1EIHA

Solution structure of the human chemokine eotaxin-2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQSCGDPKQEWVQRYMKNLDAKQKKASPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EOTAXIN-2
publication title NMR solution structure and receptor peptide binding of the CC chemokine eotaxin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eihA00
3I3CA 2JP1A 1PDQA 5E4XA 3GV3A 4NW2A 1AZPA 1U4MA 2RSOA 1PFNA 5DNFA 1G91A 1HRJA 1F9SA 4HAEA 4ZAIA 5CMDA 3F2UA 1PFBA 3G7LA 4XT3B 5EKIA 1LV9A 1S4ZA 2B2UC 1HUMA 2HUGA 4R9WA 1HA6A 2DY7A 4MHEA 4QUFA 2FJ2A 3DEOA 2L1BA 1EQTA 2KUMA 4LMQD 4X3KA 2Q8RE 1Q3LA 4RA8A 3TN2A 2NYZD 2SDFA 4HCSA 2B2WC 3FPUB 5COYA 2MPMA 1B50A 1DOMA 2MP1A 1O7ZA 2B2UA 1EIHA 2RSNA 3Q6SA 1WTPA 2L9HA 2MGSA 2B2TC 2FMMA 4IUVA 1CM9A 1XYIA 1HHVA 2R3ZA 1SAPA 2IL8A 5JJZA 4ZKCB 2NZ1D 1M8AA 2B2WA 4IUPA 1F9PA 1B53A 2FFKB 2RVLA 4X3SA 4U68A 5CORA 1VMCA 1IL8A 1MGSA 3ONAB 4ZK9B 1WVLA 3D6WA 3TZDA 1WTRA 1AZQA 1ILPA 1HFNA 1J9OA 2J7ZA 4XT1B 1EOTA 2B2TA 2Q8TA 2RA4A 4UAIA 2L4NA 1PLFA 2K03A 1WTQA 3N52A 2BDNA 1ZXTA 5D14A 1JICA 2NWGA 3H91A 3HP3A 4RWSC 1NR2A 5T1IA 2B2YC 2VXWA 1AP0A 4XDXA 3I90A 1ESRA 1QNKA 3I8ZA 3I91A 2K1BA 4IURA 1IKLA 2KECA 3GV6A 5EPKA 4IUQA 1RHPA 1JE4A 1XX8A 2X6LA 4CJ2C 1MI2A 5E4WC 3SVMA 2K01A 1RJTA 4HEDA 1F9QA 1X3QA 2HCIA 2HCCA 5T1GA 1WTOA 3MWYW 1MSGA 2B2YA 1VMPA 4X3UA 1WTWA 2H1EA 4QUCA 1SSOA 1DZ1A 2EPBA 1X32A 2EE1A 1J8IA 1DONA 2FINB 2HDMA 1ICWA 1G2SA 1RTOA 1F9RA 2B2VC 3KBXA 1O80A 2MJ8A 1TVXA 4ZLTF 2XIWA 4RAUC 2D9UA 4X3TA 1KNAA 1C8CA 4OIJA 1F2LA 1ML0D 1IKMA 1QE6A 2K28A 1CA5A 1NAPA 1U4RA 2DY8A 2X6GA 1WD1A 2L12A 2CVRA 3QO2A 4MN3A 4IUTA 1BBXC 2KEDA 1B4OA 4HSVA 3P7JA 3KUPA 1G6ZA 1ILQA 3IFDA 1WTXA 1NR4A 2KOLA 1BNZA 5EQ0A 4OIKA 2K05A 2N55A 5EPJA 5CBAE 2EOTA 1B3AA 5EPLA 1NCVA 1PFMA 1A15A 1DOKA 1QG7A 1X3PA 1HFGA 2N88A 1E0BA 3IL8A 5EJWA 3DEPA 1BF4A 1HUNA 1U4PA 2FHTA 4DN4M 5CBEE 1U4LA 3DM1A 1DOLA 1KNEA 1O7YA 2KEEA 1WTVA 2X69A 1EL0A 1G2TA 2L11A 1MSHA 3R93A 4O42A 4ZKBB 4R8IA 1CA6A 1RTNA 2K04A 4IUUA 1B2TA 4CJ0B 2JYOA 5AFWA 3UI2A 1GUWA 1RODA 2HDLA 3FDTA 3LWEA 1BO0A 1WD0A 2B2VA 2KVMA 1SDFA 1EIGA 5D65A 4CJ1B 2M2LA 3MTSA
chains in the Genus database with same CATH superfamily
2YV5A 5HY6A 2B63H 4B3RL 2K52A 4L63B 1PMRA 5A2QL 2R6GA 4LFAQ 4XT3B 1TQOA 5EKIA 1YITA 2J4XA 1L0YB 1LTAD 5JJLA 3PQIA 1AE3A 4U673 1K3BC 3DEOA 4LMQD 3CCJA 1WYDA 3PUZA 3J7YW 1GHJA 1QUQA 2CCZA 2JA8G 1B50A 1A2UA 1NMGA 2G9DA 4NP5A 5IY0A 4K2LA 5JJKA 1CM9A 2R61A 1F2MA 4IZ8A 1PRTF 2RVLA 2PI2A 5I9OA 3ONAB 1WVLA 4JI5L 1PTOB 1TR5A 3S17H 3G6EA 1XNRL 4A3MB 3NWTA 5J22A 3I4NB 3S15H 3GV6A 4LF5Q 3CHBD 5EKLA 4YCUA 1PYBA 3ER0A 1HCZA 4JI4Q 3U4VA 2UUBQ 2WKDA 1I50H 2E74C 5J3BA 4DV4Q 2A69D 3G4SA 4A3IG 2IJ0A 5HGQA 1EZ8A 1TWGH 1RL2A 4ME5A 2OTLA 2QEJC 5IP9H 2AHOB 5ELOA 4X65Q 1Q86C 4DR1L 3S1RH 2K28A 2EY1A 2K32A 2HIVA 2WB1E 2NN6H 3WDNA 1BBXC 2GVAA 4AYBG 4QQBX 1UUPA 2K05A 1N34L 4DAPA 1Q12A 4P73A 1Y1VG 1K9MC 1DOKA 1I4HA 1VF5C 3QG1A 5EJWA 5LL6X 3BZCA 1LTBD 5CC4A 5FLXc 4XQJA 3K5OA 1PH6A 1BKBA 3T1YL 4JI7Q 4A3EG 4B9WA 4NXML 3V2TA 4DV3L 1SNMA 5C4XH 1XMOL 1FD7D 2F3WA 3KLSX 1DD2A 4CKEA 1H95A 3AQQA 4DNRB 2NVXB 4O0AA 2F3VA 2A73B 4NW2A 5I4DA 4BBSB 2KQ3A 1UEAB 3OYYA 4KLKA 2GVBA 3G7LA 4I65A 1B7YB 1LV9A 4L8JA 1FGBD 1HA6A 3T13A 4LW1A 2ZT9C 1EQTA 2BA1A 2AWOA 1CKNA 4DAYA 5C3EG 1YZ6A 1NUCA 2CW0C 3J81i 2OT2A 1SNQA 2F4IA 1WI5A 3PGZA 3TP8A 2F0PA 2F0SA 3BJUA 3MXUA 4DK6C 1PYWD 4F88A 2JA8B 1B53A 4Y7NH 3PF5A 2C9OA 4BA2I 2PW7A 1DGSA 3WOFA 4K6LA 5GADC 1PLFA 3IRBA 3HS0C 2G9HD 4DR4L 1V8QA 5D14A 5I9PA 2L15A 3BDLA 1PA6A 1AP0A 3I91A 3HKZG 2F0VA 1ASYA 1TY0A 2WB1B 1CT1D 3ND8A 1OXXK 1YJ9A 2JEAI 2I5LX 5IGGA 1A3UA 4GOPB 1HNZL 4FO2A 1YJWA 3OIQA 1JC7A 1B44D 4WFN3 1GUTA 1ICWA 4DR6L 2OWOA 5IP9G 4ALPA 1PZKD 2PMZB 4TRDA 4YWMA 1VDZA 3DWAA 2NN6G 4BY7H 2A6ED 2AQ1B 2F0OA 1J5EL 1W2BA 3IFDA 3GQBA 4NPSA 4LFCQ 2KCTA 5NUCA 5JPNC 4LF4Q 1TWCB 1SYDA 1X3GA 4LF8L 2B3GA 1EY0A 3NBHB 2O2LD 5CV4A 1G2TA 2UUAQ 4BY1H 2KBNA 2RDGA 3VR2A 2PQAA 2KCCA 3TBIB 1FJGQ 1WFQA 1EQVA 5C4ZA 1KAWA 1CQVA 4C3JB 4CJ1B 4G4KA 3HOWG 2QCPX 4GNXC 4A3EB 2JA7G 1A3VA 1HTLD 5DNFA 4QMGA 4GKKQ 1XTDA 2XTIA 2LXJA 3QOJA 3CCLA 1A62A 1HUMA 5FO9B 3F8TA 3K7AH 2WACA 3HKSA 3FKIB 2EIFA 1K8MA 3TN2A 1BCPB 4RCOA 1KHIA 4DNIA 4C2MH 2NVTH 1SJHD 5M5XB 4K8IA 3OWEB 3H0GB 1D5ZC 3LWUA 2NZ1D 3M9BA 5C3EB 2EVBA 4U68A 5E1FA 4BXXH 4UP7A 1GHKA 3C46A 3T1HL 3IKJA 1WTQA 3N52A 4OX9Q 1KDAA 2AWNA 1JICA 1CFMA 4ID6A 5FJ8H 1ESRA 3S17B 1QZGA 3A8JE 1LTGD 2R7DA 4ME3A 3NQIA 2RHSB 1XMQQ 1M4VA 4JI3L 4GKJL 1OXSC 4A3BH 4DV2Q 4JBWA 4LF9Q 3WOEA 3S15B 3MWYW 1G291 5E3FA 1K73C 4A3DH 2F0GA 1HNXL 3NE5B 1L1OC 1I50B 3M4YA 2ZM6L 3QJYA 2B2VC 2UXCL 2A6HD 3BDCA 1W6JA 4RAUC 4BY7G 4PZ7A 3K81C 4B9XA 4KHZA 3R2IA 4R4TA 1VQMA 2LMCB 3HOYH 3A7LA 1JOQA 1UE1A 4EQOA 4GLAC 2XVSA 2F0HA 5C44B 3V96A 4O1NA 3KDFB 2R7ZH 1H9SA 1IBKL 4OGQC 4K0KL 3U4ZA 2N88A 2PW5A 1HXYD 4DV6L 3S1QH 1E0BA 4BY1G 1TS4A 2EJFC 2A19A 2L11A 3GTQH 5FLMH 1B70B 2JYOA 3X3MA 1EEFD 2HDLA 4NDXA 2I5MX 3LWEA 4JI1Q 4DR3L 4XYQA 2E2IB 1RF2D 3STBD 1H9RA 1PFNA 4IFDJ 3OSOA 1L1OB 5CMDA 3K5MA 1KAAA 3K7UC 3DWPA 3QR8A 5I6YA 1K8GA 5M3FB 1X3FA 3HGBA 4TSSA 1O78A 2WKCA 4DV0L 3HOWB 2JA7B 1VQ9A 3R2TA 4X64Q 1PFSA 3NK9A 4B08A 3K8AA 4OXPA 1LUZA 2YU9H 1EIHA 3TEHB 1GKHA 1WTPA 1OXUA 1I4XA 3CD6A 2O5IC 1EFID 2MFIA 4BXXG 1XNQQ 2TSSA 3T51B 2VQEQ 2CHBD 5IWAL 1Q46A 3NPPA 4R1JA 1F2ZA 3Q22A 2F4VQ 5BR8Q 4JI2Q 5FJ8G 4A3FH 4OWTB 4Y7NB 3H91A 5D3DA 2PPBC 4IURA 1EY4A 4A3BG 4DXGA 3ZJYC 4YHHL 4A3DG 1ONLA 5G3LF 1LTID 4H0LC 4HJ8A 5I2YA 2B2YA 3FRPB 4HMJA 2H1EA 3KYHC 1SSOA 1Z9FA 1YIJA 4KV6A 1YNND 1VQKA 1IL2A 1IW7C 4POFA 3I4MH 3DXJC 4IOAA 3J7AF 4IQZA 1BCPF 3UDGA 4KY5A 5IYCH 1JB3A 4J1MA 3HOYG 3KF8A 1HZAA 2NZHA 3NWSA 2WINB 3OTOQ 1QZHA 2R7ZG 4BY7B 4JYAL 2IT1A 4WJ4A 1S5BD 2A74C 3CCEA 4RHSA 2RCNA 4RH6A 2DGYA 4JBJA 5FLMG 2AUJD 5C5MA 4B3RQ 3DM1A 3GTOH 3RMHA 2NTSA 3R93A 4R8IA 1B2TA 3QWNA 2VNUD 1VQ8A 2F0IA 4BY1B 3G6JB 3MXNB 5LMNW 4YWKA 1WD0A 3GTJB 1DM0B 4JG2A 4B3TL 3PUXA 1TS3A 2KENA 4KD3A 1PH8A 1UWVA 2RHQB 5K36G 1LTSD 2F0TA 1HZCA 4JI6L 1A3TA 2ZJQA 1FGUA 4LUOA 2KUMA 1HZBA 4CDFC 2SDFA 2V4DA 4JI5Q 3NENA 1EFWA 3CMEA 4IFDI 3MC0B 1XNRQ 2FMMA 2GA4B 2QEXA 4BBSH 5CR3A 3RN5A 4DKAC 2UXBL 2NVTB 4IUPA 3J80c 3TQYA 1MGSA 3OHXC 4A3FG 1E2ZA 1IZ6A 1EWIA 1ILPA 5GAHC 4JV5L 2I46A 3E9IA 2OTJA 2SOBA 2A6EC 3BVMA 3CPWA 5IODA 1SE3A 4G7HC 2VXWA 3I8ZA 3J81E 4DV7L 3SK8A 1STAA 2GN5A 1O7LA 1MI2A 2IWHA 4DR1Q 1TWHB 2HCCA 1II3A 2EYMA 3I4MG 1WTWA 2KCMA 1X32A 1KABA 4AH6A 4A3BB 2VUMB 3PIOA 5IYCG 1Q8IA 1Y8OB 1N34Q 1S5FD 1ASZA 1C8CA 3NELA 5C4HA 2OXPA 3ULPA 3TP6A 1SFOH 1GUGA 1JOKA 3EN2A 4RFBA 5C4JB 1LO5D 2CVRA 5FK9C 3FMCA 3ND9A 3E9HA 4IUTA 2CWPA 2KCNA 1V1PA 2KJXA 3OMGA 1B4OA 4B3ML 1GJXA 2BCOA 3HOYB 2KOLA 2VS1A 5EQ0A 4DV3Q 4NXMQ 5EPJA 4K5VA 5M3MH 4PQXA 1GUNA 2CWAA 3GTGB 2RDHA 3PO3H 1HFGA 1IBMQ 2R7ZB 1CSQA 3CKIB 1V43A 3J7ZC 4WRDA 2G5DA 3L7ZC 1C48A 1JJGA 1MJEA 3FDTA 1YHBA 2F52A 1FYCA 1CHQD 5FO7B 2EYFA 4I7ZC 5DM63 2SNSA 2B2VA 4RG1A 4LF7Q 3J7A5 1TWCH 2K7VA 3GV3A 2RSOA 2VY3A 3KFUA 3TP5A 3U9SA 5M5YB 4R9WA 1X54A 4AIMA 3IFTA 1E24A 2ENBA 1GO3E 1DCZA 4A76A 2ZTCA 3KJOA 4IPGA 3KF6B 1JE5A 1STHA 2MPMA 4K2KA 3HOVH 4BBSG 4C3JH 1TWAB 2MP1A 1B9NA 4FF4A 3Q8DA 4DR4Q 2MGSA 1HJPA 3ULJA 1DXMA 4KKUA 1QOHA 3H3VC 1VMCA 1PVOA 2A6HC 3FKIH 4WJWA 4UY8C 4ZCKA 2Q8TA 2RA4A 3ICEA 1VQDA 3HOUB 3BZDB 4QF4A 4QIWB 1EYGA 1HNZQ 3GTKB 1V9PA 2TMPA 2IX3A 5KNCA 2HHHL 5M5XH 4A3FB 4C56C 1IKLA 1C9OA 3H0GH 4J15A 1SN8A 2RBMA 3TP7A 5FLXE 2N8NA 1WOCA 4IUQA 1TT2A 5C3EH 2X6LA 1X3QA 1QVFA 4GN3B 3MVVA 3RUZA 3PF4A 1LYLA 1KRTA 2UU9Q 1J5EQ 3QOLA 2ZXOA 3RZDB 2YTYA 1LT5D 4IOCA 3RLOA 2MO1A 3M3YH 4JVZA 2NB0A 3VYSA 4IJLA 2WAQE 2MJ8A 1TVXA 4DFAA 4JBMA 4DU9A 2WB1G 5D3IB 3I4MB 2OQ0A 3J80i 4EQNA 4DR5L 1PHJA 1YJNA 4XQNA 2PNHA 3STBC 4HSVA 5M3MG 4A3CH 3NUCA 1E22A 2F1MA 1N36L 3PO3G 1VQOA 2R7FA 2EOTA 3JC66 3PUVA 3Q24A 1N33L 3GTLH 2JXMB 3T56B 5GAEC 2Q2IA 1SYGA 1EL0A 1YNJD 1SE2A 4KMUC 1CA6A 4CJ0B 2F0FA 5C44H 3GTOB 3CCVA 3EJIA 4HR7B 1J6QA 3UE0A 2FMCA 3BVGA 3CXCA 4G7ZC 2DJGC 2Q2HA 3W3AA 5IT9L 2JJQA 5KYLA 1NTGA 1HRJA 1G51A 2PZUA 5GROA 4DGZA 1AFPA 3H3VI 5C3WA 2EYOA 4KJNA 3EROA 3EIVA 3H15A 3OW7A 1D2BA 3HOVG 1H9SB 3H6MA 4C3JG 4DUYQ 2ASBA 3Q23A 3T1HQ 3PIP3 1PH5A 2E2IH 1L0WA 2RSNA 1ENCA 3OW2A 2QW7A 4QJFA 5F2DA 4KN7C 1XYIA 1NBWA 1GM5A 5JJZA 3CF5A 1ENAA 5DAUA 2J0TD 1YNNC 3FKIG 2B2WA 3MHBA 5M3FH 4XYOA 1AZQA 4JI3Q 3HOWH 4GKJQ 5K5PA 2JA7H 1AEXA 3AEVA 3S2DB 1UE6A 1HNXQ 2WAQB 3W2DA 1K83B 3H0GG 1SMXA 5T1IA 1PRTD 2B2YC 2ZM6Q 1QNKA 1BOSA 5J39A 3K58A 3A8IE 1N32L 1K3RA 2Y0SE 4NMZA 2KECA 5KNDA 1VF7A 4CDCC 4IPHA 2LY7A 2JQOA 5FKAC 1QVGA 5C6AA 1TU2B 5IP7G 4KHPQ 4YIJA 3EBEA 3A56A 4P71A 4AYBE 1DYQA 3AU7A 2EE1A 3E0EA 3HRZC 5J1ZA 4C3HB 5IGEA 1RTOA 2EYPA 1F9RA 3TMEA 1M90C 3I55A 4ZLTF 2XIWA 5IGBA 3MFGA 4KJOA 1STNA 1IBKQ 4EQ5A 4K8JA 4DV6Q 1GUOA 1CA5A 4JCVE 2X6GA 3I7FA 1ZYRD 1QB5D 1A2TA 2XGTA 4A3CG 1E7ZA 4H02A 1SFOB 3T16A 3EFXD 5IGFA 1JB7A 4B3SL 1Q81C 4A3GG 4HN7A 1AN8A 1E3PA 4CDEC 3M7GA 1STYA 4DR7L 2PO4A 3HOXG 1UEBA 1NNXA 1U4PA 4BWGB 5M3MB 5CBEE 1B3QA 1FNWA 3CRKC 5C44G 3OWFA 4ZKBB 3PO3B 4IUUA 5LMNL 3MEHA 1WCMH 3OOCA 2K6AA 3OPOA 1CI3M 2Z6BA 4DV0Q 4LFAL 1U0LA 2KVMA 1SDFA 1Q8KA 1R4QB 2JP1A 5E4XA 5AJ3Q 1STGA 1KD1C 3KF8B 1X56A 4PMWA 1EY8A 1VQCA 5C0XG 2I0QA 5EGTA 1HQRD 2V1CC 3D4RA 1N9WA 2DY7A 3K59A 4IFDH 5IWAQ 2OF1A 3F2DA 1F2YA 4HCSA 3CRLC 3GTJH 4DV5L 4A75A 3HKZE 4IUVA 2K5VA 1IBLL 4G57A 2R3ZA 1SAPA 3CCSA 3HOVB 4HIOA 1XXGA 5M3FG 3I4OA 1JCKB 1O7IA 4PZ6A 4GN5A 2E5LQ 4ODGA 4X3SA 1IL8A 2KA7A 5DLQE 5C0XJ 3VA5A 1BVSA 1HR0W 4OWXB 1YBYA 4UAIA 1CUKA 4GS3A 4LF5L 1EYCA 1KQSA 3ERSX 2ALYB 4KTAA 3OMCA 3HP3A 1PH7A 2A68D 1H9KA 4XDXA 2BH2A 1I4PA 1RHPA 1T5XD 5IE8A 4FXDA 3SVMA 3DHQA 2AKWB 4OO1I 3NTIA 5TSSA 2K5WA 2AQ2B 1SMYD 3SGIA 2EPBA 3KBXA 4JPBW 1VQIA 4BBRH 1LTTD 3B6YA 1RD9D 3K0XA 3M3YB 3ULLA 2ICEC 4YCWA 2EJMA 4M8AA 1U4RA 1SNDA 4CKCA 5I6WA 1TWHH 3G71A 4X62L 1B1ZA 2VUMH 3M4QA 4GNXB 1XPUA 1BQQT 1B3AA 4PMBA 5CYUA 4OELB 3SDZA 1X55A 2FHTA 4EGVA 1WCMG 1PTOD 3GTLB 4K5XA 5M9OA 5C4JH 3A74A 4A3GB 2IHEA 3S2HH 4JI6Q 3LNNA 3RNUA 3HOXB 1UNSA 4DUZL 3DWQA 2EYHA 2M2LA 4K5WA 2PNRC 3S16B 3GTGH 4X6AH 1PDQA 5JVH3 4H13C 3RLFA 1E1OA 2RF4A 4IFDG 3FP9A 3GDEA 1JMCA 1V1PB 1PZID 3K57A 1MJCA 2FJ2A 5EKKA 1Y1WG 1SBBB 4GLVB 4EVOA 4TQUS 2BH8A 4DAMA 1E1TA 1PV4A 1BR9A 3HFZB 2RQXA 1EY6A 1S5ED 1PH4A 4DV7Q 5DEHA 1M8AA 5M5YH 2VQFL 5CORA 1SXTA 1PYSB 4ZUJA 2PZWA 3TS2A 1ICFB 5JJIA 5H1SE 5K36H 3GP7A 4FXGC 5ELFA 4XTCS 1ZXTA 1TWAH 3C1EA 3H94A 2MO0A 3DMUA 1N8RC 3CQZH 1I6VC 5BN3A 2QDBA 4R4QA 4UP8A 2UUCL 3KBGA 5C0XI 3CCMA 1WTOA 3HG9A 1F9QA 2HCIA 2A69C 2HQLA 3D3RA 1K8OA 5ELDA 2HQEA 4HIKA 3M7NA 4KKTA 3HOUH 4LJZC 4BBRG 3QIAA 1YNJC 1EIFA 4R4CA 3GTKH 1BUVT 2M00A 3CCRA 4DR2Q 1CZWA 3UE1A 1H9MA 1SYCA 1JT8A 2XSCA 4CGYB 3P75A 3M85A 4F7XA 1ML0D 1JWUD 1X65A 1EYDA 1EY7A 2R93B 2DY8A 1JR0D 1M1KC 2L12A 2VUMG 2CQOA 3BS1A 2OEOA 2EJGC 3I73A 1G6ZA 1IYJB 3BU2A 3VYRA 3RZDH 3P20A 4ULLA 1WTXA 1L0XB 3VR6A 4ZYSA 4YY3Q 2FXQA 1EZ6A 1QUQB 1V1QA 2E2HB 5JOBA 4O2DA 3NQTA 1X3PA 4IPCA 4DN4M 1I4QA 3URYA 4P2CB 1C0AA 3SK4A 2Z6KA 3J80E 5KNBA 4GOPA 5HGTA 4A4IA 1S72A 3BVZA 3MXPA 3DM3A 3M4OH 1WCMB 1EY5A 3H3VH 2F0UA 3V05A 2ZXPA 3NTKA 3DUZA 3CW2C 2F3IA 4HAEA 4P74A 1EQQA 2O5JC 2RKSA 4RKBA 1I5FA 1PRTC 4X3KA 2Z9HA 1SNCA 3E0JA 2B2WC 5COYA 1S3OA 1KLGD 4TKOB 3Q6SA 1SROA 2CW0D 3NBHA 4UPAA 3W1GA 1Y1WB 4X66L 2HHHQ 5IYDH 2EYJA 4MIUA 4FF1A 2N78A 4ZK9B 1U5KA 1X9NA 3D6WA 1HFNA 4ILWA 1RCVD 4DK3C 1VQAA 1I4GA 4JK1C 2BDNA 2NWGA 2P5ZX 4RWSC 4DV2L 4NXNL 4LF9L 1ZYRC 2PZTA 2WP8J 4C1NK 3TREA 1HA5A 1IHZA 2ES2A 1HNWL 2F0WA 2JA5H 4RKLA 3E5SA 5L37A 4POGA 2Z0SA 3EVQA 3AFPA 3HOUG 2DUDA 3SHLA 4JC0A 4JOIA 4PMCA 1K0SA 2F0MA 3NXWA 3S2DH 2ZXRA 1JWSD 4R8NA 2CH4W 4A3JB 4G7OC 1K83H 2XWBB 5G3LD 1TS5A 3D4DA 1N36Q 4TVAB 5A35A 4OIJA 1F2LA 2OQKA 4KHVA 1IKMA 4BBRB 3D31A 1NAPA 1EWCA 4DV1L 3SK6A 5LL6S 3A0JA 3SXHA 3F1ZA 1BCPD 1VS0A 3NTHA 3L0OA 3MXGA 1AW7A 4R4IA 3HZXA 4C3HH 1CKNB 3KLRA 4DAYB 1CZGA 1TY2A 1ZKOA 3LX0A 4IJHA 4XQQA 3TZUA 4JI1L 1DOLA 3TRZA 1O7YA 1WTVA 4ABNA 1R9TB 1RTNA 5KIXA 3UI2A 4LNQA 2OCEA 4A93B 5ELEA 1BO0A 2IHFA 5A2QE 3S2HB 1EIGA 1Q1BA 5JPMC 3T1YQ 3S14B 1EU4A 2WFWA 4EX5A 5LMUL 1XMOQ 4ZAIA 1IXRA 2KHIA 1NSNS 1HPCA 1SYFA 2XN9C 3K80C 1KDCA 4UDUC 2DJFC 2Q2UA 2A68C 1V1OA 1KTKA 3KDFA 5E7NA 1I94L 4P75A 4RA8A 3W5OA 1XNQL 3FPUB 2A8VA 2VQEL 1OO9B 3BDOA 5IYBH 5IYDG 2L9HA 1ET6A 1NY4A 4A3LH 1SMYC 4ZKCB 4RHRA 5BR8L 2RCFA 4JI2L 2F4VL 1HR0L 4AQYL 1D7QA 5IGDA 1F9PA 2F0NA 4S3SA 1D8LA 3JAML 3A54A 2B2TA 1TWFB 2ZTEA 4NKLA 3W1BA 2PQEA 2L5TA 1EOVA 3JAMc 2JA5G 2C35B 4MTNA 4BS9A 1BBUA 5DM73 1LM0A 4GN4B 3NEMA 4N9PA 3J81L 4HEDA 3CQZB 4HJ5A 2UXDL 4FF2A 2D0PA 2D2CC 3AB9A 4GLXA 2WAQG 4WORA 1LLRD 2NTTA 1Z6HA 4X3UA 1DZ1A 2PQAB 2JA9A 2ATWA 2H5XA 1I6HB 2SNMA 1DONA 1VQNA 2D0OA 4ZRZA 1VQGA 1PTOC 1O80A 3U58A 5IT9E 2NVYH 4LUZA 2E2JH 3LGJA 3S24A 1UAPA 2C5CA 1P8LA 4XIGS 1TXYA 4DR6Q 3SE0A 4C3HG 5LMNQ 1NR4A 1Q1EA 3EA6A 4H44C 1NMFA 5IP7H 1PFMA 1T9HA 3MEFA 1QVCA 3KLWA 1BF4A 4J6HA 4IALA 2R92H 1U4LA 4LF6L 5IIFA 1IYUA 1YHQA 1D1IA 3K5LA 5C5LA 4LF8Q 4HJ9A 2BOSA 3FHWA 4FDBA 2K75A 3CCQA 2D62A 2ICIA 4DV5Q 1HZ9A 1AZPA 1U4MA 2NZOA 4KY7A 4JBKA 3M4OB 2MUYA 3F2UA 2NVQH 4RGMA 1JJCB 1IBLQ 3I72A 1PH9A 1Z7TA 3E3XA 4A3GH 1MD2D 2K33A 3HEJA 1FNVA 1CKMA 1KIXA 3FVQA 3L2PA 4MZ9A 3HOXH 4DNTB 2ZJPA 5IYBG 3VR4A 1NJIC 3P1HA 5FOBB 4A3LG 1W3SA 4YWLA 3S16H 2ZTDA 2F03A 1MIUA 1HHVA 3RD4A 3CU7A 4JI0L 5JEAH 4CDDC 4LUVA 3MAQA 3PUYA 4JI8L 1BXTA 5IT9c 1JJ2A 3MXNA 5JVG3 1EOTA 3RN2A 2K5HA 3GTPB 4OO1G 3E6ZX 2Y0SG 1LTRD 1BBWA 5C0XH 1NR2A 2DNCA 4Q0FA 4L5QA 4DA2A 4IN3A 1SE8A 2LSSA 3I70A 1Z47A 4KKSA 1I4RA 1G8ZD 3I56A 3A7AB 1QILA 2QILA 2EY6A 3MFYA 1AH9A 4N8FA 4UHVA 2JA5B 4HTHA 3EQLC 1C4QA 4OL7A 5T1GA 4FYDA 2K14A 2O4XA 5CV6A 1EEID 4HMIA 3GD7A 5FLXL 4Y52H 2EQSA 3PO2G 2A1AA 2HT1A 4X62Q 3C1FA 1J8IA 2CFMA 2PMZE 1G2SA 3HOZH 1I3QB 3CPFA 1IW7D 2XNAC 4DK1A 1GVPA 2D9UA 4C3IH 4LFBL 4BA1I 1QJOA 5FO8B 3VDYA 2D5DA 4Q5VA 2UXCQ 3Q0AA 2B63G 5IOCA 1Q7YC 1IBML 4OONA 4L5TA 1ILQA 3VA7A 3JAMi 3RR5A 3SEBA 2Z6KC 4I7AA 1STEA 4GOPC 1TS2A 4APVA 2R92G 4DUZQ 2B8GA 3DEPA 3S1MH 1EQRA 1UE5A 4L5RC 2R93H 3KLSA 4FVMA 1MSHA 4LF7L 2E76C 4LWCA 4K0KQ 1GUWA 1F77A 4HIDA 2I07B 2XWJB 1A0IA 2JSOA 1Q82C 2AUKA 3N6RA 1ET9A 2N49A 4J8QA 3MTSA 4JW0A 4PV1C 2E2HH 3U9OA 4HJAA 1R4PB 1G91A 1G6PA 4IPDA 2BA0A 1XTCD 4DR3Q 4PG3A 3IAYA 4MNOA 3MZ5A 1SRUA 4MHEA 2VQFQ 2QA4A 4LAAA 3KJPA 2BDOA 5GAGC 2NYZD 1DOMA 4R4OA 2B2UA 2B29A 5JEAG 1VQ4A 4KD4A 3BZKA 3ITPA 2NUCA 4CHTB 1AE2A 2K5QA 3CAMA 1Y8PB 1HTPA 2UUCQ 3TZDA 3NBIA 2K03A 3KK7A 5ELNA 1VQ6A 2K50A 1EWHA 2B39A 1EIYB 3A5ZB 1YHAA 4RGOS 5IGCA 4A3IB 3PSIA 2VB3X 2L55A 4JOIC 1CTMA 1BCPC 4F87A 2UU9L 4YCVA 5JEAJ 1Y1WH 5CV9A 5EPKA 3VYTA 4QCLA 1A63A 3CC2A 3L3OC 2Y0SB 1PTOF 2IW3A 4HIMA 1X3EA 3KF6A 3HOZG 5CV8A 1SE4A 2E8GA 2FINB 3L9AX 5M5WH 4C3IG 3S1NH 4AYBB 4YHHQ 1D5XC 2JE6I 4ZQ3A 2IX1A 5C4XG 1JWMD 1Y1VB 3WWVA 3PO2B 4JI4L 2UUBL 4DV4L 4P72A 2VZAA 2RDFA 2CKZB 2QKIC 2JK8A 5I2XA 2NVYB 2E2JB 4ZUIA 1ZEQX 4A3JH 1CSPA 3ZYYX 1VQEA 1E2VA 5CGKA 2B63B 2I5HA 2F0KA 1NCVA 2YTVA 3PCOB 4M1UB 4X65L 3GTMH 2R93G 2LS01 3UDIA 4DK0A 1KNEA 1DJRD 4JYAQ 4O42A 3RLNA 5KRUA 3S9WA 1KLUD 1SJED 5AFWA 2R92B 4KN4C 2F0QA 3D4WA 4N8X1 2F0DA 2EXZA 1P16A 1K8AC 3D8GA 2VW9A 4KK7A 4V0BA 2Z8LA 5ISRA 2VB2X 1F9SA 4DUYL 4JI7L 2BE5D 1ENFA 3PIO3 3CC7A 1R9TH 1GXDC 4X66Q 3QB3A 4B3TQ 4WJ3M 4OEMB 4OWWB 2NVQB 4A93H 2K5DA 1HH2P 3O13A 2Q8RE 2NBFA 3UDXA 1FL0A 3S14H 3NSWA 2B2TC 4NXNQ 2LFNA 3HKZB 3PUWA 2PYKA 1HNWQ 1MKHA 1PXUA 2XRQD 2YYZA 1D1KA 2JA6H 1LT6D 2L4NA 2Q8IB 2UXBQ 1FNUA 3CC4A 4FXKC 3RZOH 4KHPL 1TWGB 1Y69U 1T5EA 2K1BA 4LK1C 4JV5Q 1EU3A 4Z9CB 1D6EC 1CKOA 4KI0A 1PH1A 2HD3A 3S1RB 4CJ2C 1SNOA 2K01A 1RJTA 1XWEA 4DV1Q 4NB3A 1VMPA 1TWFH 4FNFA 4QUCA 2Q2TA 2IX0A 1XPOA 2Z4HA 3R3OA 1GD7A 1KRSA 4A3KH 2PI2E 4KY6A 2EDGA 4QGUA 2DN8A 3NHHA 4EQPA 3BG3A 3DLLA 3HOZB 1QE6A 2WV6D 1PH3A 2F0EA 3PIPA 4C3IB 3J7AV 3FEWX 5C4XB 2JN4A 2K4KA 3T53B 3I2ZA 4A3JG 4V190 3AFQA 2CQAA 3C2PA 2VL6A 1I6HH 5BN5A 2NN6I 4OHJA 1H9JA 1Y8NB 1B9MA 4B3MQ 4DF7A 4HCEA 1C7YA 4PZ8A 1Q90A 5KEEA 3BYTB 5KGUA 5LMUQ 1W6KA 2X69A 3GO5A 3SR1A 3S1MB 5AJ3L 1S5DD 4LFCL 1VCIA 3BYYB 1YEZA 3VR3A 3UDFA 4LF4L 1VQ5A 1I94Q 2EY5A 4K6DA 1LT4D 2QF7A 1LABA 2UUAL 1LTLA 3K6OA 1BDOA 4IUNA 4A93G 4CKBA 1S4ZA 2HUGA 1FJGL 1X6OA 1HR0Q 3A55A 4AQYQ 3OIPA 2L1BA 3TDQA 1Q3LA 5CV7A 2EYLA 1MBYA 3MA2B 2E5LL 2A5HA 2QDLA 2XRSD 4HSPA 2KHJA 4GKKL 4C1NI 1FR3A 1FVIA 2IPKD 2IL8A 4QL5A 1K28A 5ELCA 1PTOH 1K0RA 3D0FA 1SYEA 2JA6G 3SK5A 1CQFA 2J7ZA 2JEBI 3J81j 2UXDQ 1HQMC 4A3MH 3I4NH 2Z4IA 2AQ3B 1TIID 1VQHA 3I90A 1CHPD 3I4LA 3TS0A 3K5NA 1D5MC 5LHY1 5E4WC 1E2WA 4E6IA 1EUJA 3D6CA 1MSGA 2EY2A 1JORA 2LKVA 4OX9L 4PNYA 5C3XA 4A3KG 1KXLA 3GTPH 2CH4A 1UE7A 2ID0A 2E2DC 1LT3D 4UP9A 4N9TA 4X3TA 1KNAA 1WTHA 1XMQL 2WIIB 5M5WB 3S1NB 5EAYA 3U50C 1SNPA 3F2BA 1WD1A 4LF6Q 4MN3A 1TKWB 2F0JA 1LACA 1GUSA 1SLJA 3KUPA 3P7JA 5CV5A 2M9VA 4OIKA 5ELBA 4DXFA 1OXTA 2N55A 4DPGA 4DR5Q 1I3QH 1XJVA 3M4PA 4QY7A 2E75C 2F0LA 1QG7A 1QNUA 3IL8A 2EZVA 1PRTB 1S5CD 3GTMB 1WJJA 1HUNA 4FF3A 2K04A 1YVCA 4K14A 3K7AB 1NE3A 1VQPA 1N33Q 1JQYD 2NVXH 5HURA 1U9RA 1A8VA 3J80L 3JAME 4C2MB 3I3CA 5JAVA 2QGQA 4GZYC 1PFBA 2B2UC 2ZJRA 4F8MA 4JI0Q 1SEBD 4QUFA 5GQOA 2KHSA 2MQHA 1VQLA 1QCBD 4RCNA 4GNXA 4JI8Q 1RIPA 4H7BA 1PZJD 1O7ZA 1ESFA 5KYIA 3VR5A 2JA8H 1Y14B 3F2CA 3G48A 1GOZA 3TSSA 1SYBA 1S40A 5EBCA 4RGTA 3R8BA 2FFKB 2SEBD 2L0CA 4X64L 1WTRA 4A3MG 2YTXA 4QIWE 3I4NG 1J9OA 3NP8A 4XT1B 4FP5D 3A8KE 3AYHB 2H4OA 1OTCA 4L5SA 4A3DB 3A5UA 2MHVA 1CK1A 2HIXA 2JA6B 1VQBA 1STBA 2MNAA 3C3LA 1QWYA 4QB4A 3RZOB 1IYVA 1KL9A 4LFBQ 1JE4A 1XX8A 1VQFA 1MHWC 4DR2L 1PH2A 5BN4A 4IO9A 3KOJA 1N32Q 4CBVA 2EXDA 2HDMA 1B8AA 3AMUA 4A3IH 1VQ7A 3K0YA 2B8FA 4XXEA 3S1QB 1EY9A 4HJ7A 3PV0A 4A3KB 1L1OA 4YY3L 3GTQB 4OO1H 1A6XA 1EYAA 3QO2A 3CMAA 2DNEA 2KEDA 1KDBA 1BNZA 2LXKA 5EBDA 4MTKA 5CBAE 2BE5C 3PMFA 1SR3A 5EPLA 3T4AC 3J81c 1A15A 1L2FA 1Y1VH 3CP0A 1KC8C 3PO2H 2K5NA 1RDPD 1XPRA 4B3SQ 3VYUA 1VQJA 2KEEA 4RMFA 2PCFB 3OTOL 3FPPA 1YNXA 2Z1CA 3X3NA 4DAVA 4DR7Q 2IY5B 1RODA 1YI2A 3H09A 3CCUA 4RGNA 4A3EH 2N3SA 1JOOA 1RKNA 3ERQA 1OXVA 2AMCB 5D65A 4L6TB 2YU9B
chains in the Genus database with same CATH topology
4L63B 1PMRA 5A2QL 2R6GA 4XT3B 1TQOA 5EKIA 2J4XA 1L0YB 1LTAD 4U673 3DEOA 4LMQD 3PUZA 3J7YW 1GHJA 1B50A 1A2UA 2G9DA 4NP5A 4K2LA 1CM9A 2R61A 1F2MA 4IZ8A 1PRTF 2RVLA 5I9OA 3ONAB 1WVLA 1PTOB 1TR5A 4A3MB 3NWTA 5J22A 3I4NB 3GV6A 3CHBD 5EKLA 1HCZA 2WKDA 2E74C 2A69D 2IJ0A 1EZ8A 4ME5A 2QEJC 2K28A 2EY1A 2K32A 2NN6H 3WDNA 1BBXC 1UUPA 2K05A 4DAPA 1Q12A 1DOKA 1I4HA 1VF5C 3QG1A 5EJWA 5LL6X 1LTBD 5CC4A 4XQJA 3K5OA 4B9WA 3V2TA 1SNMA 1FD7D 2F3WA 3KLSX 1DD2A 4CKEA 4DNRB 2NVXB 2F3VA 2A73B 4NW2A 5I4DA 4BBSB 2KQ3A 1UEAB 3G7LA 4I65A 1LV9A 4L8JA 1FGBD 1HA6A 3T13A 2ZT9C 1EQTA 2BA1A 2AWOA 4DAYA 1NUCA 2CW0C 2OT2A 1SNQA 2F4IA 3TP8A 2F0PA 2F0SA 3MXUA 1PYWD 4F88A 2JA8B 1B53A 2C9OA 4BA2I 2PW7A 3WOFA 4K6LA 1PLFA 3HS0C 2G9HD 1V8QA 5D14A 5I9PA 3BDLA 1AP0A 3I91A 2F0VA 1TY0A 2WB1B 1CT1D 3ND8A 1OXXK 2JEAI 5IGGA 1A3UA 4FO2A 3OIQA 1JC7A 1B44D 4WFN3 1GUTA 1ICWA 1PZKD 2PMZB 4TRDA 1VDZA 3DWAA 2NN6G 2A6ED 2AQ1B 2F0OA 3IFDA 3GQBA 5NUCA 5JPNC 1TWCB 1SYDA 1EY0A 2O2LD 5CV4A 1G2TA 2RDGA 3VR2A 3TBIB 2KCCA 1EQVA 5C4ZA 1CQVA 4C3JB 4CJ1B 4G4KA 2QCPX 4A3EB 1A3VA 1HTLD 5DNFA 4QMGA 3QOJA 1HUMA 5FO9B 2WACA 3FKIB 1K8MA 3TN2A 1BCPB 4RCOA 1SJHD 5M5XB 4K8IA 3OWEB 3H0GB 1D5ZC 3LWUA 2NZ1D 5C3EB 2EVBA 4U68A 5E1FA 1GHKA 3C46A 3IKJA 1WTQA 3N52A 1KDAA 2AWNA 1JICA 1CFMA 4ID6A 1ESRA 3S17B 3A8JE 1LTGD 3NQIA 1M4VA 1OXSC 4JBWA 3WOEA 3S15B 3MWYW 1G291 5E3FA 2F0GA 3NE5B 1I50B 3M4YA 3QJYA 2B2VC 2A6HD 3BDCA 1W6JA 4RAUC 4B9XA 4KHZA 3R2IA 2LMCB 3A7LA 1JOQA 4EQOA 2XVSA 2F0HA 5C44B 3V96A 4O1NA 1H9SA 4OGQC 2N88A 2PW5A 1HXYD 1E0BA 1TS4A 2EJFC 2L11A 2JYOA 3X3MA 1EEFD 2HDLA 4NDXA 3LWEA 4XYQA 2E2IB 1RF2D 1H9RA 1PFNA 4IFDJ 3OSOA 5CMDA 3K5MA 1KAAA 3DWPA 5I6YA 5M3FB 3HOWB 3HGBA 4TSSA 1O78A 2WKCA 2JA7B 3R2TA 3NK9A 4B08A 1EIHA 1WTPA 1OXUA 1I4XA 2O5IC 1EFID 2TSSA 3T51B 2CHBD 3NPPA 1F2ZA 3Q22A 4Y7NB 3H91A 5D3DA 2PPBC 4IURA 1EY4A 4DXGA 1ONLA 5G3LF 1LTID 4H0LC 5I2YA 2B2YA 3FRPB 4HMJA 2H1EA 1SSOA 4KV6A 1YNND 1IW7C 3DXJC 3J7AF 4IQZA 1BCPF 4KY5A 1JB3A 4J1MA 3KF8A 3NWSA 2WINB 4BY7B 2IT1A 1S5BD 2A74C 4RHSA 4RH6A 2AUJD 5C5MA 3DM1A 3RMHA 2NTSA 3R93A 4R8IA 1B2TA 3QWNA 2VNUD 2F0IA 4BY1B 3G6JB 1WD0A 3GTJB 1DM0B 3PUXA 1TS3A 4KD3A 5K36G 1LTSD 2F0TA 1A3TA 2KUMA 2SDFA 2V4DA 4IFDI 3MC0B 2FMMA 2GA4B 5CR3A 2NVTB 4IUPA 1MGSA 3OHXC 1E2ZA 1ILPA 2I46A 2SOBA 2A6EC 3BVMA 5IODA 1SE3A 4G7HC 2VXWA 3I8ZA 3J81E 3SK8A 1STAA 1O7LA 1MI2A 2IWHA 1TWHB 2HCCA 1II3A 2EYMA 1WTWA 1X32A 1KABA 4A3BB 2VUMB 1Q8IA 1Y8OB 1S5FD 1C8CA 5C4HA 2OXPA 3TP6A 1GUGA 1JOKA 4RFBA 5C4JB 1LO5D 2CVRA 5FK9C 3FMCA 3ND9A 4IUTA 2KCNA 1GJXA 1V1PA 2KJXA 3OMGA 1B4OA 2BCOA 3HOYB 2KOLA 5EQ0A 5EPJA 4K5VA 4PQXA 1GUNA 3GTGB 2RDHA 1HFGA 2R7ZB 3CKIB 1V43A 4WRDA 3L7ZC 1C48A 3FDTA 1FYCA 1CHQD 5FO7B 2EYFA 4I7ZC 5DM63 2SNSA 2B2VA 2K7VA 3GV3A 2RSOA 3TP5A 3U9SA 5M5YB 4R9WA 3IFTA 2ENBA 1DCZA 1STHA 2MPMA 4K2KA 1TWAB 2MP1A 1B9NA 4FF4A 2MGSA 1DXMA 4KKUA 1QOHA 3H3VC 1VMCA 2A6HC 4WJWA 2Q8TA 2RA4A 3HOUB 3BZDB 4QF4A 4QIWB 3GTKB 2IX3A 2TMPA 5KNCA 4A3FB 4C56C 1IKLA 2RBMA 3TP7A 5FLXE 4IUQA 1TT2A 2X6LA 1X3QA 3RUZA 3MVVA 3QOLA 2ZXOA 3RZDB 1LT5D 2NB0A 3VYSA 2MJ8A 1TVXA 4DFAA 4DU9A 5D3IB 3I4MB 4EQNA 4XQNA 4HSVA 3NUCA 2F1MA 2EOTA 3PUVA 3Q24A 2JXMB 3T56B 1SYGA 1EL0A 1YNJD 1SE2A 4KMUC 1CA6A 4CJ0B 2F0FA 3GTOB 3EJIA 4HR7B 2FMCA 3BVGA 4G7ZC 3W3AA 5IT9L 5KYLA 1HRJA 2PZUA 4DGZA 1AFPA 5C3WA 2EYOA 4KJNA 3EROA 3OW7A 1D2BA 1H9SB 3H6MA 4C3JG 3Q23A 3PIP3 2RSNA 1ENCA 5F2DA 4KN7C 1XYIA 5JJZA 1ENAA 5DAUA 2J0TD 1YNNC 2B2WA 3MHBA 4XYOA 1AZQA 5K5PA 1AEXA 3S2DB 2WAQB 3W2DA 1K83B 5T1IA 1PRTD 2B2YC 1QNKA 1BOSA 5J39A 3K58A 3A8IE 4NMZA 2KECA 5KNDA 1VF7A 5FKAC 2LY7A 5C6AA 1TU2B 4YIJA 3A56A 1DYQA 3AU7A 2EE1A 3HRZC 5J1ZA 4C3HB 5IGEA 1RTOA 2EYPA 1F9RA 3TMEA 4ZLTF 2XIWA 5IGBA 3MFGA 4KJOA 1STNA 4K8JA 1GUOA 1CA5A 2X6GA 1ZYRD 1QB5D 1A2TA 1SFOB 3T16A 3EFXD 5IGFA 4HN7A 1AN8A 3M7GA 1STYA 2PO4A 4BWGB 1U4PA 5M3MB 5CBEE 1FNWA 3CRKC 3OWFA 4ZKBB 3PO3B 4IUUA 3MEHA 3OOCA 2K6AA 3OPOA 1CI3M 2KVMA 1SDFA 1R4QB 2JP1A 5E4XA 1STGA 4PMWA 1EY8A 5C0XG 5EGTA 1HQRD 3D4RA 2DY7A 3K59A 4IFDH 2OF1A 1F2YA 4HCSA 3CRLC 4IUVA 4G57A 2R3ZA 1SAPA 3HOVB 1XXGA 1JCKB 4ODGA 4X3SA 1IL8A 2KA7A 5C0XJ 3VA5A 4UAIA 1EYCA 4KTAA 3OMCA 3HP3A 2A68D 1H9KA 4XDXA 1I4PA 1RHPA 1T5XD 4FXDA 3SVMA 3DHQA 4OO1I 3NTIA 5TSSA 2K5WA 2AQ2B 1SMYD 2EPBA 3KBXA 1LTTD 1RD9D 3M3YB 2ICEC 2EJMA 4M8AA 1U4RA 1SNDA 4CKCA 5I6WA 1B1ZA 1BQQT 1B3AA 4PMBA 5CYUA 3SDZA 2FHTA 4EGVA 1PTOD 3GTLB 4K5XA 5M9OA 4A3GB 3LNNA 3HOXB 1UNSA 3DWQA 2EYHA 2M2LA 4K5WA 2PNRC 3S16B 1PDQA 5JVH3 4H13C 3RLFA 4IFDG 1V1PB 1PZID 3K57A 2FJ2A 5EKKA 1SBBB 4EVOA 4TQUS 1BR9A 2RQXA 1EY6A 1S5ED 5DEHA 1M8AA 5CORA 1SXTA 4ZUJA 2PZWA 5K36H 3GP7A 4FXGC 5ELFA 4XTCS 1ZXTA 3C1EA 3H94A 3DMUA 1I6VC 5BN3A 2QDBA 3KBGA 5C0XI 1WTOA 3HG9A 1F9QA 2HCIA 2A69C 3D3RA 1K8OA 5ELDA 2HQEA 3M7NA 4KKTA 4LJZC 3QIAA 1YNJC 1BUVT 2M00A 1CZWA 1H9MA 1SYCA 2XSCA 4CGYB 3P75A 3M85A 4F7XA 1ML0D 1JWUD 1EYDA 1EY7A 2R93B 2DY8A 1JR0D 2L12A 3BS1A 2OEOA 2EJGC 3I73A 1G6ZA 3VYRA 1WTXA 3P20A 4ULLA 1L0XB 3VR6A 4ZYSA 1EZ6A 2E2HB 5JOBA 3NQTA 1X3PA 4DN4M 1I4QA 3URYA 4P2CB 3SK4A 3J80E 5KNBA 5HGTA 3BVZA 3MXPA 1WCMB 1EY5A 2F0UA 3V05A 2ZXPA 3NTKA 3DUZA 4HAEA 2O5JC 2RKSA 4RKBA 1PRTC 4X3KA 1SNCA 3E0JA 2B2WC 5COYA 1KLGD 4TKOB 3Q6SA 2CW0D 3NBHA 1Y1WB 2EYJA 4MIUA 4FF1A 4ZK9B 3D6WA 1HFNA 4ILWA 1RCVD 1I4GA 4JK1C 2BDNA 2NWGA 4RWSC 1ZYRC 2PZTA 2WP8J 4C1NK 1HA5A 1IHZA 2F0WA 4RKLA 3E5SA 3EVQA 3SHLA 4PMCA 2F0MA 3NXWA 2ZXRA 1JWSD 4R8NA 4G7OC 4A3JB 2XWBB 5G3LD 1TS5A 3D4DA 5A35A 4OIJA 1F2LA 4KHVA 1IKMA 4BBRB 3D31A 1NAPA 1EWCA 3SK6A 5LL6S 3SXHA 1BCPD 3NTHA 3MXGA 1AW7A 3HZXA 3KLRA 1CZGA 1TY2A 1ZKOA 3LX0A 4XQQA 3TZUA 1DOLA 1O7YA 1WTVA 4ABNA 1R9TB 1RTNA 5KIXA 3UI2A 4A93B 5ELEA 1BO0A 5A2QE 3S2HB 1EIGA 1Q1BA 5JPMC 3S14B 1EU4A 4ZAIA 1NSNS 1HPCA 1SYFA 2XN9C 1KDCA 4UDUC 2A68C 1V1OA 1KTKA 4RA8A 3FPUB 1OO9B 3BDOA 2L9HA 1ET6A 1SMYC 4ZKCB 4RHRA 5IGDA 1F9PA 2F0NA 4S3SA 3JAML 3A54A 2B2TA 1TWFB 4NKLA 2PQEA 2L5TA 4BS9A 5DM73 4N9PA 3J81L 4HEDA 3CQZB 4FF2A 2D2CC 3AB9A 4WORA 1LLRD 2NTTA 1Z6HA 4X3UA 1DZ1A 1I6HB 2SNMA 1DONA 4ZRZA 1PTOC 1O80A 5IT9E 1UAPA 2C5CA 4XIGS 3SE0A 4C3HG 1NR4A 1Q1EA 3EA6A 4H44C 1PFMA 1BF4A 4J6HA 4IALA 1U4LA 5IIFA 1IYUA 1D1IA 3K5LA 5C5LA 2BOSA 2D62A 2ICIA 1AZPA 1U4MA 4KY7A 3M4OB 2MUYA 3F2UA 4RGMA 3I72A 1Z7TA 1MD2D 2K33A 3HEJA 1FNVA 3FVQA 4DNTB 3VR4A 3P1HA 5FOBB 2F03A 1HHVA 3RD4A 3CU7A 5JEAH 3MAQA 3PUYA 1BXTA 3MXNA 5JVG3 1EOTA 3GTPB 4OO1G 3E6ZX 1LTRD 5C0XH 1NR2A 2DNCA 4Q0FA 4DA2A 4IN3A 3I70A 1Z47A 4KKSA 1I4RA 1G8ZD 3A7AB 1QILA 2QILA 2EY6A 3MFYA 2JA5B 4HTHA 3EQLC 1C4QA 4OL7A 5T1GA 4FYDA 2O4XA 5CV6A 5FLXL 1EEID 4HMIA 3GD7A 3C1FA 1J8IA 1G2SA 1I3QB 1IW7D 2XNAC 4DK1A 2D9UA 4BA1I 1QJOA 5FO8B 2D5DA 4Q5VA 3Q0AA 5IOCA 1ILQA 3VA7A 3SEBA 1STEA 1TS2A 2B8GA 3DEPA 3KLSA 4FVMA 1MSHA 2E76C 1GUWA 1F77A 2I07B 2XWJB 2JSOA 2AUKA 3N6RA 1ET9A 4J8QA 4PV1C 3MTSA 3U9OA 1R4PB 1G91A 2BA0A 1XTCD 3IAYA 3MZ5A 4MHEA 4LAAA 2BDOA 2NYZD 1DOMA 2B2UA 5JEAG 4KD4A 3ITPA 2NUCA 4CHTB 2K5QA 1Y8PB 1HTPA 3TZDA 3NBIA 2K03A 3KK7A 1EWHA 2B39A 4RGOS 5IGCA 4A3IB 2VB3X 2L55A 1CTMA 1BCPC 4F87A 5JEAJ 5CV9A 5EPKA 3VYTA 4QCLA 3L3OC 2Y0SB 1PTOF 2IW3A 5CV8A 1SE4A 2FINB 3L9AX 4C3IG 4AYBB 1D5XC 2JE6I 4ZQ3A 2IX1A 1JWMD 1Y1VB 3PO2B 2RDFA 2QKIC 5I2XA 2NVYB 2E2JB 4ZUIA 1ZEQX 3ZYYX 1E2VA 5CGKA 2B63B 2F0KA 1NCVA 4M1UB 2LS01 4DK0A 1KNEA 1DJRD 4O42A 5KRUA 3S9WA 1KLUD 1SJED 5AFWA 2R92B 4KN4C 2F0QA 3D4WA 2F0DA 2EXZA 3D8GA 4KK7A 4V0BA 2Z8LA 5ISRA 2VB2X 1F9SA 2BE5D 1ENFA 3PIO3 1GXDC 3QB3A 2NVQB 2K5DA 3O13A 2Q8RE 2NBFA 3NSWA 2B2TC 2LFNA 3HKZB 3PUWA 2PYKA 1PXUA 2XRQD 2YYZA 1D1KA 1LT6D 2L4NA 2Q8IB 1FNUA 4FXKC 1TWGB 1Y69U 1T5EA 2K1BA 4LK1C 1EU3A 4Z9CB 1D6EC 4KI0A 3S1RB 4CJ2C 1SNOA 2K01A 1RJTA 1XWEA 1VMPA 4FNFA 4QUCA 2IX0A 2Z4HA 3R3OA 4KY6A 2EDGA 2DN8A 3NHHA 4EQPA 3BG3A 3HOZB 1QE6A 2WV6D 2F0EA 4C3IB 3J7AV 3FEWX 5C4XB 4V190 3T53B 2CQAA 3C2PA 5BN5A 2NN6I 4OHJA 1H9JA 1Y8NB 1B9MA 4DF7A 4HCEA 1Q90A 5KEEA 3BYTB 5KGUA 1W6KA 2X69A 3GO5A 3SR1A 3S1MB 1S5DD 1VCIA 3BYYB 3VR3A 2EY5A 4K6DA 1LT4D 2QF7A 1LABA 3K6OA 1BDOA 4IUNA 4CKBA 1S4ZA 2HUGA 3A55A 3OIPA 2L1BA 3TDQA 1Q3LA 5CV7A 2EYLA 1MBYA 3MA2B 2A5HA 2XRSD 4HSPA 4C1NI 1FR3A 2IPKD 2IL8A 5ELCA 1PTOH 1SYEA 3SK5A 1CQFA 2J7ZA 2JEBI 1HQMC 2Z4IA 2AQ3B 1TIID 3I90A 1CHPD 3I4LA 3K5NA 1D5MC 5LHY1 5E4WC 1E2WA 4E6IA 3D6CA 1MSGA 2EY2A 1JORA 2LKVA 4PNYA 5C3XA 2ID0A 2E2DC 1LT3D 4N9TA 4X3TA 1KNAA 2WIIB 5M5WB 3S1NB 1SNPA 1WD1A 4MN3A 1TKWB 2F0JA 1LACA 1GUSA 3KUPA 3P7JA 5CV5A 2M9VA 4OIKA 5ELBA 4DXFA 1OXTA 2N55A 2E75C 2F0LA 1QG7A 1QNUA 3IL8A 2EZVA 1PRTB 1S5CD 3GTMB 1HUNA 4FF3A 2K04A 4K14A 3K7AB 1JQYD 5HURA 1U9RA 3J80L 3JAME 4C2MB 3I3CA 5JAVA 4GZYC 1PFBA 2B2UC 4F8MA 1SEBD 4QUFA 2KHSA 1QCBD 4RCNA 4H7BA 1PZJD 1O7ZA 1ESFA 5KYIA 3VR5A 1GOZA 3TSSA 1SYBA 5EBCA 4RGTA 3R8BA 2FFKB 2SEBD 2L0CA 1WTRA 1J9OA 3NP8A 4XT1B 4FP5D 3A8KE 4A3DB 2H4OA 2MHVA 1CK1A 2JA6B 1STBA 3C3LA 1QWYA 4QB4A 3RZOB 1IYVA 1JE4A 1XX8A 5BN4A 4CBVA 2HDMA 3AMUA 3K0YA 2B8FA 4XXEA 3S1QB 1EY9A 3PV0A 4A3KB 3GTQB 4OO1H 1A6XA 1EYAA 3QO2A 2DNEA 2KEDA 1KDBA 1BNZA 5EBDA 5CBAE 2BE5C 3PMFA 5EPLA 3T4AC 1A15A 1RDPD 3VYUA 2KEEA 2PCFB 3FPPA 3X3NA 2Z1CA 4DAVA 1RODA 3H09A 4RGNA 1JOOA 1RKNA 3ERQA 1OXVA 5D65A 4L6TB 2YU9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3C A;  2JP1 A;  1PDQ A;  5E4X A;  3GV3 A;  4NW2 A;  1AZP A;  1U4M A;  2RSO A;  1PFN A;  5DNF A;  1G91 A;  1HRJ A;  1F9S A;  4HAE A;  4ZAI A;  5CMD A;  3F2U A;  1PFB A;  3G7L A;  4XT3 B;  5EKI A;  1LV9 A;  1S4Z A;  2B2U C;  1HUM A;  2HUG A;  4R9W A;  1HA6 A;  2DY7 A;  4MHE A;  4QUF A;  2FJ2 A;  3DEO A;  2L1B A;  1EQT A;  2KUM A;  4LMQ D;  4X3K A;  2Q8R E;  1Q3L A;  4RA8 A;  3TN2 A;  2NYZ D;  2SDF A;  4HCS A;  2B2W C;  3FPU B;  5COY A;  2MPM A;  1B50 A;  1DOM A;  2MP1 A;  1O7Z A;  2B2U A;  1EIH A;  2RSN A;  3Q6S A;  1WTP A;  2L9H A;  2MGS A;  2B2T C;  2FMM A;  4IUV A;  1CM9 A;  1XYI A;  1HHV A;  2R3Z A;  1SAP A;  2IL8 A;  5JJZ A;  4ZKC B;  2NZ1 D;  1M8A A;  2B2W A;  4IUP A;  1F9P A;  1B53 A;  2FFK B;  2RVL A;  4X3S A;  4U68 A;  5COR A;  1VMC A;  1IL8 A;  1MGS A;  3ONA B;  4ZK9 B;  1WVL A;  3D6W A;  3TZD A;  1WTR A;  1AZQ A;  1ILP A;  1HFN A;  1J9O A;  2J7Z A;  4XT1 B;  1EOT A;  2B2T A;  2Q8T A;  2RA4 A;  4UAI A;  2L4N A;  1PLF A;  2K03 A;  1WTQ A;  3N52 A;  2BDN A;  1ZXT A;  5D14 A;  1JIC A;  2NWG A;  3H91 A;  3HP3 A;  4RWS C;  1NR2 A;  5T1I A;  2B2Y C;  2VXW A;  1AP0 A;  4XDX A;  3I90 A;  1ESR A;  1QNK A;  3I8Z A;  3I91 A;  2K1B A;  4IUR A;  1IKL A;  2KEC A;  3GV6 A;  5EPK A;  4IUQ A;  1RHP A;  1JE4 A;  1XX8 A;  2X6L A;  4CJ2 C;  1MI2 A;  5E4W C;  3SVM A;  2K01 A;  1RJT A;  4HED A;  1F9Q A;  1X3Q A;  2HCI A;  2HCC A;  5T1G A;  1WTO A;  3MWY W;  1MSG A;  2B2Y A;  1VMP A;  4X3U A;  1WTW A;  2H1E A;  4QUC A;  1SSO A;  1DZ1 A;  2EPB A;  1X32 A;  2EE1 A;  1J8I A;  1DON A;  2FIN B;  2HDM A;  1ICW A;  1G2S A;  1RTO A;  1F9R A;  2B2V C;  3KBX A;  1O80 A;  2MJ8 A;  1TVX A;  4ZLT F;  2XIW A;  4RAU C;  2D9U A;  4X3T A;  1KNA A;  1C8C A;  4OIJ A;  1F2L A;  1ML0 D;  1IKM A;  1QE6 A;  2K28 A;  1CA5 A;  1NAP A;  1U4R A;  2DY8 A;  2X6G A;  1WD1 A;  2L12 A;  2CVR A;  3QO2 A;  4MN3 A;  4IUT A;  1BBX C;  2KED A;  1B4O A;  4HSV A;  3P7J A;  3KUP A;  1G6Z A;  1ILQ A;  3IFD A;  1WTX A;  1NR4 A;  2KOL A;  1BNZ A;  5EQ0 A;  4OIK A;  2K05 A;  2N55 A;  5EPJ A;  5CBA E;  2EOT A;  1B3A A;  5EPL A;  1NCV A;  1PFM A;  1A15 A;  1DOK A;  1QG7 A;  1X3P A;  1HFG A;  2N88 A;  1E0B A;  3IL8 A;  5EJW A;  3DEP A;  1BF4 A;  1HUN A;  1U4P A;  2FHT A;  4DN4 M;  5CBE E;  1U4L A;  3DM1 A;  1DOL A;  1KNE A;  1O7Y A;  2KEE A;  1WTV A;  2X69 A;  1EL0 A;  1G2T A;  2L11 A;  1MSH A;  3R93 A;  4O42 A;  4ZKB B;  4R8I A;  1CA6 A;  1RTN A;  2K04 A;  4IUU A;  1B2T A;  4CJ0 B;  2JYO A;  5AFW A;  3UI2 A;  1GUW A;  1ROD A;  2HDL A;  3FDT A;  3LWE A;  1BO0 A;  1WD0 A;  2B2V A;  2KVM A;  1SDF A;  1EIG A;  5D65 A;  4CJ1 B;  2M2L A;  3MTS A; 
#chains in the Genus database with same CATH topology
 2YV5 A;  5HY6 A;  2B63 H;  4B3R L;  2K52 A;  4L63 B;  1PMR A;  5A2Q L;  2R6G A;  4LFA Q;  4XT3 B;  1TQO A;  5EKI A;  1YIT A;  2J4X A;  1L0Y B;  1LTA D;  5JJL A;  3PQI A;  1AE3 A;  4U67 3;  1K3B C;  3DEO A;  4LMQ D;  3CCJ A;  1WYD A;  3PUZ A;  3J7Y W;  1GHJ A;  1QUQ A;  2CCZ A;  2JA8 G;  1B50 A;  1A2U A;  1NMG A;  2G9D A;  4NP5 A;  5IY0 A;  4K2L A;  5JJK A;  1CM9 A;  2R61 A;  1F2M A;  4IZ8 A;  1PRT F;  2RVL A;  2PI2 A;  5I9O A;  3ONA B;  1WVL A;  4JI5 L;  1PTO B;  1TR5 A;  3S17 H;  3G6E A;  1XNR L;  4A3M B;  3NWT A;  5J22 A;  3I4N B;  3S15 H;  3GV6 A;  4LF5 Q;  3CHB D;  5EKL A;  4YCU A;  1PYB A;  3ER0 A;  1HCZ A;  4JI4 Q;  3U4V A;  2UUB Q;  2WKD A;  1I50 H;  2E74 C;  5J3B A;  4DV4 Q;  2A69 D;  3G4S A;  4A3I G;  2IJ0 A;  5HGQ A;  1EZ8 A;  1TWG H;  1RL2 A;  4ME5 A;  2OTL A;  2QEJ C;  5IP9 H;  2AHO B;  5ELO A;  4X65 Q;  1Q86 C;  4DR1 L;  3S1R H;  2K28 A;  2EY1 A;  2K32 A;  2HIV A;  2WB1 E;  2NN6 H;  3WDN A;  1BBX C;  2GVA A;  4AYB G;  4QQB X;  1UUP A;  2K05 A;  1N34 L;  4DAP A;  1Q12 A;  4P73 A;  1Y1V G;  1K9M C;  1DOK A;  1I4H A;  1VF5 C;  3QG1 A;  5EJW A;  5LL6 X;  3BZC A;  1LTB D;  5CC4 A;  5FLX c;  4XQJ A;  3K5O A;  1PH6 A;  1BKB A;  3T1Y L;  4JI7 Q;  4A3E G;  4B9W A;  4NXM L;  3V2T A;  4DV3 L;  1SNM A;  5C4X H;  1XMO L;  1FD7 D;  2F3W A;  3KLS X;  1DD2 A;  4CKE A;  1H95 A;  3AQQ A;  4DNR B;  2NVX B;  4O0A A;  2F3V A;  2A73 B;  4NW2 A;  5I4D A;  4BBS B;  2KQ3 A;  1UEA B;  3OYY A;  4KLK A;  2GVB A;  3G7L A;  4I65 A;  1B7Y B;  1LV9 A;  4L8J A;  1FGB D;  1HA6 A;  3T13 A;  4LW1 A;  2ZT9 C;  1EQT A;  2BA1 A;  2AWO A;  1CKN A;  4DAY A;  5C3E G;  1YZ6 A;  1NUC A;  2CW0 C;  3J81 i;  2OT2 A;  1SNQ A;  2F4I A;  1WI5 A;  3PGZ A;  3TP8 A;  2F0P A;  2F0S A;  3BJU A;  3MXU A;  4DK6 C;  1PYW D;  4F88 A;  2JA8 B;  1B53 A;  4Y7N H;  3PF5 A;  2C9O A;  4BA2 I;  2PW7 A;  1DGS A;  3WOF A;  4K6L A;  5GAD C;  1PLF A;  3IRB A;  3HS0 C;  2G9H D;  4DR4 L;  1V8Q A;  5D14 A;  5I9P A;  2L15 A;  3BDL A;  1PA6 A;  1AP0 A;  3I91 A;  3HKZ G;  2F0V A;  1ASY A;  1TY0 A;  2WB1 B;  1CT1 D;  3ND8 A;  1OXX K;  1YJ9 A;  2JEA I;  2I5L X;  5IGG A;  1A3U A;  4GOP B;  1HNZ L;  4FO2 A;  1YJW A;  3OIQ A;  1JC7 A;  1B44 D;  4WFN 3;  1GUT A;  1ICW A;  4DR6 L;  2OWO A;  5IP9 G;  4ALP A;  1PZK D;  2PMZ B;  4TRD A;  4YWM A;  1VDZ A;  3DWA A;  2NN6 G;  4BY7 H;  2A6E D;  2AQ1 B;  2F0O A;  1J5E L;  1W2B A;  3IFD A;  3GQB A;  4NPS A;  4LFC Q;  2KCT A;  5NUC A;  5JPN C;  4LF4 Q;  1TWC B;  1SYD A;  1X3G A;  4LF8 L;  2B3G A;  1EY0 A;  3NBH B;  2O2L D;  5CV4 A;  1G2T A;  2UUA Q;  4BY1 H;  2KBN A;  2RDG A;  3VR2 A;  2PQA A;  2KCC A;  3TBI B;  1FJG Q;  1WFQ A;  1EQV A;  5C4Z A;  1KAW A;  1CQV A;  4C3J B;  4CJ1 B;  4G4K A;  3HOW G;  2QCP X;  4GNX C;  4A3E B;  2JA7 G;  1A3V A;  1HTL D;  5DNF A;  4QMG A;  4GKK Q;  1XTD A;  2XTI A;  2LXJ A;  3QOJ A;  3CCL A;  1A62 A;  1HUM A;  5FO9 B;  3F8T A;  3K7A H;  2WAC A;  3HKS A;  3FKI B;  2EIF A;  1K8M A;  3TN2 A;  1BCP B;  4RCO A;  1KHI A;  4DNI A;  4C2M H;  2NVT H;  1SJH D;  5M5X B;  4K8I A;  3OWE B;  3H0G B;  1D5Z C;  3LWU A;  2NZ1 D;  3M9B A;  5C3E B;  2EVB A;  4U68 A;  5E1F A;  4BXX H;  4UP7 A;  1GHK A;  3C46 A;  3T1H L;  3IKJ A;  1WTQ A;  3N52 A;  4OX9 Q;  1KDA A;  2AWN A;  1JIC A;  1CFM A;  4ID6 A;  5FJ8 H;  1ESR A;  3S17 B;  1QZG A;  3A8J E;  1LTG D;  2R7D A;  4ME3 A;  3NQI A;  2RHS B;  1XMQ Q;  1M4V A;  4JI3 L;  4GKJ L;  1OXS C;  4A3B H;  4DV2 Q;  4JBW A;  4LF9 Q;  3WOE A;  3S15 B;  3MWY W;  1G29 1;  5E3F A;  1K73 C;  4A3D H;  2F0G A;  1HNX L;  3NE5 B;  1L1O C;  1I50 B;  3M4Y A;  2ZM6 L;  3QJY A;  2B2V C;  2UXC L;  2A6H D;  3BDC A;  1W6J A;  4RAU C;  4BY7 G;  4PZ7 A;  3K81 C;  4B9X A;  4KHZ A;  3R2I A;  4R4T A;  1VQM A;  2LMC B;  3HOY H;  3A7L A;  1JOQ A;  1UE1 A;  4EQO A;  4GLA C;  2XVS A;  2F0H A;  5C44 B;  3V96 A;  4O1N A;  3KDF B;  2R7Z H;  1H9S A;  1IBK L;  4OGQ C;  4K0K L;  3U4Z A;  2N88 A;  2PW5 A;  1HXY D;  4DV6 L;  3S1Q H;  1E0B A;  4BY1 G;  1TS4 A;  2EJF C;  2A19 A;  2L11 A;  3GTQ H;  5FLM H;  1B70 B;  2JYO A;  3X3M A;  1EEF D;  2HDL A;  4NDX A;  2I5M X;  3LWE A;  4JI1 Q;  4DR3 L;  4XYQ A;  2E2I B;  1RF2 D;  3STB D;  1H9R A;  1PFN A;  4IFD J;  3OSO A;  1L1O B;  5CMD A;  3K5M A;  1KAA A;  3K7U C;  3DWP A;  3QR8 A;  5I6Y A;  1K8G A;  5M3F B;  1X3F A;  3HGB A;  4TSS A;  1O78 A;  2WKC A;  4DV0 L;  3HOW B;  2JA7 B;  1VQ9 A;  3R2T A;  4X64 Q;  1PFS A;  3NK9 A;  4B08 A;  3K8A A;  4OXP A;  1LUZ A;  2YU9 H;  1EIH A;  3TEH B;  1GKH A;  1WTP A;  1OXU A;  1I4X A;  3CD6 A;  2O5I C;  1EFI D;  2MFI A;  4BXX G;  1XNQ Q;  2TSS A;  3T51 B;  2VQE Q;  2CHB D;  5IWA L;  1Q46 A;  3NPP A;  4R1J A;  1F2Z A;  3Q22 A;  2F4V Q;  5BR8 Q;  4JI2 Q;  5FJ8 G;  4A3F H;  4OWT B;  4Y7N B;  3H91 A;  5D3D A;  2PPB C;  4IUR A;  1EY4 A;  4A3B G;  4DXG A;  3ZJY C;  4YHH L;  4A3D G;  1ONL A;  5G3L F;  1LTI D;  4H0L C;  4HJ8 A;  5I2Y A;  2B2Y A;  3FRP B;  4HMJ A;  2H1E A;  3KYH C;  1SSO A;  1Z9F A;  1YIJ A;  4KV6 A;  1YNN D;  1VQK A;  1IL2 A;  1IW7 C;  4POF A;  3I4M H;  3DXJ C;  4IOA A;  3J7A F;  4IQZ A;  1BCP F;  3UDG A;  4KY5 A;  5IYC H;  1JB3 A;  4J1M A;  3HOY G;  3KF8 A;  1HZA A;  2NZH A;  3NWS A;  2WIN B;  3OTO Q;  1QZH A;  2R7Z G;  4BY7 B;  4JYA L;  2IT1 A;  4WJ4 A;  1S5B D;  2A74 C;  3CCE A;  4RHS A;  2RCN A;  4RH6 A;  2DGY A;  4JBJ A;  5FLM G;  2AUJ D;  5C5M A;  4B3R Q;  3DM1 A;  3GTO H;  3RMH A;  2NTS A;  3R93 A;  4R8I A;  1B2T A;  3QWN A;  2VNU D;  1VQ8 A;  2F0I A;  4BY1 B;  3G6J B;  3MXN B;  5LMN W;  4YWK A;  1WD0 A;  3GTJ B;  1DM0 B;  4JG2 A;  4B3T L;  3PUX A;  1TS3 A;  2KEN A;  4KD3 A;  1PH8 A;  1UWV A;  2RHQ B;  5K36 G;  1LTS D;  2F0T A;  1HZC A;  4JI6 L;  1A3T A;  2ZJQ A;  1FGU A;  4LUO A;  2KUM A;  1HZB A;  4CDF C;  2SDF A;  2V4D A;  4JI5 Q;  3NEN A;  1EFW A;  3CME A;  4IFD I;  3MC0 B;  1XNR Q;  2FMM A;  2GA4 B;  2QEX A;  4BBS H;  5CR3 A;  3RN5 A;  4DKA C;  2UXB L;  2NVT B;  4IUP A;  3J80 c;  3TQY A;  1MGS A;  3OHX C;  4A3F G;  1E2Z A;  1IZ6 A;  1EWI A;  1ILP A;  5GAH C;  4JV5 L;  2I46 A;  3E9I A;  2OTJ A;  2SOB A;  2A6E C;  3BVM A;  3CPW A;  5IOD A;  1SE3 A;  4G7H C;  2VXW A;  3I8Z A;  3J81 E;  4DV7 L;  3SK8 A;  1STA A;  2GN5 A;  1O7L A;  1MI2 A;  2IWH A;  4DR1 Q;  1TWH B;  2HCC A;  1II3 A;  2EYM A;  3I4M G;  1WTW A;  2KCM A;  1X32 A;  1KAB A;  4AH6 A;  4A3B B;  2VUM B;  3PIO A;  5IYC G;  1Q8I A;  1Y8O B;  1N34 Q;  1S5F D;  1ASZ A;  1C8C A;  3NEL A;  5C4H A;  2OXP A;  3ULP A;  3TP6 A;  1SFO H;  1GUG A;  1JOK A;  3EN2 A;  4RFB A;  5C4J B;  1LO5 D;  2CVR A;  5FK9 C;  3FMC A;  3ND9 A;  3E9H A;  4IUT A;  2CWP A;  2KCN A;  1V1P A;  2KJX A;  3OMG A;  1B4O A;  4B3M L;  1GJX A;  2BCO A;  3HOY B;  2KOL A;  2VS1 A;  5EQ0 A;  4DV3 Q;  4NXM Q;  5EPJ A;  4K5V A;  5M3M H;  4PQX A;  1GUN A;  2CWA A;  3GTG B;  2RDH A;  3PO3 H;  1HFG A;  1IBM Q;  2R7Z B;  1CSQ A;  3CKI B;  1V43 A;  3J7Z C;  4WRD A;  2G5D A;  3L7Z C;  1C48 A;  1JJG A;  1MJE A;  3FDT A;  1YHB A;  2F52 A;  1FYC A;  1CHQ D;  5FO7 B;  2EYF A;  4I7Z C;  5DM6 3;  2SNS A;  2B2V A;  4RG1 A;  4LF7 Q;  3J7A 5;  1TWC H;  2K7V A;  3GV3 A;  2RSO A;  2VY3 A;  3KFU A;  3TP5 A;  3U9S A;  5M5Y B;  4R9W A;  1X54 A;  4AIM A;  3IFT A;  1E24 A;  2ENB A;  1GO3 E;  1DCZ A;  4A76 A;  2ZTC A;  3KJO A;  4IPG A;  3KF6 B;  1JE5 A;  1STH A;  2MPM A;  4K2K A;  3HOV H;  4BBS G;  4C3J H;  1TWA B;  2MP1 A;  1B9N A;  4FF4 A;  3Q8D A;  4DR4 Q;  2MGS A;  1HJP A;  3ULJ A;  1DXM A;  4KKU A;  1QOH A;  3H3V C;  1VMC A;  1PVO A;  2A6H C;  3FKI H;  4WJW A;  4UY8 C;  4ZCK A;  2Q8T A;  2RA4 A;  3ICE A;  1VQD A;  3HOU B;  3BZD B;  4QF4 A;  4QIW B;  1EYG A;  1HNZ Q;  3GTK B;  1V9P A;  2TMP A;  2IX3 A;  5KNC A;  2HHH L;  5M5X H;  4A3F B;  4C56 C;  1IKL A;  1C9O A;  3H0G H;  4J15 A;  1SN8 A;  2RBM A;  3TP7 A;  5FLX E;  2N8N A;  1WOC A;  4IUQ A;  1TT2 A;  5C3E H;  2X6L A;  1X3Q A;  1QVF A;  4GN3 B;  3MVV A;  3RUZ A;  3PF4 A;  1LYL A;  1KRT A;  2UU9 Q;  1J5E Q;  3QOL A;  2ZXO A;  3RZD B;  2YTY A;  1LT5 D;  4IOC A;  3RLO A;  2MO1 A;  3M3Y H;  4JVZ A;  2NB0 A;  3VYS A;  4IJL A;  2WAQ E;  2MJ8 A;  1TVX A;  4DFA A;  4JBM A;  4DU9 A;  2WB1 G;  5D3I B;  3I4M B;  2OQ0 A;  3J80 i;  4EQN A;  4DR5 L;  1PHJ A;  1YJN A;  4XQN A;  2PNH A;  3STB C;  4HSV A;  5M3M G;  4A3C H;  3NUC A;  1E22 A;  2F1M A;  1N36 L;  3PO3 G;  1VQO A;  2R7F A;  2EOT A;  3JC6 6;  3PUV A;  3Q24 A;  1N33 L;  3GTL H;  2JXM B;  3T56 B;  5GAE C;  2Q2I A;  1SYG A;  1EL0 A;  1YNJ D;  1SE2 A;  4KMU C;  1CA6 A;  4CJ0 B;  2F0F A;  5C44 H;  3GTO B;  3CCV A;  3EJI A;  4HR7 B;  1J6Q A;  3UE0 A;  2FMC A;  3BVG A;  3CXC A;  4G7Z C;  2DJG C;  2Q2H A;  3W3A A;  5IT9 L;  2JJQ A;  5KYL A;  1NTG A;  1HRJ A;  1G51 A;  2PZU A;  5GRO A;  4DGZ A;  1AFP A;  3H3V I;  5C3W A;  2EYO A;  4KJN A;  3ERO A;  3EIV A;  3H15 A;  3OW7 A;  1D2B A;  3HOV G;  1H9S B;  3H6M A;  4C3J G;  4DUY Q;  2ASB A;  3Q23 A;  3T1H Q;  3PIP 3;  1PH5 A;  2E2I H;  1L0W A;  2RSN A;  1ENC A;  3OW2 A;  2QW7 A;  4QJF A;  5F2D A;  4KN7 C;  1XYI A;  1NBW A;  1GM5 A;  5JJZ A;  3CF5 A;  1ENA A;  5DAU A;  2J0T D;  1YNN C;  3FKI G;  2B2W A;  3MHB A;  5M3F H;  4XYO A;  1AZQ A;  4JI3 Q;  3HOW H;  4GKJ Q;  5K5P A;  2JA7 H;  1AEX A;  3AEV A;  3S2D B;  1UE6 A;  1HNX Q;  2WAQ B;  3W2D A;  1K83 B;  3H0G G;  1SMX A;  5T1I A;  1PRT D;  2B2Y C;  2ZM6 Q;  1QNK A;  1BOS A;  5J39 A;  3K58 A;  3A8I E;  1N32 L;  1K3R A;  2Y0S E;  4NMZ A;  2KEC A;  5KND A;  1VF7 A;  4CDC C;  4IPH A;  2LY7 A;  2JQO A;  5FKA C;  1QVG A;  5C6A A;  1TU2 B;  5IP7 G;  4KHP Q;  4YIJ A;  3EBE A;  3A56 A;  4P71 A;  4AYB E;  1DYQ A;  3AU7 A;  2EE1 A;  3E0E A;  3HRZ C;  5J1Z A;  4C3H B;  5IGE A;  1RTO A;  2EYP A;  1F9R A;  3TME A;  1M90 C;  3I55 A;  4ZLT F;  2XIW A;  5IGB A;  3MFG A;  4KJO A;  1STN A;  1IBK Q;  4EQ5 A;  4K8J A;  4DV6 Q;  1GUO A;  1CA5 A;  4JCV E;  2X6G A;  3I7F A;  1ZYR D;  1QB5 D;  1A2T A;  2XGT A;  4A3C G;  1E7Z A;  4H02 A;  1SFO B;  3T16 A;  3EFX D;  5IGF A;  1JB7 A;  4B3S L;  1Q81 C;  4A3G G;  4HN7 A;  1AN8 A;  1E3P A;  4CDE C;  3M7G A;  1STY A;  4DR7 L;  2PO4 A;  3HOX G;  1UEB A;  1NNX A;  1U4P A;  4BWG B;  5M3M B;  5CBE E;  1B3Q A;  1FNW A;  3CRK C;  5C44 G;  3OWF A;  4ZKB B;  3PO3 B;  4IUU A;  5LMN L;  3MEH A;  1WCM H;  3OOC A;  2K6A A;  3OPO A;  1CI3 M;  2Z6B A;  4DV0 Q;  4LFA L;  1U0L A;  2KVM A;  1SDF A;  1Q8K A;  1R4Q B;  2JP1 A;  5E4X A;  5AJ3 Q;  1STG A;  1KD1 C;  3KF8 B;  1X56 A;  4PMW A;  1EY8 A;  1VQC A;  5C0X G;  2I0Q A;  5EGT A;  1HQR D;  2V1C C;  3D4R A;  1N9W A;  2DY7 A;  3K59 A;  4IFD H;  5IWA Q;  2OF1 A;  3F2D A;  1F2Y A;  4HCS A;  3CRL C;  3GTJ H;  4DV5 L;  4A75 A;  3HKZ E;  4IUV A;  2K5V A;  1IBL L;  4G57 A;  2R3Z A;  1SAP A;  3CCS A;  3HOV B;  4HIO A;  1XXG A;  5M3F G;  3I4O A;  1JCK B;  1O7I A;  4PZ6 A;  4GN5 A;  2E5L Q;  4ODG A;  4X3S A;  1IL8 A;  2KA7 A;  5DLQ E;  5C0X J;  3VA5 A;  1BVS A;  1HR0 W;  4OWX B;  1YBY A;  4UAI A;  1CUK A;  4GS3 A;  4LF5 L;  1EYC A;  1KQS A;  3ERS X;  2ALY B;  4KTA A;  3OMC A;  3HP3 A;  1PH7 A;  2A68 D;  1H9K A;  4XDX A;  2BH2 A;  1I4P A;  1RHP A;  1T5X D;  5IE8 A;  4FXD A;  3SVM A;  3DHQ A;  2AKW B;  4OO1 I;  3NTI A;  5TSS A;  2K5W A;  2AQ2 B;  1SMY D;  3SGI A;  2EPB A;  3KBX A;  4JPB W;  1VQI A;  4BBR H;  1LTT D;  3B6Y A;  1RD9 D;  3K0X A;  3M3Y B;  3ULL A;  2ICE C;  4YCW A;  2EJM A;  4M8A A;  1U4R A;  1SND A;  4CKC A;  5I6W A;  1TWH H;  3G71 A;  4X62 L;  1B1Z A;  2VUM H;  3M4Q A;  4GNX B;  1XPU A;  1BQQ T;  1B3A A;  4PMB A;  5CYU A;  4OEL B;  3SDZ A;  1X55 A;  2FHT A;  4EGV A;  1WCM G;  1PTO D;  3GTL B;  4K5X A;  5M9O A;  5C4J H;  3A74 A;  4A3G B;  2IHE A;  3S2H H;  4JI6 Q;  3LNN A;  3RNU A;  3HOX B;  1UNS A;  4DUZ L;  3DWQ A;  2EYH A;  2M2L A;  4K5W A;  2PNR C;  3S16 B;  3GTG H;  4X6A H;  1PDQ A;  5JVH 3;  4H13 C;  3RLF A;  1E1O A;  2RF4 A;  4IFD G;  3FP9 A;  3GDE A;  1JMC A;  1V1P B;  1PZI D;  3K57 A;  1MJC A;  2FJ2 A;  5EKK A;  1Y1W G;  1SBB B;  4GLV B;  4EVO A;  4TQU S;  2BH8 A;  4DAM A;  1E1T A;  1PV4 A;  1BR9 A;  3HFZ B;  2RQX A;  1EY6 A;  1S5E D;  1PH4 A;  4DV7 Q;  5DEH A;  1M8A A;  5M5Y H;  2VQF L;  5COR A;  1SXT A;  1PYS B;  4ZUJ A;  2PZW A;  3TS2 A;  1ICF B;  5JJI A;  5H1S E;  5K36 H;  3GP7 A;  4FXG C;  5ELF A;  4XTC S;  1ZXT A;  1TWA H;  3C1E A;  3H94 A;  2MO0 A;  3DMU A;  1N8R C;  3CQZ H;  1I6V C;  5BN3 A;  2QDB A;  4R4Q A;  4UP8 A;  2UUC L;  3KBG A;  5C0X I;  3CCM A;  1WTO A;  3HG9 A;  1F9Q A;  2HCI A;  2A69 C;  2HQL A;  3D3R A;  1K8O A;  5ELD A;  2HQE A;  4HIK A;  3M7N A;  4KKT A;  3HOU H;  4LJZ C;  4BBR G;  3QIA A;  1YNJ C;  1EIF A;  4R4C A;  3GTK H;  1BUV T;  2M00 A;  3CCR A;  4DR2 Q;  1CZW A;  3UE1 A;  1H9M A;  1SYC A;  1JT8 A;  2XSC A;  4CGY B;  3P75 A;  3M85 A;  4F7X A;  1ML0 D;  1JWU D;  1X65 A;  1EYD A;  1EY7 A;  2R93 B;  2DY8 A;  1JR0 D;  1M1K C;  2L12 A;  2VUM G;  2CQO A;  3BS1 A;  2OEO A;  2EJG C;  3I73 A;  1G6Z A;  1IYJ B;  3BU2 A;  3VYR A;  3RZD H;  3P20 A;  4ULL A;  1WTX A;  1L0X B;  3VR6 A;  4ZYS A;  4YY3 Q;  2FXQ A;  1EZ6 A;  1QUQ B;  1V1Q A;  2E2H B;  5JOB A;  4O2D A;  3NQT A;  1X3P A;  4IPC A;  4DN4 M;  1I4Q A;  3URY A;  4P2C B;  1C0A A;  3SK4 A;  2Z6K A;  3J80 E;  5KNB A;  4GOP A;  5HGT A;  4A4I A;  1S72 A;  3BVZ A;  3MXP A;  3DM3 A;  3M4O H;  1WCM B;  1EY5 A;  3H3V H;  2F0U A;  3V05 A;  2ZXP A;  3NTK A;  3DUZ A;  3CW2 C;  2F3I A;  4HAE A;  4P74 A;  1EQQ A;  2O5J C;  2RKS A;  4RKB A;  1I5F A;  1PRT C;  4X3K A;  2Z9H A;  1SNC A;  3E0J A;  2B2W C;  5COY A;  1S3O A;  1KLG D;  4TKO B;  3Q6S A;  1SRO A;  2CW0 D;  3NBH A;  4UPA A;  3W1G A;  1Y1W B;  4X66 L;  2HHH Q;  5IYD H;  2EYJ A;  4MIU A;  4FF1 A;  2N78 A;  4ZK9 B;  1U5K A;  1X9N A;  3D6W A;  1HFN A;  4ILW A;  1RCV D;  4DK3 C;  1VQA A;  1I4G A;  4JK1 C;  2BDN A;  2NWG A;  2P5Z X;  4RWS C;  4DV2 L;  4NXN L;  4LF9 L;  1ZYR C;  2PZT A;  2WP8 J;  4C1N K;  3TRE A;  1HA5 A;  1IHZ A;  2ES2 A;  1HNW L;  2F0W A;  2JA5 H;  4RKL A;  3E5S A;  5L37 A;  4POG A;  2Z0S A;  3EVQ A;  3AFP A;  3HOU G;  2DUD A;  3SHL A;  4JC0 A;  4JOI A;  4PMC A;  1K0S A;  2F0M A;  3NXW A;  3S2D H;  2ZXR A;  1JWS D;  4R8N A;  2CH4 W;  4A3J B;  4G7O C;  1K83 H;  2XWB B;  5G3L D;  1TS5 A;  3D4D A;  1N36 Q;  4TVA B;  5A35 A;  4OIJ A;  1F2L A;  2OQK A;  4KHV A;  1IKM A;  4BBR B;  3D31 A;  1NAP A;  1EWC A;  4DV1 L;  3SK6 A;  5LL6 S;  3A0J A;  3SXH A;  3F1Z A;  1BCP D;  1VS0 A;  3NTH A;  3L0O A;  3MXG A;  1AW7 A;  4R4I A;  3HZX A;  4C3H H;  1CKN B;  3KLR A;  4DAY B;  1CZG A;  1TY2 A;  1ZKO A;  3LX0 A;  4IJH A;  4XQQ A;  3TZU A;  4JI1 L;  1DOL A;  3TRZ A;  1O7Y A;  1WTV A;  4ABN A;  1R9T B;  1RTN A;  5KIX A;  3UI2 A;  4LNQ A;  2OCE A;  4A93 B;  5ELE A;  1BO0 A;  2IHF A;  5A2Q E;  3S2H B;  1EIG A;  1Q1B A;  5JPM C;  3T1Y Q;  3S14 B;  1EU4 A;  2WFW A;  4EX5 A;  5LMU L;  1XMO Q;  4ZAI A;  1IXR A;  2KHI A;  1NSN S;  1HPC A;  1SYF A;  2XN9 C;  3K80 C;  1KDC A;  4UDU C;  2DJF C;  2Q2U A;  2A68 C;  1V1O A;  1KTK A;  3KDF A;  5E7N A;  1I94 L;  4P75 A;  4RA8 A;  3W5O A;  1XNQ L;  3FPU B;  2A8V A;  2VQE L;  1OO9 B;  3BDO A;  5IYB H;  5IYD G;  2L9H A;  1ET6 A;  1NY4 A;  4A3L H;  1SMY C;  4ZKC B;  4RHR A;  5BR8 L;  2RCF A;  4JI2 L;  2F4V L;  1HR0 L;  4AQY L;  1D7Q A;  5IGD A;  1F9P A;  2F0N A;  4S3S A;  1D8L A;  3JAM L;  3A54 A;  2B2T A;  1TWF B;  2ZTE A;  4NKL A;  3W1B A;  2PQE A;  2L5T A;  1EOV A;  3JAM c;  2JA5 G;  2C35 B;  4MTN A;  4BS9 A;  1BBU A;  5DM7 3;  1LM0 A;  4GN4 B;  3NEM A;  4N9P A;  3J81 L;  4HED A;  3CQZ B;  4HJ5 A;  2UXD L;  4FF2 A;  2D0P A;  2D2C C;  3AB9 A;  4GLX A;  2WAQ G;  4WOR A;  1LLR D;  2NTT A;  1Z6H A;  4X3U A;  1DZ1 A;  2PQA B;  2JA9 A;  2ATW A;  2H5X A;  1I6H B;  2SNM A;  1DON A;  1VQN A;  2D0O A;  4ZRZ A;  1VQG A;  1PTO C;  1O80 A;  3U58 A;  5IT9 E;  2NVY H;  4LUZ A;  2E2J H;  3LGJ A;  3S24 A;  1UAP A;  2C5C A;  1P8L A;  4XIG S;  1TXY A;  4DR6 Q;  3SE0 A;  4C3H G;  5LMN Q;  1NR4 A;  1Q1E A;  3EA6 A;  4H44 C;  1NMF A;  5IP7 H;  1PFM A;  1T9H A;  3MEF A;  1QVC A;  3KLW A;  1BF4 A;  4J6H A;  4IAL A;  2R92 H;  1U4L A;  4LF6 L;  5IIF A;  1IYU A;  1YHQ A;  1D1I A;  3K5L A;  5C5L A;  4LF8 Q;  4HJ9 A;  2BOS A;  3FHW A;  4FDB A;  2K75 A;  3CCQ A;  2D62 A;  2ICI A;  4DV5 Q;  1HZ9 A;  1AZP A;  1U4M A;  2NZO A;  4KY7 A;  4JBK A;  3M4O B;  2MUY A;  3F2U A;  2NVQ H;  4RGM A;  1JJC B;  1IBL Q;  3I72 A;  1PH9 A;  1Z7T A;  3E3X A;  4A3G H;  1MD2 D;  2K33 A;  3HEJ A;  1FNV A;  1CKM A;  1KIX A;  3FVQ A;  3L2P A;  4MZ9 A;  3HOX H;  4DNT B;  2ZJP A;  5IYB G;  3VR4 A;  1NJI C;  3P1H A;  5FOB B;  4A3L G;  1W3S A;  4YWL A;  3S16 H;  2ZTD A;  2F03 A;  1MIU A;  1HHV A;  3RD4 A;  3CU7 A;  4JI0 L;  5JEA H;  4CDD C;  4LUV A;  3MAQ A;  3PUY A;  4JI8 L;  1BXT A;  5IT9 c;  1JJ2 A;  3MXN A;  5JVG 3;  1EOT A;  3RN2 A;  2K5H A;  3GTP B;  4OO1 G;  3E6Z X;  2Y0S G;  1LTR D;  1BBW A;  5C0X H;  1NR2 A;  2DNC A;  4Q0F A;  4L5Q A;  4DA2 A;  4IN3 A;  1SE8 A;  2LSS A;  3I70 A;  1Z47 A;  4KKS A;  1I4R A;  1G8Z D;  3I56 A;  3A7A B;  1QIL A;  2QIL A;  2EY6 A;  3MFY A;  1AH9 A;  4N8F A;  4UHV A;  2JA5 B;  4HTH A;  3EQL C;  1C4Q A;  4OL7 A;  5T1G A;  4FYD A;  2K14 A;  2O4X A;  5CV6 A;  1EEI D;  4HMI A;  3GD7 A;  5FLX L;  4Y52 H;  2EQS A;  3PO2 G;  2A1A A;  2HT1 A;  4X62 Q;  3C1F A;  1J8I A;  2CFM A;  2PMZ E;  1G2S A;  3HOZ H;  1I3Q B;  3CPF A;  1IW7 D;  2XNA C;  4DK1 A;  1GVP A;  2D9U A;  4C3I H;  4LFB L;  4BA1 I;  1QJO A;  5FO8 B;  3VDY A;  2D5D A;  4Q5V A;  2UXC Q;  3Q0A A;  2B63 G;  5IOC A;  1Q7Y C;  1IBM L;  4OON A;  4L5T A;  1ILQ A;  3VA7 A;  3JAM i;  3RR5 A;  3SEB A;  2Z6K C;  4I7A A;  1STE A;  4GOP C;  1TS2 A;  4APV A;  2R92 G;  4DUZ Q;  2B8G A;  3DEP A;  3S1M H;  1EQR A;  1UE5 A;  4L5R C;  2R93 H;  3KLS A;  4FVM A;  1MSH A;  4LF7 L;  2E76 C;  4LWC A;  4K0K Q;  1GUW A;  1F77 A;  4HID A;  2I07 B;  2XWJ B;  1A0I A;  2JSO A;  1Q82 C;  2AUK A;  3N6R A;  1ET9 A;  2N49 A;  4J8Q A;  3MTS A;  4JW0 A;  4PV1 C;  2E2H H;  3U9O A;  4HJA A;  1R4P B;  1G91 A;  1G6P A;  4IPD A;  2BA0 A;  1XTC D;  4DR3 Q;  4PG3 A;  3IAY A;  4MNO A;  3MZ5 A;  1SRU A;  4MHE A;  2VQF Q;  2QA4 A;  4LAA A;  3KJP A;  2BDO A;  5GAG C;  2NYZ D;  1DOM A;  4R4O A;  2B2U A;  2B29 A;  5JEA G;  1VQ4 A;  4KD4 A;  3BZK A;  3ITP A;  2NUC A;  4CHT B;  1AE2 A;  2K5Q A;  3CAM A;  1Y8P B;  1HTP A;  2UUC Q;  3TZD A;  3NBI A;  2K03 A;  3KK7 A;  5ELN A;  1VQ6 A;  2K50 A;  1EWH A;  2B39 A;  1EIY B;  3A5Z B;  1YHA A;  4RGO S;  5IGC A;  4A3I B;  3PSI A;  2VB3 X;  2L55 A;  4JOI C;  1CTM A;  1BCP C;  4F87 A;  2UU9 L;  4YCV A;  5JEA J;  1Y1W H;  5CV9 A;  5EPK A;  3VYT A;  4QCL A;  1A63 A;  3CC2 A;  3L3O C;  2Y0S B;  1PTO F;  2IW3 A;  4HIM A;  1X3E A;  3KF6 A;  3HOZ G;  5CV8 A;  1SE4 A;  2E8G A;  2FIN B;  3L9A X;  5M5W H;  4C3I G;  3S1N H;  4AYB B;  4YHH Q;  1D5X C;  2JE6 I;  4ZQ3 A;  2IX1 A;  5C4X G;  1JWM D;  1Y1V B;  3WWV A;  3PO2 B;  4JI4 L;  2UUB L;  4DV4 L;  4P72 A;  2VZA A;  2RDF A;  2CKZ B;  2QKI C;  2JK8 A;  5I2X A;  2NVY B;  2E2J B;  4ZUI A;  1ZEQ X;  4A3J H;  1CSP A;  3ZYY X;  1VQE A;  1E2V A;  5CGK A;  2B63 B;  2I5H A;  2F0K A;  1NCV A;  2YTV A;  3PCO B;  4M1U B;  4X65 L;  3GTM H;  2R93 G;  2LS0 1;  3UDI A;  4DK0 A;  1KNE A;  1DJR D;  4JYA Q;  4O42 A;  3RLN A;  5KRU A;  3S9W A;  1KLU D;  1SJE D;  5AFW A;  2R92 B;  4KN4 C;  2F0Q A;  3D4W A;  4N8X 1;  2F0D A;  2EXZ A;  1P16 A;  1K8A C;  3D8G A;  2VW9 A;  4KK7 A;  4V0B A;  2Z8L A;  5ISR A;  2VB2 X;  1F9S A;  4DUY L;  4JI7 L;  2BE5 D;  1ENF A;  3PIO 3;  3CC7 A;  1R9T H;  1GXD C;  4X66 Q;  3QB3 A;  4B3T Q;  4WJ3 M;  4OEM B;  4OWW B;  2NVQ B;  4A93 H;  2K5D A;  1HH2 P;  3O13 A;  2Q8R E;  2NBF A;  3UDX A;  1FL0 A;  3S14 H;  3NSW A;  2B2T C;  4NXN Q;  2LFN A;  3HKZ B;  3PUW A;  2PYK A;  1HNW Q;  1MKH A;  1PXU A;  2XRQ D;  2YYZ A;  1D1K A;  2JA6 H;  1LT6 D;  2L4N A;  2Q8I B;  2UXB Q;  1FNU A;  3CC4 A;  4FXK C;  3RZO H;  4KHP L;  1TWG B;  1Y69 U;  1T5E A;  2K1B A;  4LK1 C;  4JV5 Q;  1EU3 A;  4Z9C B;  1D6E C;  1CKO A;  4KI0 A;  1PH1 A;  2HD3 A;  3S1R B;  4CJ2 C;  1SNO A;  2K01 A;  1RJT A;  1XWE A;  4DV1 Q;  4NB3 A;  1VMP A;  1TWF H;  4FNF A;  4QUC A;  2Q2T A;  2IX0 A;  1XPO A;  2Z4H A;  3R3O A;  1GD7 A;  1KRS A;  4A3K H;  2PI2 E;  4KY6 A;  2EDG A;  4QGU A;  2DN8 A;  3NHH A;  4EQP A;  3BG3 A;  3DLL A;  3HOZ B;  1QE6 A;  2WV6 D;  1PH3 A;  2F0E A;  3PIP A;  4C3I B;  3J7A V;  3FEW X;  5C4X B;  2JN4 A;  2K4K A;  3T53 B;  3I2Z A;  4A3J G;  4V19 0;  3AFQ A;  2CQA A;  3C2P A;  2VL6 A;  1I6H H;  5BN5 A;  2NN6 I;  4OHJ A;  1H9J A;  1Y8N B;  1B9M A;  4B3M Q;  4DF7 A;  4HCE A;  1C7Y A;  4PZ8 A;  1Q90 A;  5KEE A;  3BYT B;  5KGU A;  5LMU Q;  1W6K A;  2X69 A;  3GO5 A;  3SR1 A;  3S1M B;  5AJ3 L;  1S5D D;  4LFC L;  1VCI A;  3BYY B;  1YEZ A;  3VR3 A;  3UDF A;  4LF4 L;  1VQ5 A;  1I94 Q;  2EY5 A;  4K6D A;  1LT4 D;  2QF7 A;  1LAB A;  2UUA L;  1LTL A;  3K6O A;  1BDO A;  4IUN A;  4A93 G;  4CKB A;  1S4Z A;  2HUG A;  1FJG L;  1X6O A;  1HR0 Q;  3A55 A;  4AQY Q;  3OIP A;  2L1B A;  3TDQ A;  1Q3L A;  5CV7 A;  2EYL A;  1MBY A;  3MA2 B;  2E5L L;  2A5H A;  2QDL A;  2XRS D;  4HSP A;  2KHJ A;  4GKK L;  4C1N I;  1FR3 A;  1FVI A;  2IPK D;  2IL8 A;  4QL5 A;  1K28 A;  5ELC A;  1PTO H;  1K0R A;  3D0F A;  1SYE A;  2JA6 G;  3SK5 A;  1CQF A;  2J7Z A;  2JEB I;  3J81 j;  2UXD Q;  1HQM C;  4A3M H;  3I4N H;  2Z4I A;  2AQ3 B;  1TII D;  1VQH A;  3I90 A;  1CHP D;  3I4L A;  3TS0 A;  3K5N A;  1D5M C;  5LHY 1;  5E4W C;  1E2W A;  4E6I A;  1EUJ A;  3D6C A;  1MSG A;  2EY2 A;  1JOR A;  2LKV A;  4OX9 L;  4PNY A;  5C3X A;  4A3K G;  1KXL A;  3GTP H;  2CH4 A;  1UE7 A;  2ID0 A;  2E2D C;  1LT3 D;  4UP9 A;  4N9T A;  4X3T A;  1KNA A;  1WTH A;  1XMQ L;  2WII B;  5M5W B;  3S1N B;  5EAY A;  3U50 C;  1SNP A;  3F2B A;  1WD1 A;  4LF6 Q;  4MN3 A;  1TKW B;  2F0J A;  1LAC A;  1GUS A;  1SLJ A;  3KUP A;  3P7J A;  5CV5 A;  2M9V A;  4OIK A;  5ELB A;  4DXF A;  1OXT A;  2N55 A;  4DPG A;  4DR5 Q;  1I3Q H;  1XJV A;  3M4P A;  4QY7 A;  2E75 C;  2F0L A;  1QG7 A;  1QNU A;  3IL8 A;  2EZV A;  1PRT B;  1S5C D;  3GTM B;  1WJJ A;  1HUN A;  4FF3 A;  2K04 A;  1YVC A;  4K14 A;  3K7A B;  1NE3 A;  1VQP A;  1N33 Q;  1JQY D;  2NVX H;  5HUR A;  1U9R A;  1A8V A;  3J80 L;  3JAM E;  4C2M B;  3I3C A;  5JAV A;  2QGQ A;  4GZY C;  1PFB A;  2B2U C;  2ZJR A;  4F8M A;  4JI0 Q;  1SEB D;  4QUF A;  5GQO A;  2KHS A;  2MQH A;  1VQL A;  1QCB D;  4RCN A;  4GNX A;  4JI8 Q;  1RIP A;  4H7B A;  1PZJ D;  1O7Z A;  1ESF A;  5KYI A;  3VR5 A;  2JA8 H;  1Y14 B;  3F2C A;  3G48 A;  1GOZ A;  3TSS A;  1SYB A;  1S40 A;  5EBC A;  4RGT A;  3R8B A;  2FFK B;  2SEB D;  2L0C A;  4X64 L;  1WTR A;  4A3M G;  2YTX A;  4QIW E;  3I4N G;  1J9O A;  3NP8 A;  4XT1 B;  4FP5 D;  3A8K E;  3AYH B;  2H4O A;  1OTC A;  4L5S A;  4A3D B;  3A5U A;  2MHV A;  1CK1 A;  2HIX A;  2JA6 B;  1VQB A;  1STB A;  2MNA A;  3C3L A;  1QWY A;  4QB4 A;  3RZO B;  1IYV A;  1KL9 A;  4LFB Q;  1JE4 A;  1XX8 A;  1VQF A;  1MHW C;  4DR2 L;  1PH2 A;  5BN4 A;  4IO9 A;  3KOJ A;  1N32 Q;  4CBV A;  2EXD A;  2HDM A;  1B8A A;  3AMU A;  4A3I H;  1VQ7 A;  3K0Y A;  2B8F A;  4XXE A;  3S1Q B;  1EY9 A;  4HJ7 A;  3PV0 A;  4A3K B;  1L1O A;  4YY3 L;  3GTQ B;  4OO1 H;  1A6X A;  1EYA A;  3QO2 A;  3CMA A;  2DNE A;  2KED A;  1KDB A;  1BNZ A;  2LXK A;  5EBD A;  4MTK A;  5CBA E;  2BE5 C;  3PMF A;  1SR3 A;  5EPL A;  3T4A C;  3J81 c;  1A15 A;  1L2F A;  1Y1V H;  3CP0 A;  1KC8 C;  3PO2 H;  2K5N A;  1RDP D;  1XPR A;  4B3S Q;  3VYU A;  1VQJ A;  2KEE A;  4RMF A;  2PCF B;  3OTO L;  3FPP A;  1YNX A;  2Z1C A;  3X3N A;  4DAV A;  4DR7 Q;  2IY5 B;  1ROD A;  1YI2 A;  3H09 A;  3CCU A;  4RGN A;  4A3E H;  2N3S A;  1JOO A;  1RKN A;  3ERQ A;  1OXV A;  2AMC B;  5D65 A;  4L6T B;  2YU9 B; 
#chains in the Genus database with same CATH homology
 4L63 B;  1PMR A;  5A2Q L;  2R6G A;  4XT3 B;  1TQO A;  5EKI A;  2J4X A;  1L0Y B;  1LTA D;  4U67 3;  3DEO A;  4LMQ D;  3PUZ A;  3J7Y W;  1GHJ A;  1B50 A;  1A2U A;  2G9D A;  4NP5 A;  4K2L A;  1CM9 A;  2R61 A;  1F2M A;  4IZ8 A;  1PRT F;  2RVL A;  5I9O A;  3ONA B;  1WVL A;  1PTO B;  1TR5 A;  4A3M B;  3NWT A;  5J22 A;  3I4N B;  3GV6 A;  3CHB D;  5EKL A;  1HCZ A;  2WKD A;  2E74 C;  2A69 D;  2IJ0 A;  1EZ8 A;  4ME5 A;  2QEJ C;  2K28 A;  2EY1 A;  2K32 A;  2NN6 H;  3WDN A;  1BBX C;  1UUP A;  2K05 A;  4DAP A;  1Q12 A;  1DOK A;  1I4H A;  1VF5 C;  3QG1 A;  5EJW A;  5LL6 X;  1LTB D;  5CC4 A;  4XQJ A;  3K5O A;  4B9W A;  3V2T A;  1SNM A;  1FD7 D;  2F3W A;  3KLS X;  1DD2 A;  4CKE A;  4DNR B;  2NVX B;  2F3V A;  2A73 B;  4NW2 A;  5I4D A;  4BBS B;  2KQ3 A;  1UEA B;  3G7L A;  4I65 A;  1LV9 A;  4L8J A;  1FGB D;  1HA6 A;  3T13 A;  2ZT9 C;  1EQT A;  2BA1 A;  2AWO A;  4DAY A;  1NUC A;  2CW0 C;  2OT2 A;  1SNQ A;  2F4I A;  3TP8 A;  2F0P A;  2F0S A;  3MXU A;  1PYW D;  4F88 A;  2JA8 B;  1B53 A;  2C9O A;  4BA2 I;  2PW7 A;  3WOF A;  4K6L A;  1PLF A;  3HS0 C;  2G9H D;  1V8Q A;  5D14 A;  5I9P A;  3BDL A;  1AP0 A;  3I91 A;  2F0V A;  1TY0 A;  2WB1 B;  1CT1 D;  3ND8 A;  1OXX K;  2JEA I;  5IGG A;  1A3U A;  4FO2 A;  3OIQ A;  1JC7 A;  1B44 D;  4WFN 3;  1GUT A;  1ICW A;  1PZK D;  2PMZ B;  4TRD A;  1VDZ A;  3DWA A;  2NN6 G;  2A6E D;  2AQ1 B;  2F0O A;  3IFD A;  3GQB A;  5NUC A;  5JPN C;  1TWC B;  1SYD A;  1EY0 A;  2O2L D;  5CV4 A;  1G2T A;  2RDG A;  3VR2 A;  3TBI B;  2KCC A;  1EQV A;  5C4Z A;  1CQV A;  4C3J B;  4CJ1 B;  4G4K A;  2QCP X;  4A3E B;  1A3V A;  1HTL D;  5DNF A;  4QMG A;  3QOJ A;  1HUM A;  5FO9 B;  2WAC A;  3FKI B;  1K8M A;  3TN2 A;  1BCP B;  4RCO A;  1SJH D;  5M5X B;  4K8I A;  3OWE B;  3H0G B;  1D5Z C;  3LWU A;  2NZ1 D;  5C3E B;  2EVB A;  4U68 A;  5E1F A;  1GHK A;  3C46 A;  3IKJ A;  1WTQ A;  3N52 A;  1KDA A;  2AWN A;  1JIC A;  1CFM A;  4ID6 A;  1ESR A;  3S17 B;  3A8J E;  1LTG D;  3NQI A;  1M4V A;  1OXS C;  4JBW A;  3WOE A;  3S15 B;  3MWY W;  1G29 1;  5E3F A;  2F0G A;  3NE5 B;  1I50 B;  3M4Y A;  3QJY A;  2B2V C;  2A6H D;  3BDC A;  1W6J A;  4RAU C;  4B9X A;  4KHZ A;  3R2I A;  2LMC B;  3A7L A;  1JOQ A;  4EQO A;  2XVS A;  2F0H A;  5C44 B;  3V96 A;  4O1N A;  1H9S A;  4OGQ C;  2N88 A;  2PW5 A;  1HXY D;  1E0B A;  1TS4 A;  2EJF C;  2L11 A;  2JYO A;  3X3M A;  1EEF D;  2HDL A;  4NDX A;  3LWE A;  4XYQ A;  2E2I B;  1RF2 D;  1H9R A;  1PFN A;  4IFD J;  3OSO A;  5CMD A;  3K5M A;  1KAA A;  3DWP A;  5I6Y A;  5M3F B;  3HOW B;  3HGB A;  4TSS A;  1O78 A;  2WKC A;  2JA7 B;  3R2T A;  3NK9 A;  4B08 A;  1EIH A;  1WTP A;  1OXU A;  1I4X A;  2O5I C;  1EFI D;  2TSS A;  3T51 B;  2CHB D;  3NPP A;  1F2Z A;  3Q22 A;  4Y7N B;  3H91 A;  5D3D A;  2PPB C;  4IUR A;  1EY4 A;  4DXG A;  1ONL A;  5G3L F;  1LTI D;  4H0L C;  5I2Y A;  2B2Y A;  3FRP B;  4HMJ A;  2H1E A;  1SSO A;  4KV6 A;  1YNN D;  1IW7 C;  3DXJ C;  3J7A F;  4IQZ A;  1BCP F;  4KY5 A;  1JB3 A;  4J1M A;  3KF8 A;  3NWS A;  2WIN B;  4BY7 B;  2IT1 A;  1S5B D;  2A74 C;  4RHS A;  4RH6 A;  2AUJ D;  5C5M A;  3DM1 A;  3RMH A;  2NTS A;  3R93 A;  4R8I A;  1B2T A;  3QWN A;  2VNU D;  2F0I A;  4BY1 B;  3G6J B;  1WD0 A;  3GTJ B;  1DM0 B;  3PUX A;  1TS3 A;  4KD3 A;  5K36 G;  1LTS D;  2F0T A;  1A3T A;  2KUM A;  2SDF A;  2V4D A;  4IFD I;  3MC0 B;  2FMM A;  2GA4 B;  5CR3 A;  2NVT B;  4IUP A;  1MGS A;  3OHX C;  1E2Z A;  1ILP A;  2I46 A;  2SOB A;  2A6E C;  3BVM A;  5IOD A;  1SE3 A;  4G7H C;  2VXW A;  3I8Z A;  3J81 E;  3SK8 A;  1STA A;  1O7L A;  1MI2 A;  2IWH A;  1TWH B;  2HCC A;  1II3 A;  2EYM A;  1WTW A;  1X32 A;  1KAB A;  4A3B B;  2VUM B;  1Q8I A;  1Y8O B;  1S5F D;  1C8C A;  5C4H A;  2OXP A;  3TP6 A;  1GUG A;  1JOK A;  4RFB A;  5C4J B;  1LO5 D;  2CVR A;  5FK9 C;  3FMC A;  3ND9 A;  4IUT A;  2KCN A;  1GJX A;  1V1P A;  2KJX A;  3OMG A;  1B4O A;  2BCO A;  3HOY B;  2KOL A;  5EQ0 A;  5EPJ A;  4K5V A;  4PQX A;  1GUN A;  3GTG B;  2RDH A;  1HFG A;  2R7Z B;  3CKI B;  1V43 A;  4WRD A;  3L7Z C;  1C48 A;  3FDT A;  1FYC A;  1CHQ D;  5FO7 B;  2EYF A;  4I7Z C;  5DM6 3;  2SNS A;  2B2V A;  2K7V A;  3GV3 A;  2RSO A;  3TP5 A;  3U9S A;  5M5Y B;  4R9W A;  3IFT A;  2ENB A;  1DCZ A;  1STH A;  2MPM A;  4K2K A;  1TWA B;  2MP1 A;  1B9N A;  4FF4 A;  2MGS A;  1DXM A;  4KKU A;  1QOH A;  3H3V C;  1VMC A;  2A6H C;  4WJW A;  2Q8T A;  2RA4 A;  3HOU B;  3BZD B;  4QF4 A;  4QIW B;  3GTK B;  2IX3 A;  2TMP A;  5KNC A;  4A3F B;  4C56 C;  1IKL A;  2RBM A;  3TP7 A;  5FLX E;  4IUQ A;  1TT2 A;  2X6L A;  1X3Q A;  3RUZ A;  3MVV A;  3QOL A;  2ZXO A;  3RZD B;  1LT5 D;  2NB0 A;  3VYS A;  2MJ8 A;  1TVX A;  4DFA A;  4DU9 A;  5D3I B;  3I4M B;  4EQN A;  4XQN A;  4HSV A;  3NUC A;  2F1M A;  2EOT A;  3PUV A;  3Q24 A;  2JXM B;  3T56 B;  1SYG A;  1EL0 A;  1YNJ D;  1SE2 A;  4KMU C;  1CA6 A;  4CJ0 B;  2F0F A;  3GTO B;  3EJI A;  4HR7 B;  2FMC A;  3BVG A;  4G7Z C;  3W3A A;  5IT9 L;  5KYL A;  1HRJ A;  2PZU A;  4DGZ A;  1AFP A;  5C3W A;  2EYO A;  4KJN A;  3ERO A;  3OW7 A;  1D2B A;  1H9S B;  3H6M A;  4C3J G;  3Q23 A;  3PIP 3;  2RSN A;  1ENC A;  5F2D A;  4KN7 C;  1XYI A;  5JJZ A;  1ENA A;  5DAU A;  2J0T D;  1YNN C;  2B2W A;  3MHB A;  4XYO A;  1AZQ A;  5K5P A;  1AEX A;  3S2D B;  2WAQ B;  3W2D A;  1K83 B;  5T1I A;  1PRT D;  2B2Y C;  1QNK A;  1BOS A;  5J39 A;  3K58 A;  3A8I E;  4NMZ A;  2KEC A;  5KND A;  1VF7 A;  5FKA C;  2LY7 A;  5C6A A;  1TU2 B;  4YIJ A;  3A56 A;  1DYQ A;  3AU7 A;  2EE1 A;  3HRZ C;  5J1Z A;  4C3H B;  5IGE A;  1RTO A;  2EYP A;  1F9R A;  3TME A;  4ZLT F;  2XIW A;  5IGB A;  3MFG A;  4KJO A;  1STN A;  4K8J A;  1GUO A;  1CA5 A;  2X6G A;  1ZYR D;  1QB5 D;  1A2T A;  1SFO B;  3T16 A;  3EFX D;  5IGF A;  4HN7 A;  1AN8 A;  3M7G A;  1STY A;  2PO4 A;  4BWG B;  1U4P A;  5M3M B;  5CBE E;  1FNW A;  3CRK C;  3OWF A;  4ZKB B;  3PO3 B;  4IUU A;  3MEH A;  3OOC A;  2K6A A;  3OPO A;  1CI3 M;  2KVM A;  1SDF A;  1R4Q B;  2JP1 A;  5E4X A;  1STG A;  4PMW A;  1EY8 A;  5C0X G;  5EGT A;  1HQR D;  3D4R A;  2DY7 A;  3K59 A;  4IFD H;  2OF1 A;  1F2Y A;  4HCS A;  3CRL C;  4IUV A;  4G57 A;  2R3Z A;  1SAP A;  3HOV B;  1XXG A;  1JCK B;  4ODG A;  4X3S A;  1IL8 A;  2KA7 A;  5C0X J;  3VA5 A;  4UAI A;  1EYC A;  4KTA A;  3OMC A;  3HP3 A;  2A68 D;  1H9K A;  4XDX A;  1I4P A;  1RHP A;  1T5X D;  4FXD A;  3SVM A;  3DHQ A;  4OO1 I;  3NTI A;  5TSS A;  2K5W A;  2AQ2 B;  1SMY D;  2EPB A;  3KBX A;  1LTT D;  1RD9 D;  3M3Y B;  2ICE C;  2EJM A;  4M8A A;  1U4R A;  1SND A;  4CKC A;  5I6W A;  1B1Z A;  1BQQ T;  1B3A A;  4PMB A;  5CYU A;  3SDZ A;  2FHT A;  4EGV A;  1PTO D;  3GTL B;  4K5X A;  5M9O A;  4A3G B;  3LNN A;  3HOX B;  1UNS A;  3DWQ A;  2EYH A;  2M2L A;  4K5W A;  2PNR C;  3S16 B;  1PDQ A;  5JVH 3;  4H13 C;  3RLF A;  4IFD G;  1V1P B;  1PZI D;  3K57 A;  2FJ2 A;  5EKK A;  1SBB B;  4EVO A;  4TQU S;  1BR9 A;  2RQX A;  1EY6 A;  1S5E D;  5DEH A;  1M8A A;  5COR A;  1SXT A;  4ZUJ A;  2PZW A;  5K36 H;  3GP7 A;  4FXG C;  5ELF A;  4XTC S;  1ZXT A;  3C1E A;  3H94 A;  3DMU A;  1I6V C;  5BN3 A;  2QDB A;  3KBG A;  5C0X I;  1WTO A;  3HG9 A;  1F9Q A;  2HCI A;  2A69 C;  3D3R A;  1K8O A;  5ELD A;  2HQE A;  3M7N A;  4KKT A;  4LJZ C;  3QIA A;  1YNJ C;  1BUV T;  2M00 A;  1CZW A;  1H9M A;  1SYC A;  2XSC A;  4CGY B;  3P75 A;  3M85 A;  4F7X A;  1ML0 D;  1JWU D;  1EYD A;  1EY7 A;  2R93 B;  2DY8 A;  1JR0 D;  2L12 A;  3BS1 A;  2OEO A;  2EJG C;  3I73 A;  1G6Z A;  3VYR A;  1WTX A;  3P20 A;  4ULL A;  1L0X B;  3VR6 A;  4ZYS A;  1EZ6 A;  2E2H B;  5JOB A;  3NQT A;  1X3P A;  4DN4 M;  1I4Q A;  3URY A;  4P2C B;  3SK4 A;  3J80 E;  5KNB A;  5HGT A;  3BVZ A;  3MXP A;  1WCM B;  1EY5 A;  2F0U A;  3V05 A;  2ZXP A;  3NTK A;  3DUZ A;  4HAE A;  2O5J C;  2RKS A;  4RKB A;  1PRT C;  4X3K A;  1SNC A;  3E0J A;  2B2W C;  5COY A;  1KLG D;  4TKO B;  3Q6S A;  2CW0 D;  3NBH A;  1Y1W B;  2EYJ A;  4MIU A;  4FF1 A;  4ZK9 B;  3D6W A;  1HFN A;  4ILW A;  1RCV D;  1I4G A;  4JK1 C;  2BDN A;  2NWG A;  4RWS C;  1ZYR C;  2PZT A;  2WP8 J;  4C1N K;  1HA5 A;  1IHZ A;  2F0W A;  4RKL A;  3E5S A;  3EVQ A;  3SHL A;  4PMC A;  2F0M A;  3NXW A;  2ZXR A;  1JWS D;  4R8N A;  4G7O C;  4A3J B;  2XWB B;  5G3L D;  1TS5 A;  3D4D A;  5A35 A;  4OIJ A;  1F2L A;  4KHV A;  1IKM A;  4BBR B;  3D31 A;  1NAP A;  1EWC A;  3SK6 A;  5LL6 S;  3SXH A;  1BCP D;  3NTH A;  3MXG A;  1AW7 A;  3HZX A;  3KLR A;  1CZG A;  1TY2 A;  1ZKO A;  3LX0 A;  4XQQ A;  3TZU A;  1DOL A;  1O7Y A;  1WTV A;  4ABN A;  1R9T B;  1RTN A;  5KIX A;  3UI2 A;  4A93 B;  5ELE A;  1BO0 A;  5A2Q E;  3S2H B;  1EIG A;  1Q1B A;  5JPM C;  3S14 B;  1EU4 A;  4ZAI A;  1NSN S;  1HPC A;  1SYF A;  2XN9 C;  1KDC A;  4UDU C;  2A68 C;  1V1O A;  1KTK A;  4RA8 A;  3FPU B;  1OO9 B;  3BDO A;  2L9H A;  1ET6 A;  1SMY C;  4ZKC B;  4RHR A;  5IGD A;  1F9P A;  2F0N A;  4S3S A;  3JAM L;  3A54 A;  2B2T A;  1TWF B;  4NKL A;  2PQE A;  2L5T A;  4BS9 A;  5DM7 3;  4N9P A;  3J81 L;  4HED A;  3CQZ B;  4FF2 A;  2D2C C;  3AB9 A;  4WOR A;  1LLR D;  2NTT A;  1Z6H A;  4X3U A;  1DZ1 A;  1I6H B;  2SNM A;  1DON A;  4ZRZ A;  1PTO C;  1O80 A;  5IT9 E;  1UAP A;  2C5C A;  4XIG S;  3SE0 A;  4C3H G;  1NR4 A;  1Q1E A;  3EA6 A;  4H44 C;  1PFM A;  1BF4 A;  4J6H A;  4IAL A;  1U4L A;  5IIF A;  1IYU A;  1D1I A;  3K5L A;  5C5L A;  2BOS A;  2D62 A;  2ICI A;  1AZP A;  1U4M A;  4KY7 A;  3M4O B;  2MUY A;  3F2U A;  4RGM A;  3I72 A;  1Z7T A;  1MD2 D;  2K33 A;  3HEJ A;  1FNV A;  3FVQ A;  4DNT B;  3VR4 A;  3P1H A;  5FOB B;  2F03 A;  1HHV A;  3RD4 A;  3CU7 A;  5JEA H;  3MAQ A;  3PUY A;  1BXT A;  3MXN A;  5JVG 3;  1EOT A;  3GTP B;  4OO1 G;  3E6Z X;  1LTR D;  5C0X H;  1NR2 A;  2DNC A;  4Q0F A;  4DA2 A;  4IN3 A;  3I70 A;  1Z47 A;  4KKS A;  1I4R A;  1G8Z D;  3A7A B;  1QIL A;  2QIL A;  2EY6 A;  3MFY A;  2JA5 B;  4HTH A;  3EQL C;  1C4Q A;  4OL7 A;  5T1G A;  4FYD A;  2O4X A;  5CV6 A;  5FLX L;  1EEI D;  4HMI A;  3GD7 A;  3C1F A;  1J8I A;  1G2S A;  1I3Q B;  1IW7 D;  2XNA C;  4DK1 A;  2D9U A;  4BA1 I;  1QJO A;  5FO8 B;  2D5D A;  4Q5V A;  3Q0A A;  5IOC A;  1ILQ A;  3VA7 A;  3SEB A;  1STE A;  1TS2 A;  2B8G A;  3DEP A;  3KLS A;  4FVM A;  1MSH A;  2E76 C;  1GUW A;  1F77 A;  2I07 B;  2XWJ B;  2JSO A;  2AUK A;  3N6R A;  1ET9 A;  4J8Q A;  4PV1 C;  3MTS A;  3U9O A;  1R4P B;  1G91 A;  2BA0 A;  1XTC D;  3IAY A;  3MZ5 A;  4MHE A;  4LAA A;  2BDO A;  2NYZ D;  1DOM A;  2B2U A;  5JEA G;  4KD4 A;  3ITP A;  2NUC A;  4CHT B;  2K5Q A;  1Y8P B;  1HTP A;  3TZD A;  3NBI A;  2K03 A;  3KK7 A;  1EWH A;  2B39 A;  4RGO S;  5IGC A;  4A3I B;  2VB3 X;  2L55 A;  1CTM A;  1BCP C;  4F87 A;  5JEA J;  5CV9 A;  5EPK A;  3VYT A;  4QCL A;  3L3O C;  2Y0S B;  1PTO F;  2IW3 A;  5CV8 A;  1SE4 A;  2FIN B;  3L9A X;  4C3I G;  4AYB B;  1D5X C;  2JE6 I;  4ZQ3 A;  2IX1 A;  1JWM D;  1Y1V B;  3PO2 B;  2RDF A;  2QKI C;  5I2X A;  2NVY B;  2E2J B;  4ZUI A;  1ZEQ X;  3ZYY X;  1E2V A;  5CGK A;  2B63 B;  2F0K A;  1NCV A;  4M1U B;  2LS0 1;  4DK0 A;  1KNE A;  1DJR D;  4O42 A;  5KRU A;  3S9W A;  1KLU D;  1SJE D;  5AFW A;  2R92 B;  4KN4 C;  2F0Q A;  3D4W A;  2F0D A;  2EXZ A;  3D8G A;  4KK7 A;  4V0B A;  2Z8L A;  5ISR A;  2VB2 X;  1F9S A;  2BE5 D;  1ENF A;  3PIO 3;  1GXD C;  3QB3 A;  2NVQ B;  2K5D A;  3O13 A;  2Q8R E;  2NBF A;  3NSW A;  2B2T C;  2LFN A;  3HKZ B;  3PUW A;  2PYK A;  1PXU A;  2XRQ D;  2YYZ A;  1D1K A;  1LT6 D;  2L4N A;  2Q8I B;  1FNU A;  4FXK C;  1TWG B;  1Y69 U;  1T5E A;  2K1B A;  4LK1 C;  1EU3 A;  4Z9C B;  1D6E C;  4KI0 A;  3S1R B;  4CJ2 C;  1SNO A;  2K01 A;  1RJT A;  1XWE A;  1VMP A;  4FNF A;  4QUC A;  2IX0 A;  2Z4H A;  3R3O A;  4KY6 A;  2EDG A;  2DN8 A;  3NHH A;  4EQP A;  3BG3 A;  3HOZ B;  1QE6 A;  2WV6 D;  2F0E A;  4C3I B;  3J7A V;  3FEW X;  5C4X B;  4V19 0;  3T53 B;  2CQA A;  3C2P A;  5BN5 A;  2NN6 I;  4OHJ A;  1H9J A;  1Y8N B;  1B9M A;  4DF7 A;  4HCE A;  1Q90 A;  5KEE A;  3BYT B;  5KGU A;  1W6K A;  2X69 A;  3GO5 A;  3SR1 A;  3S1M B;  1S5D D;  1VCI A;  3BYY B;  3VR3 A;  2EY5 A;  4K6D A;  1LT4 D;  2QF7 A;  1LAB A;  3K6O A;  1BDO A;  4IUN A;  4CKB A;  1S4Z A;  2HUG A;  3A55 A;  3OIP A;  2L1B A;  3TDQ A;  1Q3L A;  5CV7 A;  2EYL A;  1MBY A;  3MA2 B;  2A5H A;  2XRS D;  4HSP A;  4C1N I;  1FR3 A;  2IPK D;  2IL8 A;  5ELC A;  1PTO H;  1SYE A;  3SK5 A;  1CQF A;  2J7Z A;  2JEB I;  1HQM C;  2Z4I A;  2AQ3 B;  1TII D;  3I90 A;  1CHP D;  3I4L A;  3K5N A;  1D5M C;  5LHY 1;  5E4W C;  1E2W A;  4E6I A;  3D6C A;  1MSG A;  2EY2 A;  1JOR A;  2LKV A;  4PNY A;  5C3X A;  2ID0 A;  2E2D C;  1LT3 D;  4N9T A;  4X3T A;  1KNA A;  2WII B;  5M5W B;  3S1N B;  1SNP A;  1WD1 A;  4MN3 A;  1TKW B;  2F0J A;  1LAC A;  1GUS A;  3KUP A;  3P7J A;  5CV5 A;  2M9V A;  4OIK A;  5ELB A;  4DXF A;  1OXT A;  2N55 A;  2E75 C;  2F0L A;  1QG7 A;  1QNU A;  3IL8 A;  2EZV A;  1PRT B;  1S5C D;  3GTM B;  1HUN A;  4FF3 A;  2K04 A;  4K14 A;  3K7A B;  1JQY D;  5HUR A;  1U9R A;  3J80 L;  3JAM E;  4C2M B;  3I3C A;  5JAV A;  4GZY C;  1PFB A;  2B2U C;  4F8M A;  1SEB D;  4QUF A;  2KHS A;  1QCB D;  4RCN A;  4H7B A;  1PZJ D;  1O7Z A;  1ESF A;  5KYI A;  3VR5 A;  1GOZ A;  3TSS A;  1SYB A;  5EBC A;  4RGT A;  3R8B A;  2FFK B;  2SEB D;  2L0C A;  1WTR A;  1J9O A;  3NP8 A;  4XT1 B;  4FP5 D;  3A8K E;  4A3D B;  2H4O A;  2MHV A;  1CK1 A;  2JA6 B;  1STB A;  3C3L A;  1QWY A;  4QB4 A;  3RZO B;  1IYV A;  1JE4 A;  1XX8 A;  5BN4 A;  4CBV A;  2HDM A;  3AMU A;  3K0Y A;  2B8F A;  4XXE A;  3S1Q B;  1EY9 A;  3PV0 A;  4A3K B;  3GTQ B;  4OO1 H;  1A6X A;  1EYA A;  3QO2 A;  2DNE A;  2KED A;  1KDB A;  1BNZ A;  5EBD A;  5CBA E;  2BE5 C;  3PMF A;  5EPL A;  3T4A C;  1A15 A;  1RDP D;  3VYU A;  2KEE A;  2PCF B;  3FPP A;  3X3N A;  2Z1C A;  4DAV A;  1ROD A;  3H09 A;  4RGN A;  1JOO A;  1RKN A;  3ERQ A;  1OXV A;  5D65 A;  4L6T B;  2YU9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...