4ME5A

Crystal structure of staphylococcal nuclease variant delta+phs v23s/v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTSKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4me5A00
3VA5A 1TQOA 5HGTA 4ZQ3A 5C3XA 2EY1A 5HURA 3R3OA 2EY5A 4MIUA 3D6CA 1KDBA 5E3FA 2ENBA 4HMIA 4K5XA 3T13A 2RDFA 5IOCA 2O4XA 3TP5A 5KYLA 1SYGA 1AEXA 1KDAA 2F0SA 4QB4A 4EQPA 1SYDA 1KDCA 1TR5A 4HMJA 4IUNA 3SK8A 1STYA 1EZ6A 4J6HA 1SNPA 2KHSA 1SNQA 2OF1A 2PYKA 3PMFA 4N9PA 1EYDA 2SNMA 1SYBA 4K5WA 4K6DA 5KIXA 5CR3A 5DEHA 1STNA 3SXHA 2EYLA 5C5MA 5CV7A 4K14A 5F2DA 4IALA 3EROA 5CV8A 4IZ8A 2SOBA 3QOLA 1EYCA 2PZUA 3MZ5A 3TMEA 5C5LA 2F0HA 1JORA 3OWFA 5C6AA 5I6WA 1EY5A 2F0WA 1ENAA 4KJNA 4WORA 1EY6A 1STAA 2PZTA 2HQEA 1NSNS 4F7XA 4G57A 4B9WA 3MEHA 5JOBA 3RUZA 1SNCA 3BDLA 2EYFA 2WACA 3D4DA 3SK4A 4QF4A 4DFAA 3C1EA 5I9OA 1JOKA 5IGFA 1SYCA 2F0LA 5IGGA 5KGUA 2EYJA 4ID6A 4QMGA 1JOOA 1A2UA 1STHA 3P1HA 2F0FA 4KD3A 4K2KA 4LAAA 2F0MA 5CV9A 4B9XA 3NUCA 1II3A 3SK5A 1F2MA 5IGCA 1EQVA 2F0GA 2M00A 3E5SA 3EJIA 5KYIA 2F3WA 3TP7A 1SNOA 5I9PA 5EGTA 2NUCA 3SHLA 1A3TA 1STBA 4R8NA 5KRUA 4KY5A 3OMCA 2EYHA 4PMBA 2RKSA 5CC4A 2EY2A 2PZWA 3U9OA 2EYMA 4J1MA 1EY0A 4KY6A 1EYAA 1ENCA 4OL7A 4RKLA 1KABA 4WRDA 1JOQA 3NQTA 2RBMA 5KEEA 4DF7A 3BDCA 1SNMA 1EY7A 2F0UA 4TRDA 4NDXA 3D8GA 2F0TA 3ERQA 4E6IA 2EYOA 5M9OA 3NHHA 4NMZA 5CGKA 3HEJA 5J22A 2KQ3A 1STGA 2EY6A 2F3VA 4I65A 4YIJA 1RKNA 4KJOA 4KY7A 3V2TA 5IODA 2F0KA 2EXZA 3MHBA 1A2TA 1F2ZA 4KHVA 5IGBA 2OEOA 4NP5A 4EVOA 5J1ZA 2EYPA 2SNSA 3MVVA 5C4ZA 4K8JA 3HZXA 3T16A 4DGZA 5I6YA 1KAAA 3LX0A 2PQEA 4KTAA 2F0QA 1F2YA 4H7BA 3EVQA 5IGDA 4F8MA 4N9TA 5EKLA 3D4WA 1TT2A 5IIFA 3NK9A 1SNDA 3TP6A 1SYEA 2PW5A 4PMCA 3P75A 1SYFA 4HTHA 4ME5A 5CV4A 4K8IA 3SR1A 4EQOA 2F0NA 1EZ8A 5EKKA 3SK6A 5E1FA 5DAUA 4KD4A 3TP8A 3S9WA 3OMGA 5C4HA 4ZUIA 3QB3A 4ZUJA 1EY4A 2F0VA 3C1FA 3NP8A 5CV6A 1IHZA 5JAVA 1NUCA 3ITPA 2F0EA 2LKVA 3H6MA 5ISRA 3MXPA 1EY8A 4K5VA 4EQNA 1EY9A 2F0JA 2QDBA 4RKBA 2OXPA 2F0OA 2PW7A 3NXWA 3QOJA 4NKLA 4DU9A 2F0PA 4KV6A 4K2LA 5NUCA 4ODGA 5J39A 5CV5A 2F0DA 2F0IA 5K5PA 5C3WA 5IGEA 3DHQA 4S3SA 4PNYA 1A3VA 1A3UA 3OSOA 1U9RA 3DMUA
chains in the Genus database with same CATH superfamily
1F2LA 3S2DH 1TQOA 2NVTB 5D65A 1Q82C 4B3SL 2HQLA 1N32L 1U5KA 1HZCA 1SYDA 3T51B 2HIVA 1E1OA 1QZGA 1A6XA 4DV1Q 2B2VA 3FPPA 4YCUA 4J8QA 1XX8A 4R4QA 3QOLA 2DN8A 2D62A 2WKCA 3OWFA 2F4VQ 3D6WA 2VB3X 2BE5C 3TZUA 3H0GG 3BVZA 1ONLA 2ZTEA 1CHQD 3CF5A 1LM0A 1PTOB 3GTQB 4GLXA 2Y0SE 2EYJA 4A3JB 3WDNA 1A2UA 4A3DH 1LABA 1RTOA 3AYHB 3P1HA 1II3A 3DXJC 2RHSB 4DKAC 3I3CA 1QNUA 3PUVA 3V96A 3E6ZX 3RZOB 1X3EA 4OO1H 2RKSA 1Q8IA 4JV5L 2HCIA 1H9JA 3MTSA 3MFGA 4AYBB 5AJ3L 2OQKA 3BJUA 5D3DA 2UXBL 1EQQA 4FXGC 4JI0L 1BVSA 3JAMi 2EY6A 1IXRA 4DV1L 5EPKA 1MBYA 4HSPA 2JA6B 4G7OC 1SLJA 4DPGA 1HZAA 3JAME 2XSCA 4LF5Q 2HT1A 1UWVA 5IYCG 4DR4L 3P75A 4HIKA 3BZCA 3FRPB 3SR1A 3W5OA 3U9SA 2XTIA 4HN7A 1YEZA 3IFDA 4ZUJA 2DJGC 4LK1C 3BZDB 1GJXA 1JT8A 2F0JA 2F0OA 4NKLA 1EQTA 4KV6A 1F9PA 2J7ZA 3I90A 3DHQA 1CKNA 2F3IA 1PH6A 2I46A 1WVLA 3F2CA 3P7JA 3K8AA 3VYUA 2KVMA 4GZYC 4B3TQ 1B2TA 4CKCA 1TU2B 5LMNQ 4BBRG 1M90C 2K5WA 1TS4A 4OO1G 3VR4A 1E24A 1D5MC 5C4XG 4QB4A 1XMOL 4RH6A 1SE3A 1OXVA 4J6HA 3E9IA 1HTPA 2I0QA 1Y1WB 2N3SA 3KK7A 1EYGA 5CR3A 3CCRA 1D1IA 5CV7A 1LO5D 1I6HB 5GAEC 2NBFA 3AFQA 1VF5C 4OONA 1PRTD 4LF5L 5AFWA 4JBWA 3NE5B 2VL6A 3HOUB 4F7XA 2Q2UA 4JI1Q 2IHEA 4DK0A 4Y52H 3J7ZC 1JQYD 3CKIB 4KK7A 1C0AA 1RD9D 2HHHL 4ULLA 2WACA 1CKOA 3SK4A 2E76C 5KGUA 1LTGD 2KCTA 2F0LA 2H5XA 3CCEA 2YU9B 4C3IG 5IGCA 3OTOQ 3HOZG 2JP1A 3EJIA 3SE0A 4A93G 1PLFA 3HKSA 1HR0W 1B1ZA 1SFOH 1VS0A 1CI3M 2K05A 4OGQC 3SHLA 1A3TA 3IRBA 3FVQA 4HJ5A 3J7AV 1ASZA 4XDXA 2OCEA 4IUQA 5KEEA 1QB5D 2JA9A 4U673 2OWOA 1VQOA 4A3DB 2DY7A 4LUZA 2KQ3A 3CC4A 4BXXH 2NZOA 2XWBB 1PHJA 4I65A 1DONA 2WB1B 4LF4Q 1A2TA 1BCPD 3Q0AA 2K04A 4H44C 3HZXA 1GM5A 4KTAA 1EEFD 1ET6A 3OWEB 2SDFA 2WV6D 4DK1A 2K14A 3S1NB 5CYUA 4N9TA 2LS01 1TWAB 5IIFA 1WTQA 2E2JH 4DNIA 1YNJD 3OYYA 1LT5D 4DR6Q 1TKWB 1QJOA 4LWCA 2E75C 3HGBA 2RVLA 3C1FA 3NP8A 5IYBG 1J6QA 1L0YB 2UU9L 1PFBA 4RGNA 5A2QL 5K36H 3HOXB 1QOHA 4YY3Q 3IL8A 2R92B 2O5JC 1SXTA 4JYAL 2RHQB 1R9TB 5CMDA 1FNUA 2YYZA 2KEEA 1YITA 4HMIA 5EQ0A 3NTKA 1TWFH 1PYBA 4BXXG 3KUPA 1V9PA 3A55A 4FYDA 1L1OA 1SE4A 4C1NI 4Z9CB 5ELFA 1SYBA 3CP0A 3J80L 3CC2A 4UP9A 3W1GA 4DV4Q 3N52A 4QL5A 4UP8A 3GTMH 2J4XA 3TBIB 4YWMA 1BOSA 2ZM6Q 1NJIC 1EIGA 5I6WA 2PI2A 1D6EC 2L12A 1DOMA 3NSWA 4KJNA 3PIOA 3TQYA 3MWYW 5IT9L 5JOBA 3SGIA 3BDLA 2EYFA 4GLAC 1Q1BA 4DR3Q 4IPHA 1N34Q 3VYRA 4DN4M 1WD1A 2F0MA 4IUTA 4ZLTF 1YNJC 2AUKA 5FO9B 4JI7Q 1EWIA 1OO9B 2BA1A 2UXCQ 1PZKD 1O7LA 3E0EA 5DNFA 1QZHA 4A3JG 4A3BH 4R4OA 5IP9G 4WRDA 4L6TB 1EY0A 4L5SA 2AQ2B 3FEWX 3UDFA 4EGVA 4X3SA 3I56A 2BH2A 5JJZA 3ICEA 2JXMB 1LTSD 3K80C 5A35A 4LFBL 5CGKA 2F3VA 2CKZB 1S5FD 1HNZQ 1EIFA 4LF7Q 1F2ZA 1PFNA 3CCMA 3CQZH 1DYQA 1EWCA 3RZDB 1WOCA 4JI4L 2IW3A 3KBXA 3KJPA 2F0QA 4H7BA 4F87A 2PNRC 4DR2Q 3KDFB 3VR6A 3FDTA 4PMCA 4ME5A 3J81i 3U50C 4ILWA 4IFDH 4NB3A 2N55A 1KLUD 1V1PB 1CM9A 1D5XC 2HDLA 4CHTB 3KLWA 2K5VA 4IPGA 1N33Q 5I2YA 5C3EG 5GAGC 3NXWA 3HOZB 2LMCB 4GKJQ 3I4MG 2Q2IA 1R9TH 4DAYB 3S1NH 4JVZA 4CDFC 3DUZA 3D0FA 1K9MC 3A56A 3H15A 2E2IB 3OSOA 4OX9Q 3EFXD 3I8ZA 1KDBA 2C5CA 1TS5A 3BYYB 2JN4A 3T13A 3PIO3 5KYLA 2Q8RE 3SK8A 1O78A 1X32A 2TMPA 5KNDA 1HR0L 5JEAG 4X3KA 3PO3H 1WTOA 1B4OA 1BBWA 2ID0A 3Q8DA 1FYCA 4IALA 3EROA 4X64Q 2ICIA 1AZPA 1XMQL 1I5FA 1PH1A 3SEBA 4H0LC 4WORA 2YV5A 3GTLB 4ZRZA 1F77A 1K83H 3PIP3 1SNCA 1I3QH 5C0XI 2ZT9C 4MTKA 1FD7D 1VDZA 5EKIA 1IKLA 1STEA 3VYTA 4Q0FA 4KKTA 1UUPA 1D7QA 2B63B 5LMNW 5HGTA 5FLMG 1JE5A 1ASYA 2NVTH 1XYIA 4C1NK 5KYIA 3RLNA 4PG3A 4KY5A 1IW7C 3GTGB 2SEBD 2L15A 1EYAA 2IPKD 4JI2Q 3J81j 1MSGA 1GOZA 1HZBA 2UU9Q 3K59A 4WFN3 2B2UC 3KJOA 2IHFA 1HR0Q 3U4ZA 2JYOA 1S4ZA 1CKNB 5IODA 1BR9A 4L5QA 3M4QA 1HXYD 1RDPD 1Y69U 4QCLA 3ND9A 4CDEC 1PTOH 3S1QB 3D4WA 1GO3E 2B2WC 1GUSA 3PF4A 5E1FA 2M9VA 4DR5L 4CKEA 4WJ3M 1EY4A 2EDGA 4XYOA 3OW7A 5C4JH 1WTXA 1MSHA 4LFCL 4LFAL 1H9SB 1D2BA 2GN5A 4B3SQ 5HGQA 4RKBA 1A15A 2PW7A 4DU9A 2MJ8A 2UUCL 1N32Q 3J81c 3J81E 3I4NG 2UUAQ 2F0IA 2B2TC 2A6EC 1MKHA 1YHBA 2A69C 3TEHB 3CD6A 3T1HL 3H0GH 4HR7B 1MGSA 4DNTB 1KDAA 4UDUC 4AQYQ 1VQPA 2CWAA 2B3GA 4EQPA 4NXNL 1L2FA 4IUNA 1TR5A 2ES2A 4K0KL 3FKIH 1E3PA 2UXCL 3PMFA 4OEMB 4GN5A 2CWPA 4RG1A 2B2UA 2N78A 1YIJA 2R7FA 1I50H 3VYSA 1RCVD 4JI1L 1WTVA 3VR3A 3I73A 4BA2I 4R1JA 2R93B 3HP3A 5CORA 5C6AA 1L0XB 2Z9HA 2N49A 2A6HD 2R61A 1JICA 1UE1A 5IT9E 4JW0A 4LUVA 1RIPA 2BCOA 3NENA 2AQ3B 3J7YW 4IJLA 2A68D 2VY3A 2A68C 1QUQB 3GQBA 4LFAQ 4LFCQ 1I4XA 1LTBD 3WWVA 4KHPL 4LAAA 4DAPA 1F2MA 2D5DA 4GOPB 1SJED 2M00A 2YU9H 2JSOA 4JI3L 3ULPA 4JI0Q 1QNKA 3BZKA 2R93G 4X65Q 4J1MA 1YNXA 1K0RA 1Z47A 1L1OC 4CGYB 2B2TA 3OOCA 2VQEQ 5C3EH 2HCCA 3TN2A 5JVG3 1HCZA 3A8JE 4OXPA 1LTTD 4GKJL 2HIXA 2ZJQA 5FOBB 1VQJA 1ILQA 2EXZA 2JEAI 1WD0A 1PFSA 4RGOS 1PH4A 2RA4A 3KF8B 3RN5A 3DM3A 4ALPA 1KNAA 1IBMQ 1XWEA 1TS2A 3M7GA 4MTNA 3HOWG 4ZAIA 5EKKA 3GTKB 5M5XB 1PH5A 1WTPA 1X55A 3OMGA 4C3HH 3QB3A 2VW9A 4JK1C 4XT1B 1PRTC 1CUKA 3L0OA 3ULJA 1G2SA 4DV3Q 1WFQA 2A74C 4O0AA 3CCVA 3T1YQ 2XRQD 2F0PA 1E22A 3M4OH 2N8NA 3AFPA 2B63H 2K32A 4A3JH 4A3BG 4DV6Q 3GTQH 4UY8C 2A6ED 4NW2A 4YCWA 4QUCA 1EOVA 2BDOA 1BF4A 5C4XB 4JG2A 4K5XA 1PVOA 5IOCA 4DV7Q 4RHSA 4DV4L 1SNQA 3O13A 4K5WA 2JA8G 4HJ8A 3PUZA 2EJFC 2L1BA 3OPOA 2XNAC 1XNRQ 4QQBX 5IWAL 3CC7A 1VCIA 3NTIA 2NVQB 1A63A 1NY4A 4GNXB 3K0YA 1FR3A 3K81C 1K8AC 4LF9Q 1L0WA 4LJZC 4X6AH 2F0FA 2CVRA 2KENA 4RFBA 4B9XA 3NUCA 2D2CC 3PO2H 1PMRA 1CTMA 2NN6I 3GTPB 5D3IB 4B3ML 1SR3A 1YJ9A 1X3PA 1X3GA 5KRUA 5FLXc 1C9OA 3JAML 3UDXA 2EYMA 5M3MG 2QW7A 1DGSA 1KABA 3NQTA 3CAMA 3GTOB 5K36G 2FXQA 4TRDA 1VQ8A 1Y1VB 3A54A 3ND8A 1KRSA 3VR5A 3HEJA 3DWQA 1Q81C 4HJ9A 5DM73 2BDNA 2F0KA 4AIMA 2JA8B 4L5RC 2FHTA 4A3LH 4QGUA 1VQMA 3PGZA 4DR2L 1HFGA 1BKBA 4XTCS 3QO2A 1VMCA 2I07B 5IGDA 4A3KB 1HNWQ 2ZXPA 1QVFA 1VQIA 4B3RQ 1XNQQ 2MPMA 3KYHC 3J80i 4A93B 4HTHA 4YCVA 1M1KC 4LF9L 2XGTA 1HJPA 4KD4A 4JYAQ 5G3LD 4K0KQ 4WJ4A 2IWHA 5JPMC 3UDGA 1QILA 4MHEA 1NUCA 5A2QE 2VQFQ 4IO9A 1HNXL 2R7ZG 4K2LA 5NUCA 1GUTA 1X54A 2RF4A 2R92H 1H9KA 4QIWE 1OXUA 5IP7G 1A3UA 2R3ZA 2DY8A 3L2PA 2NVXH 1OXXK 1H95A 4CJ0B 2KUMA 4RWSC 2ICEC 4OHJA 2VUMG 4BWGB 3S15H 2N88A 4C3HB 2E5LQ 4R4CA 3A7AB 1LV9A 2KHIA 4FXDA 3SVMA 3NEMA 1HFNA 4A4IA 5KNBA 5DEHA 5C5MA 3CW2C 2PI2E 2VZAA 1HUMA 3KBGA 1G2TA 4FO2A 2UUBQ 1EYCA 1VF7A 2PZUA 1AZQA 2X6LA 2K6AA 1VQ9A 4C3HG 1I94Q 1IL2A 4GNXA 1GVPA 3D4DA 1EU3A 4QF4A 2QA4A 2K03A 2NTSA 4KMUC 4DR1Q 5IYCH 2ZM6L 2EPBA 4P74A 2F3WA 1PV4A 2FINB 3C2PA 2DGYA 4C3JH 1FGBD 1KHIA 4YWLA 1RTNA 2XWJB 1X9NA 1N34L 1CSQA 1ENCA 1CHPD 2IT1A 4OL7A 5FO8B 1VQ5A 3W2DA 5LL6S 2RBMA 1PRTB 2X6GA 1Q3LA 4QJFA 1SNMA 3FKIB 2F0TA 5M9OA 1KTKA 1ZYRC 1T5EA 3UE1A 3PO2G 1CZWA 3MHBA 4KHVA 5IGBA 1VQ4A 4NP5A 3ZYYX 3MVVA 4G7HC 1QVCA 2M2LA 1CKMA 1GUWA 1F2YA 4OO1I 1S72A 3PO3G 1UEAB 1TIID 1QCBD 3TRZA 1WCMH 3K5MA 3KOJA 1SYEA 4KKUA 1MJCA 3S2DB 3HKZE 2KECA 2QGQA 1KRTA 5AJ3Q 2F0VA 3U4VA 1V8QA 4XT3B 1A62A 3HOZH 3DEPA 5J39A 1PRTF 1TS3A 3QIAA 3T53B 1V43A 1KAWA 5M5YB 3V05A 2O5IC 1Q46A 3TSSA 1DM0B 1PZJD 4CJ1B 3TS0A 3GO5A 4A93H 4BY7H 2ALYB 1JC7A 4BY7B 4LUOA 2EIFA 4MIUA 1MHWC 1K73C 1Y1VG 2RDFA 5JJLA 1RHPA 2PNHA 5ELOA 1J5EL 2NWGA 1U0LA 1KDCA 1AFPA 3DEOA 4P75A 4ZK9B 4L63B 2PQAB 1YI2A 1DOLA 1TWGB 1CK1A 4DAMA 3TMEA 1XXGA 3RZOH 3CRKC 1PH2A 1IYUA 5BN4A 5BR8Q 1E2ZA 4DUYQ 4FP5D 1MIUA 4KHPQ 1T5XD 3KLRA 1CSPA 2G5DA 3CPWA 1XTCD 2AUJD 4ID6A 4IQZA 4X3UA 1N36L 1XMQQ 1VQEA 4I7ZC 3J7A5 4YHHL 1BBXC 1FVIA 1PYWD 5EBDA 3M85A 3OHXC 3Q23A 3M7NA 3RLOA 3J80E 1LUZA 2AWNA 4WJWA 3I4NH 4HAEA 1WCMG 5EGTA 3EIVA 1UE5A 4GKKL 3E9HA 4PMBA 2VUMH 2NN6H 4JI7L 4RGTA 1SDFA 2LSSA 4FDBA 3L9AX 1J5EQ 3CRLC 3T4AC 2C35B 3B6YA 4NMZA 1L1OB 1VQ6A 2A69D 5C3EB 2ZJPA 4C56C 1QE6A 1D8LA 3KLSA 4JI2L 1NE3A 3ZJYC 3RR5A 4KN7C 3ERSX 2PQEA 1I4GA 4CBVA 2IX1A 1KIXA 1AE3A 3BVGA 1TWGH 1X3FA 3AQQA 2RDGA 3SK6A 1DZ1A 1S5DD 5C4HA 2CCZA 4X3TA 3CPFA 1PH3A 3HKZB 1U4LA 5ISRA 1B3AA 2MQHA 4HJ7A 4K5VA 3A5ZB 1EL0A 3I4MB 4JI8L 2Z1CA 2QDLA 3H3VI 4AQYL 1X65A 2F0DA 3N6RA 4EQ5A 4TQUS 3VR2A 4LF8L 1I6HH 1CA6A 1TXYA 1SEBD 2MFIA 3CCSA 3K7AB 2EY5A 2NZHA 3D6CA 2ENBA 4X66L 1BDOA 1I4HA 1E2VA 4DV0L 2VUMB 1F9QA 2ZJRA 2UXBQ 3AU7A 1AP0A 1UE7A 1AN8A 1EYDA 4ME3A 4LNQA 1ICFB 4K6DA 5FJ8G 1RODA 3C46A 4FF4A 2L9HA 4Y7NB 1KNEA 4A3IH 4Y7NH 2JA7G 2MNAA 3S15B 1A0IA 2HQEA 4G57A 4IPDA 4DAYA 4JI3Q 1ML0D 2A8VA 1DXMA 3RUZA 1YJWA 2KOLA 3G48A 1NR2A 3H91A 2K5DA 4P72A 1BBUA 3RMHA 4JI8Q 3I4NB 4P71A 1NAPA 3HOYG 5T1GA 4A3GG 5EAYA 2JA8H 1Z9FA 2F0GA 4RAUC 1JB7A 4JI5L 3K57A 4APVA 1YZ6A 1U4RA 1X3QA 4DR7L 2PZWA 1KD1C 1IBKL 3G7LA 3I4MH 1JOQA 1VQBA 4RKLA 2LXKA 3PCOB 2ASBA 3JC66 3I4LA 1AH9A 3AB9A 5J22A 2HUGA 3K7AH 2XRSD 3URYA 3KF8A 4DR3L 4YWKA 1CA5A 3S17B 2YTXA 2OEOA 5FKAC 3X3MA 4A76A 1LT3D 4BS9A 1XNQL 3H94A 3GV3A 4CKBA 2JA6H 2IJ0A 1PYSB 2Q2HA 2KEDA 1GHJA 3S1MH 1S5CD 1BUVT 2O2LD 2EOTA 5CV4A 4ZKCB 3T56B 4BBSG 5GQOA 1HPCA 1Y8PB 1XTDA 3CMAA 3RZDH 1NBWA 3MXNB 4KHZA 1V1QA 2A6HC 1VMPA 4V0BA 1EY8A 2B29A 4C3IH 2IX3A 2EZVA 4QIWB 4A3DG 2DNCA 4DV7L 1HNZL 4DR7Q 1ICWA 4R4IA 5TSSA 1A3VA 3JAMc 3VA5A 4DA2A 5E3FA 1K8MA 3GD7A 3PUWA 4OWTB 3TP5A 1C48A 2JJQA 3MC0B 2H1EA 3OW2A 5C0XH 2CH4W 1JB3A 2KCMA 2VS1A 2EXDA 4HCSA 2NN6G 1K28A 2NB0A 3QR8A 2GVAA 1EQRA 4QUFA 3CCQA 1IKMA 1IZ6A 3DWPA 2E2HH 1VQLA 1JCKB 4ZCKA 1EFID 4L8JA 3LWUA 1STAA 2NZ1D 2B63G 3I91A 3NELA 3UI2A 3DWAA 3MEHA 3GTGH 4FF3A 3TS2A 4I7AA 1W6KA 2Q2TA 2B2WA 1JOOA 1PH7A 1YHAA 1GD7A 1V1PA 4A3CG 3BG3A 3E5SA 4A3LG 3ER0A 4RCNA 1NTGA 1WTRA 1O7IA 4YY3L 1SFOB 4A3IB 4A3KG 4R8NA 2E74C 2K4KA 1AE2A 2R7ZH 1W3SA 3U9OA 2HDMA 3A74A 1GUOA 3MAQA 3F2UA 4FF1A 1HQMC 2VB2X 5EPLA 2MP1A 2JQOA 1ENFA 3NHHA 3NQIA 1STGA 1VQFA 1ZYRD 2PPBC 3EN2A 2RSNA 1X56A 5HY6A 4IUVA 1RJTA 4DV5Q 5KNCA 2SNSA 4LF8Q 5E7NA 3S16H 3TDQA 5C0XG 1BO0A 3HOVH 1OTCA 1KXLA 4X66Q 5CBEE 3Q6SA 1Y1WH 4DV0Q 3VA7A 4BBRB 1Y8NB 2K33A 2G9HD 1SE2A 2CFMA 2Q8IB 1DD2A 1G91A 4DUZL 1PXUA 2LKVA 1S3OA 1K3RA 3H6MA 4OELB 1IYVA 3S17H 1G6ZA 3R2TA 4X62Q 4JBKA 1LTAD 4DV3L 3K58A 3CCJA 1PTOF 4L5TA 4LF6Q 4UPAA 2NVYH 3PUYA 4A3MB 4ZYSA 1K0SA 3I55A 2CW0C 4ZQ3A 1XPUA 4DV6L 2E2IH 2WFWA 2R93H 4CDCC 2O4XA 1VQHA 1TWFB 3F2BA 4DV5L 2KBNA 1STYA 3HOYB 5C44H 4LFBQ 4IFDJ 1SNPA 2OF1A 5EJWA 1Q90A 3QJYA 4NXMQ 1D1KA 2UUCQ 2PMZB 4F88A 1OXSC 1EY6A 5ELNA 4PZ6A 3WOFA 2JE6I 3A8KE 1N36Q 4HEDA 4DAVA 3RNUA 1BNZA 3PF5A 1GUNA 1Q8KA 3C1EA 1JOKA 5IGGA 4A3MG 1PH9A 2TSSA 1PZID 1STHA 1S40A 1HQRD 2WIIB 1ESFA 4A3FG 1F9RA 2E2HB 1FGUA 5H1SE 3FKIG 4H13C 4GOPA 5IT9c 2QF7A 2RQXA 4OIJA 3F1ZA 3A8IE 1FJGL 2JEBI 2KA7A 1UAPA 1VQDA 3CCLA 2D0PA 1VQGA 1SROA 1Z7TA 1GKHA 1IYJB 4AYBE 1JWUD 3ERQA 1E2WA 2ZXRA 3FPUB 3GTJH 2WP8J 1JE4A 3STBD 1LYLA 2K5QA 1SSOA 4KY7A 5DM63 1E1TA 5IYDG 4A75A 1B53A 2K5NA 1TWCB 4F8MA 1CQVA 1XPOA 3HS0C 3IKJA 1K3BC 3H09A 3CXCA 1HUNA 2UXDL 4EQOA 3G71A 3GTMB 3KF6A 1HNWL 4ZUIA 3NWTA 1M8AA 1SN8A 2MHVA 1H9RA 4DK3C 2F0EA 3MXPA 4PQXA 4EQNA 4C2MB 1EY9A 1EFWA 3AEVA 2OXPA 4ODGA 3NBIA 1HA6A 4IURA 5CV5A 5ELBA 3HOVB 5IGEA 3HKZG 1V1OA 5BN3A 5FK9C 5DAUA 3DMUA 4DNRB 2WB1G 2OTJA 1EEID 1SAPA 1FL0A 1EWHA 5IP9H 1PDQA 2DUDA 1CFMA 5IYBH 3OTOL 2GVBA 3WOEA 2GA4B 1YNND 3OIQA 1I4RA 1N8RC 2F4VL 2Z0SA 3S1RH 4R8IA 4K14A 1IL8A 5CV8A 2JA5B 3T1YL 1QG7A 2EE1A 2EJMA 1EY5A 3S16B 5JVH3 1NSNS 3GTLH 3A5UA 1JWSD 4QY7A 1Q12A 2LY7A 3MFYA 4MNOA 1LTLA 2I5LX 2Z8LA 5JJIA 2K01A 1I94L 3QG1A 3UE0A 2WAQE 3HOUG 2R6GA 1WCMB 3M4PA 1D5ZC 1Q1EA 1ET9A 2K75A 4GS3A 2XN9C 4JOIC 4DR1L 1SNOA 1OXTA 1Z6HA 4O2DA 4DR6L 1SJHD 1XNRL 5G3LF 5IWAQ 4DUZQ 1B44D 1EY7A 3D8GA 4K6LA 1VQ7A 4E6IA 1I50B 2CQOA 2CH4A 4O42A 2NTTA 4RA8A 4XXEA 2QEJC 3NPPA 1VQKA 4A3EH 1YVCA 4XQQA 2PCFB 4EVOA 5J1ZA 5LL6X 1R4PB 4JI6L 1K8OA 3T16A 5I6YA 1A8VA 1KAAA 1E7ZA 1QWYA 1U4MA 4DXGA 3M4OB 2ZXOA 5LMUQ 5CBAE 3K0XA 4P2CB 3PO3B 1LTRD 1C8CA 2PW5A 4BY7G 3GTJB 1EUJA 4HIDA 1F9SA 5D14A 2NYZD 4CDDC 1TWHH 1B8AA 4A3FH 5CV6A 3R8BA 2CHBD 1I4PA 1LLRD 2QDBA 4GNXC 3QOJA 1VQAA 1G51A 2JA6G 5E4WC 3BYTB 3PIPA 1BCPF 1DCZA 2G9DA 4KI0A 1IHZA 5GADC 2B39A 1O80A 1BXTA 4DV2L 5C3XA 2QILA 3A0JA 3R3OA 3FHWA 4IUPA 4G4KA 5I2XA 1HHVA 4AH6A 4AYBG 4HMJA 4BY1G 3S1RB 1EZ6A 1Q86C 2KHSA 2K1BA 4TKOB 4RGMA 5E4XA 4JI6Q 2F1MA 3S1MB 1STNA 2JK8A 3D31A 4V190 1TY2A 2ZTDA 2R92G 5C0XJ 4IZ8A 3STBC 2SOBA 5IP7H 3K7UC 4FXKC 2L4NA 1KC8C 2Z4IA 5M3FB 1I6VC 4IFDI 1Y8OB 2F0WA 3TZDA 3K5LA 3HOWB 2EVBA 2PZTA 2D0OA 2OTLA 4J15A 4DR5Q 4C3JB 3DLLA 3RLFA 1P8LA 4TVAB 1SYCA 1IBKQ 3BVMA 4R9WA 2F4IA 4JV5Q 2B2VC 1WJJA 2IX0A 5CV9A 4HIMA 3GV6A 3GP7A 1G8ZD 1MD2D 3DM1A 2WAQB 2K50A 2XVSA 1EOTA 2PO4A 4IUUA 3GTPH 1PH8A 3R2IA 3UDIA 5FJ8H 3Q22A 1X6OA 1TWAH 3LWEA 2E2JB 4UP7A 1TWCH 2LFNA 3BDCA 2Z6KA 4NDXA 4JI5Q 4IFDG 1N33L 1O7YA 4BY1B 1ZXTA 2WAQG 1DOKA 2FMMA 2BOSA 4YIJA 2A73B 1VQNA 2BH8A 5C44G 4JOIA 3Q24A 2EYPA 3NBHB 2KCNA 2P5ZX 4KKSA 3LX0A 2RSOA 4C3JG 1ILPA 1AW7A 1JWMD 3VDYA 2KJXA 4POFA 3PQIA 1SNDA 4IPCA 5ELCA 3TP6A 1YHQA 1SYFA 4N8FA 4K8IA 5C4JB 4EX5A 1EZ8A 4IJHA 3S9WA 1MJEA 3H3VC 2K7VA 5GROA 1G291 3S2HB 2I5MX 3IFTA 1SMYD 3E0JA 3G6JB 4XYQA 2AWOA 5L37A 1HTLD 4X64L 3HOYH 1WTHA 5I4DA 1B9NA 2B8GA 2OT2A 4P73A 1RF2D 1PA6A 5C3WA 2C9OA 4S3SA 3S24A 3F2DA 1Y1WG 1UE6A 5M3MB 3MEFA 1YJNA 2VQEL 5HURA 5M5WB 1BCPC 3NBHA 3PUXA 2K28A 1J8IA 4BA1I 3LNNA 1AEXA 2Z6BA 4RHRA 3CQZB 4GLVB 1I4QA 1I3QB 4NXML 4JBMA 2SNMA 2Z6KC 5KIXA 2YTVA 1GUGA 3I2ZA 2EYLA 5LMNL 2PMZE 3ONAB 2PQAA 1SRUA 1T9HA 3TREA 4ABNA 4DXFA 3NTHA 1U4PA 4BBSB 2AQ1B 4BBSH 2QKIC 1M4VA 4MN3A 3KLSX 2L11A 2EQSA 4K2KA 2NVXB 1TVXA 1EQVA 1HNXQ 2RCNA 3RN2A 2NUCA 1GHKA 3BDOA 2EYHA 1WYDA 2JA5G 1SMYC 2EY2A 2B2YC 4HIOA 3PSIA 1B50A 1PFMA 5JEAJ 1UEBA 2F0UA 5COYA 2FJ2A 3KDFA 1YBYA 4JI4Q 2E5LL 4KN4C 3C3LA 2K5HA 4HJAA 1JJCB 4KJOA 4GN3B 1HA5A 2UUAL 2J0TD 2YTYA 5M5WH 2F52A 1G6PA 2AMCB 3FP9A 5C4ZA 4K8JA 4YHHQ 4DV2Q 2D9UA 1SMXA 4A3IG 2V4DA 5T1IA 3I72A 4A3GB 4IN3A 2UUBL 3GTKH 1LT6D 3S14B 3MXGA 2QCPX 2WKDA 5M3FH 2OQ0A 4JPBW 3ULLA 1JJ2A 2A5HA 4N8X1 1NCVA 1KQSA 4PZ8A 2XIWA 3H0GB 4TSSA 3HOUH 3HOXH 4B3MQ 4OX9L 4OIKA 1NR4A 1NNXA 3M9BA 1FNVA 5K5PA 1UNSA 5BN5A 1B3QA 2Z4HA 3CHBD 5FLXL 4LW1A 1EIYB 2JA5H 3I70A 1U9RA 2IY5B 4G7ZC 2K52A 1HH2P 3PO2B 1KLGD 3E3XA 3K5OA 4M1UB 1H9MA 4JBJA 4X62L 4XQNA 3HOVG 2CQAA 4B3TL 5ELEA 2BA0A 1W2BA 2V1CC 1JJGA 5EBCA 1XMOQ 4OWXB 4X65L 2L55A 2Q8TA 3X3NA 4FNFA 4B3RL 3MZ5A 5C5LA 2QEXA 4GOPC 1JORA 1IW7D 4PV1C 2F03A 5M3FG 1WTWA 3KF6B 3MXUA 3A7LA 1SBBB 5IGFA 4FVMA 5I9OA 4HCEA 1BCPB 1FJGQ 4QMGA 5M5XH 1WI5A 3S14H 4KD3A 1CQFA 2HHHQ 4OWWB 2DNEA 4PZ7A 4Q5VA 2R7ZB 1HZ9A 1EU4A 4GN4B 3HOWH 2X69A 1J9OA 2A1AA 2MGSA 3CU7A 5CC4A 3H3VH 2RCFA 1NMFA 4R4TA 2E8GA 2ATWA 1C4QA 1LT4D 3LGJA 2NVYB 4A3MH 2EYOA 4HSVA 1TWHB 3G6EA 1H9SA 3HRZC 4A3FB 5C4XH 1GXDC 2CW0D 2KHJA 4KLKA 1RKNA 1N9WA 1NMGA 3V2TA 3BS1A 2DJFC 1K83B 3S2HH 3K5NA 2WB1E 2I5HA 2LXJA 4DGZA 3K6OA 1KL9A 1C7YA 2EJGC 1B70B 3D4RA 1TT2A 1YNNC 1IBLQ 3NK9A 1TY0A 5ELDA 4LF7L 5EPJA 1QVGA 3J7AF 3M3YH 1JMCA 3D3RA 3ITPA 3GDEA 2VXWA 4RCOA 3P20A 4H02A 4A3CH 4C2MH 3AMUA 2UXDQ 1B7YB 4A3KH 2JA7B 3M4YA 4PNYA 4XQJA 1W6JA 4A3EB 4NXNQ 2EY1A 3CCUA 3R93A 1PTOC 2FMCA 4UHVA 4LF6L 1DJRD 2WINB 5GAHC 3HFZB 1SYGA 2F0SA 4O1NA 4DR4Q 4RMFA 1E0BA 3KFUA 1HRJA 4A3EG 3HOXG 2PYKA 4N9PA 4FF2A 2E2DC 1B9MA 3SXHA 5M3MH 3J81L 3PV0A 2FFKB 5F2DA 3FMCA 5IYDH 2ZTCA 2F0HA 1IBLL 3F8TA 1ENAA 1CT1D 4B08A 4MZ9A 3MA2B 2VNUD 4POGA 1CZGA 4B9WA 3I4OA 4JCVE 2Y0SB 2AKWB 3IAYA 1JR0D 2B8FA 5J3BA 4DFAA 4BY1H 3EA6A 1Y14B 3GTOH 3MXNA 1ZKOA 5JEAH 1MI2A 3SK5A 2MO0A 4M8AA 3U58A 2AHOB 3I7FA 2HD3A 2H4OA 3TP7A 4CJ2C 2A19A 5I9PA 2NVQH 4UAIA 4XIGS 3M3YB 1S5ED 1STBA 3OMCA 2L5TA 1LTID 3QWNA 4KY6A 4PMWA 1XPRA 1XJVA 4IOCA 1O7ZA 3SDZA 1SE8A 4DF7A 3G4SA 2KCCA 2VQFL 1Q7YC 2JA7H 1VQCA 3HG9A 4BBRH 4NPSA 2MUYA 5JPNC 5JJKA 4JC0A 1QUQA 2BE5D 4C3IB 5LHY1 5FO7B 1PTOD 3OIPA 1IBML 4DK6C 3RD4A 5C44B 3W3AA 4A3BB 3NWSA 3L3OC 3S1QH 5BR8L 4DUYL 3EVQA 3W1BA 3J80c 1ZEQX 1R4QB 3EQLC 1Y1VH 5EKLA 5DLQE 2MO1A 2F0NA 5IE8A 5FLMH 5IY0A 3TP8A 3CMEA 2L0CA 1RL2A 2R7DA 5JAVA 4ZKBB 1S5BD 5M5YH 3T1HQ 3L7ZC 4U68A 5LMUL 2Y0SG 1P16A 1K8GA 3BU2A 2B2YA 1BQQT 4A3GH 3EBEA 1LACA 1FNWA 4IOAA 4GKKQ 1ESRA 4LF4L 2IL8A 1EIHA 4LMQD 5FLXE 2RDHA
chains in the Genus database with same CATH topology
1F2LA 1TQOA 2NVTB 5D65A 1SYDA 3T51B 1A6XA 2B2VA 3FPPA 4J8QA 1XX8A 3QOLA 2DN8A 2D62A 2WKCA 3OWFA 3D6WA 2VB3X 2BE5C 3TZUA 3BVZA 1ONLA 1CHQD 3GTQB 1PTOB 2EYJA 4A3JB 3WDNA 1A2UA 1LABA 1RTOA 3P1HA 1II3A 3DXJC 3I3CA 1QNUA 3PUVA 3V96A 3E6ZX 3RZOB 4OO1H 2RKSA 1Q8IA 2HCIA 1H9JA 3MTSA 3MFGA 4AYBB 5D3DA 4FXGC 2EY6A 5EPKA 1MBYA 4HSPA 2JA6B 4G7OC 3JAME 2XSCA 3P75A 3FRPB 3SR1A 3U9SA 4HN7A 3IFDA 4ZUJA 4LK1C 3BZDB 1GJXA 2F0JA 2F0OA 4NKLA 1EQTA 4KV6A 1F9PA 2J7ZA 3I90A 3DHQA 2I46A 1WVLA 3P7JA 3VYUA 2KVMA 4GZYC 1B2TA 4CKCA 1TU2B 2K5WA 1TS4A 4OO1G 3VR4A 1D5MC 4QB4A 4RH6A 1SE3A 1OXVA 4J6HA 1HTPA 1Y1WB 3KK7A 5CR3A 1D1IA 5CV7A 1LO5D 1I6HB 2NBFA 1VF5C 1PRTD 5AFWA 4JBWA 3NE5B 3HOUB 4F7XA 4DK0A 1JQYD 3CKIB 4KK7A 1RD9D 4ULLA 2WACA 3SK4A 5KGUA 2E76C 1LTGD 2F0LA 2YU9B 4C3IG 5IGCA 2JP1A 3EJIA 3SE0A 1PLFA 1B1ZA 1CI3M 2K05A 4OGQC 3SHLA 1A3TA 3FVQA 3J7AV 4XDXA 4IUQA 5KEEA 1QB5D 4U673 4A3DB 2DY7A 2KQ3A 2XWBB 4I65A 1DONA 2WB1B 1A2TA 1BCPD 3Q0AA 2K04A 4H44C 3HZXA 4KTAA 1EEFD 1ET6A 3OWEB 2SDFA 2WV6D 4DK1A 3S1NB 5CYUA 4N9TA 2LS01 1TWAB 5IIFA 1WTQA 1YNJD 1LT5D 1TKWB 1QJOA 2E75C 3HGBA 2RVLA 3C1FA 3NP8A 1L0YB 1PFBA 4RGNA 5A2QL 5K36H 3HOXB 1QOHA 3IL8A 2R92B 2O5JC 1SXTA 1R9TB 5CMDA 1FNUA 2YYZA 2KEEA 4HMIA 5EQ0A 3NTKA 3KUPA 3A55A 4FYDA 1SE4A 4C1NI 4Z9CB 5ELFA 1SYBA 3J80L 3N52A 2J4XA 3TBIB 1BOSA 1EIGA 5I6WA 4KJNA 1D6EC 2L12A 1DOMA 3NSWA 3MWYW 5IT9L 5JOBA 3BDLA 2EYFA 1Q1BA 3VYRA 4DN4M 1WD1A 2F0MA 4IUTA 4ZLTF 1YNJC 2AUKA 5FO9B 1OO9B 2BA1A 1PZKD 1O7LA 5DNFA 4WRDA 4L6TB 1EY0A 2AQ2B 3FEWX 4EGVA 4X3SA 5JJZA 2JXMB 5A35A 1LTSD 5CGKA 2F3VA 1S5FD 1F2ZA 1PFNA 1DYQA 1EWCA 3RZDB 2IW3A 3KBXA 2F0QA 4H7BA 4F87A 2PNRC 3VR6A 3FDTA 4PMCA 4ME5A 4ILWA 4IFDH 2N55A 1KLUD 1V1PB 1CM9A 1D5XC 2HDLA 4CHTB 5I2YA 3NXWA 3HOZB 2LMCB 3DUZA 3A56A 2E2IB 3OSOA 3EFXD 3I8ZA 1KDBA 2C5CA 1TS5A 3BYYB 3T13A 3PIO3 5KYLA 2Q8RE 3SK8A 1O78A 1X32A 2TMPA 5KNDA 5JEAG 4X3KA 1WTOA 1B4OA 2ID0A 1FYCA 4IALA 3EROA 2ICIA 1AZPA 3SEBA 4H0LC 4WORA 3GTLB 4ZRZA 1F77A 3PIP3 1SNCA 5C0XI 2ZT9C 1FD7D 1VDZA 5EKIA 1IKLA 1STEA 3VYTA 4Q0FA 4KKTA 1UUPA 2B63B 5HGTA 1XYIA 4C1NK 5KYIA 4KY5A 1IW7C 3GTGB 2SEBD 1EYAA 2IPKD 1MSGA 1GOZA 3K59A 4WFN3 2B2UC 2JYOA 1S4ZA 5IODA 1BR9A 1HXYD 1RDPD 1Y69U 4QCLA 3ND9A 1PTOH 3S1QB 3D4WA 2B2WC 1GUSA 5E1FA 2M9VA 4CKEA 1EY4A 2EDGA 4XYOA 3OW7A 1WTXA 1MSHA 1H9SB 1D2BA 4RKBA 1A15A 2PW7A 4DU9A 2MJ8A 3J81E 2F0IA 2B2TC 2A6EC 2A69C 4HR7B 1MGSA 4DNTB 1KDAA 4UDUC 4EQPA 4IUNA 1TR5A 3PMFA 2B2UA 3VYSA 1RCVD 1WTVA 3VR3A 3I73A 4BA2I 2R93B 3HP3A 5CORA 5C6AA 1L0XB 2A6HD 2R61A 1JICA 5IT9E 2BCOA 2AQ3B 3J7YW 2A68D 2A68C 3GQBA 1I4XA 1LTBD 4LAAA 4DAPA 1F2MA 2D5DA 1SJED 2M00A 2JSOA 1QNKA 4J1MA 1Z47A 4CGYB 2B2TA 3OOCA 2HCCA 3TN2A 5JVG3 1HCZA 3A8JE 1LTTD 5FOBB 1ILQA 2EXZA 2JEAI 1WD0A 4RGOS 2RA4A 1KNAA 1XWEA 1TS2A 3M7GA 4ZAIA 5EKKA 3GTKB 5M5XB 1WTPA 3OMGA 3QB3A 4JK1C 4XT1B 1PRTC 1G2SA 2A74C 2XRQD 2F0PA 2K32A 2A6ED 4NW2A 4QUCA 2BDOA 1BF4A 5C4XB 4K5XA 5IOCA 4RHSA 1SNQA 3O13A 4K5WA 3PUZA 2EJFC 2L1BA 3OPOA 2XNAC 1VCIA 3NTIA 2NVQB 3K0YA 1FR3A 4LJZC 2F0FA 2CVRA 4RFBA 4B9XA 3NUCA 2D2CC 1PMRA 1CTMA 2NN6I 3GTPB 5D3IB 1X3PA 5KRUA 3JAML 2EYMA 1KABA 3NQTA 3GTOB 5K36G 4TRDA 1Y1VB 3A54A 3ND8A 3VR5A 3HEJA 3DWQA 5DM73 2BDNA 2F0KA 2JA8B 2FHTA 1HFGA 4XTCS 3QO2A 1VMCA 2I07B 5IGDA 4A3KB 2ZXPA 2MPMA 4A93B 4HTHA 4KD4A 5G3LD 2IWHA 5JPMC 1QILA 4MHEA 1NUCA 5A2QE 4K2LA 5NUCA 1GUTA 1H9KA 1OXUA 1A3UA 2R3ZA 2DY8A 1OXXK 4CJ0B 2KUMA 4RWSC 2ICEC 4OHJA 4BWGB 2N88A 4C3HB 3A7AB 1LV9A 4FXDA 3SVMA 1HFNA 5KNBA 5DEHA 5C5MA 3KBGA 1HUMA 1G2TA 4FO2A 1EYCA 1VF7A 2PZUA 1AZQA 2X6LA 2K6AA 4C3HG 3D4DA 1EU3A 4QF4A 2K03A 2NTSA 4KMUC 2EPBA 2F3WA 2FINB 3C2PA 1FGBD 1RTNA 2XWJB 1ENCA 1CHPD 2IT1A 4OL7A 5FO8B 3W2DA 5LL6S 2RBMA 1PRTB 2X6GA 1Q3LA 1SNMA 3FKIB 2F0TA 5M9OA 1KTKA 1ZYRC 1T5EA 1CZWA 3MHBA 4KHVA 5IGBA 4NP5A 3ZYYX 3MVVA 4G7HC 2M2LA 1GUWA 1F2YA 4OO1I 1UEAB 1TIID 1QCBD 3K5MA 1SYEA 4KKUA 3S2DB 2KECA 2F0VA 1V8QA 4XT3B 3DEPA 5J39A 1PRTF 1TS3A 3QIAA 3T53B 1V43A 5M5YB 3V05A 2O5IC 3TSSA 1DM0B 1PZJD 4CJ1B 3GO5A 1JC7A 4BY7B 4MIUA 2RDFA 1RHPA 2NWGA 1KDCA 1AFPA 3DEOA 4ZK9B 4L63B 1DOLA 1TWGB 1CK1A 3TMEA 1XXGA 3CRKC 1IYUA 5BN4A 1E2ZA 4FP5D 1T5XD 3KLRA 1XTCD 2AUJD 4ID6A 4IQZA 4X3UA 4I7ZC 1BBXC 1PYWD 3M85A 3M7NA 5EBDA 3OHXC 3Q23A 3J80E 2AWNA 4WJWA 4HAEA 5EGTA 4PMBA 2NN6H 4RGTA 1SDFA 3L9AX 3CRLC 3T4AC 4NMZA 2A69D 5C3EB 4C56C 1QE6A 3KLSA 4KN7C 2PQEA 1I4GA 4CBVA 2IX1A 3BVGA 2RDGA 3SK6A 1DZ1A 1S5DD 5C4HA 4X3TA 3HKZB 1U4LA 5ISRA 1B3AA 4K5VA 1EL0A 3I4MB 2Z1CA 2F0DA 3N6RA 4TQUS 3VR2A 1CA6A 1SEBD 3K7AB 2EY5A 3D6CA 2ENBA 1BDOA 1I4HA 1E2VA 2VUMB 1F9QA 3AU7A 1AP0A 1AN8A 1EYDA 4K6DA 1RODA 3C46A 4FF4A 2L9HA 4Y7NB 1KNEA 3S15B 2HQEA 4G57A 4DAYA 1ML0D 1DXMA 3RUZA 2KOLA 1NR2A 3H91A 2K5DA 3RMHA 3I4NB 1NAPA 5T1GA 2F0GA 4RAUC 3K57A 1U4RA 1X3QA 2PZWA 3G7LA 1JOQA 4RKLA 3I4LA 3AB9A 5J22A 2HUGA 2XRSD 3URYA 3KF8A 1CA5A 3S17B 5FKAC 2OEOA 3X3MA 1LT3D 4BS9A 3H94A 3GV3A 4CKBA 2IJ0A 2KEDA 1GHJA 1S5CD 1BUVT 2O2LD 2EOTA 5CV4A 4ZKCB 3T56B 1HPCA 1Y8PB 4KHZA 2A6HC 1VMPA 4V0BA 1EY8A 2IX3A 2EZVA 4QIWB 2DNCA 1ICWA 5TSSA 1A3VA 3VA5A 4DA2A 5E3FA 1K8MA 3GD7A 3PUWA 3TP5A 1C48A 3MC0B 2H1EA 5C0XH 1JB3A 4HCSA 2NN6G 2NB0A 4QUFA 1IKMA 3DWPA 1JCKB 1EFID 4L8JA 3LWUA 1STAA 2NZ1D 3I91A 3UI2A 3DWAA 3MEHA 4FF3A 1W6KA 2B2WA 1JOOA 1V1PA 3BG3A 3E5SA 4RCNA 1WTRA 1SFOB 4A3IB 4R8NA 2E74C 3U9OA 2HDMA 1GUOA 3MAQA 3F2UA 4FF1A 1HQMC 2VB2X 5EPLA 2MP1A 1ENFA 3NHHA 3NQIA 1STGA 1ZYRD 2PPBC 2RSNA 4IUVA 1RJTA 5KNCA 2SNSA 3TDQA 5C0XG 1BO0A 5CBEE 3Q6SA 3VA7A 4BBRB 1Y8NB 2K33A 2G9HD 1SE2A 2Q8IB 1DD2A 1G91A 1PXUA 2LKVA 3H6MA 1IYVA 1G6ZA 3R2TA 1LTAD 3K58A 1PTOF 4A3MB 3PUYA 4ZYSA 2CW0C 4ZQ3A 2O4XA 1TWFB 1STYA 3HOYB 4IFDJ 1SNPA 2OF1A 5EJWA 1Q90A 3QJYA 1D1KA 2PMZB 4F88A 1OXSC 1EY6A 3WOFA 2JE6I 3A8KE 4HEDA 4DAVA 1BNZA 1GUNA 3C1EA 1JOKA 5IGGA 2TSSA 1PZID 1STHA 1HQRD 2WIIB 1ESFA 1F9RA 2E2HB 4H13C 2QF7A 2RQXA 4OIJA 3A8IE 2JEBI 2KA7A 1UAPA 1Z7TA 1JWUD 3ERQA 1E2WA 2ZXRA 3FPUB 2WP8J 1JE4A 2K5QA 1SSOA 4KY7A 5DM63 1B53A 1TWCB 4F8MA 1CQVA 3HS0C 3IKJA 3H09A 1HUNA 4EQOA 3GTMB 4ZUIA 3NWTA 1M8AA 2MHVA 1H9RA 2F0EA 3MXPA 4PQXA 4EQNA 4C2MB 1EY9A 2OXPA 4ODGA 3NBIA 1HA6A 4IURA 5CV5A 5ELBA 3HOVB 5IGEA 1V1OA 5BN3A 5FK9C 5DAUA 3DMUA 4DNRB 1EEID 1SAPA 1EWHA 1PDQA 1CFMA 3WOEA 2GA4B 1YNND 3OIQA 1I4RA 4R8IA 4K14A 1IL8A 5CV8A 2JA5B 1QG7A 2EE1A 2EJMA 1EY5A 3S16B 5JVH3 1NSNS 1JWSD 1Q12A 2LY7A 3MFYA 2Z8LA 2K01A 3QG1A 2R6GA 1WCMB 1D5ZC 1Q1EA 1ET9A 2XN9C 1SNOA 1OXTA 1Z6HA 1SJHD 5G3LF 1B44D 1EY7A 3D8GA 4K6LA 4E6IA 1I50B 4O42A 2NTTA 4RA8A 4XXEA 2QEJC 3NPPA 4XQQA 2PCFB 4EVOA 5J1ZA 5LL6X 1R4PB 1K8OA 3T16A 5I6YA 1KAAA 1QWYA 1U4MA 4DXGA 3M4OB 2ZXOA 5CBAE 4P2CB 3PO3B 1LTRD 1C8CA 2PW5A 3GTJB 1F9SA 5D14A 2NYZD 5CV6A 3R8BA 2CHBD 1I4PA 1LLRD 2QDBA 3QOJA 5E4WC 3BYTB 1BCPF 1DCZA 4KI0A 2G9DA 1IHZA 2B39A 1O80A 1BXTA 5C3XA 2QILA 3R3OA 4IUPA 4G4KA 5I2XA 1HHVA 4HMJA 3S1RB 1EZ6A 2KHSA 2K1BA 4TKOB 4RGMA 5E4XA 2F1MA 3S1MB 1STNA 3D31A 4V190 1TY2A 5C0XJ 4IZ8A 2SOBA 4FXKC 2L4NA 2Z4IA 5M3FB 1I6VC 4IFDI 1Y8OB 2F0WA 3TZDA 3K5LA 3HOWB 2EVBA 2PZTA 4C3JB 3RLFA 1SYCA 3BVMA 4R9WA 2F4IA 2B2VC 2IX0A 5CV9A 3GV6A 3GP7A 1G8ZD 1MD2D 3DM1A 2WAQB 2XVSA 1EOTA 2PO4A 4IUUA 3R2IA 3Q22A 3LWEA 2E2JB 3BDCA 2LFNA 4NDXA 4IFDG 1O7YA 4BY1B 1ZXTA 1DOKA 2FMMA 2BOSA 4YIJA 2A73B 3Q24A 2EYPA 2KCNA 4KKSA 3LX0A 2RSOA 4C3JG 1ILPA 1AW7A 1JWMD 2KJXA 1SNDA 5ELCA 3TP6A 1SYFA 4K8IA 5C4JB 1EZ8A 3S9WA 3H3VC 2K7VA 1G291 3S2HB 3IFTA 1SMYD 3E0JA 3G6JB 4XYQA 2AWOA 1HTLD 5I4DA 1B9NA 2B8GA 2OT2A 1RF2D 5C3WA 2C9OA 4S3SA 5M3MB 5M5WB 5HURA 1BCPC 3NBHA 3PUXA 2K28A 1J8IA 4BA1I 3LNNA 1AEXA 4RHRA 3CQZB 1I4QA 1I3QB 2SNMA 5KIXA 1GUGA 2EYLA 3ONAB 4ABNA 4DXFA 3NTHA 1U4PA 4BBSB 2AQ1B 2QKIC 1M4VA 4MN3A 3KLSX 2L11A 4K2KA 2NVXB 1TVXA 1EQVA 2NUCA 1GHKA 3BDOA 2EYHA 1SMYC 2EY2A 2B2YC 1B50A 1PFMA 5JEAJ 2F0UA 5COYA 2FJ2A 4KN4C 3C3LA 4KJOA 1HA5A 2J0TD 5C4ZA 4K8JA 2D9UA 2V4DA 5T1IA 3I72A 4A3GB 4IN3A 1LT6D 3S14B 3MXGA 2QCPX 2WKDA 2A5HA 1NCVA 2XIWA 3H0GB 4TSSA 4OIKA 1NR4A 1FNVA 5K5PA 1UNSA 5BN5A 2Z4HA 3CHBD 5FLXL 3I70A 1U9RA 4G7ZC 3PO2B 1KLGD 3K5OA 4M1UB 1H9MA 4XQNA 2CQAA 5ELEA 2BA0A 5EBCA 2L55A 2Q8TA 3X3NA 4FNFA 3MZ5A 5C5LA 1JORA 1IW7D 4PV1C 2F03A 1WTWA 3MXUA 3A7LA 1SBBB 5IGFA 4FVMA 5I9OA 4HCEA 1BCPB 4QMGA 4KD3A 1CQFA 2DNEA 4Q5VA 2R7ZB 1EU4A 2X69A 1J9OA 2MGSA 3CU7A 5CC4A 1C4QA 1LT4D 2NVYB 2EYOA 4HSVA 1TWHB 4A3FB 1H9SA 3HRZC 1GXDC 2CW0D 1RKNA 3V2TA 3BS1A 1K83B 3K5NA 4DGZA 3K6OA 2EJGC 3D4RA 1TT2A 1YNNC 3NK9A 1TY0A 5ELDA 5EPJA 3J7AF 3D3RA 3ITPA 2VXWA 4RCOA 3P20A 3AMUA 2JA7B 3M4YA 4PNYA 4XQJA 1W6JA 4A3EB 2EY1A 3R93A 1PTOC 2FMCA 1DJRD 2WINB 1SYGA 2F0SA 4O1NA 1E0BA 1HRJA 2PYKA 4N9PA 4FF2A 2E2DC 1B9MA 3SXHA 3J81L 3PV0A 2FFKB 5F2DA 3FMCA 2F0HA 1ENAA 1CT1D 4B08A 3MA2B 2VNUD 1CZGA 4B9WA 2Y0SB 3IAYA 1JR0D 2B8FA 4DFAA 3EA6A 3MXNA 1ZKOA 5JEAH 1MI2A 3SK5A 4M8AA 4CJ2C 2H4OA 3TP7A 5I9PA 4UAIA 4XIGS 3M3YB 1S5ED 1STBA 3OMCA 2L5TA 1LTID 3QWNA 4KY6A 4PMWA 1O7ZA 3SDZA 4DF7A 2KCCA 3HG9A 2MUYA 5JPNC 4C3IB 2BE5D 5LHY1 5FO7B 1PTOD 3OIPA 3RD4A 5C44B 3W3AA 4A3BB 3NWSA 3L3OC 3EVQA 1ZEQX 1R4QB 3EQLC 5EKLA 2F0NA 3TP8A 2L0CA 5JAVA 4ZKBB 1S5BD 3L7ZC 4U68A 2B2YA 1BQQT 1LACA 1FNWA 1ESRA 2IL8A 1EIHA 4LMQD 5FLXE 2RDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VA5 A;  1TQO A;  5HGT A;  4ZQ3 A;  5C3X A;  2EY1 A;  5HUR A;  3R3O A;  2EY5 A;  4MIU A;  3D6C A;  1KDB A;  5E3F A;  2ENB A;  4HMI A;  4K5X A;  3T13 A;  2RDF A;  5IOC A;  2O4X A;  3TP5 A;  5KYL A;  1SYG A;  1AEX A;  1KDA A;  2F0S A;  4QB4 A;  4EQP A;  1SYD A;  1KDC A;  1TR5 A;  4HMJ A;  4IUN A;  3SK8 A;  1STY A;  1EZ6 A;  4J6H A;  1SNP A;  2KHS A;  1SNQ A;  2OF1 A;  2PYK A;  3PMF A;  4N9P A;  1EYD A;  2SNM A;  1SYB A;  4K5W A;  4K6D A;  5KIX A;  5CR3 A;  5DEH A;  1STN A;  3SXH A;  2EYL A;  5C5M A;  5CV7 A;  4K14 A;  5F2D A;  4IAL A;  3ERO A;  5CV8 A;  4IZ8 A;  2SOB A;  3QOL A;  1EYC A;  2PZU A;  3MZ5 A;  3TME A;  5C5L A;  2F0H A;  1JOR A;  3OWF A;  5C6A A;  5I6W A;  1EY5 A;  2F0W A;  1ENA A;  4KJN A;  4WOR A;  1EY6 A;  1STA A;  2PZT A;  2HQE A;  1NSN S;  4F7X A;  4G57 A;  4B9W A;  3MEH A;  5JOB A;  3RUZ A;  1SNC A;  3BDL A;  2EYF A;  2WAC A;  3D4D A;  3SK4 A;  4QF4 A;  4DFA A;  3C1E A;  5I9O A;  1JOK A;  5IGF A;  1SYC A;  2F0L A;  5IGG A;  5KGU A;  2EYJ A;  4ID6 A;  4QMG A;  1JOO A;  1A2U A;  1STH A;  3P1H A;  2F0F A;  4KD3 A;  4K2K A;  4LAA A;  2F0M A;  5CV9 A;  4B9X A;  3NUC A;  1II3 A;  3SK5 A;  1F2M A;  5IGC A;  1EQV A;  2F0G A;  2M00 A;  3E5S A;  3EJI A;  5KYI A;  2F3W A;  3TP7 A;  1SNO A;  5I9P A;  5EGT A;  2NUC A;  3SHL A;  1A3T A;  1STB A;  4R8N A;  5KRU A;  4KY5 A;  3OMC A;  2EYH A;  4PMB A;  2RKS A;  5CC4 A;  2EY2 A;  2PZW A;  3U9O A;  2EYM A;  4J1M A;  1EY0 A;  4KY6 A;  1EYA A;  1ENC A;  4OL7 A;  4RKL A;  1KAB A;  4WRD A;  1JOQ A;  3NQT A;  2RBM A;  5KEE A;  4DF7 A;  3BDC A;  1SNM A;  1EY7 A;  2F0U A;  4TRD A;  4NDX A;  3D8G A;  2F0T A;  3ERQ A;  4E6I A;  2EYO A;  5M9O A;  3NHH A;  4NMZ A;  5CGK A;  3HEJ A;  5J22 A;  2KQ3 A;  1STG A;  2EY6 A;  2F3V A;  4I65 A;  4YIJ A;  1RKN A;  4KJO A;  4KY7 A;  3V2T A;  5IOD A;  2F0K A;  2EXZ A;  3MHB A;  1A2T A;  1F2Z A;  4KHV A;  5IGB A;  2OEO A;  4NP5 A;  4EVO A;  5J1Z A;  2EYP A;  2SNS A;  3MVV A;  5C4Z A;  4K8J A;  3HZX A;  3T16 A;  4DGZ A;  5I6Y A;  1KAA A;  3LX0 A;  2PQE A;  4KTA A;  2F0Q A;  1F2Y A;  4H7B A;  3EVQ A;  5IGD A;  4F8M A;  4N9T A;  5EKL A;  3D4W A;  1TT2 A;  5IIF A;  3NK9 A;  1SND A;  3TP6 A;  1SYE A;  2PW5 A;  4PMC A;  3P75 A;  1SYF A;  4HTH A;  4ME5 A;  5CV4 A;  4K8I A;  3SR1 A;  4EQO A;  2F0N A;  1EZ8 A;  5EKK A;  3SK6 A;  5E1F A;  5DAU A;  4KD4 A;  3TP8 A;  3S9W A;  3OMG A;  5C4H A;  4ZUI A;  3QB3 A;  4ZUJ A;  1EY4 A;  2F0V A;  3C1F A;  3NP8 A;  5CV6 A;  1IHZ A;  5JAV A;  1NUC A;  3ITP A;  2F0E A;  2LKV A;  3H6M A;  5ISR A;  3MXP A;  1EY8 A;  4K5V A;  4EQN A;  1EY9 A;  2F0J A;  2QDB A;  4RKB A;  2OXP A;  2F0O A;  2PW7 A;  3NXW A;  3QOJ A;  4NKL A;  4DU9 A;  2F0P A;  4KV6 A;  4K2L A;  5NUC A;  4ODG A;  5J39 A;  5CV5 A;  2F0D A;  2F0I A;  5K5P A;  5C3W A;  5IGE A;  3DHQ A;  4S3S A;  4PNY A;  1A3V A;  1A3U A;  3OSO A;  1U9R A;  3DMU A; 
#chains in the Genus database with same CATH topology
 1F2L A;  3S2D H;  1TQO A;  2NVT B;  5D65 A;  1Q82 C;  4B3S L;  2HQL A;  1N32 L;  1U5K A;  1HZC A;  1SYD A;  3T51 B;  2HIV A;  1E1O A;  1QZG A;  1A6X A;  4DV1 Q;  2B2V A;  3FPP A;  4YCU A;  4J8Q A;  1XX8 A;  4R4Q A;  3QOL A;  2DN8 A;  2D62 A;  2WKC A;  3OWF A;  2F4V Q;  3D6W A;  2VB3 X;  2BE5 C;  3TZU A;  3H0G G;  3BVZ A;  1ONL A;  2ZTE A;  1CHQ D;  3CF5 A;  1LM0 A;  1PTO B;  3GTQ B;  4GLX A;  2Y0S E;  2EYJ A;  4A3J B;  3WDN A;  1A2U A;  4A3D H;  1LAB A;  1RTO A;  3AYH B;  3P1H A;  1II3 A;  3DXJ C;  2RHS B;  4DKA C;  3I3C A;  1QNU A;  3PUV A;  3V96 A;  3E6Z X;  3RZO B;  1X3E A;  4OO1 H;  2RKS A;  1Q8I A;  4JV5 L;  2HCI A;  1H9J A;  3MTS A;  3MFG A;  4AYB B;  5AJ3 L;  2OQK A;  3BJU A;  5D3D A;  2UXB L;  1EQQ A;  4FXG C;  4JI0 L;  1BVS A;  3JAM i;  2EY6 A;  1IXR A;  4DV1 L;  5EPK A;  1MBY A;  4HSP A;  2JA6 B;  4G7O C;  1SLJ A;  4DPG A;  1HZA A;  3JAM E;  2XSC A;  4LF5 Q;  2HT1 A;  1UWV A;  5IYC G;  4DR4 L;  3P75 A;  4HIK A;  3BZC A;  3FRP B;  3SR1 A;  3W5O A;  3U9S A;  2XTI A;  4HN7 A;  1YEZ A;  3IFD A;  4ZUJ A;  2DJG C;  4LK1 C;  3BZD B;  1GJX A;  1JT8 A;  2F0J A;  2F0O A;  4NKL A;  1EQT A;  4KV6 A;  1F9P A;  2J7Z A;  3I90 A;  3DHQ A;  1CKN A;  2F3I A;  1PH6 A;  2I46 A;  1WVL A;  3F2C A;  3P7J A;  3K8A A;  3VYU A;  2KVM A;  4GZY C;  4B3T Q;  1B2T A;  4CKC A;  1TU2 B;  5LMN Q;  4BBR G;  1M90 C;  2K5W A;  1TS4 A;  4OO1 G;  3VR4 A;  1E24 A;  1D5M C;  5C4X G;  4QB4 A;  1XMO L;  4RH6 A;  1SE3 A;  1OXV A;  4J6H A;  3E9I A;  1HTP A;  2I0Q A;  1Y1W B;  2N3S A;  3KK7 A;  1EYG A;  5CR3 A;  3CCR A;  1D1I A;  5CV7 A;  1LO5 D;  1I6H B;  5GAE C;  2NBF A;  3AFQ A;  1VF5 C;  4OON A;  1PRT D;  4LF5 L;  5AFW A;  4JBW A;  3NE5 B;  2VL6 A;  3HOU B;  4F7X A;  2Q2U A;  4JI1 Q;  2IHE A;  4DK0 A;  4Y52 H;  3J7Z C;  1JQY D;  3CKI B;  4KK7 A;  1C0A A;  1RD9 D;  2HHH L;  4ULL A;  2WAC A;  1CKO A;  3SK4 A;  2E76 C;  5KGU A;  1LTG D;  2KCT A;  2F0L A;  2H5X A;  3CCE A;  2YU9 B;  4C3I G;  5IGC A;  3OTO Q;  3HOZ G;  2JP1 A;  3EJI A;  3SE0 A;  4A93 G;  1PLF A;  3HKS A;  1HR0 W;  1B1Z A;  1SFO H;  1VS0 A;  1CI3 M;  2K05 A;  4OGQ C;  3SHL A;  1A3T A;  3IRB A;  3FVQ A;  4HJ5 A;  3J7A V;  1ASZ A;  4XDX A;  2OCE A;  4IUQ A;  5KEE A;  1QB5 D;  2JA9 A;  4U67 3;  2OWO A;  1VQO A;  4A3D B;  2DY7 A;  4LUZ A;  2KQ3 A;  3CC4 A;  4BXX H;  2NZO A;  2XWB B;  1PHJ A;  4I65 A;  1DON A;  2WB1 B;  4LF4 Q;  1A2T A;  1BCP D;  3Q0A A;  2K04 A;  4H44 C;  3HZX A;  1GM5 A;  4KTA A;  1EEF D;  1ET6 A;  3OWE B;  2SDF A;  2WV6 D;  4DK1 A;  2K14 A;  3S1N B;  5CYU A;  4N9T A;  2LS0 1;  1TWA B;  5IIF A;  1WTQ A;  2E2J H;  4DNI A;  1YNJ D;  3OYY A;  1LT5 D;  4DR6 Q;  1TKW B;  1QJO A;  4LWC A;  2E75 C;  3HGB A;  2RVL A;  3C1F A;  3NP8 A;  5IYB G;  1J6Q A;  1L0Y B;  2UU9 L;  1PFB A;  4RGN A;  5A2Q L;  5K36 H;  3HOX B;  1QOH A;  4YY3 Q;  3IL8 A;  2R92 B;  2O5J C;  1SXT A;  4JYA L;  2RHQ B;  1R9T B;  5CMD A;  1FNU A;  2YYZ A;  2KEE A;  1YIT A;  4HMI A;  5EQ0 A;  3NTK A;  1TWF H;  1PYB A;  4BXX G;  3KUP A;  1V9P A;  3A55 A;  4FYD A;  1L1O A;  1SE4 A;  4C1N I;  4Z9C B;  5ELF A;  1SYB A;  3CP0 A;  3J80 L;  3CC2 A;  4UP9 A;  3W1G A;  4DV4 Q;  3N52 A;  4QL5 A;  4UP8 A;  3GTM H;  2J4X A;  3TBI B;  4YWM A;  1BOS A;  2ZM6 Q;  1NJI C;  1EIG A;  5I6W A;  2PI2 A;  1D6E C;  2L12 A;  1DOM A;  3NSW A;  4KJN A;  3PIO A;  3TQY A;  3MWY W;  5IT9 L;  5JOB A;  3SGI A;  3BDL A;  2EYF A;  4GLA C;  1Q1B A;  4DR3 Q;  4IPH A;  1N34 Q;  3VYR A;  4DN4 M;  1WD1 A;  2F0M A;  4IUT A;  4ZLT F;  1YNJ C;  2AUK A;  5FO9 B;  4JI7 Q;  1EWI A;  1OO9 B;  2BA1 A;  2UXC Q;  1PZK D;  1O7L A;  3E0E A;  5DNF A;  1QZH A;  4A3J G;  4A3B H;  4R4O A;  5IP9 G;  4WRD A;  4L6T B;  1EY0 A;  4L5S A;  2AQ2 B;  3FEW X;  3UDF A;  4EGV A;  4X3S A;  3I56 A;  2BH2 A;  5JJZ A;  3ICE A;  2JXM B;  1LTS D;  3K80 C;  5A35 A;  4LFB L;  5CGK A;  2F3V A;  2CKZ B;  1S5F D;  1HNZ Q;  1EIF A;  4LF7 Q;  1F2Z A;  1PFN A;  3CCM A;  3CQZ H;  1DYQ A;  1EWC A;  3RZD B;  1WOC A;  4JI4 L;  2IW3 A;  3KBX A;  3KJP A;  2F0Q A;  4H7B A;  4F87 A;  2PNR C;  4DR2 Q;  3KDF B;  3VR6 A;  3FDT A;  4PMC A;  4ME5 A;  3J81 i;  3U50 C;  4ILW A;  4IFD H;  4NB3 A;  2N55 A;  1KLU D;  1V1P B;  1CM9 A;  1D5X C;  2HDL A;  4CHT B;  3KLW A;  2K5V A;  4IPG A;  1N33 Q;  5I2Y A;  5C3E G;  5GAG C;  3NXW A;  3HOZ B;  2LMC B;  4GKJ Q;  3I4M G;  2Q2I A;  1R9T H;  4DAY B;  3S1N H;  4JVZ A;  4CDF C;  3DUZ A;  3D0F A;  1K9M C;  3A56 A;  3H15 A;  2E2I B;  3OSO A;  4OX9 Q;  3EFX D;  3I8Z A;  1KDB A;  2C5C A;  1TS5 A;  3BYY B;  2JN4 A;  3T13 A;  3PIO 3;  5KYL A;  2Q8R E;  3SK8 A;  1O78 A;  1X32 A;  2TMP A;  5KND A;  1HR0 L;  5JEA G;  4X3K A;  3PO3 H;  1WTO A;  1B4O A;  1BBW A;  2ID0 A;  3Q8D A;  1FYC A;  4IAL A;  3ERO A;  4X64 Q;  2ICI A;  1AZP A;  1XMQ L;  1I5F A;  1PH1 A;  3SEB A;  4H0L C;  4WOR A;  2YV5 A;  3GTL B;  4ZRZ A;  1F77 A;  1K83 H;  3PIP 3;  1SNC A;  1I3Q H;  5C0X I;  2ZT9 C;  4MTK A;  1FD7 D;  1VDZ A;  5EKI A;  1IKL A;  1STE A;  3VYT A;  4Q0F A;  4KKT A;  1UUP A;  1D7Q A;  2B63 B;  5LMN W;  5HGT A;  5FLM G;  1JE5 A;  1ASY A;  2NVT H;  1XYI A;  4C1N K;  5KYI A;  3RLN A;  4PG3 A;  4KY5 A;  1IW7 C;  3GTG B;  2SEB D;  2L15 A;  1EYA A;  2IPK D;  4JI2 Q;  3J81 j;  1MSG A;  1GOZ A;  1HZB A;  2UU9 Q;  3K59 A;  4WFN 3;  2B2U C;  3KJO A;  2IHF A;  1HR0 Q;  3U4Z A;  2JYO A;  1S4Z A;  1CKN B;  5IOD A;  1BR9 A;  4L5Q A;  3M4Q A;  1HXY D;  1RDP D;  1Y69 U;  4QCL A;  3ND9 A;  4CDE C;  1PTO H;  3S1Q B;  3D4W A;  1GO3 E;  2B2W C;  1GUS A;  3PF4 A;  5E1F A;  2M9V A;  4DR5 L;  4CKE A;  4WJ3 M;  1EY4 A;  2EDG A;  4XYO A;  3OW7 A;  5C4J H;  1WTX A;  1MSH A;  4LFC L;  4LFA L;  1H9S B;  1D2B A;  2GN5 A;  4B3S Q;  5HGQ A;  4RKB A;  1A15 A;  2PW7 A;  4DU9 A;  2MJ8 A;  2UUC L;  1N32 Q;  3J81 c;  3J81 E;  3I4N G;  2UUA Q;  2F0I A;  2B2T C;  2A6E C;  1MKH A;  1YHB A;  2A69 C;  3TEH B;  3CD6 A;  3T1H L;  3H0G H;  4HR7 B;  1MGS A;  4DNT B;  1KDA A;  4UDU C;  4AQY Q;  1VQP A;  2CWA A;  2B3G A;  4EQP A;  4NXN L;  1L2F A;  4IUN A;  1TR5 A;  2ES2 A;  4K0K L;  3FKI H;  1E3P A;  2UXC L;  3PMF A;  4OEM B;  4GN5 A;  2CWP A;  4RG1 A;  2B2U A;  2N78 A;  1YIJ A;  2R7F A;  1I50 H;  3VYS A;  1RCV D;  4JI1 L;  1WTV A;  3VR3 A;  3I73 A;  4BA2 I;  4R1J A;  2R93 B;  3HP3 A;  5COR A;  5C6A A;  1L0X B;  2Z9H A;  2N49 A;  2A6H D;  2R61 A;  1JIC A;  1UE1 A;  5IT9 E;  4JW0 A;  4LUV A;  1RIP A;  2BCO A;  3NEN A;  2AQ3 B;  3J7Y W;  4IJL A;  2A68 D;  2VY3 A;  2A68 C;  1QUQ B;  3GQB A;  4LFA Q;  4LFC Q;  1I4X A;  1LTB D;  3WWV A;  4KHP L;  4LAA A;  4DAP A;  1F2M A;  2D5D A;  4GOP B;  1SJE D;  2M00 A;  2YU9 H;  2JSO A;  4JI3 L;  3ULP A;  4JI0 Q;  1QNK A;  3BZK A;  2R93 G;  4X65 Q;  4J1M A;  1YNX A;  1K0R A;  1Z47 A;  1L1O C;  4CGY B;  2B2T A;  3OOC A;  2VQE Q;  5C3E H;  2HCC A;  3TN2 A;  5JVG 3;  1HCZ A;  3A8J E;  4OXP A;  1LTT D;  4GKJ L;  2HIX A;  2ZJQ A;  5FOB B;  1VQJ A;  1ILQ A;  2EXZ A;  2JEA I;  1WD0 A;  1PFS A;  4RGO S;  1PH4 A;  2RA4 A;  3KF8 B;  3RN5 A;  3DM3 A;  4ALP A;  1KNA A;  1IBM Q;  1XWE A;  1TS2 A;  3M7G A;  4MTN A;  3HOW G;  4ZAI A;  5EKK A;  3GTK B;  5M5X B;  1PH5 A;  1WTP A;  1X55 A;  3OMG A;  4C3H H;  3QB3 A;  2VW9 A;  4JK1 C;  4XT1 B;  1PRT C;  1CUK A;  3L0O A;  3ULJ A;  1G2S A;  4DV3 Q;  1WFQ A;  2A74 C;  4O0A A;  3CCV A;  3T1Y Q;  2XRQ D;  2F0P A;  1E22 A;  3M4O H;  2N8N A;  3AFP A;  2B63 H;  2K32 A;  4A3J H;  4A3B G;  4DV6 Q;  3GTQ H;  4UY8 C;  2A6E D;  4NW2 A;  4YCW A;  4QUC A;  1EOV A;  2BDO A;  1BF4 A;  5C4X B;  4JG2 A;  4K5X A;  1PVO A;  5IOC A;  4DV7 Q;  4RHS A;  4DV4 L;  1SNQ A;  3O13 A;  4K5W A;  2JA8 G;  4HJ8 A;  3PUZ A;  2EJF C;  2L1B A;  3OPO A;  2XNA C;  1XNR Q;  4QQB X;  5IWA L;  3CC7 A;  1VCI A;  3NTI A;  2NVQ B;  1A63 A;  1NY4 A;  4GNX B;  3K0Y A;  1FR3 A;  3K81 C;  1K8A C;  4LF9 Q;  1L0W A;  4LJZ C;  4X6A H;  2F0F A;  2CVR A;  2KEN A;  4RFB A;  4B9X A;  3NUC A;  2D2C C;  3PO2 H;  1PMR A;  1CTM A;  2NN6 I;  3GTP B;  5D3I B;  4B3M L;  1SR3 A;  1YJ9 A;  1X3P A;  1X3G A;  5KRU A;  5FLX c;  1C9O A;  3JAM L;  3UDX A;  2EYM A;  5M3M G;  2QW7 A;  1DGS A;  1KAB A;  3NQT A;  3CAM A;  3GTO B;  5K36 G;  2FXQ A;  4TRD A;  1VQ8 A;  1Y1V B;  3A54 A;  3ND8 A;  1KRS A;  3VR5 A;  3HEJ A;  3DWQ A;  1Q81 C;  4HJ9 A;  5DM7 3;  2BDN A;  2F0K A;  4AIM A;  2JA8 B;  4L5R C;  2FHT A;  4A3L H;  4QGU A;  1VQM A;  3PGZ A;  4DR2 L;  1HFG A;  1BKB A;  4XTC S;  3QO2 A;  1VMC A;  2I07 B;  5IGD A;  4A3K B;  1HNW Q;  2ZXP A;  1QVF A;  1VQI A;  4B3R Q;  1XNQ Q;  2MPM A;  3KYH C;  3J80 i;  4A93 B;  4HTH A;  4YCV A;  1M1K C;  4LF9 L;  2XGT A;  1HJP A;  4KD4 A;  4JYA Q;  5G3L D;  4K0K Q;  4WJ4 A;  2IWH A;  5JPM C;  3UDG A;  1QIL A;  4MHE A;  1NUC A;  5A2Q E;  2VQF Q;  4IO9 A;  1HNX L;  2R7Z G;  4K2L A;  5NUC A;  1GUT A;  1X54 A;  2RF4 A;  2R92 H;  1H9K A;  4QIW E;  1OXU A;  5IP7 G;  1A3U A;  2R3Z A;  2DY8 A;  3L2P A;  2NVX H;  1OXX K;  1H95 A;  4CJ0 B;  2KUM A;  4RWS C;  2ICE C;  4OHJ A;  2VUM G;  4BWG B;  3S15 H;  2N88 A;  4C3H B;  2E5L Q;  4R4C A;  3A7A B;  1LV9 A;  2KHI A;  4FXD A;  3SVM A;  3NEM A;  1HFN A;  4A4I A;  5KNB A;  5DEH A;  5C5M A;  3CW2 C;  2PI2 E;  2VZA A;  1HUM A;  3KBG A;  1G2T A;  4FO2 A;  2UUB Q;  1EYC A;  1VF7 A;  2PZU A;  1AZQ A;  2X6L A;  2K6A A;  1VQ9 A;  4C3H G;  1I94 Q;  1IL2 A;  4GNX A;  1GVP A;  3D4D A;  1EU3 A;  4QF4 A;  2QA4 A;  2K03 A;  2NTS A;  4KMU C;  4DR1 Q;  5IYC H;  2ZM6 L;  2EPB A;  4P74 A;  2F3W A;  1PV4 A;  2FIN B;  3C2P A;  2DGY A;  4C3J H;  1FGB D;  1KHI A;  4YWL A;  1RTN A;  2XWJ B;  1X9N A;  1N34 L;  1CSQ A;  1ENC A;  1CHP D;  2IT1 A;  4OL7 A;  5FO8 B;  1VQ5 A;  3W2D A;  5LL6 S;  2RBM A;  1PRT B;  2X6G A;  1Q3L A;  4QJF A;  1SNM A;  3FKI B;  2F0T A;  5M9O A;  1KTK A;  1ZYR C;  1T5E A;  3UE1 A;  3PO2 G;  1CZW A;  3MHB A;  4KHV A;  5IGB A;  1VQ4 A;  4NP5 A;  3ZYY X;  3MVV A;  4G7H C;  1QVC A;  2M2L A;  1CKM A;  1GUW A;  1F2Y A;  4OO1 I;  1S72 A;  3PO3 G;  1UEA B;  1TII D;  1QCB D;  3TRZ A;  1WCM H;  3K5M A;  3KOJ A;  1SYE A;  4KKU A;  1MJC A;  3S2D B;  3HKZ E;  2KEC A;  2QGQ A;  1KRT A;  5AJ3 Q;  2F0V A;  3U4V A;  1V8Q A;  4XT3 B;  1A62 A;  3HOZ H;  3DEP A;  5J39 A;  1PRT F;  1TS3 A;  3QIA A;  3T53 B;  1V43 A;  1KAW A;  5M5Y B;  3V05 A;  2O5I C;  1Q46 A;  3TSS A;  1DM0 B;  1PZJ D;  4CJ1 B;  3TS0 A;  3GO5 A;  4A93 H;  4BY7 H;  2ALY B;  1JC7 A;  4BY7 B;  4LUO A;  2EIF A;  4MIU A;  1MHW C;  1K73 C;  1Y1V G;  2RDF A;  5JJL A;  1RHP A;  2PNH A;  5ELO A;  1J5E L;  2NWG A;  1U0L A;  1KDC A;  1AFP A;  3DEO A;  4P75 A;  4ZK9 B;  4L63 B;  2PQA B;  1YI2 A;  1DOL A;  1TWG B;  1CK1 A;  4DAM A;  3TME A;  1XXG A;  3RZO H;  3CRK C;  1PH2 A;  1IYU A;  5BN4 A;  5BR8 Q;  1E2Z A;  4DUY Q;  4FP5 D;  1MIU A;  4KHP Q;  1T5X D;  3KLR A;  1CSP A;  2G5D A;  3CPW A;  1XTC D;  2AUJ D;  4ID6 A;  4IQZ A;  4X3U A;  1N36 L;  1XMQ Q;  1VQE A;  4I7Z C;  3J7A 5;  4YHH L;  1BBX C;  1FVI A;  1PYW D;  5EBD A;  3M85 A;  3OHX C;  3Q23 A;  3M7N A;  3RLO A;  3J80 E;  1LUZ A;  2AWN A;  4WJW A;  3I4N H;  4HAE A;  1WCM G;  5EGT A;  3EIV A;  1UE5 A;  4GKK L;  3E9H A;  4PMB A;  2VUM H;  2NN6 H;  4JI7 L;  4RGT A;  1SDF A;  2LSS A;  4FDB A;  3L9A X;  1J5E Q;  3CRL C;  3T4A C;  2C35 B;  3B6Y A;  4NMZ A;  1L1O B;  1VQ6 A;  2A69 D;  5C3E B;  2ZJP A;  4C56 C;  1QE6 A;  1D8L A;  3KLS A;  4JI2 L;  1NE3 A;  3ZJY C;  3RR5 A;  4KN7 C;  3ERS X;  2PQE A;  1I4G A;  4CBV A;  2IX1 A;  1KIX A;  1AE3 A;  3BVG A;  1TWG H;  1X3F A;  3AQQ A;  2RDG A;  3SK6 A;  1DZ1 A;  1S5D D;  5C4H A;  2CCZ A;  4X3T A;  3CPF A;  1PH3 A;  3HKZ B;  1U4L A;  5ISR A;  1B3A A;  2MQH A;  4HJ7 A;  4K5V A;  3A5Z B;  1EL0 A;  3I4M B;  4JI8 L;  2Z1C A;  2QDL A;  3H3V I;  4AQY L;  1X65 A;  2F0D A;  3N6R A;  4EQ5 A;  4TQU S;  3VR2 A;  4LF8 L;  1I6H H;  1CA6 A;  1TXY A;  1SEB D;  2MFI A;  3CCS A;  3K7A B;  2EY5 A;  2NZH A;  3D6C A;  2ENB A;  4X66 L;  1BDO A;  1I4H A;  1E2V A;  4DV0 L;  2VUM B;  1F9Q A;  2ZJR A;  2UXB Q;  3AU7 A;  1AP0 A;  1UE7 A;  1AN8 A;  1EYD A;  4ME3 A;  4LNQ A;  1ICF B;  4K6D A;  5FJ8 G;  1ROD A;  3C46 A;  4FF4 A;  2L9H A;  4Y7N B;  1KNE A;  4A3I H;  4Y7N H;  2JA7 G;  2MNA A;  3S15 B;  1A0I A;  2HQE A;  4G57 A;  4IPD A;  4DAY A;  4JI3 Q;  1ML0 D;  2A8V A;  1DXM A;  3RUZ A;  1YJW A;  2KOL A;  3G48 A;  1NR2 A;  3H91 A;  2K5D A;  4P72 A;  1BBU A;  3RMH A;  4JI8 Q;  3I4N B;  4P71 A;  1NAP A;  3HOY G;  5T1G A;  4A3G G;  5EAY A;  2JA8 H;  1Z9F A;  2F0G A;  4RAU C;  1JB7 A;  4JI5 L;  3K57 A;  4APV A;  1YZ6 A;  1U4R A;  1X3Q A;  4DR7 L;  2PZW A;  1KD1 C;  1IBK L;  3G7L A;  3I4M H;  1JOQ A;  1VQB A;  4RKL A;  2LXK A;  3PCO B;  2ASB A;  3JC6 6;  3I4L A;  1AH9 A;  3AB9 A;  5J22 A;  2HUG A;  3K7A H;  2XRS D;  3URY A;  3KF8 A;  4DR3 L;  4YWK A;  1CA5 A;  3S17 B;  2YTX A;  2OEO A;  5FKA C;  3X3M A;  4A76 A;  1LT3 D;  4BS9 A;  1XNQ L;  3H94 A;  3GV3 A;  4CKB A;  2JA6 H;  2IJ0 A;  1PYS B;  2Q2H A;  2KED A;  1GHJ A;  3S1M H;  1S5C D;  1BUV T;  2O2L D;  2EOT A;  5CV4 A;  4ZKC B;  3T56 B;  4BBS G;  5GQO A;  1HPC A;  1Y8P B;  1XTD A;  3CMA A;  3RZD H;  1NBW A;  3MXN B;  4KHZ A;  1V1Q A;  2A6H C;  1VMP A;  4V0B A;  1EY8 A;  2B29 A;  4C3I H;  2IX3 A;  2EZV A;  4QIW B;  4A3D G;  2DNC A;  4DV7 L;  1HNZ L;  4DR7 Q;  1ICW A;  4R4I A;  5TSS A;  1A3V A;  3JAM c;  3VA5 A;  4DA2 A;  5E3F A;  1K8M A;  3GD7 A;  3PUW A;  4OWT B;  3TP5 A;  1C48 A;  2JJQ A;  3MC0 B;  2H1E A;  3OW2 A;  5C0X H;  2CH4 W;  1JB3 A;  2KCM A;  2VS1 A;  2EXD A;  4HCS A;  2NN6 G;  1K28 A;  2NB0 A;  3QR8 A;  2GVA A;  1EQR A;  4QUF A;  3CCQ A;  1IKM A;  1IZ6 A;  3DWP A;  2E2H H;  1VQL A;  1JCK B;  4ZCK A;  1EFI D;  4L8J A;  3LWU A;  1STA A;  2NZ1 D;  2B63 G;  3I91 A;  3NEL A;  3UI2 A;  3DWA A;  3MEH A;  3GTG H;  4FF3 A;  3TS2 A;  4I7A A;  1W6K A;  2Q2T A;  2B2W A;  1JOO A;  1PH7 A;  1YHA A;  1GD7 A;  1V1P A;  4A3C G;  3BG3 A;  3E5S A;  4A3L G;  3ER0 A;  4RCN A;  1NTG A;  1WTR A;  1O7I A;  4YY3 L;  1SFO B;  4A3I B;  4A3K G;  4R8N A;  2E74 C;  2K4K A;  1AE2 A;  2R7Z H;  1W3S A;  3U9O A;  2HDM A;  3A74 A;  1GUO A;  3MAQ A;  3F2U A;  4FF1 A;  1HQM C;  2VB2 X;  5EPL A;  2MP1 A;  2JQO A;  1ENF A;  3NHH A;  3NQI A;  1STG A;  1VQF A;  1ZYR D;  2PPB C;  3EN2 A;  2RSN A;  1X56 A;  5HY6 A;  4IUV A;  1RJT A;  4DV5 Q;  5KNC A;  2SNS A;  4LF8 Q;  5E7N A;  3S16 H;  3TDQ A;  5C0X G;  1BO0 A;  3HOV H;  1OTC A;  1KXL A;  4X66 Q;  5CBE E;  3Q6S A;  1Y1W H;  4DV0 Q;  3VA7 A;  4BBR B;  1Y8N B;  2K33 A;  2G9H D;  1SE2 A;  2CFM A;  2Q8I B;  1DD2 A;  1G91 A;  4DUZ L;  1PXU A;  2LKV A;  1S3O A;  1K3R A;  3H6M A;  4OEL B;  1IYV A;  3S17 H;  1G6Z A;  3R2T A;  4X62 Q;  4JBK A;  1LTA D;  4DV3 L;  3K58 A;  3CCJ A;  1PTO F;  4L5T A;  4LF6 Q;  4UPA A;  2NVY H;  3PUY A;  4A3M B;  4ZYS A;  1K0S A;  3I55 A;  2CW0 C;  4ZQ3 A;  1XPU A;  4DV6 L;  2E2I H;  2WFW A;  2R93 H;  4CDC C;  2O4X A;  1VQH A;  1TWF B;  3F2B A;  4DV5 L;  2KBN A;  1STY A;  3HOY B;  5C44 H;  4LFB Q;  4IFD J;  1SNP A;  2OF1 A;  5EJW A;  1Q90 A;  3QJY A;  4NXM Q;  1D1K A;  2UUC Q;  2PMZ B;  4F88 A;  1OXS C;  1EY6 A;  5ELN A;  4PZ6 A;  3WOF A;  2JE6 I;  3A8K E;  1N36 Q;  4HED A;  4DAV A;  3RNU A;  1BNZ A;  3PF5 A;  1GUN A;  1Q8K A;  3C1E A;  1JOK A;  5IGG A;  4A3M G;  1PH9 A;  2TSS A;  1PZI D;  1STH A;  1S40 A;  1HQR D;  2WII B;  1ESF A;  4A3F G;  1F9R A;  2E2H B;  1FGU A;  5H1S E;  3FKI G;  4H13 C;  4GOP A;  5IT9 c;  2QF7 A;  2RQX A;  4OIJ A;  3F1Z A;  3A8I E;  1FJG L;  2JEB I;  2KA7 A;  1UAP A;  1VQD A;  3CCL A;  2D0P A;  1VQG A;  1SRO A;  1Z7T A;  1GKH A;  1IYJ B;  4AYB E;  1JWU D;  3ERQ A;  1E2W A;  2ZXR A;  3FPU B;  3GTJ H;  2WP8 J;  1JE4 A;  3STB D;  1LYL A;  2K5Q A;  1SSO A;  4KY7 A;  5DM6 3;  1E1T A;  5IYD G;  4A75 A;  1B53 A;  2K5N A;  1TWC B;  4F8M A;  1CQV A;  1XPO A;  3HS0 C;  3IKJ A;  1K3B C;  3H09 A;  3CXC A;  1HUN A;  2UXD L;  4EQO A;  3G71 A;  3GTM B;  3KF6 A;  1HNW L;  4ZUI A;  3NWT A;  1M8A A;  1SN8 A;  2MHV A;  1H9R A;  4DK3 C;  2F0E A;  3MXP A;  4PQX A;  4EQN A;  4C2M B;  1EY9 A;  1EFW A;  3AEV A;  2OXP A;  4ODG A;  3NBI A;  1HA6 A;  4IUR A;  5CV5 A;  5ELB A;  3HOV B;  5IGE A;  3HKZ G;  1V1O A;  5BN3 A;  5FK9 C;  5DAU A;  3DMU A;  4DNR B;  2WB1 G;  2OTJ A;  1EEI D;  1SAP A;  1FL0 A;  1EWH A;  5IP9 H;  1PDQ A;  2DUD A;  1CFM A;  5IYB H;  3OTO L;  2GVB A;  3WOE A;  2GA4 B;  1YNN D;  3OIQ A;  1I4R A;  1N8R C;  2F4V L;  2Z0S A;  3S1R H;  4R8I A;  4K14 A;  1IL8 A;  5CV8 A;  2JA5 B;  3T1Y L;  1QG7 A;  2EE1 A;  2EJM A;  1EY5 A;  3S16 B;  5JVH 3;  1NSN S;  3GTL H;  3A5U A;  1JWS D;  4QY7 A;  1Q12 A;  2LY7 A;  3MFY A;  4MNO A;  1LTL A;  2I5L X;  2Z8L A;  5JJI A;  2K01 A;  1I94 L;  3QG1 A;  3UE0 A;  2WAQ E;  3HOU G;  2R6G A;  1WCM B;  3M4P A;  1D5Z C;  1Q1E A;  1ET9 A;  2K75 A;  4GS3 A;  2XN9 C;  4JOI C;  4DR1 L;  1SNO A;  1OXT A;  1Z6H A;  4O2D A;  4DR6 L;  1SJH D;  1XNR L;  5G3L F;  5IWA Q;  4DUZ Q;  1B44 D;  1EY7 A;  3D8G A;  4K6L A;  1VQ7 A;  4E6I A;  1I50 B;  2CQO A;  2CH4 A;  4O42 A;  2NTT A;  4RA8 A;  4XXE A;  2QEJ C;  3NPP A;  1VQK A;  4A3E H;  1YVC A;  4XQQ A;  2PCF B;  4EVO A;  5J1Z A;  5LL6 X;  1R4P B;  4JI6 L;  1K8O A;  3T16 A;  5I6Y A;  1A8V A;  1KAA A;  1E7Z A;  1QWY A;  1U4M A;  4DXG A;  3M4O B;  2ZXO A;  5LMU Q;  5CBA E;  3K0X A;  4P2C B;  3PO3 B;  1LTR D;  1C8C A;  2PW5 A;  4BY7 G;  3GTJ B;  1EUJ A;  4HID A;  1F9S A;  5D14 A;  2NYZ D;  4CDD C;  1TWH H;  1B8A A;  4A3F H;  5CV6 A;  3R8B A;  2CHB D;  1I4P A;  1LLR D;  2QDB A;  4GNX C;  3QOJ A;  1VQA A;  1G51 A;  2JA6 G;  5E4W C;  3BYT B;  3PIP A;  1BCP F;  1DCZ A;  2G9D A;  4KI0 A;  1IHZ A;  5GAD C;  2B39 A;  1O80 A;  1BXT A;  4DV2 L;  5C3X A;  2QIL A;  3A0J A;  3R3O A;  3FHW A;  4IUP A;  4G4K A;  5I2X A;  1HHV A;  4AH6 A;  4AYB G;  4HMJ A;  4BY1 G;  3S1R B;  1EZ6 A;  1Q86 C;  2KHS A;  2K1B A;  4TKO B;  4RGM A;  5E4X A;  4JI6 Q;  2F1M A;  3S1M B;  1STN A;  2JK8 A;  3D31 A;  4V19 0;  1TY2 A;  2ZTD A;  2R92 G;  5C0X J;  4IZ8 A;  3STB C;  2SOB A;  5IP7 H;  3K7U C;  4FXK C;  2L4N A;  1KC8 C;  2Z4I A;  5M3F B;  1I6V C;  4IFD I;  1Y8O B;  2F0W A;  3TZD A;  3K5L A;  3HOW B;  2EVB A;  2PZT A;  2D0O A;  2OTL A;  4J15 A;  4DR5 Q;  4C3J B;  3DLL A;  3RLF A;  1P8L A;  4TVA B;  1SYC A;  1IBK Q;  3BVM A;  4R9W A;  2F4I A;  4JV5 Q;  2B2V C;  1WJJ A;  2IX0 A;  5CV9 A;  4HIM A;  3GV6 A;  3GP7 A;  1G8Z D;  1MD2 D;  3DM1 A;  2WAQ B;  2K50 A;  2XVS A;  1EOT A;  2PO4 A;  4IUU A;  3GTP H;  1PH8 A;  3R2I A;  3UDI A;  5FJ8 H;  3Q22 A;  1X6O A;  1TWA H;  3LWE A;  2E2J B;  4UP7 A;  1TWC H;  2LFN A;  3BDC A;  2Z6K A;  4NDX A;  4JI5 Q;  4IFD G;  1N33 L;  1O7Y A;  4BY1 B;  1ZXT A;  2WAQ G;  1DOK A;  2FMM A;  2BOS A;  4YIJ A;  2A73 B;  1VQN A;  2BH8 A;  5C44 G;  4JOI A;  3Q24 A;  2EYP A;  3NBH B;  2KCN A;  2P5Z X;  4KKS A;  3LX0 A;  2RSO A;  4C3J G;  1ILP A;  1AW7 A;  1JWM D;  3VDY A;  2KJX A;  4POF A;  3PQI A;  1SND A;  4IPC A;  5ELC A;  3TP6 A;  1YHQ A;  1SYF A;  4N8F A;  4K8I A;  5C4J B;  4EX5 A;  1EZ8 A;  4IJH A;  3S9W A;  1MJE A;  3H3V C;  2K7V A;  5GRO A;  1G29 1;  3S2H B;  2I5M X;  3IFT A;  1SMY D;  3E0J A;  3G6J B;  4XYQ A;  2AWO A;  5L37 A;  1HTL D;  4X64 L;  3HOY H;  1WTH A;  5I4D A;  1B9N A;  2B8G A;  2OT2 A;  4P73 A;  1RF2 D;  1PA6 A;  5C3W A;  2C9O A;  4S3S A;  3S24 A;  3F2D A;  1Y1W G;  1UE6 A;  5M3M B;  3MEF A;  1YJN A;  2VQE L;  5HUR A;  5M5W B;  1BCP C;  3NBH A;  3PUX A;  2K28 A;  1J8I A;  4BA1 I;  3LNN A;  1AEX A;  2Z6B A;  4RHR A;  3CQZ B;  4GLV B;  1I4Q A;  1I3Q B;  4NXM L;  4JBM A;  2SNM A;  2Z6K C;  5KIX A;  2YTV A;  1GUG A;  3I2Z A;  2EYL A;  5LMN L;  2PMZ E;  3ONA B;  2PQA A;  1SRU A;  1T9H A;  3TRE A;  4ABN A;  4DXF A;  3NTH A;  1U4P A;  4BBS B;  2AQ1 B;  4BBS H;  2QKI C;  1M4V A;  4MN3 A;  3KLS X;  2L11 A;  2EQS A;  4K2K A;  2NVX B;  1TVX A;  1EQV A;  1HNX Q;  2RCN A;  3RN2 A;  2NUC A;  1GHK A;  3BDO A;  2EYH A;  1WYD A;  2JA5 G;  1SMY C;  2EY2 A;  2B2Y C;  4HIO A;  3PSI A;  1B50 A;  1PFM A;  5JEA J;  1UEB A;  2F0U A;  5COY A;  2FJ2 A;  3KDF A;  1YBY A;  4JI4 Q;  2E5L L;  4KN4 C;  3C3L A;  2K5H A;  4HJA A;  1JJC B;  4KJO A;  4GN3 B;  1HA5 A;  2UUA L;  2J0T D;  2YTY A;  5M5W H;  2F52 A;  1G6P A;  2AMC B;  3FP9 A;  5C4Z A;  4K8J A;  4YHH Q;  4DV2 Q;  2D9U A;  1SMX A;  4A3I G;  2V4D A;  5T1I A;  3I72 A;  4A3G B;  4IN3 A;  2UUB L;  3GTK H;  1LT6 D;  3S14 B;  3MXG A;  2QCP X;  2WKD A;  5M3F H;  2OQ0 A;  4JPB W;  3ULL A;  1JJ2 A;  2A5H A;  4N8X 1;  1NCV A;  1KQS A;  4PZ8 A;  2XIW A;  3H0G B;  4TSS A;  3HOU H;  3HOX H;  4B3M Q;  4OX9 L;  4OIK A;  1NR4 A;  1NNX A;  3M9B A;  1FNV A;  5K5P A;  1UNS A;  5BN5 A;  1B3Q A;  2Z4H A;  3CHB D;  5FLX L;  4LW1 A;  1EIY B;  2JA5 H;  3I70 A;  1U9R A;  2IY5 B;  4G7Z C;  2K52 A;  1HH2 P;  3PO2 B;  1KLG D;  3E3X A;  3K5O A;  4M1U B;  1H9M A;  4JBJ A;  4X62 L;  4XQN A;  3HOV G;  2CQA A;  4B3T L;  5ELE A;  2BA0 A;  1W2B A;  2V1C C;  1JJG A;  5EBC A;  1XMO Q;  4OWX B;  4X65 L;  2L55 A;  2Q8T A;  3X3N A;  4FNF A;  4B3R L;  3MZ5 A;  5C5L A;  2QEX A;  4GOP C;  1JOR A;  1IW7 D;  4PV1 C;  2F03 A;  5M3F G;  1WTW A;  3KF6 B;  3MXU A;  3A7L A;  1SBB B;  5IGF A;  4FVM A;  5I9O A;  4HCE A;  1BCP B;  1FJG Q;  4QMG A;  5M5X H;  1WI5 A;  3S14 H;  4KD3 A;  1CQF A;  2HHH Q;  4OWW B;  2DNE A;  4PZ7 A;  4Q5V A;  2R7Z B;  1HZ9 A;  1EU4 A;  4GN4 B;  3HOW H;  2X69 A;  1J9O A;  2A1A A;  2MGS A;  3CU7 A;  5CC4 A;  3H3V H;  2RCF A;  1NMF A;  4R4T A;  2E8G A;  2ATW A;  1C4Q A;  1LT4 D;  3LGJ A;  2NVY B;  4A3M H;  2EYO A;  4HSV A;  1TWH B;  3G6E A;  1H9S A;  3HRZ C;  4A3F B;  5C4X H;  1GXD C;  2CW0 D;  2KHJ A;  4KLK A;  1RKN A;  1N9W A;  1NMG A;  3V2T A;  3BS1 A;  2DJF C;  1K83 B;  3S2H H;  3K5N A;  2WB1 E;  2I5H A;  2LXJ A;  4DGZ A;  3K6O A;  1KL9 A;  1C7Y A;  2EJG C;  1B70 B;  3D4R A;  1TT2 A;  1YNN C;  1IBL Q;  3NK9 A;  1TY0 A;  5ELD A;  4LF7 L;  5EPJ A;  1QVG A;  3J7A F;  3M3Y H;  1JMC A;  3D3R A;  3ITP A;  3GDE A;  2VXW A;  4RCO A;  3P20 A;  4H02 A;  4A3C H;  4C2M H;  3AMU A;  2UXD Q;  1B7Y B;  4A3K H;  2JA7 B;  3M4Y A;  4PNY A;  4XQJ A;  1W6J A;  4A3E B;  4NXN Q;  2EY1 A;  3CCU A;  3R93 A;  1PTO C;  2FMC A;  4UHV A;  4LF6 L;  1DJR D;  2WIN B;  5GAH C;  3HFZ B;  1SYG A;  2F0S A;  4O1N A;  4DR4 Q;  4RMF A;  1E0B A;  3KFU A;  1HRJ A;  4A3E G;  3HOX G;  2PYK A;  4N9P A;  4FF2 A;  2E2D C;  1B9M A;  3SXH A;  5M3M H;  3J81 L;  3PV0 A;  2FFK B;  5F2D A;  3FMC A;  5IYD H;  2ZTC A;  2F0H A;  1IBL L;  3F8T A;  1ENA A;  1CT1 D;  4B08 A;  4MZ9 A;  3MA2 B;  2VNU D;  4POG A;  1CZG A;  4B9W A;  3I4O A;  4JCV E;  2Y0S B;  2AKW B;  3IAY A;  1JR0 D;  2B8F A;  5J3B A;  4DFA A;  4BY1 H;  3EA6 A;  1Y14 B;  3GTO H;  3MXN A;  1ZKO A;  5JEA H;  1MI2 A;  3SK5 A;  2MO0 A;  4M8A A;  3U58 A;  2AHO B;  3I7F A;  2HD3 A;  2H4O A;  3TP7 A;  4CJ2 C;  2A19 A;  5I9P A;  2NVQ H;  4UAI A;  4XIG S;  3M3Y B;  1S5E D;  1STB A;  3OMC A;  2L5T A;  1LTI D;  3QWN A;  4KY6 A;  4PMW A;  1XPR A;  1XJV A;  4IOC A;  1O7Z A;  3SDZ A;  1SE8 A;  4DF7 A;  3G4S A;  2KCC A;  2VQF L;  1Q7Y C;  2JA7 H;  1VQC A;  3HG9 A;  4BBR H;  4NPS A;  2MUY A;  5JPN C;  5JJK A;  4JC0 A;  1QUQ A;  2BE5 D;  4C3I B;  5LHY 1;  5FO7 B;  1PTO D;  3OIP A;  1IBM L;  4DK6 C;  3RD4 A;  5C44 B;  3W3A A;  4A3B B;  3NWS A;  3L3O C;  3S1Q H;  5BR8 L;  4DUY L;  3EVQ A;  3W1B A;  3J80 c;  1ZEQ X;  1R4Q B;  3EQL C;  1Y1V H;  5EKL A;  5DLQ E;  2MO1 A;  2F0N A;  5IE8 A;  5FLM H;  5IY0 A;  3TP8 A;  3CME A;  2L0C A;  1RL2 A;  2R7D A;  5JAV A;  4ZKB B;  1S5B D;  5M5Y H;  3T1H Q;  3L7Z C;  4U68 A;  5LMU L;  2Y0S G;  1P16 A;  1K8G A;  3BU2 A;  2B2Y A;  1BQQ T;  4A3G H;  3EBE A;  1LAC A;  1FNW A;  4IOA A;  4GKK Q;  1ESR A;  4LF4 L;  2IL8 A;  1EIH A;  4LMQ D;  5FLX E;  2RDH A; 
#chains in the Genus database with same CATH homology
 1F2L A;  1TQO A;  2NVT B;  5D65 A;  1SYD A;  3T51 B;  1A6X A;  2B2V A;  3FPP A;  4J8Q A;  1XX8 A;  3QOL A;  2DN8 A;  2D62 A;  2WKC A;  3OWF A;  3D6W A;  2VB3 X;  2BE5 C;  3TZU A;  3BVZ A;  1ONL A;  1CHQ D;  3GTQ B;  1PTO B;  2EYJ A;  4A3J B;  3WDN A;  1A2U A;  1LAB A;  1RTO A;  3P1H A;  1II3 A;  3DXJ C;  3I3C A;  1QNU A;  3PUV A;  3V96 A;  3E6Z X;  3RZO B;  4OO1 H;  2RKS A;  1Q8I A;  2HCI A;  1H9J A;  3MTS A;  3MFG A;  4AYB B;  5D3D A;  4FXG C;  2EY6 A;  5EPK A;  1MBY A;  4HSP A;  2JA6 B;  4G7O C;  3JAM E;  2XSC A;  3P75 A;  3FRP B;  3SR1 A;  3U9S A;  4HN7 A;  3IFD A;  4ZUJ A;  4LK1 C;  3BZD B;  1GJX A;  2F0J A;  2F0O A;  4NKL A;  1EQT A;  4KV6 A;  1F9P A;  2J7Z A;  3I90 A;  3DHQ A;  2I46 A;  1WVL A;  3P7J A;  3VYU A;  2KVM A;  4GZY C;  1B2T A;  4CKC A;  1TU2 B;  2K5W A;  1TS4 A;  4OO1 G;  3VR4 A;  1D5M C;  4QB4 A;  4RH6 A;  1SE3 A;  1OXV A;  4J6H A;  1HTP A;  1Y1W B;  3KK7 A;  5CR3 A;  1D1I A;  5CV7 A;  1LO5 D;  1I6H B;  2NBF A;  1VF5 C;  1PRT D;  5AFW A;  4JBW A;  3NE5 B;  3HOU B;  4F7X A;  4DK0 A;  1JQY D;  3CKI B;  4KK7 A;  1RD9 D;  4ULL A;  2WAC A;  3SK4 A;  5KGU A;  2E76 C;  1LTG D;  2F0L A;  2YU9 B;  4C3I G;  5IGC A;  2JP1 A;  3EJI A;  3SE0 A;  1PLF A;  1B1Z A;  1CI3 M;  2K05 A;  4OGQ C;  3SHL A;  1A3T A;  3FVQ A;  3J7A V;  4XDX A;  4IUQ A;  5KEE A;  1QB5 D;  4U67 3;  4A3D B;  2DY7 A;  2KQ3 A;  2XWB B;  4I65 A;  1DON A;  2WB1 B;  1A2T A;  1BCP D;  3Q0A A;  2K04 A;  4H44 C;  3HZX A;  4KTA A;  1EEF D;  1ET6 A;  3OWE B;  2SDF A;  2WV6 D;  4DK1 A;  3S1N B;  5CYU A;  4N9T A;  2LS0 1;  1TWA B;  5IIF A;  1WTQ A;  1YNJ D;  1LT5 D;  1TKW B;  1QJO A;  2E75 C;  3HGB A;  2RVL A;  3C1F A;  3NP8 A;  1L0Y B;  1PFB A;  4RGN A;  5A2Q L;  5K36 H;  3HOX B;  1QOH A;  3IL8 A;  2R92 B;  2O5J C;  1SXT A;  1R9T B;  5CMD A;  1FNU A;  2YYZ A;  2KEE A;  4HMI A;  5EQ0 A;  3NTK A;  3KUP A;  3A55 A;  4FYD A;  1SE4 A;  4C1N I;  4Z9C B;  5ELF A;  1SYB A;  3J80 L;  3N52 A;  2J4X A;  3TBI B;  1BOS A;  1EIG A;  5I6W A;  4KJN A;  1D6E C;  2L12 A;  1DOM A;  3NSW A;  3MWY W;  5IT9 L;  5JOB A;  3BDL A;  2EYF A;  1Q1B A;  3VYR A;  4DN4 M;  1WD1 A;  2F0M A;  4IUT A;  4ZLT F;  1YNJ C;  2AUK A;  5FO9 B;  1OO9 B;  2BA1 A;  1PZK D;  1O7L A;  5DNF A;  4WRD A;  4L6T B;  1EY0 A;  2AQ2 B;  3FEW X;  4EGV A;  4X3S A;  5JJZ A;  2JXM B;  5A35 A;  1LTS D;  5CGK A;  2F3V A;  1S5F D;  1F2Z A;  1PFN A;  1DYQ A;  1EWC A;  3RZD B;  2IW3 A;  3KBX A;  2F0Q A;  4H7B A;  4F87 A;  2PNR C;  3VR6 A;  3FDT A;  4PMC A;  4ME5 A;  4ILW A;  4IFD H;  2N55 A;  1KLU D;  1V1P B;  1CM9 A;  1D5X C;  2HDL A;  4CHT B;  5I2Y A;  3NXW A;  3HOZ B;  2LMC B;  3DUZ A;  3A56 A;  2E2I B;  3OSO A;  3EFX D;  3I8Z A;  1KDB A;  2C5C A;  1TS5 A;  3BYY B;  3T13 A;  3PIO 3;  5KYL A;  2Q8R E;  3SK8 A;  1O78 A;  1X32 A;  2TMP A;  5KND A;  5JEA G;  4X3K A;  1WTO A;  1B4O A;  2ID0 A;  1FYC A;  4IAL A;  3ERO A;  2ICI A;  1AZP A;  3SEB A;  4H0L C;  4WOR A;  3GTL B;  4ZRZ A;  1F77 A;  3PIP 3;  1SNC A;  5C0X I;  2ZT9 C;  1FD7 D;  1VDZ A;  5EKI A;  1IKL A;  1STE A;  3VYT A;  4Q0F A;  4KKT A;  1UUP A;  2B63 B;  5HGT A;  1XYI A;  4C1N K;  5KYI A;  4KY5 A;  1IW7 C;  3GTG B;  2SEB D;  1EYA A;  2IPK D;  1MSG A;  1GOZ A;  3K59 A;  4WFN 3;  2B2U C;  2JYO A;  1S4Z A;  5IOD A;  1BR9 A;  1HXY D;  1RDP D;  1Y69 U;  4QCL A;  3ND9 A;  1PTO H;  3S1Q B;  3D4W A;  2B2W C;  1GUS A;  5E1F A;  2M9V A;  4CKE A;  1EY4 A;  2EDG A;  4XYO A;  3OW7 A;  1WTX A;  1MSH A;  1H9S B;  1D2B A;  4RKB A;  1A15 A;  2PW7 A;  4DU9 A;  2MJ8 A;  3J81 E;  2F0I A;  2B2T C;  2A6E C;  2A69 C;  4HR7 B;  1MGS A;  4DNT B;  1KDA A;  4UDU C;  4EQP A;  4IUN A;  1TR5 A;  3PMF A;  2B2U A;  3VYS A;  1RCV D;  1WTV A;  3VR3 A;  3I73 A;  4BA2 I;  2R93 B;  3HP3 A;  5COR A;  5C6A A;  1L0X B;  2A6H D;  2R61 A;  1JIC A;  5IT9 E;  2BCO A;  2AQ3 B;  3J7Y W;  2A68 D;  2A68 C;  3GQB A;  1I4X A;  1LTB D;  4LAA A;  4DAP A;  1F2M A;  2D5D A;  1SJE D;  2M00 A;  2JSO A;  1QNK A;  4J1M A;  1Z47 A;  4CGY B;  2B2T A;  3OOC A;  2HCC A;  3TN2 A;  5JVG 3;  1HCZ A;  3A8J E;  1LTT D;  5FOB B;  1ILQ A;  2EXZ A;  2JEA I;  1WD0 A;  4RGO S;  2RA4 A;  1KNA A;  1XWE A;  1TS2 A;  3M7G A;  4ZAI A;  5EKK A;  3GTK B;  5M5X B;  1WTP A;  3OMG A;  3QB3 A;  4JK1 C;  4XT1 B;  1PRT C;  1G2S A;  2A74 C;  2XRQ D;  2F0P A;  2K32 A;  2A6E D;  4NW2 A;  4QUC A;  2BDO A;  1BF4 A;  5C4X B;  4K5X A;  5IOC A;  4RHS A;  1SNQ A;  3O13 A;  4K5W A;  3PUZ A;  2EJF C;  2L1B A;  3OPO A;  2XNA C;  1VCI A;  3NTI A;  2NVQ B;  3K0Y A;  1FR3 A;  4LJZ C;  2F0F A;  2CVR A;  4RFB A;  4B9X A;  3NUC A;  2D2C C;  1PMR A;  1CTM A;  2NN6 I;  3GTP B;  5D3I B;  1X3P A;  5KRU A;  3JAM L;  2EYM A;  1KAB A;  3NQT A;  3GTO B;  5K36 G;  4TRD A;  1Y1V B;  3A54 A;  3ND8 A;  3VR5 A;  3HEJ A;  3DWQ A;  5DM7 3;  2BDN A;  2F0K A;  2JA8 B;  2FHT A;  1HFG A;  4XTC S;  3QO2 A;  1VMC A;  2I07 B;  5IGD A;  4A3K B;  2ZXP A;  2MPM A;  4A93 B;  4HTH A;  4KD4 A;  5G3L D;  2IWH A;  5JPM C;  1QIL A;  4MHE A;  1NUC A;  5A2Q E;  4K2L A;  5NUC A;  1GUT A;  1H9K A;  1OXU A;  1A3U A;  2R3Z A;  2DY8 A;  1OXX K;  4CJ0 B;  2KUM A;  4RWS C;  2ICE C;  4OHJ A;  4BWG B;  2N88 A;  4C3H B;  3A7A B;  1LV9 A;  4FXD A;  3SVM A;  1HFN A;  5KNB A;  5DEH A;  5C5M A;  3KBG A;  1HUM A;  1G2T A;  4FO2 A;  1EYC A;  1VF7 A;  2PZU A;  1AZQ A;  2X6L A;  2K6A A;  4C3H G;  3D4D A;  1EU3 A;  4QF4 A;  2K03 A;  2NTS A;  4KMU C;  2EPB A;  2F3W A;  2FIN B;  3C2P A;  1FGB D;  1RTN A;  2XWJ B;  1ENC A;  1CHP D;  2IT1 A;  4OL7 A;  5FO8 B;  3W2D A;  5LL6 S;  2RBM A;  1PRT B;  2X6G A;  1Q3L A;  1SNM A;  3FKI B;  2F0T A;  5M9O A;  1KTK A;  1ZYR C;  1T5E A;  1CZW A;  3MHB A;  4KHV A;  5IGB A;  4NP5 A;  3ZYY X;  3MVV A;  4G7H C;  2M2L A;  1GUW A;  1F2Y A;  4OO1 I;  1UEA B;  1TII D;  1QCB D;  3K5M A;  1SYE A;  4KKU A;  3S2D B;  2KEC A;  2F0V A;  1V8Q A;  4XT3 B;  3DEP A;  5J39 A;  1PRT F;  1TS3 A;  3QIA A;  3T53 B;  1V43 A;  5M5Y B;  3V05 A;  2O5I C;  3TSS A;  1DM0 B;  1PZJ D;  4CJ1 B;  3GO5 A;  1JC7 A;  4BY7 B;  4MIU A;  2RDF A;  1RHP A;  2NWG A;  1KDC A;  1AFP A;  3DEO A;  4ZK9 B;  4L63 B;  1DOL A;  1TWG B;  1CK1 A;  3TME A;  1XXG A;  3CRK C;  1IYU A;  5BN4 A;  1E2Z A;  4FP5 D;  1T5X D;  3KLR A;  1XTC D;  2AUJ D;  4ID6 A;  4IQZ A;  4X3U A;  4I7Z C;  1BBX C;  1PYW D;  3M85 A;  3M7N A;  5EBD A;  3OHX C;  3Q23 A;  3J80 E;  2AWN A;  4WJW A;  4HAE A;  5EGT A;  4PMB A;  2NN6 H;  4RGT A;  1SDF A;  3L9A X;  3CRL C;  3T4A C;  4NMZ A;  2A69 D;  5C3E B;  4C56 C;  1QE6 A;  3KLS A;  4KN7 C;  2PQE A;  1I4G A;  4CBV A;  2IX1 A;  3BVG A;  2RDG A;  3SK6 A;  1DZ1 A;  1S5D D;  5C4H A;  4X3T A;  3HKZ B;  1U4L A;  5ISR A;  1B3A A;  4K5V A;  1EL0 A;  3I4M B;  2Z1C A;  2F0D A;  3N6R A;  4TQU S;  3VR2 A;  1CA6 A;  1SEB D;  3K7A B;  2EY5 A;  3D6C A;  2ENB A;  1BDO A;  1I4H A;  1E2V A;  2VUM B;  1F9Q A;  3AU7 A;  1AP0 A;  1AN8 A;  1EYD A;  4K6D A;  1ROD A;  3C46 A;  4FF4 A;  2L9H A;  4Y7N B;  1KNE A;  3S15 B;  2HQE A;  4G57 A;  4DAY A;  1ML0 D;  1DXM A;  3RUZ A;  2KOL A;  1NR2 A;  3H91 A;  2K5D A;  3RMH A;  3I4N B;  1NAP A;  5T1G A;  2F0G A;  4RAU C;  3K57 A;  1U4R A;  1X3Q A;  2PZW A;  3G7L A;  1JOQ A;  4RKL A;  3I4L A;  3AB9 A;  5J22 A;  2HUG A;  2XRS D;  3URY A;  3KF8 A;  1CA5 A;  3S17 B;  5FKA C;  2OEO A;  3X3M A;  1LT3 D;  4BS9 A;  3H94 A;  3GV3 A;  4CKB A;  2IJ0 A;  2KED A;  1GHJ A;  1S5C D;  1BUV T;  2O2L D;  2EOT A;  5CV4 A;  4ZKC B;  3T56 B;  1HPC A;  1Y8P B;  4KHZ A;  2A6H C;  1VMP A;  4V0B A;  1EY8 A;  2IX3 A;  2EZV A;  4QIW B;  2DNC A;  1ICW A;  5TSS A;  1A3V A;  3VA5 A;  4DA2 A;  5E3F A;  1K8M A;  3GD7 A;  3PUW A;  3TP5 A;  1C48 A;  3MC0 B;  2H1E A;  5C0X H;  1JB3 A;  4HCS A;  2NN6 G;  2NB0 A;  4QUF A;  1IKM A;  3DWP A;  1JCK B;  1EFI D;  4L8J A;  3LWU A;  1STA A;  2NZ1 D;  3I91 A;  3UI2 A;  3DWA A;  3MEH A;  4FF3 A;  1W6K A;  2B2W A;  1JOO A;  1V1P A;  3BG3 A;  3E5S A;  4RCN A;  1WTR A;  1SFO B;  4A3I B;  4R8N A;  2E74 C;  3U9O A;  2HDM A;  1GUO A;  3MAQ A;  3F2U A;  4FF1 A;  1HQM C;  2VB2 X;  5EPL A;  2MP1 A;  1ENF A;  3NHH A;  3NQI A;  1STG A;  1ZYR D;  2PPB C;  2RSN A;  4IUV A;  1RJT A;  5KNC A;  2SNS A;  3TDQ A;  5C0X G;  1BO0 A;  5CBE E;  3Q6S A;  3VA7 A;  4BBR B;  1Y8N B;  2K33 A;  2G9H D;  1SE2 A;  2Q8I B;  1DD2 A;  1G91 A;  1PXU A;  2LKV A;  3H6M A;  1IYV A;  1G6Z A;  3R2T A;  1LTA D;  3K58 A;  1PTO F;  4A3M B;  3PUY A;  4ZYS A;  2CW0 C;  4ZQ3 A;  2O4X A;  1TWF B;  1STY A;  3HOY B;  4IFD J;  1SNP A;  2OF1 A;  5EJW A;  1Q90 A;  3QJY A;  1D1K A;  2PMZ B;  4F88 A;  1OXS C;  1EY6 A;  3WOF A;  2JE6 I;  3A8K E;  4HED A;  4DAV A;  1BNZ A;  1GUN A;  3C1E A;  1JOK A;  5IGG A;  2TSS A;  1PZI D;  1STH A;  1HQR D;  2WII B;  1ESF A;  1F9R A;  2E2H B;  4H13 C;  2QF7 A;  2RQX A;  4OIJ A;  3A8I E;  2JEB I;  2KA7 A;  1UAP A;  1Z7T A;  1JWU D;  3ERQ A;  1E2W A;  2ZXR A;  3FPU B;  2WP8 J;  1JE4 A;  2K5Q A;  1SSO A;  4KY7 A;  5DM6 3;  1B53 A;  1TWC B;  4F8M A;  1CQV A;  3HS0 C;  3IKJ A;  3H09 A;  1HUN A;  4EQO A;  3GTM B;  4ZUI A;  3NWT A;  1M8A A;  2MHV A;  1H9R A;  2F0E A;  3MXP A;  4PQX A;  4EQN A;  4C2M B;  1EY9 A;  2OXP A;  4ODG A;  3NBI A;  1HA6 A;  4IUR A;  5CV5 A;  5ELB A;  3HOV B;  5IGE A;  1V1O A;  5BN3 A;  5FK9 C;  5DAU A;  3DMU A;  4DNR B;  1EEI D;  1SAP A;  1EWH A;  1PDQ A;  1CFM A;  3WOE A;  2GA4 B;  1YNN D;  3OIQ A;  1I4R A;  4R8I A;  4K14 A;  1IL8 A;  5CV8 A;  2JA5 B;  1QG7 A;  2EE1 A;  2EJM A;  1EY5 A;  3S16 B;  5JVH 3;  1NSN S;  1JWS D;  1Q12 A;  2LY7 A;  3MFY A;  2Z8L A;  2K01 A;  3QG1 A;  2R6G A;  1WCM B;  1D5Z C;  1Q1E A;  1ET9 A;  2XN9 C;  1SNO A;  1OXT A;  1Z6H A;  1SJH D;  5G3L F;  1B44 D;  1EY7 A;  3D8G A;  4K6L A;  4E6I A;  1I50 B;  4O42 A;  2NTT A;  4RA8 A;  4XXE A;  2QEJ C;  3NPP A;  4XQQ A;  2PCF B;  4EVO A;  5J1Z A;  5LL6 X;  1R4P B;  1K8O A;  3T16 A;  5I6Y A;  1KAA A;  1QWY A;  1U4M A;  4DXG A;  3M4O B;  2ZXO A;  5CBA E;  4P2C B;  3PO3 B;  1LTR D;  1C8C A;  2PW5 A;  3GTJ B;  1F9S A;  5D14 A;  2NYZ D;  5CV6 A;  3R8B A;  2CHB D;  1I4P A;  1LLR D;  2QDB A;  3QOJ A;  5E4W C;  3BYT B;  1BCP F;  1DCZ A;  4KI0 A;  2G9D A;  1IHZ A;  2B39 A;  1O80 A;  1BXT A;  5C3X A;  2QIL A;  3R3O A;  4IUP A;  4G4K A;  5I2X A;  1HHV A;  4HMJ A;  3S1R B;  1EZ6 A;  2KHS A;  2K1B A;  4TKO B;  4RGM A;  5E4X A;  2F1M A;  3S1M B;  1STN A;  3D31 A;  4V19 0;  1TY2 A;  5C0X J;  4IZ8 A;  2SOB A;  4FXK C;  2L4N A;  2Z4I A;  5M3F B;  1I6V C;  4IFD I;  1Y8O B;  2F0W A;  3TZD A;  3K5L A;  3HOW B;  2EVB A;  2PZT A;  4C3J B;  3RLF A;  1SYC A;  3BVM A;  4R9W A;  2F4I A;  2B2V C;  2IX0 A;  5CV9 A;  3GV6 A;  3GP7 A;  1G8Z D;  1MD2 D;  3DM1 A;  2WAQ B;  2XVS A;  1EOT A;  2PO4 A;  4IUU A;  3R2I A;  3Q22 A;  3LWE A;  2E2J B;  3BDC A;  2LFN A;  4NDX A;  4IFD G;  1O7Y A;  4BY1 B;  1ZXT A;  1DOK A;  2FMM A;  2BOS A;  4YIJ A;  2A73 B;  3Q24 A;  2EYP A;  2KCN A;  4KKS A;  3LX0 A;  2RSO A;  4C3J G;  1ILP A;  1AW7 A;  1JWM D;  2KJX A;  1SND A;  5ELC A;  3TP6 A;  1SYF A;  4K8I A;  5C4J B;  1EZ8 A;  3S9W A;  3H3V C;  2K7V A;  1G29 1;  3S2H B;  3IFT A;  1SMY D;  3E0J A;  3G6J B;  4XYQ A;  2AWO A;  1HTL D;  5I4D A;  1B9N A;  2B8G A;  2OT2 A;  1RF2 D;  5C3W A;  2C9O A;  4S3S A;  5M3M B;  5M5W B;  5HUR A;  1BCP C;  3NBH A;  3PUX A;  2K28 A;  1J8I A;  4BA1 I;  3LNN A;  1AEX A;  4RHR A;  3CQZ B;  1I4Q A;  1I3Q B;  2SNM A;  5KIX A;  1GUG A;  2EYL A;  3ONA B;  4ABN A;  4DXF A;  3NTH A;  1U4P A;  4BBS B;  2AQ1 B;  2QKI C;  1M4V A;  4MN3 A;  3KLS X;  2L11 A;  4K2K A;  2NVX B;  1TVX A;  1EQV A;  2NUC A;  1GHK A;  3BDO A;  2EYH A;  1SMY C;  2EY2 A;  2B2Y C;  1B50 A;  1PFM A;  5JEA J;  2F0U A;  5COY A;  2FJ2 A;  4KN4 C;  3C3L A;  4KJO A;  1HA5 A;  2J0T D;  5C4Z A;  4K8J A;  2D9U A;  2V4D A;  5T1I A;  3I72 A;  4A3G B;  4IN3 A;  1LT6 D;  3S14 B;  3MXG A;  2QCP X;  2WKD A;  2A5H A;  1NCV A;  2XIW A;  3H0G B;  4TSS A;  4OIK A;  1NR4 A;  1FNV A;  5K5P A;  1UNS A;  5BN5 A;  2Z4H A;  3CHB D;  5FLX L;  3I70 A;  1U9R A;  4G7Z C;  3PO2 B;  1KLG D;  3K5O A;  4M1U B;  1H9M A;  4XQN A;  2CQA A;  5ELE A;  2BA0 A;  5EBC A;  2L55 A;  2Q8T A;  3X3N A;  4FNF A;  3MZ5 A;  5C5L A;  1JOR A;  1IW7 D;  4PV1 C;  2F03 A;  1WTW A;  3MXU A;  3A7L A;  1SBB B;  5IGF A;  4FVM A;  5I9O A;  4HCE A;  1BCP B;  4QMG A;  4KD3 A;  1CQF A;  2DNE A;  4Q5V A;  2R7Z B;  1EU4 A;  2X69 A;  1J9O A;  2MGS A;  3CU7 A;  5CC4 A;  1C4Q A;  1LT4 D;  2NVY B;  2EYO A;  4HSV A;  1TWH B;  4A3F B;  1H9S A;  3HRZ C;  1GXD C;  2CW0 D;  1RKN A;  3V2T A;  3BS1 A;  1K83 B;  3K5N A;  4DGZ A;  3K6O A;  2EJG C;  3D4R A;  1TT2 A;  1YNN C;  3NK9 A;  1TY0 A;  5ELD A;  5EPJ A;  3J7A F;  3D3R A;  3ITP A;  2VXW A;  4RCO A;  3P20 A;  3AMU A;  2JA7 B;  3M4Y A;  4PNY A;  4XQJ A;  1W6J A;  4A3E B;  2EY1 A;  3R93 A;  1PTO C;  2FMC A;  1DJR D;  2WIN B;  1SYG A;  2F0S A;  4O1N A;  1E0B A;  1HRJ A;  2PYK A;  4N9P A;  4FF2 A;  2E2D C;  1B9M A;  3SXH A;  3J81 L;  3PV0 A;  2FFK B;  5F2D A;  3FMC A;  2F0H A;  1ENA A;  1CT1 D;  4B08 A;  3MA2 B;  2VNU D;  1CZG A;  4B9W A;  2Y0S B;  3IAY A;  1JR0 D;  2B8F A;  4DFA A;  3EA6 A;  3MXN A;  1ZKO A;  5JEA H;  1MI2 A;  3SK5 A;  4M8A A;  4CJ2 C;  2H4O A;  3TP7 A;  5I9P A;  4UAI A;  4XIG S;  3M3Y B;  1S5E D;  1STB A;  3OMC A;  2L5T A;  1LTI D;  3QWN A;  4KY6 A;  4PMW A;  1O7Z A;  3SDZ A;  4DF7 A;  2KCC A;  3HG9 A;  2MUY A;  5JPN C;  4C3I B;  2BE5 D;  5LHY 1;  5FO7 B;  1PTO D;  3OIP A;  3RD4 A;  5C44 B;  3W3A A;  4A3B B;  3NWS A;  3L3O C;  3EVQ A;  1ZEQ X;  1R4Q B;  3EQL C;  5EKL A;  2F0N A;  3TP8 A;  2L0C A;  5JAV A;  4ZKB B;  1S5B D;  3L7Z C;  4U68 A;  2B2Y A;  1BQQ T;  1LAC A;  1FNW A;  1ESR A;  2IL8 A;  1EIH A;  4LMQ D;  5FLX E;  2RDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...