1WVLA

Crystal structure of multimeric dna-binding protein sac7d-gcn4 with dna decamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKKGVLKKLRAVENELH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 5'-D(*CP*CP*TP*AP*TP*AP*TP*AP*GP*G)-3'
publication title Design and characterization of a multimeric DNA binding protein using Sac7d and GCN4 as templates
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 19
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wvlA00
2DY7A 4X3SA 2B2TA 1ML0D 1ZXTA 2B2VA 2KVMA 2KEEA 1IKLA 2EPBA 3ONAB 2EE1A 2SDFA 1BF4A 1NR4A 1KNEA 2B2WC 1F9RA 2K04A 2JP1A 4IUUA 1BO0A 2K28A 2FJ2A 3UI2A 3I8ZA 2XIWA 1SSOA 2MGSA 4HCSA 4RAUC 1J9OA 2Q8RE 1G2TA 2HCCA 3F2UA 1M8AA 1MGSA 2NYZD 2N88A 5EQ0A 2JYOA 1X3QA 2DY8A 2MJ8A 1WD1A 4QUFA 1Q3LA 1QE6A 3DEPA 1WTRA 2B2UA 1F2LA 1U4RA 2NWGA 1EQTA 2M2LA 2FMMA 2J7ZA 3KBXA 3N52A 1MSHA 4XT3B 5EKIA 2RA4A 1DOLA 2B2YC 1IKMA 1JICA 2EOTA 3KUPA 2MPMA 5AFWA 1DONA 1HFNA 2FHTA 4NW2A 2HUGA 4U68A 3I91A 1BBXC 4R8IA 2KECA 1QNKA 2H1EA 1WD0A 1RTNA 1GUWA 1HUNA 1NR2A 3HP3A 2K1BA 1X3PA 1B2TA 5EJWA 5EPKA 3Q6SA 5D14A 4HSVA 1PLFA 3TN2A 5CBAE 3G7LA 4HAEA 4ZKBB 1E0BA 1SAPA 2HDLA 3R93A 2FINB 1EIGA 2L11A 2NZ1D 1A15A 1MSGA 2Q8TA 1EIHA 1SDFA 5COYA 4LMQD 4XT1B 5EPJA 2K05A 3I3CA 5E4XA 1J8IA 1EL0A 1WTPA 1B53A 4DN4M 2BDNA 1CM9A 3GV6A 1WVLA 2IL8A 4O42A 4CJ0B 2X6LA 1HA6A 2B2TC 2B2YA 1G91A 2B2VC 2K03A 1HRJA 2L12A 1F9PA 4OIJA 4RWSC 1HFGA 3DM1A 4XDXA 5DNFA 1AZQA 2RVLA 2L4NA 1U4LA 3I90A 1JE4A 3D6WA 1VMCA 1MI2A 2L9HA 4OIKA 1ESRA 3MTSA 1CA6A 1XYIA 1C8CA 2B2WA 4QUCA 1KNAA 1RTOA 4X3UA 2VXWA 1PDQA 4IUQA 5D65A 1WTVA 3IL8A 1DZ1A 1NAPA 1G2SA 5CMDA 3H91A 4ZKCB 4IUPA 1PFBA 4MN3A 4IUTA 2N55A 2L1BA 1X32A 1ILPA 5E4WC 3TZDA 1AP0A 5CBEE 3FPUB 4ZK9B 4R9WA 1O7ZA 1PFMA 5CORA 2HDMA 5T1GA 1G6ZA 1HHVA 1NCVA 1RODA 2CVRA 1DOMA 3DEOA 1F9SA 2X6GA 1DOKA 1EOTA 1O80A 1XX8A 3P7JA 1BNZA 5EPLA 4CJ1B 2K01A 3QO2A 1IL8A 4X3KA 4CJ2C 1AZPA 1B50A 2X69A 1VMPA 2FFKB 2R3ZA 2KUMA 2KEDA 4RA8A 1ICWA 1WTWA 1CA5A 2RSOA 3GV3A 1U4MA 1PFNA 1S4ZA 1WTXA 1B3AA 2RSNA 5JJZA 1LV9A 1HUMA 2B2UC 4X3TA 3LWEA 1WTQA 4ZAIA 1B4OA 4IURA 3IFDA 5T1IA 1ILQA 1O7YA 2HCIA 1TVXA 4IUVA 1RJTA 4ZLTF 1RHPA 3FDTA 4MHEA 1U4PA 2KOLA 2MP1A 4UAIA 3MWYW 2D9UA 3SVMA 1F9QA 4HEDA 1QG7A 1WTOA
chains in the Genus database with same CATH superfamily
2DY7A 4G7ZC 2ZJQA 1CKNB 4DV7L 2KEEA 4DV7Q 1KNEA 4CJ1B 3MXGA 1DGSA 1O78A 1VQ4A 1SSOA 1PRTB 4LF7L 4A3JB 4OXPA 4DK0A 3A8IE 4LF7Q 1KQSA 1CZWA 3DEPA 2ZM6L 4ODGA 2FMMA 3PUYA 3KJOA 5M5WH 1I6HH 2ZM6Q 4U68A 2F0GA 2JA5B 1NSNS 3BZKA 5EAYA 1QUQA 2F1MA 4DR4L 4HCEA 2YU9H 2EJGC 1XMQL 4EQNA 3OIQA 1B8AA 4DR4Q 1IXRA 2NVTH 3TQYA 4LFBL 3V05A 1XMQQ 1VQ5A 2K5WA 4LFBQ 3K0XA 3T16A 3A8KE 1EUJA 3F2DA 5F2DA 2BDNA 3GV6A 5LHY1 1JOQA 1VQLA 2JK8A 3A56A 5C44G 4XDXA 4OWXB 4NPSA 1PH3A 5EBCA 5L37A 2LY7A 2N49A 1M90C 1TIID 1GXDC 1SFOB 1C8CA 1TXYA 3EIVA 4DKAC 1SROA 1DZ1A 3TMEA 2I5HA 5C4XH 4B3RL 2UUBL 2F52A 1ASYA 4B3RQ 2EYPA 4IJLA 2YYZA 1TT2A 5J22A 3M4OB 1F9SA 1SNCA 2XVSA 3H15A 1D7QA 1NUCA 2WINB 4OWTB 1BCPD 4CBVA 1WTWA 1CA5A 5C44B 2N3SA 4P71A 4HN7A 2QW7A 4R4CA 3K59A 4HIDA 1CQFA 4X3TA 1WTQA 4ZAIA 4DR7L 4ILWA 2GN5A 4DA2A 1K83B 4IUVA 1STEA 2D0PA 4GOPA 4DR7Q 3BVMA 1D1IA 3CXCA 4HEDA 2CH4A 1MHWC 4KKUA 4A3EH 1IKLA 1CT1D 1X55A 4G7HC 3EVQA 5GAHC 4K2KA 4ME3A 4R4OA 3RLNA 1A3TA 3I4MG 1J9OA 1L2FA 1WJJA 4ULLA 2IX0A 1E2WA 3AYHB 1X3EA 3PIOA 1KHIA 2E2HB 2CH4W 1Q81C 2E2IB 1PTOF 2B2UA 2CFMA 2R61A 4DXFA 5KGUA 3UDGA 5G3LD 3CC2A 3S1QH 1DOLA 4R4IA 3OIPA 1PH6A 1KL9A 2FHTA 4NW2A 4C3HG 3I91A 4DF7A 5ELDA 1ENFA 2PI2A 5BN3A 2K1BA 3GO5A 2TSSA 5C3EG 3RZOB 2PQEA 1GKHA 1HTPA 2GA4B 4C3IH 3NTKA 4KHPL 2Q8TA 3JAME 1FYCA 5GROA 4KHPQ 1EL0A 1Z47A 4NDXA 3VA5A 1HA6A 4K2LA 3SK6A 2K03A 3T13A 1NMGA 1F9PA 3NTHA 5K36G 2KHJA 2L5TA 5I9PA 1LTRD 1KDAA 1AFPA 4C3HB 1Q8KA 3HOXH 3CPWA 4JW0A 3R2IA 5C4JB 3PIP3 3GTQH 4FF1A 5C6AA 5C3EB 3FPPA 1PFBA 2A68C 1RD9D 4AYBG 3U4VA 1UE1A 2VQFL 1Y1WH 5E4WC 4YIJA 1STGA 1ASZA 2LXKA 5CORA 4UDUC 2ZTCA 1KLUD 3IKJA 2VQFQ 5IGGA 1YIJA 1PH2A 5EPLA 1PH9A 2ID0A 3BZCA 4A3DH 1SMYC 3OW7A 3PV0A 2RCNA 5CYUA 3ULLA 3HOZH 2RSOA 3WDNA 3T4AC 3HG9A 5JEAG 4OX9L 1ENCA 5JPMC 1E3PA 4OX9Q 1TVXA 1T9HA 4BY1G 4BY7H 4UAIA 4FF4A 2K14A 2L55A 4DV1L 1JB3A 4JPBW 4AYBB 3S14B 1PYWD 1BQQT 2D62A 3K80C 4DV1Q 3ONAB 2B39A 3EN2A 1NR4A 2F0WA 3VYRA 3D6CA 3RMHA 2EY6A 1HNXL 2CQAA 1HZBA 3EJIA 4HCSA 5IODA 1T5XD 2ES2A 1ZYRD 1M1KC 1EY5A 1HNXQ 1MGSA 1YNXA 1UE5A 3DM3A 1X3QA 2H4OA 4QUFA 1UEBA 3R2TA 3STBC 1WTRA 3N52A 1PYBA 5IP9H 1TWFB 2AQ2B 4YWKA 3K57A 2AWNA 4L5TA 4KN4C 4JI6L 3K5LA 5C0XJ 3NWSA 1K8AC 4JI6Q 3LGJA 2E2JH 1V1OA 3HFZB 5CV6A 1L0WA 2XN9C 1PLFA 3AU7A 2PMZE 1X9NA 2SOBA 3SEBA 2NUCA 4ZRZA 5COYA 4EX5A 4JBJA 1PH5A 1X3GA 5E4XA 1SNPA 1TS4A 4MNOA 3BYTB 3KDFB 4RH6A 1MJEA 4JI3L 1EQQA 3E5SA 2VNUD 3CCVA 1GOZA 1SMXA 4JI3Q 3X3NA 1AZQA 3FVQA 3S1RB 1ICFB 2A6HD 3G48A 4YHHL 1E2VA 3ULJA 3TS2A 3E6ZX 3E3XA 5IYDH 1F2ZA 4YHHQ 4A93H 3PSIA 5CMDA 1EFID 4NMZA 3RN5A 4ALPA 1X32A 1HR0W 1XMOL 4LJZC 3MAQA 1IL2A 3CAMA 3VR3A 1C4QA 5M3MH 1XMOQ 3KK7A 1FR3A 2VW9A 3GTKB 1YNJC 1RF2D 5C5LA 1KRTA 2FFKB 1XPUA 4QF4A 4XTCS 4TRDA 1SE8A 3PMFA 2R92G 4BA2I 2K4KA 1TWGB 1U4MA 1F2YA 1Y1VB 3SK5A 1SYFA 1YBYA 5ELBA 3DLLA 1PZJD 5CV7A 4LF6L 1LV9A 3OYYA 2TMPA 1XTDA 1PH8A 2DNCA 1I5FA 2G9HD 2V4DA 1VF5C 3URYA 4C3JH 2LS01 1X54A 3MWYW 1F9QA 3OMCA 5DM63 2IJ0A 1YNND 4V0BA 2F0MA 1ML0D 1R9TB 1ZKOA 2EE1A 2PYKA 2WV6D 1VQOA 1F9RA 5JAVA 3I8ZA 4JOIC 3V2TA 2F0HA 4A3FG 4DR2L 3GTJB 1M8AA 5E3FA 1RKNA 4DR2Q 3A7LA 2JA8H 1Q3LA 2R92B 1BDOA 3ER0A 1V9PA 2F03A 1HA5A 1DONA 2EOTA 3PO3H 3M4YA 2HUGA 4R8IA 4A3KB 1RTNA 1G291 1MIUA 4ZYSA 5C3XA 3RLFA 1UAPA 3C1EA 2L11A 5HY6A 4X65L 3UDFA 5EPJA 1PRTD 4JI7L 1V1QA 3DUZA 2VQEL 4X65Q 4A3FB 5IY0A 3RUZA 3H3VC 4JI7Q 1GUGA 1EFWA 3A74A 3CRLC 2VQEQ 3NWTA 4RKBA 4G4KA 3PCOB 3L2PA 4A3BH 2IHEA 4Q0FA 4DAVA 4B08A 2BOSA 2L4NA 1U4LA 2K7VA 4KV6A 2K50A 4MTKA 3MTSA 4X3UA 3SR1A 2ZT9C 5CV8A 4JOIA 1NAPA 4RG1A 3GP7A 1U5KA 1SYGA 4OO1G 1W3SA 5E1FA 3S2HH 1Y8PB 2NZHA 2JSOA 2HT1A 4NXNL 2LXJA 3K81C 1NCVA 4QGUA 4IFDI 1DXMA 1GJXA 1EYAA 3I4OA 4NXNQ 2GVAA 1AEXA 3GTLH 4HIMA 3C46A 1RDPD 2R3ZA 3VR6A 1TQOA 2KEDA 1WCMH 4FF3A 2R7ZH 4LF9L 1IYJB 1S4ZA 4GN5A 4LF9Q 4GKJL 2MHVA 3VYTA 3S16B 1JJ2A 4GKJQ 1OXXK 3CQZH 3E0EA 4DK1A 1QVCA 4JI0L 2MP1A 4K8IA 2D5DA 4JI0Q 1EWIA 1XNQL 1XNRL 3F2CA 3ULPA 1MKHA 3MXNA 1XNQQ 4AH6A 1L0YB 2PCFB 1XNRQ 3VR2A 2FJ2A 4PZ8A 4BBRG 2K75A 2Y0SB 1QOHA 4S3SA 5EQ0A 4PMCA 5I6YA 4DR1L 4DR1Q 1YVCA 1U4RA 1EQTA 2JEAI 3M7NA 1X6OA 3G6JB 4FYDA 1JICA 1YZ6A 2MPMA 5BN4A 2A69C 1H95A 3K0YA 2JXMB 4R4QA 3CCMA 1QZGA 2A1AA 4DV2L 1EEID 5LMNW 2JA5H 3TP7A 3HP3A 3TZUA 4DV2Q 4HJ7A 4LUOA 1KXLA 3J80i 3HOWH 1EZ8A 1FNVA 1GD7A 4I65A 4B3TL 1TWAB 1TWHH 3MEHA 2QEXA 4LMQD 1BKBA 3TRZA 4QMGA 4B3TQ 1Q1EA 5IYCG 4BBRB 2KCTA 3I3CA 1J8IA 1IBML 2WAQG 4CJ0B 5IT9c 4XYQA 1A2TA 1IBMQ 1VQAA 1B1ZA 1Q90A 1N8RC 1S5BD 3A5ZB 2CKZB 3H09A 3I90A 4GZYC 3NELA 1J5EL 2B63G 5K5PA 1J5EQ 2WP8J 2VZAA 3NPPA 4ZKCB 3KFUA 4IUPA 4IUTA 2NVYB 4A3IG 2XNAC 1RIPA 3X3MA 3D4RA 2VB2X 1SJHD 3DWAA 3TP8A 3OSOA 2WAQB 4O1NA 5ISRA 1B9MA 1EY0A 1AE2A 4F7XA 1VQNA 1LLRD 2I5LX 1N33L 2B63B 2LMCB 2PW5A 3IFDA 1N33Q 1OXSC 1UE6A 3FDTA 1Y8NB 4MHEA 4C2MH 3K5OA 3E0JA 3OWFA 3KBGA 2NVXB 1ZXTA 1LT5D 1QJOA 2XTIA 3FRPB 3IFTA 3LNNA 3EBEA 4A3JG 2R6GA 1JWMD 4IFDH 3IRBA 3KOJA 4X66L 3CC4A 1YJ9A 1A62A 1LT6D 3EA6A 4OEMB 1UWVA 3NENA 4X66Q 5A2QE 3GTOH 2QEJC 1OTCA 3OWEB 1BOSA 2MUYA 3H94A 1EYCA 1I4HA 1K0RA 4DV4L 2Z8LA 4FXDA 1DD2A 5JJLA 4C56C 4KD4A 4DV4Q 1Q82C 3MFYA 2NB0A 1QNKA 4WFN3 4NXML 1N32L 2K6AA 3I72A 2MNAA 1KD1C 3Q6SA 4NXMQ 1N32Q 4HSVA 3FP9A 1BCPC 4A3GG 4MIUA 2K52A 2K33A 1SR3A 1UNSA 2EXZA 2VUMH 3MA2B 3K58A 2UXBL 1WTPA 3I4MH 2NVQH 1JB7A 4KY7A 1V1PA 2UXBQ 3BVGA 2B2YA 2Q2TA 4IFDJ 1GUSA 3HOVH 1HFGA 3QOJA 2AQ1B 1TY0A 1Q12A 1CSQA 2YV5A 1PV4A 4BA1I 4JI1L 4OIKA 4KKSA 2UUCL 3B6YA 2UXCL 3S1MB 4IQZA 4JI1Q 1N36L 2UUCQ 3HKZE 2UXCQ 1YHQA 1HNWL 4H7BA 1N36Q 5IGBA 3J80c 5M5XB 1HNWQ 4PZ6A 3FKIB 4GOPC 4A3GB 1ILPA 5CBEE 1JOOA 2OWOA 1A8VA 4DAYA 1G6ZA 4CKBA 5FLMH 1HHVA 2R93B 1LO5D 5EGTA 2KA7A 1O80A 1XX8A 5DLQE 1BNZA 2F3IA 4JI8L 4GNXA 1HZCA 4U673 1CHPD 3S2DH 4JI8Q 4BXXH 2WACA 4FDBA 3F1ZA 5TSSA 3S17H 2B2UC 3OOCA 4EGVA 5IOCA 3S1NH 1VQBA 4GS3A 2L0CA 3DXJC 4MTNA 2WB1B 2HCIA 3M9BA 2PZUA 4ZLTF 3HOYG 1EOVA 3BVZA 4K0KL 1TWCH 3D3RA 2HIVA 3FEWX 1K0SA 2F3WA 2A74C 2QDLA 2UUBQ 4K0KQ 4X3SA 5I9OA 1E1OA 2LSSA 4K5WA 2EPBA 2KHSA 5BN5A 2NN6I 1BF4A 2K04A 4JCVE 4JK1C 3UI2A 1F77A 4XQNA 4L8JA 3NBHA 4Y7NB 1VDZA 1EYGA 2ICIA 2LFNA 1S5DD 2MJ8A 2QKIC 5M3FG 3I2ZA 1XJVA 1GVPA 2RDHA 2J7ZA 1B9NA 3J81E 2F0KA 4WJ4A 3M3YB 5JEAH 3T56B 4K5XA 2WKCA 3HOYB 3I4NG 1I94L 4BY1H 1B2TA 2I0QA 2EY5A 4PZ7A 3G7LA 3QWNA 1I94Q 1Q8IA 5IIFA 3J81j 3PIPA 1PXUA 1A0IA 1I50B 3KF8A 2K05A 2EJFC 1B53A 5M3FB 1K8OA 1HQMC 3A0JA 2F4IA 1HPCA 5IP7G 2QGQA 3DM1A 1UUPA 2HIXA 2DNEA 1SLJA 3ITPA 1JE4A 5JPNC 3A5UA 2ZTEA 3NQTA 4IUQA 3I4NB 3IL8A 4ID6A 1YITA 1G2SA 2OXPA 4IPHA 1ZYRC 1WFQA 3PO2B 1SNOA 1JQYD 2GVBA 3GTGH 3F8TA 1PH7A 3RR5A 4PMBA 3TP6A 1QB5D 1I4RA 1GUTA 1O7ZA 4YY3L 4HJ8A 4YY3Q 1IYUA 2NTTA 3P7JA 2J4XA 3AQQA 4RA8A 1BBUA 3C3LA 4L5QA 4GLXA 4C1NI 3CD6A 4DV5L 1I6HB 5IWAL 5ELOA 5M5WB 4DV5Q 5JOBA 4RCNA 5IWAQ 3SK8A 1HZAA 3SVMA 5I2XA 2JA6H 1WTOA 1GM5A 4JBMA 5EKKA 1LTTD 2YU9B 3QIAA 5C4XG 1LTLA 3R8BA 2NVTB 2E8GA 3NQIA 4PV1C 1NNXA 3VR4A 3GTPH 4IOAA 2A6HC 1HCZA 3P1HA 4F87A 2VL6A 4UY8C 2HCCA 1QVFA 4O0AA 1JJCB 4R8NA 3RZDH 5NUCA 1I3QH 2KCNA 5ELCA 1B44D 5FLXE 4J8QA 5KRUA 4JI2L 1BBWA 3WOFA 2RHQB 4JI2Q 4P75A 4HMJA 4BBSH 2AKWB 4OONA 5FOBB 4DK6C 2WKDA 1B70B 1RL2A 2SNSA 5AJ3L 3BDLA 2C9OA 4ZKBB 4CDFC 1Q86C 1E0BA 2PO4A 2NN6H 4TVAB 5AJ3Q 4JC0A 3CCEA 5C4XB 1D5XC 1SDFA 1Q1BA 2CWAA 3R3OA 1PMRA 4QB4A 1SE4A 4K5VA 1K8MA 2L12A 3NK9A 4RWSC 2RF4A 4DNIA 1YNNC 1JC7A 3F2BA 2UXDL 1H9MA 1JCKB 3O13A 1CA6A 2F4VL 2UXDQ 1EY7A 1RTOA 3CC7A 5D3DA 1EY6A 2F4VQ 5C4HA 1LT4D 3ERQA 5HGQA 2CWPA 1XPRA 2HQLA 1SE3A 1C0AA 2HDMA 5T1GA 1VS0A 4DAMA 4C3IG 1RODA 4A3EB 5EBDA 1CQVA 1L0XB 5FO9B 2EY2A 1Y1VG 3RNUA 1V1PB 4DXGA 1LTGD 2EQSA 1KIXA 1B3AA 2A68D 2OCEA 4IN3A 5IYBH 1QUQB 3S1QB 1ZEQX 2E2DC 5T1IA 2DGYA 1RJTA 2F0PA 5JVG3 4UP9A 2KVMA 2PZWA 1XPOA 1A63A 1SMYD 2F0TA 3TDQA 5DEHA 3H0GH 4C3IB 1CI3M 1K3RA 2MGSA 1M4VA 3BZDB 2YTYA 4DAYB 1Y1WG 3EROA 2JA9A 3SDZA 4WJWA 3S15H 2NWGA 1MSHA 5CR3A 4LF6Q 4A3KG 2FMCA 3FMCA 4A3DG 4KHVA 4APVA 5C0XG 1YEZA 1BCPB 1C9OA 1KRSA 3BYYB 1HQRD 1WI5A 2HQEA 1DJRD 1VQGA 1HUNA 2KQ3A 4LNQA 4WORA 2RCFA 3HOXB 1PHJA 5JJIA 1YHAA 2Z6KC 4DR5L 3NE5B 3GTQB 1SYEA 4DR5Q 3KLWA 4BY7G 2NZ1D 1A15A 2JA7G 1PTOD 1NTGA 1Y1WB 4BBRH 4DN4M 5M9OA 1ENAA 5HGTA 3BDCA 2DJGC 3MZ5A 3MHBA 3U58A 1V8QA 2ICEC 1QZHA 1AW7A 2RDGA 1IHZA 4A3DB 3D6WA 4AIMA 3JAMi 1Y14B 1KDBA 1ESRA 3HOZB 4GOPB 4KN7C 4QUCA 1KNAA 5D65A 1I4PA 4KI0A 1A3VA 2Z9HA 4XIGS 1K73C 1MD2D 4P72A 1IW7D 3JC66 1FVIA 5FJ8H 4BY7B 1KAWA 1LTID 3K7AH 5KNCA 2IY5B 1VQ8A 2JA7B 3KF8B 1NJIC 3MXPA 3DEOA 1S5FD 2X6GA 1BUVT 5M5YH 5IT9L 2CCZA 5CV4A 4QIWB 1U9RA 1AZPA 1W6KA 1B50A 2E5LL 3SK4A 4JV5L 3PUVA 1HR0L 2Z6KA 2E5LQ 4JV5Q 1HR0Q 1QWYA 2RBMA 3KYHC 2JQOA 1XXGA 2F0UA 4IURA 4A3CG 4A3MH 1O7LA 4HIOA 3KLRA 1GUNA 3D4WA 1B7YB 1LABA 4J6HA 2KOLA 4H13C 5IYDG 2OTJA 3CF5A 1YNJD 4A93G 3TEHB 2NVXH 2Y0SG 1K3BC 4A3IH 2AWOA 5J39A 3U9OA 3GTMH 4H44C 2EDGA 2WFWA 3F2UA 3I56A 1PTOH 4IALA 2NYZD 2N88A 4G57A 5ELFA 1STAA 3S24A 4AYBE 5M3MG 2DY8A 3I55A 2J0TD 1D6EC 4ZUIA 3CHBD 3ND8A 2I5MX 3W1BA 2B8FA 3ICEA 3KUPA 2NBFA 3L7ZC 2F0DA 1EY8A 2ZXOA 4QL5A 5GAGC 4CHTB 4DFAA 4I7ZC 5CBAE 3PUXA 4HAEA 1OXUA 4A93B 4ZQ3A 4CKCA 4L5SA 1SAPA 1KAAA 2MO0A 3S9WA 1KTKA 4J15A 2ZTDA 1EIHA 4A3JH 2PPBC 2R7FA 1STBA 2EXDA 3AMUA 2F0VA 2KHIA 4I7AA 2AUKA 3MXUA 4POGA 2VY3A 5M3MB 2G9DA 1TS5A 4RGTA 2EY1A 2A6ED 4FP5D 1H9SA 3DMUA 1WTHA 4OIJA 4HIKA 1DYQA 4N8X1 2JA8G 3EQLC 2Z0SA 4YCVA 4DU9A 5KIXA 1BCPF 1Z7TA 3BG3A 2NTSA 3PO3G 1IZ6A 2PQAA 5I2YA 4X6AH 3PUZA 3MC0B 1DCZA 2JN4A 4XQQA 1Z6HA 4RHRA 2N55A 4C3JB 3UE0A 3TZDA 2F0FA 5J3BA 1OO9B 2IX1A 4Z9CB 4LF8L 1HH2P 4RMFA 4X64L 3TSSA 1DOKA 1ET9A 4LF8Q 4K8JA 4X64Q 2VB3X 1K8GA 3CCLA 3QOLA 4X3KA 2Z4IA 1Q7YC 3H6MA 1JWSD 4FXGC 3SE0A 1SFOH 1WTXA 2JA8B 2EYJA 4L5RC 1UEAB 3JAMc 4TSSA 1JORA 4A3BG 2DN8A 4BWGB 3IAYA 2EVBA 3TREA 3PO3B 3J80L 5FO7B 5G3LF 4OHJA 4RGOS 2K5VA 1TKWB 1JOKA 1FNUA 3KF6A 3UDIA 3NTIA 3HOUG 3M4OH 2UU9L 1G51A 2JP1A 3C2PA 2UU9Q 1G8ZD 1G2TA 1VQPA 1PVOA 3WWVA 5C44H 1SYCA 1CHQD 3DWQA 4Y7NH 1WD1A 2KBNA 2IPKD 1TS2A 3A8JE 2CW0D 3U9SA 2JE6I 2B2YC 3NEMA 1WCMG 1EY4A 1K83H 4PQXA 4A3BB 1XTCD 2IWHA 5D3IB 1WD0A 1NR2A 4CDCC 1EQRA 3Q23A 4DAPA 3L3OC 4OWWB 1LYLA 1VQMA 3HOUB 2F0JA 1C7YA 1VQ6A 2PZTA 3S2HB 5LMNL 4O2DA 2E2HH 4F88A 1PA6A 1AN8A 1CM9A 5ELNA 2E2IH 3W3AA 4O42A 3TS0A 4CGYB 1IYVA 3L9AX 3GTLB 1H9JA 1GHJA 2Z4HA 4WJ3M 4UHVA 5DNFA 4GNXC 4AQYL 4J1MA 1QCBD 2Z1CA 1WCMB 2R7ZB 3D8GA 3UE1A 1QVGA 2XSCA 1MI2A 2A5HA 4AQYQ 4QQBX 3RZOH 3HS0C 3SHLA 3FKIG 1A2UA 1CSPA 2IHFA 1A3UA 4RKLA 2O4XA 3M7GA 4JI5L 2I07B 1PZKD 3CQZB 1HTLD 2BH8A 3VYUA 4JI5Q 2R93G 4M8AA 1AP0A 3SGIA 1VQDA 5CV5A 2AUJD 3HOWG 3VDYA 1DOMA 4JYAL 1Y8OB 1FGUA 4PG3A 2PI2E 4QJFA 3OTOL 4JYAQ 1LM0A 4L6TB 1VMPA 3KDFA 3OTOQ 4DNTB 4C3HH 5IP7H 3CCSA 2WB1G 4RFBA 3K5MA 2ZJPA 4M1UB 5JJZA 5C4JH 1HUMA 1HNZL 3LWEA 3U50C 2B3GA 5C3EH 4DK3C 4A76A 2BH2A 1H9RA 2MQHA 1HNZQ 1CFMA 2KCCA 4DNRB 4E6IA 3KLSX 2QF7A 4N9PA 2R7DA 1TY2A 2E74C 3OW2A 1E24A 4CDDC 1EU3A 1SNDA 2SDFA 3HOWB 2BE5D 4RAUC 4IPGA 1TWHB 1EWHA 4OELB 5K36H 2JYOA 1EQVA 5E7NA 5JJKA 3D0FA 2F0NA 4HR7B 3M85A 4A3LG 1MBYA 4WRDA 1SE2A 1D5MC 4OGQC 4POFA 1Z9FA 5C5MA 4B3SL 2Y0SE 2A19A 2M9VA 2PMZB 5C0XI 4B3SQ 3P20A 4G7OC 2H1EA 1SBBB 3S14H 3I7FA 2OF1A 1X3PA 3GD7A 5EJWA 3J7ZC 1HZ9A 4HJ9A 1TR5A 2Q8IB 4UP7A 4KTAA 1AH9A 2ZJRA 3I73A 1CK1A 2EJMA 3M4QA 2XWJB 2BDOA 4UPAA 4FXKC 4IFDG 2F0OA 2X6LA 1YHBA 1TWFH 1EEFD 1HRJA 3T53B 2ALYB 4JVZA 5IE8A 3G71A 2BA0A 1FNWA 4GN4B 3BS1A 1KLGD 2WIIB 2OQKA 5ELEA 1R4QB 3OMGA 1VMCA 2O5IC 4DV6L 1IBKL 3PO2G 4QY7A 3HRZC 2ENBA 1STNA 4RHSA 1WTVA 1NY4A 4DV6Q 1SYDA 1IBKQ 2RHSB 4Q5VA 1F2MA 3MXNB 4C2MB 4R4TA 2PNRC 4JBWA 4ZK9B 3A54A 1Q46A 2XRSD 4PNYA 1STYA 2D0OA 3K8AA 5IGEA 4XQJA 2VUMG 4P2CB 2V1CC 2KUMA 1D5ZC 4BS9A 3S1RH 2IW3A 3GTOB 4HMIA 1H9SB 3OPOA 3PGZA 1NMFA 5CGKA 3HOVG 3DHQA 1VQJA 3RN2A 2WAQE 5JEAJ 3Q0AA 4OO1I 1RHPA 1ESFA 2PQAB 1JE5A 1I4GA 2AMCB 5IT9E 1QG7A 4B3ML 4TQUS 1BR9A 3K6OA 4K6LA 1PZID 2SEBD 4B3MQ 1I6VC 2C5CA 1J6QA 3T1HL 3U4ZA 1BO0A 4XXEA 3GTKH 2Q8RE 3T1HQ 2F0EA 1TWGH 5FLMG 2VUMB 2K5QA 1TS3A 1Y1VH 1GUOA 3NBIA 3I4MB 1QE6A 2AQ3B 4R1JA 1PRTF 4IO9A 2NVQB 2HD3A 4LW1A 2QDBA 4NP5A 1X56A 3VYSA 3CKIB 3CMEA 3HOVB 1IBLL 4BXXG 2QCPX 4RCOA 4DUYL 5GADC 1H9KA 2KECA 1IBLQ 1KDCA 3G6EA 4DUYQ 1R9TH 5DAUA 3BDOA 5KYIA 1VQEA 4KK7A 1OXVA 1QNUA 4YWMA 4FVMA 5LL6S 3KF6B 3GTJH 3PIO3 1X3FA 4RGNA 4NB3A 3SXHA 2ASBA 3E9IA 1WVLA 1JJGA 2R92H 2DUDA 1P16A 5GQOA 2YTXA 2B2TC 1L1OC 4GLAC 4RGMA 5KNDA 1CKMA 1D1KA 3S2DB 4A3KH 1PYSB 5C0XH 4EQPA 2HHHL 2G5DA 2VXWA 3S17B 2SNMA 2MFIA 1HXYD 2JJQA 2HHHQ 3S1NB 3ND9A 4KLKA 5A2QL 4ZUJA 2KENA 4FF2A 1TWCB 4A3EG 2L1BA 1UE7A 1S72A 1STHA 2RQXA 4A3FH 1PH1A 4R9WA 5GAEC 2F0LA 4IZ8A 4UP8A 1II3A 2CVRA 2JA7H 2DJFC 1X65A 2PNHA 3NUCA 3I4LA 2K01A 4CJ2C 2L15A 3VR5A 1A6XA 4KMUC 1AE3A 2EYMA 2E75C 3CP0A 5BR8L 1ICWA 3OHXC 1GO3E 3CCUA 3MEFA 1FL0A 5BR8Q 1LACA 4LUZA 3K5NA 2Q2IA 1N34L 5J1ZA 5LMUL 2OTLA 4NKLA 1PTOC 2N8NA 3NXWA 4FNFA 1N34Q 4X62L 5LMUQ 3A55A 2EIFA 3W1GA 1SRUA 2I46A 2IT1A 1VQ7A 3CCRA 4X62Q 2B2TA 4BY1B 3UDXA 1L1OA 2WB1E 1JT8A 3CW2C 5I6WA 4IUUA 1VQFA 2K5DA 5EKLA 3QR8A 4LWCA 4FO2A 3J80E 4EVOA 1E22A 1F2LA 3DWPA 1IW7C 2M2LA 3S16H 1JWUD 1PRTC 4XT3B 2EYLA 1IKMA 1SNQA 1E2ZA 2IX3A 3HOXG 3TP5A 1E1TA 4LF5L 1W6JA 3M4PA 3KLSA 4A3CH 4OO1H 1VQIA 3P75A 4LF5Q 1YI2A 1CZGA 5C3WA 4GN3B 3TN2A 4ABNA 2A8VA 3GDEA 3QG1A 1TU2B 2UUAL 3RLOA 2FINB 3J81i 1MSGA 1O7IA 3D4DA 2JA6G 2K32A 2UUAQ 1FJGL 4XT1B 1EIFA 3GTGB 1VF7A 4GNXB 1FJGQ 2QILA 4DGZA 1N9WA 2VS1A 3TBIB 5LL6X 1ONLA 1QILA 1S40A 3NSWA 3HOZG 2YTVA 2JEBI 3T51B 2L9HA 5A35A 5KNBA 2QA4A 3CCQA 1XYIA 2K5NA 3CMAA 3QB3A 3J7A5 3Q22A 3H91A 3STBD 3W2DA 1TWAH 1CKNA 4BBSG 3G4SA 3BU2A 1VCIA 2C35B 4F8MA 1CTMA 1K9MC 2JA6B 3J81L 1LTBD 2ZXPA 2RDFA 3ZJYC 3J7YW 3NBHB 2NN6G 4EQOA 4Y52H 5FKAC 3GTPB 2Q2UA 1IL8A 3HKSA 1VQCA 1V43A 3RZDB 3GV3A 5IP9G 1I3QB 4PMWA 2CQOA 1EU4A 1B4OA 4JBKA 2B29A 3NP8A 1GHKA 4XYOA 1U4PA 4N9TA 2NVYH 4BBSB 5HURA 2P5ZX 5IYCH 3AFPA 4DR6L 2A6EC 4KHZA 3VA7A 4DR6Q 2B2WC 2XIWA 3RD4A 1I4XA 4EQ5A 1RCVD 4DV3L 4P73A 1FD7D 1PH4A 3HKZG 4DV3Q 1I4QA 3D31A 3KBXA 2B63H 3JAML 1WYDA 2RA4A 5EKIA 3KJPA 1JR0D 4P74A 2KCMA 4QCLA 3MFGA 3MVVA 2E2JB 1GUWA 2A73B 5IYBG 3H3VI 3K7UC 5D14A 5IGFA 4KD3A 4B9WA 2HDLA 2XGTA 3HOUH 5KYLA 3ZYYX 1FGBD 2RKSA 1T5EA 2FXQA 2ZXRA 3H0GG 1G91A 2B2VC 4L63B 4DPGA 3HKZB 4DUZL 1JMCA 4OL7A 4DUZQ 2Q2HA 4H0LC 2RVLA 1CUKA 4KKTA 1D8LA 1WOCA 3HZXA 5CC4A 4DV0L 2H5XA 4YWLA 2OT2A 1SNMA 2B2WA 1KC8C 4DV0Q 4LK1C 2CHBD 4C3JG 1SEBD 1SN8A 2F3VA 3CU7A 4LAAA 4LUVA 3BJUA 1SXTA 4IUNA 3J81c 2EYFA 4IPCA 2N78A 5FLXL 1G6PA 1E7ZA 2MO1A 2CW0C 1EIYB 4C1NK 1C48A 1PFMA 1LT3D 3PUWA 4GLVB 3V96A 1OXTA 3I70A 1R4PB 1EWCA 5FO8B 2AHOB 4LF4L 1LTSD 1EOTA 3AB9A 3H0GB 4LF4Q 3QO2A 2M00A 1LTAD 2X69A 2OEOA 1SJED 1YJWA 1VQKA 2D2CC 3C1FA 1K28A 1PFNA 3S1MH 4HJ5A 1EYDA 1VQHA 4DR3L 2RSNA 3S15B 3A7AB 4TKOB 4DR3Q 3EFXD 3J7AV 4H02A 4KY6A 1ILQA 4B9XA 5M5XH 4HJAA 1S5CD 3FKIH 4A3GH 4N8FA 2O5JC 2OQ0A 1NE3A 4JG2A 2B2VA 3LX0A 2R93H 3CCJA 1BBXC 2K28A 1NBWA 2EYOA 4KJOA 5FJ8G 1KABA 2F0IA 4JI4L 4V190 4ME5A 2E76C 4JI4Q 3GQBA 5IGDA 4A4IA 4IJHA 3E9HA 2B8GA 3PQIA 3PF4A 2BA1A 3FHWA 1S5ED 3J7AF 5I4DA 2EZVA 5AFWA 1HFNA 3Q8DA 2F0QA 4KY5A 4HTHA 3NHHA 1HJPA 2XWBB 1P8LA 1VQ9A 5EPKA 4A3MG 2Z6BA 4MZ9A 1LUZA 1W2BA 3R93A 1EIGA 4ZCKA 3Q24A 4YCWA 2ATWA 5IGCA 3L0OA 1L1OB 1EY9A 1SYBA 5H1SE 3HEJA 3K7AB 5JVH3 4IOCA 4YCUA 1DM0B 2IL8A 1EZ6A 2XRQD 1BXTA 3WOEA 5DM73 4A75A 2R7ZG 5M5YB 1ET6A 3M3YH 1Y69U 4K14A 4A3LH 4IPDA 4LFCL 4HSPA 4KJNA 3HOYH 1U0LA 4LFCQ 2BE5C 1PDQA 4LFAL 5KEEA 2BCOA 3H3VH 2K5HA 3PF5A 4A3MB 1I50H 5FK9C 4LFAQ 4GKKL 5CV9A 5FLXc 4MN3A 4GKKQ 1CKOA 3N6RA 2A69D 3FPUB 1D2BA 5LMNQ 2PW7A 5M3FH 3AEVA 4CKEA 4A3IB 4CDEC 3ERSX 1S3OA 3GTMB 2LKVA 2KJXA 1PTOB 1PFSA 1BVSA 2O2LD 1YJNA 3CPFA 3LWUA 4K6DA 3I4NH 3AFQA 2F0SA 4QIWE 3T1YL 3HGBA 1XWEA 3PO2H 3W5OA 2NZOA 2JA5G 1O7YA 5C4ZA 3T1YQ 3CRKC 1B3QA 2EYHA 2D9UA 3QJYA 1MJCA
chains in the Genus database with same CATH topology
2DY7A 4G7ZC 2KEEA 1KNEA 4CJ1B 3MXGA 1O78A 1SSOA 1PRTB 4A3JB 4DK0A 3A8IE 1CZWA 3DEPA 4ODGA 2FMMA 3PUYA 4U68A 2F0GA 2JA5B 1NSNS 2F1MA 4HCEA 2EJGC 4EQNA 3OIQA 3V05A 2K5WA 3T16A 3A8KE 5F2DA 2BDNA 3GV6A 5LHY1 1JOQA 3A56A 4XDXA 5EBCA 2LY7A 1TIID 1GXDC 1SFOB 1C8CA 1DZ1A 3TMEA 2EYPA 2YYZA 1TT2A 5J22A 3M4OB 1F9SA 1SNCA 2XVSA 1NUCA 2WINB 1BCPD 4CBVA 1WTWA 1CA5A 5C44B 4HN7A 3K59A 1CQFA 4X3TA 1WTQA 4ZAIA 4ILWA 4DA2A 1K83B 4IUVA 1STEA 3BVMA 1D1IA 4HEDA 4KKUA 1IKLA 1CT1D 4G7HC 3EVQA 4K2KA 1A3TA 1J9OA 4ULLA 2IX0A 1E2WA 2E2HB 2E2IB 1PTOF 2B2UA 2R61A 4DXFA 5KGUA 5G3LD 1DOLA 3OIPA 2FHTA 4NW2A 4C3HG 3I91A 4DF7A 5ELDA 1ENFA 5BN3A 2K1BA 3GO5A 2TSSA 3RZOB 2PQEA 1HTPA 2GA4B 3NTKA 2Q8TA 3JAME 1FYCA 1EL0A 1Z47A 4NDXA 3VA5A 1HA6A 4K2LA 3SK6A 2K03A 3T13A 1F9PA 3NTHA 5K36G 2L5TA 5I9PA 1LTRD 1KDAA 1AFPA 4C3HB 3R2IA 5C4JB 3PIP3 4FF1A 5C6AA 5C3EB 3FPPA 1PFBA 2A68C 1RD9D 5E4WC 4YIJA 1STGA 5CORA 4UDUC 1KLUD 3IKJA 5IGGA 5EPLA 2ID0A 1SMYC 3OW7A 3PV0A 5CYUA 2RSOA 3WDNA 3T4AC 3HG9A 5JEAG 1ENCA 5JPMC 1TVXA 4UAIA 4FF4A 2L55A 1JB3A 4AYBB 3S14B 1PYWD 1BQQT 2D62A 3ONAB 2B39A 1NR4A 2F0WA 3VYRA 3D6CA 3RMHA 2EY6A 2CQAA 3EJIA 4HCSA 5IODA 1T5XD 1ZYRD 1EY5A 1MGSA 1X3QA 2H4OA 4QUFA 3R2TA 1WTRA 3N52A 1TWFB 2AQ2B 3K57A 2AWNA 4KN4C 3K5LA 5C0XJ 3NWSA 1V1OA 5CV6A 2XN9C 1PLFA 3AU7A 2SOBA 3SEBA 2NUCA 4ZRZA 5COYA 5E4XA 1SNPA 1TS4A 3BYTB 4RH6A 3E5SA 2VNUD 1GOZA 3X3NA 1AZQA 3FVQA 3S1RB 2A6HD 1E2VA 3E6ZX 1F2ZA 5CMDA 1EFID 4NMZA 1X32A 4LJZC 3MAQA 3VR3A 1C4QA 3KK7A 1FR3A 3GTKB 1YNJC 1RF2D 5C5LA 2FFKB 4QF4A 4XTCS 4TRDA 3PMFA 4BA2I 1TWGB 1U4MA 1F2YA 1Y1VB 3SK5A 1SYFA 5ELBA 1PZJD 5CV7A 1LV9A 2TMPA 2DNCA 2G9HD 2V4DA 1VF5C 3URYA 2LS01 3MWYW 1F9QA 3OMCA 5DM63 2IJ0A 1YNND 4V0BA 2F0MA 1ML0D 1R9TB 1ZKOA 2EE1A 2PYKA 2WV6D 1F9RA 5JAVA 3I8ZA 3V2TA 2F0HA 3GTJB 1M8AA 5E3FA 1RKNA 3A7LA 1Q3LA 2R92B 1BDOA 2F03A 1HA5A 1DONA 2EOTA 3M4YA 2HUGA 4R8IA 4A3KB 1RTNA 1G291 4ZYSA 5C3XA 3RLFA 1UAPA 3C1EA 2L11A 5EPJA 1PRTD 3DUZA 4A3FB 3RUZA 3H3VC 1GUGA 3CRLC 3NWTA 4RKBA 4G4KA 4Q0FA 4DAVA 4B08A 2BOSA 2L4NA 1U4LA 2K7VA 4KV6A 3MTSA 4X3UA 3SR1A 2ZT9C 5CV8A 1NAPA 3GP7A 1SYGA 4OO1G 5E1FA 1Y8PB 2JSOA 4IFDI 1NCVA 1DXMA 1GJXA 1EYAA 1AEXA 3C46A 1RDPD 2R3ZA 3VR6A 1TQOA 2KEDA 4FF3A 1S4ZA 2MHVA 3VYTA 3S16B 1OXXK 4DK1A 2MP1A 4K8IA 2D5DA 3MXNA 1L0YB 2PCFB 3VR2A 2FJ2A 2Y0SB 1QOHA 4S3SA 5EQ0A 4PMCA 5I6YA 1U4RA 1EQTA 2JEAI 3M7NA 3G6JB 4FYDA 1JICA 2MPMA 5BN4A 2A69C 3K0YA 2JXMB 1EEID 3TP7A 3HP3A 3TZUA 1EZ8A 1FNVA 4I65A 1TWAB 3MEHA 4LMQD 4QMGA 1Q1EA 4BBRB 3I3CA 1J8IA 4CJ0B 4XYQA 1A2TA 1B1ZA 1Q90A 1S5BD 3H09A 4GZYC 3I90A 5K5PA 2WP8J 3NPPA 4ZKCB 4IUPA 4IUTA 2NVYB 2XNAC 3X3MA 3D4RA 2VB2X 1SJHD 3DWAA 3TP8A 3OSOA 2WAQB 4O1NA 5ISRA 1B9MA 1EY0A 4F7XA 1LLRD 2B63B 2LMCB 2PW5A 3IFDA 1OXSC 3FDTA 1Y8NB 4MHEA 3K5OA 3E0JA 3OWFA 3KBGA 2NVXB 1ZXTA 1LT5D 1QJOA 3FRPB 3IFTA 3LNNA 2R6GA 1JWMD 4IFDH 1LT6D 3EA6A 5A2QE 2QEJC 3OWEB 1BOSA 2MUYA 3H94A 1EYCA 1I4HA 2Z8LA 4FXDA 1DD2A 4C56C 4KD4A 3MFYA 2NB0A 1QNKA 4WFN3 2K6AA 3I72A 3Q6SA 4HSVA 1BCPC 4MIUA 2K33A 1UNSA 2EXZA 3MA2B 3K58A 1WTPA 4KY7A 1V1PA 3BVGA 2B2YA 4IFDJ 1GUSA 1HFGA 3QOJA 2AQ1B 1TY0A 1Q12A 4BA1I 4OIKA 4KKSA 3S1MB 4IQZA 4H7BA 5IGBA 5M5XB 3FKIB 4A3GB 1ILPA 5CBEE 1JOOA 1G6ZA 4DAYA 4CKBA 1HHVA 2R93B 1LO5D 5EGTA 2KA7A 1O80A 1XX8A 1BNZA 4U673 1CHPD 2WACA 5TSSA 2B2UC 3OOCA 4EGVA 5IOCA 2L0CA 3DXJC 2WB1B 2HCIA 2PZUA 4ZLTF 3BVZA 3D3RA 3FEWX 2F3WA 2A74C 4X3SA 5I9OA 4K5WA 2EPBA 2KHSA 5BN5A 2NN6I 1BF4A 2K04A 3UI2A 4JK1C 1F77A 4XQNA 4L8JA 3NBHA 4Y7NB 1VDZA 2ICIA 2LFNA 1S5DD 2MJ8A 2QKIC 2RDHA 2J7ZA 1B9NA 3J81E 2F0KA 3M3YB 5JEAH 3T56B 4K5XA 2WKCA 3HOYB 1B2TA 2EY5A 3G7LA 3QWNA 1Q8IA 5IIFA 1PXUA 1I50B 3KF8A 2K05A 2EJFC 1B53A 5M3FB 1K8OA 1HQMC 2F4IA 1HPCA 3DM1A 1UUPA 2DNEA 3ITPA 1JE4A 5JPNC 3NQTA 4IUQA 3I4NB 3IL8A 4ID6A 1G2SA 2OXPA 1ZYRC 3PO2B 1SNOA 1JQYD 4PMBA 3TP6A 1QB5D 1I4RA 1GUTA 1O7ZA 1IYUA 2NTTA 3P7JA 2J4XA 4RA8A 3C3LA 4C1NI 1I6HB 5M5WB 5JOBA 4RCNA 3SK8A 3SVMA 5I2XA 1WTOA 5EKKA 1LTTD 2YU9B 3QIAA 3R8BA 2NVTB 3NQIA 4PV1C 3VR4A 2A6HC 1HCZA 3P1HA 4F87A 2HCCA 4R8NA 5NUCA 2KCNA 5ELCA 1B44D 5FLXE 4J8QA 5KRUA 3WOFA 4HMJA 5FOBB 2WKDA 2SNSA 3BDLA 2C9OA 4ZKBB 1E0BA 2PO4A 2NN6H 5C4XB 1D5XC 1SDFA 1Q1BA 3R3OA 1PMRA 4QB4A 1SE4A 4K5VA 1K8MA 2L12A 3NK9A 4RWSC 1YNNC 1JC7A 1H9MA 1JCKB 3O13A 1CA6A 1EY7A 1RTOA 5D3DA 1EY6A 5C4HA 1LT4D 3ERQA 1SE3A 2HDMA 5T1GA 4C3IG 1RODA 4A3EB 5EBDA 1CQVA 1L0XB 5FO9B 2EY2A 1V1PB 4DXGA 1LTGD 1B3AA 2A68D 4IN3A 3S1QB 1ZEQX 2E2DC 5T1IA 1RJTA 2F0PA 5JVG3 2KVMA 2PZWA 1SMYD 2F0TA 3TDQA 5DEHA 4C3IB 1CI3M 2MGSA 1M4VA 3BZDB 3EROA 3SDZA 4WJWA 2NWGA 1MSHA 5CR3A 2FMCA 3FMCA 4KHVA 5C0XG 1BCPB 3BYYB 1HQRD 2HQEA 1DJRD 1HUNA 2KQ3A 4WORA 3HOXB 3NE5B 3GTQB 1SYEA 2NZ1D 1A15A 1PTOD 1Y1WB 4DN4M 5M9OA 1ENAA 5HGTA 3BDCA 3MZ5A 3MHBA 1V8QA 2ICEC 1AW7A 2RDGA 1IHZA 4A3DB 3D6WA 1KDBA 1ESRA 3HOZB 4KN7C 4QUCA 1KNAA 5D65A 1I4PA 4KI0A 1A3VA 4XIGS 1MD2D 1IW7D 4BY7B 1LTID 5KNCA 2JA7B 3MXPA 3DEOA 1S5FD 2X6GA 1BUVT 5IT9L 5CV4A 4QIWB 1U9RA 1AZPA 1W6KA 1B50A 3SK4A 3PUVA 1QWYA 2RBMA 1XXGA 2F0UA 4IURA 1O7LA 3KLRA 1GUNA 3D4WA 1LABA 4J6HA 2KOLA 4H13C 1YNJD 2AWOA 5J39A 3U9OA 4H44C 2EDGA 3F2UA 1PTOH 4IALA 2NYZD 2N88A 4G57A 5ELFA 1STAA 2DY8A 2J0TD 1D6EC 4ZUIA 3CHBD 3ND8A 2B8FA 3KUPA 2NBFA 3L7ZC 2F0DA 1EY8A 2ZXOA 4CHTB 4DFAA 4I7ZC 5CBAE 3PUXA 4HAEA 1OXUA 4A93B 4ZQ3A 4CKCA 1SAPA 1KAAA 3S9WA 1KTKA 1EIHA 2PPBC 1STBA 3AMUA 2F0VA 2AUKA 3MXUA 5M3MB 2G9DA 1TS5A 4RGTA 2EY1A 2A6ED 4FP5D 1H9SA 3DMUA 4OIJA 1DYQA 3EQLC 4DU9A 5KIXA 1BCPF 1Z7TA 3BG3A 2NTSA 5I2YA 3PUZA 3MC0B 1DCZA 4XQQA 1Z6HA 4RHRA 2N55A 4C3JB 3TZDA 2F0FA 1OO9B 2IX1A 4Z9CB 3TSSA 1DOKA 1ET9A 4K8JA 2VB3X 3QOLA 4X3KA 2Z4IA 3H6MA 1JWSD 4FXGC 3SE0A 1WTXA 2JA8B 2EYJA 1UEAB 4TSSA 1JORA 2DN8A 4BWGB 3IAYA 2EVBA 3PO3B 3J80L 5FO7B 5G3LF 4OHJA 4RGOS 1TKWB 1JOKA 1FNUA 3NTIA 2JP1A 3C2PA 1G8ZD 1G2TA 1SYCA 1CHQD 3DWQA 1WD1A 2IPKD 1TS2A 3A8JE 2CW0D 3U9SA 2JE6I 2B2YC 1EY4A 4PQXA 4A3BB 1XTCD 2IWHA 5D3IB 1WD0A 1NR2A 3Q23A 4DAPA 3L3OC 3HOUB 2F0JA 2PZTA 3S2HB 4F88A 1AN8A 1CM9A 3W3AA 4O42A 4CGYB 1IYVA 3L9AX 3GTLB 1H9JA 1GHJA 2Z4HA 5DNFA 4J1MA 1QCBD 2Z1CA 1WCMB 2R7ZB 3D8GA 2XSCA 1MI2A 2A5HA 3HS0C 3SHLA 1A2UA 1A3UA 4RKLA 2O4XA 3M7GA 2I07B 1PZKD 3CQZB 1HTLD 3VYUA 4M8AA 1AP0A 5CV5A 2AUJD 1DOMA 1Y8OB 4L6TB 1VMPA 4DNTB 3K5MA 4RFBA 4M1UB 5JJZA 1HUMA 3LWEA 1H9RA 1CFMA 2KCCA 4DNRB 4E6IA 3KLSX 2QF7A 4N9PA 1TY2A 2E74C 1EU3A 1SNDA 2SDFA 3HOWB 2BE5D 4RAUC 1TWHB 1EWHA 5K36H 2JYOA 1EQVA 2F0NA 4HR7B 3M85A 1MBYA 4WRDA 1SE2A 1D5MC 4OGQC 5C5MA 2M9VA 2PMZB 5C0XI 3P20A 4G7OC 2H1EA 1SBBB 2OF1A 3GD7A 1X3PA 5EJWA 1TR5A 2Q8IB 4KTAA 3I73A 1CK1A 2EJMA 2XWJB 2BDOA 4FXKC 4IFDG 2F0OA 2X6LA 1EEFD 1HRJA 3T53B 2BA0A 1FNWA 3BS1A 1KLGD 2WIIB 5ELEA 1R4QB 3OMGA 1VMCA 2O5IC 3HRZC 2ENBA 1STNA 4RHSA 1WTVA 1SYDA 4Q5VA 1F2MA 4C2MB 2PNRC 4JBWA 4ZK9B 3A54A 2XRSD 4PNYA 1STYA 5IGEA 4XQJA 4P2CB 2KUMA 1D5ZC 4BS9A 2IW3A 3GTOB 4HMIA 1H9SB 3OPOA 5CGKA 3DHQA 5JEAJ 3Q0AA 4OO1I 1RHPA 1ESFA 5IT9E 1I4GA 1QG7A 4TQUS 1BR9A 3K6OA 4K6LA 1PZID 2SEBD 1I6VC 2C5CA 1BO0A 4XXEA 2Q8RE 2F0EA 2VUMB 2K5QA 1TS3A 1GUOA 3NBIA 3I4MB 1QE6A 2AQ3B 1PRTF 2NVQB 4NP5A 2QDBA 3VYSA 3CKIB 3HOVB 2QCPX 4RCOA 1H9KA 2KECA 1KDCA 5DAUA 3BDOA 5KYIA 4KK7A 1OXVA 1QNUA 4FVMA 5LL6S 3PIO3 4RGNA 3SXHA 1WVLA 2B2TC 4RGMA 5KNDA 1D1KA 3S2DB 5C0XH 4EQPA 2VXWA 3S17B 2SNMA 3S1NB 1HXYD 3ND9A 5A2QL 4ZUJA 4FF2A 1TWCB 2L1BA 1STHA 2RQXA 4R9WA 2F0LA 4IZ8A 1II3A 2CVRA 3NUCA 3I4LA 2K01A 4CJ2C 1A6XA 3VR5A 4KMUC 2EYMA 2E75C 1ICWA 3OHXC 1LACA 3K5NA 5J1ZA 4NKLA 1PTOC 3NXWA 4FNFA 3A55A 2I46A 2IT1A 2B2TA 4BY1B 5I6WA 4IUUA 2K5DA 5EKLA 4FO2A 3J80E 4EVOA 1F2LA 3DWPA 1IW7C 2M2LA 1JWUD 1PRTC 4XT3B 2EYLA 1IKMA 1SNQA 1E2ZA 2IX3A 3TP5A 1W6JA 3KLSA 4OO1H 3P75A 1CZGA 5C3WA 3TN2A 4ABNA 3QG1A 1TU2B 2FINB 1MSGA 3D4DA 2K32A 4XT1B 3GTGB 1VF7A 2QILA 4DGZA 3TBIB 5LL6X 1ONLA 1QILA 3NSWA 2JEBI 3T51B 2L9HA 5A35A 5KNBA 1XYIA 3QB3A 3Q22A 3H91A 3W2DA 1VCIA 4F8MA 1CTMA 2JA6B 3J81L 1LTBD 2ZXPA 2RDFA 3J7YW 2NN6G 4EQOA 5FKAC 3GTPB 1IL8A 1V43A 3RZDB 3GV3A 1I3QB 4PMWA 1EU4A 1B4OA 3NP8A 1GHKA 4XYOA 1U4PA 4N9TA 4BBSB 5HURA 2A6EC 4KHZA 3VA7A 2B2WC 2XIWA 3RD4A 1I4XA 1RCVD 1FD7D 1I4QA 3D31A 3KBXA 3JAML 5EKIA 2RA4A 1JR0D 4QCLA 3MFGA 3MVVA 2E2JB 1GUWA 2A73B 5D14A 5IGFA 4KD3A 4B9WA 2HDLA 5KYLA 3ZYYX 1FGBD 2RKSA 1T5EA 2ZXRA 1G91A 2B2VC 4L63B 3HKZB 4OL7A 4H0LC 2RVLA 4KKTA 3HZXA 5CC4A 2OT2A 1SNMA 2B2WA 4LK1C 2CHBD 4C3JG 1SEBD 2F3VA 3CU7A 4LAAA 1SXTA 4IUNA 2EYFA 5FLXL 2CW0C 4C1NK 1C48A 1PFMA 1LT3D 3PUWA 3V96A 1OXTA 3I70A 1R4PB 1EWCA 5FO8B 1LTSD 1EOTA 3AB9A 3H0GB 3QO2A 2M00A 1LTAD 2X69A 2OEOA 1SJED 2D2CC 3C1FA 1PFNA 1EYDA 2RSNA 3S15B 3A7AB 4TKOB 3EFXD 3J7AV 4KY6A 1ILQA 4B9XA 1S5CD 2O5JC 2B2VA 3LX0A 1BBXC 2K28A 4KJOA 2EYOA 1KABA 2F0IA 4V190 4ME5A 2E76C 3GQBA 5IGDA 2B8GA 2BA1A 1S5ED 3J7AF 5I4DA 2EZVA 5AFWA 1HFNA 2F0QA 4KY5A 4HTHA 3NHHA 2XWBB 5EPKA 3R93A 1EIGA 3Q24A 5IGCA 1EY9A 1SYBA 3HEJA 3K7AB 5JVH3 5DM73 1DM0B 2IL8A 3WOEA 1EZ6A 1BXTA 2XRQD 5M5YB 1ET6A 1Y69U 4K14A 4HSPA 4KJNA 2BE5C 1PDQA 5KEEA 2BCOA 4A3MB 5FK9C 5CV9A 4MN3A 3N6RA 2A69D 3FPUB 1D2BA 2PW7A 4CKEA 4A3IB 3GTMB 2LKVA 2KJXA 1PTOB 2O2LD 3LWUA 4K6DA 2F0SA 3HGBA 1XWEA 1O7YA 5C4ZA 3CRKC 2EYHA 2D9UA 3QJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DY7 A;  4X3S A;  2B2T A;  1ML0 D;  1ZXT A;  2B2V A;  2KVM A;  2KEE A;  1IKL A;  2EPB A;  3ONA B;  2EE1 A;  2SDF A;  1BF4 A;  1NR4 A;  1KNE A;  2B2W C;  1F9R A;  2K04 A;  2JP1 A;  4IUU A;  1BO0 A;  2K28 A;  2FJ2 A;  3UI2 A;  3I8Z A;  2XIW A;  1SSO A;  2MGS A;  4HCS A;  4RAU C;  1J9O A;  2Q8R E;  1G2T A;  2HCC A;  3F2U A;  1M8A A;  1MGS A;  2NYZ D;  2N88 A;  5EQ0 A;  2JYO A;  1X3Q A;  2DY8 A;  2MJ8 A;  1WD1 A;  4QUF A;  1Q3L A;  1QE6 A;  3DEP A;  1WTR A;  2B2U A;  1F2L A;  1U4R A;  2NWG A;  1EQT A;  2M2L A;  2FMM A;  2J7Z A;  3KBX A;  3N52 A;  1MSH A;  4XT3 B;  5EKI A;  2RA4 A;  1DOL A;  2B2Y C;  1IKM A;  1JIC A;  2EOT A;  3KUP A;  2MPM A;  5AFW A;  1DON A;  1HFN A;  2FHT A;  4NW2 A;  2HUG A;  4U68 A;  3I91 A;  1BBX C;  4R8I A;  2KEC A;  1QNK A;  2H1E A;  1WD0 A;  1RTN A;  1GUW A;  1HUN A;  1NR2 A;  3HP3 A;  2K1B A;  1X3P A;  1B2T A;  5EJW A;  5EPK A;  3Q6S A;  5D14 A;  4HSV A;  1PLF A;  3TN2 A;  5CBA E;  3G7L A;  4HAE A;  4ZKB B;  1E0B A;  1SAP A;  2HDL A;  3R93 A;  2FIN B;  1EIG A;  2L11 A;  2NZ1 D;  1A15 A;  1MSG A;  2Q8T A;  1EIH A;  1SDF A;  5COY A;  4LMQ D;  4XT1 B;  5EPJ A;  2K05 A;  3I3C A;  5E4X A;  1J8I A;  1EL0 A;  1WTP A;  1B53 A;  4DN4 M;  2BDN A;  1CM9 A;  3GV6 A;  1WVL A;  2IL8 A;  4O42 A;  4CJ0 B;  2X6L A;  1HA6 A;  2B2T C;  2B2Y A;  1G91 A;  2B2V C;  2K03 A;  1HRJ A;  2L12 A;  1F9P A;  4OIJ A;  4RWS C;  1HFG A;  3DM1 A;  4XDX A;  5DNF A;  1AZQ A;  2RVL A;  2L4N A;  1U4L A;  3I90 A;  1JE4 A;  3D6W A;  1VMC A;  1MI2 A;  2L9H A;  4OIK A;  1ESR A;  3MTS A;  1CA6 A;  1XYI A;  1C8C A;  2B2W A;  4QUC A;  1KNA A;  1RTO A;  4X3U A;  2VXW A;  1PDQ A;  4IUQ A;  5D65 A;  1WTV A;  3IL8 A;  1DZ1 A;  1NAP A;  1G2S A;  5CMD A;  3H91 A;  4ZKC B;  4IUP A;  1PFB A;  4MN3 A;  4IUT A;  2N55 A;  2L1B A;  1X32 A;  1ILP A;  5E4W C;  3TZD A;  1AP0 A;  5CBE E;  3FPU B;  4ZK9 B;  4R9W A;  1O7Z A;  1PFM A;  5COR A;  2HDM A;  5T1G A;  1G6Z A;  1HHV A;  1NCV A;  1ROD A;  2CVR A;  1DOM A;  3DEO A;  1F9S A;  2X6G A;  1DOK A;  1EOT A;  1O80 A;  1XX8 A;  3P7J A;  1BNZ A;  5EPL A;  4CJ1 B;  2K01 A;  3QO2 A;  1IL8 A;  4X3K A;  4CJ2 C;  1AZP A;  1B50 A;  2X69 A;  1VMP A;  2FFK B;  2R3Z A;  2KUM A;  2KED A;  4RA8 A;  1ICW A;  1WTW A;  1CA5 A;  2RSO A;  3GV3 A;  1U4M A;  1PFN A;  1S4Z A;  1WTX A;  1B3A A;  2RSN A;  5JJZ A;  1LV9 A;  1HUM A;  2B2U C;  4X3T A;  3LWE A;  1WTQ A;  4ZAI A;  1B4O A;  4IUR A;  3IFD A;  5T1I A;  1ILQ A;  1O7Y A;  2HCI A;  1TVX A;  4IUV A;  1RJT A;  4ZLT F;  1RHP A;  3FDT A;  4MHE A;  1U4P A;  2KOL A;  2MP1 A;  4UAI A;  3MWY W;  2D9U A;  3SVM A;  1F9Q A;  4HED A;  1QG7 A;  1WTO A; 
#chains in the Genus database with same CATH topology
 2DY7 A;  4G7Z C;  2ZJQ A;  1CKN B;  4DV7 L;  2KEE A;  4DV7 Q;  1KNE A;  4CJ1 B;  3MXG A;  1DGS A;  1O78 A;  1VQ4 A;  1SSO A;  1PRT B;  4LF7 L;  4A3J B;  4OXP A;  4DK0 A;  3A8I E;  4LF7 Q;  1KQS A;  1CZW A;  3DEP A;  2ZM6 L;  4ODG A;  2FMM A;  3PUY A;  3KJO A;  5M5W H;  1I6H H;  2ZM6 Q;  4U68 A;  2F0G A;  2JA5 B;  1NSN S;  3BZK A;  5EAY A;  1QUQ A;  2F1M A;  4DR4 L;  4HCE A;  2YU9 H;  2EJG C;  1XMQ L;  4EQN A;  3OIQ A;  1B8A A;  4DR4 Q;  1IXR A;  2NVT H;  3TQY A;  4LFB L;  3V05 A;  1XMQ Q;  1VQ5 A;  2K5W A;  4LFB Q;  3K0X A;  3T16 A;  3A8K E;  1EUJ A;  3F2D A;  5F2D A;  2BDN A;  3GV6 A;  5LHY 1;  1JOQ A;  1VQL A;  2JK8 A;  3A56 A;  5C44 G;  4XDX A;  4OWX B;  4NPS A;  1PH3 A;  5EBC A;  5L37 A;  2LY7 A;  2N49 A;  1M90 C;  1TII D;  1GXD C;  1SFO B;  1C8C A;  1TXY A;  3EIV A;  4DKA C;  1SRO A;  1DZ1 A;  3TME A;  2I5H A;  5C4X H;  4B3R L;  2UUB L;  2F52 A;  1ASY A;  4B3R Q;  2EYP A;  4IJL A;  2YYZ A;  1TT2 A;  5J22 A;  3M4O B;  1F9S A;  1SNC A;  2XVS A;  3H15 A;  1D7Q A;  1NUC A;  2WIN B;  4OWT B;  1BCP D;  4CBV A;  1WTW A;  1CA5 A;  5C44 B;  2N3S A;  4P71 A;  4HN7 A;  2QW7 A;  4R4C A;  3K59 A;  4HID A;  1CQF A;  4X3T A;  1WTQ A;  4ZAI A;  4DR7 L;  4ILW A;  2GN5 A;  4DA2 A;  1K83 B;  4IUV A;  1STE A;  2D0P A;  4GOP A;  4DR7 Q;  3BVM A;  1D1I A;  3CXC A;  4HED A;  2CH4 A;  1MHW C;  4KKU A;  4A3E H;  1IKL A;  1CT1 D;  1X55 A;  4G7H C;  3EVQ A;  5GAH C;  4K2K A;  4ME3 A;  4R4O A;  3RLN A;  1A3T A;  3I4M G;  1J9O A;  1L2F A;  1WJJ A;  4ULL A;  2IX0 A;  1E2W A;  3AYH B;  1X3E A;  3PIO A;  1KHI A;  2E2H B;  2CH4 W;  1Q81 C;  2E2I B;  1PTO F;  2B2U A;  2CFM A;  2R61 A;  4DXF A;  5KGU A;  3UDG A;  5G3L D;  3CC2 A;  3S1Q H;  1DOL A;  4R4I A;  3OIP A;  1PH6 A;  1KL9 A;  2FHT A;  4NW2 A;  4C3H G;  3I91 A;  4DF7 A;  5ELD A;  1ENF A;  2PI2 A;  5BN3 A;  2K1B A;  3GO5 A;  2TSS A;  5C3E G;  3RZO B;  2PQE A;  1GKH A;  1HTP A;  2GA4 B;  4C3I H;  3NTK A;  4KHP L;  2Q8T A;  3JAM E;  1FYC A;  5GRO A;  4KHP Q;  1EL0 A;  1Z47 A;  4NDX A;  3VA5 A;  1HA6 A;  4K2L A;  3SK6 A;  2K03 A;  3T13 A;  1NMG A;  1F9P A;  3NTH A;  5K36 G;  2KHJ A;  2L5T A;  5I9P A;  1LTR D;  1KDA A;  1AFP A;  4C3H B;  1Q8K A;  3HOX H;  3CPW A;  4JW0 A;  3R2I A;  5C4J B;  3PIP 3;  3GTQ H;  4FF1 A;  5C6A A;  5C3E B;  3FPP A;  1PFB A;  2A68 C;  1RD9 D;  4AYB G;  3U4V A;  1UE1 A;  2VQF L;  1Y1W H;  5E4W C;  4YIJ A;  1STG A;  1ASZ A;  2LXK A;  5COR A;  4UDU C;  2ZTC A;  1KLU D;  3IKJ A;  2VQF Q;  5IGG A;  1YIJ A;  1PH2 A;  5EPL A;  1PH9 A;  2ID0 A;  3BZC A;  4A3D H;  1SMY C;  3OW7 A;  3PV0 A;  2RCN A;  5CYU A;  3ULL A;  3HOZ H;  2RSO A;  3WDN A;  3T4A C;  3HG9 A;  5JEA G;  4OX9 L;  1ENC A;  5JPM C;  1E3P A;  4OX9 Q;  1TVX A;  1T9H A;  4BY1 G;  4BY7 H;  4UAI A;  4FF4 A;  2K14 A;  2L55 A;  4DV1 L;  1JB3 A;  4JPB W;  4AYB B;  3S14 B;  1PYW D;  1BQQ T;  2D62 A;  3K80 C;  4DV1 Q;  3ONA B;  2B39 A;  3EN2 A;  1NR4 A;  2F0W A;  3VYR A;  3D6C A;  3RMH A;  2EY6 A;  1HNX L;  2CQA A;  1HZB A;  3EJI A;  4HCS A;  5IOD A;  1T5X D;  2ES2 A;  1ZYR D;  1M1K C;  1EY5 A;  1HNX Q;  1MGS A;  1YNX A;  1UE5 A;  3DM3 A;  1X3Q A;  2H4O A;  4QUF A;  1UEB A;  3R2T A;  3STB C;  1WTR A;  3N52 A;  1PYB A;  5IP9 H;  1TWF B;  2AQ2 B;  4YWK A;  3K57 A;  2AWN A;  4L5T A;  4KN4 C;  4JI6 L;  3K5L A;  5C0X J;  3NWS A;  1K8A C;  4JI6 Q;  3LGJ A;  2E2J H;  1V1O A;  3HFZ B;  5CV6 A;  1L0W A;  2XN9 C;  1PLF A;  3AU7 A;  2PMZ E;  1X9N A;  2SOB A;  3SEB A;  2NUC A;  4ZRZ A;  5COY A;  4EX5 A;  4JBJ A;  1PH5 A;  1X3G A;  5E4X A;  1SNP A;  1TS4 A;  4MNO A;  3BYT B;  3KDF B;  4RH6 A;  1MJE A;  4JI3 L;  1EQQ A;  3E5S A;  2VNU D;  3CCV A;  1GOZ A;  1SMX A;  4JI3 Q;  3X3N A;  1AZQ A;  3FVQ A;  3S1R B;  1ICF B;  2A6H D;  3G48 A;  4YHH L;  1E2V A;  3ULJ A;  3TS2 A;  3E6Z X;  3E3X A;  5IYD H;  1F2Z A;  4YHH Q;  4A93 H;  3PSI A;  5CMD A;  1EFI D;  4NMZ A;  3RN5 A;  4ALP A;  1X32 A;  1HR0 W;  1XMO L;  4LJZ C;  3MAQ A;  1IL2 A;  3CAM A;  3VR3 A;  1C4Q A;  5M3M H;  1XMO Q;  3KK7 A;  1FR3 A;  2VW9 A;  3GTK B;  1YNJ C;  1RF2 D;  5C5L A;  1KRT A;  2FFK B;  1XPU A;  4QF4 A;  4XTC S;  4TRD A;  1SE8 A;  3PMF A;  2R92 G;  4BA2 I;  2K4K A;  1TWG B;  1U4M A;  1F2Y A;  1Y1V B;  3SK5 A;  1SYF A;  1YBY A;  5ELB A;  3DLL A;  1PZJ D;  5CV7 A;  4LF6 L;  1LV9 A;  3OYY A;  2TMP A;  1XTD A;  1PH8 A;  2DNC A;  1I5F A;  2G9H D;  2V4D A;  1VF5 C;  3URY A;  4C3J H;  2LS0 1;  1X54 A;  3MWY W;  1F9Q A;  3OMC A;  5DM6 3;  2IJ0 A;  1YNN D;  4V0B A;  2F0M A;  1ML0 D;  1R9T B;  1ZKO A;  2EE1 A;  2PYK A;  2WV6 D;  1VQO A;  1F9R A;  5JAV A;  3I8Z A;  4JOI C;  3V2T A;  2F0H A;  4A3F G;  4DR2 L;  3GTJ B;  1M8A A;  5E3F A;  1RKN A;  4DR2 Q;  3A7L A;  2JA8 H;  1Q3L A;  2R92 B;  1BDO A;  3ER0 A;  1V9P A;  2F03 A;  1HA5 A;  1DON A;  2EOT A;  3PO3 H;  3M4Y A;  2HUG A;  4R8I A;  4A3K B;  1RTN A;  1G29 1;  1MIU A;  4ZYS A;  5C3X A;  3RLF A;  1UAP A;  3C1E A;  2L11 A;  5HY6 A;  4X65 L;  3UDF A;  5EPJ A;  1PRT D;  4JI7 L;  1V1Q A;  3DUZ A;  2VQE L;  4X65 Q;  4A3F B;  5IY0 A;  3RUZ A;  3H3V C;  4JI7 Q;  1GUG A;  1EFW A;  3A74 A;  3CRL C;  2VQE Q;  3NWT A;  4RKB A;  4G4K A;  3PCO B;  3L2P A;  4A3B H;  2IHE A;  4Q0F A;  4DAV A;  4B08 A;  2BOS A;  2L4N A;  1U4L A;  2K7V A;  4KV6 A;  2K50 A;  4MTK A;  3MTS A;  4X3U A;  3SR1 A;  2ZT9 C;  5CV8 A;  4JOI A;  1NAP A;  4RG1 A;  3GP7 A;  1U5K A;  1SYG A;  4OO1 G;  1W3S A;  5E1F A;  3S2H H;  1Y8P B;  2NZH A;  2JSO A;  2HT1 A;  4NXN L;  2LXJ A;  3K81 C;  1NCV A;  4QGU A;  4IFD I;  1DXM A;  1GJX A;  1EYA A;  3I4O A;  4NXN Q;  2GVA A;  1AEX A;  3GTL H;  4HIM A;  3C46 A;  1RDP D;  2R3Z A;  3VR6 A;  1TQO A;  2KED A;  1WCM H;  4FF3 A;  2R7Z H;  4LF9 L;  1IYJ B;  1S4Z A;  4GN5 A;  4LF9 Q;  4GKJ L;  2MHV A;  3VYT A;  3S16 B;  1JJ2 A;  4GKJ Q;  1OXX K;  3CQZ H;  3E0E A;  4DK1 A;  1QVC A;  4JI0 L;  2MP1 A;  4K8I A;  2D5D A;  4JI0 Q;  1EWI A;  1XNQ L;  1XNR L;  3F2C A;  3ULP A;  1MKH A;  3MXN A;  1XNQ Q;  4AH6 A;  1L0Y B;  2PCF B;  1XNR Q;  3VR2 A;  2FJ2 A;  4PZ8 A;  4BBR G;  2K75 A;  2Y0S B;  1QOH A;  4S3S A;  5EQ0 A;  4PMC A;  5I6Y A;  4DR1 L;  4DR1 Q;  1YVC A;  1U4R A;  1EQT A;  2JEA I;  3M7N A;  1X6O A;  3G6J B;  4FYD A;  1JIC A;  1YZ6 A;  2MPM A;  5BN4 A;  2A69 C;  1H95 A;  3K0Y A;  2JXM B;  4R4Q A;  3CCM A;  1QZG A;  2A1A A;  4DV2 L;  1EEI D;  5LMN W;  2JA5 H;  3TP7 A;  3HP3 A;  3TZU A;  4DV2 Q;  4HJ7 A;  4LUO A;  1KXL A;  3J80 i;  3HOW H;  1EZ8 A;  1FNV A;  1GD7 A;  4I65 A;  4B3T L;  1TWA B;  1TWH H;  3MEH A;  2QEX A;  4LMQ D;  1BKB A;  3TRZ A;  4QMG A;  4B3T Q;  1Q1E A;  5IYC G;  4BBR B;  2KCT A;  3I3C A;  1J8I A;  1IBM L;  2WAQ G;  4CJ0 B;  5IT9 c;  4XYQ A;  1A2T A;  1IBM Q;  1VQA A;  1B1Z A;  1Q90 A;  1N8R C;  1S5B D;  3A5Z B;  2CKZ B;  3H09 A;  3I90 A;  4GZY C;  3NEL A;  1J5E L;  2B63 G;  5K5P A;  1J5E Q;  2WP8 J;  2VZA A;  3NPP A;  4ZKC B;  3KFU A;  4IUP A;  4IUT A;  2NVY B;  4A3I G;  2XNA C;  1RIP A;  3X3M A;  3D4R A;  2VB2 X;  1SJH D;  3DWA A;  3TP8 A;  3OSO A;  2WAQ B;  4O1N A;  5ISR A;  1B9M A;  1EY0 A;  1AE2 A;  4F7X A;  1VQN A;  1LLR D;  2I5L X;  1N33 L;  2B63 B;  2LMC B;  2PW5 A;  3IFD A;  1N33 Q;  1OXS C;  1UE6 A;  3FDT A;  1Y8N B;  4MHE A;  4C2M H;  3K5O A;  3E0J A;  3OWF A;  3KBG A;  2NVX B;  1ZXT A;  1LT5 D;  1QJO A;  2XTI A;  3FRP B;  3IFT A;  3LNN A;  3EBE A;  4A3J G;  2R6G A;  1JWM D;  4IFD H;  3IRB A;  3KOJ A;  4X66 L;  3CC4 A;  1YJ9 A;  1A62 A;  1LT6 D;  3EA6 A;  4OEM B;  1UWV A;  3NEN A;  4X66 Q;  5A2Q E;  3GTO H;  2QEJ C;  1OTC A;  3OWE B;  1BOS A;  2MUY A;  3H94 A;  1EYC A;  1I4H A;  1K0R A;  4DV4 L;  2Z8L A;  4FXD A;  1DD2 A;  5JJL A;  4C56 C;  4KD4 A;  4DV4 Q;  1Q82 C;  3MFY A;  2NB0 A;  1QNK A;  4WFN 3;  4NXM L;  1N32 L;  2K6A A;  3I72 A;  2MNA A;  1KD1 C;  3Q6S A;  4NXM Q;  1N32 Q;  4HSV A;  3FP9 A;  1BCP C;  4A3G G;  4MIU A;  2K52 A;  2K33 A;  1SR3 A;  1UNS A;  2EXZ A;  2VUM H;  3MA2 B;  3K58 A;  2UXB L;  1WTP A;  3I4M H;  2NVQ H;  1JB7 A;  4KY7 A;  1V1P A;  2UXB Q;  3BVG A;  2B2Y A;  2Q2T A;  4IFD J;  1GUS A;  3HOV H;  1HFG A;  3QOJ A;  2AQ1 B;  1TY0 A;  1Q12 A;  1CSQ A;  2YV5 A;  1PV4 A;  4BA1 I;  4JI1 L;  4OIK A;  4KKS A;  2UUC L;  3B6Y A;  2UXC L;  3S1M B;  4IQZ A;  4JI1 Q;  1N36 L;  2UUC Q;  3HKZ E;  2UXC Q;  1YHQ A;  1HNW L;  4H7B A;  1N36 Q;  5IGB A;  3J80 c;  5M5X B;  1HNW Q;  4PZ6 A;  3FKI B;  4GOP C;  4A3G B;  1ILP A;  5CBE E;  1JOO A;  2OWO A;  1A8V A;  4DAY A;  1G6Z A;  4CKB A;  5FLM H;  1HHV A;  2R93 B;  1LO5 D;  5EGT A;  2KA7 A;  1O80 A;  1XX8 A;  5DLQ E;  1BNZ A;  2F3I A;  4JI8 L;  4GNX A;  1HZC A;  4U67 3;  1CHP D;  3S2D H;  4JI8 Q;  4BXX H;  2WAC A;  4FDB A;  3F1Z A;  5TSS A;  3S17 H;  2B2U C;  3OOC A;  4EGV A;  5IOC A;  3S1N H;  1VQB A;  4GS3 A;  2L0C A;  3DXJ C;  4MTN A;  2WB1 B;  2HCI A;  3M9B A;  2PZU A;  4ZLT F;  3HOY G;  1EOV A;  3BVZ A;  4K0K L;  1TWC H;  3D3R A;  2HIV A;  3FEW X;  1K0S A;  2F3W A;  2A74 C;  2QDL A;  2UUB Q;  4K0K Q;  4X3S A;  5I9O A;  1E1O A;  2LSS A;  4K5W A;  2EPB A;  2KHS A;  5BN5 A;  2NN6 I;  1BF4 A;  2K04 A;  4JCV E;  4JK1 C;  3UI2 A;  1F77 A;  4XQN A;  4L8J A;  3NBH A;  4Y7N B;  1VDZ A;  1EYG A;  2ICI A;  2LFN A;  1S5D D;  2MJ8 A;  2QKI C;  5M3F G;  3I2Z A;  1XJV A;  1GVP A;  2RDH A;  2J7Z A;  1B9N A;  3J81 E;  2F0K A;  4WJ4 A;  3M3Y B;  5JEA H;  3T56 B;  4K5X A;  2WKC A;  3HOY B;  3I4N G;  1I94 L;  4BY1 H;  1B2T A;  2I0Q A;  2EY5 A;  4PZ7 A;  3G7L A;  3QWN A;  1I94 Q;  1Q8I A;  5IIF A;  3J81 j;  3PIP A;  1PXU A;  1A0I A;  1I50 B;  3KF8 A;  2K05 A;  2EJF C;  1B53 A;  5M3F B;  1K8O A;  1HQM C;  3A0J A;  2F4I A;  1HPC A;  5IP7 G;  2QGQ A;  3DM1 A;  1UUP A;  2HIX A;  2DNE A;  1SLJ A;  3ITP A;  1JE4 A;  5JPN C;  3A5U A;  2ZTE A;  3NQT A;  4IUQ A;  3I4N B;  3IL8 A;  4ID6 A;  1YIT A;  1G2S A;  2OXP A;  4IPH A;  1ZYR C;  1WFQ A;  3PO2 B;  1SNO A;  1JQY D;  2GVB A;  3GTG H;  3F8T A;  1PH7 A;  3RR5 A;  4PMB A;  3TP6 A;  1QB5 D;  1I4R A;  1GUT A;  1O7Z A;  4YY3 L;  4HJ8 A;  4YY3 Q;  1IYU A;  2NTT A;  3P7J A;  2J4X A;  3AQQ A;  4RA8 A;  1BBU A;  3C3L A;  4L5Q A;  4GLX A;  4C1N I;  3CD6 A;  4DV5 L;  1I6H B;  5IWA L;  5ELO A;  5M5W B;  4DV5 Q;  5JOB A;  4RCN A;  5IWA Q;  3SK8 A;  1HZA A;  3SVM A;  5I2X A;  2JA6 H;  1WTO A;  1GM5 A;  4JBM A;  5EKK A;  1LTT D;  2YU9 B;  3QIA A;  5C4X G;  1LTL A;  3R8B A;  2NVT B;  2E8G A;  3NQI A;  4PV1 C;  1NNX A;  3VR4 A;  3GTP H;  4IOA A;  2A6H C;  1HCZ A;  3P1H A;  4F87 A;  2VL6 A;  4UY8 C;  2HCC A;  1QVF A;  4O0A A;  1JJC B;  4R8N A;  3RZD H;  5NUC A;  1I3Q H;  2KCN A;  5ELC A;  1B44 D;  5FLX E;  4J8Q A;  5KRU A;  4JI2 L;  1BBW A;  3WOF A;  2RHQ B;  4JI2 Q;  4P75 A;  4HMJ A;  4BBS H;  2AKW B;  4OON A;  5FOB B;  4DK6 C;  2WKD A;  1B70 B;  1RL2 A;  2SNS A;  5AJ3 L;  3BDL A;  2C9O A;  4ZKB B;  4CDF C;  1Q86 C;  1E0B A;  2PO4 A;  2NN6 H;  4TVA B;  5AJ3 Q;  4JC0 A;  3CCE A;  5C4X B;  1D5X C;  1SDF A;  1Q1B A;  2CWA A;  3R3O A;  1PMR A;  4QB4 A;  1SE4 A;  4K5V A;  1K8M A;  2L12 A;  3NK9 A;  4RWS C;  2RF4 A;  4DNI A;  1YNN C;  1JC7 A;  3F2B A;  2UXD L;  1H9M A;  1JCK B;  3O13 A;  1CA6 A;  2F4V L;  2UXD Q;  1EY7 A;  1RTO A;  3CC7 A;  5D3D A;  1EY6 A;  2F4V Q;  5C4H A;  1LT4 D;  3ERQ A;  5HGQ A;  2CWP A;  1XPR A;  2HQL A;  1SE3 A;  1C0A A;  2HDM A;  5T1G A;  1VS0 A;  4DAM A;  4C3I G;  1ROD A;  4A3E B;  5EBD A;  1CQV A;  1L0X B;  5FO9 B;  2EY2 A;  1Y1V G;  3RNU A;  1V1P B;  4DXG A;  1LTG D;  2EQS A;  1KIX A;  1B3A A;  2A68 D;  2OCE A;  4IN3 A;  5IYB H;  1QUQ B;  3S1Q B;  1ZEQ X;  2E2D C;  5T1I A;  2DGY A;  1RJT A;  2F0P A;  5JVG 3;  4UP9 A;  2KVM A;  2PZW A;  1XPO A;  1A63 A;  1SMY D;  2F0T A;  3TDQ A;  5DEH A;  3H0G H;  4C3I B;  1CI3 M;  1K3R A;  2MGS A;  1M4V A;  3BZD B;  2YTY A;  4DAY B;  1Y1W G;  3ERO A;  2JA9 A;  3SDZ A;  4WJW A;  3S15 H;  2NWG A;  1MSH A;  5CR3 A;  4LF6 Q;  4A3K G;  2FMC A;  3FMC A;  4A3D G;  4KHV A;  4APV A;  5C0X G;  1YEZ A;  1BCP B;  1C9O A;  1KRS A;  3BYY B;  1HQR D;  1WI5 A;  2HQE A;  1DJR D;  1VQG A;  1HUN A;  2KQ3 A;  4LNQ A;  4WOR A;  2RCF A;  3HOX B;  1PHJ A;  5JJI A;  1YHA A;  2Z6K C;  4DR5 L;  3NE5 B;  3GTQ B;  1SYE A;  4DR5 Q;  3KLW A;  4BY7 G;  2NZ1 D;  1A15 A;  2JA7 G;  1PTO D;  1NTG A;  1Y1W B;  4BBR H;  4DN4 M;  5M9O A;  1ENA A;  5HGT A;  3BDC A;  2DJG C;  3MZ5 A;  3MHB A;  3U58 A;  1V8Q A;  2ICE C;  1QZH A;  1AW7 A;  2RDG A;  1IHZ A;  4A3D B;  3D6W A;  4AIM A;  3JAM i;  1Y14 B;  1KDB A;  1ESR A;  3HOZ B;  4GOP B;  4KN7 C;  4QUC A;  1KNA A;  5D65 A;  1I4P A;  4KI0 A;  1A3V A;  2Z9H A;  4XIG S;  1K73 C;  1MD2 D;  4P72 A;  1IW7 D;  3JC6 6;  1FVI A;  5FJ8 H;  4BY7 B;  1KAW A;  1LTI D;  3K7A H;  5KNC A;  2IY5 B;  1VQ8 A;  2JA7 B;  3KF8 B;  1NJI C;  3MXP A;  3DEO A;  1S5F D;  2X6G A;  1BUV T;  5M5Y H;  5IT9 L;  2CCZ A;  5CV4 A;  4QIW B;  1U9R A;  1AZP A;  1W6K A;  1B50 A;  2E5L L;  3SK4 A;  4JV5 L;  3PUV A;  1HR0 L;  2Z6K A;  2E5L Q;  4JV5 Q;  1HR0 Q;  1QWY A;  2RBM A;  3KYH C;  2JQO A;  1XXG A;  2F0U A;  4IUR A;  4A3C G;  4A3M H;  1O7L A;  4HIO A;  3KLR A;  1GUN A;  3D4W A;  1B7Y B;  1LAB A;  4J6H A;  2KOL A;  4H13 C;  5IYD G;  2OTJ A;  3CF5 A;  1YNJ D;  4A93 G;  3TEH B;  2NVX H;  2Y0S G;  1K3B C;  4A3I H;  2AWO A;  5J39 A;  3U9O A;  3GTM H;  4H44 C;  2EDG A;  2WFW A;  3F2U A;  3I56 A;  1PTO H;  4IAL A;  2NYZ D;  2N88 A;  4G57 A;  5ELF A;  1STA A;  3S24 A;  4AYB E;  5M3M G;  2DY8 A;  3I55 A;  2J0T D;  1D6E C;  4ZUI A;  3CHB D;  3ND8 A;  2I5M X;  3W1B A;  2B8F A;  3ICE A;  3KUP A;  2NBF A;  3L7Z C;  2F0D A;  1EY8 A;  2ZXO A;  4QL5 A;  5GAG C;  4CHT B;  4DFA A;  4I7Z C;  5CBA E;  3PUX A;  4HAE A;  1OXU A;  4A93 B;  4ZQ3 A;  4CKC A;  4L5S A;  1SAP A;  1KAA A;  2MO0 A;  3S9W A;  1KTK A;  4J15 A;  2ZTD A;  1EIH A;  4A3J H;  2PPB C;  2R7F A;  1STB A;  2EXD A;  3AMU A;  2F0V A;  2KHI A;  4I7A A;  2AUK A;  3MXU A;  4POG A;  2VY3 A;  5M3M B;  2G9D A;  1TS5 A;  4RGT A;  2EY1 A;  2A6E D;  4FP5 D;  1H9S A;  3DMU A;  1WTH A;  4OIJ A;  4HIK A;  1DYQ A;  4N8X 1;  2JA8 G;  3EQL C;  2Z0S A;  4YCV A;  4DU9 A;  5KIX A;  1BCP F;  1Z7T A;  3BG3 A;  2NTS A;  3PO3 G;  1IZ6 A;  2PQA A;  5I2Y A;  4X6A H;  3PUZ A;  3MC0 B;  1DCZ A;  2JN4 A;  4XQQ A;  1Z6H A;  4RHR A;  2N55 A;  4C3J B;  3UE0 A;  3TZD A;  2F0F A;  5J3B A;  1OO9 B;  2IX1 A;  4Z9C B;  4LF8 L;  1HH2 P;  4RMF A;  4X64 L;  3TSS A;  1DOK A;  1ET9 A;  4LF8 Q;  4K8J A;  4X64 Q;  2VB3 X;  1K8G A;  3CCL A;  3QOL A;  4X3K A;  2Z4I A;  1Q7Y C;  3H6M A;  1JWS D;  4FXG C;  3SE0 A;  1SFO H;  1WTX A;  2JA8 B;  2EYJ A;  4L5R C;  1UEA B;  3JAM c;  4TSS A;  1JOR A;  4A3B G;  2DN8 A;  4BWG B;  3IAY A;  2EVB A;  3TRE A;  3PO3 B;  3J80 L;  5FO7 B;  5G3L F;  4OHJ A;  4RGO S;  2K5V A;  1TKW B;  1JOK A;  1FNU A;  3KF6 A;  3UDI A;  3NTI A;  3HOU G;  3M4O H;  2UU9 L;  1G51 A;  2JP1 A;  3C2P A;  2UU9 Q;  1G8Z D;  1G2T A;  1VQP A;  1PVO A;  3WWV A;  5C44 H;  1SYC A;  1CHQ D;  3DWQ A;  4Y7N H;  1WD1 A;  2KBN A;  2IPK D;  1TS2 A;  3A8J E;  2CW0 D;  3U9S A;  2JE6 I;  2B2Y C;  3NEM A;  1WCM G;  1EY4 A;  1K83 H;  4PQX A;  4A3B B;  1XTC D;  2IWH A;  5D3I B;  1WD0 A;  1NR2 A;  4CDC C;  1EQR A;  3Q23 A;  4DAP A;  3L3O C;  4OWW B;  1LYL A;  1VQM A;  3HOU B;  2F0J A;  1C7Y A;  1VQ6 A;  2PZT A;  3S2H B;  5LMN L;  4O2D A;  2E2H H;  4F88 A;  1PA6 A;  1AN8 A;  1CM9 A;  5ELN A;  2E2I H;  3W3A A;  4O42 A;  3TS0 A;  4CGY B;  1IYV A;  3L9A X;  3GTL B;  1H9J A;  1GHJ A;  2Z4H A;  4WJ3 M;  4UHV A;  5DNF A;  4GNX C;  4AQY L;  4J1M A;  1QCB D;  2Z1C A;  1WCM B;  2R7Z B;  3D8G A;  3UE1 A;  1QVG A;  2XSC A;  1MI2 A;  2A5H A;  4AQY Q;  4QQB X;  3RZO H;  3HS0 C;  3SHL A;  3FKI G;  1A2U A;  1CSP A;  2IHF A;  1A3U A;  4RKL A;  2O4X A;  3M7G A;  4JI5 L;  2I07 B;  1PZK D;  3CQZ B;  1HTL D;  2BH8 A;  3VYU A;  4JI5 Q;  2R93 G;  4M8A A;  1AP0 A;  3SGI A;  1VQD A;  5CV5 A;  2AUJ D;  3HOW G;  3VDY A;  1DOM A;  4JYA L;  1Y8O B;  1FGU A;  4PG3 A;  2PI2 E;  4QJF A;  3OTO L;  4JYA Q;  1LM0 A;  4L6T B;  1VMP A;  3KDF A;  3OTO Q;  4DNT B;  4C3H H;  5IP7 H;  3CCS A;  2WB1 G;  4RFB A;  3K5M A;  2ZJP A;  4M1U B;  5JJZ A;  5C4J H;  1HUM A;  1HNZ L;  3LWE A;  3U50 C;  2B3G A;  5C3E H;  4DK3 C;  4A76 A;  2BH2 A;  1H9R A;  2MQH A;  1HNZ Q;  1CFM A;  2KCC A;  4DNR B;  4E6I A;  3KLS X;  2QF7 A;  4N9P A;  2R7D A;  1TY2 A;  2E74 C;  3OW2 A;  1E24 A;  4CDD C;  1EU3 A;  1SND A;  2SDF A;  3HOW B;  2BE5 D;  4RAU C;  4IPG A;  1TWH B;  1EWH A;  4OEL B;  5K36 H;  2JYO A;  1EQV A;  5E7N A;  5JJK A;  3D0F A;  2F0N A;  4HR7 B;  3M85 A;  4A3L G;  1MBY A;  4WRD A;  1SE2 A;  1D5M C;  4OGQ C;  4POF A;  1Z9F A;  5C5M A;  4B3S L;  2Y0S E;  2A19 A;  2M9V A;  2PMZ B;  5C0X I;  4B3S Q;  3P20 A;  4G7O C;  2H1E A;  1SBB B;  3S14 H;  3I7F A;  2OF1 A;  1X3P A;  3GD7 A;  5EJW A;  3J7Z C;  1HZ9 A;  4HJ9 A;  1TR5 A;  2Q8I B;  4UP7 A;  4KTA A;  1AH9 A;  2ZJR A;  3I73 A;  1CK1 A;  2EJM A;  3M4Q A;  2XWJ B;  2BDO A;  4UPA A;  4FXK C;  4IFD G;  2F0O A;  2X6L A;  1YHB A;  1TWF H;  1EEF D;  1HRJ A;  3T53 B;  2ALY B;  4JVZ A;  5IE8 A;  3G71 A;  2BA0 A;  1FNW A;  4GN4 B;  3BS1 A;  1KLG D;  2WII B;  2OQK A;  5ELE A;  1R4Q B;  3OMG A;  1VMC A;  2O5I C;  4DV6 L;  1IBK L;  3PO2 G;  4QY7 A;  3HRZ C;  2ENB A;  1STN A;  4RHS A;  1WTV A;  1NY4 A;  4DV6 Q;  1SYD A;  1IBK Q;  2RHS B;  4Q5V A;  1F2M A;  3MXN B;  4C2M B;  4R4T A;  2PNR C;  4JBW A;  4ZK9 B;  3A54 A;  1Q46 A;  2XRS D;  4PNY A;  1STY A;  2D0O A;  3K8A A;  5IGE A;  4XQJ A;  2VUM G;  4P2C B;  2V1C C;  2KUM A;  1D5Z C;  4BS9 A;  3S1R H;  2IW3 A;  3GTO B;  4HMI A;  1H9S B;  3OPO A;  3PGZ A;  1NMF A;  5CGK A;  3HOV G;  3DHQ A;  1VQJ A;  3RN2 A;  2WAQ E;  5JEA J;  3Q0A A;  4OO1 I;  1RHP A;  1ESF A;  2PQA B;  1JE5 A;  1I4G A;  2AMC B;  5IT9 E;  1QG7 A;  4B3M L;  4TQU S;  1BR9 A;  3K6O A;  4K6L A;  1PZI D;  2SEB D;  4B3M Q;  1I6V C;  2C5C A;  1J6Q A;  3T1H L;  3U4Z A;  1BO0 A;  4XXE A;  3GTK H;  2Q8R E;  3T1H Q;  2F0E A;  1TWG H;  5FLM G;  2VUM B;  2K5Q A;  1TS3 A;  1Y1V H;  1GUO A;  3NBI A;  3I4M B;  1QE6 A;  2AQ3 B;  4R1J A;  1PRT F;  4IO9 A;  2NVQ B;  2HD3 A;  4LW1 A;  2QDB A;  4NP5 A;  1X56 A;  3VYS A;  3CKI B;  3CME A;  3HOV B;  1IBL L;  4BXX G;  2QCP X;  4RCO A;  4DUY L;  5GAD C;  1H9K A;  2KEC A;  1IBL Q;  1KDC A;  3G6E A;  4DUY Q;  1R9T H;  5DAU A;  3BDO A;  5KYI A;  1VQE A;  4KK7 A;  1OXV A;  1QNU A;  4YWM A;  4FVM A;  5LL6 S;  3KF6 B;  3GTJ H;  3PIO 3;  1X3F A;  4RGN A;  4NB3 A;  3SXH A;  2ASB A;  3E9I A;  1WVL A;  1JJG A;  2R92 H;  2DUD A;  1P16 A;  5GQO A;  2YTX A;  2B2T C;  1L1O C;  4GLA C;  4RGM A;  5KND A;  1CKM A;  1D1K A;  3S2D B;  4A3K H;  1PYS B;  5C0X H;  4EQP A;  2HHH L;  2G5D A;  2VXW A;  3S17 B;  2SNM A;  2MFI A;  1HXY D;  2JJQ A;  2HHH Q;  3S1N B;  3ND9 A;  4KLK A;  5A2Q L;  4ZUJ A;  2KEN A;  4FF2 A;  1TWC B;  4A3E G;  2L1B A;  1UE7 A;  1S72 A;  1STH A;  2RQX A;  4A3F H;  1PH1 A;  4R9W A;  5GAE C;  2F0L A;  4IZ8 A;  4UP8 A;  1II3 A;  2CVR A;  2JA7 H;  2DJF C;  1X65 A;  2PNH A;  3NUC A;  3I4L A;  2K01 A;  4CJ2 C;  2L15 A;  3VR5 A;  1A6X A;  4KMU C;  1AE3 A;  2EYM A;  2E75 C;  3CP0 A;  5BR8 L;  1ICW A;  3OHX C;  1GO3 E;  3CCU A;  3MEF A;  1FL0 A;  5BR8 Q;  1LAC A;  4LUZ A;  3K5N A;  2Q2I A;  1N34 L;  5J1Z A;  5LMU L;  2OTL A;  4NKL A;  1PTO C;  2N8N A;  3NXW A;  4FNF A;  1N34 Q;  4X62 L;  5LMU Q;  3A55 A;  2EIF A;  3W1G A;  1SRU A;  2I46 A;  2IT1 A;  1VQ7 A;  3CCR A;  4X62 Q;  2B2T A;  4BY1 B;  3UDX A;  1L1O A;  2WB1 E;  1JT8 A;  3CW2 C;  5I6W A;  4IUU A;  1VQF A;  2K5D A;  5EKL A;  3QR8 A;  4LWC A;  4FO2 A;  3J80 E;  4EVO A;  1E22 A;  1F2L A;  3DWP A;  1IW7 C;  2M2L A;  3S16 H;  1JWU D;  1PRT C;  4XT3 B;  2EYL A;  1IKM A;  1SNQ A;  1E2Z A;  2IX3 A;  3HOX G;  3TP5 A;  1E1T A;  4LF5 L;  1W6J A;  3M4P A;  3KLS A;  4A3C H;  4OO1 H;  1VQI A;  3P75 A;  4LF5 Q;  1YI2 A;  1CZG A;  5C3W A;  4GN3 B;  3TN2 A;  4ABN A;  2A8V A;  3GDE A;  3QG1 A;  1TU2 B;  2UUA L;  3RLO A;  2FIN B;  3J81 i;  1MSG A;  1O7I A;  3D4D A;  2JA6 G;  2K32 A;  2UUA Q;  1FJG L;  4XT1 B;  1EIF A;  3GTG B;  1VF7 A;  4GNX B;  1FJG Q;  2QIL A;  4DGZ A;  1N9W A;  2VS1 A;  3TBI B;  5LL6 X;  1ONL A;  1QIL A;  1S40 A;  3NSW A;  3HOZ G;  2YTV A;  2JEB I;  3T51 B;  2L9H A;  5A35 A;  5KNB A;  2QA4 A;  3CCQ A;  1XYI A;  2K5N A;  3CMA A;  3QB3 A;  3J7A 5;  3Q22 A;  3H91 A;  3STB D;  3W2D A;  1TWA H;  1CKN A;  4BBS G;  3G4S A;  3BU2 A;  1VCI A;  2C35 B;  4F8M A;  1CTM A;  1K9M C;  2JA6 B;  3J81 L;  1LTB D;  2ZXP A;  2RDF A;  3ZJY C;  3J7Y W;  3NBH B;  2NN6 G;  4EQO A;  4Y52 H;  5FKA C;  3GTP B;  2Q2U A;  1IL8 A;  3HKS A;  1VQC A;  1V43 A;  3RZD B;  3GV3 A;  5IP9 G;  1I3Q B;  4PMW A;  2CQO A;  1EU4 A;  1B4O A;  4JBK A;  2B29 A;  3NP8 A;  1GHK A;  4XYO A;  1U4P A;  4N9T A;  2NVY H;  4BBS B;  5HUR A;  2P5Z X;  5IYC H;  3AFP A;  4DR6 L;  2A6E C;  4KHZ A;  3VA7 A;  4DR6 Q;  2B2W C;  2XIW A;  3RD4 A;  1I4X A;  4EQ5 A;  1RCV D;  4DV3 L;  4P73 A;  1FD7 D;  1PH4 A;  3HKZ G;  4DV3 Q;  1I4Q A;  3D31 A;  3KBX A;  2B63 H;  3JAM L;  1WYD A;  2RA4 A;  5EKI A;  3KJP A;  1JR0 D;  4P74 A;  2KCM A;  4QCL A;  3MFG A;  3MVV A;  2E2J B;  1GUW A;  2A73 B;  5IYB G;  3H3V I;  3K7U C;  5D14 A;  5IGF A;  4KD3 A;  4B9W A;  2HDL A;  2XGT A;  3HOU H;  5KYL A;  3ZYY X;  1FGB D;  2RKS A;  1T5E A;  2FXQ A;  2ZXR A;  3H0G G;  1G91 A;  2B2V C;  4L63 B;  4DPG A;  3HKZ B;  4DUZ L;  1JMC A;  4OL7 A;  4DUZ Q;  2Q2H A;  4H0L C;  2RVL A;  1CUK A;  4KKT A;  1D8L A;  1WOC A;  3HZX A;  5CC4 A;  4DV0 L;  2H5X A;  4YWL A;  2OT2 A;  1SNM A;  2B2W A;  1KC8 C;  4DV0 Q;  4LK1 C;  2CHB D;  4C3J G;  1SEB D;  1SN8 A;  2F3V A;  3CU7 A;  4LAA A;  4LUV A;  3BJU A;  1SXT A;  4IUN A;  3J81 c;  2EYF A;  4IPC A;  2N78 A;  5FLX L;  1G6P A;  1E7Z A;  2MO1 A;  2CW0 C;  1EIY B;  4C1N K;  1C48 A;  1PFM A;  1LT3 D;  3PUW A;  4GLV B;  3V96 A;  1OXT A;  3I70 A;  1R4P B;  1EWC A;  5FO8 B;  2AHO B;  4LF4 L;  1LTS D;  1EOT A;  3AB9 A;  3H0G B;  4LF4 Q;  3QO2 A;  2M00 A;  1LTA D;  2X69 A;  2OEO A;  1SJE D;  1YJW A;  1VQK A;  2D2C C;  3C1F A;  1K28 A;  1PFN A;  3S1M H;  4HJ5 A;  1EYD A;  1VQH A;  4DR3 L;  2RSN A;  3S15 B;  3A7A B;  4TKO B;  4DR3 Q;  3EFX D;  3J7A V;  4H02 A;  4KY6 A;  1ILQ A;  4B9X A;  5M5X H;  4HJA A;  1S5C D;  3FKI H;  4A3G H;  4N8F A;  2O5J C;  2OQ0 A;  1NE3 A;  4JG2 A;  2B2V A;  3LX0 A;  2R93 H;  3CCJ A;  1BBX C;  2K28 A;  1NBW A;  2EYO A;  4KJO A;  5FJ8 G;  1KAB A;  2F0I A;  4JI4 L;  4V19 0;  4ME5 A;  2E76 C;  4JI4 Q;  3GQB A;  5IGD A;  4A4I A;  4IJH A;  3E9H A;  2B8G A;  3PQI A;  3PF4 A;  2BA1 A;  3FHW A;  1S5E D;  3J7A F;  5I4D A;  2EZV A;  5AFW A;  1HFN A;  3Q8D A;  2F0Q A;  4KY5 A;  4HTH A;  3NHH A;  1HJP A;  2XWB B;  1P8L A;  1VQ9 A;  5EPK A;  4A3M G;  2Z6B A;  4MZ9 A;  1LUZ A;  1W2B A;  3R93 A;  1EIG A;  4ZCK A;  3Q24 A;  4YCW A;  2ATW A;  5IGC A;  3L0O A;  1L1O B;  1EY9 A;  1SYB A;  5H1S E;  3HEJ A;  3K7A B;  5JVH 3;  4IOC A;  4YCU A;  1DM0 B;  2IL8 A;  1EZ6 A;  2XRQ D;  1BXT A;  3WOE A;  5DM7 3;  4A75 A;  2R7Z G;  5M5Y B;  1ET6 A;  3M3Y H;  1Y69 U;  4K14 A;  4A3L H;  4IPD A;  4LFC L;  4HSP A;  4KJN A;  3HOY H;  1U0L A;  4LFC Q;  2BE5 C;  1PDQ A;  4LFA L;  5KEE A;  2BCO A;  3H3V H;  2K5H A;  3PF5 A;  4A3M B;  1I50 H;  5FK9 C;  4LFA Q;  4GKK L;  5CV9 A;  5FLX c;  4MN3 A;  4GKK Q;  1CKO A;  3N6R A;  2A69 D;  3FPU B;  1D2B A;  5LMN Q;  2PW7 A;  5M3F H;  3AEV A;  4CKE A;  4A3I B;  4CDE C;  3ERS X;  1S3O A;  3GTM B;  2LKV A;  2KJX A;  1PTO B;  1PFS A;  1BVS A;  2O2L D;  1YJN A;  3CPF A;  3LWU A;  4K6D A;  3I4N H;  3AFQ A;  2F0S A;  4QIW E;  3T1Y L;  3HGB A;  1XWE A;  3PO2 H;  3W5O A;  2NZO A;  2JA5 G;  1O7Y A;  5C4Z A;  3T1Y Q;  3CRK C;  1B3Q A;  2EYH A;  2D9U A;  3QJY A;  1MJC A; 
#chains in the Genus database with same CATH homology
 2DY7 A;  4G7Z C;  2KEE A;  1KNE A;  4CJ1 B;  3MXG A;  1O78 A;  1SSO A;  1PRT B;  4A3J B;  4DK0 A;  3A8I E;  1CZW A;  3DEP A;  4ODG A;  2FMM A;  3PUY A;  4U68 A;  2F0G A;  2JA5 B;  1NSN S;  2F1M A;  4HCE A;  2EJG C;  4EQN A;  3OIQ A;  3V05 A;  2K5W A;  3T16 A;  3A8K E;  5F2D A;  2BDN A;  3GV6 A;  5LHY 1;  1JOQ A;  3A56 A;  4XDX A;  5EBC A;  2LY7 A;  1TII D;  1GXD C;  1SFO B;  1C8C A;  1DZ1 A;  3TME A;  2EYP A;  2YYZ A;  1TT2 A;  5J22 A;  3M4O B;  1F9S A;  1SNC A;  2XVS A;  1NUC A;  2WIN B;  1BCP D;  4CBV A;  1WTW A;  1CA5 A;  5C44 B;  4HN7 A;  3K59 A;  1CQF A;  4X3T A;  1WTQ A;  4ZAI A;  4ILW A;  4DA2 A;  1K83 B;  4IUV A;  1STE A;  3BVM A;  1D1I A;  4HED A;  4KKU A;  1IKL A;  1CT1 D;  4G7H C;  3EVQ A;  4K2K A;  1A3T A;  1J9O A;  4ULL A;  2IX0 A;  1E2W A;  2E2H B;  2E2I B;  1PTO F;  2B2U A;  2R61 A;  4DXF A;  5KGU A;  5G3L D;  1DOL A;  3OIP A;  2FHT A;  4NW2 A;  4C3H G;  3I91 A;  4DF7 A;  5ELD A;  1ENF A;  5BN3 A;  2K1B A;  3GO5 A;  2TSS A;  3RZO B;  2PQE A;  1HTP A;  2GA4 B;  3NTK A;  2Q8T A;  3JAM E;  1FYC A;  1EL0 A;  1Z47 A;  4NDX A;  3VA5 A;  1HA6 A;  4K2L A;  3SK6 A;  2K03 A;  3T13 A;  1F9P A;  3NTH A;  5K36 G;  2L5T A;  5I9P A;  1LTR D;  1KDA A;  1AFP A;  4C3H B;  3R2I A;  5C4J B;  3PIP 3;  4FF1 A;  5C6A A;  5C3E B;  3FPP A;  1PFB A;  2A68 C;  1RD9 D;  5E4W C;  4YIJ A;  1STG A;  5COR A;  4UDU C;  1KLU D;  3IKJ A;  5IGG A;  5EPL A;  2ID0 A;  1SMY C;  3OW7 A;  3PV0 A;  5CYU A;  2RSO A;  3WDN A;  3T4A C;  3HG9 A;  5JEA G;  1ENC A;  5JPM C;  1TVX A;  4UAI A;  4FF4 A;  2L55 A;  1JB3 A;  4AYB B;  3S14 B;  1PYW D;  1BQQ T;  2D62 A;  3ONA B;  2B39 A;  1NR4 A;  2F0W A;  3VYR A;  3D6C A;  3RMH A;  2EY6 A;  2CQA A;  3EJI A;  4HCS A;  5IOD A;  1T5X D;  1ZYR D;  1EY5 A;  1MGS A;  1X3Q A;  2H4O A;  4QUF A;  3R2T A;  1WTR A;  3N52 A;  1TWF B;  2AQ2 B;  3K57 A;  2AWN A;  4KN4 C;  3K5L A;  5C0X J;  3NWS A;  1V1O A;  5CV6 A;  2XN9 C;  1PLF A;  3AU7 A;  2SOB A;  3SEB A;  2NUC A;  4ZRZ A;  5COY A;  5E4X A;  1SNP A;  1TS4 A;  3BYT B;  4RH6 A;  3E5S A;  2VNU D;  1GOZ A;  3X3N A;  1AZQ A;  3FVQ A;  3S1R B;  2A6H D;  1E2V A;  3E6Z X;  1F2Z A;  5CMD A;  1EFI D;  4NMZ A;  1X32 A;  4LJZ C;  3MAQ A;  3VR3 A;  1C4Q A;  3KK7 A;  1FR3 A;  3GTK B;  1YNJ C;  1RF2 D;  5C5L A;  2FFK B;  4QF4 A;  4XTC S;  4TRD A;  3PMF A;  4BA2 I;  1TWG B;  1U4M A;  1F2Y A;  1Y1V B;  3SK5 A;  1SYF A;  5ELB A;  1PZJ D;  5CV7 A;  1LV9 A;  2TMP A;  2DNC A;  2G9H D;  2V4D A;  1VF5 C;  3URY A;  2LS0 1;  3MWY W;  1F9Q A;  3OMC A;  5DM6 3;  2IJ0 A;  1YNN D;  4V0B A;  2F0M A;  1ML0 D;  1R9T B;  1ZKO A;  2EE1 A;  2PYK A;  2WV6 D;  1F9R A;  5JAV A;  3I8Z A;  3V2T A;  2F0H A;  3GTJ B;  1M8A A;  5E3F A;  1RKN A;  3A7L A;  1Q3L A;  2R92 B;  1BDO A;  2F03 A;  1HA5 A;  1DON A;  2EOT A;  3M4Y A;  2HUG A;  4R8I A;  4A3K B;  1RTN A;  1G29 1;  4ZYS A;  5C3X A;  3RLF A;  1UAP A;  3C1E A;  2L11 A;  5EPJ A;  1PRT D;  3DUZ A;  4A3F B;  3RUZ A;  3H3V C;  1GUG A;  3CRL C;  3NWT A;  4RKB A;  4G4K A;  4Q0F A;  4DAV A;  4B08 A;  2BOS A;  2L4N A;  1U4L A;  2K7V A;  4KV6 A;  3MTS A;  4X3U A;  3SR1 A;  2ZT9 C;  5CV8 A;  1NAP A;  3GP7 A;  1SYG A;  4OO1 G;  5E1F A;  1Y8P B;  2JSO A;  4IFD I;  1NCV A;  1DXM A;  1GJX A;  1EYA A;  1AEX A;  3C46 A;  1RDP D;  2R3Z A;  3VR6 A;  1TQO A;  2KED A;  4FF3 A;  1S4Z A;  2MHV A;  3VYT A;  3S16 B;  1OXX K;  4DK1 A;  2MP1 A;  4K8I A;  2D5D A;  3MXN A;  1L0Y B;  2PCF B;  3VR2 A;  2FJ2 A;  2Y0S B;  1QOH A;  4S3S A;  5EQ0 A;  4PMC A;  5I6Y A;  1U4R A;  1EQT A;  2JEA I;  3M7N A;  3G6J B;  4FYD A;  1JIC A;  2MPM A;  5BN4 A;  2A69 C;  3K0Y A;  2JXM B;  1EEI D;  3TP7 A;  3HP3 A;  3TZU A;  1EZ8 A;  1FNV A;  4I65 A;  1TWA B;  3MEH A;  4LMQ D;  4QMG A;  1Q1E A;  4BBR B;  3I3C A;  1J8I A;  4CJ0 B;  4XYQ A;  1A2T A;  1B1Z A;  1Q90 A;  1S5B D;  3H09 A;  4GZY C;  3I90 A;  5K5P A;  2WP8 J;  3NPP A;  4ZKC B;  4IUP A;  4IUT A;  2NVY B;  2XNA C;  3X3M A;  3D4R A;  2VB2 X;  1SJH D;  3DWA A;  3TP8 A;  3OSO A;  2WAQ B;  4O1N A;  5ISR A;  1B9M A;  1EY0 A;  4F7X A;  1LLR D;  2B63 B;  2LMC B;  2PW5 A;  3IFD A;  1OXS C;  3FDT A;  1Y8N B;  4MHE A;  3K5O A;  3E0J A;  3OWF A;  3KBG A;  2NVX B;  1ZXT A;  1LT5 D;  1QJO A;  3FRP B;  3IFT A;  3LNN A;  2R6G A;  1JWM D;  4IFD H;  1LT6 D;  3EA6 A;  5A2Q E;  2QEJ C;  3OWE B;  1BOS A;  2MUY A;  3H94 A;  1EYC A;  1I4H A;  2Z8L A;  4FXD A;  1DD2 A;  4C56 C;  4KD4 A;  3MFY A;  2NB0 A;  1QNK A;  4WFN 3;  2K6A A;  3I72 A;  3Q6S A;  4HSV A;  1BCP C;  4MIU A;  2K33 A;  1UNS A;  2EXZ A;  3MA2 B;  3K58 A;  1WTP A;  4KY7 A;  1V1P A;  3BVG A;  2B2Y A;  4IFD J;  1GUS A;  1HFG A;  3QOJ A;  2AQ1 B;  1TY0 A;  1Q12 A;  4BA1 I;  4OIK A;  4KKS A;  3S1M B;  4IQZ A;  4H7B A;  5IGB A;  5M5X B;  3FKI B;  4A3G B;  1ILP A;  5CBE E;  1JOO A;  1G6Z A;  4DAY A;  4CKB A;  1HHV A;  2R93 B;  1LO5 D;  5EGT A;  2KA7 A;  1O80 A;  1XX8 A;  1BNZ A;  4U67 3;  1CHP D;  2WAC A;  5TSS A;  2B2U C;  3OOC A;  4EGV A;  5IOC A;  2L0C A;  3DXJ C;  2WB1 B;  2HCI A;  2PZU A;  4ZLT F;  3BVZ A;  3D3R A;  3FEW X;  2F3W A;  2A74 C;  4X3S A;  5I9O A;  4K5W A;  2EPB A;  2KHS A;  5BN5 A;  2NN6 I;  1BF4 A;  2K04 A;  3UI2 A;  4JK1 C;  1F77 A;  4XQN A;  4L8J A;  3NBH A;  4Y7N B;  1VDZ A;  2ICI A;  2LFN A;  1S5D D;  2MJ8 A;  2QKI C;  2RDH A;  2J7Z A;  1B9N A;  3J81 E;  2F0K A;  3M3Y B;  5JEA H;  3T56 B;  4K5X A;  2WKC A;  3HOY B;  1B2T A;  2EY5 A;  3G7L A;  3QWN A;  1Q8I A;  5IIF A;  1PXU A;  1I50 B;  3KF8 A;  2K05 A;  2EJF C;  1B53 A;  5M3F B;  1K8O A;  1HQM C;  2F4I A;  1HPC A;  3DM1 A;  1UUP A;  2DNE A;  3ITP A;  1JE4 A;  5JPN C;  3NQT A;  4IUQ A;  3I4N B;  3IL8 A;  4ID6 A;  1G2S A;  2OXP A;  1ZYR C;  3PO2 B;  1SNO A;  1JQY D;  4PMB A;  3TP6 A;  1QB5 D;  1I4R A;  1GUT A;  1O7Z A;  1IYU A;  2NTT A;  3P7J A;  2J4X A;  4RA8 A;  3C3L A;  4C1N I;  1I6H B;  5M5W B;  5JOB A;  4RCN A;  3SK8 A;  3SVM A;  5I2X A;  1WTO A;  5EKK A;  1LTT D;  2YU9 B;  3QIA A;  3R8B A;  2NVT B;  3NQI A;  4PV1 C;  3VR4 A;  2A6H C;  1HCZ A;  3P1H A;  4F87 A;  2HCC A;  4R8N A;  5NUC A;  2KCN A;  5ELC A;  1B44 D;  5FLX E;  4J8Q A;  5KRU A;  3WOF A;  4HMJ A;  5FOB B;  2WKD A;  2SNS A;  3BDL A;  2C9O A;  4ZKB B;  1E0B A;  2PO4 A;  2NN6 H;  5C4X B;  1D5X C;  1SDF A;  1Q1B A;  3R3O A;  1PMR A;  4QB4 A;  1SE4 A;  4K5V A;  1K8M A;  2L12 A;  3NK9 A;  4RWS C;  1YNN C;  1JC7 A;  1H9M A;  1JCK B;  3O13 A;  1CA6 A;  1EY7 A;  1RTO A;  5D3D A;  1EY6 A;  5C4H A;  1LT4 D;  3ERQ A;  1SE3 A;  2HDM A;  5T1G A;  4C3I G;  1ROD A;  4A3E B;  5EBD A;  1CQV A;  1L0X B;  5FO9 B;  2EY2 A;  1V1P B;  4DXG A;  1LTG D;  1B3A A;  2A68 D;  4IN3 A;  3S1Q B;  1ZEQ X;  2E2D C;  5T1I A;  1RJT A;  2F0P A;  5JVG 3;  2KVM A;  2PZW A;  1SMY D;  2F0T A;  3TDQ A;  5DEH A;  4C3I B;  1CI3 M;  2MGS A;  1M4V A;  3BZD B;  3ERO A;  3SDZ A;  4WJW A;  2NWG A;  1MSH A;  5CR3 A;  2FMC A;  3FMC A;  4KHV A;  5C0X G;  1BCP B;  3BYY B;  1HQR D;  2HQE A;  1DJR D;  1HUN A;  2KQ3 A;  4WOR A;  3HOX B;  3NE5 B;  3GTQ B;  1SYE A;  2NZ1 D;  1A15 A;  1PTO D;  1Y1W B;  4DN4 M;  5M9O A;  1ENA A;  5HGT A;  3BDC A;  3MZ5 A;  3MHB A;  1V8Q A;  2ICE C;  1AW7 A;  2RDG A;  1IHZ A;  4A3D B;  3D6W A;  1KDB A;  1ESR A;  3HOZ B;  4KN7 C;  4QUC A;  1KNA A;  5D65 A;  1I4P A;  4KI0 A;  1A3V A;  4XIG S;  1MD2 D;  1IW7 D;  4BY7 B;  1LTI D;  5KNC A;  2JA7 B;  3MXP A;  3DEO A;  1S5F D;  2X6G A;  1BUV T;  5IT9 L;  5CV4 A;  4QIW B;  1U9R A;  1AZP A;  1W6K A;  1B50 A;  3SK4 A;  3PUV A;  1QWY A;  2RBM A;  1XXG A;  2F0U A;  4IUR A;  1O7L A;  3KLR A;  1GUN A;  3D4W A;  1LAB A;  4J6H A;  2KOL A;  4H13 C;  1YNJ D;  2AWO A;  5J39 A;  3U9O A;  4H44 C;  2EDG A;  3F2U A;  1PTO H;  4IAL A;  2NYZ D;  2N88 A;  4G57 A;  5ELF A;  1STA A;  2DY8 A;  2J0T D;  1D6E C;  4ZUI A;  3CHB D;  3ND8 A;  2B8F A;  3KUP A;  2NBF A;  3L7Z C;  2F0D A;  1EY8 A;  2ZXO A;  4CHT B;  4DFA A;  4I7Z C;  5CBA E;  3PUX A;  4HAE A;  1OXU A;  4A93 B;  4ZQ3 A;  4CKC A;  1SAP A;  1KAA A;  3S9W A;  1KTK A;  1EIH A;  2PPB C;  1STB A;  3AMU A;  2F0V A;  2AUK A;  3MXU A;  5M3M B;  2G9D A;  1TS5 A;  4RGT A;  2EY1 A;  2A6E D;  4FP5 D;  1H9S A;  3DMU A;  4OIJ A;  1DYQ A;  3EQL C;  4DU9 A;  5KIX A;  1BCP F;  1Z7T A;  3BG3 A;  2NTS A;  5I2Y A;  3PUZ A;  3MC0 B;  1DCZ A;  4XQQ A;  1Z6H A;  4RHR A;  2N55 A;  4C3J B;  3TZD A;  2F0F A;  1OO9 B;  2IX1 A;  4Z9C B;  3TSS A;  1DOK A;  1ET9 A;  4K8J A;  2VB3 X;  3QOL A;  4X3K A;  2Z4I A;  3H6M A;  1JWS D;  4FXG C;  3SE0 A;  1WTX A;  2JA8 B;  2EYJ A;  1UEA B;  4TSS A;  1JOR A;  2DN8 A;  4BWG B;  3IAY A;  2EVB A;  3PO3 B;  3J80 L;  5FO7 B;  5G3L F;  4OHJ A;  4RGO S;  1TKW B;  1JOK A;  1FNU A;  3NTI A;  2JP1 A;  3C2P A;  1G8Z D;  1G2T A;  1SYC A;  1CHQ D;  3DWQ A;  1WD1 A;  2IPK D;  1TS2 A;  3A8J E;  2CW0 D;  3U9S A;  2JE6 I;  2B2Y C;  1EY4 A;  4PQX A;  4A3B B;  1XTC D;  2IWH A;  5D3I B;  1WD0 A;  1NR2 A;  3Q23 A;  4DAP A;  3L3O C;  3HOU B;  2F0J A;  2PZT A;  3S2H B;  4F88 A;  1AN8 A;  1CM9 A;  3W3A A;  4O42 A;  4CGY B;  1IYV A;  3L9A X;  3GTL B;  1H9J A;  1GHJ A;  2Z4H A;  5DNF A;  4J1M A;  1QCB D;  2Z1C A;  1WCM B;  2R7Z B;  3D8G A;  2XSC A;  1MI2 A;  2A5H A;  3HS0 C;  3SHL A;  1A2U A;  1A3U A;  4RKL A;  2O4X A;  3M7G A;  2I07 B;  1PZK D;  3CQZ B;  1HTL D;  3VYU A;  4M8A A;  1AP0 A;  5CV5 A;  2AUJ D;  1DOM A;  1Y8O B;  4L6T B;  1VMP A;  4DNT B;  3K5M A;  4RFB A;  4M1U B;  5JJZ A;  1HUM A;  3LWE A;  1H9R A;  1CFM A;  2KCC A;  4DNR B;  4E6I A;  3KLS X;  2QF7 A;  4N9P A;  1TY2 A;  2E74 C;  1EU3 A;  1SND A;  2SDF A;  3HOW B;  2BE5 D;  4RAU C;  1TWH B;  1EWH A;  5K36 H;  2JYO A;  1EQV A;  2F0N A;  4HR7 B;  3M85 A;  1MBY A;  4WRD A;  1SE2 A;  1D5M C;  4OGQ C;  5C5M A;  2M9V A;  2PMZ B;  5C0X I;  3P20 A;  4G7O C;  2H1E A;  1SBB B;  2OF1 A;  3GD7 A;  1X3P A;  5EJW A;  1TR5 A;  2Q8I B;  4KTA A;  3I73 A;  1CK1 A;  2EJM A;  2XWJ B;  2BDO A;  4FXK C;  4IFD G;  2F0O A;  2X6L A;  1EEF D;  1HRJ A;  3T53 B;  2BA0 A;  1FNW A;  3BS1 A;  1KLG D;  2WII B;  5ELE A;  1R4Q B;  3OMG A;  1VMC A;  2O5I C;  3HRZ C;  2ENB A;  1STN A;  4RHS A;  1WTV A;  1SYD A;  4Q5V A;  1F2M A;  4C2M B;  2PNR C;  4JBW A;  4ZK9 B;  3A54 A;  2XRS D;  4PNY A;  1STY A;  5IGE A;  4XQJ A;  4P2C B;  2KUM A;  1D5Z C;  4BS9 A;  2IW3 A;  3GTO B;  4HMI A;  1H9S B;  3OPO A;  5CGK A;  3DHQ A;  5JEA J;  3Q0A A;  4OO1 I;  1RHP A;  1ESF A;  5IT9 E;  1I4G A;  1QG7 A;  4TQU S;  1BR9 A;  3K6O A;  4K6L A;  1PZI D;  2SEB D;  1I6V C;  2C5C A;  1BO0 A;  4XXE A;  2Q8R E;  2F0E A;  2VUM B;  2K5Q A;  1TS3 A;  1GUO A;  3NBI A;  3I4M B;  1QE6 A;  2AQ3 B;  1PRT F;  2NVQ B;  4NP5 A;  2QDB A;  3VYS A;  3CKI B;  3HOV B;  2QCP X;  4RCO A;  1H9K A;  2KEC A;  1KDC A;  5DAU A;  3BDO A;  5KYI A;  4KK7 A;  1OXV A;  1QNU A;  4FVM A;  5LL6 S;  3PIO 3;  4RGN A;  3SXH A;  1WVL A;  2B2T C;  4RGM A;  5KND A;  1D1K A;  3S2D B;  5C0X H;  4EQP A;  2VXW A;  3S17 B;  2SNM A;  3S1N B;  1HXY D;  3ND9 A;  5A2Q L;  4ZUJ A;  4FF2 A;  1TWC B;  2L1B A;  1STH A;  2RQX A;  4R9W A;  2F0L A;  4IZ8 A;  1II3 A;  2CVR A;  3NUC A;  3I4L A;  2K01 A;  4CJ2 C;  1A6X A;  3VR5 A;  4KMU C;  2EYM A;  2E75 C;  1ICW A;  3OHX C;  1LAC A;  3K5N A;  5J1Z A;  4NKL A;  1PTO C;  3NXW A;  4FNF A;  3A55 A;  2I46 A;  2IT1 A;  2B2T A;  4BY1 B;  5I6W A;  4IUU A;  2K5D A;  5EKL A;  4FO2 A;  3J80 E;  4EVO A;  1F2L A;  3DWP A;  1IW7 C;  2M2L A;  1JWU D;  1PRT C;  4XT3 B;  2EYL A;  1IKM A;  1SNQ A;  1E2Z A;  2IX3 A;  3TP5 A;  1W6J A;  3KLS A;  4OO1 H;  3P75 A;  1CZG A;  5C3W A;  3TN2 A;  4ABN A;  3QG1 A;  1TU2 B;  2FIN B;  1MSG A;  3D4D A;  2K32 A;  4XT1 B;  3GTG B;  1VF7 A;  2QIL A;  4DGZ A;  3TBI B;  5LL6 X;  1ONL A;  1QIL A;  3NSW A;  2JEB I;  3T51 B;  2L9H A;  5A35 A;  5KNB A;  1XYI A;  3QB3 A;  3Q22 A;  3H91 A;  3W2D A;  1VCI A;  4F8M A;  1CTM A;  2JA6 B;  3J81 L;  1LTB D;  2ZXP A;  2RDF A;  3J7Y W;  2NN6 G;  4EQO A;  5FKA C;  3GTP B;  1IL8 A;  1V43 A;  3RZD B;  3GV3 A;  1I3Q B;  4PMW A;  1EU4 A;  1B4O A;  3NP8 A;  1GHK A;  4XYO A;  1U4P A;  4N9T A;  4BBS B;  5HUR A;  2A6E C;  4KHZ A;  3VA7 A;  2B2W C;  2XIW A;  3RD4 A;  1I4X A;  1RCV D;  1FD7 D;  1I4Q A;  3D31 A;  3KBX A;  3JAM L;  5EKI A;  2RA4 A;  1JR0 D;  4QCL A;  3MFG A;  3MVV A;  2E2J B;  1GUW A;  2A73 B;  5D14 A;  5IGF A;  4KD3 A;  4B9W A;  2HDL A;  5KYL A;  3ZYY X;  1FGB D;  2RKS A;  1T5E A;  2ZXR A;  1G91 A;  2B2V C;  4L63 B;  3HKZ B;  4OL7 A;  4H0L C;  2RVL A;  4KKT A;  3HZX A;  5CC4 A;  2OT2 A;  1SNM A;  2B2W A;  4LK1 C;  2CHB D;  4C3J G;  1SEB D;  2F3V A;  3CU7 A;  4LAA A;  1SXT A;  4IUN A;  2EYF A;  5FLX L;  2CW0 C;  4C1N K;  1C48 A;  1PFM A;  1LT3 D;  3PUW A;  3V96 A;  1OXT A;  3I70 A;  1R4P B;  1EWC A;  5FO8 B;  1LTS D;  1EOT A;  3AB9 A;  3H0G B;  3QO2 A;  2M00 A;  1LTA D;  2X69 A;  2OEO A;  1SJE D;  2D2C C;  3C1F A;  1PFN A;  1EYD A;  2RSN A;  3S15 B;  3A7A B;  4TKO B;  3EFX D;  3J7A V;  4KY6 A;  1ILQ A;  4B9X A;  1S5C D;  2O5J C;  2B2V A;  3LX0 A;  1BBX C;  2K28 A;  4KJO A;  2EYO A;  1KAB A;  2F0I A;  4V19 0;  4ME5 A;  2E76 C;  3GQB A;  5IGD A;  2B8G A;  2BA1 A;  1S5E D;  3J7A F;  5I4D A;  2EZV A;  5AFW A;  1HFN A;  2F0Q A;  4KY5 A;  4HTH A;  3NHH A;  2XWB B;  5EPK A;  3R93 A;  1EIG A;  3Q24 A;  5IGC A;  1EY9 A;  1SYB A;  3HEJ A;  3K7A B;  5JVH 3;  5DM7 3;  1DM0 B;  2IL8 A;  3WOE A;  1EZ6 A;  1BXT A;  2XRQ D;  5M5Y B;  1ET6 A;  1Y69 U;  4K14 A;  4HSP A;  4KJN A;  2BE5 C;  1PDQ A;  5KEE A;  2BCO A;  4A3M B;  5FK9 C;  5CV9 A;  4MN3 A;  3N6R A;  2A69 D;  3FPU B;  1D2B A;  2PW7 A;  4CKE A;  4A3I B;  3GTM B;  2LKV A;  2KJX A;  1PTO B;  2O2L D;  3LWU A;  4K6D A;  2F0S A;  3HGB A;  1XWE A;  1O7Y A;  5C4Z A;  3CRK C;  2EYH A;  2D9U A;  3QJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...