1EIHA

Solution structure of the human chemokine eotaxin-2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQSCGDPKQEWVQRYMKNLDAKQKKASPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords EOTAXIN-2
publication title NMR solution structure and receptor peptide binding of the CC chemokine eotaxin-2.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eihA00
4HSVA 4IUTA 1MSGA 5DNFA 2B2UC 1WTPA 1IL8A 5D65A 5COYA 5CORA 2DY8A 5JJZA 4LMQD 1WVLA 1QG7A 1O7ZA 1F9QA 1X32A 3DEOA 3IFDA 3D6WA 5D14A 2L11A 4R8IA 1WD0A 1HRJA 1X3PA 3H91A 5CBEE 3KUPA 1MSHA 2HDMA 3I90A 2BDNA 4MN3A 5CMDA 2M2LA 4OIKA 1WTOA 2RA4A 1U4LA 4DN4M 3DM1A 1QNKA 1SSOA 2KOLA 4ZK9B 2L9HA 1DOMA 4IUUA 5CBAE 1G2SA 2K05A 2B2WA 1EQTA 1O7YA 1F9SA 4ZLTF 1ICWA 2NWGA 1G2TA 1RJTA 3KBXA 3TZDA 1KNAA 4ZAIA 1AZQA 1XX8A 1PFNA 1SAPA 1J9OA 2KEDA 2L12A 4HEDA 1CA5A 2N88A 1M8AA 2B2TC 1NR2A 5T1GA 1NR4A 2R3ZA 2K04A 3GV3A 4NW2A 1DONA 1HA6A 2JP1A 2SDFA 3MWYW 3P7JA 1NAPA 2B2VC 2FINB 1B3AA 1B4OA 2X69A 2KEEA 3FDTA 1ESRA 1NCVA 4XDXA 4CJ1B 2B2YA 3GV6A 3MTSA 1XYIA 3UI2A 2EPBA 1U4MA 2HUGA 1TVXA 1F9RA 1S4ZA 2JYOA 2X6GA 5E4XA 2X6LA 1HHVA 4QUFA 1O80A 1BF4A 1RHPA 1SDFA 2KVMA 2KUMA 1PFMA 1ILQA 4UAIA 4X3SA 1BBXC 1EIHA 3ONAB 3Q6SA 5EJWA 4X3KA 2FJ2A 4RWSC 4IUVA 1BO0A 5E4WC 5EPJA 3G7LA 2KECA 1WTQA 2XIWA 2EE1A 2FFKB 4IUPA 4ZKBB 2CVRA 2J7ZA 2RSNA 4XT1B 1IKMA 2MJ8A 4CJ2C 1LV9A 4XT3B 1EL0A 3HP3A 1AP0A 1G91A 1CM9A 1VMPA 4QUCA 1RODA 3LWEA 1KNEA 2EOTA 1EOTA 4RA8A 2K1BA 4IURA 1WTWA 2B2UA 1ZXTA 2IL8A 1ILPA 2N55A 4RAUC 1B2TA 1DZ1A 1RTNA 1DOLA 1X3QA 3IL8A 4ZKCB 2D9UA 3N52A 1A15A 2B2VA 1U4PA 1JE4A 4R9WA 2L1BA 2MP1A 1RTOA 4X3UA 1B50A 2HCIA 4X3TA 1WTVA 1WTRA 2K01A 4HAEA 1QE6A 5AFWA 1C8CA 1GUWA 1PDQA 1Q3LA 2B2YC 3FPUB 3I91A 2HCCA 2K28A 2H1EA 1MGSA 3I8ZA 4IUQA 3SVMA 4OIJA 3F2UA 4CJ0B 3I3CA 2Q8TA 2MGSA 1DOKA 1HUNA 1EIGA 1BNZA 4HCSA 5EKIA 1HFGA 2L4NA 2NYZD 2B2WC 1PFBA 1VMCA 2HDLA 2VXWA 5EQ0A 4U68A 1F2LA 2B2TA 2NZ1D 1J8IA 2K03A 1F9PA 5EPKA 1HUMA 1MI2A 4O42A 2MPMA 4MHEA 5T1IA 3R93A 2FHTA 1CA6A 1PLFA 1JICA 1B53A 1HFNA 1E0BA 2RVLA 1WTXA 3QO2A 1WD1A 1AZPA 2RSOA 3TN2A 2DY7A 5EPLA 1U4RA 1IKLA 1G6ZA 3DEPA 2FMMA 1ML0D 2Q8RE
chains in the Genus database with same CATH superfamily
2E2IB 4IUTA 1XMQQ 3CCLA 2UUCL 3J81j 1XPOA 1E24A 3SXHA 3K5LA 3IAYA 2LKVA 4A3JB 2K5DA 4ILWA 2UU9Q 1X3FA 3VR2A 1Q86C 1D1IA 3ND8A 3CC4A 2K4KA 1JJCB 3BYYB 4IJHA 3M85A 4RFBA 3QJYA 2K5VA 1V1PB 3WDNA 1STGA 2JA6H 2F0EA 1HZBA 1UWVA 4JBWA 4HMJA 2L12A 2KEDA 5M3FH 4L5QA 1NR4A 2BDOA 2VZAA 2EXZA 1YNNC 1MBYA 1CHQD 3J80c 3CC2A 2FINB 1G291 1HZAA 3DWAA 3M3YB 5EAYA 3WOFA 2RCFA 2F0FA 4QIWB 3W2DA 4K6DA 4KMUC 2FMCA 4X64L 4BBRH 1LM0A 5IT9E 1O7IA 5C0XJ 3Q6SA 3RN2A 3T1HQ 3SDZA 1JB3A 5CYUA 3S14H 3M4OH 3HP3A 3PMFA 4UP7A 3W3AA 3LX0A 3CC7A 2ICIA 2R7FA 2I5HA 1PH3A 2B2UA 4I7AA 1C9OA 2PI2A 3K5NA 4JG2A 1IL2A 2LXKA 4L63B 2L1BA 4X3TA 1TKWB 3S1NH 1WTRA 5I4DA 3K57A 4G7OC 2M9VA 4J15A 2JA7G 1KRSA 1I4QA 4JVZA 1EWIA 1CKNB 2OT2A 1QILA 2UXBL 1B1ZA 2F0LA 2KCTA 3I3CA 5NUCA 4RH6A 4CKBA 4DR2L 3J81i 2UUCQ 2KHSA 5LL6X 4DV0L 4MZ9A 2BH2A 2F52A 1BUVT 1P8LA 4EQOA 3PF5A 1W2BA 2EVBA 1SMYC 2FHTA 1OXTA 2F0IA 4DV7L 5I2XA 3FPPA 3PUWA 2JA5B 3AEVA 3BG3A 4C2MH 1CSQA 1TWAB 4OO1H 5KRUA 5D65A 3X3NA 4DPGA 3RD4A 1WI5A 1ASYA 1X32A 5KIXA 4EQNA 2R7ZB 3OMCA 1X3PA 1JWUD 2XRQD 3MXUA 1KDBA 2M2LA 1S72A 4B3SL 1WCMG 2NVTH 2G9HD 4J1MA 5C0XG 1ZYRC 4DR5L 1F9SA 2DJFC 2FXQA 5JEAJ 5H1SE 1FGBD 4X64Q 2SOBA 4PMBA 4BY1B 4ZAIA 1IBKL 1EZ8A 3T53B 3A0JA 1N36L 2ENBA 4A76A 3M4QA 3A8JE 2B2VC 3GTOH 1B4OA 1NCVA 3J81E 1I94L 1IBML 3HOUB 3HOYB 1J5EL 3TP6A 1K83B 1LTRD 1KTKA 1SMYD 4BY7B 4OO1I 1IW7C 2WKDA 3V96A 1EEFD 3SEBA 4DAPA 4LFBL 2GN5A 3M4PA 1EYGA 2O5JC 5ELOA 5IYDH 1CFMA 1UE6A 2A73B 5DM73 4L6TB 2F1MA 1PV4A 1RF2D 1V1QA 2RSNA 2EYJA 4RMFA 1C4QA 4CDFC 4Q0FA 4N9PA 4NKLA 2QDBA 1U0LA 2UXBQ 4A3LH 1PRTC 4DR2Q 3S1MB 3CRKC 2JK8A 4DV0Q 1X56A 3GTGH 3S1QB 1ZYRD 2EZVA 1L0YB 1SFOH 1JOQA 4UP9A 4TRDA 1LT6D 3QOLA 5IE8A 4EQ5A 4DV7Q 1SR3A 3I73A 3NENA 4A3BB 3W1GA 3U9SA 5M5WB 3FKIH 4OIJA 1HQRD 1UEAB 3CQZH 5EBDA 5EKIA 2BA0A 2B2WC 2C35B 5M5XB 1STBA 2Z6KA 1EY0A 3J7A5 3MFYA 2B2TA 2WB1B 1IW7D 3T56B 3PIO3 4BBSB 1S5DD 3RLFA 5JEAG 1UE5A 3S24A 3HOXH 1DD2A 3CF5A 1HH2P 4MHEA 4B3SQ 5I6YA 1K28A 1HXYD 4R4TA 4DR5Q 1GKHA 3FEWX 3G4SA 3W5OA 2Q8RE 5IGGA 2HIXA 1IBKQ 5A2QL 4B3TL 2NN6G 1PH5A 4DAYA 3K5OA 1PRTD 2I07B 3BZDB 4A3MH 1HRJA 2MUYA 3FMCA 3K7AB 1PH7A 1E2VA 3NSWA 5IWAL 3NPPA 4OIKA 1BQQT 2RA4A 1Y8OB 4IN3A 1NSNS 1I94Q 2KOLA 2LXJA 3CCQA 1IBMQ 1XNQL 1J5EQ 2NVXB 4R4IA 1V1OA 1A6XA 2B63B 4ZLTF 1O7YA 4F7XA 1HCZA 1ZKOA 4LFBQ 5KGUA 1B3QA 4LF6L 3UDIA 3CP0A 2MQHA 2PZUA 3T13A 4A3DB 3I4NG 3MTSA 5F2DA 4IPGA 3S9WA 2QW7A 1S4ZA 5AJ3L 3MXGA 4NXNL 1SE8A 4KHZA 1K8MA 5CV5A 2DUDA 2DNCA 5EGTA 4CDDC 4HIMA 4JI4L 2RHSB 3KLSA 4ME5A 1IYJB 1JR0D 5KNDA 2MNAA 2FFKB 3D4RA 4QQBX 4DUYL 2MJ8A 3K80C 5TSSA 2PPBC 2SEBD 2A74C 5IYBH 2R61A 3RR5A 5FO8B 2K1BA 4A3FB 4JI1L 1ILPA 4LF8L 4IOAA 2B2VA 2VQEL 3G48A 1RTOA 1I3QB 2Q8IB 3HKZB 4POGA 2B3GA 3WOEA 3HEJA 5CV9A 4HJ9A 2E8GA 1QCBD 2NTTA 1GUTA 4HCSA 5LHY1 3MAQA 1VQ8A 3VYTA 2N78A 3A56A 4GOPC 2NZ1D 5EBCA 5IGEA 1TY2A 1XMOL 5IWAQ 2JJQA 4EX5A 1H9SA 1XNQQ 1KLUD 2QKIC 1JICA 4K2KA 2WACA 1W6KA 4KN4C 1VQHA 4LAAA 2VQFL 4A4IA 3DEPA 1STYA 1E7ZA 5IYDG 1E1OA 3TP7A 4QF4A 3A55A 3ULJA 2DY8A 5C5LA 2JA6B 4LF6Q 3DMUA 5M3FB 3MHBA 1QNUA 5CV8A 2L11A 5CBEE 3OWEB 4A3LG 3VR4A 1K0SA 3I4OA 1BBWA 3ERQA 1TWGB 4JOIA 3HOWG 1L1OA 3LNNA 2B2WA 2AQ3B 4GLVB 5AJ3Q 2ASBA 1ICWA 3EBEA 4OWXB 4NXNQ 2NWGA 2CHBD 1MJCA 1LTBD 2NBFA 4JI4Q 4G7HC 4BBRB 3FKIG 5K5PA 3JC66 4M1UB 2EJFC 1NAPA 4JI8L 4CJ1B 3FDTA 3G6EA 3BDOA 4DUYQ 1QZHA 3URYA 2EY1A 3GP7A 3S14B 3M4OB 3A5ZB 1UE1A 4JI1Q 3HOXG 2LFNA 4IQZA 2KUMA 1OXSC 1K3RA 3NQTA 1H95A 2VQEQ 4DGZA 4G7ZC 2JE6I 3RLNA 1Q7YC 5EPJA 3I2ZA 2L55A 4HMIA 3S1NB 3EFXD 2NTSA 4ZKBB 1VQFA 1EFID 5IGFA 2AWOA 2CFMA 2EYMA 4DAYB 1KNEA 3T1YL 1K8OA 2R93H 1VF7A 1XMOQ 4RHRA 4I7ZC 5GADC 3K81C 1B50A 2Q2TA 3OOCA 3ULPA 3CMEA 2DJGC 1DYQA 2QGQA 4R4QA 5C5MA 2VQFQ 4UP8A 1B7YB 3DXJC 1SYFA 4WJWA 2NVYH 4GZYC 3CAMA 1DOKA 2PQAA 1EU3A 5E1FA 2QILA 1VMCA 1YNXA 4U68A 5C3XA 1Y8NB 4X66Q 4KY6A 2CWPA 4B3ML 2MPMA 4R4CA 4HJ7A 1AW7A 1BKBA 1ET9A 1XPUA 3CD6A 2RSOA 4A93H 2NVTB 3S2HH 3GDEA 1YNJC 2QA4A 1PH9A 2HD3A 1IL8A 2VUMH 5COYA 5GROA 5IT9c 3RZOH 2PCFB 2F4VL 5IYBG 3CCVA 1ICFB 3CXCA 4DFAA 1MSHA 4JI8Q 3OWFA 1GUGA 4Z9CB 1QVFA 3GTOB 1DOMA 4IJLA 1HZ9A 4CGYB 3RN5A 4GOPA 4IPCA 1KNAA 2EIFA 2QEJC 1FNUA 2BCOA 3SK4A 3A74A 1VQKA 1KAWA 3UDFA 5ELEA 4O1NA 1HA6A 1NMFA 4LF4L 4CDCC 1AZPA 1PXUA 3S16H 2ZT9C 3EROA 3T1YQ 4QUFA 1IBLL 4UDUC 1S3OA 3OYYA 1H9SB 1SYEA 1PRTB 3NTKA 2PMZB 4IUVA 1I4RA 1SLJA 5C4XG 4IPDA 5GQOA 4F8MA 1IXRA 5M3MG 1NJIC 1AFPA 5C4ZA 3GTPH 4K14A 4XT3B 3GTLH 1EOTA 1EUJA 3MC0B 1DXMA 1B2TA 1XTCD 1JWSD 4ZKCB 1A15A 4B3MQ 3GTKH 4X3UA 3GTMH 1Q81C 1L1OB 1RDPD 3DWQA 3CCRA 4GNXC 4JCVE 3HOXB 1A3UA 4IALA 1SYCA 1HTPA 2H4OA 1VQJA 4EGVA 3C1FA 5FO7B 4HJAA 1X9NA 2A19A 4JPBW 3KLWA 2F3VA 3K7UC 2IX3A 1M90C 1AN8A 2D0PA 2F4VQ 3AYHB 5A35A 3VR3A 1EYCA 3CCEA 1WCMH 1V9PA 1F9PA 2CQAA 5C0XH 3HG9A 4A3MB 1PFSA 4DR6L 3R3OA 4C3IH 3J81c 1HA5A 2RBMA 2XN9C 1VQBA 3NP8A 4A3IH 1WD0A 4LF9Q 1MSGA 2ZJRA 2XGTA 4ME3A 1GM5A 1F2YA 4DR7Q 3MEFA 1Q82C 2Y0SG 1SMXA 1Y8PB 3HS0C 1AH9A 5CC4A 3GO5A 4X65L 2RDHA 4LF4Q 1K0RA 2HIVA 1ENCA 3R2TA 4KK7A 1EYDA 3MXPA 5C44B 1I4XA 1QNKA 5LMNW 4JI5Q 2R93G 2EYPA 4C3HB 1Y1VB 3NK9A 3C46A 1N33L 1G2TA 1IBLQ 3EA6A 3EJIA 5ELCA 1VQGA 4XIGS 1J9OA 4RGTA 2A5HA 1GUNA 3D4WA 3PIPA 1NR2A 2A68D 2XTIA 5C0XI 1SNPA 1H9RA 3MWYW 4E6IA 5I9PA 4XDXA 1KABA 2UUBL 3STBD 3GTJB 2PQAB 4C3JG 1Y69U 1U4MA 3CPFA 3RLOA 1X54A 3J7ZC 5CGKA 3Q8DA 2IHFA 5C4HA 1S5ED 2O5IC 1TWHB 4LFCL 4UAIA 4F87A 2K5QA 2OF1A 3QWNA 4QL5A 4GKKL 3HOZB 1N34L 3MVVA 4A93G 1KXLA 3A8KE 4B3RQ 3HKSA 4AQYL 1OXVA 4ULLA 2VUMG 3TS2A 1TWFH 1BOSA 1LV9A 1EL0A 1YJNA 1R9TH 3DUZA 1RODA 4LWCA 1HR0W 4JI3L 2IL8A 1PZID 1ZEQX 2Z0SA 3HOVH 1GUOA 5JEAH 4LK1C 1U4PA 3QR8A 1R4QB 1SN8A 5LMUQ 4PQXA 1WTVA 4DR6Q 1LACA 2F0WA 2JSOA 4KJNA 2I5LX 5E3FA 4GOPB 3RNUA 1TT2A 1YHBA 4DV2L 2Q2HA 2LSSA 1YITA 1GHJA 2NN6H 3CKIB 3L2PA 2R7DA 2L0CA 3A7AB 1XPRA 1JT8A 2XWJB 4QJFA 2RDFA 1KDCA 2E2HB 2OQ0A 4WJ3M 4NPSA 3T16A 4X65Q 2BA1A 2E74C 4JK1C 4N8X1 1SNQA 1EY9A 3K0YA 4LFAQ 5C3WA 1WTXA 3H0GG 5GAGC 1SE2A 1N33Q 5BN5A 4L5RC 1H9MA 2YTVA 4APVA 5DNFA 3I70A 1YNND 2F0OA 1SNOA 1A2TA 2CQOA 1YBYA 1TY0A 1VQNA 2ZTEA 4KD4A 5C4JH 3A7LA 3I4NH 2BDNA 1DM0B 1E22A 4GN4B 3JAML 1U4LA 3VR5A 4DN4M 2I46A 3DM1A 2AKWB 4EQPA 2JA9A 4N9TA 1FNVA 2L5TA 5FJ8G 2NN6I 4H7BA 4LFCQ 1MD2D 4A3GG 2WFWA 1V43A 3GD7A 4GKKQ 1N34Q 1P16A 1SE3A 2KBNA 5M5YB 4FF2A 1PTOF 3DHQA 4AQYQ 3BVGA 2R92G 4JI2L 4KJOA 2B2YA 4C56C 2HUGA 1HNWL 1GHKA 4JI3Q 1K3BC 3A5UA 2X6LA 3UE1A 2EY6A 1EIFA 4LF7L 1JJGA 4C3IG 5JJLA 2WAQG 3NEMA 1BDOA 2K33A 4AYBG 3SR1A 3VA7A 4A3IG 4RWSC 5EKKA 2NB0A 3OIQA 4HIKA 3L3OC 4FXDA 1JC7A 2F0MA 2QDLA 4DV2Q 3G71A 1A62A 1AP0A 4DK0A 1VMPA 4FP5D 2EOTA 3J7YW 4IURA 1TIID 2NVYB 1DZ1A 4RKLA 3MA2B 4QIWE 4YCWA 4DNIA 3D0FA 2F0VA 3N52A 2I5MX 4B9WA 4WORA 4ZCKA 4P72A 2HQLA 3TP8A 1C8CA 1I6HB 3KF6A 1GUWA 2A6EC 3E0JA 3FPUB 1VF5C 2K28A 4KHPL 3GTQB 2NVQH 4K5XA 4XYOA 2Q8TA 3S2HB 1OTCA 2QEXA 4PV1C 4MNOA 1XWEA 3UE0A 1NY4A 5IY0A 4WFN3 5CV4A 2PW7A 3NWTA 4KV6A 4DF7A 2VNUD 4GS3A 1F2MA 3HOWH 1N9WA 1B53A 1EWCA 1WD1A 2BE5C 2F0TA 4KTAA 5FLXc 1II3A 2DY7A 3U4VA 4DR4L 1AEXA 1Q12A 4HTHA 4PG3A 1EYAA 1J6QA 4KKSA 4GLXA 3MXNB 1LLRD 2E75C 5D14A 3S15H 3H91A 3M9BA 2MO1A 2EY5A 1WTOA 2Y0SE 1BCPF 1EU4A 5HY6A 3HOVG 1CI3M 5CBAE 1EY8A 4QGUA 5EKLA 1EQTA 3U9OA 1RL2A 3PUZA 2A6ED 3E9IA 4YWKA 1RJTA 1X55A 2JN4A 3KBXA 3FHWA 3K58A 1AZQA 2O2LD 4I65A 3PUYA 5CR3A 3X3MA 1TS2A 4A3CH 1SEBD 2LY7A 1EFWA 3OW2A 2JA7B 3M7NA 1N36Q 2HT1A 4K8IA 4NMZA 1D6EC 3GTPB 4XXEA 5FO9B 1BXTA 1O7LA 3ICEA 2BE5D 2AUJD 2ATWA 2KENA 3S2DH 1FR3A 2EJMA 4YY3L 1JORA 4JC0A 1LTAD 2DN8A 3AB9A 4J6HA 4A3EG 4LW1A 2CVRA 5DM63 4KHPQ 4OWWB 2RCNA 4C1NK 4ZUJA 4GNXB 1A2UA 1B70B 2E2JH 4K0KL 1PH6A 1DOLA 4JBMA 2JEBI 3SE0A 5GAHC 3PUVA 4RGOS 1JE4A 2A6HC 4BA2I 3QOJA 1PHJA 1WCMB 1QVCA 1JWMD 5JPNC 4WJ4A 3CHBD 1HQMC 2RDGA 1ET6A 1NNXA 1JOOA 1VQOA 3BVZA 2F0SA 1HJPA 1EIGA 1HFGA 2P5ZX 1NE3A 4DR3L 2OTJA 5IGDA 1VQIA 2Q2UA 1D5XC 1LT5D 4QMGA 1CKOA 3NUCA 2WP8J 1ASZA 1IYUA 1WTHA 5T1IA 2N49A 5JJKA 4K8JA 1C7YA 3NQIA 4NB3A 1QZGA 4QCLA 2ALYB 2F0JA 1ML0D 1VQLA 4P71A 1U5KA 1FVIA 2EY2A 3RZDB 3IFDA 2IJ0A 4B3TQ 1Z9FA 1NBWA 3KUPA 1IZ6A 2F0PA 5G3LF 1L0WA 4JYAL 2Z4HA 4AH6A 2NZOA 3H3VC 1SJED 2A6HD 4YWMA 1G2SA 3P1HA 4O2DA 3H3VH 1STNA 2OXPA 4GKJL 1C0AA 1CT1D 3S1RH 1GD7A 1PFNA 4YY3Q 2EYOA 3M3YH 5C4XH 1M8AA 3KF6B 4GLAC 3ZJYC 2K04A 1EY4A 5M3MH 3GV3A 4KHVA 4L5TA 5BN4A 2A8VA 2SDFA 2B8FA 3KBGA 4LNQA 4FO2A 3K8AA 1FL0A 3QG1A 1TWFB 4XQNA 4DR1L 2A69C 4JI6L 2G5DA 1TWCH 4BWGB 4K0KQ 2SNSA 4JBKA 4P75A 2KVMA 1OXXK 4OL7A 5C3EG 2AHOB 5KEEA 2GVAA 2RQXA 1MIUA 5FKAC 1HZCA 5IP7H 1XTDA 1VQ4A 1X3EA 2WAQE 1PZKD 5ELDA 4AYBE 2ZJPA 1B8AA 5IP9G 1F2ZA 4MTKA 3H3VI 3J80L 4RA8A 1JMCA 5KYLA 1CHPD 5FLXE 1L0XB 4DR3Q 3KYHC 1LABA 1RTNA 2F0NA 4XYQA 2D9UA 4DKAC 2MP1A 4LF8Q 1CQVA 3BVMA 2EYLA 4OELB 4HAEA 1CKMA 2VS1A 4XQQA 3TREA 2UXDL 5JVH3 3P20A 4AIMA 2AUKA 1KQSA 2F0HA 1YI2A 1KHIA 2C9OA 4A3CG 2MGSA 1HUNA 1D1KA 4PZ8A 5CV6A 1H9JA 2ID0A 4R1JA 2VL6A 1RCVD 5EPKA 4JYAQ 5C4JB 1CA6A 2PQEA 3I4NB 2M00A 3I4MG 1T9HA 4UPAA 4NDXA 4GN3B 4TVAB 2KJXA 3I91A 4G4KA 2JA8G 3CPWA 1UUPA 4C2MB 1JE5A 3DEOA 1Y1WG 3TZUA 4C3JH 1OXUA 1SSOA 4DR1Q 1B44D 3PO2G 2K05A 1YJ9A 1NMGA 4K6LA 4IZ8A 4A3KG 3U58A 3D8GA 1LTID 3C2PA 1JCKB 3HOYH 1K83H 4DV5L 4CKCA 1EQRA 4BXXH 4O42A 2TMPA 2KEEA 4F88A 2Z9HA 1QOHA 1Z6HA 1XYIA 3K59A 1TVXA 2QCPX 3E0EA 5KNBA 1STEA 2YU9H 1QVGA 1RHPA 1SDFA 1PMRA 3T51B 3MFGA 2J0TD 5LL6S 2MO0A 3OHXC 4HJ8A 1PA6A 1SROA 5E4WC 3AMUA 4A3JG 2UXDQ 4MTNA 3S1MH 1JB7A 2XNAC 1QJOA 5FK9C 2I0QA 3I56A 2CH4W 3M4YA 2IHEA 5J1ZA 3TBIB 4DK3C 2XSCA 3GQBA 3J7AV 4A3BH 4IFDJ 5LMNL 3OTOL 5JPMC 1UEBA 3H0GH 3JAMi 3GTGB 2JEAI 2F0GA 3HOWB 1SFOB 1YNJD 1Q3LA 1SRUA 5M5XH 4DK1A 1VQPA 3F8TA 1GUSA 2PNRC 4BBSH 1B9MA 1S5CD 1D5ZC 2VB2X 1M1KC 1BNZA 4R8NA 5BR8L 1XJVA 2VXWA 3FKIB 3S17H 2MHVA 3CQZB 2DNEA 4YCUA 1HUMA 3S15B 2Z6BA 3E3XA 2IY5B 4FDBA 5FJ8H 1E0BA 3QO2A 1GVPA 2V1CC 3C3LA 4ZYSA 2LS01 4A3GH 3U4ZA 5FOBB 4RKBA 1IKLA 3I8ZA 5IP7G 2B2UC 1TS5A 2CKZB 1WVLA 1RIPA 2CW0C 4BS9A 5KYIA 2R92H 3D6WA 4DV5Q 1G6PA 2B63H 3I90A 1Z47A 4DV4L 3DM3A 4MN3A 5KNCA 1Q1EA 1HR0L 3H09A 2RF4A 4IUUA 1PVOA 1PH4A 3TRZA 1PYBA 2OEOA 4Y7NH 2VB3X 2Z1CA 4RG1A 1I4PA 1X65A 2WKCA 3JAME 4HEDA 3EQLC 2LMCB 5T1GA 1RKNA 5GAEC 4PMCA 4PNYA 1XXGA 1E1TA 2D62A 1FJGL 4NW2A 4X6AH 4DAMA 2TSSA 3GV6A 2AQ1B 2ZJQA 1CUKA 1D8LA 2JA5G 4FF3A 2DGYA 3N6RA 1ONLA 3KLSX 3Q22A 1YIJA 1N32L 4DU9A 4JI0L 4DAVA 3ONAB 1W3SA 5LMNQ 3OTOQ 5IIFA 3KDFA 4B08A 2FJ2A 1S40A 2CH4A 3D31A 3G7LA 2R7ZG 3T4AC 1Z7TA 4A3FH 1FYCA 2CW0D 3U50C 1SNCA 1WJJA 3LWEA 4IUNA 5BR8Q 4DV1L 1AE3A 1X3QA 4BY1G 1T5EA 4G57A 2WIIB 4R9WA 4YIJA 4RGNA 2K14A 3TSSA 2K01A 1WOCA 4PZ7A 4Y52H 2PMZE 3D6CA 1VQ9A 3V2TA 1PYWD 4IUQA 2K75A 2D5DA 4FVMA 5ELBA 3HOYG 3HOUG 3MXNA 1D7QA 1MHWC 2K6AA 2KHJA 4BY7G 4BXXG 1MKHA 3I72A 1VCIA 3TEHB 1EQQA 3BDLA 1LTLA 1BR9A 2IW3A 2SNMA 2YYZA 4DV4Q 1HR0Q 2CWAA 4FXKC 4LUZA 3R93A 2RVLA 1S5BD 1QWYA 4XTCS 4P2CB 5HGQA 1U4RA 1U9RA 4JI7L 1CSPA 2PNHA 1SYDA 3VDYA 3KFUA 4O0AA 3PO3H 1TWGH 4PZ6A 1L2FA 3S1RB 3AFQA 1FJGQ 3SGIA 5C4XB 2UUAL 4K5WA 5M3MB 4J8QA 4DUZL 1BVSA 5FLMH 3O13A 4HN7A 4A3BG 3UDGA 4C1NI 1N32Q 1ENFA 1Q90A 1B9NA 1TWCB 4JI0Q 1I50H 1XX8A 2EJGC 2Z6KC 4YCVA 2B2TC 2IWHA 2D0OA 3D4DA 1FGUA 4A3EH 2WB1G 4BBSG 1EY7A 1KDAA 4GNXA 1KC8C 1H9KA 2X69A 3SK8A 2Z8LA 4DK6C 3NTHA 3ITPA 3KOJA 4DXFA 5E7NA 3K5MA 2UUBQ 1KD1C 4DV1Q 5A2QE 1PFMA 3PIP3 4X3SA 3NELA 4H0LC 1LYLA 1KL9A 1BO0A 3NBIA 4L8JA 4XT1B 1K8GA 4FXGC 4OGQC 2B63G 3RUZA 3J7AF 2KQ3A 4OHJA 1G51A 4RGMA 2Y0SB 3L9AX 3SK6A 3VR6A 1PTOC 3PIOA 2KCNA 2R93B 4A3DG 1A63A 1I6VC 2F0KA 3SVMA 4JI7Q 1MGSA 1I5FA 1PTOH 4M8AA 3M7GA 1FD7D 1TS3A 5I6WA 1X6OA 2L4NA 4R4OA 3V05A 3A54A 1G8ZD 2K5WA 2UUAQ 2K03A 4S3SA 1SBBB 4HR7B 1VQ7A 3F1ZA 4DUZQ 1PLFA 2O4XA 1HFNA 4C3JB 3NBHB 3CW2C 1UAPA 1YHQA 2BH8A 4OONA 3DLLA 1G6ZA 4YHHL 4IOCA 2B39A 2B29A 1VS0A 2QF7A 3KJPA 3KDFB 2ES2A 4A3FG 5JJZA 1O78A 4B9XA 4KN7C 4A93B 3PV0A 4DV6L 4CDEC 2KHIA 3RMHA 1VQMA 1EEID 1QB5D 2YTXA 2VUMB 2XVSA 4OWTB 3E5SA 2EYHA 3HKZG 3RZOB 4TQUS 1K73C 1LTTD 1PRTF 3BZKA 3D3RA 4PMWA 3CU7A 2XRSD 3ND9A 3J80i 1PTOD 3BU2A 3CCMA 3TDQA 5C3EH 1LTSD 4LF5L 4K2LA 4OEMB 2YU9B 1VQ5A 2R3ZA 3PSIA 1TS4A 1STAA 1C48A 4DXGA 1EY6A 2JP1A 2RHQB 5DAUA 5IT9L 3HGBA 5IP9H 1G91A 3Q23A 1JOKA 4JI2Q 1F9RA 2J4XA 1WFQA 1NUCA 4RCNA 1HNWQ 1EIHA 3TS0A 1ILQA 1R4PB 2ZXRA 3S16B 4ZQ3A 4LF7Q 2OWOA 3VA5A 2JA6G 2EDGA 4X3KA 1UE7A 3BYTB 5M3FG 1E2ZA 1WTQA 4IUPA 5HURA 3H0GB 2IX0A 4JOIC 1IKMA 3PO3G 2VY3A 4A75A 1L1OC 1BCPC 3HRZC 4OXPA 2EYFA 1SYBA 2L15A 3EVQA 2N55A 3GTLB 3E9HA 5FLMG 1LT4D 2UXCL 3I4MH 4BBRG 3S17B 5AFWA 3J80E 1LUZA 2ICEC 3A8IE 5J22A 3GTKB 4YHHQ 1S5FD 4HSPA 3GTMB 2JA8H 4A3GB 1VQAA 1NTGA 5IYCH 1YJWA 1Y1WH 2IX1A 2NYZD 2YTYA 4DV6Q 1VQEA 5JAVA 1TXYA 4P73A 4K5VA 1J8IA 4H13C 4V0BA 1A8VA 2R92B 4KI0A 1MI2A 3PO2H 3F2CA 3NTIA 2ZXPA 2K32A 4QB4A 4A3KH 1DCZA 3BZCA 4NXML 1LO5D 5C6AA 5EPLA 3L7ZC 1CTMA 4MIUA 3QIAA 3LGJA 4JV5L 4LF5Q 4Y7NB 4C3IB 4EVOA 1PH2A 4DR4Q 3SK5A 5CORA 1BCPD 2WAQB 5C44H 1XNRL 4AYBB 3ZYYX 4TKOB 1O7ZA 4A3IB 4C3HH 1Y1VH 3PF4A 1GOZA 2HDMA 5J3BA 5JJIA 3B6YA 5IODA 4ZK9B 1K9MC 2L9HA 4KKUA 1F77A 1T5XD 2E2IH 3NXWA 3KJOA 3NHHA 4HIOA 3KF8A 3FP9A 2H5XA 3J81L 1ENAA 2IPKD 2PZTA 4KY7A 3K0XA 4H44C 1SAPA 1A3VA 4A3JH 1W6JA 4OO1G 3GTJH 2IT1A 2ZM6L 4ZUIA 2E5LL 5IGBA 4U673 4JW0A 1TWHH 1B3AA 2Q2IA 1TU2B 1ESRA 4ODGA 4Q5VA 3UI2A 3EN2A 3HOZH 2JQOA 2WB1E 3KK7A 3IFTA 2AQ2B 2JYOA 4DV3L 2K5NA 1O80A 3Q0AA 2GVBA 1V8QA 5I2YA 2EXDA 5D3DA 2UXCQ 1KRTA 5BN3A 1HPCA 2KCMA 2XIWA 4KY5A 1YVCA 2F3IA 2J7ZA 4CJ2C 3Q24A 1PH8A 1CM9A 3EIVA 3F2BA 5K36H 2KA7A 2B8GA 2K52A 1R9TB 3AQQA 1I4HA 2PYKA 2PI2E 2PZWA 1YHAA 5DLQE 4ZRZA 1EQVA 4L5SA 1VQ6A 3HOVB 4NXMQ 3I55A 4OX9L 4QY7A 1PDQA 2N3SA 3HZXA 2MFIA 2E2HH 2Z4IA 2E76C 4N8FA 2WINB 3F2UA 4JV5Q 3C1EA 5L37A 3PUXA 5HGTA 1XNRQ 1CZGA 2EQSA 4X66L 1GO3E 3JAMc 1DGSA 1PFBA 3AFPA 4RHSA 5EQ0A 3PO3B 3KLRA 4FF1A 3K6OA 4POFA 1E2WA 5M9OA 4ALPA 5ISRA 1ESFA 4UY8C 3NE5B 2FMMA 5I9OA 1QUQA 1FNWA 3IRBA 1RD9D 4LUVA 3P75A 5G3LD 1HNXL 3VYRA 2V4DA 4KD3A 4DNRB 1WTPA 2HHHL 4LMQD 2F4IA 4JBJA 1I50B 1QG7A 1LT3D 2ZM6Q 1F9QA 4R8IA 2E5LQ 1TQOA 4A3EB 3F2DA 5CMDA 2A69D 3CCSA 4IFDH 2JA5H 1STHA 2WV6D 3ULLA 4DV3Q 2K7VA 1TWAH 1VQCA 2OTLA 5M5YH 3HKZE 5JOBA 1A0IA 3I4LA 1I4GA 4LJZC 5D3IB 1PZJD 4BA1I 1VQDA 2R7ZH 3SHLA 2N88A 1CA5A 4GKJQ 3L0OA 5IYCG 3TQYA 3P7JA 1SYGA 1PH1A 4IO9A 4A3MG 1GXDC 4FNFA 5E4XA 3R2IA 1EWHA 4BY1H 1BF4A 1BBXC 4JI6Q 3OSOA 1KIXA 4TSSA 1OO9B 4HCEA 1JQYD 3TMEA 5CV7A 1CZWA 1LTGD 4IFDI 1HNZL 4OX9Q 2KCCA 3HOUH 3NWSA 5C44G 3CRLC 4BY7H 1K8AC 2ZTCA 4C3HG 1Y1VG 1E3PA 1YEZA 3CCJA 1PTOB 3CCUA 1ZXTA 2XWBB 3TP5A 1Y14B 1EIYB 1I6HH 1V1PA 1D5MC 3WWVA 3H6MA 4V190 2HCIA 3GTQH 4UHVA 4YWLA 5JVG3 3CMAA 2E2DC 3KF8B 1JJ2A 4KLKA 4X62L 2H1EA 1HNZQ 1BBUA 1YZ6A 1M4VA 1HNXQ 3S1QH 3BJUA 2HHHQ 3PQIA 5J39A 3BDCA 3H94A 3MEHA 4DNTB 1DJRD 1X3GA 3HOZG 2NVQB 4RCOA 5M5WH 4LF9L 1HTLD 1IHZA 2AWNA 3ERSX 4CBVA 4DR7L 2BOSA 4HSVA 2YV5A 4FYDA 2F0UA 2CCZA 3PGZA 2NZHA 5C3EB 1IYVA 3VYSA 3W1BA 1SXTA 4CHTB 2NUCA 2K50A 1WYDA 4JI5L 2D2CC 5K36G 4NP5A 1Q8KA 2G9DA 1MJEA 3FVQA 1AE2A 3VYUA 3QB3A 5ELNA 3TZDA 2A1AA 2JXMB 1CKNA 5FLXL 4CKEA 1XMQL 2JA7H 2AMCB 1EOVA 1KAAA 3K7AH 4H02A 1DONA 2UU9L 3UDXA 2VW9A 2R6GA 1Q46A 2N8NA 2NVXH 2F0QA 1KLGD 4FF4A 2K5HA 2EPBA 4XQJA 2X6GA 3R8BA 3AU7A 1GJXA 1HHVA 5ELFA 1UNSA 1SNMA 1SE4A 2ZTDA 5DEHA 1BCPB 5IOCA 4B3RL 3H15A 3BS1A 1CQFA 5EJWA 4A3DH 3OIPA 1D2BA 2KECA 4ABNA 3I4MB 2EE1A 3S2DB 4HJ5A 4X62Q 2A68C 1QUQB 1EY5A 1Q1BA 4DA2A 3OW7A 1VDZA 4QUCA 1WTWA 4ID6A 2JA8B 1Q8IA 5IGCA 3STBC 4GN5A 5LMUL 1TR5A 4RAUC 4IFDG 2PW5A 3IL8A 2F0DA 2HQEA 2OQKA 1Y1WB 3I7FA 3NBHA 2PO4A 2RKSA 2E2JB 3T1HL 1SJHD 1QE6A 1CK1A 3OMGA 3HFZB 1PYSB 2B2YC 3PO2B 2F03A 2HCCA 4A3KB 1SNDA 3E6ZX 4CJ0B 3IKJA 3ER0A 4WRDA 4P74A 1EZ6A 3PCOB 1N8RC 2GA4B 2C5CA 2HDLA 3G6JB 2ZXOA 2OCEA 1F2LA 1I3QH 3OPOA 3LWUA 4HIDA 3MZ5A 4LFAL 2F3WA 4KKTA 4LUOA 1A3TA 3TN2A 3FRPB 3RZDH 4IPHA 3DWPA
chains in the Genus database with same CATH topology
2E2IB 4IUTA 3SXHA 3K5LA 3IAYA 2LKVA 4A3JB 2K5DA 4ILWA 3VR2A 1D1IA 3ND8A 3BYYB 3M85A 4RFBA 3QJYA 1V1PB 3WDNA 1STGA 2F0EA 4JBWA 4HMJA 2L12A 2KEDA 1NR4A 2BDOA 2EXZA 1YNNC 1MBYA 1CHQD 2FINB 1G291 3DWAA 3M3YB 3WOFA 2F0FA 4QIWB 3W2DA 4K6DA 4KMUC 2FMCA 5IT9E 5C0XJ 3Q6SA 3SDZA 1JB3A 5CYUA 3HP3A 3PMFA 3W3AA 3LX0A 2ICIA 2B2UA 3K5NA 4L63B 2L1BA 4X3TA 1TKWB 1WTRA 5I4DA 3K57A 4G7OC 2M9VA 1I4QA 2OT2A 1QILA 1B1ZA 2F0LA 3I3CA 5NUCA 4RH6A 4CKBA 2KHSA 5LL6X 1BUVT 4EQOA 2EVBA 1SMYC 2FHTA 1OXTA 2F0IA 5I2XA 3FPPA 3PUWA 2JA5B 3BG3A 1TWAB 4OO1H 5KRUA 5D65A 3X3NA 3RD4A 1X32A 5KIXA 4EQNA 2R7ZB 3OMCA 1X3PA 1JWUD 2XRQD 3MXUA 1KDBA 2M2LA 2G9HD 4J1MA 5C0XG 1ZYRC 1F9SA 5JEAJ 1FGBD 2SOBA 4PMBA 4BY1B 4ZAIA 1EZ8A 3T53B 2ENBA 3A8JE 2B2VC 1B4OA 1NCVA 3J81E 3HOYB 3HOUB 3TP6A 1K83B 1LTRD 1KTKA 1SMYD 4BY7B 4OO1I 1IW7C 2WKDA 3V96A 1EEFD 3SEBA 4DAPA 2O5JC 1CFMA 2A73B 5DM73 4L6TB 2F1MA 1RF2D 2RSNA 2EYJA 1C4QA 4Q0FA 4N9PA 4NKLA 2QDBA 1PRTC 3S1MB 3CRKC 3S1QB 1ZYRD 2EZVA 1L0YB 1JOQA 4TRDA 1LT6D 3QOLA 3I73A 4A3BB 3U9SA 5M5WB 4OIJA 1HQRD 1UEAB 5EBDA 5EKIA 2BA0A 2B2WC 5M5XB 1STBA 1EY0A 3MFYA 2B2TA 2WB1B 1IW7D 3T56B 3PIO3 4BBSB 1S5DD 3RLFA 5JEAG 1DD2A 4MHEA 5I6YA 1HXYD 3FEWX 2Q8RE 5IGGA 5A2QL 2NN6G 4DAYA 3K5OA 1PRTD 2I07B 3BZDB 1HRJA 2MUYA 3FMCA 3K7AB 1E2VA 3NSWA 3NPPA 4OIKA 1BQQT 2RA4A 1Y8OB 4IN3A 1NSNS 2KOLA 2NVXB 1A6XA 1V1OA 2B63B 4ZLTF 1O7YA 4F7XA 1HCZA 1ZKOA 5KGUA 2PZUA 3T13A 4A3DB 3MTSA 5F2DA 3S9WA 1S4ZA 3MXGA 4KHZA 1K8MA 5CV5A 2DNCA 5EGTA 3KLSA 4ME5A 1JR0D 5KNDA 2FFKB 3D4RA 2MJ8A 5TSSA 2PPBC 2SEBD 2A74C 2R61A 5FO8B 2K1BA 4A3FB 1ILPA 2B2VA 1RTOA 1I3QB 2Q8IB 3HKZB 3WOEA 3HEJA 5CV9A 1QCBD 2NTTA 1GUTA 4HCSA 5LHY1 3MAQA 3VYTA 3A56A 2NZ1D 5EBCA 5IGEA 1TY2A 1H9SA 1KLUD 2QKIC 1JICA 4K2KA 2WACA 1W6KA 4KN4C 4LAAA 3DEPA 1STYA 3TP7A 4QF4A 3A55A 2DY8A 5C5LA 2JA6B 3DMUA 5M3FB 3MHBA 1QNUA 5CV8A 2L11A 5CBEE 3OWEB 3VR4A 3ERQA 1TWGB 3LNNA 2B2WA 2AQ3B 1ICWA 2NWGA 2CHBD 1LTBD 2NBFA 4G7HC 4BBRB 5K5PA 4M1UB 2EJFC 1NAPA 4CJ1B 3FDTA 3BDOA 3URYA 2EY1A 3GP7A 3S14B 3M4OB 2LFNA 4IQZA 2KUMA 1OXSC 3NQTA 4DGZA 4G7ZC 2JE6I 5EPJA 2L55A 4HMIA 3S1NB 3EFXD 2NTSA 4ZKBB 1EFID 5IGFA 2AWOA 2EYMA 1KNEA 1K8OA 1VF7A 4RHRA 4I7ZC 1B50A 3OOCA 1DYQA 5C5MA 3DXJC 1SYFA 4WJWA 4GZYC 1DOKA 1EU3A 5E1FA 2QILA 1VMCA 4U68A 5C3XA 1Y8NB 4KY6A 2MPMA 1AW7A 1ET9A 2RSOA 2NVTB 1YNJC 1IL8A 5COYA 2PCFB 4DFAA 1MSHA 3OWFA 1GUGA 4Z9CB 3GTOB 1DOMA 4CGYB 1KNAA 2QEJC 1FNUA 2BCOA 3SK4A 5ELEA 4O1NA 1HA6A 1AZPA 1PXUA 2ZT9C 3EROA 4QUFA 4UDUC 1H9SB 1SYEA 1PRTB 3NTKA 2PMZB 4IUVA 1I4RA 4F8MA 1AFPA 5C4ZA 4K14A 4XT3B 1EOTA 3MC0B 1DXMA 1B2TA 1XTCD 1JWSD 4ZKCB 1A15A 4X3UA 1RDPD 3DWQA 3HOXB 1A3UA 4IALA 1SYCA 1HTPA 2H4OA 4EGVA 3C1FA 5FO7B 2F3VA 2IX3A 1AN8A 5A35A 3VR3A 1EYCA 1F9PA 2CQAA 5C0XH 3HG9A 4A3MB 3R3OA 1HA5A 2RBMA 2XN9C 3NP8A 1WD0A 1MSGA 1F2YA 1Y8PB 3HS0C 5CC4A 3GO5A 2RDHA 1ENCA 3R2TA 4KK7A 1EYDA 3MXPA 5C44B 1I4XA 1QNKA 2EYPA 4C3HB 1Y1VB 3NK9A 3C46A 1G2TA 3EA6A 3EJIA 5ELCA 4XIGS 1J9OA 4RGTA 2A5HA 1GUNA 3D4WA 1NR2A 2A68D 5C0XI 1SNPA 1H9RA 3MWYW 4E6IA 5I9PA 4XDXA 1KABA 3GTJB 1Y69U 4C3JG 1U4MA 5CGKA 5C4HA 1S5ED 2O5IC 1TWHB 4UAIA 4F87A 2K5QA 2OF1A 3QWNA 3HOZB 3MVVA 3A8KE 1OXVA 4ULLA 1BOSA 1LV9A 1EL0A 3DUZA 1RODA 2IL8A 1PZID 1ZEQX 1GUOA 5JEAH 4LK1C 1U4PA 1R4QB 4PQXA 1WTVA 1LACA 2F0WA 2JSOA 4KJNA 5E3FA 1TT2A 1GHJA 2NN6H 3CKIB 3A7AB 2L0CA 2XWJB 2RDFA 1KDCA 2E2HB 3T16A 2BA1A 2E74C 4JK1C 1SNQA 1EY9A 3K0YA 5C3WA 1WTXA 1SE2A 5BN5A 1H9MA 5DNFA 3I70A 1YNND 2F0OA 1SNOA 1A2TA 1TY0A 4KD4A 3A7LA 2BDNA 1DM0B 3JAML 1U4LA 3VR5A 4DN4M 2I46A 3DM1A 4EQPA 4N9TA 1FNVA 2L5TA 2NN6I 4H7BA 1MD2D 1V43A 3GD7A 1SE3A 5M5YB 4FF2A 1PTOF 3DHQA 3BVGA 4KJOA 2B2YA 4C56C 2HUGA 1GHKA 2X6LA 2EY6A 4C3IG 1BDOA 2K33A 3SR1A 3VA7A 4RWSC 5EKKA 2NB0A 3OIQA 3L3OC 4FXDA 1JC7A 2F0MA 1AP0A 4DK0A 1VMPA 4FP5D 2EOTA 3J7YW 4IURA 1TIID 2NVYB 1DZ1A 4RKLA 3MA2B 2F0VA 3N52A 4B9WA 4WORA 3TP8A 1C8CA 1I6HB 1GUWA 2A6EC 3E0JA 3FPUB 1VF5C 2K28A 3GTQB 4K5XA 4XYOA 2Q8TA 3S2HB 4PV1C 1XWEA 4WFN3 5CV4A 2PW7A 3NWTA 4KV6A 4DF7A 2VNUD 1F2MA 1B53A 1EWCA 1WD1A 2BE5C 2F0TA 4KTAA 1II3A 2DY7A 1AEXA 1Q12A 4HTHA 1EYAA 4KKSA 1LLRD 2E75C 5D14A 3H91A 2EY5A 1WTOA 1BCPF 1EU4A 1CI3M 5CBAE 1EY8A 5EKLA 1EQTA 3U9OA 3PUZA 2A6ED 1RJTA 3KBXA 3K58A 1AZQA 2O2LD 4I65A 3PUYA 5CR3A 3X3MA 1TS2A 1SEBD 2LY7A 2JA7B 3M7NA 4K8IA 4NMZA 1D6EC 3GTPB 4XXEA 5FO9B 1BXTA 1O7LA 2BE5D 2AUJD 1FR3A 2EJMA 1JORA 1LTAD 2DN8A 3AB9A 4J6HA 2CVRA 5DM63 4C1NK 4ZUJA 1A2UA 1DOLA 2JEBI 3SE0A 3PUVA 4RGOS 1JE4A 2A6HC 4BA2I 3QOJA 1WCMB 1JWMD 5JPNC 3CHBD 1HQMC 2RDGA 1ET6A 1JOOA 3BVZA 2F0SA 1EIGA 1HFGA 5IGDA 1D5XC 1LT5D 4QMGA 3NUCA 2WP8J 1IYUA 5T1IA 4K8JA 3NQIA 4QCLA 2F0JA 1ML0D 2EY2A 3RZDB 3IFDA 2IJ0A 3KUPA 2F0PA 5G3LF 2Z4HA 3H3VC 1SJED 2A6HD 1G2SA 3P1HA 1STNA 2OXPA 1CT1D 1PFNA 2EYOA 1M8AA 2K04A 1EY4A 3GV3A 4KHVA 5BN4A 2SDFA 2B8FA 3KBGA 4FO2A 3QG1A 1TWFB 4XQNA 2A69C 4BWGB 2SNSA 2KVMA 1OXXK 4OL7A 5KEEA 2RQXA 5FKAC 1PZKD 5ELDA 1F2ZA 3J80L 4RA8A 5KYLA 1CHPD 5FLXE 1L0XB 1LABA 1RTNA 2F0NA 4XYQA 2D9UA 2MP1A 1CQVA 3BVMA 2EYLA 4HAEA 4XQQA 5JVH3 3P20A 2AUKA 2F0HA 2C9OA 2MGSA 1HUNA 1D1KA 5CV6A 1H9JA 2ID0A 5EPKA 1RCVD 5C4JB 1CA6A 2PQEA 3I4NB 2M00A 4NDXA 2KJXA 3I91A 4G4KA 1UUPA 4C2MB 3DEOA 3TZUA 1OXUA 1SSOA 1B44D 2K05A 4K6LA 4IZ8A 3D8GA 1LTID 3C2PA 1JCKB 4CKCA 4O42A 2TMPA 2KEEA 4F88A 1QOHA 1Z6HA 1XYIA 3K59A 1TVXA 2QCPX 5KNBA 1STEA 1RHPA 1SDFA 1PMRA 3T51B 3MFGA 2J0TD 5LL6S 3OHXC 5E4WC 3AMUA 2XNAC 1QJOA 5FK9C 3M4YA 5J1ZA 3TBIB 2XSCA 3GQBA 3J7AV 4IFDJ 5JPMC 3GTGB 2JEAI 2F0GA 3HOWB 1SFOB 1YNJD 1Q3LA 4DK1A 1GUSA 2PNRC 1B9MA 1S5CD 1D5ZC 2VB2X 1BNZA 4R8NA 2VXWA 3FKIB 2MHVA 3CQZB 2DNEA 1HUMA 3S15B 1E0BA 3QO2A 3C3LA 4ZYSA 2LS01 5FOBB 4RKBA 1IKLA 3I8ZA 2B2UC 1TS5A 1WVLA 2CW0C 4BS9A 5KYIA 3D6WA 3I90A 1Z47A 4MN3A 5KNCA 1Q1EA 3H09A 4IUUA 2OEOA 2VB3X 2Z1CA 1I4PA 2WKCA 3JAME 4HEDA 3EQLC 2LMCB 5T1GA 1RKNA 4PMCA 4PNYA 1XXGA 2D62A 4NW2A 2TSSA 3GV6A 2AQ1B 4FF3A 3N6RA 1ONLA 3KLSX 3Q22A 4DU9A 4DAVA 3ONAB 5IIFA 4B08A 2FJ2A 3D31A 3G7LA 3T4AC 1Z7TA 1FYCA 2CW0D 1SNCA 3LWEA 4IUNA 1X3QA 1T5EA 4G57A 2WIIB 4R9WA 4YIJA 4RGNA 3TSSA 2K01A 3D6CA 3V2TA 1PYWD 4IUQA 2D5DA 4FVMA 5ELBA 3MXNA 2K6AA 3I72A 1VCIA 2IW3A 3BDLA 1BR9A 2SNMA 2YYZA 4FXKC 3R93A 2RVLA 1S5BD 1QWYA 4XTCS 4P2CB 1U4RA 1U9RA 1SYDA 3S1RB 5C4XB 4K5WA 5M3MB 4J8QA 3O13A 4HN7A 4C1NI 1ENFA 1Q90A 1B9NA 1TWCB 1XX8A 2EJGC 2B2TC 2IWHA 3D4DA 1EY7A 1KDAA 1H9KA 2X69A 3SK8A 2Z8LA 3NTHA 3ITPA 4DXFA 3K5MA 5A2QE 1PFMA 3PIP3 4X3SA 4H0LC 1BO0A 3NBIA 4L8JA 4XT1B 4FXGC 4OGQC 3RUZA 3J7AF 2KQ3A 4OHJA 4RGMA 2Y0SB 3L9AX 3SK6A 3VR6A 1PTOC 2KCNA 2R93B 1I6VC 2F0KA 3SVMA 1MGSA 1PTOH 4M8AA 3M7GA 1FD7D 1TS3A 5I6WA 2L4NA 3V05A 3A54A 1G8ZD 2K5WA 2K03A 4S3SA 1SBBB 4HR7B 1PLFA 2O4XA 1HFNA 4C3JB 1UAPA 1G6ZA 2B39A 2QF7A 5JJZA 1O78A 4B9XA 4KN7C 4A93B 3PV0A 3RMHA 1EEID 1QB5D 2VUMB 2XVSA 3E5SA 2EYHA 3RZOB 4TQUS 1LTTD 1PRTF 3D3RA 4PMWA 3CU7A 2XRSD 3ND9A 1PTOD 3TDQA 1LTSD 4K2LA 2YU9B 2R3ZA 1TS4A 1STAA 1C48A 4DXGA 1EY6A 2JP1A 5DAUA 5IT9L 3HGBA 1G91A 3Q23A 1JOKA 1F9RA 2J4XA 1NUCA 4RCNA 1EIHA 1ILQA 1R4PB 2ZXRA 3S16B 4ZQ3A 3VA5A 2EDGA 4X3KA 3BYTB 1E2ZA 1WTQA 4IUPA 5HURA 3H0GB 2IX0A 1IKMA 1BCPC 3HRZC 2EYFA 1SYBA 3EVQA 2N55A 3GTLB 1LT4D 3S17B 5AFWA 3J80E 2ICEC 3A8IE 5J22A 3GTKB 1S5FD 4HSPA 3GTMB 4A3GB 2IX1A 2NYZD 5JAVA 4K5VA 1J8IA 4H13C 4V0BA 2R92B 4KI0A 1MI2A 3NTIA 2ZXPA 2K32A 4QB4A 1DCZA 1LO5D 5C6AA 5EPLA 3L7ZC 1CTMA 4MIUA 3QIAA 4Y7NB 4C3IB 4EVOA 3SK5A 5CORA 1BCPD 2WAQB 4AYBB 3ZYYX 4TKOB 1O7ZA 4A3IB 1GOZA 2HDMA 5IODA 4ZK9B 2L9HA 4KKUA 1F77A 1T5XD 3NXWA 3NHHA 3KF8A 3J81L 1ENAA 2IPKD 2PZTA 4KY7A 4H44C 1SAPA 1A3VA 1W6JA 4OO1G 2IT1A 4ZUIA 5IGBA 4U673 1B3AA 1TU2B 1ESRA 4ODGA 4Q5VA 3UI2A 3KK7A 3IFTA 2AQ2B 2JYOA 1O80A 3Q0AA 5I2YA 1V8QA 5D3DA 5BN3A 1HPCA 2XIWA 4KY5A 2J7ZA 4CJ2C 3Q24A 1CM9A 5K36H 2KA7A 2B8GA 1R9TB 1I4HA 2PYKA 2PZWA 4ZRZA 1EQVA 3HOVB 1PDQA 3HZXA 2Z4IA 2E76C 2WINB 3F2UA 3C1EA 3PUXA 5HGTA 1CZGA 1PFBA 4RHSA 5EQ0A 3PO3B 3KLRA 4FF1A 3K6OA 1E2WA 5M9OA 5ISRA 1ESFA 3NE5B 2FMMA 5I9OA 1FNWA 5G3LD 1RD9D 3P75A 3VYRA 2V4DA 4KD3A 4DNRB 1WTPA 4LMQD 2F4IA 1I50B 1QG7A 1LT3D 1F9QA 4R8IA 1TQOA 4A3EB 5CMDA 2A69D 4IFDH 1STHA 2WV6D 2K7VA 5JOBA 3I4LA 4LJZC 1I4GA 5D3IB 4BA1I 1PZJD 3SHLA 2N88A 1CA5A 3P7JA 1SYGA 1GXDC 4FNFA 5E4XA 3R2IA 1EWHA 1BF4A 1BBXC 3OSOA 4TSSA 1OO9B 4HCEA 1JQYD 3TMEA 5CV7A 1CZWA 1LTGD 4IFDI 2KCCA 3NWSA 3CRLC 4C3HG 1PTOB 1ZXTA 2XWBB 3TP5A 1V1PA 1D5MC 3H6MA 4V190 2HCIA 5JVG3 2E2DC 2H1EA 1M4VA 5J39A 3BDCA 3H94A 3MEHA 4DNTB 1DJRD 2NVQB 4RCOA 1HTLD 1IHZA 2AWNA 4CBVA 2BOSA 4HSVA 4FYDA 2F0UA 5C3EB 1IYVA 3VYSA 1SXTA 4CHTB 2NUCA 2D2CC 5K36G 4NP5A 2G9DA 3FVQA 3VYUA 3QB3A 3TZDA 2JXMB 5FLXL 4CKEA 1KAAA 1DONA 2R6GA 2F0QA 1KLGD 4FF4A 2EPBA 4XQJA 2X6GA 3R8BA 3AU7A 1GJXA 1HHVA 5ELFA 1UNSA 1SNMA 1SE4A 5DEHA 1BCPB 5IOCA 3BS1A 1CQFA 5EJWA 3OIPA 1D2BA 2KECA 4ABNA 3I4MB 2EE1A 3S2DB 2A68C 1EY5A 1Q1BA 4DA2A 3OW7A 1VDZA 4QUCA 1WTWA 4ID6A 2JA8B 1Q8IA 5IGCA 1TR5A 4RAUC 4IFDG 2PW5A 3IL8A 2F0DA 2HQEA 1Y1WB 3NBHA 2PO4A 2RKSA 2E2JB 1SJHD 1QE6A 1CK1A 3OMGA 2B2YC 3PO2B 2F03A 2HCCA 4A3KB 1SNDA 3E6ZX 4CJ0B 3IKJA 4WRDA 1EZ6A 2GA4B 2C5CA 2HDLA 3G6JB 2ZXOA 3OPOA 1F2LA 3LWUA 3MZ5A 2F3WA 4KKTA 1A3TA 3TN2A 3FRPB 3DWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HSV A;  4IUT A;  1MSG A;  5DNF A;  2B2U C;  1WTP A;  1IL8 A;  5D65 A;  5COY A;  5COR A;  2DY8 A;  5JJZ A;  4LMQ D;  1WVL A;  1QG7 A;  1O7Z A;  1F9Q A;  1X32 A;  3DEO A;  3IFD A;  3D6W A;  5D14 A;  2L11 A;  4R8I A;  1WD0 A;  1HRJ A;  1X3P A;  3H91 A;  5CBE E;  3KUP A;  1MSH A;  2HDM A;  3I90 A;  2BDN A;  4MN3 A;  5CMD A;  2M2L A;  4OIK A;  1WTO A;  2RA4 A;  1U4L A;  4DN4 M;  3DM1 A;  1QNK A;  1SSO A;  2KOL A;  4ZK9 B;  2L9H A;  1DOM A;  4IUU A;  5CBA E;  1G2S A;  2K05 A;  2B2W A;  1EQT A;  1O7Y A;  1F9S A;  4ZLT F;  1ICW A;  2NWG A;  1G2T A;  1RJT A;  3KBX A;  3TZD A;  1KNA A;  4ZAI A;  1AZQ A;  1XX8 A;  1PFN A;  1SAP A;  1J9O A;  2KED A;  2L12 A;  4HED A;  1CA5 A;  2N88 A;  1M8A A;  2B2T C;  1NR2 A;  5T1G A;  1NR4 A;  2R3Z A;  2K04 A;  3GV3 A;  4NW2 A;  1DON A;  1HA6 A;  2JP1 A;  2SDF A;  3MWY W;  3P7J A;  1NAP A;  2B2V C;  2FIN B;  1B3A A;  1B4O A;  2X69 A;  2KEE A;  3FDT A;  1ESR A;  1NCV A;  4XDX A;  4CJ1 B;  2B2Y A;  3GV6 A;  3MTS A;  1XYI A;  3UI2 A;  2EPB A;  1U4M A;  2HUG A;  1TVX A;  1F9R A;  1S4Z A;  2JYO A;  2X6G A;  5E4X A;  2X6L A;  1HHV A;  4QUF A;  1O80 A;  1BF4 A;  1RHP A;  1SDF A;  2KVM A;  2KUM A;  1PFM A;  1ILQ A;  4UAI A;  4X3S A;  1BBX C;  1EIH A;  3ONA B;  3Q6S A;  5EJW A;  4X3K A;  2FJ2 A;  4RWS C;  4IUV A;  1BO0 A;  5E4W C;  5EPJ A;  3G7L A;  2KEC A;  1WTQ A;  2XIW A;  2EE1 A;  2FFK B;  4IUP A;  4ZKB B;  2CVR A;  2J7Z A;  2RSN A;  4XT1 B;  1IKM A;  2MJ8 A;  4CJ2 C;  1LV9 A;  4XT3 B;  1EL0 A;  3HP3 A;  1AP0 A;  1G91 A;  1CM9 A;  1VMP A;  4QUC A;  1ROD A;  3LWE A;  1KNE A;  2EOT A;  1EOT A;  4RA8 A;  2K1B A;  4IUR A;  1WTW A;  2B2U A;  1ZXT A;  2IL8 A;  1ILP A;  2N55 A;  4RAU C;  1B2T A;  1DZ1 A;  1RTN A;  1DOL A;  1X3Q A;  3IL8 A;  4ZKC B;  2D9U A;  3N52 A;  1A15 A;  2B2V A;  1U4P A;  1JE4 A;  4R9W A;  2L1B A;  2MP1 A;  1RTO A;  4X3U A;  1B50 A;  2HCI A;  4X3T A;  1WTV A;  1WTR A;  2K01 A;  4HAE A;  1QE6 A;  5AFW A;  1C8C A;  1GUW A;  1PDQ A;  1Q3L A;  2B2Y C;  3FPU B;  3I91 A;  2HCC A;  2K28 A;  2H1E A;  1MGS A;  3I8Z A;  4IUQ A;  3SVM A;  4OIJ A;  3F2U A;  4CJ0 B;  3I3C A;  2Q8T A;  2MGS A;  1DOK A;  1HUN A;  1EIG A;  1BNZ A;  4HCS A;  5EKI A;  1HFG A;  2L4N A;  2NYZ D;  2B2W C;  1PFB A;  1VMC A;  2HDL A;  2VXW A;  5EQ0 A;  4U68 A;  1F2L A;  2B2T A;  2NZ1 D;  1J8I A;  2K03 A;  1F9P A;  5EPK A;  1HUM A;  1MI2 A;  4O42 A;  2MPM A;  4MHE A;  5T1I A;  3R93 A;  2FHT A;  1CA6 A;  1PLF A;  1JIC A;  1B53 A;  1HFN A;  1E0B A;  2RVL A;  1WTX A;  3QO2 A;  1WD1 A;  1AZP A;  2RSO A;  3TN2 A;  2DY7 A;  5EPL A;  1U4R A;  1IKL A;  1G6Z A;  3DEP A;  2FMM A;  1ML0 D;  2Q8R E; 
#chains in the Genus database with same CATH topology
 2E2I B;  4IUT A;  1XMQ Q;  3CCL A;  2UUC L;  3J81 j;  1XPO A;  1E24 A;  3SXH A;  3K5L A;  3IAY A;  2LKV A;  4A3J B;  2K5D A;  4ILW A;  2UU9 Q;  1X3F A;  3VR2 A;  1Q86 C;  1D1I A;  3ND8 A;  3CC4 A;  2K4K A;  1JJC B;  3BYY B;  4IJH A;  3M85 A;  4RFB A;  3QJY A;  2K5V A;  1V1P B;  3WDN A;  1STG A;  2JA6 H;  2F0E A;  1HZB A;  1UWV A;  4JBW A;  4HMJ A;  2L12 A;  2KED A;  5M3F H;  4L5Q A;  1NR4 A;  2BDO A;  2VZA A;  2EXZ A;  1YNN C;  1MBY A;  1CHQ D;  3J80 c;  3CC2 A;  2FIN B;  1G29 1;  1HZA A;  3DWA A;  3M3Y B;  5EAY A;  3WOF A;  2RCF A;  2F0F A;  4QIW B;  3W2D A;  4K6D A;  4KMU C;  2FMC A;  4X64 L;  4BBR H;  1LM0 A;  5IT9 E;  1O7I A;  5C0X J;  3Q6S A;  3RN2 A;  3T1H Q;  3SDZ A;  1JB3 A;  5CYU A;  3S14 H;  3M4O H;  3HP3 A;  3PMF A;  4UP7 A;  3W3A A;  3LX0 A;  3CC7 A;  2ICI A;  2R7F A;  2I5H A;  1PH3 A;  2B2U A;  4I7A A;  1C9O A;  2PI2 A;  3K5N A;  4JG2 A;  1IL2 A;  2LXK A;  4L63 B;  2L1B A;  4X3T A;  1TKW B;  3S1N H;  1WTR A;  5I4D A;  3K57 A;  4G7O C;  2M9V A;  4J15 A;  2JA7 G;  1KRS A;  1I4Q A;  4JVZ A;  1EWI A;  1CKN B;  2OT2 A;  1QIL A;  2UXB L;  1B1Z A;  2F0L A;  2KCT A;  3I3C A;  5NUC A;  4RH6 A;  4CKB A;  4DR2 L;  3J81 i;  2UUC Q;  2KHS A;  5LL6 X;  4DV0 L;  4MZ9 A;  2BH2 A;  2F52 A;  1BUV T;  1P8L A;  4EQO A;  3PF5 A;  1W2B A;  2EVB A;  1SMY C;  2FHT A;  1OXT A;  2F0I A;  4DV7 L;  5I2X A;  3FPP A;  3PUW A;  2JA5 B;  3AEV A;  3BG3 A;  4C2M H;  1CSQ A;  1TWA B;  4OO1 H;  5KRU A;  5D65 A;  3X3N A;  4DPG A;  3RD4 A;  1WI5 A;  1ASY A;  1X32 A;  5KIX A;  4EQN A;  2R7Z B;  3OMC A;  1X3P A;  1JWU D;  2XRQ D;  3MXU A;  1KDB A;  2M2L A;  1S72 A;  4B3S L;  1WCM G;  2NVT H;  2G9H D;  4J1M A;  5C0X G;  1ZYR C;  4DR5 L;  1F9S A;  2DJF C;  2FXQ A;  5JEA J;  5H1S E;  1FGB D;  4X64 Q;  2SOB A;  4PMB A;  4BY1 B;  4ZAI A;  1IBK L;  1EZ8 A;  3T53 B;  3A0J A;  1N36 L;  2ENB A;  4A76 A;  3M4Q A;  3A8J E;  2B2V C;  3GTO H;  1B4O A;  1NCV A;  3J81 E;  1I94 L;  1IBM L;  3HOU B;  3HOY B;  1J5E L;  3TP6 A;  1K83 B;  1LTR D;  1KTK A;  1SMY D;  4BY7 B;  4OO1 I;  1IW7 C;  2WKD A;  3V96 A;  1EEF D;  3SEB A;  4DAP A;  4LFB L;  2GN5 A;  3M4P A;  1EYG A;  2O5J C;  5ELO A;  5IYD H;  1CFM A;  1UE6 A;  2A73 B;  5DM7 3;  4L6T B;  2F1M A;  1PV4 A;  1RF2 D;  1V1Q A;  2RSN A;  2EYJ A;  4RMF A;  1C4Q A;  4CDF C;  4Q0F A;  4N9P A;  4NKL A;  2QDB A;  1U0L A;  2UXB Q;  4A3L H;  1PRT C;  4DR2 Q;  3S1M B;  3CRK C;  2JK8 A;  4DV0 Q;  1X56 A;  3GTG H;  3S1Q B;  1ZYR D;  2EZV A;  1L0Y B;  1SFO H;  1JOQ A;  4UP9 A;  4TRD A;  1LT6 D;  3QOL A;  5IE8 A;  4EQ5 A;  4DV7 Q;  1SR3 A;  3I73 A;  3NEN A;  4A3B B;  3W1G A;  3U9S A;  5M5W B;  3FKI H;  4OIJ A;  1HQR D;  1UEA B;  3CQZ H;  5EBD A;  5EKI A;  2BA0 A;  2B2W C;  2C35 B;  5M5X B;  1STB A;  2Z6K A;  1EY0 A;  3J7A 5;  3MFY A;  2B2T A;  2WB1 B;  1IW7 D;  3T56 B;  3PIO 3;  4BBS B;  1S5D D;  3RLF A;  5JEA G;  1UE5 A;  3S24 A;  3HOX H;  1DD2 A;  3CF5 A;  1HH2 P;  4MHE A;  4B3S Q;  5I6Y A;  1K28 A;  1HXY D;  4R4T A;  4DR5 Q;  1GKH A;  3FEW X;  3G4S A;  3W5O A;  2Q8R E;  5IGG A;  2HIX A;  1IBK Q;  5A2Q L;  4B3T L;  2NN6 G;  1PH5 A;  4DAY A;  3K5O A;  1PRT D;  2I07 B;  3BZD B;  4A3M H;  1HRJ A;  2MUY A;  3FMC A;  3K7A B;  1PH7 A;  1E2V A;  3NSW A;  5IWA L;  3NPP A;  4OIK A;  1BQQ T;  2RA4 A;  1Y8O B;  4IN3 A;  1NSN S;  1I94 Q;  2KOL A;  2LXJ A;  3CCQ A;  1IBM Q;  1XNQ L;  1J5E Q;  2NVX B;  4R4I A;  1V1O A;  1A6X A;  2B63 B;  4ZLT F;  1O7Y A;  4F7X A;  1HCZ A;  1ZKO A;  4LFB Q;  5KGU A;  1B3Q A;  4LF6 L;  3UDI A;  3CP0 A;  2MQH A;  2PZU A;  3T13 A;  4A3D B;  3I4N G;  3MTS A;  5F2D A;  4IPG A;  3S9W A;  2QW7 A;  1S4Z A;  5AJ3 L;  3MXG A;  4NXN L;  1SE8 A;  4KHZ A;  1K8M A;  5CV5 A;  2DUD A;  2DNC A;  5EGT A;  4CDD C;  4HIM A;  4JI4 L;  2RHS B;  3KLS A;  4ME5 A;  1IYJ B;  1JR0 D;  5KND A;  2MNA A;  2FFK B;  3D4R A;  4QQB X;  4DUY L;  2MJ8 A;  3K80 C;  5TSS A;  2PPB C;  2SEB D;  2A74 C;  5IYB H;  2R61 A;  3RR5 A;  5FO8 B;  2K1B A;  4A3F B;  4JI1 L;  1ILP A;  4LF8 L;  4IOA A;  2B2V A;  2VQE L;  3G48 A;  1RTO A;  1I3Q B;  2Q8I B;  3HKZ B;  4POG A;  2B3G A;  3WOE A;  3HEJ A;  5CV9 A;  4HJ9 A;  2E8G A;  1QCB D;  2NTT A;  1GUT A;  4HCS A;  5LHY 1;  3MAQ A;  1VQ8 A;  3VYT A;  2N78 A;  3A56 A;  4GOP C;  2NZ1 D;  5EBC A;  5IGE A;  1TY2 A;  1XMO L;  5IWA Q;  2JJQ A;  4EX5 A;  1H9S A;  1XNQ Q;  1KLU D;  2QKI C;  1JIC A;  4K2K A;  2WAC A;  1W6K A;  4KN4 C;  1VQH A;  4LAA A;  2VQF L;  4A4I A;  3DEP A;  1STY A;  1E7Z A;  5IYD G;  1E1O A;  3TP7 A;  4QF4 A;  3A55 A;  3ULJ A;  2DY8 A;  5C5L A;  2JA6 B;  4LF6 Q;  3DMU A;  5M3F B;  3MHB A;  1QNU A;  5CV8 A;  2L11 A;  5CBE E;  3OWE B;  4A3L G;  3VR4 A;  1K0S A;  3I4O A;  1BBW A;  3ERQ A;  1TWG B;  4JOI A;  3HOW G;  1L1O A;  3LNN A;  2B2W A;  2AQ3 B;  4GLV B;  5AJ3 Q;  2ASB A;  1ICW A;  3EBE A;  4OWX B;  4NXN Q;  2NWG A;  2CHB D;  1MJC A;  1LTB D;  2NBF A;  4JI4 Q;  4G7H C;  4BBR B;  3FKI G;  5K5P A;  3JC6 6;  4M1U B;  2EJF C;  1NAP A;  4JI8 L;  4CJ1 B;  3FDT A;  3G6E A;  3BDO A;  4DUY Q;  1QZH A;  3URY A;  2EY1 A;  3GP7 A;  3S14 B;  3M4O B;  3A5Z B;  1UE1 A;  4JI1 Q;  3HOX G;  2LFN A;  4IQZ A;  2KUM A;  1OXS C;  1K3R A;  3NQT A;  1H95 A;  2VQE Q;  4DGZ A;  4G7Z C;  2JE6 I;  3RLN A;  1Q7Y C;  5EPJ A;  3I2Z A;  2L55 A;  4HMI A;  3S1N B;  3EFX D;  2NTS A;  4ZKB B;  1VQF A;  1EFI D;  5IGF A;  2AWO A;  2CFM A;  2EYM A;  4DAY B;  1KNE A;  3T1Y L;  1K8O A;  2R93 H;  1VF7 A;  1XMO Q;  4RHR A;  4I7Z C;  5GAD C;  3K81 C;  1B50 A;  2Q2T A;  3OOC A;  3ULP A;  3CME A;  2DJG C;  1DYQ A;  2QGQ A;  4R4Q A;  5C5M A;  2VQF Q;  4UP8 A;  1B7Y B;  3DXJ C;  1SYF A;  4WJW A;  2NVY H;  4GZY C;  3CAM A;  1DOK A;  2PQA A;  1EU3 A;  5E1F A;  2QIL A;  1VMC A;  1YNX A;  4U68 A;  5C3X A;  1Y8N B;  4X66 Q;  4KY6 A;  2CWP A;  4B3M L;  2MPM A;  4R4C A;  4HJ7 A;  1AW7 A;  1BKB A;  1ET9 A;  1XPU A;  3CD6 A;  2RSO A;  4A93 H;  2NVT B;  3S2H H;  3GDE A;  1YNJ C;  2QA4 A;  1PH9 A;  2HD3 A;  1IL8 A;  2VUM H;  5COY A;  5GRO A;  5IT9 c;  3RZO H;  2PCF B;  2F4V L;  5IYB G;  3CCV A;  1ICF B;  3CXC A;  4DFA A;  1MSH A;  4JI8 Q;  3OWF A;  1GUG A;  4Z9C B;  1QVF A;  3GTO B;  1DOM A;  4IJL A;  1HZ9 A;  4CGY B;  3RN5 A;  4GOP A;  4IPC A;  1KNA A;  2EIF A;  2QEJ C;  1FNU A;  2BCO A;  3SK4 A;  3A74 A;  1VQK A;  1KAW A;  3UDF A;  5ELE A;  4O1N A;  1HA6 A;  1NMF A;  4LF4 L;  4CDC C;  1AZP A;  1PXU A;  3S16 H;  2ZT9 C;  3ERO A;  3T1Y Q;  4QUF A;  1IBL L;  4UDU C;  1S3O A;  3OYY A;  1H9S B;  1SYE A;  1PRT B;  3NTK A;  2PMZ B;  4IUV A;  1I4R A;  1SLJ A;  5C4X G;  4IPD A;  5GQO A;  4F8M A;  1IXR A;  5M3M G;  1NJI C;  1AFP A;  5C4Z A;  3GTP H;  4K14 A;  4XT3 B;  3GTL H;  1EOT A;  1EUJ A;  3MC0 B;  1DXM A;  1B2T A;  1XTC D;  1JWS D;  4ZKC B;  1A15 A;  4B3M Q;  3GTK H;  4X3U A;  3GTM H;  1Q81 C;  1L1O B;  1RDP D;  3DWQ A;  3CCR A;  4GNX C;  4JCV E;  3HOX B;  1A3U A;  4IAL A;  1SYC A;  1HTP A;  2H4O A;  1VQJ A;  4EGV A;  3C1F A;  5FO7 B;  4HJA A;  1X9N A;  2A19 A;  4JPB W;  3KLW A;  2F3V A;  3K7U C;  2IX3 A;  1M90 C;  1AN8 A;  2D0P A;  2F4V Q;  3AYH B;  5A35 A;  3VR3 A;  1EYC A;  3CCE A;  1WCM H;  1V9P A;  1F9P A;  2CQA A;  5C0X H;  3HG9 A;  4A3M B;  1PFS A;  4DR6 L;  3R3O A;  4C3I H;  3J81 c;  1HA5 A;  2RBM A;  2XN9 C;  1VQB A;  3NP8 A;  4A3I H;  1WD0 A;  4LF9 Q;  1MSG A;  2ZJR A;  2XGT A;  4ME3 A;  1GM5 A;  1F2Y A;  4DR7 Q;  3MEF A;  1Q82 C;  2Y0S G;  1SMX A;  1Y8P B;  3HS0 C;  1AH9 A;  5CC4 A;  3GO5 A;  4X65 L;  2RDH A;  4LF4 Q;  1K0R A;  2HIV A;  1ENC A;  3R2T A;  4KK7 A;  1EYD A;  3MXP A;  5C44 B;  1I4X A;  1QNK A;  5LMN W;  4JI5 Q;  2R93 G;  2EYP A;  4C3H B;  1Y1V B;  3NK9 A;  3C46 A;  1N33 L;  1G2T A;  1IBL Q;  3EA6 A;  3EJI A;  5ELC A;  1VQG A;  4XIG S;  1J9O A;  4RGT A;  2A5H A;  1GUN A;  3D4W A;  3PIP A;  1NR2 A;  2A68 D;  2XTI A;  5C0X I;  1SNP A;  1H9R A;  3MWY W;  4E6I A;  5I9P A;  4XDX A;  1KAB A;  2UUB L;  3STB D;  3GTJ B;  2PQA B;  4C3J G;  1Y69 U;  1U4M A;  3CPF A;  3RLO A;  1X54 A;  3J7Z C;  5CGK A;  3Q8D A;  2IHF A;  5C4H A;  1S5E D;  2O5I C;  1TWH B;  4LFC L;  4UAI A;  4F87 A;  2K5Q A;  2OF1 A;  3QWN A;  4QL5 A;  4GKK L;  3HOZ B;  1N34 L;  3MVV A;  4A93 G;  1KXL A;  3A8K E;  4B3R Q;  3HKS A;  4AQY L;  1OXV A;  4ULL A;  2VUM G;  3TS2 A;  1TWF H;  1BOS A;  1LV9 A;  1EL0 A;  1YJN A;  1R9T H;  3DUZ A;  1ROD A;  4LWC A;  1HR0 W;  4JI3 L;  2IL8 A;  1PZI D;  1ZEQ X;  2Z0S A;  3HOV H;  1GUO A;  5JEA H;  4LK1 C;  1U4P A;  3QR8 A;  1R4Q B;  1SN8 A;  5LMU Q;  4PQX A;  1WTV A;  4DR6 Q;  1LAC A;  2F0W A;  2JSO A;  4KJN A;  2I5L X;  5E3F A;  4GOP B;  3RNU A;  1TT2 A;  1YHB A;  4DV2 L;  2Q2H A;  2LSS A;  1YIT A;  1GHJ A;  2NN6 H;  3CKI B;  3L2P A;  2R7D A;  2L0C A;  3A7A B;  1XPR A;  1JT8 A;  2XWJ B;  4QJF A;  2RDF A;  1KDC A;  2E2H B;  2OQ0 A;  4WJ3 M;  4NPS A;  3T16 A;  4X65 Q;  2BA1 A;  2E74 C;  4JK1 C;  4N8X 1;  1SNQ A;  1EY9 A;  3K0Y A;  4LFA Q;  5C3W A;  1WTX A;  3H0G G;  5GAG C;  1SE2 A;  1N33 Q;  5BN5 A;  4L5R C;  1H9M A;  2YTV A;  4APV A;  5DNF A;  3I70 A;  1YNN D;  2F0O A;  1SNO A;  1A2T A;  2CQO A;  1YBY A;  1TY0 A;  1VQN A;  2ZTE A;  4KD4 A;  5C4J H;  3A7L A;  3I4N H;  2BDN A;  1DM0 B;  1E22 A;  4GN4 B;  3JAM L;  1U4L A;  3VR5 A;  4DN4 M;  2I46 A;  3DM1 A;  2AKW B;  4EQP A;  2JA9 A;  4N9T A;  1FNV A;  2L5T A;  5FJ8 G;  2NN6 I;  4H7B A;  4LFC Q;  1MD2 D;  4A3G G;  2WFW A;  1V43 A;  3GD7 A;  4GKK Q;  1N34 Q;  1P16 A;  1SE3 A;  2KBN A;  5M5Y B;  4FF2 A;  1PTO F;  3DHQ A;  4AQY Q;  3BVG A;  2R92 G;  4JI2 L;  4KJO A;  2B2Y A;  4C56 C;  2HUG A;  1HNW L;  1GHK A;  4JI3 Q;  1K3B C;  3A5U A;  2X6L A;  3UE1 A;  2EY6 A;  1EIF A;  4LF7 L;  1JJG A;  4C3I G;  5JJL A;  2WAQ G;  3NEM A;  1BDO A;  2K33 A;  4AYB G;  3SR1 A;  3VA7 A;  4A3I G;  4RWS C;  5EKK A;  2NB0 A;  3OIQ A;  4HIK A;  3L3O C;  4FXD A;  1JC7 A;  2F0M A;  2QDL A;  4DV2 Q;  3G71 A;  1A62 A;  1AP0 A;  4DK0 A;  1VMP A;  4FP5 D;  2EOT A;  3J7Y W;  4IUR A;  1TII D;  2NVY B;  1DZ1 A;  4RKL A;  3MA2 B;  4QIW E;  4YCW A;  4DNI A;  3D0F A;  2F0V A;  3N52 A;  2I5M X;  4B9W A;  4WOR A;  4ZCK A;  4P72 A;  2HQL A;  3TP8 A;  1C8C A;  1I6H B;  3KF6 A;  1GUW A;  2A6E C;  3E0J A;  3FPU B;  1VF5 C;  2K28 A;  4KHP L;  3GTQ B;  2NVQ H;  4K5X A;  4XYO A;  2Q8T A;  3S2H B;  1OTC A;  2QEX A;  4PV1 C;  4MNO A;  1XWE A;  3UE0 A;  1NY4 A;  5IY0 A;  4WFN 3;  5CV4 A;  2PW7 A;  3NWT A;  4KV6 A;  4DF7 A;  2VNU D;  4GS3 A;  1F2M A;  3HOW H;  1N9W A;  1B53 A;  1EWC A;  1WD1 A;  2BE5 C;  2F0T A;  4KTA A;  5FLX c;  1II3 A;  2DY7 A;  3U4V A;  4DR4 L;  1AEX A;  1Q12 A;  4HTH A;  4PG3 A;  1EYA A;  1J6Q A;  4KKS A;  4GLX A;  3MXN B;  1LLR D;  2E75 C;  5D14 A;  3S15 H;  3H91 A;  3M9B A;  2MO1 A;  2EY5 A;  1WTO A;  2Y0S E;  1BCP F;  1EU4 A;  5HY6 A;  3HOV G;  1CI3 M;  5CBA E;  1EY8 A;  4QGU A;  5EKL A;  1EQT A;  3U9O A;  1RL2 A;  3PUZ A;  2A6E D;  3E9I A;  4YWK A;  1RJT A;  1X55 A;  2JN4 A;  3KBX A;  3FHW A;  3K58 A;  1AZQ A;  2O2L D;  4I65 A;  3PUY A;  5CR3 A;  3X3M A;  1TS2 A;  4A3C H;  1SEB D;  2LY7 A;  1EFW A;  3OW2 A;  2JA7 B;  3M7N A;  1N36 Q;  2HT1 A;  4K8I A;  4NMZ A;  1D6E C;  3GTP B;  4XXE A;  5FO9 B;  1BXT A;  1O7L A;  3ICE A;  2BE5 D;  2AUJ D;  2ATW A;  2KEN A;  3S2D H;  1FR3 A;  2EJM A;  4YY3 L;  1JOR A;  4JC0 A;  1LTA D;  2DN8 A;  3AB9 A;  4J6H A;  4A3E G;  4LW1 A;  2CVR A;  5DM6 3;  4KHP Q;  4OWW B;  2RCN A;  4C1N K;  4ZUJ A;  4GNX B;  1A2U A;  1B70 B;  2E2J H;  4K0K L;  1PH6 A;  1DOL A;  4JBM A;  2JEB I;  3SE0 A;  5GAH C;  3PUV A;  4RGO S;  1JE4 A;  2A6H C;  4BA2 I;  3QOJ A;  1PHJ A;  1WCM B;  1QVC A;  1JWM D;  5JPN C;  4WJ4 A;  3CHB D;  1HQM C;  2RDG A;  1ET6 A;  1NNX A;  1JOO A;  1VQO A;  3BVZ A;  2F0S A;  1HJP A;  1EIG A;  1HFG A;  2P5Z X;  1NE3 A;  4DR3 L;  2OTJ A;  5IGD A;  1VQI A;  2Q2U A;  1D5X C;  1LT5 D;  4QMG A;  1CKO A;  3NUC A;  2WP8 J;  1ASZ A;  1IYU A;  1WTH A;  5T1I A;  2N49 A;  5JJK A;  4K8J A;  1C7Y A;  3NQI A;  4NB3 A;  1QZG A;  4QCL A;  2ALY B;  2F0J A;  1ML0 D;  1VQL A;  4P71 A;  1U5K A;  1FVI A;  2EY2 A;  3RZD B;  3IFD A;  2IJ0 A;  4B3T Q;  1Z9F A;  1NBW A;  3KUP A;  1IZ6 A;  2F0P A;  5G3L F;  1L0W A;  4JYA L;  2Z4H A;  4AH6 A;  2NZO A;  3H3V C;  1SJE D;  2A6H D;  4YWM A;  1G2S A;  3P1H A;  4O2D A;  3H3V H;  1STN A;  2OXP A;  4GKJ L;  1C0A A;  1CT1 D;  3S1R H;  1GD7 A;  1PFN A;  4YY3 Q;  2EYO A;  3M3Y H;  5C4X H;  1M8A A;  3KF6 B;  4GLA C;  3ZJY C;  2K04 A;  1EY4 A;  5M3M H;  3GV3 A;  4KHV A;  4L5T A;  5BN4 A;  2A8V A;  2SDF A;  2B8F A;  3KBG A;  4LNQ A;  4FO2 A;  3K8A A;  1FL0 A;  3QG1 A;  1TWF B;  4XQN A;  4DR1 L;  2A69 C;  4JI6 L;  2G5D A;  1TWC H;  4BWG B;  4K0K Q;  2SNS A;  4JBK A;  4P75 A;  2KVM A;  1OXX K;  4OL7 A;  5C3E G;  2AHO B;  5KEE A;  2GVA A;  2RQX A;  1MIU A;  5FKA C;  1HZC A;  5IP7 H;  1XTD A;  1VQ4 A;  1X3E A;  2WAQ E;  1PZK D;  5ELD A;  4AYB E;  2ZJP A;  1B8A A;  5IP9 G;  1F2Z A;  4MTK A;  3H3V I;  3J80 L;  4RA8 A;  1JMC A;  5KYL A;  1CHP D;  5FLX E;  1L0X B;  4DR3 Q;  3KYH C;  1LAB A;  1RTN A;  2F0N A;  4XYQ A;  2D9U A;  4DKA C;  2MP1 A;  4LF8 Q;  1CQV A;  3BVM A;  2EYL A;  4OEL B;  4HAE A;  1CKM A;  2VS1 A;  4XQQ A;  3TRE A;  2UXD L;  5JVH 3;  3P20 A;  4AIM A;  2AUK A;  1KQS A;  2F0H A;  1YI2 A;  1KHI A;  2C9O A;  4A3C G;  2MGS A;  1HUN A;  1D1K A;  4PZ8 A;  5CV6 A;  1H9J A;  2ID0 A;  4R1J A;  2VL6 A;  1RCV D;  5EPK A;  4JYA Q;  5C4J B;  1CA6 A;  2PQE A;  3I4N B;  2M00 A;  3I4M G;  1T9H A;  4UPA A;  4NDX A;  4GN3 B;  4TVA B;  2KJX A;  3I91 A;  4G4K A;  2JA8 G;  3CPW A;  1UUP A;  4C2M B;  1JE5 A;  3DEO A;  1Y1W G;  3TZU A;  4C3J H;  1OXU A;  1SSO A;  4DR1 Q;  1B44 D;  3PO2 G;  2K05 A;  1YJ9 A;  1NMG A;  4K6L A;  4IZ8 A;  4A3K G;  3U58 A;  3D8G A;  1LTI D;  3C2P A;  1JCK B;  3HOY H;  1K83 H;  4DV5 L;  4CKC A;  1EQR A;  4BXX H;  4O42 A;  2TMP A;  2KEE A;  4F88 A;  2Z9H A;  1QOH A;  1Z6H A;  1XYI A;  3K59 A;  1TVX A;  2QCP X;  3E0E A;  5KNB A;  1STE A;  2YU9 H;  1QVG A;  1RHP A;  1SDF A;  1PMR A;  3T51 B;  3MFG A;  2J0T D;  5LL6 S;  2MO0 A;  3OHX C;  4HJ8 A;  1PA6 A;  1SRO A;  5E4W C;  3AMU A;  4A3J G;  2UXD Q;  4MTN A;  3S1M H;  1JB7 A;  2XNA C;  1QJO A;  5FK9 C;  2I0Q A;  3I56 A;  2CH4 W;  3M4Y A;  2IHE A;  5J1Z A;  3TBI B;  4DK3 C;  2XSC A;  3GQB A;  3J7A V;  4A3B H;  4IFD J;  5LMN L;  3OTO L;  5JPM C;  1UEB A;  3H0G H;  3JAM i;  3GTG B;  2JEA I;  2F0G A;  3HOW B;  1SFO B;  1YNJ D;  1Q3L A;  1SRU A;  5M5X H;  4DK1 A;  1VQP A;  3F8T A;  1GUS A;  2PNR C;  4BBS H;  1B9M A;  1S5C D;  1D5Z C;  2VB2 X;  1M1K C;  1BNZ A;  4R8N A;  5BR8 L;  1XJV A;  2VXW A;  3FKI B;  3S17 H;  2MHV A;  3CQZ B;  2DNE A;  4YCU A;  1HUM A;  3S15 B;  2Z6B A;  3E3X A;  2IY5 B;  4FDB A;  5FJ8 H;  1E0B A;  3QO2 A;  1GVP A;  2V1C C;  3C3L A;  4ZYS A;  2LS0 1;  4A3G H;  3U4Z A;  5FOB B;  4RKB A;  1IKL A;  3I8Z A;  5IP7 G;  2B2U C;  1TS5 A;  2CKZ B;  1WVL A;  1RIP A;  2CW0 C;  4BS9 A;  5KYI A;  2R92 H;  3D6W A;  4DV5 Q;  1G6P A;  2B63 H;  3I90 A;  1Z47 A;  4DV4 L;  3DM3 A;  4MN3 A;  5KNC A;  1Q1E A;  1HR0 L;  3H09 A;  2RF4 A;  4IUU A;  1PVO A;  1PH4 A;  3TRZ A;  1PYB A;  2OEO A;  4Y7N H;  2VB3 X;  2Z1C A;  4RG1 A;  1I4P A;  1X65 A;  2WKC A;  3JAM E;  4HED A;  3EQL C;  2LMC B;  5T1G A;  1RKN A;  5GAE C;  4PMC A;  4PNY A;  1XXG A;  1E1T A;  2D62 A;  1FJG L;  4NW2 A;  4X6A H;  4DAM A;  2TSS A;  3GV6 A;  2AQ1 B;  2ZJQ A;  1CUK A;  1D8L A;  2JA5 G;  4FF3 A;  2DGY A;  3N6R A;  1ONL A;  3KLS X;  3Q22 A;  1YIJ A;  1N32 L;  4DU9 A;  4JI0 L;  4DAV A;  3ONA B;  1W3S A;  5LMN Q;  3OTO Q;  5IIF A;  3KDF A;  4B08 A;  2FJ2 A;  1S40 A;  2CH4 A;  3D31 A;  3G7L A;  2R7Z G;  3T4A C;  1Z7T A;  4A3F H;  1FYC A;  2CW0 D;  3U50 C;  1SNC A;  1WJJ A;  3LWE A;  4IUN A;  5BR8 Q;  4DV1 L;  1AE3 A;  1X3Q A;  4BY1 G;  1T5E A;  4G57 A;  2WII B;  4R9W A;  4YIJ A;  4RGN A;  2K14 A;  3TSS A;  2K01 A;  1WOC A;  4PZ7 A;  4Y52 H;  2PMZ E;  3D6C A;  1VQ9 A;  3V2T A;  1PYW D;  4IUQ A;  2K75 A;  2D5D A;  4FVM A;  5ELB A;  3HOY G;  3HOU G;  3MXN A;  1D7Q A;  1MHW C;  2K6A A;  2KHJ A;  4BY7 G;  4BXX G;  1MKH A;  3I72 A;  1VCI A;  3TEH B;  1EQQ A;  3BDL A;  1LTL A;  1BR9 A;  2IW3 A;  2SNM A;  2YYZ A;  4DV4 Q;  1HR0 Q;  2CWA A;  4FXK C;  4LUZ A;  3R93 A;  2RVL A;  1S5B D;  1QWY A;  4XTC S;  4P2C B;  5HGQ A;  1U4R A;  1U9R A;  4JI7 L;  1CSP A;  2PNH A;  1SYD A;  3VDY A;  3KFU A;  4O0A A;  3PO3 H;  1TWG H;  4PZ6 A;  1L2F A;  3S1R B;  3AFQ A;  1FJG Q;  3SGI A;  5C4X B;  2UUA L;  4K5W A;  5M3M B;  4J8Q A;  4DUZ L;  1BVS A;  5FLM H;  3O13 A;  4HN7 A;  4A3B G;  3UDG A;  4C1N I;  1N32 Q;  1ENF A;  1Q90 A;  1B9N A;  1TWC B;  4JI0 Q;  1I50 H;  1XX8 A;  2EJG C;  2Z6K C;  4YCV A;  2B2T C;  2IWH A;  2D0O A;  3D4D A;  1FGU A;  4A3E H;  2WB1 G;  4BBS G;  1EY7 A;  1KDA A;  4GNX A;  1KC8 C;  1H9K A;  2X69 A;  3SK8 A;  2Z8L A;  4DK6 C;  3NTH A;  3ITP A;  3KOJ A;  4DXF A;  5E7N A;  3K5M A;  2UUB Q;  1KD1 C;  4DV1 Q;  5A2Q E;  1PFM A;  3PIP 3;  4X3S A;  3NEL A;  4H0L C;  1LYL A;  1KL9 A;  1BO0 A;  3NBI A;  4L8J A;  4XT1 B;  1K8G A;  4FXG C;  4OGQ C;  2B63 G;  3RUZ A;  3J7A F;  2KQ3 A;  4OHJ A;  1G51 A;  4RGM A;  2Y0S B;  3L9A X;  3SK6 A;  3VR6 A;  1PTO C;  3PIO A;  2KCN A;  2R93 B;  4A3D G;  1A63 A;  1I6V C;  2F0K A;  3SVM A;  4JI7 Q;  1MGS A;  1I5F A;  1PTO H;  4M8A A;  3M7G A;  1FD7 D;  1TS3 A;  5I6W A;  1X6O A;  2L4N A;  4R4O A;  3V05 A;  3A54 A;  1G8Z D;  2K5W A;  2UUA Q;  2K03 A;  4S3S A;  1SBB B;  4HR7 B;  1VQ7 A;  3F1Z A;  4DUZ Q;  1PLF A;  2O4X A;  1HFN A;  4C3J B;  3NBH B;  3CW2 C;  1UAP A;  1YHQ A;  2BH8 A;  4OON A;  3DLL A;  1G6Z A;  4YHH L;  4IOC A;  2B39 A;  2B29 A;  1VS0 A;  2QF7 A;  3KJP A;  3KDF B;  2ES2 A;  4A3F G;  5JJZ A;  1O78 A;  4B9X A;  4KN7 C;  4A93 B;  3PV0 A;  4DV6 L;  4CDE C;  2KHI A;  3RMH A;  1VQM A;  1EEI D;  1QB5 D;  2YTX A;  2VUM B;  2XVS A;  4OWT B;  3E5S A;  2EYH A;  3HKZ G;  3RZO B;  4TQU S;  1K73 C;  1LTT D;  1PRT F;  3BZK A;  3D3R A;  4PMW A;  3CU7 A;  2XRS D;  3ND9 A;  3J80 i;  1PTO D;  3BU2 A;  3CCM A;  3TDQ A;  5C3E H;  1LTS D;  4LF5 L;  4K2L A;  4OEM B;  2YU9 B;  1VQ5 A;  2R3Z A;  3PSI A;  1TS4 A;  1STA A;  1C48 A;  4DXG A;  1EY6 A;  2JP1 A;  2RHQ B;  5DAU A;  5IT9 L;  3HGB A;  5IP9 H;  1G91 A;  3Q23 A;  1JOK A;  4JI2 Q;  1F9R A;  2J4X A;  1WFQ A;  1NUC A;  4RCN A;  1HNW Q;  1EIH A;  3TS0 A;  1ILQ A;  1R4P B;  2ZXR A;  3S16 B;  4ZQ3 A;  4LF7 Q;  2OWO A;  3VA5 A;  2JA6 G;  2EDG A;  4X3K A;  1UE7 A;  3BYT B;  5M3F G;  1E2Z A;  1WTQ A;  4IUP A;  5HUR A;  3H0G B;  2IX0 A;  4JOI C;  1IKM A;  3PO3 G;  2VY3 A;  4A75 A;  1L1O C;  1BCP C;  3HRZ C;  4OXP A;  2EYF A;  1SYB A;  2L15 A;  3EVQ A;  2N55 A;  3GTL B;  3E9H A;  5FLM G;  1LT4 D;  2UXC L;  3I4M H;  4BBR G;  3S17 B;  5AFW A;  3J80 E;  1LUZ A;  2ICE C;  3A8I E;  5J22 A;  3GTK B;  4YHH Q;  1S5F D;  4HSP A;  3GTM B;  2JA8 H;  4A3G B;  1VQA A;  1NTG A;  5IYC H;  1YJW A;  1Y1W H;  2IX1 A;  2NYZ D;  2YTY A;  4DV6 Q;  1VQE A;  5JAV A;  1TXY A;  4P73 A;  4K5V A;  1J8I A;  4H13 C;  4V0B A;  1A8V A;  2R92 B;  4KI0 A;  1MI2 A;  3PO2 H;  3F2C A;  3NTI A;  2ZXP A;  2K32 A;  4QB4 A;  4A3K H;  1DCZ A;  3BZC A;  4NXM L;  1LO5 D;  5C6A A;  5EPL A;  3L7Z C;  1CTM A;  4MIU A;  3QIA A;  3LGJ A;  4JV5 L;  4LF5 Q;  4Y7N B;  4C3I B;  4EVO A;  1PH2 A;  4DR4 Q;  3SK5 A;  5COR A;  1BCP D;  2WAQ B;  5C44 H;  1XNR L;  4AYB B;  3ZYY X;  4TKO B;  1O7Z A;  4A3I B;  4C3H H;  1Y1V H;  3PF4 A;  1GOZ A;  2HDM A;  5J3B A;  5JJI A;  3B6Y A;  5IOD A;  4ZK9 B;  1K9M C;  2L9H A;  4KKU A;  1F77 A;  1T5X D;  2E2I H;  3NXW A;  3KJO A;  3NHH A;  4HIO A;  3KF8 A;  3FP9 A;  2H5X A;  3J81 L;  1ENA A;  2IPK D;  2PZT A;  4KY7 A;  3K0X A;  4H44 C;  1SAP A;  1A3V A;  4A3J H;  1W6J A;  4OO1 G;  3GTJ H;  2IT1 A;  2ZM6 L;  4ZUI A;  2E5L L;  5IGB A;  4U67 3;  4JW0 A;  1TWH H;  1B3A A;  2Q2I A;  1TU2 B;  1ESR A;  4ODG A;  4Q5V A;  3UI2 A;  3EN2 A;  3HOZ H;  2JQO A;  2WB1 E;  3KK7 A;  3IFT A;  2AQ2 B;  2JYO A;  4DV3 L;  2K5N A;  1O80 A;  3Q0A A;  2GVB A;  1V8Q A;  5I2Y A;  2EXD A;  5D3D A;  2UXC Q;  1KRT A;  5BN3 A;  1HPC A;  2KCM A;  2XIW A;  4KY5 A;  1YVC A;  2F3I A;  2J7Z A;  4CJ2 C;  3Q24 A;  1PH8 A;  1CM9 A;  3EIV A;  3F2B A;  5K36 H;  2KA7 A;  2B8G A;  2K52 A;  1R9T B;  3AQQ A;  1I4H A;  2PYK A;  2PI2 E;  2PZW A;  1YHA A;  5DLQ E;  4ZRZ A;  1EQV A;  4L5S A;  1VQ6 A;  3HOV B;  4NXM Q;  3I55 A;  4OX9 L;  4QY7 A;  1PDQ A;  2N3S A;  3HZX A;  2MFI A;  2E2H H;  2Z4I A;  2E76 C;  4N8F A;  2WIN B;  3F2U A;  4JV5 Q;  3C1E A;  5L37 A;  3PUX A;  5HGT A;  1XNR Q;  1CZG A;  2EQS A;  4X66 L;  1GO3 E;  3JAM c;  1DGS A;  1PFB A;  3AFP A;  4RHS A;  5EQ0 A;  3PO3 B;  3KLR A;  4FF1 A;  3K6O A;  4POF A;  1E2W A;  5M9O A;  4ALP A;  5ISR A;  1ESF A;  4UY8 C;  3NE5 B;  2FMM A;  5I9O A;  1QUQ A;  1FNW A;  3IRB A;  1RD9 D;  4LUV A;  3P75 A;  5G3L D;  1HNX L;  3VYR A;  2V4D A;  4KD3 A;  4DNR B;  1WTP A;  2HHH L;  4LMQ D;  2F4I A;  4JBJ A;  1I50 B;  1QG7 A;  1LT3 D;  2ZM6 Q;  1F9Q A;  4R8I A;  2E5L Q;  1TQO A;  4A3E B;  3F2D A;  5CMD A;  2A69 D;  3CCS A;  4IFD H;  2JA5 H;  1STH A;  2WV6 D;  3ULL A;  4DV3 Q;  2K7V A;  1TWA H;  1VQC A;  2OTL A;  5M5Y H;  3HKZ E;  5JOB A;  1A0I A;  3I4L A;  1I4G A;  4LJZ C;  5D3I B;  1PZJ D;  4BA1 I;  1VQD A;  2R7Z H;  3SHL A;  2N88 A;  1CA5 A;  4GKJ Q;  3L0O A;  5IYC G;  3TQY A;  3P7J A;  1SYG A;  1PH1 A;  4IO9 A;  4A3M G;  1GXD C;  4FNF A;  5E4X A;  3R2I A;  1EWH A;  4BY1 H;  1BF4 A;  1BBX C;  4JI6 Q;  3OSO A;  1KIX A;  4TSS A;  1OO9 B;  4HCE A;  1JQY D;  3TME A;  5CV7 A;  1CZW A;  1LTG D;  4IFD I;  1HNZ L;  4OX9 Q;  2KCC A;  3HOU H;  3NWS A;  5C44 G;  3CRL C;  4BY7 H;  1K8A C;  2ZTC A;  4C3H G;  1Y1V G;  1E3P A;  1YEZ A;  3CCJ A;  1PTO B;  3CCU A;  1ZXT A;  2XWB B;  3TP5 A;  1Y14 B;  1EIY B;  1I6H H;  1V1P A;  1D5M C;  3WWV A;  3H6M A;  4V19 0;  2HCI A;  3GTQ H;  4UHV A;  4YWL A;  5JVG 3;  3CMA A;  2E2D C;  3KF8 B;  1JJ2 A;  4KLK A;  4X62 L;  2H1E A;  1HNZ Q;  1BBU A;  1YZ6 A;  1M4V A;  1HNX Q;  3S1Q H;  3BJU A;  2HHH Q;  3PQI A;  5J39 A;  3BDC A;  3H94 A;  3MEH A;  4DNT B;  1DJR D;  1X3G A;  3HOZ G;  2NVQ B;  4RCO A;  5M5W H;  4LF9 L;  1HTL D;  1IHZ A;  2AWN A;  3ERS X;  4CBV A;  4DR7 L;  2BOS A;  4HSV A;  2YV5 A;  4FYD A;  2F0U A;  2CCZ A;  3PGZ A;  2NZH A;  5C3E B;  1IYV A;  3VYS A;  3W1B A;  1SXT A;  4CHT B;  2NUC A;  2K50 A;  1WYD A;  4JI5 L;  2D2C C;  5K36 G;  4NP5 A;  1Q8K A;  2G9D A;  1MJE A;  3FVQ A;  1AE2 A;  3VYU A;  3QB3 A;  5ELN A;  3TZD A;  2A1A A;  2JXM B;  1CKN A;  5FLX L;  4CKE A;  1XMQ L;  2JA7 H;  2AMC B;  1EOV A;  1KAA A;  3K7A H;  4H02 A;  1DON A;  2UU9 L;  3UDX A;  2VW9 A;  2R6G A;  1Q46 A;  2N8N A;  2NVX H;  2F0Q A;  1KLG D;  4FF4 A;  2K5H A;  2EPB A;  4XQJ A;  2X6G A;  3R8B A;  3AU7 A;  1GJX A;  1HHV A;  5ELF A;  1UNS A;  1SNM A;  1SE4 A;  2ZTD A;  5DEH A;  1BCP B;  5IOC A;  4B3R L;  3H15 A;  3BS1 A;  1CQF A;  5EJW A;  4A3D H;  3OIP A;  1D2B A;  2KEC A;  4ABN A;  3I4M B;  2EE1 A;  3S2D B;  4HJ5 A;  4X62 Q;  2A68 C;  1QUQ B;  1EY5 A;  1Q1B A;  4DA2 A;  3OW7 A;  1VDZ A;  4QUC A;  1WTW A;  4ID6 A;  2JA8 B;  1Q8I A;  5IGC A;  3STB C;  4GN5 A;  5LMU L;  1TR5 A;  4RAU C;  4IFD G;  2PW5 A;  3IL8 A;  2F0D A;  2HQE A;  2OQK A;  1Y1W B;  3I7F A;  3NBH A;  2PO4 A;  2RKS A;  2E2J B;  3T1H L;  1SJH D;  1QE6 A;  1CK1 A;  3OMG A;  3HFZ B;  1PYS B;  2B2Y C;  3PO2 B;  2F03 A;  2HCC A;  4A3K B;  1SND A;  3E6Z X;  4CJ0 B;  3IKJ A;  3ER0 A;  4WRD A;  4P74 A;  1EZ6 A;  3PCO B;  1N8R C;  2GA4 B;  2C5C A;  2HDL A;  3G6J B;  2ZXO A;  2OCE A;  1F2L A;  1I3Q H;  3OPO A;  3LWU A;  4HID A;  3MZ5 A;  4LFA L;  2F3W A;  4KKT A;  4LUO A;  1A3T A;  3TN2 A;  3FRP B;  3RZD H;  4IPH A;  3DWP A; 
#chains in the Genus database with same CATH homology
 2E2I B;  4IUT A;  3SXH A;  3K5L A;  3IAY A;  2LKV A;  4A3J B;  2K5D A;  4ILW A;  3VR2 A;  1D1I A;  3ND8 A;  3BYY B;  3M85 A;  4RFB A;  3QJY A;  1V1P B;  3WDN A;  1STG A;  2F0E A;  4JBW A;  4HMJ A;  2L12 A;  2KED A;  1NR4 A;  2BDO A;  2EXZ A;  1YNN C;  1MBY A;  1CHQ D;  2FIN B;  1G29 1;  3DWA A;  3M3Y B;  3WOF A;  2F0F A;  4QIW B;  3W2D A;  4K6D A;  4KMU C;  2FMC A;  5IT9 E;  5C0X J;  3Q6S A;  3SDZ A;  1JB3 A;  5CYU A;  3HP3 A;  3PMF A;  3W3A A;  3LX0 A;  2ICI A;  2B2U A;  3K5N A;  4L63 B;  2L1B A;  4X3T A;  1TKW B;  1WTR A;  5I4D A;  3K57 A;  4G7O C;  2M9V A;  1I4Q A;  2OT2 A;  1QIL A;  1B1Z A;  2F0L A;  3I3C A;  5NUC A;  4RH6 A;  4CKB A;  2KHS A;  5LL6 X;  1BUV T;  4EQO A;  2EVB A;  1SMY C;  2FHT A;  1OXT A;  2F0I A;  5I2X A;  3FPP A;  3PUW A;  2JA5 B;  3BG3 A;  1TWA B;  4OO1 H;  5KRU A;  5D65 A;  3X3N A;  3RD4 A;  1X32 A;  5KIX A;  4EQN A;  2R7Z B;  3OMC A;  1X3P A;  1JWU D;  2XRQ D;  3MXU A;  1KDB A;  2M2L A;  2G9H D;  4J1M A;  5C0X G;  1ZYR C;  1F9S A;  5JEA J;  1FGB D;  2SOB A;  4PMB A;  4BY1 B;  4ZAI A;  1EZ8 A;  3T53 B;  2ENB A;  3A8J E;  2B2V C;  1B4O A;  1NCV A;  3J81 E;  3HOY B;  3HOU B;  3TP6 A;  1K83 B;  1LTR D;  1KTK A;  1SMY D;  4BY7 B;  4OO1 I;  1IW7 C;  2WKD A;  3V96 A;  1EEF D;  3SEB A;  4DAP A;  2O5J C;  1CFM A;  2A73 B;  5DM7 3;  4L6T B;  2F1M A;  1RF2 D;  2RSN A;  2EYJ A;  1C4Q A;  4Q0F A;  4N9P A;  4NKL A;  2QDB A;  1PRT C;  3S1M B;  3CRK C;  3S1Q B;  1ZYR D;  2EZV A;  1L0Y B;  1JOQ A;  4TRD A;  1LT6 D;  3QOL A;  3I73 A;  4A3B B;  3U9S A;  5M5W B;  4OIJ A;  1HQR D;  1UEA B;  5EBD A;  5EKI A;  2BA0 A;  2B2W C;  5M5X B;  1STB A;  1EY0 A;  3MFY A;  2B2T A;  2WB1 B;  1IW7 D;  3T56 B;  3PIO 3;  4BBS B;  1S5D D;  3RLF A;  5JEA G;  1DD2 A;  4MHE A;  5I6Y A;  1HXY D;  3FEW X;  2Q8R E;  5IGG A;  5A2Q L;  2NN6 G;  4DAY A;  3K5O A;  1PRT D;  2I07 B;  3BZD B;  1HRJ A;  2MUY A;  3FMC A;  3K7A B;  1E2V A;  3NSW A;  3NPP A;  4OIK A;  1BQQ T;  2RA4 A;  1Y8O B;  4IN3 A;  1NSN S;  2KOL A;  2NVX B;  1A6X A;  1V1O A;  2B63 B;  4ZLT F;  1O7Y A;  4F7X A;  1HCZ A;  1ZKO A;  5KGU A;  2PZU A;  3T13 A;  4A3D B;  3MTS A;  5F2D A;  3S9W A;  1S4Z A;  3MXG A;  4KHZ A;  1K8M A;  5CV5 A;  2DNC A;  5EGT A;  3KLS A;  4ME5 A;  1JR0 D;  5KND A;  2FFK B;  3D4R A;  2MJ8 A;  5TSS A;  2PPB C;  2SEB D;  2A74 C;  2R61 A;  5FO8 B;  2K1B A;  4A3F B;  1ILP A;  2B2V A;  1RTO A;  1I3Q B;  2Q8I B;  3HKZ B;  3WOE A;  3HEJ A;  5CV9 A;  1QCB D;  2NTT A;  1GUT A;  4HCS A;  5LHY 1;  3MAQ A;  3VYT A;  3A56 A;  2NZ1 D;  5EBC A;  5IGE A;  1TY2 A;  1H9S A;  1KLU D;  2QKI C;  1JIC A;  4K2K A;  2WAC A;  1W6K A;  4KN4 C;  4LAA A;  3DEP A;  1STY A;  3TP7 A;  4QF4 A;  3A55 A;  2DY8 A;  5C5L A;  2JA6 B;  3DMU A;  5M3F B;  3MHB A;  1QNU A;  5CV8 A;  2L11 A;  5CBE E;  3OWE B;  3VR4 A;  3ERQ A;  1TWG B;  3LNN A;  2B2W A;  2AQ3 B;  1ICW A;  2NWG A;  2CHB D;  1LTB D;  2NBF A;  4G7H C;  4BBR B;  5K5P A;  4M1U B;  2EJF C;  1NAP A;  4CJ1 B;  3FDT A;  3BDO A;  3URY A;  2EY1 A;  3GP7 A;  3S14 B;  3M4O B;  2LFN A;  4IQZ A;  2KUM A;  1OXS C;  3NQT A;  4DGZ A;  4G7Z C;  2JE6 I;  5EPJ A;  2L55 A;  4HMI A;  3S1N B;  3EFX D;  2NTS A;  4ZKB B;  1EFI D;  5IGF A;  2AWO A;  2EYM A;  1KNE A;  1K8O A;  1VF7 A;  4RHR A;  4I7Z C;  1B50 A;  3OOC A;  1DYQ A;  5C5M A;  3DXJ C;  1SYF A;  4WJW A;  4GZY C;  1DOK A;  1EU3 A;  5E1F A;  2QIL A;  1VMC A;  4U68 A;  5C3X A;  1Y8N B;  4KY6 A;  2MPM A;  1AW7 A;  1ET9 A;  2RSO A;  2NVT B;  1YNJ C;  1IL8 A;  5COY A;  2PCF B;  4DFA A;  1MSH A;  3OWF A;  1GUG A;  4Z9C B;  3GTO B;  1DOM A;  4CGY B;  1KNA A;  2QEJ C;  1FNU A;  2BCO A;  3SK4 A;  5ELE A;  4O1N A;  1HA6 A;  1AZP A;  1PXU A;  2ZT9 C;  3ERO A;  4QUF A;  4UDU C;  1H9S B;  1SYE A;  1PRT B;  3NTK A;  2PMZ B;  4IUV A;  1I4R A;  4F8M A;  1AFP A;  5C4Z A;  4K14 A;  4XT3 B;  1EOT A;  3MC0 B;  1DXM A;  1B2T A;  1XTC D;  1JWS D;  4ZKC B;  1A15 A;  4X3U A;  1RDP D;  3DWQ A;  3HOX B;  1A3U A;  4IAL A;  1SYC A;  1HTP A;  2H4O A;  4EGV A;  3C1F A;  5FO7 B;  2F3V A;  2IX3 A;  1AN8 A;  5A35 A;  3VR3 A;  1EYC A;  1F9P A;  2CQA A;  5C0X H;  3HG9 A;  4A3M B;  3R3O A;  1HA5 A;  2RBM A;  2XN9 C;  3NP8 A;  1WD0 A;  1MSG A;  1F2Y A;  1Y8P B;  3HS0 C;  5CC4 A;  3GO5 A;  2RDH A;  1ENC A;  3R2T A;  4KK7 A;  1EYD A;  3MXP A;  5C44 B;  1I4X A;  1QNK A;  2EYP A;  4C3H B;  1Y1V B;  3NK9 A;  3C46 A;  1G2T A;  3EA6 A;  3EJI A;  5ELC A;  4XIG S;  1J9O A;  4RGT A;  2A5H A;  1GUN A;  3D4W A;  1NR2 A;  2A68 D;  5C0X I;  1SNP A;  1H9R A;  3MWY W;  4E6I A;  5I9P A;  4XDX A;  1KAB A;  3GTJ B;  1Y69 U;  4C3J G;  1U4M A;  5CGK A;  5C4H A;  1S5E D;  2O5I C;  1TWH B;  4UAI A;  4F87 A;  2K5Q A;  2OF1 A;  3QWN A;  3HOZ B;  3MVV A;  3A8K E;  1OXV A;  4ULL A;  1BOS A;  1LV9 A;  1EL0 A;  3DUZ A;  1ROD A;  2IL8 A;  1PZI D;  1ZEQ X;  1GUO A;  5JEA H;  4LK1 C;  1U4P A;  1R4Q B;  4PQX A;  1WTV A;  1LAC A;  2F0W A;  2JSO A;  4KJN A;  5E3F A;  1TT2 A;  1GHJ A;  2NN6 H;  3CKI B;  3A7A B;  2L0C A;  2XWJ B;  2RDF A;  1KDC A;  2E2H B;  3T16 A;  2BA1 A;  2E74 C;  4JK1 C;  1SNQ A;  1EY9 A;  3K0Y A;  5C3W A;  1WTX A;  1SE2 A;  5BN5 A;  1H9M A;  5DNF A;  3I70 A;  1YNN D;  2F0O A;  1SNO A;  1A2T A;  1TY0 A;  4KD4 A;  3A7L A;  2BDN A;  1DM0 B;  3JAM L;  1U4L A;  3VR5 A;  4DN4 M;  2I46 A;  3DM1 A;  4EQP A;  4N9T A;  1FNV A;  2L5T A;  2NN6 I;  4H7B A;  1MD2 D;  1V43 A;  3GD7 A;  1SE3 A;  5M5Y B;  4FF2 A;  1PTO F;  3DHQ A;  3BVG A;  4KJO A;  2B2Y A;  4C56 C;  2HUG A;  1GHK A;  2X6L A;  2EY6 A;  4C3I G;  1BDO A;  2K33 A;  3SR1 A;  3VA7 A;  4RWS C;  5EKK A;  2NB0 A;  3OIQ A;  3L3O C;  4FXD A;  1JC7 A;  2F0M A;  1AP0 A;  4DK0 A;  1VMP A;  4FP5 D;  2EOT A;  3J7Y W;  4IUR A;  1TII D;  2NVY B;  1DZ1 A;  4RKL A;  3MA2 B;  2F0V A;  3N52 A;  4B9W A;  4WOR A;  3TP8 A;  1C8C A;  1I6H B;  1GUW A;  2A6E C;  3E0J A;  3FPU B;  1VF5 C;  2K28 A;  3GTQ B;  4K5X A;  4XYO A;  2Q8T A;  3S2H B;  4PV1 C;  1XWE A;  4WFN 3;  5CV4 A;  2PW7 A;  3NWT A;  4KV6 A;  4DF7 A;  2VNU D;  1F2M A;  1B53 A;  1EWC A;  1WD1 A;  2BE5 C;  2F0T A;  4KTA A;  1II3 A;  2DY7 A;  1AEX A;  1Q12 A;  4HTH A;  1EYA A;  4KKS A;  1LLR D;  2E75 C;  5D14 A;  3H91 A;  2EY5 A;  1WTO A;  1BCP F;  1EU4 A;  1CI3 M;  5CBA E;  1EY8 A;  5EKL A;  1EQT A;  3U9O A;  3PUZ A;  2A6E D;  1RJT A;  3KBX A;  3K58 A;  1AZQ A;  2O2L D;  4I65 A;  3PUY A;  5CR3 A;  3X3M A;  1TS2 A;  1SEB D;  2LY7 A;  2JA7 B;  3M7N A;  4K8I A;  4NMZ A;  1D6E C;  3GTP B;  4XXE A;  5FO9 B;  1BXT A;  1O7L A;  2BE5 D;  2AUJ D;  1FR3 A;  2EJM A;  1JOR A;  1LTA D;  2DN8 A;  3AB9 A;  4J6H A;  2CVR A;  5DM6 3;  4C1N K;  4ZUJ A;  1A2U A;  1DOL A;  2JEB I;  3SE0 A;  3PUV A;  4RGO S;  1JE4 A;  2A6H C;  4BA2 I;  3QOJ A;  1WCM B;  1JWM D;  5JPN C;  3CHB D;  1HQM C;  2RDG A;  1ET6 A;  1JOO A;  3BVZ A;  2F0S A;  1EIG A;  1HFG A;  5IGD A;  1D5X C;  1LT5 D;  4QMG A;  3NUC A;  2WP8 J;  1IYU A;  5T1I A;  4K8J A;  3NQI A;  4QCL A;  2F0J A;  1ML0 D;  2EY2 A;  3RZD B;  3IFD A;  2IJ0 A;  3KUP A;  2F0P A;  5G3L F;  2Z4H A;  3H3V C;  1SJE D;  2A6H D;  1G2S A;  3P1H A;  1STN A;  2OXP A;  1CT1 D;  1PFN A;  2EYO A;  1M8A A;  2K04 A;  1EY4 A;  3GV3 A;  4KHV A;  5BN4 A;  2SDF A;  2B8F A;  3KBG A;  4FO2 A;  3QG1 A;  1TWF B;  4XQN A;  2A69 C;  4BWG B;  2SNS A;  2KVM A;  1OXX K;  4OL7 A;  5KEE A;  2RQX A;  5FKA C;  1PZK D;  5ELD A;  1F2Z A;  3J80 L;  4RA8 A;  5KYL A;  1CHP D;  5FLX E;  1L0X B;  1LAB A;  1RTN A;  2F0N A;  4XYQ A;  2D9U A;  2MP1 A;  1CQV A;  3BVM A;  2EYL A;  4HAE A;  4XQQ A;  5JVH 3;  3P20 A;  2AUK A;  2F0H A;  2C9O A;  2MGS A;  1HUN A;  1D1K A;  5CV6 A;  1H9J A;  2ID0 A;  5EPK A;  1RCV D;  5C4J B;  1CA6 A;  2PQE A;  3I4N B;  2M00 A;  4NDX A;  2KJX A;  3I91 A;  4G4K A;  1UUP A;  4C2M B;  3DEO A;  3TZU A;  1OXU A;  1SSO A;  1B44 D;  2K05 A;  4K6L A;  4IZ8 A;  3D8G A;  1LTI D;  3C2P A;  1JCK B;  4CKC A;  4O42 A;  2TMP A;  2KEE A;  4F88 A;  1QOH A;  1Z6H A;  1XYI A;  3K59 A;  1TVX A;  2QCP X;  5KNB A;  1STE A;  1RHP A;  1SDF A;  1PMR A;  3T51 B;  3MFG A;  2J0T D;  5LL6 S;  3OHX C;  5E4W C;  3AMU A;  2XNA C;  1QJO A;  5FK9 C;  3M4Y A;  5J1Z A;  3TBI B;  2XSC A;  3GQB A;  3J7A V;  4IFD J;  5JPM C;  3GTG B;  2JEA I;  2F0G A;  3HOW B;  1SFO B;  1YNJ D;  1Q3L A;  4DK1 A;  1GUS A;  2PNR C;  1B9M A;  1S5C D;  1D5Z C;  2VB2 X;  1BNZ A;  4R8N A;  2VXW A;  3FKI B;  2MHV A;  3CQZ B;  2DNE A;  1HUM A;  3S15 B;  1E0B A;  3QO2 A;  3C3L A;  4ZYS A;  2LS0 1;  5FOB B;  4RKB A;  1IKL A;  3I8Z A;  2B2U C;  1TS5 A;  1WVL A;  2CW0 C;  4BS9 A;  5KYI A;  3D6W A;  3I90 A;  1Z47 A;  4MN3 A;  5KNC A;  1Q1E A;  3H09 A;  4IUU A;  2OEO A;  2VB3 X;  2Z1C A;  1I4P A;  2WKC A;  3JAM E;  4HED A;  3EQL C;  2LMC B;  5T1G A;  1RKN A;  4PMC A;  4PNY A;  1XXG A;  2D62 A;  4NW2 A;  2TSS A;  3GV6 A;  2AQ1 B;  4FF3 A;  3N6R A;  1ONL A;  3KLS X;  3Q22 A;  4DU9 A;  4DAV A;  3ONA B;  5IIF A;  4B08 A;  2FJ2 A;  3D31 A;  3G7L A;  3T4A C;  1Z7T A;  1FYC A;  2CW0 D;  1SNC A;  3LWE A;  4IUN A;  1X3Q A;  1T5E A;  4G57 A;  2WII B;  4R9W A;  4YIJ A;  4RGN A;  3TSS A;  2K01 A;  3D6C A;  3V2T A;  1PYW D;  4IUQ A;  2D5D A;  4FVM A;  5ELB A;  3MXN A;  2K6A A;  3I72 A;  1VCI A;  2IW3 A;  3BDL A;  1BR9 A;  2SNM A;  2YYZ A;  4FXK C;  3R93 A;  2RVL A;  1S5B D;  1QWY A;  4XTC S;  4P2C B;  1U4R A;  1U9R A;  1SYD A;  3S1R B;  5C4X B;  4K5W A;  5M3M B;  4J8Q A;  3O13 A;  4HN7 A;  4C1N I;  1ENF A;  1Q90 A;  1B9N A;  1TWC B;  1XX8 A;  2EJG C;  2B2T C;  2IWH A;  3D4D A;  1EY7 A;  1KDA A;  1H9K A;  2X69 A;  3SK8 A;  2Z8L A;  3NTH A;  3ITP A;  4DXF A;  3K5M A;  5A2Q E;  1PFM A;  3PIP 3;  4X3S A;  4H0L C;  1BO0 A;  3NBI A;  4L8J A;  4XT1 B;  4FXG C;  4OGQ C;  3RUZ A;  3J7A F;  2KQ3 A;  4OHJ A;  4RGM A;  2Y0S B;  3L9A X;  3SK6 A;  3VR6 A;  1PTO C;  2KCN A;  2R93 B;  1I6V C;  2F0K A;  3SVM A;  1MGS A;  1PTO H;  4M8A A;  3M7G A;  1FD7 D;  1TS3 A;  5I6W A;  2L4N A;  3V05 A;  3A54 A;  1G8Z D;  2K5W A;  2K03 A;  4S3S A;  1SBB B;  4HR7 B;  1PLF A;  2O4X A;  1HFN A;  4C3J B;  1UAP A;  1G6Z A;  2B39 A;  2QF7 A;  5JJZ A;  1O78 A;  4B9X A;  4KN7 C;  4A93 B;  3PV0 A;  3RMH A;  1EEI D;  1QB5 D;  2VUM B;  2XVS A;  3E5S A;  2EYH A;  3RZO B;  4TQU S;  1LTT D;  1PRT F;  3D3R A;  4PMW A;  3CU7 A;  2XRS D;  3ND9 A;  1PTO D;  3TDQ A;  1LTS D;  4K2L A;  2YU9 B;  2R3Z A;  1TS4 A;  1STA A;  1C48 A;  4DXG A;  1EY6 A;  2JP1 A;  5DAU A;  5IT9 L;  3HGB A;  1G91 A;  3Q23 A;  1JOK A;  1F9R A;  2J4X A;  1NUC A;  4RCN A;  1EIH A;  1ILQ A;  1R4P B;  2ZXR A;  3S16 B;  4ZQ3 A;  3VA5 A;  2EDG A;  4X3K A;  3BYT B;  1E2Z A;  1WTQ A;  4IUP A;  5HUR A;  3H0G B;  2IX0 A;  1IKM A;  1BCP C;  3HRZ C;  2EYF A;  1SYB A;  3EVQ A;  2N55 A;  3GTL B;  1LT4 D;  3S17 B;  5AFW A;  3J80 E;  2ICE C;  3A8I E;  5J22 A;  3GTK B;  1S5F D;  4HSP A;  3GTM B;  4A3G B;  2IX1 A;  2NYZ D;  5JAV A;  4K5V A;  1J8I A;  4H13 C;  4V0B A;  2R92 B;  4KI0 A;  1MI2 A;  3NTI A;  2ZXP A;  2K32 A;  4QB4 A;  1DCZ A;  1LO5 D;  5C6A A;  5EPL A;  3L7Z C;  1CTM A;  4MIU A;  3QIA A;  4Y7N B;  4C3I B;  4EVO A;  3SK5 A;  5COR A;  1BCP D;  2WAQ B;  4AYB B;  3ZYY X;  4TKO B;  1O7Z A;  4A3I B;  1GOZ A;  2HDM A;  5IOD A;  4ZK9 B;  2L9H A;  4KKU A;  1F77 A;  1T5X D;  3NXW A;  3NHH A;  3KF8 A;  3J81 L;  1ENA A;  2IPK D;  2PZT A;  4KY7 A;  4H44 C;  1SAP A;  1A3V A;  1W6J A;  4OO1 G;  2IT1 A;  4ZUI A;  5IGB A;  4U67 3;  1B3A A;  1TU2 B;  1ESR A;  4ODG A;  4Q5V A;  3UI2 A;  3KK7 A;  3IFT A;  2AQ2 B;  2JYO A;  1O80 A;  3Q0A A;  5I2Y A;  1V8Q A;  5D3D A;  5BN3 A;  1HPC A;  2XIW A;  4KY5 A;  2J7Z A;  4CJ2 C;  3Q24 A;  1CM9 A;  5K36 H;  2KA7 A;  2B8G A;  1R9T B;  1I4H A;  2PYK A;  2PZW A;  4ZRZ A;  1EQV A;  3HOV B;  1PDQ A;  3HZX A;  2Z4I A;  2E76 C;  2WIN B;  3F2U A;  3C1E A;  3PUX A;  5HGT A;  1CZG A;  1PFB A;  4RHS A;  5EQ0 A;  3PO3 B;  3KLR A;  4FF1 A;  3K6O A;  1E2W A;  5M9O A;  5ISR A;  1ESF A;  3NE5 B;  2FMM A;  5I9O A;  1FNW A;  5G3L D;  1RD9 D;  3P75 A;  3VYR A;  2V4D A;  4KD3 A;  4DNR B;  1WTP A;  4LMQ D;  2F4I A;  1I50 B;  1QG7 A;  1LT3 D;  1F9Q A;  4R8I A;  1TQO A;  4A3E B;  5CMD A;  2A69 D;  4IFD H;  1STH A;  2WV6 D;  2K7V A;  5JOB A;  3I4L A;  4LJZ C;  1I4G A;  5D3I B;  4BA1 I;  1PZJ D;  3SHL A;  2N88 A;  1CA5 A;  3P7J A;  1SYG A;  1GXD C;  4FNF A;  5E4X A;  3R2I A;  1EWH A;  1BF4 A;  1BBX C;  3OSO A;  4TSS A;  1OO9 B;  4HCE A;  1JQY D;  3TME A;  5CV7 A;  1CZW A;  1LTG D;  4IFD I;  2KCC A;  3NWS A;  3CRL C;  4C3H G;  1PTO B;  1ZXT A;  2XWB B;  3TP5 A;  1V1P A;  1D5M C;  3H6M A;  4V19 0;  2HCI A;  5JVG 3;  2E2D C;  2H1E A;  1M4V A;  5J39 A;  3BDC A;  3H94 A;  3MEH A;  4DNT B;  1DJR D;  2NVQ B;  4RCO A;  1HTL D;  1IHZ A;  2AWN A;  4CBV A;  2BOS A;  4HSV A;  4FYD A;  2F0U A;  5C3E B;  1IYV A;  3VYS A;  1SXT A;  4CHT B;  2NUC A;  2D2C C;  5K36 G;  4NP5 A;  2G9D A;  3FVQ A;  3VYU A;  3QB3 A;  3TZD A;  2JXM B;  5FLX L;  4CKE A;  1KAA A;  1DON A;  2R6G A;  2F0Q A;  1KLG D;  4FF4 A;  2EPB A;  4XQJ A;  2X6G A;  3R8B A;  3AU7 A;  1GJX A;  1HHV A;  5ELF A;  1UNS A;  1SNM A;  1SE4 A;  5DEH A;  1BCP B;  5IOC A;  3BS1 A;  1CQF A;  5EJW A;  3OIP A;  1D2B A;  2KEC A;  4ABN A;  3I4M B;  2EE1 A;  3S2D B;  2A68 C;  1EY5 A;  1Q1B A;  4DA2 A;  3OW7 A;  1VDZ A;  4QUC A;  1WTW A;  4ID6 A;  2JA8 B;  1Q8I A;  5IGC A;  1TR5 A;  4RAU C;  4IFD G;  2PW5 A;  3IL8 A;  2F0D A;  2HQE A;  1Y1W B;  3NBH A;  2PO4 A;  2RKS A;  2E2J B;  1SJH D;  1QE6 A;  1CK1 A;  3OMG A;  2B2Y C;  3PO2 B;  2F03 A;  2HCC A;  4A3K B;  1SND A;  3E6Z X;  4CJ0 B;  3IKJ A;  4WRD A;  1EZ6 A;  2GA4 B;  2C5C A;  2HDL A;  3G6J B;  2ZXO A;  3OPO A;  1F2L A;  3LWU A;  3MZ5 A;  2F3W A;  4KKT A;  1A3T A;  3TN2 A;  3FRP B;  3DWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...