5EKKA

Crystal structure of staphylococcal nuclease variant delta+phs v39d/l125e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLDDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLERKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V39D/L125E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ekkA00
1SYEA 3LX0A 2RKSA 5KGUA 1STHA 4ZQ3A 1JOQA 4EQPA 2EY6A 3NQTA 3TMEA 3NUCA 3PMFA 5CGKA 3SK5A 1F2MA 2PZTA 4IZ8A 4K5WA 4DU9A 1JOKA 1NUCA 2F0OA 4YIJA 5EKLA 2F0KA 1A3UA 3ITPA 5I9PA 4K2LA 3OWFA 5E3FA 1A2TA 5C5MA 4H7BA 3MZ5A 4ID6A 4ZUIA 3SK6A 2F0IA 3SXHA 1JOOA 2NUCA 1KDCA 2F0NA 4KY6A 1SYFA 5HURA 3T16A 3SHLA 1KAAA 4KD4A 5IGDA 5KYLA 2RBMA 4N9TA 5C4HA 3T13A 3S9WA 2F0WA 3P1HA 3V2TA 1EY6A 3OMCA 4DFAA 5EGTA 4E6IA 1STYA 3EROA 2F0VA 3OMGA 2EYLA 2EYJA 2ENBA 2F0TA 2F0EA 2EXZA 1EYDA 3OSOA 4WRDA 2F0PA 3TP8A 1F2YA 5IGEA 5CC4A 3VA5A 2EYPA 3NHHA 5IGGA 5KYIA 3NP8A 1KDAA 2SNSA 3BDCA 3DHQA 1SYBA 4K5VA 4MIUA 3MEHA 3P75A 5JAVA 4NDXA 4KY5A 5IODA 5KRUA 3QOJA 4K2KA 4PMCA 1F2ZA 1TR5A 1RKNA 5DAUA 3MXPA 1STNA 1SNMA 3U9OA 1A3VA 2QDBA 4EQOA 4PMBA 1SYGA 5KEEA 5CV7A 4J1MA 2SNMA 3EVQA 4K8JA 2F0FA 1NSNS 5IOCA 1EYAA 3EJIA 2EYOA 3SR1A 2F0QA 4NP5A 4ME5A 5ISRA 4HMJA 2O4XA 1KDBA 4NMZA 4RKLA 2F0HA 4G57A 1SNOA 1U9RA 4B9XA 4J6HA 4LAAA 2F0JA 5CV9A 4KTAA 2PW7A 3R3OA 5EKKA 4DF7A 4KHVA 5C3XA 1JORA 1TT2A 1SNCA 1EY5A 1EY4A 2F3VA 5M9OA 1EY7A 4K6DA 3QB3A 4KJNA 2EY1A 2PQEA 2LKVA 5KIXA 4WORA 4QB4A 3D4WA 4DGZA 1EZ6A 2F0UA 4I65A 4HMIA 3D4DA 5IGCA 5E1FA 3TP5A 5J1ZA 5CV6A 2SOBA 4K5XA 1A2UA 1EZ8A 5I6WA 2OF1A 2OEOA 4S3SA 1TQOA 5CV8A 4EQNA 5J39A 2M00A 2PZUA 1EYCA 3MVVA 5CV4A 5J22A 2F0LA 3MHBA 4ODGA 4OL7A 3H6MA 1AEXA 4QF4A 3SK4A 4F8MA 5I9OA 5IIFA 1ENAA 5IGBA 5NUCA 3TP6A 1STBA 1EY9A 1KABA 3DMUA 5HGTA 2KQ3A 2F0DA 2F3WA 4N9PA 2WACA 4TRDA 4HTHA 2EY2A 1IHZA 4NKLA 4IALA 4R8NA 5C5LA 1EQVA 1A3TA 1SNQA 3HEJA 4QMGA 5JOBA 3RUZA 2EYFA 2EYHA 4KV6A 4KY7A 1SYCA 3QOLA 5C6AA 2OXPA 1SNDA 2F0MA 2EYMA 4PNYA 4B9WA 4K8IA 1SYDA 1ENCA 2PYKA 4EVOA 3D6CA 5DEHA 3E5SA 3TP7A 5CV5A 4RKBA 5IGFA 1EY8A 1STGA 1EY0A 2RDFA 5F2DA 5C4ZA 3NK9A 1II3A 2F0SA 4KD3A 2F0GA 3SK8A 4KJOA 3HZXA 3BDLA 4F7XA 4ZUJA 5C3WA 2EY5A 2KHSA 2PW5A 3NXWA 2PZWA 2HQEA 4K14A 3C1FA 5CR3A 5K5PA 1SNPA 5I6YA 1STAA 4IUNA 3D8GA 3C1EA 3ERQA
chains in the Genus database with same CATH superfamily
1EIGA 1IBML 2DY8A 5C4JB 2E76C 2LXKA 1Y14B 1DXMA 4QGUA 5BR8L 3G71A 3K58A 3OPOA 2Z4IA 1H9KA 3CHBD 4K5WA 4DU9A 3QR8A 2HIVA 2WAQE 5C44B 5AJ3L 3J7ZC 2B2YA 1HNZL 1V1PA 3VDYA 3S1QB 4IFDJ 2HUGA 4PQXA 3ND8A 3I56A 1ESRA 3E9HA 3HKZB 4DUYL 1LT4D 1DCZA 3I2ZA 1EUJA 1I3QH 1SFOH 3NHHA 5FJ8H 2RF4A 4FO2A 5EAYA 3MEHA 5JAVA 3KOJA 1YIJA 4LF7Q 3KDFB 4BY1H 3W1GA 2N78A 5M3FH 4X3UA 2CCZA 2E5LQ 2UUCQ 2D2CC 4R9WA 3GV3A 1T5EA 5GAHC 5C3EB 2EVBA 4C3HG 1HZAA 2M2LA 4HIOA 1K8GA 2DJFC 3TZDA 2IPKD 3D6WA 4LF5L 4ME5A 3ULJA 1EYGA 3OWEB 4YWLA 5HY6A 1G6PA 2KEEA 5IWAQ 2F3VA 4GS3A 1D1IA 3MA2B 4K6DA 1STEA 1GUTA 2EY1A 4KLKA 1HFGA 1EZ6A 2JEBI 1C0AA 1QG7A 2WB1B 1WCMH 4RH6A 1O7LA 3UDFA 3KF8A 2CH4A 5HGQA 1A62A 4L8JA 4AH6A 5ELFA 2XRSD 3HKSA 1G291 3MVVA 5CV4A 5D3DA 5C0XG 3NWTA 1H9JA 4F8MA 5IIFA 1FVIA 4BBSB 5LHY1 5H1SE 3GTKB 4DV3Q 4AYBB 4N9PA 1TWHB 1VQLA 2K7VA 1KD1C 3FRPB 3K7AH 1BDOA 1VQ5A 4A93H 4RGMA 1DZ1A 3GP7A 3AQQA 3VR4A 4A3KG 2PNRC 2F1MA 1BOSA 4EVOA 1JT8A 1TWFB 1ESFA 3HFZB 4JI3Q 4KJOA 4XT3B 3Q0AA 1XNRQ 3BDLA 2MJ8A 4DUZL 4X62L 3BZCA 4LNQA 2K6AA 1R9TH 1X9NA 1TWAB 1XTCD 2KCNA 4JI2Q 3UDGA 4R4OA 1QILA 3H94A 4B3MQ 3S15B 1WTRA 3U50C 4IZ8A 3Q8DA 5L37A 1U4MA 3V05A 1G51A 4HSVA 1BKBA 3TQYA 1VCIA 4ID6A 1BR9A 1WTHA 4DAMA 4DFAA 4A3FB 2HHHQ 2Z9HA 1VS0A 3VYRA 3J80c 3CC4A 3HOUH 1UEAB 1H9SA 4A3DG 1IXRA 3D4RA 3J80i 1KDAA 1SYBA 2QW7A 1XMOL 1A8VA 1BCPC 4F88A 3KLWA 5KNCA 4HIKA 1F9SA 1I4PA 5IP7H 5T1GA 4B3RL 4R4TA 1SNMA 2X69A 1PTOB 3A7AB 5D65A 1HUMA 1O7YA 2F0FA 3UDXA 4QCLA 2QKIC 2KCMA 2ZJPA 1TWGH 4XXEA 5ELDA 1PV4A 2F0HA 2SEBD 4CJ2C 2PW7A 3J81E 2YYZA 1EY7A 3QB3A 4ZRZA 4DGZA 2WIIB 2UU9L 1HQRD 1PMRA 2K14A 4KK7A 1EEID 2SOBA 1IKLA 1SRUA 3OIPA 1W6JA 1U4RA 1EU3A 4K0KL 1Q90A 4C3JH 3KJOA 4IFDG 5IT9L 1MSHA 2EZVA 4LUZA 2LSSA 3TP6A 4HJ9A 1F77A 5M5XH 4DXFA 1JR0D 4FF3A 5JJZA 3HS0C 1B9NA 4ABNA 4BBRG 2N88A 3HG9A 4C3HB 4A4IA 2A68C 2K5DA 5EBCA 5EKIA 4CDFC 2UUBL 2EYHA 4RHRA 5IYBH 2JYOA 1ZXTA 4L5RC 4KHPQ 4RKBA 1E7ZA 2J0TD 1QOHA 1OO9B 1UNSA 1II3A 4DK1A 2A73B 4F87A 1YI2A 3FKIB 1MGSA 3AB9A 5C3WA 1M8AA 4LF9Q 2Y0SE 2KCTA 1KRTA 5E7NA 4DR7Q 4XQNA 1D8LA 3GD7A 1L1OB 2J7ZA 2C35B 4GOPB 1R4PB 2PZTA 3KUPA 1A6XA 1FL0A 1MKHA 1MIUA 3HOYG 1TKWB 3GTJB 3GTOH 4DR1L 1PHJA 2IL8A 2E2JH 2NUCA 2F0NA 3P20A 1PTOF 2NTSA 4LF4L 5IGDA 2KHJA 1SN8A 4ULLA 3TREA 2EXZA 1CKOA 1F2YA 3M4PA 3KK7A 3VA5A 3BDCA 2AQ2B 4A3KB 4LW1A 3PUWA 3VR2A 4G7OC 3GTLH 1K83H 2R7FA 4NDXA 2A74C 3IL8A 3KBGA 1X55A 3TBIB 3BDOA 1F2ZA 5C4XG 1LLRD 3E9IA 2ZJRA 4DR4L 3CMAA 1PVOA 2M9VA 3JAML 1PH9A 5IOCA 2ATWA 3T1YL 3EJIA 2NN6I 1VQOA 5FK9C 1N9WA 1VMPA 1JQYD 1I3QB 3S1MH 1TS4A 5G3LF 3M4OH 1D1KA 3HKZE 3CQZH 4LFCQ 5FOBB 2K4KA 1F9QA 5JVH3 2Q8IB 1WTWA 5J1ZA 4C3IG 2VB2X 2EPBA 4IJLA 4ZYSA 5I6WA 2OEOA 4S3SA 2I46A 4GNXA 1TQOA 5J39A 4NXML 4R4CA 5KNDA 1QE6A 4LUOA 4A3GG 1CK1A 1GHJA 3QIAA 4PG3A 3S14B 4ODGA 4Y52H 1A15A 1AEXA 2L11A 5BN4A 1E2WA 1HZBA 1WTQA 2F3WA 4JC0A 4N8FA 2Q2UA 1K8OA 4EX5A 2Z1CA 4R8NA 1O7IA 1EQVA 3HEJA 1PFSA 2AKWB 2NVTB 5IYCH 1PTOD 2A19A 1SNDA 1L0WA 5JJKA 1WCMB 3JC66 3CC7A 1JOQA 4UHVA 1STGA 3TRZA 2RCNA 2WB1E 1EFID 2BH8A 1I94Q 2FJ2A 1PFNA 2WAQB 5CBAE 2XSCA 1SE4A 5IP9G 2E2IB 3EN2A 4LFAL 2DY7A 3KBXA 2B29A 5C44H 1A3UA 5E3FA 3KLSX 4XIGS 2RDGA 3S1QH 1B4OA 1SYFA 1S72A 2XTIA 1K0SA 2UUAL 5LL6X 1YHAA 3J7YW 3V2TA 4YWKA 5FO9B 3EROA 2ENBA 2WFWA 2B2VA 3MXGA 1B50A 1K9MC 3MTSA 2YU9H 1ET6A 1CSQA 4MHEA 1ZEQX 4JW0A 1W3SA 3K81C 4DNTB 3PV0A 5CV7A 3R8BA 5C3EH 3R2TA 4JK1C 1RTNA 2RSNA 4IN3A 2OTJA 5K36G 1JMCA 1SEBD 1OXXK 1JICA 3U4ZA 1VQDA 1HTLD 5JPNC 1HNWL 3H3VI 1KC8C 2H5XA 1PH7A 1BCPB 4PZ6A 3MXNB 1XJVA 3HOYB 4BXXG 1NTGA 1CUKA 2N49A 1LTLA 1K8MA 3E0EA 4DV4Q 3MEFA 3I4NG 3I4OA 3PO2G 2PO4A 3A8JE 1A63A 1GUWA 2PQAA 2OF1A 2NTTA 3CAMA 2DGYA 1S5BD 2R7ZG 1I4GA 1TWGB 4UDUC 5COYA 4BBSH 5HGTA 4JBKA 5C4XB 3GTKH 1TWHH 4I7AA 4DA2A 1IBLL 4OO1H 1HZ9A 3M4QA 4MTKA 4DV1Q 2K50A 1XMQL 4V190 4JPBW 2NZHA 2F0MA 3MXUA 3H91A 4B9WA 1I4XA 1HJPA 4QIWE 2OWOA 2DNCA 1ILQA 1HRJA 1YEZA 2JA8G 3GTGB 1EWIA 1MBYA 4C3JB 3H15A 1NR2A 2BCOA 5M5XB 2MP1A 3U4VA 3TMEA 2N3SA 4C3IB 3SK5A 2L0CA 3RZOH 3RMHA 2CH4W 3J80E 2ICIA 1NUCA 4H0LC 2O2LD 3U58A 4LF8L 5LMUL 5JEAJ 4KKSA 3TZUA 2QILA 1JE4A 1VQKA 1BXTA 3W2DA 4UY8C 3T16A 3A5UA 2RCFA 4NPSA 3MFGA 1JJ2A 4A3FH 2VQEQ 2F0TA 1FR3A 3MC0B 4RGOS 2EYPA 3NP8A 1U4PA 1BCPF 1FYCA 2R3ZA 2HT1A 4XQJA 4XYQA 2HCIA 4PMCA 1YHBA 2N55A 3GV6A 3K6OA 1WOCA 2VUMH 3F2BA 4IURA 1PTOH 4GLVB 1V1OA 1XYIA 3S2DB 1PTOC 1N32Q 3SR1A 1OXTA 4NP5A 1XXGA 5EPKA 2A8VA 3VYTA 2JXMB 2B2UA 2D0OA 5EQ0A 1HZCA 4KJNA 3GTLB 2LKVA 1PYWD 4QB4A 2K01A 1N36L 4I65A 2Z0SA 2L4NA 1KNAA 5IGCA 2QCPX 1X3FA 4JG2A 3J7AV 1EQRA 1XX8A 2B2TA 1VQEA 4CBVA 3VYSA 3FDTA 2PZUA 3A8IE 5LMNQ 4QUFA 2RVLA 2B2WC 3BJUA 3C2PA 2JA6G 1LTTD 2UXCQ 4RMFA 1WJJA 2AWNA 1UAPA 4JV5Q 3ONAB 1X3PA 1VQIA 1I50B 1QZGA 2Q8RE 4FXKC 4IALA 4DV5Q 3GQBA 1JWSD 3M4OB 4LF6Q 4C3HH 1NE3A 2RSOA 1V9PA 3KF8B 3FEWX 1LTBD 2Y0SB 4DV6Q 5T1IA 4R4IA 5C4ZA 4AIMA 3DEOA 2EDGA 3I4NB 1BCPD 2PMZE 5I6YA 2E5LL 4UAIA 4YIJA 3ERQA 3PO2B 3LX0A 5DM73 4ZK9B 4HR7B 2EY6A 1YITA 2UXBQ 4IJHA 1L1OC 3OTOL 3ULLA 4LFBL 4TQUS 5C0XH 3GTJH 3LWEA 3PCOB 2R7ZB 3OWFA 4JOIA 2ZXRA 4P74A 2F0IA 5HURA 3K59A 5IYDG 1KLGD 1EQQA 4DR2L 4DR3L 2A69C 2VUMG 4JVZA 4RGTA 1Z6HA 2F0EA 3PUYA 1DJRD 4A3KH 2BDOA 3VA7A 4R1JA 2Q2IA 3TN2A 2JA8B 3IFTA 1PH6A 3DWPA 2CFMA 3FP9A 2JK8A 1HCZA 1J5EQ 3EIVA 1WTPA 4X3SA 1SAPA 4JYAQ 3JAMc 4A3CG 1PRTC 2LXJA 4NXNQ 1NMGA 1Q8IA 4C2MB 3JAMi 1VQFA 2I5LX 4RKLA 4NMZA 4JI1L 5C4HA 2A68D 3CRLC 1Y1VG 2KEDA 1JORA 2K32A 3CXCA 1EQTA 2NN6G 1P8LA 2IJ0A 2RDHA 2YU9B 4RGNA 4DKAC 2V1CC 4OELB 1PDQA 2L5TA 1LT5D 3L2PA 1PH2A 3FMCA 3QO2A 5JEAG 1IL2A 4A3DH 3AMUA 4GN3B 1H95A 4WJWA 3RNUA 2VW9A 4DV0Q 4Q0FA 3S14H 4KI0A 3L3OC 4BA1I 2Z6KA 4UPAA 1LT3D 1B53A 3OIQA 3M7GA 1PH1A 1K28A 1SSOA 1E2VA 1L0YB 2NB0A 1HR0W 1CKNA 5C5LA 2F03A 5M5YH 2B3GA 1Q8KA 4ILWA 1SNQA 2F4VL 3CD6A 1PZKD 2MGSA 3UE1A 2NVTH 3M3YB 4KY7A 2HHHL 1SYCA 3QOLA 4DAYA 3NE5B 4CKBA 5M5WB 5J3BA 2PYKA 1VQPA 4FXGC 1NAPA 5CV5A 2R92G 3NQIA 4DR6Q 3E0JA 2MFIA 3SDZA 2PW5A 1QNUA 2PZWA 2YTXA 4A3BH 2EE1A 1KRSA 3T1HL 2E75C 1Q46A 5KGUA 3DWAA 3S2HB 1HFNA 1LO5D 2PI2E 3FPUB 4M1UB 2E2IH 1GD7A 1TS5A 1I6HH 1AN8A 1E24A 2N8NA 4IFDH 2B8GA 1IBMQ 2JA6B 1IYVA 3MZ5A 1JOOA 2A6HC 3HOVG 3K5MA 3CCVA 5BR8Q 1UWVA 2BOSA 2D62A 1EIYB 1ICWA 4B3TL 2K04A 1R4QB 4BBRH 5AJ3Q 4RCOA 1ENFA 1FJGL 2YTYA 1PYSB 5KNBA 1PXUA 4DNIA 1VF5C 4DUYQ 3RZOB 4WFN3 4FP5D 2G9DA 3KFUA 1AE3A 5DAUA 4YY3L 2JA7G 4APVA 2IHEA 2VL6A 2D0PA 1CHQD 1YNJC 4UP7A 1YJ9A 3BVMA 2K05A 2GVAA 5CMDA 2A6EC 4DK3C 4A3EG 5ISRA 2I5MX 5E4WC 1E1OA 1LTID 1U9RA 2RA4A 3HOYH 3BS1A 1N33L 3I4LA 1EFWA 4LF5Q 1D7QA 3K0XA 2BDNA 5BN5A 1PYBA 1HHVA 1JE5A 1I4HA 1E0BA 2VUMB 3URYA 1DONA 1WTOA 5ELEA 4EQNA 1Q81C 2FFKB 5BN3A 1AZPA 1DOMA 3HGBA 5NUCA 2QDLA 4R4QA 5C4XH 4QJFA 1ILPA 1GOZA 2C9OA 4RWSC 4QIWB 2KOLA 4A3BG 4I7ZC 1DGSA 4QMGA 3KDFA 4O1NA 1X54A 1JWUD 2OXPA 3J7AF 1AP0A 3WDNA 4PNYA 1OXSC 4GKJL 4HJ7A 4N8X1 1DYQA 2EJFC 1Y1VB 1PH8A 1E2ZA 2A5HA 4F7XA 3GTGH 2HQEA 1KIXA 4TSSA 4A3MG 3X3NA 4CKCA 1EOTA 1S5FD 2RKSA 5JJIA 4C3IH 5EJWA 3SVMA 4X3KA 1W2BA 4IOCA 3BU2A 1EIFA 1IBKL 2X6GA 2OT2A 1RTOA 4DUZQ 4X62Q 3ER0A 4CGYB 1RL2A 4A3GH 4O2DA 4H7BA 3HP3A 2ICEC 2E2DC 1AH9A 1D5ZC 3G6JB 4OIKA 2RBMA 1TY0A 2E2HB 2RHQB 4LK1C 4HIMA 4BWGB 1ET9A 1E3PA 1EYDA 1H9RA 4HCSA 2F0PA 1VQ7A 1LTRD 1QWYA 3CKIB 1PZJD 1JB3A 3RLNA 5IODA 1V43A 3S1RB 1TR5A 4Z9CB 5I2XA 4X64L 2B2YC 1XMOQ 2PPBC 2SNMA 2KJXA 2GVBA 3S2DH 5IP9H 4HMJA 1MD2D 4G57A 3F1ZA 5C3XA 1RHPA 4KHVA 3K8AA 3A7LA 3VR3A 3T4AC 3D3RA 3T56B 4AQYL 1P16A 3A5ZB 4WORA 3HOVB 3P7JA 5IT9E 1RF2D 1LUZA 4HMIA 4X66L 1I5FA 4XTCS 1LTGD 1I94L 1J8IA 4K5XA 2QF7A 4J8QA 1PRTB 2ALYB 4DK6C 2CW0C 1CFMA 1CA6A 2UU9Q 1G8ZD 3A55A 4OL7A 3H6MA 1LACA 5I9OA 1G6ZA 4HAEA 2HDMA 5FKAC 1I50H 2JA7B 1EU4A 1GKHA 2AUJD 4GKKQ 1E22A 4K0KQ 4HEDA 2VQFL 1AE2A 4YCVA 3F2DA 1EIHA 5K36H 5C6AA 1S5ED 1SJED 2PQAB 3M9BA 1IZ6A 2XN9C 4A3EB 3KF6B 2PMZB 4H02A 4K8IA 3D6CA 3TP7A 2ZM6L 1SBBB 1CI3M 2Q2HA 4BXXH 4A3DB 1G91A 2B8FA 2UUBQ 1QZHA 2QGQA 2KHSA 3DLLA 1E1TA 3I4NH 4TKOB 3BYYB 3C1FA 3C1EA 3PO2H 1SYEA 3D31A 4IPCA 4HJ8A 5CGKA 3C3LA 1LYLA 4MN3A 1AFPA 4PMWA 5M5YB 4JI5L 1WTXA 2R7ZH 3PF4A 1TXYA 4C1NK 4CDCC 3HOWG 2EOTA 2K52A 1KLUD 3A54A 1B44D 2F0WA 4H44C 2H1EA 2F0VA 4DR1Q 2FXQA 1VQBA 4A3BB 2ZXPA 2BE5C 2DN8A 4DR5Q 3JAME 3NTKA 4LF4Q 3VR5A 4MIUA 3BVGA 1D5MC 2KA7A 3I55A 4P73A 3KLSA 4MZ9A 3G48A 1HR0L 1CA5A 1KNEA 2L1BA 2JA8H 1STNA 1I6HB 1IKMA 4PMBA 2AUKA 5KEEA 1JWMD 4A3MB 3SEBA 3F2CA 2K5QA 2KUMA 4K8JA 3M7NA 2K5WA 1M90C 1VQCA 1PRTF 4C2MH 4MTNA 2BH2A 2AWOA 1XPRA 5G3LD 4BBRB 1D5XC 5EKKA 1BQQT 2NWGA 5GQOA 3VYUA 2VNUD 1VMCA 3T1YQ 5FLXL 1GHKA 3K80C 4GOPA 4DV7L 1SMYC 2BA1A 2I07B 2NVYB 4JI6Q 1Y69U 1C48A 1X65A 3SK4A 5IGBA 1ENAA 1RCVD 2G5DA 1U4LA 2KQ3A 1EEFD 2JP1A 2LFNA 4NXMQ 1IHZA 2BA0A 4JI7L 4KHZA 1WVLA 3RUZA 1YJWA 3M3YH 5M5WH 4JI4L 5EPLA 1XTDA 2A69D 3BG3A 3BZKA 1O78A 4RG1A 3SK8A 1OXUA 1FNVA 2EXDA 1B1ZA 2AHOB 4Y7NB 4YHHL 4HIDA 2UXDL 1CQVA 1A0IA 1TWCB 3RN5A 1NBWA 3S2HH 5I4DA 1GXDC 5AFWA 3PMFA 2L55A 3Q23A 3KYHC 4FF4A 4BY7G 2LMCB 1Q1BA 5CYUA 1SROA 2F0KA 1F2LA 1S5DD 1T5XD 1PRTD 3WWVA 4XQQA 4C1NI 5GAGC 2JA6H 1X3GA 4POGA 4N9TA 2HD3A 3PIPA 4LFAQ 1QUQA 3PO3G 1STYA 5E4XA 1IL8A 4JI8L 1SR3A 3OW7A 1B7YB 4JCVE 5IGGA 4HJAA 4JI0Q 3DHQA 1K3BC 1XNQL 2XNAC 2UUAQ 4IOAA 2FHTA 4K2KA 1GUGA 1Y8NB 5ELCA 1IYJB 2K5VA 3F8TA 2K5NA 1YNNC 5CORA 2QDBA 2MNAA 3C46A 2IX1A 1SYGA 2ASBA 4A3GB 2F52A 4J1MA 1VF7A 4B3SL 4OXPA 1Q1EA 3IAYA 3E6ZX 2I0QA 3NTHA 3J81i 1GO3E 1TS3A 4DV2L 4LWCA 3NELA 5FO7B 2WKDA 1SNOA 5ELOA 4B9XA 4OWWB 4DK0A 3R3OA 3W1BA 1KL9A 1W6KA 1SNCA 4OX9L 1EY4A 2O5IC 4A3JG 4ZKCB 4X65L 3HOWB 1UEBA 2TMPA 1WI5A 4ZKBB 1KTKA 1HNWQ 5IYDH 1HH2P 1B2TA 1V1PB 2R93H 2KBNA 1A2UA 4BS9A 3PQIA 5CV8A 1HNXL 3CCJA 1EYCA 3K57A 3PSIA 4QF4A 3SGIA 1HXYD 1AW7A 1F9PA 4HSPA 2JJQA 4DPGA 2A6HD 3K5NA 2RQXA 5JOBA 3DEPA 4A3CH 4ALPA 2EQSA 3K5OA 1N34L 4HJ5A 1Q7YC 1FNWA 5C0XJ 1IBLQ 4GNXC 2CHBD 1Y1VH 3BZDB 2ID0A 1O80A 2TSSA 1VQ8A 3A56A 2NN6H 1XMQQ 1SNPA 1LV9A 3RLFA 3D8GA 2KVMA 4RA8A 5IT9c 3EBEA 1CKNB 4EQPA 3MXNA 4GN4B 3F2UA 5JEAH 1YNJD 1C7YA 4XYOA 4DAYB 1SLJA 4IPDA 1NMFA 2SDFA 4KN4C 5GAEC 2NBFA 5I9PA 2A6ED 3OW2A 3O13A 1QJOA 5C5MA 1D2BA 4FDBA 1VQHA 2DNEA 3UE0A 3DWQA 2NVQH 1KAAA 2PCFB 1S3OA 1LT6D 4OONA 2E2HH 4LF7L 3I73A 5EGTA 1DM0B 4LF8Q 1CSPA 1AZQA 4FXDA 1RIPA 4IUQA 2MPMA 1PH5A 2UUCL 1B3QA 2L15A 4K5VA 1OTCA 4OHJA 4KY5A 2R92H 3QOJA 2G9HD 3S1RH 1KXLA 3EVQA 4O0AA 3M4YA 3NPPA 5IWAL 1WYDA 5ELNA 4BY7B 3PGZA 2R93G 1VQJA 2B2VC 1CQFA 3FPPA 1SXTA 3L7ZC 4KTAA 1EY5A 4KMUC 2PQEA 1WTVA 1N8RC 3HOVH 3CCUA 2HQLA 4B08A 3PUZA 1L2FA 3D4DA 4CKEA 4LJZC 3PO3B 3J81j 4FF1A 2HDLA 5D14A 3BYTB 1B70B 4UP8A 4DV3L 1VDZA 2IT1A 2M00A 1N36Q 5J22A 3WOFA 5IGFA 2ZXOA 4G7HC 1BO0A 1H9SB 4KKTA 1JJCB 2MO1A 3G6EA 2JA7H 1ZYRD 4ME3A 1RD9D 3IRBA 1KAWA 4NKLA 2WP8J 4L5QA 4L6TB 4JI3L 1XNRL 1GUNA 4EGVA 4TVAB 1NJIC 1YZ6A 4A3EH 1HQMC 5DM63 5JJLA 4WJ4A 1SYDA 4RFBA 1YJNA 4JI2L 3J7A5 2CKZB 4B3ML 2Z4HA 4ZUJA 4A3JB 3H3VH 2E74C 5GROA 3RR5A 3H3VC 2A1AA 4H13C 1F2MA 2OQKA 1BBXC 5EKLA 3KLRA 2NVXB 1BNZA 3ITPA 4K2LA 3CCMA 1NY4A 4KY6A 5DNFA 3SHLA 5FLMG 1K8AC 4A3IG 5M3MH 3OTOQ 4IPGA 3OMCA 4LFBQ 3N52A 3NSWA 3HOXG 4WRDA 5CC4A 3FKIG 2SNSA 3CPFA 2AMCB 2OQ0A 4DR2Q 4DR3Q 1DD2A 1BBWA 2D5DA 2CW0D 1Q12A 4IO9A 3GTPB 3PIOA 4A3MH 1Y8OB 4NW2A 3STBC 1VQAA 3I91A 2LY7A 1I4RA 4P75A 3I4MG 3EFXD 1SE2A 2IW3A 1TS2A 4YCWA 2O4XA 3FVQA 3H09A 1HNZQ 2F0JA 1GUSA 1C9OA 1RJTA 4O42A 3M85A 4IUUA 1CZGA 1M4VA 1BVSA 1UE1A 2DUDA 3NBHA 5FLXc 5IE8A 1EWCA 1PZID 2K33A 2NYZD 4JI1Q 2L9HA 2NVYH 3LWUA 2MHVA 3EA6A 3TP5A 3H0GH 3J81L 1Q82C 2CWAA 2FMMA 4IPHA 1LTSD 3RN2A 1NNXA 2I5HA 3RZDH 3WOEA 1GJXA 2KCCA 2B2UC 4JBMA 2F0DA 2WACA 4KHPL 3HOZH 1CHPD 3CRKC 3G4SA 2EYFA 5FJ8G 1PA6A 1IW7C 4LF9L 2RHSB 2R93B 4BY1G 2B2TC 4DR7L 2BE5D 5M3FG 2F4VQ 3ZYYX 2VY3A 4EQ5A 4Y7NH 1O7ZA 2IY5B 3S24A 2GA4B 3OYYA 4RCNA 1TWCH 3BVZA 3NWSA 4G7ZC 1PLFA 2EJGC 1STHA 3LNNA 1VQMA 2JSOA 4K6LA 1NCVA 5LMNW 5M3MG 3LGJA 2F3IA 1YNXA 4PZ7A 1JCKB 3T1HQ 3DM3A 4GNXB 1KQSA 1KDCA 5ELBA 3R93A 4P2CB 1QB5D 2JEAI 1C4QA 2MQHA 4OIJA 5KYLA 3S9WA 3T13A 3S17H 1WCMG 1DOLA 4ZAIA 2O5JC 1EY6A 2ZJQA 4WJ3M 1Z7TA 1GVPA 3CU7A 2NZ1D 2XRQD 1JC7A 2HCCA 1KHIA 1TY2A 1SMYD 2F4IA 4OGQC 4OO1I 4B3TQ 3CF5A 4XT1B 2WAQG 5D3IB 1RKNA 3GTQB 5I2YA 1ZYRC 3L0OA 2JN4A 4EQOA 1FJGQ 1QVGA 4DAPA 4JOIC 4QY7A 1OXVA 3TS0A 1XPUA 4GKKL 4A93G 2R7DA 2NVQB 2EYOA 4LMQD 4YY3Q 3ICEA 4LFCL 1JB7A 3H0GG 3D0FA 4DAVA 1UUPA 3NBIA 4G4KA 4J6HA 4LAAA 1ONLA 3I70A 3K7UC 1ICFB 1MJEA 4L5SA 3U9SA 1T9HA 3HOWH 1Z47A 4M8AA 2R92B 4FYDA 2R6GA 4A3IB 1Y8PB 1M1KC 1ML0D 2IX0A 1GUOA 3HOXB 1RODA 2K75A 3HOZG 3G7LA 1N33Q 2VB3X 5LL6S 2EJMA 3MAQA 1YVCA 4B3RQ 1EOVA 3DMUA 1S5CD 5CBEE 2ES2A 3AYHB 3PIP3 1FNUA 1ASZA 2IWHA 1A3TA 3HOUG 1Z9FA 3ND9A 3EQLC 2QEJC 3I4MB 3HRZC 4A3LH 1ENCA 4DR5L 4CDEC 4XDXA 3E5SA 5DLQE 1EY8A 3CCQA 5IP7G 3NK9A 2F0SA 4KD3A 4NB3A 3S1NB 2EY5A 4K14A 1Y1WH 3GO5A 2Z6KC 1SMXA 4GKJQ 1B3AA 4QL5A 3GTMB 3CPWA 1BF4A 2KENA 1QNKA 2J4XA 3N6RA 1YNND 2K28A 1C8CA 4RHSA 1VQNA 2CQOA 1V1QA 4GZYC 2XWJB 4QQBX 4CDDC 2ZTDA 1RDPD 1IBKQ 2Q8TA 4KD4A 1IYUA 1MJCA 4DNRB 1F9RA 3DXJC 4CHTB 2EYLA 2EYJA 2C5CA 3OSOA 3GDEA 5IGEA 5KYIA 1SFOB 1X6OA 4JI6L 1HPCA 3CC2A 1ZKOA 2WKCA 1HA5A 3P75A 4C3JG 3QJYA 3X3MA 5KRUA 4BY1B 1VQ6A 5M3FB 1G2TA 1MSGA 1JJGA 1A3VA 4YCUA 2JA5H 1BUVT 2IHFA 1NSNS 2B63H 3TDQA 1QUQB 4FNFA 1QVCA 1EYAA 4DV4L 2F0QA 2B2WA 5IYBG 5M3MB 4BY7H 1KDBA 3OOCA 4X64Q 2AQ3B 5CV9A 3CCSA 3A0JA 1XWEA 5M9OA 1I6VC 3PF5A 3PUVA 3S16H 5KIXA 1I4QA 2JQOA 3D4WA 2P5ZX 3T51B 2OTLA 1U5KA 5E1FA 3W5OA 5C0XI 4X6AH 3PO3H 4PZ8A 2KHIA 3K0YA 1VQ4A 4AQYQ 4MNOA 1YHQA 4J15A 2F0LA 4X66Q 1CZWA 4DV1L 2Q2TA 1X3QA 4A3LG 4DR4Q 1EY9A 1KABA 1S4ZA 1STBA 2H4OA 2YTVA 5C4JH 2L12A 4DN4M 1SE8A 3K5LA 4UP9A 2QA4A 1L1OA 1D6EC 1Y1WG 1PFBA 4A76A 1SE3A 3K7AB 4KV6A 2LS01 4A93B 1NR4A 1CT1D 3Q22A 1HTPA 1PFMA 4AYBE 3Q6SA 5DEHA 3H0GB 4JI0L 3A74A 5F2DA 1EY0A 4U68A 3CCLA 1SDFA 2VQFQ 1XPOA 2VZAA 1U0LA 4A3JH 3GTMH 1G2SA 5K5PA 3RZDB 4IUNA 1R9TB 5JPMC 1S40A 2ZM6Q 3I8ZA 3TS2A 3HOZB 3QWNA 3CCRA 4X3TA 4RAUC 3FHWA 4IUPA 3AFQA 4IUTA 2F0OA 4GLAC 2NVXH 2VQEL 1FD7D 2ZTEA 1K3RA 3Q24A 3R2IA 2CQAA 5EBDA 1HA6A 3ULPA 2XWBB 3AFPA 3IFDA 3KJPA 4JI5Q 2CWPA 3P1HA 4E6IA 3J80L 4CJ0B 2Y0SG 1PH4A 2ZTCA 1CM9A 3OMGA 3TP8A 4CJ1B 3HOUB 3ZJYC 2JA5G 2XIWA 2B63G 1FGUA 2B39A 2K03A 1Q86C 2XVSA 1N32L 1WFQA 4IQZA 2JA9A 3MXPA 3GTPH 1CTMA 1LABA 3QG1A 4DXGA 1WD1A 2MUYA 1GM5A 4C56C 3KF6A 1VQ9A 3B6YA 5FLXE 2QEXA 5FO8B 2AQ1B 5IYCG 5A35A 1HR0Q 2YV5A 3S17B 1TIID 3UDIA 4L63B 3NENA 4JBWA 4P71A 2PNHA 4DF7A 1B9MA 4V0BA 1TT2A 1YBYA 1UE7A 3I90A 2K5HA 3PUXA 5LMNL 2F0UA 2MO0A 2X6LA 4IFDI 2UXCL 5CV6A 2HIXA 4JV5L 1DOKA 1TWFH 4ZCKA 4KN7C 3J81c 4DV5L 1SJHD 5C44G 4OWXB 4LF6L 3MHBA 4DV7Q 1BBUA 1TWAH 2IX3A 2E8GA 1J6QA 3HKZG 4TRDA 3S15H 4DV6L 4BA2I 5A2QL 4HCEA 4OWTB 3VR6A 2EYMA 3V96A 4Q5VA 2RDFA 5JVG3 4JI7Q 2UXBL 5CR3A 2VS1A 3L9AX 3RD4A 1Q3LA 1TU2B 4A75A 4JI4Q 2Z8LA 1CKMA 3DM1A 3PIO3 1STAA 5C3EG 2Z6BA 1FGBD 3NXWA 5EPJA 2EIFA 1LTAD 2R61A 4ZQ3A 3AEVA 3IKJA 3NQTA 3NUCA 1HUNA 2FINB 4POFA 2JE6I 1J9OA 3MFYA 2WV6D 1JOKA 3STBD 4GN5A 4YHHQ 2UXDQ 3GTOB 3ERSX 4GLXA 2OCEA 2DJGC 1A2TA 2V4DA 3MWYW 4ZUIA 3SK6A 3SXHA 2E2JB 2NZOA 1UE5A 2D9UA 3T53B 5GADC 4HN7A 2WB1G 2WINB 4L5TA 1MHWC 3NEMA 1H9MA 1B8AA 1Y1WB 1K0RA 1J5EL 1K83B 4JYAL 1K73C 1EL0A 4BBSG 5IY0A 4NXNL 1ASYA 4JI8Q 3GTQH 1TVXA 1QCBD 4FVMA 4AYBG 3U9OA 1X3EA 1XNQQ 1EWHA 2KECA 4OO1G 3DUZA 1UE6A 3E3XA 5A2QE 1X56A 2CVRA 4YWMA 4LUVA 4ZLTF 2K1BA 1L0XB 2PI2A 3NTIA 5LMUQ 4U673 4PV1C 3S1MB 4B3SQ 3I7FA 1IW7D 4DV2Q 3TEHB 3CQZB 1LM0A 5FLMH 4DV0L 3CP0A 1X32A 4A3IH 4KKUA 3A8KE 3CW2C 5TSSA 3RLOA 3HOXH 1EZ8A 4OX9Q 2JA5B 3W3AA 3I3CA 4X65Q 2B63B 3FKIH 4IUVA 1MI2A 3I72A 3TSSA 4OEMB 3OHXC 1VQGA 1WD0A 4QUCA 3NBHB 3UI2A 1HNXQ 4HTHA 2EY2A 4A3FG 4P72A 4DR6L 3S16B 1V8QA 4GOPC 1QVFA 3I4MH 3AU7A 2XGTA 3CCEA 4FF2A 2ZT9C 2GN5A 3SE0A 2FMCA 4JBJA 2F0GA 3S1NH 3HZXA 4R8IA 1N34Q 3CMEA 2VXWA 1PH3A
chains in the Genus database with same CATH topology
1EIGA 2DY8A 5C4JB 2E76C 1DXMA 3K58A 3OPOA 2Z4IA 1H9KA 3CHBD 4K5WA 4DU9A 5C44B 2B2YA 1V1PA 3S1QB 4IFDJ 2HUGA 4PQXA 3ND8A 1ESRA 3HKZB 1LT4D 1DCZA 3NHHA 4FO2A 3MEHA 5JAVA 4X3UA 2D2CC 4R9WA 3GV3A 1T5EA 5C3EB 2EVBA 4C3HG 2M2LA 3TZDA 2IPKD 3D6WA 4ME5A 3OWEB 2KEEA 2F3VA 1D1IA 3MA2B 4K6DA 1STEA 1GUTA 2EY1A 1HFGA 1EZ6A 2JEBI 1QG7A 2WB1B 4RH6A 1O7LA 3KF8A 4L8JA 5ELFA 2XRSD 1G291 3MVVA 5CV4A 5D3DA 5C0XG 3NWTA 1H9JA 4F8MA 5IIFA 4BBSB 5LHY1 3GTKB 4AYBB 4N9PA 1TWHB 2K7VA 3FRPB 1BDOA 4RGMA 1DZ1A 3GP7A 3VR4A 2PNRC 2F1MA 1BOSA 4EVOA 1TWFB 1ESFA 4KJOA 4XT3B 3Q0AA 3BDLA 2MJ8A 2K6AA 1TWAB 1XTCD 2KCNA 1QILA 3H94A 3S15B 1WTRA 4IZ8A 1U4MA 3V05A 4HSVA 1VCIA 4ID6A 1BR9A 4DFAA 4A3FB 3VYRA 1UEAB 1H9SA 3D4RA 1KDAA 1SYBA 1BCPC 4F88A 5KNCA 1F9SA 1I4PA 5T1GA 1SNMA 2X69A 1PTOB 3A7AB 5D65A 1HUMA 1O7YA 2F0FA 4QCLA 2QKIC 4XXEA 5ELDA 2F0HA 2SEBD 4CJ2C 2PW7A 3J81E 2YYZA 1EY7A 3QB3A 4ZRZA 4DGZA 2WIIB 1HQRD 1PMRA 4KK7A 1EEID 2SOBA 1IKLA 3OIPA 1W6JA 1U4RA 1EU3A 1Q90A 4IFDG 5IT9L 1MSHA 2EZVA 3TP6A 1F77A 4DXFA 1JR0D 4FF3A 5JJZA 3HS0C 1B9NA 4ABNA 4C3HB 2N88A 3HG9A 5EBCA 2A68C 2K5DA 5EKIA 2EYHA 4RHRA 2JYOA 1ZXTA 4RKBA 2J0TD 1QOHA 1OO9B 1UNSA 1II3A 4DK1A 2A73B 4F87A 3FKIB 1MGSA 3AB9A 5C3WA 1M8AA 4XQNA 3GD7A 2J7ZA 1R4PB 2PZTA 3KUPA 1A6XA 1TKWB 3GTJB 2IL8A 2NUCA 2F0NA 3P20A 1PTOF 2NTSA 5IGDA 4ULLA 2EXZA 1F2YA 3KK7A 3VA5A 3BDCA 2AQ2B 4A3KB 3VR2A 3PUWA 4G7OC 4NDXA 2A74C 3IL8A 3KBGA 3TBIB 3BDOA 1F2ZA 1LLRD 2M9VA 3JAML 5IOCA 3EJIA 2NN6I 5FK9C 1VMPA 1JQYD 1I3QB 1TS4A 5G3LF 1D1KA 5FOBB 1F9QA 5JVH3 2Q8IB 1WTWA 5J1ZA 4C3IG 2VB2X 2EPBA 4ZYSA 5I6WA 2OEOA 4S3SA 2I46A 1TQOA 5J39A 5KNDA 1QE6A 1CK1A 1GHJA 3QIAA 3S14B 4ODGA 1A15A 1AEXA 2L11A 5BN4A 1E2WA 1WTQA 2F3WA 1K8OA 2Z1CA 4R8NA 1EQVA 3HEJA 2NVTB 1PTOD 1SNDA 1WCMB 1JOQA 1STGA 1EFID 2FJ2A 1PFNA 2WAQB 5CBAE 2XSCA 1SE4A 2E2IB 2DY7A 3KBXA 1A3UA 5E3FA 3KLSX 4XIGS 2RDGA 1B4OA 1SYFA 5LL6X 3J7YW 3V2TA 5FO9B 3EROA 2ENBA 2B2VA 3MXGA 1B50A 3MTSA 1ET6A 4MHEA 1ZEQX 4DNTB 3PV0A 5CV7A 3R8BA 3R2TA 4JK1C 1RTNA 2RSNA 4IN3A 5K36G 1SEBD 1OXXK 1JICA 1HTLD 5JPNC 1BCPB 3HOYB 1K8MA 2PO4A 3A8JE 1GUWA 2OF1A 2NTTA 1S5BD 1I4GA 1TWGB 4UDUC 5COYA 5HGTA 5C4XB 4DA2A 4OO1H 4V190 2F0MA 3MXUA 3H91A 4B9WA 1I4XA 2DNCA 1ILQA 1HRJA 3GTGB 1MBYA 4C3JB 1NR2A 2BCOA 5M5XB 2MP1A 3TMEA 4C3IB 3SK5A 2L0CA 3RMHA 3J80E 2ICIA 1NUCA 4H0LC 2O2LD 5JEAJ 4KKSA 3TZUA 2QILA 1JE4A 1BXTA 3W2DA 3T16A 3MFGA 2F0TA 1FR3A 3MC0B 4RGOS 2EYPA 3NP8A 1U4PA 1BCPF 1FYCA 2R3ZA 4XQJA 4XYQA 2HCIA 4PMCA 2N55A 3GV6A 3K6OA 4IURA 1PTOH 1V1OA 1XYIA 3S2DB 1PTOC 3SR1A 1OXTA 4NP5A 1XXGA 5EPKA 3VYTA 2JXMB 2B2UA 5EQ0A 4KJNA 3GTLB 2LKVA 1PYWD 4QB4A 2K01A 4I65A 2L4NA 1KNAA 5IGCA 2QCPX 3J7AV 1XX8A 2B2TA 4CBVA 3VYSA 3FDTA 2PZUA 3A8IE 4QUFA 2RVLA 2B2WC 3C2PA 1LTTD 2AWNA 1UAPA 3ONAB 1X3PA 1I50B 2Q8RE 4FXKC 4IALA 3GQBA 1JWSD 3M4OB 2RSOA 3FEWX 1LTBD 2Y0SB 5T1IA 5C4ZA 3DEOA 2EDGA 3I4NB 1BCPD 5I6YA 4UAIA 4YIJA 3ERQA 3PO2B 3LX0A 5DM73 4ZK9B 4HR7B 2EY6A 4TQUS 5C0XH 3LWEA 2R7ZB 3OWFA 2ZXRA 2F0IA 5HURA 3K59A 1KLGD 2A69C 4RGTA 1Z6HA 2F0EA 3PUYA 1DJRD 2BDOA 3VA7A 3TN2A 2JA8B 3IFTA 3DWPA 1HCZA 1WTPA 4X3SA 1SAPA 1PRTC 1Q8IA 4C2MB 4RKLA 4NMZA 5C4HA 2A68D 3CRLC 2KEDA 1JORA 2K32A 1EQTA 2NN6G 2IJ0A 2RDHA 2YU9B 4RGNA 1PDQA 2L5TA 1LT5D 3FMCA 3QO2A 5JEAG 3AMUA 4WJWA 4Q0FA 4KI0A 3L3OC 4BA1I 1LT3D 1B53A 3OIQA 3M7GA 1SSOA 1E2VA 1L0YB 2NB0A 5C5LA 2F03A 4ILWA 1SNQA 1PZKD 2MGSA 3M3YB 4KY7A 1SYCA 3QOLA 4DAYA 3NE5B 4CKBA 5M5WB 2PYKA 4FXGC 1NAPA 5CV5A 3NQIA 3E0JA 3SDZA 2PW5A 1QNUA 2PZWA 2EE1A 2E75C 5KGUA 3DWAA 3S2HB 1HFNA 1LO5D 3FPUB 4M1UB 1TS5A 1AN8A 4IFDH 2B8GA 2JA6B 1IYVA 3MZ5A 1JOOA 2A6HC 3K5MA 2BOSA 2D62A 1ICWA 2K04A 1R4QB 4RCOA 1ENFA 5KNBA 1PXUA 1VF5C 3RZOB 4WFN3 4FP5D 2G9DA 5DAUA 1CHQD 1YNJC 3BVMA 2K05A 5CMDA 2A6EC 5ISRA 5E4WC 1LTID 1U9RA 2RA4A 3BS1A 3I4LA 2BDNA 5BN5A 1HHVA 1I4HA 1E0BA 2VUMB 3URYA 1DONA 1WTOA 5ELEA 4EQNA 2FFKB 5BN3A 1AZPA 1DOMA 3HGBA 5NUCA 1ILPA 1GOZA 2C9OA 4RWSC 4QIWB 2KOLA 4I7ZC 4QMGA 4O1NA 1JWUD 2OXPA 3J7AF 1AP0A 3WDNA 4PNYA 1OXSC 1DYQA 2EJFC 1Y1VB 1E2ZA 2A5HA 4F7XA 2HQEA 4TSSA 3X3NA 4CKCA 1EOTA 1S5FD 2RKSA 5EJWA 3SVMA 4X3KA 2X6GA 2OT2A 1RTOA 4CGYB 4H7BA 3HP3A 2ICEC 2E2DC 1D5ZC 3G6JB 4OIKA 2RBMA 1TY0A 2E2HB 4LK1C 4BWGB 1ET9A 1EYDA 4HCSA 1H9RA 2F0PA 1LTRD 1QWYA 3CKIB 1PZJD 1JB3A 5IODA 1V43A 3S1RB 1TR5A 4Z9CB 5I2XA 2B2YC 2PPBC 2SNMA 2KJXA 4HMJA 1MD2D 4G57A 5C3XA 1RHPA 4KHVA 3A7LA 3VR3A 3T4AC 3D3RA 3T56B 4WORA 3HOVB 3P7JA 5IT9E 1RF2D 4HMIA 4XTCS 1LTGD 1J8IA 4K5XA 2QF7A 4J8QA 1PRTB 2CW0C 1CFMA 1CA6A 1G8ZD 3A55A 4OL7A 3H6MA 1LACA 5I9OA 1G6ZA 4HAEA 2HDMA 5FKAC 2JA7B 1EU4A 2AUJD 4HEDA 1EIHA 5K36H 5C6AA 1S5ED 1SJED 4A3EB 2XN9C 2PMZB 4K8IA 3D6CA 3TP7A 1SBBB 1CI3M 1G91A 4A3DB 2B8FA 2KHSA 4TKOB 3BYYB 3C1FA 3C1EA 1SYEA 3D31A 5CGKA 3C3LA 4MN3A 1AFPA 4PMWA 5M5YB 1WTXA 4C1NK 2EOTA 1KLUD 3A54A 1B44D 2F0WA 4H44C 2H1EA 2F0VA 4A3BB 2ZXPA 2BE5C 2DN8A 3JAME 3NTKA 3VR5A 4MIUA 3BVGA 1D5MC 2KA7A 3KLSA 1CA5A 1KNEA 2L1BA 1STNA 1I6HB 1IKMA 4PMBA 2AUKA 5KEEA 1JWMD 4A3MB 3SEBA 2K5QA 2KUMA 4K8JA 3M7NA 2K5WA 1PRTF 2AWOA 5G3LD 4BBRB 1D5XC 5EKKA 1BQQT 2NWGA 3VYUA 2VNUD 1VMCA 5FLXL 1GHKA 1SMYC 2BA1A 2I07B 2NVYB 1Y69U 1C48A 3SK4A 5IGBA 1ENAA 1RCVD 1U4LA 2KQ3A 1EEFD 2JP1A 2LFNA 1IHZA 2BA0A 4KHZA 1WVLA 3RUZA 5EPLA 2A69D 3BG3A 1O78A 3SK8A 1OXUA 1FNVA 1B1ZA 4Y7NB 1CQVA 1TWCB 5I4DA 1GXDC 5AFWA 3PMFA 2L55A 3Q23A 4FF4A 2LMCB 1Q1BA 5CYUA 2F0KA 1F2LA 1S5DD 1T5XD 1PRTD 4C1NI 4XQQA 4N9TA 1STYA 5E4XA 1IL8A 3OW7A 5IGGA 3DHQA 2XNAC 2FHTA 4K2KA 1GUGA 1Y8NB 5ELCA 5CORA 3C46A 1YNNC 2QDBA 2IX1A 1SYGA 4A3GB 4J1MA 1VF7A 1Q1EA 3IAYA 3E6ZX 3NTHA 1TS3A 5FO7B 2WKDA 1SNOA 4B9XA 4DK0A 3R3OA 1W6KA 1SNCA 1EY4A 2O5IC 4ZKCB 3HOWB 2TMPA 4ZKBB 1KTKA 1B2TA 1V1PB 1A2UA 4BS9A 5CV8A 1EYCA 3K57A 4QF4A 1HXYD 1AW7A 1F9PA 4HSPA 2A6HD 3K5NA 2RQXA 5JOBA 3DEPA 3K5OA 1FNWA 5C0XJ 2CHBD 3BZDB 2ID0A 1O80A 2TSSA 3A56A 2NN6H 1SNPA 1LV9A 3RLFA 3D8GA 2KVMA 4RA8A 4EQPA 3MXNA 3F2UA 5JEAH 1YNJD 4XYOA 2SDFA 4KN4C 2NBFA 5I9PA 2A6ED 3O13A 1QJOA 5C5MA 1D2BA 2DNEA 3DWQA 1KAAA 2PCFB 1LT6D 3I73A 5EGTA 1DM0B 1AZQA 4FXDA 4IUQA 2MPMA 4K5VA 4OHJA 4KY5A 3QOJA 2G9HD 3EVQA 3M4YA 3NPPA 4BY7B 2B2VC 1CQFA 3FPPA 1SXTA 3L7ZC 4KTAA 1EY5A 4KMUC 2PQEA 1WTVA 4B08A 3PUZA 3D4DA 4CKEA 4LJZC 3PO3B 4FF1A 2HDLA 5D14A 3BYTB 1VDZA 2IT1A 2M00A 5J22A 3WOFA 5IGFA 2ZXOA 4G7HC 1BO0A 1H9SB 4KKTA 1ZYRD 1RD9D 4NKLA 2WP8J 4L6TB 1GUNA 4EGVA 1HQMC 5DM63 1SYDA 4RFBA 2Z4HA 4ZUJA 4A3JB 2E74C 3H3VC 4H13C 1F2MA 1BBXC 5EKLA 3KLRA 2NVXB 1BNZA 3ITPA 4K2LA 4KY6A 5DNFA 3SHLA 3OMCA 3N52A 3NSWA 4WRDA 5CC4A 2SNSA 1DD2A 2D5DA 2CW0D 1Q12A 3GTPB 1Y8OB 4NW2A 3I91A 2LY7A 1I4RA 3EFXD 1SE2A 2IW3A 1TS2A 2O4XA 3FVQA 3H09A 2F0JA 1GUSA 4O42A 1RJTA 3M85A 4IUUA 1CZGA 1M4VA 3NBHA 1EWCA 1PZID 2K33A 2NYZD 2L9HA 3LWUA 2MHVA 3EA6A 3TP5A 3J81L 2FMMA 1LTSD 3WOEA 1GJXA 2KCCA 2B2UC 2F0DA 2WACA 1CHPD 3CRKC 2EYFA 1IW7C 2R93B 2B2TC 2BE5D 3ZYYX 1O7ZA 2GA4B 4RCNA 3BVZA 4G7ZC 3NWSA 1PLFA 2EJGC 1STHA 3LNNA 2JSOA 4K6LA 1NCVA 1JCKB 1KDCA 5ELBA 3R93A 4P2CB 1QB5D 2JEAI 1C4QA 5KYLA 4OIJA 3S9WA 3T13A 4ZAIA 1DOLA 2O5JC 1EY6A 1Z7TA 3CU7A 2NZ1D 2XRQD 1JC7A 2HCCA 1TY2A 1SMYD 2F4IA 4OGQC 4OO1I 4XT1B 5D3IB 1RKNA 3GTQB 5I2YA 1ZYRC 4EQOA 4DAPA 1OXVA 2NVQB 2EYOA 4LMQD 4DAVA 1UUPA 3NBIA 4G4KA 4J6HA 4LAAA 1ONLA 3I70A 3U9SA 1Z47A 4M8AA 2R92B 4FYDA 2R6GA 4A3IB 1Y8PB 1ML0D 2IX0A 1GUOA 3HOXB 1RODA 3G7LA 2VB3X 5LL6S 2EJMA 3MAQA 3DMUA 1S5CD 5CBEE 3PIP3 1FNUA 2IWHA 1A3TA 3ND9A 3EQLC 2QEJC 3I4MB 3HRZC 1ENCA 4XDXA 3E5SA 1EY8A 3NK9A 2F0SA 4KD3A 3S1NB 2EY5A 4K14A 3GO5A 1B3AA 3GTMB 1BF4A 1QNKA 2J4XA 3N6RA 1YNND 2K28A 1C8CA 4RHSA 4GZYC 2XWJB 1RDPD 2Q8TA 4KD4A 1IYUA 4DNRB 1F9RA 3DXJC 4CHTB 2EYLA 2EYJA 2C5CA 3OSOA 5IGEA 5KYIA 1SFOB 1HPCA 1ZKOA 2WKCA 1HA5A 3P75A 4C3JG 3QJYA 3X3MA 5KRUA 4BY1B 5M3FB 1G2TA 1MSGA 1A3VA 1BUVT 1NSNS 3TDQA 4FNFA 1EYAA 2F0QA 2B2WA 5M3MB 1KDBA 3OOCA 2AQ3B 5CV9A 1XWEA 5M9OA 1I6VC 3PUVA 5KIXA 1I4QA 3D4WA 3T51B 5E1FA 5C0XI 3K0YA 2F0LA 1CZWA 1X3QA 1STBA 1EY9A 1KABA 1S4ZA 2H4OA 2L12A 4DN4M 3K5LA 1D6EC 1PFBA 1SE3A 3K7AB 4KV6A 2LS01 4A93B 1NR4A 1CT1D 3Q22A 1HTPA 1PFMA 3Q6SA 5DEHA 3H0GB 5F2DA 1EY0A 4U68A 1SDFA 1G2SA 5K5PA 3RZDB 4IUNA 1R9TB 5JPMC 3I8ZA 3HOZB 3QWNA 4X3TA 4RAUC 4IUPA 4IUTA 2F0OA 1FD7D 3Q24A 3R2IA 2CQAA 5EBDA 1HA6A 2XWBB 3IFDA 3P1HA 4E6IA 3J80L 4CJ0B 3OMGA 1CM9A 3TP8A 4CJ1B 3HOUB 2XIWA 2B39A 2K03A 2XVSA 4IQZA 3MXPA 1CTMA 1LABA 3QG1A 4DXGA 1WD1A 2MUYA 4C56C 5FLXE 5FO8B 2AQ1B 5A35A 3S17B 1TIID 4L63B 4JBWA 4DF7A 1B9MA 4V0BA 1TT2A 3I90A 3PUXA 2F0UA 2X6LA 4IFDI 5CV6A 1DOKA 4KN7C 1SJHD 3MHBA 2IX3A 4TRDA 4BA2I 5A2QL 4HCEA 3VR6A 2EYMA 3V96A 4Q5VA 2RDFA 5JVG3 5CR3A 3L9AX 3RD4A 1Q3LA 1TU2B 2Z8LA 3DM1A 3PIO3 1STAA 1FGBD 3NXWA 5EPJA 1LTAD 2R61A 4ZQ3A 3IKJA 3NQTA 3NUCA 1HUNA 2FINB 2JE6I 1J9OA 3MFYA 2WV6D 1JOKA 3GTOB 1A2TA 2V4DA 3MWYW 4ZUIA 3SK6A 3SXHA 2E2JB 2D9UA 3T53B 4HN7A 2WINB 1H9MA 1Y1WB 1K83B 1EL0A 1TVXA 1QCBD 4FVMA 3U9OA 1EWHA 2KECA 4OO1G 3DUZA 5A2QE 2CVRA 4ZLTF 2K1BA 1L0XB 3NTIA 4U673 4PV1C 3S1MB 1IW7D 3CQZB 1X32A 4KKUA 3A8KE 5TSSA 1EZ8A 2JA5B 3W3AA 3I3CA 2B63B 4IUVA 1MI2A 3I72A 3TSSA 3OHXC 1WD0A 4QUCA 3UI2A 4HTHA 2EY2A 3S16B 1V8QA 3AU7A 4FF2A 2ZT9C 3SE0A 2FMCA 2F0GA 3HZXA 4R8IA 2VXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYE A;  3LX0 A;  2RKS A;  5KGU A;  1STH A;  4ZQ3 A;  1JOQ A;  4EQP A;  2EY6 A;  3NQT A;  3TME A;  3NUC A;  3PMF A;  5CGK A;  3SK5 A;  1F2M A;  2PZT A;  4IZ8 A;  4K5W A;  4DU9 A;  1JOK A;  1NUC A;  2F0O A;  4YIJ A;  5EKL A;  2F0K A;  1A3U A;  3ITP A;  5I9P A;  4K2L A;  3OWF A;  5E3F A;  1A2T A;  5C5M A;  4H7B A;  3MZ5 A;  4ID6 A;  4ZUI A;  3SK6 A;  2F0I A;  3SXH A;  1JOO A;  2NUC A;  1KDC A;  2F0N A;  4KY6 A;  1SYF A;  5HUR A;  3T16 A;  3SHL A;  1KAA A;  4KD4 A;  5IGD A;  5KYL A;  2RBM A;  4N9T A;  5C4H A;  3T13 A;  3S9W A;  2F0W A;  3P1H A;  3V2T A;  1EY6 A;  3OMC A;  4DFA A;  5EGT A;  4E6I A;  1STY A;  3ERO A;  2F0V A;  3OMG A;  2EYL A;  2EYJ A;  2ENB A;  2F0T A;  2F0E A;  2EXZ A;  1EYD A;  3OSO A;  4WRD A;  2F0P A;  3TP8 A;  1F2Y A;  5IGE A;  5CC4 A;  3VA5 A;  2EYP A;  3NHH A;  5IGG A;  5KYI A;  3NP8 A;  1KDA A;  2SNS A;  3BDC A;  3DHQ A;  1SYB A;  4K5V A;  4MIU A;  3MEH A;  3P75 A;  5JAV A;  4NDX A;  4KY5 A;  5IOD A;  5KRU A;  3QOJ A;  4K2K A;  4PMC A;  1F2Z A;  1TR5 A;  1RKN A;  5DAU A;  3MXP A;  1STN A;  1SNM A;  3U9O A;  1A3V A;  2QDB A;  4EQO A;  4PMB A;  1SYG A;  5KEE A;  5CV7 A;  4J1M A;  2SNM A;  3EVQ A;  4K8J A;  2F0F A;  1NSN S;  5IOC A;  1EYA A;  3EJI A;  2EYO A;  3SR1 A;  2F0Q A;  4NP5 A;  4ME5 A;  5ISR A;  4HMJ A;  2O4X A;  1KDB A;  4NMZ A;  4RKL A;  2F0H A;  4G57 A;  1SNO A;  1U9R A;  4B9X A;  4J6H A;  4LAA A;  2F0J A;  5CV9 A;  4KTA A;  2PW7 A;  3R3O A;  5EKK A;  4DF7 A;  4KHV A;  5C3X A;  1JOR A;  1TT2 A;  1SNC A;  1EY5 A;  1EY4 A;  2F3V A;  5M9O A;  1EY7 A;  4K6D A;  3QB3 A;  4KJN A;  2EY1 A;  2PQE A;  2LKV A;  5KIX A;  4WOR A;  4QB4 A;  3D4W A;  4DGZ A;  1EZ6 A;  2F0U A;  4I65 A;  4HMI A;  3D4D A;  5IGC A;  5E1F A;  3TP5 A;  5J1Z A;  5CV6 A;  2SOB A;  4K5X A;  1A2U A;  1EZ8 A;  5I6W A;  2OF1 A;  2OEO A;  4S3S A;  1TQO A;  5CV8 A;  4EQN A;  5J39 A;  2M00 A;  2PZU A;  1EYC A;  3MVV A;  5CV4 A;  5J22 A;  2F0L A;  3MHB A;  4ODG A;  4OL7 A;  3H6M A;  1AEX A;  4QF4 A;  3SK4 A;  4F8M A;  5I9O A;  5IIF A;  1ENA A;  5IGB A;  5NUC A;  3TP6 A;  1STB A;  1EY9 A;  1KAB A;  3DMU A;  5HGT A;  2KQ3 A;  2F0D A;  2F3W A;  4N9P A;  2WAC A;  4TRD A;  4HTH A;  2EY2 A;  1IHZ A;  4NKL A;  4IAL A;  4R8N A;  5C5L A;  1EQV A;  1A3T A;  1SNQ A;  3HEJ A;  4QMG A;  5JOB A;  3RUZ A;  2EYF A;  2EYH A;  4KV6 A;  4KY7 A;  1SYC A;  3QOL A;  5C6A A;  2OXP A;  1SND A;  2F0M A;  2EYM A;  4PNY A;  4B9W A;  4K8I A;  1SYD A;  1ENC A;  2PYK A;  4EVO A;  3D6C A;  5DEH A;  3E5S A;  3TP7 A;  5CV5 A;  4RKB A;  5IGF A;  1EY8 A;  1STG A;  1EY0 A;  2RDF A;  5F2D A;  5C4Z A;  3NK9 A;  1II3 A;  2F0S A;  4KD3 A;  2F0G A;  3SK8 A;  4KJO A;  3HZX A;  3BDL A;  4F7X A;  4ZUJ A;  5C3W A;  2EY5 A;  2KHS A;  2PW5 A;  3NXW A;  2PZW A;  2HQE A;  4K14 A;  3C1F A;  5CR3 A;  5K5P A;  1SNP A;  5I6Y A;  1STA A;  4IUN A;  3D8G A;  3C1E A;  3ERQ A; 
#chains in the Genus database with same CATH topology
 1EIG A;  1IBM L;  2DY8 A;  5C4J B;  2E76 C;  2LXK A;  1Y14 B;  1DXM A;  4QGU A;  5BR8 L;  3G71 A;  3K58 A;  3OPO A;  2Z4I A;  1H9K A;  3CHB D;  4K5W A;  4DU9 A;  3QR8 A;  2HIV A;  2WAQ E;  5C44 B;  5AJ3 L;  3J7Z C;  2B2Y A;  1HNZ L;  1V1P A;  3VDY A;  3S1Q B;  4IFD J;  2HUG A;  4PQX A;  3ND8 A;  3I56 A;  1ESR A;  3E9H A;  3HKZ B;  4DUY L;  1LT4 D;  1DCZ A;  3I2Z A;  1EUJ A;  1I3Q H;  1SFO H;  3NHH A;  5FJ8 H;  2RF4 A;  4FO2 A;  5EAY A;  3MEH A;  5JAV A;  3KOJ A;  1YIJ A;  4LF7 Q;  3KDF B;  4BY1 H;  3W1G A;  2N78 A;  5M3F H;  4X3U A;  2CCZ A;  2E5L Q;  2UUC Q;  2D2C C;  4R9W A;  3GV3 A;  1T5E A;  5GAH C;  5C3E B;  2EVB A;  4C3H G;  1HZA A;  2M2L A;  4HIO A;  1K8G A;  2DJF C;  3TZD A;  2IPK D;  3D6W A;  4LF5 L;  4ME5 A;  3ULJ A;  1EYG A;  3OWE B;  4YWL A;  5HY6 A;  1G6P A;  2KEE A;  5IWA Q;  2F3V A;  4GS3 A;  1D1I A;  3MA2 B;  4K6D A;  1STE A;  1GUT A;  2EY1 A;  4KLK A;  1HFG A;  1EZ6 A;  2JEB I;  1C0A A;  1QG7 A;  2WB1 B;  1WCM H;  4RH6 A;  1O7L A;  3UDF A;  3KF8 A;  2CH4 A;  5HGQ A;  1A62 A;  4L8J A;  4AH6 A;  5ELF A;  2XRS D;  3HKS A;  1G29 1;  3MVV A;  5CV4 A;  5D3D A;  5C0X G;  3NWT A;  1H9J A;  4F8M A;  5IIF A;  1FVI A;  4BBS B;  5LHY 1;  5H1S E;  3GTK B;  4DV3 Q;  4AYB B;  4N9P A;  1TWH B;  1VQL A;  2K7V A;  1KD1 C;  3FRP B;  3K7A H;  1BDO A;  1VQ5 A;  4A93 H;  4RGM A;  1DZ1 A;  3GP7 A;  3AQQ A;  3VR4 A;  4A3K G;  2PNR C;  2F1M A;  1BOS A;  4EVO A;  1JT8 A;  1TWF B;  1ESF A;  3HFZ B;  4JI3 Q;  4KJO A;  4XT3 B;  3Q0A A;  1XNR Q;  3BDL A;  2MJ8 A;  4DUZ L;  4X62 L;  3BZC A;  4LNQ A;  2K6A A;  1R9T H;  1X9N A;  1TWA B;  1XTC D;  2KCN A;  4JI2 Q;  3UDG A;  4R4O A;  1QIL A;  3H94 A;  4B3M Q;  3S15 B;  1WTR A;  3U50 C;  4IZ8 A;  3Q8D A;  5L37 A;  1U4M A;  3V05 A;  1G51 A;  4HSV A;  1BKB A;  3TQY A;  1VCI A;  4ID6 A;  1BR9 A;  1WTH A;  4DAM A;  4DFA A;  4A3F B;  2HHH Q;  2Z9H A;  1VS0 A;  3VYR A;  3J80 c;  3CC4 A;  3HOU H;  1UEA B;  1H9S A;  4A3D G;  1IXR A;  3D4R A;  3J80 i;  1KDA A;  1SYB A;  2QW7 A;  1XMO L;  1A8V A;  1BCP C;  4F88 A;  3KLW A;  5KNC A;  4HIK A;  1F9S A;  1I4P A;  5IP7 H;  5T1G A;  4B3R L;  4R4T A;  1SNM A;  2X69 A;  1PTO B;  3A7A B;  5D65 A;  1HUM A;  1O7Y A;  2F0F A;  3UDX A;  4QCL A;  2QKI C;  2KCM A;  2ZJP A;  1TWG H;  4XXE A;  5ELD A;  1PV4 A;  2F0H A;  2SEB D;  4CJ2 C;  2PW7 A;  3J81 E;  2YYZ A;  1EY7 A;  3QB3 A;  4ZRZ A;  4DGZ A;  2WII B;  2UU9 L;  1HQR D;  1PMR A;  2K14 A;  4KK7 A;  1EEI D;  2SOB A;  1IKL A;  1SRU A;  3OIP A;  1W6J A;  1U4R A;  1EU3 A;  4K0K L;  1Q90 A;  4C3J H;  3KJO A;  4IFD G;  5IT9 L;  1MSH A;  2EZV A;  4LUZ A;  2LSS A;  3TP6 A;  4HJ9 A;  1F77 A;  5M5X H;  4DXF A;  1JR0 D;  4FF3 A;  5JJZ A;  3HS0 C;  1B9N A;  4ABN A;  4BBR G;  2N88 A;  3HG9 A;  4C3H B;  4A4I A;  2A68 C;  2K5D A;  5EBC A;  5EKI A;  4CDF C;  2UUB L;  2EYH A;  4RHR A;  5IYB H;  2JYO A;  1ZXT A;  4L5R C;  4KHP Q;  4RKB A;  1E7Z A;  2J0T D;  1QOH A;  1OO9 B;  1UNS A;  1II3 A;  4DK1 A;  2A73 B;  4F87 A;  1YI2 A;  3FKI B;  1MGS A;  3AB9 A;  5C3W A;  1M8A A;  4LF9 Q;  2Y0S E;  2KCT A;  1KRT A;  5E7N A;  4DR7 Q;  4XQN A;  1D8L A;  3GD7 A;  1L1O B;  2J7Z A;  2C35 B;  4GOP B;  1R4P B;  2PZT A;  3KUP A;  1A6X A;  1FL0 A;  1MKH A;  1MIU A;  3HOY G;  1TKW B;  3GTJ B;  3GTO H;  4DR1 L;  1PHJ A;  2IL8 A;  2E2J H;  2NUC A;  2F0N A;  3P20 A;  1PTO F;  2NTS A;  4LF4 L;  5IGD A;  2KHJ A;  1SN8 A;  4ULL A;  3TRE A;  2EXZ A;  1CKO A;  1F2Y A;  3M4P A;  3KK7 A;  3VA5 A;  3BDC A;  2AQ2 B;  4A3K B;  4LW1 A;  3PUW A;  3VR2 A;  4G7O C;  3GTL H;  1K83 H;  2R7F A;  4NDX A;  2A74 C;  3IL8 A;  3KBG A;  1X55 A;  3TBI B;  3BDO A;  1F2Z A;  5C4X G;  1LLR D;  3E9I A;  2ZJR A;  4DR4 L;  3CMA A;  1PVO A;  2M9V A;  3JAM L;  1PH9 A;  5IOC A;  2ATW A;  3T1Y L;  3EJI A;  2NN6 I;  1VQO A;  5FK9 C;  1N9W A;  1VMP A;  1JQY D;  1I3Q B;  3S1M H;  1TS4 A;  5G3L F;  3M4O H;  1D1K A;  3HKZ E;  3CQZ H;  4LFC Q;  5FOB B;  2K4K A;  1F9Q A;  5JVH 3;  2Q8I B;  1WTW A;  5J1Z A;  4C3I G;  2VB2 X;  2EPB A;  4IJL A;  4ZYS A;  5I6W A;  2OEO A;  4S3S A;  2I46 A;  4GNX A;  1TQO A;  5J39 A;  4NXM L;  4R4C A;  5KND A;  1QE6 A;  4LUO A;  4A3G G;  1CK1 A;  1GHJ A;  3QIA A;  4PG3 A;  3S14 B;  4ODG A;  4Y52 H;  1A15 A;  1AEX A;  2L11 A;  5BN4 A;  1E2W A;  1HZB A;  1WTQ A;  2F3W A;  4JC0 A;  4N8F A;  2Q2U A;  1K8O A;  4EX5 A;  2Z1C A;  4R8N A;  1O7I A;  1EQV A;  3HEJ A;  1PFS A;  2AKW B;  2NVT B;  5IYC H;  1PTO D;  2A19 A;  1SND A;  1L0W A;  5JJK A;  1WCM B;  3JC6 6;  3CC7 A;  1JOQ A;  4UHV A;  1STG A;  3TRZ A;  2RCN A;  2WB1 E;  1EFI D;  2BH8 A;  1I94 Q;  2FJ2 A;  1PFN A;  2WAQ B;  5CBA E;  2XSC A;  1SE4 A;  5IP9 G;  2E2I B;  3EN2 A;  4LFA L;  2DY7 A;  3KBX A;  2B29 A;  5C44 H;  1A3U A;  5E3F A;  3KLS X;  4XIG S;  2RDG A;  3S1Q H;  1B4O A;  1SYF A;  1S72 A;  2XTI A;  1K0S A;  2UUA L;  5LL6 X;  1YHA A;  3J7Y W;  3V2T A;  4YWK A;  5FO9 B;  3ERO A;  2ENB A;  2WFW A;  2B2V A;  3MXG A;  1B50 A;  1K9M C;  3MTS A;  2YU9 H;  1ET6 A;  1CSQ A;  4MHE A;  1ZEQ X;  4JW0 A;  1W3S A;  3K81 C;  4DNT B;  3PV0 A;  5CV7 A;  3R8B A;  5C3E H;  3R2T A;  4JK1 C;  1RTN A;  2RSN A;  4IN3 A;  2OTJ A;  5K36 G;  1JMC A;  1SEB D;  1OXX K;  1JIC A;  3U4Z A;  1VQD A;  1HTL D;  5JPN C;  1HNW L;  3H3V I;  1KC8 C;  2H5X A;  1PH7 A;  1BCP B;  4PZ6 A;  3MXN B;  1XJV A;  3HOY B;  4BXX G;  1NTG A;  1CUK A;  2N49 A;  1LTL A;  1K8M A;  3E0E A;  4DV4 Q;  3MEF A;  3I4N G;  3I4O A;  3PO2 G;  2PO4 A;  3A8J E;  1A63 A;  1GUW A;  2PQA A;  2OF1 A;  2NTT A;  3CAM A;  2DGY A;  1S5B D;  2R7Z G;  1I4G A;  1TWG B;  4UDU C;  5COY A;  4BBS H;  5HGT A;  4JBK A;  5C4X B;  3GTK H;  1TWH H;  4I7A A;  4DA2 A;  1IBL L;  4OO1 H;  1HZ9 A;  3M4Q A;  4MTK A;  4DV1 Q;  2K50 A;  1XMQ L;  4V19 0;  4JPB W;  2NZH A;  2F0M A;  3MXU A;  3H91 A;  4B9W A;  1I4X A;  1HJP A;  4QIW E;  2OWO A;  2DNC A;  1ILQ A;  1HRJ A;  1YEZ A;  2JA8 G;  3GTG B;  1EWI A;  1MBY A;  4C3J B;  3H15 A;  1NR2 A;  2BCO A;  5M5X B;  2MP1 A;  3U4V A;  3TME A;  2N3S A;  4C3I B;  3SK5 A;  2L0C A;  3RZO H;  3RMH A;  2CH4 W;  3J80 E;  2ICI A;  1NUC A;  4H0L C;  2O2L D;  3U58 A;  4LF8 L;  5LMU L;  5JEA J;  4KKS A;  3TZU A;  2QIL A;  1JE4 A;  1VQK A;  1BXT A;  3W2D A;  4UY8 C;  3T16 A;  3A5U A;  2RCF A;  4NPS A;  3MFG A;  1JJ2 A;  4A3F H;  2VQE Q;  2F0T A;  1FR3 A;  3MC0 B;  4RGO S;  2EYP A;  3NP8 A;  1U4P A;  1BCP F;  1FYC A;  2R3Z A;  2HT1 A;  4XQJ A;  4XYQ A;  2HCI A;  4PMC A;  1YHB A;  2N55 A;  3GV6 A;  3K6O A;  1WOC A;  2VUM H;  3F2B A;  4IUR A;  1PTO H;  4GLV B;  1V1O A;  1XYI A;  3S2D B;  1PTO C;  1N32 Q;  3SR1 A;  1OXT A;  4NP5 A;  1XXG A;  5EPK A;  2A8V A;  3VYT A;  2JXM B;  2B2U A;  2D0O A;  5EQ0 A;  1HZC A;  4KJN A;  3GTL B;  2LKV A;  1PYW D;  4QB4 A;  2K01 A;  1N36 L;  4I65 A;  2Z0S A;  2L4N A;  1KNA A;  5IGC A;  2QCP X;  1X3F A;  4JG2 A;  3J7A V;  1EQR A;  1XX8 A;  2B2T A;  1VQE A;  4CBV A;  3VYS A;  3FDT A;  2PZU A;  3A8I E;  5LMN Q;  4QUF A;  2RVL A;  2B2W C;  3BJU A;  3C2P A;  2JA6 G;  1LTT D;  2UXC Q;  4RMF A;  1WJJ A;  2AWN A;  1UAP A;  4JV5 Q;  3ONA B;  1X3P A;  1VQI A;  1I50 B;  1QZG A;  2Q8R E;  4FXK C;  4IAL A;  4DV5 Q;  3GQB A;  1JWS D;  3M4O B;  4LF6 Q;  4C3H H;  1NE3 A;  2RSO A;  1V9P A;  3KF8 B;  3FEW X;  1LTB D;  2Y0S B;  4DV6 Q;  5T1I A;  4R4I A;  5C4Z A;  4AIM A;  3DEO A;  2EDG A;  3I4N B;  1BCP D;  2PMZ E;  5I6Y A;  2E5L L;  4UAI A;  4YIJ A;  3ERQ A;  3PO2 B;  3LX0 A;  5DM7 3;  4ZK9 B;  4HR7 B;  2EY6 A;  1YIT A;  2UXB Q;  4IJH A;  1L1O C;  3OTO L;  3ULL A;  4LFB L;  4TQU S;  5C0X H;  3GTJ H;  3LWE A;  3PCO B;  2R7Z B;  3OWF A;  4JOI A;  2ZXR A;  4P74 A;  2F0I A;  5HUR A;  3K59 A;  5IYD G;  1KLG D;  1EQQ A;  4DR2 L;  4DR3 L;  2A69 C;  2VUM G;  4JVZ A;  4RGT A;  1Z6H A;  2F0E A;  3PUY A;  1DJR D;  4A3K H;  2BDO A;  3VA7 A;  4R1J A;  2Q2I A;  3TN2 A;  2JA8 B;  3IFT A;  1PH6 A;  3DWP A;  2CFM A;  3FP9 A;  2JK8 A;  1HCZ A;  1J5E Q;  3EIV A;  1WTP A;  4X3S A;  1SAP A;  4JYA Q;  3JAM c;  4A3C G;  1PRT C;  2LXJ A;  4NXN Q;  1NMG A;  1Q8I A;  4C2M B;  3JAM i;  1VQF A;  2I5L X;  4RKL A;  4NMZ A;  4JI1 L;  5C4H A;  2A68 D;  3CRL C;  1Y1V G;  2KED A;  1JOR A;  2K32 A;  3CXC A;  1EQT A;  2NN6 G;  1P8L A;  2IJ0 A;  2RDH A;  2YU9 B;  4RGN A;  4DKA C;  2V1C C;  4OEL B;  1PDQ A;  2L5T A;  1LT5 D;  3L2P A;  1PH2 A;  3FMC A;  3QO2 A;  5JEA G;  1IL2 A;  4A3D H;  3AMU A;  4GN3 B;  1H95 A;  4WJW A;  3RNU A;  2VW9 A;  4DV0 Q;  4Q0F A;  3S14 H;  4KI0 A;  3L3O C;  4BA1 I;  2Z6K A;  4UPA A;  1LT3 D;  1B53 A;  3OIQ A;  3M7G A;  1PH1 A;  1K28 A;  1SSO A;  1E2V A;  1L0Y B;  2NB0 A;  1HR0 W;  1CKN A;  5C5L A;  2F03 A;  5M5Y H;  2B3G A;  1Q8K A;  4ILW A;  1SNQ A;  2F4V L;  3CD6 A;  1PZK D;  2MGS A;  3UE1 A;  2NVT H;  3M3Y B;  4KY7 A;  2HHH L;  1SYC A;  3QOL A;  4DAY A;  3NE5 B;  4CKB A;  5M5W B;  5J3B A;  2PYK A;  1VQP A;  4FXG C;  1NAP A;  5CV5 A;  2R92 G;  3NQI A;  4DR6 Q;  3E0J A;  2MFI A;  3SDZ A;  2PW5 A;  1QNU A;  2PZW A;  2YTX A;  4A3B H;  2EE1 A;  1KRS A;  3T1H L;  2E75 C;  1Q46 A;  5KGU A;  3DWA A;  3S2H B;  1HFN A;  1LO5 D;  2PI2 E;  3FPU B;  4M1U B;  2E2I H;  1GD7 A;  1TS5 A;  1I6H H;  1AN8 A;  1E24 A;  2N8N A;  4IFD H;  2B8G A;  1IBM Q;  2JA6 B;  1IYV A;  3MZ5 A;  1JOO A;  2A6H C;  3HOV G;  3K5M A;  3CCV A;  5BR8 Q;  1UWV A;  2BOS A;  2D62 A;  1EIY B;  1ICW A;  4B3T L;  2K04 A;  1R4Q B;  4BBR H;  5AJ3 Q;  4RCO A;  1ENF A;  1FJG L;  2YTY A;  1PYS B;  5KNB A;  1PXU A;  4DNI A;  1VF5 C;  4DUY Q;  3RZO B;  4WFN 3;  4FP5 D;  2G9D A;  3KFU A;  1AE3 A;  5DAU A;  4YY3 L;  2JA7 G;  4APV A;  2IHE A;  2VL6 A;  2D0P A;  1CHQ D;  1YNJ C;  4UP7 A;  1YJ9 A;  3BVM A;  2K05 A;  2GVA A;  5CMD A;  2A6E C;  4DK3 C;  4A3E G;  5ISR A;  2I5M X;  5E4W C;  1E1O A;  1LTI D;  1U9R A;  2RA4 A;  3HOY H;  3BS1 A;  1N33 L;  3I4L A;  1EFW A;  4LF5 Q;  1D7Q A;  3K0X A;  2BDN A;  5BN5 A;  1PYB A;  1HHV A;  1JE5 A;  1I4H A;  1E0B A;  2VUM B;  3URY A;  1DON A;  1WTO A;  5ELE A;  4EQN A;  1Q81 C;  2FFK B;  5BN3 A;  1AZP A;  1DOM A;  3HGB A;  5NUC A;  2QDL A;  4R4Q A;  5C4X H;  4QJF A;  1ILP A;  1GOZ A;  2C9O A;  4RWS C;  4QIW B;  2KOL A;  4A3B G;  4I7Z C;  1DGS A;  4QMG A;  3KDF A;  4O1N A;  1X54 A;  1JWU D;  2OXP A;  3J7A F;  1AP0 A;  3WDN A;  4PNY A;  1OXS C;  4GKJ L;  4HJ7 A;  4N8X 1;  1DYQ A;  2EJF C;  1Y1V B;  1PH8 A;  1E2Z A;  2A5H A;  4F7X A;  3GTG H;  2HQE A;  1KIX A;  4TSS A;  4A3M G;  3X3N A;  4CKC A;  1EOT A;  1S5F D;  2RKS A;  5JJI A;  4C3I H;  5EJW A;  3SVM A;  4X3K A;  1W2B A;  4IOC A;  3BU2 A;  1EIF A;  1IBK L;  2X6G A;  2OT2 A;  1RTO A;  4DUZ Q;  4X62 Q;  3ER0 A;  4CGY B;  1RL2 A;  4A3G H;  4O2D A;  4H7B A;  3HP3 A;  2ICE C;  2E2D C;  1AH9 A;  1D5Z C;  3G6J B;  4OIK A;  2RBM A;  1TY0 A;  2E2H B;  2RHQ B;  4LK1 C;  4HIM A;  4BWG B;  1ET9 A;  1E3P A;  1EYD A;  1H9R A;  4HCS A;  2F0P A;  1VQ7 A;  1LTR D;  1QWY A;  3CKI B;  1PZJ D;  1JB3 A;  3RLN A;  5IOD A;  1V43 A;  3S1R B;  1TR5 A;  4Z9C B;  5I2X A;  4X64 L;  2B2Y C;  1XMO Q;  2PPB C;  2SNM A;  2KJX A;  2GVB A;  3S2D H;  5IP9 H;  4HMJ A;  1MD2 D;  4G57 A;  3F1Z A;  5C3X A;  1RHP A;  4KHV A;  3K8A A;  3A7L A;  3VR3 A;  3T4A C;  3D3R A;  3T56 B;  4AQY L;  1P16 A;  3A5Z B;  4WOR A;  3HOV B;  3P7J A;  5IT9 E;  1RF2 D;  1LUZ A;  4HMI A;  4X66 L;  1I5F A;  4XTC S;  1LTG D;  1I94 L;  1J8I A;  4K5X A;  2QF7 A;  4J8Q A;  1PRT B;  2ALY B;  4DK6 C;  2CW0 C;  1CFM A;  1CA6 A;  2UU9 Q;  1G8Z D;  3A55 A;  4OL7 A;  3H6M A;  1LAC A;  5I9O A;  1G6Z A;  4HAE A;  2HDM A;  5FKA C;  1I50 H;  2JA7 B;  1EU4 A;  1GKH A;  2AUJ D;  4GKK Q;  1E22 A;  4K0K Q;  4HED A;  2VQF L;  1AE2 A;  4YCV A;  3F2D A;  1EIH A;  5K36 H;  5C6A A;  1S5E D;  1SJE D;  2PQA B;  3M9B A;  1IZ6 A;  2XN9 C;  4A3E B;  3KF6 B;  2PMZ B;  4H02 A;  4K8I A;  3D6C A;  3TP7 A;  2ZM6 L;  1SBB B;  1CI3 M;  2Q2H A;  4BXX H;  4A3D B;  1G91 A;  2B8F A;  2UUB Q;  1QZH A;  2QGQ A;  2KHS A;  3DLL A;  1E1T A;  3I4N H;  4TKO B;  3BYY B;  3C1F A;  3C1E A;  3PO2 H;  1SYE A;  3D31 A;  4IPC A;  4HJ8 A;  5CGK A;  3C3L A;  1LYL A;  4MN3 A;  1AFP A;  4PMW A;  5M5Y B;  4JI5 L;  1WTX A;  2R7Z H;  3PF4 A;  1TXY A;  4C1N K;  4CDC C;  3HOW G;  2EOT A;  2K52 A;  1KLU D;  3A54 A;  1B44 D;  2F0W A;  4H44 C;  2H1E A;  2F0V A;  4DR1 Q;  2FXQ A;  1VQB A;  4A3B B;  2ZXP A;  2BE5 C;  2DN8 A;  4DR5 Q;  3JAM E;  3NTK A;  4LF4 Q;  3VR5 A;  4MIU A;  3BVG A;  1D5M C;  2KA7 A;  3I55 A;  4P73 A;  3KLS A;  4MZ9 A;  3G48 A;  1HR0 L;  1CA5 A;  1KNE A;  2L1B A;  2JA8 H;  1STN A;  1I6H B;  1IKM A;  4PMB A;  2AUK A;  5KEE A;  1JWM D;  4A3M B;  3SEB A;  3F2C A;  2K5Q A;  2KUM A;  4K8J A;  3M7N A;  2K5W A;  1M90 C;  1VQC A;  1PRT F;  4C2M H;  4MTN A;  2BH2 A;  2AWO A;  1XPR A;  5G3L D;  4BBR B;  1D5X C;  5EKK A;  1BQQ T;  2NWG A;  5GQO A;  3VYU A;  2VNU D;  1VMC A;  3T1Y Q;  5FLX L;  1GHK A;  3K80 C;  4GOP A;  4DV7 L;  1SMY C;  2BA1 A;  2I07 B;  2NVY B;  4JI6 Q;  1Y69 U;  1C48 A;  1X65 A;  3SK4 A;  5IGB A;  1ENA A;  1RCV D;  2G5D A;  1U4L A;  2KQ3 A;  1EEF D;  2JP1 A;  2LFN A;  4NXM Q;  1IHZ A;  2BA0 A;  4JI7 L;  4KHZ A;  1WVL A;  3RUZ A;  1YJW A;  3M3Y H;  5M5W H;  4JI4 L;  5EPL A;  1XTD A;  2A69 D;  3BG3 A;  3BZK A;  1O78 A;  4RG1 A;  3SK8 A;  1OXU A;  1FNV A;  2EXD A;  1B1Z A;  2AHO B;  4Y7N B;  4YHH L;  4HID A;  2UXD L;  1CQV A;  1A0I A;  1TWC B;  3RN5 A;  1NBW A;  3S2H H;  5I4D A;  1GXD C;  5AFW A;  3PMF A;  2L55 A;  3Q23 A;  3KYH C;  4FF4 A;  4BY7 G;  2LMC B;  1Q1B A;  5CYU A;  1SRO A;  2F0K A;  1F2L A;  1S5D D;  1T5X D;  1PRT D;  3WWV A;  4XQQ A;  4C1N I;  5GAG C;  2JA6 H;  1X3G A;  4POG A;  4N9T A;  2HD3 A;  3PIP A;  4LFA Q;  1QUQ A;  3PO3 G;  1STY A;  5E4X A;  1IL8 A;  4JI8 L;  1SR3 A;  3OW7 A;  1B7Y B;  4JCV E;  5IGG A;  4HJA A;  4JI0 Q;  3DHQ A;  1K3B C;  1XNQ L;  2XNA C;  2UUA Q;  4IOA A;  2FHT A;  4K2K A;  1GUG A;  1Y8N B;  5ELC A;  1IYJ B;  2K5V A;  3F8T A;  2K5N A;  1YNN C;  5COR A;  2QDB A;  2MNA A;  3C46 A;  2IX1 A;  1SYG A;  2ASB A;  4A3G B;  2F52 A;  4J1M A;  1VF7 A;  4B3S L;  4OXP A;  1Q1E A;  3IAY A;  3E6Z X;  2I0Q A;  3NTH A;  3J81 i;  1GO3 E;  1TS3 A;  4DV2 L;  4LWC A;  3NEL A;  5FO7 B;  2WKD A;  1SNO A;  5ELO A;  4B9X A;  4OWW B;  4DK0 A;  3R3O A;  3W1B A;  1KL9 A;  1W6K A;  1SNC A;  4OX9 L;  1EY4 A;  2O5I C;  4A3J G;  4ZKC B;  4X65 L;  3HOW B;  1UEB A;  2TMP A;  1WI5 A;  4ZKB B;  1KTK A;  1HNW Q;  5IYD H;  1HH2 P;  1B2T A;  1V1P B;  2R93 H;  2KBN A;  1A2U A;  4BS9 A;  3PQI A;  5CV8 A;  1HNX L;  3CCJ A;  1EYC A;  3K57 A;  3PSI A;  4QF4 A;  3SGI A;  1HXY D;  1AW7 A;  1F9P A;  4HSP A;  2JJQ A;  4DPG A;  2A6H D;  3K5N A;  2RQX A;  5JOB A;  3DEP A;  4A3C H;  4ALP A;  2EQS A;  3K5O A;  1N34 L;  4HJ5 A;  1Q7Y C;  1FNW A;  5C0X J;  1IBL Q;  4GNX C;  2CHB D;  1Y1V H;  3BZD B;  2ID0 A;  1O80 A;  2TSS A;  1VQ8 A;  3A56 A;  2NN6 H;  1XMQ Q;  1SNP A;  1LV9 A;  3RLF A;  3D8G A;  2KVM A;  4RA8 A;  5IT9 c;  3EBE A;  1CKN B;  4EQP A;  3MXN A;  4GN4 B;  3F2U A;  5JEA H;  1YNJ D;  1C7Y A;  4XYO A;  4DAY B;  1SLJ A;  4IPD A;  1NMF A;  2SDF A;  4KN4 C;  5GAE C;  2NBF A;  5I9P A;  2A6E D;  3OW2 A;  3O13 A;  1QJO A;  5C5M A;  1D2B A;  4FDB A;  1VQH A;  2DNE A;  3UE0 A;  3DWQ A;  2NVQ H;  1KAA A;  2PCF B;  1S3O A;  1LT6 D;  4OON A;  2E2H H;  4LF7 L;  3I73 A;  5EGT A;  1DM0 B;  4LF8 Q;  1CSP A;  1AZQ A;  4FXD A;  1RIP A;  4IUQ A;  2MPM A;  1PH5 A;  2UUC L;  1B3Q A;  2L15 A;  4K5V A;  1OTC A;  4OHJ A;  4KY5 A;  2R92 H;  3QOJ A;  2G9H D;  3S1R H;  1KXL A;  3EVQ A;  4O0A A;  3M4Y A;  3NPP A;  5IWA L;  1WYD A;  5ELN A;  4BY7 B;  3PGZ A;  2R93 G;  1VQJ A;  2B2V C;  1CQF A;  3FPP A;  1SXT A;  3L7Z C;  4KTA A;  1EY5 A;  4KMU C;  2PQE A;  1WTV A;  1N8R C;  3HOV H;  3CCU A;  2HQL A;  4B08 A;  3PUZ A;  1L2F A;  3D4D A;  4CKE A;  4LJZ C;  3PO3 B;  3J81 j;  4FF1 A;  2HDL A;  5D14 A;  3BYT B;  1B70 B;  4UP8 A;  4DV3 L;  1VDZ A;  2IT1 A;  2M00 A;  1N36 Q;  5J22 A;  3WOF A;  5IGF A;  2ZXO A;  4G7H C;  1BO0 A;  1H9S B;  4KKT A;  1JJC B;  2MO1 A;  3G6E A;  2JA7 H;  1ZYR D;  4ME3 A;  1RD9 D;  3IRB A;  1KAW A;  4NKL A;  2WP8 J;  4L5Q A;  4L6T B;  4JI3 L;  1XNR L;  1GUN A;  4EGV A;  4TVA B;  1NJI C;  1YZ6 A;  4A3E H;  1HQM C;  5DM6 3;  5JJL A;  4WJ4 A;  1SYD A;  4RFB A;  1YJN A;  4JI2 L;  3J7A 5;  2CKZ B;  4B3M L;  2Z4H A;  4ZUJ A;  4A3J B;  3H3V H;  2E74 C;  5GRO A;  3RR5 A;  3H3V C;  2A1A A;  4H13 C;  1F2M A;  2OQK A;  1BBX C;  5EKL A;  3KLR A;  2NVX B;  1BNZ A;  3ITP A;  4K2L A;  3CCM A;  1NY4 A;  4KY6 A;  5DNF A;  3SHL A;  5FLM G;  1K8A C;  4A3I G;  5M3M H;  3OTO Q;  4IPG A;  3OMC A;  4LFB Q;  3N52 A;  3NSW A;  3HOX G;  4WRD A;  5CC4 A;  3FKI G;  2SNS A;  3CPF A;  2AMC B;  2OQ0 A;  4DR2 Q;  4DR3 Q;  1DD2 A;  1BBW A;  2D5D A;  2CW0 D;  1Q12 A;  4IO9 A;  3GTP B;  3PIO A;  4A3M H;  1Y8O B;  4NW2 A;  3STB C;  1VQA A;  3I91 A;  2LY7 A;  1I4R A;  4P75 A;  3I4M G;  3EFX D;  1SE2 A;  2IW3 A;  1TS2 A;  4YCW A;  2O4X A;  3FVQ A;  3H09 A;  1HNZ Q;  2F0J A;  1GUS A;  1C9O A;  1RJT A;  4O42 A;  3M85 A;  4IUU A;  1CZG A;  1M4V A;  1BVS A;  1UE1 A;  2DUD A;  3NBH A;  5FLX c;  5IE8 A;  1EWC A;  1PZI D;  2K33 A;  2NYZ D;  4JI1 Q;  2L9H A;  2NVY H;  3LWU A;  2MHV A;  3EA6 A;  3TP5 A;  3H0G H;  3J81 L;  1Q82 C;  2CWA A;  2FMM A;  4IPH A;  1LTS D;  3RN2 A;  1NNX A;  2I5H A;  3RZD H;  3WOE A;  1GJX A;  2KCC A;  2B2U C;  4JBM A;  2F0D A;  2WAC A;  4KHP L;  3HOZ H;  1CHP D;  3CRK C;  3G4S A;  2EYF A;  5FJ8 G;  1PA6 A;  1IW7 C;  4LF9 L;  2RHS B;  2R93 B;  4BY1 G;  2B2T C;  4DR7 L;  2BE5 D;  5M3F G;  2F4V Q;  3ZYY X;  2VY3 A;  4EQ5 A;  4Y7N H;  1O7Z A;  2IY5 B;  3S24 A;  2GA4 B;  3OYY A;  4RCN A;  1TWC H;  3BVZ A;  3NWS A;  4G7Z C;  1PLF A;  2EJG C;  1STH A;  3LNN A;  1VQM A;  2JSO A;  4K6L A;  1NCV A;  5LMN W;  5M3M G;  3LGJ A;  2F3I A;  1YNX A;  4PZ7 A;  1JCK B;  3T1H Q;  3DM3 A;  4GNX B;  1KQS A;  1KDC A;  5ELB A;  3R93 A;  4P2C B;  1QB5 D;  2JEA I;  1C4Q A;  2MQH A;  4OIJ A;  5KYL A;  3S9W A;  3T13 A;  3S17 H;  1WCM G;  1DOL A;  4ZAI A;  2O5J C;  1EY6 A;  2ZJQ A;  4WJ3 M;  1Z7T A;  1GVP A;  3CU7 A;  2NZ1 D;  2XRQ D;  1JC7 A;  2HCC A;  1KHI A;  1TY2 A;  1SMY D;  2F4I A;  4OGQ C;  4OO1 I;  4B3T Q;  3CF5 A;  4XT1 B;  2WAQ G;  5D3I B;  1RKN A;  3GTQ B;  5I2Y A;  1ZYR C;  3L0O A;  2JN4 A;  4EQO A;  1FJG Q;  1QVG A;  4DAP A;  4JOI C;  4QY7 A;  1OXV A;  3TS0 A;  1XPU A;  4GKK L;  4A93 G;  2R7D A;  2NVQ B;  2EYO A;  4LMQ D;  4YY3 Q;  3ICE A;  4LFC L;  1JB7 A;  3H0G G;  3D0F A;  4DAV A;  1UUP A;  3NBI A;  4G4K A;  4J6H A;  4LAA A;  1ONL A;  3I70 A;  3K7U C;  1ICF B;  1MJE A;  4L5S A;  3U9S A;  1T9H A;  3HOW H;  1Z47 A;  4M8A A;  2R92 B;  4FYD A;  2R6G A;  4A3I B;  1Y8P B;  1M1K C;  1ML0 D;  2IX0 A;  1GUO A;  3HOX B;  1ROD A;  2K75 A;  3HOZ G;  3G7L A;  1N33 Q;  2VB3 X;  5LL6 S;  2EJM A;  3MAQ A;  1YVC A;  4B3R Q;  1EOV A;  3DMU A;  1S5C D;  5CBE E;  2ES2 A;  3AYH B;  3PIP 3;  1FNU A;  1ASZ A;  2IWH A;  1A3T A;  3HOU G;  1Z9F A;  3ND9 A;  3EQL C;  2QEJ C;  3I4M B;  3HRZ C;  4A3L H;  1ENC A;  4DR5 L;  4CDE C;  4XDX A;  3E5S A;  5DLQ E;  1EY8 A;  3CCQ A;  5IP7 G;  3NK9 A;  2F0S A;  4KD3 A;  4NB3 A;  3S1N B;  2EY5 A;  4K14 A;  1Y1W H;  3GO5 A;  2Z6K C;  1SMX A;  4GKJ Q;  1B3A A;  4QL5 A;  3GTM B;  3CPW A;  1BF4 A;  2KEN A;  1QNK A;  2J4X A;  3N6R A;  1YNN D;  2K28 A;  1C8C A;  4RHS A;  1VQN A;  2CQO A;  1V1Q A;  4GZY C;  2XWJ B;  4QQB X;  4CDD C;  2ZTD A;  1RDP D;  1IBK Q;  2Q8T A;  4KD4 A;  1IYU A;  1MJC A;  4DNR B;  1F9R A;  3DXJ C;  4CHT B;  2EYL A;  2EYJ A;  2C5C A;  3OSO A;  3GDE A;  5IGE A;  5KYI A;  1SFO B;  1X6O A;  4JI6 L;  1HPC A;  3CC2 A;  1ZKO A;  2WKC A;  1HA5 A;  3P75 A;  4C3J G;  3QJY A;  3X3M A;  5KRU A;  4BY1 B;  1VQ6 A;  5M3F B;  1G2T A;  1MSG A;  1JJG A;  1A3V A;  4YCU A;  2JA5 H;  1BUV T;  2IHF A;  1NSN S;  2B63 H;  3TDQ A;  1QUQ B;  4FNF A;  1QVC A;  1EYA A;  4DV4 L;  2F0Q A;  2B2W A;  5IYB G;  5M3M B;  4BY7 H;  1KDB A;  3OOC A;  4X64 Q;  2AQ3 B;  5CV9 A;  3CCS A;  3A0J A;  1XWE A;  5M9O A;  1I6V C;  3PF5 A;  3PUV A;  3S16 H;  5KIX A;  1I4Q A;  2JQO A;  3D4W A;  2P5Z X;  3T51 B;  2OTL A;  1U5K A;  5E1F A;  3W5O A;  5C0X I;  4X6A H;  3PO3 H;  4PZ8 A;  2KHI A;  3K0Y A;  1VQ4 A;  4AQY Q;  4MNO A;  1YHQ A;  4J15 A;  2F0L A;  4X66 Q;  1CZW A;  4DV1 L;  2Q2T A;  1X3Q A;  4A3L G;  4DR4 Q;  1EY9 A;  1KAB A;  1S4Z A;  1STB A;  2H4O A;  2YTV A;  5C4J H;  2L12 A;  4DN4 M;  1SE8 A;  3K5L A;  4UP9 A;  2QA4 A;  1L1O A;  1D6E C;  1Y1W G;  1PFB A;  4A76 A;  1SE3 A;  3K7A B;  4KV6 A;  2LS0 1;  4A93 B;  1NR4 A;  1CT1 D;  3Q22 A;  1HTP A;  1PFM A;  4AYB E;  3Q6S A;  5DEH A;  3H0G B;  4JI0 L;  3A74 A;  5F2D A;  1EY0 A;  4U68 A;  3CCL A;  1SDF A;  2VQF Q;  1XPO A;  2VZA A;  1U0L A;  4A3J H;  3GTM H;  1G2S A;  5K5P A;  3RZD B;  4IUN A;  1R9T B;  5JPM C;  1S40 A;  2ZM6 Q;  3I8Z A;  3TS2 A;  3HOZ B;  3QWN A;  3CCR A;  4X3T A;  4RAU C;  3FHW A;  4IUP A;  3AFQ A;  4IUT A;  2F0O A;  4GLA C;  2NVX H;  2VQE L;  1FD7 D;  2ZTE A;  1K3R A;  3Q24 A;  3R2I A;  2CQA A;  5EBD A;  1HA6 A;  3ULP A;  2XWB B;  3AFP A;  3IFD A;  3KJP A;  4JI5 Q;  2CWP A;  3P1H A;  4E6I A;  3J80 L;  4CJ0 B;  2Y0S G;  1PH4 A;  2ZTC A;  1CM9 A;  3OMG A;  3TP8 A;  4CJ1 B;  3HOU B;  3ZJY C;  2JA5 G;  2XIW A;  2B63 G;  1FGU A;  2B39 A;  2K03 A;  1Q86 C;  2XVS A;  1N32 L;  1WFQ A;  4IQZ A;  2JA9 A;  3MXP A;  3GTP H;  1CTM A;  1LAB A;  3QG1 A;  4DXG A;  1WD1 A;  2MUY A;  1GM5 A;  4C56 C;  3KF6 A;  1VQ9 A;  3B6Y A;  5FLX E;  2QEX A;  5FO8 B;  2AQ1 B;  5IYC G;  5A35 A;  1HR0 Q;  2YV5 A;  3S17 B;  1TII D;  3UDI A;  4L63 B;  3NEN A;  4JBW A;  4P71 A;  2PNH A;  4DF7 A;  1B9M A;  4V0B A;  1TT2 A;  1YBY A;  1UE7 A;  3I90 A;  2K5H A;  3PUX A;  5LMN L;  2F0U A;  2MO0 A;  2X6L A;  4IFD I;  2UXC L;  5CV6 A;  2HIX A;  4JV5 L;  1DOK A;  1TWF H;  4ZCK A;  4KN7 C;  3J81 c;  4DV5 L;  1SJH D;  5C44 G;  4OWX B;  4LF6 L;  3MHB A;  4DV7 Q;  1BBU A;  1TWA H;  2IX3 A;  2E8G A;  1J6Q A;  3HKZ G;  4TRD A;  3S15 H;  4DV6 L;  4BA2 I;  5A2Q L;  4HCE A;  4OWT B;  3VR6 A;  2EYM A;  3V96 A;  4Q5V A;  2RDF A;  5JVG 3;  4JI7 Q;  2UXB L;  5CR3 A;  2VS1 A;  3L9A X;  3RD4 A;  1Q3L A;  1TU2 B;  4A75 A;  4JI4 Q;  2Z8L A;  1CKM A;  3DM1 A;  3PIO 3;  1STA A;  5C3E G;  2Z6B A;  1FGB D;  3NXW A;  5EPJ A;  2EIF A;  1LTA D;  2R61 A;  4ZQ3 A;  3AEV A;  3IKJ A;  3NQT A;  3NUC A;  1HUN A;  2FIN B;  4POF A;  2JE6 I;  1J9O A;  3MFY A;  2WV6 D;  1JOK A;  3STB D;  4GN5 A;  4YHH Q;  2UXD Q;  3GTO B;  3ERS X;  4GLX A;  2OCE A;  2DJG C;  1A2T A;  2V4D A;  3MWY W;  4ZUI A;  3SK6 A;  3SXH A;  2E2J B;  2NZO A;  1UE5 A;  2D9U A;  3T53 B;  5GAD C;  4HN7 A;  2WB1 G;  2WIN B;  4L5T A;  1MHW C;  3NEM A;  1H9M A;  1B8A A;  1Y1W B;  1K0R A;  1J5E L;  1K83 B;  4JYA L;  1K73 C;  1EL0 A;  4BBS G;  5IY0 A;  4NXN L;  1ASY A;  4JI8 Q;  3GTQ H;  1TVX A;  1QCB D;  4FVM A;  4AYB G;  3U9O A;  1X3E A;  1XNQ Q;  1EWH A;  2KEC A;  4OO1 G;  3DUZ A;  1UE6 A;  3E3X A;  5A2Q E;  1X56 A;  2CVR A;  4YWM A;  4LUV A;  4ZLT F;  2K1B A;  1L0X B;  2PI2 A;  3NTI A;  5LMU Q;  4U67 3;  4PV1 C;  3S1M B;  4B3S Q;  3I7F A;  1IW7 D;  4DV2 Q;  3TEH B;  3CQZ B;  1LM0 A;  5FLM H;  4DV0 L;  3CP0 A;  1X32 A;  4A3I H;  4KKU A;  3A8K E;  3CW2 C;  5TSS A;  3RLO A;  3HOX H;  1EZ8 A;  4OX9 Q;  2JA5 B;  3W3A A;  3I3C A;  4X65 Q;  2B63 B;  3FKI H;  4IUV A;  1MI2 A;  3I72 A;  3TSS A;  4OEM B;  3OHX C;  1VQG A;  1WD0 A;  4QUC A;  3NBH B;  3UI2 A;  1HNX Q;  4HTH A;  2EY2 A;  4A3F G;  4P72 A;  4DR6 L;  3S16 B;  1V8Q A;  4GOP C;  1QVF A;  3I4M H;  3AU7 A;  2XGT A;  3CCE A;  4FF2 A;  2ZT9 C;  2GN5 A;  3SE0 A;  2FMC A;  4JBJ A;  2F0G A;  3S1N H;  3HZX A;  4R8I A;  1N34 Q;  3CME A;  2VXW A;  1PH3 A; 
#chains in the Genus database with same CATH homology
 1EIG A;  2DY8 A;  5C4J B;  2E76 C;  1DXM A;  3K58 A;  3OPO A;  2Z4I A;  1H9K A;  3CHB D;  4K5W A;  4DU9 A;  5C44 B;  2B2Y A;  1V1P A;  3S1Q B;  4IFD J;  2HUG A;  4PQX A;  3ND8 A;  1ESR A;  3HKZ B;  1LT4 D;  1DCZ A;  3NHH A;  4FO2 A;  3MEH A;  5JAV A;  4X3U A;  2D2C C;  4R9W A;  3GV3 A;  1T5E A;  5C3E B;  2EVB A;  4C3H G;  2M2L A;  3TZD A;  2IPK D;  3D6W A;  4ME5 A;  3OWE B;  2KEE A;  2F3V A;  1D1I A;  3MA2 B;  4K6D A;  1STE A;  1GUT A;  2EY1 A;  1HFG A;  1EZ6 A;  2JEB I;  1QG7 A;  2WB1 B;  4RH6 A;  1O7L A;  3KF8 A;  4L8J A;  5ELF A;  2XRS D;  1G29 1;  3MVV A;  5CV4 A;  5D3D A;  5C0X G;  3NWT A;  1H9J A;  4F8M A;  5IIF A;  4BBS B;  5LHY 1;  3GTK B;  4AYB B;  4N9P A;  1TWH B;  2K7V A;  3FRP B;  1BDO A;  4RGM A;  1DZ1 A;  3GP7 A;  3VR4 A;  2PNR C;  2F1M A;  1BOS A;  4EVO A;  1TWF B;  1ESF A;  4KJO A;  4XT3 B;  3Q0A A;  3BDL A;  2MJ8 A;  2K6A A;  1TWA B;  1XTC D;  2KCN A;  1QIL A;  3H94 A;  3S15 B;  1WTR A;  4IZ8 A;  1U4M A;  3V05 A;  4HSV A;  1VCI A;  4ID6 A;  1BR9 A;  4DFA A;  4A3F B;  3VYR A;  1UEA B;  1H9S A;  3D4R A;  1KDA A;  1SYB A;  1BCP C;  4F88 A;  5KNC A;  1F9S A;  1I4P A;  5T1G A;  1SNM A;  2X69 A;  1PTO B;  3A7A B;  5D65 A;  1HUM A;  1O7Y A;  2F0F A;  4QCL A;  2QKI C;  4XXE A;  5ELD A;  2F0H A;  2SEB D;  4CJ2 C;  2PW7 A;  3J81 E;  2YYZ A;  1EY7 A;  3QB3 A;  4ZRZ A;  4DGZ A;  2WII B;  1HQR D;  1PMR A;  4KK7 A;  1EEI D;  2SOB A;  1IKL A;  3OIP A;  1W6J A;  1U4R A;  1EU3 A;  1Q90 A;  4IFD G;  5IT9 L;  1MSH A;  2EZV A;  3TP6 A;  1F77 A;  4DXF A;  1JR0 D;  4FF3 A;  5JJZ A;  3HS0 C;  1B9N A;  4ABN A;  4C3H B;  2N88 A;  3HG9 A;  5EBC A;  2A68 C;  2K5D A;  5EKI A;  2EYH A;  4RHR A;  2JYO A;  1ZXT A;  4RKB A;  2J0T D;  1QOH A;  1OO9 B;  1UNS A;  1II3 A;  4DK1 A;  2A73 B;  4F87 A;  3FKI B;  1MGS A;  3AB9 A;  5C3W A;  1M8A A;  4XQN A;  3GD7 A;  2J7Z A;  1R4P B;  2PZT A;  3KUP A;  1A6X A;  1TKW B;  3GTJ B;  2IL8 A;  2NUC A;  2F0N A;  3P20 A;  1PTO F;  2NTS A;  5IGD A;  4ULL A;  2EXZ A;  1F2Y A;  3KK7 A;  3VA5 A;  3BDC A;  2AQ2 B;  4A3K B;  3VR2 A;  3PUW A;  4G7O C;  4NDX A;  2A74 C;  3IL8 A;  3KBG A;  3TBI B;  3BDO A;  1F2Z A;  1LLR D;  2M9V A;  3JAM L;  5IOC A;  3EJI A;  2NN6 I;  5FK9 C;  1VMP A;  1JQY D;  1I3Q B;  1TS4 A;  5G3L F;  1D1K A;  5FOB B;  1F9Q A;  5JVH 3;  2Q8I B;  1WTW A;  5J1Z A;  4C3I G;  2VB2 X;  2EPB A;  4ZYS A;  5I6W A;  2OEO A;  4S3S A;  2I46 A;  1TQO A;  5J39 A;  5KND A;  1QE6 A;  1CK1 A;  1GHJ A;  3QIA A;  3S14 B;  4ODG A;  1A15 A;  1AEX A;  2L11 A;  5BN4 A;  1E2W A;  1WTQ A;  2F3W A;  1K8O A;  2Z1C A;  4R8N A;  1EQV A;  3HEJ A;  2NVT B;  1PTO D;  1SND A;  1WCM B;  1JOQ A;  1STG A;  1EFI D;  2FJ2 A;  1PFN A;  2WAQ B;  5CBA E;  2XSC A;  1SE4 A;  2E2I B;  2DY7 A;  3KBX A;  1A3U A;  5E3F A;  3KLS X;  4XIG S;  2RDG A;  1B4O A;  1SYF A;  5LL6 X;  3J7Y W;  3V2T A;  5FO9 B;  3ERO A;  2ENB A;  2B2V A;  3MXG A;  1B50 A;  3MTS A;  1ET6 A;  4MHE A;  1ZEQ X;  4DNT B;  3PV0 A;  5CV7 A;  3R8B A;  3R2T A;  4JK1 C;  1RTN A;  2RSN A;  4IN3 A;  5K36 G;  1SEB D;  1OXX K;  1JIC A;  1HTL D;  5JPN C;  1BCP B;  3HOY B;  1K8M A;  2PO4 A;  3A8J E;  1GUW A;  2OF1 A;  2NTT A;  1S5B D;  1I4G A;  1TWG B;  4UDU C;  5COY A;  5HGT A;  5C4X B;  4DA2 A;  4OO1 H;  4V19 0;  2F0M A;  3MXU A;  3H91 A;  4B9W A;  1I4X A;  2DNC A;  1ILQ A;  1HRJ A;  3GTG B;  1MBY A;  4C3J B;  1NR2 A;  2BCO A;  5M5X B;  2MP1 A;  3TME A;  4C3I B;  3SK5 A;  2L0C A;  3RMH A;  3J80 E;  2ICI A;  1NUC A;  4H0L C;  2O2L D;  5JEA J;  4KKS A;  3TZU A;  2QIL A;  1JE4 A;  1BXT A;  3W2D A;  3T16 A;  3MFG A;  2F0T A;  1FR3 A;  3MC0 B;  4RGO S;  2EYP A;  3NP8 A;  1U4P A;  1BCP F;  1FYC A;  2R3Z A;  4XQJ A;  4XYQ A;  2HCI A;  4PMC A;  2N55 A;  3GV6 A;  3K6O A;  4IUR A;  1PTO H;  1V1O A;  1XYI A;  3S2D B;  1PTO C;  3SR1 A;  1OXT A;  4NP5 A;  1XXG A;  5EPK A;  3VYT A;  2JXM B;  2B2U A;  5EQ0 A;  4KJN A;  3GTL B;  2LKV A;  1PYW D;  4QB4 A;  2K01 A;  4I65 A;  2L4N A;  1KNA A;  5IGC A;  2QCP X;  3J7A V;  1XX8 A;  2B2T A;  4CBV A;  3VYS A;  3FDT A;  2PZU A;  3A8I E;  4QUF A;  2RVL A;  2B2W C;  3C2P A;  1LTT D;  2AWN A;  1UAP A;  3ONA B;  1X3P A;  1I50 B;  2Q8R E;  4FXK C;  4IAL A;  3GQB A;  1JWS D;  3M4O B;  2RSO A;  3FEW X;  1LTB D;  2Y0S B;  5T1I A;  5C4Z A;  3DEO A;  2EDG A;  3I4N B;  1BCP D;  5I6Y A;  4UAI A;  4YIJ A;  3ERQ A;  3PO2 B;  3LX0 A;  5DM7 3;  4ZK9 B;  4HR7 B;  2EY6 A;  4TQU S;  5C0X H;  3LWE A;  2R7Z B;  3OWF A;  2ZXR A;  2F0I A;  5HUR A;  3K59 A;  1KLG D;  2A69 C;  4RGT A;  1Z6H A;  2F0E A;  3PUY A;  1DJR D;  2BDO A;  3VA7 A;  3TN2 A;  2JA8 B;  3IFT A;  3DWP A;  1HCZ A;  1WTP A;  4X3S A;  1SAP A;  1PRT C;  1Q8I A;  4C2M B;  4RKL A;  4NMZ A;  5C4H A;  2A68 D;  3CRL C;  2KED A;  1JOR A;  2K32 A;  1EQT A;  2NN6 G;  2IJ0 A;  2RDH A;  2YU9 B;  4RGN A;  1PDQ A;  2L5T A;  1LT5 D;  3FMC A;  3QO2 A;  5JEA G;  3AMU A;  4WJW A;  4Q0F A;  4KI0 A;  3L3O C;  4BA1 I;  1LT3 D;  1B53 A;  3OIQ A;  3M7G A;  1SSO A;  1E2V A;  1L0Y B;  2NB0 A;  5C5L A;  2F03 A;  4ILW A;  1SNQ A;  1PZK D;  2MGS A;  3M3Y B;  4KY7 A;  1SYC A;  3QOL A;  4DAY A;  3NE5 B;  4CKB A;  5M5W B;  2PYK A;  4FXG C;  1NAP A;  5CV5 A;  3NQI A;  3E0J A;  3SDZ A;  2PW5 A;  1QNU A;  2PZW A;  2EE1 A;  2E75 C;  5KGU A;  3DWA A;  3S2H B;  1HFN A;  1LO5 D;  3FPU B;  4M1U B;  1TS5 A;  1AN8 A;  4IFD H;  2B8G A;  2JA6 B;  1IYV A;  3MZ5 A;  1JOO A;  2A6H C;  3K5M A;  2BOS A;  2D62 A;  1ICW A;  2K04 A;  1R4Q B;  4RCO A;  1ENF A;  5KNB A;  1PXU A;  1VF5 C;  3RZO B;  4WFN 3;  4FP5 D;  2G9D A;  5DAU A;  1CHQ D;  1YNJ C;  3BVM A;  2K05 A;  5CMD A;  2A6E C;  5ISR A;  5E4W C;  1LTI D;  1U9R A;  2RA4 A;  3BS1 A;  3I4L A;  2BDN A;  5BN5 A;  1HHV A;  1I4H A;  1E0B A;  2VUM B;  3URY A;  1DON A;  1WTO A;  5ELE A;  4EQN A;  2FFK B;  5BN3 A;  1AZP A;  1DOM A;  3HGB A;  5NUC A;  1ILP A;  1GOZ A;  2C9O A;  4RWS C;  4QIW B;  2KOL A;  4I7Z C;  4QMG A;  4O1N A;  1JWU D;  2OXP A;  3J7A F;  1AP0 A;  3WDN A;  4PNY A;  1OXS C;  1DYQ A;  2EJF C;  1Y1V B;  1E2Z A;  2A5H A;  4F7X A;  2HQE A;  4TSS A;  3X3N A;  4CKC A;  1EOT A;  1S5F D;  2RKS A;  5EJW A;  3SVM A;  4X3K A;  2X6G A;  2OT2 A;  1RTO A;  4CGY B;  4H7B A;  3HP3 A;  2ICE C;  2E2D C;  1D5Z C;  3G6J B;  4OIK A;  2RBM A;  1TY0 A;  2E2H B;  4LK1 C;  4BWG B;  1ET9 A;  1EYD A;  4HCS A;  1H9R A;  2F0P A;  1LTR D;  1QWY A;  3CKI B;  1PZJ D;  1JB3 A;  5IOD A;  1V43 A;  3S1R B;  1TR5 A;  4Z9C B;  5I2X A;  2B2Y C;  2PPB C;  2SNM A;  2KJX A;  4HMJ A;  1MD2 D;  4G57 A;  5C3X A;  1RHP A;  4KHV A;  3A7L A;  3VR3 A;  3T4A C;  3D3R A;  3T56 B;  4WOR A;  3HOV B;  3P7J A;  5IT9 E;  1RF2 D;  4HMI A;  4XTC S;  1LTG D;  1J8I A;  4K5X A;  2QF7 A;  4J8Q A;  1PRT B;  2CW0 C;  1CFM A;  1CA6 A;  1G8Z D;  3A55 A;  4OL7 A;  3H6M A;  1LAC A;  5I9O A;  1G6Z A;  4HAE A;  2HDM A;  5FKA C;  2JA7 B;  1EU4 A;  2AUJ D;  4HED A;  1EIH A;  5K36 H;  5C6A A;  1S5E D;  1SJE D;  4A3E B;  2XN9 C;  2PMZ B;  4K8I A;  3D6C A;  3TP7 A;  1SBB B;  1CI3 M;  1G91 A;  4A3D B;  2B8F A;  2KHS A;  4TKO B;  3BYY B;  3C1F A;  3C1E A;  1SYE A;  3D31 A;  5CGK A;  3C3L A;  4MN3 A;  1AFP A;  4PMW A;  5M5Y B;  1WTX A;  4C1N K;  2EOT A;  1KLU D;  3A54 A;  1B44 D;  2F0W A;  4H44 C;  2H1E A;  2F0V A;  4A3B B;  2ZXP A;  2BE5 C;  2DN8 A;  3JAM E;  3NTK A;  3VR5 A;  4MIU A;  3BVG A;  1D5M C;  2KA7 A;  3KLS A;  1CA5 A;  1KNE A;  2L1B A;  1STN A;  1I6H B;  1IKM A;  4PMB A;  2AUK A;  5KEE A;  1JWM D;  4A3M B;  3SEB A;  2K5Q A;  2KUM A;  4K8J A;  3M7N A;  2K5W A;  1PRT F;  2AWO A;  5G3L D;  4BBR B;  1D5X C;  5EKK A;  1BQQ T;  2NWG A;  3VYU A;  2VNU D;  1VMC A;  5FLX L;  1GHK A;  1SMY C;  2BA1 A;  2I07 B;  2NVY B;  1Y69 U;  1C48 A;  3SK4 A;  5IGB A;  1ENA A;  1RCV D;  1U4L A;  2KQ3 A;  1EEF D;  2JP1 A;  2LFN A;  1IHZ A;  2BA0 A;  4KHZ A;  1WVL A;  3RUZ A;  5EPL A;  2A69 D;  3BG3 A;  1O78 A;  3SK8 A;  1OXU A;  1FNV A;  1B1Z A;  4Y7N B;  1CQV A;  1TWC B;  5I4D A;  1GXD C;  5AFW A;  3PMF A;  2L55 A;  3Q23 A;  4FF4 A;  2LMC B;  1Q1B A;  5CYU A;  2F0K A;  1F2L A;  1S5D D;  1T5X D;  1PRT D;  4C1N I;  4XQQ A;  4N9T A;  1STY A;  5E4X A;  1IL8 A;  3OW7 A;  5IGG A;  3DHQ A;  2XNA C;  2FHT A;  4K2K A;  1GUG A;  1Y8N B;  5ELC A;  5COR A;  3C46 A;  1YNN C;  2QDB A;  2IX1 A;  1SYG A;  4A3G B;  4J1M A;  1VF7 A;  1Q1E A;  3IAY A;  3E6Z X;  3NTH A;  1TS3 A;  5FO7 B;  2WKD A;  1SNO A;  4B9X A;  4DK0 A;  3R3O A;  1W6K A;  1SNC A;  1EY4 A;  2O5I C;  4ZKC B;  3HOW B;  2TMP A;  4ZKB B;  1KTK A;  1B2T A;  1V1P B;  1A2U A;  4BS9 A;  5CV8 A;  1EYC A;  3K57 A;  4QF4 A;  1HXY D;  1AW7 A;  1F9P A;  4HSP A;  2A6H D;  3K5N A;  2RQX A;  5JOB A;  3DEP A;  3K5O A;  1FNW A;  5C0X J;  2CHB D;  3BZD B;  2ID0 A;  1O80 A;  2TSS A;  3A56 A;  2NN6 H;  1SNP A;  1LV9 A;  3RLF A;  3D8G A;  2KVM A;  4RA8 A;  4EQP A;  3MXN A;  3F2U A;  5JEA H;  1YNJ D;  4XYO A;  2SDF A;  4KN4 C;  2NBF A;  5I9P A;  2A6E D;  3O13 A;  1QJO A;  5C5M A;  1D2B A;  2DNE A;  3DWQ A;  1KAA A;  2PCF B;  1LT6 D;  3I73 A;  5EGT A;  1DM0 B;  1AZQ A;  4FXD A;  4IUQ A;  2MPM A;  4K5V A;  4OHJ A;  4KY5 A;  3QOJ A;  2G9H D;  3EVQ A;  3M4Y A;  3NPP A;  4BY7 B;  2B2V C;  1CQF A;  3FPP A;  1SXT A;  3L7Z C;  4KTA A;  1EY5 A;  4KMU C;  2PQE A;  1WTV A;  4B08 A;  3PUZ A;  3D4D A;  4CKE A;  4LJZ C;  3PO3 B;  4FF1 A;  2HDL A;  5D14 A;  3BYT B;  1VDZ A;  2IT1 A;  2M00 A;  5J22 A;  3WOF A;  5IGF A;  2ZXO A;  4G7H C;  1BO0 A;  1H9S B;  4KKT A;  1ZYR D;  1RD9 D;  4NKL A;  2WP8 J;  4L6T B;  1GUN A;  4EGV A;  1HQM C;  5DM6 3;  1SYD A;  4RFB A;  2Z4H A;  4ZUJ A;  4A3J B;  2E74 C;  3H3V C;  4H13 C;  1F2M A;  1BBX C;  5EKL A;  3KLR A;  2NVX B;  1BNZ A;  3ITP A;  4K2L A;  4KY6 A;  5DNF A;  3SHL A;  3OMC A;  3N52 A;  3NSW A;  4WRD A;  5CC4 A;  2SNS A;  1DD2 A;  2D5D A;  2CW0 D;  1Q12 A;  3GTP B;  1Y8O B;  4NW2 A;  3I91 A;  2LY7 A;  1I4R A;  3EFX D;  1SE2 A;  2IW3 A;  1TS2 A;  2O4X A;  3FVQ A;  3H09 A;  2F0J A;  1GUS A;  4O42 A;  1RJT A;  3M85 A;  4IUU A;  1CZG A;  1M4V A;  3NBH A;  1EWC A;  1PZI D;  2K33 A;  2NYZ D;  2L9H A;  3LWU A;  2MHV A;  3EA6 A;  3TP5 A;  3J81 L;  2FMM A;  1LTS D;  3WOE A;  1GJX A;  2KCC A;  2B2U C;  2F0D A;  2WAC A;  1CHP D;  3CRK C;  2EYF A;  1IW7 C;  2R93 B;  2B2T C;  2BE5 D;  3ZYY X;  1O7Z A;  2GA4 B;  4RCN A;  3BVZ A;  4G7Z C;  3NWS A;  1PLF A;  2EJG C;  1STH A;  3LNN A;  2JSO A;  4K6L A;  1NCV A;  1JCK B;  1KDC A;  5ELB A;  3R93 A;  4P2C B;  1QB5 D;  2JEA I;  1C4Q A;  5KYL A;  4OIJ A;  3S9W A;  3T13 A;  4ZAI A;  1DOL A;  2O5J C;  1EY6 A;  1Z7T A;  3CU7 A;  2NZ1 D;  2XRQ D;  1JC7 A;  2HCC A;  1TY2 A;  1SMY D;  2F4I A;  4OGQ C;  4OO1 I;  4XT1 B;  5D3I B;  1RKN A;  3GTQ B;  5I2Y A;  1ZYR C;  4EQO A;  4DAP A;  1OXV A;  2NVQ B;  2EYO A;  4LMQ D;  4DAV A;  1UUP A;  3NBI A;  4G4K A;  4J6H A;  4LAA A;  1ONL A;  3I70 A;  3U9S A;  1Z47 A;  4M8A A;  2R92 B;  4FYD A;  2R6G A;  4A3I B;  1Y8P B;  1ML0 D;  2IX0 A;  1GUO A;  3HOX B;  1ROD A;  3G7L A;  2VB3 X;  5LL6 S;  2EJM A;  3MAQ A;  3DMU A;  1S5C D;  5CBE E;  3PIP 3;  1FNU A;  2IWH A;  1A3T A;  3ND9 A;  3EQL C;  2QEJ C;  3I4M B;  3HRZ C;  1ENC A;  4XDX A;  3E5S A;  1EY8 A;  3NK9 A;  2F0S A;  4KD3 A;  3S1N B;  2EY5 A;  4K14 A;  3GO5 A;  1B3A A;  3GTM B;  1BF4 A;  1QNK A;  2J4X A;  3N6R A;  1YNN D;  2K28 A;  1C8C A;  4RHS A;  4GZY C;  2XWJ B;  1RDP D;  2Q8T A;  4KD4 A;  1IYU A;  4DNR B;  1F9R A;  3DXJ C;  4CHT B;  2EYL A;  2EYJ A;  2C5C A;  3OSO A;  5IGE A;  5KYI A;  1SFO B;  1HPC A;  1ZKO A;  2WKC A;  1HA5 A;  3P75 A;  4C3J G;  3QJY A;  3X3M A;  5KRU A;  4BY1 B;  5M3F B;  1G2T A;  1MSG A;  1A3V A;  1BUV T;  1NSN S;  3TDQ A;  4FNF A;  1EYA A;  2F0Q A;  2B2W A;  5M3M B;  1KDB A;  3OOC A;  2AQ3 B;  5CV9 A;  1XWE A;  5M9O A;  1I6V C;  3PUV A;  5KIX A;  1I4Q A;  3D4W A;  3T51 B;  5E1F A;  5C0X I;  3K0Y A;  2F0L A;  1CZW A;  1X3Q A;  1STB A;  1EY9 A;  1KAB A;  1S4Z A;  2H4O A;  2L12 A;  4DN4 M;  3K5L A;  1D6E C;  1PFB A;  1SE3 A;  3K7A B;  4KV6 A;  2LS0 1;  4A93 B;  1NR4 A;  1CT1 D;  3Q22 A;  1HTP A;  1PFM A;  3Q6S A;  5DEH A;  3H0G B;  5F2D A;  1EY0 A;  4U68 A;  1SDF A;  1G2S A;  5K5P A;  3RZD B;  4IUN A;  1R9T B;  5JPM C;  3I8Z A;  3HOZ B;  3QWN A;  4X3T A;  4RAU C;  4IUP A;  4IUT A;  2F0O A;  1FD7 D;  3Q24 A;  3R2I A;  2CQA A;  5EBD A;  1HA6 A;  2XWB B;  3IFD A;  3P1H A;  4E6I A;  3J80 L;  4CJ0 B;  3OMG A;  1CM9 A;  3TP8 A;  4CJ1 B;  3HOU B;  2XIW A;  2B39 A;  2K03 A;  2XVS A;  4IQZ A;  3MXP A;  1CTM A;  1LAB A;  3QG1 A;  4DXG A;  1WD1 A;  2MUY A;  4C56 C;  5FLX E;  5FO8 B;  2AQ1 B;  5A35 A;  3S17 B;  1TII D;  4L63 B;  4JBW A;  4DF7 A;  1B9M A;  4V0B A;  1TT2 A;  3I90 A;  3PUX A;  2F0U A;  2X6L A;  4IFD I;  5CV6 A;  1DOK A;  4KN7 C;  1SJH D;  3MHB A;  2IX3 A;  4TRD A;  4BA2 I;  5A2Q L;  4HCE A;  3VR6 A;  2EYM A;  3V96 A;  4Q5V A;  2RDF A;  5JVG 3;  5CR3 A;  3L9A X;  3RD4 A;  1Q3L A;  1TU2 B;  2Z8L A;  3DM1 A;  3PIO 3;  1STA A;  1FGB D;  3NXW A;  5EPJ A;  1LTA D;  2R61 A;  4ZQ3 A;  3IKJ A;  3NQT A;  3NUC A;  1HUN A;  2FIN B;  2JE6 I;  1J9O A;  3MFY A;  2WV6 D;  1JOK A;  3GTO B;  1A2T A;  2V4D A;  3MWY W;  4ZUI A;  3SK6 A;  3SXH A;  2E2J B;  2D9U A;  3T53 B;  4HN7 A;  2WIN B;  1H9M A;  1Y1W B;  1K83 B;  1EL0 A;  1TVX A;  1QCB D;  4FVM A;  3U9O A;  1EWH A;  2KEC A;  4OO1 G;  3DUZ A;  5A2Q E;  2CVR A;  4ZLT F;  2K1B A;  1L0X B;  3NTI A;  4U67 3;  4PV1 C;  3S1M B;  1IW7 D;  3CQZ B;  1X32 A;  4KKU A;  3A8K E;  5TSS A;  1EZ8 A;  2JA5 B;  3W3A A;  3I3C A;  2B63 B;  4IUV A;  1MI2 A;  3I72 A;  3TSS A;  3OHX C;  1WD0 A;  4QUC A;  3UI2 A;  4HTH A;  2EY2 A;  3S16 B;  1V8Q A;  3AU7 A;  4FF2 A;  2ZT9 C;  3SE0 A;  2FMC A;  2F0G A;  3HZX A;  4R8I A;  2VXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...