4ME5A

Crystal structure of staphylococcal nuclease variant delta+phs v23s/v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTSKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4me5A00
5IGFA 4YIJA 4EQPA 4NKLA 2F3VA 4IUNA 1SNOA 1NUCA 3NHHA 4K8JA 5KYLA 2EYLA 3MXPA 2F0JA 2PZUA 3D8GA 4QB4A 2F0PA 4DGZA 3MZ5A 1EY0A 4HMIA 1TT2A 1EYDA 4OL7A 1ENCA 1KDAA 5J39A 1STGA 2KHSA 3NQTA 2F0DA 5JAVA 4E6IA 3MEHA 4S3SA 3EVQA 1JOQA 5CV4A 3NUCA 1STYA 2F0QA 4NDXA 5IOCA 4KD4A 2F0HA 4QMGA 5E3FA 3SK4A 1KAAA 5DEHA 2EYJA 3HEJA 1A3TA 1EYAA 5CC4A 2F0UA 3OSOA 2M00A 3QOLA 3NP8A 2EY2A 2SNSA 1SYCA 1TR5A 4QF4A 3TP6A 1SNPA 1EY6A 1A3VA 2O4XA 2RBMA 3OWFA 4K5WA 5C5MA 2F0TA 5J1ZA 2EYHA 5HURA 1F2MA 3ITPA 2ENBA 5C5LA 5C4HA 1SYBA 3D6CA 3C1FA 4KD3A 4PNYA 3SXHA 3T16A 3QB3A 5CV6A 1SNCA 4KY7A 2PZWA 1SNDA 3VA5A 5CV7A 4HTHA 5KYIA 3NXWA 3TMEA 2OXPA 4K14A 4KHVA 5I9OA 2QDBA 5KEEA 2LKVA 3V2TA 2F0FA 1JOKA 2HQEA 1EZ8A 2OEOA 2WACA 1RKNA 3D4DA 1F2ZA 3DHQA 4IALA 4K5VA 4KJNA 2OF1A 3OMCA 5HGTA 4KV6A 1EYCA 1STAA 1TQOA 5CV5A 2F0EA 1EY4A 1KDCA 1SNMA 1EY9A 5EKLA 5E1FA 3TP8A 4H7BA 4RKBA 2SOBA 5EGTA 5C6AA 5CR3A 4I65A 4ZUJA 5I6WA 5EKKA 4ZUIA 1STHA 4J6HA 1JORA 3H6MA 3PMFA 4B9WA 5KRUA 4RKLA 1F2YA 1NSNS 1STNA 5KGUA 4KY5A 1STBA 2PW5A 3U9OA 5IGBA 4EQNA 1SNQA 4LAAA 2F0GA 4TRDA 5KIXA 1SYGA 2RKSA 4G57A 4R8NA 3RUZA 4K2LA 2F0NA 2NUCA 5I6YA 5C4ZA 2EYPA 1SYFA 2F0IA 2PYKA 1EY5A 1II3A 4K2KA 4NMZA 1A3UA 3QOJA 2EYMA 5NUCA 5F2DA 4DU9A 1EZ6A 5IIFA 3NK9A 4MIUA 3SHLA 4WORA 5C3XA 4EQOA 5K5PA 1EY8A 3EROA 1U9RA 2F0MA 3SK5A 4K5XA 4PMCA 2EXZA 3T13A 5IGGA 5CV8A 4IZ8A 2EYFA 3TP7A 4ME5A 2SNMA 3DMUA 3TP5A 1KDBA 1ENAA 5IGDA 5IODA 2F0OA 2EY6A 3OMGA 3P1HA 2EY1A 2F0WA 4ID6A 5CGKA 5IGCA 5M9OA 1AEXA 4PMBA 3SK6A 3SK8A 5ISRA 4WRDA 3HZXA 1KABA 2F0VA 3D4WA 4KY6A 5C3WA 3ERQA 1SYEA 1EY7A 1JOOA 1A2TA 3E5SA 4K8IA 3BDLA 5I9PA 2RDFA 4EVOA 4J1MA 2EY5A 4F8MA 2PZTA 3LX0A 2EYOA 2F3WA 4F7XA 4N9PA 3S9WA 1A2UA 2KQ3A 5J22A 4ZQ3A 1SYDA 3P75A 2F0KA 3BDCA 2PQEA 5IGEA 4B9XA 4ODGA 4DF7A 1EQVA 4DFAA 4KTAA 2F0LA 4NP5A 5CV9A 3C1EA 4KJOA 4N9TA 5JOBA 3SR1A 5DAUA 2F0SA 4HMJA 4K6DA 1IHZA 3MVVA 3R3OA 2PW7A 3MHBA 3EJIA
chains in the Genus database with same CATH superfamily
2E2DC 1VQEA 4M1UB 2F3VA 4DV7Q 4LF9L 4P2CB 2AMCB 5LMUL 5CGKA 1C9OA 2QKIC 4A3JB 2UXBL 1S5FD 4FF4A 1BQQT 4AYBG 4E6IA 1SBBB 4KMUC 2KECA 4XTCS 4DN4M 3HOWB 3HG9A 3LGJA 3FEWX 2UUAL 2CHBD 2WP8J 4G7ZC 5C44H 2O4XA 1PTOH 2HQLA 2FMCA 5I2YA 4CDEC 4KKUA 5HURA 5C4HA 4BY7B 3OTOQ 5JEAJ 1HA6A 1Q82C 2IT1A 1VF5C 5GADC 3MEFA 1TS2A 3MWYW 1A62A 1F2ZA 1QVGA 5IP9G 2QW7A 1JQYD 3L0OA 4OWWB 3S1QB 2UUBL 4ZYSA 2F0EA 3I3CA 1JJ2A 2EQSA 4LF8L 3H6MA 4J15A 4CKCA 1ZYRC 2R7ZB 3MA2B 1Q3LA 1Q8KA 1SAPA 5EBCA 4BXXH 2DY7A 2WKDA 1TWAB 1B44D 1PH2A 4LF4L 3PF4A 4DR1Q 1QJOA 2G9HD 5M3MG 3CF5A 2TMPA 3KJPA 1K8GA 4K5XA 1I4PA 4QUCA 2JQOA 1X55A 1OXVA 1N33Q 4FF3A 5IODA 2I5HA 4ID6A 1PRTB 3I4OA 2ZJPA 1YJWA 3EBEA 2TSSA 1YIJA 2MP1A 4A3DH 1F77A 5ELBA 2JA9A 3CQZB 1L1OB 4U673 1B9MA 4L63B 1Y1WB 2NVYH 3D6WA 4Q5VA 4X64Q 2C35B 1E24A 4DR1L 2Q2UA 4A3KB 3TZUA 1BKBA 1A15A 2A5HA 4KTAA 3PUYA 2JA6G 4POFA 3K7UC 4CDFC 3JC66 2F0SA 1KLUD 5ELNA 3RLOA 2JJQA 1KQSA 1N33L 5C4JB 4DAYB 2UXDQ 1UEAB 3A7LA 3I4NH 2CW0C 1K73C 1TT2A 3ZYYX 1ENCA 4WFN3 1VQ5A 4C3IH 3RD4A 4JBWA 4QQBX 3HRZC 3K5NA 3F2DA 3A7AB 1RF2D 3S1MH 3QJYA 1MJCA 3F8TA 3QOLA 5C0XG 2B63H 1A3VA 2RBMA 2IX3A 4K0KQ 1IKMA 5G3LD 1HUNA 3M4PA 4P72A 2NBFA 4H02A 1NE3A 3D3RA 1U0LA 1WTVA 2N88A 2OXPA 1LUZA 1KHIA 3OWEB 2K5VA 1G2TA 1HFNA 5FLMG 3A54A 3U9SA 1AZPA 1JWUD 4OELB 3JAML 1SNMA 2KOLA 4H44C 1XPOA 4ZUJA 4BA2I 2NN6G 4HAEA 2B8GA 4KN4C 1Y8OB 4UPAA 4K0KL 2VZAA 2VXWA 4RH6A 2NN6I 3PMFA 4B3MQ 3K8AA 3U9OA 2K04A 4PG3A 1GD7A 3E3XA 4LAAA 5M5YH 4A4IA 4DR2L 3AFQA 4DK6C 3M85A 4GOPA 1PRTC 1RHPA 4RGOS 2AQ2B 3UDGA 4C3HH 1VQPA 3IRBA 2AUKA 3SHLA 1AE2A 1RODA 3VR5A 4A3IG 1OXUA 3R93A 3TP7A 2K14A 4DAVA 5IYBH 4HN7A 4BBSB 4XIGS 3HS0C 2EY6A 3H3VC 2L9HA 3E9IA 4HJ5A 1H95A 3HOUG 5M5WB 1WFQA 3T56B 1CK1A 5ELEA 4H0LC 1PXUA 1K9MC 2V1CC 4PZ6A 3LX0A 4OEMB 1K3RA 3ERSX 2L11A 3K80C 1M90C 3J80i 1S3OA 2A6HC 4A3GB 1LO5D 3KBGA 1HNWL 2AWOA 3Q0AA 1BUVT 5AFWA 1JE5A 2MQHA 3A8IE 4IFDJ 1QILA 5T1GA 4V0BA 3BVZA 2KCNA 1QZGA 1Z6HA 5FLXc 1PZID 1GUSA 1VQ6A 2B2VC 1FJGL 3NQTA 3S16B 4HIDA 1GKHA 1IBKQ 1RTNA 5L37A 2I07B 1N34L 1J6QA 2OQ0A 2H1EA 3UE1A 2IY5B 1Z9FA 1TWCB 1SSOA 3CCJA 1V43A 2D0PA 1P8LA 2E76C 1CA5A 1YHAA 2B2VA 4B3RQ 1CSQA 4PNYA 2PQAA 2XSCA 3T16A 1S5DD 1J9OA 2R92H 2MPMA 1GUGA 3I8ZA 1RJTA 1T9HA 4JI1L 2UU9Q 2A68C 1D1IA 2EPBA 3PQIA 2WACA 4RA8A 4A3EG 1RKNA 3D4RA 3M4OH 1SJHD 3CKIB 1LT6D 4JPBW 1YZ6A 3KFUA 2B2TC 1I4GA 1LTAD 1PH8A 1KRTA 1AZQA 3SEBA 1X9NA 2K5WA 5E1FA 3G7LA 4N8X1 5FO8B 3J7AV 1STHA 4TQUS 3PUZA 1XMQL 2IWHA 1OTCA 4B3TQ 5COYA 4X65Q 4C1NK 1SNQA 3BZKA 2IHEA 2VQEL 2UU9L 4K2LA 2NVTB 3GTOB 2L0CA 1FGUA 4GN5A 1UWVA 3UDXA 3GV6A 1EL0A 3IAYA 3S15B 4JW0A 2PCFB 4A3FB 1TWFH 4DR3L 3NBHB 5HY6A 3X3NA 1EEFD 3S14H 2KHIA 1N9WA 3HOZB 4LNQA 1OO9B 1YHQA 4C3JB 1YVCA 4GN3B 4JI7Q 1B3AA 1Y14B 3E9HA 3PO2G 2UUCQ 4X65L 1ZKOA 3VR4A 5I9PA 4EVOA 1KRSA 1PYBA 3FPUB 1A2UA 3V05A 4IFDH 1K8AC 1U4PA 3L7ZC 3M3YH 4MTNA 4O42A 1PLFA 4LF5L 1FL0A 4GNXB 1HZ9A 3S2HB 4DF7A 5EPKA 1G2SA 1E22A 1EQVA 1BR9A 1VQLA 4A93B 2JA5B 4KJOA 4BWGB 1C48A 1YNJC 2EIFA 2DGYA 2NZ1D 2I5MX 2WAQB 5FJ8H 4IUUA 5D14A 1T5EA 1EU3A 4Y7NB 5FK9C 4IPCA 1UE7A 2KHSA 4LUZA 1FNUA 1WTOA 4GLAC 3J81E 4S3SA 4YCUA 2R61A 3D0FA 4GZYC 1VQGA 3QWNA 5LL6X 3FKIH 4KD4A 1RTOA 2LMCB 3NP8A 1DD2A 1ENFA 4RMFA 4KI0A 4R4TA 5G3LF 3PO3G 4QCLA 1R9TH 2ENBA 4IJLA 1EWIA 2R7DA 1SYBA 4OXPA 3SXHA 4BY7G 4A3CG 1UNSA 2MHVA 1SNDA 5JJLA 4JI5Q 1V1QA 5KYIA 1D8LA 3NXWA 2QDLA 1QUQB 3FDTA 5ELCA 1EIFA 3S2DB 4WJ4A 5A35A 2NTTA 1X56A 1IW7D 2K5HA 2GA4B 2YYZA 1IBML 4XT1B 1E1TA 4UP8A 5EKLA 4H7BA 2CWAA 2SOBA 1SXTA 5I6WA 3RZDH 5C0XJ 3K6OA 1VQIA 4CJ0B 5AJ3L 4JBMA 1EFID 3AYHB 4L5SA 4O1NA 1STNA 5KNCA 1ICWA 5IP9H 1NJIC 1B8AA 4JOIC 3GO5A 3MXNA 3VYTA 1O7ZA 1PH7A 1NBWA 4DV5Q 1XJVA 1SN8A 1I50B 2YU9B 3SGIA 1QVCA 3I73A 3RN5A 3T1YL 1VQBA 4NMZA 4JV5Q 5F2DA 3S17B 1GUWA 1GUNA 3I56A 1VQHA 1Q12A 1L2FA 1SE3A 3DMUA 4C3HG 2RQXA 4GNXC 1H9JA 1HNZQ 3I4MG 1TWHH 2WAQE 5M3MH 1WCMG 3KF8A 2M2LA 1D5ZC 1X32A 2IPKD 1I6HH 5IGEA 2GN5A 2DY8A 1KLGD 3ONAB 3H3VI 4DR5L 2XGTA 3QG1A 3NENA 4QIWE 2H4OA 1A8VA 1C7YA 4K6DA 1Y1VB 2I46A 3BDOA 4IUNA 3A0JA 2KCCA 4YWMA 1HNZL 2A69C 2N55A 3GTJH 1DONA 4DAPA 1EYDA 2WB1B 4DNRB 1QE6A 3W1GA 2EJFC 3STBC 1ZEQX 2JE6I 1EEID 4BY1G 4JI2L 2JA6H 1AE3A 2VY3A 4IUTA 2JA7G 1CI3M 1EYAA 1TS3A 1B3QA 3H0GB 1JJCB 1YJ9A 4GLVB 5C5MA 1SE2A 1WI5A 1HQMC 1X3GA 4YHHQ 2KEDA 1F2MA 2FMMA 3C1FA 2RHQB 5CV6A 2F3IA 3GTPB 2F4IA 3W1BA 5C0XH 1A0IA 2JEAI 1V9PA 1Y69U 2UXCQ 1T5XD 1JCKB 3AU7A 3T51B 1DZ1A 1KDCA 2L1BA 5C6AA 1MSGA 3GTGH 2IL8A 2A8VA 3TRZA 5M5XB 4HJ8A 3DWQA 2BH8A 2ZM6L 4LWCA 4A3BB 1O7YA 4B9WA 4DV3Q 1IYUA 5KGUA 2A73B 3CW2C 2K6AA 3OW7A 4AH6A 1GUOA 1H9SB 1V1OA 3KJOA 1XNRQ 1AP0A 4ME3A 2F03A 2NN6H 5NUCA 4OO1I 2UXCL 4MIUA 4WORA 1YNND 1BCPB 1ESRA 4ZRZA 2EXZA 2PNHA 2O2LD 5BR8Q 4DNIA 4BBSG 1HR0L 2NWGA 5IGCA 1NTGA 1NMGA 5KNDA 1XXGA 1XPUA 4WRDA 1PTOB 3D4WA 2HIXA 3T1HQ 1HQRD 1E0BA 1JOOA 2ICEC 2JSOA 4XXEA 1BOSA 2D62A 4A3MB 2CFMA 2NVQB 3BYTB 4A3IH 4ZKCB 2PI2E 3IKJA 4F88A 1XNRL 3VR3A 3S1RH 1DM0B 1B9NA 2J7ZA 4L8JA 3HOUH 2AKWB 1AW7A 1PFMA 5EPJA 1JWMD 1TKWB 1BXTA 1TY2A 1ICFB 3OPOA 1VS0A 1PYSB 3B6YA 3NTIA 3GTLH 2ZJRA 1SNOA 2Z6KA 3KF6A 4HR7B 1CZWA 2EYLA 5LMUQ 1N36L 4QB4A 3D8GA 3MZ5A 1EY0A 4HMIA 1KDAA 2JA8G 2UXBQ 1PYWD 2RDHA 3LWEA 5HGQA 1K83H 1ILPA 4H13C 4RGTA 3RR5A 1LV9A 4QUFA 4NXML 1VQFA 4TSSA 4OX9L 1A3TA 4RWSC 3FMCA 3J81L 1SNPA 2K4KA 1FD7D 3I70A 4IQZA 5J1ZA 3BYYB 1LT4D 5FLXE 1MHWC 3D6CA 2E2HB 1O7IA 3QB3A 1Q86C 5IY0A 4FNFA 2PZWA 1PH4A 4HTHA 3K5LA 2OT2A 4LFBL 2LKVA 3V2TA 1WTHA 1W6KA 3DHQA 3Q23A 1HNXL 5HGTA 1K3BC 2UUBQ 1EYCA 2K32A 4A3DB 3SDZA 5GAEC 3HOYB 4HCEA 1Z47A 2MUYA 2NVYB 4F87A 4QJFA 1UUPA 4I65A 3TN2A 3CCQA 4JCVE 4LF8Q 4J6HA 4N8FA 2ZTCA 2BOSA 3OIQA 1Q81C 1R4PB 4R4IA 4A3EH 1BCPC 4DV2Q 3PIP3 2K52A 2N49A 1Q90A 5BN5A 2NZHA 3R2IA 4R4QA 2MO0A 1UE5A 1DOKA 3I4NB 4U68A 3LWUA 3WDNA 3CMEA 4CHTB 1ASYA 4LF4Q 3QOJA 4DUYL 1PTOC 1F9RA 3I91A 1UAPA 3SK5A 4C3IB 1E2ZA 5CV8A 4LF7Q 4ZAIA 4UAIA 4ME5A 3TP5A 4L5RC 5IGDA 2L12A 4JI8Q 3HOZG 1ZYRD 3JAMi 5ISRA 1GVPA 3UE0A 2B63B 4DNTB 4R8IA 4DV2L 1SFOH 1M8AA 1I4RA 5GAGC 4GOPB 3NELA 2R6GA 3AQQA 4F8MA 3M4YA 4F7XA 2AWNA 1I94Q 3S1NB 4G7OC 3ER0A 5GQOA 4JC0A 4XQQA 3C46A 4GKKL 5IE8A 1U4MA 5BN3A 2N78A 4A93G 5CV9A 4BS9A 2EVBA 4LF7L 3PO2H 2K75A 2ZT9C 5LHY1 1LTID 4L5TA 1KAWA 2WAQG 3HEJA 3E6ZX 4C1NI 3P7JA 4CKBA 4YCVA 4JI8L 1VQAA 2PNRC 1H9RA 1B7YB 3BVMA 1G6ZA 4I7AA 3VYUA 2RSOA 1I94L 4DV0L 1JOQA 2P5ZX 5M5YB 1QNUA 4QMGA 1FYCA 4EQ5A 1S5CD 4PMWA 4IURA 1FNWA 2Z9HA 1SMYD 1L0WA 1HTLD 1Y8PB 4RCNA 2CW0D 4JI3L 1SNCA 4KY7A 3GP7A 1SE4A 2Z6BA 2XTIA 5EPLA 1C8CA 1BBWA 4XT3B 3J7YW 5IGFA 1JOKA 4PQXA 2JP1A 4BBRG 3PO3H 1STAA 5C3EG 1XPRA 1LABA 1M4VA 1PFSA 3OYYA 4BY7H 2RHSB 4A3CH 4X62L 1Q1EA 4OGQC 2PO4A 5FO9B 2CH4W 5DM73 1HPCA 1PHJA 4X66L 1PFNA 1IL2A 1LYLA 1STBA 1BO0A 2BE5C 3W2DA 1HH2P 3IL8A 4DR2Q 1C0AA 3CCSA 5I6YA 3NWSA 1IXRA 2F0IA 2MO1A 4P74A 1PFBA 1K0SA 3Q22A 4IOAA 3Q8DA 4EQOA 4JBJA 5C3XA 4GOPC 4PMCA 3T13A 5IGGA 4LFCL 1ASZA 1TWAH 2F0OA 4IPDA 1NAPA 4B3SL 3IFDA 3QO2A 1U4RA 4PMBA 4XQJA 4ZCKA 4JK1C 3MXGA 2D0OA 2E5LQ 2B2YA 3CPWA 2PZTA 3KLSX 1PRTD 3VDYA 2R92B 3FRPB 1VQJA 5A2QE 1PH6A 1HNWQ 4KLKA 1GXDC 2QEXA 1YITA 3I4MH 4NW2A 1B4OA 4N9TA 1BF4A 3ULJA 3K58A 3E0JA 1WCMH 3MTSA 3CMAA 4IPGA 1SMXA 4JI0L 4K8JA 2F0JA 2PZUA 4C2MH 4YY3L 4ALPA 1EFWA 1HZAA 1WOCA 2CKZB 2E5LL 4KHZA 1FJGQ 2EDGA 1XWEA 3CCVA 2ZTDA 5CV4A 2A6HD 5IOCA 5M3FG 1N34Q 2J0TD 1KAAA 2E75C 2EYJA 3RNUA 1LM0A 2F0UA 5H1SE 2SNSA 1VCIA 2QGQA 4P75A 1CQFA 5ELOA 2MJ8A 4RFBA 3J7ZC 1EQQA 1A63A 4R4OA 1TWFB 3HKZG 4Y52H 4BY1H 1IBLL 2IX0A 1UE6A 1G91A 1X3FA 2CQOA 3OHXC 3VA5A 4G7HC 3I2ZA 3S14B 4JI1Q 2HDLA 3CCUA 2JA7H 4IOCA 2NVXB 2F0FA 5FLXL 1F2LA 3ZJYC 2J4XA 4KJNA 5I2XA 4K5VA 2XRSD 1HZCA 3OMCA 5K36G 2R93B 3OIPA 3CP0A 1EOTA 2K50A 1TWGB 4RKBA 4OWXB 3M3YB 2DJGC 5EKKA 4GN4B 2B29A 4HJAA 1JB3A 3S24A 1S4ZA 4UDUC 3EQLC 1XMQQ 5EAYA 2EXDA 2B2WA 4HIKA 1MKHA 4G57A 2A68D 2VQEQ 3C2PA 4WJ3M 2JXMB 2ZXPA 1SYFA 1LT3D 1YNXA 3A5UA 1H9MA 1EZ6A 2B39A 1KXLA 2A6ED 5K5PA 2VB2X 3EROA 1U9RA 1CZGA 2BCOA 5E4XA 4NXNL 4XDXA 4DR3Q 3C3LA 3KK7A 2OWOA 2RDGA 1B53A 1SLJA 3FKIB 2K5QA 3HOXG 1HZBA 4DUZL 3H94A 4ZLTF 1PZKD 3SK6A 4B08A 1VQ9A 2F0VA 3U4VA 3TEHB 4A3MG 4AYBB 4P73A 1P16A 4FDBA 2KQ3A 4IUVA 5IYCG 3K5MA 2Q2IA 3WOFA 3X3MA 4BBSH 4LF5Q 5IT9c 5FKAC 3UDFA 4X3SA 2F0LA 2VUMB 1NY4A 3C1EA 5M5WH 4DV1L 2K28A 3A74A 4HJ7A 5IP7G 1PV4A 1PH9A 3MVVA 4LF6L 3KOJA 3PIPA 3EJIA 3NHHA 1N8RC 3KF8B 2JN4A 4TKOB 2VQFL 4LFAL 2V4DA 3U58A 4J8QA 1C4QA 1BDOA 3BU2A 3RZOB 5JAVA 4OIKA 2E74C 2Z4IA 2ZJQA 3NBIA 2F0QA 3CHBD 5E7NA 4YWLA 3OSOA 1EWHA 4OWTB 1YNJD 3PSIA 3PIO3 4KHPQ 4RAUC 3J80c 2JA8H 5EQ0A 3NPPA 1KC8C 1HRJA 3I4LA 3VR2A 5DNFA 2IW3A 1R4QB 2R7FA 3QIAA 1GO3E 1O7LA 3UI2A 4A3JG 1G8ZD 1HXYD 1NCVA 5J3BA 1TWHB 1SR3A 1TWCH 4DR7L 5M3MB 1MBYA 4QGUA 1I5FA 2F1MA 3IFTA 3PUVA 1IBMQ 1PH5A 3HOWG 3BZDB 3HOYG 4AQYL 1I6HB 1ZXTA 4XYQA 2K33A 5AJ3Q 4KHPL 4UP7A 3K7AB 3I90A 4RKLA 1EIHA 1AN8A 1PVOA 3CC4A 3CU7A 5IGBA 2DN8A 1TU2B 3TS2A 1TS4A 2EYPA 2SDFA 4CDCC 3T1YQ 1MD2D 1II3A 1Q46A 4AYBE 1V1PB 5IIFA 3KLRA 2F0MA 2JA6B 2YTYA 4HIMA 1O78A 1TVXA 2D2CC 1SJED 1EQRA 3HP3A 3KYHC 5JPNC 2G5DA 1FVIA 1ENAA 3RLFA 4DR6L 2WKCA 2R7ZG 1D2BA 4ZK9B 3KDFA 3GTMB 3DEPA 1IYJB 1PRTF 1ML0D 1I6VC 1D7QA 1LTLA 2QCPX 2ID0A 4TVAB 1K28A 3HOZH 1LTBD 2DUDA 3HOVB 1TS5A 2AQ3B 5IYDG 4NP5A 4DR5Q 2VB3X 1CQVA 5A2QL 1CHQD 3K59A 3BZCA 3DXJC 3Q6SA 4DGZA 1OXTA 1RL2A 4OL7A 4O2DA 4RHRA 1K8MA 1E1OA 2F0DA 4JI2Q 5LMNL 4A93H 1Y1WG 1Q7YC 1WJJA 4NDXA 3GTKB 5DEHA 4A3KG 3G48A 1SROA 1V8QA 3QR8A 1GUTA 2YTXA 2AQ1B 1OXSC 2EYHA 3KF6B 5GAHC 1NMFA 3R2TA 2A69D 5CV7A 2ZXOA 4O0AA 3STBD 1CT1D 5I9OA 4NB3A 3M7NA 3CPFA 1VQOA 4JI6L 1QB5D 2QA4A 3PUXA 3K57A 4A3IB 1EY4A 2F4VQ 2LS01 1YI2A 4PV1C 2ZM6Q 4ZUIA 1I3QB 4IJHA 1FGBD 3HFZB 5JJKA 3BS1A 3HOUB 2RVLA 3J81i 4C56C 1L0XB 4DKAC 1E3PA 4BBRH 2F0GA 5C3EH 2EJMA 1HA5A 3GTLB 2F0NA 1PDQA 2K7VA 4CBVA 1S5BD 1VQNA 1CFMA 1CM9A 1K83B 4X6AH 4LJZC 3ND9A 1YHBA 1A6XA 2F4VL 2B8FA 2K5DA 1HR0Q 5C4XB 5EJWA 4APVA 1UEBA 1YBYA 2VS1A 1LTTD 2ZTEA 3SE0A 2YU9H 4JI4L 1G51A 5M9OA 2BDNA 3ULPA 3FPPA 5C3WA 3S17H 2OCEA 4RGMA 1S5ED 4KKSA 4FXKC 4P71A 3BG3A 1VQ7A 4ZQ3A 4OO1G 3BDCA 3MFGA 4L6TB 2HHHQ 1HR0W 3A8KE 1LLRD 1VQKA 4DXGA 5DAUA 1O80A 2F52A 5D65A 3MHBA 5IWAL 4HSVA 1IL8A 1JR0D 4YIJA 2BA1A 3MAQA 3F2BA 1N36Q 5C44B 5T1IA 1STGA 1XNQL 4DXFA 2Z6KC 3CC2A 2WB1E 1CA6A 2O5JC 4IUQA 1IKLA 2Y0SB 1STYA 2E2JH 4NXMQ 2K03A 4A3GG 1B70B 4JYAL 3SK4A 4OX9Q 2HHHL 2VNUD 2CH4A 1W2BA 2EY2A 4G4KA 1U4LA 1XMOL 1RDPD 1CHPD 1WTPA 4OIJA 4X3UA 5CORA 2RF4A 3PUWA 3FP9A 5M3FH 3KBXA 4LFBQ 2QDBA 4IUPA 3T4AC 4CDDC 5JVG3 3K0XA 2L5TA 1U5KA 2B2UA 1HNXQ 1FR3A 1F9PA 2I5LX 2OTJA 2HCIA 4GKJL 1DYQA 5CR3A 4IFDI 2K5NA 3GTPH 1F9SA 1H9KA 5CMDA 1PMRA 2A19A 1LTSD 3PO2B 1RIPA 3V96A 5K36H 3PGZA 3O13A 4R8NA 3H91A 3CC7A 2PI2A 1KNAA 3LNNA 3GTQH 1EQTA 1VQCA 1IZ6A 5ELDA 5M5XH 1A3UA 1XTDA 3NE5B 4DUYQ 2JK8A 2IHFA 4FF2A 3DM1A 1GM5A 1KDBA 3OMGA 1HFGA 1E2VA 1BCPD 3SK8A 3TSSA 3ERQA 1A2TA 3D31A 4V190 3MXUA 2EY5A 2EYOA 2E8GA 1YJNA 4DV6Q 1XYIA 1PH1A 1PTOD 3HOXH 1VDZA 4GKKQ 3AEVA 2L55A 2Y0SE 4NPSA 2E2IH 3L9AX 1K8OA 4A3FG 2VUMG 3KLSA 1E2WA 3EN2A 4HMJA 5CYUA 3PO3B 1F9QA 1J5EL 2RSNA 3R3OA 3S1MB 4IN3A 2Q8TA 4A3MH 2NVQH 4DV7L 2FHTA 4C3JG 5IYCH 5BN4A 3NWTA 5E4WC 3G6EA 1GOZA 1VF7A 4YWKA 3AB9A 4K6LA 1H9SA 1VQ8A 4DV0Q 2WV6D 4DV6L 5IP7H 5IT9E 1JWSD 2ASBA 2H5XA 1QZHA 3TZDA 2EOTA 2YV5A 3BJUA 4DPGA 2NB0A 1EY6A 2JA5G 1ET9A 3OWFA 2Z1CA 2X6LA 2Z4HA 3A56A 4KD3A 3OTOL 5DLQE 4JI3Q 2O5IC 2WIIB 2JEBI 1Y8NB 1CKNA 2B3GA 4KKTA 1WVLA 2N8NA 4LK1C 3VYRA 4DA2A 2RCNA 2LXJA 1JE4A 1KTKA 1Q8IA 3GV3A 3NSWA 2NTSA 5CV5A 3R8BA 2BH2A 2E2HH 1N32Q 4X62Q 3A5ZB 1MGSA 3J80E 2Q2TA 4C3HB 3U50C 4A3JH 4X66Q 5KRUA 3I4MB 5JVH3 4KY5A 2NZOA 1WCMB 2L4NA 2KA7A 4EQNA 1M1KC 3G4SA 4TRDA 3HOWH 3HOYH 3AMUA 2RCFA 4C2MB 2ZXRA 4K2KA 3CXCA 4ABNA 2LY7A 4IO9A 1ESFA 1JB7A 4X3KA 4LFCQ 1N32L 4CGYB 1DCZA 3N52A 1DXMA 4AIMA 1SMYC 1I4QA 4B3SQ 2BA0A 4MHEA 5FOBB 2ICIA 2PQAB 5CBEE 3CD6A 1QOHA 2BE5D 2XWJB 1KABA 4FVMA 3S1QH 4MNOA 1MSHA 4K8IA 2Q8IB 3H15A 4BY1B 1WTXA 1I4HA 3VYSA 1PA6A 1SYDA 4X64L 5JEAH 1VQDA 4HSPA 1YEZA 2B2YC 4B9XA 2JA7B 3HOVG 2R7ZH 3DEOA 4GS3A 3SVMA 2IJ0A 5C0XI 2X69A 2C9OA 1EWCA 2IX1A 2KEEA 1HUMA 2HT1A 2KVMA 3S1NH 3A55A 2UXDL 4I7ZC 4JI0Q 3MXPA 4YY3Q 5J39A 2WFWA 1WD0A 2VL6A 5JJIA 2Q2HA 1BBXC 4MN3A 3JAMc 5IYDH 1SRUA 1KIXA 1CTMA 1G291 5E3FA 1KNEA 2M00A 1KD1C 3GDEA 1SYCA 1QG7A 5ELFA 3M4OB 1CKOA 5TSSA 3J7A5 1Y1VG 3N6RA 1NNXA 3CQZH 4OHJA 5KNBA 1VQ4A 1W3SA 1IBLQ 3I55A 4ZKBB 1Y1WH 2QILA 3H3VH 2WB1G 1ET6A 3TMEA 4K14A 4A3KH 2KHJA 5KEEA 2FFKB 2C5CA 3NQIA 1Z7TA 2XVSA 1X3PA 4HIOA 3L3OC 3W5OA 1HHVA 1EYGA 5C4JH 1L1OC 1EY9A 2EZVA 3H0GG 3H09A 4OONA 4RGNA 4B3ML 1MI2A 1PZJD 3WOEA 1CKMA 3NTHA 3UDIA 3A8JE 1SDFA 2PW5A 3CRKC 3GD7A 1WYDA 3TQYA 1QCBD 2K01A 5KIXA 3AFPA 2YTVA 3EA6A 2PMZB 1JMCA 1L1OA 1TY0A 2B2WC 2AUJD 1VMCA 2XNAC 4DU9A 3NK9A 3MFYA 4NXNQ 3M4QA 4ULLA 3OW2A 1GHJA 4A75A 2EYFA 3CRLC 2M9VA 5C4XG 2A1AA 4DUZQ 1LTRD 3P1HA 3G6JB 1BCPF 4A3BG 4FXGC 4A3LG 4DAYA 3J81j 2MGSA 2JA8B 1EY7A 2XWBB 3ICEA 2F3WA 1HJPA 4WJWA 3M9BA 1PTOF 3EIVA 2F0KA 4HCSA 1SEBD 1RCVD 1JJGA 2KBNA 3W3AA 1TXYA 5GROA 3K0YA 4DV1Q 3RLNA 1BVSA 2PW7A 4EGVA 4LF6Q 5JPMC 3WWVA 4EQPA 1ILQA 3KDFB 1NUCA 5C44G 4OO1H 3MXNB 3CAMA 2XRQD 4LFAQ 2VQFQ 5EBDA 1R9TB 1I4XA 3F2UA 2Z0SA 1XX8A 1IBKL 2Y0SG 2A6EC 5CC4A 2K05A 1CUKA 5IT9L 4K5WA 4CJ2C 1STEA 5C5LA 4B3RL 4IPHA 3RZDB 2LXKA 4FP5D 2HIVA 4JBKA 4A3GH 1QWYA 2B2TA 4FXDA 2Q8RE 4KHVA 2OTLA 4CJ1B 2HQEA 1EZ8A 2OEOA 4DR7Q 4BXXG 2OF1A 2PMZE 4BA1I 4KV6A 5JJZA 1GHKA 3TBIB 4MZ9A 2RA4A 4AQYQ 4PZ7A 5EGTA 2GVBA 1VQMA 2HCCA 4KN7C 4LW1A 1X65A 3KUPA 1FNVA 1LT5D 3PV0A 2CVRA 2NVXH 1NSNS 3FHWA 4B3TL 3S16H 1GJXA 3J80L 1CSPA 2FJ2A 2R93H 3PCOB 3TREA 5D3DA 1TWGH 5C4ZA 2BDOA 2PYKA 4RG1A 1B50A 3F2CA 4A3DG 4DK1A 3L2PA 4XYOA 2PPBC 1DOMA 3OOCA 1AFPA 4IZ8A 2SNMA 3HKSA 2EJGC 4DR6Q 1G6PA 2EY1A 2Z8LA 1AH9A 3HZXA 4JI7L 3TS0A 1QNKA 1SYEA 4HJ9A 2UUCL 3BDLA 4J1MA 2R3ZA 3I4NG 1J8IA 3P75A 1WTQA 3CCMA 3GTJB 4QIWB 2LFNA 3FVQA 4C3IG 4DFAA 1D5MC 5JOBA 1S40A 3NEMA 1D1KA 5JEAG 3DUZA 3HGBA 2NVTH 3GTOH 1RD9D 5KYLA 2B63G 3KLWA 3DWAA 3S15H 5EKIA 4CKEA 4A3FH 5LMNQ 2VUMH 2NYZD 3URYA 2HDMA 4FO2A 3RMHA 5I4DA 3NUCA 4BBRB 1IW7C 4EX5A 5C3EB 1MJEA 1WTRA 2CCZA 1OXXK 2QF7A 4X3TA 1NR4A 2SEBD 5D3IB 4QF4A 1TR5A 4C3JH 2KCTA 2KJXA 5LL6S 2G9DA 2JYOA 2CQAA 4R9WA 4GLXA 3RZOH 1WD1A 1UE1A 2DJFC 3GTGB 5LMNW 3VR6A 1LTGD 4JI5L 1JT8A 3S2HH 4KK7A 2AHOB 2KCMA 1X3EA 4JI6Q 2JA5H 4Q0FA 3TP8A 2ATWA 4R1JA 4DAMA 3NBHA 3E0EA 4JOIA 2QEJC 4Y7NH 1TIID 1SE8A 1JORA 1EIYB 3CCRA 1F2YA 2D5DA 4DK3C 2I0QA 1DJRD 5IYBG 2HUGA 2XN9C 2RKSA 3EFXD 4QY7A 4DV5L 3TDQA 4A76A 3K81C 1B1ZA 5FO7B 4JV5L 1X6OA 4PZ8A 3CCEA 3K7AH 1EY8A 2MNAA 1BBUA 1EU4A 4GNXA 2E2JB 1EIGA 3M7GA 1E7ZA 4JVZA 3PF5A 3S1RB 2F0WA 4JI4Q 3S2DH 4KY6A 2K1BA 2XIWA 3E5SA 3MC0B 2RDFA 2OQKA 3NTKA 4N9PA 1D5XC 2D9UA 5M3FB 2EE1A 2FINB 4ODGA 4Z9CB 3U4ZA 1VMPA 1DOLA 2LSSA 4QL5A 4DV4Q 3GTMH 3SR1A 1JICA 1D6EC 1S72A 1KL9A 5IWAQ 3HKZB 4NKLA 1I50H 4RCOA 1EOVA 2F0PA 4M8AA 3RN2A 1XNQQ 1EUJA 2N3SA 3HOVH 3MEHA 1QUQA 3F1ZA 3EVQA 4RHSA 3DWPA 2R92G 3ULLA 4JYAQ 2F0HA 1V1PA 1HTPA 3GTQB 4YCWA 4LMQD 1XMOQ 3TP6A 3G71A 4DV4L 3GQBA 1MIUA 2F0TA 4YHHL 2ES2A 1X3QA 1W6JA 3ITPA 5FLMH 1X54A 3GTKH 2DNCA 2KUMA 3JAME 2DNEA 4A3EB 3D4DA 4IALA 3I72A 1Y1VH 1TQOA 3ND8A 1YNNC 4GKJQ 1BNZA 2A74C 2WINB 1QVFA 3Q24A 2B2UC 3HOXB 2CWPA 4UHVA 4DR4Q 3DM3A 2E2IB 3DLLA 4DV3L 4UY8C 1CKNB 3BVGA 4HEDA 4UP9A 1SYGA 1WTWA 3RUZA 2MFIA 3VA7A 2NUCA 4LUVA 1HCZA 2KENA 3H0GH 1EY5A 4POGA 2L15A 1SFOB 2EYMA 1PH3A 3P20A 3CCLA 1I3QH 4JG2A 3K5OA 3S9WA 2R93G 1Q1BA 5CBAE 4L5QA 4IFDG 5BR8L 1B2TA 2ALYB 1NR2A 1XTCD 4XQNA 3J7AF 1IYVA 4LF9Q 4DR4L 1LACA 4MTKA 2HD3A 1AEXA 1K0RA 1DGSA 1L0YB 3I7FA 3HKZE 2X6GA 3T1HL 5DM63 5FJ8G 4FYDA 5J22A 4ILWA 3J81c 2PQEA 4LUOA 5C4XH 2UUAQ 4DK0A 3PIOA 4A3BH 2FXQA 2VW9A 1ONLA 4A3LH 4R4CA 4FF1A 1JC7A 1J5EQ 1IHZA 3T53B 3FKIG 2GVAA
chains in the Genus database with same CATH topology
2E2DC 4M1UB 2F3VA 4P2CB 5CGKA 2QKIC 4A3JB 1S5FD 4FF4A 1BQQT 4E6IA 1SBBB 4KMUC 2KECA 4XTCS 4DN4M 3HOWB 3HG9A 3FEWX 2CHBD 2WP8J 4G7ZC 2O4XA 1PTOH 2FMCA 5I2YA 4KKUA 5HURA 5C4HA 4BY7B 5JEAJ 1HA6A 2IT1A 1VF5C 1TS2A 3MWYW 1F2ZA 1JQYD 3S1QB 4ZYSA 2F0EA 3I3CA 3H6MA 4CKCA 1ZYRC 2R7ZB 3MA2B 1Q3LA 1SAPA 5EBCA 2DY7A 2WKDA 1TWAB 1B44D 1QJOA 2G9HD 2TMPA 4K5XA 1I4PA 4QUCA 1OXVA 4FF3A 5IODA 4ID6A 1PRTB 2TSSA 2MP1A 1F77A 5ELBA 3CQZB 4U673 1B9MA 4L63B 1Y1WB 3D6WA 4Q5VA 4A3KB 3TZUA 1A15A 2A5HA 4KTAA 3PUYA 2F0SA 1KLUD 5C4JB 1UEAB 3A7LA 2CW0C 1TT2A 3ZYYX 1ENCA 4WFN3 3RD4A 4JBWA 3HRZC 3K5NA 3A7AB 1RF2D 3QJYA 3QOLA 5C0XG 1A3VA 2RBMA 2IX3A 1IKMA 5G3LD 1HUNA 2NBFA 3D3RA 1WTVA 2N88A 2OXPA 3OWEB 1G2TA 1HFNA 3A54A 3U9SA 1AZPA 1JWUD 3JAML 1SNMA 2KOLA 4H44C 4ZUJA 4BA2I 2NN6G 4HAEA 2B8GA 4KN4C 1Y8OB 2VXWA 4RH6A 2NN6I 3PMFA 3U9OA 2K04A 4LAAA 3M85A 1PRTC 1RHPA 4RGOS 2AQ2B 2AUKA 3SHLA 1RODA 3VR5A 1OXUA 3R93A 3TP7A 4DAVA 4HN7A 4BBSB 4XIGS 3HS0C 2EY6A 3H3VC 2L9HA 5M5WB 3T56B 1CK1A 5ELEA 4H0LC 1PXUA 3LX0A 2L11A 2A6HC 4A3GB 1LO5D 3KBGA 2AWOA 3Q0AA 1BUVT 5AFWA 3A8IE 4IFDJ 1QILA 5T1GA 4V0BA 3BVZA 2KCNA 1Z6HA 1PZID 1GUSA 2B2VC 3NQTA 3S16B 1RTNA 2I07B 2H1EA 1TWCB 1SSOA 1V43A 2E76C 1CA5A 2B2VA 4PNYA 3T16A 2XSCA 1S5DD 1J9OA 2MPMA 1GUGA 3I8ZA 1RJTA 2A68C 1D1IA 2EPBA 2WACA 4RA8A 1RKNA 3D4RA 1SJHD 3CKIB 1LT6D 2B2TC 1I4GA 1LTAD 1AZQA 3SEBA 2K5WA 5E1FA 3G7LA 5FO8B 3J7AV 1STHA 4TQUS 3PUZA 2IWHA 5COYA 4C1NK 1SNQA 4K2LA 2NVTB 3GTOB 2L0CA 3GV6A 1EL0A 3IAYA 3S15B 2PCFB 4A3FB 3X3NA 1EEFD 3HOZB 1OO9B 4C3JB 1B3AA 1ZKOA 5I9PA 3VR4A 4EVOA 3FPUB 1A2UA 3V05A 4IFDH 1U4PA 3L7ZC 4O42A 1PLFA 3S2HB 4DF7A 5EPKA 1G2SA 1EQVA 1BR9A 4A93B 2JA5B 4KJOA 4BWGB 1C48A 1YNJC 2NZ1D 2WAQB 4IUUA 5D14A 1T5EA 1EU3A 4Y7NB 5FK9C 2KHSA 1FNUA 1WTOA 3J81E 4S3SA 2R61A 4GZYC 3QWNA 5LL6X 4KD4A 1RTOA 2LMCB 3NP8A 1DD2A 1ENFA 4KI0A 5G3LF 4QCLA 2ENBA 1SYBA 3SXHA 1UNSA 2MHVA 1SNDA 5KYIA 3NXWA 3FDTA 5ELCA 3S2DB 5A35A 2NTTA 1IW7D 2GA4B 2YYZA 4XT1B 5EKLA 4H7BA 2SOBA 1SXTA 5I6WA 5C0XJ 3K6OA 4CJ0B 1EFID 4O1NA 1STNA 5KNCA 1ICWA 3GO5A 3MXNA 3VYTA 1O7ZA 1I50B 2YU9B 3I73A 4NMZA 5F2DA 3S17B 1GUWA 1GUNA 1Q12A 1SE3A 3DMUA 4C3HG 2RQXA 1H9JA 3KF8A 2M2LA 1D5ZC 1X32A 2IPKD 5IGEA 2DY8A 1KLGD 3ONAB 3QG1A 2H4OA 4K6DA 1Y1VB 2I46A 3BDOA 4IUNA 2KCCA 2A69C 2N55A 1DONA 4DAPA 1EYDA 2WB1B 4DNRB 1QE6A 2EJFC 1ZEQX 2JE6I 1EEID 4IUTA 1CI3M 1EYAA 1TS3A 3H0GB 5C5MA 1SE2A 1HQMC 2KEDA 1F2MA 2FMMA 3C1FA 5CV6A 3GTPB 2F4IA 5C0XH 2JEAI 1Y69U 1T5XD 1JCKB 3AU7A 3T51B 1DZ1A 1KDCA 2L1BA 5C6AA 1MSGA 2IL8A 5M5XB 3DWQA 4A3BB 1O7YA 4B9WA 1IYUA 5KGUA 2A73B 2K6AA 3OW7A 1GUOA 1H9SB 1V1OA 1AP0A 2F03A 2NN6H 5NUCA 4OO1I 4MIUA 4WORA 1YNND 1BCPB 1ESRA 4ZRZA 2EXZA 2O2LD 2NWGA 5IGCA 5KNDA 1XXGA 4WRDA 1PTOB 3D4WA 1HQRD 1E0BA 1JOOA 2ICEC 2JSOA 4XXEA 1BOSA 2D62A 4A3MB 2NVQB 3BYTB 4ZKCB 3IKJA 4F88A 3VR3A 1DM0B 1B9NA 2J7ZA 4L8JA 1AW7A 1PFMA 5EPJA 1JWMD 1TKWB 1BXTA 1TY2A 3OPOA 3NTIA 1SNOA 4HR7B 1CZWA 2EYLA 4QB4A 3D8GA 3MZ5A 1EY0A 4HMIA 1KDAA 1PYWD 2RDHA 3LWEA 1ILPA 4H13C 4RGTA 1LV9A 4QUFA 4TSSA 1A3TA 4RWSC 3FMCA 3J81L 1SNPA 1FD7D 3I70A 4IQZA 5J1ZA 3BYYB 1LT4D 5FLXE 3D6CA 2E2HB 3QB3A 4FNFA 2PZWA 4HTHA 3K5LA 2OT2A 2LKVA 3V2TA 1W6KA 3DHQA 3Q23A 5HGTA 4A3DB 1EYCA 2K32A 3SDZA 3HOYB 4HCEA 1Z47A 2MUYA 2NVYB 4F87A 1UUPA 4I65A 3TN2A 4J6HA 2BOSA 3OIQA 1R4PB 1BCPC 3PIP3 1Q90A 5BN5A 3R2IA 1DOKA 3I4NB 4U68A 3LWUA 3WDNA 4CHTB 3QOJA 1PTOC 1F9RA 3I91A 1UAPA 3SK5A 4C3IB 1E2ZA 5CV8A 4ZAIA 4UAIA 4ME5A 3TP5A 5IGDA 2L12A 1ZYRD 5ISRA 2B63B 4DNTB 4R8IA 1M8AA 1I4RA 2R6GA 4F8MA 3M4YA 4F7XA 2AWNA 3S1NB 4G7OC 4XQQA 3C46A 1U4MA 5CV9A 4BS9A 2EVBA 2ZT9C 5LHY1 1LTID 3HEJA 3E6ZX 4C1NI 3P7JA 4CKBA 2PNRC 1H9RA 3BVMA 1G6ZA 3VYUA 2RSOA 1JOQA 5M5YB 1QNUA 4QMGA 1FYCA 1S5CD 4PMWA 4IURA 1FNWA 1SMYD 1HTLD 1Y8PB 4RCNA 2CW0D 1SNCA 4KY7A 3GP7A 1SE4A 5EPLA 1C8CA 4XT3B 3J7YW 5IGFA 1JOKA 4PQXA 2JP1A 1STAA 1LABA 1M4VA 1Q1EA 4OGQC 2PO4A 5FO9B 5DM73 1HPCA 1PFNA 1STBA 1BO0A 2BE5C 3W2DA 3IL8A 5I6YA 3NWSA 2F0IA 1PFBA 3Q22A 5C3XA 4EQOA 4PMCA 3T13A 5IGGA 2F0OA 1NAPA 3IFDA 3QO2A 1U4RA 4PMBA 4XQJA 4JK1C 3MXGA 2B2YA 2PZTA 3KLSX 1PRTD 2R92B 3FRPB 5A2QE 1GXDC 4NW2A 1B4OA 4N9TA 1BF4A 3K58A 3E0JA 3MTSA 4K8JA 2F0JA 2PZUA 4KHZA 2EDGA 1XWEA 5CV4A 2A6HD 5IOCA 2J0TD 1KAAA 2E75C 2EYJA 2F0UA 2SNSA 1VCIA 1CQFA 2MJ8A 4RFBA 1TWFB 2IX0A 1G91A 3OHXC 3VA5A 4G7HC 3S14B 2HDLA 2NVXB 2F0FA 5FLXL 1F2LA 2J4XA 4KJNA 5I2XA 4K5VA 2XRSD 3OMCA 5K36G 2R93B 3OIPA 1EOTA 1TWGB 4RKBA 3M3YB 5EKKA 1JB3A 1S4ZA 4UDUC 3EQLC 2B2WA 4G57A 2A68D 3C2PA 2JXMB 2ZXPA 1SYFA 1LT3D 1H9MA 1EZ6A 2B39A 2A6ED 5K5PA 2VB2X 3EROA 1U9RA 1CZGA 2BCOA 5E4XA 4XDXA 3C3LA 3KK7A 2RDGA 1B53A 3FKIB 2K5QA 3H94A 4ZLTF 1PZKD 3SK6A 4B08A 2F0VA 4AYBB 2KQ3A 4IUVA 3K5MA 3WOFA 3X3MA 5FKAC 4X3SA 2F0LA 2VUMB 3C1EA 2K28A 3MVVA 3EJIA 3NHHA 4TKOB 2V4DA 4J8QA 1C4QA 1BDOA 3RZOB 5JAVA 4OIKA 2E74C 2Z4IA 3NBIA 2F0QA 3CHBD 3OSOA 1EWHA 1YNJD 3PIO3 4RAUC 5EQ0A 3NPPA 1HRJA 3I4LA 3VR2A 5DNFA 2IW3A 1R4QB 3QIAA 1O7LA 3UI2A 1G8ZD 1HXYD 1NCVA 1TWHB 5M3MB 1MBYA 2F1MA 3IFTA 3PUVA 3BZDB 1I6HB 1ZXTA 4XYQA 2K33A 3K7AB 3I90A 4RKLA 1EIHA 1AN8A 3CU7A 5IGBA 2DN8A 1TU2B 1TS4A 2EYPA 2SDFA 1MD2D 1II3A 1V1PB 5IIFA 3KLRA 2F0MA 2JA6B 1O78A 1TVXA 2D2CC 1SJED 3HP3A 5JPNC 1ENAA 3RLFA 2WKCA 1D2BA 4ZK9B 3GTMB 3DEPA 1PRTF 1ML0D 1I6VC 2QCPX 2ID0A 1LTBD 3HOVB 1TS5A 2AQ3B 4NP5A 2VB3X 1CQVA 5A2QL 1CHQD 3K59A 3DXJC 3Q6SA 4DGZA 1OXTA 4OL7A 4RHRA 1K8MA 2F0DA 4NDXA 3GTKB 5DEHA 1V8QA 1GUTA 2AQ1B 1OXSC 2EYHA 3R2TA 2A69D 5CV7A 2ZXOA 1CT1D 5I9OA 3M7NA 1QB5D 3PUXA 3K57A 4A3IB 1EY4A 2LS01 4ZUIA 1I3QB 1FGBD 3BS1A 3HOUB 2RVLA 4C56C 1L0XB 2F0GA 2EJMA 1HA5A 3GTLB 2F0NA 1PDQA 2K7VA 4CBVA 1S5BD 1CFMA 1CM9A 1K83B 4LJZC 3ND9A 1A6XA 2B8FA 2K5DA 5C4XB 5EJWA 1LTTD 3SE0A 5M9OA 2BDNA 3FPPA 5C3WA 4RGMA 1S5ED 4KKSA 4FXKC 3BG3A 4ZQ3A 4OO1G 3BDCA 3MFGA 4L6TB 3A8KE 1LLRD 4DXGA 5DAUA 1O80A 5D65A 3MHBA 4HSVA 1IL8A 1JR0D 4YIJA 2BA1A 3MAQA 5C44B 5T1IA 1STGA 4DXFA 1CA6A 2O5JC 4IUQA 1IKLA 2Y0SB 1STYA 2K03A 3SK4A 2VNUD 2EY2A 4G4KA 1U4LA 1RDPD 1CHPD 1WTPA 4OIJA 4X3UA 5CORA 3PUWA 3KBXA 2QDBA 4IUPA 3T4AC 5JVG3 2L5TA 2B2UA 1FR3A 1F9PA 2HCIA 1DYQA 5CR3A 4IFDI 1F9SA 1H9KA 5CMDA 1PMRA 1LTSD 3PO2B 3V96A 5K36H 3O13A 4R8NA 3H91A 1KNAA 3LNNA 1EQTA 5ELDA 1A3UA 3NE5B 4FF2A 3DM1A 1KDBA 3OMGA 1HFGA 1E2VA 1BCPD 3SK8A 3TSSA 3ERQA 1A2TA 3D31A 4V190 3MXUA 2EY5A 2EYOA 1XYIA 1PTOD 1VDZA 2L55A 3L9AX 1K8OA 3KLSA 1E2WA 4HMJA 5CYUA 3PO3B 1F9QA 2RSNA 3R3OA 3S1MB 4IN3A 2Q8TA 2FHTA 4C3JG 5BN4A 3NWTA 5E4WC 1GOZA 1VF7A 3AB9A 4K6LA 1H9SA 2WV6D 5IT9E 1JWSD 3TZDA 2EOTA 2NB0A 1EY6A 1ET9A 3OWFA 2Z1CA 2X6LA 2Z4HA 3A56A 4KD3A 2O5IC 2WIIB 2JEBI 1Y8NB 4KKTA 1WVLA 4LK1C 3VYRA 4DA2A 1JE4A 1KTKA 1Q8IA 3GV3A 3NSWA 2NTSA 5CV5A 3R8BA 1MGSA 3J80E 4C3HB 5KRUA 3I4MB 5JVH3 4KY5A 1WCMB 2L4NA 2KA7A 4EQNA 4TRDA 3AMUA 4C2MB 2ZXRA 4K2KA 4ABNA 2LY7A 1ESFA 4X3KA 4CGYB 1DCZA 3N52A 1DXMA 1SMYC 1I4QA 2BA0A 4MHEA 5FOBB 2ICIA 5CBEE 1QOHA 2BE5D 2XWJB 1KABA 4FVMA 1MSHA 4K8IA 2Q8IB 4BY1B 1WTXA 1I4HA 3VYSA 1SYDA 5JEAH 4HSPA 4B9XA 2B2YC 2JA7B 3DEOA 3SVMA 2IJ0A 5C0XI 2X69A 2C9OA 1EWCA 2IX1A 2KEEA 1HUMA 2KVMA 3A55A 4I7ZC 3MXPA 5J39A 1WD0A 1BBXC 4MN3A 1CTMA 1G291 5E3FA 1KNEA 2M00A 5ELFA 1SYCA 1QG7A 3M4OB 5TSSA 3N6RA 4OHJA 5KNBA 4ZKBB 2QILA 1ET6A 3TMEA 4K14A 5KEEA 2FFKB 2C5CA 3NQIA 1Z7TA 2XVSA 1X3PA 3L3OC 1HHVA 1EY9A 2EZVA 3H09A 4RGNA 1MI2A 1PZJD 3WOEA 3NTHA 3A8JE 1SDFA 2PW5A 3CRKC 3GD7A 1QCBD 2K01A 5KIXA 3EA6A 2PMZB 1TY0A 2B2WC 2AUJD 1VMCA 2XNAC 4DU9A 3NK9A 3MFYA 4ULLA 1GHJA 2EYFA 3CRLC 2M9VA 1LTRD 3P1HA 3G6JB 1BCPF 4FXGC 4DAYA 2MGSA 2JA8B 1EY7A 2XWBB 2F3WA 4WJWA 1PTOF 2F0KA 4HCSA 1SEBD 1RCVD 3W3AA 3K0YA 4EGVA 2PW7A 5JPMC 4EQPA 1ILQA 1NUCA 4OO1H 2XRQD 5EBDA 1R9TB 1I4XA 3F2UA 1XX8A 2A6EC 5CC4A 2K05A 5IT9L 4K5WA 4CJ2C 1STEA 5C5LA 3RZDB 4FP5D 1QWYA 2B2TA 4FXDA 2Q8RE 4KHVA 4CJ1B 2HQEA 1EZ8A 2OEOA 2OF1A 4BA1I 4KV6A 5JJZA 1GHKA 3TBIB 2RA4A 5EGTA 2HCCA 4KN7C 3KUPA 1FNVA 1LT5D 3PV0A 2CVRA 1NSNS 1GJXA 3J80L 2FJ2A 5D3DA 5C4ZA 2BDOA 2PYKA 1B50A 4DK1A 4XYOA 2PPBC 1DOMA 3OOCA 1AFPA 4IZ8A 2SNMA 2EJGC 2EY1A 2Z8LA 3HZXA 1QNKA 1SYEA 3BDLA 4J1MA 2R3ZA 1J8IA 3P75A 1WTQA 3GTJB 4QIWB 2LFNA 3FVQA 4C3IG 4DFAA 1D5MC 5JOBA 1D1KA 5JEAG 3DUZA 3HGBA 1RD9D 5KYLA 3DWAA 5EKIA 4CKEA 2NYZD 3URYA 2HDMA 4FO2A 3RMHA 5I4DA 3NUCA 4BBRB 1IW7C 5C3EB 1WTRA 1OXXK 2QF7A 4X3TA 1NR4A 2SEBD 5D3IB 4QF4A 1TR5A 5LL6S 2KJXA 2G9DA 2JYOA 2CQAA 4R9WA 1WD1A 3GTGB 3VR6A 1LTGD 4KK7A 4Q0FA 3TP8A 3NBHA 2QEJC 1TIID 1JORA 1F2YA 2D5DA 1DJRD 2HUGA 2XN9C 2RKSA 3EFXD 3TDQA 1B1ZA 5FO7B 1EY8A 1EU4A 2E2JB 1EIGA 3M7GA 3S1RB 2F0WA 4KY6A 2K1BA 2XIWA 3E5SA 3MC0B 2RDFA 3NTKA 4N9PA 1D5XC 2D9UA 5M3FB 2EE1A 2FINB 4ODGA 4Z9CB 1VMPA 1DOLA 3SR1A 1JICA 1D6EC 3HKZB 4NKLA 4RCOA 2F0PA 4M8AA 3MEHA 3EVQA 4RHSA 3DWPA 2F0HA 1V1PA 1HTPA 3GTQB 4LMQD 3TP6A 3GQBA 2F0TA 1X3QA 1W6JA 3ITPA 2DNCA 2KUMA 3JAME 2DNEA 4A3EB 3D4DA 4IALA 3I72A 1TQOA 3ND8A 1YNNC 1BNZA 2A74C 2WINB 3Q24A 2B2UC 3HOXB 2E2IB 3BVGA 4HEDA 1SYGA 1WTWA 3RUZA 3VA7A 2NUCA 1HCZA 1EY5A 1SFOB 2EYMA 3P20A 3K5OA 3S9WA 1Q1BA 5CBAE 4IFDG 1B2TA 1NR2A 1XTCD 4XQNA 3J7AF 1IYVA 1LACA 1AEXA 1L0YB 2X6GA 5DM63 4FYDA 5J22A 4ILWA 2PQEA 4DK0A 1ONLA 4FF1A 1JC7A 1IHZA 3T53B 5BN3A 4PV1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGF A;  4YIJ A;  4EQP A;  4NKL A;  2F3V A;  4IUN A;  1SNO A;  1NUC A;  3NHH A;  4K8J A;  5KYL A;  2EYL A;  3MXP A;  2F0J A;  2PZU A;  3D8G A;  4QB4 A;  2F0P A;  4DGZ A;  3MZ5 A;  1EY0 A;  4HMI A;  1TT2 A;  1EYD A;  4OL7 A;  1ENC A;  1KDA A;  5J39 A;  1STG A;  2KHS A;  3NQT A;  2F0D A;  5JAV A;  4E6I A;  3MEH A;  4S3S A;  3EVQ A;  1JOQ A;  5CV4 A;  3NUC A;  1STY A;  2F0Q A;  4NDX A;  5IOC A;  4KD4 A;  2F0H A;  4QMG A;  5E3F A;  3SK4 A;  1KAA A;  5DEH A;  2EYJ A;  3HEJ A;  1A3T A;  1EYA A;  5CC4 A;  2F0U A;  3OSO A;  2M00 A;  3QOL A;  3NP8 A;  2EY2 A;  2SNS A;  1SYC A;  1TR5 A;  4QF4 A;  3TP6 A;  1SNP A;  1EY6 A;  1A3V A;  2O4X A;  2RBM A;  3OWF A;  4K5W A;  5C5M A;  2F0T A;  5J1Z A;  2EYH A;  5HUR A;  1F2M A;  3ITP A;  2ENB A;  5C5L A;  5C4H A;  1SYB A;  3D6C A;  3C1F A;  4KD3 A;  4PNY A;  3SXH A;  3T16 A;  3QB3 A;  5CV6 A;  1SNC A;  4KY7 A;  2PZW A;  1SND A;  3VA5 A;  5CV7 A;  4HTH A;  5KYI A;  3NXW A;  3TME A;  2OXP A;  4K14 A;  4KHV A;  5I9O A;  2QDB A;  5KEE A;  2LKV A;  3V2T A;  2F0F A;  1JOK A;  2HQE A;  1EZ8 A;  2OEO A;  2WAC A;  1RKN A;  3D4D A;  1F2Z A;  3DHQ A;  4IAL A;  4K5V A;  4KJN A;  2OF1 A;  3OMC A;  5HGT A;  4KV6 A;  1EYC A;  1STA A;  1TQO A;  5CV5 A;  2F0E A;  1EY4 A;  1KDC A;  1SNM A;  1EY9 A;  5EKL A;  5E1F A;  3TP8 A;  4H7B A;  4RKB A;  2SOB A;  5EGT A;  5C6A A;  5CR3 A;  4I65 A;  4ZUJ A;  5I6W A;  5EKK A;  4ZUI A;  1STH A;  4J6H A;  1JOR A;  3H6M A;  3PMF A;  4B9W A;  5KRU A;  4RKL A;  1F2Y A;  1NSN S;  1STN A;  5KGU A;  4KY5 A;  1STB A;  2PW5 A;  3U9O A;  5IGB A;  4EQN A;  1SNQ A;  4LAA A;  2F0G A;  4TRD A;  5KIX A;  1SYG A;  2RKS A;  4G57 A;  4R8N A;  3RUZ A;  4K2L A;  2F0N A;  2NUC A;  5I6Y A;  5C4Z A;  2EYP A;  1SYF A;  2F0I A;  2PYK A;  1EY5 A;  1II3 A;  4K2K A;  4NMZ A;  1A3U A;  3QOJ A;  2EYM A;  5NUC A;  5F2D A;  4DU9 A;  1EZ6 A;  5IIF A;  3NK9 A;  4MIU A;  3SHL A;  4WOR A;  5C3X A;  4EQO A;  5K5P A;  1EY8 A;  3ERO A;  1U9R A;  2F0M A;  3SK5 A;  4K5X A;  4PMC A;  2EXZ A;  3T13 A;  5IGG A;  5CV8 A;  4IZ8 A;  2EYF A;  3TP7 A;  4ME5 A;  2SNM A;  3DMU A;  3TP5 A;  1KDB A;  1ENA A;  5IGD A;  5IOD A;  2F0O A;  2EY6 A;  3OMG A;  3P1H A;  2EY1 A;  2F0W A;  4ID6 A;  5CGK A;  5IGC A;  5M9O A;  1AEX A;  4PMB A;  3SK6 A;  3SK8 A;  5ISR A;  4WRD A;  3HZX A;  1KAB A;  2F0V A;  3D4W A;  4KY6 A;  5C3W A;  3ERQ A;  1SYE A;  1EY7 A;  1JOO A;  1A2T A;  3E5S A;  4K8I A;  3BDL A;  5I9P A;  2RDF A;  4EVO A;  4J1M A;  2EY5 A;  4F8M A;  2PZT A;  3LX0 A;  2EYO A;  2F3W A;  4F7X A;  4N9P A;  3S9W A;  1A2U A;  2KQ3 A;  5J22 A;  4ZQ3 A;  1SYD A;  3P75 A;  2F0K A;  3BDC A;  2PQE A;  5IGE A;  4B9X A;  4ODG A;  4DF7 A;  1EQV A;  4DFA A;  4KTA A;  2F0L A;  4NP5 A;  5CV9 A;  3C1E A;  4KJO A;  4N9T A;  5JOB A;  3SR1 A;  5DAU A;  2F0S A;  4HMJ A;  4K6D A;  1IHZ A;  3MVV A;  3R3O A;  2PW7 A;  3MHB A;  3EJI A; 
#chains in the Genus database with same CATH topology
 2E2D C;  1VQE A;  4M1U B;  2F3V A;  4DV7 Q;  4LF9 L;  4P2C B;  2AMC B;  5LMU L;  5CGK A;  1C9O A;  2QKI C;  4A3J B;  2UXB L;  1S5F D;  4FF4 A;  1BQQ T;  4AYB G;  4E6I A;  1SBB B;  4KMU C;  2KEC A;  4XTC S;  4DN4 M;  3HOW B;  3HG9 A;  3LGJ A;  3FEW X;  2UUA L;  2CHB D;  2WP8 J;  4G7Z C;  5C44 H;  2O4X A;  1PTO H;  2HQL A;  2FMC A;  5I2Y A;  4CDE C;  4KKU A;  5HUR A;  5C4H A;  4BY7 B;  3OTO Q;  5JEA J;  1HA6 A;  1Q82 C;  2IT1 A;  1VF5 C;  5GAD C;  3MEF A;  1TS2 A;  3MWY W;  1A62 A;  1F2Z A;  1QVG A;  5IP9 G;  2QW7 A;  1JQY D;  3L0O A;  4OWW B;  3S1Q B;  2UUB L;  4ZYS A;  2F0E A;  3I3C A;  1JJ2 A;  2EQS A;  4LF8 L;  3H6M A;  4J15 A;  4CKC A;  1ZYR C;  2R7Z B;  3MA2 B;  1Q3L A;  1Q8K A;  1SAP A;  5EBC A;  4BXX H;  2DY7 A;  2WKD A;  1TWA B;  1B44 D;  1PH2 A;  4LF4 L;  3PF4 A;  4DR1 Q;  1QJO A;  2G9H D;  5M3M G;  3CF5 A;  2TMP A;  3KJP A;  1K8G A;  4K5X A;  1I4P A;  4QUC A;  2JQO A;  1X55 A;  1OXV A;  1N33 Q;  4FF3 A;  5IOD A;  2I5H A;  4ID6 A;  1PRT B;  3I4O A;  2ZJP A;  1YJW A;  3EBE A;  2TSS A;  1YIJ A;  2MP1 A;  4A3D H;  1F77 A;  5ELB A;  2JA9 A;  3CQZ B;  1L1O B;  4U67 3;  1B9M A;  4L63 B;  1Y1W B;  2NVY H;  3D6W A;  4Q5V A;  4X64 Q;  2C35 B;  1E24 A;  4DR1 L;  2Q2U A;  4A3K B;  3TZU A;  1BKB A;  1A15 A;  2A5H A;  4KTA A;  3PUY A;  2JA6 G;  4POF A;  3K7U C;  4CDF C;  3JC6 6;  2F0S A;  1KLU D;  5ELN A;  3RLO A;  2JJQ A;  1KQS A;  1N33 L;  5C4J B;  4DAY B;  2UXD Q;  1UEA B;  3A7L A;  3I4N H;  2CW0 C;  1K73 C;  1TT2 A;  3ZYY X;  1ENC A;  4WFN 3;  1VQ5 A;  4C3I H;  3RD4 A;  4JBW A;  4QQB X;  3HRZ C;  3K5N A;  3F2D A;  3A7A B;  1RF2 D;  3S1M H;  3QJY A;  1MJC A;  3F8T A;  3QOL A;  5C0X G;  2B63 H;  1A3V A;  2RBM A;  2IX3 A;  4K0K Q;  1IKM A;  5G3L D;  1HUN A;  3M4P A;  4P72 A;  2NBF A;  4H02 A;  1NE3 A;  3D3R A;  1U0L A;  1WTV A;  2N88 A;  2OXP A;  1LUZ A;  1KHI A;  3OWE B;  2K5V A;  1G2T A;  1HFN A;  5FLM G;  3A54 A;  3U9S A;  1AZP A;  1JWU D;  4OEL B;  3JAM L;  1SNM A;  2KOL A;  4H44 C;  1XPO A;  4ZUJ A;  4BA2 I;  2NN6 G;  4HAE A;  2B8G A;  4KN4 C;  1Y8O B;  4UPA A;  4K0K L;  2VZA A;  2VXW A;  4RH6 A;  2NN6 I;  3PMF A;  4B3M Q;  3K8A A;  3U9O A;  2K04 A;  4PG3 A;  1GD7 A;  3E3X A;  4LAA A;  5M5Y H;  4A4I A;  4DR2 L;  3AFQ A;  4DK6 C;  3M85 A;  4GOP A;  1PRT C;  1RHP A;  4RGO S;  2AQ2 B;  3UDG A;  4C3H H;  1VQP A;  3IRB A;  2AUK A;  3SHL A;  1AE2 A;  1ROD A;  3VR5 A;  4A3I G;  1OXU A;  3R93 A;  3TP7 A;  2K14 A;  4DAV A;  5IYB H;  4HN7 A;  4BBS B;  4XIG S;  3HS0 C;  2EY6 A;  3H3V C;  2L9H A;  3E9I A;  4HJ5 A;  1H95 A;  3HOU G;  5M5W B;  1WFQ A;  3T56 B;  1CK1 A;  5ELE A;  4H0L C;  1PXU A;  1K9M C;  2V1C C;  4PZ6 A;  3LX0 A;  4OEM B;  1K3R A;  3ERS X;  2L11 A;  3K80 C;  1M90 C;  3J80 i;  1S3O A;  2A6H C;  4A3G B;  1LO5 D;  3KBG A;  1HNW L;  2AWO A;  3Q0A A;  1BUV T;  5AFW A;  1JE5 A;  2MQH A;  3A8I E;  4IFD J;  1QIL A;  5T1G A;  4V0B A;  3BVZ A;  2KCN A;  1QZG A;  1Z6H A;  5FLX c;  1PZI D;  1GUS A;  1VQ6 A;  2B2V C;  1FJG L;  3NQT A;  3S16 B;  4HID A;  1GKH A;  1IBK Q;  1RTN A;  5L37 A;  2I07 B;  1N34 L;  1J6Q A;  2OQ0 A;  2H1E A;  3UE1 A;  2IY5 B;  1Z9F A;  1TWC B;  1SSO A;  3CCJ A;  1V43 A;  2D0P A;  1P8L A;  2E76 C;  1CA5 A;  1YHA A;  2B2V A;  4B3R Q;  1CSQ A;  4PNY A;  2PQA A;  2XSC A;  3T16 A;  1S5D D;  1J9O A;  2R92 H;  2MPM A;  1GUG A;  3I8Z A;  1RJT A;  1T9H A;  4JI1 L;  2UU9 Q;  2A68 C;  1D1I A;  2EPB A;  3PQI A;  2WAC A;  4RA8 A;  4A3E G;  1RKN A;  3D4R A;  3M4O H;  1SJH D;  3CKI B;  1LT6 D;  4JPB W;  1YZ6 A;  3KFU A;  2B2T C;  1I4G A;  1LTA D;  1PH8 A;  1KRT A;  1AZQ A;  3SEB A;  1X9N A;  2K5W A;  5E1F A;  3G7L A;  4N8X 1;  5FO8 B;  3J7A V;  1STH A;  4TQU S;  3PUZ A;  1XMQ L;  2IWH A;  1OTC A;  4B3T Q;  5COY A;  4X65 Q;  4C1N K;  1SNQ A;  3BZK A;  2IHE A;  2VQE L;  2UU9 L;  4K2L A;  2NVT B;  3GTO B;  2L0C A;  1FGU A;  4GN5 A;  1UWV A;  3UDX A;  3GV6 A;  1EL0 A;  3IAY A;  3S15 B;  4JW0 A;  2PCF B;  4A3F B;  1TWF H;  4DR3 L;  3NBH B;  5HY6 A;  3X3N A;  1EEF D;  3S14 H;  2KHI A;  1N9W A;  3HOZ B;  4LNQ A;  1OO9 B;  1YHQ A;  4C3J B;  1YVC A;  4GN3 B;  4JI7 Q;  1B3A A;  1Y14 B;  3E9H A;  3PO2 G;  2UUC Q;  4X65 L;  1ZKO A;  3VR4 A;  5I9P A;  4EVO A;  1KRS A;  1PYB A;  3FPU B;  1A2U A;  3V05 A;  4IFD H;  1K8A C;  1U4P A;  3L7Z C;  3M3Y H;  4MTN A;  4O42 A;  1PLF A;  4LF5 L;  1FL0 A;  4GNX B;  1HZ9 A;  3S2H B;  4DF7 A;  5EPK A;  1G2S A;  1E22 A;  1EQV A;  1BR9 A;  1VQL A;  4A93 B;  2JA5 B;  4KJO A;  4BWG B;  1C48 A;  1YNJ C;  2EIF A;  2DGY A;  2NZ1 D;  2I5M X;  2WAQ B;  5FJ8 H;  4IUU A;  5D14 A;  1T5E A;  1EU3 A;  4Y7N B;  5FK9 C;  4IPC A;  1UE7 A;  2KHS A;  4LUZ A;  1FNU A;  1WTO A;  4GLA C;  3J81 E;  4S3S A;  4YCU A;  2R61 A;  3D0F A;  4GZY C;  1VQG A;  3QWN A;  5LL6 X;  3FKI H;  4KD4 A;  1RTO A;  2LMC B;  3NP8 A;  1DD2 A;  1ENF A;  4RMF A;  4KI0 A;  4R4T A;  5G3L F;  3PO3 G;  4QCL A;  1R9T H;  2ENB A;  4IJL A;  1EWI A;  2R7D A;  1SYB A;  4OXP A;  3SXH A;  4BY7 G;  4A3C G;  1UNS A;  2MHV A;  1SND A;  5JJL A;  4JI5 Q;  1V1Q A;  5KYI A;  1D8L A;  3NXW A;  2QDL A;  1QUQ B;  3FDT A;  5ELC A;  1EIF A;  3S2D B;  4WJ4 A;  5A35 A;  2NTT A;  1X56 A;  1IW7 D;  2K5H A;  2GA4 B;  2YYZ A;  1IBM L;  4XT1 B;  1E1T A;  4UP8 A;  5EKL A;  4H7B A;  2CWA A;  2SOB A;  1SXT A;  5I6W A;  3RZD H;  5C0X J;  3K6O A;  1VQI A;  4CJ0 B;  5AJ3 L;  4JBM A;  1EFI D;  3AYH B;  4L5S A;  4O1N A;  1STN A;  5KNC A;  1ICW A;  5IP9 H;  1NJI C;  1B8A A;  4JOI C;  3GO5 A;  3MXN A;  3VYT A;  1O7Z A;  1PH7 A;  1NBW A;  4DV5 Q;  1XJV A;  1SN8 A;  1I50 B;  2YU9 B;  3SGI A;  1QVC A;  3I73 A;  3RN5 A;  3T1Y L;  1VQB A;  4NMZ A;  4JV5 Q;  5F2D A;  3S17 B;  1GUW A;  1GUN A;  3I56 A;  1VQH A;  1Q12 A;  1L2F A;  1SE3 A;  3DMU A;  4C3H G;  2RQX A;  4GNX C;  1H9J A;  1HNZ Q;  3I4M G;  1TWH H;  2WAQ E;  5M3M H;  1WCM G;  3KF8 A;  2M2L A;  1D5Z C;  1X32 A;  2IPK D;  1I6H H;  5IGE A;  2GN5 A;  2DY8 A;  1KLG D;  3ONA B;  3H3V I;  4DR5 L;  2XGT A;  3QG1 A;  3NEN A;  4QIW E;  2H4O A;  1A8V A;  1C7Y A;  4K6D A;  1Y1V B;  2I46 A;  3BDO A;  4IUN A;  3A0J A;  2KCC A;  4YWM A;  1HNZ L;  2A69 C;  2N55 A;  3GTJ H;  1DON A;  4DAP A;  1EYD A;  2WB1 B;  4DNR B;  1QE6 A;  3W1G A;  2EJF C;  3STB C;  1ZEQ X;  2JE6 I;  1EEI D;  4BY1 G;  4JI2 L;  2JA6 H;  1AE3 A;  2VY3 A;  4IUT A;  2JA7 G;  1CI3 M;  1EYA A;  1TS3 A;  1B3Q A;  3H0G B;  1JJC B;  1YJ9 A;  4GLV B;  5C5M A;  1SE2 A;  1WI5 A;  1HQM C;  1X3G A;  4YHH Q;  2KED A;  1F2M A;  2FMM A;  3C1F A;  2RHQ B;  5CV6 A;  2F3I A;  3GTP B;  2F4I A;  3W1B A;  5C0X H;  1A0I A;  2JEA I;  1V9P A;  1Y69 U;  2UXC Q;  1T5X D;  1JCK B;  3AU7 A;  3T51 B;  1DZ1 A;  1KDC A;  2L1B A;  5C6A A;  1MSG A;  3GTG H;  2IL8 A;  2A8V A;  3TRZ A;  5M5X B;  4HJ8 A;  3DWQ A;  2BH8 A;  2ZM6 L;  4LWC A;  4A3B B;  1O7Y A;  4B9W A;  4DV3 Q;  1IYU A;  5KGU A;  2A73 B;  3CW2 C;  2K6A A;  3OW7 A;  4AH6 A;  1GUO A;  1H9S B;  1V1O A;  3KJO A;  1XNR Q;  1AP0 A;  4ME3 A;  2F03 A;  2NN6 H;  5NUC A;  4OO1 I;  2UXC L;  4MIU A;  4WOR A;  1YNN D;  1BCP B;  1ESR A;  4ZRZ A;  2EXZ A;  2PNH A;  2O2L D;  5BR8 Q;  4DNI A;  4BBS G;  1HR0 L;  2NWG A;  5IGC A;  1NTG A;  1NMG A;  5KND A;  1XXG A;  1XPU A;  4WRD A;  1PTO B;  3D4W A;  2HIX A;  3T1H Q;  1HQR D;  1E0B A;  1JOO A;  2ICE C;  2JSO A;  4XXE A;  1BOS A;  2D62 A;  4A3M B;  2CFM A;  2NVQ B;  3BYT B;  4A3I H;  4ZKC B;  2PI2 E;  3IKJ A;  4F88 A;  1XNR L;  3VR3 A;  3S1R H;  1DM0 B;  1B9N A;  2J7Z A;  4L8J A;  3HOU H;  2AKW B;  1AW7 A;  1PFM A;  5EPJ A;  1JWM D;  1TKW B;  1BXT A;  1TY2 A;  1ICF B;  3OPO A;  1VS0 A;  1PYS B;  3B6Y A;  3NTI A;  3GTL H;  2ZJR A;  1SNO A;  2Z6K A;  3KF6 A;  4HR7 B;  1CZW A;  2EYL A;  5LMU Q;  1N36 L;  4QB4 A;  3D8G A;  3MZ5 A;  1EY0 A;  4HMI A;  1KDA A;  2JA8 G;  2UXB Q;  1PYW D;  2RDH A;  3LWE A;  5HGQ A;  1K83 H;  1ILP A;  4H13 C;  4RGT A;  3RR5 A;  1LV9 A;  4QUF A;  4NXM L;  1VQF A;  4TSS A;  4OX9 L;  1A3T A;  4RWS C;  3FMC A;  3J81 L;  1SNP A;  2K4K A;  1FD7 D;  3I70 A;  4IQZ A;  5J1Z A;  3BYY B;  1LT4 D;  5FLX E;  1MHW C;  3D6C A;  2E2H B;  1O7I A;  3QB3 A;  1Q86 C;  5IY0 A;  4FNF A;  2PZW A;  1PH4 A;  4HTH A;  3K5L A;  2OT2 A;  4LFB L;  2LKV A;  3V2T A;  1WTH A;  1W6K A;  3DHQ A;  3Q23 A;  1HNX L;  5HGT A;  1K3B C;  2UUB Q;  1EYC A;  2K32 A;  4A3D B;  3SDZ A;  5GAE C;  3HOY B;  4HCE A;  1Z47 A;  2MUY A;  2NVY B;  4F87 A;  4QJF A;  1UUP A;  4I65 A;  3TN2 A;  3CCQ A;  4JCV E;  4LF8 Q;  4J6H A;  4N8F A;  2ZTC A;  2BOS A;  3OIQ A;  1Q81 C;  1R4P B;  4R4I A;  4A3E H;  1BCP C;  4DV2 Q;  3PIP 3;  2K52 A;  2N49 A;  1Q90 A;  5BN5 A;  2NZH A;  3R2I A;  4R4Q A;  2MO0 A;  1UE5 A;  1DOK A;  3I4N B;  4U68 A;  3LWU A;  3WDN A;  3CME A;  4CHT B;  1ASY A;  4LF4 Q;  3QOJ A;  4DUY L;  1PTO C;  1F9R A;  3I91 A;  1UAP A;  3SK5 A;  4C3I B;  1E2Z A;  5CV8 A;  4LF7 Q;  4ZAI A;  4UAI A;  4ME5 A;  3TP5 A;  4L5R C;  5IGD A;  2L12 A;  4JI8 Q;  3HOZ G;  1ZYR D;  3JAM i;  5ISR A;  1GVP A;  3UE0 A;  2B63 B;  4DNT B;  4R8I A;  4DV2 L;  1SFO H;  1M8A A;  1I4R A;  5GAG C;  4GOP B;  3NEL A;  2R6G A;  3AQQ A;  4F8M A;  3M4Y A;  4F7X A;  2AWN A;  1I94 Q;  3S1N B;  4G7O C;  3ER0 A;  5GQO A;  4JC0 A;  4XQQ A;  3C46 A;  4GKK L;  5IE8 A;  1U4M A;  5BN3 A;  2N78 A;  4A93 G;  5CV9 A;  4BS9 A;  2EVB A;  4LF7 L;  3PO2 H;  2K75 A;  2ZT9 C;  5LHY 1;  1LTI D;  4L5T A;  1KAW A;  2WAQ G;  3HEJ A;  3E6Z X;  4C1N I;  3P7J A;  4CKB A;  4YCV A;  4JI8 L;  1VQA A;  2PNR C;  1H9R A;  1B7Y B;  3BVM A;  1G6Z A;  4I7A A;  3VYU A;  2RSO A;  1I94 L;  4DV0 L;  1JOQ A;  2P5Z X;  5M5Y B;  1QNU A;  4QMG A;  1FYC A;  4EQ5 A;  1S5C D;  4PMW A;  4IUR A;  1FNW A;  2Z9H A;  1SMY D;  1L0W A;  1HTL D;  1Y8P B;  4RCN A;  2CW0 D;  4JI3 L;  1SNC A;  4KY7 A;  3GP7 A;  1SE4 A;  2Z6B A;  2XTI A;  5EPL A;  1C8C A;  1BBW A;  4XT3 B;  3J7Y W;  5IGF A;  1JOK A;  4PQX A;  2JP1 A;  4BBR G;  3PO3 H;  1STA A;  5C3E G;  1XPR A;  1LAB A;  1M4V A;  1PFS A;  3OYY A;  4BY7 H;  2RHS B;  4A3C H;  4X62 L;  1Q1E A;  4OGQ C;  2PO4 A;  5FO9 B;  2CH4 W;  5DM7 3;  1HPC A;  1PHJ A;  4X66 L;  1PFN A;  1IL2 A;  1LYL A;  1STB A;  1BO0 A;  2BE5 C;  3W2D A;  1HH2 P;  3IL8 A;  4DR2 Q;  1C0A A;  3CCS A;  5I6Y A;  3NWS A;  1IXR A;  2F0I A;  2MO1 A;  4P74 A;  1PFB A;  1K0S A;  3Q22 A;  4IOA A;  3Q8D A;  4EQO A;  4JBJ A;  5C3X A;  4GOP C;  4PMC A;  3T13 A;  5IGG A;  4LFC L;  1ASZ A;  1TWA H;  2F0O A;  4IPD A;  1NAP A;  4B3S L;  3IFD A;  3QO2 A;  1U4R A;  4PMB A;  4XQJ A;  4ZCK A;  4JK1 C;  3MXG A;  2D0O A;  2E5L Q;  2B2Y A;  3CPW A;  2PZT A;  3KLS X;  1PRT D;  3VDY A;  2R92 B;  3FRP B;  1VQJ A;  5A2Q E;  1PH6 A;  1HNW Q;  4KLK A;  1GXD C;  2QEX A;  1YIT A;  3I4M H;  4NW2 A;  1B4O A;  4N9T A;  1BF4 A;  3ULJ A;  3K58 A;  3E0J A;  1WCM H;  3MTS A;  3CMA A;  4IPG A;  1SMX A;  4JI0 L;  4K8J A;  2F0J A;  2PZU A;  4C2M H;  4YY3 L;  4ALP A;  1EFW A;  1HZA A;  1WOC A;  2CKZ B;  2E5L L;  4KHZ A;  1FJG Q;  2EDG A;  1XWE A;  3CCV A;  2ZTD A;  5CV4 A;  2A6H D;  5IOC A;  5M3F G;  1N34 Q;  2J0T D;  1KAA A;  2E75 C;  2EYJ A;  3RNU A;  1LM0 A;  2F0U A;  5H1S E;  2SNS A;  1VCI A;  2QGQ A;  4P75 A;  1CQF A;  5ELO A;  2MJ8 A;  4RFB A;  3J7Z C;  1EQQ A;  1A63 A;  4R4O A;  1TWF B;  3HKZ G;  4Y52 H;  4BY1 H;  1IBL L;  2IX0 A;  1UE6 A;  1G91 A;  1X3F A;  2CQO A;  3OHX C;  3VA5 A;  4G7H C;  3I2Z A;  3S14 B;  4JI1 Q;  2HDL A;  3CCU A;  2JA7 H;  4IOC A;  2NVX B;  2F0F A;  5FLX L;  1F2L A;  3ZJY C;  2J4X A;  4KJN A;  5I2X A;  4K5V A;  2XRS D;  1HZC A;  3OMC A;  5K36 G;  2R93 B;  3OIP A;  3CP0 A;  1EOT A;  2K50 A;  1TWG B;  4RKB A;  4OWX B;  3M3Y B;  2DJG C;  5EKK A;  4GN4 B;  2B29 A;  4HJA A;  1JB3 A;  3S24 A;  1S4Z A;  4UDU C;  3EQL C;  1XMQ Q;  5EAY A;  2EXD A;  2B2W A;  4HIK A;  1MKH A;  4G57 A;  2A68 D;  2VQE Q;  3C2P A;  4WJ3 M;  2JXM B;  2ZXP A;  1SYF A;  1LT3 D;  1YNX A;  3A5U A;  1H9M A;  1EZ6 A;  2B39 A;  1KXL A;  2A6E D;  5K5P A;  2VB2 X;  3ERO A;  1U9R A;  1CZG A;  2BCO A;  5E4X A;  4NXN L;  4XDX A;  4DR3 Q;  3C3L A;  3KK7 A;  2OWO A;  2RDG A;  1B53 A;  1SLJ A;  3FKI B;  2K5Q A;  3HOX G;  1HZB A;  4DUZ L;  3H94 A;  4ZLT F;  1PZK D;  3SK6 A;  4B08 A;  1VQ9 A;  2F0V A;  3U4V A;  3TEH B;  4A3M G;  4AYB B;  4P73 A;  1P16 A;  4FDB A;  2KQ3 A;  4IUV A;  5IYC G;  3K5M A;  2Q2I A;  3WOF A;  3X3M A;  4BBS H;  4LF5 Q;  5IT9 c;  5FKA C;  3UDF A;  4X3S A;  2F0L A;  2VUM B;  1NY4 A;  3C1E A;  5M5W H;  4DV1 L;  2K28 A;  3A74 A;  4HJ7 A;  5IP7 G;  1PV4 A;  1PH9 A;  3MVV A;  4LF6 L;  3KOJ A;  3PIP A;  3EJI A;  3NHH A;  1N8R C;  3KF8 B;  2JN4 A;  4TKO B;  2VQF L;  4LFA L;  2V4D A;  3U58 A;  4J8Q A;  1C4Q A;  1BDO A;  3BU2 A;  3RZO B;  5JAV A;  4OIK A;  2E74 C;  2Z4I A;  2ZJQ A;  3NBI A;  2F0Q A;  3CHB D;  5E7N A;  4YWL A;  3OSO A;  1EWH A;  4OWT B;  1YNJ D;  3PSI A;  3PIO 3;  4KHP Q;  4RAU C;  3J80 c;  2JA8 H;  5EQ0 A;  3NPP A;  1KC8 C;  1HRJ A;  3I4L A;  3VR2 A;  5DNF A;  2IW3 A;  1R4Q B;  2R7F A;  3QIA A;  1GO3 E;  1O7L A;  3UI2 A;  4A3J G;  1G8Z D;  1HXY D;  1NCV A;  5J3B A;  1TWH B;  1SR3 A;  1TWC H;  4DR7 L;  5M3M B;  1MBY A;  4QGU A;  1I5F A;  2F1M A;  3IFT A;  3PUV A;  1IBM Q;  1PH5 A;  3HOW G;  3BZD B;  3HOY G;  4AQY L;  1I6H B;  1ZXT A;  4XYQ A;  2K33 A;  5AJ3 Q;  4KHP L;  4UP7 A;  3K7A B;  3I90 A;  4RKL A;  1EIH A;  1AN8 A;  1PVO A;  3CC4 A;  3CU7 A;  5IGB A;  2DN8 A;  1TU2 B;  3TS2 A;  1TS4 A;  2EYP A;  2SDF A;  4CDC C;  3T1Y Q;  1MD2 D;  1II3 A;  1Q46 A;  4AYB E;  1V1P B;  5IIF A;  3KLR A;  2F0M A;  2JA6 B;  2YTY A;  4HIM A;  1O78 A;  1TVX A;  2D2C C;  1SJE D;  1EQR A;  3HP3 A;  3KYH C;  5JPN C;  2G5D A;  1FVI A;  1ENA A;  3RLF A;  4DR6 L;  2WKC A;  2R7Z G;  1D2B A;  4ZK9 B;  3KDF A;  3GTM B;  3DEP A;  1IYJ B;  1PRT F;  1ML0 D;  1I6V C;  1D7Q A;  1LTL A;  2QCP X;  2ID0 A;  4TVA B;  1K28 A;  3HOZ H;  1LTB D;  2DUD A;  3HOV B;  1TS5 A;  2AQ3 B;  5IYD G;  4NP5 A;  4DR5 Q;  2VB3 X;  1CQV A;  5A2Q L;  1CHQ D;  3K59 A;  3BZC A;  3DXJ C;  3Q6S A;  4DGZ A;  1OXT A;  1RL2 A;  4OL7 A;  4O2D A;  4RHR A;  1K8M A;  1E1O A;  2F0D A;  4JI2 Q;  5LMN L;  4A93 H;  1Y1W G;  1Q7Y C;  1WJJ A;  4NDX A;  3GTK B;  5DEH A;  4A3K G;  3G48 A;  1SRO A;  1V8Q A;  3QR8 A;  1GUT A;  2YTX A;  2AQ1 B;  1OXS C;  2EYH A;  3KF6 B;  5GAH C;  1NMF A;  3R2T A;  2A69 D;  5CV7 A;  2ZXO A;  4O0A A;  3STB D;  1CT1 D;  5I9O A;  4NB3 A;  3M7N A;  3CPF A;  1VQO A;  4JI6 L;  1QB5 D;  2QA4 A;  3PUX A;  3K57 A;  4A3I B;  1EY4 A;  2F4V Q;  2LS0 1;  1YI2 A;  4PV1 C;  2ZM6 Q;  4ZUI A;  1I3Q B;  4IJH A;  1FGB D;  3HFZ B;  5JJK A;  3BS1 A;  3HOU B;  2RVL A;  3J81 i;  4C56 C;  1L0X B;  4DKA C;  1E3P A;  4BBR H;  2F0G A;  5C3E H;  2EJM A;  1HA5 A;  3GTL B;  2F0N A;  1PDQ A;  2K7V A;  4CBV A;  1S5B D;  1VQN A;  1CFM A;  1CM9 A;  1K83 B;  4X6A H;  4LJZ C;  3ND9 A;  1YHB A;  1A6X A;  2F4V L;  2B8F A;  2K5D A;  1HR0 Q;  5C4X B;  5EJW A;  4APV A;  1UEB A;  1YBY A;  2VS1 A;  1LTT D;  2ZTE A;  3SE0 A;  2YU9 H;  4JI4 L;  1G51 A;  5M9O A;  2BDN A;  3ULP A;  3FPP A;  5C3W A;  3S17 H;  2OCE A;  4RGM A;  1S5E D;  4KKS A;  4FXK C;  4P71 A;  3BG3 A;  1VQ7 A;  4ZQ3 A;  4OO1 G;  3BDC A;  3MFG A;  4L6T B;  2HHH Q;  1HR0 W;  3A8K E;  1LLR D;  1VQK A;  4DXG A;  5DAU A;  1O80 A;  2F52 A;  5D65 A;  3MHB A;  5IWA L;  4HSV A;  1IL8 A;  1JR0 D;  4YIJ A;  2BA1 A;  3MAQ A;  3F2B A;  1N36 Q;  5C44 B;  5T1I A;  1STG A;  1XNQ L;  4DXF A;  2Z6K C;  3CC2 A;  2WB1 E;  1CA6 A;  2O5J C;  4IUQ A;  1IKL A;  2Y0S B;  1STY A;  2E2J H;  4NXM Q;  2K03 A;  4A3G G;  1B70 B;  4JYA L;  3SK4 A;  4OX9 Q;  2HHH L;  2VNU D;  2CH4 A;  1W2B A;  2EY2 A;  4G4K A;  1U4L A;  1XMO L;  1RDP D;  1CHP D;  1WTP A;  4OIJ A;  4X3U A;  5COR A;  2RF4 A;  3PUW A;  3FP9 A;  5M3F H;  3KBX A;  4LFB Q;  2QDB A;  4IUP A;  3T4A C;  4CDD C;  5JVG 3;  3K0X A;  2L5T A;  1U5K A;  2B2U A;  1HNX Q;  1FR3 A;  1F9P A;  2I5L X;  2OTJ A;  2HCI A;  4GKJ L;  1DYQ A;  5CR3 A;  4IFD I;  2K5N A;  3GTP H;  1F9S A;  1H9K A;  5CMD A;  1PMR A;  2A19 A;  1LTS D;  3PO2 B;  1RIP A;  3V96 A;  5K36 H;  3PGZ A;  3O13 A;  4R8N A;  3H91 A;  3CC7 A;  2PI2 A;  1KNA A;  3LNN A;  3GTQ H;  1EQT A;  1VQC A;  1IZ6 A;  5ELD A;  5M5X H;  1A3U A;  1XTD A;  3NE5 B;  4DUY Q;  2JK8 A;  2IHF A;  4FF2 A;  3DM1 A;  1GM5 A;  1KDB A;  3OMG A;  1HFG A;  1E2V A;  1BCP D;  3SK8 A;  3TSS A;  3ERQ A;  1A2T A;  3D31 A;  4V19 0;  3MXU A;  2EY5 A;  2EYO A;  2E8G A;  1YJN A;  4DV6 Q;  1XYI A;  1PH1 A;  1PTO D;  3HOX H;  1VDZ A;  4GKK Q;  3AEV A;  2L55 A;  2Y0S E;  4NPS A;  2E2I H;  3L9A X;  1K8O A;  4A3F G;  2VUM G;  3KLS A;  1E2W A;  3EN2 A;  4HMJ A;  5CYU A;  3PO3 B;  1F9Q A;  1J5E L;  2RSN A;  3R3O A;  3S1M B;  4IN3 A;  2Q8T A;  4A3M H;  2NVQ H;  4DV7 L;  2FHT A;  4C3J G;  5IYC H;  5BN4 A;  3NWT A;  5E4W C;  3G6E A;  1GOZ A;  1VF7 A;  4YWK A;  3AB9 A;  4K6L A;  1H9S A;  1VQ8 A;  4DV0 Q;  2WV6 D;  4DV6 L;  5IP7 H;  5IT9 E;  1JWS D;  2ASB A;  2H5X A;  1QZH A;  3TZD A;  2EOT A;  2YV5 A;  3BJU A;  4DPG A;  2NB0 A;  1EY6 A;  2JA5 G;  1ET9 A;  3OWF A;  2Z1C A;  2X6L A;  2Z4H A;  3A56 A;  4KD3 A;  3OTO L;  5DLQ E;  4JI3 Q;  2O5I C;  2WII B;  2JEB I;  1Y8N B;  1CKN A;  2B3G A;  4KKT A;  1WVL A;  2N8N A;  4LK1 C;  3VYR A;  4DA2 A;  2RCN A;  2LXJ A;  1JE4 A;  1KTK A;  1Q8I A;  3GV3 A;  3NSW A;  2NTS A;  5CV5 A;  3R8B A;  2BH2 A;  2E2H H;  1N32 Q;  4X62 Q;  3A5Z B;  1MGS A;  3J80 E;  2Q2T A;  4C3H B;  3U50 C;  4A3J H;  4X66 Q;  5KRU A;  3I4M B;  5JVH 3;  4KY5 A;  2NZO A;  1WCM B;  2L4N A;  2KA7 A;  4EQN A;  1M1K C;  3G4S A;  4TRD A;  3HOW H;  3HOY H;  3AMU A;  2RCF A;  4C2M B;  2ZXR A;  4K2K A;  3CXC A;  4ABN A;  2LY7 A;  4IO9 A;  1ESF A;  1JB7 A;  4X3K A;  4LFC Q;  1N32 L;  4CGY B;  1DCZ A;  3N52 A;  1DXM A;  4AIM A;  1SMY C;  1I4Q A;  4B3S Q;  2BA0 A;  4MHE A;  5FOB B;  2ICI A;  2PQA B;  5CBE E;  3CD6 A;  1QOH A;  2BE5 D;  2XWJ B;  1KAB A;  4FVM A;  3S1Q H;  4MNO A;  1MSH A;  4K8I A;  2Q8I B;  3H15 A;  4BY1 B;  1WTX A;  1I4H A;  3VYS A;  1PA6 A;  1SYD A;  4X64 L;  5JEA H;  1VQD A;  4HSP A;  1YEZ A;  2B2Y C;  4B9X A;  2JA7 B;  3HOV G;  2R7Z H;  3DEO A;  4GS3 A;  3SVM A;  2IJ0 A;  5C0X I;  2X69 A;  2C9O A;  1EWC A;  2IX1 A;  2KEE A;  1HUM A;  2HT1 A;  2KVM A;  3S1N H;  3A55 A;  2UXD L;  4I7Z C;  4JI0 Q;  3MXP A;  4YY3 Q;  5J39 A;  2WFW A;  1WD0 A;  2VL6 A;  5JJI A;  2Q2H A;  1BBX C;  4MN3 A;  3JAM c;  5IYD H;  1SRU A;  1KIX A;  1CTM A;  1G29 1;  5E3F A;  1KNE A;  2M00 A;  1KD1 C;  3GDE A;  1SYC A;  1QG7 A;  5ELF A;  3M4O B;  1CKO A;  5TSS A;  3J7A 5;  1Y1V G;  3N6R A;  1NNX A;  3CQZ H;  4OHJ A;  5KNB A;  1VQ4 A;  1W3S A;  1IBL Q;  3I55 A;  4ZKB B;  1Y1W H;  2QIL A;  3H3V H;  2WB1 G;  1ET6 A;  3TME A;  4K14 A;  4A3K H;  2KHJ A;  5KEE A;  2FFK B;  2C5C A;  3NQI A;  1Z7T A;  2XVS A;  1X3P A;  4HIO A;  3L3O C;  3W5O A;  1HHV A;  1EYG A;  5C4J H;  1L1O C;  1EY9 A;  2EZV A;  3H0G G;  3H09 A;  4OON A;  4RGN A;  4B3M L;  1MI2 A;  1PZJ D;  3WOE A;  1CKM A;  3NTH A;  3UDI A;  3A8J E;  1SDF A;  2PW5 A;  3CRK C;  3GD7 A;  1WYD A;  3TQY A;  1QCB D;  2K01 A;  5KIX A;  3AFP A;  2YTV A;  3EA6 A;  2PMZ B;  1JMC A;  1L1O A;  1TY0 A;  2B2W C;  2AUJ D;  1VMC A;  2XNA C;  4DU9 A;  3NK9 A;  3MFY A;  4NXN Q;  3M4Q A;  4ULL A;  3OW2 A;  1GHJ A;  4A75 A;  2EYF A;  3CRL C;  2M9V A;  5C4X G;  2A1A A;  4DUZ Q;  1LTR D;  3P1H A;  3G6J B;  1BCP F;  4A3B G;  4FXG C;  4A3L G;  4DAY A;  3J81 j;  2MGS A;  2JA8 B;  1EY7 A;  2XWB B;  3ICE A;  2F3W A;  1HJP A;  4WJW A;  3M9B A;  1PTO F;  3EIV A;  2F0K A;  4HCS A;  1SEB D;  1RCV D;  1JJG A;  2KBN A;  3W3A A;  1TXY A;  5GRO A;  3K0Y A;  4DV1 Q;  3RLN A;  1BVS A;  2PW7 A;  4EGV A;  4LF6 Q;  5JPM C;  3WWV A;  4EQP A;  1ILQ A;  3KDF B;  1NUC A;  5C44 G;  4OO1 H;  3MXN B;  3CAM A;  2XRQ D;  4LFA Q;  2VQF Q;  5EBD A;  1R9T B;  1I4X A;  3F2U A;  2Z0S A;  1XX8 A;  1IBK L;  2Y0S G;  2A6E C;  5CC4 A;  2K05 A;  1CUK A;  5IT9 L;  4K5W A;  4CJ2 C;  1STE A;  5C5L A;  4B3R L;  4IPH A;  3RZD B;  2LXK A;  4FP5 D;  2HIV A;  4JBK A;  4A3G H;  1QWY A;  2B2T A;  4FXD A;  2Q8R E;  4KHV A;  2OTL A;  4CJ1 B;  2HQE A;  1EZ8 A;  2OEO A;  4DR7 Q;  4BXX G;  2OF1 A;  2PMZ E;  4BA1 I;  4KV6 A;  5JJZ A;  1GHK A;  3TBI B;  4MZ9 A;  2RA4 A;  4AQY Q;  4PZ7 A;  5EGT A;  2GVB A;  1VQM A;  2HCC A;  4KN7 C;  4LW1 A;  1X65 A;  3KUP A;  1FNV A;  1LT5 D;  3PV0 A;  2CVR A;  2NVX H;  1NSN S;  3FHW A;  4B3T L;  3S16 H;  1GJX A;  3J80 L;  1CSP A;  2FJ2 A;  2R93 H;  3PCO B;  3TRE A;  5D3D A;  1TWG H;  5C4Z A;  2BDO A;  2PYK A;  4RG1 A;  1B50 A;  3F2C A;  4A3D G;  4DK1 A;  3L2P A;  4XYO A;  2PPB C;  1DOM A;  3OOC A;  1AFP A;  4IZ8 A;  2SNM A;  3HKS A;  2EJG C;  4DR6 Q;  1G6P A;  2EY1 A;  2Z8L A;  1AH9 A;  3HZX A;  4JI7 L;  3TS0 A;  1QNK A;  1SYE A;  4HJ9 A;  2UUC L;  3BDL A;  4J1M A;  2R3Z A;  3I4N G;  1J8I A;  3P75 A;  1WTQ A;  3CCM A;  3GTJ B;  4QIW B;  2LFN A;  3FVQ A;  4C3I G;  4DFA A;  1D5M C;  5JOB A;  1S40 A;  3NEM A;  1D1K A;  5JEA G;  3DUZ A;  3HGB A;  2NVT H;  3GTO H;  1RD9 D;  5KYL A;  2B63 G;  3KLW A;  3DWA A;  3S15 H;  5EKI A;  4CKE A;  4A3F H;  5LMN Q;  2VUM H;  2NYZ D;  3URY A;  2HDM A;  4FO2 A;  3RMH A;  5I4D A;  3NUC A;  4BBR B;  1IW7 C;  4EX5 A;  5C3E B;  1MJE A;  1WTR A;  2CCZ A;  1OXX K;  2QF7 A;  4X3T A;  1NR4 A;  2SEB D;  5D3I B;  4QF4 A;  1TR5 A;  4C3J H;  2KCT A;  2KJX A;  5LL6 S;  2G9D A;  2JYO A;  2CQA A;  4R9W A;  4GLX A;  3RZO H;  1WD1 A;  1UE1 A;  2DJF C;  3GTG B;  5LMN W;  3VR6 A;  1LTG D;  4JI5 L;  1JT8 A;  3S2H H;  4KK7 A;  2AHO B;  2KCM A;  1X3E A;  4JI6 Q;  2JA5 H;  4Q0F A;  3TP8 A;  2ATW A;  4R1J A;  4DAM A;  3NBH A;  3E0E A;  4JOI A;  2QEJ C;  4Y7N H;  1TII D;  1SE8 A;  1JOR A;  1EIY B;  3CCR A;  1F2Y A;  2D5D A;  4DK3 C;  2I0Q A;  1DJR D;  5IYB G;  2HUG A;  2XN9 C;  2RKS A;  3EFX D;  4QY7 A;  4DV5 L;  3TDQ A;  4A76 A;  3K81 C;  1B1Z A;  5FO7 B;  4JV5 L;  1X6O A;  4PZ8 A;  3CCE A;  3K7A H;  1EY8 A;  2MNA A;  1BBU A;  1EU4 A;  4GNX A;  2E2J B;  1EIG A;  3M7G A;  1E7Z A;  4JVZ A;  3PF5 A;  3S1R B;  2F0W A;  4JI4 Q;  3S2D H;  4KY6 A;  2K1B A;  2XIW A;  3E5S A;  3MC0 B;  2RDF A;  2OQK A;  3NTK A;  4N9P A;  1D5X C;  2D9U A;  5M3F B;  2EE1 A;  2FIN B;  4ODG A;  4Z9C B;  3U4Z A;  1VMP A;  1DOL A;  2LSS A;  4QL5 A;  4DV4 Q;  3GTM H;  3SR1 A;  1JIC A;  1D6E C;  1S72 A;  1KL9 A;  5IWA Q;  3HKZ B;  4NKL A;  1I50 H;  4RCO A;  1EOV A;  2F0P A;  4M8A A;  3RN2 A;  1XNQ Q;  1EUJ A;  2N3S A;  3HOV H;  3MEH A;  1QUQ A;  3F1Z A;  3EVQ A;  4RHS A;  3DWP A;  2R92 G;  3ULL A;  4JYA Q;  2F0H A;  1V1P A;  1HTP A;  3GTQ B;  4YCW A;  4LMQ D;  1XMO Q;  3TP6 A;  3G71 A;  4DV4 L;  3GQB A;  1MIU A;  2F0T A;  4YHH L;  2ES2 A;  1X3Q A;  1W6J A;  3ITP A;  5FLM H;  1X54 A;  3GTK H;  2DNC A;  2KUM A;  3JAM E;  2DNE A;  4A3E B;  3D4D A;  4IAL A;  3I72 A;  1Y1V H;  1TQO A;  3ND8 A;  1YNN C;  4GKJ Q;  1BNZ A;  2A74 C;  2WIN B;  1QVF A;  3Q24 A;  2B2U C;  3HOX B;  2CWP A;  4UHV A;  4DR4 Q;  3DM3 A;  2E2I B;  3DLL A;  4DV3 L;  4UY8 C;  1CKN B;  3BVG A;  4HED A;  4UP9 A;  1SYG A;  1WTW A;  3RUZ A;  2MFI A;  3VA7 A;  2NUC A;  4LUV A;  1HCZ A;  2KEN A;  3H0G H;  1EY5 A;  4POG A;  2L15 A;  1SFO B;  2EYM A;  1PH3 A;  3P20 A;  3CCL A;  1I3Q H;  4JG2 A;  3K5O A;  3S9W A;  2R93 G;  1Q1B A;  5CBA E;  4L5Q A;  4IFD G;  5BR8 L;  1B2T A;  2ALY B;  1NR2 A;  1XTC D;  4XQN A;  3J7A F;  1IYV A;  4LF9 Q;  4DR4 L;  1LAC A;  4MTK A;  2HD3 A;  1AEX A;  1K0R A;  1DGS A;  1L0Y B;  3I7F A;  3HKZ E;  2X6G A;  3T1H L;  5DM6 3;  5FJ8 G;  4FYD A;  5J22 A;  4ILW A;  3J81 c;  2PQE A;  4LUO A;  5C4X H;  2UUA Q;  4DK0 A;  3PIO A;  4A3B H;  2FXQ A;  2VW9 A;  1ONL A;  4A3L H;  4R4C A;  4FF1 A;  1JC7 A;  1J5E Q;  1IHZ A;  3T53 B;  3FKI G;  2GVA A; 
#chains in the Genus database with same CATH homology
 2E2D C;  4M1U B;  2F3V A;  4P2C B;  5CGK A;  2QKI C;  4A3J B;  1S5F D;  4FF4 A;  1BQQ T;  4E6I A;  1SBB B;  4KMU C;  2KEC A;  4XTC S;  4DN4 M;  3HOW B;  3HG9 A;  3FEW X;  2CHB D;  2WP8 J;  4G7Z C;  2O4X A;  1PTO H;  2FMC A;  5I2Y A;  4KKU A;  5HUR A;  5C4H A;  4BY7 B;  5JEA J;  1HA6 A;  2IT1 A;  1VF5 C;  1TS2 A;  3MWY W;  1F2Z A;  1JQY D;  3S1Q B;  4ZYS A;  2F0E A;  3I3C A;  3H6M A;  4CKC A;  1ZYR C;  2R7Z B;  3MA2 B;  1Q3L A;  1SAP A;  5EBC A;  2DY7 A;  2WKD A;  1TWA B;  1B44 D;  1QJO A;  2G9H D;  2TMP A;  4K5X A;  1I4P A;  4QUC A;  1OXV A;  4FF3 A;  5IOD A;  4ID6 A;  1PRT B;  2TSS A;  2MP1 A;  1F77 A;  5ELB A;  3CQZ B;  4U67 3;  1B9M A;  4L63 B;  1Y1W B;  3D6W A;  4Q5V A;  4A3K B;  3TZU A;  1A15 A;  2A5H A;  4KTA A;  3PUY A;  2F0S A;  1KLU D;  5C4J B;  1UEA B;  3A7L A;  2CW0 C;  1TT2 A;  3ZYY X;  1ENC A;  4WFN 3;  3RD4 A;  4JBW A;  3HRZ C;  3K5N A;  3A7A B;  1RF2 D;  3QJY A;  3QOL A;  5C0X G;  1A3V A;  2RBM A;  2IX3 A;  1IKM A;  5G3L D;  1HUN A;  2NBF A;  3D3R A;  1WTV A;  2N88 A;  2OXP A;  3OWE B;  1G2T A;  1HFN A;  3A54 A;  3U9S A;  1AZP A;  1JWU D;  3JAM L;  1SNM A;  2KOL A;  4H44 C;  4ZUJ A;  4BA2 I;  2NN6 G;  4HAE A;  2B8G A;  4KN4 C;  1Y8O B;  2VXW A;  4RH6 A;  2NN6 I;  3PMF A;  3U9O A;  2K04 A;  4LAA A;  3M85 A;  1PRT C;  1RHP A;  4RGO S;  2AQ2 B;  2AUK A;  3SHL A;  1ROD A;  3VR5 A;  1OXU A;  3R93 A;  3TP7 A;  4DAV A;  4HN7 A;  4BBS B;  4XIG S;  3HS0 C;  2EY6 A;  3H3V C;  2L9H A;  5M5W B;  3T56 B;  1CK1 A;  5ELE A;  4H0L C;  1PXU A;  3LX0 A;  2L11 A;  2A6H C;  4A3G B;  1LO5 D;  3KBG A;  2AWO A;  3Q0A A;  1BUV T;  5AFW A;  3A8I E;  4IFD J;  1QIL A;  5T1G A;  4V0B A;  3BVZ A;  2KCN A;  1Z6H A;  1PZI D;  1GUS A;  2B2V C;  3NQT A;  3S16 B;  1RTN A;  2I07 B;  2H1E A;  1TWC B;  1SSO A;  1V43 A;  2E76 C;  1CA5 A;  2B2V A;  4PNY A;  3T16 A;  2XSC A;  1S5D D;  1J9O A;  2MPM A;  1GUG A;  3I8Z A;  1RJT A;  2A68 C;  1D1I A;  2EPB A;  2WAC A;  4RA8 A;  1RKN A;  3D4R A;  1SJH D;  3CKI B;  1LT6 D;  2B2T C;  1I4G A;  1LTA D;  1AZQ A;  3SEB A;  2K5W A;  5E1F A;  3G7L A;  5FO8 B;  3J7A V;  1STH A;  4TQU S;  3PUZ A;  2IWH A;  5COY A;  4C1N K;  1SNQ A;  4K2L A;  2NVT B;  3GTO B;  2L0C A;  3GV6 A;  1EL0 A;  3IAY A;  3S15 B;  2PCF B;  4A3F B;  3X3N A;  1EEF D;  3HOZ B;  1OO9 B;  4C3J B;  1B3A A;  1ZKO A;  5I9P A;  3VR4 A;  4EVO A;  3FPU B;  1A2U A;  3V05 A;  4IFD H;  1U4P A;  3L7Z C;  4O42 A;  1PLF A;  3S2H B;  4DF7 A;  5EPK A;  1G2S A;  1EQV A;  1BR9 A;  4A93 B;  2JA5 B;  4KJO A;  4BWG B;  1C48 A;  1YNJ C;  2NZ1 D;  2WAQ B;  4IUU A;  5D14 A;  1T5E A;  1EU3 A;  4Y7N B;  5FK9 C;  2KHS A;  1FNU A;  1WTO A;  3J81 E;  4S3S A;  2R61 A;  4GZY C;  3QWN A;  5LL6 X;  4KD4 A;  1RTO A;  2LMC B;  3NP8 A;  1DD2 A;  1ENF A;  4KI0 A;  5G3L F;  4QCL A;  2ENB A;  1SYB A;  3SXH A;  1UNS A;  2MHV A;  1SND A;  5KYI A;  3NXW A;  3FDT A;  5ELC A;  3S2D B;  5A35 A;  2NTT A;  1IW7 D;  2GA4 B;  2YYZ A;  4XT1 B;  5EKL A;  4H7B A;  2SOB A;  1SXT A;  5I6W A;  5C0X J;  3K6O A;  4CJ0 B;  1EFI D;  4O1N A;  1STN A;  5KNC A;  1ICW A;  3GO5 A;  3MXN A;  3VYT A;  1O7Z A;  1I50 B;  2YU9 B;  3I73 A;  4NMZ A;  5F2D A;  3S17 B;  1GUW A;  1GUN A;  1Q12 A;  1SE3 A;  3DMU A;  4C3H G;  2RQX A;  1H9J A;  3KF8 A;  2M2L A;  1D5Z C;  1X32 A;  2IPK D;  5IGE A;  2DY8 A;  1KLG D;  3ONA B;  3QG1 A;  2H4O A;  4K6D A;  1Y1V B;  2I46 A;  3BDO A;  4IUN A;  2KCC A;  2A69 C;  2N55 A;  1DON A;  4DAP A;  1EYD A;  2WB1 B;  4DNR B;  1QE6 A;  2EJF C;  1ZEQ X;  2JE6 I;  1EEI D;  4IUT A;  1CI3 M;  1EYA A;  1TS3 A;  3H0G B;  5C5M A;  1SE2 A;  1HQM C;  2KED A;  1F2M A;  2FMM A;  3C1F A;  5CV6 A;  3GTP B;  2F4I A;  5C0X H;  2JEA I;  1Y69 U;  1T5X D;  1JCK B;  3AU7 A;  3T51 B;  1DZ1 A;  1KDC A;  2L1B A;  5C6A A;  1MSG A;  2IL8 A;  5M5X B;  3DWQ A;  4A3B B;  1O7Y A;  4B9W A;  1IYU A;  5KGU A;  2A73 B;  2K6A A;  3OW7 A;  1GUO A;  1H9S B;  1V1O A;  1AP0 A;  2F03 A;  2NN6 H;  5NUC A;  4OO1 I;  4MIU A;  4WOR A;  1YNN D;  1BCP B;  1ESR A;  4ZRZ A;  2EXZ A;  2O2L D;  2NWG A;  5IGC A;  5KND A;  1XXG A;  4WRD A;  1PTO B;  3D4W A;  1HQR D;  1E0B A;  1JOO A;  2ICE C;  2JSO A;  4XXE A;  1BOS A;  2D62 A;  4A3M B;  2NVQ B;  3BYT B;  4ZKC B;  3IKJ A;  4F88 A;  3VR3 A;  1DM0 B;  1B9N A;  2J7Z A;  4L8J A;  1AW7 A;  1PFM A;  5EPJ A;  1JWM D;  1TKW B;  1BXT A;  1TY2 A;  3OPO A;  3NTI A;  1SNO A;  4HR7 B;  1CZW A;  2EYL A;  4QB4 A;  3D8G A;  3MZ5 A;  1EY0 A;  4HMI A;  1KDA A;  1PYW D;  2RDH A;  3LWE A;  1ILP A;  4H13 C;  4RGT A;  1LV9 A;  4QUF A;  4TSS A;  1A3T A;  4RWS C;  3FMC A;  3J81 L;  1SNP A;  1FD7 D;  3I70 A;  4IQZ A;  5J1Z A;  3BYY B;  1LT4 D;  5FLX E;  3D6C A;  2E2H B;  3QB3 A;  4FNF A;  2PZW A;  4HTH A;  3K5L A;  2OT2 A;  2LKV A;  3V2T A;  1W6K A;  3DHQ A;  3Q23 A;  5HGT A;  4A3D B;  1EYC A;  2K32 A;  3SDZ A;  3HOY B;  4HCE A;  1Z47 A;  2MUY A;  2NVY B;  4F87 A;  1UUP A;  4I65 A;  3TN2 A;  4J6H A;  2BOS A;  3OIQ A;  1R4P B;  1BCP C;  3PIP 3;  1Q90 A;  5BN5 A;  3R2I A;  1DOK A;  3I4N B;  4U68 A;  3LWU A;  3WDN A;  4CHT B;  3QOJ A;  1PTO C;  1F9R A;  3I91 A;  1UAP A;  3SK5 A;  4C3I B;  1E2Z A;  5CV8 A;  4ZAI A;  4UAI A;  4ME5 A;  3TP5 A;  5IGD A;  2L12 A;  1ZYR D;  5ISR A;  2B63 B;  4DNT B;  4R8I A;  1M8A A;  1I4R A;  2R6G A;  4F8M A;  3M4Y A;  4F7X A;  2AWN A;  3S1N B;  4G7O C;  4XQQ A;  3C46 A;  1U4M A;  5CV9 A;  4BS9 A;  2EVB A;  2ZT9 C;  5LHY 1;  1LTI D;  3HEJ A;  3E6Z X;  4C1N I;  3P7J A;  4CKB A;  2PNR C;  1H9R A;  3BVM A;  1G6Z A;  3VYU A;  2RSO A;  1JOQ A;  5M5Y B;  1QNU A;  4QMG A;  1FYC A;  1S5C D;  4PMW A;  4IUR A;  1FNW A;  1SMY D;  1HTL D;  1Y8P B;  4RCN A;  2CW0 D;  1SNC A;  4KY7 A;  3GP7 A;  1SE4 A;  5EPL A;  1C8C A;  4XT3 B;  3J7Y W;  5IGF A;  1JOK A;  4PQX A;  2JP1 A;  1STA A;  1LAB A;  1M4V A;  1Q1E A;  4OGQ C;  2PO4 A;  5FO9 B;  5DM7 3;  1HPC A;  1PFN A;  1STB A;  1BO0 A;  2BE5 C;  3W2D A;  3IL8 A;  5I6Y A;  3NWS A;  2F0I A;  1PFB A;  3Q22 A;  5C3X A;  4EQO A;  4PMC A;  3T13 A;  5IGG A;  2F0O A;  1NAP A;  3IFD A;  3QO2 A;  1U4R A;  4PMB A;  4XQJ A;  4JK1 C;  3MXG A;  2B2Y A;  2PZT A;  3KLS X;  1PRT D;  2R92 B;  3FRP B;  5A2Q E;  1GXD C;  4NW2 A;  1B4O A;  4N9T A;  1BF4 A;  3K58 A;  3E0J A;  3MTS A;  4K8J A;  2F0J A;  2PZU A;  4KHZ A;  2EDG A;  1XWE A;  5CV4 A;  2A6H D;  5IOC A;  2J0T D;  1KAA A;  2E75 C;  2EYJ A;  2F0U A;  2SNS A;  1VCI A;  1CQF A;  2MJ8 A;  4RFB A;  1TWF B;  2IX0 A;  1G91 A;  3OHX C;  3VA5 A;  4G7H C;  3S14 B;  2HDL A;  2NVX B;  2F0F A;  5FLX L;  1F2L A;  2J4X A;  4KJN A;  5I2X A;  4K5V A;  2XRS D;  3OMC A;  5K36 G;  2R93 B;  3OIP A;  1EOT A;  1TWG B;  4RKB A;  3M3Y B;  5EKK A;  1JB3 A;  1S4Z A;  4UDU C;  3EQL C;  2B2W A;  4G57 A;  2A68 D;  3C2P A;  2JXM B;  2ZXP A;  1SYF A;  1LT3 D;  1H9M A;  1EZ6 A;  2B39 A;  2A6E D;  5K5P A;  2VB2 X;  3ERO A;  1U9R A;  1CZG A;  2BCO A;  5E4X A;  4XDX A;  3C3L A;  3KK7 A;  2RDG A;  1B53 A;  3FKI B;  2K5Q A;  3H94 A;  4ZLT F;  1PZK D;  3SK6 A;  4B08 A;  2F0V A;  4AYB B;  2KQ3 A;  4IUV A;  3K5M A;  3WOF A;  3X3M A;  5FKA C;  4X3S A;  2F0L A;  2VUM B;  3C1E A;  2K28 A;  3MVV A;  3EJI A;  3NHH A;  4TKO B;  2V4D A;  4J8Q A;  1C4Q A;  1BDO A;  3RZO B;  5JAV A;  4OIK A;  2E74 C;  2Z4I A;  3NBI A;  2F0Q A;  3CHB D;  3OSO A;  1EWH A;  1YNJ D;  3PIO 3;  4RAU C;  5EQ0 A;  3NPP A;  1HRJ A;  3I4L A;  3VR2 A;  5DNF A;  2IW3 A;  1R4Q B;  3QIA A;  1O7L A;  3UI2 A;  1G8Z D;  1HXY D;  1NCV A;  1TWH B;  5M3M B;  1MBY A;  2F1M A;  3IFT A;  3PUV A;  3BZD B;  1I6H B;  1ZXT A;  4XYQ A;  2K33 A;  3K7A B;  3I90 A;  4RKL A;  1EIH A;  1AN8 A;  3CU7 A;  5IGB A;  2DN8 A;  1TU2 B;  1TS4 A;  2EYP A;  2SDF A;  1MD2 D;  1II3 A;  1V1P B;  5IIF A;  3KLR A;  2F0M A;  2JA6 B;  1O78 A;  1TVX A;  2D2C C;  1SJE D;  3HP3 A;  5JPN C;  1ENA A;  3RLF A;  2WKC A;  1D2B A;  4ZK9 B;  3GTM B;  3DEP A;  1PRT F;  1ML0 D;  1I6V C;  2QCP X;  2ID0 A;  1LTB D;  3HOV B;  1TS5 A;  2AQ3 B;  4NP5 A;  2VB3 X;  1CQV A;  5A2Q L;  1CHQ D;  3K59 A;  3DXJ C;  3Q6S A;  4DGZ A;  1OXT A;  4OL7 A;  4RHR A;  1K8M A;  2F0D A;  4NDX A;  3GTK B;  5DEH A;  1V8Q A;  1GUT A;  2AQ1 B;  1OXS C;  2EYH A;  3R2T A;  2A69 D;  5CV7 A;  2ZXO A;  1CT1 D;  5I9O A;  3M7N A;  1QB5 D;  3PUX A;  3K57 A;  4A3I B;  1EY4 A;  2LS0 1;  4ZUI A;  1I3Q B;  1FGB D;  3BS1 A;  3HOU B;  2RVL A;  4C56 C;  1L0X B;  2F0G A;  2EJM A;  1HA5 A;  3GTL B;  2F0N A;  1PDQ A;  2K7V A;  4CBV A;  1S5B D;  1CFM A;  1CM9 A;  1K83 B;  4LJZ C;  3ND9 A;  1A6X A;  2B8F A;  2K5D A;  5C4X B;  5EJW A;  1LTT D;  3SE0 A;  5M9O A;  2BDN A;  3FPP A;  5C3W A;  4RGM A;  1S5E D;  4KKS A;  4FXK C;  3BG3 A;  4ZQ3 A;  4OO1 G;  3BDC A;  3MFG A;  4L6T B;  3A8K E;  1LLR D;  4DXG A;  5DAU A;  1O80 A;  5D65 A;  3MHB A;  4HSV A;  1IL8 A;  1JR0 D;  4YIJ A;  2BA1 A;  3MAQ A;  5C44 B;  5T1I A;  1STG A;  4DXF A;  1CA6 A;  2O5J C;  4IUQ A;  1IKL A;  2Y0S B;  1STY A;  2K03 A;  3SK4 A;  2VNU D;  2EY2 A;  4G4K A;  1U4L A;  1RDP D;  1CHP D;  1WTP A;  4OIJ A;  4X3U A;  5COR A;  3PUW A;  3KBX A;  2QDB A;  4IUP A;  3T4A C;  5JVG 3;  2L5T A;  2B2U A;  1FR3 A;  1F9P A;  2HCI A;  1DYQ A;  5CR3 A;  4IFD I;  1F9S A;  1H9K A;  5CMD A;  1PMR A;  1LTS D;  3PO2 B;  3V96 A;  5K36 H;  3O13 A;  4R8N A;  3H91 A;  1KNA A;  3LNN A;  1EQT A;  5ELD A;  1A3U A;  3NE5 B;  4FF2 A;  3DM1 A;  1KDB A;  3OMG A;  1HFG A;  1E2V A;  1BCP D;  3SK8 A;  3TSS A;  3ERQ A;  1A2T A;  3D31 A;  4V19 0;  3MXU A;  2EY5 A;  2EYO A;  1XYI A;  1PTO D;  1VDZ A;  2L55 A;  3L9A X;  1K8O A;  3KLS A;  1E2W A;  4HMJ A;  5CYU A;  3PO3 B;  1F9Q A;  2RSN A;  3R3O A;  3S1M B;  4IN3 A;  2Q8T A;  2FHT A;  4C3J G;  5BN4 A;  3NWT A;  5E4W C;  1GOZ A;  1VF7 A;  3AB9 A;  4K6L A;  1H9S A;  2WV6 D;  5IT9 E;  1JWS D;  3TZD A;  2EOT A;  2NB0 A;  1EY6 A;  1ET9 A;  3OWF A;  2Z1C A;  2X6L A;  2Z4H A;  3A56 A;  4KD3 A;  2O5I C;  2WII B;  2JEB I;  1Y8N B;  4KKT A;  1WVL A;  4LK1 C;  3VYR A;  4DA2 A;  1JE4 A;  1KTK A;  1Q8I A;  3GV3 A;  3NSW A;  2NTS A;  5CV5 A;  3R8B A;  1MGS A;  3J80 E;  4C3H B;  5KRU A;  3I4M B;  5JVH 3;  4KY5 A;  1WCM B;  2L4N A;  2KA7 A;  4EQN A;  4TRD A;  3AMU A;  4C2M B;  2ZXR A;  4K2K A;  4ABN A;  2LY7 A;  1ESF A;  4X3K A;  4CGY B;  1DCZ A;  3N52 A;  1DXM A;  1SMY C;  1I4Q A;  2BA0 A;  4MHE A;  5FOB B;  2ICI A;  5CBE E;  1QOH A;  2BE5 D;  2XWJ B;  1KAB A;  4FVM A;  1MSH A;  4K8I A;  2Q8I B;  4BY1 B;  1WTX A;  1I4H A;  3VYS A;  1SYD A;  5JEA H;  4HSP A;  4B9X A;  2B2Y C;  2JA7 B;  3DEO A;  3SVM A;  2IJ0 A;  5C0X I;  2X69 A;  2C9O A;  1EWC A;  2IX1 A;  2KEE A;  1HUM A;  2KVM A;  3A55 A;  4I7Z C;  3MXP A;  5J39 A;  1WD0 A;  1BBX C;  4MN3 A;  1CTM A;  1G29 1;  5E3F A;  1KNE A;  2M00 A;  5ELF A;  1SYC A;  1QG7 A;  3M4O B;  5TSS A;  3N6R A;  4OHJ A;  5KNB A;  4ZKB B;  2QIL A;  1ET6 A;  3TME A;  4K14 A;  5KEE A;  2FFK B;  2C5C A;  3NQI A;  1Z7T A;  2XVS A;  1X3P A;  3L3O C;  1HHV A;  1EY9 A;  2EZV A;  3H09 A;  4RGN A;  1MI2 A;  1PZJ D;  3WOE A;  3NTH A;  3A8J E;  1SDF A;  2PW5 A;  3CRK C;  3GD7 A;  1QCB D;  2K01 A;  5KIX A;  3EA6 A;  2PMZ B;  1TY0 A;  2B2W C;  2AUJ D;  1VMC A;  2XNA C;  4DU9 A;  3NK9 A;  3MFY A;  4ULL A;  1GHJ A;  2EYF A;  3CRL C;  2M9V A;  1LTR D;  3P1H A;  3G6J B;  1BCP F;  4FXG C;  4DAY A;  2MGS A;  2JA8 B;  1EY7 A;  2XWB B;  2F3W A;  4WJW A;  1PTO F;  2F0K A;  4HCS A;  1SEB D;  1RCV D;  3W3A A;  3K0Y A;  4EGV A;  2PW7 A;  5JPM C;  4EQP A;  1ILQ A;  1NUC A;  4OO1 H;  2XRQ D;  5EBD A;  1R9T B;  1I4X A;  3F2U A;  1XX8 A;  2A6E C;  5CC4 A;  2K05 A;  5IT9 L;  4K5W A;  4CJ2 C;  1STE A;  5C5L A;  3RZD B;  4FP5 D;  1QWY A;  2B2T A;  4FXD A;  2Q8R E;  4KHV A;  4CJ1 B;  2HQE A;  1EZ8 A;  2OEO A;  2OF1 A;  4BA1 I;  4KV6 A;  5JJZ A;  1GHK A;  3TBI B;  2RA4 A;  5EGT A;  2HCC A;  4KN7 C;  3KUP A;  1FNV A;  1LT5 D;  3PV0 A;  2CVR A;  1NSN S;  1GJX A;  3J80 L;  2FJ2 A;  5D3D A;  5C4Z A;  2BDO A;  2PYK A;  1B50 A;  4DK1 A;  4XYO A;  2PPB C;  1DOM A;  3OOC A;  1AFP A;  4IZ8 A;  2SNM A;  2EJG C;  2EY1 A;  2Z8L A;  3HZX A;  1QNK A;  1SYE A;  3BDL A;  4J1M A;  2R3Z A;  1J8I A;  3P75 A;  1WTQ A;  3GTJ B;  4QIW B;  2LFN A;  3FVQ A;  4C3I G;  4DFA A;  1D5M C;  5JOB A;  1D1K A;  5JEA G;  3DUZ A;  3HGB A;  1RD9 D;  5KYL A;  3DWA A;  5EKI A;  4CKE A;  2NYZ D;  3URY A;  2HDM A;  4FO2 A;  3RMH A;  5I4D A;  3NUC A;  4BBR B;  1IW7 C;  5C3E B;  1WTR A;  1OXX K;  2QF7 A;  4X3T A;  1NR4 A;  2SEB D;  5D3I B;  4QF4 A;  1TR5 A;  5LL6 S;  2KJX A;  2G9D A;  2JYO A;  2CQA A;  4R9W A;  1WD1 A;  3GTG B;  3VR6 A;  1LTG D;  4KK7 A;  4Q0F A;  3TP8 A;  3NBH A;  2QEJ C;  1TII D;  1JOR A;  1F2Y A;  2D5D A;  1DJR D;  2HUG A;  2XN9 C;  2RKS A;  3EFX D;  3TDQ A;  1B1Z A;  5FO7 B;  1EY8 A;  1EU4 A;  2E2J B;  1EIG A;  3M7G A;  3S1R B;  2F0W A;  4KY6 A;  2K1B A;  2XIW A;  3E5S A;  3MC0 B;  2RDF A;  3NTK A;  4N9P A;  1D5X C;  2D9U A;  5M3F B;  2EE1 A;  2FIN B;  4ODG A;  4Z9C B;  1VMP A;  1DOL A;  3SR1 A;  1JIC A;  1D6E C;  3HKZ B;  4NKL A;  4RCO A;  2F0P A;  4M8A A;  3MEH A;  3EVQ A;  4RHS A;  3DWP A;  2F0H A;  1V1P A;  1HTP A;  3GTQ B;  4LMQ D;  3TP6 A;  3GQB A;  2F0T A;  1X3Q A;  1W6J A;  3ITP A;  2DNC A;  2KUM A;  3JAM E;  2DNE A;  4A3E B;  3D4D A;  4IAL A;  3I72 A;  1TQO A;  3ND8 A;  1YNN C;  1BNZ A;  2A74 C;  2WIN B;  3Q24 A;  2B2U C;  3HOX B;  2E2I B;  3BVG A;  4HED A;  1SYG A;  1WTW A;  3RUZ A;  3VA7 A;  2NUC A;  1HCZ A;  1EY5 A;  1SFO B;  2EYM A;  3P20 A;  3K5O A;  3S9W A;  1Q1B A;  5CBA E;  4IFD G;  1B2T A;  1NR2 A;  1XTC D;  4XQN A;  3J7A F;  1IYV A;  1LAC A;  1AEX A;  1L0Y B;  2X6G A;  5DM6 3;  4FYD A;  5J22 A;  4ILW A;  2PQE A;  4DK0 A;  1ONL A;  4FF1 A;  1JC7 A;  1IHZ A;  3T53 B;  5BN3 A;  4PV1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...