3KLRA

Bovine h-protein at 0.88 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
SVRKFTEKHEWVTTENGVGTVGISNFAQEALGDVVYCSLPEVGTKLNKQEEFGALESVKAASELYSPLSGEVTEINKALAENPGLVNKSCYEDGWLIKMTFSNPSELDELMSEEAYEKYIKSIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title High-resolution X-ray crystal structure of bovine H-protein at 0.88 A resolution
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3klrA00
1OXTA 2ZT9C 1Q90A 5K36H 3A7LA 3MFYA 4G7ZC 2JXMB 1H9JA 3A7AB 2Q8IB 3WDNA 1LACA 2D62A 4OO1G 1CTMA 4H44C 2E75C 5JEAH 1H9KA 2V4DA 2E74C 4IFDH 1IYUA 4DK0A 2JEAI 1OXSC 4DNTB 5C0XG 1HPCA 1VF7A 1GHKA 2DN8A 1H9MA 2D5DA 4H0LC 1IYVA 1FYCA 3DXJC 1GUTA 1TU2B 3D31A 1GHJA 3ND9A 3VR6A 2NN6I 1V43A 4XTCS 1VCIA 3PUWA 4LJZC 3VR2A 3VA7A 2A6ED 2B8FA 3L7ZC 3LWUA 4KN7C 2A69D 2EVBA 3BDOA 1QJOA 1CFMA 2F1MA 3BG3A 1VDZA 3M7NA 2IT1A 3I73A 4JK1C 3I72A 2E76C 2NN6H 1LABA 1V8QA 3PV0A 3I4LA 1DCZA 5BN4A 4GZYC 2A68C 1Q1BA 1GUSA 1Z7TA 3OPOA 2DNCA 1PMRA 1OXXK 2EJGC 4H13C 4L8JA 1Y69U 2QF7A 1IW7C 3ND8A 2AUKA 2BE5C 1ZKOA 3PUZA 1TKWB 3M85A 3RLFA 1YNNC 4RCNA 3GQBA 2D2CC 2L5TA 4KKUA 1A6XA 4OGQC 5KNCA 2O5IC 1SMYC 2K32A 4IQZA 4XIGS 2DNEA 1E2VA 1YNJC 2A6HC 2JE6I 1CI3M 4G7HC 3IFTA 3A8KE 3T56B 3LNNA 4KN4C 3N6RA 1Y8PB 3W3AA 1H9RA 3AB9A 3FMCA 4KI0A 4TKOB 5KNBA 1Q1EA 3QJYA 4KMUC 1H9SB 5K36G 2NN6G 2EJMA 3EQLC 2AWOA 3T53B 3VR3A 1HCZA 3TZUA 3MXUA 4DNRB 2PPBC 1DD2A 1GUOA 3CRLC 1ZYRC 1OXUA 2CW0C 2EDGA 3A8IE 1Y8OB 3M4YA 5JEAG 4LK1C 4G7OC 4IFDG 4KHZA 3KLRA 1G291 2K33A 3A8JE 3HGBA 4JBWA 1Q12A 1FR3A 3VR5A 1EWHA 1K8MA 3QIAA 2BA1A 3QG1A 3PUYA 1B9MA 4DK1A 1O7LA 1K8OA 2KA7A 2AUJD 4BA1I 1I6VC 2A6EC 5BN5A 2A68D 2LMCB 4KKTA 5KNDA 2A69C 2BA0A 4TQUS 1B9NA 1ONLA 4PV1C 4OO1H 1GJXA 1DXMA 1VF5C 2PCFB 1GUNA 1IW7D 3FPPA 1Z6HA 2R6GA 3H94A 2BE5D 3NE5B 3PUVA 2JEBI 5A35A 5C0XH 3OW7A 4HR7B 2PNRC 1E2ZA 2O5JC 3SE0A 2K7VA 2YYZA 2B8GA 1HTPA 3T51B 1BDOA 1T5EA 3P20A 4I7ZC 3GD7A 2A6HD 5BN3A 1OXVA 2KCCA 3OOCA 3VR4A 1GUGA 1O78A 1Y8NB 2EJFC 4BA2I 1HQMC 1H9SA 3PUXA 4KKSA 3SDZA 3CRKC 2BDOA 3IKJA 3U9SA 3D4RA 1E2WA
chains in the Genus database with same CATH superfamily
5K36H 3A7LA 3M4QA 3TDQA 1G2TA 4GKJQ 4CHTB 3K5NA 3Q8DA 1A8VA 1RJTA 2UXCQ 3DHQA 5IWAQ 3CCEA 1PTOC 4DV2Q 4XDXA 1RKNA 3NQTA 4GLVB 3PO3G 1E0BA 4LJZC 1FVIA 3K8AA 3A0JA 4FF4A 4C56C 4N9TA 1QZGA 4DR1Q 4C3JG 3RUZA 4JI1Q 1S5BD 3V2TA 2RDGA 2FFKB 2EPBA 4L6TB 2E5LL 1PMRA 2LS01 2KUMA 2QCPX 3E5SA 2KECA 4X64Q 1D7QA 1BVSA 3NPPA 3H3VI 2ICEC 1XMQL 2Z0SA 1WTXA 3RD4A 2R7DA 4P71A 2CWPA 3RLFA 1EFWA 2EXZA 3MHBA 3J7A5 2EZVA 4B3RL 3GTLH 4K2KA 1KABA 2KBNA 4A3CG 1EQRA 4KN4C 4NXNQ 1BBUA 4DR6Q 4B3SQ 2CCZA 2F0MA 4IURA 2NBFA 4YHHQ 3TZUA 1PTOD 4DNRB 5KRUA 1L1OA 1PH3A 4QQBX 4B3ML 5FO9B 5KYIA 1X3QA 4DPGA 4A3BB 5LMUQ 1KAWA 5E4XA 2VY3A 3TS0A 2BA1A 2NB0A 2N88A 2F03A 1TS4A 2X6GA 1KDAA 3QB3A 4HJ8A 4DR2L 2A69C 5FK9C 1GJXA 3MFGA 3L2PA 1VQOA 1ASZA 3NENA 4DV4L 1Z6HA 2XVSA 4X3SA 3OTOL 2IWHA 3KK7A 4NB3A 2H4OA 4CJ1B 3JAME 1K83H 1A2UA 2YYZA 5EPLA 1ICFB 4Q5VA 1XTDA 3GTGH 3GTKH 1HTPA 3TBIB 3X3NA 3P20A 5FOBB 1LO5D 2Y0SE 1KD1C 4OONA 2EJFC 1LTID 1SDFA 1Q8KA 3H3VC 5NUCA 2CQAA 3T4AC 3D4RA 4DUZQ 4C3IG 5CV6A 4AIMA 1NR4A 2KVMA 3J81i 4AQYQ 1B3AA 3L9AX 4A3JH 3S1MH 3P1HA 1ZEQX 1NBWA 5KGUA 4IFDH 4X65Q 1PH7A 2K6AA 4DGZA 2CVRA 5M3MG 3FKIH 4RGNA 2KOLA 1VQIA 3CF5A 2A69D 3HOUG 2R7FA 4A3FG 4C2MB 2IT1A 3PMFA 1KRSA 1LUZA 2NUCA 2VW9A 4LFCQ 1TXYA 4BY1G 4X66Q 2E2DC 5GQOA 4DAYB 1SSOA 4EVOA 2B2UC 3PSIA 1TKWB 2GN5A 2JA7B 3BZCA 5IYBH 2A5HA 4MHEA 2UXDQ 4GLAC 1E2VA 2JE6I 2SOBA 4UP9A 3LNNA 1HUMA 1SRUA 1Y8PB 5FJ8G 1Y1WB 4KI0A 4OXPA 1PH5A 1E22A 2NN6G 3TP5A 4KLKA 1PRTC 2XRQD 3CKIB 3Q22A 3CCLA 4BXXG 1IZ6A 1E3PA 5I6WA 1G291 3DM1A 4BBRB 1VQ8A 5CC4A 4GS3A 4B3TQ 1C0AA 5HY6A 2PQAB 1IBLQ 1A62A 4B08A 5HURA 1EWCA 2EYMA 4OX9Q 4A3MB 2KA7A 5M3FH 5KNDA 4JBKA 4LF9Q 3SK5A 2MHVA 4FXKC 4HCSA 1TWCH 2XTIA 2R7ZB 3Q24A 2WB1G 3NTIA 2K01A 2N55A 2PNRC 4DK6C 4A3KB 3I4NB 2O5JC 3ULLA 1J6QA 4QF4A 3VR4A 1L1OB 3HOWH 3KYHC 1VMPA 3S2DH 4UP7A 1SXTA 2R93B 1CZGA 3NP8A 1DJRD 4P74A 2R3ZA 1PRTD 3KF8A 4POFA 1HNZL 2B63B 2B2TC 3QOJA 1J5EL 1JB7A 1XMOQ 2E75C 4GKKQ 3HOVB 2V4DA 3BVMA 2KCNA 4DK0A 3ER0A 1S3OA 2HCCA 1HPCA 1HZBA 3VYUA 4GLXA 1HR0Q 4GN5A 1F2YA 4RG1A 2OQ0A 4XQNA 4BBSB 1WFQA 3PIPA 1WTHA 1SYGA 4JI3Q 4K8IA 1SLJA 3BG3A 4XXEA 2N3SA 2K1BA 1LABA 3I4LA 1Q82C 1IHZA 4L5QA 5C0XJ 3D8GA 4RAUC 2TMPA 4A3DH 3K59A 2D2CC 2CKZB 1M4VA 3MAQA 1STGA 4IJHA 3A54A 1LTTD 3HOYB 1WTPA 3I70A 5TSSA 3CXCA 4P73A 5IODA 1PTOF 1EOTA 2XSCA 4GNXC 3T1YL 1S5FD 3CU7A 4XT1B 4DV1L 3BZKA 5IE8A 3S1RB 3I4MB 2I5HA 2I46A 1U4PA 1U4LA 2R92G 2EYHA 2Z1CA 2O4XA 3TMEA 4R4CA 1Y1VB 1WTQA 4QCLA 5FLXL 1VQMA 4KD4A 1KXLA 3QR8A 4FXDA 4HMIA 4JOIC 4DR5Q 2LY7A 1O7LA 1BKBA 4LAAA 4QJFA 1DGSA 2QEXA 1F9QA 2F0KA 1UAPA 3S2HH 1AZQA 2OQKA 3DWAA 4OO1H 1BXTA 3DM3A 3UDIA 4K0KQ 3ICEA 2B2VC 4N9PA 3AMUA 4MN3A 4JW0A 1IL2A 2SEBD 1CKMA 4MZ9A 3P75A 4Y7NH 3KBXA 1UE7A 1G2SA 2Y0SG 3K0YA 1HNWL 3JAML 4YWMA 1RTOA 3I90A 1PA6A 1H9SA 2Q2TA 2BDOA 2YTXA 4FDBA 2D9UA 3I4OA 2MJ8A 4AH6A 1EIYB 2SNSA 1LACA 1YNXA 4IPCA 5JEAH 1N36Q 1QB5D 4IPDA 2YU9H 1GHKA 3SK8A 4A3IH 5FO7B 1KTKA 4EQ5A 5IGCA 3J81j 3NELA 1STHA 3F2CA 3T1HL 4LMQD 4KK7A 3VA7A 2G5DA 3KJOA 1IKLA 2JN4A 3MXGA 1VDZA 5M5XH 1CHPD 3I72A 2NWGA 4WJ3M 1ET6A 1WCMH 4B3RQ 4F87A 5C3EB 1B2TA 5K5PA 2HQLA 1D8LA 4FVMA 5FLMH 2A19A 3S16H 3BVZA 2VUMH 5C4JB 2L5TA 1SNOA 1SYDA 3OHXC 4KKUA 3EJIA 2K32A 1QVGA 1EEID 4A3GH 4KHVA 1EL0A 3BDCA 2JA8G 1IBML 5KNBA 1XWEA 1KNEA 1AZPA 1K28A 4DR2Q 4R9WA 2EIFA 2LXKA 4JI2L 4DR3L 3PO3H 2MNAA 3A56A 2I5LX 4RCOA 2NTSA 1AE3A 3E9IA 3OTOQ 1DZ1A 3KF6B 3G6JB 4RWSC 2JA6G 4C3JH 3J80L 3AEVA 3DEOA 3GV6A 5I2XA 3KJPA 1MKHA 1S5ED 2F0QA 4DU9A 2F0OA 1I4QA 3J81E 1XNQL 4IUTA 4IPHA 4R8IA 5EKLA 3FPPA 1PHJA 4KJOA 2K5DA 3CCQA 2IL8A 1I94Q 3RNUA 2B2YA 2K7VA 5ELCA 5CBAE 4POGA 2E2JH 2EOTA 1BDOA 1G6ZA 1T5EA 3GTLB 1BQQT 1IXRA 1QILA 4A93H 1GXDC 2K50A 1SE2A 2XRSD 4PG3A 5F2DA 3HOXG 4FO2A 1PRTF 1I4RA 1SJED 2RCNA 3NXWA 4RGOS 4CJ2C 1JR0D 3ULPA 2D62A 5LL6S 4HSPA 1SBBB 2OT2A 2JEAI 2BH2A 3K81C 3BU2A 3SVMA 4ALPA 1MSGA 1TWAH 2PZWA 2B8FA 1SYCA 3BDOA 1QG7A 4PZ7A 1JOKA 2F1MA 3NQIA 4LF8Q 4YCWA 1EQVA 2IW3A 1HFNA 1Z9FA 1V1QA 3PV0A 1F2LA 1K83B 3GTGB 1S4ZA 1TS3A 4X3UA 1Z7TA 2KHSA 1XXGA 2FHTA 3CP0A 3GO5A 4HTHA 1WTVA 2EJGC 4HMJA 1Y69U 4GOPB 3M85A 4JI0L 4UDUC 2O5IC 4UY8C 4XIGS 4KY7A 1CQFA 1CKOA 3F2DA 3E3XA 4A3JB 4A3BG 3S1MB 3S1QH 3RLNA 4RKLA 5HGQA 3HKZB 3PGZA 2IJ0A 3KFUA 1Q1EA 4HJAA 1C8CA 4E6IA 5J22A 4LUVA 4IFDJ 4LF6Q 4FYDA 1EY6A 2R61A 3FKIB 5LL6X 1V1OA 1XX8A 2Q2HA 3PQIA 5M3MH 3KLRA 2WV6D 2DJFC 3K7UC 3HOZH 2F0TA 4RGTA 3M9BA 3GTQH 3PUYA 4UHVA 1B9MA 1EY8A 4JBJA 2AHOB 1TQOA 5BN5A 4DN4M 4JV5L 4DR4L 5JAVA 1LTRD 1ESFA 1E2ZA 4YCVA 4A3EB 1J5EQ 2JQOA 4ZYSA 3F2BA 3D6WA 4ILWA 4FXGC 3QOLA 4DXGA 5IT9c 3OOCA 2WKDA 3CC7A 3AU7A 1O78A 4BA2I 5CV7A 1II3A 1HQMC 3SK4A 2IX1A 1KIXA 1HUNA 3SDZA 1JORA 1SJHD 4U68A 1OXTA 2Z8LA 1M8AA 1XJVA 1JB3A 1R4PB 1N8RC 1TT2A 2EYJA 2A73B 5C3WA 1OXSC 1M1KC 1QUQA 2DN8A 5IP9H 1J9OA 2CHBD 3DLLA 4JG2A 1V43A 2BCOA 5M3FB 3VDYA 2SDFA 1KAAA 3NWSA 1NNXA 1TWCB 4LF7L 1HJPA 3PCOB 2JA7G 1N33Q 5C3XA 4KHPQ 1X3PA 5AJ3L 4DV5L 3EN2A 3OIQA 2FXQA 1A3UA 3KUPA 3T16A 2HIXA 4A3LG 1OXXK 4H13C 4FF2A 3NBHB 1Y1WG 1NE3A 4KV6A 3KDFA 3HOWB 3N52A 3L0OA 2PNHA 2F0GA 1VQLA 3SGIA 3MXPA 4HEDA 5IYDG 3CAMA 4WJWA 5KYLA 1A6XA 3S17H 3ITPA 1W6JA 1CM9A 4RGMA 4DKAC 1CZWA 4OHJA 1VQFA 1WJJA 2Z6KA 4BBRG 4PZ6A 1AH9A 5BR8Q 4OWTB 1BO0A 2EXDA 3Q6SA 1XNRL 3TP6A 4A3MG 3NBIA 3DWQA 4QY7A 3A8JE 1B53A 3HEJA 3GP7A 2R7ZG 2HHHL 4RH6A 3QIAA 1L1OC 2KEDA 5E3FA 4A3KG 4TRDA 1GKHA 1HNWQ 1VQEA 3RZDH 1Q86C 1QNUA 4WFN3 4KKTA 1UEBA 3HFZB 1EQQA 3GTJH 2ENBA 3BZDB 2PCFB 5CV5A 1X3EA 2VQFL 5E1FA 1TWFH 2R93G 3FP9A 2DUDA 5FLXE 2RKSA 3C3LA 3J81L 2B63G 2RCFA 2J4XA 2B3GA 1X9NA 3HOVG 4PMWA 1NUCA 4JYAQ 2EE1A 5C0XI 1EFID 4MIUA 1CA6A 4BBSG 2K03A 1PH9A 5C6AA 2UUCL 4G57A 2J0TD 2Q8IB 1EYAA 3HG9A 1PV4A 2B29A 1H9KA 1K73C 4KTAA 1CKNB 1LT6D 5C0XG 2WFWA 1H9MA 2D5DA 1VQHA 3I7FA 3CMEA 4C3HH 2BH8A 3H09A 1LV9A 4RHSA 1BCPB 1NMGA 3S2HB 1BUVT 4CJ0B 3WWVA 2DY7A 5ELNA 1X65A 4DK3C 3CHBD 4N8X1 4GZYC 4PNYA 1G51A 1SAPA 3HOYG 1GUSA 1TR5A 2DNCA 1IBMQ 3U50C 4TVAB 1BR9A 2AUKA 1U9RA 3QO2A 3VA5A 5C5MA 1SNDA 2UXBL 4JI2Q 1NY4A 4DR3Q 3I4MG 3QWNA 5I9PA 1YNJC 1DOMA 2RVLA 5CYUA 5ISRA 4JI4Q 3M3YH 3K0XA 4DV6L 1LTLA 1Y1VG 1FJGQ 1JT8A 1BBWA 1GM5A 5IY0A 2JA5H 3FMCA 1N34L 1OTCA 2YU9B 1O7IA 2SNMA 2EJMA 4A3IB 5ELFA 5JEAJ 2E2HH 3S1NH 1NSNS 1EZ8A 1VQKA 1QZHA 3TSSA 4IOCA 4JI8Q 3HGBA 1ENCA 2ALYB 5ELDA 5M5XB 3U4ZA 2UU9L 2QA4A 1PZJD 1WCMB 3P7JA 3LWEA 1YHBA 5EAYA 3RZOH 2KJXA 3W5OA 3KLWA 2B2WC 2PMZE 4LF4L 3S16B 1VF5C 3C1FA 3CQZH 1VS0A 5JPMC 2CH4A 2VUMB 1F9RA 4LFBQ 3ERSX 5L37A 3SE0A 1SEBD 2JP1A 3WOEA 4A3GB 2AQ2B 1YNJD 1L0YB 1SN8A 3J80E 4IPGA 2LFNA 3PO2H 1XTCD 3V05A 2A1AA 2JA8H 1MSHA 2X6LA 3B6YA 1Q81C 3U9SA 4JI6L 1E2WA 2NZOA 4DV0L 2B2UA 5IP7G 4HJ5A 1O80A 3E0EA 2FMCA 2JXMB 2D0OA 5DM73 3PO3B 4APVA 4M8AA 4HCEA 1CHQD 4DR7L 3TP8A 4JPBW 2F0VA 1GUTA 4WRDA 5C3EG 4X62L 4C3JB 1YZ6A 2H5XA 5IYCH 1O7ZA 3E0JA 3D4WA 2KHJA 1STEA 3D4DA 1QJOA 4OIKA 4NW2A 3I56A 3M7NA 2AWNA 2VXWA 2E76C 4N8FA 5BN4A 2E2JB 4A93B 2OTLA 5J3BA 1VQ9A 2D0PA 5EPJA 3GQBA 3K80C 4L5SA 3HOXH 4J6HA 5KNCA 4JI5Q 1SMYC 4QB4A 1A3VA 4CDEC 1W3SA 1EOVA 3FEWX 3A8KE 1Z47A 2LSSA 1V1PA 4PMBA 2NVXH 2Q8RE 1CT1D 4DV3Q 2ZJPA 3SEBA 1SNCA 2ID0A 3CRLC 2NZHA 1IBKL 2MO0A 5G3LD 4JV5Q 1LTSD 5C4XG 1TWAB 3OW2A 5CBEE 2K33A 1EY7A 1JJGA 3VR5A 5A2QE 2B2TA 1EWHA 1I5FA 2VB3X 2F0EA 1LTAD 1L0XB 1MGSA 3BVGA 1MD2D 3ONAB 1EYGA 5JJZA 4IOAA 2UUAQ 1RCVD 5CR3A 1D2BA 3IFDA 1AP0A 2R6GA 3STBC 3PUVA 4RKBA 1P8LA 3K7AH 2Q2UA 4HR7B 1SMYD 1ASYA 1YHQA 1T5XD 3S1QB 1Y8NB 3J7AF 2K5VA 3CRKC 3CCSA 1O7YA 2FMMA 3Q0AA 3H0GG 2L9HA 2OCEA 5D3IB 4YCUA 2UXCL 3KBGA 4IN3A 1EY0A 1EU3A 5IWAL 4DV2L 5DAUA 5D14A 4BY7G 2KENA 5M3MB 2L11A 4QUFA 3HOZB 1NR2A 1KNAA 5AJ3Q 1PH8A 1VQ4A 4H0LC 4DV5Q 1X6OA 3GTQB 1RTNA 1KDBA 1TU2B 4GOPC 4R4QA 5EJWA 4XTCS 2NYZD 4GNXA 2WAQB 1XYIA 1I50H 4IFDI 1CK1A 5FKAC 2ZTCA 5C44G 4H02A 4OWXB 1JOOA 5DM63 2IHEA 4A3JG 1W2BA 4UAIA 3CCMA 1R4QB 4JOIA 4DAPA 3S15H 2MO1A 1YHAA 1TWHH 1G8ZD 4NXNL 2F0NA 4YIJA 2RHSB 2E5LQ 3G7LA 3FKIG 4IQZA 2B2VA 2NVYH 2V1CC 3NEMA 1KRTA 1CI3M 3GTPH 4A76A 1EYDA 1XMQQ 5ELEA 1HA6A 4Q0FA 3URYA 5LMUL 1LT5D 4HN7A 2CW0C 4MNOA 2L55A 3KF8B 2F0SA 1S72A 4KHZA 5HGTA 1UUPA 2DY8A 2C35B 2F0DA 1LT3D 4B3MQ 1WVLA 3A5UA 4A3EG 1VQCA 1RDPD 1HNXL 5IYBG 2G9DA 2JA7H 1B3QA 5I2YA 2E8GA 3CW2C 4ME3A 2F0WA 2X69A 3NUCA 3MXNA 3ZYYX 4PV1C 4J15A 4A3LH 3CD6A 1DXMA 1JE4A 3JAMi 1X56A 5CMDA 3OW7A 2F3WA 1RODA 5C4ZA 4X3KA 3CPFA 3S17B 5IYDH 1IL8A 4DV4Q 1B4OA 4G4KA 4Z9CB 5FLXc 1PTOH 4EQOA 2JSOA 4QGUA 4NPSA 5J1ZA 1M90C 1TS5A 1PFMA 1SYFA 4X65L 2ZTEA 4ABNA 5M3FG 4QMGA 3CMAA 3D0FA 4R4TA 1I3QH 2KEEA 4XQQA 1HHVA 3H91A 4IUQA 2K28A 4RHRA 4DNIA 2JK8A 2EY6A 4DNTB 3RMHA 3HP3A 3DXJC 3TZDA 3D31A 1D1KA 1SE4A 2HUGA 1B7YB 1TS2A 3RZDB 1DONA 2DJGC 3JAMc 1LM0A 4KN7C 4A3CH 2EVBA 3GTJB 3BDLA 2VZAA 1TWFB 3CC4A 2PW7A 1PZKD 3E6ZX 5T1GA 1TWGH 4DV6Q 1C7YA 4ZUIA 1BBXC 4DA2A 4CKBA 2UXDL 3MWYW 4LFAL 5T1IA 2HDMA 3HKSA 2PYKA 1MI2A 5M5YH 4OGQC 2L15A 1YVCA 4G7HC 2M00A 5JPNC 2C9OA 2IX3A 4C1NK 1Q3LA 3AQQA 3DEPA 1K0SA 3UDGA 1H9RA 5IGFA 1B70B 2F0LA 4L5TA 5M5WH 1H9SB 1EIFA 3EQLC 3GTKB 5G3LF 4C3HB 1GUOA 4B3TL 1W6KA 1YI2A 1Y8OB 1VQBA 2K5HA 2VS1A 3GV3A 4OEMB 2AKWB 4OX9L 2JYOA 1X32A 4JBWA 2N49A 3IL8A 2NZ1D 2M2LA 2HT1A 1HZCA 1K8MA 4XT3B 4JBMA 4DK1A 4I7AA 2DGYA 4C3IH 3H3VH 5A2QL 2VNUD 4ZQ3A 1RL2A 3I91A 3PF5A 4TQUS 1B9NA 2NVTH 2BOSA 2HD3A 2Y0SB 3EFXD 3NE5B 4JI6Q 1SYBA 1MIUA 3IRBA 1STYA 1YITA 2B8GA 4ZLTF 2PO4A 3A74A 4OO1I 2CH4W 3ERQA 1PFNA 4DR7Q 1WD1A 1BCPC 2ZM6L 4HJ7A 3HOUH 2JA5B 4DV7L 1XMOL 4P75A 3S24A 4A3FH 3OYYA 4X62Q 4LNQA 4GKKL 3J80c 1B8AA 1C48A 2E2HB 3S1NB 4JI7L 3UDFA 1HR0L 2WAQE 1EY5A 3A7AB 2K04A 4OO1G 1UE1A 4JVZA 1CTMA 1V9PA 4BY1H 1K8AC 3S14H 1NAPA 3OMGA 2PZTA 2QKIC 4JI3L 1HNZQ 1IYVA 1XPUA 1AW7A 1PXUA 1GHJA 1U4RA 2VL6A 4GN3B 5J39A 2JA9A 3R8BA 3RZOB 3VR2A 4HIOA 1PFSA 3D3RA 3MZ5A 5FJ8H 1PH2A 3CQZB 4K14A 1SROA 1HRJA 4NKLA 2KHIA 1CQVA 4LUOA 3FHWA 2NN6H 3ULJA 4V190 2K75A 4BXXH 1N32L 4EGVA 1LYLA 1L2FA 3PO2B 3ND8A 2L1BA 2GVBA 1AN8A 4A3IG 1IBKQ 1KL9A 4M1UB 4FF1A 4R4IA 3U58A 1Q7YC 3MC0B 1FL0A 4QIWB 5GADC 2F0PA 1PH1A 3W3AA 4J8QA 3DUZA 1F2ZA 1FNVA 4K5XA 1WCMG 1U4MA 1JQYD 1SNPA 2OEOA 2PPBC 5IOCA 2E2IH 3GTOH 2AQ3B 3EROA 4DR5L 5FLMG 2NTTA 4ZUJA 5CV4A 3T1YQ 3S2DB 3I55A 4IUVA 4DV1Q 4ZRZA 4UP8A 1GO3E 3FDTA 4B9WA 4V0BA 4K0KL 4KJNA 1WTOA 5D65A 1NJIC 2XWBB 4A3GG 1K8OA 1FGBD 4IZ8A 4AYBB 4DAYA 4H7BA 4O0AA 1WD0A 3T13A 4YWLA 2JEBI 3E9HA 5A35A 3HZXA 3HOXB 1PVOA 3R3OA 4PZ8A 5DNFA 1PH4A 1EEFD 3J7YW 4I7ZC 4KD3A 1RD9D 4UPAA 5C5LA 2N8NA 2FINB 3UI2A 2NVXB 4GN4B 4CDDC 3I4NG 3VYRA 4OIJA 1N36L 1K0RA 1LLRD 5AFWA 4L63B 4DAVA 4G7ZC 2PI2E 5EGTA 1EIGA 4K5VA 2KCTA 4A3DB 2XWJB 2XIWA 5C4XH 2QDLA 1YBYA 2PQAA 2VQEL 2RF4A 1I4PA 1Q46A 3G4SA 1CSQA 5JVG3 2RSOA 1HZ9A 3VR6A 4A93G 2L0CA 4DUYL 2F0JA 4NMZA 4YY3L 2EYFA 2EYLA 1QVFA 3T1HQ 4XYQA 3RN2A 3K7AB 2EQSA 2F0FA 3M4PA 1IKMA 1BF4A 2A8VA 5IGGA 1RHPA 2RDFA 2R92H 3NK9A 2BE5C 5ELBA 3PIOA 5JJLA 4PMCA 1UNSA 1KHIA 3OWFA 1ML0D 4LW1A 3MEFA 3GTMH 4K6LA 3H0GH 2Z4IA 4A4IA 2QEJC 1F77A 5IIFA 4BY7H 3AB9A 4U673 3HS0C 1HNXQ 3QJYA 3K5MA 4Y7NB 3T53B 3VR3A 5ELOA 2WIIB 3KOJA 1DOLA 2MUYA 1EZ6A 3A8IE 1R9TH 3HKZE 5JVH3 1I50B 2ICIA 2OTJA 2HQEA 4O42A 1QUQB 2F4VL 1I6HH 5C44H 4DAMA 1PZID 4BA1I 3W1BA 1I94L 1EY9A 2LKVA 1G6PA 1EWIA 2OWOA 3S15B 3H94A 3O13A 3M4OH 4CBVA 1NCVA 2BE5D 2RBMA 3SR1A 1TIID 2YTYA 1TWHB 2EYPA 1A15A 1YIJA 1S5DD 4IO9A 2MFIA 4TSSA 3T51B 1XNQQ 2NVYB 1H95A 2IPKD 3TP7A 4OWWB 3GTPB 1OXVA 4LWCA 2H1EA 2HIVA 4FF3A 3HOZG 1SYEA 1IYJB 3KDFB 3OSOA 4BWGB 3PF4A 4NDXA 1Q90A 2K5QA 3TQYA 5KEEA 2WAQG 1CA5A 1H9JA 3TRZA 3TREA 5E7NA 2E74C 1IYUA 1I4HA 5CORA 5LMNL 2AQ1B 2UUBL 2RSNA 3J81c 1FYCA 1SFOH 1AFPA 1A0IA 5GAEC 3ND9A 4LF8L 1X54A 2NN6I 4RMFA 5JOBA 4A3EH 4RFBA 2NVQH 4CDCC 3K57A 5E4WC 2LXJA 4LFAQ 2RA4A 1ET9A 1SMXA 3NTKA 1ENAA 3Q23A 1JWUD 4O1NA 1V8QA 1WTWA 3BYYB 2F0IA 3OPOA 4QIWE 1K3RA 5LHY1 1ESRA 1BCPF 4MTKA 1LT4D 4Y52H 1PTOB 2QF7A 1RIPA 3NTHA 4ZKBB 3U4VA 1HTLD 5IP9G 2B2WA 2N78A 2O2LD 3L3OC 2JA6H 1K9MC 3VYTA 3CCRA 1I3QB 3IFTA 2HDLA 4LF6L 1YJWA 4JI0Q 1I4XA 3TN2A 2HCIA 2FJ2A 2K52A 2WKCA 1VQJA 4KMUC 5K36G 5IT9E 2K14A 1UWVA 4ODGA 3R2TA 3CCUA 2EDGA 3M4YA 4AYBE 4NXML 2EYOA 2WP8J 1EU4A 5GAHC 4ZCKA 4JC0A 2MQHA 4P2CB 5I4DA 4K8JA 2K5NA 1BNZA 2ES2A 1AEXA 4LF5L 1A3TA 1TWGB 1I6VC 2ZM6Q 1U0LA 4DV7Q 1X3FA 3D6CA 1GUNA 2BDNA 3DMUA 4JI7Q 1HA5A 3OMCA 1S40A 5M5YB 1VQ5A 5I6YA 2MP1A 4I65A 1HQRD 2XNAC 4DR4Q 1PYWD 4R8NA 2ZXOA 3MVVA 2IHFA 2ZJQA 1DM0B 1TY2A 1JJ2A 1UE5A 3PUXA 2KCMA 2M9VA 1GUWA 1HZAA 2XGTA 3OIPA 5M5WB 5M9OA 2I0QA 1YEZA 3I3CA 1F9PA 4L5RC 3MFYA 1WOCA 1ICWA 4EQNA 5EBDA 2PW5A 3G71A 4OL7A 3S9WA 3KF6A 2ATWA 1MJEA 3H15A 1K8GA 1X3GA 1N32Q 4YWKA 4C3IB 4B9XA 5KIXA 3PUWA 3FVQA 1N33L 3DWPA 5EBCA 4KHPL 3EA6A 1DYQA 4RA8A 4A3BH 1HH2P 3LWUA 4HIDA 4ID6A 2NVTB 1E1OA 3SK6A 1XPOA 1KQSA 4GKJL 3W2DA 1D5MC 1TVXA 1WYDA 1JWSD 1QOHA 1E1TA 1QVCA 2OF1A 3G6EA 1AE2A 2J7ZA 2QDBA 2A68C 3A55A 1Q1BA 3SHLA 4HSVA 2KQ3A 4L8JA 4LF7Q 2PI2A 1HR0W 1ZKOA 1STNA 3HOUB 3PIO3 5IGDA 3EBEA 2QW7A 4A3FB 1GOZA 1YNNC 4C3HG 4DR1L 1DOKA 1SE3A 4K6DA 5BR8L 4JI1L 2DNEA 2F0UA 3N6RA 2MGSA 4EX5A 4BY1B 4EQPA 1C9OA 5DEHA 3STBD 4X64L 3S14B 1ILPA 2QGQA 2MPMA 3R93A 3HRZC 4BS9A 4KY6A 1B1ZA 2YTVA 4WJ4A 4IUNA 3MXUA 1SNQA 1EQTA 4S3SA 1BOSA 1SE8A 3HKZG 2F52A 4JCVE 4IFDG 3M7GA 4HIMA 2F4IA 1XNRQ 2Q8TA 1FR3A 4DR6L 3MTSA 4B3SL 3CCVA 1JWMD 1N9WA 1FD7D 3WOFA 2I5MX 4YHHL 3RR5A 2HHHQ 1KLUD 2A68D 5IGBA 2BA0A 4GOPA 1MBYA 1ONLA 5COYA 2JA5G 4HJ9A 1PRTB 4C2MH 3VYSA 1HXYD 1MHWC 1S5CD 4WORA 5EKKA 1YNND 3AFPA 4JYAL 1QNKA 1STBA 2VQFQ 2KCCA 4A75A 2Z9HA 2VQEQ 3H6MA 5FO8B 4KKSA 2EY1A 2F3IA 2WB1B 3UE0A 1E24A 1ILQA 5JJIA 2ZT9C 4DUYQ 3LX0A 3F1ZA 3NHHA 3GTOB 5I9OA 3WDNA 2E2IB 2A74C 3MEHA 1C4QA 5CGKA 3C2PA 4YY3Q 1VMCA 4H44C 1Y1WH 1PDQA 3I2ZA 3K5LA 2VB2X 1V1PB 1B44D 1L0WA 2Q2IA 2UUCQ 1D1IA 1YJNA 2C5CA 3EVQA 2RHQB 3AYHB 3SXHA 4ZK9B 2F0HA 4DUZL 5EKIA 5CV8A 3K6OA 2B39A 4AQYL 3PO2G 3LGJA 1PLFA 2B2YC 4BBRH 1ENFA 1FNWA 5CV9A 4KY5A 2ZTDA 3FPUB 2IY5B 4FP5D 1VQ6A 1GVPA 2RDHA 2CW0D 4A3MH 1UEAB 2I07B 1D6EC 2AMCB 2YV5A 1TY0A 2K05A 3G48A 3W1GA 5C4HA 1IW7C 2ZJRA 1YJ9A 4P72A 4XYOA 4QUCA 1PH6A 4JI4L 4DXFA 2R7ZH 3TEHB 3R2IA 1FJGL 5EQ0A 2QILA 4RCNA 1EIHA 4A3KH 5IYCG 3I4NH 4NP5A 1F9SA 1STAA 2RQXA 3HOWG 4CGYB 4IUUA 2TSSA 4OELB 3T56B 1LTBD 2UXBQ 4LFCL 4CKEA 5IGEA 4TKOB 4X66L 5C4XB 2F4VQ 1QE6A 4PQXA 2ASBA 1HFGA 4JI8L 1VQGA 2R93H 5H1SE 2AWOA 2ZXPA 3CC2A 2EY5A 1DD2A 1ZYRC 1OXUA 2K4KA 4AYBG 2B63H 2CFMA 1N34Q 1VQAA 3OWEB 1VQNA 5IT9L 3HOVH 4ZKCB 4ME5A 3BS1A 3QG1A 1Y14B 1SNMA 5DLQE 4BBSH 2WINB 2A6EC 3NSWA 3NBHA 4LFBL 2LMCB 2UU9Q 1EYCA 4GNXB 4O2DA 3KLSA 2R92B 1KLGD 1ZXTA 2CQOA 2F3VA 1IW7D 2PZUA 1SR3A 4QL5A 1F2MA 5D3DA 5C0XH 1VQDA 4F8MA 1JMCA 1JICA 1JJCB 4IALA 5EPKA 4LF4Q 3GTMB 1PYSB 2XN9C 3RN5A 3J80i 1VQPA 1IBLL 3H0GB 4HIKA 3K58A 3I8ZA 4A3DG 3PIP3 3MA2B 3K5OA 1QWYA 5LMNQ 4BY7B 2UUBQ 4LF9L 3BYTB 1PFBA 4K2LA 1D5ZC 1NMFA 3NWTA 3X3MA 1KDCA 3J7ZC 3HOYH 2G9HD 1ZYRD 1CSPA 4MTNA 4X3TA 2WACA 4IUPA 1XPRA 1R9TB 1X55A 4DV0Q 1WTRA 1A2TA 5JJKA 1VF7A 2L12A 4C1NI 1MJCA 1I6HB 5C44B 3UDXA 3I4MH 3S1RH 1VCIA 3M3YB 1PYBA 1LTGD 4DFAA 3C46A 1UE6A 2A6ED 3F8TA 3L7ZC 3J7AV 1Y1VH 4ULLA 1CFMA 1WI5A 3M4OB 1GD7A 2GA4B 3I73A 4JK1C 3FRPB 3UE1A 1JOQA 3U9OA 4CDFC 1DCZA 2EY2A 3JC66 4JI5L 3A5ZB 2L4NA 3C1EA 3MXNB 1FGUA 3F2UA 5GAGC 1J8IA 1D5XC 3PUZA 4IJLA 1VQ7A 1EY4A 1A63A 1T9HA 5LMNW 4NXMQ 4DV3L 2A6HC 1Q8IA 1EUJA 3KLSX 4R1JA 1JC7A 2P5ZX 3EIVA 1CKNA 3ZJYC 4J1MA 5GROA 1NTGA 4CKCA 4LF5Q 1SFOB 1HCZA 1U5KA 4K5WA 2JJQA 2ZXRA 2NVQB 1G91A 5JEAG 4LK1C 4G7OC 2CWAA 3AFQA 1BCPD 1JCKB 2JA8B 1Q12A 1E7ZA 2PMZB 2UUAL 4R4OA 1QCBD 3GDEA 4DF7A 1FNUA 2AUJD 5IP7H 3BJUA 4X6AH 1B50A 2OXPA 3IAYA 4ZAIA 1P16A 2PQEA 2Z4HA 2Z6BA 4HAEA 2WB1E 2IX0A 3TS2A 4XQJA 2K5WA 2Z6KC 3V96A 1KC8C 5C3EH 2JA6B 4F7XA 3CPWA 1RF2D 1CUKA 3GD7A 2A6HD 3RLOA 4F88A 5BN3A 2VUMG 2GVAA 1GUGA 4LUZA 1K3BC 4FNFA 1JE5A 1I4GA 5C4JH 3CCJA 3IKJA 1OO9B
chains in the Genus database with same CATH topology
5K36H 3A7LA 3TDQA 1G2TA 4CHTB 3K5NA 1RJTA 3DHQA 1PTOC 4XDXA 1RKNA 3NQTA 1E0BA 4LJZC 4FF4A 4C56C 4N9TA 4C3JG 3RUZA 1S5BD 3V2TA 2RDGA 2FFKB 2EPBA 4L6TB 1PMRA 2LS01 2KUMA 2QCPX 3E5SA 2KECA 3NPPA 2ICEC 1WTXA 3RD4A 3RLFA 2EXZA 3MHBA 2EZVA 4K2KA 1KABA 4KN4C 2F0MA 4IURA 2NBFA 3TZUA 1PTOD 4DNRB 5KRUA 5FO9B 5KYIA 1X3QA 4A3BB 5E4XA 2BA1A 2NB0A 2N88A 2F03A 1TS4A 2X6GA 1KDAA 3QB3A 2A69C 5FK9C 1GJXA 3MFGA 1Z6HA 2XVSA 4X3SA 2IWHA 3KK7A 4CJ1B 2H4OA 3JAME 4Q5VA 1A2UA 2YYZA 5EPLA 1HTPA 3X3NA 3TBIB 3P20A 5FOBB 1LO5D 2EJFC 1LTID 1SDFA 3H3VC 5NUCA 2CQAA 3T4AC 3D4RA 4C3IG 5CV6A 1NR4A 2KVMA 1B3AA 3L9AX 3P1HA 1ZEQX 5KGUA 4IFDH 2K6AA 4DGZA 2CVRA 4RGNA 2KOLA 2A69D 4C2MB 2IT1A 3PMFA 2NUCA 2E2DC 1SSOA 4EVOA 2B2UC 1TKWB 2JA7B 2A5HA 4MHEA 1E2VA 2JE6I 2SOBA 3LNNA 1HUMA 1Y8PB 1Y1WB 4KI0A 2NN6G 3TP5A 1PRTC 2XRQD 3CKIB 3Q22A 5I6WA 1G291 3DM1A 4BBRB 5CC4A 4B08A 5HURA 1EWCA 2EYMA 4A3MB 2KA7A 5KNDA 3SK5A 2MHVA 4FXKC 4HCSA 2R7ZB 3Q24A 3NTIA 2K01A 2N55A 2PNRC 4A3KB 3I4NB 2O5JC 4QF4A 3VR4A 1VMPA 1SXTA 2R93B 1CZGA 3NP8A 1DJRD 2R3ZA 1PRTD 3KF8A 2B63B 2B2TC 3QOJA 2E75C 3HOVB 2V4DA 3BVMA 2KCNA 4DK0A 2HCCA 1HPCA 3VYUA 1F2YA 4XQNA 4BBSB 1SYGA 4K8IA 3BG3A 4XXEA 2K1BA 1LABA 3I4LA 1IHZA 5C0XJ 3D8GA 4RAUC 2TMPA 3K59A 2D2CC 1M4VA 3MAQA 1STGA 3A54A 1LTTD 3HOYB 1WTPA 3I70A 5TSSA 5IODA 1PTOF 1EOTA 2XSCA 1S5FD 3CU7A 4XT1B 3I4MB 3S1RB 2I46A 1U4PA 1U4LA 2EYHA 2Z1CA 2O4XA 3TMEA 1WTQA 1Y1VB 4QCLA 5FLXL 4KD4A 4FXDA 4HMIA 2LY7A 1O7LA 4LAAA 1F9QA 2F0KA 1UAPA 1AZQA 3DWAA 4OO1H 1BXTA 2B2VC 4N9PA 3AMUA 4MN3A 2SEBD 3P75A 3KBXA 1G2SA 3K0YA 3JAML 1RTOA 3I90A 1H9SA 2BDOA 2D9UA 2MJ8A 2SNSA 1LACA 5JEAH 1QB5D 1GHKA 3SK8A 5FO7B 1KTKA 5IGCA 1STHA 4LMQD 4KK7A 3VA7A 1IKLA 3MXGA 1VDZA 1CHPD 3I72A 2NWGA 1ET6A 4F87A 5C3EB 1B2TA 5K5PA 4FVMA 3BVZA 5C4JB 2L5TA 1SNOA 1SYDA 3OHXC 4KKUA 3EJIA 2K32A 1EEID 4KHVA 1EL0A 3BDCA 5KNBA 1XWEA 1KNEA 1AZPA 4R9WA 3A56A 4RCOA 2NTSA 1DZ1A 3G6JB 4RWSC 3J80L 3DEOA 3GV6A 5I2XA 1S5ED 2F0QA 4DU9A 2F0OA 1I4QA 3J81E 4IUTA 4R8IA 5EKLA 3FPPA 4KJOA 2K5DA 2IL8A 2B2YA 2K7VA 5ELCA 5CBAE 2EOTA 1BDOA 1G6ZA 1T5EA 3GTLB 1BQQT 1QILA 1GXDC 1SE2A 2XRSD 5F2DA 4FO2A 1PRTF 1I4RA 1SJED 3NXWA 4RGOS 4CJ2C 1JR0D 2D62A 5LL6S 4HSPA 1SBBB 2OT2A 2JEAI 3SVMA 1MSGA 2PZWA 2B8FA 1SYCA 3BDOA 1QG7A 1JOKA 2F1MA 3NQIA 1EQVA 2IW3A 1HFNA 3PV0A 1F2LA 1K83B 3GTGB 1S4ZA 1TS3A 4X3UA 1Z7TA 2KHSA 1XXGA 2FHTA 3GO5A 4HTHA 1WTVA 4HMJA 2EJGC 1Y69U 3M85A 4UDUC 2O5IC 4XIGS 4KY7A 1CQFA 4A3JB 3S1MB 4RKLA 3HKZB 2IJ0A 1Q1EA 1C8CA 4E6IA 5J22A 4IFDJ 4FYDA 1EY6A 2R61A 3FKIB 5LL6X 1V1OA 1XX8A 3KLRA 2WV6D 2F0TA 4RGTA 3PUYA 1B9MA 1EY8A 1TQOA 5BN5A 4DN4M 5JAVA 1LTRD 1ESFA 1E2ZA 4A3EB 4ZYSA 3D6WA 4ILWA 4FXGC 3QOLA 4DXGA 3OOCA 2WKDA 3AU7A 1O78A 4BA2I 5CV7A 1II3A 1HQMC 3SK4A 2IX1A 1HUNA 3SDZA 1JORA 1SJHD 4U68A 1OXTA 2Z8LA 1M8AA 1JB3A 1R4PB 1TT2A 2EYJA 2A73B 5C3WA 1OXSC 2DN8A 1J9OA 2CHBD 1V43A 2BCOA 5M3FB 2SDFA 1KAAA 3NWSA 1TWCB 5C3XA 1X3PA 3OIQA 1A3UA 3KUPA 3T16A 1OXXK 4H13C 4FF2A 4KV6A 3HOWB 3N52A 2F0GA 3MXPA 4HEDA 4WJWA 5KYLA 1A6XA 3ITPA 1W6JA 1CM9A 4RGMA 1CZWA 4OHJA 1BO0A 3Q6SA 3TP6A 3NBIA 3DWQA 3A8JE 1B53A 3HEJA 3GP7A 4RH6A 3QIAA 2KEDA 5E3FA 4TRDA 1QNUA 4WFN3 4KKTA 2ENBA 3BZDB 2PCFB 5CV5A 5E1FA 5FLXE 2RKSA 3C3LA 3J81L 2J4XA 4PMWA 1NUCA 2EE1A 5C0XI 1EFID 4MIUA 1CA6A 2K03A 5C6AA 4G57A 2J0TD 2Q8IB 1EYAA 3HG9A 1H9KA 4KTAA 1LT6D 5C0XG 1H9MA 2D5DA 3H09A 1LV9A 4RHSA 1BCPB 3S2HB 1BUVT 4CJ0B 2DY7A 3CHBD 4GZYC 4PNYA 1SAPA 1GUSA 1TR5A 2DNCA 1BR9A 2AUKA 1U9RA 3QO2A 3VA5A 5C5MA 1SNDA 3QWNA 5I9PA 1YNJC 1DOMA 2RVLA 5CYUA 5ISRA 3FMCA 2YU9B 2SNMA 2EJMA 4A3IB 5ELFA 5JEAJ 1NSNS 1EZ8A 3TSSA 3HGBA 1ENCA 5ELDA 5M5XB 1PZJD 1WCMB 3P7JA 3LWEA 2KJXA 2B2WC 3S16B 1VF5C 3C1FA 5JPMC 2VUMB 1F9RA 3SE0A 1SEBD 2JP1A 3WOEA 4A3GB 2AQ2B 1YNJD 1L0YB 3J80E 2LFNA 1XTCD 3V05A 1MSHA 2X6LA 3U9SA 1E2WA 2B2UA 1O80A 2FMCA 2JXMB 5DM73 3PO3B 4M8AA 4HCEA 1CHQD 3TP8A 2F0VA 1GUTA 4WRDA 4C3JB 1O7ZA 3E0JA 3D4WA 1STEA 3D4DA 1QJOA 4OIKA 4NW2A 3M7NA 2AWNA 2VXWA 2E76C 5BN4A 2E2JB 4A93B 5EPJA 3GQBA 4J6HA 5KNCA 1SMYC 4QB4A 1A3VA 3FEWX 3A8KE 1Z47A 1V1PA 4PMBA 2Q8RE 1CT1D 3SEBA 1SNCA 2ID0A 3CRLC 5G3LD 1LTSD 1TWAB 5CBEE 2K33A 1EY7A 3VR5A 5A2QE 2B2TA 1EWHA 2VB3X 2F0EA 1LTAD 1L0XB 1MGSA 3BVGA 1MD2D 3ONAB 5JJZA 1RCVD 5CR3A 1D2BA 3IFDA 1AP0A 2R6GA 3PUVA 4RKBA 4HR7B 1SMYD 1T5XD 3S1QB 1Y8NB 3J7AF 3CRKC 1O7YA 2FMMA 3Q0AA 2L9HA 5D3IB 3KBGA 4IN3A 1EY0A 1EU3A 5DAUA 5D14A 5M3MB 2L11A 4QUFA 3HOZB 1NR2A 1KNAA 4H0LC 3GTQB 1RTNA 1KDBA 1TU2B 5EJWA 4XTCS 2NYZD 2WAQB 1XYIA 4IFDI 1CK1A 5FKAC 1JOOA 5DM63 4UAIA 1R4QB 4DAPA 1G8ZD 2F0NA 4YIJA 3G7LA 4IQZA 2B2VA 1CI3M 1EYDA 5ELEA 1HA6A 4Q0FA 3URYA 1LT5D 4HN7A 2CW0C 2L55A 2F0SA 4KHZA 5HGTA 1UUPA 2DY8A 2F0DA 1LT3D 1WVLA 1RDPD 2G9DA 5I2YA 2F0WA 2X69A 3NUCA 3MXNA 3ZYYX 4PV1C 1DXMA 1JE4A 5CMDA 3OW7A 2F3WA 1RODA 5C4ZA 4X3KA 3S17B 1IL8A 1B4OA 4G4KA 4Z9CB 1PTOH 4EQOA 2JSOA 5J1ZA 1TS5A 1PFMA 1SYFA 4ABNA 4QMGA 2KEEA 4XQQA 1HHVA 3H91A 4IUQA 2K28A 4RHRA 2EY6A 4DNTB 3RMHA 3HP3A 3DXJC 3TZDA 3D31A 1D1KA 1SE4A 2HUGA 1TS2A 3RZDB 1DONA 4KN7C 2EVBA 3GTJB 3BDLA 1TWFB 2PW7A 1PZKD 3E6ZX 5T1GA 4ZUIA 1BBXC 4DA2A 4CKBA 3MWYW 5T1IA 2HDMA 2PYKA 1MI2A 4OGQC 4G7HC 2M00A 5JPNC 2C9OA 2IX3A 4C1NK 1Q3LA 3DEPA 1H9RA 5IGFA 2F0LA 1H9SB 3EQLC 3GTKB 5G3LF 4C3HB 1GUOA 1W6KA 1Y8OB 3GV3A 2JYOA 1X32A 4JBWA 3IL8A 2NZ1D 2M2LA 1K8MA 4XT3B 4DK1A 5A2QL 2VNUD 4ZQ3A 3I91A 4TQUS 1B9NA 2BOSA 2Y0SB 3EFXD 3NE5B 1SYBA 1STYA 2B8GA 4ZLTF 2PO4A 4OO1I 3ERQA 1PFNA 1WD1A 1BCPC 2JA5B 1C48A 2E2HB 3S1NB 3A7AB 1EY5A 2K04A 4OO1G 1CTMA 1NAPA 3OMGA 2PZTA 2QKIC 1IYVA 1AW7A 1PXUA 1GHJA 1U4RA 5J39A 3R8BA 3RZOB 3VR2A 3D3RA 3MZ5A 3CQZB 4K14A 1HRJA 4NKLA 1CQVA 2NN6H 4V190 4EGVA 3PO2B 3ND8A 2L1BA 1AN8A 4M1UB 4FF1A 3MC0B 4QIWB 2F0PA 3W3AA 4J8QA 3DUZA 1F2ZA 1FNVA 4K5XA 1U4MA 1JQYD 1SNPA 2OEOA 2PPBC 5IOCA 2AQ3B 3EROA 2NTTA 4ZUJA 5CV4A 3S2DB 4IUVA 4ZRZA 3FDTA 4B9WA 4V0BA 4KJNA 1WTOA 5D65A 2XWBB 1K8OA 1FGBD 4IZ8A 4AYBB 4DAYA 4H7BA 1WD0A 3T13A 2JEBI 5A35A 3HZXA 3HOXB 3R3OA 5DNFA 1EEFD 3J7YW 4I7ZC 4KD3A 1RD9D 5C5LA 2FINB 3UI2A 2NVXB 3VYRA 4OIJA 1LLRD 5AFWA 4L63B 4DAVA 4G7ZC 5EGTA 1EIGA 4K5VA 4A3DB 2XWJB 2XIWA 1I4PA 5JVG3 2RSOA 3VR6A 2L0CA 2F0JA 4NMZA 2EYFA 2EYLA 4XYQA 3K7AB 2F0FA 1IKMA 1BF4A 5IGGA 1RHPA 2RDFA 3NK9A 2BE5C 5ELBA 4PMCA 1UNSA 3OWFA 1ML0D 4K6LA 2Z4IA 2QEJC 1F77A 5IIFA 3AB9A 4U673 3HS0C 3QJYA 3K5MA 4Y7NB 3T53B 3VR3A 2WIIB 1DOLA 2MUYA 1EZ6A 3A8IE 5JVH3 1I50B 2ICIA 2HQEA 4O42A 1PZID 4BA1I 1EY9A 2LKVA 3S15B 3H94A 3O13A 4CBVA 1NCVA 2BE5D 2RBMA 3SR1A 1TIID 1TWHB 2EYPA 1A15A 1S5DD 4TSSA 3T51B 2NVYB 2IPKD 3TP7A 3GTPB 1OXVA 2H1EA 4FF3A 1SYEA 3OSOA 4BWGB 4NDXA 1Q90A 2K5QA 5KEEA 1CA5A 1H9JA 2E74C 1IYUA 1I4HA 5CORA 2AQ1B 2RSNA 1FYCA 1AFPA 3ND9A 2NN6I 5JOBA 4RFBA 3K57A 5E4WC 2RA4A 1ET9A 3NTKA 1ENAA 3Q23A 1JWUD 4O1NA 1V8QA 1WTWA 3BYYB 2F0IA 3OPOA 5LHY1 1ESRA 1BCPF 1LT4D 1PTOB 2QF7A 3NTHA 4ZKBB 1HTLD 2B2WA 2O2LD 3L3OC 3VYTA 1I3QB 3IFTA 2HDLA 1I4XA 3TN2A 2HCIA 2FJ2A 2WKCA 4KMUC 5K36G 5IT9E 4ODGA 3R2TA 2EDGA 3M4YA 2EYOA 2WP8J 1EU4A 4P2CB 5I4DA 4K8JA 1BNZA 1AEXA 1A3TA 1TWGB 1I6VC 3D6CA 1GUNA 2BDNA 3DMUA 1HA5A 3OMCA 5M5YB 5I6YA 2MP1A 4I65A 1HQRD 2XNAC 1PYWD 4R8NA 2ZXOA 3MVVA 1DM0B 1TY2A 3PUXA 2M9VA 1GUWA 3OIPA 5M5WB 5M9OA 3I3CA 1F9PA 3MFYA 1ICWA 4EQNA 5EBDA 2PW5A 4OL7A 3S9WA 4C3IB 5KIXA 4B9XA 3PUWA 3FVQA 3DWPA 5EBCA 3EA6A 1DYQA 4RA8A 3LWUA 4ID6A 2NVTB 3SK6A 3W2DA 1D5MC 1TVXA 1JWSD 1QOHA 2OF1A 2J7ZA 2QDBA 2A68C 3A55A 1Q1BA 3SHLA 4HSVA 2KQ3A 4L8JA 1ZKOA 1STNA 3HOUB 3PIO3 5IGDA 4A3FB 1GOZA 1YNNC 4C3HG 1DOKA 1SE3A 4K6DA 2DNEA 2F0UA 3N6RA 2MGSA 4BY1B 4EQPA 5DEHA 3S14B 1ILPA 2MPMA 3R93A 4BS9A 3HRZC 4KY6A 1B1ZA 4IUNA 3MXUA 1SNQA 1EQTA 4S3SA 1BOSA 4IFDG 3M7GA 2F4IA 2Q8TA 1FR3A 3MTSA 1JWMD 1FD7D 3WOFA 1KLUD 2A68D 5IGBA 2BA0A 1MBYA 1ONLA 5COYA 1PRTB 3VYSA 1HXYD 1S5CD 4WORA 5EKKA 1YNND 1QNKA 1STBA 2KCCA 3H6MA 5FO8B 4KKSA 2EY1A 2WB1B 1ILQA 2ZT9C 3LX0A 3NHHA 3GTOB 5I9OA 3WDNA 2E2IB 2A74C 3MEHA 1C4QA 5CGKA 3C2PA 1VMCA 4H44C 1PDQA 3K5LA 2VB2X 1V1PB 1B44D 1D1IA 2C5CA 3EVQA 3SXHA 4ZK9B 2F0HA 5EKIA 5CV8A 3K6OA 2B39A 1PLFA 2B2YC 1ENFA 1FNWA 5CV9A 4KY5A 3FPUB 4FP5D 2RDHA 2CW0D 1UEAB 2I07B 1D6EC 1TY0A 2K05A 5C4HA 1IW7C 4XYOA 4QUCA 4DXFA 3R2IA 5EQ0A 2QILA 4RCNA 1EIHA 4NP5A 1F9SA 1STAA 2RQXA 4CGYB 4IUUA 2TSSA 3T56B 1LTBD 4CKEA 5IGEA 4TKOB 5C4XB 1QE6A 4PQXA 1HFGA 2AWOA 2ZXPA 2EY5A 1DD2A 1ZYRC 1OXUA 3OWEB 5IT9L 4ZKCB 4ME5A 3BS1A 3QG1A 1SNMA 2WINB 2A6EC 3NSWA 3NBHA 2LMCB 1EYCA 2R92B 3KLSA 1KLGD 1ZXTA 2F3VA 1IW7D 2PZUA 1F2MA 5D3DA 5C0XH 4F8MA 1JICA 4IALA 5EPKA 3GTMB 2XN9C 3H0GB 3K58A 3I8ZA 3PIP3 3MA2B 3K5OA 1QWYA 4BY7B 3BYTB 1PFBA 4K2LA 1D5ZC 3NWTA 3X3MA 1KDCA 2G9HD 1ZYRD 4X3TA 2WACA 4IUPA 1R9TB 1WTRA 1A2TA 1VF7A 2L12A 4C1NI 1I6HB 5C44B 1VCIA 3M3YB 1LTGD 4DFAA 3C46A 2A6ED 3L7ZC 3J7AV 4ULLA 1CFMA 3M4OB 2GA4B 3I73A 4JK1C 3FRPB 1JOQA 3U9OA 1DCZA 2EY2A 2L4NA 3C1EA 3F2UA 1J8IA 1D5XC 3PUZA 1EY4A 2A6HC 1Q8IA 3KLSX 1JC7A 4J1MA 4CKCA 1SFOB 1HCZA 4K5WA 2ZXRA 2NVQB 1G91A 5JEAG 4LK1C 4G7OC 1BCPD 1JCKB 2JA8B 1Q12A 2PMZB 1QCBD 4DF7A 1FNUA 2AUJD 1B50A 2OXPA 3IAYA 4ZAIA 2PQEA 2Z4HA 4HAEA 2IX0A 4XQJA 2K5WA 3V96A 2JA6B 4F7XA 1RF2D 3GD7A 2A6HD 4F88A 5BN3A 1GUGA 4FNFA 1I4GA 3IKJA 1OO9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXT A;  2ZT9 C;  1Q90 A;  5K36 H;  3A7L A;  3MFY A;  4G7Z C;  2JXM B;  1H9J A;  3A7A B;  2Q8I B;  3WDN A;  1LAC A;  2D62 A;  4OO1 G;  1CTM A;  4H44 C;  2E75 C;  5JEA H;  1H9K A;  2V4D A;  2E74 C;  4IFD H;  1IYU A;  4DK0 A;  2JEA I;  1OXS C;  4DNT B;  5C0X G;  1HPC A;  1VF7 A;  1GHK A;  2DN8 A;  1H9M A;  2D5D A;  4H0L C;  1IYV A;  1FYC A;  3DXJ C;  1GUT A;  1TU2 B;  3D31 A;  1GHJ A;  3ND9 A;  3VR6 A;  2NN6 I;  1V43 A;  4XTC S;  1VCI A;  3PUW A;  4LJZ C;  3VR2 A;  3VA7 A;  2A6E D;  2B8F A;  3L7Z C;  3LWU A;  4KN7 C;  2A69 D;  2EVB A;  3BDO A;  1QJO A;  1CFM A;  2F1M A;  3BG3 A;  1VDZ A;  3M7N A;  2IT1 A;  3I73 A;  4JK1 C;  3I72 A;  2E76 C;  2NN6 H;  1LAB A;  1V8Q A;  3PV0 A;  3I4L A;  1DCZ A;  5BN4 A;  4GZY C;  2A68 C;  1Q1B A;  1GUS A;  1Z7T A;  3OPO A;  2DNC A;  1PMR A;  1OXX K;  2EJG C;  4H13 C;  4L8J A;  1Y69 U;  2QF7 A;  1IW7 C;  3ND8 A;  2AUK A;  2BE5 C;  1ZKO A;  3PUZ A;  1TKW B;  3M85 A;  3RLF A;  1YNN C;  4RCN A;  3GQB A;  2D2C C;  2L5T A;  4KKU A;  1A6X A;  4OGQ C;  5KNC A;  2O5I C;  1SMY C;  2K32 A;  4IQZ A;  4XIG S;  2DNE A;  1E2V A;  1YNJ C;  2A6H C;  2JE6 I;  1CI3 M;  4G7H C;  3IFT A;  3A8K E;  3T56 B;  3LNN A;  4KN4 C;  3N6R A;  1Y8P B;  3W3A A;  1H9R A;  3AB9 A;  3FMC A;  4KI0 A;  4TKO B;  5KNB A;  1Q1E A;  3QJY A;  4KMU C;  1H9S B;  5K36 G;  2NN6 G;  2EJM A;  3EQL C;  2AWO A;  3T53 B;  3VR3 A;  1HCZ A;  3TZU A;  3MXU A;  4DNR B;  2PPB C;  1DD2 A;  1GUO A;  3CRL C;  1ZYR C;  1OXU A;  2CW0 C;  2EDG A;  3A8I E;  1Y8O B;  3M4Y A;  5JEA G;  4LK1 C;  4G7O C;  4IFD G;  4KHZ A;  3KLR A;  1G29 1;  2K33 A;  3A8J E;  3HGB A;  4JBW A;  1Q12 A;  1FR3 A;  3VR5 A;  1EWH A;  1K8M A;  3QIA A;  2BA1 A;  3QG1 A;  3PUY A;  1B9M A;  4DK1 A;  1O7L A;  1K8O A;  2KA7 A;  2AUJ D;  4BA1 I;  1I6V C;  2A6E C;  5BN5 A;  2A68 D;  2LMC B;  4KKT A;  5KND A;  2A69 C;  2BA0 A;  4TQU S;  1B9N A;  1ONL A;  4PV1 C;  4OO1 H;  1GJX A;  1DXM A;  1VF5 C;  2PCF B;  1GUN A;  1IW7 D;  3FPP A;  1Z6H A;  2R6G A;  3H94 A;  2BE5 D;  3NE5 B;  3PUV A;  2JEB I;  5A35 A;  5C0X H;  3OW7 A;  4HR7 B;  2PNR C;  1E2Z A;  2O5J C;  3SE0 A;  2K7V A;  2YYZ A;  2B8G A;  1HTP A;  3T51 B;  1BDO A;  1T5E A;  3P20 A;  4I7Z C;  3GD7 A;  2A6H D;  5BN3 A;  1OXV A;  2KCC A;  3OOC A;  3VR4 A;  1GUG A;  1O78 A;  1Y8N B;  2EJF C;  4BA2 I;  1HQM C;  1H9S A;  3PUX A;  4KKS A;  3SDZ A;  3CRK C;  2BDO A;  3IKJ A;  3U9S A;  3D4R A;  1E2W A; 
#chains in the Genus database with same CATH topology
 5K36 H;  3A7L A;  3M4Q A;  3TDQ A;  1G2T A;  4GKJ Q;  4CHT B;  3K5N A;  3Q8D A;  1A8V A;  1RJT A;  2UXC Q;  3DHQ A;  5IWA Q;  3CCE A;  1PTO C;  4DV2 Q;  4XDX A;  1RKN A;  3NQT A;  4GLV B;  3PO3 G;  1E0B A;  4LJZ C;  1FVI A;  3K8A A;  3A0J A;  4FF4 A;  4C56 C;  4N9T A;  1QZG A;  4DR1 Q;  4C3J G;  3RUZ A;  4JI1 Q;  1S5B D;  3V2T A;  2RDG A;  2FFK B;  2EPB A;  4L6T B;  2E5L L;  1PMR A;  2LS0 1;  2KUM A;  2QCP X;  3E5S A;  2KEC A;  4X64 Q;  1D7Q A;  1BVS A;  3NPP A;  3H3V I;  2ICE C;  1XMQ L;  2Z0S A;  1WTX A;  3RD4 A;  2R7D A;  4P71 A;  2CWP A;  3RLF A;  1EFW A;  2EXZ A;  3MHB A;  3J7A 5;  2EZV A;  4B3R L;  3GTL H;  4K2K A;  1KAB A;  2KBN A;  4A3C G;  1EQR A;  4KN4 C;  4NXN Q;  1BBU A;  4DR6 Q;  4B3S Q;  2CCZ A;  2F0M A;  4IUR A;  2NBF A;  4YHH Q;  3TZU A;  1PTO D;  4DNR B;  5KRU A;  1L1O A;  1PH3 A;  4QQB X;  4B3M L;  5FO9 B;  5KYI A;  1X3Q A;  4DPG A;  4A3B B;  5LMU Q;  1KAW A;  5E4X A;  2VY3 A;  3TS0 A;  2BA1 A;  2NB0 A;  2N88 A;  2F03 A;  1TS4 A;  2X6G A;  1KDA A;  3QB3 A;  4HJ8 A;  4DR2 L;  2A69 C;  5FK9 C;  1GJX A;  3MFG A;  3L2P A;  1VQO A;  1ASZ A;  3NEN A;  4DV4 L;  1Z6H A;  2XVS A;  4X3S A;  3OTO L;  2IWH A;  3KK7 A;  4NB3 A;  2H4O A;  4CJ1 B;  3JAM E;  1K83 H;  1A2U A;  2YYZ A;  5EPL A;  1ICF B;  4Q5V A;  1XTD A;  3GTG H;  3GTK H;  1HTP A;  3TBI B;  3X3N A;  3P20 A;  5FOB B;  1LO5 D;  2Y0S E;  1KD1 C;  4OON A;  2EJF C;  1LTI D;  1SDF A;  1Q8K A;  3H3V C;  5NUC A;  2CQA A;  3T4A C;  3D4R A;  4DUZ Q;  4C3I G;  5CV6 A;  4AIM A;  1NR4 A;  2KVM A;  3J81 i;  4AQY Q;  1B3A A;  3L9A X;  4A3J H;  3S1M H;  3P1H A;  1ZEQ X;  1NBW A;  5KGU A;  4IFD H;  4X65 Q;  1PH7 A;  2K6A A;  4DGZ A;  2CVR A;  5M3M G;  3FKI H;  4RGN A;  2KOL A;  1VQI A;  3CF5 A;  2A69 D;  3HOU G;  2R7F A;  4A3F G;  4C2M B;  2IT1 A;  3PMF A;  1KRS A;  1LUZ A;  2NUC A;  2VW9 A;  4LFC Q;  1TXY A;  4BY1 G;  4X66 Q;  2E2D C;  5GQO A;  4DAY B;  1SSO A;  4EVO A;  2B2U C;  3PSI A;  1TKW B;  2GN5 A;  2JA7 B;  3BZC A;  5IYB H;  2A5H A;  4MHE A;  2UXD Q;  4GLA C;  1E2V A;  2JE6 I;  2SOB A;  4UP9 A;  3LNN A;  1HUM A;  1SRU A;  1Y8P B;  5FJ8 G;  1Y1W B;  4KI0 A;  4OXP A;  1PH5 A;  1E22 A;  2NN6 G;  3TP5 A;  4KLK A;  1PRT C;  2XRQ D;  3CKI B;  3Q22 A;  3CCL A;  4BXX G;  1IZ6 A;  1E3P A;  5I6W A;  1G29 1;  3DM1 A;  4BBR B;  1VQ8 A;  5CC4 A;  4GS3 A;  4B3T Q;  1C0A A;  5HY6 A;  2PQA B;  1IBL Q;  1A62 A;  4B08 A;  5HUR A;  1EWC A;  2EYM A;  4OX9 Q;  4A3M B;  2KA7 A;  5M3F H;  5KND A;  4JBK A;  4LF9 Q;  3SK5 A;  2MHV A;  4FXK C;  4HCS A;  1TWC H;  2XTI A;  2R7Z B;  3Q24 A;  2WB1 G;  3NTI A;  2K01 A;  2N55 A;  2PNR C;  4DK6 C;  4A3K B;  3I4N B;  2O5J C;  3ULL A;  1J6Q A;  4QF4 A;  3VR4 A;  1L1O B;  3HOW H;  3KYH C;  1VMP A;  3S2D H;  4UP7 A;  1SXT A;  2R93 B;  1CZG A;  3NP8 A;  1DJR D;  4P74 A;  2R3Z A;  1PRT D;  3KF8 A;  4POF A;  1HNZ L;  2B63 B;  2B2T C;  3QOJ A;  1J5E L;  1JB7 A;  1XMO Q;  2E75 C;  4GKK Q;  3HOV B;  2V4D A;  3BVM A;  2KCN A;  4DK0 A;  3ER0 A;  1S3O A;  2HCC A;  1HPC A;  1HZB A;  3VYU A;  4GLX A;  1HR0 Q;  4GN5 A;  1F2Y A;  4RG1 A;  2OQ0 A;  4XQN A;  4BBS B;  1WFQ A;  3PIP A;  1WTH A;  1SYG A;  4JI3 Q;  4K8I A;  1SLJ A;  3BG3 A;  4XXE A;  2N3S A;  2K1B A;  1LAB A;  3I4L A;  1Q82 C;  1IHZ A;  4L5Q A;  5C0X J;  3D8G A;  4RAU C;  2TMP A;  4A3D H;  3K59 A;  2D2C C;  2CKZ B;  1M4V A;  3MAQ A;  1STG A;  4IJH A;  3A54 A;  1LTT D;  3HOY B;  1WTP A;  3I70 A;  5TSS A;  3CXC A;  4P73 A;  5IOD A;  1PTO F;  1EOT A;  2XSC A;  4GNX C;  3T1Y L;  1S5F D;  3CU7 A;  4XT1 B;  4DV1 L;  3BZK A;  5IE8 A;  3S1R B;  3I4M B;  2I5H A;  2I46 A;  1U4P A;  1U4L A;  2R92 G;  2EYH A;  2Z1C A;  2O4X A;  3TME A;  4R4C A;  1Y1V B;  1WTQ A;  4QCL A;  5FLX L;  1VQM A;  4KD4 A;  1KXL A;  3QR8 A;  4FXD A;  4HMI A;  4JOI C;  4DR5 Q;  2LY7 A;  1O7L A;  1BKB A;  4LAA A;  4QJF A;  1DGS A;  2QEX A;  1F9Q A;  2F0K A;  1UAP A;  3S2H H;  1AZQ A;  2OQK A;  3DWA A;  4OO1 H;  1BXT A;  3DM3 A;  3UDI A;  4K0K Q;  3ICE A;  2B2V C;  4N9P A;  3AMU A;  4MN3 A;  4JW0 A;  1IL2 A;  2SEB D;  1CKM A;  4MZ9 A;  3P75 A;  4Y7N H;  3KBX A;  1UE7 A;  1G2S A;  2Y0S G;  3K0Y A;  1HNW L;  3JAM L;  4YWM A;  1RTO A;  3I90 A;  1PA6 A;  1H9S A;  2Q2T A;  2BDO A;  2YTX A;  4FDB A;  2D9U A;  3I4O A;  2MJ8 A;  4AH6 A;  1EIY B;  2SNS A;  1LAC A;  1YNX A;  4IPC A;  5JEA H;  1N36 Q;  1QB5 D;  4IPD A;  2YU9 H;  1GHK A;  3SK8 A;  4A3I H;  5FO7 B;  1KTK A;  4EQ5 A;  5IGC A;  3J81 j;  3NEL A;  1STH A;  3F2C A;  3T1H L;  4LMQ D;  4KK7 A;  3VA7 A;  2G5D A;  3KJO A;  1IKL A;  2JN4 A;  3MXG A;  1VDZ A;  5M5X H;  1CHP D;  3I72 A;  2NWG A;  4WJ3 M;  1ET6 A;  1WCM H;  4B3R Q;  4F87 A;  5C3E B;  1B2T A;  5K5P A;  2HQL A;  1D8L A;  4FVM A;  5FLM H;  2A19 A;  3S16 H;  3BVZ A;  2VUM H;  5C4J B;  2L5T A;  1SNO A;  1SYD A;  3OHX C;  4KKU A;  3EJI A;  2K32 A;  1QVG A;  1EEI D;  4A3G H;  4KHV A;  1EL0 A;  3BDC A;  2JA8 G;  1IBM L;  5KNB A;  1XWE A;  1KNE A;  1AZP A;  1K28 A;  4DR2 Q;  4R9W A;  2EIF A;  2LXK A;  4JI2 L;  4DR3 L;  3PO3 H;  2MNA A;  3A56 A;  2I5L X;  4RCO A;  2NTS A;  1AE3 A;  3E9I A;  3OTO Q;  1DZ1 A;  3KF6 B;  3G6J B;  4RWS C;  2JA6 G;  4C3J H;  3J80 L;  3AEV A;  3DEO A;  3GV6 A;  5I2X A;  3KJP A;  1MKH A;  1S5E D;  2F0Q A;  4DU9 A;  2F0O A;  1I4Q A;  3J81 E;  1XNQ L;  4IUT A;  4IPH A;  4R8I A;  5EKL A;  3FPP A;  1PHJ A;  4KJO A;  2K5D A;  3CCQ A;  2IL8 A;  1I94 Q;  3RNU A;  2B2Y A;  2K7V A;  5ELC A;  5CBA E;  4POG A;  2E2J H;  2EOT A;  1BDO A;  1G6Z A;  1T5E A;  3GTL B;  1BQQ T;  1IXR A;  1QIL A;  4A93 H;  1GXD C;  2K50 A;  1SE2 A;  2XRS D;  4PG3 A;  5F2D A;  3HOX G;  4FO2 A;  1PRT F;  1I4R A;  1SJE D;  2RCN A;  3NXW A;  4RGO S;  4CJ2 C;  1JR0 D;  3ULP A;  2D62 A;  5LL6 S;  4HSP A;  1SBB B;  2OT2 A;  2JEA I;  2BH2 A;  3K81 C;  3BU2 A;  3SVM A;  4ALP A;  1MSG A;  1TWA H;  2PZW A;  2B8F A;  1SYC A;  3BDO A;  1QG7 A;  4PZ7 A;  1JOK A;  2F1M A;  3NQI A;  4LF8 Q;  4YCW A;  1EQV A;  2IW3 A;  1HFN A;  1Z9F A;  1V1Q A;  3PV0 A;  1F2L A;  1K83 B;  3GTG B;  1S4Z A;  1TS3 A;  4X3U A;  1Z7T A;  2KHS A;  1XXG A;  2FHT A;  3CP0 A;  3GO5 A;  4HTH A;  1WTV A;  2EJG C;  4HMJ A;  1Y69 U;  4GOP B;  3M85 A;  4JI0 L;  4UDU C;  2O5I C;  4UY8 C;  4XIG S;  4KY7 A;  1CQF A;  1CKO A;  3F2D A;  3E3X A;  4A3J B;  4A3B G;  3S1M B;  3S1Q H;  3RLN A;  4RKL A;  5HGQ A;  3HKZ B;  3PGZ A;  2IJ0 A;  3KFU A;  1Q1E A;  4HJA A;  1C8C A;  4E6I A;  5J22 A;  4LUV A;  4IFD J;  4LF6 Q;  4FYD A;  1EY6 A;  2R61 A;  3FKI B;  5LL6 X;  1V1O A;  1XX8 A;  2Q2H A;  3PQI A;  5M3M H;  3KLR A;  2WV6 D;  2DJF C;  3K7U C;  3HOZ H;  2F0T A;  4RGT A;  3M9B A;  3GTQ H;  3PUY A;  4UHV A;  1B9M A;  1EY8 A;  4JBJ A;  2AHO B;  1TQO A;  5BN5 A;  4DN4 M;  4JV5 L;  4DR4 L;  5JAV A;  1LTR D;  1ESF A;  1E2Z A;  4YCV A;  4A3E B;  1J5E Q;  2JQO A;  4ZYS A;  3F2B A;  3D6W A;  4ILW A;  4FXG C;  3QOL A;  4DXG A;  5IT9 c;  3OOC A;  2WKD A;  3CC7 A;  3AU7 A;  1O78 A;  4BA2 I;  5CV7 A;  1II3 A;  1HQM C;  3SK4 A;  2IX1 A;  1KIX A;  1HUN A;  3SDZ A;  1JOR A;  1SJH D;  4U68 A;  1OXT A;  2Z8L A;  1M8A A;  1XJV A;  1JB3 A;  1R4P B;  1N8R C;  1TT2 A;  2EYJ A;  2A73 B;  5C3W A;  1OXS C;  1M1K C;  1QUQ A;  2DN8 A;  5IP9 H;  1J9O A;  2CHB D;  3DLL A;  4JG2 A;  1V43 A;  2BCO A;  5M3F B;  3VDY A;  2SDF A;  1KAA A;  3NWS A;  1NNX A;  1TWC B;  4LF7 L;  1HJP A;  3PCO B;  2JA7 G;  1N33 Q;  5C3X A;  4KHP Q;  1X3P A;  5AJ3 L;  4DV5 L;  3EN2 A;  3OIQ A;  2FXQ A;  1A3U A;  3KUP A;  3T16 A;  2HIX A;  4A3L G;  1OXX K;  4H13 C;  4FF2 A;  3NBH B;  1Y1W G;  1NE3 A;  4KV6 A;  3KDF A;  3HOW B;  3N52 A;  3L0O A;  2PNH A;  2F0G A;  1VQL A;  3SGI A;  3MXP A;  4HED A;  5IYD G;  3CAM A;  4WJW A;  5KYL A;  1A6X A;  3S17 H;  3ITP A;  1W6J A;  1CM9 A;  4RGM A;  4DKA C;  1CZW A;  4OHJ A;  1VQF A;  1WJJ A;  2Z6K A;  4BBR G;  4PZ6 A;  1AH9 A;  5BR8 Q;  4OWT B;  1BO0 A;  2EXD A;  3Q6S A;  1XNR L;  3TP6 A;  4A3M G;  3NBI A;  3DWQ A;  4QY7 A;  3A8J E;  1B53 A;  3HEJ A;  3GP7 A;  2R7Z G;  2HHH L;  4RH6 A;  3QIA A;  1L1O C;  2KED A;  5E3F A;  4A3K G;  4TRD A;  1GKH A;  1HNW Q;  1VQE A;  3RZD H;  1Q86 C;  1QNU A;  4WFN 3;  4KKT A;  1UEB A;  3HFZ B;  1EQQ A;  3GTJ H;  2ENB A;  3BZD B;  2PCF B;  5CV5 A;  1X3E A;  2VQF L;  5E1F A;  1TWF H;  2R93 G;  3FP9 A;  2DUD A;  5FLX E;  2RKS A;  3C3L A;  3J81 L;  2B63 G;  2RCF A;  2J4X A;  2B3G A;  1X9N A;  3HOV G;  4PMW A;  1NUC A;  4JYA Q;  2EE1 A;  5C0X I;  1EFI D;  4MIU A;  1CA6 A;  4BBS G;  2K03 A;  1PH9 A;  5C6A A;  2UUC L;  4G57 A;  2J0T D;  2Q8I B;  1EYA A;  3HG9 A;  1PV4 A;  2B29 A;  1H9K A;  1K73 C;  4KTA A;  1CKN B;  1LT6 D;  5C0X G;  2WFW A;  1H9M A;  2D5D A;  1VQH A;  3I7F A;  3CME A;  4C3H H;  2BH8 A;  3H09 A;  1LV9 A;  4RHS A;  1BCP B;  1NMG A;  3S2H B;  1BUV T;  4CJ0 B;  3WWV A;  2DY7 A;  5ELN A;  1X65 A;  4DK3 C;  3CHB D;  4N8X 1;  4GZY C;  4PNY A;  1G51 A;  1SAP A;  3HOY G;  1GUS A;  1TR5 A;  2DNC A;  1IBM Q;  3U50 C;  4TVA B;  1BR9 A;  2AUK A;  1U9R A;  3QO2 A;  3VA5 A;  5C5M A;  1SND A;  2UXB L;  4JI2 Q;  1NY4 A;  4DR3 Q;  3I4M G;  3QWN A;  5I9P A;  1YNJ C;  1DOM A;  2RVL A;  5CYU A;  5ISR A;  4JI4 Q;  3M3Y H;  3K0X A;  4DV6 L;  1LTL A;  1Y1V G;  1FJG Q;  1JT8 A;  1BBW A;  1GM5 A;  5IY0 A;  2JA5 H;  3FMC A;  1N34 L;  1OTC A;  2YU9 B;  1O7I A;  2SNM A;  2EJM A;  4A3I B;  5ELF A;  5JEA J;  2E2H H;  3S1N H;  1NSN S;  1EZ8 A;  1VQK A;  1QZH A;  3TSS A;  4IOC A;  4JI8 Q;  3HGB A;  1ENC A;  2ALY B;  5ELD A;  5M5X B;  3U4Z A;  2UU9 L;  2QA4 A;  1PZJ D;  1WCM B;  3P7J A;  3LWE A;  1YHB A;  5EAY A;  3RZO H;  2KJX A;  3W5O A;  3KLW A;  2B2W C;  2PMZ E;  4LF4 L;  3S16 B;  1VF5 C;  3C1F A;  3CQZ H;  1VS0 A;  5JPM C;  2CH4 A;  2VUM B;  1F9R A;  4LFB Q;  3ERS X;  5L37 A;  3SE0 A;  1SEB D;  2JP1 A;  3WOE A;  4A3G B;  2AQ2 B;  1YNJ D;  1L0Y B;  1SN8 A;  3J80 E;  4IPG A;  2LFN A;  3PO2 H;  1XTC D;  3V05 A;  2A1A A;  2JA8 H;  1MSH A;  2X6L A;  3B6Y A;  1Q81 C;  3U9S A;  4JI6 L;  1E2W A;  2NZO A;  4DV0 L;  2B2U A;  5IP7 G;  4HJ5 A;  1O80 A;  3E0E A;  2FMC A;  2JXM B;  2D0O A;  5DM7 3;  3PO3 B;  4APV A;  4M8A A;  4HCE A;  1CHQ D;  4DR7 L;  3TP8 A;  4JPB W;  2F0V A;  1GUT A;  4WRD A;  5C3E G;  4X62 L;  4C3J B;  1YZ6 A;  2H5X A;  5IYC H;  1O7Z A;  3E0J A;  3D4W A;  2KHJ A;  1STE A;  3D4D A;  1QJO A;  4OIK A;  4NW2 A;  3I56 A;  3M7N A;  2AWN A;  2VXW A;  2E76 C;  4N8F A;  5BN4 A;  2E2J B;  4A93 B;  2OTL A;  5J3B A;  1VQ9 A;  2D0P A;  5EPJ A;  3GQB A;  3K80 C;  4L5S A;  3HOX H;  4J6H A;  5KNC A;  4JI5 Q;  1SMY C;  4QB4 A;  1A3V A;  4CDE C;  1W3S A;  1EOV A;  3FEW X;  3A8K E;  1Z47 A;  2LSS A;  1V1P A;  4PMB A;  2NVX H;  2Q8R E;  1CT1 D;  4DV3 Q;  2ZJP A;  3SEB A;  1SNC A;  2ID0 A;  3CRL C;  2NZH A;  1IBK L;  2MO0 A;  5G3L D;  4JV5 Q;  1LTS D;  5C4X G;  1TWA B;  3OW2 A;  5CBE E;  2K33 A;  1EY7 A;  1JJG A;  3VR5 A;  5A2Q E;  2B2T A;  1EWH A;  1I5F A;  2VB3 X;  2F0E A;  1LTA D;  1L0X B;  1MGS A;  3BVG A;  1MD2 D;  3ONA B;  1EYG A;  5JJZ A;  4IOA A;  2UUA Q;  1RCV D;  5CR3 A;  1D2B A;  3IFD A;  1AP0 A;  2R6G A;  3STB C;  3PUV A;  4RKB A;  1P8L A;  3K7A H;  2Q2U A;  4HR7 B;  1SMY D;  1ASY A;  1YHQ A;  1T5X D;  3S1Q B;  1Y8N B;  3J7A F;  2K5V A;  3CRK C;  3CCS A;  1O7Y A;  2FMM A;  3Q0A A;  3H0G G;  2L9H A;  2OCE A;  5D3I B;  4YCU A;  2UXC L;  3KBG A;  4IN3 A;  1EY0 A;  1EU3 A;  5IWA L;  4DV2 L;  5DAU A;  5D14 A;  4BY7 G;  2KEN A;  5M3M B;  2L11 A;  4QUF A;  3HOZ B;  1NR2 A;  1KNA A;  5AJ3 Q;  1PH8 A;  1VQ4 A;  4H0L C;  4DV5 Q;  1X6O A;  3GTQ B;  1RTN A;  1KDB A;  1TU2 B;  4GOP C;  4R4Q A;  5EJW A;  4XTC S;  2NYZ D;  4GNX A;  2WAQ B;  1XYI A;  1I50 H;  4IFD I;  1CK1 A;  5FKA C;  2ZTC A;  5C44 G;  4H02 A;  4OWX B;  1JOO A;  5DM6 3;  2IHE A;  4A3J G;  1W2B A;  4UAI A;  3CCM A;  1R4Q B;  4JOI A;  4DAP A;  3S15 H;  2MO1 A;  1YHA A;  1TWH H;  1G8Z D;  4NXN L;  2F0N A;  4YIJ A;  2RHS B;  2E5L Q;  3G7L A;  3FKI G;  4IQZ A;  2B2V A;  2NVY H;  2V1C C;  3NEM A;  1KRT A;  1CI3 M;  3GTP H;  4A76 A;  1EYD A;  1XMQ Q;  5ELE A;  1HA6 A;  4Q0F A;  3URY A;  5LMU L;  1LT5 D;  4HN7 A;  2CW0 C;  4MNO A;  2L55 A;  3KF8 B;  2F0S A;  1S72 A;  4KHZ A;  5HGT A;  1UUP A;  2DY8 A;  2C35 B;  2F0D A;  1LT3 D;  4B3M Q;  1WVL A;  3A5U A;  4A3E G;  1VQC A;  1RDP D;  1HNX L;  5IYB G;  2G9D A;  2JA7 H;  1B3Q A;  5I2Y A;  2E8G A;  3CW2 C;  4ME3 A;  2F0W A;  2X69 A;  3NUC A;  3MXN A;  3ZYY X;  4PV1 C;  4J15 A;  4A3L H;  3CD6 A;  1DXM A;  1JE4 A;  3JAM i;  1X56 A;  5CMD A;  3OW7 A;  2F3W A;  1ROD A;  5C4Z A;  4X3K A;  3CPF A;  3S17 B;  5IYD H;  1IL8 A;  4DV4 Q;  1B4O A;  4G4K A;  4Z9C B;  5FLX c;  1PTO H;  4EQO A;  2JSO A;  4QGU A;  4NPS A;  5J1Z A;  1M90 C;  1TS5 A;  1PFM A;  1SYF A;  4X65 L;  2ZTE A;  4ABN A;  5M3F G;  4QMG A;  3CMA A;  3D0F A;  4R4T A;  1I3Q H;  2KEE A;  4XQQ A;  1HHV A;  3H91 A;  4IUQ A;  2K28 A;  4RHR A;  4DNI A;  2JK8 A;  2EY6 A;  4DNT B;  3RMH A;  3HP3 A;  3DXJ C;  3TZD A;  3D31 A;  1D1K A;  1SE4 A;  2HUG A;  1B7Y B;  1TS2 A;  3RZD B;  1DON A;  2DJG C;  3JAM c;  1LM0 A;  4KN7 C;  4A3C H;  2EVB A;  3GTJ B;  3BDL A;  2VZA A;  1TWF B;  3CC4 A;  2PW7 A;  1PZK D;  3E6Z X;  5T1G A;  1TWG H;  4DV6 Q;  1C7Y A;  4ZUI A;  1BBX C;  4DA2 A;  4CKB A;  2UXD L;  3MWY W;  4LFA L;  5T1I A;  2HDM A;  3HKS A;  2PYK A;  1MI2 A;  5M5Y H;  4OGQ C;  2L15 A;  1YVC A;  4G7H C;  2M00 A;  5JPN C;  2C9O A;  2IX3 A;  4C1N K;  1Q3L A;  3AQQ A;  3DEP A;  1K0S A;  3UDG A;  1H9R A;  5IGF A;  1B70 B;  2F0L A;  4L5T A;  5M5W H;  1H9S B;  1EIF A;  3EQL C;  3GTK B;  5G3L F;  4C3H B;  1GUO A;  4B3T L;  1W6K A;  1YI2 A;  1Y8O B;  1VQB A;  2K5H A;  2VS1 A;  3GV3 A;  4OEM B;  2AKW B;  4OX9 L;  2JYO A;  1X32 A;  4JBW A;  2N49 A;  3IL8 A;  2NZ1 D;  2M2L A;  2HT1 A;  1HZC A;  1K8M A;  4XT3 B;  4JBM A;  4DK1 A;  4I7A A;  2DGY A;  4C3I H;  3H3V H;  5A2Q L;  2VNU D;  4ZQ3 A;  1RL2 A;  3I91 A;  3PF5 A;  4TQU S;  1B9N A;  2NVT H;  2BOS A;  2HD3 A;  2Y0S B;  3EFX D;  3NE5 B;  4JI6 Q;  1SYB A;  1MIU A;  3IRB A;  1STY A;  1YIT A;  2B8G A;  4ZLT F;  2PO4 A;  3A74 A;  4OO1 I;  2CH4 W;  3ERQ A;  1PFN A;  4DR7 Q;  1WD1 A;  1BCP C;  2ZM6 L;  4HJ7 A;  3HOU H;  2JA5 B;  4DV7 L;  1XMO L;  4P75 A;  3S24 A;  4A3F H;  3OYY A;  4X62 Q;  4LNQ A;  4GKK L;  3J80 c;  1B8A A;  1C48 A;  2E2H B;  3S1N B;  4JI7 L;  3UDF A;  1HR0 L;  2WAQ E;  1EY5 A;  3A7A B;  2K04 A;  4OO1 G;  1UE1 A;  4JVZ A;  1CTM A;  1V9P A;  4BY1 H;  1K8A C;  3S14 H;  1NAP A;  3OMG A;  2PZT A;  2QKI C;  4JI3 L;  1HNZ Q;  1IYV A;  1XPU A;  1AW7 A;  1PXU A;  1GHJ A;  1U4R A;  2VL6 A;  4GN3 B;  5J39 A;  2JA9 A;  3R8B A;  3RZO B;  3VR2 A;  4HIO A;  1PFS A;  3D3R A;  3MZ5 A;  5FJ8 H;  1PH2 A;  3CQZ B;  4K14 A;  1SRO A;  1HRJ A;  4NKL A;  2KHI A;  1CQV A;  4LUO A;  3FHW A;  2NN6 H;  3ULJ A;  4V19 0;  2K75 A;  4BXX H;  1N32 L;  4EGV A;  1LYL A;  1L2F A;  3PO2 B;  3ND8 A;  2L1B A;  2GVB A;  1AN8 A;  4A3I G;  1IBK Q;  1KL9 A;  4M1U B;  4FF1 A;  4R4I A;  3U58 A;  1Q7Y C;  3MC0 B;  1FL0 A;  4QIW B;  5GAD C;  2F0P A;  1PH1 A;  3W3A A;  4J8Q A;  3DUZ A;  1F2Z A;  1FNV A;  4K5X A;  1WCM G;  1U4M A;  1JQY D;  1SNP A;  2OEO A;  2PPB C;  5IOC A;  2E2I H;  3GTO H;  2AQ3 B;  3ERO A;  4DR5 L;  5FLM G;  2NTT A;  4ZUJ A;  5CV4 A;  3T1Y Q;  3S2D B;  3I55 A;  4IUV A;  4DV1 Q;  4ZRZ A;  4UP8 A;  1GO3 E;  3FDT A;  4B9W A;  4V0B A;  4K0K L;  4KJN A;  1WTO A;  5D65 A;  1NJI C;  2XWB B;  4A3G G;  1K8O A;  1FGB D;  4IZ8 A;  4AYB B;  4DAY A;  4H7B A;  4O0A A;  1WD0 A;  3T13 A;  4YWL A;  2JEB I;  3E9H A;  5A35 A;  3HZX A;  3HOX B;  1PVO A;  3R3O A;  4PZ8 A;  5DNF A;  1PH4 A;  1EEF D;  3J7Y W;  4I7Z C;  4KD3 A;  1RD9 D;  4UPA A;  5C5L A;  2N8N A;  2FIN B;  3UI2 A;  2NVX B;  4GN4 B;  4CDD C;  3I4N G;  3VYR A;  4OIJ A;  1N36 L;  1K0R A;  1LLR D;  5AFW A;  4L63 B;  4DAV A;  4G7Z C;  2PI2 E;  5EGT A;  1EIG A;  4K5V A;  2KCT A;  4A3D B;  2XWJ B;  2XIW A;  5C4X H;  2QDL A;  1YBY A;  2PQA A;  2VQE L;  2RF4 A;  1I4P A;  1Q46 A;  3G4S A;  1CSQ A;  5JVG 3;  2RSO A;  1HZ9 A;  3VR6 A;  4A93 G;  2L0C A;  4DUY L;  2F0J A;  4NMZ A;  4YY3 L;  2EYF A;  2EYL A;  1QVF A;  3T1H Q;  4XYQ A;  3RN2 A;  3K7A B;  2EQS A;  2F0F A;  3M4P A;  1IKM A;  1BF4 A;  2A8V A;  5IGG A;  1RHP A;  2RDF A;  2R92 H;  3NK9 A;  2BE5 C;  5ELB A;  3PIO A;  5JJL A;  4PMC A;  1UNS A;  1KHI A;  3OWF A;  1ML0 D;  4LW1 A;  3MEF A;  3GTM H;  4K6L A;  3H0G H;  2Z4I A;  4A4I A;  2QEJ C;  1F77 A;  5IIF A;  4BY7 H;  3AB9 A;  4U67 3;  3HS0 C;  1HNX Q;  3QJY A;  3K5M A;  4Y7N B;  3T53 B;  3VR3 A;  5ELO A;  2WII B;  3KOJ A;  1DOL A;  2MUY A;  1EZ6 A;  3A8I E;  1R9T H;  3HKZ E;  5JVH 3;  1I50 B;  2ICI A;  2OTJ A;  2HQE A;  4O42 A;  1QUQ B;  2F4V L;  1I6H H;  5C44 H;  4DAM A;  1PZI D;  4BA1 I;  3W1B A;  1I94 L;  1EY9 A;  2LKV A;  1G6P A;  1EWI A;  2OWO A;  3S15 B;  3H94 A;  3O13 A;  3M4O H;  4CBV A;  1NCV A;  2BE5 D;  2RBM A;  3SR1 A;  1TII D;  2YTY A;  1TWH B;  2EYP A;  1A15 A;  1YIJ A;  1S5D D;  4IO9 A;  2MFI A;  4TSS A;  3T51 B;  1XNQ Q;  2NVY B;  1H95 A;  2IPK D;  3TP7 A;  4OWW B;  3GTP B;  1OXV A;  4LWC A;  2H1E A;  2HIV A;  4FF3 A;  3HOZ G;  1SYE A;  1IYJ B;  3KDF B;  3OSO A;  4BWG B;  3PF4 A;  4NDX A;  1Q90 A;  2K5Q A;  3TQY A;  5KEE A;  2WAQ G;  1CA5 A;  1H9J A;  3TRZ A;  3TRE A;  5E7N A;  2E74 C;  1IYU A;  1I4H A;  5COR A;  5LMN L;  2AQ1 B;  2UUB L;  2RSN A;  3J81 c;  1FYC A;  1SFO H;  1AFP A;  1A0I A;  5GAE C;  3ND9 A;  4LF8 L;  1X54 A;  2NN6 I;  4RMF A;  5JOB A;  4A3E H;  4RFB A;  2NVQ H;  4CDC C;  3K57 A;  5E4W C;  2LXJ A;  4LFA Q;  2RA4 A;  1ET9 A;  1SMX A;  3NTK A;  1ENA A;  3Q23 A;  1JWU D;  4O1N A;  1V8Q A;  1WTW A;  3BYY B;  2F0I A;  3OPO A;  4QIW E;  1K3R A;  5LHY 1;  1ESR A;  1BCP F;  4MTK A;  1LT4 D;  4Y52 H;  1PTO B;  2QF7 A;  1RIP A;  3NTH A;  4ZKB B;  3U4V A;  1HTL D;  5IP9 G;  2B2W A;  2N78 A;  2O2L D;  3L3O C;  2JA6 H;  1K9M C;  3VYT A;  3CCR A;  1I3Q B;  3IFT A;  2HDL A;  4LF6 L;  1YJW A;  4JI0 Q;  1I4X A;  3TN2 A;  2HCI A;  2FJ2 A;  2K52 A;  2WKC A;  1VQJ A;  4KMU C;  5K36 G;  5IT9 E;  2K14 A;  1UWV A;  4ODG A;  3R2T A;  3CCU A;  2EDG A;  3M4Y A;  4AYB E;  4NXM L;  2EYO A;  2WP8 J;  1EU4 A;  5GAH C;  4ZCK A;  4JC0 A;  2MQH A;  4P2C B;  5I4D A;  4K8J A;  2K5N A;  1BNZ A;  2ES2 A;  1AEX A;  4LF5 L;  1A3T A;  1TWG B;  1I6V C;  2ZM6 Q;  1U0L A;  4DV7 Q;  1X3F A;  3D6C A;  1GUN A;  2BDN A;  3DMU A;  4JI7 Q;  1HA5 A;  3OMC A;  1S40 A;  5M5Y B;  1VQ5 A;  5I6Y A;  2MP1 A;  4I65 A;  1HQR D;  2XNA C;  4DR4 Q;  1PYW D;  4R8N A;  2ZXO A;  3MVV A;  2IHF A;  2ZJQ A;  1DM0 B;  1TY2 A;  1JJ2 A;  1UE5 A;  3PUX A;  2KCM A;  2M9V A;  1GUW A;  1HZA A;  2XGT A;  3OIP A;  5M5W B;  5M9O A;  2I0Q A;  1YEZ A;  3I3C A;  1F9P A;  4L5R C;  3MFY A;  1WOC A;  1ICW A;  4EQN A;  5EBD A;  2PW5 A;  3G71 A;  4OL7 A;  3S9W A;  3KF6 A;  2ATW A;  1MJE A;  3H15 A;  1K8G A;  1X3G A;  1N32 Q;  4YWK A;  4C3I B;  4B9X A;  5KIX A;  3PUW A;  3FVQ A;  1N33 L;  3DWP A;  5EBC A;  4KHP L;  3EA6 A;  1DYQ A;  4RA8 A;  4A3B H;  1HH2 P;  3LWU A;  4HID A;  4ID6 A;  2NVT B;  1E1O A;  3SK6 A;  1XPO A;  1KQS A;  4GKJ L;  3W2D A;  1D5M C;  1TVX A;  1WYD A;  1JWS D;  1QOH A;  1E1T A;  1QVC A;  2OF1 A;  3G6E A;  1AE2 A;  2J7Z A;  2QDB A;  2A68 C;  3A55 A;  1Q1B A;  3SHL A;  4HSV A;  2KQ3 A;  4L8J A;  4LF7 Q;  2PI2 A;  1HR0 W;  1ZKO A;  1STN A;  3HOU B;  3PIO 3;  5IGD A;  3EBE A;  2QW7 A;  4A3F B;  1GOZ A;  1YNN C;  4C3H G;  4DR1 L;  1DOK A;  1SE3 A;  4K6D A;  5BR8 L;  4JI1 L;  2DNE A;  2F0U A;  3N6R A;  2MGS A;  4EX5 A;  4BY1 B;  4EQP A;  1C9O A;  5DEH A;  3STB D;  4X64 L;  3S14 B;  1ILP A;  2QGQ A;  2MPM A;  3R93 A;  3HRZ C;  4BS9 A;  4KY6 A;  1B1Z A;  2YTV A;  4WJ4 A;  4IUN A;  3MXU A;  1SNQ A;  1EQT A;  4S3S A;  1BOS A;  1SE8 A;  3HKZ G;  2F52 A;  4JCV E;  4IFD G;  3M7G A;  4HIM A;  2F4I A;  1XNR Q;  2Q8T A;  1FR3 A;  4DR6 L;  3MTS A;  4B3S L;  3CCV A;  1JWM D;  1N9W A;  1FD7 D;  3WOF A;  2I5M X;  4YHH L;  3RR5 A;  2HHH Q;  1KLU D;  2A68 D;  5IGB A;  2BA0 A;  4GOP A;  1MBY A;  1ONL A;  5COY A;  2JA5 G;  4HJ9 A;  1PRT B;  4C2M H;  3VYS A;  1HXY D;  1MHW C;  1S5C D;  4WOR A;  5EKK A;  1YNN D;  3AFP A;  4JYA L;  1QNK A;  1STB A;  2VQF Q;  2KCC A;  4A75 A;  2Z9H A;  2VQE Q;  3H6M A;  5FO8 B;  4KKS A;  2EY1 A;  2F3I A;  2WB1 B;  3UE0 A;  1E24 A;  1ILQ A;  5JJI A;  2ZT9 C;  4DUY Q;  3LX0 A;  3F1Z A;  3NHH A;  3GTO B;  5I9O A;  3WDN A;  2E2I B;  2A74 C;  3MEH A;  1C4Q A;  5CGK A;  3C2P A;  4YY3 Q;  1VMC A;  4H44 C;  1Y1W H;  1PDQ A;  3I2Z A;  3K5L A;  2VB2 X;  1V1P B;  1B44 D;  1L0W A;  2Q2I A;  2UUC Q;  1D1I A;  1YJN A;  2C5C A;  3EVQ A;  2RHQ B;  3AYH B;  3SXH A;  4ZK9 B;  2F0H A;  4DUZ L;  5EKI A;  5CV8 A;  3K6O A;  2B39 A;  4AQY L;  3PO2 G;  3LGJ A;  1PLF A;  2B2Y C;  4BBR H;  1ENF A;  1FNW A;  5CV9 A;  4KY5 A;  2ZTD A;  3FPU B;  2IY5 B;  4FP5 D;  1VQ6 A;  1GVP A;  2RDH A;  2CW0 D;  4A3M H;  1UEA B;  2I07 B;  1D6E C;  2AMC B;  2YV5 A;  1TY0 A;  2K05 A;  3G48 A;  3W1G A;  5C4H A;  1IW7 C;  2ZJR A;  1YJ9 A;  4P72 A;  4XYO A;  4QUC A;  1PH6 A;  4JI4 L;  4DXF A;  2R7Z H;  3TEH B;  3R2I A;  1FJG L;  5EQ0 A;  2QIL A;  4RCN A;  1EIH A;  4A3K H;  5IYC G;  3I4N H;  4NP5 A;  1F9S A;  1STA A;  2RQX A;  3HOW G;  4CGY B;  4IUU A;  2TSS A;  4OEL B;  3T56 B;  1LTB D;  2UXB Q;  4LFC L;  4CKE A;  5IGE A;  4TKO B;  4X66 L;  5C4X B;  2F4V Q;  1QE6 A;  4PQX A;  2ASB A;  1HFG A;  4JI8 L;  1VQG A;  2R93 H;  5H1S E;  2AWO A;  2ZXP A;  3CC2 A;  2EY5 A;  1DD2 A;  1ZYR C;  1OXU A;  2K4K A;  4AYB G;  2B63 H;  2CFM A;  1N34 Q;  1VQA A;  3OWE B;  1VQN A;  5IT9 L;  3HOV H;  4ZKC B;  4ME5 A;  3BS1 A;  3QG1 A;  1Y14 B;  1SNM A;  5DLQ E;  4BBS H;  2WIN B;  2A6E C;  3NSW A;  3NBH A;  4LFB L;  2LMC B;  2UU9 Q;  1EYC A;  4GNX B;  4O2D A;  3KLS A;  2R92 B;  1KLG D;  1ZXT A;  2CQO A;  2F3V A;  1IW7 D;  2PZU A;  1SR3 A;  4QL5 A;  1F2M A;  5D3D A;  5C0X H;  1VQD A;  4F8M A;  1JMC A;  1JIC A;  1JJC B;  4IAL A;  5EPK A;  4LF4 Q;  3GTM B;  1PYS B;  2XN9 C;  3RN5 A;  3J80 i;  1VQP A;  1IBL L;  3H0G B;  4HIK A;  3K58 A;  3I8Z A;  4A3D G;  3PIP 3;  3MA2 B;  3K5O A;  1QWY A;  5LMN Q;  4BY7 B;  2UUB Q;  4LF9 L;  3BYT B;  1PFB A;  4K2L A;  1D5Z C;  1NMF A;  3NWT A;  3X3M A;  1KDC A;  3J7Z C;  3HOY H;  2G9H D;  1ZYR D;  1CSP A;  4MTN A;  4X3T A;  2WAC A;  4IUP A;  1XPR A;  1R9T B;  1X55 A;  4DV0 Q;  1WTR A;  1A2T A;  5JJK A;  1VF7 A;  2L12 A;  4C1N I;  1MJC A;  1I6H B;  5C44 B;  3UDX A;  3I4M H;  3S1R H;  1VCI A;  3M3Y B;  1PYB A;  1LTG D;  4DFA A;  3C46 A;  1UE6 A;  2A6E D;  3F8T A;  3L7Z C;  3J7A V;  1Y1V H;  4ULL A;  1CFM A;  1WI5 A;  3M4O B;  1GD7 A;  2GA4 B;  3I73 A;  4JK1 C;  3FRP B;  3UE1 A;  1JOQ A;  3U9O A;  4CDF C;  1DCZ A;  2EY2 A;  3JC6 6;  4JI5 L;  3A5Z B;  2L4N A;  3C1E A;  3MXN B;  1FGU A;  3F2U A;  5GAG C;  1J8I A;  1D5X C;  3PUZ A;  4IJL A;  1VQ7 A;  1EY4 A;  1A63 A;  1T9H A;  5LMN W;  4NXM Q;  4DV3 L;  2A6H C;  1Q8I A;  1EUJ A;  3KLS X;  4R1J A;  1JC7 A;  2P5Z X;  3EIV A;  1CKN A;  3ZJY C;  4J1M A;  5GRO A;  1NTG A;  4CKC A;  4LF5 Q;  1SFO B;  1HCZ A;  1U5K A;  4K5W A;  2JJQ A;  2ZXR A;  2NVQ B;  1G91 A;  5JEA G;  4LK1 C;  4G7O C;  2CWA A;  3AFQ A;  1BCP D;  1JCK B;  2JA8 B;  1Q12 A;  1E7Z A;  2PMZ B;  2UUA L;  4R4O A;  1QCB D;  3GDE A;  4DF7 A;  1FNU A;  2AUJ D;  5IP7 H;  3BJU A;  4X6A H;  1B50 A;  2OXP A;  3IAY A;  4ZAI A;  1P16 A;  2PQE A;  2Z4H A;  2Z6B A;  4HAE A;  2WB1 E;  2IX0 A;  3TS2 A;  4XQJ A;  2K5W A;  2Z6K C;  3V96 A;  1KC8 C;  5C3E H;  2JA6 B;  4F7X A;  3CPW A;  1RF2 D;  1CUK A;  3GD7 A;  2A6H D;  3RLO A;  4F88 A;  5BN3 A;  2VUM G;  2GVA A;  1GUG A;  4LUZ A;  1K3B C;  4FNF A;  1JE5 A;  1I4G A;  5C4J H;  3CCJ A;  3IKJ A;  1OO9 B; 
#chains in the Genus database with same CATH homology
 5K36 H;  3A7L A;  3TDQ A;  1G2T A;  4CHT B;  3K5N A;  1RJT A;  3DHQ A;  1PTO C;  4XDX A;  1RKN A;  3NQT A;  1E0B A;  4LJZ C;  4FF4 A;  4C56 C;  4N9T A;  4C3J G;  3RUZ A;  1S5B D;  3V2T A;  2RDG A;  2FFK B;  2EPB A;  4L6T B;  1PMR A;  2LS0 1;  2KUM A;  2QCP X;  3E5S A;  2KEC A;  3NPP A;  2ICE C;  1WTX A;  3RD4 A;  3RLF A;  2EXZ A;  3MHB A;  2EZV A;  4K2K A;  1KAB A;  4KN4 C;  2F0M A;  4IUR A;  2NBF A;  3TZU A;  1PTO D;  4DNR B;  5KRU A;  5FO9 B;  5KYI A;  1X3Q A;  4A3B B;  5E4X A;  2BA1 A;  2NB0 A;  2N88 A;  2F03 A;  1TS4 A;  2X6G A;  1KDA A;  3QB3 A;  2A69 C;  5FK9 C;  1GJX A;  3MFG A;  1Z6H A;  2XVS A;  4X3S A;  2IWH A;  3KK7 A;  4CJ1 B;  2H4O A;  3JAM E;  4Q5V A;  1A2U A;  2YYZ A;  5EPL A;  1HTP A;  3X3N A;  3TBI B;  3P20 A;  5FOB B;  1LO5 D;  2EJF C;  1LTI D;  1SDF A;  3H3V C;  5NUC A;  2CQA A;  3T4A C;  3D4R A;  4C3I G;  5CV6 A;  1NR4 A;  2KVM A;  1B3A A;  3L9A X;  3P1H A;  1ZEQ X;  5KGU A;  4IFD H;  2K6A A;  4DGZ A;  2CVR A;  4RGN A;  2KOL A;  2A69 D;  4C2M B;  2IT1 A;  3PMF A;  2NUC A;  2E2D C;  1SSO A;  4EVO A;  2B2U C;  1TKW B;  2JA7 B;  2A5H A;  4MHE A;  1E2V A;  2JE6 I;  2SOB A;  3LNN A;  1HUM A;  1Y8P B;  1Y1W B;  4KI0 A;  2NN6 G;  3TP5 A;  1PRT C;  2XRQ D;  3CKI B;  3Q22 A;  5I6W A;  1G29 1;  3DM1 A;  4BBR B;  5CC4 A;  4B08 A;  5HUR A;  1EWC A;  2EYM A;  4A3M B;  2KA7 A;  5KND A;  3SK5 A;  2MHV A;  4FXK C;  4HCS A;  2R7Z B;  3Q24 A;  3NTI A;  2K01 A;  2N55 A;  2PNR C;  4A3K B;  3I4N B;  2O5J C;  4QF4 A;  3VR4 A;  1VMP A;  1SXT A;  2R93 B;  1CZG A;  3NP8 A;  1DJR D;  2R3Z A;  1PRT D;  3KF8 A;  2B63 B;  2B2T C;  3QOJ A;  2E75 C;  3HOV B;  2V4D A;  3BVM A;  2KCN A;  4DK0 A;  2HCC A;  1HPC A;  3VYU A;  1F2Y A;  4XQN A;  4BBS B;  1SYG A;  4K8I A;  3BG3 A;  4XXE A;  2K1B A;  1LAB A;  3I4L A;  1IHZ A;  5C0X J;  3D8G A;  4RAU C;  2TMP A;  3K59 A;  2D2C C;  1M4V A;  3MAQ A;  1STG A;  3A54 A;  1LTT D;  3HOY B;  1WTP A;  3I70 A;  5TSS A;  5IOD A;  1PTO F;  1EOT A;  2XSC A;  1S5F D;  3CU7 A;  4XT1 B;  3I4M B;  3S1R B;  2I46 A;  1U4P A;  1U4L A;  2EYH A;  2Z1C A;  2O4X A;  3TME A;  1WTQ A;  1Y1V B;  4QCL A;  5FLX L;  4KD4 A;  4FXD A;  4HMI A;  2LY7 A;  1O7L A;  4LAA A;  1F9Q A;  2F0K A;  1UAP A;  1AZQ A;  3DWA A;  4OO1 H;  1BXT A;  2B2V C;  4N9P A;  3AMU A;  4MN3 A;  2SEB D;  3P75 A;  3KBX A;  1G2S A;  3K0Y A;  3JAM L;  1RTO A;  3I90 A;  1H9S A;  2BDO A;  2D9U A;  2MJ8 A;  2SNS A;  1LAC A;  5JEA H;  1QB5 D;  1GHK A;  3SK8 A;  5FO7 B;  1KTK A;  5IGC A;  1STH A;  4LMQ D;  4KK7 A;  3VA7 A;  1IKL A;  3MXG A;  1VDZ A;  1CHP D;  3I72 A;  2NWG A;  1ET6 A;  4F87 A;  5C3E B;  1B2T A;  5K5P A;  4FVM A;  3BVZ A;  5C4J B;  2L5T A;  1SNO A;  1SYD A;  3OHX C;  4KKU A;  3EJI A;  2K32 A;  1EEI D;  4KHV A;  1EL0 A;  3BDC A;  5KNB A;  1XWE A;  1KNE A;  1AZP A;  4R9W A;  3A56 A;  4RCO A;  2NTS A;  1DZ1 A;  3G6J B;  4RWS C;  3J80 L;  3DEO A;  3GV6 A;  5I2X A;  1S5E D;  2F0Q A;  4DU9 A;  2F0O A;  1I4Q A;  3J81 E;  4IUT A;  4R8I A;  5EKL A;  3FPP A;  4KJO A;  2K5D A;  2IL8 A;  2B2Y A;  2K7V A;  5ELC A;  5CBA E;  2EOT A;  1BDO A;  1G6Z A;  1T5E A;  3GTL B;  1BQQ T;  1QIL A;  1GXD C;  1SE2 A;  2XRS D;  5F2D A;  4FO2 A;  1PRT F;  1I4R A;  1SJE D;  3NXW A;  4RGO S;  4CJ2 C;  1JR0 D;  2D62 A;  5LL6 S;  4HSP A;  1SBB B;  2OT2 A;  2JEA I;  3SVM A;  1MSG A;  2PZW A;  2B8F A;  1SYC A;  3BDO A;  1QG7 A;  1JOK A;  2F1M A;  3NQI A;  1EQV A;  2IW3 A;  1HFN A;  3PV0 A;  1F2L A;  1K83 B;  3GTG B;  1S4Z A;  1TS3 A;  4X3U A;  1Z7T A;  2KHS A;  1XXG A;  2FHT A;  3GO5 A;  4HTH A;  1WTV A;  4HMJ A;  2EJG C;  1Y69 U;  3M85 A;  4UDU C;  2O5I C;  4XIG S;  4KY7 A;  1CQF A;  4A3J B;  3S1M B;  4RKL A;  3HKZ B;  2IJ0 A;  1Q1E A;  1C8C A;  4E6I A;  5J22 A;  4IFD J;  4FYD A;  1EY6 A;  2R61 A;  3FKI B;  5LL6 X;  1V1O A;  1XX8 A;  3KLR A;  2WV6 D;  2F0T A;  4RGT A;  3PUY A;  1B9M A;  1EY8 A;  1TQO A;  5BN5 A;  4DN4 M;  5JAV A;  1LTR D;  1ESF A;  1E2Z A;  4A3E B;  4ZYS A;  3D6W A;  4ILW A;  4FXG C;  3QOL A;  4DXG A;  3OOC A;  2WKD A;  3AU7 A;  1O78 A;  4BA2 I;  5CV7 A;  1II3 A;  1HQM C;  3SK4 A;  2IX1 A;  1HUN A;  3SDZ A;  1JOR A;  1SJH D;  4U68 A;  1OXT A;  2Z8L A;  1M8A A;  1JB3 A;  1R4P B;  1TT2 A;  2EYJ A;  2A73 B;  5C3W A;  1OXS C;  2DN8 A;  1J9O A;  2CHB D;  1V43 A;  2BCO A;  5M3F B;  2SDF A;  1KAA A;  3NWS A;  1TWC B;  5C3X A;  1X3P A;  3OIQ A;  1A3U A;  3KUP A;  3T16 A;  1OXX K;  4H13 C;  4FF2 A;  4KV6 A;  3HOW B;  3N52 A;  2F0G A;  3MXP A;  4HED A;  4WJW A;  5KYL A;  1A6X A;  3ITP A;  1W6J A;  1CM9 A;  4RGM A;  1CZW A;  4OHJ A;  1BO0 A;  3Q6S A;  3TP6 A;  3NBI A;  3DWQ A;  3A8J E;  1B53 A;  3HEJ A;  3GP7 A;  4RH6 A;  3QIA A;  2KED A;  5E3F A;  4TRD A;  1QNU A;  4WFN 3;  4KKT A;  2ENB A;  3BZD B;  2PCF B;  5CV5 A;  5E1F A;  5FLX E;  2RKS A;  3C3L A;  3J81 L;  2J4X A;  4PMW A;  1NUC A;  2EE1 A;  5C0X I;  1EFI D;  4MIU A;  1CA6 A;  2K03 A;  5C6A A;  4G57 A;  2J0T D;  2Q8I B;  1EYA A;  3HG9 A;  1H9K A;  4KTA A;  1LT6 D;  5C0X G;  1H9M A;  2D5D A;  3H09 A;  1LV9 A;  4RHS A;  1BCP B;  3S2H B;  1BUV T;  4CJ0 B;  2DY7 A;  3CHB D;  4GZY C;  4PNY A;  1SAP A;  1GUS A;  1TR5 A;  2DNC A;  1BR9 A;  2AUK A;  1U9R A;  3QO2 A;  3VA5 A;  5C5M A;  1SND A;  3QWN A;  5I9P A;  1YNJ C;  1DOM A;  2RVL A;  5CYU A;  5ISR A;  3FMC A;  2YU9 B;  2SNM A;  2EJM A;  4A3I B;  5ELF A;  5JEA J;  1NSN S;  1EZ8 A;  3TSS A;  3HGB A;  1ENC A;  5ELD A;  5M5X B;  1PZJ D;  1WCM B;  3P7J A;  3LWE A;  2KJX A;  2B2W C;  3S16 B;  1VF5 C;  3C1F A;  5JPM C;  2VUM B;  1F9R A;  3SE0 A;  1SEB D;  2JP1 A;  3WOE A;  4A3G B;  2AQ2 B;  1YNJ D;  1L0Y B;  3J80 E;  2LFN A;  1XTC D;  3V05 A;  1MSH A;  2X6L A;  3U9S A;  1E2W A;  2B2U A;  1O80 A;  2FMC A;  2JXM B;  5DM7 3;  3PO3 B;  4M8A A;  4HCE A;  1CHQ D;  3TP8 A;  2F0V A;  1GUT A;  4WRD A;  4C3J B;  1O7Z A;  3E0J A;  3D4W A;  1STE A;  3D4D A;  1QJO A;  4OIK A;  4NW2 A;  3M7N A;  2AWN A;  2VXW A;  2E76 C;  5BN4 A;  2E2J B;  4A93 B;  5EPJ A;  3GQB A;  4J6H A;  5KNC A;  1SMY C;  4QB4 A;  1A3V A;  3FEW X;  3A8K E;  1Z47 A;  1V1P A;  4PMB A;  2Q8R E;  1CT1 D;  3SEB A;  1SNC A;  2ID0 A;  3CRL C;  5G3L D;  1LTS D;  1TWA B;  5CBE E;  2K33 A;  1EY7 A;  3VR5 A;  5A2Q E;  2B2T A;  1EWH A;  2VB3 X;  2F0E A;  1LTA D;  1L0X B;  1MGS A;  3BVG A;  1MD2 D;  3ONA B;  5JJZ A;  1RCV D;  5CR3 A;  1D2B A;  3IFD A;  1AP0 A;  2R6G A;  3PUV A;  4RKB A;  4HR7 B;  1SMY D;  1T5X D;  3S1Q B;  1Y8N B;  3J7A F;  3CRK C;  1O7Y A;  2FMM A;  3Q0A A;  2L9H A;  5D3I B;  3KBG A;  4IN3 A;  1EY0 A;  1EU3 A;  5DAU A;  5D14 A;  5M3M B;  2L11 A;  4QUF A;  3HOZ B;  1NR2 A;  1KNA A;  4H0L C;  3GTQ B;  1RTN A;  1KDB A;  1TU2 B;  5EJW A;  4XTC S;  2NYZ D;  2WAQ B;  1XYI A;  4IFD I;  1CK1 A;  5FKA C;  1JOO A;  5DM6 3;  4UAI A;  1R4Q B;  4DAP A;  1G8Z D;  2F0N A;  4YIJ A;  3G7L A;  4IQZ A;  2B2V A;  1CI3 M;  1EYD A;  5ELE A;  1HA6 A;  4Q0F A;  3URY A;  1LT5 D;  4HN7 A;  2CW0 C;  2L55 A;  2F0S A;  4KHZ A;  5HGT A;  1UUP A;  2DY8 A;  2F0D A;  1LT3 D;  1WVL A;  1RDP D;  2G9D A;  5I2Y A;  2F0W A;  2X69 A;  3NUC A;  3MXN A;  3ZYY X;  4PV1 C;  1DXM A;  1JE4 A;  5CMD A;  3OW7 A;  2F3W A;  1ROD A;  5C4Z A;  4X3K A;  3S17 B;  1IL8 A;  1B4O A;  4G4K A;  4Z9C B;  1PTO H;  4EQO A;  2JSO A;  5J1Z A;  1TS5 A;  1PFM A;  1SYF A;  4ABN A;  4QMG A;  2KEE A;  4XQQ A;  1HHV A;  3H91 A;  4IUQ A;  2K28 A;  4RHR A;  2EY6 A;  4DNT B;  3RMH A;  3HP3 A;  3DXJ C;  3TZD A;  3D31 A;  1D1K A;  1SE4 A;  2HUG A;  1TS2 A;  3RZD B;  1DON A;  4KN7 C;  2EVB A;  3GTJ B;  3BDL A;  1TWF B;  2PW7 A;  1PZK D;  3E6Z X;  5T1G A;  4ZUI A;  1BBX C;  4DA2 A;  4CKB A;  3MWY W;  5T1I A;  2HDM A;  2PYK A;  1MI2 A;  4OGQ C;  4G7H C;  2M00 A;  5JPN C;  2C9O A;  2IX3 A;  4C1N K;  1Q3L A;  3DEP A;  1H9R A;  5IGF A;  2F0L A;  1H9S B;  3EQL C;  3GTK B;  5G3L F;  4C3H B;  1GUO A;  1W6K A;  1Y8O B;  3GV3 A;  2JYO A;  1X32 A;  4JBW A;  3IL8 A;  2NZ1 D;  2M2L A;  1K8M A;  4XT3 B;  4DK1 A;  5A2Q L;  2VNU D;  4ZQ3 A;  3I91 A;  4TQU S;  1B9N A;  2BOS A;  2Y0S B;  3EFX D;  3NE5 B;  1SYB A;  1STY A;  2B8G A;  4ZLT F;  2PO4 A;  4OO1 I;  3ERQ A;  1PFN A;  1WD1 A;  1BCP C;  2JA5 B;  1C48 A;  2E2H B;  3S1N B;  3A7A B;  1EY5 A;  2K04 A;  4OO1 G;  1CTM A;  1NAP A;  3OMG A;  2PZT A;  2QKI C;  1IYV A;  1AW7 A;  1PXU A;  1GHJ A;  1U4R A;  5J39 A;  3R8B A;  3RZO B;  3VR2 A;  3D3R A;  3MZ5 A;  3CQZ B;  4K14 A;  1HRJ A;  4NKL A;  1CQV A;  2NN6 H;  4V19 0;  4EGV A;  3PO2 B;  3ND8 A;  2L1B A;  1AN8 A;  4M1U B;  4FF1 A;  3MC0 B;  4QIW B;  2F0P A;  3W3A A;  4J8Q A;  3DUZ A;  1F2Z A;  1FNV A;  4K5X A;  1U4M A;  1JQY D;  1SNP A;  2OEO A;  2PPB C;  5IOC A;  2AQ3 B;  3ERO A;  2NTT A;  4ZUJ A;  5CV4 A;  3S2D B;  4IUV A;  4ZRZ A;  3FDT A;  4B9W A;  4V0B A;  4KJN A;  1WTO A;  5D65 A;  2XWB B;  1K8O A;  1FGB D;  4IZ8 A;  4AYB B;  4DAY A;  4H7B A;  1WD0 A;  3T13 A;  2JEB I;  5A35 A;  3HZX A;  3HOX B;  3R3O A;  5DNF A;  1EEF D;  3J7Y W;  4I7Z C;  4KD3 A;  1RD9 D;  5C5L A;  2FIN B;  3UI2 A;  2NVX B;  3VYR A;  4OIJ A;  1LLR D;  5AFW A;  4L63 B;  4DAV A;  4G7Z C;  5EGT A;  1EIG A;  4K5V A;  4A3D B;  2XWJ B;  2XIW A;  1I4P A;  5JVG 3;  2RSO A;  3VR6 A;  2L0C A;  2F0J A;  4NMZ A;  2EYF A;  2EYL A;  4XYQ A;  3K7A B;  2F0F A;  1IKM A;  1BF4 A;  5IGG A;  1RHP A;  2RDF A;  3NK9 A;  2BE5 C;  5ELB A;  4PMC A;  1UNS A;  3OWF A;  1ML0 D;  4K6L A;  2Z4I A;  2QEJ C;  1F77 A;  5IIF A;  3AB9 A;  4U67 3;  3HS0 C;  3QJY A;  3K5M A;  4Y7N B;  3T53 B;  3VR3 A;  2WII B;  1DOL A;  2MUY A;  1EZ6 A;  3A8I E;  5JVH 3;  1I50 B;  2ICI A;  2HQE A;  4O42 A;  1PZI D;  4BA1 I;  1EY9 A;  2LKV A;  3S15 B;  3H94 A;  3O13 A;  4CBV A;  1NCV A;  2BE5 D;  2RBM A;  3SR1 A;  1TII D;  1TWH B;  2EYP A;  1A15 A;  1S5D D;  4TSS A;  3T51 B;  2NVY B;  2IPK D;  3TP7 A;  3GTP B;  1OXV A;  2H1E A;  4FF3 A;  1SYE A;  3OSO A;  4BWG B;  4NDX A;  1Q90 A;  2K5Q A;  5KEE A;  1CA5 A;  1H9J A;  2E74 C;  1IYU A;  1I4H A;  5COR A;  2AQ1 B;  2RSN A;  1FYC A;  1AFP A;  3ND9 A;  2NN6 I;  5JOB A;  4RFB A;  3K57 A;  5E4W C;  2RA4 A;  1ET9 A;  3NTK A;  1ENA A;  3Q23 A;  1JWU D;  4O1N A;  1V8Q A;  1WTW A;  3BYY B;  2F0I A;  3OPO A;  5LHY 1;  1ESR A;  1BCP F;  1LT4 D;  1PTO B;  2QF7 A;  3NTH A;  4ZKB B;  1HTL D;  2B2W A;  2O2L D;  3L3O C;  3VYT A;  1I3Q B;  3IFT A;  2HDL A;  1I4X A;  3TN2 A;  2HCI A;  2FJ2 A;  2WKC A;  4KMU C;  5K36 G;  5IT9 E;  4ODG A;  3R2T A;  2EDG A;  3M4Y A;  2EYO A;  2WP8 J;  1EU4 A;  4P2C B;  5I4D A;  4K8J A;  1BNZ A;  1AEX A;  1A3T A;  1TWG B;  1I6V C;  3D6C A;  1GUN A;  2BDN A;  3DMU A;  1HA5 A;  3OMC A;  5M5Y B;  5I6Y A;  2MP1 A;  4I65 A;  1HQR D;  2XNA C;  1PYW D;  4R8N A;  2ZXO A;  3MVV A;  1DM0 B;  1TY2 A;  3PUX A;  2M9V A;  1GUW A;  3OIP A;  5M5W B;  5M9O A;  3I3C A;  1F9P A;  3MFY A;  1ICW A;  4EQN A;  5EBD A;  2PW5 A;  4OL7 A;  3S9W A;  4C3I B;  5KIX A;  4B9X A;  3PUW A;  3FVQ A;  3DWP A;  5EBC A;  3EA6 A;  1DYQ A;  4RA8 A;  3LWU A;  4ID6 A;  2NVT B;  3SK6 A;  3W2D A;  1D5M C;  1TVX A;  1JWS D;  1QOH A;  2OF1 A;  2J7Z A;  2QDB A;  2A68 C;  3A55 A;  1Q1B A;  3SHL A;  4HSV A;  2KQ3 A;  4L8J A;  1ZKO A;  1STN A;  3HOU B;  3PIO 3;  5IGD A;  4A3F B;  1GOZ A;  1YNN C;  4C3H G;  1DOK A;  1SE3 A;  4K6D A;  2DNE A;  2F0U A;  3N6R A;  2MGS A;  4BY1 B;  4EQP A;  5DEH A;  3S14 B;  1ILP A;  2MPM A;  3R93 A;  4BS9 A;  3HRZ C;  4KY6 A;  1B1Z A;  4IUN A;  3MXU A;  1SNQ A;  1EQT A;  4S3S A;  1BOS A;  4IFD G;  3M7G A;  2F4I A;  2Q8T A;  1FR3 A;  3MTS A;  1JWM D;  1FD7 D;  3WOF A;  1KLU D;  2A68 D;  5IGB A;  2BA0 A;  1MBY A;  1ONL A;  5COY A;  1PRT B;  3VYS A;  1HXY D;  1S5C D;  4WOR A;  5EKK A;  1YNN D;  1QNK A;  1STB A;  2KCC A;  3H6M A;  5FO8 B;  4KKS A;  2EY1 A;  2WB1 B;  1ILQ A;  2ZT9 C;  3LX0 A;  3NHH A;  3GTO B;  5I9O A;  3WDN A;  2E2I B;  2A74 C;  3MEH A;  1C4Q A;  5CGK A;  3C2P A;  1VMC A;  4H44 C;  1PDQ A;  3K5L A;  2VB2 X;  1V1P B;  1B44 D;  1D1I A;  2C5C A;  3EVQ A;  3SXH A;  4ZK9 B;  2F0H A;  5EKI A;  5CV8 A;  3K6O A;  2B39 A;  1PLF A;  2B2Y C;  1ENF A;  1FNW A;  5CV9 A;  4KY5 A;  3FPU B;  4FP5 D;  2RDH A;  2CW0 D;  1UEA B;  2I07 B;  1D6E C;  1TY0 A;  2K05 A;  5C4H A;  1IW7 C;  4XYO A;  4QUC A;  4DXF A;  3R2I A;  5EQ0 A;  2QIL A;  4RCN A;  1EIH A;  4NP5 A;  1F9S A;  1STA A;  2RQX A;  4CGY B;  4IUU A;  2TSS A;  3T56 B;  1LTB D;  4CKE A;  5IGE A;  4TKO B;  5C4X B;  1QE6 A;  4PQX A;  1HFG A;  2AWO A;  2ZXP A;  2EY5 A;  1DD2 A;  1ZYR C;  1OXU A;  3OWE B;  5IT9 L;  4ZKC B;  4ME5 A;  3BS1 A;  3QG1 A;  1SNM A;  2WIN B;  2A6E C;  3NSW A;  3NBH A;  2LMC B;  1EYC A;  2R92 B;  3KLS A;  1KLG D;  1ZXT A;  2F3V A;  1IW7 D;  2PZU A;  1F2M A;  5D3D A;  5C0X H;  4F8M A;  1JIC A;  4IAL A;  5EPK A;  3GTM B;  2XN9 C;  3H0G B;  3K58 A;  3I8Z A;  3PIP 3;  3MA2 B;  3K5O A;  1QWY A;  4BY7 B;  3BYT B;  1PFB A;  4K2L A;  1D5Z C;  3NWT A;  3X3M A;  1KDC A;  2G9H D;  1ZYR D;  4X3T A;  2WAC A;  4IUP A;  1R9T B;  1WTR A;  1A2T A;  1VF7 A;  2L12 A;  4C1N I;  1I6H B;  5C44 B;  1VCI A;  3M3Y B;  1LTG D;  4DFA A;  3C46 A;  2A6E D;  3L7Z C;  3J7A V;  4ULL A;  1CFM A;  3M4O B;  2GA4 B;  3I73 A;  4JK1 C;  3FRP B;  1JOQ A;  3U9O A;  1DCZ A;  2EY2 A;  2L4N A;  3C1E A;  3F2U A;  1J8I A;  1D5X C;  3PUZ A;  1EY4 A;  2A6H C;  1Q8I A;  3KLS X;  1JC7 A;  4J1M A;  4CKC A;  1SFO B;  1HCZ A;  4K5W A;  2ZXR A;  2NVQ B;  1G91 A;  5JEA G;  4LK1 C;  4G7O C;  1BCP D;  1JCK B;  2JA8 B;  1Q12 A;  2PMZ B;  1QCB D;  4DF7 A;  1FNU A;  2AUJ D;  1B50 A;  2OXP A;  3IAY A;  4ZAI A;  2PQE A;  2Z4H A;  4HAE A;  2IX0 A;  4XQJ A;  2K5W A;  3V96 A;  2JA6 B;  4F7X A;  1RF2 D;  3GD7 A;  2A6H D;  4F88 A;  5BN3 A;  1GUG A;  4FNF A;  1I4G A;  3IKJ A;  1OO9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...