1WVLA

Crystal structure of multimeric dna-binding protein sac7d-gcn4 with dna decamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
b'MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKKGVLKKLRAVENELH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*AP*TP*AP*TP*AP*GP*G)-3'
publication title Design and characterization of a multimeric DNA binding protein using Sac7d and GCN4 as templates
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Structural protein/dna
total genus 19
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wvlA00
1JICA 1IKMA 2FINB 1QNKA 4ZKBB 1EIHA 2EE1A 1O7ZA 1HFGA 4R8IA 1WD1A 1B50A 4X3TA 1BF4A 1DOMA 4XT3B 1RODA 2NZ1D 1U4MA 2B2YC 2B2YA 2KVMA 3DM1A 5T1IA 1Q3LA 1SAPA 4XDXA 1B2TA 2N88A 1F9SA 2SDFA 4DN4M 1ICWA 2JP1A 2L12A 1G2TA 1AZQA 1WVLA 2K28A 1NCVA 4X3UA 3GV3A 5DNFA 1JE4A 3I91A 4IUQA 1BBXC 2X69A 2B2TC 2IL8A 2L11A 1EQTA 2HDMA 2K01A 5EPJA 2NYZD 1EIGA 2B2VC 1RTNA 2X6GA 1J8IA 1ESRA 2KECA 1VMCA 2BDNA 2M2LA 1BNZA 2NWGA 4MHEA 4HSVA 1PLFA 2FHTA 1B53A 2MPMA 1ML0D 1J9OA 1U4PA 4RA8A 2N55A 3TZDA 1U4LA 2HCIA 1O7YA 1KNEA 2K05A 2HUGA 1M8AA 3I8ZA 1NR2A 1HHVA 1TVXA 1DOLA 2FFKB 2MP1A 1E0BA 5CMDA 1G6ZA 2D9UA 1PFMA 4IUPA 4ZKCB 1EL0A 2RVLA 2HCCA 3HP3A 3Q6SA 1WTPA 1DZ1A 3D6WA 4XT1B 3SVMA 2XIWA 1EOTA 2JYOA 1WTRA 1U4RA 1WTQA 1F9RA 3I3CA 5CBAE 2L4NA 1HUNA 1RHPA 1X3PA 1HFNA 1G2SA 3LWEA 3ONAB 3FPUB 4CJ0B 5EPKA 4OIJA 1GUWA 2L9HA 1CM9A 4OIKA 1VMPA 4IUUA 2KUMA 4NW2A 1QG7A 2B2WA 2EOTA 1CA5A 1HA6A 2KEDA 4IURA 5COYA 2J7ZA 1BO0A 2R3ZA 5E4WC 4ZLTF 3F2UA 1ILPA 2L1BA 4HAEA 4QUFA 2KOLA 5JJZA 1MI2A 1ILQA 1PDQA 1NR4A 4U68A 3KUPA 4ZK9B 5EKIA 1SSOA 1X32A 2K1BA 1S4ZA 2MGSA 4X3KA 4CJ2C 3H91A 2K03A 3MWYW 4ZAIA 3R93A 2CVRA 1HRJA 1G91A 1MGSA 4UAIA 2FJ2A 1B3AA 1DOKA 2RSNA 1PFNA 3FDTA 5D65A 4IUVA 1WTWA 4O42A 1WTVA 3KBXA 5AFWA 4HEDA 1CA6A 1AZPA 2K04A 3GV6A 5E4XA 5EQ0A 1MSGA 1F9PA 2B2UA 2EPBA 4LMQD 2H1EA 2Q8RE 1LV9A 1A15A 1IKLA 3N52A 2X6LA 3IL8A 2VXWA 1SDFA 1X3QA 4R9WA 1NAPA 2HDLA 5D14A 1RJTA 5EJWA 2B2WC 3P7JA 5T1GA 3QO2A 4MN3A 2RA4A 1C8CA 4X3SA 1B4OA 1O80A 2DY8A 4QUCA 1WTOA 2KEEA 3TN2A 1WD0A 4HCSA 1F2LA 5CBEE 4RAUC 2DY7A 1IL8A 5EPLA 2FMMA 1WTXA 5CORA 2B2TA 1DONA 3G7LA 3MTSA 1HUMA 1F9QA 1QE6A 2B2VA 2MJ8A 3I90A 4CJ1B 1PFBA 2RSOA 1RTOA 1ZXTA 4IUTA 2Q8TA 1AP0A 3DEPA 3IFDA 3UI2A 1KNAA 1XYIA 1XX8A 1MSHA 2B2UC 3DEOA 4RWSC
chains in the Genus database with same CATH superfamily
1Q8KA 2R6GA 4BA2I 1HFGA 3T1HQ 4JYAL 1DOMA 3Q8DA 2Q2HA 3DM1A 4LUOA 1KABA 2B63H 2DUDA 4BBRG 5DNFA 2XNAC 1RL2A 1TY0A 5IY0A 1TWAH 4K2KA 1S40A 1QCBD 3VYRA 1SEBD 3GDEA 5EPJA 2G9DA 2Z6BA 2OCEA 5G3LD 2OQ0A 4RFBA 1HZAA 4C56C 5DEHA 1GUGA 5IGDA 4L63B 5IYBH 3R3OA 2L5TA 1IW7C 4A3BB 1DOLA 4YHHL 4FF1A 3GTGB 3F2BA 1EOVA 2XIWA 3BVMA 4IO9A 1HH2P 1LM0A 3T56B 4BBSG 3I3CA 2KCMA 2LSSA 1X56A 4M8AA 5GROA 4BS9A 2LFNA 4FF3A 1JWMD 1TS2A 4CDDC 1SR3A 2L9HA 2AUJD 2B29A 1H9SA 1ASZA 2ZJQA 4KY6A 4O1NA 5BR8L 4IURA 4C2MB 1BO0A 3F2UA 3GTGH 3CHBD 2NVXB 5K5PA 1EY0A 4FXDA 1TU2B 5CV8A 3TP8A 1V1PA 1EY9A 2RSNA 4A3KG 4RKBA 5C5MA 5C44B 1WI5A 2EPBA 3OWEB 1ZKOA 2CH4A 5EGTA 4KKUA 4QGUA 4C2MH 4EQ5A 1STNA 2L15A 4EQPA 2A6EC 2NVXH 5KIXA 3RR5A 1XMQL 4LF8Q 3D3RA 4RAUC 5ELEA 1X9NA 1YHQA 3H3VC 1TIID 1A2UA 5C44H 4NXML 1KDBA 1K9MC 5C0XJ 4ULLA 3FHWA 4OL7A 4AQYL 3DEOA 3NBHA 4RWSC 3I4MB 1E1OA 4ZKBB 5IGGA 3A7AB 4N8X1 5T1IA 4CBVA 4HR7B 4P74A 5EBCA 3W2DA 5I2YA 1IBLQ 4F7XA 4CDEC 1G2TA 4GN3B 1QILA 3DUZA 4LF9L 4X64Q 2KECA 3HFZB 5C4ZA 2F0TA 3I4MH 2E8GA 4HSVA 1ENAA 4KHPL 2IJ0A 1BCPD 2WB1B 3RMHA 2KHSA 3KJOA 4KHVA 4QMGA 1R4QB 1VQHA 2F1MA 2N78A 4K0KQ 1O7YA 1I3QB 1QNUA 2NZOA 1CI3M 4YCWA 3ER0A 3CXCA 4B3MQ 1K0SA 2Y0SE 3H3VI 1D5MC 5FLMH 2IX1A 4ABNA 1AE3A 3HEJA 2QA4A 1T5EA 4Q5VA 1JORA 4V190 4WJ4A 5CV4A 3PIOA 3CCLA 2WV6D 1SNCA 2ASBA 5ELNA 2KUMA 4JOIC 2UUAQ 3T1HL 2AWOA 4UP9A 1T5XD 4PNYA 5D3DA 2MO0A 2MQHA 2CH4W 4PV1C 2Y0SG 4BBRB 1V1QA 3MWYW 1AN8A 4DR5L 1IL2A 1G91A 4DAYB 4HJ5A 4GKKQ 5CV6A 4JCVE 1H9SB 2R61A 1AZPA 1VQLA 1VQDA 5E4XA 1S72A 2F3WA 1JR0D 2HDLA 4DV7Q 5C4XG 4DKAC 3P7JA 4JBWA 4BBRH 1KIXA 5K36H 2R7ZB 1CHPD 4LUZA 3UE0A 1N32Q 3VDYA 1V1PB 1UAPA 4G4KA 5M3MB 1BVSA 3CW2C 1IYUA 2RHQB 5ELBA 4BBSB 1N34Q 3OTOQ 3L9AX 1Z47A 5NUCA 1CKNB 3MTSA 4DPGA 1HUMA 1FJGL 4X65Q 1LT5D 5IWAQ 1EU4A 2A69D 4LF6Q 2J0TD 1JICA 1SYDA 3X3MA 1D8LA 1VQJA 1PMRA 1EIHA 3AYHB 4KJOA 2R7ZH 2OTJA 1WD1A 4DUZQ 2C9OA 1I4QA 3Q22A 1HNWL 1U4MA 2TMPA 5M3MH 2RCFA 2I5MX 1KRSA 3DWAA 3ULJA 4BBSH 2K4KA 4A3MH 3NK9A 2K28A 5LMNW 3TDQA 4IUQA 1N9WA 1YVCA 4H7BA 5JEAH 2JA6G 1U5KA 3H0GB 3TQYA 3S1QB 4A93B 2E2JB 4A3KB 1P16A 1X54A 3TMEA 2B2VC 1RTNA 1J8IA 2MHVA 1VMCA 1RF2D 1QVGA 4H0LC 2QKIC 4HIMA 4RCNA 4G7ZC 2PW5A 5C3XA 2A73B 2JEAI 4IJLA 4C3JG 1H9MA 5HGQA 2EY5A 3CMAA 2A1AA 4KK7A 4BY7G 2MP1A 4LF8L 1EY8A 1TWFB 3H0GH 4A93H 1HZ9A 2E2JH 4LNQA 4A3KH 5JJIA 1I4RA 1OXVA 3D6WA 3A55A 1GVPA 1Q7YC 2D2CC 1K8AC 4IFDJ 2UXBQ 1B8AA 1PH5A 3ZYYX 2F0UA 4DR7Q 3LWEA 2Z6KA 1PA6A 5FLXc 2I5LX 1GHJA 2J4XA 2F03A 4KI0A 5DAUA 3T13A 1N33L 3M4QA 4NMZA 2J7ZA 4RGOS 2QGQA 1BBUA 1PXUA 1TWFH 2UU9Q 4UDUC 5HY6A 1TT2A 1Y1VG 4PG3A 4OO1G 3HZXA 4DUYL 4ZAIA 5CR3A 3K57A 5EAYA 4UAIA 1HJPA 1X3FA 3KBXA 4GNXC 4CDCC 1YNJC 3J7AF 4BWGB 2BA1A 1EYAA 5GAEC 1DONA 3J80c 3BVZA 4K0KL 1GUSA 1RJTA 2CCZA 3TRZA 1VQAA 1MIUA 4DV3L 4B3ML 4C3HH 1L1OB 2DNEA 5IGCA 1BKBA 2QCPX 1D2BA 5JPMC 5FO9B 3WWVA 5L37A 4RKLA 1ZXTA 1EY4A 3HRZC 3PGZA 1ENFA 1MSHA 3G6EA 1A63A 1XPUA 4A3GG 4PMBA 1PH4A 4O0AA 2JA7G 1NY4A 4KV6A 5M9OA 3W1BA 1O7ZA 4DR3Q 4A3CG 4GOPB 2NZ1D 2Y0SB 4Y7NB 1CZGA 3I70A 2LXKA 2OTLA 3NWSA 1DD2A 1FNWA 1CQFA 2JXMB 2C5CA 2GVAA 3J7YW 1JB7A 1LTBD 1WJJA 3AU7A 4UHVA 3TSSA 2N3SA 5EKKA 1NMFA 4JBJA 4DF7A 1X6OA 2PZWA 1FNVA 3A54A 2AWNA 3MZ5A 4RCOA 4CKEA 5AJ3L 1E2VA 2E2IB 2AHOB 1NBWA 4IPCA 5HGTA 4LFAQ 2YTXA 2F0JA 3HKZE 2UXCQ 2VNUD 1M8AA 4DV5Q 4KN7C 2V1CC 1N32L 5TSSA 1VQ7A 4R4OA 4XQQA 2K5WA 4PZ6A 3ERSX 3TBIB 3KDFA 1IHZA 2ZT9C 5CBAE 1XTCD 2QEXA 3AMUA 4IALA 1ZYRD 1TWGB 2F52A 4UP8A 1A3UA 4X65L 4P75A 4C3IG 3J81c 2E2IH 2R93G 5IWAL 3VR2A 2K5DA 1CZWA 3SK5A 1GUWA 1CSPA 2JE6I 1SE2A 1PH2A 4KD4A 2JQOA 3H94A 3HKZG 4NW2A 4DUZL 2NB0A 3I56A 1N36Q 2YYZA 2K5VA 3D4WA 4HMJA 4ZLTF 1PVOA 3C2PA 4HAEA 5C3EG 1ILQA 3OW2A 4ZUIA 4U68A 4ME5A 1Z9FA 3KLSA 2HIVA 4A3IG 1EUJA 4DV2Q 2CQOA 1S5ED 1TWGH 2B63G 1DOKA 4F88A 3UDGA 4DV4L 2XWBB 4IUVA 4APVA 4B3SQ 2RCNA 1UNSA 2EY6A 4KTAA 3MXNB 4IOCA 4BY7B 1STBA 1AEXA 3GTLB 5IYBG 4OWXB 1KDCA 1IL8A 2EVBA 3OMCA 3CD6A 5KRUA 4LUVA 2GA4B 4G57A 1PRTC 1F9QA 4JI3L 4CJ1B 3PO3B 2UXBL 1PZID 4DR7L 3PSIA 2KHJA 4LF7L 2MUYA 4OX9Q 2M00A 4JBMA 1PTOC 1YIJA 4BY7H 3GTLH 1FYCA 4FXGC 4N9TA 2XTIA 2UU9L 3NTKA 4CKBA 2EYJA 3G6JB 4ODGA 1BBWA 2LMCB 2BCOA 1WVLA 2XWJB 5A2QL 1Q46A 1JE4A 4FP5D 1DXMA 3PO3H 1XXGA 1E2ZA 1YHAA 2NYZD 4Q0FA 5C0XH 1SN8A 4MHEA 4DV1L 2EYMA 2ICIA 2CW0D 2MPMA 3K59A 2AKWB 2ENBA 5KYLA 3AFQA 2K05A 1TS4A 4MTKA 1KD1C 4OO1H 2K50A 3SR1A 2IY5B 4NPSA 2A5HA 4B3RQ 3HP3A 1WTPA 1CKMA 4PZ8A 2F0FA 1SLJA 2PQAA 3RUZA 2KQ3A 1G8ZD 1SNMA 1KHIA 3MAQA 1G2SA 3HGBA 2ZM6L 4FF2A 2RDHA 5G3LF 3F2CA 2JA7B 3JC66 1S5DD 2VQEQ 4QF4A 2L0CA 1CM9A 1OO9B 3V05A 3R2TA 4LFBQ 2WIIB 2UUCL 3KF8B 3PF4A 1K3RA 3KDFB 3MXPA 1RIPA 2EYPA 3S24A 2K32A 2IX0A 4X3KA 2MGSA 5ELDA 4K6LA 1F2YA 2NUCA 2JA7H 4JI8Q 4ALPA 4DK0A 4DNIA 1SROA 4RMFA 1B3QA 2ZXOA 1B70B 1A15A 5EJWA 1X3QA 3J7AV 3VYUA 4NB3A 3GQBA 1YNXA 2WB1E 4DV5L 5CV7A 1VS0A 4JI1Q 1VF7A 2C35B 4H13C 5JVG3 4WRDA 1B9NA 2DN8A 1BCPB 3PCOB 1PFBA 2R93B 2NZHA 1VQOA 4FO2A 1PV4A 4V0BA 3VA5A 2AQ1B 2FINB 1SMYD 1YHBA 3A0JA 3EJIA 1RCVD 2NN6I 1B50A 2WB1G 3FKIB 4X3TA 5C3EB 4EQNA 2B2YA 2KA7A 4A3IB 1F9SA 1Y8OB 3GTKB 1CHQD 3QWNA 3GV3A 4DV6Q 4LF5Q 5A2QE 1JOQA 2IL8A 2Z8LA 5BN4A 3KF6A 2R93H 4DR4Q 1EIGA 2D62A 3CKIB 2ZJPA 2M9VA 5GAGC 2DGYA 1J9OA 5E3FA 4I7AA 2K5HA 3FKIH 2IHEA 5C3EH 1UWVA 4JI5L 2PZUA 4IFDI 4A3IH 3P20A 3F1ZA 5IGEA 2VQFQ 1NR2A 3GTKH 2QF7A 3A8JE 3SGIA 2A6HD 4GLVB 3HOVG 1SFOB 3Q6SA 1DZ1A 4DAVA 5K36G 4LFCQ 1A2TA 2PYKA 2CWPA 3C1EA 4RGMA 1WTQA 1EU3A 1EQQA 3T4AC 3R2IA 1HFNA 3ZJYC 3NUCA 4EGVA 2VS1A 2AMCB 3T53B 1BCPF 4WJ3M 1WCMG 1F2ZA 3JAMc 1KDAA 1GUNA 1K8GA 4TVAB 3E3XA 1SFOH 3NSWA 1UEAB 4YWMA 3J80i 2R7ZG 2KBNA 5FLXL 3M85A 1TR5A 4XQJA 4LWCA 5ELFA 3UDXA 3VR5A 5M3MG 4DXGA 3RN5A 2F0PA 2FJ2A 1XMOQ 1PFNA 4A3MG 1K83B 1UEBA 5JEAG 1M1KC 4JI6Q 1XNQL 2PCFB 3UE1A 3ITPA 3K7AB 1EFWA 3HOYB 3I4OA 1XWEA 4B3RL 2FMMA 3WDNA 2Z4HA 1K83H 3J80L 1E24A 3H0GG 4A93G 1VQBA 1PYWD 3EFXD 1UE7A 2VQEL 1Q12A 1TS3A 3H09A 3K7AH 1SE4A 4R8IA 2VY3A 3HOYH 3KYHC 1YNNC 4IPDA 1TY2A 3BG3A 3CU7A 1LT4D 4DN4M 2JEBI 2EYFA 4X3UA 3TEHB 1E2WA 5GAHC 2B39A 2B2TC 3HOWB 2NVYH 5J22A 3NELA 3DWPA 1NSNS 2RHSB 3QG1A 1ESRA 4K5VA 4JI8L 2XRQD 2FHTA 1CSQA 2A74C 4OGQC 4X6AH 1SJED 4JOIA 3K81C 4B9XA 5IP9G 1KNEA 1VCIA 3J81i 1NMGA 5HURA 2IX3A 5GQOA 1IBMQ 1TVXA 3KF6B 4YY3Q 3HOWH 1VQNA 1L0XB 1B44D 5D3IB 1M90C 4C3HG 4IN3A 3TS0A 2E5LL 3K0YA 1JQYD 1E7ZA 2VB2X 1OXXK 4OXPA 1YI2A 3PUVA 4A3FB 1HNXQ 1EWCA 2D5DA 1ILPA 3FPPA 4A3LG 1JOKA 4LJZC 1KRTA 3S1NB 1CFMA 4IOAA 1WYDA 2EXDA 3KUPA 5FLXE 5CV9A 3J81L 3M4YA 3EN2A 3CF5A 3LGJA 1B3AA 1D5ZC 4A75A 1CA6A 4DGZA 4GKJL 1QUQA 1WOCA 3NQTA 2HQLA 2KENA 3KJPA 4RH6A 4A3FH 1VQ9A 3S17B 1NAPA 3EA6A 1C48A 2F0OA 3SK6A 1EY7A 3QO2A 4KKTA 2VQFL 3S1NH 2FMCA 3K7UC 2XVSA 4LW1A 4POGA 3HOVB 2EYOA 4HCSA 1F2LA 1DYQA 1HTPA 4BA1I 4QY7A 5CORA 3HKSA 4L8JA 3ULLA 1FNUA 4LFCL 2A68C 3J80E 1Y1WG 2B2VA 2ZTEA 1EY6A 1LYLA 1HR0Q 3STBD 2LXJA 3UDFA 3NTIA 3S17H 1WCMB 2NTTA 4DR2Q 1YBYA 3H3VH 3I55A 3GTOB 4K14A 1L0WA 2IWHA 2OF1A 1Z7TA 3HOVH 4GLAC 2Q2IA 5I9PA 2KVMA 2ID0A 2OT2A 1N8RC 4XDXA 2ZTDA 1BUVT 3T51B 3CC2A 3O13A 3E9IA 1DCZA 1LTLA 2YTYA 4L5QA 4A3MB 3RZOB 2K01A 1I6HB 1XMOL 1YJ9A 1Y8PB 3DXJC 4A3DG 1VQPA 1WCMH 2BE5D 3G48A 2WP8J 5H1SE 3GTOH 1XPRA 3OYYA 4RA8A 1AFPA 3K58A 4JI6L 3BS1A 4YWKA 1OXUA 1JJGA 3CRKC 4PZ7A 2WKDA 2RQXA 5CMDA 4DU9A 3TP7A 5KGUA 3RZOH 1I6HH 5DM63 4XXEA 1EOTA 2HIXA 2B3GA 1U4RA 1F9RA 4JV5Q 4GNXA 2Z1CA 3NBHB 3CCJA 2O4XA 2E76C 3F8TA 4P2CB 4A76A 3VYTA 3EQLC 3NTHA 5JPNC 2EOTA 3CPWA 2KEDA 1EY5A 4JI2Q 4TRDA 1Y14B 4K8IA 3W1GA 3J81E 3X3NA 2P5ZX 1IBKQ 3GTPB 1SBBB 4XYOA 3RLFA 1HPCA 4DAPA 3I7FA 4DNTB 1L1OC 2V4DA 2UUBQ 1GJXA 3M4OB 3PO3G 5LMUQ 2G9HD 1VQIA 5C0XG 3A56A 3FP9A 1C9OA 3U58A 3KK7A 2B2WC 5C3WA 1IW7D 4XIGS 5IGFA 4B3TQ 4Y52H 1EZ8A 3RLOA 3VR3A 5CBEE 3GTPH 4GOPC 4YY3L 1IBLL 4CGYB 1WTXA 1SNDA 1V1OA 4JI7Q 1XNRQ 4C3HB 1QJOA 3PIO3 3CP0A 2EJFC 3I73A 4P71A 4IUNA 3M4OH 2CHBD 1GHKA 4X64L 3DEPA 4PMCA 5IT9c 5IP9H 1YJNA 3KBGA 4GN5A 4JI4Q 3S2DB 3ICEA 3QIAA 1TQOA 4RHRA 1IKMA 5I6WA 3L3OC 1Q3LA 4NKLA 3FRPB 1OXSC 4WJWA 3D8GA 3M3YB 2AUKA 5EBDA 4KN4C 5IGBA 1SE3A 4KY5A 2I46A 3NPPA 4S3SA 3CQZB 3S2DH 1SYEA 1SYCA 4A3LH 2D0PA 5GADC 3Q0AA 1A62A 2UUAL 5IE8A 2A6ED 1SXTA 2A8VA 2K52A 4ME3A 2FFKB 3S16B 2HHHQ 3S14B 3JAMi 1UUPA 3M3YH 1Y1WB 1SNOA 1HUNA 1X3GA 4GKKL 3CQZH 2ICEC 4DV0Q 4K8JA 1J5EQ 3CCVA 1VQ6A 4DR2L 4OIKA 4HIDA 2BH2A 4HIOA 1LTSD 4DV7L 2RKSA 4ZCKA 1SMXA 2VZAA 4FF4A 3S16H 4QJFA 3U9OA 3S14H 2L1BA 2KOLA 1PFSA 1NR4A 1Y1WH 2BDOA 3I4NB 4PMWA 5EKIA 1SSOA 1X32A 2MNAA 1E1TA 2F0QA 3R93A 1N34L 4A3DB 3OTOL 5D65A 3A8KE 3JAML 1FGUA 2R92B 3CC7A 3S1MB 3MEHA 3V2TA 1KAAA 2PMZB 4KY7A 2KCTA 3IL8A 4R9WA 4LF6L 3WOFA 3OMGA 3D6CA 4MN3A 3I4NH 1B4OA 2KCCA 3FKIG 2H5XA 3URYA 1TWCB 3K5LA 3SK8A 4A3EB 2DY7A 1JJCB 1ASYA 4A3DH 2RDGA 1S5BD 2R92H 4IJHA 1QE6A 1H9JA 1STGA 3S1MH 3GTQB 3WOEA 1VQMA 2NN6G 2PQEA 4FVMA 1JB3A 2YV5A 5FO7B 1G51A 1VQEA 1W3SA 3KOJA 2K75A 1HZCA 1TWCH 4CHTB 3ERQA 4A3EH 1BQQT 4IQZA 1GO3E 2B8FA 2N88A 1KAWA 1IBKL 1BBXC 4HJ7A 1D1IA 3KLSX 3GTQH 1QB5D 1SRUA 4R1JA 2UUBL 3U9SA 1ET9A 2KHIA 2G5DA 5CV5A 2LY7A 1B53A 1X3EA 2CKZB 4QL5A 5LMUL 1ESFA 1QZHA 3TP6A 4HJ8A 3IAYA 5KNCA 1BOSA 1GOZA 1CK1A 2QEJC 3I4LA 4B3TL 1QVFA 3SEBA 1E0BA 3PIP3 2D9UA 1JCKB 2WFWA 4L6TB 4JI7L 1XNRL 4IZ8A 1VQGA 1RHPA 2NTSA 5DM73 2YU9H 4GN4B 1JMCA 5EPKA 3EBEA 3AEVA 2OWOA 1VMPA 3L2PA 3NEMA 3HS0C 1HA6A 2HT1A 1O7LA 3KFUA 5J1ZA 2JA5G 1VQCA 4HJAA 3MHBA 5JJZA 3HOXB 2F0GA 4NP5A 3HOYG 3SK4A 3RNUA 3GTJB 5J39A 3H91A 5M5XB 5JEAJ 1C4QA 2QDLA 5KEEA 1W2BA 4DNRB 1B9MA 3JAME 1WTWA 1WTVA 1E22A 1ET6A 1GM5A 1OXTA 1MBYA 1MSGA 5A35A 2Q8IB 2Q8RE 1BCPC 1KXLA 1VQFA 5JVH3 1KLGD 1U9RA 2WAQE 4DR3L 1V8QA 3HOXH 4HJ9A 3HOZG 3BDCA 3GTJH 2HHHL 4C1NI 1HTLD 2GN5A 5M5XH 1LTGD 3C3LA 3MFYA 3BVGA 3OSOA 3BYYB 3IRBA 3G7LA 3CCSA 5M3FH 5IYDH 2MJ8A 1C7YA 3BZDB 4UY8C 4IUTA 1Q8IA 4DV0L 3HOWG 4RHSA 3G4SA 4L5SA 4R8NA 5IYCH 1C0AA 2CWAA 2WAQG 2EJGC 4RGTA 1EEFD 1PH8A 1MJCA 4XT3B 4LFAL 3MVVA 2JK8A 2UXCL 2PI2A 1PZJD 1PYBA 2ES2A 1I4PA 1MHWC 2F3IA 1NCVA 2YTVA 3U4VA 2X69A 3P1HA 4TSSA 4A4IA 2F4IA 2L11A 4XQNA 1OTCA 4NXMQ 4JI0Q 1ONLA 4YCVA 2A19A 2I0QA 2QDBA 1O78A 1YNJD 4JBKA 1B7YB 2H4OA 1PH7A 1ML0D 1U4PA 3K5NA 1Y69U 4GLXA 4JC0A 1HQRD 1S5FD 4AYBE 1D5XC 4JPBW 2HUGA 1EIFA 1N36L 5C5LA 1D7QA 1ZEQX 4A3FG 3AQQA 1K8OA 2K33A 4ZKCB 3ND8A 5LL6X 5JJLA 2HCCA 4DV2L 2BOSA 4LF9Q 4NXNQ 4UP7A 1MKHA 1VQ5A 1K8MA 1V43A 5JJKA 3KLWA 4UPAA 3FPUB 3VYSA 4CJ0B 4B3SL 1YZ6A 1W6JA 4GZYC 2A69C 4MIUA 1II3A 3NENA 4PQXA 4AYBG 4HSPA 5M5WB 3OWFA 1IYJB 1STAA 3PQIA 2PNHA 4IPGA 5FOBB 4R4IA 2GVBA 3MXUA 3S1RB 1K0RA 4I7ZC 4K6DA 1HRJA 3C46A 2F0NA 3FDTA 2NN6H 3CCMA 5BN3A 4JK1C 3IKJA 3L7ZC 1XJVA 3S9WA 4OX9L 5M5WH 3W3AA 5M5YB 3MXGA 3A7LA 3EROA 1HXYD 1GUTA 1HR0W 3LWUA 1EEID 2DY8A 3DMUA 1Q1BA 3S1RH 2PQAB 2F0VA 2E74C 1WTHA 4F8MA 1Q90A 3Q24A 3VR4A 4DR5Q 3NWTA 2B2TA 4IFDH 3N6RA 3LNNA 1KNAA 4YCUA 4E6IA 2B2UC 5M5YH 3MC0B 1QNKA 2EE1A 3M7GA 1I6VC 3SE0A 2JA8B 2F0EA 2JA5B 2EIFA 3BYTB 4JG2A 2B2YC 3CRLC 4OELB 1SAPA 3PMFA 1VDZA 3E9HA 4I65A 2ZXRA 2L12A 5IT9L 3OIPA 3M4PA 2OQKA 2E75C 3U4ZA 2F4VQ 1KL9A 2HDMA 2Z0SA 4DAMA 1FJGQ 2EJMA 5I6YA 2NVYB 4DAYA 4KD3A 4QCLA 2N49A 1IZ6A 2QILA 2JA8H 5KNDA 2JA5H 3TZDA 1U4LA 2OXPA 1LLRD 3D4DA 4A3BH 1HNWQ 3HOZB 3I8ZA 4LFBL 2F3VA 3NE5B 3W5OA 5ISRA 3PV0A 1HHVA 2SNSA 4IUPA 1PFMA 4XYQA 4J8QA 4GKJQ 1K3BC 2JYOA 1PRTD 5C4JB 1WTRA 2UXDQ 4DR1Q 1X3PA 2RF4A 2PPBC 3C1FA 1CKNA 4H02A 2DJFC 1FVIA 2WAQB 5CC4A 1PTOD 2EY2A 3RLNA 3HOZH 4HIKA 5DLQE 5FO8B 2JN4A 3GD7A 5IIFA 2WINB 5IOCA 2D0OA 1TKWB 3B6YA 5EKLA 4ZYSA 3L0OA 5C4JH 3KLRA 4X62Q 1CT1D 2IT1A 1EFID 2K03A 2RBMA 4JI1L 1LTID 1SYFA 4JI0L 4YWLA 4O42A 3EVQA 3GV6A 1UE6A 3K5MA 1E3PA 1FGBD 4K2LA 2E2HB 3DWQA 1UE1A 1I50B 2VB3X 1F2MA 4POFA 1N33Q 1H9RA 5T1GA 3PO2B 1WD0A 2O5JC 4DK3C 3G71A 1QOHA 4DUYQ 4DV6L 4LF5L 2K5NA 3K0XA 1K28A 3M7NA 3LX0A 4NXNL 3E6ZX 3I90A 2K6AA 3OPOA 3A74A 4DXFA 4DR4L 1ZYRC 2E2HH 1J6QA 1XX8A 1I50H 4BY1B 3QOJA 4AYBB 2K14A 2F0MA 3GTMB 5BN5A 4A3JB 3PO2H 2IPKD 4C1NK 5KNBA 3U50C 4DV3Q 3FEWX 1W6KA 3FMCA 1EYCA 2I5HA 2JP1A 5IT9E 1YJWA 3I91A 5ELCA 2O5IC 4NDXA 1F77A 4BY1H 3GTMH 3R8BA 3DLLA 4JW0A 1SJHD 4A3JH 1I3QH 1A3VA 4GS3A 3QOLA 1I94Q 3HG9A 4KMUC 4HMIA 5IP7G 1LUZA 2PMZE 3K8AA 1I5FA 2WKCA 3BJUA 4KJNA 3QJYA 4KKSA 3VA7A 3E0EA 1STEA 3V96A 2EDGA 2Q2TA 1L1OA 1JJ2A 1JE5A 3I4NG 1LT6D 2BH8A 5AJ3Q 4LF4Q 4OIJA 2R92G 3A5UA 2JJQA 2VUMG 4ILWA 1HZBA 1HQMC 2ATWA 2B2WA 1O7IA 4QIWE 4YIJA 3CCUA 2NVTB 2HD3A 1FL0A 2NVQB 5COYA 3FVQA 4GOPA 3PUZA 2F0LA 3I72A 3QB3A 5FKAC 1KC8C 4A3EG 2CVRA 2ZXPA 2F4VL 4XTCS 2FXQA 1D6EC 1DM0B 4J15A 5AFWA 3S2HB 2K04A 2DJGC 1TXYA 2CW0C 3NQIA 1SYBA 2NVTH 1BNZA 2NVQH 2EXZA 1SDFA 2RDFA 2VXWA 5D14A 4L5RC 2SEBD 1C8CA 1WTOA 1LABA 3TN2A 2CQAA 2Z4IA 1A6XA 1AE2A 5EPLA 4EX5A 1JOOA 3DM3A 2UXDL 4DR1L 4DV4Q 3S2HH 2N8NA 2RSOA 2Q8TA 1D1KA 3J7A5 3GP7A 3NBIA 4EVOA 5JAVA 1R4PB 3S1QH 1KLUD 1IBML 4KLKA 3RN2A 1ICWA 1Q1EA 2XRSD 4J1MA 1AZQA 4X62L 2ZTCA 3BU2A 3T16A 4DK6C 1QUQB 4JI3Q 1HNZQ 2BDNA 3MA2B 2F0IA 1STHA 2NWGA 3SXHA 4LF7Q 4WORA 3J81j 4U673 3P75A 1EWIA 1JC7A 3IFTA 4TQUS 2E2DC 1ENCA 4DK1A 5FJ8G 1HNXL 3TS2A 4M1UB 2ZJRA 3MXNA 2Z9HA 3A5ZB 2XSCA 3ND9A 1I4HA 3HOXG 2MFIA 4R4QA 1NUCA 4R4CA 3DHQA 4DV1Q 3ONAB 5C4HA 2KJXA 3BDOA 3PUWA 1A3TA 5I4DA 5IYDG 5M3FG 2KCNA 4B9WA 1UE5A 1CUKA 1EIYB 1SMYC 1QG7A 1YNND 1CA5A 2QW7A 2R3ZA 5IYCG 1MI2A 1FD7D 1LTRD 3SHLA 4ZK9B 3GO5A 5LHY1 2TSSA 4RGNA 3CMEA 3ULPA 3PIPA 5E7NA 3BDLA 3PUXA 4HTHA 4HEDA 2ZM6Q 5EQ0A 1EWHA 4CDFC 1XTDA 2Z6KC 4J6HA 1F9PA 3A8IE 4LMQD 1HR0L 5ELOA 2VW9A 1LV9A 2EQSA 4LK1C 1Q86C 1NJIC 3N52A 2X6LA 1I94L 1L2FA 2UUCQ 4FNFA 3HOUG 1YEZA 1ICFB 3RZDB 2ALYB 2XN9C 2A6HC 1FR3A 2R7FA 4GNXB 2JA9A 5CGKA 3E5SA 1VF5C 3PUYA 4N8FA 1BXTA 4MNOA 1XYIA 2VUMB 4LF4L 2O2LD 5C4XB 5IP7H 4Y7NH 4OONA 3K5OA 1S5CD 3BZKA 2Q2UA 1JWSD 1NTGA 1BF4A 2F0KA 3T1YQ 3RZDH 4DR6Q 1EYGA 1VQKA 3NHHA 3NP8A 3NXWA 4BXXG 3PF5A 4FYDA 2SDFA 1NE3A 3KF8A 3QR8A 4IPHA 5FK9C 3K6OA 1GUOA 4G7OC 2AQ2B 1DGSA 4JV5L 4ID6A 2VUMH 2M2LA 3D4RA 5C4XH 3TZUA 1LTTD 4MZ9A 4QIWB 1KQSA 4OWWB 1DJRD 2L55A 1EZ6A 2N55A 5LMNQ 2HCIA 2HQEA 3TP5A 1SNQA 3EIVA 1S3OA 4X66Q 4JI2L 4WFN3 1LTAD 4EQOA 1G6ZA 1AW7A 2JA6B 2R7DA 1A0IA 2SOBA 1EL0A 4QB4A 1SNPA 4R4TA 2A68D 1G291 4F87A 2F0HA 2L4NA 1VQ4A 3MFGA 1X55A 1IYVA 3UDIA 1Q81C 4AH6A 1JT8A 2LKVA 4C3JB 4G7HC 4L5TA 2YU9B 3I2ZA 4IFDG 4IUUA 1JWUD 2I07B 4JI5Q 4K5WA 1IXRA 4FDBA 1EQRA 2AQ3B 1H9KA 1PYSB 4OEMB 5C0XI 2EZVA 4JYAQ 5E4WC 4AIMA 2JA6H 4QUFA 3OIQA 4ZRZA 2K1BA 1S4ZA 1PHJA 1GXDC 1MGSA 4HN7A 3BZCA 1HNZL 4C3JH 4OO1I 1EYDA 1KTKA 4K5XA 4O2DA 1R9TB 2BA0A 5LL6S 1STYA 1PZKD 1IKLA 5F2DA 4DA2A 2F0WA 1RKNA 3K80C 1T9HA 4JI4L 3VR6A 2PI2E 1AH9A 2XGTA 2VL6A 4X3SA 2JA8G 1Y1VB 1XPOA 2IW3A 4YHHQ 3AB9A 3RD4A 4A3BG 4DFAA 2CFMA 3OHXC 4MTNA 1R9TH 1PH6A 1AP0A 1RTOA 1SE8A 3UI2A 3IFDA 3D31A 5M3FB 3CCQA 3S15B 1L0YB 3CAMA 5FJ8H 3J7ZC 1XNQQ 5I2XA 1EQVA 5BR8Q 1U0LA 1Y1VH 1RODA 4LAAA 1B2TA 1G6PA 1PRTB 3CCRA 3Q23A 1K73C 3CCEA 1TWHB 5KYIA 1PH3A 1HA5A 4KHZA 1VQ8A 3CPFA 1EQTA 1HCZA 5IODA 1GD7A 2X6GA 3S15H 1CTMA 1X65A 4A3GB 1PTOB 2DNCA 1LT3D 1MD2D 4TKOB 1YITA 1PLFA 1Z6HA 4QQBX 4JVZA 5C44G 1J5EL 5C6AA 3H6MA 2WACA 2EY1A 1Y8NB 1CQVA 2PZTA 3E0JA 4ZQ3A 3HOUB 1BR9A 3D0FA 1NNXA 1TWHH 4RG1A 1V9PA 1XMQQ 1SYGA 2RVLA 1P8LA 4XT1B 1I4GA 3SVMA 2K5QA 4A3GH 1M4VA 1PTOH 2OEOA 4P73A 3SDZA 1A8VA 4CKCA 4B08A 4A3CH 3STBC 4H44C 4AQYQ 3AFPA 3HOUH 3OOCA 3H15A 4Z9CB 1TS5A 3I4MG 2PNRC 2F0SA 3MEFA 3T1YL 1LACA 4DR6L 2EYHA 4FXKC 2PW7A 5CYUA 1GKHA 1Q82C 1PDQA 4OWTB 3PO2G 2K7VA 4CJ2C 4OHJA 4N9PA 1PH9A 1PRTF 1RD9D 5I9OA 2JSOA 4C3IB 5FLMG 1QWYA 2E5LQ 2MO1A 1CKOA 1I4XA 4P72A 2BE5C 2NBFA 1MJEA 5E1FA 2B2UA 5J3BA 1BDOA 2SNMA 4KHPQ 2H1EA 3CC4A 3OW7A 3HKZB 5JOBA 5LMNL 1B1ZA 4BXXH 1PTOF 4BY1G 2LS01 2F0DA 2EYLA 4ZUJA 4X66L 2RA4A 4A3JG 1O80A 2IHFA 4QUCA 2KEEA 2B63B 1RDPD 1PH1A 1WFQA 3M9BA 1H95A 4HCEA 4C3IH 1QVCA 1TWAB 2B8GA 1QZGA 3TREA 2PO4A 1LO5D 3F2DA
chains in the Genus database with same CATH topology
2R6GA 4BA2I 1HFGA 1DOMA 3DM1A 1KABA 5DNFA 2XNAC 1TY0A 4K2KA 1QCBD 3VYRA 1SEBD 5EPJA 2G9DA 5G3LD 4RFBA 4C56C 5DEHA 1GUGA 5IGDA 4L63B 3R3OA 2L5TA 1IW7C 4A3BB 1DOLA 4FF1A 3GTGB 2XIWA 3BVMA 3T56B 3I3CA 4M8AA 4BS9A 2LFNA 4FF3A 1JWMD 1TS2A 2L9HA 2AUJD 1H9SA 4KY6A 4O1NA 4IURA 4C2MB 1BO0A 3F2UA 3CHBD 2NVXB 5K5PA 1EY0A 4FXDA 1TU2B 5CV8A 3TP8A 1V1PA 1EY9A 2RSNA 4RKBA 5C5MA 5C44B 2EPBA 3OWEB 1ZKOA 5EGTA 4KKUA 1STNA 4EQPA 2A6EC 5KIXA 3D3RA 4RAUC 5ELEA 3H3VC 1TIID 1A2UA 1KDBA 5C0XJ 4ULLA 4OL7A 3DEOA 3NBHA 4RWSC 3I4MB 4ZKBB 5IGGA 3A7AB 5T1IA 4CBVA 4HR7B 5EBCA 3W2DA 5I2YA 4F7XA 1G2TA 1QILA 3DUZA 2KECA 5C4ZA 2F0TA 4HSVA 1ENAA 2IJ0A 1BCPD 2WB1B 3RMHA 2KHSA 4KHVA 4QMGA 1R4QB 2F1MA 1O7YA 1I3QB 1QNUA 1CI3M 1D5MC 2IX1A 4ABNA 3HEJA 1T5EA 4Q5VA 1JORA 4V190 5CV4A 2WV6D 1SNCA 2KUMA 2AWOA 1T5XD 4PNYA 5D3DA 4PV1C 4BBRB 3MWYW 1AN8A 1G91A 5CV6A 1H9SB 2R61A 1AZPA 5E4XA 2F3WA 1JR0D 2HDLA 3P7JA 4JBWA 5K36H 2R7ZB 1CHPD 1V1PB 1UAPA 4G4KA 5M3MB 1IYUA 5ELBA 4BBSB 3L9AX 1Z47A 5NUCA 3MTSA 1HUMA 1LT5D 1EU4A 2A69D 2J0TD 1JICA 1SYDA 3X3MA 1PMRA 1EIHA 4KJOA 1WD1A 2C9OA 1I4QA 3Q22A 1U4MA 2TMPA 3DWAA 3NK9A 2K28A 3TDQA 4IUQA 4H7BA 5JEAH 3S1QB 3H0GB 4A93B 2E2JB 4A3KB 3TMEA 2B2VC 1RTNA 1J8IA 2MHVA 1VMCA 1RF2D 4H0LC 2QKIC 4RCNA 4G7ZC 2PW5A 5C3XA 2A73B 2JEAI 4C3JG 1H9MA 2EY5A 4KK7A 2MP1A 1EY8A 1TWFB 1I4RA 1OXVA 3D6WA 3A55A 2D2CC 4IFDJ 3ZYYX 2F0UA 3LWEA 1GHJA 2J4XA 2F03A 4KI0A 5DAUA 3T13A 4NMZA 2J7ZA 4RGOS 1PXUA 4UDUC 1TT2A 4OO1G 3HZXA 4ZAIA 5CR3A 3K57A 4UAIA 3KBXA 1YNJC 3J7AF 4BWGB 2BA1A 1EYAA 1DONA 3BVZA 1GUSA 1RJTA 2DNEA 5IGCA 2QCPX 1D2BA 5JPMC 5FO9B 4RKLA 1ZXTA 1EY4A 3HRZC 1ENFA 1MSHA 4PMBA 4KV6A 5M9OA 1O7ZA 2NZ1D 2Y0SB 4Y7NB 1CZGA 3I70A 3NWSA 1DD2A 1FNWA 1CQFA 2JXMB 2C5CA 3J7YW 1LTBD 3AU7A 3TSSA 5EKKA 4DF7A 2PZWA 1FNVA 3A54A 2AWNA 3MZ5A 4RCOA 4CKEA 1E2VA 2E2IB 5HGTA 2F0JA 2VNUD 1M8AA 4KN7C 5TSSA 4XQQA 2K5WA 3TBIB 1IHZA 2ZT9C 5CBAE 1XTCD 3AMUA 4IALA 1ZYRD 1TWGB 1A3UA 4C3IG 3VR2A 2K5DA 1CZWA 3SK5A 1GUWA 2JE6I 1SE2A 4KD4A 3H94A 4NW2A 2NB0A 2YYZA 3D4WA 4HMJA 4ZLTF 3C2PA 4HAEA 1ILQA 4ZUIA 4U68A 4ME5A 3KLSA 1S5ED 1DOKA 4F88A 2XWBB 4IUVA 1UNSA 2EY6A 4KTAA 4BY7B 1STBA 1AEXA 3GTLB 1KDCA 1IL8A 2EVBA 3OMCA 5KRUA 2GA4B 4G57A 1PRTC 4CJ1B 1F9QA 3PO3B 1PZID 2MUYA 2M00A 1PTOC 1FYCA 4FXGC 4N9TA 3NTKA 4CKBA 2EYJA 3G6JB 4ODGA 2LMCB 2BCOA 1WVLA 2XWJB 5A2QL 1JE4A 4FP5D 1DXMA 1XXGA 1E2ZA 2NYZD 4Q0FA 5C0XH 4MHEA 2EYMA 2ICIA 2CW0D 2MPMA 3K59A 2ENBA 5KYLA 2K05A 1TS4A 4OO1H 3SR1A 2A5HA 3HP3A 1WTPA 2F0FA 3RUZA 2KQ3A 1G8ZD 1SNMA 3MAQA 1G2SA 3HGBA 4FF2A 2RDHA 5G3LF 2JA7B 1S5DD 4QF4A 2L0CA 1CM9A 1OO9B 3V05A 3R2TA 2WIIB 3MXPA 2EYPA 2K32A 2IX0A 4X3KA 2MGSA 5ELDA 4K6LA 1F2YA 2NUCA 4DK0A 2ZXOA 1A15A 5EJWA 1X3QA 3J7AV 3VYUA 3GQBA 5CV7A 1VF7A 4H13C 5JVG3 4WRDA 1B9NA 2DN8A 1BCPB 1PFBA 2R93B 4FO2A 4V0BA 3VA5A 2AQ1B 2FINB 1SMYD 3EJIA 1RCVD 2NN6I 1B50A 3FKIB 4X3TA 5C3EB 4EQNA 2B2YA 2KA7A 4A3IB 1F9SA 1Y8OB 3GTKB 1CHQD 3QWNA 3GV3A 5A2QE 1JOQA 2IL8A 2Z8LA 5BN4A 1EIGA 2D62A 3CKIB 2M9VA 1J9OA 5E3FA 2PZUA 4IFDI 3P20A 5IGEA 1NR2A 2QF7A 3A8JE 2A6HD 1SFOB 3Q6SA 1DZ1A 4DAVA 5K36G 1A2TA 2PYKA 3C1EA 1WTQA 4RGMA 1EU3A 3T4AC 3R2IA 1HFNA 3NUCA 4EGVA 3T53B 1BCPF 1F2ZA 1KDAA 1GUNA 3NSWA 1UEAB 5FLXL 3M85A 1TR5A 4XQJA 3VR5A 5ELFA 4DXGA 2F0PA 2FJ2A 1PFNA 1K83B 5JEAG 2PCFB 3ITPA 3K7AB 3HOYB 1XWEA 2FMMA 3WDNA 2Z4HA 3J80L 1PYWD 3EFXD 1Q12A 1TS3A 3H09A 1SE4A 4R8IA 1YNNC 1TY2A 3BG3A 3CU7A 1LT4D 4DN4M 2JEBI 2EYFA 4X3UA 1E2WA 2B39A 2B2TC 3HOWB 5J22A 3DWPA 4K5VA 1NSNS 3QG1A 1ESRA 2XRQD 2FHTA 2A74C 4OGQC 1SJED 4B9XA 1KNEA 1VCIA 5HURA 2IX3A 1TVXA 1L0XB 1B44D 5D3IB 4C3HG 4IN3A 3K0YA 1JQYD 2VB2X 1OXXK 3PUVA 4A3FB 1EWCA 2D5DA 1ILPA 3FPPA 1JOKA 4LJZC 3S1NB 1CFMA 3KUPA 5FLXE 5CV9A 3J81L 3M4YA 1B3AA 1D5ZC 1CA6A 4DGZA 3NQTA 4RH6A 3S17B 1NAPA 3EA6A 1C48A 2F0OA 3SK6A 1EY7A 3QO2A 4KKTA 2FMCA 2XVSA 3HOVB 2EYOA 4HCSA 1F2LA 1DYQA 1HTPA 4BA1I 5CORA 4L8JA 1FNUA 2A68C 3J80E 2B2VA 1EY6A 3NTIA 1WCMB 2NTTA 3GTOB 4K14A 2IWHA 2OF1A 1Z7TA 5I9PA 2KVMA 2ID0A 2OT2A 4XDXA 1BUVT 3T51B 3O13A 1DCZA 4A3MB 3RZOB 2K01A 1I6HB 1Y8PB 3DXJC 2BE5D 2WP8J 4RA8A 1AFPA 3K58A 3BS1A 1OXUA 3CRKC 2WKDA 2RQXA 5CMDA 4DU9A 3TP7A 5KGUA 5DM63 4XXEA 1EOTA 1U4RA 1F9RA 2Z1CA 2O4XA 2E76C 4P2CB 3VYTA 3EQLC 3NTHA 5JPNC 2EOTA 2KEDA 1EY5A 4TRDA 4K8IA 3J81E 3X3NA 3GTPB 1SBBB 4XYOA 3RLFA 1HPCA 4DAPA 4DNTB 2V4DA 1GJXA 3M4OB 2G9HD 5C0XG 3A56A 3KK7A 2B2WC 5C3WA 1IW7D 4XIGS 5IGFA 1EZ8A 3VR3A 5CBEE 4CGYB 1WTXA 1SNDA 1V1OA 4C3HB 1QJOA 3PIO3 2EJFC 3I73A 4IUNA 2CHBD 1GHKA 3DEPA 4PMCA 3KBGA 3S2DB 3QIAA 1TQOA 4RHRA 1IKMA 5I6WA 3L3OC 1Q3LA 4NKLA 3FRPB 1OXSC 4WJWA 3D8GA 3M3YB 2AUKA 5EBDA 4KN4C 5IGBA 1SE3A 4KY5A 2I46A 3NPPA 4S3SA 3CQZB 1SYEA 1SYCA 3Q0AA 2A6ED 1SXTA 2FFKB 3S16B 3S14B 1UUPA 1Y1WB 1SNOA 1HUNA 2ICEC 4K8JA 4OIKA 1LTSD 2RKSA 4FF4A 3U9OA 2L1BA 2KOLA 1NR4A 2BDOA 3I4NB 4PMWA 5EKIA 1SSOA 1X32A 2F0QA 3R93A 4A3DB 5D65A 3A8KE 3JAML 2R92B 3S1MB 3MEHA 3V2TA 1KAAA 2PMZB 4KY7A 4R9WA 3IL8A 3WOFA 3OMGA 3D6CA 4MN3A 1B4OA 2KCCA 3URYA 1TWCB 3K5LA 3SK8A 4A3EB 2DY7A 2RDGA 1S5BD 1QE6A 1H9JA 1STGA 3GTQB 3WOEA 2NN6G 2PQEA 4FVMA 1JB3A 5FO7B 4CHTB 3ERQA 1BQQT 4IQZA 2B8FA 2N88A 1BBXC 1D1IA 3KLSX 1QB5D 3U9SA 1ET9A 5CV5A 2LY7A 1B53A 1ESFA 3TP6A 3IAYA 5KNCA 1BOSA 1GOZA 1CK1A 2QEJC 3I4LA 3SEBA 1E0BA 3PIP3 2D9UA 1JCKB 4L6TB 4IZ8A 1RHPA 2NTSA 5DM73 5EPKA 1VMPA 3HS0C 1HA6A 1O7LA 5J1ZA 3MHBA 5JJZA 3HOXB 2F0GA 4NP5A 3SK4A 3GTJB 5J39A 3H91A 5M5XB 5JEAJ 1C4QA 5KEEA 4DNRB 1B9MA 3JAME 1WTWA 1WTVA 1ET6A 1OXTA 1MBYA 1MSGA 5A35A 2Q8IB 2Q8RE 1BCPC 5JVH3 1KLGD 1U9RA 1V8QA 3BDCA 4C1NI 1HTLD 1LTGD 3C3LA 3MFYA 3BVGA 3OSOA 3BYYB 3G7LA 2MJ8A 3BZDB 4IUTA 1Q8IA 4RHSA 4R8NA 2EJGC 4RGTA 1EEFD 4XT3B 3MVVA 1PZJD 1I4PA 1NCVA 2X69A 3P1HA 4TSSA 2F4IA 2L11A 4XQNA 1ONLA 2QDBA 1O78A 1YNJD 2H4OA 1ML0D 1U4PA 3K5NA 1Y69U 1HQRD 1S5FD 1D5XC 2HUGA 5C5LA 1ZEQX 1K8OA 2K33A 4ZKCB 3ND8A 5LL6X 2HCCA 2BOSA 1K8MA 1V43A 3FPUB 3VYSA 4CJ0B 1W6JA 4GZYC 2A69C 4MIUA 1II3A 4PQXA 4HSPA 5M5WB 3OWFA 1STAA 5FOBB 3MXUA 3S1RB 4I7ZC 4K6DA 1HRJA 3C46A 2F0NA 3FDTA 2NN6H 5BN3A 4JK1C 3IKJA 3L7ZC 3S9WA 3W3AA 5M5YB 3MXGA 3A7LA 3EROA 1HXYD 1GUTA 3LWUA 1EEID 2DY8A 3DMUA 1Q1BA 2F0VA 2E74C 4F8MA 1Q90A 3Q24A 3VR4A 3NWTA 2B2TA 4IFDH 3N6RA 3LNNA 1KNAA 4E6IA 2B2UC 3MC0B 1QNKA 2EE1A 3M7GA 1I6VC 3SE0A 2JA8B 2F0EA 2JA5B 3BYTB 2B2YC 3CRLC 1SAPA 3PMFA 1VDZA 4I65A 2ZXRA 2L12A 5IT9L 3OIPA 2E75C 2HDMA 2EJMA 5I6YA 2NVYB 4DAYA 4KD3A 4QCLA 2QILA 5KNDA 3TZDA 1U4LA 2OXPA 1LLRD 3D4DA 3HOZB 3I8ZA 2F3VA 3NE5B 5ISRA 1HHVA 3PV0A 2SNSA 4IUPA 1PFMA 4XYQA 4J8QA 2JYOA 1PRTD 5C4JB 1WTRA 1X3PA 2PPBC 3C1FA 2WAQB 5CC4A 1PTOD 2EY2A 5FO8B 3GD7A 5IIFA 2WINB 5IOCA 1TKWB 5EKLA 4ZYSA 3KLRA 1CT1D 2IT1A 1EFID 2K03A 2RBMA 1LTID 1SYFA 4O42A 3EVQA 3GV6A 3K5MA 1FGBD 4K2LA 2E2HB 3DWQA 1I50B 2VB3X 1F2MA 1H9RA 5T1GA 3PO2B 1WD0A 2O5JC 1QOHA 3M7NA 3LX0A 3E6ZX 3I90A 2K6AA 3OPOA 4DXFA 1ZYRC 1XX8A 4BY1B 3QOJA 4AYBB 3GTMB 2F0MA 5BN5A 4A3JB 2IPKD 4C1NK 5KNBA 3FEWX 1W6KA 3FMCA 1EYCA 2JP1A 5IT9E 3I91A 5ELCA 2O5IC 4NDXA 1F77A 3R8BA 1SJHD 1A3VA 3QOLA 3HG9A 4KMUC 4HMIA 2WKCA 4KJNA 3QJYA 4KKSA 3VA7A 3V96A 1STEA 2EDGA 1LT6D 4OIJA 4ILWA 1HQMC 2B2WA 4YIJA 2NVTB 2NVQB 5COYA 3FVQA 3PUZA 2F0LA 3I72A 3QB3A 5FKAC 2CVRA 2ZXPA 4XTCS 1D6EC 1DM0B 5AFWA 3S2HB 2K04A 2CW0C 3NQIA 1SYBA 1BNZA 2EXZA 1SDFA 2RDFA 2VXWA 5D14A 2SEBD 1C8CA 1WTOA 1LABA 3TN2A 2CQAA 2Z4IA 1A6XA 5EPLA 1JOOA 2RSOA 2Q8TA 1D1KA 3GP7A 3NBIA 4EVOA 5JAVA 1R4PB 1KLUD 1ICWA 1Q1EA 2XRSD 4J1MA 1AZQA 3T16A 2BDNA 3MA2B 2F0IA 1STHA 2NWGA 3SXHA 4WORA 4U673 3P75A 1JC7A 3IFTA 4TQUS 2E2DC 1ENCA 4DK1A 4M1UB 3MXNA 2XSCA 3ND9A 1I4HA 1NUCA 3DHQA 3ONAB 5C4HA 2KJXA 3BDOA 3PUWA 1A3TA 5I4DA 2KCNA 4B9WA 1SMYC 1QG7A 1YNND 1CA5A 2R3ZA 1MI2A 1FD7D 1LTRD 3SHLA 4ZK9B 3GO5A 5LHY1 2TSSA 4RGNA 3BDLA 3PUXA 4HTHA 4HEDA 5EQ0A 1EWHA 4J6HA 1F9PA 3A8IE 4LMQD 1LV9A 4LK1C 3N52A 2X6LA 4FNFA 3RZDB 2XN9C 2A6HC 1FR3A 5CGKA 3E5SA 1VF5C 3PUYA 1BXTA 1XYIA 2VUMB 2O2LD 5C4XB 3K5OA 1S5CD 1JWSD 1BF4A 2F0KA 3NHHA 3NP8A 3NXWA 4FYDA 2SDFA 3KF8A 5FK9C 3K6OA 1GUOA 4G7OC 2AQ2B 4ID6A 2M2LA 3D4RA 3TZUA 1LTTD 4QIWB 1DJRD 2L55A 1EZ6A 2N55A 2HCIA 2HQEA 3TP5A 1SNQA 4WFN3 1LTAD 4EQOA 1G6ZA 1AW7A 2JA6B 1EL0A 2SOBA 4QB4A 1SNPA 2A68D 1G291 4F87A 2F0HA 2L4NA 3MFGA 1IYVA 2LKVA 4C3JB 4G7HC 2YU9B 4IFDG 4IUUA 1JWUD 2I07B 4K5WA 2AQ3B 1H9KA 2EZVA 5C0XI 5E4WC 4QUFA 3OIQA 4ZRZA 2K1BA 1S4ZA 1GXDC 1MGSA 4HN7A 4OO1I 1EYDA 1KTKA 4K5XA 1R9TB 2BA0A 5LL6S 1STYA 1PZKD 1IKLA 5F2DA 4DA2A 2F0WA 1RKNA 3VR6A 4X3SA 1Y1VB 2IW3A 3AB9A 3RD4A 4DFAA 3OHXC 1AP0A 1RTOA 3UI2A 3IFDA 3D31A 5M3FB 3S15B 1L0YB 5I2XA 1EQVA 1RODA 4LAAA 1B2TA 1PRTB 3Q23A 1TWHB 5KYIA 1HA5A 4KHZA 1EQTA 1HCZA 5IODA 2X6GA 1CTMA 4A3GB 1PTOB 2DNCA 1LT3D 1MD2D 4TKOB 1PLFA 1Z6HA 5C6AA 3H6MA 2WACA 2EY1A 1Y8NB 1CQVA 2PZTA 3E0JA 4ZQ3A 3HOUB 1BR9A 1SYGA 2RVLA 4XT1B 1I4GA 3SVMA 2K5QA 1M4VA 1PTOH 2OEOA 3SDZA 4CKCA 4B08A 4H44C 3OOCA 4Z9CB 1TS5A 2PNRC 2F0SA 1LACA 2EYHA 4FXKC 2PW7A 5CYUA 1PDQA 2K7VA 4CJ2C 4OHJA 4N9PA 1PRTF 1RD9D 5I9OA 2JSOA 4C3IB 1QWYA 1I4XA 2BE5C 2NBFA 5E1FA 2B2UA 1BDOA 2SNMA 2H1EA 3OW7A 3HKZB 5JOBA 1B1ZA 1PTOF 2LS01 2F0DA 2EYLA 4ZUJA 2RA4A 1O80A 4QUCA 2KEEA 2B63B 1RDPD 4HCEA 1TWAB 2B8GA 2PO4A 1LO5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JIC A;  1IKM A;  2FIN B;  1QNK A;  4ZKB B;  1EIH A;  2EE1 A;  1O7Z A;  1HFG A;  4R8I A;  1WD1 A;  1B50 A;  4X3T A;  1BF4 A;  1DOM A;  4XT3 B;  1ROD A;  2NZ1 D;  1U4M A;  2B2Y C;  2B2Y A;  2KVM A;  3DM1 A;  5T1I A;  1Q3L A;  1SAP A;  4XDX A;  1B2T A;  2N88 A;  1F9S A;  2SDF A;  4DN4 M;  1ICW A;  2JP1 A;  2L12 A;  1G2T A;  1AZQ A;  1WVL A;  2K28 A;  1NCV A;  4X3U A;  3GV3 A;  5DNF A;  1JE4 A;  3I91 A;  4IUQ A;  1BBX C;  2X69 A;  2B2T C;  2IL8 A;  2L11 A;  1EQT A;  2HDM A;  2K01 A;  5EPJ A;  2NYZ D;  1EIG A;  2B2V C;  1RTN A;  2X6G A;  1J8I A;  1ESR A;  2KEC A;  1VMC A;  2BDN A;  2M2L A;  1BNZ A;  2NWG A;  4MHE A;  4HSV A;  1PLF A;  2FHT A;  1B53 A;  2MPM A;  1ML0 D;  1J9O A;  1U4P A;  4RA8 A;  2N55 A;  3TZD A;  1U4L A;  2HCI A;  1O7Y A;  1KNE A;  2K05 A;  2HUG A;  1M8A A;  3I8Z A;  1NR2 A;  1HHV A;  1TVX A;  1DOL A;  2FFK B;  2MP1 A;  1E0B A;  5CMD A;  1G6Z A;  2D9U A;  1PFM A;  4IUP A;  4ZKC B;  1EL0 A;  2RVL A;  2HCC A;  3HP3 A;  3Q6S A;  1WTP A;  1DZ1 A;  3D6W A;  4XT1 B;  3SVM A;  2XIW A;  1EOT A;  2JYO A;  1WTR A;  1U4R A;  1WTQ A;  1F9R A;  3I3C A;  5CBA E;  2L4N A;  1HUN A;  1RHP A;  1X3P A;  1HFN A;  1G2S A;  3LWE A;  3ONA B;  3FPU B;  4CJ0 B;  5EPK A;  4OIJ A;  1GUW A;  2L9H A;  1CM9 A;  4OIK A;  1VMP A;  4IUU A;  2KUM A;  4NW2 A;  1QG7 A;  2B2W A;  2EOT A;  1CA5 A;  1HA6 A;  2KED A;  4IUR A;  5COY A;  2J7Z A;  1BO0 A;  2R3Z A;  5E4W C;  4ZLT F;  3F2U A;  1ILP A;  2L1B A;  4HAE A;  4QUF A;  2KOL A;  5JJZ A;  1MI2 A;  1ILQ A;  1PDQ A;  1NR4 A;  4U68 A;  3KUP A;  4ZK9 B;  5EKI A;  1SSO A;  1X32 A;  2K1B A;  1S4Z A;  2MGS A;  4X3K A;  4CJ2 C;  3H91 A;  2K03 A;  3MWY W;  4ZAI A;  3R93 A;  2CVR A;  1HRJ A;  1G91 A;  1MGS A;  4UAI A;  2FJ2 A;  1B3A A;  1DOK A;  2RSN A;  1PFN A;  3FDT A;  5D65 A;  4IUV A;  1WTW A;  4O42 A;  1WTV A;  3KBX A;  5AFW A;  4HED A;  1CA6 A;  1AZP A;  2K04 A;  3GV6 A;  5E4X A;  5EQ0 A;  1MSG A;  1F9P A;  2B2U A;  2EPB A;  4LMQ D;  2H1E A;  2Q8R E;  1LV9 A;  1A15 A;  1IKL A;  3N52 A;  2X6L A;  3IL8 A;  2VXW A;  1SDF A;  1X3Q A;  4R9W A;  1NAP A;  2HDL A;  5D14 A;  1RJT A;  5EJW A;  2B2W C;  3P7J A;  5T1G A;  3QO2 A;  4MN3 A;  2RA4 A;  1C8C A;  4X3S A;  1B4O A;  1O80 A;  2DY8 A;  4QUC A;  1WTO A;  2KEE A;  3TN2 A;  1WD0 A;  4HCS A;  1F2L A;  5CBE E;  4RAU C;  2DY7 A;  1IL8 A;  5EPL A;  2FMM A;  1WTX A;  5COR A;  2B2T A;  1DON A;  3G7L A;  3MTS A;  1HUM A;  1F9Q A;  1QE6 A;  2B2V A;  2MJ8 A;  3I90 A;  4CJ1 B;  1PFB A;  2RSO A;  1RTO A;  1ZXT A;  4IUT A;  2Q8T A;  1AP0 A;  3DEP A;  3IFD A;  3UI2 A;  1KNA A;  1XYI A;  1XX8 A;  1MSH A;  2B2U C;  3DEO A;  4RWS C; 
#chains in the Genus database with same CATH topology
 1Q8K A;  2R6G A;  4BA2 I;  1HFG A;  3T1H Q;  4JYA L;  1DOM A;  3Q8D A;  2Q2H A;  3DM1 A;  4LUO A;  1KAB A;  2B63 H;  2DUD A;  4BBR G;  5DNF A;  2XNA C;  1RL2 A;  1TY0 A;  5IY0 A;  1TWA H;  4K2K A;  1S40 A;  1QCB D;  3VYR A;  1SEB D;  3GDE A;  5EPJ A;  2G9D A;  2Z6B A;  2OCE A;  5G3L D;  2OQ0 A;  4RFB A;  1HZA A;  4C56 C;  5DEH A;  1GUG A;  5IGD A;  4L63 B;  5IYB H;  3R3O A;  2L5T A;  1IW7 C;  4A3B B;  1DOL A;  4YHH L;  4FF1 A;  3GTG B;  3F2B A;  1EOV A;  2XIW A;  3BVM A;  4IO9 A;  1HH2 P;  1LM0 A;  3T56 B;  4BBS G;  3I3C A;  2KCM A;  2LSS A;  1X56 A;  4M8A A;  5GRO A;  4BS9 A;  2LFN A;  4FF3 A;  1JWM D;  1TS2 A;  4CDD C;  1SR3 A;  2L9H A;  2AUJ D;  2B29 A;  1H9S A;  1ASZ A;  2ZJQ A;  4KY6 A;  4O1N A;  5BR8 L;  4IUR A;  4C2M B;  1BO0 A;  3F2U A;  3GTG H;  3CHB D;  2NVX B;  5K5P A;  1EY0 A;  4FXD A;  1TU2 B;  5CV8 A;  3TP8 A;  1V1P A;  1EY9 A;  2RSN A;  4A3K G;  4RKB A;  5C5M A;  5C44 B;  1WI5 A;  2EPB A;  3OWE B;  1ZKO A;  2CH4 A;  5EGT A;  4KKU A;  4QGU A;  4C2M H;  4EQ5 A;  1STN A;  2L15 A;  4EQP A;  2A6E C;  2NVX H;  5KIX A;  3RR5 A;  1XMQ L;  4LF8 Q;  3D3R A;  4RAU C;  5ELE A;  1X9N A;  1YHQ A;  3H3V C;  1TII D;  1A2U A;  5C44 H;  4NXM L;  1KDB A;  1K9M C;  5C0X J;  4ULL A;  3FHW A;  4OL7 A;  4AQY L;  3DEO A;  3NBH A;  4RWS C;  3I4M B;  1E1O A;  4ZKB B;  5IGG A;  3A7A B;  4N8X 1;  5T1I A;  4CBV A;  4HR7 B;  4P74 A;  5EBC A;  3W2D A;  5I2Y A;  1IBL Q;  4F7X A;  4CDE C;  1G2T A;  4GN3 B;  1QIL A;  3DUZ A;  4LF9 L;  4X64 Q;  2KEC A;  3HFZ B;  5C4Z A;  2F0T A;  3I4M H;  2E8G A;  4HSV A;  1ENA A;  4KHP L;  2IJ0 A;  1BCP D;  2WB1 B;  3RMH A;  2KHS A;  3KJO A;  4KHV A;  4QMG A;  1R4Q B;  1VQH A;  2F1M A;  2N78 A;  4K0K Q;  1O7Y A;  1I3Q B;  1QNU A;  2NZO A;  1CI3 M;  4YCW A;  3ER0 A;  3CXC A;  4B3M Q;  1K0S A;  2Y0S E;  3H3V I;  1D5M C;  5FLM H;  2IX1 A;  4ABN A;  1AE3 A;  3HEJ A;  2QA4 A;  1T5E A;  4Q5V A;  1JOR A;  4V19 0;  4WJ4 A;  5CV4 A;  3PIO A;  3CCL A;  2WV6 D;  1SNC A;  2ASB A;  5ELN A;  2KUM A;  4JOI C;  2UUA Q;  3T1H L;  2AWO A;  4UP9 A;  1T5X D;  4PNY A;  5D3D A;  2MO0 A;  2MQH A;  2CH4 W;  4PV1 C;  2Y0S G;  4BBR B;  1V1Q A;  3MWY W;  1AN8 A;  4DR5 L;  1IL2 A;  1G91 A;  4DAY B;  4HJ5 A;  4GKK Q;  5CV6 A;  4JCV E;  1H9S B;  2R61 A;  1AZP A;  1VQL A;  1VQD A;  5E4X A;  1S72 A;  2F3W A;  1JR0 D;  2HDL A;  4DV7 Q;  5C4X G;  4DKA C;  3P7J A;  4JBW A;  4BBR H;  1KIX A;  5K36 H;  2R7Z B;  1CHP D;  4LUZ A;  3UE0 A;  1N32 Q;  3VDY A;  1V1P B;  1UAP A;  4G4K A;  5M3M B;  1BVS A;  3CW2 C;  1IYU A;  2RHQ B;  5ELB A;  4BBS B;  1N34 Q;  3OTO Q;  3L9A X;  1Z47 A;  5NUC A;  1CKN B;  3MTS A;  4DPG A;  1HUM A;  1FJG L;  4X65 Q;  1LT5 D;  5IWA Q;  1EU4 A;  2A69 D;  4LF6 Q;  2J0T D;  1JIC A;  1SYD A;  3X3M A;  1D8L A;  1VQJ A;  1PMR A;  1EIH A;  3AYH B;  4KJO A;  2R7Z H;  2OTJ A;  1WD1 A;  4DUZ Q;  2C9O A;  1I4Q A;  3Q22 A;  1HNW L;  1U4M A;  2TMP A;  5M3M H;  2RCF A;  2I5M X;  1KRS A;  3DWA A;  3ULJ A;  4BBS H;  2K4K A;  4A3M H;  3NK9 A;  2K28 A;  5LMN W;  3TDQ A;  4IUQ A;  1N9W A;  1YVC A;  4H7B A;  5JEA H;  2JA6 G;  1U5K A;  3H0G B;  3TQY A;  3S1Q B;  4A93 B;  2E2J B;  4A3K B;  1P16 A;  1X54 A;  3TME A;  2B2V C;  1RTN A;  1J8I A;  2MHV A;  1VMC A;  1RF2 D;  1QVG A;  4H0L C;  2QKI C;  4HIM A;  4RCN A;  4G7Z C;  2PW5 A;  5C3X A;  2A73 B;  2JEA I;  4IJL A;  4C3J G;  1H9M A;  5HGQ A;  2EY5 A;  3CMA A;  2A1A A;  4KK7 A;  4BY7 G;  2MP1 A;  4LF8 L;  1EY8 A;  1TWF B;  3H0G H;  4A93 H;  1HZ9 A;  2E2J H;  4LNQ A;  4A3K H;  5JJI A;  1I4R A;  1OXV A;  3D6W A;  3A55 A;  1GVP A;  1Q7Y C;  2D2C C;  1K8A C;  4IFD J;  2UXB Q;  1B8A A;  1PH5 A;  3ZYY X;  2F0U A;  4DR7 Q;  3LWE A;  2Z6K A;  1PA6 A;  5FLX c;  2I5L X;  1GHJ A;  2J4X A;  2F03 A;  4KI0 A;  5DAU A;  3T13 A;  1N33 L;  3M4Q A;  4NMZ A;  2J7Z A;  4RGO S;  2QGQ A;  1BBU A;  1PXU A;  1TWF H;  2UU9 Q;  4UDU C;  5HY6 A;  1TT2 A;  1Y1V G;  4PG3 A;  4OO1 G;  3HZX A;  4DUY L;  4ZAI A;  5CR3 A;  3K57 A;  5EAY A;  4UAI A;  1HJP A;  1X3F A;  3KBX A;  4GNX C;  4CDC C;  1YNJ C;  3J7A F;  4BWG B;  2BA1 A;  1EYA A;  5GAE C;  1DON A;  3J80 c;  3BVZ A;  4K0K L;  1GUS A;  1RJT A;  2CCZ A;  3TRZ A;  1VQA A;  1MIU A;  4DV3 L;  4B3M L;  4C3H H;  1L1O B;  2DNE A;  5IGC A;  1BKB A;  2QCP X;  1D2B A;  5JPM C;  5FO9 B;  3WWV A;  5L37 A;  4RKL A;  1ZXT A;  1EY4 A;  3HRZ C;  3PGZ A;  1ENF A;  1MSH A;  3G6E A;  1A63 A;  1XPU A;  4A3G G;  4PMB A;  1PH4 A;  4O0A A;  2JA7 G;  1NY4 A;  4KV6 A;  5M9O A;  3W1B A;  1O7Z A;  4DR3 Q;  4A3C G;  4GOP B;  2NZ1 D;  2Y0S B;  4Y7N B;  1CZG A;  3I70 A;  2LXK A;  2OTL A;  3NWS A;  1DD2 A;  1FNW A;  1CQF A;  2JXM B;  2C5C A;  2GVA A;  3J7Y W;  1JB7 A;  1LTB D;  1WJJ A;  3AU7 A;  4UHV A;  3TSS A;  2N3S A;  5EKK A;  1NMF A;  4JBJ A;  4DF7 A;  1X6O A;  2PZW A;  1FNV A;  3A54 A;  2AWN A;  3MZ5 A;  4RCO A;  4CKE A;  5AJ3 L;  1E2V A;  2E2I B;  2AHO B;  1NBW A;  4IPC A;  5HGT A;  4LFA Q;  2YTX A;  2F0J A;  3HKZ E;  2UXC Q;  2VNU D;  1M8A A;  4DV5 Q;  4KN7 C;  2V1C C;  1N32 L;  5TSS A;  1VQ7 A;  4R4O A;  4XQQ A;  2K5W A;  4PZ6 A;  3ERS X;  3TBI B;  3KDF A;  1IHZ A;  2ZT9 C;  5CBA E;  1XTC D;  2QEX A;  3AMU A;  4IAL A;  1ZYR D;  1TWG B;  2F52 A;  4UP8 A;  1A3U A;  4X65 L;  4P75 A;  4C3I G;  3J81 c;  2E2I H;  2R93 G;  5IWA L;  3VR2 A;  2K5D A;  1CZW A;  3SK5 A;  1GUW A;  1CSP A;  2JE6 I;  1SE2 A;  1PH2 A;  4KD4 A;  2JQO A;  3H94 A;  3HKZ G;  4NW2 A;  4DUZ L;  2NB0 A;  3I56 A;  1N36 Q;  2YYZ A;  2K5V A;  3D4W A;  4HMJ A;  4ZLT F;  1PVO A;  3C2P A;  4HAE A;  5C3E G;  1ILQ A;  3OW2 A;  4ZUI A;  4U68 A;  4ME5 A;  1Z9F A;  3KLS A;  2HIV A;  4A3I G;  1EUJ A;  4DV2 Q;  2CQO A;  1S5E D;  1TWG H;  2B63 G;  1DOK A;  4F88 A;  3UDG A;  4DV4 L;  2XWB B;  4IUV A;  4APV A;  4B3S Q;  2RCN A;  1UNS A;  2EY6 A;  4KTA A;  3MXN B;  4IOC A;  4BY7 B;  1STB A;  1AEX A;  3GTL B;  5IYB G;  4OWX B;  1KDC A;  1IL8 A;  2EVB A;  3OMC A;  3CD6 A;  5KRU A;  4LUV A;  2GA4 B;  4G57 A;  1PRT C;  1F9Q A;  4JI3 L;  4CJ1 B;  3PO3 B;  2UXB L;  1PZI D;  4DR7 L;  3PSI A;  2KHJ A;  4LF7 L;  2MUY A;  4OX9 Q;  2M00 A;  4JBM A;  1PTO C;  1YIJ A;  4BY7 H;  3GTL H;  1FYC A;  4FXG C;  4N9T A;  2XTI A;  2UU9 L;  3NTK A;  4CKB A;  2EYJ A;  3G6J B;  4ODG A;  1BBW A;  2LMC B;  2BCO A;  1WVL A;  2XWJ B;  5A2Q L;  1Q46 A;  1JE4 A;  4FP5 D;  1DXM A;  3PO3 H;  1XXG A;  1E2Z A;  1YHA A;  2NYZ D;  4Q0F A;  5C0X H;  1SN8 A;  4MHE A;  4DV1 L;  2EYM A;  2ICI A;  2CW0 D;  2MPM A;  3K59 A;  2AKW B;  2ENB A;  5KYL A;  3AFQ A;  2K05 A;  1TS4 A;  4MTK A;  1KD1 C;  4OO1 H;  2K50 A;  3SR1 A;  2IY5 B;  4NPS A;  2A5H A;  4B3R Q;  3HP3 A;  1WTP A;  1CKM A;  4PZ8 A;  2F0F A;  1SLJ A;  2PQA A;  3RUZ A;  2KQ3 A;  1G8Z D;  1SNM A;  1KHI A;  3MAQ A;  1G2S A;  3HGB A;  2ZM6 L;  4FF2 A;  2RDH A;  5G3L F;  3F2C A;  2JA7 B;  3JC6 6;  1S5D D;  2VQE Q;  4QF4 A;  2L0C A;  1CM9 A;  1OO9 B;  3V05 A;  3R2T A;  4LFB Q;  2WII B;  2UUC L;  3KF8 B;  3PF4 A;  1K3R A;  3KDF B;  3MXP A;  1RIP A;  2EYP A;  3S24 A;  2K32 A;  2IX0 A;  4X3K A;  2MGS A;  5ELD A;  4K6L A;  1F2Y A;  2NUC A;  2JA7 H;  4JI8 Q;  4ALP A;  4DK0 A;  4DNI A;  1SRO A;  4RMF A;  1B3Q A;  2ZXO A;  1B70 B;  1A15 A;  5EJW A;  1X3Q A;  3J7A V;  3VYU A;  4NB3 A;  3GQB A;  1YNX A;  2WB1 E;  4DV5 L;  5CV7 A;  1VS0 A;  4JI1 Q;  1VF7 A;  2C35 B;  4H13 C;  5JVG 3;  4WRD A;  1B9N A;  2DN8 A;  1BCP B;  3PCO B;  1PFB A;  2R93 B;  2NZH A;  1VQO A;  4FO2 A;  1PV4 A;  4V0B A;  3VA5 A;  2AQ1 B;  2FIN B;  1SMY D;  1YHB A;  3A0J A;  3EJI A;  1RCV D;  2NN6 I;  1B50 A;  2WB1 G;  3FKI B;  4X3T A;  5C3E B;  4EQN A;  2B2Y A;  2KA7 A;  4A3I B;  1F9S A;  1Y8O B;  3GTK B;  1CHQ D;  3QWN A;  3GV3 A;  4DV6 Q;  4LF5 Q;  5A2Q E;  1JOQ A;  2IL8 A;  2Z8L A;  5BN4 A;  3KF6 A;  2R93 H;  4DR4 Q;  1EIG A;  2D62 A;  3CKI B;  2ZJP A;  2M9V A;  5GAG C;  2DGY A;  1J9O A;  5E3F A;  4I7A A;  2K5H A;  3FKI H;  2IHE A;  5C3E H;  1UWV A;  4JI5 L;  2PZU A;  4IFD I;  4A3I H;  3P20 A;  3F1Z A;  5IGE A;  2VQF Q;  1NR2 A;  3GTK H;  2QF7 A;  3A8J E;  3SGI A;  2A6H D;  4GLV B;  3HOV G;  1SFO B;  3Q6S A;  1DZ1 A;  4DAV A;  5K36 G;  4LFC Q;  1A2T A;  2PYK A;  2CWP A;  3C1E A;  4RGM A;  1WTQ A;  1EU3 A;  1EQQ A;  3T4A C;  3R2I A;  1HFN A;  3ZJY C;  3NUC A;  4EGV A;  2VS1 A;  2AMC B;  3T53 B;  1BCP F;  4WJ3 M;  1WCM G;  1F2Z A;  3JAM c;  1KDA A;  1GUN A;  1K8G A;  4TVA B;  3E3X A;  1SFO H;  3NSW A;  1UEA B;  4YWM A;  3J80 i;  2R7Z G;  2KBN A;  5FLX L;  3M85 A;  1TR5 A;  4XQJ A;  4LWC A;  5ELF A;  3UDX A;  3VR5 A;  5M3M G;  4DXG A;  3RN5 A;  2F0P A;  2FJ2 A;  1XMO Q;  1PFN A;  4A3M G;  1K83 B;  1UEB A;  5JEA G;  1M1K C;  4JI6 Q;  1XNQ L;  2PCF B;  3UE1 A;  3ITP A;  3K7A B;  1EFW A;  3HOY B;  3I4O A;  1XWE A;  4B3R L;  2FMM A;  3WDN A;  2Z4H A;  1K83 H;  3J80 L;  1E24 A;  3H0G G;  4A93 G;  1VQB A;  1PYW D;  3EFX D;  1UE7 A;  2VQE L;  1Q12 A;  1TS3 A;  3H09 A;  3K7A H;  1SE4 A;  4R8I A;  2VY3 A;  3HOY H;  3KYH C;  1YNN C;  4IPD A;  1TY2 A;  3BG3 A;  3CU7 A;  1LT4 D;  4DN4 M;  2JEB I;  2EYF A;  4X3U A;  3TEH B;  1E2W A;  5GAH C;  2B39 A;  2B2T C;  3HOW B;  2NVY H;  5J22 A;  3NEL A;  3DWP A;  1NSN S;  2RHS B;  3QG1 A;  1ESR A;  4K5V A;  4JI8 L;  2XRQ D;  2FHT A;  1CSQ A;  2A74 C;  4OGQ C;  4X6A H;  1SJE D;  4JOI A;  3K81 C;  4B9X A;  5IP9 G;  1KNE A;  1VCI A;  3J81 i;  1NMG A;  5HUR A;  2IX3 A;  5GQO A;  1IBM Q;  1TVX A;  3KF6 B;  4YY3 Q;  3HOW H;  1VQN A;  1L0X B;  1B44 D;  5D3I B;  1M90 C;  4C3H G;  4IN3 A;  3TS0 A;  2E5L L;  3K0Y A;  1JQY D;  1E7Z A;  2VB2 X;  1OXX K;  4OXP A;  1YI2 A;  3PUV A;  4A3F B;  1HNX Q;  1EWC A;  2D5D A;  1ILP A;  3FPP A;  4A3L G;  1JOK A;  4LJZ C;  1KRT A;  3S1N B;  1CFM A;  4IOA A;  1WYD A;  2EXD A;  3KUP A;  5FLX E;  5CV9 A;  3J81 L;  3M4Y A;  3EN2 A;  3CF5 A;  3LGJ A;  1B3A A;  1D5Z C;  4A75 A;  1CA6 A;  4DGZ A;  4GKJ L;  1QUQ A;  1WOC A;  3NQT A;  2HQL A;  2KEN A;  3KJP A;  4RH6 A;  4A3F H;  1VQ9 A;  3S17 B;  1NAP A;  3EA6 A;  1C48 A;  2F0O A;  3SK6 A;  1EY7 A;  3QO2 A;  4KKT A;  2VQF L;  3S1N H;  2FMC A;  3K7U C;  2XVS A;  4LW1 A;  4POG A;  3HOV B;  2EYO A;  4HCS A;  1F2L A;  1DYQ A;  1HTP A;  4BA1 I;  4QY7 A;  5COR A;  3HKS A;  4L8J A;  3ULL A;  1FNU A;  4LFC L;  2A68 C;  3J80 E;  1Y1W G;  2B2V A;  2ZTE A;  1EY6 A;  1LYL A;  1HR0 Q;  3STB D;  2LXJ A;  3UDF A;  3NTI A;  3S17 H;  1WCM B;  2NTT A;  4DR2 Q;  1YBY A;  3H3V H;  3I55 A;  3GTO B;  4K14 A;  1L0W A;  2IWH A;  2OF1 A;  1Z7T A;  3HOV H;  4GLA C;  2Q2I A;  5I9P A;  2KVM A;  2ID0 A;  2OT2 A;  1N8R C;  4XDX A;  2ZTD A;  1BUV T;  3T51 B;  3CC2 A;  3O13 A;  3E9I A;  1DCZ A;  1LTL A;  2YTY A;  4L5Q A;  4A3M B;  3RZO B;  2K01 A;  1I6H B;  1XMO L;  1YJ9 A;  1Y8P B;  3DXJ C;  4A3D G;  1VQP A;  1WCM H;  2BE5 D;  3G48 A;  2WP8 J;  5H1S E;  3GTO H;  1XPR A;  3OYY A;  4RA8 A;  1AFP A;  3K58 A;  4JI6 L;  3BS1 A;  4YWK A;  1OXU A;  1JJG A;  3CRK C;  4PZ7 A;  2WKD A;  2RQX A;  5CMD A;  4DU9 A;  3TP7 A;  5KGU A;  3RZO H;  1I6H H;  5DM6 3;  4XXE A;  1EOT A;  2HIX A;  2B3G A;  1U4R A;  1F9R A;  4JV5 Q;  4GNX A;  2Z1C A;  3NBH B;  3CCJ A;  2O4X A;  2E76 C;  3F8T A;  4P2C B;  4A76 A;  3VYT A;  3EQL C;  3NTH A;  5JPN C;  2EOT A;  3CPW A;  2KED A;  1EY5 A;  4JI2 Q;  4TRD A;  1Y14 B;  4K8I A;  3W1G A;  3J81 E;  3X3N A;  2P5Z X;  1IBK Q;  3GTP B;  1SBB B;  4XYO A;  3RLF A;  1HPC A;  4DAP A;  3I7F A;  4DNT B;  1L1O C;  2V4D A;  2UUB Q;  1GJX A;  3M4O B;  3PO3 G;  5LMU Q;  2G9H D;  1VQI A;  5C0X G;  3A56 A;  3FP9 A;  1C9O A;  3U58 A;  3KK7 A;  2B2W C;  5C3W A;  1IW7 D;  4XIG S;  5IGF A;  4B3T Q;  4Y52 H;  1EZ8 A;  3RLO A;  3VR3 A;  5CBE E;  3GTP H;  4GOP C;  4YY3 L;  1IBL L;  4CGY B;  1WTX A;  1SND A;  1V1O A;  4JI7 Q;  1XNR Q;  4C3H B;  1QJO A;  3PIO 3;  3CP0 A;  2EJF C;  3I73 A;  4P71 A;  4IUN A;  3M4O H;  2CHB D;  1GHK A;  4X64 L;  3DEP A;  4PMC A;  5IT9 c;  5IP9 H;  1YJN A;  3KBG A;  4GN5 A;  4JI4 Q;  3S2D B;  3ICE A;  3QIA A;  1TQO A;  4RHR A;  1IKM A;  5I6W A;  3L3O C;  1Q3L A;  4NKL A;  3FRP B;  1OXS C;  4WJW A;  3D8G A;  3M3Y B;  2AUK A;  5EBD A;  4KN4 C;  5IGB A;  1SE3 A;  4KY5 A;  2I46 A;  3NPP A;  4S3S A;  3CQZ B;  3S2D H;  1SYE A;  1SYC A;  4A3L H;  2D0P A;  5GAD C;  3Q0A A;  1A62 A;  2UUA L;  5IE8 A;  2A6E D;  1SXT A;  2A8V A;  2K52 A;  4ME3 A;  2FFK B;  3S16 B;  2HHH Q;  3S14 B;  3JAM i;  1UUP A;  3M3Y H;  1Y1W B;  1SNO A;  1HUN A;  1X3G A;  4GKK L;  3CQZ H;  2ICE C;  4DV0 Q;  4K8J A;  1J5E Q;  3CCV A;  1VQ6 A;  4DR2 L;  4OIK A;  4HID A;  2BH2 A;  4HIO A;  1LTS D;  4DV7 L;  2RKS A;  4ZCK A;  1SMX A;  2VZA A;  4FF4 A;  3S16 H;  4QJF A;  3U9O A;  3S14 H;  2L1B A;  2KOL A;  1PFS A;  1NR4 A;  1Y1W H;  2BDO A;  3I4N B;  4PMW A;  5EKI A;  1SSO A;  1X32 A;  2MNA A;  1E1T A;  2F0Q A;  3R93 A;  1N34 L;  4A3D B;  3OTO L;  5D65 A;  3A8K E;  3JAM L;  1FGU A;  2R92 B;  3CC7 A;  3S1M B;  3MEH A;  3V2T A;  1KAA A;  2PMZ B;  4KY7 A;  2KCT A;  3IL8 A;  4R9W A;  4LF6 L;  3WOF A;  3OMG A;  3D6C A;  4MN3 A;  3I4N H;  1B4O A;  2KCC A;  3FKI G;  2H5X A;  3URY A;  1TWC B;  3K5L A;  3SK8 A;  4A3E B;  2DY7 A;  1JJC B;  1ASY A;  4A3D H;  2RDG A;  1S5B D;  2R92 H;  4IJH A;  1QE6 A;  1H9J A;  1STG A;  3S1M H;  3GTQ B;  3WOE A;  1VQM A;  2NN6 G;  2PQE A;  4FVM A;  1JB3 A;  2YV5 A;  5FO7 B;  1G51 A;  1VQE A;  1W3S A;  3KOJ A;  2K75 A;  1HZC A;  1TWC H;  4CHT B;  3ERQ A;  4A3E H;  1BQQ T;  4IQZ A;  1GO3 E;  2B8F A;  2N88 A;  1KAW A;  1IBK L;  1BBX C;  4HJ7 A;  1D1I A;  3KLS X;  3GTQ H;  1QB5 D;  1SRU A;  4R1J A;  2UUB L;  3U9S A;  1ET9 A;  2KHI A;  2G5D A;  5CV5 A;  2LY7 A;  1B53 A;  1X3E A;  2CKZ B;  4QL5 A;  5LMU L;  1ESF A;  1QZH A;  3TP6 A;  4HJ8 A;  3IAY A;  5KNC A;  1BOS A;  1GOZ A;  1CK1 A;  2QEJ C;  3I4L A;  4B3T L;  1QVF A;  3SEB A;  1E0B A;  3PIP 3;  2D9U A;  1JCK B;  2WFW A;  4L6T B;  4JI7 L;  1XNR L;  4IZ8 A;  1VQG A;  1RHP A;  2NTS A;  5DM7 3;  2YU9 H;  4GN4 B;  1JMC A;  5EPK A;  3EBE A;  3AEV A;  2OWO A;  1VMP A;  3L2P A;  3NEM A;  3HS0 C;  1HA6 A;  2HT1 A;  1O7L A;  3KFU A;  5J1Z A;  2JA5 G;  1VQC A;  4HJA A;  3MHB A;  5JJZ A;  3HOX B;  2F0G A;  4NP5 A;  3HOY G;  3SK4 A;  3RNU A;  3GTJ B;  5J39 A;  3H91 A;  5M5X B;  5JEA J;  1C4Q A;  2QDL A;  5KEE A;  1W2B A;  4DNR B;  1B9M A;  3JAM E;  1WTW A;  1WTV A;  1E22 A;  1ET6 A;  1GM5 A;  1OXT A;  1MBY A;  1MSG A;  5A35 A;  2Q8I B;  2Q8R E;  1BCP C;  1KXL A;  1VQF A;  5JVH 3;  1KLG D;  1U9R A;  2WAQ E;  4DR3 L;  1V8Q A;  3HOX H;  4HJ9 A;  3HOZ G;  3BDC A;  3GTJ H;  2HHH L;  4C1N I;  1HTL D;  2GN5 A;  5M5X H;  1LTG D;  3C3L A;  3MFY A;  3BVG A;  3OSO A;  3BYY B;  3IRB A;  3G7L A;  3CCS A;  5M3F H;  5IYD H;  2MJ8 A;  1C7Y A;  3BZD B;  4UY8 C;  4IUT A;  1Q8I A;  4DV0 L;  3HOW G;  4RHS A;  3G4S A;  4L5S A;  4R8N A;  5IYC H;  1C0A A;  2CWA A;  2WAQ G;  2EJG C;  4RGT A;  1EEF D;  1PH8 A;  1MJC A;  4XT3 B;  4LFA L;  3MVV A;  2JK8 A;  2UXC L;  2PI2 A;  1PZJ D;  1PYB A;  2ES2 A;  1I4P A;  1MHW C;  2F3I A;  1NCV A;  2YTV A;  3U4V A;  2X69 A;  3P1H A;  4TSS A;  4A4I A;  2F4I A;  2L11 A;  4XQN A;  1OTC A;  4NXM Q;  4JI0 Q;  1ONL A;  4YCV A;  2A19 A;  2I0Q A;  2QDB A;  1O78 A;  1YNJ D;  4JBK A;  1B7Y B;  2H4O A;  1PH7 A;  1ML0 D;  1U4P A;  3K5N A;  1Y69 U;  4GLX A;  4JC0 A;  1HQR D;  1S5F D;  4AYB E;  1D5X C;  4JPB W;  2HUG A;  1EIF A;  1N36 L;  5C5L A;  1D7Q A;  1ZEQ X;  4A3F G;  3AQQ A;  1K8O A;  2K33 A;  4ZKC B;  3ND8 A;  5LL6 X;  5JJL A;  2HCC A;  4DV2 L;  2BOS A;  4LF9 Q;  4NXN Q;  4UP7 A;  1MKH A;  1VQ5 A;  1K8M A;  1V43 A;  5JJK A;  3KLW A;  4UPA A;  3FPU B;  3VYS A;  4CJ0 B;  4B3S L;  1YZ6 A;  1W6J A;  4GZY C;  2A69 C;  4MIU A;  1II3 A;  3NEN A;  4PQX A;  4AYB G;  4HSP A;  5M5W B;  3OWF A;  1IYJ B;  1STA A;  3PQI A;  2PNH A;  4IPG A;  5FOB B;  4R4I A;  2GVB A;  3MXU A;  3S1R B;  1K0R A;  4I7Z C;  4K6D A;  1HRJ A;  3C46 A;  2F0N A;  3FDT A;  2NN6 H;  3CCM A;  5BN3 A;  4JK1 C;  3IKJ A;  3L7Z C;  1XJV A;  3S9W A;  4OX9 L;  5M5W H;  3W3A A;  5M5Y B;  3MXG A;  3A7L A;  3ERO A;  1HXY D;  1GUT A;  1HR0 W;  3LWU A;  1EEI D;  2DY8 A;  3DMU A;  1Q1B A;  3S1R H;  2PQA B;  2F0V A;  2E74 C;  1WTH A;  4F8M A;  1Q90 A;  3Q24 A;  3VR4 A;  4DR5 Q;  3NWT A;  2B2T A;  4IFD H;  3N6R A;  3LNN A;  1KNA A;  4YCU A;  4E6I A;  2B2U C;  5M5Y H;  3MC0 B;  1QNK A;  2EE1 A;  3M7G A;  1I6V C;  3SE0 A;  2JA8 B;  2F0E A;  2JA5 B;  2EIF A;  3BYT B;  4JG2 A;  2B2Y C;  3CRL C;  4OEL B;  1SAP A;  3PMF A;  1VDZ A;  3E9H A;  4I65 A;  2ZXR A;  2L12 A;  5IT9 L;  3OIP A;  3M4P A;  2OQK A;  2E75 C;  3U4Z A;  2F4V Q;  1KL9 A;  2HDM A;  2Z0S A;  4DAM A;  1FJG Q;  2EJM A;  5I6Y A;  2NVY B;  4DAY A;  4KD3 A;  4QCL A;  2N49 A;  1IZ6 A;  2QIL A;  2JA8 H;  5KND A;  2JA5 H;  3TZD A;  1U4L A;  2OXP A;  1LLR D;  3D4D A;  4A3B H;  1HNW Q;  3HOZ B;  3I8Z A;  4LFB L;  2F3V A;  3NE5 B;  3W5O A;  5ISR A;  3PV0 A;  1HHV A;  2SNS A;  4IUP A;  1PFM A;  4XYQ A;  4J8Q A;  4GKJ Q;  1K3B C;  2JYO A;  1PRT D;  5C4J B;  1WTR A;  2UXD Q;  4DR1 Q;  1X3P A;  2RF4 A;  2PPB C;  3C1F A;  1CKN A;  4H02 A;  2DJF C;  1FVI A;  2WAQ B;  5CC4 A;  1PTO D;  2EY2 A;  3RLN A;  3HOZ H;  4HIK A;  5DLQ E;  5FO8 B;  2JN4 A;  3GD7 A;  5IIF A;  2WIN B;  5IOC A;  2D0O A;  1TKW B;  3B6Y A;  5EKL A;  4ZYS A;  3L0O A;  5C4J H;  3KLR A;  4X62 Q;  1CT1 D;  2IT1 A;  1EFI D;  2K03 A;  2RBM A;  4JI1 L;  1LTI D;  1SYF A;  4JI0 L;  4YWL A;  4O42 A;  3EVQ A;  3GV6 A;  1UE6 A;  3K5M A;  1E3P A;  1FGB D;  4K2L A;  2E2H B;  3DWQ A;  1UE1 A;  1I50 B;  2VB3 X;  1F2M A;  4POF A;  1N33 Q;  1H9R A;  5T1G A;  3PO2 B;  1WD0 A;  2O5J C;  4DK3 C;  3G71 A;  1QOH A;  4DUY Q;  4DV6 L;  4LF5 L;  2K5N A;  3K0X A;  1K28 A;  3M7N A;  3LX0 A;  4NXN L;  3E6Z X;  3I90 A;  2K6A A;  3OPO A;  3A74 A;  4DXF A;  4DR4 L;  1ZYR C;  2E2H H;  1J6Q A;  1XX8 A;  1I50 H;  4BY1 B;  3QOJ A;  4AYB B;  2K14 A;  2F0M A;  3GTM B;  5BN5 A;  4A3J B;  3PO2 H;  2IPK D;  4C1N K;  5KNB A;  3U50 C;  4DV3 Q;  3FEW X;  1W6K A;  3FMC A;  1EYC A;  2I5H A;  2JP1 A;  5IT9 E;  1YJW A;  3I91 A;  5ELC A;  2O5I C;  4NDX A;  1F77 A;  4BY1 H;  3GTM H;  3R8B A;  3DLL A;  4JW0 A;  1SJH D;  4A3J H;  1I3Q H;  1A3V A;  4GS3 A;  3QOL A;  1I94 Q;  3HG9 A;  4KMU C;  4HMI A;  5IP7 G;  1LUZ A;  2PMZ E;  3K8A A;  1I5F A;  2WKC A;  3BJU A;  4KJN A;  3QJY A;  4KKS A;  3VA7 A;  3E0E A;  1STE A;  3V96 A;  2EDG A;  2Q2T A;  1L1O A;  1JJ2 A;  1JE5 A;  3I4N G;  1LT6 D;  2BH8 A;  5AJ3 Q;  4LF4 Q;  4OIJ A;  2R92 G;  3A5U A;  2JJQ A;  2VUM G;  4ILW A;  1HZB A;  1HQM C;  2ATW A;  2B2W A;  1O7I A;  4QIW E;  4YIJ A;  3CCU A;  2NVT B;  2HD3 A;  1FL0 A;  2NVQ B;  5COY A;  3FVQ A;  4GOP A;  3PUZ A;  2F0L A;  3I72 A;  3QB3 A;  5FKA C;  1KC8 C;  4A3E G;  2CVR A;  2ZXP A;  2F4V L;  4XTC S;  2FXQ A;  1D6E C;  1DM0 B;  4J15 A;  5AFW A;  3S2H B;  2K04 A;  2DJG C;  1TXY A;  2CW0 C;  3NQI A;  1SYB A;  2NVT H;  1BNZ A;  2NVQ H;  2EXZ A;  1SDF A;  2RDF A;  2VXW A;  5D14 A;  4L5R C;  2SEB D;  1C8C A;  1WTO A;  1LAB A;  3TN2 A;  2CQA A;  2Z4I A;  1A6X A;  1AE2 A;  5EPL A;  4EX5 A;  1JOO A;  3DM3 A;  2UXD L;  4DR1 L;  4DV4 Q;  3S2H H;  2N8N A;  2RSO A;  2Q8T A;  1D1K A;  3J7A 5;  3GP7 A;  3NBI A;  4EVO A;  5JAV A;  1R4P B;  3S1Q H;  1KLU D;  1IBM L;  4KLK A;  3RN2 A;  1ICW A;  1Q1E A;  2XRS D;  4J1M A;  1AZQ A;  4X62 L;  2ZTC A;  3BU2 A;  3T16 A;  4DK6 C;  1QUQ B;  4JI3 Q;  1HNZ Q;  2BDN A;  3MA2 B;  2F0I A;  1STH A;  2NWG A;  3SXH A;  4LF7 Q;  4WOR A;  3J81 j;  4U67 3;  3P75 A;  1EWI A;  1JC7 A;  3IFT A;  4TQU S;  2E2D C;  1ENC A;  4DK1 A;  5FJ8 G;  1HNX L;  3TS2 A;  4M1U B;  2ZJR A;  3MXN A;  2Z9H A;  3A5Z B;  2XSC A;  3ND9 A;  1I4H A;  3HOX G;  2MFI A;  4R4Q A;  1NUC A;  4R4C A;  3DHQ A;  4DV1 Q;  3ONA B;  5C4H A;  2KJX A;  3BDO A;  3PUW A;  1A3T A;  5I4D A;  5IYD G;  5M3F G;  2KCN A;  4B9W A;  1UE5 A;  1CUK A;  1EIY B;  1SMY C;  1QG7 A;  1YNN D;  1CA5 A;  2QW7 A;  2R3Z A;  5IYC G;  1MI2 A;  1FD7 D;  1LTR D;  3SHL A;  4ZK9 B;  3GO5 A;  5LHY 1;  2TSS A;  4RGN A;  3CME A;  3ULP A;  3PIP A;  5E7N A;  3BDL A;  3PUX A;  4HTH A;  4HED A;  2ZM6 Q;  5EQ0 A;  1EWH A;  4CDF C;  1XTD A;  2Z6K C;  4J6H A;  1F9P A;  3A8I E;  4LMQ D;  1HR0 L;  5ELO A;  2VW9 A;  1LV9 A;  2EQS A;  4LK1 C;  1Q86 C;  1NJI C;  3N52 A;  2X6L A;  1I94 L;  1L2F A;  2UUC Q;  4FNF A;  3HOU G;  1YEZ A;  1ICF B;  3RZD B;  2ALY B;  2XN9 C;  2A6H C;  1FR3 A;  2R7F A;  4GNX B;  2JA9 A;  5CGK A;  3E5S A;  1VF5 C;  3PUY A;  4N8F A;  1BXT A;  4MNO A;  1XYI A;  2VUM B;  4LF4 L;  2O2L D;  5C4X B;  5IP7 H;  4Y7N H;  4OON A;  3K5O A;  1S5C D;  3BZK A;  2Q2U A;  1JWS D;  1NTG A;  1BF4 A;  2F0K A;  3T1Y Q;  3RZD H;  4DR6 Q;  1EYG A;  1VQK A;  3NHH A;  3NP8 A;  3NXW A;  4BXX G;  3PF5 A;  4FYD A;  2SDF A;  1NE3 A;  3KF8 A;  3QR8 A;  4IPH A;  5FK9 C;  3K6O A;  1GUO A;  4G7O C;  2AQ2 B;  1DGS A;  4JV5 L;  4ID6 A;  2VUM H;  2M2L A;  3D4R A;  5C4X H;  3TZU A;  1LTT D;  4MZ9 A;  4QIW B;  1KQS A;  4OWW B;  1DJR D;  2L55 A;  1EZ6 A;  2N55 A;  5LMN Q;  2HCI A;  2HQE A;  3TP5 A;  1SNQ A;  3EIV A;  1S3O A;  4X66 Q;  4JI2 L;  4WFN 3;  1LTA D;  4EQO A;  1G6Z A;  1AW7 A;  2JA6 B;  2R7D A;  1A0I A;  2SOB A;  1EL0 A;  4QB4 A;  1SNP A;  4R4T A;  2A68 D;  1G29 1;  4F87 A;  2F0H A;  2L4N A;  1VQ4 A;  3MFG A;  1X55 A;  1IYV A;  3UDI A;  1Q81 C;  4AH6 A;  1JT8 A;  2LKV A;  4C3J B;  4G7H C;  4L5T A;  2YU9 B;  3I2Z A;  4IFD G;  4IUU A;  1JWU D;  2I07 B;  4JI5 Q;  4K5W A;  1IXR A;  4FDB A;  1EQR A;  2AQ3 B;  1H9K A;  1PYS B;  4OEM B;  5C0X I;  2EZV A;  4JYA Q;  5E4W C;  4AIM A;  2JA6 H;  4QUF A;  3OIQ A;  4ZRZ A;  2K1B A;  1S4Z A;  1PHJ A;  1GXD C;  1MGS A;  4HN7 A;  3BZC A;  1HNZ L;  4C3J H;  4OO1 I;  1EYD A;  1KTK A;  4K5X A;  4O2D A;  1R9T B;  2BA0 A;  5LL6 S;  1STY A;  1PZK D;  1IKL A;  5F2D A;  4DA2 A;  2F0W A;  1RKN A;  3K80 C;  1T9H A;  4JI4 L;  3VR6 A;  2PI2 E;  1AH9 A;  2XGT A;  2VL6 A;  4X3S A;  2JA8 G;  1Y1V B;  1XPO A;  2IW3 A;  4YHH Q;  3AB9 A;  3RD4 A;  4A3B G;  4DFA A;  2CFM A;  3OHX C;  4MTN A;  1R9T H;  1PH6 A;  1AP0 A;  1RTO A;  1SE8 A;  3UI2 A;  3IFD A;  3D31 A;  5M3F B;  3CCQ A;  3S15 B;  1L0Y B;  3CAM A;  5FJ8 H;  3J7Z C;  1XNQ Q;  5I2X A;  1EQV A;  5BR8 Q;  1U0L A;  1Y1V H;  1ROD A;  4LAA A;  1B2T A;  1G6P A;  1PRT B;  3CCR A;  3Q23 A;  1K73 C;  3CCE A;  1TWH B;  5KYI A;  1PH3 A;  1HA5 A;  4KHZ A;  1VQ8 A;  3CPF A;  1EQT A;  1HCZ A;  5IOD A;  1GD7 A;  2X6G A;  3S15 H;  1CTM A;  1X65 A;  4A3G B;  1PTO B;  2DNC A;  1LT3 D;  1MD2 D;  4TKO B;  1YIT A;  1PLF A;  1Z6H A;  4QQB X;  4JVZ A;  5C44 G;  1J5E L;  5C6A A;  3H6M A;  2WAC A;  2EY1 A;  1Y8N B;  1CQV A;  2PZT A;  3E0J A;  4ZQ3 A;  3HOU B;  1BR9 A;  3D0F A;  1NNX A;  1TWH H;  4RG1 A;  1V9P A;  1XMQ Q;  1SYG A;  2RVL A;  1P8L A;  4XT1 B;  1I4G A;  3SVM A;  2K5Q A;  4A3G H;  1M4V A;  1PTO H;  2OEO A;  4P73 A;  3SDZ A;  1A8V A;  4CKC A;  4B08 A;  4A3C H;  3STB C;  4H44 C;  4AQY Q;  3AFP A;  3HOU H;  3OOC A;  3H15 A;  4Z9C B;  1TS5 A;  3I4M G;  2PNR C;  2F0S A;  3MEF A;  3T1Y L;  1LAC A;  4DR6 L;  2EYH A;  4FXK C;  2PW7 A;  5CYU A;  1GKH A;  1Q82 C;  1PDQ A;  4OWT B;  3PO2 G;  2K7V A;  4CJ2 C;  4OHJ A;  4N9P A;  1PH9 A;  1PRT F;  1RD9 D;  5I9O A;  2JSO A;  4C3I B;  5FLM G;  1QWY A;  2E5L Q;  2MO1 A;  1CKO A;  1I4X A;  4P72 A;  2BE5 C;  2NBF A;  1MJE A;  5E1F A;  2B2U A;  5J3B A;  1BDO A;  2SNM A;  4KHP Q;  2H1E A;  3CC4 A;  3OW7 A;  3HKZ B;  5JOB A;  5LMN L;  1B1Z A;  4BXX H;  1PTO F;  4BY1 G;  2LS0 1;  2F0D A;  2EYL A;  4ZUJ A;  4X66 L;  2RA4 A;  4A3J G;  1O80 A;  2IHF A;  4QUC A;  2KEE A;  2B63 B;  1RDP D;  1PH1 A;  1WFQ A;  3M9B A;  1H95 A;  4HCE A;  4C3I H;  1QVC A;  1TWA B;  2B8G A;  1QZG A;  3TRE A;  2PO4 A;  1LO5 D;  3F2D A; 
#chains in the Genus database with same CATH homology
 2R6G A;  4BA2 I;  1HFG A;  1DOM A;  3DM1 A;  1KAB A;  5DNF A;  2XNA C;  1TY0 A;  4K2K A;  1QCB D;  3VYR A;  1SEB D;  5EPJ A;  2G9D A;  5G3L D;  4RFB A;  4C56 C;  5DEH A;  1GUG A;  5IGD A;  4L63 B;  3R3O A;  2L5T A;  1IW7 C;  4A3B B;  1DOL A;  4FF1 A;  3GTG B;  2XIW A;  3BVM A;  3T56 B;  3I3C A;  4M8A A;  4BS9 A;  2LFN A;  4FF3 A;  1JWM D;  1TS2 A;  2L9H A;  2AUJ D;  1H9S A;  4KY6 A;  4O1N A;  4IUR A;  4C2M B;  1BO0 A;  3F2U A;  3CHB D;  2NVX B;  5K5P A;  1EY0 A;  4FXD A;  1TU2 B;  5CV8 A;  3TP8 A;  1V1P A;  1EY9 A;  2RSN A;  4RKB A;  5C5M A;  5C44 B;  2EPB A;  3OWE B;  1ZKO A;  5EGT A;  4KKU A;  1STN A;  4EQP A;  2A6E C;  5KIX A;  3D3R A;  4RAU C;  5ELE A;  3H3V C;  1TII D;  1A2U A;  1KDB A;  5C0X J;  4ULL A;  4OL7 A;  3DEO A;  3NBH A;  4RWS C;  3I4M B;  4ZKB B;  5IGG A;  3A7A B;  5T1I A;  4CBV A;  4HR7 B;  5EBC A;  3W2D A;  5I2Y A;  4F7X A;  1G2T A;  1QIL A;  3DUZ A;  2KEC A;  5C4Z A;  2F0T A;  4HSV A;  1ENA A;  2IJ0 A;  1BCP D;  2WB1 B;  3RMH A;  2KHS A;  4KHV A;  4QMG A;  1R4Q B;  2F1M A;  1O7Y A;  1I3Q B;  1QNU A;  1CI3 M;  1D5M C;  2IX1 A;  4ABN A;  3HEJ A;  1T5E A;  4Q5V A;  1JOR A;  4V19 0;  5CV4 A;  2WV6 D;  1SNC A;  2KUM A;  2AWO A;  1T5X D;  4PNY A;  5D3D A;  4PV1 C;  4BBR B;  3MWY W;  1AN8 A;  1G91 A;  5CV6 A;  1H9S B;  2R61 A;  1AZP A;  5E4X A;  2F3W A;  1JR0 D;  2HDL A;  3P7J A;  4JBW A;  5K36 H;  2R7Z B;  1CHP D;  1V1P B;  1UAP A;  4G4K A;  5M3M B;  1IYU A;  5ELB A;  4BBS B;  3L9A X;  1Z47 A;  5NUC A;  3MTS A;  1HUM A;  1LT5 D;  1EU4 A;  2A69 D;  2J0T D;  1JIC A;  1SYD A;  3X3M A;  1PMR A;  1EIH A;  4KJO A;  1WD1 A;  2C9O A;  1I4Q A;  3Q22 A;  1U4M A;  2TMP A;  3DWA A;  3NK9 A;  2K28 A;  3TDQ A;  4IUQ A;  4H7B A;  5JEA H;  3S1Q B;  3H0G B;  4A93 B;  2E2J B;  4A3K B;  3TME A;  2B2V C;  1RTN A;  1J8I A;  2MHV A;  1VMC A;  1RF2 D;  4H0L C;  2QKI C;  4RCN A;  4G7Z C;  2PW5 A;  5C3X A;  2A73 B;  2JEA I;  4C3J G;  1H9M A;  2EY5 A;  4KK7 A;  2MP1 A;  1EY8 A;  1TWF B;  1I4R A;  1OXV A;  3D6W A;  3A55 A;  2D2C C;  4IFD J;  3ZYY X;  2F0U A;  3LWE A;  1GHJ A;  2J4X A;  2F03 A;  4KI0 A;  5DAU A;  3T13 A;  4NMZ A;  2J7Z A;  4RGO S;  1PXU A;  4UDU C;  1TT2 A;  4OO1 G;  3HZX A;  4ZAI A;  5CR3 A;  3K57 A;  4UAI A;  3KBX A;  1YNJ C;  3J7A F;  4BWG B;  2BA1 A;  1EYA A;  1DON A;  3BVZ A;  1GUS A;  1RJT A;  2DNE A;  5IGC A;  2QCP X;  1D2B A;  5JPM C;  5FO9 B;  4RKL A;  1ZXT A;  1EY4 A;  3HRZ C;  1ENF A;  1MSH A;  4PMB A;  4KV6 A;  5M9O A;  1O7Z A;  2NZ1 D;  2Y0S B;  4Y7N B;  1CZG A;  3I70 A;  3NWS A;  1DD2 A;  1FNW A;  1CQF A;  2JXM B;  2C5C A;  3J7Y W;  1LTB D;  3AU7 A;  3TSS A;  5EKK A;  4DF7 A;  2PZW A;  1FNV A;  3A54 A;  2AWN A;  3MZ5 A;  4RCO A;  4CKE A;  1E2V A;  2E2I B;  5HGT A;  2F0J A;  2VNU D;  1M8A A;  4KN7 C;  5TSS A;  4XQQ A;  2K5W A;  3TBI B;  1IHZ A;  2ZT9 C;  5CBA E;  1XTC D;  3AMU A;  4IAL A;  1ZYR D;  1TWG B;  1A3U A;  4C3I G;  3VR2 A;  2K5D A;  1CZW A;  3SK5 A;  1GUW A;  2JE6 I;  1SE2 A;  4KD4 A;  3H94 A;  4NW2 A;  2NB0 A;  2YYZ A;  3D4W A;  4HMJ A;  4ZLT F;  3C2P A;  4HAE A;  1ILQ A;  4ZUI A;  4U68 A;  4ME5 A;  3KLS A;  1S5E D;  1DOK A;  4F88 A;  2XWB B;  4IUV A;  1UNS A;  2EY6 A;  4KTA A;  4BY7 B;  1STB A;  1AEX A;  3GTL B;  1KDC A;  1IL8 A;  2EVB A;  3OMC A;  5KRU A;  2GA4 B;  4G57 A;  1PRT C;  4CJ1 B;  1F9Q A;  3PO3 B;  1PZI D;  2MUY A;  2M00 A;  1PTO C;  1FYC A;  4FXG C;  4N9T A;  3NTK A;  4CKB A;  2EYJ A;  3G6J B;  4ODG A;  2LMC B;  2BCO A;  1WVL A;  2XWJ B;  5A2Q L;  1JE4 A;  4FP5 D;  1DXM A;  1XXG A;  1E2Z A;  2NYZ D;  4Q0F A;  5C0X H;  4MHE A;  2EYM A;  2ICI A;  2CW0 D;  2MPM A;  3K59 A;  2ENB A;  5KYL A;  2K05 A;  1TS4 A;  4OO1 H;  3SR1 A;  2A5H A;  3HP3 A;  1WTP A;  2F0F A;  3RUZ A;  2KQ3 A;  1G8Z D;  1SNM A;  3MAQ A;  1G2S A;  3HGB A;  4FF2 A;  2RDH A;  5G3L F;  2JA7 B;  1S5D D;  4QF4 A;  2L0C A;  1CM9 A;  1OO9 B;  3V05 A;  3R2T A;  2WII B;  3MXP A;  2EYP A;  2K32 A;  2IX0 A;  4X3K A;  2MGS A;  5ELD A;  4K6L A;  1F2Y A;  2NUC A;  4DK0 A;  2ZXO A;  1A15 A;  5EJW A;  1X3Q A;  3J7A V;  3VYU A;  3GQB A;  5CV7 A;  1VF7 A;  4H13 C;  5JVG 3;  4WRD A;  1B9N A;  2DN8 A;  1BCP B;  1PFB A;  2R93 B;  4FO2 A;  4V0B A;  3VA5 A;  2AQ1 B;  2FIN B;  1SMY D;  3EJI A;  1RCV D;  2NN6 I;  1B50 A;  3FKI B;  4X3T A;  5C3E B;  4EQN A;  2B2Y A;  2KA7 A;  4A3I B;  1F9S A;  1Y8O B;  3GTK B;  1CHQ D;  3QWN A;  3GV3 A;  5A2Q E;  1JOQ A;  2IL8 A;  2Z8L A;  5BN4 A;  1EIG A;  2D62 A;  3CKI B;  2M9V A;  1J9O A;  5E3F A;  2PZU A;  4IFD I;  3P20 A;  5IGE A;  1NR2 A;  2QF7 A;  3A8J E;  2A6H D;  1SFO B;  3Q6S A;  1DZ1 A;  4DAV A;  5K36 G;  1A2T A;  2PYK A;  3C1E A;  1WTQ A;  4RGM A;  1EU3 A;  3T4A C;  3R2I A;  1HFN A;  3NUC A;  4EGV A;  3T53 B;  1BCP F;  1F2Z A;  1KDA A;  1GUN A;  3NSW A;  1UEA B;  5FLX L;  3M85 A;  1TR5 A;  4XQJ A;  3VR5 A;  5ELF A;  4DXG A;  2F0P A;  2FJ2 A;  1PFN A;  1K83 B;  5JEA G;  2PCF B;  3ITP A;  3K7A B;  3HOY B;  1XWE A;  2FMM A;  3WDN A;  2Z4H A;  3J80 L;  1PYW D;  3EFX D;  1Q12 A;  1TS3 A;  3H09 A;  1SE4 A;  4R8I A;  1YNN C;  1TY2 A;  3BG3 A;  3CU7 A;  1LT4 D;  4DN4 M;  2JEB I;  2EYF A;  4X3U A;  1E2W A;  2B39 A;  2B2T C;  3HOW B;  5J22 A;  3DWP A;  4K5V A;  1NSN S;  3QG1 A;  1ESR A;  2XRQ D;  2FHT A;  2A74 C;  4OGQ C;  1SJE D;  4B9X A;  1KNE A;  1VCI A;  5HUR A;  2IX3 A;  1TVX A;  1L0X B;  1B44 D;  5D3I B;  4C3H G;  4IN3 A;  3K0Y A;  1JQY D;  2VB2 X;  1OXX K;  3PUV A;  4A3F B;  1EWC A;  2D5D A;  1ILP A;  3FPP A;  1JOK A;  4LJZ C;  3S1N B;  1CFM A;  3KUP A;  5FLX E;  5CV9 A;  3J81 L;  3M4Y A;  1B3A A;  1D5Z C;  1CA6 A;  4DGZ A;  3NQT A;  4RH6 A;  3S17 B;  1NAP A;  3EA6 A;  1C48 A;  2F0O A;  3SK6 A;  1EY7 A;  3QO2 A;  4KKT A;  2FMC A;  2XVS A;  3HOV B;  2EYO A;  4HCS A;  1F2L A;  1DYQ A;  1HTP A;  4BA1 I;  5COR A;  4L8J A;  1FNU A;  2A68 C;  3J80 E;  2B2V A;  1EY6 A;  3NTI A;  1WCM B;  2NTT A;  3GTO B;  4K14 A;  2IWH A;  2OF1 A;  1Z7T A;  5I9P A;  2KVM A;  2ID0 A;  2OT2 A;  4XDX A;  1BUV T;  3T51 B;  3O13 A;  1DCZ A;  4A3M B;  3RZO B;  2K01 A;  1I6H B;  1Y8P B;  3DXJ C;  2BE5 D;  2WP8 J;  4RA8 A;  1AFP A;  3K58 A;  3BS1 A;  1OXU A;  3CRK C;  2WKD A;  2RQX A;  5CMD A;  4DU9 A;  3TP7 A;  5KGU A;  5DM6 3;  4XXE A;  1EOT A;  1U4R A;  1F9R A;  2Z1C A;  2O4X A;  2E76 C;  4P2C B;  3VYT A;  3EQL C;  3NTH A;  5JPN C;  2EOT A;  2KED A;  1EY5 A;  4TRD A;  4K8I A;  3J81 E;  3X3N A;  3GTP B;  1SBB B;  4XYO A;  3RLF A;  1HPC A;  4DAP A;  4DNT B;  2V4D A;  1GJX A;  3M4O B;  2G9H D;  5C0X G;  3A56 A;  3KK7 A;  2B2W C;  5C3W A;  1IW7 D;  4XIG S;  5IGF A;  1EZ8 A;  3VR3 A;  5CBE E;  4CGY B;  1WTX A;  1SND A;  1V1O A;  4C3H B;  1QJO A;  3PIO 3;  2EJF C;  3I73 A;  4IUN A;  2CHB D;  1GHK A;  3DEP A;  4PMC A;  3KBG A;  3S2D B;  3QIA A;  1TQO A;  4RHR A;  1IKM A;  5I6W A;  3L3O C;  1Q3L A;  4NKL A;  3FRP B;  1OXS C;  4WJW A;  3D8G A;  3M3Y B;  2AUK A;  5EBD A;  4KN4 C;  5IGB A;  1SE3 A;  4KY5 A;  2I46 A;  3NPP A;  4S3S A;  3CQZ B;  1SYE A;  1SYC A;  3Q0A A;  2A6E D;  1SXT A;  2FFK B;  3S16 B;  3S14 B;  1UUP A;  1Y1W B;  1SNO A;  1HUN A;  2ICE C;  4K8J A;  4OIK A;  1LTS D;  2RKS A;  4FF4 A;  3U9O A;  2L1B A;  2KOL A;  1NR4 A;  2BDO A;  3I4N B;  4PMW A;  5EKI A;  1SSO A;  1X32 A;  2F0Q A;  3R93 A;  4A3D B;  5D65 A;  3A8K E;  3JAM L;  2R92 B;  3S1M B;  3MEH A;  3V2T A;  1KAA A;  2PMZ B;  4KY7 A;  4R9W A;  3IL8 A;  3WOF A;  3OMG A;  3D6C A;  4MN3 A;  1B4O A;  2KCC A;  3URY A;  1TWC B;  3K5L A;  3SK8 A;  4A3E B;  2DY7 A;  2RDG A;  1S5B D;  1QE6 A;  1H9J A;  1STG A;  3GTQ B;  3WOE A;  2NN6 G;  2PQE A;  4FVM A;  1JB3 A;  5FO7 B;  4CHT B;  3ERQ A;  1BQQ T;  4IQZ A;  2B8F A;  2N88 A;  1BBX C;  1D1I A;  3KLS X;  1QB5 D;  3U9S A;  1ET9 A;  5CV5 A;  2LY7 A;  1B53 A;  1ESF A;  3TP6 A;  3IAY A;  5KNC A;  1BOS A;  1GOZ A;  1CK1 A;  2QEJ C;  3I4L A;  3SEB A;  1E0B A;  3PIP 3;  2D9U A;  1JCK B;  4L6T B;  4IZ8 A;  1RHP A;  2NTS A;  5DM7 3;  5EPK A;  1VMP A;  3HS0 C;  1HA6 A;  1O7L A;  5J1Z A;  3MHB A;  5JJZ A;  3HOX B;  2F0G A;  4NP5 A;  3SK4 A;  3GTJ B;  5J39 A;  3H91 A;  5M5X B;  5JEA J;  1C4Q A;  5KEE A;  4DNR B;  1B9M A;  3JAM E;  1WTW A;  1WTV A;  1ET6 A;  1OXT A;  1MBY A;  1MSG A;  5A35 A;  2Q8I B;  2Q8R E;  1BCP C;  5JVH 3;  1KLG D;  1U9R A;  1V8Q A;  3BDC A;  4C1N I;  1HTL D;  1LTG D;  3C3L A;  3MFY A;  3BVG A;  3OSO A;  3BYY B;  3G7L A;  2MJ8 A;  3BZD B;  4IUT A;  1Q8I A;  4RHS A;  4R8N A;  2EJG C;  4RGT A;  1EEF D;  4XT3 B;  3MVV A;  1PZJ D;  1I4P A;  1NCV A;  2X69 A;  3P1H A;  4TSS A;  2F4I A;  2L11 A;  4XQN A;  1ONL A;  2QDB A;  1O78 A;  1YNJ D;  2H4O A;  1ML0 D;  1U4P A;  3K5N A;  1Y69 U;  1HQR D;  1S5F D;  1D5X C;  2HUG A;  5C5L A;  1ZEQ X;  1K8O A;  2K33 A;  4ZKC B;  3ND8 A;  5LL6 X;  2HCC A;  2BOS A;  1K8M A;  1V43 A;  3FPU B;  3VYS A;  4CJ0 B;  1W6J A;  4GZY C;  2A69 C;  4MIU A;  1II3 A;  4PQX A;  4HSP A;  5M5W B;  3OWF A;  1STA A;  5FOB B;  3MXU A;  3S1R B;  4I7Z C;  4K6D A;  1HRJ A;  3C46 A;  2F0N A;  3FDT A;  2NN6 H;  5BN3 A;  4JK1 C;  3IKJ A;  3L7Z C;  3S9W A;  3W3A A;  5M5Y B;  3MXG A;  3A7L A;  3ERO A;  1HXY D;  1GUT A;  3LWU A;  1EEI D;  2DY8 A;  3DMU A;  1Q1B A;  2F0V A;  2E74 C;  4F8M A;  1Q90 A;  3Q24 A;  3VR4 A;  3NWT A;  2B2T A;  4IFD H;  3N6R A;  3LNN A;  1KNA A;  4E6I A;  2B2U C;  3MC0 B;  1QNK A;  2EE1 A;  3M7G A;  1I6V C;  3SE0 A;  2JA8 B;  2F0E A;  2JA5 B;  3BYT B;  2B2Y C;  3CRL C;  1SAP A;  3PMF A;  1VDZ A;  4I65 A;  2ZXR A;  2L12 A;  5IT9 L;  3OIP A;  2E75 C;  2HDM A;  2EJM A;  5I6Y A;  2NVY B;  4DAY A;  4KD3 A;  4QCL A;  2QIL A;  5KND A;  3TZD A;  1U4L A;  2OXP A;  1LLR D;  3D4D A;  3HOZ B;  3I8Z A;  2F3V A;  3NE5 B;  5ISR A;  1HHV A;  3PV0 A;  2SNS A;  4IUP A;  1PFM A;  4XYQ A;  4J8Q A;  2JYO A;  1PRT D;  5C4J B;  1WTR A;  1X3P A;  2PPB C;  3C1F A;  2WAQ B;  5CC4 A;  1PTO D;  2EY2 A;  5FO8 B;  3GD7 A;  5IIF A;  2WIN B;  5IOC A;  1TKW B;  5EKL A;  4ZYS A;  3KLR A;  1CT1 D;  2IT1 A;  1EFI D;  2K03 A;  2RBM A;  1LTI D;  1SYF A;  4O42 A;  3EVQ A;  3GV6 A;  3K5M A;  1FGB D;  4K2L A;  2E2H B;  3DWQ A;  1I50 B;  2VB3 X;  1F2M A;  1H9R A;  5T1G A;  3PO2 B;  1WD0 A;  2O5J C;  1QOH A;  3M7N A;  3LX0 A;  3E6Z X;  3I90 A;  2K6A A;  3OPO A;  4DXF A;  1ZYR C;  1XX8 A;  4BY1 B;  3QOJ A;  4AYB B;  3GTM B;  2F0M A;  5BN5 A;  4A3J B;  2IPK D;  4C1N K;  5KNB A;  3FEW X;  1W6K A;  3FMC A;  1EYC A;  2JP1 A;  5IT9 E;  3I91 A;  5ELC A;  2O5I C;  4NDX A;  1F77 A;  3R8B A;  1SJH D;  1A3V A;  3QOL A;  3HG9 A;  4KMU C;  4HMI A;  2WKC A;  4KJN A;  3QJY A;  4KKS A;  3VA7 A;  3V96 A;  1STE A;  2EDG A;  1LT6 D;  4OIJ A;  4ILW A;  1HQM C;  2B2W A;  4YIJ A;  2NVT B;  2NVQ B;  5COY A;  3FVQ A;  3PUZ A;  2F0L A;  3I72 A;  3QB3 A;  5FKA C;  2CVR A;  2ZXP A;  4XTC S;  1D6E C;  1DM0 B;  5AFW A;  3S2H B;  2K04 A;  2CW0 C;  3NQI A;  1SYB A;  1BNZ A;  2EXZ A;  1SDF A;  2RDF A;  2VXW A;  5D14 A;  2SEB D;  1C8C A;  1WTO A;  1LAB A;  3TN2 A;  2CQA A;  2Z4I A;  1A6X A;  5EPL A;  1JOO A;  2RSO A;  2Q8T A;  1D1K A;  3GP7 A;  3NBI A;  4EVO A;  5JAV A;  1R4P B;  1KLU D;  1ICW A;  1Q1E A;  2XRS D;  4J1M A;  1AZQ A;  3T16 A;  2BDN A;  3MA2 B;  2F0I A;  1STH A;  2NWG A;  3SXH A;  4WOR A;  4U67 3;  3P75 A;  1JC7 A;  3IFT A;  4TQU S;  2E2D C;  1ENC A;  4DK1 A;  4M1U B;  3MXN A;  2XSC A;  3ND9 A;  1I4H A;  1NUC A;  3DHQ A;  3ONA B;  5C4H A;  2KJX A;  3BDO A;  3PUW A;  1A3T A;  5I4D A;  2KCN A;  4B9W A;  1SMY C;  1QG7 A;  1YNN D;  1CA5 A;  2R3Z A;  1MI2 A;  1FD7 D;  1LTR D;  3SHL A;  4ZK9 B;  3GO5 A;  5LHY 1;  2TSS A;  4RGN A;  3BDL A;  3PUX A;  4HTH A;  4HED A;  5EQ0 A;  1EWH A;  4J6H A;  1F9P A;  3A8I E;  4LMQ D;  1LV9 A;  4LK1 C;  3N52 A;  2X6L A;  4FNF A;  3RZD B;  2XN9 C;  2A6H C;  1FR3 A;  5CGK A;  3E5S A;  1VF5 C;  3PUY A;  1BXT A;  1XYI A;  2VUM B;  2O2L D;  5C4X B;  3K5O A;  1S5C D;  1JWS D;  1BF4 A;  2F0K A;  3NHH A;  3NP8 A;  3NXW A;  4FYD A;  2SDF A;  3KF8 A;  5FK9 C;  3K6O A;  1GUO A;  4G7O C;  2AQ2 B;  4ID6 A;  2M2L A;  3D4R A;  3TZU A;  1LTT D;  4QIW B;  1DJR D;  2L55 A;  1EZ6 A;  2N55 A;  2HCI A;  2HQE A;  3TP5 A;  1SNQ A;  4WFN 3;  1LTA D;  4EQO A;  1G6Z A;  1AW7 A;  2JA6 B;  1EL0 A;  2SOB A;  4QB4 A;  1SNP A;  2A68 D;  1G29 1;  4F87 A;  2F0H A;  2L4N A;  3MFG A;  1IYV A;  2LKV A;  4C3J B;  4G7H C;  2YU9 B;  4IFD G;  4IUU A;  1JWU D;  2I07 B;  4K5W A;  2AQ3 B;  1H9K A;  2EZV A;  5C0X I;  5E4W C;  4QUF A;  3OIQ A;  4ZRZ A;  2K1B A;  1S4Z A;  1GXD C;  1MGS A;  4HN7 A;  4OO1 I;  1EYD A;  1KTK A;  4K5X A;  1R9T B;  2BA0 A;  5LL6 S;  1STY A;  1PZK D;  1IKL A;  5F2D A;  4DA2 A;  2F0W A;  1RKN A;  3VR6 A;  4X3S A;  1Y1V B;  2IW3 A;  3AB9 A;  3RD4 A;  4DFA A;  3OHX C;  1AP0 A;  1RTO A;  3UI2 A;  3IFD A;  3D31 A;  5M3F B;  3S15 B;  1L0Y B;  5I2X A;  1EQV A;  1ROD A;  4LAA A;  1B2T A;  1PRT B;  3Q23 A;  1TWH B;  5KYI A;  1HA5 A;  4KHZ A;  1EQT A;  1HCZ A;  5IOD A;  2X6G A;  1CTM A;  4A3G B;  1PTO B;  2DNC A;  1LT3 D;  1MD2 D;  4TKO B;  1PLF A;  1Z6H A;  5C6A A;  3H6M A;  2WAC A;  2EY1 A;  1Y8N B;  1CQV A;  2PZT A;  3E0J A;  4ZQ3 A;  3HOU B;  1BR9 A;  1SYG A;  2RVL A;  4XT1 B;  1I4G A;  3SVM A;  2K5Q A;  1M4V A;  1PTO H;  2OEO A;  3SDZ A;  4CKC A;  4B08 A;  4H44 C;  3OOC A;  4Z9C B;  1TS5 A;  2PNR C;  2F0S A;  1LAC A;  2EYH A;  4FXK C;  2PW7 A;  5CYU A;  1PDQ A;  2K7V A;  4CJ2 C;  4OHJ A;  4N9P A;  1PRT F;  1RD9 D;  5I9O A;  2JSO A;  4C3I B;  1QWY A;  1I4X A;  2BE5 C;  2NBF A;  5E1F A;  2B2U A;  1BDO A;  2SNM A;  2H1E A;  3OW7 A;  3HKZ B;  5JOB A;  1B1Z A;  1PTO F;  2LS0 1;  2F0D A;  2EYL A;  4ZUJ A;  2RA4 A;  1O80 A;  4QUC A;  2KEE A;  2B63 B;  1RDP D;  4HCE A;  1TWA B;  2B8G A;  2PO4 A;  1LO5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...