1WVLA

Crystal structure of multimeric dna-binding protein sac7d-gcn4 with dna decamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKKGVLKKLRAVENELH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and characterization of a multimeric DNA binding protein using Sac7d and GCN4 as templates
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Structural protein/dna
molecule keywords 5'-D(*CP*CP*TP*AP*TP*AP*TP*AP*GP*G)-3'
total genus 19
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wvlA00
3D6WA 1Q3LA 1RHPA 4CJ2C 1PFMA 2X69A 2KVMA 2K1BA 4IUUA 1SAPA 5CORA 4CJ0B 2L4NA 1E0BA 2HCIA 2MPMA 2RSOA 2B2YA 1JICA 4R9WA 4ZKBB 4ZLTF 2KEDA 1B2TA 2EOTA 1F2LA 1HUNA 2H1EA 4XT1B 3TN2A 4NW2A 1BF4A 1ICWA 2FINB 1SDFA 1C8CA 3LWEA 1J9OA 1DOKA 3DM1A 2B2VA 2L9HA 3IFDA 1TVXA 2MJ8A 5EJWA 4DN4M 1CA5A 1RJTA 5COYA 1KNAA 5E4WC 1SSOA 1KNEA 1PDQA 1RODA 1ILPA 2VXWA 1PFNA 4HSVA 2FHTA 1S4ZA 2Q8RE 4O42A 1IKMA 1RTNA 2L12A 2X6GA 1HRJA 3I8ZA 2B2TA 4IURA 1F9RA 1F9QA 1QNKA 3FPUB 2JP1A 3IL8A 4ZK9B 4X3UA 1WD0A 1PFBA 1WTQA 2N88A 2L1BA 1DOLA 2SDFA 3I3CA 4MN3A 4ZAIA 2B2WA 1IKLA 1WTVA 4XDXA 1VMCA 3Q6SA 2X6LA 2HUGA 3H91A 3MWYW 1LV9A 4LMQD 1EOTA 1NR4A 1EQTA 1WTOA 2DY7A 1B3AA 1MSGA 1HFGA 1NAPA 1X32A 2R3ZA 4HEDA 1WTPA 1F9SA 2J7ZA 5EQ0A 2B2VC 1B53A 3UI2A 1IL8A 5DNFA 2Q8TA 1DOMA 2L11A 4OIKA 5EPKA 4ZKCB 1AP0A 1RTOA 1U4RA 5CMDA 2JYOA 3MTSA 1MSHA 5EPJA 1ML0D 1BNZA 2B2UC 5D65A 2KECA 1BBXC 3GV6A 1O7ZA 1B50A 2EE1A 1QG7A 1HA6A 1VMPA 2BDNA 2K05A 1WTRA 1G91A 1O7YA 1MGSA 2K28A 4HCSA 4XT3B 5JJZA 4R8IA 5AFWA 2FMMA 1MI2A 1ZXTA 1G2TA 2K03A 2K04A 5CBAE 1ESRA 3N52A 1M8AA 4RWSC 1AZPA 1QE6A 4X3TA 3DEOA 1U4LA 1U4MA 2FFKB 2NZ1D 5T1IA 2HCCA 3KBXA 3KUPA 5E4XA 1PLFA 2K01A 1WD1A 1DONA 1XX8A 2XIWA 3DEPA 3GV3A 2MGSA 3FDTA 2DY8A 1HUMA 1EIHA 1NCVA 1BO0A 3I90A 4IUTA 4OIJA 4UAIA 3TZDA 1X3QA 2NWGA 2MP1A 5EKIA 2M2LA 4QUCA 1X3PA 2IL8A 1G6ZA 2D9UA 1WVLA 1CM9A 3SVMA 3R93A 2FJ2A 4HAEA 2EPBA 4CJ1B 1EL0A 1DZ1A 1HHVA 1U4PA 4QUFA 2NYZD 1XYIA 4U68A 3ONAB 4X3SA 2B2UA 2KEEA 2N55A 2RA4A 4RA8A 5EPLA 1J8IA 1HFNA 2B2TC 2B2WC 1F9PA 4IUPA 2CVRA 3P7JA 4X3KA 1GUWA 1EIGA 1O80A 1B4OA 2B2YC 2RVLA 4MHEA 5CBEE 2KUMA 1WTWA 3QO2A 5D14A 2HDLA 1NR2A 1WTXA 1JE4A 5T1GA 3HP3A 2RSNA 1CA6A 3F2UA 3G7LA 4IUVA 1ILQA 1A15A 2KOLA 3I91A 1G2SA 1AZQA 4RAUC 4IUQA 2HDMA
chains in the Genus database with same CATH superfamily
4DPGA 4IUUA 2KCTA 2XWJB 2NB0A 1J5EL 5C4XB 4ULLA 4DR3L 3ND8A 2EOTA 1WCMG 1LT3D 3EQLC 4IALA 2H1EA 1S3OA 2PMZB 1GUTA 2FINB 3MFYA 2DGYA 3PUZA 3LWEA 2ID0A 5IWAQ 3L9AX 3LNNA 2VQEQ 4KJNA 3D4DA 4GS3A 1II3A 4FXGC 1AEXA 2VQFL 1SLJA 1A2TA 2M9VA 2YU9B 1IXRA 4BBSH 2F0DA 4X62L 3OOCA 1G51A 4LWCA 1M4VA 2B2WA 3MVVA 4KKSA 2EY5A 2K33A 1B3AA 1A6XA 5IYCG 4K0KL 1R4QB 3Q24A 3RZDB 4QF4A 4G7OC 5FLMG 4F7XA 5JOBA 1ML0D 1TWFH 4H02A 2CW0C 3S9WA 1WTRA 2QILA 4CDFC 1JOOA 1N9WA 4XT3B 4OX9Q 3GTGH 1SNCA 4KHVA 5AFWA 3EIVA 1EYGA 4EX5A 2RHSB 1YHQA 1TS3A 2FMCA 1PTOB 1V8QA 5IGCA 1PLFA 2C5CA 3M4PA 4AYBE 3L0OA 1LUZA 4V190 2EXZA 5CV4A 5EKIA 5IT9c 3NQTA 1G6ZA 2D0PA 4A3GB 5E1FA 5FO7B 1R9TB 2EPBA 1JR0D 4RH6A 4DV3L 2PQAB 4RA8A 3T1HL 4CKBA 1EFID 4K5VA 1OO9B 3I4MB 3E3XA 4C3JG 3M7GA 4HSPA 1IYJB 1WTWA 4LFCQ 2HDLA 1WTXA 2JEAI 5LMUQ 1JE5A 3F2BA 1YI2A 1Y69U 1SMYD 1QILA 3R8BA 1Q3LA 3HOUH 5CORA 2I5MX 5CC4A 1I5FA 4JCVE 2QF7A 2HCIA 1TWGH 1VQOA 4A3FH 2NN6I 1DXMA 4ZKBB 1B2TA 5C4XH 2UUCQ 4NXML 4GKKQ 4DR3Q 3U9SA 4DU9A 4G7ZC 4B3SQ 1PTOC 1NE3A 4B3RQ 1PDQA 2Z8LA 4DF7A 1EFWA 1K83B 4JI5L 3OTOL 5ELFA 4JI4L 4A3KB 2Z6BA 5D3IB 4LF8Q 4DV6Q 3I3CA 2L1BA 3G6JB 3NEMA 1P8LA 1A8VA 2E2HB 1VMCA 5KNCA 1BXTA 4NXMQ 2VUMG 4GKKL 2QDLA 4L5RC 3QIAA 4YHHQ 1IYUA 4APVA 1NUCA 2L11A 3HOVB 5IGGA 3DWQA 1XPRA 3BYTB 4KD3A 3DWAA 4LW1A 2Q2TA 4POFA 1H9SA 1MGSA 1RD9D 1ASZA 1V9PA 4C3JB 3SDZA 4A3GH 4BY1H 3K7AH 1ESRA 5IIFA 2XRQD 1K0RA 3H0GH 4CKEA 1YJNA 2NZ1D 1IBMQ 2NTTA 4WRDA 1B70B 4IJHA 5LL6S 1DONA 3PO2G 4PZ8A 2MGSA 1STNA 2DY8A 2R7ZG 2EJMA 4LNQA 2MP1A 2WAQB 4PQXA 3SK6A 2EYJA 4NPSA 2I5LX 4JI4Q 1EZ8A 2UUBQ 5ISRA 1KTKA 4B08A 2WAQE 4X3KA 5C0XG 1B4OA 2IX1A 2B3GA 3TP6A 3CC4A 1RKNA 1CQVA 3RUZA 5CV8A 3K5LA 1AZQA 3J7AF 2X69A 1V1OA 1NJIC 5JJLA 2IW3A 2JA7G 4L8JA 2F0MA 4DV1L 5IGEA 4DR1Q 1HUNA 2B8GA 4KHPL 1BF4A 1SDFA 4DK6C 1VQ7A 1EWCA 1VQPA 2B2VA 3H6MA 4BXXH 1JOQA 1CA5A 1RJTA 2HIVA 2NTSA 1WCMH 3NBHB 4A3EG 2PYKA 1WJJA 5KGUA 1B44D 2SNMA 3BZDB 1STAA 1G8ZD 2N88A 1PXUA 1PRTF 1L0YB 1SR3A 3NK9A 1IW7C 1RF2D 1EOTA 1EYAA 1WTPA 3SHLA 4GNXC 2OT2A 3HFZB 5BR8L 1JWSD 5HURA 4P75A 2BH8A 5DNFA 3ZJYC 1GM5A 2JA7B 4YCVA 2QKIC 3S16B 3U58A 4B3TQ 3K59A 2J4XA 4IOCA 3GTOH 1BVSA 5EPJA 1SNMA 4LUVA 4UP9A 2KCMA 2PI2A 2EE1A 1IBML 4KK7A 1Y1WH 1KHIA 5BN4A 3H15A 3RZOB 2G5DA 3MA2B 3S1QH 4DNTB 1JJ2A 3LWUA 5F2DA 5HGTA 4BY7B 3A8IE 3J80L 1PH3A 1CKNB 1BBWA 1QUQA 1U4MA 4XTCS 3OHXC 4QY7A 2NN6G 5ELCA 1PH6A 2KA7A 4X65Q 3H3VI 2PZWA 2JA9A 2EYOA 1CI3M 3BG3A 5KNDA 2F0NA 1MD2D 4WORA 1WVLA 3TBIB 3R93A 2O5JC 4OL7A 4HAEA 1H9SB 1L0WA 1U4PA 4U68A 3L7ZC 5JEAG 1RCVD 2KEEA 3I4MH 3JAME 1LTBD 1S5DD 3HKZB 4LF7Q 2NVYB 1SYCA 5ELNA 4A3LH 3GTQH 4KKTA 2CQAA 3QO2A 5M5XB 1FD7D 5TSSA 4UY8C 2OEOA 5CR3A 2K5VA 2AQ3B 3HOZH 4BY7G 1FGUA 3DHQA 4TQUS 1UEBA 3SEBA 1E0BA 1YNNC 1KAAA 1HPCA 2VQFQ 3ERQA 1Q90A 3D0FA 2PNHA 3HZXA 4TVAB 4X66Q 1KD1C 1SE4A 1W6JA 4NXNQ 3AMUA 1DOKA 1PRTB 1XJVA 1TVXA 1TS2A 3I4NG 5KIXA 1H9RA 3W1BA 2AHOB 1S4ZA 1TY0A 4DUZL 4TKOB 3M9BA 4RFBA 2O5IC 1F9RA 2A19A 2UXBQ 3CC7A 4X3UA 4DUYQ 1N33Q 2ENBA 3QOJA 5BN3A 4HR7B 5IYDG 3S24A 1E2ZA 1UWVA 2ZM6Q 2A6HC 3PF4A 1E1OA 3MXGA 1EIYB 4DV5Q 2P5ZX 3KDFB 3PUYA 3BU2A 4JI0L 2CWPA 4ZKCB 3T4AC 1GUGA 2E75C 2A1AA 2YYZA 1SE3A 1SXTA 3A56A 4JW0A 1M90C 1N34L 3A7AB 5D65A 2WIIB 1VQNA 4JV5L 4NP5A 1QCBD 1I4PA 3Q8DA 4UP7A 3CPFA 4P71A 2ZM6L 3ERSX 4JI8L 4KV6A 3F1ZA 1HR0Q 2RKSA 1LT4D 3PO3G 4QL5A 4HJ8A 3MXUA 4ID6A 4JI3L 3NTKA 5C5LA 5BN5A 4B3MQ 1KAWA 2H5XA 5C3EB 4YWMA 3SGIA 3VR3A 4XQNA 2KBNA 2XGTA 5J3BA 2DUDA 5I9PA 1NMGA 1K3RA 4GOPC 2ZJPA 4IUTA 1IBLQ 2JXMB 5A2QE 3TS2A 1UE1A 2F0QA 1BBUA 1YEZA 2QEJC 2I07B 1DZ1A 4QUFA 1VDZA 1DGSA 4N8FA 1YHBA 1ZYRC 2L5TA 3QB3A 4DAYA 4KJOA 3P7JA 4IQZA 2B29A 1TR5A 2VB2X 4EQ5A 2R92B 4AYBG 3OYYA 3NENA 1F77A 1I94Q 2YTXA 3FKIG 4JBWA 5LMNQ 5IT9E 2LKVA 1S72A 4DN4M 2VUMB 2C9OA 3WOFA 1LM0A 3URYA 4GLXA 4LF9Q 1B7YB 4RGMA 1D1IA 1QVCA 3CC2A 4BY1G 1CSQA 1ESFA 4DR5L 2D5DA 1TKWB 3PCOB 1GUNA 3OPOA 1A3VA 2N49A 5JAVA 1QUQB 1AH9A 4WJ4A 1VQCA 4BBRH 5COYA 5E4WC 4JOIC 2YTVA 3GTPB 1KNEA 2A73B 3K5MA 1FYCA 1PFNA 4G57A 4BA1I 5A35A 2JJQA 3PO3H 4N9PA 4A75A 2F0WA 1QNKA 3K0XA 4PG3A 3K5NA 4C3IB 4MNOA 2XVSA 2WAQG 2JK8A 1GO3E 3CP0A 5EBDA 3FMCA 2HUGA 2WB1B 2JSOA 1EQTA 1K83H 5HGQA 1NAPA 1KDAA 5EQ0A 1X54A 4NB3A 2Q8TA 1OXUA 2MO0A 4FYDA 3J7YW 4X65L 3HOUG 3J80E 3M4QA 3S1NB 1YBYA 1BQQT 3K81C 1O7YA 5IE8A 2JA5G 4DNIA 1I6HB 1HNZL 1I6VC 1O7IA 5GAGC 1QOHA 1U5KA 1CT1D 5FKAC 4DR2Q 3HOZB 5JJKA 1SMXA 2CQOA 2EY6A 3J7ZC 1JJGA 2FFKB 3CCMA 3S17B 5GAHC 4RKLA 4RHRA 5CGKA 4JV5Q 2XIWA 3DEPA 5A2QL 5J39A 4HIKA 4UP8A 3JC66 4GKJQ 3WDNA 4BBSG 3KF8B 3BZCA 4K8IA 2K14A 4L5TA 2C35B 1H9JA 3I73A 1KQSA 3GTLH 1B1ZA 4NDXA 4O0AA 4UDUC 1UAPA 4L5QA 2IHEA 1XNRQ 2A6HD 2V1CC 1NY4A 1BKBA 3K80C 3HOVH 1FJGL 3EFXD 1SYFA 2OF1A 3F2UA 1VF7A 5K36H 1K8AC 1QNUA 5IGDA 3I4MG 4IUQA 2HDMA 1Y1VG 3FEWX 3J81c 4FDBA 1IZ6A 2YTYA 4MZ9A 1C0AA 4IJLA 1K0SA 2F0VA 2KEDA 4DV3Q 1PV4A 2ZJQA 3KJPA 4DV0L 4AH6A 3DM3A 1C8CA 5JVH3 5DLQE 4KLKA 3ULLA 2E2JH 1HR0W 2A74C 2EYPA 2ICEC 3G71A 4I7ZC 3MXNB 2L15A 5FLXL 5KNBA 4LF8L 1Q1EA 1LACA 1EWHA 3CCSA 1HRJA 1RTNA 2L12A 4DXGA 1WYDA 2RDFA 1A2UA 4TSSA 1WTQA 4GN4B 3T1YL 1Y1WG 4MN3A 1IKLA 3C1FA 3ICEA 2ZT9C 4PZ6A 1NMFA 2WINB 1LV9A 3DMUA 1Y1VB 4Q5VA 2JN4A 5EKLA 4B3SL 2R3ZA 4DAYB 2PZTA 1F9SA 4A3LG 1EQQA 2EYFA 3CMEA 1B53A 4A3DG 2AWOA 5C4HA 2A68C 1C9OA 3TP8A 4ILWA 3RLFA 1PZJD 1BBXC 1LTGD 3KBGA 3VYRA 1SE2A 5FLXE 1PYSB 5M5YB 1JOKA 3C3LA 4JOIA 1MI2A 4HJ7A 4X62Q 1YJWA 1CK1A 4QMGA 4QB4A 2EZVA 3NBIA 2N78A 5T1IA 3MXPA 2CW0D 3BVMA 4HMJA 1Y1WB 1Z7TA 4E6IA 1WD1A 1Q8KA 1XX8A 5D3DA 3FKIH 2ZJRA 4OWTB 4OXPA 3T13A 1I50B 1D5ZC 5C4JB 1ICFB 4DV4Q 3HOYB 4RHSA 5NUCA 2IL8A 2D9UA 1PH5A 1ZKOA 1Q12A 3PO2H 1EL0A 1HHVA 3RZOH 3S1QB 1ENAA 1GKHA 2EYLA 1E3PA 2B2UA 1OXSC 2K5QA 3PUVA 1Q46A 4K0KQ 5I6YA 1VCIA 1X9NA 1FNWA 1PRTD 3PIO3 2B2YC 4LFAL 2CH4W 2EVBA 2KUMA 4IO9A 3G48A 2IWHA 2ATWA 1AE2A 3IAYA 3OIQA 2K5WA 1ZYRD 2E5LL 2BH2A 2E2JB 1ILQA 1X3EA 3PV0A 3QWNA 3HOXB 4NW2A 4QIWB 4LF5L 4IOAA 3X3NA 5C4JH 4JI6L 2QEXA 3E0EA 2KVMA 1Q7YC 2PI2E 2L4NA 4LUZA 4X64L 1STBA 1FNVA 5DM73 4C3IH 1A62A 1HZBA 4HJ5A 1VQLA 2B63H 3KLSX 4XT1B 4IZ8A 3HS0C 3E5SA 1EY8A 2JE6I 5IT9L 1STGA 3CXCA 2WKDA 4G4KA 3UDXA 1V1PA 2HHHL 3S2HH 3S2DB 1I94L 4HJAA 1RODA 2UU9L 2VXWA 3HOXH 3FVQA 4K6LA 1B3QA 1IKMA 4WJWA 5IODA 3Q23A 2IJ0A 5C6AA 4ZAIA 1JC7A 2E74C 5JVG3 2VNUD 3CQZB 1VQDA 4PMBA 1X32A 1AE3A 5IWAL 1SRUA 3GTKH 4YHHL 1RTOA 4A4IA 1U4RA 5CMDA 2R92G 2EIFA 4LF9L 4A3MH 4L5SA 1QG7A 3HKZG 3FKIB 4GNXB 5FK9C 3DXJC 2BDNA 1GUSA 4HCSA 2K28A 1LTID 1WFQA 1LABA 4IUNA 4PMWA 4AYBB 4OEMB 2K03A 2IX3A 3MAQA 2JQOA 4FF3A 3KBXA 3RLNA 3HRZC 3OW2A 1QZGA 1SBBB 2WB1E 2SOBA 3CAMA 2DNEA 5I6WA 4JI0Q 1BO0A 3I4OA 4QQBX 4BY1B 3TSSA 3K7AB 5CV9A 4QUCA 1CM9A 4CJ1B 5M5XH 1YVCA 2F4IA 3KFUA 3RD4A 1C48A 3ONAB 4F8MA 2G9HD 2N55A 3M4YA 4DGZA 2D62A 4JI2L 2EXDA 4DUYL 1N33L 4DV6L 3TREA 2CVRA 2B63B 1QVFA 2Q2HA 1CHQD 3GTPH 2QA4A 4ABNA 2K5NA 2VUMH 5IGBA 3G7LA 1WI5A 4LAAA 5C3WA 5C0XJ 2PNRC 4IFDJ 3O13A 3D6WA 2V4DA 4A3IH 2UUAL 1MHWC 4LF4L 4JC0A 5KYIA 2TMPA 2RSOA 3OMGA 4R9WA 4BXXG 3T53B 4DAMA 4DR5Q 1Z9FA 3GTJB 3T16A 1EQRA 2VY3A 3GTOB 1YNND 2R7FA 1RDPD 2E8GA 1GHKA 1TWHH 2DJFC 1AFPA 4TRDA 1SMYC 4UPAA 3Q0AA 1YNXA 4OO1H 4EQPA 3V05A 1SNPA 2PQAA 2FHTA 4L63B 1Q82C 3GTJH 2X6GA 2F4VQ 1LT6D 3OSOA 4FP5D 1W2BA 5HY6A 4ZK9B 3HGBA 4PZ7A 2NVYH 3VR6A 1YNJD 2E2IH 1JWUD 3VR5A 3JAMc 2VZAA 2HHHQ 2NVQB 1K73C 4GNXA 3D6CA 4Y7NB 5IYCH 3FP9A 1JMCA 5LHY1 2K7VA 3M3YH 1XNQL 3D4RA 5EBCA 3SK8A 2WB1G 3CCJA 3K58A 4R4OA 1PH4A 5CV5A 2UXBL 4NKLA 1SEBD 2QCPX 2QW7A 2BE5D 3QOLA 4K8JA 3DUZA 3NE5B 1E1TA 3GD7A 4R4IA 1WTHA 1V43A 2NVQH 4X3TA 2NN6H 1KDBA 1P16A 1PFSA 1A3UA 1VQFA 1TWAH 1WOCA 2UUBL 3W5OA 2MFIA 4GLAC 4FF4A 5ELOA 4JI1L 1HNXQ 2LSSA 2PMZE 2F0FA 3SVMA 2F4VL 2MQHA 1S40A 1I6HH 4DR1L 4A3KG 1QZHA 3C46A 3T1YQ 1LTAD 2RA4A 4J6HA 4YWKA 5FLMH 4GOPA 1VQ6A 3GP7A 4YWLA 1DM0B 1GUWA 5C4ZA 1O80A 4CDDC 1EYCA 3AEVA 2B8FA 1E24A 2RSNA 3KK7A 4YIJA 1TWHB 3VYSA 3HOYH 1A15A 4XYOA 4RAUC 4HSVA 3ITPA 2DN8A 1KRTA 2N8NA 3B6YA 2UUAQ 4Z9CB 1S5BD 4S3SA 1RIPA 1JT8A 2DJGC 2JA8B 4IFDG 1LTSD 1EY7A 1MBYA 1C4QA 3OIPA 4QGUA 1BCPB 3IFDA 3S2DH 1LTRD 5FJ8H 4LK1C 4A93G 2NZHA 2F0HA 1B9MA 2Z4IA 3HOZG 1X6OA 4CKCA 3KLRA 2K4KA 4DR6L 1STEA 3UDIA 4NXNL 2R93B 2Z6KA 3U4ZA 2KHSA 4YY3Q 2F0GA 4LMQD 3MWYW 1WTOA 1XWEA 3M85A 4HEDA 4ME5A 4R4CA 1DOMA 2NUCA 1AN8A 1TT2A 3U9OA 1QJOA 4A3KH 1PYBA 1D7QA 2G9DA 1O7ZA 2IT1A 4IFDI 4JBMA 1I4XA 1KLGD 2Z0SA 4C1NI 4OGQC 1OTCA 1HQRD 1KLUD 5JJZA 1L1OB 4JK1C 3J81E 4KTAA 3GTKB 2I46A 5CBAE 1F2MA 5LMNW 2OWOA 2BE5C 4EQOA 4A3JB 5GADC 4FXDA 3TEHB 3GQBA 1SFOH 1F2YA 3KDFA 3T1HQ 1VQ5A 5GAEC 4Q0FA 3U50C 2QDBA 1K8GA 3VDYA 1EOVA 4YCUA 4UAIA 3KF6B 4KY7A 4IPDA 3D3RA 3S1MH 3E9IA 1HZCA 4QJFA 1TS4A 1Y1VH 1XTDA 2O4XA 4C3HB 3OW7A 2BA1A 1X65A 3PMFA 2RVLA 3BDCA 1CKOA 2XN9C 3KLSA 1FNUA 1VQBA 4DR4Q 4B3RL 1NBWA 3K0YA 3LGJA 1G2SA 1I4HA 4O2DA 1PFMA 4GN5A 2UXDL 4JG2A 3TQYA 4A3DB 2J0TD 3GO5A 3PUXA 4ZUIA 3S17H 2O2LD 4CBVA 3RMHA 3FRPB 1E2WA 1VQKA 2ZXPA 3J81i 3CPWA 5FOBB 5C0XH 2K75A 1G6PA 4EVOA 1CSPA 5LMUL 2UU9Q 3CKIB 2VW9A 3BZKA 2HQLA 4EQNA 3UE1A 2ZTDA 1AW7A 2XNAC 3A8JE 4F87A 1XPUA 4OHJA 3DWPA 2OTLA 4XDXA 1O7LA 3HEJA 1NR4A 2F0PA 2WV6D 5C3XA 1UNSA 2MUYA 1EQVA 1D5MC 1TWCB 2Z4HA 1IBLL 4C3JH 5M3FG 2B2VC 3CF5A 2EY1A 4A3CG 5EPKA 1Y8OB 1L1OC 1FVIA 2UXCL 4C2MH 2CH4A 3MTSA 5I9OA 3I7FA 1HA6A 2RDHA 1G91A 4JI3Q 2F0IA 1J6QA 4HTHA 4IN3A 3PSIA 2NZOA 4R4QA 1MKHA 3DLLA 3HOXG 3UDGA 4MTKA 3DEOA 1BOSA 1N36Q 2E2IB 4JBJA 1B8AA 1HH2P 1JWMD 1HA5A 1PZID 2SEBD 2AQ2B 4DV4L 2QGQA 2XRSD 3CD6A 3SE0A 4Y7NH 2K52A 1NCVA 4CGYB 2A69C 3TZUA 4LF6L 1Q86C 2FXQA 1R4PB 2NYZD 1F2ZA 2R92H 3S1RH 3CRKC 3FHWA 1Q1BA 2B2TC 4LFCL 4JYAL 3S15B 1V1PB 5IP9H 1Y8PB 2F3WA 3VA7A 1RL2A 2BOSA 3KJOA 4RGNA 1KXLA 4OO1G 2A6ED 4I7AA 4CJ0B 3N6RA 3EN2A 4WJ3M 1W3SA 2ASBA 2BDOA 3S2HB 2B2YA 2LXKA 2R93H 3KLWA 4A3DH 1F2LA 5KYLA 5H1SE 3TN2A 4YY3L 4I65A 3OWFA 2DNCA 2LMCB 1XTCD 3E9HA 3NBHA 1PA6A 3NWSA 4DXFA 3GTLB 4A3FG 3VR2A 1XNRL 1EY5A 4JI5Q 1TWCH 5C3EG 1V1QA 5GROA 3CU7A 2AKWB 1PH7A 4IURA 2AMCB 1F9QA 5GQOA 4GZYC 1KDCA 4HCEA 4JI1Q 4B9WA 3FPPA 2JA6B 1BCPF 1STHA 1G291 3CCUA 1YIJA 4R4TA 3P1HA 1VQMA 3BDLA 3PIP3 1HFGA 4MIUA 1CTMA 1TIID 3IFTA 3QG1A 1N32L 4DR2L 4OIKA 1XPOA 1PYWD 2CHBD 1JCKB 2H4OA 1MSHA 4HJ9A 1I50H 2OQKA 2Q2UA 3NELA 1D1KA 2F0TA 3AQQA 5K5PA 4B3ML 1EUJA 2OQ0A 1TU2B 3S1RB 3I2ZA 4GKJL 2D0OA 4UHVA 3HG9A 1EYDA 3PO2B 3ND9A 1ZXTA 4J15A 1G2TA 3I70A 3E6ZX 1I3QB 4HIDA 4OX9L 2KCCA 3TRZA 1EY4A 3F2DA 1TS5A 1TWAB 2JA8G 3I4NH 1LT5D 4RCOA 4ALPA 1K3BC 1X55A 3EBEA 3A74A 1PH2A 4R8NA 3RZDH 3RN5A 1SYBA 1SJHD 1ENFA 3TZDA 1X3QA 2Q2IA 3SR1A 4OONA 5I4DA 1XNQQ 4HMIA 1K8OA 2JA6H 3H09A 1K28A 1SE8A 2VB3X 4M1UB 2K5DA 2KQ3A 3BYYB 1HQMC 3U4VA 4C2MB 1EIGA 2F03A 3PIOA 5ELDA 2AWNA 1PTOH 3AYHB 1N34Q 3MEFA 4AQYL 3W3AA 1KABA 4DK1A 1HTPA 1PH1A 5I2XA 4C1NK 5EAYA 3J81j 2K1BA 2JA8H 1T9HA 2PQEA 2I0QA 4ZLTF 3A0JA 4BA2I 1IBKQ 4KD4A 3T51B 4XQJA 2EY2A 1Z6HA 1B9NA 5IY0A 3CMAA 4KKUA 1EY0A 1H9MA 2L9HA 3NXWA 4C3IG 3GTGB 5JJIA 4K2KA 1X3GA 3HOWG 3K7UC 4JI2Q 3H3VC 2RCNA 1LO5D 3RNUA 4A3MB 2Y0SE 5JPMC 3BS1A 1CKNA 1VQGA 2GVAA 4LF4Q 1S5FD 1BCPC 1VQAA 3S14H 2VS1A 3VYUA 1BUVT 3H94A 4KHZA 4JBKA 3Q6SA 2OCEA 2Y0SB 1SYGA 1PMRA 2LS01 1EY6A 4IPCA 3CRLC 5E3FA 2IX0A 1R9TH 2IY5B 3UI2A 4P73A 3EJIA 4DR7L 5G3LD 4A3EH 4RMFA 1JB3A 5C3EH 1B50A 5G3LF 4ODGA 1VMPA 4YCWA 5AJ3Q 1D8LA 2GA4B 3D4WA 3SXHA 4IPHA 3G6EA 2B63G 4H0LC 1EWIA 4IFDH 1NSNS 2ES2A 1XMQQ 1AZPA 4A3MG 2Q8IB 4DKAC 3RR5A 4CDCC 3KUPA 2L0CA 4DV2Q 1SN8A 1ENCA 3MZ5A 3WWVA 3I72A 1EIHA 3ER0A 4RGTA 3A5ZB 2NWGA 2KHJA 2EYHA 4J1MA 1JORA 4GLVB 2FJ2A 3MXNA 5C44G 2HD3A 1VQ4A 1DYQA 2BA0A 4G7HC 4M8AA 1TWFB 1PHJA 3JAMi 1UEAB 4QIWE 2F0KA 4XYQA 1S5ED 2F0EA 1K8MA 1MIUA 4IUVA 3NP8A 2BCOA 1HTLD 4ZCKA 1H95A 2AUKA 2IHFA 1PTOD 5IYBH 1SAPA 1STYA 5BR8Q 3H0GG 2F1MA 2R6GA 1IYVA 4DV0Q 4DV7L 1OXVA 2UUCL 2A68D 1ASYA 4A3GG 1A63A 2HQEA 2K32A 3ULPA 2F0SA 1GHJA 3QJYA 5J22A 4NMZA 2TSSA 4A3EB 3DM1A 3PQIA 4OWXB 4AIMA 5C44B 1UUPA 4N8X1 1VS0A 1LYLA 1PTOF 2CWAA 1PVOA 3BJUA 5FO8B 2ZTEA 2NVTH 3R2TA 3GDEA 3L2PA 2Q8RE 1D5XC 5C0XI 3EROA 2B2TA 2F0LA 5IYBG 2JP1A 1WD0A 4LF6Q 3I4NB 2NVXB 3HOVG 2E5LQ 2A69D 1VQ9A 2X6LA 2B39A 4H44C 1SROA 5C4XG 5ELEA 4LUOA 3L3OC 2UXCQ 1AP0A 3HOWH 1YNJC 4C3HG 4DK3C 3KF6A 4A3JH 3S16H 4K14A 4RGOS 1EU4A 2RQXA 5EGTA 5M3FB 3CHBD 4ZRZA 2I5HA 3N52A 1QE6A 3A55A 5JEAJ 1N36L 4K5XA 2HCCA 2WACA 3WOEA 5E4XA 5ELBA 1L1OA 1E22A 3JAML 4FVMA 4A3JG 4DAVA 3H3VH 4C3HH 4OIJA 1M1KC 4KY6A 3TP7A 2M2LA 4DA2A 4FNFA 3STBD 2F0JA 3NHHA 3CCRA 5EPLA 3KOJA 4RG1A 2HT1A 3E0JA 1GD7A 1VQIA 2Z1CA 1LTTD 4MHEA 5CBEE 5KEEA 2NVTB 1FGBD 5D14A 1JB7A 1NR2A 1JE4A 2K5HA 4KI0A 1IHZA 4OELB 4KHPQ 1TQOA 2AUJD 5DEHA 2M00A 2A5HA 1RHPA 4X64Q 4JYAQ 4XXEA 2NBFA 1KL9A 2MPMA 1JICA 3CCEA 2Z6KC 1UE5A 3PUWA 1SFOB 5M3MH 2RCFA 1GXDC 3MFGA 1ICWA 3KF8A 3AFQA 2ZXOA 3C2PA 1TWGB 1PZKD 2ZTCA 2MJ8A 1UE6A 5IGFA 3OTOQ 3NTIA 3T56B 4XQQA 1OXTA 2WFWA 3CQZH 3M4OB 3LX0A 2E2DC 1HJPA 2UXDQ 3J80c 3HOWB 3IL8A 3TP5A 2HIXA 4LF5Q 5IP7G 4FXKC 4Y52H 1O78A 4PNYA 4A3IB 3H91A 1SNDA 4RCNA 3X3MA 2F3IA 4K2LA 1MSGA 2YV5A 2EJGC 4DFAA 3HKSA 3IRBA 3AU7A 3D31A 4P74A 3K57A 3P20A 2F3VA 2XSCA 2KECA 1YITA 1J5EQ 1VF5C 4X6AH 1OXXK 2K05A 2ICIA 4V0BA 4KN4C 3ULJA 4LFBL 4WFN3 3S1MB 4PMCA 2PZUA 2K04A 1M8AA 3SK4A 2R7ZB 1TY2A 4FO2A 2OTJA 4KN7C 1KC8C 4L6TB 1E2VA 4DAPA 1LLRD 5C5MA 1BR9A 4H7BA 4JPBW 5M5WB 3F8TA 3M4OH 1HUMA 1SNOA 1Y8NB 3I90A 4EGVA 3GTMB 1CFMA 1A0IA 4DV5L 3J80i 2PO4A 2LFNA 2JA7H 3W1GA 2CKZB 3C1EA 1I4GA 4GN3B 4IPGA 3I55A 1XYIA 1DCZA 2IPKD 5FO9B 5CV7A 3S1NH 1X3FA 3MC0B 1HFNA 1Z47A 1HNZQ 1S5CD 4CDEC 1D6EC 5IP9G 1GOZA 1ONLA 3UDFA 1QVGA 1QB5D 2YU9H 4DNRB 5DAUA 3I91A 1GJXA 4MTNA 2R61A 1WCMB 1YZ6A 1D2BA 3EVQA 3VR4A 4JI7L 3A54A 5L37A 3CCVA 2EYMA 2XTIA 4A3IG 4K6DA 5JPNC 2KENA 2NVXH 3R3OA 5K36G 4BBSB 1KIXA 4PV1C 4FF2A 1X56A 5EKKA 2R7ZH 4BS9A 1HNWQ 1L0XB 1ET9A 1EY9A 1ET6A 3A5UA 4KMUC 2JEBI 3SK5A 1HNXL 3TMEA 4CHTB 2PW5A 3TDQA 1MJEA 2L55A 1LTLA 2D2CC 1EIFA 5EJWA 3RN2A 4JI6Q 1KNAA 4FF1A 1SSOA 4DV2L 1SYEA 4O42A 4LFBQ 3I8ZA 1XMOQ 1U9RA 3FPUB 4LFAQ 4A3BH 1XXGA 1GUOA 1PFBA 3V2TA 1PH8A 2SDFA 5LMNL 3D8GA 1CHPD 4OWWB 1CZGA 1T5EA 3NSWA 3M7NA 5AJ3L 2DY7A 3Q22A 1DJRD 1JJCB 1DD2A 5J1ZA 1YHAA 2E2HH 3OWEB 4A3CH 2LXJA 3CCLA 2J7ZA 2RDGA 1IL8A 1HXYD 2JA6G 1QWYA 1CQFA 3S14B 1I4RA 2PW7A 2CCZA 4J8QA 3NWTA 4H13C 4JVZA 2B2UC 3GV6A 1H9KA 1VQJA 3AB9A 3MHBA 1I3QH 3P75A 5DM63 1YJ9A 1CZWA 3BVGA 1VQHA 1W6KA 1I4QA 3F2CA 2FMMA 2RHQB 3MEHA 5M3MG 2ZXRA 1Q8IA 2E76C 1SJED 1JQYD 3BDOA 4OO1I 1PRTC 5M5YH 4P72A 2K01A 3K8AA 1IL2A 2A8VA 1ZEQX 2F0UA 3GTQB 1VQ8A 3GV3A 3A7LA 3H0GB 3FDTA 2SNSA 4DR7Q 1BDOA 1IW7D 2CFMA 4ZUJA 4A93B 1N8RC 1Y14B 2GN5A 1HZ9A 1X3PA 2AQ1B 3RLOA 2R7DA 5IP7H 1NTGA 3I56A 1Q81C 4K5WA 4R1JA 1L2FA 1J8IA 4DR4L 4JI8Q 1HR0L 2B2WC 1BCPD 4BWGB 2WKCA 2KCNA 2RF4A 1XMQL 3QR8A 2MO1A 3OMCA 4F88A 1CA6A 3PF5A 2Y0SG 4RKBA 2XWBB 1A3TA 4CJ2C 3NTHA 4DUZQ 1EEFD 1KRSA 2RBMA 4BBRG 2VL6A 2KJXA 1SYDA 4DV1Q 1T5XD 4QCLA 1EZ6A 3PGZA 2VQEL 2F0OA 4BY7H 2EQSA 1GVPA 2WP8J 3HKZE 1J9OA 3CCQA 1K9MC 2A6EC 2K50A 2LY7A 2R93G 3NQIA 4AQYQ 3V96A 1C7YA 1ILPA 1FJGQ 4KY5A 4DK0A 5IOCA 5M3MB 5CYUA 4P2CB 4A3FB 2Z9HA 1DOLA 1FL0A 1WTVA 2GVBA 1MJCA 1VQEA 3UE0A 1PH9A 3HOUB 4DV7Q 1SNQA 3PIPA 3NUCA 4XIGS 3GTMH 2ALYB 5I2YA 4LF7L 3NPPA 4A76A 1HNWL 4BBRB 2JA5B 3CW2C 5C44H 3W2DA 4HIOA 4A93H 1NNXA 5JEAH 2JYOA 5M9OA 2OXPA 1IBKL 3K5OA 1BNZA 3IKJA 4ME3A 3PO3B 4N9TA 4ZQ3A 1CUKA 4POGA 4JI7Q 1HCZA 1FR3A 5KRUA 3TS0A 1CKMA 2K6AA 3BVZA 3ZYYX 4A3BG 4R8IA 2JA5H 3K6OA 4GOPB 4HIMA 4B3TL 1UE7A 2F52A 4RWSC 3KYHC 2PPBC 3J81L 1U4LA 5CV6A 3M3YB 2KHIA 1TXYA 5FJ8G 2EJFC 2PCFB 2MHVA 3AFPA 4ZYSA 3HOYG 1EU3A 2MNAA 3I4LA 3J7AV 4LJZC 1EEID 1N32Q 3A8KE 3R2IA 4B9XA 3VA5A 5M3FH 5E7NA 3STBC 4X3SA 3S15H 5FLXc 4IUPA 1F9PA 1XMOL 1U0LA 5M5WH 2N3SA 4DR6Q 4HN7A 3G4SA 5IYDH 3J7A5 1HZAA 4X66L 4A3BB 2EDGA 3HP3A 5T1GA 3EA6A 1E7ZA 3VYTA 4C56C 4O1NA 2KOLA 5LL6X 4U673
chains in the Genus database with same CATH topology
4IUUA 2XWJB 2NB0A 5C4XB 4ULLA 3ND8A 2EOTA 1LT3D 3EQLC 4IALA 2H1EA 2PMZB 1GUTA 2FINB 3MFYA 3PUZA 3LWEA 2ID0A 3L9AX 3LNNA 4KJNA 3D4DA 1II3A 4FXGC 1AEXA 1A2TA 2M9VA 2YU9B 2F0DA 3OOCA 1M4VA 2B2WA 3MVVA 4KKSA 2EY5A 2K33A 1B3AA 1A6XA 1R4QB 3Q24A 3RZDB 4QF4A 4G7OC 4F7XA 5JOBA 1ML0D 2CW0C 3S9WA 1WTRA 2QILA 1JOOA 4XT3B 1SNCA 4KHVA 5AFWA 1TS3A 2FMCA 1PTOB 1V8QA 5IGCA 1PLFA 2C5CA 4V190 2EXZA 5CV4A 5EKIA 3NQTA 1G6ZA 4A3GB 5E1FA 5FO7B 1R9TB 2EPBA 1JR0D 4RH6A 4RA8A 4CKBA 1EFID 4K5VA 1OO9B 3I4MB 4C3JG 3M7GA 4HSPA 1WTWA 2HDLA 1WTXA 2JEAI 1Y69U 1SMYD 1QILA 3R8BA 1Q3LA 5CORA 5CC4A 2QF7A 2HCIA 2NN6I 1DXMA 4ZKBB 1B2TA 3U9SA 4DU9A 4G7ZC 1PTOC 1PDQA 2Z8LA 4DF7A 1K83B 5ELFA 4A3KB 5D3IB 3I3CA 2L1BA 3G6JB 2E2HB 1VMCA 5KNCA 1BXTA 3QIAA 1IYUA 1NUCA 2L11A 3HOVB 5IGGA 3DWQA 3BYTB 4KD3A 3DWAA 1H9SA 1MGSA 1RD9D 4C3JB 3SDZA 1ESRA 5IIFA 2XRQD 4CKEA 2NZ1D 2NTTA 4WRDA 5LL6S 1DONA 2MGSA 1STNA 2DY8A 2EJMA 2MP1A 2WAQB 4PQXA 3SK6A 2EYJA 1EZ8A 5ISRA 1KTKA 4B08A 4X3KA 5C0XG 1B4OA 2IX1A 3TP6A 1RKNA 1CQVA 3RUZA 5CV8A 3K5LA 1AZQA 3J7AF 2X69A 1V1OA 2IW3A 4L8JA 2F0MA 5IGEA 1HUNA 2B8GA 1BF4A 1SDFA 1EWCA 2B2VA 3H6MA 1JOQA 1CA5A 1RJTA 2NTSA 2PYKA 5KGUA 1B44D 2SNMA 3BZDB 1STAA 1G8ZD 2N88A 1PXUA 1PRTF 1L0YB 3NK9A 1IW7C 1RF2D 1EOTA 1EYAA 1WTPA 3SHLA 2OT2A 1JWSD 5HURA 5DNFA 2JA7B 2QKIC 3S16B 3K59A 2J4XA 5EPJA 1SNMA 2EE1A 4KK7A 5BN4A 3RZOB 3MA2B 4DNTB 3LWUA 5F2DA 5HGTA 4BY7B 3A8IE 3J80L 1U4MA 4XTCS 3OHXC 2NN6G 5ELCA 2KA7A 2PZWA 2EYOA 1CI3M 3BG3A 5KNDA 2F0NA 1MD2D 4WORA 1WVLA 3TBIB 3R93A 2O5JC 4OL7A 4HAEA 1H9SB 1U4PA 4U68A 3L7ZC 5JEAG 1RCVD 2KEEA 3JAME 1LTBD 1S5DD 3HKZB 2NVYB 1SYCA 4KKTA 2CQAA 3QO2A 5M5XB 1FD7D 5TSSA 2OEOA 5CR3A 2AQ3B 3DHQA 4TQUS 3SEBA 1E0BA 1YNNC 1KAAA 1HPCA 3ERQA 1Q90A 3HZXA 1SE4A 1W6JA 3AMUA 1DOKA 1PRTB 1TVXA 1TS2A 5KIXA 1H9RA 1S4ZA 1TY0A 4TKOB 2O5IC 4RFBA 1F9RA 4X3UA 2ENBA 3QOJA 5BN3A 4HR7B 1E2ZA 2A6HC 3MXGA 3PUYA 4ZKCB 3T4AC 1GUGA 2E75C 2YYZA 1SE3A 1SXTA 3A56A 3A7AB 5D65A 2WIIB 4NP5A 1QCBD 1I4PA 4KV6A 2RKSA 1LT4D 3MXUA 4ID6A 3NTKA 5C5LA 5BN5A 5C3EB 3VR3A 4XQNA 5I9PA 4IUTA 2JXMB 5A2QE 2F0QA 2QEJC 2I07B 1DZ1A 4QUFA 1VDZA 1ZYRC 2L5TA 3QB3A 4DAYA 4KJOA 3P7JA 4IQZA 1TR5A 2VB2X 2R92B 1F77A 4JBWA 5IT9E 2LKVA 4DN4M 2VUMB 2C9OA 3WOFA 3URYA 4RGMA 1D1IA 1ESFA 2D5DA 1TKWB 1GUNA 3OPOA 1A3VA 5JAVA 5COYA 5E4WC 3GTPB 1KNEA 2A73B 3K5MA 1FYCA 1PFNA 4G57A 4BA1I 5A35A 4N9PA 2F0WA 1QNKA 3K5NA 4C3IB 2XVSA 5EBDA 3FMCA 2HUGA 2WB1B 2JSOA 1EQTA 1NAPA 1KDAA 5EQ0A 2Q8TA 1OXUA 4FYDA 3J7YW 3J80E 3S1NB 1BQQT 1O7YA 1I6HB 1I6VC 1QOHA 1CT1D 5FKAC 3HOZB 2EY6A 2FFKB 3S17B 4RKLA 4RHRA 5CGKA 2XIWA 3DEPA 5A2QL 5J39A 3WDNA 4K8IA 3I73A 1H9JA 1B1ZA 4NDXA 4UDUC 1UAPA 2A6HD 3EFXD 1SYFA 2OF1A 3F2UA 1VF7A 5K36H 1QNUA 5IGDA 4IUQA 2HDMA 3FEWX 2F0VA 2KEDA 1C8CA 5JVH3 2A74C 2EYPA 2ICEC 4I7ZC 5FLXL 5KNBA 1Q1EA 1LACA 1EWHA 1HRJA 1RTNA 2L12A 4DXGA 2RDFA 1A2UA 4TSSA 1WTQA 4MN3A 1IKLA 3C1FA 2ZT9C 2WINB 1LV9A 3DMUA 1Y1VB 4Q5VA 5EKLA 2R3ZA 2PZTA 1F9SA 2EYFA 1B53A 2AWOA 5C4HA 2A68C 3TP8A 4ILWA 3RLFA 1PZJD 1BBXC 1LTGD 3KBGA 3VYRA 1SE2A 5FLXE 5M5YB 1JOKA 3C3LA 1MI2A 1CK1A 4QMGA 4QB4A 2EZVA 3NBIA 5T1IA 3MXPA 2CW0D 3BVMA 4HMJA 1Y1WB 1Z7TA 4E6IA 1WD1A 1XX8A 5D3DA 3T13A 1I50B 1D5ZC 5C4JB 3HOYB 4RHSA 5NUCA 2IL8A 2D9UA 1ZKOA 1Q12A 1EL0A 1HHVA 3S1QB 1ENAA 2EYLA 2B2UA 1OXSC 2K5QA 3PUVA 5I6YA 1VCIA 1FNWA 1PRTD 3PIO3 2B2YC 2EVBA 2KUMA 2IWHA 3IAYA 3OIQA 2K5WA 1ZYRD 2E2JB 1ILQA 3PV0A 3QWNA 3HOXB 4NW2A 4QIWB 3X3NA 2KVMA 2L4NA 1STBA 1FNVA 5DM73 3KLSX 4XT1B 4IZ8A 3HS0C 3E5SA 1EY8A 2JE6I 5IT9L 1STGA 2WKDA 4G4KA 1V1PA 3S2DB 1RODA 2VXWA 3FVQA 4K6LA 1IKMA 4WJWA 5IODA 3Q23A 2IJ0A 5C6AA 4ZAIA 1JC7A 2E74C 5JVG3 2VNUD 3CQZB 4PMBA 1X32A 1RTOA 1U4RA 5CMDA 1QG7A 3FKIB 5FK9C 3DXJC 2BDNA 1GUSA 4HCSA 2K28A 1LTID 1LABA 4IUNA 4PMWA 4AYBB 2K03A 2IX3A 3MAQA 4FF3A 3KBXA 3HRZC 1SBBB 2SOBA 2DNEA 5I6WA 1BO0A 4BY1B 3TSSA 3K7AB 5CV9A 4QUCA 1CM9A 4CJ1B 2F4IA 3RD4A 1C48A 3ONAB 4F8MA 2G9HD 2N55A 3M4YA 4DGZA 2D62A 2CVRA 2B63B 1CHQD 4ABNA 5IGBA 3G7LA 4LAAA 5C3WA 5C0XJ 2PNRC 4IFDJ 3O13A 3D6WA 2V4DA 5KYIA 2TMPA 2RSOA 3OMGA 4R9WA 3T53B 3GTJB 3T16A 3GTOB 1YNND 1RDPD 1GHKA 1AFPA 4TRDA 1SMYC 3Q0AA 4OO1H 4EQPA 3V05A 1SNPA 2FHTA 4L63B 2X6GA 1LT6D 3OSOA 4FP5D 4ZK9B 3HGBA 3VR6A 1YNJD 1JWUD 3VR5A 2NVQB 3D6CA 4Y7NB 5LHY1 2K7VA 3SK8A 3D4RA 5EBCA 3K58A 5CV5A 4NKLA 1SEBD 2QCPX 2BE5D 3QOLA 4K8JA 3DUZA 3NE5B 3GD7A 1V43A 4X3TA 2NN6H 1KDBA 1A3UA 4FF4A 2F0FA 3SVMA 3C46A 1LTAD 2RA4A 4J6HA 3GP7A 1DM0B 1GUWA 5C4ZA 1O80A 1EYCA 2B8FA 2RSNA 3KK7A 4YIJA 1TWHB 3VYSA 1A15A 4XYOA 4RAUC 4HSVA 3ITPA 2DN8A 4Z9CB 1S5BD 4S3SA 2JA8B 4IFDG 1LTSD 1EY7A 1MBYA 1C4QA 3OIPA 1BCPB 3IFDA 1LTRD 4LK1C 2F0HA 1B9MA 2Z4IA 4CKCA 3KLRA 1STEA 2R93B 2KHSA 2F0GA 4LMQD 3MWYW 1WTOA 1XWEA 3M85A 4HEDA 4ME5A 1DOMA 2NUCA 1AN8A 1TT2A 3U9OA 1QJOA 2G9DA 1O7ZA 2IT1A 4IFDI 1I4XA 1KLGD 4C1NI 4OGQC 1HQRD 1KLUD 5JJZA 4JK1C 3J81E 4KTAA 3GTKB 2I46A 5CBAE 1F2MA 2BE5C 4EQOA 4A3JB 4FXDA 3GQBA 1F2YA 4Q0FA 2QDBA 4UAIA 4KY7A 3D3RA 1TS4A 2O4XA 4C3HB 3OW7A 2BA1A 3PMFA 2RVLA 3BDCA 2XN9C 3KLSA 1FNUA 3K0YA 1G2SA 1I4HA 1PFMA 4A3DB 2J0TD 3GO5A 3PUXA 4ZUIA 2O2LD 4CBVA 3RMHA 3FRPB 1E2WA 2ZXPA 5FOBB 5C0XH 4EVOA 3CKIB 4EQNA 1AW7A 2XNAC 3A8JE 4F87A 4OHJA 3DWPA 4XDXA 1O7LA 3HEJA 1NR4A 2F0PA 2WV6D 5C3XA 1UNSA 2MUYA 1EQVA 1D5MC 1TWCB 2Z4HA 2B2VC 2EY1A 5EPKA 1Y8OB 3MTSA 5I9OA 1HA6A 2RDHA 1G91A 2F0IA 4HTHA 4IN3A 3DEOA 1BOSA 2E2IB 1JWMD 1HA5A 1PZID 2SEBD 2AQ2B 2XRSD 3SE0A 1NCVA 4CGYB 2A69C 3TZUA 1R4PB 2NYZD 1F2ZA 3CRKC 1Q1BA 2B2TC 3S15B 1V1PB 1Y8PB 2F3WA 3VA7A 2BOSA 4RGNA 4OO1G 2A6ED 4CJ0B 3N6RA 2BDOA 3S2HB 2B2YA 1F2LA 5KYLA 3TN2A 4I65A 3OWFA 2DNCA 2LMCB 1XTCD 3NBHA 3NWSA 4DXFA 3GTLB 3VR2A 1EY5A 3CU7A 4IURA 1F9QA 4GZYC 1KDCA 4HCEA 4B9WA 3FPPA 2JA6B 1BCPF 1STHA 1G291 3P1HA 3BDLA 3PIP3 1HFGA 4MIUA 1CTMA 1TIID 3IFTA 3QG1A 4OIKA 1PYWD 2CHBD 1JCKB 2H4OA 1MSHA 1D1KA 2F0TA 5K5PA 1TU2B 3S1RB 3PO2B 3HG9A 1EYDA 3ND9A 1ZXTA 1G2TA 3I70A 3E6ZX 1I3QB 2KCCA 1EY4A 1TS5A 1TWAB 1LT5D 4RCOA 4R8NA 1SYBA 1SJHD 1ENFA 3TZDA 1X3QA 3SR1A 5I4DA 4HMIA 1K8OA 3H09A 2VB3X 4M1UB 2K5DA 2KQ3A 3BYYB 1HQMC 2F03A 4C2MB 1EIGA 5ELDA 2AWNA 1PTOH 3W3AA 1KABA 4DK1A 1HTPA 5I2XA 4C1NK 2K1BA 2PQEA 4ZLTF 4BA2I 4KD4A 3T51B 4XQJA 2EY2A 1Z6HA 1B9NA 4KKUA 1EY0A 1H9MA 2L9HA 3NXWA 4C3IG 3GTGB 4K2KA 3H3VC 1LO5D 4A3MB 5JPMC 3BS1A 1S5FD 1BCPC 3VYUA 1BUVT 3H94A 4KHZA 3Q6SA 2Y0SB 1SYGA 1PMRA 2LS01 1EY6A 3CRLC 5E3FA 2IX0A 3UI2A 3EJIA 5G3LD 1JB3A 1B50A 5G3LF 4ODGA 1VMPA 2GA4B 3D4WA 3SXHA 4H0LC 4IFDH 1NSNS 1AZPA 2Q8IB 3KUPA 2L0CA 1ENCA 3MZ5A 3I72A 1EIHA 4RGTA 2NWGA 4J1MA 2EYHA 1JORA 2FJ2A 3MXNA 1DYQA 2BA0A 4G7HC 4M8AA 1TWFB 1UEAB 2F0KA 4XYQA 1S5ED 2F0EA 1K8MA 4IUVA 3NP8A 2BCOA 1HTLD 2AUKA 1PTOD 1SAPA 1STYA 2F1MA 2R6GA 1IYVA 1OXVA 2A68D 2HQEA 2K32A 2F0SA 1GHJA 3QJYA 5J22A 4NMZA 2TSSA 4A3EB 3DM1A 5C44B 1UUPA 1PTOF 5FO8B 3R2TA 2Q8RE 1D5XC 5C0XI 3EROA 2B2TA 2F0LA 2JP1A 1WD0A 3I4NB 2NVXB 2A69D 2X6LA 2B39A 4H44C 5ELEA 3L3OC 1AP0A 1YNJC 4C3HG 4K14A 4RGOS 1EU4A 2RQXA 5EGTA 5M3FB 3CHBD 4ZRZA 3N52A 1QE6A 3A55A 5JEAJ 4K5XA 2HCCA 2WACA 3WOEA 5E4XA 5ELBA 3JAML 4FVMA 4DAVA 4OIJA 4KY6A 3TP7A 2M2LA 4DA2A 4FNFA 2F0JA 3NHHA 5EPLA 3E0JA 2Z1CA 1LTTD 4MHEA 5CBEE 5KEEA 2NVTB 1FGBD 5D14A 1NR2A 1JE4A 4KI0A 1IHZA 1TQOA 2AUJD 5DEHA 2M00A 2A5HA 1RHPA 4XXEA 2NBFA 2MPMA 1JICA 3PUWA 1SFOB 1GXDC 3MFGA 1ICWA 3KF8A 2ZXOA 3C2PA 1TWGB 1PZKD 2MJ8A 5IGFA 3NTIA 3T56B 4XQQA 1OXTA 3M4OB 3LX0A 2E2DC 3HOWB 3IL8A 3TP5A 4FXKC 1O78A 4A3IB 4PNYA 3H91A 1SNDA 4RCNA 3X3MA 4K2LA 1MSGA 2EJGC 4DFAA 3AU7A 3D31A 3K57A 3P20A 2F3VA 2XSCA 2KECA 1VF5C 1OXXK 2K05A 2ICIA 4V0BA 4KN4C 4WFN3 3S1MB 4PMCA 2PZUA 2K04A 1M8AA 3SK4A 2R7ZB 1TY2A 4FO2A 4KN7C 4L6TB 1E2VA 4DAPA 1LLRD 5C5MA 1BR9A 4H7BA 5M5WB 1HUMA 1SNOA 1Y8NB 3I90A 4EGVA 3GTMB 1CFMA 2PO4A 2LFNA 3C1EA 1I4GA 1XYIA 1DCZA 2IPKD 5FO9B 5CV7A 3MC0B 1HFNA 1Z47A 1S5CD 1D6EC 1GOZA 1ONLA 1QB5D 4DNRB 5DAUA 3I91A 1GJXA 2R61A 1WCMB 1D2BA 3EVQA 3VR4A 3A54A 2EYMA 4K6DA 5JPNC 3R3OA 5K36G 4BBSB 4PV1C 4FF2A 5EKKA 4BS9A 1L0XB 1ET9A 1EY9A 1ET6A 4KMUC 2JEBI 3SK5A 3TMEA 4CHTB 2PW5A 3TDQA 2L55A 2D2CC 5EJWA 1KNAA 4FF1A 1SSOA 1SYEA 4O42A 3I8ZA 1U9RA 3FPUB 1XXGA 1GUOA 1PFBA 3V2TA 2SDFA 3D8GA 1CHPD 1CZGA 1T5EA 3NSWA 3M7NA 2DY7A 3Q22A 1DJRD 1DD2A 5J1ZA 3OWEB 2J7ZA 2RDGA 1IL8A 1HXYD 1QWYA 1CQFA 3S14B 1I4RA 2PW7A 4J8QA 3NWTA 4H13C 2B2UC 1H9KA 3GV6A 3AB9A 3MHBA 3P75A 5DM63 1CZWA 3BVGA 1W6KA 1I4QA 2FMMA 3MEHA 2ZXRA 1Q8IA 2E76C 1SJED 1JQYD 3BDOA 4OO1I 1PRTC 2K01A 1ZEQX 2F0UA 3GTQB 3GV3A 3A7LA 3H0GB 3FDTA 2SNSA 1BDOA 1IW7D 4ZUJA 4A93B 2AQ1B 1X3PA 4K5WA 1J8IA 2B2WC 1BCPD 4BWGB 2WKCA 2KCNA 3OMCA 4F88A 1CA6A 4RKBA 2XWBB 1A3TA 4CJ2C 3NTHA 1EEFD 2RBMA 2KJXA 1SYDA 1T5XD 4QCLA 1EZ6A 2F0OA 2WP8J 1J9OA 2A6EC 2LY7A 3NQIA 3V96A 1ILPA 4KY5A 4DK0A 5IOCA 5M3MB 5CYUA 4P2CB 4A3FB 1DOLA 1WTVA 3HOUB 1SNQA 3NUCA 4XIGS 5I2YA 3NPPA 2JA5B 4BBRB 3W2DA 5JEAH 2JYOA 5M9OA 2OXPA 3K5OA 1BNZA 3IKJA 3PO3B 4N9TA 4ZQ3A 1HCZA 1FR3A 5KRUA 2K6AA 3BVZA 3ZYYX 4R8IA 3K6OA 4RWSC 2PPBC 3J81L 1U4LA 5CV6A 3M3YB 2EJFC 2PCFB 2MHVA 4ZYSA 1EU3A 3I4LA 3J7AV 4LJZC 1EEID 3A8KE 3R2IA 4B9XA 3VA5A 4X3SA 4IUPA 1F9PA 4HN7A 4A3BB 2EDGA 3HP3A 5T1GA 3EA6A 3VYTA 4C56C 4O1NA 2KOLA 5LL6X 4U673
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6W A;  1Q3L A;  1RHP A;  4CJ2 C;  1PFM A;  2X69 A;  2KVM A;  2K1B A;  4IUU A;  1SAP A;  5COR A;  4CJ0 B;  2L4N A;  1E0B A;  2HCI A;  2MPM A;  2RSO A;  2B2Y A;  1JIC A;  4R9W A;  4ZKB B;  4ZLT F;  2KED A;  1B2T A;  2EOT A;  1F2L A;  1HUN A;  2H1E A;  4XT1 B;  3TN2 A;  4NW2 A;  1BF4 A;  1ICW A;  2FIN B;  1SDF A;  1C8C A;  3LWE A;  1J9O A;  1DOK A;  3DM1 A;  2B2V A;  2L9H A;  3IFD A;  1TVX A;  2MJ8 A;  5EJW A;  4DN4 M;  1CA5 A;  1RJT A;  5COY A;  1KNA A;  5E4W C;  1SSO A;  1KNE A;  1PDQ A;  1ROD A;  1ILP A;  2VXW A;  1PFN A;  4HSV A;  2FHT A;  1S4Z A;  2Q8R E;  4O42 A;  1IKM A;  1RTN A;  2L12 A;  2X6G A;  1HRJ A;  3I8Z A;  2B2T A;  4IUR A;  1F9R A;  1F9Q A;  1QNK A;  3FPU B;  2JP1 A;  3IL8 A;  4ZK9 B;  4X3U A;  1WD0 A;  1PFB A;  1WTQ A;  2N88 A;  2L1B A;  1DOL A;  2SDF A;  3I3C A;  4MN3 A;  4ZAI A;  2B2W A;  1IKL A;  1WTV A;  4XDX A;  1VMC A;  3Q6S A;  2X6L A;  2HUG A;  3H91 A;  3MWY W;  1LV9 A;  4LMQ D;  1EOT A;  1NR4 A;  1EQT A;  1WTO A;  2DY7 A;  1B3A A;  1MSG A;  1HFG A;  1NAP A;  1X32 A;  2R3Z A;  4HED A;  1WTP A;  1F9S A;  2J7Z A;  5EQ0 A;  2B2V C;  1B53 A;  3UI2 A;  1IL8 A;  5DNF A;  2Q8T A;  1DOM A;  2L11 A;  4OIK A;  5EPK A;  4ZKC B;  1AP0 A;  1RTO A;  1U4R A;  5CMD A;  2JYO A;  3MTS A;  1MSH A;  5EPJ A;  1ML0 D;  1BNZ A;  2B2U C;  5D65 A;  2KEC A;  1BBX C;  3GV6 A;  1O7Z A;  1B50 A;  2EE1 A;  1QG7 A;  1HA6 A;  1VMP A;  2BDN A;  2K05 A;  1WTR A;  1G91 A;  1O7Y A;  1MGS A;  2K28 A;  4HCS A;  4XT3 B;  5JJZ A;  4R8I A;  5AFW A;  2FMM A;  1MI2 A;  1ZXT A;  1G2T A;  2K03 A;  2K04 A;  5CBA E;  1ESR A;  3N52 A;  1M8A A;  4RWS C;  1AZP A;  1QE6 A;  4X3T A;  3DEO A;  1U4L A;  1U4M A;  2FFK B;  2NZ1 D;  5T1I A;  2HCC A;  3KBX A;  3KUP A;  5E4X A;  1PLF A;  2K01 A;  1WD1 A;  1DON A;  1XX8 A;  2XIW A;  3DEP A;  3GV3 A;  2MGS A;  3FDT A;  2DY8 A;  1HUM A;  1EIH A;  1NCV A;  1BO0 A;  3I90 A;  4IUT A;  4OIJ A;  4UAI A;  3TZD A;  1X3Q A;  2NWG A;  2MP1 A;  5EKI A;  2M2L A;  4QUC A;  1X3P A;  2IL8 A;  1G6Z A;  2D9U A;  1WVL A;  1CM9 A;  3SVM A;  3R93 A;  2FJ2 A;  4HAE A;  2EPB A;  4CJ1 B;  1EL0 A;  1DZ1 A;  1HHV A;  1U4P A;  4QUF A;  2NYZ D;  1XYI A;  4U68 A;  3ONA B;  4X3S A;  2B2U A;  2KEE A;  2N55 A;  2RA4 A;  4RA8 A;  5EPL A;  1J8I A;  1HFN A;  2B2T C;  2B2W C;  1F9P A;  4IUP A;  2CVR A;  3P7J A;  4X3K A;  1GUW A;  1EIG A;  1O80 A;  1B4O A;  2B2Y C;  2RVL A;  4MHE A;  5CBE E;  2KUM A;  1WTW A;  3QO2 A;  5D14 A;  2HDL A;  1NR2 A;  1WTX A;  1JE4 A;  5T1G A;  3HP3 A;  2RSN A;  1CA6 A;  3F2U A;  3G7L A;  4IUV A;  1ILQ A;  1A15 A;  2KOL A;  3I91 A;  1G2S A;  1AZQ A;  4RAU C;  4IUQ A;  2HDM A; 
#chains in the Genus database with same CATH topology
 4DPG A;  4IUU A;  2KCT A;  2XWJ B;  2NB0 A;  1J5E L;  5C4X B;  4ULL A;  4DR3 L;  3ND8 A;  2EOT A;  1WCM G;  1LT3 D;  3EQL C;  4IAL A;  2H1E A;  1S3O A;  2PMZ B;  1GUT A;  2FIN B;  3MFY A;  2DGY A;  3PUZ A;  3LWE A;  2ID0 A;  5IWA Q;  3L9A X;  3LNN A;  2VQE Q;  4KJN A;  3D4D A;  4GS3 A;  1II3 A;  4FXG C;  1AEX A;  2VQF L;  1SLJ A;  1A2T A;  2M9V A;  2YU9 B;  1IXR A;  4BBS H;  2F0D A;  4X62 L;  3OOC A;  1G51 A;  4LWC A;  1M4V A;  2B2W A;  3MVV A;  4KKS A;  2EY5 A;  2K33 A;  1B3A A;  1A6X A;  5IYC G;  4K0K L;  1R4Q B;  3Q24 A;  3RZD B;  4QF4 A;  4G7O C;  5FLM G;  4F7X A;  5JOB A;  1ML0 D;  1TWF H;  4H02 A;  2CW0 C;  3S9W A;  1WTR A;  2QIL A;  4CDF C;  1JOO A;  1N9W A;  4XT3 B;  4OX9 Q;  3GTG H;  1SNC A;  4KHV A;  5AFW A;  3EIV A;  1EYG A;  4EX5 A;  2RHS B;  1YHQ A;  1TS3 A;  2FMC A;  1PTO B;  1V8Q A;  5IGC A;  1PLF A;  2C5C A;  3M4P A;  4AYB E;  3L0O A;  1LUZ A;  4V19 0;  2EXZ A;  5CV4 A;  5EKI A;  5IT9 c;  3NQT A;  1G6Z A;  2D0P A;  4A3G B;  5E1F A;  5FO7 B;  1R9T B;  2EPB A;  1JR0 D;  4RH6 A;  4DV3 L;  2PQA B;  4RA8 A;  3T1H L;  4CKB A;  1EFI D;  4K5V A;  1OO9 B;  3I4M B;  3E3X A;  4C3J G;  3M7G A;  4HSP A;  1IYJ B;  1WTW A;  4LFC Q;  2HDL A;  1WTX A;  2JEA I;  5LMU Q;  1JE5 A;  3F2B A;  1YI2 A;  1Y69 U;  1SMY D;  1QIL A;  3R8B A;  1Q3L A;  3HOU H;  5COR A;  2I5M X;  5CC4 A;  1I5F A;  4JCV E;  2QF7 A;  2HCI A;  1TWG H;  1VQO A;  4A3F H;  2NN6 I;  1DXM A;  4ZKB B;  1B2T A;  5C4X H;  2UUC Q;  4NXM L;  4GKK Q;  4DR3 Q;  3U9S A;  4DU9 A;  4G7Z C;  4B3S Q;  1PTO C;  1NE3 A;  4B3R Q;  1PDQ A;  2Z8L A;  4DF7 A;  1EFW A;  1K83 B;  4JI5 L;  3OTO L;  5ELF A;  4JI4 L;  4A3K B;  2Z6B A;  5D3I B;  4LF8 Q;  4DV6 Q;  3I3C A;  2L1B A;  3G6J B;  3NEM A;  1P8L A;  1A8V A;  2E2H B;  1VMC A;  5KNC A;  1BXT A;  4NXM Q;  2VUM G;  4GKK L;  2QDL A;  4L5R C;  3QIA A;  4YHH Q;  1IYU A;  4APV A;  1NUC A;  2L11 A;  3HOV B;  5IGG A;  3DWQ A;  1XPR A;  3BYT B;  4KD3 A;  3DWA A;  4LW1 A;  2Q2T A;  4POF A;  1H9S A;  1MGS A;  1RD9 D;  1ASZ A;  1V9P A;  4C3J B;  3SDZ A;  4A3G H;  4BY1 H;  3K7A H;  1ESR A;  5IIF A;  2XRQ D;  1K0R A;  3H0G H;  4CKE A;  1YJN A;  2NZ1 D;  1IBM Q;  2NTT A;  4WRD A;  1B70 B;  4IJH A;  5LL6 S;  1DON A;  3PO2 G;  4PZ8 A;  2MGS A;  1STN A;  2DY8 A;  2R7Z G;  2EJM A;  4LNQ A;  2MP1 A;  2WAQ B;  4PQX A;  3SK6 A;  2EYJ A;  4NPS A;  2I5L X;  4JI4 Q;  1EZ8 A;  2UUB Q;  5ISR A;  1KTK A;  4B08 A;  2WAQ E;  4X3K A;  5C0X G;  1B4O A;  2IX1 A;  2B3G A;  3TP6 A;  3CC4 A;  1RKN A;  1CQV A;  3RUZ A;  5CV8 A;  3K5L A;  1AZQ A;  3J7A F;  2X69 A;  1V1O A;  1NJI C;  5JJL A;  2IW3 A;  2JA7 G;  4L8J A;  2F0M A;  4DV1 L;  5IGE A;  4DR1 Q;  1HUN A;  2B8G A;  4KHP L;  1BF4 A;  1SDF A;  4DK6 C;  1VQ7 A;  1EWC A;  1VQP A;  2B2V A;  3H6M A;  4BXX H;  1JOQ A;  1CA5 A;  1RJT A;  2HIV A;  2NTS A;  1WCM H;  3NBH B;  4A3E G;  2PYK A;  1WJJ A;  5KGU A;  1B44 D;  2SNM A;  3BZD B;  1STA A;  1G8Z D;  2N88 A;  1PXU A;  1PRT F;  1L0Y B;  1SR3 A;  3NK9 A;  1IW7 C;  1RF2 D;  1EOT A;  1EYA A;  1WTP A;  3SHL A;  4GNX C;  2OT2 A;  3HFZ B;  5BR8 L;  1JWS D;  5HUR A;  4P75 A;  2BH8 A;  5DNF A;  3ZJY C;  1GM5 A;  2JA7 B;  4YCV A;  2QKI C;  3S16 B;  3U58 A;  4B3T Q;  3K59 A;  2J4X A;  4IOC A;  3GTO H;  1BVS A;  5EPJ A;  1SNM A;  4LUV A;  4UP9 A;  2KCM A;  2PI2 A;  2EE1 A;  1IBM L;  4KK7 A;  1Y1W H;  1KHI A;  5BN4 A;  3H15 A;  3RZO B;  2G5D A;  3MA2 B;  3S1Q H;  4DNT B;  1JJ2 A;  3LWU A;  5F2D A;  5HGT A;  4BY7 B;  3A8I E;  3J80 L;  1PH3 A;  1CKN B;  1BBW A;  1QUQ A;  1U4M A;  4XTC S;  3OHX C;  4QY7 A;  2NN6 G;  5ELC A;  1PH6 A;  2KA7 A;  4X65 Q;  3H3V I;  2PZW A;  2JA9 A;  2EYO A;  1CI3 M;  3BG3 A;  5KND A;  2F0N A;  1MD2 D;  4WOR A;  1WVL A;  3TBI B;  3R93 A;  2O5J C;  4OL7 A;  4HAE A;  1H9S B;  1L0W A;  1U4P A;  4U68 A;  3L7Z C;  5JEA G;  1RCV D;  2KEE A;  3I4M H;  3JAM E;  1LTB D;  1S5D D;  3HKZ B;  4LF7 Q;  2NVY B;  1SYC A;  5ELN A;  4A3L H;  3GTQ H;  4KKT A;  2CQA A;  3QO2 A;  5M5X B;  1FD7 D;  5TSS A;  4UY8 C;  2OEO A;  5CR3 A;  2K5V A;  2AQ3 B;  3HOZ H;  4BY7 G;  1FGU A;  3DHQ A;  4TQU S;  1UEB A;  3SEB A;  1E0B A;  1YNN C;  1KAA A;  1HPC A;  2VQF Q;  3ERQ A;  1Q90 A;  3D0F A;  2PNH A;  3HZX A;  4TVA B;  4X66 Q;  1KD1 C;  1SE4 A;  1W6J A;  4NXN Q;  3AMU A;  1DOK A;  1PRT B;  1XJV A;  1TVX A;  1TS2 A;  3I4N G;  5KIX A;  1H9R A;  3W1B A;  2AHO B;  1S4Z A;  1TY0 A;  4DUZ L;  4TKO B;  3M9B A;  4RFB A;  2O5I C;  1F9R A;  2A19 A;  2UXB Q;  3CC7 A;  4X3U A;  4DUY Q;  1N33 Q;  2ENB A;  3QOJ A;  5BN3 A;  4HR7 B;  5IYD G;  3S24 A;  1E2Z A;  1UWV A;  2ZM6 Q;  2A6H C;  3PF4 A;  1E1O A;  3MXG A;  1EIY B;  4DV5 Q;  2P5Z X;  3KDF B;  3PUY A;  3BU2 A;  4JI0 L;  2CWP A;  4ZKC B;  3T4A C;  1GUG A;  2E75 C;  2A1A A;  2YYZ A;  1SE3 A;  1SXT A;  3A56 A;  4JW0 A;  1M90 C;  1N34 L;  3A7A B;  5D65 A;  2WII B;  1VQN A;  4JV5 L;  4NP5 A;  1QCB D;  1I4P A;  3Q8D A;  4UP7 A;  3CPF A;  4P71 A;  2ZM6 L;  3ERS X;  4JI8 L;  4KV6 A;  3F1Z A;  1HR0 Q;  2RKS A;  1LT4 D;  3PO3 G;  4QL5 A;  4HJ8 A;  3MXU A;  4ID6 A;  4JI3 L;  3NTK A;  5C5L A;  5BN5 A;  4B3M Q;  1KAW A;  2H5X A;  5C3E B;  4YWM A;  3SGI A;  3VR3 A;  4XQN A;  2KBN A;  2XGT A;  5J3B A;  2DUD A;  5I9P A;  1NMG A;  1K3R A;  4GOP C;  2ZJP A;  4IUT A;  1IBL Q;  2JXM B;  5A2Q E;  3TS2 A;  1UE1 A;  2F0Q A;  1BBU A;  1YEZ A;  2QEJ C;  2I07 B;  1DZ1 A;  4QUF A;  1VDZ A;  1DGS A;  4N8F A;  1YHB A;  1ZYR C;  2L5T A;  3QB3 A;  4DAY A;  4KJO A;  3P7J A;  4IQZ A;  2B29 A;  1TR5 A;  2VB2 X;  4EQ5 A;  2R92 B;  4AYB G;  3OYY A;  3NEN A;  1F77 A;  1I94 Q;  2YTX A;  3FKI G;  4JBW A;  5LMN Q;  5IT9 E;  2LKV A;  1S72 A;  4DN4 M;  2VUM B;  2C9O A;  3WOF A;  1LM0 A;  3URY A;  4GLX A;  4LF9 Q;  1B7Y B;  4RGM A;  1D1I A;  1QVC A;  3CC2 A;  4BY1 G;  1CSQ A;  1ESF A;  4DR5 L;  2D5D A;  1TKW B;  3PCO B;  1GUN A;  3OPO A;  1A3V A;  2N49 A;  5JAV A;  1QUQ B;  1AH9 A;  4WJ4 A;  1VQC A;  4BBR H;  5COY A;  5E4W C;  4JOI C;  2YTV A;  3GTP B;  1KNE A;  2A73 B;  3K5M A;  1FYC A;  1PFN A;  4G57 A;  4BA1 I;  5A35 A;  2JJQ A;  3PO3 H;  4N9P A;  4A75 A;  2F0W A;  1QNK A;  3K0X A;  4PG3 A;  3K5N A;  4C3I B;  4MNO A;  2XVS A;  2WAQ G;  2JK8 A;  1GO3 E;  3CP0 A;  5EBD A;  3FMC A;  2HUG A;  2WB1 B;  2JSO A;  1EQT A;  1K83 H;  5HGQ A;  1NAP A;  1KDA A;  5EQ0 A;  1X54 A;  4NB3 A;  2Q8T A;  1OXU A;  2MO0 A;  4FYD A;  3J7Y W;  4X65 L;  3HOU G;  3J80 E;  3M4Q A;  3S1N B;  1YBY A;  1BQQ T;  3K81 C;  1O7Y A;  5IE8 A;  2JA5 G;  4DNI A;  1I6H B;  1HNZ L;  1I6V C;  1O7I A;  5GAG C;  1QOH A;  1U5K A;  1CT1 D;  5FKA C;  4DR2 Q;  3HOZ B;  5JJK A;  1SMX A;  2CQO A;  2EY6 A;  3J7Z C;  1JJG A;  2FFK B;  3CCM A;  3S17 B;  5GAH C;  4RKL A;  4RHR A;  5CGK A;  4JV5 Q;  2XIW A;  3DEP A;  5A2Q L;  5J39 A;  4HIK A;  4UP8 A;  3JC6 6;  4GKJ Q;  3WDN A;  4BBS G;  3KF8 B;  3BZC A;  4K8I A;  2K14 A;  4L5T A;  2C35 B;  1H9J A;  3I73 A;  1KQS A;  3GTL H;  1B1Z A;  4NDX A;  4O0A A;  4UDU C;  1UAP A;  4L5Q A;  2IHE A;  1XNR Q;  2A6H D;  2V1C C;  1NY4 A;  1BKB A;  3K80 C;  3HOV H;  1FJG L;  3EFX D;  1SYF A;  2OF1 A;  3F2U A;  1VF7 A;  5K36 H;  1K8A C;  1QNU A;  5IGD A;  3I4M G;  4IUQ A;  2HDM A;  1Y1V G;  3FEW X;  3J81 c;  4FDB A;  1IZ6 A;  2YTY A;  4MZ9 A;  1C0A A;  4IJL A;  1K0S A;  2F0V A;  2KED A;  4DV3 Q;  1PV4 A;  2ZJQ A;  3KJP A;  4DV0 L;  4AH6 A;  3DM3 A;  1C8C A;  5JVH 3;  5DLQ E;  4KLK A;  3ULL A;  2E2J H;  1HR0 W;  2A74 C;  2EYP A;  2ICE C;  3G71 A;  4I7Z C;  3MXN B;  2L15 A;  5FLX L;  5KNB A;  4LF8 L;  1Q1E A;  1LAC A;  1EWH A;  3CCS A;  1HRJ A;  1RTN A;  2L12 A;  4DXG A;  1WYD A;  2RDF A;  1A2U A;  4TSS A;  1WTQ A;  4GN4 B;  3T1Y L;  1Y1W G;  4MN3 A;  1IKL A;  3C1F A;  3ICE A;  2ZT9 C;  4PZ6 A;  1NMF A;  2WIN B;  1LV9 A;  3DMU A;  1Y1V B;  4Q5V A;  2JN4 A;  5EKL A;  4B3S L;  2R3Z A;  4DAY B;  2PZT A;  1F9S A;  4A3L G;  1EQQ A;  2EYF A;  3CME A;  1B53 A;  4A3D G;  2AWO A;  5C4H A;  2A68 C;  1C9O A;  3TP8 A;  4ILW A;  3RLF A;  1PZJ D;  1BBX C;  1LTG D;  3KBG A;  3VYR A;  1SE2 A;  5FLX E;  1PYS B;  5M5Y B;  1JOK A;  3C3L A;  4JOI A;  1MI2 A;  4HJ7 A;  4X62 Q;  1YJW A;  1CK1 A;  4QMG A;  4QB4 A;  2EZV A;  3NBI A;  2N78 A;  5T1I A;  3MXP A;  2CW0 D;  3BVM A;  4HMJ A;  1Y1W B;  1Z7T A;  4E6I A;  1WD1 A;  1Q8K A;  1XX8 A;  5D3D A;  3FKI H;  2ZJR A;  4OWT B;  4OXP A;  3T13 A;  1I50 B;  1D5Z C;  5C4J B;  1ICF B;  4DV4 Q;  3HOY B;  4RHS A;  5NUC A;  2IL8 A;  2D9U A;  1PH5 A;  1ZKO A;  1Q12 A;  3PO2 H;  1EL0 A;  1HHV A;  3RZO H;  3S1Q B;  1ENA A;  1GKH A;  2EYL A;  1E3P A;  2B2U A;  1OXS C;  2K5Q A;  3PUV A;  1Q46 A;  4K0K Q;  5I6Y A;  1VCI A;  1X9N A;  1FNW A;  1PRT D;  3PIO 3;  2B2Y C;  4LFA L;  2CH4 W;  2EVB A;  2KUM A;  4IO9 A;  3G48 A;  2IWH A;  2ATW A;  1AE2 A;  3IAY A;  3OIQ A;  2K5W A;  1ZYR D;  2E5L L;  2BH2 A;  2E2J B;  1ILQ A;  1X3E A;  3PV0 A;  3QWN A;  3HOX B;  4NW2 A;  4QIW B;  4LF5 L;  4IOA A;  3X3N A;  5C4J H;  4JI6 L;  2QEX A;  3E0E A;  2KVM A;  1Q7Y C;  2PI2 E;  2L4N A;  4LUZ A;  4X64 L;  1STB A;  1FNV A;  5DM7 3;  4C3I H;  1A62 A;  1HZB A;  4HJ5 A;  1VQL A;  2B63 H;  3KLS X;  4XT1 B;  4IZ8 A;  3HS0 C;  3E5S A;  1EY8 A;  2JE6 I;  5IT9 L;  1STG A;  3CXC A;  2WKD A;  4G4K A;  3UDX A;  1V1P A;  2HHH L;  3S2H H;  3S2D B;  1I94 L;  4HJA A;  1ROD A;  2UU9 L;  2VXW A;  3HOX H;  3FVQ A;  4K6L A;  1B3Q A;  1IKM A;  4WJW A;  5IOD A;  3Q23 A;  2IJ0 A;  5C6A A;  4ZAI A;  1JC7 A;  2E74 C;  5JVG 3;  2VNU D;  3CQZ B;  1VQD A;  4PMB A;  1X32 A;  1AE3 A;  5IWA L;  1SRU A;  3GTK H;  4YHH L;  1RTO A;  4A4I A;  1U4R A;  5CMD A;  2R92 G;  2EIF A;  4LF9 L;  4A3M H;  4L5S A;  1QG7 A;  3HKZ G;  3FKI B;  4GNX B;  5FK9 C;  3DXJ C;  2BDN A;  1GUS A;  4HCS A;  2K28 A;  1LTI D;  1WFQ A;  1LAB A;  4IUN A;  4PMW A;  4AYB B;  4OEM B;  2K03 A;  2IX3 A;  3MAQ A;  2JQO A;  4FF3 A;  3KBX A;  3RLN A;  3HRZ C;  3OW2 A;  1QZG A;  1SBB B;  2WB1 E;  2SOB A;  3CAM A;  2DNE A;  5I6W A;  4JI0 Q;  1BO0 A;  3I4O A;  4QQB X;  4BY1 B;  3TSS A;  3K7A B;  5CV9 A;  4QUC A;  1CM9 A;  4CJ1 B;  5M5X H;  1YVC A;  2F4I A;  3KFU A;  3RD4 A;  1C48 A;  3ONA B;  4F8M A;  2G9H D;  2N55 A;  3M4Y A;  4DGZ A;  2D62 A;  4JI2 L;  2EXD A;  4DUY L;  1N33 L;  4DV6 L;  3TRE A;  2CVR A;  2B63 B;  1QVF A;  2Q2H A;  1CHQ D;  3GTP H;  2QA4 A;  4ABN A;  2K5N A;  2VUM H;  5IGB A;  3G7L A;  1WI5 A;  4LAA A;  5C3W A;  5C0X J;  2PNR C;  4IFD J;  3O13 A;  3D6W A;  2V4D A;  4A3I H;  2UUA L;  1MHW C;  4LF4 L;  4JC0 A;  5KYI A;  2TMP A;  2RSO A;  3OMG A;  4R9W A;  4BXX G;  3T53 B;  4DAM A;  4DR5 Q;  1Z9F A;  3GTJ B;  3T16 A;  1EQR A;  2VY3 A;  3GTO B;  1YNN D;  2R7F A;  1RDP D;  2E8G A;  1GHK A;  1TWH H;  2DJF C;  1AFP A;  4TRD A;  1SMY C;  4UPA A;  3Q0A A;  1YNX A;  4OO1 H;  4EQP A;  3V05 A;  1SNP A;  2PQA A;  2FHT A;  4L63 B;  1Q82 C;  3GTJ H;  2X6G A;  2F4V Q;  1LT6 D;  3OSO A;  4FP5 D;  1W2B A;  5HY6 A;  4ZK9 B;  3HGB A;  4PZ7 A;  2NVY H;  3VR6 A;  1YNJ D;  2E2I H;  1JWU D;  3VR5 A;  3JAM c;  2VZA A;  2HHH Q;  2NVQ B;  1K73 C;  4GNX A;  3D6C A;  4Y7N B;  5IYC H;  3FP9 A;  1JMC A;  5LHY 1;  2K7V A;  3M3Y H;  1XNQ L;  3D4R A;  5EBC A;  3SK8 A;  2WB1 G;  3CCJ A;  3K58 A;  4R4O A;  1PH4 A;  5CV5 A;  2UXB L;  4NKL A;  1SEB D;  2QCP X;  2QW7 A;  2BE5 D;  3QOL A;  4K8J A;  3DUZ A;  3NE5 B;  1E1T A;  3GD7 A;  4R4I A;  1WTH A;  1V43 A;  2NVQ H;  4X3T A;  2NN6 H;  1KDB A;  1P16 A;  1PFS A;  1A3U A;  1VQF A;  1TWA H;  1WOC A;  2UUB L;  3W5O A;  2MFI A;  4GLA C;  4FF4 A;  5ELO A;  4JI1 L;  1HNX Q;  2LSS A;  2PMZ E;  2F0F A;  3SVM A;  2F4V L;  2MQH A;  1S40 A;  1I6H H;  4DR1 L;  4A3K G;  1QZH A;  3C46 A;  3T1Y Q;  1LTA D;  2RA4 A;  4J6H A;  4YWK A;  5FLM H;  4GOP A;  1VQ6 A;  3GP7 A;  4YWL A;  1DM0 B;  1GUW A;  5C4Z A;  1O80 A;  4CDD C;  1EYC A;  3AEV A;  2B8F A;  1E24 A;  2RSN A;  3KK7 A;  4YIJ A;  1TWH B;  3VYS A;  3HOY H;  1A15 A;  4XYO A;  4RAU C;  4HSV A;  3ITP A;  2DN8 A;  1KRT A;  2N8N A;  3B6Y A;  2UUA Q;  4Z9C B;  1S5B D;  4S3S A;  1RIP A;  1JT8 A;  2DJG C;  2JA8 B;  4IFD G;  1LTS D;  1EY7 A;  1MBY A;  1C4Q A;  3OIP A;  4QGU A;  1BCP B;  3IFD A;  3S2D H;  1LTR D;  5FJ8 H;  4LK1 C;  4A93 G;  2NZH A;  2F0H A;  1B9M A;  2Z4I A;  3HOZ G;  1X6O A;  4CKC A;  3KLR A;  2K4K A;  4DR6 L;  1STE A;  3UDI A;  4NXN L;  2R93 B;  2Z6K A;  3U4Z A;  2KHS A;  4YY3 Q;  2F0G A;  4LMQ D;  3MWY W;  1WTO A;  1XWE A;  3M85 A;  4HED A;  4ME5 A;  4R4C A;  1DOM A;  2NUC A;  1AN8 A;  1TT2 A;  3U9O A;  1QJO A;  4A3K H;  1PYB A;  1D7Q A;  2G9D A;  1O7Z A;  2IT1 A;  4IFD I;  4JBM A;  1I4X A;  1KLG D;  2Z0S A;  4C1N I;  4OGQ C;  1OTC A;  1HQR D;  1KLU D;  5JJZ A;  1L1O B;  4JK1 C;  3J81 E;  4KTA A;  3GTK B;  2I46 A;  5CBA E;  1F2M A;  5LMN W;  2OWO A;  2BE5 C;  4EQO A;  4A3J B;  5GAD C;  4FXD A;  3TEH B;  3GQB A;  1SFO H;  1F2Y A;  3KDF A;  3T1H Q;  1VQ5 A;  5GAE C;  4Q0F A;  3U50 C;  2QDB A;  1K8G A;  3VDY A;  1EOV A;  4YCU A;  4UAI A;  3KF6 B;  4KY7 A;  4IPD A;  3D3R A;  3S1M H;  3E9I A;  1HZC A;  4QJF A;  1TS4 A;  1Y1V H;  1XTD A;  2O4X A;  4C3H B;  3OW7 A;  2BA1 A;  1X65 A;  3PMF A;  2RVL A;  3BDC A;  1CKO A;  2XN9 C;  3KLS A;  1FNU A;  1VQB A;  4DR4 Q;  4B3R L;  1NBW A;  3K0Y A;  3LGJ A;  1G2S A;  1I4H A;  4O2D A;  1PFM A;  4GN5 A;  2UXD L;  4JG2 A;  3TQY A;  4A3D B;  2J0T D;  3GO5 A;  3PUX A;  4ZUI A;  3S17 H;  2O2L D;  4CBV A;  3RMH A;  3FRP B;  1E2W A;  1VQK A;  2ZXP A;  3J81 i;  3CPW A;  5FOB B;  5C0X H;  2K75 A;  1G6P A;  4EVO A;  1CSP A;  5LMU L;  2UU9 Q;  3CKI B;  2VW9 A;  3BZK A;  2HQL A;  4EQN A;  3UE1 A;  2ZTD A;  1AW7 A;  2XNA C;  3A8J E;  4F87 A;  1XPU A;  4OHJ A;  3DWP A;  2OTL A;  4XDX A;  1O7L A;  3HEJ A;  1NR4 A;  2F0P A;  2WV6 D;  5C3X A;  1UNS A;  2MUY A;  1EQV A;  1D5M C;  1TWC B;  2Z4H A;  1IBL L;  4C3J H;  5M3F G;  2B2V C;  3CF5 A;  2EY1 A;  4A3C G;  5EPK A;  1Y8O B;  1L1O C;  1FVI A;  2UXC L;  4C2M H;  2CH4 A;  3MTS A;  5I9O A;  3I7F A;  1HA6 A;  2RDH A;  1G91 A;  4JI3 Q;  2F0I A;  1J6Q A;  4HTH A;  4IN3 A;  3PSI A;  2NZO A;  4R4Q A;  1MKH A;  3DLL A;  3HOX G;  3UDG A;  4MTK A;  3DEO A;  1BOS A;  1N36 Q;  2E2I B;  4JBJ A;  1B8A A;  1HH2 P;  1JWM D;  1HA5 A;  1PZI D;  2SEB D;  2AQ2 B;  4DV4 L;  2QGQ A;  2XRS D;  3CD6 A;  3SE0 A;  4Y7N H;  2K52 A;  1NCV A;  4CGY B;  2A69 C;  3TZU A;  4LF6 L;  1Q86 C;  2FXQ A;  1R4P B;  2NYZ D;  1F2Z A;  2R92 H;  3S1R H;  3CRK C;  3FHW A;  1Q1B A;  2B2T C;  4LFC L;  4JYA L;  3S15 B;  1V1P B;  5IP9 H;  1Y8P B;  2F3W A;  3VA7 A;  1RL2 A;  2BOS A;  3KJO A;  4RGN A;  1KXL A;  4OO1 G;  2A6E D;  4I7A A;  4CJ0 B;  3N6R A;  3EN2 A;  4WJ3 M;  1W3S A;  2ASB A;  2BDO A;  3S2H B;  2B2Y A;  2LXK A;  2R93 H;  3KLW A;  4A3D H;  1F2L A;  5KYL A;  5H1S E;  3TN2 A;  4YY3 L;  4I65 A;  3OWF A;  2DNC A;  2LMC B;  1XTC D;  3E9H A;  3NBH A;  1PA6 A;  3NWS A;  4DXF A;  3GTL B;  4A3F G;  3VR2 A;  1XNR L;  1EY5 A;  4JI5 Q;  1TWC H;  5C3E G;  1V1Q A;  5GRO A;  3CU7 A;  2AKW B;  1PH7 A;  4IUR A;  2AMC B;  1F9Q A;  5GQO A;  4GZY C;  1KDC A;  4HCE A;  4JI1 Q;  4B9W A;  3FPP A;  2JA6 B;  1BCP F;  1STH A;  1G29 1;  3CCU A;  1YIJ A;  4R4T A;  3P1H A;  1VQM A;  3BDL A;  3PIP 3;  1HFG A;  4MIU A;  1CTM A;  1TII D;  3IFT A;  3QG1 A;  1N32 L;  4DR2 L;  4OIK A;  1XPO A;  1PYW D;  2CHB D;  1JCK B;  2H4O A;  1MSH A;  4HJ9 A;  1I50 H;  2OQK A;  2Q2U A;  3NEL A;  1D1K A;  2F0T A;  3AQQ A;  5K5P A;  4B3M L;  1EUJ A;  2OQ0 A;  1TU2 B;  3S1R B;  3I2Z A;  4GKJ L;  2D0O A;  4UHV A;  3HG9 A;  1EYD A;  3PO2 B;  3ND9 A;  1ZXT A;  4J15 A;  1G2T A;  3I70 A;  3E6Z X;  1I3Q B;  4HID A;  4OX9 L;  2KCC A;  3TRZ A;  1EY4 A;  3F2D A;  1TS5 A;  1TWA B;  2JA8 G;  3I4N H;  1LT5 D;  4RCO A;  4ALP A;  1K3B C;  1X55 A;  3EBE A;  3A74 A;  1PH2 A;  4R8N A;  3RZD H;  3RN5 A;  1SYB A;  1SJH D;  1ENF A;  3TZD A;  1X3Q A;  2Q2I A;  3SR1 A;  4OON A;  5I4D A;  1XNQ Q;  4HMI A;  1K8O A;  2JA6 H;  3H09 A;  1K28 A;  1SE8 A;  2VB3 X;  4M1U B;  2K5D A;  2KQ3 A;  3BYY B;  1HQM C;  3U4V A;  4C2M B;  1EIG A;  2F03 A;  3PIO A;  5ELD A;  2AWN A;  1PTO H;  3AYH B;  1N34 Q;  3MEF A;  4AQY L;  3W3A A;  1KAB A;  4DK1 A;  1HTP A;  1PH1 A;  5I2X A;  4C1N K;  5EAY A;  3J81 j;  2K1B A;  2JA8 H;  1T9H A;  2PQE A;  2I0Q A;  4ZLT F;  3A0J A;  4BA2 I;  1IBK Q;  4KD4 A;  3T51 B;  4XQJ A;  2EY2 A;  1Z6H A;  1B9N A;  5IY0 A;  3CMA A;  4KKU A;  1EY0 A;  1H9M A;  2L9H A;  3NXW A;  4C3I G;  3GTG B;  5JJI A;  4K2K A;  1X3G A;  3HOW G;  3K7U C;  4JI2 Q;  3H3V C;  2RCN A;  1LO5 D;  3RNU A;  4A3M B;  2Y0S E;  5JPM C;  3BS1 A;  1CKN A;  1VQG A;  2GVA A;  4LF4 Q;  1S5F D;  1BCP C;  1VQA A;  3S14 H;  2VS1 A;  3VYU A;  1BUV T;  3H94 A;  4KHZ A;  4JBK A;  3Q6S A;  2OCE A;  2Y0S B;  1SYG A;  1PMR A;  2LS0 1;  1EY6 A;  4IPC A;  3CRL C;  5E3F A;  2IX0 A;  1R9T H;  2IY5 B;  3UI2 A;  4P73 A;  3EJI A;  4DR7 L;  5G3L D;  4A3E H;  4RMF A;  1JB3 A;  5C3E H;  1B50 A;  5G3L F;  4ODG A;  1VMP A;  4YCW A;  5AJ3 Q;  1D8L A;  2GA4 B;  3D4W A;  3SXH A;  4IPH A;  3G6E A;  2B63 G;  4H0L C;  1EWI A;  4IFD H;  1NSN S;  2ES2 A;  1XMQ Q;  1AZP A;  4A3M G;  2Q8I B;  4DKA C;  3RR5 A;  4CDC C;  3KUP A;  2L0C A;  4DV2 Q;  1SN8 A;  1ENC A;  3MZ5 A;  3WWV A;  3I72 A;  1EIH A;  3ER0 A;  4RGT A;  3A5Z B;  2NWG A;  2KHJ A;  2EYH A;  4J1M A;  1JOR A;  4GLV B;  2FJ2 A;  3MXN A;  5C44 G;  2HD3 A;  1VQ4 A;  1DYQ A;  2BA0 A;  4G7H C;  4M8A A;  1TWF B;  1PHJ A;  3JAM i;  1UEA B;  4QIW E;  2F0K A;  4XYQ A;  1S5E D;  2F0E A;  1K8M A;  1MIU A;  4IUV A;  3NP8 A;  2BCO A;  1HTL D;  4ZCK A;  1H95 A;  2AUK A;  2IHF A;  1PTO D;  5IYB H;  1SAP A;  1STY A;  5BR8 Q;  3H0G G;  2F1M A;  2R6G A;  1IYV A;  4DV0 Q;  4DV7 L;  1OXV A;  2UUC L;  2A68 D;  1ASY A;  4A3G G;  1A63 A;  2HQE A;  2K32 A;  3ULP A;  2F0S A;  1GHJ A;  3QJY A;  5J22 A;  4NMZ A;  2TSS A;  4A3E B;  3DM1 A;  3PQI A;  4OWX B;  4AIM A;  5C44 B;  1UUP A;  4N8X 1;  1VS0 A;  1LYL A;  1PTO F;  2CWA A;  1PVO A;  3BJU A;  5FO8 B;  2ZTE A;  2NVT H;  3R2T A;  3GDE A;  3L2P A;  2Q8R E;  1D5X C;  5C0X I;  3ERO A;  2B2T A;  2F0L A;  5IYB G;  2JP1 A;  1WD0 A;  4LF6 Q;  3I4N B;  2NVX B;  3HOV G;  2E5L Q;  2A69 D;  1VQ9 A;  2X6L A;  2B39 A;  4H44 C;  1SRO A;  5C4X G;  5ELE A;  4LUO A;  3L3O C;  2UXC Q;  1AP0 A;  3HOW H;  1YNJ C;  4C3H G;  4DK3 C;  3KF6 A;  4A3J H;  3S16 H;  4K14 A;  4RGO S;  1EU4 A;  2RQX A;  5EGT A;  5M3F B;  3CHB D;  4ZRZ A;  2I5H A;  3N52 A;  1QE6 A;  3A55 A;  5JEA J;  1N36 L;  4K5X A;  2HCC A;  2WAC A;  3WOE A;  5E4X A;  5ELB A;  1L1O A;  1E22 A;  3JAM L;  4FVM A;  4A3J G;  4DAV A;  3H3V H;  4C3H H;  4OIJ A;  1M1K C;  4KY6 A;  3TP7 A;  2M2L A;  4DA2 A;  4FNF A;  3STB D;  2F0J A;  3NHH A;  3CCR A;  5EPL A;  3KOJ A;  4RG1 A;  2HT1 A;  3E0J A;  1GD7 A;  1VQI A;  2Z1C A;  1LTT D;  4MHE A;  5CBE E;  5KEE A;  2NVT B;  1FGB D;  5D14 A;  1JB7 A;  1NR2 A;  1JE4 A;  2K5H A;  4KI0 A;  1IHZ A;  4OEL B;  4KHP Q;  1TQO A;  2AUJ D;  5DEH A;  2M00 A;  2A5H A;  1RHP A;  4X64 Q;  4JYA Q;  4XXE A;  2NBF A;  1KL9 A;  2MPM A;  1JIC A;  3CCE A;  2Z6K C;  1UE5 A;  3PUW A;  1SFO B;  5M3M H;  2RCF A;  1GXD C;  3MFG A;  1ICW A;  3KF8 A;  3AFQ A;  2ZXO A;  3C2P A;  1TWG B;  1PZK D;  2ZTC A;  2MJ8 A;  1UE6 A;  5IGF A;  3OTO Q;  3NTI A;  3T56 B;  4XQQ A;  1OXT A;  2WFW A;  3CQZ H;  3M4O B;  3LX0 A;  2E2D C;  1HJP A;  2UXD Q;  3J80 c;  3HOW B;  3IL8 A;  3TP5 A;  2HIX A;  4LF5 Q;  5IP7 G;  4FXK C;  4Y52 H;  1O78 A;  4PNY A;  4A3I B;  3H91 A;  1SND A;  4RCN A;  3X3M A;  2F3I A;  4K2L A;  1MSG A;  2YV5 A;  2EJG C;  4DFA A;  3HKS A;  3IRB A;  3AU7 A;  3D31 A;  4P74 A;  3K57 A;  3P20 A;  2F3V A;  2XSC A;  2KEC A;  1YIT A;  1J5E Q;  1VF5 C;  4X6A H;  1OXX K;  2K05 A;  2ICI A;  4V0B A;  4KN4 C;  3ULJ A;  4LFB L;  4WFN 3;  3S1M B;  4PMC A;  2PZU A;  2K04 A;  1M8A A;  3SK4 A;  2R7Z B;  1TY2 A;  4FO2 A;  2OTJ A;  4KN7 C;  1KC8 C;  4L6T B;  1E2V A;  4DAP A;  1LLR D;  5C5M A;  1BR9 A;  4H7B A;  4JPB W;  5M5W B;  3F8T A;  3M4O H;  1HUM A;  1SNO A;  1Y8N B;  3I90 A;  4EGV A;  3GTM B;  1CFM A;  1A0I A;  4DV5 L;  3J80 i;  2PO4 A;  2LFN A;  2JA7 H;  3W1G A;  2CKZ B;  3C1E A;  1I4G A;  4GN3 B;  4IPG A;  3I55 A;  1XYI A;  1DCZ A;  2IPK D;  5FO9 B;  5CV7 A;  3S1N H;  1X3F A;  3MC0 B;  1HFN A;  1Z47 A;  1HNZ Q;  1S5C D;  4CDE C;  1D6E C;  5IP9 G;  1GOZ A;  1ONL A;  3UDF A;  1QVG A;  1QB5 D;  2YU9 H;  4DNR B;  5DAU A;  3I91 A;  1GJX A;  4MTN A;  2R61 A;  1WCM B;  1YZ6 A;  1D2B A;  3EVQ A;  3VR4 A;  4JI7 L;  3A54 A;  5L37 A;  3CCV A;  2EYM A;  2XTI A;  4A3I G;  4K6D A;  5JPN C;  2KEN A;  2NVX H;  3R3O A;  5K36 G;  4BBS B;  1KIX A;  4PV1 C;  4FF2 A;  1X56 A;  5EKK A;  2R7Z H;  4BS9 A;  1HNW Q;  1L0X B;  1ET9 A;  1EY9 A;  1ET6 A;  3A5U A;  4KMU C;  2JEB I;  3SK5 A;  1HNX L;  3TME A;  4CHT B;  2PW5 A;  3TDQ A;  1MJE A;  2L55 A;  1LTL A;  2D2C C;  1EIF A;  5EJW A;  3RN2 A;  4JI6 Q;  1KNA A;  4FF1 A;  1SSO A;  4DV2 L;  1SYE A;  4O42 A;  4LFB Q;  3I8Z A;  1XMO Q;  1U9R A;  3FPU B;  4LFA Q;  4A3B H;  1XXG A;  1GUO A;  1PFB A;  3V2T A;  1PH8 A;  2SDF A;  5LMN L;  3D8G A;  1CHP D;  4OWW B;  1CZG A;  1T5E A;  3NSW A;  3M7N A;  5AJ3 L;  2DY7 A;  3Q22 A;  1DJR D;  1JJC B;  1DD2 A;  5J1Z A;  1YHA A;  2E2H H;  3OWE B;  4A3C H;  2LXJ A;  3CCL A;  2J7Z A;  2RDG A;  1IL8 A;  1HXY D;  2JA6 G;  1QWY A;  1CQF A;  3S14 B;  1I4R A;  2PW7 A;  2CCZ A;  4J8Q A;  3NWT A;  4H13 C;  4JVZ A;  2B2U C;  3GV6 A;  1H9K A;  1VQJ A;  3AB9 A;  3MHB A;  1I3Q H;  3P75 A;  5DM6 3;  1YJ9 A;  1CZW A;  3BVG A;  1VQH A;  1W6K A;  1I4Q A;  3F2C A;  2FMM A;  2RHQ B;  3MEH A;  5M3M G;  2ZXR A;  1Q8I A;  2E76 C;  1SJE D;  1JQY D;  3BDO A;  4OO1 I;  1PRT C;  5M5Y H;  4P72 A;  2K01 A;  3K8A A;  1IL2 A;  2A8V A;  1ZEQ X;  2F0U A;  3GTQ B;  1VQ8 A;  3GV3 A;  3A7L A;  3H0G B;  3FDT A;  2SNS A;  4DR7 Q;  1BDO A;  1IW7 D;  2CFM A;  4ZUJ A;  4A93 B;  1N8R C;  1Y14 B;  2GN5 A;  1HZ9 A;  1X3P A;  2AQ1 B;  3RLO A;  2R7D A;  5IP7 H;  1NTG A;  3I56 A;  1Q81 C;  4K5W A;  4R1J A;  1L2F A;  1J8I A;  4DR4 L;  4JI8 Q;  1HR0 L;  2B2W C;  1BCP D;  4BWG B;  2WKC A;  2KCN A;  2RF4 A;  1XMQ L;  3QR8 A;  2MO1 A;  3OMC A;  4F88 A;  1CA6 A;  3PF5 A;  2Y0S G;  4RKB A;  2XWB B;  1A3T A;  4CJ2 C;  3NTH A;  4DUZ Q;  1EEF D;  1KRS A;  2RBM A;  4BBR G;  2VL6 A;  2KJX A;  1SYD A;  4DV1 Q;  1T5X D;  4QCL A;  1EZ6 A;  3PGZ A;  2VQE L;  2F0O A;  4BY7 H;  2EQS A;  1GVP A;  2WP8 J;  3HKZ E;  1J9O A;  3CCQ A;  1K9M C;  2A6E C;  2K50 A;  2LY7 A;  2R93 G;  3NQI A;  4AQY Q;  3V96 A;  1C7Y A;  1ILP A;  1FJG Q;  4KY5 A;  4DK0 A;  5IOC A;  5M3M B;  5CYU A;  4P2C B;  4A3F B;  2Z9H A;  1DOL A;  1FL0 A;  1WTV A;  2GVB A;  1MJC A;  1VQE A;  3UE0 A;  1PH9 A;  3HOU B;  4DV7 Q;  1SNQ A;  3PIP A;  3NUC A;  4XIG S;  3GTM H;  2ALY B;  5I2Y A;  4LF7 L;  3NPP A;  4A76 A;  1HNW L;  4BBR B;  2JA5 B;  3CW2 C;  5C44 H;  3W2D A;  4HIO A;  4A93 H;  1NNX A;  5JEA H;  2JYO A;  5M9O A;  2OXP A;  1IBK L;  3K5O A;  1BNZ A;  3IKJ A;  4ME3 A;  3PO3 B;  4N9T A;  4ZQ3 A;  1CUK A;  4POG A;  4JI7 Q;  1HCZ A;  1FR3 A;  5KRU A;  3TS0 A;  1CKM A;  2K6A A;  3BVZ A;  3ZYY X;  4A3B G;  4R8I A;  2JA5 H;  3K6O A;  4GOP B;  4HIM A;  4B3T L;  1UE7 A;  2F52 A;  4RWS C;  3KYH C;  2PPB C;  3J81 L;  1U4L A;  5CV6 A;  3M3Y B;  2KHI A;  1TXY A;  5FJ8 G;  2EJF C;  2PCF B;  2MHV A;  3AFP A;  4ZYS A;  3HOY G;  1EU3 A;  2MNA A;  3I4L A;  3J7A V;  4LJZ C;  1EEI D;  1N32 Q;  3A8K E;  3R2I A;  4B9X A;  3VA5 A;  5M3F H;  5E7N A;  3STB C;  4X3S A;  3S15 H;  5FLX c;  4IUP A;  1F9P A;  1XMO L;  1U0L A;  5M5W H;  2N3S A;  4DR6 Q;  4HN7 A;  3G4S A;  5IYD H;  3J7A 5;  1HZA A;  4X66 L;  4A3B B;  2EDG A;  3HP3 A;  5T1G A;  3EA6 A;  1E7Z A;  3VYT A;  4C56 C;  4O1N A;  2KOL A;  5LL6 X;  4U67 3; 
#chains in the Genus database with same CATH homology
 4IUU A;  2XWJ B;  2NB0 A;  5C4X B;  4ULL A;  3ND8 A;  2EOT A;  1LT3 D;  3EQL C;  4IAL A;  2H1E A;  2PMZ B;  1GUT A;  2FIN B;  3MFY A;  3PUZ A;  3LWE A;  2ID0 A;  3L9A X;  3LNN A;  4KJN A;  3D4D A;  1II3 A;  4FXG C;  1AEX A;  1A2T A;  2M9V A;  2YU9 B;  2F0D A;  3OOC A;  1M4V A;  2B2W A;  3MVV A;  4KKS A;  2EY5 A;  2K33 A;  1B3A A;  1A6X A;  1R4Q B;  3Q24 A;  3RZD B;  4QF4 A;  4G7O C;  4F7X A;  5JOB A;  1ML0 D;  2CW0 C;  3S9W A;  1WTR A;  2QIL A;  1JOO A;  4XT3 B;  1SNC A;  4KHV A;  5AFW A;  1TS3 A;  2FMC A;  1PTO B;  1V8Q A;  5IGC A;  1PLF A;  2C5C A;  4V19 0;  2EXZ A;  5CV4 A;  5EKI A;  3NQT A;  1G6Z A;  4A3G B;  5E1F A;  5FO7 B;  1R9T B;  2EPB A;  1JR0 D;  4RH6 A;  4RA8 A;  4CKB A;  1EFI D;  4K5V A;  1OO9 B;  3I4M B;  4C3J G;  3M7G A;  4HSP A;  1WTW A;  2HDL A;  1WTX A;  2JEA I;  1Y69 U;  1SMY D;  1QIL A;  3R8B A;  1Q3L A;  5COR A;  5CC4 A;  2QF7 A;  2HCI A;  2NN6 I;  1DXM A;  4ZKB B;  1B2T A;  3U9S A;  4DU9 A;  4G7Z C;  1PTO C;  1PDQ A;  2Z8L A;  4DF7 A;  1K83 B;  5ELF A;  4A3K B;  5D3I B;  3I3C A;  2L1B A;  3G6J B;  2E2H B;  1VMC A;  5KNC A;  1BXT A;  3QIA A;  1IYU A;  1NUC A;  2L11 A;  3HOV B;  5IGG A;  3DWQ A;  3BYT B;  4KD3 A;  3DWA A;  1H9S A;  1MGS A;  1RD9 D;  4C3J B;  3SDZ A;  1ESR A;  5IIF A;  2XRQ D;  4CKE A;  2NZ1 D;  2NTT A;  4WRD A;  5LL6 S;  1DON A;  2MGS A;  1STN A;  2DY8 A;  2EJM A;  2MP1 A;  2WAQ B;  4PQX A;  3SK6 A;  2EYJ A;  1EZ8 A;  5ISR A;  1KTK A;  4B08 A;  4X3K A;  5C0X G;  1B4O A;  2IX1 A;  3TP6 A;  1RKN A;  1CQV A;  3RUZ A;  5CV8 A;  3K5L A;  1AZQ A;  3J7A F;  2X69 A;  1V1O A;  2IW3 A;  4L8J A;  2F0M A;  5IGE A;  1HUN A;  2B8G A;  1BF4 A;  1SDF A;  1EWC A;  2B2V A;  3H6M A;  1JOQ A;  1CA5 A;  1RJT A;  2NTS A;  2PYK A;  5KGU A;  1B44 D;  2SNM A;  3BZD B;  1STA A;  1G8Z D;  2N88 A;  1PXU A;  1PRT F;  1L0Y B;  3NK9 A;  1IW7 C;  1RF2 D;  1EOT A;  1EYA A;  1WTP A;  3SHL A;  2OT2 A;  1JWS D;  5HUR A;  5DNF A;  2JA7 B;  2QKI C;  3S16 B;  3K59 A;  2J4X A;  5EPJ A;  1SNM A;  2EE1 A;  4KK7 A;  5BN4 A;  3RZO B;  3MA2 B;  4DNT B;  3LWU A;  5F2D A;  5HGT A;  4BY7 B;  3A8I E;  3J80 L;  1U4M A;  4XTC S;  3OHX C;  2NN6 G;  5ELC A;  2KA7 A;  2PZW A;  2EYO A;  1CI3 M;  3BG3 A;  5KND A;  2F0N A;  1MD2 D;  4WOR A;  1WVL A;  3TBI B;  3R93 A;  2O5J C;  4OL7 A;  4HAE A;  1H9S B;  1U4P A;  4U68 A;  3L7Z C;  5JEA G;  1RCV D;  2KEE A;  3JAM E;  1LTB D;  1S5D D;  3HKZ B;  2NVY B;  1SYC A;  4KKT A;  2CQA A;  3QO2 A;  5M5X B;  1FD7 D;  5TSS A;  2OEO A;  5CR3 A;  2AQ3 B;  3DHQ A;  4TQU S;  3SEB A;  1E0B A;  1YNN C;  1KAA A;  1HPC A;  3ERQ A;  1Q90 A;  3HZX A;  1SE4 A;  1W6J A;  3AMU A;  1DOK A;  1PRT B;  1TVX A;  1TS2 A;  5KIX A;  1H9R A;  1S4Z A;  1TY0 A;  4TKO B;  2O5I C;  4RFB A;  1F9R A;  4X3U A;  2ENB A;  3QOJ A;  5BN3 A;  4HR7 B;  1E2Z A;  2A6H C;  3MXG A;  3PUY A;  4ZKC B;  3T4A C;  1GUG A;  2E75 C;  2YYZ A;  1SE3 A;  1SXT A;  3A56 A;  3A7A B;  5D65 A;  2WII B;  4NP5 A;  1QCB D;  1I4P A;  4KV6 A;  2RKS A;  1LT4 D;  3MXU A;  4ID6 A;  3NTK A;  5C5L A;  5BN5 A;  5C3E B;  3VR3 A;  4XQN A;  5I9P A;  4IUT A;  2JXM B;  5A2Q E;  2F0Q A;  2QEJ C;  2I07 B;  1DZ1 A;  4QUF A;  1VDZ A;  1ZYR C;  2L5T A;  3QB3 A;  4DAY A;  4KJO A;  3P7J A;  4IQZ A;  1TR5 A;  2VB2 X;  2R92 B;  1F77 A;  4JBW A;  5IT9 E;  2LKV A;  4DN4 M;  2VUM B;  2C9O A;  3WOF A;  3URY A;  4RGM A;  1D1I A;  1ESF A;  2D5D A;  1TKW B;  1GUN A;  3OPO A;  1A3V A;  5JAV A;  5COY A;  5E4W C;  3GTP B;  1KNE A;  2A73 B;  3K5M A;  1FYC A;  1PFN A;  4G57 A;  4BA1 I;  5A35 A;  4N9P A;  2F0W A;  1QNK A;  3K5N A;  4C3I B;  2XVS A;  5EBD A;  3FMC A;  2HUG A;  2WB1 B;  2JSO A;  1EQT A;  1NAP A;  1KDA A;  5EQ0 A;  2Q8T A;  1OXU A;  4FYD A;  3J7Y W;  3J80 E;  3S1N B;  1BQQ T;  1O7Y A;  1I6H B;  1I6V C;  1QOH A;  1CT1 D;  5FKA C;  3HOZ B;  2EY6 A;  2FFK B;  3S17 B;  4RKL A;  4RHR A;  5CGK A;  2XIW A;  3DEP A;  5A2Q L;  5J39 A;  3WDN A;  4K8I A;  3I73 A;  1H9J A;  1B1Z A;  4NDX A;  4UDU C;  1UAP A;  2A6H D;  3EFX D;  1SYF A;  2OF1 A;  3F2U A;  1VF7 A;  5K36 H;  1QNU A;  5IGD A;  4IUQ A;  2HDM A;  3FEW X;  2F0V A;  2KED A;  1C8C A;  5JVH 3;  2A74 C;  2EYP A;  2ICE C;  4I7Z C;  5FLX L;  5KNB A;  1Q1E A;  1LAC A;  1EWH A;  1HRJ A;  1RTN A;  2L12 A;  4DXG A;  2RDF A;  1A2U A;  4TSS A;  1WTQ A;  4MN3 A;  1IKL A;  3C1F A;  2ZT9 C;  2WIN B;  1LV9 A;  3DMU A;  1Y1V B;  4Q5V A;  5EKL A;  2R3Z A;  2PZT A;  1F9S A;  2EYF A;  1B53 A;  2AWO A;  5C4H A;  2A68 C;  3TP8 A;  4ILW A;  3RLF A;  1PZJ D;  1BBX C;  1LTG D;  3KBG A;  3VYR A;  1SE2 A;  5FLX E;  5M5Y B;  1JOK A;  3C3L A;  1MI2 A;  1CK1 A;  4QMG A;  4QB4 A;  2EZV A;  3NBI A;  5T1I A;  3MXP A;  2CW0 D;  3BVM A;  4HMJ A;  1Y1W B;  1Z7T A;  4E6I A;  1WD1 A;  1XX8 A;  5D3D A;  3T13 A;  1I50 B;  1D5Z C;  5C4J B;  3HOY B;  4RHS A;  5NUC A;  2IL8 A;  2D9U A;  1ZKO A;  1Q12 A;  1EL0 A;  1HHV A;  3S1Q B;  1ENA A;  2EYL A;  2B2U A;  1OXS C;  2K5Q A;  3PUV A;  5I6Y A;  1VCI A;  1FNW A;  1PRT D;  3PIO 3;  2B2Y C;  2EVB A;  2KUM A;  2IWH A;  3IAY A;  3OIQ A;  2K5W A;  1ZYR D;  2E2J B;  1ILQ A;  3PV0 A;  3QWN A;  3HOX B;  4NW2 A;  4QIW B;  3X3N A;  2KVM A;  2L4N A;  1STB A;  1FNV A;  5DM7 3;  3KLS X;  4XT1 B;  4IZ8 A;  3HS0 C;  3E5S A;  1EY8 A;  2JE6 I;  5IT9 L;  1STG A;  2WKD A;  4G4K A;  1V1P A;  3S2D B;  1ROD A;  2VXW A;  3FVQ A;  4K6L A;  1IKM A;  4WJW A;  5IOD A;  3Q23 A;  2IJ0 A;  5C6A A;  4ZAI A;  1JC7 A;  2E74 C;  5JVG 3;  2VNU D;  3CQZ B;  4PMB A;  1X32 A;  1RTO A;  1U4R A;  5CMD A;  1QG7 A;  3FKI B;  5FK9 C;  3DXJ C;  2BDN A;  1GUS A;  4HCS A;  2K28 A;  1LTI D;  1LAB A;  4IUN A;  4PMW A;  4AYB B;  2K03 A;  2IX3 A;  3MAQ A;  4FF3 A;  3KBX A;  3HRZ C;  1SBB B;  2SOB A;  2DNE A;  5I6W A;  1BO0 A;  4BY1 B;  3TSS A;  3K7A B;  5CV9 A;  4QUC A;  1CM9 A;  4CJ1 B;  2F4I A;  3RD4 A;  1C48 A;  3ONA B;  4F8M A;  2G9H D;  2N55 A;  3M4Y A;  4DGZ A;  2D62 A;  2CVR A;  2B63 B;  1CHQ D;  4ABN A;  5IGB A;  3G7L A;  4LAA A;  5C3W A;  5C0X J;  2PNR C;  4IFD J;  3O13 A;  3D6W A;  2V4D A;  5KYI A;  2TMP A;  2RSO A;  3OMG A;  4R9W A;  3T53 B;  3GTJ B;  3T16 A;  3GTO B;  1YNN D;  1RDP D;  1GHK A;  1AFP A;  4TRD A;  1SMY C;  3Q0A A;  4OO1 H;  4EQP A;  3V05 A;  1SNP A;  2FHT A;  4L63 B;  2X6G A;  1LT6 D;  3OSO A;  4FP5 D;  4ZK9 B;  3HGB A;  3VR6 A;  1YNJ D;  1JWU D;  3VR5 A;  2NVQ B;  3D6C A;  4Y7N B;  5LHY 1;  2K7V A;  3SK8 A;  3D4R A;  5EBC A;  3K58 A;  5CV5 A;  4NKL A;  1SEB D;  2QCP X;  2BE5 D;  3QOL A;  4K8J A;  3DUZ A;  3NE5 B;  3GD7 A;  1V43 A;  4X3T A;  2NN6 H;  1KDB A;  1A3U A;  4FF4 A;  2F0F A;  3SVM A;  3C46 A;  1LTA D;  2RA4 A;  4J6H A;  3GP7 A;  1DM0 B;  1GUW A;  5C4Z A;  1O80 A;  1EYC A;  2B8F A;  2RSN A;  3KK7 A;  4YIJ A;  1TWH B;  3VYS A;  1A15 A;  4XYO A;  4RAU C;  4HSV A;  3ITP A;  2DN8 A;  4Z9C B;  1S5B D;  4S3S A;  2JA8 B;  4IFD G;  1LTS D;  1EY7 A;  1MBY A;  1C4Q A;  3OIP A;  1BCP B;  3IFD A;  1LTR D;  4LK1 C;  2F0H A;  1B9M A;  2Z4I A;  4CKC A;  3KLR A;  1STE A;  2R93 B;  2KHS A;  2F0G A;  4LMQ D;  3MWY W;  1WTO A;  1XWE A;  3M85 A;  4HED A;  4ME5 A;  1DOM A;  2NUC A;  1AN8 A;  1TT2 A;  3U9O A;  1QJO A;  2G9D A;  1O7Z A;  2IT1 A;  4IFD I;  1I4X A;  1KLG D;  4C1N I;  4OGQ C;  1HQR D;  1KLU D;  5JJZ A;  4JK1 C;  3J81 E;  4KTA A;  3GTK B;  2I46 A;  5CBA E;  1F2M A;  2BE5 C;  4EQO A;  4A3J B;  4FXD A;  3GQB A;  1F2Y A;  4Q0F A;  2QDB A;  4UAI A;  4KY7 A;  3D3R A;  1TS4 A;  2O4X A;  4C3H B;  3OW7 A;  2BA1 A;  3PMF A;  2RVL A;  3BDC A;  2XN9 C;  3KLS A;  1FNU A;  3K0Y A;  1G2S A;  1I4H A;  1PFM A;  4A3D B;  2J0T D;  3GO5 A;  3PUX A;  4ZUI A;  2O2L D;  4CBV A;  3RMH A;  3FRP B;  1E2W A;  2ZXP A;  5FOB B;  5C0X H;  4EVO A;  3CKI B;  4EQN A;  1AW7 A;  2XNA C;  3A8J E;  4F87 A;  4OHJ A;  3DWP A;  4XDX A;  1O7L A;  3HEJ A;  1NR4 A;  2F0P A;  2WV6 D;  5C3X A;  1UNS A;  2MUY A;  1EQV A;  1D5M C;  1TWC B;  2Z4H A;  2B2V C;  2EY1 A;  5EPK A;  1Y8O B;  3MTS A;  5I9O A;  1HA6 A;  2RDH A;  1G91 A;  2F0I A;  4HTH A;  4IN3 A;  3DEO A;  1BOS A;  2E2I B;  1JWM D;  1HA5 A;  1PZI D;  2SEB D;  2AQ2 B;  2XRS D;  3SE0 A;  1NCV A;  4CGY B;  2A69 C;  3TZU A;  1R4P B;  2NYZ D;  1F2Z A;  3CRK C;  1Q1B A;  2B2T C;  3S15 B;  1V1P B;  1Y8P B;  2F3W A;  3VA7 A;  2BOS A;  4RGN A;  4OO1 G;  2A6E D;  4CJ0 B;  3N6R A;  2BDO A;  3S2H B;  2B2Y A;  1F2L A;  5KYL A;  3TN2 A;  4I65 A;  3OWF A;  2DNC A;  2LMC B;  1XTC D;  3NBH A;  3NWS A;  4DXF A;  3GTL B;  3VR2 A;  1EY5 A;  3CU7 A;  4IUR A;  1F9Q A;  4GZY C;  1KDC A;  4HCE A;  4B9W A;  3FPP A;  2JA6 B;  1BCP F;  1STH A;  1G29 1;  3P1H A;  3BDL A;  3PIP 3;  1HFG A;  4MIU A;  1CTM A;  1TII D;  3IFT A;  3QG1 A;  4OIK A;  1PYW D;  2CHB D;  1JCK B;  2H4O A;  1MSH A;  1D1K A;  2F0T A;  5K5P A;  1TU2 B;  3S1R B;  3PO2 B;  3HG9 A;  1EYD A;  3ND9 A;  1ZXT A;  1G2T A;  3I70 A;  3E6Z X;  1I3Q B;  2KCC A;  1EY4 A;  1TS5 A;  1TWA B;  1LT5 D;  4RCO A;  4R8N A;  1SYB A;  1SJH D;  1ENF A;  3TZD A;  1X3Q A;  3SR1 A;  5I4D A;  4HMI A;  1K8O A;  3H09 A;  2VB3 X;  4M1U B;  2K5D A;  2KQ3 A;  3BYY B;  1HQM C;  2F03 A;  4C2M B;  1EIG A;  5ELD A;  2AWN A;  1PTO H;  3W3A A;  1KAB A;  4DK1 A;  1HTP A;  5I2X A;  4C1N K;  2K1B A;  2PQE A;  4ZLT F;  4BA2 I;  4KD4 A;  3T51 B;  4XQJ A;  2EY2 A;  1Z6H A;  1B9N A;  4KKU A;  1EY0 A;  1H9M A;  2L9H A;  3NXW A;  4C3I G;  3GTG B;  4K2K A;  3H3V C;  1LO5 D;  4A3M B;  5JPM C;  3BS1 A;  1S5F D;  1BCP C;  3VYU A;  1BUV T;  3H94 A;  4KHZ A;  3Q6S A;  2Y0S B;  1SYG A;  1PMR A;  2LS0 1;  1EY6 A;  3CRL C;  5E3F A;  2IX0 A;  3UI2 A;  3EJI A;  5G3L D;  1JB3 A;  1B50 A;  5G3L F;  4ODG A;  1VMP A;  2GA4 B;  3D4W A;  3SXH A;  4H0L C;  4IFD H;  1NSN S;  1AZP A;  2Q8I B;  3KUP A;  2L0C A;  1ENC A;  3MZ5 A;  3I72 A;  1EIH A;  4RGT A;  2NWG A;  4J1M A;  2EYH A;  1JOR A;  2FJ2 A;  3MXN A;  1DYQ A;  2BA0 A;  4G7H C;  4M8A A;  1TWF B;  1UEA B;  2F0K A;  4XYQ A;  1S5E D;  2F0E A;  1K8M A;  4IUV A;  3NP8 A;  2BCO A;  1HTL D;  2AUK A;  1PTO D;  1SAP A;  1STY A;  2F1M A;  2R6G A;  1IYV A;  1OXV A;  2A68 D;  2HQE A;  2K32 A;  2F0S A;  1GHJ A;  3QJY A;  5J22 A;  4NMZ A;  2TSS A;  4A3E B;  3DM1 A;  5C44 B;  1UUP A;  1PTO F;  5FO8 B;  3R2T A;  2Q8R E;  1D5X C;  5C0X I;  3ERO A;  2B2T A;  2F0L A;  2JP1 A;  1WD0 A;  3I4N B;  2NVX B;  2A69 D;  2X6L A;  2B39 A;  4H44 C;  5ELE A;  3L3O C;  1AP0 A;  1YNJ C;  4C3H G;  4K14 A;  4RGO S;  1EU4 A;  2RQX A;  5EGT A;  5M3F B;  3CHB D;  4ZRZ A;  3N52 A;  1QE6 A;  3A55 A;  5JEA J;  4K5X A;  2HCC A;  2WAC A;  3WOE A;  5E4X A;  5ELB A;  3JAM L;  4FVM A;  4DAV A;  4OIJ A;  4KY6 A;  3TP7 A;  2M2L A;  4DA2 A;  4FNF A;  2F0J A;  3NHH A;  5EPL A;  3E0J A;  2Z1C A;  1LTT D;  4MHE A;  5CBE E;  5KEE A;  2NVT B;  1FGB D;  5D14 A;  1NR2 A;  1JE4 A;  4KI0 A;  1IHZ A;  1TQO A;  2AUJ D;  5DEH A;  2M00 A;  2A5H A;  1RHP A;  4XXE A;  2NBF A;  2MPM A;  1JIC A;  3PUW A;  1SFO B;  1GXD C;  3MFG A;  1ICW A;  3KF8 A;  2ZXO A;  3C2P A;  1TWG B;  1PZK D;  2MJ8 A;  5IGF A;  3NTI A;  3T56 B;  4XQQ A;  1OXT A;  3M4O B;  3LX0 A;  2E2D C;  3HOW B;  3IL8 A;  3TP5 A;  4FXK C;  1O78 A;  4A3I B;  4PNY A;  3H91 A;  1SND A;  4RCN A;  3X3M A;  4K2L A;  1MSG A;  2EJG C;  4DFA A;  3AU7 A;  3D31 A;  3K57 A;  3P20 A;  2F3V A;  2XSC A;  2KEC A;  1VF5 C;  1OXX K;  2K05 A;  2ICI A;  4V0B A;  4KN4 C;  4WFN 3;  3S1M B;  4PMC A;  2PZU A;  2K04 A;  1M8A A;  3SK4 A;  2R7Z B;  1TY2 A;  4FO2 A;  4KN7 C;  4L6T B;  1E2V A;  4DAP A;  1LLR D;  5C5M A;  1BR9 A;  4H7B A;  5M5W B;  1HUM A;  1SNO A;  1Y8N B;  3I90 A;  4EGV A;  3GTM B;  1CFM A;  2PO4 A;  2LFN A;  3C1E A;  1I4G A;  1XYI A;  1DCZ A;  2IPK D;  5FO9 B;  5CV7 A;  3MC0 B;  1HFN A;  1Z47 A;  1S5C D;  1D6E C;  1GOZ A;  1ONL A;  1QB5 D;  4DNR B;  5DAU A;  3I91 A;  1GJX A;  2R61 A;  1WCM B;  1D2B A;  3EVQ A;  3VR4 A;  3A54 A;  2EYM A;  4K6D A;  5JPN C;  3R3O A;  5K36 G;  4BBS B;  4PV1 C;  4FF2 A;  5EKK A;  4BS9 A;  1L0X B;  1ET9 A;  1EY9 A;  1ET6 A;  4KMU C;  2JEB I;  3SK5 A;  3TME A;  4CHT B;  2PW5 A;  3TDQ A;  2L55 A;  2D2C C;  5EJW A;  1KNA A;  4FF1 A;  1SSO A;  1SYE A;  4O42 A;  3I8Z A;  1U9R A;  3FPU B;  1XXG A;  1GUO A;  1PFB A;  3V2T A;  2SDF A;  3D8G A;  1CHP D;  1CZG A;  1T5E A;  3NSW A;  3M7N A;  2DY7 A;  3Q22 A;  1DJR D;  1DD2 A;  5J1Z A;  3OWE B;  2J7Z A;  2RDG A;  1IL8 A;  1HXY D;  1QWY A;  1CQF A;  3S14 B;  1I4R A;  2PW7 A;  4J8Q A;  3NWT A;  4H13 C;  2B2U C;  1H9K A;  3GV6 A;  3AB9 A;  3MHB A;  3P75 A;  5DM6 3;  1CZW A;  3BVG A;  1W6K A;  1I4Q A;  2FMM A;  3MEH A;  2ZXR A;  1Q8I A;  2E76 C;  1SJE D;  1JQY D;  3BDO A;  4OO1 I;  1PRT C;  2K01 A;  1ZEQ X;  2F0U A;  3GTQ B;  3GV3 A;  3A7L A;  3H0G B;  3FDT A;  2SNS A;  1BDO A;  1IW7 D;  4ZUJ A;  4A93 B;  2AQ1 B;  1X3P A;  4K5W A;  1J8I A;  2B2W C;  1BCP D;  4BWG B;  2WKC A;  2KCN A;  3OMC A;  4F88 A;  1CA6 A;  4RKB A;  2XWB B;  1A3T A;  4CJ2 C;  3NTH A;  1EEF D;  2RBM A;  2KJX A;  1SYD A;  1T5X D;  4QCL A;  1EZ6 A;  2F0O A;  2WP8 J;  1J9O A;  2A6E C;  2LY7 A;  3NQI A;  3V96 A;  1ILP A;  4KY5 A;  4DK0 A;  5IOC A;  5M3M B;  5CYU A;  4P2C B;  4A3F B;  1DOL A;  1WTV A;  3HOU B;  1SNQ A;  3NUC A;  4XIG S;  5I2Y A;  3NPP A;  2JA5 B;  4BBR B;  3W2D A;  5JEA H;  2JYO A;  5M9O A;  2OXP A;  3K5O A;  1BNZ A;  3IKJ A;  3PO3 B;  4N9T A;  4ZQ3 A;  1HCZ A;  1FR3 A;  5KRU A;  2K6A A;  3BVZ A;  3ZYY X;  4R8I A;  3K6O A;  4RWS C;  2PPB C;  3J81 L;  1U4L A;  5CV6 A;  3M3Y B;  2EJF C;  2PCF B;  2MHV A;  4ZYS A;  1EU3 A;  3I4L A;  3J7A V;  4LJZ C;  1EEI D;  3A8K E;  3R2I A;  4B9X A;  3VA5 A;  4X3S A;  4IUP A;  1F9P A;  4HN7 A;  4A3B B;  2EDG A;  3HP3 A;  5T1G A;  3EA6 A;  3VYT A;  4C56 C;  4O1N A;  2KOL A;  5LL6 X;  4U67 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...