1WVLA

Crystal structure of multimeric dna-binding protein sac7d-gcn4 with dna decamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKKGVLKKLRAVENELH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*AP*TP*AP*TP*AP*GP*G)-3'
publication title Design and characterization of a multimeric DNA binding protein using Sac7d and GCN4 as templates
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Structural protein/dna
total genus 19
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wvlA00
1HUNA 2B2UA 1PFBA 2NZ1D 3MTSA 2L1BA 1J9OA 2K05A 3FPUB 1CA5A 1ILPA 1EQTA 1QG7A 5AFWA 1EL0A 1RJTA 1KNEA 2B2YC 2CVRA 2J7ZA 1J8IA 1F9QA 5E4WC 1HHVA 1HFGA 4HEDA 3G7LA 2B2YA 4R9WA 1B50A 3SVMA 1PDQA 5T1IA 1HUMA 1U4PA 2DY7A 2NYZD 2EOTA 2B2TC 5DNFA 1ICWA 1F9RA 2FMMA 1DOLA 2KOLA 5D14A 2HDMA 1G2TA 4OIKA 5EPJA 4IUPA 3I8ZA 4QUFA 1DONA 4IUTA 1JE4A 1X3PA 1HRJA 1CM9A 1CA6A 2H1EA 1BBXC 4HSVA 1F2LA 1RTOA 1IKMA 1U4RA 1BNZA 2B2UC 2MPMA 1SAPA 1RHPA 1VMPA 2VXWA 1G2SA 1JICA 2K28A 1AZQA 1MGSA 5EJWA 1KNAA 1SDFA 4MHEA 3D6WA 4XT3B 2FFKB 2MJ8A 5EPLA 3TZDA 1RODA 1G91A 4CJ2C 1DOMA 3KBXA 4XDXA 1C8CA 4IUQA 4LMQD 1WTRA 1DZ1A 1F9PA 1S4ZA 1QNKA 5COYA 2SDFA 4OIJA 1O7YA 2JP1A 2M2LA 2NWGA 2DY8A 3IL8A 4IURA 2K04A 1U4LA 1NAPA 3Q6SA 1A15A 5EPKA 1U4MA 3I91A 4NW2A 1SSOA 5T1GA 1ZXTA 2L11A 3UI2A 1MSGA 1RTNA 1NR2A 2K03A 4RAUC 1MI2A 4U68A 4R8IA 4X3SA 1B53A 3DEOA 1PFMA 1ML0D 1WTWA 1BO0A 2MP1A 4MN3A 1X3QA 2RA4A 4IUUA 2K1BA 1AZPA 1Q3LA 1F9SA 2L4NA 4CJ1B 4O42A 2N55A 3GV3A 1G6ZA 2XIWA 1ILQA 3FDTA 2FJ2A 1QE6A 1B3AA 1O80A 2L9HA 2JYOA 2Q8TA 1AP0A 3DM1A 1WTQA 3MWYW 3HP3A 4UAIA 2FINB 1B2TA 2RSNA 4X3UA 1M8AA 1WVLA 2EE1A 1NCVA 2MGSA 2RVLA 4RWSC 1B4OA 4ZK9B 4ZKBB 2EPBA 2HCIA 3P7JA 1ESRA 1DOKA 1PLFA 2KUMA 1WTXA 4IUVA 1WD1A 1EIHA 1IL8A 1X32A 1XX8A 2FHTA 4XT1B 1HA6A 1TVXA 2KEDA 2X6LA 2HUGA 2R3ZA 3I90A 3DEPA 3IFDA 2HDLA 3KUPA 5EQ0A 4ZLTF 1WTOA 2HCCA 2KECA 2B2WC 4CJ0B 4HCSA 4DN4M 2B2WA 3H91A 3QO2A 3R93A 1EIGA 4X3TA 3I3CA 5CMDA 4RA8A 4ZAIA 1MSHA 2N88A 2X6GA 3F2UA 4QUCA 1EOTA 2BDNA 5CBEE 1WD0A 2K01A 1LV9A 3ONAB 1PFNA 2B2VC 2KEEA 3N52A 1WTPA 2B2VA 1BF4A 2B2TA 1GUWA 5E4XA 2RSOA 3GV6A 5EKIA 2KVMA 1WTVA 2IL8A 5D65A 2L12A 1NR4A 4HAEA 1XYIA 3LWEA 2X69A 4X3KA 3TN2A 1VMCA 5CORA 1IKLA 1O7ZA 5CBAE 4ZKCB 5JJZA 1HFNA 1E0BA 2D9UA 2Q8RE
chains in the Genus database with same CATH superfamily
1UEAB 3NP8A 2EZVA 4FXDA 2E2HB 1T5XD 3I56A 1Z6HA 5FLXE 3K80C 4DK1A 3PO3B 1SNOA 5T1IA 2K5DA 2I0QA 2PNRC 2YU9B 2KCTA 4H0LC 4A3LG 2VQEQ 2EIFA 3ULLA 3S1MH 2JA7G 3CPFA 3IKJA 3HOVB 3CRKC 3M4YA 4LF5Q 4HSVA 1JWUD 3BDCA 4X62L 1IKMA 3PV0A 2MPMA 1CTMA 3DWQA 2LSSA 2ZM6Q 4IOCA 1JICA 1AZQA 4EQ5A 2PZTA 1STNA 1E1TA 3PGZA 3VYSA 1DOMA 1UAPA 3KBXA 5FJ8H 3CKIB 1WTRA 4BBSB 1L2FA 2NWGA 4RKBA 4JI4L 3A74A 4A93G 5M9OA 3CXCA 4DV2Q 5IY0A 3W5OA 2F52A 1TS3A 5LMNQ 2K03A 4R8IA 1WCMG 3K8AA 2RA4A 2F0KA 2L4NA 4RFBA 1EWCA 1Z47A 1C0AA 2BA1A 1UUPA 4FF2A 4BBRH 5HURA 2B63B 1Y1VG 4GS3A 4L5SA 4CDEC 1TWAH 3JAML 4ZK9B 3NELA 2ES2A 4O0AA 5EKLA 2R93G 1XX8A 1PA6A 1GM5A 4LFBL 5FLXL 3NENA 5A2QE 3A8KE 1WI5A 2OEOA 5ELNA 3CU7A 1YNJD 2GVAA 1WTOA 3HOZH 5KGUA 3P20A 1HR0Q 2WP8J 3GTQB 1XPOA 3EN2A 4LF4L 1N36Q 2QEJC 2F3WA 3VA5A 1J5EQ 3S14H 1I94L 3PF5A 1PFNA 4KN7C 4B9WA 3N52A 3D31A 3OTOQ 4FVMA 3S1MB 4C1NK 1NJIC 2VB2X 1IBML 1PH9A 1D1KA 4JC0A 2RCFA 5JJZA 1DGSA 1NMFA 4L63B 4LF8Q 1EYGA 2NZ1D 3FPUB 1EZ6A 5J3BA 3L2PA 1YHAA 3K0XA 1CQFA 1JWMD 4UY8C 1HFGA 1PHJA 5M3FH 1HUMA 2I07B 4CDDC 4YHHL 1TR5A 2HDMA 1SBBB 3QIAA 5IP7G 4JW0A 4DR1Q 1UWVA 4NXMQ 3Q24A 4PNYA 1G291 1G2SA 1EY0A 3I4MB 1SYDA 2LY7A 5EJWA 1G6ZA 4BBRB 2VUMB 2NVXH 4DR3Q 2QEXA 4DV6Q 4A4IA 4FXGC 4DV5Q 5C6AA 1YEZA 2F0QA 5A2QL 2BE5C 3QB3A 1TWAB 1RCVD 2SNMA 3I70A 2ZXRA 5T1GA 3C2PA 5CR3A 4KV6A 1DCZA 3IAYA 3PIP3 1A3UA 5JVG3 4A3CH 4X3SA 1B53A 1SMYD 3RZDH 3RLFA 5ELFA 3S9WA 4RCOA 1AH9A 4IFDJ 3KK7A 1KHIA 3Q22A 5IGFA 4OX9Q 1L1OC 1PTOF 2PNHA 4CHTB 3W2DA 2JA6G 4WFN3 4ID6A 4S3SA 4RWSC 1N33L 1I50H 1K0RA 1I4XA 3D6CA 3A55A 3RNUA 4DR4L 4NXNL 5DM73 1HPCA 4BY7B 1WYDA 2B2WC 3C1EA 2WAQB 2YTVA 4RGMA 1X3FA 5JJLA 2X6GA 1GUOA 3K58A 1L0YB 2KHIA 1CFMA 2M9VA 2G5DA 1SNDA 1YBYA 1OXSC 4YWLA 4DR7Q 2QILA 1WD0A 5M3FB 4DXFA 1F77A 1T5EA 3UDFA 3V96A 2DNCA 4PZ7A 1HQRD 3EROA 1K83H 2XVSA 5EKIA 2ID0A 1ICFB 3MC0B 4DAYA 4N8X1 2L0CA 5DAUA 3H09A 3DHQA 3NHHA 3AQQA 4CDFC 2F0OA 2RBMA 4FF4A 3HG9A 2JJQA 4A3MG 2F3VA 1RJTA 4M8AA 2Z6BA 4C3JB 2J7ZA 4GKJL 4MNOA 3HKZG 3SVMA 1PDQA 1U4PA 5CV5A 3NE5B 1BKBA 3QWNA 4A75A 1ICWA 2Q8IB 2F0VA 3I8ZA 3NK9A 4YCUA 4JI0Q 2I5LX 3PMFA 1GVPA 4BWGB 3OW2A 1J6QA 4JVZA 2E74C 1KL9A 3QOJA 3RZDB 4DU9A 1I4HA 1IYJB 1EQQA 2AQ1B 1TWCH 4JI3L 3H94A 3RLNA 1G91A 3TZUA 2NN6H 4DXGA 5D3DA 5DLQE 2ASBA 2UXBL 3FHWA 1TS2A 1QNKA 2R7ZG 2JA5G 2UXCQ 2JP1A 2NVYB 3IL8A 2CKZB 4EQPA 2K04A 3PIOA 4DV3Q 1I50B 2Q2UA 2E2JH 4BA2I 3S17B 3I91A 3E6ZX 5KNCA 2MNAA 1CQVA 3R2TA 1PFSA 1X3EA 1LT3D 3VYUA 1ML0D 3HOWH 4IUNA 3VR3A 1B9MA 4FF3A 2K6AA 3GV3A 1TIID 4JK1C 4CKCA 1HZBA 3J7AV 3GTKB 1KRSA 1X6OA 4X6AH 2A5HA 4UP9A 3MVVA 3D4WA 2HD3A 4DAYB 1VQOA 1LTLA 2K75A 1O7IA 3FKIH 4I65A 1B3QA 1EIFA 1K83B 5FO8B 1E1OA 3SK4A 4BA1I 3CC2A 2EYLA 1G8ZD 3I90A 5IP9G 1XMQL 1XNQQ 2RKSA 4ZLTF 1LTTD 5I9PA 1IBKQ 5IGCA 2F0NA 4QF4A 2CHBD 3I55A 1Q8IA 1JE5A 1N34Q 1JT8A 2D2CC 1HCZA 1OO9B 3K6OA 2JXMB 2V4DA 1WTPA 1WTHA 1SYBA 1ENCA 3GV6A 3TSSA 4KD4A 1YNNC 4QJFA 1X3GA 5CBAE 1CSPA 3PQIA 2O5IC 2NVQB 2E2DC 2SEBD 5C4JB 4E6IA 4XXEA 3CC7A 2E5LL 3CCLA 3M9BA 1MJCA 2QGQA 2VNUD 2OWOA 2Z4IA 1X56A 1YZ6A 1EEID 4N9TA 3NQTA 2E2JB 1JB3A 1S5BD 4IUPA 1TQOA 1LYLA 4Y7NB 4U673 3HOXB 1QB5D 1JE4A 5CGKA 2Z0SA 4DF7A 3HOWB 4JV5L 2A69D 4K0KQ 1G51A 1M1KC 1PZKD 3K57A 3A5ZB 2EYOA 4YWKA 2IX0A 1H9SA 1QWYA 1YIJA 1PH7A 1C8CA 4DFAA 1NY4A 1F9PA 5COYA 1BXTA 3FKIB 4DV0Q 4DV4Q 3ND9A 3WWVA 4IALA 1KQSA 1NAPA 3H0GG 3SK5A 3LWUA 3MA2B 2PMZE 2L11A 3CW2C 1BCPD 4L5QA 1YITA 3RN2A 4JG2A 2UUCL 1XPUA 2N55A 3G48A 1VQLA 4XTCS 2BA0A 3M4OB 1GHJA 4A3FG 3ULJA 1PH6A 4HJ9A 4KD3A 1M8AA 4A3GH 4A3IH 4KY5A 1XMOL 1STHA 1VQHA 1QUQA 1ESRA 2A6HD 1CKMA 2VQFL 3PUXA 4L5RC 5LHY1 1VQGA 3RN5A 2F0JA 1JOKA 2AKWB 4JI7Q 2DUDA 3MHBA 2UXDL 4RMFA 5EBCA 1EYCA 1H9MA 1GUTA 4CGYB 4GNXA 3J7YW 1YHBA 2MO0A 2QDLA 3SXHA 5EKKA 1Y1WH 4C3IG 1GUWA 2RCNA 1TWFB 4HAEA 4POGA 3L9AX 4DUYQ 3TP7A 4GOPA 1X9NA 1HNXQ 2K05A 5JJKA 2R92G 3NTKA 2RHQB 2K33A 1KNEA 3MAQA 1SNCA 5E4WC 5IODA 4UHVA 2ZTCA 3SK6A 3DWAA 5IYDH 1LABA 1HZ9A 3HOYH 3JAMi 4X64Q 3S16H 4KJOA 1STEA 4KJNA 3T1YL 1QZHA 3J81j 2NTTA 4LF6Q 3G6EA 2XWBB 1QUQB 1ESFA 4JOIA 4IPCA 4YWMA 5DM63 1B1ZA 4Y52H 3AU7A 2EYMA 4CJ2C 1CKOA 1U9RA 3MEFA 2IHFA 4OHJA 2SNSA 3HFZB 3NPPA 2K5NA 4A3GB 1EY5A 2JA8H 2F1MA 4DAPA 3HGBA 1X55A 5GROA 5C3EH 1MD2D 1UNSA 1JQYD 1VQ7A 4B3SQ 2XIWA 3U50C 5M3MB 4IFDH 1ILQA 2K50A 4FDBA 1S5DD 4NPSA 4R4IA 1XNRQ 4GOPB 2WIIB 3K5NA 4DV7Q 2LXKA 4UAIA 2FINB 1JMCA 1NCVA 3PO2G 4RGNA 3S2HH 4JBKA 4ZKBB 1LT4D 1FNVA 1N8RC 4IPDA 1X32A 2PQEA 1EQRA 4BXXH 3GDEA 2ZXOA 4KI0A 5C0XJ 3KF6A 3T4AC 1KAWA 1SJED 2EVBA 5FLXc 1BVSA 4GLXA 4CKEA 4HJ8A 1CZWA 1B9NA 3I3CA 4UP7A 1RD9D 4BY1H 1D6EC 5C4XB 3J7ZC 2B63G 4DV1L 3J81c 3OSOA 1LTAD 1AE3A 2ATWA 1ZYRD 4HN7A 2KEEA 3NSWA 1E24A 3SR1A 1WOCA 3HOYB 3V2TA 2A6ED 2L12A 4B3MQ 3TS2A 1NR4A 4G7OC 1SE3A 5CORA 2GA4B 1PRTB 1XWEA 2AQ3B 1BDOA 2N49A 1Q12A 1HUNA 3HKSA 4QCLA 5JEAG 2CQOA 3CQZH 1SFOH 1TT2A 5I2XA 1HNZL 1NBWA 1HHVA 4HJAA 2B2YA 3KLSX 2JEAI 4KLKA 5IIFA 2DY7A 5C44G 2EOTA 5DNFA 4F87A 1SR3A 2YV5A 3ZJYC 1VQ4A 2IX3A 1Q1EA 3AEVA 4A76A 1TU2B 5EPJA 3Q0AA 2JA8B 4A3BH 1MIUA 2XNAC 1KLUD 2F0UA 2L5TA 2UUAL 1PYSB 3GTOB 4KY7A 2BE5D 5C3EB 1BBXC 3TRZA 5GQOA 3F2CA 4L5TA 1Y8OB 4G7HC 3DUZA 1IW7C 1EFWA 3E5SA 1AW7A 3KF6B 4OGQC 4EQNA 1ASYA 2ZM6L 3FP9A 4LMQD 3F1ZA 1KXLA 1TY2A 2SDFA 3LNNA 4ZUJA 1D1IA 1NMGA 3J81E 3S2HB 3Q6SA 1S40A 2IY5B 1PTOH 3BYYB 1ASZA 2V1CC 5K36H 2EYFA 3T16A 1EQVA 4DV2L 4AQYQ 4OXPA 5LMNL 4JI5Q 4A3JH 2O4XA 4K8IA 5ELBA 4HJ5A 2F3IA 2ICIA 2JA9A 4JYAQ 1H9JA 4BY1B 1IYUA 3ERSX 2KCCA 5AJ3L 4X65Q 2VUMG 3ZYYX 1D5XC 3P75A 2BH8A 3I4NH 3T51B 2LS01 4KMUC 3CD6A 1DJRD 2HCIA 3S1QH 5BR8Q 1OTCA 1TVXA 3I4LA 4HIMA 4XYQA 4IFDI 2RHSB 3DEPA 4L8JA 1DYQA 4JI2L 5CMDA 2NZOA 4G4KA 4ZAIA 3CQZB 2N88A 1GD7A 3F8TA 3TREA 4HCEA 3K7UC 1HR0L 3KOJA 5CBEE 2EY5A 4XIGS 3AMUA 1VF7A 4A3EB 1N36L 1IYVA 4A3LH 1BCPF 3OPOA 1HTPA 1NNXA 2JA7H 3HKZE 4X62Q 3W1GA 5LL6X 2IL8A 1YJ9A 4KHPL 3D3RA 3OTOL 3GP7A 4BY7G 2D9UA 1IHZA 4YY3Q 3C3LA 1I4PA 1BOSA 5I2YA 1CHQD 1QJOA 4OL7A 5AFWA 3J81L 4LF8L 1Y69U 3G4SA 1PTOC 1Q90A 4KKUA 1VQCA 4K6LA 2AMCB 2TSSA 4O2DA 4A93H 4LF9Q 2D5DA 2B2TC 3JC66 3VYRA 3RLOA 2ZJPA 1KTKA 4P71A 2F4VQ 1VS0A 1WCMH 4N8FA 4AIMA 1LTRD 3CMAA 1CM9A 4JI1L 1XPRA 2QCPX 4A3JB 3NXWA 1RHPA 1A63A 4ODGA 1A3TA 1Y1VH 1MGSA 4C3JG 1LACA 5KRUA 2NVTH 4JI6L 2IPKD 2ZT9C 2TMPA 3I4NB 3BDOA 2BCOA 2R93H 3BVZA 1A15A 2R61A 1JORA 3S1QB 2Q2TA 1RTNA 1NR2A 5FLMG 3DEOA 1WTWA 3V05A 4LF4Q 2MP1A 1BQQT 4UPAA 5BN4A 3GTPH 1LTGD 3BZCA 3RD4A 3DM1A 3S1NH 5L37A 3CCVA 1P8LA 2N78A 1IBMQ 1DXMA 4MTNA 1WJJA 4J8QA 1PVOA 3NBIA 3DM3A 3BS1A 1AN8A 1DOKA 1JJ2A 1EIHA 1IL8A 1VQDA 5JOBA 3PCOB 3VA7A 4DR2L 1FJGQ 4HIDA 1Q8KA 2WACA 2OCEA 2PPBC 1JCKB 1RF2D 3KBGA 3HOZB 1PH8A 3QO2A 2JN4A 1EWIA 1GXDC 4R8NA 1H9KA 2PCFB 1YNND 3VR2A 4YHHQ 1JWSD 2F0GA 2Z6KA 5IGDA 3RR5A 3S14B 4A93B 5H1SE 5IP7H 5IYCG 4L6TB 2K14A 4WORA 3W1BA 1D7QA 3MXNA 1SROA 1TKWB 1XYIA 2J4XA 1L1OB 1O7ZA 4EVOA 2YTXA 1VQFA 3CRLC 4IQZA 3QR8A 3CF5A 3R8BA 2F0SA 1EQTA 1Y1VB 4HMJA 1LO5D 2CVRA 2PW5A 2NVTB 1B44D 5JVH3 2C9OA 3BU2A 1PH5A 3GTJH 2H4OA 2J0TD 1I3QH 2E8GA 3CCMA 3K7AH 1DOLA 2A1AA 3EJIA 1F2YA 2OTJA 1SNMA 3EQLC 1Z9FA 1JC7A 1EOVA 3STBC 5GAHC 4OO1G 5C0XG 3RZOH 1SYEA 2ZXPA 4LFCL 4JI8L 1BNZA 2B2UC 4RHSA 2ZTEA 3CAMA 1V1PB 3GTPB 3RMHA 2KCMA 1PYWD 2NVXB 2JA6H 4XDXA 3S1NB 4IUQA 1S4ZA 3E0JA 5IYCH 5I6WA 3MXPA 4NXNQ 2Q2IA 4HR7B 4ME5A 4FP5D 3NWTA 3HOUG 3C46A 1KLGD 1V1QA 3HOXG 4DV3L 2UU9L 1FL0A 4KK7A 4EX5A 3BJUA 4IPGA 3D4DA 4DAVA 1X3QA 1EY8A 2CW0C 2NB0A 4RH6A 4CJ1B 4PQXA 3MXNB 2O2LD 5KNBA 4JBMA 3L3OC 1JJGA 2H5XA 2EYJA 1K8MA 1EFID 1B7YB 3L7ZC 1B4OA 1KIXA 2EPBA 4FNFA 5GAGC 1I4QA 4A3KG 2Y0SE 2KEDA 2NUCA 2EDGA 5HGQA 5ELDA 1YJNA 5C5LA 1E2VA 3MXUA 2D0OA 1LLRD 4GKJQ 4WJ4A 5JEAJ 4XQQA 4A3MH 3KFUA 2PYKA 3T1HL 2VZAA 3GD7A 4P74A 1VQ8A 4YIJA 2PI2E 2GVBA 1SNPA 2B2VA 3U58A 1I3QB 4V190 1R4QB 2C35B 2D62A 4JI3Q 4DGZA 2Q8RE 3RZOB 1I4RA 4Q0FA 1J9OA 2UXBQ 3TBIB 2AWOA 3FRPB 1QCBD 2KJXA 4IN3A 2R7ZH 3PSIA 2JA5H 5IWAL 2JA6B 4R4TA 1GUSA 1NUCA 1GO3E 3EA6A 2KOLA 1KAAA 3A7LA 4IPHA 2B3GA 1QILA 1HNWL 2JSOA 2F0HA 1VDZA 1N32L 1F2LA 4TVAB 4UDUC 4IO9A 4QGUA 1TWCB 3I2ZA 2K28A 1LUZA 4MHEA 1TS4A 4K0KL 3ITPA 1FNUA 3HS0C 2F0WA 1SMYC 3N6RA 1DZ1A 4ULLA 1P16A 2B39A 1MKHA 2VL6A 3H3VH 1XMQQ 3M7GA 5IP9H 4GKKQ 5I4DA 5FOBB 4JBJA 2XRQD 5FO7B 5HY6A 3U4ZA 4A3MB 4AYBE 3CMEA 4J6HA 2K52A 1VQ5A 3HKZB 4IOAA 1PZJD 3KF8A 2UUBQ 2F0LA 4QL5A 4KKSA 3EFXD 3NEMA 1F2MA 1E2ZA 2RVLA 1IBLL 4P2CB 4QIWE 4P72A 1PLFA 1EIYB 4HMIA 4IUVA 2PO4A 4O1NA 3S1RH 3GTMH 5FO9B 3ND8A 5EQ0A 1PRTD 4V0BA 4DNIA 3ULPA 1LTID 2EJMA 1K73C 2G9HD 5M3MG 3EVQA 1D5ZC 3CCQA 4KHZA 1OXXK 4AH6A 4OO1I 1YNXA 2A68C 2R7ZB 2JA5B 1LV9A 2F0EA 3ONAB 5C0XI 1FNWA 2WV6D 4H13C 1KC8C 3CCRA 4Q5VA 3K5LA 1ENAA 3M4QA 3SDZA 2Q2HA 2E2IH 1HFNA 2AUKA 2WB1E 1KABA 2E75C 2P5ZX 3BVGA 2WKDA 2ENBA 4DUYL 1JJCB 5LMUL 1QG7A 3BZKA 1V43A 3H3VC 4DA2A 5G3LD 4LJZC 1H95A 4R9WA 4J1MA 1B50A 2XTIA 1L0XB 4C3HG 2HHHL 1PH2A 3H0GH 3UDGA 4CDCC 5ELCA 2HQEA 4B3RL 3BYTB 1CZGA 3NQIA 5ELEA 3KF8B 3WOEA 1BBUA 1D2BA 1CKNA 1HZAA 4X64L 3PF4A 4A3DG 1RTOA 2IT1A 1U4RA 4K2KA 1TY0A 3G71A 1PZID 4LF6L 4DNRB 4NP5A 2DGYA 4A3FH 5IYBG 1KNAA 1SDFA 1XMOQ 3D6WA 1GKHA 4CBVA 4OWTB 4DR6Q 2AUJD 3ER0A 1W6KA 4OIJA 1CUKA 4PG3A 3I72A 2KQ3A 4NW2A 1SSOA 2WKCA 1MSGA 2DNEA 1X65A 3M7NA 2UXDQ 3GTMB 5J1ZA 1VQNA 4DK6C 1ONLA 4R4OA 1TWGH 2VS1A 4DR5Q 3MEHA 2K4KA 1QE6A 3H3VI 3J81i 2OQ0A 4B3SL 2DN8A 4K5XA 4XQJA 3PO3G 4C3IH 5IGEA 1B2TA 1WVLA 1XNRL 4C2MH 4QY7A 4A3IB 2N3SA 3L0OA 2K5HA 5CV6A 4DV7L 4XQNA 3TP6A 4LFAL 2VY3A 1C7YA 3NTHA 3W3AA 1XTCD 2EQSA 1HQMC 1PH3A 3OMCA 3HOVG 1Z7TA 2HDLA 1Y8NB 1KDBA 3P1HA 2R92H 1VQPA 1V8QA 1MSHA 3F2UA 4GNXC 3PIO3 1CKNB 2BDNA 2JEBI 2LMCB 5E7NA 1OXUA 3NBHB 3K5MA 5LL6S 4BBSG 2LKVA 1H9RA 4ZYSA 1Y1WB 3T53B 2ALYB 2PI2A 4KY6A 4ZCKA 4LF7Q 3NWSA 3UDIA 1EWHA 3LWEA 2QDBA 1VMCA 3IFDA 4P73A 2E2HH 4X66L 3PIPA 2NZHA 4IZ8A 3OYYA 3SGIA 1J8IA 3G7LA 3F2DA 2PQAB 4A3EG 2YU9H 4OONA 1HA5A 2A69C 3SK8A 1D5MC 4PZ8A 2FMMA 1LM0A 3QJYA 5EAYA 1PYBA 1S5FD 1G2TA 4OIKA 3PUVA 4QUFA 3I73A 5EBDA 3TP5A 1QVFA 1NTGA 3J80c 4IUTA 3S16B 3URYA 1PH4A 1I6HH 1CA6A 4MTKA 3VR4A 2H1EA 4WJ3M 1V1OA 1TWGB 5C4HA 1SE4A 2PW7A 1JOQA 1ENFA 3OIQA 2F4IA 1IXRA 3KYHC 1BCPC 2YTYA 4XYOA 1QVGA 2Y0SB 4C3IB 3A8IE 3PO2H 4LUOA 4HIOA 2M2LA 4CKBA 1U4LA 1SJHD 3LGJA 1ET6A 1M90C 4U68A 4HSPA 4DUZQ 3R3OA 3A5UA 1R9TH 1BO0A 2VQEL 4DV1Q 4AQYL 4LF5L 2B63H 4RHRA 4JI5L 1PMRA 3FDTA 4J15A 2A6HC 1JOOA 1N9WA 4RG1A 1A6XA 2ZJQA 4JYAL 3IRBA 2RQXA 5FJ8G 3HP3A 2RSNA 3FPPA 4ME3A 1BR9A 5E3FA 1ET9A 2E76C 4ABNA 2F0MA 4DAMA 4EQOA 1X54A 5I9OA 3MFYA 4DK0A 2A8VA 4DNTB 1EY9A 4JBWA 1SMXA 3NUCA 2YYZA 5KEEA 3FVQA 4G57A 1I5FA 5JEAH 3J80E 2OT2A 3GTQH 3D0FA 4X3TA 3B6YA 2D0PA 4KKTA 3I4MG 4M1UB 1EOTA 1Q81C 1B70B 4BBRG 5C44H 3K59A 1PXUA 4BS9A 1XTDA 1BF4A 2JK8A 2UUAQ 2B2TA 4B3TQ 1SEBD 1RIPA 2HQLA 2L55A 4KHPQ 1FYCA 5C3XA 2FMCA 1VQMA 4RCNA 1I6HB 5IGGA 3UE1A 1SYFA 3ERQA 2Z8LA 5EPLA 1HNZQ 3HOZG 2L1BA 5TSSA 5NUCA 1EL0A 1DM0B 4YY3L 2FXQA 3STBD 3CCSA 2B2YC 1SFOB 2KBNA 1KD1C 4FF1A 4HEDA 1LT6D 2EY2A 3PO2B 1DD2A 3E0EA 1F9RA 3O13A 1PRTF 2Z1CA 1J5EL 1GUNA 2A73B 4LF9L 1QOHA 4A3BB 4OWXB 1KRTA 4AYBB 1W6JA 4N9PA 5IT9c 3PUZA 1R9TB 3U4VA 2F4VL 5AJ3Q 1VQ9A 1E22A 3K81C 3I4MH 3SEBA 2VW9A 2WAQG 2VUMH 4XT3B 3T13A 4QIWB 3TZDA 1Q86C 4JI4Q 1A3VA 1FD7D 2PMZB 2CW0D 5M3FG 3VR6A 5D3IB 3QG1A 2DJFC 4IURA 1QNUA 3J80L 5HGTA 4OELB 1K28A 1IZ6A 1PTOB 4RGOS 5GAEC 4RAUC 1MI2A 4JI2Q 4FXKC 5G3LF 1GOZA 4MN3A 2XGTA 1I6VC 1AZPA 1M4VA 4DR1L 5BN3A 3M3YH 1LTSD 2HIXA 1OXVA 4NXML 2FJ2A 1SYCA 2JYOA 5C44B 1L1OA 4LFBQ 4DR3L 4DV6L 3P7JA 1WTXA 2WB1B 3HEJA 4DV5L 4GN4B 1C4QA 4ALPA 1AFPA 2X6LA 2AWNA 3E9HA 2M00A 2ICEC 4BY7H 4QB4A 4HIKA 1ZYRC 4A3CG 1R4PB 2HCCA 4F7XA 1FJGL 2B2WA 3KJPA 1KDAA 1RL2A 1EIGA 1I94Q 5IT9E 2K5WA 2A6EC 1VQJA 4P75A 1GHKA 1A2TA 2A74C 5JJIA 1C9OA 3PUYA 1K8AC 2MQHA 3KLWA 3J7AF 4JI1Q 5JAVA 4OX9L 2JA7B 1V1PA 3CHBD 3CC4A 3KJOA 1CT1D 3OIPA 4X3KA 3TN2A 1XJVA 1VQEA 2B2UA 4JI6Q 1ILPA 4K8JA 1U0LA 1WFQA 4C3JH 3H6MA 4H7BA 3DWPA 1F9QA 3A7AB 5EGTA 2EYHA 4NKLA 2MO1A 3BVMA 3I4OA 4C1NI 4PMWA 4DR7L 5I6YA 3I7FA 5FLMH 1RKNA 1X3PA 1WCMB 1G6PA 1HRJA 1A0IA 3GTLH 2XRSD 2QA4A 4Z9CB 1B8AA 3M3YB 4TSSA 4PMBA 2PZWA 2B29A 3X3NA 3OMGA 1K3RA 2FFKB 4LAAA 1YHQA 3A0JA 3C1FA 2B8GA 4K14A 1UE5A 3OWEB 4ZUIA 3SHLA 2NVYH 4DPGA 4DR2Q 2VB3X 4OWWB 3M4PA 3S17H 1EY7A 1ZKOA 2R93B 1TWHH 1ZXTA 4FYDA 2EXZA 5IT9L 3BDLA 1SYGA 3MFGA 2MFIA 4JI0L 3CP0A 4IUUA 2K1BA 1Q3LA 1MBYA 5CV8A 3GTKH 1HZCA 3KDFA 2SOBA 4G7ZC 1EY6A 1CSQA 1B3AA 1O80A 3MZ5A 1FVIA 4K6DA 1N33Q 2K7VA 1WTQA 2NN6G 1II3A 2BH2A 4GZYC 2CQAA 1TXYA 4DR4Q 1E7ZA 2F0DA 1HA6A 4PV1C 4XT1B 2QF7A 2UXCL 2F0IA 2A68D 1STBA 2R3ZA 4H02A 2IWHA 2KECA 3HOWG 2CH4A 2K5VA 3D4RA 2EY1A 2EYPA 2Z6KC 4QUCA 4K5WA 1RDPD 2K01A 4R4QA 2JE6I 3AB9A 1YNJC 2KENA 2K5QA 3FKIG 2I46A 4LFCQ 4JI8Q 4OO1H 2R7DA 2R6GA 4APVA 2X69A 5C0XH 3CPWA 3EBEA 1OXTA 3PUWA 1V9PA 3GTLB 4TKOB 2NVQH 1PFBA 4ZRZA 3LX0A 5C4JH 5E1FA 5IE8A 2WFWA 1XNQL 1LTBD 2I5MX 3K5OA 3KLSA 1IBKL 4LUVA 3AFPA 4OEMB 5M5XH 2RDGA 2NYZD 3KDFB 2UU9Q 3HOUH 5CYUA 4JPBW 2CCZA 3GTJB 1YJWA 5D14A 1N34L 4JCVE 1DONA 4Y7NH 3A54A 3K7AB 5J39A 1TWHB 4F88A 3HOXH 2AHOB 3HZXA 1SXTA 3VDYA 1HJPA 1EY4A 3BZDB 5JPNC 2KA7A 1ZEQX 2MJ8A 3WOFA 3H15A 1JB7A 3KLRA 4NB3A 1TS5A 4R4CA 1PH1A 3TMEA 3TEHB 1O7YA 4A3KH 5LMNW 3Q8DA 1AE2A 5CV7A 2Z4HA 4KTAA 1FR3A 4GN3B 5M5WH 2IHEA 3EIVA 3OOCA 3T1HQ 1STYA 2OXPA 2RDFA 4GKKL 1HTLD 2KHSA 3M4OH 4HJ7A 1Q1BA 1U5KA 1VQIA 3M85A 4I7ZC 2L9HA 5KYIA 3J7A5 2O5JC 4X3UA 2HT1A 2IJ0A 4F8MA 2MUYA 1I4GA 3G6JB 1XXGA 2UUBL 4I7AA 1CI3M 1W3SA 4LNQA 4LWCA 4DV0L 4DV4L 5C5MA 4UP8A 1S3OA 2CWPA 1HR0W 2F0TA 3GO5A 3E3XA 2EJFC 2G9DA 5IWAQ 1YI2A 1A8VA 4B9XA 1VF5C 3GQBA 1K3BC 1E2WA 2B2VC 1QZGA 1EZ8A 5M5XB 1HNWQ 1Q7YC 4A3GG 3HOUB 4A3IG 3Q23A 5E4XA 1TWFH 2RSOA 4IJLA 1N32Q 1EYDA 2C5CA 1WTVA 2L15A 5D65A 1GUGA 2E5LQ 2EJGC 3WDNA 3D8GA 2BOSA 2CH4W 3MTSA 5ELOA 1CA5A 4GLAC 5DEHA 1F2ZA 1UE1A 2NTSA 2K32A 3DXJC 4JI7L 2EY6A 4IJHA 2NBFA 2XWJB 3T56B 4R1JA 1STAA 4WRDA 2A19A 1Y1WG 3U9SA 4A3KB 4H44C 1AEXA 3DMUA 4JV5Q 4C56C 3VYTA 1SRUA 1CHPD 2NN6I 1VQBA 5M5WB 4B08A 4RGTA 3MXGA 2QW7A 3FMCA 5M5YH 2VXWA 3OW7A 4K5VA 1BBWA 1IBLQ 1HNXL 5C4XG 4LW1A 1UE7A 3QOLA 2ZJRA 1S72A 1KDCA 3E9IA 1SE2A 2CWAA 5EPKA 5IYDG 4DR6L 2ZTDA 3F2BA 2B8FA 3HOYG 1IW7D 3AFQA 3UI2A 2UUCQ 5IOCA 1K0SA 1PFMA 2OTLA 3IFTA 3NBHA 4ILWA 5M3MH 4QMGA 3OWFA 4TRDA 5GADC 1EEFD 3FEWX 4LUZA 4DR5L 4DKAC 3MWYW 2Y0SG 2Z9HA 2EE1A 2MGSA 4KHVA 2VQFQ 3RUZA 3TP8A 2HIVA 1A2UA 1BUVT 1MHWC 2KUMA 1H9SB 2FHTA 2KCNA 3TS0A 2JA8G 5LMUQ 3GTGH 1T9HA 3S1RB 3R2IA 4FO2A 2LFNA 5C3EG 2AQ2B 1UEBA 1HH2P 1NSNS 4DN4M 2PQAA 3S24A 3H91A 3R93A 4KN4C 2F0FA 5C4XH 1VCIA 2HHHQ 1VQ6A 4IFDG 3S2DH 5C3WA 4C3HH 1W2BA 5CV4A 1L0WA 3X3MA 4B3RQ 1UE6A 2DJGC 2OF1A 1YVCA 4HTHA 1K8GA 1EU3A 3J80i 1MJEA 4A3DH 4BXXG 1S5CD 1E3PA 1Y8PB 1E0BA 4LF7L 1SLJA 2E2IB 4LK1C 5M5YB 5IYBH 2F03A 4NMZA 4BY1G 1PV4A 1LT5D 4YCVA 1A62A 3VR5A 2WAQE 1STGA 3ICEA 1O78A 3H0GB 3T1YQ 5FKAC 4GNXB 2LXJA 3S15H 5KYLA 1PTOD 2BDOA 3GTOH 1S5ED 3UDXA 4K2LA 4GOPC 1FGBD 4WJWA 2IW3A 1SAPA 4B3ML 1VMPA 4MZ9A 2KHJA 1JR0D 1K9MC 2IX1A 3CCUA 4POFA 2MHVA 1FGUA 4A3FB 3PO3H 1EU4A 1RODA 2R7FA 2QKIC 1C48A 4LFAQ 2XSCA 5KNDA 2CFMA 2JQOA 1D8LA 2DY8A 5ISRA 3CCEA 3JAMc 1U4MA 3HRZC 1SE8A 3HOVH 4A3BG 4AYBG 3GTGB 4RKLA 3U9OA 1CK1A 1F9SA 5BN5A 4JOIC 4O42A 4DUZL 1IL2A 2N8NA 5C4ZA 5CC4A 3DLLA 1EYAA 2I5HA 2Q8TA 3TDQA 1AP0A 3S2DB 4C3HB 4ZQ3A 2WINB 1GJXA 1Y14B 4BBSH 1SNQA 1PRTC 4GN5A 4TQUS 2RDHA 3TQYA 3A56A 1Q46A 5IGBA 2OQKA 4C2MB 1WD1A 4GLVB 3SE0A 5JPMC 2GN5A 3BG3A 4X66Q 4A3DB 5K36G 1BCPB 2HUGA 3NTIA 3KUPA 1VQAA 1EUJA 5KIXA 1VQKA 4DK3C 4HCSA 1QVCA 5F2DA 4CJ0B 4A3JG 1O7LA 2R92B 2PZUA 4RA8A 5J22A 3K0YA 3A8JE 3UE0A 5A35A 1HXYD 4A3EH 4QQBX 2RF4A 4MIUA 1K8OA 5FK9C 4PZ6A 4X65L 3I4NG 1NE3A 2WB1G 2KVMA 1SN8A 2XN9C 3AYHB 3S15B 4B3TL 2EXDA 3CCJA 4YCWA 1IKLA 3JAME 3OHXC 4PMCA 4ZKCB 5K5PA 5CV9A 4NDXA 5BR8L 4EGVA 2F0PA 1Q82C
chains in the Genus database with same CATH topology
1UEAB 3NP8A 2EZVA 4FXDA 2E2HB 1T5XD 1Z6HA 5FLXE 4DK1A 3PO3B 1SNOA 5T1IA 2K5DA 2PNRC 2YU9B 4H0LC 3IKJA 3HOVB 3CRKC 3M4YA 4HSVA 1JWUD 3BDCA 1IKMA 3PV0A 2MPMA 1CTMA 3DWQA 1JICA 1AZQA 2PZTA 1STNA 3VYSA 1DOMA 1UAPA 3KBXA 3CKIB 1WTRA 4BBSB 2NWGA 4RKBA 5M9OA 1TS3A 2K03A 4R8IA 2RA4A 2F0KA 2L4NA 4RFBA 1EWCA 1Z47A 2BA1A 1UUPA 4FF2A 5HURA 2B63B 3JAML 4ZK9B 5EKLA 1XX8A 5FLXL 5A2QE 3A8KE 2OEOA 3CU7A 1YNJD 1WTOA 5KGUA 3P20A 2WP8J 3GTQB 2QEJC 2F3WA 3VA5A 1PFNA 4KN7C 4B9WA 3N52A 3D31A 4FVMA 3S1MB 4C1NK 2VB2X 1D1KA 5JJZA 4L63B 2NZ1D 3FPUB 1EZ6A 1CQFA 1JWMD 1HFGA 1HUMA 2I07B 1TR5A 2HDMA 1SBBB 3QIAA 3Q24A 4PNYA 1G291 1G2SA 1EY0A 3I4MB 1SYDA 2LY7A 5EJWA 1G6ZA 4BBRB 2VUMB 4FXGC 5C6AA 2F0QA 5A2QL 2BE5C 3QB3A 1TWAB 1RCVD 2SNMA 3I70A 2ZXRA 5T1GA 3C2PA 5CR3A 4KV6A 1DCZA 3IAYA 3PIP3 1A3UA 5JVG3 4X3SA 1B53A 1SMYD 3RLFA 5ELFA 3S9WA 4RCOA 4IFDJ 3KK7A 3Q22A 5IGFA 1PTOF 4CHTB 3W2DA 4WFN3 4ID6A 4S3SA 4RWSC 1I4XA 3D6CA 3A55A 5DM73 1HPCA 4BY7B 2B2WC 3C1EA 2WAQB 4RGMA 2X6GA 1GUOA 3K58A 1L0YB 1CFMA 2M9VA 1SNDA 1OXSC 2QILA 1WD0A 5M3FB 4DXFA 1F77A 1T5EA 3V96A 2DNCA 1HQRD 3EROA 2XVSA 5EKIA 2ID0A 3MC0B 4DAYA 2L0CA 5DAUA 3H09A 3DHQA 3NHHA 2F0OA 2RBMA 4FF4A 3HG9A 2F3VA 1RJTA 4M8AA 4C3JB 2J7ZA 3SVMA 1PDQA 1U4PA 5CV5A 3NE5B 3QWNA 1ICWA 2Q8IB 2F0VA 3I8ZA 3NK9A 3PMFA 4BWGB 2E74C 3QOJA 3RZDB 4DU9A 1I4HA 2AQ1B 3H94A 1G91A 3TZUA 2NN6H 4DXGA 5D3DA 1TS2A 1QNKA 2JP1A 2NVYB 3IL8A 4EQPA 2K04A 4BA2I 1I50B 3S17B 3I91A 3E6ZX 5KNCA 1CQVA 3R2TA 1LT3D 3VYUA 1ML0D 4IUNA 3VR3A 1B9MA 4FF3A 2K6AA 3GV3A 1TIID 4JK1C 4CKCA 3J7AV 3GTKB 2A5HA 3MVVA 3D4WA 4I65A 1K83B 5FO8B 3SK4A 4BA1I 2EYLA 1G8ZD 3I90A 2RKSA 4ZLTF 1LTTD 5I9PA 5IGCA 2F0NA 4QF4A 2CHBD 1Q8IA 2D2CC 1HCZA 1OO9B 3K6OA 2JXMB 2V4DA 1WTPA 1SYBA 1ENCA 3GV6A 3TSSA 4KD4A 1YNNC 5CBAE 2O5IC 2NVQB 2E2DC 2SEBD 5C4JB 4E6IA 4XXEA 2VNUD 2Z4IA 4N9TA 1EEID 3NQTA 2E2JB 1JB3A 1S5BD 4IUPA 1TQOA 4Y7NB 4U673 3HOXB 1QB5D 1JE4A 5CGKA 4DF7A 3HOWB 2A69D 1PZKD 3K57A 2EYOA 2IX0A 1H9SA 1QWYA 1C8CA 4DFAA 1F9PA 5COYA 1BXTA 3FKIB 3ND9A 4IALA 1NAPA 3SK5A 3LWUA 3MA2B 2L11A 1BCPD 2N55A 4XTCS 2BA0A 3M4OB 1GHJA 4KD3A 1M8AA 4KY5A 1STHA 1ESRA 2A6HD 3PUXA 5LHY1 2F0JA 1JOKA 3MHBA 5EBCA 1EYCA 1H9MA 1GUTA 4CGYB 3J7YW 3SXHA 5EKKA 4C3IG 1GUWA 1TWFB 4HAEA 3L9AX 3TP7A 2K05A 3NTKA 2K33A 1KNEA 3MAQA 1SNCA 5E4WC 5IODA 3SK6A 3DWAA 1LABA 4KJOA 1STEA 4KJNA 2NTTA 2XWBB 1ESFA 5DM63 1B1ZA 3AU7A 2EYMA 4CJ2C 1U9RA 4OHJA 2SNSA 3NPPA 4A3GB 1EY5A 2F1MA 4DAPA 3HGBA 1MD2D 1UNSA 1JQYD 2XIWA 5M3MB 4IFDH 1ILQA 1S5DD 2WIIB 3K5NA 4UAIA 2FINB 1NCVA 4RGNA 4ZKBB 1FNVA 1LT4D 1X32A 2PQEA 2ZXOA 4KI0A 5C0XJ 3T4AC 1SJED 2EVBA 4CKEA 1CZWA 1B9NA 3I3CA 1RD9D 1D6EC 5C4XB 3OSOA 1LTAD 1ZYRD 4HN7A 2KEEA 3NSWA 3SR1A 3HOYB 3V2TA 2A6ED 2L12A 1NR4A 4G7OC 1SE3A 5CORA 2GA4B 1PRTB 1XWEA 2AQ3B 1BDOA 1Q12A 1HUNA 4QCLA 5JEAG 1TT2A 5I2XA 1HHVA 2B2YA 3KLSX 2JEAI 5IIFA 2DY7A 2EOTA 5DNFA 4F87A 2IX3A 1Q1EA 1TU2B 5EPJA 3Q0AA 2JA8B 2XNAC 1KLUD 2F0UA 2L5TA 3GTOB 4KY7A 2BE5D 5C3EB 1BBXC 1Y8OB 4G7HC 3DUZA 1IW7C 3E5SA 1AW7A 4OGQC 4EQNA 4LMQD 1TY2A 2SDFA 3LNNA 4ZUJA 1D1IA 3J81E 3S2HB 3Q6SA 1PTOH 3BYYB 5K36H 2EYFA 3T16A 1EQVA 2O4XA 4K8IA 5ELBA 2ICIA 1H9JA 4BY1B 1IYUA 2KCCA 3ZYYX 1D5XC 3P75A 3T51B 2LS01 4KMUC 1DJRD 2HCIA 1TVXA 3I4LA 4XYQA 4IFDI 3DEPA 4L8JA 1DYQA 5CMDA 4G4KA 4ZAIA 3CQZB 2N88A 4HCEA 5CBEE 2EY5A 4XIGS 3AMUA 1VF7A 4A3EB 1IYVA 1BCPF 3OPOA 1HTPA 5LL6X 2IL8A 3D3RA 3GP7A 2D9UA 1IHZA 3C3LA 1I4PA 1BOSA 5I2YA 1CHQD 1QJOA 4OL7A 5AFWA 3J81L 1Y69U 1PTOC 1Q90A 4KKUA 4K6LA 2TSSA 2D5DA 2B2TC 3VYRA 1KTKA 1LTRD 1CM9A 2QCPX 4A3JB 3NXWA 1RHPA 4ODGA 1A3TA 1MGSA 4C3JG 1LACA 5KRUA 2IPKD 2ZT9C 2TMPA 3I4NB 3BDOA 2BCOA 3BVZA 1A15A 2R61A 1JORA 3S1QB 1RTNA 1NR2A 3DEOA 1WTWA 3V05A 2MP1A 1BQQT 5BN4A 1LTGD 3RD4A 3DM1A 1DXMA 4J8QA 3NBIA 3BS1A 1AN8A 1DOKA 1EIHA 1IL8A 5JOBA 3VA7A 2WACA 2PPBC 1JCKB 1RF2D 3KBGA 3HOZB 3QO2A 1GXDC 4R8NA 1H9KA 2PCFB 1YNND 3VR2A 1JWSD 2F0GA 5IGDA 3S14B 4A93B 4L6TB 4WORA 3MXNA 1TKWB 1XYIA 2J4XA 1O7ZA 4EVOA 3CRLC 4IQZA 3R8BA 2F0SA 1EQTA 1Y1VB 4HMJA 1LO5D 2CVRA 2PW5A 2NVTB 1B44D 5JVH3 2C9OA 2H4OA 2J0TD 1DOLA 3EJIA 1F2YA 1SNMA 3EQLC 1JC7A 4OO1G 5C0XG 1SYEA 2ZXPA 1BNZA 2B2UC 4RHSA 1V1PB 3GTPB 3RMHA 1PYWD 2NVXB 4XDXA 3S1NB 4IUQA 1S4ZA 3E0JA 5I6WA 3MXPA 4HR7B 4ME5A 4FP5D 3NWTA 3C46A 1KLGD 4KK7A 3D4DA 4DAVA 1X3QA 1EY8A 4CJ1B 2CW0C 2NB0A 4RH6A 4PQXA 2O2LD 5KNBA 3L3OC 2EYJA 1K8MA 1EFID 3L7ZC 1B4OA 2EPBA 4FNFA 1I4QA 2KEDA 2NUCA 2EDGA 5ELDA 5C5LA 1E2VA 3MXUA 1LLRD 5JEAJ 4XQQA 2PYKA 3GD7A 4YIJA 1SNPA 2B2VA 1I3QB 4V190 1R4QB 2D62A 4DGZA 2Q8RE 3RZOB 1I4RA 4Q0FA 1J9OA 3TBIB 2AWOA 3FRPB 1QCBD 2KJXA 4IN3A 2JA6B 1GUSA 1NUCA 3EA6A 2KOLA 1KAAA 3A7LA 1QILA 2JSOA 2F0HA 1VDZA 1F2LA 4UDUC 1TWCB 2K28A 4MHEA 1TS4A 3ITPA 1FNUA 3HS0C 2F0WA 1SMYC 3N6RA 1DZ1A 4ULLA 2B39A 3M7GA 5I4DA 5FOBB 2XRQD 5FO7B 4A3MB 4J6HA 3HKZB 1PZJD 3KF8A 2F0LA 4KKSA 3EFXD 1F2MA 1E2ZA 2RVLA 4P2CB 1PLFA 4HMIA 4IUVA 2PO4A 4O1NA 5FO9B 3ND8A 5EQ0A 1PRTD 4V0BA 1LTID 2EJMA 2G9HD 3EVQA 1D5ZC 4KHZA 1OXXK 4OO1I 2A68C 2R7ZB 2JA5B 1LV9A 2F0EA 3ONAB 5C0XI 1FNWA 2WV6D 4H13C 4Q5VA 3K5LA 1ENAA 3SDZA 1HFNA 2AUKA 1KABA 2E75C 3BVGA 2WKDA 2ENBA 1QG7A 1V43A 3H3VC 4DA2A 5G3LD 4LJZC 4R9WA 4J1MA 1B50A 1L0XB 4C3HG 5ELCA 2HQEA 3BYTB 1CZGA 3NQIA 5ELEA 3WOEA 1D2BA 1RTOA 2IT1A 1U4RA 4K2KA 1TY0A 1PZID 4DNRB 4NP5A 1KNAA 1SDFA 3D6WA 4CBVA 2AUJD 1W6KA 4OIJA 3I72A 2KQ3A 4NW2A 1SSOA 2WKCA 1MSGA 2DNEA 3M7NA 3GTMB 5J1ZA 1ONLA 3MEHA 1QE6A 2DN8A 4K5XA 4XQJA 5IGEA 1B2TA 1WVLA 4A3IB 5CV6A 4XQNA 3TP6A 3NTHA 3W3AA 1XTCD 1HQMC 3OMCA 1Z7TA 2HDLA 1Y8NB 1KDBA 3P1HA 1V8QA 1MSHA 3F2UA 3PIO3 2BDNA 2JEBI 2LMCB 1OXUA 3K5MA 5LL6S 2LKVA 1H9RA 4ZYSA 1Y1WB 3T53B 4KY6A 3NWSA 1EWHA 3LWEA 2QDBA 1VMCA 3IFDA 4IZ8A 1J8IA 3G7LA 1HA5A 2A69C 3SK8A 1D5MC 2FMMA 3QJYA 1S5FD 1G2TA 4OIKA 3PUVA 4QUFA 3I73A 5EBDA 3TP5A 4IUTA 3S16B 3URYA 1CA6A 3VR4A 2H1EA 1V1OA 1TWGB 5C4HA 1SE4A 2PW7A 1JOQA 1ENFA 3OIQA 2F4IA 1BCPC 4XYOA 2Y0SB 4C3IB 3A8IE 2M2LA 4CKBA 1U4LA 1SJHD 1ET6A 4U68A 4HSPA 3R3OA 1BO0A 4RHRA 1PMRA 3FDTA 2A6HC 1JOOA 1A6XA 2RQXA 3HP3A 2RSNA 3FPPA 1BR9A 5E3FA 1ET9A 2E76C 4ABNA 2F0MA 4EQOA 5I9OA 3MFYA 4DK0A 4DNTB 1EY9A 4JBWA 3NUCA 5KEEA 2YYZA 3FVQA 4G57A 5JEAH 3J80E 2OT2A 4X3TA 4KKTA 4M1UB 1EOTA 3K59A 1PXUA 4BS9A 1BF4A 2B2TA 1SEBD 2L55A 1FYCA 5C3XA 2FMCA 4RCNA 1I6HB 5IGGA 1SYFA 3ERQA 2Z8LA 5EPLA 2L1BA 5TSSA 5NUCA 1EL0A 1DM0B 2B2YC 1SFOB 4FF1A 4HEDA 1LT6D 2EY2A 3PO2B 1DD2A 1F9RA 1PRTF 2Z1CA 3O13A 1GUNA 2A73B 1QOHA 4A3BB 4AYBB 1W6JA 4N9PA 3PUZA 1R9TB 3SEBA 4XT3B 3T13A 4QIWB 3TZDA 1A3VA 1FD7D 2PMZB 2CW0D 3VR6A 5D3IB 3QG1A 4IURA 1QNUA 3J80L 5HGTA 1PTOB 4RGOS 4RAUC 1MI2A 4FXKC 5G3LF 1GOZA 4MN3A 1I6VC 1AZPA 1M4VA 5BN3A 1LTSD 1OXVA 2FJ2A 1SYCA 2JYOA 5C44B 3P7JA 1WTXA 2WB1B 3HEJA 1C4QA 1AFPA 2X6LA 2AWNA 2M00A 2ICEC 4QB4A 1ZYRC 1R4PB 2HCCA 4F7XA 2B2WA 1KDAA 1EIGA 5IT9E 2K5WA 2A6EC 1GHKA 1A2TA 2A74C 3PUYA 3J7AF 5JAVA 2JA7B 1V1PA 3CHBD 1CT1D 3OIPA 4X3KA 3TN2A 2B2UA 1ILPA 4K8JA 3H6MA 4H7BA 3DWPA 1F9QA 3A7AB 5EGTA 2EYHA 4NKLA 3BVMA 4C1NI 4PMWA 5I6YA 1RKNA 1X3PA 1WCMB 1HRJA 2XRSD 4Z9CB 3M3YB 4TSSA 4PMBA 2PZWA 3X3NA 3OMGA 2FFKB 4LAAA 3C1FA 2B8GA 4ZUIA 3OWEB 4K14A 3SHLA 2VB3X 1EY7A 1ZKOA 2R93B 1ZXTA 4FYDA 2EXZA 5IT9L 3BDLA 1SYGA 3MFGA 4IUUA 2K1BA 1Q3LA 1MBYA 5CV8A 2SOBA 4G7ZC 1EY6A 1B3AA 1O80A 3MZ5A 4K6DA 2K7VA 1WTQA 2NN6G 1II3A 4GZYC 2CQAA 2F0DA 1HA6A 4PV1C 4XT1B 2QF7A 2F0IA 2A68D 1STBA 2R3ZA 2IWHA 2KECA 3D4RA 2EY1A 2EYPA 4QUCA 4K5WA 1RDPD 2K01A 2JE6I 3AB9A 1YNJC 2K5QA 2I46A 4OO1H 2R6GA 2X69A 5C0XH 1OXTA 3PUWA 3GTLB 4TKOB 1PFBA 4ZRZA 3LX0A 5E1FA 1LTBD 3K5OA 3KLSA 2RDGA 2NYZD 5CYUA 3GTJB 5D14A 1DONA 3A54A 3K7AB 5J39A 1TWHB 4F88A 3HZXA 1SXTA 1EY4A 3BZDB 5JPNC 2KA7A 1ZEQX 2MJ8A 3WOFA 3KLRA 1TS5A 3TMEA 1O7YA 5CV7A 2Z4HA 4KTAA 1FR3A 3OOCA 1STYA 2OXPA 2RDFA 1HTLD 2KHSA 1Q1BA 3M85A 4I7ZC 2L9HA 5KYIA 2O5JC 4X3UA 2IJ0A 4F8MA 2MUYA 1I4GA 3G6JB 1XXGA 1CI3M 5C5MA 2F0TA 3GO5A 2EJFC 2G9DA 4B9XA 1VF5C 3GQBA 1E2WA 2B2VC 1EZ8A 5M5XB 3HOUB 3Q23A 5E4XA 2RSOA 1EYDA 2C5CA 1WTVA 5D65A 1GUGA 2EJGC 3WDNA 3D8GA 2BOSA 3MTSA 1CA5A 5DEHA 1F2ZA 2NTSA 2K32A 3DXJC 2EY6A 2NBFA 2XWJB 3T56B 1STAA 4WRDA 3U9SA 4A3KB 4H44C 1AEXA 3DMUA 4C56C 3VYTA 1CHPD 2NN6I 5M5WB 4B08A 4RGTA 3MXGA 3FMCA 2VXWA 3OW7A 4K5VA 3QOLA 1KDCA 1SE2A 5EPKA 2B8FA 1IW7D 3UI2A 5IOCA 1PFMA 3IFTA 3NBHA 4ILWA 4QMGA 3OWFA 4TRDA 1EEFD 3FEWX 3MWYW 2EE1A 2MGSA 4KHVA 3RUZA 3TP8A 1A2UA 1BUVT 2KUMA 1H9SB 2FHTA 2KCNA 3S1RB 3R2IA 4FO2A 2LFNA 2AQ2B 1NSNS 4DN4M 3H91A 3R93A 4KN4C 2F0FA 1VCIA 4IFDG 5C3WA 5CV4A 3X3MA 2OF1A 4HTHA 1EU3A 1S5CD 1Y8PB 1E0BA 2E2IB 4LK1C 5M5YB 2F03A 4NMZA 1LT5D 3VR5A 1STGA 1O78A 3H0GB 5FKAC 5KYLA 1PTOD 2BDOA 1S5ED 4K2LA 1FGBD 4WJWA 2IW3A 1SAPA 1VMPA 1JR0D 2IX1A 2MHVA 4A3FB 1EU4A 1RODA 2QKIC 1C48A 2XSCA 5KNDA 2DY8A 5ISRA 1U4MA 3HRZC 3GTGB 4RKLA 3U9OA 1CK1A 1F9SA 5BN5A 4O42A 5C4ZA 5CC4A 1EYAA 2Q8TA 3TDQA 1AP0A 3S2DB 4C3HB 4ZQ3A 2WINB 1GJXA 1SNQA 1PRTC 4TQUS 2RDHA 3A56A 5IGBA 4C2MB 1WD1A 3SE0A 5JPMC 3BG3A 4A3DB 5K36G 1BCPB 2HUGA 3NTIA 3KUPA 5KIXA 4CJ0B 4HCSA 5F2DA 1O7LA 2R92B 2PZUA 4RA8A 5J22A 3K0YA 3A8JE 5A35A 1HXYD 4MIUA 1K8OA 5FK9C 2KVMA 2XN9C 3S15B 1IKLA 3JAME 3OHXC 4PMCA 4ZKCB 5K5PA 5CV9A 4NDXA 4EGVA 2F0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUN A;  2B2U A;  1PFB A;  2NZ1 D;  3MTS A;  2L1B A;  1J9O A;  2K05 A;  3FPU B;  1CA5 A;  1ILP A;  1EQT A;  1QG7 A;  5AFW A;  1EL0 A;  1RJT A;  1KNE A;  2B2Y C;  2CVR A;  2J7Z A;  1J8I A;  1F9Q A;  5E4W C;  1HHV A;  1HFG A;  4HED A;  3G7L A;  2B2Y A;  4R9W A;  1B50 A;  3SVM A;  1PDQ A;  5T1I A;  1HUM A;  1U4P A;  2DY7 A;  2NYZ D;  2EOT A;  2B2T C;  5DNF A;  1ICW A;  1F9R A;  2FMM A;  1DOL A;  2KOL A;  5D14 A;  2HDM A;  1G2T A;  4OIK A;  5EPJ A;  4IUP A;  3I8Z A;  4QUF A;  1DON A;  4IUT A;  1JE4 A;  1X3P A;  1HRJ A;  1CM9 A;  1CA6 A;  2H1E A;  1BBX C;  4HSV A;  1F2L A;  1RTO A;  1IKM A;  1U4R A;  1BNZ A;  2B2U C;  2MPM A;  1SAP A;  1RHP A;  1VMP A;  2VXW A;  1G2S A;  1JIC A;  2K28 A;  1AZQ A;  1MGS A;  5EJW A;  1KNA A;  1SDF A;  4MHE A;  3D6W A;  4XT3 B;  2FFK B;  2MJ8 A;  5EPL A;  3TZD A;  1ROD A;  1G91 A;  4CJ2 C;  1DOM A;  3KBX A;  4XDX A;  1C8C A;  4IUQ A;  4LMQ D;  1WTR A;  1DZ1 A;  1F9P A;  1S4Z A;  1QNK A;  5COY A;  2SDF A;  4OIJ A;  1O7Y A;  2JP1 A;  2M2L A;  2NWG A;  2DY8 A;  3IL8 A;  4IUR A;  2K04 A;  1U4L A;  1NAP A;  3Q6S A;  1A15 A;  5EPK A;  1U4M A;  3I91 A;  4NW2 A;  1SSO A;  5T1G A;  1ZXT A;  2L11 A;  3UI2 A;  1MSG A;  1RTN A;  1NR2 A;  2K03 A;  4RAU C;  1MI2 A;  4U68 A;  4R8I A;  4X3S A;  1B53 A;  3DEO A;  1PFM A;  1ML0 D;  1WTW A;  1BO0 A;  2MP1 A;  4MN3 A;  1X3Q A;  2RA4 A;  4IUU A;  2K1B A;  1AZP A;  1Q3L A;  1F9S A;  2L4N A;  4CJ1 B;  4O42 A;  2N55 A;  3GV3 A;  1G6Z A;  2XIW A;  1ILQ A;  3FDT A;  2FJ2 A;  1QE6 A;  1B3A A;  1O80 A;  2L9H A;  2JYO A;  2Q8T A;  1AP0 A;  3DM1 A;  1WTQ A;  3MWY W;  3HP3 A;  4UAI A;  2FIN B;  1B2T A;  2RSN A;  4X3U A;  1M8A A;  1WVL A;  2EE1 A;  1NCV A;  2MGS A;  2RVL A;  4RWS C;  1B4O A;  4ZK9 B;  4ZKB B;  2EPB A;  2HCI A;  3P7J A;  1ESR A;  1DOK A;  1PLF A;  2KUM A;  1WTX A;  4IUV A;  1WD1 A;  1EIH A;  1IL8 A;  1X32 A;  1XX8 A;  2FHT A;  4XT1 B;  1HA6 A;  1TVX A;  2KED A;  2X6L A;  2HUG A;  2R3Z A;  3I90 A;  3DEP A;  3IFD A;  2HDL A;  3KUP A;  5EQ0 A;  4ZLT F;  1WTO A;  2HCC A;  2KEC A;  2B2W C;  4CJ0 B;  4HCS A;  4DN4 M;  2B2W A;  3H91 A;  3QO2 A;  3R93 A;  1EIG A;  4X3T A;  3I3C A;  5CMD A;  4RA8 A;  4ZAI A;  1MSH A;  2N88 A;  2X6G A;  3F2U A;  4QUC A;  1EOT A;  2BDN A;  5CBE E;  1WD0 A;  2K01 A;  1LV9 A;  3ONA B;  1PFN A;  2B2V C;  2KEE A;  3N52 A;  1WTP A;  2B2V A;  1BF4 A;  2B2T A;  1GUW A;  5E4X A;  2RSO A;  3GV6 A;  5EKI A;  2KVM A;  1WTV A;  2IL8 A;  5D65 A;  2L12 A;  1NR4 A;  4HAE A;  1XYI A;  3LWE A;  2X69 A;  4X3K A;  3TN2 A;  1VMC A;  5COR A;  1IKL A;  1O7Z A;  5CBA E;  4ZKC B;  5JJZ A;  1HFN A;  1E0B A;  2D9U A;  2Q8R E; 
#chains in the Genus database with same CATH topology
 1UEA B;  3NP8 A;  2EZV A;  4FXD A;  2E2H B;  1T5X D;  3I56 A;  1Z6H A;  5FLX E;  3K80 C;  4DK1 A;  3PO3 B;  1SNO A;  5T1I A;  2K5D A;  2I0Q A;  2PNR C;  2YU9 B;  2KCT A;  4H0L C;  4A3L G;  2VQE Q;  2EIF A;  3ULL A;  3S1M H;  2JA7 G;  3CPF A;  3IKJ A;  3HOV B;  3CRK C;  3M4Y A;  4LF5 Q;  4HSV A;  1JWU D;  3BDC A;  4X62 L;  1IKM A;  3PV0 A;  2MPM A;  1CTM A;  3DWQ A;  2LSS A;  2ZM6 Q;  4IOC A;  1JIC A;  1AZQ A;  4EQ5 A;  2PZT A;  1STN A;  1E1T A;  3PGZ A;  3VYS A;  1DOM A;  1UAP A;  3KBX A;  5FJ8 H;  3CKI B;  1WTR A;  4BBS B;  1L2F A;  2NWG A;  4RKB A;  4JI4 L;  3A74 A;  4A93 G;  5M9O A;  3CXC A;  4DV2 Q;  5IY0 A;  3W5O A;  2F52 A;  1TS3 A;  5LMN Q;  2K03 A;  4R8I A;  1WCM G;  3K8A A;  2RA4 A;  2F0K A;  2L4N A;  4RFB A;  1EWC A;  1Z47 A;  1C0A A;  2BA1 A;  1UUP A;  4FF2 A;  4BBR H;  5HUR A;  2B63 B;  1Y1V G;  4GS3 A;  4L5S A;  4CDE C;  1TWA H;  3JAM L;  4ZK9 B;  3NEL A;  2ES2 A;  4O0A A;  5EKL A;  2R93 G;  1XX8 A;  1PA6 A;  1GM5 A;  4LFB L;  5FLX L;  3NEN A;  5A2Q E;  3A8K E;  1WI5 A;  2OEO A;  5ELN A;  3CU7 A;  1YNJ D;  2GVA A;  1WTO A;  3HOZ H;  5KGU A;  3P20 A;  1HR0 Q;  2WP8 J;  3GTQ B;  1XPO A;  3EN2 A;  4LF4 L;  1N36 Q;  2QEJ C;  2F3W A;  3VA5 A;  1J5E Q;  3S14 H;  1I94 L;  3PF5 A;  1PFN A;  4KN7 C;  4B9W A;  3N52 A;  3D31 A;  3OTO Q;  4FVM A;  3S1M B;  4C1N K;  1NJI C;  2VB2 X;  1IBM L;  1PH9 A;  1D1K A;  4JC0 A;  2RCF A;  5JJZ A;  1DGS A;  1NMF A;  4L63 B;  4LF8 Q;  1EYG A;  2NZ1 D;  3FPU B;  1EZ6 A;  5J3B A;  3L2P A;  1YHA A;  3K0X A;  1CQF A;  1JWM D;  4UY8 C;  1HFG A;  1PHJ A;  5M3F H;  1HUM A;  2I07 B;  4CDD C;  4YHH L;  1TR5 A;  2HDM A;  1SBB B;  3QIA A;  5IP7 G;  4JW0 A;  4DR1 Q;  1UWV A;  4NXM Q;  3Q24 A;  4PNY A;  1G29 1;  1G2S A;  1EY0 A;  3I4M B;  1SYD A;  2LY7 A;  5EJW A;  1G6Z A;  4BBR B;  2VUM B;  2NVX H;  4DR3 Q;  2QEX A;  4DV6 Q;  4A4I A;  4FXG C;  4DV5 Q;  5C6A A;  1YEZ A;  2F0Q A;  5A2Q L;  2BE5 C;  3QB3 A;  1TWA B;  1RCV D;  2SNM A;  3I70 A;  2ZXR A;  5T1G A;  3C2P A;  5CR3 A;  4KV6 A;  1DCZ A;  3IAY A;  3PIP 3;  1A3U A;  5JVG 3;  4A3C H;  4X3S A;  1B53 A;  1SMY D;  3RZD H;  3RLF A;  5ELF A;  3S9W A;  4RCO A;  1AH9 A;  4IFD J;  3KK7 A;  1KHI A;  3Q22 A;  5IGF A;  4OX9 Q;  1L1O C;  1PTO F;  2PNH A;  4CHT B;  3W2D A;  2JA6 G;  4WFN 3;  4ID6 A;  4S3S A;  4RWS C;  1N33 L;  1I50 H;  1K0R A;  1I4X A;  3D6C A;  3A55 A;  3RNU A;  4DR4 L;  4NXN L;  5DM7 3;  1HPC A;  4BY7 B;  1WYD A;  2B2W C;  3C1E A;  2WAQ B;  2YTV A;  4RGM A;  1X3F A;  5JJL A;  2X6G A;  1GUO A;  3K58 A;  1L0Y B;  2KHI A;  1CFM A;  2M9V A;  2G5D A;  1SND A;  1YBY A;  1OXS C;  4YWL A;  4DR7 Q;  2QIL A;  1WD0 A;  5M3F B;  4DXF A;  1F77 A;  1T5E A;  3UDF A;  3V96 A;  2DNC A;  4PZ7 A;  1HQR D;  3ERO A;  1K83 H;  2XVS A;  5EKI A;  2ID0 A;  1ICF B;  3MC0 B;  4DAY A;  4N8X 1;  2L0C A;  5DAU A;  3H09 A;  3DHQ A;  3NHH A;  3AQQ A;  4CDF C;  2F0O A;  2RBM A;  4FF4 A;  3HG9 A;  2JJQ A;  4A3M G;  2F3V A;  1RJT A;  4M8A A;  2Z6B A;  4C3J B;  2J7Z A;  4GKJ L;  4MNO A;  3HKZ G;  3SVM A;  1PDQ A;  1U4P A;  5CV5 A;  3NE5 B;  1BKB A;  3QWN A;  4A75 A;  1ICW A;  2Q8I B;  2F0V A;  3I8Z A;  3NK9 A;  4YCU A;  4JI0 Q;  2I5L X;  3PMF A;  1GVP A;  4BWG B;  3OW2 A;  1J6Q A;  4JVZ A;  2E74 C;  1KL9 A;  3QOJ A;  3RZD B;  4DU9 A;  1I4H A;  1IYJ B;  1EQQ A;  2AQ1 B;  1TWC H;  4JI3 L;  3H94 A;  3RLN A;  1G91 A;  3TZU A;  2NN6 H;  4DXG A;  5D3D A;  5DLQ E;  2ASB A;  2UXB L;  3FHW A;  1TS2 A;  1QNK A;  2R7Z G;  2JA5 G;  2UXC Q;  2JP1 A;  2NVY B;  3IL8 A;  2CKZ B;  4EQP A;  2K04 A;  3PIO A;  4DV3 Q;  1I50 B;  2Q2U A;  2E2J H;  4BA2 I;  3S17 B;  3I91 A;  3E6Z X;  5KNC A;  2MNA A;  1CQV A;  3R2T A;  1PFS A;  1X3E A;  1LT3 D;  3VYU A;  1ML0 D;  3HOW H;  4IUN A;  3VR3 A;  1B9M A;  4FF3 A;  2K6A A;  3GV3 A;  1TII D;  4JK1 C;  4CKC A;  1HZB A;  3J7A V;  3GTK B;  1KRS A;  1X6O A;  4X6A H;  2A5H A;  4UP9 A;  3MVV A;  3D4W A;  2HD3 A;  4DAY B;  1VQO A;  1LTL A;  2K75 A;  1O7I A;  3FKI H;  4I65 A;  1B3Q A;  1EIF A;  1K83 B;  5FO8 B;  1E1O A;  3SK4 A;  4BA1 I;  3CC2 A;  2EYL A;  1G8Z D;  3I90 A;  5IP9 G;  1XMQ L;  1XNQ Q;  2RKS A;  4ZLT F;  1LTT D;  5I9P A;  1IBK Q;  5IGC A;  2F0N A;  4QF4 A;  2CHB D;  3I55 A;  1Q8I A;  1JE5 A;  1N34 Q;  1JT8 A;  2D2C C;  1HCZ A;  1OO9 B;  3K6O A;  2JXM B;  2V4D A;  1WTP A;  1WTH A;  1SYB A;  1ENC A;  3GV6 A;  3TSS A;  4KD4 A;  1YNN C;  4QJF A;  1X3G A;  5CBA E;  1CSP A;  3PQI A;  2O5I C;  2NVQ B;  2E2D C;  2SEB D;  5C4J B;  4E6I A;  4XXE A;  3CC7 A;  2E5L L;  3CCL A;  3M9B A;  1MJC A;  2QGQ A;  2VNU D;  2OWO A;  2Z4I A;  1X56 A;  1YZ6 A;  1EEI D;  4N9T A;  3NQT A;  2E2J B;  1JB3 A;  1S5B D;  4IUP A;  1TQO A;  1LYL A;  4Y7N B;  4U67 3;  3HOX B;  1QB5 D;  1JE4 A;  5CGK A;  2Z0S A;  4DF7 A;  3HOW B;  4JV5 L;  2A69 D;  4K0K Q;  1G51 A;  1M1K C;  1PZK D;  3K57 A;  3A5Z B;  2EYO A;  4YWK A;  2IX0 A;  1H9S A;  1QWY A;  1YIJ A;  1PH7 A;  1C8C A;  4DFA A;  1NY4 A;  1F9P A;  5COY A;  1BXT A;  3FKI B;  4DV0 Q;  4DV4 Q;  3ND9 A;  3WWV A;  4IAL A;  1KQS A;  1NAP A;  3H0G G;  3SK5 A;  3LWU A;  3MA2 B;  2PMZ E;  2L11 A;  3CW2 C;  1BCP D;  4L5Q A;  1YIT A;  3RN2 A;  4JG2 A;  2UUC L;  1XPU A;  2N55 A;  3G48 A;  1VQL A;  4XTC S;  2BA0 A;  3M4O B;  1GHJ A;  4A3F G;  3ULJ A;  1PH6 A;  4HJ9 A;  4KD3 A;  1M8A A;  4A3G H;  4A3I H;  4KY5 A;  1XMO L;  1STH A;  1VQH A;  1QUQ A;  1ESR A;  2A6H D;  1CKM A;  2VQF L;  3PUX A;  4L5R C;  5LHY 1;  1VQG A;  3RN5 A;  2F0J A;  1JOK A;  2AKW B;  4JI7 Q;  2DUD A;  3MHB A;  2UXD L;  4RMF A;  5EBC A;  1EYC A;  1H9M A;  1GUT A;  4CGY B;  4GNX A;  3J7Y W;  1YHB A;  2MO0 A;  2QDL A;  3SXH A;  5EKK A;  1Y1W H;  4C3I G;  1GUW A;  2RCN A;  1TWF B;  4HAE A;  4POG A;  3L9A X;  4DUY Q;  3TP7 A;  4GOP A;  1X9N A;  1HNX Q;  2K05 A;  5JJK A;  2R92 G;  3NTK A;  2RHQ B;  2K33 A;  1KNE A;  3MAQ A;  1SNC A;  5E4W C;  5IOD A;  4UHV A;  2ZTC A;  3SK6 A;  3DWA A;  5IYD H;  1LAB A;  1HZ9 A;  3HOY H;  3JAM i;  4X64 Q;  3S16 H;  4KJO A;  1STE A;  4KJN A;  3T1Y L;  1QZH A;  3J81 j;  2NTT A;  4LF6 Q;  3G6E A;  2XWB B;  1QUQ B;  1ESF A;  4JOI A;  4IPC A;  4YWM A;  5DM6 3;  1B1Z A;  4Y52 H;  3AU7 A;  2EYM A;  4CJ2 C;  1CKO A;  1U9R A;  3MEF A;  2IHF A;  4OHJ A;  2SNS A;  3HFZ B;  3NPP A;  2K5N A;  4A3G B;  1EY5 A;  2JA8 H;  2F1M A;  4DAP A;  3HGB A;  1X55 A;  5GRO A;  5C3E H;  1MD2 D;  1UNS A;  1JQY D;  1VQ7 A;  4B3S Q;  2XIW A;  3U50 C;  5M3M B;  4IFD H;  1ILQ A;  2K50 A;  4FDB A;  1S5D D;  4NPS A;  4R4I A;  1XNR Q;  4GOP B;  2WII B;  3K5N A;  4DV7 Q;  2LXK A;  4UAI A;  2FIN B;  1JMC A;  1NCV A;  3PO2 G;  4RGN A;  3S2H H;  4JBK A;  4ZKB B;  1LT4 D;  1FNV A;  1N8R C;  4IPD A;  1X32 A;  2PQE A;  1EQR A;  4BXX H;  3GDE A;  2ZXO A;  4KI0 A;  5C0X J;  3KF6 A;  3T4A C;  1KAW A;  1SJE D;  2EVB A;  5FLX c;  1BVS A;  4GLX A;  4CKE A;  4HJ8 A;  1CZW A;  1B9N A;  3I3C A;  4UP7 A;  1RD9 D;  4BY1 H;  1D6E C;  5C4X B;  3J7Z C;  2B63 G;  4DV1 L;  3J81 c;  3OSO A;  1LTA D;  1AE3 A;  2ATW A;  1ZYR D;  4HN7 A;  2KEE A;  3NSW A;  1E24 A;  3SR1 A;  1WOC A;  3HOY B;  3V2T A;  2A6E D;  2L12 A;  4B3M Q;  3TS2 A;  1NR4 A;  4G7O C;  1SE3 A;  5COR A;  2GA4 B;  1PRT B;  1XWE A;  2AQ3 B;  1BDO A;  2N49 A;  1Q12 A;  1HUN A;  3HKS A;  4QCL A;  5JEA G;  2CQO A;  3CQZ H;  1SFO H;  1TT2 A;  5I2X A;  1HNZ L;  1NBW A;  1HHV A;  4HJA A;  2B2Y A;  3KLS X;  2JEA I;  4KLK A;  5IIF A;  2DY7 A;  5C44 G;  2EOT A;  5DNF A;  4F87 A;  1SR3 A;  2YV5 A;  3ZJY C;  1VQ4 A;  2IX3 A;  1Q1E A;  3AEV A;  4A76 A;  1TU2 B;  5EPJ A;  3Q0A A;  2JA8 B;  4A3B H;  1MIU A;  2XNA C;  1KLU D;  2F0U A;  2L5T A;  2UUA L;  1PYS B;  3GTO B;  4KY7 A;  2BE5 D;  5C3E B;  1BBX C;  3TRZ A;  5GQO A;  3F2C A;  4L5T A;  1Y8O B;  4G7H C;  3DUZ A;  1IW7 C;  1EFW A;  3E5S A;  1AW7 A;  3KF6 B;  4OGQ C;  4EQN A;  1ASY A;  2ZM6 L;  3FP9 A;  4LMQ D;  3F1Z A;  1KXL A;  1TY2 A;  2SDF A;  3LNN A;  4ZUJ A;  1D1I A;  1NMG A;  3J81 E;  3S2H B;  3Q6S A;  1S40 A;  2IY5 B;  1PTO H;  3BYY B;  1ASZ A;  2V1C C;  5K36 H;  2EYF A;  3T16 A;  1EQV A;  4DV2 L;  4AQY Q;  4OXP A;  5LMN L;  4JI5 Q;  4A3J H;  2O4X A;  4K8I A;  5ELB A;  4HJ5 A;  2F3I A;  2ICI A;  2JA9 A;  4JYA Q;  1H9J A;  4BY1 B;  1IYU A;  3ERS X;  2KCC A;  5AJ3 L;  4X65 Q;  2VUM G;  3ZYY X;  1D5X C;  3P75 A;  2BH8 A;  3I4N H;  3T51 B;  2LS0 1;  4KMU C;  3CD6 A;  1DJR D;  2HCI A;  3S1Q H;  5BR8 Q;  1OTC A;  1TVX A;  3I4L A;  4HIM A;  4XYQ A;  4IFD I;  2RHS B;  3DEP A;  4L8J A;  1DYQ A;  4JI2 L;  5CMD A;  2NZO A;  4G4K A;  4ZAI A;  3CQZ B;  2N88 A;  1GD7 A;  3F8T A;  3TRE A;  4HCE A;  3K7U C;  1HR0 L;  3KOJ A;  5CBE E;  2EY5 A;  4XIG S;  3AMU A;  1VF7 A;  4A3E B;  1N36 L;  1IYV A;  4A3L H;  1BCP F;  3OPO A;  1HTP A;  1NNX A;  2JA7 H;  3HKZ E;  4X62 Q;  3W1G A;  5LL6 X;  2IL8 A;  1YJ9 A;  4KHP L;  3D3R A;  3OTO L;  3GP7 A;  4BY7 G;  2D9U A;  1IHZ A;  4YY3 Q;  3C3L A;  1I4P A;  1BOS A;  5I2Y A;  1CHQ D;  1QJO A;  4OL7 A;  5AFW A;  3J81 L;  4LF8 L;  1Y69 U;  3G4S A;  1PTO C;  1Q90 A;  4KKU A;  1VQC A;  4K6L A;  2AMC B;  2TSS A;  4O2D A;  4A93 H;  4LF9 Q;  2D5D A;  2B2T C;  3JC6 6;  3VYR A;  3RLO A;  2ZJP A;  1KTK A;  4P71 A;  2F4V Q;  1VS0 A;  1WCM H;  4N8F A;  4AIM A;  1LTR D;  3CMA A;  1CM9 A;  4JI1 L;  1XPR A;  2QCP X;  4A3J B;  3NXW A;  1RHP A;  1A63 A;  4ODG A;  1A3T A;  1Y1V H;  1MGS A;  4C3J G;  1LAC A;  5KRU A;  2NVT H;  4JI6 L;  2IPK D;  2ZT9 C;  2TMP A;  3I4N B;  3BDO A;  2BCO A;  2R93 H;  3BVZ A;  1A15 A;  2R61 A;  1JOR A;  3S1Q B;  2Q2T A;  1RTN A;  1NR2 A;  5FLM G;  3DEO A;  1WTW A;  3V05 A;  4LF4 Q;  2MP1 A;  1BQQ T;  4UPA A;  5BN4 A;  3GTP H;  1LTG D;  3BZC A;  3RD4 A;  3DM1 A;  3S1N H;  5L37 A;  3CCV A;  1P8L A;  2N78 A;  1IBM Q;  1DXM A;  4MTN A;  1WJJ A;  4J8Q A;  1PVO A;  3NBI A;  3DM3 A;  3BS1 A;  1AN8 A;  1DOK A;  1JJ2 A;  1EIH A;  1IL8 A;  1VQD A;  5JOB A;  3PCO B;  3VA7 A;  4DR2 L;  1FJG Q;  4HID A;  1Q8K A;  2WAC A;  2OCE A;  2PPB C;  1JCK B;  1RF2 D;  3KBG A;  3HOZ B;  1PH8 A;  3QO2 A;  2JN4 A;  1EWI A;  1GXD C;  4R8N A;  1H9K A;  2PCF B;  1YNN D;  3VR2 A;  4YHH Q;  1JWS D;  2F0G A;  2Z6K A;  5IGD A;  3RR5 A;  3S14 B;  4A93 B;  5H1S E;  5IP7 H;  5IYC G;  4L6T B;  2K14 A;  4WOR A;  3W1B A;  1D7Q A;  3MXN A;  1SRO A;  1TKW B;  1XYI A;  2J4X A;  1L1O B;  1O7Z A;  4EVO A;  2YTX A;  1VQF A;  3CRL C;  4IQZ A;  3QR8 A;  3CF5 A;  3R8B A;  2F0S A;  1EQT A;  1Y1V B;  4HMJ A;  1LO5 D;  2CVR A;  2PW5 A;  2NVT B;  1B44 D;  5JVH 3;  2C9O A;  3BU2 A;  1PH5 A;  3GTJ H;  2H4O A;  2J0T D;  1I3Q H;  2E8G A;  3CCM A;  3K7A H;  1DOL A;  2A1A A;  3EJI A;  1F2Y A;  2OTJ A;  1SNM A;  3EQL C;  1Z9F A;  1JC7 A;  1EOV A;  3STB C;  5GAH C;  4OO1 G;  5C0X G;  3RZO H;  1SYE A;  2ZXP A;  4LFC L;  4JI8 L;  1BNZ A;  2B2U C;  4RHS A;  2ZTE A;  3CAM A;  1V1P B;  3GTP B;  3RMH A;  2KCM A;  1PYW D;  2NVX B;  2JA6 H;  4XDX A;  3S1N B;  4IUQ A;  1S4Z A;  3E0J A;  5IYC H;  5I6W A;  3MXP A;  4NXN Q;  2Q2I A;  4HR7 B;  4ME5 A;  4FP5 D;  3NWT A;  3HOU G;  3C46 A;  1KLG D;  1V1Q A;  3HOX G;  4DV3 L;  2UU9 L;  1FL0 A;  4KK7 A;  4EX5 A;  3BJU A;  4IPG A;  3D4D A;  4DAV A;  1X3Q A;  1EY8 A;  2CW0 C;  2NB0 A;  4RH6 A;  4CJ1 B;  4PQX A;  3MXN B;  2O2L D;  5KNB A;  4JBM A;  3L3O C;  1JJG A;  2H5X A;  2EYJ A;  1K8M A;  1EFI D;  1B7Y B;  3L7Z C;  1B4O A;  1KIX A;  2EPB A;  4FNF A;  5GAG C;  1I4Q A;  4A3K G;  2Y0S E;  2KED A;  2NUC A;  2EDG A;  5HGQ A;  5ELD A;  1YJN A;  5C5L A;  1E2V A;  3MXU A;  2D0O A;  1LLR D;  4GKJ Q;  4WJ4 A;  5JEA J;  4XQQ A;  4A3M H;  3KFU A;  2PYK A;  3T1H L;  2VZA A;  3GD7 A;  4P74 A;  1VQ8 A;  4YIJ A;  2PI2 E;  2GVB A;  1SNP A;  2B2V A;  3U58 A;  1I3Q B;  4V19 0;  1R4Q B;  2C35 B;  2D62 A;  4JI3 Q;  4DGZ A;  2Q8R E;  3RZO B;  1I4R A;  4Q0F A;  1J9O A;  2UXB Q;  3TBI B;  2AWO A;  3FRP B;  1QCB D;  2KJX A;  4IN3 A;  2R7Z H;  3PSI A;  2JA5 H;  5IWA L;  2JA6 B;  4R4T A;  1GUS A;  1NUC A;  1GO3 E;  3EA6 A;  2KOL A;  1KAA A;  3A7L A;  4IPH A;  2B3G A;  1QIL A;  1HNW L;  2JSO A;  2F0H A;  1VDZ A;  1N32 L;  1F2L A;  4TVA B;  4UDU C;  4IO9 A;  4QGU A;  1TWC B;  3I2Z A;  2K28 A;  1LUZ A;  4MHE A;  1TS4 A;  4K0K L;  3ITP A;  1FNU A;  3HS0 C;  2F0W A;  1SMY C;  3N6R A;  1DZ1 A;  4ULL A;  1P16 A;  2B39 A;  1MKH A;  2VL6 A;  3H3V H;  1XMQ Q;  3M7G A;  5IP9 H;  4GKK Q;  5I4D A;  5FOB B;  4JBJ A;  2XRQ D;  5FO7 B;  5HY6 A;  3U4Z A;  4A3M B;  4AYB E;  3CME A;  4J6H A;  2K52 A;  1VQ5 A;  3HKZ B;  4IOA A;  1PZJ D;  3KF8 A;  2UUB Q;  2F0L A;  4QL5 A;  4KKS A;  3EFX D;  3NEM A;  1F2M A;  1E2Z A;  2RVL A;  1IBL L;  4P2C B;  4QIW E;  4P72 A;  1PLF A;  1EIY B;  4HMI A;  4IUV A;  2PO4 A;  4O1N A;  3S1R H;  3GTM H;  5FO9 B;  3ND8 A;  5EQ0 A;  1PRT D;  4V0B A;  4DNI A;  3ULP A;  1LTI D;  2EJM A;  1K73 C;  2G9H D;  5M3M G;  3EVQ A;  1D5Z C;  3CCQ A;  4KHZ A;  1OXX K;  4AH6 A;  4OO1 I;  1YNX A;  2A68 C;  2R7Z B;  2JA5 B;  1LV9 A;  2F0E A;  3ONA B;  5C0X I;  1FNW A;  2WV6 D;  4H13 C;  1KC8 C;  3CCR A;  4Q5V A;  3K5L A;  1ENA A;  3M4Q A;  3SDZ A;  2Q2H A;  2E2I H;  1HFN A;  2AUK A;  2WB1 E;  1KAB A;  2E75 C;  2P5Z X;  3BVG A;  2WKD A;  2ENB A;  4DUY L;  1JJC B;  5LMU L;  1QG7 A;  3BZK A;  1V43 A;  3H3V C;  4DA2 A;  5G3L D;  4LJZ C;  1H95 A;  4R9W A;  4J1M A;  1B50 A;  2XTI A;  1L0X B;  4C3H G;  2HHH L;  1PH2 A;  3H0G H;  3UDG A;  4CDC C;  5ELC A;  2HQE A;  4B3R L;  3BYT B;  1CZG A;  3NQI A;  5ELE A;  3KF8 B;  3WOE A;  1BBU A;  1D2B A;  1CKN A;  1HZA A;  4X64 L;  3PF4 A;  4A3D G;  1RTO A;  2IT1 A;  1U4R A;  4K2K A;  1TY0 A;  3G71 A;  1PZI D;  4LF6 L;  4DNR B;  4NP5 A;  2DGY A;  4A3F H;  5IYB G;  1KNA A;  1SDF A;  1XMO Q;  3D6W A;  1GKH A;  4CBV A;  4OWT B;  4DR6 Q;  2AUJ D;  3ER0 A;  1W6K A;  4OIJ A;  1CUK A;  4PG3 A;  3I72 A;  2KQ3 A;  4NW2 A;  1SSO A;  2WKC A;  1MSG A;  2DNE A;  1X65 A;  3M7N A;  2UXD Q;  3GTM B;  5J1Z A;  1VQN A;  4DK6 C;  1ONL A;  4R4O A;  1TWG H;  2VS1 A;  4DR5 Q;  3MEH A;  2K4K A;  1QE6 A;  3H3V I;  3J81 i;  2OQ0 A;  4B3S L;  2DN8 A;  4K5X A;  4XQJ A;  3PO3 G;  4C3I H;  5IGE A;  1B2T A;  1WVL A;  1XNR L;  4C2M H;  4QY7 A;  4A3I B;  2N3S A;  3L0O A;  2K5H A;  5CV6 A;  4DV7 L;  4XQN A;  3TP6 A;  4LFA L;  2VY3 A;  1C7Y A;  3NTH A;  3W3A A;  1XTC D;  2EQS A;  1HQM C;  1PH3 A;  3OMC A;  3HOV G;  1Z7T A;  2HDL A;  1Y8N B;  1KDB A;  3P1H A;  2R92 H;  1VQP A;  1V8Q A;  1MSH A;  3F2U A;  4GNX C;  3PIO 3;  1CKN B;  2BDN A;  2JEB I;  2LMC B;  5E7N A;  1OXU A;  3NBH B;  3K5M A;  5LL6 S;  4BBS G;  2LKV A;  1H9R A;  4ZYS A;  1Y1W B;  3T53 B;  2ALY B;  2PI2 A;  4KY6 A;  4ZCK A;  4LF7 Q;  3NWS A;  3UDI A;  1EWH A;  3LWE A;  2QDB A;  1VMC A;  3IFD A;  4P73 A;  2E2H H;  4X66 L;  3PIP A;  2NZH A;  4IZ8 A;  3OYY A;  3SGI A;  1J8I A;  3G7L A;  3F2D A;  2PQA B;  4A3E G;  2YU9 H;  4OON A;  1HA5 A;  2A69 C;  3SK8 A;  1D5M C;  4PZ8 A;  2FMM A;  1LM0 A;  3QJY A;  5EAY A;  1PYB A;  1S5F D;  1G2T A;  4OIK A;  3PUV A;  4QUF A;  3I73 A;  5EBD A;  3TP5 A;  1QVF A;  1NTG A;  3J80 c;  4IUT A;  3S16 B;  3URY A;  1PH4 A;  1I6H H;  1CA6 A;  4MTK A;  3VR4 A;  2H1E A;  4WJ3 M;  1V1O A;  1TWG B;  5C4H A;  1SE4 A;  2PW7 A;  1JOQ A;  1ENF A;  3OIQ A;  2F4I A;  1IXR A;  3KYH C;  1BCP C;  2YTY A;  4XYO A;  1QVG A;  2Y0S B;  4C3I B;  3A8I E;  3PO2 H;  4LUO A;  4HIO A;  2M2L A;  4CKB A;  1U4L A;  1SJH D;  3LGJ A;  1ET6 A;  1M90 C;  4U68 A;  4HSP A;  4DUZ Q;  3R3O A;  3A5U A;  1R9T H;  1BO0 A;  2VQE L;  4DV1 Q;  4AQY L;  4LF5 L;  2B63 H;  4RHR A;  4JI5 L;  1PMR A;  3FDT A;  4J15 A;  2A6H C;  1JOO A;  1N9W A;  4RG1 A;  1A6X A;  2ZJQ A;  4JYA L;  3IRB A;  2RQX A;  5FJ8 G;  3HP3 A;  2RSN A;  3FPP A;  4ME3 A;  1BR9 A;  5E3F A;  1ET9 A;  2E76 C;  4ABN A;  2F0M A;  4DAM A;  4EQO A;  1X54 A;  5I9O A;  3MFY A;  4DK0 A;  2A8V A;  4DNT B;  1EY9 A;  4JBW A;  1SMX A;  3NUC A;  2YYZ A;  5KEE A;  3FVQ A;  4G57 A;  1I5F A;  5JEA H;  3J80 E;  2OT2 A;  3GTQ H;  3D0F A;  4X3T A;  3B6Y A;  2D0P A;  4KKT A;  3I4M G;  4M1U B;  1EOT A;  1Q81 C;  1B70 B;  4BBR G;  5C44 H;  3K59 A;  1PXU A;  4BS9 A;  1XTD A;  1BF4 A;  2JK8 A;  2UUA Q;  2B2T A;  4B3T Q;  1SEB D;  1RIP A;  2HQL A;  2L55 A;  4KHP Q;  1FYC A;  5C3X A;  2FMC A;  1VQM A;  4RCN A;  1I6H B;  5IGG A;  3UE1 A;  1SYF A;  3ERQ A;  2Z8L A;  5EPL A;  1HNZ Q;  3HOZ G;  2L1B A;  5TSS A;  5NUC A;  1EL0 A;  1DM0 B;  4YY3 L;  2FXQ A;  3STB D;  3CCS A;  2B2Y C;  1SFO B;  2KBN A;  1KD1 C;  4FF1 A;  4HED A;  1LT6 D;  2EY2 A;  3PO2 B;  1DD2 A;  3E0E A;  1F9R A;  3O13 A;  1PRT F;  2Z1C A;  1J5E L;  1GUN A;  2A73 B;  4LF9 L;  1QOH A;  4A3B B;  4OWX B;  1KRT A;  4AYB B;  1W6J A;  4N9P A;  5IT9 c;  3PUZ A;  1R9T B;  3U4V A;  2F4V L;  5AJ3 Q;  1VQ9 A;  1E22 A;  3K81 C;  3I4M H;  3SEB A;  2VW9 A;  2WAQ G;  2VUM H;  4XT3 B;  3T13 A;  4QIW B;  3TZD A;  1Q86 C;  4JI4 Q;  1A3V A;  1FD7 D;  2PMZ B;  2CW0 D;  5M3F G;  3VR6 A;  5D3I B;  3QG1 A;  2DJF C;  4IUR A;  1QNU A;  3J80 L;  5HGT A;  4OEL B;  1K28 A;  1IZ6 A;  1PTO B;  4RGO S;  5GAE C;  4RAU C;  1MI2 A;  4JI2 Q;  4FXK C;  5G3L F;  1GOZ A;  4MN3 A;  2XGT A;  1I6V C;  1AZP A;  1M4V A;  4DR1 L;  5BN3 A;  3M3Y H;  1LTS D;  2HIX A;  1OXV A;  4NXM L;  2FJ2 A;  1SYC A;  2JYO A;  5C44 B;  1L1O A;  4LFB Q;  4DR3 L;  4DV6 L;  3P7J A;  1WTX A;  2WB1 B;  3HEJ A;  4DV5 L;  4GN4 B;  1C4Q A;  4ALP A;  1AFP A;  2X6L A;  2AWN A;  3E9H A;  2M00 A;  2ICE C;  4BY7 H;  4QB4 A;  4HIK A;  1ZYR C;  4A3C G;  1R4P B;  2HCC A;  4F7X A;  1FJG L;  2B2W A;  3KJP A;  1KDA A;  1RL2 A;  1EIG A;  1I94 Q;  5IT9 E;  2K5W A;  2A6E C;  1VQJ A;  4P75 A;  1GHK A;  1A2T A;  2A74 C;  5JJI A;  1C9O A;  3PUY A;  1K8A C;  2MQH A;  3KLW A;  3J7A F;  4JI1 Q;  5JAV A;  4OX9 L;  2JA7 B;  1V1P A;  3CHB D;  3CC4 A;  3KJO A;  1CT1 D;  3OIP A;  4X3K A;  3TN2 A;  1XJV A;  1VQE A;  2B2U A;  4JI6 Q;  1ILP A;  4K8J A;  1U0L A;  1WFQ A;  4C3J H;  3H6M A;  4H7B A;  3DWP A;  1F9Q A;  3A7A B;  5EGT A;  2EYH A;  4NKL A;  2MO1 A;  3BVM A;  3I4O A;  4C1N I;  4PMW A;  4DR7 L;  5I6Y A;  3I7F A;  5FLM H;  1RKN A;  1X3P A;  1WCM B;  1G6P A;  1HRJ A;  1A0I A;  3GTL H;  2XRS D;  2QA4 A;  4Z9C B;  1B8A A;  3M3Y B;  4TSS A;  4PMB A;  2PZW A;  2B29 A;  3X3N A;  3OMG A;  1K3R A;  2FFK B;  4LAA A;  1YHQ A;  3A0J A;  3C1F A;  2B8G A;  4K14 A;  1UE5 A;  3OWE B;  4ZUI A;  3SHL A;  2NVY H;  4DPG A;  4DR2 Q;  2VB3 X;  4OWW B;  3M4P A;  3S17 H;  1EY7 A;  1ZKO A;  2R93 B;  1TWH H;  1ZXT A;  4FYD A;  2EXZ A;  5IT9 L;  3BDL A;  1SYG A;  3MFG A;  2MFI A;  4JI0 L;  3CP0 A;  4IUU A;  2K1B A;  1Q3L A;  1MBY A;  5CV8 A;  3GTK H;  1HZC A;  3KDF A;  2SOB A;  4G7Z C;  1EY6 A;  1CSQ A;  1B3A A;  1O80 A;  3MZ5 A;  1FVI A;  4K6D A;  1N33 Q;  2K7V A;  1WTQ A;  2NN6 G;  1II3 A;  2BH2 A;  4GZY C;  2CQA A;  1TXY A;  4DR4 Q;  1E7Z A;  2F0D A;  1HA6 A;  4PV1 C;  4XT1 B;  2QF7 A;  2UXC L;  2F0I A;  2A68 D;  1STB A;  2R3Z A;  4H02 A;  2IWH A;  2KEC A;  3HOW G;  2CH4 A;  2K5V A;  3D4R A;  2EY1 A;  2EYP A;  2Z6K C;  4QUC A;  4K5W A;  1RDP D;  2K01 A;  4R4Q A;  2JE6 I;  3AB9 A;  1YNJ C;  2KEN A;  2K5Q A;  3FKI G;  2I46 A;  4LFC Q;  4JI8 Q;  4OO1 H;  2R7D A;  2R6G A;  4APV A;  2X69 A;  5C0X H;  3CPW A;  3EBE A;  1OXT A;  3PUW A;  1V9P A;  3GTL B;  4TKO B;  2NVQ H;  1PFB A;  4ZRZ A;  3LX0 A;  5C4J H;  5E1F A;  5IE8 A;  2WFW A;  1XNQ L;  1LTB D;  2I5M X;  3K5O A;  3KLS A;  1IBK L;  4LUV A;  3AFP A;  4OEM B;  5M5X H;  2RDG A;  2NYZ D;  3KDF B;  2UU9 Q;  3HOU H;  5CYU A;  4JPB W;  2CCZ A;  3GTJ B;  1YJW A;  5D14 A;  1N34 L;  4JCV E;  1DON A;  4Y7N H;  3A54 A;  3K7A B;  5J39 A;  1TWH B;  4F88 A;  3HOX H;  2AHO B;  3HZX A;  1SXT A;  3VDY A;  1HJP A;  1EY4 A;  3BZD B;  5JPN C;  2KA7 A;  1ZEQ X;  2MJ8 A;  3WOF A;  3H15 A;  1JB7 A;  3KLR A;  4NB3 A;  1TS5 A;  4R4C A;  1PH1 A;  3TME A;  3TEH B;  1O7Y A;  4A3K H;  5LMN W;  3Q8D A;  1AE2 A;  5CV7 A;  2Z4H A;  4KTA A;  1FR3 A;  4GN3 B;  5M5W H;  2IHE A;  3EIV A;  3OOC A;  3T1H Q;  1STY A;  2OXP A;  2RDF A;  4GKK L;  1HTL D;  2KHS A;  3M4O H;  4HJ7 A;  1Q1B A;  1U5K A;  1VQI A;  3M85 A;  4I7Z C;  2L9H A;  5KYI A;  3J7A 5;  2O5J C;  4X3U A;  2HT1 A;  2IJ0 A;  4F8M A;  2MUY A;  1I4G A;  3G6J B;  1XXG A;  2UUB L;  4I7A A;  1CI3 M;  1W3S A;  4LNQ A;  4LWC A;  4DV0 L;  4DV4 L;  5C5M A;  4UP8 A;  1S3O A;  2CWP A;  1HR0 W;  2F0T A;  3GO5 A;  3E3X A;  2EJF C;  2G9D A;  5IWA Q;  1YI2 A;  1A8V A;  4B9X A;  1VF5 C;  3GQB A;  1K3B C;  1E2W A;  2B2V C;  1QZG A;  1EZ8 A;  5M5X B;  1HNW Q;  1Q7Y C;  4A3G G;  3HOU B;  4A3I G;  3Q23 A;  5E4X A;  1TWF H;  2RSO A;  4IJL A;  1N32 Q;  1EYD A;  2C5C A;  1WTV A;  2L15 A;  5D65 A;  1GUG A;  2E5L Q;  2EJG C;  3WDN A;  3D8G A;  2BOS A;  2CH4 W;  3MTS A;  5ELO A;  1CA5 A;  4GLA C;  5DEH A;  1F2Z A;  1UE1 A;  2NTS A;  2K32 A;  3DXJ C;  4JI7 L;  2EY6 A;  4IJH A;  2NBF A;  2XWJ B;  3T56 B;  4R1J A;  1STA A;  4WRD A;  2A19 A;  1Y1W G;  3U9S A;  4A3K B;  4H44 C;  1AEX A;  3DMU A;  4JV5 Q;  4C56 C;  3VYT A;  1SRU A;  1CHP D;  2NN6 I;  1VQB A;  5M5W B;  4B08 A;  4RGT A;  3MXG A;  2QW7 A;  3FMC A;  5M5Y H;  2VXW A;  3OW7 A;  4K5V A;  1BBW A;  1IBL Q;  1HNX L;  5C4X G;  4LW1 A;  1UE7 A;  3QOL A;  2ZJR A;  1S72 A;  1KDC A;  3E9I A;  1SE2 A;  2CWA A;  5EPK A;  5IYD G;  4DR6 L;  2ZTD A;  3F2B A;  2B8F A;  3HOY G;  1IW7 D;  3AFQ A;  3UI2 A;  2UUC Q;  5IOC A;  1K0S A;  1PFM A;  2OTL A;  3IFT A;  3NBH A;  4ILW A;  5M3M H;  4QMG A;  3OWF A;  4TRD A;  5GAD C;  1EEF D;  3FEW X;  4LUZ A;  4DR5 L;  4DKA C;  3MWY W;  2Y0S G;  2Z9H A;  2EE1 A;  2MGS A;  4KHV A;  2VQF Q;  3RUZ A;  3TP8 A;  2HIV A;  1A2U A;  1BUV T;  1MHW C;  2KUM A;  1H9S B;  2FHT A;  2KCN A;  3TS0 A;  2JA8 G;  5LMU Q;  3GTG H;  1T9H A;  3S1R B;  3R2I A;  4FO2 A;  2LFN A;  5C3E G;  2AQ2 B;  1UEB A;  1HH2 P;  1NSN S;  4DN4 M;  2PQA A;  3S24 A;  3H91 A;  3R93 A;  4KN4 C;  2F0F A;  5C4X H;  1VCI A;  2HHH Q;  1VQ6 A;  4IFD G;  3S2D H;  5C3W A;  4C3H H;  1W2B A;  5CV4 A;  1L0W A;  3X3M A;  4B3R Q;  1UE6 A;  2DJG C;  2OF1 A;  1YVC A;  4HTH A;  1K8G A;  1EU3 A;  3J80 i;  1MJE A;  4A3D H;  4BXX G;  1S5C D;  1E3P A;  1Y8P B;  1E0B A;  4LF7 L;  1SLJ A;  2E2I B;  4LK1 C;  5M5Y B;  5IYB H;  2F03 A;  4NMZ A;  4BY1 G;  1PV4 A;  1LT5 D;  4YCV A;  1A62 A;  3VR5 A;  2WAQ E;  1STG A;  3ICE A;  1O78 A;  3H0G B;  3T1Y Q;  5FKA C;  4GNX B;  2LXJ A;  3S15 H;  5KYL A;  1PTO D;  2BDO A;  3GTO H;  1S5E D;  3UDX A;  4K2L A;  4GOP C;  1FGB D;  4WJW A;  2IW3 A;  1SAP A;  4B3M L;  1VMP A;  4MZ9 A;  2KHJ A;  1JR0 D;  1K9M C;  2IX1 A;  3CCU A;  4POF A;  2MHV A;  1FGU A;  4A3F B;  3PO3 H;  1EU4 A;  1ROD A;  2R7F A;  2QKI C;  1C48 A;  4LFA Q;  2XSC A;  5KND A;  2CFM A;  2JQO A;  1D8L A;  2DY8 A;  5ISR A;  3CCE A;  3JAM c;  1U4M A;  3HRZ C;  1SE8 A;  3HOV H;  4A3B G;  4AYB G;  3GTG B;  4RKL A;  3U9O A;  1CK1 A;  1F9S A;  5BN5 A;  4JOI C;  4O42 A;  4DUZ L;  1IL2 A;  2N8N A;  5C4Z A;  5CC4 A;  3DLL A;  1EYA A;  2I5H A;  2Q8T A;  3TDQ A;  1AP0 A;  3S2D B;  4C3H B;  4ZQ3 A;  2WIN B;  1GJX A;  1Y14 B;  4BBS H;  1SNQ A;  1PRT C;  4GN5 A;  4TQU S;  2RDH A;  3TQY A;  3A56 A;  1Q46 A;  5IGB A;  2OQK A;  4C2M B;  1WD1 A;  4GLV B;  3SE0 A;  5JPM C;  2GN5 A;  3BG3 A;  4X66 Q;  4A3D B;  5K36 G;  1BCP B;  2HUG A;  3NTI A;  3KUP A;  1VQA A;  1EUJ A;  5KIX A;  1VQK A;  4DK3 C;  4HCS A;  1QVC A;  5F2D A;  4CJ0 B;  4A3J G;  1O7L A;  2R92 B;  2PZU A;  4RA8 A;  5J22 A;  3K0Y A;  3A8J E;  3UE0 A;  5A35 A;  1HXY D;  4A3E H;  4QQB X;  2RF4 A;  4MIU A;  1K8O A;  5FK9 C;  4PZ6 A;  4X65 L;  3I4N G;  1NE3 A;  2WB1 G;  2KVM A;  1SN8 A;  2XN9 C;  3AYH B;  3S15 B;  4B3T L;  2EXD A;  3CCJ A;  4YCW A;  1IKL A;  3JAM E;  3OHX C;  4PMC A;  4ZKC B;  5K5P A;  5CV9 A;  4NDX A;  5BR8 L;  4EGV A;  2F0P A;  1Q82 C; 
#chains in the Genus database with same CATH homology
 1UEA B;  3NP8 A;  2EZV A;  4FXD A;  2E2H B;  1T5X D;  1Z6H A;  5FLX E;  4DK1 A;  3PO3 B;  1SNO A;  5T1I A;  2K5D A;  2PNR C;  2YU9 B;  4H0L C;  3IKJ A;  3HOV B;  3CRK C;  3M4Y A;  4HSV A;  1JWU D;  3BDC A;  1IKM A;  3PV0 A;  2MPM A;  1CTM A;  3DWQ A;  1JIC A;  1AZQ A;  2PZT A;  1STN A;  3VYS A;  1DOM A;  1UAP A;  3KBX A;  3CKI B;  1WTR A;  4BBS B;  2NWG A;  4RKB A;  5M9O A;  1TS3 A;  2K03 A;  4R8I A;  2RA4 A;  2F0K A;  2L4N A;  4RFB A;  1EWC A;  1Z47 A;  2BA1 A;  1UUP A;  4FF2 A;  5HUR A;  2B63 B;  3JAM L;  4ZK9 B;  5EKL A;  1XX8 A;  5FLX L;  5A2Q E;  3A8K E;  2OEO A;  3CU7 A;  1YNJ D;  1WTO A;  5KGU A;  3P20 A;  2WP8 J;  3GTQ B;  2QEJ C;  2F3W A;  3VA5 A;  1PFN A;  4KN7 C;  4B9W A;  3N52 A;  3D31 A;  4FVM A;  3S1M B;  4C1N K;  2VB2 X;  1D1K A;  5JJZ A;  4L63 B;  2NZ1 D;  3FPU B;  1EZ6 A;  1CQF A;  1JWM D;  1HFG A;  1HUM A;  2I07 B;  1TR5 A;  2HDM A;  1SBB B;  3QIA A;  3Q24 A;  4PNY A;  1G29 1;  1G2S A;  1EY0 A;  3I4M B;  1SYD A;  2LY7 A;  5EJW A;  1G6Z A;  4BBR B;  2VUM B;  4FXG C;  5C6A A;  2F0Q A;  5A2Q L;  2BE5 C;  3QB3 A;  1TWA B;  1RCV D;  2SNM A;  3I70 A;  2ZXR A;  5T1G A;  3C2P A;  5CR3 A;  4KV6 A;  1DCZ A;  3IAY A;  3PIP 3;  1A3U A;  5JVG 3;  4X3S A;  1B53 A;  1SMY D;  3RLF A;  5ELF A;  3S9W A;  4RCO A;  4IFD J;  3KK7 A;  3Q22 A;  5IGF A;  1PTO F;  4CHT B;  3W2D A;  4WFN 3;  4ID6 A;  4S3S A;  4RWS C;  1I4X A;  3D6C A;  3A55 A;  5DM7 3;  1HPC A;  4BY7 B;  2B2W C;  3C1E A;  2WAQ B;  4RGM A;  2X6G A;  1GUO A;  3K58 A;  1L0Y B;  1CFM A;  2M9V A;  1SND A;  1OXS C;  2QIL A;  1WD0 A;  5M3F B;  4DXF A;  1F77 A;  1T5E A;  3V96 A;  2DNC A;  1HQR D;  3ERO A;  2XVS A;  5EKI A;  2ID0 A;  3MC0 B;  4DAY A;  2L0C A;  5DAU A;  3H09 A;  3DHQ A;  3NHH A;  2F0O A;  2RBM A;  4FF4 A;  3HG9 A;  2F3V A;  1RJT A;  4M8A A;  4C3J B;  2J7Z A;  3SVM A;  1PDQ A;  1U4P A;  5CV5 A;  3NE5 B;  3QWN A;  1ICW A;  2Q8I B;  2F0V A;  3I8Z A;  3NK9 A;  3PMF A;  4BWG B;  2E74 C;  3QOJ A;  3RZD B;  4DU9 A;  1I4H A;  2AQ1 B;  3H94 A;  1G91 A;  3TZU A;  2NN6 H;  4DXG A;  5D3D A;  1TS2 A;  1QNK A;  2JP1 A;  2NVY B;  3IL8 A;  4EQP A;  2K04 A;  4BA2 I;  1I50 B;  3S17 B;  3I91 A;  3E6Z X;  5KNC A;  1CQV A;  3R2T A;  1LT3 D;  3VYU A;  1ML0 D;  4IUN A;  3VR3 A;  1B9M A;  4FF3 A;  2K6A A;  3GV3 A;  1TII D;  4JK1 C;  4CKC A;  3J7A V;  3GTK B;  2A5H A;  3MVV A;  3D4W A;  4I65 A;  1K83 B;  5FO8 B;  3SK4 A;  4BA1 I;  2EYL A;  1G8Z D;  3I90 A;  2RKS A;  4ZLT F;  1LTT D;  5I9P A;  5IGC A;  2F0N A;  4QF4 A;  2CHB D;  1Q8I A;  2D2C C;  1HCZ A;  1OO9 B;  3K6O A;  2JXM B;  2V4D A;  1WTP A;  1SYB A;  1ENC A;  3GV6 A;  3TSS A;  4KD4 A;  1YNN C;  5CBA E;  2O5I C;  2NVQ B;  2E2D C;  2SEB D;  5C4J B;  4E6I A;  4XXE A;  2VNU D;  2Z4I A;  4N9T A;  1EEI D;  3NQT A;  2E2J B;  1JB3 A;  1S5B D;  4IUP A;  1TQO A;  4Y7N B;  4U67 3;  3HOX B;  1QB5 D;  1JE4 A;  5CGK A;  4DF7 A;  3HOW B;  2A69 D;  1PZK D;  3K57 A;  2EYO A;  2IX0 A;  1H9S A;  1QWY A;  1C8C A;  4DFA A;  1F9P A;  5COY A;  1BXT A;  3FKI B;  3ND9 A;  4IAL A;  1NAP A;  3SK5 A;  3LWU A;  3MA2 B;  2L11 A;  1BCP D;  2N55 A;  4XTC S;  2BA0 A;  3M4O B;  1GHJ A;  4KD3 A;  1M8A A;  4KY5 A;  1STH A;  1ESR A;  2A6H D;  3PUX A;  5LHY 1;  2F0J A;  1JOK A;  3MHB A;  5EBC A;  1EYC A;  1H9M A;  1GUT A;  4CGY B;  3J7Y W;  3SXH A;  5EKK A;  4C3I G;  1GUW A;  1TWF B;  4HAE A;  3L9A X;  3TP7 A;  2K05 A;  3NTK A;  2K33 A;  1KNE A;  3MAQ A;  1SNC A;  5E4W C;  5IOD A;  3SK6 A;  3DWA A;  1LAB A;  4KJO A;  1STE A;  4KJN A;  2NTT A;  2XWB B;  1ESF A;  5DM6 3;  1B1Z A;  3AU7 A;  2EYM A;  4CJ2 C;  1U9R A;  4OHJ A;  2SNS A;  3NPP A;  4A3G B;  1EY5 A;  2F1M A;  4DAP A;  3HGB A;  1MD2 D;  1UNS A;  1JQY D;  2XIW A;  5M3M B;  4IFD H;  1ILQ A;  1S5D D;  2WII B;  3K5N A;  4UAI A;  2FIN B;  1NCV A;  4RGN A;  4ZKB B;  1FNV A;  1LT4 D;  1X32 A;  2PQE A;  2ZXO A;  4KI0 A;  5C0X J;  3T4A C;  1SJE D;  2EVB A;  4CKE A;  1CZW A;  1B9N A;  3I3C A;  1RD9 D;  1D6E C;  5C4X B;  3OSO A;  1LTA D;  1ZYR D;  4HN7 A;  2KEE A;  3NSW A;  3SR1 A;  3HOY B;  3V2T A;  2A6E D;  2L12 A;  1NR4 A;  4G7O C;  1SE3 A;  5COR A;  2GA4 B;  1PRT B;  1XWE A;  2AQ3 B;  1BDO A;  1Q12 A;  1HUN A;  4QCL A;  5JEA G;  1TT2 A;  5I2X A;  1HHV A;  2B2Y A;  3KLS X;  2JEA I;  5IIF A;  2DY7 A;  2EOT A;  5DNF A;  4F87 A;  2IX3 A;  1Q1E A;  1TU2 B;  5EPJ A;  3Q0A A;  2JA8 B;  2XNA C;  1KLU D;  2F0U A;  2L5T A;  3GTO B;  4KY7 A;  2BE5 D;  5C3E B;  1BBX C;  1Y8O B;  4G7H C;  3DUZ A;  1IW7 C;  3E5S A;  1AW7 A;  4OGQ C;  4EQN A;  4LMQ D;  1TY2 A;  2SDF A;  3LNN A;  4ZUJ A;  1D1I A;  3J81 E;  3S2H B;  3Q6S A;  1PTO H;  3BYY B;  5K36 H;  2EYF A;  3T16 A;  1EQV A;  2O4X A;  4K8I A;  5ELB A;  2ICI A;  1H9J A;  4BY1 B;  1IYU A;  2KCC A;  3ZYY X;  1D5X C;  3P75 A;  3T51 B;  2LS0 1;  4KMU C;  1DJR D;  2HCI A;  1TVX A;  3I4L A;  4XYQ A;  4IFD I;  3DEP A;  4L8J A;  1DYQ A;  5CMD A;  4G4K A;  4ZAI A;  3CQZ B;  2N88 A;  4HCE A;  5CBE E;  2EY5 A;  4XIG S;  3AMU A;  1VF7 A;  4A3E B;  1IYV A;  1BCP F;  3OPO A;  1HTP A;  5LL6 X;  2IL8 A;  3D3R A;  3GP7 A;  2D9U A;  1IHZ A;  3C3L A;  1I4P A;  1BOS A;  5I2Y A;  1CHQ D;  1QJO A;  4OL7 A;  5AFW A;  3J81 L;  1Y69 U;  1PTO C;  1Q90 A;  4KKU A;  4K6L A;  2TSS A;  2D5D A;  2B2T C;  3VYR A;  1KTK A;  1LTR D;  1CM9 A;  2QCP X;  4A3J B;  3NXW A;  1RHP A;  4ODG A;  1A3T A;  1MGS A;  4C3J G;  1LAC A;  5KRU A;  2IPK D;  2ZT9 C;  2TMP A;  3I4N B;  3BDO A;  2BCO A;  3BVZ A;  1A15 A;  2R61 A;  1JOR A;  3S1Q B;  1RTN A;  1NR2 A;  3DEO A;  1WTW A;  3V05 A;  2MP1 A;  1BQQ T;  5BN4 A;  1LTG D;  3RD4 A;  3DM1 A;  1DXM A;  4J8Q A;  3NBI A;  3BS1 A;  1AN8 A;  1DOK A;  1EIH A;  1IL8 A;  5JOB A;  3VA7 A;  2WAC A;  2PPB C;  1JCK B;  1RF2 D;  3KBG A;  3HOZ B;  3QO2 A;  1GXD C;  4R8N A;  1H9K A;  2PCF B;  1YNN D;  3VR2 A;  1JWS D;  2F0G A;  5IGD A;  3S14 B;  4A93 B;  4L6T B;  4WOR A;  3MXN A;  1TKW B;  1XYI A;  2J4X A;  1O7Z A;  4EVO A;  3CRL C;  4IQZ A;  3R8B A;  2F0S A;  1EQT A;  1Y1V B;  4HMJ A;  1LO5 D;  2CVR A;  2PW5 A;  2NVT B;  1B44 D;  5JVH 3;  2C9O A;  2H4O A;  2J0T D;  1DOL A;  3EJI A;  1F2Y A;  1SNM A;  3EQL C;  1JC7 A;  4OO1 G;  5C0X G;  1SYE A;  2ZXP A;  1BNZ A;  2B2U C;  4RHS A;  1V1P B;  3GTP B;  3RMH A;  1PYW D;  2NVX B;  4XDX A;  3S1N B;  4IUQ A;  1S4Z A;  3E0J A;  5I6W A;  3MXP A;  4HR7 B;  4ME5 A;  4FP5 D;  3NWT A;  3C46 A;  1KLG D;  4KK7 A;  3D4D A;  4DAV A;  1X3Q A;  1EY8 A;  4CJ1 B;  2CW0 C;  2NB0 A;  4RH6 A;  4PQX A;  2O2L D;  5KNB A;  3L3O C;  2EYJ A;  1K8M A;  1EFI D;  3L7Z C;  1B4O A;  2EPB A;  4FNF A;  1I4Q A;  2KED A;  2NUC A;  2EDG A;  5ELD A;  5C5L A;  1E2V A;  3MXU A;  1LLR D;  5JEA J;  4XQQ A;  2PYK A;  3GD7 A;  4YIJ A;  1SNP A;  2B2V A;  1I3Q B;  4V19 0;  1R4Q B;  2D62 A;  4DGZ A;  2Q8R E;  3RZO B;  1I4R A;  4Q0F A;  1J9O A;  3TBI B;  2AWO A;  3FRP B;  1QCB D;  2KJX A;  4IN3 A;  2JA6 B;  1GUS A;  1NUC A;  3EA6 A;  2KOL A;  1KAA A;  3A7L A;  1QIL A;  2JSO A;  2F0H A;  1VDZ A;  1F2L A;  4UDU C;  1TWC B;  2K28 A;  4MHE A;  1TS4 A;  3ITP A;  1FNU A;  3HS0 C;  2F0W A;  1SMY C;  3N6R A;  1DZ1 A;  4ULL A;  2B39 A;  3M7G A;  5I4D A;  5FOB B;  2XRQ D;  5FO7 B;  4A3M B;  4J6H A;  3HKZ B;  1PZJ D;  3KF8 A;  2F0L A;  4KKS A;  3EFX D;  1F2M A;  1E2Z A;  2RVL A;  4P2C B;  1PLF A;  4HMI A;  4IUV A;  2PO4 A;  4O1N A;  5FO9 B;  3ND8 A;  5EQ0 A;  1PRT D;  4V0B A;  1LTI D;  2EJM A;  2G9H D;  3EVQ A;  1D5Z C;  4KHZ A;  1OXX K;  4OO1 I;  2A68 C;  2R7Z B;  2JA5 B;  1LV9 A;  2F0E A;  3ONA B;  5C0X I;  1FNW A;  2WV6 D;  4H13 C;  4Q5V A;  3K5L A;  1ENA A;  3SDZ A;  1HFN A;  2AUK A;  1KAB A;  2E75 C;  3BVG A;  2WKD A;  2ENB A;  1QG7 A;  1V43 A;  3H3V C;  4DA2 A;  5G3L D;  4LJZ C;  4R9W A;  4J1M A;  1B50 A;  1L0X B;  4C3H G;  5ELC A;  2HQE A;  3BYT B;  1CZG A;  3NQI A;  5ELE A;  3WOE A;  1D2B A;  1RTO A;  2IT1 A;  1U4R A;  4K2K A;  1TY0 A;  1PZI D;  4DNR B;  4NP5 A;  1KNA A;  1SDF A;  3D6W A;  4CBV A;  2AUJ D;  1W6K A;  4OIJ A;  3I72 A;  2KQ3 A;  4NW2 A;  1SSO A;  2WKC A;  1MSG A;  2DNE A;  3M7N A;  3GTM B;  5J1Z A;  1ONL A;  3MEH A;  1QE6 A;  2DN8 A;  4K5X A;  4XQJ A;  5IGE A;  1B2T A;  1WVL A;  4A3I B;  5CV6 A;  4XQN A;  3TP6 A;  3NTH A;  3W3A A;  1XTC D;  1HQM C;  3OMC A;  1Z7T A;  2HDL A;  1Y8N B;  1KDB A;  3P1H A;  1V8Q A;  1MSH A;  3F2U A;  3PIO 3;  2BDN A;  2JEB I;  2LMC B;  1OXU A;  3K5M A;  5LL6 S;  2LKV A;  1H9R A;  4ZYS A;  1Y1W B;  3T53 B;  4KY6 A;  3NWS A;  1EWH A;  3LWE A;  2QDB A;  1VMC A;  3IFD A;  4IZ8 A;  1J8I A;  3G7L A;  1HA5 A;  2A69 C;  3SK8 A;  1D5M C;  2FMM A;  3QJY A;  1S5F D;  1G2T A;  4OIK A;  3PUV A;  4QUF A;  3I73 A;  5EBD A;  3TP5 A;  4IUT A;  3S16 B;  3URY A;  1CA6 A;  3VR4 A;  2H1E A;  1V1O A;  1TWG B;  5C4H A;  1SE4 A;  2PW7 A;  1JOQ A;  1ENF A;  3OIQ A;  2F4I A;  1BCP C;  4XYO A;  2Y0S B;  4C3I B;  3A8I E;  2M2L A;  4CKB A;  1U4L A;  1SJH D;  1ET6 A;  4U68 A;  4HSP A;  3R3O A;  1BO0 A;  4RHR A;  1PMR A;  3FDT A;  2A6H C;  1JOO A;  1A6X A;  2RQX A;  3HP3 A;  2RSN A;  3FPP A;  1BR9 A;  5E3F A;  1ET9 A;  2E76 C;  4ABN A;  2F0M A;  4EQO A;  5I9O A;  3MFY A;  4DK0 A;  4DNT B;  1EY9 A;  4JBW A;  3NUC A;  5KEE A;  2YYZ A;  3FVQ A;  4G57 A;  5JEA H;  3J80 E;  2OT2 A;  4X3T A;  4KKT A;  4M1U B;  1EOT A;  3K59 A;  1PXU A;  4BS9 A;  1BF4 A;  2B2T A;  1SEB D;  2L55 A;  1FYC A;  5C3X A;  2FMC A;  4RCN A;  1I6H B;  5IGG A;  1SYF A;  3ERQ A;  2Z8L A;  5EPL A;  2L1B A;  5TSS A;  5NUC A;  1EL0 A;  1DM0 B;  2B2Y C;  1SFO B;  4FF1 A;  4HED A;  1LT6 D;  2EY2 A;  3PO2 B;  1DD2 A;  1F9R A;  1PRT F;  2Z1C A;  3O13 A;  1GUN A;  2A73 B;  1QOH A;  4A3B B;  4AYB B;  1W6J A;  4N9P A;  3PUZ A;  1R9T B;  3SEB A;  4XT3 B;  3T13 A;  4QIW B;  3TZD A;  1A3V A;  1FD7 D;  2PMZ B;  2CW0 D;  3VR6 A;  5D3I B;  3QG1 A;  4IUR A;  1QNU A;  3J80 L;  5HGT A;  1PTO B;  4RGO S;  4RAU C;  1MI2 A;  4FXK C;  5G3L F;  1GOZ A;  4MN3 A;  1I6V C;  1AZP A;  1M4V A;  5BN3 A;  1LTS D;  1OXV A;  2FJ2 A;  1SYC A;  2JYO A;  5C44 B;  3P7J A;  1WTX A;  2WB1 B;  3HEJ A;  1C4Q A;  1AFP A;  2X6L A;  2AWN A;  2M00 A;  2ICE C;  4QB4 A;  1ZYR C;  1R4P B;  2HCC A;  4F7X A;  2B2W A;  1KDA A;  1EIG A;  5IT9 E;  2K5W A;  2A6E C;  1GHK A;  1A2T A;  2A74 C;  3PUY A;  3J7A F;  5JAV A;  2JA7 B;  1V1P A;  3CHB D;  1CT1 D;  3OIP A;  4X3K A;  3TN2 A;  2B2U A;  1ILP A;  4K8J A;  3H6M A;  4H7B A;  3DWP A;  1F9Q A;  3A7A B;  5EGT A;  2EYH A;  4NKL A;  3BVM A;  4C1N I;  4PMW A;  5I6Y A;  1RKN A;  1X3P A;  1WCM B;  1HRJ A;  2XRS D;  4Z9C B;  3M3Y B;  4TSS A;  4PMB A;  2PZW A;  3X3N A;  3OMG A;  2FFK B;  4LAA A;  3C1F A;  2B8G A;  4ZUI A;  3OWE B;  4K14 A;  3SHL A;  2VB3 X;  1EY7 A;  1ZKO A;  2R93 B;  1ZXT A;  4FYD A;  2EXZ A;  5IT9 L;  3BDL A;  1SYG A;  3MFG A;  4IUU A;  2K1B A;  1Q3L A;  1MBY A;  5CV8 A;  2SOB A;  4G7Z C;  1EY6 A;  1B3A A;  1O80 A;  3MZ5 A;  4K6D A;  2K7V A;  1WTQ A;  2NN6 G;  1II3 A;  4GZY C;  2CQA A;  2F0D A;  1HA6 A;  4PV1 C;  4XT1 B;  2QF7 A;  2F0I A;  2A68 D;  1STB A;  2R3Z A;  2IWH A;  2KEC A;  3D4R A;  2EY1 A;  2EYP A;  4QUC A;  4K5W A;  1RDP D;  2K01 A;  2JE6 I;  3AB9 A;  1YNJ C;  2K5Q A;  2I46 A;  4OO1 H;  2R6G A;  2X69 A;  5C0X H;  1OXT A;  3PUW A;  3GTL B;  4TKO B;  1PFB A;  4ZRZ A;  3LX0 A;  5E1F A;  1LTB D;  3K5O A;  3KLS A;  2RDG A;  2NYZ D;  5CYU A;  3GTJ B;  5D14 A;  1DON A;  3A54 A;  3K7A B;  5J39 A;  1TWH B;  4F88 A;  3HZX A;  1SXT A;  1EY4 A;  3BZD B;  5JPN C;  2KA7 A;  1ZEQ X;  2MJ8 A;  3WOF A;  3KLR A;  1TS5 A;  3TME A;  1O7Y A;  5CV7 A;  2Z4H A;  4KTA A;  1FR3 A;  3OOC A;  1STY A;  2OXP A;  2RDF A;  1HTL D;  2KHS A;  1Q1B A;  3M85 A;  4I7Z C;  2L9H A;  5KYI A;  2O5J C;  4X3U A;  2IJ0 A;  4F8M A;  2MUY A;  1I4G A;  3G6J B;  1XXG A;  1CI3 M;  5C5M A;  2F0T A;  3GO5 A;  2EJF C;  2G9D A;  4B9X A;  1VF5 C;  3GQB A;  1E2W A;  2B2V C;  1EZ8 A;  5M5X B;  3HOU B;  3Q23 A;  5E4X A;  2RSO A;  1EYD A;  2C5C A;  1WTV A;  5D65 A;  1GUG A;  2EJG C;  3WDN A;  3D8G A;  2BOS A;  3MTS A;  1CA5 A;  5DEH A;  1F2Z A;  2NTS A;  2K32 A;  3DXJ C;  2EY6 A;  2NBF A;  2XWJ B;  3T56 B;  1STA A;  4WRD A;  3U9S A;  4A3K B;  4H44 C;  1AEX A;  3DMU A;  4C56 C;  3VYT A;  1CHP D;  2NN6 I;  5M5W B;  4B08 A;  4RGT A;  3MXG A;  3FMC A;  2VXW A;  3OW7 A;  4K5V A;  3QOL A;  1KDC A;  1SE2 A;  5EPK A;  2B8F A;  1IW7 D;  3UI2 A;  5IOC A;  1PFM A;  3IFT A;  3NBH A;  4ILW A;  4QMG A;  3OWF A;  4TRD A;  1EEF D;  3FEW X;  3MWY W;  2EE1 A;  2MGS A;  4KHV A;  3RUZ A;  3TP8 A;  1A2U A;  1BUV T;  2KUM A;  1H9S B;  2FHT A;  2KCN A;  3S1R B;  3R2I A;  4FO2 A;  2LFN A;  2AQ2 B;  1NSN S;  4DN4 M;  3H91 A;  3R93 A;  4KN4 C;  2F0F A;  1VCI A;  4IFD G;  5C3W A;  5CV4 A;  3X3M A;  2OF1 A;  4HTH A;  1EU3 A;  1S5C D;  1Y8P B;  1E0B A;  2E2I B;  4LK1 C;  5M5Y B;  2F03 A;  4NMZ A;  1LT5 D;  3VR5 A;  1STG A;  1O78 A;  3H0G B;  5FKA C;  5KYL A;  1PTO D;  2BDO A;  1S5E D;  4K2L A;  1FGB D;  4WJW A;  2IW3 A;  1SAP A;  1VMP A;  1JR0 D;  2IX1 A;  2MHV A;  4A3F B;  1EU4 A;  1ROD A;  2QKI C;  1C48 A;  2XSC A;  5KND A;  2DY8 A;  5ISR A;  1U4M A;  3HRZ C;  3GTG B;  4RKL A;  3U9O A;  1CK1 A;  1F9S A;  5BN5 A;  4O42 A;  5C4Z A;  5CC4 A;  1EYA A;  2Q8T A;  3TDQ A;  1AP0 A;  3S2D B;  4C3H B;  4ZQ3 A;  2WIN B;  1GJX A;  1SNQ A;  1PRT C;  4TQU S;  2RDH A;  3A56 A;  5IGB A;  4C2M B;  1WD1 A;  3SE0 A;  5JPM C;  3BG3 A;  4A3D B;  5K36 G;  1BCP B;  2HUG A;  3NTI A;  3KUP A;  5KIX A;  4CJ0 B;  4HCS A;  5F2D A;  1O7L A;  2R92 B;  2PZU A;  4RA8 A;  5J22 A;  3K0Y A;  3A8J E;  5A35 A;  1HXY D;  4MIU A;  1K8O A;  5FK9 C;  2KVM A;  2XN9 C;  3S15 B;  1IKL A;  3JAM E;  3OHX C;  4PMC A;  4ZKC B;  5K5P A;  5CV9 A;  4NDX A;  4EGV A;  2F0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...