5EKKA

Crystal structure of staphylococcal nuclease variant delta+phs v39d/l125e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLDDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLERKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V39D/L125E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ekkA00
1SYGA 2EYFA 4PNYA 4ZUJA 5C6AA 4IUNA 1JORA 5KEEA 4F8MA 4EVOA 2EYJA 2PZTA 3MHBA 2F0TA 3NHHA 1STBA 4K5WA 2F0EA 2PZWA 3HZXA 2SNMA 4K5XA 4NMZA 1A2UA 2WACA 3PMFA 4ODGA 1KDCA 2PQEA 4HMIA 5JOBA 5I6YA 4YIJA 5K5PA 5J39A 2RBMA 4R8NA 3D6CA 4KTAA 3BDLA 1EY5A 2SOBA 1A3UA 1SYBA 2EYPA 2F0WA 2KHSA 3OWFA 5J1ZA 5IGGA 4DGZA 3DHQA 3H6MA 5IGBA 5IGCA 4NKLA 2F0IA 4I65A 3EROA 2EY6A 1STHA 5IGDA 3U9OA 1F2MA 1STAA 5J22A 2EYMA 1IHZA 3MEHA 5C3XA 1TT2A 2F3VA 4F7XA 5KYIA 4ID6A 3MVVA 5HGTA 2QDBA 1EY4A 1EYCA 2EYLA 2PW7A 1EZ8A 1SYDA 3D8GA 4PMCA 1A3VA 2F0VA 4N9TA 2F0OA 4S3SA 1SYFA 2F0HA 4E6IA 5IGFA 1SNCA 4EQNA 1SNPA 3EVQA 2PW5A 4QMGA 1EQVA 4B9WA 1A3TA 3C1EA 5CC4A 2F0PA 1AEXA 1II3A 2OEOA 4KV6A 1TR5A 2F0MA 5CR3A 1SYCA 3NP8A 3QOLA 4NDXA 3SK4A 5JAVA 3ITPA 1KAAA 4N9PA 1SNMA 5CV5A 1JOKA 2F0SA 5C4HA 2F3WA 5F2DA 1SYEA 3NUCA 1EY7A 5KGUA 3ERQA 4KJNA 3C1FA 3QB3A 1F2YA 4K8JA 1STYA 4EQOA 5EKKA 2LKVA 3D4DA 3HEJA 1EY0A 3SK6A 3NK9A 2EY2A 3SK5A 1RKNA 2EXZA 4EQPA 1EZ6A 2F0QA 1NUCA 4IZ8A 2HQEA 4NP5A 5DEHA 5E3FA 4QB4A 3SK8A 1JOQA 4WORA 4HTHA 4K2LA 4G57A 2F0GA 2O4XA 3MXPA 3OSOA 3R3OA 4KJOA 3RUZA 3TP5A 1ENCA 5KRUA 1EYAA 2NUCA 4IALA 2EY5A 1SNDA 4B9XA 2OXPA 2M00A 4RKLA 5CV8A 2F0NA 2F0DA 5I9PA 3NXWA 4RKBA 1EY8A 5KYLA 5CGKA 4MIUA 1SNOA 1TQOA 4PMBA 4KY7A 4QF4A 3SR1A 5CV7A 3SXHA 5C3WA 5I9OA 1STGA 4ME5A 4ZUIA 5IIFA 1SNQA 3P1HA 2PZUA 4K6DA 4K5VA 4DF7A 1ENAA 2EYOA 3EJIA 1F2ZA 3TP7A 3TMEA 5KIXA 2KQ3A 3E5SA 3P75A 1A2TA 5ISRA 4KY5A 5HURA 5CV4A 4LAAA 1KDBA 2SNSA 4K8IA 5E1FA 4K2KA 4WRDA 4H7BA 5CV6A 4J6HA 1NSNS 3S9WA 5C5LA 4K14A 3TP6A 1U9RA 3MZ5A 3NQTA 3D4WA 1JOOA 4DFAA 2F0KA 3T13A 2ENBA 4KD3A 4TRDA 3TP8A 4KHVA 3V2TA 5EGTA 3SHLA 3BDCA 2RKSA 4KD4A 2F0LA 5IOCA 4J1MA 4DU9A 5C4ZA 2F0UA 3DMUA 5I6WA 5EKLA 3LX0A 3T16A 2OF1A 1KABA 2PYKA 4HMJA 5CV9A 5NUCA 5IGEA 2RDFA 3QOJA 4KY6A 4OL7A 5C5MA 4ZQ3A 2EYHA 5IODA 1EY9A 2F0FA 5M9OA 5DAUA 3VA5A 1EYDA 1EY6A 2EY1A 3OMCA 1STNA 3OMGA 1KDAA 2F0JA
chains in the Genus database with same CATH superfamily
3QG1A 2K7VA 1HCZA 1W6JA 2IJ0A 1HZCA 1GXDC 4K5WA 4OXPA 5IP7G 2MJ8A 4JI7L 2QF7A 2B29A 2B8GA 5JVG3 2VQEL 4A3MH 2X6GA 2ZM6L 2DY8A 2A69C 4OELB 1U4PA 4K0KQ 1EIGA 1HR0Q 1QZGA 3NENA 1WTXA 1STAA 3KLWA 1IHZA 4X66L 4IOCA 2Z6KA 4WJ4A 1PDQA 4EGVA 3S1RB 1SXTA 1SYFA 1TWHH 2CW0D 4FXDA 1WCMG 4G7HC 2D0OA 5D3DA 5JPMC 3KLSX 4JYAQ 3K57A 2ICEC 4DR6L 3K5OA 1UAPA 1IYVA 1PRTF 4NDXA 3ITPA 3R8BA 3VYUA 3AEVA 1PHJA 4HR7B 1MSHA 2F0SA 4A3DG 2A68D 3NWTA 5IT9c 1SSOA 4A3GH 1B44D 1I6HH 2AQ3B 4QL5A 1D8LA 2B63G 1OXUA 2XN9C 2A74C 4NW2A 1VQ7A 3E9IA 1JOQA 2HQEA 4NP5A 4QB4A 4RA8A 1CKMA 4C3JG 3PO2G 1ESFA 4RH6A 2NVYH 3MEFA 1I5FA 3K59A 4UDUC 4GN5A 5ELOA 3DM3A 3PQIA 1V1PA 4F88A 1PYBA 1C9OA 2JJQA 4XQNA 5C3EH 4PMBA 5C0XI 1AZQA 2KCMA 3SGIA 4UP9A 1ILPA 5C3WA 3MA2B 5I9OA 3T1YQ 3C2PA 1SAPA 1X65A 3BU2A 3F2DA 3GV3A 2Q2TA 3RLFA 2ZXPA 1SFOB 4QQBX 3W1GA 1D5ZC 1LACA 5ISRA 3HOUG 1XWEA 1D2BA 4DA2A 2HIXA 2I5LX 3ULLA 2XIWA 4J6HA 4BY1B 1S4ZA 1I4HA 4DN4M 3STBD 2JE6I 2WV6D 4DFAA 2IX0A 4TRDA 1ZYRD 3UDFA 4BBRB 1I50B 4C3IH 1DOLA 1MIUA 2KUMA 2MNAA 2HHHQ 1UE7A 1UUPA 1LTTD 4AIMA 3H3VH 1K8OA 2QGQA 5GAEC 1KLGD 3CPWA 3R2IA 4ZCKA 3CCEA 2EY1A 1HZAA 1KDAA 1PRTB 2WAQG 1BCPD 3VR3A 1N36Q 2F0EA 2WACA 3KFUA 5JOBA 1KXLA 1UE5A 3IRBA 1JWSD 5FO8B 4POFA 4K0KL 3J7AF 1HR0L 1PTOD 3KLRA 4FDBA 1LUZA 3MXGA 3EROA 1D7QA 3FKIB 4MZ9A 2PW7A 3X3NA 1MJCA 4B3RQ 5FLMH 3CP0A 5D14A 3C1EA 3CF5A 5M5YH 4DR4Q 1H9SA 3CXCA 1Q8IA 3HOWG 2QW7A 1Y8NB 4JI2Q 5EBCA 1S5ED 4LFCL 3WWVA 5BR8Q 4KLKA 5BN3A 1YI2A 4DAMA 3C1FA 1NY4A 1I4GA 3PF5A 1MHWC 3NQIA 4JPBW 2GVAA 3PO3G 1HR0W 4CDFC 5M3MG 3GTPH 5E4WC 1F2LA 4LF8Q 1LABA 4LWCA 3J80L 5KRUA 2UXBQ 1ENCA 4KKUA 1Y8OB 4P74A 1HQRD 4X65Q 1DGSA 4LF9L 4RKLA 2PNRC 3SE0A 1IW7C 5LMUQ 4H13C 2I5HA 4IJLA 1KQSA 5K36H 3AMUA 3U50C 1WCMB 1M8AA 3ZJYC 1EIYB 1W3SA 5IYBG 1HNWL 3L2PA 4DAPA 4A3KH 1BCPB 5FO7B 2G5DA 2A8VA 4A3DB 3U58A 2EDGA 3I70A 5E7NA 1G2SA 3BDOA 3TP6A 1R4PB 3MZ5A 3A7LA 4QCLA 3J81c 5JVH3 1Z47A 3KOJA 4FF3A 2B63B 4YWKA 1R4QB 4C3JB 1HZBA 3PO2B 5M5XB 2HHHL 3HG9A 1MGSA 2OF1A 4DV1Q 1E2VA 1XX8A 1Z6HA 3MXUA 1Y1VH 1NBWA 3OMGA 3H94A 2AHOB 1BNZA 3BVGA 1G91A 1IBKQ 1JCKB 3CQZB 3M4OB 3HOUB 3AYHB 1ML0D 3CMEA 4ZYSA 5J1ZA 1XJVA 1LTRD 4CDDC 4JI1Q 3H6MA 1K83B 2LFNA 1UE1A 5IGBA 1SEBD 1PH9A 4GLAC 4TQUS 3MVVA 1HA6A 1GUWA 5IWAQ 4B3RL 2EYLA 2VY3A 3FRPB 3BVZA 3GTGB 4S3SA 3S1NH 4OIKA 4DR4L 4X62Q 1PZJD 3FP9A 1LTLA 4DV5Q 1NTGA 3PIO3 5ELBA 1IL2A 4X6AH 2AWNA 1BO0A 4IPGA 3HKZG 4CKEA 4CJ2C 2F3WA 2WAQB 3T51B 2B2UC 4LF7L 1FJGL 4OO1G 2A6HC 2K75A 1STYA 2JN4A 2N3SA 1GUSA 3WDNA 3SVMA 1N32Q 3K58A 1Q46A 3KBGA 4KK7A 2JA8G 1QUQA 2NZHA 3TP5A 1DJRD 2LS01 1I3QB 2NUCA 3W2DA 1SNDA 1VQPA 2QDLA 1A8VA 5KNDA 3GTLB 2PMZE 3UI2A 2L4NA 3A55A 3FEWX 4KY7A 4NXMQ 1YNXA 2OT2A 4B08A 1F2ZA 5IYDG 3GDEA 2KQ3A 3E5SA 4AH6A 3KK7A 1XPUA 2BE5C 5CV4A 5HURA 3A5UA 1PH2A 5IT9E 1WTVA 5J3BA 1QG7A 3KJOA 2OTLA 5GADC 3GTKB 3M4QA 5IE8A 3D4RA 3EIVA 3TP8A 4R4CA 4A3JH 5EGTA 3PO3B 5M3MB 2MFIA 1KC8C 2RDGA 5AFWA 1SBBB 5C4ZA 3CKIB 4BXXH 1TWAH 3T56B 4A3BH 3KUPA 2Q8TA 1R9TH 2EYHA 1EY9A 4LK1C 1IBKL 2HUGA 4QGUA 4ZUJA 1XMQQ 3H3VC 1K8AC 3F2BA 3S2HB 4R8IA 4ZKBB 4G7ZC 4YIJA 1IYUA 3S16B 2EZVA 3BDLA 2SOBA 3X3MA 4XQQA 3HOXG 3K80C 4GOPA 1DXMA 2UUAQ 3VR2A 2E2HB 1WTPA 5IWAL 1X55A 1D5MC 1TT2A 2KVMA 3K0XA 1EZ8A 3NSWA 1JR0D 4LUVA 4X62L 5IGFA 2F0VA 2A69D 4E6IA 4LJZC 2G9HD 3S17H 4HCEA 4JI4Q 3OWEB 2AUJD 2CWAA 1AN8A 2E8GA 5D3IB 4RMFA 1GUNA 4GNXA 1Z7TA 1Y1WG 3ONAB 1KRSA 1TS3A 2QA4A 5FLXL 3AFPA 3NELA 1BBUA 1DCZA 1YHAA 2E2JB 2K5VA 1JMCA 1Q3LA 3T1HQ 4GS3A 1RKNA 5E3FA 1FNWA 4CDEC 5LMNQ 1TWFB 1HHVA 5G3LF 3DWPA 2BA1A 1DM0B 3GTOH 3KBXA 4R4QA 4IALA 5IP9H 3DXJC 4POGA 4DR1L 2EQSA 3NXWA 4IPHA 1WTHA 5A2QE 3S1MH 4OONA 4G7OC 4K5VA 1TWGB 2K5QA 3HOVH 1PFNA 3NWSA 2EYOA 4NXNQ 5EKIA 1MKHA 4PMWA 3I4MG 5KIXA 3BZKA 1NCVA 4IFDG 1AE2A 4K8IA 1RIPA 3A54A 3HKZB 3RZOB 3VA7A 4CBVA 4K14A 2K32A 5C4XH 2KHIA 4A3EG 2AUKA 2DJFC 1O80A 3S15H 2UXDL 1EFID 4DU9A 4DV4Q 2JA8B 2ZTDA 4TKOB 4DR3Q 3JAMc 2JA5H 1FNVA 2JA6G 3F2UA 4Q5VA 2PQAB 3NBIA 1EL0A 3CAMA 2NVXH 4DV2Q 4AYBE 3B6YA 1WI5A 4PNYA 1BDOA 2B39A 2B3GA 4GN3B 4CGYB 5KNBA 1CHQD 1QCBD 5K5PA 1YJWA 2RBMA 4CKBA 1C7YA 1SYBA 3OWFA 2TMPA 3J81E 1JWMD 4OEMB 3TN2A 4DV7Q 4APVA 2EE1A 2RQXA 4OO1I 1XMOQ 2I0QA 1I4RA 4YWLA 3V05A 3J81i 3QJYA 1BBWA 2RDHA 2PNHA 3OW7A 3H0GH 4A4IA 4X64Q 3R2TA 2JYOA 1VQ6A 2UUCQ 2OQKA 4A3LH 5EAYA 4P2CB 1ILQA 2LSSA 3QOLA 2VQFL 5HY6A 2XVSA 1WJJA 1DONA 1O78A 1HRJA 4LF5Q 1S5BD 1X3EA 3GP7A 3HRZC 4ABNA 3SK6A 2EY2A 2EXZA 1PH3A 3HOXB 2HCIA 4HEDA 5M5WB 3C46A 2JA7G 3OYYA 2HQLA 3G6EA 2CH4A 2Y0SG 1UEAB 4NPSA 4BY7H 4KHPQ 2F0DA 4C3HH 1B3QA 3PGZA 1S40A 4HCSA 4NXNL 1ICFB 1STGA 1HNXQ 1SNQA 1E7ZA 3I4NH 1Q81C 1VMCA 3GTJH 4ZK9B 2A19A 1S5CD 3EBEA 4QJFA 3J7A5 5H1SE 4G4KA 3BG3A 5BN4A 2H5XA 3DWAA 1OXVA 3DM1A 1Y1WB 2L15A 1QWYA 1VMPA 1IBML 3NQTA 1EQTA 4CJ0B 2R7ZH 3S14B 4KD3A 4A3CG 4KHVA 4JI6Q 3GTQB 2N55A 1PMRA 4OWXB 3CW2C 2BDOA 2F0UA 2P5ZX 2O2LD 3TSSA 2R7DA 5GROA 2VNUD 4GKKQ 3MFGA 2RCFA 2WKCA 1EY6A 1VQHA 5FO9B 3S1QB 4TVAB 1OXXK 2C35B 1LT6D 4BA1I 5KEEA 1B9MA 1NJIC 1ET9A 2WIIB 3I4MB 5I6YA 4PV1C 1C0AA 1CZWA 1SLJA 1CZGA 2F3IA 2EYPA 4IURA 1SN8A 1EOVA 2EXDA 1AW7A 2ATWA 4A3EB 4GOPC 3T4AC 3CD6A 1PH6A 3BZDB 3M3YH 5HGTA 1Q86C 1EY4A 3I8ZA 2UU9Q 5DLQE 1Q1EA 3HOZG 2Z9HA 3HOYB 2UUCL 3CPFA 2UUBQ 1J8IA 4DV6L 1AFPA 1L0WA 2ZT9C 4DV3L 4P72A 4KI0A 2JA6B 1YJNA 5I4DA 4Y52H 2XWBB 4C1NK 4P75A 4DNIA 1SMYC 4Q0FA 4XT1B 5FJ8G 4C3IG 4JI0Q 1H9KA 3TREA 4DR7L 2F0QA 1JB3A 3M85A 3SK8A 1N8RC 1AZPA 2YU9H 4IFDI 3VR6A 3MXPA 3OSOA 4KJOA 1SFOH 1VF5C 2JSOA 2UXCL 1U4MA 2A6HD 4HN7A 4DXGA 1B50A 4IUQA 1K8MA 1HNZL 2F0NA 1L1OC 2K52A 2J7ZA 1YIJA 4C2MB 4OX9L 4AQYQ 1L0YB 2PZUA 1LTID 1ONLA 3TP7A 4MHEA 1VQAA 3AB9A 4DUYQ 4BBRH 2X6LA 4WRDA 3S9WA 5JJIA 4JV5L 4ILWA 2LY7A 3ER0A 4LF4Q 1T5EA 5FLMG 2F0KA 4PZ6A 4HIOA 1RTNA 3CC7A 4JBKA 1B1ZA 2BE5D 5EBDA 1VQCA 4I7ZC 1PFBA 5COYA 1FVIA 1QNKA 3D0FA 2JA7B 3BVMA 4KMUC 5DNFA 4FF1A 2PYKA 2Y0SB 2NN6H 2IT1A 5C5MA 4JI3L 1QJOA 3ZYYX 3QIAA 2RSNA 3VA5A 5JEAH 4RCNA 4CJ1B 4JBJA 3OHXC 1K3RA 2F0JA 4CKCA 4ZKCB 2BH2A 2SEBD 3QR8A 1YNJC 4NMZA 2AWOA 4DUZQ 5J39A 5AJ3Q 2KEEA 1GUOA 1IZ6A 3VYTA 1QVCA 3AFQA 3U9OA 4LMQD 3I7FA 1KLUD 2FINB 3MEHA 3BJUA 5DM73 5C3XA 4A3FG 1G6ZA 2MUYA 4A3KG 4DNTB 3J7YW 2QDBA 3GD7A 1HA5A 3JAME 3H09A 2K04A 1IKLA 1K0RA 3FPUB 4EQNA 1K0SA 5JJZA 4DR5Q 1PLFA 4B9WA 3E0EA 4DK3C 1BCPF 2F0MA 3JAMi 3WOEA 2NVTH 1KAAA 3CU7A 3UDIA 3I73A 4IUTA 4RCOA 3RD4A 1JOKA 4HJ5A 2IY5B 5JJKA 1I94Q 5EPJA 5GQOA 2MHVA 2CWPA 5ELEA 1PTOF 3CCLA 2NVYB 4R4OA 1E2ZA 2L11A 4K6LA 1EZ6A 5DEHA 2XRSD 2ALYB 5C3EB 4QUCA 1V1QA 1IKMA 4G57A 1Y8PB 4JYAL 2E5LQ 4DKAC 2I46A 3UE1A 1VQNA 1SROA 2OXPA 2EJGC 2HDLA 1IL8A 3G4SA 2E2IH 2EVBA 3HOZB 4EX5A 2B63H 2JEBI 3PO2H 1SJHD 1CKNB 1YHBA 5JEAJ 3S2DH 1VQ4A 1K73C 4C3IB 5C44H 1KHIA 1HTLD 1O7LA 4GLVB 3TEHB 3T1YL 5EPKA 2ZJQA 4RAUC 2MO0A 5EKLA 2IHFA 3CQZH 3I91A 3ULJA 4GKJQ 4DR2Q 3M4OH 1B4OA 3CCVA 4XYOA 2JXMB 1Z9FA 2RA4A 3QWNA 1LTGD 4BA2I 1E1TA 4XIGS 5DAUA 2WB1G 1K83H 1STNA 3M4PA 4JC0A 4YCVA 1XTDA 3GTMH 1EWHA 1JORA 4F8MA 2PZTA 2F0TA 3GQBA 5AJ3L 1HXYD 1PTOB 4FVMA 4LFAQ 5A2QL 4A93G 4JOIA 3Q24A 2VL6A 1X3PA 3AQQA 3GTGH 2O5IC 1J6QA 1KD1C 2PI2A 1KRTA 1NR4A 2PPBC 4DNRB 2A5HA 2RCNA 4F7XA 1QNUA 3OTOQ 1EIHA 3BS1A 1XNRQ 3G6JB 1YNNC 1A3VA 1HPCA 2F0HA 1N36L 1U4RA 3EVQA 4X3KA 4YHHQ 1VCIA 4KN4C 1V1OA 2IHEA 2AQ1B 4A3JG 5CBAE 2G9DA 4L6TB 1I3QH 3DEPA 4ME3A 1RCVD 4BXXG 3ERQA 1G6PA 4KJNA 4DAYB 1VS0A 1H9JA 4IPCA 4JI8Q 1U4LA 2DNCA 2F0GA 3R3OA 2RVLA 2MQHA 2YYZA 2Z6KC 2ZTCA 3A8KE 3KYHC 5ELCA 1EYAA 1WTOA 4A75A 2YTXA 1N34Q 3HOWH 3J81L 2E74C 4A3FB 1V8QA 4A3KB 1GUGA 3NEMA 4JI2L 1NR2A 2Z1CA 5BR8L 2NVQH 2FHTA 1FGBD 2A73B 3GTKH 3M7GA 3CC2A 3RNUA 2WKDA 1WFQA 5M3MH 1GOZA 1LM0A 1JE5A 5ELNA 1CSQA 4LF8L 5IY0A 1YJ9A 1E3PA 4H7BA 2K14A 2UXBL 4MTNA 1K9MC 1U9RA 4X65L 1BVSA 3V96A 5LMUL 1VQGA 5LL6S 2WP8J 2ZTEA 2O5JC 1N33Q 2J4XA 2YV5A 2AQ2B 2NZOA 3A74A 3MC0B 1Y1VB 2R92G 5EQ0A 1B53A 3S2HH 2Z8LA 1TS5A 3IFDA 1PRTC 3U4VA 4UHVA 1E22A 1W6KA 4P71A 1VQ5A 1TKWB 1GKHA 5E1FA 1B3AA 4EVOA 2EYJA 3A5ZB 5IODA 1ENFA 4H44C 3K6OA 3EQLC 4UP7A 1CK1A 4J15A 3IL8A 1ET6A 4DGZA 4DV1L 4X3TA 2VUMG 3S1NB 4DAVA 4P73A 3HOVG 1XNRL 1Q90A 2R93H 4A3IH 2QCPX 3EA6A 3OIPA 1VQFA 4YHHL 4XTCS 1TIID 1FR3A 5DM63 3RN2A 1WD1A 2DJGC 4KV6A 1MJEA 2WB1B 3HP3A 4JI1L 1SNMA 5C4HA 5GAGC 3KDFB 3I4OA 1DD2A 1TVXA 3RLNA 3IAYA 2HD3A 2BOSA 4UP8A 4A93B 1SRUA 2CKZB 2N88A 2LKVA 1LLRD 2L12A 1QB5D 5IYCG 1SMYD 3GO5A 3K7UC 4DV5L 1B2TA 1F9SA 2DGYA 3L3OC 3Q0AA 5CV8A 4CHTB 3RZOH 4QIWB 4GN4B 3T53B 5LL6X 2OWOA 4Y7NH 5CV7A 1VQLA 4DXFA 3BYTB 1XNQQ 1N32L 3CCSA 2V4DA 3PF4A 3K81C 1CM9A 1KDBA 2D2CC 2SNSA 1JQYD 4A3JB 2JA8H 3SEBA 4PZ7A 1I6VC 1PYWD 5C5LA 1VQIA 1TWAB 2JA9A 5TSSA 3NTHA 2E2DC 2HT1A 4A3BB 1HQMC 1G8ZD 2PQAA 1R9TB 1NNXA 4A3LG 4NXML 5CORA 3BDCA 4J1MA 4NB3A 1PH7A 3FVQA 3DMUA 1RTOA 2VW9A 3HGBA 5IYDH 4B3TQ 3FMCA 1AP0A 2FFKB 5G3LD 1LTBD 2WINB 4HIMA 1E24A 1EYDA 2VB2X 5T1IA 3C3LA 1SYGA 1H9MA 4JI5Q 2I5MX 1PH4A 3RZDB 2HDMA 3PUWA 4BY7G 4M8AA 4LF6Q 4C3HG 1BR9A 3BZCA 3HS0C 4JOIC 4HJ7A 3KF6B 2KJXA 1D1IA 1IBLQ 3HOYG 4DK0A 2KCNA 2L0CA 3MTSA 3I2ZA 1M90C 1YNJD 2I07B 4KN7C 2K5HA 2PMZB 5E4XA 1XMQL 1CHPD 2R92B 1VQKA 4RHSA 1X3FA 2F0PA 1TWCB 2OEOA 2R7ZG 1H9RA 1BXTA 3SK4A 2IL8A 1EYGA 2NBFA 3W1BA 2UUAL 1L2FA 2NTSA 4UPAA 4YY3Q 2E76C 1OO9B 2XWJB 4U673 1WTRA 1L1OB 1PH1A 1J5EQ 1IXRA 4IO9A 4PQXA 4K8JA 3GTOB 1OTCA 1EY0A 3VDYA 3RLOA 4HAEA 1EUJA 4JI4L 4R1JA 2VUMB 3S1MB 1TU2B 4XT3B 1I4XA 4KKSA 4DK6C 1EFWA 3HOVB 1Y1WH 4BBSH 1GD7A 1O7IA 3H15A 1EEID 5M3FG 4B3SQ 4WFN3 2AKWB 2F4VQ 2F4IA 3A0JA 4L63B 3S14H 1P8LA 3JAML 3T1HL 3TMEA 5A35A 1X32A 2QKIC 3L0OA 1ZEQX 1O7ZA 5LMNL 3G7LA 1YBYA 3AU7A 1YITA 2BDNA 1NSNS 3M4YA 1BOSA 1D1KA 1GVPA 2NZ1D 1JOOA 3I3CA 3T13A 5I2XA 3Q8DA 3S1QH 2IW3A 2DNEA 3SHLA 4A3MG 2D9UA 2ZM6Q 1A63A 1U0LA 3I4MH 1ICWA 3IFTA 5IGEA 3NBHB 4IFDH 4GZYC 1GHJA 3NTIA 2FXQA 3LWEA 3OMCA 4X66Q 4L5RC 2KENA 1OXTA 2EYFA 3PUXA 4X3UA 2KOLA 1JJ2A 2Y0SE 1DZ1A 4WJ3M 2N8NA 4LF6L 1KL9A 4R8NA 4GLXA 5LMNW 4XYQA 4DR6Q 5T1GA 4DV4L 3U9SA 1A3UA 2KHSA 3D3RA 2F0WA 2FJ2A 3A8IE 4PG3A 4DR3L 2CCZA 1C8CA 4LW1A 2IPKD 4A3GG 2CVRA 1FD7D 3L9AX 3CCMA 4DV2L 1K3BC 4RHRA 1EYCA 1MD2D 4DV0Q 1SNCA 2GA4B 2PW5A 5C0XH 3I55A 1A3TA 1XXGA 1II3A 1KNEA 3FDTA 3S1RH 2K1BA 4YY3L 1SE4A 2DY7A 3W5OA 5C3EG 1X9NA 1YNND 2YTVA 3KF8B 3CRLC 4DV7L 3QB3A 4N8FA 1XMOL 4EQOA 4C2MH 2LXKA 1S3OA 2F52A 2NN6G 3HEJA 4BY7B 1JC7A 5C4JB 3M7NA 3R93A 3ND9A 4C3HB 4IZ8A 5JEAG 1EWIA 4WORA 4HTHA 4X64L 1FYCA 3CHBD 4L5SA 2Z0SA 1UWVA 1VQMA 3PSIA 3K7AB 1TXYA 3MXNB 3PCOB 1WYDA 1VQ8A 4B3SL 1B8AA 3GTJB 1G51A 1A6XA 2M00A 3J81j 1RF2D 1VQEA 1TY2A 2F4VL 4M1UB 2B2WA 4MIUA 4TSSA 4LF5L 1A62A 3SR1A 4ZAIA 3MAQA 1QVGA 1LT5D 2J0TD 4GNXC 4ULLA 2ZXRA 4WJWA 2R7ZB 1A0IA 1KTKA 2JA7H 4K2KA 5CV6A 2ZJRA 1HH2P 4KHPL 2K05A 1LYLA 1YEZA 2R3ZA 3OOCA 4H02A 3MFYA 2K5WA 2Q2HA 2F0LA 4XDXA 4BY1H 1HNXL 1CUKA 5I6WA 2OTJA 2ASBA 5NUCA 2RDFA 4KY6A 1GJXA 1G291 2H4OA 1EQQA 2NWGA 3CMAA 5M3FB 1TS4A 4BWGB 1I50H 1CSPA 3VR4A 5JPNC 1ZXTA 4RGMA 3NHHA 4K5XA 4A3CH 1HJPA 1PRTD 2PZWA 3ICEA 3FPPA 3UDGA 1HTPA 4JI6L 3LNNA 2B2UA 5C0XJ 2A6EC 5I2YA 3I56A 3M3YB 1NE3A 1RD9D 3OPOA 3RR5A 4LFCQ 2R7FA 1STHA 4GKKL 2B2VA 2JP1A 4N8X1 2Z4HA 3FHWA 4DV0L 1T5XD 4A3MB 2EIFA 2F0OA 3FKIH 1NMFA 3RMHA 4QMGA 2LMCB 5CC4A 5C44G 1XYIA 3DWQA 4KKTA 2LXJA 1PZID 3A7AB 3NP8A 5JAVA 2NYZD 4LF9Q 1EOTA 1DYQA 2ID0A 1JT8A 1VQDA 2YU9B 4YCWA 5K36G 1TWHB 1KNAA 5IT9L 2PCFB 3JC66 1Q12A 2XTIA 3SK5A 4ZRZA 1HNWQ 1B7YB 2UU9L 1NUCA 3HOZH 2UUBL 1QZHA 1V43A 1HZ9A 4KHZA 5IP7H 1EQRA 3WOFA 1BKBA 3BYYB 4A3GB 5I9PA 3F2CA 1I6HB 5KYLA 2HCCA 5CGKA 1F9RA 1CKNA 1S5FD 1TQOA 2RF4A 1WOCA 3PUYA 2K5DA 1E1OA 5FJ8H 4JI0L 2PI2E 4IPDA 1VDZA 4MTKA 1Q7YC 2PO4A 3EJIA 3PIPA 1AH9A 1GHKA 3PUVA 2QEXA 1V1PB 1Y69U 3KJPA 1S5DD 1Y1VG 1JJCB 1WCMH 2WAQE 3J80c 3D4WA 4A76A 1SDFA 2N78A 1YVCA 2K03A 4A3DH 2RKSA 4BS9A 4AQYL 4OWTB 4HIKA 1YHQA 2JK8A 1F9PA 2OQ0A 1M1KC 1BBXC 1TY0A 1PTOH 3LX0A 5EJWA 5CV9A 1RHPA 3A8JE 4OWWB 4DUYL 1L0XB 2VXWA 3NPPA 1RL2A 4ZQ3A 5M9OA 1QE6A 4QUFA 1X3GA 1RDPD 4C3JH 1UE6A 3CC4A 2XRQD 1B9NA 4LF4L 5M5XH 2D62A 4DK1A 1O7YA 3D6WA 3M9BA 3HZXA 1STEA 1CFMA 2N49A 2Q8IB 2XSCA 3K8AA 4LUZA 3TZDA 4KTAA 3RN5A 4IOAA 3P7JA 5IGGA 3QO2A 4U68A 4I65A 1W2BA 2L5TA 2EY6A 3LWUA 3ERSX 4LF7Q 1FJGQ 2X69A 3E0JA 3HOUH 1PH8A 3EFXD 3W3AA 2NN6I 2NVTB 1EWCA 2K5NA 1SNPA 4DAYA 4L5TA 4DUZL 4Z9CB 4HSPA 1WD0A 1U5KA 1VQ9A 1CT1D 2KBNA 3UDXA 4RG1A 4N9PA 2NTTA 2VZAA 1H95A 2EJFC 3ULPA 2CFMA 2ICIA 3J7AV 4IUVA 4A3FH 1SE8A 2K6AA 4L8JA 1E2WA 2L9HA 2VS1A 2WB1E 1H9SB 5M5YB 2BCOA 2E2IB 3IKJA 4DR5L 3H3VI 4B3MQ 4O0AA 2EY5A 1AE3A 4IUPA 2F1MA 1EY8A 4RKBA 1I94L 1NAPA 2JEAI 1MBYA 2R61A 3I72A 2IX1A 2OCEA 3K0YA 4L5QA 2B2WC 2TSSA 4OIJA 5IIFA 3GTPB 3S2DB 3VYRA 5C44B 3GTLH 2IWHA 4QIWE 4A3BG 3P75A 2DN8A 2L55A 4JK1C 2R93G 4A3IG 2E5LL 1RODA 1TS2A 2NB0A 1KAWA 3ND8A 2ENBA 2BA0A 2CH4W 3MWYW 1LV9A 3L7ZC 2K33A 3CCUA 1ZKOA 3E3XA 3GTMB 3UE0A 4ZLTF 1JJGA 3E9HA 4C56C 3PO3H 2E75C 5EPLA 1UEBA 4IUNA 3D31A 2EPBA 1X56A 3MHBA 2ZJPA 4FP5D 1YZ6A 3TRZA 1NMGA 4FYDA 3O13A 4O2DA 3OW2A 2IX3A 3HKZE 2EOTA 2CHBD 2B2YA 2CW0C 2QILA 4FNFA 4GKJL 4DR2L 2B2TA 1WTWA 5IYBH 1PA6A 1PZKD 3S16H 1PFMA 3N6RA 2B2VC 2A68C 4PMCA 3KDFA 3VR5A 2E2HH 4DPGA 1F77A 4RGNA 4A93H 1PYSB 4LFAL 1IYJB 2CQAA 1EQVA 1WTQA 4XQJA 2KA7A 2EJMA 1AEXA 1TR5A 5IP9G 1MSGA 4DR1Q 5CV5A 4V190 4JVZA 3NUCA 1SR3A 3I90A 5L37A 4LNQA 1M4VA 1A15A 3OTOL 1RJTA 3HOWB 1QILA 2MO1A 1GUTA 2K4KA 4B3ML 2KHJA 3DUZA 2ES2A 2NVQB 3OIQA 4H0LC 3RUZA 2E2JH 3Q6SA 1XTCD 2F03A 1X3QA 5C4XG 1Q1BA 4JBWA 1PFSA 3TS0A 1TWFH 4O1NA 1Q8KA 2UXDQ 2C5CA 3A56A 5FLXc 4ZUIA 1G2TA 4R4TA 3STBC 1QUQB 3P1HA 2GN5A 1JE4A 3S24A 3URYA 4JI8L 1Y14B 1ZYRC 4YCUA 3TQYA 2JA5G 4KY5A 4HJ9A 4LAAA 1SJED 3CRKC 1TWGH 4IQZA 1N34L 4RFBA 3HFZB 4QY7A 1KIXA 1BUVT 2GVBA 4FO2A 2Q8RE 2K28A 1CTMA 1BCPC 3RZDH 1PXUA 3E6ZX 3NTKA 4OO1H 1CKOA 3T16A 1CQFA 4UY8C 4HMJA 2RSOA 3QOJA 4IUUA 4OL7A 1J9OA 1GO3E 2QEJC 3F1ZA 3TS2A 1E0BA 1SE3A 1PTOC 2CQOA 1EEFD 3KF6A 3K5MA 1HUNA 4CDCC 5C6AA 1GM5A 1N33L 1STBA 2XNAC 2SNMA 1A2UA 2V1CC 3PMFA 3H0GG 3Q23A 2PQEA 4BBSG 1FGUA 4YWMA 2R92H 4XXEA 3J80E 2R93B 4A3IB 2D5DA 4FF4A 2VQFQ 2F0IA 1QVFA 1TWCH 1F2MA 1MI2A 4FXKC 5J22A 3PIOA 1BF4A 2D0PA 3J80i 5CYUA 2B8FA 5FKAC 2A6ED 3CCQA 1SYDA 4LFBQ 3PV0A 4GOPB 1L1OA 1VQJA 1CI3M 3TDQA 1D6EC 4LUOA 5CR3A 1SYCA 5GAHC 5CMDA 3EN2A 1K8GA 2VUMH 4JBMA 1EY7A 5KGUA 2BH8A 1D5XC 3U4ZA 3I4NG 1B70B 3S17B 1DOKA 1C4QA 4EQPA 4IN3A 4GNXB 1HFGA 4RGOS 1LTAD 1HFNA 2AMCB 4AYBG 4K2LA 4HSVA 4Y7NB 3GV6A 3VYSA 1X6OA 2KECA 1UNSA 4B9XA 3K5LA 1IBMQ 2YTYA 1PV4A 2FMMA 3HOXH 4HJ8A 5M5WH 1F9QA 2Q2UA 1I4PA 3SXHA 1EU3A 3CCJA 1VQBA 2Z6BA 2M2LA 1CQVA 4K6DA 4DF7A 4R9WA 5FOBB 1ENAA 4RWSC 2A1AA 2MGSA 1BQQT 4HJAA 1CA5A 1A2TA 1K28A 3KLSA 5IYCH 1PH5A 1DOMA 1EIFA 4IJHA 2RHSB 5D65A 2FMCA 1WVLA 5ELFA 2HIVA 5BN5A 2MPMA 1N9WA 3NBHA 1X54A 1PVOA 5C0XG 1SMXA 2K01A 3J7ZC 4KD4A 2M9VA 5IOCA 4ALPA 4V0BA 2MP1A 1XNQL 1C48A 1VF7A 3P20A 1V9PA 3K5NA 1S72A 5JJLA 3GTQH 5C4XB 1LT4D 1CA6A 3S15B 3LGJA 2Q2IA 2XGTA 2RHQB 4ODGA 1LO5D 1KDCA 1SE2A 4HMIA 5ELDA 4DV3Q 3H91A 4DV6Q 2JA5B 3D6CA 4UAIA 4JI7Q 2ZXOA 1EY5A 2VQEQ 5IGCA 3DHQA 4R4IA 2NVXB 4NKLA 4B3TL 4X3SA 4JCVE 5IGDA 2VB3X 3HKSA 3G71A 5CBEE 2B2YC 4C1NI 2EYMA 2B2TC 4MNOA 2F3VA 5KYIA 4LFBL 4ID6A 1OXSC 1P16A 3D8GA 1ESRA 4JI5L 4EQ5A 4DR7Q 4N9TA 3KF8A 4A3EH 5C4JH 4OGQC 1Q82C 1JB7A 3I4LA 2KCCA 2UXCQ 1HNZQ 4O42A 3HOYH 1IBLL 4BY1G 1ASZA 2K50A 3K7AH 3NE5B 1SYEA 5F2DA 1LT3D 4OX9Q 4HIDA 2KEDA 2SDFA 2H1EA 3MXNA 1F2YA 5LHY1 1HUMA 2JA6H 3H0GB 5EKKA 3Q22A 1JICA 3D4DA 1IW7D 4BBSB 3NK9A 1EU4A 3TZUA 4BBRG 1LTSD 2O4XA 4MN3A 4J8QA 4JV5Q 1XPOA 2JQOA 3SDZA 1SNOA 4QF4A 2Z4IA 3F8TA 4I7AA 1J5EL 4JW0A 4ME5A 1XPRA 3DLLA 3TBIB 1ASYA 2L1BA 4OHJA 3PUZA 3G48A 2WFWA 4JI3Q 1QOHA 2C9OA 1T9HA 2DUDA 3N52A 4JG2A 3FKIG 4F87A 4FF2A 3I4NB 5M3FH 2R6GA 3DEOA 1VQOA 3V2TA 2KCTA 4RGTA 5FK9C 3PIP3 5KNCA 1FNUA 5HGQA 4AYBB 1FL0A 1I4QA 1JWUD 1KABA 3CCRA 4FXGC 5FLXE 2F0FA 4PZ8A 4IFDJ
chains in the Genus database with same CATH topology
3QG1A 2K7VA 1HCZA 1W6JA 2IJ0A 1GXDC 4K5WA 2MJ8A 2QF7A 2B8GA 5JVG3 2X6GA 2DY8A 2A69C 1U4PA 1EIGA 1WTXA 1STAA 1IHZA 1PDQA 4EGVA 3S1RB 1SXTA 1SYFA 2CW0D 4FXDA 4G7HC 5D3DA 5JPMC 3KLSX 3K57A 2ICEC 3K5OA 1UAPA 1IYVA 1PRTF 4NDXA 3ITPA 3R8BA 3VYUA 4HR7B 1MSHA 2F0SA 2A68D 3NWTA 1SSOA 1B44D 2AQ3B 1OXUA 2XN9C 2A74C 4NW2A 1JOQA 2HQEA 4NP5A 4QB4A 4RA8A 4C3JG 1ESFA 4RH6A 3K59A 4UDUC 1V1PA 4F88A 1AZQA 4XQNA 4PMBA 5C0XI 1ILPA 5C3WA 3MA2B 5I9OA 3C2PA 1SAPA 3GV3A 3RLFA 2ZXPA 1SFOB 1D5ZC 1LACA 5ISRA 1XWEA 1D2BA 4DA2A 2XIWA 4J6HA 4BY1B 1S4ZA 1I4HA 4DN4M 2JE6I 2WV6D 4DFAA 2IX0A 4TRDA 1ZYRD 4BBRB 1I50B 1DOLA 2KUMA 1UUPA 1LTTD 1K8OA 1KLGD 3R2IA 2EY1A 1PRTB 1KDAA 1BCPD 3VR3A 2F0EA 2WACA 5JOBA 5FO8B 1JWSD 3J7AF 1PTOD 3KLRA 3MXGA 3EROA 3FKIB 2PW7A 3X3NA 5D14A 3C1EA 1H9SA 1Q8IA 1Y8NB 5EBCA 1S5ED 5BN3A 3C1FA 1I4GA 3NQIA 5E4WC 1F2LA 1LABA 3J80L 5KRUA 1ENCA 4KKUA 1Y8OB 1HQRD 4RKLA 2PNRC 3SE0A 1IW7C 4H13C 5K36H 3AMUA 1WCMB 1M8AA 4DAPA 1BCPB 5FO7B 4A3DB 2EDGA 3I70A 1G2SA 3BDOA 3TP6A 1R4PB 3MZ5A 3A7LA 4QCLA 5JVH3 1Z47A 4FF3A 2B63B 1R4QB 4C3JB 3PO2B 5M5XB 3HG9A 1MGSA 2OF1A 1E2VA 1XX8A 1Z6HA 3MXUA 3OMGA 3H94A 1BNZA 3BVGA 1G91A 1JCKB 3CQZB 3M4OB 3HOUB 1ML0D 4ZYSA 5J1ZA 1LTRD 5IGBA 3H6MA 1K83B 2LFNA 1SEBD 4TQUS 3MVVA 1HA6A 1GUWA 2EYLA 3FRPB 3BVZA 3GTGB 4S3SA 4OIKA 1PZJD 3PIO3 5ELBA 2AWNA 1BO0A 4CKEA 4CJ2C 2F3WA 2WAQB 3T51B 2B2UC 4OO1G 2A6HC 1STYA 1GUSA 3WDNA 3SVMA 3K58A 3KBGA 4KK7A 3TP5A 1DJRD 2LS01 1I3QB 2NUCA 3W2DA 1SNDA 5KNDA 3GTLB 3UI2A 2L4NA 3A55A 3FEWX 4KY7A 2OT2A 4B08A 1F2ZA 2KQ3A 3E5SA 3KK7A 2BE5C 5CV4A 5HURA 5IT9E 1WTVA 1QG7A 3GTKB 3D4RA 3TP8A 5EGTA 3PO3B 5M3MB 2RDGA 5AFWA 1SBBB 5C4ZA 3CKIB 3T56B 3KUPA 2Q8TA 2EYHA 1EY9A 4LK1C 2HUGA 4ZUJA 3H3VC 3S2HB 4R8IA 4ZKBB 4G7ZC 4YIJA 1IYUA 3S16B 2EZVA 3BDLA 2SOBA 3X3MA 4XQQA 1DXMA 2E2HB 3VR2A 1WTPA 1D5MC 1TT2A 2KVMA 1EZ8A 3NSWA 1JR0D 5IGFA 2F0VA 2A69D 4E6IA 4LJZC 2G9HD 4HCEA 3OWEB 2AUJD 1AN8A 5D3IB 1GUNA 1Z7TA 3ONAB 1TS3A 5FLXL 1DCZA 2E2JB 1Q3LA 1RKNA 5E3FA 1FNWA 1TWFB 1HHVA 5G3LF 3DWPA 2BA1A 1DM0B 3KBXA 4IALA 3DXJC 3NXWA 5A2QE 4G7OC 4K5VA 1TWGB 2K5QA 1PFNA 3NWSA 2EYOA 5EKIA 4PMWA 5KIXA 1NCVA 4IFDG 4K8IA 3A54A 3RZOB 3HKZB 3VA7A 4CBVA 4K14A 2K32A 2AUKA 1O80A 1EFID 4DU9A 2JA8B 4TKOB 1FNVA 3F2UA 4Q5VA 3NBIA 1EL0A 4PNYA 1BDOA 2B39A 4CGYB 5KNBA 1CHQD 1QCBD 5K5PA 2RBMA 4CKBA 1SYBA 3OWFA 2TMPA 3J81E 1JWMD 3TN2A 2EE1A 2RQXA 4OO1I 1I4RA 3V05A 3QJYA 2RDHA 3OW7A 3R2TA 2JYOA 4P2CB 1ILQA 3QOLA 2XVSA 1DONA 1O78A 1HRJA 1S5BD 3GP7A 3HRZC 4ABNA 3SK6A 2EY2A 2EXZA 3HOXB 2HCIA 4HEDA 5M5WB 3C46A 1UEAB 2F0DA 4HCSA 1STGA 1SNQA 1VMCA 4ZK9B 1S5CD 4G4KA 3BG3A 5BN4A 3DWAA 1OXVA 3DM1A 1Y1WB 1QWYA 1VMPA 3NQTA 1EQTA 4CJ0B 3S14B 4KD3A 4KHVA 3GTQB 2N55A 1PMRA 2BDOA 2F0UA 3TSSA 2O2LD 2VNUD 3MFGA 2WKCA 1EY6A 5FO9B 3S1QB 1OXXK 1LT6D 4BA1I 5KEEA 1B9MA 1ET9A 2WIIB 3I4MB 5I6YA 4PV1C 1CZWA 1CZGA 2EYPA 4IURA 1AW7A 4A3EB 3T4AC 3BZDB 5HGTA 1EY4A 3I8ZA 1Q1EA 3HOYB 1J8IA 1AFPA 2ZT9C 4KI0A 2JA6B 5I4DA 2XWBB 4C1NK 1SMYC 4Q0FA 4XT1B 4C3IG 1H9KA 2F0QA 1JB3A 3M85A 3SK8A 1AZPA 4IFDI 3VR6A 3MXPA 3OSOA 4KJOA 1VF5C 2JSOA 1U4MA 2A6HD 4HN7A 4DXGA 1B50A 4IUQA 1K8MA 2F0NA 2J7ZA 4C2MB 1L0YB 2PZUA 1LTID 1ONLA 3TP7A 4MHEA 3AB9A 2X6LA 4WRDA 3S9WA 4ILWA 2LY7A 1T5EA 2F0KA 1RTNA 1B1ZA 2BE5D 5EBDA 4I7ZC 1PFBA 5COYA 1QNKA 2JA7B 3BVMA 4KMUC 5DNFA 4FF1A 2PYKA 2Y0SB 2NN6H 2IT1A 5C5MA 3ZYYX 1QJOA 3QIAA 2RSNA 3VA5A 5JEAH 4RCNA 4CJ1B 3OHXC 2F0JA 4CKCA 4ZKCB 2SEBD 1YNJC 4NMZA 2AWOA 5J39A 2KEEA 1GUOA 3VYTA 3U9OA 4LMQD 3MEHA 1KLUD 2FINB 1G6ZA 5DM73 5C3XA 2MUYA 4DNTB 3J7YW 2QDBA 3GD7A 1HA5A 3JAME 3H09A 2K04A 1IKLA 3FPUB 4EQNA 5JJZA 1PLFA 4B9WA 1BCPF 2F0MA 3WOEA 1KAAA 3CU7A 3I73A 4IUTA 4RCOA 3RD4A 1JOKA 5EPJA 2MHVA 5ELEA 1PTOF 2NVYB 1E2ZA 2L11A 4K6LA 1EZ6A 5DEHA 2XRSD 5C3EB 4QUCA 1IKMA 4G57A 1Y8PB 2I46A 2OXPA 2EJGC 2HDLA 1IL8A 2EVBA 3HOZB 2JEBI 1SJHD 5JEAJ 4C3IB 1HTLD 1O7LA 5EPKA 4RAUC 5EKLA 3I91A 1B4OA 4XYOA 2JXMB 2RA4A 3QWNA 1LTGD 4BA2I 4XIGS 5DAUA 1STNA 1EWHA 1JORA 4F8MA 2PZTA 2F0TA 3GQBA 1HXYD 1PTOB 4FVMA 5A2QL 3Q24A 1X3PA 2O5IC 1NR4A 2PPBC 4DNRB 2A5HA 4F7XA 1QNUA 1EIHA 3BS1A 3G6JB 1YNNC 1A3VA 1HPCA 2F0HA 1U4RA 3EVQA 4X3KA 1VCIA 4KN4C 1V1OA 2AQ1B 5CBAE 2G9DA 4L6TB 3DEPA 1RCVD 3ERQA 4KJNA 1H9JA 1U4LA 2DNCA 2F0GA 3R3OA 2RVLA 3A8KE 2YYZA 5ELCA 1EYAA 1WTOA 3J81L 2E74C 4A3FB 1V8QA 4A3KB 1GUGA 1NR2A 2Z1CA 2FHTA 1FGBD 2A73B 3M7GA 2WKDA 1GOZA 4H7BA 1U9RA 3V96A 5LL6S 2WP8J 2O5JC 2J4XA 2AQ2B 3MC0B 1Y1VB 5EQ0A 1B53A 2Z8LA 1TS5A 3IFDA 1PRTC 1W6KA 1TKWB 5E1FA 1B3AA 4EVOA 2EYJA 5IODA 1ENFA 4H44C 3K6OA 3EQLC 1CK1A 3IL8A 1ET6A 4DGZA 4X3TA 3S1NB 4DAVA 1Q90A 2QCPX 3EA6A 3OIPA 4XTCS 1TIID 1FR3A 5DM63 1WD1A 4KV6A 2WB1B 3HP3A 1SNMA 5C4HA 1DD2A 1TVXA 3IAYA 2BOSA 4A93B 2N88A 2LKVA 1LLRD 2L12A 1QB5D 1SMYD 3GO5A 1B2TA 1F9SA 3L3OC 3Q0AA 5CV8A 4CHTB 4QIWB 3T53B 5LL6X 5CV7A 4DXFA 3BYTB 2V4DA 1CM9A 1KDBA 2D2CC 2SNSA 1JQYD 4A3JB 3SEBA 1I6VC 1PYWD 5C5LA 1TWAB 5TSSA 3NTHA 2E2DC 4A3BB 1HQMC 1G8ZD 1R9TB 5CORA 3BDCA 4J1MA 3FVQA 3DMUA 1RTOA 3HGBA 3FMCA 1AP0A 2FFKB 5G3LD 1LTBD 2WINB 1EYDA 2VB2X 5T1IA 3C3LA 1SYGA 1H9MA 3RZDB 2HDMA 3PUWA 4M8AA 4C3HG 1BR9A 3HS0C 2KJXA 1D1IA 4DK0A 2KCNA 2L0CA 3MTSA 1YNJD 2I07B 4KN7C 2PMZB 5E4XA 1CHPD 2R92B 4RHSA 2F0PA 1TWCB 2OEOA 1H9RA 1BXTA 3SK4A 2IL8A 2NBFA 2NTSA 2E76C 1OO9B 2XWJB 4U673 1WTRA 3GTOB 4PQXA 4K8JA 1EY0A 4HAEA 2VUMB 3S1MB 1TU2B 4XT3B 1I4XA 4KKSA 3HOVB 1EEID 4WFN3 2F4IA 4L63B 3JAML 3TMEA 5A35A 1X32A 2QKIC 1ZEQX 1O7ZA 3G7LA 3AU7A 2BDNA 1NSNS 3M4YA 1BOSA 1D1KA 2NZ1D 1JOOA 3I3CA 3T13A 5I2XA 2IW3A 2DNEA 3SHLA 2D9UA 1ICWA 3IFTA 5IGEA 4IFDH 4GZYC 1GHJA 3NTIA 3LWEA 3OMCA 1OXTA 2EYFA 3PUXA 4X3UA 2KOLA 1DZ1A 4R8NA 4XYQA 5T1GA 3U9SA 1A3UA 2KHSA 3D3RA 2F0WA 2FJ2A 3A8IE 1C8CA 2IPKD 2CVRA 1FD7D 3L9AX 4RHRA 1EYCA 1MD2D 1SNCA 2GA4B 2PW5A 5C0XH 1A3TA 1XXGA 1II3A 1KNEA 3FDTA 2K1BA 1SE4A 2DY7A 1YNND 3CRLC 3QB3A 4EQOA 2NN6G 3HEJA 4BY7B 1JC7A 5C4JB 3M7NA 3R93A 3ND9A 4C3HB 4IZ8A 5JEAG 4WORA 4HTHA 1FYCA 3CHBD 3K7AB 1A6XA 3GTJB 2M00A 1RF2D 1TY2A 4M1UB 2B2WA 4MIUA 4TSSA 3SR1A 4ZAIA 3MAQA 1LT5D 2J0TD 4ULLA 2ZXRA 4WJWA 2R7ZB 1KTKA 4K2KA 5CV6A 2K05A 2R3ZA 3OOCA 3MFYA 2K5WA 2F0LA 4XDXA 5I6WA 5NUCA 2RDFA 4KY6A 1GJXA 1G291 2H4OA 2NWGA 5M3FB 1TS4A 4BWGB 3VR4A 5JPNC 1ZXTA 4RGMA 3NHHA 4K5XA 1PRTD 2PZWA 3FPPA 1HTPA 3LNNA 2B2UA 5C0XJ 2A6EC 5I2YA 3M3YB 1RD9D 3OPOA 1STHA 2B2VA 2JP1A 2Z4HA 1T5XD 4A3MB 2F0OA 3RMHA 4QMGA 2LMCB 5CC4A 1XYIA 3DWQA 4KKTA 1PZID 3A7AB 3NP8A 5JAVA 2NYZD 1EOTA 1DYQA 2ID0A 2YU9B 5K36G 1TWHB 1KNAA 5IT9L 2PCFB 1Q12A 3SK5A 4ZRZA 1NUCA 1V43A 4KHZA 3WOFA 3BYYB 4A3GB 5I9PA 1I6HB 5KYLA 2HCCA 5CGKA 1F9RA 1S5FD 1TQOA 3PUYA 2K5DA 1VDZA 2PO4A 3EJIA 1GHKA 3PUVA 1V1PB 1Y69U 1S5DD 3D4WA 1SDFA 2K03A 2RKSA 4BS9A 1F9PA 1BBXC 1TY0A 1PTOH 3LX0A 5EJWA 5CV9A 1RHPA 3A8JE 1L0XB 2VXWA 3NPPA 4ZQ3A 5M9OA 1QE6A 4QUFA 1RDPD 2XRQD 1B9NA 2D62A 4DK1A 1O7YA 3D6WA 3HZXA 1STEA 1CFMA 2Q8IB 2XSCA 3TZDA 4KTAA 3P7JA 5IGGA 3QO2A 4U68A 4I65A 2L5TA 2EY6A 3LWUA 2X69A 3E0JA 3EFXD 3W3AA 2NN6I 2NVTB 1EWCA 1SNPA 4DAYA 4Z9CB 4HSPA 1WD0A 1CT1D 4N9PA 2NTTA 2EJFC 2ICIA 3J7AV 4IUVA 2K6AA 4L8JA 1E2WA 2L9HA 1H9SB 5M5YB 2BCOA 2E2IB 3IKJA 2EY5A 4IUPA 2F1MA 1EY8A 4RKBA 1NAPA 2JEAI 1MBYA 2R61A 3I72A 2IX1A 3K0YA 2B2WC 2TSSA 4OIJA 5IIFA 3GTPB 3S2DB 3VYRA 5C44B 2IWHA 3P75A 2DN8A 2L55A 4JK1C 1RODA 1TS2A 2NB0A 3ND8A 2ENBA 2BA0A 3MWYW 1LV9A 3L7ZC 2K33A 1ZKOA 3GTMB 4ZLTF 4C56C 2E75C 5EPLA 4IUNA 3D31A 2EPBA 3MHBA 4FP5D 4FYDA 3O13A 2IX3A 2EOTA 2CHBD 2B2YA 2CW0C 2QILA 4FNFA 2B2TA 1WTWA 1PZKD 1PFMA 3N6RA 2B2VC 2A68C 4PMCA 3VR5A 1F77A 4RGNA 2CQAA 1EQVA 1WTQA 4XQJA 2KA7A 2EJMA 1AEXA 1TR5A 1MSGA 5CV5A 4V190 3NUCA 3I90A 1M4VA 1A15A 1RJTA 3HOWB 1QILA 1GUTA 3DUZA 2NVQB 3OIQA 4H0LC 3RUZA 3Q6SA 1XTCD 2F03A 1X3QA 1Q1BA 4JBWA 4O1NA 2C5CA 3A56A 4ZUIA 1G2TA 3P1HA 1JE4A 3URYA 1ZYRC 4KY5A 4LAAA 1SJED 3CRKC 4IQZA 4RFBA 1BUVT 4FO2A 2Q8RE 2K28A 1CTMA 1BCPC 1PXUA 3E6ZX 3NTKA 4OO1H 3T16A 1CQFA 4HMJA 2RSOA 3QOJA 4IUUA 4OL7A 1J9OA 2QEJC 1E0BA 1SE3A 1PTOC 1EEFD 3K5MA 1HUNA 5C6AA 1STBA 2XNAC 2SNMA 1A2UA 3PMFA 3Q23A 2PQEA 4XXEA 3J80E 2R93B 4A3IB 2D5DA 4FF4A 2F0IA 1F2MA 1MI2A 4FXKC 5J22A 1BF4A 5CYUA 2B8FA 5FKAC 2A6ED 1SYDA 3PV0A 1CI3M 3TDQA 1D6EC 5CR3A 1SYCA 5CMDA 1EY7A 5KGUA 1D5XC 3S17B 1DOKA 1C4QA 4EQPA 4IN3A 1HFGA 4RGOS 1LTAD 1HFNA 4K2LA 4HSVA 4Y7NB 3GV6A 3VYSA 2KECA 1UNSA 4B9XA 3K5LA 2FMMA 1F9QA 1I4PA 3SXHA 1EU3A 2M2LA 1CQVA 4K6DA 4DF7A 4R9WA 5FOBB 1ENAA 4RWSC 2MGSA 1BQQT 1CA5A 1A2TA 3KLSA 1DOMA 5D65A 2FMCA 1WVLA 5ELFA 5BN5A 2MPMA 3NBHA 5C0XG 2K01A 4KD4A 5IOCA 2M9VA 4V0BA 2MP1A 1C48A 1VF7A 3P20A 3K5NA 5C4XB 1LT4D 1CA6A 3S15B 4ODGA 1LO5D 1KDCA 1SE2A 4HMIA 5ELDA 3H91A 2JA5B 3D6CA 4UAIA 2ZXOA 1EY5A 5IGCA 3DHQA 2NVXB 4NKLA 4X3SA 5IGDA 2VB3X 5CBEE 2B2YC 4C1NI 2EYMA 2B2TC 2F3VA 5KYIA 4ID6A 1OXSC 3D8GA 1ESRA 4N9TA 3KF8A 4OGQC 3I4LA 2KCCA 4O42A 3NE5B 5F2DA 1SYEA 1LT3D 2KEDA 2SDFA 2H1EA 3MXNA 1F2YA 5LHY1 1HUMA 3H0GB 5EKKA 3Q22A 1JICA 3D4DA 1IW7D 4BBSB 3NK9A 1EU4A 3TZUA 1LTSD 2O4XA 4MN3A 4J8QA 3SDZA 1SNOA 4QF4A 2Z4IA 4ME5A 3TBIB 2L1BA 4OHJA 3PUZA 1QOHA 2C9OA 3N52A 4F87A 4FF2A 3I4NB 2R6GA 3DEOA 3V2TA 4RGTA 5FK9C 3PIP3 5KNCA 1FNUA 4AYBB 1I4QA 1JWUD 1KABA 4FXGC 5FLXE 2F0FA 4IFDJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYG A;  2EYF A;  4PNY A;  4ZUJ A;  5C6A A;  4IUN A;  1JOR A;  5KEE A;  4F8M A;  4EVO A;  2EYJ A;  2PZT A;  3MHB A;  2F0T A;  3NHH A;  1STB A;  4K5W A;  2F0E A;  2PZW A;  3HZX A;  2SNM A;  4K5X A;  4NMZ A;  1A2U A;  2WAC A;  3PMF A;  4ODG A;  1KDC A;  2PQE A;  4HMI A;  5JOB A;  5I6Y A;  4YIJ A;  5K5P A;  5J39 A;  2RBM A;  4R8N A;  3D6C A;  4KTA A;  3BDL A;  1EY5 A;  2SOB A;  1A3U A;  1SYB A;  2EYP A;  2F0W A;  2KHS A;  3OWF A;  5J1Z A;  5IGG A;  4DGZ A;  3DHQ A;  3H6M A;  5IGB A;  5IGC A;  4NKL A;  2F0I A;  4I65 A;  3ERO A;  2EY6 A;  1STH A;  5IGD A;  3U9O A;  1F2M A;  1STA A;  5J22 A;  2EYM A;  1IHZ A;  3MEH A;  5C3X A;  1TT2 A;  2F3V A;  4F7X A;  5KYI A;  4ID6 A;  3MVV A;  5HGT A;  2QDB A;  1EY4 A;  1EYC A;  2EYL A;  2PW7 A;  1EZ8 A;  1SYD A;  3D8G A;  4PMC A;  1A3V A;  2F0V A;  4N9T A;  2F0O A;  4S3S A;  1SYF A;  2F0H A;  4E6I A;  5IGF A;  1SNC A;  4EQN A;  1SNP A;  3EVQ A;  2PW5 A;  4QMG A;  1EQV A;  4B9W A;  1A3T A;  3C1E A;  5CC4 A;  2F0P A;  1AEX A;  1II3 A;  2OEO A;  4KV6 A;  1TR5 A;  2F0M A;  5CR3 A;  1SYC A;  3NP8 A;  3QOL A;  4NDX A;  3SK4 A;  5JAV A;  3ITP A;  1KAA A;  4N9P A;  1SNM A;  5CV5 A;  1JOK A;  2F0S A;  5C4H A;  2F3W A;  5F2D A;  1SYE A;  3NUC A;  1EY7 A;  5KGU A;  3ERQ A;  4KJN A;  3C1F A;  3QB3 A;  1F2Y A;  4K8J A;  1STY A;  4EQO A;  5EKK A;  2LKV A;  3D4D A;  3HEJ A;  1EY0 A;  3SK6 A;  3NK9 A;  2EY2 A;  3SK5 A;  1RKN A;  2EXZ A;  4EQP A;  1EZ6 A;  2F0Q A;  1NUC A;  4IZ8 A;  2HQE A;  4NP5 A;  5DEH A;  5E3F A;  4QB4 A;  3SK8 A;  1JOQ A;  4WOR A;  4HTH A;  4K2L A;  4G57 A;  2F0G A;  2O4X A;  3MXP A;  3OSO A;  3R3O A;  4KJO A;  3RUZ A;  3TP5 A;  1ENC A;  5KRU A;  1EYA A;  2NUC A;  4IAL A;  2EY5 A;  1SND A;  4B9X A;  2OXP A;  2M00 A;  4RKL A;  5CV8 A;  2F0N A;  2F0D A;  5I9P A;  3NXW A;  4RKB A;  1EY8 A;  5KYL A;  5CGK A;  4MIU A;  1SNO A;  1TQO A;  4PMB A;  4KY7 A;  4QF4 A;  3SR1 A;  5CV7 A;  3SXH A;  5C3W A;  5I9O A;  1STG A;  4ME5 A;  4ZUI A;  5IIF A;  1SNQ A;  3P1H A;  2PZU A;  4K6D A;  4K5V A;  4DF7 A;  1ENA A;  2EYO A;  3EJI A;  1F2Z A;  3TP7 A;  3TME A;  5KIX A;  2KQ3 A;  3E5S A;  3P75 A;  1A2T A;  5ISR A;  4KY5 A;  5HUR A;  5CV4 A;  4LAA A;  1KDB A;  2SNS A;  4K8I A;  5E1F A;  4K2K A;  4WRD A;  4H7B A;  5CV6 A;  4J6H A;  1NSN S;  3S9W A;  5C5L A;  4K14 A;  3TP6 A;  1U9R A;  3MZ5 A;  3NQT A;  3D4W A;  1JOO A;  4DFA A;  2F0K A;  3T13 A;  2ENB A;  4KD3 A;  4TRD A;  3TP8 A;  4KHV A;  3V2T A;  5EGT A;  3SHL A;  3BDC A;  2RKS A;  4KD4 A;  2F0L A;  5IOC A;  4J1M A;  4DU9 A;  5C4Z A;  2F0U A;  3DMU A;  5I6W A;  5EKL A;  3LX0 A;  3T16 A;  2OF1 A;  1KAB A;  2PYK A;  4HMJ A;  5CV9 A;  5NUC A;  5IGE A;  2RDF A;  3QOJ A;  4KY6 A;  4OL7 A;  5C5M A;  4ZQ3 A;  2EYH A;  5IOD A;  1EY9 A;  2F0F A;  5M9O A;  5DAU A;  3VA5 A;  1EYD A;  1EY6 A;  2EY1 A;  3OMC A;  1STN A;  3OMG A;  1KDA A;  2F0J A; 
#chains in the Genus database with same CATH topology
 3QG1 A;  2K7V A;  1HCZ A;  1W6J A;  2IJ0 A;  1HZC A;  1GXD C;  4K5W A;  4OXP A;  5IP7 G;  2MJ8 A;  4JI7 L;  2QF7 A;  2B29 A;  2B8G A;  5JVG 3;  2VQE L;  4A3M H;  2X6G A;  2ZM6 L;  2DY8 A;  2A69 C;  4OEL B;  1U4P A;  4K0K Q;  1EIG A;  1HR0 Q;  1QZG A;  3NEN A;  1WTX A;  1STA A;  3KLW A;  1IHZ A;  4X66 L;  4IOC A;  2Z6K A;  4WJ4 A;  1PDQ A;  4EGV A;  3S1R B;  1SXT A;  1SYF A;  1TWH H;  2CW0 D;  4FXD A;  1WCM G;  4G7H C;  2D0O A;  5D3D A;  5JPM C;  3KLS X;  4JYA Q;  3K57 A;  2ICE C;  4DR6 L;  3K5O A;  1UAP A;  1IYV A;  1PRT F;  4NDX A;  3ITP A;  3R8B A;  3VYU A;  3AEV A;  1PHJ A;  4HR7 B;  1MSH A;  2F0S A;  4A3D G;  2A68 D;  3NWT A;  5IT9 c;  1SSO A;  4A3G H;  1B44 D;  1I6H H;  2AQ3 B;  4QL5 A;  1D8L A;  2B63 G;  1OXU A;  2XN9 C;  2A74 C;  4NW2 A;  1VQ7 A;  3E9I A;  1JOQ A;  2HQE A;  4NP5 A;  4QB4 A;  4RA8 A;  1CKM A;  4C3J G;  3PO2 G;  1ESF A;  4RH6 A;  2NVY H;  3MEF A;  1I5F A;  3K59 A;  4UDU C;  4GN5 A;  5ELO A;  3DM3 A;  3PQI A;  1V1P A;  4F88 A;  1PYB A;  1C9O A;  2JJQ A;  4XQN A;  5C3E H;  4PMB A;  5C0X I;  1AZQ A;  2KCM A;  3SGI A;  4UP9 A;  1ILP A;  5C3W A;  3MA2 B;  5I9O A;  3T1Y Q;  3C2P A;  1SAP A;  1X65 A;  3BU2 A;  3F2D A;  3GV3 A;  2Q2T A;  3RLF A;  2ZXP A;  1SFO B;  4QQB X;  3W1G A;  1D5Z C;  1LAC A;  5ISR A;  3HOU G;  1XWE A;  1D2B A;  4DA2 A;  2HIX A;  2I5L X;  3ULL A;  2XIW A;  4J6H A;  4BY1 B;  1S4Z A;  1I4H A;  4DN4 M;  3STB D;  2JE6 I;  2WV6 D;  4DFA A;  2IX0 A;  4TRD A;  1ZYR D;  3UDF A;  4BBR B;  1I50 B;  4C3I H;  1DOL A;  1MIU A;  2KUM A;  2MNA A;  2HHH Q;  1UE7 A;  1UUP A;  1LTT D;  4AIM A;  3H3V H;  1K8O A;  2QGQ A;  5GAE C;  1KLG D;  3CPW A;  3R2I A;  4ZCK A;  3CCE A;  2EY1 A;  1HZA A;  1KDA A;  1PRT B;  2WAQ G;  1BCP D;  3VR3 A;  1N36 Q;  2F0E A;  2WAC A;  3KFU A;  5JOB A;  1KXL A;  1UE5 A;  3IRB A;  1JWS D;  5FO8 B;  4POF A;  4K0K L;  3J7A F;  1HR0 L;  1PTO D;  3KLR A;  4FDB A;  1LUZ A;  3MXG A;  3ERO A;  1D7Q A;  3FKI B;  4MZ9 A;  2PW7 A;  3X3N A;  1MJC A;  4B3R Q;  5FLM H;  3CP0 A;  5D14 A;  3C1E A;  3CF5 A;  5M5Y H;  4DR4 Q;  1H9S A;  3CXC A;  1Q8I A;  3HOW G;  2QW7 A;  1Y8N B;  4JI2 Q;  5EBC A;  1S5E D;  4LFC L;  3WWV A;  5BR8 Q;  4KLK A;  5BN3 A;  1YI2 A;  4DAM A;  3C1F A;  1NY4 A;  1I4G A;  3PF5 A;  1MHW C;  3NQI A;  4JPB W;  2GVA A;  3PO3 G;  1HR0 W;  4CDF C;  5M3M G;  3GTP H;  5E4W C;  1F2L A;  4LF8 Q;  1LAB A;  4LWC A;  3J80 L;  5KRU A;  2UXB Q;  1ENC A;  4KKU A;  1Y8O B;  4P74 A;  1HQR D;  4X65 Q;  1DGS A;  4LF9 L;  4RKL A;  2PNR C;  3SE0 A;  1IW7 C;  5LMU Q;  4H13 C;  2I5H A;  4IJL A;  1KQS A;  5K36 H;  3AMU A;  3U50 C;  1WCM B;  1M8A A;  3ZJY C;  1EIY B;  1W3S A;  5IYB G;  1HNW L;  3L2P A;  4DAP A;  4A3K H;  1BCP B;  5FO7 B;  2G5D A;  2A8V A;  4A3D B;  3U58 A;  2EDG A;  3I70 A;  5E7N A;  1G2S A;  3BDO A;  3TP6 A;  1R4P B;  3MZ5 A;  3A7L A;  4QCL A;  3J81 c;  5JVH 3;  1Z47 A;  3KOJ A;  4FF3 A;  2B63 B;  4YWK A;  1R4Q B;  4C3J B;  1HZB A;  3PO2 B;  5M5X B;  2HHH L;  3HG9 A;  1MGS A;  2OF1 A;  4DV1 Q;  1E2V A;  1XX8 A;  1Z6H A;  3MXU A;  1Y1V H;  1NBW A;  3OMG A;  3H94 A;  2AHO B;  1BNZ A;  3BVG A;  1G91 A;  1IBK Q;  1JCK B;  3CQZ B;  3M4O B;  3HOU B;  3AYH B;  1ML0 D;  3CME A;  4ZYS A;  5J1Z A;  1XJV A;  1LTR D;  4CDD C;  4JI1 Q;  3H6M A;  1K83 B;  2LFN A;  1UE1 A;  5IGB A;  1SEB D;  1PH9 A;  4GLA C;  4TQU S;  3MVV A;  1HA6 A;  1GUW A;  5IWA Q;  4B3R L;  2EYL A;  2VY3 A;  3FRP B;  3BVZ A;  3GTG B;  4S3S A;  3S1N H;  4OIK A;  4DR4 L;  4X62 Q;  1PZJ D;  3FP9 A;  1LTL A;  4DV5 Q;  1NTG A;  3PIO 3;  5ELB A;  1IL2 A;  4X6A H;  2AWN A;  1BO0 A;  4IPG A;  3HKZ G;  4CKE A;  4CJ2 C;  2F3W A;  2WAQ B;  3T51 B;  2B2U C;  4LF7 L;  1FJG L;  4OO1 G;  2A6H C;  2K75 A;  1STY A;  2JN4 A;  2N3S A;  1GUS A;  3WDN A;  3SVM A;  1N32 Q;  3K58 A;  1Q46 A;  3KBG A;  4KK7 A;  2JA8 G;  1QUQ A;  2NZH A;  3TP5 A;  1DJR D;  2LS0 1;  1I3Q B;  2NUC A;  3W2D A;  1SND A;  1VQP A;  2QDL A;  1A8V A;  5KND A;  3GTL B;  2PMZ E;  3UI2 A;  2L4N A;  3A55 A;  3FEW X;  4KY7 A;  4NXM Q;  1YNX A;  2OT2 A;  4B08 A;  1F2Z A;  5IYD G;  3GDE A;  2KQ3 A;  3E5S A;  4AH6 A;  3KK7 A;  1XPU A;  2BE5 C;  5CV4 A;  5HUR A;  3A5U A;  1PH2 A;  5IT9 E;  1WTV A;  5J3B A;  1QG7 A;  3KJO A;  2OTL A;  5GAD C;  3GTK B;  3M4Q A;  5IE8 A;  3D4R A;  3EIV A;  3TP8 A;  4R4C A;  4A3J H;  5EGT A;  3PO3 B;  5M3M B;  2MFI A;  1KC8 C;  2RDG A;  5AFW A;  1SBB B;  5C4Z A;  3CKI B;  4BXX H;  1TWA H;  3T56 B;  4A3B H;  3KUP A;  2Q8T A;  1R9T H;  2EYH A;  1EY9 A;  4LK1 C;  1IBK L;  2HUG A;  4QGU A;  4ZUJ A;  1XMQ Q;  3H3V C;  1K8A C;  3F2B A;  3S2H B;  4R8I A;  4ZKB B;  4G7Z C;  4YIJ A;  1IYU A;  3S16 B;  2EZV A;  3BDL A;  2SOB A;  3X3M A;  4XQQ A;  3HOX G;  3K80 C;  4GOP A;  1DXM A;  2UUA Q;  3VR2 A;  2E2H B;  1WTP A;  5IWA L;  1X55 A;  1D5M C;  1TT2 A;  2KVM A;  3K0X A;  1EZ8 A;  3NSW A;  1JR0 D;  4LUV A;  4X62 L;  5IGF A;  2F0V A;  2A69 D;  4E6I A;  4LJZ C;  2G9H D;  3S17 H;  4HCE A;  4JI4 Q;  3OWE B;  2AUJ D;  2CWA A;  1AN8 A;  2E8G A;  5D3I B;  4RMF A;  1GUN A;  4GNX A;  1Z7T A;  1Y1W G;  3ONA B;  1KRS A;  1TS3 A;  2QA4 A;  5FLX L;  3AFP A;  3NEL A;  1BBU A;  1DCZ A;  1YHA A;  2E2J B;  2K5V A;  1JMC A;  1Q3L A;  3T1H Q;  4GS3 A;  1RKN A;  5E3F A;  1FNW A;  4CDE C;  5LMN Q;  1TWF B;  1HHV A;  5G3L F;  3DWP A;  2BA1 A;  1DM0 B;  3GTO H;  3KBX A;  4R4Q A;  4IAL A;  5IP9 H;  3DXJ C;  4POG A;  4DR1 L;  2EQS A;  3NXW A;  4IPH A;  1WTH A;  5A2Q E;  3S1M H;  4OON A;  4G7O C;  4K5V A;  1TWG B;  2K5Q A;  3HOV H;  1PFN A;  3NWS A;  2EYO A;  4NXN Q;  5EKI A;  1MKH A;  4PMW A;  3I4M G;  5KIX A;  3BZK A;  1NCV A;  4IFD G;  1AE2 A;  4K8I A;  1RIP A;  3A54 A;  3HKZ B;  3RZO B;  3VA7 A;  4CBV A;  4K14 A;  2K32 A;  5C4X H;  2KHI A;  4A3E G;  2AUK A;  2DJF C;  1O80 A;  3S15 H;  2UXD L;  1EFI D;  4DU9 A;  4DV4 Q;  2JA8 B;  2ZTD A;  4TKO B;  4DR3 Q;  3JAM c;  2JA5 H;  1FNV A;  2JA6 G;  3F2U A;  4Q5V A;  2PQA B;  3NBI A;  1EL0 A;  3CAM A;  2NVX H;  4DV2 Q;  4AYB E;  3B6Y A;  1WI5 A;  4PNY A;  1BDO A;  2B39 A;  2B3G A;  4GN3 B;  4CGY B;  5KNB A;  1CHQ D;  1QCB D;  5K5P A;  1YJW A;  2RBM A;  4CKB A;  1C7Y A;  1SYB A;  3OWF A;  2TMP A;  3J81 E;  1JWM D;  4OEM B;  3TN2 A;  4DV7 Q;  4APV A;  2EE1 A;  2RQX A;  4OO1 I;  1XMO Q;  2I0Q A;  1I4R A;  4YWL A;  3V05 A;  3J81 i;  3QJY A;  1BBW A;  2RDH A;  2PNH A;  3OW7 A;  3H0G H;  4A4I A;  4X64 Q;  3R2T A;  2JYO A;  1VQ6 A;  2UUC Q;  2OQK A;  4A3L H;  5EAY A;  4P2C B;  1ILQ A;  2LSS A;  3QOL A;  2VQF L;  5HY6 A;  2XVS A;  1WJJ A;  1DON A;  1O78 A;  1HRJ A;  4LF5 Q;  1S5B D;  1X3E A;  3GP7 A;  3HRZ C;  4ABN A;  3SK6 A;  2EY2 A;  2EXZ A;  1PH3 A;  3HOX B;  2HCI A;  4HED A;  5M5W B;  3C46 A;  2JA7 G;  3OYY A;  2HQL A;  3G6E A;  2CH4 A;  2Y0S G;  1UEA B;  4NPS A;  4BY7 H;  4KHP Q;  2F0D A;  4C3H H;  1B3Q A;  3PGZ A;  1S40 A;  4HCS A;  4NXN L;  1ICF B;  1STG A;  1HNX Q;  1SNQ A;  1E7Z A;  3I4N H;  1Q81 C;  1VMC A;  3GTJ H;  4ZK9 B;  2A19 A;  1S5C D;  3EBE A;  4QJF A;  3J7A 5;  5H1S E;  4G4K A;  3BG3 A;  5BN4 A;  2H5X A;  3DWA A;  1OXV A;  3DM1 A;  1Y1W B;  2L15 A;  1QWY A;  1VMP A;  1IBM L;  3NQT A;  1EQT A;  4CJ0 B;  2R7Z H;  3S14 B;  4KD3 A;  4A3C G;  4KHV A;  4JI6 Q;  3GTQ B;  2N55 A;  1PMR A;  4OWX B;  3CW2 C;  2BDO A;  2F0U A;  2P5Z X;  2O2L D;  3TSS A;  2R7D A;  5GRO A;  2VNU D;  4GKK Q;  3MFG A;  2RCF A;  2WKC A;  1EY6 A;  1VQH A;  5FO9 B;  3S1Q B;  4TVA B;  1OXX K;  2C35 B;  1LT6 D;  4BA1 I;  5KEE A;  1B9M A;  1NJI C;  1ET9 A;  2WII B;  3I4M B;  5I6Y A;  4PV1 C;  1C0A A;  1CZW A;  1SLJ A;  1CZG A;  2F3I A;  2EYP A;  4IUR A;  1SN8 A;  1EOV A;  2EXD A;  1AW7 A;  2ATW A;  4A3E B;  4GOP C;  3T4A C;  3CD6 A;  1PH6 A;  3BZD B;  3M3Y H;  5HGT A;  1Q86 C;  1EY4 A;  3I8Z A;  2UU9 Q;  5DLQ E;  1Q1E A;  3HOZ G;  2Z9H A;  3HOY B;  2UUC L;  3CPF A;  2UUB Q;  1J8I A;  4DV6 L;  1AFP A;  1L0W A;  2ZT9 C;  4DV3 L;  4P72 A;  4KI0 A;  2JA6 B;  1YJN A;  5I4D A;  4Y52 H;  2XWB B;  4C1N K;  4P75 A;  4DNI A;  1SMY C;  4Q0F A;  4XT1 B;  5FJ8 G;  4C3I G;  4JI0 Q;  1H9K A;  3TRE A;  4DR7 L;  2F0Q A;  1JB3 A;  3M85 A;  3SK8 A;  1N8R C;  1AZP A;  2YU9 H;  4IFD I;  3VR6 A;  3MXP A;  3OSO A;  4KJO A;  1SFO H;  1VF5 C;  2JSO A;  2UXC L;  1U4M A;  2A6H D;  4HN7 A;  4DXG A;  1B50 A;  4IUQ A;  1K8M A;  1HNZ L;  2F0N A;  1L1O C;  2K52 A;  2J7Z A;  1YIJ A;  4C2M B;  4OX9 L;  4AQY Q;  1L0Y B;  2PZU A;  1LTI D;  1ONL A;  3TP7 A;  4MHE A;  1VQA A;  3AB9 A;  4DUY Q;  4BBR H;  2X6L A;  4WRD A;  3S9W A;  5JJI A;  4JV5 L;  4ILW A;  2LY7 A;  3ER0 A;  4LF4 Q;  1T5E A;  5FLM G;  2F0K A;  4PZ6 A;  4HIO A;  1RTN A;  3CC7 A;  4JBK A;  1B1Z A;  2BE5 D;  5EBD A;  1VQC A;  4I7Z C;  1PFB A;  5COY A;  1FVI A;  1QNK A;  3D0F A;  2JA7 B;  3BVM A;  4KMU C;  5DNF A;  4FF1 A;  2PYK A;  2Y0S B;  2NN6 H;  2IT1 A;  5C5M A;  4JI3 L;  1QJO A;  3ZYY X;  3QIA A;  2RSN A;  3VA5 A;  5JEA H;  4RCN A;  4CJ1 B;  4JBJ A;  3OHX C;  1K3R A;  2F0J A;  4CKC A;  4ZKC B;  2BH2 A;  2SEB D;  3QR8 A;  1YNJ C;  4NMZ A;  2AWO A;  4DUZ Q;  5J39 A;  5AJ3 Q;  2KEE A;  1GUO A;  1IZ6 A;  3VYT A;  1QVC A;  3AFQ A;  3U9O A;  4LMQ D;  3I7F A;  1KLU D;  2FIN B;  3MEH A;  3BJU A;  5DM7 3;  5C3X A;  4A3F G;  1G6Z A;  2MUY A;  4A3K G;  4DNT B;  3J7Y W;  2QDB A;  3GD7 A;  1HA5 A;  3JAM E;  3H09 A;  2K04 A;  1IKL A;  1K0R A;  3FPU B;  4EQN A;  1K0S A;  5JJZ A;  4DR5 Q;  1PLF A;  4B9W A;  3E0E A;  4DK3 C;  1BCP F;  2F0M A;  3JAM i;  3WOE A;  2NVT H;  1KAA A;  3CU7 A;  3UDI A;  3I73 A;  4IUT A;  4RCO A;  3RD4 A;  1JOK A;  4HJ5 A;  2IY5 B;  5JJK A;  1I94 Q;  5EPJ A;  5GQO A;  2MHV A;  2CWP A;  5ELE A;  1PTO F;  3CCL A;  2NVY B;  4R4O A;  1E2Z A;  2L11 A;  4K6L A;  1EZ6 A;  5DEH A;  2XRS D;  2ALY B;  5C3E B;  4QUC A;  1V1Q A;  1IKM A;  4G57 A;  1Y8P B;  4JYA L;  2E5L Q;  4DKA C;  2I46 A;  3UE1 A;  1VQN A;  1SRO A;  2OXP A;  2EJG C;  2HDL A;  1IL8 A;  3G4S A;  2E2I H;  2EVB A;  3HOZ B;  4EX5 A;  2B63 H;  2JEB I;  3PO2 H;  1SJH D;  1CKN B;  1YHB A;  5JEA J;  3S2D H;  1VQ4 A;  1K73 C;  4C3I B;  5C44 H;  1KHI A;  1HTL D;  1O7L A;  4GLV B;  3TEH B;  3T1Y L;  5EPK A;  2ZJQ A;  4RAU C;  2MO0 A;  5EKL A;  2IHF A;  3CQZ H;  3I91 A;  3ULJ A;  4GKJ Q;  4DR2 Q;  3M4O H;  1B4O A;  3CCV A;  4XYO A;  2JXM B;  1Z9F A;  2RA4 A;  3QWN A;  1LTG D;  4BA2 I;  1E1T A;  4XIG S;  5DAU A;  2WB1 G;  1K83 H;  1STN A;  3M4P A;  4JC0 A;  4YCV A;  1XTD A;  3GTM H;  1EWH A;  1JOR A;  4F8M A;  2PZT A;  2F0T A;  3GQB A;  5AJ3 L;  1HXY D;  1PTO B;  4FVM A;  4LFA Q;  5A2Q L;  4A93 G;  4JOI A;  3Q24 A;  2VL6 A;  1X3P A;  3AQQ A;  3GTG H;  2O5I C;  1J6Q A;  1KD1 C;  2PI2 A;  1KRT A;  1NR4 A;  2PPB C;  4DNR B;  2A5H A;  2RCN A;  4F7X A;  1QNU A;  3OTO Q;  1EIH A;  3BS1 A;  1XNR Q;  3G6J B;  1YNN C;  1A3V A;  1HPC A;  2F0H A;  1N36 L;  1U4R A;  3EVQ A;  4X3K A;  4YHH Q;  1VCI A;  4KN4 C;  1V1O A;  2IHE A;  2AQ1 B;  4A3J G;  5CBA E;  2G9D A;  4L6T B;  1I3Q H;  3DEP A;  4ME3 A;  1RCV D;  4BXX G;  3ERQ A;  1G6P A;  4KJN A;  4DAY B;  1VS0 A;  1H9J A;  4IPC A;  4JI8 Q;  1U4L A;  2DNC A;  2F0G A;  3R3O A;  2RVL A;  2MQH A;  2YYZ A;  2Z6K C;  2ZTC A;  3A8K E;  3KYH C;  5ELC A;  1EYA A;  1WTO A;  4A75 A;  2YTX A;  1N34 Q;  3HOW H;  3J81 L;  2E74 C;  4A3F B;  1V8Q A;  4A3K B;  1GUG A;  3NEM A;  4JI2 L;  1NR2 A;  2Z1C A;  5BR8 L;  2NVQ H;  2FHT A;  1FGB D;  2A73 B;  3GTK H;  3M7G A;  3CC2 A;  3RNU A;  2WKD A;  1WFQ A;  5M3M H;  1GOZ A;  1LM0 A;  1JE5 A;  5ELN A;  1CSQ A;  4LF8 L;  5IY0 A;  1YJ9 A;  1E3P A;  4H7B A;  2K14 A;  2UXB L;  4MTN A;  1K9M C;  1U9R A;  4X65 L;  1BVS A;  3V96 A;  5LMU L;  1VQG A;  5LL6 S;  2WP8 J;  2ZTE A;  2O5J C;  1N33 Q;  2J4X A;  2YV5 A;  2AQ2 B;  2NZO A;  3A74 A;  3MC0 B;  1Y1V B;  2R92 G;  5EQ0 A;  1B53 A;  3S2H H;  2Z8L A;  1TS5 A;  3IFD A;  1PRT C;  3U4V A;  4UHV A;  1E22 A;  1W6K A;  4P71 A;  1VQ5 A;  1TKW B;  1GKH A;  5E1F A;  1B3A A;  4EVO A;  2EYJ A;  3A5Z B;  5IOD A;  1ENF A;  4H44 C;  3K6O A;  3EQL C;  4UP7 A;  1CK1 A;  4J15 A;  3IL8 A;  1ET6 A;  4DGZ A;  4DV1 L;  4X3T A;  2VUM G;  3S1N B;  4DAV A;  4P73 A;  3HOV G;  1XNR L;  1Q90 A;  2R93 H;  4A3I H;  2QCP X;  3EA6 A;  3OIP A;  1VQF A;  4YHH L;  4XTC S;  1TII D;  1FR3 A;  5DM6 3;  3RN2 A;  1WD1 A;  2DJG C;  4KV6 A;  1MJE A;  2WB1 B;  3HP3 A;  4JI1 L;  1SNM A;  5C4H A;  5GAG C;  3KDF B;  3I4O A;  1DD2 A;  1TVX A;  3RLN A;  3IAY A;  2HD3 A;  2BOS A;  4UP8 A;  4A93 B;  1SRU A;  2CKZ B;  2N88 A;  2LKV A;  1LLR D;  2L12 A;  1QB5 D;  5IYC G;  1SMY D;  3GO5 A;  3K7U C;  4DV5 L;  1B2T A;  1F9S A;  2DGY A;  3L3O C;  3Q0A A;  5CV8 A;  4CHT B;  3RZO H;  4QIW B;  4GN4 B;  3T53 B;  5LL6 X;  2OWO A;  4Y7N H;  5CV7 A;  1VQL A;  4DXF A;  3BYT B;  1XNQ Q;  1N32 L;  3CCS A;  2V4D A;  3PF4 A;  3K81 C;  1CM9 A;  1KDB A;  2D2C C;  2SNS A;  1JQY D;  4A3J B;  2JA8 H;  3SEB A;  4PZ7 A;  1I6V C;  1PYW D;  5C5L A;  1VQI A;  1TWA B;  2JA9 A;  5TSS A;  3NTH A;  2E2D C;  2HT1 A;  4A3B B;  1HQM C;  1G8Z D;  2PQA A;  1R9T B;  1NNX A;  4A3L G;  4NXM L;  5COR A;  3BDC A;  4J1M A;  4NB3 A;  1PH7 A;  3FVQ A;  3DMU A;  1RTO A;  2VW9 A;  3HGB A;  5IYD H;  4B3T Q;  3FMC A;  1AP0 A;  2FFK B;  5G3L D;  1LTB D;  2WIN B;  4HIM A;  1E24 A;  1EYD A;  2VB2 X;  5T1I A;  3C3L A;  1SYG A;  1H9M A;  4JI5 Q;  2I5M X;  1PH4 A;  3RZD B;  2HDM A;  3PUW A;  4BY7 G;  4M8A A;  4LF6 Q;  4C3H G;  1BR9 A;  3BZC A;  3HS0 C;  4JOI C;  4HJ7 A;  3KF6 B;  2KJX A;  1D1I A;  1IBL Q;  3HOY G;  4DK0 A;  2KCN A;  2L0C A;  3MTS A;  3I2Z A;  1M90 C;  1YNJ D;  2I07 B;  4KN7 C;  2K5H A;  2PMZ B;  5E4X A;  1XMQ L;  1CHP D;  2R92 B;  1VQK A;  4RHS A;  1X3F A;  2F0P A;  1TWC B;  2OEO A;  2R7Z G;  1H9R A;  1BXT A;  3SK4 A;  2IL8 A;  1EYG A;  2NBF A;  3W1B A;  2UUA L;  1L2F A;  2NTS A;  4UPA A;  4YY3 Q;  2E76 C;  1OO9 B;  2XWJ B;  4U67 3;  1WTR A;  1L1O B;  1PH1 A;  1J5E Q;  1IXR A;  4IO9 A;  4PQX A;  4K8J A;  3GTO B;  1OTC A;  1EY0 A;  3VDY A;  3RLO A;  4HAE A;  1EUJ A;  4JI4 L;  4R1J A;  2VUM B;  3S1M B;  1TU2 B;  4XT3 B;  1I4X A;  4KKS A;  4DK6 C;  1EFW A;  3HOV B;  1Y1W H;  4BBS H;  1GD7 A;  1O7I A;  3H15 A;  1EEI D;  5M3F G;  4B3S Q;  4WFN 3;  2AKW B;  2F4V Q;  2F4I A;  3A0J A;  4L63 B;  3S14 H;  1P8L A;  3JAM L;  3T1H L;  3TME A;  5A35 A;  1X32 A;  2QKI C;  3L0O A;  1ZEQ X;  1O7Z A;  5LMN L;  3G7L A;  1YBY A;  3AU7 A;  1YIT A;  2BDN A;  1NSN S;  3M4Y A;  1BOS A;  1D1K A;  1GVP A;  2NZ1 D;  1JOO A;  3I3C A;  3T13 A;  5I2X A;  3Q8D A;  3S1Q H;  2IW3 A;  2DNE A;  3SHL A;  4A3M G;  2D9U A;  2ZM6 Q;  1A63 A;  1U0L A;  3I4M H;  1ICW A;  3IFT A;  5IGE A;  3NBH B;  4IFD H;  4GZY C;  1GHJ A;  3NTI A;  2FXQ A;  3LWE A;  3OMC A;  4X66 Q;  4L5R C;  2KEN A;  1OXT A;  2EYF A;  3PUX A;  4X3U A;  2KOL A;  1JJ2 A;  2Y0S E;  1DZ1 A;  4WJ3 M;  2N8N A;  4LF6 L;  1KL9 A;  4R8N A;  4GLX A;  5LMN W;  4XYQ A;  4DR6 Q;  5T1G A;  4DV4 L;  3U9S A;  1A3U A;  2KHS A;  3D3R A;  2F0W A;  2FJ2 A;  3A8I E;  4PG3 A;  4DR3 L;  2CCZ A;  1C8C A;  4LW1 A;  2IPK D;  4A3G G;  2CVR A;  1FD7 D;  3L9A X;  3CCM A;  4DV2 L;  1K3B C;  4RHR A;  1EYC A;  1MD2 D;  4DV0 Q;  1SNC A;  2GA4 B;  2PW5 A;  5C0X H;  3I55 A;  1A3T A;  1XXG A;  1II3 A;  1KNE A;  3FDT A;  3S1R H;  2K1B A;  4YY3 L;  1SE4 A;  2DY7 A;  3W5O A;  5C3E G;  1X9N A;  1YNN D;  2YTV A;  3KF8 B;  3CRL C;  4DV7 L;  3QB3 A;  4N8F A;  1XMO L;  4EQO A;  4C2M H;  2LXK A;  1S3O A;  2F52 A;  2NN6 G;  3HEJ A;  4BY7 B;  1JC7 A;  5C4J B;  3M7N A;  3R93 A;  3ND9 A;  4C3H B;  4IZ8 A;  5JEA G;  1EWI A;  4WOR A;  4HTH A;  4X64 L;  1FYC A;  3CHB D;  4L5S A;  2Z0S A;  1UWV A;  1VQM A;  3PSI A;  3K7A B;  1TXY A;  3MXN B;  3PCO B;  1WYD A;  1VQ8 A;  4B3S L;  1B8A A;  3GTJ B;  1G51 A;  1A6X A;  2M00 A;  3J81 j;  1RF2 D;  1VQE A;  1TY2 A;  2F4V L;  4M1U B;  2B2W A;  4MIU A;  4TSS A;  4LF5 L;  1A62 A;  3SR1 A;  4ZAI A;  3MAQ A;  1QVG A;  1LT5 D;  2J0T D;  4GNX C;  4ULL A;  2ZXR A;  4WJW A;  2R7Z B;  1A0I A;  1KTK A;  2JA7 H;  4K2K A;  5CV6 A;  2ZJR A;  1HH2 P;  4KHP L;  2K05 A;  1LYL A;  1YEZ A;  2R3Z A;  3OOC A;  4H02 A;  3MFY A;  2K5W A;  2Q2H A;  2F0L A;  4XDX A;  4BY1 H;  1HNX L;  1CUK A;  5I6W A;  2OTJ A;  2ASB A;  5NUC A;  2RDF A;  4KY6 A;  1GJX A;  1G29 1;  2H4O A;  1EQQ A;  2NWG A;  3CMA A;  5M3F B;  1TS4 A;  4BWG B;  1I50 H;  1CSP A;  3VR4 A;  5JPN C;  1ZXT A;  4RGM A;  3NHH A;  4K5X A;  4A3C H;  1HJP A;  1PRT D;  2PZW A;  3ICE A;  3FPP A;  3UDG A;  1HTP A;  4JI6 L;  3LNN A;  2B2U A;  5C0X J;  2A6E C;  5I2Y A;  3I56 A;  3M3Y B;  1NE3 A;  1RD9 D;  3OPO A;  3RR5 A;  4LFC Q;  2R7F A;  1STH A;  4GKK L;  2B2V A;  2JP1 A;  4N8X 1;  2Z4H A;  3FHW A;  4DV0 L;  1T5X D;  4A3M B;  2EIF A;  2F0O A;  3FKI H;  1NMF A;  3RMH A;  4QMG A;  2LMC B;  5CC4 A;  5C44 G;  1XYI A;  3DWQ A;  4KKT A;  2LXJ A;  1PZI D;  3A7A B;  3NP8 A;  5JAV A;  2NYZ D;  4LF9 Q;  1EOT A;  1DYQ A;  2ID0 A;  1JT8 A;  1VQD A;  2YU9 B;  4YCW A;  5K36 G;  1TWH B;  1KNA A;  5IT9 L;  2PCF B;  3JC6 6;  1Q12 A;  2XTI A;  3SK5 A;  4ZRZ A;  1HNW Q;  1B7Y B;  2UU9 L;  1NUC A;  3HOZ H;  2UUB L;  1QZH A;  1V43 A;  1HZ9 A;  4KHZ A;  5IP7 H;  1EQR A;  3WOF A;  1BKB A;  3BYY B;  4A3G B;  5I9P A;  3F2C A;  1I6H B;  5KYL A;  2HCC A;  5CGK A;  1F9R A;  1CKN A;  1S5F D;  1TQO A;  2RF4 A;  1WOC A;  3PUY A;  2K5D A;  1E1O A;  5FJ8 H;  4JI0 L;  2PI2 E;  4IPD A;  1VDZ A;  4MTK A;  1Q7Y C;  2PO4 A;  3EJI A;  3PIP A;  1AH9 A;  1GHK A;  3PUV A;  2QEX A;  1V1P B;  1Y69 U;  3KJP A;  1S5D D;  1Y1V G;  1JJC B;  1WCM H;  2WAQ E;  3J80 c;  3D4W A;  4A76 A;  1SDF A;  2N78 A;  1YVC A;  2K03 A;  4A3D H;  2RKS A;  4BS9 A;  4AQY L;  4OWT B;  4HIK A;  1YHQ A;  2JK8 A;  1F9P A;  2OQ0 A;  1M1K C;  1BBX C;  1TY0 A;  1PTO H;  3LX0 A;  5EJW A;  5CV9 A;  1RHP A;  3A8J E;  4OWW B;  4DUY L;  1L0X B;  2VXW A;  3NPP A;  1RL2 A;  4ZQ3 A;  5M9O A;  1QE6 A;  4QUF A;  1X3G A;  1RDP D;  4C3J H;  1UE6 A;  3CC4 A;  2XRQ D;  1B9N A;  4LF4 L;  5M5X H;  2D62 A;  4DK1 A;  1O7Y A;  3D6W A;  3M9B A;  3HZX A;  1STE A;  1CFM A;  2N49 A;  2Q8I B;  2XSC A;  3K8A A;  4LUZ A;  3TZD A;  4KTA A;  3RN5 A;  4IOA A;  3P7J A;  5IGG A;  3QO2 A;  4U68 A;  4I65 A;  1W2B A;  2L5T A;  2EY6 A;  3LWU A;  3ERS X;  4LF7 Q;  1FJG Q;  2X69 A;  3E0J A;  3HOU H;  1PH8 A;  3EFX D;  3W3A A;  2NN6 I;  2NVT B;  1EWC A;  2K5N A;  1SNP A;  4DAY A;  4L5T A;  4DUZ L;  4Z9C B;  4HSP A;  1WD0 A;  1U5K A;  1VQ9 A;  1CT1 D;  2KBN A;  3UDX A;  4RG1 A;  4N9P A;  2NTT A;  2VZA A;  1H95 A;  2EJF C;  3ULP A;  2CFM A;  2ICI A;  3J7A V;  4IUV A;  4A3F H;  1SE8 A;  2K6A A;  4L8J A;  1E2W A;  2L9H A;  2VS1 A;  2WB1 E;  1H9S B;  5M5Y B;  2BCO A;  2E2I B;  3IKJ A;  4DR5 L;  3H3V I;  4B3M Q;  4O0A A;  2EY5 A;  1AE3 A;  4IUP A;  2F1M A;  1EY8 A;  4RKB A;  1I94 L;  1NAP A;  2JEA I;  1MBY A;  2R61 A;  3I72 A;  2IX1 A;  2OCE A;  3K0Y A;  4L5Q A;  2B2W C;  2TSS A;  4OIJ A;  5IIF A;  3GTP B;  3S2D B;  3VYR A;  5C44 B;  3GTL H;  2IWH A;  4QIW E;  4A3B G;  3P75 A;  2DN8 A;  2L55 A;  4JK1 C;  2R93 G;  4A3I G;  2E5L L;  1ROD A;  1TS2 A;  2NB0 A;  1KAW A;  3ND8 A;  2ENB A;  2BA0 A;  2CH4 W;  3MWY W;  1LV9 A;  3L7Z C;  2K33 A;  3CCU A;  1ZKO A;  3E3X A;  3GTM B;  3UE0 A;  4ZLT F;  1JJG A;  3E9H A;  4C56 C;  3PO3 H;  2E75 C;  5EPL A;  1UEB A;  4IUN A;  3D31 A;  2EPB A;  1X56 A;  3MHB A;  2ZJP A;  4FP5 D;  1YZ6 A;  3TRZ A;  1NMG A;  4FYD A;  3O13 A;  4O2D A;  3OW2 A;  2IX3 A;  3HKZ E;  2EOT A;  2CHB D;  2B2Y A;  2CW0 C;  2QIL A;  4FNF A;  4GKJ L;  4DR2 L;  2B2T A;  1WTW A;  5IYB H;  1PA6 A;  1PZK D;  3S16 H;  1PFM A;  3N6R A;  2B2V C;  2A68 C;  4PMC A;  3KDF A;  3VR5 A;  2E2H H;  4DPG A;  1F77 A;  4RGN A;  4A93 H;  1PYS B;  4LFA L;  1IYJ B;  2CQA A;  1EQV A;  1WTQ A;  4XQJ A;  2KA7 A;  2EJM A;  1AEX A;  1TR5 A;  5IP9 G;  1MSG A;  4DR1 Q;  5CV5 A;  4V19 0;  4JVZ A;  3NUC A;  1SR3 A;  3I90 A;  5L37 A;  4LNQ A;  1M4V A;  1A15 A;  3OTO L;  1RJT A;  3HOW B;  1QIL A;  2MO1 A;  1GUT A;  2K4K A;  4B3M L;  2KHJ A;  3DUZ A;  2ES2 A;  2NVQ B;  3OIQ A;  4H0L C;  3RUZ A;  2E2J H;  3Q6S A;  1XTC D;  2F03 A;  1X3Q A;  5C4X G;  1Q1B A;  4JBW A;  1PFS A;  3TS0 A;  1TWF H;  4O1N A;  1Q8K A;  2UXD Q;  2C5C A;  3A56 A;  5FLX c;  4ZUI A;  1G2T A;  4R4T A;  3STB C;  1QUQ B;  3P1H A;  2GN5 A;  1JE4 A;  3S24 A;  3URY A;  4JI8 L;  1Y14 B;  1ZYR C;  4YCU A;  3TQY A;  2JA5 G;  4KY5 A;  4HJ9 A;  4LAA A;  1SJE D;  3CRK C;  1TWG H;  4IQZ A;  1N34 L;  4RFB A;  3HFZ B;  4QY7 A;  1KIX A;  1BUV T;  2GVB A;  4FO2 A;  2Q8R E;  2K28 A;  1CTM A;  1BCP C;  3RZD H;  1PXU A;  3E6Z X;  3NTK A;  4OO1 H;  1CKO A;  3T16 A;  1CQF A;  4UY8 C;  4HMJ A;  2RSO A;  3QOJ A;  4IUU A;  4OL7 A;  1J9O A;  1GO3 E;  2QEJ C;  3F1Z A;  3TS2 A;  1E0B A;  1SE3 A;  1PTO C;  2CQO A;  1EEF D;  3KF6 A;  3K5M A;  1HUN A;  4CDC C;  5C6A A;  1GM5 A;  1N33 L;  1STB A;  2XNA C;  2SNM A;  1A2U A;  2V1C C;  3PMF A;  3H0G G;  3Q23 A;  2PQE A;  4BBS G;  1FGU A;  4YWM A;  2R92 H;  4XXE A;  3J80 E;  2R93 B;  4A3I B;  2D5D A;  4FF4 A;  2VQF Q;  2F0I A;  1QVF A;  1TWC H;  1F2M A;  1MI2 A;  4FXK C;  5J22 A;  3PIO A;  1BF4 A;  2D0P A;  3J80 i;  5CYU A;  2B8F A;  5FKA C;  2A6E D;  3CCQ A;  1SYD A;  4LFB Q;  3PV0 A;  4GOP B;  1L1O A;  1VQJ A;  1CI3 M;  3TDQ A;  1D6E C;  4LUO A;  5CR3 A;  1SYC A;  5GAH C;  5CMD A;  3EN2 A;  1K8G A;  2VUM H;  4JBM A;  1EY7 A;  5KGU A;  2BH8 A;  1D5X C;  3U4Z A;  3I4N G;  1B70 B;  3S17 B;  1DOK A;  1C4Q A;  4EQP A;  4IN3 A;  4GNX B;  1HFG A;  4RGO S;  1LTA D;  1HFN A;  2AMC B;  4AYB G;  4K2L A;  4HSV A;  4Y7N B;  3GV6 A;  3VYS A;  1X6O A;  2KEC A;  1UNS A;  4B9X A;  3K5L A;  1IBM Q;  2YTY A;  1PV4 A;  2FMM A;  3HOX H;  4HJ8 A;  5M5W H;  1F9Q A;  2Q2U A;  1I4P A;  3SXH A;  1EU3 A;  3CCJ A;  1VQB A;  2Z6B A;  2M2L A;  1CQV A;  4K6D A;  4DF7 A;  4R9W A;  5FOB B;  1ENA A;  4RWS C;  2A1A A;  2MGS A;  1BQQ T;  4HJA A;  1CA5 A;  1A2T A;  1K28 A;  3KLS A;  5IYC H;  1PH5 A;  1DOM A;  1EIF A;  4IJH A;  2RHS B;  5D65 A;  2FMC A;  1WVL A;  5ELF A;  2HIV A;  5BN5 A;  2MPM A;  1N9W A;  3NBH A;  1X54 A;  1PVO A;  5C0X G;  1SMX A;  2K01 A;  3J7Z C;  4KD4 A;  2M9V A;  5IOC A;  4ALP A;  4V0B A;  2MP1 A;  1XNQ L;  1C48 A;  1VF7 A;  3P20 A;  1V9P A;  3K5N A;  1S72 A;  5JJL A;  3GTQ H;  5C4X B;  1LT4 D;  1CA6 A;  3S15 B;  3LGJ A;  2Q2I A;  2XGT A;  2RHQ B;  4ODG A;  1LO5 D;  1KDC A;  1SE2 A;  4HMI A;  5ELD A;  4DV3 Q;  3H91 A;  4DV6 Q;  2JA5 B;  3D6C A;  4UAI A;  4JI7 Q;  2ZXO A;  1EY5 A;  2VQE Q;  5IGC A;  3DHQ A;  4R4I A;  2NVX B;  4NKL A;  4B3T L;  4X3S A;  4JCV E;  5IGD A;  2VB3 X;  3HKS A;  3G71 A;  5CBE E;  2B2Y C;  4C1N I;  2EYM A;  2B2T C;  4MNO A;  2F3V A;  5KYI A;  4LFB L;  4ID6 A;  1OXS C;  1P16 A;  3D8G A;  1ESR A;  4JI5 L;  4EQ5 A;  4DR7 Q;  4N9T A;  3KF8 A;  4A3E H;  5C4J H;  4OGQ C;  1Q82 C;  1JB7 A;  3I4L A;  2KCC A;  2UXC Q;  1HNZ Q;  4O42 A;  3HOY H;  1IBL L;  4BY1 G;  1ASZ A;  2K50 A;  3K7A H;  3NE5 B;  1SYE A;  5F2D A;  1LT3 D;  4OX9 Q;  4HID A;  2KED A;  2SDF A;  2H1E A;  3MXN A;  1F2Y A;  5LHY 1;  1HUM A;  2JA6 H;  3H0G B;  5EKK A;  3Q22 A;  1JIC A;  3D4D A;  1IW7 D;  4BBS B;  3NK9 A;  1EU4 A;  3TZU A;  4BBR G;  1LTS D;  2O4X A;  4MN3 A;  4J8Q A;  4JV5 Q;  1XPO A;  2JQO A;  3SDZ A;  1SNO A;  4QF4 A;  2Z4I A;  3F8T A;  4I7A A;  1J5E L;  4JW0 A;  4ME5 A;  1XPR A;  3DLL A;  3TBI B;  1ASY A;  2L1B A;  4OHJ A;  3PUZ A;  3G48 A;  2WFW A;  4JI3 Q;  1QOH A;  2C9O A;  1T9H A;  2DUD A;  3N52 A;  4JG2 A;  3FKI G;  4F87 A;  4FF2 A;  3I4N B;  5M3F H;  2R6G A;  3DEO A;  1VQO A;  3V2T A;  2KCT A;  4RGT A;  5FK9 C;  3PIP 3;  5KNC A;  1FNU A;  5HGQ A;  4AYB B;  1FL0 A;  1I4Q A;  1JWU D;  1KAB A;  3CCR A;  4FXG C;  5FLX E;  2F0F A;  4PZ8 A;  4IFD J; 
#chains in the Genus database with same CATH homology
 3QG1 A;  2K7V A;  1HCZ A;  1W6J A;  2IJ0 A;  1GXD C;  4K5W A;  2MJ8 A;  2QF7 A;  2B8G A;  5JVG 3;  2X6G A;  2DY8 A;  2A69 C;  1U4P A;  1EIG A;  1WTX A;  1STA A;  1IHZ A;  1PDQ A;  4EGV A;  3S1R B;  1SXT A;  1SYF A;  2CW0 D;  4FXD A;  4G7H C;  5D3D A;  5JPM C;  3KLS X;  3K57 A;  2ICE C;  3K5O A;  1UAP A;  1IYV A;  1PRT F;  4NDX A;  3ITP A;  3R8B A;  3VYU A;  4HR7 B;  1MSH A;  2F0S A;  2A68 D;  3NWT A;  1SSO A;  1B44 D;  2AQ3 B;  1OXU A;  2XN9 C;  2A74 C;  4NW2 A;  1JOQ A;  2HQE A;  4NP5 A;  4QB4 A;  4RA8 A;  4C3J G;  1ESF A;  4RH6 A;  3K59 A;  4UDU C;  1V1P A;  4F88 A;  1AZQ A;  4XQN A;  4PMB A;  5C0X I;  1ILP A;  5C3W A;  3MA2 B;  5I9O A;  3C2P A;  1SAP A;  3GV3 A;  3RLF A;  2ZXP A;  1SFO B;  1D5Z C;  1LAC A;  5ISR A;  1XWE A;  1D2B A;  4DA2 A;  2XIW A;  4J6H A;  4BY1 B;  1S4Z A;  1I4H A;  4DN4 M;  2JE6 I;  2WV6 D;  4DFA A;  2IX0 A;  4TRD A;  1ZYR D;  4BBR B;  1I50 B;  1DOL A;  2KUM A;  1UUP A;  1LTT D;  1K8O A;  1KLG D;  3R2I A;  2EY1 A;  1PRT B;  1KDA A;  1BCP D;  3VR3 A;  2F0E A;  2WAC A;  5JOB A;  5FO8 B;  1JWS D;  3J7A F;  1PTO D;  3KLR A;  3MXG A;  3ERO A;  3FKI B;  2PW7 A;  3X3N A;  5D14 A;  3C1E A;  1H9S A;  1Q8I A;  1Y8N B;  5EBC A;  1S5E D;  5BN3 A;  3C1F A;  1I4G A;  3NQI A;  5E4W C;  1F2L A;  1LAB A;  3J80 L;  5KRU A;  1ENC A;  4KKU A;  1Y8O B;  1HQR D;  4RKL A;  2PNR C;  3SE0 A;  1IW7 C;  4H13 C;  5K36 H;  3AMU A;  1WCM B;  1M8A A;  4DAP A;  1BCP B;  5FO7 B;  4A3D B;  2EDG A;  3I70 A;  1G2S A;  3BDO A;  3TP6 A;  1R4P B;  3MZ5 A;  3A7L A;  4QCL A;  5JVH 3;  1Z47 A;  4FF3 A;  2B63 B;  1R4Q B;  4C3J B;  3PO2 B;  5M5X B;  3HG9 A;  1MGS A;  2OF1 A;  1E2V A;  1XX8 A;  1Z6H A;  3MXU A;  3OMG A;  3H94 A;  1BNZ A;  3BVG A;  1G91 A;  1JCK B;  3CQZ B;  3M4O B;  3HOU B;  1ML0 D;  4ZYS A;  5J1Z A;  1LTR D;  5IGB A;  3H6M A;  1K83 B;  2LFN A;  1SEB D;  4TQU S;  3MVV A;  1HA6 A;  1GUW A;  2EYL A;  3FRP B;  3BVZ A;  3GTG B;  4S3S A;  4OIK A;  1PZJ D;  3PIO 3;  5ELB A;  2AWN A;  1BO0 A;  4CKE A;  4CJ2 C;  2F3W A;  2WAQ B;  3T51 B;  2B2U C;  4OO1 G;  2A6H C;  1STY A;  1GUS A;  3WDN A;  3SVM A;  3K58 A;  3KBG A;  4KK7 A;  3TP5 A;  1DJR D;  2LS0 1;  1I3Q B;  2NUC A;  3W2D A;  1SND A;  5KND A;  3GTL B;  3UI2 A;  2L4N A;  3A55 A;  3FEW X;  4KY7 A;  2OT2 A;  4B08 A;  1F2Z A;  2KQ3 A;  3E5S A;  3KK7 A;  2BE5 C;  5CV4 A;  5HUR A;  5IT9 E;  1WTV A;  1QG7 A;  3GTK B;  3D4R A;  3TP8 A;  5EGT A;  3PO3 B;  5M3M B;  2RDG A;  5AFW A;  1SBB B;  5C4Z A;  3CKI B;  3T56 B;  3KUP A;  2Q8T A;  2EYH A;  1EY9 A;  4LK1 C;  2HUG A;  4ZUJ A;  3H3V C;  3S2H B;  4R8I A;  4ZKB B;  4G7Z C;  4YIJ A;  1IYU A;  3S16 B;  2EZV A;  3BDL A;  2SOB A;  3X3M A;  4XQQ A;  1DXM A;  2E2H B;  3VR2 A;  1WTP A;  1D5M C;  1TT2 A;  2KVM A;  1EZ8 A;  3NSW A;  1JR0 D;  5IGF A;  2F0V A;  2A69 D;  4E6I A;  4LJZ C;  2G9H D;  4HCE A;  3OWE B;  2AUJ D;  1AN8 A;  5D3I B;  1GUN A;  1Z7T A;  3ONA B;  1TS3 A;  5FLX L;  1DCZ A;  2E2J B;  1Q3L A;  1RKN A;  5E3F A;  1FNW A;  1TWF B;  1HHV A;  5G3L F;  3DWP A;  2BA1 A;  1DM0 B;  3KBX A;  4IAL A;  3DXJ C;  3NXW A;  5A2Q E;  4G7O C;  4K5V A;  1TWG B;  2K5Q A;  1PFN A;  3NWS A;  2EYO A;  5EKI A;  4PMW A;  5KIX A;  1NCV A;  4IFD G;  4K8I A;  3A54 A;  3RZO B;  3HKZ B;  3VA7 A;  4CBV A;  4K14 A;  2K32 A;  2AUK A;  1O80 A;  1EFI D;  4DU9 A;  2JA8 B;  4TKO B;  1FNV A;  3F2U A;  4Q5V A;  3NBI A;  1EL0 A;  4PNY A;  1BDO A;  2B39 A;  4CGY B;  5KNB A;  1CHQ D;  1QCB D;  5K5P A;  2RBM A;  4CKB A;  1SYB A;  3OWF A;  2TMP A;  3J81 E;  1JWM D;  3TN2 A;  2EE1 A;  2RQX A;  4OO1 I;  1I4R A;  3V05 A;  3QJY A;  2RDH A;  3OW7 A;  3R2T A;  2JYO A;  4P2C B;  1ILQ A;  3QOL A;  2XVS A;  1DON A;  1O78 A;  1HRJ A;  1S5B D;  3GP7 A;  3HRZ C;  4ABN A;  3SK6 A;  2EY2 A;  2EXZ A;  3HOX B;  2HCI A;  4HED A;  5M5W B;  3C46 A;  1UEA B;  2F0D A;  4HCS A;  1STG A;  1SNQ A;  1VMC A;  4ZK9 B;  1S5C D;  4G4K A;  3BG3 A;  5BN4 A;  3DWA A;  1OXV A;  3DM1 A;  1Y1W B;  1QWY A;  1VMP A;  3NQT A;  1EQT A;  4CJ0 B;  3S14 B;  4KD3 A;  4KHV A;  3GTQ B;  2N55 A;  1PMR A;  2BDO A;  2F0U A;  3TSS A;  2O2L D;  2VNU D;  3MFG A;  2WKC A;  1EY6 A;  5FO9 B;  3S1Q B;  1OXX K;  1LT6 D;  4BA1 I;  5KEE A;  1B9M A;  1ET9 A;  2WII B;  3I4M B;  5I6Y A;  4PV1 C;  1CZW A;  1CZG A;  2EYP A;  4IUR A;  1AW7 A;  4A3E B;  3T4A C;  3BZD B;  5HGT A;  1EY4 A;  3I8Z A;  1Q1E A;  3HOY B;  1J8I A;  1AFP A;  2ZT9 C;  4KI0 A;  2JA6 B;  5I4D A;  2XWB B;  4C1N K;  1SMY C;  4Q0F A;  4XT1 B;  4C3I G;  1H9K A;  2F0Q A;  1JB3 A;  3M85 A;  3SK8 A;  1AZP A;  4IFD I;  3VR6 A;  3MXP A;  3OSO A;  4KJO A;  1VF5 C;  2JSO A;  1U4M A;  2A6H D;  4HN7 A;  4DXG A;  1B50 A;  4IUQ A;  1K8M A;  2F0N A;  2J7Z A;  4C2M B;  1L0Y B;  2PZU A;  1LTI D;  1ONL A;  3TP7 A;  4MHE A;  3AB9 A;  2X6L A;  4WRD A;  3S9W A;  4ILW A;  2LY7 A;  1T5E A;  2F0K A;  1RTN A;  1B1Z A;  2BE5 D;  5EBD A;  4I7Z C;  1PFB A;  5COY A;  1QNK A;  2JA7 B;  3BVM A;  4KMU C;  5DNF A;  4FF1 A;  2PYK A;  2Y0S B;  2NN6 H;  2IT1 A;  5C5M A;  3ZYY X;  1QJO A;  3QIA A;  2RSN A;  3VA5 A;  5JEA H;  4RCN A;  4CJ1 B;  3OHX C;  2F0J A;  4CKC A;  4ZKC B;  2SEB D;  1YNJ C;  4NMZ A;  2AWO A;  5J39 A;  2KEE A;  1GUO A;  3VYT A;  3U9O A;  4LMQ D;  3MEH A;  1KLU D;  2FIN B;  1G6Z A;  5DM7 3;  5C3X A;  2MUY A;  4DNT B;  3J7Y W;  2QDB A;  3GD7 A;  1HA5 A;  3JAM E;  3H09 A;  2K04 A;  1IKL A;  3FPU B;  4EQN A;  5JJZ A;  1PLF A;  4B9W A;  1BCP F;  2F0M A;  3WOE A;  1KAA A;  3CU7 A;  3I73 A;  4IUT A;  4RCO A;  3RD4 A;  1JOK A;  5EPJ A;  2MHV A;  5ELE A;  1PTO F;  2NVY B;  1E2Z A;  2L11 A;  4K6L A;  1EZ6 A;  5DEH A;  2XRS D;  5C3E B;  4QUC A;  1IKM A;  4G57 A;  1Y8P B;  2I46 A;  2OXP A;  2EJG C;  2HDL A;  1IL8 A;  2EVB A;  3HOZ B;  2JEB I;  1SJH D;  5JEA J;  4C3I B;  1HTL D;  1O7L A;  5EPK A;  4RAU C;  5EKL A;  3I91 A;  1B4O A;  4XYO A;  2JXM B;  2RA4 A;  3QWN A;  1LTG D;  4BA2 I;  4XIG S;  5DAU A;  1STN A;  1EWH A;  1JOR A;  4F8M A;  2PZT A;  2F0T A;  3GQB A;  1HXY D;  1PTO B;  4FVM A;  5A2Q L;  3Q24 A;  1X3P A;  2O5I C;  1NR4 A;  2PPB C;  4DNR B;  2A5H A;  4F7X A;  1QNU A;  1EIH A;  3BS1 A;  3G6J B;  1YNN C;  1A3V A;  1HPC A;  2F0H A;  1U4R A;  3EVQ A;  4X3K A;  1VCI A;  4KN4 C;  1V1O A;  2AQ1 B;  5CBA E;  2G9D A;  4L6T B;  3DEP A;  1RCV D;  3ERQ A;  4KJN A;  1H9J A;  1U4L A;  2DNC A;  2F0G A;  3R3O A;  2RVL A;  3A8K E;  2YYZ A;  5ELC A;  1EYA A;  1WTO A;  3J81 L;  2E74 C;  4A3F B;  1V8Q A;  4A3K B;  1GUG A;  1NR2 A;  2Z1C A;  2FHT A;  1FGB D;  2A73 B;  3M7G A;  2WKD A;  1GOZ A;  4H7B A;  1U9R A;  3V96 A;  5LL6 S;  2WP8 J;  2O5J C;  2J4X A;  2AQ2 B;  3MC0 B;  1Y1V B;  5EQ0 A;  1B53 A;  2Z8L A;  1TS5 A;  3IFD A;  1PRT C;  1W6K A;  1TKW B;  5E1F A;  1B3A A;  4EVO A;  2EYJ A;  5IOD A;  1ENF A;  4H44 C;  3K6O A;  3EQL C;  1CK1 A;  3IL8 A;  1ET6 A;  4DGZ A;  4X3T A;  3S1N B;  4DAV A;  1Q90 A;  2QCP X;  3EA6 A;  3OIP A;  4XTC S;  1TII D;  1FR3 A;  5DM6 3;  1WD1 A;  4KV6 A;  2WB1 B;  3HP3 A;  1SNM A;  5C4H A;  1DD2 A;  1TVX A;  3IAY A;  2BOS A;  4A93 B;  2N88 A;  2LKV A;  1LLR D;  2L12 A;  1QB5 D;  1SMY D;  3GO5 A;  1B2T A;  1F9S A;  3L3O C;  3Q0A A;  5CV8 A;  4CHT B;  4QIW B;  3T53 B;  5LL6 X;  5CV7 A;  4DXF A;  3BYT B;  2V4D A;  1CM9 A;  1KDB A;  2D2C C;  2SNS A;  1JQY D;  4A3J B;  3SEB A;  1I6V C;  1PYW D;  5C5L A;  1TWA B;  5TSS A;  3NTH A;  2E2D C;  4A3B B;  1HQM C;  1G8Z D;  1R9T B;  5COR A;  3BDC A;  4J1M A;  3FVQ A;  3DMU A;  1RTO A;  3HGB A;  3FMC A;  1AP0 A;  2FFK B;  5G3L D;  1LTB D;  2WIN B;  1EYD A;  2VB2 X;  5T1I A;  3C3L A;  1SYG A;  1H9M A;  3RZD B;  2HDM A;  3PUW A;  4M8A A;  4C3H G;  1BR9 A;  3HS0 C;  2KJX A;  1D1I A;  4DK0 A;  2KCN A;  2L0C A;  3MTS A;  1YNJ D;  2I07 B;  4KN7 C;  2PMZ B;  5E4X A;  1CHP D;  2R92 B;  4RHS A;  2F0P A;  1TWC B;  2OEO A;  1H9R A;  1BXT A;  3SK4 A;  2IL8 A;  2NBF A;  2NTS A;  2E76 C;  1OO9 B;  2XWJ B;  4U67 3;  1WTR A;  3GTO B;  4PQX A;  4K8J A;  1EY0 A;  4HAE A;  2VUM B;  3S1M B;  1TU2 B;  4XT3 B;  1I4X A;  4KKS A;  3HOV B;  1EEI D;  4WFN 3;  2F4I A;  4L63 B;  3JAM L;  3TME A;  5A35 A;  1X32 A;  2QKI C;  1ZEQ X;  1O7Z A;  3G7L A;  3AU7 A;  2BDN A;  1NSN S;  3M4Y A;  1BOS A;  1D1K A;  2NZ1 D;  1JOO A;  3I3C A;  3T13 A;  5I2X A;  2IW3 A;  2DNE A;  3SHL A;  2D9U A;  1ICW A;  3IFT A;  5IGE A;  4IFD H;  4GZY C;  1GHJ A;  3NTI A;  3LWE A;  3OMC A;  1OXT A;  2EYF A;  3PUX A;  4X3U A;  2KOL A;  1DZ1 A;  4R8N A;  4XYQ A;  5T1G A;  3U9S A;  1A3U A;  2KHS A;  3D3R A;  2F0W A;  2FJ2 A;  3A8I E;  1C8C A;  2IPK D;  2CVR A;  1FD7 D;  3L9A X;  4RHR A;  1EYC A;  1MD2 D;  1SNC A;  2GA4 B;  2PW5 A;  5C0X H;  1A3T A;  1XXG A;  1II3 A;  1KNE A;  3FDT A;  2K1B A;  1SE4 A;  2DY7 A;  1YNN D;  3CRL C;  3QB3 A;  4EQO A;  2NN6 G;  3HEJ A;  4BY7 B;  1JC7 A;  5C4J B;  3M7N A;  3R93 A;  3ND9 A;  4C3H B;  4IZ8 A;  5JEA G;  4WOR A;  4HTH A;  1FYC A;  3CHB D;  3K7A B;  1A6X A;  3GTJ B;  2M00 A;  1RF2 D;  1TY2 A;  4M1U B;  2B2W A;  4MIU A;  4TSS A;  3SR1 A;  4ZAI A;  3MAQ A;  1LT5 D;  2J0T D;  4ULL A;  2ZXR A;  4WJW A;  2R7Z B;  1KTK A;  4K2K A;  5CV6 A;  2K05 A;  2R3Z A;  3OOC A;  3MFY A;  2K5W A;  2F0L A;  4XDX A;  5I6W A;  5NUC A;  2RDF A;  4KY6 A;  1GJX A;  1G29 1;  2H4O A;  2NWG A;  5M3F B;  1TS4 A;  4BWG B;  3VR4 A;  5JPN C;  1ZXT A;  4RGM A;  3NHH A;  4K5X A;  1PRT D;  2PZW A;  3FPP A;  1HTP A;  3LNN A;  2B2U A;  5C0X J;  2A6E C;  5I2Y A;  3M3Y B;  1RD9 D;  3OPO A;  1STH A;  2B2V A;  2JP1 A;  2Z4H A;  1T5X D;  4A3M B;  2F0O A;  3RMH A;  4QMG A;  2LMC B;  5CC4 A;  1XYI A;  3DWQ A;  4KKT A;  1PZI D;  3A7A B;  3NP8 A;  5JAV A;  2NYZ D;  1EOT A;  1DYQ A;  2ID0 A;  2YU9 B;  5K36 G;  1TWH B;  1KNA A;  5IT9 L;  2PCF B;  1Q12 A;  3SK5 A;  4ZRZ A;  1NUC A;  1V43 A;  4KHZ A;  3WOF A;  3BYY B;  4A3G B;  5I9P A;  1I6H B;  5KYL A;  2HCC A;  5CGK A;  1F9R A;  1S5F D;  1TQO A;  3PUY A;  2K5D A;  1VDZ A;  2PO4 A;  3EJI A;  1GHK A;  3PUV A;  1V1P B;  1Y69 U;  1S5D D;  3D4W A;  1SDF A;  2K03 A;  2RKS A;  4BS9 A;  1F9P A;  1BBX C;  1TY0 A;  1PTO H;  3LX0 A;  5EJW A;  5CV9 A;  1RHP A;  3A8J E;  1L0X B;  2VXW A;  3NPP A;  4ZQ3 A;  5M9O A;  1QE6 A;  4QUF A;  1RDP D;  2XRQ D;  1B9N A;  2D62 A;  4DK1 A;  1O7Y A;  3D6W A;  3HZX A;  1STE A;  1CFM A;  2Q8I B;  2XSC A;  3TZD A;  4KTA A;  3P7J A;  5IGG A;  3QO2 A;  4U68 A;  4I65 A;  2L5T A;  2EY6 A;  3LWU A;  2X69 A;  3E0J A;  3EFX D;  3W3A A;  2NN6 I;  2NVT B;  1EWC A;  1SNP A;  4DAY A;  4Z9C B;  4HSP A;  1WD0 A;  1CT1 D;  4N9P A;  2NTT A;  2EJF C;  2ICI A;  3J7A V;  4IUV A;  2K6A A;  4L8J A;  1E2W A;  2L9H A;  1H9S B;  5M5Y B;  2BCO A;  2E2I B;  3IKJ A;  2EY5 A;  4IUP A;  2F1M A;  1EY8 A;  4RKB A;  1NAP A;  2JEA I;  1MBY A;  2R61 A;  3I72 A;  2IX1 A;  3K0Y A;  2B2W C;  2TSS A;  4OIJ A;  5IIF A;  3GTP B;  3S2D B;  3VYR A;  5C44 B;  2IWH A;  3P75 A;  2DN8 A;  2L55 A;  4JK1 C;  1ROD A;  1TS2 A;  2NB0 A;  3ND8 A;  2ENB A;  2BA0 A;  3MWY W;  1LV9 A;  3L7Z C;  2K33 A;  1ZKO A;  3GTM B;  4ZLT F;  4C56 C;  2E75 C;  5EPL A;  4IUN A;  3D31 A;  2EPB A;  3MHB A;  4FP5 D;  4FYD A;  3O13 A;  2IX3 A;  2EOT A;  2CHB D;  2B2Y A;  2CW0 C;  2QIL A;  4FNF A;  2B2T A;  1WTW A;  1PZK D;  1PFM A;  3N6R A;  2B2V C;  2A68 C;  4PMC A;  3VR5 A;  1F77 A;  4RGN A;  2CQA A;  1EQV A;  1WTQ A;  4XQJ A;  2KA7 A;  2EJM A;  1AEX A;  1TR5 A;  1MSG A;  5CV5 A;  4V19 0;  3NUC A;  3I90 A;  1M4V A;  1A15 A;  1RJT A;  3HOW B;  1QIL A;  1GUT A;  3DUZ A;  2NVQ B;  3OIQ A;  4H0L C;  3RUZ A;  3Q6S A;  1XTC D;  2F03 A;  1X3Q A;  1Q1B A;  4JBW A;  4O1N A;  2C5C A;  3A56 A;  4ZUI A;  1G2T A;  3P1H A;  1JE4 A;  3URY A;  1ZYR C;  4KY5 A;  4LAA A;  1SJE D;  3CRK C;  4IQZ A;  4RFB A;  1BUV T;  4FO2 A;  2Q8R E;  2K28 A;  1CTM A;  1BCP C;  1PXU A;  3E6Z X;  3NTK A;  4OO1 H;  3T16 A;  1CQF A;  4HMJ A;  2RSO A;  3QOJ A;  4IUU A;  4OL7 A;  1J9O A;  2QEJ C;  1E0B A;  1SE3 A;  1PTO C;  1EEF D;  3K5M A;  1HUN A;  5C6A A;  1STB A;  2XNA C;  2SNM A;  1A2U A;  3PMF A;  3Q23 A;  2PQE A;  4XXE A;  3J80 E;  2R93 B;  4A3I B;  2D5D A;  4FF4 A;  2F0I A;  1F2M A;  1MI2 A;  4FXK C;  5J22 A;  1BF4 A;  5CYU A;  2B8F A;  5FKA C;  2A6E D;  1SYD A;  3PV0 A;  1CI3 M;  3TDQ A;  1D6E C;  5CR3 A;  1SYC A;  5CMD A;  1EY7 A;  5KGU A;  1D5X C;  3S17 B;  1DOK A;  1C4Q A;  4EQP A;  4IN3 A;  1HFG A;  4RGO S;  1LTA D;  1HFN A;  4K2L A;  4HSV A;  4Y7N B;  3GV6 A;  3VYS A;  2KEC A;  1UNS A;  4B9X A;  3K5L A;  2FMM A;  1F9Q A;  1I4P A;  3SXH A;  1EU3 A;  2M2L A;  1CQV A;  4K6D A;  4DF7 A;  4R9W A;  5FOB B;  1ENA A;  4RWS C;  2MGS A;  1BQQ T;  1CA5 A;  1A2T A;  3KLS A;  1DOM A;  5D65 A;  2FMC A;  1WVL A;  5ELF A;  5BN5 A;  2MPM A;  3NBH A;  5C0X G;  2K01 A;  4KD4 A;  5IOC A;  2M9V A;  4V0B A;  2MP1 A;  1C48 A;  1VF7 A;  3P20 A;  3K5N A;  5C4X B;  1LT4 D;  1CA6 A;  3S15 B;  4ODG A;  1LO5 D;  1KDC A;  1SE2 A;  4HMI A;  5ELD A;  3H91 A;  2JA5 B;  3D6C A;  4UAI A;  2ZXO A;  1EY5 A;  5IGC A;  3DHQ A;  2NVX B;  4NKL A;  4X3S A;  5IGD A;  2VB3 X;  5CBE E;  2B2Y C;  4C1N I;  2EYM A;  2B2T C;  2F3V A;  5KYI A;  4ID6 A;  1OXS C;  3D8G A;  1ESR A;  4N9T A;  3KF8 A;  4OGQ C;  3I4L A;  2KCC A;  4O42 A;  3NE5 B;  5F2D A;  1SYE A;  1LT3 D;  2KED A;  2SDF A;  2H1E A;  3MXN A;  1F2Y A;  5LHY 1;  1HUM A;  3H0G B;  5EKK A;  3Q22 A;  1JIC A;  3D4D A;  1IW7 D;  4BBS B;  3NK9 A;  1EU4 A;  3TZU A;  1LTS D;  2O4X A;  4MN3 A;  4J8Q A;  3SDZ A;  1SNO A;  4QF4 A;  2Z4I A;  4ME5 A;  3TBI B;  2L1B A;  4OHJ A;  3PUZ A;  1QOH A;  2C9O A;  3N52 A;  4F87 A;  4FF2 A;  3I4N B;  2R6G A;  3DEO A;  3V2T A;  4RGT A;  5FK9 C;  3PIP 3;  5KNC A;  1FNU A;  4AYB B;  1I4Q A;  1JWU D;  1KAB A;  4FXG C;  5FLX E;  2F0F A;  4IFD J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...