5EKKA

Crystal structure of staphylococcal nuclease variant delta+phs v39d/l125e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLDDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLERKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V39D/L125E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ekkA00
4NKLA 5C5MA 2KQ3A 1KABA 4KV6A 5IGBA 1STGA 4RKLA 4K5VA 5CV9A 4EQNA 4IALA 3MVVA 4H7BA 4B9XA 3D4WA 4KHVA 5CV8A 4IUNA 5JOBA 5E3FA 2PW7A 2PQEA 4QMGA 5CGKA 4DFAA 2OEOA 2F0WA 5E1FA 5J1ZA 5HURA 4PNYA 5F2DA 3EROA 3EVQA 1A3VA 3OMGA 4PMBA 2F0KA 5IIFA 3H6MA 3NQTA 1KDCA 1RKNA 3PMFA 1KAAA 4K6DA 4R8NA 2EYOA 5IGDA 2F0TA 4EQOA 4N9TA 1EY9A 3LX0A 3DHQA 1EZ6A 3U9OA 3E5SA 5IGCA 1EY4A 1II3A 3NK9A 3SK8A 5DEHA 5K5PA 1JOQA 1A3UA 4WRDA 4I65A 4J1MA 2EY6A 3MEHA 1EQVA 3HZXA 3TP7A 2EYLA 3HEJA 2EYJA 1SYDA 1EY8A 1SNPA 2F0NA 2PW5A 4IZ8A 2F0DA 4QB4A 2LKVA 4ME5A 4K5WA 4B9WA 5I6YA 3P1HA 5C4ZA 5KYLA 2ENBA 1SNOA 1EY5A 2KHSA 2RDFA 2F3VA 4ID6A 4K5XA 3RUZA 3SXHA 3C1FA 5IOCA 1JORA 3ERQA 1KDBA 3SHLA 4NP5A 2EYPA 2F0MA 1SYEA 4HMIA 5CC4A 2WACA 3DMUA 3OMCA 4ZUJA 2O4XA 5C6AA 2SNSA 4S3SA 5EKLA 1ENCA 3BDLA 3P75A 1F2MA 3QOJA 4TRDA 4KD3A 4YIJA 3TP8A 5J22A 2SOBA 4NDXA 1SYBA 5KGUA 1STNA 1EZ8A 1EY0A 1STHA 1SNDA 1SNQA 2F0SA 3MHBA 3NP8A 4HMJA 1F2YA 4NMZA 5C5LA 2F0QA 4DGZA 5JAVA 4KJNA 1U9RA 1EYCA 3EJIA 3ITPA 1SYGA 4LAAA 4OL7A 4WORA 3T13A 4MIUA 5IGFA 2EXZA 2EYHA 3QB3A 3SK4A 2SNMA 1SYFA 1JOOA 2F0UA 3TP6A 4KY7A 2F0OA 5IGGA 2RBMA 3MZ5A 1SNMA 4G57A 4J6HA 5NUCA 2EYMA 1KDAA 2F0EA 5EKKA 5I9PA 1A2TA 4KTAA 4ODGA 4HTHA 4EQPA 3SK6A 4F8MA 5C3XA 1STBA 3D6CA 4KY6A 3SK5A 2F0HA 5HGTA 3VA5A 4EVOA 3BDCA 4K14A 4KJOA 3S9WA 4DU9A 1SNCA 1A2UA 2F0IA 2EY2A 1TT2A 2EY5A 1STYA 4PMCA 3SR1A 3V2TA 5CR3A 1TR5A 2F0GA 5M9OA 1NUCA 4ZQ3A 2F0FA 2NUCA 5CV5A 5IGEA 2PYKA 5EGTA 5J39A 3TP5A 4RKBA 2OF1A 5KRUA 3TMEA 4K2KA 2RKSA 1IHZA 3OWFA 2F0JA 2M00A 4DF7A 1NSNS 2QDBA 1EY7A 5IODA 2F3WA 5C3WA 1STAA 4F7XA 5DAUA 3NXWA 5CV4A 4K8JA 1AEXA 2EYFA 5C4HA 1EY6A 1SYCA 2F0PA 3NUCA 5CV6A 3R3OA 3T16A 4ZUIA 3C1EA 3OSOA 3NHHA 2F0VA 4N9PA 1A3TA 5ISRA 3D4DA 4QF4A 5KEEA 3D8GA 3MXPA 4KY5A 1F2ZA 1JOKA 4KD4A 4E6IA 2PZWA 2PZTA 4K2LA 4K8IA 2OXPA 5KIXA 5CV7A 5I6WA 2PZUA 1EYAA 2F0LA 2HQEA 1EYDA 1ENAA 5KYIA 3QOLA 5I9OA 1TQOA 2EY1A
chains in the Genus database with same CATH superfamily
3O13A 1KQSA 1ICWA 1I4PA 4AQYL 1B8AA 3I4MG 4WJ3M 2E76C 2K01A 1PRTB 1EIFA 1N33L 1CT1D 3S2HB 3F1ZA 1QVFA 4GKJL 4HN7A 1WYDA 1FJGL 2HIVA 5DM73 1UAPA 5IGCA 4DUZQ 3RNUA 3BG3A 3MEHA 3W1BA 3A5UA 4DUZL 3PV0A 1BCPD 4QL5A 4LMQD 1N34Q 1B4OA 1HA5A 3T53B 3W1GA 4X3KA 2QA4A 4GLVB 1H9RA 2JA8B 2JE6I 4RGNA 5LL6X 4IUQA 2MQHA 3CMAA 1HQMC 4QIWB 4BBSB 4KD3A 3TP8A 2CWPA 1EQTA 4YWMA 3NP8A 3S9WA 4FF1A 4A3BH 1E2VA 4LAAA 2QCPX 1SYGA 1CUKA 1V8QA 5FJ8H 1DONA 3I55A 3ERSX 5FO9B 1YEZA 1QVCA 5GADC 4G7ZC 3PCOB 1Y1WB 1SNMA 2K14A 3HOZH 2NVQB 1DD2A 3CQZB 1RTOA 1S4ZA 4DPGA 3S1RH 1G291 1X3FA 4KY6A 1NAPA 5GAHC 1STYA 4A76A 1CI3M 1BR9A 3I4NH 2NYZD 2IX3A 3G6EA 1AN8A 2AUKA 1NUCA 2HHHQ 4Y52H 2O2LD 4LJZC 5CV5A 2LY7A 3VR2A 4DV3L 1VQ5A 4JBWA 2RKSA 1K0SA 2F0JA 1YNND 3E3XA 2UUCQ 3C2PA 4XYQA 2UUBL 2K5HA 2KCTA 2XWBB 4AYBG 4JBKA 2UUCL 3S2DB 5M3MH 1HZAA 1WJJA 2YTVA 1CTMA 4BBRG 4P2CB 4HJ5A 3U58A 3J81i 2K04A 1Z7TA 4DAYA 1JB3A 5KIXA 1HUMA 2PZUA 1EYAA 3JAMc 1BCPC 1RD9D 5LMNQ 4A3KB 1I50B 2VY3A 2XNAC 3QOLA 4JV5Q 3MA2B 3C46A 2PO4A 5LMNL 4LF4Q 5LMUL 1ET9A 4A3EG 2ES2A 1TIID 1GXDC 2GA4B 4KKSA 1GUSA 4BY1B 2K4KA 4LF9Q 4HR7B 1L0XB 3FP9A 4GLXA 2Q2TA 2UXDL 1BXTA 1PH8A 3PUXA 3U9OA 3KBXA 4LFCQ 1HZBA 2MO1A 3NE5B 1B7YB 1A3UA 3MXUA 3DXJC 3K0XA 2JA7G 4A3DG 3T4AC 4IZ8A 1KLGD 1R4QB 5BN4A 2ENBA 3M4QA 2E2DC 3I4MH 2B63B 4YWKA 4ZUJA 1VQNA 1VQ9A 1Q8KA 2NVYB 2Z9HA 3PIOA 1IZ6A 1CKNA 1VCIA 2QILA 3IL8A 5C4JH 2HIXA 2KCCA 4KJNA 1U9RA 3DWPA 2E8GA 1N32Q 1YNNC 4A3IG 2EJMA 5A2QL 4LWCA 1K83H 1LO5D 5ELBA 1Q7YC 5IGGA 2JEBI 2KBNA 4POGA 3GV6A 3A5ZB 4DV0L 4DV2L 3FPPA 1L1OB 2R7FA 4ULLA 4H44C 3CCQA 4DR2Q 4C3IH 4GOPA 2K5VA 3NBHB 2I07B 2WB1G 3S16B 3CRKC 4OX9Q 3CC2A 3GQBA 4B3SL 3TSSA 4OX9L 3TMEA 1PYBA 3PF4A 1IBLQ 3I8ZA 2JA6H 5C3WA 1M8AA 4DR5Q 3NXWA 3NWSA 3WWVA 2YU9B 4FP5D 1VQEA 2F0PA 4DV1L 4IFDJ 3NHHA 5ELCA 2UXCL 3MXNB 4BY7B 5C44B 3S14B 1Y8OB 3DWAA 2F0LA 1RODA 2HCIA 2BOSA 2AKWB 2R93B 2B8FA 1SAPA 3T1YQ 3E9HA 1PH4A 1KABA 1YITA 1MGSA 5CV9A 3CCVA 4JI3L 5JOBA 1O7IA 4IPCA 4PZ8A 1TKWB 2PQEA 3T1YL 3Q0AA 4QUFA 4PMBA 2F0KA 5IIFA 2GVBA 4FF3A 3P7JA 1NCVA 3NPPA 1VMPA 1QNUA 1TWAH 2RHSB 1SMYD 1XTCD 5M3FG 2GVAA 5GAGC 1PH6A 4V190 1JJ2A 2R7ZH 3R93A 2AWOA 3F2UA 4HIKA 3HOVH 1EEFD 3P1HA 1BO0A 2KHSA 3NSWA 1NMGA 2G5DA 4A3EH 3BZCA 2YTXA 2K75A 1YJNA 1X3EA 1LTGD 3PSIA 2F4IA 1B44D 1F2MA 5JJIA 2ZXOA 3J81c 2JA5H 1VQAA 2HT1A 2LXKA 3ITPA 4BXXH 1AH9A 3EIVA 1GO3E 1JOOA 4RG1A 4XQJA 4X64Q 5D65A 1AFPA 4CDEC 4FO2A 4QGUA 1P16A 4AYBB 1NJIC 2D0OA 1VQ7A 1HH2P 5ELEA 2E2HB 2DY7A 4B3TL 5A35A 1D1IA 2F1MA 4RKBA 1Z47A 2OF1A 2P5ZX 3RZDB 1HNWL 3H0GH 4TKOB 2NZHA 1QJOA 2Q8RE 4GOPC 3HOYG 1IL8A 2RF4A 5FLXE 2WINB 2MHVA 1EY6A 1LTLA 2BCOA 3RN5A 4JI7L 3EN2A 2L0CA 1SMYC 2ZT9C 3GO5A 3BU2A 4DR7L 1MSGA 5FO8B 1D5XC 3VR5A 4Q5VA 1SBBB 1LT4D 2JYOA 3K7AB 1WD0A 1XMOQ 1HFGA 1TQOA 1X32A 2JA7B 1SSOA 5CYUA 3K80C 3KOJA 2K1BA 1EU3A 2VQFL 1V1QA 4PNYA 5C0XJ 5M5YB 1E1OA 3PMFA 3UDXA 2N49A 3M4OH 2CFMA 4N9TA 3HFZB 2R3ZA 2MGSA 3GTKH 5IYDH 1GKHA 5DEHA 2NTTA 2E2IB 2ALYB 1R9TH 2J0TD 4ZCKA 2OT2A 1CM9A 4YY3Q 1SYDA 2E74C 2F0NA 4DN4M 3A8KE 2LKVA 3CW2C 1GHJA 1SNOA 2EIFA 5EPJA 3VDYA 5CORA 2N8NA 3K8AA 5IT9E 3ERQA 1KDBA 5H1SE 1M4VA 1BBWA 1CZGA 5C6AA 3J7ZC 2D62A 3GTJB 2VNUD 4HJ8A 5IP7G 5M3FH 5EPLA 1PRTC 1FNWA 2AWNA 5AJ3Q 2F0SA 2WB1B 1X6OA 3FHWA 3FKIH 2E5LQ 3I73A 4GNXA 5IGFA 3EA6A 4CGYB 2EYHA 1HR0Q 3CHBD 3AB9A 5AJ3L 4U68A 1Q3LA 2X69A 5C3EB 1PFMA 5EPKA 1CA5A 4J6HA 2EYMA 3OW7A 1A0IA 1E2ZA 3KLSX 4CDCC 4R4OA 5HGTA 3VA5A 4ZK9B 1XNQL 1A2UA 1ZKOA 4GS3A 4POFA 4JCVE 1T9HA 1LTTD 2VB3X 2FMCA 2IHEA 1XMQQ 1K0RA 5IGEA 3VR4A 3H91A 3TP5A 5KRUA 1ESRA 2FFKB 4O42A 4YWLA 4B08A 1AE2A 4KKUA 1D7QA 1X3PA 4J15A 4AIMA 1L1OA 3N6RA 1DOMA 4YCVA 5DLQE 5C4HA 3PO3G 5IYBG 1WTXA 1QNKA 2K5WA 4OELB 4MN3A 3GTOB 3K81C 3GTMB 2J7ZA 4LF6Q 4V0BA 2TMPA 3BZDB 4A3FH 3VYSA 1NTGA 1Y1VB 4P75A 1W2BA 4DKAC 4DNIA 4LF6L 1EEID 4ODGA 4XDXA 1HJPA 3WOFA 3MFGA 2XTIA 3K5LA 2Z4HA 1XPRA 2LXJA 1PHJA 2A73B 4HIMA 1EWIA 2HUGA 3OHXC 3H6MA 5JVH3 3MXNA 2MPMA 1JE5A 1TWCH 5JJZA 3GTPH 2D9UA 1BBUA 3E5SA 2NN6I 4DAPA 3CPFA 1WTVA 4OWXB 3HZXA 3CCUA 4JI1Q 2G9HD 2A6EC 1PH2A 3A7LA 4JOIA 4QB4A 4CHTB 2FMMA 3CU7A 4NW2A 2K03A 2WIIB 4JI1L 3I3CA 4C2MH 4XXEA 4CBVA 4HSVA 1PTOF 3DUZA 1VQ6A 5I2XA 4TRDA 4K0KQ 2DUDA 2EDGA 5IE8A 1GUOA 3S24A 1XXGA 5KYLA 2KVMA 4DK6C 1XTDA 3I72A 4JI6Q 1I4RA 1L2FA 2A6HD 1VQDA 1CFMA 4LF7L 5HGQA 1AZQA 1VQ8A 1G2SA 4QCLA 1C0AA 4O0AA 5FJ8G 4A3JB 1KNEA 1LACA 4HAEA 3MZ5A 2B2YA 2WP8J 3A8JE 2YTYA 5FOBB 3HOYB 4GKKL 5FO7B 4DNTB 5C3XA 3PUVA 1TWHB 2EY2A 3GTQB 3FRPB 2B2TA 3M3YB 1E2WA 4GN3B 4NXNL 1C8CA 2F0FA 4X66L 1BF4A 2X6LA 2PYKA 2V4DA 5EJWA 2L9HA 2PQAB 3ULPA 1GUNA 2F3WA 5JEAJ 2VUMG 2BDNA 4DA2A 2D2CC 4K8JA 4PZ6A 2CH4W 4RHRA 1HRJA 3R3OA 5D14A 3ZYYX 5M3MG 2R7DA 2ICIA 2NTSA 4QF4A 4G4KA 4KY5A 5BN5A 1UE6A 1J8IA 1GHKA 1U0LA 2QF7A 4IQZA 4RHSA 1L1OC 4XT3B 4MTKA 5FK9C 5CBAE 2A68C 1LLRD 3L9AX 1CZWA 4CKCA 1Q46A 3M85A 4IFDH 2GN5A 4RKLA 3S2HH 1O7YA 2QGQA 3CC7A 1LT6D 5F2DA 3A54A 4ILWA 2XN9C 2VQEL 3IFTA 4JI0Q 3JAML 2ZTCA 4R8NA 1NMFA 3T56B 1B1ZA 1KRTA 1UE1A 4JI0L 1EY4A 4EX5A 2A6HC 4HJ9A 1I6HB 4DV7L 3SK8A 1E1TA 1YHBA 4X65L 4G7HC 1I4XA 2OQ0A 1B3AA 1V1OA 1MBYA 4ZKBB 2HDMA 3K5MA 2B8GA 4ID6A 5T1IA 1ASZA 2KA7A 1D1KA 4WFN3 1ICFB 4BBSH 1D2BA 1E22A 3KDFB 1VQ4A 2WAQE 1PV4A 1QE6A 3H94A 5KNCA 1KRSA 1I6VC 2SEBD 2L4NA 4JOIC 1UWVA 4UDUC 5EBCA 4WJWA 1Q1BA 3H15A 1NY4A 5C4XB 3S17B 4NMZA 1SNDA 2B2UA 4HMJA 1F2YA 5JAVA 1HTPA 4OL7A 2PNHA 4DR3Q 1VQLA 1Q12A 2SNMA 3FPUB 2IPKD 1DGSA 1NR2A 1C4QA 2F0UA 1DCZA 4DR3L 2Z6BA 1WTPA 3GTGH 4X3SA 4OO1G 3LNNA 1N34L 1Q82C 1SN8A 1PZKD 1STBA 1QCBD 1DYQA 4FXGC 4K14A 4JC0A 3PIPA 3HP3A 5G3LF 4TSSA 4C3IG 1KLUD 2B2YC 3A56A 2PPBC 2KCMA 3PUYA 3K6OA 3RN2A 5EGTA 1XWEA 3J7AF 1WTOA 1YNXA 3BYYB 1V1PA 2VXWA 1RHPA 1STAA 3I7FA 2B2TC 3DEOA 3OW2A 1PH5A 1HNXQ 2JA6G 1S5CD 2EPBA 3OYYA 1MSHA 1HNXL 2E2JH 1G6PA 1AW7A 4TVAB 4A3KH 1VQIA 4KD4A 4DV4Q 1QILA 1J6QA 4LF5Q 4G7OC 4DV6Q 4JVZA 3HKZG 3TZDA 1EYDA 3J80E 2YYZA 1ML0D 4BWGB 4BY1H 2KQ3A 1ASYA 2VUMH 2HHHL 3G7LA 4IURA 4KHVA 3SEBA 3HGBA 4LUOA 1SE4A 3EROA 2CH4A 4H02A 2Y0SG 3HOUG 1UNSA 4OHJA 4R4CA 3CCJA 3BYTB 1CKOA 4ZKCB 1Q86C 3EBEA 1SRUA 3TQYA 2Q2HA 5C0XH 1X65A 3G4SA 2OCEA 2KEDA 2CQAA 4C1NK 2F0DA 3J80c 5I6YA 2OWOA 2R7ZG 4A3BB 4Y7NH 2WAQG 1EIYB 3HOVG 2DN8A 5GQOA 1GM5A 4DR6Q 4JV5L 3HOXB 2BA0A 4IOCA 3T1HQ 4A3LG 4C3HB 1M90C 4LF4L 3HOZB 1ENCA 2BA1A 1MI2A 1BQQT 4NDXA 3S1RB 2NVTB 1SYBA 5KGUA 4LF9L 3LWUA 1EY0A 3MHBA 2JA5G 4KHPQ 3RR5A 4HJ7A 4IPGA 4QJFA 3R2IA 3I4NB 1S72A 1V9PA 4LFCL 3K7UC 4BXXG 4CJ2C 2F52A 2KJXA 3J81L 2C35B 5JPMC 3K57A 4KMUC 1TS4A 4JBJA 4PV1C 2B2UC 4YHHQ 4A4IA 3S16H 2KEEA 1D8LA 4EVOA 3PO2H 3Q23A 3KLRA 2ASBA 3N52A 3V2TA 5M3MB 4PZ7A 1TR5A 2KCNA 4CJ0B 4L63B 2R92H 3D0FA 4U673 1M1KC 1I4HA 5IODA 1EFWA 4DV5Q 4A3MB 2B2VA 4RFBA 4OO1H 1N32L 3KF8A 3GTLH 3H0GG 3D4RA 1H9SB 3MWYW 1ZEQX 5CV6A 3ULJA 1RCVD 1UUPA 3OSOA 4Q0FA 1PLFA 2R93H 3MXPA 4QQBX 5TSSA 4LFBQ 1SMXA 1ET6A 3PIP3 3U4VA 4A93H 4DR2L 2CW0D 2ATWA 2PQAA 4LFBL 4DXGA 3WDNA 2L5TA 4ME3A 2IL8A 4JI2Q 4B3MQ 2UUAQ 1IBLL 3I4MB 1JB7A 3RMHA 5IGDA 4DR5L 1WVLA 4XQQA 2A74C 1BCPF 2DNCA 1EYGA 1II3A 3NK9A 1C48A 1H9JA 2MUYA 2IW3A 4I7AA 5J3BA 5IYDG 4WRDA 1G8ZD 4I65A 2K5QA 3KBGA 5C4JB 3KF6B 4NB3A 1XNRQ 3D31A 4ME5A 3S1QH 2Q8IB 2QKIC 3PUWA 4DK0A 4EQ5A 3OIPA 2LSSA 4NP5A 2F0MA 4X3TA 3DMUA 1SE3A 3S15H 1WI5A 4HSPA 3HOUH 2QW7A 4IJLA 1CQVA 4L5QA 1ZYRD 3SDZA 3AFPA 5M5XB 4LFAQ 4X62Q 4C3IB 1X3GA 3L3OC 4C3JG 4DUYQ 3FKIG 2OTLA 1I3QH 3KDFA 3UE0A 1MJEA 5KNBA 2F0OA 1I4QA 1E24A 4RGOS 1WD1A 5CBEE 5NUCA 5L37A 4A3LH 4KTAA 1CHQD 2Q2IA 4F8MA 2X6GA 1SFOH 4KJOA 3TS0A 1IYVA 4NXMQ 4P73A 4JI8Q 3E0JA 2F0GA 2MP1A 3JC66 4HIDA 3RZDH 5CMDA 5IP9H 5M5WH 4IUVA 4NXML 3HKZB 3HRZC 1OXXK 4K2KA 2EQSA 4ZLTF 2NVXB 1S5ED 4TQUS 5A2QE 3CCEA 1WOCA 2NBFA 2FINB 1JWSD 3NTHA 2EZVA 4ZRZA 2Q2UA 4X64L 4L6TB 2A69D 1K9MC 1X54A 4BBRB 2B2VC 2R61A 2N78A 1SJHD 2PMZB 2A1AA 4A3FG 1VQGA 5C5MA 1HFNA 1VF5C 2XIWA 3GD7A 1IYJB 5M5YH 1S5BD 3BDOA 4JYAQ 3EQLC 5CV8A 4A3EB 3VR6A 4LF8Q 1VQFA 3FMCA 5EAYA 3L2PA 1EQQA 1ZYRC 4LW1A 4HEDA 4CJ1B 4LF8L 2EE1A 1FD7D 2OQKA 1YIJA 3RLFA 2N88A 2BE5D 2JA5B 1FNUA 3TP7A 2WFWA 4R4QA 1I94Q 2F4VQ 4PQXA 4B9WA 4XIGS 4A3DB 1KNAA 4K5XA 1EFID 1PH3A 1CA6A 1XMOL 1I94L 5HY6A 2C9OA 2K6AA 4OIJA 4R9WA 3G6JB 4B3RQ 3TDQA 4KHZA 2SNSA 5FLXc 1V43A 5DM63 3P75A 5E4XA 3QOJA 2KECA 1P8LA 4QIWE 1W3SA 3OIQA 5C3EH 1A6XA 1K8AC 2AUJD 2AQ3B 5FLMH 3KYHC 4K6LA 1SDFA 5AFWA 1TS3A 4IN3A 4A3IB 5E4WC 3S1MH 2DY8A 5COYA 4QY7A 2I5MX 4YY3L 3BVMA 2K7VA 3VYUA 4HTHA 3DLLA 1O7LA 4MHEA 3SK5A 3RZOH 2A69C 1Y8NB 1EIHA 3BDCA 1Y14B 4DU9A 1SROA 2F0IA 1TT2A 4FNFA 1Y69U 2WKCA 2Z6KA 3CAMA 5M9OA 1LYLA 5KNDA 2JJQA 4C3JH 2NUCA 1BUVT 3FVQA 1TWFH 3CKIB 4DF7A 2E5LL 1J5EQ 1HR0L 5DAUA 5IY0A 2V1CC 3GTMH 3AU7A 5IT9c 1BOSA 1HHVA 1O78A 1Y1VH 1RDPD 1A3TA 2DNEA 3SVMA 3A8IE 2BE5C 1GUWA 3M4OB 3OOCA 1JJCB 1CK1A 3GTKB 2K5DA 2CWAA 4X3UA 1H9SA 2KHJA 5BR8Q 4IFDG 1XMQL 1KHIA 1LTSD 4KN4C 3OMGA 3EVQA 5BR8L 3NQTA 3X3NA 2MNAA 3NBHA 2F0TA 3TZUA 1YI2A 4QUCA 5EBDA 1TVXA 1RL2A 1A62A 4LUVA 1HA6A 5M3FB 1STEA 1VQMA 4Z9CB 2EYLA 1SNPA 2EYJA 1EUJA 2K32A 2JA8G 2F3VA 1G6ZA 1N36Q 1FYCA 3C1FA 3MEFA 1JORA 1PZID 1Y8PB 4BBSG 1TWGH 4S3SA 5EKLA 2IHFA 1NNXA 4RCOA 3S1NB 1STNA 1GVPA 2M2LA 2VZAA 3RD4A 4DAYB 1OXSC 2EXZA 3I4LA 3SK4A 1GUGA 1Y1WG 1KXLA 2EXDA 4PG3A 1WCMH 3OTOQ 1KDAA 1K8GA 3DWQA 5IWAQ 4IUUA 1O7ZA 1X9NA 3HOWH 1FL0A 1PRTF 1IYUA 1VQCA 2EJGC 3KLSA 1HZCA 5JVG3 2JEAI 4HIOA 1FR3A 4K0KL 2L15A 1C9OA 1VDZA 2VL6A 4KK7A 1NSNS 4JI6L 3J7YW 5LL6S 1ILPA 4JI5Q 2Z6KC 3I70A 5CV4A 1BBXC 3V96A 1DZ1A 1B53A 3X3MA 2VW9A 2Z8LA 1SE8A 4JI5L 1LT3D 4ZUIA 3J81j 1MIUA 4DXFA 4N9PA 3H09A 4JI4Q 3NWTA 3H3VI 2IX1A 3D6WA 4A3KG 4A3GH 4OWTB 1K73C 1VQKA 3ND9A 2I5LX 1CKMA 2R6GA 3UI2A 2XWJB 1N8RC 3CMEA 2RSOA 3J80i 1PFNA 4BY1G 1PYWD 4IUNA 3J7A5 3I2ZA 2OEOA 2F0WA 5E1FA 1HNZQ 3Q6SA 1A63A 5JJKA 1OXUA 1F9QA 2RHQB 2YV5A 1S5DD 4JW0A 2EYOA 1HNZL 1QWYA 4J8QA 5K36H 3F2DA 3BJUA 1SLJA 3I90A 2ZTDA 4OEMB 3A55A 3M4YA 2EOTA 4N8FA 2IY5B 1G2TA 4X6AH 3QWNA 3KFUA 4UPAA 3LGJA 2MJ8A 2AQ2B 2Q8TA 1EOTA 5C0XG 2E75C 1U4MA 2FHTA 2RDFA 3ER0A 4JPBW 3DM3A 5C4ZA 1HUNA 3NENA 3GV3A 4R4IA 5IOCA 1K3BC 5C4XH 4HMIA 2WACA 3K59A 3S17H 2O4XA 1YJ9A 4KN7C 2B29A 2I46A 2RDGA 1TS5A 4LUZA 1K3RA 3TREA 1QZGA 1IBKQ 1SXTA 3J80L 1F2LA 1XX8A 3ULLA 1CSQA 4BA1I 1OXVA 3VR3A 3QB3A 2CCZA 1JICA 1UEBA 2ICEC 1RF2D 2JA8H 2JQOA 1TU2B 4I7ZC 2PCFB 2RCFA 4ZAIA 3AYHB 4YCWA 4EQPA 4APVA 4OXPA 4C1NI 4KI0A 1IBMQ 4AYBE 3STBD 1DOKA 4IPDA 3SR1A 3PO2G 1G51A 1SE2A 1IBML 3ICEA 2PMZE 2QEJC 1Y1WH 2NVQH 4WJ4A 4RWSC 4RCNA 3CQZH 1IHZA 1S3OA 2R92G 4BA2I 5LMNW 1N33Q 1EY7A 1Q8IA 1FGUA 1F9RA 4HCEA 3CCMA 5E7NA 4GKJQ 4F7XA 1JR0D 2Z1CA 3TEHB 1FJGQ 1PTOB 1AEXA 2F3IA 1YJWA 2RA4A 1DXMA 1QG7A 4BY7G 5C44G 3R8BA 3PO3B 2NZ1D 2OTJA 1D5ZC 3HKSA 2R93G 1CHPD 3TS2A 2ID0A 3E6ZX 2LS01 1EQRA 5I9OA 2K28A 4A93G 2K50A 1STGA 2IX0A 4K5VA 3S2DH 3I4OA 4OWWB 2JN4A 1T5XD 2A5HA 5CGKA 4QMGA 2C5CA 5J1ZA 3PQIA 4A3CG 2ZXPA 1T5EA 3OPOA 1WTHA 5EKIA 4ALPA 4UY8C 1UE5A 2K33A 1I50H 2HQLA 1GOZA 1JOQA 1JQYD 2EY6A 4CKEA 3VYTA 3AEVA 2WV6D 4GLAC 4DV4L 4KKTA 3W3AA 4UP7A 3HOXH 4LF5L 3BVZA 3G71A 4C3HH 4DV6L 2NVTH 2B2WC 2EYPA 5CC4A 1H9MA 3STBC 3M4PA 3GTGB 3QJYA 2RVLA 1JWUD 2VS1A 4ABNA 3C3LA 1U4PA 2WKDA 5LHY1 3JAME 4DV3Q 3FDTA 5T1GA 4RMFA 4DGZA 2F0QA 1PVOA 1W6KA 3RLOA 1YVCA 1EWHA 1TY0A 2FJ2A 3K5NA 2UUBQ 2WB1E 5IYCG 2XRSD 1YZ6A 3KJPA 1GUTA 3F2BA 2B63H 4P74A 1SYFA 2K05A 3CRLC 4DAMA 4IFDI 4CDDC 2NVYH 1JMCA 2F0EA 5I9PA 1LT5D 3G48A 3SK6A 4NPSA 3D6CA 4JK1C 2F0HA 3M7NA 1QB5D 4O1NA 2JP1A 2ZM6Q 4DR6L 1MKHA 3E0EA 3T1HL 1S40A 3EFXD 2E2JB 3MTSA 1O80A 3KUPA 3Q22A 4A3MH 2ZM6L 4ZQ3A 4DR1Q 5LMUQ 1DOLA 4R8IA 5IP9G 2Z0SA 4KHPL 4OIKA 1TY2A 1KIXA 4DR1L 2QDBA 4IUPA 1LABA 3NTKA 2UXDQ 3VYRA 1EWCA 3WOEA 1Z6HA 2EYFA 4RGTA 2VUMB 1OXTA 1WTQA 1DJRD 4JG2A 3QR8A 1JJGA 1Z9FA 4YHHL 4E6IA 4UAIA 3F2CA 1B3QA 3UDGA 2A8VA 1U5KA 3QG1A 3AMUA 1PH9A 3MFYA 1S5FD 5JEAG 1ENAA 3V05A 5KYIA 3CXCA 3CC4A 4GNXB 1EU4A 3M9BA 2YU9H 2RDHA 1IW7D 5HURA 5GAEC 3DM1A 4DFAA 1IL2A 3ND8A 4Y7NB 4BY7H 4MNOA 5C44H 3S14H 4DV5L 5ELDA 1EY9A 3DHQA 1H9KA 3BZKA 1JCKB 3P20A 1ENFA 5BN3A 3PF5A 3QO2A 1MJCA 1EQVA 4BS9A 3HEJA 3GP7A 4DK3C 1Q1EA 3CCSA 4DV0Q 3KK7A 4DV2Q 1EOVA 1PDQA 1AZPA 1DM0B 2MO0A 4A3CH 1RJTA 1VQJA 1XPUA 4FF4A 2AQ1B 4H0LC 1KD1C 5M5XH 4JI2L 2CHBD 1E0BA 2SOBA 2NN6G 4B3SQ 1PFBA 3K58A 4B3ML 2DJFC 2RQXA 1EZ8A 4B9XA 2H5XA 1SNQA 2UUAL 3A74A 1D5MC 1SJED 3PO2B 3K5OA 1LTRD 3EJIA 4MTNA 4MIUA 1VMCA 5C3EG 2IJ0A 1J9OA 4H13C 3UDIA 5FLXL 3H3VC 4DV1Q 2R92B 5FLMG 2NB0A 4O2DA 1WTRA 1XNRL 2UXCQ 1K83B 3TBIB 4JBMA 1ONLA 1XYIA 2K5NA 3IKJA 3GTLB 3OWEB 2L12A 1FVIA 4PMCA 4CKBA 2NVXH 3ONAB 3CD6A 4JI3Q 5IYCH 1HXYD 4R1JA 1Q90A 4R4TA 3L0OA 1AP0A 1IW7C 5C0XI 4LFAL 4X62L 4A93B 4DUYL 3NELA 1D6EC 5D3DA 3J81E 3NUCA 3TN2A 4BBRH 2E2HH 2JA6B 5GROA 1I4GA 3UE1A 4LNQA 2UXBQ 1MHWC 1Y1VG 5I6WA 2CW0C 1VQPA 1B9MA 2UXBL 2HQEA 3MAQA 1HTLD 4JI8L 3KLWA 4NKLA 4F88A 5IGBA 5IT9L 4EQNA 5ELOA 4CDFC 2XSCA 2ZJQA 2PNRC 3S1QB 1X56A 1PH7A 3MXGA 2B3GA 1B2TA 1KAAA 2H1EA 3F8TA 4RH6A 5DNFA 4EQOA 3K7AH 3UDFA 4IOAA 2CKZB 3S15B 2Y0SB 3HOUB 2BH2A 2JA7H 4A3DH 5JEAH 4HJAA 2NZOA 1BVSA 1TWAB 4FXDA 2QDLA 1QVGA 1EY8A 2PW5A 3PUZA 4K5WA 4OGQC 2N3SA 1EY5A 1ESFA 3SXHA 1HR0W 4AH6A 5I4DA 1OTCA 1F9SA 2H4OA 1JT8A 2R7ZB 1PYSB 2WAQB 2HD3A 1I3QB 3HOVB 1K28A 1SYEA 3OMCA 4OO1I 4JYAL 3W5OA 1HQRD 4B3TQ 4F87A 2JXMB 2E2IH 1BDOA 3PIO3 1SFOB 1STHA 1PTOD 1HNWQ 1PRTD 1UE7A 3IFDA 4A3IH 5D3IB 3T13A 4A3JG 4M1UB 4XT1B 3ZJYC 1VF7A 5M5WB 3TP6A 4JI7Q 1C7YA 1NE3A 3AQQA 3GTJH 2F4VL 4DR7Q 5EKKA 1K8MA 1JC7A 3GDEA 1WCMG 1VS0A 1BCPB 2I5HA 2NN6H 3HOWG 4B3RL 1QUQB 1LTID 3NTIA 2KUMA 1L0YB 4UHVA 2VQFQ 3OWFA 2XVSA 1UEAB 2O5JC 4IPHA 1KL9A 1FNVA 1SYCA 3PGZA 3H0GB 3R2TA 3T16A 5JPNC 3D3RA 4DNRB 4A75A 3CCRA 5KEEA 3D8GA 1LV9A 1JOKA 4RGMA 2PZWA 2PZTA 4K2LA 3AFQA 2PI2A 4K8IA 4P71A 4A3GG 4PMWA 3U50C 1WTWA 4KV6A 4IALA 4H7BA 3D4WA 2IWHA 1BNZA 3HS0C 3A0JA 2PW7A 3U4ZA 2QEXA 1A3VA 3GTOH 3B6YA 1KDCA 1RKNA 3H3VH 1J5EL 4DR4Q 4K6DA 1YNJD 1X55A 3LX0A 1PTOC 3I91A 5K36G 4DR4L 2J4XA 4KLKA 1KAWA 1N9WA 4N8X1 1VQBA 1PH1A 4FXKC 2VB2X 2A6ED 3KJOA 3U9SA 1R9TB 2UU9Q 4UP9A 2F03A 1XNQQ 3S1NH 2FXQA 2L55A 2DGYA 1YBYA 1V1PB 2LMCB 4RAUC 1ZXTA 3SGIA 4L5RC 4FF2A 2UU9L 3S1MB 2EJFC 5C4XG 2N55A 1NBWA 1LTBD 4YIJA 1CSPA 4M8AA 3RZOB 2CVRA 2TSSA 1EYCA 1SEBD 1LTAD 2PI2E 3TRZA 2O5IC 4IJHA 4C3JB 4L8JA 3FKIB 1F77A 1TWFB 4GZYC 1GD7A 1YHAA 1ILQA 1FGBD 2BH8A 1L0WA 1N36L 4UP8A 1TXYA 2ZJPA 2AHOB 3I56A 3IRBA 5CR3A 1XPOA 3RLNA 4A3JH 3KF6A 2CQOA 1PA6A 2L1BA 2SDFA 1TS2A 5G3LD 5J39A 4RA8A 3CF5A 4XYOA 1B50A 2M00A 2XGTA 3HOYH 1G91A 4HCSA 1PMRA 1TWHH 1IKMA 4OONA 1K8OA 3GTQH 1YNJC 1MD2D 5I2YA 3M3YH 3A7AB 3W2DA 3OTOL 1HCZA 5ISRA 3D4DA 1OO9B 4P72A 5IWAL 4L5TA 4L5SA 2OXPA 3IAYA 5CV7A 1U4LA 1IKLA 1X3QA 1IXRA 2A68D 2HCCA 2EY1A 5C5LA 3MC0B 3VA7A 4A3FB 3MVVA 2EVBA 2NWGA 4GN4B 1EIGA 5E3FA 3Q24A 4MZ9A 1E3PA 2Z4IA 3NBIA 5ELFA 1I5FA 1RTNA 1E7ZA 5FKAC 2D5DA 3M7GA 4LF7Q 1EZ6A 1JWMD 3BS1A 4FYDA 1TWGB 3NQIA 2L11A 4J1MA 4A3BG 1CKNB 4JI4L 1TWCB 1A8VA 4FDBA 4IO9A 3GTPB 1R4PB 2XRQD 5EQ0A 4DK1A 2KOLA 4GKKQ 3DEPA 1AE3A 1LUZA 5ELNA 4IUTA 3FEWX 3RUZA 3HOXG 1JE4A 1VQOA 4YCUA 1BKBA 4C3HG 1XJVA 1QOHA 3SHLA 1VQHA 1QZHA 3BVGA 3HOZG 5JJLA 4GNXC 3KF8B 3J7AV 5IP7H 1I6HH 2KHIA 4NXNQ 1WCMB 1A15A 2ZTEA 3BDLA 1SR3A 4GN5A 4X66Q 5J22A 4FVMA 4C2MB 1CQFA 4DAVA 1RIPA 2KENA 3K0YA 2IT1A 2JK8A 2A19A 3HOWB 5K5PA 3I4NG 4LK1C 2B2WA 2JSOA 4ZYSA 3JAMi 3L7ZC 4WORA 2MFIA 4GOPB 3NEMA 2JA9A 3CCLA 4EGVA 2HDLA 2B63G 2K52A 4KY7A 2RBMA 3LWEA 4G57A 3HG9A 2I0QA 1A2TA 1KTKA 1YHQA 1F9PA 1WFQA 1Q81C 1U4RA 1LM0A 1PZJD 1SNCA 3QIAA 4XQNA 2EY5A 2M9VA 1EL0A 1PFSA 2DJGC 4C56C 1KC8C 1B9NA 1GJXA 1W6JA 3URYA 2D0PA 1IBKL 1PTOH 2ZJRA 4A3MG 3CP0A 1PXUA 4A3GB 2RSNA 3HKZE 2VQEQ 2G9DA 2BDOA 2LFNA 3PO3H 5IYBH 2AMCB 4XTCS 3CPWA 1H95A 2RCNA 3E9IA 4DV7Q 1QUQA 3C1EA 3T51B 2F0VA 1B70B 4X65Q 2ZXRA 1F2ZA 2Y0SE 1HPCA 3SE0A 1NR4A 3Q8DA 2B39A 4AQYQ 1HZ9A
chains in the Genus database with same CATH topology
3O13A 1ICWA 1I4PA 2E76C 2K01A 1PRTB 1CT1D 3S2HB 4HN7A 5DM73 1UAPA 5IGCA 3BG3A 3MEHA 3PV0A 1BCPD 4LMQD 1B4OA 1HA5A 3T53B 4X3KA 1H9RA 2JA8B 2JE6I 4RGNA 5LL6X 4IUQA 1HQMC 4QIWB 4BBSB 4KD3A 3TP8A 1EQTA 3S9WA 3NP8A 4FF1A 1E2VA 4LAAA 2QCPX 1SYGA 1V8QA 1DONA 5FO9B 4G7ZC 1Y1WB 1SNMA 2NVQB 1DD2A 3CQZB 1RTOA 1S4ZA 1G291 4KY6A 1NAPA 1STYA 1CI3M 1BR9A 2NYZD 2IX3A 1AN8A 2AUKA 1NUCA 2O2LD 4LJZC 5CV5A 2LY7A 3VR2A 4JBWA 2RKSA 2F0JA 1YNND 3C2PA 4XYQA 2XWBB 3S2DB 1CTMA 4P2CB 2K04A 1Z7TA 4DAYA 1JB3A 5KIXA 1HUMA 2PZUA 1EYAA 1BCPC 1RD9D 4A3KB 1I50B 2XNAC 3QOLA 3MA2B 3C46A 2PO4A 1ET9A 1TIID 1GXDC 2GA4B 4KKSA 1GUSA 4BY1B 4HR7B 1L0XB 1BXTA 3PUXA 3U9OA 3KBXA 3NE5B 1A3UA 3MXUA 3DXJC 3T4AC 4IZ8A 1KLGD 1R4QB 5BN4A 2ENBA 2E2DC 2B63B 4ZUJA 2NVYB 1VCIA 2QILA 3IL8A 2KCCA 4KJNA 1U9RA 3DWPA 1YNNC 2EJMA 5A2QL 1LO5D 5ELBA 5IGGA 2JEBI 3GV6A 3FPPA 4ULLA 4H44C 2I07B 3S16B 3CRKC 3GQBA 3TSSA 3TMEA 3I8ZA 5C3WA 1M8AA 3NXWA 3NWSA 2YU9B 4FP5D 2F0PA 4IFDJ 3NHHA 5ELCA 4BY7B 5C44B 3S14B 1Y8OB 3DWAA 2F0LA 1RODA 2HCIA 2BOSA 2R93B 2B8FA 1SAPA 1KABA 1MGSA 5CV9A 5JOBA 1TKWB 2PQEA 3Q0AA 4QUFA 4PMBA 2F0KA 5IIFA 4FF3A 3P7JA 1NCVA 3NPPA 1VMPA 1QNUA 1SMYD 1XTCD 4V190 3R93A 2AWOA 3F2UA 1EEFD 3P1HA 1BO0A 2KHSA 3NSWA 1LTGD 2F4IA 1B44D 1F2MA 2ZXOA 3ITPA 1JOOA 4XQJA 5D65A 1AFPA 4FO2A 4AYBB 5ELEA 2E2HB 2DY7A 5A35A 1D1IA 2F1MA 4RKBA 1Z47A 2OF1A 3RZDB 4TKOB 2Q8RE 1QJOA 1IL8A 5FLXE 2WINB 2MHVA 1EY6A 2BCOA 2L0CA 1SMYC 2ZT9C 3GO5A 1MSGA 5FO8B 1D5XC 3VR5A 4Q5VA 1SBBB 1LT4D 2JYOA 3K7AB 1WD0A 1HFGA 1TQOA 1X32A 2JA7B 1SSOA 5CYUA 2K1BA 1EU3A 4PNYA 5C0XJ 5M5YB 3PMFA 4N9TA 2R3ZA 2MGSA 5DEHA 2NTTA 2E2IB 2J0TD 2OT2A 1CM9A 1SYDA 2E74C 2F0NA 4DN4M 3A8KE 2LKVA 1GHJA 1SNOA 5EPJA 5CORA 5IT9E 3ERQA 1KDBA 1M4VA 1CZGA 5C6AA 2D62A 3GTJB 2VNUD 5EPLA 1PRTC 1FNWA 2AWNA 2F0SA 2WB1B 3I73A 5IGFA 3EA6A 4CGYB 2EYHA 3CHBD 3AB9A 4U68A 1Q3LA 2X69A 5C3EB 1PFMA 5EPKA 1CA5A 4J6HA 2EYMA 3OW7A 1E2ZA 3KLSX 5HGTA 3VA5A 4ZK9B 1A2UA 1ZKOA 1LTTD 2VB3X 2FMCA 5IGEA 3VR4A 3H91A 3TP5A 5KRUA 1ESRA 2FFKB 4O42A 4B08A 4KKUA 1X3PA 3N6RA 1DOMA 5C4HA 1WTXA 1QNKA 2K5WA 4MN3A 3GTOB 3GTMB 2J7ZA 4V0BA 2TMPA 3BZDB 3VYSA 1Y1VB 4ODGA 1EEID 4XDXA 3WOFA 3MFGA 3K5LA 2Z4HA 2A73B 2HUGA 3OHXC 3H6MA 5JVH3 3MXNA 2MPMA 5JJZA 2D9UA 3E5SA 2NN6I 4DAPA 1WTVA 3HZXA 2G9HD 2A6EC 3A7LA 4QB4A 4CHTB 2FMMA 3CU7A 4NW2A 2K03A 2WIIB 3I3CA 4XXEA 4CBVA 4HSVA 1PTOF 3DUZA 5I2XA 4TRDA 2EDGA 1GUOA 5KYLA 1XXGA 2KVMA 3I72A 1I4RA 2A6HD 1CFMA 1AZQA 4QCLA 1G2SA 4A3JB 1KNEA 1LACA 4HAEA 3MZ5A 2B2YA 2WP8J 3A8JE 5FOBB 3HOYB 5FO7B 4DNTB 5C3XA 3PUVA 1TWHB 2EY2A 3GTQB 3FRPB 2B2TA 3M3YB 1E2WA 1C8CA 2F0FA 1BF4A 2X6LA 2PYKA 2V4DA 5EJWA 2L9HA 1GUNA 2F3WA 5JEAJ 2BDNA 4DA2A 2D2CC 4K8JA 1HRJA 4RHRA 3R3OA 5D14A 3ZYYX 4QF4A 2ICIA 2NTSA 5BN5A 4G4KA 4KY5A 1J8IA 1GHKA 2QF7A 4IQZA 4RHSA 5FK9C 4XT3B 5CBAE 2A68C 1LLRD 3L9AX 1CZWA 4CKCA 3M85A 4IFDH 4RKLA 1O7YA 1LT6D 5F2DA 3A54A 4ILWA 2XN9C 3IFTA 3JAML 4R8NA 3T56B 1B1ZA 1EY4A 2A6HC 1I6HB 3SK8A 4G7HC 1I4XA 1B3AA 1V1OA 1MBYA 4ZKBB 2HDMA 3K5MA 2B8GA 4ID6A 5T1IA 2KA7A 1D1KA 4WFN3 1D2BA 1QE6A 3H94A 5KNCA 1I6VC 2SEBD 2L4NA 4UDUC 5EBCA 4WJWA 1Q1BA 5C4XB 3S17B 4NMZA 1SNDA 2B2UA 4HMJA 1F2YA 5JAVA 1HTPA 4OL7A 1Q12A 2SNMA 3FPUB 2IPKD 1NR2A 1C4QA 2F0UA 1DCZA 1WTPA 4X3SA 4OO1G 3LNNA 1PZKD 1STBA 1QCBD 1DYQA 4FXGC 4K14A 3HP3A 5G3LF 4TSSA 4C3IG 1KLUD 2B2YC 3A56A 2PPBC 3PUYA 3K6OA 5EGTA 1XWEA 3J7AF 1WTOA 3BYYB 1V1PA 2VXWA 1RHPA 1STAA 2B2TC 3DEOA 1S5CD 2EPBA 1MSHA 1AW7A 4KD4A 1QILA 4G7OC 3TZDA 1EYDA 3J80E 2YYZA 1ML0D 4BWGB 2KQ3A 3G7LA 4IURA 4KHVA 3SEBA 3HGBA 1SE4A 3EROA 1UNSA 4OHJA 3BYTB 4ZKCB 5C0XH 2KEDA 4C1NK 2CQAA 2F0DA 4A3BB 5I6YA 2DN8A 3HOXB 2BA0A 4C3HB 3HOZB 1ENCA 2BA1A 1MI2A 1BQQT 4NDXA 3S1RB 2NVTB 1SYBA 5KGUA 3LWUA 1EY0A 3MHBA 3R2IA 3I4NB 4CJ2C 2KJXA 3J81L 5JPMC 3K57A 4KMUC 1TS4A 4PV1C 2B2UC 2KEEA 4EVOA 3Q23A 3KLRA 3N52A 3V2TA 5M3MB 1TR5A 2KCNA 4CJ0B 4L63B 4U673 1I4HA 5IODA 4A3MB 2B2VA 4RFBA 4OO1H 3KF8A 3D4RA 1H9SB 3MWYW 1ZEQX 5CV6A 1RCVD 1UUPA 3OSOA 4Q0FA 1PLFA 3MXPA 5TSSA 1ET6A 3PIP3 2CW0D 4DXGA 3WDNA 2L5TA 2IL8A 3I4MB 3RMHA 5IGDA 1WVLA 4XQQA 2A74C 1BCPF 2DNCA 1II3A 3NK9A 1C48A 1H9JA 2MUYA 2IW3A 4WRDA 1G8ZD 4I65A 2K5QA 3KBGA 5C4JB 3D31A 4ME5A 2Q8IB 2QKIC 3PUWA 4DK0A 3OIPA 4NP5A 2F0MA 4X3TA 3DMUA 1SE3A 4HSPA 1CQVA 1ZYRD 3SDZA 5M5XB 4C3IB 3L3OC 4C3JG 5KNBA 2F0OA 1I4QA 4RGOS 1WD1A 5CBEE 5NUCA 4KTAA 1CHQD 4F8MA 2X6GA 4KJOA 1IYVA 3E0JA 2F0GA 2MP1A 5CMDA 4IUVA 3HKZB 3HRZC 1OXXK 4K2KA 4ZLTF 2NVXB 1S5ED 4TQUS 5A2QE 2NBFA 2FINB 1JWSD 3NTHA 2EZVA 4ZRZA 4L6TB 2A69D 4BBRB 2B2VC 2R61A 1SJHD 2PMZB 5C5MA 1HFNA 1VF5C 2XIWA 3GD7A 1S5BD 3BDOA 3EQLC 5CV8A 4A3EB 3VR6A 3FMCA 1ZYRC 4HEDA 4CJ1B 2EE1A 1FD7D 3RLFA 2N88A 2BE5D 2JA5B 1FNUA 3TP7A 4PQXA 4B9WA 4XIGS 4A3DB 1KNAA 4K5XA 1EFID 1CA6A 2C9OA 2K6AA 4OIJA 4R9WA 3G6JB 3TDQA 4KHZA 2SNSA 1V43A 5DM63 3P75A 5E4XA 3QOJA 2KECA 3OIQA 1A6XA 2AUJD 2AQ3B 4K6LA 1SDFA 5AFWA 1TS3A 4IN3A 4A3IB 5E4WC 2DY8A 5COYA 3BVMA 2K7VA 3VYUA 4HTHA 1O7LA 4MHEA 3SK5A 2A69C 1Y8NB 1EIHA 3BDCA 4DU9A 2F0IA 1TT2A 4FNFA 2WKCA 5M9OA 5KNDA 2NUCA 1BUVT 3FVQA 3CKIB 4DF7A 5DAUA 3AU7A 1BOSA 1HHVA 1O78A 1RDPD 1A3TA 2DNEA 3SVMA 3A8IE 2BE5C 1GUWA 3M4OB 3OOCA 1CK1A 3GTKB 2K5DA 4X3UA 1H9SA 4IFDG 1LTSD 4KN4C 3OMGA 3EVQA 3NQTA 3X3NA 3NBHA 2F0TA 3TZUA 4QUCA 5EBDA 1TVXA 1HA6A 5M3FB 1STEA 4Z9CB 2EYLA 1SNPA 2EYJA 2K32A 2F3VA 1G6ZA 1FYCA 3C1FA 1JORA 1PZID 1Y8PB 4S3SA 5EKLA 4RCOA 3S1NB 1STNA 2M2LA 3RD4A 1OXSC 2EXZA 3I4LA 3SK4A 1GUGA 1KDAA 3DWQA 4IUUA 1O7ZA 1PRTF 1IYUA 2EJGC 3KLSA 5JVG3 2JEAI 1FR3A 1VDZA 4KK7A 1NSNS 3J7YW 5LL6S 1ILPA 5CV4A 3I70A 1BBXC 3V96A 1DZ1A 1B53A 3X3MA 2Z8LA 1LT3D 4ZUIA 4DXFA 4N9PA 3H09A 3NWTA 2IX1A 3D6WA 3ND9A 2R6GA 3UI2A 2XWJB 2RSOA 1PFNA 1PYWD 4IUNA 2OEOA 2F0WA 5E1FA 3Q6SA 1OXUA 1F9QA 1S5DD 2EYOA 1QWYA 4J8QA 5K36H 3I90A 3A55A 3M4YA 2EOTA 1G2TA 3QWNA 2MJ8A 2Q8TA 2AQ2B 1EOTA 5C0XG 2E75C 1U4MA 2FHTA 2RDFA 5C4ZA 1Y69U 1HUNA 3GV3A 5IOCA 4HMIA 2WACA 3K59A 2O4XA 4KN7C 2I46A 2RDGA 1TS5A 1SXTA 3J80L 1F2LA 1XX8A 4BA1I 1OXVA 3VR3A 3QB3A 1JICA 2ICEC 1RF2D 1TU2B 4I7ZC 2PCFB 4ZAIA 4EQPA 4C1NI 4KI0A 1DOKA 3SR1A 1SE2A 2QEJC 4RWSC 4RCNA 1IHZA 4BA2I 1EY7A 1Q8IA 1F9RA 4HCEA 4F7XA 1JR0D 2Z1CA 1PTOB 1AEXA 2RA4A 1DXMA 1QG7A 3R8BA 3PO3B 2NZ1D 1D5ZC 1CHPD 2ID0A 3E6ZX 2LS01 5I9OA 2K28A 1STGA 2IX0A 4K5VA 1T5XD 2A5HA 5CGKA 4QMGA 2C5CA 5J1ZA 2ZXPA 1T5EA 3OPOA 5EKIA 2K33A 1GOZA 1JOQA 1JQYD 2EY6A 4CKEA 3VYTA 2WV6D 4KKTA 3W3AA 3BVZA 2B2WC 2EYPA 5CC4A 1H9MA 3GTGB 3QJYA 2RVLA 1JWUD 4ABNA 3C3LA 1U4PA 2WKDA 5LHY1 3JAME 3FDTA 5T1GA 4DGZA 2F0QA 1W6KA 1EWHA 1TY0A 2FJ2A 3K5NA 2XRSD 1GUTA 1SYFA 2K05A 3CRLC 4IFDI 2F0EA 5I9PA 1LT5D 3SK6A 3D6CA 4JK1C 2F0HA 3M7NA 1QB5D 4O1NA 2JP1A 3EFXD 2E2JB 3MTSA 1O80A 3KUPA 3Q22A 4ZQ3A 1DOLA 4R8IA 4OIKA 1TY2A 2QDBA 4IUPA 1LABA 3NTKA 3VYRA 1EWCA 3WOEA 1Z6HA 2EYFA 4RGTA 2VUMB 1OXTA 1WTQA 1DJRD 4E6IA 4UAIA 3QG1A 3AMUA 3MFYA 1S5FD 5JEAG 1ENAA 3V05A 5KYIA 1EU4A 2RDHA 1IW7D 5HURA 3DM1A 4DFAA 3ND8A 4Y7NB 5ELDA 1EY9A 3DHQA 1H9KA 1JCKB 3P20A 1ENFA 5BN3A 3QO2A 1EQVA 4BS9A 3HEJA 3GP7A 1Q1EA 3KK7A 1PDQA 1AZPA 1DM0B 1RJTA 4FF4A 2AQ1B 4H0LC 2CHBD 1E0BA 2SOBA 2NN6G 1PFBA 3K58A 2RQXA 1EZ8A 4B9XA 1SNQA 1D5MC 1SJED 3PO2B 3K5OA 1LTRD 3EJIA 4MIUA 1VMCA 2IJ0A 1J9OA 4H13C 5FLXL 3H3VC 2R92B 2NB0A 1WTRA 1K83B 3TBIB 1ONLA 1XYIA 3IKJA 3GTLB 3OWEB 2L12A 4PMCA 4CKBA 3ONAB 1HXYD 1Q90A 1AP0A 1IW7C 5C0XI 4A93B 1D6EC 5D3DA 3J81E 3NUCA 3TN2A 2JA6B 1I4GA 5I6WA 2CW0C 1B9MA 2HQEA 3MAQA 1HTLD 4NKLA 4F88A 5IGBA 5IT9L 4EQNA 2XSCA 2PNRC 3S1QB 3MXGA 1B2TA 1KAAA 2H1EA 4RH6A 5DNFA 4EQOA 3S15B 2Y0SB 3HOUB 5JEAH 1TWAB 4FXDA 1EY8A 2PW5A 3PUZA 4K5WA 4OGQC 1EY5A 1ESFA 3SXHA 5I4DA 1F9SA 2H4OA 2R7ZB 2WAQB 1I3QB 3HOVB 1SYEA 3OMCA 4OO1I 1HQRD 4F87A 2JXMB 1BDOA 3PIO3 1SFOB 1STHA 1PTOD 1PRTD 3IFDA 5D3IB 3T13A 4M1UB 4XT1B 1VF7A 5M5WB 3TP6A 5EKKA 1K8MA 1JC7A 1BCPB 2NN6H 1LTID 3NTIA 2KUMA 1L0YB 3OWFA 2XVSA 1UEAB 2O5JC 1FNVA 1SYCA 3H0GB 3R2TA 3T16A 5JPNC 3D3RA 4DNRB 5KEEA 3D8GA 1LV9A 1JOKA 4RGMA 2PZWA 2PZTA 4K2LA 4K8IA 4PMWA 1WTWA 4KV6A 4IALA 4H7BA 3D4WA 2IWHA 1BNZA 3HS0C 2PW7A 1A3VA 1KDCA 1RKNA 4K6DA 1YNJD 3LX0A 1PTOC 3I91A 5K36G 2J4XA 4FXKC 2VB2X 2A6ED 3U9SA 1R9TB 2F03A 2L55A 1V1PB 2LMCB 4RAUC 1ZXTA 4FF2A 3S1MB 2EJFC 2N55A 1LTBD 4YIJA 4M8AA 3RZOB 2CVRA 2TSSA 1EYCA 1SEBD 1LTAD 2O5IC 4C3JB 4L8JA 3FKIB 1F77A 1TWFB 4GZYC 1ILQA 1FGBD 5CR3A 2L1BA 2SDFA 1TS2A 5G3LD 5J39A 4RA8A 4XYOA 1B50A 2M00A 1G91A 4HCSA 1PMRA 1IKMA 1K8OA 1YNJC 1MD2D 5I2YA 3A7AB 3W2DA 1HCZA 5ISRA 3D4DA 1OO9B 2OXPA 3IAYA 5CV7A 1U4LA 1IKLA 1X3QA 2A68D 2HCCA 2EY1A 5C5LA 3MC0B 3VA7A 4A3FB 3MVVA 2EVBA 2NWGA 5E3FA 1EIGA 3Q24A 2Z4IA 3NBIA 5ELFA 1RTNA 5FKAC 2D5DA 3M7GA 1EZ6A 1JWMD 3BS1A 4FYDA 1TWGB 3NQIA 2L11A 4J1MA 1TWCB 3GTPB 1R4PB 2XRQD 4DK1A 5EQ0A 2KOLA 3DEPA 4IUTA 3FEWX 3RUZA 1JE4A 4C3HG 1QOHA 3SHLA 3BVGA 3J7AV 1WCMB 1A15A 3BDLA 5J22A 4FVMA 4C2MB 1CQFA 4DAVA 3K0YA 2IT1A 3HOWB 5K5PA 4LK1C 2B2WA 2JSOA 4ZYSA 3L7ZC 4WORA 4EGVA 2HDLA 4KY7A 2RBMA 3LWEA 4G57A 3HG9A 1A2TA 1KTKA 1F9PA 1U4RA 1PZJD 1SNCA 3QIAA 4XQNA 2EY5A 2M9VA 1EL0A 4C56C 1B9NA 1GJXA 1W6JA 3URYA 1PTOH 1PXUA 4A3GB 2RSNA 2G9DA 2BDOA 2LFNA 4XTCS 3C1EA 3T51B 2F0VA 2ZXRA 1F2ZA 1HPCA 3SE0A 1NR4A 2B39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKL A;  5C5M A;  2KQ3 A;  1KAB A;  4KV6 A;  5IGB A;  1STG A;  4RKL A;  4K5V A;  5CV9 A;  4EQN A;  4IAL A;  3MVV A;  4H7B A;  4B9X A;  3D4W A;  4KHV A;  5CV8 A;  4IUN A;  5JOB A;  5E3F A;  2PW7 A;  2PQE A;  4QMG A;  5CGK A;  4DFA A;  2OEO A;  2F0W A;  5E1F A;  5J1Z A;  5HUR A;  4PNY A;  5F2D A;  3ERO A;  3EVQ A;  1A3V A;  3OMG A;  4PMB A;  2F0K A;  5IIF A;  3H6M A;  3NQT A;  1KDC A;  1RKN A;  3PMF A;  1KAA A;  4K6D A;  4R8N A;  2EYO A;  5IGD A;  2F0T A;  4EQO A;  4N9T A;  1EY9 A;  3LX0 A;  3DHQ A;  1EZ6 A;  3U9O A;  3E5S A;  5IGC A;  1EY4 A;  1II3 A;  3NK9 A;  3SK8 A;  5DEH A;  5K5P A;  1JOQ A;  1A3U A;  4WRD A;  4I65 A;  4J1M A;  2EY6 A;  3MEH A;  1EQV A;  3HZX A;  3TP7 A;  2EYL A;  3HEJ A;  2EYJ A;  1SYD A;  1EY8 A;  1SNP A;  2F0N A;  2PW5 A;  4IZ8 A;  2F0D A;  4QB4 A;  2LKV A;  4ME5 A;  4K5W A;  4B9W A;  5I6Y A;  3P1H A;  5C4Z A;  5KYL A;  2ENB A;  1SNO A;  1EY5 A;  2KHS A;  2RDF A;  2F3V A;  4ID6 A;  4K5X A;  3RUZ A;  3SXH A;  3C1F A;  5IOC A;  1JOR A;  3ERQ A;  1KDB A;  3SHL A;  4NP5 A;  2EYP A;  2F0M A;  1SYE A;  4HMI A;  5CC4 A;  2WAC A;  3DMU A;  3OMC A;  4ZUJ A;  2O4X A;  5C6A A;  2SNS A;  4S3S A;  5EKL A;  1ENC A;  3BDL A;  3P75 A;  1F2M A;  3QOJ A;  4TRD A;  4KD3 A;  4YIJ A;  3TP8 A;  5J22 A;  2SOB A;  4NDX A;  1SYB A;  5KGU A;  1STN A;  1EZ8 A;  1EY0 A;  1STH A;  1SND A;  1SNQ A;  2F0S A;  3MHB A;  3NP8 A;  4HMJ A;  1F2Y A;  4NMZ A;  5C5L A;  2F0Q A;  4DGZ A;  5JAV A;  4KJN A;  1U9R A;  1EYC A;  3EJI A;  3ITP A;  1SYG A;  4LAA A;  4OL7 A;  4WOR A;  3T13 A;  4MIU A;  5IGF A;  2EXZ A;  2EYH A;  3QB3 A;  3SK4 A;  2SNM A;  1SYF A;  1JOO A;  2F0U A;  3TP6 A;  4KY7 A;  2F0O A;  5IGG A;  2RBM A;  3MZ5 A;  1SNM A;  4G57 A;  4J6H A;  5NUC A;  2EYM A;  1KDA A;  2F0E A;  5EKK A;  5I9P A;  1A2T A;  4KTA A;  4ODG A;  4HTH A;  4EQP A;  3SK6 A;  4F8M A;  5C3X A;  1STB A;  3D6C A;  4KY6 A;  3SK5 A;  2F0H A;  5HGT A;  3VA5 A;  4EVO A;  3BDC A;  4K14 A;  4KJO A;  3S9W A;  4DU9 A;  1SNC A;  1A2U A;  2F0I A;  2EY2 A;  1TT2 A;  2EY5 A;  1STY A;  4PMC A;  3SR1 A;  3V2T A;  5CR3 A;  1TR5 A;  2F0G A;  5M9O A;  1NUC A;  4ZQ3 A;  2F0F A;  2NUC A;  5CV5 A;  5IGE A;  2PYK A;  5EGT A;  5J39 A;  3TP5 A;  4RKB A;  2OF1 A;  5KRU A;  3TME A;  4K2K A;  2RKS A;  1IHZ A;  3OWF A;  2F0J A;  2M00 A;  4DF7 A;  1NSN S;  2QDB A;  1EY7 A;  5IOD A;  2F3W A;  5C3W A;  1STA A;  4F7X A;  5DAU A;  3NXW A;  5CV4 A;  4K8J A;  1AEX A;  2EYF A;  5C4H A;  1EY6 A;  1SYC A;  2F0P A;  3NUC A;  5CV6 A;  3R3O A;  3T16 A;  4ZUI A;  3C1E A;  3OSO A;  3NHH A;  2F0V A;  4N9P A;  1A3T A;  5ISR A;  3D4D A;  4QF4 A;  5KEE A;  3D8G A;  3MXP A;  4KY5 A;  1F2Z A;  1JOK A;  4KD4 A;  4E6I A;  2PZW A;  2PZT A;  4K2L A;  4K8I A;  2OXP A;  5KIX A;  5CV7 A;  5I6W A;  2PZU A;  1EYA A;  2F0L A;  2HQE A;  1EYD A;  1ENA A;  5KYI A;  3QOL A;  5I9O A;  1TQO A;  2EY1 A; 
#chains in the Genus database with same CATH topology
 3O13 A;  1KQS A;  1ICW A;  1I4P A;  4AQY L;  1B8A A;  3I4M G;  4WJ3 M;  2E76 C;  2K01 A;  1PRT B;  1EIF A;  1N33 L;  1CT1 D;  3S2H B;  3F1Z A;  1QVF A;  4GKJ L;  4HN7 A;  1WYD A;  1FJG L;  2HIV A;  5DM7 3;  1UAP A;  5IGC A;  4DUZ Q;  3RNU A;  3BG3 A;  3MEH A;  3W1B A;  3A5U A;  4DUZ L;  3PV0 A;  1BCP D;  4QL5 A;  4LMQ D;  1N34 Q;  1B4O A;  1HA5 A;  3T53 B;  3W1G A;  4X3K A;  2QA4 A;  4GLV B;  1H9R A;  2JA8 B;  2JE6 I;  4RGN A;  5LL6 X;  4IUQ A;  2MQH A;  3CMA A;  1HQM C;  4QIW B;  4BBS B;  4KD3 A;  3TP8 A;  2CWP A;  1EQT A;  4YWM A;  3NP8 A;  3S9W A;  4FF1 A;  4A3B H;  1E2V A;  4LAA A;  2QCP X;  1SYG A;  1CUK A;  1V8Q A;  5FJ8 H;  1DON A;  3I55 A;  3ERS X;  5FO9 B;  1YEZ A;  1QVC A;  5GAD C;  4G7Z C;  3PCO B;  1Y1W B;  1SNM A;  2K14 A;  3HOZ H;  2NVQ B;  1DD2 A;  3CQZ B;  1RTO A;  1S4Z A;  4DPG A;  3S1R H;  1G29 1;  1X3F A;  4KY6 A;  1NAP A;  5GAH C;  1STY A;  4A76 A;  1CI3 M;  1BR9 A;  3I4N H;  2NYZ D;  2IX3 A;  3G6E A;  1AN8 A;  2AUK A;  1NUC A;  2HHH Q;  4Y52 H;  2O2L D;  4LJZ C;  5CV5 A;  2LY7 A;  3VR2 A;  4DV3 L;  1VQ5 A;  4JBW A;  2RKS A;  1K0S A;  2F0J A;  1YNN D;  3E3X A;  2UUC Q;  3C2P A;  4XYQ A;  2UUB L;  2K5H A;  2KCT A;  2XWB B;  4AYB G;  4JBK A;  2UUC L;  3S2D B;  5M3M H;  1HZA A;  1WJJ A;  2YTV A;  1CTM A;  4BBR G;  4P2C B;  4HJ5 A;  3U58 A;  3J81 i;  2K04 A;  1Z7T A;  4DAY A;  1JB3 A;  5KIX A;  1HUM A;  2PZU A;  1EYA A;  3JAM c;  1BCP C;  1RD9 D;  5LMN Q;  4A3K B;  1I50 B;  2VY3 A;  2XNA C;  3QOL A;  4JV5 Q;  3MA2 B;  3C46 A;  2PO4 A;  5LMN L;  4LF4 Q;  5LMU L;  1ET9 A;  4A3E G;  2ES2 A;  1TII D;  1GXD C;  2GA4 B;  4KKS A;  1GUS A;  4BY1 B;  2K4K A;  4LF9 Q;  4HR7 B;  1L0X B;  3FP9 A;  4GLX A;  2Q2T A;  2UXD L;  1BXT A;  1PH8 A;  3PUX A;  3U9O A;  3KBX A;  4LFC Q;  1HZB A;  2MO1 A;  3NE5 B;  1B7Y B;  1A3U A;  3MXU A;  3DXJ C;  3K0X A;  2JA7 G;  4A3D G;  3T4A C;  4IZ8 A;  1KLG D;  1R4Q B;  5BN4 A;  2ENB A;  3M4Q A;  2E2D C;  3I4M H;  2B63 B;  4YWK A;  4ZUJ A;  1VQN A;  1VQ9 A;  1Q8K A;  2NVY B;  2Z9H A;  3PIO A;  1IZ6 A;  1CKN A;  1VCI A;  2QIL A;  3IL8 A;  5C4J H;  2HIX A;  2KCC A;  4KJN A;  1U9R A;  3DWP A;  2E8G A;  1N32 Q;  1YNN C;  4A3I G;  2EJM A;  5A2Q L;  4LWC A;  1K83 H;  1LO5 D;  5ELB A;  1Q7Y C;  5IGG A;  2JEB I;  2KBN A;  4POG A;  3GV6 A;  3A5Z B;  4DV0 L;  4DV2 L;  3FPP A;  1L1O B;  2R7F A;  4ULL A;  4H44 C;  3CCQ A;  4DR2 Q;  4C3I H;  4GOP A;  2K5V A;  3NBH B;  2I07 B;  2WB1 G;  3S16 B;  3CRK C;  4OX9 Q;  3CC2 A;  3GQB A;  4B3S L;  3TSS A;  4OX9 L;  3TME A;  1PYB A;  3PF4 A;  1IBL Q;  3I8Z A;  2JA6 H;  5C3W A;  1M8A A;  4DR5 Q;  3NXW A;  3NWS A;  3WWV A;  2YU9 B;  4FP5 D;  1VQE A;  2F0P A;  4DV1 L;  4IFD J;  3NHH A;  5ELC A;  2UXC L;  3MXN B;  4BY7 B;  5C44 B;  3S14 B;  1Y8O B;  3DWA A;  2F0L A;  1ROD A;  2HCI A;  2BOS A;  2AKW B;  2R93 B;  2B8F A;  1SAP A;  3T1Y Q;  3E9H A;  1PH4 A;  1KAB A;  1YIT A;  1MGS A;  5CV9 A;  3CCV A;  4JI3 L;  5JOB A;  1O7I A;  4IPC A;  4PZ8 A;  1TKW B;  2PQE A;  3T1Y L;  3Q0A A;  4QUF A;  4PMB A;  2F0K A;  5IIF A;  2GVB A;  4FF3 A;  3P7J A;  1NCV A;  3NPP A;  1VMP A;  1QNU A;  1TWA H;  2RHS B;  1SMY D;  1XTC D;  5M3F G;  2GVA A;  5GAG C;  1PH6 A;  4V19 0;  1JJ2 A;  2R7Z H;  3R93 A;  2AWO A;  3F2U A;  4HIK A;  3HOV H;  1EEF D;  3P1H A;  1BO0 A;  2KHS A;  3NSW A;  1NMG A;  2G5D A;  4A3E H;  3BZC A;  2YTX A;  2K75 A;  1YJN A;  1X3E A;  1LTG D;  3PSI A;  2F4I A;  1B44 D;  1F2M A;  5JJI A;  2ZXO A;  3J81 c;  2JA5 H;  1VQA A;  2HT1 A;  2LXK A;  3ITP A;  4BXX H;  1AH9 A;  3EIV A;  1GO3 E;  1JOO A;  4RG1 A;  4XQJ A;  4X64 Q;  5D65 A;  1AFP A;  4CDE C;  4FO2 A;  4QGU A;  1P16 A;  4AYB B;  1NJI C;  2D0O A;  1VQ7 A;  1HH2 P;  5ELE A;  2E2H B;  2DY7 A;  4B3T L;  5A35 A;  1D1I A;  2F1M A;  4RKB A;  1Z47 A;  2OF1 A;  2P5Z X;  3RZD B;  1HNW L;  3H0G H;  4TKO B;  2NZH A;  1QJO A;  2Q8R E;  4GOP C;  3HOY G;  1IL8 A;  2RF4 A;  5FLX E;  2WIN B;  2MHV A;  1EY6 A;  1LTL A;  2BCO A;  3RN5 A;  4JI7 L;  3EN2 A;  2L0C A;  1SMY C;  2ZT9 C;  3GO5 A;  3BU2 A;  4DR7 L;  1MSG A;  5FO8 B;  1D5X C;  3VR5 A;  4Q5V A;  1SBB B;  1LT4 D;  2JYO A;  3K7A B;  1WD0 A;  1XMO Q;  1HFG A;  1TQO A;  1X32 A;  2JA7 B;  1SSO A;  5CYU A;  3K80 C;  3KOJ A;  2K1B A;  1EU3 A;  2VQF L;  1V1Q A;  4PNY A;  5C0X J;  5M5Y B;  1E1O A;  3PMF A;  3UDX A;  2N49 A;  3M4O H;  2CFM A;  4N9T A;  3HFZ B;  2R3Z A;  2MGS A;  3GTK H;  5IYD H;  1GKH A;  5DEH A;  2NTT A;  2E2I B;  2ALY B;  1R9T H;  2J0T D;  4ZCK A;  2OT2 A;  1CM9 A;  4YY3 Q;  1SYD A;  2E74 C;  2F0N A;  4DN4 M;  3A8K E;  2LKV A;  3CW2 C;  1GHJ A;  1SNO A;  2EIF A;  5EPJ A;  3VDY A;  5COR A;  2N8N A;  3K8A A;  5IT9 E;  3ERQ A;  1KDB A;  5H1S E;  1M4V A;  1BBW A;  1CZG A;  5C6A A;  3J7Z C;  2D62 A;  3GTJ B;  2VNU D;  4HJ8 A;  5IP7 G;  5M3F H;  5EPL A;  1PRT C;  1FNW A;  2AWN A;  5AJ3 Q;  2F0S A;  2WB1 B;  1X6O A;  3FHW A;  3FKI H;  2E5L Q;  3I73 A;  4GNX A;  5IGF A;  3EA6 A;  4CGY B;  2EYH A;  1HR0 Q;  3CHB D;  3AB9 A;  5AJ3 L;  4U68 A;  1Q3L A;  2X69 A;  5C3E B;  1PFM A;  5EPK A;  1CA5 A;  4J6H A;  2EYM A;  3OW7 A;  1A0I A;  1E2Z A;  3KLS X;  4CDC C;  4R4O A;  5HGT A;  3VA5 A;  4ZK9 B;  1XNQ L;  1A2U A;  1ZKO A;  4GS3 A;  4POF A;  4JCV E;  1T9H A;  1LTT D;  2VB3 X;  2FMC A;  2IHE A;  1XMQ Q;  1K0R A;  5IGE A;  3VR4 A;  3H91 A;  3TP5 A;  5KRU A;  1ESR A;  2FFK B;  4O42 A;  4YWL A;  4B08 A;  1AE2 A;  4KKU A;  1D7Q A;  1X3P A;  4J15 A;  4AIM A;  1L1O A;  3N6R A;  1DOM A;  4YCV A;  5DLQ E;  5C4H A;  3PO3 G;  5IYB G;  1WTX A;  1QNK A;  2K5W A;  4OEL B;  4MN3 A;  3GTO B;  3K81 C;  3GTM B;  2J7Z A;  4LF6 Q;  4V0B A;  2TMP A;  3BZD B;  4A3F H;  3VYS A;  1NTG A;  1Y1V B;  4P75 A;  1W2B A;  4DKA C;  4DNI A;  4LF6 L;  1EEI D;  4ODG A;  4XDX A;  1HJP A;  3WOF A;  3MFG A;  2XTI A;  3K5L A;  2Z4H A;  1XPR A;  2LXJ A;  1PHJ A;  2A73 B;  4HIM A;  1EWI A;  2HUG A;  3OHX C;  3H6M A;  5JVH 3;  3MXN A;  2MPM A;  1JE5 A;  1TWC H;  5JJZ A;  3GTP H;  2D9U A;  1BBU A;  3E5S A;  2NN6 I;  4DAP A;  3CPF A;  1WTV A;  4OWX B;  3HZX A;  3CCU A;  4JI1 Q;  2G9H D;  2A6E C;  1PH2 A;  3A7L A;  4JOI A;  4QB4 A;  4CHT B;  2FMM A;  3CU7 A;  4NW2 A;  2K03 A;  2WII B;  4JI1 L;  3I3C A;  4C2M H;  4XXE A;  4CBV A;  4HSV A;  1PTO F;  3DUZ A;  1VQ6 A;  5I2X A;  4TRD A;  4K0K Q;  2DUD A;  2EDG A;  5IE8 A;  1GUO A;  3S24 A;  1XXG A;  5KYL A;  2KVM A;  4DK6 C;  1XTD A;  3I72 A;  4JI6 Q;  1I4R A;  1L2F A;  2A6H D;  1VQD A;  1CFM A;  4LF7 L;  5HGQ A;  1AZQ A;  1VQ8 A;  1G2S A;  4QCL A;  1C0A A;  4O0A A;  5FJ8 G;  4A3J B;  1KNE A;  1LAC A;  4HAE A;  3MZ5 A;  2B2Y A;  2WP8 J;  3A8J E;  2YTY A;  5FOB B;  3HOY B;  4GKK L;  5FO7 B;  4DNT B;  5C3X A;  3PUV A;  1TWH B;  2EY2 A;  3GTQ B;  3FRP B;  2B2T A;  3M3Y B;  1E2W A;  4GN3 B;  4NXN L;  1C8C A;  2F0F A;  4X66 L;  1BF4 A;  2X6L A;  2PYK A;  2V4D A;  5EJW A;  2L9H A;  2PQA B;  3ULP A;  1GUN A;  2F3W A;  5JEA J;  2VUM G;  2BDN A;  4DA2 A;  2D2C C;  4K8J A;  4PZ6 A;  2CH4 W;  4RHR A;  1HRJ A;  3R3O A;  5D14 A;  3ZYY X;  5M3M G;  2R7D A;  2ICI A;  2NTS A;  4QF4 A;  4G4K A;  4KY5 A;  5BN5 A;  1UE6 A;  1J8I A;  1GHK A;  1U0L A;  2QF7 A;  4IQZ A;  4RHS A;  1L1O C;  4XT3 B;  4MTK A;  5FK9 C;  5CBA E;  2A68 C;  1LLR D;  3L9A X;  1CZW A;  4CKC A;  1Q46 A;  3M85 A;  4IFD H;  2GN5 A;  4RKL A;  3S2H H;  1O7Y A;  2QGQ A;  3CC7 A;  1LT6 D;  5F2D A;  3A54 A;  4ILW A;  2XN9 C;  2VQE L;  3IFT A;  4JI0 Q;  3JAM L;  2ZTC A;  4R8N A;  1NMF A;  3T56 B;  1B1Z A;  1KRT A;  1UE1 A;  4JI0 L;  1EY4 A;  4EX5 A;  2A6H C;  4HJ9 A;  1I6H B;  4DV7 L;  3SK8 A;  1E1T A;  1YHB A;  4X65 L;  4G7H C;  1I4X A;  2OQ0 A;  1B3A A;  1V1O A;  1MBY A;  4ZKB B;  2HDM A;  3K5M A;  2B8G A;  4ID6 A;  5T1I A;  1ASZ A;  2KA7 A;  1D1K A;  4WFN 3;  1ICF B;  4BBS H;  1D2B A;  1E22 A;  3KDF B;  1VQ4 A;  2WAQ E;  1PV4 A;  1QE6 A;  3H94 A;  5KNC A;  1KRS A;  1I6V C;  2SEB D;  2L4N A;  4JOI C;  1UWV A;  4UDU C;  5EBC A;  4WJW A;  1Q1B A;  3H15 A;  1NY4 A;  5C4X B;  3S17 B;  4NMZ A;  1SND A;  2B2U A;  4HMJ A;  1F2Y A;  5JAV A;  1HTP A;  4OL7 A;  2PNH A;  4DR3 Q;  1VQL A;  1Q12 A;  2SNM A;  3FPU B;  2IPK D;  1DGS A;  1NR2 A;  1C4Q A;  2F0U A;  1DCZ A;  4DR3 L;  2Z6B A;  1WTP A;  3GTG H;  4X3S A;  4OO1 G;  3LNN A;  1N34 L;  1Q82 C;  1SN8 A;  1PZK D;  1STB A;  1QCB D;  1DYQ A;  4FXG C;  4K14 A;  4JC0 A;  3PIP A;  3HP3 A;  5G3L F;  4TSS A;  4C3I G;  1KLU D;  2B2Y C;  3A56 A;  2PPB C;  2KCM A;  3PUY A;  3K6O A;  3RN2 A;  5EGT A;  1XWE A;  3J7A F;  1WTO A;  1YNX A;  3BYY B;  1V1P A;  2VXW A;  1RHP A;  1STA A;  3I7F A;  2B2T C;  3DEO A;  3OW2 A;  1PH5 A;  1HNX Q;  2JA6 G;  1S5C D;  2EPB A;  3OYY A;  1MSH A;  1HNX L;  2E2J H;  1G6P A;  1AW7 A;  4TVA B;  4A3K H;  1VQI A;  4KD4 A;  4DV4 Q;  1QIL A;  1J6Q A;  4LF5 Q;  4G7O C;  4DV6 Q;  4JVZ A;  3HKZ G;  3TZD A;  1EYD A;  3J80 E;  2YYZ A;  1ML0 D;  4BWG B;  4BY1 H;  2KQ3 A;  1ASY A;  2VUM H;  2HHH L;  3G7L A;  4IUR A;  4KHV A;  3SEB A;  3HGB A;  4LUO A;  1SE4 A;  3ERO A;  2CH4 A;  4H02 A;  2Y0S G;  3HOU G;  1UNS A;  4OHJ A;  4R4C A;  3CCJ A;  3BYT B;  1CKO A;  4ZKC B;  1Q86 C;  3EBE A;  1SRU A;  3TQY A;  2Q2H A;  5C0X H;  1X65 A;  3G4S A;  2OCE A;  2KED A;  2CQA A;  4C1N K;  2F0D A;  3J80 c;  5I6Y A;  2OWO A;  2R7Z G;  4A3B B;  4Y7N H;  2WAQ G;  1EIY B;  3HOV G;  2DN8 A;  5GQO A;  1GM5 A;  4DR6 Q;  4JV5 L;  3HOX B;  2BA0 A;  4IOC A;  3T1H Q;  4A3L G;  4C3H B;  1M90 C;  4LF4 L;  3HOZ B;  1ENC A;  2BA1 A;  1MI2 A;  1BQQ T;  4NDX A;  3S1R B;  2NVT B;  1SYB A;  5KGU A;  4LF9 L;  3LWU A;  1EY0 A;  3MHB A;  2JA5 G;  4KHP Q;  3RR5 A;  4HJ7 A;  4IPG A;  4QJF A;  3R2I A;  3I4N B;  1S72 A;  1V9P A;  4LFC L;  3K7U C;  4BXX G;  4CJ2 C;  2F52 A;  2KJX A;  3J81 L;  2C35 B;  5JPM C;  3K57 A;  4KMU C;  1TS4 A;  4JBJ A;  4PV1 C;  2B2U C;  4YHH Q;  4A4I A;  3S16 H;  2KEE A;  1D8L A;  4EVO A;  3PO2 H;  3Q23 A;  3KLR A;  2ASB A;  3N52 A;  3V2T A;  5M3M B;  4PZ7 A;  1TR5 A;  2KCN A;  4CJ0 B;  4L63 B;  2R92 H;  3D0F A;  4U67 3;  1M1K C;  1I4H A;  5IOD A;  1EFW A;  4DV5 Q;  4A3M B;  2B2V A;  4RFB A;  4OO1 H;  1N32 L;  3KF8 A;  3GTL H;  3H0G G;  3D4R A;  1H9S B;  3MWY W;  1ZEQ X;  5CV6 A;  3ULJ A;  1RCV D;  1UUP A;  3OSO A;  4Q0F A;  1PLF A;  2R93 H;  3MXP A;  4QQB X;  5TSS A;  4LFB Q;  1SMX A;  1ET6 A;  3PIP 3;  3U4V A;  4A93 H;  4DR2 L;  2CW0 D;  2ATW A;  2PQA A;  4LFB L;  4DXG A;  3WDN A;  2L5T A;  4ME3 A;  2IL8 A;  4JI2 Q;  4B3M Q;  2UUA Q;  1IBL L;  3I4M B;  1JB7 A;  3RMH A;  5IGD A;  4DR5 L;  1WVL A;  4XQQ A;  2A74 C;  1BCP F;  2DNC A;  1EYG A;  1II3 A;  3NK9 A;  1C48 A;  1H9J A;  2MUY A;  2IW3 A;  4I7A A;  5J3B A;  5IYD G;  4WRD A;  1G8Z D;  4I65 A;  2K5Q A;  3KBG A;  5C4J B;  3KF6 B;  4NB3 A;  1XNR Q;  3D31 A;  4ME5 A;  3S1Q H;  2Q8I B;  2QKI C;  3PUW A;  4DK0 A;  4EQ5 A;  3OIP A;  2LSS A;  4NP5 A;  2F0M A;  4X3T A;  3DMU A;  1SE3 A;  3S15 H;  1WI5 A;  4HSP A;  3HOU H;  2QW7 A;  4IJL A;  1CQV A;  4L5Q A;  1ZYR D;  3SDZ A;  3AFP A;  5M5X B;  4LFA Q;  4X62 Q;  4C3I B;  1X3G A;  3L3O C;  4C3J G;  4DUY Q;  3FKI G;  2OTL A;  1I3Q H;  3KDF A;  3UE0 A;  1MJE A;  5KNB A;  2F0O A;  1I4Q A;  1E24 A;  4RGO S;  1WD1 A;  5CBE E;  5NUC A;  5L37 A;  4A3L H;  4KTA A;  1CHQ D;  2Q2I A;  4F8M A;  2X6G A;  1SFO H;  4KJO A;  3TS0 A;  1IYV A;  4NXM Q;  4P73 A;  4JI8 Q;  3E0J A;  2F0G A;  2MP1 A;  3JC6 6;  4HID A;  3RZD H;  5CMD A;  5IP9 H;  5M5W H;  4IUV A;  4NXM L;  3HKZ B;  3HRZ C;  1OXX K;  4K2K A;  2EQS A;  4ZLT F;  2NVX B;  1S5E D;  4TQU S;  5A2Q E;  3CCE A;  1WOC A;  2NBF A;  2FIN B;  1JWS D;  3NTH A;  2EZV A;  4ZRZ A;  2Q2U A;  4X64 L;  4L6T B;  2A69 D;  1K9M C;  1X54 A;  4BBR B;  2B2V C;  2R61 A;  2N78 A;  1SJH D;  2PMZ B;  2A1A A;  4A3F G;  1VQG A;  5C5M A;  1HFN A;  1VF5 C;  2XIW A;  3GD7 A;  1IYJ B;  5M5Y H;  1S5B D;  3BDO A;  4JYA Q;  3EQL C;  5CV8 A;  4A3E B;  3VR6 A;  4LF8 Q;  1VQF A;  3FMC A;  5EAY A;  3L2P A;  1EQQ A;  1ZYR C;  4LW1 A;  4HED A;  4CJ1 B;  4LF8 L;  2EE1 A;  1FD7 D;  2OQK A;  1YIJ A;  3RLF A;  2N88 A;  2BE5 D;  2JA5 B;  1FNU A;  3TP7 A;  2WFW A;  4R4Q A;  1I94 Q;  2F4V Q;  4PQX A;  4B9W A;  4XIG S;  4A3D B;  1KNA A;  4K5X A;  1EFI D;  1PH3 A;  1CA6 A;  1XMO L;  1I94 L;  5HY6 A;  2C9O A;  2K6A A;  4OIJ A;  4R9W A;  3G6J B;  4B3R Q;  3TDQ A;  4KHZ A;  2SNS A;  5FLX c;  1V43 A;  5DM6 3;  3P75 A;  5E4X A;  3QOJ A;  2KEC A;  1P8L A;  4QIW E;  1W3S A;  3OIQ A;  5C3E H;  1A6X A;  1K8A C;  2AUJ D;  2AQ3 B;  5FLM H;  3KYH C;  4K6L A;  1SDF A;  5AFW A;  1TS3 A;  4IN3 A;  4A3I B;  5E4W C;  3S1M H;  2DY8 A;  5COY A;  4QY7 A;  2I5M X;  4YY3 L;  3BVM A;  2K7V A;  3VYU A;  4HTH A;  3DLL A;  1O7L A;  4MHE A;  3SK5 A;  3RZO H;  2A69 C;  1Y8N B;  1EIH A;  3BDC A;  1Y14 B;  4DU9 A;  1SRO A;  2F0I A;  1TT2 A;  4FNF A;  1Y69 U;  2WKC A;  2Z6K A;  3CAM A;  5M9O A;  1LYL A;  5KND A;  2JJQ A;  4C3J H;  2NUC A;  1BUV T;  3FVQ A;  1TWF H;  3CKI B;  4DF7 A;  2E5L L;  1J5E Q;  1HR0 L;  5DAU A;  5IY0 A;  2V1C C;  3GTM H;  3AU7 A;  5IT9 c;  1BOS A;  1HHV A;  1O78 A;  1Y1V H;  1RDP D;  1A3T A;  2DNE A;  3SVM A;  3A8I E;  2BE5 C;  1GUW A;  3M4O B;  3OOC A;  1JJC B;  1CK1 A;  3GTK B;  2K5D A;  2CWA A;  4X3U A;  1H9S A;  2KHJ A;  5BR8 Q;  4IFD G;  1XMQ L;  1KHI A;  1LTS D;  4KN4 C;  3OMG A;  3EVQ A;  5BR8 L;  3NQT A;  3X3N A;  2MNA A;  3NBH A;  2F0T A;  3TZU A;  1YI2 A;  4QUC A;  5EBD A;  1TVX A;  1RL2 A;  1A62 A;  4LUV A;  1HA6 A;  5M3F B;  1STE A;  1VQM A;  4Z9C B;  2EYL A;  1SNP A;  2EYJ A;  1EUJ A;  2K32 A;  2JA8 G;  2F3V A;  1G6Z A;  1N36 Q;  1FYC A;  3C1F A;  3MEF A;  1JOR A;  1PZI D;  1Y8P B;  4BBS G;  1TWG H;  4S3S A;  5EKL A;  2IHF A;  1NNX A;  4RCO A;  3S1N B;  1STN A;  1GVP A;  2M2L A;  2VZA A;  3RD4 A;  4DAY B;  1OXS C;  2EXZ A;  3I4L A;  3SK4 A;  1GUG A;  1Y1W G;  1KXL A;  2EXD A;  4PG3 A;  1WCM H;  3OTO Q;  1KDA A;  1K8G A;  3DWQ A;  5IWA Q;  4IUU A;  1O7Z A;  1X9N A;  3HOW H;  1FL0 A;  1PRT F;  1IYU A;  1VQC A;  2EJG C;  3KLS A;  1HZC A;  5JVG 3;  2JEA I;  4HIO A;  1FR3 A;  4K0K L;  2L15 A;  1C9O A;  1VDZ A;  2VL6 A;  4KK7 A;  1NSN S;  4JI6 L;  3J7Y W;  5LL6 S;  1ILP A;  4JI5 Q;  2Z6K C;  3I70 A;  5CV4 A;  1BBX C;  3V96 A;  1DZ1 A;  1B53 A;  3X3M A;  2VW9 A;  2Z8L A;  1SE8 A;  4JI5 L;  1LT3 D;  4ZUI A;  3J81 j;  1MIU A;  4DXF A;  4N9P A;  3H09 A;  4JI4 Q;  3NWT A;  3H3V I;  2IX1 A;  3D6W A;  4A3K G;  4A3G H;  4OWT B;  1K73 C;  1VQK A;  3ND9 A;  2I5L X;  1CKM A;  2R6G A;  3UI2 A;  2XWJ B;  1N8R C;  3CME A;  2RSO A;  3J80 i;  1PFN A;  4BY1 G;  1PYW D;  4IUN A;  3J7A 5;  3I2Z A;  2OEO A;  2F0W A;  5E1F A;  1HNZ Q;  3Q6S A;  1A63 A;  5JJK A;  1OXU A;  1F9Q A;  2RHQ B;  2YV5 A;  1S5D D;  4JW0 A;  2EYO A;  1HNZ L;  1QWY A;  4J8Q A;  5K36 H;  3F2D A;  3BJU A;  1SLJ A;  3I90 A;  2ZTD A;  4OEM B;  3A55 A;  3M4Y A;  2EOT A;  4N8F A;  2IY5 B;  1G2T A;  4X6A H;  3QWN A;  3KFU A;  4UPA A;  3LGJ A;  2MJ8 A;  2AQ2 B;  2Q8T A;  1EOT A;  5C0X G;  2E75 C;  1U4M A;  2FHT A;  2RDF A;  3ER0 A;  4JPB W;  3DM3 A;  5C4Z A;  1HUN A;  3NEN A;  3GV3 A;  4R4I A;  5IOC A;  1K3B C;  5C4X H;  4HMI A;  2WAC A;  3K59 A;  3S17 H;  2O4X A;  1YJ9 A;  4KN7 C;  2B29 A;  2I46 A;  2RDG A;  1TS5 A;  4LUZ A;  1K3R A;  3TRE A;  1QZG A;  1IBK Q;  1SXT A;  3J80 L;  1F2L A;  1XX8 A;  3ULL A;  1CSQ A;  4BA1 I;  1OXV A;  3VR3 A;  3QB3 A;  2CCZ A;  1JIC A;  1UEB A;  2ICE C;  1RF2 D;  2JA8 H;  2JQO A;  1TU2 B;  4I7Z C;  2PCF B;  2RCF A;  4ZAI A;  3AYH B;  4YCW A;  4EQP A;  4APV A;  4OXP A;  4C1N I;  4KI0 A;  1IBM Q;  4AYB E;  3STB D;  1DOK A;  4IPD A;  3SR1 A;  3PO2 G;  1G51 A;  1SE2 A;  1IBM L;  3ICE A;  2PMZ E;  2QEJ C;  1Y1W H;  2NVQ H;  4WJ4 A;  4RWS C;  4RCN A;  3CQZ H;  1IHZ A;  1S3O A;  2R92 G;  4BA2 I;  5LMN W;  1N33 Q;  1EY7 A;  1Q8I A;  1FGU A;  1F9R A;  4HCE A;  3CCM A;  5E7N A;  4GKJ Q;  4F7X A;  1JR0 D;  2Z1C A;  3TEH B;  1FJG Q;  1PTO B;  1AEX A;  2F3I A;  1YJW A;  2RA4 A;  1DXM A;  1QG7 A;  4BY7 G;  5C44 G;  3R8B A;  3PO3 B;  2NZ1 D;  2OTJ A;  1D5Z C;  3HKS A;  2R93 G;  1CHP D;  3TS2 A;  2ID0 A;  3E6Z X;  2LS0 1;  1EQR A;  5I9O A;  2K28 A;  4A93 G;  2K50 A;  1STG A;  2IX0 A;  4K5V A;  3S2D H;  3I4O A;  4OWW B;  2JN4 A;  1T5X D;  2A5H A;  5CGK A;  4QMG A;  2C5C A;  5J1Z A;  3PQI A;  4A3C G;  2ZXP A;  1T5E A;  3OPO A;  1WTH A;  5EKI A;  4ALP A;  4UY8 C;  1UE5 A;  2K33 A;  1I50 H;  2HQL A;  1GOZ A;  1JOQ A;  1JQY D;  2EY6 A;  4CKE A;  3VYT A;  3AEV A;  2WV6 D;  4GLA C;  4DV4 L;  4KKT A;  3W3A A;  4UP7 A;  3HOX H;  4LF5 L;  3BVZ A;  3G71 A;  4C3H H;  4DV6 L;  2NVT H;  2B2W C;  2EYP A;  5CC4 A;  1H9M A;  3STB C;  3M4P A;  3GTG B;  3QJY A;  2RVL A;  1JWU D;  2VS1 A;  4ABN A;  3C3L A;  1U4P A;  2WKD A;  5LHY 1;  3JAM E;  4DV3 Q;  3FDT A;  5T1G A;  4RMF A;  4DGZ A;  2F0Q A;  1PVO A;  1W6K A;  3RLO A;  1YVC A;  1EWH A;  1TY0 A;  2FJ2 A;  3K5N A;  2UUB Q;  2WB1 E;  5IYC G;  2XRS D;  1YZ6 A;  3KJP A;  1GUT A;  3F2B A;  2B63 H;  4P74 A;  1SYF A;  2K05 A;  3CRL C;  4DAM A;  4IFD I;  4CDD C;  2NVY H;  1JMC A;  2F0E A;  5I9P A;  1LT5 D;  3G48 A;  3SK6 A;  4NPS A;  3D6C A;  4JK1 C;  2F0H A;  3M7N A;  1QB5 D;  4O1N A;  2JP1 A;  2ZM6 Q;  4DR6 L;  1MKH A;  3E0E A;  3T1H L;  1S40 A;  3EFX D;  2E2J B;  3MTS A;  1O80 A;  3KUP A;  3Q22 A;  4A3M H;  2ZM6 L;  4ZQ3 A;  4DR1 Q;  5LMU Q;  1DOL A;  4R8I A;  5IP9 G;  2Z0S A;  4KHP L;  4OIK A;  1TY2 A;  1KIX A;  4DR1 L;  2QDB A;  4IUP A;  1LAB A;  3NTK A;  2UXD Q;  3VYR A;  1EWC A;  3WOE A;  1Z6H A;  2EYF A;  4RGT A;  2VUM B;  1OXT A;  1WTQ A;  1DJR D;  4JG2 A;  3QR8 A;  1JJG A;  1Z9F A;  4YHH L;  4E6I A;  4UAI A;  3F2C A;  1B3Q A;  3UDG A;  2A8V A;  1U5K A;  3QG1 A;  3AMU A;  1PH9 A;  3MFY A;  1S5F D;  5JEA G;  1ENA A;  3V05 A;  5KYI A;  3CXC A;  3CC4 A;  4GNX B;  1EU4 A;  3M9B A;  2YU9 H;  2RDH A;  1IW7 D;  5HUR A;  5GAE C;  3DM1 A;  4DFA A;  1IL2 A;  3ND8 A;  4Y7N B;  4BY7 H;  4MNO A;  5C44 H;  3S14 H;  4DV5 L;  5ELD A;  1EY9 A;  3DHQ A;  1H9K A;  3BZK A;  1JCK B;  3P20 A;  1ENF A;  5BN3 A;  3PF5 A;  3QO2 A;  1MJC A;  1EQV A;  4BS9 A;  3HEJ A;  3GP7 A;  4DK3 C;  1Q1E A;  3CCS A;  4DV0 Q;  3KK7 A;  4DV2 Q;  1EOV A;  1PDQ A;  1AZP A;  1DM0 B;  2MO0 A;  4A3C H;  1RJT A;  1VQJ A;  1XPU A;  4FF4 A;  2AQ1 B;  4H0L C;  1KD1 C;  5M5X H;  4JI2 L;  2CHB D;  1E0B A;  2SOB A;  2NN6 G;  4B3S Q;  1PFB A;  3K58 A;  4B3M L;  2DJF C;  2RQX A;  1EZ8 A;  4B9X A;  2H5X A;  1SNQ A;  2UUA L;  3A74 A;  1D5M C;  1SJE D;  3PO2 B;  3K5O A;  1LTR D;  3EJI A;  4MTN A;  4MIU A;  1VMC A;  5C3E G;  2IJ0 A;  1J9O A;  4H13 C;  3UDI A;  5FLX L;  3H3V C;  4DV1 Q;  2R92 B;  5FLM G;  2NB0 A;  4O2D A;  1WTR A;  1XNR L;  2UXC Q;  1K83 B;  3TBI B;  4JBM A;  1ONL A;  1XYI A;  2K5N A;  3IKJ A;  3GTL B;  3OWE B;  2L12 A;  1FVI A;  4PMC A;  4CKB A;  2NVX H;  3ONA B;  3CD6 A;  4JI3 Q;  5IYC H;  1HXY D;  4R1J A;  1Q90 A;  4R4T A;  3L0O A;  1AP0 A;  1IW7 C;  5C0X I;  4LFA L;  4X62 L;  4A93 B;  4DUY L;  3NEL A;  1D6E C;  5D3D A;  3J81 E;  3NUC A;  3TN2 A;  4BBR H;  2E2H H;  2JA6 B;  5GRO A;  1I4G A;  3UE1 A;  4LNQ A;  2UXB Q;  1MHW C;  1Y1V G;  5I6W A;  2CW0 C;  1VQP A;  1B9M A;  2UXB L;  2HQE A;  3MAQ A;  1HTL D;  4JI8 L;  3KLW A;  4NKL A;  4F88 A;  5IGB A;  5IT9 L;  4EQN A;  5ELO A;  4CDF C;  2XSC A;  2ZJQ A;  2PNR C;  3S1Q B;  1X56 A;  1PH7 A;  3MXG A;  2B3G A;  1B2T A;  1KAA A;  2H1E A;  3F8T A;  4RH6 A;  5DNF A;  4EQO A;  3K7A H;  3UDF A;  4IOA A;  2CKZ B;  3S15 B;  2Y0S B;  3HOU B;  2BH2 A;  2JA7 H;  4A3D H;  5JEA H;  4HJA A;  2NZO A;  1BVS A;  1TWA B;  4FXD A;  2QDL A;  1QVG A;  1EY8 A;  2PW5 A;  3PUZ A;  4K5W A;  4OGQ C;  2N3S A;  1EY5 A;  1ESF A;  3SXH A;  1HR0 W;  4AH6 A;  5I4D A;  1OTC A;  1F9S A;  2H4O A;  1JT8 A;  2R7Z B;  1PYS B;  2WAQ B;  2HD3 A;  1I3Q B;  3HOV B;  1K28 A;  1SYE A;  3OMC A;  4OO1 I;  4JYA L;  3W5O A;  1HQR D;  4B3T Q;  4F87 A;  2JXM B;  2E2I H;  1BDO A;  3PIO 3;  1SFO B;  1STH A;  1PTO D;  1HNW Q;  1PRT D;  1UE7 A;  3IFD A;  4A3I H;  5D3I B;  3T13 A;  4A3J G;  4M1U B;  4XT1 B;  3ZJY C;  1VF7 A;  5M5W B;  3TP6 A;  4JI7 Q;  1C7Y A;  1NE3 A;  3AQQ A;  3GTJ H;  2F4V L;  4DR7 Q;  5EKK A;  1K8M A;  1JC7 A;  3GDE A;  1WCM G;  1VS0 A;  1BCP B;  2I5H A;  2NN6 H;  3HOW G;  4B3R L;  1QUQ B;  1LTI D;  3NTI A;  2KUM A;  1L0Y B;  4UHV A;  2VQF Q;  3OWF A;  2XVS A;  1UEA B;  2O5J C;  4IPH A;  1KL9 A;  1FNV A;  1SYC A;  3PGZ A;  3H0G B;  3R2T A;  3T16 A;  5JPN C;  3D3R A;  4DNR B;  4A75 A;  3CCR A;  5KEE A;  3D8G A;  1LV9 A;  1JOK A;  4RGM A;  2PZW A;  2PZT A;  4K2L A;  3AFQ A;  2PI2 A;  4K8I A;  4P71 A;  4A3G G;  4PMW A;  3U50 C;  1WTW A;  4KV6 A;  4IAL A;  4H7B A;  3D4W A;  2IWH A;  1BNZ A;  3HS0 C;  3A0J A;  2PW7 A;  3U4Z A;  2QEX A;  1A3V A;  3GTO H;  3B6Y A;  1KDC A;  1RKN A;  3H3V H;  1J5E L;  4DR4 Q;  4K6D A;  1YNJ D;  1X55 A;  3LX0 A;  1PTO C;  3I91 A;  5K36 G;  4DR4 L;  2J4X A;  4KLK A;  1KAW A;  1N9W A;  4N8X 1;  1VQB A;  1PH1 A;  4FXK C;  2VB2 X;  2A6E D;  3KJO A;  3U9S A;  1R9T B;  2UU9 Q;  4UP9 A;  2F03 A;  1XNQ Q;  3S1N H;  2FXQ A;  2L55 A;  2DGY A;  1YBY A;  1V1P B;  2LMC B;  4RAU C;  1ZXT A;  3SGI A;  4L5R C;  4FF2 A;  2UU9 L;  3S1M B;  2EJF C;  5C4X G;  2N55 A;  1NBW A;  1LTB D;  4YIJ A;  1CSP A;  4M8A A;  3RZO B;  2CVR A;  2TSS A;  1EYC A;  1SEB D;  1LTA D;  2PI2 E;  3TRZ A;  2O5I C;  4IJH A;  4C3J B;  4L8J A;  3FKI B;  1F77 A;  1TWF B;  4GZY C;  1GD7 A;  1YHA A;  1ILQ A;  1FGB D;  2BH8 A;  1L0W A;  1N36 L;  4UP8 A;  1TXY A;  2ZJP A;  2AHO B;  3I56 A;  3IRB A;  5CR3 A;  1XPO A;  3RLN A;  4A3J H;  3KF6 A;  2CQO A;  1PA6 A;  2L1B A;  2SDF A;  1TS2 A;  5G3L D;  5J39 A;  4RA8 A;  3CF5 A;  4XYO A;  1B50 A;  2M00 A;  2XGT A;  3HOY H;  1G91 A;  4HCS A;  1PMR A;  1TWH H;  1IKM A;  4OON A;  1K8O A;  3GTQ H;  1YNJ C;  1MD2 D;  5I2Y A;  3M3Y H;  3A7A B;  3W2D A;  3OTO L;  1HCZ A;  5ISR A;  3D4D A;  1OO9 B;  4P72 A;  5IWA L;  4L5T A;  4L5S A;  2OXP A;  3IAY A;  5CV7 A;  1U4L A;  1IKL A;  1X3Q A;  1IXR A;  2A68 D;  2HCC A;  2EY1 A;  5C5L A;  3MC0 B;  3VA7 A;  4A3F B;  3MVV A;  2EVB A;  2NWG A;  4GN4 B;  1EIG A;  5E3F A;  3Q24 A;  4MZ9 A;  1E3P A;  2Z4I A;  3NBI A;  5ELF A;  1I5F A;  1RTN A;  1E7Z A;  5FKA C;  2D5D A;  3M7G A;  4LF7 Q;  1EZ6 A;  1JWM D;  3BS1 A;  4FYD A;  1TWG B;  3NQI A;  2L11 A;  4J1M A;  4A3B G;  1CKN B;  4JI4 L;  1TWC B;  1A8V A;  4FDB A;  4IO9 A;  3GTP B;  1R4P B;  2XRQ D;  5EQ0 A;  4DK1 A;  2KOL A;  4GKK Q;  3DEP A;  1AE3 A;  1LUZ A;  5ELN A;  4IUT A;  3FEW X;  3RUZ A;  3HOX G;  1JE4 A;  1VQO A;  4YCU A;  1BKB A;  4C3H G;  1XJV A;  1QOH A;  3SHL A;  1VQH A;  1QZH A;  3BVG A;  3HOZ G;  5JJL A;  4GNX C;  3KF8 B;  3J7A V;  5IP7 H;  1I6H H;  2KHI A;  4NXN Q;  1WCM B;  1A15 A;  2ZTE A;  3BDL A;  1SR3 A;  4GN5 A;  4X66 Q;  5J22 A;  4FVM A;  4C2M B;  1CQF A;  4DAV A;  1RIP A;  2KEN A;  3K0Y A;  2IT1 A;  2JK8 A;  2A19 A;  3HOW B;  5K5P A;  3I4N G;  4LK1 C;  2B2W A;  2JSO A;  4ZYS A;  3JAM i;  3L7Z C;  4WOR A;  2MFI A;  4GOP B;  3NEM A;  2JA9 A;  3CCL A;  4EGV A;  2HDL A;  2B63 G;  2K52 A;  4KY7 A;  2RBM A;  3LWE A;  4G57 A;  3HG9 A;  2I0Q A;  1A2T A;  1KTK A;  1YHQ A;  1F9P A;  1WFQ A;  1Q81 C;  1U4R A;  1LM0 A;  1PZJ D;  1SNC A;  3QIA A;  4XQN A;  2EY5 A;  2M9V A;  1EL0 A;  1PFS A;  2DJG C;  4C56 C;  1KC8 C;  1B9N A;  1GJX A;  1W6J A;  3URY A;  2D0P A;  1IBK L;  1PTO H;  2ZJR A;  4A3M G;  3CP0 A;  1PXU A;  4A3G B;  2RSN A;  3HKZ E;  2VQE Q;  2G9D A;  2BDO A;  2LFN A;  3PO3 H;  5IYB H;  2AMC B;  4XTC S;  3CPW A;  1H95 A;  2RCN A;  3E9I A;  4DV7 Q;  1QUQ A;  3C1E A;  3T51 B;  2F0V A;  1B70 B;  4X65 Q;  2ZXR A;  1F2Z A;  2Y0S E;  1HPC A;  3SE0 A;  1NR4 A;  3Q8D A;  2B39 A;  4AQY Q;  1HZ9 A; 
#chains in the Genus database with same CATH homology
 3O13 A;  1ICW A;  1I4P A;  2E76 C;  2K01 A;  1PRT B;  1CT1 D;  3S2H B;  4HN7 A;  5DM7 3;  1UAP A;  5IGC A;  3BG3 A;  3MEH A;  3PV0 A;  1BCP D;  4LMQ D;  1B4O A;  1HA5 A;  3T53 B;  4X3K A;  1H9R A;  2JA8 B;  2JE6 I;  4RGN A;  5LL6 X;  4IUQ A;  1HQM C;  4QIW B;  4BBS B;  4KD3 A;  3TP8 A;  1EQT A;  3S9W A;  3NP8 A;  4FF1 A;  1E2V A;  4LAA A;  2QCP X;  1SYG A;  1V8Q A;  1DON A;  5FO9 B;  4G7Z C;  1Y1W B;  1SNM A;  2NVQ B;  1DD2 A;  3CQZ B;  1RTO A;  1S4Z A;  1G29 1;  4KY6 A;  1NAP A;  1STY A;  1CI3 M;  1BR9 A;  2NYZ D;  2IX3 A;  1AN8 A;  2AUK A;  1NUC A;  2O2L D;  4LJZ C;  5CV5 A;  2LY7 A;  3VR2 A;  4JBW A;  2RKS A;  2F0J A;  1YNN D;  3C2P A;  4XYQ A;  2XWB B;  3S2D B;  1CTM A;  4P2C B;  2K04 A;  1Z7T A;  4DAY A;  1JB3 A;  5KIX A;  1HUM A;  2PZU A;  1EYA A;  1BCP C;  1RD9 D;  4A3K B;  1I50 B;  2XNA C;  3QOL A;  3MA2 B;  3C46 A;  2PO4 A;  1ET9 A;  1TII D;  1GXD C;  2GA4 B;  4KKS A;  1GUS A;  4BY1 B;  4HR7 B;  1L0X B;  1BXT A;  3PUX A;  3U9O A;  3KBX A;  3NE5 B;  1A3U A;  3MXU A;  3DXJ C;  3T4A C;  4IZ8 A;  1KLG D;  1R4Q B;  5BN4 A;  2ENB A;  2E2D C;  2B63 B;  4ZUJ A;  2NVY B;  1VCI A;  2QIL A;  3IL8 A;  2KCC A;  4KJN A;  1U9R A;  3DWP A;  1YNN C;  2EJM A;  5A2Q L;  1LO5 D;  5ELB A;  5IGG A;  2JEB I;  3GV6 A;  3FPP A;  4ULL A;  4H44 C;  2I07 B;  3S16 B;  3CRK C;  3GQB A;  3TSS A;  3TME A;  3I8Z A;  5C3W A;  1M8A A;  3NXW A;  3NWS A;  2YU9 B;  4FP5 D;  2F0P A;  4IFD J;  3NHH A;  5ELC A;  4BY7 B;  5C44 B;  3S14 B;  1Y8O B;  3DWA A;  2F0L A;  1ROD A;  2HCI A;  2BOS A;  2R93 B;  2B8F A;  1SAP A;  1KAB A;  1MGS A;  5CV9 A;  5JOB A;  1TKW B;  2PQE A;  3Q0A A;  4QUF A;  4PMB A;  2F0K A;  5IIF A;  4FF3 A;  3P7J A;  1NCV A;  3NPP A;  1VMP A;  1QNU A;  1SMY D;  1XTC D;  4V19 0;  3R93 A;  2AWO A;  3F2U A;  1EEF D;  3P1H A;  1BO0 A;  2KHS A;  3NSW A;  1LTG D;  2F4I A;  1B44 D;  1F2M A;  2ZXO A;  3ITP A;  1JOO A;  4XQJ A;  5D65 A;  1AFP A;  4FO2 A;  4AYB B;  5ELE A;  2E2H B;  2DY7 A;  5A35 A;  1D1I A;  2F1M A;  4RKB A;  1Z47 A;  2OF1 A;  3RZD B;  4TKO B;  2Q8R E;  1QJO A;  1IL8 A;  5FLX E;  2WIN B;  2MHV A;  1EY6 A;  2BCO A;  2L0C A;  1SMY C;  2ZT9 C;  3GO5 A;  1MSG A;  5FO8 B;  1D5X C;  3VR5 A;  4Q5V A;  1SBB B;  1LT4 D;  2JYO A;  3K7A B;  1WD0 A;  1HFG A;  1TQO A;  1X32 A;  2JA7 B;  1SSO A;  5CYU A;  2K1B A;  1EU3 A;  4PNY A;  5C0X J;  5M5Y B;  3PMF A;  4N9T A;  2R3Z A;  2MGS A;  5DEH A;  2NTT A;  2E2I B;  2J0T D;  2OT2 A;  1CM9 A;  1SYD A;  2E74 C;  2F0N A;  4DN4 M;  3A8K E;  2LKV A;  1GHJ A;  1SNO A;  5EPJ A;  5COR A;  5IT9 E;  3ERQ A;  1KDB A;  1M4V A;  1CZG A;  5C6A A;  2D62 A;  3GTJ B;  2VNU D;  5EPL A;  1PRT C;  1FNW A;  2AWN A;  2F0S A;  2WB1 B;  3I73 A;  5IGF A;  3EA6 A;  4CGY B;  2EYH A;  3CHB D;  3AB9 A;  4U68 A;  1Q3L A;  2X69 A;  5C3E B;  1PFM A;  5EPK A;  1CA5 A;  4J6H A;  2EYM A;  3OW7 A;  1E2Z A;  3KLS X;  5HGT A;  3VA5 A;  4ZK9 B;  1A2U A;  1ZKO A;  1LTT D;  2VB3 X;  2FMC A;  5IGE A;  3VR4 A;  3H91 A;  3TP5 A;  5KRU A;  1ESR A;  2FFK B;  4O42 A;  4B08 A;  4KKU A;  1X3P A;  3N6R A;  1DOM A;  5C4H A;  1WTX A;  1QNK A;  2K5W A;  4MN3 A;  3GTO B;  3GTM B;  2J7Z A;  4V0B A;  2TMP A;  3BZD B;  3VYS A;  1Y1V B;  4ODG A;  1EEI D;  4XDX A;  3WOF A;  3MFG A;  3K5L A;  2Z4H A;  2A73 B;  2HUG A;  3OHX C;  3H6M A;  5JVH 3;  3MXN A;  2MPM A;  5JJZ A;  2D9U A;  3E5S A;  2NN6 I;  4DAP A;  1WTV A;  3HZX A;  2G9H D;  2A6E C;  3A7L A;  4QB4 A;  4CHT B;  2FMM A;  3CU7 A;  4NW2 A;  2K03 A;  2WII B;  3I3C A;  4XXE A;  4CBV A;  4HSV A;  1PTO F;  3DUZ A;  5I2X A;  4TRD A;  2EDG A;  1GUO A;  5KYL A;  1XXG A;  2KVM A;  3I72 A;  1I4R A;  2A6H D;  1CFM A;  1AZQ A;  4QCL A;  1G2S A;  4A3J B;  1KNE A;  1LAC A;  4HAE A;  3MZ5 A;  2B2Y A;  2WP8 J;  3A8J E;  5FOB B;  3HOY B;  5FO7 B;  4DNT B;  5C3X A;  3PUV A;  1TWH B;  2EY2 A;  3GTQ B;  3FRP B;  2B2T A;  3M3Y B;  1E2W A;  1C8C A;  2F0F A;  1BF4 A;  2X6L A;  2PYK A;  2V4D A;  5EJW A;  2L9H A;  1GUN A;  2F3W A;  5JEA J;  2BDN A;  4DA2 A;  2D2C C;  4K8J A;  1HRJ A;  4RHR A;  3R3O A;  5D14 A;  3ZYY X;  4QF4 A;  2ICI A;  2NTS A;  5BN5 A;  4G4K A;  4KY5 A;  1J8I A;  1GHK A;  2QF7 A;  4IQZ A;  4RHS A;  5FK9 C;  4XT3 B;  5CBA E;  2A68 C;  1LLR D;  3L9A X;  1CZW A;  4CKC A;  3M85 A;  4IFD H;  4RKL A;  1O7Y A;  1LT6 D;  5F2D A;  3A54 A;  4ILW A;  2XN9 C;  3IFT A;  3JAM L;  4R8N A;  3T56 B;  1B1Z A;  1EY4 A;  2A6H C;  1I6H B;  3SK8 A;  4G7H C;  1I4X A;  1B3A A;  1V1O A;  1MBY A;  4ZKB B;  2HDM A;  3K5M A;  2B8G A;  4ID6 A;  5T1I A;  2KA7 A;  1D1K A;  4WFN 3;  1D2B A;  1QE6 A;  3H94 A;  5KNC A;  1I6V C;  2SEB D;  2L4N A;  4UDU C;  5EBC A;  4WJW A;  1Q1B A;  5C4X B;  3S17 B;  4NMZ A;  1SND A;  2B2U A;  4HMJ A;  1F2Y A;  5JAV A;  1HTP A;  4OL7 A;  1Q12 A;  2SNM A;  3FPU B;  2IPK D;  1NR2 A;  1C4Q A;  2F0U A;  1DCZ A;  1WTP A;  4X3S A;  4OO1 G;  3LNN A;  1PZK D;  1STB A;  1QCB D;  1DYQ A;  4FXG C;  4K14 A;  3HP3 A;  5G3L F;  4TSS A;  4C3I G;  1KLU D;  2B2Y C;  3A56 A;  2PPB C;  3PUY A;  3K6O A;  5EGT A;  1XWE A;  3J7A F;  1WTO A;  3BYY B;  1V1P A;  2VXW A;  1RHP A;  1STA A;  2B2T C;  3DEO A;  1S5C D;  2EPB A;  1MSH A;  1AW7 A;  4KD4 A;  1QIL A;  4G7O C;  3TZD A;  1EYD A;  3J80 E;  2YYZ A;  1ML0 D;  4BWG B;  2KQ3 A;  3G7L A;  4IUR A;  4KHV A;  3SEB A;  3HGB A;  1SE4 A;  3ERO A;  1UNS A;  4OHJ A;  3BYT B;  4ZKC B;  5C0X H;  2KED A;  4C1N K;  2CQA A;  2F0D A;  4A3B B;  5I6Y A;  2DN8 A;  3HOX B;  2BA0 A;  4C3H B;  3HOZ B;  1ENC A;  2BA1 A;  1MI2 A;  1BQQ T;  4NDX A;  3S1R B;  2NVT B;  1SYB A;  5KGU A;  3LWU A;  1EY0 A;  3MHB A;  3R2I A;  3I4N B;  4CJ2 C;  2KJX A;  3J81 L;  5JPM C;  3K57 A;  4KMU C;  1TS4 A;  4PV1 C;  2B2U C;  2KEE A;  4EVO A;  3Q23 A;  3KLR A;  3N52 A;  3V2T A;  5M3M B;  1TR5 A;  2KCN A;  4CJ0 B;  4L63 B;  4U67 3;  1I4H A;  5IOD A;  4A3M B;  2B2V A;  4RFB A;  4OO1 H;  3KF8 A;  3D4R A;  1H9S B;  3MWY W;  1ZEQ X;  5CV6 A;  1RCV D;  1UUP A;  3OSO A;  4Q0F A;  1PLF A;  3MXP A;  5TSS A;  1ET6 A;  3PIP 3;  2CW0 D;  4DXG A;  3WDN A;  2L5T A;  2IL8 A;  3I4M B;  3RMH A;  5IGD A;  1WVL A;  4XQQ A;  2A74 C;  1BCP F;  2DNC A;  1II3 A;  3NK9 A;  1C48 A;  1H9J A;  2MUY A;  2IW3 A;  4WRD A;  1G8Z D;  4I65 A;  2K5Q A;  3KBG A;  5C4J B;  3D31 A;  4ME5 A;  2Q8I B;  2QKI C;  3PUW A;  4DK0 A;  3OIP A;  4NP5 A;  2F0M A;  4X3T A;  3DMU A;  1SE3 A;  4HSP A;  1CQV A;  1ZYR D;  3SDZ A;  5M5X B;  4C3I B;  3L3O C;  4C3J G;  5KNB A;  2F0O A;  1I4Q A;  4RGO S;  1WD1 A;  5CBE E;  5NUC A;  4KTA A;  1CHQ D;  4F8M A;  2X6G A;  4KJO A;  1IYV A;  3E0J A;  2F0G A;  2MP1 A;  5CMD A;  4IUV A;  3HKZ B;  3HRZ C;  1OXX K;  4K2K A;  4ZLT F;  2NVX B;  1S5E D;  4TQU S;  5A2Q E;  2NBF A;  2FIN B;  1JWS D;  3NTH A;  2EZV A;  4ZRZ A;  4L6T B;  2A69 D;  4BBR B;  2B2V C;  2R61 A;  1SJH D;  2PMZ B;  5C5M A;  1HFN A;  1VF5 C;  2XIW A;  3GD7 A;  1S5B D;  3BDO A;  3EQL C;  5CV8 A;  4A3E B;  3VR6 A;  3FMC A;  1ZYR C;  4HED A;  4CJ1 B;  2EE1 A;  1FD7 D;  3RLF A;  2N88 A;  2BE5 D;  2JA5 B;  1FNU A;  3TP7 A;  4PQX A;  4B9W A;  4XIG S;  4A3D B;  1KNA A;  4K5X A;  1EFI D;  1CA6 A;  2C9O A;  2K6A A;  4OIJ A;  4R9W A;  3G6J B;  3TDQ A;  4KHZ A;  2SNS A;  1V43 A;  5DM6 3;  3P75 A;  5E4X A;  3QOJ A;  2KEC A;  3OIQ A;  1A6X A;  2AUJ D;  2AQ3 B;  4K6L A;  1SDF A;  5AFW A;  1TS3 A;  4IN3 A;  4A3I B;  5E4W C;  2DY8 A;  5COY A;  3BVM A;  2K7V A;  3VYU A;  4HTH A;  1O7L A;  4MHE A;  3SK5 A;  2A69 C;  1Y8N B;  1EIH A;  3BDC A;  4DU9 A;  2F0I A;  1TT2 A;  4FNF A;  2WKC A;  5M9O A;  5KND A;  2NUC A;  1BUV T;  3FVQ A;  3CKI B;  4DF7 A;  5DAU A;  3AU7 A;  1BOS A;  1HHV A;  1O78 A;  1RDP D;  1A3T A;  2DNE A;  3SVM A;  3A8I E;  2BE5 C;  1GUW A;  3M4O B;  3OOC A;  1CK1 A;  3GTK B;  2K5D A;  4X3U A;  1H9S A;  4IFD G;  1LTS D;  4KN4 C;  3OMG A;  3EVQ A;  3NQT A;  3X3N A;  3NBH A;  2F0T A;  3TZU A;  4QUC A;  5EBD A;  1TVX A;  1HA6 A;  5M3F B;  1STE A;  4Z9C B;  2EYL A;  1SNP A;  2EYJ A;  2K32 A;  2F3V A;  1G6Z A;  1FYC A;  3C1F A;  1JOR A;  1PZI D;  1Y8P B;  4S3S A;  5EKL A;  4RCO A;  3S1N B;  1STN A;  2M2L A;  3RD4 A;  1OXS C;  2EXZ A;  3I4L A;  3SK4 A;  1GUG A;  1KDA A;  3DWQ A;  4IUU A;  1O7Z A;  1PRT F;  1IYU A;  2EJG C;  3KLS A;  5JVG 3;  2JEA I;  1FR3 A;  1VDZ A;  4KK7 A;  1NSN S;  3J7Y W;  5LL6 S;  1ILP A;  5CV4 A;  3I70 A;  1BBX C;  3V96 A;  1DZ1 A;  1B53 A;  3X3M A;  2Z8L A;  1LT3 D;  4ZUI A;  4DXF A;  4N9P A;  3H09 A;  3NWT A;  2IX1 A;  3D6W A;  3ND9 A;  2R6G A;  3UI2 A;  2XWJ B;  2RSO A;  1PFN A;  1PYW D;  4IUN A;  2OEO A;  2F0W A;  5E1F A;  3Q6S A;  1OXU A;  1F9Q A;  1S5D D;  2EYO A;  1QWY A;  4J8Q A;  5K36 H;  3I90 A;  3A55 A;  3M4Y A;  2EOT A;  1G2T A;  3QWN A;  2MJ8 A;  2Q8T A;  2AQ2 B;  1EOT A;  5C0X G;  2E75 C;  1U4M A;  2FHT A;  2RDF A;  5C4Z A;  1Y69 U;  1HUN A;  3GV3 A;  5IOC A;  4HMI A;  2WAC A;  3K59 A;  2O4X A;  4KN7 C;  2I46 A;  2RDG A;  1TS5 A;  1SXT A;  3J80 L;  1F2L A;  1XX8 A;  4BA1 I;  1OXV A;  3VR3 A;  3QB3 A;  1JIC A;  2ICE C;  1RF2 D;  1TU2 B;  4I7Z C;  2PCF B;  4ZAI A;  4EQP A;  4C1N I;  4KI0 A;  1DOK A;  3SR1 A;  1SE2 A;  2QEJ C;  4RWS C;  4RCN A;  1IHZ A;  4BA2 I;  1EY7 A;  1Q8I A;  1F9R A;  4HCE A;  4F7X A;  1JR0 D;  2Z1C A;  1PTO B;  1AEX A;  2RA4 A;  1DXM A;  1QG7 A;  3R8B A;  3PO3 B;  2NZ1 D;  1D5Z C;  1CHP D;  2ID0 A;  3E6Z X;  2LS0 1;  5I9O A;  2K28 A;  1STG A;  2IX0 A;  4K5V A;  1T5X D;  2A5H A;  5CGK A;  4QMG A;  2C5C A;  5J1Z A;  2ZXP A;  1T5E A;  3OPO A;  5EKI A;  2K33 A;  1GOZ A;  1JOQ A;  1JQY D;  2EY6 A;  4CKE A;  3VYT A;  2WV6 D;  4KKT A;  3W3A A;  3BVZ A;  2B2W C;  2EYP A;  5CC4 A;  1H9M A;  3GTG B;  3QJY A;  2RVL A;  1JWU D;  4ABN A;  3C3L A;  1U4P A;  2WKD A;  5LHY 1;  3JAM E;  3FDT A;  5T1G A;  4DGZ A;  2F0Q A;  1W6K A;  1EWH A;  1TY0 A;  2FJ2 A;  3K5N A;  2XRS D;  1GUT A;  1SYF A;  2K05 A;  3CRL C;  4IFD I;  2F0E A;  5I9P A;  1LT5 D;  3SK6 A;  3D6C A;  4JK1 C;  2F0H A;  3M7N A;  1QB5 D;  4O1N A;  2JP1 A;  3EFX D;  2E2J B;  3MTS A;  1O80 A;  3KUP A;  3Q22 A;  4ZQ3 A;  1DOL A;  4R8I A;  4OIK A;  1TY2 A;  2QDB A;  4IUP A;  1LAB A;  3NTK A;  3VYR A;  1EWC A;  3WOE A;  1Z6H A;  2EYF A;  4RGT A;  2VUM B;  1OXT A;  1WTQ A;  1DJR D;  4E6I A;  4UAI A;  3QG1 A;  3AMU A;  3MFY A;  1S5F D;  5JEA G;  1ENA A;  3V05 A;  5KYI A;  1EU4 A;  2RDH A;  1IW7 D;  5HUR A;  3DM1 A;  4DFA A;  3ND8 A;  4Y7N B;  5ELD A;  1EY9 A;  3DHQ A;  1H9K A;  1JCK B;  3P20 A;  1ENF A;  5BN3 A;  3QO2 A;  1EQV A;  4BS9 A;  3HEJ A;  3GP7 A;  1Q1E A;  3KK7 A;  1PDQ A;  1AZP A;  1DM0 B;  1RJT A;  4FF4 A;  2AQ1 B;  4H0L C;  2CHB D;  1E0B A;  2SOB A;  2NN6 G;  1PFB A;  3K58 A;  2RQX A;  1EZ8 A;  4B9X A;  1SNQ A;  1D5M C;  1SJE D;  3PO2 B;  3K5O A;  1LTR D;  3EJI A;  4MIU A;  1VMC A;  2IJ0 A;  1J9O A;  4H13 C;  5FLX L;  3H3V C;  2R92 B;  2NB0 A;  1WTR A;  1K83 B;  3TBI B;  1ONL A;  1XYI A;  3IKJ A;  3GTL B;  3OWE B;  2L12 A;  4PMC A;  4CKB A;  3ONA B;  1HXY D;  1Q90 A;  1AP0 A;  1IW7 C;  5C0X I;  4A93 B;  1D6E C;  5D3D A;  3J81 E;  3NUC A;  3TN2 A;  2JA6 B;  1I4G A;  5I6W A;  2CW0 C;  1B9M A;  2HQE A;  3MAQ A;  1HTL D;  4NKL A;  4F88 A;  5IGB A;  5IT9 L;  4EQN A;  2XSC A;  2PNR C;  3S1Q B;  3MXG A;  1B2T A;  1KAA A;  2H1E A;  4RH6 A;  5DNF A;  4EQO A;  3S15 B;  2Y0S B;  3HOU B;  5JEA H;  1TWA B;  4FXD A;  1EY8 A;  2PW5 A;  3PUZ A;  4K5W A;  4OGQ C;  1EY5 A;  1ESF A;  3SXH A;  5I4D A;  1F9S A;  2H4O A;  2R7Z B;  2WAQ B;  1I3Q B;  3HOV B;  1SYE A;  3OMC A;  4OO1 I;  1HQR D;  4F87 A;  2JXM B;  1BDO A;  3PIO 3;  1SFO B;  1STH A;  1PTO D;  1PRT D;  3IFD A;  5D3I B;  3T13 A;  4M1U B;  4XT1 B;  1VF7 A;  5M5W B;  3TP6 A;  5EKK A;  1K8M A;  1JC7 A;  1BCP B;  2NN6 H;  1LTI D;  3NTI A;  2KUM A;  1L0Y B;  3OWF A;  2XVS A;  1UEA B;  2O5J C;  1FNV A;  1SYC A;  3H0G B;  3R2T A;  3T16 A;  5JPN C;  3D3R A;  4DNR B;  5KEE A;  3D8G A;  1LV9 A;  1JOK A;  4RGM A;  2PZW A;  2PZT A;  4K2L A;  4K8I A;  4PMW A;  1WTW A;  4KV6 A;  4IAL A;  4H7B A;  3D4W A;  2IWH A;  1BNZ A;  3HS0 C;  2PW7 A;  1A3V A;  1KDC A;  1RKN A;  4K6D A;  1YNJ D;  3LX0 A;  1PTO C;  3I91 A;  5K36 G;  2J4X A;  4FXK C;  2VB2 X;  2A6E D;  3U9S A;  1R9T B;  2F03 A;  2L55 A;  1V1P B;  2LMC B;  4RAU C;  1ZXT A;  4FF2 A;  3S1M B;  2EJF C;  2N55 A;  1LTB D;  4YIJ A;  4M8A A;  3RZO B;  2CVR A;  2TSS A;  1EYC A;  1SEB D;  1LTA D;  2O5I C;  4C3J B;  4L8J A;  3FKI B;  1F77 A;  1TWF B;  4GZY C;  1ILQ A;  1FGB D;  5CR3 A;  2L1B A;  2SDF A;  1TS2 A;  5G3L D;  5J39 A;  4RA8 A;  4XYO A;  1B50 A;  2M00 A;  1G91 A;  4HCS A;  1PMR A;  1IKM A;  1K8O A;  1YNJ C;  1MD2 D;  5I2Y A;  3A7A B;  3W2D A;  1HCZ A;  5ISR A;  3D4D A;  1OO9 B;  2OXP A;  3IAY A;  5CV7 A;  1U4L A;  1IKL A;  1X3Q A;  2A68 D;  2HCC A;  2EY1 A;  5C5L A;  3MC0 B;  3VA7 A;  4A3F B;  3MVV A;  2EVB A;  2NWG A;  5E3F A;  1EIG A;  3Q24 A;  2Z4I A;  3NBI A;  5ELF A;  1RTN A;  5FKA C;  2D5D A;  3M7G A;  1EZ6 A;  1JWM D;  3BS1 A;  4FYD A;  1TWG B;  3NQI A;  2L11 A;  4J1M A;  1TWC B;  3GTP B;  1R4P B;  2XRQ D;  4DK1 A;  5EQ0 A;  2KOL A;  3DEP A;  4IUT A;  3FEW X;  3RUZ A;  1JE4 A;  4C3H G;  1QOH A;  3SHL A;  3BVG A;  3J7A V;  1WCM B;  1A15 A;  3BDL A;  5J22 A;  4FVM A;  4C2M B;  1CQF A;  4DAV A;  3K0Y A;  2IT1 A;  3HOW B;  5K5P A;  4LK1 C;  2B2W A;  2JSO A;  4ZYS A;  3L7Z C;  4WOR A;  4EGV A;  2HDL A;  4KY7 A;  2RBM A;  3LWE A;  4G57 A;  3HG9 A;  1A2T A;  1KTK A;  1F9P A;  1U4R A;  1PZJ D;  1SNC A;  3QIA A;  4XQN A;  2EY5 A;  2M9V A;  1EL0 A;  4C56 C;  1B9N A;  1GJX A;  1W6J A;  3URY A;  1PTO H;  1PXU A;  4A3G B;  2RSN A;  2G9D A;  2BDO A;  2LFN A;  4XTC S;  3C1E A;  3T51 B;  2F0V A;  2ZXR A;  1F2Z A;  1HPC A;  3SE0 A;  1NR4 A;  2B39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...