4RAUC

Crystal structure of rtofab in complex with human pf4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
EDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of RTOFab in complex with platelet factor 4
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords RTOFab light chain
total genus 5
structure length 65
sequence length 65
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rauC00
1O80A 4QUCA 1G91A 1MI2A 2D9UA 2N88A 1AP0A 2L11A 1BNZA 2B2TC 1F2LA 2L1BA 2MGSA 1NAPA 5AFWA 2R3ZA 1QNKA 5D14A 4R9WA 2BDNA 2SDFA 1WTWA 1U4MA 1HUMA 5E4XA 1C8CA 1IKMA 2B2WA 4U68A 1HUNA 2KECA 2X6LA 2B2YA 1BF4A 1DOLA 1U4RA 4RA8A 2HCCA 3I91A 3KBXA 1DOKA 4R8IA 1DONA 1IL8A 1B53A 3I3CA 1PFMA 5COYA 1GUWA 2KEEA 2K03A 1J8IA 2K05A 1DOMA 1B2TA 4ZAIA 2KUMA 4NW2A 1U4PA 5CMDA 4CJ1B 4QUFA 1WTVA 2NYZD 1EOTA 2RA4A 1AZQA 4OIKA 2L12A 1VMPA 3SVMA 5T1IA 3TZDA 2L9HA 1JE4A 1PDQA 2MPMA 2FJ2A 5CORA 1KNEA 1RTOA 1SDFA 2FMMA 3P7JA 1EIHA 1BO0A 5EQ0A 3R93A 1VMCA 3DEOA 2RVLA 3IFDA 1LV9A 3MTSA 3DEPA 3G7LA 3UI2A 2B2WC 4XT1B 5D65A 1CA5A 1RODA 1WD0A 2L4NA 2EE1A 1IKLA 4ZK9B 4CJ0B 1ILPA 1G2TA 3FDTA 3GV6A 2CVRA 1KNAA 2X69A 1EQTA 1F9PA 1NR2A 2FFKB 1PFBA 2HDLA 5EPLA 5EPKA 1NR4A 3ONAB 4IUTA 4MN3A 1BBXC 1PFNA 2KVMA 3MWYW 1RHPA 4IUVA 1X3QA 2H1EA 4IUPA 1J9OA 1SSOA 1MGSA 1RTNA 1XYIA 1A15A 1ICWA 3KUPA 2B2UC 1SAPA 2VXWA 5E4WC 4ZLTF 1Q3LA 1E0BA 1ML0D 3F2UA 4HCSA 1U4LA 3DM1A 4X3UA 1CM9A 1B4OA 3LWEA 2X6GA 2M2LA 2MJ8A 3D6WA 4XDXA 4HEDA 4MHEA 3N52A 4UAIA 4X3KA 2N55A 5T1GA 1MSGA 1QG7A 3Q6SA 1EIGA 3I8ZA 1M8AA 2Q8RE 1QE6A 2KOLA 1F9SA 4X3SA 1WTRA 2DY8A 3GV3A 3IL8A 2K04A 3QO2A 2HCIA 4ZKCB 1CA6A 2K01A 5EPJA 1WTOA 1B50A 2JYOA 4OIJA 2B2YC 1ILQA 2K28A 1ZXTA 2MP1A 2NWGA 2B2VA 2B2VC 4HSVA 2KEDA 2HUGA 1WVLA 1X3PA 1S4ZA 1B3AA 2FINB 2J7ZA 2K1BA 4LMQD 1HRJA 4ZKBB 1G2SA 1HFNA 2RSOA 1WTQA 1PLFA 4CJ2C 5CBAE 5DNFA 2B2TA 1TVXA 4XT3B 2HDMA 1XX8A 2IL8A 1F9QA 1HHVA 4RWSC 2NZ1D 1HA6A 1WTXA 3FPUB 1EL0A 1DZ1A 1G6ZA 1F9RA 1AZPA 3I90A 1ESRA 2XIWA 4HAEA 2JP1A 3H91A 5EKIA 1WTPA 4RAUC 1HFGA 1NCVA 3HP3A 2EOTA 4X3TA 2Q8TA 2EPBA 1JICA 1O7YA 2FHTA 4IURA 3TN2A 4DN4M 5CBEE 2B2UA 1WD1A 4IUQA 1X32A 4IUUA 2RSNA 5JJZA 1MSHA 2DY7A 4O42A 5EJWA 1O7ZA 1RJTA
chains in the Genus database with same CATH superfamily
2E74C 1PH8A 4XTCS 1YBYA 1O7IA 2UXBQ 1AP0A 3E6ZX 1F2LA 2IWHA 2LXKA 3SDZA 3A7AB 1O7LA 1JWMD 2CWAA 3GTPB 4QQBX 1N34L 2NTTA 4A3IG 3ERQA 3NTKA 1BOSA 1JOQA 4DNIA 3S1NH 2R7ZB 4KV6A 4BBRG 1IBLQ 2R93G 4JI2L 5T1IA 2F0FA 2HHHL 3S1RH 1PTOC 3NPPA 1GOZA 3S16H 5IP7H 4GNXB 4B3ML 4YY3L 2L4NA 3IAYA 2NN6H 3JAMi 3GTMH 5C0XG 4F7XA 4K8IA 4HSPA 3HOVB 4A3FH 4BBSH 1RHPA 4JW0A 2DN8A 3VYUA 1ZEQX 1PTOH 4LF9Q 3KUPA 2VXWA 3L2PA 1U4LA 5I9OA 5IGDA 3LWEA 2MJ8A 3VDYA 2E2JB 2KCMA 4HEDA 1PH3A 4UAIA 4X3KA 5DM63 1FVIA 4K2LA 2KOLA 1T9HA 3SK4A 4GOPC 2WFWA 1N8RC 3A7LA 3HOWG 1R4QB 2G9HD 2MP1A 2OF1A 3M4OH 1X3PA 3CP0A 3P20A 2N49A 2F0JA 1S4ZA 1HRJA 1E22A 1EY4A 5JJLA 3SEBA 4NXML 4JOIA 1SBBB 5C4JB 3G6EA 3OMCA 5FJ8G 4FF2A 4IFDG 2NVXB 3D3RA 2JA8B 3IRBA 2F0KA 1SYGA 5IYBG 3HOUG 3KYHC 3CPFA 1WYDA 4KY6A 5IP9G 3MVVA 1O78A 1JICA 1S3OA 4DN4M 4JPBW 4A3FG 2K5DA 4YCWA 3J81c 1VQLA 2O5JC 4DGZA 4FYDA 3A5ZB 1LM0A 3S15B 2N88A 1V9PA 5KYLA 1HH2P 1KDCA 2JA8G 3NSWA 1D6EC 4G57A 1IKMA 1N33Q 1QOHA 1U4RA 2ZTEA 4A3CH 3DUZA 2KEEA 1CUKA 4X66Q 2K05A 1WCMB 2F0SA 4E6IA 4NPSA 2KUMA 3GTJB 4ODGA 3Q23A 1B2TA 1J5EQ 4MIUA 2RA4A 3G4SA 2B8GA 3F2BA 1IBMQ 3SVMA 1BUVT 3SE0A 5GROA 1JJ2A 2NUCA 2MPMA 1VQ7A 1SE4A 4K0KL 1DYQA 1HZAA 4LF7L 3GDEA 3UI2A 2EVBA 1Q12A 1YHBA 3QOJA 3QOLA 2K5HA 4GZYC 3RNUA 4DR3L 2CVRA 1ASYA 4KHZA 5EPLA 3PO2H 4IUTA 3RZDB 2I0QA 1EEFD 3UDIA 1HTLD 1L1OB 3AB9A 3OPOA 4CDEC 3M7GA 1H9JA 4LAAA 5C6AA 4CBVA 1VQNA 1NE3A 1Q8KA 1EIYB 4A3LH 1CK1A 3K7AB 4B3TQ 4UP9A 4JI6L 4XDXA 2KJXA 3N52A 3K7UC 2N55A 4DV0Q 1H9RA 2ZTCA 2OXPA 1JB3A 5CV6A 3HOZH 1YJWA 1BCPB 4ABNA 2K04A 4JI7Q 3K6OA 4C3IH 4DPGA 2K28A 4JC0A 1CZWA 1W2BA 1Q81C 1U9RA 2QKIC 2DGYA 1EQVA 4KHPL 4WRDA 2QW7A 3UDXA 2I5HA 2IJ0A 3K0YA 4JI0L 3AU7A 2JA7G 4XYOA 3PF4A 3E3XA 5CGKA 2IY5B 2A68D 1XX8A 2EYHA 2WAQE 3NQIA 4MTKA 4RGNA 3RN2A 1HA6A 4GLXA 2E5LQ 2EJGC 5C3EB 1ESRA 4H44C 4JI7L 1ENCA 4P72A 4X3TA 4JBJA 1TKWB 1X3FA 1YEZA 2AQ3B 2TSSA 1SJHD 4IPDA 5BN5A 5CV9A 1EQRA 3NBIA 4ZQ3A 3CRKC 4DXGA 4K6DA 1L0WA 2EYFA 4OXPA 1NAPA 1HZBA 1LACA 3E5SA 4TSSA 1HZ9A 1SNCA 2ICEC 3CU7A 4HJ8A 2WB1E 4HIOA 3R3OA 4C1NI 1Y1WG 4A75A 1LABA 1D5ZC 2K03A 4ZAIA 3DWPA 2F0MA 4QUFA 3NWTA 2F0TA 2NYZD 2EYJA 2A1AA 1I94L 1S5ED 3HGBA 4R8NA 4YY3Q 3TBIB 4GS3A 3VR4A 5BR8Q 2WACA 1YJ9A 3M4QA 3R2TA 3HOZB 1BO0A 4CKEA 1SE3A 3RUZA 3IFDA 4DK3C 3UE1A 1II3A 3H6MA 3C46A 3M7NA 4RFBA 2F0QA 3GP7A 3C2PA 5G3LD 3CCLA 1GUSA 4ALPA 1VDZA 3M4PA 4JV5L 4DNTB 2VUMB 5IYCH 2CQAA 1GVPA 3RD4A 1Q1EA 2OEOA 2MQHA 1SEBD 4DV6Q 3TZUA 5IODA 1FGBD 1ICFB 1PVOA 5IGFA 1E2VA 3H09A 4YHHL 1HXYD 3OWEB 1E2ZA 1KTKA 1FD7D 5M9OA 2EYMA 3K80C 2OQKA 1I4QA 3OIPA 3RZOH 2ZXPA 5CC4A 5CBAE 4L5SA 1I4RA 1I3QB 4K5XA 5IT9c 3CC4A 1HPCA 2K75A 2Q2IA 3PUVA 1Q86C 4BXXH 1ENFA 1LYLA 5GADC 1Q1BA 1PH6A 3CD6A 4DR7Q 1UAPA 3TN2A 4L8JA 3BVGA 3J7AF 4DR6L 2RDFA 3UE0A 4Y52H 3VA7A 1GXDC 5LHY1 2DY7A 1EWIA 3CXCA 2IX1A 1O80A 4JBWA 1KHIA 3KLSA 4P75A 4RGTA 1STBA 2KHJA 3FKIH 5D14A 5E7NA 4TRDA 1BDOA 1EQQA 3KDFB 4JBMA 2HIXA 2KECA 1EY9A 2B2YA 2CH4A 4A3JG 1PFSA 4DK1A 1STGA 3I70A 5ELEA 1OXVA 1JMCA 4L5TA 1TWFH 1LO5D 2B29A 1JJGA 1AZQA 2L12A 5GAHC 4LUVA 1VQIA 4GN5A 2C5CA 4A4IA 3MXNA 2F3WA 3PIPA 3KJPA 4IO9A 1VQOA 4KKSA 1CT1D 1SNQA 3E9IA 1NBWA 3OTOL 3CF5A 1C4QA 3P7JA 3SK5A 1D1IA 2RVLA 1ET6A 4X6AH 4XT1B 3EVQA 2JA5G 4QY7A 1TWHB 2L0CA 2Z8LA 2EXZA 4QCLA 3Q22A 2LXJA 1KRSA 2EYOA 1JOKA 3KF8B 1M4VA 3J81j 1PFNA 5TSSA 4FNFA 4A3KB 4IUPA 1MGSA 4OGQC 1PTOB 4DAVA 1RTNA 1W6KA 2K32A 5ELFA 4ZLTF 4FO2A 3OOCA 5I4DA 3W1GA 3S9WA 1E0BA 1UEAB 4J15A 5FLXE 3GTLH 4PQXA 3DLLA 3G48A 1NNXA 5M5YH 4IOAA 4QMGA 1A2TA 5T1GA 1X3GA 5C3EG 3EN2A 4U673 1IBKL 1S72A 1EUJA 4B9XA 5DLQE 3E9HA 3PUWA 4DAYB 3U9SA 4DV5L 2NVTB 4JI1Q 3A54A 1PH5A 2K1BA 4LUZA 3H3VI 2ZM6Q 4CJ2C 2FXQA 5DNFA 3ULPA 1QCBD 2JSOA 3T1HL 3KLSX 2EYPA 2WAQG 4TVAB 2BCOA 2DUDA 2EOTA 1GHJA 4M1UB 2C35B 5JVG3 4KY5A 5JJZA 1EYAA 3CCUA 4JI8L 4OL7A 1FNUA 3HOXB 1QNUA 3GD7A 4JK1C 2F4IA 4C3HG 1SNPA 3GTGB 1K8AC 1VQ9A 3H0GB 1T5XD 1V8QA 4JI4Q 1A63A 1IYUA 1TWFB 1HUMA 5E4XA 2B2WA 4QIWE 2QF7A 3H3VH 1CKNA 4BA1I 2KCNA 5C4HA 4JI4L 2M00A 3KBGA 4ID6A 4A3JH 3MXGA 3F2DA 1FJGL 2E5LL 4X62Q 3DHQA 4JG2A 1YNJD 5M5YB 1PMRA 2DNEA 5CMDA 4IPHA 4KN4C 4DR1L 2UXCL 3M9BA 1Y69U 1WCMH 4YWKA 1TY2A 1YHAA 4MTNA 1RTOA 4NB3A 4KTAA 2ES2A 2B39A 5C0XH 1EZ6A 1TQOA 1I6HH 1LV9A 3M85A 4BBSG 1Y1VB 4C56C 2PO4A 3NK9A 1XPUA 2LKVA 1PTOF 2G9DA 4RH6A 2Z4IA 3FKIB 4JI1L 5K5PA 1XPRA 1GUNA 1MJCA 2F0WA 2KVMA 3OSOA 4DXFA 3TDQA 1RKNA 2YTXA 4B3RL 3RZDH 1B9NA 4JI3L 3F2UA 5M5XB 4JI2Q 3A55A 1CQFA 1ASZA 2HD3A 1I6VC 2Y0SB 4NXNQ 4EQNA 1OXUA 3T4AC 2JEAI 3D4DA 3EQLC 4ZKCB 3BVZA 1OO9B 2ICIA 4UY8C 3SR1A 1P16A 2B2VA 3G6JB 3NTIA 4C3JG 2J7ZA 3MAQA 4ZUJA 1LT6D 1HFNA 2F0VA 4N8X1 1HTPA 4JI6Q 3A8KE 3MA2B 4AYBG 2PZWA 4UP8A 3V05A 3CCMA 2NZ1D 1F9RA 2RHSB 2XIWA 5CR3A 2E2JH 2AQ1B 3AYHB 5FJ8H 5CBEE 1Y1VH 3DWAA 5CYUA 1YJNA 1V1QA 5M5WB 1KABA 3HFZB 2NN6I 4AYBB 1JJCB 3A8JE 4ULLA 4QGUA 2HIVA 4A3FB 1YITA 3D8GA 2B2TC 5AFWA 3V96A 4YCUA 2R3ZA 3K57A 2ALYB 4LFBL 2A6EC 3PO3H 3A56A 3DXJC 2UXBL 4LF6L 3S1MH 3FRPB 3T56B 4G4KA 5AJ3L 3LGJA 2I07B 1V1PA 4EGVA 4CJ1B 1Q8IA 4NXMQ 2CH4W 1QJOA 1IZ6A 5M3FB 5ELOA 1VQ5A 3QWNA 4FF4A 1SDFA 4HMJA 1SNOA 1VMCA 2YTVA 2RBMA 4DR4L 1CKOA 1LTSD 5IGCA 4DAPA 1H9SB 4BWGB 4X64L 4J1MA 4Q0FA 1WTPA 1F9PA 2Q8TA 2LSSA 4IPCA 3NELA 1Q82C 1R9TH 2E2IH 2VZAA 3ICEA 1JE5A 2DNCA 3HOVH 1EY8A 1ML0D 5FLXL 5EBDA 2IW3A 2YYZA 5EKLA 4R4CA 1N36L 3WDNA 3OHXC 1HZCA 4J8QA 5C3EH 2B63B 2IHEA 3T51B 4RG1A 1S5FD 2NZHA 3I4OA 1B8AA 4FF1A 1EWCA 3LX0A 2FMCA 4DU9A 1PH1A 4EVOA 2JYOA 3CAMA 4OIJA 2D62A 2JQOA 3NP8A 4PMBA 4BXXG 2R93B 4OO1I 1YHQA 1L0XB 1WFQA 2UUCL 4I65A 1I4GA 1K3RA 1HHVA 2XGTA 1AFPA 1I4PA 4K5WA 4H02A 1AZPA 2N3SA 4A3DG 1UUPA 2JA5H 1PRTC 5EKIA 1O7YA 2NB0A 1TWHH 1B44D 3DWQA 3K7AH 1VQ8A 3BJUA 3UDFA 4JV5Q 1IXRA 1WI5A 1B53A 3HS0C 4A3GH 1NSNS 1EY0A 2RQXA 1VF7A 3I7FA 1KXLA 2F4VL 2Z0SA 4IJLA 4R9WA 2HHHQ 1NJIC 1Z6HA 1E1TA 2XRQD 2LS01 4ME5A 4PZ8A 3KF8A 3CQZH 2X6LA 4AH6A 2ASBA 2E8GA 4YHHQ 1VQKA 4IOCA 3AEVA 3I91A 3FPPA 1AE3A 3KBXA 3OIQA 2UXDL 3VYTA 2ENBA 1GUWA 5HURA 2QDBA 5IYDH 3F2CA 1WTVA 3B6YA 1B70B 5J3BA 1VQHA 2WKDA 2R93H 4R4TA 3GTJH 1Y8PB 4IFDH 5JAVA 4FXKC 1PRTF 2VL6A 1VQ6A 1HA5A 3ULLA 1CHPD 3L7ZC 4M8AA 1YI2A 4LF5L 3G7LA 4AYBE 1BR9A 2XTIA 3K5LA 3CMAA 1BVSA 3J80E 4A3EH 1EY6A 5KRUA 1A3VA 2CFMA 1WD1A 5K36G 1SYCA 2D0PA 2FFKB 1NR4A 5HY6A 3J7AV 1IW7D 1X3QA 4JI5L 3J7ZC 2KQ3A 2NVXH 5DM73 5IY0A 3M4YA 1ICWA 4IALA 5E4WC 2WAQB 4K8JA 4HCSA 1H9SA 1UEBA 4P74A 1PH2A 3J80c 1HR0W 2CW0D 4HN7A 1QZGA 3OYYA 4POFA 4IFDJ 5H1SE 2O4XA 4OWTB 1SXTA 1IBLL 1WCMG 3T53B 1WTOA 4JI0Q 3HOWH 2R92B 1PZJD 1ILQA 2EY5A 1ZXTA 3I4MB 1STNA 1A62A 4ZKBB 2VUMH 2K5WA 3HOYG 3K5OA 4A3MG 1LTBD 2ID0A 4LK1C 3J81i 3K59A 4GKKQ 4WJ3M 4OX9Q 3PUZA 3P75A 2E75C 2XN9C 1G6ZA 1GJXA 4BY1G 2BDOA 1OTCA 3I90A 3E0EA 4LF7Q 4RAUC 4B3TL 3TMEA 4OO1H 1UE6A 2Z4HA 1F2YA 4ZYSA 1R4PB 3HEJA 3S1QH 2AUKA 4OEMB 1O7ZA 1FR3A 1J8IA 2KHIA 3NXWA 1CSQA 4X66L 3TS2A 2L55A 2K14A 4C2MB 2VQEL 2JJQA 5C4JH 2JA6G 5FO7B 4DR1Q 3I4NG 4AIMA 1K0RA 4LF9L 1WTWA 1HNZL 4GKJQ 3PMFA 2N8NA 2F0GA 1FJGQ 1MD2D 2PI2A 1CZGA 4DV7Q 1DOKA 1K9MC 1IL8A 3S16B 4DV0L 2R61A 4R1JA 1U4PA 4J6HA 3KFUA 4BS9A 4QIWB 3OWFA 3KLRA 2V1CC 1HNZQ 4GKJL 3S2DH 3DM3A 4LJZC 2FJ2A 1TXYA 1TS4A 5EGTA 3QIAA 5KIXA 1H9KA 2PQAA 1K3BC 4KKUA 4GN4B 1VQMA 2EE1A 4P71A 1ILPA 3FDTA 3GTKB 2CWPA 3IKJA 1QVGA 2A68C 3NQTA 3ONAB 3I4NB 1K28A 1E24A 4IUVA 1TWGB 1EIFA 4C3HB 1LLRD 1TT2A 5IYDG 1EY7A 2AWNA 3U58A 3BYTB 2VB2X 1ONLA 1CI3M 5ELBA 2CCZA 4RCNA 2A5HA 1KQSA 1KDAA 1K83H 3SXHA 4JBKA 1HNXQ 4LNQA 1NY4A 1TWAH 1HNXL 4HTHA 1LTRD 4UDUC 5GAEC 2ZJRA 2ZTDA 1PTOD 3AQQA 2PCFB 4APVA 4BBRH 4EQOA 4CDFC 2AMCB 2Z6KA 2VB3X 4GOPA 4F87A 4LF4Q 4IQZA 2JA7H 4RHRA 4JYAQ 1SR3A 3S24A 2UU9L 3X3NA 3V2TA 5CV5A 1WTXA 3FPUB 1YNJC 3KF6B 1H95A 2PPBC 2VUMG 3BS1A 3H3VC 2FHTA 4LW1A 3ITPA 3KDFA 3CKIB 3K5NA 5IIFA 2F0UA 2NTSA 1G91A 1LT5D 1FGUA 1S5CD 1TWGH 3MFYA 1XMOL 4A3KG 2L11A 4N9TA 2MNAA 3HOVG 1G291 3RLNA 2YU9H 1U5KA 4A3CG 4L5QA 1BKBA 3W1BA 2B63H 1E7ZA 3MC0B 4JI5Q 4X65Q 4S3SA 3QB3A 3K5MA 2EZVA 1XXGA 5M3FH 1K83B 5ISRA 5G3LF 1WTHA 3U50C 4AQYL 2A19A 2RF4A 1XNRQ 1NTGA 2MO0A 1LTLA 3BDOA 3VR6A 1UE5A 1K8OA 3DEPA 3KK7A 5HGQA 4BA2I 1WD0A 4ZK9B 1M1KC 5IP9H 1G2TA 1MIUA 1GUGA 3GV6A 3JAML 4NMZA 1HNWL 3P1HA 1XMQQ 2X69A 4DV4L 4PZ6A 4K14A 5KNCA 2UUAL 3CCQA 1SSOA 4XIGS 3CW2C 2XRSD 3S2DB 1VQDA 1CTMA 5J1ZA 2B2UC 1V1PB 3HOYB 4HR7B 3M4OB 2WV6D 2HQLA 4DAYA 3MXPA 3VYSA 3CHBD 1G6PA 1IL2A 1JT8A 5C4XH 3SK8A 5JPNC 3T1YQ 4PZ7A 5LMNL 3EIVA 1M8AA 2Z6KC 4LF8Q 3D31A 4LFAQ 2LY7A 1CA6A 1QUQB 1D5MC 1Y1WB 2OT2A 3HKSA 2HUGA 2JK8A 5JOBA 2C9OA 4G7HC 3PF5A 1B3AA 2KCTA 2R92H 1WTQA 2PQEA 1STYA 1K8GA 5IWAQ 2HDMA 5K36H 1L1OA 2E2DC 2GVAA 1KL9A 1UWVA 4C3JH 2MFIA 1DZ1A 1Q90A 1STHA 2MO1A 1NCVA 3BDCA 3CCVA 5LMUQ 4LF6Q 4CKCA 2MUYA 5JPMC 1STEA 1B9MA 2CKZB 1GM5A 2P5ZX 2HQEA 4A3MB 4A3EG 1X56A 2EDGA 2SEBD 1E3PA 4GLAC 4C1NK 2SNMA 3HOWB 1JOOA 1K73C 1SYBA 4LFCL 3STBC 2ZXOA 2K33A 4GOPB 3TS0A 1J5EL 3GTPH 3HOZG 5F2DA 1CKMA 1TY0A 2WINB 5M3FG 3M3YH 4DV3L 4X64Q 1VMPA 5M5XH 2M9VA 2SNSA 5E3FA 2EQSA 2VQFQ 4JVZA 4DV4Q 4XQJA 2PW7A 1QVCA 1VQEA 4KK7A 4L5RC 4HJ7A 1XJVA 5CV4A 4A3GB 4OO1G 3FVQA 2B3GA 2PZTA 3SGIA 4LF8L 4EQPA 4RKBA 4DA2A 5I9PA 5D65A 1GUOA 4OELB 4CJ0B 1T5EA 2JA9A 2JA5B 3HOXG 3KJOA 3K8AA 2NN6G 4DV3Q 1EQTA 5IGEA 2PW5A 1BNZA 1YNNC 4A3DB 4A93B 4BY1H 1CQVA 1BQQT 1GO3E 4DR3Q 1XYIA 1VF5C 4BBRB 3HOUB 1NMGA 2D0OA 1JQYD 2NZOA 1AN8A 2A69D 1N34Q 5FLXc 4MHEA 5LL6X 3PGZA 4DUZQ 3PSIA 1JB7A 2JA6H 1LTAD 4FP5D 4DNRB 4X3SA 1VQGA 3EROA 4A3BG 2IT1A 3J7YW 2B2YC 4QJFA 1SFOH 1K8MA 1SJED 2KEDA 2XVSA 3GTGH 4DAMA 3OTOQ 1DJRD 1DXMA 3OMGA 4JI8Q 2EXDA 1AH9A 1X6OA 5LMNW 2JN4A 4A3JB 3ERSX 4B3RQ 4R4IA 2CHBD 1PA6A 3H91A 3I72A 5D3IB 1GUTA 2R92G 3HP3A 2JXMB 4A3BB 4DF7A 1JC7A 2QILA 4QL5A 1QILA 3BZKA 5JJKA 1DD2A 4LFAL 1LUZA 4F88A 4A3KH 1PZKD 2E2IB 1R9TB 1UE1A 1QUQA 4RCOA 4MZ9A 2NVQH 3RLOA 5KNBA 5A2QL 2OTLA 4KD4A 4JI3Q 2VY3A 5AJ3Q 2TMPA 1C48A 5IWAL 2GN5A 4RA8A 2RHQB 5FO9B 2EY6A 2AKWB 4MNOA 4RHSA 2A6ED 1OXXK 3Q0AA 3CCSA 1UNSA 2PNRC 1V1OA 5C0XJ 4A3IB 1EOTA 4UHVA 1RD9D 3Q24A 1GD7A 4DFAA 1JORA 3O13A 5IP7G 1A6XA 1EU3A 1Y1VG 1RDPD 1PYBA 5C44G 2PZUA 2Z1CA 3S1QB 2BE5C 1XMOQ 2K50A 3L3OC 1KRTA 5FKAC 3BYYB 1QWYA 1D7QA 4WORA 2IX0A 1IKLA 1JR0D 2UUBQ 5C5MA 5L37A 3OW2A 5EPKA 4KHPQ 3MXNB 4DR2L 4MN3A 1BBXC 4KLKA 2LFNA 2WB1G 4DK0A 2OCEA 3FEWX 4YWMA 1LT4D 1DM0B 1SAPA 1U0LA 3T16A 2I46A 5C44B 1EZ8A 4O2DA 5NUCA 4OHJA 5HGTA 1PYSB 2QCPX 3C1FA 5LMUL 1TS3A 1PYWD 1QG7A 4OONA 1XNQQ 2Q8RE 2O5IC 4A3LG 2DY8A 1I3QH 3IL8A 3URYA 2H5XA 4IN3A 2D5DA 2PQAB 3MFGA 4YWLA 1KD1C 2BA0A 2NVYB 1F2ZA 5C3WA 4X62L 3S2HB 4N9PA 1PLFA 4KI0A 4C3IG 1HQRD 1ESFA 1F9QA 1LTTD 1Q46A 4DUYQ 5IYBH 1VCIA 4WJ4A 3I55A 3WOEA 4HAEA 4K0KQ 2F0HA 2IX3A 1HFGA 5DEHA 1MKHA 4IUQA 3T1YL 2L15A 1SYFA 1MSHA 4GNXC 3PUYA 3EFXD 3VA5A 5FLMG 2DJFC 4DR5L 1PRTD 1OXTA 4CDDC 5KNDA 4WFN3 4BY7G 3KLWA 1F2MA 3PCOB 3HKZB 4DR5Q 2Q2HA 1SE8A 2NBFA 2RCNA 4FXGC 2BDNA 1BBUA 2L5TA 5C0XI 1C7YA 1Z47A 3CCEA 3I4LA 4I7AA 1B7YB 1BBWA 1TWCB 2HCCA 1TR5A 1D2BA 2J4XA 1DONA 5COYA 1I4XA 4V190 3CQZB 4Y7NH 1XTCD 1DOMA 2OTJA 3S17H 3S2HH 5J22A 2BOSA 1XNRL 3H0GG 5ELDA 1JE4A 2ZT9C 4DR2Q 1PDQA 3I73A 2ZJQA 2UXCQ 4L6TB 5DAUA 5EQ0A 4ZCKA 5IGBA 1AW7A 3OW7A 1XPOA 1C0AA 5C4XB 2Y0SE 4X65L 4RGOS 2BA1A 1Q7YC 4B3SL 4A93G 1Y8OB 2Q2TA 1PFBA 4DV1L 1CKNB 2CW0C 4LF4L 4JYAL 1N32Q 3CC7A 2K6AA 4DKAC 4IPGA 1KLUD 3VYRA 4Z9CB 2RDGA 1KIXA 1EFID 3A0JA 4TKOB 2EJMA 3U4VA 1IW7C 1S5DD 1CM9A 4X3UA 3PIP3 5LL6S 1V43A 1WOCA 4HJ9A 2ZXRA 1MSGA 5FOBB 3BDLA 2K7VA 3TP8A 3I8ZA 3EA6A 2KHSA 4H0LC 1WTRA 3RMHA 3GV3A 1B50A 2K01A 2KA7A 3CCRA 4GN3B 3ER0A 2B2VC 4HSVA 2K52A 4IUNA 4LMQD 1VQBA 2Z9HA 3LNNA 4PMCA 2RSOA 3SK6A 4H13C 4BY7B 3HOXH 1PXUA 2IL8A 1KLGD 4RWSC 3BG3A 5LMNQ 2BH8A 1E1OA 1S5BD 3FP9A 2JP1A 2OWOA 2MHVA 1LT3D 1PRTB 2YU9B 2JEBI 4N8FA 4IUUA 2RSNA 1PH4A 1I5FA 1F77A 5CV8A 1FYCA 4KJOA 1EU4A 3EBEA 3GO5A 1JWUD 1BCPC 1L1OC 3K58A 4A3GG 1B1ZA 4DV6L 2EIFA 4JOIC 1QB5D 2NVTH 1A2UA 2EJFC 3F1ZA 1SRUA 4P2CB 1C8CA 4G7OC 4HCEA 1SMXA 2G5DA 3RR5A 4UP7A 1Z9FA 3ULJA 2A6HC 3PIOA 2VNUD 2QDLA 3A8IE 3Q8DA 1PFMA 1BCPF 1CFMA 1EYGA 3S1MB 1TS2A 3AMUA 3J81E 3VR2A 3K0XA 3A5UA 5E1FA 1RIPA 3S17B 3ND8A 4NKLA 3MXUA 1AE2A 3NEMA 2QGQA 4ILWA 1KNEA 5M5WH 1Y8NB 1GHKA 5A2QE 2FMMA 2LMCB 5IT9L 3R93A 1EIHA 2RDHA 3D0FA 3DEOA 2PI2E 3MTSA 1TWCH 2B2WC 4IFDI 2F1MA 5C4ZA 5JEAH 1CA5A 3R2IA 5I6WA 2XWBB 2PYKA 5GQOA 1HUNA 1NR2A 2HDLA 3HRZC 4DV5Q 5FO8B 4LWCA 4B08A 2AHOB 4DV2Q 1J9OA 1X9NA 3JAME 4HMIA 1HR0L 3W5OA 1MHWC 3NENA 4NXNL 5IYCG 3I4NH 1Q3LA 4H7BA 4AQYQ 2NVYH 2F03A 3GTKH 2EY2A 3D6WA 3SHLA 3RLFA 2V4DA 1PZID 4LUOA 2KBNA 5C5LA 3EJIA 2F0IA 3H15A 1N33L 3RN5A 1ZYRC 1F9SA 3H94A 2IPKD 1NUCA 3CRLC 3VR5A 2F3IA 2VS1A 3FHWA 4XYQA 3U9OA 4GKKL 1ET9A 3M3YB 3UDGA 2A74C 1QVFA 1Y1WH 1IYVA 4OWWB 1VQFA 4KHVA 5IT9E 1TVXA 4DK6C 4XT3B 1TU2B 2RCFA 4KMUC 1EL0A 5M3MG 1SLJA 4FVMA 1A0IA 4QF4A 4CGYB 1HJPA 2XWJB 4K2KA 3J81L 4POGA 5C44H 3X3MA 2QEJC 4O42A 1G8ZD 4KN7C 1A3UA 4GLVB 3NBHB 1MI2A 2D9UA 2WP8J 2PMZB 1X54A 4DUZL 1N36Q 2D2CC 3GTQB 2I5MX 1U4MA 2F52A 1ZKOA 2VQFL 3ZYYX 1A8VA 3MZ5A 4U68A 2UUCQ 5I2YA 3L0OA 2H4OA 1D1KA 4C3JB 2JA8H 1LTGD 2F0EA 1RCVD 3D4RA 3ZJYC 4LF5Q 1P8LA 3S1RB 4NW2A 2QA4A 1ZYRD 1PV4A 4K5VA 5BR8L 3H0GH 4OIKA 3BU2A 4KKTA 2L9HA 1W6JA 3HKZE 5EBCA 4DR4Q 4F8MA 4XXEA 5ELCA 1I94Q 3ND9A 1FNVA 1SMYD 3PO2G 2QEXA 3TREA 4DV1Q 4PG3A 1RODA 1KDBA 4B3MQ 4OX9L 3BVMA 2YV5A 5IGGA 1A3TA 2YTYA 3QG1A 1WJJA 3FKIG 3PV0A 3MWYW 1CSPA 1SE2A 2H1EA 2XSCA 5JEAG 4GNXA 4PNYA 1SNDA 4BY7H 2F4VQ 4BBSB 4CKBA 1SMYC 1W3SA 4JCVE 3J7A5 4A3EB 1SFOB 1YVCA 2IHFA 2M2LA 4NDXA 4A3BH 1RL2A 3W3AA 1C9OA 1AEXA 2AWOA 3R8BA 4NP5A 3TP6A 4K6LA 5GAGC 3TSSA 4KJNA 2N78A 1DCZA 4YCVA 2WKCA 1YNXA 2F0PA 4FXDA 2HCIA 4A76A 3I2ZA 4FDBA 3GTLB 1MJEA 3K81C 2RKSA 1VQ4A 2NVQB 1PH7A 1G2SA 1CHQD 1N9WA 2F0DA 2WB1B 1UE7A 2VQEQ 1JWSD 2A73B 4BY1B 2JA6B 3LWUA 1FNWA 2DJGC 1SNMA 1I50H 4IZ8A 3T1HQ 1TS5A 1B3QA 1KAWA 4PV1C 3TP5A 3J80i 5M3MH 5D3DA 3S14B 4HIKA 5A35A 4QUCA 4C3HH 5C3XA 5M3MB 1RF2D 4A93H 5JVH3 2L1BA 3PQIA 2MGSA 4O1NA 1Y14B 5JEAJ 2SOBA 5I2XA 1PH9A 1KAAA 3GQBA 2O2LD 3FMCA 4Y7NB 1I50B 5ELNA 1BF4A 1DOLA 1EYDA 3L9AX 3D4WA 1TWAB 5BN4A 3QJYA 2K5QA 1DGSA 2F0LA 2JA7B 4ME3A 2F0OA 3VR3A 5C4XG 1XMQL 2ZM6L 2Q2UA 3J80L 4XQNA 4O0AA 4DUYL 2EY1A 5JJIA 1N32L 2I5LX 2A69C 3STBD 3PIO3 1OXSC 4A3MH 4ZUIA 5CORA 1YIJA 3TP7A 5CV7A 1IYJB 3NBHA 4B3SQ 3PO2B 4IJHA 4P73A 4XQQA 4EX5A 3GTOB 2XNAC 5BN3A 3TRZA 3N6RA 1S40A 2VW9A 3NUCA 2K4KA 4RGMA 1SROA 1KNAA 1X3EA 2UUAQ 2BH2A 3NHHA 1XNQL 1VS0A 4EQ5A 4FF3A 1M90C 1SYDA 2Q8IB 2KENA 2R6GA 4V0BA 3D6CA 3RZOB 3F8TA 3KOJA 2EYLA 3DM1A 5EAYA 3NE5B 1YNND 2F3VA 4DV7L 1YZ6A 2CQOA 4HIMA 4OWXB 3Q6SA 1G51A 2WIIB 3MEFA 2A6HD 2A8VA 1X65A 3QO2A 2BE5D 3MEHA 5EPJA 3CCJA 1NMFA 1IBKQ 2NWGA 3U4ZA 3HZXA 1WVLA 1EEID 2FINB 3JC66 3IFTA 3I4MG 1E2WA 1MBYA 1SN8A 3S15H 3QR8A 4KD3A 2Y0SG 5J39A 2E2HB 1HNWQ 1TIID 1BCPD 5FLMH 3A74A 3PUXA 3WWVA 3T13A 4KY7A 3PO3B 3GTQH 2Z6BA 2K5VA 1IBML 1X55A 4CDCC 2KCCA 3AFPA 4YIJA 1ENAA 5EJWA 2OQ0A 3TEHB 4HIDA 4C2MH 3TQYA 2R7DA 1STAA 1QNKA 2B63G 3W2DA 2SDFA 4A3IH 1J6QA 2R7ZG 3MHBA 1GKHA 2UU9Q 4LFBQ 2E2HH 4R8IA 1IHZA 1LTID 2AUJD 3I3CA 1I4HA 2B8FA 3KF6A 3BZCA 3HG9A 1EWHA 4CHTB 2ZJPA 4RKLA 3HOYH 3TZDA 3I4MH 1L0YB 2AQ2B 3C1EA 5KEEA 1FL0A 4RMFA 3GTMB 3NWSA 3GTOH 4R4OA 1Z7TA 3DMUA 4L63B 4ZRZA 1VQPA 1QZHA 2HT1A 4I7ZC 3C3LA 1A15A 1EFWA 5IOCA 1HQMC 1EOVA 3CC2A 2R7ZH 3S1NB 3WOFA 4G7ZC 2UXDQ 1B4OA 5I6YA 2X6GA 3PO3G 4C3IB 1XTDA 1VQJA 4R4QA 1K0SA 4UPAA 3I56A 1EIGA 4HJAA 3G71A 1I6HB 1QE6A 3NTHA 1KC8C 1HCZA 4WJWA 1H9MA 4DV2L 4QB4A 2R7FA 4LFCQ 1XWEA 1HR0Q 4DR7L 3AFQA 2JE6I 4DR6Q 2GA4B 5KYIA 4B9WA 3JAMc 3HOUH 1SYEA 1VQAA 4HJ5A 2ATWA 1BXTA 2J0TD 1VQCA 2B2TA 1JCKB 3CMEA 4Q5VA 3S14H 4A3DH 3HKZG 3CPWA 1PHJA 2K5NA 5FK9C 4PMWA 1EYCA 5EKKA 1D8LA 1EY5A 2E76C 2EPBA 4TQUS 1D5XC 4IURA 2B2UA 3E0JA 2GVBA 2PNHA 1X32A 2PMZE 3BZDB 1L2FA 5KGUA 2UUBL 2F0NA 5IE8A 1RJTA
chains in the Genus database with same CATH topology
2E74C 4XTCS 1AP0A 3E6ZX 1F2LA 2IWHA 3SDZA 3A7AB 1O7LA 1JWMD 3GTPB 2NTTA 3ERQA 3NTKA 1BOSA 1JOQA 2R7ZB 4KV6A 5T1IA 2F0FA 1PTOC 3NPPA 1GOZA 2L4NA 3IAYA 2NN6H 5C0XG 4F7XA 4K8IA 4HSPA 3HOVB 1RHPA 2DN8A 3VYUA 1ZEQX 1PTOH 3KUPA 2VXWA 1U4LA 5I9OA 5IGDA 3LWEA 2MJ8A 2E2JB 4HEDA 4UAIA 4X3KA 5DM63 4K2LA 2KOLA 3SK4A 3A7LA 1R4QB 2G9HD 2MP1A 2OF1A 1X3PA 3P20A 2F0JA 1S4ZA 1HRJA 1EY4A 3SEBA 1SBBB 5C4JB 3OMCA 4FF2A 4IFDG 2NVXB 3D3RA 2JA8B 2F0KA 1SYGA 4KY6A 3MVVA 1O78A 1JICA 4DN4M 2K5DA 2O5JC 4DGZA 4FYDA 3S15B 2N88A 5KYLA 1KDCA 3NSWA 1D6EC 4G57A 1IKMA 1QOHA 1U4RA 3DUZA 2KEEA 2K05A 1WCMB 2F0SA 4E6IA 3GTJB 2KUMA 1B2TA 4ODGA 3Q23A 4MIUA 2RA4A 2B8GA 3SVMA 1BUVT 3SE0A 2NUCA 2MPMA 1SE4A 1DYQA 3UI2A 2EVBA 1Q12A 3QOJA 3QOLA 4GZYC 2CVRA 4KHZA 5EPLA 4IUTA 3RZDB 1EEFD 1HTLD 3AB9A 3OPOA 3M7GA 1H9JA 4LAAA 5C6AA 4CBVA 1CK1A 3K7AB 4XDXA 2KJXA 3N52A 2N55A 1H9RA 2OXPA 1JB3A 5CV6A 1BCPB 4ABNA 2K04A 3K6OA 2K28A 1CZWA 1U9RA 2QKIC 1EQVA 4WRDA 2IJ0A 3K0YA 3AU7A 4XYOA 5CGKA 2A68D 1XX8A 2EYHA 3NQIA 4RGNA 1HA6A 2EJGC 5C3EB 1ESRA 4H44C 1ENCA 4X3TA 1TKWB 2AQ3B 2TSSA 1SJHD 5BN5A 5CV9A 3NBIA 4ZQ3A 3CRKC 4DXGA 4K6DA 2EYFA 1NAPA 1LACA 3E5SA 4TSSA 1SNCA 2ICEC 3CU7A 3R3OA 4C1NI 1LABA 1D5ZC 2K03A 4ZAIA 3DWPA 2F0MA 4QUFA 3NWTA 2F0TA 2NYZD 2EYJA 1S5ED 3HGBA 4R8NA 3TBIB 3VR4A 2WACA 3R2TA 3HOZB 1BO0A 4CKEA 1SE3A 3RUZA 3IFDA 1II3A 3H6MA 3C46A 3M7NA 4RFBA 2F0QA 3GP7A 3C2PA 5G3LD 1GUSA 1VDZA 4DNTB 2VUMB 2CQAA 3RD4A 1Q1EA 2OEOA 1SEBD 3TZUA 5IODA 1FGBD 5IGFA 1E2VA 3H09A 1HXYD 3OWEB 1E2ZA 1KTKA 1FD7D 5M9OA 2EYMA 1I4QA 3OIPA 2ZXPA 5CC4A 5CBAE 1I4RA 1I3QB 4K5XA 1HPCA 3PUVA 1ENFA 1Q1BA 1UAPA 3TN2A 4L8JA 3BVGA 3J7AF 2RDFA 3VA7A 1GXDC 5LHY1 2DY7A 2IX1A 1O80A 4JBWA 3KLSA 4RGTA 1STBA 5D14A 4TRDA 1BDOA 2KECA 1EY9A 2B2YA 4DK1A 1STGA 3I70A 5ELEA 1OXVA 1LO5D 1AZQA 2L12A 2C5CA 3MXNA 2F3WA 4KKSA 1CT1D 1SNQA 1C4QA 3P7JA 3SK5A 1D1IA 2RVLA 1ET6A 4XT1B 3EVQA 1TWHB 2L0CA 2Z8LA 2EXZA 4QCLA 3Q22A 2EYOA 1JOKA 1M4VA 1PFNA 5TSSA 4FNFA 4A3KB 4IUPA 1MGSA 4OGQC 1PTOB 4DAVA 1RTNA 1W6KA 2K32A 5ELFA 4ZLTF 4FO2A 3OOCA 5I4DA 3S9WA 1E0BA 1UEAB 5FLXE 4PQXA 4QMGA 1A2TA 5T1GA 4U673 4B9XA 3PUWA 2NVTB 3U9SA 3A54A 2K1BA 4CJ2C 5DNFA 1QCBD 2JSOA 3KLSX 2EYPA 2BCOA 2EOTA 1GHJA 4M1UB 5JVG3 4KY5A 5JJZA 1EYAA 4OL7A 1FNUA 3HOXB 1QNUA 3GD7A 4JK1C 2F4IA 4C3HG 1SNPA 3GTGB 1T5XD 1V8QA 3H0GB 1IYUA 1TWFB 1HUMA 5E4XA 2B2WA 2QF7A 4BA1I 2KCNA 5C4HA 2M00A 3KBGA 4ID6A 3MXGA 3DHQA 1YNJD 5M5YB 1PMRA 2DNEA 5CMDA 4KN4C 1Y69U 1TY2A 1RTOA 4KTAA 2B39A 5C0XH 1EZ6A 1TQOA 1LV9A 3M85A 1Y1VB 4C56C 2PO4A 3NK9A 2LKVA 1PTOF 2G9DA 4RH6A 2Z4IA 3FKIB 5K5PA 1GUNA 2F0WA 2KVMA 3OSOA 4DXFA 3TDQA 1RKNA 1B9NA 3F2UA 5M5XB 3A55A 1CQFA 1I6VC 2Y0SB 4EQNA 1OXUA 3T4AC 2JEAI 3D4DA 3EQLC 4ZKCB 3BVZA 1OO9B 2ICIA 3SR1A 2B2VA 4C3JG 3G6JB 3NTIA 2J7ZA 3MAQA 4ZUJA 1LT6D 1HFNA 2F0VA 1HTPA 3A8KE 3MA2B 2PZWA 3V05A 2NZ1D 1F9RA 2XIWA 5CR3A 2AQ1B 5CBEE 3DWAA 5CYUA 5M5WB 1KABA 2NN6I 4AYBB 3A8JE 4ULLA 4A3FB 3D8GA 2B2TC 5AFWA 3V96A 2R3ZA 3K57A 2A6EC 3A56A 3DXJC 3FRPB 3T56B 4G4KA 2I07B 1V1PA 4EGVA 4CJ1B 1Q8IA 1QJOA 5M3FB 3QWNA 4FF4A 1SDFA 4HMJA 1SNOA 1VMCA 2RBMA 5IGCA 1LTSD 4DAPA 1H9SB 4BWGB 4J1MA 4Q0FA 1WTPA 1F9PA 2Q8TA 2DNCA 1EY8A 1ML0D 5FLXL 5EBDA 2IW3A 2YYZA 5EKLA 3WDNA 3OHXC 4J8QA 2B63B 3T51B 1S5FD 4FF1A 1EWCA 3LX0A 2FMCA 4DU9A 4EVOA 2JYOA 4OIJA 2D62A 3NP8A 4PMBA 2R93B 4OO1I 1L0XB 4I65A 1I4GA 1HHVA 1AFPA 1I4PA 4K5WA 1AZPA 1UUPA 1PRTC 5EKIA 1O7YA 2NB0A 1B44D 3DWQA 1B53A 3HS0C 1NSNS 1EY0A 2RQXA 1VF7A 4R9WA 1Z6HA 2XRQD 4ME5A 2LS01 3KF8A 2X6LA 3I91A 3FPPA 3KBXA 3OIQA 3VYTA 2ENBA 1GUWA 5HURA 2QDBA 1WTVA 2WKDA 1Y8PB 4IFDH 5JAVA 4FXKC 1PRTF 1HA5A 1CHPD 3L7ZC 4M8AA 3G7LA 1BR9A 3K5LA 3J80E 1EY6A 5KRUA 1A3VA 1WD1A 5K36G 1SYCA 2FFKB 1NR4A 3J7AV 1IW7D 1X3QA 2KQ3A 5DM73 3M4YA 1ICWA 4IALA 5E4WC 2WAQB 4K8JA 4HCSA 1H9SA 2CW0D 4HN7A 4IFDJ 2O4XA 1SXTA 3T53B 1WTOA 2R92B 1PZJD 1ILQA 2EY5A 1ZXTA 3I4MB 1STNA 4ZKBB 2K5WA 3K5OA 1LTBD 2ID0A 4LK1C 3K59A 3PUZA 3P75A 2E75C 2XN9C 1G6ZA 1GJXA 2BDOA 3I90A 4RAUC 3TMEA 4OO1H 2Z4HA 1F2YA 4ZYSA 1R4PB 3HEJA 2AUKA 1O7ZA 1FR3A 1J8IA 3NXWA 2L55A 4C2MB 5FO7B 1WTWA 3PMFA 2F0GA 1MD2D 1CZGA 1DOKA 1IL8A 3S16B 2R61A 1U4PA 4J6HA 4BS9A 4QIWB 3OWFA 3KLRA 4LJZC 2FJ2A 1TS4A 5EGTA 3QIAA 5KIXA 1H9KA 4KKUA 2EE1A 1ILPA 3FDTA 3GTKB 3IKJA 2A68C 3NQTA 3ONAB 3I4NB 4IUVA 1TWGB 4C3HB 1LLRD 1TT2A 1EY7A 2AWNA 3BYTB 2VB2X 1ONLA 1CI3M 5ELBA 4RCNA 2A5HA 1KDAA 3SXHA 4HTHA 1LTRD 4UDUC 1PTOD 2PCFB 4EQOA 2VB3X 4F87A 4IQZA 4RHRA 3X3NA 3V2TA 5CV5A 1WTXA 3FPUB 1YNJC 2PPBC 3BS1A 3H3VC 2FHTA 3ITPA 3CKIB 3K5NA 5IIFA 2F0UA 2NTSA 1G91A 1LT5D 1S5CD 3MFYA 2L11A 4N9TA 1G291 3MC0B 4S3SA 3QB3A 3K5MA 2EZVA 1XXGA 1K83B 5ISRA 5G3LF 3BDOA 3VR6A 1K8OA 3DEPA 3KK7A 4BA2I 1WD0A 4ZK9B 1G2TA 3GV6A 1GUGA 3JAML 4NMZA 3P1HA 2X69A 4K14A 5KNCA 1SSOA 4XIGS 2XRSD 3S2DB 1CTMA 5J1ZA 2B2UC 1V1PB 3HOYB 4HR7B 3M4OB 2WV6D 4DAYA 3MXPA 3VYSA 3CHBD 3SK8A 5JPNC 1M8AA 3D31A 2LY7A 1CA6A 1D5MC 1Y1WB 2OT2A 2HUGA 5JOBA 2C9OA 4G7HC 1B3AA 1WTQA 2PQEA 1STYA 2HDMA 5K36H 2E2DC 1DZ1A 1Q90A 1STHA 1NCVA 3BDCA 4CKCA 2MUYA 5JPMC 1STEA 1B9MA 2HQEA 4A3MB 2EDGA 2SEBD 4C1NK 2SNMA 3HOWB 1JOOA 1SYBA 2ZXOA 2K33A 5F2DA 1TY0A 2WINB 1VMPA 2M9VA 2SNSA 5E3FA 4XQJA 2PW7A 4KK7A 4OO1G 4A3GB 5CV4A 3FVQA 2PZTA 4EQPA 4RKBA 4DA2A 5I9PA 5D65A 1GUOA 4CJ0B 1T5EA 2JA5B 2NN6G 1BNZA 1EQTA 2PW5A 5IGEA 1YNNC 4A3DB 4A93B 1CQVA 1BQQT 1XYIA 1VF5C 4BBRB 3HOUB 1JQYD 1AN8A 2A69D 4MHEA 5LL6X 1LTAD 4FP5D 4DNRB 4X3SA 3EROA 2IT1A 3J7YW 2B2YC 1K8MA 1SJED 2KEDA 2XVSA 1DJRD 1DXMA 3OMGA 4A3JB 2CHBD 3H91A 3I72A 5D3IB 1GUTA 3HP3A 2JXMB 4A3BB 4DF7A 1JC7A 2QILA 1QILA 1DD2A 4F88A 1PZKD 2E2IB 1R9TB 4RCOA 5KNBA 5A2QL 4KD4A 2TMPA 1C48A 4RA8A 5FO9B 2EY6A 4RHSA 2A6ED 1OXXK 3Q0AA 1UNSA 2PNRC 1V1OA 5C0XJ 4A3IB 1EOTA 1RD9D 3Q24A 4DFAA 1JORA 3O13A 1A6XA 1EU3A 1RDPD 2PZUA 2Z1CA 3S1QB 2BE5C 3L3OC 5FKAC 3BYYB 1QWYA 4WORA 2IX0A 1IKLA 1JR0D 5C5MA 5EPKA 4MN3A 1BBXC 2LFNA 4DK0A 3FEWX 1LT4D 1DM0B 1SAPA 3T16A 2I46A 5C44B 1EZ8A 5NUCA 4OHJA 5HGTA 2QCPX 3C1FA 1TS3A 1PYWD 1QG7A 2Q8RE 2O5IC 2DY8A 3IL8A 3URYA 4IN3A 2D5DA 3MFGA 2BA0A 2NVYB 1F2ZA 5C3WA 3S2HB 4N9PA 1PLFA 4KI0A 4C3IG 1HQRD 1ESFA 1F9QA 1LTTD 1VCIA 3WOEA 4HAEA 2F0HA 2IX3A 1HFGA 5DEHA 4IUQA 1SYFA 1MSHA 3PUYA 3EFXD 3VA5A 1PRTD 1OXTA 5KNDA 4WFN3 1F2MA 3HKZB 2NBFA 4FXGC 2BDNA 2L5TA 5C0XI 1Z47A 3I4LA 1TWCB 2HCCA 1TR5A 1D2BA 2J4XA 1DONA 5COYA 1I4XA 4V190 3CQZB 1XTCD 1DOMA 5J22A 2BOSA 5ELDA 1JE4A 2ZT9C 1PDQA 3I73A 4L6TB 5DAUA 5EQ0A 5IGBA 1AW7A 3OW7A 5C4XB 4RGOS 2BA1A 1Y8OB 1PFBA 2CW0C 2K6AA 1KLUD 3VYRA 4Z9CB 2RDGA 1EFID 4TKOB 2EJMA 1IW7C 3PIP3 1S5DD 1CM9A 4X3UA 5LL6S 1V43A 2ZXRA 1MSGA 5FOBB 3BDLA 2K7VA 3TP8A 3I8ZA 3EA6A 2KHSA 4H0LC 1WTRA 3RMHA 3GV3A 1B50A 2K01A 2KA7A 2B2VC 4HSVA 4IUNA 4LMQD 3LNNA 4PMCA 2RSOA 3SK6A 4H13C 4BY7B 1PXUA 2IL8A 1KLGD 4RWSC 3BG3A 1S5BD 2JP1A 2MHVA 1LT3D 1PRTB 2YU9B 2JEBI 4IUUA 2RSNA 1F77A 5CV8A 1FYCA 4KJOA 1EU4A 3GO5A 1JWUD 1BCPC 3K58A 1B1ZA 1QB5D 1A2UA 2EJFC 4P2CB 4G7OC 1C8CA 4HCEA 2A6HC 2VNUD 3A8IE 1PFMA 1BCPF 1CFMA 3S1MB 1TS2A 3AMUA 3J81E 3VR2A 5E1FA 3S17B 3ND8A 4NKLA 3MXUA 4ILWA 1KNEA 1Y8NB 1GHKA 5A2QE 2FMMA 2LMCB 5IT9L 3R93A 1EIHA 2RDHA 3DEOA 3MTSA 2B2WC 4IFDI 2F1MA 5C4ZA 5JEAH 1CA5A 3R2IA 5I6WA 2XWBB 2PYKA 1HUNA 1NR2A 2HDLA 3HRZC 5FO8B 4B08A 1J9OA 3JAME 4HMIA 1Q3LA 4H7BA 2F03A 2EY2A 3SHLA 3D6WA 3RLFA 2V4DA 1PZID 5C5LA 3EJIA 2F0IA 1ZYRC 1F9SA 3H94A 2IPKD 1NUCA 3CRLC 3VR5A 4XYQA 3U9OA 1ET9A 3M3YB 2A74C 1IYVA 4KHVA 5IT9E 1TVXA 4XT3B 1TU2B 4KMUC 1EL0A 4FVMA 4QF4A 4CGYB 3J81L 2XWJB 4K2KA 3X3MA 2QEJC 4O42A 1G8ZD 4KN7C 1A3UA 1MI2A 2D9UA 2WP8J 2PMZB 2D2CC 3GTQB 1U4MA 1ZKOA 3ZYYX 3MZ5A 4U68A 5I2YA 2H4OA 1D1KA 4C3JB 1LTGD 2F0EA 1RCVD 3D4RA 3S1RB 4NW2A 1ZYRD 4K5VA 4OIKA 4KKTA 2L9HA 1W6JA 5EBCA 4F8MA 4XXEA 5ELCA 3ND9A 1FNVA 1SMYD 1RODA 1KDBA 3BVMA 5IGGA 1A3TA 3QG1A 3PV0A 3MWYW 1SE2A 2H1EA 2XSCA 5JEAG 4PNYA 1SNDA 4BBSB 4CKBA 1SMYC 4A3EB 1SFOB 2M2LA 4NDXA 3W3AA 1AEXA 2AWOA 3R8BA 4NP5A 3TP6A 4K6LA 3TSSA 4KJNA 1DCZA 2WKCA 2F0PA 4FXDA 2HCIA 3GTLB 2RKSA 2NVQB 1G2SA 1CHQD 2F0DA 2WB1B 1JWSD 2A73B 4BY1B 2JA6B 3LWUA 1FNWA 1SNMA 4IZ8A 1TS5A 4PV1C 3TP5A 5D3DA 3S14B 5A35A 4QUCA 5C3XA 5M3MB 1RF2D 5JVH3 2L1BA 2MGSA 4O1NA 5JEAJ 2SOBA 5I2XA 1KAAA 3GQBA 2O2LD 3FMCA 4Y7NB 1I50B 1BF4A 1DOLA 1EYDA 3L9AX 3D4WA 1TWAB 5BN4A 3QJYA 2K5QA 2F0LA 2JA7B 2F0OA 3VR3A 3J80L 4XQNA 2EY1A 2A69C 3PIO3 1OXSC 4ZUIA 5CORA 3TP7A 5CV7A 3NBHA 3PO2B 4XQQA 3GTOB 2XNAC 5BN3A 3N6RA 3NUCA 4RGMA 1KNAA 3NHHA 4FF3A 1SYDA 2Q8IB 2R6GA 4V0BA 3D6CA 3RZOB 2EYLA 3DM1A 3NE5B 1YNND 2F3VA 3Q6SA 2WIIB 2A6HD 3QO2A 2BE5D 3MEHA 5EPJA 2NWGA 3HZXA 1WVLA 1EEID 2FINB 3IFTA 1E2WA 1MBYA 4KD3A 5J39A 2E2HB 1TIID 1BCPD 3PUXA 3T13A 4KY7A 3PO3B 2KCCA 4YIJA 1ENAA 5EJWA 1STAA 1QNKA 3W2DA 2SDFA 3MHBA 4R8IA 1IHZA 1LTID 2AUJD 3I3CA 1I4HA 2B8FA 3HG9A 1EWHA 4CHTB 4RKLA 3TZDA 1L0YB 2AQ2B 3C1EA 5KEEA 3GTMB 3NWSA 1Z7TA 3DMUA 4L63B 4ZRZA 4I7ZC 3C3LA 1A15A 5IOCA 1HQMC 3S1NB 3WOFA 4G7ZC 1B4OA 5I6YA 2X6GA 4C3IB 1EIGA 1I6HB 1QE6A 3NTHA 1HCZA 4WJWA 1H9MA 4QB4A 1XWEA 2JE6I 2GA4B 5KYIA 4B9WA 1SYEA 1BXTA 2J0TD 2B2TA 1JCKB 4Q5VA 5FK9C 4PMWA 1EYCA 5EKKA 1EY5A 2E76C 2EPBA 4TQUS 1D5XC 4IURA 2B2UA 3E0JA 3BZDB 1X32A 5KGUA 2F0NA 1RJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O80 A;  4QUC A;  1G91 A;  1MI2 A;  2D9U A;  2N88 A;  1AP0 A;  2L11 A;  1BNZ A;  2B2T C;  1F2L A;  2L1B A;  2MGS A;  1NAP A;  5AFW A;  2R3Z A;  1QNK A;  5D14 A;  4R9W A;  2BDN A;  2SDF A;  1WTW A;  1U4M A;  1HUM A;  5E4X A;  1C8C A;  1IKM A;  2B2W A;  4U68 A;  1HUN A;  2KEC A;  2X6L A;  2B2Y A;  1BF4 A;  1DOL A;  1U4R A;  4RA8 A;  2HCC A;  3I91 A;  3KBX A;  1DOK A;  4R8I A;  1DON A;  1IL8 A;  1B53 A;  3I3C A;  1PFM A;  5COY A;  1GUW A;  2KEE A;  2K03 A;  1J8I A;  2K05 A;  1DOM A;  1B2T A;  4ZAI A;  2KUM A;  4NW2 A;  1U4P A;  5CMD A;  4CJ1 B;  4QUF A;  1WTV A;  2NYZ D;  1EOT A;  2RA4 A;  1AZQ A;  4OIK A;  2L12 A;  1VMP A;  3SVM A;  5T1I A;  3TZD A;  2L9H A;  1JE4 A;  1PDQ A;  2MPM A;  2FJ2 A;  5COR A;  1KNE A;  1RTO A;  1SDF A;  2FMM A;  3P7J A;  1EIH A;  1BO0 A;  5EQ0 A;  3R93 A;  1VMC A;  3DEO A;  2RVL A;  3IFD A;  1LV9 A;  3MTS A;  3DEP A;  3G7L A;  3UI2 A;  2B2W C;  4XT1 B;  5D65 A;  1CA5 A;  1ROD A;  1WD0 A;  2L4N A;  2EE1 A;  1IKL A;  4ZK9 B;  4CJ0 B;  1ILP A;  1G2T A;  3FDT A;  3GV6 A;  2CVR A;  1KNA A;  2X69 A;  1EQT A;  1F9P A;  1NR2 A;  2FFK B;  1PFB A;  2HDL A;  5EPL A;  5EPK A;  1NR4 A;  3ONA B;  4IUT A;  4MN3 A;  1BBX C;  1PFN A;  2KVM A;  3MWY W;  1RHP A;  4IUV A;  1X3Q A;  2H1E A;  4IUP A;  1J9O A;  1SSO A;  1MGS A;  1RTN A;  1XYI A;  1A15 A;  1ICW A;  3KUP A;  2B2U C;  1SAP A;  2VXW A;  5E4W C;  4ZLT F;  1Q3L A;  1E0B A;  1ML0 D;  3F2U A;  4HCS A;  1U4L A;  3DM1 A;  4X3U A;  1CM9 A;  1B4O A;  3LWE A;  2X6G A;  2M2L A;  2MJ8 A;  3D6W A;  4XDX A;  4HED A;  4MHE A;  3N52 A;  4UAI A;  4X3K A;  2N55 A;  5T1G A;  1MSG A;  1QG7 A;  3Q6S A;  1EIG A;  3I8Z A;  1M8A A;  2Q8R E;  1QE6 A;  2KOL A;  1F9S A;  4X3S A;  1WTR A;  2DY8 A;  3GV3 A;  3IL8 A;  2K04 A;  3QO2 A;  2HCI A;  4ZKC B;  1CA6 A;  2K01 A;  5EPJ A;  1WTO A;  1B50 A;  2JYO A;  4OIJ A;  2B2Y C;  1ILQ A;  2K28 A;  1ZXT A;  2MP1 A;  2NWG A;  2B2V A;  2B2V C;  4HSV A;  2KED A;  2HUG A;  1WVL A;  1X3P A;  1S4Z A;  1B3A A;  2FIN B;  2J7Z A;  2K1B A;  4LMQ D;  1HRJ A;  4ZKB B;  1G2S A;  1HFN A;  2RSO A;  1WTQ A;  1PLF A;  4CJ2 C;  5CBA E;  5DNF A;  2B2T A;  1TVX A;  4XT3 B;  2HDM A;  1XX8 A;  2IL8 A;  1F9Q A;  1HHV A;  4RWS C;  2NZ1 D;  1HA6 A;  1WTX A;  3FPU B;  1EL0 A;  1DZ1 A;  1G6Z A;  1F9R A;  1AZP A;  3I90 A;  1ESR A;  2XIW A;  4HAE A;  2JP1 A;  3H91 A;  5EKI A;  1WTP A;  4RAU C;  1HFG A;  1NCV A;  3HP3 A;  2EOT A;  4X3T A;  2Q8T A;  2EPB A;  1JIC A;  1O7Y A;  2FHT A;  4IUR A;  3TN2 A;  4DN4 M;  5CBE E;  2B2U A;  1WD1 A;  4IUQ A;  1X32 A;  4IUU A;  2RSN A;  5JJZ A;  1MSH A;  2DY7 A;  4O42 A;  5EJW A;  1O7Z A;  1RJT A; 
#chains in the Genus database with same CATH topology
 2E74 C;  1PH8 A;  4XTC S;  1YBY A;  1O7I A;  2UXB Q;  1AP0 A;  3E6Z X;  1F2L A;  2IWH A;  2LXK A;  3SDZ A;  3A7A B;  1O7L A;  1JWM D;  2CWA A;  3GTP B;  4QQB X;  1N34 L;  2NTT A;  4A3I G;  3ERQ A;  3NTK A;  1BOS A;  1JOQ A;  4DNI A;  3S1N H;  2R7Z B;  4KV6 A;  4BBR G;  1IBL Q;  2R93 G;  4JI2 L;  5T1I A;  2F0F A;  2HHH L;  3S1R H;  1PTO C;  3NPP A;  1GOZ A;  3S16 H;  5IP7 H;  4GNX B;  4B3M L;  4YY3 L;  2L4N A;  3IAY A;  2NN6 H;  3JAM i;  3GTM H;  5C0X G;  4F7X A;  4K8I A;  4HSP A;  3HOV B;  4A3F H;  4BBS H;  1RHP A;  4JW0 A;  2DN8 A;  3VYU A;  1ZEQ X;  1PTO H;  4LF9 Q;  3KUP A;  2VXW A;  3L2P A;  1U4L A;  5I9O A;  5IGD A;  3LWE A;  2MJ8 A;  3VDY A;  2E2J B;  2KCM A;  4HED A;  1PH3 A;  4UAI A;  4X3K A;  5DM6 3;  1FVI A;  4K2L A;  2KOL A;  1T9H A;  3SK4 A;  4GOP C;  2WFW A;  1N8R C;  3A7L A;  3HOW G;  1R4Q B;  2G9H D;  2MP1 A;  2OF1 A;  3M4O H;  1X3P A;  3CP0 A;  3P20 A;  2N49 A;  2F0J A;  1S4Z A;  1HRJ A;  1E22 A;  1EY4 A;  5JJL A;  3SEB A;  4NXM L;  4JOI A;  1SBB B;  5C4J B;  3G6E A;  3OMC A;  5FJ8 G;  4FF2 A;  4IFD G;  2NVX B;  3D3R A;  2JA8 B;  3IRB A;  2F0K A;  1SYG A;  5IYB G;  3HOU G;  3KYH C;  3CPF A;  1WYD A;  4KY6 A;  5IP9 G;  3MVV A;  1O78 A;  1JIC A;  1S3O A;  4DN4 M;  4JPB W;  4A3F G;  2K5D A;  4YCW A;  3J81 c;  1VQL A;  2O5J C;  4DGZ A;  4FYD A;  3A5Z B;  1LM0 A;  3S15 B;  2N88 A;  1V9P A;  5KYL A;  1HH2 P;  1KDC A;  2JA8 G;  3NSW A;  1D6E C;  4G57 A;  1IKM A;  1N33 Q;  1QOH A;  1U4R A;  2ZTE A;  4A3C H;  3DUZ A;  2KEE A;  1CUK A;  4X66 Q;  2K05 A;  1WCM B;  2F0S A;  4E6I A;  4NPS A;  2KUM A;  3GTJ B;  4ODG A;  3Q23 A;  1B2T A;  1J5E Q;  4MIU A;  2RA4 A;  3G4S A;  2B8G A;  3F2B A;  1IBM Q;  3SVM A;  1BUV T;  3SE0 A;  5GRO A;  1JJ2 A;  2NUC A;  2MPM A;  1VQ7 A;  1SE4 A;  4K0K L;  1DYQ A;  1HZA A;  4LF7 L;  3GDE A;  3UI2 A;  2EVB A;  1Q12 A;  1YHB A;  3QOJ A;  3QOL A;  2K5H A;  4GZY C;  3RNU A;  4DR3 L;  2CVR A;  1ASY A;  4KHZ A;  5EPL A;  3PO2 H;  4IUT A;  3RZD B;  2I0Q A;  1EEF D;  3UDI A;  1HTL D;  1L1O B;  3AB9 A;  3OPO A;  4CDE C;  3M7G A;  1H9J A;  4LAA A;  5C6A A;  4CBV A;  1VQN A;  1NE3 A;  1Q8K A;  1EIY B;  4A3L H;  1CK1 A;  3K7A B;  4B3T Q;  4UP9 A;  4JI6 L;  4XDX A;  2KJX A;  3N52 A;  3K7U C;  2N55 A;  4DV0 Q;  1H9R A;  2ZTC A;  2OXP A;  1JB3 A;  5CV6 A;  3HOZ H;  1YJW A;  1BCP B;  4ABN A;  2K04 A;  4JI7 Q;  3K6O A;  4C3I H;  4DPG A;  2K28 A;  4JC0 A;  1CZW A;  1W2B A;  1Q81 C;  1U9R A;  2QKI C;  2DGY A;  1EQV A;  4KHP L;  4WRD A;  2QW7 A;  3UDX A;  2I5H A;  2IJ0 A;  3K0Y A;  4JI0 L;  3AU7 A;  2JA7 G;  4XYO A;  3PF4 A;  3E3X A;  5CGK A;  2IY5 B;  2A68 D;  1XX8 A;  2EYH A;  2WAQ E;  3NQI A;  4MTK A;  4RGN A;  3RN2 A;  1HA6 A;  4GLX A;  2E5L Q;  2EJG C;  5C3E B;  1ESR A;  4H44 C;  4JI7 L;  1ENC A;  4P72 A;  4X3T A;  4JBJ A;  1TKW B;  1X3F A;  1YEZ A;  2AQ3 B;  2TSS A;  1SJH D;  4IPD A;  5BN5 A;  5CV9 A;  1EQR A;  3NBI A;  4ZQ3 A;  3CRK C;  4DXG A;  4K6D A;  1L0W A;  2EYF A;  4OXP A;  1NAP A;  1HZB A;  1LAC A;  3E5S A;  4TSS A;  1HZ9 A;  1SNC A;  2ICE C;  3CU7 A;  4HJ8 A;  2WB1 E;  4HIO A;  3R3O A;  4C1N I;  1Y1W G;  4A75 A;  1LAB A;  1D5Z C;  2K03 A;  4ZAI A;  3DWP A;  2F0M A;  4QUF A;  3NWT A;  2F0T A;  2NYZ D;  2EYJ A;  2A1A A;  1I94 L;  1S5E D;  3HGB A;  4R8N A;  4YY3 Q;  3TBI B;  4GS3 A;  3VR4 A;  5BR8 Q;  2WAC A;  1YJ9 A;  3M4Q A;  3R2T A;  3HOZ B;  1BO0 A;  4CKE A;  1SE3 A;  3RUZ A;  3IFD A;  4DK3 C;  3UE1 A;  1II3 A;  3H6M A;  3C46 A;  3M7N A;  4RFB A;  2F0Q A;  3GP7 A;  3C2P A;  5G3L D;  3CCL A;  1GUS A;  4ALP A;  1VDZ A;  3M4P A;  4JV5 L;  4DNT B;  2VUM B;  5IYC H;  2CQA A;  1GVP A;  3RD4 A;  1Q1E A;  2OEO A;  2MQH A;  1SEB D;  4DV6 Q;  3TZU A;  5IOD A;  1FGB D;  1ICF B;  1PVO A;  5IGF A;  1E2V A;  3H09 A;  4YHH L;  1HXY D;  3OWE B;  1E2Z A;  1KTK A;  1FD7 D;  5M9O A;  2EYM A;  3K80 C;  2OQK A;  1I4Q A;  3OIP A;  3RZO H;  2ZXP A;  5CC4 A;  5CBA E;  4L5S A;  1I4R A;  1I3Q B;  4K5X A;  5IT9 c;  3CC4 A;  1HPC A;  2K75 A;  2Q2I A;  3PUV A;  1Q86 C;  4BXX H;  1ENF A;  1LYL A;  5GAD C;  1Q1B A;  1PH6 A;  3CD6 A;  4DR7 Q;  1UAP A;  3TN2 A;  4L8J A;  3BVG A;  3J7A F;  4DR6 L;  2RDF A;  3UE0 A;  4Y52 H;  3VA7 A;  1GXD C;  5LHY 1;  2DY7 A;  1EWI A;  3CXC A;  2IX1 A;  1O80 A;  4JBW A;  1KHI A;  3KLS A;  4P75 A;  4RGT A;  1STB A;  2KHJ A;  3FKI H;  5D14 A;  5E7N A;  4TRD A;  1BDO A;  1EQQ A;  3KDF B;  4JBM A;  2HIX A;  2KEC A;  1EY9 A;  2B2Y A;  2CH4 A;  4A3J G;  1PFS A;  4DK1 A;  1STG A;  3I70 A;  5ELE A;  1OXV A;  1JMC A;  4L5T A;  1TWF H;  1LO5 D;  2B29 A;  1JJG A;  1AZQ A;  2L12 A;  5GAH C;  4LUV A;  1VQI A;  4GN5 A;  2C5C A;  4A4I A;  3MXN A;  2F3W A;  3PIP A;  3KJP A;  4IO9 A;  1VQO A;  4KKS A;  1CT1 D;  1SNQ A;  3E9I A;  1NBW A;  3OTO L;  3CF5 A;  1C4Q A;  3P7J A;  3SK5 A;  1D1I A;  2RVL A;  1ET6 A;  4X6A H;  4XT1 B;  3EVQ A;  2JA5 G;  4QY7 A;  1TWH B;  2L0C A;  2Z8L A;  2EXZ A;  4QCL A;  3Q22 A;  2LXJ A;  1KRS A;  2EYO A;  1JOK A;  3KF8 B;  1M4V A;  3J81 j;  1PFN A;  5TSS A;  4FNF A;  4A3K B;  4IUP A;  1MGS A;  4OGQ C;  1PTO B;  4DAV A;  1RTN A;  1W6K A;  2K32 A;  5ELF A;  4ZLT F;  4FO2 A;  3OOC A;  5I4D A;  3W1G A;  3S9W A;  1E0B A;  1UEA B;  4J15 A;  5FLX E;  3GTL H;  4PQX A;  3DLL A;  3G48 A;  1NNX A;  5M5Y H;  4IOA A;  4QMG A;  1A2T A;  5T1G A;  1X3G A;  5C3E G;  3EN2 A;  4U67 3;  1IBK L;  1S72 A;  1EUJ A;  4B9X A;  5DLQ E;  3E9H A;  3PUW A;  4DAY B;  3U9S A;  4DV5 L;  2NVT B;  4JI1 Q;  3A54 A;  1PH5 A;  2K1B A;  4LUZ A;  3H3V I;  2ZM6 Q;  4CJ2 C;  2FXQ A;  5DNF A;  3ULP A;  1QCB D;  2JSO A;  3T1H L;  3KLS X;  2EYP A;  2WAQ G;  4TVA B;  2BCO A;  2DUD A;  2EOT A;  1GHJ A;  4M1U B;  2C35 B;  5JVG 3;  4KY5 A;  5JJZ A;  1EYA A;  3CCU A;  4JI8 L;  4OL7 A;  1FNU A;  3HOX B;  1QNU A;  3GD7 A;  4JK1 C;  2F4I A;  4C3H G;  1SNP A;  3GTG B;  1K8A C;  1VQ9 A;  3H0G B;  1T5X D;  1V8Q A;  4JI4 Q;  1A63 A;  1IYU A;  1TWF B;  1HUM A;  5E4X A;  2B2W A;  4QIW E;  2QF7 A;  3H3V H;  1CKN A;  4BA1 I;  2KCN A;  5C4H A;  4JI4 L;  2M00 A;  3KBG A;  4ID6 A;  4A3J H;  3MXG A;  3F2D A;  1FJG L;  2E5L L;  4X62 Q;  3DHQ A;  4JG2 A;  1YNJ D;  5M5Y B;  1PMR A;  2DNE A;  5CMD A;  4IPH A;  4KN4 C;  4DR1 L;  2UXC L;  3M9B A;  1Y69 U;  1WCM H;  4YWK A;  1TY2 A;  1YHA A;  4MTN A;  1RTO A;  4NB3 A;  4KTA A;  2ES2 A;  2B39 A;  5C0X H;  1EZ6 A;  1TQO A;  1I6H H;  1LV9 A;  3M85 A;  4BBS G;  1Y1V B;  4C56 C;  2PO4 A;  3NK9 A;  1XPU A;  2LKV A;  1PTO F;  2G9D A;  4RH6 A;  2Z4I A;  3FKI B;  4JI1 L;  5K5P A;  1XPR A;  1GUN A;  1MJC A;  2F0W A;  2KVM A;  3OSO A;  4DXF A;  3TDQ A;  1RKN A;  2YTX A;  4B3R L;  3RZD H;  1B9N A;  4JI3 L;  3F2U A;  5M5X B;  4JI2 Q;  3A55 A;  1CQF A;  1ASZ A;  2HD3 A;  1I6V C;  2Y0S B;  4NXN Q;  4EQN A;  1OXU A;  3T4A C;  2JEA I;  3D4D A;  3EQL C;  4ZKC B;  3BVZ A;  1OO9 B;  2ICI A;  4UY8 C;  3SR1 A;  1P16 A;  2B2V A;  3G6J B;  3NTI A;  4C3J G;  2J7Z A;  3MAQ A;  4ZUJ A;  1LT6 D;  1HFN A;  2F0V A;  4N8X 1;  1HTP A;  4JI6 Q;  3A8K E;  3MA2 B;  4AYB G;  2PZW A;  4UP8 A;  3V05 A;  3CCM A;  2NZ1 D;  1F9R A;  2RHS B;  2XIW A;  5CR3 A;  2E2J H;  2AQ1 B;  3AYH B;  5FJ8 H;  5CBE E;  1Y1V H;  3DWA A;  5CYU A;  1YJN A;  1V1Q A;  5M5W B;  1KAB A;  3HFZ B;  2NN6 I;  4AYB B;  1JJC B;  3A8J E;  4ULL A;  4QGU A;  2HIV A;  4A3F B;  1YIT A;  3D8G A;  2B2T C;  5AFW A;  3V96 A;  4YCU A;  2R3Z A;  3K57 A;  2ALY B;  4LFB L;  2A6E C;  3PO3 H;  3A56 A;  3DXJ C;  2UXB L;  4LF6 L;  3S1M H;  3FRP B;  3T56 B;  4G4K A;  5AJ3 L;  3LGJ A;  2I07 B;  1V1P A;  4EGV A;  4CJ1 B;  1Q8I A;  4NXM Q;  2CH4 W;  1QJO A;  1IZ6 A;  5M3F B;  5ELO A;  1VQ5 A;  3QWN A;  4FF4 A;  1SDF A;  4HMJ A;  1SNO A;  1VMC A;  2YTV A;  2RBM A;  4DR4 L;  1CKO A;  1LTS D;  5IGC A;  4DAP A;  1H9S B;  4BWG B;  4X64 L;  4J1M A;  4Q0F A;  1WTP A;  1F9P A;  2Q8T A;  2LSS A;  4IPC A;  3NEL A;  1Q82 C;  1R9T H;  2E2I H;  2VZA A;  3ICE A;  1JE5 A;  2DNC A;  3HOV H;  1EY8 A;  1ML0 D;  5FLX L;  5EBD A;  2IW3 A;  2YYZ A;  5EKL A;  4R4C A;  1N36 L;  3WDN A;  3OHX C;  1HZC A;  4J8Q A;  5C3E H;  2B63 B;  2IHE A;  3T51 B;  4RG1 A;  1S5F D;  2NZH A;  3I4O A;  1B8A A;  4FF1 A;  1EWC A;  3LX0 A;  2FMC A;  4DU9 A;  1PH1 A;  4EVO A;  2JYO A;  3CAM A;  4OIJ A;  2D62 A;  2JQO A;  3NP8 A;  4PMB A;  4BXX G;  2R93 B;  4OO1 I;  1YHQ A;  1L0X B;  1WFQ A;  2UUC L;  4I65 A;  1I4G A;  1K3R A;  1HHV A;  2XGT A;  1AFP A;  1I4P A;  4K5W A;  4H02 A;  1AZP A;  2N3S A;  4A3D G;  1UUP A;  2JA5 H;  1PRT C;  5EKI A;  1O7Y A;  2NB0 A;  1TWH H;  1B44 D;  3DWQ A;  3K7A H;  1VQ8 A;  3BJU A;  3UDF A;  4JV5 Q;  1IXR A;  1WI5 A;  1B53 A;  3HS0 C;  4A3G H;  1NSN S;  1EY0 A;  2RQX A;  1VF7 A;  3I7F A;  1KXL A;  2F4V L;  2Z0S A;  4IJL A;  4R9W A;  2HHH Q;  1NJI C;  1Z6H A;  1E1T A;  2XRQ D;  2LS0 1;  4ME5 A;  4PZ8 A;  3KF8 A;  3CQZ H;  2X6L A;  4AH6 A;  2ASB A;  2E8G A;  4YHH Q;  1VQK A;  4IOC A;  3AEV A;  3I91 A;  3FPP A;  1AE3 A;  3KBX A;  3OIQ A;  2UXD L;  3VYT A;  2ENB A;  1GUW A;  5HUR A;  2QDB A;  5IYD H;  3F2C A;  1WTV A;  3B6Y A;  1B70 B;  5J3B A;  1VQH A;  2WKD A;  2R93 H;  4R4T A;  3GTJ H;  1Y8P B;  4IFD H;  5JAV A;  4FXK C;  1PRT F;  2VL6 A;  1VQ6 A;  1HA5 A;  3ULL A;  1CHP D;  3L7Z C;  4M8A A;  1YI2 A;  4LF5 L;  3G7L A;  4AYB E;  1BR9 A;  2XTI A;  3K5L A;  3CMA A;  1BVS A;  3J80 E;  4A3E H;  1EY6 A;  5KRU A;  1A3V A;  2CFM A;  1WD1 A;  5K36 G;  1SYC A;  2D0P A;  2FFK B;  1NR4 A;  5HY6 A;  3J7A V;  1IW7 D;  1X3Q A;  4JI5 L;  3J7Z C;  2KQ3 A;  2NVX H;  5DM7 3;  5IY0 A;  3M4Y A;  1ICW A;  4IAL A;  5E4W C;  2WAQ B;  4K8J A;  4HCS A;  1H9S A;  1UEB A;  4P74 A;  1PH2 A;  3J80 c;  1HR0 W;  2CW0 D;  4HN7 A;  1QZG A;  3OYY A;  4POF A;  4IFD J;  5H1S E;  2O4X A;  4OWT B;  1SXT A;  1IBL L;  1WCM G;  3T53 B;  1WTO A;  4JI0 Q;  3HOW H;  2R92 B;  1PZJ D;  1ILQ A;  2EY5 A;  1ZXT A;  3I4M B;  1STN A;  1A62 A;  4ZKB B;  2VUM H;  2K5W A;  3HOY G;  3K5O A;  4A3M G;  1LTB D;  2ID0 A;  4LK1 C;  3J81 i;  3K59 A;  4GKK Q;  4WJ3 M;  4OX9 Q;  3PUZ A;  3P75 A;  2E75 C;  2XN9 C;  1G6Z A;  1GJX A;  4BY1 G;  2BDO A;  1OTC A;  3I90 A;  3E0E A;  4LF7 Q;  4RAU C;  4B3T L;  3TME A;  4OO1 H;  1UE6 A;  2Z4H A;  1F2Y A;  4ZYS A;  1R4P B;  3HEJ A;  3S1Q H;  2AUK A;  4OEM B;  1O7Z A;  1FR3 A;  1J8I A;  2KHI A;  3NXW A;  1CSQ A;  4X66 L;  3TS2 A;  2L55 A;  2K14 A;  4C2M B;  2VQE L;  2JJQ A;  5C4J H;  2JA6 G;  5FO7 B;  4DR1 Q;  3I4N G;  4AIM A;  1K0R A;  4LF9 L;  1WTW A;  1HNZ L;  4GKJ Q;  3PMF A;  2N8N A;  2F0G A;  1FJG Q;  1MD2 D;  2PI2 A;  1CZG A;  4DV7 Q;  1DOK A;  1K9M C;  1IL8 A;  3S16 B;  4DV0 L;  2R61 A;  4R1J A;  1U4P A;  4J6H A;  3KFU A;  4BS9 A;  4QIW B;  3OWF A;  3KLR A;  2V1C C;  1HNZ Q;  4GKJ L;  3S2D H;  3DM3 A;  4LJZ C;  2FJ2 A;  1TXY A;  1TS4 A;  5EGT A;  3QIA A;  5KIX A;  1H9K A;  2PQA A;  1K3B C;  4KKU A;  4GN4 B;  1VQM A;  2EE1 A;  4P71 A;  1ILP A;  3FDT A;  3GTK B;  2CWP A;  3IKJ A;  1QVG A;  2A68 C;  3NQT A;  3ONA B;  3I4N B;  1K28 A;  1E24 A;  4IUV A;  1TWG B;  1EIF A;  4C3H B;  1LLR D;  1TT2 A;  5IYD G;  1EY7 A;  2AWN A;  3U58 A;  3BYT B;  2VB2 X;  1ONL A;  1CI3 M;  5ELB A;  2CCZ A;  4RCN A;  2A5H A;  1KQS A;  1KDA A;  1K83 H;  3SXH A;  4JBK A;  1HNX Q;  4LNQ A;  1NY4 A;  1TWA H;  1HNX L;  4HTH A;  1LTR D;  4UDU C;  5GAE C;  2ZJR A;  2ZTD A;  1PTO D;  3AQQ A;  2PCF B;  4APV A;  4BBR H;  4EQO A;  4CDF C;  2AMC B;  2Z6K A;  2VB3 X;  4GOP A;  4F87 A;  4LF4 Q;  4IQZ A;  2JA7 H;  4RHR A;  4JYA Q;  1SR3 A;  3S24 A;  2UU9 L;  3X3N A;  3V2T A;  5CV5 A;  1WTX A;  3FPU B;  1YNJ C;  3KF6 B;  1H95 A;  2PPB C;  2VUM G;  3BS1 A;  3H3V C;  2FHT A;  4LW1 A;  3ITP A;  3KDF A;  3CKI B;  3K5N A;  5IIF A;  2F0U A;  2NTS A;  1G91 A;  1LT5 D;  1FGU A;  1S5C D;  1TWG H;  3MFY A;  1XMO L;  4A3K G;  2L11 A;  4N9T A;  2MNA A;  3HOV G;  1G29 1;  3RLN A;  2YU9 H;  1U5K A;  4A3C G;  4L5Q A;  1BKB A;  3W1B A;  2B63 H;  1E7Z A;  3MC0 B;  4JI5 Q;  4X65 Q;  4S3S A;  3QB3 A;  3K5M A;  2EZV A;  1XXG A;  5M3F H;  1K83 B;  5ISR A;  5G3L F;  1WTH A;  3U50 C;  4AQY L;  2A19 A;  2RF4 A;  1XNR Q;  1NTG A;  2MO0 A;  1LTL A;  3BDO A;  3VR6 A;  1UE5 A;  1K8O A;  3DEP A;  3KK7 A;  5HGQ A;  4BA2 I;  1WD0 A;  4ZK9 B;  1M1K C;  5IP9 H;  1G2T A;  1MIU A;  1GUG A;  3GV6 A;  3JAM L;  4NMZ A;  1HNW L;  3P1H A;  1XMQ Q;  2X69 A;  4DV4 L;  4PZ6 A;  4K14 A;  5KNC A;  2UUA L;  3CCQ A;  1SSO A;  4XIG S;  3CW2 C;  2XRS D;  3S2D B;  1VQD A;  1CTM A;  5J1Z A;  2B2U C;  1V1P B;  3HOY B;  4HR7 B;  3M4O B;  2WV6 D;  2HQL A;  4DAY A;  3MXP A;  3VYS A;  3CHB D;  1G6P A;  1IL2 A;  1JT8 A;  5C4X H;  3SK8 A;  5JPN C;  3T1Y Q;  4PZ7 A;  5LMN L;  3EIV A;  1M8A A;  2Z6K C;  4LF8 Q;  3D31 A;  4LFA Q;  2LY7 A;  1CA6 A;  1QUQ B;  1D5M C;  1Y1W B;  2OT2 A;  3HKS A;  2HUG A;  2JK8 A;  5JOB A;  2C9O A;  4G7H C;  3PF5 A;  1B3A A;  2KCT A;  2R92 H;  1WTQ A;  2PQE A;  1STY A;  1K8G A;  5IWA Q;  2HDM A;  5K36 H;  1L1O A;  2E2D C;  2GVA A;  1KL9 A;  1UWV A;  4C3J H;  2MFI A;  1DZ1 A;  1Q90 A;  1STH A;  2MO1 A;  1NCV A;  3BDC A;  3CCV A;  5LMU Q;  4LF6 Q;  4CKC A;  2MUY A;  5JPM C;  1STE A;  1B9M A;  2CKZ B;  1GM5 A;  2P5Z X;  2HQE A;  4A3M B;  4A3E G;  1X56 A;  2EDG A;  2SEB D;  1E3P A;  4GLA C;  4C1N K;  2SNM A;  3HOW B;  1JOO A;  1K73 C;  1SYB A;  4LFC L;  3STB C;  2ZXO A;  2K33 A;  4GOP B;  3TS0 A;  1J5E L;  3GTP H;  3HOZ G;  5F2D A;  1CKM A;  1TY0 A;  2WIN B;  5M3F G;  3M3Y H;  4DV3 L;  4X64 Q;  1VMP A;  5M5X H;  2M9V A;  2SNS A;  5E3F A;  2EQS A;  2VQF Q;  4JVZ A;  4DV4 Q;  4XQJ A;  2PW7 A;  1QVC A;  1VQE A;  4KK7 A;  4L5R C;  4HJ7 A;  1XJV A;  5CV4 A;  4A3G B;  4OO1 G;  3FVQ A;  2B3G A;  2PZT A;  3SGI A;  4LF8 L;  4EQP A;  4RKB A;  4DA2 A;  5I9P A;  5D65 A;  1GUO A;  4OEL B;  4CJ0 B;  1T5E A;  2JA9 A;  2JA5 B;  3HOX G;  3KJO A;  3K8A A;  2NN6 G;  4DV3 Q;  1EQT A;  5IGE A;  2PW5 A;  1BNZ A;  1YNN C;  4A3D B;  4A93 B;  4BY1 H;  1CQV A;  1BQQ T;  1GO3 E;  4DR3 Q;  1XYI A;  1VF5 C;  4BBR B;  3HOU B;  1NMG A;  2D0O A;  1JQY D;  2NZO A;  1AN8 A;  2A69 D;  1N34 Q;  5FLX c;  4MHE A;  5LL6 X;  3PGZ A;  4DUZ Q;  3PSI A;  1JB7 A;  2JA6 H;  1LTA D;  4FP5 D;  4DNR B;  4X3S A;  1VQG A;  3ERO A;  4A3B G;  2IT1 A;  3J7Y W;  2B2Y C;  4QJF A;  1SFO H;  1K8M A;  1SJE D;  2KED A;  2XVS A;  3GTG H;  4DAM A;  3OTO Q;  1DJR D;  1DXM A;  3OMG A;  4JI8 Q;  2EXD A;  1AH9 A;  1X6O A;  5LMN W;  2JN4 A;  4A3J B;  3ERS X;  4B3R Q;  4R4I A;  2CHB D;  1PA6 A;  3H91 A;  3I72 A;  5D3I B;  1GUT A;  2R92 G;  3HP3 A;  2JXM B;  4A3B B;  4DF7 A;  1JC7 A;  2QIL A;  4QL5 A;  1QIL A;  3BZK A;  5JJK A;  1DD2 A;  4LFA L;  1LUZ A;  4F88 A;  4A3K H;  1PZK D;  2E2I B;  1R9T B;  1UE1 A;  1QUQ A;  4RCO A;  4MZ9 A;  2NVQ H;  3RLO A;  5KNB A;  5A2Q L;  2OTL A;  4KD4 A;  4JI3 Q;  2VY3 A;  5AJ3 Q;  2TMP A;  1C48 A;  5IWA L;  2GN5 A;  4RA8 A;  2RHQ B;  5FO9 B;  2EY6 A;  2AKW B;  4MNO A;  4RHS A;  2A6E D;  1OXX K;  3Q0A A;  3CCS A;  1UNS A;  2PNR C;  1V1O A;  5C0X J;  4A3I B;  1EOT A;  4UHV A;  1RD9 D;  3Q24 A;  1GD7 A;  4DFA A;  1JOR A;  3O13 A;  5IP7 G;  1A6X A;  1EU3 A;  1Y1V G;  1RDP D;  1PYB A;  5C44 G;  2PZU A;  2Z1C A;  3S1Q B;  2BE5 C;  1XMO Q;  2K50 A;  3L3O C;  1KRT A;  5FKA C;  3BYY B;  1QWY A;  1D7Q A;  4WOR A;  2IX0 A;  1IKL A;  1JR0 D;  2UUB Q;  5C5M A;  5L37 A;  3OW2 A;  5EPK A;  4KHP Q;  3MXN B;  4DR2 L;  4MN3 A;  1BBX C;  4KLK A;  2LFN A;  2WB1 G;  4DK0 A;  2OCE A;  3FEW X;  4YWM A;  1LT4 D;  1DM0 B;  1SAP A;  1U0L A;  3T16 A;  2I46 A;  5C44 B;  1EZ8 A;  4O2D A;  5NUC A;  4OHJ A;  5HGT A;  1PYS B;  2QCP X;  3C1F A;  5LMU L;  1TS3 A;  1PYW D;  1QG7 A;  4OON A;  1XNQ Q;  2Q8R E;  2O5I C;  4A3L G;  2DY8 A;  1I3Q H;  3IL8 A;  3URY A;  2H5X A;  4IN3 A;  2D5D A;  2PQA B;  3MFG A;  4YWL A;  1KD1 C;  2BA0 A;  2NVY B;  1F2Z A;  5C3W A;  4X62 L;  3S2H B;  4N9P A;  1PLF A;  4KI0 A;  4C3I G;  1HQR D;  1ESF A;  1F9Q A;  1LTT D;  1Q46 A;  4DUY Q;  5IYB H;  1VCI A;  4WJ4 A;  3I55 A;  3WOE A;  4HAE A;  4K0K Q;  2F0H A;  2IX3 A;  1HFG A;  5DEH A;  1MKH A;  4IUQ A;  3T1Y L;  2L15 A;  1SYF A;  1MSH A;  4GNX C;  3PUY A;  3EFX D;  3VA5 A;  5FLM G;  2DJF C;  4DR5 L;  1PRT D;  1OXT A;  4CDD C;  5KND A;  4WFN 3;  4BY7 G;  3KLW A;  1F2M A;  3PCO B;  3HKZ B;  4DR5 Q;  2Q2H A;  1SE8 A;  2NBF A;  2RCN A;  4FXG C;  2BDN A;  1BBU A;  2L5T A;  5C0X I;  1C7Y A;  1Z47 A;  3CCE A;  3I4L A;  4I7A A;  1B7Y B;  1BBW A;  1TWC B;  2HCC A;  1TR5 A;  1D2B A;  2J4X A;  1DON A;  5COY A;  1I4X A;  4V19 0;  3CQZ B;  4Y7N H;  1XTC D;  1DOM A;  2OTJ A;  3S17 H;  3S2H H;  5J22 A;  2BOS A;  1XNR L;  3H0G G;  5ELD A;  1JE4 A;  2ZT9 C;  4DR2 Q;  1PDQ A;  3I73 A;  2ZJQ A;  2UXC Q;  4L6T B;  5DAU A;  5EQ0 A;  4ZCK A;  5IGB A;  1AW7 A;  3OW7 A;  1XPO A;  1C0A A;  5C4X B;  2Y0S E;  4X65 L;  4RGO S;  2BA1 A;  1Q7Y C;  4B3S L;  4A93 G;  1Y8O B;  2Q2T A;  1PFB A;  4DV1 L;  1CKN B;  2CW0 C;  4LF4 L;  4JYA L;  1N32 Q;  3CC7 A;  2K6A A;  4DKA C;  4IPG A;  1KLU D;  3VYR A;  4Z9C B;  2RDG A;  1KIX A;  1EFI D;  3A0J A;  4TKO B;  2EJM A;  3U4V A;  1IW7 C;  1S5D D;  1CM9 A;  4X3U A;  3PIP 3;  5LL6 S;  1V43 A;  1WOC A;  4HJ9 A;  2ZXR A;  1MSG A;  5FOB B;  3BDL A;  2K7V A;  3TP8 A;  3I8Z A;  3EA6 A;  2KHS A;  4H0L C;  1WTR A;  3RMH A;  3GV3 A;  1B50 A;  2K01 A;  2KA7 A;  3CCR A;  4GN3 B;  3ER0 A;  2B2V C;  4HSV A;  2K52 A;  4IUN A;  4LMQ D;  1VQB A;  2Z9H A;  3LNN A;  4PMC A;  2RSO A;  3SK6 A;  4H13 C;  4BY7 B;  3HOX H;  1PXU A;  2IL8 A;  1KLG D;  4RWS C;  3BG3 A;  5LMN Q;  2BH8 A;  1E1O A;  1S5B D;  3FP9 A;  2JP1 A;  2OWO A;  2MHV A;  1LT3 D;  1PRT B;  2YU9 B;  2JEB I;  4N8F A;  4IUU A;  2RSN A;  1PH4 A;  1I5F A;  1F77 A;  5CV8 A;  1FYC A;  4KJO A;  1EU4 A;  3EBE A;  3GO5 A;  1JWU D;  1BCP C;  1L1O C;  3K58 A;  4A3G G;  1B1Z A;  4DV6 L;  2EIF A;  4JOI C;  1QB5 D;  2NVT H;  1A2U A;  2EJF C;  3F1Z A;  1SRU A;  4P2C B;  1C8C A;  4G7O C;  4HCE A;  1SMX A;  2G5D A;  3RR5 A;  4UP7 A;  1Z9F A;  3ULJ A;  2A6H C;  3PIO A;  2VNU D;  2QDL A;  3A8I E;  3Q8D A;  1PFM A;  1BCP F;  1CFM A;  1EYG A;  3S1M B;  1TS2 A;  3AMU A;  3J81 E;  3VR2 A;  3K0X A;  3A5U A;  5E1F A;  1RIP A;  3S17 B;  3ND8 A;  4NKL A;  3MXU A;  1AE2 A;  3NEM A;  2QGQ A;  4ILW A;  1KNE A;  5M5W H;  1Y8N B;  1GHK A;  5A2Q E;  2FMM A;  2LMC B;  5IT9 L;  3R93 A;  1EIH A;  2RDH A;  3D0F A;  3DEO A;  2PI2 E;  3MTS A;  1TWC H;  2B2W C;  4IFD I;  2F1M A;  5C4Z A;  5JEA H;  1CA5 A;  3R2I A;  5I6W A;  2XWB B;  2PYK A;  5GQO A;  1HUN A;  1NR2 A;  2HDL A;  3HRZ C;  4DV5 Q;  5FO8 B;  4LWC A;  4B08 A;  2AHO B;  4DV2 Q;  1J9O A;  1X9N A;  3JAM E;  4HMI A;  1HR0 L;  3W5O A;  1MHW C;  3NEN A;  4NXN L;  5IYC G;  3I4N H;  1Q3L A;  4H7B A;  4AQY Q;  2NVY H;  2F03 A;  3GTK H;  2EY2 A;  3D6W A;  3SHL A;  3RLF A;  2V4D A;  1PZI D;  4LUO A;  2KBN A;  5C5L A;  3EJI A;  2F0I A;  3H15 A;  1N33 L;  3RN5 A;  1ZYR C;  1F9S A;  3H94 A;  2IPK D;  1NUC A;  3CRL C;  3VR5 A;  2F3I A;  2VS1 A;  3FHW A;  4XYQ A;  3U9O A;  4GKK L;  1ET9 A;  3M3Y B;  3UDG A;  2A74 C;  1QVF A;  1Y1W H;  1IYV A;  4OWW B;  1VQF A;  4KHV A;  5IT9 E;  1TVX A;  4DK6 C;  4XT3 B;  1TU2 B;  2RCF A;  4KMU C;  1EL0 A;  5M3M G;  1SLJ A;  4FVM A;  1A0I A;  4QF4 A;  4CGY B;  1HJP A;  2XWJ B;  4K2K A;  3J81 L;  4POG A;  5C44 H;  3X3M A;  2QEJ C;  4O42 A;  1G8Z D;  4KN7 C;  1A3U A;  4GLV B;  3NBH B;  1MI2 A;  2D9U A;  2WP8 J;  2PMZ B;  1X54 A;  4DUZ L;  1N36 Q;  2D2C C;  3GTQ B;  2I5M X;  1U4M A;  2F52 A;  1ZKO A;  2VQF L;  3ZYY X;  1A8V A;  3MZ5 A;  4U68 A;  2UUC Q;  5I2Y A;  3L0O A;  2H4O A;  1D1K A;  4C3J B;  2JA8 H;  1LTG D;  2F0E A;  1RCV D;  3D4R A;  3ZJY C;  4LF5 Q;  1P8L A;  3S1R B;  4NW2 A;  2QA4 A;  1ZYR D;  1PV4 A;  4K5V A;  5BR8 L;  3H0G H;  4OIK A;  3BU2 A;  4KKT A;  2L9H A;  1W6J A;  3HKZ E;  5EBC A;  4DR4 Q;  4F8M A;  4XXE A;  5ELC A;  1I94 Q;  3ND9 A;  1FNV A;  1SMY D;  3PO2 G;  2QEX A;  3TRE A;  4DV1 Q;  4PG3 A;  1ROD A;  1KDB A;  4B3M Q;  4OX9 L;  3BVM A;  2YV5 A;  5IGG A;  1A3T A;  2YTY A;  3QG1 A;  1WJJ A;  3FKI G;  3PV0 A;  3MWY W;  1CSP A;  1SE2 A;  2H1E A;  2XSC A;  5JEA G;  4GNX A;  4PNY A;  1SND A;  4BY7 H;  2F4V Q;  4BBS B;  4CKB A;  1SMY C;  1W3S A;  4JCV E;  3J7A 5;  4A3E B;  1SFO B;  1YVC A;  2IHF A;  2M2L A;  4NDX A;  4A3B H;  1RL2 A;  3W3A A;  1C9O A;  1AEX A;  2AWO A;  3R8B A;  4NP5 A;  3TP6 A;  4K6L A;  5GAG C;  3TSS A;  4KJN A;  2N78 A;  1DCZ A;  4YCV A;  2WKC A;  1YNX A;  2F0P A;  4FXD A;  2HCI A;  4A76 A;  3I2Z A;  4FDB A;  3GTL B;  1MJE A;  3K81 C;  2RKS A;  1VQ4 A;  2NVQ B;  1PH7 A;  1G2S A;  1CHQ D;  1N9W A;  2F0D A;  2WB1 B;  1UE7 A;  2VQE Q;  1JWS D;  2A73 B;  4BY1 B;  2JA6 B;  3LWU A;  1FNW A;  2DJG C;  1SNM A;  1I50 H;  4IZ8 A;  3T1H Q;  1TS5 A;  1B3Q A;  1KAW A;  4PV1 C;  3TP5 A;  3J80 i;  5M3M H;  5D3D A;  3S14 B;  4HIK A;  5A35 A;  4QUC A;  4C3H H;  5C3X A;  5M3M B;  1RF2 D;  4A93 H;  5JVH 3;  2L1B A;  3PQI A;  2MGS A;  4O1N A;  1Y14 B;  5JEA J;  2SOB A;  5I2X A;  1PH9 A;  1KAA A;  3GQB A;  2O2L D;  3FMC A;  4Y7N B;  1I50 B;  5ELN A;  1BF4 A;  1DOL A;  1EYD A;  3L9A X;  3D4W A;  1TWA B;  5BN4 A;  3QJY A;  2K5Q A;  1DGS A;  2F0L A;  2JA7 B;  4ME3 A;  2F0O A;  3VR3 A;  5C4X G;  1XMQ L;  2ZM6 L;  2Q2U A;  3J80 L;  4XQN A;  4O0A A;  4DUY L;  2EY1 A;  5JJI A;  1N32 L;  2I5L X;  2A69 C;  3STB D;  3PIO 3;  1OXS C;  4A3M H;  4ZUI A;  5COR A;  1YIJ A;  3TP7 A;  5CV7 A;  1IYJ B;  3NBH A;  4B3S Q;  3PO2 B;  4IJH A;  4P73 A;  4XQQ A;  4EX5 A;  3GTO B;  2XNA C;  5BN3 A;  3TRZ A;  3N6R A;  1S40 A;  2VW9 A;  3NUC A;  2K4K A;  4RGM A;  1SRO A;  1KNA A;  1X3E A;  2UUA Q;  2BH2 A;  3NHH A;  1XNQ L;  1VS0 A;  4EQ5 A;  4FF3 A;  1M90 C;  1SYD A;  2Q8I B;  2KEN A;  2R6G A;  4V0B A;  3D6C A;  3RZO B;  3F8T A;  3KOJ A;  2EYL A;  3DM1 A;  5EAY A;  3NE5 B;  1YNN D;  2F3V A;  4DV7 L;  1YZ6 A;  2CQO A;  4HIM A;  4OWX B;  3Q6S A;  1G51 A;  2WII B;  3MEF A;  2A6H D;  2A8V A;  1X65 A;  3QO2 A;  2BE5 D;  3MEH A;  5EPJ A;  3CCJ A;  1NMF A;  1IBK Q;  2NWG A;  3U4Z A;  3HZX A;  1WVL A;  1EEI D;  2FIN B;  3JC6 6;  3IFT A;  3I4M G;  1E2W A;  1MBY A;  1SN8 A;  3S15 H;  3QR8 A;  4KD3 A;  2Y0S G;  5J39 A;  2E2H B;  1HNW Q;  1TII D;  1BCP D;  5FLM H;  3A74 A;  3PUX A;  3WWV A;  3T13 A;  4KY7 A;  3PO3 B;  3GTQ H;  2Z6B A;  2K5V A;  1IBM L;  1X55 A;  4CDC C;  2KCC A;  3AFP A;  4YIJ A;  1ENA A;  5EJW A;  2OQ0 A;  3TEH B;  4HID A;  4C2M H;  3TQY A;  2R7D A;  1STA A;  1QNK A;  2B63 G;  3W2D A;  2SDF A;  4A3I H;  1J6Q A;  2R7Z G;  3MHB A;  1GKH A;  2UU9 Q;  4LFB Q;  2E2H H;  4R8I A;  1IHZ A;  1LTI D;  2AUJ D;  3I3C A;  1I4H A;  2B8F A;  3KF6 A;  3BZC A;  3HG9 A;  1EWH A;  4CHT B;  2ZJP A;  4RKL A;  3HOY H;  3TZD A;  3I4M H;  1L0Y B;  2AQ2 B;  3C1E A;  5KEE A;  1FL0 A;  4RMF A;  3GTM B;  3NWS A;  3GTO H;  4R4O A;  1Z7T A;  3DMU A;  4L63 B;  4ZRZ A;  1VQP A;  1QZH A;  2HT1 A;  4I7Z C;  3C3L A;  1A15 A;  1EFW A;  5IOC A;  1HQM C;  1EOV A;  3CC2 A;  2R7Z H;  3S1N B;  3WOF A;  4G7Z C;  2UXD Q;  1B4O A;  5I6Y A;  2X6G A;  3PO3 G;  4C3I B;  1XTD A;  1VQJ A;  4R4Q A;  1K0S A;  4UPA A;  3I56 A;  1EIG A;  4HJA A;  3G71 A;  1I6H B;  1QE6 A;  3NTH A;  1KC8 C;  1HCZ A;  4WJW A;  1H9M A;  4DV2 L;  4QB4 A;  2R7F A;  4LFC Q;  1XWE A;  1HR0 Q;  4DR7 L;  3AFQ A;  2JE6 I;  4DR6 Q;  2GA4 B;  5KYI A;  4B9W A;  3JAM c;  3HOU H;  1SYE A;  1VQA A;  4HJ5 A;  2ATW A;  1BXT A;  2J0T D;  1VQC A;  2B2T A;  1JCK B;  3CME A;  4Q5V A;  3S14 H;  4A3D H;  3HKZ G;  3CPW A;  1PHJ A;  2K5N A;  5FK9 C;  4PMW A;  1EYC A;  5EKK A;  1D8L A;  1EY5 A;  2E76 C;  2EPB A;  4TQU S;  1D5X C;  4IUR A;  2B2U A;  3E0J A;  2GVB A;  2PNH A;  1X32 A;  2PMZ E;  3BZD B;  1L2F A;  5KGU A;  2UUB L;  2F0N A;  5IE8 A;  1RJT A; 
#chains in the Genus database with same CATH homology
 2E74 C;  4XTC S;  1AP0 A;  3E6Z X;  1F2L A;  2IWH A;  3SDZ A;  3A7A B;  1O7L A;  1JWM D;  3GTP B;  2NTT A;  3ERQ A;  3NTK A;  1BOS A;  1JOQ A;  2R7Z B;  4KV6 A;  5T1I A;  2F0F A;  1PTO C;  3NPP A;  1GOZ A;  2L4N A;  3IAY A;  2NN6 H;  5C0X G;  4F7X A;  4K8I A;  4HSP A;  3HOV B;  1RHP A;  2DN8 A;  3VYU A;  1ZEQ X;  1PTO H;  3KUP A;  2VXW A;  1U4L A;  5I9O A;  5IGD A;  3LWE A;  2MJ8 A;  2E2J B;  4HED A;  4UAI A;  4X3K A;  5DM6 3;  4K2L A;  2KOL A;  3SK4 A;  3A7L A;  1R4Q B;  2G9H D;  2MP1 A;  2OF1 A;  1X3P A;  3P20 A;  2F0J A;  1S4Z A;  1HRJ A;  1EY4 A;  3SEB A;  1SBB B;  5C4J B;  3OMC A;  4FF2 A;  4IFD G;  2NVX B;  3D3R A;  2JA8 B;  2F0K A;  1SYG A;  4KY6 A;  3MVV A;  1O78 A;  1JIC A;  4DN4 M;  2K5D A;  2O5J C;  4DGZ A;  4FYD A;  3S15 B;  2N88 A;  5KYL A;  1KDC A;  3NSW A;  1D6E C;  4G57 A;  1IKM A;  1QOH A;  1U4R A;  3DUZ A;  2KEE A;  2K05 A;  1WCM B;  2F0S A;  4E6I A;  3GTJ B;  2KUM A;  1B2T A;  4ODG A;  3Q23 A;  4MIU A;  2RA4 A;  2B8G A;  3SVM A;  1BUV T;  3SE0 A;  2NUC A;  2MPM A;  1SE4 A;  1DYQ A;  3UI2 A;  2EVB A;  1Q12 A;  3QOJ A;  3QOL A;  4GZY C;  2CVR A;  4KHZ A;  5EPL A;  4IUT A;  3RZD B;  1EEF D;  1HTL D;  3AB9 A;  3OPO A;  3M7G A;  1H9J A;  4LAA A;  5C6A A;  4CBV A;  1CK1 A;  3K7A B;  4XDX A;  2KJX A;  3N52 A;  2N55 A;  1H9R A;  2OXP A;  1JB3 A;  5CV6 A;  1BCP B;  4ABN A;  2K04 A;  3K6O A;  2K28 A;  1CZW A;  1U9R A;  2QKI C;  1EQV A;  4WRD A;  2IJ0 A;  3K0Y A;  3AU7 A;  4XYO A;  5CGK A;  2A68 D;  1XX8 A;  2EYH A;  3NQI A;  4RGN A;  1HA6 A;  2EJG C;  5C3E B;  1ESR A;  4H44 C;  1ENC A;  4X3T A;  1TKW B;  2AQ3 B;  2TSS A;  1SJH D;  5BN5 A;  5CV9 A;  3NBI A;  4ZQ3 A;  3CRK C;  4DXG A;  4K6D A;  2EYF A;  1NAP A;  1LAC A;  3E5S A;  4TSS A;  1SNC A;  2ICE C;  3CU7 A;  3R3O A;  4C1N I;  1LAB A;  1D5Z C;  2K03 A;  4ZAI A;  3DWP A;  2F0M A;  4QUF A;  3NWT A;  2F0T A;  2NYZ D;  2EYJ A;  1S5E D;  3HGB A;  4R8N A;  3TBI B;  3VR4 A;  2WAC A;  3R2T A;  3HOZ B;  1BO0 A;  4CKE A;  1SE3 A;  3RUZ A;  3IFD A;  1II3 A;  3H6M A;  3C46 A;  3M7N A;  4RFB A;  2F0Q A;  3GP7 A;  3C2P A;  5G3L D;  1GUS A;  1VDZ A;  4DNT B;  2VUM B;  2CQA A;  3RD4 A;  1Q1E A;  2OEO A;  1SEB D;  3TZU A;  5IOD A;  1FGB D;  5IGF A;  1E2V A;  3H09 A;  1HXY D;  3OWE B;  1E2Z A;  1KTK A;  1FD7 D;  5M9O A;  2EYM A;  1I4Q A;  3OIP A;  2ZXP A;  5CC4 A;  5CBA E;  1I4R A;  1I3Q B;  4K5X A;  1HPC A;  3PUV A;  1ENF A;  1Q1B A;  1UAP A;  3TN2 A;  4L8J A;  3BVG A;  3J7A F;  2RDF A;  3VA7 A;  1GXD C;  5LHY 1;  2DY7 A;  2IX1 A;  1O80 A;  4JBW A;  3KLS A;  4RGT A;  1STB A;  5D14 A;  4TRD A;  1BDO A;  2KEC A;  1EY9 A;  2B2Y A;  4DK1 A;  1STG A;  3I70 A;  5ELE A;  1OXV A;  1LO5 D;  1AZQ A;  2L12 A;  2C5C A;  3MXN A;  2F3W A;  4KKS A;  1CT1 D;  1SNQ A;  1C4Q A;  3P7J A;  3SK5 A;  1D1I A;  2RVL A;  1ET6 A;  4XT1 B;  3EVQ A;  1TWH B;  2L0C A;  2Z8L A;  2EXZ A;  4QCL A;  3Q22 A;  2EYO A;  1JOK A;  1M4V A;  1PFN A;  5TSS A;  4FNF A;  4A3K B;  4IUP A;  1MGS A;  4OGQ C;  1PTO B;  4DAV A;  1RTN A;  1W6K A;  2K32 A;  5ELF A;  4ZLT F;  4FO2 A;  3OOC A;  5I4D A;  3S9W A;  1E0B A;  1UEA B;  5FLX E;  4PQX A;  4QMG A;  1A2T A;  5T1G A;  4U67 3;  4B9X A;  3PUW A;  2NVT B;  3U9S A;  3A54 A;  2K1B A;  4CJ2 C;  5DNF A;  1QCB D;  2JSO A;  3KLS X;  2EYP A;  2BCO A;  2EOT A;  1GHJ A;  4M1U B;  5JVG 3;  4KY5 A;  5JJZ A;  1EYA A;  4OL7 A;  1FNU A;  3HOX B;  1QNU A;  3GD7 A;  4JK1 C;  2F4I A;  4C3H G;  1SNP A;  3GTG B;  1T5X D;  1V8Q A;  3H0G B;  1IYU A;  1TWF B;  1HUM A;  5E4X A;  2B2W A;  2QF7 A;  4BA1 I;  2KCN A;  5C4H A;  2M00 A;  3KBG A;  4ID6 A;  3MXG A;  3DHQ A;  1YNJ D;  5M5Y B;  1PMR A;  2DNE A;  5CMD A;  4KN4 C;  1Y69 U;  1TY2 A;  1RTO A;  4KTA A;  2B39 A;  5C0X H;  1EZ6 A;  1TQO A;  1LV9 A;  3M85 A;  1Y1V B;  4C56 C;  2PO4 A;  3NK9 A;  2LKV A;  1PTO F;  2G9D A;  4RH6 A;  2Z4I A;  3FKI B;  5K5P A;  1GUN A;  2F0W A;  2KVM A;  3OSO A;  4DXF A;  3TDQ A;  1RKN A;  1B9N A;  3F2U A;  5M5X B;  3A55 A;  1CQF A;  1I6V C;  2Y0S B;  4EQN A;  1OXU A;  3T4A C;  2JEA I;  3D4D A;  3EQL C;  4ZKC B;  3BVZ A;  1OO9 B;  2ICI A;  3SR1 A;  2B2V A;  4C3J G;  3G6J B;  3NTI A;  2J7Z A;  3MAQ A;  4ZUJ A;  1LT6 D;  1HFN A;  2F0V A;  1HTP A;  3A8K E;  3MA2 B;  2PZW A;  3V05 A;  2NZ1 D;  1F9R A;  2XIW A;  5CR3 A;  2AQ1 B;  5CBE E;  3DWA A;  5CYU A;  5M5W B;  1KAB A;  2NN6 I;  4AYB B;  3A8J E;  4ULL A;  4A3F B;  3D8G A;  2B2T C;  5AFW A;  3V96 A;  2R3Z A;  3K57 A;  2A6E C;  3A56 A;  3DXJ C;  3FRP B;  3T56 B;  4G4K A;  2I07 B;  1V1P A;  4EGV A;  4CJ1 B;  1Q8I A;  1QJO A;  5M3F B;  3QWN A;  4FF4 A;  1SDF A;  4HMJ A;  1SNO A;  1VMC A;  2RBM A;  5IGC A;  1LTS D;  4DAP A;  1H9S B;  4BWG B;  4J1M A;  4Q0F A;  1WTP A;  1F9P A;  2Q8T A;  2DNC A;  1EY8 A;  1ML0 D;  5FLX L;  5EBD A;  2IW3 A;  2YYZ A;  5EKL A;  3WDN A;  3OHX C;  4J8Q A;  2B63 B;  3T51 B;  1S5F D;  4FF1 A;  1EWC A;  3LX0 A;  2FMC A;  4DU9 A;  4EVO A;  2JYO A;  4OIJ A;  2D62 A;  3NP8 A;  4PMB A;  2R93 B;  4OO1 I;  1L0X B;  4I65 A;  1I4G A;  1HHV A;  1AFP A;  1I4P A;  4K5W A;  1AZP A;  1UUP A;  1PRT C;  5EKI A;  1O7Y A;  2NB0 A;  1B44 D;  3DWQ A;  1B53 A;  3HS0 C;  1NSN S;  1EY0 A;  2RQX A;  1VF7 A;  4R9W A;  1Z6H A;  2XRQ D;  4ME5 A;  2LS0 1;  3KF8 A;  2X6L A;  3I91 A;  3FPP A;  3KBX A;  3OIQ A;  3VYT A;  2ENB A;  1GUW A;  5HUR A;  2QDB A;  1WTV A;  2WKD A;  1Y8P B;  4IFD H;  5JAV A;  4FXK C;  1PRT F;  1HA5 A;  1CHP D;  3L7Z C;  4M8A A;  3G7L A;  1BR9 A;  3K5L A;  3J80 E;  1EY6 A;  5KRU A;  1A3V A;  1WD1 A;  5K36 G;  1SYC A;  2FFK B;  1NR4 A;  3J7A V;  1IW7 D;  1X3Q A;  2KQ3 A;  5DM7 3;  3M4Y A;  1ICW A;  4IAL A;  5E4W C;  2WAQ B;  4K8J A;  4HCS A;  1H9S A;  2CW0 D;  4HN7 A;  4IFD J;  2O4X A;  1SXT A;  3T53 B;  1WTO A;  2R92 B;  1PZJ D;  1ILQ A;  2EY5 A;  1ZXT A;  3I4M B;  1STN A;  4ZKB B;  2K5W A;  3K5O A;  1LTB D;  2ID0 A;  4LK1 C;  3K59 A;  3PUZ A;  3P75 A;  2E75 C;  2XN9 C;  1G6Z A;  1GJX A;  2BDO A;  3I90 A;  4RAU C;  3TME A;  4OO1 H;  2Z4H A;  1F2Y A;  4ZYS A;  1R4P B;  3HEJ A;  2AUK A;  1O7Z A;  1FR3 A;  1J8I A;  3NXW A;  2L55 A;  4C2M B;  5FO7 B;  1WTW A;  3PMF A;  2F0G A;  1MD2 D;  1CZG A;  1DOK A;  1IL8 A;  3S16 B;  2R61 A;  1U4P A;  4J6H A;  4BS9 A;  4QIW B;  3OWF A;  3KLR A;  4LJZ C;  2FJ2 A;  1TS4 A;  5EGT A;  3QIA A;  5KIX A;  1H9K A;  4KKU A;  2EE1 A;  1ILP A;  3FDT A;  3GTK B;  3IKJ A;  2A68 C;  3NQT A;  3ONA B;  3I4N B;  4IUV A;  1TWG B;  4C3H B;  1LLR D;  1TT2 A;  1EY7 A;  2AWN A;  3BYT B;  2VB2 X;  1ONL A;  1CI3 M;  5ELB A;  4RCN A;  2A5H A;  1KDA A;  3SXH A;  4HTH A;  1LTR D;  4UDU C;  1PTO D;  2PCF B;  4EQO A;  2VB3 X;  4F87 A;  4IQZ A;  4RHR A;  3X3N A;  3V2T A;  5CV5 A;  1WTX A;  3FPU B;  1YNJ C;  2PPB C;  3BS1 A;  3H3V C;  2FHT A;  3ITP A;  3CKI B;  3K5N A;  5IIF A;  2F0U A;  2NTS A;  1G91 A;  1LT5 D;  1S5C D;  3MFY A;  2L11 A;  4N9T A;  1G29 1;  3MC0 B;  4S3S A;  3QB3 A;  3K5M A;  2EZV A;  1XXG A;  1K83 B;  5ISR A;  5G3L F;  3BDO A;  3VR6 A;  1K8O A;  3DEP A;  3KK7 A;  4BA2 I;  1WD0 A;  4ZK9 B;  1G2T A;  3GV6 A;  1GUG A;  3JAM L;  4NMZ A;  3P1H A;  2X69 A;  4K14 A;  5KNC A;  1SSO A;  4XIG S;  2XRS D;  3S2D B;  1CTM A;  5J1Z A;  2B2U C;  1V1P B;  3HOY B;  4HR7 B;  3M4O B;  2WV6 D;  4DAY A;  3MXP A;  3VYS A;  3CHB D;  3SK8 A;  5JPN C;  1M8A A;  3D31 A;  2LY7 A;  1CA6 A;  1D5M C;  1Y1W B;  2OT2 A;  2HUG A;  5JOB A;  2C9O A;  4G7H C;  1B3A A;  1WTQ A;  2PQE A;  1STY A;  2HDM A;  5K36 H;  2E2D C;  1DZ1 A;  1Q90 A;  1STH A;  1NCV A;  3BDC A;  4CKC A;  2MUY A;  5JPM C;  1STE A;  1B9M A;  2HQE A;  4A3M B;  2EDG A;  2SEB D;  4C1N K;  2SNM A;  3HOW B;  1JOO A;  1SYB A;  2ZXO A;  2K33 A;  5F2D A;  1TY0 A;  2WIN B;  1VMP A;  2M9V A;  2SNS A;  5E3F A;  4XQJ A;  2PW7 A;  4KK7 A;  4OO1 G;  4A3G B;  5CV4 A;  3FVQ A;  2PZT A;  4EQP A;  4RKB A;  4DA2 A;  5I9P A;  5D65 A;  1GUO A;  4CJ0 B;  1T5E A;  2JA5 B;  2NN6 G;  1BNZ A;  1EQT A;  2PW5 A;  5IGE A;  1YNN C;  4A3D B;  4A93 B;  1CQV A;  1BQQ T;  1XYI A;  1VF5 C;  4BBR B;  3HOU B;  1JQY D;  1AN8 A;  2A69 D;  4MHE A;  5LL6 X;  1LTA D;  4FP5 D;  4DNR B;  4X3S A;  3ERO A;  2IT1 A;  3J7Y W;  2B2Y C;  1K8M A;  1SJE D;  2KED A;  2XVS A;  1DJR D;  1DXM A;  3OMG A;  4A3J B;  2CHB D;  3H91 A;  3I72 A;  5D3I B;  1GUT A;  3HP3 A;  2JXM B;  4A3B B;  4DF7 A;  1JC7 A;  2QIL A;  1QIL A;  1DD2 A;  4F88 A;  1PZK D;  2E2I B;  1R9T B;  4RCO A;  5KNB A;  5A2Q L;  4KD4 A;  2TMP A;  1C48 A;  4RA8 A;  5FO9 B;  2EY6 A;  4RHS A;  2A6E D;  1OXX K;  3Q0A A;  1UNS A;  2PNR C;  1V1O A;  5C0X J;  4A3I B;  1EOT A;  1RD9 D;  3Q24 A;  4DFA A;  1JOR A;  3O13 A;  1A6X A;  1EU3 A;  1RDP D;  2PZU A;  2Z1C A;  3S1Q B;  2BE5 C;  3L3O C;  5FKA C;  3BYY B;  1QWY A;  4WOR A;  2IX0 A;  1IKL A;  1JR0 D;  5C5M A;  5EPK A;  4MN3 A;  1BBX C;  2LFN A;  4DK0 A;  3FEW X;  1LT4 D;  1DM0 B;  1SAP A;  3T16 A;  2I46 A;  5C44 B;  1EZ8 A;  5NUC A;  4OHJ A;  5HGT A;  2QCP X;  3C1F A;  1TS3 A;  1PYW D;  1QG7 A;  2Q8R E;  2O5I C;  2DY8 A;  3IL8 A;  3URY A;  4IN3 A;  2D5D A;  3MFG A;  2BA0 A;  2NVY B;  1F2Z A;  5C3W A;  3S2H B;  4N9P A;  1PLF A;  4KI0 A;  4C3I G;  1HQR D;  1ESF A;  1F9Q A;  1LTT D;  1VCI A;  3WOE A;  4HAE A;  2F0H A;  2IX3 A;  1HFG A;  5DEH A;  4IUQ A;  1SYF A;  1MSH A;  3PUY A;  3EFX D;  3VA5 A;  1PRT D;  1OXT A;  5KND A;  4WFN 3;  1F2M A;  3HKZ B;  2NBF A;  4FXG C;  2BDN A;  2L5T A;  5C0X I;  1Z47 A;  3I4L A;  1TWC B;  2HCC A;  1TR5 A;  1D2B A;  2J4X A;  1DON A;  5COY A;  1I4X A;  4V19 0;  3CQZ B;  1XTC D;  1DOM A;  5J22 A;  2BOS A;  5ELD A;  1JE4 A;  2ZT9 C;  1PDQ A;  3I73 A;  4L6T B;  5DAU A;  5EQ0 A;  5IGB A;  1AW7 A;  3OW7 A;  5C4X B;  4RGO S;  2BA1 A;  1Y8O B;  1PFB A;  2CW0 C;  2K6A A;  1KLU D;  3VYR A;  4Z9C B;  2RDG A;  1EFI D;  4TKO B;  2EJM A;  1IW7 C;  3PIP 3;  1S5D D;  1CM9 A;  4X3U A;  5LL6 S;  1V43 A;  2ZXR A;  1MSG A;  5FOB B;  3BDL A;  2K7V A;  3TP8 A;  3I8Z A;  3EA6 A;  2KHS A;  4H0L C;  1WTR A;  3RMH A;  3GV3 A;  1B50 A;  2K01 A;  2KA7 A;  2B2V C;  4HSV A;  4IUN A;  4LMQ D;  3LNN A;  4PMC A;  2RSO A;  3SK6 A;  4H13 C;  4BY7 B;  1PXU A;  2IL8 A;  1KLG D;  4RWS C;  3BG3 A;  1S5B D;  2JP1 A;  2MHV A;  1LT3 D;  1PRT B;  2YU9 B;  2JEB I;  4IUU A;  2RSN A;  1F77 A;  5CV8 A;  1FYC A;  4KJO A;  1EU4 A;  3GO5 A;  1JWU D;  1BCP C;  3K58 A;  1B1Z A;  1QB5 D;  1A2U A;  2EJF C;  4P2C B;  4G7O C;  1C8C A;  4HCE A;  2A6H C;  2VNU D;  3A8I E;  1PFM A;  1BCP F;  1CFM A;  3S1M B;  1TS2 A;  3AMU A;  3J81 E;  3VR2 A;  5E1F A;  3S17 B;  3ND8 A;  4NKL A;  3MXU A;  4ILW A;  1KNE A;  1Y8N B;  1GHK A;  5A2Q E;  2FMM A;  2LMC B;  5IT9 L;  3R93 A;  1EIH A;  2RDH A;  3DEO A;  3MTS A;  2B2W C;  4IFD I;  2F1M A;  5C4Z A;  5JEA H;  1CA5 A;  3R2I A;  5I6W A;  2XWB B;  2PYK A;  1HUN A;  1NR2 A;  2HDL A;  3HRZ C;  5FO8 B;  4B08 A;  1J9O A;  3JAM E;  4HMI A;  1Q3L A;  4H7B A;  2F03 A;  2EY2 A;  3SHL A;  3D6W A;  3RLF A;  2V4D A;  1PZI D;  5C5L A;  3EJI A;  2F0I A;  1ZYR C;  1F9S A;  3H94 A;  2IPK D;  1NUC A;  3CRL C;  3VR5 A;  4XYQ A;  3U9O A;  1ET9 A;  3M3Y B;  2A74 C;  1IYV A;  4KHV A;  5IT9 E;  1TVX A;  4XT3 B;  1TU2 B;  4KMU C;  1EL0 A;  4FVM A;  4QF4 A;  4CGY B;  3J81 L;  2XWJ B;  4K2K A;  3X3M A;  2QEJ C;  4O42 A;  1G8Z D;  4KN7 C;  1A3U A;  1MI2 A;  2D9U A;  2WP8 J;  2PMZ B;  2D2C C;  3GTQ B;  1U4M A;  1ZKO A;  3ZYY X;  3MZ5 A;  4U68 A;  5I2Y A;  2H4O A;  1D1K A;  4C3J B;  1LTG D;  2F0E A;  1RCV D;  3D4R A;  3S1R B;  4NW2 A;  1ZYR D;  4K5V A;  4OIK A;  4KKT A;  2L9H A;  1W6J A;  5EBC A;  4F8M A;  4XXE A;  5ELC A;  3ND9 A;  1FNV A;  1SMY D;  1ROD A;  1KDB A;  3BVM A;  5IGG A;  1A3T A;  3QG1 A;  3PV0 A;  3MWY W;  1SE2 A;  2H1E A;  2XSC A;  5JEA G;  4PNY A;  1SND A;  4BBS B;  4CKB A;  1SMY C;  4A3E B;  1SFO B;  2M2L A;  4NDX A;  3W3A A;  1AEX A;  2AWO A;  3R8B A;  4NP5 A;  3TP6 A;  4K6L A;  3TSS A;  4KJN A;  1DCZ A;  2WKC A;  2F0P A;  4FXD A;  2HCI A;  3GTL B;  2RKS A;  2NVQ B;  1G2S A;  1CHQ D;  2F0D A;  2WB1 B;  1JWS D;  2A73 B;  4BY1 B;  2JA6 B;  3LWU A;  1FNW A;  1SNM A;  4IZ8 A;  1TS5 A;  4PV1 C;  3TP5 A;  5D3D A;  3S14 B;  5A35 A;  4QUC A;  5C3X A;  5M3M B;  1RF2 D;  5JVH 3;  2L1B A;  2MGS A;  4O1N A;  5JEA J;  2SOB A;  5I2X A;  1KAA A;  3GQB A;  2O2L D;  3FMC A;  4Y7N B;  1I50 B;  1BF4 A;  1DOL A;  1EYD A;  3L9A X;  3D4W A;  1TWA B;  5BN4 A;  3QJY A;  2K5Q A;  2F0L A;  2JA7 B;  2F0O A;  3VR3 A;  3J80 L;  4XQN A;  2EY1 A;  2A69 C;  3PIO 3;  1OXS C;  4ZUI A;  5COR A;  3TP7 A;  5CV7 A;  3NBH A;  3PO2 B;  4XQQ A;  3GTO B;  2XNA C;  5BN3 A;  3N6R A;  3NUC A;  4RGM A;  1KNA A;  3NHH A;  4FF3 A;  1SYD A;  2Q8I B;  2R6G A;  4V0B A;  3D6C A;  3RZO B;  2EYL A;  3DM1 A;  3NE5 B;  1YNN D;  2F3V A;  3Q6S A;  2WII B;  2A6H D;  3QO2 A;  2BE5 D;  3MEH A;  5EPJ A;  2NWG A;  3HZX A;  1WVL A;  1EEI D;  2FIN B;  3IFT A;  1E2W A;  1MBY A;  4KD3 A;  5J39 A;  2E2H B;  1TII D;  1BCP D;  3PUX A;  3T13 A;  4KY7 A;  3PO3 B;  2KCC A;  4YIJ A;  1ENA A;  5EJW A;  1STA A;  1QNK A;  3W2D A;  2SDF A;  3MHB A;  4R8I A;  1IHZ A;  1LTI D;  2AUJ D;  3I3C A;  1I4H A;  2B8F A;  3HG9 A;  1EWH A;  4CHT B;  4RKL A;  3TZD A;  1L0Y B;  2AQ2 B;  3C1E A;  5KEE A;  3GTM B;  3NWS A;  1Z7T A;  3DMU A;  4L63 B;  4ZRZ A;  4I7Z C;  3C3L A;  1A15 A;  5IOC A;  1HQM C;  3S1N B;  3WOF A;  4G7Z C;  1B4O A;  5I6Y A;  2X6G A;  4C3I B;  1EIG A;  1I6H B;  1QE6 A;  3NTH A;  1HCZ A;  4WJW A;  1H9M A;  4QB4 A;  1XWE A;  2JE6 I;  2GA4 B;  5KYI A;  4B9W A;  1SYE A;  1BXT A;  2J0T D;  2B2T A;  1JCK B;  4Q5V A;  5FK9 C;  4PMW A;  1EYC A;  5EKK A;  1EY5 A;  2E76 C;  2EPB A;  4TQU S;  1D5X C;  4IUR A;  2B2U A;  3E0J A;  3BZD B;  1X32 A;  5KGU A;  2F0N A;  1RJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...