4ME5A

Crystal structure of staphylococcal nuclease variant delta+phs v23s/v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTSKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4me5A00
2EY2A 2O4XA 1EY0A 4KJOA 2HQEA 2F0DA 5KYIA 5DEHA 1SNQA 4WRDA 3D4DA 1KDCA 5I6YA 1EY8A 4TRDA 3VA5A 4IZ8A 4MIUA 4I65A 3OMGA 5C3XA 4EQNA 5I9OA 2F0LA 4KD4A 1SYFA 3BDCA 4N9PA 1EYCA 4K8IA 2PYKA 3OWFA 5KRUA 3NUCA 1AEXA 5CGKA 4ZQ3A 2EYMA 4R8NA 2F0NA 4QMGA 5KGUA 1IHZA 5J1ZA 1STAA 4OL7A 5E1FA 1KABA 5CV7A 3TP8A 3P1HA 2F0TA 5I9PA 3LX0A 1A2UA 5EGTA 5JOBA 2F3WA 3SK5A 3MHBA 4EQOA 2EY6A 2F0WA 2F0JA 3NXWA 4ZUJA 2KHSA 1A2TA 5K5PA 1EQVA 3P75A 4K5VA 1SYEA 1A3TA 2KQ3A 4DGZA 4G57A 2PZUA 1NUCA 4H7BA 2SOBA 4B9XA 4PMCA 2F0QA 1KDAA 4N9TA 1KAAA 3NP8A 1JOOA 1SNCA 3OSOA 3RUZA 5NUCA 2EYHA 5HURA 2SNMA 2EYLA 2PW5A 4J1MA 4F7XA 5J39A 5C5LA 5IGCA 2EYFA 1SYCA 1TQOA 3SR1A 2PZWA 4K14A 3D6CA 3QOJA 4ODGA 5EKKA 5HGTA 2RBMA 1ENAA 4IUNA 4KY7A 3NQTA 4NMZA 2ENBA 4KY6A 4QB4A 3SXHA 1EY4A 1EY9A 5C5MA 5KIXA 4S3SA 3SK4A 3T16A 1TR5A 1A3UA 3H6MA 3U9OA 4K5WA 2OEOA 4WORA 1EY5A 1JORA 3D4WA 3EROA 3MEHA 1F2YA 2F0OA 2WACA 2RKSA 5C4ZA 2SNSA 3HEJA 1RKNA 3EVQA 2EY5A 1TT2A 3TMEA 3TP7A 1EY7A 2F0FA 2RDFA 3E5SA 2OF1A 2M00A 5IODA 4NP5A 3TP6A 5E3FA 2F0VA 3SK6A 4RKLA 4E6IA 3EJIA 3PMFA 4RKBA 5IGEA 1U9RA 3DHQA 1KDBA 2F0UA 4KTAA 1EYAA 1EZ6A 3HZXA 3R3OA 2F0GA 4KY5A 1F2ZA 4KD3A 2F0SA 1SYBA 2EY1A 3MZ5A 1SYGA 5CV4A 5CV8A 5J22A 4NDXA 2QDBA 4PNYA 5EKLA 3ITPA 3C1EA 4ZUIA 4ME5A 2OXPA 5IIFA 5ISRA 3D8GA 4K6DA 1A3VA 5M9OA 2F0HA 4NKLA 3MVVA 4K5XA 5C4HA 1EYDA 4HMJA 1ENCA 1STBA 5IOCA 4PMBA 4KJNA 3C1FA 4DF7A 5IGDA 5JAVA 3BDLA 5C3WA 5KYLA 3TP5A 5I6WA 2F0MA 5CV9A 5IGGA 2F3VA 2PW7A 2EYOA 2EYPA 3V2TA 5C6AA 3DMUA 2F0IA 1NSNS 3SK8A 4IALA 1SNMA 1STNA 2LKVA 4HTHA 4K2KA 4DFAA 1SNOA 3ERQA 2EXZA 1STHA 3MXPA 2F0PA 3SHLA 5KEEA 1SNPA 4HMIA 1JOQA 1EZ8A 4K2LA 4YIJA 4EQPA 4J6HA 1JOKA 4DU9A 3T13A 4K8JA 4EVOA 2EYJA 2NUCA 3QB3A 4B9WA 1STGA 4KHVA 4F8MA 3NHHA 3NK9A 5CC4A 5IGBA 3QOLA 5DAUA 3S9WA 2PQEA 5CR3A 4LAAA 1II3A 1EY6A 2F0EA 1SNDA 3OMCA 4QF4A 2F0KA 5IGFA 2PZTA 5CV6A 5CV5A 1STYA 5F2DA 1SYDA 4KV6A 1F2MA 4ID6A
chains in the Genus database with same CATH superfamily
3I4LA 4QUCA 4LF6L 1OXXK 2EIFA 1EY8A 4TRDA 3OMGA 4EQNA 1YITA 1J8IA 3GTOB 1O7ZA 5GAGC 3NUCA 1YJNA 1Y14B 3S24A 2YU9H 2F3IA 4QMGA 2KBNA 4DV2L 2B2TA 1CA6A 1G2TA 3G48A 1CHPD 2JA5B 1G51A 4ZUJA 4QGUA 3T1YL 3BYYB 1G6PA 3OPOA 4G57A 2B2YC 5M5WB 3HOUH 3OIQA 3AYHB 4NXNL 4A3MG 4J1MA 1TWAH 1Q90A 3R2IA 1QNUA 3C3LA 5HGTA 2YTVA 5BR8L 1SMXA 2JQOA 1K3BC 2WB1G 1XTCD 5KIXA 3H6MA 3BVZA 3L9AX 1PFNA 4TVAB 4G7HC 2XWJB 3F2CA 1QE6A 1BCPB 2WAQB 1TS4A 5C4XB 1WTXA 1Q1BA 1SFOH 3H3VH 1X6OA 1Q86C 3CMEA 3J80i 4DR3Q 3SK6A 3F8TA 1CK1A 5IGEA 3K57A 2Q2IA 5EPLA 3GTLH 1C7YA 4ZYSA 2H5XA 1HNZL 1TWFH 4K6DA 4JVZA 2EVBA 1E24A 4DK3C 1D5XC 5IP7G 1TY2A 2F0MA 1WCMB 2RHQB 3H0GB 4CDDC 1PH7A 2E76C 3DMUA 1Q8IA 2VY3A 3M9BA 1K9MC 2Q8RE 2LKVA 3K81C 3FKIH 2HCIA 3S17B 2KCCA 2CH4W 4F8MA 4FF3A 3FPUB 3R8BA 1XNQQ 2N49A 4JBMA 2PQEA 1W6KA 1WJJA 3GTJB 3AFQA 1F2MA 4DAMA 1PDQA 3FVQA 4MIUA 4I65A 1NNXA 1N8RC 5C4XH 2R3ZA 3S16B 2XWBB 1HFNA 4U673 1U4PA 3OWFA 5FLMG 5CGKA 4DR6Q 4AYBB 2CH4A 4JI7Q 1HQMC 4PZ6A 3U4ZA 5LMNW 1STAA 3J80L 3A0JA 1VQOA 3H91A 5C3EB 1SE4A 2OTLA 3WWVA 4DV6L 4B3ML 2HT1A 4EQOA 2R7ZH 3TBIB 1BXTA 2D2CC 3BVMA 1PVOA 4BBRH 5M5XB 1Y1VH 1B7YB 2Z0SA 3I4MG 1YHBA 4IUQA 3HP3A 1SYCA 2NVXB 1TQOA 1B2TA 4LF9Q 1XXGA 3RNUA 4O2DA 2I0QA 4Z9CB 3PUYA 1FJGL 1KRSA 1AP0A 1XNRQ 4X64L 5EQ0A 3S2HB 3I2ZA 5ELOA 1STEA 1KD1C 4DR4Q 4AH6A 4JYAQ 2BOSA 1DZ1A 4LF7Q 3L7ZC 1QUQA 4Q5VA 3CPFA 2QEJC 3GTJH 4KHPQ 3BZDB 2F0GA 2EY1A 1PHJA 4IQZA 1BUVT 1O80A 2QDBA 1NMFA 2WKDA 1XMOQ 1VF5C 4A3GB 4A3MB 2GVAA 5EBDA 3M4QA 1ENCA 4PMBA 4RGTA 3CCQA 2X6GA 3J7AV 1MKHA 3MEFA 1EIHA 1EFID 1QZHA 2K03A 5C3EH 3V2TA 1SJHD 2PMZE 4HN7A 2F0IA 1BCPD 4IALA 2CW0C 4DV3Q 2E2DC 2D5DA 2K50A 1PV4A 5M5XH 1U4MA 1E0BA 4C2MH 4N8FA 2Y0SG 3PIP3 3GDEA 1VQ8A 2I5MX 2NUCA 5CC4A 3NHHA 2VQFQ 4C3HH 4C3IB 3QWNA 4C56C 3K58A 3WOFA 5F2DA 1HZBA 4X65Q 4GKJL 3D4DA 2ES2A 4JG2A 1R9TH 4IZ8A 2IX0A 3J7A5 3AB9A 3WDNA 3CQZH 4OIJA 2LXKA 1VQDA 3S1NH 3W3AA 3H94A 4C3JG 3MXGA 2F0TA 1QCBD 3SK5A 1B3QA 4YY3Q 1DD2A 1JCKB 5M3FB 1KLUD 2MUYA 5FOBB 1X3PA 2B8FA 1Q1EA 2VNUD 4IFDJ 1WVLA 2DY8A 2SNMA 3J80E 4BBSB 2NTTA 1PZID 4JI2L 4HSPA 3E9IA 5IE8A 4XQJA 4IPCA 2VS1A 3D6CA 4OO1I 1LTSD 1PRTD 2LS01 1T5EA 3OYYA 3NBHA 2LSSA 4CDFC 4GNXB 5ELDA 2QW7A 3J7AF 4A75A 3F1ZA 1D1KA 1NJIC 4LW1A 1DOLA 2MFIA 3KF6A 3QG1A 1BCPC 1JJGA 2HDLA 1JWUD 1HZAA 1OXVA 2CKZB 2UXDL 1VQGA 2NZHA 2OF1A 4UAIA 3L2PA 1A6XA 5IODA 2F0VA 3I70A 1B9NA 2AQ2B 1NTGA 3I55A 5JVH3 1AN8A 1TKWB 2B2VC 1UEBA 4OO1G 5IIFA 2C5CA 4K5XA 2A6HD 3MXNA 4DR5L 2E2HH 2JA7G 3T1HQ 1AE2A 3TP5A 1KLGD 2B2WA 2JA8G 2JA6G 1EQTA 4A3JB 3S1MB 1SNPA 4A93G 1LT5D 1E1OA 1LTAD 5G3LD 5IGBA 5ELCA 1V1OA 3EQLC 3MTSA 4R9WA 2EQSA 2Q2HA 2EPBA 4WFN3 4HJ9A 1MIUA 2F0EA 5FK9C 3PO2B 2UXCQ 1A62A 3ZJYC 1XPRA 3KBXA 4IFDI 1O7IA 3S1RB 1VQ6A 1L0XB 4B3SL 4DV1Q 2VL6A 4JI0Q 4P71A 1KXLA 3RR5A 2ZXPA 3FP9A 4I7ZC 5FLMH 4KN7C 2MNAA 5T1IA 4B08A 1AZQA 5BN4A 4F88A 4X66Q 1PH8A 3DWPA 3MXUA 3F2DA 5E1FA 4PMWA 1EYGA 3EBEA 4QY7A 2NZ1D 3MHBA 3V05A 2VUMH 3P75A 3K6OA 3ONAB 3I4MH 2HUGA 2UXBQ 4IFDG 3AU7A 4RGOS 3M3YB 4A3BB 3NP8A 3A5ZB 5NUCA 1VQEA 2EYFA 4HEDA 4DUZQ 2VQEQ 1C48A 3BS1A 4A3DG 3FRPB 3PCOB 1VQAA 4HIDA 1VQBA 1MJCA 2NWGA 5E7NA 3NWTA 3MWYW 4Y7NB 5ELBA 4K5WA 4GLAC 2OEOA 2E5LL 1EY5A 1I4HA 1SE2A 2WACA 2E2JB 1ESRA 2SNSA 2E75C 5JJLA 1RKNA 4YHHL 4LF4L 1EEFD 3E5SA 2KCMA 4C3JB 1FNWA 3E6ZX 2F4VQ 4RKLA 1RTOA 1NR4A 3DHQA 1EYAA 4KY5A 4OEMB 4R4CA 2UUCQ 2KEEA 2ICIA 1X9NA 1PH2A 1IYVA 3H15A 1PYBA 3I73A 1I50H 2E2IB 1EYDA 1ZXTA 1N32L 3FDTA 4KJNA 3F2BA 1VQLA 2L0CA 2FINB 5IGGA 4GN5A 1EOVA 4LFAL 5A2QL 1CSPA 2A68D 4X62L 3HOYH 4PZ8A 2VXWA 1IBKL 3KF8A 4JI4Q 1TWHH 2WP8J 4IUTA 3LGJA 3LNNA 2FMMA 1QVFA 4BY1B 2Z9HA 1GUGA 1K8MA 2MO0A 1E2WA 4K8JA 4B3RQ 1N9WA 1DOMA 5IYCG 5FO8B 3QOLA 1BDOA 2HIVA 2ZXRA 1HQRD 5IGFA 2FMCA 3HKZE 1WTVA 1XJVA 2EY2A 4Y7NH 1X32A 3AFPA 4DK6C 2V4DA 5FLXc 1SJED 3J81j 2BE5D 2JA7B 1FR3A 4GKKQ 1E1TA 1CQFA 4LF6Q 3NWSA 2UUAL 1BQQT 1Z7TA 4ZQ3A 2HCCA 5M3MB 1B1ZA 3FKIG 3TN2A 1PZJD 2JA6B 4MNOA 4CBVA 5I9PA 2F3WA 1MD2D 1EWCA 3D3RA 4Q0FA 4X3KA 4LUOA 1WOCA 3SVMA 4PMCA 4IO9A 2OT2A 5JPNC 3T1YQ 2K5HA 5C0XJ 2N3SA 1Y8PB 2NB0A 1PH6A 2EJFC 3PO3H 5TSSA 3SXHA 4DA2A 2AQ3B 4GNXC 1KNEA 2TMPA 2ID0A 4GOPB 1I5FA 2EJGC 2K75A 5BR8Q 1GO3E 4JPBW 1GUTA 2A74C 2Q2TA 2D9UA 1S3OA 1LTGD 2KHJA 2XRQD 2R7ZG 1W6JA 3PUVA 1RF2D 4BBRG 4OO1H 1A0IA 3TSSA 4KD3A 1FVIA 5ELEA 4KKUA 4BY7H 1NBWA 3MVVA 4OELB 3QO2A 1HNZQ 3PQIA 3K0XA 3VYSA 2BE5C 2JA8H 2F3VA 1JMCA 2PW7A 4JV5L 1YBYA 4JI3L 1GUWA 3PV0A 1HR0L 1X55A 2YU9B 1MSGA 4A93H 2NVYB 4XT1B 4A3KG 1HCZA 3KLRA 2B29A 4EQPA 2UUBL 3S2DH 1JC7A 3X3NA 5A2QE 1PH1A 4IUVA 3R93A 3NSWA 3A74A 1SYDA 2KENA 3SE0A 4LFBL 1RDPD 5LHY1 2R93G 2DUDA 2QEXA 4WRDA 3HOXG 1D5MC 1GXDC 5C0XI 2OQKA 4U68A 3AMUA 1HNWL 4DV4L 2A1AA 1K0RA 1ICFB 1QVCA 1SYFA 2B2YA 2K52A 2IL8A 2KECA 4N9PA 1EYCA 2PYKA 1FNUA 2E74C 1AEXA 5KRUA 1BOSA 1VQNA 1MSHA 2Z1CA 5M5YH 1JE4A 1KABA 1QILA 2B63G 1SFOB 4IFDH 1EIFA 1FGUA 5EPKA 5A35A 4YCVA 4HSVA 3V96A 1I94L 4C3HG 3GTQB 4R8IA 4B3MQ 5JVG3 2N78A 3KK7A 2EYLA 4A3DH 4NXML 1Q3LA 1VS0A 5C5LA 5C0XG 2OCEA 5KNBA 1TWFB 5D14A 1GJXA 4PG3A 2RBMA 3TEHB 1W2BA 4KY7A 5CBEE 4NMZA 5JJZA 2IWHA 2WV6D 4KY6A 1EY4A 2NVYH 4ZCKA 3G7LA 2YV5A 2RCNA 3U9OA 1N34Q 4A3IH 3K0YA 1JB7A 1FJGQ 3SDZA 1WI5A 2Q8TA 1W3SA 3ERSX 4FYDA 1CZGA 1HZCA 1V1PB 2XVSA 4X64Q 3FKIB 2M00A 2CCZA 4XDXA 4RCOA 3RN5A 4DR1L 3ICEA 4F87A 4BS9A 1GUOA 5M9OA 2F0HA 1SAPA 2F03A 4AQYL 4V190 3UDIA 1BCPF 2JEAI 4ULLA 3GTMH 1GUSA 5I6WA 2NN6I 1Z6HA 1IW7C 2EYPA 1D8LA 1UNSA 2JJQA 5E4XA 2QCPX 3SK8A 3KOJA 4KK7A 2ZTDA 4HTHA 3OIPA 1YNXA 3TZUA 1PZKD 5IYCH 2F0PA 3GTQH 4HMIA 1RIPA 2DN8A 5BN5A 4ZRZA 4POGA 4LWCA 2R7ZB 4GLVB 3KDFA 3IAYA 1LT4D 1EUJA 1S5ED 2B2UC 4BBRB 1II3A 1Y1VB 4GKKL 1KNAA 2BCOA 4KHZA 3CPWA 1DYQA 3I90A 3QR8A 4DR7L 1DCZA 3ULPA 1KRTA 1SNQA 3HG9A 1IL8A 2NN6G 1K3RA 1VCIA 4OX9Q 1RHPA 5I9OA 1VQIA 1B3AA 4P73A 3BDCA 2ZM6L 4GKJQ 4OWWB 2R7DA 1B4OA 1L1OC 4DAYB 5IWAL 1QNKA 3NTIA 1SEBD 1VQ7A 1J5EL 1TS5A 1I4RA 3P1HA 1OTCA 4AYBE 3MFYA 1LTRD 2P5ZX 1TVXA 2RVLA 3N6RA 1F9QA 1SYEA 2UU9L 1K73C 1S5FD 4ZKBB 1NUCA 1PRTF 2CHBD 3T56B 3WOEA 1G2SA 3NBHB 4DV7Q 1PRTB 2V1CC 4O42A 2K4KA 5T1GA 3PIOA 1YJ9A 3QOJA 1EWIA 2VB3X 4HR7B 3C2PA 1VQJA 2ENBA 1VQMA 3OW7A 2WINB 3D31A 3KF6B 2NTSA 4JI2Q 4CKCA 1IYJB 3J7YW 2CFMA 3KLSX 1XX8A 3QIAA 4GOPC 3CKIB 2LXJA 1HZ9A 1RJTA 3ZYYX 4DV5L 2HHHQ 3FPPA 1EY7A 4DPGA 4X6AH 2D0OA 2VUMG 1R4QB 1NY4A 4JC0A 4R4QA 4C2MB 4KTAA 3K5LA 3CCMA 4BA2I 3TZDA 1WTHA 3AQQA 3MXNB 3MZ5A 2HDMA 5CV4A 4HJAA 5J22A 4C3HB 4PNYA 1WTPA 5EKLA 2XGTA 3HGBA 5FLXL 4LF8Q 2BH2A 5IOCA 3K5NA 4ZLTF 3KUPA 4L5SA 2NVTH 2YTYA 2A69D 1R9TB 1PXUA 4BXXH 3URYA 2L11A 1IBLL 3EN2A 4IJHA 1UUPA 5C6AA 4OWXB 1H9SB 5G3LF 2K14A 4A3KH 3CQZB 1H9MA 4ZK9B 3S1NB 2EXZA 1RL2A 3D0FA 2EOTA 3MXPA 4H13C 5IP9G 1M8AA 5KNDA 5JEAJ 1SBBB 2ZTEA 4RGMA 2K7VA 4UP8A 2EYJA 1HHVA 3STBD 3DEOA 1FL0A 1U5KA 2XTIA 1MGSA 4UP9A 4LAAA 3Q24A 2R93H 1UAPA 4XQQA 1Q12A 1K8AC 2PZTA 3HOXH 2RA4A 4A3LH 5CORA 2XIWA 1VQPA 4OIKA 1LYLA 2C9OA 1KDCA 1JQYD 2WB1B 4EQ5A 1EOTA 4I7AA 4FF4A 2F0LA 3A7LA 1VF7A 3HOYG 4B3SQ 1HXYD 1JB3A 2Z6BA 2B63H 4QIWB 4UP7A 5CV7A 1KAWA 5DNFA 5DM73 3TS0A 3H3VC 3M85A 4ZAIA 2EY6A 3G4SA 3I7FA 1JWSD 4YCUA 1CKMA 1I6VC 3A55A 4H7BA 5C0XH 1K8GA 2X69A 3RUZA 1ILQA 4RMFA 4LF5L 1NAPA 2RQXA 1WYDA 2E2HB 1CTMA 4KI0A 1S4ZA 1P8LA 1C8CA 1X3GA 5C4JH 3QJYA 4K6LA 2B2VA 2PMZB 3D4WA 4ABNA 3RLOA 1LLRD 3HEJA 4HCSA 3TDQA 3CXCA 2E5LQ 2F0FA 3KJOA 1HUNA 4A76A 2JXMB 1PLFA 3TP6A 4E6IA 3PMFA 2Z4HA 3STBC 4A3CG 4YHHQ 5HY6A 1ZEQX 4LF4Q 1F2ZA 1IKMA 2LFNA 1G8ZD 4IN3A 3D8GA 3BU2A 1F9SA 4MTKA 5IT9c 4EGVA 3PO3G 4WJ3M 4DF7A 5IGDA 3I4NH 2DJFC 3BDLA 4FXKC 5COYA 5CYUA 4DAVA 1XYIA 1N32Q 4QL5A 3KJPA 3SEBA 4QUFA 1B53A 2NBFA 5D3DA 5J3BA 2YYZA 3CD6A 5FLXE 3GO5A 3JC66 1SNOA 1QJOA 4LFAQ 5JEAG 3E3XA 1EZ8A 4X62Q 4J6HA 1KL9A 3T13A 5GAHC 3KLWA 2A5HA 2MPMA 2VUMB 4OWTB 4BY7G 3I4MB 4J8QA 2BA0A 3J81c 3TQYA 1HNXQ 3RZOH 4KKTA 1HJPA 2NN6H 5CV6A 1JJ2A 2GN5A 4IPGA 5KYIA 3CC2A 2K32A 3DLLA 2MP1A 1E22A 3CCJA 1DJRD 1I4QA 1K83H 4L5QA 3GV3A 4IURA 4R4OA 4CJ1B 1IHZA 3T53B 1XPUA 2ALYB 3HKSA 2UUAQ 1JJCB 1N36L 5IYDH 3S14H 5BN3A 4RAUC 1Y1WG 1L0WA 1IBML 1Z47A 3K5OA 3KLSA 1X3QA 1JOOA 3M4PA 1XWEA 5CBAE 5HURA 3HKZG 1PRTC 3VA7A 3SGIA 4DV0L 2PZWA 1I50B 1YEZA 1IKLA 3HOZG 3NQTA 1AW7A 1SR3A 2A6ED 3W5OA 4JI8L 3SK4A 4DNTB 1RD9D 1LV9A 5LMUL 3HOYB 2GA4B 1TWHB 4AIMA 4DV3L 1UE1A 5E4WC 2EY5A 2Y0SB 3OTOL 2KA7A 2XSCA 1B44D 3CCUA 4KKSA 1IZ6A 1SYBA 1DONA 5CV8A 2A6HC 2SDFA 2G9HD 5ISRA 2BA1A 1TWCH 1STBA 1MBYA 5JJIA 1LACA 1V9PA 2RSOA 3GTGH 1HTPA 4A3IG 1PA6A 1ZYRD 4A4IA 3EIVA 5IP9H 1D7QA 2LMCB 4DUYL 3MA2B 2FXQA 2JEBI 4PV1C 1TWGH 1YZ6A 1JOQA 4JV5Q 4JI3Q 1HR0Q 4CJ0B 3CCLA 4KHVA 4PQXA 4CHTB 1SE8A 1QOHA 1VQ4A 2UUBQ 4IUPA 3O13A 3CMAA 1PTOH 3OMCA 4QF4A 5I2YA 2L15A 1WD0A 3OHXC 4ID6A 5JJKA 1L0YB 3VA5A 1BKBA 3PO3B 4LNQA 3GD7A 1E2ZA 3VR3A 2L55A 1M90C 1DGSA 3RN2A 4K8IA 1LTLA 3K7UC 1YNND 2O2LD 2QF7A 1OXUA 2F0NA 5AFWA 2XN9C 3MC0B 4DK1A 1XPOA 1HNWQ 2B39A 4DV4Q 2J4XA 4MZ9A 3FMCA 1PH4A 1A2UA 5EGTA 1E3PA 2JE6I 4B3TL 2AWOA 2F0WA 3NXWA 2KHSA 5LMNL 4GNXA 3Q6SA 2SOBA 2F0QA 2AMCB 1YHAA 4BY7B 3U50C 3M4OH 1I94Q 4RG1A 3SR1A 5ELNA 1S72A 3S1QH 4XIGS 2K1BA 5GROA 4NXMQ 1GOZA 4QCLA 4JI5L 1C0AA 1JR0D 4L8JA 1TR5A 3Q0AA 2JA8B 4N8X1 3PF4A 3NPPA 1JORA 1X3FA 3MEHA 2NZOA 4DV2Q 4A93B 3VYRA 1T5XD 4XYQA 3TMEA 5FJ8G 4A3CH 1N33L 3GTKH 3S2DB 4JI1L 2A19A 2JA5G 4FXGC 3HOWH 2ZTCA 4TSSA 2K33A 2J7ZA 1Y1WB 3I91A 1J6QA 4ZUIA 3ITPA 4NXNQ 1L2FA 3I72A 3HKZB 4DR1Q 4MHEA 1PTOD 3ULLA 3PIPA 1YNJD 2A68C 5K36G 3CW2C 2FHTA 3GQBA 2RDHA 4JOIC 4AQYQ 4XYOA 1YIJA 5JEAH 1NSNS 3OW2A 4X3TA 1STNA 3RZDH 4FVMA 3ERQA 3T4AC 1CKNA 3KDFB 5KNCA 4CDEC 1QWYA 5M5YB 5AJ3L 1PH9A 1CM9A 1SE3A 3DWQA 4EVOA 4YCWA 4A3FH 3QB3A 2X6LA 4B9WA 4JBWA 3NK9A 4DXFA 2UXBL 1LT6D 2JSOA 1GD7A 3J81i 4X3SA 2KUMA 3GTPH 2I5HA 4DN4M 2VZAA 3VR4A 4X3UA 5CV5A 1JT8A 5DLQE 4A3DB 3IFTA 2O4XA 4ALPA 1CZWA 2ASBA 2AWNA 2MHVA 1K28A 1S5BD 1EL0A 4BXXG 5C3XA 1ML0D 2NVQH 1HUMA 2YTXA 1EIYB 2OWOA 4DR7Q 4A3EG 3VDYA 4LFCL 4A3IB 4QJFA 2IHFA 1TIID 4K0KL 2ZM6Q 4P74A 3I56A 1Y1WH 3NEMA 1V8QA 1I3QH 5IWAQ 1A2TA 2KQ3A 3BZKA 4DXGA 4B9XA 1QB5D 1BNZA 1M4VA 1KAAA 1UEAB 3NENA 2Z6KC 3G71A 3BJUA 4HIKA 2A73B 5IT9L 4A3LG 1I6HH 3HOZH 3EA6A 2R7FA 2UU9Q 1ONLA 4FNFA 4FDBA 4K14A 4ODGA 4XXEA 3DWAA 4JI6L 1YNJC 2G9DA 1A15A 3E9HA 3GTMB 4S3SA 3DEPA 1SSOA 1HA5A 3CRLC 1I4PA 2LY7A 3ER0A 2CWAA 3CRKC 3NELA 4AYBG 3OOCA 3K5MA 3BVGA 4DV6Q 4DV5Q 4HJ8A 4OONA 4RHSA 1HPCA 1VQHA 2O5JC 2MGSA 1BR9A 2KJXA 3J81L 1JE5A 1Q8KA 4DR2L 1B50A 3G6EA 2I07B 2EZVA 4NDXA 1ICWA 1Q82C 2ATWA 1X3EA 2K5QA 1EIGA 3T51B 1VQ9A 4FO2A 3CP0A 4UPAA 3VYUA 2CVRA 1QUQB 5JAVA 1SLJA 4JW0A 4CKEA 2XRSD 2EYOA 2B2UA 3RMHA 1PFMA 2R92H 1BBXC 3CAMA 3VR5A 2WAQE 1IBLQ 1VMCA 3W1BA 1GHJA 1AFPA 1Q81C 1R4PB 3HOVG 2AUKA 5I2XA 2MO1A 1JOKA 1VMPA 4GN3B 4NW2A 2E8GA 1WD1A 2WKCA 5EBCA 2A8VA 1L1OA 4OHJA 1X56A 2TSSA 1ASZA 1STYA 2PQAA 3ULJA 3ND8A 1ET9A 2K05A 2HQEA 4JBJA 3I4NG 5C44H 5JPMC 5I6YA 3S15H 1OO9B 1WFQA 2H1EA 4A3GG 4UY8C 1DXMA 1B70B 4GN4B 3OWEB 4IPDA 4UDUC 2N55A 3M7NA 2N8NA 2R61A 2QDLA 2L9HA 2MJ8A 1O7LA 4NB3A 5KGUA 2JYOA 4KN4C 3D4RA 4OL7A 3TP8A 4G7OC 3L3OC 3LX0A 1H95A 2K5NA 5EAYA 1EQVA 1PH5A 4K5VA 1BVSA 4GOPA 1IL2A 2PZUA 4QQBX 2Q8IB 3PUXA 1NE3A 3VYTA 3EFXD 2PW5A 5FO9B 3FEWX 1A8VA 3MAQA 1CQVA 4C3IG 2B2TC 4IOCA 2JK8A 3DM1A 1ENAA 4LF5Q 1C9OA 1TS2A 1ESFA 2NVTB 3GTOH 4YWLA 5C5MA 5IT9E 4H02A 3I4OA 1E2VA 5FJ8H 1O78A 4DK0A 4A3EB 1XMQL 4A3KB 1OXTA 5C4ZA 2QA4A 3EVQA 3JAMc 2JA5H 2L1BA 5IYDG 3IRBA 4FF2A 4V0BA 4RKBA 3K80C 2F0UA 1YHQA 1PFBA 3R3OA 5M5WH 5M3FG 5EJWA 4JK1C 1VQCA 4ME5A 2R93B 1MHWC 1A3VA 3HOXB 2RDGA 2PPBC 4BBSG 5K36H 5C4HA 2MQHA 1AZPA 2BH8A 2IPKD 2F1MA 3J81E 3NE5B 4YWMA 5C3WA 1CFMA 5KYLA 3J7ZC 3CHBD 5HGQA 4DAPA 1LM0A 4M8AA 2K6AA 2EXDA 4OGQC 1LTID 4L6TB 1F77A 2AKWB 2OTJA 2B63B 1EFWA 1STHA 3PSIA 1UE7A 1SN8A 3DXJC 2UXDQ 4K2LA 4L5TA 1SXTA 2CW0D 3CCEA 3UE0A 1Y8NB 2OQ0A 4IJLA 4R4TA 2CWPA 3HFZB 3IKJA 4HIMA 1IYUA 4DKAC 4OXPA 2KEDA 4GS3A 1OXSC 1MI2A 4HAEA 3U4VA 5EKKA 4RGNA 4DR5Q 1GVPA 2Z8LA 2PI2A 5IY0A 4A3EH 1WCMH 1C4QA 3PUWA 3H0GH 4KD4A 2C35B 1N34L 2WB1E 1FYCA 5C4JB 2EE1A 4G4KA 1G91A 3AEVA 5IYBG 2K01A 1S5CD 3S17H 4RCNA 1PMRA 1K8OA 2HQLA 4MTNA 4M1UB 5JOBA 2I46A 5D65A 4A3JG 3HOVB 4BWGB 1D2BA 2F0JA 5K5PA 3HRZC 1BBUA 4TKOB 2KVMA 4QIWE 4RA8A 2N88A 1N36Q 1ET6A 1KDAA 1UWVA 1E7ZA 1BO0A 1CSQA 3OSOA 3A56A 2ZJPA 4F7XA 2M2LA 1FD7D 1V1PA 4GZYC 1RODA 1IBMQ 3PO2G 3D6WA 1G6ZA 1WTOA 2KOLA 5L37A 4IUNA 2ZJQA 3PGZA 2H4OA 3I4NB 1LTBD 3CU7A 4HCEA 3S16H 3E0EA 2G5DA 4DV0Q 1TS3A 4G7ZC 3EROA 5LL6S 4DR3L 2VB2X 4JI8Q 1WTRA 1TT2A 1G291 1GKHA 3NTKA 5LMUQ 3EJIA 1LO5D 1SROA 3HZXA 3OTOQ 2IX1A 3C46A 1QG7A 1ILPA 3H09A 1AE3A 3RZOB 2NVXH 3NQIA 4A3BG 4FP5D 5H1SE 1Q46A 2A69C 1PYSB 4POFA 4HMJA 4PZ7A 5I4DA 4OX9L 1HR0W 3CCVA 2FJ2A 4Y52H 3S2HH 1EWHA 2EDGA 1F9RA 1K83B 3HOVH 2I5LX 4K2KA 1NCVA 3ND9A 1QZGA 2SEBD 1XNQL 2FFKB 1LTTD 1VQ5A 1VQKA 2Q2UA 4DUYQ 4DU9A 1HFGA 1SRUA 2F4IA 3S14B 3UI2A 3I8ZA 3HOWG 2DY7A 2B3GA 1FGBD 2AQ1B 4R4IA 3FHWA 2KCNA 2JN4A 4DAYA 4DV7L 5GQOA 2F0KA 3KF8B 3K59A 4A3GH 4A3MH 3U58A 2IJ0A 3IFDA 4KLKA 4KJOA 2F0DA 4DR6L 2HD3A 4LUVA 4JI7L 5CMDA 1BBWA 4RHRA 4R8NA 1IBKQ 2HHHL 2K5DA 3KFUA 2DNCA 1HRJA 1QVGA 4HJ7A 4BY1G 1Q7YC 5DM63 4A3FG 3UDXA 3P7JA 2DJGC 3GV6A 4C3IH 4LF9L 4N9TA 1SNCA 3HS0C 4B3TQ 2D62A 5LMNQ 1CI3M 5IGCA 3A7AB 3RLNA 1XNRL 4LF8L 1RCVD 1FNVA 1TWCB 3G6JB 5ELFA 5EPJA 4XT3B 5IP7H 4DR4L 1EY9A 4JYAL 4DNIA 2CQAA 4LF7L 3GTGB 1Z9FA 1MJEA 2WIIB 4IPHA 1YJWA 2ICEC 1U4RA 1F2YA 2GVBA 2IW3A 4R1JA 4JI5Q 4KHPL 2DGYA 5M3MG 1M1KC 4FXDA 4YWKA 1TWGB 3TP7A 3JAMi 3DUZA 2NYZD 3R2TA 4NP5A 5M3FH 5E3FA 2QILA 1XMOL 2K5VA 1I4GA 1DM0B 5EKIA 2Y0SE 4CGYB 1LUZA 1PTOF 4J15A 1H9SA 1N33Q 4BBSH 3UDFA 4JI1Q 1PTOB 4FF1A 3LWUA 3K7AB 3TS2A 3A8JE 2EJMA 4NKLA 3UDGA 5FO7B 1VDZA 3C1FA 2JA9A 1DOKA 3PUZA 3F2UA 4HJ5A 1HA6A 5CV9A 2IX3A 1CKNB 2ZJRA 3B6YA 2KCTA 1D6EC 3UE1A 3A5UA 2R6GA 3L0OA 1SNMA 1K0SA 1KTKA 1D1IA 1F2LA 5KEEA 3Q8DA 2VQFL 1KQSA 4JCVE 2F52A 1X65A 3CC7A 1LT3D 1RTNA 2B2WC 5AJ3Q 2RF4A 5CR3A 2QKIC 4X65L 2K04A 4RWSC 1B8AA 1SNDA 1TXYA 2L5TA 3M4OB 3S1QB 2IY5B 4C1NI 3CC4A 4O1NA 2R92G 5IYBH 5GADC 3BYTB 1KHIA 4YY3L 2AHOB 3NTHA 3JAML 4A3JH 1NR2A 4MN3A 5J1ZA 3S1MH 2O5IC 1CA5A 2ZT9C 2RCFA 4LFCQ 3GTKB 1CKOA 3K7AH 4CJ2C 4K0KQ 1J9OA 4P2CB 3HOWB 3PO2H 4IOAA 1Y8OB 4L5RC 4C1NK 1ASYA 2BDOA 3H3VI 3S1RH 4APVA 3HOUG 4XTCS 4EX5A 2A6EC 5C44G 4LFBQ 2KHIA 1VQFA 1UE6A 4BA1I 1HTLD 1B9MA 3A8KE 3W2DA 1HH2P 4H0LC 4P72A 1YI2A 4HIOA 4JI6Q 2K28A 4RFBA 1I4XA 5GAEC 2RKSA 1X54A 3RZDB 2RDFA 2QGQA 4RH6A 2L4NA 3PIO3 1EQRA 1XTDA 3J80c 3U9SA 2ZXOA 4LUZA 3VR6A 3TRZA 4JOIA 1U9RA 4WJWA 4A3FB 1EZ6A 3M3YH 2BDNA 1KC8C 1GHKA 4A3BH 3CCRA 1SYGA 1EEID 1V43A 1HNXL 3T1HL 3GTPB 1TU2B 3PF5A 4DR2Q 2K5WA 4LJZC 1JICA 1YVCA 1GUNA 1ZYRC 2PCFB 1H9JA 2DNEA 2M9VA 2NVQB 3CF5A 3M7GA 3VR2A 2E2JH 1U0LA 3DM3A 2L12A 1P16A 3P20A 4C3JH 1CUKA 1ZKOA 1L1OB 1I3QB 2UXCL 2HIXA 1STGA 1SMYD 2PQAB 3CCSA 5DAUA 2VW9A 2B8GA 4DV1L 4JI0L 2XNAC 2E2IH 1I6HB 3HOZB 4KMUC 1IXRA 1GM5A 1EY0A 5DEHA 1WTWA 4X66L 4H44C 1YNNC 3E0JA 4IUUA 4LK1C 1PYWD 1AH9A 1F9PA 1H9KA 1BF4A 2Z6KA 2EYMA 2WAQG 2PNRC 5C4XG 1PH3A 4BY1H 2PNHA 2IT1A 4DNRB 4GLXA 3M4YA 4ME3A 3BZCA 3A8IE 3W1GA 1A3TA 4DGZA 4DUZL 3KBGA 2RHSB 2VQEL 3JAME 1SDFA 4P75A 2EYHA 5J39A 2D0PA 3KYHC 1Y1VG 4CKBA 1PFSA 2J0TD 1WCMG 3BG3A 2JA7H 4QB4A 3H0GG 1JWMD 4ILWA 3T16A 1A3UA 4WORA 2WFWA 5M3MH 4WJ4A 2R92B 2F0OA 2F4VL 2JA6H 2Z4IA 1J5EQ 5D3IB 2UUCL 3BDOA 3Q23A 1U4LA 1XMQQ 3IL8A 2PI2E 3NBIA 1CT1D 1KDBA 1NMGA 2PO4A 1SMYC 3Q22A 3N52A 1ENFA 2F0SA 2RSNA 1LABA 5FKAC 3LWEA 3TREA 1PTOC 3C1EA 3RD4A 2OXPA 1EQQA 1EU3A 1S5DD 5LL6X 3A54A 1T9HA 1TY0A 3HOUB 3S15B 1A63A 3I3CA 5C44B 4JI4L 1TWAB 2IHEA 4O0AA 2JP1A 4CDCC 4XQNA 2AUJD 4TQUS 4JBKA 4L63B 4B3RL 4UHVA 4DFAA 5C3EG 1S40A 1IW7D 1O7YA 1V1QA 1EU4A 4ZKCB 3SHLA 1UE5A 3X3MA 4YIJA 3GP7A 1D5ZC 2CQOA 1CHQD 3K8AA 1Y69U 3RLFA 3S9WA 1H9RA 4LMQD 1KIXA 1EY6A 3MFGA 4NPSA 4KV6A 1WTQA 3GTLB
chains in the Genus database with same CATH topology
3I4LA 4QUCA 1OXXK 1EY8A 4TRDA 3OMGA 4EQNA 1J8IA 3GTOB 1O7ZA 3NUCA 4QMGA 2B2TA 1CA6A 1G2TA 1CHPD 2JA5B 4ZUJA 3BYYB 3OPOA 4G57A 2B2YC 5M5WB 3OIQA 4J1MA 1Q90A 3R2IA 1QNUA 3C3LA 5HGTA 1XTCD 5KIXA 3H6MA 3BVZA 3L9AX 1PFNA 4G7HC 2XWJB 1QE6A 1BCPB 2WAQB 1TS4A 5C4XB 1WTXA 1Q1BA 3SK6A 1CK1A 5IGEA 3K57A 5EPLA 4ZYSA 4K6DA 2EVBA 1D5XC 1TY2A 2F0MA 1WCMB 3H0GB 2E76C 3DMUA 1Q8IA 2Q8RE 2LKVA 2HCIA 3S17B 2KCCA 4F8MA 4FF3A 3FPUB 3R8BA 2PQEA 1W6KA 3GTJB 1F2MA 1PDQA 3FVQA 4MIUA 4I65A 2R3ZA 3S16B 2XWBB 1HFNA 4U673 1U4PA 3OWFA 5CGKA 4AYBB 1HQMC 1STAA 3J80L 3H91A 5C3EB 1SE4A 4EQOA 3TBIB 1BXTA 2D2CC 3BVMA 5M5XB 4IUQA 3HP3A 1SYCA 2NVXB 1TQOA 1B2TA 1XXGA 4Z9CB 3PUYA 1AP0A 5EQ0A 3S2HB 1STEA 2BOSA 1DZ1A 3L7ZC 4Q5VA 2QEJC 3BZDB 2F0GA 2EY1A 4IQZA 1BUVT 1O80A 2QDBA 2WKDA 1VF5C 4A3GB 4A3MB 5EBDA 1ENCA 4PMBA 4RGTA 2X6GA 3J7AV 1EIHA 1EFID 2K03A 3V2TA 1SJHD 4HN7A 2F0IA 1BCPD 4IALA 2CW0C 2E2DC 2D5DA 1U4MA 1E0BA 3PIP3 2NUCA 5CC4A 3NHHA 4C3IB 3QWNA 4C56C 3K58A 3WOFA 5F2DA 3D4DA 4IZ8A 2IX0A 3AB9A 3WDNA 4OIJA 3W3AA 3H94A 4C3JG 3MXGA 2F0TA 1QCBD 3SK5A 1DD2A 1JCKB 5M3FB 1KLUD 2MUYA 5FOBB 1X3PA 2B8FA 1Q1EA 2VNUD 4IFDJ 1WVLA 2DY8A 2SNMA 3J80E 4BBSB 2NTTA 1PZID 4HSPA 4XQJA 3D6CA 4OO1I 1LTSD 1PRTD 2LS01 1T5EA 3NBHA 5ELDA 3J7AF 1D1KA 1DOLA 3QG1A 1BCPC 2HDLA 1JWUD 1OXVA 4UAIA 2OF1A 1A6XA 5IODA 2F0VA 3I70A 1B9NA 2AQ2B 5JVH3 1AN8A 1TKWB 2B2VC 4OO1G 5IIFA 2C5CA 4K5XA 2A6HD 3MXNA 3TP5A 1KLGD 2B2WA 1EQTA 4A3JB 3S1MB 1SNPA 1LT5D 1LTAD 5G3LD 5IGBA 5ELCA 1V1OA 3EQLC 3MTSA 4R9WA 2EPBA 4WFN3 5FK9C 2F0EA 3PO2B 3KBXA 4IFDI 3S1RB 1L0XB 2ZXPA 4I7ZC 4KN7C 5T1IA 4B08A 1AZQA 5BN4A 4F88A 3DWPA 3MXUA 5E1FA 4PMWA 2NZ1D 3MHBA 3V05A 3P75A 3K6OA 3ONAB 2HUGA 4IFDG 3AU7A 4RGOS 3M3YB 4A3BB 3NP8A 5NUCA 2EYFA 4HEDA 3BS1A 1C48A 3FRPB 2NWGA 3NWTA 3MWYW 4Y7NB 5ELBA 4K5WA 2OEOA 1EY5A 1I4HA 1SE2A 2WACA 2E2JB 1ESRA 2SNSA 2E75C 1RKNA 1EEFD 3E5SA 4C3JB 1FNWA 3E6ZX 4RKLA 1RTOA 1NR4A 3DHQA 1EYAA 4KY5A 2KEEA 2ICIA 1IYVA 3I73A 2E2IB 1EYDA 1ZXTA 3FDTA 4KJNA 2L0CA 2FINB 5IGGA 5A2QL 2A68D 2VXWA 3KF8A 2WP8J 4IUTA 3LNNA 2FMMA 4BY1B 1GUGA 1K8MA 1E2WA 4K8JA 1DOMA 5FO8B 3QOLA 1BDOA 2ZXRA 1HQRD 5IGFA 2FMCA 1WTVA 2EY2A 1X32A 2V4DA 1SJED 2BE5D 2JA7B 1FR3A 1CQFA 3NWSA 1BQQT 1Z7TA 4ZQ3A 2HCCA 5M3MB 1B1ZA 3TN2A 1PZJD 2JA6B 4CBVA 5I9PA 2F3WA 1MD2D 1EWCA 3D3RA 4Q0FA 4X3KA 3SVMA 4PMCA 2OT2A 5JPNC 5C0XJ 1Y8PB 2NB0A 2EJFC 5TSSA 3SXHA 4DA2A 2AQ3B 1KNEA 2TMPA 2ID0A 2EJGC 1GUTA 2A74C 2D9UA 1LTGD 2XRQD 1W6JA 3PUVA 1RF2D 4OO1H 3TSSA 4KD3A 5ELEA 4KKUA 3MVVA 3QO2A 3VYSA 2BE5C 2F3VA 2PW7A 1GUWA 3PV0A 2YU9B 1MSGA 2NVYB 4XT1B 1HCZA 3KLRA 4EQPA 1JC7A 3X3NA 5A2QE 4IUVA 3R93A 3NSWA 1SYDA 3SE0A 1RDPD 5LHY1 4WRDA 1D5MC 1GXDC 5C0XI 4U68A 3AMUA 1SYFA 2B2YA 2IL8A 2KECA 4N9PA 1EYCA 2PYKA 1FNUA 2E74C 1AEXA 5KRUA 1BOSA 1MSHA 2Z1CA 1JE4A 1KABA 1QILA 1SFOB 4IFDH 5EPKA 5A35A 4HSVA 3V96A 4C3HG 3GTQB 4R8IA 5JVG3 3KK7A 2EYLA 1Q3LA 5C5LA 5C0XG 5KNBA 1TWFB 5D14A 1GJXA 2RBMA 4KY7A 5JJZA 4NMZA 5CBEE 2IWHA 2WV6D 4KY6A 1EY4A 3G7LA 3U9OA 3K0YA 3SDZA 2Q8TA 4FYDA 1CZGA 1V1PB 2XVSA 3FKIB 2M00A 4XDXA 4RCOA 4F87A 4BS9A 1GUOA 5M9OA 2F0HA 1SAPA 2F03A 4V190 1BCPF 2JEAI 4ULLA 1GUSA 5I6WA 2NN6I 1Z6HA 1IW7C 2EYPA 1UNSA 5E4XA 2QCPX 3SK8A 4KK7A 4HTHA 3OIPA 3TZUA 1PZKD 2F0PA 4HMIA 2DN8A 5BN5A 4ZRZA 2R7ZB 3IAYA 1LT4D 4BBRB 1S5ED 2B2UC 1II3A 1Y1VB 1KNAA 2BCOA 4KHZA 1DYQA 3I90A 1DCZA 1SNQA 3HG9A 1IL8A 2NN6G 1VCIA 1RHPA 5I9OA 1B3AA 3BDCA 1B4OA 1QNKA 3NTIA 1SEBD 1TS5A 1I4RA 3P1HA 3MFYA 1LTRD 1TVXA 2RVLA 3N6RA 1F9QA 1SYEA 1S5FD 4ZKBB 1NUCA 1PRTF 2CHBD 3T56B 3WOEA 1G2SA 1PRTB 4O42A 5T1GA 3QOJA 2VB3X 4HR7B 3C2PA 2ENBA 3OW7A 2WINB 3D31A 2NTSA 4CKCA 3J7YW 3KLSX 1XX8A 3QIAA 3CKIB 1RJTA 3ZYYX 3FPPA 1EY7A 1R4QB 4C2MB 4KTAA 3K5LA 4BA2I 3TZDA 3MZ5A 2HDMA 5CV4A 5J22A 4C3HB 4PNYA 1WTPA 5EKLA 3HGBA 5FLXL 5IOCA 3K5NA 4ZLTF 3KUPA 2A69D 1R9TB 1PXUA 3URYA 2L11A 1UUPA 5C6AA 1H9SB 5G3LF 3CQZB 1H9MA 4ZK9B 3S1NB 2EXZA 4H13C 3MXPA 2EOTA 1M8AA 5KNDA 5JEAJ 1SBBB 4RGMA 2K7VA 2EYJA 1HHVA 3DEOA 1MGSA 4LAAA 3Q24A 1UAPA 4XQQA 1Q12A 2PZTA 2RA4A 5CORA 2XIWA 4OIKA 2C9OA 1KDCA 1JQYD 2WB1B 1EOTA 4FF4A 2F0LA 3A7LA 1VF7A 1HXYD 1JB3A 4QIWB 5CV7A 5DNFA 5DM73 3H3VC 3M85A 4ZAIA 2EY6A 1JWSD 1I6VC 3A55A 4H7BA 5C0XH 2X69A 3RUZA 1ILQA 1NAPA 2RQXA 2E2HB 1CTMA 4KI0A 1S4ZA 1C8CA 3QJYA 4K6LA 2B2VA 2PMZB 3D4WA 4ABNA 1LLRD 3HEJA 4HCSA 3TDQA 2F0FA 1HUNA 2JXMB 1PLFA 3TP6A 4E6IA 3PMFA 2Z4HA 1ZEQX 1F2ZA 1IKMA 2LFNA 1G8ZD 4IN3A 3D8GA 1F9SA 4EGVA 4DF7A 5IGDA 3BDLA 4FXKC 5COYA 5CYUA 4DAVA 1XYIA 4QUFA 3SEBA 1B53A 2NBFA 5D3DA 2YYZA 5FLXE 3GO5A 1SNOA 1QJOA 5JEAG 1EZ8A 4J6HA 3T13A 2A5HA 2MPMA 2VUMB 3I4MB 4J8QA 2BA0A 4KKTA 5CV6A 2NN6H 5KYIA 2K32A 2MP1A 1DJRD 1I4QA 3GV3A 4IURA 4CJ1B 1IHZA 3T53B 5BN3A 4RAUC 1Z47A 3K5OA 3KLSA 1X3QA 1JOOA 5CBAE 1XWEA 5HURA 1PRTC 3VA7A 2PZWA 1I50B 1IKLA 3NQTA 1AW7A 2A6ED 3SK4A 4DNTB 1RD9D 1LV9A 3HOYB 2GA4B 1TWHB 5E4WC 2EY5A 2Y0SB 2KA7A 2XSCA 1B44D 4KKSA 1SYBA 1DONA 5CV8A 2A6HC 2SDFA 2G9HD 5ISRA 2BA1A 1STBA 1MBYA 1LACA 2RSOA 1HTPA 1ZYRD 2LMCB 3MA2B 2JEBI 4PV1C 1JOQA 4CJ0B 4KHVA 4PQXA 4CHTB 1QOHA 4IUPA 3O13A 1PTOH 3OMCA 4QF4A 5I2YA 1WD0A 3OHXC 4ID6A 1L0YB 3VA5A 3PO3B 3GD7A 1E2ZA 3VR3A 2L55A 4K8IA 1YNND 2O2LD 2QF7A 1OXUA 2F0NA 5AFWA 2XN9C 3MC0B 4DK1A 2B39A 2J4XA 3FMCA 1A2UA 5EGTA 2JE6I 2AWOA 2F0WA 3NXWA 2KHSA 3Q6SA 2SOBA 2F0QA 4BY7B 3SR1A 4XIGS 2K1BA 1GOZA 4QCLA 1JR0D 4L8JA 1TR5A 3Q0AA 2JA8B 3NPPA 1JORA 3MEHA 4A93B 3VYRA 1T5XD 4XYQA 3TMEA 3S2DB 4FXGC 4TSSA 2K33A 2J7ZA 1Y1WB 3I91A 4ZUIA 3ITPA 3I72A 3HKZB 4MHEA 1PTOD 1YNJD 2A68C 5K36G 2FHTA 3GQBA 2RDHA 4XYOA 5JEAH 1NSNS 4X3TA 1STNA 4FVMA 3ERQA 3T4AC 5KNCA 1QWYA 5M5YB 1CM9A 1SE3A 3DWQA 4EVOA 3QB3A 2X6LA 4B9WA 4JBWA 3NK9A 4DXFA 1LT6D 2JSOA 4X3SA 2KUMA 4DN4M 3VR4A 4X3UA 5CV5A 4A3DB 3IFTA 2O4XA 1CZWA 2AWNA 2MHVA 1S5BD 1EL0A 5C3XA 1ML0D 1HUMA 4A3IB 1TIID 1V8QA 1A2TA 2KQ3A 4DXGA 4B9XA 1QB5D 1BNZA 1M4VA 1KAAA 1UEAB 2A73B 5IT9L 3EA6A 1ONLA 4FNFA 4K14A 4ODGA 4XXEA 3DWAA 1YNJC 2G9DA 1A15A 3GTMB 4S3SA 3DEPA 1SSOA 1HA5A 3CRLC 1I4PA 2LY7A 3CRKC 3OOCA 3K5MA 3BVGA 4RHSA 1HPCA 2O5JC 2MGSA 1BR9A 2KJXA 3J81L 1B50A 2I07B 2EZVA 4NDXA 1ICWA 2K5QA 1EIGA 3T51B 4FO2A 3VYUA 2CVRA 5JAVA 4CKEA 2XRSD 2EYOA 2B2UA 3RMHA 1PFMA 1BBXC 3VR5A 1VMCA 1AFPA 1GHJA 1R4PB 2AUKA 5I2XA 1JOKA 1VMPA 4NW2A 1WD1A 2WKCA 5EBCA 4OHJA 2TSSA 1STYA 3ND8A 1ET9A 2K05A 2HQEA 5JPMC 5I6YA 1OO9B 2H1EA 1DXMA 3OWEB 4UDUC 2N55A 3M7NA 2R61A 2L9HA 2MJ8A 1O7LA 5KGUA 2JYOA 4KN4C 3D4RA 4OL7A 3TP8A 4G7OC 3L3OC 3LX0A 1EQVA 4K5VA 2PZUA 2Q8IB 3PUXA 3VYTA 3EFXD 2PW5A 5FO9B 3FEWX 3MAQA 1CQVA 4C3IG 2B2TC 3DM1A 1ENAA 1TS2A 1ESFA 2NVTB 5C5MA 5IT9E 1E2VA 4A3EB 1O78A 4DK0A 4A3KB 1OXTA 5C4ZA 3EVQA 2L1BA 4FF2A 4V0BA 4RKBA 2F0UA 1PFBA 3R3OA 5EJWA 4JK1C 4ME5A 2R93B 1A3VA 3HOXB 2RDGA 2PPBC 5K36H 5C4HA 1AZPA 2IPKD 2F1MA 3J81E 3NE5B 5C3WA 1CFMA 5KYLA 3CHBD 4DAPA 4M8AA 2K6AA 4OGQC 1LTID 4L6TB 1F77A 2B63B 1STHA 3DXJC 4K2LA 1SXTA 2CW0D 1Y8NB 3IKJA 1IYUA 2KEDA 1OXSC 1MI2A 4HAEA 5EKKA 4RGNA 2Z8LA 1C4QA 3PUWA 4KD4A 1FYCA 5C4JB 2EE1A 4G4KA 1G91A 2K01A 1S5CD 4RCNA 1PMRA 1K8OA 4M1UB 5JOBA 2I46A 5D65A 3HOVB 4BWGB 1D2BA 2F0JA 5K5PA 3HRZC 4TKOB 2KVMA 4RA8A 2N88A 1ET6A 1KDAA 1BO0A 3OSOA 3A56A 4F7XA 2M2LA 1FD7D 1V1PA 4GZYC 1RODA 3D6WA 1G6ZA 1WTOA 2KOLA 4IUNA 2H4OA 3I4NB 1LTBD 3CU7A 4HCEA 1TS3A 4G7ZC 3EROA 5LL6S 2VB2X 1WTRA 1TT2A 1G291 3NTKA 3EJIA 1LO5D 3HZXA 2IX1A 3C46A 1QG7A 1ILPA 3H09A 3RZOB 3NQIA 4FP5D 2A69C 4HMJA 5I4DA 2FJ2A 1EWHA 2EDGA 1F9RA 1K83B 4K2KA 1NCVA 3ND9A 2SEBD 2FFKB 1LTTD 4DU9A 1HFGA 2F4IA 3S14B 3UI2A 3I8ZA 2DY7A 1FGBD 2AQ1B 2KCNA 4DAYA 2F0KA 3K59A 2IJ0A 3IFDA 4KJOA 2F0DA 5CMDA 4RHRA 4R8NA 2K5DA 2DNCA 1HRJA 5DM63 3P7JA 3GV6A 4N9TA 1SNCA 3HS0C 2D62A 1CI3M 5IGCA 3A7AB 1RCVD 1FNVA 1TWCB 3G6JB 5ELFA 5EPJA 4XT3B 1EY9A 2CQAA 3GTGB 2WIIB 2ICEC 1U4RA 1F2YA 2IW3A 4FXDA 1TWGB 3TP7A 3DUZA 2NYZD 3R2TA 4NP5A 5E3FA 2QILA 1I4GA 1DM0B 5EKIA 4CGYB 1PTOF 1H9SA 1PTOB 4FF1A 3LWUA 3K7AB 3A8JE 2EJMA 4NKLA 5FO7B 1VDZA 3C1FA 1DOKA 3PUZA 3F2UA 1HA6A 5CV9A 2IX3A 1D6EC 2R6GA 1SNMA 1KTKA 1D1IA 1F2LA 5KEEA 1LT3D 1RTNA 2B2WC 5CR3A 2QKIC 2K04A 4RWSC 1SNDA 2L5TA 3M4OB 3S1QB 4C1NI 4O1NA 3BYTB 3NTHA 3JAML 1NR2A 4MN3A 5J1ZA 2O5IC 1CA5A 2ZT9C 3GTKB 4CJ2C 1J9OA 4P2CB 3HOWB 1Y8OB 4C1NK 2BDOA 4XTCS 2A6EC 4BA1I 1HTLD 1B9MA 3A8KE 3W2DA 4H0LC 2K28A 4RFBA 1I4XA 2RKSA 3RZDB 2RDFA 4RH6A 2L4NA 3PIO3 3U9SA 2ZXOA 3VR6A 1U9RA 4WJWA 4A3FB 1EZ6A 2BDNA 1GHKA 1SYGA 1EEID 1V43A 3GTPB 1TU2B 2K5WA 4LJZC 1JICA 1GUNA 1ZYRC 2PCFB 1H9JA 2DNEA 2M9VA 2NVQB 3M7GA 3VR2A 2L12A 3P20A 1ZKOA 1I3QB 1STGA 1SMYD 5DAUA 2B8GA 2XNAC 1I6HB 3HOZB 4KMUC 1EY0A 5DEHA 1WTWA 4H44C 1YNNC 3E0JA 4IUUA 4LK1C 1PYWD 1F9PA 1H9KA 1BF4A 2EYMA 2PNRC 2IT1A 4DNRB 3M4YA 3A8IE 1A3TA 4DGZA 3KBGA 3JAME 1SDFA 2EYHA 5J39A 4CKBA 2J0TD 3BG3A 4QB4A 1JWMD 4ILWA 3T16A 1A3UA 4WORA 2R92B 2F0OA 2Z4IA 5D3IB 3BDOA 3Q23A 1U4LA 3IL8A 3NBIA 1CT1D 1KDBA 2PO4A 1SMYC 3Q22A 3N52A 1ENFA 2F0SA 2RSNA 1LABA 5FKAC 3LWEA 1PTOC 3C1EA 3RD4A 2OXPA 1EU3A 1S5DD 5LL6X 3A54A 1TY0A 3HOUB 3S15B 3I3CA 5C44B 1TWAB 2JP1A 4XQNA 2AUJD 4TQUS 4L63B 4DFAA 1IW7D 1O7YA 1EU4A 4ZKCB 3SHLA 3X3MA 4YIJA 3GP7A 1D5ZC 1CHQD 1Y69U 3RLFA 3S9WA 1H9RA 4LMQD 1EY6A 3MFGA 4KV6A 1WTQA 3GTLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY2 A;  2O4X A;  1EY0 A;  4KJO A;  2HQE A;  2F0D A;  5KYI A;  5DEH A;  1SNQ A;  4WRD A;  3D4D A;  1KDC A;  5I6Y A;  1EY8 A;  4TRD A;  3VA5 A;  4IZ8 A;  4MIU A;  4I65 A;  3OMG A;  5C3X A;  4EQN A;  5I9O A;  2F0L A;  4KD4 A;  1SYF A;  3BDC A;  4N9P A;  1EYC A;  4K8I A;  2PYK A;  3OWF A;  5KRU A;  3NUC A;  1AEX A;  5CGK A;  4ZQ3 A;  2EYM A;  4R8N A;  2F0N A;  4QMG A;  5KGU A;  1IHZ A;  5J1Z A;  1STA A;  4OL7 A;  5E1F A;  1KAB A;  5CV7 A;  3TP8 A;  3P1H A;  2F0T A;  5I9P A;  3LX0 A;  1A2U A;  5EGT A;  5JOB A;  2F3W A;  3SK5 A;  3MHB A;  4EQO A;  2EY6 A;  2F0W A;  2F0J A;  3NXW A;  4ZUJ A;  2KHS A;  1A2T A;  5K5P A;  1EQV A;  3P75 A;  4K5V A;  1SYE A;  1A3T A;  2KQ3 A;  4DGZ A;  4G57 A;  2PZU A;  1NUC A;  4H7B A;  2SOB A;  4B9X A;  4PMC A;  2F0Q A;  1KDA A;  4N9T A;  1KAA A;  3NP8 A;  1JOO A;  1SNC A;  3OSO A;  3RUZ A;  5NUC A;  2EYH A;  5HUR A;  2SNM A;  2EYL A;  2PW5 A;  4J1M A;  4F7X A;  5J39 A;  5C5L A;  5IGC A;  2EYF A;  1SYC A;  1TQO A;  3SR1 A;  2PZW A;  4K14 A;  3D6C A;  3QOJ A;  4ODG A;  5EKK A;  5HGT A;  2RBM A;  1ENA A;  4IUN A;  4KY7 A;  3NQT A;  4NMZ A;  2ENB A;  4KY6 A;  4QB4 A;  3SXH A;  1EY4 A;  1EY9 A;  5C5M A;  5KIX A;  4S3S A;  3SK4 A;  3T16 A;  1TR5 A;  1A3U A;  3H6M A;  3U9O A;  4K5W A;  2OEO A;  4WOR A;  1EY5 A;  1JOR A;  3D4W A;  3ERO A;  3MEH A;  1F2Y A;  2F0O A;  2WAC A;  2RKS A;  5C4Z A;  2SNS A;  3HEJ A;  1RKN A;  3EVQ A;  2EY5 A;  1TT2 A;  3TME A;  3TP7 A;  1EY7 A;  2F0F A;  2RDF A;  3E5S A;  2OF1 A;  2M00 A;  5IOD A;  4NP5 A;  3TP6 A;  5E3F A;  2F0V A;  3SK6 A;  4RKL A;  4E6I A;  3EJI A;  3PMF A;  4RKB A;  5IGE A;  1U9R A;  3DHQ A;  1KDB A;  2F0U A;  4KTA A;  1EYA A;  1EZ6 A;  3HZX A;  3R3O A;  2F0G A;  4KY5 A;  1F2Z A;  4KD3 A;  2F0S A;  1SYB A;  2EY1 A;  3MZ5 A;  1SYG A;  5CV4 A;  5CV8 A;  5J22 A;  4NDX A;  2QDB A;  4PNY A;  5EKL A;  3ITP A;  3C1E A;  4ZUI A;  4ME5 A;  2OXP A;  5IIF A;  5ISR A;  3D8G A;  4K6D A;  1A3V A;  5M9O A;  2F0H A;  4NKL A;  3MVV A;  4K5X A;  5C4H A;  1EYD A;  4HMJ A;  1ENC A;  1STB A;  5IOC A;  4PMB A;  4KJN A;  3C1F A;  4DF7 A;  5IGD A;  5JAV A;  3BDL A;  5C3W A;  5KYL A;  3TP5 A;  5I6W A;  2F0M A;  5CV9 A;  5IGG A;  2F3V A;  2PW7 A;  2EYO A;  2EYP A;  3V2T A;  5C6A A;  3DMU A;  2F0I A;  1NSN S;  3SK8 A;  4IAL A;  1SNM A;  1STN A;  2LKV A;  4HTH A;  4K2K A;  4DFA A;  1SNO A;  3ERQ A;  2EXZ A;  1STH A;  3MXP A;  2F0P A;  3SHL A;  5KEE A;  1SNP A;  4HMI A;  1JOQ A;  1EZ8 A;  4K2L A;  4YIJ A;  4EQP A;  4J6H A;  1JOK A;  4DU9 A;  3T13 A;  4K8J A;  4EVO A;  2EYJ A;  2NUC A;  3QB3 A;  4B9W A;  1STG A;  4KHV A;  4F8M A;  3NHH A;  3NK9 A;  5CC4 A;  5IGB A;  3QOL A;  5DAU A;  3S9W A;  2PQE A;  5CR3 A;  4LAA A;  1II3 A;  1EY6 A;  2F0E A;  1SND A;  3OMC A;  4QF4 A;  2F0K A;  5IGF A;  2PZT A;  5CV6 A;  5CV5 A;  1STY A;  5F2D A;  1SYD A;  4KV6 A;  1F2M A;  4ID6 A; 
#chains in the Genus database with same CATH topology
 3I4L A;  4QUC A;  4LF6 L;  1OXX K;  2EIF A;  1EY8 A;  4TRD A;  3OMG A;  4EQN A;  1YIT A;  1J8I A;  3GTO B;  1O7Z A;  5GAG C;  3NUC A;  1YJN A;  1Y14 B;  3S24 A;  2YU9 H;  2F3I A;  4QMG A;  2KBN A;  4DV2 L;  2B2T A;  1CA6 A;  1G2T A;  3G48 A;  1CHP D;  2JA5 B;  1G51 A;  4ZUJ A;  4QGU A;  3T1Y L;  3BYY B;  1G6P A;  3OPO A;  4G57 A;  2B2Y C;  5M5W B;  3HOU H;  3OIQ A;  3AYH B;  4NXN L;  4A3M G;  4J1M A;  1TWA H;  1Q90 A;  3R2I A;  1QNU A;  3C3L A;  5HGT A;  2YTV A;  5BR8 L;  1SMX A;  2JQO A;  1K3B C;  2WB1 G;  1XTC D;  5KIX A;  3H6M A;  3BVZ A;  3L9A X;  1PFN A;  4TVA B;  4G7H C;  2XWJ B;  3F2C A;  1QE6 A;  1BCP B;  2WAQ B;  1TS4 A;  5C4X B;  1WTX A;  1Q1B A;  1SFO H;  3H3V H;  1X6O A;  1Q86 C;  3CME A;  3J80 i;  4DR3 Q;  3SK6 A;  3F8T A;  1CK1 A;  5IGE A;  3K57 A;  2Q2I A;  5EPL A;  3GTL H;  1C7Y A;  4ZYS A;  2H5X A;  1HNZ L;  1TWF H;  4K6D A;  4JVZ A;  2EVB A;  1E24 A;  4DK3 C;  1D5X C;  5IP7 G;  1TY2 A;  2F0M A;  1WCM B;  2RHQ B;  3H0G B;  4CDD C;  1PH7 A;  2E76 C;  3DMU A;  1Q8I A;  2VY3 A;  3M9B A;  1K9M C;  2Q8R E;  2LKV A;  3K81 C;  3FKI H;  2HCI A;  3S17 B;  2KCC A;  2CH4 W;  4F8M A;  4FF3 A;  3FPU B;  3R8B A;  1XNQ Q;  2N49 A;  4JBM A;  2PQE A;  1W6K A;  1WJJ A;  3GTJ B;  3AFQ A;  1F2M A;  4DAM A;  1PDQ A;  3FVQ A;  4MIU A;  4I65 A;  1NNX A;  1N8R C;  5C4X H;  2R3Z A;  3S16 B;  2XWB B;  1HFN A;  4U67 3;  1U4P A;  3OWF A;  5FLM G;  5CGK A;  4DR6 Q;  4AYB B;  2CH4 A;  4JI7 Q;  1HQM C;  4PZ6 A;  3U4Z A;  5LMN W;  1STA A;  3J80 L;  3A0J A;  1VQO A;  3H91 A;  5C3E B;  1SE4 A;  2OTL A;  3WWV A;  4DV6 L;  4B3M L;  2HT1 A;  4EQO A;  2R7Z H;  3TBI B;  1BXT A;  2D2C C;  3BVM A;  1PVO A;  4BBR H;  5M5X B;  1Y1V H;  1B7Y B;  2Z0S A;  3I4M G;  1YHB A;  4IUQ A;  3HP3 A;  1SYC A;  2NVX B;  1TQO A;  1B2T A;  4LF9 Q;  1XXG A;  3RNU A;  4O2D A;  2I0Q A;  4Z9C B;  3PUY A;  1FJG L;  1KRS A;  1AP0 A;  1XNR Q;  4X64 L;  5EQ0 A;  3S2H B;  3I2Z A;  5ELO A;  1STE A;  1KD1 C;  4DR4 Q;  4AH6 A;  4JYA Q;  2BOS A;  1DZ1 A;  4LF7 Q;  3L7Z C;  1QUQ A;  4Q5V A;  3CPF A;  2QEJ C;  3GTJ H;  4KHP Q;  3BZD B;  2F0G A;  2EY1 A;  1PHJ A;  4IQZ A;  1BUV T;  1O80 A;  2QDB A;  1NMF A;  2WKD A;  1XMO Q;  1VF5 C;  4A3G B;  4A3M B;  2GVA A;  5EBD A;  3M4Q A;  1ENC A;  4PMB A;  4RGT A;  3CCQ A;  2X6G A;  3J7A V;  1MKH A;  3MEF A;  1EIH A;  1EFI D;  1QZH A;  2K03 A;  5C3E H;  3V2T A;  1SJH D;  2PMZ E;  4HN7 A;  2F0I A;  1BCP D;  4IAL A;  2CW0 C;  4DV3 Q;  2E2D C;  2D5D A;  2K50 A;  1PV4 A;  5M5X H;  1U4M A;  1E0B A;  4C2M H;  4N8F A;  2Y0S G;  3PIP 3;  3GDE A;  1VQ8 A;  2I5M X;  2NUC A;  5CC4 A;  3NHH A;  2VQF Q;  4C3H H;  4C3I B;  3QWN A;  4C56 C;  3K58 A;  3WOF A;  5F2D A;  1HZB A;  4X65 Q;  4GKJ L;  3D4D A;  2ES2 A;  4JG2 A;  1R9T H;  4IZ8 A;  2IX0 A;  3J7A 5;  3AB9 A;  3WDN A;  3CQZ H;  4OIJ A;  2LXK A;  1VQD A;  3S1N H;  3W3A A;  3H94 A;  4C3J G;  3MXG A;  2F0T A;  1QCB D;  3SK5 A;  1B3Q A;  4YY3 Q;  1DD2 A;  1JCK B;  5M3F B;  1KLU D;  2MUY A;  5FOB B;  1X3P A;  2B8F A;  1Q1E A;  2VNU D;  4IFD J;  1WVL A;  2DY8 A;  2SNM A;  3J80 E;  4BBS B;  2NTT A;  1PZI D;  4JI2 L;  4HSP A;  3E9I A;  5IE8 A;  4XQJ A;  4IPC A;  2VS1 A;  3D6C A;  4OO1 I;  1LTS D;  1PRT D;  2LS0 1;  1T5E A;  3OYY A;  3NBH A;  2LSS A;  4CDF C;  4GNX B;  5ELD A;  2QW7 A;  3J7A F;  4A75 A;  3F1Z A;  1D1K A;  1NJI C;  4LW1 A;  1DOL A;  2MFI A;  3KF6 A;  3QG1 A;  1BCP C;  1JJG A;  2HDL A;  1JWU D;  1HZA A;  1OXV A;  2CKZ B;  2UXD L;  1VQG A;  2NZH A;  2OF1 A;  4UAI A;  3L2P A;  1A6X A;  5IOD A;  2F0V A;  3I70 A;  1B9N A;  2AQ2 B;  1NTG A;  3I55 A;  5JVH 3;  1AN8 A;  1TKW B;  2B2V C;  1UEB A;  4OO1 G;  5IIF A;  2C5C A;  4K5X A;  2A6H D;  3MXN A;  4DR5 L;  2E2H H;  2JA7 G;  3T1H Q;  1AE2 A;  3TP5 A;  1KLG D;  2B2W A;  2JA8 G;  2JA6 G;  1EQT A;  4A3J B;  3S1M B;  1SNP A;  4A93 G;  1LT5 D;  1E1O A;  1LTA D;  5G3L D;  5IGB A;  5ELC A;  1V1O A;  3EQL C;  3MTS A;  4R9W A;  2EQS A;  2Q2H A;  2EPB A;  4WFN 3;  4HJ9 A;  1MIU A;  2F0E A;  5FK9 C;  3PO2 B;  2UXC Q;  1A62 A;  3ZJY C;  1XPR A;  3KBX A;  4IFD I;  1O7I A;  3S1R B;  1VQ6 A;  1L0X B;  4B3S L;  4DV1 Q;  2VL6 A;  4JI0 Q;  4P71 A;  1KXL A;  3RR5 A;  2ZXP A;  3FP9 A;  4I7Z C;  5FLM H;  4KN7 C;  2MNA A;  5T1I A;  4B08 A;  1AZQ A;  5BN4 A;  4F88 A;  4X66 Q;  1PH8 A;  3DWP A;  3MXU A;  3F2D A;  5E1F A;  4PMW A;  1EYG A;  3EBE A;  4QY7 A;  2NZ1 D;  3MHB A;  3V05 A;  2VUM H;  3P75 A;  3K6O A;  3ONA B;  3I4M H;  2HUG A;  2UXB Q;  4IFD G;  3AU7 A;  4RGO S;  3M3Y B;  4A3B B;  3NP8 A;  3A5Z B;  5NUC A;  1VQE A;  2EYF A;  4HED A;  4DUZ Q;  2VQE Q;  1C48 A;  3BS1 A;  4A3D G;  3FRP B;  3PCO B;  1VQA A;  4HID A;  1VQB A;  1MJC A;  2NWG A;  5E7N A;  3NWT A;  3MWY W;  4Y7N B;  5ELB A;  4K5W A;  4GLA C;  2OEO A;  2E5L L;  1EY5 A;  1I4H A;  1SE2 A;  2WAC A;  2E2J B;  1ESR A;  2SNS A;  2E75 C;  5JJL A;  1RKN A;  4YHH L;  4LF4 L;  1EEF D;  3E5S A;  2KCM A;  4C3J B;  1FNW A;  3E6Z X;  2F4V Q;  4RKL A;  1RTO A;  1NR4 A;  3DHQ A;  1EYA A;  4KY5 A;  4OEM B;  4R4C A;  2UUC Q;  2KEE A;  2ICI A;  1X9N A;  1PH2 A;  1IYV A;  3H15 A;  1PYB A;  3I73 A;  1I50 H;  2E2I B;  1EYD A;  1ZXT A;  1N32 L;  3FDT A;  4KJN A;  3F2B A;  1VQL A;  2L0C A;  2FIN B;  5IGG A;  4GN5 A;  1EOV A;  4LFA L;  5A2Q L;  1CSP A;  2A68 D;  4X62 L;  3HOY H;  4PZ8 A;  2VXW A;  1IBK L;  3KF8 A;  4JI4 Q;  1TWH H;  2WP8 J;  4IUT A;  3LGJ A;  3LNN A;  2FMM A;  1QVF A;  4BY1 B;  2Z9H A;  1GUG A;  1K8M A;  2MO0 A;  1E2W A;  4K8J A;  4B3R Q;  1N9W A;  1DOM A;  5IYC G;  5FO8 B;  3QOL A;  1BDO A;  2HIV A;  2ZXR A;  1HQR D;  5IGF A;  2FMC A;  3HKZ E;  1WTV A;  1XJV A;  2EY2 A;  4Y7N H;  1X32 A;  3AFP A;  4DK6 C;  2V4D A;  5FLX c;  1SJE D;  3J81 j;  2BE5 D;  2JA7 B;  1FR3 A;  4GKK Q;  1E1T A;  1CQF A;  4LF6 Q;  3NWS A;  2UUA L;  1BQQ T;  1Z7T A;  4ZQ3 A;  2HCC A;  5M3M B;  1B1Z A;  3FKI G;  3TN2 A;  1PZJ D;  2JA6 B;  4MNO A;  4CBV A;  5I9P A;  2F3W A;  1MD2 D;  1EWC A;  3D3R A;  4Q0F A;  4X3K A;  4LUO A;  1WOC A;  3SVM A;  4PMC A;  4IO9 A;  2OT2 A;  5JPN C;  3T1Y Q;  2K5H A;  5C0X J;  2N3S A;  1Y8P B;  2NB0 A;  1PH6 A;  2EJF C;  3PO3 H;  5TSS A;  3SXH A;  4DA2 A;  2AQ3 B;  4GNX C;  1KNE A;  2TMP A;  2ID0 A;  4GOP B;  1I5F A;  2EJG C;  2K75 A;  5BR8 Q;  1GO3 E;  4JPB W;  1GUT A;  2A74 C;  2Q2T A;  2D9U A;  1S3O A;  1LTG D;  2KHJ A;  2XRQ D;  2R7Z G;  1W6J A;  3PUV A;  1RF2 D;  4BBR G;  4OO1 H;  1A0I A;  3TSS A;  4KD3 A;  1FVI A;  5ELE A;  4KKU A;  4BY7 H;  1NBW A;  3MVV A;  4OEL B;  3QO2 A;  1HNZ Q;  3PQI A;  3K0X A;  3VYS A;  2BE5 C;  2JA8 H;  2F3V A;  1JMC A;  2PW7 A;  4JV5 L;  1YBY A;  4JI3 L;  1GUW A;  3PV0 A;  1HR0 L;  1X55 A;  2YU9 B;  1MSG A;  4A93 H;  2NVY B;  4XT1 B;  4A3K G;  1HCZ A;  3KLR A;  2B29 A;  4EQP A;  2UUB L;  3S2D H;  1JC7 A;  3X3N A;  5A2Q E;  1PH1 A;  4IUV A;  3R93 A;  3NSW A;  3A74 A;  1SYD A;  2KEN A;  3SE0 A;  4LFB L;  1RDP D;  5LHY 1;  2R93 G;  2DUD A;  2QEX A;  4WRD A;  3HOX G;  1D5M C;  1GXD C;  5C0X I;  2OQK A;  4U68 A;  3AMU A;  1HNW L;  4DV4 L;  2A1A A;  1K0R A;  1ICF B;  1QVC A;  1SYF A;  2B2Y A;  2K52 A;  2IL8 A;  2KEC A;  4N9P A;  1EYC A;  2PYK A;  1FNU A;  2E74 C;  1AEX A;  5KRU A;  1BOS A;  1VQN A;  1MSH A;  2Z1C A;  5M5Y H;  1JE4 A;  1KAB A;  1QIL A;  2B63 G;  1SFO B;  4IFD H;  1EIF A;  1FGU A;  5EPK A;  5A35 A;  4YCV A;  4HSV A;  3V96 A;  1I94 L;  4C3H G;  3GTQ B;  4R8I A;  4B3M Q;  5JVG 3;  2N78 A;  3KK7 A;  2EYL A;  4A3D H;  4NXM L;  1Q3L A;  1VS0 A;  5C5L A;  5C0X G;  2OCE A;  5KNB A;  1TWF B;  5D14 A;  1GJX A;  4PG3 A;  2RBM A;  3TEH B;  1W2B A;  4KY7 A;  5CBE E;  4NMZ A;  5JJZ A;  2IWH A;  2WV6 D;  4KY6 A;  1EY4 A;  2NVY H;  4ZCK A;  3G7L A;  2YV5 A;  2RCN A;  3U9O A;  1N34 Q;  4A3I H;  3K0Y A;  1JB7 A;  1FJG Q;  3SDZ A;  1WI5 A;  2Q8T A;  1W3S A;  3ERS X;  4FYD A;  1CZG A;  1HZC A;  1V1P B;  2XVS A;  4X64 Q;  3FKI B;  2M00 A;  2CCZ A;  4XDX A;  4RCO A;  3RN5 A;  4DR1 L;  3ICE A;  4F87 A;  4BS9 A;  1GUO A;  5M9O A;  2F0H A;  1SAP A;  2F03 A;  4AQY L;  4V19 0;  3UDI A;  1BCP F;  2JEA I;  4ULL A;  3GTM H;  1GUS A;  5I6W A;  2NN6 I;  1Z6H A;  1IW7 C;  2EYP A;  1D8L A;  1UNS A;  2JJQ A;  5E4X A;  2QCP X;  3SK8 A;  3KOJ A;  4KK7 A;  2ZTD A;  4HTH A;  3OIP A;  1YNX A;  3TZU A;  1PZK D;  5IYC H;  2F0P A;  3GTQ H;  4HMI A;  1RIP A;  2DN8 A;  5BN5 A;  4ZRZ A;  4POG A;  4LWC A;  2R7Z B;  4GLV B;  3KDF A;  3IAY A;  1LT4 D;  1EUJ A;  1S5E D;  2B2U C;  4BBR B;  1II3 A;  1Y1V B;  4GKK L;  1KNA A;  2BCO A;  4KHZ A;  3CPW A;  1DYQ A;  3I90 A;  3QR8 A;  4DR7 L;  1DCZ A;  3ULP A;  1KRT A;  1SNQ A;  3HG9 A;  1IL8 A;  2NN6 G;  1K3R A;  1VCI A;  4OX9 Q;  1RHP A;  5I9O A;  1VQI A;  1B3A A;  4P73 A;  3BDC A;  2ZM6 L;  4GKJ Q;  4OWW B;  2R7D A;  1B4O A;  1L1O C;  4DAY B;  5IWA L;  1QNK A;  3NTI A;  1SEB D;  1VQ7 A;  1J5E L;  1TS5 A;  1I4R A;  3P1H A;  1OTC A;  4AYB E;  3MFY A;  1LTR D;  2P5Z X;  1TVX A;  2RVL A;  3N6R A;  1F9Q A;  1SYE A;  2UU9 L;  1K73 C;  1S5F D;  4ZKB B;  1NUC A;  1PRT F;  2CHB D;  3T56 B;  3WOE A;  1G2S A;  3NBH B;  4DV7 Q;  1PRT B;  2V1C C;  4O42 A;  2K4K A;  5T1G A;  3PIO A;  1YJ9 A;  3QOJ A;  1EWI A;  2VB3 X;  4HR7 B;  3C2P A;  1VQJ A;  2ENB A;  1VQM A;  3OW7 A;  2WIN B;  3D31 A;  3KF6 B;  2NTS A;  4JI2 Q;  4CKC A;  1IYJ B;  3J7Y W;  2CFM A;  3KLS X;  1XX8 A;  3QIA A;  4GOP C;  3CKI B;  2LXJ A;  1HZ9 A;  1RJT A;  3ZYY X;  4DV5 L;  2HHH Q;  3FPP A;  1EY7 A;  4DPG A;  4X6A H;  2D0O A;  2VUM G;  1R4Q B;  1NY4 A;  4JC0 A;  4R4Q A;  4C2M B;  4KTA A;  3K5L A;  3CCM A;  4BA2 I;  3TZD A;  1WTH A;  3AQQ A;  3MXN B;  3MZ5 A;  2HDM A;  5CV4 A;  4HJA A;  5J22 A;  4C3H B;  4PNY A;  1WTP A;  5EKL A;  2XGT A;  3HGB A;  5FLX L;  4LF8 Q;  2BH2 A;  5IOC A;  3K5N A;  4ZLT F;  3KUP A;  4L5S A;  2NVT H;  2YTY A;  2A69 D;  1R9T B;  1PXU A;  4BXX H;  3URY A;  2L11 A;  1IBL L;  3EN2 A;  4IJH A;  1UUP A;  5C6A A;  4OWX B;  1H9S B;  5G3L F;  2K14 A;  4A3K H;  3CQZ B;  1H9M A;  4ZK9 B;  3S1N B;  2EXZ A;  1RL2 A;  3D0F A;  2EOT A;  3MXP A;  4H13 C;  5IP9 G;  1M8A A;  5KND A;  5JEA J;  1SBB B;  2ZTE A;  4RGM A;  2K7V A;  4UP8 A;  2EYJ A;  1HHV A;  3STB D;  3DEO A;  1FL0 A;  1U5K A;  2XTI A;  1MGS A;  4UP9 A;  4LAA A;  3Q24 A;  2R93 H;  1UAP A;  4XQQ A;  1Q12 A;  1K8A C;  2PZT A;  3HOX H;  2RA4 A;  4A3L H;  5COR A;  2XIW A;  1VQP A;  4OIK A;  1LYL A;  2C9O A;  1KDC A;  1JQY D;  2WB1 B;  4EQ5 A;  1EOT A;  4I7A A;  4FF4 A;  2F0L A;  3A7L A;  1VF7 A;  3HOY G;  4B3S Q;  1HXY D;  1JB3 A;  2Z6B A;  2B63 H;  4QIW B;  4UP7 A;  5CV7 A;  1KAW A;  5DNF A;  5DM7 3;  3TS0 A;  3H3V C;  3M85 A;  4ZAI A;  2EY6 A;  3G4S A;  3I7F A;  1JWS D;  4YCU A;  1CKM A;  1I6V C;  3A55 A;  4H7B A;  5C0X H;  1K8G A;  2X69 A;  3RUZ A;  1ILQ A;  4RMF A;  4LF5 L;  1NAP A;  2RQX A;  1WYD A;  2E2H B;  1CTM A;  4KI0 A;  1S4Z A;  1P8L A;  1C8C A;  1X3G A;  5C4J H;  3QJY A;  4K6L A;  2B2V A;  2PMZ B;  3D4W A;  4ABN A;  3RLO A;  1LLR D;  3HEJ A;  4HCS A;  3TDQ A;  3CXC A;  2E5L Q;  2F0F A;  3KJO A;  1HUN A;  4A76 A;  2JXM B;  1PLF A;  3TP6 A;  4E6I A;  3PMF A;  2Z4H A;  3STB C;  4A3C G;  4YHH Q;  5HY6 A;  1ZEQ X;  4LF4 Q;  1F2Z A;  1IKM A;  2LFN A;  1G8Z D;  4IN3 A;  3D8G A;  3BU2 A;  1F9S A;  4MTK A;  5IT9 c;  4EGV A;  3PO3 G;  4WJ3 M;  4DF7 A;  5IGD A;  3I4N H;  2DJF C;  3BDL A;  4FXK C;  5COY A;  5CYU A;  4DAV A;  1XYI A;  1N32 Q;  4QL5 A;  3KJP A;  3SEB A;  4QUF A;  1B53 A;  2NBF A;  5D3D A;  5J3B A;  2YYZ A;  3CD6 A;  5FLX E;  3GO5 A;  3JC6 6;  1SNO A;  1QJO A;  4LFA Q;  5JEA G;  3E3X A;  1EZ8 A;  4X62 Q;  4J6H A;  1KL9 A;  3T13 A;  5GAH C;  3KLW A;  2A5H A;  2MPM A;  2VUM B;  4OWT B;  4BY7 G;  3I4M B;  4J8Q A;  2BA0 A;  3J81 c;  3TQY A;  1HNX Q;  3RZO H;  4KKT A;  1HJP A;  2NN6 H;  5CV6 A;  1JJ2 A;  2GN5 A;  4IPG A;  5KYI A;  3CC2 A;  2K32 A;  3DLL A;  2MP1 A;  1E22 A;  3CCJ A;  1DJR D;  1I4Q A;  1K83 H;  4L5Q A;  3GV3 A;  4IUR A;  4R4O A;  4CJ1 B;  1IHZ A;  3T53 B;  1XPU A;  2ALY B;  3HKS A;  2UUA Q;  1JJC B;  1N36 L;  5IYD H;  3S14 H;  5BN3 A;  4RAU C;  1Y1W G;  1L0W A;  1IBM L;  1Z47 A;  3K5O A;  3KLS A;  1X3Q A;  1JOO A;  3M4P A;  1XWE A;  5CBA E;  5HUR A;  3HKZ G;  1PRT C;  3VA7 A;  3SGI A;  4DV0 L;  2PZW A;  1I50 B;  1YEZ A;  1IKL A;  3HOZ G;  3NQT A;  1AW7 A;  1SR3 A;  2A6E D;  3W5O A;  4JI8 L;  3SK4 A;  4DNT B;  1RD9 D;  1LV9 A;  5LMU L;  3HOY B;  2GA4 B;  1TWH B;  4AIM A;  4DV3 L;  1UE1 A;  5E4W C;  2EY5 A;  2Y0S B;  3OTO L;  2KA7 A;  2XSC A;  1B44 D;  3CCU A;  4KKS A;  1IZ6 A;  1SYB A;  1DON A;  5CV8 A;  2A6H C;  2SDF A;  2G9H D;  5ISR A;  2BA1 A;  1TWC H;  1STB A;  1MBY A;  5JJI A;  1LAC A;  1V9P A;  2RSO A;  3GTG H;  1HTP A;  4A3I G;  1PA6 A;  1ZYR D;  4A4I A;  3EIV A;  5IP9 H;  1D7Q A;  2LMC B;  4DUY L;  3MA2 B;  2FXQ A;  2JEB I;  4PV1 C;  1TWG H;  1YZ6 A;  1JOQ A;  4JV5 Q;  4JI3 Q;  1HR0 Q;  4CJ0 B;  3CCL A;  4KHV A;  4PQX A;  4CHT B;  1SE8 A;  1QOH A;  1VQ4 A;  2UUB Q;  4IUP A;  3O13 A;  3CMA A;  1PTO H;  3OMC A;  4QF4 A;  5I2Y A;  2L15 A;  1WD0 A;  3OHX C;  4ID6 A;  5JJK A;  1L0Y B;  3VA5 A;  1BKB A;  3PO3 B;  4LNQ A;  3GD7 A;  1E2Z A;  3VR3 A;  2L55 A;  1M90 C;  1DGS A;  3RN2 A;  4K8I A;  1LTL A;  3K7U C;  1YNN D;  2O2L D;  2QF7 A;  1OXU A;  2F0N A;  5AFW A;  2XN9 C;  3MC0 B;  4DK1 A;  1XPO A;  1HNW Q;  2B39 A;  4DV4 Q;  2J4X A;  4MZ9 A;  3FMC A;  1PH4 A;  1A2U A;  5EGT A;  1E3P A;  2JE6 I;  4B3T L;  2AWO A;  2F0W A;  3NXW A;  2KHS A;  5LMN L;  4GNX A;  3Q6S A;  2SOB A;  2F0Q A;  2AMC B;  1YHA A;  4BY7 B;  3U50 C;  3M4O H;  1I94 Q;  4RG1 A;  3SR1 A;  5ELN A;  1S72 A;  3S1Q H;  4XIG S;  2K1B A;  5GRO A;  4NXM Q;  1GOZ A;  4QCL A;  4JI5 L;  1C0A A;  1JR0 D;  4L8J A;  1TR5 A;  3Q0A A;  2JA8 B;  4N8X 1;  3PF4 A;  3NPP A;  1JOR A;  1X3F A;  3MEH A;  2NZO A;  4DV2 Q;  4A93 B;  3VYR A;  1T5X D;  4XYQ A;  3TME A;  5FJ8 G;  4A3C H;  1N33 L;  3GTK H;  3S2D B;  4JI1 L;  2A19 A;  2JA5 G;  4FXG C;  3HOW H;  2ZTC A;  4TSS A;  2K33 A;  2J7Z A;  1Y1W B;  3I91 A;  1J6Q A;  4ZUI A;  3ITP A;  4NXN Q;  1L2F A;  3I72 A;  3HKZ B;  4DR1 Q;  4MHE A;  1PTO D;  3ULL A;  3PIP A;  1YNJ D;  2A68 C;  5K36 G;  3CW2 C;  2FHT A;  3GQB A;  2RDH A;  4JOI C;  4AQY Q;  4XYO A;  1YIJ A;  5JEA H;  1NSN S;  3OW2 A;  4X3T A;  1STN A;  3RZD H;  4FVM A;  3ERQ A;  3T4A C;  1CKN A;  3KDF B;  5KNC A;  4CDE C;  1QWY A;  5M5Y B;  5AJ3 L;  1PH9 A;  1CM9 A;  1SE3 A;  3DWQ A;  4EVO A;  4YCW A;  4A3F H;  3QB3 A;  2X6L A;  4B9W A;  4JBW A;  3NK9 A;  4DXF A;  2UXB L;  1LT6 D;  2JSO A;  1GD7 A;  3J81 i;  4X3S A;  2KUM A;  3GTP H;  2I5H A;  4DN4 M;  2VZA A;  3VR4 A;  4X3U A;  5CV5 A;  1JT8 A;  5DLQ E;  4A3D B;  3IFT A;  2O4X A;  4ALP A;  1CZW A;  2ASB A;  2AWN A;  2MHV A;  1K28 A;  1S5B D;  1EL0 A;  4BXX G;  5C3X A;  1ML0 D;  2NVQ H;  1HUM A;  2YTX A;  1EIY B;  2OWO A;  4DR7 Q;  4A3E G;  3VDY A;  4LFC L;  4A3I B;  4QJF A;  2IHF A;  1TII D;  4K0K L;  2ZM6 Q;  4P74 A;  3I56 A;  1Y1W H;  3NEM A;  1V8Q A;  1I3Q H;  5IWA Q;  1A2T A;  2KQ3 A;  3BZK A;  4DXG A;  4B9X A;  1QB5 D;  1BNZ A;  1M4V A;  1KAA A;  1UEA B;  3NEN A;  2Z6K C;  3G71 A;  3BJU A;  4HIK A;  2A73 B;  5IT9 L;  4A3L G;  1I6H H;  3HOZ H;  3EA6 A;  2R7F A;  2UU9 Q;  1ONL A;  4FNF A;  4FDB A;  4K14 A;  4ODG A;  4XXE A;  3DWA A;  4JI6 L;  1YNJ C;  2G9D A;  1A15 A;  3E9H A;  3GTM B;  4S3S A;  3DEP A;  1SSO A;  1HA5 A;  3CRL C;  1I4P A;  2LY7 A;  3ER0 A;  2CWA A;  3CRK C;  3NEL A;  4AYB G;  3OOC A;  3K5M A;  3BVG A;  4DV6 Q;  4DV5 Q;  4HJ8 A;  4OON A;  4RHS A;  1HPC A;  1VQH A;  2O5J C;  2MGS A;  1BR9 A;  2KJX A;  3J81 L;  1JE5 A;  1Q8K A;  4DR2 L;  1B50 A;  3G6E A;  2I07 B;  2EZV A;  4NDX A;  1ICW A;  1Q82 C;  2ATW A;  1X3E A;  2K5Q A;  1EIG A;  3T51 B;  1VQ9 A;  4FO2 A;  3CP0 A;  4UPA A;  3VYU A;  2CVR A;  1QUQ B;  5JAV A;  1SLJ A;  4JW0 A;  4CKE A;  2XRS D;  2EYO A;  2B2U A;  3RMH A;  1PFM A;  2R92 H;  1BBX C;  3CAM A;  3VR5 A;  2WAQ E;  1IBL Q;  1VMC A;  3W1B A;  1GHJ A;  1AFP A;  1Q81 C;  1R4P B;  3HOV G;  2AUK A;  5I2X A;  2MO1 A;  1JOK A;  1VMP A;  4GN3 B;  4NW2 A;  2E8G A;  1WD1 A;  2WKC A;  5EBC A;  2A8V A;  1L1O A;  4OHJ A;  1X56 A;  2TSS A;  1ASZ A;  1STY A;  2PQA A;  3ULJ A;  3ND8 A;  1ET9 A;  2K05 A;  2HQE A;  4JBJ A;  3I4N G;  5C44 H;  5JPM C;  5I6Y A;  3S15 H;  1OO9 B;  1WFQ A;  2H1E A;  4A3G G;  4UY8 C;  1DXM A;  1B70 B;  4GN4 B;  3OWE B;  4IPD A;  4UDU C;  2N55 A;  3M7N A;  2N8N A;  2R61 A;  2QDL A;  2L9H A;  2MJ8 A;  1O7L A;  4NB3 A;  5KGU A;  2JYO A;  4KN4 C;  3D4R A;  4OL7 A;  3TP8 A;  4G7O C;  3L3O C;  3LX0 A;  1H95 A;  2K5N A;  5EAY A;  1EQV A;  1PH5 A;  4K5V A;  1BVS A;  4GOP A;  1IL2 A;  2PZU A;  4QQB X;  2Q8I B;  3PUX A;  1NE3 A;  3VYT A;  3EFX D;  2PW5 A;  5FO9 B;  3FEW X;  1A8V A;  3MAQ A;  1CQV A;  4C3I G;  2B2T C;  4IOC A;  2JK8 A;  3DM1 A;  1ENA A;  4LF5 Q;  1C9O A;  1TS2 A;  1ESF A;  2NVT B;  3GTO H;  4YWL A;  5C5M A;  5IT9 E;  4H02 A;  3I4O A;  1E2V A;  5FJ8 H;  1O78 A;  4DK0 A;  4A3E B;  1XMQ L;  4A3K B;  1OXT A;  5C4Z A;  2QA4 A;  3EVQ A;  3JAM c;  2JA5 H;  2L1B A;  5IYD G;  3IRB A;  4FF2 A;  4V0B A;  4RKB A;  3K80 C;  2F0U A;  1YHQ A;  1PFB A;  3R3O A;  5M5W H;  5M3F G;  5EJW A;  4JK1 C;  1VQC A;  4ME5 A;  2R93 B;  1MHW C;  1A3V A;  3HOX B;  2RDG A;  2PPB C;  4BBS G;  5K36 H;  5C4H A;  2MQH A;  1AZP A;  2BH8 A;  2IPK D;  2F1M A;  3J81 E;  3NE5 B;  4YWM A;  5C3W A;  1CFM A;  5KYL A;  3J7Z C;  3CHB D;  5HGQ A;  4DAP A;  1LM0 A;  4M8A A;  2K6A A;  2EXD A;  4OGQ C;  1LTI D;  4L6T B;  1F77 A;  2AKW B;  2OTJ A;  2B63 B;  1EFW A;  1STH A;  3PSI A;  1UE7 A;  1SN8 A;  3DXJ C;  2UXD Q;  4K2L A;  4L5T A;  1SXT A;  2CW0 D;  3CCE A;  3UE0 A;  1Y8N B;  2OQ0 A;  4IJL A;  4R4T A;  2CWP A;  3HFZ B;  3IKJ A;  4HIM A;  1IYU A;  4DKA C;  4OXP A;  2KED A;  4GS3 A;  1OXS C;  1MI2 A;  4HAE A;  3U4V A;  5EKK A;  4RGN A;  4DR5 Q;  1GVP A;  2Z8L A;  2PI2 A;  5IY0 A;  4A3E H;  1WCM H;  1C4Q A;  3PUW A;  3H0G H;  4KD4 A;  2C35 B;  1N34 L;  2WB1 E;  1FYC A;  5C4J B;  2EE1 A;  4G4K A;  1G91 A;  3AEV A;  5IYB G;  2K01 A;  1S5C D;  3S17 H;  4RCN A;  1PMR A;  1K8O A;  2HQL A;  4MTN A;  4M1U B;  5JOB A;  2I46 A;  5D65 A;  4A3J G;  3HOV B;  4BWG B;  1D2B A;  2F0J A;  5K5P A;  3HRZ C;  1BBU A;  4TKO B;  2KVM A;  4QIW E;  4RA8 A;  2N88 A;  1N36 Q;  1ET6 A;  1KDA A;  1UWV A;  1E7Z A;  1BO0 A;  1CSQ A;  3OSO A;  3A56 A;  2ZJP A;  4F7X A;  2M2L A;  1FD7 D;  1V1P A;  4GZY C;  1ROD A;  1IBM Q;  3PO2 G;  3D6W A;  1G6Z A;  1WTO A;  2KOL A;  5L37 A;  4IUN A;  2ZJQ A;  3PGZ A;  2H4O A;  3I4N B;  1LTB D;  3CU7 A;  4HCE A;  3S16 H;  3E0E A;  2G5D A;  4DV0 Q;  1TS3 A;  4G7Z C;  3ERO A;  5LL6 S;  4DR3 L;  2VB2 X;  4JI8 Q;  1WTR A;  1TT2 A;  1G29 1;  1GKH A;  3NTK A;  5LMU Q;  3EJI A;  1LO5 D;  1SRO A;  3HZX A;  3OTO Q;  2IX1 A;  3C46 A;  1QG7 A;  1ILP A;  3H09 A;  1AE3 A;  3RZO B;  2NVX H;  3NQI A;  4A3B G;  4FP5 D;  5H1S E;  1Q46 A;  2A69 C;  1PYS B;  4POF A;  4HMJ A;  4PZ7 A;  5I4D A;  4OX9 L;  1HR0 W;  3CCV A;  2FJ2 A;  4Y52 H;  3S2H H;  1EWH A;  2EDG A;  1F9R A;  1K83 B;  3HOV H;  2I5L X;  4K2K A;  1NCV A;  3ND9 A;  1QZG A;  2SEB D;  1XNQ L;  2FFK B;  1LTT D;  1VQ5 A;  1VQK A;  2Q2U A;  4DUY Q;  4DU9 A;  1HFG A;  1SRU A;  2F4I A;  3S14 B;  3UI2 A;  3I8Z A;  3HOW G;  2DY7 A;  2B3G A;  1FGB D;  2AQ1 B;  4R4I A;  3FHW A;  2KCN A;  2JN4 A;  4DAY A;  4DV7 L;  5GQO A;  2F0K A;  3KF8 B;  3K59 A;  4A3G H;  4A3M H;  3U58 A;  2IJ0 A;  3IFD A;  4KLK A;  4KJO A;  2F0D A;  4DR6 L;  2HD3 A;  4LUV A;  4JI7 L;  5CMD A;  1BBW A;  4RHR A;  4R8N A;  1IBK Q;  2HHH L;  2K5D A;  3KFU A;  2DNC A;  1HRJ A;  1QVG A;  4HJ7 A;  4BY1 G;  1Q7Y C;  5DM6 3;  4A3F G;  3UDX A;  3P7J A;  2DJG C;  3GV6 A;  4C3I H;  4LF9 L;  4N9T A;  1SNC A;  3HS0 C;  4B3T Q;  2D62 A;  5LMN Q;  1CI3 M;  5IGC A;  3A7A B;  3RLN A;  1XNR L;  4LF8 L;  1RCV D;  1FNV A;  1TWC B;  3G6J B;  5ELF A;  5EPJ A;  4XT3 B;  5IP7 H;  4DR4 L;  1EY9 A;  4JYA L;  4DNI A;  2CQA A;  4LF7 L;  3GTG B;  1Z9F A;  1MJE A;  2WII B;  4IPH A;  1YJW A;  2ICE C;  1U4R A;  1F2Y A;  2GVB A;  2IW3 A;  4R1J A;  4JI5 Q;  4KHP L;  2DGY A;  5M3M G;  1M1K C;  4FXD A;  4YWK A;  1TWG B;  3TP7 A;  3JAM i;  3DUZ A;  2NYZ D;  3R2T A;  4NP5 A;  5M3F H;  5E3F A;  2QIL A;  1XMO L;  2K5V A;  1I4G A;  1DM0 B;  5EKI A;  2Y0S E;  4CGY B;  1LUZ A;  1PTO F;  4J15 A;  1H9S A;  1N33 Q;  4BBS H;  3UDF A;  4JI1 Q;  1PTO B;  4FF1 A;  3LWU A;  3K7A B;  3TS2 A;  3A8J E;  2EJM A;  4NKL A;  3UDG A;  5FO7 B;  1VDZ A;  3C1F A;  2JA9 A;  1DOK A;  3PUZ A;  3F2U A;  4HJ5 A;  1HA6 A;  5CV9 A;  2IX3 A;  1CKN B;  2ZJR A;  3B6Y A;  2KCT A;  1D6E C;  3UE1 A;  3A5U A;  2R6G A;  3L0O A;  1SNM A;  1K0S A;  1KTK A;  1D1I A;  1F2L A;  5KEE A;  3Q8D A;  2VQF L;  1KQS A;  4JCV E;  2F52 A;  1X65 A;  3CC7 A;  1LT3 D;  1RTN A;  2B2W C;  5AJ3 Q;  2RF4 A;  5CR3 A;  2QKI C;  4X65 L;  2K04 A;  4RWS C;  1B8A A;  1SND A;  1TXY A;  2L5T A;  3M4O B;  3S1Q B;  2IY5 B;  4C1N I;  3CC4 A;  4O1N A;  2R92 G;  5IYB H;  5GAD C;  3BYT B;  1KHI A;  4YY3 L;  2AHO B;  3NTH A;  3JAM L;  4A3J H;  1NR2 A;  4MN3 A;  5J1Z A;  3S1M H;  2O5I C;  1CA5 A;  2ZT9 C;  2RCF A;  4LFC Q;  3GTK B;  1CKO A;  3K7A H;  4CJ2 C;  4K0K Q;  1J9O A;  4P2C B;  3HOW B;  3PO2 H;  4IOA A;  1Y8O B;  4L5R C;  4C1N K;  1ASY A;  2BDO A;  3H3V I;  3S1R H;  4APV A;  3HOU G;  4XTC S;  4EX5 A;  2A6E C;  5C44 G;  4LFB Q;  2KHI A;  1VQF A;  1UE6 A;  4BA1 I;  1HTL D;  1B9M A;  3A8K E;  3W2D A;  1HH2 P;  4H0L C;  4P72 A;  1YI2 A;  4HIO A;  4JI6 Q;  2K28 A;  4RFB A;  1I4X A;  5GAE C;  2RKS A;  1X54 A;  3RZD B;  2RDF A;  2QGQ A;  4RH6 A;  2L4N A;  3PIO 3;  1EQR A;  1XTD A;  3J80 c;  3U9S A;  2ZXO A;  4LUZ A;  3VR6 A;  3TRZ A;  4JOI A;  1U9R A;  4WJW A;  4A3F B;  1EZ6 A;  3M3Y H;  2BDN A;  1KC8 C;  1GHK A;  4A3B H;  3CCR A;  1SYG A;  1EEI D;  1V43 A;  1HNX L;  3T1H L;  3GTP B;  1TU2 B;  3PF5 A;  4DR2 Q;  2K5W A;  4LJZ C;  1JIC A;  1YVC A;  1GUN A;  1ZYR C;  2PCF B;  1H9J A;  2DNE A;  2M9V A;  2NVQ B;  3CF5 A;  3M7G A;  3VR2 A;  2E2J H;  1U0L A;  3DM3 A;  2L12 A;  1P16 A;  3P20 A;  4C3J H;  1CUK A;  1ZKO A;  1L1O B;  1I3Q B;  2UXC L;  2HIX A;  1STG A;  1SMY D;  2PQA B;  3CCS A;  5DAU A;  2VW9 A;  2B8G A;  4DV1 L;  4JI0 L;  2XNA C;  2E2I H;  1I6H B;  3HOZ B;  4KMU C;  1IXR A;  1GM5 A;  1EY0 A;  5DEH A;  1WTW A;  4X66 L;  4H44 C;  1YNN C;  3E0J A;  4IUU A;  4LK1 C;  1PYW D;  1AH9 A;  1F9P A;  1H9K A;  1BF4 A;  2Z6K A;  2EYM A;  2WAQ G;  2PNR C;  5C4X G;  1PH3 A;  4BY1 H;  2PNH A;  2IT1 A;  4DNR B;  4GLX A;  3M4Y A;  4ME3 A;  3BZC A;  3A8I E;  3W1G A;  1A3T A;  4DGZ A;  4DUZ L;  3KBG A;  2RHS B;  2VQE L;  3JAM E;  1SDF A;  4P75 A;  2EYH A;  5J39 A;  2D0P A;  3KYH C;  1Y1V G;  4CKB A;  1PFS A;  2J0T D;  1WCM G;  3BG3 A;  2JA7 H;  4QB4 A;  3H0G G;  1JWM D;  4ILW A;  3T16 A;  1A3U A;  4WOR A;  2WFW A;  5M3M H;  4WJ4 A;  2R92 B;  2F0O A;  2F4V L;  2JA6 H;  2Z4I A;  1J5E Q;  5D3I B;  2UUC L;  3BDO A;  3Q23 A;  1U4L A;  1XMQ Q;  3IL8 A;  2PI2 E;  3NBI A;  1CT1 D;  1KDB A;  1NMG A;  2PO4 A;  1SMY C;  3Q22 A;  3N52 A;  1ENF A;  2F0S A;  2RSN A;  1LAB A;  5FKA C;  3LWE A;  3TRE A;  1PTO C;  3C1E A;  3RD4 A;  2OXP A;  1EQQ A;  1EU3 A;  1S5D D;  5LL6 X;  3A54 A;  1T9H A;  1TY0 A;  3HOU B;  3S15 B;  1A63 A;  3I3C A;  5C44 B;  4JI4 L;  1TWA B;  2IHE A;  4O0A A;  2JP1 A;  4CDC C;  4XQN A;  2AUJ D;  4TQU S;  4JBK A;  4L63 B;  4B3R L;  4UHV A;  4DFA A;  5C3E G;  1S40 A;  1IW7 D;  1O7Y A;  1V1Q A;  1EU4 A;  4ZKC B;  3SHL A;  1UE5 A;  3X3M A;  4YIJ A;  3GP7 A;  1D5Z C;  2CQO A;  1CHQ D;  3K8A A;  1Y69 U;  3RLF A;  3S9W A;  1H9R A;  4LMQ D;  1KIX A;  1EY6 A;  3MFG A;  4NPS A;  4KV6 A;  1WTQ A;  3GTL B; 
#chains in the Genus database with same CATH homology
 3I4L A;  4QUC A;  1OXX K;  1EY8 A;  4TRD A;  3OMG A;  4EQN A;  1J8I A;  3GTO B;  1O7Z A;  3NUC A;  4QMG A;  2B2T A;  1CA6 A;  1G2T A;  1CHP D;  2JA5 B;  4ZUJ A;  3BYY B;  3OPO A;  4G57 A;  2B2Y C;  5M5W B;  3OIQ A;  4J1M A;  1Q90 A;  3R2I A;  1QNU A;  3C3L A;  5HGT A;  1XTC D;  5KIX A;  3H6M A;  3BVZ A;  3L9A X;  1PFN A;  4G7H C;  2XWJ B;  1QE6 A;  1BCP B;  2WAQ B;  1TS4 A;  5C4X B;  1WTX A;  1Q1B A;  3SK6 A;  1CK1 A;  5IGE A;  3K57 A;  5EPL A;  4ZYS A;  4K6D A;  2EVB A;  1D5X C;  1TY2 A;  2F0M A;  1WCM B;  3H0G B;  2E76 C;  3DMU A;  1Q8I A;  2Q8R E;  2LKV A;  2HCI A;  3S17 B;  2KCC A;  4F8M A;  4FF3 A;  3FPU B;  3R8B A;  2PQE A;  1W6K A;  3GTJ B;  1F2M A;  1PDQ A;  3FVQ A;  4MIU A;  4I65 A;  2R3Z A;  3S16 B;  2XWB B;  1HFN A;  4U67 3;  1U4P A;  3OWF A;  5CGK A;  4AYB B;  1HQM C;  1STA A;  3J80 L;  3H91 A;  5C3E B;  1SE4 A;  4EQO A;  3TBI B;  1BXT A;  2D2C C;  3BVM A;  5M5X B;  4IUQ A;  3HP3 A;  1SYC A;  2NVX B;  1TQO A;  1B2T A;  1XXG A;  4Z9C B;  3PUY A;  1AP0 A;  5EQ0 A;  3S2H B;  1STE A;  2BOS A;  1DZ1 A;  3L7Z C;  4Q5V A;  2QEJ C;  3BZD B;  2F0G A;  2EY1 A;  4IQZ A;  1BUV T;  1O80 A;  2QDB A;  2WKD A;  1VF5 C;  4A3G B;  4A3M B;  5EBD A;  1ENC A;  4PMB A;  4RGT A;  2X6G A;  3J7A V;  1EIH A;  1EFI D;  2K03 A;  3V2T A;  1SJH D;  4HN7 A;  2F0I A;  1BCP D;  4IAL A;  2CW0 C;  2E2D C;  2D5D A;  1U4M A;  1E0B A;  3PIP 3;  2NUC A;  5CC4 A;  3NHH A;  4C3I B;  3QWN A;  4C56 C;  3K58 A;  3WOF A;  5F2D A;  3D4D A;  4IZ8 A;  2IX0 A;  3AB9 A;  3WDN A;  4OIJ A;  3W3A A;  3H94 A;  4C3J G;  3MXG A;  2F0T A;  1QCB D;  3SK5 A;  1DD2 A;  1JCK B;  5M3F B;  1KLU D;  2MUY A;  5FOB B;  1X3P A;  2B8F A;  1Q1E A;  2VNU D;  4IFD J;  1WVL A;  2DY8 A;  2SNM A;  3J80 E;  4BBS B;  2NTT A;  1PZI D;  4HSP A;  4XQJ A;  3D6C A;  4OO1 I;  1LTS D;  1PRT D;  2LS0 1;  1T5E A;  3NBH A;  5ELD A;  3J7A F;  1D1K A;  1DOL A;  3QG1 A;  1BCP C;  2HDL A;  1JWU D;  1OXV A;  4UAI A;  2OF1 A;  1A6X A;  5IOD A;  2F0V A;  3I70 A;  1B9N A;  2AQ2 B;  5JVH 3;  1AN8 A;  1TKW B;  2B2V C;  4OO1 G;  5IIF A;  2C5C A;  4K5X A;  2A6H D;  3MXN A;  3TP5 A;  1KLG D;  2B2W A;  1EQT A;  4A3J B;  3S1M B;  1SNP A;  1LT5 D;  1LTA D;  5G3L D;  5IGB A;  5ELC A;  1V1O A;  3EQL C;  3MTS A;  4R9W A;  2EPB A;  4WFN 3;  5FK9 C;  2F0E A;  3PO2 B;  3KBX A;  4IFD I;  3S1R B;  1L0X B;  2ZXP A;  4I7Z C;  4KN7 C;  5T1I A;  4B08 A;  1AZQ A;  5BN4 A;  4F88 A;  3DWP A;  3MXU A;  5E1F A;  4PMW A;  2NZ1 D;  3MHB A;  3V05 A;  3P75 A;  3K6O A;  3ONA B;  2HUG A;  4IFD G;  3AU7 A;  4RGO S;  3M3Y B;  4A3B B;  3NP8 A;  5NUC A;  2EYF A;  4HED A;  3BS1 A;  1C48 A;  3FRP B;  2NWG A;  3NWT A;  3MWY W;  4Y7N B;  5ELB A;  4K5W A;  2OEO A;  1EY5 A;  1I4H A;  1SE2 A;  2WAC A;  2E2J B;  1ESR A;  2SNS A;  2E75 C;  1RKN A;  1EEF D;  3E5S A;  4C3J B;  1FNW A;  3E6Z X;  4RKL A;  1RTO A;  1NR4 A;  3DHQ A;  1EYA A;  4KY5 A;  2KEE A;  2ICI A;  1IYV A;  3I73 A;  2E2I B;  1EYD A;  1ZXT A;  3FDT A;  4KJN A;  2L0C A;  2FIN B;  5IGG A;  5A2Q L;  2A68 D;  2VXW A;  3KF8 A;  2WP8 J;  4IUT A;  3LNN A;  2FMM A;  4BY1 B;  1GUG A;  1K8M A;  1E2W A;  4K8J A;  1DOM A;  5FO8 B;  3QOL A;  1BDO A;  2ZXR A;  1HQR D;  5IGF A;  2FMC A;  1WTV A;  2EY2 A;  1X32 A;  2V4D A;  1SJE D;  2BE5 D;  2JA7 B;  1FR3 A;  1CQF A;  3NWS A;  1BQQ T;  1Z7T A;  4ZQ3 A;  2HCC A;  5M3M B;  1B1Z A;  3TN2 A;  1PZJ D;  2JA6 B;  4CBV A;  5I9P A;  2F3W A;  1MD2 D;  1EWC A;  3D3R A;  4Q0F A;  4X3K A;  3SVM A;  4PMC A;  2OT2 A;  5JPN C;  5C0X J;  1Y8P B;  2NB0 A;  2EJF C;  5TSS A;  3SXH A;  4DA2 A;  2AQ3 B;  1KNE A;  2TMP A;  2ID0 A;  2EJG C;  1GUT A;  2A74 C;  2D9U A;  1LTG D;  2XRQ D;  1W6J A;  3PUV A;  1RF2 D;  4OO1 H;  3TSS A;  4KD3 A;  5ELE A;  4KKU A;  3MVV A;  3QO2 A;  3VYS A;  2BE5 C;  2F3V A;  2PW7 A;  1GUW A;  3PV0 A;  2YU9 B;  1MSG A;  2NVY B;  4XT1 B;  1HCZ A;  3KLR A;  4EQP A;  1JC7 A;  3X3N A;  5A2Q E;  4IUV A;  3R93 A;  3NSW A;  1SYD A;  3SE0 A;  1RDP D;  5LHY 1;  4WRD A;  1D5M C;  1GXD C;  5C0X I;  4U68 A;  3AMU A;  1SYF A;  2B2Y A;  2IL8 A;  2KEC A;  4N9P A;  1EYC A;  2PYK A;  1FNU A;  2E74 C;  1AEX A;  5KRU A;  1BOS A;  1MSH A;  2Z1C A;  1JE4 A;  1KAB A;  1QIL A;  1SFO B;  4IFD H;  5EPK A;  5A35 A;  4HSV A;  3V96 A;  4C3H G;  3GTQ B;  4R8I A;  5JVG 3;  3KK7 A;  2EYL A;  1Q3L A;  5C5L A;  5C0X G;  5KNB A;  1TWF B;  5D14 A;  1GJX A;  2RBM A;  4KY7 A;  5JJZ A;  4NMZ A;  5CBE E;  2IWH A;  2WV6 D;  4KY6 A;  1EY4 A;  3G7L A;  3U9O A;  3K0Y A;  3SDZ A;  2Q8T A;  4FYD A;  1CZG A;  1V1P B;  2XVS A;  3FKI B;  2M00 A;  4XDX A;  4RCO A;  4F87 A;  4BS9 A;  1GUO A;  5M9O A;  2F0H A;  1SAP A;  2F03 A;  4V19 0;  1BCP F;  2JEA I;  4ULL A;  1GUS A;  5I6W A;  2NN6 I;  1Z6H A;  1IW7 C;  2EYP A;  1UNS A;  5E4X A;  2QCP X;  3SK8 A;  4KK7 A;  4HTH A;  3OIP A;  3TZU A;  1PZK D;  2F0P A;  4HMI A;  2DN8 A;  5BN5 A;  4ZRZ A;  2R7Z B;  3IAY A;  1LT4 D;  4BBR B;  1S5E D;  2B2U C;  1II3 A;  1Y1V B;  1KNA A;  2BCO A;  4KHZ A;  1DYQ A;  3I90 A;  1DCZ A;  1SNQ A;  3HG9 A;  1IL8 A;  2NN6 G;  1VCI A;  1RHP A;  5I9O A;  1B3A A;  3BDC A;  1B4O A;  1QNK A;  3NTI A;  1SEB D;  1TS5 A;  1I4R A;  3P1H A;  3MFY A;  1LTR D;  1TVX A;  2RVL A;  3N6R A;  1F9Q A;  1SYE A;  1S5F D;  4ZKB B;  1NUC A;  1PRT F;  2CHB D;  3T56 B;  3WOE A;  1G2S A;  1PRT B;  4O42 A;  5T1G A;  3QOJ A;  2VB3 X;  4HR7 B;  3C2P A;  2ENB A;  3OW7 A;  2WIN B;  3D31 A;  2NTS A;  4CKC A;  3J7Y W;  3KLS X;  1XX8 A;  3QIA A;  3CKI B;  1RJT A;  3ZYY X;  3FPP A;  1EY7 A;  1R4Q B;  4C2M B;  4KTA A;  3K5L A;  4BA2 I;  3TZD A;  3MZ5 A;  2HDM A;  5CV4 A;  5J22 A;  4C3H B;  4PNY A;  1WTP A;  5EKL A;  3HGB A;  5FLX L;  5IOC A;  3K5N A;  4ZLT F;  3KUP A;  2A69 D;  1R9T B;  1PXU A;  3URY A;  2L11 A;  1UUP A;  5C6A A;  1H9S B;  5G3L F;  3CQZ B;  1H9M A;  4ZK9 B;  3S1N B;  2EXZ A;  4H13 C;  3MXP A;  2EOT A;  1M8A A;  5KND A;  5JEA J;  1SBB B;  4RGM A;  2K7V A;  2EYJ A;  1HHV A;  3DEO A;  1MGS A;  4LAA A;  3Q24 A;  1UAP A;  4XQQ A;  1Q12 A;  2PZT A;  2RA4 A;  5COR A;  2XIW A;  4OIK A;  2C9O A;  1KDC A;  1JQY D;  2WB1 B;  1EOT A;  4FF4 A;  2F0L A;  3A7L A;  1VF7 A;  1HXY D;  1JB3 A;  4QIW B;  5CV7 A;  5DNF A;  5DM7 3;  3H3V C;  3M85 A;  4ZAI A;  2EY6 A;  1JWS D;  1I6V C;  3A55 A;  4H7B A;  5C0X H;  2X69 A;  3RUZ A;  1ILQ A;  1NAP A;  2RQX A;  2E2H B;  1CTM A;  4KI0 A;  1S4Z A;  1C8C A;  3QJY A;  4K6L A;  2B2V A;  2PMZ B;  3D4W A;  4ABN A;  1LLR D;  3HEJ A;  4HCS A;  3TDQ A;  2F0F A;  1HUN A;  2JXM B;  1PLF A;  3TP6 A;  4E6I A;  3PMF A;  2Z4H A;  1ZEQ X;  1F2Z A;  1IKM A;  2LFN A;  1G8Z D;  4IN3 A;  3D8G A;  1F9S A;  4EGV A;  4DF7 A;  5IGD A;  3BDL A;  4FXK C;  5COY A;  5CYU A;  4DAV A;  1XYI A;  4QUF A;  3SEB A;  1B53 A;  2NBF A;  5D3D A;  2YYZ A;  5FLX E;  3GO5 A;  1SNO A;  1QJO A;  5JEA G;  1EZ8 A;  4J6H A;  3T13 A;  2A5H A;  2MPM A;  2VUM B;  3I4M B;  4J8Q A;  2BA0 A;  4KKT A;  5CV6 A;  2NN6 H;  5KYI A;  2K32 A;  2MP1 A;  1DJR D;  1I4Q A;  3GV3 A;  4IUR A;  4CJ1 B;  1IHZ A;  3T53 B;  5BN3 A;  4RAU C;  1Z47 A;  3K5O A;  3KLS A;  1X3Q A;  1JOO A;  5CBA E;  1XWE A;  5HUR A;  1PRT C;  3VA7 A;  2PZW A;  1I50 B;  1IKL A;  3NQT A;  1AW7 A;  2A6E D;  3SK4 A;  4DNT B;  1RD9 D;  1LV9 A;  3HOY B;  2GA4 B;  1TWH B;  5E4W C;  2EY5 A;  2Y0S B;  2KA7 A;  2XSC A;  1B44 D;  4KKS A;  1SYB A;  1DON A;  5CV8 A;  2A6H C;  2SDF A;  2G9H D;  5ISR A;  2BA1 A;  1STB A;  1MBY A;  1LAC A;  2RSO A;  1HTP A;  1ZYR D;  2LMC B;  3MA2 B;  2JEB I;  4PV1 C;  1JOQ A;  4CJ0 B;  4KHV A;  4PQX A;  4CHT B;  1QOH A;  4IUP A;  3O13 A;  1PTO H;  3OMC A;  4QF4 A;  5I2Y A;  1WD0 A;  3OHX C;  4ID6 A;  1L0Y B;  3VA5 A;  3PO3 B;  3GD7 A;  1E2Z A;  3VR3 A;  2L55 A;  4K8I A;  1YNN D;  2O2L D;  2QF7 A;  1OXU A;  2F0N A;  5AFW A;  2XN9 C;  3MC0 B;  4DK1 A;  2B39 A;  2J4X A;  3FMC A;  1A2U A;  5EGT A;  2JE6 I;  2AWO A;  2F0W A;  3NXW A;  2KHS A;  3Q6S A;  2SOB A;  2F0Q A;  4BY7 B;  3SR1 A;  4XIG S;  2K1B A;  1GOZ A;  4QCL A;  1JR0 D;  4L8J A;  1TR5 A;  3Q0A A;  2JA8 B;  3NPP A;  1JOR A;  3MEH A;  4A93 B;  3VYR A;  1T5X D;  4XYQ A;  3TME A;  3S2D B;  4FXG C;  4TSS A;  2K33 A;  2J7Z A;  1Y1W B;  3I91 A;  4ZUI A;  3ITP A;  3I72 A;  3HKZ B;  4MHE A;  1PTO D;  1YNJ D;  2A68 C;  5K36 G;  2FHT A;  3GQB A;  2RDH A;  4XYO A;  5JEA H;  1NSN S;  4X3T A;  1STN A;  4FVM A;  3ERQ A;  3T4A C;  5KNC A;  1QWY A;  5M5Y B;  1CM9 A;  1SE3 A;  3DWQ A;  4EVO A;  3QB3 A;  2X6L A;  4B9W A;  4JBW A;  3NK9 A;  4DXF A;  1LT6 D;  2JSO A;  4X3S A;  2KUM A;  4DN4 M;  3VR4 A;  4X3U A;  5CV5 A;  4A3D B;  3IFT A;  2O4X A;  1CZW A;  2AWN A;  2MHV A;  1S5B D;  1EL0 A;  5C3X A;  1ML0 D;  1HUM A;  4A3I B;  1TII D;  1V8Q A;  1A2T A;  2KQ3 A;  4DXG A;  4B9X A;  1QB5 D;  1BNZ A;  1M4V A;  1KAA A;  1UEA B;  2A73 B;  5IT9 L;  3EA6 A;  1ONL A;  4FNF A;  4K14 A;  4ODG A;  4XXE A;  3DWA A;  1YNJ C;  2G9D A;  1A15 A;  3GTM B;  4S3S A;  3DEP A;  1SSO A;  1HA5 A;  3CRL C;  1I4P A;  2LY7 A;  3CRK C;  3OOC A;  3K5M A;  3BVG A;  4RHS A;  1HPC A;  2O5J C;  2MGS A;  1BR9 A;  2KJX A;  3J81 L;  1B50 A;  2I07 B;  2EZV A;  4NDX A;  1ICW A;  2K5Q A;  1EIG A;  3T51 B;  4FO2 A;  3VYU A;  2CVR A;  5JAV A;  4CKE A;  2XRS D;  2EYO A;  2B2U A;  3RMH A;  1PFM A;  1BBX C;  3VR5 A;  1VMC A;  1AFP A;  1GHJ A;  1R4P B;  2AUK A;  5I2X A;  1JOK A;  1VMP A;  4NW2 A;  1WD1 A;  2WKC A;  5EBC A;  4OHJ A;  2TSS A;  1STY A;  3ND8 A;  1ET9 A;  2K05 A;  2HQE A;  5JPM C;  5I6Y A;  1OO9 B;  2H1E A;  1DXM A;  3OWE B;  4UDU C;  2N55 A;  3M7N A;  2R61 A;  2L9H A;  2MJ8 A;  1O7L A;  5KGU A;  2JYO A;  4KN4 C;  3D4R A;  4OL7 A;  3TP8 A;  4G7O C;  3L3O C;  3LX0 A;  1EQV A;  4K5V A;  2PZU A;  2Q8I B;  3PUX A;  3VYT A;  3EFX D;  2PW5 A;  5FO9 B;  3FEW X;  3MAQ A;  1CQV A;  4C3I G;  2B2T C;  3DM1 A;  1ENA A;  1TS2 A;  1ESF A;  2NVT B;  5C5M A;  5IT9 E;  1E2V A;  4A3E B;  1O78 A;  4DK0 A;  4A3K B;  1OXT A;  5C4Z A;  3EVQ A;  2L1B A;  4FF2 A;  4V0B A;  4RKB A;  2F0U A;  1PFB A;  3R3O A;  5EJW A;  4JK1 C;  4ME5 A;  2R93 B;  1A3V A;  3HOX B;  2RDG A;  2PPB C;  5K36 H;  5C4H A;  1AZP A;  2IPK D;  2F1M A;  3J81 E;  3NE5 B;  5C3W A;  1CFM A;  5KYL A;  3CHB D;  4DAP A;  4M8A A;  2K6A A;  4OGQ C;  1LTI D;  4L6T B;  1F77 A;  2B63 B;  1STH A;  3DXJ C;  4K2L A;  1SXT A;  2CW0 D;  1Y8N B;  3IKJ A;  1IYU A;  2KED A;  1OXS C;  1MI2 A;  4HAE A;  5EKK A;  4RGN A;  2Z8L A;  1C4Q A;  3PUW A;  4KD4 A;  1FYC A;  5C4J B;  2EE1 A;  4G4K A;  1G91 A;  2K01 A;  1S5C D;  4RCN A;  1PMR A;  1K8O A;  4M1U B;  5JOB A;  2I46 A;  5D65 A;  3HOV B;  4BWG B;  1D2B A;  2F0J A;  5K5P A;  3HRZ C;  4TKO B;  2KVM A;  4RA8 A;  2N88 A;  1ET6 A;  1KDA A;  1BO0 A;  3OSO A;  3A56 A;  4F7X A;  2M2L A;  1FD7 D;  1V1P A;  4GZY C;  1ROD A;  3D6W A;  1G6Z A;  1WTO A;  2KOL A;  4IUN A;  2H4O A;  3I4N B;  1LTB D;  3CU7 A;  4HCE A;  1TS3 A;  4G7Z C;  3ERO A;  5LL6 S;  2VB2 X;  1WTR A;  1TT2 A;  1G29 1;  3NTK A;  3EJI A;  1LO5 D;  3HZX A;  2IX1 A;  3C46 A;  1QG7 A;  1ILP A;  3H09 A;  3RZO B;  3NQI A;  4FP5 D;  2A69 C;  4HMJ A;  5I4D A;  2FJ2 A;  1EWH A;  2EDG A;  1F9R A;  1K83 B;  4K2K A;  1NCV A;  3ND9 A;  2SEB D;  2FFK B;  1LTT D;  4DU9 A;  1HFG A;  2F4I A;  3S14 B;  3UI2 A;  3I8Z A;  2DY7 A;  1FGB D;  2AQ1 B;  2KCN A;  4DAY A;  2F0K A;  3K59 A;  2IJ0 A;  3IFD A;  4KJO A;  2F0D A;  5CMD A;  4RHR A;  4R8N A;  2K5D A;  2DNC A;  1HRJ A;  5DM6 3;  3P7J A;  3GV6 A;  4N9T A;  1SNC A;  3HS0 C;  2D62 A;  1CI3 M;  5IGC A;  3A7A B;  1RCV D;  1FNV A;  1TWC B;  3G6J B;  5ELF A;  5EPJ A;  4XT3 B;  1EY9 A;  2CQA A;  3GTG B;  2WII B;  2ICE C;  1U4R A;  1F2Y A;  2IW3 A;  4FXD A;  1TWG B;  3TP7 A;  3DUZ A;  2NYZ D;  3R2T A;  4NP5 A;  5E3F A;  2QIL A;  1I4G A;  1DM0 B;  5EKI A;  4CGY B;  1PTO F;  1H9S A;  1PTO B;  4FF1 A;  3LWU A;  3K7A B;  3A8J E;  2EJM A;  4NKL A;  5FO7 B;  1VDZ A;  3C1F A;  1DOK A;  3PUZ A;  3F2U A;  1HA6 A;  5CV9 A;  2IX3 A;  1D6E C;  2R6G A;  1SNM A;  1KTK A;  1D1I A;  1F2L A;  5KEE A;  1LT3 D;  1RTN A;  2B2W C;  5CR3 A;  2QKI C;  2K04 A;  4RWS C;  1SND A;  2L5T A;  3M4O B;  3S1Q B;  4C1N I;  4O1N A;  3BYT B;  3NTH A;  3JAM L;  1NR2 A;  4MN3 A;  5J1Z A;  2O5I C;  1CA5 A;  2ZT9 C;  3GTK B;  4CJ2 C;  1J9O A;  4P2C B;  3HOW B;  1Y8O B;  4C1N K;  2BDO A;  4XTC S;  2A6E C;  4BA1 I;  1HTL D;  1B9M A;  3A8K E;  3W2D A;  4H0L C;  2K28 A;  4RFB A;  1I4X A;  2RKS A;  3RZD B;  2RDF A;  4RH6 A;  2L4N A;  3PIO 3;  3U9S A;  2ZXO A;  3VR6 A;  1U9R A;  4WJW A;  4A3F B;  1EZ6 A;  2BDN A;  1GHK A;  1SYG A;  1EEI D;  1V43 A;  3GTP B;  1TU2 B;  2K5W A;  4LJZ C;  1JIC A;  1GUN A;  1ZYR C;  2PCF B;  1H9J A;  2DNE A;  2M9V A;  2NVQ B;  3M7G A;  3VR2 A;  2L12 A;  3P20 A;  1ZKO A;  1I3Q B;  1STG A;  1SMY D;  5DAU A;  2B8G A;  2XNA C;  1I6H B;  3HOZ B;  4KMU C;  1EY0 A;  5DEH A;  1WTW A;  4H44 C;  1YNN C;  3E0J A;  4IUU A;  4LK1 C;  1PYW D;  1F9P A;  1H9K A;  1BF4 A;  2EYM A;  2PNR C;  2IT1 A;  4DNR B;  3M4Y A;  3A8I E;  1A3T A;  4DGZ A;  3KBG A;  3JAM E;  1SDF A;  2EYH A;  5J39 A;  4CKB A;  2J0T D;  3BG3 A;  4QB4 A;  1JWM D;  4ILW A;  3T16 A;  1A3U A;  4WOR A;  2R92 B;  2F0O A;  2Z4I A;  5D3I B;  3BDO A;  3Q23 A;  1U4L A;  3IL8 A;  3NBI A;  1CT1 D;  1KDB A;  2PO4 A;  1SMY C;  3Q22 A;  3N52 A;  1ENF A;  2F0S A;  2RSN A;  1LAB A;  5FKA C;  3LWE A;  1PTO C;  3C1E A;  3RD4 A;  2OXP A;  1EU3 A;  1S5D D;  5LL6 X;  3A54 A;  1TY0 A;  3HOU B;  3S15 B;  3I3C A;  5C44 B;  1TWA B;  2JP1 A;  4XQN A;  2AUJ D;  4TQU S;  4L63 B;  4DFA A;  1IW7 D;  1O7Y A;  1EU4 A;  4ZKC B;  3SHL A;  3X3M A;  4YIJ A;  3GP7 A;  1D5Z C;  1CHQ D;  1Y69 U;  3RLF A;  3S9W A;  1H9R A;  4LMQ D;  1EY6 A;  3MFG A;  4KV6 A;  1WTQ A;  3GTL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...