4RAUC

Crystal structure of rtofab in complex with human pf4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
EDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RTOFab light chain
publication title crystal structure of RTOFab in complex with platelet factor 4
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 5
structure length 65
sequence length 65
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rauC00
5CMDA 1F9PA 1X3QA 1PFMA 2BDNA 2R3ZA 3I91A 2B2YA 2FMMA 4ZAIA 2FFKB 2KOLA 1SAPA 2RVLA 1O7YA 1XX8A 2D9UA 2MPMA 3FPUB 4RAUC 1IL8A 1QE6A 1X32A 4IURA 5EJWA 1O80A 5EQ0A 4LMQD 4IUQA 1NCVA 1F9QA 4R9WA 2Q8TA 5CBAE 1BF4A 1CA5A 2B2TA 4IUUA 2K28A 3G7LA 1B3AA 2HDLA 1CM9A 2EE1A 1B50A 5T1IA 4HAEA 4RA8A 3DM1A 1M8AA 4OIJA 2KVMA 1HUMA 2K1BA 2L12A 1HRJA 1BO0A 3I90A 5D14A 4MN3A 1BNZA 4ZK9B 1WTXA 4MHEA 5EPKA 2FHTA 2Q8RE 1QG7A 2EOTA 2N88A 3ONAB 5EKIA 1G2TA 1TVXA 1PLFA 2KEEA 2J7ZA 3KUPA 1MI2A 2DY8A 1U4LA 4IUVA 3LWEA 2RSOA 1EIHA 1SSOA 5EPJA 2MP1A 1WD0A 2B2WC 3KBXA 1ILPA 2VXWA 1GUWA 1A15A 5E4XA 3GV6A 1F9RA 1DOLA 1F9SA 2M2LA 1C8CA 1E0BA 4HEDA 2NWGA 4UAIA 5DNFA 5EPLA 5CORA 1ML0D 3IFDA 1MSHA 2B2VA 1HA6A 1PFNA 2B2UC 2MJ8A 2IL8A 1HUNA 4OIKA 1PFBA 3MWYW 3HP3A 2HDMA 1VMCA 1X3PA 1U4MA 2L4NA 2NZ1D 4ZKBB 2HUGA 4XDXA 3SVMA 5T1GA 1NR2A 1RJTA 4R8IA 1WD1A 4XT1B 2X6GA 1BBXC 1SDFA 4ZKCB 3IL8A 4CJ1B 2XIWA 2N55A 4HCSA 2L1BA 4XT3B 4DN4M 2FJ2A 1EL0A 1LV9A 1WTOA 1JE4A 4ZLTF 1MGSA 2CVRA 3D6WA 3FDTA 2B2WA 3P7JA 2K05A 1JICA 1WTQA 1Q3LA 2DY7A 2RA4A 2SDFA 1DOMA 3MTSA 3I8ZA 4CJ0B 1XYIA 1WTWA 5E4WC 1J9OA 2NYZD 1DZ1A 2JP1A 3R93A 1G6ZA 2K03A 2MGSA 1DONA 2B2UA 5CBEE 1IKMA 1ILQA 2K01A 4IUTA 1ZXTA 1AZQA 3UI2A 4QUCA 4RWSC 2L9HA 2K04A 1RODA 4X3TA 1KNEA 4NW2A 1AZPA 3DEPA 1ESRA 4X3UA 4CJ2C 2B2VC 1CA6A 1HFGA 5JJZA 1EOTA 3DEOA 2B2YC 2H1EA 2HCIA 3N52A 3TN2A 1NR4A 2KECA 2RSNA 5D65A 2JYOA 4X3SA 1O7ZA 1B4OA 1F2LA 1KNAA 2X6LA 2KEDA 1B2TA 3I3CA 5COYA 1QNKA 2B2TC 4U68A 1DOKA 1WVLA 1G2SA 1WTPA 4QUFA 1ICWA 3H91A 1IKLA 1HHVA 1EQTA 2HCCA 1VMPA 2KUMA 3Q6SA 3GV3A 1WTVA 1NAPA 1AP0A 1EIGA 2EPBA 5AFWA 4O42A 1RTNA 1RHPA 1S4ZA 1B53A 4HSVA 1HFNA 1U4PA 4X3KA 3TZDA 1MSGA 1U4RA 2X69A 1RTOA 2FINB 1J8IA 4IUPA 3QO2A 2L11A 1WTRA 1G91A 3F2UA 1PDQA
chains in the Genus database with same CATH superfamily
1F9PA 2RBMA 2R3ZA 1VS0A 1SAPA 3CCLA 1O7YA 5C4HA 4CJ2C 4A3EB 1S72A 1X32A 4IURA 4R4TA 5C6AA 4XQNA 2Z4HA 2UXCQ 2IPKD 3NBIA 4F8MA 1M1KC 3HOYG 1VQBA 5CC4A 3RLOA 1N34Q 4OIJA 1CK1A 2K52A 1STYA 1HRJA 1BNZA 5DM63 5EPKA 5E1FA 1VQFA 5KNBA 1VQKA 4HMJA 4R4IA 2HT1A 4UDUC 3HKZE 4CKEA 2RSOA 4YHHL 2C5CA 3KBXA 2G9HD 3EFXD 1I4RA 1HQRD 3DHQA 2I5HA 2BA0A 4AH6A 4X62L 1WI5A 4DAYA 4JI3Q 2BDOA 2RCFA 3WWVA 1K83H 1OXSC 4DR4Q 2HDMA 3GTKB 4QY7A 2YV5A 3L0OA 4IALA 3PO2H 2E2HB 5J39A 4JI8Q 1K28A 4HCSA 5CYUA 1SR3A 5IT9E 4V190 5FOBB 1BR9A 1MD2D 1A2UA 3L3OC 2ALYB 4ODGA 1G6PA 4A3BB 1TIID 2F0EA 3MTSA 4F88A 1DZ1A 3ZJYC 2NVQH 3U58A 5C5LA 3JAMc 2MGSA 3M3YH 3MAQA 5CBEE 3ZYYX 1TWGB 5IE8A 1PH6A 1NSNS 4KJOA 3SR1A 3HOVH 3L7ZC 2XTIA 5BR8L 1HNWL 4A3IB 1PH1A 2R93B 1MIUA 4BBSH 4GNXC 3HOWH 1CTMA 4X3SA 5FO8B 1GUGA 3NBHA 2X6LA 1CKMA 4YWKA 4A3CH 3I4NG 2UXDQ 2A68C 2F0HA 2VQFQ 2F0OA 2F4VQ 1A0IA 4LF4L 1SYEA 2XRSD 4K2LA 1U4PA 2O4XA 3WDNA 1CSQA 1CHQD 2FINB 1VQ8A 2IJ0A 1X6OA 5BN5A 3K0XA 1SYFA 1O78A 4JI4Q 3I4LA 3MEHA 1M90C 2GN5A 1RCVD 3KBGA 1PH9A 2PQAA 5C0XH 4ZAIA 1VQ7A 4GNXA 3GTMB 2Z1CA 5CBAE 3AEVA 4R9WA 4MZ9A 2DGYA 4OWTB 3NSWA 2QDLA 3G7LA 2XN9C 5CV8A 2Q2HA 3BZKA 4I65A 3J80E 2F03A 2UXBQ 2D62A 1FR3A 1I4XA 4CGYB 3I4MG 2Z0SA 3PO3G 2QA4A 3TBIB 2F0PA 3S24A 1A62A 1Z6HA 1KDAA 1SROA 1WD0A 2JA9A 1E24A 2VXWA 3GV6A 3CPFA 5AJ3Q 3BZDB 5GAEC 2JA5G 1I6VC 1VQHA 1K0RA 2EJMA 2B8FA 3CW2C 3ITPA 3K80C 1DM0B 1H9KA 1EYAA 2PMZB 1VMCA 1L1OB 1X3PA 4BA2I 3OPOA 4ZKBB 1L2FA 3E6ZX 1PH4A 4KHZA 4DV6Q 4BY7H 3NWSA 4JI7Q 2XIWA 3HEJA 3A8JE 3ERQA 3T16A 2CW0D 1GXDC 1JE4A 1WOCA 3D6WA 3J7AF 2K6AA 2B63B 3J81E 4CJ0B 1A3VA 1D5ZC 3UDGA 1IL2A 3TSSA 4OX9Q 3GTLB 2VQEQ 1S5ED 2AHOB 5IOCA 4DR6L 1QVCA 1ZXTA 3U50C 3RZDH 4EX5A 5ELFA 1GO3E 1LACA 3S2DH 1HZCA 4HIOA 5IIFA 1N33Q 3PF4A 4BY1B 4H0LC 1F2ZA 2UUAQ 4DUYL 2E2DC 1NNXA 3BDOA 4XIGS 2I0QA 3QR8A 1ESFA 3H09A 4Y7NB 5COYA 4U68A 1G2SA 1K8MA 3E3XA 4K5WA 1X55A 1SE4A 2HCCA 4JCVE 3Q6SA 1SEBD 4QGUA 3A7AB 5IYBG 2IY5B 1EIFA 3K5LA 1SJHD 2F0VA 4NB3A 1V9PA 1G91A 1R9TB 2N78A 3SK8A 4HTHA 1FNUA 4L8JA 3MXPA 1I94L 1X3QA 1PFMA 2WACA 5FO9B 4K0KL 5C4XB 1EOVA 3PQIA 3PMFA 5CV6A 4OO1I 4LMQD 4LF8L 1QUQA 1XMOQ 4LFCQ 4PZ8A 4IUUA 1ENFA 1RL2A 5M5WH 1X3EA 4L5QA 4IQZA 5LMUL 4FXKC 1Z7TA 5G3LD 2KCNA 4IPCA 5DAUA 2KCCA 4RGOS 1W6KA 3IRBA 3E5SA 3ONAB 5JEAG 1FGBD 3KUPA 2PW5A 1U4LA 2F0WA 5CV4A 3ND9A 3QIAA 1VQ6A 3FKIG 2ZTEA 2F0JA 3FRPB 4BXXG 2PI2A 4K6LA 2ES2A 5DNFA 3IFDA 4GLVB 1FJGQ 4OIKA 1HNXL 4R4QA 2DN8A 2A69D 1K8AC 3SEBA 3H94A 3I4NH 3S1NB 1PYWD 3NTIA 4JI0L 4OGQC 3S2HH 4QIWE 3TREA 4IN3A 1TU2B 1VQIA 1QCBD 1V1QA 1VDZA 1EFWA 1NJIC 4P2CB 3M7NA 1EL0A 5G3LF 1UE1A 2WKCA 2DY7A 5EKKA 1MBYA 3URYA 1WCMG 2NVYH 1SMYD 1V1OA 4A3KH 5ISRA 1CUKA 2AMCB 1BDOA 1BQQT 2J0TD 2E5LL 2NZHA 3OTOL 1V1PB 2BA1A 1PTOB 3GTQH 2NZOA 3M4OB 3QOLA 4UP9A 2E76C 1LABA 1WVLA 2YU9H 3VR2A 5J3BA 2KHJA 3I4MH 1SYBA 1VQLA 2YTVA 1PRTF 5IODA 2Q8IB 3DWQA 3GV3A 2ENBA 1PRTC 1ZEQX 1EIGA 3OSOA 1DCZA 4C3HG 2JA5H 2AUJD 5C4ZA 2Y0SB 1KD1C 2A19A 2K5WA 1LTAD 2KHIA 5CV7A 1KAWA 4UP8A 4LF9Q 1Q46A 2RHQB 1NUCA 3JAME 1J5EQ 3CD6A 4X64Q 4ZQ3A 1EU3A 4A3JB 5EPJA 5EJWA 4LF5L 3DXJC 1HTLD 1I3QH 4PG3A 1Q7YC 2F0TA 3NEMA 5IP9G 2RCNA 3EROA 4P71A 5FJ8G 4DR1Q 2UUBL 1HUMA 3PSIA 1BO0A 3A55A 2OEOA 1J6QA 4PNYA 2FHTA 1Y1WG 4H44C 2WAQG 4G7HC 4RHSA 1GKHA 4OWXB 1Z9FA 3SK5A 2EJFC 4OO1G 2MP1A 3QWNA 4GN3B 4AYBB 5ELEA 1W2BA 1E3PA 2LKVA 5A2QL 3CKIB 4A3DG 3MXUA 1PTOD 2F0MA 3BJUA 5D3DA 3S1QH 1U4MA 5FLXc 2F0GA 2NZ1D 2K75A 2HUGA 4XDXA 3LX0A 3SVMA 1YIJA 1WD1A 1SMXA 5IP7G 3T1YL 1JB3A 3FP9A 1SYDA 5KYIA 2JSOA 3IL8A 4OONA 5H1SE 5IYDH 2B39A 4DN4M 1KL9A 4JK1C 1NE3A 3NTHA 1PH3A 1FNVA 4ZLTF 1XPOA 4EQPA 1OTCA 3T1HL 1PMRA 1STNA 5GAHC 4DK1A 4ME5A 4ID6A 4QUCA 1CKNB 4DV2L 4IFDJ 3H6MA 4PMCA 2LSSA 1HFGA 1HH2P 3VR6A 2GVAA 2LS01 3C1FA 3CP0A 4YHHQ 3J7AV 3PF5A 3KJPA 1F2LA 1B2TA 3J80i 1XPRA 1WJJA 1VQMA 5JEAH 4L5RC 4DKAC 2VNUD 2E2IB 2F0LA 2K5HA 1G51A 3CCQA 3R8BA 1XNRL 3FKIH 4BXXH 4JI2L 1EEID 1RTOA 3HOZB 4LF6L 3QO2A 1HA5A 3HOXG 5IGDA 3C2PA 2I5MX 2G9DA 3S15H 3TZUA 1WTHA 3TRZA 4KV6A 4KI0A 1HPCA 3MFGA 1Q1EA 1G291 3CXCA 3U9SA 5IYCG 3RD4A 3PCOB 1B50A 4DGZA 3AMUA 1G8ZD 2B29A 1E1OA 1FYCA 2KCMA 4YY3L 5BR8Q 1HNWQ 3BDCA 1Y1WB 1Y14B 1WCMH 1QG7A 3M4QA 3J81i 2KEEA 2VUMG 3K58A 4G57A 1WYDA 1T9HA 3E9HA 4A3EG 4FP5D 1CZWA 1JOKA 2EY6A 4A3DB 3VR4A 2HHHL 4LF4Q 4GOPC 4RCNA 2PZWA 2R7FA 1NMGA 3P20A 1KLUD 3I55A 1ASYA 1UE6A 2MFIA 4HCEA 5DEHA 1GVPA 2XWJB 1QZGA 1KTKA 4DAYB 1JB7A 4C3HH 1I6HH 2FJ2A 2ZXPA 1KHIA 3ERSX 4FF4A 2SEBD 2QEXA 5EKLA 4DK6C 4YCUA 1PVOA 3CCSA 1CFMA 2CH4A 3FMCA 4OELB 4K2KA 3KJOA 3Q24A 4JI5L 1OO9B 3H3VI 1HR0L 4X66Q 1KNEA 5IY0A 4LF7L 4DAVA 5IP9H 2HD3A 2K50A 1UEAB 3S16H 4LW1A 1FNWA 1SLJA 1K3RA 3DEOA 1LTID 1YNNC 5FJ8H 4B3RL 1NR4A 1TWFH 1KNAA 5I9PA 4DNIA 2F0IA 3I3CA 1QZHA 1IYJB 1B70B 1STHA 1ICWA 4A3BG 1T5XD 4DV4L 3K7AB 1H9SA 4IO9A 3OWEB 4OO1H 4PZ7A 4JPBW 2WB1B 2YTYA 2HIVA 4KD4A 1KLGD 3CQZB 1ONLA 3J81j 3NBHB 1QJOA 1SNDA 4A93B 3CRKC 1ZYRD 4JOIC 3S14H 4A3IG 1PDQA 3MFYA 1JORA 1TY0A 2R93G 1I50B 2FMMA 3DWPA 1LTGD 3K5OA 4AIMA 2WINB 1BF4A 1NCVA 3STBD 1EUJA 5IP7H 3QB3A 1XWEA 2NTTA 2PZTA 2DJFC 1YI2A 3ND8A 1SYCA 4DR6Q 2PZUA 1OXTA 3PUWA 4JI6L 3T4AC 3KFUA 3A54A 1S5FD 1TVXA 2J7ZA 4DUYQ 2VUMB 2WFWA 2IHEA 1I5FA 1EIHA 2UUCL 1UNSA 2BE5C 4DV3L 2J4XA 4HJ9A 1C8CA 1RKNA 4UAIA 4QB4A 3K81C 5HURA 1H95A 1L0XB 4XYOA 2B2UC 2TMPA 1XMQL 1DGSA 3MWYW 2K5NA 4A76A 1IW7C 2MHVA 2IHFA 1PA6A 1Q86C 3CHBD 2F52A 3NK9A 4M1UB 5M5XH 4A3GG 1DXMA 1SYGA 1SDFA 4CJ1B 1I94Q 4K0KQ 3OMCA 4AQYL 4LNQA 3F2DA 3SK6A 4V0BA 4LF8Q 1D5MC 1HR0W 4PV1C 1RDPD 2AKWB 3HOXH 1EY6A 5LMUQ 3GTJB 2B2UA 3JAMi 4DXFA 1ILQA 2WAQE 3U9OA 1AZQA 4RWSC 2ZXRA 2NTSA 1RODA 2HQEA 4DR3Q 5JPNC 5IYCH 3DEPA 2A6HD 3IAYA 5JJZA 3KF6A 3RZOH 1B3QA 3HGBA 1EY0A 4ZUJA 5JAVA 2KECA 4DXGA 1O7ZA 1CZGA 2K32A 3SXHA 2KEDA 5FLXE 3TEHB 4DU9A 4G7ZC 1DYQA 1EQTA 2B63G 1HNXQ 4GLXA 2ID0A 4A3EH 1TR5A 3EQLC 1J8IA 4P72A 2CWAA 3TP6A 3VA7A 2O5IC 5KIXA 1IBKL 1EYGA 5IGBA 2NUCA 3FPPA 2BDNA 4BY1G 3J7YW 2Q2TA 4B3TL 1WTPA 1D1KA 2IT1A 3KLSA 4EGVA 5JVH3 3CC7A 1HTPA 4IUQA 4QL5A 2H4OA 3ULPA 3QG1A 3KDFA 1GUTA 4HIMA 2VB3X 4HAEA 3VYTA 1R4PB 2OF1A 2E5LQ 3I90A 1QOHA 3OTOQ 3G4SA 3D8GA 5CR3A 4MHEA 1LTRD 2Q8RE 3BU2A 1G2TA 2QF7A 2ZTCA 2GA4B 1PLFA 3H0GB 4OL7A 1SFOB 3DLLA 2ASBA 1B44D 5C4XG 1SRUA 3GTKH 4RH6A 4N9PA 4DFAA 1EU4A 2ZM6L 5ELBA 2E2HH 1UE5A 4RGNA 1PFSA 3J7A5 4K5XA 5LMNL 2F3IA 4K6DA 1BBUA 2L4NA 4FVMA 3T51B 4EQ5A 5C3EG 4A3BH 4A3GB 5T1GA 1NR2A 4NPSA 1CT1D 4R8IA 2X6GA 3ER0A 4ZKCB 1DD2A 2RDGA 2NVTB 1HQMC 4KY7A 4LF5Q 3A8IE 4Q0FA 1S40A 1WFQA 3RLNA 3RLFA 5JOBA 4C56C 4A3IH 5NUCA 1XYIA 2R93H 3R93A 1VCIA 5J1ZA 3NQIA 2UUBQ 1K3BC 1IKMA 1IBLL 3MZ5A 3BS1A 1YEZA 2CCZA 2K04A 4IPHA 1CA6A 1D7QA 5ELNA 4IUNA 2EYFA 1PZKD 3NHHA 5I6WA 3AB9A 1JMCA 4KD3A 4QMGA 4DK3C 2UU9L 1U0LA 4RCOA 1U5KA 1BVSA 5C44G 3SDZA 3CRLC 1I4GA 2ZJPA 1JQYD 5AFWA 1EWCA 1TWHB 3NPPA 1EEFD 3GTMH 1F77A 3EBEA 2OCEA 1JJ2A 1YHBA 3A0JA 3T1YQ 1YZ6A 1LT5D 3CAMA 3HOYH 4H13C 3QOJA 1AW7A 1STGA 3DWAA 4RAUC 1HXYD 2DJGC 4JBWA 2EYHA 3HFZB 3GTOB 4DR2L 1TWCB 1JT8A 3T1HQ 1RD9D 4RA8A 3DM1A 4EQOA 4IPGA 4S3SA 4DV2Q 4WJWA 2PCFB 1TS4A 5M9OA 2F0QA 2CW0C 1X54A 2EOTA 2Z4IA 2Y0SG 3JC66 4NXML 4BA1I 5I2XA 3PIOA 2SOBA 3EN2A 5CV9A 5C0XJ 5LMNW 3K7UC 2JQOA 3P1HA 4A3JG 1Y8OB 2F0DA 1F9RA 4DF7A 2PYKA 2BH8A 1XNRQ 5IGGA 1TS3A 5GADC 4JI2Q 1SE2A 1Q1BA 3A56A 1V8QA 4LF6Q 2ZT9C 5C3EB 1STEA 4L5TA 2E75C 3VYUA 4C3IB 2B63H 1VQCA 4POFA 3H3VH 3GTLH 4KHVA 2NVXB 2QGQA 2JA7G 2D0OA 3P7JA 2XVSA 2K05A 1JICA 4AYBG 2CFMA 1PH2A 1CQVA 4BY1H 3RN2A 2RKSA 1YNJD 3KF8A 2WIIB 3VYRA 2K01A 4YY3Q 3R2TA 2Q2UA 4Y7NH 2L9HA 4DAMA 1EYCA 2YTXA 1QVGA 4XQJA 1L1OC 4C1NI 2EXDA 4OHJA 4B9XA 1X56A 5KGUA 1PH7A 3RR5A 3BVGA 3N52A 2DUDA 4JV5Q 1HZ9A 1JCKB 4BBRG 3C46A 4DV5L 5C44B 1R9TH 1B7YB 3TS0A 3CCMA 2HHHQ 1GOZA 1WTVA 5C4XH 2EPBA 1UAPA 4CDCC 3M9BA 2JA8B 3KK7A 4IUPA 4JW0A 4ZRZA 4CHTB 4HJ7A 5KEEA 1PZID 2QKIC 1W6JA 1SNOA 4L63B 1A3TA 3I91A 1LYLA 2R7ZB 3UDFA 5M5YB 2RVLA 2D9UA 2MPMA 2WP8J 3NUCA 3S1RB 3OIPA 4KTAA 4DR7Q 2QDBA 2A69C 2UXDL 2PMZE 2IW3A 4JI5Q 4NP5A 1RIPA 2JA6G 3BDLA 3PO3H 4Y52H 2KVMA 1HR0Q 1QB5D 1EZ6A 4IJHA 4LF7Q 2K4KA 3CMEA 3HOZG 1ET6A 1UWVA 2O2LD 5IGCA 4B3RQ 1K8OA 2HQLA 2KCTA 3MHBA 1HCZA 2DNEA 4DV0L 1EFID 1SMYC 5E4XA 3PIP3 1C48A 3S1NH 4KHPL 1D5XC 2KQ3A 2NWGA 3CF5A 1IYVA 4DPGA 1Y1VB 2JXMB 1PFBA 2TSSA 4GKJL 4I7ZC 1SNMA 2JEBI 4N8FA 4N8X1 1B9NA 3DMUA 1RJTA 4OXPA 1KIXA 4B9WA 1EY8A 3W5OA 2L1BA 2Z9HA 1D2BA 2EYPA 3IFTA 2JA7B 1UUPA 3FDTA 3HKZG 3PGZA 1LM0A 3S1MB 3E0JA 5ELOA 3PUVA 3CCRA 3S17B 5C3XA 5C4JB 1VQ4A 3AU7A 1PTOH 3M4OH 4IUTA 4JG2A 4JI6Q 3HOUB 4NW2A 4JI1L 4Q5VA 1AZPA 3M4YA 1ESRA 1I4QA 1OXUA 4LK1C 3K5MA 1K8GA 3AFQA 3VA5A 2UUCQ 5IYBH 1IXRA 2F4IA 2IX3A 1XXGA 4BBRB 4DV3Q 4APVA 1CI3M 4KK7A 3D31A 3AFPA 2EQSA 1L0YB 5I4DA 1V43A 3GD7A 4O0AA 2MO0A 1XMQQ 2O5JC 1LO5D 2RDHA 1RHPA 3D4DA 1B53A 4HSVA 2K5DA 5C0XI 3W1GA 5M3FB 4KMUC 4A3FB 3CMAA 2KA7A 4CDEC 2UUAL 4AQYQ 4DK0A 2HIXA 1PTOF 5EGTA 3KOJA 3BG3A 1O80A 3QJYA 2A6ED 4F7XA 4X62Q 2KENA 4K5VA 1TXYA 2K28A 1B3AA 2EY5A 2JA6B 4DV1L 2EE1A 4UHVA 3GTGB 4C3JG 3EIVA 2WB1G 4C2MB 2L12A 5C3WA 1AN8A 5D14A 1WTXA 1A6XA 4KKUA 3MXGA 5A2QE 4A93G 2EXZA 4A3MB 4L5SA 3LWEA 3CCEA 2F1MA 1UE7A 4U673 2ZJRA 1V1PA 1QNUA 1DOLA 1STBA 5FKAC 4LFCL 1MSHA 3L2PA 1HA6A 3R3OA 2A74C 2KJXA 2N49A 2Z8LA 4B08A 3MXNB 3T13A 5LL6S 4IJLA 1PZJD 3BVMA 3UDXA 2L15A 1YJ9A 2A5HA 1DJRD 1Q90A 1IBKQ 2B3GA 1I4HA 5ELDA 1EQRA 2R92B 1ENCA 1EQVA 2VL6A 4B3TQ 2QILA 2FMCA 3HKZB 2VW9A 1K0SA 1BCPB 4LWCA 3TS2A 4IOAA 5M3MB 3RN5A 3GTPH 1EY4A 4R4OA 2E2JB 3P75A 2VY3A 1G6ZA 2K03A 4K14A 2D0PA 2Y0SE 3ULLA 1JOOA 1B8AA 4X3TA 3RUZA 3HRZC 4EVOA 2E2IH 2KHSA 4QQBX 1EOTA 2B2YC 4NDXA 3MVVA 1KDCA 2R7DA 3OYYA 5ELCA 3SK4A 1MHWC 3G71A 1AFPA 3HOZH 2ZM6Q 3HOVG 2P5ZX 1NMFA 3BZCA 1IKLA 2PPBC 4DR5L 3M4PA 4JYAL 5LMNQ 4BBSG 3NENA 4GOPA 3NP8A 3K6OA 1E22A 2K7VA 3OW2A 4A3CG 1WTRA 2VB2X 1TS5A 5GROA 3ICEA 3M7GA 3NWTA 4AYBE 4Z9CB 1LT4D 2B2YA 3OOCA 2AQ2B 4HIDA 2V1CC 1AH9A 1QE6A 5JEAJ 1Y1WH 1CA5A 2EYOA 4PMBA 2BCOA 2C9OA 1TWAB 4JC0A 4C3JB 1IBLQ 2L55A 2JJQA 4LAAA 2BOSA 4GN5A 4A3LG 1JE5A 1BCPD 1XPUA 2EY1A 4A3DH 1E2ZA 1Z47A 4HN7A 2DY8A 1KC8C 4IUVA 1VF5C 2R6GA 4NKLA 2ZTDA 1SSOA 2BH2A 1I4PA 3VDYA 1TKWB 1W3SA 1H9JA 4FNFA 1EZ8A 5EPLA 5IWAL 3NELA 2LXJA 4QCLA 1S5CD 2K5VA 3RNUA 2PQAB 2SNMA 5KYLA 4GNXB 3I56A 4O1NA 1CQFA 1P8LA 1LTSD 1K83B 1E1TA 3H0GG 2I46A 4JOIA 1S3OA 4YWMA 1SBBB 3HG9A 5LL6X 4HSPA 3V2TA 4DUZL 4DR2Q 1Q3LA 1N36L 2XNAC 3PO2B 4BY7G 1N9WA 3J7ZC 4IFDI 2VZAA 4UP7A 3LGJA 1E2VA 1XNQL 1ZYRC 5IT9L 1A8VA 2NB0A 2EJGC 3Q0AA 2XRQD 4DV7L 4J1MA 4JBMA 4NXMQ 4P74A 3K7AH 3STBC 2NVQB 1KXLA 1MJCA 3HZXA 2NN6I 1JJCB 4CKCA 3M3YB 2JYOA 5EAYA 2SNSA 3CQZH 1QNKA 2K14A 1EQQA 1PXUA 3HOVB 3VYSA 1KRTA 4NXNL 4LFAL 4A93H 3H91A 1K73C 3O13A 1HHVA 2Q2IA 2MNAA 3DUZA 2KUMA 2LFNA 4TSSA 4GKKL 2ZXOA 4BBSB 3HOWB 1I50H 3D4RA 1RTNA 1Y69U 3B6YA 1JC7A 4J15A 1X3FA 1LT6D 1E2WA 1P16A 3TMEA 3BYYB 4KJNA 2A1AA 2G5DA 3E0EA 3EJIA 3KLRA 1VQPA 2JN4A 5CMDA 4IOCA 1H9RA 3FPUB 2EY2A 4X65L 1NTGA 4XXEA 3CU7A 1F9QA 1ICFB 1S5BD 2VUMH 2RHSB 2CKZB 1PH8A 4GLAC 3E9IA 1JR0D 2EDGA 3MC0B 2A68D 3U4ZA 2K1BA 4LFBL 4JI0Q 5DLQE 2OTJA 2EVBA 2N88A 3BVZA 4WJ3M 4LUOA 5BN4A 1EIYB 1ZKOA 3J80L 1F9SA 3KLWA 3S9WA 4DV5Q 3GO5A 4FF3A 4HJ8A 1EY9A 3I72A 2PW7A 2OTLA 2A6HC 3I73A 2L5TA 3U4VA 3UE1A 4EQNA 2CHBD 1FD7D 1GD7A 4TKOB 2OQKA 1IHZA 4K8JA 1QUQB 4ME3A 2B8GA 1IYUA 2N55A 1N32L 2RDFA 4TRDA 3GTJH 2AWNA 1WTOA 1AE2A 2N8NA 2QW7A 1Q81C 1VQ9A 3VR3A 1PYBA 4BY7B 2WB1E 2KBNA 2NYZD 4FF1A 2AUKA 3A8KE 1PHJA 2JP1A 4A4IA 5FK9C 2MQHA 5TSSA 3AQQA 1C4QA 2OXPA 3J81L 4G7OC 3KYHC 4C3IG 1X9NA 1T5EA 4QIWB 1FVIA 4A3KG 5IGEA 4DV0Q 4A3LH 1AEXA 5D65A 2JEAI 4B3ML 1TWGH 3CCVA 3KF8B 4RHRA 3RZDB 4KHPQ 2B2TC 4GN4B 3A7LA 1GJXA 1B1ZA 4QUFA 3S2DB 4WFN3 1GUSA 1GUOA 3HOYB 3D0FA 4IFDG 4MTKA 5K36G 4GKJQ 4B3SL 5E7NA 3NE5B 1SXTA 4CDDC 4K8IA 2I07B 1YITA 2H5XA 3I7FA 4X66L 2DNCA 2AQ3B 2JK8A 2JE6I 4LJZC 2EIFA 4IPDA 5FLMG 3A74A 4GZYC 4G4KA 2NN6G 1CSPA 1S5DD 1XX8A 5HGTA 1VQ5A 4FXGC 2B2TA 2MUYA 1X65A 3W1BA 5D3IB 1EYDA 2HDLA 5I2YA 3D6CA 2CQAA 3H0GH 2F0SA 2LMCB 1SFOH 2ZJQA 1VQGA 4ALPA 1M8AA 4JI1Q 2JA8G 4RFBA 1HNZL 3UE0A 1IBML 5F2DA 3TP5A 2NBFA 5M5WB 5CV5A 3G6JB 3VR5A 4BS9A 3SGIA 4P73A 2XSCA 3OMGA 3NTKA 1RF2D 1ILPA 2R7ZG 3OWFA 1BUVT 2M2LA 4A3GH 1KQSA 4PMWA 3F2CA 4DAPA 4WJ4A 1VF7A 2L0CA 2NVTH 1O7IA 1HZBA 4ZCKA 3GDEA 1CKOA 2C35B 2PQEA 3G6EA 3I70A 4XT3B 5DM73 2GVBA 2CVRA 2PNHA 3I4NB 1U9RA 3S2HB 1PRTB 2UXCL 4DV1Q 1DOMA 1EWHA 3F1ZA 4RKLA 1J9OA 1YHAA 5IYDG 3V05A 4HJAA 1CHPD 1Y1VG 1N34L 3UI2A 4R1JA 1JWMD 2EZVA 1VQNA 3T53B 1JWSD 3TP8A 4X3UA 2B2VC 2NVYB 3F2BA 4A3KB 3MA2B 1TWHH 4ZUIA 1A63A 3T56B 3LWUA 4CDFC 4JI3L 1JJGA 3GTQB 4R4CA 1S4ZA 4DR4L 1JOQA 4WRDA 2F0FA 3TZDA 4X6AH 4DR3L 2YU9B 3GTOH 2L11A 3Q8DA 3HOUG 3I4MB 1TWCH 3PO3B 1KABA 4ABNA 2A8VA 5HY6A 2B2VA 4FYDA 4RGMA 2M9VA 4XYQA 4JI8L 2KOLA 5EQ0A 3H15A 2JA5B 1EY5A 3PUYA 1TT2A 4MIUA 1F2MA 5T1IA 3JAML 3W2DA 4KLKA 3FEWX 3KLSX 4JBKA 3H3VC 4KY5A 4ZK9B 2PI2E 1PRTD 1I3QB 3OIQA 5M3FG 1SNQA 4DNRB 5I9OA 4A3FG 1L1OA 1UEBA 3WOEA 3WOFA 4WORA 2AQ1B 1LT3D 1TQOA 1YNJC 1BBWA 4MTNA 5C3EH 2YYZA 2XWBB 5BN3A 4HMIA 4C3IH 4HEDA 1PYSB 3GP7A 4DR5Q 1ENAA 3C1EA 4JYAQ 2IL8A 4FO2A 3I4OA 2VQFL 1HUNA 4UPAA 2F4VL 3LNNA 2NVXH 5FO7B 2IX1A 4IZ8A 4IFDH 4CKBA 4XT1B 3CC4A 5K36H 1BBXC 4JI4L 3TQYA 2WKDA 4A3MG 2EYMA 1N8RC 3S1QB 2M00A 2SDFA 5FLMH 5HGQA 2AWOA 2NN6H 4DV4Q 2N3SA 1SE3A 3EA6A 2VS1A 1STAA 4N9TA 2MO1A 5KNDA 4UY8C 1L0WA 1H9MA 4E6IA 5C44H 2UXBL 2CWPA 5JJKA 3D4WA 3Q23A 2RSNA 1Q82C 2R92G 2JA8H 4LUVA 1YNXA 2E74C 3ULJA 5AJ3L 3RMHA 5IWAQ 5M3MG 4P75A 1NAPA 1TS2A 5GAGC 2R7ZH 2EYJA 4DA2A 5M5YH 4X3KA 1FGUA 3S1RH 2X69A 4FDBA 1LTBD 2R61A 4DV6L 3K59A 4FXDA 4JI7L 1KRSA 3FKIB 2F0NA 1IL8A 4DUZQ 2QCPX 1N36Q 4JVZA 2Q8TA 1Q8IA 4GOPB 2PO4A 1CM9A 2ICIA 1XNQQ 4ZYSA 3UDIA 3S15B 2EYLA 3OW7A 5IT9c 4OX9L 2VQEL 4A3JH 4DV7Q 2F3VA 4HR7B 5KRUA 1Q12A 1YJWA 5I6YA 1MI2A 3EVQA 3PUXA 4M8AA 1N33L 1Y1VH 1M4VA 2LY7A 1H9SB 2D5DA 1PTOC 4LFAQ 4NXNQ 2XGTA 1C7YA 1WCMB 1E0BA 4ILWA 3HS0C 4KY6A 1ML0D 4GKKQ 3FVQA 1PFNA 2MJ8A 2D2CC 4I7AA 2JA7H 4ULLA 4MNOA 1AE3A 3K5NA 3FHWA 3GTPB 3S1MH 4FF2A 3CC2A 3S17H 3CPWA 5C4JH 4R8NA 5JJIA 3NXWA 4NMZA 1EY7A 1X3GA 4X65Q 1NY4A 1VQOA 2E8GA 1LV9A 1MGSA 1GUNA 1VQAA 3HOUH 1D8LA 4OWWB 1XMOL 4QJFA 3PUZA 4F87A 4HIKA 1WTWA 1HZAA 1BXTA 4TQUS 2ATWA 1DONA 4C3HB 1I6HB 5EBDA 1BKBA 3D3RA 4BBRH 4LFBQ 5KNCA 1SE8A 4YCWA 4LUZA 2ICEC 1VQEA 2A6EC 2H1EA 2HCIA 3N6RA 1GHKA 1Y8NB 1HJPA 3J80c 3M85A 2FXQA 5JJLA 1Q8KA 1VQJA 2Z6BA 5M3FH 2Z6KC 4A3FH 4RGTA 4CBVA 3S16B 1VMPA 3PO2G 4PQXA 3CCUA 3TDQA 1AP0A 1FL0A 4YIJA 1BOSA 1TWFB 2CQOA 1D6EC 1F2YA 4O42A 3SHLA 4YWLA 1FJGL 1HFNA 2V4DA 4KN7C 1U4RA 1MJEA 4RMFA 1YHQA 1II3A 2WAQB 1ET9A 3F2UA 2JA6H 1YJNA 3K8AA 3GTGH 1N32Q 2WV6D 4H02A 3R2IA 4JV5L 1R4QB 2FFKB 4C2MH 5E3FA 1XJVA 4DNTB 1VQDA 5C5MA 1SNPA 4H7BA 1YNND 4KKSA 5K5PA 2IX0A 1PH5A 4HJ5A 2Z6KA 4KKTA 5A35A 1SNCA 5JVG3 3S14B 4A3MH 2IWHA 5JPMC 3G48A 4BWGB 1LTTD 3HOWG 3KF6B 4JBJA 4TVAB 1YVCA 3OHXC 1C9OA 4MN3A 1OXXK 2K33A 1LLRD 5EKIA 3J81c 1B9MA 2QEJC 4YCVA 1EWIA 1GM5A 1O7LA 4B3MQ 1QILA 2B2WC 1GUWA 3PV0A 1A15A 3K57A 2F0UA 2OT2A 2PNRC 1LUZA 2F0KA 4DR7L 1XTDA 5CORA 3TP7A 3A5ZB 4B3SQ 2R92H 4PZ6A 5LHY1 5CGKA 3HP3A 4A75A 1XTCD 5C0XG 2OQ0A 3AYHB 4XQQA 5M3MH 3CCJA 1C0AA 3A5UA 3Q22A 2E2JH 1SJED 1Y8PB 5IGFA 2LXKA 4LF9L 4L6TB 3IKJA 1KDBA 3KDFB 1CKNA 1K9MC 2RQXA 1J5EL 1IZ6A 4X64L 3PIPA 2B2WA 4GS3A 1WTQA 4J8QA 2UU9Q 5GQOA 2RA4A 4POGA 5M5XB 1A3UA 3I8ZA 5E4WC 1LTLA 5EBCA 2BE5D 4J6HA 1SN8A 1KAAA 1E7ZA 1HNZQ 4DR1L 3K0YA 1ASZA 2F3WA 1IBMQ 3X3NA 2RF4A 1YBYA 3HOXB 4QF4A 2CH4W 4OEMB 1IW7D 2I5LX 3TN2A 3SE0A 3L9AX 1QVFA 3HKSA 4KN4C 1B4OA 3C3LA 3F8TA 3DM3A 5J22A 1DOKA 1OXVA 4RG1A 2K5QA 3BYTB 1TY2A 1BCPF 1MKHA 3W3AA 3I2ZA 4XTCS 4O2DA 1BCPC 1GHJA 1QWYA 3V96A 3RZOB 1NBWA 3NQTA 5L37A 3MEFA 4RKBA 5FLXL 3GQBA 3X3MA 1MSGA 1A2TA 2OWOA 1JWUD 1PV4A 4C1NK 2A73B 3PIO3 1D1IA 3MXNA 1TWAH 4C3JH
chains in the Genus database with same CATH topology
1F9PA 2RBMA 2R3ZA 1SAPA 1O7YA 5C4HA 4CJ2C 4A3EB 1X32A 4IURA 5C6AA 4XQNA 2Z4HA 2IPKD 3NBIA 4F8MA 5CC4A 4OIJA 1CK1A 1STYA 1HRJA 1BNZA 5DM63 5EPKA 5E1FA 5KNBA 4HMJA 4UDUC 4CKEA 2RSOA 2C5CA 3KBXA 2G9HD 3EFXD 1I4RA 1HQRD 3DHQA 2BA0A 4DAYA 2BDOA 1OXSC 2HDMA 3GTKB 4IALA 2E2HB 5J39A 4HCSA 5CYUA 5IT9E 4V190 5FOBB 1BR9A 1MD2D 1A2UA 3L3OC 4ODGA 4A3BB 1TIID 2F0EA 3MTSA 4F88A 1DZ1A 5C5LA 2MGSA 3MAQA 5CBEE 3ZYYX 1TWGB 1NSNS 4KJOA 3SR1A 3L7ZC 4A3IB 2R93B 1CTMA 4X3SA 5FO8B 1GUGA 3NBHA 2X6LA 2A68C 2F0HA 2F0OA 1SYEA 2XRSD 4K2LA 1U4PA 2O4XA 3WDNA 1CHQD 2FINB 2IJ0A 5BN5A 1SYFA 1O78A 3I4LA 3MEHA 1RCVD 3KBGA 5C0XH 4ZAIA 3GTMB 2Z1CA 5CBAE 4R9WA 3NSWA 3G7LA 2XN9C 5CV8A 4I65A 3J80E 2F03A 2D62A 1FR3A 1I4XA 4CGYB 3TBIB 2F0PA 1Z6HA 1KDAA 1WD0A 2VXWA 3GV6A 3BZDB 1I6VC 2EJMA 2B8FA 3ITPA 1DM0B 1H9KA 1EYAA 2PMZB 1VMCA 1X3PA 4BA2I 3OPOA 4ZKBB 3E6ZX 4KHZA 3NWSA 2XIWA 3HEJA 3A8JE 3ERQA 3T16A 2CW0D 1GXDC 1JE4A 3D6WA 3J7AF 2K6AA 2B63B 3J81E 4CJ0B 1A3VA 1D5ZC 3TSSA 3GTLB 1S5ED 5IOCA 1ZXTA 5ELFA 1LACA 5IIFA 4BY1B 4H0LC 1F2ZA 2E2DC 3BDOA 4XIGS 1ESFA 3H09A 4Y7NB 5COYA 4U68A 1G2SA 1K8MA 4K5WA 1SE4A 2HCCA 3Q6SA 1SEBD 3A7AB 3K5LA 1SJHD 2F0VA 1G91A 1R9TB 3SK8A 4HTHA 1FNUA 4L8JA 3MXPA 5C4XB 1X3QA 1PFMA 2WACA 5FO9B 3PMFA 5CV6A 4OO1I 4LMQD 4IUUA 1ENFA 4IQZA 4FXKC 1Z7TA 5G3LD 2KCNA 5DAUA 2KCCA 4RGOS 1W6KA 3ONAB 3E5SA 5JEAG 1FGBD 3KUPA 2PW5A 1U4LA 2F0WA 5CV4A 3ND9A 3QIAA 2F0JA 3FRPB 4K6LA 5DNFA 3IFDA 4OIKA 2DN8A 2A69D 3SEBA 3H94A 3S1NB 1PYWD 3NTIA 4OGQC 4IN3A 1TU2B 1QCBD 1VDZA 4P2CB 3M7NA 1EL0A 5G3LF 2WKCA 2DY7A 5EKKA 1MBYA 3URYA 1SMYD 1V1OA 5ISRA 1BDOA 1BQQT 2J0TD 1V1PB 2BA1A 1PTOB 3M4OB 3QOLA 2E76C 1LABA 1WVLA 3VR2A 1SYBA 1PRTF 5IODA 2Q8IB 3DWQA 3GV3A 2ENBA 1PRTC 1ZEQX 1EIGA 3OSOA 1DCZA 4C3HG 1D1IA 2AUJD 5C4ZA 2Y0SB 2K5WA 1LTAD 5CV7A 1NUCA 3JAME 4ZQ3A 1EU3A 4A3JB 5EPJA 5EJWA 3DXJC 1HTLD 2F0TA 3EROA 1HUMA 1BO0A 3A55A 2OEOA 4PNYA 2FHTA 4H44C 4G7HC 4RHSA 3SK5A 2EJFC 4OO1G 2MP1A 3QWNA 4AYBB 5ELEA 2LKVA 5A2QL 3CKIB 3MXUA 1PTOD 2F0MA 5D3DA 1U4MA 2F0GA 2NZ1D 2HUGA 4XDXA 3LX0A 3SVMA 1WD1A 1JB3A 1SYDA 5KYIA 2JSOA 3IL8A 2B39A 4DN4M 4JK1C 3NTHA 1FNVA 4ZLTF 4EQPA 1PMRA 1STNA 4DK1A 4ME5A 4ID6A 4QUCA 4IFDJ 3H6MA 4PMCA 1HFGA 3VR6A 2LS01 3C1FA 3J7AV 1F2LA 1B2TA 5JEAH 2VNUD 2E2IB 2F0LA 3R8BA 1EEID 1RTOA 3HOZB 3QO2A 1HA5A 5IGDA 3C2PA 2G9DA 3TZUA 4KV6A 4KI0A 1HPCA 3MFGA 1Q1EA 1G291 3U9SA 3RD4A 1B50A 4DGZA 3AMUA 1G8ZD 1FYCA 3BDCA 1Y1WB 1QG7A 2KEEA 3K58A 4G57A 4FP5D 1CZWA 1JOKA 2EY6A 4A3DB 3VR4A 4RCNA 2PZWA 3P20A 1KLUD 4HCEA 5DEHA 2XWJB 1KTKA 2FJ2A 2ZXPA 4FF4A 2SEBD 5EKLA 1CFMA 3FMCA 4K2KA 3Q24A 1OO9B 1KNEA 4DAVA 1UEAB 1FNWA 3DEOA 1LTID 1YNNC 1NR4A 1KNAA 5I9PA 2F0IA 3I3CA 1STHA 1ICWA 1T5XD 3K7AB 1H9SA 3OWEB 4OO1H 2WB1B 4KD4A 1KLGD 3CQZB 1ONLA 1QJOA 1SNDA 4A93B 3CRKC 1ZYRD 1PDQA 3MFYA 1JORA 1TY0A 1I50B 2FMMA 3DWPA 1LTGD 3K5OA 2WINB 1BF4A 1NCVA 3QB3A 1XWEA 2NTTA 2PZTA 3ND8A 1SYCA 2PZUA 1OXTA 3PUWA 3T4AC 3A54A 1S5FD 1TVXA 2J7ZA 2VUMB 1EIHA 1UNSA 2BE5C 2J4XA 1C8CA 1RKNA 4UAIA 4QB4A 5HURA 1L0XB 4XYOA 2B2UC 2TMPA 3MWYW 1IW7C 2MHVA 3CHBD 3NK9A 4M1UB 1DXMA 1SYGA 1SDFA 4CJ1B 3OMCA 3SK6A 4V0BA 1D5MC 4PV1C 1RDPD 1EY6A 3GTJB 2B2UA 4DXFA 1ILQA 3U9OA 1AZQA 4RWSC 2ZXRA 2NTSA 1RODA 2HQEA 5JPNC 3DEPA 2A6HD 3IAYA 5JJZA 3HGBA 1EY0A 4ZUJA 5JAVA 2KECA 4DXGA 1O7ZA 1CZGA 2K32A 3SXHA 2KEDA 5FLXE 4DU9A 4G7ZC 1DYQA 1EQTA 2ID0A 1TR5A 3EQLC 1J8IA 3TP6A 3VA7A 2O5IC 5KIXA 5IGBA 2NUCA 3FPPA 2BDNA 3J7YW 1WTPA 1D1KA 2IT1A 3KLSA 4EGVA 5JVH3 1HTPA 4IUQA 2H4OA 3QG1A 1GUTA 2VB3X 4HAEA 3VYTA 1R4PB 2OF1A 3I90A 1QOHA 3D8GA 5CR3A 4MHEA 1LTRD 2Q8RE 1G2TA 2QF7A 2GA4B 1PLFA 3H0GB 4OL7A 1SFOB 1B44D 4RH6A 4N9PA 4DFAA 1EU4A 5ELBA 4RGNA 4K5XA 4K6DA 2L4NA 4FVMA 3T51B 4A3GB 5T1GA 1NR2A 4R8IA 1CT1D 2X6GA 4ZKCB 1DD2A 2RDGA 2NVTB 1HQMC 4KY7A 3A8IE 4Q0FA 3RLFA 5JOBA 4C56C 5NUCA 1XYIA 3R93A 1VCIA 5J1ZA 3NQIA 1IKMA 3MZ5A 3BS1A 2K04A 1CA6A 4IUNA 2EYFA 1PZKD 3NHHA 5I6WA 3AB9A 4KD3A 4QMGA 4RCOA 3SDZA 3CRLC 1I4GA 1JQYD 5AFWA 1EWCA 1TWHB 3NPPA 1EEFD 1F77A 1LT5D 4H13C 3QOJA 1AW7A 1STGA 3DWAA 4RAUC 1HXYD 4JBWA 2EYHA 3GTOB 1TWCB 1RD9D 4RA8A 3DM1A 4EQOA 4S3SA 4WJWA 2PCFB 1TS4A 5M9OA 2F0QA 2CW0C 2Z4IA 2EOTA 4BA1I 5I2XA 2SOBA 5CV9A 5C0XJ 3P1HA 1Y8OB 2F0DA 1F9RA 4DF7A 2PYKA 5IGGA 1TS3A 1SE2A 1Q1BA 3A56A 1V8QA 2ZT9C 5C3EB 1STEA 3VYUA 2E75C 4C3IB 4KHVA 2NVXB 3P7JA 2XVSA 2K05A 1JICA 1CQVA 2RKSA 1YNJD 3KF8A 2WIIB 3VYRA 2K01A 3R2TA 2L9HA 1EYCA 4XQJA 4C1NI 4OHJA 4B9XA 5KGUA 3BVGA 3N52A 1JCKB 3C46A 5C44B 1GOZA 1WTVA 2EPBA 1UAPA 2JA8B 3KK7A 4IUPA 4CHTB 4ZRZA 5KEEA 1PZID 2QKIC 1W6JA 1SNOA 4L63B 1A3TA 3I91A 2R7ZB 5M5YB 2RVLA 2D9UA 2MPMA 2WP8J 3NUCA 3S1RB 3OIPA 4KTAA 2QDBA 2A69C 2IW3A 4NP5A 3BDLA 2KVMA 1QB5D 1EZ6A 1ET6A 2O2LD 5IGCA 1K8OA 3MHBA 1HCZA 2DNEA 1EFID 1SMYC 5E4XA 3PIP3 1C48A 1D5XC 2KQ3A 2NWGA 1IYVA 1Y1VB 2JXMB 1PFBA 2TSSA 4I7ZC 1SNMA 2JEBI 1B9NA 3DMUA 1RJTA 4B9WA 1EY8A 2L1BA 1D2BA 2EYPA 3IFTA 2JA7B 1UUPA 3FDTA 3S1MB 3E0JA 3PUVA 3S17B 5C3XA 5C4JB 3AU7A 1PTOH 4IUTA 3HOUB 4NW2A 4Q5VA 1AZPA 3M4YA 1ESRA 1I4QA 1OXUA 4LK1C 3K5MA 3VA5A 2IX3A 2F4IA 1XXGA 4BBRB 1CI3M 4KK7A 3D31A 1L0YB 5I4DA 1V43A 3GD7A 2O5JC 1LO5D 2RDHA 1RHPA 3D4DA 1B53A 4HSVA 2K5DA 5C0XI 5M3FB 4KMUC 4A3FB 2KA7A 4DK0A 1PTOF 5EGTA 3BG3A 1O80A 3QJYA 2A6ED 4F7XA 4K5VA 2K28A 1B3AA 2EY5A 2JA6B 2EE1A 3GTGB 4C3JG 4C2MB 2L12A 5C3WA 1AN8A 5D14A 1WTXA 1A6XA 4KKUA 3MXGA 5A2QE 2EXZA 4A3MB 3LWEA 2F1MA 4U673 1V1PA 1QNUA 1DOLA 1STBA 5FKAC 1MSHA 1HA6A 3R3OA 2A74C 2KJXA 2Z8LA 4B08A 3T13A 5LL6S 1PZJD 3BVMA 2A5HA 1DJRD 1Q90A 5ELDA 2R92B 1ENCA 1EQVA 2QILA 2FMCA 3HKZB 1BCPB 5M3MB 1EY4A 2E2JB 3P75A 1G6ZA 2K03A 4K14A 1JOOA 4X3TA 3RUZA 3HRZC 4EVOA 2KHSA 1EOTA 2B2YC 4NDXA 3MVVA 1KDCA 5ELCA 3SK4A 1AFPA 1IKLA 2PPBC 3NP8A 3K6OA 2K7VA 1WTRA 2VB2X 1TS5A 3M7GA 3NWTA 4Z9CB 1LT4D 2B2YA 3OOCA 2AQ2B 1QE6A 5JEAJ 1CA5A 2EYOA 4PMBA 2BCOA 2C9OA 1TWAB 4C3JB 2L55A 4LAAA 2BOSA 1BCPD 2EY1A 1E2ZA 1Z47A 4HN7A 2DY8A 4IUVA 1VF5C 2R6GA 4NKLA 1SSOA 1I4PA 1TKWB 1H9JA 4FNFA 1EZ8A 5EPLA 4QCLA 1S5CD 2SNMA 5KYLA 4O1NA 1CQFA 1LTSD 1K83B 2I46A 1SBBB 3HG9A 5LL6X 4HSPA 3V2TA 1Q3LA 2XNAC 3PO2B 4IFDI 1E2VA 1ZYRC 5IT9L 2NB0A 2EJGC 3Q0AA 2XRQD 4J1MA 2NVQB 3HZXA 3M3YB 2NN6I 4CKCA 2JYOA 2SNSA 1QNKA 1PXUA 3HOVB 3VYSA 3H91A 3O13A 1HHVA 3DUZA 2KUMA 2LFNA 4TSSA 2ZXOA 4BBSB 3HOWB 3D4RA 1RTNA 1Y69U 1JC7A 1LT6D 1E2WA 3TMEA 3BYYB 4KJNA 3EJIA 3KLRA 5CMDA 1H9RA 3FPUB 2EY2A 4XXEA 3CU7A 1F9QA 1S5BD 3MC0B 1JR0D 2EDGA 2A68D 2K1BA 2EVBA 2N88A 3BVZA 5BN4A 1ZKOA 3J80L 1F9SA 3S9WA 3GO5A 4FF3A 1EY9A 3I72A 2PW7A 2A6HC 3I73A 2L5TA 4EQNA 2CHBD 1FD7D 4TKOB 1IHZA 4K8JA 2B8GA 1IYUA 2N55A 2RDFA 4TRDA 2AWNA 1WTOA 3VR3A 4BY7B 2NYZD 4FF1A 2AUKA 3A8KE 2JP1A 5FK9C 5TSSA 1C4QA 2OXPA 3J81L 4G7OC 4C3IG 1T5EA 4QIWB 5IGEA 1AEXA 5D65A 2JEAI 3RZDB 4RHRA 2B2TC 3A7LA 1GJXA 1B1ZA 4QUFA 3S2DB 4WFN3 1GUSA 1GUOA 3HOYB 4IFDG 5K36G 3NE5B 1SXTA 4K8IA 2I07B 2DNCA 2AQ3B 2JE6I 4LJZC 4GZYC 4G4KA 2NN6G 1S5DD 1XX8A 5HGTA 4FXGC 2B2TA 2MUYA 5D3IB 1EYDA 2HDLA 5I2YA 3D6CA 2CQAA 2F0SA 2LMCB 1M8AA 4RFBA 5F2DA 3TP5A 2NBFA 5M5WB 5CV5A 3G6JB 3VR5A 4BS9A 2XSCA 3OMGA 3NTKA 1RF2D 1ILPA 3OWFA 1BUVT 2M2LA 4PMWA 4DAPA 1VF7A 2L0CA 2PQEA 3I70A 4XT3B 5DM73 2CVRA 3I4NB 1U9RA 3S2HB 1PRTB 1DOMA 1EWHA 4RKLA 1J9OA 3V05A 1CHPD 3UI2A 1JWMD 2EZVA 3T53B 1JWSD 3TP8A 4X3UA 2B2VC 2NVYB 4A3KB 3MA2B 4ZUIA 3T56B 3LWUA 3GTQB 1S4ZA 1JOQA 4WRDA 2F0FA 3TZDA 2YU9B 2L11A 3I4MB 3PO3B 1KABA 4ABNA 2B2VA 4FYDA 4RGMA 2M9VA 4XYQA 2KOLA 5EQ0A 2JA5B 1EY5A 3PUYA 1TT2A 4MIUA 1F2MA 5T1IA 3JAML 3W2DA 3FEWX 3KLSX 3H3VC 4KY5A 4ZK9B 1PRTD 1I3QB 3OIQA 1SNQA 4DNRB 5I9OA 3WOEA 3WOFA 4WORA 2AQ1B 1LT3D 1TQOA 1YNJC 2YYZA 2XWBB 5BN3A 4HMIA 4HEDA 3GP7A 1ENAA 3C1EA 2IL8A 4FO2A 1HUNA 3LNNA 5FO7B 2IX1A 4IZ8A 4IFDH 4CKBA 4XT1B 5K36H 1BBXC 2WKDA 2EYMA 3S1QB 2M00A 2SDFA 2AWOA 2NN6H 1SE3A 3EA6A 1STAA 4N9TA 5KNDA 1H9MA 4E6IA 3D4WA 3Q23A 2RSNA 2E74C 3RMHA 1NAPA 1TS2A 2EYJA 4DA2A 4X3KA 2X69A 1LTBD 2R61A 3K59A 4FXDA 3FKIB 2F0NA 1IL8A 2QCPX 2Q8TA 1Q8IA 2PO4A 1CM9A 2ICIA 4ZYSA 3S15B 2EYLA 3OW7A 2F3VA 4HR7B 5KRUA 1Q12A 5I6YA 1MI2A 3EVQA 3PUXA 4M8AA 1M4VA 2LY7A 1H9SB 2D5DA 1PTOC 1WCMB 1E0BA 4ILWA 3HS0C 4KY6A 1ML0D 3FVQA 1PFNA 2MJ8A 2D2CC 4ULLA 3K5NA 3GTPB 4FF2A 4R8NA 3NXWA 4NMZA 1EY7A 1LV9A 1MGSA 1GUNA 3PUZA 4F87A 1WTWA 1BXTA 4TQUS 1DONA 4C3HB 1I6HB 5EBDA 3D3RA 5KNCA 2ICEC 2A6EC 2H1EA 2HCIA 3N6RA 1GHKA 1Y8NB 3M85A 4RGTA 4CBVA 3S16B 1VMPA 4PQXA 3TDQA 1AP0A 4YIJA 4O42A 1BOSA 1TWFB 1D6EC 1F2YA 3SHLA 1HFNA 2V4DA 4KN7C 1U4RA 1II3A 2WAQB 1ET9A 3F2UA 2WV6D 3R2IA 1R4QB 2FFKB 5E3FA 4DNTB 5C5MA 1SNPA 4H7BA 1YNND 4KKSA 5K5PA 2IX0A 5A35A 4KKTA 5JVG3 1SNCA 3S14B 2IWHA 5JPMC 4BWGB 1LTTD 3OHXC 4MN3A 1OXXK 2K33A 1LLRD 5EKIA 1B9MA 2QEJC 1O7LA 1QILA 2B2WC 1GUWA 3PV0A 1A15A 3K57A 2F0UA 2OT2A 2PNRC 2F0KA 5CORA 3TP7A 5LHY1 5CGKA 3HP3A 1XTCD 5C0XG 4XQQA 3Q22A 1SJED 1Y8PB 5IGFA 4L6TB 3IKJA 1KDBA 2RQXA 2B2WA 1WTQA 4J8QA 2RA4A 5M5XB 1A3UA 3I8ZA 5E4WC 5EBCA 2BE5D 4J6HA 1KAAA 3K0YA 2F3WA 3X3NA 3HOXB 4QF4A 1IW7D 3TN2A 3SE0A 3L9AX 4KN4C 1B4OA 3C3LA 5J22A 1DOKA 1OXVA 2K5QA 3BYTB 1TY2A 1BCPF 4XTCS 3W3AA 1BCPC 1GHJA 1QWYA 3V96A 3RZOB 3NQTA 4RKBA 5FLXL 3GQBA 1A2TA 1MSGA 1JWUD 4C1NK 2A73B 3PIO3 3X3MA 3MXNA 1I4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMD A;  1F9P A;  1X3Q A;  1PFM A;  2BDN A;  2R3Z A;  3I91 A;  2B2Y A;  2FMM A;  4ZAI A;  2FFK B;  2KOL A;  1SAP A;  2RVL A;  1O7Y A;  1XX8 A;  2D9U A;  2MPM A;  3FPU B;  4RAU C;  1IL8 A;  1QE6 A;  1X32 A;  4IUR A;  5EJW A;  1O80 A;  5EQ0 A;  4LMQ D;  4IUQ A;  1NCV A;  1F9Q A;  4R9W A;  2Q8T A;  5CBA E;  1BF4 A;  1CA5 A;  2B2T A;  4IUU A;  2K28 A;  3G7L A;  1B3A A;  2HDL A;  1CM9 A;  2EE1 A;  1B50 A;  5T1I A;  4HAE A;  4RA8 A;  3DM1 A;  1M8A A;  4OIJ A;  2KVM A;  1HUM A;  2K1B A;  2L12 A;  1HRJ A;  1BO0 A;  3I90 A;  5D14 A;  4MN3 A;  1BNZ A;  4ZK9 B;  1WTX A;  4MHE A;  5EPK A;  2FHT A;  2Q8R E;  1QG7 A;  2EOT A;  2N88 A;  3ONA B;  5EKI A;  1G2T A;  1TVX A;  1PLF A;  2KEE A;  2J7Z A;  3KUP A;  1MI2 A;  2DY8 A;  1U4L A;  4IUV A;  3LWE A;  2RSO A;  1EIH A;  1SSO A;  5EPJ A;  2MP1 A;  1WD0 A;  2B2W C;  3KBX A;  1ILP A;  2VXW A;  1GUW A;  1A15 A;  5E4X A;  3GV6 A;  1F9R A;  1DOL A;  1F9S A;  2M2L A;  1C8C A;  1E0B A;  4HED A;  2NWG A;  4UAI A;  5DNF A;  5EPL A;  5COR A;  1ML0 D;  3IFD A;  1MSH A;  2B2V A;  1HA6 A;  1PFN A;  2B2U C;  2MJ8 A;  2IL8 A;  1HUN A;  4OIK A;  1PFB A;  3MWY W;  3HP3 A;  2HDM A;  1VMC A;  1X3P A;  1U4M A;  2L4N A;  2NZ1 D;  4ZKB B;  2HUG A;  4XDX A;  3SVM A;  5T1G A;  1NR2 A;  1RJT A;  4R8I A;  1WD1 A;  4XT1 B;  2X6G A;  1BBX C;  1SDF A;  4ZKC B;  3IL8 A;  4CJ1 B;  2XIW A;  2N55 A;  4HCS A;  2L1B A;  4XT3 B;  4DN4 M;  2FJ2 A;  1EL0 A;  1LV9 A;  1WTO A;  1JE4 A;  4ZLT F;  1MGS A;  2CVR A;  3D6W A;  3FDT A;  2B2W A;  3P7J A;  2K05 A;  1JIC A;  1WTQ A;  1Q3L A;  2DY7 A;  2RA4 A;  2SDF A;  1DOM A;  3MTS A;  3I8Z A;  4CJ0 B;  1XYI A;  1WTW A;  5E4W C;  1J9O A;  2NYZ D;  1DZ1 A;  2JP1 A;  3R93 A;  1G6Z A;  2K03 A;  2MGS A;  1DON A;  2B2U A;  5CBE E;  1IKM A;  1ILQ A;  2K01 A;  4IUT A;  1ZXT A;  1AZQ A;  3UI2 A;  4QUC A;  4RWS C;  2L9H A;  2K04 A;  1ROD A;  4X3T A;  1KNE A;  4NW2 A;  1AZP A;  3DEP A;  1ESR A;  4X3U A;  4CJ2 C;  2B2V C;  1CA6 A;  1HFG A;  5JJZ A;  1EOT A;  3DEO A;  2B2Y C;  2H1E A;  2HCI A;  3N52 A;  3TN2 A;  1NR4 A;  2KEC A;  2RSN A;  5D65 A;  2JYO A;  4X3S A;  1O7Z A;  1B4O A;  1F2L A;  1KNA A;  2X6L A;  2KED A;  1B2T A;  3I3C A;  5COY A;  1QNK A;  2B2T C;  4U68 A;  1DOK A;  1WVL A;  1G2S A;  1WTP A;  4QUF A;  1ICW A;  3H91 A;  1IKL A;  1HHV A;  1EQT A;  2HCC A;  1VMP A;  2KUM A;  3Q6S A;  3GV3 A;  1WTV A;  1NAP A;  1AP0 A;  1EIG A;  2EPB A;  5AFW A;  4O42 A;  1RTN A;  1RHP A;  1S4Z A;  1B53 A;  4HSV A;  1HFN A;  1U4P A;  4X3K A;  3TZD A;  1MSG A;  1U4R A;  2X69 A;  1RTO A;  2FIN B;  1J8I A;  4IUP A;  3QO2 A;  2L11 A;  1WTR A;  1G91 A;  3F2U A;  1PDQ A; 
#chains in the Genus database with same CATH topology
 1F9P A;  2RBM A;  2R3Z A;  1VS0 A;  1SAP A;  3CCL A;  1O7Y A;  5C4H A;  4CJ2 C;  4A3E B;  1S72 A;  1X32 A;  4IUR A;  4R4T A;  5C6A A;  4XQN A;  2Z4H A;  2UXC Q;  2IPK D;  3NBI A;  4F8M A;  1M1K C;  3HOY G;  1VQB A;  5CC4 A;  3RLO A;  1N34 Q;  4OIJ A;  1CK1 A;  2K52 A;  1STY A;  1HRJ A;  1BNZ A;  5DM6 3;  5EPK A;  5E1F A;  1VQF A;  5KNB A;  1VQK A;  4HMJ A;  4R4I A;  2HT1 A;  4UDU C;  3HKZ E;  4CKE A;  2RSO A;  4YHH L;  2C5C A;  3KBX A;  2G9H D;  3EFX D;  1I4R A;  1HQR D;  3DHQ A;  2I5H A;  2BA0 A;  4AH6 A;  4X62 L;  1WI5 A;  4DAY A;  4JI3 Q;  2BDO A;  2RCF A;  3WWV A;  1K83 H;  1OXS C;  4DR4 Q;  2HDM A;  3GTK B;  4QY7 A;  2YV5 A;  3L0O A;  4IAL A;  3PO2 H;  2E2H B;  5J39 A;  4JI8 Q;  1K28 A;  4HCS A;  5CYU A;  1SR3 A;  5IT9 E;  4V19 0;  5FOB B;  1BR9 A;  1MD2 D;  1A2U A;  3L3O C;  2ALY B;  4ODG A;  1G6P A;  4A3B B;  1TII D;  2F0E A;  3MTS A;  4F88 A;  1DZ1 A;  3ZJY C;  2NVQ H;  3U58 A;  5C5L A;  3JAM c;  2MGS A;  3M3Y H;  3MAQ A;  5CBE E;  3ZYY X;  1TWG B;  5IE8 A;  1PH6 A;  1NSN S;  4KJO A;  3SR1 A;  3HOV H;  3L7Z C;  2XTI A;  5BR8 L;  1HNW L;  4A3I B;  1PH1 A;  2R93 B;  1MIU A;  4BBS H;  4GNX C;  3HOW H;  1CTM A;  4X3S A;  5FO8 B;  1GUG A;  3NBH A;  2X6L A;  1CKM A;  4YWK A;  4A3C H;  3I4N G;  2UXD Q;  2A68 C;  2F0H A;  2VQF Q;  2F0O A;  2F4V Q;  1A0I A;  4LF4 L;  1SYE A;  2XRS D;  4K2L A;  1U4P A;  2O4X A;  3WDN A;  1CSQ A;  1CHQ D;  2FIN B;  1VQ8 A;  2IJ0 A;  1X6O A;  5BN5 A;  3K0X A;  1SYF A;  1O78 A;  4JI4 Q;  3I4L A;  3MEH A;  1M90 C;  2GN5 A;  1RCV D;  3KBG A;  1PH9 A;  2PQA A;  5C0X H;  4ZAI A;  1VQ7 A;  4GNX A;  3GTM B;  2Z1C A;  5CBA E;  3AEV A;  4R9W A;  4MZ9 A;  2DGY A;  4OWT B;  3NSW A;  2QDL A;  3G7L A;  2XN9 C;  5CV8 A;  2Q2H A;  3BZK A;  4I65 A;  3J80 E;  2F03 A;  2UXB Q;  2D62 A;  1FR3 A;  1I4X A;  4CGY B;  3I4M G;  2Z0S A;  3PO3 G;  2QA4 A;  3TBI B;  2F0P A;  3S24 A;  1A62 A;  1Z6H A;  1KDA A;  1SRO A;  1WD0 A;  2JA9 A;  1E24 A;  2VXW A;  3GV6 A;  3CPF A;  5AJ3 Q;  3BZD B;  5GAE C;  2JA5 G;  1I6V C;  1VQH A;  1K0R A;  2EJM A;  2B8F A;  3CW2 C;  3ITP A;  3K80 C;  1DM0 B;  1H9K A;  1EYA A;  2PMZ B;  1VMC A;  1L1O B;  1X3P A;  4BA2 I;  3OPO A;  4ZKB B;  1L2F A;  3E6Z X;  1PH4 A;  4KHZ A;  4DV6 Q;  4BY7 H;  3NWS A;  4JI7 Q;  2XIW A;  3HEJ A;  3A8J E;  3ERQ A;  3T16 A;  2CW0 D;  1GXD C;  1JE4 A;  1WOC A;  3D6W A;  3J7A F;  2K6A A;  2B63 B;  3J81 E;  4CJ0 B;  1A3V A;  1D5Z C;  3UDG A;  1IL2 A;  3TSS A;  4OX9 Q;  3GTL B;  2VQE Q;  1S5E D;  2AHO B;  5IOC A;  4DR6 L;  1QVC A;  1ZXT A;  3U50 C;  3RZD H;  4EX5 A;  5ELF A;  1GO3 E;  1LAC A;  3S2D H;  1HZC A;  4HIO A;  5IIF A;  1N33 Q;  3PF4 A;  4BY1 B;  4H0L C;  1F2Z A;  2UUA Q;  4DUY L;  2E2D C;  1NNX A;  3BDO A;  4XIG S;  2I0Q A;  3QR8 A;  1ESF A;  3H09 A;  4Y7N B;  5COY A;  4U68 A;  1G2S A;  1K8M A;  3E3X A;  4K5W A;  1X55 A;  1SE4 A;  2HCC A;  4JCV E;  3Q6S A;  1SEB D;  4QGU A;  3A7A B;  5IYB G;  2IY5 B;  1EIF A;  3K5L A;  1SJH D;  2F0V A;  4NB3 A;  1V9P A;  1G91 A;  1R9T B;  2N78 A;  3SK8 A;  4HTH A;  1FNU A;  4L8J A;  3MXP A;  1I94 L;  1X3Q A;  1PFM A;  2WAC A;  5FO9 B;  4K0K L;  5C4X B;  1EOV A;  3PQI A;  3PMF A;  5CV6 A;  4OO1 I;  4LMQ D;  4LF8 L;  1QUQ A;  1XMO Q;  4LFC Q;  4PZ8 A;  4IUU A;  1ENF A;  1RL2 A;  5M5W H;  1X3E A;  4L5Q A;  4IQZ A;  5LMU L;  4FXK C;  1Z7T A;  5G3L D;  2KCN A;  4IPC A;  5DAU A;  2KCC A;  4RGO S;  1W6K A;  3IRB A;  3E5S A;  3ONA B;  5JEA G;  1FGB D;  3KUP A;  2PW5 A;  1U4L A;  2F0W A;  5CV4 A;  3ND9 A;  3QIA A;  1VQ6 A;  3FKI G;  2ZTE A;  2F0J A;  3FRP B;  4BXX G;  2PI2 A;  4K6L A;  2ES2 A;  5DNF A;  3IFD A;  4GLV B;  1FJG Q;  4OIK A;  1HNX L;  4R4Q A;  2DN8 A;  2A69 D;  1K8A C;  3SEB A;  3H94 A;  3I4N H;  3S1N B;  1PYW D;  3NTI A;  4JI0 L;  4OGQ C;  3S2H H;  4QIW E;  3TRE A;  4IN3 A;  1TU2 B;  1VQI A;  1QCB D;  1V1Q A;  1VDZ A;  1EFW A;  1NJI C;  4P2C B;  3M7N A;  1EL0 A;  5G3L F;  1UE1 A;  2WKC A;  2DY7 A;  5EKK A;  1MBY A;  3URY A;  1WCM G;  2NVY H;  1SMY D;  1V1O A;  4A3K H;  5ISR A;  1CUK A;  2AMC B;  1BDO A;  1BQQ T;  2J0T D;  2E5L L;  2NZH A;  3OTO L;  1V1P B;  2BA1 A;  1PTO B;  3GTQ H;  2NZO A;  3M4O B;  3QOL A;  4UP9 A;  2E76 C;  1LAB A;  1WVL A;  2YU9 H;  3VR2 A;  5J3B A;  2KHJ A;  3I4M H;  1SYB A;  1VQL A;  2YTV A;  1PRT F;  5IOD A;  2Q8I B;  3DWQ A;  3GV3 A;  2ENB A;  1PRT C;  1ZEQ X;  1EIG A;  3OSO A;  1DCZ A;  4C3H G;  2JA5 H;  2AUJ D;  5C4Z A;  2Y0S B;  1KD1 C;  2A19 A;  2K5W A;  1LTA D;  2KHI A;  5CV7 A;  1KAW A;  4UP8 A;  4LF9 Q;  1Q46 A;  2RHQ B;  1NUC A;  3JAM E;  1J5E Q;  3CD6 A;  4X64 Q;  4ZQ3 A;  1EU3 A;  4A3J B;  5EPJ A;  5EJW A;  4LF5 L;  3DXJ C;  1HTL D;  1I3Q H;  4PG3 A;  1Q7Y C;  2F0T A;  3NEM A;  5IP9 G;  2RCN A;  3ERO A;  4P71 A;  5FJ8 G;  4DR1 Q;  2UUB L;  1HUM A;  3PSI A;  1BO0 A;  3A55 A;  2OEO A;  1J6Q A;  4PNY A;  2FHT A;  1Y1W G;  4H44 C;  2WAQ G;  4G7H C;  4RHS A;  1GKH A;  4OWX B;  1Z9F A;  3SK5 A;  2EJF C;  4OO1 G;  2MP1 A;  3QWN A;  4GN3 B;  4AYB B;  5ELE A;  1W2B A;  1E3P A;  2LKV A;  5A2Q L;  3CKI B;  4A3D G;  3MXU A;  1PTO D;  2F0M A;  3BJU A;  5D3D A;  3S1Q H;  1U4M A;  5FLX c;  2F0G A;  2NZ1 D;  2K75 A;  2HUG A;  4XDX A;  3LX0 A;  3SVM A;  1YIJ A;  1WD1 A;  1SMX A;  5IP7 G;  3T1Y L;  1JB3 A;  3FP9 A;  1SYD A;  5KYI A;  2JSO A;  3IL8 A;  4OON A;  5H1S E;  5IYD H;  2B39 A;  4DN4 M;  1KL9 A;  4JK1 C;  1NE3 A;  3NTH A;  1PH3 A;  1FNV A;  4ZLT F;  1XPO A;  4EQP A;  1OTC A;  3T1H L;  1PMR A;  1STN A;  5GAH C;  4DK1 A;  4ME5 A;  4ID6 A;  4QUC A;  1CKN B;  4DV2 L;  4IFD J;  3H6M A;  4PMC A;  2LSS A;  1HFG A;  1HH2 P;  3VR6 A;  2GVA A;  2LS0 1;  3C1F A;  3CP0 A;  4YHH Q;  3J7A V;  3PF5 A;  3KJP A;  1F2L A;  1B2T A;  3J80 i;  1XPR A;  1WJJ A;  1VQM A;  5JEA H;  4L5R C;  4DKA C;  2VNU D;  2E2I B;  2F0L A;  2K5H A;  1G51 A;  3CCQ A;  3R8B A;  1XNR L;  3FKI H;  4BXX H;  4JI2 L;  1EEI D;  1RTO A;  3HOZ B;  4LF6 L;  3QO2 A;  1HA5 A;  3HOX G;  5IGD A;  3C2P A;  2I5M X;  2G9D A;  3S15 H;  3TZU A;  1WTH A;  3TRZ A;  4KV6 A;  4KI0 A;  1HPC A;  3MFG A;  1Q1E A;  1G29 1;  3CXC A;  3U9S A;  5IYC G;  3RD4 A;  3PCO B;  1B50 A;  4DGZ A;  3AMU A;  1G8Z D;  2B29 A;  1E1O A;  1FYC A;  2KCM A;  4YY3 L;  5BR8 Q;  1HNW Q;  3BDC A;  1Y1W B;  1Y14 B;  1WCM H;  1QG7 A;  3M4Q A;  3J81 i;  2KEE A;  2VUM G;  3K58 A;  4G57 A;  1WYD A;  1T9H A;  3E9H A;  4A3E G;  4FP5 D;  1CZW A;  1JOK A;  2EY6 A;  4A3D B;  3VR4 A;  2HHH L;  4LF4 Q;  4GOP C;  4RCN A;  2PZW A;  2R7F A;  1NMG A;  3P20 A;  1KLU D;  3I55 A;  1ASY A;  1UE6 A;  2MFI A;  4HCE A;  5DEH A;  1GVP A;  2XWJ B;  1QZG A;  1KTK A;  4DAY B;  1JB7 A;  4C3H H;  1I6H H;  2FJ2 A;  2ZXP A;  1KHI A;  3ERS X;  4FF4 A;  2SEB D;  2QEX A;  5EKL A;  4DK6 C;  4YCU A;  1PVO A;  3CCS A;  1CFM A;  2CH4 A;  3FMC A;  4OEL B;  4K2K A;  3KJO A;  3Q24 A;  4JI5 L;  1OO9 B;  3H3V I;  1HR0 L;  4X66 Q;  1KNE A;  5IY0 A;  4LF7 L;  4DAV A;  5IP9 H;  2HD3 A;  2K50 A;  1UEA B;  3S16 H;  4LW1 A;  1FNW A;  1SLJ A;  1K3R A;  3DEO A;  1LTI D;  1YNN C;  5FJ8 H;  4B3R L;  1NR4 A;  1TWF H;  1KNA A;  5I9P A;  4DNI A;  2F0I A;  3I3C A;  1QZH A;  1IYJ B;  1B70 B;  1STH A;  1ICW A;  4A3B G;  1T5X D;  4DV4 L;  3K7A B;  1H9S A;  4IO9 A;  3OWE B;  4OO1 H;  4PZ7 A;  4JPB W;  2WB1 B;  2YTY A;  2HIV A;  4KD4 A;  1KLG D;  3CQZ B;  1ONL A;  3J81 j;  3NBH B;  1QJO A;  1SND A;  4A93 B;  3CRK C;  1ZYR D;  4JOI C;  3S14 H;  4A3I G;  1PDQ A;  3MFY A;  1JOR A;  1TY0 A;  2R93 G;  1I50 B;  2FMM A;  3DWP A;  1LTG D;  3K5O A;  4AIM A;  2WIN B;  1BF4 A;  1NCV A;  3STB D;  1EUJ A;  5IP7 H;  3QB3 A;  1XWE A;  2NTT A;  2PZT A;  2DJF C;  1YI2 A;  3ND8 A;  1SYC A;  4DR6 Q;  2PZU A;  1OXT A;  3PUW A;  4JI6 L;  3T4A C;  3KFU A;  3A54 A;  1S5F D;  1TVX A;  2J7Z A;  4DUY Q;  2VUM B;  2WFW A;  2IHE A;  1I5F A;  1EIH A;  2UUC L;  1UNS A;  2BE5 C;  4DV3 L;  2J4X A;  4HJ9 A;  1C8C A;  1RKN A;  4UAI A;  4QB4 A;  3K81 C;  5HUR A;  1H95 A;  1L0X B;  4XYO A;  2B2U C;  2TMP A;  1XMQ L;  1DGS A;  3MWY W;  2K5N A;  4A76 A;  1IW7 C;  2MHV A;  2IHF A;  1PA6 A;  1Q86 C;  3CHB D;  2F52 A;  3NK9 A;  4M1U B;  5M5X H;  4A3G G;  1DXM A;  1SYG A;  1SDF A;  4CJ1 B;  1I94 Q;  4K0K Q;  3OMC A;  4AQY L;  4LNQ A;  3F2D A;  3SK6 A;  4V0B A;  4LF8 Q;  1D5M C;  1HR0 W;  4PV1 C;  1RDP D;  2AKW B;  3HOX H;  1EY6 A;  5LMU Q;  3GTJ B;  2B2U A;  3JAM i;  4DXF A;  1ILQ A;  2WAQ E;  3U9O A;  1AZQ A;  4RWS C;  2ZXR A;  2NTS A;  1ROD A;  2HQE A;  4DR3 Q;  5JPN C;  5IYC H;  3DEP A;  2A6H D;  3IAY A;  5JJZ A;  3KF6 A;  3RZO H;  1B3Q A;  3HGB A;  1EY0 A;  4ZUJ A;  5JAV A;  2KEC A;  4DXG A;  1O7Z A;  1CZG A;  2K32 A;  3SXH A;  2KED A;  5FLX E;  3TEH B;  4DU9 A;  4G7Z C;  1DYQ A;  1EQT A;  2B63 G;  1HNX Q;  4GLX A;  2ID0 A;  4A3E H;  1TR5 A;  3EQL C;  1J8I A;  4P72 A;  2CWA A;  3TP6 A;  3VA7 A;  2O5I C;  5KIX A;  1IBK L;  1EYG A;  5IGB A;  2NUC A;  3FPP A;  2BDN A;  4BY1 G;  3J7Y W;  2Q2T A;  4B3T L;  1WTP A;  1D1K A;  2IT1 A;  3KLS A;  4EGV A;  5JVH 3;  3CC7 A;  1HTP A;  4IUQ A;  4QL5 A;  2H4O A;  3ULP A;  3QG1 A;  3KDF A;  1GUT A;  4HIM A;  2VB3 X;  4HAE A;  3VYT A;  1R4P B;  2OF1 A;  2E5L Q;  3I90 A;  1QOH A;  3OTO Q;  3G4S A;  3D8G A;  5CR3 A;  4MHE A;  1LTR D;  2Q8R E;  3BU2 A;  1G2T A;  2QF7 A;  2ZTC A;  2GA4 B;  1PLF A;  3H0G B;  4OL7 A;  1SFO B;  3DLL A;  2ASB A;  1B44 D;  5C4X G;  1SRU A;  3GTK H;  4RH6 A;  4N9P A;  4DFA A;  1EU4 A;  2ZM6 L;  5ELB A;  2E2H H;  1UE5 A;  4RGN A;  1PFS A;  3J7A 5;  4K5X A;  5LMN L;  2F3I A;  4K6D A;  1BBU A;  2L4N A;  4FVM A;  3T51 B;  4EQ5 A;  5C3E G;  4A3B H;  4A3G B;  5T1G A;  1NR2 A;  4NPS A;  1CT1 D;  4R8I A;  2X6G A;  3ER0 A;  4ZKC B;  1DD2 A;  2RDG A;  2NVT B;  1HQM C;  4KY7 A;  4LF5 Q;  3A8I E;  4Q0F A;  1S40 A;  1WFQ A;  3RLN A;  3RLF A;  5JOB A;  4C56 C;  4A3I H;  5NUC A;  1XYI A;  2R93 H;  3R93 A;  1VCI A;  5J1Z A;  3NQI A;  2UUB Q;  1K3B C;  1IKM A;  1IBL L;  3MZ5 A;  3BS1 A;  1YEZ A;  2CCZ A;  2K04 A;  4IPH A;  1CA6 A;  1D7Q A;  5ELN A;  4IUN A;  2EYF A;  1PZK D;  3NHH A;  5I6W A;  3AB9 A;  1JMC A;  4KD3 A;  4QMG A;  4DK3 C;  2UU9 L;  1U0L A;  4RCO A;  1U5K A;  1BVS A;  5C44 G;  3SDZ A;  3CRL C;  1I4G A;  2ZJP A;  1JQY D;  5AFW A;  1EWC A;  1TWH B;  3NPP A;  1EEF D;  3GTM H;  1F77 A;  3EBE A;  2OCE A;  1JJ2 A;  1YHB A;  3A0J A;  3T1Y Q;  1YZ6 A;  1LT5 D;  3CAM A;  3HOY H;  4H13 C;  3QOJ A;  1AW7 A;  1STG A;  3DWA A;  4RAU C;  1HXY D;  2DJG C;  4JBW A;  2EYH A;  3HFZ B;  3GTO B;  4DR2 L;  1TWC B;  1JT8 A;  3T1H Q;  1RD9 D;  4RA8 A;  3DM1 A;  4EQO A;  4IPG A;  4S3S A;  4DV2 Q;  4WJW A;  2PCF B;  1TS4 A;  5M9O A;  2F0Q A;  2CW0 C;  1X54 A;  2EOT A;  2Z4I A;  2Y0S G;  3JC6 6;  4NXM L;  4BA1 I;  5I2X A;  3PIO A;  2SOB A;  3EN2 A;  5CV9 A;  5C0X J;  5LMN W;  3K7U C;  2JQO A;  3P1H A;  4A3J G;  1Y8O B;  2F0D A;  1F9R A;  4DF7 A;  2PYK A;  2BH8 A;  1XNR Q;  5IGG A;  1TS3 A;  5GAD C;  4JI2 Q;  1SE2 A;  1Q1B A;  3A56 A;  1V8Q A;  4LF6 Q;  2ZT9 C;  5C3E B;  1STE A;  4L5T A;  2E75 C;  3VYU A;  4C3I B;  2B63 H;  1VQC A;  4POF A;  3H3V H;  3GTL H;  4KHV A;  2NVX B;  2QGQ A;  2JA7 G;  2D0O A;  3P7J A;  2XVS A;  2K05 A;  1JIC A;  4AYB G;  2CFM A;  1PH2 A;  1CQV A;  4BY1 H;  3RN2 A;  2RKS A;  1YNJ D;  3KF8 A;  2WII B;  3VYR A;  2K01 A;  4YY3 Q;  3R2T A;  2Q2U A;  4Y7N H;  2L9H A;  4DAM A;  1EYC A;  2YTX A;  1QVG A;  4XQJ A;  1L1O C;  4C1N I;  2EXD A;  4OHJ A;  4B9X A;  1X56 A;  5KGU A;  1PH7 A;  3RR5 A;  3BVG A;  3N52 A;  2DUD A;  4JV5 Q;  1HZ9 A;  1JCK B;  4BBR G;  3C46 A;  4DV5 L;  5C44 B;  1R9T H;  1B7Y B;  3TS0 A;  3CCM A;  2HHH Q;  1GOZ A;  1WTV A;  5C4X H;  2EPB A;  1UAP A;  4CDC C;  3M9B A;  2JA8 B;  3KK7 A;  4IUP A;  4JW0 A;  4ZRZ A;  4CHT B;  4HJ7 A;  5KEE A;  1PZI D;  2QKI C;  1W6J A;  1SNO A;  4L63 B;  1A3T A;  3I91 A;  1LYL A;  2R7Z B;  3UDF A;  5M5Y B;  2RVL A;  2D9U A;  2MPM A;  2WP8 J;  3NUC A;  3S1R B;  3OIP A;  4KTA A;  4DR7 Q;  2QDB A;  2A69 C;  2UXD L;  2PMZ E;  2IW3 A;  4JI5 Q;  4NP5 A;  1RIP A;  2JA6 G;  3BDL A;  3PO3 H;  4Y52 H;  2KVM A;  1HR0 Q;  1QB5 D;  1EZ6 A;  4IJH A;  4LF7 Q;  2K4K A;  3CME A;  3HOZ G;  1ET6 A;  1UWV A;  2O2L D;  5IGC A;  4B3R Q;  1K8O A;  2HQL A;  2KCT A;  3MHB A;  1HCZ A;  2DNE A;  4DV0 L;  1EFI D;  1SMY C;  5E4X A;  3PIP 3;  1C48 A;  3S1N H;  4KHP L;  1D5X C;  2KQ3 A;  2NWG A;  3CF5 A;  1IYV A;  4DPG A;  1Y1V B;  2JXM B;  1PFB A;  2TSS A;  4GKJ L;  4I7Z C;  1SNM A;  2JEB I;  4N8F A;  4N8X 1;  1B9N A;  3DMU A;  1RJT A;  4OXP A;  1KIX A;  4B9W A;  1EY8 A;  3W5O A;  2L1B A;  2Z9H A;  1D2B A;  2EYP A;  3IFT A;  2JA7 B;  1UUP A;  3FDT A;  3HKZ G;  3PGZ A;  1LM0 A;  3S1M B;  3E0J A;  5ELO A;  3PUV A;  3CCR A;  3S17 B;  5C3X A;  5C4J B;  1VQ4 A;  3AU7 A;  1PTO H;  3M4O H;  4IUT A;  4JG2 A;  4JI6 Q;  3HOU B;  4NW2 A;  4JI1 L;  4Q5V A;  1AZP A;  3M4Y A;  1ESR A;  1I4Q A;  1OXU A;  4LK1 C;  3K5M A;  1K8G A;  3AFQ A;  3VA5 A;  2UUC Q;  5IYB H;  1IXR A;  2F4I A;  2IX3 A;  1XXG A;  4BBR B;  4DV3 Q;  4APV A;  1CI3 M;  4KK7 A;  3D31 A;  3AFP A;  2EQS A;  1L0Y B;  5I4D A;  1V43 A;  3GD7 A;  4O0A A;  2MO0 A;  1XMQ Q;  2O5J C;  1LO5 D;  2RDH A;  1RHP A;  3D4D A;  1B53 A;  4HSV A;  2K5D A;  5C0X I;  3W1G A;  5M3F B;  4KMU C;  4A3F B;  3CMA A;  2KA7 A;  4CDE C;  2UUA L;  4AQY Q;  4DK0 A;  2HIX A;  1PTO F;  5EGT A;  3KOJ A;  3BG3 A;  1O80 A;  3QJY A;  2A6E D;  4F7X A;  4X62 Q;  2KEN A;  4K5V A;  1TXY A;  2K28 A;  1B3A A;  2EY5 A;  2JA6 B;  4DV1 L;  2EE1 A;  4UHV A;  3GTG B;  4C3J G;  3EIV A;  2WB1 G;  4C2M B;  2L12 A;  5C3W A;  1AN8 A;  5D14 A;  1WTX A;  1A6X A;  4KKU A;  3MXG A;  5A2Q E;  4A93 G;  2EXZ A;  4A3M B;  4L5S A;  3LWE A;  3CCE A;  2F1M A;  1UE7 A;  4U67 3;  2ZJR A;  1V1P A;  1QNU A;  1DOL A;  1STB A;  5FKA C;  4LFC L;  1MSH A;  3L2P A;  1HA6 A;  3R3O A;  2A74 C;  2KJX A;  2N49 A;  2Z8L A;  4B08 A;  3MXN B;  3T13 A;  5LL6 S;  4IJL A;  1PZJ D;  3BVM A;  3UDX A;  2L15 A;  1YJ9 A;  2A5H A;  1DJR D;  1Q90 A;  1IBK Q;  2B3G A;  1I4H A;  5ELD A;  1EQR A;  2R92 B;  1ENC A;  1EQV A;  2VL6 A;  4B3T Q;  2QIL A;  2FMC A;  3HKZ B;  2VW9 A;  1K0S A;  1BCP B;  4LWC A;  3TS2 A;  4IOA A;  5M3M B;  3RN5 A;  3GTP H;  1EY4 A;  4R4O A;  2E2J B;  3P75 A;  2VY3 A;  1G6Z A;  2K03 A;  4K14 A;  2D0P A;  2Y0S E;  3ULL A;  1JOO A;  1B8A A;  4X3T A;  3RUZ A;  3HRZ C;  4EVO A;  2E2I H;  2KHS A;  4QQB X;  1EOT A;  2B2Y C;  4NDX A;  3MVV A;  1KDC A;  2R7D A;  3OYY A;  5ELC A;  3SK4 A;  1MHW C;  3G71 A;  1AFP A;  3HOZ H;  2ZM6 Q;  3HOV G;  2P5Z X;  1NMF A;  3BZC A;  1IKL A;  2PPB C;  4DR5 L;  3M4P A;  4JYA L;  5LMN Q;  4BBS G;  3NEN A;  4GOP A;  3NP8 A;  3K6O A;  1E22 A;  2K7V A;  3OW2 A;  4A3C G;  1WTR A;  2VB2 X;  1TS5 A;  5GRO A;  3ICE A;  3M7G A;  3NWT A;  4AYB E;  4Z9C B;  1LT4 D;  2B2Y A;  3OOC A;  2AQ2 B;  4HID A;  2V1C C;  1AH9 A;  1QE6 A;  5JEA J;  1Y1W H;  1CA5 A;  2EYO A;  4PMB A;  2BCO A;  2C9O A;  1TWA B;  4JC0 A;  4C3J B;  1IBL Q;  2L55 A;  2JJQ A;  4LAA A;  2BOS A;  4GN5 A;  4A3L G;  1JE5 A;  1BCP D;  1XPU A;  2EY1 A;  4A3D H;  1E2Z A;  1Z47 A;  4HN7 A;  2DY8 A;  1KC8 C;  4IUV A;  1VF5 C;  2R6G A;  4NKL A;  2ZTD A;  1SSO A;  2BH2 A;  1I4P A;  3VDY A;  1TKW B;  1W3S A;  1H9J A;  4FNF A;  1EZ8 A;  5EPL A;  5IWA L;  3NEL A;  2LXJ A;  4QCL A;  1S5C D;  2K5V A;  3RNU A;  2PQA B;  2SNM A;  5KYL A;  4GNX B;  3I56 A;  4O1N A;  1CQF A;  1P8L A;  1LTS D;  1K83 B;  1E1T A;  3H0G G;  2I46 A;  4JOI A;  1S3O A;  4YWM A;  1SBB B;  3HG9 A;  5LL6 X;  4HSP A;  3V2T A;  4DUZ L;  4DR2 Q;  1Q3L A;  1N36 L;  2XNA C;  3PO2 B;  4BY7 G;  1N9W A;  3J7Z C;  4IFD I;  2VZA A;  4UP7 A;  3LGJ A;  1E2V A;  1XNQ L;  1ZYR C;  5IT9 L;  1A8V A;  2NB0 A;  2EJG C;  3Q0A A;  2XRQ D;  4DV7 L;  4J1M A;  4JBM A;  4NXM Q;  4P74 A;  3K7A H;  3STB C;  2NVQ B;  1KXL A;  1MJC A;  3HZX A;  2NN6 I;  1JJC B;  4CKC A;  3M3Y B;  2JYO A;  5EAY A;  2SNS A;  3CQZ H;  1QNK A;  2K14 A;  1EQQ A;  1PXU A;  3HOV B;  3VYS A;  1KRT A;  4NXN L;  4LFA L;  4A93 H;  3H91 A;  1K73 C;  3O13 A;  1HHV A;  2Q2I A;  2MNA A;  3DUZ A;  2KUM A;  2LFN A;  4TSS A;  4GKK L;  2ZXO A;  4BBS B;  3HOW B;  1I50 H;  3D4R A;  1RTN A;  1Y69 U;  3B6Y A;  1JC7 A;  4J15 A;  1X3F A;  1LT6 D;  1E2W A;  1P16 A;  3TME A;  3BYY B;  4KJN A;  2A1A A;  2G5D A;  3E0E A;  3EJI A;  3KLR A;  1VQP A;  2JN4 A;  5CMD A;  4IOC A;  1H9R A;  3FPU B;  2EY2 A;  4X65 L;  1NTG A;  4XXE A;  3CU7 A;  1F9Q A;  1ICF B;  1S5B D;  2VUM H;  2RHS B;  2CKZ B;  1PH8 A;  4GLA C;  3E9I A;  1JR0 D;  2EDG A;  3MC0 B;  2A68 D;  3U4Z A;  2K1B A;  4LFB L;  4JI0 Q;  5DLQ E;  2OTJ A;  2EVB A;  2N88 A;  3BVZ A;  4WJ3 M;  4LUO A;  5BN4 A;  1EIY B;  1ZKO A;  3J80 L;  1F9S A;  3KLW A;  3S9W A;  4DV5 Q;  3GO5 A;  4FF3 A;  4HJ8 A;  1EY9 A;  3I72 A;  2PW7 A;  2OTL A;  2A6H C;  3I73 A;  2L5T A;  3U4V A;  3UE1 A;  4EQN A;  2CHB D;  1FD7 D;  1GD7 A;  4TKO B;  2OQK A;  1IHZ A;  4K8J A;  1QUQ B;  4ME3 A;  2B8G A;  1IYU A;  2N55 A;  1N32 L;  2RDF A;  4TRD A;  3GTJ H;  2AWN A;  1WTO A;  1AE2 A;  2N8N A;  2QW7 A;  1Q81 C;  1VQ9 A;  3VR3 A;  1PYB A;  4BY7 B;  2WB1 E;  2KBN A;  2NYZ D;  4FF1 A;  2AUK A;  3A8K E;  1PHJ A;  2JP1 A;  4A4I A;  5FK9 C;  2MQH A;  5TSS A;  3AQQ A;  1C4Q A;  2OXP A;  3J81 L;  4G7O C;  3KYH C;  4C3I G;  1X9N A;  1T5E A;  4QIW B;  1FVI A;  4A3K G;  5IGE A;  4DV0 Q;  4A3L H;  1AEX A;  5D65 A;  2JEA I;  4B3M L;  1TWG H;  3CCV A;  3KF8 B;  4RHR A;  3RZD B;  4KHP Q;  2B2T C;  4GN4 B;  3A7L A;  1GJX A;  1B1Z A;  4QUF A;  3S2D B;  4WFN 3;  1GUS A;  1GUO A;  3HOY B;  3D0F A;  4IFD G;  4MTK A;  5K36 G;  4GKJ Q;  4B3S L;  5E7N A;  3NE5 B;  1SXT A;  4CDD C;  4K8I A;  2I07 B;  1YIT A;  2H5X A;  3I7F A;  4X66 L;  2DNC A;  2AQ3 B;  2JK8 A;  2JE6 I;  4LJZ C;  2EIF A;  4IPD A;  5FLM G;  3A74 A;  4GZY C;  4G4K A;  2NN6 G;  1CSP A;  1S5D D;  1XX8 A;  5HGT A;  1VQ5 A;  4FXG C;  2B2T A;  2MUY A;  1X65 A;  3W1B A;  5D3I B;  1EYD A;  2HDL A;  5I2Y A;  3D6C A;  2CQA A;  3H0G H;  2F0S A;  2LMC B;  1SFO H;  2ZJQ A;  1VQG A;  4ALP A;  1M8A A;  4JI1 Q;  2JA8 G;  4RFB A;  1HNZ L;  3UE0 A;  1IBM L;  5F2D A;  3TP5 A;  2NBF A;  5M5W B;  5CV5 A;  3G6J B;  3VR5 A;  4BS9 A;  3SGI A;  4P73 A;  2XSC A;  3OMG A;  3NTK A;  1RF2 D;  1ILP A;  2R7Z G;  3OWF A;  1BUV T;  2M2L A;  4A3G H;  1KQS A;  4PMW A;  3F2C A;  4DAP A;  4WJ4 A;  1VF7 A;  2L0C A;  2NVT H;  1O7I A;  1HZB A;  4ZCK A;  3GDE A;  1CKO A;  2C35 B;  2PQE A;  3G6E A;  3I70 A;  4XT3 B;  5DM7 3;  2GVB A;  2CVR A;  2PNH A;  3I4N B;  1U9R A;  3S2H B;  1PRT B;  2UXC L;  4DV1 Q;  1DOM A;  1EWH A;  3F1Z A;  4RKL A;  1J9O A;  1YHA A;  5IYD G;  3V05 A;  4HJA A;  1CHP D;  1Y1V G;  1N34 L;  3UI2 A;  4R1J A;  1JWM D;  2EZV A;  1VQN A;  3T53 B;  1JWS D;  3TP8 A;  4X3U A;  2B2V C;  2NVY B;  3F2B A;  4A3K B;  3MA2 B;  1TWH H;  4ZUI A;  1A63 A;  3T56 B;  3LWU A;  4CDF C;  4JI3 L;  1JJG A;  3GTQ B;  4R4C A;  1S4Z A;  4DR4 L;  1JOQ A;  4WRD A;  2F0F A;  3TZD A;  4X6A H;  4DR3 L;  2YU9 B;  3GTO H;  2L11 A;  3Q8D A;  3HOU G;  3I4M B;  1TWC H;  3PO3 B;  1KAB A;  4ABN A;  2A8V A;  5HY6 A;  2B2V A;  4FYD A;  4RGM A;  2M9V A;  4XYQ A;  4JI8 L;  2KOL A;  5EQ0 A;  3H15 A;  2JA5 B;  1EY5 A;  3PUY A;  1TT2 A;  4MIU A;  1F2M A;  5T1I A;  3JAM L;  3W2D A;  4KLK A;  3FEW X;  3KLS X;  4JBK A;  3H3V C;  4KY5 A;  4ZK9 B;  2PI2 E;  1PRT D;  1I3Q B;  3OIQ A;  5M3F G;  1SNQ A;  4DNR B;  5I9O A;  4A3F G;  1L1O A;  1UEB A;  3WOE A;  3WOF A;  4WOR A;  2AQ1 B;  1LT3 D;  1TQO A;  1YNJ C;  1BBW A;  4MTN A;  5C3E H;  2YYZ A;  2XWB B;  5BN3 A;  4HMI A;  4C3I H;  4HED A;  1PYS B;  3GP7 A;  4DR5 Q;  1ENA A;  3C1E A;  4JYA Q;  2IL8 A;  4FO2 A;  3I4O A;  2VQF L;  1HUN A;  4UPA A;  2F4V L;  3LNN A;  2NVX H;  5FO7 B;  2IX1 A;  4IZ8 A;  4IFD H;  4CKB A;  4XT1 B;  3CC4 A;  5K36 H;  1BBX C;  4JI4 L;  3TQY A;  2WKD A;  4A3M G;  2EYM A;  1N8R C;  3S1Q B;  2M00 A;  2SDF A;  5FLM H;  5HGQ A;  2AWO A;  2NN6 H;  4DV4 Q;  2N3S A;  1SE3 A;  3EA6 A;  2VS1 A;  1STA A;  4N9T A;  2MO1 A;  5KND A;  4UY8 C;  1L0W A;  1H9M A;  4E6I A;  5C44 H;  2UXB L;  2CWP A;  5JJK A;  3D4W A;  3Q23 A;  2RSN A;  1Q82 C;  2R92 G;  2JA8 H;  4LUV A;  1YNX A;  2E74 C;  3ULJ A;  5AJ3 L;  3RMH A;  5IWA Q;  5M3M G;  4P75 A;  1NAP A;  1TS2 A;  5GAG C;  2R7Z H;  2EYJ A;  4DA2 A;  5M5Y H;  4X3K A;  1FGU A;  3S1R H;  2X69 A;  4FDB A;  1LTB D;  2R61 A;  4DV6 L;  3K59 A;  4FXD A;  4JI7 L;  1KRS A;  3FKI B;  2F0N A;  1IL8 A;  4DUZ Q;  2QCP X;  1N36 Q;  4JVZ A;  2Q8T A;  1Q8I A;  4GOP B;  2PO4 A;  1CM9 A;  2ICI A;  1XNQ Q;  4ZYS A;  3UDI A;  3S15 B;  2EYL A;  3OW7 A;  5IT9 c;  4OX9 L;  2VQE L;  4A3J H;  4DV7 Q;  2F3V A;  4HR7 B;  5KRU A;  1Q12 A;  1YJW A;  5I6Y A;  1MI2 A;  3EVQ A;  3PUX A;  4M8A A;  1N33 L;  1Y1V H;  1M4V A;  2LY7 A;  1H9S B;  2D5D A;  1PTO C;  4LFA Q;  4NXN Q;  2XGT A;  1C7Y A;  1WCM B;  1E0B A;  4ILW A;  3HS0 C;  4KY6 A;  1ML0 D;  4GKK Q;  3FVQ A;  1PFN A;  2MJ8 A;  2D2C C;  4I7A A;  2JA7 H;  4ULL A;  4MNO A;  1AE3 A;  3K5N A;  3FHW A;  3GTP B;  3S1M H;  4FF2 A;  3CC2 A;  3S17 H;  3CPW A;  5C4J H;  4R8N A;  5JJI A;  3NXW A;  4NMZ A;  1EY7 A;  1X3G A;  4X65 Q;  1NY4 A;  1VQO A;  2E8G A;  1LV9 A;  1MGS A;  1GUN A;  1VQA A;  3HOU H;  1D8L A;  4OWW B;  1XMO L;  4QJF A;  3PUZ A;  4F87 A;  4HIK A;  1WTW A;  1HZA A;  1BXT A;  4TQU S;  2ATW A;  1DON A;  4C3H B;  1I6H B;  5EBD A;  1BKB A;  3D3R A;  4BBR H;  4LFB Q;  5KNC A;  1SE8 A;  4YCW A;  4LUZ A;  2ICE C;  1VQE A;  2A6E C;  2H1E A;  2HCI A;  3N6R A;  1GHK A;  1Y8N B;  1HJP A;  3J80 c;  3M85 A;  2FXQ A;  5JJL A;  1Q8K A;  1VQJ A;  2Z6B A;  5M3F H;  2Z6K C;  4A3F H;  4RGT A;  4CBV A;  3S16 B;  1VMP A;  3PO2 G;  4PQX A;  3CCU A;  3TDQ A;  1AP0 A;  1FL0 A;  4YIJ A;  1BOS A;  1TWF B;  2CQO A;  1D6E C;  1F2Y A;  4O42 A;  3SHL A;  4YWL A;  1FJG L;  1HFN A;  2V4D A;  4KN7 C;  1U4R A;  1MJE A;  4RMF A;  1YHQ A;  1II3 A;  2WAQ B;  1ET9 A;  3F2U A;  2JA6 H;  1YJN A;  3K8A A;  3GTG H;  1N32 Q;  2WV6 D;  4H02 A;  3R2I A;  4JV5 L;  1R4Q B;  2FFK B;  4C2M H;  5E3F A;  1XJV A;  4DNT B;  1VQD A;  5C5M A;  1SNP A;  4H7B A;  1YNN D;  4KKS A;  5K5P A;  2IX0 A;  1PH5 A;  4HJ5 A;  2Z6K A;  4KKT A;  5A35 A;  1SNC A;  5JVG 3;  3S14 B;  4A3M H;  2IWH A;  5JPM C;  3G48 A;  4BWG B;  1LTT D;  3HOW G;  3KF6 B;  4JBJ A;  4TVA B;  1YVC A;  3OHX C;  1C9O A;  4MN3 A;  1OXX K;  2K33 A;  1LLR D;  5EKI A;  3J81 c;  1B9M A;  2QEJ C;  4YCV A;  1EWI A;  1GM5 A;  1O7L A;  4B3M Q;  1QIL A;  2B2W C;  1GUW A;  3PV0 A;  1A15 A;  3K57 A;  2F0U A;  2OT2 A;  2PNR C;  1LUZ A;  2F0K A;  4DR7 L;  1XTD A;  5COR A;  3TP7 A;  3A5Z B;  4B3S Q;  2R92 H;  4PZ6 A;  5LHY 1;  5CGK A;  3HP3 A;  4A75 A;  1XTC D;  5C0X G;  2OQ0 A;  3AYH B;  4XQQ A;  5M3M H;  3CCJ A;  1C0A A;  3A5U A;  3Q22 A;  2E2J H;  1SJE D;  1Y8P B;  5IGF A;  2LXK A;  4LF9 L;  4L6T B;  3IKJ A;  1KDB A;  3KDF B;  1CKN A;  1K9M C;  2RQX A;  1J5E L;  1IZ6 A;  4X64 L;  3PIP A;  2B2W A;  4GS3 A;  1WTQ A;  4J8Q A;  2UU9 Q;  5GQO A;  2RA4 A;  4POG A;  5M5X B;  1A3U A;  3I8Z A;  5E4W C;  1LTL A;  5EBC A;  2BE5 D;  4J6H A;  1SN8 A;  1KAA A;  1E7Z A;  1HNZ Q;  4DR1 L;  3K0Y A;  1ASZ A;  2F3W A;  1IBM Q;  3X3N A;  2RF4 A;  1YBY A;  3HOX B;  4QF4 A;  2CH4 W;  4OEM B;  1IW7 D;  2I5L X;  3TN2 A;  3SE0 A;  3L9A X;  1QVF A;  3HKS A;  4KN4 C;  1B4O A;  3C3L A;  3F8T A;  3DM3 A;  5J22 A;  1DOK A;  1OXV A;  4RG1 A;  2K5Q A;  3BYT B;  1TY2 A;  1BCP F;  1MKH A;  3W3A A;  3I2Z A;  4XTC S;  4O2D A;  1BCP C;  1GHJ A;  1QWY A;  3V96 A;  3RZO B;  1NBW A;  3NQT A;  5L37 A;  3MEF A;  4RKB A;  5FLX L;  3GQB A;  3X3M A;  1MSG A;  1A2T A;  2OWO A;  1JWU D;  1PV4 A;  4C1N K;  2A73 B;  3PIO 3;  1D1I A;  3MXN A;  1TWA H;  4C3J H; 
#chains in the Genus database with same CATH homology
 1F9P A;  2RBM A;  2R3Z A;  1SAP A;  1O7Y A;  5C4H A;  4CJ2 C;  4A3E B;  1X32 A;  4IUR A;  5C6A A;  4XQN A;  2Z4H A;  2IPK D;  3NBI A;  4F8M A;  5CC4 A;  4OIJ A;  1CK1 A;  1STY A;  1HRJ A;  1BNZ A;  5DM6 3;  5EPK A;  5E1F A;  5KNB A;  4HMJ A;  4UDU C;  4CKE A;  2RSO A;  2C5C A;  3KBX A;  2G9H D;  3EFX D;  1I4R A;  1HQR D;  3DHQ A;  2BA0 A;  4DAY A;  2BDO A;  1OXS C;  2HDM A;  3GTK B;  4IAL A;  2E2H B;  5J39 A;  4HCS A;  5CYU A;  5IT9 E;  4V19 0;  5FOB B;  1BR9 A;  1MD2 D;  1A2U A;  3L3O C;  4ODG A;  4A3B B;  1TII D;  2F0E A;  3MTS A;  4F88 A;  1DZ1 A;  5C5L A;  2MGS A;  3MAQ A;  5CBE E;  3ZYY X;  1TWG B;  1NSN S;  4KJO A;  3SR1 A;  3L7Z C;  4A3I B;  2R93 B;  1CTM A;  4X3S A;  5FO8 B;  1GUG A;  3NBH A;  2X6L A;  2A68 C;  2F0H A;  2F0O A;  1SYE A;  2XRS D;  4K2L A;  1U4P A;  2O4X A;  3WDN A;  1CHQ D;  2FIN B;  2IJ0 A;  5BN5 A;  1SYF A;  1O78 A;  3I4L A;  3MEH A;  1RCV D;  3KBG A;  5C0X H;  4ZAI A;  3GTM B;  2Z1C A;  5CBA E;  4R9W A;  3NSW A;  3G7L A;  2XN9 C;  5CV8 A;  4I65 A;  3J80 E;  2F03 A;  2D62 A;  1FR3 A;  1I4X A;  4CGY B;  3TBI B;  2F0P A;  1Z6H A;  1KDA A;  1WD0 A;  2VXW A;  3GV6 A;  3BZD B;  1I6V C;  2EJM A;  2B8F A;  3ITP A;  1DM0 B;  1H9K A;  1EYA A;  2PMZ B;  1VMC A;  1X3P A;  4BA2 I;  3OPO A;  4ZKB B;  3E6Z X;  4KHZ A;  3NWS A;  2XIW A;  3HEJ A;  3A8J E;  3ERQ A;  3T16 A;  2CW0 D;  1GXD C;  1JE4 A;  3D6W A;  3J7A F;  2K6A A;  2B63 B;  3J81 E;  4CJ0 B;  1A3V A;  1D5Z C;  3TSS A;  3GTL B;  1S5E D;  5IOC A;  1ZXT A;  5ELF A;  1LAC A;  5IIF A;  4BY1 B;  4H0L C;  1F2Z A;  2E2D C;  3BDO A;  4XIG S;  1ESF A;  3H09 A;  4Y7N B;  5COY A;  4U68 A;  1G2S A;  1K8M A;  4K5W A;  1SE4 A;  2HCC A;  3Q6S A;  1SEB D;  3A7A B;  3K5L A;  1SJH D;  2F0V A;  1G91 A;  1R9T B;  3SK8 A;  4HTH A;  1FNU A;  4L8J A;  3MXP A;  5C4X B;  1X3Q A;  1PFM A;  2WAC A;  5FO9 B;  3PMF A;  5CV6 A;  4OO1 I;  4LMQ D;  4IUU A;  1ENF A;  4IQZ A;  4FXK C;  1Z7T A;  5G3L D;  2KCN A;  5DAU A;  2KCC A;  4RGO S;  1W6K A;  3ONA B;  3E5S A;  5JEA G;  1FGB D;  3KUP A;  2PW5 A;  1U4L A;  2F0W A;  5CV4 A;  3ND9 A;  3QIA A;  2F0J A;  3FRP B;  4K6L A;  5DNF A;  3IFD A;  4OIK A;  2DN8 A;  2A69 D;  3SEB A;  3H94 A;  3S1N B;  1PYW D;  3NTI A;  4OGQ C;  4IN3 A;  1TU2 B;  1QCB D;  1VDZ A;  4P2C B;  3M7N A;  1EL0 A;  5G3L F;  2WKC A;  2DY7 A;  5EKK A;  1MBY A;  3URY A;  1SMY D;  1V1O A;  5ISR A;  1BDO A;  1BQQ T;  2J0T D;  1V1P B;  2BA1 A;  1PTO B;  3M4O B;  3QOL A;  2E76 C;  1LAB A;  1WVL A;  3VR2 A;  1SYB A;  1PRT F;  5IOD A;  2Q8I B;  3DWQ A;  3GV3 A;  2ENB A;  1PRT C;  1ZEQ X;  1EIG A;  3OSO A;  1DCZ A;  4C3H G;  1D1I A;  2AUJ D;  5C4Z A;  2Y0S B;  2K5W A;  1LTA D;  5CV7 A;  1NUC A;  3JAM E;  4ZQ3 A;  1EU3 A;  4A3J B;  5EPJ A;  5EJW A;  3DXJ C;  1HTL D;  2F0T A;  3ERO A;  1HUM A;  1BO0 A;  3A55 A;  2OEO A;  4PNY A;  2FHT A;  4H44 C;  4G7H C;  4RHS A;  3SK5 A;  2EJF C;  4OO1 G;  2MP1 A;  3QWN A;  4AYB B;  5ELE A;  2LKV A;  5A2Q L;  3CKI B;  3MXU A;  1PTO D;  2F0M A;  5D3D A;  1U4M A;  2F0G A;  2NZ1 D;  2HUG A;  4XDX A;  3LX0 A;  3SVM A;  1WD1 A;  1JB3 A;  1SYD A;  5KYI A;  2JSO A;  3IL8 A;  2B39 A;  4DN4 M;  4JK1 C;  3NTH A;  1FNV A;  4ZLT F;  4EQP A;  1PMR A;  1STN A;  4DK1 A;  4ME5 A;  4ID6 A;  4QUC A;  4IFD J;  3H6M A;  4PMC A;  1HFG A;  3VR6 A;  2LS0 1;  3C1F A;  3J7A V;  1F2L A;  1B2T A;  5JEA H;  2VNU D;  2E2I B;  2F0L A;  3R8B A;  1EEI D;  1RTO A;  3HOZ B;  3QO2 A;  1HA5 A;  5IGD A;  3C2P A;  2G9D A;  3TZU A;  4KV6 A;  4KI0 A;  1HPC A;  3MFG A;  1Q1E A;  1G29 1;  3U9S A;  3RD4 A;  1B50 A;  4DGZ A;  3AMU A;  1G8Z D;  1FYC A;  3BDC A;  1Y1W B;  1QG7 A;  2KEE A;  3K58 A;  4G57 A;  4FP5 D;  1CZW A;  1JOK A;  2EY6 A;  4A3D B;  3VR4 A;  4RCN A;  2PZW A;  3P20 A;  1KLU D;  4HCE A;  5DEH A;  2XWJ B;  1KTK A;  2FJ2 A;  2ZXP A;  4FF4 A;  2SEB D;  5EKL A;  1CFM A;  3FMC A;  4K2K A;  3Q24 A;  1OO9 B;  1KNE A;  4DAV A;  1UEA B;  1FNW A;  3DEO A;  1LTI D;  1YNN C;  1NR4 A;  1KNA A;  5I9P A;  2F0I A;  3I3C A;  1STH A;  1ICW A;  1T5X D;  3K7A B;  1H9S A;  3OWE B;  4OO1 H;  2WB1 B;  4KD4 A;  1KLG D;  3CQZ B;  1ONL A;  1QJO A;  1SND A;  4A93 B;  3CRK C;  1ZYR D;  1PDQ A;  3MFY A;  1JOR A;  1TY0 A;  1I50 B;  2FMM A;  3DWP A;  1LTG D;  3K5O A;  2WIN B;  1BF4 A;  1NCV A;  3QB3 A;  1XWE A;  2NTT A;  2PZT A;  3ND8 A;  1SYC A;  2PZU A;  1OXT A;  3PUW A;  3T4A C;  3A54 A;  1S5F D;  1TVX A;  2J7Z A;  2VUM B;  1EIH A;  1UNS A;  2BE5 C;  2J4X A;  1C8C A;  1RKN A;  4UAI A;  4QB4 A;  5HUR A;  1L0X B;  4XYO A;  2B2U C;  2TMP A;  3MWY W;  1IW7 C;  2MHV A;  3CHB D;  3NK9 A;  4M1U B;  1DXM A;  1SYG A;  1SDF A;  4CJ1 B;  3OMC A;  3SK6 A;  4V0B A;  1D5M C;  4PV1 C;  1RDP D;  1EY6 A;  3GTJ B;  2B2U A;  4DXF A;  1ILQ A;  3U9O A;  1AZQ A;  4RWS C;  2ZXR A;  2NTS A;  1ROD A;  2HQE A;  5JPN C;  3DEP A;  2A6H D;  3IAY A;  5JJZ A;  3HGB A;  1EY0 A;  4ZUJ A;  5JAV A;  2KEC A;  4DXG A;  1O7Z A;  1CZG A;  2K32 A;  3SXH A;  2KED A;  5FLX E;  4DU9 A;  4G7Z C;  1DYQ A;  1EQT A;  2ID0 A;  1TR5 A;  3EQL C;  1J8I A;  3TP6 A;  3VA7 A;  2O5I C;  5KIX A;  5IGB A;  2NUC A;  3FPP A;  2BDN A;  3J7Y W;  1WTP A;  1D1K A;  2IT1 A;  3KLS A;  4EGV A;  5JVH 3;  1HTP A;  4IUQ A;  2H4O A;  3QG1 A;  1GUT A;  2VB3 X;  4HAE A;  3VYT A;  1R4P B;  2OF1 A;  3I90 A;  1QOH A;  3D8G A;  5CR3 A;  4MHE A;  1LTR D;  2Q8R E;  1G2T A;  2QF7 A;  2GA4 B;  1PLF A;  3H0G B;  4OL7 A;  1SFO B;  1B44 D;  4RH6 A;  4N9P A;  4DFA A;  1EU4 A;  5ELB A;  4RGN A;  4K5X A;  4K6D A;  2L4N A;  4FVM A;  3T51 B;  4A3G B;  5T1G A;  1NR2 A;  4R8I A;  1CT1 D;  2X6G A;  4ZKC B;  1DD2 A;  2RDG A;  2NVT B;  1HQM C;  4KY7 A;  3A8I E;  4Q0F A;  3RLF A;  5JOB A;  4C56 C;  5NUC A;  1XYI A;  3R93 A;  1VCI A;  5J1Z A;  3NQI A;  1IKM A;  3MZ5 A;  3BS1 A;  2K04 A;  1CA6 A;  4IUN A;  2EYF A;  1PZK D;  3NHH A;  5I6W A;  3AB9 A;  4KD3 A;  4QMG A;  4RCO A;  3SDZ A;  3CRL C;  1I4G A;  1JQY D;  5AFW A;  1EWC A;  1TWH B;  3NPP A;  1EEF D;  1F77 A;  1LT5 D;  4H13 C;  3QOJ A;  1AW7 A;  1STG A;  3DWA A;  4RAU C;  1HXY D;  4JBW A;  2EYH A;  3GTO B;  1TWC B;  1RD9 D;  4RA8 A;  3DM1 A;  4EQO A;  4S3S A;  4WJW A;  2PCF B;  1TS4 A;  5M9O A;  2F0Q A;  2CW0 C;  2Z4I A;  2EOT A;  4BA1 I;  5I2X A;  2SOB A;  5CV9 A;  5C0X J;  3P1H A;  1Y8O B;  2F0D A;  1F9R A;  4DF7 A;  2PYK A;  5IGG A;  1TS3 A;  1SE2 A;  1Q1B A;  3A56 A;  1V8Q A;  2ZT9 C;  5C3E B;  1STE A;  3VYU A;  2E75 C;  4C3I B;  4KHV A;  2NVX B;  3P7J A;  2XVS A;  2K05 A;  1JIC A;  1CQV A;  2RKS A;  1YNJ D;  3KF8 A;  2WII B;  3VYR A;  2K01 A;  3R2T A;  2L9H A;  1EYC A;  4XQJ A;  4C1N I;  4OHJ A;  4B9X A;  5KGU A;  3BVG A;  3N52 A;  1JCK B;  3C46 A;  5C44 B;  1GOZ A;  1WTV A;  2EPB A;  1UAP A;  2JA8 B;  3KK7 A;  4IUP A;  4CHT B;  4ZRZ A;  5KEE A;  1PZI D;  2QKI C;  1W6J A;  1SNO A;  4L63 B;  1A3T A;  3I91 A;  2R7Z B;  5M5Y B;  2RVL A;  2D9U A;  2MPM A;  2WP8 J;  3NUC A;  3S1R B;  3OIP A;  4KTA A;  2QDB A;  2A69 C;  2IW3 A;  4NP5 A;  3BDL A;  2KVM A;  1QB5 D;  1EZ6 A;  1ET6 A;  2O2L D;  5IGC A;  1K8O A;  3MHB A;  1HCZ A;  2DNE A;  1EFI D;  1SMY C;  5E4X A;  3PIP 3;  1C48 A;  1D5X C;  2KQ3 A;  2NWG A;  1IYV A;  1Y1V B;  2JXM B;  1PFB A;  2TSS A;  4I7Z C;  1SNM A;  2JEB I;  1B9N A;  3DMU A;  1RJT A;  4B9W A;  1EY8 A;  2L1B A;  1D2B A;  2EYP A;  3IFT A;  2JA7 B;  1UUP A;  3FDT A;  3S1M B;  3E0J A;  3PUV A;  3S17 B;  5C3X A;  5C4J B;  3AU7 A;  1PTO H;  4IUT A;  3HOU B;  4NW2 A;  4Q5V A;  1AZP A;  3M4Y A;  1ESR A;  1I4Q A;  1OXU A;  4LK1 C;  3K5M A;  3VA5 A;  2IX3 A;  2F4I A;  1XXG A;  4BBR B;  1CI3 M;  4KK7 A;  3D31 A;  1L0Y B;  5I4D A;  1V43 A;  3GD7 A;  2O5J C;  1LO5 D;  2RDH A;  1RHP A;  3D4D A;  1B53 A;  4HSV A;  2K5D A;  5C0X I;  5M3F B;  4KMU C;  4A3F B;  2KA7 A;  4DK0 A;  1PTO F;  5EGT A;  3BG3 A;  1O80 A;  3QJY A;  2A6E D;  4F7X A;  4K5V A;  2K28 A;  1B3A A;  2EY5 A;  2JA6 B;  2EE1 A;  3GTG B;  4C3J G;  4C2M B;  2L12 A;  5C3W A;  1AN8 A;  5D14 A;  1WTX A;  1A6X A;  4KKU A;  3MXG A;  5A2Q E;  2EXZ A;  4A3M B;  3LWE A;  2F1M A;  4U67 3;  1V1P A;  1QNU A;  1DOL A;  1STB A;  5FKA C;  1MSH A;  1HA6 A;  3R3O A;  2A74 C;  2KJX A;  2Z8L A;  4B08 A;  3T13 A;  5LL6 S;  1PZJ D;  3BVM A;  2A5H A;  1DJR D;  1Q90 A;  5ELD A;  2R92 B;  1ENC A;  1EQV A;  2QIL A;  2FMC A;  3HKZ B;  1BCP B;  5M3M B;  1EY4 A;  2E2J B;  3P75 A;  1G6Z A;  2K03 A;  4K14 A;  1JOO A;  4X3T A;  3RUZ A;  3HRZ C;  4EVO A;  2KHS A;  1EOT A;  2B2Y C;  4NDX A;  3MVV A;  1KDC A;  5ELC A;  3SK4 A;  1AFP A;  1IKL A;  2PPB C;  3NP8 A;  3K6O A;  2K7V A;  1WTR A;  2VB2 X;  1TS5 A;  3M7G A;  3NWT A;  4Z9C B;  1LT4 D;  2B2Y A;  3OOC A;  2AQ2 B;  1QE6 A;  5JEA J;  1CA5 A;  2EYO A;  4PMB A;  2BCO A;  2C9O A;  1TWA B;  4C3J B;  2L55 A;  4LAA A;  2BOS A;  1BCP D;  2EY1 A;  1E2Z A;  1Z47 A;  4HN7 A;  2DY8 A;  4IUV A;  1VF5 C;  2R6G A;  4NKL A;  1SSO A;  1I4P A;  1TKW B;  1H9J A;  4FNF A;  1EZ8 A;  5EPL A;  4QCL A;  1S5C D;  2SNM A;  5KYL A;  4O1N A;  1CQF A;  1LTS D;  1K83 B;  2I46 A;  1SBB B;  3HG9 A;  5LL6 X;  4HSP A;  3V2T A;  1Q3L A;  2XNA C;  3PO2 B;  4IFD I;  1E2V A;  1ZYR C;  5IT9 L;  2NB0 A;  2EJG C;  3Q0A A;  2XRQ D;  4J1M A;  2NVQ B;  3HZX A;  3M3Y B;  2NN6 I;  4CKC A;  2JYO A;  2SNS A;  1QNK A;  1PXU A;  3HOV B;  3VYS A;  3H91 A;  3O13 A;  1HHV A;  3DUZ A;  2KUM A;  2LFN A;  4TSS A;  2ZXO A;  4BBS B;  3HOW B;  3D4R A;  1RTN A;  1Y69 U;  1JC7 A;  1LT6 D;  1E2W A;  3TME A;  3BYY B;  4KJN A;  3EJI A;  3KLR A;  5CMD A;  1H9R A;  3FPU B;  2EY2 A;  4XXE A;  3CU7 A;  1F9Q A;  1S5B D;  3MC0 B;  1JR0 D;  2EDG A;  2A68 D;  2K1B A;  2EVB A;  2N88 A;  3BVZ A;  5BN4 A;  1ZKO A;  3J80 L;  1F9S A;  3S9W A;  3GO5 A;  4FF3 A;  1EY9 A;  3I72 A;  2PW7 A;  2A6H C;  3I73 A;  2L5T A;  4EQN A;  2CHB D;  1FD7 D;  4TKO B;  1IHZ A;  4K8J A;  2B8G A;  1IYU A;  2N55 A;  2RDF A;  4TRD A;  2AWN A;  1WTO A;  3VR3 A;  4BY7 B;  2NYZ D;  4FF1 A;  2AUK A;  3A8K E;  2JP1 A;  5FK9 C;  5TSS A;  1C4Q A;  2OXP A;  3J81 L;  4G7O C;  4C3I G;  1T5E A;  4QIW B;  5IGE A;  1AEX A;  5D65 A;  2JEA I;  3RZD B;  4RHR A;  2B2T C;  3A7L A;  1GJX A;  1B1Z A;  4QUF A;  3S2D B;  4WFN 3;  1GUS A;  1GUO A;  3HOY B;  4IFD G;  5K36 G;  3NE5 B;  1SXT A;  4K8I A;  2I07 B;  2DNC A;  2AQ3 B;  2JE6 I;  4LJZ C;  4GZY C;  4G4K A;  2NN6 G;  1S5D D;  1XX8 A;  5HGT A;  4FXG C;  2B2T A;  2MUY A;  5D3I B;  1EYD A;  2HDL A;  5I2Y A;  3D6C A;  2CQA A;  2F0S A;  2LMC B;  1M8A A;  4RFB A;  5F2D A;  3TP5 A;  2NBF A;  5M5W B;  5CV5 A;  3G6J B;  3VR5 A;  4BS9 A;  2XSC A;  3OMG A;  3NTK A;  1RF2 D;  1ILP A;  3OWF A;  1BUV T;  2M2L A;  4PMW A;  4DAP A;  1VF7 A;  2L0C A;  2PQE A;  3I70 A;  4XT3 B;  5DM7 3;  2CVR A;  3I4N B;  1U9R A;  3S2H B;  1PRT B;  1DOM A;  1EWH A;  4RKL A;  1J9O A;  3V05 A;  1CHP D;  3UI2 A;  1JWM D;  2EZV A;  3T53 B;  1JWS D;  3TP8 A;  4X3U A;  2B2V C;  2NVY B;  4A3K B;  3MA2 B;  4ZUI A;  3T56 B;  3LWU A;  3GTQ B;  1S4Z A;  1JOQ A;  4WRD A;  2F0F A;  3TZD A;  2YU9 B;  2L11 A;  3I4M B;  3PO3 B;  1KAB A;  4ABN A;  2B2V A;  4FYD A;  4RGM A;  2M9V A;  4XYQ A;  2KOL A;  5EQ0 A;  2JA5 B;  1EY5 A;  3PUY A;  1TT2 A;  4MIU A;  1F2M A;  5T1I A;  3JAM L;  3W2D A;  3FEW X;  3KLS X;  3H3V C;  4KY5 A;  4ZK9 B;  1PRT D;  1I3Q B;  3OIQ A;  1SNQ A;  4DNR B;  5I9O A;  3WOE A;  3WOF A;  4WOR A;  2AQ1 B;  1LT3 D;  1TQO A;  1YNJ C;  2YYZ A;  2XWB B;  5BN3 A;  4HMI A;  4HED A;  3GP7 A;  1ENA A;  3C1E A;  2IL8 A;  4FO2 A;  1HUN A;  3LNN A;  5FO7 B;  2IX1 A;  4IZ8 A;  4IFD H;  4CKB A;  4XT1 B;  5K36 H;  1BBX C;  2WKD A;  2EYM A;  3S1Q B;  2M00 A;  2SDF A;  2AWO A;  2NN6 H;  1SE3 A;  3EA6 A;  1STA A;  4N9T A;  5KND A;  1H9M A;  4E6I A;  3D4W A;  3Q23 A;  2RSN A;  2E74 C;  3RMH A;  1NAP A;  1TS2 A;  2EYJ A;  4DA2 A;  4X3K A;  2X69 A;  1LTB D;  2R61 A;  3K59 A;  4FXD A;  3FKI B;  2F0N A;  1IL8 A;  2QCP X;  2Q8T A;  1Q8I A;  2PO4 A;  1CM9 A;  2ICI A;  4ZYS A;  3S15 B;  2EYL A;  3OW7 A;  2F3V A;  4HR7 B;  5KRU A;  1Q12 A;  5I6Y A;  1MI2 A;  3EVQ A;  3PUX A;  4M8A A;  1M4V A;  2LY7 A;  1H9S B;  2D5D A;  1PTO C;  1WCM B;  1E0B A;  4ILW A;  3HS0 C;  4KY6 A;  1ML0 D;  3FVQ A;  1PFN A;  2MJ8 A;  2D2C C;  4ULL A;  3K5N A;  3GTP B;  4FF2 A;  4R8N A;  3NXW A;  4NMZ A;  1EY7 A;  1LV9 A;  1MGS A;  1GUN A;  3PUZ A;  4F87 A;  1WTW A;  1BXT A;  4TQU S;  1DON A;  4C3H B;  1I6H B;  5EBD A;  3D3R A;  5KNC A;  2ICE C;  2A6E C;  2H1E A;  2HCI A;  3N6R A;  1GHK A;  1Y8N B;  3M85 A;  4RGT A;  4CBV A;  3S16 B;  1VMP A;  4PQX A;  3TDQ A;  1AP0 A;  4YIJ A;  4O42 A;  1BOS A;  1TWF B;  1D6E C;  1F2Y A;  3SHL A;  1HFN A;  2V4D A;  4KN7 C;  1U4R A;  1II3 A;  2WAQ B;  1ET9 A;  3F2U A;  2WV6 D;  3R2I A;  1R4Q B;  2FFK B;  5E3F A;  4DNT B;  5C5M A;  1SNP A;  4H7B A;  1YNN D;  4KKS A;  5K5P A;  2IX0 A;  5A35 A;  4KKT A;  5JVG 3;  1SNC A;  3S14 B;  2IWH A;  5JPM C;  4BWG B;  1LTT D;  3OHX C;  4MN3 A;  1OXX K;  2K33 A;  1LLR D;  5EKI A;  1B9M A;  2QEJ C;  1O7L A;  1QIL A;  2B2W C;  1GUW A;  3PV0 A;  1A15 A;  3K57 A;  2F0U A;  2OT2 A;  2PNR C;  2F0K A;  5COR A;  3TP7 A;  5LHY 1;  5CGK A;  3HP3 A;  1XTC D;  5C0X G;  4XQQ A;  3Q22 A;  1SJE D;  1Y8P B;  5IGF A;  4L6T B;  3IKJ A;  1KDB A;  2RQX A;  2B2W A;  1WTQ A;  4J8Q A;  2RA4 A;  5M5X B;  1A3U A;  3I8Z A;  5E4W C;  5EBC A;  2BE5 D;  4J6H A;  1KAA A;  3K0Y A;  2F3W A;  3X3N A;  3HOX B;  4QF4 A;  1IW7 D;  3TN2 A;  3SE0 A;  3L9A X;  4KN4 C;  1B4O A;  3C3L A;  5J22 A;  1DOK A;  1OXV A;  2K5Q A;  3BYT B;  1TY2 A;  1BCP F;  4XTC S;  3W3A A;  1BCP C;  1GHJ A;  1QWY A;  3V96 A;  3RZO B;  3NQT A;  4RKB A;  5FLX L;  3GQB A;  1A2T A;  1MSG A;  1JWU D;  4C1N K;  2A73 B;  3PIO 3;  3X3M A;  3MXN A;  1I4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...