3KLRA

Bovine h-protein at 0.88 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
SVRKFTEKHEWVTTENGVGTVGISNFAQEALGDVVYCSLPEVGTKLNKQEEFGALESVKAASELYSPLSGEVTEINKALAENPGLVNKSCYEDGWLIKMTFSNPSELDELMSEEAYEKYIKSIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution X-ray crystal structure of bovine H-protein at 0.88 A resolution
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
molecule keywords Glycine cleavage system H protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3klrA00
1O7LA 4OGQC 1Q12A 2AWOA 2K32A 4KKUA 4XTCS 4IFDG 1Y69U 1DD2A 1QJOA 5BN5A 1GUNA 4KHZA 1H9JA 3GQBA 5KNBA 1H9SA 1T5EA 2A6EC 2CW0C 3M7NA 3OOCA 4DK1A 4G7ZC 2O5JC 2QF7A 4IQZA 2BA0A 4KKTA 1OXVA 1K8MA 2EJFC 3NE5B 1H9MA 1Z7TA 2KCCA 1TU2B 4DK0A 3BDOA 4IFDH 3CRLC 4TKOB 2DN8A 2YYZA 3SDZA 1GHKA 2JE6I 2L5TA 2D5DA 3A8KE 3IKJA 1OXTA 1Y8PB 2E76C 2E74C 3P20A 2A6ED 4KMUC 1K8OA 1GJXA 3M4YA 2EJMA 1ZKOA 1HCZA 2JEBI 1GUSA 1ONLA 2NN6G 2ZT9C 3DXJC 3PUYA 4BA1I 1HPCA 1LABA 2K7VA 3LWUA 3OW7A 4JK1C 3A7AB 1E2ZA 3MXUA 5JEAG 2BE5C 3PUXA 1OXUA 1OXXK 4G7OC 2EDGA 1BDOA 3T51B 1PMRA 5K36H 1OXSC 4H44C 1O78A 2A6HC 1V43A 2JXMB 4KN4C 3A8JE 4I7ZC 5BN4A 4KKSA 3A7LA 2B8FA 3VR6A 3T53B 2JEAI 3N6RA 3AB9A 2A6HD 3I73A 4JBWA 1HQMC 1H9KA 4OO1G 1YNNC 1GUOA 3SE0A 1ZYRC 5JEAH 2NN6H 3VR3A 2IT1A 3RLFA 2BE5D 5KNCA 1A6XA 1VF7A 4BA2I 2A69D 1SMYC 1LACA 1DXMA 2D2CC 1VCIA 3TZUA 1FR3A 4KI0A 1YNJC 3I4LA 2R6GA 4DNRB 2PNRC 3VR5A 2B8GA 2D62A 3U9SA 4L8JA 1IYVA 3QIAA 3WDNA 4GZYC 3ND8A 1DCZA 2F1MA 1Y8OB 4HR7B 1EWHA 2DNEA 2DNCA 3FMCA 3PUWA 3VA7A 2A69C 3D31A 1V8QA 1IYUA 3W3AA 3PV0A 1IW7C 2EJGC 2V4DA 2E75C 1H9RA 2K33A 1GUGA 3IFTA 1G291 1E2WA 1CTMA 5C0XH 4H13C 3KLRA 3OPOA 4RCNA 5BN3A 1Q1BA 1B9NA 2EVBA 4G7HC 1Q1EA 4KN7C 2BDOA 3GD7A 3I72A 3H94A 3VR2A 2AUKA 2NN6I 3T56B 4OO1H 3D4RA 1Z6HA 1TKWB 1IW7D 3VR4A 3LNNA 2PCFB 2PPBC 5KNDA 1Y8NB 3BG3A 3CRKC 3ND9A 1GUTA 1GHJA 3MFYA 4H0LC 2BA1A 2LMCB 1Q90A 1CFMA 1H9SB 1CI3M 1FYCA 3PUZA 1B9MA 3QG1A 4DNTB 3QJYA 5K36G 3HGBA 1E2VA 3L7ZC 1HTPA 3A8IE 2O5IC 3EQLC 3PUVA 2AUJD 2A68D 4PV1C 4XIGS 1I6VC 1VDZA 2Q8IB 4TQUS 2KA7A 4LJZC 5C0XG 5A35A 4LK1C 3M85A 3FPPA 2A68C 1VF5C
chains in the Genus database with same CATH superfamily
1F9RA 4BBRB 1HJPA 4RGOS 4JI1L 4OGQC 3PIOA 1VQ5A 2R93H 5KNBA 2CW0C 4G7ZC 3CC4A 3SK5A 2GA4B 1PH3A 1ENFA 3LWEA 5IT9E 3FP9A 2MO0A 3VYUA 4J6HA 1MKHA 5JVH3 4A3EB 2JJQA 2K01A 3QB3A 3H0GH 1VQMA 4OHJA 2F0DA 4Y7NB 1LTID 2TSSA 1PH7A 4NP5A 1CA6A 1EY8A 3PUXA 3M3YH 5IGGA 3NSWA 2EY6A 5CV4A 5M5YB 5I2XA 3ERSX 4CDCC 4ILWA 2F0GA 4OELB 2B2TC 3RZOH 4F87A 1I6HB 2BE5D 5CV5A 1ET6A 3PO3G 3GTPB 1WTPA 1I3QB 4BA2I 1STNA 1B70B 1VQ4A 4PNYA 4GKJQ 4ME3A 3HZXA 1YNJC 3I4LA 5ELOA 2Q2UA 4GS3A 2IWHA 4CBVA 3ITPA 3TS2A 2E2JH 5FLXL 2R93G 3F2DA 1SR3A 5LMUQ 4IUUA 5C3XA 2JA7H 1A15A 1I5FA 2O4XA 4QIWB 4K8IA 4GOPA 1C0AA 3NQTA 4CDDC 3K5LA 1G2SA 1KLUD 4HSPA 1SYEA 3DWPA 4UDUC 1HNXL 2RSNA 1AE2A 3VA5A 4A3DG 5E7NA 3H94A 4C3IH 3Q0AA 3KFUA 1QVFA 1N8RC 1NUCA 1BBXC 2N3SA 3W1BA 1KD1C 3OWEB 1WI5A 1CFMA 1H9SB 1SN8A 2NVXB 1TWGB 2YTYA 2RCNA 1YI2A 1CKNA 4X62Q 1H95A 4FXDA 3P7JA 2M9VA 3FDTA 2E5LL 1IZ6A 3A0JA 4JI2Q 3CKIB 1PA6A 1Y69U 4DR4Q 5FLMG 2J4XA 4RHSA 4BBRH 1K8MA 2LFNA 4ALPA 2G5DA 3RUZA 2GVBA 2RCFA 1BR9A 1GHKA 2JE6I 3IKJA 5IP7G 1ICWA 1VQDA 3C1FA 4ZLTF 4FYDA 3S1QB 4RH6A 2VB3X 5DLQE 4DUYL 4EQPA 1YNND 2K5NA 2A1AA 4PMCA 3U50C 1E2ZA 4XQJA 5J1ZA 4JI6Q 3S16H 3UDGA 2Q2IA 4R4CA 4JI7Q 4X3KA 1KRSA 1Y1VH 4HN7A 3GV3A 1D5ZC 3M4OH 1STAA 1I94L 1LT4D 3S1QH 1I4GA 4A75A 5C4ZA 3HKZE 1YITA 1B8AA 5IYBH 2ATWA 4DPGA 2LS01 3D8GA 1EUJA 2BDNA 4LF7Q 1ENAA 1LTTD 1PZID 4KJNA 1RTOA 3VYSA 5FJ8G 5GQOA 3I56A 4R8IA 1ICFB 2PNHA 3ZJYC 2Z4IA 2DUDA 4GNXC 3TEHB 3FEWX 1X3QA 2H1EA 3CXCA 1PZKD 3MEFA 4UPAA 4Z9CB 3K5MA 2DNEA 1XXGA 1LYLA 4LW1A 2I5LX 5J3BA 1UWVA 1IW7C 3K8AA 1Q81C 1FD7D 4JW0A 3R8BA 1TWGH 2RF4A 3DUZA 1EY0A 1YEZA 3I7FA 3KLWA 3HOXH 4KHPL 1X32A 1W2BA 2RDGA 1TWCB 1CKMA 3EJIA 1RIPA 3FKIG 4ZK9B 3KBGA 3E5SA 4APVA 1JR0D 1L1OC 3D6CA 5IYDH 3T1YL 2KOLA 4POFA 2JA5B 3MFYA 2WINB 1CI3M 3QG1A 1EY6A 4RCOA 1HTPA 3LX0A 4KD3A 4AYBB 3CC2A 2KECA 2C35B 4TQUS 1UUPA 2LXJA 4GLVB 3FPPA 4ZKBB 1PYWD 1MGSA 2JP1A 2VXWA 1EZ8A 2UXDQ 1F2YA 3IAYA 3M7NA 3OOCA 1ZEQX 3OYYA 2BA0A 2EYFA 5IYCH 2Z0SA 3BDOA 1NCVA 1P8LA 5JOBA 2L5TA 4MN3A 2D5DA 3NTKA 2CHBD 2LXKA 1STHA 2E76C 3NPPA 3AMUA 3S2HH 3E0JA 4JI3L 3OTOQ 1CQVA 5FLXc 3PMFA 4KTAA 3STBC 3S17H 3S16B 3U4VA 5M5YH 2Q2HA 4H7BA 3T1YQ 1BOSA 1UEBA 3MAQA 2DJFC 2OWOA 4N8X1 1I6HH 1YJWA 2FMCA 4LMQD 3Q8DA 2WIIB 5E3FA 3RLFA 1A6XA 5A2QL 2V1CC 1PRTB 4RGTA 2HIXA 1NNXA 4PMWA 1FR3A 5M9OA 4MTNA 3CCEA 3UI2A 4QF4A 2DNCA 2F0QA 5CV9A 5L37A 2VQEQ 3AEVA 2MNAA 2F0EA 1S5DD 2K1BA 2OXPA 4OWXB 1H9RA 5LMNW 4DUYQ 1V9PA 4PZ7A 3BYYB 4YHHQ 4DA2A 4MTKA 3I2ZA 1FVIA 1M4VA 3VR2A 2DY7A 1HA6A 2QEXA 3TRZA 4RWSC 1GVPA 4QUCA 4IFDI 4ZRZA 1QVCA 3E0EA 3S2HB 2E8GA 3H09A 1GO3E 2F0PA 2A19A 4DR5Q 1B9MA 3QJYA 4JYAL 1O7ZA 1C8CA 1MJCA 5IYDG 1K28A 3TSSA 1HNWQ 1FNWA 5FK9C 4QUFA 3EA6A 3WWVA 1QILA 4LF4Q 1PTOF 1C9OA 2AHOB 2E5LQ 3G6EA 4KKUA 1WYDA 2B2UA 1KIXA 5IWAL 2CVRA 5JPMC 2O5JC 3D0FA 2KCNA 3L2PA 1OXVA 3EVQA 3PQIA 4MZ9A 4JOIA 1JWSD 1G91A 2Z4HA 2E74C 2X69A 2JA5H 1RD9D 3R2IA 4LF9Q 3CQZB 1X6OA 4S3SA 3DEOA 3M3YB 4FO2A 5C6AA 2PQAA 3S14B 2NZHA 2FJ2A 3UDXA 1EQVA 1U4RA 3KF6A 4NXNL 1OXXK 4DV7Q 1WTOA 1WTHA 4DAPA 4L5RC 1STYA 5BN4A 4DR5L 2VQEL 1QCBD 3N6RA 3CHBD 4DF7A 4KHPQ 4AYBE 3C3LA 4DV4Q 1GUOA 4GKJL 1ZYRC 3V05A 2C5CA 5JJKA 4LF4L 3ULJA 3K58A 3VYRA 5CGKA 5FKAC 4B08A 3SGIA 4JG2A 2VQFL 3S1NH 3MXPA 3KOJA 1IYVA 2HHHQ 1QUQB 4QMGA 1WTVA 4OIJA 2WACA 4Q0FA 5ELEA 1D1IA 1QNKA 1TS3A 5FLMH 1V1PB 1Y1VB 4WFN3 1Q1BA 1VQPA 2CH4A 3MWYW 1A63A 4K6LA 2VS1A 3QOJA 3NUCA 1IW7D 5T1IA 4A3CH 5KNDA 4DR3L 1YNXA 5LL6X 3ULPA 4JPBW 2ZM6Q 4K0KL 3FKIB 2MQHA 3C2PA 2QA4A 4YWKA 4GN3B 1HQRD 3MZ5A 4C3HH 5C4JH 1SNMA 1PTOD 4DR2Q 4FF4A 2QEJC 2KA7A 4CKCA 4LK1C 3M85A 1X3GA 1STEA 4IUNA 3NTIA 1VQAA 5EAYA 1DOMA 1ESFA 4IUVA 4CGYB 3RNUA 4JOIC 3J7ZC 1DM0B 4C1NK 3NHHA 1S5ED 4QIWE 1NMFA 1U9RA 2XRSD 4AH6A 4CJ2C 2R7ZG 1TQOA 1SAPA 3KJPA 3BVZA 1TY2A 2KHJA 3DWQA 3P75A 1U5KA 4DK0A 4ZUIA 1D2BA 3TS0A 2ASBA 2FHTA 2K4KA 1RHPA 3A8KE 4PZ8A 3NXWA 1Q86C 1BCPC 3I4OA 2A6ED 3G7LA 1A3VA 4NPSA 1QZHA 1M8AA 2Z1CA 4BWGB 3D4DA 2NVYH 2F4VL 2BE5C 3TN2A 3CCMA 2Z9HA 1XX8A 1O78A 4UAIA 3A7LA 3RLOA 3S1RB 3F2CA 4DV6L 4B3SL 1EZ6A 3RD4A 4YHHL 1HH2P 1G2TA 2NN6H 2IT1A 5IY0A 3CU7A 1S5CD 4X66L 1G8ZD 1CKOA 1LT6D 2F0TA 5IWAQ 2K5WA 2L1BA 3PF5A 1HFGA 5FLXE 1EIHA 2RHSB 3MXNB 4C3JH 2B63B 3NBHA 2B8GA 1E7ZA 2BOSA 1I3QH 5D3DA 3BS1A 2B2VC 4ZCKA 4DR6L 1HNWL 3D31A 3C1EA 2V4DA 4XXEA 4IPCA 5GROA 2MHVA 2QDLA 3RZDB 4CJ1B 5FJ8H 3TREA 2R7FA 2IL8A 3HOUB 3FVQA 1HFNA 2O2LD 3T56B 3X3NA 4XT1B 1TKWB 3DEPA 3CAMA 2I0QA 4OWTB 1C48A 1GHJA 5M3FH 3SR1A 3H0GB 1AZPA 2B39A 3O13A 3J7A5 1V1QA 1B3QA 4K8JA 1KTKA 1XTDA 2UUAL 1NMGA 4C3IG 4U673 3Q22A 4C56C 2WFWA 3K57A 1W6JA 4TSSA 3PO2B 4A93G 5GAHC 2L9HA 4B9WA 2VUMH 2F52A 1Q12A 4CJ0B 5DEHA 2UUBL 1CK1A 1S5FD 3I91A 1JB7A 1TIID 1U0LA 2NVTH 2NVQH 4BY7B 1PYBA 1CZGA 2IJ0A 4A3JG 1HR0W 1V1PA 3CRLC 4BBRG 1C4QA 1IBKQ 2UXBQ 5C4JB 3R3OA 1JCKB 4QL5A 4JI2L 3AFQA 1KXLA 4UP7A 2UU9Q 1I94Q 2EJMA 1PRTF 1VQ8A 3A54A 2F0VA 1SFOH 4JK1C 2CH4W 4WJ3M 1WTQA 4DV7L 4JBKA 4ZYSA 2A73B 2EYHA 5M3MG 2R92H 3BZKA 1JT8A 5C4XH 4J15A 1E0BA 3OIPA 1LTBD 2F0KA 1KRTA 1S72A 4K2KA 4ME5A 1VQ9A 1S5BD 1CHPD 1YVCA 1LM0A 1K73C 5KNCA 4IO9A 2IX0A 1YJ9A 1SMXA 4WORA 4K5VA 2CFMA 2CWAA 1TS4A 1SSOA 2M2LA 2E2HH 4EQ5A 1MD2D 1FJGL 4C2MH 4LFCQ 4QY7A 1VQCA 1T9HA 2EY1A 1FNUA 1AZQA 4A76A 2VW9A 3KBXA 4HMJA 2KVMA 5IYCG 1V8QA 1IYUA 1VQJA 1YNJD 1R9TH 4KLKA 4HIDA 1DJRD 2XTIA 1A3TA 4G57A 2Y0SB 4RA8A 3CCVA 2B2TA 4BY1H 2UUCL 3I70A 4DKAC 3H15A 3K59A 5M3FB 1F9QA 4HMIA 3GTLH 1IYJB 1D5MC 4TVAB 1BNZA 4JI0Q 2JA9A 2PPBC 2NZOA 4GLXA 3BG3A 4RHRA 1EEFD 1Y1VG 4DR3Q 3ND9A 1EQTA 4GKKQ 2F0UA 1JJGA 4A3DB 1BXTA 1WTWA 1LTSD 1NTGA 2PZWA 4CKEA 3A5UA 1MSGA 2K5HA 3CCQA 4O2DA 1LO5D 3L7ZC 4U68A 1BBWA 4A3FH 4Y52H 4OONA 5C0XG 1RF2D 2R61A 3BDLA 1HZ9A 1VQFA 4IALA 1HXYD 1F2LA 1QG7A 5IIFA 2YTVA 4PQXA 1IBLL 2JA8G 3BDCA 2XSCA 4BBSG 5DM63 3ERQA 4LUOA 5FO7B 1RL2A 1WCMH 4MIUA 2PI2E 5IGCA 2FFKB 2ZTDA 1J8IA 2KCCA 4GN4B 2F03A 3TP8A 4TKOB 3K7UC 1N34L 1HA5A 3E9IA 2L15A 3H91A 2BH2A 4JV5Q 1GUSA 3EBEA 4BA1I 2PYKA 2L11A 2K7VA 3OW7A 1AW7A 3UE1A 5IYBG 1N36Q 1TS2A 4DR6Q 3PSIA 3M9BA 4EQNA 5K36H 5AJ3L 3CC7A 5C3EH 4I7ZC 3JAME 1L0XB 2NYZD 4EX5A 5I4DA 4RKBA 2E2IB 1YNNC 1L2FA 1JJ2A 4HCSA 2HD3A 4K5WA 1MHWC 5CMDA 2ICIA 4HJ8A 4GLAC 2NVTB 1LACA 1VQHA 1JICA 4DR1L 4RGNA 2HCIA 1U4LA 5EPLA 3GTLB 1PFMA 4DN4M 1DCZA 2F0OA 3PCOB 1A3UA 4JI8L 1R9TB 1KDBA 3Q6SA 2EZVA 2E75C 5EPKA 2B63G 1Q8IA 1E2WA 4C3JG 2B2YA 1J6QA 1MI2A 4LFBQ 1K8AC 4DV2Q 3M7GA 2LY7A 5HY6A 3I72A 1NBWA 2FMMA 3KF6B 3F2BA 4XYOA 2F3IA 2Z8LA 3VR4A 3HOUH 1NR2A 4K2LA 4NKLA 1EL0A 1CA5A 3CW2C 3JC66 2HDLA 1LT5D 5BR8L 1M1KC 3MC0B 3HOUG 4J1MA 4A4IA 3TQYA 1E24A 3J7YW 4F7XA 1HZAA 3VDYA 4DUZL 1RDPD 5LMUL 3GTGH 4KD4A 3OHXC 2O5IC 5HGQA 2EPBA 1TWAH 2JA5G 1IKMA 3PF4A 1N32L 5DM73 5A35A 2SEBD 4R1JA 1LTAD 3T4AC 3S2DH 4GOPB 1HNXQ 1NSNS 1KC8C 3UE0A 4DV3Q 1II3A 1SXTA 5LMNQ 1SRUA 4AQYQ 1XNRL 4DR4L 3MEHA 3I8ZA 4LF9L 3FRPB 4AIMA 4X66Q 1SDFA 4DGZA 2QF7A 3KK7A 1LTLA 2CQAA 2WKDA 1TU2B 3I4NB 3PIP3 4IPHA 4IUPA 1SROA 3P1HA 1SYCA 4R8NA 1KABA 1O80A 5I6WA 3MTSA 4OO1I 1SNDA 1CUKA 4DV4L 2OEOA 2JA6B 1AH9A 1UE5A 3TP5A 2EDGA 3GDEA 1XMQQ 3PO2H 1PH1A 3A8JE 1IL2A 5D3IB 3CQZH 3K0YA 4B3ML 1HQMC 4CDFC 4DV5Q 5M5WB 1EIYB 3I4MB 5M3MB 2I07B 5JAVA 2KCTA 1G6PA 1WD1A 4B3TQ 2XWBB 2D2CC 2WAQB 4HIOA 3IRBA 4CHTB 4DNIA 1ASYA 2JN4A 2K04A 3EROA 3HOWB 5A2QE 5IP9G 4NMZA 1JOKA 2B2YC 2PNRC 3ND8A 4DR7Q 2AKWB 2KQ3A 2JQOA 1WCMG 1VQ7A 3GTOB 3S17B 1X65A 5CC4A 3HOVH 3M4QA 3HS0C 1TWHH 3PV0A 4OX9L 2K33A 5JPNC 4FNFA 2PI2A 4A3BG 4DXGA 4DV1Q 2GVAA 5C0XH 4N9TA 5C4XB 5BN3A 1UEAB 2CWPA 4K0KQ 2UUCQ 1N32Q 1B44D 3F8TA 3J7AV 4DXFA 3LNNA 2PCFB 1Y8NB 5ISRA 3SK8A 3A56A 1X55A 4XDXA 2LMCB 1SLJA 1FYCA 1S40A 1Y14B 4NXMQ 1LTRD 1HUMA 1XPUA 3E3XA 4WJ4A 1B53A 5ELBA 3A8IE 5ELDA 1J9OA 1FL0A 2A68D 4XIGS 5C5LA 3S15H 3K80C 1PZJD 5IE8A 3QR8A 1XYIA 1EWCA 1N36L 2ZXPA 2F3VA 4DV0L 2K5DA 3GTQB 5AJ3Q 2EIFA 2VUMB 4XTCS 1YBYA 4LF6L 2Q8RE 4PMBA 2YV5A 5BN5A 1EY9A 1PFNA 3HFZB 2EY5A 2ZXOA 1BUVT 1WOCA 2FXQA 2VL6A 1JJCB 4Y7NH 1TWCH 1EOTA 1R4QB 4A3KH 1PTOH 4DAMA 2Z6KA 3DWAA 2RA4A 1K0SA 1Y1WH 4X62L 5IGFA 3J7AF 1SE2A 4GNXB 2LSSA 3M4YA 4IUTA 5IODA 3KYHC 1HPCA 1LABA 4A3FG 4EQOA 2TMPA 1BO0A 1O7IA 2KJXA 3MXUA 2DGYA 1B3AA 1OXUA 2GN5A 4G7OC 1HTLD 1PFSA 1EYGA 2AQ2B 3VR6A 2B2WA 1PH6A 1F2MA 1B50A 2ALYB 2Y0SE 3QOLA 4JBWA 1EU4A 4F88A 3F2UA 2N78A 3J80E 3JAML 1X56A 3KF8A 1L0WA 5AFWA 1CZWA 1T5XD 1L1OA 3HOXG 2RBMA 4IUQA 1DXMA 2B63H 3OTOL 3TZUA 4JI3Q 1DONA 1N9WA 2EYPA 3AFPA 2XNAC 1ZYRD 3J80i 4R4QA 3BYTB 2F1MA 4A3IB 1Y8OB 4ZUJA 1EIGA 1UAPA 3CMAA 3AU7A 3CCJA 4H13C 1B9NA 1PYSB 5DAUA 1XMQL 4I65A 1ENCA 1JMCA 1HR0Q 2G9HD 3GTOH 1F2ZA 3NBIA 1SYBA 2AMCB 3I3CA 4C3HG 4V190 3NEMA 4RAUC 4LF6Q 2QDBA 3KUPA 4FVMA 3B6YA 4XT3B 2WB1B 2XIWA 2Q8TA 3T1HL 2HIVA 3OSOA 4LF5Q 1EWIA 5M3MH 4P74A 4RGMA 3H3VC 3BVGA 2Q8IB 1I50B 4OEMB 2NVXH 1PLFA 3K5OA 3J81E 2N55A 1O7LA 4QCLA 3HOVG 5G3LD 1JE5A 3CPFA 1KDAA 2KCMA 3STBD 4IQZA 4JVZA 4KJOA 1SEBD 3RN2A 1Z7TA 3E9HA 1A2UA 4P72A 2JA8H 4HIMA 2WKCA 2XGTA 1YHBA 2WAQE 4LUZA 4UP8A 5IGBA 1S4ZA 1PRTD 5FO9B 4K5XA 1G6ZA 4DAYA 1ONLA 2SNSA 3BZDB 1N33L 2MO1A 3LWUA 5TSSA 5F2DA 1JORA 3NBHB 1PH8A 2HDMA 4NXNQ 1IL8A 3CP0A 1Q8KA 1BCPD 3ULLA 2OQKA 4L5SA 5ELNA 5J39A 1XMOL 1ASZA 5D14A 1QUQA 2D9UA 2JA6G 3NWTA 1FJGQ 3T13A 1BBUA 3SK6A 1O7YA 4DV5L 3J80L 1VQ6A 2HQEA 2JSOA 2I5HA 2L55A 4BY1G 3U4ZA 1IKLA 1QE6A 2M00A 1STGA 4NDXA 4O42A 4B3SQ 3BU2A 5IGDA 4LAAA 4PZ6A 1QOHA 4YWLA 1EOVA 1Z9FA 2QILA 2RHQB 4IJHA 3F1ZA 1D1KA 1HHVA 4O1NA 3TZDA 4FF1A 3HOWH 4L8JA 3WDNA 3W5OA 3JAMc 4LF8Q 4HIKA 4L63B 2WAQG 3W3AA 4B9XA 4OX9Q 1QVGA 1X3PA 3V96A 5I6YA 1ILPA 1K3BC 2PZUA 1U4MA 5M5WH 1K8GA 3I4MH 3UDFA 4IFDJ 4FF3A 4LFAL 1I4PA 1LV9A 2PQEA 4KK7A 2IW3A 3H3VH 2B2UC 2Q2TA 3SK4A 1GM5A 1FGBD 2NUCA 4P75A 1RODA 3WOEA 1VQLA 2RDFA 3G71A 2K50A 3DLLA 2EXZA 2PMZB 4C1NI 2OTLA 2EOTA 1QZGA 3PIPA 2HT1A 1BCPB 2UXCL 3KF8B 1ILQA 2JK8A 1NAPA 5E1FA 1X3FA 4EVOA 3EFXD 4QB4A 5IGEA 2HCCA 3I4NH 3H0GG 1OTCA 1SNPA 5G3LF 3RMHA 1EU3A 2P5ZX 2K32A 1PRTC 4C3IB 1K9MC 5KYIA 1YIJA 4Q5VA 1I4QA 3GTMH 4A93B 4X65L 1H9MA 3ICEA 1E22A 2H4OA 1C7YA 5KIXA 4JYAQ 2YYZA 1Q46A 2VUMG 1OXTA 2RSOA 1Y8PB 2NWGA 1IBLQ 3M4OB 3G48A 1XNQQ 4BY7G 2K14A 3K6OA 4OL7A 5GAGC 4KMUC 4BS9A 5C0XJ 3DXJC 5CV7A 3PUYA 1MIUA 4A3JB 3TBIB 1MSHA 5CV6A 4A3GH 5CORA 4IOCA 1SNQA 2ID0A 1A2TA 1BCPF 1N34Q 4K14A 3T51B 5FO8B 2A5HA 1V1OA 1K0RA 1DGSA 1E1OA 1CSQA 4JI4L 4A3FB 2EQSA 3MXGA 4ID6A 3SVMA 5J22A 1Y1WB 4B3TL 4A3CG 1E3PA 1EEID 5HGTA 1SBBB 1PDQA 4A3LH 1SJHD 3EN2A 3VYTA 1X9NA 3W2DA 4A3KB 1AP0A 4A3DH 3HOZB 3D6WA 2QKIC 1IBMQ 4NXML 2F0LA 3VR5A 3HOZH 2D62A 4DV2L 1EIFA 1G51A 3GTQH 4GZYC 3HOXB 1HUNA 1I50H 4V0BA 3KDFA 3K7AB 3NWSA 2A69C 2HUGA 4A3EH 4YCUA 3S15B 4R4TA 1JE4A 3CCUA 1GOZA 1PTOB 4M8AA 1EFID 3HEJA 4XQQA 4A3MG 5EKIA 4YY3L 1B1ZA 4A3IG 1HR0L 2DY8A 4JI8Q 5C3EB 3ER0A 4NW2A 1NJIC 1KL9A 1P16A 5LL6S 4C2MB 2UXDL 2OQ0A 2XRQD 4POGA 2Y0SG 3S9WA 1TXYA 4LFBL 4FP5D 4H0LC 1SYGA 1IXRA 4KHVA 4P2CB 3N52A 4DV3L 5M3FG 3I90A 3CF5A 1WJJA 1L0YB 3BJUA 5C3WA 3RR5A 1D8LA 3DM3A 2AUJD 4A3IH 1I6VC 4DK3C 1XNQL 4LJZC 2PW5A 2NTTA 4TRDA 2ZTCA 1K3RA 4G4KA 2ZJRA 1CM9A 2MGSA 3KJOA 4A3EG 4JI5Q 4DUZQ 1H9SA 3GTPH 1B4OA 3CCSA 1EYDA 4RMFA 3CMEA 4IFDH 4IURA 4JI4Q 5ELFA 1A0IA 4X64L 2JA8B 3HOVB 3OIQA 1PHJA 4BBSB 1X54A 4A3LG 2ZJQA 3T16A 4HJ9A 1X3EA 4E6IA 2ZT9C 5CYUA 1DOKA 3GTKB 1IBML 1F77A 1DZ1A 1KHIA 1VQIA 3QO2A 1WFQA 2PO4A 1OXSC 4GOPC 3NQIA 4HJ5A 2E2DC 3K5NA 2JEAI 4PG3A 4YCVA 2N88A 3QWNA 3SE0A 2KHSA 1A8VA 1SMYD 2SNMA 4YCWA 4HEDA 1PH5A 2R93B 1NR4A 1SMYC 2G9DA 4ZKCB 1KAWA 2AWNA 1Q82C 2R6GA 4DV1L 4A3BH 4LFCL 3U9SA 3NK9A 1PXUA 3RLNA 3MVVA 3KDFB 4J8QA 1YHQA 3GO5A 2IPKD 1B2TA 1D7QA 4M1UB 2KEDA 3C46A 3GTGB 1G291 2B2WC 3OPOA 5EKLA 3Q24A 4RCNA 4KN7C 2E2JB 2BDOA 4HSVA 1EQQA 4DAVA 3G6JB 1VQKA 4OO1H 5KEEA 3S2DB 4O0AA 4C3JB 4DK6C 1TY0A 1JC7A 1I4XA 2CCZA 1W3SA 2A8VA 3U58A 5CBAE 1Q90A 3RZOB 3SHLA 2EE1A 3A5ZB 5T1GA 1TWHB 4DV6Q 1YZ6A 1WVLA 1GKHA 5BR8Q 1CQFA 2KUMA 2K75A 4DU9A 4A3GG 1WTXA 2B3GA 4LWCA 1YHAA 2DJGC 4R9WA 2SOBA 4BY7H 3CPWA 2NVQB 2EYMA 5LHY1 2YU9B 2VZAA 4IFDG 2R7DA 1PH4A 2J7ZA 3GQBA 1CHQD 2RQXA 1LTGD 4IJLA 4IPDA 3HKZB 4ZAIA 2N8NA 4X65Q 5KGUA 2OT2A 4GKKL 1RKNA 5JEAJ 1VS0A 3OWFA 2H5XA 3OMGA 3P20A 1CKNB 1LUZA 3K0XA 4GNXA 2NN6G 5C0XI 3K81C 3I4NG 3PO3H 4X6AH 2KEEA 2JA6H 2EY2A 1WD0A 4H44C 5NUCA 1KNAA 1V43A 4IPGA 1TWFH 2X6LA 1L1OB 2NBFA 3GTJB 2ZTEA 2J0TD 4XYQA 4KV6A 4YY3Q 3A55A 5IT9c 5KYLA 4AQYL 3RN5A 3VR3A 2UUAQ 1AFPA 4H02A 3S1MH 4B3MQ 3FKIH 3G4SA 3MFGA 5IOCA 3PGZA 2L4NA 4P73A 4DNRB 1Y1WG 1PH2A 3I4MG 1K83H 4K6DA 2R7ZH 1I4HA 4HR7B 1EWHA 1GUWA 3FMCA 1VQOA 3VA7A 5K5PA 2ZM6L 2L12A 5I2YA 4KY5A 2FINB 3HOWG 1F9SA 1Q3LA 3WOFA 1YJNA 4HJAA 1SE3A 4G7HC 1WCMB 1Q1EA 4JBJA 2ICEC 2UU9L 2NN6I 5IT9L 1KQSA 3D4RA 3HOYB 2UXCQ 3S1NB 1JWMD 3MXNA 4F8MA 4A3BB 1TS5A 3OW2A 2F4IA 4A3MB 1EFWA 5C4XG 1Z47A 2JYOA 2R92G 2BA1A 5EPJA 3DMUA 5C3EG 2F0JA 4FDBA 1HZBA 1RCVD 2D0OA 2NZ1D 1E2VA 4X3UA 1KLGD 2VQFQ 5EBCA 3PIO3 4ABNA 1EY4A 1RTNA 4ULLA 4OIKA 3HKSA 5C4HA 2WB1E 3SEBA 5EKKA 2AWOA 2F0WA 3E6ZX 3L9AX 2XWJB 5LMNL 1GUNA 5GADC 2E2HB 4DK1A 1M90C 2D0PA 5EQ0A 3KLSX 2CW0D 2I46A 2A74C 4HJ7A 2E2IH 3MHBA 1XPOA 5IP9H 1MBYA 4L5TA 3CD6A 3H6MA 1DOLA 1K8OA 4KY6A 3R2TA 1TVXA 3ZYYX 5C44B 1CSPA 4ZQ3A 4B3RQ 3D4WA 3JAMi 1QB5D 2IHFA 5JEAG 2IX3A 1XTCD 1BF4A 3NTHA 4LF7L 3J81j 2F0FA 3AYHB 2N49A 4KKSA 2B8FA 3T53B 3X3MA 4HAEA 2KBNA 3S1MB 2BH8A 1H9KA 5ELCA 3J80c 3EIVA 1HZCA 4XQNA 1STBA 4LF8L 4JV5L 1VQGA 2I5MX 2PMZE 2XN9C 3UDIA 3S1RH 2UUBQ 2F0MA 1VCIA 2PZTA 3NP8A 2LKVA 2B29A 2SDFA 1BVSA 2MUYA 1D6EC 1SE4A 2JA7G 1JOQA 1EY7A 2CKZB 1HNZL 4WJWA 4UY8C 3GP7A 3IFTA 4MHEA 1NY4A 4JI5L 4HTHA 1CTMA 2IY5B 2ES2A 2F4VQ 1I4RA 1VMPA 2KENA 2K5VA 2XVSA 4UP9A 1VQEA 4CKBA 1AEXA 1E1TA 2F3WA 3K7AH 3AQQA 3J81c 3Q23A 2AUKA 3KLSA 4L5QA 1S3OA 3GTKH 1EYCA 1RJTA 4OWWB 3PUZA 3NENA 1J5EQ 3HGBA 2QCPX 4C3HB 1KAAA 2B2VA 1TR5A 1EY5A 4RFBA 5GAEC 3PUVA 4IN3A 4PV1C 5I9OA 1PH9A 2QGQA 2WB1G 3V2TA 4DAYB 4LF5L 4RKLA 3A74A 5I9PA 1JWUD 1FGUA 1VF5C 3L3OC 1JB3A 1K83B 4B3RL 4DV0Q 4DR1Q 2R3ZA 1QJOA 1W6KA 1Q7YC 1CT1D 2NB0A 4HCEA 4N8FA 3J81L 1TWAB 4DFAA 5M5XB 4A3JH 4A3GB 1MJEA 1LLRD 2EJFC 4P71A 2DN8A 5CR3A 4GN5A 2WP8J 3DHQA 4RG1A 4QGUA 1OO9B 3HKZG 5M5XH 4NB3A 3W1GA 1HCZA 2JEBI 4N9PA 3U9OA 3GTMB 4A93H 4JI0L 1ML0D 3A7AB 2KHIA 3H3VI 1XNRQ 2NVYB 1TT2A 3PO3B 4JI1Q 2A6HC 2JXMB 4KN4C 3BVMA 2EYJA 1ZXTA 1B7YB 1DYQA 3I73A 4OO1G 3GTJH 1SYDA 2CQOA 2C9OA 5FOBB 1ET9A 3BZCA 2EXDA 3URYA 2NTSA 4KI0A 2MP1A 4JBMA 5IP7H 4WRDA 4BY1B 2YU9H 1WTRA 4DR2L 1ESRA 3I55A 5H1SE 1HRJA 1XJVA 3TMEA 2RKSA 4EGVA 2WV6D 1GUGA 4I7AA 4JI6L 2MFIA 3KLRA 2AQ3B 2EVBA 5KRUA 1VMCA 5C5MA 1PVOA 3GD7A 1F9PA 1UE6A 3HOYH 2ENBA 2IHEA 2L0CA 3DM1A 1Z6HA 4ODGA 3TP6A 1EYAA 1D5XC 2MJ8A 4DR7L 1GUTA 1KNEA 4R4OA 3CCLA 3RZDH 1LT3D 2ZJPA 3T1HQ 4IOAA 1SE8A 4LNQA 5EJWA 1PV4A 1NE3A 3HOYG 3J81i 3M4PA 3IFDA 4KY7A 3CCRA 2R7ZB 1VDZA 2VB2X 4FF2A 2VNUD 5E4WC 2R92B 2RVLA 2A68C 2Z6KC 2F0SA 4MNOA 1SFOB 1HNZQ 1SYFA 2F0HA 2X6GA 1DD2A 2F0IA 4LFAQ 3NELA 5HURA 4L6TB 4KHZA 1H9JA 1KDCA 1T5EA 2A6EC 1FNVA 3HG9A 3HRZC 5CV8A 1XPRA 1PTOC 2AQ1B 1EQRA 4KKTA 3NE5B 4YIJA 1BQQT 1UNSA 3S24A 1IBKL 3FPUB 2UXBL 3SDZA 1BKBA 1SNCA 1AE3A 2Z6BA 1SJED 2K05A 1TWFB 2OCEA 1GJXA 4CDEC 1ZKOA 5JVG3 2YTXA 3LGJA 2BCOA 4R4IA 1N33Q 2ZXRA 5COYA 1A62A 4X64Q 1BDOA 4BXXG 1PMRA 3S14H 4JI7L 4UHVA 5C44G 1XMOQ 2EYLA 3AB9A 2A6HD 3HP3A 2VY3A 2HHHL 4LUVA 2PW7A 5JEAH 5EGTA 2OTJA 1VF7A 4A3MH 1JQYD 2A69D 3SXHA 1PFBA 4IZ8A 3TDQA 4YWMA 3GV6A 1UE1A 1JOOA 4FXGC 5DNFA 1GXDC 3QIAA 1J5EL 1IHZA 3FHWA 4A3KG 3PUWA 2EYOA 2HQLA 3HOZG 4BBSH 2F0NA 2MPMA 2EJGC 5D65A 2OF1A 4FXKC 1GD7A 2K03A 2JA7B 4X3SA 3OMCA 2IX1A 2K28A 2QW7A 3L0OA 4JCVE 1R4PB 5JJIA 2K52A 3MA2B 5C44H 2PQAB 3TP7A 1AN8A 3R93A 3CRKC 2K6AA 4AYBG 5E4XA 1SNOA 5EBDA 3PO2G 4X3TA 1QNUA 4BXXH 3D3RA 3IL8A 4OXPA 1XWEA 4DNTB 5JJLA 5K36G 1U4PA 4JC0A 2K5QA 3ONAB 4QJFA 3EQLC 2RDHA 1VQBA 1VQNA 4QQBX 5JJZA 1QWYA 1UE7A 5CBEE
chains in the Genus database with same CATH topology
1F9RA 4BBRB 4RGOS 4OGQC 5KNBA 2CW0C 4G7ZC 3SK5A 2GA4B 1ENFA 3LWEA 5IT9E 3VYUA 4J6HA 5JVH3 4A3EB 2K01A 3QB3A 4OHJA 2F0DA 4Y7NB 1LTID 2TSSA 4NP5A 1CA6A 1EY8A 3PUXA 5IGGA 3NSWA 2EY6A 5CV4A 5M5YB 5I2XA 4ILWA 2F0GA 2B2TC 4F87A 1I6HB 2BE5D 5CV5A 1ET6A 3GTPB 1WTPA 1I3QB 4BA2I 1STNA 4PNYA 3HZXA 1YNJC 3I4LA 2IWHA 4CBVA 3ITPA 5FLXL 4IUUA 5C3XA 1A15A 2O4XA 4QIWB 4K8IA 3NQTA 3K5LA 1G2SA 1KLUD 4HSPA 1SYEA 3DWPA 4UDUC 2RSNA 3VA5A 3H94A 3Q0AA 1NUCA 1BBXC 3OWEB 1CFMA 1H9SB 2NVXB 1TWGB 4FXDA 3P7JA 2M9VA 3FDTA 3CKIB 1Y69U 2J4XA 4RHSA 1K8MA 2LFNA 3RUZA 1BR9A 1GHKA 2JE6I 3IKJA 1ICWA 3C1FA 4ZLTF 4FYDA 3S1QB 4RH6A 2VB3X 4EQPA 1YNND 4PMCA 1E2ZA 4XQJA 5J1ZA 4X3KA 4HN7A 3GV3A 1D5ZC 1STAA 1LT4D 1I4GA 5C4ZA 2LS01 3D8GA 2BDNA 1ENAA 1LTTD 1PZID 4KJNA 1RTOA 3VYSA 4R8IA 2Z4IA 3FEWX 1X3QA 2H1EA 1PZKD 4Z9CB 3K5MA 2DNEA 1XXGA 1IW7C 1FD7D 3R8BA 3DUZA 1EY0A 1X32A 2RDGA 1TWCB 3EJIA 4ZK9B 3KBGA 3E5SA 1JR0D 3D6CA 2KOLA 2JA5B 3MFYA 2WINB 1CI3M 3QG1A 1EY6A 4RCOA 1HTPA 3LX0A 4KD3A 4AYBB 2KECA 4TQUS 1UUPA 3FPPA 4ZKBB 1PYWD 1MGSA 2JP1A 2VXWA 1EZ8A 1F2YA 3IAYA 3M7NA 3OOCA 1ZEQX 2BA0A 2EYFA 3BDOA 1NCVA 5JOBA 2L5TA 4MN3A 2D5DA 3NTKA 2CHBD 1STHA 2E76C 3NPPA 3AMUA 3E0JA 1CQVA 3PMFA 4KTAA 3S16B 4H7BA 1BOSA 3MAQA 2FMCA 4LMQD 2WIIB 5E3FA 3RLFA 1A6XA 5A2QL 1PRTB 4RGTA 4PMWA 1FR3A 5M9OA 3UI2A 4QF4A 2DNCA 2F0QA 5CV9A 2F0EA 1S5DD 2K1BA 2OXPA 1H9RA 3BYYB 4DA2A 1M4VA 3VR2A 2DY7A 1HA6A 4RWSC 4QUCA 4IFDI 4ZRZA 3S2HB 3H09A 2F0PA 1B9MA 3QJYA 1O7ZA 1C8CA 3TSSA 1FNWA 5FK9C 4QUFA 3EA6A 1QILA 1PTOF 4KKUA 2B2UA 2CVRA 5JPMC 2O5JC 2KCNA 1OXVA 3EVQA 1JWSD 1G91A 2Z4HA 2E74C 2X69A 1RD9D 3R2IA 3CQZB 4S3SA 3DEOA 3M3YB 4FO2A 5C6AA 3S14B 2FJ2A 1EQVA 1U4RA 1OXXK 1WTOA 4DAPA 1STYA 5BN4A 1QCBD 3N6RA 3CHBD 4DF7A 3C3LA 1GUOA 1ZYRC 3V05A 2C5CA 3K58A 3VYRA 5CGKA 5FKAC 4B08A 3MXPA 1IYVA 4QMGA 1WTVA 4OIJA 2WACA 4Q0FA 5ELEA 1D1IA 1QNKA 1TS3A 1V1PB 1Y1VB 4WFN3 1Q1BA 3MWYW 4K6LA 3QOJA 3NUCA 1IW7D 5T1IA 5KNDA 5LL6X 3FKIB 3C2PA 1HQRD 3MZ5A 1SNMA 1PTOD 4FF4A 2QEJC 2KA7A 4CKCA 4LK1C 3M85A 1STEA 4IUNA 3NTIA 1DOMA 1ESFA 4IUVA 4CGYB 1DM0B 4C1NK 3NHHA 1S5ED 2XRSD 1U9RA 4CJ2C 1TQOA 1SAPA 3BVZA 1TY2A 3DWQA 3P75A 4DK0A 1D2BA 4ZUIA 2FHTA 1RHPA 3A8KE 3NXWA 1BCPC 2A6ED 3G7LA 1A3VA 1M8AA 2Z1CA 4BWGB 3D4DA 2BE5C 3TN2A 1XX8A 1O78A 4UAIA 3A7LA 3S1RB 1EZ6A 3RD4A 1G2TA 2NN6H 2IT1A 3CU7A 1S5CD 1G8ZD 1LT6D 2F0TA 2K5WA 2L1BA 1HFGA 5FLXE 1EIHA 2B63B 3NBHA 2B8GA 2BOSA 5D3DA 3BS1A 2B2VC 3D31A 3C1EA 2V4DA 4XXEA 2MHVA 3RZDB 4CJ1B 2IL8A 3HOUB 3FVQA 1HFNA 2O2LD 3T56B 3X3NA 4XT1B 1TKWB 3DEPA 1C48A 1GHJA 3SR1A 3H0GB 1AZPA 2B39A 3O13A 4K8JA 1KTKA 4C3IG 4U673 3Q22A 4C56C 3K57A 1W6JA 4TSSA 3PO2B 2L9HA 4B9WA 1Q12A 4CJ0B 5DEHA 1CK1A 1S5FD 3I91A 1TIID 4BY7B 1CZGA 2IJ0A 1V1PA 3CRLC 1C4QA 5C4JB 3R3OA 1JCKB 2EJMA 1PRTF 3A54A 2F0VA 4JK1C 1WTQA 4ZYSA 2A73B 2EYHA 1E0BA 3OIPA 1LTBD 2F0KA 4K2KA 4ME5A 1S5BD 1CHPD 5KNCA 2IX0A 4WORA 4K5VA 1TS4A 1SSOA 2M2LA 1MD2D 2EY1A 1FNUA 1AZQA 3KBXA 4HMJA 2KVMA 1V8QA 1IYUA 1YNJD 1DJRD 1A3TA 2Y0SB 4G57A 4RA8A 2B2TA 3I70A 5M3FB 3K59A 1F9QA 4HMIA 1D5MC 1BNZA 2PPBC 3BG3A 4RHRA 1EEFD 3ND9A 1EQTA 2F0UA 4A3DB 1BXTA 1WTWA 1LTSD 2PZWA 4CKEA 1MSGA 1LO5D 3L7ZC 4U68A 5C0XG 1RF2D 2R61A 3BDLA 4IALA 1HXYD 1F2LA 1QG7A 5IIFA 4PQXA 3BDCA 2XSCA 5DM63 3ERQA 5FO7B 4MIUA 5IGCA 2FFKB 1J8IA 2KCCA 2F03A 3TP8A 4TKOB 1HA5A 3H91A 1GUSA 4BA1I 2PYKA 2L11A 2K7VA 3OW7A 1AW7A 1TS2A 4EQNA 5K36H 4I7ZC 3JAME 1L0XB 2NYZD 5I4DA 4RKBA 2E2IB 1YNNC 4HCSA 4K5WA 5CMDA 2ICIA 2NVTB 1LACA 1JICA 4RGNA 2HCIA 1U4LA 5EPLA 3GTLB 1PFMA 4DN4M 1DCZA 2F0OA 1A3UA 1R9TB 1KDBA 3Q6SA 2EZVA 2E75C 5EPKA 1Q8IA 1E2WA 4C3JG 2B2YA 1MI2A 3M7GA 2LY7A 3I72A 2FMMA 4XYOA 2Z8LA 3VR4A 1NR2A 4K2LA 4NKLA 1EL0A 1CA5A 2HDLA 1LT5D 3MC0B 4J1MA 3J7YW 4F7XA 1RDPD 4KD4A 3OHXC 2O5IC 2EPBA 1IKMA 5DM73 5A35A 2SEBD 1LTAD 3T4AC 1NSNS 1II3A 1SXTA 3MEHA 3I8ZA 3FRPB 1SDFA 4DGZA 2QF7A 3KK7A 2CQAA 2WKDA 1TU2B 3I4NB 3PIP3 4IUPA 3P1HA 1SYCA 4R8NA 1KABA 1O80A 5I6WA 3MTSA 4OO1I 1SNDA 2JA6B 2OEOA 3TP5A 2EDGA 3A8JE 5D3IB 3K0YA 1HQMC 5M5WB 3I4MB 5M3MB 2I07B 5JAVA 1WD1A 2XWBB 2D2CC 2WAQB 4CHTB 3HOWB 2K04A 3EROA 5A2QE 4NMZA 1JOKA 2B2YC 2PNRC 3ND8A 2KQ3A 3GTOB 3S17B 5CC4A 3HS0C 3PV0A 2K33A 5JPNC 4FNFA 4DXGA 5C0XH 4N9TA 5C4XB 5BN3A 1UEAB 1B44D 3J7AV 4DXFA 3LNNA 2PCFB 1Y8NB 5ISRA 3SK8A 3A56A 4XDXA 2LMCB 1FYCA 1LTRD 1HUMA 1B53A 5ELBA 3A8IE 5ELDA 1J9OA 2A68D 4XIGS 5C5LA 1PZJD 1XYIA 1EWCA 2ZXPA 2F3VA 2K5DA 3GTQB 2VUMB 4XTCS 2Q8RE 4PMBA 5BN5A 1EY9A 1PFNA 2EY5A 2ZXOA 1BUVT 1EOTA 1R4QB 1PTOH 3DWAA 2RA4A 5IGFA 3J7AF 1SE2A 3M4YA 4IUTA 5IODA 1HPCA 1LABA 4EQOA 2TMPA 1BO0A 2KJXA 3MXUA 1B3AA 1OXUA 4G7OC 1HTLD 2AQ2B 3VR6A 2B2WA 1F2MA 1B50A 3QOLA 4JBWA 1EU4A 4F88A 3F2UA 3J80E 3JAML 3KF8A 5AFWA 1CZWA 1T5XD 2RBMA 4IUQA 1DXMA 3TZUA 1DONA 2EYPA 2XNAC 1ZYRD 3BYTB 2F1MA 4A3IB 1Y8OB 4ZUJA 1EIGA 1UAPA 3AU7A 4H13C 1B9NA 5DAUA 4I65A 1ENCA 2G9HD 1F2ZA 3NBIA 1SYBA 4C3HG 3I3CA 4V190 4RAUC 2QDBA 3KUPA 4FVMA 4XT3B 2WB1B 2XIWA 2Q8TA 3OSOA 4RGMA 3H3VC 3BVGA 2Q8IB 1I50B 1PLFA 3K5OA 3J81E 2N55A 1O7LA 4QCLA 5G3LD 1KDAA 4IQZA 4KJOA 1SEBD 1Z7TA 1A2UA 2WKCA 5IGBA 1S4ZA 1PRTD 5FO9B 4K5XA 1G6ZA 4DAYA 1ONLA 2SNSA 3BZDB 3LWUA 5TSSA 5F2DA 1JORA 2HDMA 1IL8A 1BCPD 5J39A 5D14A 2D9UA 3NWTA 3T13A 3SK6A 1O7YA 3J80L 2HQEA 2JSOA 2L55A 1IKLA 1QE6A 2M00A 1STGA 4NDXA 4O42A 5IGDA 4LAAA 1QOHA 2QILA 1HHVA 1D1KA 4O1NA 3TZDA 4FF1A 4L8JA 3WDNA 4L63B 3W3AA 4B9XA 1ILPA 1X3PA 3V96A 5I6YA 2PZUA 1U4MA 4IFDJ 4FF3A 1I4PA 1LV9A 2PQEA 4KK7A 2IW3A 2B2UC 3SK4A 1FGBD 2NUCA 1RODA 3WOEA 2RDFA 2EXZA 2PMZB 4C1NI 2EOTA 1BCPB 1ILQA 1NAPA 5E1FA 4EVOA 3EFXD 4QB4A 5IGEA 2HCCA 1SNPA 5G3LF 3RMHA 1EU3A 2K32A 1PRTC 4C3IB 5KYIA 4Q5VA 1I4QA 4A93B 1H9MA 2H4OA 5KIXA 2YYZA 1OXTA 2RSOA 1Y8PB 2NWGA 3M4OB 3K6OA 4OL7A 4KMUC 4BS9A 5C0XJ 3DXJC 5CV7A 3PUYA 4A3JB 3TBIB 1MSHA 5CV6A 5CORA 1SNQA 2ID0A 1A2TA 1BCPF 4K14A 3T51B 5FO8B 2A5HA 1V1OA 4A3FB 3MXGA 4ID6A 3SVMA 5J22A 1Y1WB 5HGTA 1EEID 1SBBB 1PDQA 1SJHD 3VYTA 3W2DA 4A3KB 1AP0A 3HOZB 3D6WA 2QKIC 2F0LA 3VR5A 2D62A 4GZYC 3HOXB 1HUNA 4V0BA 3K7AB 3NWSA 2A69C 2HUGA 3S15B 1JE4A 1GOZA 1PTOB 4M8AA 1EFID 3HEJA 4XQQA 5EKIA 1B1ZA 2DY8A 5C3EB 4NW2A 5LL6S 4C2MB 2XRQD 3S9WA 4FP5D 4H0LC 1SYGA 4KHVA 4P2CB 3N52A 3I90A 1L0YB 5C3WA 2AUJD 1I6VC 4LJZC 2PW5A 2NTTA 4TRDA 4G4KA 1CM9A 2MGSA 1H9SA 1B4OA 1EYDA 4IFDH 4IURA 5ELFA 2JA8B 3HOVB 3OIQA 4BBSB 3T16A 4E6IA 2ZT9C 5CYUA 1DOKA 3GTKB 1F77A 1DZ1A 3QO2A 2PO4A 1OXSC 3NQIA 2E2DC 3K5NA 2JEAI 2N88A 3QWNA 3SE0A 2KHSA 1SMYD 2SNMA 4HEDA 2R93B 1NR4A 1SMYC 2G9DA 4ZKCB 2AWNA 2R6GA 3U9SA 3NK9A 1PXUA 3MVVA 4J8QA 3GO5A 2IPKD 1B2TA 4M1UB 2KEDA 3C46A 3GTGB 1G291 2B2WC 3OPOA 5EKLA 3Q24A 4RCNA 4KN7C 2E2JB 2BDOA 4HSVA 4DAVA 3G6JB 4OO1H 5KEEA 3S2DB 4C3JB 1TY0A 1JC7A 1I4XA 5CBAE 1Q90A 3RZOB 3SHLA 2EE1A 5T1GA 1TWHB 1WVLA 1CQFA 2KUMA 4DU9A 1WTXA 4R9WA 2SOBA 2NVQB 2EYMA 5LHY1 2YU9B 4IFDG 2J7ZA 3GQBA 1CHQD 2RQXA 1LTGD 3HKZB 4ZAIA 5KGUA 2OT2A 1RKNA 5JEAJ 3OWFA 3OMGA 3P20A 2NN6G 5C0XI 2KEEA 2EY2A 1WD0A 4H44C 5NUCA 1KNAA 1V43A 2X6LA 2NBFA 3GTJB 2J0TD 4XYQA 4KV6A 3A55A 5KYLA 3VR3A 1AFPA 3MFGA 5IOCA 2L4NA 4DNRB 4K6DA 1I4HA 4HR7B 1EWHA 1GUWA 3FMCA 3VA7A 5K5PA 2L12A 5I2YA 4KY5A 2FINB 1F9SA 1Q3LA 3WOFA 1SE3A 4G7HC 1WCMB 1Q1EA 2ICEC 2NN6I 5IT9L 3D4RA 3HOYB 3S1NB 1JWMD 3MXNA 4F8MA 4A3BB 1TS5A 2F4IA 4A3MB 1Z47A 2JYOA 2BA1A 5EPJA 3DMUA 2F0JA 1RCVD 2NZ1D 1E2VA 4X3UA 1KLGD 5EBCA 3PIO3 4ABNA 1EY4A 1RTNA 4ULLA 4OIKA 5C4HA 3SEBA 5EKKA 2AWOA 2F0WA 3E6ZX 3L9AX 2XWJB 1GUNA 2E2HB 4DK1A 5EQ0A 3KLSX 2CW0D 2I46A 2A74C 3MHBA 1MBYA 3H6MA 1DOLA 1K8OA 4KY6A 3R2TA 1TVXA 3ZYYX 5C44B 4ZQ3A 3D4WA 1QB5D 5JEAG 2IX3A 1XTCD 1BF4A 3NTHA 2F0FA 4KKSA 2B8FA 3T53B 3X3MA 4HAEA 3S1MB 1H9KA 5ELCA 4XQNA 1STBA 2XN9C 2F0MA 1VCIA 2PZTA 3NP8A 2LKVA 2SDFA 2MUYA 1D6EC 1SE4A 1JOQA 1EY7A 4WJWA 3GP7A 3IFTA 4MHEA 4HTHA 1CTMA 1I4RA 1VMPA 2XVSA 4CKBA 1AEXA 2F3WA 3Q23A 2AUKA 3KLSA 1EYCA 1RJTA 3PUZA 3HGBA 2QCPX 4C3HB 1KAAA 2B2VA 1TR5A 1EY5A 4RFBA 3PUVA 4IN3A 4PV1C 5I9OA 3V2TA 4RKLA 5I9PA 1JWUD 1VF5C 3L3OC 1JB3A 1K83B 2R3ZA 1QJOA 1W6KA 1CT1D 2NB0A 4HCEA 3J81L 1TWAB 4DFAA 5M5XB 4A3GB 1LLRD 2EJFC 2DN8A 5CR3A 2WP8J 3DHQA 1OO9B 1HCZA 2JEBI 4N9PA 3U9OA 3GTMB 1ML0D 3A7AB 2NVYB 1TT2A 3PO3B 2A6HC 2JXMB 4KN4C 3BVMA 2EYJA 1ZXTA 1DYQA 3I73A 4OO1G 1SYDA 2C9OA 5FOBB 1ET9A 3URYA 2NTSA 4KI0A 2MP1A 4WRDA 4BY1B 1WTRA 1ESRA 1HRJA 3TMEA 2RKSA 4EGVA 2WV6D 1GUGA 3KLRA 2AQ3B 2EVBA 5KRUA 1VMCA 5C5MA 3GD7A 1F9PA 2ENBA 2L0CA 3DM1A 1Z6HA 4ODGA 3TP6A 1EYAA 1D5XC 2MJ8A 1GUTA 1KNEA 1LT3D 5EJWA 3IFDA 4KY7A 2R7ZB 1VDZA 2VB2X 4FF2A 2VNUD 5E4WC 2R92B 2RVLA 2A68C 2F0SA 1SFOB 1SYFA 2F0HA 2X6GA 1DD2A 2F0IA 5HURA 4L6TB 4KHZA 1H9JA 1KDCA 1T5EA 2A6EC 1FNVA 3HG9A 3HRZC 5CV8A 1PTOC 2AQ1B 4KKTA 3NE5B 4YIJA 1BQQT 1UNSA 3FPUB 3SDZA 1SNCA 1SJED 2K05A 1TWFB 1GJXA 1ZKOA 5JVG3 2BCOA 2ZXRA 5COYA 1BDOA 1PMRA 2EYLA 3AB9A 2A6HD 3HP3A 2PW7A 5JEAH 5EGTA 1VF7A 1JQYD 2A69D 3SXHA 1PFBA 4IZ8A 3TDQA 3GV6A 1JOOA 4FXGC 5DNFA 1GXDC 3QIAA 1IHZA 3PUWA 2EYOA 2F0NA 2MPMA 2EJGC 5D65A 2OF1A 4FXKC 2K03A 2JA7B 4X3SA 3OMCA 2IX1A 2K28A 1R4PB 3MA2B 3TP7A 1AN8A 3R93A 3CRKC 2K6AA 5E4XA 1SNOA 5EBDA 4X3TA 1QNUA 3D3RA 3IL8A 1XWEA 4DNTB 5K36G 1U4PA 2K5QA 3ONAB 3EQLC 2RDHA 5JJZA 1QWYA 5CBEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7L A;  4OGQ C;  1Q12 A;  2AWO A;  2K32 A;  4KKU A;  4XTC S;  4IFD G;  1Y69 U;  1DD2 A;  1QJO A;  5BN5 A;  1GUN A;  4KHZ A;  1H9J A;  3GQB A;  5KNB A;  1H9S A;  1T5E A;  2A6E C;  2CW0 C;  3M7N A;  3OOC A;  4DK1 A;  4G7Z C;  2O5J C;  2QF7 A;  4IQZ A;  2BA0 A;  4KKT A;  1OXV A;  1K8M A;  2EJF C;  3NE5 B;  1H9M A;  1Z7T A;  2KCC A;  1TU2 B;  4DK0 A;  3BDO A;  4IFD H;  3CRL C;  4TKO B;  2DN8 A;  2YYZ A;  3SDZ A;  1GHK A;  2JE6 I;  2L5T A;  2D5D A;  3A8K E;  3IKJ A;  1OXT A;  1Y8P B;  2E76 C;  2E74 C;  3P20 A;  2A6E D;  4KMU C;  1K8O A;  1GJX A;  3M4Y A;  2EJM A;  1ZKO A;  1HCZ A;  2JEB I;  1GUS A;  1ONL A;  2NN6 G;  2ZT9 C;  3DXJ C;  3PUY A;  4BA1 I;  1HPC A;  1LAB A;  2K7V A;  3LWU A;  3OW7 A;  4JK1 C;  3A7A B;  1E2Z A;  3MXU A;  5JEA G;  2BE5 C;  3PUX A;  1OXU A;  1OXX K;  4G7O C;  2EDG A;  1BDO A;  3T51 B;  1PMR A;  5K36 H;  1OXS C;  4H44 C;  1O78 A;  2A6H C;  1V43 A;  2JXM B;  4KN4 C;  3A8J E;  4I7Z C;  5BN4 A;  4KKS A;  3A7L A;  2B8F A;  3VR6 A;  3T53 B;  2JEA I;  3N6R A;  3AB9 A;  2A6H D;  3I73 A;  4JBW A;  1HQM C;  1H9K A;  4OO1 G;  1YNN C;  1GUO A;  3SE0 A;  1ZYR C;  5JEA H;  2NN6 H;  3VR3 A;  2IT1 A;  3RLF A;  2BE5 D;  5KNC A;  1A6X A;  1VF7 A;  4BA2 I;  2A69 D;  1SMY C;  1LAC A;  1DXM A;  2D2C C;  1VCI A;  3TZU A;  1FR3 A;  4KI0 A;  1YNJ C;  3I4L A;  2R6G A;  4DNR B;  2PNR C;  3VR5 A;  2B8G A;  2D62 A;  3U9S A;  4L8J A;  1IYV A;  3QIA A;  3WDN A;  4GZY C;  3ND8 A;  1DCZ A;  2F1M A;  1Y8O B;  4HR7 B;  1EWH A;  2DNE A;  2DNC A;  3FMC A;  3PUW A;  3VA7 A;  2A69 C;  3D31 A;  1V8Q A;  1IYU A;  3W3A A;  3PV0 A;  1IW7 C;  2EJG C;  2V4D A;  2E75 C;  1H9R A;  2K33 A;  1GUG A;  3IFT A;  1G29 1;  1E2W A;  1CTM A;  5C0X H;  4H13 C;  3KLR A;  3OPO A;  4RCN A;  5BN3 A;  1Q1B A;  1B9N A;  2EVB A;  4G7H C;  1Q1E A;  4KN7 C;  2BDO A;  3GD7 A;  3I72 A;  3H94 A;  3VR2 A;  2AUK A;  2NN6 I;  3T56 B;  4OO1 H;  3D4R A;  1Z6H A;  1TKW B;  1IW7 D;  3VR4 A;  3LNN A;  2PCF B;  2PPB C;  5KND A;  1Y8N B;  3BG3 A;  3CRK C;  3ND9 A;  1GUT A;  1GHJ A;  3MFY A;  4H0L C;  2BA1 A;  2LMC B;  1Q90 A;  1CFM A;  1H9S B;  1CI3 M;  1FYC A;  3PUZ A;  1B9M A;  3QG1 A;  4DNT B;  3QJY A;  5K36 G;  3HGB A;  1E2V A;  3L7Z C;  1HTP A;  3A8I E;  2O5I C;  3EQL C;  3PUV A;  2AUJ D;  2A68 D;  4PV1 C;  4XIG S;  1I6V C;  1VDZ A;  2Q8I B;  4TQU S;  2KA7 A;  4LJZ C;  5C0X G;  5A35 A;  4LK1 C;  3M85 A;  3FPP A;  2A68 C;  1VF5 C; 
#chains in the Genus database with same CATH topology
 1F9R A;  4BBR B;  1HJP A;  4RGO S;  4JI1 L;  4OGQ C;  3PIO A;  1VQ5 A;  2R93 H;  5KNB A;  2CW0 C;  4G7Z C;  3CC4 A;  3SK5 A;  2GA4 B;  1PH3 A;  1ENF A;  3LWE A;  5IT9 E;  3FP9 A;  2MO0 A;  3VYU A;  4J6H A;  1MKH A;  5JVH 3;  4A3E B;  2JJQ A;  2K01 A;  3QB3 A;  3H0G H;  1VQM A;  4OHJ A;  2F0D A;  4Y7N B;  1LTI D;  2TSS A;  1PH7 A;  4NP5 A;  1CA6 A;  1EY8 A;  3PUX A;  3M3Y H;  5IGG A;  3NSW A;  2EY6 A;  5CV4 A;  5M5Y B;  5I2X A;  3ERS X;  4CDC C;  4ILW A;  2F0G A;  4OEL B;  2B2T C;  3RZO H;  4F87 A;  1I6H B;  2BE5 D;  5CV5 A;  1ET6 A;  3PO3 G;  3GTP B;  1WTP A;  1I3Q B;  4BA2 I;  1STN A;  1B70 B;  1VQ4 A;  4PNY A;  4GKJ Q;  4ME3 A;  3HZX A;  1YNJ C;  3I4L A;  5ELO A;  2Q2U A;  4GS3 A;  2IWH A;  4CBV A;  3ITP A;  3TS2 A;  2E2J H;  5FLX L;  2R93 G;  3F2D A;  1SR3 A;  5LMU Q;  4IUU A;  5C3X A;  2JA7 H;  1A15 A;  1I5F A;  2O4X A;  4QIW B;  4K8I A;  4GOP A;  1C0A A;  3NQT A;  4CDD C;  3K5L A;  1G2S A;  1KLU D;  4HSP A;  1SYE A;  3DWP A;  4UDU C;  1HNX L;  2RSN A;  1AE2 A;  3VA5 A;  4A3D G;  5E7N A;  3H94 A;  4C3I H;  3Q0A A;  3KFU A;  1QVF A;  1N8R C;  1NUC A;  1BBX C;  2N3S A;  3W1B A;  1KD1 C;  3OWE B;  1WI5 A;  1CFM A;  1H9S B;  1SN8 A;  2NVX B;  1TWG B;  2YTY A;  2RCN A;  1YI2 A;  1CKN A;  4X62 Q;  1H95 A;  4FXD A;  3P7J A;  2M9V A;  3FDT A;  2E5L L;  1IZ6 A;  3A0J A;  4JI2 Q;  3CKI B;  1PA6 A;  1Y69 U;  4DR4 Q;  5FLM G;  2J4X A;  4RHS A;  4BBR H;  1K8M A;  2LFN A;  4ALP A;  2G5D A;  3RUZ A;  2GVB A;  2RCF A;  1BR9 A;  1GHK A;  2JE6 I;  3IKJ A;  5IP7 G;  1ICW A;  1VQD A;  3C1F A;  4ZLT F;  4FYD A;  3S1Q B;  4RH6 A;  2VB3 X;  5DLQ E;  4DUY L;  4EQP A;  1YNN D;  2K5N A;  2A1A A;  4PMC A;  3U50 C;  1E2Z A;  4XQJ A;  5J1Z A;  4JI6 Q;  3S16 H;  3UDG A;  2Q2I A;  4R4C A;  4JI7 Q;  4X3K A;  1KRS A;  1Y1V H;  4HN7 A;  3GV3 A;  1D5Z C;  3M4O H;  1STA A;  1I94 L;  1LT4 D;  3S1Q H;  1I4G A;  4A75 A;  5C4Z A;  3HKZ E;  1YIT A;  1B8A A;  5IYB H;  2ATW A;  4DPG A;  2LS0 1;  3D8G A;  1EUJ A;  2BDN A;  4LF7 Q;  1ENA A;  1LTT D;  1PZI D;  4KJN A;  1RTO A;  3VYS A;  5FJ8 G;  5GQO A;  3I56 A;  4R8I A;  1ICF B;  2PNH A;  3ZJY C;  2Z4I A;  2DUD A;  4GNX C;  3TEH B;  3FEW X;  1X3Q A;  2H1E A;  3CXC A;  1PZK D;  3MEF A;  4UPA A;  4Z9C B;  3K5M A;  2DNE A;  1XXG A;  1LYL A;  4LW1 A;  2I5L X;  5J3B A;  1UWV A;  1IW7 C;  3K8A A;  1Q81 C;  1FD7 D;  4JW0 A;  3R8B A;  1TWG H;  2RF4 A;  3DUZ A;  1EY0 A;  1YEZ A;  3I7F A;  3KLW A;  3HOX H;  4KHP L;  1X32 A;  1W2B A;  2RDG A;  1TWC B;  1CKM A;  3EJI A;  1RIP A;  3FKI G;  4ZK9 B;  3KBG A;  3E5S A;  4APV A;  1JR0 D;  1L1O C;  3D6C A;  5IYD H;  3T1Y L;  2KOL A;  4POF A;  2JA5 B;  3MFY A;  2WIN B;  1CI3 M;  3QG1 A;  1EY6 A;  4RCO A;  1HTP A;  3LX0 A;  4KD3 A;  4AYB B;  3CC2 A;  2KEC A;  2C35 B;  4TQU S;  1UUP A;  2LXJ A;  4GLV B;  3FPP A;  4ZKB B;  1PYW D;  1MGS A;  2JP1 A;  2VXW A;  1EZ8 A;  2UXD Q;  1F2Y A;  3IAY A;  3M7N A;  3OOC A;  1ZEQ X;  3OYY A;  2BA0 A;  2EYF A;  5IYC H;  2Z0S A;  3BDO A;  1NCV A;  1P8L A;  5JOB A;  2L5T A;  4MN3 A;  2D5D A;  3NTK A;  2CHB D;  2LXK A;  1STH A;  2E76 C;  3NPP A;  3AMU A;  3S2H H;  3E0J A;  4JI3 L;  3OTO Q;  1CQV A;  5FLX c;  3PMF A;  4KTA A;  3STB C;  3S17 H;  3S16 B;  3U4V A;  5M5Y H;  2Q2H A;  4H7B A;  3T1Y Q;  1BOS A;  1UEB A;  3MAQ A;  2DJF C;  2OWO A;  4N8X 1;  1I6H H;  1YJW A;  2FMC A;  4LMQ D;  3Q8D A;  2WII B;  5E3F A;  3RLF A;  1A6X A;  5A2Q L;  2V1C C;  1PRT B;  4RGT A;  2HIX A;  1NNX A;  4PMW A;  1FR3 A;  5M9O A;  4MTN A;  3CCE A;  3UI2 A;  4QF4 A;  2DNC A;  2F0Q A;  5CV9 A;  5L37 A;  2VQE Q;  3AEV A;  2MNA A;  2F0E A;  1S5D D;  2K1B A;  2OXP A;  4OWX B;  1H9R A;  5LMN W;  4DUY Q;  1V9P A;  4PZ7 A;  3BYY B;  4YHH Q;  4DA2 A;  4MTK A;  3I2Z A;  1FVI A;  1M4V A;  3VR2 A;  2DY7 A;  1HA6 A;  2QEX A;  3TRZ A;  4RWS C;  1GVP A;  4QUC A;  4IFD I;  4ZRZ A;  1QVC A;  3E0E A;  3S2H B;  2E8G A;  3H09 A;  1GO3 E;  2F0P A;  2A19 A;  4DR5 Q;  1B9M A;  3QJY A;  4JYA L;  1O7Z A;  1C8C A;  1MJC A;  5IYD G;  1K28 A;  3TSS A;  1HNW Q;  1FNW A;  5FK9 C;  4QUF A;  3EA6 A;  3WWV A;  1QIL A;  4LF4 Q;  1PTO F;  1C9O A;  2AHO B;  2E5L Q;  3G6E A;  4KKU A;  1WYD A;  2B2U A;  1KIX A;  5IWA L;  2CVR A;  5JPM C;  2O5J C;  3D0F A;  2KCN A;  3L2P A;  1OXV A;  3EVQ A;  3PQI A;  4MZ9 A;  4JOI A;  1JWS D;  1G91 A;  2Z4H A;  2E74 C;  2X69 A;  2JA5 H;  1RD9 D;  3R2I A;  4LF9 Q;  3CQZ B;  1X6O A;  4S3S A;  3DEO A;  3M3Y B;  4FO2 A;  5C6A A;  2PQA A;  3S14 B;  2NZH A;  2FJ2 A;  3UDX A;  1EQV A;  1U4R A;  3KF6 A;  4NXN L;  1OXX K;  4DV7 Q;  1WTO A;  1WTH A;  4DAP A;  4L5R C;  1STY A;  5BN4 A;  4DR5 L;  2VQE L;  1QCB D;  3N6R A;  3CHB D;  4DF7 A;  4KHP Q;  4AYB E;  3C3L A;  4DV4 Q;  1GUO A;  4GKJ L;  1ZYR C;  3V05 A;  2C5C A;  5JJK A;  4LF4 L;  3ULJ A;  3K58 A;  3VYR A;  5CGK A;  5FKA C;  4B08 A;  3SGI A;  4JG2 A;  2VQF L;  3S1N H;  3MXP A;  3KOJ A;  1IYV A;  2HHH Q;  1QUQ B;  4QMG A;  1WTV A;  4OIJ A;  2WAC A;  4Q0F A;  5ELE A;  1D1I A;  1QNK A;  1TS3 A;  5FLM H;  1V1P B;  1Y1V B;  4WFN 3;  1Q1B A;  1VQP A;  2CH4 A;  3MWY W;  1A63 A;  4K6L A;  2VS1 A;  3QOJ A;  3NUC A;  1IW7 D;  5T1I A;  4A3C H;  5KND A;  4DR3 L;  1YNX A;  5LL6 X;  3ULP A;  4JPB W;  2ZM6 Q;  4K0K L;  3FKI B;  2MQH A;  3C2P A;  2QA4 A;  4YWK A;  4GN3 B;  1HQR D;  3MZ5 A;  4C3H H;  5C4J H;  1SNM A;  1PTO D;  4DR2 Q;  4FF4 A;  2QEJ C;  2KA7 A;  4CKC A;  4LK1 C;  3M85 A;  1X3G A;  1STE A;  4IUN A;  3NTI A;  1VQA A;  5EAY A;  1DOM A;  1ESF A;  4IUV A;  4CGY B;  3RNU A;  4JOI C;  3J7Z C;  1DM0 B;  4C1N K;  3NHH A;  1S5E D;  4QIW E;  1NMF A;  1U9R A;  2XRS D;  4AH6 A;  4CJ2 C;  2R7Z G;  1TQO A;  1SAP A;  3KJP A;  3BVZ A;  1TY2 A;  2KHJ A;  3DWQ A;  3P75 A;  1U5K A;  4DK0 A;  4ZUI A;  1D2B A;  3TS0 A;  2ASB A;  2FHT A;  2K4K A;  1RHP A;  3A8K E;  4PZ8 A;  3NXW A;  1Q86 C;  1BCP C;  3I4O A;  2A6E D;  3G7L A;  1A3V A;  4NPS A;  1QZH A;  1M8A A;  2Z1C A;  4BWG B;  3D4D A;  2NVY H;  2F4V L;  2BE5 C;  3TN2 A;  3CCM A;  2Z9H A;  1XX8 A;  1O78 A;  4UAI A;  3A7L A;  3RLO A;  3S1R B;  3F2C A;  4DV6 L;  4B3S L;  1EZ6 A;  3RD4 A;  4YHH L;  1HH2 P;  1G2T A;  2NN6 H;  2IT1 A;  5IY0 A;  3CU7 A;  1S5C D;  4X66 L;  1G8Z D;  1CKO A;  1LT6 D;  2F0T A;  5IWA Q;  2K5W A;  2L1B A;  3PF5 A;  1HFG A;  5FLX E;  1EIH A;  2RHS B;  3MXN B;  4C3J H;  2B63 B;  3NBH A;  2B8G A;  1E7Z A;  2BOS A;  1I3Q H;  5D3D A;  3BS1 A;  2B2V C;  4ZCK A;  4DR6 L;  1HNW L;  3D31 A;  3C1E A;  2V4D A;  4XXE A;  4IPC A;  5GRO A;  2MHV A;  2QDL A;  3RZD B;  4CJ1 B;  5FJ8 H;  3TRE A;  2R7F A;  2IL8 A;  3HOU B;  3FVQ A;  1HFN A;  2O2L D;  3T56 B;  3X3N A;  4XT1 B;  1TKW B;  3DEP A;  3CAM A;  2I0Q A;  4OWT B;  1C48 A;  1GHJ A;  5M3F H;  3SR1 A;  3H0G B;  1AZP A;  2B39 A;  3O13 A;  3J7A 5;  1V1Q A;  1B3Q A;  4K8J A;  1KTK A;  1XTD A;  2UUA L;  1NMG A;  4C3I G;  4U67 3;  3Q22 A;  4C56 C;  2WFW A;  3K57 A;  1W6J A;  4TSS A;  3PO2 B;  4A93 G;  5GAH C;  2L9H A;  4B9W A;  2VUM H;  2F52 A;  1Q12 A;  4CJ0 B;  5DEH A;  2UUB L;  1CK1 A;  1S5F D;  3I91 A;  1JB7 A;  1TII D;  1U0L A;  2NVT H;  2NVQ H;  4BY7 B;  1PYB A;  1CZG A;  2IJ0 A;  4A3J G;  1HR0 W;  1V1P A;  3CRL C;  4BBR G;  1C4Q A;  1IBK Q;  2UXB Q;  5C4J B;  3R3O A;  1JCK B;  4QL5 A;  4JI2 L;  3AFQ A;  1KXL A;  4UP7 A;  2UU9 Q;  1I94 Q;  2EJM A;  1PRT F;  1VQ8 A;  3A54 A;  2F0V A;  1SFO H;  4JK1 C;  2CH4 W;  4WJ3 M;  1WTQ A;  4DV7 L;  4JBK A;  4ZYS A;  2A73 B;  2EYH A;  5M3M G;  2R92 H;  3BZK A;  1JT8 A;  5C4X H;  4J15 A;  1E0B A;  3OIP A;  1LTB D;  2F0K A;  1KRT A;  1S72 A;  4K2K A;  4ME5 A;  1VQ9 A;  1S5B D;  1CHP D;  1YVC A;  1LM0 A;  1K73 C;  5KNC A;  4IO9 A;  2IX0 A;  1YJ9 A;  1SMX A;  4WOR A;  4K5V A;  2CFM A;  2CWA A;  1TS4 A;  1SSO A;  2M2L A;  2E2H H;  4EQ5 A;  1MD2 D;  1FJG L;  4C2M H;  4LFC Q;  4QY7 A;  1VQC A;  1T9H A;  2EY1 A;  1FNU A;  1AZQ A;  4A76 A;  2VW9 A;  3KBX A;  4HMJ A;  2KVM A;  5IYC G;  1V8Q A;  1IYU A;  1VQJ A;  1YNJ D;  1R9T H;  4KLK A;  4HID A;  1DJR D;  2XTI A;  1A3T A;  4G57 A;  2Y0S B;  4RA8 A;  3CCV A;  2B2T A;  4BY1 H;  2UUC L;  3I70 A;  4DKA C;  3H15 A;  3K59 A;  5M3F B;  1F9Q A;  4HMI A;  3GTL H;  1IYJ B;  1D5M C;  4TVA B;  1BNZ A;  4JI0 Q;  2JA9 A;  2PPB C;  2NZO A;  4GLX A;  3BG3 A;  4RHR A;  1EEF D;  1Y1V G;  4DR3 Q;  3ND9 A;  1EQT A;  4GKK Q;  2F0U A;  1JJG A;  4A3D B;  1BXT A;  1WTW A;  1LTS D;  1NTG A;  2PZW A;  4CKE A;  3A5U A;  1MSG A;  2K5H A;  3CCQ A;  4O2D A;  1LO5 D;  3L7Z C;  4U68 A;  1BBW A;  4A3F H;  4Y52 H;  4OON A;  5C0X G;  1RF2 D;  2R61 A;  3BDL A;  1HZ9 A;  1VQF A;  4IAL A;  1HXY D;  1F2L A;  1QG7 A;  5IIF A;  2YTV A;  4PQX A;  1IBL L;  2JA8 G;  3BDC A;  2XSC A;  4BBS G;  5DM6 3;  3ERQ A;  4LUO A;  5FO7 B;  1RL2 A;  1WCM H;  4MIU A;  2PI2 E;  5IGC A;  2FFK B;  2ZTD A;  1J8I A;  2KCC A;  4GN4 B;  2F03 A;  3TP8 A;  4TKO B;  3K7U C;  1N34 L;  1HA5 A;  3E9I A;  2L15 A;  3H91 A;  2BH2 A;  4JV5 Q;  1GUS A;  3EBE A;  4BA1 I;  2PYK A;  2L11 A;  2K7V A;  3OW7 A;  1AW7 A;  3UE1 A;  5IYB G;  1N36 Q;  1TS2 A;  4DR6 Q;  3PSI A;  3M9B A;  4EQN A;  5K36 H;  5AJ3 L;  3CC7 A;  5C3E H;  4I7Z C;  3JAM E;  1L0X B;  2NYZ D;  4EX5 A;  5I4D A;  4RKB A;  2E2I B;  1YNN C;  1L2F A;  1JJ2 A;  4HCS A;  2HD3 A;  4K5W A;  1MHW C;  5CMD A;  2ICI A;  4HJ8 A;  4GLA C;  2NVT B;  1LAC A;  1VQH A;  1JIC A;  4DR1 L;  4RGN A;  2HCI A;  1U4L A;  5EPL A;  3GTL B;  1PFM A;  4DN4 M;  1DCZ A;  2F0O A;  3PCO B;  1A3U A;  4JI8 L;  1R9T B;  1KDB A;  3Q6S A;  2EZV A;  2E75 C;  5EPK A;  2B63 G;  1Q8I A;  1E2W A;  4C3J G;  2B2Y A;  1J6Q A;  1MI2 A;  4LFB Q;  1K8A C;  4DV2 Q;  3M7G A;  2LY7 A;  5HY6 A;  3I72 A;  1NBW A;  2FMM A;  3KF6 B;  3F2B A;  4XYO A;  2F3I A;  2Z8L A;  3VR4 A;  3HOU H;  1NR2 A;  4K2L A;  4NKL A;  1EL0 A;  1CA5 A;  3CW2 C;  3JC6 6;  2HDL A;  1LT5 D;  5BR8 L;  1M1K C;  3MC0 B;  3HOU G;  4J1M A;  4A4I A;  3TQY A;  1E24 A;  3J7Y W;  4F7X A;  1HZA A;  3VDY A;  4DUZ L;  1RDP D;  5LMU L;  3GTG H;  4KD4 A;  3OHX C;  2O5I C;  5HGQ A;  2EPB A;  1TWA H;  2JA5 G;  1IKM A;  3PF4 A;  1N32 L;  5DM7 3;  5A35 A;  2SEB D;  4R1J A;  1LTA D;  3T4A C;  3S2D H;  4GOP B;  1HNX Q;  1NSN S;  1KC8 C;  3UE0 A;  4DV3 Q;  1II3 A;  1SXT A;  5LMN Q;  1SRU A;  4AQY Q;  1XNR L;  4DR4 L;  3MEH A;  3I8Z A;  4LF9 L;  3FRP B;  4AIM A;  4X66 Q;  1SDF A;  4DGZ A;  2QF7 A;  3KK7 A;  1LTL A;  2CQA A;  2WKD A;  1TU2 B;  3I4N B;  3PIP 3;  4IPH A;  4IUP A;  1SRO A;  3P1H A;  1SYC A;  4R8N A;  1KAB A;  1O80 A;  5I6W A;  3MTS A;  4OO1 I;  1SND A;  1CUK A;  4DV4 L;  2OEO A;  2JA6 B;  1AH9 A;  1UE5 A;  3TP5 A;  2EDG A;  3GDE A;  1XMQ Q;  3PO2 H;  1PH1 A;  3A8J E;  1IL2 A;  5D3I B;  3CQZ H;  3K0Y A;  4B3M L;  1HQM C;  4CDF C;  4DV5 Q;  5M5W B;  1EIY B;  3I4M B;  5M3M B;  2I07 B;  5JAV A;  2KCT A;  1G6P A;  1WD1 A;  4B3T Q;  2XWB B;  2D2C C;  2WAQ B;  4HIO A;  3IRB A;  4CHT B;  4DNI A;  1ASY A;  2JN4 A;  2K04 A;  3ERO A;  3HOW B;  5A2Q E;  5IP9 G;  4NMZ A;  1JOK A;  2B2Y C;  2PNR C;  3ND8 A;  4DR7 Q;  2AKW B;  2KQ3 A;  2JQO A;  1WCM G;  1VQ7 A;  3GTO B;  3S17 B;  1X65 A;  5CC4 A;  3HOV H;  3M4Q A;  3HS0 C;  1TWH H;  3PV0 A;  4OX9 L;  2K33 A;  5JPN C;  4FNF A;  2PI2 A;  4A3B G;  4DXG A;  4DV1 Q;  2GVA A;  5C0X H;  4N9T A;  5C4X B;  5BN3 A;  1UEA B;  2CWP A;  4K0K Q;  2UUC Q;  1N32 Q;  1B44 D;  3F8T A;  3J7A V;  4DXF A;  3LNN A;  2PCF B;  1Y8N B;  5ISR A;  3SK8 A;  3A56 A;  1X55 A;  4XDX A;  2LMC B;  1SLJ A;  1FYC A;  1S40 A;  1Y14 B;  4NXM Q;  1LTR D;  1HUM A;  1XPU A;  3E3X A;  4WJ4 A;  1B53 A;  5ELB A;  3A8I E;  5ELD A;  1J9O A;  1FL0 A;  2A68 D;  4XIG S;  5C5L A;  3S15 H;  3K80 C;  1PZJ D;  5IE8 A;  3QR8 A;  1XYI A;  1EWC A;  1N36 L;  2ZXP A;  2F3V A;  4DV0 L;  2K5D A;  3GTQ B;  5AJ3 Q;  2EIF A;  2VUM B;  4XTC S;  1YBY A;  4LF6 L;  2Q8R E;  4PMB A;  2YV5 A;  5BN5 A;  1EY9 A;  1PFN A;  3HFZ B;  2EY5 A;  2ZXO A;  1BUV T;  1WOC A;  2FXQ A;  2VL6 A;  1JJC B;  4Y7N H;  1TWC H;  1EOT A;  1R4Q B;  4A3K H;  1PTO H;  4DAM A;  2Z6K A;  3DWA A;  2RA4 A;  1K0S A;  1Y1W H;  4X62 L;  5IGF A;  3J7A F;  1SE2 A;  4GNX B;  2LSS A;  3M4Y A;  4IUT A;  5IOD A;  3KYH C;  1HPC A;  1LAB A;  4A3F G;  4EQO A;  2TMP A;  1BO0 A;  1O7I A;  2KJX A;  3MXU A;  2DGY A;  1B3A A;  1OXU A;  2GN5 A;  4G7O C;  1HTL D;  1PFS A;  1EYG A;  2AQ2 B;  3VR6 A;  2B2W A;  1PH6 A;  1F2M A;  1B50 A;  2ALY B;  2Y0S E;  3QOL A;  4JBW A;  1EU4 A;  4F88 A;  3F2U A;  2N78 A;  3J80 E;  3JAM L;  1X56 A;  3KF8 A;  1L0W A;  5AFW A;  1CZW A;  1T5X D;  1L1O A;  3HOX G;  2RBM A;  4IUQ A;  1DXM A;  2B63 H;  3OTO L;  3TZU A;  4JI3 Q;  1DON A;  1N9W A;  2EYP A;  3AFP A;  2XNA C;  1ZYR D;  3J80 i;  4R4Q A;  3BYT B;  2F1M A;  4A3I B;  1Y8O B;  4ZUJ A;  1EIG A;  1UAP A;  3CMA A;  3AU7 A;  3CCJ A;  4H13 C;  1B9N A;  1PYS B;  5DAU A;  1XMQ L;  4I65 A;  1ENC A;  1JMC A;  1HR0 Q;  2G9H D;  3GTO H;  1F2Z A;  3NBI A;  1SYB A;  2AMC B;  3I3C A;  4C3H G;  4V19 0;  3NEM A;  4RAU C;  4LF6 Q;  2QDB A;  3KUP A;  4FVM A;  3B6Y A;  4XT3 B;  2WB1 B;  2XIW A;  2Q8T A;  3T1H L;  2HIV A;  3OSO A;  4LF5 Q;  1EWI A;  5M3M H;  4P74 A;  4RGM A;  3H3V C;  3BVG A;  2Q8I B;  1I50 B;  4OEM B;  2NVX H;  1PLF A;  3K5O A;  3J81 E;  2N55 A;  1O7L A;  4QCL A;  3HOV G;  5G3L D;  1JE5 A;  3CPF A;  1KDA A;  2KCM A;  3STB D;  4IQZ A;  4JVZ A;  4KJO A;  1SEB D;  3RN2 A;  1Z7T A;  3E9H A;  1A2U A;  4P72 A;  2JA8 H;  4HIM A;  2WKC A;  2XGT A;  1YHB A;  2WAQ E;  4LUZ A;  4UP8 A;  5IGB A;  1S4Z A;  1PRT D;  5FO9 B;  4K5X A;  1G6Z A;  4DAY A;  1ONL A;  2SNS A;  3BZD B;  1N33 L;  2MO1 A;  3LWU A;  5TSS A;  5F2D A;  1JOR A;  3NBH B;  1PH8 A;  2HDM A;  4NXN Q;  1IL8 A;  3CP0 A;  1Q8K A;  1BCP D;  3ULL A;  2OQK A;  4L5S A;  5ELN A;  5J39 A;  1XMO L;  1ASZ A;  5D14 A;  1QUQ A;  2D9U A;  2JA6 G;  3NWT A;  1FJG Q;  3T13 A;  1BBU A;  3SK6 A;  1O7Y A;  4DV5 L;  3J80 L;  1VQ6 A;  2HQE A;  2JSO A;  2I5H A;  2L55 A;  4BY1 G;  3U4Z A;  1IKL A;  1QE6 A;  2M00 A;  1STG A;  4NDX A;  4O42 A;  4B3S Q;  3BU2 A;  5IGD A;  4LAA A;  4PZ6 A;  1QOH A;  4YWL A;  1EOV A;  1Z9F A;  2QIL A;  2RHQ B;  4IJH A;  3F1Z A;  1D1K A;  1HHV A;  4O1N A;  3TZD A;  4FF1 A;  3HOW H;  4L8J A;  3WDN A;  3W5O A;  3JAM c;  4LF8 Q;  4HIK A;  4L63 B;  2WAQ G;  3W3A A;  4B9X A;  4OX9 Q;  1QVG A;  1X3P A;  3V96 A;  5I6Y A;  1ILP A;  1K3B C;  2PZU A;  1U4M A;  5M5W H;  1K8G A;  3I4M H;  3UDF A;  4IFD J;  4FF3 A;  4LFA L;  1I4P A;  1LV9 A;  2PQE A;  4KK7 A;  2IW3 A;  3H3V H;  2B2U C;  2Q2T A;  3SK4 A;  1GM5 A;  1FGB D;  2NUC A;  4P75 A;  1ROD A;  3WOE A;  1VQL A;  2RDF A;  3G71 A;  2K50 A;  3DLL A;  2EXZ A;  2PMZ B;  4C1N I;  2OTL A;  2EOT A;  1QZG A;  3PIP A;  2HT1 A;  1BCP B;  2UXC L;  3KF8 B;  1ILQ A;  2JK8 A;  1NAP A;  5E1F A;  1X3F A;  4EVO A;  3EFX D;  4QB4 A;  5IGE A;  2HCC A;  3I4N H;  3H0G G;  1OTC A;  1SNP A;  5G3L F;  3RMH A;  1EU3 A;  2P5Z X;  2K32 A;  1PRT C;  4C3I B;  1K9M C;  5KYI A;  1YIJ A;  4Q5V A;  1I4Q A;  3GTM H;  4A93 B;  4X65 L;  1H9M A;  3ICE A;  1E22 A;  2H4O A;  1C7Y A;  5KIX A;  4JYA Q;  2YYZ A;  1Q46 A;  2VUM G;  1OXT A;  2RSO A;  1Y8P B;  2NWG A;  1IBL Q;  3M4O B;  3G48 A;  1XNQ Q;  4BY7 G;  2K14 A;  3K6O A;  4OL7 A;  5GAG C;  4KMU C;  4BS9 A;  5C0X J;  3DXJ C;  5CV7 A;  3PUY A;  1MIU A;  4A3J B;  3TBI B;  1MSH A;  5CV6 A;  4A3G H;  5COR A;  4IOC A;  1SNQ A;  2ID0 A;  1A2T A;  1BCP F;  1N34 Q;  4K14 A;  3T51 B;  5FO8 B;  2A5H A;  1V1O A;  1K0R A;  1DGS A;  1E1O A;  1CSQ A;  4JI4 L;  4A3F B;  2EQS A;  3MXG A;  4ID6 A;  3SVM A;  5J22 A;  1Y1W B;  4B3T L;  4A3C G;  1E3P A;  1EEI D;  5HGT A;  1SBB B;  1PDQ A;  4A3L H;  1SJH D;  3EN2 A;  3VYT A;  1X9N A;  3W2D A;  4A3K B;  1AP0 A;  4A3D H;  3HOZ B;  3D6W A;  2QKI C;  1IBM Q;  4NXM L;  2F0L A;  3VR5 A;  3HOZ H;  2D62 A;  4DV2 L;  1EIF A;  1G51 A;  3GTQ H;  4GZY C;  3HOX B;  1HUN A;  1I50 H;  4V0B A;  3KDF A;  3K7A B;  3NWS A;  2A69 C;  2HUG A;  4A3E H;  4YCU A;  3S15 B;  4R4T A;  1JE4 A;  3CCU A;  1GOZ A;  1PTO B;  4M8A A;  1EFI D;  3HEJ A;  4XQQ A;  4A3M G;  5EKI A;  4YY3 L;  1B1Z A;  4A3I G;  1HR0 L;  2DY8 A;  4JI8 Q;  5C3E B;  3ER0 A;  4NW2 A;  1NJI C;  1KL9 A;  1P16 A;  5LL6 S;  4C2M B;  2UXD L;  2OQ0 A;  2XRQ D;  4POG A;  2Y0S G;  3S9W A;  1TXY A;  4LFB L;  4FP5 D;  4H0L C;  1SYG A;  1IXR A;  4KHV A;  4P2C B;  3N52 A;  4DV3 L;  5M3F G;  3I90 A;  3CF5 A;  1WJJ A;  1L0Y B;  3BJU A;  5C3W A;  3RR5 A;  1D8L A;  3DM3 A;  2AUJ D;  4A3I H;  1I6V C;  4DK3 C;  1XNQ L;  4LJZ C;  2PW5 A;  2NTT A;  4TRD A;  2ZTC A;  1K3R A;  4G4K A;  2ZJR A;  1CM9 A;  2MGS A;  3KJO A;  4A3E G;  4JI5 Q;  4DUZ Q;  1H9S A;  3GTP H;  1B4O A;  3CCS A;  1EYD A;  4RMF A;  3CME A;  4IFD H;  4IUR A;  4JI4 Q;  5ELF A;  1A0I A;  4X64 L;  2JA8 B;  3HOV B;  3OIQ A;  1PHJ A;  4BBS B;  1X54 A;  4A3L G;  2ZJQ A;  3T16 A;  4HJ9 A;  1X3E A;  4E6I A;  2ZT9 C;  5CYU A;  1DOK A;  3GTK B;  1IBM L;  1F77 A;  1DZ1 A;  1KHI A;  1VQI A;  3QO2 A;  1WFQ A;  2PO4 A;  1OXS C;  4GOP C;  3NQI A;  4HJ5 A;  2E2D C;  3K5N A;  2JEA I;  4PG3 A;  4YCV A;  2N88 A;  3QWN A;  3SE0 A;  2KHS A;  1A8V A;  1SMY D;  2SNM A;  4YCW A;  4HED A;  1PH5 A;  2R93 B;  1NR4 A;  1SMY C;  2G9D A;  4ZKC B;  1KAW A;  2AWN A;  1Q82 C;  2R6G A;  4DV1 L;  4A3B H;  4LFC L;  3U9S A;  3NK9 A;  1PXU A;  3RLN A;  3MVV A;  3KDF B;  4J8Q A;  1YHQ A;  3GO5 A;  2IPK D;  1B2T A;  1D7Q A;  4M1U B;  2KED A;  3C46 A;  3GTG B;  1G29 1;  2B2W C;  3OPO A;  5EKL A;  3Q24 A;  4RCN A;  4KN7 C;  2E2J B;  2BDO A;  4HSV A;  1EQQ A;  4DAV A;  3G6J B;  1VQK A;  4OO1 H;  5KEE A;  3S2D B;  4O0A A;  4C3J B;  4DK6 C;  1TY0 A;  1JC7 A;  1I4X A;  2CCZ A;  1W3S A;  2A8V A;  3U58 A;  5CBA E;  1Q90 A;  3RZO B;  3SHL A;  2EE1 A;  3A5Z B;  5T1G A;  1TWH B;  4DV6 Q;  1YZ6 A;  1WVL A;  1GKH A;  5BR8 Q;  1CQF A;  2KUM A;  2K75 A;  4DU9 A;  4A3G G;  1WTX A;  2B3G A;  4LWC A;  1YHA A;  2DJG C;  4R9W A;  2SOB A;  4BY7 H;  3CPW A;  2NVQ B;  2EYM A;  5LHY 1;  2YU9 B;  2VZA A;  4IFD G;  2R7D A;  1PH4 A;  2J7Z A;  3GQB A;  1CHQ D;  2RQX A;  1LTG D;  4IJL A;  4IPD A;  3HKZ B;  4ZAI A;  2N8N A;  4X65 Q;  5KGU A;  2OT2 A;  4GKK L;  1RKN A;  5JEA J;  1VS0 A;  3OWF A;  2H5X A;  3OMG A;  3P20 A;  1CKN B;  1LUZ A;  3K0X A;  4GNX A;  2NN6 G;  5C0X I;  3K81 C;  3I4N G;  3PO3 H;  4X6A H;  2KEE A;  2JA6 H;  2EY2 A;  1WD0 A;  4H44 C;  5NUC A;  1KNA A;  1V43 A;  4IPG A;  1TWF H;  2X6L A;  1L1O B;  2NBF A;  3GTJ B;  2ZTE A;  2J0T D;  4XYQ A;  4KV6 A;  4YY3 Q;  3A55 A;  5IT9 c;  5KYL A;  4AQY L;  3RN5 A;  3VR3 A;  2UUA Q;  1AFP A;  4H02 A;  3S1M H;  4B3M Q;  3FKI H;  3G4S A;  3MFG A;  5IOC A;  3PGZ A;  2L4N A;  4P73 A;  4DNR B;  1Y1W G;  1PH2 A;  3I4M G;  1K83 H;  4K6D A;  2R7Z H;  1I4H A;  4HR7 B;  1EWH A;  1GUW A;  3FMC A;  1VQO A;  3VA7 A;  5K5P A;  2ZM6 L;  2L12 A;  5I2Y A;  4KY5 A;  2FIN B;  3HOW G;  1F9S A;  1Q3L A;  3WOF A;  1YJN A;  4HJA A;  1SE3 A;  4G7H C;  1WCM B;  1Q1E A;  4JBJ A;  2ICE C;  2UU9 L;  2NN6 I;  5IT9 L;  1KQS A;  3D4R A;  3HOY B;  2UXC Q;  3S1N B;  1JWM D;  3MXN A;  4F8M A;  4A3B B;  1TS5 A;  3OW2 A;  2F4I A;  4A3M B;  1EFW A;  5C4X G;  1Z47 A;  2JYO A;  2R92 G;  2BA1 A;  5EPJ A;  3DMU A;  5C3E G;  2F0J A;  4FDB A;  1HZB A;  1RCV D;  2D0O A;  2NZ1 D;  1E2V A;  4X3U A;  1KLG D;  2VQF Q;  5EBC A;  3PIO 3;  4ABN A;  1EY4 A;  1RTN A;  4ULL A;  4OIK A;  3HKS A;  5C4H A;  2WB1 E;  3SEB A;  5EKK A;  2AWO A;  2F0W A;  3E6Z X;  3L9A X;  2XWJ B;  5LMN L;  1GUN A;  5GAD C;  2E2H B;  4DK1 A;  1M90 C;  2D0P A;  5EQ0 A;  3KLS X;  2CW0 D;  2I46 A;  2A74 C;  4HJ7 A;  2E2I H;  3MHB A;  1XPO A;  5IP9 H;  1MBY A;  4L5T A;  3CD6 A;  3H6M A;  1DOL A;  1K8O A;  4KY6 A;  3R2T A;  1TVX A;  3ZYY X;  5C44 B;  1CSP A;  4ZQ3 A;  4B3R Q;  3D4W A;  3JAM i;  1QB5 D;  2IHF A;  5JEA G;  2IX3 A;  1XTC D;  1BF4 A;  3NTH A;  4LF7 L;  3J81 j;  2F0F A;  3AYH B;  2N49 A;  4KKS A;  2B8F A;  3T53 B;  3X3M A;  4HAE A;  2KBN A;  3S1M B;  2BH8 A;  1H9K A;  5ELC A;  3J80 c;  3EIV A;  1HZC A;  4XQN A;  1STB A;  4LF8 L;  4JV5 L;  1VQG A;  2I5M X;  2PMZ E;  2XN9 C;  3UDI A;  3S1R H;  2UUB Q;  2F0M A;  1VCI A;  2PZT A;  3NP8 A;  2LKV A;  2B29 A;  2SDF A;  1BVS A;  2MUY A;  1D6E C;  1SE4 A;  2JA7 G;  1JOQ A;  1EY7 A;  2CKZ B;  1HNZ L;  4WJW A;  4UY8 C;  3GP7 A;  3IFT A;  4MHE A;  1NY4 A;  4JI5 L;  4HTH A;  1CTM A;  2IY5 B;  2ES2 A;  2F4V Q;  1I4R A;  1VMP A;  2KEN A;  2K5V A;  2XVS A;  4UP9 A;  1VQE A;  4CKB A;  1AEX A;  1E1T A;  2F3W A;  3K7A H;  3AQQ A;  3J81 c;  3Q23 A;  2AUK A;  3KLS A;  4L5Q A;  1S3O A;  3GTK H;  1EYC A;  1RJT A;  4OWW B;  3PUZ A;  3NEN A;  1J5E Q;  3HGB A;  2QCP X;  4C3H B;  1KAA A;  2B2V A;  1TR5 A;  1EY5 A;  4RFB A;  5GAE C;  3PUV A;  4IN3 A;  4PV1 C;  5I9O A;  1PH9 A;  2QGQ A;  2WB1 G;  3V2T A;  4DAY B;  4LF5 L;  4RKL A;  3A74 A;  5I9P A;  1JWU D;  1FGU A;  1VF5 C;  3L3O C;  1JB3 A;  1K83 B;  4B3R L;  4DV0 Q;  4DR1 Q;  2R3Z A;  1QJO A;  1W6K A;  1Q7Y C;  1CT1 D;  2NB0 A;  4HCE A;  4N8F A;  3J81 L;  1TWA B;  4DFA A;  5M5X B;  4A3J H;  4A3G B;  1MJE A;  1LLR D;  2EJF C;  4P71 A;  2DN8 A;  5CR3 A;  4GN5 A;  2WP8 J;  3DHQ A;  4RG1 A;  4QGU A;  1OO9 B;  3HKZ G;  5M5X H;  4NB3 A;  3W1G A;  1HCZ A;  2JEB I;  4N9P A;  3U9O A;  3GTM B;  4A93 H;  4JI0 L;  1ML0 D;  3A7A B;  2KHI A;  3H3V I;  1XNR Q;  2NVY B;  1TT2 A;  3PO3 B;  4JI1 Q;  2A6H C;  2JXM B;  4KN4 C;  3BVM A;  2EYJ A;  1ZXT A;  1B7Y B;  1DYQ A;  3I73 A;  4OO1 G;  3GTJ H;  1SYD A;  2CQO A;  2C9O A;  5FOB B;  1ET9 A;  3BZC A;  2EXD A;  3URY A;  2NTS A;  4KI0 A;  2MP1 A;  4JBM A;  5IP7 H;  4WRD A;  4BY1 B;  2YU9 H;  1WTR A;  4DR2 L;  1ESR A;  3I55 A;  5H1S E;  1HRJ A;  1XJV A;  3TME A;  2RKS A;  4EGV A;  2WV6 D;  1GUG A;  4I7A A;  4JI6 L;  2MFI A;  3KLR A;  2AQ3 B;  2EVB A;  5KRU A;  1VMC A;  5C5M A;  1PVO A;  3GD7 A;  1F9P A;  1UE6 A;  3HOY H;  2ENB A;  2IHE A;  2L0C A;  3DM1 A;  1Z6H A;  4ODG A;  3TP6 A;  1EYA A;  1D5X C;  2MJ8 A;  4DR7 L;  1GUT A;  1KNE A;  4R4O A;  3CCL A;  3RZD H;  1LT3 D;  2ZJP A;  3T1H Q;  4IOA A;  1SE8 A;  4LNQ A;  5EJW A;  1PV4 A;  1NE3 A;  3HOY G;  3J81 i;  3M4P A;  3IFD A;  4KY7 A;  3CCR A;  2R7Z B;  1VDZ A;  2VB2 X;  4FF2 A;  2VNU D;  5E4W C;  2R92 B;  2RVL A;  2A68 C;  2Z6K C;  2F0S A;  4MNO A;  1SFO B;  1HNZ Q;  1SYF A;  2F0H A;  2X6G A;  1DD2 A;  2F0I A;  4LFA Q;  3NEL A;  5HUR A;  4L6T B;  4KHZ A;  1H9J A;  1KDC A;  1T5E A;  2A6E C;  1FNV A;  3HG9 A;  3HRZ C;  5CV8 A;  1XPR A;  1PTO C;  2AQ1 B;  1EQR A;  4KKT A;  3NE5 B;  4YIJ A;  1BQQ T;  1UNS A;  3S24 A;  1IBK L;  3FPU B;  2UXB L;  3SDZ A;  1BKB A;  1SNC A;  1AE3 A;  2Z6B A;  1SJE D;  2K05 A;  1TWF B;  2OCE A;  1GJX A;  4CDE C;  1ZKO A;  5JVG 3;  2YTX A;  3LGJ A;  2BCO A;  4R4I A;  1N33 Q;  2ZXR A;  5COY A;  1A62 A;  4X64 Q;  1BDO A;  4BXX G;  1PMR A;  3S14 H;  4JI7 L;  4UHV A;  5C44 G;  1XMO Q;  2EYL A;  3AB9 A;  2A6H D;  3HP3 A;  2VY3 A;  2HHH L;  4LUV A;  2PW7 A;  5JEA H;  5EGT A;  2OTJ A;  1VF7 A;  4A3M H;  1JQY D;  2A69 D;  3SXH A;  1PFB A;  4IZ8 A;  3TDQ A;  4YWM A;  3GV6 A;  1UE1 A;  1JOO A;  4FXG C;  5DNF A;  1GXD C;  3QIA A;  1J5E L;  1IHZ A;  3FHW A;  4A3K G;  3PUW A;  2EYO A;  2HQL A;  3HOZ G;  4BBS H;  2F0N A;  2MPM A;  2EJG C;  5D65 A;  2OF1 A;  4FXK C;  1GD7 A;  2K03 A;  2JA7 B;  4X3S A;  3OMC A;  2IX1 A;  2K28 A;  2QW7 A;  3L0O A;  4JCV E;  1R4P B;  5JJI A;  2K52 A;  3MA2 B;  5C44 H;  2PQA B;  3TP7 A;  1AN8 A;  3R93 A;  3CRK C;  2K6A A;  4AYB G;  5E4X A;  1SNO A;  5EBD A;  3PO2 G;  4X3T A;  1QNU A;  4BXX H;  3D3R A;  3IL8 A;  4OXP A;  1XWE A;  4DNT B;  5JJL A;  5K36 G;  1U4P A;  4JC0 A;  2K5Q A;  3ONA B;  4QJF A;  3EQL C;  2RDH A;  1VQB A;  1VQN A;  4QQB X;  5JJZ A;  1QWY A;  1UE7 A;  5CBE E; 
#chains in the Genus database with same CATH homology
 1F9R A;  4BBR B;  4RGO S;  4OGQ C;  5KNB A;  2CW0 C;  4G7Z C;  3SK5 A;  2GA4 B;  1ENF A;  3LWE A;  5IT9 E;  3VYU A;  4J6H A;  5JVH 3;  4A3E B;  2K01 A;  3QB3 A;  4OHJ A;  2F0D A;  4Y7N B;  1LTI D;  2TSS A;  4NP5 A;  1CA6 A;  1EY8 A;  3PUX A;  5IGG A;  3NSW A;  2EY6 A;  5CV4 A;  5M5Y B;  5I2X A;  4ILW A;  2F0G A;  2B2T C;  4F87 A;  1I6H B;  2BE5 D;  5CV5 A;  1ET6 A;  3GTP B;  1WTP A;  1I3Q B;  4BA2 I;  1STN A;  4PNY A;  3HZX A;  1YNJ C;  3I4L A;  2IWH A;  4CBV A;  3ITP A;  5FLX L;  4IUU A;  5C3X A;  1A15 A;  2O4X A;  4QIW B;  4K8I A;  3NQT A;  3K5L A;  1G2S A;  1KLU D;  4HSP A;  1SYE A;  3DWP A;  4UDU C;  2RSN A;  3VA5 A;  3H94 A;  3Q0A A;  1NUC A;  1BBX C;  3OWE B;  1CFM A;  1H9S B;  2NVX B;  1TWG B;  4FXD A;  3P7J A;  2M9V A;  3FDT A;  3CKI B;  1Y69 U;  2J4X A;  4RHS A;  1K8M A;  2LFN A;  3RUZ A;  1BR9 A;  1GHK A;  2JE6 I;  3IKJ A;  1ICW A;  3C1F A;  4ZLT F;  4FYD A;  3S1Q B;  4RH6 A;  2VB3 X;  4EQP A;  1YNN D;  4PMC A;  1E2Z A;  4XQJ A;  5J1Z A;  4X3K A;  4HN7 A;  3GV3 A;  1D5Z C;  1STA A;  1LT4 D;  1I4G A;  5C4Z A;  2LS0 1;  3D8G A;  2BDN A;  1ENA A;  1LTT D;  1PZI D;  4KJN A;  1RTO A;  3VYS A;  4R8I A;  2Z4I A;  3FEW X;  1X3Q A;  2H1E A;  1PZK D;  4Z9C B;  3K5M A;  2DNE A;  1XXG A;  1IW7 C;  1FD7 D;  3R8B A;  3DUZ A;  1EY0 A;  1X32 A;  2RDG A;  1TWC B;  3EJI A;  4ZK9 B;  3KBG A;  3E5S A;  1JR0 D;  3D6C A;  2KOL A;  2JA5 B;  3MFY A;  2WIN B;  1CI3 M;  3QG1 A;  1EY6 A;  4RCO A;  1HTP A;  3LX0 A;  4KD3 A;  4AYB B;  2KEC A;  4TQU S;  1UUP A;  3FPP A;  4ZKB B;  1PYW D;  1MGS A;  2JP1 A;  2VXW A;  1EZ8 A;  1F2Y A;  3IAY A;  3M7N A;  3OOC A;  1ZEQ X;  2BA0 A;  2EYF A;  3BDO A;  1NCV A;  5JOB A;  2L5T A;  4MN3 A;  2D5D A;  3NTK A;  2CHB D;  1STH A;  2E76 C;  3NPP A;  3AMU A;  3E0J A;  1CQV A;  3PMF A;  4KTA A;  3S16 B;  4H7B A;  1BOS A;  3MAQ A;  2FMC A;  4LMQ D;  2WII B;  5E3F A;  3RLF A;  1A6X A;  5A2Q L;  1PRT B;  4RGT A;  4PMW A;  1FR3 A;  5M9O A;  3UI2 A;  4QF4 A;  2DNC A;  2F0Q A;  5CV9 A;  2F0E A;  1S5D D;  2K1B A;  2OXP A;  1H9R A;  3BYY B;  4DA2 A;  1M4V A;  3VR2 A;  2DY7 A;  1HA6 A;  4RWS C;  4QUC A;  4IFD I;  4ZRZ A;  3S2H B;  3H09 A;  2F0P A;  1B9M A;  3QJY A;  1O7Z A;  1C8C A;  3TSS A;  1FNW A;  5FK9 C;  4QUF A;  3EA6 A;  1QIL A;  1PTO F;  4KKU A;  2B2U A;  2CVR A;  5JPM C;  2O5J C;  2KCN A;  1OXV A;  3EVQ A;  1JWS D;  1G91 A;  2Z4H A;  2E74 C;  2X69 A;  1RD9 D;  3R2I A;  3CQZ B;  4S3S A;  3DEO A;  3M3Y B;  4FO2 A;  5C6A A;  3S14 B;  2FJ2 A;  1EQV A;  1U4R A;  1OXX K;  1WTO A;  4DAP A;  1STY A;  5BN4 A;  1QCB D;  3N6R A;  3CHB D;  4DF7 A;  3C3L A;  1GUO A;  1ZYR C;  3V05 A;  2C5C A;  3K58 A;  3VYR A;  5CGK A;  5FKA C;  4B08 A;  3MXP A;  1IYV A;  4QMG A;  1WTV A;  4OIJ A;  2WAC A;  4Q0F A;  5ELE A;  1D1I A;  1QNK A;  1TS3 A;  1V1P B;  1Y1V B;  4WFN 3;  1Q1B A;  3MWY W;  4K6L A;  3QOJ A;  3NUC A;  1IW7 D;  5T1I A;  5KND A;  5LL6 X;  3FKI B;  3C2P A;  1HQR D;  3MZ5 A;  1SNM A;  1PTO D;  4FF4 A;  2QEJ C;  2KA7 A;  4CKC A;  4LK1 C;  3M85 A;  1STE A;  4IUN A;  3NTI A;  1DOM A;  1ESF A;  4IUV A;  4CGY B;  1DM0 B;  4C1N K;  3NHH A;  1S5E D;  2XRS D;  1U9R A;  4CJ2 C;  1TQO A;  1SAP A;  3BVZ A;  1TY2 A;  3DWQ A;  3P75 A;  4DK0 A;  1D2B A;  4ZUI A;  2FHT A;  1RHP A;  3A8K E;  3NXW A;  1BCP C;  2A6E D;  3G7L A;  1A3V A;  1M8A A;  2Z1C A;  4BWG B;  3D4D A;  2BE5 C;  3TN2 A;  1XX8 A;  1O78 A;  4UAI A;  3A7L A;  3S1R B;  1EZ6 A;  3RD4 A;  1G2T A;  2NN6 H;  2IT1 A;  3CU7 A;  1S5C D;  1G8Z D;  1LT6 D;  2F0T A;  2K5W A;  2L1B A;  1HFG A;  5FLX E;  1EIH A;  2B63 B;  3NBH A;  2B8G A;  2BOS A;  5D3D A;  3BS1 A;  2B2V C;  3D31 A;  3C1E A;  2V4D A;  4XXE A;  2MHV A;  3RZD B;  4CJ1 B;  2IL8 A;  3HOU B;  3FVQ A;  1HFN A;  2O2L D;  3T56 B;  3X3N A;  4XT1 B;  1TKW B;  3DEP A;  1C48 A;  1GHJ A;  3SR1 A;  3H0G B;  1AZP A;  2B39 A;  3O13 A;  4K8J A;  1KTK A;  4C3I G;  4U67 3;  3Q22 A;  4C56 C;  3K57 A;  1W6J A;  4TSS A;  3PO2 B;  2L9H A;  4B9W A;  1Q12 A;  4CJ0 B;  5DEH A;  1CK1 A;  1S5F D;  3I91 A;  1TII D;  4BY7 B;  1CZG A;  2IJ0 A;  1V1P A;  3CRL C;  1C4Q A;  5C4J B;  3R3O A;  1JCK B;  2EJM A;  1PRT F;  3A54 A;  2F0V A;  4JK1 C;  1WTQ A;  4ZYS A;  2A73 B;  2EYH A;  1E0B A;  3OIP A;  1LTB D;  2F0K A;  4K2K A;  4ME5 A;  1S5B D;  1CHP D;  5KNC A;  2IX0 A;  4WOR A;  4K5V A;  1TS4 A;  1SSO A;  2M2L A;  1MD2 D;  2EY1 A;  1FNU A;  1AZQ A;  3KBX A;  4HMJ A;  2KVM A;  1V8Q A;  1IYU A;  1YNJ D;  1DJR D;  1A3T A;  2Y0S B;  4G57 A;  4RA8 A;  2B2T A;  3I70 A;  5M3F B;  3K59 A;  1F9Q A;  4HMI A;  1D5M C;  1BNZ A;  2PPB C;  3BG3 A;  4RHR A;  1EEF D;  3ND9 A;  1EQT A;  2F0U A;  4A3D B;  1BXT A;  1WTW A;  1LTS D;  2PZW A;  4CKE A;  1MSG A;  1LO5 D;  3L7Z C;  4U68 A;  5C0X G;  1RF2 D;  2R61 A;  3BDL A;  4IAL A;  1HXY D;  1F2L A;  1QG7 A;  5IIF A;  4PQX A;  3BDC A;  2XSC A;  5DM6 3;  3ERQ A;  5FO7 B;  4MIU A;  5IGC A;  2FFK B;  1J8I A;  2KCC A;  2F03 A;  3TP8 A;  4TKO B;  1HA5 A;  3H91 A;  1GUS A;  4BA1 I;  2PYK A;  2L11 A;  2K7V A;  3OW7 A;  1AW7 A;  1TS2 A;  4EQN A;  5K36 H;  4I7Z C;  3JAM E;  1L0X B;  2NYZ D;  5I4D A;  4RKB A;  2E2I B;  1YNN C;  4HCS A;  4K5W A;  5CMD A;  2ICI A;  2NVT B;  1LAC A;  1JIC A;  4RGN A;  2HCI A;  1U4L A;  5EPL A;  3GTL B;  1PFM A;  4DN4 M;  1DCZ A;  2F0O A;  1A3U A;  1R9T B;  1KDB A;  3Q6S A;  2EZV A;  2E75 C;  5EPK A;  1Q8I A;  1E2W A;  4C3J G;  2B2Y A;  1MI2 A;  3M7G A;  2LY7 A;  3I72 A;  2FMM A;  4XYO A;  2Z8L A;  3VR4 A;  1NR2 A;  4K2L A;  4NKL A;  1EL0 A;  1CA5 A;  2HDL A;  1LT5 D;  3MC0 B;  4J1M A;  3J7Y W;  4F7X A;  1RDP D;  4KD4 A;  3OHX C;  2O5I C;  2EPB A;  1IKM A;  5DM7 3;  5A35 A;  2SEB D;  1LTA D;  3T4A C;  1NSN S;  1II3 A;  1SXT A;  3MEH A;  3I8Z A;  3FRP B;  1SDF A;  4DGZ A;  2QF7 A;  3KK7 A;  2CQA A;  2WKD A;  1TU2 B;  3I4N B;  3PIP 3;  4IUP A;  3P1H A;  1SYC A;  4R8N A;  1KAB A;  1O80 A;  5I6W A;  3MTS A;  4OO1 I;  1SND A;  2JA6 B;  2OEO A;  3TP5 A;  2EDG A;  3A8J E;  5D3I B;  3K0Y A;  1HQM C;  5M5W B;  3I4M B;  5M3M B;  2I07 B;  5JAV A;  1WD1 A;  2XWB B;  2D2C C;  2WAQ B;  4CHT B;  3HOW B;  2K04 A;  3ERO A;  5A2Q E;  4NMZ A;  1JOK A;  2B2Y C;  2PNR C;  3ND8 A;  2KQ3 A;  3GTO B;  3S17 B;  5CC4 A;  3HS0 C;  3PV0 A;  2K33 A;  5JPN C;  4FNF A;  4DXG A;  5C0X H;  4N9T A;  5C4X B;  5BN3 A;  1UEA B;  1B44 D;  3J7A V;  4DXF A;  3LNN A;  2PCF B;  1Y8N B;  5ISR A;  3SK8 A;  3A56 A;  4XDX A;  2LMC B;  1FYC A;  1LTR D;  1HUM A;  1B53 A;  5ELB A;  3A8I E;  5ELD A;  1J9O A;  2A68 D;  4XIG S;  5C5L A;  1PZJ D;  1XYI A;  1EWC A;  2ZXP A;  2F3V A;  2K5D A;  3GTQ B;  2VUM B;  4XTC S;  2Q8R E;  4PMB A;  5BN5 A;  1EY9 A;  1PFN A;  2EY5 A;  2ZXO A;  1BUV T;  1EOT A;  1R4Q B;  1PTO H;  3DWA A;  2RA4 A;  5IGF A;  3J7A F;  1SE2 A;  3M4Y A;  4IUT A;  5IOD A;  1HPC A;  1LAB A;  4EQO A;  2TMP A;  1BO0 A;  2KJX A;  3MXU A;  1B3A A;  1OXU A;  4G7O C;  1HTL D;  2AQ2 B;  3VR6 A;  2B2W A;  1F2M A;  1B50 A;  3QOL A;  4JBW A;  1EU4 A;  4F88 A;  3F2U A;  3J80 E;  3JAM L;  3KF8 A;  5AFW A;  1CZW A;  1T5X D;  2RBM A;  4IUQ A;  1DXM A;  3TZU A;  1DON A;  2EYP A;  2XNA C;  1ZYR D;  3BYT B;  2F1M A;  4A3I B;  1Y8O B;  4ZUJ A;  1EIG A;  1UAP A;  3AU7 A;  4H13 C;  1B9N A;  5DAU A;  4I65 A;  1ENC A;  2G9H D;  1F2Z A;  3NBI A;  1SYB A;  4C3H G;  3I3C A;  4V19 0;  4RAU C;  2QDB A;  3KUP A;  4FVM A;  4XT3 B;  2WB1 B;  2XIW A;  2Q8T A;  3OSO A;  4RGM A;  3H3V C;  3BVG A;  2Q8I B;  1I50 B;  1PLF A;  3K5O A;  3J81 E;  2N55 A;  1O7L A;  4QCL A;  5G3L D;  1KDA A;  4IQZ A;  4KJO A;  1SEB D;  1Z7T A;  1A2U A;  2WKC A;  5IGB A;  1S4Z A;  1PRT D;  5FO9 B;  4K5X A;  1G6Z A;  4DAY A;  1ONL A;  2SNS A;  3BZD B;  3LWU A;  5TSS A;  5F2D A;  1JOR A;  2HDM A;  1IL8 A;  1BCP D;  5J39 A;  5D14 A;  2D9U A;  3NWT A;  3T13 A;  3SK6 A;  1O7Y A;  3J80 L;  2HQE A;  2JSO A;  2L55 A;  1IKL A;  1QE6 A;  2M00 A;  1STG A;  4NDX A;  4O42 A;  5IGD A;  4LAA A;  1QOH A;  2QIL A;  1HHV A;  1D1K A;  4O1N A;  3TZD A;  4FF1 A;  4L8J A;  3WDN A;  4L63 B;  3W3A A;  4B9X A;  1ILP A;  1X3P A;  3V96 A;  5I6Y A;  2PZU A;  1U4M A;  4IFD J;  4FF3 A;  1I4P A;  1LV9 A;  2PQE A;  4KK7 A;  2IW3 A;  2B2U C;  3SK4 A;  1FGB D;  2NUC A;  1ROD A;  3WOE A;  2RDF A;  2EXZ A;  2PMZ B;  4C1N I;  2EOT A;  1BCP B;  1ILQ A;  1NAP A;  5E1F A;  4EVO A;  3EFX D;  4QB4 A;  5IGE A;  2HCC A;  1SNP A;  5G3L F;  3RMH A;  1EU3 A;  2K32 A;  1PRT C;  4C3I B;  5KYI A;  4Q5V A;  1I4Q A;  4A93 B;  1H9M A;  2H4O A;  5KIX A;  2YYZ A;  1OXT A;  2RSO A;  1Y8P B;  2NWG A;  3M4O B;  3K6O A;  4OL7 A;  4KMU C;  4BS9 A;  5C0X J;  3DXJ C;  5CV7 A;  3PUY A;  4A3J B;  3TBI B;  1MSH A;  5CV6 A;  5COR A;  1SNQ A;  2ID0 A;  1A2T A;  1BCP F;  4K14 A;  3T51 B;  5FO8 B;  2A5H A;  1V1O A;  4A3F B;  3MXG A;  4ID6 A;  3SVM A;  5J22 A;  1Y1W B;  5HGT A;  1EEI D;  1SBB B;  1PDQ A;  1SJH D;  3VYT A;  3W2D A;  4A3K B;  1AP0 A;  3HOZ B;  3D6W A;  2QKI C;  2F0L A;  3VR5 A;  2D62 A;  4GZY C;  3HOX B;  1HUN A;  4V0B A;  3K7A B;  3NWS A;  2A69 C;  2HUG A;  3S15 B;  1JE4 A;  1GOZ A;  1PTO B;  4M8A A;  1EFI D;  3HEJ A;  4XQQ A;  5EKI A;  1B1Z A;  2DY8 A;  5C3E B;  4NW2 A;  5LL6 S;  4C2M B;  2XRQ D;  3S9W A;  4FP5 D;  4H0L C;  1SYG A;  4KHV A;  4P2C B;  3N52 A;  3I90 A;  1L0Y B;  5C3W A;  2AUJ D;  1I6V C;  4LJZ C;  2PW5 A;  2NTT A;  4TRD A;  4G4K A;  1CM9 A;  2MGS A;  1H9S A;  1B4O A;  1EYD A;  4IFD H;  4IUR A;  5ELF A;  2JA8 B;  3HOV B;  3OIQ A;  4BBS B;  3T16 A;  4E6I A;  2ZT9 C;  5CYU A;  1DOK A;  3GTK B;  1F77 A;  1DZ1 A;  3QO2 A;  2PO4 A;  1OXS C;  3NQI A;  2E2D C;  3K5N A;  2JEA I;  2N88 A;  3QWN A;  3SE0 A;  2KHS A;  1SMY D;  2SNM A;  4HED A;  2R93 B;  1NR4 A;  1SMY C;  2G9D A;  4ZKC B;  2AWN A;  2R6G A;  3U9S A;  3NK9 A;  1PXU A;  3MVV A;  4J8Q A;  3GO5 A;  2IPK D;  1B2T A;  4M1U B;  2KED A;  3C46 A;  3GTG B;  1G29 1;  2B2W C;  3OPO A;  5EKL A;  3Q24 A;  4RCN A;  4KN7 C;  2E2J B;  2BDO A;  4HSV A;  4DAV A;  3G6J B;  4OO1 H;  5KEE A;  3S2D B;  4C3J B;  1TY0 A;  1JC7 A;  1I4X A;  5CBA E;  1Q90 A;  3RZO B;  3SHL A;  2EE1 A;  5T1G A;  1TWH B;  1WVL A;  1CQF A;  2KUM A;  4DU9 A;  1WTX A;  4R9W A;  2SOB A;  2NVQ B;  2EYM A;  5LHY 1;  2YU9 B;  4IFD G;  2J7Z A;  3GQB A;  1CHQ D;  2RQX A;  1LTG D;  3HKZ B;  4ZAI A;  5KGU A;  2OT2 A;  1RKN A;  5JEA J;  3OWF A;  3OMG A;  3P20 A;  2NN6 G;  5C0X I;  2KEE A;  2EY2 A;  1WD0 A;  4H44 C;  5NUC A;  1KNA A;  1V43 A;  2X6L A;  2NBF A;  3GTJ B;  2J0T D;  4XYQ A;  4KV6 A;  3A55 A;  5KYL A;  3VR3 A;  1AFP A;  3MFG A;  5IOC A;  2L4N A;  4DNR B;  4K6D A;  1I4H A;  4HR7 B;  1EWH A;  1GUW A;  3FMC A;  3VA7 A;  5K5P A;  2L12 A;  5I2Y A;  4KY5 A;  2FIN B;  1F9S A;  1Q3L A;  3WOF A;  1SE3 A;  4G7H C;  1WCM B;  1Q1E A;  2ICE C;  2NN6 I;  5IT9 L;  3D4R A;  3HOY B;  3S1N B;  1JWM D;  3MXN A;  4F8M A;  4A3B B;  1TS5 A;  2F4I A;  4A3M B;  1Z47 A;  2JYO A;  2BA1 A;  5EPJ A;  3DMU A;  2F0J A;  1RCV D;  2NZ1 D;  1E2V A;  4X3U A;  1KLG D;  5EBC A;  3PIO 3;  4ABN A;  1EY4 A;  1RTN A;  4ULL A;  4OIK A;  5C4H A;  3SEB A;  5EKK A;  2AWO A;  2F0W A;  3E6Z X;  3L9A X;  2XWJ B;  1GUN A;  2E2H B;  4DK1 A;  5EQ0 A;  3KLS X;  2CW0 D;  2I46 A;  2A74 C;  3MHB A;  1MBY A;  3H6M A;  1DOL A;  1K8O A;  4KY6 A;  3R2T A;  1TVX A;  3ZYY X;  5C44 B;  4ZQ3 A;  3D4W A;  1QB5 D;  5JEA G;  2IX3 A;  1XTC D;  1BF4 A;  3NTH A;  2F0F A;  4KKS A;  2B8F A;  3T53 B;  3X3M A;  4HAE A;  3S1M B;  1H9K A;  5ELC A;  4XQN A;  1STB A;  2XN9 C;  2F0M A;  1VCI A;  2PZT A;  3NP8 A;  2LKV A;  2SDF A;  2MUY A;  1D6E C;  1SE4 A;  1JOQ A;  1EY7 A;  4WJW A;  3GP7 A;  3IFT A;  4MHE A;  4HTH A;  1CTM A;  1I4R A;  1VMP A;  2XVS A;  4CKB A;  1AEX A;  2F3W A;  3Q23 A;  2AUK A;  3KLS A;  1EYC A;  1RJT A;  3PUZ A;  3HGB A;  2QCP X;  4C3H B;  1KAA A;  2B2V A;  1TR5 A;  1EY5 A;  4RFB A;  3PUV A;  4IN3 A;  4PV1 C;  5I9O A;  3V2T A;  4RKL A;  5I9P A;  1JWU D;  1VF5 C;  3L3O C;  1JB3 A;  1K83 B;  2R3Z A;  1QJO A;  1W6K A;  1CT1 D;  2NB0 A;  4HCE A;  3J81 L;  1TWA B;  4DFA A;  5M5X B;  4A3G B;  1LLR D;  2EJF C;  2DN8 A;  5CR3 A;  2WP8 J;  3DHQ A;  1OO9 B;  1HCZ A;  2JEB I;  4N9P A;  3U9O A;  3GTM B;  1ML0 D;  3A7A B;  2NVY B;  1TT2 A;  3PO3 B;  2A6H C;  2JXM B;  4KN4 C;  3BVM A;  2EYJ A;  1ZXT A;  1DYQ A;  3I73 A;  4OO1 G;  1SYD A;  2C9O A;  5FOB B;  1ET9 A;  3URY A;  2NTS A;  4KI0 A;  2MP1 A;  4WRD A;  4BY1 B;  1WTR A;  1ESR A;  1HRJ A;  3TME A;  2RKS A;  4EGV A;  2WV6 D;  1GUG A;  3KLR A;  2AQ3 B;  2EVB A;  5KRU A;  1VMC A;  5C5M A;  3GD7 A;  1F9P A;  2ENB A;  2L0C A;  3DM1 A;  1Z6H A;  4ODG A;  3TP6 A;  1EYA A;  1D5X C;  2MJ8 A;  1GUT A;  1KNE A;  1LT3 D;  5EJW A;  3IFD A;  4KY7 A;  2R7Z B;  1VDZ A;  2VB2 X;  4FF2 A;  2VNU D;  5E4W C;  2R92 B;  2RVL A;  2A68 C;  2F0S A;  1SFO B;  1SYF A;  2F0H A;  2X6G A;  1DD2 A;  2F0I A;  5HUR A;  4L6T B;  4KHZ A;  1H9J A;  1KDC A;  1T5E A;  2A6E C;  1FNV A;  3HG9 A;  3HRZ C;  5CV8 A;  1PTO C;  2AQ1 B;  4KKT A;  3NE5 B;  4YIJ A;  1BQQ T;  1UNS A;  3FPU B;  3SDZ A;  1SNC A;  1SJE D;  2K05 A;  1TWF B;  1GJX A;  1ZKO A;  5JVG 3;  2BCO A;  2ZXR A;  5COY A;  1BDO A;  1PMR A;  2EYL A;  3AB9 A;  2A6H D;  3HP3 A;  2PW7 A;  5JEA H;  5EGT A;  1VF7 A;  1JQY D;  2A69 D;  3SXH A;  1PFB A;  4IZ8 A;  3TDQ A;  3GV6 A;  1JOO A;  4FXG C;  5DNF A;  1GXD C;  3QIA A;  1IHZ A;  3PUW A;  2EYO A;  2F0N A;  2MPM A;  2EJG C;  5D65 A;  2OF1 A;  4FXK C;  2K03 A;  2JA7 B;  4X3S A;  3OMC A;  2IX1 A;  2K28 A;  1R4P B;  3MA2 B;  3TP7 A;  1AN8 A;  3R93 A;  3CRK C;  2K6A A;  5E4X A;  1SNO A;  5EBD A;  4X3T A;  1QNU A;  3D3R A;  3IL8 A;  1XWE A;  4DNT B;  5K36 G;  1U4P A;  2K5Q A;  3ONA B;  3EQL C;  2RDH A;  5JJZ A;  1QWY A;  5CBE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...