4RAUC

Crystal structure of rtofab in complex with human pf4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
b'EDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RTOFab light chain
publication title crystal structure of RTOFab in complex with platelet factor 4
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 5
structure length 65
sequence length 65
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rauC00
4R9WA 4HSVA 1DOMA 1NR2A 2RSOA 1BBXC 1F9QA 1BNZA 3ONAB 1WTVA 3TN2A 2HDLA 4CJ1B 2N55A 1B4OA 1RODA 1F9SA 4QUFA 2EOTA 1PLFA 2B2VA 2Q8RE 1QNKA 2K01A 3KBXA 3MWYW 4LMQD 1E0BA 4XDXA 4ZLTF 1WTQA 1F2LA 1EIGA 1PFNA 2RA4A 2B2TC 2D9UA 1PDQA 1G2TA 2FHTA 4RAUC 4UAIA 3UI2A 1QE6A 4ZKCB 3H91A 3MTSA 5COYA 1J8IA 5EQ0A 4NW2A 2Q8TA 1EIHA 1DOKA 1RTNA 2IL8A 2MGSA 1J9OA 1HUMA 3I8ZA 1C8CA 1WTWA 2M2LA 1WTRA 2B2YC 2NWGA 5CBAE 1XX8A 4IUTA 1IL8A 2FJ2A 2JP1A 2HCCA 5E4WC 1MGSA 2L9HA 3R93A 1HA6A 3P7JA 1NCVA 3N52A 2KVMA 1EL0A 5E4XA 3I3CA 3GV6A 2EPBA 2B2VC 2J7ZA 1ICWA 2L11A 1SAPA 5T1IA 1DONA 2H1EA 4IUQA 1WTXA 1G91A 1X3QA 4OIKA 2DY7A 5T1GA 4X3UA 1SDFA 2HCIA 1MSHA 1U4LA 1KNAA 1O80A 1DZ1A 2KEDA 1RHPA 1Q3LA 2BDNA 2X69A 1XYIA 4U68A 1CM9A 1A15A 1O7YA 1G2SA 1ILQA 1EQTA 1JE4A 2B2WA 2MPMA 1U4MA 3Q6SA 3LWEA 1AZPA 4CJ0B 1S4ZA 2KECA 2X6GA 5EKIA 1ML0D 3I91A 1WVLA 1B53A 2FFKB 4HEDA 1JICA 5JJZA 1BO0A 4MN3A 3FPUB 1B50A 1HFGA 1NAPA 2NYZD 2HUGA 4ZKBB 1QG7A 5DNFA 2SDFA 4IUUA 1WTOA 1SSOA 1F9RA 1U4PA 2CVRA 2R3ZA 4HCSA 4X3KA 3TZDA 1HUNA 1LV9A 1MI2A 3GV3A 1BF4A 4RA8A 5CORA 4DN4M 2FINB 1CA5A 1RTOA 4RWSC 5CBEE 2K28A 2B2WC 4IUPA 2K05A 3FDTA 1IKMA 2K03A 4R8IA 1RJTA 1X32A 3DM1A 2B2TA 1B3AA 2N88A 1VMPA 2HDMA 3DEOA 5D65A 5EPJA 5EPKA 1GUWA 1WTPA 1WD1A 2JYOA 4XT1B 1ESRA 1KNEA 2L12A 2K04A 2DY8A 3D6WA 3IFDA 3IL8A 5EJWA 1CA6A 1VMCA 2B2YA 1U4RA 2X6LA 3I90A 1AP0A 4X3TA 1X3PA 2B2UA 1B2TA 1PFBA 2K1BA 5AFWA 1G6ZA 4XT3B 5CMDA 1HHVA 2RSNA 4O42A 1HRJA 2KUMA 3DEPA 3QO2A 4QUCA 2EE1A 2KEEA 3KUPA 5D14A 4ZK9B 2L1BA 4X3SA 1IKLA 1HFNA 1F9PA 2RVLA 3HP3A 5EPLA 1DOLA 1EOTA 1MSGA 2MJ8A 2NZ1D 2VXWA 2XIWA 3F2UA 4HAEA 4OIJA 3SVMA 1AZQA 1ILPA 2KOLA 3G7LA 1TVXA 1NR4A 2MP1A 4CJ2C 2L4NA 1M8AA 1PFMA 4IURA 4MHEA 4ZAIA 1WD0A 1O7ZA 2B2UC 4IUVA 2FMMA 1ZXTA
chains in the Genus database with same CATH superfamily
4ID6A 4A93B 5KNCA 4WFN3 2R93G 2HIXA 3H3VI 1YHAA 2IT1A 3RLFA 2K5QA 5JAVA 1JB3A 3PF4A 4YY3L 1WTQA 3J7AF 5JEAH 1T5EA 1A63A 4OELB 3F1ZA 4DXFA 5C4ZA 4FF2A 4RAUC 2EY6A 4DR5Q 1TWGH 3S15B 1PH8A 4PMCA 2G9DA 2QCPX 1JORA 4I7ZC 5COYA 1I4XA 3U9SA 1EQRA 2ZTCA 2NVQB 2JP1A 2HCCA 2CWPA 3VYUA 1Y1WH 4EQPA 2UUAL 3J7ZC 4ULLA 3GV6A 4WJ4A 2JA6H 2F0KA 2J7ZA 2L11A 3OIPA 2F0LA 3T53B 1SJHD 5JPMC 4FXKC 1EY8A 1H9KA 2F4IA 3JAME 2ES2A 4GKJL 2D2CC 1QVCA 1RHPA 2A74C 3KF8A 3MC0B 5G3LF 4B9XA 1N36L 1STYA 1NY4A 4DV2Q 1T9HA 2X69A 1S5ED 3GQBA 3S14B 3S1NB 1S4ZA 5H1SE 2JEBI 3G6EA 3C3LA 5JVH3 4MZ9A 3JAMc 4DUYL 4A3JG 3I4NH 2K5NA 1KD1C 5IGBA 4ZYSA 4LF4L 2NYZD 2VY3A 1CZWA 1HNXQ 1P16A 3J80E 1XPOA 4KHZA 5F2DA 2K5WA 3PO3G 1X6OA 1Y69U 2CH4A 2ZJPA 1YHBA 5CV5A 4JI1L 4BBRB 3DLLA 2EVBA 3K5OA 1WCMB 1PH7A 1WTPA 1YJWA 2JYOA 1GM5A 1XTDA 3MFGA 1A0IA 3M4OH 5ELFA 5C3EG 2B2YA 1ESFA 1EY7A 3I90A 3TS2A 4Y7NH 1EFID 3GTGH 4PMBA 3NBHA 4FF3A 4XT3B 4IZ8A 1TWHH 2Z8LA 3URYA 4C2MB 2I46A 3H0GG 1R9TB 1V1PB 3MVVA 1L0XB 1SYEA 4C1NI 4A93H 2A19A 5FLMH 1V8QA 3V96A 2R93B 2B63H 4IUVA 1YI2A 3E5SA 4OO1H 5EKLA 5FLXL 3CCQA 3VYTA 1PLFA 1KXLA 3MWYW 1M4VA 1WTHA 2JE6I 1I94L 1HR0Q 1XMQQ 4JI6L 2F0TA 5DAUA 1Z9FA 4K14A 5CYUA 1HJPA 1D5XC 1GHJA 4NKLA 3TBIB 3HOYB 1KIXA 1HH2P 3HKZG 4J8QA 5E4XA 4A3FG 3H3VC 3C1FA 1UEAB 3TP6A 5EAYA 1K28A 1S72A 3AB9A 1JJGA 1I4QA 3LWUA 4GN5A 3CD6A 3OWEB 4LF9L 4F7XA 1JOQA 2E2DC 4A3JB 4C3JG 4KKUA 3AEVA 1C0AA 1K3RA 4P71A 3VR5A 1SLJA 4B3ML 3UDGA 4B3TQ 2E75C 1C9OA 2SDFA 4BXXH 1WCMH 4FF1A 4DK1A 3ZYYX 3A5UA 2QGQA 1JR0D 4KD4A 2CH4W 2JA8G 4RHRA 1J6QA 1BKBA 2JA5G 5IP7G 4EQNA 2NVXB 4NP5A 3TP5A 4C3HH 1LTSD 4R4TA 4IPGA 5I4DA 1E2WA 2BH2A 2K04A 3IFDA 4C2MH 2NTSA 2XGTA 1R9TH 1QUQB 3MXUA 1SNMA 1JOOA 1T5XD 4UP7A 4H02A 3SGIA 2Z9HA 3T16A 1ET9A 4JYAL 1EYDA 4YY3Q 3QG1A 3OMCA 3G4SA 2RSNA 3K5NA 3CCVA 3DEPA 2KEEA 2MFIA 1C4QA 4M1UB 3MXPA 2R93H 4HJ8A 5IT9L 1W6KA 3OOCA 2BDOA 2DGYA 5EPLA 1GVPA 3PGZA 4HAEA 1UE5A 3IFTA 2F0EA 4F8MA 3SVMA 3BZDB 4CJ2C 1LT3D 2UUAQ 1JWSD 4DKAC 1A8VA 1TT2A 4ME3A 2V4DA 1VS0A 1F9QA 3C1EA 3L0OA 4HJAA 4GKJQ 5GROA 3UDIA 2PI2A 4OL7A 4HR7B 4APVA 2ZTEA 1N36Q 1PH3A 2D9UA 1BCPC 2VUMB 5FO9B 2BA1A 4IJLA 1BQQT 2G5DA 3RN2A 3D4RA 3W1GA 2IL8A 2E2JB 3RLNA 4DUYQ 1VQ4A 2RCFA 1XX8A 3J7YW 4KY5A 3GTLH 4CGYB 4DV4L 5CR3A 1S5CD 1SYBA 3NE5B 1VQNA 3BJUA 1WFQA 1X3FA 4A3JH 2HCIA 4JI1Q 4EQOA 4YWKA 1GO3E 1VQ8A 2BDNA 3GTMB 4RHSA 1EEID 4C3JB 5M5XB 5I2XA 3L9AX 1EQTA 3PO3H 2R7ZB 3NUCA 2QW7A 3I91A 3Q24A 3M7GA 1VQGA 2NVTB 4R4CA 1KRSA 4R4IA 4Y52H 2IPKD 1QG7A 5CV8A 5GAHC 2NVXH 1AE3A 5ELNA 5IGFA 2JA8B 4NB3A 4RGTA 4P73A 5C3EH 5CORA 1EQQA 4LUZA 2ALYB 5A35A 3DXJC 5IYBG 3NPPA 3H6MA 3S9WA 1A3VA 1LLRD 4A3LG 1BR9A 1VMPA 2NN6G 1SMYC 2BOSA 2HHHL 1QB5D 3H0GH 3RZOB 1UAPA 1KNEA 2F3WA 3K7AH 2PQAA 2EIFA 1EY9A 3BDLA 1VMCA 2VS1A 1PFBA 3MA2B 4L5QA 1I94Q 2F0HA 1KC8C 2F0WA 3GTPB 4JI6Q 3PV0A 3CPWA 3ULJA 3KUPA 1NUCA 4A3KG 4GOPA 4A3MB 2JQOA 4H44C 5NUCA 4IFDG 1VQCA 1VQPA 1GXDC 4IFDJ 3TEHB 1W3SA 5AJ3L 4GN4B 5JVG3 1E1OA 4F88A 1WD0A 1ZXTA 4X3KA 3K7UC 3D3RA 4DK6C 2AQ2B 4K2LA 4CDCC 4IALA 1YNNC 4DV3L 3CP0A 1SBBB 2EOTA 3HRZC 4WJWA 4C1NK 5BR8L 5C4JB 4DR2L 4GOPC 2I5MX 2E2JH 3KBXA 5GQOA 4P75A 2LSSA 4LF9Q 3ICEA 2O4XA 1ZYRC 1Q7YC 1JJ2A 1LTID 1TIID 3HG9A 1X65A 2IY5B 4RG1A 1OO9B 4B3MQ 1IL8A 2VNUD 4M8AA 2EYLA 1MGSA 2AUJD 2RHSB 1VQOA 3T13A 1B8AA 4C3JH 3NK9A 3I73A 1IBKL 3I4MG 2A69C 1Y14B 4BY1G 1EFWA 1AH9A 2NVTH 2MUYA 3FMCA 1XYIA 4RKBA 3DMUA 2MPMA 5C4HA 3PQIA 2JA8H 4WORA 3ULLA 3NTKA 5ELDA 1TR5A 2JA5H 5IP7H 1LABA 3AFQA 4JYAQ 5C44B 4ZUJA 1NAPA 1D5ZC 3E3XA 1EWIA 1F9RA 1YJ9A 4L5TA 1YEZA 3E0EA 1UUPA 2KJXA 1TWFB 4RA8A 2AHOB 2ZXPA 1IYUA 2QDBA 1FNWA 3FPPA 3HKSA 2YV5A 1X32A 3DM1A 2N88A 2HDMA 4IN3A 3VA7A 3ER0A 4MIUA 3F2DA 2Y0SE 3OWFA 1AW7A 2EJMA 2R6GA 5IGEA 1PYSB 1AP0A 1BBWA 3ULPA 4JOIC 1G291 4ZQ3A 2EYPA 2FMCA 3RD4A 1RKNA 1Q82C 2EE1A 4LF8L 1HFNA 1KLGD 2RVLA 1DOLA 3DWPA 3QOJA 3M4QA 1ILPA 2YU9H 1P8LA 1PYWD 5C4JH 3NTHA 1M8AA 4IURA 4AYBG 4DV4Q 4A3IG 4FXGC 1PRTC 4CJ1B 5CV4A 3S17H 3J81E 2NVYH 4HSVA 1BBXC 2EY1A 1TS4A 1YNJC 2HDLA 4UDUC 3P75A 2K14A 3X3NA 5C4XB 5ISRA 5M5WH 2M9VA 4C3IB 2H4OA 1PDQA 4K0KL 2MO0A 2Z4HA 4UAIA 3J81c 2R92G 2KHJA 2F0QA 2Q8TA 3TREA 1DOKA 4KN4C 4CBVA 2RDGA 2O2LD 4JBWA 1S3OA 5C5MA 3FVQA 5IODA 3P7JA 3EA6A 1KDBA 1XWEA 2WAQE 3CW2C 3R2IA 2A68D 5KGUA 1VQKA 1SNQA 4OIKA 3OW7A 3A8IE 2K7VA 3CCSA 5M5YB 1HZBA 1Q1BA 1X3GA 3MXNA 2Y0SB 2KEDA 5KRUA 2HHHQ 1SFOB 3VR3A 4DR3L 5IYCH 3W2DA 1JE4A 3AYHB 3PMFA 1VQMA 1HZAA 1TWFH 5BN3A 3J80L 4A3GG 4BWGB 5IYBH 3E6ZX 1PXUA 4A3LH 3K5MA 2NN6H 2QKIC 3S16B 1TWGB 5DNFA 4TQUS 4PMWA 1MKHA 4HCSA 1NJIC 3E9HA 1W6JA 2F1MA 4GNXC 1C7YA 1Y1WB 2IHEA 4IUPA 3GD7A 5AJ3Q 1Y8PB 4A3KH 5CGKA 3WWVA 1KTKA 1N32L 2QDLA 4IFDH 4DV3Q 1IXRA 5BR8Q 4DR2Q 4CDFC 5ELEA 5AFWA 3KF6B 2EJGC 3PCOB 2JA7G 3GDEA 1V1OA 3I4NB 5I6WA 1GHKA 3NQTA 4A3BG 4IQZA 3MHBA 3F2UA 1GUGA 2RHQB 3ND9A 1IW7D 5LMNW 4X6AH 1CFMA 4R8NA 1DJRD 2V1CC 2RSOA 3P20A 1CI3M 4KV6A 3I56A 2UUCL 1IBKQ 3GTJB 1WTVA 3A7LA 3D6CA 2A6EC 3A74A 1H9MA 4XDXA 4Q0FA 4LK1C 2R92B 1I4GA 4KD3A 2B2TC 4Y7NB 5ELCA 3GTGB 2PZUA 3H91A 4HJ7A 4BY1H 1EIHA 4JI2L 1J9OA 3C46A 1E1TA 1TWHB 1TXYA 4HN7A 1MJEA 4MTNA 3GO5A 3STBD 3CKIB 5I9OA 3BVGA 3I3CA 2EPBA 1SFOH 1ZEQX 3SE0A 5T1GA 2SNMA 1L0WA 1I6HH 5K36G 4DR1L 1SDFA 3MAQA 2M00A 4GKKL 2B63B 1KDAA 3KOJA 1B70B 1HQMC 3R3OA 2IWHA 4JBMA 1FL0A 4HIKA 1QZGA 3S16H 4A3DG 3BZKA 4JI4L 2X6GA 3IAYA 4JI0L 3TSSA 1B50A 3K8AA 2FXQA 4ZKBB 4LF8Q 3TZDA 1N34L 3KK7A 1TKWB 2EXDA 1G6PA 3NENA 3SK8A 2DNEA 2K28A 3TP7A 3CRLC 3OSOA 4R8IA 1IL2A 1KDCA 1Z7TA 3CCEA 1KLUD 2CW0C 3PIO3 4EGVA 1JCKB 2DY8A 3D6WA 3Q8DA 4N9PA 1EYAA 5HY6A 3GP7A 2JK8A 1STNA 1NMGA 2F0VA 1DM0B 4A3IH 2UU9L 4YCUA 3PO2G 3LGJA 4QUCA 1BCPF 3HOWG 4K0KQ 4IPHA 1IKLA 2AMCB 1F9PA 3GTJH 1R4QB 1O78A 2K32A 2NTTA 2NZ1D 3PUVA 1AZQA 1TS5A 2HIVA 3JC66 3EQLC 2E74C 3E9IA 2R92H 3UDXA 1LT5D 3FEWX 4IJHA 3KBGA 3S2HH 1YIJA 2WACA 2YTVA 5HURA 1O7LA 1B4OA 1EU3A 4KLKA 2PMZB 4C3HB 2B2VA 3IRBA 1TWAH 5E7NA 2VQEL 3V05A 1TWCB 2XTIA 2EXZA 4DR3Q 4DR7Q 1D1KA 3HOXG 2FHTA 4O0AA 3U4VA 4KI0A 1YNXA 3DHQA 4DFAA 1JMCA 2B2YC 4TRDA 3NEMA 1VQEA 1BXTA 3HS0C 3NXWA 2L5TA 1GKHA 3A56A 1ZKOA 2B2VC 4DNTB 2QF7A 2K75A 1SAPA 4LFCL 2H1EA 1KL9A 3CCRA 2KHSA 4A3GH 3EJIA 2K5DA 1OTCA 2F4VQ 1X54A 3T1YL 1U4LA 3KLWA 1OXSC 3WOFA 2KCMA 1MHWC 3K0XA 4LF6Q 3HOZG 2Q2HA 3DUZA 3J80i 2EY5A 5C3WA 1GUSA 1N32Q 1GD7A 3OMGA 5LMNL 2NB0A 4KHPL 2B8GA 2K52A 1FD7D 4JG2A 5C0XI 3BVMA 4K5WA 2GN5A 1HUNA 2F0FA 1SMXA 2Z0SA 1M1KC 1Q8KA 5KIXA 4ABNA 4DU9A 3ERSX 1RF2D 1JJCB 3GTLB 4KTAA 3PUZA 1BOSA 2JA7H 1BCPB 4DA2A 1E2ZA 2UUCQ 1L1OA 4A3BH 3H3VH 1PH9A 1PHJA 1PMRA 2OQ0A 3T4AC 3HKZE 4UP8A 4WRDA 4NDXA 4YCVA 2HD3A 2AUKA 3PO3B 4GLVB 2NZOA 2A6HC 1UE6A 1UE7A 4X3SA 4JI2Q 2VXWA 4HMIA 1CSQA 1L1OC 2KCTA 4S3SA 3G7LA 5M3FG 1II3A 2JN4A 4X62L 5C3EB 1TWCH 3F8TA 4R9WA 3OHXC 3VR6A 3BYYB 1B7YB 1STBA 3M4YA 4IOCA 3H94A 3EIVA 3TN2A 2I0QA 4H7BA 1K0SA 4DR1Q 4GKKQ 4FVMA 4NXML 3H0GB 4I7AA 1PTOC 3K7AB 3L7ZC 4ZLTF 1PFNA 4ZRZA 3AU7A 2D62A 3FKIG 3UI2A 3MTSA 4DAMA 4JI4Q 1YVCA 4LFAL 5K36H 1IYJB 3S1MB 2NWGA 4HCEA 1FR3A 2CHBD 4ZUIA 1PTOH 2KHIA 1N34Q 5JJIA 4A3DH 4DV0L 1ET6A 1WTXA 3KDFB 4IPCA 2EJFC 2PQEA 4PZ6A 3RZDB 1DZ1A 1SRUA 2GVAA 1LT6D 2J0TD 1VCIA 2RF4A 3BG3A 5FK9C 3V2TA 2SOBA 2SEBD 4QY7A 1A15A 1JB7A 1RDPD 3HKZB 3LWEA 4R1JA 4H13C 2N78A 4UP9A 2PQAB 4LF4Q 1ML0D 4A3FB 5IOCA 1JICA 5ELBA 2UU9Q 2OXPA 1F2ZA 1GUNA 4LF7L 2BE5C 1YITA 2QEJC 1QNUA 4IUUA 4LUOA 4K6LA 1U4PA 2AQ3B 2PNHA 2R7DA 1MI2A 1Y1VG 3ZJYC 3BU2A 2FINB 1R4PB 4B3SL 1I5FA 4GOPB 3MZ5A 1G51A 3KJPA 2K03A 4GN3B 3PO2H 4G57A 1B3AA 4AQYL 3HOWH 1IBLL 1SE3A 2N49A 1VQAA 4XT1B 1PYBA 1YJNA 2VL6A 3IL8A 4DUZL 1QUQA 1TY0A 5IY0A 3GTQB 3AMUA 5FO8B 2VQEQ 2A6HD 5CMDA 1PH1A 2ASBA 4RFBA 2WFWA 2JA5B 4ZK9B 1CKNB 2R7FA 4Z9CB 4HJ9A 1Q86C 1K0RA 3J81L 4BA2I 4N8FA 3HOVG 2EY2A 4LF5L 3HOXH 5KYIA 4LFCQ 1H9SA 3NQIA 4K8JA 1VF7A 5FLXc 5HGTA 2WKDA 1DXMA 2LS01 1RODA 2IX0A 1DGSA 3S1MH 3D8GA 2RQXA 3I55A 1UWVA 4BY7G 2RA4A 5J3BA 3RNUA 2OF1A 1LACA 2SNSA 1ICFB 1IHZA 5LMNQ 4B9WA 2MGSA 3E0JA 3UDFA 4LAAA 4KHPQ 5KEEA 3A7AB 4DK3C 3GTKB 1JC7A 3RZDH 4NXNL 3HOZH 2E8GA 1NCVA 1QJOA 5D3DA 3G6JB 4JV5L 2ID0A 3I72A 4OX9L 2HT1A 3SK4A 1DONA 1EYCA 2YU9B 1VQ6A 1GUTA 1HTLD 5EKKA 3S17B 3OW2A 2NVYB 4A3FH 1BCPD 1NNXA 4OXPA 4E6IA 1ILQA 2H5XA 5M3MG 4G7HC 3KFUA 1U4MA 2RKSA 3NHHA 1A3UA 5KNDA 1FNUA 1O7IA 1VQ5A 1VDZA 5M5WB 2RDHA 3CHBD 4ODGA 1CHQD 1WVLA 4HTHA 1BO0A 3FPUB 1PRTB 1Y1VB 2XNAC 2XVSA 4EX5A 1H95A 2E2IH 2LMCB 2R3ZA 2QA4A 2CVRA 5DM73 2C9OA 3CXCA 4YWMA 3KYHC 1K8AC 5ELOA 2BH8A 5GAEC 2E76C 2UXBL 3GTQH 4X62Q 1FJGL 2AKWB 4UY8C 3AFPA 1W2BA 5EJWA 1STEA 2X6LA 2UXDL 4NXMQ 1X3PA 4DAYB 4EQ5A 1AFPA 1J5EL 4YHHL 1D2BA 4V190 4QIWE 2ZJQA 1RIPA 3PUXA 1XPRA 4BBSG 4XQJA 3DWAA 4LFAQ 3BDOA 2XIWA 4DV1L 1SMYD 2JSOA 1PVOA 1VQ9A 3U58A 4FNFA 1O7ZA 1A2TA 1LT4D 1F2YA 3FKIH 2VB3X 4DV0Q 3I4OA 4CKEA 1IBML 1NR2A 1K8OA 5J39A 2C5CA 4DGZA 3WDNA 2Q8RE 2MNAA 4A3KB 5IE8A 1U9RA 4LWCA 2QEXA 3GTKH 1I3QH 2F0OA 4QCLA 2BA0A 4DPGA 4OWXB 3TQYA 4DR4L 3K5LA 4K8IA 4GNXB 4JPBW 4RCNA 3I8ZA 4JI3L 1X55A 2DJGC 1WI5A 4IUTA 4LF7Q 1YHQA 3R93A 2E2HH 4KK7A 2ZT9C 3ERQA 3PIP3 1YNND 4KKTA 1C48A 4B3SQ 1HPCA 4WJ3M 4GLAC 5KNBA 4LJZC 3RLOA 4Q5VA 4AQYQ 1S40A 4XQQA 1IBLQ 3OTOL 2HQEA 1ZYRD 5M3MB 4LFBL 4A76A 1Q81C 2WIIB 5A2QE 1SE4A 1Y1VH 1O7YA 2A1AA 4DUZQ 1HNZL 5IWAL 4QJFA 2EZVA 4JBKA 2KECA 4CKCA 1PFSA 2A5HA 4QIWB 2AQ1B 3JAML 2HUGA 3I4MB 1WTOA 1B44D 5FOBB 1LTLA 1SYCA 4CDEC 2E5LL 2A69D 3D0FA 4BY1B 1YBYA 2O5JC 3K57A 2G9HD 4P72A 1CA5A 4A3EG 3S1RH 5CBEE 4UHVA 1EOVA 1Q46A 1TS3A 4LF5Q 2IW3A 4P2CB 1Q1EA 1ESRA 1TQOA 4K2KA 4QF4A 1I6HB 3WOEA 3P1HA 2WB1G 4X3TA 1EWHA 3HOVH 4L5SA 2KUMA 1SN8A 4BBSB 2PW7A 4LUVA 3NP8A 5FKAC 1EZ8A 2F0JA 2L1BA 3MEHA 3J81i 1Y8NB 4GZYC 1CHPD 2F0DA 2MP1A 2OTLA 4BY7H 4L8JA 4NXNQ 1E24A 1PFMA 4MHEA 2UUBL 4JV5Q 3TZUA 1B2TA 4OX9Q 3EN2A 1BNZA 1Z47A 3ONAB 3PIOA 2YYZA 2IX1A 3EBEA 1UNSA 4QUFA 5IGDA 1CT1D 2XSCA 1E0BA 1VQ7A 1NE3A 4OONA 5GADC 1F2LA 1EIGA 1XTCD 1S5BD 4J6HA 4A3CG 5I2YA 4OEMB 1HR0L 1VQDA 4X66L 3VYRA 4YWLA 2WP8J 2YTYA 2ATWA 4AYBB 4A3IB 3NTIA 1D6EC 1C8CA 4QL5A 3T1HL 1WTRA 1XPUA 1PV4A 1HTPA 1PRTD 3FRPB 4JCVE 4RCOA 4QGUA 2L9HA 1HA6A 2Z6KA 3VYSA 2XRQD 3CCJA 4V0BA 5M3MH 1YNJD 1DD2A 4MTKA 1ICWA 3TMEA 1XJVA 4ILWA 4IUQA 2DY7A 3VDYA 5DEHA 3TRZA 4XIGS 3S1QH 3KJOA 3CC7A 2UXBQ 1KABA 1N33L 3MEFA 4QB4A 2PCFB 2VB2X 3KF8B 3S2HB 3I4MH 1JE5A 4BBRG 2B2WA 1EY5A 1F2MA 1EY0A 2PNRC 4JW0A 5DLQE 4BXXG 1WCMG 2PO4A 1FYCA 1TWAB 2UXDQ 3VR4A 4DF7A 1WJJA 1J5EQ 1JT8A 4HEDA 3F2BA 1XXGA 4IPDA 2AWNA 4YHHQ 2A8VA 1HFGA 2F0GA 3CC2A 2Z6BA 4A3EB 1PH6A 1WOCA 1EIYB 4RGOS 2KA7A 1RCVD 1Z6HA 4DV1Q 4NPSA 1CZGA 2B2WC 1EY6A 2PMZE 1XNQL 3K0YA 5CC4A 3QJYA 4FXDA 5EPKA 4A3GB 1IBMQ 1EEFD 4KY6A 2EDGA 4OHJA 3J81j 4BBSH 3M9BA 2L12A 2VZAA 1VQBA 4DAPA 2DUDA 2CQAA 2RDFA 1Y8OB 1U4RA 2B39A 1JWUD 1PTOF 3KF6A 3CCMA 3L3OC 4IUNA 3NBHB 1HHVA 3Q0AA 2C35B 4DR4Q 3GTOB 5HGQA 1ASYA 2D0OA 2DNCA 3M85A 5IYDG 2OCEA 4JI3Q 3SDZA 2RCNA 1SR3A 1TVXA 3TS0A 1QWYA 4DV7L 2L4NA 4RH6A 3OIQA 4ZAIA 5JJLA 3HOYG 1S5FD 5T1IA 3BZCA 1K3BC 1FGBD 2EQSA 5C3XA 2VW9A 3CCLA 2UXCL 4U673 5J22A 2JA7B 2XWJB 1QNKA 1PZID 3OTOQ 4A3BB 4LFBQ 3R2TA 4TVAB 2MHVA 1HNZQ 5IWAQ 4X65L 4CKBA 1J8IA 5EQ0A 1RTNA 2B8FA 5CV7A 1KAWA 1NBWA 2LFNA 4XTCS 2MQHA 4DNIA 2WKCA 4DXGA 2E5LQ 2KVMA 1IZ6A 1EL0A 2L15A 3I2ZA 4IO9A 4R4QA 2VQFL 2P5ZX 4LW1A 2A6ED 3CQZB 3S2DH 4X3UA 3OPOA 1SNCA 1F77A 1X9NA 1GUOA 5C0XG 1LO5D 2ICIA 2PI2E 4MNOA 3W5OA 5C0XJ 4HJ5A 1G2SA 3J80c 4CJ0B 4A3EH 3Q22A 5J1ZA 1L1OB 3JAMi 4HSPA 1A62A 1FGUA 1SSOA 5GAGC 4KN7C 3CAMA 2GVBA 1ENCA 4PG3A 1I50H 2OT2A 3K59A 3T56B 2QILA 2K5HA 1HA5A 2K05A 1PTOB 4TKOB 1IKMA 4A3DB 1LUZA 1N8RC 5LL6S 2F03A 1GUWA 2UUBQ 4K5VA 1ENAA 4RGMA 3A8KE 3GTOH 3D4DA 3U4ZA 1NTGA 1L0YB 3HOUG 1CQFA 3S15H 5IGCA 1DYQA 1I4PA 3LNNA 1MD2D 2NVQH 1S5DD 3K81C 3NBIA 1XMOL 4X66Q 4IOAA 2NZHA 5DM63 1EY4A 1VQHA 3S24A 3SXHA 1QZHA 4QMGA 3T1HQ 3I4LA 1CKMA 5BN4A 2CW0D 2VUMG 2KOLA 3TDQA 1QVGA 3NELA 4A3CH 4G7OC 2A73B 5K5PA 1MIUA 1K8MA 4QQBX 1RL2A 3PO2B 3HOWB 3S14H 1F9SA 1N33Q 3S1NH 4DV6L 2Q2IA 4LMQD 4JI8L 3R8BA 4DK0A 2IJ0A 2IHFA 1SYDA 4G4KA 1V1PA 2Z1CA 4UPAA 3H09A 3CC4A 1QE6A 2GA4B 4NW2A 1E2VA 2I07B 3CQZH 3K58A 1GOZA 5E4WC 4A75A 2R7ZG 1BVSA 3KLSX 2EYOA 4BBRH 5BN5A 1EZ6A 3DM3A 3DWQA 3BDCA 1VQFA 1ONLA 2MO1A 3CMEA 2F0SA 3HOXB 1U5KA 1B3QA 1XNQQ 4AH6A 2TMPA 4FF4A 1CM9A 3PF5A 3Q6SA 2JA9A 3X3MA 4HIDA 2ZJRA 5L37A 4JI0Q 5EKIA 3W3AA 1K9MC 2FFKB 1XNRL 1H9JA 3ITPA 4MN3A 1HNWL 3RR5A 2ICEC 1SJED 1V43A 1LV9A 3M7NA 5FJ8G 3TP8A 1Q90A 4RWSC 1PH4A 4PNYA 3HOZB 1I4RA 4XYQA 4PQXA 4O1NA 4DV7Q 4A3MG 2JEAI 2F0UA 1VF5C 2ZM6L 1VQLA 4CHTB 2K4KA 1E3PA 1SNOA 1A2UA 3HOUB 1JWMD 1CA6A 1VQJA 5IYDH 4X64L 2K5VA 3I7FA 4B3RL 2UXCQ 1H9SB 3G48A 2B2UA 4N9TA 1KQSA 1TS2A 3L2PA 3J7A5 1N9WA 1G6ZA 3K6OA 2F0PA 4O42A 2N8NA 3HOYH 5IP9G 4X65Q 4HIMA 1HQRD 4RGNA 2B3GA 3UE0A 1PA6A 1QOHA 1EOTA 1HCZA 2E2IB 4KJNA 1PRTF 1NR4A 1OXUA 1JQYD 2N3SA 3CPFA 4NMZA 1ENFA 1X56A 2ZTDA 2B2UC 4J15A 5CV9A 1D1IA 3QB3A 5KYLA 4G7ZC 1I4HA 3IKJA 2VQFQ 1SE2A 5LMUL 4L5RC 4JI5L 2K01A 3U9OA 1KHIA 2I5LX 2PW5A 4PZ7A 3NWSA 4JC0A 5FLXE 2PPBC 2TSSA 1MJCA 5M3FB 4GS3A 4ZKCB 1OXXK 1CSPA 2XRSD 4KKSA 1E7ZA 3D4WA 1EIFA 1HUMA 4YIJA 3VA5A 5CBAE 2FJ2A 4YCWA 1BDOA 5C0XH 2HQLA 2J4XA 5C44G 1EYGA 3BS1A 3KDFA 1PZJD 1MBYA 5JOBA 5IYCG 3T1YQ 2R61A 1SEBD 1LTTD 5A2QL 1PTOD 1UE1A 3SK6A 2K6AA 4DR6L 4DNRB 1LM0A 3CRKC 3FKIB 1Q3LA 1EWCA 1CTMA 4U68A 4DV5L 3SHLA 3MFYA 2PYKA 4F87A 3A54A 1D7QA 1PZKD 3M3YB 1CUKA 1I3QB 3HEJA 2ZXRA 3SR1A 1XMOQ 4EVOA 4ALPA 2CKZB 1DCZA 3HGBA 3QWNA 5E3FA 4DN4M 3HOUH 1OXTA 1RTOA 3PIPA 1QCBD 2E2HB 1E22A 1CK1A 1SXTA 5G3LD 4TSSA 1YZ6A 3RN5A 2OWOA 4R4OA 2WV6D 2LXKA 2EYHA 3HFZB 4HMJA 1QILA 1HZCA 2VUMH 2BE5D 3A55A 4DV6Q 4JI8Q 1LYLA 1TU2B 2NN6I 1LTGD 3QO2A 1NMFA 1CKNA 5C4XG 1BUVT 1FVIA 1HR0W 2AWOA 4JI7L 3FP9A 4C3IG 4GLXA 3B6YA 2BCOA 2WINB 4JBJA 5IT9E 1AN8A 1K83B 1LTRD 1I6VC 2O5IC 2FMMA 5EBDA 1CQVA 3PUWA 5IIFA 3S1RB 1PH2A 3GTMH 1LTAD 5M3FH 5M5XH 3BVZA 5FO7B 4J1MA 2A68C 4IFDI 3ND8A 5M9OA 1TY2A 3KLSA 1HZ9A 2Q2UA 2R7ZH 1STGA 4I65A 5IT9c 1G8ZD 2OQKA 1G2TA 5C5LA 2Y0SG 1IYVA 3G71A 1FNVA 3CF5A 4FP5D 3EFXD 1RD9D 1M90C 4BS9A 3HOVB 5CV6A 2M2LA 3K80C 1XNRQ 1HNWQ 5LHY1 2YTXA 2RBMA 5EGTA 3N52A 1JOKA 3EROA 5JEAG 1PH5A 5JEAJ 2DN8A 5LL6X 3QR8A 4L63B 3O13A 4JOIA 3RZOH 4BY7B 5IGGA 1Q12A 1SYGA 2XN9C 3MXGA 4PZ8A 3MXNB 4A4IA 3M3YH 2ZM6Q 5JJKA 1Y1WG 4HIOA 5C6AA 4OGQC 5FJ8H 2K33A 2JA6G 3GTPH 4DR5L 4X64Q 4B3RQ 3W1BA 3A0JA 1AZPA 2ZXOA 1B1ZA 1A6XA 1EUJA 4A3MH 2LY7A 3N6RA 4B08A 4FDBA 2Q2TA 1EQVA 4POGA 2KBNA 3Q23A 2F0NA 1SNDA 1BF4A 1D5MC 3SK5A 3CU7A 2F0IA 1V9PA 4P74A 2KCCA 3FDTA 4LNQA 3I4NG 4L6TB 5IP9H 3DEOA 3HZXA 5EPJA 4ME5A 1GJXA 1WD1A 4DV2L 1IW7C 3FHWA 3S1QB 5I9PA 1SYFA 1ASZA 3NWTA 2WAQG 5JPNC 1LTBD 4DAYA 5LMUQ 4POFA 5I6YA 2EYMA 2L0CA 2CQOA 5TSSA 4AYBE 4JI5Q 3PUYA 1K73C 2F3IA 4JVZA 3RUZA 3CMAA 1NSNS 1HNXL 5D14A 4CDDC 1K83H 2KENA 2PZWA 3HP3A 3VR2A 2MJ8A 4OIJA 4FYDA 4DAVA 4XQNA 3UE1A 5EBCA 4KMUC 2CCZA 1DOMA 3STBC 2F52A 2OTJA 2CFMA 2ENBA 2PZTA 2N55A 4DR6Q 2EYFA 4A93G 5FLMG 1Q8IA 1H9RA 2OEOA 3H15A 1A3TA 3M4PA 4FO2A 2D0PA 5C44H 4DV5Q 3F2CA 4GNXA 1EU4A 4K5XA 2B63G 1OXVA 4OO1G 4DR7L 2XWBB 1WTWA 2Z4IA 1B9NA 2EYJA 4AIMA 3LX0A 3RMHA 1AE2A 2NUCA 2B29A 3BYTB 1WYDA 4KY7A 5E1FA 3CCUA 3D31A 1B9MA 1U0LA 2WB1E 1G91A 1L2FA 1X3QA 2I5HA 3QIAA 2JJQA 3EVQA 1MSHA 4JK1C 3SEBA 1KNAA 4RKLA 1O80A 2F4VL 2JA6B 3I70A 1BBUA 4KHVA 1XMQL 3U50C 2L55A 4LF6L 3J7AV 2KCNA 4BA1I 1STAA 2JXMB 4KJOA 3A5ZB 1UEBA 1B53A 2LKVA 2DJFC 5JJZA 2D5DA 3QOLA 3OYYA 1K8GA 1V1QA 4O2DA 3A8JE 4C56C 4OO1I 3GV3A 2KQ3A 4PV1C 4JI7Q 3KLRA 1X3EA 2IX3A 2K50A 1FJGQ 1QVFA 3PSIA 4XYOA 1RJTA 1SNPA 2B2TA 4RMFA 2Q8IB 1SE8A 2F3VA 5D65A 5C4XH 2F0MA 2WAQB 2LXJA 3S2DB 2Z6KC 1CKOA 4ZCKA 4C3IH 1KRTA 2K1BA 4H0LC 4K6DA 3AQQA 3T51B 4B3TL 1HRJA 4N8X1 4OWWB 4C3HG 3M4OB 1HXYD 3NSWA 1SROA 1MSGA 1STHA 1KAAA 3C2PA 4XXEA 2NBFA 1VQIA 4OWTB 2CWAA 1D8LA 5M5YH 1AEXA 2WB1B 5D3IB 1I50B
chains in the Genus database with same CATH topology
4ID6A 4A93B 5KNCA 4WFN3 2IT1A 3RLFA 2K5QA 5JAVA 1JB3A 1WTQA 3J7AF 5JEAH 1T5EA 4DXFA 5C4ZA 4FF2A 4RAUC 2EY6A 3S15B 4PMCA 2G9DA 2QCPX 1JORA 4I7ZC 5COYA 1I4XA 3U9SA 2NVQB 2JP1A 2HCCA 3VYUA 4EQPA 4ULLA 3GV6A 2F0KA 2J7ZA 2L11A 3OIPA 2F0LA 3T53B 1SJHD 5JPMC 4FXKC 1EY8A 1H9KA 2F4IA 3JAME 2D2CC 1RHPA 2A74C 3KF8A 3MC0B 5G3LF 4B9XA 1STYA 2X69A 1S5ED 3GQBA 3S14B 3S1NB 1S4ZA 2JEBI 3C3LA 5JVH3 5IGBA 4ZYSA 2NYZD 1CZWA 3J80E 4KHZA 5F2DA 2K5WA 1Y69U 5CV5A 4BBRB 2EVBA 3K5OA 1WCMB 1WTPA 2JYOA 3MFGA 5ELFA 2B2YA 1ESFA 1EY7A 3I90A 1EFID 4PMBA 3NBHA 4FF3A 4XT3B 4IZ8A 2Z8LA 3URYA 4C2MB 2I46A 1R9TB 1V1PB 3MVVA 1L0XB 1SYEA 4C1NI 1V8QA 3V96A 2R93B 4IUVA 3E5SA 4OO1H 5EKLA 5FLXL 3VYTA 1PLFA 3MWYW 1M4VA 2JE6I 2F0TA 5DAUA 4K14A 5CYUA 1D5XC 1GHJA 4NKLA 3TBIB 3HOYB 4J8QA 5E4XA 3H3VC 3C1FA 1UEAB 3TP6A 3AB9A 1I4QA 3LWUA 3OWEB 4F7XA 1JOQA 2E2DC 4A3JB 4C3JG 4KKUA 3VR5A 2E75C 2SDFA 4FF1A 4DK1A 3ZYYX 1JR0D 4KD4A 4RHRA 4EQNA 2NVXB 4NP5A 3TP5A 1LTSD 5I4DA 1E2WA 2K04A 3IFDA 2NTSA 3MXUA 1SNMA 1JOOA 1T5XD 3T16A 1ET9A 1EYDA 3QG1A 3OMCA 3K5NA 2RSNA 3DEPA 2KEEA 1C4QA 4M1UB 3MXPA 5IT9L 1W6KA 3OOCA 2BDOA 5EPLA 4HAEA 3IFTA 2F0EA 4F8MA 3SVMA 3BZDB 4CJ2C 1LT3D 1JWSD 1TT2A 2V4DA 1F9QA 3C1EA 4OL7A 4HR7B 2D9UA 1BCPC 2VUMB 5FO9B 2BA1A 1BQQT 3D4RA 2IL8A 2E2JB 1XX8A 3J7YW 4KY5A 4CGYB 5CR3A 1S5CD 1SYBA 3NE5B 2HCIA 4EQOA 2BDNA 3GTMB 4RHSA 1EEID 4C3JB 5M5XB 5I2XA 3L9AX 1EQTA 2R7ZB 3NUCA 3I91A 3Q24A 3M7GA 2NVTB 2IPKD 1QG7A 5CV8A 5IGFA 2JA8B 4RGTA 5CORA 5A35A 3DXJC 3NPPA 3H6MA 3S9WA 1A3VA 1LLRD 1BR9A 1VMPA 2NN6G 1SMYC 2BOSA 1QB5D 3RZOB 1UAPA 1KNEA 2F3WA 1EY9A 3BDLA 1VMCA 1PFBA 3MA2B 2F0HA 2F0WA 3GTPB 3PV0A 3KUPA 1NUCA 4A3MB 4H44C 5NUCA 4IFDG 1GXDC 4IFDJ 5JVG3 4F88A 1WD0A 1ZXTA 4X3KA 3D3RA 2AQ2B 4K2LA 4IALA 1YNNC 1SBBB 2EOTA 3HRZC 4WJWA 4C1NK 5C4JB 3KBXA 2O4XA 1ZYRC 1LTID 1TIID 3HG9A 1OO9B 1IL8A 2VNUD 4M8AA 2EYLA 1MGSA 2AUJD 3T13A 3NK9A 3I73A 2A69C 2MUYA 3FMCA 1XYIA 4RKBA 3DMUA 2MPMA 5C4HA 4WORA 3NTKA 5ELDA 1TR5A 1LABA 5C44B 4ZUJA 1NAPA 1D5ZC 1F9RA 1UUPA 2KJXA 1TWFB 4RA8A 2ZXPA 1IYUA 2QDBA 1FNWA 3FPPA 1X32A 3DM1A 2N88A 2HDMA 4IN3A 3VA7A 4MIUA 3OWFA 1AW7A 2EJMA 2R6GA 5IGEA 1AP0A 1G291 4ZQ3A 2EYPA 2FMCA 3RD4A 1RKNA 2EE1A 1HFNA 1KLGD 2RVLA 1DOLA 3DWPA 3QOJA 1ILPA 1PYWD 3NTHA 1M8AA 4IURA 4FXGC 4CJ1B 1PRTC 5CV4A 3J81E 4HSVA 1BBXC 2EY1A 1TS4A 1YNJC 2HDLA 4UDUC 3P75A 3X3NA 5C4XB 5ISRA 2M9VA 4C3IB 2H4OA 1PDQA 2Z4HA 4UAIA 2F0QA 2Q8TA 1DOKA 4KN4C 4CBVA 2RDGA 2O2LD 4JBWA 5C5MA 3FVQA 5IODA 3P7JA 3EA6A 1KDBA 1XWEA 3R2IA 2A68D 5KGUA 1SNQA 4OIKA 3OW7A 3A8IE 2K7VA 5M5YB 1Q1BA 3MXNA 2Y0SB 2KEDA 5KRUA 1SFOB 3VR3A 3W2DA 1JE4A 3PMFA 5BN3A 3J80L 4BWGB 3E6ZX 1PXUA 3K5MA 2NN6H 2QKIC 3S16B 1TWGB 5DNFA 4TQUS 4PMWA 4HCSA 1W6JA 2F1MA 1Y1WB 4IUPA 3GD7A 1Y8PB 5CGKA 1KTKA 4IFDH 5ELEA 5AFWA 2EJGC 1V1OA 3I4NB 5I6WA 1GHKA 3NQTA 4IQZA 3MHBA 3F2UA 1GUGA 3ND9A 1IW7D 1CFMA 4R8NA 1DJRD 2RSOA 3P20A 1CI3M 4KV6A 3GTJB 1WTVA 3A7LA 3D6CA 2A6EC 1H9MA 4XDXA 4Q0FA 4LK1C 2R92B 1I4GA 4KD3A 2B2TC 4Y7NB 5ELCA 3GTGB 2PZUA 3H91A 1EIHA 1J9OA 3C46A 1TWHB 4HN7A 3GO5A 3CKIB 5I9OA 3BVGA 3I3CA 2EPBA 1ZEQX 3SE0A 5T1GA 2SNMA 5K36G 1SDFA 3MAQA 2M00A 2B63B 1KDAA 1HQMC 3R3OA 2IWHA 2X6GA 3IAYA 3TSSA 1B50A 4ZKBB 3TZDA 3KK7A 1TKWB 3SK8A 2DNEA 2K28A 3TP7A 3CRLC 3OSOA 4R8IA 1KDCA 1Z7TA 1KLUD 2CW0C 3PIO3 4EGVA 1JCKB 2DY8A 3D6WA 4N9PA 1EYAA 3GP7A 1STNA 2F0VA 1DM0B 4QUCA 1BCPF 1IKLA 1F9PA 1R4QB 1O78A 2K32A 2NTTA 2NZ1D 3PUVA 1AZQA 1TS5A 3EQLC 2E74C 1LT5D 3FEWX 3KBGA 2WACA 5HURA 1O7LA 1B4OA 1EU3A 2PMZB 4C3HB 2B2VA 3V05A 1TWCB 2EXZA 1D1KA 2FHTA 4KI0A 3DHQA 4DFAA 2B2YC 4TRDA 1BXTA 3HS0C 3NXWA 2L5TA 3A56A 1ZKOA 2B2VC 4DNTB 2QF7A 1SAPA 2H1EA 2KHSA 3EJIA 2K5DA 1U4LA 1OXSC 3WOFA 3DUZA 2EY5A 5C3WA 1GUSA 3OMGA 2NB0A 2B8GA 1FD7D 5C0XI 3BVMA 4K5WA 1HUNA 2F0FA 5KIXA 4ABNA 4DU9A 1RF2D 3GTLB 4KTAA 3PUZA 1BOSA 1BCPB 4DA2A 1E2ZA 1PMRA 3T4AC 4WRDA 4NDXA 2AUKA 3PO3B 2A6HC 4X3SA 2VXWA 4HMIA 4S3SA 3G7LA 1II3A 5C3EB 4R9WA 3VR6A 3OHXC 3BYYB 1STBA 3M4YA 3H94A 3TN2A 4H7BA 4FVMA 3H0GB 1PTOC 3K7AB 3L7ZC 4ZLTF 1PFNA 4ZRZA 3AU7A 2D62A 3UI2A 3MTSA 5K36H 3S1MB 2NWGA 4HCEA 1FR3A 2CHBD 4ZUIA 1PTOH 1ET6A 1WTXA 2EJFC 2PQEA 3RZDB 1DZ1A 5FK9C 1LT6D 2J0TD 1VCIA 3BG3A 3V2TA 2SOBA 2SEBD 1A15A 1RDPD 3HKZB 3LWEA 4H13C 1ML0D 4A3FB 5IOCA 1JICA 5ELBA 2OXPA 1F2ZA 1GUNA 2BE5C 2QEJC 1QNUA 4IUUA 4K6LA 1U4PA 2AQ3B 1MI2A 2FINB 1R4PB 3MZ5A 2K03A 4G57A 1B3AA 1SE3A 4XT1B 3IL8A 1TY0A 3GTQB 3AMUA 5FO8B 2A6HD 5CMDA 4RFBA 2JA5B 4ZK9B 4Z9CB 3J81L 4BA2I 2EY2A 5KYIA 1H9SA 3NQIA 4K8JA 1VF7A 5HGTA 2WKDA 1DXMA 2LS01 1RODA 2IX0A 3D8GA 2RQXA 2RA4A 2OF1A 1LACA 2SNSA 1IHZA 4B9WA 2MGSA 3E0JA 4LAAA 5KEEA 3A7AB 3GTKB 1JC7A 1NCVA 1QJOA 5D3DA 3G6JB 2ID0A 3I72A 1DONA 3SK4A 1EYCA 2YU9B 1GUTA 1HTLD 5EKKA 3S17B 2NVYB 1BCPD 4E6IA 1ILQA 4G7HC 1U4MA 2RKSA 3NHHA 1A3UA 5KNDA 1FNUA 1VDZA 5M5WB 2RDHA 3CHBD 4ODGA 1CHQD 1WVLA 4HTHA 1BO0A 3FPUB 1PRTB 1Y1VB 2XNAC 2XVSA 2LMCB 2R3ZA 2CVRA 5DM73 2C9OA 2E76C 5EJWA 1STEA 2X6LA 1X3PA 1AFPA 1D2BA 4V190 3PUXA 4XQJA 3DWAA 3BDOA 2XIWA 1SMYD 2JSOA 4FNFA 1O7ZA 1A2TA 1LT4D 1F2YA 2VB3X 4CKEA 1NR2A 1K8OA 5J39A 2C5CA 4DGZA 3WDNA 2Q8RE 4A3KB 1U9RA 2F0OA 4QCLA 2BA0A 3K5LA 4K8IA 4RCNA 3I8ZA 4IUTA 3R93A 4KK7A 2ZT9C 3ERQA 3PIP3 1YNND 4KKTA 1C48A 1HPCA 5KNBA 4LJZC 4Q5VA 4XQQA 2HQEA 1ZYRD 5M3MB 2WIIB 5A2QE 1SE4A 1O7YA 2EZVA 2KECA 4CKCA 2A5HA 4QIWB 2AQ1B 3JAML 2HUGA 3I4MB 1WTOA 1B44D 5FOBB 1SYCA 2O5JC 4BY1B 2A69D 3K57A 2G9HD 1CA5A 5CBEE 1TS3A 2IW3A 4P2CB 1Q1EA 1ESRA 1TQOA 4K2KA 4QF4A 1I6HB 3WOEA 3P1HA 4X3TA 1EWHA 2KUMA 4BBSB 2PW7A 3NP8A 5FKAC 1EZ8A 2F0JA 2L1BA 3MEHA 1Y8NB 4GZYC 1CHPD 2F0DA 2MP1A 4L8JA 1PFMA 4MHEA 3TZUA 1B2TA 1BNZA 1Z47A 3ONAB 2YYZA 2IX1A 4QUFA 1UNSA 5IGDA 1CT1D 2XSCA 1E0BA 1F2LA 1EIGA 1XTCD 1S5BD 4J6HA 5I2YA 3VYRA 2WP8J 4AYBB 4A3IB 3NTIA 1D6EC 1C8CA 1WTRA 1HTPA 1PRTD 3FRPB 4RCOA 2L9HA 1HA6A 3VYSA 2XRQD 4V0BA 1YNJD 1DD2A 1ICWA 3TMEA 4ILWA 4IUQA 2DY7A 5DEHA 4XIGS 1KABA 4QB4A 2PCFB 2VB2X 3S2HB 2B2WA 1EY5A 1F2MA 1EY0A 2PNRC 2PO4A 1FYCA 1TWAB 3VR4A 4DF7A 4HEDA 1XXGA 2AWNA 1HFGA 2F0GA 4A3EB 4RGOS 2KA7A 1RCVD 1Z6HA 1CZGA 2B2WC 1EY6A 3K0YA 5CC4A 3QJYA 4FXDA 5EPKA 4A3GB 1EEFD 4KY6A 2EDGA 4OHJA 2L12A 4DAPA 2CQAA 2RDFA 1Y8OB 1U4RA 2B39A 1JWUD 1PTOF 3L3OC 4IUNA 1HHVA 3Q0AA 3GTOB 2DNCA 3M85A 3SDZA 1TVXA 1QWYA 2L4NA 4RH6A 3OIQA 4ZAIA 1S5FD 5T1IA 1FGBD 5C3XA 4U673 5J22A 2JA7B 2XWJB 1QNKA 1PZID 4A3BB 3R2TA 2MHVA 4CKBA 1J8IA 5EQ0A 1RTNA 2B8FA 5CV7A 2LFNA 4XTCS 2WKCA 4DXGA 2KVMA 1EL0A 2A6ED 3CQZB 4X3UA 3OPOA 1SNCA 1F77A 1GUOA 5C0XG 1LO5D 2ICIA 5C0XJ 1G2SA 4CJ0B 3Q22A 5J1ZA 4HSPA 1SSOA 4KN7C 1ENCA 2OT2A 3K59A 3T56B 2QILA 1HA5A 2K05A 1PTOB 4TKOB 1IKMA 4A3DB 5LL6S 2F03A 1GUWA 4K5VA 1ENAA 4RGMA 3A8KE 3D4DA 1L0YB 1CQFA 5IGCA 1DYQA 1I4PA 3LNNA 1MD2D 1S5DD 3NBIA 5DM63 1EY4A 3SXHA 4QMGA 3I4LA 5BN4A 2CW0D 2KOLA 3TDQA 4G7OC 2A73B 5K5PA 1K8MA 3PO2B 3HOWB 1F9SA 4LMQD 3R8BA 4DK0A 2IJ0A 4G4KA 1SYDA 1V1PA 2Z1CA 3H09A 1QE6A 2GA4B 4NW2A 1E2VA 2I07B 3K58A 1GOZA 5E4WC 3KLSX 2EYOA 5BN5A 1EZ6A 3DWQA 3BDCA 1ONLA 2F0SA 3HOXB 2TMPA 4FF4A 1CM9A 3Q6SA 3X3MA 5EKIA 3W3AA 2FFKB 1H9JA 3ITPA 4MN3A 2ICEC 1SJED 1V43A 1LV9A 3M7NA 3TP8A 1Q90A 4RWSC 4PNYA 3HOZB 1I4RA 4XYQA 4PQXA 4O1NA 2JEAI 2F0UA 1VF5C 4CHTB 1SNOA 1A2UA 3HOUB 1JWMD 1CA6A 1H9SB 2B2UA 4N9TA 1TS2A 1G6ZA 3K6OA 2F0PA 4O42A 1HQRD 4RGNA 1QOHA 1EOTA 1HCZA 2E2IB 4KJNA 1PRTF 1NR4A 1OXUA 1JQYD 4NMZA 1ENFA 2B2UC 5CV9A 1D1IA 3QB3A 5KYLA 4G7ZC 1I4HA 3IKJA 1SE2A 2K01A 3U9OA 2PW5A 3NWSA 5FLXE 2PPBC 2TSSA 5M3FB 4ZKCB 1OXXK 2XRSD 4KKSA 3D4WA 4YIJA 1HUMA 3VA5A 5CBAE 2FJ2A 1BDOA 5C0XH 2J4XA 3BS1A 1PZJD 1MBYA 5JOBA 2R61A 1SEBD 1LTTD 5A2QL 1PTOD 3SK6A 2K6AA 4DNRB 3CRKC 3FKIB 1Q3LA 1EWCA 1CTMA 4U68A 3SHLA 3MFYA 2PYKA 4F87A 3A54A 1PZKD 3M3YB 1I3QB 3HEJA 2ZXRA 3SR1A 4EVOA 1DCZA 3HGBA 3QWNA 5E3FA 4DN4M 1OXTA 1RTOA 1QCBD 2E2HB 1CK1A 1SXTA 5G3LD 4TSSA 2WV6D 2EYHA 4HMJA 1QILA 2BE5D 3A55A 1TU2B 2NN6I 1LTGD 3QO2A 1BUVT 2AWOA 4C3IG 2BCOA 2WINB 5IT9E 1AN8A 1K83B 1LTRD 1I6VC 2O5IC 2FMMA 5EBDA 1CQVA 3PUWA 5IIFA 3S1RB 1LTAD 3BVZA 5FO7B 4J1MA 2A68C 4IFDI 3ND8A 5M9OA 1TY2A 3KLSA 1STGA 4I65A 1G8ZD 1G2TA 5C5LA 1IYVA 1FNVA 4FP5D 3EFXD 1RD9D 4BS9A 3HOVB 5CV6A 2M2LA 5LHY1 2RBMA 5EGTA 3N52A 1JOKA 3EROA 5JEAG 5JEAJ 2DN8A 5LL6X 4L63B 3O13A 4BY7B 5IGGA 1Q12A 1SYGA 2XN9C 3MXGA 5C6AA 4OGQC 2K33A 1AZPA 2ZXOA 1B1ZA 1A6XA 2LY7A 3N6RA 4B08A 1EQVA 3Q23A 2F0NA 1SNDA 1BF4A 1D5MC 3SK5A 3CU7A 2F0IA 2KCCA 3FDTA 4L6TB 3DEOA 3HZXA 5EPJA 4ME5A 1GJXA 1WD1A 1IW7C 3S1QB 5I9PA 1SYFA 3NWTA 5JPNC 1LTBD 4DAYA 5I6YA 2EYMA 2L0CA 5TSSA 3PUYA 3RUZA 1NSNS 5D14A 2PZWA 3HP3A 3VR2A 2MJ8A 4OIJA 4FYDA 4DAVA 4XQNA 5EBCA 4KMUC 1DOMA 2ENBA 2PZTA 2N55A 2EYFA 1Q8IA 1H9RA 2OEOA 1A3TA 4FO2A 1EU4A 4K5XA 1OXVA 4OO1G 2XWBB 1WTWA 2Z4IA 1B9NA 2EYJA 3LX0A 3RMHA 2NUCA 3BYTB 5E1FA 4KY7A 3D31A 1B9MA 1G91A 1X3QA 3QIAA 3EVQA 1MSHA 4JK1C 3SEBA 1KNAA 4RKLA 1O80A 2JA6B 3I70A 4KHVA 2L55A 3J7AV 2KCNA 4BA1I 1STAA 2JXMB 4KJOA 1B53A 2LKVA 5JJZA 2D5DA 3QOLA 3A8JE 4C56C 4OO1I 3GV3A 2KQ3A 4PV1C 3KLRA 2IX3A 4XYOA 1RJTA 1SNPA 2B2TA 2Q8IB 2F3VA 5D65A 2F0MA 2WAQB 3S2DB 2K1BA 4H0LC 4K6DA 3T51B 1HRJA 4C3HG 3M4OB 1HXYD 3NSWA 1MSGA 1STHA 1KAAA 3C2PA 4XXEA 2NBFA 1AEXA 2WB1B 5D3IB 1I50B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9W A;  4HSV A;  1DOM A;  1NR2 A;  2RSO A;  1BBX C;  1F9Q A;  1BNZ A;  3ONA B;  1WTV A;  3TN2 A;  2HDL A;  4CJ1 B;  2N55 A;  1B4O A;  1ROD A;  1F9S A;  4QUF A;  2EOT A;  1PLF A;  2B2V A;  2Q8R E;  1QNK A;  2K01 A;  3KBX A;  3MWY W;  4LMQ D;  1E0B A;  4XDX A;  4ZLT F;  1WTQ A;  1F2L A;  1EIG A;  1PFN A;  2RA4 A;  2B2T C;  2D9U A;  1PDQ A;  1G2T A;  2FHT A;  4RAU C;  4UAI A;  3UI2 A;  1QE6 A;  4ZKC B;  3H91 A;  3MTS A;  5COY A;  1J8I A;  5EQ0 A;  4NW2 A;  2Q8T A;  1EIH A;  1DOK A;  1RTN A;  2IL8 A;  2MGS A;  1J9O A;  1HUM A;  3I8Z A;  1C8C A;  1WTW A;  2M2L A;  1WTR A;  2B2Y C;  2NWG A;  5CBA E;  1XX8 A;  4IUT A;  1IL8 A;  2FJ2 A;  2JP1 A;  2HCC A;  5E4W C;  1MGS A;  2L9H A;  3R93 A;  1HA6 A;  3P7J A;  1NCV A;  3N52 A;  2KVM A;  1EL0 A;  5E4X A;  3I3C A;  3GV6 A;  2EPB A;  2B2V C;  2J7Z A;  1ICW A;  2L11 A;  1SAP A;  5T1I A;  1DON A;  2H1E A;  4IUQ A;  1WTX A;  1G91 A;  1X3Q A;  4OIK A;  2DY7 A;  5T1G A;  4X3U A;  1SDF A;  2HCI A;  1MSH A;  1U4L A;  1KNA A;  1O80 A;  1DZ1 A;  2KED A;  1RHP A;  1Q3L A;  2BDN A;  2X69 A;  1XYI A;  4U68 A;  1CM9 A;  1A15 A;  1O7Y A;  1G2S A;  1ILQ A;  1EQT A;  1JE4 A;  2B2W A;  2MPM A;  1U4M A;  3Q6S A;  3LWE A;  1AZP A;  4CJ0 B;  1S4Z A;  2KEC A;  2X6G A;  5EKI A;  1ML0 D;  3I91 A;  1WVL A;  1B53 A;  2FFK B;  4HED A;  1JIC A;  5JJZ A;  1BO0 A;  4MN3 A;  3FPU B;  1B50 A;  1HFG A;  1NAP A;  2NYZ D;  2HUG A;  4ZKB B;  1QG7 A;  5DNF A;  2SDF A;  4IUU A;  1WTO A;  1SSO A;  1F9R A;  1U4P A;  2CVR A;  2R3Z A;  4HCS A;  4X3K A;  3TZD A;  1HUN A;  1LV9 A;  1MI2 A;  3GV3 A;  1BF4 A;  4RA8 A;  5COR A;  4DN4 M;  2FIN B;  1CA5 A;  1RTO A;  4RWS C;  5CBE E;  2K28 A;  2B2W C;  4IUP A;  2K05 A;  3FDT A;  1IKM A;  2K03 A;  4R8I A;  1RJT A;  1X32 A;  3DM1 A;  2B2T A;  1B3A A;  2N88 A;  1VMP A;  2HDM A;  3DEO A;  5D65 A;  5EPJ A;  5EPK A;  1GUW A;  1WTP A;  1WD1 A;  2JYO A;  4XT1 B;  1ESR A;  1KNE A;  2L12 A;  2K04 A;  2DY8 A;  3D6W A;  3IFD A;  3IL8 A;  5EJW A;  1CA6 A;  1VMC A;  2B2Y A;  1U4R A;  2X6L A;  3I90 A;  1AP0 A;  4X3T A;  1X3P A;  2B2U A;  1B2T A;  1PFB A;  2K1B A;  5AFW A;  1G6Z A;  4XT3 B;  5CMD A;  1HHV A;  2RSN A;  4O42 A;  1HRJ A;  2KUM A;  3DEP A;  3QO2 A;  4QUC A;  2EE1 A;  2KEE A;  3KUP A;  5D14 A;  4ZK9 B;  2L1B A;  4X3S A;  1IKL A;  1HFN A;  1F9P A;  2RVL A;  3HP3 A;  5EPL A;  1DOL A;  1EOT A;  1MSG A;  2MJ8 A;  2NZ1 D;  2VXW A;  2XIW A;  3F2U A;  4HAE A;  4OIJ A;  3SVM A;  1AZQ A;  1ILP A;  2KOL A;  3G7L A;  1TVX A;  1NR4 A;  2MP1 A;  4CJ2 C;  2L4N A;  1M8A A;  1PFM A;  4IUR A;  4MHE A;  4ZAI A;  1WD0 A;  1O7Z A;  2B2U C;  4IUV A;  2FMM A;  1ZXT A; 
#chains in the Genus database with same CATH topology
 4ID6 A;  4A93 B;  5KNC A;  4WFN 3;  2R93 G;  2HIX A;  3H3V I;  1YHA A;  2IT1 A;  3RLF A;  2K5Q A;  5JAV A;  1JB3 A;  3PF4 A;  4YY3 L;  1WTQ A;  3J7A F;  5JEA H;  1T5E A;  1A63 A;  4OEL B;  3F1Z A;  4DXF A;  5C4Z A;  4FF2 A;  4RAU C;  2EY6 A;  4DR5 Q;  1TWG H;  3S15 B;  1PH8 A;  4PMC A;  2G9D A;  2QCP X;  1JOR A;  4I7Z C;  5COY A;  1I4X A;  3U9S A;  1EQR A;  2ZTC A;  2NVQ B;  2JP1 A;  2HCC A;  2CWP A;  3VYU A;  1Y1W H;  4EQP A;  2UUA L;  3J7Z C;  4ULL A;  3GV6 A;  4WJ4 A;  2JA6 H;  2F0K A;  2J7Z A;  2L11 A;  3OIP A;  2F0L A;  3T53 B;  1SJH D;  5JPM C;  4FXK C;  1EY8 A;  1H9K A;  2F4I A;  3JAM E;  2ES2 A;  4GKJ L;  2D2C C;  1QVC A;  1RHP A;  2A74 C;  3KF8 A;  3MC0 B;  5G3L F;  4B9X A;  1N36 L;  1STY A;  1NY4 A;  4DV2 Q;  1T9H A;  2X69 A;  1S5E D;  3GQB A;  3S14 B;  3S1N B;  1S4Z A;  5H1S E;  2JEB I;  3G6E A;  3C3L A;  5JVH 3;  4MZ9 A;  3JAM c;  4DUY L;  4A3J G;  3I4N H;  2K5N A;  1KD1 C;  5IGB A;  4ZYS A;  4LF4 L;  2NYZ D;  2VY3 A;  1CZW A;  1HNX Q;  1P16 A;  3J80 E;  1XPO A;  4KHZ A;  5F2D A;  2K5W A;  3PO3 G;  1X6O A;  1Y69 U;  2CH4 A;  2ZJP A;  1YHB A;  5CV5 A;  4JI1 L;  4BBR B;  3DLL A;  2EVB A;  3K5O A;  1WCM B;  1PH7 A;  1WTP A;  1YJW A;  2JYO A;  1GM5 A;  1XTD A;  3MFG A;  1A0I A;  3M4O H;  5ELF A;  5C3E G;  2B2Y A;  1ESF A;  1EY7 A;  3I90 A;  3TS2 A;  4Y7N H;  1EFI D;  3GTG H;  4PMB A;  3NBH A;  4FF3 A;  4XT3 B;  4IZ8 A;  1TWH H;  2Z8L A;  3URY A;  4C2M B;  2I46 A;  3H0G G;  1R9T B;  1V1P B;  3MVV A;  1L0X B;  1SYE A;  4C1N I;  4A93 H;  2A19 A;  5FLM H;  1V8Q A;  3V96 A;  2R93 B;  2B63 H;  4IUV A;  1YI2 A;  3E5S A;  4OO1 H;  5EKL A;  5FLX L;  3CCQ A;  3VYT A;  1PLF A;  1KXL A;  3MWY W;  1M4V A;  1WTH A;  2JE6 I;  1I94 L;  1HR0 Q;  1XMQ Q;  4JI6 L;  2F0T A;  5DAU A;  1Z9F A;  4K14 A;  5CYU A;  1HJP A;  1D5X C;  1GHJ A;  4NKL A;  3TBI B;  3HOY B;  1KIX A;  1HH2 P;  3HKZ G;  4J8Q A;  5E4X A;  4A3F G;  3H3V C;  3C1F A;  1UEA B;  3TP6 A;  5EAY A;  1K28 A;  1S72 A;  3AB9 A;  1JJG A;  1I4Q A;  3LWU A;  4GN5 A;  3CD6 A;  3OWE B;  4LF9 L;  4F7X A;  1JOQ A;  2E2D C;  4A3J B;  4C3J G;  4KKU A;  3AEV A;  1C0A A;  1K3R A;  4P71 A;  3VR5 A;  1SLJ A;  4B3M L;  3UDG A;  4B3T Q;  2E75 C;  1C9O A;  2SDF A;  4BXX H;  1WCM H;  4FF1 A;  4DK1 A;  3ZYY X;  3A5U A;  2QGQ A;  1JR0 D;  4KD4 A;  2CH4 W;  2JA8 G;  4RHR A;  1J6Q A;  1BKB A;  2JA5 G;  5IP7 G;  4EQN A;  2NVX B;  4NP5 A;  3TP5 A;  4C3H H;  1LTS D;  4R4T A;  4IPG A;  5I4D A;  1E2W A;  2BH2 A;  2K04 A;  3IFD A;  4C2M H;  2NTS A;  2XGT A;  1R9T H;  1QUQ B;  3MXU A;  1SNM A;  1JOO A;  1T5X D;  4UP7 A;  4H02 A;  3SGI A;  2Z9H A;  3T16 A;  1ET9 A;  4JYA L;  1EYD A;  4YY3 Q;  3QG1 A;  3OMC A;  3G4S A;  2RSN A;  3K5N A;  3CCV A;  3DEP A;  2KEE A;  2MFI A;  1C4Q A;  4M1U B;  3MXP A;  2R93 H;  4HJ8 A;  5IT9 L;  1W6K A;  3OOC A;  2BDO A;  2DGY A;  5EPL A;  1GVP A;  3PGZ A;  4HAE A;  1UE5 A;  3IFT A;  2F0E A;  4F8M A;  3SVM A;  3BZD B;  4CJ2 C;  1LT3 D;  2UUA Q;  1JWS D;  4DKA C;  1A8V A;  1TT2 A;  4ME3 A;  2V4D A;  1VS0 A;  1F9Q A;  3C1E A;  3L0O A;  4HJA A;  4GKJ Q;  5GRO A;  3UDI A;  2PI2 A;  4OL7 A;  4HR7 B;  4APV A;  2ZTE A;  1N36 Q;  1PH3 A;  2D9U A;  1BCP C;  2VUM B;  5FO9 B;  2BA1 A;  4IJL A;  1BQQ T;  2G5D A;  3RN2 A;  3D4R A;  3W1G A;  2IL8 A;  2E2J B;  3RLN A;  4DUY Q;  1VQ4 A;  2RCF A;  1XX8 A;  3J7Y W;  4KY5 A;  3GTL H;  4CGY B;  4DV4 L;  5CR3 A;  1S5C D;  1SYB A;  3NE5 B;  1VQN A;  3BJU A;  1WFQ A;  1X3F A;  4A3J H;  2HCI A;  4JI1 Q;  4EQO A;  4YWK A;  1GO3 E;  1VQ8 A;  2BDN A;  3GTM B;  4RHS A;  1EEI D;  4C3J B;  5M5X B;  5I2X A;  3L9A X;  1EQT A;  3PO3 H;  2R7Z B;  3NUC A;  2QW7 A;  3I91 A;  3Q24 A;  3M7G A;  1VQG A;  2NVT B;  4R4C A;  1KRS A;  4R4I A;  4Y52 H;  2IPK D;  1QG7 A;  5CV8 A;  5GAH C;  2NVX H;  1AE3 A;  5ELN A;  5IGF A;  2JA8 B;  4NB3 A;  4RGT A;  4P73 A;  5C3E H;  5COR A;  1EQQ A;  4LUZ A;  2ALY B;  5A35 A;  3DXJ C;  5IYB G;  3NPP A;  3H6M A;  3S9W A;  1A3V A;  1LLR D;  4A3L G;  1BR9 A;  1VMP A;  2NN6 G;  1SMY C;  2BOS A;  2HHH L;  1QB5 D;  3H0G H;  3RZO B;  1UAP A;  1KNE A;  2F3W A;  3K7A H;  2PQA A;  2EIF A;  1EY9 A;  3BDL A;  1VMC A;  2VS1 A;  1PFB A;  3MA2 B;  4L5Q A;  1I94 Q;  2F0H A;  1KC8 C;  2F0W A;  3GTP B;  4JI6 Q;  3PV0 A;  3CPW A;  3ULJ A;  3KUP A;  1NUC A;  4A3K G;  4GOP A;  4A3M B;  2JQO A;  4H44 C;  5NUC A;  4IFD G;  1VQC A;  1VQP A;  1GXD C;  4IFD J;  3TEH B;  1W3S A;  5AJ3 L;  4GN4 B;  5JVG 3;  1E1O A;  4F88 A;  1WD0 A;  1ZXT A;  4X3K A;  3K7U C;  3D3R A;  4DK6 C;  2AQ2 B;  4K2L A;  4CDC C;  4IAL A;  1YNN C;  4DV3 L;  3CP0 A;  1SBB B;  2EOT A;  3HRZ C;  4WJW A;  4C1N K;  5BR8 L;  5C4J B;  4DR2 L;  4GOP C;  2I5M X;  2E2J H;  3KBX A;  5GQO A;  4P75 A;  2LSS A;  4LF9 Q;  3ICE A;  2O4X A;  1ZYR C;  1Q7Y C;  1JJ2 A;  1LTI D;  1TII D;  3HG9 A;  1X65 A;  2IY5 B;  4RG1 A;  1OO9 B;  4B3M Q;  1IL8 A;  2VNU D;  4M8A A;  2EYL A;  1MGS A;  2AUJ D;  2RHS B;  1VQO A;  3T13 A;  1B8A A;  4C3J H;  3NK9 A;  3I73 A;  1IBK L;  3I4M G;  2A69 C;  1Y14 B;  4BY1 G;  1EFW A;  1AH9 A;  2NVT H;  2MUY A;  3FMC A;  1XYI A;  4RKB A;  3DMU A;  2MPM A;  5C4H A;  3PQI A;  2JA8 H;  4WOR A;  3ULL A;  3NTK A;  5ELD A;  1TR5 A;  2JA5 H;  5IP7 H;  1LAB A;  3AFQ A;  4JYA Q;  5C44 B;  4ZUJ A;  1NAP A;  1D5Z C;  3E3X A;  1EWI A;  1F9R A;  1YJ9 A;  4L5T A;  1YEZ A;  3E0E A;  1UUP A;  2KJX A;  1TWF B;  4RA8 A;  2AHO B;  2ZXP A;  1IYU A;  2QDB A;  1FNW A;  3FPP A;  3HKS A;  2YV5 A;  1X32 A;  3DM1 A;  2N88 A;  2HDM A;  4IN3 A;  3VA7 A;  3ER0 A;  4MIU A;  3F2D A;  2Y0S E;  3OWF A;  1AW7 A;  2EJM A;  2R6G A;  5IGE A;  1PYS B;  1AP0 A;  1BBW A;  3ULP A;  4JOI C;  1G29 1;  4ZQ3 A;  2EYP A;  2FMC A;  3RD4 A;  1RKN A;  1Q82 C;  2EE1 A;  4LF8 L;  1HFN A;  1KLG D;  2RVL A;  1DOL A;  3DWP A;  3QOJ A;  3M4Q A;  1ILP A;  2YU9 H;  1P8L A;  1PYW D;  5C4J H;  3NTH A;  1M8A A;  4IUR A;  4AYB G;  4DV4 Q;  4A3I G;  4FXG C;  1PRT C;  4CJ1 B;  5CV4 A;  3S17 H;  3J81 E;  2NVY H;  4HSV A;  1BBX C;  2EY1 A;  1TS4 A;  1YNJ C;  2HDL A;  4UDU C;  3P75 A;  2K14 A;  3X3N A;  5C4X B;  5ISR A;  5M5W H;  2M9V A;  4C3I B;  2H4O A;  1PDQ A;  4K0K L;  2MO0 A;  2Z4H A;  4UAI A;  3J81 c;  2R92 G;  2KHJ A;  2F0Q A;  2Q8T A;  3TRE A;  1DOK A;  4KN4 C;  4CBV A;  2RDG A;  2O2L D;  4JBW A;  1S3O A;  5C5M A;  3FVQ A;  5IOD A;  3P7J A;  3EA6 A;  1KDB A;  1XWE A;  2WAQ E;  3CW2 C;  3R2I A;  2A68 D;  5KGU A;  1VQK A;  1SNQ A;  4OIK A;  3OW7 A;  3A8I E;  2K7V A;  3CCS A;  5M5Y B;  1HZB A;  1Q1B A;  1X3G A;  3MXN A;  2Y0S B;  2KED A;  5KRU A;  2HHH Q;  1SFO B;  3VR3 A;  4DR3 L;  5IYC H;  3W2D A;  1JE4 A;  3AYH B;  3PMF A;  1VQM A;  1HZA A;  1TWF H;  5BN3 A;  3J80 L;  4A3G G;  4BWG B;  5IYB H;  3E6Z X;  1PXU A;  4A3L H;  3K5M A;  2NN6 H;  2QKI C;  3S16 B;  1TWG B;  5DNF A;  4TQU S;  4PMW A;  1MKH A;  4HCS A;  1NJI C;  3E9H A;  1W6J A;  2F1M A;  4GNX C;  1C7Y A;  1Y1W B;  2IHE A;  4IUP A;  3GD7 A;  5AJ3 Q;  1Y8P B;  4A3K H;  5CGK A;  3WWV A;  1KTK A;  1N32 L;  2QDL A;  4IFD H;  4DV3 Q;  1IXR A;  5BR8 Q;  4DR2 Q;  4CDF C;  5ELE A;  5AFW A;  3KF6 B;  2EJG C;  3PCO B;  2JA7 G;  3GDE A;  1V1O A;  3I4N B;  5I6W A;  1GHK A;  3NQT A;  4A3B G;  4IQZ A;  3MHB A;  3F2U A;  1GUG A;  2RHQ B;  3ND9 A;  1IW7 D;  5LMN W;  4X6A H;  1CFM A;  4R8N A;  1DJR D;  2V1C C;  2RSO A;  3P20 A;  1CI3 M;  4KV6 A;  3I56 A;  2UUC L;  1IBK Q;  3GTJ B;  1WTV A;  3A7L A;  3D6C A;  2A6E C;  3A74 A;  1H9M A;  4XDX A;  4Q0F A;  4LK1 C;  2R92 B;  1I4G A;  4KD3 A;  2B2T C;  4Y7N B;  5ELC A;  3GTG B;  2PZU A;  3H91 A;  4HJ7 A;  4BY1 H;  1EIH A;  4JI2 L;  1J9O A;  3C46 A;  1E1T A;  1TWH B;  1TXY A;  4HN7 A;  1MJE A;  4MTN A;  3GO5 A;  3STB D;  3CKI B;  5I9O A;  3BVG A;  3I3C A;  2EPB A;  1SFO H;  1ZEQ X;  3SE0 A;  5T1G A;  2SNM A;  1L0W A;  1I6H H;  5K36 G;  4DR1 L;  1SDF A;  3MAQ A;  2M00 A;  4GKK L;  2B63 B;  1KDA A;  3KOJ A;  1B70 B;  1HQM C;  3R3O A;  2IWH A;  4JBM A;  1FL0 A;  4HIK A;  1QZG A;  3S16 H;  4A3D G;  3BZK A;  4JI4 L;  2X6G A;  3IAY A;  4JI0 L;  3TSS A;  1B50 A;  3K8A A;  2FXQ A;  4ZKB B;  4LF8 Q;  3TZD A;  1N34 L;  3KK7 A;  1TKW B;  2EXD A;  1G6P A;  3NEN A;  3SK8 A;  2DNE A;  2K28 A;  3TP7 A;  3CRL C;  3OSO A;  4R8I A;  1IL2 A;  1KDC A;  1Z7T A;  3CCE A;  1KLU D;  2CW0 C;  3PIO 3;  4EGV A;  1JCK B;  2DY8 A;  3D6W A;  3Q8D A;  4N9P A;  1EYA A;  5HY6 A;  3GP7 A;  2JK8 A;  1STN A;  1NMG A;  2F0V A;  1DM0 B;  4A3I H;  2UU9 L;  4YCU A;  3PO2 G;  3LGJ A;  4QUC A;  1BCP F;  3HOW G;  4K0K Q;  4IPH A;  1IKL A;  2AMC B;  1F9P A;  3GTJ H;  1R4Q B;  1O78 A;  2K32 A;  2NTT A;  2NZ1 D;  3PUV A;  1AZQ A;  1TS5 A;  2HIV A;  3JC6 6;  3EQL C;  2E74 C;  3E9I A;  2R92 H;  3UDX A;  1LT5 D;  3FEW X;  4IJH A;  3KBG A;  3S2H H;  1YIJ A;  2WAC A;  2YTV A;  5HUR A;  1O7L A;  1B4O A;  1EU3 A;  4KLK A;  2PMZ B;  4C3H B;  2B2V A;  3IRB A;  1TWA H;  5E7N A;  2VQE L;  3V05 A;  1TWC B;  2XTI A;  2EXZ A;  4DR3 Q;  4DR7 Q;  1D1K A;  3HOX G;  2FHT A;  4O0A A;  3U4V A;  4KI0 A;  1YNX A;  3DHQ A;  4DFA A;  1JMC A;  2B2Y C;  4TRD A;  3NEM A;  1VQE A;  1BXT A;  3HS0 C;  3NXW A;  2L5T A;  1GKH A;  3A56 A;  1ZKO A;  2B2V C;  4DNT B;  2QF7 A;  2K75 A;  1SAP A;  4LFC L;  2H1E A;  1KL9 A;  3CCR A;  2KHS A;  4A3G H;  3EJI A;  2K5D A;  1OTC A;  2F4V Q;  1X54 A;  3T1Y L;  1U4L A;  3KLW A;  1OXS C;  3WOF A;  2KCM A;  1MHW C;  3K0X A;  4LF6 Q;  3HOZ G;  2Q2H A;  3DUZ A;  3J80 i;  2EY5 A;  5C3W A;  1GUS A;  1N32 Q;  1GD7 A;  3OMG A;  5LMN L;  2NB0 A;  4KHP L;  2B8G A;  2K52 A;  1FD7 D;  4JG2 A;  5C0X I;  3BVM A;  4K5W A;  2GN5 A;  1HUN A;  2F0F A;  1SMX A;  2Z0S A;  1M1K C;  1Q8K A;  5KIX A;  4ABN A;  4DU9 A;  3ERS X;  1RF2 D;  1JJC B;  3GTL B;  4KTA A;  3PUZ A;  1BOS A;  2JA7 H;  1BCP B;  4DA2 A;  1E2Z A;  2UUC Q;  1L1O A;  4A3B H;  3H3V H;  1PH9 A;  1PHJ A;  1PMR A;  2OQ0 A;  3T4A C;  3HKZ E;  4UP8 A;  4WRD A;  4NDX A;  4YCV A;  2HD3 A;  2AUK A;  3PO3 B;  4GLV B;  2NZO A;  2A6H C;  1UE6 A;  1UE7 A;  4X3S A;  4JI2 Q;  2VXW A;  4HMI A;  1CSQ A;  1L1O C;  2KCT A;  4S3S A;  3G7L A;  5M3F G;  1II3 A;  2JN4 A;  4X62 L;  5C3E B;  1TWC H;  3F8T A;  4R9W A;  3OHX C;  3VR6 A;  3BYY B;  1B7Y B;  1STB A;  3M4Y A;  4IOC A;  3H94 A;  3EIV A;  3TN2 A;  2I0Q A;  4H7B A;  1K0S A;  4DR1 Q;  4GKK Q;  4FVM A;  4NXM L;  3H0G B;  4I7A A;  1PTO C;  3K7A B;  3L7Z C;  4ZLT F;  1PFN A;  4ZRZ A;  3AU7 A;  2D62 A;  3FKI G;  3UI2 A;  3MTS A;  4DAM A;  4JI4 Q;  1YVC A;  4LFA L;  5K36 H;  1IYJ B;  3S1M B;  2NWG A;  4HCE A;  1FR3 A;  2CHB D;  4ZUI A;  1PTO H;  2KHI A;  1N34 Q;  5JJI A;  4A3D H;  4DV0 L;  1ET6 A;  1WTX A;  3KDF B;  4IPC A;  2EJF C;  2PQE A;  4PZ6 A;  3RZD B;  1DZ1 A;  1SRU A;  2GVA A;  1LT6 D;  2J0T D;  1VCI A;  2RF4 A;  3BG3 A;  5FK9 C;  3V2T A;  2SOB A;  2SEB D;  4QY7 A;  1A15 A;  1JB7 A;  1RDP D;  3HKZ B;  3LWE A;  4R1J A;  4H13 C;  2N78 A;  4UP9 A;  2PQA B;  4LF4 Q;  1ML0 D;  4A3F B;  5IOC A;  1JIC A;  5ELB A;  2UU9 Q;  2OXP A;  1F2Z A;  1GUN A;  4LF7 L;  2BE5 C;  1YIT A;  2QEJ C;  1QNU A;  4IUU A;  4LUO A;  4K6L A;  1U4P A;  2AQ3 B;  2PNH A;  2R7D A;  1MI2 A;  1Y1V G;  3ZJY C;  3BU2 A;  2FIN B;  1R4P B;  4B3S L;  1I5F A;  4GOP B;  3MZ5 A;  1G51 A;  3KJP A;  2K03 A;  4GN3 B;  3PO2 H;  4G57 A;  1B3A A;  4AQY L;  3HOW H;  1IBL L;  1SE3 A;  2N49 A;  1VQA A;  4XT1 B;  1PYB A;  1YJN A;  2VL6 A;  3IL8 A;  4DUZ L;  1QUQ A;  1TY0 A;  5IY0 A;  3GTQ B;  3AMU A;  5FO8 B;  2VQE Q;  2A6H D;  5CMD A;  1PH1 A;  2ASB A;  4RFB A;  2WFW A;  2JA5 B;  4ZK9 B;  1CKN B;  2R7F A;  4Z9C B;  4HJ9 A;  1Q86 C;  1K0R A;  3J81 L;  4BA2 I;  4N8F A;  3HOV G;  2EY2 A;  4LF5 L;  3HOX H;  5KYI A;  4LFC Q;  1H9S A;  3NQI A;  4K8J A;  1VF7 A;  5FLX c;  5HGT A;  2WKD A;  1DXM A;  2LS0 1;  1ROD A;  2IX0 A;  1DGS A;  3S1M H;  3D8G A;  2RQX A;  3I55 A;  1UWV A;  4BY7 G;  2RA4 A;  5J3B A;  3RNU A;  2OF1 A;  1LAC A;  2SNS A;  1ICF B;  1IHZ A;  5LMN Q;  4B9W A;  2MGS A;  3E0J A;  3UDF A;  4LAA A;  4KHP Q;  5KEE A;  3A7A B;  4DK3 C;  3GTK B;  1JC7 A;  3RZD H;  4NXN L;  3HOZ H;  2E8G A;  1NCV A;  1QJO A;  5D3D A;  3G6J B;  4JV5 L;  2ID0 A;  3I72 A;  4OX9 L;  2HT1 A;  3SK4 A;  1DON A;  1EYC A;  2YU9 B;  1VQ6 A;  1GUT A;  1HTL D;  5EKK A;  3S17 B;  3OW2 A;  2NVY B;  4A3F H;  1BCP D;  1NNX A;  4OXP A;  4E6I A;  1ILQ A;  2H5X A;  5M3M G;  4G7H C;  3KFU A;  1U4M A;  2RKS A;  3NHH A;  1A3U A;  5KND A;  1FNU A;  1O7I A;  1VQ5 A;  1VDZ A;  5M5W B;  2RDH A;  3CHB D;  4ODG A;  1CHQ D;  1WVL A;  4HTH A;  1BO0 A;  3FPU B;  1PRT B;  1Y1V B;  2XNA C;  2XVS A;  4EX5 A;  1H95 A;  2E2I H;  2LMC B;  2R3Z A;  2QA4 A;  2CVR A;  5DM7 3;  2C9O A;  3CXC A;  4YWM A;  3KYH C;  1K8A C;  5ELO A;  2BH8 A;  5GAE C;  2E76 C;  2UXB L;  3GTQ H;  4X62 Q;  1FJG L;  2AKW B;  4UY8 C;  3AFP A;  1W2B A;  5EJW A;  1STE A;  2X6L A;  2UXD L;  4NXM Q;  1X3P A;  4DAY B;  4EQ5 A;  1AFP A;  1J5E L;  4YHH L;  1D2B A;  4V19 0;  4QIW E;  2ZJQ A;  1RIP A;  3PUX A;  1XPR A;  4BBS G;  4XQJ A;  3DWA A;  4LFA Q;  3BDO A;  2XIW A;  4DV1 L;  1SMY D;  2JSO A;  1PVO A;  1VQ9 A;  3U58 A;  4FNF A;  1O7Z A;  1A2T A;  1LT4 D;  1F2Y A;  3FKI H;  2VB3 X;  4DV0 Q;  3I4O A;  4CKE A;  1IBM L;  1NR2 A;  1K8O A;  5J39 A;  2C5C A;  4DGZ A;  3WDN A;  2Q8R E;  2MNA A;  4A3K B;  5IE8 A;  1U9R A;  4LWC A;  2QEX A;  3GTK H;  1I3Q H;  2F0O A;  4QCL A;  2BA0 A;  4DPG A;  4OWX B;  3TQY A;  4DR4 L;  3K5L A;  4K8I A;  4GNX B;  4JPB W;  4RCN A;  3I8Z A;  4JI3 L;  1X55 A;  2DJG C;  1WI5 A;  4IUT A;  4LF7 Q;  1YHQ A;  3R93 A;  2E2H H;  4KK7 A;  2ZT9 C;  3ERQ A;  3PIP 3;  1YNN D;  4KKT A;  1C48 A;  4B3S Q;  1HPC A;  4WJ3 M;  4GLA C;  5KNB A;  4LJZ C;  3RLO A;  4Q5V A;  4AQY Q;  1S40 A;  4XQQ A;  1IBL Q;  3OTO L;  2HQE A;  1ZYR D;  5M3M B;  4LFB L;  4A76 A;  1Q81 C;  2WII B;  5A2Q E;  1SE4 A;  1Y1V H;  1O7Y A;  2A1A A;  4DUZ Q;  1HNZ L;  5IWA L;  4QJF A;  2EZV A;  4JBK A;  2KEC A;  4CKC A;  1PFS A;  2A5H A;  4QIW B;  2AQ1 B;  3JAM L;  2HUG A;  3I4M B;  1WTO A;  1B44 D;  5FOB B;  1LTL A;  1SYC A;  4CDE C;  2E5L L;  2A69 D;  3D0F A;  4BY1 B;  1YBY A;  2O5J C;  3K57 A;  2G9H D;  4P72 A;  1CA5 A;  4A3E G;  3S1R H;  5CBE E;  4UHV A;  1EOV A;  1Q46 A;  1TS3 A;  4LF5 Q;  2IW3 A;  4P2C B;  1Q1E A;  1ESR A;  1TQO A;  4K2K A;  4QF4 A;  1I6H B;  3WOE A;  3P1H A;  2WB1 G;  4X3T A;  1EWH A;  3HOV H;  4L5S A;  2KUM A;  1SN8 A;  4BBS B;  2PW7 A;  4LUV A;  3NP8 A;  5FKA C;  1EZ8 A;  2F0J A;  2L1B A;  3MEH A;  3J81 i;  1Y8N B;  4GZY C;  1CHP D;  2F0D A;  2MP1 A;  2OTL A;  4BY7 H;  4L8J A;  4NXN Q;  1E24 A;  1PFM A;  4MHE A;  2UUB L;  4JV5 Q;  3TZU A;  1B2T A;  4OX9 Q;  3EN2 A;  1BNZ A;  1Z47 A;  3ONA B;  3PIO A;  2YYZ A;  2IX1 A;  3EBE A;  1UNS A;  4QUF A;  5IGD A;  1CT1 D;  2XSC A;  1E0B A;  1VQ7 A;  1NE3 A;  4OON A;  5GAD C;  1F2L A;  1EIG A;  1XTC D;  1S5B D;  4J6H A;  4A3C G;  5I2Y A;  4OEM B;  1HR0 L;  1VQD A;  4X66 L;  3VYR A;  4YWL A;  2WP8 J;  2YTY A;  2ATW A;  4AYB B;  4A3I B;  3NTI A;  1D6E C;  1C8C A;  4QL5 A;  3T1H L;  1WTR A;  1XPU A;  1PV4 A;  1HTP A;  1PRT D;  3FRP B;  4JCV E;  4RCO A;  4QGU A;  2L9H A;  1HA6 A;  2Z6K A;  3VYS A;  2XRQ D;  3CCJ A;  4V0B A;  5M3M H;  1YNJ D;  1DD2 A;  4MTK A;  1ICW A;  3TME A;  1XJV A;  4ILW A;  4IUQ A;  2DY7 A;  3VDY A;  5DEH A;  3TRZ A;  4XIG S;  3S1Q H;  3KJO A;  3CC7 A;  2UXB Q;  1KAB A;  1N33 L;  3MEF A;  4QB4 A;  2PCF B;  2VB2 X;  3KF8 B;  3S2H B;  3I4M H;  1JE5 A;  4BBR G;  2B2W A;  1EY5 A;  1F2M A;  1EY0 A;  2PNR C;  4JW0 A;  5DLQ E;  4BXX G;  1WCM G;  2PO4 A;  1FYC A;  1TWA B;  2UXD Q;  3VR4 A;  4DF7 A;  1WJJ A;  1J5E Q;  1JT8 A;  4HED A;  3F2B A;  1XXG A;  4IPD A;  2AWN A;  4YHH Q;  2A8V A;  1HFG A;  2F0G A;  3CC2 A;  2Z6B A;  4A3E B;  1PH6 A;  1WOC A;  1EIY B;  4RGO S;  2KA7 A;  1RCV D;  1Z6H A;  4DV1 Q;  4NPS A;  1CZG A;  2B2W C;  1EY6 A;  2PMZ E;  1XNQ L;  3K0Y A;  5CC4 A;  3QJY A;  4FXD A;  5EPK A;  4A3G B;  1IBM Q;  1EEF D;  4KY6 A;  2EDG A;  4OHJ A;  3J81 j;  4BBS H;  3M9B A;  2L12 A;  2VZA A;  1VQB A;  4DAP A;  2DUD A;  2CQA A;  2RDF A;  1Y8O B;  1U4R A;  2B39 A;  1JWU D;  1PTO F;  3KF6 A;  3CCM A;  3L3O C;  4IUN A;  3NBH B;  1HHV A;  3Q0A A;  2C35 B;  4DR4 Q;  3GTO B;  5HGQ A;  1ASY A;  2D0O A;  2DNC A;  3M85 A;  5IYD G;  2OCE A;  4JI3 Q;  3SDZ A;  2RCN A;  1SR3 A;  1TVX A;  3TS0 A;  1QWY A;  4DV7 L;  2L4N A;  4RH6 A;  3OIQ A;  4ZAI A;  5JJL A;  3HOY G;  1S5F D;  5T1I A;  3BZC A;  1K3B C;  1FGB D;  2EQS A;  5C3X A;  2VW9 A;  3CCL A;  2UXC L;  4U67 3;  5J22 A;  2JA7 B;  2XWJ B;  1QNK A;  1PZI D;  3OTO Q;  4A3B B;  4LFB Q;  3R2T A;  4TVA B;  2MHV A;  1HNZ Q;  5IWA Q;  4X65 L;  4CKB A;  1J8I A;  5EQ0 A;  1RTN A;  2B8F A;  5CV7 A;  1KAW A;  1NBW A;  2LFN A;  4XTC S;  2MQH A;  4DNI A;  2WKC A;  4DXG A;  2E5L Q;  2KVM A;  1IZ6 A;  1EL0 A;  2L15 A;  3I2Z A;  4IO9 A;  4R4Q A;  2VQF L;  2P5Z X;  4LW1 A;  2A6E D;  3CQZ B;  3S2D H;  4X3U A;  3OPO A;  1SNC A;  1F77 A;  1X9N A;  1GUO A;  5C0X G;  1LO5 D;  2ICI A;  2PI2 E;  4MNO A;  3W5O A;  5C0X J;  4HJ5 A;  1G2S A;  3J80 c;  4CJ0 B;  4A3E H;  3Q22 A;  5J1Z A;  1L1O B;  3JAM i;  4HSP A;  1A62 A;  1FGU A;  1SSO A;  5GAG C;  4KN7 C;  3CAM A;  2GVB A;  1ENC A;  4PG3 A;  1I50 H;  2OT2 A;  3K59 A;  3T56 B;  2QIL A;  2K5H A;  1HA5 A;  2K05 A;  1PTO B;  4TKO B;  1IKM A;  4A3D B;  1LUZ A;  1N8R C;  5LL6 S;  2F03 A;  1GUW A;  2UUB Q;  4K5V A;  1ENA A;  4RGM A;  3A8K E;  3GTO H;  3D4D A;  3U4Z A;  1NTG A;  1L0Y B;  3HOU G;  1CQF A;  3S15 H;  5IGC A;  1DYQ A;  1I4P A;  3LNN A;  1MD2 D;  2NVQ H;  1S5D D;  3K81 C;  3NBI A;  1XMO L;  4X66 Q;  4IOA A;  2NZH A;  5DM6 3;  1EY4 A;  1VQH A;  3S24 A;  3SXH A;  1QZH A;  4QMG A;  3T1H Q;  3I4L A;  1CKM A;  5BN4 A;  2CW0 D;  2VUM G;  2KOL A;  3TDQ A;  1QVG A;  3NEL A;  4A3C H;  4G7O C;  2A73 B;  5K5P A;  1MIU A;  1K8M A;  4QQB X;  1RL2 A;  3PO2 B;  3HOW B;  3S14 H;  1F9S A;  1N33 Q;  3S1N H;  4DV6 L;  2Q2I A;  4LMQ D;  4JI8 L;  3R8B A;  4DK0 A;  2IJ0 A;  2IHF A;  1SYD A;  4G4K A;  1V1P A;  2Z1C A;  4UPA A;  3H09 A;  3CC4 A;  1QE6 A;  2GA4 B;  4NW2 A;  1E2V A;  2I07 B;  3CQZ H;  3K58 A;  1GOZ A;  5E4W C;  4A75 A;  2R7Z G;  1BVS A;  3KLS X;  2EYO A;  4BBR H;  5BN5 A;  1EZ6 A;  3DM3 A;  3DWQ A;  3BDC A;  1VQF A;  1ONL A;  2MO1 A;  3CME A;  2F0S A;  3HOX B;  1U5K A;  1B3Q A;  1XNQ Q;  4AH6 A;  2TMP A;  4FF4 A;  1CM9 A;  3PF5 A;  3Q6S A;  2JA9 A;  3X3M A;  4HID A;  2ZJR A;  5L37 A;  4JI0 Q;  5EKI A;  3W3A A;  1K9M C;  2FFK B;  1XNR L;  1H9J A;  3ITP A;  4MN3 A;  1HNW L;  3RR5 A;  2ICE C;  1SJE D;  1V43 A;  1LV9 A;  3M7N A;  5FJ8 G;  3TP8 A;  1Q90 A;  4RWS C;  1PH4 A;  4PNY A;  3HOZ B;  1I4R A;  4XYQ A;  4PQX A;  4O1N A;  4DV7 Q;  4A3M G;  2JEA I;  2F0U A;  1VF5 C;  2ZM6 L;  1VQL A;  4CHT B;  2K4K A;  1E3P A;  1SNO A;  1A2U A;  3HOU B;  1JWM D;  1CA6 A;  1VQJ A;  5IYD H;  4X64 L;  2K5V A;  3I7F A;  4B3R L;  2UXC Q;  1H9S B;  3G48 A;  2B2U A;  4N9T A;  1KQS A;  1TS2 A;  3L2P A;  3J7A 5;  1N9W A;  1G6Z A;  3K6O A;  2F0P A;  4O42 A;  2N8N A;  3HOY H;  5IP9 G;  4X65 Q;  4HIM A;  1HQR D;  4RGN A;  2B3G A;  3UE0 A;  1PA6 A;  1QOH A;  1EOT A;  1HCZ A;  2E2I B;  4KJN A;  1PRT F;  1NR4 A;  1OXU A;  1JQY D;  2N3S A;  3CPF A;  4NMZ A;  1ENF A;  1X56 A;  2ZTD A;  2B2U C;  4J15 A;  5CV9 A;  1D1I A;  3QB3 A;  5KYL A;  4G7Z C;  1I4H A;  3IKJ A;  2VQF Q;  1SE2 A;  5LMU L;  4L5R C;  4JI5 L;  2K01 A;  3U9O A;  1KHI A;  2I5L X;  2PW5 A;  4PZ7 A;  3NWS A;  4JC0 A;  5FLX E;  2PPB C;  2TSS A;  1MJC A;  5M3F B;  4GS3 A;  4ZKC B;  1OXX K;  1CSP A;  2XRS D;  4KKS A;  1E7Z A;  3D4W A;  1EIF A;  1HUM A;  4YIJ A;  3VA5 A;  5CBA E;  2FJ2 A;  4YCW A;  1BDO A;  5C0X H;  2HQL A;  2J4X A;  5C44 G;  1EYG A;  3BS1 A;  3KDF A;  1PZJ D;  1MBY A;  5JOB A;  5IYC G;  3T1Y Q;  2R61 A;  1SEB D;  1LTT D;  5A2Q L;  1PTO D;  1UE1 A;  3SK6 A;  2K6A A;  4DR6 L;  4DNR B;  1LM0 A;  3CRK C;  3FKI B;  1Q3L A;  1EWC A;  1CTM A;  4U68 A;  4DV5 L;  3SHL A;  3MFY A;  2PYK A;  4F87 A;  3A54 A;  1D7Q A;  1PZK D;  3M3Y B;  1CUK A;  1I3Q B;  3HEJ A;  2ZXR A;  3SR1 A;  1XMO Q;  4EVO A;  4ALP A;  2CKZ B;  1DCZ A;  3HGB A;  3QWN A;  5E3F A;  4DN4 M;  3HOU H;  1OXT A;  1RTO A;  3PIP A;  1QCB D;  2E2H B;  1E22 A;  1CK1 A;  1SXT A;  5G3L D;  4TSS A;  1YZ6 A;  3RN5 A;  2OWO A;  4R4O A;  2WV6 D;  2LXK A;  2EYH A;  3HFZ B;  4HMJ A;  1QIL A;  1HZC A;  2VUM H;  2BE5 D;  3A55 A;  4DV6 Q;  4JI8 Q;  1LYL A;  1TU2 B;  2NN6 I;  1LTG D;  3QO2 A;  1NMF A;  1CKN A;  5C4X G;  1BUV T;  1FVI A;  1HR0 W;  2AWO A;  4JI7 L;  3FP9 A;  4C3I G;  4GLX A;  3B6Y A;  2BCO A;  2WIN B;  4JBJ A;  5IT9 E;  1AN8 A;  1K83 B;  1LTR D;  1I6V C;  2O5I C;  2FMM A;  5EBD A;  1CQV A;  3PUW A;  5IIF A;  3S1R B;  1PH2 A;  3GTM H;  1LTA D;  5M3F H;  5M5X H;  3BVZ A;  5FO7 B;  4J1M A;  2A68 C;  4IFD I;  3ND8 A;  5M9O A;  1TY2 A;  3KLS A;  1HZ9 A;  2Q2U A;  2R7Z H;  1STG A;  4I65 A;  5IT9 c;  1G8Z D;  2OQK A;  1G2T A;  5C5L A;  2Y0S G;  1IYV A;  3G71 A;  1FNV A;  3CF5 A;  4FP5 D;  3EFX D;  1RD9 D;  1M90 C;  4BS9 A;  3HOV B;  5CV6 A;  2M2L A;  3K80 C;  1XNR Q;  1HNW Q;  5LHY 1;  2YTX A;  2RBM A;  5EGT A;  3N52 A;  1JOK A;  3ERO A;  5JEA G;  1PH5 A;  5JEA J;  2DN8 A;  5LL6 X;  3QR8 A;  4L63 B;  3O13 A;  4JOI A;  3RZO H;  4BY7 B;  5IGG A;  1Q12 A;  1SYG A;  2XN9 C;  3MXG A;  4PZ8 A;  3MXN B;  4A4I A;  3M3Y H;  2ZM6 Q;  5JJK A;  1Y1W G;  4HIO A;  5C6A A;  4OGQ C;  5FJ8 H;  2K33 A;  2JA6 G;  3GTP H;  4DR5 L;  4X64 Q;  4B3R Q;  3W1B A;  3A0J A;  1AZP A;  2ZXO A;  1B1Z A;  1A6X A;  1EUJ A;  4A3M H;  2LY7 A;  3N6R A;  4B08 A;  4FDB A;  2Q2T A;  1EQV A;  4POG A;  2KBN A;  3Q23 A;  2F0N A;  1SND A;  1BF4 A;  1D5M C;  3SK5 A;  3CU7 A;  2F0I A;  1V9P A;  4P74 A;  2KCC A;  3FDT A;  4LNQ A;  3I4N G;  4L6T B;  5IP9 H;  3DEO A;  3HZX A;  5EPJ A;  4ME5 A;  1GJX A;  1WD1 A;  4DV2 L;  1IW7 C;  3FHW A;  3S1Q B;  5I9P A;  1SYF A;  1ASZ A;  3NWT A;  2WAQ G;  5JPN C;  1LTB D;  4DAY A;  5LMU Q;  4POF A;  5I6Y A;  2EYM A;  2L0C A;  2CQO A;  5TSS A;  4AYB E;  4JI5 Q;  3PUY A;  1K73 C;  2F3I A;  4JVZ A;  3RUZ A;  3CMA A;  1NSN S;  1HNX L;  5D14 A;  4CDD C;  1K83 H;  2KEN A;  2PZW A;  3HP3 A;  3VR2 A;  2MJ8 A;  4OIJ A;  4FYD A;  4DAV A;  4XQN A;  3UE1 A;  5EBC A;  4KMU C;  2CCZ A;  1DOM A;  3STB C;  2F52 A;  2OTJ A;  2CFM A;  2ENB A;  2PZT A;  2N55 A;  4DR6 Q;  2EYF A;  4A93 G;  5FLM G;  1Q8I A;  1H9R A;  2OEO A;  3H15 A;  1A3T A;  3M4P A;  4FO2 A;  2D0P A;  5C44 H;  4DV5 Q;  3F2C A;  4GNX A;  1EU4 A;  4K5X A;  2B63 G;  1OXV A;  4OO1 G;  4DR7 L;  2XWB B;  1WTW A;  2Z4I A;  1B9N A;  2EYJ A;  4AIM A;  3LX0 A;  3RMH A;  1AE2 A;  2NUC A;  2B29 A;  3BYT B;  1WYD A;  4KY7 A;  5E1F A;  3CCU A;  3D31 A;  1B9M A;  1U0L A;  2WB1 E;  1G91 A;  1L2F A;  1X3Q A;  2I5H A;  3QIA A;  2JJQ A;  3EVQ A;  1MSH A;  4JK1 C;  3SEB A;  1KNA A;  4RKL A;  1O80 A;  2F4V L;  2JA6 B;  3I70 A;  1BBU A;  4KHV A;  1XMQ L;  3U50 C;  2L55 A;  4LF6 L;  3J7A V;  2KCN A;  4BA1 I;  1STA A;  2JXM B;  4KJO A;  3A5Z B;  1UEB A;  1B53 A;  2LKV A;  2DJF C;  5JJZ A;  2D5D A;  3QOL A;  3OYY A;  1K8G A;  1V1Q A;  4O2D A;  3A8J E;  4C56 C;  4OO1 I;  3GV3 A;  2KQ3 A;  4PV1 C;  4JI7 Q;  3KLR A;  1X3E A;  2IX3 A;  2K50 A;  1FJG Q;  1QVF A;  3PSI A;  4XYO A;  1RJT A;  1SNP A;  2B2T A;  4RMF A;  2Q8I B;  1SE8 A;  2F3V A;  5D65 A;  5C4X H;  2F0M A;  2WAQ B;  2LXJ A;  3S2D B;  2Z6K C;  1CKO A;  4ZCK A;  4C3I H;  1KRT A;  2K1B A;  4H0L C;  4K6D A;  3AQQ A;  3T51 B;  4B3T L;  1HRJ A;  4N8X 1;  4OWW B;  4C3H G;  3M4O B;  1HXY D;  3NSW A;  1SRO A;  1MSG A;  1STH A;  1KAA A;  3C2P A;  4XXE A;  2NBF A;  1VQI A;  4OWT B;  2CWA A;  1D8L A;  5M5Y H;  1AEX A;  2WB1 B;  5D3I B;  1I50 B; 
#chains in the Genus database with same CATH homology
 4ID6 A;  4A93 B;  5KNC A;  4WFN 3;  2IT1 A;  3RLF A;  2K5Q A;  5JAV A;  1JB3 A;  1WTQ A;  3J7A F;  5JEA H;  1T5E A;  4DXF A;  5C4Z A;  4FF2 A;  4RAU C;  2EY6 A;  3S15 B;  4PMC A;  2G9D A;  2QCP X;  1JOR A;  4I7Z C;  5COY A;  1I4X A;  3U9S A;  2NVQ B;  2JP1 A;  2HCC A;  3VYU A;  4EQP A;  4ULL A;  3GV6 A;  2F0K A;  2J7Z A;  2L11 A;  3OIP A;  2F0L A;  3T53 B;  1SJH D;  5JPM C;  4FXK C;  1EY8 A;  1H9K A;  2F4I A;  3JAM E;  2D2C C;  1RHP A;  2A74 C;  3KF8 A;  3MC0 B;  5G3L F;  4B9X A;  1STY A;  2X69 A;  1S5E D;  3GQB A;  3S14 B;  3S1N B;  1S4Z A;  2JEB I;  3C3L A;  5JVH 3;  5IGB A;  4ZYS A;  2NYZ D;  1CZW A;  3J80 E;  4KHZ A;  5F2D A;  2K5W A;  1Y69 U;  5CV5 A;  4BBR B;  2EVB A;  3K5O A;  1WCM B;  1WTP A;  2JYO A;  3MFG A;  5ELF A;  2B2Y A;  1ESF A;  1EY7 A;  3I90 A;  1EFI D;  4PMB A;  3NBH A;  4FF3 A;  4XT3 B;  4IZ8 A;  2Z8L A;  3URY A;  4C2M B;  2I46 A;  1R9T B;  1V1P B;  3MVV A;  1L0X B;  1SYE A;  4C1N I;  1V8Q A;  3V96 A;  2R93 B;  4IUV A;  3E5S A;  4OO1 H;  5EKL A;  5FLX L;  3VYT A;  1PLF A;  3MWY W;  1M4V A;  2JE6 I;  2F0T A;  5DAU A;  4K14 A;  5CYU A;  1D5X C;  1GHJ A;  4NKL A;  3TBI B;  3HOY B;  4J8Q A;  5E4X A;  3H3V C;  3C1F A;  1UEA B;  3TP6 A;  3AB9 A;  1I4Q A;  3LWU A;  3OWE B;  4F7X A;  1JOQ A;  2E2D C;  4A3J B;  4C3J G;  4KKU A;  3VR5 A;  2E75 C;  2SDF A;  4FF1 A;  4DK1 A;  3ZYY X;  1JR0 D;  4KD4 A;  4RHR A;  4EQN A;  2NVX B;  4NP5 A;  3TP5 A;  1LTS D;  5I4D A;  1E2W A;  2K04 A;  3IFD A;  2NTS A;  3MXU A;  1SNM A;  1JOO A;  1T5X D;  3T16 A;  1ET9 A;  1EYD A;  3QG1 A;  3OMC A;  3K5N A;  2RSN A;  3DEP A;  2KEE A;  1C4Q A;  4M1U B;  3MXP A;  5IT9 L;  1W6K A;  3OOC A;  2BDO A;  5EPL A;  4HAE A;  3IFT A;  2F0E A;  4F8M A;  3SVM A;  3BZD B;  4CJ2 C;  1LT3 D;  1JWS D;  1TT2 A;  2V4D A;  1F9Q A;  3C1E A;  4OL7 A;  4HR7 B;  2D9U A;  1BCP C;  2VUM B;  5FO9 B;  2BA1 A;  1BQQ T;  3D4R A;  2IL8 A;  2E2J B;  1XX8 A;  3J7Y W;  4KY5 A;  4CGY B;  5CR3 A;  1S5C D;  1SYB A;  3NE5 B;  2HCI A;  4EQO A;  2BDN A;  3GTM B;  4RHS A;  1EEI D;  4C3J B;  5M5X B;  5I2X A;  3L9A X;  1EQT A;  2R7Z B;  3NUC A;  3I91 A;  3Q24 A;  3M7G A;  2NVT B;  2IPK D;  1QG7 A;  5CV8 A;  5IGF A;  2JA8 B;  4RGT A;  5COR A;  5A35 A;  3DXJ C;  3NPP A;  3H6M A;  3S9W A;  1A3V A;  1LLR D;  1BR9 A;  1VMP A;  2NN6 G;  1SMY C;  2BOS A;  1QB5 D;  3RZO B;  1UAP A;  1KNE A;  2F3W A;  1EY9 A;  3BDL A;  1VMC A;  1PFB A;  3MA2 B;  2F0H A;  2F0W A;  3GTP B;  3PV0 A;  3KUP A;  1NUC A;  4A3M B;  4H44 C;  5NUC A;  4IFD G;  1GXD C;  4IFD J;  5JVG 3;  4F88 A;  1WD0 A;  1ZXT A;  4X3K A;  3D3R A;  2AQ2 B;  4K2L A;  4IAL A;  1YNN C;  1SBB B;  2EOT A;  3HRZ C;  4WJW A;  4C1N K;  5C4J B;  3KBX A;  2O4X A;  1ZYR C;  1LTI D;  1TII D;  3HG9 A;  1OO9 B;  1IL8 A;  2VNU D;  4M8A A;  2EYL A;  1MGS A;  2AUJ D;  3T13 A;  3NK9 A;  3I73 A;  2A69 C;  2MUY A;  3FMC A;  1XYI A;  4RKB A;  3DMU A;  2MPM A;  5C4H A;  4WOR A;  3NTK A;  5ELD A;  1TR5 A;  1LAB A;  5C44 B;  4ZUJ A;  1NAP A;  1D5Z C;  1F9R A;  1UUP A;  2KJX A;  1TWF B;  4RA8 A;  2ZXP A;  1IYU A;  2QDB A;  1FNW A;  3FPP A;  1X32 A;  3DM1 A;  2N88 A;  2HDM A;  4IN3 A;  3VA7 A;  4MIU A;  3OWF A;  1AW7 A;  2EJM A;  2R6G A;  5IGE A;  1AP0 A;  1G29 1;  4ZQ3 A;  2EYP A;  2FMC A;  3RD4 A;  1RKN A;  2EE1 A;  1HFN A;  1KLG D;  2RVL A;  1DOL A;  3DWP A;  3QOJ A;  1ILP A;  1PYW D;  3NTH A;  1M8A A;  4IUR A;  4FXG C;  4CJ1 B;  1PRT C;  5CV4 A;  3J81 E;  4HSV A;  1BBX C;  2EY1 A;  1TS4 A;  1YNJ C;  2HDL A;  4UDU C;  3P75 A;  3X3N A;  5C4X B;  5ISR A;  2M9V A;  4C3I B;  2H4O A;  1PDQ A;  2Z4H A;  4UAI A;  2F0Q A;  2Q8T A;  1DOK A;  4KN4 C;  4CBV A;  2RDG A;  2O2L D;  4JBW A;  5C5M A;  3FVQ A;  5IOD A;  3P7J A;  3EA6 A;  1KDB A;  1XWE A;  3R2I A;  2A68 D;  5KGU A;  1SNQ A;  4OIK A;  3OW7 A;  3A8I E;  2K7V A;  5M5Y B;  1Q1B A;  3MXN A;  2Y0S B;  2KED A;  5KRU A;  1SFO B;  3VR3 A;  3W2D A;  1JE4 A;  3PMF A;  5BN3 A;  3J80 L;  4BWG B;  3E6Z X;  1PXU A;  3K5M A;  2NN6 H;  2QKI C;  3S16 B;  1TWG B;  5DNF A;  4TQU S;  4PMW A;  4HCS A;  1W6J A;  2F1M A;  1Y1W B;  4IUP A;  3GD7 A;  1Y8P B;  5CGK A;  1KTK A;  4IFD H;  5ELE A;  5AFW A;  2EJG C;  1V1O A;  3I4N B;  5I6W A;  1GHK A;  3NQT A;  4IQZ A;  3MHB A;  3F2U A;  1GUG A;  3ND9 A;  1IW7 D;  1CFM A;  4R8N A;  1DJR D;  2RSO A;  3P20 A;  1CI3 M;  4KV6 A;  3GTJ B;  1WTV A;  3A7L A;  3D6C A;  2A6E C;  1H9M A;  4XDX A;  4Q0F A;  4LK1 C;  2R92 B;  1I4G A;  4KD3 A;  2B2T C;  4Y7N B;  5ELC A;  3GTG B;  2PZU A;  3H91 A;  1EIH A;  1J9O A;  3C46 A;  1TWH B;  4HN7 A;  3GO5 A;  3CKI B;  5I9O A;  3BVG A;  3I3C A;  2EPB A;  1ZEQ X;  3SE0 A;  5T1G A;  2SNM A;  5K36 G;  1SDF A;  3MAQ A;  2M00 A;  2B63 B;  1KDA A;  1HQM C;  3R3O A;  2IWH A;  2X6G A;  3IAY A;  3TSS A;  1B50 A;  4ZKB B;  3TZD A;  3KK7 A;  1TKW B;  3SK8 A;  2DNE A;  2K28 A;  3TP7 A;  3CRL C;  3OSO A;  4R8I A;  1KDC A;  1Z7T A;  1KLU D;  2CW0 C;  3PIO 3;  4EGV A;  1JCK B;  2DY8 A;  3D6W A;  4N9P A;  1EYA A;  3GP7 A;  1STN A;  2F0V A;  1DM0 B;  4QUC A;  1BCP F;  1IKL A;  1F9P A;  1R4Q B;  1O78 A;  2K32 A;  2NTT A;  2NZ1 D;  3PUV A;  1AZQ A;  1TS5 A;  3EQL C;  2E74 C;  1LT5 D;  3FEW X;  3KBG A;  2WAC A;  5HUR A;  1O7L A;  1B4O A;  1EU3 A;  2PMZ B;  4C3H B;  2B2V A;  3V05 A;  1TWC B;  2EXZ A;  1D1K A;  2FHT A;  4KI0 A;  3DHQ A;  4DFA A;  2B2Y C;  4TRD A;  1BXT A;  3HS0 C;  3NXW A;  2L5T A;  3A56 A;  1ZKO A;  2B2V C;  4DNT B;  2QF7 A;  1SAP A;  2H1E A;  2KHS A;  3EJI A;  2K5D A;  1U4L A;  1OXS C;  3WOF A;  3DUZ A;  2EY5 A;  5C3W A;  1GUS A;  3OMG A;  2NB0 A;  2B8G A;  1FD7 D;  5C0X I;  3BVM A;  4K5W A;  1HUN A;  2F0F A;  5KIX A;  4ABN A;  4DU9 A;  1RF2 D;  3GTL B;  4KTA A;  3PUZ A;  1BOS A;  1BCP B;  4DA2 A;  1E2Z A;  1PMR A;  3T4A C;  4WRD A;  4NDX A;  2AUK A;  3PO3 B;  2A6H C;  4X3S A;  2VXW A;  4HMI A;  4S3S A;  3G7L A;  1II3 A;  5C3E B;  4R9W A;  3VR6 A;  3OHX C;  3BYY B;  1STB A;  3M4Y A;  3H94 A;  3TN2 A;  4H7B A;  4FVM A;  3H0G B;  1PTO C;  3K7A B;  3L7Z C;  4ZLT F;  1PFN A;  4ZRZ A;  3AU7 A;  2D62 A;  3UI2 A;  3MTS A;  5K36 H;  3S1M B;  2NWG A;  4HCE A;  1FR3 A;  2CHB D;  4ZUI A;  1PTO H;  1ET6 A;  1WTX A;  2EJF C;  2PQE A;  3RZD B;  1DZ1 A;  5FK9 C;  1LT6 D;  2J0T D;  1VCI A;  3BG3 A;  3V2T A;  2SOB A;  2SEB D;  1A15 A;  1RDP D;  3HKZ B;  3LWE A;  4H13 C;  1ML0 D;  4A3F B;  5IOC A;  1JIC A;  5ELB A;  2OXP A;  1F2Z A;  1GUN A;  2BE5 C;  2QEJ C;  1QNU A;  4IUU A;  4K6L A;  1U4P A;  2AQ3 B;  1MI2 A;  2FIN B;  1R4P B;  3MZ5 A;  2K03 A;  4G57 A;  1B3A A;  1SE3 A;  4XT1 B;  3IL8 A;  1TY0 A;  3GTQ B;  3AMU A;  5FO8 B;  2A6H D;  5CMD A;  4RFB A;  2JA5 B;  4ZK9 B;  4Z9C B;  3J81 L;  4BA2 I;  2EY2 A;  5KYI A;  1H9S A;  3NQI A;  4K8J A;  1VF7 A;  5HGT A;  2WKD A;  1DXM A;  2LS0 1;  1ROD A;  2IX0 A;  3D8G A;  2RQX A;  2RA4 A;  2OF1 A;  1LAC A;  2SNS A;  1IHZ A;  4B9W A;  2MGS A;  3E0J A;  4LAA A;  5KEE A;  3A7A B;  3GTK B;  1JC7 A;  1NCV A;  1QJO A;  5D3D A;  3G6J B;  2ID0 A;  3I72 A;  1DON A;  3SK4 A;  1EYC A;  2YU9 B;  1GUT A;  1HTL D;  5EKK A;  3S17 B;  2NVY B;  1BCP D;  4E6I A;  1ILQ A;  4G7H C;  1U4M A;  2RKS A;  3NHH A;  1A3U A;  5KND A;  1FNU A;  1VDZ A;  5M5W B;  2RDH A;  3CHB D;  4ODG A;  1CHQ D;  1WVL A;  4HTH A;  1BO0 A;  3FPU B;  1PRT B;  1Y1V B;  2XNA C;  2XVS A;  2LMC B;  2R3Z A;  2CVR A;  5DM7 3;  2C9O A;  2E76 C;  5EJW A;  1STE A;  2X6L A;  1X3P A;  1AFP A;  1D2B A;  4V19 0;  3PUX A;  4XQJ A;  3DWA A;  3BDO A;  2XIW A;  1SMY D;  2JSO A;  4FNF A;  1O7Z A;  1A2T A;  1LT4 D;  1F2Y A;  2VB3 X;  4CKE A;  1NR2 A;  1K8O A;  5J39 A;  2C5C A;  4DGZ A;  3WDN A;  2Q8R E;  4A3K B;  1U9R A;  2F0O A;  4QCL A;  2BA0 A;  3K5L A;  4K8I A;  4RCN A;  3I8Z A;  4IUT A;  3R93 A;  4KK7 A;  2ZT9 C;  3ERQ A;  3PIP 3;  1YNN D;  4KKT A;  1C48 A;  1HPC A;  5KNB A;  4LJZ C;  4Q5V A;  4XQQ A;  2HQE A;  1ZYR D;  5M3M B;  2WII B;  5A2Q E;  1SE4 A;  1O7Y A;  2EZV A;  2KEC A;  4CKC A;  2A5H A;  4QIW B;  2AQ1 B;  3JAM L;  2HUG A;  3I4M B;  1WTO A;  1B44 D;  5FOB B;  1SYC A;  2O5J C;  4BY1 B;  2A69 D;  3K57 A;  2G9H D;  1CA5 A;  5CBE E;  1TS3 A;  2IW3 A;  4P2C B;  1Q1E A;  1ESR A;  1TQO A;  4K2K A;  4QF4 A;  1I6H B;  3WOE A;  3P1H A;  4X3T A;  1EWH A;  2KUM A;  4BBS B;  2PW7 A;  3NP8 A;  5FKA C;  1EZ8 A;  2F0J A;  2L1B A;  3MEH A;  1Y8N B;  4GZY C;  1CHP D;  2F0D A;  2MP1 A;  4L8J A;  1PFM A;  4MHE A;  3TZU A;  1B2T A;  1BNZ A;  1Z47 A;  3ONA B;  2YYZ A;  2IX1 A;  4QUF A;  1UNS A;  5IGD A;  1CT1 D;  2XSC A;  1E0B A;  1F2L A;  1EIG A;  1XTC D;  1S5B D;  4J6H A;  5I2Y A;  3VYR A;  2WP8 J;  4AYB B;  4A3I B;  3NTI A;  1D6E C;  1C8C A;  1WTR A;  1HTP A;  1PRT D;  3FRP B;  4RCO A;  2L9H A;  1HA6 A;  3VYS A;  2XRQ D;  4V0B A;  1YNJ D;  1DD2 A;  1ICW A;  3TME A;  4ILW A;  4IUQ A;  2DY7 A;  5DEH A;  4XIG S;  1KAB A;  4QB4 A;  2PCF B;  2VB2 X;  3S2H B;  2B2W A;  1EY5 A;  1F2M A;  1EY0 A;  2PNR C;  2PO4 A;  1FYC A;  1TWA B;  3VR4 A;  4DF7 A;  4HED A;  1XXG A;  2AWN A;  1HFG A;  2F0G A;  4A3E B;  4RGO S;  2KA7 A;  1RCV D;  1Z6H A;  1CZG A;  2B2W C;  1EY6 A;  3K0Y A;  5CC4 A;  3QJY A;  4FXD A;  5EPK A;  4A3G B;  1EEF D;  4KY6 A;  2EDG A;  4OHJ A;  2L12 A;  4DAP A;  2CQA A;  2RDF A;  1Y8O B;  1U4R A;  2B39 A;  1JWU D;  1PTO F;  3L3O C;  4IUN A;  1HHV A;  3Q0A A;  3GTO B;  2DNC A;  3M85 A;  3SDZ A;  1TVX A;  1QWY A;  2L4N A;  4RH6 A;  3OIQ A;  4ZAI A;  1S5F D;  5T1I A;  1FGB D;  5C3X A;  4U67 3;  5J22 A;  2JA7 B;  2XWJ B;  1QNK A;  1PZI D;  4A3B B;  3R2T A;  2MHV A;  4CKB A;  1J8I A;  5EQ0 A;  1RTN A;  2B8F A;  5CV7 A;  2LFN A;  4XTC S;  2WKC A;  4DXG A;  2KVM A;  1EL0 A;  2A6E D;  3CQZ B;  4X3U A;  3OPO A;  1SNC A;  1F77 A;  1GUO A;  5C0X G;  1LO5 D;  2ICI A;  5C0X J;  1G2S A;  4CJ0 B;  3Q22 A;  5J1Z A;  4HSP A;  1SSO A;  4KN7 C;  1ENC A;  2OT2 A;  3K59 A;  3T56 B;  2QIL A;  1HA5 A;  2K05 A;  1PTO B;  4TKO B;  1IKM A;  4A3D B;  5LL6 S;  2F03 A;  1GUW A;  4K5V A;  1ENA A;  4RGM A;  3A8K E;  3D4D A;  1L0Y B;  1CQF A;  5IGC A;  1DYQ A;  1I4P A;  3LNN A;  1MD2 D;  1S5D D;  3NBI A;  5DM6 3;  1EY4 A;  3SXH A;  4QMG A;  3I4L A;  5BN4 A;  2CW0 D;  2KOL A;  3TDQ A;  4G7O C;  2A73 B;  5K5P A;  1K8M A;  3PO2 B;  3HOW B;  1F9S A;  4LMQ D;  3R8B A;  4DK0 A;  2IJ0 A;  4G4K A;  1SYD A;  1V1P A;  2Z1C A;  3H09 A;  1QE6 A;  2GA4 B;  4NW2 A;  1E2V A;  2I07 B;  3K58 A;  1GOZ A;  5E4W C;  3KLS X;  2EYO A;  5BN5 A;  1EZ6 A;  3DWQ A;  3BDC A;  1ONL A;  2F0S A;  3HOX B;  2TMP A;  4FF4 A;  1CM9 A;  3Q6S A;  3X3M A;  5EKI A;  3W3A A;  2FFK B;  1H9J A;  3ITP A;  4MN3 A;  2ICE C;  1SJE D;  1V43 A;  1LV9 A;  3M7N A;  3TP8 A;  1Q90 A;  4RWS C;  4PNY A;  3HOZ B;  1I4R A;  4XYQ A;  4PQX A;  4O1N A;  2JEA I;  2F0U A;  1VF5 C;  4CHT B;  1SNO A;  1A2U A;  3HOU B;  1JWM D;  1CA6 A;  1H9S B;  2B2U A;  4N9T A;  1TS2 A;  1G6Z A;  3K6O A;  2F0P A;  4O42 A;  1HQR D;  4RGN A;  1QOH A;  1EOT A;  1HCZ A;  2E2I B;  4KJN A;  1PRT F;  1NR4 A;  1OXU A;  1JQY D;  4NMZ A;  1ENF A;  2B2U C;  5CV9 A;  1D1I A;  3QB3 A;  5KYL A;  4G7Z C;  1I4H A;  3IKJ A;  1SE2 A;  2K01 A;  3U9O A;  2PW5 A;  3NWS A;  5FLX E;  2PPB C;  2TSS A;  5M3F B;  4ZKC B;  1OXX K;  2XRS D;  4KKS A;  3D4W A;  4YIJ A;  1HUM A;  3VA5 A;  5CBA E;  2FJ2 A;  1BDO A;  5C0X H;  2J4X A;  3BS1 A;  1PZJ D;  1MBY A;  5JOB A;  2R61 A;  1SEB D;  1LTT D;  5A2Q L;  1PTO D;  3SK6 A;  2K6A A;  4DNR B;  3CRK C;  3FKI B;  1Q3L A;  1EWC A;  1CTM A;  4U68 A;  3SHL A;  3MFY A;  2PYK A;  4F87 A;  3A54 A;  1PZK D;  3M3Y B;  1I3Q B;  3HEJ A;  2ZXR A;  3SR1 A;  4EVO A;  1DCZ A;  3HGB A;  3QWN A;  5E3F A;  4DN4 M;  1OXT A;  1RTO A;  1QCB D;  2E2H B;  1CK1 A;  1SXT A;  5G3L D;  4TSS A;  2WV6 D;  2EYH A;  4HMJ A;  1QIL A;  2BE5 D;  3A55 A;  1TU2 B;  2NN6 I;  1LTG D;  3QO2 A;  1BUV T;  2AWO A;  4C3I G;  2BCO A;  2WIN B;  5IT9 E;  1AN8 A;  1K83 B;  1LTR D;  1I6V C;  2O5I C;  2FMM A;  5EBD A;  1CQV A;  3PUW A;  5IIF A;  3S1R B;  1LTA D;  3BVZ A;  5FO7 B;  4J1M A;  2A68 C;  4IFD I;  3ND8 A;  5M9O A;  1TY2 A;  3KLS A;  1STG A;  4I65 A;  1G8Z D;  1G2T A;  5C5L A;  1IYV A;  1FNV A;  4FP5 D;  3EFX D;  1RD9 D;  4BS9 A;  3HOV B;  5CV6 A;  2M2L A;  5LHY 1;  2RBM A;  5EGT A;  3N52 A;  1JOK A;  3ERO A;  5JEA G;  5JEA J;  2DN8 A;  5LL6 X;  4L63 B;  3O13 A;  4BY7 B;  5IGG A;  1Q12 A;  1SYG A;  2XN9 C;  3MXG A;  5C6A A;  4OGQ C;  2K33 A;  1AZP A;  2ZXO A;  1B1Z A;  1A6X A;  2LY7 A;  3N6R A;  4B08 A;  1EQV A;  3Q23 A;  2F0N A;  1SND A;  1BF4 A;  1D5M C;  3SK5 A;  3CU7 A;  2F0I A;  2KCC A;  3FDT A;  4L6T B;  3DEO A;  3HZX A;  5EPJ A;  4ME5 A;  1GJX A;  1WD1 A;  1IW7 C;  3S1Q B;  5I9P A;  1SYF A;  3NWT A;  5JPN C;  1LTB D;  4DAY A;  5I6Y A;  2EYM A;  2L0C A;  5TSS A;  3PUY A;  3RUZ A;  1NSN S;  5D14 A;  2PZW A;  3HP3 A;  3VR2 A;  2MJ8 A;  4OIJ A;  4FYD A;  4DAV A;  4XQN A;  5EBC A;  4KMU C;  1DOM A;  2ENB A;  2PZT A;  2N55 A;  2EYF A;  1Q8I A;  1H9R A;  2OEO A;  1A3T A;  4FO2 A;  1EU4 A;  4K5X A;  1OXV A;  4OO1 G;  2XWB B;  1WTW A;  2Z4I A;  1B9N A;  2EYJ A;  3LX0 A;  3RMH A;  2NUC A;  3BYT B;  5E1F A;  4KY7 A;  3D31 A;  1B9M A;  1G91 A;  1X3Q A;  3QIA A;  3EVQ A;  1MSH A;  4JK1 C;  3SEB A;  1KNA A;  4RKL A;  1O80 A;  2JA6 B;  3I70 A;  4KHV A;  2L55 A;  3J7A V;  2KCN A;  4BA1 I;  1STA A;  2JXM B;  4KJO A;  1B53 A;  2LKV A;  5JJZ A;  2D5D A;  3QOL A;  3A8J E;  4C56 C;  4OO1 I;  3GV3 A;  2KQ3 A;  4PV1 C;  3KLR A;  2IX3 A;  4XYO A;  1RJT A;  1SNP A;  2B2T A;  2Q8I B;  2F3V A;  5D65 A;  2F0M A;  2WAQ B;  3S2D B;  2K1B A;  4H0L C;  4K6D A;  3T51 B;  1HRJ A;  4C3H G;  3M4O B;  1HXY D;  3NSW A;  1MSG A;  1STH A;  1KAA A;  3C2P A;  4XXE A;  2NBF A;  1AEX A;  2WB1 B;  5D3I B;  1I50 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...