4RAUC

Crystal structure of rtofab in complex with human pf4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
EDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords RTOFab light chain
publication title crystal structure of RTOFab in complex with platelet factor 4
rcsb
source organism Mus musculus
total genus 5
structure length 65
sequence length 65
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rauC00
2KVMA 2X6GA 1IL8A 1EL0A 4X3UA 1F9PA 5EPJA 1O7ZA 2MP1A 4CJ2C 2B2YC 5CMDA 1WTVA 1X3PA 4HSVA 5D14A 3IL8A 1WTRA 2K05A 5E4WC 1G6ZA 2K01A 1GUWA 2KUMA 2L9HA 3I90A 4HCSA 1BO0A 1E0BA 1WVLA 1IKLA 1XYIA 2X6LA 4ZKCB 2B2WC 1AP0A 2N55A 1DZ1A 2KECA 4QUCA 4X3KA 1ICWA 3QO2A 1NCVA 1HHVA 3I3CA 1F9QA 1RTNA 2X69A 1SSOA 1KNEA 1MI2A 3UI2A 2FMMA 1O7YA 3F2UA 3R93A 3DM1A 4CJ1B 5COYA 2D9UA 1NAPA 1DOKA 2KOLA 1CA5A 5EPLA 2DY8A 1QNKA 2RSNA 1WD1A 5CBAE 1C8CA 4X3SA 2L11A 1HUNA 3FDTA 3MWYW 4R9WA 2H1EA 1J9OA 4R8IA 4RA8A 1HUMA 3KUPA 1EQTA 4MN3A 4XT3B 2B2TA 1F9RA 4ZK9B 2L12A 1BBXC 2L1BA 1DOMA 1PFMA 1QG7A 3SVMA 1HFNA 5DNFA 2HDMA 1MSHA 3TN2A 4HAEA 1F2LA 4MHEA 1CA6A 4LMQD 1IKMA 1G2SA 2KEDA 2Q8RE 3HP3A 5EKIA 3LWEA 1RODA 4ZAIA 2FJ2A 2M2LA 1MGSA 5T1IA 1WTQA 1B2TA 5EPKA 3DEOA 2HDLA 1U4MA 1EIHA 5JJZA 4IUPA 2HCCA 4OIKA 3TZDA 2HUGA 1QE6A 2SDFA 3D6WA 2BDNA 1DOLA 2FHTA 3MTSA 2L4NA 3G7LA 1ILQA 4RWSC 4U68A 4XDXA 2DY7A 5E4XA 3I8ZA 4IURA 2FINB 1AZQA 1XX8A 1RJTA 2JYOA 2JP1A 3GV6A 1RTOA 2RVLA 2HCIA 2IL8A 5CORA 2FFKB 2MGSA 5AFWA 2B2UA 2Q8TA 4DN4M 1WTOA 3FPUB 2VXWA 2B2VA 1SAPA 4O42A 4OIJA 5CBEE 4IUQA 4NW2A 1CM9A 1M8AA 2NZ1D 1X32A 2N88A 2RSOA 3Q6SA 2K03A 4RAUC 2R3ZA 1ZXTA 1RHPA 2EPBA 1X3QA 1PLFA 1O80A 1WTWA 1G91A 1TVXA 3N52A 3IFDA 1WTXA 3H91A 2EE1A 2B2WA 2K04A 1J8IA 2EOTA 1AZPA 1PDQA 1U4PA 2B2VC 2MJ8A 2RA4A 3DEPA 2B2TC 2KEEA 1WD0A 4ZKBB 1U4LA 4UAIA 1LV9A 3KBXA 4IUTA 1ML0D 5T1GA 1EOTA 1ILPA 1VMPA 1PFBA 3ONAB 1A15A 1B53A 1MSGA 1WTPA 4XT1B 1F9SA 1DONA 1NR4A 4HEDA 1U4RA 1NR2A 1JE4A 4X3TA 1JICA 2NWGA 1KNAA 5EQ0A 3GV3A 1BF4A 1HRJA 2K28A 2B2YA 3I91A 4IUVA 3P7JA 2J7ZA 4QUFA 1B3AA 1EIGA 4CJ0B 1HFGA 1SDFA 1B50A 1BNZA 4IUUA 4ZLTF 5EJWA 2XIWA 2CVRA 1HA6A 1ESRA 1S4ZA 2K1BA 5D65A 1VMCA 2MPMA 2B2UC 1Q3LA 1PFNA 2NYZD 1G2TA 1B4OA
chains in the Genus database with same CATH superfamily
1SYBA 2KCTA 4C3JG 1ICFB 2IX1A 1R9TH 2O4XA 5A2QL 4ZUJA 3C2PA 3W1GA 1WTVA 1VQMA 2BH2A 1EYAA 5M3FH 3S1RB 1PH3A 3J80c 4A3BG 1NMFA 5LL6S 3UDGA 1H9SB 1SSOA 4QB4A 4FYDA 1SROA 1PFSA 4L5TA 5FO7B 3S2HH 5ELFA 2RF4A 1KDBA 4KLKA 3T51B 1WD1A 4U673 1TWFH 2B3GA 2NN6H 5GAGC 1L1OC 1STBA 3GQBA 1CSPA 5KNCA 1QG7A 3HOWH 2E75C 3M4OB 5IP9H 3Q8DA 1H9KA 4TKOB 4JI8Q 3NEMA 1PTOD 5M5WB 3MTSA 5C4XG 1XWEA 5C0XI 2NZOA 3W2DA 1YVCA 5JEAH 3GV6A 2Z4HA 2F0TA 3MXGA 1SR3A 2ID0A 3SE0A 1UE6A 2MO0A 4DV1L 1X32A 3STBD 2UXDL 1UNSA 1TWGH 1SXTA 1YBYA 4V0BA 1CTMA 3F2BA 4FXKC 5GROA 1K8AC 1BUVT 2A68D 1BKBA 4HTHA 3G6EA 1RIPA 2EYFA 2B63H 2IPKD 5EGTA 1K73C 4DR1Q 1LV9A 2WAQE 3OHXC 2EYLA 3NP8A 4PZ7A 1AFPA 3H0GG 5I2XA 1HNWQ 1JOQA 4GKKL 4BXXG 2RDGA 1FR3A 5C3XA 2J0TD 4PZ8A 3PUZA 1A0IA 1RF2D 1Q90A 4I7AA 1H9RA 2ENBA 4X64Q 3IRBA 2WAQB 2HHHL 3AFQA 2LS01 1SYGA 2K32A 4KY5A 2PZUA 3A8JE 4NKLA 2IX0A 4UP8A 4A75A 3GTKH 4A93H 4F7XA 4OWWB 5M3MH 1V8QA 1G6ZA 2K01A 1HZ9A 1WVLA 1PZKD 1GHJA 1B70B 4C3JH 1AP0A 3RLNA 3OYYA 5I9OA 4QQBX 5EKKA 5IGDA 1BVSA 4FXGC 3UI2A 2ATWA 1WCMG 3KK7A 3CCJA 1JOKA 5LMNL 4R4TA 2KHJA 3SK4A 3GTJH 2CW0C 1HUNA 2IHFA 2PZTA 2CFMA 1VQPA 4DAYB 4R8IA 4ULLA 4GNXB 2B2TA 4ZK9B 1IBLL 3TS2A 1DOMA 1AEXA 5CR3A 4NXMQ 3M3YB 2Z6BA 5GAHC 3NELA 2UU9L 1KL9A 2EJGC 3SEBA 3J81E 4KKUA 1ENAA 1EIYB 4OO1G 4UDUC 1HA6A 4GLXA 2FHTA 2EXDA 1FL0A 1V1QA 1EU3A 4DV4Q 1IYVA 4A3DG 4A3CG 1K3BC 1Z7TA 2JYOA 4R4CA 2RVLA 2EJFC 4K0KQ 2MGSA 5AFWA 5D3IB 5IGGA 1KRTA 3I4NB 1BCPD 5IT9E 1MIUA 2DJGC 1ENFA 3H15A 2RSOA 2UXCQ 1II3A 1SE4A 5C4XH 1VQKA 2F0VA 1BOSA 1TWHB 4DR3L 3FKIB 4EVOA 1UE5A 4CKEA 5IYDG 4LNQA 3PO3B 1DCZA 2QKIC 2GVBA 3E5SA 3MAQA 4YWKA 1PDQA 1KC8C 5JJKA 2XVSA 2PO4A 1X56A 4ZKBB 4UAIA 1ASYA 3IAYA 4GOPC 3KBGA 3BDCA 3VDYA 5CV9A 5ELNA 3U50C 1VQBA 3SGIA 1IBKQ 1KAWA 2SOBA 1PH2A 2YTVA 4OX9Q 4FXDA 4WJWA 3S1MB 1QVCA 1JMCA 3D4WA 2LXKA 4HN7A 3D8GA 1LLRD 3BS1A 3ERSX 1B44D 4ZLTF 3H0GH 1LM0A 2OTJA 1S4ZA 3A8IE 4ZQ3A 5IYBG 5I6YA 1EUJA 3HOUB 3KDFB 3MEFA 1O7ZA 1LTAD 2D0OA 2B2YC 3K57A 3HGBA 3I7FA 1JJCB 2K5DA 1PTOF 1SNCA 3TMEA 1VF5C 4RCNA 2AQ3B 4J6HA 2XNAC 4DNRB 1HHVA 3RZOH 1F9QA 2PPBC 2UUBL 2QDBA 1Q81C 2FMMA 5AJ3L 3NTHA 2Z8LA 4L5QA 3CC4A 5C5MA 1Q86C 3PIOA 1RD9D 4XT3B 2H4OA 1PRTC 4PG3A 3BJUA 1TWAH 1WCMH 3SVMA 1EY6A 4HAEA 1I4XA 2ZJRA 1YNNC 5EKIA 2OT2A 1D7QA 1I3QB 1RODA 2XTIA 2PQEA 1D5XC 2UUCQ 4H44C 4OIKA 2JK8A 5FLXc 4WRDA 2SDFA 3SXHA 4JBJA 1ILQA 4GNXA 3OPOA 3PCOB 1TU2B 4B08A 4L6TB 1DGSA 4YY3L 1NSNS 3I72A 2R6GA 4PMCA 4LF8Q 1WFQA 2K75A 3OIQA 1UEBA 4CKBA 4OO1H 2CQAA 1TS2A 1M8AA 3J7AF 4RAUC 2A8VA 3EQLC 4JI1Q 1PZID 2RKSA 2PYKA 4A3DH 4A3CH 3OWEB 4BY7B 1ONLA 1G91A 3N52A 4NB3A 3UE0A 4E6IA 1E7ZA 3CMEA 1J5EQ 1AN8A 2PW7A 1ET6A 1IXRA 1EOVA 4G7ZC 3ND8A 2K6AA 2XN9C 1PV4A 1PFBA 3ONAB 5IYDH 3A7AB 1Y1VB 5J1ZA 1SNQA 3NUCA 2HQEA 4CDEC 1Q8IA 1LTBD 1L1OA 3OIPA 4DR5Q 3MEHA 1SRUA 3BU2A 3MVVA 1S40A 2LXJA 1HFGA 1VQ9A 3A54A 5HY6A 5JJIA 2R92B 4JI2L 4A3JG 2QA4A 2AWOA 1LTLA 1IL8A 1PMRA 4K6DA 1EY0A 4QY7A 2R7DA 3EVQA 4OWTB 2WV6D 1X3PA 2E2JH 3L7ZC 2L9HA 1UAPA 2B2WC 5EBDA 2C35B 1U9RA 2WKCA 2K5WA 1IW7D 3LWUA 4A76A 1KIXA 1HR0W 1BCPF 4Y52H 5COYA 3DLLA 4YCVA 2R93G 4FF2A 1HNXQ 4DR7Q 3GD7A 2L11A 4UY8C 1CZGA 3CPFA 3RZDB 3I73A 5LHY1 3CQZB 2BH8A 2PZWA 2NVYB 2HDMA 2KHIA 4OO1I 1LABA 3WOEA 1AE2A 3CCSA 1OTCA 3S1QB 2F0UA 2QGQA 3A5ZB 4KV6A 5EPKA 4HJAA 1EFWA 2OQKA 4K14A 2WINB 2LY7A 1F2YA 5D3DA 2IT1A 1RJTA 5CV5A 1GOZA 4DR1L 3RNUA 4LFBQ 2WIIB 3IKJA 1LUZA 4O2DA 1DM0B 3PQIA 2PQAB 1LACA 3A0JA 2N88A 2EPBA 2L55A 3PO2B 3KF8A 4CBVA 2M00A 5I9PA 4HIMA 4AQYQ 3DXJC 3I4MG 2JJQA 1Y1WG 1PRTB 1W2BA 1FVIA 4X64L 1IZ6A 1S5BD 4I7ZC 2BA1A 3R8BA 1GD7A 2JA7G 1SN8A 3CHBD 3KFUA 3PF5A 1V1OA 2UUAL 1T5XD 1NE3A 1I50H 1U4RA 4GKJQ 1JE4A 3MFGA 2NWGA 1N33Q 3GTMB 4IOCA 1VQ8A 3I91A 4IUVA 1LTSD 4QUFA 1YIJA 4LFAL 1MD2D 4AYBG 2ZTCA 1BNZA 2A19A 2KBNA 1BXTA 3GTLH 4X6AH 5C0XJ 3NQIA 1EYGA 1SMYD 5C5LA 1AH9A 1DD2A 1SYEA 3KJOA 1SE2A 1B9MA 4A3KB 5BN3A 1C0AA 1RL2A 2VQEL 5IGCA 3HOXB 2KUMA 2RHQB 3RLFA 4QJFA 4A3JH 1D1KA 3S2DH 4NXML 1XMOQ 5IGEA 1O7IA 2N55A 1Z47A 5EAYA 1R9TB 1QOHA 1CZWA 3PUYA 2I5MX 3ZYYX 1YZ6A 4ILWA 1NAPA 2KOLA 1OXTA 1V43A 4OWXB 1EQVA 4DV4L 3FHWA 2BE5D 4K0KL 4IPDA 1CKMA 3S2HB 4A3EG 4GOPA 1HFNA 1K83B 1Y14B 1EY7A 2R93H 2RHSB 1KRSA 1CSQA 1TWFB 4DK3C 4ODGA 2IJ0A 5GQOA 1Q1EA 2GN5A 3C3LA 3HOWB 2BDNA 4U68A 3BVZA 2OTLA 4JI0Q 3J80i 2CH4A 3I8ZA 1D6EC 2PNRC 1RTOA 2H5XA 2TSSA 3W3AA 4IPCA 2NTTA 2B2VA 1TT2A 2HIXA 4KD4A 1SNPA 2EY2A 1IBKL 4CKCA 4DV0Q 2K03A 2ZJQA 4OX9L 1PLFA 2QEXA 2AWNA 4B3MQ 4QGUA 2XRQD 1HTLD 1U4PA 2MJ8A 2RA4A 3RMHA 1M4VA 4UP9A 4DKAC 1ML0D 5JEAJ 5I2YA 1TWGB 3T1YQ 1CQVA 3K5LA 4B3TQ 2A74C 5E3FA 3RLOA 1FJGQ 3S16B 2F4VQ 1FNWA 1EZ6A 2E2IH 5NUCA 4HIKA 2B63B 1Y1WH 4ZUIA 1CK1A 3QIAA 2PW5A 4H7BA 3NE5B 1EYDA 2JA7H 1WYDA 3A8KE 3L3OC 4F87A 4LFCQ 1GUGA 1D5MC 5D65A 3VA5A 5C44G 1Q3LA 1D8LA 1G2TA 1SLJA 1YNXA 2JA6G 1B3QA 3PIP3 1OO9B 2F3WA 3J80L 4HCSA 1HCZA 1OXSC 5LL6X 4BBRB 3VR4A 3NQTA 1TQOA 4QMGA 4DA2A 1RTNA 3AEVA 5M3MB 2QF7A 2N78A 1JQYD 1MJEA 2UUCL 2DY8A 3BDLA 4IO9A 3R2TA 1W6KA 2A6HC 3BG3A 1HUMA 2EYOA 5FJ8G 3VR6A 1Q12A 4R1JA 3TSSA 4LF8L 4JI5Q 3EBEA 1Q46A 1G2SA 2KEDA 3GTJB 3J7A5 2F4IA 4JI1L 5HGQA 1SJED 3URYA 4A3GB 2K5NA 2NBFA 1CQFA 4A3EH 1J5EL 2DY7A 4QIWE 1QVGA 4KKSA 5FO9B 3CCEA 4OONA 1X3GA 4NDXA 1L2FA 5C4JH 1EWHA 4PMBA 3TQYA 2EZVA 1EY8A 1XNRL 2VQFL 2JA8G 2RDHA 1X6OA 3KF6B 1JE5A 1RHPA 4I65A 1WTWA 4LF5Q 1PH4A 2B2WA 2EOTA 4QIWB 1STHA 4FDBA 5DLQE 1TY2A 5C4XB 4IUTA 4R4OA 1YHBA 2WKDA 3R3OA 1YNJC 2E8GA 1VS0A 5ELEA 2NVTH 1A3TA 4DNIA 2XWJB 1JICA 1IBMQ 2CKZB 1HRJA 1M90C 3P7JA 4JOIC 2QDLA 2QILA 1I94Q 4IFDG 4KMUC 3SK8A 2F0FA 5E1FA 4IQZA 4CDDC 1LYLA 2PMZE 2A6EC 1CHQD 2BDOA 1F9PA 4Q0FA 1N32Q 4DR7L 4C2MH 1IW7C 2A1AA 3H0GB 1B7YB 3FVQA 4M8AA 1GUWA 5C44H 4DK1A 2JA6H 3V96A 1K0SA 4FP5D 3T1HQ 1GUNA 1JCKB 3UDIA 2PMZB 3V05A 2F1MA 3R93A 3DM1A 3FMCA 1HTPA 3L0OA 4HIDA 1PVOA 4HMIA 3ITPA 2EDGA 3RZOB 1F9RA 4AIMA 3VR5A 4LFBL 3DM3A 3K8AA 4J15A 2R7FA 2K5HA 4CDCC 4KN7C 1S3OA 1I4HA 4NPSA 2VW9A 1VF7A 1X9NA 4DR6L 4ZAIA 1LTRD 1TS5A 2R61A 1VQIA 5FJ8H 1EIHA 4KHZA 2CCZA 4IUPA 1PXUA 5IE8A 5GADC 4AQYL 1A2UA 1TWAB 1WCMB 3NTKA 4XDXA 1IHZA 2F0MA 3HKSA 4LWCA 5L37A 4A3BH 5IIFA 1QUQA 2ZXRA 4DXGA 3SHLA 1GUOA 1SJHD 5IWAQ 1VCIA 2O2LD 1EY5A 3BZDB 4NW2A 5FKAC 2F0EA 4IPHA 4MNOA 4GKJL 1LO5D 3CCLA 1N33L 1KDAA 1QB5D 4ABNA 4YHHQ 1GVPA 3EROA 1FD7D 5CV6A 3KJPA 3HKZG 4XIGS 3GTPH 3J80E 2XWBB 4XQNA 2YYZA 4GN3B 2JA8H 2A69D 4POGA 3KBXA 4K8IA 3S17B 4A3DB 1KXLA 3OOCA 3A55A 1MSGA 3KF6A 3EFXD 1KQSA 1DONA 4LUOA 3FRPB 1XJVA 3HOZB 1SBBB 1SDFA 2VB2X 1L1OB 3RN5A 3E0EA 5JPMC 1WI5A 1I6VC 5K36G 1SE3A 2EYPA 2YU9H 1I5FA 4IFDH 1WTRA 1E2ZA 2K05A 1WJJA 1KDCA 3AQQA 3K81C 2GVAA 1E1OA 3FKIG 5J22A 1ZYRC 4N8FA 4XXEA 4QUCA 2IWHA 1H9MA 3HG9A 4ZRZA 3HOYG 2C5CA 5ELDA 2AQ2B 1KNEA 3TS0A 2UXBQ 4AH6A 5BR8Q 4KKTA 4BXXH 3QOJA 4MTKA 4JI0L 3T16A 2Z0SA 3FDTA 3MWYW 1J9OA 4ME5A 3KUPA 1JC7A 2NVXH 3R2IA 4IJHA 3UE1A 1NUCA 1K0RA 1HXYD 3WOFA 1PZJD 1PH1A 2OXPA 3TZUA 4LMQD 4DV0L 1GUSA 4KK7A 1HPCA 3HP3A 5CV4A 3OMGA 4DAVA 5FLXL 4K2KA 3H09A 4B3ML 3HOUG 1HR0Q 2CWAA 2K7VA 4NXNQ 3VR3A 3TRZA 5M5YH 2G9DA 2FFKB 3NENA 1N8RC 1XNQQ 3T1YL 4B3TL 1AW7A 2RCFA 2EY1A 1VQ7A 2RQXA 5TSSA 2F4VL 2R3ZA 5BN4A 2ZT9C 4JYAQ 2L15A 3T56B 1IL2A 4OELB 3RD4A 1UWVA 4OL7A 4DNTB 3CP0A 2B39A 2KQ3A 2P5ZX 3KF8B 4LFCL 5CC4A 4X66Q 3I56A 1Q1BA 4L8JA 4Q5VA 1HQRD 4LF6Q 4GZYC 4RGTA 1A3UA 2PNHA 3GTQH 3GTGH 4LJZC 4RGNA 1STEA 2VL6A 4K2LA 3OTOQ 2ALYB 3EIVA 4IFDI 1VQLA 3C1EA 4A3IG 5JOBA 3CD6A 1FGBD 4QL5A 2K28A 4GLVB 3S1NH 1EY4A 2XIWA 2HQLA 3QJYA 4RKLA 2VNUD 3LGJA 1VQ5A 2EYHA 1QZGA 1JWMD 1EL0A 3Q24A 3F2CA 3L9AX 1CT1D 2Y0SG 5CMDA 4HSVA 1BBUA 3K6OA 3K80C 4MTNA 2OF1A 4ZKCB 1D5ZC 3I4LA 3DWPA 4A3FB 5K36H 2DNCA 4JI5L 1FGUA 5I6WA 1UE7A 1DOKA 2RSNA 4A3JB 3MXUA 1SYCA 1PYBA 5CBAE 1Y1VG 5G3LD 2VUMB 2YV5A 3HOYH 4MN3A 5KNDA 2L1BA 2JEBI 1HH2P 1VQJA 3K0YA 5DNFA 1F2LA 5IYBH 1CA6A 2B8FA 2N49A 4P74A 4GOPB 3S15H 1WTQA 2R92G 2DJFC 4DV7Q 2HCCA 3P20A 4JVZA 4IZ8A 5F2DA 3D6CA 3E3XA 1N36Q 3H94A 4JOIA 2L4NA 4RWSC 4JI8L 3TP8A 5M5XH 2Z4IA 4B9WA 5H1SE 4K5XA 2R93B 1H95A 1XX8A 4C3HG 2JP1A 4EGVA 5CORA 5IYCG 1KAAA 3NHHA 3HOUH 1ZXTA 1X65A 3PMFA 3M7NA 1PTOC 1EQQA 3V2TA 4ME3A 1IBML 3A56A 3NBHA 5KIXA 2Q2IA 1R4PB 1DXMA 5C3EG 1I94L 1WD0A 1U4LA 4POFA 1ZEQX 3NTIA 5T1GA 3CCVA 3CAMA 4BY1G 5FLMG 3STBC 1GUTA 2XRSD 4WJ4A 1VQ4A 1G51A 1YJNA 1XMQQ 1N32L 1RCVD 1NR4A 1QCBD 1HNWL 4EX5A 2A68C 1MHWC 4P2CB 2EXZA 3HRZC 3SK6A 1I6HH 3F2DA 1BDOA 4RCOA 4DUYQ 4TVAB 2F0JA 4OXPA 2JA5B 2MNAA 4KHPQ 2NYZD 2E2IB 3OSOA 4AYBE 1Y1WB 4A3IH 1A3VA 4JI3Q 3KOJA 4NMZA 2JA7B 5FLXE 3TBIB 4JG2A 3I90A 2CW0D 2WB1G 3PO2G 3RUZA 3GTOB 1ESFA 1SYFA 1CI3M 2CWPA 2ZJPA 1R4QB 4AYBB 4DXFA 4TQUS 2K52A 5LMUQ 4DK6C 3AMUA 5EPLA 3G6JB 3OW2A 2NUCA 1C9OA 1EFID 1VQCA 1E22A 3A7LA 4JI4Q 2DGYA 4LW1A 4C3IG 4KHVA 3JAMc 3GDEA 4H0LC 1QNUA 4APVA 2UU9Q 1ZKOA 1PFMA 1SNDA 3HOVG 4C1NK 3TREA 3J7YW 1JB3A 5IWAL 3NPPA 5JVG3 1STYA 4H13C 2F0HA 1SMXA 1VQGA 3CCRA 1SEBD 1K8OA 2JSOA 3DMUA 5JJZA 4YHHL 2F0NA 4P75A 3RN2A 1XTCD 5M3FB 3I2ZA 5DM73 3VR2A 1W6JA 2DN8A 2JE6I 3OW7A 2F0WA 1HZBA 1JR0D 4DR2Q 2E2DC 3SK5A 3M9BA 4JBMA 4R8NA 2YTYA 3GO5A 4A3EB 2K4KA 3BVGA 3JC66 1SYDA 3EA6A 1I4GA 2UXCL 4C3HH 2F0PA 1TVXA 3K7AH 4OGQC 1PHJA 4LF9Q 4FF4A 5ISRA 2EYMA 3M7GA 1NY4A 4EQNA 2EQSA 5IYCH 2CHBD 1BCPC 5KRUA 1EOTA 1G8ZD 4G4KA 3AB9A 2WACA 1TS3A 4YCWA 4WJ3M 4WFN3 4IJLA 3CKIB 4KI0A 2ZTEA 1VDZA 5C3EH 2EY6A 1YI2A 5HURA 3BYTB 2B2YA 1IYJB 2XGTA 2R7ZG 3ICEA 4BY1H 5G3LF 5FLMH 3CRLC 3CQZH 1L0WA 3WWVA 4PMWA 3CMAA 1Z9FA 2B2UC 2NVTB 3K5MA 3PF4A 2UXBL 1PFNA 3I4OA 5BR8L 1JJ2A 4GN5A 2JEAI 4BBSG 2B8GA 3X3NA 1E2VA 3LNNA 3CXCA 1STGA 4B3SQ 4P72A 4A3MG 1KHIA 1F2ZA 4MIUA 3I4MH 4B3RQ 1DYQA 4ALPA 3U58A 2FMCA 5ELOA 1PRTD 3ERQA 5AJ3Q 1XPOA 3U9OA 4C2MB 5LMNW 1SNOA 4DUZQ 4P73A 1O7YA 4GS3A 2EVBA 4QF4A 4G7HC 1YNND 1YHQA 5C44B 3PSIA 1QNKA 2E5LQ 1B9NA 1HR0L 1C8CA 4Z9CB 4J8QA 3M4QA 4X3SA 2ES2A 2VY3A 4NXNL 4DFAA 2JA6B 1QWYA 1VQNA 2KA7A 1NJIC 4O0AA 3PUWA 1XNQL 3TN2A 4A4IA 1LTTD 1IKMA 2F52A 3TP7A 2ICIA 3Q23A 4JYAL 3EN2A 1V9PA 2CH4W 2WFWA 4RKBA 4JBKA 4C3IH 1L0YB 4DU9A 3DEOA 1P16A 3MXNB 4DV3Q 3GTKB 4A93B 4XQJA 3T13A 4BWGB 2QEJC 1VQ6A 1FNUA 3HOVH 3MZ5A 3P1HA 2WP8J 3H6MA 4IURA 4X66L 1AZQA 1XPUA 4C3JB 2HCIA 4HCEA 2MQHA 1PYWD 2Q8TA 2EJMA 3CC2A 4OIJA 4A3LG 1DJRD 2NZ1D 4BBRG 4EQ5A 1S72A 3OTOL 4LAAA 2E2HH 3K7UC 1QUQB 2EIFA 4G57A 4L5RC 2LMCB 4GNXC 3S14H 4A3BB 1Y8NB 1CKNB 1GXDC 4BA1I 4K5VA 1FYCA 5E7NA 5JVH3 3WDNA 2HIVA 1CUKA 1T5EA 2HT1A 1VMPA 2IY5B 2SEBD 2AQ1B 3CU7A 4XT1B 3J81c 2KENA 3MHBA 4DV2Q 4P71A 3GTPB 4N9PA 2JA8B 3ULLA 2JQOA 5IY0A 4A3GG 3IFTA 4JI2Q 4DR5L 4JW0A 3UDFA 3NXWA 2QCPX 2K1BA 1X3EA 1P8LA 1K83H 1SE8A 2MPMA 4H02A 5IT9c 3PIO3 5GAEC 4EQPA 3EJIA 1TWCH 4JC0A 1LT5D 3VYTA 1MBYA 2R7ZH 4CJ2C 3TP6A 2NVQH 2OEOA 5D14A 5IGFA 4LF7Q 1BQQT 2IX3A 1XYIA 3AYHB 2E76C 3HZXA 2TMPA 1SFOH 2LSSA 1NBWA 1BCPB 2KECA 2L0CA 4BBSH 1PTOH 2YU9B 4OHJA 1F77A 3I3CA 2FXQA 2X69A 5M9OA 1QJOA 3I55A 3F2UA 2D0PA 4CJ1B 5BN5A 3QR8A 4A3MH 1RDPD 2N8NA 2ZXPA 4DV7L 1Q8KA 4UP7A 1UUPA 2QW7A 3PV0A 4BA2I 1XXGA 1N36L 1U0LA 3H3VI 3OMCA 1Y8OB 2E74C 1HNXL 3W1BA 4IFDJ 1WTHA 3N6RA 1OXUA 5ELCA 4S3SA 3ZJYC 3D3RA 2K5QA 4JPBW 1EWCA 4DK0A 4Y7NH 3S16H 4JI6Q 2F3VA 2NVXB 3GP7A 3Q0AA 3TZDA 1GO3E 1PH8A 5EBCA 3U9SA 3CRKC 3F8TA 1G291 1PYSB 3W5OA 3TEHB 3NWTA 4DN4M 1YJWA 4O42A 2PI2E 2ICEC 4YCUA 1EWIA 4X62Q 1CM9A 1JWSD 1XMQL 2F0DA 4N9TA 3MXNA 1Y8PB 1GJXA 5M5YB 1E3PA 3UDXA 3T4AC 3H91A 3QWNA 2EE1A 2WAQG 4DUYL 4BS9A 1AZPA 4A3LH 1TY0A 3DEPA 4V190 1LTID 1A2TA 4BBRH 5CGKA 3CCUA 2IHEA 3KYHC 5KNBA 4KHPL 1AE3A 3LX0A 3HKZE 2I0QA 2UUAQ 1O7LA 2ZTDA 1PRTF 2NN6I 4JI3L 5CYUA 1KABA 3E9HA 1CKNA 4LFAQ 4X3TA 5EQ0A 1HJPA 4PV1C 5FO8B 3GTQB 4CJ0B 3GTGB 4DPGA 3VYSA 2CVRA 2ASBA 1VMCA 3HKZB 2ZM6Q 3S1RH 4JI7Q 5LMUL 5DEHA 3DWAA 3K0XA 2EYJA 1D2BA 1CHPD 2VQEQ 1K9MC 1JB7A 3S1NB 2MP1A 4A3GH 4K8JA 4JI4L 5KEEA 4RFBA 2RCNA 1S5ED 2I07B 2KCNA 1LTGD 4RMFA 1H9SA 3FPPA 2Q2HA 3FEWX 2I5LX 1SMYC 3QG1A 4R4QA 3KLWA 4X3KA 3PGZA 1XPRA 1XMOL 1NCVA 2K50A 1HNZQ 3VYUA 4ID6A 3M4OH 4C1NI 4IUNA 3HS0C 3I4NG 4RA8A 2NTSA 2SNSA 1PA6A 4DR2L 1BBXC 2Q2UA 5M5WH 1UEAB 1K8GA 3HOZG 2LFNA 3ND9A 2MHVA 3PIPA 4DR4Q 1LT3D 4DV5Q 3PO3G 2XSCA 3NK9A 2KCMA 5JPNC 2FJ2A 1E2WA 3D4DA 5A2QE 1EZ8A 5CV7A 2PCFB 1Y69U 3HOYB 2J4XA 2E2JB 1TKWB 4LF9L 4IALA 3RR5A 2BE5C 3G7LA 1EIFA 5E4XA 1IYUA 1N34Q 4HIOA 4LF4Q 2DNEA 3K59A 4C56C 2LKVA 3FP9A 3C1FA 2B2UA 2DUDA 3S15B 3FPUB 2I46A 3I70A 4X65Q 3Q6SA 1EEID 1PH7A 5M5XB 3F1ZA 1SNMA 1PH6A 3S24A 1HA5A 2AUJD 4HMJA 4HJ7A 3NBIA 3J7ZC 1GM5A 2K04A 2B2VC 1KLUD 4JV5Q 3NBHB 1YJ9A 3PUVA 1JJGA 1ILPA 2F0OA 3D31A 3ULPA 1E1TA 3P75A 1JORA 4UHVA 5J3BA 5K5PA 1JWUD 4EQOA 4B3SL 1FJGL 4ZCKA 1ASZA 4GLAC 3GV3A 4RG1A 1BF4A 4B3RL 4HSPA 4J1MA 1B3AA 1EIGA 4ZYSA 2A5HA 1TIID 1ESRA 2PI2A 3DHQA 1Z6HA 1K3RA 4DUZL 2O5IC 1CKOA 2F0GA 3T53B 2N3SA 2KVMA 2VS1A 1EEFD 4X3UA 1I6HB 4LUVA 5EPJA 2E5LL 3VYRA 5DAUA 5IGBA 2F0SA 4KY6A 4DV6Q 3IL8A 1FNVA 1LT6D 4HJ8A 1S5CD 1IKLA 2F0LA 2Y0SE 2A6HD 4FO2A 4A3IB 3C46A 2A73B 1ICWA 3QO2A 4LUZA 2Z6KC 2I5HA 3G71A 1CFMA 3M3YH 3CPWA 2VZAA 3H3VC 4DAYA 4DV3L 4G7OC 1I50B 3SDZA 1K8MA 4KD3A 4R4IA 1VQDA 2H1EA 3U4VA 3U4ZA 1EY9A 1OXVA 1VQOA 2Y0SB 1L0XB 2AMCB 1K28A 3GTLB 4XYQA 2KCCA 4CGYB 1MSHA 5DM63 3S17H 4BY7G 2Q8IB 4MHEA 1A62A 3VA7A 1HZAA 1EU4A 4MZ9A 2Q8RE 3E6ZX 3D0FA 3LWEA 2D5DA 4FF1A 5T1IA 1STNA 3I4NH 1J6QA 1EQRA 2KJXA 1H9JA 2F0KA 1HZCA 5I4DA 3HOZH 1TWHH 3CC7A 3S2DB 3FKIH 1I4RA 3PO3H 2IL8A 4DGZA 4L5SA 1T9HA 4IN3A 2ZXOA 4N8X1 4KTAA 3G48A 1XNRQ 2VQFQ 3KLSX 4KN4C 1QVFA 4WORA 3QOLA 4A3FG 4DV2L 1YNJD 2HD3A 3DUZA 3OWFA 5KGUA 3A5UA 1C4QA 3IFDA 3JAMi 4PZ6A 1WTXA 2AHOB 3KLSA 4LF5L 1PH9A 2AKWB 2KEEA 3MFYA 1Q82C 1ENCA 3S1MH 1C7YA 5IODA 2VUMG 4TSSA 2CQOA 5C4HA 2NZHA 4C3HB 1A15A 1V1PB 1B53A 3K7AB 3PUXA 4DV1Q 4HR7B 2A6ED 4HEDA 2UXDQ 4LF7L 3M85A 1KNAA 1O78A 2V4DA 5IOCA 2MO1A 2J7ZA 4O1NA 1KLGD 2K14A 1B50A 3KDFA 4DF7A 3E9IA 1BR9A 4DAMA 5C3EB 2GA4B 1B4OA 1MJCA 2X6GA 5JJLA 4HJ9A 4GKKQ 4BY1B 1JT8A 1OXXK 1EYCA 2BCOA 1GKHA 3QB3A 1BO0A 1E0BA 2OWOA 2IW3A 3MXPA 2F03A 1G6PA 1B1ZA 2WB1E 5KYIA 5JAVA 2HHHQ 4YWMA 1MI2A 1VQHA 4JI6L 2L5TA 4XTCS 3T1HL 1CA5A 4UPAA 5J39A 3I4MB 4FNFA 4IOAA 3JAML 1I3QH 4DAPA 3M4PA 3NWSA 2L12A 3A74A 3J81j 5EKLA 2D2CC 4CHTB 4DR6Q 1D1IA 1UE1A 2C9OA 4X62L 2V1CC 2WB1B 4OEMB 5FOBB 2KHSA 4L63B 2JA5G 2G9HD 1C48A 3SR1A 1KD1C 4XYOA 3TP5A 1U4MA 5LMNQ 3ER0A 1QE6A 5FK9C 3L2PA 1DOLA 1GHKA 1I4PA 5HGTA 3CCMA 4RHSA 4BY7H 2RBMA 2D62A 1IBLQ 1A8VA 1WTOA 4C3IB 1MKHA 5IP7G 4QCLA 5C0XG 3HFZB 1WOCA 4JK1C 3HOVB 2O5JC 3K58A 1X3QA 2OCEA 2NB0A 5A35A 4RH6A 4YWLA 1A6XA 1Y1VH 1QZHA 5C4ZA 1VQAA 3HEJA 2F0QA 4F8MA 2E2HB 2B2TC 4A3KG 4A3FH 2ZM6L 4B9XA 4JI7L 1VQFA 4FVMA 3NSWA 4NP5A 3S14B 4RGMA 1NTGA 1WTPA 3HOXG 1F9SA 4K5WA 2R92H 3K5NA 2JXMB 4DR3Q 2BA0A 2Z9HA 1M1KC 2VUMH 1RKNA 3G4SA 1X3FA 2K5VA 2A69C 2MUYA 5CV8A 1ET9A 1TR5A 5C4JB 4XQQA 4IPGA 5M3FG 1ZYRD 3O13A 4KJOA 1V1PA 3CF5A 1HNZL 2EY5A 1LT4D 1TXYA 3K5OA 2F0IA 2YTXA 1A63A 2VB3X 5KYLA 5E4WC 1YITA 2X6LA 1X54A 1XTDA 4M1UB 3J7AV 1TWCB 2NN6G 1DZ1A 2K33A 1B8AA 4DR4L 1N9WA 2R7ZB 4DV5L 3RZDH 2BOSA 5C3WA 2MFIA 2NVQB 3J81i 2JN4A 1X55A 3HOWG 4GN4B 4YIJA 2D9UA 2NVYH 2Z1CA 3CW2C 5IP9G 2M9VA 4K6LA 1SFOB 1QILA 3S1QH 4TRDA 3AFPA 4BBSB 4R9WA 1N34L 4LF4L 1PTOB 1EQTA 3Q22A 1S5FD 1S5DD 3ULJA 1TS4A 2SNMA 3AU7A 4A3MB 1Q7YC 4X65L 4F88A 1VQEA 2G5DA 5JEAG 2JA9A 2UUBQ 2M2LA 1MGSA 4PNYA 1F2MA 1B2TA 2HDLA 4LK1C 1YHAA 1YEZA 1PH5A 1KTKA 3B6YA 2HUGA 3D6WA 5C6AA 3BZCA 2PQAA 3PO2H 1W3SA 2F3IA 2FINB 3S9WA 4JV5L 3BDOA 1JOOA 4RHRA 2JA5H 1BBWA 1E24A 4Y7NB 2VXWA 5CBEE 1SAPA 4IUQA 2B63G 3BYYB 4CDFC 2Q2TA 1O80A 3MA2B 5IP7H 1NNXA 1J8IA 5C0XH 3TDQA 3GTOH 3E0JA 5ELBA 3GTMH 3H3VH 1I4QA 3M4YA 4YY3Q 2Z6KA 4PQXA 1U5KA 2B29A 3J81L 3X3MA 4HJ5A 4FF3A 4LF6L 1STAA 3KLRA 3DWQA 4JBWA 1HQMC 1NMGA 4DV6L 1NR2A 2OQ0A 4KY7A 3CCQA 4A3KH 2RDFA 3MC0B 3JAME 3BZKA 4A93G 4KJNA 5M3MG 4IUUA 5EJWA 5IT9L 2AUKA 3HOXH 4RGOS 4JCVE 3D4RA 3BVMA
chains in the Genus database with same CATH topology
1SYBA 4C3JG 2IX1A 2O4XA 5A2QL 4ZUJA 3C2PA 1WTVA 1EYAA 3S1RB 5LL6S 1H9SB 1SSOA 4QB4A 4FYDA 5FO7B 5ELFA 1KDBA 3T51B 1WD1A 4U673 2NN6H 1STBA 3GQBA 5KNCA 1QG7A 2E75C 3M4OB 1H9KA 4TKOB 1PTOD 5M5WB 3MTSA 1XWEA 5C0XI 3W2DA 5JEAH 3GV6A 2Z4HA 2F0TA 3MXGA 2ID0A 3SE0A 1X32A 1UNSA 1SXTA 4V0BA 1CTMA 4FXKC 1BUVT 2A68D 4HTHA 2EYFA 2IPKD 5EGTA 1LV9A 3OHXC 2EYLA 3NP8A 1AFPA 5I2XA 1JOQA 2RDGA 1FR3A 5C3XA 2J0TD 3PUZA 1RF2D 1Q90A 1H9RA 2ENBA 2WAQB 2LS01 1SYGA 2K32A 4KY5A 2PZUA 3A8JE 4NKLA 2IX0A 4F7XA 1V8QA 1G6ZA 2K01A 1WVLA 1PZKD 1GHJA 1AP0A 5I9OA 5EKKA 5IGDA 4FXGC 3UI2A 3KK7A 1JOKA 3SK4A 2CW0C 1HUNA 2PZTA 4R8IA 4ULLA 2B2TA 4ZK9B 1DOMA 1AEXA 5CR3A 3M3YB 2EJGC 3SEBA 3J81E 4KKUA 1ENAA 4OO1G 4UDUC 1HA6A 2FHTA 1EU3A 1IYVA 1Z7TA 2JYOA 2RVLA 2EJFC 2MGSA 5AFWA 5D3IB 5IGGA 3I4NB 1BCPD 5IT9E 1ENFA 2RSOA 1II3A 1SE4A 2F0VA 1BOSA 1TWHB 3FKIB 4EVOA 4CKEA 3PO3B 1DCZA 2QKIC 3E5SA 3MAQA 1PDQA 2XVSA 2PO4A 4ZKBB 4UAIA 3IAYA 3KBGA 3BDCA 5CV9A 2SOBA 4FXDA 4WJWA 3S1MB 3D4WA 4HN7A 3D8GA 1LLRD 3BS1A 1B44D 4ZLTF 1S4ZA 3A8IE 4ZQ3A 5I6YA 3HOUB 1O7ZA 1LTAD 2B2YC 3K57A 3HGBA 2K5DA 1PTOF 1SNCA 3TMEA 1VF5C 4RCNA 2AQ3B 4J6HA 2XNAC 4DNRB 1HHVA 1F9QA 2PPBC 2QDBA 2FMMA 3NTHA 2Z8LA 5C5MA 1RD9D 4XT3B 2H4OA 1PRTC 3SVMA 1EY6A 4HAEA 1I4XA 1YNNC 5EKIA 2OT2A 1I3QB 1RODA 2PQEA 1D5XC 4H44C 4OIKA 3SXHA 4WRDA 2SDFA 1ILQA 3OPOA 1TU2B 4B08A 4L6TB 1NSNS 3I72A 2R6GA 4PMCA 4CKBA 3OIQA 4OO1H 2CQAA 1TS2A 1M8AA 3J7AF 4RAUC 3EQLC 1PZID 2RKSA 2PYKA 4BY7B 3OWEB 1ONLA 1G91A 3N52A 4E6IA 1AN8A 2PW7A 1ET6A 4G7ZC 3ND8A 2K6AA 2XN9C 1PFBA 3ONAB 3A7AB 1Y1VB 5J1ZA 1SNQA 3NUCA 2HQEA 1Q8IA 1LTBD 3OIPA 3MEHA 3MVVA 1HFGA 3A54A 2R92B 2AWOA 1IL8A 1PMRA 4K6DA 1EY0A 3EVQA 2WV6D 1X3PA 3L7ZC 2L9HA 1UAPA 2B2WC 5EBDA 1U9RA 2WKCA 2K5WA 1IW7D 3LWUA 1BCPF 5COYA 4FF2A 3GD7A 2L11A 1CZGA 3RZDB 3I73A 5LHY1 3CQZB 2PZWA 2NVYB 2HDMA 4OO1I 1LABA 3WOEA 3S1QB 2F0UA 5EPKA 4KV6A 4K14A 2WINB 2LY7A 1F2YA 5D3DA 2IT1A 1RJTA 5CV5A 1GOZA 2WIIB 3IKJA 1DM0B 1LACA 2N88A 2EPBA 2L55A 3PO2B 3KF8A 4CBVA 2M00A 5I9PA 3DXJC 1PRTB 1S5BD 4I7ZC 2BA1A 3R8BA 3CHBD 1V1OA 1T5XD 1U4RA 1JE4A 3MFGA 2NWGA 3GTMB 3I91A 4IUVA 1LTSD 4QUFA 1MD2D 1BNZA 1BXTA 5C0XJ 3NQIA 1SMYD 5C5LA 1DD2A 1SYEA 1SE2A 1B9MA 4A3KB 5BN3A 5IGCA 3HOXB 2KUMA 3RLFA 1D1KA 5IGEA 2N55A 1Z47A 1R9TB 1QOHA 1CZWA 3PUYA 3ZYYX 4ILWA 1NAPA 2KOLA 1OXTA 1V43A 1EQVA 2BE5D 3S2HB 1HFNA 1K83B 1EY7A 1TWFB 4ODGA 2IJ0A 1Q1EA 3C3LA 3HOWB 2BDNA 4U68A 3BVZA 3I8ZA 1D6EC 2PNRC 1RTOA 2TSSA 3W3AA 2NTTA 2B2VA 1TT2A 4KD4A 1SNPA 2EY2A 4CKCA 2K03A 1PLFA 2AWNA 2XRQD 1HTLD 1U4PA 2MJ8A 2RA4A 3RMHA 1M4VA 1ML0D 5JEAJ 5I2YA 1TWGB 1CQVA 3K5LA 2A74C 5E3FA 3S16B 1FNWA 1EZ6A 5NUCA 2B63B 4ZUIA 1CK1A 3QIAA 2PW5A 4H7BA 3NE5B 1EYDA 3A8KE 4F87A 3L3OC 1GUGA 1D5MC 5D65A 3VA5A 1Q3LA 1G2TA 3PIP3 1OO9B 2F3WA 3J80L 4HCSA 1HCZA 1OXSC 5LL6X 4BBRB 3VR4A 3NQTA 1TQOA 4QMGA 4DA2A 1RTNA 5M3MB 2QF7A 1JQYD 2DY8A 3BDLA 3R2TA 1W6KA 2A6HC 3BG3A 1HUMA 2EYOA 3VR6A 1Q12A 3TSSA 1G2SA 2KEDA 3GTJB 2F4IA 1SJED 3URYA 4A3GB 2NBFA 1CQFA 2DY7A 4KKSA 5FO9B 4NDXA 1EWHA 4PMBA 2EZVA 1EY8A 2RDHA 1RHPA 4I65A 1WTWA 2B2WA 2EOTA 4QIWB 1STHA 1TY2A 5C4XB 4IUTA 2WKDA 3R3OA 1YNJC 5ELEA 1A3TA 2XWJB 1JICA 1HRJA 3P7JA 2QILA 4IFDG 4KMUC 3SK8A 2F0FA 5E1FA 4IQZA 2A6EC 1CHQD 2BDOA 1F9PA 4Q0FA 1IW7C 3H0GB 3FVQA 4M8AA 1GUWA 4DK1A 3V96A 4FP5D 1GUNA 1JCKB 2PMZB 3V05A 2F1MA 3R93A 3DM1A 3FMCA 1HTPA 4HMIA 3ITPA 2EDGA 3RZOB 1F9RA 3VR5A 4KN7C 1I4HA 1VF7A 4ZAIA 1LTRD 1TS5A 2R61A 1EIHA 4KHZA 4IUPA 1PXUA 1A2UA 1TWAB 1WCMB 3NTKA 4XDXA 1IHZA 2F0MA 5IIFA 2ZXRA 4DXGA 3SHLA 1GUOA 1SJHD 1VCIA 2O2LD 1EY5A 3BZDB 4NW2A 5FKAC 2F0EA 1LO5D 1KDAA 1QB5D 4ABNA 3EROA 1FD7D 5CV6A 4XIGS 3J80E 2XWBB 4XQNA 2YYZA 2A69D 3KBXA 4K8IA 3S17B 4A3DB 3OOCA 3A55A 1MSGA 3EFXD 1DONA 3FRPB 3HOZB 1SBBB 1SDFA 2VB2X 5JPMC 1I6VC 5K36G 1SE3A 2EYPA 4IFDH 1WTRA 1E2ZA 2K05A 1KDCA 5J22A 1ZYRC 4XXEA 4QUCA 2IWHA 1H9MA 3HG9A 4ZRZA 2C5CA 5ELDA 2AQ2B 1KNEA 4KKTA 3QOJA 3T16A 3FDTA 3MWYW 1J9OA 4ME5A 3KUPA 1JC7A 3R2IA 1NUCA 1HXYD 3WOFA 1PZJD 2OXPA 3TZUA 4LMQD 1GUSA 4KK7A 1HPCA 3HP3A 5CV4A 3OMGA 4DAVA 5FLXL 4K2KA 3H09A 2K7VA 3VR3A 2G9DA 2FFKB 1AW7A 2EY1A 2RQXA 5TSSA 2R3ZA 5BN4A 2ZT9C 3T56B 3RD4A 4OL7A 4DNTB 2B39A 2KQ3A 5CC4A 1Q1BA 4L8JA 4Q5VA 1HQRD 4GZYC 4RGTA 1A3UA 4LJZC 4RGNA 1STEA 4K2LA 4IFDI 3C1EA 5JOBA 1FGBD 2K28A 1EY4A 2XIWA 3QJYA 4RKLA 2VNUD 2EYHA 1JWMD 1EL0A 3Q24A 3L9AX 1CT1D 5CMDA 4HSVA 3K6OA 2OF1A 4ZKCB 1D5ZC 3I4LA 3DWPA 4A3FB 5K36H 2DNCA 5I6WA 1DOKA 2RSNA 4A3JB 3MXUA 1SYCA 5CBAE 5G3LD 2VUMB 4MN3A 5KNDA 2L1BA 2JEBI 3K0YA 5DNFA 1F2LA 1CA6A 2B8FA 1WTQA 2HCCA 3P20A 5F2DA 4IZ8A 3D6CA 3H94A 4RWSC 2L4NA 3TP8A 2Z4IA 4B9WA 4K5XA 2R93B 1XX8A 4C3HG 2JP1A 4EGVA 5CORA 1KAAA 3NHHA 1ZXTA 3PMFA 3M7NA 1PTOC 3V2TA 3A56A 3NBHA 5KIXA 1R4PB 1DXMA 1WD0A 1U4LA 1ZEQX 3NTIA 5T1GA 1GUTA 2XRSD 1RCVD 1NR4A 1QCBD 2A68C 4P2CB 2EXZA 3HRZC 3SK6A 1BDOA 4RCOA 2F0JA 2JA5B 2NYZD 2E2IB 3OSOA 1Y1WB 1A3VA 4NMZA 2JA7B 5FLXE 3TBIB 3I90A 2CW0D 3RUZA 3GTOB 1ESFA 1SYFA 1CI3M 1R4QB 4AYBB 4DXFA 4TQUS 3AMUA 5EPLA 3G6JB 2NUCA 1EFID 3A7LA 4C3IG 4KHVA 4H0LC 1QNUA 1ZKOA 1PFMA 1SNDA 4C1NK 3J7YW 1JB3A 3NPPA 5JVG3 1STYA 4H13C 2F0HA 1SEBD 1K8OA 2JSOA 3DMUA 5JJZA 2F0NA 1XTCD 5M3FB 5DM73 3VR2A 1W6JA 2DN8A 2JE6I 3OW7A 2F0WA 1JR0D 2E2DC 3SK5A 4R8NA 3GO5A 4A3EB 3BVGA 1SYDA 3EA6A 1I4GA 2F0PA 1TVXA 4OGQC 4FF4A 5ISRA 2EYMA 3M7GA 4EQNA 2CHBD 1BCPC 5KRUA 1EOTA 1G8ZD 4G4KA 3AB9A 2WACA 1TS3A 4WFN3 3CKIB 4KI0A 1VDZA 2EY6A 5HURA 3BYTB 2B2YA 5G3LF 3CRLC 4PMWA 2B2UC 2NVTB 3K5MA 1PFNA 2JEAI 2B8GA 3X3NA 1E2VA 3LNNA 1STGA 1F2ZA 4MIUA 1DYQA 2FMCA 1PRTD 3ERQA 3U9OA 4C2MB 1SNOA 1O7YA 2EVBA 4QF4A 4G7HC 1YNND 5C44B 1QNKA 1B9NA 1C8CA 4Z9CB 4J8QA 4X3SA 4DFAA 2JA6B 1QWYA 2KA7A 3PUWA 3TN2A 1LTTD 1IKMA 3TP7A 2ICIA 3Q23A 4RKBA 4DU9A 1L0YB 3DEOA 3GTKB 4A93B 4XQJA 3T13A 4BWGB 2QEJC 1FNUA 3MZ5A 3P1HA 2WP8J 3H6MA 4IURA 1AZQA 4C3JB 2HCIA 4HCEA 1PYWD 2Q8TA 2EJMA 4OIJA 1DJRD 2NZ1D 4LAAA 4G57A 2LMCB 4A3BB 1Y8NB 1GXDC 4BA1I 4K5VA 1FYCA 5JVH3 3WDNA 1T5EA 1VMPA 2SEBD 2AQ1B 3CU7A 4XT1B 3MHBA 3GTPB 4N9PA 2JA8B 3IFTA 3NXWA 2QCPX 2K1BA 2MPMA 3PIO3 4EQPA 3EJIA 1LT5D 3VYTA 1MBYA 4CJ2C 3TP6A 2OEOA 5D14A 5IGFA 1BQQT 2IX3A 1XYIA 2E76C 3HZXA 2TMPA 1BCPB 2KECA 2L0CA 1PTOH 2YU9B 4OHJA 1F77A 3I3CA 5M9OA 2X69A 1QJOA 3F2UA 4CJ1B 5BN5A 1RDPD 2ZXPA 1UUPA 3PV0A 4BA2I 1XXGA 3OMCA 1Y8OB 2E74C 4IFDJ 3N6RA 1OXUA 5ELCA 4S3SA 3D3RA 2K5QA 1EWCA 4DK0A 2F3VA 2NVXB 3GP7A 3Q0AA 3TZDA 5EBCA 3U9SA 3CRKC 1G291 3NWTA 4DN4M 4O42A 2ICEC 1CM9A 1JWSD 2F0DA 4N9TA 3MXNA 1Y8PB 1GJXA 5M5YB 3T4AC 3H91A 3QWNA 2EE1A 4BS9A 1AZPA 1TY0A 3DEPA 4V190 1LTID 1A2TA 5CGKA 5KNBA 3LX0A 1O7LA 1PRTF 2NN6I 5CYUA 1KABA 4X3TA 5EQ0A 4PV1C 5FO8B 3GTQB 4CJ0B 3GTGB 3VYSA 2CVRA 1VMCA 3HKZB 5DEHA 3DWAA 2EYJA 1D2BA 1CHPD 3S1NB 2MP1A 4K8JA 5KEEA 4RFBA 1S5ED 2I07B 2KCNA 1LTGD 1H9SA 3FPPA 3FEWX 1SMYC 3QG1A 4X3KA 1NCVA 3VYUA 4ID6A 4C1NI 4IUNA 3HS0C 4RA8A 2NTSA 2SNSA 1BBXC 1UEAB 2LFNA 3ND9A 2MHVA 1LT3D 2XSCA 3NK9A 5JPNC 2FJ2A 1E2WA 3D4DA 5A2QE 1EZ8A 5CV7A 2PCFB 1Y69U 3HOYB 2J4XA 2E2JB 1TKWB 4IALA 2BE5C 3G7LA 5E4XA 1IYUA 2DNEA 3K59A 4C56C 2LKVA 3C1FA 2B2UA 3S15B 3FPUB 2I46A 3I70A 3Q6SA 1EEID 5M5XB 1SNMA 1HA5A 2AUJD 4HMJA 3NBIA 2K04A 2B2VC 1KLUD 3PUVA 1ILPA 2F0OA 3D31A 1JORA 3P75A 5K5PA 1JWUD 4EQOA 3GV3A 1BF4A 4HSPA 4J1MA 1B3AA 1EIGA 4ZYSA 2A5HA 1TIID 1ESRA 3DHQA 1Z6HA 2O5IC 2F0GA 3T53B 2KVMA 1EEFD 4X3UA 1I6HB 5EPJA 3VYRA 5DAUA 5IGBA 2F0SA 4KY6A 3IL8A 1FNVA 1LT6D 1S5CD 1IKLA 2F0LA 2A6HD 4FO2A 4A3IB 3C46A 2A73B 1ICWA 3QO2A 1CFMA 3H3VC 4DAYA 4G7OC 1I50B 3SDZA 1K8MA 4KD3A 2H1EA 1EY9A 1OXVA 2Y0SB 1L0XB 3GTLB 4XYQA 2KCCA 4CGYB 1MSHA 5DM63 2Q8IB 4MHEA 3VA7A 1EU4A 2Q8RE 3E6ZX 3LWEA 2D5DA 4FF1A 5T1IA 1STNA 2KJXA 1H9JA 2F0KA 5I4DA 3S2DB 1I4RA 2IL8A 4DGZA 4IN3A 2ZXOA 4KTAA 3KLSX 4KN4C 4WORA 3QOLA 1YNJD 3DUZA 3OWFA 5KGUA 1C4QA 3IFDA 1WTXA 3KLSA 2KEEA 3MFYA 1ENCA 5IODA 4TSSA 5C4HA 4C3HB 1A15A 1V1PB 1B53A 3K7AB 3PUXA 4HR7B 2A6ED 4HEDA 3M85A 1KNAA 1O78A 2V4DA 5IOCA 2J7ZA 4O1NA 1KLGD 1B50A 4DF7A 1BR9A 5C3EB 2GA4B 1B4OA 2X6GA 4BY1B 1OXXK 1EYCA 2BCOA 3QB3A 1BO0A 1E0BA 2IW3A 3MXPA 2F03A 1B1ZA 5KYIA 5JAVA 1MI2A 2L5TA 4XTCS 3I4MB 1CA5A 5J39A 4FNFA 3JAML 4DAPA 3NWSA 2L12A 5EKLA 2D2CC 4CHTB 1D1IA 2C9OA 2WB1B 5FOBB 2KHSA 4L63B 2G9HD 1C48A 3SR1A 4XYOA 3TP5A 1U4MA 1QE6A 5FK9C 1DOLA 1GHKA 1I4PA 5HGTA 4RHSA 2RBMA 2D62A 1WTOA 4C3IB 4QCLA 5C0XG 3HOVB 4JK1C 2O5JC 3K58A 1X3QA 2NB0A 5A35A 4RH6A 1A6XA 5C4ZA 3HEJA 2F0QA 4F8MA 2E2HB 2B2TC 4B9XA 4FVMA 3NSWA 4NP5A 3S14B 4RGMA 1WTPA 1F9SA 4K5WA 3K5NA 2JXMB 2BA0A 1RKNA 2A69C 2MUYA 5CV8A 1ET9A 1TR5A 5C4JB 4XQQA 1ZYRD 3O13A 4KJOA 1V1PA 2EY5A 1LT4D 3K5OA 2F0IA 2VB3X 5KYLA 5E4WC 2X6LA 4M1UB 3J7AV 1TWCB 2NN6G 1DZ1A 2K33A 2R7ZB 2BOSA 5C3WA 2NVQB 4YIJA 2D9UA 2Z1CA 2M9VA 4K6LA 1SFOB 1QILA 4TRDA 4BBSB 4R9WA 1PTOB 1EQTA 3Q22A 1S5FD 1S5DD 1TS4A 2SNMA 3AU7A 4A3MB 4F88A 5JEAG 2M2LA 1MGSA 4PNYA 1F2MA 1B2TA 2HDLA 4LK1C 1KTKA 2HUGA 3D6WA 5C6AA 2FINB 3S9WA 3BDOA 1JOOA 4RHRA 4Y7NB 2VXWA 5CBEE 1SAPA 4IUQA 3BYYB 1O80A 3MA2B 1J8IA 5C0XH 3TDQA 3E0JA 5ELBA 1I4QA 3M4YA 4PQXA 3J81L 3X3MA 4FF3A 1STAA 3KLRA 3DWQA 4JBWA 1HQMC 1NR2A 4KY7A 2RDFA 3MC0B 3JAME 4KJNA 4IUUA 5EJWA 5IT9L 2AUKA 4RGOS 3D4RA 3BVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVM A;  2X6G A;  1IL8 A;  1EL0 A;  4X3U A;  1F9P A;  5EPJ A;  1O7Z A;  2MP1 A;  4CJ2 C;  2B2Y C;  5CMD A;  1WTV A;  1X3P A;  4HSV A;  5D14 A;  3IL8 A;  1WTR A;  2K05 A;  5E4W C;  1G6Z A;  2K01 A;  1GUW A;  2KUM A;  2L9H A;  3I90 A;  4HCS A;  1BO0 A;  1E0B A;  1WVL A;  1IKL A;  1XYI A;  2X6L A;  4ZKC B;  2B2W C;  1AP0 A;  2N55 A;  1DZ1 A;  2KEC A;  4QUC A;  4X3K A;  1ICW A;  3QO2 A;  1NCV A;  1HHV A;  3I3C A;  1F9Q A;  1RTN A;  2X69 A;  1SSO A;  1KNE A;  1MI2 A;  3UI2 A;  2FMM A;  1O7Y A;  3F2U A;  3R93 A;  3DM1 A;  4CJ1 B;  5COY A;  2D9U A;  1NAP A;  1DOK A;  2KOL A;  1CA5 A;  5EPL A;  2DY8 A;  1QNK A;  2RSN A;  1WD1 A;  5CBA E;  1C8C A;  4X3S A;  2L11 A;  1HUN A;  3FDT A;  3MWY W;  4R9W A;  2H1E A;  1J9O A;  4R8I A;  4RA8 A;  1HUM A;  3KUP A;  1EQT A;  4MN3 A;  4XT3 B;  2B2T A;  1F9R A;  4ZK9 B;  2L12 A;  1BBX C;  2L1B A;  1DOM A;  1PFM A;  1QG7 A;  3SVM A;  1HFN A;  5DNF A;  2HDM A;  1MSH A;  3TN2 A;  4HAE A;  1F2L A;  4MHE A;  1CA6 A;  4LMQ D;  1IKM A;  1G2S A;  2KED A;  2Q8R E;  3HP3 A;  5EKI A;  3LWE A;  1ROD A;  4ZAI A;  2FJ2 A;  2M2L A;  1MGS A;  5T1I A;  1WTQ A;  1B2T A;  5EPK A;  3DEO A;  2HDL A;  1U4M A;  1EIH A;  5JJZ A;  4IUP A;  2HCC A;  4OIK A;  3TZD A;  2HUG A;  1QE6 A;  2SDF A;  3D6W A;  2BDN A;  1DOL A;  2FHT A;  3MTS A;  2L4N A;  3G7L A;  1ILQ A;  4RWS C;  4U68 A;  4XDX A;  2DY7 A;  5E4X A;  3I8Z A;  4IUR A;  2FIN B;  1AZQ A;  1XX8 A;  1RJT A;  2JYO A;  2JP1 A;  3GV6 A;  1RTO A;  2RVL A;  2HCI A;  2IL8 A;  5COR A;  2FFK B;  2MGS A;  5AFW A;  2B2U A;  2Q8T A;  4DN4 M;  1WTO A;  3FPU B;  2VXW A;  2B2V A;  1SAP A;  4O42 A;  4OIJ A;  5CBE E;  4IUQ A;  4NW2 A;  1CM9 A;  1M8A A;  2NZ1 D;  1X32 A;  2N88 A;  2RSO A;  3Q6S A;  2K03 A;  4RAU C;  2R3Z A;  1ZXT A;  1RHP A;  2EPB A;  1X3Q A;  1PLF A;  1O80 A;  1WTW A;  1G91 A;  1TVX A;  3N52 A;  3IFD A;  1WTX A;  3H91 A;  2EE1 A;  2B2W A;  2K04 A;  1J8I A;  2EOT A;  1AZP A;  1PDQ A;  1U4P A;  2B2V C;  2MJ8 A;  2RA4 A;  3DEP A;  2B2T C;  2KEE A;  1WD0 A;  4ZKB B;  1U4L A;  4UAI A;  1LV9 A;  3KBX A;  4IUT A;  1ML0 D;  5T1G A;  1EOT A;  1ILP A;  1VMP A;  1PFB A;  3ONA B;  1A15 A;  1B53 A;  1MSG A;  1WTP A;  4XT1 B;  1F9S A;  1DON A;  1NR4 A;  4HED A;  1U4R A;  1NR2 A;  1JE4 A;  4X3T A;  1JIC A;  2NWG A;  1KNA A;  5EQ0 A;  3GV3 A;  1BF4 A;  1HRJ A;  2K28 A;  2B2Y A;  3I91 A;  4IUV A;  3P7J A;  2J7Z A;  4QUF A;  1B3A A;  1EIG A;  4CJ0 B;  1HFG A;  1SDF A;  1B50 A;  1BNZ A;  4IUU A;  4ZLT F;  5EJW A;  2XIW A;  2CVR A;  1HA6 A;  1ESR A;  1S4Z A;  2K1B A;  5D65 A;  1VMC A;  2MPM A;  2B2U C;  1Q3L A;  1PFN A;  2NYZ D;  1G2T A;  1B4O A; 
#chains in the Genus database with same CATH topology
 1SYB A;  2KCT A;  4C3J G;  1ICF B;  2IX1 A;  1R9T H;  2O4X A;  5A2Q L;  4ZUJ A;  3C2P A;  3W1G A;  1WTV A;  1VQM A;  2BH2 A;  1EYA A;  5M3F H;  3S1R B;  1PH3 A;  3J80 c;  4A3B G;  1NMF A;  5LL6 S;  3UDG A;  1H9S B;  1SSO A;  4QB4 A;  4FYD A;  1SRO A;  1PFS A;  4L5T A;  5FO7 B;  3S2H H;  5ELF A;  2RF4 A;  1KDB A;  4KLK A;  3T51 B;  1WD1 A;  4U67 3;  1TWF H;  2B3G A;  2NN6 H;  5GAG C;  1L1O C;  1STB A;  3GQB A;  1CSP A;  5KNC A;  1QG7 A;  3HOW H;  2E75 C;  3M4O B;  5IP9 H;  3Q8D A;  1H9K A;  4TKO B;  4JI8 Q;  3NEM A;  1PTO D;  5M5W B;  3MTS A;  5C4X G;  1XWE A;  5C0X I;  2NZO A;  3W2D A;  1YVC A;  5JEA H;  3GV6 A;  2Z4H A;  2F0T A;  3MXG A;  1SR3 A;  2ID0 A;  3SE0 A;  1UE6 A;  2MO0 A;  4DV1 L;  1X32 A;  3STB D;  2UXD L;  1UNS A;  1TWG H;  1SXT A;  1YBY A;  4V0B A;  1CTM A;  3F2B A;  4FXK C;  5GRO A;  1K8A C;  1BUV T;  2A68 D;  1BKB A;  4HTH A;  3G6E A;  1RIP A;  2EYF A;  2B63 H;  2IPK D;  5EGT A;  1K73 C;  4DR1 Q;  1LV9 A;  2WAQ E;  3OHX C;  2EYL A;  3NP8 A;  4PZ7 A;  1AFP A;  3H0G G;  5I2X A;  1HNW Q;  1JOQ A;  4GKK L;  4BXX G;  2RDG A;  1FR3 A;  5C3X A;  2J0T D;  4PZ8 A;  3PUZ A;  1A0I A;  1RF2 D;  1Q90 A;  4I7A A;  1H9R A;  2ENB A;  4X64 Q;  3IRB A;  2WAQ B;  2HHH L;  3AFQ A;  2LS0 1;  1SYG A;  2K32 A;  4KY5 A;  2PZU A;  3A8J E;  4NKL A;  2IX0 A;  4UP8 A;  4A75 A;  3GTK H;  4A93 H;  4F7X A;  4OWW B;  5M3M H;  1V8Q A;  1G6Z A;  2K01 A;  1HZ9 A;  1WVL A;  1PZK D;  1GHJ A;  1B70 B;  4C3J H;  1AP0 A;  3RLN A;  3OYY A;  5I9O A;  4QQB X;  5EKK A;  5IGD A;  1BVS A;  4FXG C;  3UI2 A;  2ATW A;  1WCM G;  3KK7 A;  3CCJ A;  1JOK A;  5LMN L;  4R4T A;  2KHJ A;  3SK4 A;  3GTJ H;  2CW0 C;  1HUN A;  2IHF A;  2PZT A;  2CFM A;  1VQP A;  4DAY B;  4R8I A;  4ULL A;  4GNX B;  2B2T A;  4ZK9 B;  1IBL L;  3TS2 A;  1DOM A;  1AEX A;  5CR3 A;  4NXM Q;  3M3Y B;  2Z6B A;  5GAH C;  3NEL A;  2UU9 L;  1KL9 A;  2EJG C;  3SEB A;  3J81 E;  4KKU A;  1ENA A;  1EIY B;  4OO1 G;  4UDU C;  1HA6 A;  4GLX A;  2FHT A;  2EXD A;  1FL0 A;  1V1Q A;  1EU3 A;  4DV4 Q;  1IYV A;  4A3D G;  4A3C G;  1K3B C;  1Z7T A;  2JYO A;  4R4C A;  2RVL A;  2EJF C;  4K0K Q;  2MGS A;  5AFW A;  5D3I B;  5IGG A;  1KRT A;  3I4N B;  1BCP D;  5IT9 E;  1MIU A;  2DJG C;  1ENF A;  3H15 A;  2RSO A;  2UXC Q;  1II3 A;  1SE4 A;  5C4X H;  1VQK A;  2F0V A;  1BOS A;  1TWH B;  4DR3 L;  3FKI B;  4EVO A;  1UE5 A;  4CKE A;  5IYD G;  4LNQ A;  3PO3 B;  1DCZ A;  2QKI C;  2GVB A;  3E5S A;  3MAQ A;  4YWK A;  1PDQ A;  1KC8 C;  5JJK A;  2XVS A;  2PO4 A;  1X56 A;  4ZKB B;  4UAI A;  1ASY A;  3IAY A;  4GOP C;  3KBG A;  3BDC A;  3VDY A;  5CV9 A;  5ELN A;  3U50 C;  1VQB A;  3SGI A;  1IBK Q;  1KAW A;  2SOB A;  1PH2 A;  2YTV A;  4OX9 Q;  4FXD A;  4WJW A;  3S1M B;  1QVC A;  1JMC A;  3D4W A;  2LXK A;  4HN7 A;  3D8G A;  1LLR D;  3BS1 A;  3ERS X;  1B44 D;  4ZLT F;  3H0G H;  1LM0 A;  2OTJ A;  1S4Z A;  3A8I E;  4ZQ3 A;  5IYB G;  5I6Y A;  1EUJ A;  3HOU B;  3KDF B;  3MEF A;  1O7Z A;  1LTA D;  2D0O A;  2B2Y C;  3K57 A;  3HGB A;  3I7F A;  1JJC B;  2K5D A;  1PTO F;  1SNC A;  3TME A;  1VF5 C;  4RCN A;  2AQ3 B;  4J6H A;  2XNA C;  4DNR B;  1HHV A;  3RZO H;  1F9Q A;  2PPB C;  2UUB L;  2QDB A;  1Q81 C;  2FMM A;  5AJ3 L;  3NTH A;  2Z8L A;  4L5Q A;  3CC4 A;  5C5M A;  1Q86 C;  3PIO A;  1RD9 D;  4XT3 B;  2H4O A;  1PRT C;  4PG3 A;  3BJU A;  1TWA H;  1WCM H;  3SVM A;  1EY6 A;  4HAE A;  1I4X A;  2ZJR A;  1YNN C;  5EKI A;  2OT2 A;  1D7Q A;  1I3Q B;  1ROD A;  2XTI A;  2PQE A;  1D5X C;  2UUC Q;  4H44 C;  4OIK A;  2JK8 A;  5FLX c;  4WRD A;  2SDF A;  3SXH A;  4JBJ A;  1ILQ A;  4GNX A;  3OPO A;  3PCO B;  1TU2 B;  4B08 A;  4L6T B;  1DGS A;  4YY3 L;  1NSN S;  3I72 A;  2R6G A;  4PMC A;  4LF8 Q;  1WFQ A;  2K75 A;  3OIQ A;  1UEB A;  4CKB A;  4OO1 H;  2CQA A;  1TS2 A;  1M8A A;  3J7A F;  4RAU C;  2A8V A;  3EQL C;  4JI1 Q;  1PZI D;  2RKS A;  2PYK A;  4A3D H;  4A3C H;  3OWE B;  4BY7 B;  1ONL A;  1G91 A;  3N52 A;  4NB3 A;  3UE0 A;  4E6I A;  1E7Z A;  3CME A;  1J5E Q;  1AN8 A;  2PW7 A;  1ET6 A;  1IXR A;  1EOV A;  4G7Z C;  3ND8 A;  2K6A A;  2XN9 C;  1PV4 A;  1PFB A;  3ONA B;  5IYD H;  3A7A B;  1Y1V B;  5J1Z A;  1SNQ A;  3NUC A;  2HQE A;  4CDE C;  1Q8I A;  1LTB D;  1L1O A;  3OIP A;  4DR5 Q;  3MEH A;  1SRU A;  3BU2 A;  3MVV A;  1S40 A;  2LXJ A;  1HFG A;  1VQ9 A;  3A54 A;  5HY6 A;  5JJI A;  2R92 B;  4JI2 L;  4A3J G;  2QA4 A;  2AWO A;  1LTL A;  1IL8 A;  1PMR A;  4K6D A;  1EY0 A;  4QY7 A;  2R7D A;  3EVQ A;  4OWT B;  2WV6 D;  1X3P A;  2E2J H;  3L7Z C;  2L9H A;  1UAP A;  2B2W C;  5EBD A;  2C35 B;  1U9R A;  2WKC A;  2K5W A;  1IW7 D;  3LWU A;  4A76 A;  1KIX A;  1HR0 W;  1BCP F;  4Y52 H;  5COY A;  3DLL A;  4YCV A;  2R93 G;  4FF2 A;  1HNX Q;  4DR7 Q;  3GD7 A;  2L11 A;  4UY8 C;  1CZG A;  3CPF A;  3RZD B;  3I73 A;  5LHY 1;  3CQZ B;  2BH8 A;  2PZW A;  2NVY B;  2HDM A;  2KHI A;  4OO1 I;  1LAB A;  3WOE A;  1AE2 A;  3CCS A;  1OTC A;  3S1Q B;  2F0U A;  2QGQ A;  3A5Z B;  4KV6 A;  5EPK A;  4HJA A;  1EFW A;  2OQK A;  4K14 A;  2WIN B;  2LY7 A;  1F2Y A;  5D3D A;  2IT1 A;  1RJT A;  5CV5 A;  1GOZ A;  4DR1 L;  3RNU A;  4LFB Q;  2WII B;  3IKJ A;  1LUZ A;  4O2D A;  1DM0 B;  3PQI A;  2PQA B;  1LAC A;  3A0J A;  2N88 A;  2EPB A;  2L55 A;  3PO2 B;  3KF8 A;  4CBV A;  2M00 A;  5I9P A;  4HIM A;  4AQY Q;  3DXJ C;  3I4M G;  2JJQ A;  1Y1W G;  1PRT B;  1W2B A;  1FVI A;  4X64 L;  1IZ6 A;  1S5B D;  4I7Z C;  2BA1 A;  3R8B A;  1GD7 A;  2JA7 G;  1SN8 A;  3CHB D;  3KFU A;  3PF5 A;  1V1O A;  2UUA L;  1T5X D;  1NE3 A;  1I50 H;  1U4R A;  4GKJ Q;  1JE4 A;  3MFG A;  2NWG A;  1N33 Q;  3GTM B;  4IOC A;  1VQ8 A;  3I91 A;  4IUV A;  1LTS D;  4QUF A;  1YIJ A;  4LFA L;  1MD2 D;  4AYB G;  2ZTC A;  1BNZ A;  2A19 A;  2KBN A;  1BXT A;  3GTL H;  4X6A H;  5C0X J;  3NQI A;  1EYG A;  1SMY D;  5C5L A;  1AH9 A;  1DD2 A;  1SYE A;  3KJO A;  1SE2 A;  1B9M A;  4A3K B;  5BN3 A;  1C0A A;  1RL2 A;  2VQE L;  5IGC A;  3HOX B;  2KUM A;  2RHQ B;  3RLF A;  4QJF A;  4A3J H;  1D1K A;  3S2D H;  4NXM L;  1XMO Q;  5IGE A;  1O7I A;  2N55 A;  1Z47 A;  5EAY A;  1R9T B;  1QOH A;  1CZW A;  3PUY A;  2I5M X;  3ZYY X;  1YZ6 A;  4ILW A;  1NAP A;  2KOL A;  1OXT A;  1V43 A;  4OWX B;  1EQV A;  4DV4 L;  3FHW A;  2BE5 D;  4K0K L;  4IPD A;  1CKM A;  3S2H B;  4A3E G;  4GOP A;  1HFN A;  1K83 B;  1Y14 B;  1EY7 A;  2R93 H;  2RHS B;  1KRS A;  1CSQ A;  1TWF B;  4DK3 C;  4ODG A;  2IJ0 A;  5GQO A;  1Q1E A;  2GN5 A;  3C3L A;  3HOW B;  2BDN A;  4U68 A;  3BVZ A;  2OTL A;  4JI0 Q;  3J80 i;  2CH4 A;  3I8Z A;  1D6E C;  2PNR C;  1RTO A;  2H5X A;  2TSS A;  3W3A A;  4IPC A;  2NTT A;  2B2V A;  1TT2 A;  2HIX A;  4KD4 A;  1SNP A;  2EY2 A;  1IBK L;  4CKC A;  4DV0 Q;  2K03 A;  2ZJQ A;  4OX9 L;  1PLF A;  2QEX A;  2AWN A;  4B3M Q;  4QGU A;  2XRQ D;  1HTL D;  1U4P A;  2MJ8 A;  2RA4 A;  3RMH A;  1M4V A;  4UP9 A;  4DKA C;  1ML0 D;  5JEA J;  5I2Y A;  1TWG B;  3T1Y Q;  1CQV A;  3K5L A;  4B3T Q;  2A74 C;  5E3F A;  3RLO A;  1FJG Q;  3S16 B;  2F4V Q;  1FNW A;  1EZ6 A;  2E2I H;  5NUC A;  4HIK A;  2B63 B;  1Y1W H;  4ZUI A;  1CK1 A;  3QIA A;  2PW5 A;  4H7B A;  3NE5 B;  1EYD A;  2JA7 H;  1WYD A;  3A8K E;  3L3O C;  4F87 A;  4LFC Q;  1GUG A;  1D5M C;  5D65 A;  3VA5 A;  5C44 G;  1Q3L A;  1D8L A;  1G2T A;  1SLJ A;  1YNX A;  2JA6 G;  1B3Q A;  3PIP 3;  1OO9 B;  2F3W A;  3J80 L;  4HCS A;  1HCZ A;  1OXS C;  5LL6 X;  4BBR B;  3VR4 A;  3NQT A;  1TQO A;  4QMG A;  4DA2 A;  1RTN A;  3AEV A;  5M3M B;  2QF7 A;  2N78 A;  1JQY D;  1MJE A;  2UUC L;  2DY8 A;  3BDL A;  4IO9 A;  3R2T A;  1W6K A;  2A6H C;  3BG3 A;  1HUM A;  2EYO A;  5FJ8 G;  3VR6 A;  1Q12 A;  4R1J A;  3TSS A;  4LF8 L;  4JI5 Q;  3EBE A;  1Q46 A;  1G2S A;  2KED A;  3GTJ B;  3J7A 5;  2F4I A;  4JI1 L;  5HGQ A;  1SJE D;  3URY A;  4A3G B;  2K5N A;  2NBF A;  1CQF A;  4A3E H;  1J5E L;  2DY7 A;  4QIW E;  1QVG A;  4KKS A;  5FO9 B;  3CCE A;  4OON A;  1X3G A;  4NDX A;  1L2F A;  5C4J H;  1EWH A;  4PMB A;  3TQY A;  2EZV A;  1EY8 A;  1XNR L;  2VQF L;  2JA8 G;  2RDH A;  1X6O A;  3KF6 B;  1JE5 A;  1RHP A;  4I65 A;  1WTW A;  4LF5 Q;  1PH4 A;  2B2W A;  2EOT A;  4QIW B;  1STH A;  4FDB A;  5DLQ E;  1TY2 A;  5C4X B;  4IUT A;  4R4O A;  1YHB A;  2WKD A;  3R3O A;  1YNJ C;  2E8G A;  1VS0 A;  5ELE A;  2NVT H;  1A3T A;  4DNI A;  2XWJ B;  1JIC A;  1IBM Q;  2CKZ B;  1HRJ A;  1M90 C;  3P7J A;  4JOI C;  2QDL A;  2QIL A;  1I94 Q;  4IFD G;  4KMU C;  3SK8 A;  2F0F A;  5E1F A;  4IQZ A;  4CDD C;  1LYL A;  2PMZ E;  2A6E C;  1CHQ D;  2BDO A;  1F9P A;  4Q0F A;  1N32 Q;  4DR7 L;  4C2M H;  1IW7 C;  2A1A A;  3H0G B;  1B7Y B;  3FVQ A;  4M8A A;  1GUW A;  5C44 H;  4DK1 A;  2JA6 H;  3V96 A;  1K0S A;  4FP5 D;  3T1H Q;  1GUN A;  1JCK B;  3UDI A;  2PMZ B;  3V05 A;  2F1M A;  3R93 A;  3DM1 A;  3FMC A;  1HTP A;  3L0O A;  4HID A;  1PVO A;  4HMI A;  3ITP A;  2EDG A;  3RZO B;  1F9R A;  4AIM A;  3VR5 A;  4LFB L;  3DM3 A;  3K8A A;  4J15 A;  2R7F A;  2K5H A;  4CDC C;  4KN7 C;  1S3O A;  1I4H A;  4NPS A;  2VW9 A;  1VF7 A;  1X9N A;  4DR6 L;  4ZAI A;  1LTR D;  1TS5 A;  2R61 A;  1VQI A;  5FJ8 H;  1EIH A;  4KHZ A;  2CCZ A;  4IUP A;  1PXU A;  5IE8 A;  5GAD C;  4AQY L;  1A2U A;  1TWA B;  1WCM B;  3NTK A;  4XDX A;  1IHZ A;  2F0M A;  3HKS A;  4LWC A;  5L37 A;  4A3B H;  5IIF A;  1QUQ A;  2ZXR A;  4DXG A;  3SHL A;  1GUO A;  1SJH D;  5IWA Q;  1VCI A;  2O2L D;  1EY5 A;  3BZD B;  4NW2 A;  5FKA C;  2F0E A;  4IPH A;  4MNO A;  4GKJ L;  1LO5 D;  3CCL A;  1N33 L;  1KDA A;  1QB5 D;  4ABN A;  4YHH Q;  1GVP A;  3ERO A;  1FD7 D;  5CV6 A;  3KJP A;  3HKZ G;  4XIG S;  3GTP H;  3J80 E;  2XWB B;  4XQN A;  2YYZ A;  4GN3 B;  2JA8 H;  2A69 D;  4POG A;  3KBX A;  4K8I A;  3S17 B;  4A3D B;  1KXL A;  3OOC A;  3A55 A;  1MSG A;  3KF6 A;  3EFX D;  1KQS A;  1DON A;  4LUO A;  3FRP B;  1XJV A;  3HOZ B;  1SBB B;  1SDF A;  2VB2 X;  1L1O B;  3RN5 A;  3E0E A;  5JPM C;  1WI5 A;  1I6V C;  5K36 G;  1SE3 A;  2EYP A;  2YU9 H;  1I5F A;  4IFD H;  1WTR A;  1E2Z A;  2K05 A;  1WJJ A;  1KDC A;  3AQQ A;  3K81 C;  2GVA A;  1E1O A;  3FKI G;  5J22 A;  1ZYR C;  4N8F A;  4XXE A;  4QUC A;  2IWH A;  1H9M A;  3HG9 A;  4ZRZ A;  3HOY G;  2C5C A;  5ELD A;  2AQ2 B;  1KNE A;  3TS0 A;  2UXB Q;  4AH6 A;  5BR8 Q;  4KKT A;  4BXX H;  3QOJ A;  4MTK A;  4JI0 L;  3T16 A;  2Z0S A;  3FDT A;  3MWY W;  1J9O A;  4ME5 A;  3KUP A;  1JC7 A;  2NVX H;  3R2I A;  4IJH A;  3UE1 A;  1NUC A;  1K0R A;  1HXY D;  3WOF A;  1PZJ D;  1PH1 A;  2OXP A;  3TZU A;  4LMQ D;  4DV0 L;  1GUS A;  4KK7 A;  1HPC A;  3HP3 A;  5CV4 A;  3OMG A;  4DAV A;  5FLX L;  4K2K A;  3H09 A;  4B3M L;  3HOU G;  1HR0 Q;  2CWA A;  2K7V A;  4NXN Q;  3VR3 A;  3TRZ A;  5M5Y H;  2G9D A;  2FFK B;  3NEN A;  1N8R C;  1XNQ Q;  3T1Y L;  4B3T L;  1AW7 A;  2RCF A;  2EY1 A;  1VQ7 A;  2RQX A;  5TSS A;  2F4V L;  2R3Z A;  5BN4 A;  2ZT9 C;  4JYA Q;  2L15 A;  3T56 B;  1IL2 A;  4OEL B;  3RD4 A;  1UWV A;  4OL7 A;  4DNT B;  3CP0 A;  2B39 A;  2KQ3 A;  2P5Z X;  3KF8 B;  4LFC L;  5CC4 A;  4X66 Q;  3I56 A;  1Q1B A;  4L8J A;  4Q5V A;  1HQR D;  4LF6 Q;  4GZY C;  4RGT A;  1A3U A;  2PNH A;  3GTQ H;  3GTG H;  4LJZ C;  4RGN A;  1STE A;  2VL6 A;  4K2L A;  3OTO Q;  2ALY B;  3EIV A;  4IFD I;  1VQL A;  3C1E A;  4A3I G;  5JOB A;  3CD6 A;  1FGB D;  4QL5 A;  2K28 A;  4GLV B;  3S1N H;  1EY4 A;  2XIW A;  2HQL A;  3QJY A;  4RKL A;  2VNU D;  3LGJ A;  1VQ5 A;  2EYH A;  1QZG A;  1JWM D;  1EL0 A;  3Q24 A;  3F2C A;  3L9A X;  1CT1 D;  2Y0S G;  5CMD A;  4HSV A;  1BBU A;  3K6O A;  3K80 C;  4MTN A;  2OF1 A;  4ZKC B;  1D5Z C;  3I4L A;  3DWP A;  4A3F B;  5K36 H;  2DNC A;  4JI5 L;  1FGU A;  5I6W A;  1UE7 A;  1DOK A;  2RSN A;  4A3J B;  3MXU A;  1SYC A;  1PYB A;  5CBA E;  1Y1V G;  5G3L D;  2VUM B;  2YV5 A;  3HOY H;  4MN3 A;  5KND A;  2L1B A;  2JEB I;  1HH2 P;  1VQJ A;  3K0Y A;  5DNF A;  1F2L A;  5IYB H;  1CA6 A;  2B8F A;  2N49 A;  4P74 A;  4GOP B;  3S15 H;  1WTQ A;  2R92 G;  2DJF C;  4DV7 Q;  2HCC A;  3P20 A;  4JVZ A;  4IZ8 A;  5F2D A;  3D6C A;  3E3X A;  1N36 Q;  3H94 A;  4JOI A;  2L4N A;  4RWS C;  4JI8 L;  3TP8 A;  5M5X H;  2Z4I A;  4B9W A;  5H1S E;  4K5X A;  2R93 B;  1H95 A;  1XX8 A;  4C3H G;  2JP1 A;  4EGV A;  5COR A;  5IYC G;  1KAA A;  3NHH A;  3HOU H;  1ZXT A;  1X65 A;  3PMF A;  3M7N A;  1PTO C;  1EQQ A;  3V2T A;  4ME3 A;  1IBM L;  3A56 A;  3NBH A;  5KIX A;  2Q2I A;  1R4P B;  1DXM A;  5C3E G;  1I94 L;  1WD0 A;  1U4L A;  4POF A;  1ZEQ X;  3NTI A;  5T1G A;  3CCV A;  3CAM A;  4BY1 G;  5FLM G;  3STB C;  1GUT A;  2XRS D;  4WJ4 A;  1VQ4 A;  1G51 A;  1YJN A;  1XMQ Q;  1N32 L;  1RCV D;  1NR4 A;  1QCB D;  1HNW L;  4EX5 A;  2A68 C;  1MHW C;  4P2C B;  2EXZ A;  3HRZ C;  3SK6 A;  1I6H H;  3F2D A;  1BDO A;  4RCO A;  4DUY Q;  4TVA B;  2F0J A;  4OXP A;  2JA5 B;  2MNA A;  4KHP Q;  2NYZ D;  2E2I B;  3OSO A;  4AYB E;  1Y1W B;  4A3I H;  1A3V A;  4JI3 Q;  3KOJ A;  4NMZ A;  2JA7 B;  5FLX E;  3TBI B;  4JG2 A;  3I90 A;  2CW0 D;  2WB1 G;  3PO2 G;  3RUZ A;  3GTO B;  1ESF A;  1SYF A;  1CI3 M;  2CWP A;  2ZJP A;  1R4Q B;  4AYB B;  4DXF A;  4TQU S;  2K52 A;  5LMU Q;  4DK6 C;  3AMU A;  5EPL A;  3G6J B;  3OW2 A;  2NUC A;  1C9O A;  1EFI D;  1VQC A;  1E22 A;  3A7L A;  4JI4 Q;  2DGY A;  4LW1 A;  4C3I G;  4KHV A;  3JAM c;  3GDE A;  4H0L C;  1QNU A;  4APV A;  2UU9 Q;  1ZKO A;  1PFM A;  1SND A;  3HOV G;  4C1N K;  3TRE A;  3J7Y W;  1JB3 A;  5IWA L;  3NPP A;  5JVG 3;  1STY A;  4H13 C;  2F0H A;  1SMX A;  1VQG A;  3CCR A;  1SEB D;  1K8O A;  2JSO A;  3DMU A;  5JJZ A;  4YHH L;  2F0N A;  4P75 A;  3RN2 A;  1XTC D;  5M3F B;  3I2Z A;  5DM7 3;  3VR2 A;  1W6J A;  2DN8 A;  2JE6 I;  3OW7 A;  2F0W A;  1HZB A;  1JR0 D;  4DR2 Q;  2E2D C;  3SK5 A;  3M9B A;  4JBM A;  4R8N A;  2YTY A;  3GO5 A;  4A3E B;  2K4K A;  3BVG A;  3JC6 6;  1SYD A;  3EA6 A;  1I4G A;  2UXC L;  4C3H H;  2F0P A;  1TVX A;  3K7A H;  4OGQ C;  1PHJ A;  4LF9 Q;  4FF4 A;  5ISR A;  2EYM A;  3M7G A;  1NY4 A;  4EQN A;  2EQS A;  5IYC H;  2CHB D;  1BCP C;  5KRU A;  1EOT A;  1G8Z D;  4G4K A;  3AB9 A;  2WAC A;  1TS3 A;  4YCW A;  4WJ3 M;  4WFN 3;  4IJL A;  3CKI B;  4KI0 A;  2ZTE A;  1VDZ A;  5C3E H;  2EY6 A;  1YI2 A;  5HUR A;  3BYT B;  2B2Y A;  1IYJ B;  2XGT A;  2R7Z G;  3ICE A;  4BY1 H;  5G3L F;  5FLM H;  3CRL C;  3CQZ H;  1L0W A;  3WWV A;  4PMW A;  3CMA A;  1Z9F A;  2B2U C;  2NVT B;  3K5M A;  3PF4 A;  2UXB L;  1PFN A;  3I4O A;  5BR8 L;  1JJ2 A;  4GN5 A;  2JEA I;  4BBS G;  2B8G A;  3X3N A;  1E2V A;  3LNN A;  3CXC A;  1STG A;  4B3S Q;  4P72 A;  4A3M G;  1KHI A;  1F2Z A;  4MIU A;  3I4M H;  4B3R Q;  1DYQ A;  4ALP A;  3U58 A;  2FMC A;  5ELO A;  1PRT D;  3ERQ A;  5AJ3 Q;  1XPO A;  3U9O A;  4C2M B;  5LMN W;  1SNO A;  4DUZ Q;  4P73 A;  1O7Y A;  4GS3 A;  2EVB A;  4QF4 A;  4G7H C;  1YNN D;  1YHQ A;  5C44 B;  3PSI A;  1QNK A;  2E5L Q;  1B9N A;  1HR0 L;  1C8C A;  4Z9C B;  4J8Q A;  3M4Q A;  4X3S A;  2ES2 A;  2VY3 A;  4NXN L;  4DFA A;  2JA6 B;  1QWY A;  1VQN A;  2KA7 A;  1NJI C;  4O0A A;  3PUW A;  1XNQ L;  3TN2 A;  4A4I A;  1LTT D;  1IKM A;  2F52 A;  3TP7 A;  2ICI A;  3Q23 A;  4JYA L;  3EN2 A;  1V9P A;  2CH4 W;  2WFW A;  4RKB A;  4JBK A;  4C3I H;  1L0Y B;  4DU9 A;  3DEO A;  1P16 A;  3MXN B;  4DV3 Q;  3GTK B;  4A93 B;  4XQJ A;  3T13 A;  4BWG B;  2QEJ C;  1VQ6 A;  1FNU A;  3HOV H;  3MZ5 A;  3P1H A;  2WP8 J;  3H6M A;  4IUR A;  4X66 L;  1AZQ A;  1XPU A;  4C3J B;  2HCI A;  4HCE A;  2MQH A;  1PYW D;  2Q8T A;  2EJM A;  3CC2 A;  4OIJ A;  4A3L G;  1DJR D;  2NZ1 D;  4BBR G;  4EQ5 A;  1S72 A;  3OTO L;  4LAA A;  2E2H H;  3K7U C;  1QUQ B;  2EIF A;  4G57 A;  4L5R C;  2LMC B;  4GNX C;  3S14 H;  4A3B B;  1Y8N B;  1CKN B;  1GXD C;  4BA1 I;  4K5V A;  1FYC A;  5E7N A;  5JVH 3;  3WDN A;  2HIV A;  1CUK A;  1T5E A;  2HT1 A;  1VMP A;  2IY5 B;  2SEB D;  2AQ1 B;  3CU7 A;  4XT1 B;  3J81 c;  2KEN A;  3MHB A;  4DV2 Q;  4P71 A;  3GTP B;  4N9P A;  2JA8 B;  3ULL A;  2JQO A;  5IY0 A;  4A3G G;  3IFT A;  4JI2 Q;  4DR5 L;  4JW0 A;  3UDF A;  3NXW A;  2QCP X;  2K1B A;  1X3E A;  1P8L A;  1K83 H;  1SE8 A;  2MPM A;  4H02 A;  5IT9 c;  3PIO 3;  5GAE C;  4EQP A;  3EJI A;  1TWC H;  4JC0 A;  1LT5 D;  3VYT A;  1MBY A;  2R7Z H;  4CJ2 C;  3TP6 A;  2NVQ H;  2OEO A;  5D14 A;  5IGF A;  4LF7 Q;  1BQQ T;  2IX3 A;  1XYI A;  3AYH B;  2E76 C;  3HZX A;  2TMP A;  1SFO H;  2LSS A;  1NBW A;  1BCP B;  2KEC A;  2L0C A;  4BBS H;  1PTO H;  2YU9 B;  4OHJ A;  1F77 A;  3I3C A;  2FXQ A;  2X69 A;  5M9O A;  1QJO A;  3I55 A;  3F2U A;  2D0P A;  4CJ1 B;  5BN5 A;  3QR8 A;  4A3M H;  1RDP D;  2N8N A;  2ZXP A;  4DV7 L;  1Q8K A;  4UP7 A;  1UUP A;  2QW7 A;  3PV0 A;  4BA2 I;  1XXG A;  1N36 L;  1U0L A;  3H3V I;  3OMC A;  1Y8O B;  2E74 C;  1HNX L;  3W1B A;  4IFD J;  1WTH A;  3N6R A;  1OXU A;  5ELC A;  4S3S A;  3ZJY C;  3D3R A;  2K5Q A;  4JPB W;  1EWC A;  4DK0 A;  4Y7N H;  3S16 H;  4JI6 Q;  2F3V A;  2NVX B;  3GP7 A;  3Q0A A;  3TZD A;  1GO3 E;  1PH8 A;  5EBC A;  3U9S A;  3CRK C;  3F8T A;  1G29 1;  1PYS B;  3W5O A;  3TEH B;  3NWT A;  4DN4 M;  1YJW A;  4O42 A;  2PI2 E;  2ICE C;  4YCU A;  1EWI A;  4X62 Q;  1CM9 A;  1JWS D;  1XMQ L;  2F0D A;  4N9T A;  3MXN A;  1Y8P B;  1GJX A;  5M5Y B;  1E3P A;  3UDX A;  3T4A C;  3H91 A;  3QWN A;  2EE1 A;  2WAQ G;  4DUY L;  4BS9 A;  1AZP A;  4A3L H;  1TY0 A;  3DEP A;  4V19 0;  1LTI D;  1A2T A;  4BBR H;  5CGK A;  3CCU A;  2IHE A;  3KYH C;  5KNB A;  4KHP L;  1AE3 A;  3LX0 A;  3HKZ E;  2I0Q A;  2UUA Q;  1O7L A;  2ZTD A;  1PRT F;  2NN6 I;  4JI3 L;  5CYU A;  1KAB A;  3E9H A;  1CKN A;  4LFA Q;  4X3T A;  5EQ0 A;  1HJP A;  4PV1 C;  5FO8 B;  3GTQ B;  4CJ0 B;  3GTG B;  4DPG A;  3VYS A;  2CVR A;  2ASB A;  1VMC A;  3HKZ B;  2ZM6 Q;  3S1R H;  4JI7 Q;  5LMU L;  5DEH A;  3DWA A;  3K0X A;  2EYJ A;  1D2B A;  1CHP D;  2VQE Q;  1K9M C;  1JB7 A;  3S1N B;  2MP1 A;  4A3G H;  4K8J A;  4JI4 L;  5KEE A;  4RFB A;  2RCN A;  1S5E D;  2I07 B;  2KCN A;  1LTG D;  4RMF A;  1H9S A;  3FPP A;  2Q2H A;  3FEW X;  2I5L X;  1SMY C;  3QG1 A;  4R4Q A;  3KLW A;  4X3K A;  3PGZ A;  1XPR A;  1XMO L;  1NCV A;  2K50 A;  1HNZ Q;  3VYU A;  4ID6 A;  3M4O H;  4C1N I;  4IUN A;  3HS0 C;  3I4N G;  4RA8 A;  2NTS A;  2SNS A;  1PA6 A;  4DR2 L;  1BBX C;  2Q2U A;  5M5W H;  1UEA B;  1K8G A;  3HOZ G;  2LFN A;  3ND9 A;  2MHV A;  3PIP A;  4DR4 Q;  1LT3 D;  4DV5 Q;  3PO3 G;  2XSC A;  3NK9 A;  2KCM A;  5JPN C;  2FJ2 A;  1E2W A;  3D4D A;  5A2Q E;  1EZ8 A;  5CV7 A;  2PCF B;  1Y69 U;  3HOY B;  2J4X A;  2E2J B;  1TKW B;  4LF9 L;  4IAL A;  3RR5 A;  2BE5 C;  3G7L A;  1EIF A;  5E4X A;  1IYU A;  1N34 Q;  4HIO A;  4LF4 Q;  2DNE A;  3K59 A;  4C56 C;  2LKV A;  3FP9 A;  3C1F A;  2B2U A;  2DUD A;  3S15 B;  3FPU B;  2I46 A;  3I70 A;  4X65 Q;  3Q6S A;  1EEI D;  1PH7 A;  5M5X B;  3F1Z A;  1SNM A;  1PH6 A;  3S24 A;  1HA5 A;  2AUJ D;  4HMJ A;  4HJ7 A;  3NBI A;  3J7Z C;  1GM5 A;  2K04 A;  2B2V C;  1KLU D;  4JV5 Q;  3NBH B;  1YJ9 A;  3PUV A;  1JJG A;  1ILP A;  2F0O A;  3D31 A;  3ULP A;  1E1T A;  3P75 A;  1JOR A;  4UHV A;  5J3B A;  5K5P A;  1JWU D;  4EQO A;  4B3S L;  1FJG L;  4ZCK A;  1ASZ A;  4GLA C;  3GV3 A;  4RG1 A;  1BF4 A;  4B3R L;  4HSP A;  4J1M A;  1B3A A;  1EIG A;  4ZYS A;  2A5H A;  1TII D;  1ESR A;  2PI2 A;  3DHQ A;  1Z6H A;  1K3R A;  4DUZ L;  2O5I C;  1CKO A;  2F0G A;  3T53 B;  2N3S A;  2KVM A;  2VS1 A;  1EEF D;  4X3U A;  1I6H B;  4LUV A;  5EPJ A;  2E5L L;  3VYR A;  5DAU A;  5IGB A;  2F0S A;  4KY6 A;  4DV6 Q;  3IL8 A;  1FNV A;  1LT6 D;  4HJ8 A;  1S5C D;  1IKL A;  2F0L A;  2Y0S E;  2A6H D;  4FO2 A;  4A3I B;  3C46 A;  2A73 B;  1ICW A;  3QO2 A;  4LUZ A;  2Z6K C;  2I5H A;  3G71 A;  1CFM A;  3M3Y H;  3CPW A;  2VZA A;  3H3V C;  4DAY A;  4DV3 L;  4G7O C;  1I50 B;  3SDZ A;  1K8M A;  4KD3 A;  4R4I A;  1VQD A;  2H1E A;  3U4V A;  3U4Z A;  1EY9 A;  1OXV A;  1VQO A;  2Y0S B;  1L0X B;  2AMC B;  1K28 A;  3GTL B;  4XYQ A;  2KCC A;  4CGY B;  1MSH A;  5DM6 3;  3S17 H;  4BY7 G;  2Q8I B;  4MHE A;  1A62 A;  3VA7 A;  1HZA A;  1EU4 A;  4MZ9 A;  2Q8R E;  3E6Z X;  3D0F A;  3LWE A;  2D5D A;  4FF1 A;  5T1I A;  1STN A;  3I4N H;  1J6Q A;  1EQR A;  2KJX A;  1H9J A;  2F0K A;  1HZC A;  5I4D A;  3HOZ H;  1TWH H;  3CC7 A;  3S2D B;  3FKI H;  1I4R A;  3PO3 H;  2IL8 A;  4DGZ A;  4L5S A;  1T9H A;  4IN3 A;  2ZXO A;  4N8X 1;  4KTA A;  3G48 A;  1XNR Q;  2VQF Q;  3KLS X;  4KN4 C;  1QVF A;  4WOR A;  3QOL A;  4A3F G;  4DV2 L;  1YNJ D;  2HD3 A;  3DUZ A;  3OWF A;  5KGU A;  3A5U A;  1C4Q A;  3IFD A;  3JAM i;  4PZ6 A;  1WTX A;  2AHO B;  3KLS A;  4LF5 L;  1PH9 A;  2AKW B;  2KEE A;  3MFY A;  1Q82 C;  1ENC A;  3S1M H;  1C7Y A;  5IOD A;  2VUM G;  4TSS A;  2CQO A;  5C4H A;  2NZH A;  4C3H B;  1A15 A;  1V1P B;  1B53 A;  3K7A B;  3PUX A;  4DV1 Q;  4HR7 B;  2A6E D;  4HED A;  2UXD Q;  4LF7 L;  3M85 A;  1KNA A;  1O78 A;  2V4D A;  5IOC A;  2MO1 A;  2J7Z A;  4O1N A;  1KLG D;  2K14 A;  1B50 A;  3KDF A;  4DF7 A;  3E9I A;  1BR9 A;  4DAM A;  5C3E B;  2GA4 B;  1B4O A;  1MJC A;  2X6G A;  5JJL A;  4HJ9 A;  4GKK Q;  4BY1 B;  1JT8 A;  1OXX K;  1EYC A;  2BCO A;  1GKH A;  3QB3 A;  1BO0 A;  1E0B A;  2OWO A;  2IW3 A;  3MXP A;  2F03 A;  1G6P A;  1B1Z A;  2WB1 E;  5KYI A;  5JAV A;  2HHH Q;  4YWM A;  1MI2 A;  1VQH A;  4JI6 L;  2L5T A;  4XTC S;  3T1H L;  1CA5 A;  4UPA A;  5J39 A;  3I4M B;  4FNF A;  4IOA A;  3JAM L;  1I3Q H;  4DAP A;  3M4P A;  3NWS A;  2L12 A;  3A74 A;  3J81 j;  5EKL A;  2D2C C;  4CHT B;  4DR6 Q;  1D1I A;  1UE1 A;  2C9O A;  4X62 L;  2V1C C;  2WB1 B;  4OEM B;  5FOB B;  2KHS A;  4L63 B;  2JA5 G;  2G9H D;  1C48 A;  3SR1 A;  1KD1 C;  4XYO A;  3TP5 A;  1U4M A;  5LMN Q;  3ER0 A;  1QE6 A;  5FK9 C;  3L2P A;  1DOL A;  1GHK A;  1I4P A;  5HGT A;  3CCM A;  4RHS A;  4BY7 H;  2RBM A;  2D62 A;  1IBL Q;  1A8V A;  1WTO A;  4C3I B;  1MKH A;  5IP7 G;  4QCL A;  5C0X G;  3HFZ B;  1WOC A;  4JK1 C;  3HOV B;  2O5J C;  3K58 A;  1X3Q A;  2OCE A;  2NB0 A;  5A35 A;  4RH6 A;  4YWL A;  1A6X A;  1Y1V H;  1QZH A;  5C4Z A;  1VQA A;  3HEJ A;  2F0Q A;  4F8M A;  2E2H B;  2B2T C;  4A3K G;  4A3F H;  2ZM6 L;  4B9X A;  4JI7 L;  1VQF A;  4FVM A;  3NSW A;  4NP5 A;  3S14 B;  4RGM A;  1NTG A;  1WTP A;  3HOX G;  1F9S A;  4K5W A;  2R92 H;  3K5N A;  2JXM B;  4DR3 Q;  2BA0 A;  2Z9H A;  1M1K C;  2VUM H;  1RKN A;  3G4S A;  1X3F A;  2K5V A;  2A69 C;  2MUY A;  5CV8 A;  1ET9 A;  1TR5 A;  5C4J B;  4XQQ A;  4IPG A;  5M3F G;  1ZYR D;  3O13 A;  4KJO A;  1V1P A;  3CF5 A;  1HNZ L;  2EY5 A;  1LT4 D;  1TXY A;  3K5O A;  2F0I A;  2YTX A;  1A63 A;  2VB3 X;  5KYL A;  5E4W C;  1YIT A;  2X6L A;  1X54 A;  1XTD A;  4M1U B;  3J7A V;  1TWC B;  2NN6 G;  1DZ1 A;  2K33 A;  1B8A A;  4DR4 L;  1N9W A;  2R7Z B;  4DV5 L;  3RZD H;  2BOS A;  5C3W A;  2MFI A;  2NVQ B;  3J81 i;  2JN4 A;  1X55 A;  3HOW G;  4GN4 B;  4YIJ A;  2D9U A;  2NVY H;  2Z1C A;  3CW2 C;  5IP9 G;  2M9V A;  4K6L A;  1SFO B;  1QIL A;  3S1Q H;  4TRD A;  3AFP A;  4BBS B;  4R9W A;  1N34 L;  4LF4 L;  1PTO B;  1EQT A;  3Q22 A;  1S5F D;  1S5D D;  3ULJ A;  1TS4 A;  2SNM A;  3AU7 A;  4A3M B;  1Q7Y C;  4X65 L;  4F88 A;  1VQE A;  2G5D A;  5JEA G;  2JA9 A;  2UUB Q;  2M2L A;  1MGS A;  4PNY A;  1F2M A;  1B2T A;  2HDL A;  4LK1 C;  1YHA A;  1YEZ A;  1PH5 A;  1KTK A;  3B6Y A;  2HUG A;  3D6W A;  5C6A A;  3BZC A;  2PQA A;  3PO2 H;  1W3S A;  2F3I A;  2FIN B;  3S9W A;  4JV5 L;  3BDO A;  1JOO A;  4RHR A;  2JA5 H;  1BBW A;  1E24 A;  4Y7N B;  2VXW A;  5CBE E;  1SAP A;  4IUQ A;  2B63 G;  3BYY B;  4CDF C;  2Q2T A;  1O80 A;  3MA2 B;  5IP7 H;  1NNX A;  1J8I A;  5C0X H;  3TDQ A;  3GTO H;  3E0J A;  5ELB A;  3GTM H;  3H3V H;  1I4Q A;  3M4Y A;  4YY3 Q;  2Z6K A;  4PQX A;  1U5K A;  2B29 A;  3J81 L;  3X3M A;  4HJ5 A;  4FF3 A;  4LF6 L;  1STA A;  3KLR A;  3DWQ A;  4JBW A;  1HQM C;  1NMG A;  4DV6 L;  1NR2 A;  2OQ0 A;  4KY7 A;  3CCQ A;  4A3K H;  2RDF A;  3MC0 B;  3JAM E;  3BZK A;  4A93 G;  4KJN A;  5M3M G;  4IUU A;  5EJW A;  5IT9 L;  2AUK A;  3HOX H;  4RGO S;  4JCV E;  3D4R A;  3BVM A; 
#chains in the Genus database with same CATH homology
 1SYB A;  4C3J G;  2IX1 A;  2O4X A;  5A2Q L;  4ZUJ A;  3C2P A;  1WTV A;  1EYA A;  3S1R B;  5LL6 S;  1H9S B;  1SSO A;  4QB4 A;  4FYD A;  5FO7 B;  5ELF A;  1KDB A;  3T51 B;  1WD1 A;  4U67 3;  2NN6 H;  1STB A;  3GQB A;  5KNC A;  1QG7 A;  2E75 C;  3M4O B;  1H9K A;  4TKO B;  1PTO D;  5M5W B;  3MTS A;  1XWE A;  5C0X I;  3W2D A;  5JEA H;  3GV6 A;  2Z4H A;  2F0T A;  3MXG A;  2ID0 A;  3SE0 A;  1X32 A;  1UNS A;  1SXT A;  4V0B A;  1CTM A;  4FXK C;  1BUV T;  2A68 D;  4HTH A;  2EYF A;  2IPK D;  5EGT A;  1LV9 A;  3OHX C;  2EYL A;  3NP8 A;  1AFP A;  5I2X A;  1JOQ A;  2RDG A;  1FR3 A;  5C3X A;  2J0T D;  3PUZ A;  1RF2 D;  1Q90 A;  1H9R A;  2ENB A;  2WAQ B;  2LS0 1;  1SYG A;  2K32 A;  4KY5 A;  2PZU A;  3A8J E;  4NKL A;  2IX0 A;  4F7X A;  1V8Q A;  1G6Z A;  2K01 A;  1WVL A;  1PZK D;  1GHJ A;  1AP0 A;  5I9O A;  5EKK A;  5IGD A;  4FXG C;  3UI2 A;  3KK7 A;  1JOK A;  3SK4 A;  2CW0 C;  1HUN A;  2PZT A;  4R8I A;  4ULL A;  2B2T A;  4ZK9 B;  1DOM A;  1AEX A;  5CR3 A;  3M3Y B;  2EJG C;  3SEB A;  3J81 E;  4KKU A;  1ENA A;  4OO1 G;  4UDU C;  1HA6 A;  2FHT A;  1EU3 A;  1IYV A;  1Z7T A;  2JYO A;  2RVL A;  2EJF C;  2MGS A;  5AFW A;  5D3I B;  5IGG A;  3I4N B;  1BCP D;  5IT9 E;  1ENF A;  2RSO A;  1II3 A;  1SE4 A;  2F0V A;  1BOS A;  1TWH B;  3FKI B;  4EVO A;  4CKE A;  3PO3 B;  1DCZ A;  2QKI C;  3E5S A;  3MAQ A;  1PDQ A;  2XVS A;  2PO4 A;  4ZKB B;  4UAI A;  3IAY A;  3KBG A;  3BDC A;  5CV9 A;  2SOB A;  4FXD A;  4WJW A;  3S1M B;  3D4W A;  4HN7 A;  3D8G A;  1LLR D;  3BS1 A;  1B44 D;  4ZLT F;  1S4Z A;  3A8I E;  4ZQ3 A;  5I6Y A;  3HOU B;  1O7Z A;  1LTA D;  2B2Y C;  3K57 A;  3HGB A;  2K5D A;  1PTO F;  1SNC A;  3TME A;  1VF5 C;  4RCN A;  2AQ3 B;  4J6H A;  2XNA C;  4DNR B;  1HHV A;  1F9Q A;  2PPB C;  2QDB A;  2FMM A;  3NTH A;  2Z8L A;  5C5M A;  1RD9 D;  4XT3 B;  2H4O A;  1PRT C;  3SVM A;  1EY6 A;  4HAE A;  1I4X A;  1YNN C;  5EKI A;  2OT2 A;  1I3Q B;  1ROD A;  2PQE A;  1D5X C;  4H44 C;  4OIK A;  3SXH A;  4WRD A;  2SDF A;  1ILQ A;  3OPO A;  1TU2 B;  4B08 A;  4L6T B;  1NSN S;  3I72 A;  2R6G A;  4PMC A;  4CKB A;  3OIQ A;  4OO1 H;  2CQA A;  1TS2 A;  1M8A A;  3J7A F;  4RAU C;  3EQL C;  1PZI D;  2RKS A;  2PYK A;  4BY7 B;  3OWE B;  1ONL A;  1G91 A;  3N52 A;  4E6I A;  1AN8 A;  2PW7 A;  1ET6 A;  4G7Z C;  3ND8 A;  2K6A A;  2XN9 C;  1PFB A;  3ONA B;  3A7A B;  1Y1V B;  5J1Z A;  1SNQ A;  3NUC A;  2HQE A;  1Q8I A;  1LTB D;  3OIP A;  3MEH A;  3MVV A;  1HFG A;  3A54 A;  2R92 B;  2AWO A;  1IL8 A;  1PMR A;  4K6D A;  1EY0 A;  3EVQ A;  2WV6 D;  1X3P A;  3L7Z C;  2L9H A;  1UAP A;  2B2W C;  5EBD A;  1U9R A;  2WKC A;  2K5W A;  1IW7 D;  3LWU A;  1BCP F;  5COY A;  4FF2 A;  3GD7 A;  2L11 A;  1CZG A;  3RZD B;  3I73 A;  5LHY 1;  3CQZ B;  2PZW A;  2NVY B;  2HDM A;  4OO1 I;  1LAB A;  3WOE A;  3S1Q B;  2F0U A;  5EPK A;  4KV6 A;  4K14 A;  2WIN B;  2LY7 A;  1F2Y A;  5D3D A;  2IT1 A;  1RJT A;  5CV5 A;  1GOZ A;  2WII B;  3IKJ A;  1DM0 B;  1LAC A;  2N88 A;  2EPB A;  2L55 A;  3PO2 B;  3KF8 A;  4CBV A;  2M00 A;  5I9P A;  3DXJ C;  1PRT B;  1S5B D;  4I7Z C;  2BA1 A;  3R8B A;  3CHB D;  1V1O A;  1T5X D;  1U4R A;  1JE4 A;  3MFG A;  2NWG A;  3GTM B;  3I91 A;  4IUV A;  1LTS D;  4QUF A;  1MD2 D;  1BNZ A;  1BXT A;  5C0X J;  3NQI A;  1SMY D;  5C5L A;  1DD2 A;  1SYE A;  1SE2 A;  1B9M A;  4A3K B;  5BN3 A;  5IGC A;  3HOX B;  2KUM A;  3RLF A;  1D1K A;  5IGE A;  2N55 A;  1Z47 A;  1R9T B;  1QOH A;  1CZW A;  3PUY A;  3ZYY X;  4ILW A;  1NAP A;  2KOL A;  1OXT A;  1V43 A;  1EQV A;  2BE5 D;  3S2H B;  1HFN A;  1K83 B;  1EY7 A;  1TWF B;  4ODG A;  2IJ0 A;  1Q1E A;  3C3L A;  3HOW B;  2BDN A;  4U68 A;  3BVZ A;  3I8Z A;  1D6E C;  2PNR C;  1RTO A;  2TSS A;  3W3A A;  2NTT A;  2B2V A;  1TT2 A;  4KD4 A;  1SNP A;  2EY2 A;  4CKC A;  2K03 A;  1PLF A;  2AWN A;  2XRQ D;  1HTL D;  1U4P A;  2MJ8 A;  2RA4 A;  3RMH A;  1M4V A;  1ML0 D;  5JEA J;  5I2Y A;  1TWG B;  1CQV A;  3K5L A;  2A74 C;  5E3F A;  3S16 B;  1FNW A;  1EZ6 A;  5NUC A;  2B63 B;  4ZUI A;  1CK1 A;  3QIA A;  2PW5 A;  4H7B A;  3NE5 B;  1EYD A;  3A8K E;  4F87 A;  3L3O C;  1GUG A;  1D5M C;  5D65 A;  3VA5 A;  1Q3L A;  1G2T A;  3PIP 3;  1OO9 B;  2F3W A;  3J80 L;  4HCS A;  1HCZ A;  1OXS C;  5LL6 X;  4BBR B;  3VR4 A;  3NQT A;  1TQO A;  4QMG A;  4DA2 A;  1RTN A;  5M3M B;  2QF7 A;  1JQY D;  2DY8 A;  3BDL A;  3R2T A;  1W6K A;  2A6H C;  3BG3 A;  1HUM A;  2EYO A;  3VR6 A;  1Q12 A;  3TSS A;  1G2S A;  2KED A;  3GTJ B;  2F4I A;  1SJE D;  3URY A;  4A3G B;  2NBF A;  1CQF A;  2DY7 A;  4KKS A;  5FO9 B;  4NDX A;  1EWH A;  4PMB A;  2EZV A;  1EY8 A;  2RDH A;  1RHP A;  4I65 A;  1WTW A;  2B2W A;  2EOT A;  4QIW B;  1STH A;  1TY2 A;  5C4X B;  4IUT A;  2WKD A;  3R3O A;  1YNJ C;  5ELE A;  1A3T A;  2XWJ B;  1JIC A;  1HRJ A;  3P7J A;  2QIL A;  4IFD G;  4KMU C;  3SK8 A;  2F0F A;  5E1F A;  4IQZ A;  2A6E C;  1CHQ D;  2BDO A;  1F9P A;  4Q0F A;  1IW7 C;  3H0G B;  3FVQ A;  4M8A A;  1GUW A;  4DK1 A;  3V96 A;  4FP5 D;  1GUN A;  1JCK B;  2PMZ B;  3V05 A;  2F1M A;  3R93 A;  3DM1 A;  3FMC A;  1HTP A;  4HMI A;  3ITP A;  2EDG A;  3RZO B;  1F9R A;  3VR5 A;  4KN7 C;  1I4H A;  1VF7 A;  4ZAI A;  1LTR D;  1TS5 A;  2R61 A;  1EIH A;  4KHZ A;  4IUP A;  1PXU A;  1A2U A;  1TWA B;  1WCM B;  3NTK A;  4XDX A;  1IHZ A;  2F0M A;  5IIF A;  2ZXR A;  4DXG A;  3SHL A;  1GUO A;  1SJH D;  1VCI A;  2O2L D;  1EY5 A;  3BZD B;  4NW2 A;  5FKA C;  2F0E A;  1LO5 D;  1KDA A;  1QB5 D;  4ABN A;  3ERO A;  1FD7 D;  5CV6 A;  4XIG S;  3J80 E;  2XWB B;  4XQN A;  2YYZ A;  2A69 D;  3KBX A;  4K8I A;  3S17 B;  4A3D B;  3OOC A;  3A55 A;  1MSG A;  3EFX D;  1DON A;  3FRP B;  3HOZ B;  1SBB B;  1SDF A;  2VB2 X;  5JPM C;  1I6V C;  5K36 G;  1SE3 A;  2EYP A;  4IFD H;  1WTR A;  1E2Z A;  2K05 A;  1KDC A;  5J22 A;  1ZYR C;  4XXE A;  4QUC A;  2IWH A;  1H9M A;  3HG9 A;  4ZRZ A;  2C5C A;  5ELD A;  2AQ2 B;  1KNE A;  4KKT A;  3QOJ A;  3T16 A;  3FDT A;  3MWY W;  1J9O A;  4ME5 A;  3KUP A;  1JC7 A;  3R2I A;  1NUC A;  1HXY D;  3WOF A;  1PZJ D;  2OXP A;  3TZU A;  4LMQ D;  1GUS A;  4KK7 A;  1HPC A;  3HP3 A;  5CV4 A;  3OMG A;  4DAV A;  5FLX L;  4K2K A;  3H09 A;  2K7V A;  3VR3 A;  2G9D A;  2FFK B;  1AW7 A;  2EY1 A;  2RQX A;  5TSS A;  2R3Z A;  5BN4 A;  2ZT9 C;  3T56 B;  3RD4 A;  4OL7 A;  4DNT B;  2B39 A;  2KQ3 A;  5CC4 A;  1Q1B A;  4L8J A;  4Q5V A;  1HQR D;  4GZY C;  4RGT A;  1A3U A;  4LJZ C;  4RGN A;  1STE A;  4K2L A;  4IFD I;  3C1E A;  5JOB A;  1FGB D;  2K28 A;  1EY4 A;  2XIW A;  3QJY A;  4RKL A;  2VNU D;  2EYH A;  1JWM D;  1EL0 A;  3Q24 A;  3L9A X;  1CT1 D;  5CMD A;  4HSV A;  3K6O A;  2OF1 A;  4ZKC B;  1D5Z C;  3I4L A;  3DWP A;  4A3F B;  5K36 H;  2DNC A;  5I6W A;  1DOK A;  2RSN A;  4A3J B;  3MXU A;  1SYC A;  5CBA E;  5G3L D;  2VUM B;  4MN3 A;  5KND A;  2L1B A;  2JEB I;  3K0Y A;  5DNF A;  1F2L A;  1CA6 A;  2B8F A;  1WTQ A;  2HCC A;  3P20 A;  5F2D A;  4IZ8 A;  3D6C A;  3H94 A;  4RWS C;  2L4N A;  3TP8 A;  2Z4I A;  4B9W A;  4K5X A;  2R93 B;  1XX8 A;  4C3H G;  2JP1 A;  4EGV A;  5COR A;  1KAA A;  3NHH A;  1ZXT A;  3PMF A;  3M7N A;  1PTO C;  3V2T A;  3A56 A;  3NBH A;  5KIX A;  1R4P B;  1DXM A;  1WD0 A;  1U4L A;  1ZEQ X;  3NTI A;  5T1G A;  1GUT A;  2XRS D;  1RCV D;  1NR4 A;  1QCB D;  2A68 C;  4P2C B;  2EXZ A;  3HRZ C;  3SK6 A;  1BDO A;  4RCO A;  2F0J A;  2JA5 B;  2NYZ D;  2E2I B;  3OSO A;  1Y1W B;  1A3V A;  4NMZ A;  2JA7 B;  5FLX E;  3TBI B;  3I90 A;  2CW0 D;  3RUZ A;  3GTO B;  1ESF A;  1SYF A;  1CI3 M;  1R4Q B;  4AYB B;  4DXF A;  4TQU S;  3AMU A;  5EPL A;  3G6J B;  2NUC A;  1EFI D;  3A7L A;  4C3I G;  4KHV A;  4H0L C;  1QNU A;  1ZKO A;  1PFM A;  1SND A;  4C1N K;  3J7Y W;  1JB3 A;  3NPP A;  5JVG 3;  1STY A;  4H13 C;  2F0H A;  1SEB D;  1K8O A;  2JSO A;  3DMU A;  5JJZ A;  2F0N A;  1XTC D;  5M3F B;  5DM7 3;  3VR2 A;  1W6J A;  2DN8 A;  2JE6 I;  3OW7 A;  2F0W A;  1JR0 D;  2E2D C;  3SK5 A;  4R8N A;  3GO5 A;  4A3E B;  3BVG A;  1SYD A;  3EA6 A;  1I4G A;  2F0P A;  1TVX A;  4OGQ C;  4FF4 A;  5ISR A;  2EYM A;  3M7G A;  4EQN A;  2CHB D;  1BCP C;  5KRU A;  1EOT A;  1G8Z D;  4G4K A;  3AB9 A;  2WAC A;  1TS3 A;  4WFN 3;  3CKI B;  4KI0 A;  1VDZ A;  2EY6 A;  5HUR A;  3BYT B;  2B2Y A;  5G3L F;  3CRL C;  4PMW A;  2B2U C;  2NVT B;  3K5M A;  1PFN A;  2JEA I;  2B8G A;  3X3N A;  1E2V A;  3LNN A;  1STG A;  1F2Z A;  4MIU A;  1DYQ A;  2FMC A;  1PRT D;  3ERQ A;  3U9O A;  4C2M B;  1SNO A;  1O7Y A;  2EVB A;  4QF4 A;  4G7H C;  1YNN D;  5C44 B;  1QNK A;  1B9N A;  1C8C A;  4Z9C B;  4J8Q A;  4X3S A;  4DFA A;  2JA6 B;  1QWY A;  2KA7 A;  3PUW A;  3TN2 A;  1LTT D;  1IKM A;  3TP7 A;  2ICI A;  3Q23 A;  4RKB A;  4DU9 A;  1L0Y B;  3DEO A;  3GTK B;  4A93 B;  4XQJ A;  3T13 A;  4BWG B;  2QEJ C;  1FNU A;  3MZ5 A;  3P1H A;  2WP8 J;  3H6M A;  4IUR A;  1AZQ A;  4C3J B;  2HCI A;  4HCE A;  1PYW D;  2Q8T A;  2EJM A;  4OIJ A;  1DJR D;  2NZ1 D;  4LAA A;  4G57 A;  2LMC B;  4A3B B;  1Y8N B;  1GXD C;  4BA1 I;  4K5V A;  1FYC A;  5JVH 3;  3WDN A;  1T5E A;  1VMP A;  2SEB D;  2AQ1 B;  3CU7 A;  4XT1 B;  3MHB A;  3GTP B;  4N9P A;  2JA8 B;  3IFT A;  3NXW A;  2QCP X;  2K1B A;  2MPM A;  3PIO 3;  4EQP A;  3EJI A;  1LT5 D;  3VYT A;  1MBY A;  4CJ2 C;  3TP6 A;  2OEO A;  5D14 A;  5IGF A;  1BQQ T;  2IX3 A;  1XYI A;  2E76 C;  3HZX A;  2TMP A;  1BCP B;  2KEC A;  2L0C A;  1PTO H;  2YU9 B;  4OHJ A;  1F77 A;  3I3C A;  5M9O A;  2X69 A;  1QJO A;  3F2U A;  4CJ1 B;  5BN5 A;  1RDP D;  2ZXP A;  1UUP A;  3PV0 A;  4BA2 I;  1XXG A;  3OMC A;  1Y8O B;  2E74 C;  4IFD J;  3N6R A;  1OXU A;  5ELC A;  4S3S A;  3D3R A;  2K5Q A;  1EWC A;  4DK0 A;  2F3V A;  2NVX B;  3GP7 A;  3Q0A A;  3TZD A;  5EBC A;  3U9S A;  3CRK C;  1G29 1;  3NWT A;  4DN4 M;  4O42 A;  2ICE C;  1CM9 A;  1JWS D;  2F0D A;  4N9T A;  3MXN A;  1Y8P B;  1GJX A;  5M5Y B;  3T4A C;  3H91 A;  3QWN A;  2EE1 A;  4BS9 A;  1AZP A;  1TY0 A;  3DEP A;  4V19 0;  1LTI D;  1A2T A;  5CGK A;  5KNB A;  3LX0 A;  1O7L A;  1PRT F;  2NN6 I;  5CYU A;  1KAB A;  4X3T A;  5EQ0 A;  4PV1 C;  5FO8 B;  3GTQ B;  4CJ0 B;  3GTG B;  3VYS A;  2CVR A;  1VMC A;  3HKZ B;  5DEH A;  3DWA A;  2EYJ A;  1D2B A;  1CHP D;  3S1N B;  2MP1 A;  4K8J A;  5KEE A;  4RFB A;  1S5E D;  2I07 B;  2KCN A;  1LTG D;  1H9S A;  3FPP A;  3FEW X;  1SMY C;  3QG1 A;  4X3K A;  1NCV A;  3VYU A;  4ID6 A;  4C1N I;  4IUN A;  3HS0 C;  4RA8 A;  2NTS A;  2SNS A;  1BBX C;  1UEA B;  2LFN A;  3ND9 A;  2MHV A;  1LT3 D;  2XSC A;  3NK9 A;  5JPN C;  2FJ2 A;  1E2W A;  3D4D A;  5A2Q E;  1EZ8 A;  5CV7 A;  2PCF B;  1Y69 U;  3HOY B;  2J4X A;  2E2J B;  1TKW B;  4IAL A;  2BE5 C;  3G7L A;  5E4X A;  1IYU A;  2DNE A;  3K59 A;  4C56 C;  2LKV A;  3C1F A;  2B2U A;  3S15 B;  3FPU B;  2I46 A;  3I70 A;  3Q6S A;  1EEI D;  5M5X B;  1SNM A;  1HA5 A;  2AUJ D;  4HMJ A;  3NBI A;  2K04 A;  2B2V C;  1KLU D;  3PUV A;  1ILP A;  2F0O A;  3D31 A;  1JOR A;  3P75 A;  5K5P A;  1JWU D;  4EQO A;  3GV3 A;  1BF4 A;  4HSP A;  4J1M A;  1B3A A;  1EIG A;  4ZYS A;  2A5H A;  1TII D;  1ESR A;  3DHQ A;  1Z6H A;  2O5I C;  2F0G A;  3T53 B;  2KVM A;  1EEF D;  4X3U A;  1I6H B;  5EPJ A;  3VYR A;  5DAU A;  5IGB A;  2F0S A;  4KY6 A;  3IL8 A;  1FNV A;  1LT6 D;  1S5C D;  1IKL A;  2F0L A;  2A6H D;  4FO2 A;  4A3I B;  3C46 A;  2A73 B;  1ICW A;  3QO2 A;  1CFM A;  3H3V C;  4DAY A;  4G7O C;  1I50 B;  3SDZ A;  1K8M A;  4KD3 A;  2H1E A;  1EY9 A;  1OXV A;  2Y0S B;  1L0X B;  3GTL B;  4XYQ A;  2KCC A;  4CGY B;  1MSH A;  5DM6 3;  2Q8I B;  4MHE A;  3VA7 A;  1EU4 A;  2Q8R E;  3E6Z X;  3LWE A;  2D5D A;  4FF1 A;  5T1I A;  1STN A;  2KJX A;  1H9J A;  2F0K A;  5I4D A;  3S2D B;  1I4R A;  2IL8 A;  4DGZ A;  4IN3 A;  2ZXO A;  4KTA A;  3KLS X;  4KN4 C;  4WOR A;  3QOL A;  1YNJ D;  3DUZ A;  3OWF A;  5KGU A;  1C4Q A;  3IFD A;  1WTX A;  3KLS A;  2KEE A;  3MFY A;  1ENC A;  5IOD A;  4TSS A;  5C4H A;  4C3H B;  1A15 A;  1V1P B;  1B53 A;  3K7A B;  3PUX A;  4HR7 B;  2A6E D;  4HED A;  3M85 A;  1KNA A;  1O78 A;  2V4D A;  5IOC A;  2J7Z A;  4O1N A;  1KLG D;  1B50 A;  4DF7 A;  1BR9 A;  5C3E B;  2GA4 B;  1B4O A;  2X6G A;  4BY1 B;  1OXX K;  1EYC A;  2BCO A;  3QB3 A;  1BO0 A;  1E0B A;  2IW3 A;  3MXP A;  2F03 A;  1B1Z A;  5KYI A;  5JAV A;  1MI2 A;  2L5T A;  4XTC S;  3I4M B;  1CA5 A;  5J39 A;  4FNF A;  3JAM L;  4DAP A;  3NWS A;  2L12 A;  5EKL A;  2D2C C;  4CHT B;  1D1I A;  2C9O A;  2WB1 B;  5FOB B;  2KHS A;  4L63 B;  2G9H D;  1C48 A;  3SR1 A;  4XYO A;  3TP5 A;  1U4M A;  1QE6 A;  5FK9 C;  1DOL A;  1GHK A;  1I4P A;  5HGT A;  4RHS A;  2RBM A;  2D62 A;  1WTO A;  4C3I B;  4QCL A;  5C0X G;  3HOV B;  4JK1 C;  2O5J C;  3K58 A;  1X3Q A;  2NB0 A;  5A35 A;  4RH6 A;  1A6X A;  5C4Z A;  3HEJ A;  2F0Q A;  4F8M A;  2E2H B;  2B2T C;  4B9X A;  4FVM A;  3NSW A;  4NP5 A;  3S14 B;  4RGM A;  1WTP A;  1F9S A;  4K5W A;  3K5N A;  2JXM B;  2BA0 A;  1RKN A;  2A69 C;  2MUY A;  5CV8 A;  1ET9 A;  1TR5 A;  5C4J B;  4XQQ A;  1ZYR D;  3O13 A;  4KJO A;  1V1P A;  2EY5 A;  1LT4 D;  3K5O A;  2F0I A;  2VB3 X;  5KYL A;  5E4W C;  2X6L A;  4M1U B;  3J7A V;  1TWC B;  2NN6 G;  1DZ1 A;  2K33 A;  2R7Z B;  2BOS A;  5C3W A;  2NVQ B;  4YIJ A;  2D9U A;  2Z1C A;  2M9V A;  4K6L A;  1SFO B;  1QIL A;  4TRD A;  4BBS B;  4R9W A;  1PTO B;  1EQT A;  3Q22 A;  1S5F D;  1S5D D;  1TS4 A;  2SNM A;  3AU7 A;  4A3M B;  4F88 A;  5JEA G;  2M2L A;  1MGS A;  4PNY A;  1F2M A;  1B2T A;  2HDL A;  4LK1 C;  1KTK A;  2HUG A;  3D6W A;  5C6A A;  2FIN B;  3S9W A;  3BDO A;  1JOO A;  4RHR A;  4Y7N B;  2VXW A;  5CBE E;  1SAP A;  4IUQ A;  3BYY B;  1O80 A;  3MA2 B;  1J8I A;  5C0X H;  3TDQ A;  3E0J A;  5ELB A;  1I4Q A;  3M4Y A;  4PQX A;  3J81 L;  3X3M A;  4FF3 A;  1STA A;  3KLR A;  3DWQ A;  4JBW A;  1HQM C;  1NR2 A;  4KY7 A;  2RDF A;  3MC0 B;  3JAM E;  4KJN A;  4IUU A;  5EJW A;  5IT9 L;  2AUK A;  4RGO S;  3D4R A;  3BVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...