2AWO A;  3HOW B;  1E2V A;  3IL8 A;  4ZKC B;  5I2Y A;  3W2D A;  1A3U A;  1S5B D;  5M5W B;  1H9K A;  3VR6 A;  3PUZ A;  1EZ8 A;  5FK9 C;  4TRD A;  4ZRZ A;  2K05 A;  3U9O A;  1I3Q B;  5C3W A;  1BDO A;  5HGT A;  3EVQ A;  1S5E D;  2QDB A;  3DMU A;  1IL8 A;  1SYC A;  5T1I A;  1D1K A;  5KEE A;  2JP1 A;  5CR3 A;  4NP5 A;  2F0V A;  1LLR D;  5COY A;  3AMU A;  2EYJ A;  1U4P A;  5EKI A;  4C1N K;  5IOD A;  2E2J B;  2F0F A;  2LS0 1;  2A6E D;  1TY0 A;  2M2L A;  3SK4 A;  4HR7 B;  1EY6 A;  5I9P A;  1IYU A;  1BF4 A;  3I3C A;  5I9O A;  1CT1 D;  5C4X B;  4OIJ A;  1EYA A;  1X32 A;  3QB3 A;  1RKN A;  2QIL A;  4K5W A;  3S2H B;  3H91 A;  2Z1C A;  3IKJ A;  3NSW A;  5KND A;  4J6H A;  2A74 C;  1LTT D;  2K04 A;  2PW5 A;  1HA6 A;  2PPB C;  1LTA D;  3MAQ A;  4FF3 A;  2MPM A;  1KLU D;  2ZXO A;  2JA8 B;  1F2Y A;  5FLX L;  3D6C A;  1EY0 A;  3K59 A;  1Q1B A;  4FF1 A;  5IGE A;  1KNE A;  2BOS A;  3MZ5 A;  3RZO B;  1H9J A;  2BDN A;  4AYB B;  3F2U A;  3P20 A;  1F9R A;  2EYH A;  1F2Z A;  5D65 A;  4UAI A;  2FJ2 A;  3VYS A;  4RH6 A;  1Q1E A;  5CBE E;  5JEA J;  1RTN A;  4H44 C;  3QWN A;  5ELB A;  2Q8R E;  3OIQ A;  4L6T B;  4M1U B;  4LJZ C;  1V1P B;  2FHT A;  1SXT A;  1WD0 A;  2EE1 A;  3E5S A;  1BCP B;  2QCP X;  3PMF A;  3RLF A;  2XWB B;  3KLS A;  4CKE A;  1KAA A;  1RD9 D;  2RBM A;  3I72 A;  4RAU C;  2RA4 A;  4OO1 I;  1A15 A;  1CI3 M;  1WTX A;  1PZI D;  5I2X A;  3RUZ A;  2WP8 J;  3CQZ B;  1ESF A;  1EWH A;  1PRT D;  1QG7 A;  1NAP A;  4O42 A;  5KGU A;  2BE5 D;  3FRP B;  2F0U A;  4G4K A;  1BNZ A;  3M7N A;  1DOL A;  2SOB A;  2JA7 B;  1V8Q A;  4IUV A;  5AFW A;  1PZJ D;  4X3K A;  1PFN A;  2L12 A;  2NWG A;  3M7G A;  1M4V A;  1CZW A;  2ICE C;  4KD3 A;  4NMZ A;  1I50 B;  1V1P A;  2RDH A;  4ZQ3 A;  1D5M C;  2OEO A;  2PO4 A;  3NP8 A;  4C1N I;  3L3O C;  3S9W A;  4C3I B;  1EY9 A;  2F03 A;  1C4Q A;  3WOE A;  2B2Y C;  4H0L C;  2K03 A;  3PO3 B;  4NDX A;  4HCE A;  2NTT A;  4C3I G;  4LMQ D;  4E6I A;  1DZ1 A;  1H9S B;  1JB3 A;  3J80 L;  2LMC B;  3OHX C;  3N52 A;  3H3V C;  2WV6 D;  5ELD A;  4M8A A;  2F0M A;  2I46 A;  1Y8O B;  1O7Z A;  4PMB A;  4C3J G;  4RA8 A;  2EY1 A;  4RCN A;  1EY4 A;  3TBI B;  2XVS A;  2M9V A;  4RHS A;  1O7Y A;  1GOZ A;  4JK1 C;  4IUT A;  4QUC A;  1B53 A;  1ILP A;  2AQ2 B;  5EBC A;  3MFG A;  4PMC A;  1DCZ A;  5T1G A;  5CGK A;  4FF2 A;  2K01 A;  2MGS A;  1JQY D;  1RJT A;  2RDG A;  4XT1 B;  1B3A A;  1WTR A;  2FIN B;  3KUP A;  1II3 A;  1JOR A;  1QCB D;  3V2T A;  3J7A V;  3H09 A;  2F0O A;  5C4Z A;  1HPC A;  1H9R A;  2D2C C;  3BDO A;  5EKL A;  2HUG A;  2WAC A;  5FO8 B;  3S1N B;  4KHV A;  3GTO B;  3FPU B;  1F2L A;  1A6X A;  3OMC A;  1IKL A;  4G7Z C;  5C0X G;  4DAP A;  5IGB A;  2IX3 A;  1JWU D;  5EQ0 A;  1XTC D;  3MEH A;  4V19 0;  3C1F A;  1HUN A;  4BS9 A;  2NVQ B;  3EA6 A;  2M00 A;  2L11 A;  3TP7 A;  1TS4 A;  5M5Y B;  4IQZ A;  2KVM A;  2E2I B;  3K5N A;  4TSS A;  4OHJ A;  3D8G A;  3GTL B;  1EQV A;  2F1M A;  3DM1 A;  1YNJ C;  5M9O A;  4H7B A;  3TME A;  4DXG A;  1D2B A;  5DAU A;  4HSV A;  3FMC A;  5IGD A;  3SVM A;  5EBD A;  3X3M A;  3HOX B;  3V05 A;  4EVO A;  1WTP A;  2FMM A;  3R2I A;  1D6E C;  4KTA A;  4IZ8 A;  3TP5 A;  2PZU A;  1B50 A;  1TWG B;  2E76 C;  1PTO F;  3ERQ A;  5C5L A;  3I70 A;  3JAM L;  1EQT A;  5A2Q L;  3Q0A A;  4BBS B;  1GUT A;  3PO2 B;  4LK1 C;  1C8C A;  2DNC A;  2F0D A;  1HQR D;  1GUN A;  1Z47 A;  5K36 G;  3M4O B;  1CHP D;  5ISR A;  2D62 A;  5JPM C;  3Q6S A;  1NR4 A;  1PRT C;  3BVG A;  2A69 C;  1Y8P B;  3NWS A;  3KK7 A;  1DOK A;  1SYE A;  3J81 E;  5FO7 B;  3NQT A;  4EQP A;  1I6H B;  1EYC A;  3BYY B;  3R8B A;  1S5C D;  5IGG A;  4ZYS A;  2E75 C;  4EQN A;  3FVQ A;  3LNN A;  2EJM A;  5CV5 A;  2QKI C;  3FDT A;  4FVM A;  1JWS D;  3PV0 A;  2F0H A;  1DM0 B;  2K5Q A;  1L0X B;  2DY7 A;  2F4I A;  4ME5 A;  3DWQ A;  4K6L A;  4BA1 I;  1STY A;  4CJ2 C;  3J7Y W;  4K5X A;  3S1M B;  3DHQ A;  1E2W A;  2KOL A;  3EJI A;  4PNY A;  3A8K E;  4TKO B;  3HOZ B;  2K32 A;  4EQO A;  2WKD A;  3J80 E;  4KKU A;  3OOC A;  1NCV A;  3LWE A;  3KLR A;  1JCK B;  1Z6H A;  4CKC A;  3EQL C;  4KK7 A;  2JA5 B;  1HCZ A;  3NHH A;  4HED A;  1JIC A;  3W3A A;  4F88 A;  1JWM D;  1I6V C;  1IW7 D;  2KCN A;  1EYD A;  4HAE A;  2MHV A;  1R4P B;  4IUP A;  1RF2 D;  3BZD B;  5ELC A;  2G9D A;  2IT1 A;  1UEA B;  1EL0 A;  3C2P A;  1U4M A;  2RSO A;  1PTO H;  3GO5 A;  4MIU A;  3L9A X;  4HSP A;  3J81 L;  5EPJ A;  1IW7 C;  3MXN A;  5M5X B;  1LO5 D;  3BYT B;  2FFK B;  2L5T A;  4QCL A;  1CQV A;  1Y69 U;  1SNC A;  5J22 A;  4RGN A;  4PV1 C;  4N9P A;  3AU7 A;  4OO1 G;  1Q8I A;  4EGV A;  2ICI A;  5F2D A;  2CQA A;  2HDM A;  3HOV B;  1G2T A;  2DNE A;  3TZD A;  5C0X H;  1TT2 A;  4TQU S;  5CV7 A;  5C0X I;  1BO0 A;  1MI2 A;  2K5W A;  5D14 A;  3T56 B;  4R8N A;  1HA5 A;  3SR1 A;  3GV3 A;  5C3E B;  5M3M B;  1TKW B;  3HEJ A;  1S5D D;  1R4Q B;  4RKL A;  3H0G B;  1O78 A;  2EVB A;  1PLF A;  3T16 A;  2WB1 B;  3D4W A;  1ZYR C;  2VNU D;  4RCO A;  4G57 A;  1TU2 B;  1G29 1;  2EYO A;  2IX1 A;  4DK0 A;  1EIG A;  2HDL A;  1L0Y B;  1ML0 D;  1KDA A;  1CZG A;  4KJN A;  1SYD A;  1ICW A;  5E3F A;  2NVX B;  5E4W C;  1QNU A;  2E2D C;  1CA5 A;  1JOQ A;  3GQB A;  2AQ3 B;  2XRS D;  4B9X A;  5KRU A;  2BA1 A;  3MXP A;  3QJY A;  3SHL A;  5C44 B;  1FYC A;  1TS3 A;  4BBR B;  4U68 A;  4ULL A;  2KEE A;  2O5I C;  3OWE B;  3X3N A;  2AQ1 B;  1JOK A;  3M3Y B;  4ODG A;  1ENF A;  2E2H B;  4JBW A;  1DJR D;  3P1H A;  4LAA A;  5NUC A;  3G6J B;  2F3W A;  3S15 B;  1HUM A;  3VYT A;  4XXE A;  2K5D A;  5CV9 A;  4Z9C B;  4ILW A;  3HOY B;  2EOT A;  2OF1 A;  3S1Q B;  1HTP A;  1ILQ A;  4XQN A;  1RDP D;  4I65 A;  1Y1V B;  3KBX A;  5C4H A;  1STG A;  1WTV A;  4HN7 A;  5D3D A;  4BA2 I;  3I91 A;  1CHQ D;  2B2V A;  3A56 A;  2A68 D;  4F87 A;  2IL8 A;  2KEC A;  4KY7 A;  5JVH 3;  1K8O A;  1LAC A;  4A3I B;  3Q23 A;  1CQF A;  4RKB A;  4DNT B;  3DWA A;  3BDC A;  5CC4 A;  1PRT B;  2FMC A;  1SNQ A;  2MJ8 A;  1S4Z A;  2NN6 I;  2A73 B;  2LFN A;  1PMR A;  1OXT A;  4FF4 A;  1A3V A;  3CRK C;  3FEW X;  4XYO A;  1O7L A;  2DY8 A;  2XNA C;  3QG1 A;  2XIW A;  1HQM C;  1EEI D;  2G9H D;  3IFD A;  1BCP C;  2CVR A;  1HRJ A;  5CV6 A;  3K5L A;  1EU4 A;  5C6A A;  2R3Z A;  4X3S A;  1MD2 D;  2A68 C;  3WDN A;  1F9P A;  1D5X C;  1PTO B;  2A6E C;  3TP8 A;  2IX0 A;  2KA7 A;  3DEO A;  3CRL C;  3R2T A;  1FR3 A;  3GV6 A;  4C3H G;  2B2W C;  2K28 A;  1F77 A;  3CHB D;  3ND9 A;  2JXM B;  2L55 A;  1T5E A;  3DUZ A;  1M8A A;  2MUY A;  4CKB A;  2PW7 A;  1VMC A;  5EGT A;  5C5M A;  2B63 B;  1DOM A;  2Z4H A;  1DXM A;  2BE5 C;  3GTK B;  4B9W A;  4ZUJ A;  4FO2 A;  2B2W A;  4KY5 A;  4DXF A;  4ZLT F;  2EY5 A;  4KJO A;  2DN8 A;  1Q3L A;  2PQE A;  2ZXP A;  4O1N A;  1LV9 A;  3MVV A;  3QOJ A;  3DWP A;  1WCM B;  4PQX A;  5K5P A;  2BCO A;  2SNM A;  4C3H B;  5JEA G;  5LHY 1;  2KHS A;  2QF7 A;  2VUM B;  3TSS A;  2Z4I A;  3N6R A;  1OO9 B;  3I4L A;  2Y0S B;  1GJX A;  1T5X D;  2JE6 I;  3ITP A;  2PZW A;  5G3L F;  2H4O A;  4BY7 B;  1LTI D;  4F8M A;  2JSO A;  2YYZ A;  4WRD A;  1QIL A;  4IAL A;  3BS1 A;  5HUR A;  3ZYY X;  4XDX A;  1SDF A;  2K33 A;  5C3X A;  3K58 A;  1I4P A;  1U4R A;  2MP1 A;  3FKI B;  1CM9 A;  2BDO A;  1W6J A;  1EIH A;  2O4X A;  1HFG A;  5ELE A;  4CHT B;  2B2Y A;  4RGT A;  1AP0 A;  5KNC A;  1Y1W B;  4U67 3;  1LTS D;  2A5H A;  3NPP A;  4A3J B;  4FP5 D;  3Q24 A;  3A8J E;  3SE0 A;  3OWF A;  1ZEQ X;  4L63 B;  4J1M A;  2N55 A;  2WAQ B;  4KD4 A;  1G2S A;  1IKM A;  5M3F B;  2A69 D;  1WD1 A;  5I4D A;  1CTM A;  1EZ6 A;  2R92 B;  1TWA B;  3NBH A;  4I7Z C;  5A2Q E;  4BY1 B;  3FPP A;  1XX8 A;  1ZXT A;  3QO2 A;  2HCI A;  2NN6 H;  4CBV A;  4KV6 A;  2KQ3 A;  4IUR A;  4ABN A;  3K7A B;  2CW0 D;  1R9T B;  5CMD A;  1G91 A;  2F0P A;  1STA A;  4K5V A;  1J8I A;  3RZD B;  3D3R A;  3QOL A;  4HMI A;  4XQJ A;  2F0G A;  1ZKO A;  1AZP A;  2KED A;  1KNA A;  4BWG B;  3I73 A;  1LTB D;  4IN3 A;  5JVG 3;  1BBX C;  2ZXR A;  3BG3 A;  4KKS A;  4Q0F A;  1KDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...