4ME5A

Crystal structure of staphylococcal nuclease variant delta+phs v23s/v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTSKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4me5A00
1EZ8A 2EXZA 3BDCA 1SYCA 4QB4A 5C4ZA 5IIFA 3EJIA 4K2LA 3C1FA 1F2ZA 5E3FA 4EQPA 5M9OA 3T16A 5IGEA 1IHZA 1SYBA 4KY7A 1EY6A 1NSNS 2EY5A 3SK6A 3MZ5A 5KRUA 2PW5A 1U9RA 3NQTA 3H6MA 1SYEA 2OEOA 3OMCA 4K2KA 5EGTA 1RKNA 2PZTA 5DEHA 4DU9A 4KJNA 5IGGA 2RBMA 1STAA 1EYCA 4ME5A 4F7XA 1A2TA 5IGCA 1EYDA 5IGDA 1KABA 1EY0A 2F3WA 3ERQA 4K5VA 5KYIA 2SNSA 1F2MA 2EYLA 4I65A 2F0PA 2PZWA 1EYAA 5CR3A 2F0LA 5J1ZA 2QDBA 3VA5A 4E6IA 5IODA 2F0JA 3NUCA 4J6HA 5F2DA 3MVVA 3LX0A 2F0EA 4OL7A 5E1FA 5JOBA 4DFAA 4K5WA 3V2TA 4RKBA 4IUNA 1TQOA 5HGTA 3SK4A 4ID6A 4K14A 1II3A 3OWFA 5C4HA 2NUCA 5NUCA 1TT2A 3MXPA 4KY5A 2F0IA 4K8JA 4NDXA 1JORA 2KQ3A 2EYJA 1JOOA 2RKSA 4KV6A 3TP7A 2EYMA 4IALA 2LKVA 1TR5A 2EY6A 2F0TA 5I9OA 3QOJA 3D4DA 4RKLA 5CV7A 5CV9A 4S3SA 2F0SA 2RDFA 5CV8A 3SK8A 4N9PA 3C1EA 1F2YA 3P1HA 1STNA 5EKKA 1EY5A 5EKLA 3NK9A 5CV4A 5I6YA 3HZXA 3TP8A 5DAUA 5KYLA 4DGZA 4F8MA 5KEEA 1STYA 2F0HA 5J39A 5CC4A 4QF4A 3TP6A 5J22A 4PMBA 3MHBA 5CV6A 2EY2A 4ZQ3A 2F0UA 2O4XA 3S9WA 2F3VA 4K5XA 4N9TA 3HEJA 4HTHA 5C3WA 2F0DA 3NXWA 5CGKA 3P75A 2WACA 2EYFA 1A2UA 4PMCA 5C5MA 3NP8A 2KHSA 3RUZA 1NUCA 2PYKA 3TP5A 4YIJA 4LAAA 4EQOA 3DHQA 3SXHA 3T13A 1ENAA 4H7BA 5ISRA 2F0FA 3OMGA 1SYFA 1EY8A 2PZUA 4EQNA 4ZUIA 2PW7A 3QB3A 3EROA 3EVQA 2EY1A 3OSOA 4DF7A 3SHLA 5I6WA 5I9PA 4HMJA 1KDBA 1JOKA 4B9WA 2EYOA 4K8IA 4NP5A 1KDAA 1A3TA 3PMFA 1SNQA 4ODGA 5C3XA 1SNCA 3SK5A 4B9XA 4EVOA 5KIXA 4KY6A 4QMGA 1SYGA 4WORA 3DMUA 2OF1A 1EQVA 5IOCA 2F0NA 2F0WA 2SNMA 1KAAA 1STHA 2M00A 2PQEA 1AEXA 1EY9A 4KD3A 4TRDA 3NHHA 5CV5A 3SR1A 1SNDA 5JAVA 2F0VA 2F0QA 3ITPA 4KTAA 5IGBA 3TMEA 4ZUJA 3D6CA 1SYDA 2F0MA 1STGA 2F0OA 2SOBA 4G57A 1SNPA 4R8NA 5C6AA 1KDCA 5K5PA 5KGUA 3R3OA 3E5SA 4PNYA 3D8GA 4K6DA 4IZ8A 1EY4A 3QOLA 3MEHA 4HMIA 2ENBA 2OXPA 1A3VA 2HQEA 1ENCA 2EYPA 5HURA 2EYHA 4MIUA 4J1MA 4WRDA 1STBA 5IGFA 2F0KA 1EZ6A 1JOQA 1SNMA 4KHVA 4KD4A 4NMZA 3BDLA 4KJOA 1EY7A 1A3UA 4NKLA 2F0GA 3D4WA 1SNOA 3U9OA 5C5LA
chains in the Genus database with same CATH superfamily
3HKZE 5BN3A 1QWYA 2LFNA 1PMRA 4H0LC 1QB5D 1U4RA 3T16A 3I4MG 1EEFD 2A6HC 3A56A 4ZRZA 1EY6A 2FMCA 5GAGC 3PF5A 1S40A 4ZLTF 5EBCA 2BDOA 3U4ZA 2WKDA 2QKIC 2HUGA 2IHEA 4A3EB 1LT6D 5JVG3 4F7XA 1L0XB 3I3CA 5IGCA 2PCFB 1EYDA 1PVOA 2F3WA 5KYIA 4J15A 2YU9H 1WCMB 1XPUA 2UUCQ 2RVLA 3D0FA 1F9RA 5F2DA 5E1FA 1K73C 3SVMA 5ELEA 2JA5B 1SJED 1QG7A 1K8OA 1LYLA 3EN2A 4F87A 3FPUB 2FINB 4DKAC 2E74C 2K05A 4KKUA 4Q0FA 1SMXA 3O13A 1Q12A 1X54A 1LABA 1VQIA 1JJCB 4IALA 1N36L 3OW2A 2JA6B 2EY6A 2K14A 5M5YB 3VR2A 2RDFA 4JI7L 1MSGA 3S1QB 1E7ZA 2CKZB 5M3FH 3AMUA 1D5XC 1NE3A 3HZXA 1DOKA 2J4XA 4PZ8A 2DNEA 1E2VA 2R7FA 3VYSA 2A8VA 1JJGA 3SGIA 3VR4A 3LWUA 2F0DA 4JI4Q 3S1MH 2EJMA 3PO2B 1YITA 1LTGD 1LV9A 2C5CA 4CDFC 2MPMA 2DJGC 5FLMG 1SLJA 2K7VA 1MJEA 4C56C 1G2SA 4B3TQ 3EROA 2ICIA 1SE8A 1XNQQ 4BBSG 3VR6A 4IQZA 4HMJA 3CW2C 4Y7NH 2A69C 4K8IA 3VR5A 1SNQA 1NMGA 3GQBA 2JQOA 3G7LA 3HOXB 5M5XB 3S1NH 2NZ1D 3PV0A 4FNFA 3K5MA 1ZXTA 3K6OA 5HURA 2F4VQ 1PYBA 3S15B 1I4RA 4L8JA 2KOLA 2F0QA 1V1PA 3VYRA 4K6LA 1BBXC 4A3GB 2WINB 3HOUG 2K5VA 2QDLA 3I56A 1EUJA 4LUVA 5FLXc 3R3OA 4PZ6A 3CRLC 5IT9c 4X6AH 1R4PB 1LTID 5JJIA 1PH7A 4UP9A 3KLRA 5IGFA 5JPMC 4KHVA 4FF1A 4LF6Q 1FJGL 2CQAA 3U9OA 4M8AA 4QB4A 4G4KA 3TQYA 2UUAL 1RD9D 2PNRC 2WAQB 5CBEE 2ZJQA 1I3QH 1QOHA 4JI7Q 2WIIB 4EQ5A 2B8FA 2XNAC 1X56A 2OEOA 1HFGA 2HIVA 1KAWA 4GS3A 1W6JA 3IFDA 4GN3B 4TSSA 2QF7A 1AZQA 1VQEA 2D9UA 4DNTB 1EY0A 2NN6I 3QR8A 2EYLA 3PO3H 3BYTB 4HJAA 1IBML 1HA6A 1HRJA 3KYHC 4DK0A 2L4NA 3M9BA 2RSOA 1OXVA 3HRZC 2N78A 1N33L 2RCNA 3DM1A 4KMUC 4CDEC 3HOXH 2WAQE 3ER0A 3KUPA 4RKLA 3FDTA 3SK8A 5CV8A 5FLMH 2WAQG 4JW0A 4A76A 4QIWE 5LHY1 5LMUQ 3TP8A 4DV1Q 4QL5A 2HT1A 4DV1L 2NVYB 2B2YA 3HOWG 2PMZE 2F3VA 5IYDG 2HHHQ 3A54A 5IP7H 3OTOL 4DAYB 2CWPA 2UXBL 1JB3A 4IUTA 1H9MA 4A3LG 2F03A 1WFQA 5FO8B 1CM9A 4XYQA 4A3IH 5M3FB 4DR3Q 1IW7D 1O7ZA 1YNJC 4GNXA 2K6AA 4K0KQ 4HEDA 1VQAA 4DA2A 2XVSA 2R7ZG 1LTBD 3Q8DA 3J80E 3GTMB 3M4PA 2VUMG 2A68C 1SYGA 4YCWA 2OF1A 2NVXB 1KRSA 1QNKA 5KEEA 2PQEA 4ME3A 3DEPA 4O0AA 1LLRD 3K81C 4U673 1SYDA 4A3FB 2JA5H 1GUTA 1Q46A 5GADC 1KDCA 4NW2A 2K28A 3EFXD 2K5WA 3H91A 4OWXB 1EL0A 2A68D 4KK7A 2DJFC 1CT1D 2RDHA 4A3KG 5K36H 4UP7A 3M3YB 3RN2A 4DV2L 1NR4A 1SNOA 1SXTA 3PIP3 2PI2E 3NSWA 5FLXL 1DM0B 3H15A 1ZEQX 4ZCKA 3FEWX 2VQEQ 3PQIA 2XGTA 4O1NA 1EWHA 2X6GA 1YZ6A 4HR7B 1PHJA 1PZJD 1STAA 3BVGA 4HCEA 1PH9A 4X62L 3S24A 4DV3L 4OWWB 4M1UB 2N8NA 3IKJA 3J7ZC 4YY3Q 1PYSB 1AH9A 4JI6L 3LX0A 2F0EA 2V1CC 2UUCL 3MXGA 4IUNA 2K32A 3I72A 3H3VC 4IUUA 2PPBC 4BY7B 2ZXOA 1JORA 1QZHA 2KQ3A 2VQFQ 3UI2A 4JI4L 5IYBH 2F0TA 4YWKA 1U4LA 2BCOA 3C1EA 3MA2B 3KFUA 4A3DG 1STYA 3K59A 5J22A 4PMBA 3T53B 2O4XA 3CCEA 4TVAB 5C3WA 5CYUA 2IWHA 1KRTA 2F52A 1X32A 5ISRA 1HH2P 3T13A 2A6ED 4AH6A 1Y1WG 3OMGA 3C2PA 2JA6G 3GTQB 2JA5G 1GUOA 4EQNA 2MFIA 4QUCA 4PV1C 3A8JE 1VDZA 2AUKA 1X3QA 3KBXA 4V0BA 3DUZA 4HN7A 5C44G 3PO2H 3S1MB 2L11A 4JYAQ 5G3LF 2O2LD 3OPOA 2K04A 2DN8A 2N49A 4V190 5JVH3 4BY1G 1J8IA 1PTOF 4PZ7A 5FOBB 1PH4A 1GOZA 1N32L 4G57A 3S1QH 1O80A 2RHQB 4G7OC 2CHBD 5M5YH 3H3VH 2JA6H 3MEHA 2L9HA 4HMIA 3RZDB 4X62Q 1ILPA 4WJWA 2JSOA 1STBA 3NELA 4GLAC 3L7ZC 5IT9L 4KJOA 4P74A 2C35B 4A3MG 3CRKC 2ZJRA 1BXTA 2PQAA 1F2ZA 3TS0A 1S5ED 1VQFA 3I91A 5IGEA 2KUMA 4BY1H 1WCMH 2QGQA 3MZ5A 4A3JG 2G9DA 1D5MC 4JOIA 1ONLA 4A93B 1E1OA 2RSNA 3ND9A 5DEHA 4DU9A 3VYTA 1EYCA 4A3EH 1WJJA 4CKEA 4DNRB 4RHRA 1BOSA 3LGJA 3PGZA 3F2DA 1Z9FA 1IKLA 1T9HA 5DM63 4OEMB 4DV4L 3K0YA 2B63G 2UUBQ 3CAMA 4DK3C 2N88A 1VQMA 4L5RC 5IT9E 1V1OA 4DR2L 1XMQQ 3P20A 4XT1B 4IURA 3GO5A 4KV6A 3HOZB 3EBEA 4B08A 2CH4W 1G51A 3D4DA 5CV7A 2L1BA 1M4VA 4A3CH 1WD0A 1PZID 1IL8A 3MXUA 5DNFA 3FHWA 2AQ3B 1Q1EA 2NZHA 2R92G 3C46A 4JBWA 1EU4A 4KLKA 4X66L 4J8QA 3J81c 1VQ6A 3H0GH 1EQTA 3J81L 1E3PA 1HR0Q 5C5MA 1NUCA 3DHQA 2UU9L 3UE1A 3HKZG 3U58A 2E2DC 3QB3A 2OQ0A 3V96A 4JI0L 4OO1G 2GVBA 2JN4A 4HSPA 4CKCA 3CCSA 2NTSA 4LF7L 4JI8Q 4R8IA 4Z9CB 1CUKA 3X3NA 3M3YH 2E2JH 1I6VC 3WOEA 1IBLL 3JC66 2F0NA 1AE3A 4EX5A 4EQPA 3H09A 4TRDA 4KD3A 1TWCH 5EPKA 1B4OA 3FKIB 2F0OA 2LSSA 2OTLA 1HR0W 1B1ZA 2EDGA 2RDGA 2E8GA 4A3FH 1Q1BA 3CC4A 1IBKL 4KHZA 4PQXA 1F9SA 1SE2A 2NVXH 4OELB 2E2IH 3M7GA 3A0JA 5C0XG 3GTMH 3RLFA 3NPPA 4OIKA 2JYOA 5EQ0A 1BCPB 1Y69U 1QNUA 4A3IB 3OWEB 2A5HA 1NSNS 3TRZA 2R7ZB 3H6MA 2IX1A 2AUJD 5IGDA 1IYVA 4X64Q 2WB1B 3S2DH 1VQJA 1LUZA 1SSOA 3AFPA 1YVCA 3FVQA 1Q90A 3T1YQ 1L0YB 4GKJQ 3SDZA 1E24A 1CKNA 3T1HQ 1GM5A 3A74A 5C0XH 4RCOA 4KN7C 3OWFA 2K50A 3K5OA 5EPJA 3RMHA 1PH2A 1KXLA 1ML0D 4DR7Q 2EYJA 1GXDC 3H94A 5JJLA 1XPOA 2A19A 4OO1I 2LKVA 3K58A 1I5FA 5FJ8G 4S3SA 1DGSA 1V1PB 4OO1H 4C3HH 3DXJC 2F3IA 3I4NB 4BBSB 3J81i 4B3SL 1BDOA 4JBKA 5BR8L 4QUFA 4F8MA 2JA8G 1QZGA 3TP6A 1YNJD 1FNUA 1HNWQ 2VZAA 1JT8A 5KNDA 1GKHA 3PO3B 2E5LL 1SDFA 4OGQC 2IY5B 5CC4A 3IL8A 4JC0A 4APVA 3NWSA 1P8LA 4HSVA 2DUDA 2KCMA 5DM73 1MBYA 4R9WA 1IL2A 2FXQA 1CKOA 2A1AA 4JI6Q 4HIKA 1VQ7A 2HDLA 3Q22A 2J0TD 3PMFA 1VF7A 4IFDG 2M2LA 3CCQA 1N33Q 4KY6A 2ATWA 1OXUA 3J7AV 4DV0L 3PUWA 2ZXPA 3BVMA 1PH8A 1NY4A 4JI2L 2EE1A 5JAVA 3A5ZB 4DV7Q 1OO9B 3RLNA 2FFKB 2SOBA 5A35A 1NCVA 1HQMC 1SNPA 4IOCA 1B9NA 2R6GA 4QY7A 3T1YL 4OX9L 3OHXC 3W1GA 1H9RA 2MQHA 4IPGA 4EGVA 3PO3G 4GLVB 2KCNA 3S15H 1V1QA 1BO0A 2F0KA 3NEMA 1EZ6A 2A74C 1TWAH 5M5XH 2ID0A 2B8GA 3VYUA 3HOVG 5T1GA 1I50H 1SBBB 1YJWA 4Y7NB 2BH2A 1KTKA 1O7LA 3L3OC 3KF6B 3G71A 3NTHA 2UUAQ 3RZOB 2Y0SB 2AWOA 4LF9Q 1DYQA 3J80L 4OXPA 4WJ3M 2B2WA 1FL0A 1T5EA 2YTVA 5IYCH 1ESRA 2LMCB 1TWGH 1YHAA 2BOSA 1UEBA 4RA8A 1I94L 4XQJA 4IN3A 3A5UA 1WTHA 2QA4A 5J1ZA 1F2MA 1L0WA 2PZWA 3S16H 4K0KL 1I6HH 3ERSX 1D7QA 2Q8TA 3B6YA 4BA1I 1VQGA 5IP7G 1DD2A 4KKTA 3NBIA 1EQRA 4GKKQ 4L6TB 1YIJA 4GKKL 1WTVA 3DWPA 3QG1A 5A2QE 5AJ3L 2G9HD 2F0SA 1DCZA 2B3GA 3NK9A 3IRBA 2KEDA 1RF2D 1UE6A 4AQYL 2D0OA 3R8BA 5CV6A 2HHHL 1PYWD 3I4MH 3HOYG 4K5XA 3SEBA 2YU9B 1Q82C 2J7ZA 1U0LA 1CA6A 1EIYB 1LTSD 3TN2A 1HNWL 1A63A 1X3FA 2OT2A 1J5EL 4EQOA 2I46A 2Z1CA 1VQ9A 1D8LA 4DR6Q 4IPCA 3BJUA 3HOUH 5IYBG 3M4YA 3GDEA 3EVQA 3TDQA 2MJ8A 2DY8A 3HGBA 5JJZA 4CGYB 4IPDA 3JAME 1KDAA 1A3TA 4GOPB 1IYJB 4A3KB 4NXML 3D31A 4L5TA 4KHPQ 3DMUA 1S5DD 2ZTCA 2R93B 4UY8C 3NHHA 1X55A 2F0VA 3BDOA 4YWLA 1HZ9A 1HNZQ 1IBMQ 4UHVA 2HCCA 2LXJA 4DV7L 3OOCA 5K5PA 1D1IA 1AW7A 2RQXA 1L1OC 4K6DA 3QOLA 5M3FG 2HQEA 1FNWA 3CPFA 2EYHA 2K03A 1VS0A 3J81j 2L12A 4NKLA 1R9TH 2KHJA 1WTPA 2VNUD 2D2CC 5C4ZA 3HOWB 4X65L 1PRTF 5E4WC 2XWJB 1YHBA 4IOAA 5KRUA 2UXCL 1K8MA 2YTYA 4NXNL 2NYZD 1VQ4A 5M3MG 3BZKA 5C3EH 1G291 3HKZB 5EKIA 1Z7TA 3ERQA 1OXXK 3FMCA 4LF4Q 4LWCA 2R61A 4FF3A 1RDPD 3VA5A 1H9SB 2EOTA 2G5DA 1N32Q 4OL7A 5JOBA 2KA7A 5EJWA 4B3SQ 4DAPA 4KN4C 5FO7B 4XXEA 4A3MH 5HGTA 3I8ZA 1SE3A 1II3A 1SFOB 1GUSA 1MKHA 1TT2A 1HJPA 3K0XA 4DV5L 3S17H 1SJHD 3KOJA 5IYDH 1CKNB 1MSHA 1HTLD 1S5CD 4ZKBB 3HOXG 3M4OB 1QUQB 3GTOH 4N9PA 4LK1C 3T1HL 4DR4L 4IO9A 1L1OB 4A3DH 2YV5A 3NBHB 3OIPA 4A3IG 3L9AX 2ZT9C 5KNCA 1S5FD 1KD1C 1Y1VG 1K3RA 2HQLA 2B2TA 1VQ5A 4HTHA 5CGKA 4RGTA 5LL6X 3M85A 2KHSA 4YIJA 2BE5D 2P5ZX 3CQZH 3STBD 4X3UA 3NQIA 4L5QA 3ICEA 4DR6L 3CCJA 1ZKOA 2WV6D 1UUPA 2HCIA 3URYA 4C2MH 1XXGA 3CKIB 1SNCA 1HUMA 2BA0A 1EIHA 3PF4A 4A4IA 1KAAA 3MC0B 4JVZA 1U4MA 3AU7A 4H02A 4A3JH 2UUBL 3GTKB 3GV6A 1LO5D 5C4JB 1Y1WB 5FJ8H 1WTQA 3PUZA 3TZUA 4LFCL 2YYZA 1OXTA 1JMCA 2OXPA 4RH6A 1ENCA 2HD3A 3I7FA 4LUOA 2I5MX 4POGA 1ZYRC 3KJPA 4ULLA 3BDLA 4BXXG 3D4WA 3I4LA 5C5LA 1EZ8A 2EXZA 1I4PA 1S4ZA 3BDCA 4NPSA 4B3RL 3C1FA 2NVTB 3TREA 1WCMG 2I5LX 3W5OA 2JA7B 1M90C 1EFWA 1C7YA 1EIFA 2UU9Q 1FGBD 4DAVA 1HR0L 1RL2A 1QILA 1K9MC 3HKSA 2SNSA 1JWUD 1CHQD 3HOVB 2MUYA 4DR5L 4RKBA 1IXRA 3GTGH 1VQ8A 4BS9A 1W2BA 2AWNA 3X3MA 4K8JA 1EQQA 1Y1VB 4R4OA 1TR5A 1S3OA 2CW0C 3BYYB 2NVQB 1IBKQ 3TEHB 1D1KA 1VQNA 1X3GA 2IL8A 5I6YA 4GKJL 1ASZA 4B3RQ 3AQQA 1E0BA 3R2TA 5COYA 5C44H 1UE1A 2B63B 4B3ML 1GVPA 4ZAIA 4IFDI 3F8TA 5C4XB 1U4PA 3I90A 4XDXA 5M5WB 3P75A 1QE6A 3AFQA 1KNEA 3CXCA 1G6PA 3GTLB 1M8AA 4LAAA 4A3FG 1Z47A 4F88A 4LF5L 2Q2HA 4NB3A 5EPLA 2PW7A 1NJIC 1RIPA 1JQYD 3OSOA 1LT5D 4JV5Q 3U50C 4C3JB 4XTCS 4C3HG 5KIXA 3EA6A 3HOYH 2EJFC 1EQVA 5C0XI 1TWHH 1BNZA 4YCVA 1HNXQ 4JK1C 4DR1Q 1CA5A 1XTCD 2GVAA 2KENA 1GO3E 3R2IA 3HOYB 3E0JA 2AHOB 4XQQA 4JI3Q 5JEAG 1N34Q 4C3JH 2Z6KC 3IFTA 3WOFA 3RNUA 2EZVA 4RGNA 3VR3A 5J3BA 1YEZA 1TY0A 1SYCA 4DUZL 1AP0A 2PQAB 1K8GA 2RCFA 2XRQD 3E9HA 2BH8A 2OTJA 3FP9A 2IJ0A 2EQSA 5M5WH 4K2KA 1HZAA 1BQQT 1XNRQ 1UNSA 4IJLA 4DV5Q 4XT3B 1A2TA 1BVSA 3J81E 4IUQA 5C44B 4CDCC 1RCVD 3KF6A 3PO2G 1VMCA 3I4NG 1E2ZA 1MI2A 2VUMH 3G4SA 1XJVA 2JA8B 4RFBA 3S2HB 2IX3A 1PDQA 3RLOA 2NVQH 1PFMA 3T51B 4JOIC 3RR5A 3J7YW 4X65Q 1Y1VH 2XN9C 2NUCA 1X3EA 1FYCA 2N55A 3PIPA 2B2VC 1Q3LA 4NXNQ 1TXYA 1Y14B 3GTGB 3CCVA 4BBRH 1XYIA 4LFCQ 1KHIA 1Q81C 4XIGS 2VL6A 2OWOA 3ZYYX 2E2HH 2V4DA 4A3BH 2D62A 3D3RA 3I70A 4DV6Q 2AKWB 1HNXL 4QF4A 1BBUA 2L55A 1GUGA 4N9TA 4QIWB 2B2WC 4KHPL 2OCEA 4CBVA 3HS0C 5D3IB 4JYAL 1HCZA 3ULJA 4UDUC 1SEBD 2NN6H 1YNXA 2UXDL 1IZ6A 1PXUA 5M3MB 4R4TA 2NZOA 1B44D 3QWNA 5ELNA 3S14H 1GHKA 3I55A 4DV2Q 3PUYA 4CHTB 5C3XA 4C3IB 5C0XJ 2QW7A 3E6ZX 3K7AH 4BXXH 1KC8C 1DXMA 5IOCA 3HFZB 4JI1Q 3GTJB 3DLLA 4X3KA 4IPHA 5ELDA 1CK1A 1RJTA 5FLXE 4A3JB 3KBGA 2PI2A 2R7DA 1N8RC 2NN6G 3E5SA 4PNYA 1A3VA 5AJ3Q 1N9WA 3LWEA 5K36G 4NXMQ 2VQFL 1K83B 1JOQA 1Q86C 4KD4A 3NTIA 3PUXA 2A69D 4IUPA 1DJRD 2I07B 1I4XA 3L2PA 4AYBG 2AQ1B 1AZPA 4H13C 2K5NA 4KY7A 1CSPA 1JWSD 1JC7A 2PW5A 1RHPA 1SYEA 3OMCA 5EGTA 5GQOA 4A75A 4JG2A 4KJNA 3I73A 1K83H 5LMNQ 3CCRA 3E9IA 4KKSA 1LTTD 4RG1A 5A2QL 3Q24A 1X65A 3T56B 1UWVA 1EIGA 3CP0A 2R92B 1U5KA 1YNND 1SE4A 3GTOB 3CCMA 4QJFA 3BS1A 3KLWA 2ZM6L 5FKAC 1LACA 2CCZA 1PRTD 4P73A 2Z4IA 3F2CA 3HG9A 4OONA 2EVBA 4DUZQ 4FXDA 1EY5A 3KF8B 1VQPA 5EBDA 5KYLA 1DONA 4PMWA 2DNCA 4LFAQ 2ZTEA 3KJOA 2I5HA 3MWYW 1VQBA 1UEAB 3S9WA 4DV3Q 4X64L 1KIXA 3FPPA 4BWGB 1M1KC 2XIWA 2F1MA 3NP8A 1K28A 4OHJA 1C48A 4JBMA 2JXMB 1RTOA 5H1SE 2PZUA 3DWAA 4ZUIA 2CW0D 5TSSA 4ZYSA 4DV0Q 4RAUC 5I6WA 1VMPA 3NE5B 4BBRB 4IJHA 1J5EQ 4Y52H 4P75A 3KLSA 4WORA 1HXYD 3WWVA 2F0WA 1PH5A 4GOPC 2NWGA 5CV5A 1E2WA 4MTKA 1FVIA 5C3EG 3KDFA 4R8NA 5C6AA 1WTXA 2RHSB 3RD4A 4DK6C 1X6OA 2E5LQ 2R3ZA 2ENBA 3J7A5 2LXKA 4A3KH 2MGSA 2QILA 1C0AA 5I4DA 5AFWA 2BE5C 4LUZA 1TS3A 1O7IA 1TS2A 1VQKA 3HOUB 4YHHQ 5IIFA 1ASYA 2X6LA 1RTNA 3TS2A 4B3TL 1NAPA 1OTCA 4JBJA 1HNZL 4IUVA 4OIJA 1A62A 2AMCB 1TWFB 1S72A 5E4XA 1SN8A 3CU7A 5GAHC 4ZKCB 3NBHA 4K5VA 4FYDA 4I65A 4DNIA 1EYAA 2YTXA 1B8AA 1SR3A 2KJXA 5ELOA 5BN4A 2F0JA 1R4QB 4DXFA 3VA7A 2D5DA 2A6HD 2DGYA 4RWSC 3V2TA 1LTLA 1TQOA 4R4QA 5JPNC 2WB1E 4U68A 5NUCA 2KHIA 1TIID 2Z9HA 2TMPA 5IE8A 4HJ8A 4PG3A 5I2YA 4A3CG 1BF4A 1H9SA 2VB3X 1F2YA 4OX9Q 3I4OA 5ELFA 3V05A 2H5XA 2IT1A 2UXDQ 3GTPH 3BG3A 2Q8RE 3CMAA 5J39A 3GTJH 4ILWA 3A8IE 3MHBA 1HZCA 1Q8IA 3TZDA 3HOZG 1ICWA 4LW1A 1ET9A 2VB2X 1A8VA 3NXWA 1LTAD 1MD2D 3PIOA 4PMCA 2WACA 3CD6A 4OWTB 5C4XH 1ICFB 2VW9A 4HIDA 3RZOH 2F0FA 1VQDA 1CZWA 4JI0Q 2CH4A 2KEEA 2H4OA 2ZXRA 5I9PA 1WD1A 4DUYQ 4NP5A 2SEBD 1QCBD 1K8AC 2XSCA 1TU2B 3NTKA 2MHVA 4P2CB 2B29A 5ELCA 1TS4A 3UE0A 2SNMA 1STHA 1EY9A 1O7YA 2JEBI 3S1RB 5IGBA 2ICEC 4ZUJA 4H44C 1C8CA 5LMUL 1G8ZD 4A3BB 2E2HB 2VY3A 4BBRG 1PTOB 1PTOH 2QCPX 2WFWA 3CF5A 4HAEA 3S1RH 2E75C 4J1MA 2CVRA 4WRDA 2CQOA 4N8X1 2IW3A 4JI8L 1SNMA 3U9SA 1EU3A 1A3UA 1NTGA 3OYYA 5HY6A 4C1NI 1BR9A 3MAQA 4DR4Q 4DV4Q 1NBWA 1BCPD 3TSSA 4QGUA 1HHVA 3A55A 1F77A 1W6KA 4LF8L 1NMFA 1I4GA 3CCLA 3G48A 3KLSX 1WOCA 4RGMA 5CR3A 1CI3M 4BBSH 2FJ2A 4X3TA 3HP3A 1UE7A 4POFA 3SK4A 3GTPB 5C4XG 4AIMA 3VDYA 4FP5D 1JOOA 5DLQE 3TP7A 1HZBA 4ABNA 2JK8A 1HFNA 1F2LA 5EKKA 5EKLA 5LL6S 1PTOC 3FKIG 1PZKD 4WJ4A 2JE6I 4JI2Q 4FF2A 4LFBQ 4GNXB 2TSSA 3I2ZA 3K7UC 4B3MQ 1PH3A 2EYFA 4ALPA 1B53A 1VQLA 4DR7L 3TP5A 1WTWA 5GAEC 4H7BA 1TWFH 4BA2I 1P16A 3BZDB 4DN4M 2MO0A 1OXSC 2LY7A 1B7YB 3ULLA 3JAML 2B2TC 3STBC 4A3BG 4FF4A 3M4OH 1EWIA 1AEXA 3IAYA 1SNDA 2ES2A 4TQUS 2KBNA 3QO2A 4A3MB 2MP1A 1B9MA 4WFN3 3L0OA 5IP9H 3D8GA 4LJZC 1EY4A 3QIAA 3PCOB 2EYPA 4C3JG 5LMNL 3UDFA 1G2TA 4DR2Q 2VS1A 3AEVA 3DEOA 1TKWB 1I4HA 3QJYA 3GV3A 5EAYA 1YJNA 3NENA 3R93A 4CKBA 4GZYC 3N6RA 1CZGA 3SK6A 2Q2IA 3NQTA 1R9TB 1LT4D 1QJOA 3H0GB 1GUWA 2O5JC 5IP9G 4GN5A 3DM3A 4LFBL 4A3LH 1JICA 2F0LA 4E6IA 2QDBA 4C3IG 2JA7H 4DUYL 1XTDA 3UDXA 3NUCA 2A6EC 4DK1A 1ET6A 4YY3L 4A93G 4K5WA 2B39A 4C1NK 4O42A 4ID6A 3MFYA 1XMOQ 4JI5Q 3HOZH 5C4HA 4DPGA 2F0IA 4A3GG 1RODA 3MEFA 1DOLA 2L5TA 1Y8NB 2JP1A 3QOJA 2DY7A 4GLXA 1STNA 1KL9A 1AFPA 5CV4A 1B3QA 3GTKH 4LMQD 4DGZA 1FD7D 3J80i 2F0HA 2Q2TA 3MXNA 1MJCA 1Y8OB 2R92H 1QVCA 2F0UA 3Q6SA 2Z6BA 2K75A 4A93H 1JCKB 1V9PA 3CC7A 4BY7G 2XWBB 4C2MB 3RUZA 2PYKA 3I4MB 2QEXA 2CWAA 4RMFA 4CDDC 3F2BA 1SYFA 2VXWA 4UP8A 3PSIA 4L63B 3K5NA 1KNAA 3H3VI 3CQZB 1ESFA 4A3EG 1Q7YC 3SHLA 2Y0SG 5JEAJ 2ASBA 2KVMA 2E76C 4ODGA 2K01A 1GD7A 3RZDH 4EVOA 5D65A 3EQLC 2K5HA 4DAMA 4X66Q 3C3LA 3ITPA 1WTOA 4KTAA 5IY0A 4AQYQ 2I0QA 4A3DB 3ZJYC 1PRTB 5E7NA 3AYHB 1CHPD 1X9NA 2CFMA 4CJ1B 2O5IC 4LF4L 3S16B 2K4KA 2WP8J 4YHHL 1K0SA 5G3LD 2Z0SA 2X69A 1SMYD 1I94Q 3G6JB 4NMZA 3K7AB 4AYBE 4C3IH 1CQVA 1CKMA 3EIVA 3A7LA 3EJIA 3CC2A 3S14B 2B2UC 4YCUA 5M3MH 1F9PA 1U9RA 3OTOQ 3BU2A 1XPRA 1RKNA 2B2YC 4N8FA 3U4VA 4ME5A 4Q5VA 1TWAB 2KECA 3MFGA 4R1JA 4FVMA 5ELBA 1B50A 5CBAE 3TMEA 1QVFA 5FO9B 2F0PA 3AB9A 2NTTA 1DOMA 2EJGC 2ALYB 3RN5A 2RA4A 3ONAB 1YJ9A 1Q8KA 3F1ZA 1D2BA 3A7AB 2GN5A 4JI1L 3UDGA 4KY5A 1KQSA 3D6WA 2ZM6Q 4BY7H 2RKSA 4FDBA 2EYMA 3OW7A 3CHBD 5IODA 4GN4B 4LF9L 2ZJPA 1LT3D 2FHTA 1H95A 2B2UA 1K0RA 4LFAL 3K80C 1QVGA 1CFMA 4FXKC 2HIXA 1A15A 1N34L 2JA8H 3S2HH 2VUMB 4YWMA 4RHSA 4HJ5A 1PLFA 2QEJC 4DR1L 1TVXA 2EXDA 3W3AA 1JR0D 4X3SA 4IFDJ 1EY8A 2L15A 4DR3L 3E0EA 5I2XA 4L5SA 1E1TA 3I4NH 3BZCA 3GP7A 1S5BD 2UXBQ 5JJKA 1JJ2A 1PFBA 1EWCA 1BBWA 1JOKA 2EYOA 4G7HC 3SK5A 1HPCA 1EOVA 4HJ9A 1BKBA 1EYGA 4IFDH 1H9KA 1STEA 2N3SA 3DWQA 3PIO3 1DZ1A 4JI5L 1XMOL 4P71A 2Z6KA 2KCCA 5LMNW 5CMDA 3KDFB 3M4QA 3FRPB 2F0MA 3T4AC 1VQHA 5L37A 5KGUA 1FGUA 2F4VL 1B3AA 3S2DB 3J80c 1TWHB 1W3SA 3Q23A 3F2UA 1XNRL 1KLUD 3W2DA 2R7ZH 1AN8A 1O78A 4K2LA 1H9JA 1I6HB 1E22A 3CCUA 1J9OA 1SYBA 1MHWC 1F9QA 4DAYA 1PH6A 2AQ2B 4XYOA 3CMEA 3ULPA 2Q8IB 1FR3A 1YBYA 1C4QA 1BUVT 2PZTA 3W1BA 1XMQL 3MXNB 5IGGA 4JI3L 5IYCG 3GTLH 4MN3A 1JB7A 1HTPA 1TWGB 2R93G 1G6ZA 1Z6HA 1WYDA 2NVYH 5I9OA 1HQRD 4KI0A 3UDIA 2B63H 3KF8A 1T5XD 1TWCB 1I50B 4K14A 2K5DA 1LM0A 2M9VA 3MXPA 2OQKA 1K3BC 4MZ9A 4NDXA 3G6EA 4GNXC 2L0CA 4LF7Q 1SRUA 4P72A 4HJ7A 1JE4A 2K5QA 4JV5L 3Q0AA 4JPBW 3P1HA 3WDNA 2A73B 2XRSD 4HCSA 1BCPF 3JAMi 4DV6L 1GHJA 1JE5A 4AYBB 3H0GG 5FK9C 1B2TA 3JAMc 4ZQ3A 3HOVH 2JA9A 2ZTDA 2NBFA 3HEJA 3PUVA 4LF8Q 1IBLQ 1CTMA 1A2UA 4LNQA 4FO2A 2K33A 3E3XA 2WKCA 2NB0A 3SXHA 1ENAA 1GJXA 1I3QB 1MIUA 5BR8Q 4UAIA 2IHFA 2EIFA 3K5LA 1IKMA 1IYUA 1VCIA 5T1IA 3CPWA 3P7JA 2Y0SE 1I4QA 1PRTC 1PA6A 1V43A 2NVTH 3LNNA 4HIOA 1TS5A 2WB1G 4B9WA 3TBIB 1HA5A 3J7AF 1AE2A 3SE0A 4MHEA 2K52A 4CJ0B 1NNXA 4G7ZC 1VQOA 2M00A 1UAPA 1PH1A 4A3GH 3KK7A 3SR1A 1ILQA 1UE5A 1QUQA 1WVLA 4C3HB 1XX8A 1PV4A 3S1NB 5C4JH 1Y1WH 5CORA 1B70B 1WI5A 4I7AA 5IWAL 4MIUA 4LF6L 4MNOA 5GROA 2KCTA 1L2FA 2C9OA 1MGSA 2XTIA 3ND8A 1SROA 1D5ZC 2PNHA 5E3FA 1V8QA 4RCNA 4BY1B 1IW7C 2MNAA 2EPBA 5M9OA 4GOPA 1YNNC 1IHZA 4FXGC 2EY5A 3NWTA 1EOTA 3K57A 1VF5C 2RBMA 1FNVA 4R4CA 1GUNA 1KABA 3K8AA 2LS01 2D0PA 5D14A 4I7ZC 1A6XA 4MTNA 2F4IA 1ZYRD 1J6QA 4J6HA 3MVVA 4DFAA 2FMMA 2K1BA 1FJGQ 2Z8LA 4LF5Q 2Z4HA 2E2IB 2BDNA 4CJ2C 3OIQA 4UPAA 2VQEL 1CSQA 1PTOD 5IWAQ 2UXCQ 5CV9A 1XWEA 1CQFA 3S17B 4QCLA 4QQBX 3A8KE 3FKIH 1SFOH 4DR5Q 2PO4A 5DAUA 1LTRD 4JCVE 4TKOB 3GTQH 2EY2A 2E2JB 3BVZA 2MO1A 4XQNA 1Y8PB 1YHQA 1X3PA 5C3EB 1C9OA 3N52A 4R4IA 1XNQL 1A0IA 1G91A 1D6EC 1TY2A 2PMZB 2EY1A 1KLGD 4DF7A 2B2VA 5BN5A 3MTSA 1KDBA 2H1EA 3HOWH 2JEAI 2JJQA 1PFSA 1L1OA 1NR2A 4B9XA 1ENFA 2HDMA 1YI2A 4QMGA 5KNBA 1SMYC 4ZK9B 3D4RA 3M7NA 4O2DA 3GD7A 1BCPC 3D6CA 1STGA 5HGQA 1JWMD 5D3DA 1PFNA 1EEID 4HIMA 4IZ8A 2BA1A 5JEAH 4RGOS 2JA7G 2GA4B 1N36Q 1WTRA 2RF4A 2SDFA 1HUNA 1EFID 2IPKD 2R93H 1VQCA 4DXGA 1SAPA 1EY7A 2F0GA 2Q2UA 2IX0A
chains in the Genus database with same CATH topology
5BN3A 1QWYA 2LFNA 1PMRA 4H0LC 1QB5D 1U4RA 3T16A 1EEFD 2A6HC 3A56A 4ZRZA 1EY6A 2FMCA 4ZLTF 5EBCA 2BDOA 2WKDA 2QKIC 2HUGA 4A3EB 1LT6D 5JVG3 4F7XA 1L0XB 3I3CA 5IGCA 2PCFB 1EYDA 2F3WA 5KYIA 1WCMB 2RVLA 1F9RA 5F2DA 5E1FA 3SVMA 5ELEA 2JA5B 1SJED 1QG7A 1K8OA 4F87A 3FPUB 2FINB 2E74C 2K05A 4KKUA 4Q0FA 3O13A 1Q12A 1LABA 4IALA 2JA6B 2EY6A 5M5YB 3VR2A 2RDFA 1MSGA 3S1QB 3AMUA 1D5XC 3HZXA 1DOKA 2J4XA 3VYSA 2DNEA 1E2VA 3VR4A 3LWUA 2F0DA 3PO2B 2EJMA 1LTGD 1LV9A 2C5CA 2MPMA 2K7VA 4C56C 1G2SA 3EROA 2ICIA 3VR6A 4IQZA 4HMJA 2A69C 4K8IA 3VR5A 1SNQA 3GQBA 3G7LA 3HOXB 5M5XB 2NZ1D 3PV0A 4FNFA 3K5MA 1ZXTA 3K6OA 5HURA 3S15B 1I4RA 4L8JA 2KOLA 2F0QA 1V1PA 3VYRA 4K6LA 1BBXC 4A3GB 2WINB 3R3OA 3CRLC 1R4PB 1LTID 3KLRA 5IGFA 5JPMC 4KHVA 4FF1A 2CQAA 3U9OA 4M8AA 4QB4A 4G4KA 1RD9D 2PNRC 2WAQB 5CBEE 1QOHA 2WIIB 2B8FA 2XNAC 1HFGA 2OEOA 1W6JA 3IFDA 4TSSA 2QF7A 1AZQA 2D9UA 4DNTB 1EY0A 2NN6I 2EYLA 3BYTB 1HA6A 1HRJA 4DK0A 2L4NA 2RSOA 1OXVA 3HRZC 3DM1A 4KMUC 3KUPA 4RKLA 3FDTA 3SK8A 5CV8A 5LHY1 3TP8A 2NVYB 2B2YA 2F3VA 3A54A 1JB3A 4IUTA 1H9MA 2F03A 5FO8B 1CM9A 4XYQA 5M3FB 1IW7D 1O7ZA 1YNJC 2K6AA 4HEDA 4DA2A 2XVSA 1LTBD 3J80E 3GTMB 2A68C 1SYGA 2OF1A 2NVXB 1QNKA 5KEEA 2PQEA 3DEPA 1LLRD 4U673 1SYDA 4A3FB 1GUTA 1KDCA 4NW2A 2K28A 3EFXD 2K5WA 3H91A 1EL0A 2A68D 4KK7A 1CT1D 2RDHA 5K36H 3M3YB 1NR4A 1SNOA 1SXTA 3PIP3 3NSWA 5FLXL 1DM0B 1ZEQX 3FEWX 4O1NA 1EWHA 2X6GA 4HR7B 1PZJD 1STAA 3BVGA 4HCEA 4M1UB 3IKJA 3LX0A 2F0EA 3MXGA 4IUNA 2K32A 3I72A 3H3VC 4IUUA 2PPBC 4BY7B 2ZXOA 1JORA 2KQ3A 3UI2A 2F0TA 1U4LA 2BCOA 3C1EA 3MA2B 1STYA 3K59A 5J22A 4PMBA 3T53B 2O4XA 5C3WA 5CYUA 2IWHA 1X32A 5ISRA 3T13A 2A6ED 3OMGA 3C2PA 3GTQB 1GUOA 4EQNA 4QUCA 4PV1C 3A8JE 1VDZA 2AUKA 1X3QA 3KBXA 4V0BA 3DUZA 4HN7A 3S1MB 2L11A 5G3LF 2O2LD 3OPOA 2K04A 2DN8A 4V190 5JVH3 1J8IA 1PTOF 5FOBB 1GOZA 4G57A 1O80A 4G7OC 2CHBD 3MEHA 2L9HA 4HMIA 3RZDB 1ILPA 4WJWA 2JSOA 1STBA 3L7ZC 5IT9L 4KJOA 3CRKC 1BXTA 1F2ZA 1S5ED 3I91A 5IGEA 2KUMA 3MZ5A 2G9DA 1D5MC 1ONLA 4A93B 5DEHA 2RSNA 3ND9A 4DU9A 3VYTA 1EYCA 4CKEA 4DNRB 4RHRA 1BOSA 1IKLA 5DM63 3K0YA 2N88A 5IT9E 1V1OA 3P20A 4XT1B 4IURA 3GO5A 4KV6A 3HOZB 4B08A 3D4DA 5CV7A 2L1BA 1M4VA 1WD0A 1PZID 1IL8A 3MXUA 5DNFA 2AQ3B 1Q1EA 3C46A 4JBWA 1EU4A 4J8QA 1EQTA 3J81L 5C5MA 1NUCA 3DHQA 2E2DC 3QB3A 3V96A 4OO1G 4CKCA 4HSPA 2NTSA 4R8IA 4Z9CB 3X3NA 1I6VC 3WOEA 2F0NA 4EQPA 3H09A 4TRDA 4KD3A 5EPKA 1B4OA 3FKIB 2F0OA 1B1ZA 2EDGA 2RDGA 1Q1BA 4KHZA 4PQXA 1F9SA 1SE2A 3M7GA 5C0XG 3RLFA 3NPPA 4OIKA 2JYOA 5EQ0A 1BCPB 1Y69U 1QNUA 4A3IB 3OWEB 2A5HA 1NSNS 2R7ZB 3H6MA 2IX1A 2AUJD 5IGDA 1IYVA 2WB1B 1SSOA 3FVQA 1Q90A 1L0YB 3SDZA 5C0XH 4RCOA 4KN7C 3OWFA 3K5OA 5EPJA 3RMHA 1ML0D 2EYJA 1GXDC 3H94A 4OO1I 2LKVA 3K58A 4S3SA 1V1PB 4OO1H 3DXJC 3I4NB 4BBSB 1BDOA 4QUFA 4F8MA 3TP6A 1YNJD 1FNUA 5KNDA 3PO3B 1SDFA 4OGQC 5CC4A 3IL8A 3NWSA 4HSVA 5DM73 1MBYA 4R9WA 2HDLA 3Q22A 2J0TD 3PMFA 1VF7A 4IFDG 2M2LA 4KY6A 3J7AV 1OXUA 3PUWA 2ZXPA 3BVMA 2EE1A 5JAVA 1OO9B 2FFKB 2SOBA 5A35A 1NCVA 1HQMC 1SNPA 1B9NA 2R6GA 3OHXC 1H9RA 4EGVA 2KCNA 1BO0A 2F0KA 1EZ6A 2A74C 2ID0A 2B8GA 3VYUA 5T1GA 1SBBB 4Y7NB 1KTKA 1O7LA 3L3OC 3NTHA 3RZOB 2Y0SB 2AWOA 1DYQA 3J80L 2B2WA 1T5EA 1ESRA 2LMCB 2BOSA 4RA8A 4XQJA 4IN3A 5J1ZA 1F2MA 2PZWA 2Q8TA 4BA1I 1DD2A 4KKTA 3NBIA 4L6TB 1WTVA 3DWPA 3QG1A 5A2QE 2G9HD 2F0SA 1DCZA 3NK9A 2KEDA 1RF2D 3R8BA 5CV6A 1PYWD 4K5XA 3SEBA 2YU9B 2J7ZA 1CA6A 1LTSD 3TN2A 2OT2A 4EQOA 2I46A 2Z1CA 3M4YA 3EVQA 3TDQA 2MJ8A 2DY8A 3HGBA 5JJZA 4CGYB 3JAME 1KDAA 1A3TA 4A3KB 3D31A 3DMUA 1S5DD 2R93B 3NHHA 2F0VA 3BDOA 2HCCA 3OOCA 5K5PA 1D1IA 1AW7A 2RQXA 4K6DA 3QOLA 2HQEA 1FNWA 2EYHA 2K03A 2L12A 4NKLA 1WTPA 2VNUD 2D2CC 5C4ZA 3HOWB 1PRTF 5E4WC 2XWJB 5KRUA 1K8MA 2NYZD 1G291 3HKZB 5EKIA 1Z7TA 3ERQA 1OXXK 3FMCA 2R61A 4FF3A 1RDPD 3VA5A 1H9SB 2EOTA 4OL7A 5JOBA 2KA7A 5EJWA 4DAPA 4KN4C 5FO7B 4XXEA 5HGTA 3I8ZA 1SE3A 1SFOB 1II3A 1GUSA 1TT2A 1SJHD 1MSHA 1HTLD 1S5CD 4ZKBB 3M4OB 4N9PA 4LK1C 3OIPA 3L9AX 2ZT9C 5KNCA 1S5FD 2B2TA 4HTHA 5CGKA 4RGTA 5LL6X 3M85A 2KHSA 4YIJA 2BE5D 4X3UA 3NQIA 1ZKOA 2WV6D 1UUPA 2HCIA 3URYA 1XXGA 3CKIB 1SNCA 1HUMA 2BA0A 1EIHA 1KAAA 3MC0B 1U4MA 3AU7A 3GTKB 3GV6A 1LO5D 5C4JB 1Y1WB 1WTQA 3PUZA 3TZUA 2YYZA 1OXTA 2OXPA 4RH6A 1ENCA 1ZYRC 4ULLA 3BDLA 3D4WA 3I4LA 5C5LA 1EZ8A 2EXZA 1I4PA 1S4ZA 3BDCA 3C1FA 2NVTB 2JA7B 1FGBD 4DAVA 1QILA 2SNSA 1JWUD 1CHQD 3HOVB 2MUYA 4RKBA 4BS9A 2AWNA 3X3MA 4K8JA 1Y1VB 1TR5A 2CW0C 3BYYB 2NVQB 1D1KA 2IL8A 5I6YA 1E0BA 3R2TA 5COYA 2B63B 4ZAIA 4IFDI 5C4XB 1U4PA 3I90A 4XDXA 5M5WB 3P75A 1QE6A 1KNEA 3GTLB 1M8AA 4LAAA 1Z47A 4F88A 5EPLA 2PW7A 1JQYD 3OSOA 1LT5D 4C3JB 4XTCS 4C3HG 5KIXA 3EA6A 2EJFC 1EQVA 5C0XI 1BNZA 4JK1C 1CA5A 1XTCD 3R2IA 3HOYB 3E0JA 4XQQA 5JEAG 3IFTA 3WOFA 2EZVA 4RGNA 3VR3A 1TY0A 1SYCA 1AP0A 2XRQD 2IJ0A 4K2KA 1BQQT 1UNSA 4XT3B 1A2TA 3J81E 4IUQA 5C44B 1RCVD 1VMCA 1E2ZA 1MI2A 2JA8B 4RFBA 3S2HB 2IX3A 1PDQA 1PFMA 3T51B 3J7YW 2XN9C 2NUCA 1FYCA 2N55A 2B2VC 1Q3LA 3GTGB 1XYIA 4XIGS 3ZYYX 2V4DA 2D62A 3D3RA 3I70A 4QF4A 2L55A 1GUGA 4N9TA 4QIWB 2B2WC 4CBVA 3HS0C 5D3IB 1HCZA 4UDUC 1SEBD 2NN6H 1PXUA 5M3MB 1B44D 3QWNA 1GHKA 3PUYA 4CHTB 5C3XA 4C3IB 5C0XJ 3E6ZX 1DXMA 5IOCA 3GTJB 4X3KA 5ELDA 1CK1A 1RJTA 5FLXE 4A3JB 3KBGA 2NN6G 3E5SA 4PNYA 1A3VA 3LWEA 5K36G 1K83B 1JOQA 4KD4A 3NTIA 3PUXA 2A69D 4IUPA 1DJRD 2I07B 1I4XA 2AQ1B 1AZPA 4H13C 4KY7A 1JWSD 1JC7A 2PW5A 1RHPA 1SYEA 3OMCA 5EGTA 4KJNA 3I73A 4KKSA 1LTTD 5A2QL 3Q24A 3T56B 1EIGA 2R92B 1YNND 1SE4A 3GTOB 3BS1A 5FKAC 1LACA 1PRTD 2Z4IA 3HG9A 2EVBA 4FXDA 1EY5A 5EBDA 5KYLA 1DONA 4PMWA 2DNCA 3MWYW 1UEAB 3S9WA 3FPPA 4BWGB 2XIWA 2F1MA 3NP8A 4OHJA 1C48A 2JXMB 1RTOA 2PZUA 3DWAA 4ZUIA 2CW0D 5TSSA 4ZYSA 4RAUC 5I6WA 1VMPA 3NE5B 4BBRB 3KLSA 4WORA 1HXYD 2F0WA 2NWGA 5CV5A 1E2WA 5C6AA 4R8NA 1WTXA 3RD4A 2R3ZA 2ENBA 2MGSA 2QILA 5I4DA 5AFWA 2BE5C 1TS3A 1TS2A 3HOUB 5IIFA 2X6LA 1RTNA 1NAPA 4IUVA 4OIJA 1TWFB 5E4XA 3CU7A 4ZKCB 3NBHA 4K5VA 4FYDA 4I65A 1EYAA 5BN4A 2KJXA 2F0JA 1R4QB 4DXFA 3VA7A 2D5DA 2A6HD 4RWSC 3V2TA 1TQOA 5JPNC 4U68A 5NUCA 1TIID 2TMPA 5I2YA 1BF4A 1H9SA 2VB3X 1F2YA 5ELFA 3V05A 2IT1A 3BG3A 2Q8RE 5J39A 4ILWA 3A8IE 3MHBA 1Q8IA 3TZDA 1ICWA 1ET9A 2VB2X 3NXWA 1LTAD 1MD2D 4PMCA 2WACA 2F0FA 1CZWA 2KEEA 2H4OA 2ZXRA 5I9PA 1WD1A 4NP5A 2SEBD 1QCBD 2XSCA 1TU2B 3NTKA 2MHVA 4P2CB 5ELCA 1TS4A 2SNMA 1STHA 1EY9A 1O7YA 2JEBI 3S1RB 5IGBA 2ICEC 4ZUJA 4H44C 1C8CA 1G8ZD 4A3BB 2E2HB 1PTOB 1PTOH 2QCPX 4HAEA 2E75C 4J1MA 2CVRA 4WRDA 2IW3A 1SNMA 3U9SA 1EU3A 1A3UA 4C1NI 1BR9A 3MAQA 1BCPD 3TSSA 1HHVA 3A55A 1F77A 1W6KA 1I4GA 3KLSX 4RGMA 5CR3A 1CI3M 2FJ2A 4X3TA 3HP3A 3SK4A 3GTPB 4FP5D 1JOOA 3TP7A 4ABNA 1HFNA 1F2LA 5EKKA 5EKLA 5LL6S 1PTOC 1PZKD 2JE6I 4FF2A 2TSSA 2EYFA 1B53A 3TP5A 1WTWA 4H7BA 4BA2I 3BZDB 4DN4M 1OXSC 2LY7A 3JAML 2B2TC 4FF4A 1AEXA 3IAYA 1SNDA 4TQUS 3QO2A 4A3MB 2MP1A 1B9MA 4WFN3 3D8GA 4LJZC 1EY4A 3QIAA 2EYPA 4C3JG 1G2TA 3DEOA 1TKWB 1I4HA 3QJYA 3GV3A 3R93A 4CKBA 4GZYC 3N6RA 1CZGA 3SK6A 3NQTA 1R9TB 1LT4D 1QJOA 3H0GB 1GUWA 2O5JC 1JICA 2F0LA 4E6IA 2QDBA 4C3IG 3NUCA 2A6EC 4DK1A 1ET6A 4K5WA 2B39A 4C1NK 4O42A 4ID6A 3MFYA 5C4HA 2F0IA 1RODA 1DOLA 2L5TA 1Y8NB 2JP1A 3QOJA 2DY7A 1STNA 1AFPA 5CV4A 4LMQD 4DGZA 1FD7D 2F0HA 3MXNA 1Y8OB 2F0UA 3Q6SA 1JCKB 2XWBB 4C2MB 3RUZA 2PYKA 3I4MB 1SYFA 2VXWA 4L63B 3K5NA 1KNAA 3CQZB 1ESFA 3SHLA 5JEAJ 2KVMA 2E76C 4ODGA 2K01A 4EVOA 5D65A 3EQLC 3C3LA 3ITPA 1WTOA 4KTAA 4A3DB 1PRTB 1CHPD 2O5IC 4CJ1B 3S16B 2WP8J 5G3LD 2X69A 1SMYD 3G6JB 4NMZA 3K7AB 1CQVA 3A7LA 3EJIA 3S14B 2B2UC 1F9PA 1U9RA 1RKNA 2B2YC 4ME5A 4Q5VA 1TWAB 2KECA 3MFGA 5ELBA 4FVMA 1B50A 5CBAE 3TMEA 5FO9B 2F0PA 3AB9A 2NTTA 1DOMA 2EJGC 2RA4A 3ONAB 1D2BA 3A7AB 4KY5A 3D6WA 2RKSA 2EYMA 3OW7A 3CHBD 5IODA 1LT3D 2FHTA 2B2UA 1CFMA 4FXKC 1A15A 2VUMB 4RHSA 1PLFA 2QEJC 1TVXA 3W3AA 1JR0D 4X3SA 4IFDJ 1EY8A 5I2XA 3GP7A 1S5BD 1PFBA 1EWCA 1JOKA 2EYOA 4G7HC 3SK5A 1HPCA 4IFDH 1H9KA 1STEA 3DWQA 3PIO3 1DZ1A 2KCCA 5CMDA 3FRPB 2F0MA 3T4AC 5KGUA 1B3AA 3S2DB 1TWHB 3Q23A 3F2UA 1KLUD 3W2DA 1AN8A 1O78A 4K2LA 1H9JA 1I6HB 1J9OA 1SYBA 1F9QA 4DAYA 2AQ2B 4XYOA 2Q8IB 1FR3A 1C4QA 1BUVT 2PZTA 5IGGA 4MN3A 1HTPA 1TWGB 1G6ZA 1Z6HA 5I9OA 1HQRD 4KI0A 3KF8A 1T5XD 1TWCB 1I50B 4K14A 2K5DA 2M9VA 3MXPA 4NDXA 2L0CA 1JE4A 2K5QA 3Q0AA 3P1HA 3WDNA 2A73B 2XRSD 4HCSA 1BCPF 1GHJA 4AYBB 5FK9C 1B2TA 4ZQ3A 2NBFA 3HEJA 3PUVA 1CTMA 1A2UA 4FO2A 2K33A 2WKCA 2NB0A 3SXHA 1ENAA 1GJXA 1I3QB 1IKMA 4UAIA 3K5LA 1IYUA 1VCIA 5T1IA 3P7JA 1I4QA 1PRTC 1V43A 3LNNA 1TS5A 4B9WA 3TBIB 1HA5A 3J7AF 3SE0A 4MHEA 4CJ0B 4G7ZC 2M00A 1UAPA 3KK7A 3SR1A 1ILQA 1WVLA 4C3HB 1XX8A 3S1NB 5CORA 4MIUA 2C9OA 1MGSA 3ND8A 1D5ZC 5E3FA 1V8QA 4RCNA 4BY1B 1IW7C 2EPBA 5M9OA 1YNNC 1IHZA 4FXGC 2EY5A 3NWTA 1EOTA 3K57A 1VF5C 2RBMA 1FNVA 1GUNA 1KABA 2LS01 5D14A 4I7ZC 1A6XA 2F4IA 1ZYRD 4J6HA 3MVVA 4DFAA 2FMMA 2K1BA 2Z8LA 2Z4HA 2E2IB 2BDNA 4CJ2C 3OIQA 1PTOD 5CV9A 1XWEA 1CQFA 3S17B 4QCLA 3A8KE 2PO4A 5DAUA 1LTRD 4TKOB 2EY2A 2E2JB 3BVZA 4XQNA 1Y8PB 1X3PA 5C3EB 3N52A 1G91A 1D6EC 1TY2A 2PMZB 2EY1A 1KLGD 4DF7A 2B2VA 5BN5A 3MTSA 1KDBA 2H1EA 2JEAI 1NR2A 4B9XA 1ENFA 2HDMA 4QMGA 5KNBA 1SMYC 4ZK9B 3D4RA 3M7NA 3GD7A 1BCPC 3D6CA 1STGA 1JWMD 5D3DA 1PFNA 1EEID 4IZ8A 2BA1A 5JEAH 4RGOS 2GA4B 1WTRA 2SDFA 1HUNA 1EFID 2IPKD 4DXGA 1SAPA 1EY7A 2F0GA 2IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZ8 A;  2EXZ A;  3BDC A;  1SYC A;  4QB4 A;  5C4Z A;  5IIF A;  3EJI A;  4K2L A;  3C1F A;  1F2Z A;  5E3F A;  4EQP A;  5M9O A;  3T16 A;  5IGE A;  1IHZ A;  1SYB A;  4KY7 A;  1EY6 A;  1NSN S;  2EY5 A;  3SK6 A;  3MZ5 A;  5KRU A;  2PW5 A;  1U9R A;  3NQT A;  3H6M A;  1SYE A;  2OEO A;  3OMC A;  4K2K A;  5EGT A;  1RKN A;  2PZT A;  5DEH A;  4DU9 A;  4KJN A;  5IGG A;  2RBM A;  1STA A;  1EYC A;  4ME5 A;  4F7X A;  1A2T A;  5IGC A;  1EYD A;  5IGD A;  1KAB A;  1EY0 A;  2F3W A;  3ERQ A;  4K5V A;  5KYI A;  2SNS A;  1F2M A;  2EYL A;  4I65 A;  2F0P A;  2PZW A;  1EYA A;  5CR3 A;  2F0L A;  5J1Z A;  2QDB A;  3VA5 A;  4E6I A;  5IOD A;  2F0J A;  3NUC A;  4J6H A;  5F2D A;  3MVV A;  3LX0 A;  2F0E A;  4OL7 A;  5E1F A;  5JOB A;  4DFA A;  4K5W A;  3V2T A;  4RKB A;  4IUN A;  1TQO A;  5HGT A;  3SK4 A;  4ID6 A;  4K14 A;  1II3 A;  3OWF A;  5C4H A;  2NUC A;  5NUC A;  1TT2 A;  3MXP A;  4KY5 A;  2F0I A;  4K8J A;  4NDX A;  1JOR A;  2KQ3 A;  2EYJ A;  1JOO A;  2RKS A;  4KV6 A;  3TP7 A;  2EYM A;  4IAL A;  2LKV A;  1TR5 A;  2EY6 A;  2F0T A;  5I9O A;  3QOJ A;  3D4D A;  4RKL A;  5CV7 A;  5CV9 A;  4S3S A;  2F0S A;  2RDF A;  5CV8 A;  3SK8 A;  4N9P A;  3C1E A;  1F2Y A;  3P1H A;  1STN A;  5EKK A;  1EY5 A;  5EKL A;  3NK9 A;  5CV4 A;  5I6Y A;  3HZX A;  3TP8 A;  5DAU A;  5KYL A;  4DGZ A;  4F8M A;  5KEE A;  1STY A;  2F0H A;  5J39 A;  5CC4 A;  4QF4 A;  3TP6 A;  5J22 A;  4PMB A;  3MHB A;  5CV6 A;  2EY2 A;  4ZQ3 A;  2F0U A;  2O4X A;  3S9W A;  2F3V A;  4K5X A;  4N9T A;  3HEJ A;  4HTH A;  5C3W A;  2F0D A;  3NXW A;  5CGK A;  3P75 A;  2WAC A;  2EYF A;  1A2U A;  4PMC A;  5C5M A;  3NP8 A;  2KHS A;  3RUZ A;  1NUC A;  2PYK A;  3TP5 A;  4YIJ A;  4LAA A;  4EQO A;  3DHQ A;  3SXH A;  3T13 A;  1ENA A;  4H7B A;  5ISR A;  2F0F A;  3OMG A;  1SYF A;  1EY8 A;  2PZU A;  4EQN A;  4ZUI A;  2PW7 A;  3QB3 A;  3ERO A;  3EVQ A;  2EY1 A;  3OSO A;  4DF7 A;  3SHL A;  5I6W A;  5I9P A;  4HMJ A;  1KDB A;  1JOK A;  4B9W A;  2EYO A;  4K8I A;  4NP5 A;  1KDA A;  1A3T A;  3PMF A;  1SNQ A;  4ODG A;  5C3X A;  1SNC A;  3SK5 A;  4B9X A;  4EVO A;  5KIX A;  4KY6 A;  4QMG A;  1SYG A;  4WOR A;  3DMU A;  2OF1 A;  1EQV A;  5IOC A;  2F0N A;  2F0W A;  2SNM A;  1KAA A;  1STH A;  2M00 A;  2PQE A;  1AEX A;  1EY9 A;  4KD3 A;  4TRD A;  3NHH A;  5CV5 A;  3SR1 A;  1SND A;  5JAV A;  2F0V A;  2F0Q A;  3ITP A;  4KTA A;  5IGB A;  3TME A;  4ZUJ A;  3D6C A;  1SYD A;  2F0M A;  1STG A;  2F0O A;  2SOB A;  4G57 A;  1SNP A;  4R8N A;  5C6A A;  1KDC A;  5K5P A;  5KGU A;  3R3O A;  3E5S A;  4PNY A;  3D8G A;  4K6D A;  4IZ8 A;  1EY4 A;  3QOL A;  3MEH A;  4HMI A;  2ENB A;  2OXP A;  1A3V A;  2HQE A;  1ENC A;  2EYP A;  5HUR A;  2EYH A;  4MIU A;  4J1M A;  4WRD A;  1STB A;  5IGF A;  2F0K A;  1EZ6 A;  1JOQ A;  1SNM A;  4KHV A;  4KD4 A;  4NMZ A;  3BDL A;  4KJO A;  1EY7 A;  1A3U A;  4NKL A;  2F0G A;  3D4W A;  1SNO A;  3U9O A;  5C5L A; 
#chains in the Genus database with same CATH topology
 3HKZ E;  5BN3 A;  1QWY A;  2LFN A;  1PMR A;  4H0L C;  1QB5 D;  1U4R A;  3T16 A;  3I4M G;  1EEF D;  2A6H C;  3A56 A;  4ZRZ A;  1EY6 A;  2FMC A;  5GAG C;  3PF5 A;  1S40 A;  4ZLT F;  5EBC A;  2BDO A;  3U4Z A;  2WKD A;  2QKI C;  2HUG A;  2IHE A;  4A3E B;  1LT6 D;  5JVG 3;  4F7X A;  1L0X B;  3I3C A;  5IGC A;  2PCF B;  1EYD A;  1PVO A;  2F3W A;  5KYI A;  4J15 A;  2YU9 H;  1WCM B;  1XPU A;  2UUC Q;  2RVL A;  3D0F A;  1F9R A;  5F2D A;  5E1F A;  1K73 C;  3SVM A;  5ELE A;  2JA5 B;  1SJE D;  1QG7 A;  1K8O A;  1LYL A;  3EN2 A;  4F87 A;  3FPU B;  2FIN B;  4DKA C;  2E74 C;  2K05 A;  4KKU A;  4Q0F A;  1SMX A;  3O13 A;  1Q12 A;  1X54 A;  1LAB A;  1VQI A;  1JJC B;  4IAL A;  1N36 L;  3OW2 A;  2JA6 B;  2EY6 A;  2K14 A;  5M5Y B;  3VR2 A;  2RDF A;  4JI7 L;  1MSG A;  3S1Q B;  1E7Z A;  2CKZ B;  5M3F H;  3AMU A;  1D5X C;  1NE3 A;  3HZX A;  1DOK A;  2J4X A;  4PZ8 A;  2DNE A;  1E2V A;  2R7F A;  3VYS A;  2A8V A;  1JJG A;  3SGI A;  3VR4 A;  3LWU A;  2F0D A;  4JI4 Q;  3S1M H;  2EJM A;  3PO2 B;  1YIT A;  1LTG D;  1LV9 A;  2C5C A;  4CDF C;  2MPM A;  2DJG C;  5FLM G;  1SLJ A;  2K7V A;  1MJE A;  4C56 C;  1G2S A;  4B3T Q;  3ERO A;  2ICI A;  1SE8 A;  1XNQ Q;  4BBS G;  3VR6 A;  4IQZ A;  4HMJ A;  3CW2 C;  4Y7N H;  2A69 C;  4K8I A;  3VR5 A;  1SNQ A;  1NMG A;  3GQB A;  2JQO A;  3G7L A;  3HOX B;  5M5X B;  3S1N H;  2NZ1 D;  3PV0 A;  4FNF A;  3K5M A;  1ZXT A;  3K6O A;  5HUR A;  2F4V Q;  1PYB A;  3S15 B;  1I4R A;  4L8J A;  2KOL A;  2F0Q A;  1V1P A;  3VYR A;  4K6L A;  1BBX C;  4A3G B;  2WIN B;  3HOU G;  2K5V A;  2QDL A;  3I56 A;  1EUJ A;  4LUV A;  5FLX c;  3R3O A;  4PZ6 A;  3CRL C;  5IT9 c;  4X6A H;  1R4P B;  1LTI D;  5JJI A;  1PH7 A;  4UP9 A;  3KLR A;  5IGF A;  5JPM C;  4KHV A;  4FF1 A;  4LF6 Q;  1FJG L;  2CQA A;  3U9O A;  4M8A A;  4QB4 A;  4G4K A;  3TQY A;  2UUA L;  1RD9 D;  2PNR C;  2WAQ B;  5CBE E;  2ZJQ A;  1I3Q H;  1QOH A;  4JI7 Q;  2WII B;  4EQ5 A;  2B8F A;  2XNA C;  1X56 A;  2OEO A;  1HFG A;  2HIV A;  1KAW A;  4GS3 A;  1W6J A;  3IFD A;  4GN3 B;  4TSS A;  2QF7 A;  1AZQ A;  1VQE A;  2D9U A;  4DNT B;  1EY0 A;  2NN6 I;  3QR8 A;  2EYL A;  3PO3 H;  3BYT B;  4HJA A;  1IBM L;  1HA6 A;  1HRJ A;  3KYH C;  4DK0 A;  2L4N A;  3M9B A;  2RSO A;  1OXV A;  3HRZ C;  2N78 A;  1N33 L;  2RCN A;  3DM1 A;  4KMU C;  4CDE C;  3HOX H;  2WAQ E;  3ER0 A;  3KUP A;  4RKL A;  3FDT A;  3SK8 A;  5CV8 A;  5FLM H;  2WAQ G;  4JW0 A;  4A76 A;  4QIW E;  5LHY 1;  5LMU Q;  3TP8 A;  4DV1 Q;  4QL5 A;  2HT1 A;  4DV1 L;  2NVY B;  2B2Y A;  3HOW G;  2PMZ E;  2F3V A;  5IYD G;  2HHH Q;  3A54 A;  5IP7 H;  3OTO L;  4DAY B;  2CWP A;  2UXB L;  1JB3 A;  4IUT A;  1H9M A;  4A3L G;  2F03 A;  1WFQ A;  5FO8 B;  1CM9 A;  4XYQ A;  4A3I H;  5M3F B;  4DR3 Q;  1IW7 D;  1O7Z A;  1YNJ C;  4GNX A;  2K6A A;  4K0K Q;  4HED A;  1VQA A;  4DA2 A;  2XVS A;  2R7Z G;  1LTB D;  3Q8D A;  3J80 E;  3GTM B;  3M4P A;  2VUM G;  2A68 C;  1SYG A;  4YCW A;  2OF1 A;  2NVX B;  1KRS A;  1QNK A;  5KEE A;  2PQE A;  4ME3 A;  3DEP A;  4O0A A;  1LLR D;  3K81 C;  4U67 3;  1SYD A;  4A3F B;  2JA5 H;  1GUT A;  1Q46 A;  5GAD C;  1KDC A;  4NW2 A;  2K28 A;  3EFX D;  2K5W A;  3H91 A;  4OWX B;  1EL0 A;  2A68 D;  4KK7 A;  2DJF C;  1CT1 D;  2RDH A;  4A3K G;  5K36 H;  4UP7 A;  3M3Y B;  3RN2 A;  4DV2 L;  1NR4 A;  1SNO A;  1SXT A;  3PIP 3;  2PI2 E;  3NSW A;  5FLX L;  1DM0 B;  3H15 A;  1ZEQ X;  4ZCK A;  3FEW X;  2VQE Q;  3PQI A;  2XGT A;  4O1N A;  1EWH A;  2X6G A;  1YZ6 A;  4HR7 B;  1PHJ A;  1PZJ D;  1STA A;  3BVG A;  4HCE A;  1PH9 A;  4X62 L;  3S24 A;  4DV3 L;  4OWW B;  4M1U B;  2N8N A;  3IKJ A;  3J7Z C;  4YY3 Q;  1PYS B;  1AH9 A;  4JI6 L;  3LX0 A;  2F0E A;  2V1C C;  2UUC L;  3MXG A;  4IUN A;  2K32 A;  3I72 A;  3H3V C;  4IUU A;  2PPB C;  4BY7 B;  2ZXO A;  1JOR A;  1QZH A;  2KQ3 A;  2VQF Q;  3UI2 A;  4JI4 L;  5IYB H;  2F0T A;  4YWK A;  1U4L A;  2BCO A;  3C1E A;  3MA2 B;  3KFU A;  4A3D G;  1STY A;  3K59 A;  5J22 A;  4PMB A;  3T53 B;  2O4X A;  3CCE A;  4TVA B;  5C3W A;  5CYU A;  2IWH A;  1KRT A;  2F52 A;  1X32 A;  5ISR A;  1HH2 P;  3T13 A;  2A6E D;  4AH6 A;  1Y1W G;  3OMG A;  3C2P A;  2JA6 G;  3GTQ B;  2JA5 G;  1GUO A;  4EQN A;  2MFI A;  4QUC A;  4PV1 C;  3A8J E;  1VDZ A;  2AUK A;  1X3Q A;  3KBX A;  4V0B A;  3DUZ A;  4HN7 A;  5C44 G;  3PO2 H;  3S1M B;  2L11 A;  4JYA Q;  5G3L F;  2O2L D;  3OPO A;  2K04 A;  2DN8 A;  2N49 A;  4V19 0;  5JVH 3;  4BY1 G;  1J8I A;  1PTO F;  4PZ7 A;  5FOB B;  1PH4 A;  1GOZ A;  1N32 L;  4G57 A;  3S1Q H;  1O80 A;  2RHQ B;  4G7O C;  2CHB D;  5M5Y H;  3H3V H;  2JA6 H;  3MEH A;  2L9H A;  4HMI A;  3RZD B;  4X62 Q;  1ILP A;  4WJW A;  2JSO A;  1STB A;  3NEL A;  4GLA C;  3L7Z C;  5IT9 L;  4KJO A;  4P74 A;  2C35 B;  4A3M G;  3CRK C;  2ZJR A;  1BXT A;  2PQA A;  1F2Z A;  3TS0 A;  1S5E D;  1VQF A;  3I91 A;  5IGE A;  2KUM A;  4BY1 H;  1WCM H;  2QGQ A;  3MZ5 A;  4A3J G;  2G9D A;  1D5M C;  4JOI A;  1ONL A;  4A93 B;  1E1O A;  2RSN A;  3ND9 A;  5DEH A;  4DU9 A;  3VYT A;  1EYC A;  4A3E H;  1WJJ A;  4CKE A;  4DNR B;  4RHR A;  1BOS A;  3LGJ A;  3PGZ A;  3F2D A;  1Z9F A;  1IKL A;  1T9H A;  5DM6 3;  4OEM B;  4DV4 L;  3K0Y A;  2B63 G;  2UUB Q;  3CAM A;  4DK3 C;  2N88 A;  1VQM A;  4L5R C;  5IT9 E;  1V1O A;  4DR2 L;  1XMQ Q;  3P20 A;  4XT1 B;  4IUR A;  3GO5 A;  4KV6 A;  3HOZ B;  3EBE A;  4B08 A;  2CH4 W;  1G51 A;  3D4D A;  5CV7 A;  2L1B A;  1M4V A;  4A3C H;  1WD0 A;  1PZI D;  1IL8 A;  3MXU A;  5DNF A;  3FHW A;  2AQ3 B;  1Q1E A;  2NZH A;  2R92 G;  3C46 A;  4JBW A;  1EU4 A;  4KLK A;  4X66 L;  4J8Q A;  3J81 c;  1VQ6 A;  3H0G H;  1EQT A;  3J81 L;  1E3P A;  1HR0 Q;  5C5M A;  1NUC A;  3DHQ A;  2UU9 L;  3UE1 A;  3HKZ G;  3U58 A;  2E2D C;  3QB3 A;  2OQ0 A;  3V96 A;  4JI0 L;  4OO1 G;  2GVB A;  2JN4 A;  4HSP A;  4CKC A;  3CCS A;  2NTS A;  4LF7 L;  4JI8 Q;  4R8I A;  4Z9C B;  1CUK A;  3X3N A;  3M3Y H;  2E2J H;  1I6V C;  3WOE A;  1IBL L;  3JC6 6;  2F0N A;  1AE3 A;  4EX5 A;  4EQP A;  3H09 A;  4TRD A;  4KD3 A;  1TWC H;  5EPK A;  1B4O A;  3FKI B;  2F0O A;  2LSS A;  2OTL A;  1HR0 W;  1B1Z A;  2EDG A;  2RDG A;  2E8G A;  4A3F H;  1Q1B A;  3CC4 A;  1IBK L;  4KHZ A;  4PQX A;  1F9S A;  1SE2 A;  2NVX H;  4OEL B;  2E2I H;  3M7G A;  3A0J A;  5C0X G;  3GTM H;  3RLF A;  3NPP A;  4OIK A;  2JYO A;  5EQ0 A;  1BCP B;  1Y69 U;  1QNU A;  4A3I B;  3OWE B;  2A5H A;  1NSN S;  3TRZ A;  2R7Z B;  3H6M A;  2IX1 A;  2AUJ D;  5IGD A;  1IYV A;  4X64 Q;  2WB1 B;  3S2D H;  1VQJ A;  1LUZ A;  1SSO A;  3AFP A;  1YVC A;  3FVQ A;  1Q90 A;  3T1Y Q;  1L0Y B;  4GKJ Q;  3SDZ A;  1E24 A;  1CKN A;  3T1H Q;  1GM5 A;  3A74 A;  5C0X H;  4RCO A;  4KN7 C;  3OWF A;  2K50 A;  3K5O A;  5EPJ A;  3RMH A;  1PH2 A;  1KXL A;  1ML0 D;  4DR7 Q;  2EYJ A;  1GXD C;  3H94 A;  5JJL A;  1XPO A;  2A19 A;  4OO1 I;  2LKV A;  3K58 A;  1I5F A;  5FJ8 G;  4S3S A;  1DGS A;  1V1P B;  4OO1 H;  4C3H H;  3DXJ C;  2F3I A;  3I4N B;  4BBS B;  3J81 i;  4B3S L;  1BDO A;  4JBK A;  5BR8 L;  4QUF A;  4F8M A;  2JA8 G;  1QZG A;  3TP6 A;  1YNJ D;  1FNU A;  1HNW Q;  2VZA A;  1JT8 A;  5KND A;  1GKH A;  3PO3 B;  2E5L L;  1SDF A;  4OGQ C;  2IY5 B;  5CC4 A;  3IL8 A;  4JC0 A;  4APV A;  3NWS A;  1P8L A;  4HSV A;  2DUD A;  2KCM A;  5DM7 3;  1MBY A;  4R9W A;  1IL2 A;  2FXQ A;  1CKO A;  2A1A A;  4JI6 Q;  4HIK A;  1VQ7 A;  2HDL A;  3Q22 A;  2J0T D;  3PMF A;  1VF7 A;  4IFD G;  2M2L A;  3CCQ A;  1N33 Q;  4KY6 A;  2ATW A;  1OXU A;  3J7A V;  4DV0 L;  3PUW A;  2ZXP A;  3BVM A;  1PH8 A;  1NY4 A;  4JI2 L;  2EE1 A;  5JAV A;  3A5Z B;  4DV7 Q;  1OO9 B;  3RLN A;  2FFK B;  2SOB A;  5A35 A;  1NCV A;  1HQM C;  1SNP A;  4IOC A;  1B9N A;  2R6G A;  4QY7 A;  3T1Y L;  4OX9 L;  3OHX C;  3W1G A;  1H9R A;  2MQH A;  4IPG A;  4EGV A;  3PO3 G;  4GLV B;  2KCN A;  3S15 H;  1V1Q A;  1BO0 A;  2F0K A;  3NEM A;  1EZ6 A;  2A74 C;  1TWA H;  5M5X H;  2ID0 A;  2B8G A;  3VYU A;  3HOV G;  5T1G A;  1I50 H;  1SBB B;  1YJW A;  4Y7N B;  2BH2 A;  1KTK A;  1O7L A;  3L3O C;  3KF6 B;  3G71 A;  3NTH A;  2UUA Q;  3RZO B;  2Y0S B;  2AWO A;  4LF9 Q;  1DYQ A;  3J80 L;  4OXP A;  4WJ3 M;  2B2W A;  1FL0 A;  1T5E A;  2YTV A;  5IYC H;  1ESR A;  2LMC B;  1TWG H;  1YHA A;  2BOS A;  1UEB A;  4RA8 A;  1I94 L;  4XQJ A;  4IN3 A;  3A5U A;  1WTH A;  2QA4 A;  5J1Z A;  1F2M A;  1L0W A;  2PZW A;  3S16 H;  4K0K L;  1I6H H;  3ERS X;  1D7Q A;  2Q8T A;  3B6Y A;  4BA1 I;  1VQG A;  5IP7 G;  1DD2 A;  4KKT A;  3NBI A;  1EQR A;  4GKK Q;  4L6T B;  1YIJ A;  4GKK L;  1WTV A;  3DWP A;  3QG1 A;  5A2Q E;  5AJ3 L;  2G9H D;  2F0S A;  1DCZ A;  2B3G A;  3NK9 A;  3IRB A;  2KED A;  1RF2 D;  1UE6 A;  4AQY L;  2D0O A;  3R8B A;  5CV6 A;  2HHH L;  1PYW D;  3I4M H;  3HOY G;  4K5X A;  3SEB A;  2YU9 B;  1Q82 C;  2J7Z A;  1U0L A;  1CA6 A;  1EIY B;  1LTS D;  3TN2 A;  1HNW L;  1A63 A;  1X3F A;  2OT2 A;  1J5E L;  4EQO A;  2I46 A;  2Z1C A;  1VQ9 A;  1D8L A;  4DR6 Q;  4IPC A;  3BJU A;  3HOU H;  5IYB G;  3M4Y A;  3GDE A;  3EVQ A;  3TDQ A;  2MJ8 A;  2DY8 A;  3HGB A;  5JJZ A;  4CGY B;  4IPD A;  3JAM E;  1KDA A;  1A3T A;  4GOP B;  1IYJ B;  4A3K B;  4NXM L;  3D31 A;  4L5T A;  4KHP Q;  3DMU A;  1S5D D;  2ZTC A;  2R93 B;  4UY8 C;  3NHH A;  1X55 A;  2F0V A;  3BDO A;  4YWL A;  1HZ9 A;  1HNZ Q;  1IBM Q;  4UHV A;  2HCC A;  2LXJ A;  4DV7 L;  3OOC A;  5K5P A;  1D1I A;  1AW7 A;  2RQX A;  1L1O C;  4K6D A;  3QOL A;  5M3F G;  2HQE A;  1FNW A;  3CPF A;  2EYH A;  2K03 A;  1VS0 A;  3J81 j;  2L12 A;  4NKL A;  1R9T H;  2KHJ A;  1WTP A;  2VNU D;  2D2C C;  5C4Z A;  3HOW B;  4X65 L;  1PRT F;  5E4W C;  2XWJ B;  1YHB A;  4IOA A;  5KRU A;  2UXC L;  1K8M A;  2YTY A;  4NXN L;  2NYZ D;  1VQ4 A;  5M3M G;  3BZK A;  5C3E H;  1G29 1;  3HKZ B;  5EKI A;  1Z7T A;  3ERQ A;  1OXX K;  3FMC A;  4LF4 Q;  4LWC A;  2R61 A;  4FF3 A;  1RDP D;  3VA5 A;  1H9S B;  2EOT A;  2G5D A;  1N32 Q;  4OL7 A;  5JOB A;  2KA7 A;  5EJW A;  4B3S Q;  4DAP A;  4KN4 C;  5FO7 B;  4XXE A;  4A3M H;  5HGT A;  3I8Z A;  1SE3 A;  1II3 A;  1SFO B;  1GUS A;  1MKH A;  1TT2 A;  1HJP A;  3K0X A;  4DV5 L;  3S17 H;  1SJH D;  3KOJ A;  5IYD H;  1CKN B;  1MSH A;  1HTL D;  1S5C D;  4ZKB B;  3HOX G;  3M4O B;  1QUQ B;  3GTO H;  4N9P A;  4LK1 C;  3T1H L;  4DR4 L;  4IO9 A;  1L1O B;  4A3D H;  2YV5 A;  3NBH B;  3OIP A;  4A3I G;  3L9A X;  2ZT9 C;  5KNC A;  1S5F D;  1KD1 C;  1Y1V G;  1K3R A;  2HQL A;  2B2T A;  1VQ5 A;  4HTH A;  5CGK A;  4RGT A;  5LL6 X;  3M85 A;  2KHS A;  4YIJ A;  2BE5 D;  2P5Z X;  3CQZ H;  3STB D;  4X3U A;  3NQI A;  4L5Q A;  3ICE A;  4DR6 L;  3CCJ A;  1ZKO A;  2WV6 D;  1UUP A;  2HCI A;  3URY A;  4C2M H;  1XXG A;  3CKI B;  1SNC A;  1HUM A;  2BA0 A;  1EIH A;  3PF4 A;  4A4I A;  1KAA A;  3MC0 B;  4JVZ A;  1U4M A;  3AU7 A;  4H02 A;  4A3J H;  2UUB L;  3GTK B;  3GV6 A;  1LO5 D;  5C4J B;  1Y1W B;  5FJ8 H;  1WTQ A;  3PUZ A;  3TZU A;  4LFC L;  2YYZ A;  1OXT A;  1JMC A;  2OXP A;  4RH6 A;  1ENC A;  2HD3 A;  3I7F A;  4LUO A;  2I5M X;  4POG A;  1ZYR C;  3KJP A;  4ULL A;  3BDL A;  4BXX G;  3D4W A;  3I4L A;  5C5L A;  1EZ8 A;  2EXZ A;  1I4P A;  1S4Z A;  3BDC A;  4NPS A;  4B3R L;  3C1F A;  2NVT B;  3TRE A;  1WCM G;  2I5L X;  3W5O A;  2JA7 B;  1M90 C;  1EFW A;  1C7Y A;  1EIF A;  2UU9 Q;  1FGB D;  4DAV A;  1HR0 L;  1RL2 A;  1QIL A;  1K9M C;  3HKS A;  2SNS A;  1JWU D;  1CHQ D;  3HOV B;  2MUY A;  4DR5 L;  4RKB A;  1IXR A;  3GTG H;  1VQ8 A;  4BS9 A;  1W2B A;  2AWN A;  3X3M A;  4K8J A;  1EQQ A;  1Y1V B;  4R4O A;  1TR5 A;  1S3O A;  2CW0 C;  3BYY B;  2NVQ B;  1IBK Q;  3TEH B;  1D1K A;  1VQN A;  1X3G A;  2IL8 A;  5I6Y A;  4GKJ L;  1ASZ A;  4B3R Q;  3AQQ A;  1E0B A;  3R2T A;  5COY A;  5C44 H;  1UE1 A;  2B63 B;  4B3M L;  1GVP A;  4ZAI A;  4IFD I;  3F8T A;  5C4X B;  1U4P A;  3I90 A;  4XDX A;  5M5W B;  3P75 A;  1QE6 A;  3AFQ A;  1KNE A;  3CXC A;  1G6P A;  3GTL B;  1M8A A;  4LAA A;  4A3F G;  1Z47 A;  4F88 A;  4LF5 L;  2Q2H A;  4NB3 A;  5EPL A;  2PW7 A;  1NJI C;  1RIP A;  1JQY D;  3OSO A;  1LT5 D;  4JV5 Q;  3U50 C;  4C3J B;  4XTC S;  4C3H G;  5KIX A;  3EA6 A;  3HOY H;  2EJF C;  1EQV A;  5C0X I;  1TWH H;  1BNZ A;  4YCV A;  1HNX Q;  4JK1 C;  4DR1 Q;  1CA5 A;  1XTC D;  2GVA A;  2KEN A;  1GO3 E;  3R2I A;  3HOY B;  3E0J A;  2AHO B;  4XQQ A;  4JI3 Q;  5JEA G;  1N34 Q;  4C3J H;  2Z6K C;  3IFT A;  3WOF A;  3RNU A;  2EZV A;  4RGN A;  3VR3 A;  5J3B A;  1YEZ A;  1TY0 A;  1SYC A;  4DUZ L;  1AP0 A;  2PQA B;  1K8G A;  2RCF A;  2XRQ D;  3E9H A;  2BH8 A;  2OTJ A;  3FP9 A;  2IJ0 A;  2EQS A;  5M5W H;  4K2K A;  1HZA A;  1BQQ T;  1XNR Q;  1UNS A;  4IJL A;  4DV5 Q;  4XT3 B;  1A2T A;  1BVS A;  3J81 E;  4IUQ A;  5C44 B;  4CDC C;  1RCV D;  3KF6 A;  3PO2 G;  1VMC A;  3I4N G;  1E2Z A;  1MI2 A;  2VUM H;  3G4S A;  1XJV A;  2JA8 B;  4RFB A;  3S2H B;  2IX3 A;  1PDQ A;  3RLO A;  2NVQ H;  1PFM A;  3T51 B;  4JOI C;  3RR5 A;  3J7Y W;  4X65 Q;  1Y1V H;  2XN9 C;  2NUC A;  1X3E A;  1FYC A;  2N55 A;  3PIP A;  2B2V C;  1Q3L A;  4NXN Q;  1TXY A;  1Y14 B;  3GTG B;  3CCV A;  4BBR H;  1XYI A;  4LFC Q;  1KHI A;  1Q81 C;  4XIG S;  2VL6 A;  2OWO A;  3ZYY X;  2E2H H;  2V4D A;  4A3B H;  2D62 A;  3D3R A;  3I70 A;  4DV6 Q;  2AKW B;  1HNX L;  4QF4 A;  1BBU A;  2L55 A;  1GUG A;  4N9T A;  4QIW B;  2B2W C;  4KHP L;  2OCE A;  4CBV A;  3HS0 C;  5D3I B;  4JYA L;  1HCZ A;  3ULJ A;  4UDU C;  1SEB D;  2NN6 H;  1YNX A;  2UXD L;  1IZ6 A;  1PXU A;  5M3M B;  4R4T A;  2NZO A;  1B44 D;  3QWN A;  5ELN A;  3S14 H;  1GHK A;  3I55 A;  4DV2 Q;  3PUY A;  4CHT B;  5C3X A;  4C3I B;  5C0X J;  2QW7 A;  3E6Z X;  3K7A H;  4BXX H;  1KC8 C;  1DXM A;  5IOC A;  3HFZ B;  4JI1 Q;  3GTJ B;  3DLL A;  4X3K A;  4IPH A;  5ELD A;  1CK1 A;  1RJT A;  5FLX E;  4A3J B;  3KBG A;  2PI2 A;  2R7D A;  1N8R C;  2NN6 G;  3E5S A;  4PNY A;  1A3V A;  5AJ3 Q;  1N9W A;  3LWE A;  5K36 G;  4NXM Q;  2VQF L;  1K83 B;  1JOQ A;  1Q86 C;  4KD4 A;  3NTI A;  3PUX A;  2A69 D;  4IUP A;  1DJR D;  2I07 B;  1I4X A;  3L2P A;  4AYB G;  2AQ1 B;  1AZP A;  4H13 C;  2K5N A;  4KY7 A;  1CSP A;  1JWS D;  1JC7 A;  2PW5 A;  1RHP A;  1SYE A;  3OMC A;  5EGT A;  5GQO A;  4A75 A;  4JG2 A;  4KJN A;  3I73 A;  1K83 H;  5LMN Q;  3CCR A;  3E9I A;  4KKS A;  1LTT D;  4RG1 A;  5A2Q L;  3Q24 A;  1X65 A;  3T56 B;  1UWV A;  1EIG A;  3CP0 A;  2R92 B;  1U5K A;  1YNN D;  1SE4 A;  3GTO B;  3CCM A;  4QJF A;  3BS1 A;  3KLW A;  2ZM6 L;  5FKA C;  1LAC A;  2CCZ A;  1PRT D;  4P73 A;  2Z4I A;  3F2C A;  3HG9 A;  4OON A;  2EVB A;  4DUZ Q;  4FXD A;  1EY5 A;  3KF8 B;  1VQP A;  5EBD A;  5KYL A;  1DON A;  4PMW A;  2DNC A;  4LFA Q;  2ZTE A;  3KJO A;  2I5H A;  3MWY W;  1VQB A;  1UEA B;  3S9W A;  4DV3 Q;  4X64 L;  1KIX A;  3FPP A;  4BWG B;  1M1K C;  2XIW A;  2F1M A;  3NP8 A;  1K28 A;  4OHJ A;  1C48 A;  4JBM A;  2JXM B;  1RTO A;  5H1S E;  2PZU A;  3DWA A;  4ZUI A;  2CW0 D;  5TSS A;  4ZYS A;  4DV0 Q;  4RAU C;  5I6W A;  1VMP A;  3NE5 B;  4BBR B;  4IJH A;  1J5E Q;  4Y52 H;  4P75 A;  3KLS A;  4WOR A;  1HXY D;  3WWV A;  2F0W A;  1PH5 A;  4GOP C;  2NWG A;  5CV5 A;  1E2W A;  4MTK A;  1FVI A;  5C3E G;  3KDF A;  4R8N A;  5C6A A;  1WTX A;  2RHS B;  3RD4 A;  4DK6 C;  1X6O A;  2E5L Q;  2R3Z A;  2ENB A;  3J7A 5;  2LXK A;  4A3K H;  2MGS A;  2QIL A;  1C0A A;  5I4D A;  5AFW A;  2BE5 C;  4LUZ A;  1TS3 A;  1O7I A;  1TS2 A;  1VQK A;  3HOU B;  4YHH Q;  5IIF A;  1ASY A;  2X6L A;  1RTN A;  3TS2 A;  4B3T L;  1NAP A;  1OTC A;  4JBJ A;  1HNZ L;  4IUV A;  4OIJ A;  1A62 A;  2AMC B;  1TWF B;  1S72 A;  5E4X A;  1SN8 A;  3CU7 A;  5GAH C;  4ZKC B;  3NBH A;  4K5V A;  4FYD A;  4I65 A;  4DNI A;  1EYA A;  2YTX A;  1B8A A;  1SR3 A;  2KJX A;  5ELO A;  5BN4 A;  2F0J A;  1R4Q B;  4DXF A;  3VA7 A;  2D5D A;  2A6H D;  2DGY A;  4RWS C;  3V2T A;  1LTL A;  1TQO A;  4R4Q A;  5JPN C;  2WB1 E;  4U68 A;  5NUC A;  2KHI A;  1TII D;  2Z9H A;  2TMP A;  5IE8 A;  4HJ8 A;  4PG3 A;  5I2Y A;  4A3C G;  1BF4 A;  1H9S A;  2VB3 X;  1F2Y A;  4OX9 Q;  3I4O A;  5ELF A;  3V05 A;  2H5X A;  2IT1 A;  2UXD Q;  3GTP H;  3BG3 A;  2Q8R E;  3CMA A;  5J39 A;  3GTJ H;  4ILW A;  3A8I E;  3MHB A;  1HZC A;  1Q8I A;  3TZD A;  3HOZ G;  1ICW A;  4LW1 A;  1ET9 A;  2VB2 X;  1A8V A;  3NXW A;  1LTA D;  1MD2 D;  3PIO A;  4PMC A;  2WAC A;  3CD6 A;  4OWT B;  5C4X H;  1ICF B;  2VW9 A;  4HID A;  3RZO H;  2F0F A;  1VQD A;  1CZW A;  4JI0 Q;  2CH4 A;  2KEE A;  2H4O A;  2ZXR A;  5I9P A;  1WD1 A;  4DUY Q;  4NP5 A;  2SEB D;  1QCB D;  1K8A C;  2XSC A;  1TU2 B;  3NTK A;  2MHV A;  4P2C B;  2B29 A;  5ELC A;  1TS4 A;  3UE0 A;  2SNM A;  1STH A;  1EY9 A;  1O7Y A;  2JEB I;  3S1R B;  5IGB A;  2ICE C;  4ZUJ A;  4H44 C;  1C8C A;  5LMU L;  1G8Z D;  4A3B B;  2E2H B;  2VY3 A;  4BBR G;  1PTO B;  1PTO H;  2QCP X;  2WFW A;  3CF5 A;  4HAE A;  3S1R H;  2E75 C;  4J1M A;  2CVR A;  4WRD A;  2CQO A;  4N8X 1;  2IW3 A;  4JI8 L;  1SNM A;  3U9S A;  1EU3 A;  1A3U A;  1NTG A;  3OYY A;  5HY6 A;  4C1N I;  1BR9 A;  3MAQ A;  4DR4 Q;  4DV4 Q;  1NBW A;  1BCP D;  3TSS A;  4QGU A;  1HHV A;  3A55 A;  1F77 A;  1W6K A;  4LF8 L;  1NMF A;  1I4G A;  3CCL A;  3G48 A;  3KLS X;  1WOC A;  4RGM A;  5CR3 A;  1CI3 M;  4BBS H;  2FJ2 A;  4X3T A;  3HP3 A;  1UE7 A;  4POF A;  3SK4 A;  3GTP B;  5C4X G;  4AIM A;  3VDY A;  4FP5 D;  1JOO A;  5DLQ E;  3TP7 A;  1HZB A;  4ABN A;  2JK8 A;  1HFN A;  1F2L A;  5EKK A;  5EKL A;  5LL6 S;  1PTO C;  3FKI G;  1PZK D;  4WJ4 A;  2JE6 I;  4JI2 Q;  4FF2 A;  4LFB Q;  4GNX B;  2TSS A;  3I2Z A;  3K7U C;  4B3M Q;  1PH3 A;  2EYF A;  4ALP A;  1B53 A;  1VQL A;  4DR7 L;  3TP5 A;  1WTW A;  5GAE C;  4H7B A;  1TWF H;  4BA2 I;  1P16 A;  3BZD B;  4DN4 M;  2MO0 A;  1OXS C;  2LY7 A;  1B7Y B;  3ULL A;  3JAM L;  2B2T C;  3STB C;  4A3B G;  4FF4 A;  3M4O H;  1EWI A;  1AEX A;  3IAY A;  1SND A;  2ES2 A;  4TQU S;  2KBN A;  3QO2 A;  4A3M B;  2MP1 A;  1B9M A;  4WFN 3;  3L0O A;  5IP9 H;  3D8G A;  4LJZ C;  1EY4 A;  3QIA A;  3PCO B;  2EYP A;  4C3J G;  5LMN L;  3UDF A;  1G2T A;  4DR2 Q;  2VS1 A;  3AEV A;  3DEO A;  1TKW B;  1I4H A;  3QJY A;  3GV3 A;  5EAY A;  1YJN A;  3NEN A;  3R93 A;  4CKB A;  4GZY C;  3N6R A;  1CZG A;  3SK6 A;  2Q2I A;  3NQT A;  1R9T B;  1LT4 D;  1QJO A;  3H0G B;  1GUW A;  2O5J C;  5IP9 G;  4GN5 A;  3DM3 A;  4LFB L;  4A3L H;  1JIC A;  2F0L A;  4E6I A;  2QDB A;  4C3I G;  2JA7 H;  4DUY L;  1XTD A;  3UDX A;  3NUC A;  2A6E C;  4DK1 A;  1ET6 A;  4YY3 L;  4A93 G;  4K5W A;  2B39 A;  4C1N K;  4O42 A;  4ID6 A;  3MFY A;  1XMO Q;  4JI5 Q;  3HOZ H;  5C4H A;  4DPG A;  2F0I A;  4A3G G;  1ROD A;  3MEF A;  1DOL A;  2L5T A;  1Y8N B;  2JP1 A;  3QOJ A;  2DY7 A;  4GLX A;  1STN A;  1KL9 A;  1AFP A;  5CV4 A;  1B3Q A;  3GTK H;  4LMQ D;  4DGZ A;  1FD7 D;  3J80 i;  2F0H A;  2Q2T A;  3MXN A;  1MJC A;  1Y8O B;  2R92 H;  1QVC A;  2F0U A;  3Q6S A;  2Z6B A;  2K75 A;  4A93 H;  1JCK B;  1V9P A;  3CC7 A;  4BY7 G;  2XWB B;  4C2M B;  3RUZ A;  2PYK A;  3I4M B;  2QEX A;  2CWA A;  4RMF A;  4CDD C;  3F2B A;  1SYF A;  2VXW A;  4UP8 A;  3PSI A;  4L63 B;  3K5N A;  1KNA A;  3H3V I;  3CQZ B;  1ESF A;  4A3E G;  1Q7Y C;  3SHL A;  2Y0S G;  5JEA J;  2ASB A;  2KVM A;  2E76 C;  4ODG A;  2K01 A;  1GD7 A;  3RZD H;  4EVO A;  5D65 A;  3EQL C;  2K5H A;  4DAM A;  4X66 Q;  3C3L A;  3ITP A;  1WTO A;  4KTA A;  5IY0 A;  4AQY Q;  2I0Q A;  4A3D B;  3ZJY C;  1PRT B;  5E7N A;  3AYH B;  1CHP D;  1X9N A;  2CFM A;  4CJ1 B;  2O5I C;  4LF4 L;  3S16 B;  2K4K A;  2WP8 J;  4YHH L;  1K0S A;  5G3L D;  2Z0S A;  2X69 A;  1SMY D;  1I94 Q;  3G6J B;  4NMZ A;  3K7A B;  4AYB E;  4C3I H;  1CQV A;  1CKM A;  3EIV A;  3A7L A;  3EJI A;  3CC2 A;  3S14 B;  2B2U C;  4YCU A;  5M3M H;  1F9P A;  1U9R A;  3OTO Q;  3BU2 A;  1XPR A;  1RKN A;  2B2Y C;  4N8F A;  3U4V A;  4ME5 A;  4Q5V A;  1TWA B;  2KEC A;  3MFG A;  4R1J A;  4FVM A;  5ELB A;  1B50 A;  5CBA E;  3TME A;  1QVF A;  5FO9 B;  2F0P A;  3AB9 A;  2NTT A;  1DOM A;  2EJG C;  2ALY B;  3RN5 A;  2RA4 A;  3ONA B;  1YJ9 A;  1Q8K A;  3F1Z A;  1D2B A;  3A7A B;  2GN5 A;  4JI1 L;  3UDG A;  4KY5 A;  1KQS A;  3D6W A;  2ZM6 Q;  4BY7 H;  2RKS A;  4FDB A;  2EYM A;  3OW7 A;  3CHB D;  5IOD A;  4GN4 B;  4LF9 L;  2ZJP A;  1LT3 D;  2FHT A;  1H95 A;  2B2U A;  1K0R A;  4LFA L;  3K80 C;  1QVG A;  1CFM A;  4FXK C;  2HIX A;  1A15 A;  1N34 L;  2JA8 H;  3S2H H;  2VUM B;  4YWM A;  4RHS A;  4HJ5 A;  1PLF A;  2QEJ C;  4DR1 L;  1TVX A;  2EXD A;  3W3A A;  1JR0 D;  4X3S A;  4IFD J;  1EY8 A;  2L15 A;  4DR3 L;  3E0E A;  5I2X A;  4L5S A;  1E1T A;  3I4N H;  3BZC A;  3GP7 A;  1S5B D;  2UXB Q;  5JJK A;  1JJ2 A;  1PFB A;  1EWC A;  1BBW A;  1JOK A;  2EYO A;  4G7H C;  3SK5 A;  1HPC A;  1EOV A;  4HJ9 A;  1BKB A;  1EYG A;  4IFD H;  1H9K A;  1STE A;  2N3S A;  3DWQ A;  3PIO 3;  1DZ1 A;  4JI5 L;  1XMO L;  4P71 A;  2Z6K A;  2KCC A;  5LMN W;  5CMD A;  3KDF B;  3M4Q A;  3FRP B;  2F0M A;  3T4A C;  1VQH A;  5L37 A;  5KGU A;  1FGU A;  2F4V L;  1B3A A;  3S2D B;  3J80 c;  1TWH B;  1W3S A;  3Q23 A;  3F2U A;  1XNR L;  1KLU D;  3W2D A;  2R7Z H;  1AN8 A;  1O78 A;  4K2L A;  1H9J A;  1I6H B;  1E22 A;  3CCU A;  1J9O A;  1SYB A;  1MHW C;  1F9Q A;  4DAY A;  1PH6 A;  2AQ2 B;  4XYO A;  3CME A;  3ULP A;  2Q8I B;  1FR3 A;  1YBY A;  1C4Q A;  1BUV T;  2PZT A;  3W1B A;  1XMQ L;  3MXN B;  5IGG A;  4JI3 L;  5IYC G;  3GTL H;  4MN3 A;  1JB7 A;  1HTP A;  1TWG B;  2R93 G;  1G6Z A;  1Z6H A;  1WYD A;  2NVY H;  5I9O A;  1HQR D;  4KI0 A;  3UDI A;  2B63 H;  3KF8 A;  1T5X D;  1TWC B;  1I50 B;  4K14 A;  2K5D A;  1LM0 A;  2M9V A;  3MXP A;  2OQK A;  1K3B C;  4MZ9 A;  4NDX A;  3G6E A;  4GNX C;  2L0C A;  4LF7 Q;  1SRU A;  4P72 A;  4HJ7 A;  1JE4 A;  2K5Q A;  4JV5 L;  3Q0A A;  4JPB W;  3P1H A;  3WDN A;  2A73 B;  2XRS D;  4HCS A;  1BCP F;  3JAM i;  4DV6 L;  1GHJ A;  1JE5 A;  4AYB B;  3H0G G;  5FK9 C;  1B2T A;  3JAM c;  4ZQ3 A;  3HOV H;  2JA9 A;  2ZTD A;  2NBF A;  3HEJ A;  3PUV A;  4LF8 Q;  1IBL Q;  1CTM A;  1A2U A;  4LNQ A;  4FO2 A;  2K33 A;  3E3X A;  2WKC A;  2NB0 A;  3SXH A;  1ENA A;  1GJX A;  1I3Q B;  1MIU A;  5BR8 Q;  4UAI A;  2IHF A;  2EIF A;  3K5L A;  1IKM A;  1IYU A;  1VCI A;  5T1I A;  3CPW A;  3P7J A;  2Y0S E;  1I4Q A;  1PRT C;  1PA6 A;  1V43 A;  2NVT H;  3LNN A;  4HIO A;  1TS5 A;  2WB1 G;  4B9W A;  3TBI B;  1HA5 A;  3J7A F;  1AE2 A;  3SE0 A;  4MHE A;  2K52 A;  4CJ0 B;  1NNX A;  4G7Z C;  1VQO A;  2M00 A;  1UAP A;  1PH1 A;  4A3G H;  3KK7 A;  3SR1 A;  1ILQ A;  1UE5 A;  1QUQ A;  1WVL A;  4C3H B;  1XX8 A;  1PV4 A;  3S1N B;  5C4J H;  1Y1W H;  5COR A;  1B70 B;  1WI5 A;  4I7A A;  5IWA L;  4MIU A;  4LF6 L;  4MNO A;  5GRO A;  2KCT A;  1L2F A;  2C9O A;  1MGS A;  2XTI A;  3ND8 A;  1SRO A;  1D5Z C;  2PNH A;  5E3F A;  1V8Q A;  4RCN A;  4BY1 B;  1IW7 C;  2MNA A;  2EPB A;  5M9O A;  4GOP A;  1YNN C;  1IHZ A;  4FXG C;  2EY5 A;  3NWT A;  1EOT A;  3K57 A;  1VF5 C;  2RBM A;  1FNV A;  4R4C A;  1GUN A;  1KAB A;  3K8A A;  2LS0 1;  2D0P A;  5D14 A;  4I7Z C;  1A6X A;  4MTN A;  2F4I A;  1ZYR D;  1J6Q A;  4J6H A;  3MVV A;  4DFA A;  2FMM A;  2K1B A;  1FJG Q;  2Z8L A;  4LF5 Q;  2Z4H A;  2E2I B;  2BDN A;  4CJ2 C;  3OIQ A;  4UPA A;  2VQE L;  1CSQ A;  1PTO D;  5IWA Q;  2UXC Q;  5CV9 A;  1XWE A;  1CQF A;  3S17 B;  4QCL A;  4QQB X;  3A8K E;  3FKI H;  1SFO H;  4DR5 Q;  2PO4 A;  5DAU A;  1LTR D;  4JCV E;  4TKO B;  3GTQ H;  2EY2 A;  2E2J B;  3BVZ A;  2MO1 A;  4XQN A;  1Y8P B;  1YHQ A;  1X3P A;  5C3E B;  1C9O A;  3N52 A;  4R4I A;  1XNQ L;  1A0I A;  1G91 A;  1D6E C;  1TY2 A;  2PMZ B;  2EY1 A;  1KLG D;  4DF7 A;  2B2V A;  5BN5 A;  3MTS A;  1KDB A;  2H1E A;  3HOW H;  2JEA I;  2JJQ A;  1PFS A;  1L1O A;  1NR2 A;  4B9X A;  1ENF A;  2HDM A;  1YI2 A;  4QMG A;  5KNB A;  1SMY C;  4ZK9 B;  3D4R A;  3M7N A;  4O2D A;  3GD7 A;  1BCP C;  3D6C A;  1STG A;  5HGQ A;  1JWM D;  5D3D A;  1PFN A;  1EEI D;  4HIM A;  4IZ8 A;  2BA1 A;  5JEA H;  4RGO S;  2JA7 G;  2GA4 B;  1N36 Q;  1WTR A;  2RF4 A;  2SDF A;  1HUN A;  1EFI D;  2IPK D;  2R93 H;  1VQC A;  4DXG A;  1SAP A;  1EY7 A;  2F0G A;  2Q2U A;  2IX0 A; 
#chains in the Genus database with same CATH homology
 5BN3 A;  1QWY A;  2LFN A;  1PMR A;  4H0L C;  1QB5 D;  1U4R A;  3T16 A;  1EEF D;  2A6H C;  3A56 A;  4ZRZ A;  1EY6 A;  2FMC A;  4ZLT F;  5EBC A;  2BDO A;  2WKD A;  2QKI C;  2HUG A;  4A3E B;  1LT6 D;  5JVG 3;  4F7X A;  1L0X B;  3I3C A;  5IGC A;  2PCF B;  1EYD A;  2F3W A;  5KYI A;  1WCM B;  2RVL A;  1F9R A;  5F2D A;  5E1F A;  3SVM A;  5ELE A;  2JA5 B;  1SJE D;  1QG7 A;  1K8O A;  4F87 A;  3FPU B;  2FIN B;  2E74 C;  2K05 A;  4KKU A;  4Q0F A;  3O13 A;  1Q12 A;  1LAB A;  4IAL A;  2JA6 B;  2EY6 A;  5M5Y B;  3VR2 A;  2RDF A;  1MSG A;  3S1Q B;  3AMU A;  1D5X C;  3HZX A;  1DOK A;  2J4X A;  3VYS A;  2DNE A;  1E2V A;  3VR4 A;  3LWU A;  2F0D A;  3PO2 B;  2EJM A;  1LTG D;  1LV9 A;  2C5C A;  2MPM A;  2K7V A;  4C56 C;  1G2S A;  3ERO A;  2ICI A;  3VR6 A;  4IQZ A;  4HMJ A;  2A69 C;  4K8I A;  3VR5 A;  1SNQ A;  3GQB A;  3G7L A;  3HOX B;  5M5X B;  2NZ1 D;  3PV0 A;  4FNF A;  3K5M A;  1ZXT A;  3K6O A;  5HUR A;  3S15 B;  1I4R A;  4L8J A;  2KOL A;  2F0Q A;  1V1P A;  3VYR A;  4K6L A;  1BBX C;  4A3G B;  2WIN B;  3R3O A;  3CRL C;  1R4P B;  1LTI D;  3KLR A;  5IGF A;  5JPM C;  4KHV A;  4FF1 A;  2CQA A;  3U9O A;  4M8A A;  4QB4 A;  4G4K A;  1RD9 D;  2PNR C;  2WAQ B;  5CBE E;  1QOH A;  2WII B;  2B8F A;  2XNA C;  1HFG A;  2OEO A;  1W6J A;  3IFD A;  4TSS A;  2QF7 A;  1AZQ A;  2D9U A;  4DNT B;  1EY0 A;  2NN6 I;  2EYL A;  3BYT B;  1HA6 A;  1HRJ A;  4DK0 A;  2L4N A;  2RSO A;  1OXV A;  3HRZ C;  3DM1 A;  4KMU C;  3KUP A;  4RKL A;  3FDT A;  3SK8 A;  5CV8 A;  5LHY 1;  3TP8 A;  2NVY B;  2B2Y A;  2F3V A;  3A54 A;  1JB3 A;  4IUT A;  1H9M A;  2F03 A;  5FO8 B;  1CM9 A;  4XYQ A;  5M3F B;  1IW7 D;  1O7Z A;  1YNJ C;  2K6A A;  4HED A;  4DA2 A;  2XVS A;  1LTB D;  3J80 E;  3GTM B;  2A68 C;  1SYG A;  2OF1 A;  2NVX B;  1QNK A;  5KEE A;  2PQE A;  3DEP A;  1LLR D;  4U67 3;  1SYD A;  4A3F B;  1GUT A;  1KDC A;  4NW2 A;  2K28 A;  3EFX D;  2K5W A;  3H91 A;  1EL0 A;  2A68 D;  4KK7 A;  1CT1 D;  2RDH A;  5K36 H;  3M3Y B;  1NR4 A;  1SNO A;  1SXT A;  3PIP 3;  3NSW A;  5FLX L;  1DM0 B;  1ZEQ X;  3FEW X;  4O1N A;  1EWH A;  2X6G A;  4HR7 B;  1PZJ D;  1STA A;  3BVG A;  4HCE A;  4M1U B;  3IKJ A;  3LX0 A;  2F0E A;  3MXG A;  4IUN A;  2K32 A;  3I72 A;  3H3V C;  4IUU A;  2PPB C;  4BY7 B;  2ZXO A;  1JOR A;  2KQ3 A;  3UI2 A;  2F0T A;  1U4L A;  2BCO A;  3C1E A;  3MA2 B;  1STY A;  3K59 A;  5J22 A;  4PMB A;  3T53 B;  2O4X A;  5C3W A;  5CYU A;  2IWH A;  1X32 A;  5ISR A;  3T13 A;  2A6E D;  3OMG A;  3C2P A;  3GTQ B;  1GUO A;  4EQN A;  4QUC A;  4PV1 C;  3A8J E;  1VDZ A;  2AUK A;  1X3Q A;  3KBX A;  4V0B A;  3DUZ A;  4HN7 A;  3S1M B;  2L11 A;  5G3L F;  2O2L D;  3OPO A;  2K04 A;  2DN8 A;  4V19 0;  5JVH 3;  1J8I A;  1PTO F;  5FOB B;  1GOZ A;  4G57 A;  1O80 A;  4G7O C;  2CHB D;  3MEH A;  2L9H A;  4HMI A;  3RZD B;  1ILP A;  4WJW A;  2JSO A;  1STB A;  3L7Z C;  5IT9 L;  4KJO A;  3CRK C;  1BXT A;  1F2Z A;  1S5E D;  3I91 A;  5IGE A;  2KUM A;  3MZ5 A;  2G9D A;  1D5M C;  1ONL A;  4A93 B;  5DEH A;  2RSN A;  3ND9 A;  4DU9 A;  3VYT A;  1EYC A;  4CKE A;  4DNR B;  4RHR A;  1BOS A;  1IKL A;  5DM6 3;  3K0Y A;  2N88 A;  5IT9 E;  1V1O A;  3P20 A;  4XT1 B;  4IUR A;  3GO5 A;  4KV6 A;  3HOZ B;  4B08 A;  3D4D A;  5CV7 A;  2L1B A;  1M4V A;  1WD0 A;  1PZI D;  1IL8 A;  3MXU A;  5DNF A;  2AQ3 B;  1Q1E A;  3C46 A;  4JBW A;  1EU4 A;  4J8Q A;  1EQT A;  3J81 L;  5C5M A;  1NUC A;  3DHQ A;  2E2D C;  3QB3 A;  3V96 A;  4OO1 G;  4CKC A;  4HSP A;  2NTS A;  4R8I A;  4Z9C B;  3X3N A;  1I6V C;  3WOE A;  2F0N A;  4EQP A;  3H09 A;  4TRD A;  4KD3 A;  5EPK A;  1B4O A;  3FKI B;  2F0O A;  1B1Z A;  2EDG A;  2RDG A;  1Q1B A;  4KHZ A;  4PQX A;  1F9S A;  1SE2 A;  3M7G A;  5C0X G;  3RLF A;  3NPP A;  4OIK A;  2JYO A;  5EQ0 A;  1BCP B;  1Y69 U;  1QNU A;  4A3I B;  3OWE B;  2A5H A;  1NSN S;  2R7Z B;  3H6M A;  2IX1 A;  2AUJ D;  5IGD A;  1IYV A;  2WB1 B;  1SSO A;  3FVQ A;  1Q90 A;  1L0Y B;  3SDZ A;  5C0X H;  4RCO A;  4KN7 C;  3OWF A;  3K5O A;  5EPJ A;  3RMH A;  1ML0 D;  2EYJ A;  1GXD C;  3H94 A;  4OO1 I;  2LKV A;  3K58 A;  4S3S A;  1V1P B;  4OO1 H;  3DXJ C;  3I4N B;  4BBS B;  1BDO A;  4QUF A;  4F8M A;  3TP6 A;  1YNJ D;  1FNU A;  5KND A;  3PO3 B;  1SDF A;  4OGQ C;  5CC4 A;  3IL8 A;  3NWS A;  4HSV A;  5DM7 3;  1MBY A;  4R9W A;  2HDL A;  3Q22 A;  2J0T D;  3PMF A;  1VF7 A;  4IFD G;  2M2L A;  4KY6 A;  3J7A V;  1OXU A;  3PUW A;  2ZXP A;  3BVM A;  2EE1 A;  5JAV A;  1OO9 B;  2FFK B;  2SOB A;  5A35 A;  1NCV A;  1HQM C;  1SNP A;  1B9N A;  2R6G A;  3OHX C;  1H9R A;  4EGV A;  2KCN A;  1BO0 A;  2F0K A;  1EZ6 A;  2A74 C;  2ID0 A;  2B8G A;  3VYU A;  5T1G A;  1SBB B;  4Y7N B;  1KTK A;  1O7L A;  3L3O C;  3NTH A;  3RZO B;  2Y0S B;  2AWO A;  1DYQ A;  3J80 L;  2B2W A;  1T5E A;  1ESR A;  2LMC B;  2BOS A;  4RA8 A;  4XQJ A;  4IN3 A;  5J1Z A;  1F2M A;  2PZW A;  2Q8T A;  4BA1 I;  1DD2 A;  4KKT A;  3NBI A;  4L6T B;  1WTV A;  3DWP A;  3QG1 A;  5A2Q E;  2G9H D;  2F0S A;  1DCZ A;  3NK9 A;  2KED A;  1RF2 D;  3R8B A;  5CV6 A;  1PYW D;  4K5X A;  3SEB A;  2YU9 B;  2J7Z A;  1CA6 A;  1LTS D;  3TN2 A;  2OT2 A;  4EQO A;  2I46 A;  2Z1C A;  3M4Y A;  3EVQ A;  3TDQ A;  2MJ8 A;  2DY8 A;  3HGB A;  5JJZ A;  4CGY B;  3JAM E;  1KDA A;  1A3T A;  4A3K B;  3D31 A;  3DMU A;  1S5D D;  2R93 B;  3NHH A;  2F0V A;  3BDO A;  2HCC A;  3OOC A;  5K5P A;  1D1I A;  1AW7 A;  2RQX A;  4K6D A;  3QOL A;  2HQE A;  1FNW A;  2EYH A;  2K03 A;  2L12 A;  4NKL A;  1WTP A;  2VNU D;  2D2C C;  5C4Z A;  3HOW B;  1PRT F;  5E4W C;  2XWJ B;  5KRU A;  1K8M A;  2NYZ D;  1G29 1;  3HKZ B;  5EKI A;  1Z7T A;  3ERQ A;  1OXX K;  3FMC A;  2R61 A;  4FF3 A;  1RDP D;  3VA5 A;  1H9S B;  2EOT A;  4OL7 A;  5JOB A;  2KA7 A;  5EJW A;  4DAP A;  4KN4 C;  5FO7 B;  4XXE A;  5HGT A;  3I8Z A;  1SE3 A;  1SFO B;  1II3 A;  1GUS A;  1TT2 A;  1SJH D;  1MSH A;  1HTL D;  1S5C D;  4ZKB B;  3M4O B;  4N9P A;  4LK1 C;  3OIP A;  3L9A X;  2ZT9 C;  5KNC A;  1S5F D;  2B2T A;  4HTH A;  5CGK A;  4RGT A;  5LL6 X;  3M85 A;  2KHS A;  4YIJ A;  2BE5 D;  4X3U A;  3NQI A;  1ZKO A;  2WV6 D;  1UUP A;  2HCI A;  3URY A;  1XXG A;  3CKI B;  1SNC A;  1HUM A;  2BA0 A;  1EIH A;  1KAA A;  3MC0 B;  1U4M A;  3AU7 A;  3GTK B;  3GV6 A;  1LO5 D;  5C4J B;  1Y1W B;  1WTQ A;  3PUZ A;  3TZU A;  2YYZ A;  1OXT A;  2OXP A;  4RH6 A;  1ENC A;  1ZYR C;  4ULL A;  3BDL A;  3D4W A;  3I4L A;  5C5L A;  1EZ8 A;  2EXZ A;  1I4P A;  1S4Z A;  3BDC A;  3C1F A;  2NVT B;  2JA7 B;  1FGB D;  4DAV A;  1QIL A;  2SNS A;  1JWU D;  1CHQ D;  3HOV B;  2MUY A;  4RKB A;  4BS9 A;  2AWN A;  3X3M A;  4K8J A;  1Y1V B;  1TR5 A;  2CW0 C;  3BYY B;  2NVQ B;  1D1K A;  2IL8 A;  5I6Y A;  1E0B A;  3R2T A;  5COY A;  2B63 B;  4ZAI A;  4IFD I;  5C4X B;  1U4P A;  3I90 A;  4XDX A;  5M5W B;  3P75 A;  1QE6 A;  1KNE A;  3GTL B;  1M8A A;  4LAA A;  1Z47 A;  4F88 A;  5EPL A;  2PW7 A;  1JQY D;  3OSO A;  1LT5 D;  4C3J B;  4XTC S;  4C3H G;  5KIX A;  3EA6 A;  2EJF C;  1EQV A;  5C0X I;  1BNZ A;  4JK1 C;  1CA5 A;  1XTC D;  3R2I A;  3HOY B;  3E0J A;  4XQQ A;  5JEA G;  3IFT A;  3WOF A;  2EZV A;  4RGN A;  3VR3 A;  1TY0 A;  1SYC A;  1AP0 A;  2XRQ D;  2IJ0 A;  4K2K A;  1BQQ T;  1UNS A;  4XT3 B;  1A2T A;  3J81 E;  4IUQ A;  5C44 B;  1RCV D;  1VMC A;  1E2Z A;  1MI2 A;  2JA8 B;  4RFB A;  3S2H B;  2IX3 A;  1PDQ A;  1PFM A;  3T51 B;  3J7Y W;  2XN9 C;  2NUC A;  1FYC A;  2N55 A;  2B2V C;  1Q3L A;  3GTG B;  1XYI A;  4XIG S;  3ZYY X;  2V4D A;  2D62 A;  3D3R A;  3I70 A;  4QF4 A;  2L55 A;  1GUG A;  4N9T A;  4QIW B;  2B2W C;  4CBV A;  3HS0 C;  5D3I B;  1HCZ A;  4UDU C;  1SEB D;  2NN6 H;  1PXU A;  5M3M B;  1B44 D;  3QWN A;  1GHK A;  3PUY A;  4CHT B;  5C3X A;  4C3I B;  5C0X J;  3E6Z X;  1DXM A;  5IOC A;  3GTJ B;  4X3K A;  5ELD A;  1CK1 A;  1RJT A;  5FLX E;  4A3J B;  3KBG A;  2NN6 G;  3E5S A;  4PNY A;  1A3V A;  3LWE A;  5K36 G;  1K83 B;  1JOQ A;  4KD4 A;  3NTI A;  3PUX A;  2A69 D;  4IUP A;  1DJR D;  2I07 B;  1I4X A;  2AQ1 B;  1AZP A;  4H13 C;  4KY7 A;  1JWS D;  1JC7 A;  2PW5 A;  1RHP A;  1SYE A;  3OMC A;  5EGT A;  4KJN A;  3I73 A;  4KKS A;  1LTT D;  5A2Q L;  3Q24 A;  3T56 B;  1EIG A;  2R92 B;  1YNN D;  1SE4 A;  3GTO B;  3BS1 A;  5FKA C;  1LAC A;  1PRT D;  2Z4I A;  3HG9 A;  2EVB A;  4FXD A;  1EY5 A;  5EBD A;  5KYL A;  1DON A;  4PMW A;  2DNC A;  3MWY W;  1UEA B;  3S9W A;  3FPP A;  4BWG B;  2XIW A;  2F1M A;  3NP8 A;  4OHJ A;  1C48 A;  2JXM B;  1RTO A;  2PZU A;  3DWA A;  4ZUI A;  2CW0 D;  5TSS A;  4ZYS A;  4RAU C;  5I6W A;  1VMP A;  3NE5 B;  4BBR B;  3KLS A;  4WOR A;  1HXY D;  2F0W A;  2NWG A;  5CV5 A;  1E2W A;  5C6A A;  4R8N A;  1WTX A;  3RD4 A;  2R3Z A;  2ENB A;  2MGS A;  2QIL A;  5I4D A;  5AFW A;  2BE5 C;  1TS3 A;  1TS2 A;  3HOU B;  5IIF A;  2X6L A;  1RTN A;  1NAP A;  4IUV A;  4OIJ A;  1TWF B;  5E4X A;  3CU7 A;  4ZKC B;  3NBH A;  4K5V A;  4FYD A;  4I65 A;  1EYA A;  5BN4 A;  2KJX A;  2F0J A;  1R4Q B;  4DXF A;  3VA7 A;  2D5D A;  2A6H D;  4RWS C;  3V2T A;  1TQO A;  5JPN C;  4U68 A;  5NUC A;  1TII D;  2TMP A;  5I2Y A;  1BF4 A;  1H9S A;  2VB3 X;  1F2Y A;  5ELF A;  3V05 A;  2IT1 A;  3BG3 A;  2Q8R E;  5J39 A;  4ILW A;  3A8I E;  3MHB A;  1Q8I A;  3TZD A;  1ICW A;  1ET9 A;  2VB2 X;  3NXW A;  1LTA D;  1MD2 D;  4PMC A;  2WAC A;  2F0F A;  1CZW A;  2KEE A;  2H4O A;  2ZXR A;  5I9P A;  1WD1 A;  4NP5 A;  2SEB D;  1QCB D;  2XSC A;  1TU2 B;  3NTK A;  2MHV A;  4P2C B;  5ELC A;  1TS4 A;  2SNM A;  1STH A;  1EY9 A;  1O7Y A;  2JEB I;  3S1R B;  5IGB A;  2ICE C;  4ZUJ A;  4H44 C;  1C8C A;  1G8Z D;  4A3B B;  2E2H B;  1PTO B;  1PTO H;  2QCP X;  4HAE A;  2E75 C;  4J1M A;  2CVR A;  4WRD A;  2IW3 A;  1SNM A;  3U9S A;  1EU3 A;  1A3U A;  4C1N I;  1BR9 A;  3MAQ A;  1BCP D;  3TSS A;  1HHV A;  3A55 A;  1F77 A;  1W6K A;  1I4G A;  3KLS X;  4RGM A;  5CR3 A;  1CI3 M;  2FJ2 A;  4X3T A;  3HP3 A;  3SK4 A;  3GTP B;  4FP5 D;  1JOO A;  3TP7 A;  4ABN A;  1HFN A;  1F2L A;  5EKK A;  5EKL A;  5LL6 S;  1PTO C;  1PZK D;  2JE6 I;  4FF2 A;  2TSS A;  2EYF A;  1B53 A;  3TP5 A;  1WTW A;  4H7B A;  4BA2 I;  3BZD B;  4DN4 M;  1OXS C;  2LY7 A;  3JAM L;  2B2T C;  4FF4 A;  1AEX A;  3IAY A;  1SND A;  4TQU S;  3QO2 A;  4A3M B;  2MP1 A;  1B9M A;  4WFN 3;  3D8G A;  4LJZ C;  1EY4 A;  3QIA A;  2EYP A;  4C3J G;  1G2T A;  3DEO A;  1TKW B;  1I4H A;  3QJY A;  3GV3 A;  3R93 A;  4CKB A;  4GZY C;  3N6R A;  1CZG A;  3SK6 A;  3NQT A;  1R9T B;  1LT4 D;  1QJO A;  3H0G B;  1GUW A;  2O5J C;  1JIC A;  2F0L A;  4E6I A;  2QDB A;  4C3I G;  3NUC A;  2A6E C;  4DK1 A;  1ET6 A;  4K5W A;  2B39 A;  4C1N K;  4O42 A;  4ID6 A;  3MFY A;  5C4H A;  2F0I A;  1ROD A;  1DOL A;  2L5T A;  1Y8N B;  2JP1 A;  3QOJ A;  2DY7 A;  1STN A;  1AFP A;  5CV4 A;  4LMQ D;  4DGZ A;  1FD7 D;  2F0H A;  3MXN A;  1Y8O B;  2F0U A;  3Q6S A;  1JCK B;  2XWB B;  4C2M B;  3RUZ A;  2PYK A;  3I4M B;  1SYF A;  2VXW A;  4L63 B;  3K5N A;  1KNA A;  3CQZ B;  1ESF A;  3SHL A;  5JEA J;  2KVM A;  2E76 C;  4ODG A;  2K01 A;  4EVO A;  5D65 A;  3EQL C;  3C3L A;  3ITP A;  1WTO A;  4KTA A;  4A3D B;  1PRT B;  1CHP D;  2O5I C;  4CJ1 B;  3S16 B;  2WP8 J;  5G3L D;  2X69 A;  1SMY D;  3G6J B;  4NMZ A;  3K7A B;  1CQV A;  3A7L A;  3EJI A;  3S14 B;  2B2U C;  1F9P A;  1U9R A;  1RKN A;  2B2Y C;  4ME5 A;  4Q5V A;  1TWA B;  2KEC A;  3MFG A;  5ELB A;  4FVM A;  1B50 A;  5CBA E;  3TME A;  5FO9 B;  2F0P A;  3AB9 A;  2NTT A;  1DOM A;  2EJG C;  2RA4 A;  3ONA B;  1D2B A;  3A7A B;  4KY5 A;  3D6W A;  2RKS A;  2EYM A;  3OW7 A;  3CHB D;  5IOD A;  1LT3 D;  2FHT A;  2B2U A;  1CFM A;  4FXK C;  1A15 A;  2VUM B;  4RHS A;  1PLF A;  2QEJ C;  1TVX A;  3W3A A;  1JR0 D;  4X3S A;  4IFD J;  1EY8 A;  5I2X A;  3GP7 A;  1S5B D;  1PFB A;  1EWC A;  1JOK A;  2EYO A;  4G7H C;  3SK5 A;  1HPC A;  4IFD H;  1H9K A;  1STE A;  3DWQ A;  3PIO 3;  1DZ1 A;  2KCC A;  5CMD A;  3FRP B;  2F0M A;  3T4A C;  5KGU A;  1B3A A;  3S2D B;  1TWH B;  3Q23 A;  3F2U A;  1KLU D;  3W2D A;  1AN8 A;  1O78 A;  4K2L A;  1H9J A;  1I6H B;  1J9O A;  1SYB A;  1F9Q A;  4DAY A;  2AQ2 B;  4XYO A;  2Q8I B;  1FR3 A;  1C4Q A;  1BUV T;  2PZT A;  5IGG A;  4MN3 A;  1HTP A;  1TWG B;  1G6Z A;  1Z6H A;  5I9O A;  1HQR D;  4KI0 A;  3KF8 A;  1T5X D;  1TWC B;  1I50 B;  4K14 A;  2K5D A;  2M9V A;  3MXP A;  4NDX A;  2L0C A;  1JE4 A;  2K5Q A;  3Q0A A;  3P1H A;  3WDN A;  2A73 B;  2XRS D;  4HCS A;  1BCP F;  1GHJ A;  4AYB B;  5FK9 C;  1B2T A;  4ZQ3 A;  2NBF A;  3HEJ A;  3PUV A;  1CTM A;  1A2U A;  4FO2 A;  2K33 A;  2WKC A;  2NB0 A;  3SXH A;  1ENA A;  1GJX A;  1I3Q B;  1IKM A;  4UAI A;  3K5L A;  1IYU A;  1VCI A;  5T1I A;  3P7J A;  1I4Q A;  1PRT C;  1V43 A;  3LNN A;  1TS5 A;  4B9W A;  3TBI B;  1HA5 A;  3J7A F;  3SE0 A;  4MHE A;  4CJ0 B;  4G7Z C;  2M00 A;  1UAP A;  3KK7 A;  3SR1 A;  1ILQ A;  1WVL A;  4C3H B;  1XX8 A;  3S1N B;  5COR A;  4MIU A;  2C9O A;  1MGS A;  3ND8 A;  1D5Z C;  5E3F A;  1V8Q A;  4RCN A;  4BY1 B;  1IW7 C;  2EPB A;  5M9O A;  1YNN C;  1IHZ A;  4FXG C;  2EY5 A;  3NWT A;  1EOT A;  3K57 A;  1VF5 C;  2RBM A;  1FNV A;  1GUN A;  1KAB A;  2LS0 1;  5D14 A;  4I7Z C;  1A6X A;  2F4I A;  1ZYR D;  4J6H A;  3MVV A;  4DFA A;  2FMM A;  2K1B A;  2Z8L A;  2Z4H A;  2E2I B;  2BDN A;  4CJ2 C;  3OIQ A;  1PTO D;  5CV9 A;  1XWE A;  1CQF A;  3S17 B;  4QCL A;  3A8K E;  2PO4 A;  5DAU A;  1LTR D;  4TKO B;  2EY2 A;  2E2J B;  3BVZ A;  4XQN A;  1Y8P B;  1X3P A;  5C3E B;  3N52 A;  1G91 A;  1D6E C;  1TY2 A;  2PMZ B;  2EY1 A;  1KLG D;  4DF7 A;  2B2V A;  5BN5 A;  3MTS A;  1KDB A;  2H1E A;  2JEA I;  1NR2 A;  4B9X A;  1ENF A;  2HDM A;  4QMG A;  5KNB A;  1SMY C;  4ZK9 B;  3D4R A;  3M7N A;  3GD7 A;  1BCP C;  3D6C A;  1STG A;  1JWM D;  5D3D A;  1PFN A;  1EEI D;  4IZ8 A;  2BA1 A;  5JEA H;  4RGO S;  2GA4 B;  1WTR A;  2SDF A;  1HUN A;  1EFI D;  2IPK D;  4DXG A;  1SAP A;  1EY7 A;  2F0G A;  2IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...