2QCPX

1.0 a structure of cusf-ag(i) residues 10-88 from escherichia coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
b'MEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusF
publication title Unusual Cu(I)/Ag(I) coordination of Escherichia coli CusF as revealed by atomic resolution crystallography and X-ray absorption spectroscopy
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Metal binding protein
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qcpX01
2VB3X 2VB2X 2L55A 1ZEQX 2QCPX 3E6ZX 3TDQA
chains in the Genus database with same CATH superfamily
4DGZA 4R1JA 1EOTA 1FL0A 3E3XA 3J81L 4ZKBB 3CCEA 5CBEE 4F87A 1EEFD 3KF8B 3S1NH 4KHVA 5GADC 3PO2H 4DV2Q 2K7VA 1HTLD 2NYZD 2B2UA 5D14A 1VQ6A 3SHLA 1PH3A 1K8AC 3LWUA 2R7ZB 4ZRZA 1IW7D 1NMGA 1SNPA 2KCCA 1B3QA 4O1NA 5IT9L 5M5XH 2RHSB 2RBMA 4EQPA 2PZTA 4LF5L 4A3BH 2WACA 3HKZG 3TZDA 5G3LD 2DGYA 1V1PB 1VQLA 1PFNA 1J6QA 3RZDB 1VQCA 3OWEB 1DM0B 2F3WA 1TT2A 2A74C 4IOCA 4C1NI 3WDNA 2OCEA 1FNVA 2CW0C 3DEOA 4IFDG 5IGBA 1AEXA 2WIIB 2ZTEA 1EWCA 2Z8LA 1T9HA 4DXGA 4BBSH 1EU4A 1Y1WB 1CM9A 3FKIG 5LHY1 1WCMB 3HOYB 4AQYQ 4UP9A 1IBKQ 1MD2D 1V1QA 1YEZA 4DAYB 1MSGA 1EIHA 1I3QB 3QIAA 4NMZA 4HJ7A 2ZXPA 3HOVB 3HZXA 1IHZA 2B2UC 4MTNA 2B63H 5D3DA 2JA5H 1KTKA 5IP7G 3OMCA 3TP8A 4QGUA 2F0EA 1DD2A 3AEVA 3PF5A 2K28A 3JAML 2Q8IB 3T53B 3V2TA 1II3A 1KDAA 3NBHB 1VQ7A 1HNWQ 4OWTB 1PZID 4R4OA 1EY5A 3ND9A 1C9OA 3KJPA 1WTOA 1S72A 2EYHA 1V1OA 5CV5A 4LAAA 2D2CC 3KBXA 2O2LD 1FR3A 1PH4A 3RLOA 1G6PA 4IUVA 4DA2A 5HY6A 4CJ0B 1YNJD 5KYLA 4QF4A 1OXTA 2HUGA 1KC8C 4JBMA 1CQVA 3X3MA 4HMJA 2EYJA 4FXKC 3QR8A 4IUTA 3TS2A 5M9OA 2SNSA 1EY9A 2RDGA 3BYYB 1O80A 2D62A 3MC0B 1JE5A 4ZUJA 4IFDJ 1E1TA 5IGEA 1D2BA 1XWEA 1HZBA 2NZHA 4DK0A 1OO9B 1F9RA 1WYDA 3PO2G 2ZM6Q 3CKIB 3C46A 3G48A 4WJWA 3HOUH 2RDFA 3FHWA 3NK9A 3RUZA 5C3WA 2SOBA 4BA2I 1U0LA 3ITPA 2EYOA 3ERQA 2K33A 1WD1A 2OXPA 1LV9A 2KJXA 1D6EC 4DXFA 1JICA 4A3BG 4YY3L 4G7OC 2TSSA 3CC2A 1X65A 4ZKCB 4L63B 4CDFC 1GHKA 3I70A 2IX1A 4ME3A 2ICEC 4RKBA 5K36H 1TY0A 1SYDA 4DV1L 5E4XA 1K8OA 4PNYA 3J81c 1EIFA 1SE3A 5C4XG 3ZYYX 5M5YB 4KY5A 1S3OA 1WTXA 1PTOC 2E2IB 4DR6L 1E22A 1F9PA 1KXLA 1PDQA 2Z4IA 1AZPA 2RVLA 2A6EC 2HDLA 1YHQA 4BBSG 1R9TH 1SMYD 5KIXA 4DR2L 1I6HB 2F0VA 4Q0FA 2Q2TA 1K8MA 5IT9c 4CJ2C 4B3RQ 1PTOH 3FKIB 5FJ8G 4DV0Q 2WINB 3E0JA 4AIMA 1S40A 1XMQQ 2E2JB 2B63G 1BUVT 1Y1VG 2IW3A 2JA5G 1AN8A 1QZGA 2NVTH 1GM5A 2RCFA 1DOLA 2KQ3A 2QW7A 4N8FA 4B3SQ 1U5KA 4CDCC 5LMUL 3L9AX 2F0JA 3K5NA 3CCQA 2A68C 1G291 2FMMA 4KHPL 2JQOA 3KOJA 5CORA 2DNEA 4DUZQ 2IHFA 1LABA 1B9MA 1GO3E 3NBIA 2PO4A 3O13A 4DV4L 2ZJQA 1HR0Q 3TQYA 2K5VA 3BZCA 1C7YA 1K3RA 2XVSA 1B50A 4HIMA 3CPWA 4IFDI 3EVQA 3IRBA 4NXNL 3T1HQ 4DR5L 1KRTA 5KNBA 1JWUD 1R4QB 1W6KA 4ZQ3A 2F0QA 5IGCA 5C4JB 3RLFA 1PFBA 3HG9A 2NTTA 3SGIA 1I4HA 1L0YB 2HCIA 5E4WC 3MXGA 2F0OA 2JA9A 1STYA 2AMCB 5EAYA 5M3FH 2KHSA 1SNCA 3EFXD 5GAGC 1UAPA 3JAMc 4GNXA 3P1HA 3CC7A 4RCNA 5EKLA 1ENAA 4H0LC 4LF9Q 1I94Q 4DNRB 2E74C 3D3RA 4CKBA 5J3BA 4JC0A 2VQEL 1X32A 3I7FA 3D4WA 1PYSB 3R8BA 4IQZA 3S2DH 4X3UA 3K6OA 3HOUG 3S1NB 4RH6A 2KOLA 3PO2B 3BVMA 1QUQB 3I3CA 1Q8IA 3X3NA 3GTPB 4LFAQ 1F2YA 3D6WA 1SNQA 2Z4HA 4UHVA 4DK3C 4GLXA 1QNKA 4LW1A 5D65A 5IYDH 1RD9D 1HUMA 3OYYA 4DV2L 3HFZB 2UXDQ 3KDFB 2GVAA 4POGA 1Q82C 1HH2P 2R3ZA 4A3BB 5K36G 1YVCA 2OQ0A 4KY7A 1UE1A 4X65Q 3HKSA 5JOBA 1X55A 3PIP3 1X56A 2F0KA 3A8JE 4QUCA 3EN2A 1LUZA 3GTMB 2G9DA 2OTJA 5FLMH 3H0GH 5JEAH 2Q2IA 2HDMA 4R4TA 4OWWB 4UY8C 4JI7Q 3A7AB 1ET6A 4GNXC 2K04A 2KHIA 4P75A 4OO1G 5C4XB 1E2ZA 2OTLA 2EJGC 5HURA 1K8GA 2EY1A 2ID0A 5DAUA 1SYFA 2EYMA 4BBSB 1A62A 1ZYRD 4ZYSA 1VMCA 1BQQT 1UEAB 2R93H 3IFDA 2HQEA 2QDBA 1SRUA 3DEPA 4K14A 3TRZA 2K4KA 3PUZA 2B63B 2B2YA 4XYOA 4AQYL 1YJNA 1IBKL 2UU9L 2JA5B 2BA0A 2JA7G 1IW7C 3I73A 4DK1A 5DM63 1EWHA 2WAQG 3H6MA 2F0NA 4MTKA 2E2DC 1FNUA 3SR1A 1PV4A 3M7NA 1Q46A 1E0BA 3SEBA 4I7ZC 4K0KQ 1CA5A 1D5MC 3J80E 1DGSA 4GOPA 1A15A 4JBJA 2MP1A 1E2VA 1GJXA 2F0PA 1CK1A 2NZ1D 4A75A 3N6RA 3NPPA 1SNOA 3TN2A 5CMDA 3RN5A 2IY5B 2Z6KA 1CUKA 4WJ3M 2L9HA 5E3FA 1HNWL 1S5CD 3E9HA 4V0BA 1WTQA 1LTID 4U673 1VF5C 4FYDA 1TY2A 5JJKA 2RSOA 1EEID 5M3FG 1H9KA 4K6DA 1KAWA 3GD7A 3L0OA 5M5WB 1STGA 2DJGC 4WRDA 1LLRD 4JBKA 3F8TA 3CF5A 4B9WA 4BY7H 1GUGA 1UUPA 5KGUA 1W3SA 2B2YC 4NB3A 3T1YL 1GUOA 1UE7A 2HIXA 4DAVA 1NJIC 3KBGA 5FO9B 4GZYC 4X6AH 2L5TA 3T51B 1XTCD 1DONA 4ODGA 2M9VA 4FXDA 3HOUB 1ENCA 3J7AV 4TSSA 1VQ5A 1HNXQ 1HZ9A 4LJZC 2JXMB 2XRSD 2UXCQ 4C3JH 4GOPC 2ZM6L 3S9WA 2K6AA 2JA6G 3WOFA 2E75C 2DNCA 2EOTA 2X69A 2Z6KC 2GVBA 4QB4A 2VY3A 2RF4A 4X3KA 1B4OA 1STAA 2IT1A 2CWPA 1XNQQ 1YNJC 3HKZE 1J9OA 4YWMA 3MEFA 5FLMG 2F0SA 3H0GG 3E9IA 5JEAG 1B9NA 1SNDA 3MZ5A 2UUAL 1LTLA 1X6OA 1P16A 5E7NA 1I4QA 2NTSA 1YNND 4KY6A 2F1MA 1F2ZA 3MFYA 1Q7YC 1TWAH 1R9TB 4KD4A 4A3IH 2H1EA 2RDHA 1JJGA 2R93G 1KD1C 4XTCS 1BCPD 1RCVD 3F2UA 1SMXA 3CPFA 1PTOB 1IKLA 3NQIA 2L55A 2L12A 5GQOA 2R61A 4GN3B 3P20A 1TS2A 4NKLA 2OT2A 4LNQA 3HOXH 1X3EA 1QNUA 3W1GA 1NR4A 4B3RL 4RG1A 3D8GA 4DV0L 3RLNA 3KLSA 5J1ZA 1J5EL 4A3FH 4IO9A 5C6AA 1YITA 1XMQL 5IIFA 3UDFA 2JA7B 2AQ1B 3Q8DA 4R8IA 2F3IA 2E5LQ 2WAQB 5KYIA 5KEEA 2KCTA 1U4PA 4XQQA 4ILWA 4X66Q 2E2IH 1Y8OB 4B3SL 1I4XA 2YTXA 1BCPB 1S5FD 3LWEA 3VR5A 5BR8Q 1LTGD 4I7AA 3MXNA 4DUZL 1MJCA 1SJHD 5AFWA 3U4ZA 1QOHA 4V190 3AYHB 1F77A 1ICWA 1UEBA 3URYA 2MJ8A 3IFTA 1HR0L 1WD0A 1SMYC 4LFCQ 1ASZA 2K75A 1BKBA 3I91A 5EPJA 3T1HL 3G6JB 2R7FA 3TSSA 5JEAJ 5M3FB 2K5NA 1U4LA 3MTSA 3NQTA 1M90C 4OL7A 2K32A 3M85A 4BY7G 1TS4A 3PGZA 1HFNA 4ME5A 5JJIA 2FHTA 2CWAA 4RA8A 3HOZH 2LXJA 4APVA 2ES2A 3KLSX 1FGBD 2KHJA 3P7JA 5GAHC 1VQ8A 3CRKC 2XN9C 2L11A 1B3AA 1ONLA 5EPKA 4NXMQ 4LF9L 1I94L 3BYTB 2HT1A 2XSCA 1BO0A 3BZKA 1E3PA 2K50A 3PUYA 2Q8TA 4C3JG 3K59A 4GS3A 2R92G 5CBAE 2A6HD 3PO3G 3KYHC 1G51A 1K0RA 3T13A 5LMNQ 5ELNA 4TVAB 2B3GA 3GDEA 5GROA 3VYRA 2MO0A 2JA6B 2OWOA 2BA1A 4LFAL 1EYDA 1PRTD 4O42A 3SK6A 1N33Q 1QG7A 5BN3A 3VR2A 2UXDL 2HHHQ 4DU9A 3H0GB 1IBMQ 4MZ9A 1L0WA 1JJCB 1NTGA 4F7XA 1FYCA 4A3IG 2ZTCA 3I55A 3QWNA 4K5WA 3GTPH 4KKTA 4FP5D 1H9RA 3QOJA 1STBA 4GNXB 3FDTA 3OIQA 1EIGA 2R93B 1DOMA 3HS0C 4JI6Q 3MVVA 1TVXA 4YWLA 2AUJD 1EQVA 3HOXG 1YI2A 3C1EA 4OHJA 1LTBD 1XNRQ 3DWQA 4O2DA 1T5XD 2N3SA 4QJFA 4A3FG 3CD6A 1CZGA 1I6VC 1XJVA 3PV0A 2XWJB 3GTMH 4K5VA 2F0HA 3Q6SA 3S17H 3VA5A 3CCUA 5C4XH 3CCLA 2ZXOA 2EY2A 4FVMA 4JK1C 2XTIA 4Q5VA 3M3YH 1EYAA 3E5SA 3LGJA 3K5OA 5IGGA 1VQBA 1STNA 1ML0D 4K0KL 5A35A 4IUQA 5FJ8H 3MXUA 2I46A 2Z1CA 2J4XA 4DV3Q 3M4QA 2F0UA 2F3VA 1Y1VH 2Y0SE 4FO2A 2ZJPA 1ZYRC 4R4QA 2E76C 2OQKA 1C48A 5EPLA 3J7YW 1L2FA 1LM0A 4R4IA 1QWYA 3EROA 1JQYD 5DEHA 1B44D 2FMCA 2EXDA 2PYKA 3HOZG 1QVCA 3CCVA 4BY7B 1L0XB 2F0WA 2O5IC 2XIWA 5KNDA 1NMFA 4Y52H 2SNMA 5JJLA 4M8AA 2L0CA 4JW0A 4DFAA 1W2BA 1KABA 1HNZQ 3KUPA 1SDFA 3K80C 4DR4L 2VNUD 5DM73 2RSNA 5G3LF 3OTOQ 2NZOA 4DPGA 2QEXA 3A74A 2AWNA 1TS5A 2I5LX 3I90A 4C3JB 2EZVA 5JPMC 4XIGS 1A3UA 4G7ZC 5AJ3Q 1PH6A 1JOKA 4L5QA 2M2LA 1SE4A 3PO3B 2I5HA 4XXEA 5FO7B 5LL6X 5M5WH 2ATWA 1HNXL 3HRZC 3GTQH 3K57A 3M4OH 1OXSC 4CKEA 1GKHA 2JP1A 3L3OC 4GOPB 3CCSA 2QGQA 1VMPA 3PIOA 1VQ4A 4P74A 1N9WA 2SEBD 2R6GA 1G2TA 3NWSA 2AQ2B 2NVYH 2ZXRA 4MHEA 1RTNA 4DV6Q 3UI2A 2D9UA 3M4YA 3GV6A 4PQXA 4CKCA 1QVGA 2KCMA 3DM3A 1XNQL 4DNTB 2G5DA 2D0PA 2CCZA 1TWAB 3ICEA 2QCPX 4YHHQ 2EJFC 3S2HH 2N88A 4E6IA 4A3IB 3DUZA 5C0XH 4QCLA 5IWAQ 1NR2A 1GD7A 2VQFQ 1D7QA 1RHPA 2PW7A 3DM1A 1CKNA 1SEBD 4PZ8A 3PF4A 2F4IA 1L1OA 2OEOA 3M7GA 4HAEA 3SK8A 3HOXB 4IPDA 3HKZB 5C3EH 4B3ML 1I50B 1N32Q 2CH4W 3V96A 4L5RC 2BCOA 4A3FB 4EQNA 1BF4A 3GTLB 1VQOA 3QB3A 3VYSA 2NBFA 5CV9A 2WAQE 1A6XA 1B7YB 4DUYL 2L15A 3GTJH 3TEHB 1H9SA 3NXWA 3W2DA 1QB5D 3UDGA 2LY7A 4OO1H 1AP0A 4JI1Q 4JI0Q 3A8IE 2E5LL 2I0QA 1TXYA 1VDZA 1K28A 2FFKB 1YJWA 3TP6A 4HCEA 1WI5A 4FF3A 3RR5A 4X66L 1BNZA 3A54A 5IODA 4DV5Q 1H9MA 1CKMA 2MPMA 1CSPA 1YNNC 2Q2HA 4UAIA 4ZUIA 3BVGA 5BR8L 3S16H 1HPCA 1OTCA 3T56B 4LUZA 3KLWA 3BJUA 1N34Q 2QKIC 4JI4Q 3J80i 4JCVE 4A76A 1BCPC 4PV1C 2VS1A 2B39A 2JA7H 1XX8A 4XT3B 3I4MH 4LFCL 2UUCQ 1NUCA 1L1OC 1Y8NB 1B53A 1U4RA 2V1CC 4J6HA 1HCZA 4BBRH 5EKIA 3HOZB 5ELOA 3ONAB 4MN3A 1SYCA 1RDPD 4IUPA 1QE6A 3HGBA 1LTSD 4QY7A 5C3XA 1MIUA 4RWSC 1PH7A 1JB7A 3MXPA 2K5HA 3H09A 1QCBD 4N9TA 5M3MG 2Y0SG 4HIKA 3GV3A 2GA4B 4KI0A 3CXCA 4NXML 1WTWA 1K9MC 2EXZA 1ILQA 4B08A 1Z6HA 3OW7A 1JE4A 4RGNA 3R2TA 5H1SE 4QUFA 5HGQA 2ALYB 1VCIA 1HQRD 1EFWA 4RHSA 3QOLA 5LMNL 2A5HA 1KDBA 2M00A 5JAVA 3MXNB 1LT4D 4PG3A 1EZ6A 1SE8A 1KL9A 1D5XC 5JVG3 5C4HA 1SYGA 1N33L 3Q22A 3VR6A 1SJED 3AFQA 4X3TA 5C0XG 1WFQA 2IL8A 1TWCH 2HIVA 3SVMA 1IBML 4HCSA 1Y14B 3EQLC 3OWFA 1XPUA 1RODA 3TP7A 1Y8PB 3PCOB 3MWYW 2PW5A 2JA6H 1A63A 1HZAA 4A93G 3K7AH 3I4LA 4GN4B 5C3EG 1VQIA 3NSWA 4RGMA 4OONA 2A6HC 3Q23A 5ELCA 1HQMC 1KRSA 1ET9A 3M4PA 4P71A 4X64Q 4IUUA 1KQSA 4JI6L 4BY1G 4OELB 1VF7A 1VQAA 2JEBI 3S17B 2A1AA 1A8VA 1VQ9A 4OX9Q 2IHEA 4C56C 2WB1E 2NVXH 3AFPA 4IPCA 2ENBA 3TDQA 4JYAQ 5I6YA 1PRTC 3M3YB 4R4CA 2LS01 3E6ZX 2O4XA 3MA2B 5CYUA 5JPNC 1EY0A 2NN6H 1YZ6A 1E2WA 1J8IA 5IOCA 4LF7Q 2H4OA 2K05A 4XQJA 1JMCA 2BE5D 4K8IA 2BDOA 5L37A 1Y1VB 2EJMA 4LK1C 1VQMA 3S15B 4XT1B 1CFMA 4YCWA 3I4MG 4GLAC 4JI2Q 2QDLA 1GUNA 3CHBD 4DV3L 1FD7D 1NNXA 4BBRG 5IGFA 1WOCA 4C3IH 3TMEA 2WFWA 3U58A 1A0IA 5C0XJ 2K5DA 4ZK9B 1EY6A 3RMHA 4QL5A 4EVOA 3FPUB 1F9SA 3HP3A 4LF4Q 5A2QE 3PIPA 1QVFA 1PLFA 3J80c 1SR3A 1SYBA 4XYQA 1HNZL 3U50C 5M3MB 4YIJA 2Y0SB 1IL2A 1YHBA 4KV6A 4JBWA 1HR0W 3NTHA 4LFBQ 3OTOL 3G6EA 5I6WA 2JK8A 5C5LA 3G4SA 2B2VA 5CGKA 4PMWA 3GTQB 3A5UA 3CW2C 3NP8A 1HXYD 2FINB 3R3OA 4L8JA 2KUMA 4KLKA 3M4OB 5AJ3L 5EJWA 2BH2A 1LT3D 4YCVA 4G7HC 2VUMH 4B9XA 1IL8A 1PYWD 3FP9A 2EDGA 3NEMA 2UXBQ 2NVYB 5FO8B 4K6LA 2XRQD 3C3LA 2XGTA 1CI3M 5I4DA 4DR3Q 4KMUC 5FLXE 3CMEA 5FK9C 4JI5Q 1PXUA 1Q3LA 3TP5A 4KTAA 5NUCA 1K3BC 1WVLA 4LF8Q 5IYBG 3S2HB 1Q12A 3E0EA 1JB3A 3CQZH 3BS1A 1GUWA 4H44C 4IURA 4N9PA 1CZWA 4DV6L 1WTRA 2R92H 5E1FA 1TWGH 3PO3H 5FLXc 4YHHL 5BN5A 4FF4A 4HJAA 4RFBA 4PZ6A 2VL6A 5IWAL 2ICIA 2VQFL 1Q81C 4AYBE 2EIFA 5C3EB 5FOBB 1A3VA 1F2LA 2DY8A 3MAQA 1LACA 2B2VC 5I9PA 2KVMA 4BY1B 1HA6A 5EKKA 3I4OA 1CQFA 1N32L 4KKSA 4A4IA 3GTJB 3K7UC 5KRUA 3W5OA 3GTOB 4A3CH 1UWVA 4HSVA 5LL6S 1YJ9A 4ULLA 1LT6D 4Z9CB 4S3SA 4HN7A 1G2SA 1WTHA 2CFMA 5BN4A 1SYEA 4J15A 4A3LH 3DHQA 2NN6G 1F2MA 3K5MA 4L6TB 4C2MB 4JI1L 4JI0L 3OPOA 1CKOA 5IYCH 3SDZA 1V43A 5C0XI 3IAYA 3S16B 2QEJC 3J7A5 2K52A 3SXHA 2F0DA 4P2CB 1TR5A 4K8JA 4DV5L 1I50H 2JSOA 4PZ7A 1EU3A 4KK7A 2CVRA 1N8RC 1E24A 2E8GA 3GTLH 2L1BA 1GUTA 4DR1Q 2WB1G 2SDFA 2YU9H 4R8NA 3DWAA 4C3IG 1QZHA 3I4MB 1N34L 3MFGA 2H5XA 2UUBQ 1O7YA 5IGDA 2BOSA 4BBRB 4U68A 3K58A 1N36Q 2DY7A 1PTOF 3NWTA 1CKNB 3F2BA 3OIPA 4POFA 1L1OB 4QQBX 1YHAA 4A3MH 4OO1I 2B8FA 1FJGQ 2BDNA 5HGTA 3HOWH 1I4RA 2K5WA 4DR2Q 2BH8A 4C3HG 1R4PB 3HEJA 1S5ED 1JORA 5IY0A 1DXMA 3BG3A 2F0LA 1HFGA 3S14H 1TWFH 2K5QA 1C0AA 3A55A 2MNAA 1VQJA 3KJOA 1PZJD 4F88A 1H9SB 3BDOA 3Q24A 1EYCA 2VUMG 1BCPF 3K81C 3MEHA 2I5MX 1D1KA 3SK4A 1WTPA 2D5DA 4OGQC 1WTVA 1LO5D 2VZAA 4JV5Q 1JWSD 4QIWE 5CV4A 4OWXB 1PH2A 2RA4A 3A56A 3KK7A 1STHA 4ZCKA 1IXRA 1I5FA 3STBC 4LUVA 1ZKOA 1A3TA 3AQQA 4JVZA 2C35B 2VXWA 1TWHB 1TWCB 3T16A 2ZT9C 1UE5A 1D8LA 4CDEC 3BDCA 1EOVA 1K83H 5JJZA 4DV7Q 4HR7B 2N8NA 2JA8H 1X3GA 4DR7Q 4GKJQ 2MUYA 2QILA 3K7AB 1MGSA 1PVOA 1EYGA 1KAAA 4RHRA 4LF6Q 4UDUC 1H95A 1D5ZC 3ND8A 2K1BA 1G6ZA 2MGSA 1ICFB 3ZJYC 5IP9H 2X6GA 4GLVB 1BXTA 2TMPA 4A3CG 4X65L 4X64L 2NVXB 3S1QB 2VQEQ 1PH5A 3ERSX 4KN4C 4K5XA 2KCNA 1OXUA 4HJ5A 4ABNA 2WV6D 4A3LG 1DJRD 4GN5A 4CGYB 2B29A 2I07B 1X3QA 3BVZA 4CBVA 4JI7L 1LTTD 4OX9L 2F0MA 3ER0A 5IYCG 4JYAL 1EY4A 5I2YA 1IYUA 1PRTB 4AYBG 2PCFB 3F2CA 1BR9A 1VQNA 1U9RA 1PH8A 3J81i 1CSQA 3PSIA 4HIDA 1Q1BA 1B70B 1KLUD 4LF7L 1SNMA 4HMIA 1ILPA 4IZ8A 2A19A 3NUCA 5I2XA 1AW7A 2WB1B 4C3IB 2F0GA 4A3GH 2FJ2A 2YTVA 4X62Q 1B1ZA 5K5PA 4JI2L 3W1BA 3I8ZA 2AHOB 4A3MG 3HOWG 1PRTF 1P8LA 4JI3Q 3KF6A 3CMAA 4KJOA 2JN4A 1BBUA 3IL8A 2HD3A 3PUWA 4QMGA 1TKWB 2B2TA 1DCZA 1TIID 3OOCA 4C3HB 4LF4L 4RKLA 1KNEA 2NN6I 2ZJRA 3RN2A 1HUNA 3EJIA 2B2WA 3S15H 3I2ZA 3EBEA 3QJYA 4KJNA 3H15A 2EVBA 1S4ZA 2P5ZX 3D6CA 4LFBL 1JOQA 4A3DH 2UU9Q 3K0XA 2EYLA 2BE5C 2NUCA 2QA4A 3PIO3 2VUMB 4FF1A 3TS0A 2L4NA 1G91A 4IJHA 3ULLA 5ELBA 4IPGA 2A69D 5ISRA 3JC66 2DJFC 1IYVA 2KENA 2YYZA 1MKHA 1GVPA 4GKKQ 2UXBL 1PH1A 2MHVA 4P73A 3CQZB 5M3MH 2F52A 2R92B 1KLGD 2K03A 1JJ2A 2JA8G 4DR3L 1KHIA 1TWGB 1TQOA 4JI5L 3JAMi 2HQLA 4LF8L 1JC7A 4EQOA 3FMCA 3D0FA 1K73C 2KEDA 3J7AF 1DYQA 2UXCL 2RHQB 3BU2A 2PNRC 4EQ5A 5C44H 1O78A 1X3PA 3TBIB 3CCMA 3NENA 1G8ZD 3LX0A 3OHXC 2B2TC 3I4NH 5LMNW 2NWGA 5IP9G 4ALPA 2B2WC 3AU7A 4A3KH 1VQHA 1VQEA 3BDLA 4A3JG 1DZ1A 3T1YQ 1JCKB 2EYFA 2F4VQ 3SE0A 3S1MH 2CHBD 1I4PA 5J39A 4JPBW 1Q90A 1CA6A 4KKUA 3VYTA 3H3VC 3PUVA 4JG2A 1QILA 1ZEQX 2N55A 3I56A 4PMBA 2PMZE 1MBYA 2JJQA 2IX0A 3U9SA 2IX3A 5JVH3 4AYBB 2NVQH 2Q8RE 4A93H 1M1KC 4DN4M 1FNWA 3A8KE 3BZDB 3H3VH 2PQAA 3GQBA 4BY1H 2XWBB 1FGUA 2K14A 2YU9B 1XTDA 4HIOA 4A3GG 3NTKA 3J81E 2EY6A 1C4QA 3C1FA 3GTOH 3C2PA 2GN5A 2UUAQ 3L7ZC 4DF7A 4DR1L 1D1IA 2FXQA 3CP0A 3DXJC 4R9WA 1YNXA 1CHPD 3A7LA 3V05A 1BOSA 4IALA 2UUBL 4A3MB 3UDXA 4C2MH 1X54A 3HOWB 4X3SA 1N36L 2RQXA 3FRPB 3K8AA 3J80L 5IT9E 2WKDA 3CCRA 3R2IA 1S5DD 4H02A 5TSSA 3IKJA 3DMUA 4ID6A 4JI8Q 1HZCA 4Y7NH 1E7ZA 1FJGL 5C4ZA 2EYPA 3S14B 2J7ZA 1TWFB 1Q8KA 5A2QL 1STEA 1MJEA 1Z7TA 1AH9A 4A3DG 5GAEC 3STBD 3U9OA 1LYLA 2N78A 1J5EQ 4JOIA 1LTRD 1XPRA 1Q1EA 1RL2A 1XMOQ 1ZXTA 2D0OA 1EL0A 4H7BA 3S1RH 3NTIA 1GUSA 4RMFA 1NCVA 3GTGH 3UE1A 3TZUA 3R93A 1Z9FA 1IBLQ 4FF2A 4JV5L 4BWGB 1V8QA 2F0FA 4YWKA 2YV5A 1K83B 4YCUA 3AMUA 3NHHA 2F03A 4A3EH 2JA8B 1HA5A 1PYBA 5FLXL 5C44G 2F0IA 5EBCA 5I9OA 1NAPA 2B8GA 3D31A 3GTKH 3OSOA 3I4NG 1ESFA 2EPBA 1AE2A 4LUOA 4DV7L 4B3TQ 3RZOH 3KF8A 3H91A 4DR7L 2KBNA 3JAME 4QIWB 4IUNA 4GKJL 2ASBA 4A3KG 4C1NK 3MHBA 1SFOH 4XDXA 5EBDA 2LMCB 3QO2A 2E2HH 4LF6L 4A3JB 2VB2X 1UNSA 4JOIC 4NW2A 2HHHL 1NBWA 1TWHH 4O0AA 4IOAA 5COYA 5IYBH 1SBBB 1SAPA 4I65A 2JEAI 1OXVA 3EIVA 1IZ6A 5KNCA 4CJ1B 1FVIA 1V1PA 2N49A 1M8AA 2G9HD 4M1UB 2KA7A 3FVQA 3H94A 1EQTA 4PMCA 1ASYA 1EQRA 1A2TA 1BBWA 3FEWX 4J8QA 2A8VA 2F0TA 5F2DA 2CQAA 1ESRA 1JWMD 1RTOA 1XNRL 1GOZA 1A2UA 2Z9HA 1LTAD 4J1MA 4DAPA 3EA6A 1BVSA 4AH6A 4H13C 5M5XB 1K0SA 3S1QH 4A3GB 4OIJA 1RJTA 2CW0D 2LKVA 4DAYA 4MNOA 1NY4A 5CR3A 1SSOA 1B2TA 3KLRA 1HHVA 4X62L 4OXPA 3AB9A 2AUKA 2PQEA 4HTHA 2A73B 3ULPA 2C5CA 5T1GA 4EGVA 2WP8J 4IN3A 1SXTA 4XQNA 1MSHA 4JI3L 4CHTB 3L2PA 3F2DA 4RGOS 2R7ZH 4LF5Q 1CT1D 4WFN3 4KN7C 1EFID 1X3FA 1EY7A 1NSNS 2EY5A 3NBHA 2ZTDA 3VR3A 4A3DB 1XPOA 4LMQD 2LXKA 3I72A 3UDIA 1JT8A 4LWCA 3T4AC 1KNAA 3RNUA 4IPHA 2RCNA 3RZDH 2LFNA 2DN8A 1PMRA 2JE6I 3WOEA 1CTMA 4DKAC 2YTYA 1CHQD 4C3HH 3CU7A 4A3EG 1PH9A 3M9BA 2MO1A 2KEEA 1O7LA 1TS3A 2PZUA 2PI2A 4GKKL 3P75A 1Y1WH 4L5TA 1WCMH 1XXGA 3WWVA 5C44B 3HOYH 1V9PA 3VA7A 3NELA 3SK5A 5CC4A 1IYJB 1I3QH 3I4NB 2Z6BA 3HOVH 1X9NA 3KF6B 4NPSA 3PMFA 4A3KB 2QF7A 3VDYA 2Z0SA 2LSSA 2X6LA 3F1ZA 1YBYA 1EIYB 2EQSA 3TREA 3S1MB 1BBXC 4DR4Q 2CQOA 3CCJA 4OEMB 4IJLA 1F9QA 2PI2E 3FPPA 4WORA 1PHJA 2A69C 4MIUA 4UPAA 1SROA 1KDCA 3KFUA 1EQQA 2F4VL 2V4DA 1U4MA 1RKNA 5ELDA 4G57A 4A93B 3A0JA 2NVQB 2NB0A 1OXXK 2HCCA 1SE2A 1M4VA 4HEDA 1O7IA 5CV6A 4TKOB 5IYDG 3J81j 2OF1A 1ENFA 2CH4A 4RCOA 1VQPA 3CRLC 3CC4A 1VQGA 4BXXH 5D3IB 2RKSA 3D4RA 1PTOD 5CV7A 1PZKD 1Z47A 2A6ED 4DAMA 3UE0A 4HSPA 2PMZB 4ZLTF 1AFPA 2EE1A 4DK6C 2KECA 5DLQE 3CAMA 2Q2UA 1EUJA 1AZQA 1IKMA 1QJOA 1I4GA 4FNFA 3D4DA 3ULJA 4Y7NB 4DNIA 3G71A 2R7ZG 1VQFA 4YY3Q 1VS0A 2VW9A 4TQUS 1S5BD 3VYUA 1WJJA 4RGTA 1TU2B 1E1OA 1PA6A 1YIJA 5ELEA 4FXGC 4JI8L 2R7DA 4G4KA 4OIKA 4B3MQ 3H3VI 4JI4L 2A68D 4DV1Q 5IE8A 1NE3A 1XYIA 3A5ZB 1HTPA 1VQKA 4RAUC 1C8CA 5DNFA 2NVTB 4KD3A 1GXDC 4L5SA 2UUCL 3S1RB 4DUYQ 1JR0D 4DR6Q 3S24A 1VQDA 1LT5D 1XMOL 2CKZB 1Y69U 3GTGB 1AE3A 3NE5B 4TRDA 5M5YH 4HJ9A 4K2KA 4HJ8A 2PQAB 2PZWA 3OW2A 2O5JC 4NDXA 2AWOA 3W3AA 4BS9A 4IFDH 5J22A 4A3EB 1Y1WG 1I6HH 1WCMG 1IBLL 2PNHA 1SLJA 3HOYG 5T1IA 1H9JA 3J7ZC 3GTKB 3FKIH 3Q0AA 3HOVG 2PPBC 1UE6A 2E2JH 3RZOB 3PQIA 5LMUQ 2MQHA 1Q86C 4K2LA 4FDBA 2WKCA 2IPKD 3GO5A 1KIXA 1B8AA 3PUXA 5EQ0A 1SN8A 3RD4A 1QUQA 3B6YA 4KHPQ 4WJ4A 1SFOB 2AKWB 1BDOA 4B3TL 1DOKA 1GHJA 3QG1A 2IJ0A 3K5LA 2E2HB 1PFSA 5IP7H 1HJPA 4DV4Q 4N8X1 5FKAC 3KDFA 3LNNA 4NXNQ 4DR5Q 2AQ3B 3DLLA 4KHZA 2J0TD 3GP7A 3U4VA 1MI2A 4UP7A 3S2DB 1EWIA 2MFIA 3K0YA 1HRJA 4ZAIA 5CV8A 2XNAC 4CDDC 1EY8A 2K01A 3N52A 2C9OA 5C4JH 4UP8A 4P72A 1MHWC 2VB3X 3DWPA 1O7ZA 4BXXG 5EGTA 3G7LA 4BA1I 1EZ8A 3OMGA 1JOOA 2DUDA 5C5MA 4A3JH 2JYOA 1T5EA 5ELFA 4F8MA 4NP5A 1RIPA 2IWHA 1W6JA 1PFMA 3VR4A 4EX5A 1RF2D
chains in the Genus database with same CATH topology
4DGZA 1EOTA 3J81L 4ZKBB 5CBEE 4F87A 1EEFD 4KHVA 2K7VA 1HTLD 2NYZD 2B2UA 5D14A 3SHLA 3LWUA 2R7ZB 4ZRZA 1IW7D 2KCCA 1SNPA 4O1NA 5IT9L 2RBMA 4EQPA 2PZTA 2WACA 3TZDA 5G3LD 1V1PB 1PFNA 3RZDB 3OWEB 1DM0B 2F3WA 1TT2A 2A74C 4C1NI 3WDNA 1FNVA 2CW0C 3DEOA 4IFDG 5IGBA 1AEXA 2WIIB 1EWCA 2Z8LA 4DXGA 1EU4A 1Y1WB 1CM9A 5LHY1 1WCMB 3HOYB 1MD2D 1MSGA 1EIHA 1I3QB 3QIAA 4NMZA 2ZXPA 3HOVB 3HZXA 1IHZA 2B2UC 5D3DA 1KTKA 3OMCA 3TP8A 2F0EA 1DD2A 2K28A 3JAML 2Q8IB 3T53B 3V2TA 1II3A 1KDAA 1PZID 1EY5A 3ND9A 1WTOA 2EYHA 1V1OA 5CV5A 4LAAA 2D2CC 3KBXA 2O2LD 1FR3A 4IUVA 4DA2A 4CJ0B 1YNJD 5KYLA 4QF4A 1OXTA 2HUGA 1CQVA 3X3MA 4HMJA 2EYJA 4FXKC 4IUTA 5M9OA 2SNSA 1EY9A 2RDGA 3BYYB 1O80A 2D62A 3MC0B 4ZUJA 4IFDJ 5IGEA 1D2BA 1XWEA 4DK0A 1OO9B 1F9RA 3CKIB 3C46A 4WJWA 2RDFA 3NK9A 3RUZA 5C3WA 2SOBA 4BA2I 3ITPA 2EYOA 3ERQA 2K33A 1WD1A 2OXPA 1LV9A 2KJXA 1D6EC 4DXFA 1JICA 4G7OC 2TSSA 4ZKCB 4L63B 1GHKA 3I70A 2IX1A 4RKBA 2ICEC 5K36H 1TY0A 1SYDA 5E4XA 1K8OA 4PNYA 1SE3A 3ZYYX 5M5YB 4KY5A 1WTXA 1PTOC 2E2IB 1F9PA 1PDQA 2Z4IA 1AZPA 2RVLA 2A6EC 2HDLA 1SMYD 5KIXA 1I6HB 2F0VA 4Q0FA 1K8MA 4CJ2C 1PTOH 3FKIB 2WINB 3E0JA 2E2JB 1BUVT 2IW3A 1AN8A 1DOLA 2KQ3A 3L9AX 2F0JA 3K5NA 2A68C 1G291 2FMMA 5CORA 2DNEA 1LABA 1B9MA 3NBIA 2PO4A 3O13A 2XVSA 1B50A 4IFDI 3EVQA 5KNBA 1JWUD 1R4QB 1W6KA 4ZQ3A 2F0QA 5IGCA 5C4JB 3RLFA 1PFBA 3HG9A 2NTTA 1I4HA 1L0YB 2HCIA 5E4WC 3MXGA 2F0OA 1STYA 2KHSA 1SNCA 3EFXD 1UAPA 3P1HA 4RCNA 5EKLA 1ENAA 4H0LC 4DNRB 2E74C 3D3RA 4CKBA 1X32A 3D4WA 3R8BA 4IQZA 4X3UA 3K6OA 3S1NB 4RH6A 2KOLA 3PO2B 3BVMA 3I3CA 1Q8IA 3X3NA 3GTPB 1F2YA 3D6WA 1SNQA 2Z4HA 1QNKA 5D65A 1RD9D 1HUMA 2R3ZA 4A3BB 5K36G 4KY7A 5JOBA 3PIP3 2F0KA 4QUCA 3A8JE 3GTMB 2G9DA 5JEAH 2HDMA 3A7AB 1ET6A 2K04A 4OO1G 5C4XB 1E2ZA 2EJGC 5HURA 2EY1A 2ID0A 5DAUA 1SYFA 2EYMA 4BBSB 1ZYRD 4ZYSA 1VMCA 1BQQT 1UEAB 3IFDA 2HQEA 2QDBA 3DEPA 4K14A 3PUZA 2B63B 2B2YA 4XYOA 2JA5B 2BA0A 1IW7C 3I73A 4DK1A 5DM63 1EWHA 3H6MA 2F0NA 2E2DC 1FNUA 3SR1A 3M7NA 1E0BA 3SEBA 4I7ZC 1CA5A 1D5MC 3J80E 1A15A 2MP1A 1E2VA 1GJXA 2F0PA 1CK1A 2NZ1D 3N6RA 3NPPA 1SNOA 3TN2A 5CMDA 2L9HA 5E3FA 1S5CD 4V0BA 1WTQA 1LTID 4U673 1VF5C 4FYDA 1TY2A 2RSOA 1EEID 1H9KA 4K6DA 3GD7A 5M5WB 1STGA 4WRDA 1LLRD 4B9WA 1GUGA 1UUPA 5KGUA 2B2YC 1GUOA 4DAVA 3KBGA 5FO9B 4GZYC 2L5TA 3T51B 1XTCD 1DONA 4ODGA 2M9VA 4FXDA 3HOUB 1ENCA 3J7AV 4TSSA 4LJZC 2JXMB 2XRSD 3S9WA 2K6AA 3WOFA 2E75C 2DNCA 2EOTA 2X69A 4QB4A 4X3KA 1B4OA 1STAA 2IT1A 1YNJC 1J9OA 2F0SA 5JEAG 1B9NA 1SNDA 3MZ5A 1I4QA 2NTSA 1YNND 4KY6A 2F1MA 1F2ZA 3MFYA 1R9TB 4KD4A 2H1EA 2RDHA 4XTCS 1BCPD 1RCVD 3F2UA 1PTOB 1IKLA 3NQIA 2L55A 2L12A 2R61A 3P20A 1TS2A 4NKLA 2OT2A 1QNUA 1NR4A 3D8GA 3KLSA 5J1ZA 5C6AA 5IIFA 2JA7B 2AQ1B 4R8IA 2WAQB 5KYIA 5KEEA 1U4PA 4XQQA 4ILWA 1Y8OB 1I4XA 1BCPB 1S5FD 3LWEA 3VR5A 1LTGD 3MXNA 1SJHD 5AFWA 1QOHA 4V190 1F77A 1ICWA 3URYA 2MJ8A 3IFTA 1WD0A 1SMYC 3I91A 5EPJA 3G6JB 3TSSA 5JEAJ 5M3FB 1U4LA 3MTSA 3NQTA 4OL7A 2K32A 3M85A 1TS4A 1HFNA 4ME5A 2FHTA 4RA8A 3KLSX 1FGBD 3P7JA 3CRKC 2XN9C 2L11A 1B3AA 1ONLA 5EPKA 3BYTB 2XSCA 1BO0A 2Q8TA 3K59A 3PUYA 4C3JG 5CBAE 2A6HD 3T13A 2JA6B 3VYRA 2BA1A 1EYDA 1PRTD 4O42A 3SK6A 1QG7A 5BN3A 3VR2A 4DU9A 3H0GB 4F7XA 1FYCA 3QWNA 4K5WA 4KKTA 4FP5D 1H9RA 3QOJA 1STBA 2R93B 3FDTA 3OIQA 1EIGA 1DOMA 3HS0C 3MVVA 1TVXA 2AUJD 1EQVA 3C1EA 4OHJA 1LTBD 3DWQA 1T5XD 1CZGA 1I6VC 3PV0A 2XWJB 4K5VA 2F0HA 3Q6SA 3VA5A 2ZXOA 2EY2A 4FVMA 4JK1C 4Q5VA 1EYAA 3E5SA 3K5OA 5IGGA 1STNA 1ML0D 5A35A 4IUQA 3MXUA 2I46A 2Z1CA 2J4XA 2F0UA 2F3VA 4FO2A 1ZYRC 2E76C 1C48A 5EPLA 3J7YW 1QWYA 3EROA 1JQYD 5DEHA 1B44D 2FMCA 2PYKA 4BY7B 1L0XB 2F0WA 2O5IC 2XIWA 5KNDA 2SNMA 4M8AA 2L0CA 4DFAA 1KABA 3KUPA 1SDFA 2VNUD 5DM73 2RSNA 5G3LF 2AWNA 1TS5A 3I90A 4C3JB 2EZVA 5JPMC 4XIGS 1A3UA 4G7ZC 1JOKA 2M2LA 1SE4A 3PO3B 4XXEA 5FO7B 5LL6X 3HRZC 3K57A 1OXSC 4CKEA 2JP1A 3L3OC 1VMPA 2SEBD 2R6GA 1G2TA 3NWSA 2AQ2B 2ZXRA 4MHEA 1RTNA 3UI2A 2D9UA 3M4YA 3GV6A 4PQXA 4CKCA 4DNTB 1TWAB 2QCPX 2EJFC 2N88A 4E6IA 4A3IB 3DUZA 5C0XH 4QCLA 1NR2A 1RHPA 2PW7A 3DM1A 1SEBD 2F4IA 2OEOA 3M7GA 4HAEA 3SK8A 3HOXB 3HKZB 1I50B 3V96A 2BCOA 4A3FB 4EQNA 1BF4A 3GTLB 3QB3A 3VYSA 2NBFA 5CV9A 1A6XA 1H9SA 3NXWA 3W2DA 1QB5D 1AP0A 2LY7A 4OO1H 3A8IE 1VDZA 2FFKB 3TP6A 4HCEA 4FF3A 1BNZA 3A54A 5IODA 1H9MA 2MPMA 1YNNC 4UAIA 4ZUIA 3BVGA 1HPCA 3T56B 2QKIC 1BCPC 4PV1C 2B39A 1XX8A 4XT3B 1NUCA 1Y8NB 1B53A 1U4RA 4J6HA 1HCZA 5EKIA 3HOZB 3ONAB 4MN3A 1SYCA 1RDPD 4IUPA 1QE6A 3HGBA 1LTSD 5C3XA 4RWSC 3MXPA 3H09A 1QCBD 4N9TA 3GV3A 2GA4B 4KI0A 1WTWA 2EXZA 1ILQA 4B08A 1Z6HA 3OW7A 1JE4A 4RGNA 3R2TA 4QUFA 1VCIA 1HQRD 4RHSA 3QOLA 2A5HA 1KDBA 2M00A 5JAVA 1LT4D 1EZ6A 1D5XC 5JVG3 5C4HA 1SYGA 3Q22A 3VR6A 1SJED 4X3TA 5C0XG 2IL8A 3SVMA 4HCSA 3EQLC 3OWFA 1RODA 3TP7A 1Y8PB 3MWYW 2PW5A 3I4LA 3NSWA 4RGMA 2A6HC 3Q23A 5ELCA 1HQMC 1ET9A 4IUUA 1VF7A 2JEBI 3S17B 4C56C 2ENBA 3TDQA 5I6YA 1PRTC 3M3YB 2LS01 3E6ZX 2O4XA 3MA2B 5CYUA 5JPNC 1EY0A 2NN6H 1E2WA 1J8IA 5IOCA 2H4OA 2K05A 4XQJA 2BE5D 4K8IA 2BDOA 1Y1VB 2EJMA 4LK1C 3S15B 4XT1B 1CFMA 1GUNA 3CHBD 1FD7D 5IGFA 3TMEA 5C0XJ 2K5DA 4ZK9B 1EY6A 3RMHA 4EVOA 3FPUB 1F9SA 3HP3A 5A2QE 1PLFA 1SYBA 4XYQA 5M3MB 4YIJA 2Y0SB 4KV6A 4JBWA 3NTHA 5I6WA 5C5LA 2B2VA 5CGKA 4PMWA 3GTQB 3NP8A 1HXYD 2FINB 3R3OA 4L8JA 2KUMA 3M4OB 5EJWA 1LT3D 4G7HC 4B9XA 1IL8A 1PYWD 2EDGA 2NVYB 5FO8B 4K6LA 2XRQD 3C3LA 1CI3M 5I4DA 4KMUC 5FLXE 5FK9C 1PXUA 1Q3LA 3TP5A 4KTAA 5NUCA 1WVLA 3S2HB 1Q12A 1JB3A 3BS1A 1GUWA 4H44C 4IURA 4N9PA 1CZWA 1WTRA 5E1FA 5BN5A 4FF4A 4RFBA 2ICIA 5C3EB 5FOBB 1A3VA 1F2LA 2DY8A 3MAQA 1LACA 2B2VC 5I9PA 2KVMA 4BY1B 1HA6A 5EKKA 1CQFA 4KKSA 3GTJB 5KRUA 3GTOB 4HSVA 5LL6S 4ULLA 1LT6D 4Z9CB 4S3SA 4HN7A 1G2SA 5BN4A 1SYEA 3DHQA 2NN6G 1F2MA 3K5MA 4L6TB 4C2MB 3OPOA 3IAYA 3SDZA 1V43A 5C0XI 3S16B 2QEJC 3SXHA 2F0DA 4P2CB 1TR5A 4K8JA 2JSOA 1EU3A 4KK7A 2CVRA 2L1BA 1GUTA 2SDFA 4R8NA 3DWAA 4C3IG 3I4MB 3MFGA 1O7YA 5IGDA 2BOSA 4BBRB 4U68A 3K58A 2DY7A 1PTOF 3NWTA 3OIPA 4OO1I 2B8FA 2BDNA 5HGTA 1I4RA 2K5WA 4C3HG 1R4PB 3HEJA 1S5ED 1JORA 1DXMA 3BG3A 2F0LA 1HFGA 2K5QA 3A55A 1PZJD 4F88A 1H9SB 3BDOA 3Q24A 1EYCA 1BCPF 3MEHA 1D1KA 3SK4A 1WTPA 2D5DA 4OGQC 1WTVA 1LO5D 1JWSD 5CV4A 2RA4A 3A56A 3KK7A 1STHA 1ZKOA 1A3TA 2VXWA 1TWHB 1TWCB 3T16A 2ZT9C 3BDCA 5JJZA 4HR7B 2MUYA 2QILA 3K7AB 1MGSA 1KAAA 4RHRA 4UDUC 1D5ZC 3ND8A 2K1BA 1G6ZA 2MGSA 2X6GA 1BXTA 2TMPA 2NVXB 3S1QB 4KN4C 4K5XA 2KCNA 1OXUA 4ABNA 2WV6D 1DJRD 4CGYB 2I07B 1X3QA 3BVZA 4CBVA 1LTTD 2F0MA 1EY4A 5I2YA 1IYUA 1PRTB 2PCFB 1BR9A 1U9RA 1Q1BA 1KLUD 1SNMA 4HMIA 1ILPA 4IZ8A 3NUCA 5I2XA 1AW7A 2WB1B 4C3IB 2F0GA 2FJ2A 1B1ZA 5K5PA 3I8ZA 1PRTF 4KJOA 3IL8A 3PUWA 4QMGA 1TKWB 2B2TA 1DCZA 1TIID 3OOCA 4C3HB 4RKLA 1KNEA 2NN6I 1HUNA 3EJIA 2B2WA 3QJYA 4KJNA 2EVBA 1S4ZA 3D6CA 1JOQA 2EYLA 2BE5C 2NUCA 3PIO3 2VUMB 4FF1A 2L4NA 1G91A 5ELBA 2A69D 5ISRA 1IYVA 2YYZA 2MHVA 3CQZB 2R92B 1KLGD 2K03A 1TWGB 1TQOA 1JC7A 4EQOA 3FMCA 2KEDA 3J7AF 1DYQA 2PNRC 1O78A 1X3PA 3TBIB 1G8ZD 3LX0A 3OHXC 2B2TC 2NWGA 2B2WC 3AU7A 3BDLA 1DZ1A 1JCKB 2EYFA 3SE0A 2CHBD 1I4PA 5J39A 1Q90A 1CA6A 4KKUA 3VYTA 3H3VC 3PUVA 1QILA 1ZEQX 2N55A 4PMBA 1MBYA 2IX0A 3U9SA 2IX3A 5JVH3 4AYBB 2Q8RE 4DN4M 1FNWA 3A8KE 3BZDB 3GQBA 2XWBB 2YU9B 3NTKA 3J81E 2EY6A 1C4QA 3C1FA 3C2PA 3L7ZC 4DF7A 1D1IA 4R9WA 3DXJC 1CHPD 3A7LA 3V05A 1BOSA 4IALA 4A3MB 3HOWB 4X3SA 2RQXA 3FRPB 3J80L 5IT9E 2WKDA 3R2IA 1S5DD 5TSSA 3IKJA 3DMUA 4ID6A 5C4ZA 2EYPA 3S14B 2J7ZA 1TWFB 5A2QL 1STEA 1Z7TA 3U9OA 1LTRD 1Q1EA 1ZXTA 1EL0A 4H7BA 3NTIA 1GUSA 1NCVA 3TZUA 3R93A 4FF2A 4BWGB 1V8QA 2F0FA 1K83B 3AMUA 3NHHA 2F03A 2JA8B 1HA5A 5FLXL 2F0IA 5EBCA 5I9OA 1NAPA 2B8GA 3D31A 3OSOA 1ESFA 2EPBA 3KF8A 3H91A 3JAME 4QIWB 4IUNA 4C1NK 3MHBA 4XDXA 5EBDA 2LMCB 3QO2A 4A3JB 2VB2X 1UNSA 4NW2A 5COYA 1SBBB 1SAPA 4I65A 2JEAI 1OXVA 5KNCA 4CJ1B 1V1PA 1M8AA 2G9HD 4M1UB 2KA7A 3FVQA 3H94A 1EQTA 4PMCA 1A2TA 3FEWX 4J8QA 2F0TA 5F2DA 2CQAA 1ESRA 1JWMD 1RTOA 1GOZA 1A2UA 1LTAD 4J1MA 4DAPA 3EA6A 4H13C 5M5XB 4A3GB 4OIJA 1RJTA 2CW0D 2LKVA 4DAYA 5CR3A 1SSOA 1B2TA 3KLRA 1HHVA 3AB9A 2AUKA 2PQEA 4HTHA 2A73B 2C5CA 5T1GA 4EGVA 2WP8J 4IN3A 1SXTA 4XQNA 1MSHA 4CHTB 4RGOS 1CT1D 4WFN3 4KN7C 1EFID 1EY7A 1NSNS 2EY5A 3NBHA 3VR3A 4A3DB 4LMQD 3I72A 3T4AC 1KNAA 2LFNA 2DN8A 1PMRA 2JE6I 3WOEA 1CTMA 1CHQD 3CU7A 2KEEA 1O7LA 1TS3A 2PZUA 3P75A 1XXGA 5C44B 3VA7A 3SK5A 5CC4A 3I4NB 3PMFA 4A3KB 2QF7A 2X6LA 3S1MB 1BBXC 1F9QA 3FPPA 4WORA 2A69C 4MIUA 1KDCA 2V4DA 1U4MA 1RKNA 5ELDA 4G57A 4A93B 2NVQB 2NB0A 1OXXK 2HCCA 1SE2A 1M4VA 4HEDA 5CV6A 4TKOB 2OF1A 1ENFA 4RCOA 3CRLC 5D3IB 2RKSA 3D4RA 1PTOD 5CV7A 1PZKD 1Z47A 2A6ED 4HSPA 2PMZB 4ZLTF 1AFPA 2EE1A 2KECA 1AZQA 1IKMA 1QJOA 1I4GA 4FNFA 3D4DA 4Y7NB 4TQUS 1S5BD 3VYUA 4RGTA 1TU2B 5ELEA 4FXGC 4G4KA 4OIKA 2A68D 1XYIA 1HTPA 4RAUC 1C8CA 5DNFA 2NVTB 4KD3A 1GXDC 3S1RB 1JR0D 1LT5D 1Y69U 3GTGB 3NE5B 4TRDA 4K2KA 2PZWA 2O5JC 4NDXA 2AWOA 3W3AA 4BS9A 4IFDH 5J22A 4A3EB 5T1IA 1H9JA 3GTKB 3Q0AA 2PPBC 3RZOB 4K2LA 2WKCA 2IPKD 3GO5A 3PUXA 5EQ0A 3RD4A 1SFOB 1BDOA 1DOKA 1GHJA 3QG1A 2IJ0A 3K5LA 2E2HB 5FKAC 3LNNA 2AQ3B 4KHZA 2J0TD 3GP7A 1MI2A 3S2DB 3K0YA 1HRJA 4ZAIA 5CV8A 2XNAC 1EY8A 2K01A 3N52A 2C9OA 2VB3X 3DWPA 1O7ZA 5EGTA 3G7LA 4BA1I 1EZ8A 3OMGA 1JOOA 5C5MA 2JYOA 1T5EA 5ELFA 4F8MA 4NP5A 2IWHA 1W6JA 1PFMA 3VR4A 1RF2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB3 X;  2VB2 X;  2L55 A;  1ZEQ X;  2QCP X;  3E6Z X;  3TDQ A; 
#chains in the Genus database with same CATH topology
 4DGZ A;  4R1J A;  1EOT A;  1FL0 A;  3E3X A;  3J81 L;  4ZKB B;  3CCE A;  5CBE E;  4F87 A;  1EEF D;  3KF8 B;  3S1N H;  4KHV A;  5GAD C;  3PO2 H;  4DV2 Q;  2K7V A;  1HTL D;  2NYZ D;  2B2U A;  5D14 A;  1VQ6 A;  3SHL A;  1PH3 A;  1K8A C;  3LWU A;  2R7Z B;  4ZRZ A;  1IW7 D;  1NMG A;  1SNP A;  2KCC A;  1B3Q A;  4O1N A;  5IT9 L;  5M5X H;  2RHS B;  2RBM A;  4EQP A;  2PZT A;  4LF5 L;  4A3B H;  2WAC A;  3HKZ G;  3TZD A;  5G3L D;  2DGY A;  1V1P B;  1VQL A;  1PFN A;  1J6Q A;  3RZD B;  1VQC A;  3OWE B;  1DM0 B;  2F3W A;  1TT2 A;  2A74 C;  4IOC A;  4C1N I;  3WDN A;  2OCE A;  1FNV A;  2CW0 C;  3DEO A;  4IFD G;  5IGB A;  1AEX A;  2WII B;  2ZTE A;  1EWC A;  2Z8L A;  1T9H A;  4DXG A;  4BBS H;  1EU4 A;  1Y1W B;  1CM9 A;  3FKI G;  5LHY 1;  1WCM B;  3HOY B;  4AQY Q;  4UP9 A;  1IBK Q;  1MD2 D;  1V1Q A;  1YEZ A;  4DAY B;  1MSG A;  1EIH A;  1I3Q B;  3QIA A;  4NMZ A;  4HJ7 A;  2ZXP A;  3HOV B;  3HZX A;  1IHZ A;  2B2U C;  4MTN A;  2B63 H;  5D3D A;  2JA5 H;  1KTK A;  5IP7 G;  3OMC A;  3TP8 A;  4QGU A;  2F0E A;  1DD2 A;  3AEV A;  3PF5 A;  2K28 A;  3JAM L;  2Q8I B;  3T53 B;  3V2T A;  1II3 A;  1KDA A;  3NBH B;  1VQ7 A;  1HNW Q;  4OWT B;  1PZI D;  4R4O A;  1EY5 A;  3ND9 A;  1C9O A;  3KJP A;  1WTO A;  1S72 A;  2EYH A;  1V1O A;  5CV5 A;  4LAA A;  2D2C C;  3KBX A;  2O2L D;  1FR3 A;  1PH4 A;  3RLO A;  1G6P A;  4IUV A;  4DA2 A;  5HY6 A;  4CJ0 B;  1YNJ D;  5KYL A;  4QF4 A;  1OXT A;  2HUG A;  1KC8 C;  4JBM A;  1CQV A;  3X3M A;  4HMJ A;  2EYJ A;  4FXK C;  3QR8 A;  4IUT A;  3TS2 A;  5M9O A;  2SNS A;  1EY9 A;  2RDG A;  3BYY B;  1O80 A;  2D62 A;  3MC0 B;  1JE5 A;  4ZUJ A;  4IFD J;  1E1T A;  5IGE A;  1D2B A;  1XWE A;  1HZB A;  2NZH A;  4DK0 A;  1OO9 B;  1F9R A;  1WYD A;  3PO2 G;  2ZM6 Q;  3CKI B;  3C46 A;  3G48 A;  4WJW A;  3HOU H;  2RDF A;  3FHW A;  3NK9 A;  3RUZ A;  5C3W A;  2SOB A;  4BA2 I;  1U0L A;  3ITP A;  2EYO A;  3ERQ A;  2K33 A;  1WD1 A;  2OXP A;  1LV9 A;  2KJX A;  1D6E C;  4DXF A;  1JIC A;  4A3B G;  4YY3 L;  4G7O C;  2TSS A;  3CC2 A;  1X65 A;  4ZKC B;  4L63 B;  4CDF C;  1GHK A;  3I70 A;  2IX1 A;  4ME3 A;  2ICE C;  4RKB A;  5K36 H;  1TY0 A;  1SYD A;  4DV1 L;  5E4X A;  1K8O A;  4PNY A;  3J81 c;  1EIF A;  1SE3 A;  5C4X G;  3ZYY X;  5M5Y B;  4KY5 A;  1S3O A;  1WTX A;  1PTO C;  2E2I B;  4DR6 L;  1E22 A;  1F9P A;  1KXL A;  1PDQ A;  2Z4I A;  1AZP A;  2RVL A;  2A6E C;  2HDL A;  1YHQ A;  4BBS G;  1R9T H;  1SMY D;  5KIX A;  4DR2 L;  1I6H B;  2F0V A;  4Q0F A;  2Q2T A;  1K8M A;  5IT9 c;  4CJ2 C;  4B3R Q;  1PTO H;  3FKI B;  5FJ8 G;  4DV0 Q;  2WIN B;  3E0J A;  4AIM A;  1S40 A;  1XMQ Q;  2E2J B;  2B63 G;  1BUV T;  1Y1V G;  2IW3 A;  2JA5 G;  1AN8 A;  1QZG A;  2NVT H;  1GM5 A;  2RCF A;  1DOL A;  2KQ3 A;  2QW7 A;  4N8F A;  4B3S Q;  1U5K A;  4CDC C;  5LMU L;  3L9A X;  2F0J A;  3K5N A;  3CCQ A;  2A68 C;  1G29 1;  2FMM A;  4KHP L;  2JQO A;  3KOJ A;  5COR A;  2DNE A;  4DUZ Q;  2IHF A;  1LAB A;  1B9M A;  1GO3 E;  3NBI A;  2PO4 A;  3O13 A;  4DV4 L;  2ZJQ A;  1HR0 Q;  3TQY A;  2K5V A;  3BZC A;  1C7Y A;  1K3R A;  2XVS A;  1B50 A;  4HIM A;  3CPW A;  4IFD I;  3EVQ A;  3IRB A;  4NXN L;  3T1H Q;  4DR5 L;  1KRT A;  5KNB A;  1JWU D;  1R4Q B;  1W6K A;  4ZQ3 A;  2F0Q A;  5IGC A;  5C4J B;  3RLF A;  1PFB A;  3HG9 A;  2NTT A;  3SGI A;  1I4H A;  1L0Y B;  2HCI A;  5E4W C;  3MXG A;  2F0O A;  2JA9 A;  1STY A;  2AMC B;  5EAY A;  5M3F H;  2KHS A;  1SNC A;  3EFX D;  5GAG C;  1UAP A;  3JAM c;  4GNX A;  3P1H A;  3CC7 A;  4RCN A;  5EKL A;  1ENA A;  4H0L C;  4LF9 Q;  1I94 Q;  4DNR B;  2E74 C;  3D3R A;  4CKB A;  5J3B A;  4JC0 A;  2VQE L;  1X32 A;  3I7F A;  3D4W A;  1PYS B;  3R8B A;  4IQZ A;  3S2D H;  4X3U A;  3K6O A;  3HOU G;  3S1N B;  4RH6 A;  2KOL A;  3PO2 B;  3BVM A;  1QUQ B;  3I3C A;  1Q8I A;  3X3N A;  3GTP B;  4LFA Q;  1F2Y A;  3D6W A;  1SNQ A;  2Z4H A;  4UHV A;  4DK3 C;  4GLX A;  1QNK A;  4LW1 A;  5D65 A;  5IYD H;  1RD9 D;  1HUM A;  3OYY A;  4DV2 L;  3HFZ B;  2UXD Q;  3KDF B;  2GVA A;  4POG A;  1Q82 C;  1HH2 P;  2R3Z A;  4A3B B;  5K36 G;  1YVC A;  2OQ0 A;  4KY7 A;  1UE1 A;  4X65 Q;  3HKS A;  5JOB A;  1X55 A;  3PIP 3;  1X56 A;  2F0K A;  3A8J E;  4QUC A;  3EN2 A;  1LUZ A;  3GTM B;  2G9D A;  2OTJ A;  5FLM H;  3H0G H;  5JEA H;  2Q2I A;  2HDM A;  4R4T A;  4OWW B;  4UY8 C;  4JI7 Q;  3A7A B;  1ET6 A;  4GNX C;  2K04 A;  2KHI A;  4P75 A;  4OO1 G;  5C4X B;  1E2Z A;  2OTL A;  2EJG C;  5HUR A;  1K8G A;  2EY1 A;  2ID0 A;  5DAU A;  1SYF A;  2EYM A;  4BBS B;  1A62 A;  1ZYR D;  4ZYS A;  1VMC A;  1BQQ T;  1UEA B;  2R93 H;  3IFD A;  2HQE A;  2QDB A;  1SRU A;  3DEP A;  4K14 A;  3TRZ A;  2K4K A;  3PUZ A;  2B63 B;  2B2Y A;  4XYO A;  4AQY L;  1YJN A;  1IBK L;  2UU9 L;  2JA5 B;  2BA0 A;  2JA7 G;  1IW7 C;  3I73 A;  4DK1 A;  5DM6 3;  1EWH A;  2WAQ G;  3H6M A;  2F0N A;  4MTK A;  2E2D C;  1FNU A;  3SR1 A;  1PV4 A;  3M7N A;  1Q46 A;  1E0B A;  3SEB A;  4I7Z C;  4K0K Q;  1CA5 A;  1D5M C;  3J80 E;  1DGS A;  4GOP A;  1A15 A;  4JBJ A;  2MP1 A;  1E2V A;  1GJX A;  2F0P A;  1CK1 A;  2NZ1 D;  4A75 A;  3N6R A;  3NPP A;  1SNO A;  3TN2 A;  5CMD A;  3RN5 A;  2IY5 B;  2Z6K A;  1CUK A;  4WJ3 M;  2L9H A;  5E3F A;  1HNW L;  1S5C D;  3E9H A;  4V0B A;  1WTQ A;  1LTI D;  4U67 3;  1VF5 C;  4FYD A;  1TY2 A;  5JJK A;  2RSO A;  1EEI D;  5M3F G;  1H9K A;  4K6D A;  1KAW A;  3GD7 A;  3L0O A;  5M5W B;  1STG A;  2DJG C;  4WRD A;  1LLR D;  4JBK A;  3F8T A;  3CF5 A;  4B9W A;  4BY7 H;  1GUG A;  1UUP A;  5KGU A;  1W3S A;  2B2Y C;  4NB3 A;  3T1Y L;  1GUO A;  1UE7 A;  2HIX A;  4DAV A;  1NJI C;  3KBG A;  5FO9 B;  4GZY C;  4X6A H;  2L5T A;  3T51 B;  1XTC D;  1DON A;  4ODG A;  2M9V A;  4FXD A;  3HOU B;  1ENC A;  3J7A V;  4TSS A;  1VQ5 A;  1HNX Q;  1HZ9 A;  4LJZ C;  2JXM B;  2XRS D;  2UXC Q;  4C3J H;  4GOP C;  2ZM6 L;  3S9W A;  2K6A A;  2JA6 G;  3WOF A;  2E75 C;  2DNC A;  2EOT A;  2X69 A;  2Z6K C;  2GVB A;  4QB4 A;  2VY3 A;  2RF4 A;  4X3K A;  1B4O A;  1STA A;  2IT1 A;  2CWP A;  1XNQ Q;  1YNJ C;  3HKZ E;  1J9O A;  4YWM A;  3MEF A;  5FLM G;  2F0S A;  3H0G G;  3E9I A;  5JEA G;  1B9N A;  1SND A;  3MZ5 A;  2UUA L;  1LTL A;  1X6O A;  1P16 A;  5E7N A;  1I4Q A;  2NTS A;  1YNN D;  4KY6 A;  2F1M A;  1F2Z A;  3MFY A;  1Q7Y C;  1TWA H;  1R9T B;  4KD4 A;  4A3I H;  2H1E A;  2RDH A;  1JJG A;  2R93 G;  1KD1 C;  4XTC S;  1BCP D;  1RCV D;  3F2U A;  1SMX A;  3CPF A;  1PTO B;  1IKL A;  3NQI A;  2L55 A;  2L12 A;  5GQO A;  2R61 A;  4GN3 B;  3P20 A;  1TS2 A;  4NKL A;  2OT2 A;  4LNQ A;  3HOX H;  1X3E A;  1QNU A;  3W1G A;  1NR4 A;  4B3R L;  4RG1 A;  3D8G A;  4DV0 L;  3RLN A;  3KLS A;  5J1Z A;  1J5E L;  4A3F H;  4IO9 A;  5C6A A;  1YIT A;  1XMQ L;  5IIF A;  3UDF A;  2JA7 B;  2AQ1 B;  3Q8D A;  4R8I A;  2F3I A;  2E5L Q;  2WAQ B;  5KYI A;  5KEE A;  2KCT A;  1U4P A;  4XQQ A;  4ILW A;  4X66 Q;  2E2I H;  1Y8O B;  4B3S L;  1I4X A;  2YTX A;  1BCP B;  1S5F D;  3LWE A;  3VR5 A;  5BR8 Q;  1LTG D;  4I7A A;  3MXN A;  4DUZ L;  1MJC A;  1SJH D;  5AFW A;  3U4Z A;  1QOH A;  4V19 0;  3AYH B;  1F77 A;  1ICW A;  1UEB A;  3URY A;  2MJ8 A;  3IFT A;  1HR0 L;  1WD0 A;  1SMY C;  4LFC Q;  1ASZ A;  2K75 A;  1BKB A;  3I91 A;  5EPJ A;  3T1H L;  3G6J B;  2R7F A;  3TSS A;  5JEA J;  5M3F B;  2K5N A;  1U4L A;  3MTS A;  3NQT A;  1M90 C;  4OL7 A;  2K32 A;  3M85 A;  4BY7 G;  1TS4 A;  3PGZ A;  1HFN A;  4ME5 A;  5JJI A;  2FHT A;  2CWA A;  4RA8 A;  3HOZ H;  2LXJ A;  4APV A;  2ES2 A;  3KLS X;  1FGB D;  2KHJ A;  3P7J A;  5GAH C;  1VQ8 A;  3CRK C;  2XN9 C;  2L11 A;  1B3A A;  1ONL A;  5EPK A;  4NXM Q;  4LF9 L;  1I94 L;  3BYT B;  2HT1 A;  2XSC A;  1BO0 A;  3BZK A;  1E3P A;  2K50 A;  3PUY A;  2Q8T A;  4C3J G;  3K59 A;  4GS3 A;  2R92 G;  5CBA E;  2A6H D;  3PO3 G;  3KYH C;  1G51 A;  1K0R A;  3T13 A;  5LMN Q;  5ELN A;  4TVA B;  2B3G A;  3GDE A;  5GRO A;  3VYR A;  2MO0 A;  2JA6 B;  2OWO A;  2BA1 A;  4LFA L;  1EYD A;  1PRT D;  4O42 A;  3SK6 A;  1N33 Q;  1QG7 A;  5BN3 A;  3VR2 A;  2UXD L;  2HHH Q;  4DU9 A;  3H0G B;  1IBM Q;  4MZ9 A;  1L0W A;  1JJC B;  1NTG A;  4F7X A;  1FYC A;  4A3I G;  2ZTC A;  3I55 A;  3QWN A;  4K5W A;  3GTP H;  4KKT A;  4FP5 D;  1H9R A;  3QOJ A;  1STB A;  4GNX B;  3FDT A;  3OIQ A;  1EIG A;  2R93 B;  1DOM A;  3HS0 C;  4JI6 Q;  3MVV A;  1TVX A;  4YWL A;  2AUJ D;  1EQV A;  3HOX G;  1YI2 A;  3C1E A;  4OHJ A;  1LTB D;  1XNR Q;  3DWQ A;  4O2D A;  1T5X D;  2N3S A;  4QJF A;  4A3F G;  3CD6 A;  1CZG A;  1I6V C;  1XJV A;  3PV0 A;  2XWJ B;  3GTM H;  4K5V A;  2F0H A;  3Q6S A;  3S17 H;  3VA5 A;  3CCU A;  5C4X H;  3CCL A;  2ZXO A;  2EY2 A;  4FVM A;  4JK1 C;  2XTI A;  4Q5V A;  3M3Y H;  1EYA A;  3E5S A;  3LGJ A;  3K5O A;  5IGG A;  1VQB A;  1STN A;  1ML0 D;  4K0K L;  5A35 A;  4IUQ A;  5FJ8 H;  3MXU A;  2I46 A;  2Z1C A;  2J4X A;  4DV3 Q;  3M4Q A;  2F0U A;  2F3V A;  1Y1V H;  2Y0S E;  4FO2 A;  2ZJP A;  1ZYR C;  4R4Q A;  2E76 C;  2OQK A;  1C48 A;  5EPL A;  3J7Y W;  1L2F A;  1LM0 A;  4R4I A;  1QWY A;  3ERO A;  1JQY D;  5DEH A;  1B44 D;  2FMC A;  2EXD A;  2PYK A;  3HOZ G;  1QVC A;  3CCV A;  4BY7 B;  1L0X B;  2F0W A;  2O5I C;  2XIW A;  5KND A;  1NMF A;  4Y52 H;  2SNM A;  5JJL A;  4M8A A;  2L0C A;  4JW0 A;  4DFA A;  1W2B A;  1KAB A;  1HNZ Q;  3KUP A;  1SDF A;  3K80 C;  4DR4 L;  2VNU D;  5DM7 3;  2RSN A;  5G3L F;  3OTO Q;  2NZO A;  4DPG A;  2QEX A;  3A74 A;  2AWN A;  1TS5 A;  2I5L X;  3I90 A;  4C3J B;  2EZV A;  5JPM C;  4XIG S;  1A3U A;  4G7Z C;  5AJ3 Q;  1PH6 A;  1JOK A;  4L5Q A;  2M2L A;  1SE4 A;  3PO3 B;  2I5H A;  4XXE A;  5FO7 B;  5LL6 X;  5M5W H;  2ATW A;  1HNX L;  3HRZ C;  3GTQ H;  3K57 A;  3M4O H;  1OXS C;  4CKE A;  1GKH A;  2JP1 A;  3L3O C;  4GOP B;  3CCS A;  2QGQ A;  1VMP A;  3PIO A;  1VQ4 A;  4P74 A;  1N9W A;  2SEB D;  2R6G A;  1G2T A;  3NWS A;  2AQ2 B;  2NVY H;  2ZXR A;  4MHE A;  1RTN A;  4DV6 Q;  3UI2 A;  2D9U A;  3M4Y A;  3GV6 A;  4PQX A;  4CKC A;  1QVG A;  2KCM A;  3DM3 A;  1XNQ L;  4DNT B;  2G5D A;  2D0P A;  2CCZ A;  1TWA B;  3ICE A;  2QCP X;  4YHH Q;  2EJF C;  3S2H H;  2N88 A;  4E6I A;  4A3I B;  3DUZ A;  5C0X H;  4QCL A;  5IWA Q;  1NR2 A;  1GD7 A;  2VQF Q;  1D7Q A;  1RHP A;  2PW7 A;  3DM1 A;  1CKN A;  1SEB D;  4PZ8 A;  3PF4 A;  2F4I A;  1L1O A;  2OEO A;  3M7G A;  4HAE A;  3SK8 A;  3HOX B;  4IPD A;  3HKZ B;  5C3E H;  4B3M L;  1I50 B;  1N32 Q;  2CH4 W;  3V96 A;  4L5R C;  2BCO A;  4A3F B;  4EQN A;  1BF4 A;  3GTL B;  1VQO A;  3QB3 A;  3VYS A;  2NBF A;  5CV9 A;  2WAQ E;  1A6X A;  1B7Y B;  4DUY L;  2L15 A;  3GTJ H;  3TEH B;  1H9S A;  3NXW A;  3W2D A;  1QB5 D;  3UDG A;  2LY7 A;  4OO1 H;  1AP0 A;  4JI1 Q;  4JI0 Q;  3A8I E;  2E5L L;  2I0Q A;  1TXY A;  1VDZ A;  1K28 A;  2FFK B;  1YJW A;  3TP6 A;  4HCE A;  1WI5 A;  4FF3 A;  3RR5 A;  4X66 L;  1BNZ A;  3A54 A;  5IOD A;  4DV5 Q;  1H9M A;  1CKM A;  2MPM A;  1CSP A;  1YNN C;  2Q2H A;  4UAI A;  4ZUI A;  3BVG A;  5BR8 L;  3S16 H;  1HPC A;  1OTC A;  3T56 B;  4LUZ A;  3KLW A;  3BJU A;  1N34 Q;  2QKI C;  4JI4 Q;  3J80 i;  4JCV E;  4A76 A;  1BCP C;  4PV1 C;  2VS1 A;  2B39 A;  2JA7 H;  1XX8 A;  4XT3 B;  3I4M H;  4LFC L;  2UUC Q;  1NUC A;  1L1O C;  1Y8N B;  1B53 A;  1U4R A;  2V1C C;  4J6H A;  1HCZ A;  4BBR H;  5EKI A;  3HOZ B;  5ELO A;  3ONA B;  4MN3 A;  1SYC A;  1RDP D;  4IUP A;  1QE6 A;  3HGB A;  1LTS D;  4QY7 A;  5C3X A;  1MIU A;  4RWS C;  1PH7 A;  1JB7 A;  3MXP A;  2K5H A;  3H09 A;  1QCB D;  4N9T A;  5M3M G;  2Y0S G;  4HIK A;  3GV3 A;  2GA4 B;  4KI0 A;  3CXC A;  4NXM L;  1WTW A;  1K9M C;  2EXZ A;  1ILQ A;  4B08 A;  1Z6H A;  3OW7 A;  1JE4 A;  4RGN A;  3R2T A;  5H1S E;  4QUF A;  5HGQ A;  2ALY B;  1VCI A;  1HQR D;  1EFW A;  4RHS A;  3QOL A;  5LMN L;  2A5H A;  1KDB A;  2M00 A;  5JAV A;  3MXN B;  1LT4 D;  4PG3 A;  1EZ6 A;  1SE8 A;  1KL9 A;  1D5X C;  5JVG 3;  5C4H A;  1SYG A;  1N33 L;  3Q22 A;  3VR6 A;  1SJE D;  3AFQ A;  4X3T A;  5C0X G;  1WFQ A;  2IL8 A;  1TWC H;  2HIV A;  3SVM A;  1IBM L;  4HCS A;  1Y14 B;  3EQL C;  3OWF A;  1XPU A;  1ROD A;  3TP7 A;  1Y8P B;  3PCO B;  3MWY W;  2PW5 A;  2JA6 H;  1A63 A;  1HZA A;  4A93 G;  3K7A H;  3I4L A;  4GN4 B;  5C3E G;  1VQI A;  3NSW A;  4RGM A;  4OON A;  2A6H C;  3Q23 A;  5ELC A;  1HQM C;  1KRS A;  1ET9 A;  3M4P A;  4P71 A;  4X64 Q;  4IUU A;  1KQS A;  4JI6 L;  4BY1 G;  4OEL B;  1VF7 A;  1VQA A;  2JEB I;  3S17 B;  2A1A A;  1A8V A;  1VQ9 A;  4OX9 Q;  2IHE A;  4C56 C;  2WB1 E;  2NVX H;  3AFP A;  4IPC A;  2ENB A;  3TDQ A;  4JYA Q;  5I6Y A;  1PRT C;  3M3Y B;  4R4C A;  2LS0 1;  3E6Z X;  2O4X A;  3MA2 B;  5CYU A;  5JPN C;  1EY0 A;  2NN6 H;  1YZ6 A;  1E2W A;  1J8I A;  5IOC A;  4LF7 Q;  2H4O A;  2K05 A;  4XQJ A;  1JMC A;  2BE5 D;  4K8I A;  2BDO A;  5L37 A;  1Y1V B;  2EJM A;  4LK1 C;  1VQM A;  3S15 B;  4XT1 B;  1CFM A;  4YCW A;  3I4M G;  4GLA C;  4JI2 Q;  2QDL A;  1GUN A;  3CHB D;  4DV3 L;  1FD7 D;  1NNX A;  4BBR G;  5IGF A;  1WOC A;  4C3I H;  3TME A;  2WFW A;  3U58 A;  1A0I A;  5C0X J;  2K5D A;  4ZK9 B;  1EY6 A;  3RMH A;  4QL5 A;  4EVO A;  3FPU B;  1F9S A;  3HP3 A;  4LF4 Q;  5A2Q E;  3PIP A;  1QVF A;  1PLF A;  3J80 c;  1SR3 A;  1SYB A;  4XYQ A;  1HNZ L;  3U50 C;  5M3M B;  4YIJ A;  2Y0S B;  1IL2 A;  1YHB A;  4KV6 A;  4JBW A;  1HR0 W;  3NTH A;  4LFB Q;  3OTO L;  3G6E A;  5I6W A;  2JK8 A;  5C5L A;  3G4S A;  2B2V A;  5CGK A;  4PMW A;  3GTQ B;  3A5U A;  3CW2 C;  3NP8 A;  1HXY D;  2FIN B;  3R3O A;  4L8J A;  2KUM A;  4KLK A;  3M4O B;  5AJ3 L;  5EJW A;  2BH2 A;  1LT3 D;  4YCV A;  4G7H C;  2VUM H;  4B9X A;  1IL8 A;  1PYW D;  3FP9 A;  2EDG A;  3NEM A;  2UXB Q;  2NVY B;  5FO8 B;  4K6L A;  2XRQ D;  3C3L A;  2XGT A;  1CI3 M;  5I4D A;  4DR3 Q;  4KMU C;  5FLX E;  3CME A;  5FK9 C;  4JI5 Q;  1PXU A;  1Q3L A;  3TP5 A;  4KTA A;  5NUC A;  1K3B C;  1WVL A;  4LF8 Q;  5IYB G;  3S2H B;  1Q12 A;  3E0E A;  1JB3 A;  3CQZ H;  3BS1 A;  1GUW A;  4H44 C;  4IUR A;  4N9P A;  1CZW A;  4DV6 L;  1WTR A;  2R92 H;  5E1F A;  1TWG H;  3PO3 H;  5FLX c;  4YHH L;  5BN5 A;  4FF4 A;  4HJA A;  4RFB A;  4PZ6 A;  2VL6 A;  5IWA L;  2ICI A;  2VQF L;  1Q81 C;  4AYB E;  2EIF A;  5C3E B;  5FOB B;  1A3V A;  1F2L A;  2DY8 A;  3MAQ A;  1LAC A;  2B2V C;  5I9P A;  2KVM A;  4BY1 B;  1HA6 A;  5EKK A;  3I4O A;  1CQF A;  1N32 L;  4KKS A;  4A4I A;  3GTJ B;  3K7U C;  5KRU A;  3W5O A;  3GTO B;  4A3C H;  1UWV A;  4HSV A;  5LL6 S;  1YJ9 A;  4ULL A;  1LT6 D;  4Z9C B;  4S3S A;  4HN7 A;  1G2S A;  1WTH A;  2CFM A;  5BN4 A;  1SYE A;  4J15 A;  4A3L H;  3DHQ A;  2NN6 G;  1F2M A;  3K5M A;  4L6T B;  4C2M B;  4JI1 L;  4JI0 L;  3OPO A;  1CKO A;  5IYC H;  3SDZ A;  1V43 A;  5C0X I;  3IAY A;  3S16 B;  2QEJ C;  3J7A 5;  2K52 A;  3SXH A;  2F0D A;  4P2C B;  1TR5 A;  4K8J A;  4DV5 L;  1I50 H;  2JSO A;  4PZ7 A;  1EU3 A;  4KK7 A;  2CVR A;  1N8R C;  1E24 A;  2E8G A;  3GTL H;  2L1B A;  1GUT A;  4DR1 Q;  2WB1 G;  2SDF A;  2YU9 H;  4R8N A;  3DWA A;  4C3I G;  1QZH A;  3I4M B;  1N34 L;  3MFG A;  2H5X A;  2UUB Q;  1O7Y A;  5IGD A;  2BOS A;  4BBR B;  4U68 A;  3K58 A;  1N36 Q;  2DY7 A;  1PTO F;  3NWT A;  1CKN B;  3F2B A;  3OIP A;  4POF A;  1L1O B;  4QQB X;  1YHA A;  4A3M H;  4OO1 I;  2B8F A;  1FJG Q;  2BDN A;  5HGT A;  3HOW H;  1I4R A;  2K5W A;  4DR2 Q;  2BH8 A;  4C3H G;  1R4P B;  3HEJ A;  1S5E D;  1JOR A;  5IY0 A;  1DXM A;  3BG3 A;  2F0L A;  1HFG A;  3S14 H;  1TWF H;  2K5Q A;  1C0A A;  3A55 A;  2MNA A;  1VQJ A;  3KJO A;  1PZJ D;  4F88 A;  1H9S B;  3BDO A;  3Q24 A;  1EYC A;  2VUM G;  1BCP F;  3K81 C;  3MEH A;  2I5M X;  1D1K A;  3SK4 A;  1WTP A;  2D5D A;  4OGQ C;  1WTV A;  1LO5 D;  2VZA A;  4JV5 Q;  1JWS D;  4QIW E;  5CV4 A;  4OWX B;  1PH2 A;  2RA4 A;  3A56 A;  3KK7 A;  1STH A;  4ZCK A;  1IXR A;  1I5F A;  3STB C;  4LUV A;  1ZKO A;  1A3T A;  3AQQ A;  4JVZ A;  2C35 B;  2VXW A;  1TWH B;  1TWC B;  3T16 A;  2ZT9 C;  1UE5 A;  1D8L A;  4CDE C;  3BDC A;  1EOV A;  1K83 H;  5JJZ A;  4DV7 Q;  4HR7 B;  2N8N A;  2JA8 H;  1X3G A;  4DR7 Q;  4GKJ Q;  2MUY A;  2QIL A;  3K7A B;  1MGS A;  1PVO A;  1EYG A;  1KAA A;  4RHR A;  4LF6 Q;  4UDU C;  1H95 A;  1D5Z C;  3ND8 A;  2K1B A;  1G6Z A;  2MGS A;  1ICF B;  3ZJY C;  5IP9 H;  2X6G A;  4GLV B;  1BXT A;  2TMP A;  4A3C G;  4X65 L;  4X64 L;  2NVX B;  3S1Q B;  2VQE Q;  1PH5 A;  3ERS X;  4KN4 C;  4K5X A;  2KCN A;  1OXU A;  4HJ5 A;  4ABN A;  2WV6 D;  4A3L G;  1DJR D;  4GN5 A;  4CGY B;  2B29 A;  2I07 B;  1X3Q A;  3BVZ A;  4CBV A;  4JI7 L;  1LTT D;  4OX9 L;  2F0M A;  3ER0 A;  5IYC G;  4JYA L;  1EY4 A;  5I2Y A;  1IYU A;  1PRT B;  4AYB G;  2PCF B;  3F2C A;  1BR9 A;  1VQN A;  1U9R A;  1PH8 A;  3J81 i;  1CSQ A;  3PSI A;  4HID A;  1Q1B A;  1B70 B;  1KLU D;  4LF7 L;  1SNM A;  4HMI A;  1ILP A;  4IZ8 A;  2A19 A;  3NUC A;  5I2X A;  1AW7 A;  2WB1 B;  4C3I B;  2F0G A;  4A3G H;  2FJ2 A;  2YTV A;  4X62 Q;  1B1Z A;  5K5P A;  4JI2 L;  3W1B A;  3I8Z A;  2AHO B;  4A3M G;  3HOW G;  1PRT F;  1P8L A;  4JI3 Q;  3KF6 A;  3CMA A;  4KJO A;  2JN4 A;  1BBU A;  3IL8 A;  2HD3 A;  3PUW A;  4QMG A;  1TKW B;  2B2T A;  1DCZ A;  1TII D;  3OOC A;  4C3H B;  4LF4 L;  4RKL A;  1KNE A;  2NN6 I;  2ZJR A;  3RN2 A;  1HUN A;  3EJI A;  2B2W A;  3S15 H;  3I2Z A;  3EBE A;  3QJY A;  4KJN A;  3H15 A;  2EVB A;  1S4Z A;  2P5Z X;  3D6C A;  4LFB L;  1JOQ A;  4A3D H;  2UU9 Q;  3K0X A;  2EYL A;  2BE5 C;  2NUC A;  2QA4 A;  3PIO 3;  2VUM B;  4FF1 A;  3TS0 A;  2L4N A;  1G91 A;  4IJH A;  3ULL A;  5ELB A;  4IPG A;  2A69 D;  5ISR A;  3JC6 6;  2DJF C;  1IYV A;  2KEN A;  2YYZ A;  1MKH A;  1GVP A;  4GKK Q;  2UXB L;  1PH1 A;  2MHV A;  4P73 A;  3CQZ B;  5M3M H;  2F52 A;  2R92 B;  1KLG D;  2K03 A;  1JJ2 A;  2JA8 G;  4DR3 L;  1KHI A;  1TWG B;  1TQO A;  4JI5 L;  3JAM i;  2HQL A;  4LF8 L;  1JC7 A;  4EQO A;  3FMC A;  3D0F A;  1K73 C;  2KED A;  3J7A F;  1DYQ A;  2UXC L;  2RHQ B;  3BU2 A;  2PNR C;  4EQ5 A;  5C44 H;  1O78 A;  1X3P A;  3TBI B;  3CCM A;  3NEN A;  1G8Z D;  3LX0 A;  3OHX C;  2B2T C;  3I4N H;  5LMN W;  2NWG A;  5IP9 G;  4ALP A;  2B2W C;  3AU7 A;  4A3K H;  1VQH A;  1VQE A;  3BDL A;  4A3J G;  1DZ1 A;  3T1Y Q;  1JCK B;  2EYF A;  2F4V Q;  3SE0 A;  3S1M H;  2CHB D;  1I4P A;  5J39 A;  4JPB W;  1Q90 A;  1CA6 A;  4KKU A;  3VYT A;  3H3V C;  3PUV A;  4JG2 A;  1QIL A;  1ZEQ X;  2N55 A;  3I56 A;  4PMB A;  2PMZ E;  1MBY A;  2JJQ A;  2IX0 A;  3U9S A;  2IX3 A;  5JVH 3;  4AYB B;  2NVQ H;  2Q8R E;  4A93 H;  1M1K C;  4DN4 M;  1FNW A;  3A8K E;  3BZD B;  3H3V H;  2PQA A;  3GQB A;  4BY1 H;  2XWB B;  1FGU A;  2K14 A;  2YU9 B;  1XTD A;  4HIO A;  4A3G G;  3NTK A;  3J81 E;  2EY6 A;  1C4Q A;  3C1F A;  3GTO H;  3C2P A;  2GN5 A;  2UUA Q;  3L7Z C;  4DF7 A;  4DR1 L;  1D1I A;  2FXQ A;  3CP0 A;  3DXJ C;  4R9W A;  1YNX A;  1CHP D;  3A7L A;  3V05 A;  1BOS A;  4IAL A;  2UUB L;  4A3M B;  3UDX A;  4C2M H;  1X54 A;  3HOW B;  4X3S A;  1N36 L;  2RQX A;  3FRP B;  3K8A A;  3J80 L;  5IT9 E;  2WKD A;  3CCR A;  3R2I A;  1S5D D;  4H02 A;  5TSS A;  3IKJ A;  3DMU A;  4ID6 A;  4JI8 Q;  1HZC A;  4Y7N H;  1E7Z A;  1FJG L;  5C4Z A;  2EYP A;  3S14 B;  2J7Z A;  1TWF B;  1Q8K A;  5A2Q L;  1STE A;  1MJE A;  1Z7T A;  1AH9 A;  4A3D G;  5GAE C;  3STB D;  3U9O A;  1LYL A;  2N78 A;  1J5E Q;  4JOI A;  1LTR D;  1XPR A;  1Q1E A;  1RL2 A;  1XMO Q;  1ZXT A;  2D0O A;  1EL0 A;  4H7B A;  3S1R H;  3NTI A;  1GUS A;  4RMF A;  1NCV A;  3GTG H;  3UE1 A;  3TZU A;  3R93 A;  1Z9F A;  1IBL Q;  4FF2 A;  4JV5 L;  4BWG B;  1V8Q A;  2F0F A;  4YWK A;  2YV5 A;  1K83 B;  4YCU A;  3AMU A;  3NHH A;  2F03 A;  4A3E H;  2JA8 B;  1HA5 A;  1PYB A;  5FLX L;  5C44 G;  2F0I A;  5EBC A;  5I9O A;  1NAP A;  2B8G A;  3D31 A;  3GTK H;  3OSO A;  3I4N G;  1ESF A;  2EPB A;  1AE2 A;  4LUO A;  4DV7 L;  4B3T Q;  3RZO H;  3KF8 A;  3H91 A;  4DR7 L;  2KBN A;  3JAM E;  4QIW B;  4IUN A;  4GKJ L;  2ASB A;  4A3K G;  4C1N K;  3MHB A;  1SFO H;  4XDX A;  5EBD A;  2LMC B;  3QO2 A;  2E2H H;  4LF6 L;  4A3J B;  2VB2 X;  1UNS A;  4JOI C;  4NW2 A;  2HHH L;  1NBW A;  1TWH H;  4O0A A;  4IOA A;  5COY A;  5IYB H;  1SBB B;  1SAP A;  4I65 A;  2JEA I;  1OXV A;  3EIV A;  1IZ6 A;  5KNC A;  4CJ1 B;  1FVI A;  1V1P A;  2N49 A;  1M8A A;  2G9H D;  4M1U B;  2KA7 A;  3FVQ A;  3H94 A;  1EQT A;  4PMC A;  1ASY A;  1EQR A;  1A2T A;  1BBW A;  3FEW X;  4J8Q A;  2A8V A;  2F0T A;  5F2D A;  2CQA A;  1ESR A;  1JWM D;  1RTO A;  1XNR L;  1GOZ A;  1A2U A;  2Z9H A;  1LTA D;  4J1M A;  4DAP A;  3EA6 A;  1BVS A;  4AH6 A;  4H13 C;  5M5X B;  1K0S A;  3S1Q H;  4A3G B;  4OIJ A;  1RJT A;  2CW0 D;  2LKV A;  4DAY A;  4MNO A;  1NY4 A;  5CR3 A;  1SSO A;  1B2T A;  3KLR A;  1HHV A;  4X62 L;  4OXP A;  3AB9 A;  2AUK A;  2PQE A;  4HTH A;  2A73 B;  3ULP A;  2C5C A;  5T1G A;  4EGV A;  2WP8 J;  4IN3 A;  1SXT A;  4XQN A;  1MSH A;  4JI3 L;  4CHT B;  3L2P A;  3F2D A;  4RGO S;  2R7Z H;  4LF5 Q;  1CT1 D;  4WFN 3;  4KN7 C;  1EFI D;  1X3F A;  1EY7 A;  1NSN S;  2EY5 A;  3NBH A;  2ZTD A;  3VR3 A;  4A3D B;  1XPO A;  4LMQ D;  2LXK A;  3I72 A;  3UDI A;  1JT8 A;  4LWC A;  3T4A C;  1KNA A;  3RNU A;  4IPH A;  2RCN A;  3RZD H;  2LFN A;  2DN8 A;  1PMR A;  2JE6 I;  3WOE A;  1CTM A;  4DKA C;  2YTY A;  1CHQ D;  4C3H H;  3CU7 A;  4A3E G;  1PH9 A;  3M9B A;  2MO1 A;  2KEE A;  1O7L A;  1TS3 A;  2PZU A;  2PI2 A;  4GKK L;  3P75 A;  1Y1W H;  4L5T A;  1WCM H;  1XXG A;  3WWV A;  5C44 B;  3HOY H;  1V9P A;  3VA7 A;  3NEL A;  3SK5 A;  5CC4 A;  1IYJ B;  1I3Q H;  3I4N B;  2Z6B A;  3HOV H;  1X9N A;  3KF6 B;  4NPS A;  3PMF A;  4A3K B;  2QF7 A;  3VDY A;  2Z0S A;  2LSS A;  2X6L A;  3F1Z A;  1YBY A;  1EIY B;  2EQS A;  3TRE A;  3S1M B;  1BBX C;  4DR4 Q;  2CQO A;  3CCJ A;  4OEM B;  4IJL A;  1F9Q A;  2PI2 E;  3FPP A;  4WOR A;  1PHJ A;  2A69 C;  4MIU A;  4UPA A;  1SRO A;  1KDC A;  3KFU A;  1EQQ A;  2F4V L;  2V4D A;  1U4M A;  1RKN A;  5ELD A;  4G57 A;  4A93 B;  3A0J A;  2NVQ B;  2NB0 A;  1OXX K;  2HCC A;  1SE2 A;  1M4V A;  4HED A;  1O7I A;  5CV6 A;  4TKO B;  5IYD G;  3J81 j;  2OF1 A;  1ENF A;  2CH4 A;  4RCO A;  1VQP A;  3CRL C;  3CC4 A;  1VQG A;  4BXX H;  5D3I B;  2RKS A;  3D4R A;  1PTO D;  5CV7 A;  1PZK D;  1Z47 A;  2A6E D;  4DAM A;  3UE0 A;  4HSP A;  2PMZ B;  4ZLT F;  1AFP A;  2EE1 A;  4DK6 C;  2KEC A;  5DLQ E;  3CAM A;  2Q2U A;  1EUJ A;  1AZQ A;  1IKM A;  1QJO A;  1I4G A;  4FNF A;  3D4D A;  3ULJ A;  4Y7N B;  4DNI A;  3G71 A;  2R7Z G;  1VQF A;  4YY3 Q;  1VS0 A;  2VW9 A;  4TQU S;  1S5B D;  3VYU A;  1WJJ A;  4RGT A;  1TU2 B;  1E1O A;  1PA6 A;  1YIJ A;  5ELE A;  4FXG C;  4JI8 L;  2R7D A;  4G4K A;  4OIK A;  4B3M Q;  3H3V I;  4JI4 L;  2A68 D;  4DV1 Q;  5IE8 A;  1NE3 A;  1XYI A;  3A5Z B;  1HTP A;  1VQK A;  4RAU C;  1C8C A;  5DNF A;  2NVT B;  4KD3 A;  1GXD C;  4L5S A;  2UUC L;  3S1R B;  4DUY Q;  1JR0 D;  4DR6 Q;  3S24 A;  1VQD A;  1LT5 D;  1XMO L;  2CKZ B;  1Y69 U;  3GTG B;  1AE3 A;  3NE5 B;  4TRD A;  5M5Y H;  4HJ9 A;  4K2K A;  4HJ8 A;  2PQA B;  2PZW A;  3OW2 A;  2O5J C;  4NDX A;  2AWO A;  3W3A A;  4BS9 A;  4IFD H;  5J22 A;  4A3E B;  1Y1W G;  1I6H H;  1WCM G;  1IBL L;  2PNH A;  1SLJ A;  3HOY G;  5T1I A;  1H9J A;  3J7Z C;  3GTK B;  3FKI H;  3Q0A A;  3HOV G;  2PPB C;  1UE6 A;  2E2J H;  3RZO B;  3PQI A;  5LMU Q;  2MQH A;  1Q86 C;  4K2L A;  4FDB A;  2WKC A;  2IPK D;  3GO5 A;  1KIX A;  1B8A A;  3PUX A;  5EQ0 A;  1SN8 A;  3RD4 A;  1QUQ A;  3B6Y A;  4KHP Q;  4WJ4 A;  1SFO B;  2AKW B;  1BDO A;  4B3T L;  1DOK A;  1GHJ A;  3QG1 A;  2IJ0 A;  3K5L A;  2E2H B;  1PFS A;  5IP7 H;  1HJP A;  4DV4 Q;  4N8X 1;  5FKA C;  3KDF A;  3LNN A;  4NXN Q;  4DR5 Q;  2AQ3 B;  3DLL A;  4KHZ A;  2J0T D;  3GP7 A;  3U4V A;  1MI2 A;  4UP7 A;  3S2D B;  1EWI A;  2MFI A;  3K0Y A;  1HRJ A;  4ZAI A;  5CV8 A;  2XNA C;  4CDD C;  1EY8 A;  2K01 A;  3N52 A;  2C9O A;  5C4J H;  4UP8 A;  4P72 A;  1MHW C;  2VB3 X;  3DWP A;  1O7Z A;  4BXX G;  5EGT A;  3G7L A;  4BA1 I;  1EZ8 A;  3OMG A;  1JOO A;  2DUD A;  5C5M A;  4A3J H;  2JYO A;  1T5E A;  5ELF A;  4F8M A;  4NP5 A;  1RIP A;  2IWH A;  1W6J A;  1PFM A;  3VR4 A;  4EX5 A;  1RF2 D; 
#chains in the Genus database with same CATH homology
 4DGZ A;  1EOT A;  3J81 L;  4ZKB B;  5CBE E;  4F87 A;  1EEF D;  4KHV A;  2K7V A;  1HTL D;  2NYZ D;  2B2U A;  5D14 A;  3SHL A;  3LWU A;  2R7Z B;  4ZRZ A;  1IW7 D;  2KCC A;  1SNP A;  4O1N A;  5IT9 L;  2RBM A;  4EQP A;  2PZT A;  2WAC A;  3TZD A;  5G3L D;  1V1P B;  1PFN A;  3RZD B;  3OWE B;  1DM0 B;  2F3W A;  1TT2 A;  2A74 C;  4C1N I;  3WDN A;  1FNV A;  2CW0 C;  3DEO A;  4IFD G;  5IGB A;  1AEX A;  2WII B;  1EWC A;  2Z8L A;  4DXG A;  1EU4 A;  1Y1W B;  1CM9 A;  5LHY 1;  1WCM B;  3HOY B;  1MD2 D;  1MSG A;  1EIH A;  1I3Q B;  3QIA A;  4NMZ A;  2ZXP A;  3HOV B;  3HZX A;  1IHZ A;  2B2U C;  5D3D A;  1KTK A;  3OMC A;  3TP8 A;  2F0E A;  1DD2 A;  2K28 A;  3JAM L;  2Q8I B;  3T53 B;  3V2T A;  1II3 A;  1KDA A;  1PZI D;  1EY5 A;  3ND9 A;  1WTO A;  2EYH A;  1V1O A;  5CV5 A;  4LAA A;  2D2C C;  3KBX A;  2O2L D;  1FR3 A;  4IUV A;  4DA2 A;  4CJ0 B;  1YNJ D;  5KYL A;  4QF4 A;  1OXT A;  2HUG A;  1CQV A;  3X3M A;  4HMJ A;  2EYJ A;  4FXK C;  4IUT A;  5M9O A;  2SNS A;  1EY9 A;  2RDG A;  3BYY B;  1O80 A;  2D62 A;  3MC0 B;  4ZUJ A;  4IFD J;  5IGE A;  1D2B A;  1XWE A;  4DK0 A;  1OO9 B;  1F9R A;  3CKI B;  3C46 A;  4WJW A;  2RDF A;  3NK9 A;  3RUZ A;  5C3W A;  2SOB A;  4BA2 I;  3ITP A;  2EYO A;  3ERQ A;  2K33 A;  1WD1 A;  2OXP A;  1LV9 A;  2KJX A;  1D6E C;  4DXF A;  1JIC A;  4G7O C;  2TSS A;  4ZKC B;  4L63 B;  1GHK A;  3I70 A;  2IX1 A;  4RKB A;  2ICE C;  5K36 H;  1TY0 A;  1SYD A;  5E4X A;  1K8O A;  4PNY A;  1SE3 A;  3ZYY X;  5M5Y B;  4KY5 A;  1WTX A;  1PTO C;  2E2I B;  1F9P A;  1PDQ A;  2Z4I A;  1AZP A;  2RVL A;  2A6E C;  2HDL A;  1SMY D;  5KIX A;  1I6H B;  2F0V A;  4Q0F A;  1K8M A;  4CJ2 C;  1PTO H;  3FKI B;  2WIN B;  3E0J A;  2E2J B;  1BUV T;  2IW3 A;  1AN8 A;  1DOL A;  2KQ3 A;  3L9A X;  2F0J A;  3K5N A;  2A68 C;  1G29 1;  2FMM A;  5COR A;  2DNE A;  1LAB A;  1B9M A;  3NBI A;  2PO4 A;  3O13 A;  2XVS A;  1B50 A;  4IFD I;  3EVQ A;  5KNB A;  1JWU D;  1R4Q B;  1W6K A;  4ZQ3 A;  2F0Q A;  5IGC A;  5C4J B;  3RLF A;  1PFB A;  3HG9 A;  2NTT A;  1I4H A;  1L0Y B;  2HCI A;  5E4W C;  3MXG A;  2F0O A;  1STY A;  2KHS A;  1SNC A;  3EFX D;  1UAP A;  3P1H A;  4RCN A;  5EKL A;  1ENA A;  4H0L C;  4DNR B;  2E74 C;  3D3R A;  4CKB A;  1X32 A;  3D4W A;  3R8B A;  4IQZ A;  4X3U A;  3K6O A;  3S1N B;  4RH6 A;  2KOL A;  3PO2 B;  3BVM A;  3I3C A;  1Q8I A;  3X3N A;  3GTP B;  1F2Y A;  3D6W A;  1SNQ A;  2Z4H A;  1QNK A;  5D65 A;  1RD9 D;  1HUM A;  2R3Z A;  4A3B B;  5K36 G;  4KY7 A;  5JOB A;  3PIP 3;  2F0K A;  4QUC A;  3A8J E;  3GTM B;  2G9D A;  5JEA H;  2HDM A;  3A7A B;  1ET6 A;  2K04 A;  4OO1 G;  5C4X B;  1E2Z A;  2EJG C;  5HUR A;  2EY1 A;  2ID0 A;  5DAU A;  1SYF A;  2EYM A;  4BBS B;  1ZYR D;  4ZYS A;  1VMC A;  1BQQ T;  1UEA B;  3IFD A;  2HQE A;  2QDB A;  3DEP A;  4K14 A;  3PUZ A;  2B63 B;  2B2Y A;  4XYO A;  2JA5 B;  2BA0 A;  1IW7 C;  3I73 A;  4DK1 A;  5DM6 3;  1EWH A;  3H6M A;  2F0N A;  2E2D C;  1FNU A;  3SR1 A;  3M7N A;  1E0B A;  3SEB A;  4I7Z C;  1CA5 A;  1D5M C;  3J80 E;  1A15 A;  2MP1 A;  1E2V A;  1GJX A;  2F0P A;  1CK1 A;  2NZ1 D;  3N6R A;  3NPP A;  1SNO A;  3TN2 A;  5CMD A;  2L9H A;  5E3F A;  1S5C D;  4V0B A;  1WTQ A;  1LTI D;  4U67 3;  1VF5 C;  4FYD A;  1TY2 A;  2RSO A;  1EEI D;  1H9K A;  4K6D A;  3GD7 A;  5M5W B;  1STG A;  4WRD A;  1LLR D;  4B9W A;  1GUG A;  1UUP A;  5KGU A;  2B2Y C;  1GUO A;  4DAV A;  3KBG A;  5FO9 B;  4GZY C;  2L5T A;  3T51 B;  1XTC D;  1DON A;  4ODG A;  2M9V A;  4FXD A;  3HOU B;  1ENC A;  3J7A V;  4TSS A;  4LJZ C;  2JXM B;  2XRS D;  3S9W A;  2K6A A;  3WOF A;  2E75 C;  2DNC A;  2EOT A;  2X69 A;  4QB4 A;  4X3K A;  1B4O A;  1STA A;  2IT1 A;  1YNJ C;  1J9O A;  2F0S A;  5JEA G;  1B9N A;  1SND A;  3MZ5 A;  1I4Q A;  2NTS A;  1YNN D;  4KY6 A;  2F1M A;  1F2Z A;  3MFY A;  1R9T B;  4KD4 A;  2H1E A;  2RDH A;  4XTC S;  1BCP D;  1RCV D;  3F2U A;  1PTO B;  1IKL A;  3NQI A;  2L55 A;  2L12 A;  2R61 A;  3P20 A;  1TS2 A;  4NKL A;  2OT2 A;  1QNU A;  1NR4 A;  3D8G A;  3KLS A;  5J1Z A;  5C6A A;  5IIF A;  2JA7 B;  2AQ1 B;  4R8I A;  2WAQ B;  5KYI A;  5KEE A;  1U4P A;  4XQQ A;  4ILW A;  1Y8O B;  1I4X A;  1BCP B;  1S5F D;  3LWE A;  3VR5 A;  1LTG D;  3MXN A;  1SJH D;  5AFW A;  1QOH A;  4V19 0;  1F77 A;  1ICW A;  3URY A;  2MJ8 A;  3IFT A;  1WD0 A;  1SMY C;  3I91 A;  5EPJ A;  3G6J B;  3TSS A;  5JEA J;  5M3F B;  1U4L A;  3MTS A;  3NQT A;  4OL7 A;  2K32 A;  3M85 A;  1TS4 A;  1HFN A;  4ME5 A;  2FHT A;  4RA8 A;  3KLS X;  1FGB D;  3P7J A;  3CRK C;  2XN9 C;  2L11 A;  1B3A A;  1ONL A;  5EPK A;  3BYT B;  2XSC A;  1BO0 A;  2Q8T A;  3K59 A;  3PUY A;  4C3J G;  5CBA E;  2A6H D;  3T13 A;  2JA6 B;  3VYR A;  2BA1 A;  1EYD A;  1PRT D;  4O42 A;  3SK6 A;  1QG7 A;  5BN3 A;  3VR2 A;  4DU9 A;  3H0G B;  4F7X A;  1FYC A;  3QWN A;  4K5W A;  4KKT A;  4FP5 D;  1H9R A;  3QOJ A;  1STB A;  2R93 B;  3FDT A;  3OIQ A;  1EIG A;  1DOM A;  3HS0 C;  3MVV A;  1TVX A;  2AUJ D;  1EQV A;  3C1E A;  4OHJ A;  1LTB D;  3DWQ A;  1T5X D;  1CZG A;  1I6V C;  3PV0 A;  2XWJ B;  4K5V A;  2F0H A;  3Q6S A;  3VA5 A;  2ZXO A;  2EY2 A;  4FVM A;  4JK1 C;  4Q5V A;  1EYA A;  3E5S A;  3K5O A;  5IGG A;  1STN A;  1ML0 D;  5A35 A;  4IUQ A;  3MXU A;  2I46 A;  2Z1C A;  2J4X A;  2F0U A;  2F3V A;  4FO2 A;  1ZYR C;  2E76 C;  1C48 A;  5EPL A;  3J7Y W;  1QWY A;  3ERO A;  1JQY D;  5DEH A;  1B44 D;  2FMC A;  2PYK A;  4BY7 B;  1L0X B;  2F0W A;  2O5I C;  2XIW A;  5KND A;  2SNM A;  4M8A A;  2L0C A;  4DFA A;  1KAB A;  3KUP A;  1SDF A;  2VNU D;  5DM7 3;  2RSN A;  5G3L F;  2AWN A;  1TS5 A;  3I90 A;  4C3J B;  2EZV A;  5JPM C;  4XIG S;  1A3U A;  4G7Z C;  1JOK A;  2M2L A;  1SE4 A;  3PO3 B;  4XXE A;  5FO7 B;  5LL6 X;  3HRZ C;  3K57 A;  1OXS C;  4CKE A;  2JP1 A;  3L3O C;  1VMP A;  2SEB D;  2R6G A;  1G2T A;  3NWS A;  2AQ2 B;  2ZXR A;  4MHE A;  1RTN A;  3UI2 A;  2D9U A;  3M4Y A;  3GV6 A;  4PQX A;  4CKC A;  4DNT B;  1TWA B;  2QCP X;  2EJF C;  2N88 A;  4E6I A;  4A3I B;  3DUZ A;  5C0X H;  4QCL A;  1NR2 A;  1RHP A;  2PW7 A;  3DM1 A;  1SEB D;  2F4I A;  2OEO A;  3M7G A;  4HAE A;  3SK8 A;  3HOX B;  3HKZ B;  1I50 B;  3V96 A;  2BCO A;  4A3F B;  4EQN A;  1BF4 A;  3GTL B;  3QB3 A;  3VYS A;  2NBF A;  5CV9 A;  1A6X A;  1H9S A;  3NXW A;  3W2D A;  1QB5 D;  1AP0 A;  2LY7 A;  4OO1 H;  3A8I E;  1VDZ A;  2FFK B;  3TP6 A;  4HCE A;  4FF3 A;  1BNZ A;  3A54 A;  5IOD A;  1H9M A;  2MPM A;  1YNN C;  4UAI A;  4ZUI A;  3BVG A;  1HPC A;  3T56 B;  2QKI C;  1BCP C;  4PV1 C;  2B39 A;  1XX8 A;  4XT3 B;  1NUC A;  1Y8N B;  1B53 A;  1U4R A;  4J6H A;  1HCZ A;  5EKI A;  3HOZ B;  3ONA B;  4MN3 A;  1SYC A;  1RDP D;  4IUP A;  1QE6 A;  3HGB A;  1LTS D;  5C3X A;  4RWS C;  3MXP A;  3H09 A;  1QCB D;  4N9T A;  3GV3 A;  2GA4 B;  4KI0 A;  1WTW A;  2EXZ A;  1ILQ A;  4B08 A;  1Z6H A;  3OW7 A;  1JE4 A;  4RGN A;  3R2T A;  4QUF A;  1VCI A;  1HQR D;  4RHS A;  3QOL A;  2A5H A;  1KDB A;  2M00 A;  5JAV A;  1LT4 D;  1EZ6 A;  1D5X C;  5JVG 3;  5C4H A;  1SYG A;  3Q22 A;  3VR6 A;  1SJE D;  4X3T A;  5C0X G;  2IL8 A;  3SVM A;  4HCS A;  3EQL C;  3OWF A;  1ROD A;  3TP7 A;  1Y8P B;  3MWY W;  2PW5 A;  3I4L A;  3NSW A;  4RGM A;  2A6H C;  3Q23 A;  5ELC A;  1HQM C;  1ET9 A;  4IUU A;  1VF7 A;  2JEB I;  3S17 B;  4C56 C;  2ENB A;  3TDQ A;  5I6Y A;  1PRT C;  3M3Y B;  2LS0 1;  3E6Z X;  2O4X A;  3MA2 B;  5CYU A;  5JPN C;  1EY0 A;  2NN6 H;  1E2W A;  1J8I A;  5IOC A;  2H4O A;  2K05 A;  4XQJ A;  2BE5 D;  4K8I A;  2BDO A;  1Y1V B;  2EJM A;  4LK1 C;  3S15 B;  4XT1 B;  1CFM A;  1GUN A;  3CHB D;  1FD7 D;  5IGF A;  3TME A;  5C0X J;  2K5D A;  4ZK9 B;  1EY6 A;  3RMH A;  4EVO A;  3FPU B;  1F9S A;  3HP3 A;  5A2Q E;  1PLF A;  1SYB A;  4XYQ A;  5M3M B;  4YIJ A;  2Y0S B;  4KV6 A;  4JBW A;  3NTH A;  5I6W A;  5C5L A;  2B2V A;  5CGK A;  4PMW A;  3GTQ B;  3NP8 A;  1HXY D;  2FIN B;  3R3O A;  4L8J A;  2KUM A;  3M4O B;  5EJW A;  1LT3 D;  4G7H C;  4B9X A;  1IL8 A;  1PYW D;  2EDG A;  2NVY B;  5FO8 B;  4K6L A;  2XRQ D;  3C3L A;  1CI3 M;  5I4D A;  4KMU C;  5FLX E;  5FK9 C;  1PXU A;  1Q3L A;  3TP5 A;  4KTA A;  5NUC A;  1WVL A;  3S2H B;  1Q12 A;  1JB3 A;  3BS1 A;  1GUW A;  4H44 C;  4IUR A;  4N9P A;  1CZW A;  1WTR A;  5E1F A;  5BN5 A;  4FF4 A;  4RFB A;  2ICI A;  5C3E B;  5FOB B;  1A3V A;  1F2L A;  2DY8 A;  3MAQ A;  1LAC A;  2B2V C;  5I9P A;  2KVM A;  4BY1 B;  1HA6 A;  5EKK A;  1CQF A;  4KKS A;  3GTJ B;  5KRU A;  3GTO B;  4HSV A;  5LL6 S;  4ULL A;  1LT6 D;  4Z9C B;  4S3S A;  4HN7 A;  1G2S A;  5BN4 A;  1SYE A;  3DHQ A;  2NN6 G;  1F2M A;  3K5M A;  4L6T B;  4C2M B;  3OPO A;  3IAY A;  3SDZ A;  1V43 A;  5C0X I;  3S16 B;  2QEJ C;  3SXH A;  2F0D A;  4P2C B;  1TR5 A;  4K8J A;  2JSO A;  1EU3 A;  4KK7 A;  2CVR A;  2L1B A;  1GUT A;  2SDF A;  4R8N A;  3DWA A;  4C3I G;  3I4M B;  3MFG A;  1O7Y A;  5IGD A;  2BOS A;  4BBR B;  4U68 A;  3K58 A;  2DY7 A;  1PTO F;  3NWT A;  3OIP A;  4OO1 I;  2B8F A;  2BDN A;  5HGT A;  1I4R A;  2K5W A;  4C3H G;  1R4P B;  3HEJ A;  1S5E D;  1JOR A;  1DXM A;  3BG3 A;  2F0L A;  1HFG A;  2K5Q A;  3A55 A;  1PZJ D;  4F88 A;  1H9S B;  3BDO A;  3Q24 A;  1EYC A;  1BCP F;  3MEH A;  1D1K A;  3SK4 A;  1WTP A;  2D5D A;  4OGQ C;  1WTV A;  1LO5 D;  1JWS D;  5CV4 A;  2RA4 A;  3A56 A;  3KK7 A;  1STH A;  1ZKO A;  1A3T A;  2VXW A;  1TWH B;  1TWC B;  3T16 A;  2ZT9 C;  3BDC A;  5JJZ A;  4HR7 B;  2MUY A;  2QIL A;  3K7A B;  1MGS A;  1KAA A;  4RHR A;  4UDU C;  1D5Z C;  3ND8 A;  2K1B A;  1G6Z A;  2MGS A;  2X6G A;  1BXT A;  2TMP A;  2NVX B;  3S1Q B;  4KN4 C;  4K5X A;  2KCN A;  1OXU A;  4ABN A;  2WV6 D;  1DJR D;  4CGY B;  2I07 B;  1X3Q A;  3BVZ A;  4CBV A;  1LTT D;  2F0M A;  1EY4 A;  5I2Y A;  1IYU A;  1PRT B;  2PCF B;  1BR9 A;  1U9R A;  1Q1B A;  1KLU D;  1SNM A;  4HMI A;  1ILP A;  4IZ8 A;  3NUC A;  5I2X A;  1AW7 A;  2WB1 B;  4C3I B;  2F0G A;  2FJ2 A;  1B1Z A;  5K5P A;  3I8Z A;  1PRT F;  4KJO A;  3IL8 A;  3PUW A;  4QMG A;  1TKW B;  2B2T A;  1DCZ A;  1TII D;  3OOC A;  4C3H B;  4RKL A;  1KNE A;  2NN6 I;  1HUN A;  3EJI A;  2B2W A;  3QJY A;  4KJN A;  2EVB A;  1S4Z A;  3D6C A;  1JOQ A;  2EYL A;  2BE5 C;  2NUC A;  3PIO 3;  2VUM B;  4FF1 A;  2L4N A;  1G91 A;  5ELB A;  2A69 D;  5ISR A;  1IYV A;  2YYZ A;  2MHV A;  3CQZ B;  2R92 B;  1KLG D;  2K03 A;  1TWG B;  1TQO A;  1JC7 A;  4EQO A;  3FMC A;  2KED A;  3J7A F;  1DYQ A;  2PNR C;  1O78 A;  1X3P A;  3TBI B;  1G8Z D;  3LX0 A;  3OHX C;  2B2T C;  2NWG A;  2B2W C;  3AU7 A;  3BDL A;  1DZ1 A;  1JCK B;  2EYF A;  3SE0 A;  2CHB D;  1I4P A;  5J39 A;  1Q90 A;  1CA6 A;  4KKU A;  3VYT A;  3H3V C;  3PUV A;  1QIL A;  1ZEQ X;  2N55 A;  4PMB A;  1MBY A;  2IX0 A;  3U9S A;  2IX3 A;  5JVH 3;  4AYB B;  2Q8R E;  4DN4 M;  1FNW A;  3A8K E;  3BZD B;  3GQB A;  2XWB B;  2YU9 B;  3NTK A;  3J81 E;  2EY6 A;  1C4Q A;  3C1F A;  3C2P A;  3L7Z C;  4DF7 A;  1D1I A;  4R9W A;  3DXJ C;  1CHP D;  3A7L A;  3V05 A;  1BOS A;  4IAL A;  4A3M B;  3HOW B;  4X3S A;  2RQX A;  3FRP B;  3J80 L;  5IT9 E;  2WKD A;  3R2I A;  1S5D D;  5TSS A;  3IKJ A;  3DMU A;  4ID6 A;  5C4Z A;  2EYP A;  3S14 B;  2J7Z A;  1TWF B;  5A2Q L;  1STE A;  1Z7T A;  3U9O A;  1LTR D;  1Q1E A;  1ZXT A;  1EL0 A;  4H7B A;  3NTI A;  1GUS A;  1NCV A;  3TZU A;  3R93 A;  4FF2 A;  4BWG B;  1V8Q A;  2F0F A;  1K83 B;  3AMU A;  3NHH A;  2F03 A;  2JA8 B;  1HA5 A;  5FLX L;  2F0I A;  5EBC A;  5I9O A;  1NAP A;  2B8G A;  3D31 A;  3OSO A;  1ESF A;  2EPB A;  3KF8 A;  3H91 A;  3JAM E;  4QIW B;  4IUN A;  4C1N K;  3MHB A;  4XDX A;  5EBD A;  2LMC B;  3QO2 A;  4A3J B;  2VB2 X;  1UNS A;  4NW2 A;  5COY A;  1SBB B;  1SAP A;  4I65 A;  2JEA I;  1OXV A;  5KNC A;  4CJ1 B;  1V1P A;  1M8A A;  2G9H D;  4M1U B;  2KA7 A;  3FVQ A;  3H94 A;  1EQT A;  4PMC A;  1A2T A;  3FEW X;  4J8Q A;  2F0T A;  5F2D A;  2CQA A;  1ESR A;  1JWM D;  1RTO A;  1GOZ A;  1A2U A;  1LTA D;  4J1M A;  4DAP A;  3EA6 A;  4H13 C;  5M5X B;  4A3G B;  4OIJ A;  1RJT A;  2CW0 D;  2LKV A;  4DAY A;  5CR3 A;  1SSO A;  1B2T A;  3KLR A;  1HHV A;  3AB9 A;  2AUK A;  2PQE A;  4HTH A;  2A73 B;  2C5C A;  5T1G A;  4EGV A;  2WP8 J;  4IN3 A;  1SXT A;  4XQN A;  1MSH A;  4CHT B;  4RGO S;  1CT1 D;  4WFN 3;  4KN7 C;  1EFI D;  1EY7 A;  1NSN S;  2EY5 A;  3NBH A;  3VR3 A;  4A3D B;  4LMQ D;  3I72 A;  3T4A C;  1KNA A;  2LFN A;  2DN8 A;  1PMR A;  2JE6 I;  3WOE A;  1CTM A;  1CHQ D;  3CU7 A;  2KEE A;  1O7L A;  1TS3 A;  2PZU A;  3P75 A;  1XXG A;  5C44 B;  3VA7 A;  3SK5 A;  5CC4 A;  3I4N B;  3PMF A;  4A3K B;  2QF7 A;  2X6L A;  3S1M B;  1BBX C;  1F9Q A;  3FPP A;  4WOR A;  2A69 C;  4MIU A;  1KDC A;  2V4D A;  1U4M A;  1RKN A;  5ELD A;  4G57 A;  4A93 B;  2NVQ B;  2NB0 A;  1OXX K;  2HCC A;  1SE2 A;  1M4V A;  4HED A;  5CV6 A;  4TKO B;  2OF1 A;  1ENF A;  4RCO A;  3CRL C;  5D3I B;  2RKS A;  3D4R A;  1PTO D;  5CV7 A;  1PZK D;  1Z47 A;  2A6E D;  4HSP A;  2PMZ B;  4ZLT F;  1AFP A;  2EE1 A;  2KEC A;  1AZQ A;  1IKM A;  1QJO A;  1I4G A;  4FNF A;  3D4D A;  4Y7N B;  4TQU S;  1S5B D;  3VYU A;  4RGT A;  1TU2 B;  5ELE A;  4FXG C;  4G4K A;  4OIK A;  2A68 D;  1XYI A;  1HTP A;  4RAU C;  1C8C A;  5DNF A;  2NVT B;  4KD3 A;  1GXD C;  3S1R B;  1JR0 D;  1LT5 D;  1Y69 U;  3GTG B;  3NE5 B;  4TRD A;  4K2K A;  2PZW A;  2O5J C;  4NDX A;  2AWO A;  3W3A A;  4BS9 A;  4IFD H;  5J22 A;  4A3E B;  5T1I A;  1H9J A;  3GTK B;  3Q0A A;  2PPB C;  3RZO B;  4K2L A;  2WKC A;  2IPK D;  3GO5 A;  3PUX A;  5EQ0 A;  3RD4 A;  1SFO B;  1BDO A;  1DOK A;  1GHJ A;  3QG1 A;  2IJ0 A;  3K5L A;  2E2H B;  5FKA C;  3LNN A;  2AQ3 B;  4KHZ A;  2J0T D;  3GP7 A;  1MI2 A;  3S2D B;  3K0Y A;  1HRJ A;  4ZAI A;  5CV8 A;  2XNA C;  1EY8 A;  2K01 A;  3N52 A;  2C9O A;  2VB3 X;  3DWP A;  1O7Z A;  5EGT A;  3G7L A;  4BA1 I;  1EZ8 A;  3OMG A;  1JOO A;  5C5M A;  2JYO A;  1T5E A;  5ELF A;  4F8M A;  4NP5 A;  2IWH A;  1W6J A;  1PFM A;  3VR4 A;  1RF2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...