2D9UA

Solution structure of the chromo domain of chromobox homolog 2 from human
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
GSSGSSGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Chromobox protein homolog 2 (isoform 2)
publication title Solution structure of the Chromo domain of chromobox homolog 2 from human
rcsb
source organism Homo sapiens
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2d9uA00
1PDQA 1BF4A 1DOMA 2B2VC 1U4RA 3SVMA 2MGSA 2K28A 2BDNA 2K03A 2B2VA 2KVMA 2L9HA 2RVLA 1RHPA 2FJ2A 3Q6SA 4IUTA 1F2LA 2B2TC 1G6ZA 1EIGA 2JYOA 4IUPA 1MSGA 1X32A 5AFWA 5DNFA 2B2TA 1CA5A 4QUCA 1DONA 1PFBA 5CBEE 3I3CA 2KEDA 4MHEA 1AZPA 1G2TA 2MPMA 2NZ1D 1XX8A 2R3ZA 3TN2A 1WTRA 2HDMA 3KUPA 2MP1A 1U4MA 1O7ZA 2K01A 1WVLA 1M8AA 2K1BA 1EOTA 1F9RA 1WTQA 2EPBA 2HCIA 2KEEA 1BBXC 5CMDA 1TVXA 1O7YA 2HDLA 2Q8RE 1EQTA 1PLFA 2B2UC 3DEPA 5EKIA 1HRJA 1SSOA 2B2UA 3MWYW 4CJ0B 5CORA 1G2SA 1WTXA 2H1EA 2L12A 4O42A 4CJ1B 3QO2A 1WTWA 1B4OA 1MGSA 1WTVA 1J9OA 1WD0A 1A15A 1XYIA 1U4LA 1SDFA 2FFKB 2B2WC 2N88A 1BO0A 1ML0D 5T1IA 2B2WA 3G7LA 3HP3A 4LMQD 1RODA 1MSHA 1X3PA 2MJ8A 4HSVA 3IFDA 4MN3A 1S4ZA 3ONAB 4QUFA 1EL0A 2FINB 2XIWA 1BNZA 2D9UA 5D14A 1JICA 2EE1A 4RA8A 2RSOA 3FPUB 1KNEA 2HCCA 2L11A 3N52A 4IUVA 3GV3A 1KNAA 4XDXA 4DN4M 1Q3LA 1RTNA 1QE6A 1NAPA 4RAUC 2IL8A 1C8CA 1B3AA 3I90A 2DY8A 2L4NA 4HAEA 2JP1A 4IUUA 3UI2A 4R8IA 1ILPA 1EIHA 3D6WA 1DOKA 1QG7A 2FMMA 1U4PA 1VMPA 3I91A 4ZKCB 5CBAE 4UAIA 2VXWA 3TZDA 1RTOA 4R9WA 4OIJA 2NWGA 1F9SA 2NYZD 2X6GA 2X6LA 2KOLA 2RA4A 1HUNA 1DOLA 1LV9A 4IUQA 4XT3B 1HA6A 1F9QA 5E4XA 4XT1B 4ZAIA 4ZK9B 4X3KA 1VMCA 1SAPA 2HUGA 5EPLA 2L1BA 4RWSC 1QNKA 5JJZA 1AP0A 1IL8A 2Q8TA 4OIKA 5E4WC 1AZQA 2KUMA 2KECA 3MTSA 4ZKBB 5COYA 4HEDA 1G91A 3DM1A 1HHVA 1HUMA 5EPJA 5EJWA 1CM9A 1NR2A 1ILQA 4NW2A 2J7ZA 1ICWA 4X3UA 5EPKA 5EQ0A 3P7JA 3R93A 1B2TA 1WTOA 1IKLA 1ZXTA 3F2UA 2DY7A 1DZ1A 1JE4A 3DEOA 3LWEA 4X3TA 1B53A 1GUWA 5T1GA 1HFGA 1X3QA 2M2LA 1RJTA 3I8ZA 3IL8A 3KBXA 1WD1A 1WTPA 1ESRA 1F9PA 1O80A 1PFMA 2CVRA 2SDFA 4IURA 1NCVA 1CA6A 2B2YC 2FHTA 1J8IA 1HFNA 2EOTA 2N55A 2B2YA 4CJ2C 4ZLTF 1MI2A 4HCSA 3GV6A 4U68A 1PFNA 2K04A 2K05A 3H91A 3FDTA 1IKMA 1E0BA 1B50A 2X69A 2RSNA 4X3SA 5D65A 1NR4A
chains in the Genus database with same CATH superfamily
1ZYRC 3CP0A 1U4RA 4APVA 2E2DC 2A69D 2K03A 3VYUA 1QCBD 2L9HA 2RDHA 1VQ8A 4A3MG 1ASYA 1CK1A 4DAYA 1Y8PB 3S17H 1UE1A 2NVTB 2Q8IB 3C3LA 1AZPA 2FMCA 4AIMA 3KUPA 4X6AH 2N8NA 1LT4D 4DPGA 4I65A 4POGA 4L6TB 2KEEA 2Z6KA 4C3HG 3W2DA 4CDFC 4C2MB 1PH8A 3TREA 1CHQD 4DR1Q 1IBKQ 1XXGA 1WTWA 1WTVA 5ELDA 4J8QA 3HOYG 2PPBC 1QUQA 5EKLA 3K58A 4LF9L 1OXSC 3C46A 1A2TA 5LL6S 4XQQA 1MSHA 1X3PA 4L5TA 4GLVB 1KLGD 2VB2X 3R3OA 1T5XD 2XSCA 1CTMA 3KK7A 1MHWC 1I4GA 5M5YB 5JJIA 1BCPF 4NB3A 4XXEA 3NHHA 3CRLC 2CHBD 2EY2A 2RCFA 1IBLQ 3IKJA 4LF7L 3BZKA 4ZUIA 4AYBE 1KHIA 4C3JG 1Z7TA 4OIJA 1CKNA 2KOLA 2F0TA 4IPHA 4JBJA 1D6EC 2JSOA 2DN8A 2F0GA 1PH9A 4A93H 4ZK9B 2IW3A 3NTKA 4CDEC 3I72A 4J15A 2K50A 4RGTA 4A75A 2B3GA 1NY4A 5NUCA 4FVMA 1AZQA 3H6MA 2A5HA 1U9RA 1LTGD 1SJED 2OEOA 1SNMA 4FP5D 2E8GA 4CDDC 3F2BA 1IZ6A 3VYSA 1N33Q 3NQIA 2ZJQA 2EY6A 5DM73 3WOEA 4QY7A 3E0JA 1B53A 1RDPD 4GNXA 1SE4A 5G3LF 1J8IA 2QEXA 1IHZA 2B2YA 4A3IH 1WCMH 2D0PA 4U68A 5LMNQ 1GM5A 3OTOQ 4C1NK 3S2HH 4Y7NH 2ZM6Q 1X6OA 2UXCL 1IW7D 4P71A 5IYDG 4LUOA 3SVMA 1CFMA 4JI2L 4NXMQ 1K8OA 2B2TA 4DF7A 1G2TA 4A3MB 2IX1A 3I4LA 4L8JA 1E7ZA 1W6JA 4ZRZA 4G7HC 5IY0A 4H02A 4UP9A 2AQ2B 2EYJA 1X9NA 2F0WA 3GQBA 2DNEA 3I56A 2E2IB 1N8RC 4IFDJ 2Y0SG 2HDLA 3KLSA 5C4ZA 1I4HA 1SSOA 2MHVA 4C3HB 4TVAB 4A3DG 1II3A 1HZCA 3GTQH 4K2KA 5AJ3Q 3DXJC 5J39A 3HOUG 2GN5A 2Z4HA 4OELB 3G7LA 4FXGC 1HFNA 1KLUD 1QNUA 4HSVA 1EL0A 3OWEB 5KYIA 4M8AA 2NVXB 4HN7A 1TIID 3FMCA 3DUZA 4DK6C 2PO4A 4KJOA 4POFA 5DM63 3X3MA 2NTTA 3K81C 1Q3LA 5I9OA 3W1BA 4KTAA 4RAUC 1SR3A 3PV0A 1YJWA 1S5DD 1L0WA 3TRZA 3I91A 5JEAG 3NUCA 5J1ZA 3PSIA 4LW1A 3PGZA 4C3JB 4LFAL 4V190 4K5VA 1R9TB 3M7NA 4DR2L 1SYEA 5JAVA 1EY7A 3L7ZC 3KJPA 3CCVA 2WAQE 5FO9B 3GTGB 2TMPA 2JA7H 4A3KG 2G9DA 3O13A 1ICWA 2A6EC 3MVVA 2YYZA 4YHHQ 1STNA 1XNQQ 4X64L 1IYVA 2JA6H 2R7ZH 1IBML 4DK0A 4Q0FA 3QWNA 3BVZA 3Q24A 1RCVD 2EYHA 3A7AB 2ATWA 3I4NG 3RZOH 5T1GA 2A1AA 4RG1A 1X3QA 2JN4A 1F9PA 5KNCA 3H0GG 3T56B 4Q5VA 2C35B 1Y1VB 2HHHQ 2VNUD 4F87A 1EY0A 2N55A 5M5WB 1I94L 4DA2A 4NXNL 3CXCA 4P74A 3CMEA 2I5HA 4A3EG 4DKAC 1S40A 2D5DA 2CQAA 3BYYB 4K0KL 1N9WA 4CJ1B 3T16A 1TWCB 2EZVA 1VQ6A 1MSGA 1CA5A 1ZYRD 4JW0A 2K5QA 2R3ZA 1WTRA 4GKJQ 2VQFL 2HIXA 1F2MA 3NSWA 4LF5L 4PZ6A 4A3JH 4JI1Q 3H3VI 5LMUL 5J3BA 3OOCA 4JG2A 1TWHH 5CV9A 5IGCA 2EJMA 4YWMA 2Y0SB 1X3GA 1A3VA 1LLRD 4F8MA 4PZ7A 1J9OA 4A3DB 3W3AA 4DV6L 1GHJA 3K7AH 3ICEA 3HOUB 1CSQA 1OTCA 3ND9A 3SE0A 3Q8DA 3LGJA 4JV5L 1B1ZA 1OXUA 2Z1CA 2VB3X 3W1GA 1GUOA 2NN6H 3T1YL 4JI6Q 3J7YW 1KNEA 5ISRA 4NMZA 2F0MA 2NB0A 5EBCA 1BCPC 2DY8A 2PNRC 4JI8Q 2PMZE 5EGTA 2AUKA 1JR0D 2R93H 5CBAE 1TWFH 5C6AA 2EJFC 4HSPA 4A3LH 4IUQA 1HA6A 3P20A 2EYPA 5IGBA 3IFTA 3J81j 1Y1WG 3CQZH 1KDCA 3TP8A 5EPLA 4RWSC 2QA4A 5CV4A 4A3FG 1KAAA 2R92H 3S1MB 1ILQA 1WI5A 2NVTH 3R93A 2ICIA 4A3KB 2JA5G 2F4VQ 2VUMB 4P73A 1YNXA 3KDFB 1JE5A 4B3RQ 1GUWA 3HOXB 1VQGA 2PQAA 1GUGA 2NZOA 4C2MH 3I4NB 1XMOQ 1GHKA 3E5SA 5JVG3 3EFXD 3VR4A 1JJ2A 1CA6A 1VQFA 3KYHC 1MI2A 3GV6A 4L5QA 2F52A 1AEXA 1SYBA 1H9SA 4LUVA 1IKMA 1FGUA 3SR1A 4GLXA 4OWTB 1VQCA 2OTLA 1ENCA 4A3EB 4A3BH 4UPAA 1EIFA 1I6HB 1X3EA 3GO5A 4OGQC 4QF4A 2BH2A 3HOWH 1HCZA 3OSOA 2E2JH 4IUNA 4WJ4A 1YNND 1SEBD 1S5CD 1V1QA 3P1HA 2JJQA 1XX8A 5BR8Q 1OXTA 1PYBA 2HDMA 4YWKA 2MP1A 1U4MA 1PH4A 2AHOB 3JAML 4ILWA 3WWVA 3AB9A 1E2WA 1XNRL 3I55A 1B3QA 2I07B 2K4KA 4OO1G 4LF6Q 2ICEC 1Q1EA 2Q8RE 2A69C 4QIWB 4QMGA 1PXUA 5C0XH 1Y8OB 4BS9A 4OL7A 1G2SA 3EN2A 4H7BA 3VDYA 4JBMA 4B9XA 5C4XG 1EYAA 3HZXA 1XPUA 1SDFA 4BY1H 2F0IA 5T1IA 3HP3A 1RODA 4RH6A 1SNPA 3E9HA 5FLXE 5IGEA 1UEBA 2E75C 4RA8A 5JPNC 1CKOA 4DV4Q 3TP7A 1KNAA 1J6QA 1JQYD 1QVGA 4OONA 1A2UA 1QWYA 2VL6A 1STHA 1HPCA 1UE6A 1XPRA 1R4PB 2F3VA 4WRDA 3M9BA 1N34L 4UAIA 1I4RA 1YITA 4A76A 1BBUA 4KJNA 1CZWA 1LV9A 3AU7A 3BS1A 4L63B 5FJ8G 2M9VA 2E5LL 1EFID 1SYCA 4IPCA 5C3EH 2AWNA 1K8MA 1BR9A 1Z47A 1HHVA 1HUMA 4A3FB 2JQOA 4KKTA 4N9TA 5A2QE 3CCJA 1KL9A 1IKLA 2AWOA 4FF1A 1GOZA 2L55A 1UE5A 4K5XA 2JA5B 2LFNA 1HR0Q 4B3MQ 1LT5D 5GADC 2EQSA 2PI2A 3A0JA 2N49A 1BOSA 4MTNA 4C3HH 1FNUA 4ZLTF 1HR0W 1EEID 5A35A 3J80L 1PTOD 1E0BA 2F0DA 2ASBA 1VCIA 3HOYH 1PDQA 1CI3M 4LF4L 4LF8L 2HIVA 3CCSA 3AFQA 4UDUC 3NENA 1XJVA 2NVXH 1VQ5A 1QVCA 4DAMA 2A68D 3LWUA 4XIGS 4EVOA 1O7ZA 2K01A 3MA2B 3KDFA 2O5IC 1WYDA 1F9RA 1BCPB 2JXMB 5KYLA 1BBXC 1IW7C 2BE5D 2B2UC 1NUCA 4ZYSA 1H9MA 2R6GA 1IYUA 4C3JH 2F0SA 4DFAA 1TWGB 3MXNB 1ZKOA 4JK1C 3GTMB 1PYWD 3GTGH 4LF9Q 1SNQA 2UXDL 3P75A 2KA7A 1N36Q 1JJGA 4EQOA 5HGQA 1GUNA 1ET6A 1XTDA 2WACA 2YU9B 2AQ3B 1EY6A 2L11A 1BQQT 1V1PB 3GTKH 5CV5A 3T1HQ 1B3AA 1UWVA 3SHLA 2NUCA 3S15B 1EIHA 4QCLA 1U4PA 3NQTA 3F2CA 4X62L 5M5WH 2OCEA 2NWGA 4LWCA 4LF7Q 1KABA 4K5WA 4X66L 3TQYA 2D2CC 2GVAA 1IYJB 3IRBA 1CSPA 1GUTA 4DV0Q 4YY3L 1BBWA 3CU7A 4BA2I 4R4OA 1VDZA 4ZKBB 5COYA 1TWCH 3CKIB 3K59A 5IYDH 1MJCA 3ZYYX 1EYDA 4KK7A 2B63B 2UUBL 4YCUA 3GTOH 3G6JB 1YJNA 3NK9A 1C0AA 1TU2B 1EYCA 1SMYD 2UXBL 4P72A 2Q2HA 1LTTD 3KBXA 5J22A 1LTID 4O1NA 4MIUA 1JB7A 2EOTA 5C4JH 2CWPA 5M5XH 1B9MA 4DAVA 1E2ZA 3RMHA 3U50C 4A3DH 4OHJA 2BH8A 1SNDA 1S72A 4JC0A 1UUPA 1S5ED 2EJGC 1R4QB 4UHVA 3BDOA 1TY2A 2RVLA 2UXCQ 2Y0SE 2MQHA 4JI2Q 5HGTA 3KFUA 1EY4A 3B6YA 2F0UA 4IJHA 2ZTDA 1F2YA 3M3YB 4P75A 1PH2A 4TSSA 3RD4A 2WKDA 4ULLA 4I7ZC 4O2DA 3BDLA 1KD1C 1EQTA 1E2VA 1RF2D 3S24A 5BN3A 1JB3A 5JEAH 3RLFA 3S9WA 2L12A 3MXUA 1YBYA 2Z9HA 2UU9L 1A15A 1I4QA 3SK5A 4FDBA 2R7DA 2ES2A 2PI2E 4DR6L 2FFKB 2B2WC 4XQJA 1BO0A 3PO2G 2WINB 2SNSA 2NVQB 1BDOA 3S1MH 2CW0D 1D2BA 3VYRA 3G6EA 4A3KH 4A4IA 2KHJA 1E1TA 1ESFA 3PUYA 2K5NA 2MUYA 4L5RC 2FXQA 3GTJB 4JI0Q 2JP1A 3I4NH 5IP7G 1ILPA 3D6WA 4R4QA 3H0GH 1VF5C 2X6LA 1G51A 4KY6A 5LHY1 1N32L 1HUNA 3I4MH 2QF7A 3QG1A 3MEFA 3HS0C 3U4VA 3MXNA 4LFAQ 4A3EH 4JI4L 5L37A 4OIKA 3SGIA 2KUMA 4DR2Q 2SEBD 2KCCA 3FVQA 1ZEQX 4X3UA 3P7JA 2K52A 1VF7A 1W3SA 1AE3A 4PG3A 4X64Q 1V1PA 4KHVA 2IWHA 4IFDG 1JE4A 5IGDA 3Q22A 4HMJA 3UE1A 4ZCKA 4MNOA 3S2DH 5IT9E 1KIXA 2E2HB 4DR5L 2NN6I 3NELA 1S3OA 1TS5A 1I94Q 5K5PA 3L3OC 2XNAC 5DEHA 4N8X1 4QIWE 1JJCB 4IUTA 3Q6SA 3GTLB 2YTXA 4K0KQ 2QEJC 4PZ8A 4GZYC 4MHEA 3D4DA 1JOOA 4QJFA 1PFSA 1EQVA 1Y1VG 4B3SL 1HNXL 4JI3L 1KAWA 2F3IA 2EPBA 3OYYA 3CW2C 1XMQL 4OX9L 3OW2A 1Q46A 5LMUQ 4B3TL 1LTBD 1YNNC 1B44D 5CORA 1KQSA 1YI2A 1SLJA 2L0CA 4B08A 1Y1WH 5ELEA 2VZAA 4DV6Q 2DUDA 3MXGA 4A3FH 2Q2UA 1S4ZA 2EY5A 4F7XA 4B9WA 3PO2B 5EKKA 5D14A 3DWAA 3GTPB 1TWAH 4WFN3 2EE1A 1FR3A 3FPUB 2AQ1B 4ZQ3A 3D3RA 3N52A 4IUVA 3T1YQ 2JA5H 4HIKA 1Y69U 2AUJD 2IL8A 4PMWA 4Y52H 3RLOA 3PUVA 2L4NA 2I5LX 3SEBA 1B7YB 2EYMA 4FO2A 1TS4A 2A74C 4LK1C 4BBRB 3NTHA 4ZAIA 3EA6A 1Z6HA 1MJEA 1CQVA 3ERSX 4BA1I 2UUAL 3U9OA 4Z9CB 1G91A 4EQ5A 2BOSA 5EPJA 4NP5A 3TSSA 2RHSB 4FYDA 4HIMA 3RNUA 1YHQA 5D3DA 1ZXTA 3EIVA 4DR7L 1H9JA 3F2UA 4HCEA 5CYUA 1FGBD 2EYFA 4A3GG 4KMUC 1UAPA 1WTPA 1SE2A 4RFBA 4OXPA 3PO3G 3NWTA 1Q8KA 4C3IB 4OO1H 1IXRA 5GAEC 1SE8A 3BDCA 2OF1A 2AKWB 3BVMA 3I4OA 3E6ZX 1TWGH 4KKSA 3S1QB 4K14A 2A6HD 2RSNA 4RCNA 4JCVE 3SK6A 3FEWX 5C4XH 1PH1A 1SE3A 2VUMG 1Q1BA 3K8AA 2V1CC 4TKOB 4H0LC 4MZ9A 4DR3L 1YVCA 3ULPA 2EXDA 1SXTA 5FLMG 3S14H 4IUPA 1LABA 3HOXG 3IAYA 4K6LA 4DXGA 3HEJA 5E1FA 5FK9C 2MPMA 2NZ1D 3KLRA 2CH4W 4H44C 1FD7D 3TP5A 3L2PA 1T5EA 1PTOC 2F4IA 5E3FA 1WVLA 1LTAD 2QCPX 2K1BA 2IJ0A 3S15H 2MO0A 1VQOA 5DLQE 2JEBI 1XNRQ 4K8JA 5FLXc 1VQPA 1Z9FA 1K83B 2B2UA 2NVYB 5CV8A 5IYBH 1PVOA 2XTIA 1WTXA 3OPOA 4E6IA 4GKKL 4IOAA 2A68C 1WD0A 1STEA 1VQDA 2F0LA 3M4YA 1PRTD 2BE5C 2OXPA 4UY8C 2FINB 5A2QL 3KOJA 1JICA 2Z4IA 5D3IB 1E22A 3CC2A 5IWAL 4K8IA 1RTNA 2LMCB 1QE6A 3K80C 1OO9B 3BZDB 1C8CA 1EZ8A 3MAQA 1K3BC 3U4ZA 2I5MX 2KJXA 2OQKA 2VS1A 3AFPA 3PF5A 2RBMA 3GDEA 1FL0A 3KLSX 4ZKCB 1AW7A 2K32A 2VXWA 3EBEA 5KIXA 1A3UA 3J7AF 1N34Q 2IT1A 5C3XA 5E4XA 3HOVG 2RKSA 5LL6X 3TEHB 5LMNL 1TS2A 3HKZG 3UDIA 4YIJA 2Q8TA 2E5LQ 1I3QH 1L0XB 5IODA 1B8AA 2ZM6L 1O7IA 3QOJA 4J1MA 2PCFB 1RL2A 3NXWA 4NXML 4DV5L 3H15A 3PMFA 3C1FA 1D5XC 4A3CG 3M3YH 1K0SA 1B9NA 1ENFA 5C44G 2A19A 4NPSA 4X3TA 3SK8A 5CC4A 3I8ZA 1IL2A 2WB1E 1FNVA 4A3GB 2Z6KC 3DWPA 5GQOA 2L5TA 3PO3B 4DV1L 1M4VA 3RLNA 3S1RB 4RKLA 3LX0A 5M3FG 1PZKD 4X3SA 3M4OB 3T53B 4OWWB 1SMYC 4JI5L 1LACA 2FJ2A 4X65Q 1GUSA 2JYOA 5JOBA 4KI0A 1Q90A 2IX3A 4OWXB 3CCUA 5HURA 1D1KA 1DCZA 1M1KC 3S17B 2CWAA 1XTCD 4QB4A 1MD2D 4XQNA 4R4IA 1PH3A 1ENAA 2ZTCA 4F88A 5GROA 3FPPA 3CC4A 3ULJA 1CQFA 3TP6A 1MGSA 3J81i 2EYOA 4YCVA 3M7GA 2I0QA 1SYFA 1K8AC 2B2WA 5M5YH 2VQEQ 4XT1B 2LY7A 3IFDA 4CBVA 2LXKA 2UXDQ 3R2TA 1VS0A 1BNZA 1FNWA 3E9IA 1VQJA 2F0KA 4YHHL 1XNQL 1PYSB 5I2XA 1PH5A 1NAPA 2H4OA 3NTIA 1SRUA 2OT2A 1U0LA 4DK1A 1QG7A 1DONA 2CW0C 4R9WA 2YTYA 2JA8G 1STAA 2HHHL 5KGUA 1F9QA 4X66Q 3CF5A 4LFCL 3RR5A 4BY7G 2CH4A 3HRZC 1QOHA 3HOVB 1QNKA 4YY3Q 1RKNA 3HKZB 4RKBA 2YTVA 3DM1A 3GTLH 1VQKA 1XPOA 1VQMA 5I4DA 4UP8A 1EEFD 3ER0A 5IYCG 4DV7L 1PTOB 1YNJD 4RMFA 3M85A 5C44B 1G6ZA 2XWBB 2UXBQ 2O4XA 4JI1L 3OWFA 2ZJRA 2RDFA 1WOCA 4DR4Q 1RIPA 2K04A 3FDTA 4DNRB 2B63G 3MXPA 1NR4A 2MO1A 3NEMA 5M3FB 4JBWA 1WCMB 4A3IB 2IY5B 4A3MH 2J0TD 2BDNA 4KHPQ 3PO2H 2H5XA 1CT1D 4N8FA 4QUCA 4HJ7A 4KN7C 3I3CA 5F2DA 3NPPA 3FHWA 3J7AV 2E2IH 4JI6L 5BN4A 4HIOA 4R1JA 1EYGA 1EOTA 2PZTA 2RF4A 1WTQA 1QZGA 2HCIA 1E3PA 4XYQA 4DXFA 2WFWA 2C9OA 5EKIA 2QDLA 3NBHB 5IP7H 3TS2A 4K2LA 3URYA 4KV6A 3PUWA 4O42A 1B4OA 1VQBA 1YHAA 2O5JC 1CKMA 3KBGA 2UU9Q 4IPDA 4KKUA 1U4LA 1PH6A 5H1SE 1A63A 3GTQB 3ONAB 2K5WA 1A3TA 4DNIA 1NSNS 1MIUA 4DUYL 1I5FA 2RSOA 1K9MC 5C5MA 2NN6G 3V05A 4KD4A 4IFDH 1QB5D 2NBFA 4FF3A 2F1MA 1R9TH 2NYZD 2R93G 1J5EL 4ME3A 4K6DA 4DU9A 2JA8B 1N32Q 1KDAA 1V8QA 4BY7B 1KDBA 5E4WC 3TDQA 1LM0A 5IT9c 2PW5A 1KXLA 4JI4Q 1HTLD 1PZJD 1UNSA 1EWCA 1VQIA 3BVGA 4NW2A 3CRKC 2P5ZX 4BBSG 5DAUA 3TZUA 3EVQA 1HNWL 1DM0B 1BXTA 1Y1VH 1DZ1A 3LWEA 3F2DA 4FF2A 4RGNA 1C7YA 5M3MG 2DGYA 4LUZA 1O80A 3A56A 1K83H 2MFIA 3U58A 1NCVA 2RDGA 1LT3D 2ENBA 1TQOA 3A8KE 3W5OA 4DR5Q 2K05A 4U673 2X69A 1CZGA 4C56C 3M4QA 1BF4A 2B2VC 2MGSA 1D7QA 1JC7A 3MHBA 2KVMA 2QGQA 3D0FA 2RHQB 1EIGA 3BG3A 1XWEA 3K5LA 3FKIG 2BCOA 1L2FA 2KEDA 4GN5A 1L1OC 4V0BA 1I50B 4KN4C 1W2BA 2A6HC 4DV4L 2AMCB 1M8AA 3QR8A 4GS3A 3UDGA 1HNXQ 1PHJA 3D6CA 3E3XA 1HRJA 3JAME 5IE8A 3RN2A 1XMQQ 1Y8NB 4OX9Q 1SBBB 1YJ9A 4CJ0B 2E74C 3HOUH 1A6XA 1CHPD 1TWHB 1X3FA 1L0YB 5FO8B 2GA4B 3AEVA 4ME5A 5ELNA 3H3VC 2MJ8A 1PTOF 4RHRA 3K7AB 2XIWA 4DV2L 3CPWA 3CCMA 3DLLA 3J81c 3QOLA 2B8FA 5FO7B 4I7AA 1ICFB 5M9OA 2PYKA 3NBIA 3QJYA 5G3LD 1EQQA 4DUZL 4RCOA 4RGMA 3UI2A 4LJZC 1DOKA 2LXJA 1PRTC 5EBDA 3NBHA 1GVPA 4EQPA 3PO3H 1BVSA 2D62A 3I7FA 1HNZL 1AH9A 4JYAL 2TSSA 1I4PA 3S1RH 4XT3B 4ODGA 2R93B 1D1IA 2K5DA 4JOIC 3M4OH 5IGFA 1FVIA 3CMAA 1Q7YC 4HEDA 2UUCL 2VUMH 4IPGA 5C3EG 3CQZB 1NR2A 5FLMH 3BJUA 3MZ5A 1G8ZD 1TR5A 2LKVA 3JC66 3HOXH 3AMUA 4FXDA 3S16B 3A8IE 2ZXRA 2R92B 1JWSD 4BBSB 1Y14B 4DR7Q 2R61A 4BBRG 2M2LA 3A55A 1TS3A 2YV5A 5KNDA 4IOCA 5ELOA 2CFMA 1EWIA 1SYGA 5M3MB 4AQYL 4WJ3M 3PIO3 4IO9A 3Q23A 4CJ2C 1I6HH 5C0XJ 2JK8A 5ELBA 5BN5A 3A5UA 1H9KA 3CPFA 4FNFA 3J80E 4DV3L 4QQBX 3KJOA 1PZID 4DR3Q 2VW9A 1DGSA 1IBMQ 3T4AC 3RZDB 1N36L 4A3BB 4C3IG 3HOWB 3FKIB 2F0JA 1GKHA 1VQAA 2E2JB 3R8BA 3SXHA 3G4SA 2I46A 1HA5A 4ABNA 2QKIC 2SNMA 3A74A 3T1HL 4O0AA 1Q82C 1EY9A 3DEPA 2BA1A 4NXNQ 5IP9G 3PF4A 3K6OA 1U5KA 2H1EA 1NNXA 4G7OC 1M90C 3DMUA 3VR5A 3HOVH 4GKKQ 5HY6A 4DV0L 4NDXA 2ID0A 2F0HA 3HGBA 1EOVA 4H13C 1DXMA 4BY1B 3J7ZC 2VQFQ 4BXXG 3I73A 3QIAA 1X56A 2HCCA 5TSSA 4LF5Q 3GV3A 4A3CH 1PTOH 4HIDA 1LTSD 1QZHA 3HKZE 3I90A 5C44H 5IWAQ 4HAEA 4S3SA 5K36G 3DWQA 2KCNA 2WIIB 4GOPC 2JA9A 1SFOB 2PQEA 5I9PA 3CCLA 2QW7A 4WJWA 5M3FH 1LT6D 2KECA 2WV6D 4JV5Q 5EJWA 4QGUA 1LTLA 2NTSA 5JJLA 2F3WA 5C3EB 5LMNW 1EZ6A 1F77A 4LFBL 5FKAC 4ALPA 4DV5Q 1L1OB 4CDCC 2DY7A 3PIPA 3N6RA 4G4KA 1H9RA 2K5VA 2EIFA 1W6KA 2XGTA 3OMCA 2M00A 3JAMi 3J81E 1H95A 2FHTA 4JI7L 3D8GA 4KD3A 4TQUS 1HXYD 1FJGL 3L0OA 1D5ZC 2OQ0A 3D4RA 4DV1Q 4DGZA 1JORA 1YNJC 3TMEA 5C0XI 1K73C 3K7UC 2K28A 2A73B 1QVFA 1GO3E 1ASZA 4JI5Q 3OMGA 3HOZG 3HOYB 4XYOA 5AFWA 3TBIB 1VQEA 1JOQA 4HJ8A 4GN4B 1S5FD 1K3RA 2J4XA 3K5OA 2V4DA 3VR6A 3OIPA 1P16A 1YHBA 3I70A 4IALA 3U9SA 3G71A 4JI0L 2KCMA 2F0EA 1PRTB 2PQAB 2ZXOA 4DR1L 1IBKL 1HJPA 3GTMH 3I2ZA 1X65A 2DNCA 3EJIA 2JA8H 2C5CA 3QO2A 1HH2P 1JMCA 3F8TA 4FXKC 4MTKA 1XYIA 1JOKA 4BY7H 1H9SB 5FLXL 4WORA 3CD6A 2YU9H 3PCOB 3AQQA 4BWGB 3BU2A 1EY5A 3A54A 5KRUA 1MBYA 5I2YA 1ET9A 2IX0A 4PMCA 4M1UB 3SDZA 3FP9A 4JBKA 4XDXA 3KF8B 3GD7A 3E0EA 5IYCH 1IBLL 1WJJA 4PQXA 4AH6A 1A8VA 4IUUA 4R8IA 1I6VC 1VMPA 2VY3A 3S1NB 3GTKB 1QILA 2X6GA 3V96A 2XN9C 4FF4A 1DOLA 1EU4A 5FJ8H 1JWMD 1AN8A 3K0YA 4P2CB 4HJAA 4HMIA 1PMRA 4X3KA 1VMCA 1SAPA 3I4MG 3VYTA 2L1BA 4LFCQ 1SYDA 1VQ9A 2B63H 1AP0A 2HQEA 3J80i 1STBA 3STBC 4AYBG 1TY0A 3MFYA 1N33L 3CAMA 1HTPA 1JCKB 1Q12A 3GP7A 4IQZA 1I50H 2OTJA 1AE2A 1CUKA 5JPMC 3D4WA 1VQ7A 2CQOA 4YCWA 2N78A 4DV7Q 3C2PA 1WD1A 3RUZA 3GTOB 1STYA 2SDFA 1KRTA 2PW7A 1V43A 4R4TA 4A93G 2LSSA 3OTOL 1I4XA 2DJGC 5JEAJ 3H91A 1FYCA 4HJ5A 4EGVA 3BYTB 5C4JB 1YEZA 3CCQA 5M5XB 4IFDI 2B2VA 3K5MA 2EY1A 1X32A 1PFBA 4TRDA 3HKSA 5CV7A 2D0OA 3HOZB 4CGYB 3TN2A 1L1OA 3C1EA 1EY8A 3PQIA 2ZJPA 1PLFA 5C5LA 4A3IG 1WCMG 3V2TA 2ZXPA 2N3SA 1E24A 3MWYW 3PUXA 2Q2TA 5AJ3L 4N9PA 1GD7A 3R2IA 4GOPB 2NVQH 4XTCS 4LF4Q 4LF8Q 1MKHA 1VQNA 1GJXA 1WTOA 4UP7A 4MN3A 3PIP3 2XRSD 3S16H 1HZAA 2Q2IA 2PZUA 4KLKA 3GTJH 2F03A 4BBSH 4DUYQ 3NWSA 3HFZB 2JE6I 2KHIA 1NMGA 3VA7A 1SNOA 2ZTEA 5M3MH 1JT8A 4LNQA 2HT1A 2BDOA 1A62A 1G291 3QB3A 5C4HA 1J5EQ 1NMFA 5CR3A 1EQRA 3BZCA 1LO5D 3H0GB 1O78A 3OIQA 4JOIA 3VR2A 5JJZA 5FOBB 3MEHA 1EUJA 1VQHA 4NKLA 3I4MB 2G5DA 1VQLA 1PH7A 4GLAC 1HZBA 3RZDH 5EQ0A 1LTRD 4AYBB 1F2ZA 3DM3A 3FKIH 1PRTF 3WDNA 1ONLA 5EAYA 4DAPA 3KF8A 1C9OA 3A8JE 1S5BD 2Z0SA 3DEOA 2E2HH 1WFQA 1HNWQ 3CCRA 2WKCA 4DK3C 2WAQG 1HFGA 2F0FA 4X62Q 4GNXC 1ESRA 4EX5A 3WOFA 2B2YC 1G6PA 3TS0A 1YIJA 2KBNA 1SJHD 4HCSA 3J7A5 1B70B 2IHEA 2CKZB 3OHXC 4A93B 2L15A 3L9AX 3MFGA 3T51B 1LUZA 3PUZA 5C3WA 4JVZA 3S2DB 2A8VA 1B50A 4YWLA 2F0NA 3VA5A 1JWUD 2JA7G 3JAMc 1STGA 1TT2A 1DJRD 3H09A 2B2TC 4OEMB 2UUBQ 1LYLA 1SMXA 2JA6G 2R7ZG 4GKJL 2F0VA 3LNNA 4HR7B 4IN3A 4PV1C 5GAHC 4ID6A 1O7LA 1TVXA 1O7YA 1PV4A 1K8GA 1EFWA 4IZ8A 1SFOH 1C4QA 1HQMC 2K14A 2XRQD 1D5MC 3KF6B 5IYBG 1UE7A 3S2HB 1C48A 2R7FA 2HQLA 4Y7NB 4L5SA 2N88A 1ML0D 3GTPH 2PNHA 3K0XA 4LMQD 5IGGA 4QUFA 1E1OA 1V1OA 2G9HD 4KHZA 4IJLA 1Y1WB 3SK4A 2D9UA 1YZ6A 3MC0B 4DV2Q 4G7ZC 2SOBA 4R4CA 5CGKA 2B39A 4RGOS 4JI8L 4QL5A 4A3JG 3FRPB 1OXXK 2KCTA 1TWAB 1EIYB 4DUZQ 2NZHA 4BBRH 3EROA 1TXYA 1RTOA 2A6ED 2XWJB 4KY7A 1F9SA 3KLWA 1UEAB 2DJFC 5I6WA 1EU3A 3PIOA 1OXVA 4PNYA 2EDGA 1HNZQ 4DR6Q 4GOPA 4JYAQ 3A5ZB 4ZUJA 3H3VH 3DHQA 4DAYB 5IIFA 2F4VL 2UUCQ 5EPKA 2F0OA 1TKWB 2WB1G 4X65L 4J6HA 2K75A 2OWOA 4B3RL 3CC7A 3STBD 4CKEA 4CHTB 1HZ9A 5IT9L 2EVBA 3EQLC 2E76C 3VR3A 4KY5A 4C3IH 3J80c 3K5NA 2IHFA 1XMOL 2ZT9C 1RJTA 2K5HA 2K7VA 5I6YA 4PMBA 1PFMA 4A3LG 2CVRA 2KHSA 2WAQB 4IURA 3S1QH 2CCZA 3D31A 4R8NA 4AQYQ 2B29A 3HG9A 5ELCA 5IP9H 4RHSA 3ERQA 1X54A 2F0QA 3K57A 1QUQB 4HTHA 2RCNA 1AFPA 1DOMA 3UDXA 2R92G 1Q86C 1K0RA 2WP8J 1RHPA 2JA7B 1F2LA 2EXZA 3ND8A 5DNFA 5IOCA 2VQEL 4DV3Q 5C4XB 5BR8L 5CBEE 2BA0A 2JA6B 2R7ZB 4BXXH 3S14B 5JVH3 2LS01 2F0PA 2EYLA 2NVYH 3T13A 1KRSA 3OW7A 4LF6L 3RZOB 3CHBD 1SN8A 5CMDA 2RQXA 3S1NH 1KC8C 1CKNB 1KTKA 3NP8A 4HJ9A 4CKBA 4GN3B 5K36H 4G57A 3Q0AA 1P8LA 4A3BG 1BCPD 3M4PA 5ELFA 2KENA 3ITPA 3HOWG 1DD2A 1Q81C 2GVBA 1X55A 3UDFA 2QILA 1PA6A 4JPBW 4B3SQ 4JI3Q 3G48A 3A7LA 4DN4M 4CKCA 1K28A 2XVSA 1D8LA 1GXDC 1SNCA 5E7NA 5KEEA 1RD9D 4A3JB 4GNXB 4B3TQ 2FMMA 5C0XG 1B2TA 5CV6A 2B8GA 3J81L 3TZDA 3X3NA 1T9HA 3ULLA 2RA4A 4EQNA 1BKBA 4LAAA 2Z8LA 2IPKD 3CCEA 2K6AA 1HQRD 4DNTB 2JEAI 2Z6BA 1V9PA 3KF6A 2HD3A 4BY1G 2KQ3A 4DR4L 2HUGA 2K33A 4OO1I 5GAGC 1DYQA 2O2LD 1IL8A 1A0IA 1SROA 3MTSA 1NJIC 1CM9A 2PMZB 3UE0A 1EWHA 3F1ZA 2J7ZA 4KHPL 5JJKA 1WTHA 3HOZH 4C1NI 1I3QB 3RN5A 2ALYB 4A3GH 2WB1B 4LFBQ 1HR0L 1BUVT 4B3ML 1VQ4A 3IL8A 2PZWA 1Q8IA 1QJOA 3NE5B 5KNBA 1TWFB 2QDBA 3AYHB 4JI7Q 1PFNA 3H94A 2UUAQ 1NBWA 1FJGQ 2MNAA 3ZJYC 1NE3A 5D65A 1NTGA
chains in the Genus database with same CATH topology
1ZYRC 1U4RA 2E2DC 2A69D 2K03A 3VYUA 1QCBD 2L9HA 2RDHA 1CK1A 4DAYA 1Y8PB 2NVTB 2Q8IB 3C3LA 1AZPA 2FMCA 3KUPA 1LT4D 4I65A 4L6TB 2KEEA 4C3HG 3W2DA 4C2MB 1CHQD 1XXGA 1WTWA 1WTVA 5ELDA 4J8QA 2PPBC 5EKLA 3K58A 1OXSC 3C46A 1A2TA 5LL6S 4XQQA 1MSHA 1X3PA 1KLGD 2VB2X 3R3OA 1T5XD 2XSCA 1CTMA 3KK7A 1I4GA 5M5YB 1BCPF 4XXEA 3NHHA 3CRLC 2CHBD 2EY2A 3IKJA 4ZUIA 4C3JG 1Z7TA 4OIJA 2KOLA 2F0TA 1D6EC 2JSOA 2DN8A 2F0GA 4ZK9B 2IW3A 3NTKA 3I72A 4RGTA 5NUCA 4FVMA 1AZQA 3H6MA 2A5HA 1U9RA 1LTGD 1SJED 2OEOA 1SNMA 4FP5D 3VYSA 3NQIA 2EY6A 5DM73 3WOEA 3E0JA 1B53A 1RDPD 1SE4A 5G3LF 1J8IA 1IHZA 2B2YA 4U68A 4C1NK 1IW7D 3SVMA 1CFMA 1K8OA 2B2TA 4DF7A 1G2TA 4A3MB 2IX1A 3I4LA 4L8JA 1W6JA 4ZRZA 4G7HC 2AQ2B 2EYJA 2F0WA 3GQBA 2DNEA 2E2IB 4IFDJ 2HDLA 3KLSA 5C4ZA 1I4HA 1SSOA 2MHVA 4C3HB 1II3A 4K2KA 3DXJC 5J39A 2Z4HA 3G7LA 4FXGC 1HFNA 1KLUD 1QNUA 4HSVA 1EL0A 3OWEB 5KYIA 4M8AA 2NVXB 4HN7A 1TIID 3FMCA 3DUZA 2PO4A 4KJOA 5DM63 3X3MA 2NTTA 1Q3LA 5I9OA 4KTAA 4RAUC 3PV0A 1S5DD 3I91A 5JEAG 3NUCA 5J1ZA 4C3JB 4V190 4K5VA 1R9TB 3M7NA 1SYEA 5JAVA 1EY7A 3L7ZC 5FO9B 3GTGB 2TMPA 2G9DA 3O13A 1ICWA 2A6EC 3MVVA 2YYZA 1STNA 1IYVA 4DK0A 4Q0FA 3QWNA 3BVZA 3Q24A 1RCVD 2EYHA 3A7AB 5T1GA 1X3QA 1F9PA 5KNCA 3T56B 4Q5VA 1Y1VB 2VNUD 4F87A 1EY0A 2N55A 5M5WB 4DA2A 2D5DA 2CQAA 3BYYB 4CJ1B 3T16A 1TWCB 2EZVA 1MSGA 1CA5A 1ZYRD 2K5QA 2R3ZA 1WTRA 1F2MA 3NSWA 3OOCA 5CV9A 5IGCA 2EJMA 2Y0SB 1A3VA 1LLRD 4F8MA 1J9OA 4A3DB 3W3AA 1GHJA 3HOUB 3ND9A 3SE0A 1B1ZA 1OXUA 2Z1CA 2VB3X 1GUOA 2NN6H 3J7YW 1KNEA 5ISRA 4NMZA 2F0MA 2NB0A 5EBCA 1BCPC 2DY8A 2PNRC 5EGTA 2AUKA 1JR0D 5CBAE 5C6AA 2EJFC 4HSPA 4IUQA 1HA6A 3P20A 2EYPA 5IGBA 3IFTA 1KDCA 3TP8A 5EPLA 4RWSC 5CV4A 1KAAA 3S1MB 1ILQA 3R93A 2ICIA 4A3KB 2VUMB 1GUWA 3HOXB 1GUGA 3I4NB 1GHKA 3E5SA 5JVG3 3EFXD 3VR4A 1CA6A 1MI2A 3GV6A 1AEXA 1SYBA 1H9SA 1IKMA 3SR1A 1ENCA 4A3EB 1I6HB 3GO5A 4OGQC 4QF4A 1HCZA 3OSOA 4IUNA 1YNND 1SEBD 1S5CD 3P1HA 1XX8A 1OXTA 2HDMA 2MP1A 1U4MA 3JAML 4ILWA 3AB9A 1E2WA 2I07B 4OO1G 2ICEC 1Q1EA 2Q8RE 2A69C 4QIWB 4QMGA 1PXUA 5C0XH 1Y8OB 4BS9A 4OL7A 1G2SA 4H7BA 4B9XA 1EYAA 3HZXA 1SDFA 2F0IA 5T1IA 3HP3A 1RODA 4RH6A 1SNPA 5FLXE 5IGEA 2E75C 5JPNC 4RA8A 3TP7A 1KNAA 1JQYD 1A2UA 1QWYA 1STHA 1HPCA 1R4PB 2F3VA 4WRDA 4UAIA 1I4RA 4KJNA 1CZWA 1LV9A 3AU7A 3BS1A 4L63B 2M9VA 1EFID 1SYCA 2AWNA 1K8MA 1BR9A 1Z47A 1HHVA 1HUMA 4A3FB 4KKTA 4N9TA 5A2QE 1IKLA 2AWOA 4FF1A 1GOZA 2L55A 4K5XA 2JA5B 2LFNA 1LT5D 1BOSA 1FNUA 4ZLTF 1EEID 5A35A 3J80L 1PTOD 1E0BA 2F0DA 1VCIA 1PDQA 1CI3M 4UDUC 2A68D 3LWUA 4XIGS 4EVOA 1O7ZA 2K01A 3MA2B 2O5IC 1F9RA 1BCPB 2JXMB 5KYLA 1BBXC 1IW7C 2BE5D 2B2UC 1NUCA 4ZYSA 1H9MA 2R6GA 1IYUA 2F0SA 4DFAA 1TWGB 1ZKOA 4JK1C 3GTMB 1PYWD 1SNQA 3P75A 2KA7A 4EQOA 1GUNA 1ET6A 2WACA 2YU9B 2AQ3B 1EY6A 2L11A 1BQQT 1V1PB 5CV5A 1B3AA 3SHLA 2NUCA 3S15B 1EIHA 4QCLA 1U4PA 3NQTA 2NWGA 1KABA 4K5WA 2D2CC 1GUTA 3CU7A 4BA2I 1VDZA 4ZKBB 5COYA 3CKIB 3K59A 3ZYYX 1EYDA 4KK7A 2B63B 3G6JB 3NK9A 1TU2B 1EYCA 1SMYD 3KBXA 1LTTD 5J22A 1LTID 4O1NA 4MIUA 2EOTA 1B9MA 4DAVA 1E2ZA 3RMHA 4OHJA 1SNDA 1UUPA 1S5ED 2EJGC 1R4QB 3BDOA 1TY2A 2RVLA 5HGTA 1EY4A 2F0UA 1F2YA 3M3YB 4TSSA 3RD4A 2WKDA 4ULLA 4I7ZC 3BDLA 1EQTA 1E2VA 1RF2D 5BN3A 1JB3A 5JEAH 3RLFA 3S9WA 2L12A 3MXUA 1A15A 1I4QA 3SK5A 2FFKB 2B2WC 4XQJA 1BO0A 2WINB 2SNSA 2NVQB 1BDOA 2CW0D 1D2BA 3VYRA 1ESFA 3PUYA 2MUYA 3GTJB 2JP1A 1ILPA 3D6WA 1VF5C 2X6LA 4KY6A 5LHY1 1HUNA 2QF7A 3QG1A 3HS0C 3MXNA 4OIKA 2KUMA 2SEBD 2KCCA 3FVQA 1ZEQX 4X3UA 3P7JA 1VF7A 1V1PA 4KHVA 2IWHA 4IFDG 1JE4A 5IGDA 3Q22A 4HMJA 5IT9E 2E2HB 2NN6I 1TS5A 5K5PA 3L3OC 2XNAC 5DEHA 4IUTA 3Q6SA 3GTLB 2QEJC 4GZYC 4MHEA 3D4DA 1JOOA 1EQVA 2EPBA 1LTBD 1YNNC 1B44D 5CORA 2L0CA 4B08A 5ELEA 3MXGA 1S4ZA 2EY5A 4F7XA 4B9WA 3PO2B 5EKKA 5D14A 3DWAA 3GTPB 4WFN3 2EE1A 1FR3A 3FPUB 2AQ1B 4ZQ3A 3D3RA 3N52A 4IUVA 1Y69U 2AUJD 2IL8A 4PMWA 3PUVA 2L4NA 3SEBA 2EYMA 4FO2A 1TS4A 2A74C 4LK1C 4BBRB 3NTHA 4ZAIA 3EA6A 1Z6HA 1CQVA 4BA1I 3U9OA 4Z9CB 1G91A 2BOSA 5EPJA 4NP5A 3TSSA 4FYDA 5D3DA 1ZXTA 1H9JA 3F2UA 4HCEA 5CYUA 1FGBD 2EYFA 4KMUC 1UAPA 1WTPA 1SE2A 4RFBA 3NWTA 4OO1H 4C3IB 3BDCA 2OF1A 3BVMA 3E6ZX 4KKSA 3S1QB 4K14A 2A6HD 2RSNA 4RCNA 3SK6A 3FEWX 1SE3A 1Q1BA 4TKOB 4H0LC 1SXTA 4IUPA 1LABA 3IAYA 4K6LA 4DXGA 3HEJA 5E1FA 5FK9C 2MPMA 2NZ1D 3KLRA 4H44C 1FD7D 3TP5A 1T5EA 1PTOC 2F4IA 5E3FA 1WVLA 1LTAD 2QCPX 2K1BA 2IJ0A 2JEBI 4K8JA 1K83B 2B2UA 2NVYB 5CV8A 1WTXA 3OPOA 4E6IA 2A68C 1WD0A 1STEA 2F0LA 3M4YA 1PRTD 2BE5C 2OXPA 2FINB 5A2QL 1JICA 2Z4IA 5D3IB 4K8IA 1RTNA 2LMCB 1QE6A 1OO9B 3BZDB 1C8CA 1EZ8A 3MAQA 2KJXA 4ZKCB 2RBMA 3KLSX 5KIXA 1AW7A 2K32A 2VXWA 1A3UA 3J7AF 2IT1A 5C3XA 5E4XA 2RKSA 5LL6X 1TS2A 4YIJA 2Q8TA 1L0XB 5IODA 3QOJA 4J1MA 2PCFB 3NXWA 3PMFA 3C1FA 1D5XC 1B9NA 1ENFA 4X3TA 3SK8A 5CC4A 3I8ZA 1FNVA 4A3GB 3DWPA 2L5TA 3PO3B 1M4VA 3S1RB 4RKLA 3LX0A 1PZKD 4X3SA 3M4OB 3T53B 1SMYC 1LACA 2FJ2A 1GUSA 2JYOA 5JOBA 4KI0A 1Q90A 2IX3A 5HURA 1D1KA 1DCZA 3S17B 1XTCD 4QB4A 1MD2D 4XQNA 1ENAA 4F88A 3FPPA 1CQFA 3TP6A 1MGSA 2EYOA 3M7GA 1SYFA 2B2WA 4XT1B 2LY7A 3IFDA 4CBVA 3R2TA 1BNZA 1FNWA 2F0KA 5I2XA 1NAPA 2H4OA 3NTIA 2OT2A 4DK1A 1QG7A 1DONA 2CW0C 4R9WA 1STAA 5KGUA 1F9QA 3HRZC 1QOHA 3HOVB 1QNKA 1RKNA 3HKZB 4RKBA 3DM1A 5I4DA 1EEFD 1PTOB 1YNJD 3M85A 5C44B 1G6ZA 2XWBB 2O4XA 3OWFA 2RDFA 2K04A 3FDTA 4DNRB 3MXPA 1NR4A 5M3FB 4JBWA 1WCMB 4A3IB 2J0TD 2BDNA 1CT1D 4QUCA 4KN7C 3I3CA 5F2DA 3NPPA 3J7AV 5BN4A 1EOTA 2PZTA 1WTQA 2HCIA 4XYQA 4DXFA 2C9OA 5EKIA 4K2LA 3URYA 4KV6A 3PUWA 4O42A 1B4OA 2O5JC 3KBGA 4KKUA 1U4LA 3GTQB 3ONAB 2K5WA 1A3TA 1NSNS 2RSOA 5C5MA 2NN6G 3V05A 4KD4A 4IFDH 1QB5D 2NBFA 4FF3A 2F1MA 2NYZD 4K6DA 4DU9A 2JA8B 1KDAA 1V8QA 4BY7B 1KDBA 5E4WC 3TDQA 2PW5A 1HTLD 1PZJD 1UNSA 1EWCA 4NW2A 3BVGA 3CRKC 5DAUA 3TZUA 3EVQA 1DM0B 1BXTA 1DZ1A 3LWEA 4FF2A 4RGNA 1O80A 3A56A 1NCVA 2RDGA 1LT3D 2ENBA 1TQOA 3A8KE 2K05A 4U673 2X69A 1CZGA 4C56C 1BF4A 2B2VC 2MGSA 1JC7A 3MHBA 2KVMA 1EIGA 3BG3A 1XWEA 3K5LA 2BCOA 2KEDA 4V0BA 1I50B 4KN4C 2A6HC 1M8AA 3D6CA 1HRJA 3JAME 1Y8NB 1SBBB 4CJ0B 2E74C 1A6XA 1CHPD 1TWHB 1L0YB 5FO8B 2GA4B 4ME5A 3H3VC 2MJ8A 1PTOF 4RHRA 3K7AB 2XIWA 3QOLA 2B8FA 5FO7B 5M9OA 2PYKA 3NBIA 3QJYA 5G3LD 4RCOA 4RGMA 3UI2A 4LJZC 1DOKA 1PRTC 5EBDA 3NBHA 4EQPA 2D62A 2TSSA 1I4PA 4XT3B 4ODGA 2R93B 1D1IA 2K5DA 5IGFA 4HEDA 3CQZB 1NR2A 3MZ5A 1G8ZD 1TR5A 2LKVA 3AMUA 4FXDA 3S16B 3A8IE 2ZXRA 2R92B 1JWSD 4BBSB 2R61A 2M2LA 3A55A 5KNDA 1TS3A 5M3MB 1SYGA 3PIO3 3Q23A 4CJ2C 5C0XJ 5ELBA 5BN5A 1H9KA 4FNFA 3J80E 1PZID 3T4AC 3RZDB 4A3BB 4C3IG 3HOWB 3FKIB 2F0JA 2E2JB 3R8BA 3SXHA 2I46A 1HA5A 4ABNA 2QKIC 2SNMA 1EY9A 3DEPA 2BA1A 3K6OA 2H1EA 4G7OC 3DMUA 3VR5A 4NDXA 2ID0A 2F0HA 3HGBA 4H13C 1DXMA 4BY1B 3I73A 3QIAA 2HCCA 5TSSA 3GV3A 1PTOH 1LTSD 3I90A 4HAEA 4S3SA 5K36G 3DWQA 2KCNA 2WIIB 1SFOB 2PQEA 5I9PA 4WJWA 1LT6D 2KECA 2WV6D 5EJWA 2NTSA 2F3WA 5C3EB 1EZ6A 1F77A 5FKAC 2DY7A 3N6RA 4G4KA 1H9RA 1W6KA 3OMCA 2M00A 3J81E 2FHTA 3D8GA 4KD3A 4TQUS 1HXYD 1D5ZC 3D4RA 4DGZA 1JORA 1YNJC 3TMEA 5C0XI 2K28A 2A73B 3OMGA 3HOYB 4XYOA 5AFWA 3TBIB 1JOQA 1S5FD 2J4XA 3K5OA 2V4DA 3VR6A 3OIPA 3I70A 4IALA 3U9SA 2F0EA 1PRTB 2ZXOA 2DNCA 3EJIA 2C5CA 3QO2A 4FXKC 1XYIA 1JOKA 1H9SB 5FLXL 4WORA 4BWGB 1EY5A 3A54A 5KRUA 1MBYA 5I2YA 1ET9A 2IX0A 4PMCA 4M1UB 3SDZA 4XDXA 3GD7A 4PQXA 4R8IA 4IUUA 1I6VC 1VMPA 3S1NB 3GTKB 1QILA 2X6GA 3V96A 2XN9C 4FF4A 1DOLA 1EU4A 1JWMD 1AN8A 3K0YA 4P2CB 4HMIA 1PMRA 4X3KA 1VMCA 1SAPA 3VYTA 2L1BA 1SYDA 1AP0A 2HQEA 1STBA 1TY0A 3MFYA 1HTPA 1JCKB 1Q12A 3GP7A 4IQZA 5JPMC 3D4WA 3C2PA 1WD1A 3RUZA 3GTOB 1STYA 2SDFA 2PW7A 1V43A 1I4XA 5JEAJ 3H91A 1FYCA 4EGVA 3BYTB 5C4JB 5M5XB 4IFDI 2B2VA 3K5MA 2EY1A 1X32A 1PFBA 4TRDA 5CV7A 3HOZB 4CGYB 3TN2A 3C1EA 1EY8A 1PLFA 5C5LA 3V2TA 2ZXPA 3MWYW 3PUXA 4N9PA 3R2IA 4XTCS 1GJXA 1WTOA 4MN3A 3PIP3 2XRSD 2F03A 2PZUA 3NWSA 2JE6I 3VA7A 1SNOA 2BDOA 1G291 3QB3A 5C4HA 5CR3A 3OIQA 1LO5D 3H0GB 1O78A 3VR2A 5JJZA 5FOBB 3MEHA 3I4MB 4NKLA 5EQ0A 1LTRD 4AYBB 1F2ZA 1PRTF 3WDNA 1ONLA 4DAPA 3KF8A 3A8JE 1S5BD 3DEOA 2WKCA 1HFGA 2F0FA 1ESRA 3WOFA 2B2YC 1SJHD 4HCSA 4A93B 3OHXC 3L9AX 3MFGA 3T51B 5C3WA 3PUZA 3S2DB 1B50A 2F0NA 3VA5A 1JWUD 1STGA 1TT2A 1DJRD 3H09A 2B2TC 2F0VA 3LNNA 4HR7B 4IN3A 4PV1C 4ID6A 1O7LA 1TVXA 1O7YA 4IZ8A 1C4QA 1HQMC 2XRQD 1D5MC 3S2HB 1C48A 4Y7NB 2N88A 1ML0D 4LMQD 5IGGA 4QUFA 1V1OA 2G9HD 4KHZA 1Y1WB 3SK4A 2D9UA 3MC0B 4G7ZC 2SOBA 5CGKA 2B39A 4RGOS 3FRPB 1OXXK 1TWAB 3EROA 1RTOA 2A6ED 2XWJB 4KY7A 1F9SA 1UEAB 5I6WA 1EU3A 1OXVA 4PNYA 2EDGA 4ZUJA 3DHQA 5IIFA 5EPKA 2F0OA 1TKWB 4J6HA 4CKEA 4CHTB 5IT9L 3K5NA 2EVBA 3EQLC 2E76C 3VR3A 4KY5A 2ZT9C 1RJTA 5I6YA 2K7VA 4PMBA 1PFMA 2CVRA 2KHSA 2WAQB 4IURA 3D31A 4R8NA 3HG9A 5ELCA 4RHSA 3ERQA 2F0QA 3K57A 4HTHA 1AFPA 1DOMA 2WP8J 1RHPA 2JA7B 1F2LA 2EXZA 3ND8A 5DNFA 5IOCA 5C4XB 5CBEE 2BA0A 2JA6B 2R7ZB 3S14B 5JVH3 2LS01 2F0PA 2EYLA 3T13A 3OW7A 3RZOB 3CHBD 5CMDA 2RQXA 1KTKA 3NP8A 4CKBA 5K36H 4G57A 3Q0AA 1BCPD 5ELFA 3ITPA 1DD2A 2QILA 3A7LA 4DN4M 4CKCA 2XVSA 1GXDC 1SNCA 5KEEA 1RD9D 4A3JB 2FMMA 5C0XG 1B2TA 5CV6A 2B8GA 3J81L 3TZDA 3X3NA 2RA4A 4EQNA 4LAAA 2Z8LA 2IPKD 2K6AA 1HQRD 4DNTB 2JEAI 2KQ3A 2HUGA 2K33A 4OO1I 1DYQA 2O2LD 1IL8A 3MTSA 1CM9A 2PMZB 1EWHA 2J7ZA 4C1NI 1I3QB 2WB1B 1BUVT 3IL8A 2PZWA 1Q8IA 1QJOA 3NE5B 5KNBA 1TWFB 2QDBA 1PFNA 3H94A 5D65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDQ A;  1BF4 A;  1DOM A;  2B2V C;  1U4R A;  3SVM A;  2MGS A;  2K28 A;  2BDN A;  2K03 A;  2B2V A;  2KVM A;  2L9H A;  2RVL A;  1RHP A;  2FJ2 A;  3Q6S A;  4IUT A;  1F2L A;  2B2T C;  1G6Z A;  1EIG A;  2JYO A;  4IUP A;  1MSG A;  1X32 A;  5AFW A;  5DNF A;  2B2T A;  1CA5 A;  4QUC A;  1DON A;  1PFB A;  5CBE E;  3I3C A;  2KED A;  4MHE A;  1AZP A;  1G2T A;  2MPM A;  2NZ1 D;  1XX8 A;  2R3Z A;  3TN2 A;  1WTR A;  2HDM A;  3KUP A;  2MP1 A;  1U4M A;  1O7Z A;  2K01 A;  1WVL A;  1M8A A;  2K1B A;  1EOT A;  1F9R A;  1WTQ A;  2EPB A;  2HCI A;  2KEE A;  1BBX C;  5CMD A;  1TVX A;  1O7Y A;  2HDL A;  2Q8R E;  1EQT A;  1PLF A;  2B2U C;  3DEP A;  5EKI A;  1HRJ A;  1SSO A;  2B2U A;  3MWY W;  4CJ0 B;  5COR A;  1G2S A;  1WTX A;  2H1E A;  2L12 A;  4O42 A;  4CJ1 B;  3QO2 A;  1WTW A;  1B4O A;  1MGS A;  1WTV A;  1J9O A;  1WD0 A;  1A15 A;  1XYI A;  1U4L A;  1SDF A;  2FFK B;  2B2W C;  2N88 A;  1BO0 A;  1ML0 D;  5T1I A;  2B2W A;  3G7L A;  3HP3 A;  4LMQ D;  1ROD A;  1MSH A;  1X3P A;  2MJ8 A;  4HSV A;  3IFD A;  4MN3 A;  1S4Z A;  3ONA B;  4QUF A;  1EL0 A;  2FIN B;  2XIW A;  1BNZ A;  2D9U A;  5D14 A;  1JIC A;  2EE1 A;  4RA8 A;  2RSO A;  3FPU B;  1KNE A;  2HCC A;  2L11 A;  3N52 A;  4IUV A;  3GV3 A;  1KNA A;  4XDX A;  4DN4 M;  1Q3L A;  1RTN A;  1QE6 A;  1NAP A;  4RAU C;  2IL8 A;  1C8C A;  1B3A A;  3I90 A;  2DY8 A;  2L4N A;  4HAE A;  2JP1 A;  4IUU A;  3UI2 A;  4R8I A;  1ILP A;  1EIH A;  3D6W A;  1DOK A;  1QG7 A;  2FMM A;  1U4P A;  1VMP A;  3I91 A;  4ZKC B;  5CBA E;  4UAI A;  2VXW A;  3TZD A;  1RTO A;  4R9W A;  4OIJ A;  2NWG A;  1F9S A;  2NYZ D;  2X6G A;  2X6L A;  2KOL A;  2RA4 A;  1HUN A;  1DOL A;  1LV9 A;  4IUQ A;  4XT3 B;  1HA6 A;  1F9Q A;  5E4X A;  4XT1 B;  4ZAI A;  4ZK9 B;  4X3K A;  1VMC A;  1SAP A;  2HUG A;  5EPL A;  2L1B A;  4RWS C;  1QNK A;  5JJZ A;  1AP0 A;  1IL8 A;  2Q8T A;  4OIK A;  5E4W C;  1AZQ A;  2KUM A;  2KEC A;  3MTS A;  4ZKB B;  5COY A;  4HED A;  1G91 A;  3DM1 A;  1HHV A;  1HUM A;  5EPJ A;  5EJW A;  1CM9 A;  1NR2 A;  1ILQ A;  4NW2 A;  2J7Z A;  1ICW A;  4X3U A;  5EPK A;  5EQ0 A;  3P7J A;  3R93 A;  1B2T A;  1WTO A;  1IKL A;  1ZXT A;  3F2U A;  2DY7 A;  1DZ1 A;  1JE4 A;  3DEO A;  3LWE A;  4X3T A;  1B53 A;  1GUW A;  5T1G A;  1HFG A;  1X3Q A;  2M2L A;  1RJT A;  3I8Z A;  3IL8 A;  3KBX A;  1WD1 A;  1WTP A;  1ESR A;  1F9P A;  1O80 A;  1PFM A;  2CVR A;  2SDF A;  4IUR A;  1NCV A;  1CA6 A;  2B2Y C;  2FHT A;  1J8I A;  1HFN A;  2EOT A;  2N55 A;  2B2Y A;  4CJ2 C;  4ZLT F;  1MI2 A;  4HCS A;  3GV6 A;  4U68 A;  1PFN A;  2K04 A;  2K05 A;  3H91 A;  3FDT A;  1IKM A;  1E0B A;  1B50 A;  2X69 A;  2RSN A;  4X3S A;  5D65 A;  1NR4 A; 
#chains in the Genus database with same CATH topology
 1ZYR C;  3CP0 A;  1U4R A;  4APV A;  2E2D C;  2A69 D;  2K03 A;  3VYU A;  1QCB D;  2L9H A;  2RDH A;  1VQ8 A;  4A3M G;  1ASY A;  1CK1 A;  4DAY A;  1Y8P B;  3S17 H;  1UE1 A;  2NVT B;  2Q8I B;  3C3L A;  1AZP A;  2FMC A;  4AIM A;  3KUP A;  4X6A H;  2N8N A;  1LT4 D;  4DPG A;  4I65 A;  4POG A;  4L6T B;  2KEE A;  2Z6K A;  4C3H G;  3W2D A;  4CDF C;  4C2M B;  1PH8 A;  3TRE A;  1CHQ D;  4DR1 Q;  1IBK Q;  1XXG A;  1WTW A;  1WTV A;  5ELD A;  4J8Q A;  3HOY G;  2PPB C;  1QUQ A;  5EKL A;  3K58 A;  4LF9 L;  1OXS C;  3C46 A;  1A2T A;  5LL6 S;  4XQQ A;  1MSH A;  1X3P A;  4L5T A;  4GLV B;  1KLG D;  2VB2 X;  3R3O A;  1T5X D;  2XSC A;  1CTM A;  3KK7 A;  1MHW C;  1I4G A;  5M5Y B;  5JJI A;  1BCP F;  4NB3 A;  4XXE A;  3NHH A;  3CRL C;  2CHB D;  2EY2 A;  2RCF A;  1IBL Q;  3IKJ A;  4LF7 L;  3BZK A;  4ZUI A;  4AYB E;  1KHI A;  4C3J G;  1Z7T A;  4OIJ A;  1CKN A;  2KOL A;  2F0T A;  4IPH A;  4JBJ A;  1D6E C;  2JSO A;  2DN8 A;  2F0G A;  1PH9 A;  4A93 H;  4ZK9 B;  2IW3 A;  3NTK A;  4CDE C;  3I72 A;  4J15 A;  2K50 A;  4RGT A;  4A75 A;  2B3G A;  1NY4 A;  5NUC A;  4FVM A;  1AZQ A;  3H6M A;  2A5H A;  1U9R A;  1LTG D;  1SJE D;  2OEO A;  1SNM A;  4FP5 D;  2E8G A;  4CDD C;  3F2B A;  1IZ6 A;  3VYS A;  1N33 Q;  3NQI A;  2ZJQ A;  2EY6 A;  5DM7 3;  3WOE A;  4QY7 A;  3E0J A;  1B53 A;  1RDP D;  4GNX A;  1SE4 A;  5G3L F;  1J8I A;  2QEX A;  1IHZ A;  2B2Y A;  4A3I H;  1WCM H;  2D0P A;  4U68 A;  5LMN Q;  1GM5 A;  3OTO Q;  4C1N K;  3S2H H;  4Y7N H;  2ZM6 Q;  1X6O A;  2UXC L;  1IW7 D;  4P71 A;  5IYD G;  4LUO A;  3SVM A;  1CFM A;  4JI2 L;  4NXM Q;  1K8O A;  2B2T A;  4DF7 A;  1G2T A;  4A3M B;  2IX1 A;  3I4L A;  4L8J A;  1E7Z A;  1W6J A;  4ZRZ A;  4G7H C;  5IY0 A;  4H02 A;  4UP9 A;  2AQ2 B;  2EYJ A;  1X9N A;  2F0W A;  3GQB A;  2DNE A;  3I56 A;  2E2I B;  1N8R C;  4IFD J;  2Y0S G;  2HDL A;  3KLS A;  5C4Z A;  1I4H A;  1SSO A;  2MHV A;  4C3H B;  4TVA B;  4A3D G;  1II3 A;  1HZC A;  3GTQ H;  4K2K A;  5AJ3 Q;  3DXJ C;  5J39 A;  3HOU G;  2GN5 A;  2Z4H A;  4OEL B;  3G7L A;  4FXG C;  1HFN A;  1KLU D;  1QNU A;  4HSV A;  1EL0 A;  3OWE B;  5KYI A;  4M8A A;  2NVX B;  4HN7 A;  1TII D;  3FMC A;  3DUZ A;  4DK6 C;  2PO4 A;  4KJO A;  4POF A;  5DM6 3;  3X3M A;  2NTT A;  3K81 C;  1Q3L A;  5I9O A;  3W1B A;  4KTA A;  4RAU C;  1SR3 A;  3PV0 A;  1YJW A;  1S5D D;  1L0W A;  3TRZ A;  3I91 A;  5JEA G;  3NUC A;  5J1Z A;  3PSI A;  4LW1 A;  3PGZ A;  4C3J B;  4LFA L;  4V19 0;  4K5V A;  1R9T B;  3M7N A;  4DR2 L;  1SYE A;  5JAV A;  1EY7 A;  3L7Z C;  3KJP A;  3CCV A;  2WAQ E;  5FO9 B;  3GTG B;  2TMP A;  2JA7 H;  4A3K G;  2G9D A;  3O13 A;  1ICW A;  2A6E C;  3MVV A;  2YYZ A;  4YHH Q;  1STN A;  1XNQ Q;  4X64 L;  1IYV A;  2JA6 H;  2R7Z H;  1IBM L;  4DK0 A;  4Q0F A;  3QWN A;  3BVZ A;  3Q24 A;  1RCV D;  2EYH A;  3A7A B;  2ATW A;  3I4N G;  3RZO H;  5T1G A;  2A1A A;  4RG1 A;  1X3Q A;  2JN4 A;  1F9P A;  5KNC A;  3H0G G;  3T56 B;  4Q5V A;  2C35 B;  1Y1V B;  2HHH Q;  2VNU D;  4F87 A;  1EY0 A;  2N55 A;  5M5W B;  1I94 L;  4DA2 A;  4NXN L;  3CXC A;  4P74 A;  3CME A;  2I5H A;  4A3E G;  4DKA C;  1S40 A;  2D5D A;  2CQA A;  3BYY B;  4K0K L;  1N9W A;  4CJ1 B;  3T16 A;  1TWC B;  2EZV A;  1VQ6 A;  1MSG A;  1CA5 A;  1ZYR D;  4JW0 A;  2K5Q A;  2R3Z A;  1WTR A;  4GKJ Q;  2VQF L;  2HIX A;  1F2M A;  3NSW A;  4LF5 L;  4PZ6 A;  4A3J H;  4JI1 Q;  3H3V I;  5LMU L;  5J3B A;  3OOC A;  4JG2 A;  1TWH H;  5CV9 A;  5IGC A;  2EJM A;  4YWM A;  2Y0S B;  1X3G A;  1A3V A;  1LLR D;  4F8M A;  4PZ7 A;  1J9O A;  4A3D B;  3W3A A;  4DV6 L;  1GHJ A;  3K7A H;  3ICE A;  3HOU B;  1CSQ A;  1OTC A;  3ND9 A;  3SE0 A;  3Q8D A;  3LGJ A;  4JV5 L;  1B1Z A;  1OXU A;  2Z1C A;  2VB3 X;  3W1G A;  1GUO A;  2NN6 H;  3T1Y L;  4JI6 Q;  3J7Y W;  1KNE A;  5ISR A;  4NMZ A;  2F0M A;  2NB0 A;  5EBC A;  1BCP C;  2DY8 A;  2PNR C;  4JI8 Q;  2PMZ E;  5EGT A;  2AUK A;  1JR0 D;  2R93 H;  5CBA E;  1TWF H;  5C6A A;  2EJF C;  4HSP A;  4A3L H;  4IUQ A;  1HA6 A;  3P20 A;  2EYP A;  5IGB A;  3IFT A;  3J81 j;  1Y1W G;  3CQZ H;  1KDC A;  3TP8 A;  5EPL A;  4RWS C;  2QA4 A;  5CV4 A;  4A3F G;  1KAA A;  2R92 H;  3S1M B;  1ILQ A;  1WI5 A;  2NVT H;  3R93 A;  2ICI A;  4A3K B;  2JA5 G;  2F4V Q;  2VUM B;  4P73 A;  1YNX A;  3KDF B;  1JE5 A;  4B3R Q;  1GUW A;  3HOX B;  1VQG A;  2PQA A;  1GUG A;  2NZO A;  4C2M H;  3I4N B;  1XMO Q;  1GHK A;  3E5S A;  5JVG 3;  3EFX D;  3VR4 A;  1JJ2 A;  1CA6 A;  1VQF A;  3KYH C;  1MI2 A;  3GV6 A;  4L5Q A;  2F52 A;  1AEX A;  1SYB A;  1H9S A;  4LUV A;  1IKM A;  1FGU A;  3SR1 A;  4GLX A;  4OWT B;  1VQC A;  2OTL A;  1ENC A;  4A3E B;  4A3B H;  4UPA A;  1EIF A;  1I6H B;  1X3E A;  3GO5 A;  4OGQ C;  4QF4 A;  2BH2 A;  3HOW H;  1HCZ A;  3OSO A;  2E2J H;  4IUN A;  4WJ4 A;  1YNN D;  1SEB D;  1S5C D;  1V1Q A;  3P1H A;  2JJQ A;  1XX8 A;  5BR8 Q;  1OXT A;  1PYB A;  2HDM A;  4YWK A;  2MP1 A;  1U4M A;  1PH4 A;  2AHO B;  3JAM L;  4ILW A;  3WWV A;  3AB9 A;  1E2W A;  1XNR L;  3I55 A;  1B3Q A;  2I07 B;  2K4K A;  4OO1 G;  4LF6 Q;  2ICE C;  1Q1E A;  2Q8R E;  2A69 C;  4QIW B;  4QMG A;  1PXU A;  5C0X H;  1Y8O B;  4BS9 A;  4OL7 A;  1G2S A;  3EN2 A;  4H7B A;  3VDY A;  4JBM A;  4B9X A;  5C4X G;  1EYA A;  3HZX A;  1XPU A;  1SDF A;  4BY1 H;  2F0I A;  5T1I A;  3HP3 A;  1ROD A;  4RH6 A;  1SNP A;  3E9H A;  5FLX E;  5IGE A;  1UEB A;  2E75 C;  4RA8 A;  5JPN C;  1CKO A;  4DV4 Q;  3TP7 A;  1KNA A;  1J6Q A;  1JQY D;  1QVG A;  4OON A;  1A2U A;  1QWY A;  2VL6 A;  1STH A;  1HPC A;  1UE6 A;  1XPR A;  1R4P B;  2F3V A;  4WRD A;  3M9B A;  1N34 L;  4UAI A;  1I4R A;  1YIT A;  4A76 A;  1BBU A;  4KJN A;  1CZW A;  1LV9 A;  3AU7 A;  3BS1 A;  4L63 B;  5FJ8 G;  2M9V A;  2E5L L;  1EFI D;  1SYC A;  4IPC A;  5C3E H;  2AWN A;  1K8M A;  1BR9 A;  1Z47 A;  1HHV A;  1HUM A;  4A3F B;  2JQO A;  4KKT A;  4N9T A;  5A2Q E;  3CCJ A;  1KL9 A;  1IKL A;  2AWO A;  4FF1 A;  1GOZ A;  2L55 A;  1UE5 A;  4K5X A;  2JA5 B;  2LFN A;  1HR0 Q;  4B3M Q;  1LT5 D;  5GAD C;  2EQS A;  2PI2 A;  3A0J A;  2N49 A;  1BOS A;  4MTN A;  4C3H H;  1FNU A;  4ZLT F;  1HR0 W;  1EEI D;  5A35 A;  3J80 L;  1PTO D;  1E0B A;  2F0D A;  2ASB A;  1VCI A;  3HOY H;  1PDQ A;  1CI3 M;  4LF4 L;  4LF8 L;  2HIV A;  3CCS A;  3AFQ A;  4UDU C;  3NEN A;  1XJV A;  2NVX H;  1VQ5 A;  1QVC A;  4DAM A;  2A68 D;  3LWU A;  4XIG S;  4EVO A;  1O7Z A;  2K01 A;  3MA2 B;  3KDF A;  2O5I C;  1WYD A;  1F9R A;  1BCP B;  2JXM B;  5KYL A;  1BBX C;  1IW7 C;  2BE5 D;  2B2U C;  1NUC A;  4ZYS A;  1H9M A;  2R6G A;  1IYU A;  4C3J H;  2F0S A;  4DFA A;  1TWG B;  3MXN B;  1ZKO A;  4JK1 C;  3GTM B;  1PYW D;  3GTG H;  4LF9 Q;  1SNQ A;  2UXD L;  3P75 A;  2KA7 A;  1N36 Q;  1JJG A;  4EQO A;  5HGQ A;  1GUN A;  1ET6 A;  1XTD A;  2WAC A;  2YU9 B;  2AQ3 B;  1EY6 A;  2L11 A;  1BQQ T;  1V1P B;  3GTK H;  5CV5 A;  3T1H Q;  1B3A A;  1UWV A;  3SHL A;  2NUC A;  3S15 B;  1EIH A;  4QCL A;  1U4P A;  3NQT A;  3F2C A;  4X62 L;  5M5W H;  2OCE A;  2NWG A;  4LWC A;  4LF7 Q;  1KAB A;  4K5W A;  4X66 L;  3TQY A;  2D2C C;  2GVA A;  1IYJ B;  3IRB A;  1CSP A;  1GUT A;  4DV0 Q;  4YY3 L;  1BBW A;  3CU7 A;  4BA2 I;  4R4O A;  1VDZ A;  4ZKB B;  5COY A;  1TWC H;  3CKI B;  3K59 A;  5IYD H;  1MJC A;  3ZYY X;  1EYD A;  4KK7 A;  2B63 B;  2UUB L;  4YCU A;  3GTO H;  3G6J B;  1YJN A;  3NK9 A;  1C0A A;  1TU2 B;  1EYC A;  1SMY D;  2UXB L;  4P72 A;  2Q2H A;  1LTT D;  3KBX A;  5J22 A;  1LTI D;  4O1N A;  4MIU A;  1JB7 A;  2EOT A;  5C4J H;  2CWP A;  5M5X H;  1B9M A;  4DAV A;  1E2Z A;  3RMH A;  3U50 C;  4A3D H;  4OHJ A;  2BH8 A;  1SND A;  1S72 A;  4JC0 A;  1UUP A;  1S5E D;  2EJG C;  1R4Q B;  4UHV A;  3BDO A;  1TY2 A;  2RVL A;  2UXC Q;  2Y0S E;  2MQH A;  4JI2 Q;  5HGT A;  3KFU A;  1EY4 A;  3B6Y A;  2F0U A;  4IJH A;  2ZTD A;  1F2Y A;  3M3Y B;  4P75 A;  1PH2 A;  4TSS A;  3RD4 A;  2WKD A;  4ULL A;  4I7Z C;  4O2D A;  3BDL A;  1KD1 C;  1EQT A;  1E2V A;  1RF2 D;  3S24 A;  5BN3 A;  1JB3 A;  5JEA H;  3RLF A;  3S9W A;  2L12 A;  3MXU A;  1YBY A;  2Z9H A;  2UU9 L;  1A15 A;  1I4Q A;  3SK5 A;  4FDB A;  2R7D A;  2ES2 A;  2PI2 E;  4DR6 L;  2FFK B;  2B2W C;  4XQJ A;  1BO0 A;  3PO2 G;  2WIN B;  2SNS A;  2NVQ B;  1BDO A;  3S1M H;  2CW0 D;  1D2B A;  3VYR A;  3G6E A;  4A3K H;  4A4I A;  2KHJ A;  1E1T A;  1ESF A;  3PUY A;  2K5N A;  2MUY A;  4L5R C;  2FXQ A;  3GTJ B;  4JI0 Q;  2JP1 A;  3I4N H;  5IP7 G;  1ILP A;  3D6W A;  4R4Q A;  3H0G H;  1VF5 C;  2X6L A;  1G51 A;  4KY6 A;  5LHY 1;  1N32 L;  1HUN A;  3I4M H;  2QF7 A;  3QG1 A;  3MEF A;  3HS0 C;  3U4V A;  3MXN A;  4LFA Q;  4A3E H;  4JI4 L;  5L37 A;  4OIK A;  3SGI A;  2KUM A;  4DR2 Q;  2SEB D;  2KCC A;  3FVQ A;  1ZEQ X;  4X3U A;  3P7J A;  2K52 A;  1VF7 A;  1W3S A;  1AE3 A;  4PG3 A;  4X64 Q;  1V1P A;  4KHV A;  2IWH A;  4IFD G;  1JE4 A;  5IGD A;  3Q22 A;  4HMJ A;  3UE1 A;  4ZCK A;  4MNO A;  3S2D H;  5IT9 E;  1KIX A;  2E2H B;  4DR5 L;  2NN6 I;  3NEL A;  1S3O A;  1TS5 A;  1I94 Q;  5K5P A;  3L3O C;  2XNA C;  5DEH A;  4N8X 1;  4QIW E;  1JJC B;  4IUT A;  3Q6S A;  3GTL B;  2YTX A;  4K0K Q;  2QEJ C;  4PZ8 A;  4GZY C;  4MHE A;  3D4D A;  1JOO A;  4QJF A;  1PFS A;  1EQV A;  1Y1V G;  4B3S L;  1HNX L;  4JI3 L;  1KAW A;  2F3I A;  2EPB A;  3OYY A;  3CW2 C;  1XMQ L;  4OX9 L;  3OW2 A;  1Q46 A;  5LMU Q;  4B3T L;  1LTB D;  1YNN C;  1B44 D;  5COR A;  1KQS A;  1YI2 A;  1SLJ A;  2L0C A;  4B08 A;  1Y1W H;  5ELE A;  2VZA A;  4DV6 Q;  2DUD A;  3MXG A;  4A3F H;  2Q2U A;  1S4Z A;  2EY5 A;  4F7X A;  4B9W A;  3PO2 B;  5EKK A;  5D14 A;  3DWA A;  3GTP B;  1TWA H;  4WFN 3;  2EE1 A;  1FR3 A;  3FPU B;  2AQ1 B;  4ZQ3 A;  3D3R A;  3N52 A;  4IUV A;  3T1Y Q;  2JA5 H;  4HIK A;  1Y69 U;  2AUJ D;  2IL8 A;  4PMW A;  4Y52 H;  3RLO A;  3PUV A;  2L4N A;  2I5L X;  3SEB A;  1B7Y B;  2EYM A;  4FO2 A;  1TS4 A;  2A74 C;  4LK1 C;  4BBR B;  3NTH A;  4ZAI A;  3EA6 A;  1Z6H A;  1MJE A;  1CQV A;  3ERS X;  4BA1 I;  2UUA L;  3U9O A;  4Z9C B;  1G91 A;  4EQ5 A;  2BOS A;  5EPJ A;  4NP5 A;  3TSS A;  2RHS B;  4FYD A;  4HIM A;  3RNU A;  1YHQ A;  5D3D A;  1ZXT A;  3EIV A;  4DR7 L;  1H9J A;  3F2U A;  4HCE A;  5CYU A;  1FGB D;  2EYF A;  4A3G G;  4KMU C;  1UAP A;  1WTP A;  1SE2 A;  4RFB A;  4OXP A;  3PO3 G;  3NWT A;  1Q8K A;  4C3I B;  4OO1 H;  1IXR A;  5GAE C;  1SE8 A;  3BDC A;  2OF1 A;  2AKW B;  3BVM A;  3I4O A;  3E6Z X;  1TWG H;  4KKS A;  3S1Q B;  4K14 A;  2A6H D;  2RSN A;  4RCN A;  4JCV E;  3SK6 A;  3FEW X;  5C4X H;  1PH1 A;  1SE3 A;  2VUM G;  1Q1B A;  3K8A A;  2V1C C;  4TKO B;  4H0L C;  4MZ9 A;  4DR3 L;  1YVC A;  3ULP A;  2EXD A;  1SXT A;  5FLM G;  3S14 H;  4IUP A;  1LAB A;  3HOX G;  3IAY A;  4K6L A;  4DXG A;  3HEJ A;  5E1F A;  5FK9 C;  2MPM A;  2NZ1 D;  3KLR A;  2CH4 W;  4H44 C;  1FD7 D;  3TP5 A;  3L2P A;  1T5E A;  1PTO C;  2F4I A;  5E3F A;  1WVL A;  1LTA D;  2QCP X;  2K1B A;  2IJ0 A;  3S15 H;  2MO0 A;  1VQO A;  5DLQ E;  2JEB I;  1XNR Q;  4K8J A;  5FLX c;  1VQP A;  1Z9F A;  1K83 B;  2B2U A;  2NVY B;  5CV8 A;  5IYB H;  1PVO A;  2XTI A;  1WTX A;  3OPO A;  4E6I A;  4GKK L;  4IOA A;  2A68 C;  1WD0 A;  1STE A;  1VQD A;  2F0L A;  3M4Y A;  1PRT D;  2BE5 C;  2OXP A;  4UY8 C;  2FIN B;  5A2Q L;  3KOJ A;  1JIC A;  2Z4I A;  5D3I B;  1E22 A;  3CC2 A;  5IWA L;  4K8I A;  1RTN A;  2LMC B;  1QE6 A;  3K80 C;  1OO9 B;  3BZD B;  1C8C A;  1EZ8 A;  3MAQ A;  1K3B C;  3U4Z A;  2I5M X;  2KJX A;  2OQK A;  2VS1 A;  3AFP A;  3PF5 A;  2RBM A;  3GDE A;  1FL0 A;  3KLS X;  4ZKC B;  1AW7 A;  2K32 A;  2VXW A;  3EBE A;  5KIX A;  1A3U A;  3J7A F;  1N34 Q;  2IT1 A;  5C3X A;  5E4X A;  3HOV G;  2RKS A;  5LL6 X;  3TEH B;  5LMN L;  1TS2 A;  3HKZ G;  3UDI A;  4YIJ A;  2Q8T A;  2E5L Q;  1I3Q H;  1L0X B;  5IOD A;  1B8A A;  2ZM6 L;  1O7I A;  3QOJ A;  4J1M A;  2PCF B;  1RL2 A;  3NXW A;  4NXM L;  4DV5 L;  3H15 A;  3PMF A;  3C1F A;  1D5X C;  4A3C G;  3M3Y H;  1K0S A;  1B9N A;  1ENF A;  5C44 G;  2A19 A;  4NPS A;  4X3T A;  3SK8 A;  5CC4 A;  3I8Z A;  1IL2 A;  2WB1 E;  1FNV A;  4A3G B;  2Z6K C;  3DWP A;  5GQO A;  2L5T A;  3PO3 B;  4DV1 L;  1M4V A;  3RLN A;  3S1R B;  4RKL A;  3LX0 A;  5M3F G;  1PZK D;  4X3S A;  3M4O B;  3T53 B;  4OWW B;  1SMY C;  4JI5 L;  1LAC A;  2FJ2 A;  4X65 Q;  1GUS A;  2JYO A;  5JOB A;  4KI0 A;  1Q90 A;  2IX3 A;  4OWX B;  3CCU A;  5HUR A;  1D1K A;  1DCZ A;  1M1K C;  3S17 B;  2CWA A;  1XTC D;  4QB4 A;  1MD2 D;  4XQN A;  4R4I A;  1PH3 A;  1ENA A;  2ZTC A;  4F88 A;  5GRO A;  3FPP A;  3CC4 A;  3ULJ A;  1CQF A;  3TP6 A;  1MGS A;  3J81 i;  2EYO A;  4YCV A;  3M7G A;  2I0Q A;  1SYF A;  1K8A C;  2B2W A;  5M5Y H;  2VQE Q;  4XT1 B;  2LY7 A;  3IFD A;  4CBV A;  2LXK A;  2UXD Q;  3R2T A;  1VS0 A;  1BNZ A;  1FNW A;  3E9I A;  1VQJ A;  2F0K A;  4YHH L;  1XNQ L;  1PYS B;  5I2X A;  1PH5 A;  1NAP A;  2H4O A;  3NTI A;  1SRU A;  2OT2 A;  1U0L A;  4DK1 A;  1QG7 A;  1DON A;  2CW0 C;  4R9W A;  2YTY A;  2JA8 G;  1STA A;  2HHH L;  5KGU A;  1F9Q A;  4X66 Q;  3CF5 A;  4LFC L;  3RR5 A;  4BY7 G;  2CH4 A;  3HRZ C;  1QOH A;  3HOV B;  1QNK A;  4YY3 Q;  1RKN A;  3HKZ B;  4RKB A;  2YTV A;  3DM1 A;  3GTL H;  1VQK A;  1XPO A;  1VQM A;  5I4D A;  4UP8 A;  1EEF D;  3ER0 A;  5IYC G;  4DV7 L;  1PTO B;  1YNJ D;  4RMF A;  3M85 A;  5C44 B;  1G6Z A;  2XWB B;  2UXB Q;  2O4X A;  4JI1 L;  3OWF A;  2ZJR A;  2RDF A;  1WOC A;  4DR4 Q;  1RIP A;  2K04 A;  3FDT A;  4DNR B;  2B63 G;  3MXP A;  1NR4 A;  2MO1 A;  3NEM A;  5M3F B;  4JBW A;  1WCM B;  4A3I B;  2IY5 B;  4A3M H;  2J0T D;  2BDN A;  4KHP Q;  3PO2 H;  2H5X A;  1CT1 D;  4N8F A;  4QUC A;  4HJ7 A;  4KN7 C;  3I3C A;  5F2D A;  3NPP A;  3FHW A;  3J7A V;  2E2I H;  4JI6 L;  5BN4 A;  4HIO A;  4R1J A;  1EYG A;  1EOT A;  2PZT A;  2RF4 A;  1WTQ A;  1QZG A;  2HCI A;  1E3P A;  4XYQ A;  4DXF A;  2WFW A;  2C9O A;  5EKI A;  2QDL A;  3NBH B;  5IP7 H;  3TS2 A;  4K2L A;  3URY A;  4KV6 A;  3PUW A;  4O42 A;  1B4O A;  1VQB A;  1YHA A;  2O5J C;  1CKM A;  3KBG A;  2UU9 Q;  4IPD A;  4KKU A;  1U4L A;  1PH6 A;  5H1S E;  1A63 A;  3GTQ B;  3ONA B;  2K5W A;  1A3T A;  4DNI A;  1NSN S;  1MIU A;  4DUY L;  1I5F A;  2RSO A;  1K9M C;  5C5M A;  2NN6 G;  3V05 A;  4KD4 A;  4IFD H;  1QB5 D;  2NBF A;  4FF3 A;  2F1M A;  1R9T H;  2NYZ D;  2R93 G;  1J5E L;  4ME3 A;  4K6D A;  4DU9 A;  2JA8 B;  1N32 Q;  1KDA A;  1V8Q A;  4BY7 B;  1KDB A;  5E4W C;  3TDQ A;  1LM0 A;  5IT9 c;  2PW5 A;  1KXL A;  4JI4 Q;  1HTL D;  1PZJ D;  1UNS A;  1EWC A;  1VQI A;  3BVG A;  4NW2 A;  3CRK C;  2P5Z X;  4BBS G;  5DAU A;  3TZU A;  3EVQ A;  1HNW L;  1DM0 B;  1BXT A;  1Y1V H;  1DZ1 A;  3LWE A;  3F2D A;  4FF2 A;  4RGN A;  1C7Y A;  5M3M G;  2DGY A;  4LUZ A;  1O80 A;  3A56 A;  1K83 H;  2MFI A;  3U58 A;  1NCV A;  2RDG A;  1LT3 D;  2ENB A;  1TQO A;  3A8K E;  3W5O A;  4DR5 Q;  2K05 A;  4U67 3;  2X69 A;  1CZG A;  4C56 C;  3M4Q A;  1BF4 A;  2B2V C;  2MGS A;  1D7Q A;  1JC7 A;  3MHB A;  2KVM A;  2QGQ A;  3D0F A;  2RHQ B;  1EIG A;  3BG3 A;  1XWE A;  3K5L A;  3FKI G;  2BCO A;  1L2F A;  2KED A;  4GN5 A;  1L1O C;  4V0B A;  1I50 B;  4KN4 C;  1W2B A;  2A6H C;  4DV4 L;  2AMC B;  1M8A A;  3QR8 A;  4GS3 A;  3UDG A;  1HNX Q;  1PHJ A;  3D6C A;  3E3X A;  1HRJ A;  3JAM E;  5IE8 A;  3RN2 A;  1XMQ Q;  1Y8N B;  4OX9 Q;  1SBB B;  1YJ9 A;  4CJ0 B;  2E74 C;  3HOU H;  1A6X A;  1CHP D;  1TWH B;  1X3F A;  1L0Y B;  5FO8 B;  2GA4 B;  3AEV A;  4ME5 A;  5ELN A;  3H3V C;  2MJ8 A;  1PTO F;  4RHR A;  3K7A B;  2XIW A;  4DV2 L;  3CPW A;  3CCM A;  3DLL A;  3J81 c;  3QOL A;  2B8F A;  5FO7 B;  4I7A A;  1ICF B;  5M9O A;  2PYK A;  3NBI A;  3QJY A;  5G3L D;  1EQQ A;  4DUZ L;  4RCO A;  4RGM A;  3UI2 A;  4LJZ C;  1DOK A;  2LXJ A;  1PRT C;  5EBD A;  3NBH A;  1GVP A;  4EQP A;  3PO3 H;  1BVS A;  2D62 A;  3I7F A;  1HNZ L;  1AH9 A;  4JYA L;  2TSS A;  1I4P A;  3S1R H;  4XT3 B;  4ODG A;  2R93 B;  1D1I A;  2K5D A;  4JOI C;  3M4O H;  5IGF A;  1FVI A;  3CMA A;  1Q7Y C;  4HED A;  2UUC L;  2VUM H;  4IPG A;  5C3E G;  3CQZ B;  1NR2 A;  5FLM H;  3BJU A;  3MZ5 A;  1G8Z D;  1TR5 A;  2LKV A;  3JC6 6;  3HOX H;  3AMU A;  4FXD A;  3S16 B;  3A8I E;  2ZXR A;  2R92 B;  1JWS D;  4BBS B;  1Y14 B;  4DR7 Q;  2R61 A;  4BBR G;  2M2L A;  3A55 A;  1TS3 A;  2YV5 A;  5KND A;  4IOC A;  5ELO A;  2CFM A;  1EWI A;  1SYG A;  5M3M B;  4AQY L;  4WJ3 M;  3PIO 3;  4IO9 A;  3Q23 A;  4CJ2 C;  1I6H H;  5C0X J;  2JK8 A;  5ELB A;  5BN5 A;  3A5U A;  1H9K A;  3CPF A;  4FNF A;  3J80 E;  4DV3 L;  4QQB X;  3KJO A;  1PZI D;  4DR3 Q;  2VW9 A;  1DGS A;  1IBM Q;  3T4A C;  3RZD B;  1N36 L;  4A3B B;  4C3I G;  3HOW B;  3FKI B;  2F0J A;  1GKH A;  1VQA A;  2E2J B;  3R8B A;  3SXH A;  3G4S A;  2I46 A;  1HA5 A;  4ABN A;  2QKI C;  2SNM A;  3A74 A;  3T1H L;  4O0A A;  1Q82 C;  1EY9 A;  3DEP A;  2BA1 A;  4NXN Q;  5IP9 G;  3PF4 A;  3K6O A;  1U5K A;  2H1E A;  1NNX A;  4G7O C;  1M90 C;  3DMU A;  3VR5 A;  3HOV H;  4GKK Q;  5HY6 A;  4DV0 L;  4NDX A;  2ID0 A;  2F0H A;  3HGB A;  1EOV A;  4H13 C;  1DXM A;  4BY1 B;  3J7Z C;  2VQF Q;  4BXX G;  3I73 A;  3QIA A;  1X56 A;  2HCC A;  5TSS A;  4LF5 Q;  3GV3 A;  4A3C H;  1PTO H;  4HID A;  1LTS D;  1QZH A;  3HKZ E;  3I90 A;  5C44 H;  5IWA Q;  4HAE A;  4S3S A;  5K36 G;  3DWQ A;  2KCN A;  2WII B;  4GOP C;  2JA9 A;  1SFO B;  2PQE A;  5I9P A;  3CCL A;  2QW7 A;  4WJW A;  5M3F H;  1LT6 D;  2KEC A;  2WV6 D;  4JV5 Q;  5EJW A;  4QGU A;  1LTL A;  2NTS A;  5JJL A;  2F3W A;  5C3E B;  5LMN W;  1EZ6 A;  1F77 A;  4LFB L;  5FKA C;  4ALP A;  4DV5 Q;  1L1O B;  4CDC C;  2DY7 A;  3PIP A;  3N6R A;  4G4K A;  1H9R A;  2K5V A;  2EIF A;  1W6K A;  2XGT A;  3OMC A;  2M00 A;  3JAM i;  3J81 E;  1H95 A;  2FHT A;  4JI7 L;  3D8G A;  4KD3 A;  4TQU S;  1HXY D;  1FJG L;  3L0O A;  1D5Z C;  2OQ0 A;  3D4R A;  4DV1 Q;  4DGZ A;  1JOR A;  1YNJ C;  3TME A;  5C0X I;  1K73 C;  3K7U C;  2K28 A;  2A73 B;  1QVF A;  1GO3 E;  1ASZ A;  4JI5 Q;  3OMG A;  3HOZ G;  3HOY B;  4XYO A;  5AFW A;  3TBI B;  1VQE A;  1JOQ A;  4HJ8 A;  4GN4 B;  1S5F D;  1K3R A;  2J4X A;  3K5O A;  2V4D A;  3VR6 A;  3OIP A;  1P16 A;  1YHB A;  3I70 A;  4IAL A;  3U9S A;  3G71 A;  4JI0 L;  2KCM A;  2F0E A;  1PRT B;  2PQA B;  2ZXO A;  4DR1 L;  1IBK L;  1HJP A;  3GTM H;  3I2Z A;  1X65 A;  2DNC A;  3EJI A;  2JA8 H;  2C5C A;  3QO2 A;  1HH2 P;  1JMC A;  3F8T A;  4FXK C;  4MTK A;  1XYI A;  1JOK A;  4BY7 H;  1H9S B;  5FLX L;  4WOR A;  3CD6 A;  2YU9 H;  3PCO B;  3AQQ A;  4BWG B;  3BU2 A;  1EY5 A;  3A54 A;  5KRU A;  1MBY A;  5I2Y A;  1ET9 A;  2IX0 A;  4PMC A;  4M1U B;  3SDZ A;  3FP9 A;  4JBK A;  4XDX A;  3KF8 B;  3GD7 A;  3E0E A;  5IYC H;  1IBL L;  1WJJ A;  4PQX A;  4AH6 A;  1A8V A;  4IUU A;  4R8I A;  1I6V C;  1VMP A;  2VY3 A;  3S1N B;  3GTK B;  1QIL A;  2X6G A;  3V96 A;  2XN9 C;  4FF4 A;  1DOL A;  1EU4 A;  5FJ8 H;  1JWM D;  1AN8 A;  3K0Y A;  4P2C B;  4HJA A;  4HMI A;  1PMR A;  4X3K A;  1VMC A;  1SAP A;  3I4M G;  3VYT A;  2L1B A;  4LFC Q;  1SYD A;  1VQ9 A;  2B63 H;  1AP0 A;  2HQE A;  3J80 i;  1STB A;  3STB C;  4AYB G;  1TY0 A;  3MFY A;  1N33 L;  3CAM A;  1HTP A;  1JCK B;  1Q12 A;  3GP7 A;  4IQZ A;  1I50 H;  2OTJ A;  1AE2 A;  1CUK A;  5JPM C;  3D4W A;  1VQ7 A;  2CQO A;  4YCW A;  2N78 A;  4DV7 Q;  3C2P A;  1WD1 A;  3RUZ A;  3GTO B;  1STY A;  2SDF A;  1KRT A;  2PW7 A;  1V43 A;  4R4T A;  4A93 G;  2LSS A;  3OTO L;  1I4X A;  2DJG C;  5JEA J;  3H91 A;  1FYC A;  4HJ5 A;  4EGV A;  3BYT B;  5C4J B;  1YEZ A;  3CCQ A;  5M5X B;  4IFD I;  2B2V A;  3K5M A;  2EY1 A;  1X32 A;  1PFB A;  4TRD A;  3HKS A;  5CV7 A;  2D0O A;  3HOZ B;  4CGY B;  3TN2 A;  1L1O A;  3C1E A;  1EY8 A;  3PQI A;  2ZJP A;  1PLF A;  5C5L A;  4A3I G;  1WCM G;  3V2T A;  2ZXP A;  2N3S A;  1E24 A;  3MWY W;  3PUX A;  2Q2T A;  5AJ3 L;  4N9P A;  1GD7 A;  3R2I A;  4GOP B;  2NVQ H;  4XTC S;  4LF4 Q;  4LF8 Q;  1MKH A;  1VQN A;  1GJX A;  1WTO A;  4UP7 A;  4MN3 A;  3PIP 3;  2XRS D;  3S16 H;  1HZA A;  2Q2I A;  2PZU A;  4KLK A;  3GTJ H;  2F03 A;  4BBS H;  4DUY Q;  3NWS A;  3HFZ B;  2JE6 I;  2KHI A;  1NMG A;  3VA7 A;  1SNO A;  2ZTE A;  5M3M H;  1JT8 A;  4LNQ A;  2HT1 A;  2BDO A;  1A62 A;  1G29 1;  3QB3 A;  5C4H A;  1J5E Q;  1NMF A;  5CR3 A;  1EQR A;  3BZC A;  1LO5 D;  3H0G B;  1O78 A;  3OIQ A;  4JOI A;  3VR2 A;  5JJZ A;  5FOB B;  3MEH A;  1EUJ A;  1VQH A;  4NKL A;  3I4M B;  2G5D A;  1VQL A;  1PH7 A;  4GLA C;  1HZB A;  3RZD H;  5EQ0 A;  1LTR D;  4AYB B;  1F2Z A;  3DM3 A;  3FKI H;  1PRT F;  3WDN A;  1ONL A;  5EAY A;  4DAP A;  3KF8 A;  1C9O A;  3A8J E;  1S5B D;  2Z0S A;  3DEO A;  2E2H H;  1WFQ A;  1HNW Q;  3CCR A;  2WKC A;  4DK3 C;  2WAQ G;  1HFG A;  2F0F A;  4X62 Q;  4GNX C;  1ESR A;  4EX5 A;  3WOF A;  2B2Y C;  1G6P A;  3TS0 A;  1YIJ A;  2KBN A;  1SJH D;  4HCS A;  3J7A 5;  1B70 B;  2IHE A;  2CKZ B;  3OHX C;  4A93 B;  2L15 A;  3L9A X;  3MFG A;  3T51 B;  1LUZ A;  3PUZ A;  5C3W A;  4JVZ A;  3S2D B;  2A8V A;  1B50 A;  4YWL A;  2F0N A;  3VA5 A;  1JWU D;  2JA7 G;  3JAM c;  1STG A;  1TT2 A;  1DJR D;  3H09 A;  2B2T C;  4OEM B;  2UUB Q;  1LYL A;  1SMX A;  2JA6 G;  2R7Z G;  4GKJ L;  2F0V A;  3LNN A;  4HR7 B;  4IN3 A;  4PV1 C;  5GAH C;  4ID6 A;  1O7L A;  1TVX A;  1O7Y A;  1PV4 A;  1K8G A;  1EFW A;  4IZ8 A;  1SFO H;  1C4Q A;  1HQM C;  2K14 A;  2XRQ D;  1D5M C;  3KF6 B;  5IYB G;  1UE7 A;  3S2H B;  1C48 A;  2R7F A;  2HQL A;  4Y7N B;  4L5S A;  2N88 A;  1ML0 D;  3GTP H;  2PNH A;  3K0X A;  4LMQ D;  5IGG A;  4QUF A;  1E1O A;  1V1O A;  2G9H D;  4KHZ A;  4IJL A;  1Y1W B;  3SK4 A;  2D9U A;  1YZ6 A;  3MC0 B;  4DV2 Q;  4G7Z C;  2SOB A;  4R4C A;  5CGK A;  2B39 A;  4RGO S;  4JI8 L;  4QL5 A;  4A3J G;  3FRP B;  1OXX K;  2KCT A;  1TWA B;  1EIY B;  4DUZ Q;  2NZH A;  4BBR H;  3ERO A;  1TXY A;  1RTO A;  2A6E D;  2XWJ B;  4KY7 A;  1F9S A;  3KLW A;  1UEA B;  2DJF C;  5I6W A;  1EU3 A;  3PIO A;  1OXV A;  4PNY A;  2EDG A;  1HNZ Q;  4DR6 Q;  4GOP A;  4JYA Q;  3A5Z B;  4ZUJ A;  3H3V H;  3DHQ A;  4DAY B;  5IIF A;  2F4V L;  2UUC Q;  5EPK A;  2F0O A;  1TKW B;  2WB1 G;  4X65 L;  4J6H A;  2K75 A;  2OWO A;  4B3R L;  3CC7 A;  3STB D;  4CKE A;  4CHT B;  1HZ9 A;  5IT9 L;  2EVB A;  3EQL C;  2E76 C;  3VR3 A;  4KY5 A;  4C3I H;  3J80 c;  3K5N A;  2IHF A;  1XMO L;  2ZT9 C;  1RJT A;  2K5H A;  2K7V A;  5I6Y A;  4PMB A;  1PFM A;  4A3L G;  2CVR A;  2KHS A;  2WAQ B;  4IUR A;  3S1Q H;  2CCZ A;  3D31 A;  4R8N A;  4AQY Q;  2B29 A;  3HG9 A;  5ELC A;  5IP9 H;  4RHS A;  3ERQ A;  1X54 A;  2F0Q A;  3K57 A;  1QUQ B;  4HTH A;  2RCN A;  1AFP A;  1DOM A;  3UDX A;  2R92 G;  1Q86 C;  1K0R A;  2WP8 J;  1RHP A;  2JA7 B;  1F2L A;  2EXZ A;  3ND8 A;  5DNF A;  5IOC A;  2VQE L;  4DV3 Q;  5C4X B;  5BR8 L;  5CBE E;  2BA0 A;  2JA6 B;  2R7Z B;  4BXX H;  3S14 B;  5JVH 3;  2LS0 1;  2F0P A;  2EYL A;  2NVY H;  3T13 A;  1KRS A;  3OW7 A;  4LF6 L;  3RZO B;  3CHB D;  1SN8 A;  5CMD A;  2RQX A;  3S1N H;  1KC8 C;  1CKN B;  1KTK A;  3NP8 A;  4HJ9 A;  4CKB A;  4GN3 B;  5K36 H;  4G57 A;  3Q0A A;  1P8L A;  4A3B G;  1BCP D;  3M4P A;  5ELF A;  2KEN A;  3ITP A;  3HOW G;  1DD2 A;  1Q81 C;  2GVB A;  1X55 A;  3UDF A;  2QIL A;  1PA6 A;  4JPB W;  4B3S Q;  4JI3 Q;  3G48 A;  3A7L A;  4DN4 M;  4CKC A;  1K28 A;  2XVS A;  1D8L A;  1GXD C;  1SNC A;  5E7N A;  5KEE A;  1RD9 D;  4A3J B;  4GNX B;  4B3T Q;  2FMM A;  5C0X G;  1B2T A;  5CV6 A;  2B8G A;  3J81 L;  3TZD A;  3X3N A;  1T9H A;  3ULL A;  2RA4 A;  4EQN A;  1BKB A;  4LAA A;  2Z8L A;  2IPK D;  3CCE A;  2K6A A;  1HQR D;  4DNT B;  2JEA I;  2Z6B A;  1V9P A;  3KF6 A;  2HD3 A;  4BY1 G;  2KQ3 A;  4DR4 L;  2HUG A;  2K33 A;  4OO1 I;  5GAG C;  1DYQ A;  2O2L D;  1IL8 A;  1A0I A;  1SRO A;  3MTS A;  1NJI C;  1CM9 A;  2PMZ B;  3UE0 A;  1EWH A;  3F1Z A;  2J7Z A;  4KHP L;  5JJK A;  1WTH A;  3HOZ H;  4C1N I;  1I3Q B;  3RN5 A;  2ALY B;  4A3G H;  2WB1 B;  4LFB Q;  1HR0 L;  1BUV T;  4B3M L;  1VQ4 A;  3IL8 A;  2PZW A;  1Q8I A;  1QJO A;  3NE5 B;  5KNB A;  1TWF B;  2QDB A;  3AYH B;  4JI7 Q;  1PFN A;  3H94 A;  2UUA Q;  1NBW A;  1FJG Q;  2MNA A;  3ZJY C;  1NE3 A;  5D65 A;  1NTG A; 
#chains in the Genus database with same CATH homology
 1ZYR C;  1U4R A;  2E2D C;  2A69 D;  2K03 A;  3VYU A;  1QCB D;  2L9H A;  2RDH A;  1CK1 A;  4DAY A;  1Y8P B;  2NVT B;  2Q8I B;  3C3L A;  1AZP A;  2FMC A;  3KUP A;  1LT4 D;  4I65 A;  4L6T B;  2KEE A;  4C3H G;  3W2D A;  4C2M B;  1CHQ D;  1XXG A;  1WTW A;  1WTV A;  5ELD A;  4J8Q A;  2PPB C;  5EKL A;  3K58 A;  1OXS C;  3C46 A;  1A2T A;  5LL6 S;  4XQQ A;  1MSH A;  1X3P A;  1KLG D;  2VB2 X;  3R3O A;  1T5X D;  2XSC A;  1CTM A;  3KK7 A;  1I4G A;  5M5Y B;  1BCP F;  4XXE A;  3NHH A;  3CRL C;  2CHB D;  2EY2 A;  3IKJ A;  4ZUI A;  4C3J G;  1Z7T A;  4OIJ A;  2KOL A;  2F0T A;  1D6E C;  2JSO A;  2DN8 A;  2F0G A;  4ZK9 B;  2IW3 A;  3NTK A;  3I72 A;  4RGT A;  5NUC A;  4FVM A;  1AZQ A;  3H6M A;  2A5H A;  1U9R A;  1LTG D;  1SJE D;  2OEO A;  1SNM A;  4FP5 D;  3VYS A;  3NQI A;  2EY6 A;  5DM7 3;  3WOE A;  3E0J A;  1B53 A;  1RDP D;  1SE4 A;  5G3L F;  1J8I A;  1IHZ A;  2B2Y A;  4U68 A;  4C1N K;  1IW7 D;  3SVM A;  1CFM A;  1K8O A;  2B2T A;  4DF7 A;  1G2T A;  4A3M B;  2IX1 A;  3I4L A;  4L8J A;  1W6J A;  4ZRZ A;  4G7H C;  2AQ2 B;  2EYJ A;  2F0W A;  3GQB A;  2DNE A;  2E2I B;  4IFD J;  2HDL A;  3KLS A;  5C4Z A;  1I4H A;  1SSO A;  2MHV A;  4C3H B;  1II3 A;  4K2K A;  3DXJ C;  5J39 A;  2Z4H A;  3G7L A;  4FXG C;  1HFN A;  1KLU D;  1QNU A;  4HSV A;  1EL0 A;  3OWE B;  5KYI A;  4M8A A;  2NVX B;  4HN7 A;  1TII D;  3FMC A;  3DUZ A;  2PO4 A;  4KJO A;  5DM6 3;  3X3M A;  2NTT A;  1Q3L A;  5I9O A;  4KTA A;  4RAU C;  3PV0 A;  1S5D D;  3I91 A;  5JEA G;  3NUC A;  5J1Z A;  4C3J B;  4V19 0;  4K5V A;  1R9T B;  3M7N A;  1SYE A;  5JAV A;  1EY7 A;  3L7Z C;  5FO9 B;  3GTG B;  2TMP A;  2G9D A;  3O13 A;  1ICW A;  2A6E C;  3MVV A;  2YYZ A;  1STN A;  1IYV A;  4DK0 A;  4Q0F A;  3QWN A;  3BVZ A;  3Q24 A;  1RCV D;  2EYH A;  3A7A B;  5T1G A;  1X3Q A;  1F9P A;  5KNC A;  3T56 B;  4Q5V A;  1Y1V B;  2VNU D;  4F87 A;  1EY0 A;  2N55 A;  5M5W B;  4DA2 A;  2D5D A;  2CQA A;  3BYY B;  4CJ1 B;  3T16 A;  1TWC B;  2EZV A;  1MSG A;  1CA5 A;  1ZYR D;  2K5Q A;  2R3Z A;  1WTR A;  1F2M A;  3NSW A;  3OOC A;  5CV9 A;  5IGC A;  2EJM A;  2Y0S B;  1A3V A;  1LLR D;  4F8M A;  1J9O A;  4A3D B;  3W3A A;  1GHJ A;  3HOU B;  3ND9 A;  3SE0 A;  1B1Z A;  1OXU A;  2Z1C A;  2VB3 X;  1GUO A;  2NN6 H;  3J7Y W;  1KNE A;  5ISR A;  4NMZ A;  2F0M A;  2NB0 A;  5EBC A;  1BCP C;  2DY8 A;  2PNR C;  5EGT A;  2AUK A;  1JR0 D;  5CBA E;  5C6A A;  2EJF C;  4HSP A;  4IUQ A;  1HA6 A;  3P20 A;  2EYP A;  5IGB A;  3IFT A;  1KDC A;  3TP8 A;  5EPL A;  4RWS C;  5CV4 A;  1KAA A;  3S1M B;  1ILQ A;  3R93 A;  2ICI A;  4A3K B;  2VUM B;  1GUW A;  3HOX B;  1GUG A;  3I4N B;  1GHK A;  3E5S A;  5JVG 3;  3EFX D;  3VR4 A;  1CA6 A;  1MI2 A;  3GV6 A;  1AEX A;  1SYB A;  1H9S A;  1IKM A;  3SR1 A;  1ENC A;  4A3E B;  1I6H B;  3GO5 A;  4OGQ C;  4QF4 A;  1HCZ A;  3OSO A;  4IUN A;  1YNN D;  1SEB D;  1S5C D;  3P1H A;  1XX8 A;  1OXT A;  2HDM A;  2MP1 A;  1U4M A;  3JAM L;  4ILW A;  3AB9 A;  1E2W A;  2I07 B;  4OO1 G;  2ICE C;  1Q1E A;  2Q8R E;  2A69 C;  4QIW B;  4QMG A;  1PXU A;  5C0X H;  1Y8O B;  4BS9 A;  4OL7 A;  1G2S A;  4H7B A;  4B9X A;  1EYA A;  3HZX A;  1SDF A;  2F0I A;  5T1I A;  3HP3 A;  1ROD A;  4RH6 A;  1SNP A;  5FLX E;  5IGE A;  2E75 C;  5JPN C;  4RA8 A;  3TP7 A;  1KNA A;  1JQY D;  1A2U A;  1QWY A;  1STH A;  1HPC A;  1R4P B;  2F3V A;  4WRD A;  4UAI A;  1I4R A;  4KJN A;  1CZW A;  1LV9 A;  3AU7 A;  3BS1 A;  4L63 B;  2M9V A;  1EFI D;  1SYC A;  2AWN A;  1K8M A;  1BR9 A;  1Z47 A;  1HHV A;  1HUM A;  4A3F B;  4KKT A;  4N9T A;  5A2Q E;  1IKL A;  2AWO A;  4FF1 A;  1GOZ A;  2L55 A;  4K5X A;  2JA5 B;  2LFN A;  1LT5 D;  1BOS A;  1FNU A;  4ZLT F;  1EEI D;  5A35 A;  3J80 L;  1PTO D;  1E0B A;  2F0D A;  1VCI A;  1PDQ A;  1CI3 M;  4UDU C;  2A68 D;  3LWU A;  4XIG S;  4EVO A;  1O7Z A;  2K01 A;  3MA2 B;  2O5I C;  1F9R A;  1BCP B;  2JXM B;  5KYL A;  1BBX C;  1IW7 C;  2BE5 D;  2B2U C;  1NUC A;  4ZYS A;  1H9M A;  2R6G A;  1IYU A;  2F0S A;  4DFA A;  1TWG B;  1ZKO A;  4JK1 C;  3GTM B;  1PYW D;  1SNQ A;  3P75 A;  2KA7 A;  4EQO A;  1GUN A;  1ET6 A;  2WAC A;  2YU9 B;  2AQ3 B;  1EY6 A;  2L11 A;  1BQQ T;  1V1P B;  5CV5 A;  1B3A A;  3SHL A;  2NUC A;  3S15 B;  1EIH A;  4QCL A;  1U4P A;  3NQT A;  2NWG A;  1KAB A;  4K5W A;  2D2C C;  1GUT A;  3CU7 A;  4BA2 I;  1VDZ A;  4ZKB B;  5COY A;  3CKI B;  3K59 A;  3ZYY X;  1EYD A;  4KK7 A;  2B63 B;  3G6J B;  3NK9 A;  1TU2 B;  1EYC A;  1SMY D;  3KBX A;  1LTT D;  5J22 A;  1LTI D;  4O1N A;  4MIU A;  2EOT A;  1B9M A;  4DAV A;  1E2Z A;  3RMH A;  4OHJ A;  1SND A;  1UUP A;  1S5E D;  2EJG C;  1R4Q B;  3BDO A;  1TY2 A;  2RVL A;  5HGT A;  1EY4 A;  2F0U A;  1F2Y A;  3M3Y B;  4TSS A;  3RD4 A;  2WKD A;  4ULL A;  4I7Z C;  3BDL A;  1EQT A;  1E2V A;  1RF2 D;  5BN3 A;  1JB3 A;  5JEA H;  3RLF A;  3S9W A;  2L12 A;  3MXU A;  1A15 A;  1I4Q A;  3SK5 A;  2FFK B;  2B2W C;  4XQJ A;  1BO0 A;  2WIN B;  2SNS A;  2NVQ B;  1BDO A;  2CW0 D;  1D2B A;  3VYR A;  1ESF A;  3PUY A;  2MUY A;  3GTJ B;  2JP1 A;  1ILP A;  3D6W A;  1VF5 C;  2X6L A;  4KY6 A;  5LHY 1;  1HUN A;  2QF7 A;  3QG1 A;  3HS0 C;  3MXN A;  4OIK A;  2KUM A;  2SEB D;  2KCC A;  3FVQ A;  1ZEQ X;  4X3U A;  3P7J A;  1VF7 A;  1V1P A;  4KHV A;  2IWH A;  4IFD G;  1JE4 A;  5IGD A;  3Q22 A;  4HMJ A;  5IT9 E;  2E2H B;  2NN6 I;  1TS5 A;  5K5P A;  3L3O C;  2XNA C;  5DEH A;  4IUT A;  3Q6S A;  3GTL B;  2QEJ C;  4GZY C;  4MHE A;  3D4D A;  1JOO A;  1EQV A;  2EPB A;  1LTB D;  1YNN C;  1B44 D;  5COR A;  2L0C A;  4B08 A;  5ELE A;  3MXG A;  1S4Z A;  2EY5 A;  4F7X A;  4B9W A;  3PO2 B;  5EKK A;  5D14 A;  3DWA A;  3GTP B;  4WFN 3;  2EE1 A;  1FR3 A;  3FPU B;  2AQ1 B;  4ZQ3 A;  3D3R A;  3N52 A;  4IUV A;  1Y69 U;  2AUJ D;  2IL8 A;  4PMW A;  3PUV A;  2L4N A;  3SEB A;  2EYM A;  4FO2 A;  1TS4 A;  2A74 C;  4LK1 C;  4BBR B;  3NTH A;  4ZAI A;  3EA6 A;  1Z6H A;  1CQV A;  4BA1 I;  3U9O A;  4Z9C B;  1G91 A;  2BOS A;  5EPJ A;  4NP5 A;  3TSS A;  4FYD A;  5D3D A;  1ZXT A;  1H9J A;  3F2U A;  4HCE A;  5CYU A;  1FGB D;  2EYF A;  4KMU C;  1UAP A;  1WTP A;  1SE2 A;  4RFB A;  3NWT A;  4OO1 H;  4C3I B;  3BDC A;  2OF1 A;  3BVM A;  3E6Z X;  4KKS A;  3S1Q B;  4K14 A;  2A6H D;  2RSN A;  4RCN A;  3SK6 A;  3FEW X;  1SE3 A;  1Q1B A;  4TKO B;  4H0L C;  1SXT A;  4IUP A;  1LAB A;  3IAY A;  4K6L A;  4DXG A;  3HEJ A;  5E1F A;  5FK9 C;  2MPM A;  2NZ1 D;  3KLR A;  4H44 C;  1FD7 D;  3TP5 A;  1T5E A;  1PTO C;  2F4I A;  5E3F A;  1WVL A;  1LTA D;  2QCP X;  2K1B A;  2IJ0 A;  2JEB I;  4K8J A;  1K83 B;  2B2U A;  2NVY B;  5CV8 A;  1WTX A;  3OPO A;  4E6I A;  2A68 C;  1WD0 A;  1STE A;  2F0L A;  3M4Y A;  1PRT D;  2BE5 C;  2OXP A;  2FIN B;  5A2Q L;  1JIC A;  2Z4I A;  5D3I B;  4K8I A;  1RTN A;  2LMC B;  1QE6 A;  1OO9 B;  3BZD B;  1C8C A;  1EZ8 A;  3MAQ A;  2KJX A;  4ZKC B;  2RBM A;  3KLS X;  5KIX A;  1AW7 A;  2K32 A;  2VXW A;  1A3U A;  3J7A F;  2IT1 A;  5C3X A;  5E4X A;  2RKS A;  5LL6 X;  1TS2 A;  4YIJ A;  2Q8T A;  1L0X B;  5IOD A;  3QOJ A;  4J1M A;  2PCF B;  3NXW A;  3PMF A;  3C1F A;  1D5X C;  1B9N A;  1ENF A;  4X3T A;  3SK8 A;  5CC4 A;  3I8Z A;  1FNV A;  4A3G B;  3DWP A;  2L5T A;  3PO3 B;  1M4V A;  3S1R B;  4RKL A;  3LX0 A;  1PZK D;  4X3S A;  3M4O B;  3T53 B;  1SMY C;  1LAC A;  2FJ2 A;  1GUS A;  2JYO A;  5JOB A;  4KI0 A;  1Q90 A;  2IX3 A;  5HUR A;  1D1K A;  1DCZ A;  3S17 B;  1XTC D;  4QB4 A;  1MD2 D;  4XQN A;  1ENA A;  4F88 A;  3FPP A;  1CQF A;  3TP6 A;  1MGS A;  2EYO A;  3M7G A;  1SYF A;  2B2W A;  4XT1 B;  2LY7 A;  3IFD A;  4CBV A;  3R2T A;  1BNZ A;  1FNW A;  2F0K A;  5I2X A;  1NAP A;  2H4O A;  3NTI A;  2OT2 A;  4DK1 A;  1QG7 A;  1DON A;  2CW0 C;  4R9W A;  1STA A;  5KGU A;  1F9Q A;  3HRZ C;  1QOH A;  3HOV B;  1QNK A;  1RKN A;  3HKZ B;  4RKB A;  3DM1 A;  5I4D A;  1EEF D;  1PTO B;  1YNJ D;  3M85 A;  5C44 B;  1G6Z A;  2XWB B;  2O4X A;  3OWF A;  2RDF A;  2K04 A;  3FDT A;  4DNR B;  3MXP A;  1NR4 A;  5M3F B;  4JBW A;  1WCM B;  4A3I B;  2J0T D;  2BDN A;  1CT1 D;  4QUC A;  4KN7 C;  3I3C A;  5F2D A;  3NPP A;  3J7A V;  5BN4 A;  1EOT A;  2PZT A;  1WTQ A;  2HCI A;  4XYQ A;  4DXF A;  2C9O A;  5EKI A;  4K2L A;  3URY A;  4KV6 A;  3PUW A;  4O42 A;  1B4O A;  2O5J C;  3KBG A;  4KKU A;  1U4L A;  3GTQ B;  3ONA B;  2K5W A;  1A3T A;  1NSN S;  2RSO A;  5C5M A;  2NN6 G;  3V05 A;  4KD4 A;  4IFD H;  1QB5 D;  2NBF A;  4FF3 A;  2F1M A;  2NYZ D;  4K6D A;  4DU9 A;  2JA8 B;  1KDA A;  1V8Q A;  4BY7 B;  1KDB A;  5E4W C;  3TDQ A;  2PW5 A;  1HTL D;  1PZJ D;  1UNS A;  1EWC A;  4NW2 A;  3BVG A;  3CRK C;  5DAU A;  3TZU A;  3EVQ A;  1DM0 B;  1BXT A;  1DZ1 A;  3LWE A;  4FF2 A;  4RGN A;  1O80 A;  3A56 A;  1NCV A;  2RDG A;  1LT3 D;  2ENB A;  1TQO A;  3A8K E;  2K05 A;  4U67 3;  2X69 A;  1CZG A;  4C56 C;  1BF4 A;  2B2V C;  2MGS A;  1JC7 A;  3MHB A;  2KVM A;  1EIG A;  3BG3 A;  1XWE A;  3K5L A;  2BCO A;  2KED A;  4V0B A;  1I50 B;  4KN4 C;  2A6H C;  1M8A A;  3D6C A;  1HRJ A;  3JAM E;  1Y8N B;  1SBB B;  4CJ0 B;  2E74 C;  1A6X A;  1CHP D;  1TWH B;  1L0Y B;  5FO8 B;  2GA4 B;  4ME5 A;  3H3V C;  2MJ8 A;  1PTO F;  4RHR A;  3K7A B;  2XIW A;  3QOL A;  2B8F A;  5FO7 B;  5M9O A;  2PYK A;  3NBI A;  3QJY A;  5G3L D;  4RCO A;  4RGM A;  3UI2 A;  4LJZ C;  1DOK A;  1PRT C;  5EBD A;  3NBH A;  4EQP A;  2D62 A;  2TSS A;  1I4P A;  4XT3 B;  4ODG A;  2R93 B;  1D1I A;  2K5D A;  5IGF A;  4HED A;  3CQZ B;  1NR2 A;  3MZ5 A;  1G8Z D;  1TR5 A;  2LKV A;  3AMU A;  4FXD A;  3S16 B;  3A8I E;  2ZXR A;  2R92 B;  1JWS D;  4BBS B;  2R61 A;  2M2L A;  3A55 A;  5KND A;  1TS3 A;  5M3M B;  1SYG A;  3PIO 3;  3Q23 A;  4CJ2 C;  5C0X J;  5ELB A;  5BN5 A;  1H9K A;  4FNF A;  3J80 E;  1PZI D;  3T4A C;  3RZD B;  4A3B B;  4C3I G;  3HOW B;  3FKI B;  2F0J A;  2E2J B;  3R8B A;  3SXH A;  2I46 A;  1HA5 A;  4ABN A;  2QKI C;  2SNM A;  1EY9 A;  3DEP A;  2BA1 A;  3K6O A;  2H1E A;  4G7O C;  3DMU A;  3VR5 A;  4NDX A;  2ID0 A;  2F0H A;  3HGB A;  4H13 C;  1DXM A;  4BY1 B;  3I73 A;  3QIA A;  2HCC A;  5TSS A;  3GV3 A;  1PTO H;  1LTS D;  3I90 A;  4HAE A;  4S3S A;  5K36 G;  3DWQ A;  2KCN A;  2WII B;  1SFO B;  2PQE A;  5I9P A;  4WJW A;  1LT6 D;  2KEC A;  2WV6 D;  5EJW A;  2NTS A;  2F3W A;  5C3E B;  1EZ6 A;  1F77 A;  5FKA C;  2DY7 A;  3N6R A;  4G4K A;  1H9R A;  1W6K A;  3OMC A;  2M00 A;  3J81 E;  2FHT A;  3D8G A;  4KD3 A;  4TQU S;  1HXY D;  1D5Z C;  3D4R A;  4DGZ A;  1JOR A;  1YNJ C;  3TME A;  5C0X I;  2K28 A;  2A73 B;  3OMG A;  3HOY B;  4XYO A;  5AFW A;  3TBI B;  1JOQ A;  1S5F D;  2J4X A;  3K5O A;  2V4D A;  3VR6 A;  3OIP A;  3I70 A;  4IAL A;  3U9S A;  2F0E A;  1PRT B;  2ZXO A;  2DNC A;  3EJI A;  2C5C A;  3QO2 A;  4FXK C;  1XYI A;  1JOK A;  1H9S B;  5FLX L;  4WOR A;  4BWG B;  1EY5 A;  3A54 A;  5KRU A;  1MBY A;  5I2Y A;  1ET9 A;  2IX0 A;  4PMC A;  4M1U B;  3SDZ A;  4XDX A;  3GD7 A;  4PQX A;  4R8I A;  4IUU A;  1I6V C;  1VMP A;  3S1N B;  3GTK B;  1QIL A;  2X6G A;  3V96 A;  2XN9 C;  4FF4 A;  1DOL A;  1EU4 A;  1JWM D;  1AN8 A;  3K0Y A;  4P2C B;  4HMI A;  1PMR A;  4X3K A;  1VMC A;  1SAP A;  3VYT A;  2L1B A;  1SYD A;  1AP0 A;  2HQE A;  1STB A;  1TY0 A;  3MFY A;  1HTP A;  1JCK B;  1Q12 A;  3GP7 A;  4IQZ A;  5JPM C;  3D4W A;  3C2P A;  1WD1 A;  3RUZ A;  3GTO B;  1STY A;  2SDF A;  2PW7 A;  1V43 A;  1I4X A;  5JEA J;  3H91 A;  1FYC A;  4EGV A;  3BYT B;  5C4J B;  5M5X B;  4IFD I;  2B2V A;  3K5M A;  2EY1 A;  1X32 A;  1PFB A;  4TRD A;  5CV7 A;  3HOZ B;  4CGY B;  3TN2 A;  3C1E A;  1EY8 A;  1PLF A;  5C5L A;  3V2T A;  2ZXP A;  3MWY W;  3PUX A;  4N9P A;  3R2I A;  4XTC S;  1GJX A;  1WTO A;  4MN3 A;  3PIP 3;  2XRS D;  2F03 A;  2PZU A;  3NWS A;  2JE6 I;  3VA7 A;  1SNO A;  2BDO A;  1G29 1;  3QB3 A;  5C4H A;  5CR3 A;  3OIQ A;  1LO5 D;  3H0G B;  1O78 A;  3VR2 A;  5JJZ A;  5FOB B;  3MEH A;  3I4M B;  4NKL A;  5EQ0 A;  1LTR D;  4AYB B;  1F2Z A;  1PRT F;  3WDN A;  1ONL A;  4DAP A;  3KF8 A;  3A8J E;  1S5B D;  3DEO A;  2WKC A;  1HFG A;  2F0F A;  1ESR A;  3WOF A;  2B2Y C;  1SJH D;  4HCS A;  4A93 B;  3OHX C;  3L9A X;  3MFG A;  3T51 B;  5C3W A;  3PUZ A;  3S2D B;  1B50 A;  2F0N A;  3VA5 A;  1JWU D;  1STG A;  1TT2 A;  1DJR D;  3H09 A;  2B2T C;  2F0V A;  3LNN A;  4HR7 B;  4IN3 A;  4PV1 C;  4ID6 A;  1O7L A;  1TVX A;  1O7Y A;  4IZ8 A;  1C4Q A;  1HQM C;  2XRQ D;  1D5M C;  3S2H B;  1C48 A;  4Y7N B;  2N88 A;  1ML0 D;  4LMQ D;  5IGG A;  4QUF A;  1V1O A;  2G9H D;  4KHZ A;  1Y1W B;  3SK4 A;  2D9U A;  3MC0 B;  4G7Z C;  2SOB A;  5CGK A;  2B39 A;  4RGO S;  3FRP B;  1OXX K;  1TWA B;  3ERO A;  1RTO A;  2A6E D;  2XWJ B;  4KY7 A;  1F9S A;  1UEA B;  5I6W A;  1EU3 A;  1OXV A;  4PNY A;  2EDG A;  4ZUJ A;  3DHQ A;  5IIF A;  5EPK A;  2F0O A;  1TKW B;  4J6H A;  4CKE A;  4CHT B;  5IT9 L;  3K5N A;  2EVB A;  3EQL C;  2E76 C;  3VR3 A;  4KY5 A;  2ZT9 C;  1RJT A;  5I6Y A;  2K7V A;  4PMB A;  1PFM A;  2CVR A;  2KHS A;  2WAQ B;  4IUR A;  3D31 A;  4R8N A;  3HG9 A;  5ELC A;  4RHS A;  3ERQ A;  2F0Q A;  3K57 A;  4HTH A;  1AFP A;  1DOM A;  2WP8 J;  1RHP A;  2JA7 B;  1F2L A;  2EXZ A;  3ND8 A;  5DNF A;  5IOC A;  5C4X B;  5CBE E;  2BA0 A;  2JA6 B;  2R7Z B;  3S14 B;  5JVH 3;  2LS0 1;  2F0P A;  2EYL A;  3T13 A;  3OW7 A;  3RZO B;  3CHB D;  5CMD A;  2RQX A;  1KTK A;  3NP8 A;  4CKB A;  5K36 H;  4G57 A;  3Q0A A;  1BCP D;  5ELF A;  3ITP A;  1DD2 A;  2QIL A;  3A7L A;  4DN4 M;  4CKC A;  2XVS A;  1GXD C;  1SNC A;  5KEE A;  1RD9 D;  4A3J B;  2FMM A;  5C0X G;  1B2T A;  5CV6 A;  2B8G A;  3J81 L;  3TZD A;  3X3N A;  2RA4 A;  4EQN A;  4LAA A;  2Z8L A;  2IPK D;  2K6A A;  1HQR D;  4DNT B;  2JEA I;  2KQ3 A;  2HUG A;  2K33 A;  4OO1 I;  1DYQ A;  2O2L D;  1IL8 A;  3MTS A;  1CM9 A;  2PMZ B;  1EWH A;  2J7Z A;  4C1N I;  1I3Q B;  2WB1 B;  1BUV T;  3IL8 A;  2PZW A;  1Q8I A;  1QJO A;  3NE5 B;  5KNB A;  1TWF B;  2QDB A;  1PFN A;  3H94 A;  5D65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...