5EKKA

Crystal structure of staphylococcal nuclease variant delta+phs v39d/l125e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLDDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLERKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V39D/L125E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ekkA00
4DGZA 5KIXA 3D4DA 1SYBA 1A3TA 1A2TA 4H7BA 5C4ZA 5EGTA 1EQVA 3MZ5A 4ZUJA 3T16A 3TP8A 1STHA 4KJNA 4F8MA 4B9WA 4K8JA 4N9TA 1TR5A 4KY5A 4IUNA 2F0PA 2F0MA 5EKLA 5HURA 4N9PA 2F0DA 4DF7A 2F0NA 1EYAA 4RKBA 5I9PA 1JOOA 4NMZA 1F2YA 2EYOA 2HQEA 2F0WA 4NKLA 2F0LA 2EYFA 4G57A 5IGEA 3HZXA 4ZUIA 1EZ6A 3D6CA 3MEHA 5CV8A 1TQOA 2RDFA 3EROA 4KY7A 2KHSA 1EY5A 5C5MA 1KDAA 4KHVA 3SK5A 1SNCA 5NUCA 3D8GA 2EYLA 2SNMA 5IGFA 5CV9A 2ENBA 1JORA 2PW5A 5C6AA 1EY7A 3P75A 3OSOA 3SHLA 4EQPA 1JOQA 4KD4A 2EY6A 2F0QA 2F0SA 4HTHA 5ISRA 1SNQA 4E6IA 5I6WA 3SR1A 3P1HA 3S9WA 1EY9A 3C1EA 1IHZA 2F0OA 2SNSA 5DAUA 4K5VA 5CV6A 5CV7A 2EYJA 3SK8A 5C4HA 1NUCA 2RKSA 1JOKA 2PYKA 5CC4A 3DHQA 4LAAA 1SYFA 4QF4A 4B9XA 2RBMA 1KAAA 2KQ3A 1F2ZA 1SNOA 1STYA 4RKLA 3MXPA 3NUCA 3R3OA 5HGTA 1SYDA 3V2TA 2QDBA 1EY4A 3U9OA 2EYPA 5C5LA 5JAVA 3VA5A 2EY5A 1EYCA 2EYMA 5DEHA 1ENCA 3OMGA 4HMJA 4KY6A 5KGUA 4KJOA 5CR3A 4K5WA 4KD3A 2OEOA 4I65A 4K8IA 4NDXA 5JOBA 2PZWA 4DU9A 2PZUA 2F0UA 1EY0A 1KDBA 2F0KA 4IZ8A 4QMGA 3TP7A 3TP6A 2NUCA 5IOCA 1SNMA 5IGBA 3LX0A 1A3UA 1NSNS 1EZ8A 1F2MA 3MVVA 2O4XA 3QOLA 4KV6A 4S3SA 5IODA 2PW7A 3TP5A 1KABA 3QOJA 4IALA 1ENAA 4HMIA 2PQEA 3NQTA 3NK9A 1SNDA 1STBA 2F3VA 4QB4A 3TMEA 4ODGA 2EY2A 3BDCA 1U9RA 4ME5A 2LKVA 4WRDA 2SOBA 5KRUA 1II3A 3EVQA 3NHHA 5CV4A 5J22A 2F0EA 4EVOA 4K2KA 4J6HA 4TRDA 3D4WA 1STNA 3NP8A 4R8NA 2PZTA 4K6DA 5E1FA 5J39A 4KTAA 3E5SA 3SK4A 1A2UA 4K14A 4EQOA 1RKNA 5KYIA 3EJIA 1STAA 3OMCA 4J1MA 3DMUA 3MHBA 5CGKA 5K5PA 1SYGA 3C1FA 1EY6A 2F0HA 2OXPA 4MIUA 3OWFA 5J1ZA 1STGA 2F0GA 2F0IA 5C3WA 2EY1A 3HEJA 5I6YA 5IGDA 2F3WA 2EYHA 4YIJA 1AEXA 2F0JA 3NXWA 1SNPA 2F0TA 2F0VA 3RUZA 5M9OA 1KDCA 1TT2A 3ERQA 4NP5A 4ID6A 4PNYA 5I9OA 3H6MA 4OL7A 5EKKA 1SYEA 3SXHA 3QB3A 5KEEA 3PMFA 3T13A 5E3FA 4K2LA 3SK6A 1SYCA 4DFAA 4PMCA 5CV5A 5IIFA 1EY8A 5IGGA 1EYDA 2WACA 4WORA 5F2DA 5IGCA 4K5XA 3ITPA 4EQNA 2OF1A 4F7XA 5KYLA 2F0FA 4ZQ3A 5C3XA 2M00A 4PMBA 2EXZA 1A3VA 3BDLA
chains in the Genus database with same CATH superfamily
1JWSD 1A2TA 5EGTA 2B2TA 3K6OA 4RAUC 1PH6A 4XT3B 4LF7L 3A7AB 2F0DA 2B2TC 5ELEA 1HNZL 2EYOA 1WI5A 1XMQQ 3CQZH 2O2LD 2WB1E 3I70A 1QE6A 2Z1CA 4HJ8A 1DOLA 3I72A 1JWUD 3ND9A 3IFTA 4X62Q 2RSOA 3A8JE 1UNSA 3KF6A 1SNCA 3FHWA 4KHZA 2AQ1B 4CKCA 4TSSA 4LFCQ 4EQPA 4ZKBB 5M3MH 1D5MC 2F0SA 2F0QA 4R4QA 2B2UA 1SMYC 2JYOA 1HQMC 3E9HA 1E2VA 1B9MA 4HEDA 4DV4Q 3J80c 1XPOA 4OX9L 1LTSD 3AQQA 1FD7D 1M8AA 4RKLA 4ILWA 3OW7A 4JK1C 1KRSA 1GO3E 2ZJRA 3S1QH 1R4PB 4JI7L 4QJFA 3CCUA 1HZ9A 4DV4L 1Y1WH 4B3RL 1HCZA 4I65A 2FFKB 1GKHA 1QUQB 1PMRA 1TWHH 1H9SA 3TP7A 4DAVA 3U4VA 5JJZA 5IP9H 1B7YB 1NSNS 3QOLA 5HY6A 2R93H 1XYIA 3ZJYC 4JI7Q 3G48A 2LKVA 1I50H 2NZHA 1L1OC 4JI5L 1T9HA 1T5EA 3NP8A 3UDGA 3CC7A 3RD4A 1TWAB 4DR4L 3SK4A 1CQVA 1VQMA 1PRTC 4B3SL 2H4OA 1IXRA 1WTHA 2NZOA 2DY8A 3VYTA 3H3VH 3I4NG 2JA8B 1SEBD 1I94Q 2PQAA 1P16A 4OGQC 3RLFA 5EBDA 2L9HA 3FKIB 1E2WA 1CQFA 1KNAA 1U4LA 3MXGA 3NENA 2PMZB 5LHY1 4HJ9A 3FPUB 2AKWB 5M5WH 1TS2A 4A3BH 4DAMA 3V96A 1PV4A 4B9WA 2D0OA 2NTSA 2VQEQ 4A3MH 4N9PA 2WAQG 4R4CA 4IFDJ 1YEZA 4WJ3M 2HQEA 4QQBX 5BN4A 4R4IA 2L5TA 3UE1A 4C3IG 3NPPA 5CV8A 2RDFA 4HIOA 3IFDA 1EY5A 2XRQD 4A3EG 1DZ1A 1WCMB 5BR8Q 4Y52H 2JEBI 4JBMA 4KN7C 1JJGA 4E6IA 2E76C 2VW9A 4AH6A 1Y8NB 2CWPA 1GOZA 4CDEC 1SE2A 2Y0SG 1VQGA 2EVBA 3BYYB 4WJ4A 1JCKB 1SROA 1EEFD 5IP7H 5C0XH 2QEXA 4HJ5A 1V9PA 2UU9L 1VQCA 3A5UA 1YJ9A 4BBRH 3PO2B 1SNOA 1TS5A 5IYBG 3O13A 5C3EH 5EJWA 2K5HA 3S24A 2F1MA 3TDQA 3OHXC 2UU9Q 2NUCA 3KK7A 1WYDA 3M7NA 3SGIA 1I50B 1ESRA 4AIMA 1VF5C 2KHIA 3TP5A 1X3GA 2A69C 3NK9A 5K36G 3MEFA 1MGSA 4K6LA 4A3CH 2ZXPA 1HR0Q 3GTLB 1TY0A 2DNEA 5J1ZA 2E2HH 5IP9G 4P75A 1STGA 1GUNA 2CH4A 1J5EL 3KF6B 1I3QH 4BY1G 3KLRA 4CDFC 1A62A 1R9TB 4JI3L 4IURA 4XIGS 1OXSC 1SRUA 2L1BA 4KKTA 1W3SA 2NVYB 1PZJD 4AYBE 1HNXQ 2WACA 1J5EQ 1IBLL 4NXNL 3F2UA 4DR2L 4ZQ3A 2EXZA 2F03A 1CKNB 2K7VA 5KIXA 3F2DA 1O78A 1STHA 2R7ZB 1KAWA 1TR5A 2K75A 2N3SA 2KHJA 2ZXRA 3ER0A 4U68A 4UP7A 3CD6A 1ZYRD 3I7FA 1IBLQ 4RKBA 1TWCH 4M8AA 5IYBH 2R7DA 4JI6L 2IY5B 1F2YA 1N36Q 4HN7A 3PIO3 4HIMA 1PYBA 1X3QA 2K5DA 1HNZQ 2K52A 4O2DA 2BH8A 2MFIA 5IYCG 4DV1L 4PV1C 3DUZA 4KHVA 1DONA 4JCVE 5IGFA 4L5SA 4BBSG 3M3YB 3MXNB 4ZRZA 3PO3G 1EY7A 4DV6Q 1IYJB 3DWAA 1XMOL 4WFN3 1IL8A 4JI0L 2PO4A 2VL6A 2F4VL 4DV5L 3L7ZC 3AYHB 4L8JA 1IHZA 2F0OA 3H91A 2ASBA 1TWAH 4DV0Q 1VF7A 2DJGC 1DCZA 5FLXc 2PMZE 2MP1A 2EE1A 4DV5Q 1Q90A 4GLXA 5LL6S 1LTAD 4PZ8A 3A0JA 1O7LA 5DEHA 3W1BA 4DN4M 2UUBQ 1X32A 3JAML 3HRZC 1CZWA 1QJOA 2O5JC 3IL8A 4QL5A 3CF5A 1PFBA 2N55A 3A74A 4P73A 2E2DC 2JA9A 3GV3A 1MJEA 3EIVA 1PTOC 4GNXA 3HKZE 1S4ZA 3TMEA 3D4RA 1LTBD 3HOYB 3EVQA 4DA2A 1Q81C 1OTCA 2DY7A 2AMCB 4YY3L 1VQNA 1STNA 5JEAG 4R8NA 1HFNA 5E1FA 1X55A 1C48A 3KLSX 1B50A 1V1OA 5CBAE 5C3XA 2Q2UA 1V1PA 2IHFA 4A3JB 2ZXOA 1S3OA 1GVPA 1KDCA 1TT2A 4NP5A 3GTPH 1N9WA 2XTIA 1I4PA 2VB2X 5CV5A 4H13C 2QDLA 4H44C 2WV6D 2JA5H 2R93G 1PLFA 3E9IA 2OEOA 1Q1EA 3S1NH 1KNEA 5T1GA 1Q8IA 1VQ9A 2A74C 2J7ZA 3X3MA 5C4JH 2Z6BA 3VYRA 5HURA 1PTOH 2NYZD 2SDFA 5I9PA 2XGTA 4DAYA 2XWBB 2JA7G 1A15A 4BXXH 3BZDB 3RZOB 3IKJA 3G7LA 2YU9B 1F9PA 4LNQA 2CQOA 2E2JH 4O0AA 5C4JB 3PIOA 4X3KA 5FKAC 3M85A 4BS9A 5C6AA 3Q8DA 2DGYA 4EQ5A 2JA5B 3BVMA 3HS0C 1HQRD 3C1EA 1D1KA 4DV1Q 1Q82C 5JEAH 4IQZA 1X65A 4GKKL 1WTRA 3GO5A 1SYFA 3S16H 3CP0A 3L9AX 2KQ3A 4GNXB 3CCSA 4IUTA 4BBSH 5DM63 1PRTD 1HNWL 5IE8A 3D0FA 2K50A 4UP8A 3CMEA 3GDEA 1J6QA 2BDNA 2ZTEA 1TWHB 4KD3A 2AHOB 5EPJA 1LTTD 4GN3B 1NBWA 2DJFC 4DUZL 4DR3L 2A68D 1EU3A 4KV6A 5IODA 4P74A 1KABA 3QOJA 4DR6L 4BBSB 3K58A 4IJLA 4ODGA 2YV5A 4G7ZC 2PQAB 1NE3A 2F0EA 1AE3A 2C5CA 2JJQA 3GD7A 4L5QA 4J6HA 5FLMH 1S5DD 2VNUD 2ZTDA 1RHPA 4H0LC 4LUOA 4HJAA 4B3SQ 5J39A 1EWCA 2WIIB 2FJ2A 4KTAA 1BO0A 4PQXA 5JVH3 4FF4A 3UE0A 1STAA 3VDYA 4N8FA 4DR6Q 1R4QB 5I2YA 2LMCB 2B2UC 2OXPA 5DNFA 2EIFA 2NWGA 5FJ8G 3I3CA 5IGDA 5IYDH 5EPLA 2L12A 4JI3Q 1V8QA 4XDXA 3W1GA 5T1IA 3I4OA 1SMYD 1PZKD 1YIJA 3X3NA 1KLUD 4DFAA 4DR2Q 2UXDL 4LF7Q 1G2TA 5F2DA 2VS1A 1GD7A 3ITPA 3GTQH 1LYLA 1BBUA 1HNXL 2IW3A 1YZ6A 3GTOH 4H7BA 3J81c 5I2XA 4FNFA 3KLWA 4OEMB 4JYAQ 4DV7Q 2GA4B 1FGBD 4K8JA 1U5KA 4JI6Q 4IUNA 1LTGD 5COYA 4BXXG 4UY8C 2NZ1D 4R8IA 1JQYD 4YCWA 4NKLA 1EWHA 1UE6A 2MO1A 3CW2C 4G57A 2OWOA 1LT5D 5IGEA 1KIXA 4FXDA 4DR5Q 1BUVT 3GTPB 4N8X1 1KLGD 2R3ZA 3KDFA 1E22A 1VMCA 3D8GA 3W2DA 1JORA 5EAYA 4A3IB 1BCPC 3PUZA 3UI2A 1HUNA 3NWSA 4CJ1B 3GV6A 3I4NB 2XSCA 1X54A 4A76A 5IY0A 1CSPA 4KN4C 2IWHA 3BVGA 4A75A 1BVSA 1XXGA 5JPNC 2HCIA 1BCPF 1B8AA 2A69D 4X64Q 4QF4A 1X3EA 2EDGA 4IJHA 3HOVB 3BJUA 1I3QB 1W2BA 3OIQA 4A3JG 4B3TQ 1I4XA 5KNDA 2NVTB 1PTOD 2PZWA 4XQNA 4IZ8A 2RDGA 4BY7G 3RZDH 3GTJB 5G3LD 2ZJQA 2L55A 1I4HA 2A6ED 4L5TA 2PQEA 1I6HH 4JPBW 2EY2A 3NHHA 3ULPA 4PZ7A 4F88A 4OONA 1PYWD 1K9MC 4HJ7A 3QWNA 4IN3A 4K6DA 1S5BD 3LWEA 1QOHA 2B2WC 3OMCA 2JA7B 1Q12A 5CGKA 1WCMG 2PNRC 3I4MG 3OWFA 2N49A 3P20A 2F0TA 4ZYSA 5E4WC 5ELOA 5I9OA 2KENA 3J81L 1OXTA 5EKKA 1LT4D 2UUCL 1QCBD 2VQEL 1TWGH 1AW7A 5KYLA 4A3BG 2AUJD 4AQYQ 1PYSB 4OO1G 5IYDG 1Q7YC 2FMMA 1O7ZA 1PRTB 4V190 3ULLA 4LUZA 1S72A 1N34Q 2QW7A 2X6GA 4LF6L 1QVFA 5LL6X 5BR8L 3KJOA 4RMFA 1I4QA 1VMPA 4FXGC 3ULJA 1PTOF 4LMQD 1U4PA 4ZKCB 4GKJL 2MJ8A 2EPBA 4ABNA 4HAEA 1VQHA 4OXPA 1E1TA 1CFMA 2D5DA 1VQ4A 3P75A 1YHQA 3S2HH 4JC0A 2DN8A 1SE3A 3GTQB 4ZCKA 4A3KG 3H0GB 1YJWA 4HCSA 4K5VA 3A56A 5CV7A 5C4HA 4JBKA 3QG1A 1N33Q 1IL2A 1O80A 1P8LA 3HOUB 2E74C 4O1NA 1QG7A 3J7AV 1I4RA 4RHSA 4LK1C 3AMUA 1STYA 2RDHA 2QA4A 1SYDA 3CRLC 3VA5A 4ZK9B 4Q0FA 2HCCA 5AJ3L 5GAHC 2VUMG 4DK3C 2P5ZX 1ENAA 4ULLA 3K5LA 2JN4A 1FYCA 4KK7A 1K83H 2E8GA 4F87A 3I90A 3I91A 3RZDB 3D4WA 2HQLA 4LF8L 5AJ3Q 3BVZA 2K5WA 4OHJA 4FO2A 4JV5Q 3DMUA 3UDIA 1ASYA 3R2TA 2RQXA 4A3KB 3GTMH 2D9UA 4DV3Q 3M3YH 2EYHA 3RLOA 1WD0A 2JA6B 1BCPD 1KRTA 1XNRQ 1EIHA 4A93G 1I6VC 4PMCA 2B39A 4C3HB 4JI1L 1L2FA 4LUVA 1ENFA 2K4KA 2A19A 3M7GA 4DR7L 1WTXA 5HGQA 2NN6G 4DAYB 2WFWA 3Q24A 1KC8C 1A0IA 5FLMG 3S17B 3TP8A 1XJVA 1FJGL 2K28A 3SEBA 3NE5B 3CQZB 2IPKD 3JC66 4NMZA 4X3SA 3DM1A 3CXCA 2NBFA 3HZXA 1VCIA 1DJRD 2L15A 5L37A 1PTOB 4DXGA 4FVMA 3VR5A 3U4ZA 3TEHB 4EGVA 3PO3H 3CU7A 1DD2A 1YNJD 5IWAL 1PH8A 1UE1A 2IHEA 2Z6KA 1EFID 3FKIG 3NTIA 4A3KH 3SHLA 4P71A 3CCLA 1WVLA 4X3TA 4O42A 5CYUA 1A8VA 3S9WA 1UEBA 2Z4HA 1VQ8A 2CW0D 1H9MA 1E3PA 3E0JA 5C4XH 2NVXH 4NPSA 3SK8A 5IT9E 2Y0SB 2UXCL 3GQBA 4QY7A 4DV6L 4X3UA 1H95A 3EA6A 2RCNA 3VR4A 3HOVG 1Y1VG 3S1MB 1WJJA 2B2VC 1HRJA 2R93B 1UEAB 3T1YQ 2X6LA 1IBMQ 2EYPA 5C5LA 3TBIB 4OWTB 1EYCA 3WDNA 4YWLA 2YTYA 1Y8PB 1U4RA 5JJLA 1VQIA 3VA7A 4Q5VA 2ZJPA 4XXEA 1OXVA 2D62A 4XT1B 2PW7A 2J0TD 2QEJC 4IPHA 5IIFA 1D2BA 1K8AC 4G7OC 4WRDA 4IPCA 5GADC 3FVQA 1SSOA 3HOUH 2M2LA 3OYYA 5M3FH 1VQJA 4K14A 1JT8A 5KYIA 2KVMA 5K5PA 3S2DB 4ALPA 1M4VA 1YBYA 4IUQA 4R9WA 3RUZA 1HXYD 2MO0A 1I94L 5M5XH 2UUCQ 1I5FA 1EL0A 5KEEA 3TREA 4MN3A 4DK1A 3STBC 3RLNA 2XWJB 1EY8A 1EYDA 4DV3L 1BCPB 2DNCA 1G2SA 3OPOA 3S1RH 1C7YA 2H1EA 4YWKA 4KJNA 5D14A 4F8MA 3GTKH 1BQQT 4CDDC 4DUYL 1VQ7A 2A5HA 4NXNQ 3QIAA 1B3QA 1JOOA 1CA5A 4GNXC 4LF6Q 4I7AA 4U673 1PA6A 4ME3A 1XPRA 5A2QE 1X3PA 1KDAA 3GTKB 3ONAB 2R7ZH 2EJGC 4Z9CB 1UUPA 3ND8A 5FLXL 2JXMB 4JBWA 1EQTA 1E2ZA 1TS3A 5JJKA 2SNSA 2EYJA 4C1NI 2BH2A 3D3RA 4B3RQ 3DHQA 1V1QA 3MFYA 1YVCA 3TZDA 2A6EC 5KNCA 3K59A 3CC2A 1VS0A 2Q2TA 1I6HB 2B2WA 1SBBB 3R3OA 2JA6G 3V2TA 1YITA 1N32Q 4JI2Q 3SE0A 1ENCA 1XNQQ 4Y7NH 2K33A 5M3FB 4A93B 2UUBL 2F0KA 2UXBL 1SNMA 4AYBB 1A3UA 1EZ8A 2K14A 3ZYYX 4QB4A 2XIWA 3NQTA 1SNDA 1NMGA 1STBA 1HR0L 1II3A 1NCVA 2YTXA 2R61A 1JJCB 3T53B 3I4LA 4DR3Q 1A63A 2IX0A 4C1NK 4KKUA 4MHEA 1RDPD 1CK1A 2TSSA 3FEWX 5DM73 3DLLA 4YHHQ 4J1MA 2I5LX 4HSVA 4RG1A 5JEAJ 4QIWE 5FJ8H 1EY6A 1HUMA 1PH3A 5C0XG 1JC7A 4H02A 2QCPX 4YY3Q 4YIJA 1AEXA 3KYHC 1JICA 1HZBA 3I56A 2TMPA 2ZT9C 4K2LA 3SK6A 1LTRD 4C3HG 2B29A 3H0GH 4RCOA 4PZ6A 4DXFA 1HFGA 4BY7H 4PMBA 3HOZB 1AH9A 2GVAA 4UP9A 1K8MA 4DNIA 2HHHL 3PCOB 4DAPA 4FXKC 1CZGA 3KOJA 4N9TA 3PIP3 2CQAA 1K73C 5K36H 1Y14B 2Y0SE 2FINB 1C4QA 1BF4A 2F0PA 1N36L 4JG2A 1G91A 3S1RB 3STBD 1WTWA 1QNKA 4L5RC 1UWVA 1GM5A 3S14H 3HOXB 1XWEA 4A3EB 3KFUA 1LTLA 2QKIC 5M5XB 2PPBC 3PIPA 1XMOQ 4ZAIA 1OXXK 1ZEQX 4JI0Q 3S17H 2SNMA 2OCEA 1EYGA 2NVQH 3BZKA 3U9SA 4OX9Q 1D5ZC 3AB9A 3M9BA 1TWFB 1IYVA 3S2DH 1FR3A 2JA5G 2K5QA 3CCRA 2E75C 1AP0A 3MAQA 1VQPA 3KUPA 3MA2B 2PYKA 3Q22A 2B8GA 3PUWA 4LFCL 3PUVA 2JA6H 1Y1VB 1T5XD 3J81E 5FK9C 3L2PA 2JA8H 1NNXA 3NQIA 1VDZA 5HGTA 2KEEA 2QDBA 1Q86C 1EQQA 3HOZG 1BNZA 3NTKA 5KGUA 4HMJA 1A6XA 3A55A 4K8IA 1VQFA 4DU9A 1HTLD 4QMGA 3PF5A 2J4XA 5IOCA 1CHPD 3CCJA 5IGBA 3H0GG 3NBHB 4S3SA 4R4TA 4X66L 2RVLA 5J3BA 2A73B 3U9OA 1J8IA 4ZLTF 4ME5A 1G6ZA 4QIWB 2B2YC 1VQ5A 4OO1H 5BN3A 1IKMA 4IPGA 1SJED 2LY7A 5GQOA 1A2UA 2UUAQ 1RKNA 4RGOS 3EJIA 1DXMA 3HOYG 4C3IB 1PXUA 4X66Q 1XNRL 2L0CA 1ZXTA 3SDZA 4JI1Q 5KNBA 5EKIA 4BBRB 3PO2H 4KI0A 3SVMA 1GUTA 2PNHA 3ICEA 3J81i 4OL7A 1EU4A 3T13A 2RCFA 3CCVA 3J7A5 2I07B 4X65Q 4K5XA 3V05A 4OWWB 2RF4A 2M00A 3AU7A 3BDLA 2HT1A 1F77A 3MWYW 4UHVA 2R92B 2OQ0A 1ILQA 1EQRA 3VYSA 1JJ2A 4A3FG 4X65L 1TIID 5G3LF 4LF4L 2F0NA 3F2BA 1LTID 1YHAA 1NTGA 2F0WA 4RHRA 4C3HH 4IOCA 3D31A 4BWGB 3R8BA 3MEHA 3D6CA 1B1ZA 3I8ZA 1HJPA 1Q46A 3RN5A 1Y69U 4A3LH 2BE5C 1IW7D 1U0LA 4C56C 4GZYC 3GTGH 4A3JH 5E4XA 5ELBA 4L6TB 3J80L 2ZM6L 2ALYB 3VR2A 1IBKQ 2WKDA 2HIXA 4A3DG 1D8LA 3TN2A 2M9VA 4MNOA 2GVBA 3GTLH 4XQJA 2L4NA 3URYA 2OTLA 4QGUA 3W5OA 1KAAA 1FVIA 1IBML 5AFWA 1SDFA 3MXPA 4G7HC 3NUCA 3HGBA 1E7ZA 1KD1C 4XYOA 3OMGA 1KXLA 1IYUA 2VXWA 3M4PA 1NR2A 3R2IA 5CORA 3I4MH 4RGNA 5E7NA 4A3FB 3Q6SA 4L63B 3PF4A 3K5OA 3LX0A 2VB3X 2CH4W 2FXQA 1LABA 3JAMi 1IW7C 3S1MH 1H9RA 2K01A 1D1IA 4IFDI 1TU2B 4R1JA 4JW0A 2KOLA 4LF5Q 3HOWB 4BA2I 1SN8A 4DR4Q 1FNUA 2EY1A 1Z7TA 1CT1D 2HD3A 1Y1VH 1YI2A 3GTGB 3S16B 1SNPA 2LFNA 1B44D 2F0VA 4QUCA 1OXUA 4IUVA 4LWCA 5M9OA 1VQLA 1ASZA 1SFOB 4A3CG 1EOTA 5BN5A 5JVG3 3MTSA 5E3FA 1S5CD 2G9HD 5C4XG 1SLJA 1NMFA 4GS3A 1DGSA 5DLQE 1E0BA 3CKIB 2MGSA 3EN2A 2KBNA 1AN8A 3A7LA 3DM3A 1V1PB 3MZ5A 4ZUJA 1LT3D 2HHHQ 1JR0D 5D3DA 5GROA 1W6JA 3NTHA 3J7ZC 2YU9H 1AFPA 1PZID 1WTOA 1QUQA 4LF4Q 4OIKA 1CI3M 1W6KA 4OIJA 1SAPA 2CHBD 1QVCA 2WAQB 1SE8A 4HIDA 1PHJA 4JI4L 1VQ6A 3FKIH 4FYDA 1V43A 3SK5A 5NUCA 3T4AC 2AQ3B 2ZTCA 5CV9A 3EFXD 4LF9L 2F3IA 2RA4A 3F1ZA 5I6WA 1K3BC 3Q23A 3SR1A 1EY9A 3GP7A 2VQFQ 1UE7A 5D65A 3U58A 2RKSA 2ICIA 1XNQL 1YNXA 4LAAA 2QILA 4JI8L 3A8KE 4KMUC 3B6YA 1MIUA 4UAIA 2K04A 1D5XC 1PDQA 1EFWA 1I4GA 4LFAL 1O7YA 4TQUS 4RH6A 2XN9C 1WTQA 4A3MG 3GTJH 2EY5A 2EYMA 1KL9A 1N33L 4JI8Q 3UDFA 2AUKA 1EY0A 1GUWA 3KBXA 3M4OB 1EOVA 2O4XA 1FGUA 4IPDA 1WFQA 1MI2A 5C4ZA 3J80E 1L0XB 4IUUA 2V4DA 2WINB 5J22A 5M3FG 4GOPB 2MNAA 3N52A 4GN5A 2HUGA 2NTTA 1M1KC 2E2IH 3K57A 1B3AA 1OO9B 1LV9A 3I4NH 3C1FA 3HP3A 2ATWA 1IKLA 1WCMH 3HEJA 3RR5A 5FO8B 3E3XA 4A3GH 2F0JA 2NVQB 1CKNA 4DNTB 3A5ZB 3MXNA 3P7JA 4LF8Q 2G9DA 2OQKA 5GAEC 2PCFB 4PNYA 2JEAI 2UXDQ 1J9OA 4LFBL 1PVOA 4CGYB 1CSQA 1PFNA 5H1SE 1UE5A 3S14B 2ID0A 4J8QA 5C0XI 1RODA 2F4IA 2AQ2B 1S40A 1B4OA 4KD4A 1A3VA 3HFZB 1VQDA 3D4DA 1TY2A 1X56A 4C3JB 2R92G 4LFBQ 2BCOA 3H94A 1BR9A 3AFQA 2JSOA 3RN2A 4A3BB 4X62L 3R93A 4G4KA 5EKLA 4AYBG 1JB3A 2K6AA 4QCLA 5EQ0A 1GJXA 4V0BA 2EYFA 4R4OA 4ZUIA 4UPAA 1HHVA 1Q8KA 1TQOA 1L0WA 1EIFA 2LSSA 2KCTA 5C5MA 2V1CC 3IAYA 3A54A 4BY1H 3RNUA 1NAPA 1ILPA 4DV2Q 1BKBA 1HPCA 1ET6A 5EBCA 3S1NB 3EBEA 4K0KQ 3P1HA 3CCMA 3T1HL 1GHKA 4CKEA 2NVYH 5FO7B 1Y8OB 4APVA 4GOPA 2F4VQ 5M5YH 2DUDA 3CMAA 1E1OA 1MHWC 5LMNL 1X3FA 3MFGA 2B63H 4IUPA 2QF7A 3KLSA 5JAVA 1B9NA 4EX5A 3BDOA 2L11A 1C8CA 1CKOA 1DYQA 2QGQA 3HOWG 1CHQD 1SXTA 4RGTA 1Y1WB 4FF1A 2JP1A 3J7YW 3G6EA 4RCNA 1ESFA 2XVSA 4CJ0B 3LWUA 3H3VI 3T1YL 4DK0A 2B63B 4IALA 3A8IE 3OTOQ 1F2LA 3BS1A 4TKOB 4CHTB 1LACA 2FMCA 1C0AA 1TXYA 1XX8A 2UUAL 3J80i 1BBXC 4LF5L 3L3OC 2UXBQ 1K8GA 1PFMA 4FF2A 2AWOA 1KHIA 1JOQA 1TWFH 1B2TA 2B8FA 3NSWA 1MKHA 2KCCA 4B3ML 2A6HD 2N88A 1TKWB 2K03A 2VUMB 1ML0D 1DOKA 4ID6A 1PH5A 1TS4A 2Z9HA 3QB3A 3FRPB 4A3EH 3CCQA 3LNNA 3TQYA 3HOXH 4C2MB 4FDBA 2OF1A 4F7XA 2F0FA 4DGZA 1WOCA 1FL0A 4A4IA 1S5FD 1EQVA 2EOTA 2JA8G 1N34L 3FPPA 1EIGA 1VQBA 3H3VC 1D6EC 5LMUL 1QILA 1EYAA 1JMCA 2B63G 1FNWA 4C2MH 1WD1A 1ZYRC 4NW2A 2ZM6Q 3PSIA 1LLRD 2FHTA 1IBKL 1QWYA 1EZ6A 3EROA 2I0QA 2MUYA 3CCEA 3H15A 1BOSA 1EWIA 3I55A 2R92H 4A3GB 1GXDC 3BYTB 5D3IB 3JAMc 5M5WB 1YNJC 3VR6A 1GUOA 2I5MX 4HTHA 3NELA 4POFA 2BE5D 1QB5D 2OT2A 1RIPA 2K32A 5JPMC 2N8NA 4LF9Q 5DAUA 2E2IB 3PUXA 4BA1I 5LMNW 4OELB 3T1HQ 2Q2IA 4YCUA 3WWVA 1GHJA 2Z0SA 2HDLA 3E6ZX 4C3JG 4DV0L 4DV2L 2KCMA 4LFAQ 1PH1A 3HOYH 4A3DB 2D2CC 1IZ6A 1HH2P 3GTMB 4LJZC 1F9RA 1RD9D 4GKKQ 4KY6A 4KJOA 1RJTA 4NDXA 3S15B 4DPGA 2F0UA 2CVRA 4FF3A 1H9SB 1G6PA 1CKMA 4TVAB 3TSSA 3D6WA 3CRKC 3RMHA 3OOCA 4DUZQ 1K83B 1VQOA 2C35B 2CKZB 1B70B 3DWPA 4HMIA 4XYQA 4RGMA 5KRUA 4A3FH 4EVOA 1JB7A 2YTVA 1Z6HA 3F8TA 4IFDH 4NB3A 5M5YB 4MZ9A 2BA1A 2PZTA 3HG9A 1HR0W 1CM9A 2WB1B 3QO2A 3BZCA 1SYGA 1CUKA 2F0HA 4MIUA 3S1QB 1F9SA 2F0GA 2WKCA 4J15A 5CMDA 1N8RC 1VQKA 3MC0B 2F52A 3K5MA 2ES2A 4BY1B 3HOVH 2EXDA 1BXTA 3W3AA 3PO3B 3WOFA 1NY4A 1EUJA 4CJ2C 1RCVD 2Q8RE 3G4SA 1Y1WG 1KTKA 1LM0A 1K8OA 4B3MQ 4RWSC 2VY3A 5ELNA 1Z9FA 1SYBA 1FJGQ 2LXJA 1CA6A 3H09A 1RF2D 4C3JH 5GAGC 2EJFC 2F0MA 1D7QA 4JYAL 2Z4IA 4DF7A 3HKSA 4KHPQ 4FP5D 3HOXG 1PH9A 3PGZA 4A3LG 4P2CB 2RSNA 1RTOA 2A1AA 2K1BA 2IJ0A 2G5DA 1R9TH 3EQLC 3WOEA 4MTNA 2PW5A 3K8AA 2KECA 2R7ZG 4M1UB 2LS01 4KLKA 5ISRA 1XMQL 3HKZG 2VQFL 1TWGB 1M90C 1HA6A 3E0EA 1L0YB 3HOWH 4UDUC 5CV6A 2N78A 4CDCC 3CPWA 1NUCA 2MPMA 3QR8A 5ELCA 2VUMH 5IYCH 3I2ZA 3I73A 1H9KA 4B9XA 1AZPA 1NR4A 1K3RA 1NJIC 1EY4A 4RFBA 1MSGA 1U4MA 2BDOA 2R7FA 3NEMA 1SR3A 4C3IH 3CC4A 4X6AH 1N32L 4GLVB 2MQHA 3U50C 1KDBA 1DOMA 3AEVA 2EZVA 3C3LA 4B3TL 3MVVA 3TRZA 5C44H 5ELFA 1GUGA 2SOBA 2PI2E 1X9NA 4TRDA 1G51A 4YHHL 2CFMA 4A93H 3FP9A 3KF8B 4Y7NB 2JQOA 1Q3LA 1LUZA 3KBGA 5C0XJ 3N6RA 3FDTA 4JBJA 2Z8LA 5FOBB 1EEID 4P72A 2KUMA 2E5LQ 1HZCA 4XTCS 4BBRG 4GN4B 2IX1A 3T51B 1K0SA 2I5HA 1B53A 3MXUA 2RHSB 3ERQA 3VYUA 2I46A 1SE4A 3PMFA 2CWAA 1KQSA 4DUYQ 1K0RA 4IO9A 2A8VA 3K81C 2IT1A 1YHBA 1TWCB 4XQQA 3T56B 1L1OA 1XTCD 5IP7G 5M3MB 4A3MB 1A3TA 1AE2A 2R6GA 3C2PA 4CBVA 3T16A 2B3GA 3BU2A 1DM0B 5FO9B 2KEDA 5LMUQ 2ICEC 1SMXA 4AQYL 3JAME 4KY5A 4KKSA 1ET9A 2JK8A 5C3EG 1MSHA 2WB1G 3RZOH 2F0LA 1H9JA 1X6OA 4PMWA 2BA0A 1PRTF 3IRBA 1SJHD 4KY7A 1ICWA 2KJXA 3NBIA 1SFOH 2KHSA 4WJWA 4DR5L 2CCZA 4I7ZC 1MD2D 3Q0AA 3ERSX 2EYLA 2WAQE 4A3GG 4IOAA 2XNAC 4K0KL 3TS2A 1G291 2A6HC 2Q2HA 3GTOB 2XRSD 5C44G 1Z47A 2EY6A 4BY7B 1SNQA 1BDOA 4CKBA 1YNNC 2JA7H 4HR7B 2OTJA 1K28A 1BBWA 4X64L 2GN5A 4JOIC 1JOKA 5LMNQ 1O7IA 4HIKA 2IL8A 1HNWQ 4JI2L 4HSPA 3BG3A 1HZAA 4LW1A 3K7AB 3HOUG 3FMCA 3OTOL 3I4MB 1RL2A 4IFDG 1S5ED 1CTMA 3VR3A 2B2VA 4DKAC 3KJPA 2YYZA 3S15H 5JOBA 2PZUA 3TP6A 2O5IC 5C3EB 2X69A 1HA5A 3OW2A 4OO1I 4A3DH 3BDCA 1VQAA 1MBYA 1RTNA 3CHBD 2MHVA 4NXML 1FNVA 4JI5Q 3G71A 2K5VA 2K05A 2RHQB 5A2QL 2Q8TA 2HDMA 2F0IA 2KA7A 2K5NA 1E24A 5FLXE 3S2HB 4A3IH 2F3WA 2EQSA 3PV0A 3NXWA 3AFPA 5IT9c 2E5LL 3K0XA 3L0OA 1L1OB 1LO5D 1PH4A 5A35A 1SYEA 1QVGA 1PFSA 3PQIA 3PUYA 4JOIA 3J7AF 1SYCA 3HKZB 5C4XB 4PG3A 2Z6KC 5IGGA 5I4DA 1WTPA 1F9QA 3OWEB 1QZGA 2Q8IB 4DV7L 2SEBD 3LGJA 1XTDA 4JVZA 3M4QA 5ELDA 2E2JB 3J81j 4KHPL 3KDFB 3HOZH 1QNUA 3KF8A 1VQEA 1Q1BA 2EJMA 3K5NA 1UAPA 5TSSA 4GLAC 1QZHA 1WTVA 1ONLA 3M4YA 1PH7A 2ENBA 4GKJQ 2A68C 4DR1L 3K7UC 3OSOA 3F2CA 4OWXB 5IWAQ 3K80C 3QJYA 1C9OA 1JE4A 3CAMA 2NB0A 4YWMA 1JWMD 2HIVA 5EPKA 3DEOA 4JI4Q 2LXKA 2B2YA 2JE6I 5CC4A 3DEPA 2NN6H 4DR1Q 2RBMA 3PO2G 1F2ZA 2D0PA 2PI2A 4YCVA 4POGA 1TVXA 1G8ZD 5CBEE 4A3IG 2E2HB 2CW0C 2UXCQ 1JE5A 5CR3A 4K5WA 3NWTA 1PH2A 2NVTH 3OIPA 3TS0A 1F2MA 1MJCA 1YNND 2NN6I 5M3MG 1GUSA 1YJNA 2F3VA 1LT6D 5C44B 1U9RA 3M4OH 2VZAA 4QUFA 5CV4A 4RA8A 4K2KA 4JV5L 1ICFB 5IT9L 2H5XA 4HCEA 1HTPA 2WP8J 3E5SA 2BOSA 4EQOA 4NXMQ 3MHBA 1ZKOA 3G6JB 4MTKA 3K7AH 5C3WA 1EIYB 2AWNA 5I6YA 2C9OA 1XPUA 5JJIA 3K0YA 2KCNA 4B08A 1AZQA 4DK6C 3CPFA 3NBHA 3H6MA 4GOPC 3SXHA 3TZUA 4DNRB 2NVXB 4DR7Q 3DWQA 4WORA 5IGCA 2IX3A 3DXJC 3UDXA 3C46A 1STEA 4EQNA
chains in the Genus database with same CATH topology
1JWSD 1A2TA 5EGTA 2B2TA 3K6OA 4RAUC 4XT3B 3A7AB 2F0DA 2B2TC 5ELEA 2EYOA 2O2LD 3I70A 1QE6A 2Z1CA 1DOLA 3I72A 1JWUD 3ND9A 3IFTA 2RSOA 3A8JE 1UNSA 1SNCA 4KHZA 2AQ1B 4CKCA 4TSSA 4EQPA 4ZKBB 1D5MC 2F0SA 2F0QA 2B2UA 1SMYC 2JYOA 1HQMC 1E2VA 1B9MA 4HEDA 1LTSD 1FD7D 1M8AA 4RKLA 4ILWA 3OW7A 4JK1C 1R4PB 1HCZA 4I65A 2FFKB 1PMRA 1H9SA 3TP7A 4DAVA 5JJZA 1NSNS 3QOLA 1XYIA 2LKVA 1T5EA 3NP8A 3RD4A 1TWAB 3SK4A 1CQVA 1PRTC 2H4OA 2DY8A 3VYTA 2JA8B 1SEBD 4OGQC 3RLFA 5EBDA 2L9HA 3FKIB 1E2WA 1CQFA 1KNAA 1U4LA 3MXGA 2PMZB 5LHY1 3FPUB 1TS2A 3V96A 4B9WA 2NTSA 4N9PA 4IFDJ 2HQEA 5BN4A 2L5TA 4C3IG 3NPPA 5CV8A 2RDFA 3IFDA 1EY5A 2XRQD 1DZ1A 1WCMB 2JEBI 4KN7C 4E6IA 2E76C 1Y8NB 1GOZA 1SE2A 2EVBA 3BYYB 1JCKB 5C0XH 1EEFD 3PO2B 1SNOA 1TS5A 3O13A 5EJWA 2F1MA 3TDQA 3OHXC 2NUCA 3KK7A 3M7NA 1I50B 1ESRA 1VF5C 3TP5A 2A69C 3NK9A 5K36G 1MGSA 4K6LA 2ZXPA 3GTLB 1TY0A 2DNEA 5J1ZA 1STGA 1GUNA 3KLRA 1R9TB 4IURA 4XIGS 1OXSC 2L1BA 4KKTA 2NVYB 1PZJD 2WACA 3F2UA 4ZQ3A 2EXZA 2F03A 2K7VA 5KIXA 1O78A 1STHA 2R7ZB 1TR5A 2ZXRA 4U68A 1ZYRD 4RKBA 4M8AA 1F2YA 4HN7A 3PIO3 1X3QA 2K5DA 4PV1C 3DUZA 4KHVA 1DONA 5IGFA 3M3YB 4ZRZA 1EY7A 3DWAA 4WFN3 1IL8A 2PO4A 3L7ZC 4L8JA 1IHZA 2F0OA 3H91A 1VF7A 1DCZA 2MP1A 2EE1A 1Q90A 5LL6S 1LTAD 1O7LA 5DEHA 4DN4M 1X32A 3JAML 3HRZC 1CZWA 1QJOA 2O5JC 3IL8A 1PFBA 2N55A 2E2DC 3GV3A 1PTOC 1S4ZA 3TMEA 3D4RA 1LTBD 3HOYB 3EVQA 4DA2A 2DY7A 1STNA 5JEAG 4R8NA 1HFNA 5E1FA 1C48A 3KLSX 1B50A 1V1OA 5CBAE 5C3XA 1V1PA 4A3JB 2ZXOA 1KDCA 1TT2A 4NP5A 1I4PA 2VB2X 5CV5A 4H13C 4H44C 2WV6D 1PLFA 2OEOA 1Q1EA 1KNEA 5T1GA 1Q8IA 2A74C 2J7ZA 3X3MA 3VYRA 5HURA 1PTOH 2NYZD 2SDFA 5I9PA 4DAYA 2XWBB 1A15A 3BZDB 3RZOB 3IKJA 3G7LA 2YU9B 1F9PA 5C4JB 4X3KA 5FKAC 3M85A 4BS9A 5C6AA 2JA5B 3BVMA 3HS0C 1HQRD 3C1EA 1D1KA 5JEAH 4IQZA 1WTRA 3GO5A 1SYFA 3L9AX 2KQ3A 4IUTA 5DM63 1PRTD 2BDNA 5EPJA 1TWHB 4KD3A 1LTTD 2A68D 1EU3A 4KV6A 5IODA 1KABA 3QOJA 4BBSB 3K58A 4ODGA 4G7ZC 2F0EA 3GD7A 2C5CA 2VNUD 4J6HA 1S5DD 1RHPA 4H0LC 5J39A 1EWCA 2WIIB 5JVH3 4FF4A 2FJ2A 4PQXA 1BO0A 4KTAA 1STAA 1R4QB 5I2YA 2LMCB 2B2UC 2OXPA 5DNFA 2NWGA 3I3CA 5IGDA 5EPLA 2L12A 1V8QA 4XDXA 5T1IA 1SMYD 1PZKD 3X3NA 1KLUD 4DFAA 1G2TA 5F2DA 3ITPA 2IW3A 4H7BA 5I2XA 4FNFA 2GA4B 1FGBD 4K8JA 4IUNA 1LTGD 5COYA 2NZ1D 4R8IA 1JQYD 4NKLA 1EWHA 4G57A 1LT5D 5IGEA 4FXDA 1BUVT 3GTPB 1KLGD 2R3ZA 1VMCA 3D8GA 3W2DA 1JORA 4A3IB 1BCPC 3PUZA 3UI2A 1HUNA 3NWSA 4CJ1B 3GV6A 3I4NB 2XSCA 4KN4C 2IWHA 3BVGA 1XXGA 5JPNC 2HCIA 1BCPF 2A69D 4QF4A 2EDGA 3HOVB 1I3QB 3OIQA 1I4XA 5KNDA 2NVTB 1PTOD 2PZWA 4XQNA 4IZ8A 2RDGA 3GTJB 5G3LD 2L55A 1I4HA 2A6ED 2PQEA 2EY2A 3NHHA 4F88A 1PYWD 3QWNA 4IN3A 4K6DA 1S5BD 3LWEA 1QOHA 2B2WC 3OMCA 2JA7B 1Q12A 5CGKA 2PNRC 3OWFA 3P20A 2F0TA 4ZYSA 5E4WC 5I9OA 3J81L 1OXTA 5EKKA 1LT4D 1QCBD 1AW7A 5KYLA 2AUJD 4OO1G 2FMMA 1O7ZA 1PRTB 4V190 2X6GA 5LL6X 1I4QA 1VMPA 4FXGC 1PTOF 4LMQD 1U4PA 4ZKCB 2MJ8A 2EPBA 4ABNA 4HAEA 1CFMA 2D5DA 3P75A 2DN8A 1SE3A 3GTQB 3H0GB 4HCSA 4K5VA 3A56A 5CV7A 5C4HA 3QG1A 1O80A 3HOUB 2E74C 4O1NA 1QG7A 3J7AV 1I4RA 4RHSA 4LK1C 3AMUA 1STYA 2RDHA 1SYDA 3CRLC 3VA5A 4ZK9B 4Q0FA 2HCCA 1ENAA 4ULLA 3K5LA 1FYCA 4KK7A 4F87A 3I90A 3I91A 3RZDB 3D4WA 3BVZA 2K5WA 4OHJA 4FO2A 3DMUA 3R2TA 2RQXA 4A3KB 2D9UA 2EYHA 1WD0A 2JA6B 1BCPD 1EIHA 1I6VC 4PMCA 2B39A 4C3HB 1ENFA 3M7GA 1WTXA 2NN6G 3Q24A 3S17B 3TP8A 2K28A 3SEBA 3NE5B 3CQZB 2IPKD 4NMZA 4X3SA 3DM1A 2NBFA 3HZXA 1VCIA 1DJRD 1PTOB 4DXGA 4FVMA 3VR5A 4EGVA 1DD2A 3CU7A 1YNJD 1EFID 3NTIA 3SHLA 1WVLA 4X3TA 4O42A 5CYUA 3S9WA 2Z4HA 2CW0D 1H9MA 3E0JA 3SK8A 5IT9E 2Y0SB 3GQBA 4X3UA 3EA6A 3VR4A 3S1MB 2B2VC 1HRJA 2R93B 1UEAB 2X6LA 2EYPA 5C5LA 3TBIB 1EYCA 3WDNA 1Y8PB 1U4RA 3VA7A 4Q5VA 4XXEA 1OXVA 2D62A 4XT1B 2PW7A 2J0TD 2QEJC 5IIFA 1D2BA 4G7OC 4WRDA 3FVQA 1SSOA 2M2LA 4K14A 5KYIA 2KVMA 5K5PA 3S2DB 1M4VA 4IUQA 4R9WA 3RUZA 1HXYD 1EL0A 5KEEA 4MN3A 4DK1A 2XWJB 1EY8A 1EYDA 1BCPB 2DNCA 1G2SA 3OPOA 2H1EA 4KJNA 5D14A 4F8MA 1BQQT 2A5HA 3QIAA 1JOOA 1CA5A 4U673 5A2QE 1X3PA 1KDAA 3GTKB 3ONAB 2EJGC 4Z9CB 1UUPA 3ND8A 5FLXL 2JXMB 4JBWA 1EQTA 1E2ZA 1TS3A 2SNSA 2EYJA 4C1NI 3D3RA 3DHQA 3MFYA 3TZDA 2A6EC 5KNCA 3K59A 1I6HB 2B2WA 1SBBB 3R3OA 3V2TA 3SE0A 1ENCA 2K33A 5M3FB 4A93B 2F0KA 1SNMA 4AYBB 1A3UA 1EZ8A 3ZYYX 4QB4A 2XIWA 3NQTA 1SNDA 1STBA 1II3A 1NCVA 2R61A 3T53B 3I4LA 2IX0A 4C1NK 4KKUA 4MHEA 1RDPD 5DM73 1CK1A 2TSSA 3FEWX 4J1MA 4HSVA 5JEAJ 1EY6A 1HUMA 5C0XG 1JC7A 2QCPX 4YIJA 1AEXA 1JICA 2TMPA 2ZT9C 4K2LA 3SK6A 1LTRD 4C3HG 4RCOA 4DXFA 1HFGA 4PMBA 3HOZB 1K8MA 4DAPA 4FXKC 1CZGA 4N9TA 3PIP3 2CQAA 5K36H 2FINB 1C4QA 1BF4A 2F0PA 1G91A 3S1RB 1WTWA 1QNKA 3HOXB 1XWEA 4A3EB 2QKIC 5M5XB 2PPBC 4ZAIA 1OXXK 1ZEQX 2SNMA 3U9SA 1D5ZC 3AB9A 1TWFB 1IYVA 1FR3A 2K5QA 2E75C 1AP0A 3MAQA 3KUPA 3MA2B 2PYKA 3Q22A 2B8GA 3PUWA 3PUVA 1Y1VB 1T5XD 3J81E 5FK9C 3NQIA 1VDZA 5HGTA 2KEEA 2QDBA 1BNZA 3NTKA 5KGUA 4HMJA 1A6XA 3A55A 4K8IA 4DU9A 1HTLD 4QMGA 2J4XA 5IOCA 1CHPD 5IGBA 4S3SA 2RVLA 2A73B 3U9OA 1J8IA 4ZLTF 4ME5A 1G6ZA 4QIWB 2B2YC 4OO1H 5BN3A 1IKMA 1SJED 2LY7A 1A2UA 1RKNA 4RGOS 3EJIA 1DXMA 4C3IB 1PXUA 2L0CA 1ZXTA 3SDZA 5KNBA 5EKIA 4BBRB 4KI0A 3SVMA 1GUTA 4OL7A 1EU4A 3T13A 2I07B 4K5XA 3V05A 2M00A 3AU7A 3BDLA 1F77A 3MWYW 2R92B 1ILQA 3VYSA 1TIID 5G3LF 2F0NA 1LTID 2F0WA 4RHRA 3D31A 4BWGB 3R8BA 3MEHA 3D6CA 1B1ZA 3I8ZA 1Y69U 2BE5C 1IW7D 4C56C 4GZYC 5E4XA 5ELBA 4L6TB 3J80L 3VR2A 2WKDA 3TN2A 2M9VA 4XQJA 2L4NA 3URYA 1KAAA 5AFWA 1SDFA 3MXPA 4G7HC 3NUCA 3HGBA 4XYOA 3OMGA 1IYUA 2VXWA 1NR2A 3R2IA 5CORA 4RGNA 4A3FB 3Q6SA 4L63B 3K5OA 3LX0A 2VB3X 1LABA 1IW7C 1H9RA 2K01A 1D1IA 4IFDI 1TU2B 2KOLA 3HOWB 4BA2I 1FNUA 2EY1A 1Z7TA 1CT1D 3GTGB 3S16B 1SNPA 2LFNA 1B44D 2F0VA 4QUCA 1OXUA 4IUVA 5M9OA 1SFOB 1EOTA 5BN5A 5JVG3 3MTSA 5E3FA 1S5CD 2G9HD 1E0BA 3CKIB 2MGSA 1AN8A 3A7LA 1V1PB 3MZ5A 4ZUJA 1LT3D 1JR0D 5D3DA 1W6JA 3NTHA 1AFPA 1PZID 1WTOA 1CI3M 4OIKA 1W6KA 4OIJA 1SAPA 2CHBD 2WAQB 4FYDA 1V43A 3SK5A 5NUCA 3T4AC 2AQ3B 5CV9A 3EFXD 2RA4A 5I6WA 3Q23A 3SR1A 1EY9A 3GP7A 5D65A 2RKSA 2ICIA 4LAAA 2QILA 3A8KE 4KMUC 4UAIA 2K04A 1D5XC 1PDQA 1I4GA 1O7YA 4TQUS 4RH6A 2XN9C 1WTQA 2EY5A 2EYMA 2AUKA 1EY0A 1GUWA 3KBXA 3M4OB 2O4XA 1MI2A 5C4ZA 3J80E 1L0XB 2V4DA 4IUUA 2WINB 5J22A 3N52A 2HUGA 2NTTA 3K57A 1B3AA 1OO9B 1LV9A 3C1FA 3HP3A 1IKLA 3HEJA 5FO8B 2NVQB 2F0JA 4DNTB 3MXNA 3P7JA 2G9DA 2PCFB 4PNYA 2JEAI 1J9OA 4CGYB 1PFNA 3S14B 2ID0A 4J8QA 5C0XI 1RODA 2F4IA 2AQ2B 1B4OA 4KD4A 1A3VA 3D4DA 1TY2A 4C3JB 2BCOA 3H94A 1BR9A 2JSOA 4A3BB 3R93A 4G4KA 5EKLA 1JB3A 2K6AA 4QCLA 5EQ0A 1GJXA 4V0BA 2EYFA 4ZUIA 1HHVA 1TQOA 5C5MA 3IAYA 3A54A 1NAPA 1ILPA 1HPCA 1ET6A 5EBCA 3S1NB 3P1HA 1GHKA 4CKEA 5FO7B 1Y8OB 3MFGA 4IUPA 2QF7A 3KLSA 5JAVA 1B9NA 3BDOA 2L11A 1C8CA 1DYQA 1CHQD 1SXTA 4RGTA 1Y1WB 4FF1A 2JP1A 3J7YW 4RCNA 1ESFA 2XVSA 4CJ0B 3LWUA 4DK0A 2B63B 4IALA 3A8IE 1F2LA 3BS1A 4TKOB 4CHTB 1LACA 2FMCA 1XX8A 1BBXC 3L3OC 1PFMA 4FF2A 2AWOA 1JOQA 1B2TA 2B8FA 3NSWA 2KCCA 2A6HD 2N88A 1TKWB 2K03A 2VUMB 1ML0D 1DOKA 4ID6A 1TS4A 3QB3A 3FRPB 3LNNA 4C2MB 2OF1A 4F7XA 2F0FA 4DGZA 1S5FD 1EQVA 2EOTA 3FPPA 1EIGA 3H3VC 1D6EC 1QILA 1EYAA 1FNWA 1WD1A 1ZYRC 4NW2A 1LLRD 2FHTA 1QWYA 1EZ6A 3EROA 2MUYA 1BOSA 4A3GB 1GXDC 3BYTB 5D3IB 5M5WB 1YNJC 3VR6A 1GUOA 4HTHA 2BE5D 1QB5D 2OT2A 2K32A 5JPMC 5DAUA 2E2IB 3PUXA 4BA1I 1GHJA 2HDLA 3E6ZX 4C3JG 4A3DB 2D2CC 3GTMB 4LJZC 1F9RA 1RD9D 4KY6A 4KJOA 1RJTA 4NDXA 3S15B 2F0UA 2CVRA 4FF3A 1H9SB 3TSSA 3D6WA 3CRKC 3RMHA 3OOCA 1K83B 3DWPA 4HMIA 4XYQA 4RGMA 5KRUA 4EVOA 1Z6HA 4IFDH 5M5YB 2BA1A 2PZTA 3HG9A 1CM9A 2WB1B 3QO2A 1SYGA 3S1QB 2F0HA 4MIUA 1F9SA 2F0GA 2WKCA 5CMDA 3MC0B 3K5MA 4BY1B 1BXTA 3W3AA 3PO3B 3WOFA 4CJ2C 1RCVD 2Q8RE 1KTKA 1K8OA 4RWSC 1SYBA 1CA6A 3H09A 1RF2D 2EJFC 2F0MA 2Z4IA 4DF7A 4FP5D 4P2CB 2RSNA 1RTOA 2K1BA 2IJ0A 3EQLC 3WOEA 2PW5A 2KECA 4M1UB 2LS01 5ISRA 1TWGB 1HA6A 1L0YB 4UDUC 5CV6A 1NUCA 2MPMA 5ELCA 3I73A 1H9KA 4B9XA 1AZPA 1NR4A 1EY4A 4RFBA 1MSGA 1U4MA 2BDOA 1KDBA 1DOMA 2EZVA 3C3LA 3MVVA 5ELFA 1GUGA 2SOBA 4TRDA 4Y7NB 1Q3LA 3KBGA 5C0XJ 3N6RA 3FDTA 2Z8LA 5FOBB 1EEID 2KUMA 4XTCS 2IX1A 3T51B 1B53A 3MXUA 3ERQA 3VYUA 2I46A 1SE4A 3PMFA 2IT1A 1TWCB 4XQQA 3T56B 1XTCD 5M3MB 4A3MB 1A3TA 2R6GA 3C2PA 4CBVA 3T16A 5FO9B 1DM0B 2KEDA 2ICEC 3JAME 4KKSA 4KY5A 1ET9A 1MSHA 2F0LA 1H9JA 4PMWA 2BA0A 1PRTF 1SJHD 4KY7A 1ICWA 2KJXA 3NBIA 2KHSA 4WJWA 4I7ZC 1MD2D 3Q0AA 2EYLA 2XNAC 1G291 2A6HC 3GTOB 2XRSD 1Z47A 2EY6A 4BY7B 1SNQA 1BDOA 4CKBA 1YNNC 4HR7B 1JOKA 2IL8A 4HSPA 3BG3A 3K7AB 3FMCA 4IFDG 3I4MB 1S5ED 1CTMA 3VR3A 2B2VA 2YYZA 5JOBA 2PZUA 3TP6A 2O5IC 5C3EB 2X69A 1HA5A 4OO1I 3BDCA 1MBYA 1RTNA 3CHBD 2MHVA 1FNVA 2K05A 5A2QL 2Q8TA 2HDMA 2F0IA 2KA7A 3S2HB 5FLXE 2F3WA 3PV0A 3NXWA 1LO5D 5A35A 1SYEA 3PUYA 3J7AF 1SYCA 3HKZB 5C4XB 5IGGA 5I4DA 1WTPA 1F9QA 3OWEB 2Q8IB 2SEBD 5ELDA 2E2JB 1QNUA 3KF8A 1Q1BA 2EJMA 3K5NA 1UAPA 5TSSA 1WTVA 1ONLA 3M4YA 2ENBA 2A68C 3OSOA 3QJYA 1JE4A 2NB0A 1JWMD 5EPKA 3DEOA 2B2YA 2JE6I 5CC4A 3DEPA 2NN6H 2RBMA 1F2ZA 1TVXA 1G8ZD 5CBEE 2E2HB 2CW0C 5CR3A 4K5WA 3NWTA 3OIPA 1F2MA 1YNND 2NN6I 1GUSA 2F3VA 1LT6D 5C44B 1U9RA 4QUFA 5CV4A 4RA8A 4K2KA 5IT9L 4HCEA 1HTPA 2WP8J 3E5SA 2BOSA 4EQOA 3MHBA 1ZKOA 3G6JB 5C3WA 2AWNA 5I6YA 2C9OA 3K0YA 2KCNA 4B08A 1AZQA 3NBHA 3H6MA 3TZUA 3SXHA 4DNRB 2NVXB 3DWQA 4WORA 5IGCA 2IX3A 3DXJC 3C46A 1STEA 4EQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGZ A;  5KIX A;  3D4D A;  1SYB A;  1A3T A;  1A2T A;  4H7B A;  5C4Z A;  5EGT A;  1EQV A;  3MZ5 A;  4ZUJ A;  3T16 A;  3TP8 A;  1STH A;  4KJN A;  4F8M A;  4B9W A;  4K8J A;  4N9T A;  1TR5 A;  4KY5 A;  4IUN A;  2F0P A;  2F0M A;  5EKL A;  5HUR A;  4N9P A;  2F0D A;  4DF7 A;  2F0N A;  1EYA A;  4RKB A;  5I9P A;  1JOO A;  4NMZ A;  1F2Y A;  2EYO A;  2HQE A;  2F0W A;  4NKL A;  2F0L A;  2EYF A;  4G57 A;  5IGE A;  3HZX A;  4ZUI A;  1EZ6 A;  3D6C A;  3MEH A;  5CV8 A;  1TQO A;  2RDF A;  3ERO A;  4KY7 A;  2KHS A;  1EY5 A;  5C5M A;  1KDA A;  4KHV A;  3SK5 A;  1SNC A;  5NUC A;  3D8G A;  2EYL A;  2SNM A;  5IGF A;  5CV9 A;  2ENB A;  1JOR A;  2PW5 A;  5C6A A;  1EY7 A;  3P75 A;  3OSO A;  3SHL A;  4EQP A;  1JOQ A;  4KD4 A;  2EY6 A;  2F0Q A;  2F0S A;  4HTH A;  5ISR A;  1SNQ A;  4E6I A;  5I6W A;  3SR1 A;  3P1H A;  3S9W A;  1EY9 A;  3C1E A;  1IHZ A;  2F0O A;  2SNS A;  5DAU A;  4K5V A;  5CV6 A;  5CV7 A;  2EYJ A;  3SK8 A;  5C4H A;  1NUC A;  2RKS A;  1JOK A;  2PYK A;  5CC4 A;  3DHQ A;  4LAA A;  1SYF A;  4QF4 A;  4B9X A;  2RBM A;  1KAA A;  2KQ3 A;  1F2Z A;  1SNO A;  1STY A;  4RKL A;  3MXP A;  3NUC A;  3R3O A;  5HGT A;  1SYD A;  3V2T A;  2QDB A;  1EY4 A;  3U9O A;  2EYP A;  5C5L A;  5JAV A;  3VA5 A;  2EY5 A;  1EYC A;  2EYM A;  5DEH A;  1ENC A;  3OMG A;  4HMJ A;  4KY6 A;  5KGU A;  4KJO A;  5CR3 A;  4K5W A;  4KD3 A;  2OEO A;  4I65 A;  4K8I A;  4NDX A;  5JOB A;  2PZW A;  4DU9 A;  2PZU A;  2F0U A;  1EY0 A;  1KDB A;  2F0K A;  4IZ8 A;  4QMG A;  3TP7 A;  3TP6 A;  2NUC A;  5IOC A;  1SNM A;  5IGB A;  3LX0 A;  1A3U A;  1NSN S;  1EZ8 A;  1F2M A;  3MVV A;  2O4X A;  3QOL A;  4KV6 A;  4S3S A;  5IOD A;  2PW7 A;  3TP5 A;  1KAB A;  3QOJ A;  4IAL A;  1ENA A;  4HMI A;  2PQE A;  3NQT A;  3NK9 A;  1SND A;  1STB A;  2F3V A;  4QB4 A;  3TME A;  4ODG A;  2EY2 A;  3BDC A;  1U9R A;  4ME5 A;  2LKV A;  4WRD A;  2SOB A;  5KRU A;  1II3 A;  3EVQ A;  3NHH A;  5CV4 A;  5J22 A;  2F0E A;  4EVO A;  4K2K A;  4J6H A;  4TRD A;  3D4W A;  1STN A;  3NP8 A;  4R8N A;  2PZT A;  4K6D A;  5E1F A;  5J39 A;  4KTA A;  3E5S A;  3SK4 A;  1A2U A;  4K14 A;  4EQO A;  1RKN A;  5KYI A;  3EJI A;  1STA A;  3OMC A;  4J1M A;  3DMU A;  3MHB A;  5CGK A;  5K5P A;  1SYG A;  3C1F A;  1EY6 A;  2F0H A;  2OXP A;  4MIU A;  3OWF A;  5J1Z A;  1STG A;  2F0G A;  2F0I A;  5C3W A;  2EY1 A;  3HEJ A;  5I6Y A;  5IGD A;  2F3W A;  2EYH A;  4YIJ A;  1AEX A;  2F0J A;  3NXW A;  1SNP A;  2F0T A;  2F0V A;  3RUZ A;  5M9O A;  1KDC A;  1TT2 A;  3ERQ A;  4NP5 A;  4ID6 A;  4PNY A;  5I9O A;  3H6M A;  4OL7 A;  5EKK A;  1SYE A;  3SXH A;  3QB3 A;  5KEE A;  3PMF A;  3T13 A;  5E3F A;  4K2L A;  3SK6 A;  1SYC A;  4DFA A;  4PMC A;  5CV5 A;  5IIF A;  1EY8 A;  5IGG A;  1EYD A;  2WAC A;  4WOR A;  5F2D A;  5IGC A;  4K5X A;  3ITP A;  4EQN A;  2OF1 A;  4F7X A;  5KYL A;  2F0F A;  4ZQ3 A;  5C3X A;  2M00 A;  4PMB A;  2EXZ A;  1A3V A;  3BDL A; 
#chains in the Genus database with same CATH topology
 1JWS D;  1A2T A;  5EGT A;  2B2T A;  3K6O A;  4RAU C;  1PH6 A;  4XT3 B;  4LF7 L;  3A7A B;  2F0D A;  2B2T C;  5ELE A;  1HNZ L;  2EYO A;  1WI5 A;  1XMQ Q;  3CQZ H;  2O2L D;  2WB1 E;  3I70 A;  1QE6 A;  2Z1C A;  4HJ8 A;  1DOL A;  3I72 A;  1JWU D;  3ND9 A;  3IFT A;  4X62 Q;  2RSO A;  3A8J E;  1UNS A;  3KF6 A;  1SNC A;  3FHW A;  4KHZ A;  2AQ1 B;  4CKC A;  4TSS A;  4LFC Q;  4EQP A;  4ZKB B;  5M3M H;  1D5M C;  2F0S A;  2F0Q A;  4R4Q A;  2B2U A;  1SMY C;  2JYO A;  1HQM C;  3E9H A;  1E2V A;  1B9M A;  4HED A;  4DV4 Q;  3J80 c;  1XPO A;  4OX9 L;  1LTS D;  3AQQ A;  1FD7 D;  1M8A A;  4RKL A;  4ILW A;  3OW7 A;  4JK1 C;  1KRS A;  1GO3 E;  2ZJR A;  3S1Q H;  1R4P B;  4JI7 L;  4QJF A;  3CCU A;  1HZ9 A;  4DV4 L;  1Y1W H;  4B3R L;  1HCZ A;  4I65 A;  2FFK B;  1GKH A;  1QUQ B;  1PMR A;  1TWH H;  1H9S A;  3TP7 A;  4DAV A;  3U4V A;  5JJZ A;  5IP9 H;  1B7Y B;  1NSN S;  3QOL A;  5HY6 A;  2R93 H;  1XYI A;  3ZJY C;  4JI7 Q;  3G48 A;  2LKV A;  1I50 H;  2NZH A;  1L1O C;  4JI5 L;  1T9H A;  1T5E A;  3NP8 A;  3UDG A;  3CC7 A;  3RD4 A;  1TWA B;  4DR4 L;  3SK4 A;  1CQV A;  1VQM A;  1PRT C;  4B3S L;  2H4O A;  1IXR A;  1WTH A;  2NZO A;  2DY8 A;  3VYT A;  3H3V H;  3I4N G;  2JA8 B;  1SEB D;  1I94 Q;  2PQA A;  1P16 A;  4OGQ C;  3RLF A;  5EBD A;  2L9H A;  3FKI B;  1E2W A;  1CQF A;  1KNA A;  1U4L A;  3MXG A;  3NEN A;  2PMZ B;  5LHY 1;  4HJ9 A;  3FPU B;  2AKW B;  5M5W H;  1TS2 A;  4A3B H;  4DAM A;  3V96 A;  1PV4 A;  4B9W A;  2D0O A;  2NTS A;  2VQE Q;  4A3M H;  4N9P A;  2WAQ G;  4R4C A;  4IFD J;  1YEZ A;  4WJ3 M;  2HQE A;  4QQB X;  5BN4 A;  4R4I A;  2L5T A;  3UE1 A;  4C3I G;  3NPP A;  5CV8 A;  2RDF A;  4HIO A;  3IFD A;  1EY5 A;  2XRQ D;  4A3E G;  1DZ1 A;  1WCM B;  5BR8 Q;  4Y52 H;  2JEB I;  4JBM A;  4KN7 C;  1JJG A;  4E6I A;  2E76 C;  2VW9 A;  4AH6 A;  1Y8N B;  2CWP A;  1GOZ A;  4CDE C;  1SE2 A;  2Y0S G;  1VQG A;  2EVB A;  3BYY B;  4WJ4 A;  1JCK B;  1SRO A;  1EEF D;  5IP7 H;  5C0X H;  2QEX A;  4HJ5 A;  1V9P A;  2UU9 L;  1VQC A;  3A5U A;  1YJ9 A;  4BBR H;  3PO2 B;  1SNO A;  1TS5 A;  5IYB G;  3O13 A;  5C3E H;  5EJW A;  2K5H A;  3S24 A;  2F1M A;  3TDQ A;  3OHX C;  2UU9 Q;  2NUC A;  3KK7 A;  1WYD A;  3M7N A;  3SGI A;  1I50 B;  1ESR A;  4AIM A;  1VF5 C;  2KHI A;  3TP5 A;  1X3G A;  2A69 C;  3NK9 A;  5K36 G;  3MEF A;  1MGS A;  4K6L A;  4A3C H;  2ZXP A;  1HR0 Q;  3GTL B;  1TY0 A;  2DNE A;  5J1Z A;  2E2H H;  5IP9 G;  4P75 A;  1STG A;  1GUN A;  2CH4 A;  1J5E L;  3KF6 B;  1I3Q H;  4BY1 G;  3KLR A;  4CDF C;  1A62 A;  1R9T B;  4JI3 L;  4IUR A;  4XIG S;  1OXS C;  1SRU A;  2L1B A;  4KKT A;  1W3S A;  2NVY B;  1PZJ D;  4AYB E;  1HNX Q;  2WAC A;  1J5E Q;  1IBL L;  4NXN L;  3F2U A;  4DR2 L;  4ZQ3 A;  2EXZ A;  2F03 A;  1CKN B;  2K7V A;  5KIX A;  3F2D A;  1O78 A;  1STH A;  2R7Z B;  1KAW A;  1TR5 A;  2K75 A;  2N3S A;  2KHJ A;  2ZXR A;  3ER0 A;  4U68 A;  4UP7 A;  3CD6 A;  1ZYR D;  3I7F A;  1IBL Q;  4RKB A;  1TWC H;  4M8A A;  5IYB H;  2R7D A;  4JI6 L;  2IY5 B;  1F2Y A;  1N36 Q;  4HN7 A;  3PIO 3;  4HIM A;  1PYB A;  1X3Q A;  2K5D A;  1HNZ Q;  2K52 A;  4O2D A;  2BH8 A;  2MFI A;  5IYC G;  4DV1 L;  4PV1 C;  3DUZ A;  4KHV A;  1DON A;  4JCV E;  5IGF A;  4L5S A;  4BBS G;  3M3Y B;  3MXN B;  4ZRZ A;  3PO3 G;  1EY7 A;  4DV6 Q;  1IYJ B;  3DWA A;  1XMO L;  4WFN 3;  1IL8 A;  4JI0 L;  2PO4 A;  2VL6 A;  2F4V L;  4DV5 L;  3L7Z C;  3AYH B;  4L8J A;  1IHZ A;  2F0O A;  3H91 A;  2ASB A;  1TWA H;  4DV0 Q;  1VF7 A;  2DJG C;  1DCZ A;  5FLX c;  2PMZ E;  2MP1 A;  2EE1 A;  4DV5 Q;  1Q90 A;  4GLX A;  5LL6 S;  1LTA D;  4PZ8 A;  3A0J A;  1O7L A;  5DEH A;  3W1B A;  4DN4 M;  2UUB Q;  1X32 A;  3JAM L;  3HRZ C;  1CZW A;  1QJO A;  2O5J C;  3IL8 A;  4QL5 A;  3CF5 A;  1PFB A;  2N55 A;  3A74 A;  4P73 A;  2E2D C;  2JA9 A;  3GV3 A;  1MJE A;  3EIV A;  1PTO C;  4GNX A;  3HKZ E;  1S4Z A;  3TME A;  3D4R A;  1LTB D;  3HOY B;  3EVQ A;  4DA2 A;  1Q81 C;  1OTC A;  2DY7 A;  2AMC B;  4YY3 L;  1VQN A;  1STN A;  5JEA G;  4R8N A;  1HFN A;  5E1F A;  1X55 A;  1C48 A;  3KLS X;  1B50 A;  1V1O A;  5CBA E;  5C3X A;  2Q2U A;  1V1P A;  2IHF A;  4A3J B;  2ZXO A;  1S3O A;  1GVP A;  1KDC A;  1TT2 A;  4NP5 A;  3GTP H;  1N9W A;  2XTI A;  1I4P A;  2VB2 X;  5CV5 A;  4H13 C;  2QDL A;  4H44 C;  2WV6 D;  2JA5 H;  2R93 G;  1PLF A;  3E9I A;  2OEO A;  1Q1E A;  3S1N H;  1KNE A;  5T1G A;  1Q8I A;  1VQ9 A;  2A74 C;  2J7Z A;  3X3M A;  5C4J H;  2Z6B A;  3VYR A;  5HUR A;  1PTO H;  2NYZ D;  2SDF A;  5I9P A;  2XGT A;  4DAY A;  2XWB B;  2JA7 G;  1A15 A;  4BXX H;  3BZD B;  3RZO B;  3IKJ A;  3G7L A;  2YU9 B;  1F9P A;  4LNQ A;  2CQO A;  2E2J H;  4O0A A;  5C4J B;  3PIO A;  4X3K A;  5FKA C;  3M85 A;  4BS9 A;  5C6A A;  3Q8D A;  2DGY A;  4EQ5 A;  2JA5 B;  3BVM A;  3HS0 C;  1HQR D;  3C1E A;  1D1K A;  4DV1 Q;  1Q82 C;  5JEA H;  4IQZ A;  1X65 A;  4GKK L;  1WTR A;  3GO5 A;  1SYF A;  3S16 H;  3CP0 A;  3L9A X;  2KQ3 A;  4GNX B;  3CCS A;  4IUT A;  4BBS H;  5DM6 3;  1PRT D;  1HNW L;  5IE8 A;  3D0F A;  2K50 A;  4UP8 A;  3CME A;  3GDE A;  1J6Q A;  2BDN A;  2ZTE A;  1TWH B;  4KD3 A;  2AHO B;  5EPJ A;  1LTT D;  4GN3 B;  1NBW A;  2DJF C;  4DUZ L;  4DR3 L;  2A68 D;  1EU3 A;  4KV6 A;  5IOD A;  4P74 A;  1KAB A;  3QOJ A;  4DR6 L;  4BBS B;  3K58 A;  4IJL A;  4ODG A;  2YV5 A;  4G7Z C;  2PQA B;  1NE3 A;  2F0E A;  1AE3 A;  2C5C A;  2JJQ A;  3GD7 A;  4L5Q A;  4J6H A;  5FLM H;  1S5D D;  2VNU D;  2ZTD A;  1RHP A;  4H0L C;  4LUO A;  4HJA A;  4B3S Q;  5J39 A;  1EWC A;  2WII B;  2FJ2 A;  4KTA A;  1BO0 A;  4PQX A;  5JVH 3;  4FF4 A;  3UE0 A;  1STA A;  3VDY A;  4N8F A;  4DR6 Q;  1R4Q B;  5I2Y A;  2LMC B;  2B2U C;  2OXP A;  5DNF A;  2EIF A;  2NWG A;  5FJ8 G;  3I3C A;  5IGD A;  5IYD H;  5EPL A;  2L12 A;  4JI3 Q;  1V8Q A;  4XDX A;  3W1G A;  5T1I A;  3I4O A;  1SMY D;  1PZK D;  1YIJ A;  3X3N A;  1KLU D;  4DFA A;  4DR2 Q;  2UXD L;  4LF7 Q;  1G2T A;  5F2D A;  2VS1 A;  1GD7 A;  3ITP A;  3GTQ H;  1LYL A;  1BBU A;  1HNX L;  2IW3 A;  1YZ6 A;  3GTO H;  4H7B A;  3J81 c;  5I2X A;  4FNF A;  3KLW A;  4OEM B;  4JYA Q;  4DV7 Q;  2GA4 B;  1FGB D;  4K8J A;  1U5K A;  4JI6 Q;  4IUN A;  1LTG D;  5COY A;  4BXX G;  4UY8 C;  2NZ1 D;  4R8I A;  1JQY D;  4YCW A;  4NKL A;  1EWH A;  1UE6 A;  2MO1 A;  3CW2 C;  4G57 A;  2OWO A;  1LT5 D;  5IGE A;  1KIX A;  4FXD A;  4DR5 Q;  1BUV T;  3GTP B;  4N8X 1;  1KLG D;  2R3Z A;  3KDF A;  1E22 A;  1VMC A;  3D8G A;  3W2D A;  1JOR A;  5EAY A;  4A3I B;  1BCP C;  3PUZ A;  3UI2 A;  1HUN A;  3NWS A;  4CJ1 B;  3GV6 A;  3I4N B;  2XSC A;  1X54 A;  4A76 A;  5IY0 A;  1CSP A;  4KN4 C;  2IWH A;  3BVG A;  4A75 A;  1BVS A;  1XXG A;  5JPN C;  2HCI A;  1BCP F;  1B8A A;  2A69 D;  4X64 Q;  4QF4 A;  1X3E A;  2EDG A;  4IJH A;  3HOV B;  3BJU A;  1I3Q B;  1W2B A;  3OIQ A;  4A3J G;  4B3T Q;  1I4X A;  5KND A;  2NVT B;  1PTO D;  2PZW A;  4XQN A;  4IZ8 A;  2RDG A;  4BY7 G;  3RZD H;  3GTJ B;  5G3L D;  2ZJQ A;  2L55 A;  1I4H A;  2A6E D;  4L5T A;  2PQE A;  1I6H H;  4JPB W;  2EY2 A;  3NHH A;  3ULP A;  4PZ7 A;  4F88 A;  4OON A;  1PYW D;  1K9M C;  4HJ7 A;  3QWN A;  4IN3 A;  4K6D A;  1S5B D;  3LWE A;  1QOH A;  2B2W C;  3OMC A;  2JA7 B;  1Q12 A;  5CGK A;  1WCM G;  2PNR C;  3I4M G;  3OWF A;  2N49 A;  3P20 A;  2F0T A;  4ZYS A;  5E4W C;  5ELO A;  5I9O A;  2KEN A;  3J81 L;  1OXT A;  5EKK A;  1LT4 D;  2UUC L;  1QCB D;  2VQE L;  1TWG H;  1AW7 A;  5KYL A;  4A3B G;  2AUJ D;  4AQY Q;  1PYS B;  4OO1 G;  5IYD G;  1Q7Y C;  2FMM A;  1O7Z A;  1PRT B;  4V19 0;  3ULL A;  4LUZ A;  1S72 A;  1N34 Q;  2QW7 A;  2X6G A;  4LF6 L;  1QVF A;  5LL6 X;  5BR8 L;  3KJO A;  4RMF A;  1I4Q A;  1VMP A;  4FXG C;  3ULJ A;  1PTO F;  4LMQ D;  1U4P A;  4ZKC B;  4GKJ L;  2MJ8 A;  2EPB A;  4ABN A;  4HAE A;  1VQH A;  4OXP A;  1E1T A;  1CFM A;  2D5D A;  1VQ4 A;  3P75 A;  1YHQ A;  3S2H H;  4JC0 A;  2DN8 A;  1SE3 A;  3GTQ B;  4ZCK A;  4A3K G;  3H0G B;  1YJW A;  4HCS A;  4K5V A;  3A56 A;  5CV7 A;  5C4H A;  4JBK A;  3QG1 A;  1N33 Q;  1IL2 A;  1O80 A;  1P8L A;  3HOU B;  2E74 C;  4O1N A;  1QG7 A;  3J7A V;  1I4R A;  4RHS A;  4LK1 C;  3AMU A;  1STY A;  2RDH A;  2QA4 A;  1SYD A;  3CRL C;  3VA5 A;  4ZK9 B;  4Q0F A;  2HCC A;  5AJ3 L;  5GAH C;  2VUM G;  4DK3 C;  2P5Z X;  1ENA A;  4ULL A;  3K5L A;  2JN4 A;  1FYC A;  4KK7 A;  1K83 H;  2E8G A;  4F87 A;  3I90 A;  3I91 A;  3RZD B;  3D4W A;  2HQL A;  4LF8 L;  5AJ3 Q;  3BVZ A;  2K5W A;  4OHJ A;  4FO2 A;  4JV5 Q;  3DMU A;  3UDI A;  1ASY A;  3R2T A;  2RQX A;  4A3K B;  3GTM H;  2D9U A;  4DV3 Q;  3M3Y H;  2EYH A;  3RLO A;  1WD0 A;  2JA6 B;  1BCP D;  1KRT A;  1XNR Q;  1EIH A;  4A93 G;  1I6V C;  4PMC A;  2B39 A;  4C3H B;  4JI1 L;  1L2F A;  4LUV A;  1ENF A;  2K4K A;  2A19 A;  3M7G A;  4DR7 L;  1WTX A;  5HGQ A;  2NN6 G;  4DAY B;  2WFW A;  3Q24 A;  1KC8 C;  1A0I A;  5FLM G;  3S17 B;  3TP8 A;  1XJV A;  1FJG L;  2K28 A;  3SEB A;  3NE5 B;  3CQZ B;  2IPK D;  3JC6 6;  4NMZ A;  4X3S A;  3DM1 A;  3CXC A;  2NBF A;  3HZX A;  1VCI A;  1DJR D;  2L15 A;  5L37 A;  1PTO B;  4DXG A;  4FVM A;  3VR5 A;  3U4Z A;  3TEH B;  4EGV A;  3PO3 H;  3CU7 A;  1DD2 A;  1YNJ D;  5IWA L;  1PH8 A;  1UE1 A;  2IHE A;  2Z6K A;  1EFI D;  3FKI G;  3NTI A;  4A3K H;  3SHL A;  4P71 A;  3CCL A;  1WVL A;  4X3T A;  4O42 A;  5CYU A;  1A8V A;  3S9W A;  1UEB A;  2Z4H A;  1VQ8 A;  2CW0 D;  1H9M A;  1E3P A;  3E0J A;  5C4X H;  2NVX H;  4NPS A;  3SK8 A;  5IT9 E;  2Y0S B;  2UXC L;  3GQB A;  4QY7 A;  4DV6 L;  4X3U A;  1H95 A;  3EA6 A;  2RCN A;  3VR4 A;  3HOV G;  1Y1V G;  3S1M B;  1WJJ A;  2B2V C;  1HRJ A;  2R93 B;  1UEA B;  3T1Y Q;  2X6L A;  1IBM Q;  2EYP A;  5C5L A;  3TBI B;  4OWT B;  1EYC A;  3WDN A;  4YWL A;  2YTY A;  1Y8P B;  1U4R A;  5JJL A;  1VQI A;  3VA7 A;  4Q5V A;  2ZJP A;  4XXE A;  1OXV A;  2D62 A;  4XT1 B;  2PW7 A;  2J0T D;  2QEJ C;  4IPH A;  5IIF A;  1D2B A;  1K8A C;  4G7O C;  4WRD A;  4IPC A;  5GAD C;  3FVQ A;  1SSO A;  3HOU H;  2M2L A;  3OYY A;  5M3F H;  1VQJ A;  4K14 A;  1JT8 A;  5KYI A;  2KVM A;  5K5P A;  3S2D B;  4ALP A;  1M4V A;  1YBY A;  4IUQ A;  4R9W A;  3RUZ A;  1HXY D;  2MO0 A;  1I94 L;  5M5X H;  2UUC Q;  1I5F A;  1EL0 A;  5KEE A;  3TRE A;  4MN3 A;  4DK1 A;  3STB C;  3RLN A;  2XWJ B;  1EY8 A;  1EYD A;  4DV3 L;  1BCP B;  2DNC A;  1G2S A;  3OPO A;  3S1R H;  1C7Y A;  2H1E A;  4YWK A;  4KJN A;  5D14 A;  4F8M A;  3GTK H;  1BQQ T;  4CDD C;  4DUY L;  1VQ7 A;  2A5H A;  4NXN Q;  3QIA A;  1B3Q A;  1JOO A;  1CA5 A;  4GNX C;  4LF6 Q;  4I7A A;  4U67 3;  1PA6 A;  4ME3 A;  1XPR A;  5A2Q E;  1X3P A;  1KDA A;  3GTK B;  3ONA B;  2R7Z H;  2EJG C;  4Z9C B;  1UUP A;  3ND8 A;  5FLX L;  2JXM B;  4JBW A;  1EQT A;  1E2Z A;  1TS3 A;  5JJK A;  2SNS A;  2EYJ A;  4C1N I;  2BH2 A;  3D3R A;  4B3R Q;  3DHQ A;  1V1Q A;  3MFY A;  1YVC A;  3TZD A;  2A6E C;  5KNC A;  3K59 A;  3CC2 A;  1VS0 A;  2Q2T A;  1I6H B;  2B2W A;  1SBB B;  3R3O A;  2JA6 G;  3V2T A;  1YIT A;  1N32 Q;  4JI2 Q;  3SE0 A;  1ENC A;  1XNQ Q;  4Y7N H;  2K33 A;  5M3F B;  4A93 B;  2UUB L;  2F0K A;  2UXB L;  1SNM A;  4AYB B;  1A3U A;  1EZ8 A;  2K14 A;  3ZYY X;  4QB4 A;  2XIW A;  3NQT A;  1SND A;  1NMG A;  1STB A;  1HR0 L;  1II3 A;  1NCV A;  2YTX A;  2R61 A;  1JJC B;  3T53 B;  3I4L A;  4DR3 Q;  1A63 A;  2IX0 A;  4C1N K;  4KKU A;  4MHE A;  1RDP D;  1CK1 A;  2TSS A;  3FEW X;  5DM7 3;  3DLL A;  4YHH Q;  4J1M A;  2I5L X;  4HSV A;  4RG1 A;  5JEA J;  4QIW E;  5FJ8 H;  1EY6 A;  1HUM A;  1PH3 A;  5C0X G;  1JC7 A;  4H02 A;  2QCP X;  4YY3 Q;  4YIJ A;  1AEX A;  3KYH C;  1JIC A;  1HZB A;  3I56 A;  2TMP A;  2ZT9 C;  4K2L A;  3SK6 A;  1LTR D;  4C3H G;  2B29 A;  3H0G H;  4RCO A;  4PZ6 A;  4DXF A;  1HFG A;  4BY7 H;  4PMB A;  3HOZ B;  1AH9 A;  2GVA A;  4UP9 A;  1K8M A;  4DNI A;  2HHH L;  3PCO B;  4DAP A;  4FXK C;  1CZG A;  3KOJ A;  4N9T A;  3PIP 3;  2CQA A;  1K73 C;  5K36 H;  1Y14 B;  2Y0S E;  2FIN B;  1C4Q A;  1BF4 A;  2F0P A;  1N36 L;  4JG2 A;  1G91 A;  3S1R B;  3STB D;  1WTW A;  1QNK A;  4L5R C;  1UWV A;  1GM5 A;  3S14 H;  3HOX B;  1XWE A;  4A3E B;  3KFU A;  1LTL A;  2QKI C;  5M5X B;  2PPB C;  3PIP A;  1XMO Q;  4ZAI A;  1OXX K;  1ZEQ X;  4JI0 Q;  3S17 H;  2SNM A;  2OCE A;  1EYG A;  2NVQ H;  3BZK A;  3U9S A;  4OX9 Q;  1D5Z C;  3AB9 A;  3M9B A;  1TWF B;  1IYV A;  3S2D H;  1FR3 A;  2JA5 G;  2K5Q A;  3CCR A;  2E75 C;  1AP0 A;  3MAQ A;  1VQP A;  3KUP A;  3MA2 B;  2PYK A;  3Q22 A;  2B8G A;  3PUW A;  4LFC L;  3PUV A;  2JA6 H;  1Y1V B;  1T5X D;  3J81 E;  5FK9 C;  3L2P A;  2JA8 H;  1NNX A;  3NQI A;  1VDZ A;  5HGT A;  2KEE A;  2QDB A;  1Q86 C;  1EQQ A;  3HOZ G;  1BNZ A;  3NTK A;  5KGU A;  4HMJ A;  1A6X A;  3A55 A;  4K8I A;  1VQF A;  4DU9 A;  1HTL D;  4QMG A;  3PF5 A;  2J4X A;  5IOC A;  1CHP D;  3CCJ A;  5IGB A;  3H0G G;  3NBH B;  4S3S A;  4R4T A;  4X66 L;  2RVL A;  5J3B A;  2A73 B;  3U9O A;  1J8I A;  4ZLT F;  4ME5 A;  1G6Z A;  4QIW B;  2B2Y C;  1VQ5 A;  4OO1 H;  5BN3 A;  1IKM A;  4IPG A;  1SJE D;  2LY7 A;  5GQO A;  1A2U A;  2UUA Q;  1RKN A;  4RGO S;  3EJI A;  1DXM A;  3HOY G;  4C3I B;  1PXU A;  4X66 Q;  1XNR L;  2L0C A;  1ZXT A;  3SDZ A;  4JI1 Q;  5KNB A;  5EKI A;  4BBR B;  3PO2 H;  4KI0 A;  3SVM A;  1GUT A;  2PNH A;  3ICE A;  3J81 i;  4OL7 A;  1EU4 A;  3T13 A;  2RCF A;  3CCV A;  3J7A 5;  2I07 B;  4X65 Q;  4K5X A;  3V05 A;  4OWW B;  2RF4 A;  2M00 A;  3AU7 A;  3BDL A;  2HT1 A;  1F77 A;  3MWY W;  4UHV A;  2R92 B;  2OQ0 A;  1ILQ A;  1EQR A;  3VYS A;  1JJ2 A;  4A3F G;  4X65 L;  1TII D;  5G3L F;  4LF4 L;  2F0N A;  3F2B A;  1LTI D;  1YHA A;  1NTG A;  2F0W A;  4RHR A;  4C3H H;  4IOC A;  3D31 A;  4BWG B;  3R8B A;  3MEH A;  3D6C A;  1B1Z A;  3I8Z A;  1HJP A;  1Q46 A;  3RN5 A;  1Y69 U;  4A3L H;  2BE5 C;  1IW7 D;  1U0L A;  4C56 C;  4GZY C;  3GTG H;  4A3J H;  5E4X A;  5ELB A;  4L6T B;  3J80 L;  2ZM6 L;  2ALY B;  3VR2 A;  1IBK Q;  2WKD A;  2HIX A;  4A3D G;  1D8L A;  3TN2 A;  2M9V A;  4MNO A;  2GVB A;  3GTL H;  4XQJ A;  2L4N A;  3URY A;  2OTL A;  4QGU A;  3W5O A;  1KAA A;  1FVI A;  1IBM L;  5AFW A;  1SDF A;  3MXP A;  4G7H C;  3NUC A;  3HGB A;  1E7Z A;  1KD1 C;  4XYO A;  3OMG A;  1KXL A;  1IYU A;  2VXW A;  3M4P A;  1NR2 A;  3R2I A;  5COR A;  3I4M H;  4RGN A;  5E7N A;  4A3F B;  3Q6S A;  4L63 B;  3PF4 A;  3K5O A;  3LX0 A;  2VB3 X;  2CH4 W;  2FXQ A;  1LAB A;  3JAM i;  1IW7 C;  3S1M H;  1H9R A;  2K01 A;  1D1I A;  4IFD I;  1TU2 B;  4R1J A;  4JW0 A;  2KOL A;  4LF5 Q;  3HOW B;  4BA2 I;  1SN8 A;  4DR4 Q;  1FNU A;  2EY1 A;  1Z7T A;  1CT1 D;  2HD3 A;  1Y1V H;  1YI2 A;  3GTG B;  3S16 B;  1SNP A;  2LFN A;  1B44 D;  2F0V A;  4QUC A;  1OXU A;  4IUV A;  4LWC A;  5M9O A;  1VQL A;  1ASZ A;  1SFO B;  4A3C G;  1EOT A;  5BN5 A;  5JVG 3;  3MTS A;  5E3F A;  1S5C D;  2G9H D;  5C4X G;  1SLJ A;  1NMF A;  4GS3 A;  1DGS A;  5DLQ E;  1E0B A;  3CKI B;  2MGS A;  3EN2 A;  2KBN A;  1AN8 A;  3A7L A;  3DM3 A;  1V1P B;  3MZ5 A;  4ZUJ A;  1LT3 D;  2HHH Q;  1JR0 D;  5D3D A;  5GRO A;  1W6J A;  3NTH A;  3J7Z C;  2YU9 H;  1AFP A;  1PZI D;  1WTO A;  1QUQ A;  4LF4 Q;  4OIK A;  1CI3 M;  1W6K A;  4OIJ A;  1SAP A;  2CHB D;  1QVC A;  2WAQ B;  1SE8 A;  4HID A;  1PHJ A;  4JI4 L;  1VQ6 A;  3FKI H;  4FYD A;  1V43 A;  3SK5 A;  5NUC A;  3T4A C;  2AQ3 B;  2ZTC A;  5CV9 A;  3EFX D;  4LF9 L;  2F3I A;  2RA4 A;  3F1Z A;  5I6W A;  1K3B C;  3Q23 A;  3SR1 A;  1EY9 A;  3GP7 A;  2VQF Q;  1UE7 A;  5D65 A;  3U58 A;  2RKS A;  2ICI A;  1XNQ L;  1YNX A;  4LAA A;  2QIL A;  4JI8 L;  3A8K E;  4KMU C;  3B6Y A;  1MIU A;  4UAI A;  2K04 A;  1D5X C;  1PDQ A;  1EFW A;  1I4G A;  4LFA L;  1O7Y A;  4TQU S;  4RH6 A;  2XN9 C;  1WTQ A;  4A3M G;  3GTJ H;  2EY5 A;  2EYM A;  1KL9 A;  1N33 L;  4JI8 Q;  3UDF A;  2AUK A;  1EY0 A;  1GUW A;  3KBX A;  3M4O B;  1EOV A;  2O4X A;  1FGU A;  4IPD A;  1WFQ A;  1MI2 A;  5C4Z A;  3J80 E;  1L0X B;  4IUU A;  2V4D A;  2WIN B;  5J22 A;  5M3F G;  4GOP B;  2MNA A;  3N52 A;  4GN5 A;  2HUG A;  2NTT A;  1M1K C;  2E2I H;  3K57 A;  1B3A A;  1OO9 B;  1LV9 A;  3I4N H;  3C1F A;  3HP3 A;  2ATW A;  1IKL A;  1WCM H;  3HEJ A;  3RR5 A;  5FO8 B;  3E3X A;  4A3G H;  2F0J A;  2NVQ B;  1CKN A;  4DNT B;  3A5Z B;  3MXN A;  3P7J A;  4LF8 Q;  2G9D A;  2OQK A;  5GAE C;  2PCF B;  4PNY A;  2JEA I;  2UXD Q;  1J9O A;  4LFB L;  1PVO A;  4CGY B;  1CSQ A;  1PFN A;  5H1S E;  1UE5 A;  3S14 B;  2ID0 A;  4J8Q A;  5C0X I;  1ROD A;  2F4I A;  2AQ2 B;  1S40 A;  1B4O A;  4KD4 A;  1A3V A;  3HFZ B;  1VQD A;  3D4D A;  1TY2 A;  1X56 A;  4C3J B;  2R92 G;  4LFB Q;  2BCO A;  3H94 A;  1BR9 A;  3AFQ A;  2JSO A;  3RN2 A;  4A3B B;  4X62 L;  3R93 A;  4G4K A;  5EKL A;  4AYB G;  1JB3 A;  2K6A A;  4QCL A;  5EQ0 A;  1GJX A;  4V0B A;  2EYF A;  4R4O A;  4ZUI A;  4UPA A;  1HHV A;  1Q8K A;  1TQO A;  1L0W A;  1EIF A;  2LSS A;  2KCT A;  5C5M A;  2V1C C;  3IAY A;  3A54 A;  4BY1 H;  3RNU A;  1NAP A;  1ILP A;  4DV2 Q;  1BKB A;  1HPC A;  1ET6 A;  5EBC A;  3S1N B;  3EBE A;  4K0K Q;  3P1H A;  3CCM A;  3T1H L;  1GHK A;  4CKE A;  2NVY H;  5FO7 B;  1Y8O B;  4APV A;  4GOP A;  2F4V Q;  5M5Y H;  2DUD A;  3CMA A;  1E1O A;  1MHW C;  5LMN L;  1X3F A;  3MFG A;  2B63 H;  4IUP A;  2QF7 A;  3KLS A;  5JAV A;  1B9N A;  4EX5 A;  3BDO A;  2L11 A;  1C8C A;  1CKO A;  1DYQ A;  2QGQ A;  3HOW G;  1CHQ D;  1SXT A;  4RGT A;  1Y1W B;  4FF1 A;  2JP1 A;  3J7Y W;  3G6E A;  4RCN A;  1ESF A;  2XVS A;  4CJ0 B;  3LWU A;  3H3V I;  3T1Y L;  4DK0 A;  2B63 B;  4IAL A;  3A8I E;  3OTO Q;  1F2L A;  3BS1 A;  4TKO B;  4CHT B;  1LAC A;  2FMC A;  1C0A A;  1TXY A;  1XX8 A;  2UUA L;  3J80 i;  1BBX C;  4LF5 L;  3L3O C;  2UXB Q;  1K8G A;  1PFM A;  4FF2 A;  2AWO A;  1KHI A;  1JOQ A;  1TWF H;  1B2T A;  2B8F A;  3NSW A;  1MKH A;  2KCC A;  4B3M L;  2A6H D;  2N88 A;  1TKW B;  2K03 A;  2VUM B;  1ML0 D;  1DOK A;  4ID6 A;  1PH5 A;  1TS4 A;  2Z9H A;  3QB3 A;  3FRP B;  4A3E H;  3CCQ A;  3LNN A;  3TQY A;  3HOX H;  4C2M B;  4FDB A;  2OF1 A;  4F7X A;  2F0F A;  4DGZ A;  1WOC A;  1FL0 A;  4A4I A;  1S5F D;  1EQV A;  2EOT A;  2JA8 G;  1N34 L;  3FPP A;  1EIG A;  1VQB A;  3H3V C;  1D6E C;  5LMU L;  1QIL A;  1EYA A;  1JMC A;  2B63 G;  1FNW A;  4C2M H;  1WD1 A;  1ZYR C;  4NW2 A;  2ZM6 Q;  3PSI A;  1LLR D;  2FHT A;  1IBK L;  1QWY A;  1EZ6 A;  3ERO A;  2I0Q A;  2MUY A;  3CCE A;  3H15 A;  1BOS A;  1EWI A;  3I55 A;  2R92 H;  4A3G B;  1GXD C;  3BYT B;  5D3I B;  3JAM c;  5M5W B;  1YNJ C;  3VR6 A;  1GUO A;  2I5M X;  4HTH A;  3NEL A;  4POF A;  2BE5 D;  1QB5 D;  2OT2 A;  1RIP A;  2K32 A;  5JPM C;  2N8N A;  4LF9 Q;  5DAU A;  2E2I B;  3PUX A;  4BA1 I;  5LMN W;  4OEL B;  3T1H Q;  2Q2I A;  4YCU A;  3WWV A;  1GHJ A;  2Z0S A;  2HDL A;  3E6Z X;  4C3J G;  4DV0 L;  4DV2 L;  2KCM A;  4LFA Q;  1PH1 A;  3HOY H;  4A3D B;  2D2C C;  1IZ6 A;  1HH2 P;  3GTM B;  4LJZ C;  1F9R A;  1RD9 D;  4GKK Q;  4KY6 A;  4KJO A;  1RJT A;  4NDX A;  3S15 B;  4DPG A;  2F0U A;  2CVR A;  4FF3 A;  1H9S B;  1G6P A;  1CKM A;  4TVA B;  3TSS A;  3D6W A;  3CRK C;  3RMH A;  3OOC A;  4DUZ Q;  1K83 B;  1VQO A;  2C35 B;  2CKZ B;  1B70 B;  3DWP A;  4HMI A;  4XYQ A;  4RGM A;  5KRU A;  4A3F H;  4EVO A;  1JB7 A;  2YTV A;  1Z6H A;  3F8T A;  4IFD H;  4NB3 A;  5M5Y B;  4MZ9 A;  2BA1 A;  2PZT A;  3HG9 A;  1HR0 W;  1CM9 A;  2WB1 B;  3QO2 A;  3BZC A;  1SYG A;  1CUK A;  2F0H A;  4MIU A;  3S1Q B;  1F9S A;  2F0G A;  2WKC A;  4J15 A;  5CMD A;  1N8R C;  1VQK A;  3MC0 B;  2F52 A;  3K5M A;  2ES2 A;  4BY1 B;  3HOV H;  2EXD A;  1BXT A;  3W3A A;  3PO3 B;  3WOF A;  1NY4 A;  1EUJ A;  4CJ2 C;  1RCV D;  2Q8R E;  3G4S A;  1Y1W G;  1KTK A;  1LM0 A;  1K8O A;  4B3M Q;  4RWS C;  2VY3 A;  5ELN A;  1Z9F A;  1SYB A;  1FJG Q;  2LXJ A;  1CA6 A;  3H09 A;  1RF2 D;  4C3J H;  5GAG C;  2EJF C;  2F0M A;  1D7Q A;  4JYA L;  2Z4I A;  4DF7 A;  3HKS A;  4KHP Q;  4FP5 D;  3HOX G;  1PH9 A;  3PGZ A;  4A3L G;  4P2C B;  2RSN A;  1RTO A;  2A1A A;  2K1B A;  2IJ0 A;  2G5D A;  1R9T H;  3EQL C;  3WOE A;  4MTN A;  2PW5 A;  3K8A A;  2KEC A;  2R7Z G;  4M1U B;  2LS0 1;  4KLK A;  5ISR A;  1XMQ L;  3HKZ G;  2VQF L;  1TWG B;  1M90 C;  1HA6 A;  3E0E A;  1L0Y B;  3HOW H;  4UDU C;  5CV6 A;  2N78 A;  4CDC C;  3CPW A;  1NUC A;  2MPM A;  3QR8 A;  5ELC A;  2VUM H;  5IYC H;  3I2Z A;  3I73 A;  1H9K A;  4B9X A;  1AZP A;  1NR4 A;  1K3R A;  1NJI C;  1EY4 A;  4RFB A;  1MSG A;  1U4M A;  2BDO A;  2R7F A;  3NEM A;  1SR3 A;  4C3I H;  3CC4 A;  4X6A H;  1N32 L;  4GLV B;  2MQH A;  3U50 C;  1KDB A;  1DOM A;  3AEV A;  2EZV A;  3C3L A;  4B3T L;  3MVV A;  3TRZ A;  5C44 H;  5ELF A;  1GUG A;  2SOB A;  2PI2 E;  1X9N A;  4TRD A;  1G51 A;  4YHH L;  2CFM A;  4A93 H;  3FP9 A;  3KF8 B;  4Y7N B;  2JQO A;  1Q3L A;  1LUZ A;  3KBG A;  5C0X J;  3N6R A;  3FDT A;  4JBJ A;  2Z8L A;  5FOB B;  1EEI D;  4P72 A;  2KUM A;  2E5L Q;  1HZC A;  4XTC S;  4BBR G;  4GN4 B;  2IX1 A;  3T51 B;  1K0S A;  2I5H A;  1B53 A;  3MXU A;  2RHS B;  3ERQ A;  3VYU A;  2I46 A;  1SE4 A;  3PMF A;  2CWA A;  1KQS A;  4DUY Q;  1K0R A;  4IO9 A;  2A8V A;  3K81 C;  2IT1 A;  1YHB A;  1TWC B;  4XQQ A;  3T56 B;  1L1O A;  1XTC D;  5IP7 G;  5M3M B;  4A3M B;  1A3T A;  1AE2 A;  2R6G A;  3C2P A;  4CBV A;  3T16 A;  2B3G A;  3BU2 A;  1DM0 B;  5FO9 B;  2KED A;  5LMU Q;  2ICE C;  1SMX A;  4AQY L;  3JAM E;  4KY5 A;  4KKS A;  1ET9 A;  2JK8 A;  5C3E G;  1MSH A;  2WB1 G;  3RZO H;  2F0L A;  1H9J A;  1X6O A;  4PMW A;  2BA0 A;  1PRT F;  3IRB A;  1SJH D;  4KY7 A;  1ICW A;  2KJX A;  3NBI A;  1SFO H;  2KHS A;  4WJW A;  4DR5 L;  2CCZ A;  4I7Z C;  1MD2 D;  3Q0A A;  3ERS X;  2EYL A;  2WAQ E;  4A3G G;  4IOA A;  2XNA C;  4K0K L;  3TS2 A;  1G29 1;  2A6H C;  2Q2H A;  3GTO B;  2XRS D;  5C44 G;  1Z47 A;  2EY6 A;  4BY7 B;  1SNQ A;  1BDO A;  4CKB A;  1YNN C;  2JA7 H;  4HR7 B;  2OTJ A;  1K28 A;  1BBW A;  4X64 L;  2GN5 A;  4JOI C;  1JOK A;  5LMN Q;  1O7I A;  4HIK A;  2IL8 A;  1HNW Q;  4JI2 L;  4HSP A;  3BG3 A;  1HZA A;  4LW1 A;  3K7A B;  3HOU G;  3FMC A;  3OTO L;  3I4M B;  1RL2 A;  4IFD G;  1S5E D;  1CTM A;  3VR3 A;  2B2V A;  4DKA C;  3KJP A;  2YYZ A;  3S15 H;  5JOB A;  2PZU A;  3TP6 A;  2O5I C;  5C3E B;  2X69 A;  1HA5 A;  3OW2 A;  4OO1 I;  4A3D H;  3BDC A;  1VQA A;  1MBY A;  1RTN A;  3CHB D;  2MHV A;  4NXM L;  1FNV A;  4JI5 Q;  3G71 A;  2K5V A;  2K05 A;  2RHQ B;  5A2Q L;  2Q8T A;  2HDM A;  2F0I A;  2KA7 A;  2K5N A;  1E24 A;  5FLX E;  3S2H B;  4A3I H;  2F3W A;  2EQS A;  3PV0 A;  3NXW A;  3AFP A;  5IT9 c;  2E5L L;  3K0X A;  3L0O A;  1L1O B;  1LO5 D;  1PH4 A;  5A35 A;  1SYE A;  1QVG A;  1PFS A;  3PQI A;  3PUY A;  4JOI A;  3J7A F;  1SYC A;  3HKZ B;  5C4X B;  4PG3 A;  2Z6K C;  5IGG A;  5I4D A;  1WTP A;  1F9Q A;  3OWE B;  1QZG A;  2Q8I B;  4DV7 L;  2SEB D;  3LGJ A;  1XTD A;  4JVZ A;  3M4Q A;  5ELD A;  2E2J B;  3J81 j;  4KHP L;  3KDF B;  3HOZ H;  1QNU A;  3KF8 A;  1VQE A;  1Q1B A;  2EJM A;  3K5N A;  1UAP A;  5TSS A;  4GLA C;  1QZH A;  1WTV A;  1ONL A;  3M4Y A;  1PH7 A;  2ENB A;  4GKJ Q;  2A68 C;  4DR1 L;  3K7U C;  3OSO A;  3F2C A;  4OWX B;  5IWA Q;  3K80 C;  3QJY A;  1C9O A;  1JE4 A;  3CAM A;  2NB0 A;  4YWM A;  1JWM D;  2HIV A;  5EPK A;  3DEO A;  4JI4 Q;  2LXK A;  2B2Y A;  2JE6 I;  5CC4 A;  3DEP A;  2NN6 H;  4DR1 Q;  2RBM A;  3PO2 G;  1F2Z A;  2D0P A;  2PI2 A;  4YCV A;  4POG A;  1TVX A;  1G8Z D;  5CBE E;  4A3I G;  2E2H B;  2CW0 C;  2UXC Q;  1JE5 A;  5CR3 A;  4K5W A;  3NWT A;  1PH2 A;  2NVT H;  3OIP A;  3TS0 A;  1F2M A;  1MJC A;  1YNN D;  2NN6 I;  5M3M G;  1GUS A;  1YJN A;  2F3V A;  1LT6 D;  5C44 B;  1U9R A;  3M4O H;  2VZA A;  4QUF A;  5CV4 A;  4RA8 A;  4K2K A;  4JV5 L;  1ICF B;  5IT9 L;  2H5X A;  4HCE A;  1HTP A;  2WP8 J;  3E5S A;  2BOS A;  4EQO A;  4NXM Q;  3MHB A;  1ZKO A;  3G6J B;  4MTK A;  3K7A H;  5C3W A;  1EIY B;  2AWN A;  5I6Y A;  2C9O A;  1XPU A;  5JJI A;  3K0Y A;  2KCN A;  4B08 A;  1AZQ A;  4DK6 C;  3CPF A;  3NBH A;  3H6M A;  4GOP C;  3SXH A;  3TZU A;  4DNR B;  2NVX B;  4DR7 Q;  3DWQ A;  4WOR A;  5IGC A;  2IX3 A;  3DXJ C;  3UDX A;  3C46 A;  1STE A;  4EQN A; 
#chains in the Genus database with same CATH homology
 1JWS D;  1A2T A;  5EGT A;  2B2T A;  3K6O A;  4RAU C;  4XT3 B;  3A7A B;  2F0D A;  2B2T C;  5ELE A;  2EYO A;  2O2L D;  3I70 A;  1QE6 A;  2Z1C A;  1DOL A;  3I72 A;  1JWU D;  3ND9 A;  3IFT A;  2RSO A;  3A8J E;  1UNS A;  1SNC A;  4KHZ A;  2AQ1 B;  4CKC A;  4TSS A;  4EQP A;  4ZKB B;  1D5M C;  2F0S A;  2F0Q A;  2B2U A;  1SMY C;  2JYO A;  1HQM C;  1E2V A;  1B9M A;  4HED A;  1LTS D;  1FD7 D;  1M8A A;  4RKL A;  4ILW A;  3OW7 A;  4JK1 C;  1R4P B;  1HCZ A;  4I65 A;  2FFK B;  1PMR A;  1H9S A;  3TP7 A;  4DAV A;  5JJZ A;  1NSN S;  3QOL A;  1XYI A;  2LKV A;  1T5E A;  3NP8 A;  3RD4 A;  1TWA B;  3SK4 A;  1CQV A;  1PRT C;  2H4O A;  2DY8 A;  3VYT A;  2JA8 B;  1SEB D;  4OGQ C;  3RLF A;  5EBD A;  2L9H A;  3FKI B;  1E2W A;  1CQF A;  1KNA A;  1U4L A;  3MXG A;  2PMZ B;  5LHY 1;  3FPU B;  1TS2 A;  3V96 A;  4B9W A;  2NTS A;  4N9P A;  4IFD J;  2HQE A;  5BN4 A;  2L5T A;  4C3I G;  3NPP A;  5CV8 A;  2RDF A;  3IFD A;  1EY5 A;  2XRQ D;  1DZ1 A;  1WCM B;  2JEB I;  4KN7 C;  4E6I A;  2E76 C;  1Y8N B;  1GOZ A;  1SE2 A;  2EVB A;  3BYY B;  1JCK B;  5C0X H;  1EEF D;  3PO2 B;  1SNO A;  1TS5 A;  3O13 A;  5EJW A;  2F1M A;  3TDQ A;  3OHX C;  2NUC A;  3KK7 A;  3M7N A;  1I50 B;  1ESR A;  1VF5 C;  3TP5 A;  2A69 C;  3NK9 A;  5K36 G;  1MGS A;  4K6L A;  2ZXP A;  3GTL B;  1TY0 A;  2DNE A;  5J1Z A;  1STG A;  1GUN A;  3KLR A;  1R9T B;  4IUR A;  4XIG S;  1OXS C;  2L1B A;  4KKT A;  2NVY B;  1PZJ D;  2WAC A;  3F2U A;  4ZQ3 A;  2EXZ A;  2F03 A;  2K7V A;  5KIX A;  1O78 A;  1STH A;  2R7Z B;  1TR5 A;  2ZXR A;  4U68 A;  1ZYR D;  4RKB A;  4M8A A;  1F2Y A;  4HN7 A;  3PIO 3;  1X3Q A;  2K5D A;  4PV1 C;  3DUZ A;  4KHV A;  1DON A;  5IGF A;  3M3Y B;  4ZRZ A;  1EY7 A;  3DWA A;  4WFN 3;  1IL8 A;  2PO4 A;  3L7Z C;  4L8J A;  1IHZ A;  2F0O A;  3H91 A;  1VF7 A;  1DCZ A;  2MP1 A;  2EE1 A;  1Q90 A;  5LL6 S;  1LTA D;  1O7L A;  5DEH A;  4DN4 M;  1X32 A;  3JAM L;  3HRZ C;  1CZW A;  1QJO A;  2O5J C;  3IL8 A;  1PFB A;  2N55 A;  2E2D C;  3GV3 A;  1PTO C;  1S4Z A;  3TME A;  3D4R A;  1LTB D;  3HOY B;  3EVQ A;  4DA2 A;  2DY7 A;  1STN A;  5JEA G;  4R8N A;  1HFN A;  5E1F A;  1C48 A;  3KLS X;  1B50 A;  1V1O A;  5CBA E;  5C3X A;  1V1P A;  4A3J B;  2ZXO A;  1KDC A;  1TT2 A;  4NP5 A;  1I4P A;  2VB2 X;  5CV5 A;  4H13 C;  4H44 C;  2WV6 D;  1PLF A;  2OEO A;  1Q1E A;  1KNE A;  5T1G A;  1Q8I A;  2A74 C;  2J7Z A;  3X3M A;  3VYR A;  5HUR A;  1PTO H;  2NYZ D;  2SDF A;  5I9P A;  4DAY A;  2XWB B;  1A15 A;  3BZD B;  3RZO B;  3IKJ A;  3G7L A;  2YU9 B;  1F9P A;  5C4J B;  4X3K A;  5FKA C;  3M85 A;  4BS9 A;  5C6A A;  2JA5 B;  3BVM A;  3HS0 C;  1HQR D;  3C1E A;  1D1K A;  5JEA H;  4IQZ A;  1WTR A;  3GO5 A;  1SYF A;  3L9A X;  2KQ3 A;  4IUT A;  5DM6 3;  1PRT D;  2BDN A;  5EPJ A;  1TWH B;  4KD3 A;  1LTT D;  2A68 D;  1EU3 A;  4KV6 A;  5IOD A;  1KAB A;  3QOJ A;  4BBS B;  3K58 A;  4ODG A;  4G7Z C;  2F0E A;  3GD7 A;  2C5C A;  2VNU D;  4J6H A;  1S5D D;  1RHP A;  4H0L C;  5J39 A;  1EWC A;  2WII B;  5JVH 3;  4FF4 A;  2FJ2 A;  4PQX A;  1BO0 A;  4KTA A;  1STA A;  1R4Q B;  5I2Y A;  2LMC B;  2B2U C;  2OXP A;  5DNF A;  2NWG A;  3I3C A;  5IGD A;  5EPL A;  2L12 A;  1V8Q A;  4XDX A;  5T1I A;  1SMY D;  1PZK D;  3X3N A;  1KLU D;  4DFA A;  1G2T A;  5F2D A;  3ITP A;  2IW3 A;  4H7B A;  5I2X A;  4FNF A;  2GA4 B;  1FGB D;  4K8J A;  4IUN A;  1LTG D;  5COY A;  2NZ1 D;  4R8I A;  1JQY D;  4NKL A;  1EWH A;  4G57 A;  1LT5 D;  5IGE A;  4FXD A;  1BUV T;  3GTP B;  1KLG D;  2R3Z A;  1VMC A;  3D8G A;  3W2D A;  1JOR A;  4A3I B;  1BCP C;  3PUZ A;  3UI2 A;  1HUN A;  3NWS A;  4CJ1 B;  3GV6 A;  3I4N B;  2XSC A;  4KN4 C;  2IWH A;  3BVG A;  1XXG A;  5JPN C;  2HCI A;  1BCP F;  2A69 D;  4QF4 A;  2EDG A;  3HOV B;  1I3Q B;  3OIQ A;  1I4X A;  5KND A;  2NVT B;  1PTO D;  2PZW A;  4XQN A;  4IZ8 A;  2RDG A;  3GTJ B;  5G3L D;  2L55 A;  1I4H A;  2A6E D;  2PQE A;  2EY2 A;  3NHH A;  4F88 A;  1PYW D;  3QWN A;  4IN3 A;  4K6D A;  1S5B D;  3LWE A;  1QOH A;  2B2W C;  3OMC A;  2JA7 B;  1Q12 A;  5CGK A;  2PNR C;  3OWF A;  3P20 A;  2F0T A;  4ZYS A;  5E4W C;  5I9O A;  3J81 L;  1OXT A;  5EKK A;  1LT4 D;  1QCB D;  1AW7 A;  5KYL A;  2AUJ D;  4OO1 G;  2FMM A;  1O7Z A;  1PRT B;  4V19 0;  2X6G A;  5LL6 X;  1I4Q A;  1VMP A;  4FXG C;  1PTO F;  4LMQ D;  1U4P A;  4ZKC B;  2MJ8 A;  2EPB A;  4ABN A;  4HAE A;  1CFM A;  2D5D A;  3P75 A;  2DN8 A;  1SE3 A;  3GTQ B;  3H0G B;  4HCS A;  4K5V A;  3A56 A;  5CV7 A;  5C4H A;  3QG1 A;  1O80 A;  3HOU B;  2E74 C;  4O1N A;  1QG7 A;  3J7A V;  1I4R A;  4RHS A;  4LK1 C;  3AMU A;  1STY A;  2RDH A;  1SYD A;  3CRL C;  3VA5 A;  4ZK9 B;  4Q0F A;  2HCC A;  1ENA A;  4ULL A;  3K5L A;  1FYC A;  4KK7 A;  4F87 A;  3I90 A;  3I91 A;  3RZD B;  3D4W A;  3BVZ A;  2K5W A;  4OHJ A;  4FO2 A;  3DMU A;  3R2T A;  2RQX A;  4A3K B;  2D9U A;  2EYH A;  1WD0 A;  2JA6 B;  1BCP D;  1EIH A;  1I6V C;  4PMC A;  2B39 A;  4C3H B;  1ENF A;  3M7G A;  1WTX A;  2NN6 G;  3Q24 A;  3S17 B;  3TP8 A;  2K28 A;  3SEB A;  3NE5 B;  3CQZ B;  2IPK D;  4NMZ A;  4X3S A;  3DM1 A;  2NBF A;  3HZX A;  1VCI A;  1DJR D;  1PTO B;  4DXG A;  4FVM A;  3VR5 A;  4EGV A;  1DD2 A;  3CU7 A;  1YNJ D;  1EFI D;  3NTI A;  3SHL A;  1WVL A;  4X3T A;  4O42 A;  5CYU A;  3S9W A;  2Z4H A;  2CW0 D;  1H9M A;  3E0J A;  3SK8 A;  5IT9 E;  2Y0S B;  3GQB A;  4X3U A;  3EA6 A;  3VR4 A;  3S1M B;  2B2V C;  1HRJ A;  2R93 B;  1UEA B;  2X6L A;  2EYP A;  5C5L A;  3TBI B;  1EYC A;  3WDN A;  1Y8P B;  1U4R A;  3VA7 A;  4Q5V A;  4XXE A;  1OXV A;  2D62 A;  4XT1 B;  2PW7 A;  2J0T D;  2QEJ C;  5IIF A;  1D2B A;  4G7O C;  4WRD A;  3FVQ A;  1SSO A;  2M2L A;  4K14 A;  5KYI A;  2KVM A;  5K5P A;  3S2D B;  1M4V A;  4IUQ A;  4R9W A;  3RUZ A;  1HXY D;  1EL0 A;  5KEE A;  4MN3 A;  4DK1 A;  2XWJ B;  1EY8 A;  1EYD A;  1BCP B;  2DNC A;  1G2S A;  3OPO A;  2H1E A;  4KJN A;  5D14 A;  4F8M A;  1BQQ T;  2A5H A;  3QIA A;  1JOO A;  1CA5 A;  4U67 3;  5A2Q E;  1X3P A;  1KDA A;  3GTK B;  3ONA B;  2EJG C;  4Z9C B;  1UUP A;  3ND8 A;  5FLX L;  2JXM B;  4JBW A;  1EQT A;  1E2Z A;  1TS3 A;  2SNS A;  2EYJ A;  4C1N I;  3D3R A;  3DHQ A;  3MFY A;  3TZD A;  2A6E C;  5KNC A;  3K59 A;  1I6H B;  2B2W A;  1SBB B;  3R3O A;  3V2T A;  3SE0 A;  1ENC A;  2K33 A;  5M3F B;  4A93 B;  2F0K A;  1SNM A;  4AYB B;  1A3U A;  1EZ8 A;  3ZYY X;  4QB4 A;  2XIW A;  3NQT A;  1SND A;  1STB A;  1II3 A;  1NCV A;  2R61 A;  3T53 B;  3I4L A;  2IX0 A;  4C1N K;  4KKU A;  4MHE A;  1RDP D;  5DM7 3;  1CK1 A;  2TSS A;  3FEW X;  4J1M A;  4HSV A;  5JEA J;  1EY6 A;  1HUM A;  5C0X G;  1JC7 A;  2QCP X;  4YIJ A;  1AEX A;  1JIC A;  2TMP A;  2ZT9 C;  4K2L A;  3SK6 A;  1LTR D;  4C3H G;  4RCO A;  4DXF A;  1HFG A;  4PMB A;  3HOZ B;  1K8M A;  4DAP A;  4FXK C;  1CZG A;  4N9T A;  3PIP 3;  2CQA A;  5K36 H;  2FIN B;  1C4Q A;  1BF4 A;  2F0P A;  1G91 A;  3S1R B;  1WTW A;  1QNK A;  3HOX B;  1XWE A;  4A3E B;  2QKI C;  5M5X B;  2PPB C;  4ZAI A;  1OXX K;  1ZEQ X;  2SNM A;  3U9S A;  1D5Z C;  3AB9 A;  1TWF B;  1IYV A;  1FR3 A;  2K5Q A;  2E75 C;  1AP0 A;  3MAQ A;  3KUP A;  3MA2 B;  2PYK A;  3Q22 A;  2B8G A;  3PUW A;  3PUV A;  1Y1V B;  1T5X D;  3J81 E;  5FK9 C;  3NQI A;  1VDZ A;  5HGT A;  2KEE A;  2QDB A;  1BNZ A;  3NTK A;  5KGU A;  4HMJ A;  1A6X A;  3A55 A;  4K8I A;  4DU9 A;  1HTL D;  4QMG A;  2J4X A;  5IOC A;  1CHP D;  5IGB A;  4S3S A;  2RVL A;  2A73 B;  3U9O A;  1J8I A;  4ZLT F;  4ME5 A;  1G6Z A;  4QIW B;  2B2Y C;  4OO1 H;  5BN3 A;  1IKM A;  1SJE D;  2LY7 A;  1A2U A;  1RKN A;  4RGO S;  3EJI A;  1DXM A;  4C3I B;  1PXU A;  2L0C A;  1ZXT A;  3SDZ A;  5KNB A;  5EKI A;  4BBR B;  4KI0 A;  3SVM A;  1GUT A;  4OL7 A;  1EU4 A;  3T13 A;  2I07 B;  4K5X A;  3V05 A;  2M00 A;  3AU7 A;  3BDL A;  1F77 A;  3MWY W;  2R92 B;  1ILQ A;  3VYS A;  1TII D;  5G3L F;  2F0N A;  1LTI D;  2F0W A;  4RHR A;  3D31 A;  4BWG B;  3R8B A;  3MEH A;  3D6C A;  1B1Z A;  3I8Z A;  1Y69 U;  2BE5 C;  1IW7 D;  4C56 C;  4GZY C;  5E4X A;  5ELB A;  4L6T B;  3J80 L;  3VR2 A;  2WKD A;  3TN2 A;  2M9V A;  4XQJ A;  2L4N A;  3URY A;  1KAA A;  5AFW A;  1SDF A;  3MXP A;  4G7H C;  3NUC A;  3HGB A;  4XYO A;  3OMG A;  1IYU A;  2VXW A;  1NR2 A;  3R2I A;  5COR A;  4RGN A;  4A3F B;  3Q6S A;  4L63 B;  3K5O A;  3LX0 A;  2VB3 X;  1LAB A;  1IW7 C;  1H9R A;  2K01 A;  1D1I A;  4IFD I;  1TU2 B;  2KOL A;  3HOW B;  4BA2 I;  1FNU A;  2EY1 A;  1Z7T A;  1CT1 D;  3GTG B;  3S16 B;  1SNP A;  2LFN A;  1B44 D;  2F0V A;  4QUC A;  1OXU A;  4IUV A;  5M9O A;  1SFO B;  1EOT A;  5BN5 A;  5JVG 3;  3MTS A;  5E3F A;  1S5C D;  2G9H D;  1E0B A;  3CKI B;  2MGS A;  1AN8 A;  3A7L A;  1V1P B;  3MZ5 A;  4ZUJ A;  1LT3 D;  1JR0 D;  5D3D A;  1W6J A;  3NTH A;  1AFP A;  1PZI D;  1WTO A;  1CI3 M;  4OIK A;  1W6K A;  4OIJ A;  1SAP A;  2CHB D;  2WAQ B;  4FYD A;  1V43 A;  3SK5 A;  5NUC A;  3T4A C;  2AQ3 B;  5CV9 A;  3EFX D;  2RA4 A;  5I6W A;  3Q23 A;  3SR1 A;  1EY9 A;  3GP7 A;  5D65 A;  2RKS A;  2ICI A;  4LAA A;  2QIL A;  3A8K E;  4KMU C;  4UAI A;  2K04 A;  1D5X C;  1PDQ A;  1I4G A;  1O7Y A;  4TQU S;  4RH6 A;  2XN9 C;  1WTQ A;  2EY5 A;  2EYM A;  2AUK A;  1EY0 A;  1GUW A;  3KBX A;  3M4O B;  2O4X A;  1MI2 A;  5C4Z A;  3J80 E;  1L0X B;  2V4D A;  4IUU A;  2WIN B;  5J22 A;  3N52 A;  2HUG A;  2NTT A;  3K57 A;  1B3A A;  1OO9 B;  1LV9 A;  3C1F A;  3HP3 A;  1IKL A;  3HEJ A;  5FO8 B;  2NVQ B;  2F0J A;  4DNT B;  3MXN A;  3P7J A;  2G9D A;  2PCF B;  4PNY A;  2JEA I;  1J9O A;  4CGY B;  1PFN A;  3S14 B;  2ID0 A;  4J8Q A;  5C0X I;  1ROD A;  2F4I A;  2AQ2 B;  1B4O A;  4KD4 A;  1A3V A;  3D4D A;  1TY2 A;  4C3J B;  2BCO A;  3H94 A;  1BR9 A;  2JSO A;  4A3B B;  3R93 A;  4G4K A;  5EKL A;  1JB3 A;  2K6A A;  4QCL A;  5EQ0 A;  1GJX A;  4V0B A;  2EYF A;  4ZUI A;  1HHV A;  1TQO A;  5C5M A;  3IAY A;  3A54 A;  1NAP A;  1ILP A;  1HPC A;  1ET6 A;  5EBC A;  3S1N B;  3P1H A;  1GHK A;  4CKE A;  5FO7 B;  1Y8O B;  3MFG A;  4IUP A;  2QF7 A;  3KLS A;  5JAV A;  1B9N A;  3BDO A;  2L11 A;  1C8C A;  1DYQ A;  1CHQ D;  1SXT A;  4RGT A;  1Y1W B;  4FF1 A;  2JP1 A;  3J7Y W;  4RCN A;  1ESF A;  2XVS A;  4CJ0 B;  3LWU A;  4DK0 A;  2B63 B;  4IAL A;  3A8I E;  1F2L A;  3BS1 A;  4TKO B;  4CHT B;  1LAC A;  2FMC A;  1XX8 A;  1BBX C;  3L3O C;  1PFM A;  4FF2 A;  2AWO A;  1JOQ A;  1B2T A;  2B8F A;  3NSW A;  2KCC A;  2A6H D;  2N88 A;  1TKW B;  2K03 A;  2VUM B;  1ML0 D;  1DOK A;  4ID6 A;  1TS4 A;  3QB3 A;  3FRP B;  3LNN A;  4C2M B;  2OF1 A;  4F7X A;  2F0F A;  4DGZ A;  1S5F D;  1EQV A;  2EOT A;  3FPP A;  1EIG A;  3H3V C;  1D6E C;  1QIL A;  1EYA A;  1FNW A;  1WD1 A;  1ZYR C;  4NW2 A;  1LLR D;  2FHT A;  1QWY A;  1EZ6 A;  3ERO A;  2MUY A;  1BOS A;  4A3G B;  1GXD C;  3BYT B;  5D3I B;  5M5W B;  1YNJ C;  3VR6 A;  1GUO A;  4HTH A;  2BE5 D;  1QB5 D;  2OT2 A;  2K32 A;  5JPM C;  5DAU A;  2E2I B;  3PUX A;  4BA1 I;  1GHJ A;  2HDL A;  3E6Z X;  4C3J G;  4A3D B;  2D2C C;  3GTM B;  4LJZ C;  1F9R A;  1RD9 D;  4KY6 A;  4KJO A;  1RJT A;  4NDX A;  3S15 B;  2F0U A;  2CVR A;  4FF3 A;  1H9S B;  3TSS A;  3D6W A;  3CRK C;  3RMH A;  3OOC A;  1K83 B;  3DWP A;  4HMI A;  4XYQ A;  4RGM A;  5KRU A;  4EVO A;  1Z6H A;  4IFD H;  5M5Y B;  2BA1 A;  2PZT A;  3HG9 A;  1CM9 A;  2WB1 B;  3QO2 A;  1SYG A;  3S1Q B;  2F0H A;  4MIU A;  1F9S A;  2F0G A;  2WKC A;  5CMD A;  3MC0 B;  3K5M A;  4BY1 B;  1BXT A;  3W3A A;  3PO3 B;  3WOF A;  4CJ2 C;  1RCV D;  2Q8R E;  1KTK A;  1K8O A;  4RWS C;  1SYB A;  1CA6 A;  3H09 A;  1RF2 D;  2EJF C;  2F0M A;  2Z4I A;  4DF7 A;  4FP5 D;  4P2C B;  2RSN A;  1RTO A;  2K1B A;  2IJ0 A;  3EQL C;  3WOE A;  2PW5 A;  2KEC A;  4M1U B;  2LS0 1;  5ISR A;  1TWG B;  1HA6 A;  1L0Y B;  4UDU C;  5CV6 A;  1NUC A;  2MPM A;  5ELC A;  3I73 A;  1H9K A;  4B9X A;  1AZP A;  1NR4 A;  1EY4 A;  4RFB A;  1MSG A;  1U4M A;  2BDO A;  1KDB A;  1DOM A;  2EZV A;  3C3L A;  3MVV A;  5ELF A;  1GUG A;  2SOB A;  4TRD A;  4Y7N B;  1Q3L A;  3KBG A;  5C0X J;  3N6R A;  3FDT A;  2Z8L A;  5FOB B;  1EEI D;  2KUM A;  4XTC S;  2IX1 A;  3T51 B;  1B53 A;  3MXU A;  3ERQ A;  3VYU A;  2I46 A;  1SE4 A;  3PMF A;  2IT1 A;  1TWC B;  4XQQ A;  3T56 B;  1XTC D;  5M3M B;  4A3M B;  1A3T A;  2R6G A;  3C2P A;  4CBV A;  3T16 A;  5FO9 B;  1DM0 B;  2KED A;  2ICE C;  3JAM E;  4KKS A;  4KY5 A;  1ET9 A;  1MSH A;  2F0L A;  1H9J A;  4PMW A;  2BA0 A;  1PRT F;  1SJH D;  4KY7 A;  1ICW A;  2KJX A;  3NBI A;  2KHS A;  4WJW A;  4I7Z C;  1MD2 D;  3Q0A A;  2EYL A;  2XNA C;  1G29 1;  2A6H C;  3GTO B;  2XRS D;  1Z47 A;  2EY6 A;  4BY7 B;  1SNQ A;  1BDO A;  4CKB A;  1YNN C;  4HR7 B;  1JOK A;  2IL8 A;  4HSP A;  3BG3 A;  3K7A B;  3FMC A;  4IFD G;  3I4M B;  1S5E D;  1CTM A;  3VR3 A;  2B2V A;  2YYZ A;  5JOB A;  2PZU A;  3TP6 A;  2O5I C;  5C3E B;  2X69 A;  1HA5 A;  4OO1 I;  3BDC A;  1MBY A;  1RTN A;  3CHB D;  2MHV A;  1FNV A;  2K05 A;  5A2Q L;  2Q8T A;  2HDM A;  2F0I A;  2KA7 A;  3S2H B;  5FLX E;  2F3W A;  3PV0 A;  3NXW A;  1LO5 D;  5A35 A;  1SYE A;  3PUY A;  3J7A F;  1SYC A;  3HKZ B;  5C4X B;  5IGG A;  5I4D A;  1WTP A;  1F9Q A;  3OWE B;  2Q8I B;  2SEB D;  5ELD A;  2E2J B;  1QNU A;  3KF8 A;  1Q1B A;  2EJM A;  3K5N A;  1UAP A;  5TSS A;  1WTV A;  1ONL A;  3M4Y A;  2ENB A;  2A68 C;  3OSO A;  3QJY A;  1JE4 A;  2NB0 A;  1JWM D;  5EPK A;  3DEO A;  2B2Y A;  2JE6 I;  5CC4 A;  3DEP A;  2NN6 H;  2RBM A;  1F2Z A;  1TVX A;  1G8Z D;  5CBE E;  2E2H B;  2CW0 C;  5CR3 A;  4K5W A;  3NWT A;  3OIP A;  1F2M A;  1YNN D;  2NN6 I;  1GUS A;  2F3V A;  1LT6 D;  5C44 B;  1U9R A;  4QUF A;  5CV4 A;  4RA8 A;  4K2K A;  5IT9 L;  4HCE A;  1HTP A;  2WP8 J;  3E5S A;  2BOS A;  4EQO A;  3MHB A;  1ZKO A;  3G6J B;  5C3W A;  2AWN A;  5I6Y A;  2C9O A;  3K0Y A;  2KCN A;  4B08 A;  1AZQ A;  3NBH A;  3H6M A;  3TZU A;  3SXH A;  4DNR B;  2NVX B;  3DWQ A;  4WOR A;  5IGC A;  2IX3 A;  3DXJ C;  3C46 A;  1STE A;  4EQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...