3EVQA

Crystal structure of staphylococcal nuclease variant delta+phs l25e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKEMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal Structure of D+PHS L25E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3evqA00
1IHZA 2EY1A 1A2TA 2LKVA 2O4XA 2RKSA 2F0QA 1STNA 2F3VA 3VA5A 4E6IA 1II3A 2F0FA 5HURA 4IZ8A 5C4HA 3MHBA 1STGA 4OL7A 5CV9A 2PW7A 4N9PA 4K2KA 1EY8A 5HGTA 5IODA 3P75A 4H7BA 1EY5A 4K8IA 1JOKA 1KDBA 3D4WA 4R8NA 5K5PA 5ISRA 4RKBA 2F0UA 5KEEA 3SK4A 2KHSA 4RKLA 1JOOA 2M00A 2PQEA 3P1HA 3DMUA 3BDLA 1EY6A 5J1ZA 1EY0A 1KDAA 1ENCA 1SYFA 1SYGA 4QMGA 1RKNA 3E5SA 3HZXA 5EKLA 4NKLA 3TP6A 2F0EA 2ENBA 4J1MA 2F0MA 3T13A 5CGKA 5KIXA 2F0TA 3DHQA 3LX0A 3SR1A 5C4ZA 2F0SA 1A2UA 2F0OA 3QOLA 1EYCA 2F0LA 3SHLA 3RUZA 1SYBA 5IGFA 5CR3A 4HMIA 4K14A 2F0HA 4KY7A 1ENAA 1A3TA 4PMCA 5NUCA 4KJNA 1U9RA 1AEXA 3NUCA 1STYA 4DGZA 2EYLA 5KRUA 5DAUA 1JORA 3OSOA 5IGEA 2EYPA 2F0NA 3C1FA 3MEHA 4NMZA 4F8MA 1EZ6A 1SNOA 1TT2A 5C5LA 4YIJA 5I6YA 2WACA 4IALA 5JAVA 2EYJA 3C1EA 1STHA 2QDBA 5E1FA 3U9OA 1EY4A 3V2TA 3ITPA 5EKKA 3OMGA 4DU9A 1TR5A 2OEOA 2PZWA 3NXWA 3PMFA 1F2ZA 4KY6A 4K8JA 3S9WA 4ID6A 1F2YA 3EVQA 3NQTA 5I6WA 4MIUA 4QB4A 5IIFA 5IGCA 2PW5A 4LAAA 3SK8A 2PZUA 2KQ3A 4HMJA 4KHVA 5KYLA 2RBMA 3D4DA 3NP8A 1SYCA 3OWFA 4ODGA 4WORA 4EQNA 1JOQA 3SK6A 1STBA 2SOBA 3QOJA 3R3OA 4ZUIA 1EZ8A 3TMEA 4EQOA 2RDFA 2EY5A 2EYFA 1EYAA 2EYMA 3MXPA 4HTHA 4DF7A 4ZUJA 1SNMA 2F0PA 2EY6A 1SNQA 4G57A 4WRDA 2SNMA 5JOBA 3HEJA 4EQPA 5C5MA 2SNSA 5C3XA 3MVVA 4KD4A 4DFAA 2F0GA 3NHHA 2EYOA 1NUCA 3SK5A 2F0VA 2OXPA 4PNYA 1STAA 2PZTA 4NP5A 1TQOA 5CC4A 3TP8A 5J39A 2F0KA 3MZ5A 4KTAA 4KV6A 4TRDA 3BDCA 3TP5A 5CV7A 1KDCA 1SNPA 1SNDA 2F0DA 4J6HA 4B9XA 5IGGA 5I9PA 4N9TA 1EQVA 5E3FA 3SXHA 4K5WA 3T16A 2EY2A 1F2MA 1SYEA 4ME5A 4NDXA 2OF1A 5C3WA 4I65A 1NSNS 4KJOA 4IUNA 4KY5A 5KYIA 5IOCA 4QF4A 3NK9A 3EROA 1A3UA 3QB3A 3D6CA 1EYDA 3EJIA 4S3SA 5CV5A 1EY9A 1KABA 2EYHA 4K5XA 2EXZA 4EVOA 5DEHA 5CV4A 2F0WA 5I9OA 5J22A 4PMBA 5CV8A 3TP7A 5IGBA 2HQEA 4K6DA 1SNCA 3H6MA 2NUCA 3D8GA 5F2DA 4K2LA 2F0IA 4KD3A 1EY7A 5KGUA 5C6AA 1KAAA 2PYKA 4B9WA 4F7XA 5M9OA 1SYDA 2F0JA 2F3WA 5EGTA 5CV6A 5IGDA 3OMCA 4ZQ3A 4K5VA 1A3VA 3ERQA
chains in the Genus database with same CATH superfamily
1Y8OB 2K75A 1D5MC 2F0FA 4X3KA 4DAMA 2R7ZG 2K01A 4N9PA 1EQRA 3P75A 4A3BB 5C4XB 4IFDG 5ISRA 5D3DA 1G8ZD 3I4NH 1L1OC 4ZK9B 3BJUA 2XWBB 1KDAA 5AJ3Q 3FKIB 3E0JA 5KNBA 2GVBA 4IUTA 3SHLA 1Q82C 2V1CC 1IL2A 1GUWA 2E2JB 3S1RH 4RA8A 4RGMA 3I2ZA 2K5VA 5GAHC 3JC66 1RTOA 4KKTA 1PVOA 4A3BG 2MO1A 3M3YH 5C4XG 4H13C 4DV2Q 5IT9E 2UXDL 4BBRH 1S5CD 3TSSA 4AYBB 1K8OA 5FO9B 2CQAA 4JYAQ 2R6GA 4PMWA 4GS3A 1X54A 4Q0FA 4C1NK 3FKIG 3MC0B 2ICEC 1WTWA 1TWHH 1KNAA 5GQOA 3TBIB 1VQ8A 3F2BA 2Q8IB 1D2BA 3G6JB 3BU2A 1HFNA 4HTHA 1IKLA 4IPGA 2IX1A 3QWNA 4UDUC 2NYZD 4WRDA 2XN9C 4LUOA 5JOBA 1S40A 4IPHA 4L63B 3PSIA 1SE3A 2JA6H 3KLSX 2RCFA 4AYBG 5DLQE 2EVBA 4GOPC 1M4VA 3AYHB 1D6EC 3NELA 3GTKH 1NCVA 3S2DH 1HTLD 4DV0Q 1VQPA 3TEHB 4Y7NH 3UDXA 1W3SA 4DPGA 2NTSA 4HEDA 2OF1A 1SE4A 3N52A 3SVMA 4XT1B 3ZJYC 3A8JE 2UUBQ 3NK9A 2L11A 2Q2TA 4WJ3M 3MA2B 5KNCA 5G3LD 1PFMA 3CQZB 5A2QE 1SROA 2Z4HA 3F8TA 4GKKQ 5C6AA 2PYKA 2NVXB 2M9VA 1WTPA 2A69D 4Q5VA 5IYBH 3GV3A 2R61A 1LM0A 1MD2D 2GA4B 2K04A 1A2TA 2D2CC 4KMUC 1STNA 3J7ZC 1SRUA 2EE1A 1E3PA 3J80E 3J7YW 1MKHA 3VA7A 3OOCA 1G6PA 3A56A 4H7BA 3IRBA 3T1HL 4OWXB 5LL6X 2K5QA 4XT3B 2KHSA 3GTMB 1E22A 4OO1G 1N33L 4RAUC 3K58A 3JAML 4CHTB 5IYCH 4LFCL 1EUJA 1UNSA 1TU2B 2LXJA 5DM73 2K5HA 3LNNA 2PQAB 2ZJPA 4IOCA 4BY7H 1BVSA 2HIVA 2KHIA 1LV9A 5CR3A 5FLXL 1QUQA 2N8NA 4IUVA 3NWTA 4YY3Q 1U9RA 4DV6Q 2GVAA 4DGZA 1HRJA 1YZ6A 2AWNA 5IGEA 1RJTA 3CXCA 1UEBA 2J7ZA 1E1TA 5LL6S 1KRSA 4YCVA 4A3KB 5JAVA 4XQJA 2QGQA 1PFNA 2NN6H 2I5MX 2CW0C 4CKBA 3OMGA 3NXWA 1J5EQ 5JEAG 4RGOS 4DR6L 4CGYB 2EIFA 2RHSB 3GTOH 4MIUA 1SFOB 4LF6L 1KQSA 3OWFA 4ODGA 3VDYA 3Q0AA 1G91A 1UAPA 1RCVD 4O2DA 1UE1A 3OIQA 2ZTEA 1STBA 4KHPL 4ZUIA 4H44C 5JEAJ 4JW0A 4EQOA 4DV4L 4FP5D 4NPSA 2F03A 2JEAI 3NTKA 4A3KG 1NR4A 3BVGA 4JVZA 3L7ZC 3M9BA 5KNDA 1DXMA 5CC4A 1EQTA 4LF9Q 2FINB 2R7DA 5COYA 1Q86C 4JBKA 2K32A 4DUYL 2K03A 4NB3A 4TKOB 4KY5A 3N6RA 2YTXA 3EROA 1EY9A 4LW1A 1Y1VH 2A69C 2WAQB 3I4MH 4A93B 4HIMA 5GAEC 1I4GA 3MEFA 2R7ZH 3TS0A 2FJ2A 3BYTB 1PH8A 3E3XA 2LKVA 4DV1L 2F4IA 5LHY1 1W2BA 2YU9H 4IFDH 4O0AA 4JI2Q 1II3A 3J80i 4OL7A 5JVG3 5IODA 1KDBA 4R8NA 4QGUA 1A63A 3IL8A 3DMUA 2WAQG 4A93G 1B3QA 2A19A 1EWHA 2B2UA 3S17H 4NKLA 4X3SA 1TY2A 2TSSA 2XNAC 1UE5A 1I4RA 2DUDA 3RUZA 4A3BH 1RODA 5IGFA 4HMIA 5C4XH 3I73A 4KY7A 3KJPA 1S5DD 2KJXA 1XWEA 4KJNA 3KUPA 3HFZB 1CUKA 2EYLA 1PZJD 1JORA 1RD9D 2F0NA 4U68A 1NMGA 3FKIH 3NBHA 3PUZA 3RZDH 1U0LA 2KUMA 2E2HB 4KY6A 3EQLC 3HOZB 1ML0D 1U4LA 3RZOB 3EVQA 2E2JH 4C2MB 5BR8L 1IW7D 3SK8A 4O42A 1HH2P 2PQAA 1F77A 5KYLA 4GN5A 1V9PA 1L0WA 1BBWA 3OYYA 4ZKCB 2UXDQ 4DK3C 3SK6A 4C1NI 1OXXK 3QOJA 2FFKB 3PUYA 5CBAE 3M4QA 5ELFA 2QEXA 1VQLA 1IBLQ 4V0BA 3DM1A 1QNKA 3FEWX 2MUYA 2K5WA 1NUCA 1WYDA 2LSSA 3TP8A 3TP5A 5ELNA 4HR7B 1RTNA 3HOZG 5FJ8G 5E3FA 1PH5A 3I3CA 2LXKA 1SAPA 4HCSA 1JB3A 2UUCL 2WIIB 4DV3L 1Y69U 1MJEA 1YIJA 1R9TB 1FVIA 1LT6D 5T1GA 1HA6A 5I9OA 5J22A 1QE6A 3S14B 5JPMC 3T53B 2K14A 3KLRA 4JBWA 1CHPD 4K2LA 2DY8A 1VQKA 1BDOA 4FXGC 1YJWA 1KLUD 4L5RC 1BUVT 3VA5A 4DK6C 1IXRA 2QA4A 4DKAC 3QIAA 2VY3A 1EFID 2LFNA 3ER0A 1Q7YC 1JE5A 1VQFA 3OTOQ 1EY5A 1NTGA 1XJVA 3CU7A 4IN3A 3CQZH 1NY4A 3IKJA 2NVXH 2C35B 1YNND 5FLMG 3KF6A 2CWAA 3Q23A 2ZTCA 3H94A 3HZXA 1PH3A 4ILWA 1VQ7A 3PIO3 2AUKA 2ZJQA 3T1HQ 1CKNB 2JA8B 2F0OA 3T56B 2QDLA 1CSPA 1SR3A 1XNRL 4Z9CB 2K5NA 1IBML 1HPCA 1N33Q 4LFCQ 4JI7L 3GTMH 4YWLA 1A15A 1TWAB 1B1ZA 1HR0W 2Q2HA 1OTCA 2IL8A 1CQFA 2QDBA 2Q2IA 1NE3A 1IW7C 2QF7A 1XNQL 2HD3A 2IY5B 3PMFA 3HS0C 2FMCA 2A74C 5IGCA 2NZHA 3BS1A 2JA8G 3HKZE 4KKUA 2VL6A 3R3OA 5EPJA 4A3KH 1PTOB 4B3SL 2RDFA 5J3BA 1LTAD 2EYMA 4DR6Q 1PDQA 3CCJA 1ASZA 1SNQA 4LF6Q 1M1KC 3V96A 2PI2E 1PTOD 3S1QB 1YI2A 3I4OA 3SK5A 1FR3A 2F0VA 1SFOH 4KHPQ 4N8X1 2KBNA 4DV4Q 5E7NA 2B63H 1KDCA 1YHAA 3IAYA 4RFBA 2OTLA 1XTDA 1X32A 2I5LX 2AKWB 1P8LA 4NDXA 3T51B 2DNCA 3P7JA 5HY6A 5ELOA 1B7YB 1U4PA 2JA5B 5IOCA 1H9MA 4S3SA 4JI4L 2EXZA 4I7ZC 4ME3A 4BWGB 3PF4A 4DK0A 4XXEA 5I4DA 2A6ED 2HQEA 4K6DA 4R4CA 3HRZC 3H6MA 1L0YB 1HR0L 5F2DA 5KGUA 4KD3A 4DUYQ 5G3LF 3WWVA 4WFN3 1DYQA 2CFMA 1NMFA 5EGTA 1SXTA 5IGDA 1CA5A 4N8FA 2EY1A 1N36L 4K6LA 1SLJA 4H02A 5IP9G 1STGA 3NTIA 1N9WA 2HUGA 1KNEA 1YNNC 4DV5L 3BDOA 3FPPA 4CDFC 4A93H 2ZJRA 2JA5G 4LUVA 4QUCA 2F0UA 1K8MA 2X6LA 1ZYRD 1JOOA 1S5BD 4DV1Q 2IHEA 2KEDA 1AE3A 2F3IA 2F0EA 4RG1A 3VYUA 2GN5A 4BBSB 3BZCA 2NN6I 3HOXB 1LTGD 3PO3B 2E2IB 1AEXA 5EPLA 4FXKC 3E6ZX 2L15A 1V43A 1LT5D 2BOSA 2G9DA 4DR5L 1EWCA 2PZWA 2AMCB 1F2ZA 1GHKA 4EX5A 5I6WA 5GROA 2KQ3A 2DJFC 1PH1A 3NP8A 1CSQA 4BBSG 1VQEA 2HCCA 4DXGA 3HOXG 3DWAA 3TMEA 3G6EA 3PO3G 1WD1A 1YJ9A 1HTPA 1QVGA 2EY6A 5BR8Q 3A5ZB 2E2HH 5M3MB 2OWOA 3HOZH 5FJ8H 2F0GA 4J8QA 4C2MH 1JB7A 2JP1A 1K73C 1EEFD 2F52A 2RF4A 1EOVA 1SNPA 1TVXA 2F0DA 4N9TA 4ULLA 2D5DA 3TRZA 1I50B 1FD7D 1DM0B 2A6EC 1LTRD 1NSNS 4KJOA 1XXGA 4GKJL 1YNJD 2OCEA 2EXDA 3DUZA 1EYDA 5JJIA 2ZM6Q 5M3FB 3U4VA 1ZXTA 5D14A 4IFDI 1IBKL 1SSOA 3TP7A 2MO0A 2E5LL 3J81E 4OIKA 3OW2A 1JQYD 1O80A 2UUAQ 4LFBL 2UUCQ 5M3MG 4DV3Q 1BCPC 2NBFA 4OELB 2AWOA 1EFWA 4AQYL 2KOLA 1VQ6A 1R9TH 3J7A5 1FGBD 1O7YA 1YVCA 4QIWB 3NTHA 5FLMH 4LK1C 2IX3A 4LNQA 3S1NB 3TN2A 5I2YA 1I4QA 3URYA 3SK4A 1L2FA 1Q3LA 5M3FG 1S5ED 4HJ8A 2MPMA 4JOIA 2H4OA 1SMYC 4J1MA 4RHRA 1AP0A 1T5EA 2B2VA 5BN4A 1SJED 2BH8A 4GLAC 1QUQB 1TS4A 3GTLB 4DUZL 2ES2A 2YYZA 3RR5A 3CCEA 4ZYSA 4IQZA 4NMZA 1J9OA 1GKHA 1PH9A 3BZDB 2SEBD 1SDFA 1QVFA 2K4KA 1IBMQ 3STBC 2JA8H 2EJFC 4LF8Q 3UDGA 5IYDG 4K8JA 1K8GA 5FO7B 4JI7Q 4HJAA 2FMMA 1KL9A 2PO4A 1HZCA 3G71A 1VQOA 1XX8A 3D4DA 1HZAA 1TWAH 3CKIB 1XNQQ 2NVQB 4IUQA 3RLOA 1FNVA 2IX0A 2E8GA 1VQ5A 5ELBA 4G57A 4JI5Q 4RWSC 4EQPA 1HXYD 1B9NA 1Q12A 1GOZA 2B2WA 3MFGA 3OWEB 1F9RA 3W5OA 1A0IA 2WAQE 3U9SA 1E2VA 1YNJC 2HDMA 4PZ8A 2F1MA 1XPRA 1QCBD 1PTOH 3OW7A 1F2MA 5D3IB 4F88A 1T5XD 2A6HC 5JJZA 2QKIC 2QILA 3AFQA 3VR5A 3S1QH 1LACA 4EVOA 3BVZA 4IJHA 2WKDA 4L5TA 2EDGA 3J81i 1JWMD 4YHHL 2XVSA 1XPOA 5E4XA 5IP9H 1HZBA 2KCMA 1A62A 1GUSA 1N34L 3RNUA 2NZOA 4JI4Q 2MHVA 2MQHA 4GZYC 4FVMA 2O4XA 2JA5H 5T1IA 5HURA 2ATWA 2F3VA 3W1BA 1PRTB 2PW7A 4K2KA 1AN8A 1EY8A 4A3CG 3CF5A 1PFBA 3BZKA 3U58A 5K5PA 4RKBA 3DXJC 1PRTD 4P2CB 3D4RA 4AH6A 2PQEA 1N36Q 2MNAA 1EIYB 1TXYA 4FYDA 3F2DA 3D3RA 5A2QL 1DOLA 5EQ0A 5M5XH 3E5SA 5C44B 3T13A 4DV5Q 2PMZB 1CZGA 4R4QA 2F0SA 1KRTA 3RLNA 2A5HA 3MXNB 1A2UA 3QOLA 2WB1E 1Y8NB 1B4OA 4K14A 1KTKA 2XGTA 4PMCA 1V1PA 4DR7L 3HOUB 1JJ2A 3K81C 5DAUA 3NBHB 3MEHA 4F8MA 4DA2A 3CC7A 1SNOA 1TT2A 3SEBA 2DGYA 4RGTA 3ITPA 2KENA 4IPDA 3F2CA 1G51A 2A73B 4BBSH 4MZ9A 3HOXH 3PO3H 5C44G 2E2IH 4LF4L 5BN5A 2KA7A 2VB2X 2WV6D 1MBYA 2IJ0A 2RBMA 4WORA 4EQNA 3WOEA 1NBWA 2NB0A 4XYQA 1EIFA 4DR5Q 1KC8C 4XTCS 5GADC 1K83B 1SNMA 3HOUG 1ILQA 3JAME 3HEJA 5C5MA 3EFXD 5C3XA 1OXSC 3MVVA 1SEBD 1VQJA 1X3PA 1GVPA 2UXCL 1UEAB 3K80C 1TQOA 2JA7B 4LFAL 5FLXE 1UE7A 1SNDA 2LY7A 5E4WC 2CWPA 5JVH3 2EY2A 3KDFA 1SYEA 4ME5A 4ABNA 4QJFA 1QZGA 2WFWA 1TKWB 3AU7A 1G291 3ICEA 3EJIA 4JI3L 1WJJA 5M3MH 4JBMA 5CV4A 1PHJA 1AZPA 2EOTA 4CKEA 3R8BA 2L12A 2BDNA 2DN8A 2R93B 4B9WA 4R4IA 4GKJQ 1D5XC 4DR2L 1I50H 2Z6KA 4A3MB 4BA1I 2HT1A 3ERQA 2JA7G 2K6AA 4G7OC 2E5LQ 4X66Q 1Y14B 1PRTC 2WP8J 5M3FH 4LFBQ 1BCPF 2CQOA 2R92B 2Z9HA 1E2ZA 1QILA 2EJMA 4PZ7A 5EBDA 3KF6B 4XQQA 4CBVA 4AQYQ 1AZQA 4HIKA 4C3HH 5J1ZA 2B2UC 2VQFL 1SYFA 4FO2A 3AFPA 2R93G 4LF7L 2SDFA 2IWHA 5KIXA 1K28A 4LWCA 3SR1A 4PV1C 3H3VI 3I70A 4A3MG 1JJGA 2QEJC 2N3SA 3IFDA 3S1NH 3KYHC 2E74C 2VXWA 4X64L 3M4PA 1Q81C 2R92G 1ICFB 5IYDH 2JSOA 1CHQD 4MTNA 5C5LA 1BNZA 1DCZA 3TQYA 4DN4M 4DUZQ 1CQVA 3S9WA 4OONA 4A75A 1LO5D 3GTLH 2B39A 1C9OA 2VB3X 1JMCA 1JOQA 5C0XI 3MXNA 3MXGA 5CYUA 1NR2A 3OPOA 3SGIA 5TSSA 1PH7A 1I4XA 2F0PA 2O5JC 3JAMi 1B2TA 2D62A 2SNSA 4C3IB 4BXXG 3BVMA 2BE5D 1BBXC 2O5IC 4PNYA 1VMCA 4KV6A 1PZKD 3I56A 4LUZA 5C3EB 5EJWA 2NZ1D 4L6TB 1TS3A 4B3ML 1B53A 4CJ0B 2NTTA 1GD7A 4L5QA 3K5MA 1Q1BA 3HGBA 3TREA 4KN4C 4C3IG 2WKCA 4FDBA 3PO2B 1EWIA 4M1UB 4A3CH 1Z9FA 3QJYA 2CCZA 3Q6SA 4A3GB 3CCSA 5C3EG 1MGSA 1EQQA 3PIPA 4DV7L 4DXFA 4L5SA 1XMOL 4JV5L 2B29A 1CI3M 4YHHQ 1N34Q 5EBCA 3R93A 4M8AA 1JE4A 3GTGB 4OWWB 4A3FB 4RKLA 3MXUA 3AQQA 2D0PA 2XRSD 3BDLA 2UXBL 5EKLA 1OXUA 1WVLA 1TY0A 3PO2G 2B3GA 1CK1A 2IHFA 1N8RC 1EIGA 1EYCA 2QCPX 2CKZB 2J0TD 1JCKB 4RHSA 4A3GG 3A74A 1WI5A 2K5DA 4OO1H 2JK8A 5C0XJ 1KAWA 2HHHL 1X3FA 3J80c 3S1MB 3E9IA 5FKAC 2YTYA 4A3FG 1EY4A 3KOJA 1MHWC 3BG3A 1UE6A 5ELEA 1I5FA 1F2YA 2L4NA 4ZLTF 4LAAA 1OO9B 3Q24A 1U4MA 1KD1C 3HOUH 1AW7A 1CKOA 3K7UC 2QW7A 4NW2A 2A68D 4KKSA 1PYBA 2BE5C 1G6ZA 2K05A 1HFGA 3ERSX 5JEAH 4LF4Q 4IPCA 3RN2A 5CORA 2K7VA 2AQ3B 5EKIA 4X62L 2BA0A 2F0KA 1S72A 3GO5A 4DAVA 5IGGA 5I9PA 2CHBD 3G7LA 3HG9A 3UI2A 1S4ZA 1K83H 4CKCA 1RDPD 4DK1A 3E0EA 2C9OA 2HQLA 3M7NA 4QF4A 1P16A 1SBBB 1BBUA 4QIWE 3EA6A 2JA7H 1X65A 2G5DA 3HOYB 1SYDA 4JI3Q 5EPKA 1MIUA 1QOHA 3CC4A 3GV6A 1LT3D 4P75A 1TWHB 1JT8A 2LS01 3CD6A 1VQAA 3R2IA 5HGTA 1HNXL 2R93H 4DR2Q 5ELCA 4A3DB 2K50A 3P1HA 5IP7G 1PRTF 4XDXA 4A3MH 1DOMA 3QG1A 4QMGA 4JK1C 4R4TA 1F9QA 2F0TA 3HOYG 2JA6B 1QNUA 3S24A 1IYUA 3K5OA 2R92H 3I90A 3I55A 1XYIA 1WTOA 4OX9L 1JWUD 3S2DB 3K5LA 1BO0A 2NVTB 2VQFQ 3LWEA 4JI0L 2OTJA 4LF7Q 1JICA 4ZAIA 3FP9A 3B6YA 3J7AF 4A3DG 4A3JB 5E1FA 4WJWA 3U9OA 5LMUL 4DR4L 4JI6L 2EQSA 1C48A 4X64Q 3A5UA 2RCNA 2A68C 1X6OA 3DWQA 4JI1L 1QWYA 4AYBE 2JA6G 2YTVA 5FK9C 1EZ8A 3K0XA 5BN3A 1EYAA 4GNXA 1DD2A 4R4OA 3NSWA 1YHBA 2SNMA 1TWCB 4MNOA 1Q8KA 4DFAA 4A3JG 1GXDC 1VF7A 5J39A 1ENFA 1VQHA 4ZKBB 2AUJD 4Y52H 4I7AA 3EIVA 1SJHD 3KLSA 1K9MC 1T9HA 5A35A 1M8AA 3QB3A 1K3BC 1PTOC 4XYOA 5M5YB 4K5XA 2EYHA 4C3IH 1C4QA 3FRPB 2FXQA 1L1OB 1VQCA 1Y8PB 4JCVE 4K0KL 1ESRA 3AB9A 1FYCA 2KHJA 4PG3A 3D8GA 4C56C 2F0IA 3C46A 3RMHA 3RZOH 1KAAA 3S2HB 4A3IB 5M9OA 5C3EH 2V4DA 1LABA 4HSVA 5ELDA 1Z47A 1XPUA 1U5KA 1W6KA 4B3MQ 4RH6A 5IYCG 2VUMB 3QO2A 3GTOB 2PMZE 3H15A 1LUZA 3A8IE 1K3RA 4X65L 4K8IA 1KXLA 4DNTB 4ZCKA 2K52A 3UDFA 3NQIA 3PO2H 1H9JA 4JOIC 1PH4A 1B8AA 1A6XA 1SYGA 4DV7Q 4HAEA 1XMOQ 2B2VC 4JV5Q 1QG7A 3ND9A 5CGKA 1GHJA 4A3IG 4A3GH 2NN6G 1RIPA 3L0OA 1HNWL 1FGUA 1V1PB 4P73A 4AIMA 1ZYRC 2VUMG 4JI8L 3GTGH 5NUCA 3I8ZA 4A3FH 2UXBQ 2R3ZA 3G48A 3FVQA 3T4AC 4QUFA 3S14H 3C1FA 1YITA 1EZ6A 1RL2A 4OWTB 3C1EA 5D65A 1K8AC 1GO3E 5IWAL 3V2TA 1CZWA 3W3AA 5GAGC 1YNXA 3SDZA 1IZ6A 4CJ2C 1ILPA 4G7HC 3A55A 1TWGB 1WTXA 2HHHQ 1CKMA 4KHVA 4UPAA 4RGNA 1WTVA 1E2WA 1NAPA 4ZRZA 3A54A 1LTBD 3KFUA 2VQEL 2N49A 3S1MH 4OIJA 1YBYA 3S15B 1H95A 2B2WC 3V05A 1HNZL 4A4IA 4JG2A 2EYOA 1XNRQ 4KN7C 2AHOB 1STAA 4NP5A 4BY1B 3MZ5A 2JYOA 1VQMA 3S17B 3I72A 3KDFB 2D9UA 4HIDA 4B3TL 3PUWA 1I94L 4O1NA 1VQBA 4E6IA 4GLXA 4X62Q 1WCMB 4UP9A 4DAPA 4CJ1B 1B44D 2NUCA 4XQNA 1ET9A 2LMCB 3H0GB 3K5NA 5IT9L 1JWSD 4IFDJ 1SE8A 2F0JA 5CV6A 3GD7A 3RZDB 4B3SQ 1BR9A 4BY1G 5KYIA 1D8LA 2RKSA 2CH4W 2F0QA 5K36G 3G4SA 3MHBA 5IP7H 3A8KE 4JBJA 2JN4A 4X6AH 2JA9A 2O2LD 1WCMG 1CFMA 3HOYH 4GN4B 1L1OA 3GTPB 1L0XB 4OO1I 1GJXA 5M5WB 1HNXQ 1F2LA 3H0GG 3K0YA 3H09A 1E0BA 1DGSA 4PQXA 1IBLL 4DAYA 3HOVB 1PA6A 3PV0A 1PH2A 2CW0D 1G2SA 1N32L 2F0LA 1LYLA 2IT1A 3CHBD 4BS9A 2F0HA 2E2DC 4IUPA 1A3TA 4A3DH 3NPPA 1QB5D 1JR0D 1HR0Q 1PMRA 4DNRB 1O78A 1AFPA 4CDEC 1I6HB 2EYPA 1V8QA 2I07B 2WACA 1I6VC 4OX9Q 4BA2I 4XIGS 1BXTA 5H1SE 1ASYA 2RDGA 4HJ7A 1TR5A 2OEOA 2Y0SB 3D6WA 4JI0Q 3M4YA 3NQTA 4UAIA 2NVTH 3HOVG 3ZYYX 3NBIA 2AQ2B 2PNRC 3CCUA 2MJ8A 3HOWB 4NXML 3QR8A 5LMUQ 4DR4Q 4JI6Q 3K6OA 4HSPA 4A3JH 2EY5A 4MN3A 3J80L 1SN8A 1E1OA 1C7YA 4TVAB 4RCOA 2RQXA 1WFQA 5C4JB 1ESFA 4JI1Q 3OTOL 3NHHA 1MJCA 3WDNA 3J81j 4WJ4A 2J4XA 3VYTA 2L0CA 1X3EA 5CV7A 2Y0SG 2L1BA 3M85A 4GOPA 1EQVA 1Y1WB 4FF4A 2H5XA 3KF8A 3MFYA 1I4PA 3K7AB 5JJLA 2NWGA 3HOWG 3GTQB 1TWCH 3D6CA 4FF3A 3UE1A 5FO8B 1D1KA 2PI2A 3EN2A 1XTCD 5DEHA 4YCUA 4U673 1PYWD 2CVRA 2ICIA 2C5CA 1EY7A 4F7XA 2Z6KC 1PTOF 2P5ZX 5IE8A 2HIXA 3DEOA 1A3VA 4DU9A 4K0KQ 5M5YH 3RD4A 1Y1WG 4TQUS 3X3MA 4QCLA 1MI2A 4H0LC 3TDQA 1JOKA 3PIP3 2ZXOA 4CDCC 2A8VA 1D7QA 4GN3B 3FHWA 3S2HH 4A3IH 1EYGA 1UWVA 1EY6A 2FHTA 1LTTD 1RKNA 2VUMH 2F0MA 4X65Q 4KLKA 1XMQL 1PV4A 3LX0A 1HQRD 1O7ZA 5C4ZA 3J81c 2E75C 4X3UA 3NE5B 2B63B 1IBKQ 3CMAA 3LWUA 1Q90A 3NUCA 1HCZA 3OSOA 2IPKD 2RHQB 2B8GA 3A7AB 2BDOA 4JC0A 1HNWQ 1STHA 4FF2A 4UHVA 3U50C 3K57A 4FF1A 2XTIA 4JI8Q 3VYRA 2L9HA 2VS1A 1O7IA 1W6JA 3UDIA 1HUNA 1Z6HA 1V1OA 1VMPA 4OXPA 2PW5A 3CMEA 4HMJA 4IURA 2G9HD 5IWAQ 2B63G 2SOBA 1ZKOA 3M4OB 2UU9L 1HQMC 5DNFA 1ONLA 2N88A 4B3RL 1GM5A 3NEMA 3T1YL 1JJCB 2E76C 3FMCA 3A0JA 3AEVA 2D0OA 2NVYB 1TWGH 2VQEQ 2RVLA 1UUPA 3I4LA 4NXNL 1TWFB 1VCIA 1M90C 4R8IA 1WTRA 3D0FA 1O7LA 1VQNA 4K5WA 1GUOA 2HDLA 4GLVB 1I3QB 5C3WA 1HNZQ 2R7FA 2KECA 1BKBA 1NJIC 3I91A 4UY8C 3S15H 3J7AV 4LF5L 2DJGC 3GTJB 5CV5A 1OXVA 1PLFA 3DLLA 3L2PA 5HGQA 4EGVA 3CAMA 4LJZC 3CCLA 4BY1H 3AMUA 1QJOA 1SNCA 1AE2A 1EIHA 4B3TQ 1EU4A 1GUGA 5K36H 2MP1A 1I94Q 3PF5A 4P72A 1CTMA 3MAQA 3U4ZA 1YJNA 1VDZA 1X3GA 1J8IA 2KCTA 5IT9c 1KHIA 2N78A 1MSHA 3TS2A 1AH9A 2HCIA 2BA1A 4IZ8A 1WCMH 2NVQH 5CV9A 3GP7A 4A3EB 1X3QA 4DR3L 3D4WA 1HUMA 1IKMA 4B08A 2OQ0A 3H0GH 2KCNA 3KLWA 5LMNW 4JPBW 1BQQT 3CRKC 2OQKA 4HJ5A 2WB1B 3VR2A 1EY0A 3BYYB 1FL0A 4FNFA 4DR1L 4QY7A 4POGA 2I0QA 4G7ZC 2Z1CA 4C3JB 3FDTA 2BH2A 1ENAA 3CP0A 3KK7A 3NWSA 4QQBX 1WTHA 1NNXA 4KI0A 4A3EG 1U4RA 2N55A 3GTPH 1N32Q 2X6GA 4IALA 1DOKA 2EYJA 5CBEE 4P71A 5M5WH 3HOVH 2F4VL 1FNWA 2Z4IA 2WB1G 2Z6BA 2ZM6L 4ID6A 5IIFA 2JQOA 5C0XG 1R4QB 4ALPA 4CDDC 2KCCA 3RLFA 2UUAL 1FJGL 4C3JG 1VQ9A 1I6HH 4YCWA 4GNXB 1LT4D 2ALYB 2BCOA 4KHZA 4R1JA 2EYFA 4DF7A 1EEID 1Q1EA 3CCRA 4ZUJA 4EQ5A 3CCVA 1VF5C 3S16B 1OXTA 3MWYW 4A3LG 1YHQA 5C44H 5LMNL 4NXMQ 2PNHA 2PZTA 2ZTDA 3FPUB 3TZUA 4J15A 4DR7Q 1HZ9A 2WINB 1CT1D 3HP3A 3BDCA 3HOWH 4J6HA 1E7ZA 3SXHA 1TS5A 1Q46A 4F87A 1EL0A 1I4HA 2JEBI 2RSNA 4I65A 1C8CA 5C4JH 1KABA 3A7LA 4IUUA 4HIOA 3VR4A 4OGQC 3RN5A 5IGBA 3Q8DA 3GDEA 4V190 3H3VC 3I4NB 1Y1WH 3GQBA 2JE6I 5I2XA 2L55A 3KBXA 3JAMc 2Q2UA 4K5VA 3MTSA 1VQIA 3K7AH 1IHZA 2JJQA 3GTQH 1PYSB 1K0RA 2B2YC 2XSCA 5IY0A 4R9WA 3W1GA 1RHPA 1EOTA 1F9PA 3X3NA 5AJ3L 4LF8L 1PZID 3NENA 1PH6A 3L3OC 1YEZA 4APVA 5FLXc 2UXCQ 1BOSA 3PUVA 1KLGD 2B2TC 4LFAQ 4TSSA 3S1RB 2M00A 1TIID 2VZAA 1LLRD 3CW2C 5FOBB 3M3YB 3C2PA 3E9HA 2KEEA 2EPBA 1X55A 3TP6A 1DZ1A 4BBRB 3Q22A 3CPWA 3I4NG 4JI5L 2K28A 3H91A 1A8VA 4FXDA 3M7GA 1B70B 4DV2L 1SYBA 2Q8RE 4A76A 4UP7A 4JYAL 4OHJA 2L5TA 2B2YA 1STYA 1X56A 2Q8TA 3P20A 5KRUA 1Z7TA 3VR3A 1BF4A 4HN7A 1XMQQ 1HA5A 2RA4A 4YIJA 2K33A 1F9SA 2ID0A 2B2TA 1MSGA 2ZXRA 5EKKA 2EJGC 4HCEA 1V1QA 1QVCA 1VQGA 1H9SB 2CH4A 1B3AA 4QB4A 3SE0A 3W2DA 4BBRG 3PGZA 1S5FD 2I5HA 4IO9A 1SYCA 3GTKB 4YWMA 1C0AA 1E24A 4GNXC 4Y7NB 5AFWA 1SE2A 3TZDA 4DV0L 1RF2D 4L8JA 5DM63 1LTLA 1PFSA 3F1ZA 1H9KA 3ULPA 1WTQA 1BCPB 4KK7A 2UUBL 4IOAA 2OXPA 1D5ZC 4YWKA 4KTAA 5M5XB 2UU9Q 4B3RQ 1WOCA 4P74A 4B9XA 2YV5A 3LGJA 3T1YQ 1BCPD 3M4OH 2MGSA 4GKKL 2TMPA 3HKSA 4BXXH 3CC2A 3D31A 1D1IA 4NXNQ 1GUTA 5CV8A 2NVYH 1WD0A 2RDHA 1TS2A 2AQ1B 5EAYA 4OEMB 3VYSA 4POFA 1TWFH 4X3TA 4IJLA 3CRLC 2F3WA 3DEPA 4LF5Q 1SMXA 3VR6A 2VW9A 1I3QH 1STEA 2PPBC 5CMDA 3CCQA 3GTJH 2ASBA 1SMYD 5C4HA 5L37A 3KBGA 3K59A 4BY7B 2X69A 5IYBG 1HHVA 2Z0SA 4DNIA 3C3LA 2DY7A 2MFIA 3ONAB 5KEEA 2EZVA 3H3VH 3K8AA 4G4KA 2DNEA 4RCNA 4HJ9A 1B9MA 1ET6A 4UP8A 3PIOA 1ENCA 4YY3L 4DV6L 1DJRD 3WOFA 4DAYB 3EBEA 2ENBA 2I46A 4DR3Q 5JJKA 3DHQA 3DM3A 3DWPA 2RSOA 3ND8A 4A3EH 3STBD 3KJOA 2H1EA 2IW3A 1CKNA 4RMFA 2XIWA 2ZXPA 2Y0SE 1CA6A 3PCOB 3PUXA 1J5EL 4QL5A 1K0SA 4BY7G 1IYVA 4DR1Q 1FNUA 1J6QA 2B8FA 1B50A 3I7FA 2M2LA 5I6YA 2XRQD 1GUNA 5C0XH 4PZ6A 4LMQD 1Q8IA 3J81L 4C3JH 3ULLA 3R2TA 4MTKA 1R4PB 1CM9A 2PZUA 1H9RA 1ICWA 1VQDA 2Z8LA 1X9NA 2F4VQ 4A3LH 4LF9L 1VS0A 1IYJB 3MXPA 2OT2A 3OIPA 1JC7A 1HJPA 4X66L 3CCMA 1LTID 2A6HD 3UE0A 1VQ4A 3F2UA 3L9AX 1PXUA 1ZEQX 3OHXC 3PQIA 1FJGQ 4KD4A 1Y1VB 3I4MB 1IL8A 4C3HB 2JXMB 3HKZB 4GOPB 1LTSD 3CPFA 4TRDA 1G2TA 4MHEA 3O13A 2ZT9C 2R7ZB 1H9SA 3IFTA 3KF8B 5JPNC 3T16A 2K1BA 5LMNQ 4IUNA 1S3OA 2KVMA 3S16H 2A1AA 2YU9B 1EU3A 1A3UA 3ULJA 1DONA 2F0WA 1QZHA 2PCFB 4PMBA 4JI2L 1KIXA 1Y1VG 2XWJB 2VNUD 3I4MG 3OMCA 4ZQ3A 4C3HG 3HKZG
chains in the Genus database with same CATH topology
1Y8OB 1D5MC 2F0FA 4X3KA 2K01A 4N9PA 3P75A 4A3BB 5C4XB 4IFDG 5ISRA 5D3DA 1G8ZD 4ZK9B 2XWBB 1KDAA 3FKIB 3E0JA 5KNBA 4IUTA 3SHLA 1GUWA 2E2JB 4RA8A 4RGMA 1RTOA 4KKTA 4H13C 5IT9E 1S5CD 3TSSA 4AYBB 1K8OA 5FO9B 2CQAA 2R6GA 4PMWA 4C1NK 4Q0FA 3MC0B 2ICEC 1WTWA 1KNAA 3TBIB 2Q8IB 1D2BA 3G6JB 1HFNA 4HTHA 1IKLA 2IX1A 3QWNA 4UDUC 2NYZD 4WRDA 2XN9C 5JOBA 4L63B 1SE3A 3KLSX 2EVBA 1M4VA 1D6EC 1NCVA 1HTLD 2NTSA 4HEDA 2OF1A 1SE4A 3N52A 3SVMA 4XT1B 3A8JE 3NK9A 2L11A 3MA2B 5KNCA 5G3LD 1PFMA 3CQZB 5A2QE 2Z4HA 5C6AA 2PYKA 2NVXB 2M9VA 1WTPA 2A69D 4Q5VA 3GV3A 2R61A 1MD2D 2GA4B 2K04A 1A2TA 2D2CC 4KMUC 1STNA 2EE1A 3J80E 3J7YW 3VA7A 3OOCA 3A56A 4H7BA 5LL6X 2K5QA 4XT3B 2KHSA 3GTMB 4OO1G 4RAUC 3K58A 3JAML 4CHTB 1UNSA 1TU2B 5DM73 3LNNA 1LV9A 5CR3A 5FLXL 4IUVA 3NWTA 1U9RA 4DGZA 1HRJA 2AWNA 5IGEA 1RJTA 2J7ZA 5LL6S 4A3KB 5JAVA 4XQJA 1PFNA 2NN6H 2CW0C 4CKBA 3OMGA 3NXWA 5JEAG 4RGOS 4CGYB 4MIUA 1SFOB 3OWFA 4ODGA 3Q0AA 1G91A 1UAPA 1RCVD 3OIQA 1STBA 4ZUIA 4H44C 5JEAJ 4EQOA 4FP5D 2F03A 2JEAI 3NTKA 1NR4A 3BVGA 3L7ZC 5KNDA 1DXMA 5CC4A 1EQTA 2FINB 5COYA 2K32A 2K03A 4TKOB 4KY5A 3N6RA 3EROA 1EY9A 2A69C 2WAQB 4A93B 1I4GA 2FJ2A 3BYTB 2LKVA 4IFDH 2F4IA 5LHY1 1II3A 4OL7A 5JVG3 5IODA 1KDBA 4R8NA 3IL8A 3DMUA 1EWHA 2B2UA 4NKLA 4X3SA 1TY2A 2TSSA 2XNAC 1I4RA 3RUZA 1RODA 5IGFA 4HMIA 3I73A 4KY7A 1S5DD 2KJXA 1XWEA 4KJNA 3KUPA 2EYLA 1PZJD 1JORA 1RD9D 2F0NA 4U68A 3NBHA 3PUZA 2KUMA 2E2HB 4KY6A 3EQLC 3HOZB 1ML0D 1U4LA 3RZOB 3EVQA 4C2MB 1IW7D 3SK8A 4O42A 1F77A 5KYLA 4ZKCB 3SK6A 4C1NI 1OXXK 3QOJA 2FFKB 3PUYA 5CBAE 5ELFA 4V0BA 3DM1A 1QNKA 3FEWX 2MUYA 2K5WA 1NUCA 3TP8A 3TP5A 4HR7B 1RTNA 5E3FA 3I3CA 1SAPA 4HCSA 1JB3A 2WIIB 1Y69U 1R9TB 1LT6D 5T1GA 1HA6A 5I9OA 5J22A 1QE6A 3S14B 5JPMC 3T53B 3KLRA 4JBWA 1CHPD 4K2LA 2DY8A 1BDOA 4FXGC 1KLUD 1BUVT 3VA5A 3QIAA 1EFID 2LFNA 1EY5A 3CU7A 4IN3A 3IKJA 1YNND 3Q23A 3H94A 3HZXA 4ILWA 3PIO3 2AUKA 2JA8B 2F0OA 3T56B 4Z9CB 1HPCA 1A15A 1TWAB 1B1ZA 2IL8A 1CQFA 2QDBA 1IW7C 2QF7A 3PMFA 3HS0C 2FMCA 2A74C 5IGCA 3BS1A 4KKUA 3R3OA 5EPJA 1PTOB 2RDFA 1LTAD 2EYMA 1PDQA 1SNQA 3V96A 3S1QB 1PTOD 3SK5A 1FR3A 2F0VA 1KDCA 3IAYA 4RFBA 1X32A 3T51B 4NDXA 2DNCA 3P7JA 1U4PA 2JA5B 5IOCA 1H9MA 4S3SA 2EXZA 4I7ZC 4BWGB 4DK0A 4XXEA 5I4DA 2A6ED 2HQEA 4K6DA 3HRZC 3H6MA 1L0YB 5F2DA 5KGUA 4KD3A 5G3LF 4WFN3 1DYQA 5EGTA 1SXTA 5IGDA 1CA5A 2EY1A 4K6LA 1STGA 3NTIA 2HUGA 1KNEA 1YNNC 3BDOA 3FPPA 4QUCA 2F0UA 1K8MA 2X6LA 1ZYRD 1JOOA 1S5BD 2KEDA 2F0EA 3VYUA 4BBSB 2NN6I 3HOXB 1LTGD 3PO3B 2E2IB 1AEXA 5EPLA 4FXKC 3E6ZX 1V43A 1LT5D 2BOSA 2G9DA 1EWCA 2PZWA 1F2ZA 1GHKA 5I6WA 2KQ3A 3NP8A 2HCCA 4DXGA 3DWAA 3TMEA 1WD1A 1HTPA 2EY6A 5M3MB 2F0GA 4J8QA 2JP1A 1EEFD 1SNPA 1TVXA 2F0DA 4N9TA 4ULLA 2D5DA 1I50B 1FD7D 1DM0B 2A6EC 1LTRD 1NSNS 4KJOA 1XXGA 1YNJD 3DUZA 1EYDA 5M3FB 1ZXTA 5D14A 4IFDI 1SSOA 3TP7A 3J81E 4OIKA 1JQYD 1O80A 1BCPC 2NBFA 2AWOA 2KOLA 1FGBD 1O7YA 4QIWB 3NTHA 4LK1C 2IX3A 3S1NB 3TN2A 5I2YA 1I4QA 3URYA 3SK4A 1Q3LA 1S5ED 2MPMA 2H4OA 1SMYC 4J1MA 4RHRA 1AP0A 1T5EA 2B2VA 5BN4A 1SJED 1TS4A 3GTLB 2YYZA 4ZYSA 4IQZA 4NMZA 1J9OA 3BZDB 2SEBD 1SDFA 2EJFC 4K8JA 5FO7B 2FMMA 2PO4A 1XX8A 3D4DA 3CKIB 2NVQB 4IUQA 1FNVA 2IX0A 5ELBA 4G57A 4RWSC 4EQPA 1HXYD 1B9NA 1Q12A 1GOZA 2B2WA 3MFGA 3OWEB 1F9RA 3U9SA 1E2VA 1YNJC 2HDMA 2F1MA 1QCBD 1PTOH 3OW7A 1F2MA 5D3IB 4F88A 1T5XD 2A6HC 5JJZA 2QKIC 2QILA 3VR5A 1LACA 4EVOA 3BVZA 2WKDA 2EDGA 1JWMD 2XVSA 5E4XA 1GUSA 2MHVA 4GZYC 4FVMA 2O4XA 5T1IA 5HURA 2F3VA 1PRTB 2PW7A 4K2KA 1AN8A 1EY8A 1PFBA 5K5PA 4RKBA 3DXJC 1PRTD 4P2CB 3D4RA 2PQEA 4FYDA 3D3RA 5A2QL 1DOLA 5EQ0A 3E5SA 5C44B 3T13A 2PMZB 1CZGA 2F0SA 2A5HA 1A2UA 3QOLA 1Y8NB 1B4OA 4K14A 1KTKA 4PMCA 1V1PA 3HOUB 5DAUA 4F8MA 3MEHA 4DA2A 1SNOA 1TT2A 3SEBA 4RGTA 3ITPA 2A73B 5BN5A 2KA7A 2VB2X 2WV6D 1MBYA 2IJ0A 2RBMA 4WORA 4EQNA 3WOEA 2NB0A 4XYQA 4XTCS 1K83B 1SNMA 1ILQA 3JAME 3HEJA 5C5MA 3EFXD 5C3XA 1OXSC 3MVVA 1SEBD 1X3PA 1UEAB 1TQOA 2JA7B 5FLXE 1SNDA 2LY7A 5E4WC 5JVH3 2EY2A 1SYEA 4ME5A 4ABNA 1TKWB 3AU7A 1G291 3EJIA 5CV4A 1AZPA 2EOTA 4CKEA 3R8BA 2L12A 2BDNA 2DN8A 2R93B 4B9WA 1D5XC 4A3MB 4BA1I 3ERQA 2K6AA 4G7OC 1PRTC 2WP8J 1BCPF 2R92B 1E2ZA 1QILA 2EJMA 5EBDA 4XQQA 4CBVA 1AZQA 5J1ZA 2B2UC 1SYFA 4FO2A 2SDFA 2IWHA 5KIXA 3SR1A 4PV1C 3I70A 2QEJC 3IFDA 2E74C 2VXWA 2JSOA 1CHQD 5C5LA 1BNZA 1DCZA 4DN4M 1CQVA 3S9WA 1LO5D 2B39A 2VB3X 1JOQA 5C0XI 3MXNA 3MXGA 5CYUA 1NR2A 3OPOA 5TSSA 1I4XA 2F0PA 2O5JC 1B2TA 2D62A 2SNSA 4C3IB 3BVMA 2BE5D 1BBXC 2O5IC 4PNYA 1VMCA 4KV6A 1PZKD 5C3EB 5EJWA 2NZ1D 4L6TB 1TS3A 1B53A 4CJ0B 2NTTA 3K5MA 1Q1BA 3HGBA 4KN4C 4C3IG 2WKCA 3PO2B 4M1UB 3QJYA 3Q6SA 4A3GB 1MGSA 4DXFA 1CI3M 5EBCA 3R93A 4M8AA 1JE4A 3GTGB 4A3FB 4RKLA 3MXUA 2XRSD 3BDLA 5EKLA 1OXUA 1WVLA 1TY0A 1CK1A 1EIGA 1EYCA 2QCPX 2J0TD 1JCKB 4RHSA 4OO1H 2K5DA 5C0XJ 3S1MB 5FKAC 1EY4A 3BG3A 5ELEA 1F2YA 2L4NA 4ZLTF 4LAAA 1OO9B 3Q24A 1U4MA 1AW7A 4NW2A 2A68D 4KKSA 2BE5C 1G6ZA 2K05A 1HFGA 5JEAH 5CORA 2K7VA 2AQ3B 5EKIA 2BA0A 2F0KA 3GO5A 4DAVA 5IGGA 5I9PA 2CHBD 3G7LA 3HG9A 3UI2A 1S4ZA 4CKCA 1RDPD 4DK1A 2C9OA 3M7NA 4QF4A 1SBBB 3EA6A 3HOYB 1SYDA 5EPKA 1QOHA 3GV6A 1LT3D 1TWHB 2LS01 3R2IA 5HGTA 4A3DB 5ELCA 3P1HA 1PRTF 4XDXA 1DOMA 3QG1A 4QMGA 4JK1C 1F9QA 2F0TA 2JA6B 1QNUA 1IYUA 3K5OA 3I90A 1XYIA 1WTOA 1JWUD 3S2DB 3K5LA 1BO0A 2NVTB 3LWEA 1JICA 4ZAIA 3J7AF 4A3JB 5E1FA 4WJWA 3U9OA 1C48A 2A68C 3DWQA 1QWYA 5FK9C 1EZ8A 5BN3A 1EYAA 1DD2A 3NSWA 2SNMA 1TWCB 4DFAA 1GXDC 1VF7A 5J39A 4ZKBB 1ENFA 2AUJD 1SJHD 3KLSA 5A35A 1M8AA 3QB3A 1PTOC 4XYOA 5M5YB 4K5XA 2EYHA 1C4QA 3FRPB 1Y8PB 1ESRA 3AB9A 1FYCA 3D8GA 4C56C 2F0IA 3C46A 3RMHA 1KAAA 3S2HB 4A3IB 5M9OA 2V4DA 1LABA 4HSVA 5ELDA 1Z47A 1W6KA 4RH6A 2VUMB 3QO2A 3GTOB 3A8IE 4K8IA 4DNTB 3NQIA 1H9JA 1A6XA 1SYGA 4HAEA 2B2VC 1QG7A 3ND9A 5CGKA 1GHJA 2NN6G 1V1PB 1ZYRC 5NUCA 3I8ZA 2R3ZA 3FVQA 3T4AC 4QUFA 3C1FA 1EZ6A 3C1EA 5D65A 3V2TA 1CZWA 3W3AA 3SDZA 4CJ2C 1ILPA 4G7HC 3A55A 1TWGB 1WTXA 4KHVA 4RGNA 1WTVA 1E2WA 1NAPA 4ZRZA 3A54A 1LTBD 4OIJA 3S15B 2B2WC 3V05A 2EYOA 4KN7C 1STAA 4NP5A 4BY1B 3MZ5A 2JYOA 3S17B 3I72A 2D9UA 3PUWA 4O1NA 4E6IA 1WCMB 4DAPA 4CJ1B 1B44D 2NUCA 4XQNA 1ET9A 2LMCB 3H0GB 3K5NA 5IT9L 1JWSD 4IFDJ 2F0JA 5CV6A 3GD7A 3RZDB 1BR9A 5KYIA 2RKSA 2F0QA 5K36G 3MHBA 3A8KE 2O2LD 1CFMA 3GTPB 1L0XB 4OO1I 1GJXA 5M5WB 1F2LA 3K0YA 3H09A 1E0BA 4PQXA 3HOVB 4DAYA 3PV0A 2CW0D 1G2SA 2F0LA 2IT1A 3CHBD 4BS9A 2F0HA 2E2DC 4IUPA 1A3TA 3NPPA 1QB5D 1JR0D 1PMRA 4DNRB 1O78A 1AFPA 1I6HB 2EYPA 1V8QA 2I07B 2WACA 1I6VC 4BA2I 4XIGS 1BXTA 2RDGA 1TR5A 2OEOA 2Y0SB 3D6WA 3M4YA 3NQTA 4UAIA 3ZYYX 3NBIA 2AQ2B 2PNRC 2MJ8A 3HOWB 3K6OA 4HSPA 2EY5A 4MN3A 3J80L 4RCOA 2RQXA 5C4JB 1ESFA 3NHHA 3WDNA 2J4XA 3VYTA 2L0CA 5CV7A 2L1BA 3M85A 1EQVA 1Y1WB 4FF4A 3KF8A 3MFYA 1I4PA 3K7AB 2NWGA 3GTQB 3D6CA 4FF3A 5FO8B 1D1KA 5DEHA 1XTCD 4U673 1PYWD 2CVRA 2ICIA 2C5CA 1EY7A 4F7XA 1PTOF 3DEOA 1A3VA 4DU9A 3RD4A 4TQUS 3X3MA 4QCLA 1MI2A 4H0LC 3TDQA 1JOKA 3PIP3 2ZXOA 1EY6A 2FHTA 1LTTD 1RKNA 2F0MA 3LX0A 1HQRD 1O7ZA 5C4ZA 2E75C 4X3UA 3NE5B 2B63B 3LWUA 1Q90A 3NUCA 1HCZA 3OSOA 2IPKD 2B8GA 3A7AB 2BDOA 1STHA 4FF2A 3K57A 4FF1A 3VYRA 2L9HA 1W6JA 1HUNA 1Z6HA 1V1OA 1VMPA 2PW5A 4HMJA 4IURA 2G9HD 2SOBA 1ZKOA 3M4OB 1HQMC 5DNFA 1ONLA 2N88A 2E76C 3FMCA 2NVYB 2RVLA 1UUPA 3I4LA 1TWFB 1VCIA 4R8IA 1WTRA 1O7LA 4K5WA 1GUOA 2HDLA 1I3QB 5C3WA 2KECA 3I91A 3J7AV 3GTJB 5CV5A 1OXVA 1PLFA 4EGVA 4LJZC 3AMUA 1QJOA 1SNCA 1EIHA 1EU4A 1GUGA 5K36H 2MP1A 1CTMA 3MAQA 1VDZA 1J8IA 1MSHA 2HCIA 2BA1A 4IZ8A 5CV9A 3GP7A 4A3EB 1X3QA 3D4WA 1HUMA 1IKMA 4B08A 2KCNA 1BQQT 3CRKC 2WB1B 3VR2A 1EY0A 3BYYB 4FNFA 4G7ZC 2Z1CA 4C3JB 3FDTA 1ENAA 3KK7A 3NWSA 4KI0A 1U4RA 2N55A 2X6GA 4IALA 1DOKA 2EYJA 5CBEE 1FNWA 2Z4IA 4ID6A 5IIFA 5C0XG 1R4QB 2KCCA 3RLFA 4C3JG 1LT4D 2BCOA 4KHZA 2EYFA 4DF7A 1EEID 1Q1EA 4ZUJA 1VF5C 3S16B 1OXTA 3MWYW 2PZTA 3FPUB 3TZUA 2WINB 1CT1D 3HP3A 3BDCA 4J6HA 3SXHA 1TS5A 4F87A 1EL0A 1I4HA 2JEBI 2RSNA 4I65A 1C8CA 1KABA 3A7LA 4IUUA 3VR4A 4OGQC 5IGBA 4V190 3H3VC 3I4NB 5I2XA 2JE6I 3GQBA 2L55A 3KBXA 4K5VA 3MTSA 1IHZA 2B2YC 2XSCA 4R9WA 1RHPA 1EOTA 1F9PA 3X3NA 1PZID 3L3OC 1BOSA 3PUVA 1KLGD 2B2TC 4TSSA 3S1RB 2M00A 1TIID 1LLRD 5FOBB 3M3YB 3C2PA 2KEEA 2EPBA 3TP6A 1DZ1A 4BBRB 3Q22A 2K28A 3H91A 4FXDA 3M7GA 1SYBA 2Q8RE 4OHJA 2L5TA 2B2YA 1STYA 5KRUA 3P20A 2Q8TA 1Z7TA 3VR3A 1BF4A 4HN7A 1HA5A 2RA4A 4YIJA 2K33A 1F9SA 2ID0A 2B2TA 1MSGA 2ZXRA 5EKKA 2EJGC 4HCEA 1H9SB 1B3AA 4QB4A 3SE0A 3W2DA 1S5FD 1SYCA 3GTKB 4Y7NB 5AFWA 1SE2A 3TZDA 1RF2D 4L8JA 5DM63 1H9KA 1WTQA 1BCPB 4KK7A 2OXPA 1D5ZC 4KTAA 5M5XB 4B9XA 1BCPD 2MGSA 2TMPA 3D31A 1D1IA 1GUTA 5CV8A 1WD0A 2RDHA 1TS2A 2AQ1B 3VYSA 4X3TA 3CRLC 2F3WA 3DEPA 3VR6A 1STEA 2PPBC 5CMDA 1SMYD 5C4HA 3KBGA 3K59A 4BY7B 2X69A 1HHVA 3C3LA 2DY7A 3ONAB 2EZVA 5KEEA 4G4KA 2DNEA 4RCNA 1B9MA 1ET6A 1ENCA 1DJRD 3WOFA 2ENBA 2I46A 3DHQA 3DWPA 2RSOA 3ND8A 2H1EA 2IW3A 1CA6A 2XIWA 2ZXPA 3PUXA 1IYVA 1FNUA 2B8FA 1B50A 2M2LA 5I6YA 2XRQD 1GUNA 5C0XH 4LMQD 1Q8IA 3J81L 3R2TA 1R4PB 1CM9A 2PZUA 1H9RA 1ICWA 2Z8LA 3MXPA 2OT2A 3OIPA 1JC7A 1LTID 2A6HD 3F2UA 3L9AX 1PXUA 1ZEQX 3OHXC 4KD4A 1Y1VB 3I4MB 1IL8A 4C3HB 2JXMB 3HKZB 1LTSD 4TRDA 1G2TA 4MHEA 3O13A 2ZT9C 2R7ZB 1H9SA 3IFTA 5JPNC 3T16A 2K1BA 4IUNA 2KVMA 2YU9B 1EU3A 1A3UA 1DONA 2F0WA 2PCFB 4PMBA 2XWJB 2VNUD 3OMCA 4ZQ3A 4C3HG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHZ A;  2EY1 A;  1A2T A;  2LKV A;  2O4X A;  2RKS A;  2F0Q A;  1STN A;  2F3V A;  3VA5 A;  4E6I A;  1II3 A;  2F0F A;  5HUR A;  4IZ8 A;  5C4H A;  3MHB A;  1STG A;  4OL7 A;  5CV9 A;  2PW7 A;  4N9P A;  4K2K A;  1EY8 A;  5HGT A;  5IOD A;  3P75 A;  4H7B A;  1EY5 A;  4K8I A;  1JOK A;  1KDB A;  3D4W A;  4R8N A;  5K5P A;  5ISR A;  4RKB A;  2F0U A;  5KEE A;  3SK4 A;  2KHS A;  4RKL A;  1JOO A;  2M00 A;  2PQE A;  3P1H A;  3DMU A;  3BDL A;  1EY6 A;  5J1Z A;  1EY0 A;  1KDA A;  1ENC A;  1SYF A;  1SYG A;  4QMG A;  1RKN A;  3E5S A;  3HZX A;  5EKL A;  4NKL A;  3TP6 A;  2F0E A;  2ENB A;  4J1M A;  2F0M A;  3T13 A;  5CGK A;  5KIX A;  2F0T A;  3DHQ A;  3LX0 A;  3SR1 A;  5C4Z A;  2F0S A;  1A2U A;  2F0O A;  3QOL A;  1EYC A;  2F0L A;  3SHL A;  3RUZ A;  1SYB A;  5IGF A;  5CR3 A;  4HMI A;  4K14 A;  2F0H A;  4KY7 A;  1ENA A;  1A3T A;  4PMC A;  5NUC A;  4KJN A;  1U9R A;  1AEX A;  3NUC A;  1STY A;  4DGZ A;  2EYL A;  5KRU A;  5DAU A;  1JOR A;  3OSO A;  5IGE A;  2EYP A;  2F0N A;  3C1F A;  3MEH A;  4NMZ A;  4F8M A;  1EZ6 A;  1SNO A;  1TT2 A;  5C5L A;  4YIJ A;  5I6Y A;  2WAC A;  4IAL A;  5JAV A;  2EYJ A;  3C1E A;  1STH A;  2QDB A;  5E1F A;  3U9O A;  1EY4 A;  3V2T A;  3ITP A;  5EKK A;  3OMG A;  4DU9 A;  1TR5 A;  2OEO A;  2PZW A;  3NXW A;  3PMF A;  1F2Z A;  4KY6 A;  4K8J A;  3S9W A;  4ID6 A;  1F2Y A;  3EVQ A;  3NQT A;  5I6W A;  4MIU A;  4QB4 A;  5IIF A;  5IGC A;  2PW5 A;  4LAA A;  3SK8 A;  2PZU A;  2KQ3 A;  4HMJ A;  4KHV A;  5KYL A;  2RBM A;  3D4D A;  3NP8 A;  1SYC A;  3OWF A;  4ODG A;  4WOR A;  4EQN A;  1JOQ A;  3SK6 A;  1STB A;  2SOB A;  3QOJ A;  3R3O A;  4ZUI A;  1EZ8 A;  3TME A;  4EQO A;  2RDF A;  2EY5 A;  2EYF A;  1EYA A;  2EYM A;  3MXP A;  4HTH A;  4DF7 A;  4ZUJ A;  1SNM A;  2F0P A;  2EY6 A;  1SNQ A;  4G57 A;  4WRD A;  2SNM A;  5JOB A;  3HEJ A;  4EQP A;  5C5M A;  2SNS A;  5C3X A;  3MVV A;  4KD4 A;  4DFA A;  2F0G A;  3NHH A;  2EYO A;  1NUC A;  3SK5 A;  2F0V A;  2OXP A;  4PNY A;  1STA A;  2PZT A;  4NP5 A;  1TQO A;  5CC4 A;  3TP8 A;  5J39 A;  2F0K A;  3MZ5 A;  4KTA A;  4KV6 A;  4TRD A;  3BDC A;  3TP5 A;  5CV7 A;  1KDC A;  1SNP A;  1SND A;  2F0D A;  4J6H A;  4B9X A;  5IGG A;  5I9P A;  4N9T A;  1EQV A;  5E3F A;  3SXH A;  4K5W A;  3T16 A;  2EY2 A;  1F2M A;  1SYE A;  4ME5 A;  4NDX A;  2OF1 A;  5C3W A;  4I65 A;  1NSN S;  4KJO A;  4IUN A;  4KY5 A;  5KYI A;  5IOC A;  4QF4 A;  3NK9 A;  3ERO A;  1A3U A;  3QB3 A;  3D6C A;  1EYD A;  3EJI A;  4S3S A;  5CV5 A;  1EY9 A;  1KAB A;  2EYH A;  4K5X A;  2EXZ A;  4EVO A;  5DEH A;  5CV4 A;  2F0W A;  5I9O A;  5J22 A;  4PMB A;  5CV8 A;  3TP7 A;  5IGB A;  2HQE A;  4K6D A;  1SNC A;  3H6M A;  2NUC A;  3D8G A;  5F2D A;  4K2L A;  2F0I A;  4KD3 A;  1EY7 A;  5KGU A;  5C6A A;  1KAA A;  2PYK A;  4B9W A;  4F7X A;  5M9O A;  1SYD A;  2F0J A;  2F3W A;  5EGT A;  5CV6 A;  5IGD A;  3OMC A;  4ZQ3 A;  4K5V A;  1A3V A;  3ERQ A; 
#chains in the Genus database with same CATH topology
 1Y8O B;  2K75 A;  1D5M C;  2F0F A;  4X3K A;  4DAM A;  2R7Z G;  2K01 A;  4N9P A;  1EQR A;  3P75 A;  4A3B B;  5C4X B;  4IFD G;  5ISR A;  5D3D A;  1G8Z D;  3I4N H;  1L1O C;  4ZK9 B;  3BJU A;  2XWB B;  1KDA A;  5AJ3 Q;  3FKI B;  3E0J A;  5KNB A;  2GVB A;  4IUT A;  3SHL A;  1Q82 C;  2V1C C;  1IL2 A;  1GUW A;  2E2J B;  3S1R H;  4RA8 A;  4RGM A;  3I2Z A;  2K5V A;  5GAH C;  3JC6 6;  1RTO A;  4KKT A;  1PVO A;  4A3B G;  2MO1 A;  3M3Y H;  5C4X G;  4H13 C;  4DV2 Q;  5IT9 E;  2UXD L;  4BBR H;  1S5C D;  3TSS A;  4AYB B;  1K8O A;  5FO9 B;  2CQA A;  4JYA Q;  2R6G A;  4PMW A;  4GS3 A;  1X54 A;  4Q0F A;  4C1N K;  3FKI G;  3MC0 B;  2ICE C;  1WTW A;  1TWH H;  1KNA A;  5GQO A;  3TBI B;  1VQ8 A;  3F2B A;  2Q8I B;  1D2B A;  3G6J B;  3BU2 A;  1HFN A;  4HTH A;  1IKL A;  4IPG A;  2IX1 A;  3QWN A;  4UDU C;  2NYZ D;  4WRD A;  2XN9 C;  4LUO A;  5JOB A;  1S40 A;  4IPH A;  4L63 B;  3PSI A;  1SE3 A;  2JA6 H;  3KLS X;  2RCF A;  4AYB G;  5DLQ E;  2EVB A;  4GOP C;  1M4V A;  3AYH B;  1D6E C;  3NEL A;  3GTK H;  1NCV A;  3S2D H;  1HTL D;  4DV0 Q;  1VQP A;  3TEH B;  4Y7N H;  3UDX A;  1W3S A;  4DPG A;  2NTS A;  4HED A;  2OF1 A;  1SE4 A;  3N52 A;  3SVM A;  4XT1 B;  3ZJY C;  3A8J E;  2UUB Q;  3NK9 A;  2L11 A;  2Q2T A;  4WJ3 M;  3MA2 B;  5KNC A;  5G3L D;  1PFM A;  3CQZ B;  5A2Q E;  1SRO A;  2Z4H A;  3F8T A;  4GKK Q;  5C6A A;  2PYK A;  2NVX B;  2M9V A;  1WTP A;  2A69 D;  4Q5V A;  5IYB H;  3GV3 A;  2R61 A;  1LM0 A;  1MD2 D;  2GA4 B;  2K04 A;  1A2T A;  2D2C C;  4KMU C;  1STN A;  3J7Z C;  1SRU A;  2EE1 A;  1E3P A;  3J80 E;  3J7Y W;  1MKH A;  3VA7 A;  3OOC A;  1G6P A;  3A56 A;  4H7B A;  3IRB A;  3T1H L;  4OWX B;  5LL6 X;  2K5Q A;  4XT3 B;  2KHS A;  3GTM B;  1E22 A;  4OO1 G;  1N33 L;  4RAU C;  3K58 A;  3JAM L;  4CHT B;  5IYC H;  4LFC L;  1EUJ A;  1UNS A;  1TU2 B;  2LXJ A;  5DM7 3;  2K5H A;  3LNN A;  2PQA B;  2ZJP A;  4IOC A;  4BY7 H;  1BVS A;  2HIV A;  2KHI A;  1LV9 A;  5CR3 A;  5FLX L;  1QUQ A;  2N8N A;  4IUV A;  3NWT A;  4YY3 Q;  1U9R A;  4DV6 Q;  2GVA A;  4DGZ A;  1HRJ A;  1YZ6 A;  2AWN A;  5IGE A;  1RJT A;  3CXC A;  1UEB A;  2J7Z A;  1E1T A;  5LL6 S;  1KRS A;  4YCV A;  4A3K B;  5JAV A;  4XQJ A;  2QGQ A;  1PFN A;  2NN6 H;  2I5M X;  2CW0 C;  4CKB A;  3OMG A;  3NXW A;  1J5E Q;  5JEA G;  4RGO S;  4DR6 L;  4CGY B;  2EIF A;  2RHS B;  3GTO H;  4MIU A;  1SFO B;  4LF6 L;  1KQS A;  3OWF A;  4ODG A;  3VDY A;  3Q0A A;  1G91 A;  1UAP A;  1RCV D;  4O2D A;  1UE1 A;  3OIQ A;  2ZTE A;  1STB A;  4KHP L;  4ZUI A;  4H44 C;  5JEA J;  4JW0 A;  4EQO A;  4DV4 L;  4FP5 D;  4NPS A;  2F03 A;  2JEA I;  3NTK A;  4A3K G;  1NR4 A;  3BVG A;  4JVZ A;  3L7Z C;  3M9B A;  5KND A;  1DXM A;  5CC4 A;  1EQT A;  4LF9 Q;  2FIN B;  2R7D A;  5COY A;  1Q86 C;  4JBK A;  2K32 A;  4DUY L;  2K03 A;  4NB3 A;  4TKO B;  4KY5 A;  3N6R A;  2YTX A;  3ERO A;  1EY9 A;  4LW1 A;  1Y1V H;  2A69 C;  2WAQ B;  3I4M H;  4A93 B;  4HIM A;  5GAE C;  1I4G A;  3MEF A;  2R7Z H;  3TS0 A;  2FJ2 A;  3BYT B;  1PH8 A;  3E3X A;  2LKV A;  4DV1 L;  2F4I A;  5LHY 1;  1W2B A;  2YU9 H;  4IFD H;  4O0A A;  4JI2 Q;  1II3 A;  3J80 i;  4OL7 A;  5JVG 3;  5IOD A;  1KDB A;  4R8N A;  4QGU A;  1A63 A;  3IL8 A;  3DMU A;  2WAQ G;  4A93 G;  1B3Q A;  2A19 A;  1EWH A;  2B2U A;  3S17 H;  4NKL A;  4X3S A;  1TY2 A;  2TSS A;  2XNA C;  1UE5 A;  1I4R A;  2DUD A;  3RUZ A;  4A3B H;  1ROD A;  5IGF A;  4HMI A;  5C4X H;  3I73 A;  4KY7 A;  3KJP A;  1S5D D;  2KJX A;  1XWE A;  4KJN A;  3KUP A;  3HFZ B;  1CUK A;  2EYL A;  1PZJ D;  1JOR A;  1RD9 D;  2F0N A;  4U68 A;  1NMG A;  3FKI H;  3NBH A;  3PUZ A;  3RZD H;  1U0L A;  2KUM A;  2E2H B;  4KY6 A;  3EQL C;  3HOZ B;  1ML0 D;  1U4L A;  3RZO B;  3EVQ A;  2E2J H;  4C2M B;  5BR8 L;  1IW7 D;  3SK8 A;  4O42 A;  1HH2 P;  2PQA A;  1F77 A;  5KYL A;  4GN5 A;  1V9P A;  1L0W A;  1BBW A;  3OYY A;  4ZKC B;  2UXD Q;  4DK3 C;  3SK6 A;  4C1N I;  1OXX K;  3QOJ A;  2FFK B;  3PUY A;  5CBA E;  3M4Q A;  5ELF A;  2QEX A;  1VQL A;  1IBL Q;  4V0B A;  3DM1 A;  1QNK A;  3FEW X;  2MUY A;  2K5W A;  1NUC A;  1WYD A;  2LSS A;  3TP8 A;  3TP5 A;  5ELN A;  4HR7 B;  1RTN A;  3HOZ G;  5FJ8 G;  5E3F A;  1PH5 A;  3I3C A;  2LXK A;  1SAP A;  4HCS A;  1JB3 A;  2UUC L;  2WII B;  4DV3 L;  1Y69 U;  1MJE A;  1YIJ A;  1R9T B;  1FVI A;  1LT6 D;  5T1G A;  1HA6 A;  5I9O A;  5J22 A;  1QE6 A;  3S14 B;  5JPM C;  3T53 B;  2K14 A;  3KLR A;  4JBW A;  1CHP D;  4K2L A;  2DY8 A;  1VQK A;  1BDO A;  4FXG C;  1YJW A;  1KLU D;  4L5R C;  1BUV T;  3VA5 A;  4DK6 C;  1IXR A;  2QA4 A;  4DKA C;  3QIA A;  2VY3 A;  1EFI D;  2LFN A;  3ER0 A;  1Q7Y C;  1JE5 A;  1VQF A;  3OTO Q;  1EY5 A;  1NTG A;  1XJV A;  3CU7 A;  4IN3 A;  3CQZ H;  1NY4 A;  3IKJ A;  2NVX H;  2C35 B;  1YNN D;  5FLM G;  3KF6 A;  2CWA A;  3Q23 A;  2ZTC A;  3H94 A;  3HZX A;  1PH3 A;  4ILW A;  1VQ7 A;  3PIO 3;  2AUK A;  2ZJQ A;  3T1H Q;  1CKN B;  2JA8 B;  2F0O A;  3T56 B;  2QDL A;  1CSP A;  1SR3 A;  1XNR L;  4Z9C B;  2K5N A;  1IBM L;  1HPC A;  1N33 Q;  4LFC Q;  4JI7 L;  3GTM H;  4YWL A;  1A15 A;  1TWA B;  1B1Z A;  1HR0 W;  2Q2H A;  1OTC A;  2IL8 A;  1CQF A;  2QDB A;  2Q2I A;  1NE3 A;  1IW7 C;  2QF7 A;  1XNQ L;  2HD3 A;  2IY5 B;  3PMF A;  3HS0 C;  2FMC A;  2A74 C;  5IGC A;  2NZH A;  3BS1 A;  2JA8 G;  3HKZ E;  4KKU A;  2VL6 A;  3R3O A;  5EPJ A;  4A3K H;  1PTO B;  4B3S L;  2RDF A;  5J3B A;  1LTA D;  2EYM A;  4DR6 Q;  1PDQ A;  3CCJ A;  1ASZ A;  1SNQ A;  4LF6 Q;  1M1K C;  3V96 A;  2PI2 E;  1PTO D;  3S1Q B;  1YI2 A;  3I4O A;  3SK5 A;  1FR3 A;  2F0V A;  1SFO H;  4KHP Q;  4N8X 1;  2KBN A;  4DV4 Q;  5E7N A;  2B63 H;  1KDC A;  1YHA A;  3IAY A;  4RFB A;  2OTL A;  1XTD A;  1X32 A;  2I5L X;  2AKW B;  1P8L A;  4NDX A;  3T51 B;  2DNC A;  3P7J A;  5HY6 A;  5ELO A;  1B7Y B;  1U4P A;  2JA5 B;  5IOC A;  1H9M A;  4S3S A;  4JI4 L;  2EXZ A;  4I7Z C;  4ME3 A;  4BWG B;  3PF4 A;  4DK0 A;  4XXE A;  5I4D A;  2A6E D;  2HQE A;  4K6D A;  4R4C A;  3HRZ C;  3H6M A;  1L0Y B;  1HR0 L;  5F2D A;  5KGU A;  4KD3 A;  4DUY Q;  5G3L F;  3WWV A;  4WFN 3;  1DYQ A;  2CFM A;  1NMF A;  5EGT A;  1SXT A;  5IGD A;  1CA5 A;  4N8F A;  2EY1 A;  1N36 L;  4K6L A;  1SLJ A;  4H02 A;  5IP9 G;  1STG A;  3NTI A;  1N9W A;  2HUG A;  1KNE A;  1YNN C;  4DV5 L;  3BDO A;  3FPP A;  4CDF C;  4A93 H;  2ZJR A;  2JA5 G;  4LUV A;  4QUC A;  2F0U A;  1K8M A;  2X6L A;  1ZYR D;  1JOO A;  1S5B D;  4DV1 Q;  2IHE A;  2KED A;  1AE3 A;  2F3I A;  2F0E A;  4RG1 A;  3VYU A;  2GN5 A;  4BBS B;  3BZC A;  2NN6 I;  3HOX B;  1LTG D;  3PO3 B;  2E2I B;  1AEX A;  5EPL A;  4FXK C;  3E6Z X;  2L15 A;  1V43 A;  1LT5 D;  2BOS A;  2G9D A;  4DR5 L;  1EWC A;  2PZW A;  2AMC B;  1F2Z A;  1GHK A;  4EX5 A;  5I6W A;  5GRO A;  2KQ3 A;  2DJF C;  1PH1 A;  3NP8 A;  1CSQ A;  4BBS G;  1VQE A;  2HCC A;  4DXG A;  3HOX G;  3DWA A;  3TME A;  3G6E A;  3PO3 G;  1WD1 A;  1YJ9 A;  1HTP A;  1QVG A;  2EY6 A;  5BR8 Q;  3A5Z B;  2E2H H;  5M3M B;  2OWO A;  3HOZ H;  5FJ8 H;  2F0G A;  4J8Q A;  4C2M H;  1JB7 A;  2JP1 A;  1K73 C;  1EEF D;  2F52 A;  2RF4 A;  1EOV A;  1SNP A;  1TVX A;  2F0D A;  4N9T A;  4ULL A;  2D5D A;  3TRZ A;  1I50 B;  1FD7 D;  1DM0 B;  2A6E C;  1LTR D;  1NSN S;  4KJO A;  1XXG A;  4GKJ L;  1YNJ D;  2OCE A;  2EXD A;  3DUZ A;  1EYD A;  5JJI A;  2ZM6 Q;  5M3F B;  3U4V A;  1ZXT A;  5D14 A;  4IFD I;  1IBK L;  1SSO A;  3TP7 A;  2MO0 A;  2E5L L;  3J81 E;  4OIK A;  3OW2 A;  1JQY D;  1O80 A;  2UUA Q;  4LFB L;  2UUC Q;  5M3M G;  4DV3 Q;  1BCP C;  2NBF A;  4OEL B;  2AWO A;  1EFW A;  4AQY L;  2KOL A;  1VQ6 A;  1R9T H;  3J7A 5;  1FGB D;  1O7Y A;  1YVC A;  4QIW B;  3NTH A;  5FLM H;  4LK1 C;  2IX3 A;  4LNQ A;  3S1N B;  3TN2 A;  5I2Y A;  1I4Q A;  3URY A;  3SK4 A;  1L2F A;  1Q3L A;  5M3F G;  1S5E D;  4HJ8 A;  2MPM A;  4JOI A;  2H4O A;  1SMY C;  4J1M A;  4RHR A;  1AP0 A;  1T5E A;  2B2V A;  5BN4 A;  1SJE D;  2BH8 A;  4GLA C;  1QUQ B;  1TS4 A;  3GTL B;  4DUZ L;  2ES2 A;  2YYZ A;  3RR5 A;  3CCE A;  4ZYS A;  4IQZ A;  4NMZ A;  1J9O A;  1GKH A;  1PH9 A;  3BZD B;  2SEB D;  1SDF A;  1QVF A;  2K4K A;  1IBM Q;  3STB C;  2JA8 H;  2EJF C;  4LF8 Q;  3UDG A;  5IYD G;  4K8J A;  1K8G A;  5FO7 B;  4JI7 Q;  4HJA A;  2FMM A;  1KL9 A;  2PO4 A;  1HZC A;  3G71 A;  1VQO A;  1XX8 A;  3D4D A;  1HZA A;  1TWA H;  3CKI B;  1XNQ Q;  2NVQ B;  4IUQ A;  3RLO A;  1FNV A;  2IX0 A;  2E8G A;  1VQ5 A;  5ELB A;  4G57 A;  4JI5 Q;  4RWS C;  4EQP A;  1HXY D;  1B9N A;  1Q12 A;  1GOZ A;  2B2W A;  3MFG A;  3OWE B;  1F9R A;  3W5O A;  1A0I A;  2WAQ E;  3U9S A;  1E2V A;  1YNJ C;  2HDM A;  4PZ8 A;  2F1M A;  1XPR A;  1QCB D;  1PTO H;  3OW7 A;  1F2M A;  5D3I B;  4F88 A;  1T5X D;  2A6H C;  5JJZ A;  2QKI C;  2QIL A;  3AFQ A;  3VR5 A;  3S1Q H;  1LAC A;  4EVO A;  3BVZ A;  4IJH A;  2WKD A;  4L5T A;  2EDG A;  3J81 i;  1JWM D;  4YHH L;  2XVS A;  1XPO A;  5E4X A;  5IP9 H;  1HZB A;  2KCM A;  1A62 A;  1GUS A;  1N34 L;  3RNU A;  2NZO A;  4JI4 Q;  2MHV A;  2MQH A;  4GZY C;  4FVM A;  2O4X A;  2JA5 H;  5T1I A;  5HUR A;  2ATW A;  2F3V A;  3W1B A;  1PRT B;  2PW7 A;  4K2K A;  1AN8 A;  1EY8 A;  4A3C G;  3CF5 A;  1PFB A;  3BZK A;  3U58 A;  5K5P A;  4RKB A;  3DXJ C;  1PRT D;  4P2C B;  3D4R A;  4AH6 A;  2PQE A;  1N36 Q;  2MNA A;  1EIY B;  1TXY A;  4FYD A;  3F2D A;  3D3R A;  5A2Q L;  1DOL A;  5EQ0 A;  5M5X H;  3E5S A;  5C44 B;  3T13 A;  4DV5 Q;  2PMZ B;  1CZG A;  4R4Q A;  2F0S A;  1KRT A;  3RLN A;  2A5H A;  3MXN B;  1A2U A;  3QOL A;  2WB1 E;  1Y8N B;  1B4O A;  4K14 A;  1KTK A;  2XGT A;  4PMC A;  1V1P A;  4DR7 L;  3HOU B;  1JJ2 A;  3K81 C;  5DAU A;  3NBH B;  3MEH A;  4F8M A;  4DA2 A;  3CC7 A;  1SNO A;  1TT2 A;  3SEB A;  2DGY A;  4RGT A;  3ITP A;  2KEN A;  4IPD A;  3F2C A;  1G51 A;  2A73 B;  4BBS H;  4MZ9 A;  3HOX H;  3PO3 H;  5C44 G;  2E2I H;  4LF4 L;  5BN5 A;  2KA7 A;  2VB2 X;  2WV6 D;  1MBY A;  2IJ0 A;  2RBM A;  4WOR A;  4EQN A;  3WOE A;  1NBW A;  2NB0 A;  4XYQ A;  1EIF A;  4DR5 Q;  1KC8 C;  4XTC S;  5GAD C;  1K83 B;  1SNM A;  3HOU G;  1ILQ A;  3JAM E;  3HEJ A;  5C5M A;  3EFX D;  5C3X A;  1OXS C;  3MVV A;  1SEB D;  1VQJ A;  1X3P A;  1GVP A;  2UXC L;  1UEA B;  3K80 C;  1TQO A;  2JA7 B;  4LFA L;  5FLX E;  1UE7 A;  1SND A;  2LY7 A;  5E4W C;  2CWP A;  5JVH 3;  2EY2 A;  3KDF A;  1SYE A;  4ME5 A;  4ABN A;  4QJF A;  1QZG A;  2WFW A;  1TKW B;  3AU7 A;  1G29 1;  3ICE A;  3EJI A;  4JI3 L;  1WJJ A;  5M3M H;  4JBM A;  5CV4 A;  1PHJ A;  1AZP A;  2EOT A;  4CKE A;  3R8B A;  2L12 A;  2BDN A;  2DN8 A;  2R93 B;  4B9W A;  4R4I A;  4GKJ Q;  1D5X C;  4DR2 L;  1I50 H;  2Z6K A;  4A3M B;  4BA1 I;  2HT1 A;  3ERQ A;  2JA7 G;  2K6A A;  4G7O C;  2E5L Q;  4X66 Q;  1Y14 B;  1PRT C;  2WP8 J;  5M3F H;  4LFB Q;  1BCP F;  2CQO A;  2R92 B;  2Z9H A;  1E2Z A;  1QIL A;  2EJM A;  4PZ7 A;  5EBD A;  3KF6 B;  4XQQ A;  4CBV A;  4AQY Q;  1AZQ A;  4HIK A;  4C3H H;  5J1Z A;  2B2U C;  2VQF L;  1SYF A;  4FO2 A;  3AFP A;  2R93 G;  4LF7 L;  2SDF A;  2IWH A;  5KIX A;  1K28 A;  4LWC A;  3SR1 A;  4PV1 C;  3H3V I;  3I70 A;  4A3M G;  1JJG A;  2QEJ C;  2N3S A;  3IFD A;  3S1N H;  3KYH C;  2E74 C;  2VXW A;  4X64 L;  3M4P A;  1Q81 C;  2R92 G;  1ICF B;  5IYD H;  2JSO A;  1CHQ D;  4MTN A;  5C5L A;  1BNZ A;  1DCZ A;  3TQY A;  4DN4 M;  4DUZ Q;  1CQV A;  3S9W A;  4OON A;  4A75 A;  1LO5 D;  3GTL H;  2B39 A;  1C9O A;  2VB3 X;  1JMC A;  1JOQ A;  5C0X I;  3MXN A;  3MXG A;  5CYU A;  1NR2 A;  3OPO A;  3SGI A;  5TSS A;  1PH7 A;  1I4X A;  2F0P A;  2O5J C;  3JAM i;  1B2T A;  2D62 A;  2SNS A;  4C3I B;  4BXX G;  3BVM A;  2BE5 D;  1BBX C;  2O5I C;  4PNY A;  1VMC A;  4KV6 A;  1PZK D;  3I56 A;  4LUZ A;  5C3E B;  5EJW A;  2NZ1 D;  4L6T B;  1TS3 A;  4B3M L;  1B53 A;  4CJ0 B;  2NTT A;  1GD7 A;  4L5Q A;  3K5M A;  1Q1B A;  3HGB A;  3TRE A;  4KN4 C;  4C3I G;  2WKC A;  4FDB A;  3PO2 B;  1EWI A;  4M1U B;  4A3C H;  1Z9F A;  3QJY A;  2CCZ A;  3Q6S A;  4A3G B;  3CCS A;  5C3E G;  1MGS A;  1EQQ A;  3PIP A;  4DV7 L;  4DXF A;  4L5S A;  1XMO L;  4JV5 L;  2B29 A;  1CI3 M;  4YHH Q;  1N34 Q;  5EBC A;  3R93 A;  4M8A A;  1JE4 A;  3GTG B;  4OWW B;  4A3F B;  4RKL A;  3MXU A;  3AQQ A;  2D0P A;  2XRS D;  3BDL A;  2UXB L;  5EKL A;  1OXU A;  1WVL A;  1TY0 A;  3PO2 G;  2B3G A;  1CK1 A;  2IHF A;  1N8R C;  1EIG A;  1EYC A;  2QCP X;  2CKZ B;  2J0T D;  1JCK B;  4RHS A;  4A3G G;  3A74 A;  1WI5 A;  2K5D A;  4OO1 H;  2JK8 A;  5C0X J;  1KAW A;  2HHH L;  1X3F A;  3J80 c;  3S1M B;  3E9I A;  5FKA C;  2YTY A;  4A3F G;  1EY4 A;  3KOJ A;  1MHW C;  3BG3 A;  1UE6 A;  5ELE A;  1I5F A;  1F2Y A;  2L4N A;  4ZLT F;  4LAA A;  1OO9 B;  3Q24 A;  1U4M A;  1KD1 C;  3HOU H;  1AW7 A;  1CKO A;  3K7U C;  2QW7 A;  4NW2 A;  2A68 D;  4KKS A;  1PYB A;  2BE5 C;  1G6Z A;  2K05 A;  1HFG A;  3ERS X;  5JEA H;  4LF4 Q;  4IPC A;  3RN2 A;  5COR A;  2K7V A;  2AQ3 B;  5EKI A;  4X62 L;  2BA0 A;  2F0K A;  1S72 A;  3GO5 A;  4DAV A;  5IGG A;  5I9P A;  2CHB D;  3G7L A;  3HG9 A;  3UI2 A;  1S4Z A;  1K83 H;  4CKC A;  1RDP D;  4DK1 A;  3E0E A;  2C9O A;  2HQL A;  3M7N A;  4QF4 A;  1P16 A;  1SBB B;  1BBU A;  4QIW E;  3EA6 A;  2JA7 H;  1X65 A;  2G5D A;  3HOY B;  1SYD A;  4JI3 Q;  5EPK A;  1MIU A;  1QOH A;  3CC4 A;  3GV6 A;  1LT3 D;  4P75 A;  1TWH B;  1JT8 A;  2LS0 1;  3CD6 A;  1VQA A;  3R2I A;  5HGT A;  1HNX L;  2R93 H;  4DR2 Q;  5ELC A;  4A3D B;  2K50 A;  3P1H A;  5IP7 G;  1PRT F;  4XDX A;  4A3M H;  1DOM A;  3QG1 A;  4QMG A;  4JK1 C;  4R4T A;  1F9Q A;  2F0T A;  3HOY G;  2JA6 B;  1QNU A;  3S24 A;  1IYU A;  3K5O A;  2R92 H;  3I90 A;  3I55 A;  1XYI A;  1WTO A;  4OX9 L;  1JWU D;  3S2D B;  3K5L A;  1BO0 A;  2NVT B;  2VQF Q;  3LWE A;  4JI0 L;  2OTJ A;  4LF7 Q;  1JIC A;  4ZAI A;  3FP9 A;  3B6Y A;  3J7A F;  4A3D G;  4A3J B;  5E1F A;  4WJW A;  3U9O A;  5LMU L;  4DR4 L;  4JI6 L;  2EQS A;  1C48 A;  4X64 Q;  3A5U A;  2RCN A;  2A68 C;  1X6O A;  3DWQ A;  4JI1 L;  1QWY A;  4AYB E;  2JA6 G;  2YTV A;  5FK9 C;  1EZ8 A;  3K0X A;  5BN3 A;  1EYA A;  4GNX A;  1DD2 A;  4R4O A;  3NSW A;  1YHB A;  2SNM A;  1TWC B;  4MNO A;  1Q8K A;  4DFA A;  4A3J G;  1GXD C;  1VF7 A;  5J39 A;  1ENF A;  1VQH A;  4ZKB B;  2AUJ D;  4Y52 H;  4I7A A;  3EIV A;  1SJH D;  3KLS A;  1K9M C;  1T9H A;  5A35 A;  1M8A A;  3QB3 A;  1K3B C;  1PTO C;  4XYO A;  5M5Y B;  4K5X A;  2EYH A;  4C3I H;  1C4Q A;  3FRP B;  2FXQ A;  1L1O B;  1VQC A;  1Y8P B;  4JCV E;  4K0K L;  1ESR A;  3AB9 A;  1FYC A;  2KHJ A;  4PG3 A;  3D8G A;  4C56 C;  2F0I A;  3C46 A;  3RMH A;  3RZO H;  1KAA A;  3S2H B;  4A3I B;  5M9O A;  5C3E H;  2V4D A;  1LAB A;  4HSV A;  5ELD A;  1Z47 A;  1XPU A;  1U5K A;  1W6K A;  4B3M Q;  4RH6 A;  5IYC G;  2VUM B;  3QO2 A;  3GTO B;  2PMZ E;  3H15 A;  1LUZ A;  3A8I E;  1K3R A;  4X65 L;  4K8I A;  1KXL A;  4DNT B;  4ZCK A;  2K52 A;  3UDF A;  3NQI A;  3PO2 H;  1H9J A;  4JOI C;  1PH4 A;  1B8A A;  1A6X A;  1SYG A;  4DV7 Q;  4HAE A;  1XMO Q;  2B2V C;  4JV5 Q;  1QG7 A;  3ND9 A;  5CGK A;  1GHJ A;  4A3I G;  4A3G H;  2NN6 G;  1RIP A;  3L0O A;  1HNW L;  1FGU A;  1V1P B;  4P73 A;  4AIM A;  1ZYR C;  2VUM G;  4JI8 L;  3GTG H;  5NUC A;  3I8Z A;  4A3F H;  2UXB Q;  2R3Z A;  3G48 A;  3FVQ A;  3T4A C;  4QUF A;  3S14 H;  3C1F A;  1YIT A;  1EZ6 A;  1RL2 A;  4OWT B;  3C1E A;  5D65 A;  1K8A C;  1GO3 E;  5IWA L;  3V2T A;  1CZW A;  3W3A A;  5GAG C;  1YNX A;  3SDZ A;  1IZ6 A;  4CJ2 C;  1ILP A;  4G7H C;  3A55 A;  1TWG B;  1WTX A;  2HHH Q;  1CKM A;  4KHV A;  4UPA A;  4RGN A;  1WTV A;  1E2W A;  1NAP A;  4ZRZ A;  3A54 A;  1LTB D;  3KFU A;  2VQE L;  2N49 A;  3S1M H;  4OIJ A;  1YBY A;  3S15 B;  1H95 A;  2B2W C;  3V05 A;  1HNZ L;  4A4I A;  4JG2 A;  2EYO A;  1XNR Q;  4KN7 C;  2AHO B;  1STA A;  4NP5 A;  4BY1 B;  3MZ5 A;  2JYO A;  1VQM A;  3S17 B;  3I72 A;  3KDF B;  2D9U A;  4HID A;  4B3T L;  3PUW A;  1I94 L;  4O1N A;  1VQB A;  4E6I A;  4GLX A;  4X62 Q;  1WCM B;  4UP9 A;  4DAP A;  4CJ1 B;  1B44 D;  2NUC A;  4XQN A;  1ET9 A;  2LMC B;  3H0G B;  3K5N A;  5IT9 L;  1JWS D;  4IFD J;  1SE8 A;  2F0J A;  5CV6 A;  3GD7 A;  3RZD B;  4B3S Q;  1BR9 A;  4BY1 G;  5KYI A;  1D8L A;  2RKS A;  2CH4 W;  2F0Q A;  5K36 G;  3G4S A;  3MHB A;  5IP7 H;  3A8K E;  4JBJ A;  2JN4 A;  4X6A H;  2JA9 A;  2O2L D;  1WCM G;  1CFM A;  3HOY H;  4GN4 B;  1L1O A;  3GTP B;  1L0X B;  4OO1 I;  1GJX A;  5M5W B;  1HNX Q;  1F2L A;  3H0G G;  3K0Y A;  3H09 A;  1E0B A;  1DGS A;  4PQX A;  1IBL L;  4DAY A;  3HOV B;  1PA6 A;  3PV0 A;  1PH2 A;  2CW0 D;  1G2S A;  1N32 L;  2F0L A;  1LYL A;  2IT1 A;  3CHB D;  4BS9 A;  2F0H A;  2E2D C;  4IUP A;  1A3T A;  4A3D H;  3NPP A;  1QB5 D;  1JR0 D;  1HR0 Q;  1PMR A;  4DNR B;  1O78 A;  1AFP A;  4CDE C;  1I6H B;  2EYP A;  1V8Q A;  2I07 B;  2WAC A;  1I6V C;  4OX9 Q;  4BA2 I;  4XIG S;  1BXT A;  5H1S E;  1ASY A;  2RDG A;  4HJ7 A;  1TR5 A;  2OEO A;  2Y0S B;  3D6W A;  4JI0 Q;  3M4Y A;  3NQT A;  4UAI A;  2NVT H;  3HOV G;  3ZYY X;  3NBI A;  2AQ2 B;  2PNR C;  3CCU A;  2MJ8 A;  3HOW B;  4NXM L;  3QR8 A;  5LMU Q;  4DR4 Q;  4JI6 Q;  3K6O A;  4HSP A;  4A3J H;  2EY5 A;  4MN3 A;  3J80 L;  1SN8 A;  1E1O A;  1C7Y A;  4TVA B;  4RCO A;  2RQX A;  1WFQ A;  5C4J B;  1ESF A;  4JI1 Q;  3OTO L;  3NHH A;  1MJC A;  3WDN A;  3J81 j;  4WJ4 A;  2J4X A;  3VYT A;  2L0C A;  1X3E A;  5CV7 A;  2Y0S G;  2L1B A;  3M85 A;  4GOP A;  1EQV A;  1Y1W B;  4FF4 A;  2H5X A;  3KF8 A;  3MFY A;  1I4P A;  3K7A B;  5JJL A;  2NWG A;  3HOW G;  3GTQ B;  1TWC H;  3D6C A;  4FF3 A;  3UE1 A;  5FO8 B;  1D1K A;  2PI2 A;  3EN2 A;  1XTC D;  5DEH A;  4YCU A;  4U67 3;  1PYW D;  2CVR A;  2ICI A;  2C5C A;  1EY7 A;  4F7X A;  2Z6K C;  1PTO F;  2P5Z X;  5IE8 A;  2HIX A;  3DEO A;  1A3V A;  4DU9 A;  4K0K Q;  5M5Y H;  3RD4 A;  1Y1W G;  4TQU S;  3X3M A;  4QCL A;  1MI2 A;  4H0L C;  3TDQ A;  1JOK A;  3PIP 3;  2ZXO A;  4CDC C;  2A8V A;  1D7Q A;  4GN3 B;  3FHW A;  3S2H H;  4A3I H;  1EYG A;  1UWV A;  1EY6 A;  2FHT A;  1LTT D;  1RKN A;  2VUM H;  2F0M A;  4X65 Q;  4KLK A;  1XMQ L;  1PV4 A;  3LX0 A;  1HQR D;  1O7Z A;  5C4Z A;  3J81 c;  2E75 C;  4X3U A;  3NE5 B;  2B63 B;  1IBK Q;  3CMA A;  3LWU A;  1Q90 A;  3NUC A;  1HCZ A;  3OSO A;  2IPK D;  2RHQ B;  2B8G A;  3A7A B;  2BDO A;  4JC0 A;  1HNW Q;  1STH A;  4FF2 A;  4UHV A;  3U50 C;  3K57 A;  4FF1 A;  2XTI A;  4JI8 Q;  3VYR A;  2L9H A;  2VS1 A;  1O7I A;  1W6J A;  3UDI A;  1HUN A;  1Z6H A;  1V1O A;  1VMP A;  4OXP A;  2PW5 A;  3CME A;  4HMJ A;  4IUR A;  2G9H D;  5IWA Q;  2B63 G;  2SOB A;  1ZKO A;  3M4O B;  2UU9 L;  1HQM C;  5DNF A;  1ONL A;  2N88 A;  4B3R L;  1GM5 A;  3NEM A;  3T1Y L;  1JJC B;  2E76 C;  3FMC A;  3A0J A;  3AEV A;  2D0O A;  2NVY B;  1TWG H;  2VQE Q;  2RVL A;  1UUP A;  3I4L A;  4NXN L;  1TWF B;  1VCI A;  1M90 C;  4R8I A;  1WTR A;  3D0F A;  1O7L A;  1VQN A;  4K5W A;  1GUO A;  2HDL A;  4GLV B;  1I3Q B;  5C3W A;  1HNZ Q;  2R7F A;  2KEC A;  1BKB A;  1NJI C;  3I91 A;  4UY8 C;  3S15 H;  3J7A V;  4LF5 L;  2DJG C;  3GTJ B;  5CV5 A;  1OXV A;  1PLF A;  3DLL A;  3L2P A;  5HGQ A;  4EGV A;  3CAM A;  4LJZ C;  3CCL A;  4BY1 H;  3AMU A;  1QJO A;  1SNC A;  1AE2 A;  1EIH A;  4B3T Q;  1EU4 A;  1GUG A;  5K36 H;  2MP1 A;  1I94 Q;  3PF5 A;  4P72 A;  1CTM A;  3MAQ A;  3U4Z A;  1YJN A;  1VDZ A;  1X3G A;  1J8I A;  2KCT A;  5IT9 c;  1KHI A;  2N78 A;  1MSH A;  3TS2 A;  1AH9 A;  2HCI A;  2BA1 A;  4IZ8 A;  1WCM H;  2NVQ H;  5CV9 A;  3GP7 A;  4A3E B;  1X3Q A;  4DR3 L;  3D4W A;  1HUM A;  1IKM A;  4B08 A;  2OQ0 A;  3H0G H;  2KCN A;  3KLW A;  5LMN W;  4JPB W;  1BQQ T;  3CRK C;  2OQK A;  4HJ5 A;  2WB1 B;  3VR2 A;  1EY0 A;  3BYY B;  1FL0 A;  4FNF A;  4DR1 L;  4QY7 A;  4POG A;  2I0Q A;  4G7Z C;  2Z1C A;  4C3J B;  3FDT A;  2BH2 A;  1ENA A;  3CP0 A;  3KK7 A;  3NWS A;  4QQB X;  1WTH A;  1NNX A;  4KI0 A;  4A3E G;  1U4R A;  2N55 A;  3GTP H;  1N32 Q;  2X6G A;  4IAL A;  1DOK A;  2EYJ A;  5CBE E;  4P71 A;  5M5W H;  3HOV H;  2F4V L;  1FNW A;  2Z4I A;  2WB1 G;  2Z6B A;  2ZM6 L;  4ID6 A;  5IIF A;  2JQO A;  5C0X G;  1R4Q B;  4ALP A;  4CDD C;  2KCC A;  3RLF A;  2UUA L;  1FJG L;  4C3J G;  1VQ9 A;  1I6H H;  4YCW A;  4GNX B;  1LT4 D;  2ALY B;  2BCO A;  4KHZ A;  4R1J A;  2EYF A;  4DF7 A;  1EEI D;  1Q1E A;  3CCR A;  4ZUJ A;  4EQ5 A;  3CCV A;  1VF5 C;  3S16 B;  1OXT A;  3MWY W;  4A3L G;  1YHQ A;  5C44 H;  5LMN L;  4NXM Q;  2PNH A;  2PZT A;  2ZTD A;  3FPU B;  3TZU A;  4J15 A;  4DR7 Q;  1HZ9 A;  2WIN B;  1CT1 D;  3HP3 A;  3BDC A;  3HOW H;  4J6H A;  1E7Z A;  3SXH A;  1TS5 A;  1Q46 A;  4F87 A;  1EL0 A;  1I4H A;  2JEB I;  2RSN A;  4I65 A;  1C8C A;  5C4J H;  1KAB A;  3A7L A;  4IUU A;  4HIO A;  3VR4 A;  4OGQ C;  3RN5 A;  5IGB A;  3Q8D A;  3GDE A;  4V19 0;  3H3V C;  3I4N B;  1Y1W H;  3GQB A;  2JE6 I;  5I2X A;  2L55 A;  3KBX A;  3JAM c;  2Q2U A;  4K5V A;  3MTS A;  1VQI A;  3K7A H;  1IHZ A;  2JJQ A;  3GTQ H;  1PYS B;  1K0R A;  2B2Y C;  2XSC A;  5IY0 A;  4R9W A;  3W1G A;  1RHP A;  1EOT A;  1F9P A;  3X3N A;  5AJ3 L;  4LF8 L;  1PZI D;  3NEN A;  1PH6 A;  3L3O C;  1YEZ A;  4APV A;  5FLX c;  2UXC Q;  1BOS A;  3PUV A;  1KLG D;  2B2T C;  4LFA Q;  4TSS A;  3S1R B;  2M00 A;  1TII D;  2VZA A;  1LLR D;  3CW2 C;  5FOB B;  3M3Y B;  3C2P A;  3E9H A;  2KEE A;  2EPB A;  1X55 A;  3TP6 A;  1DZ1 A;  4BBR B;  3Q22 A;  3CPW A;  3I4N G;  4JI5 L;  2K28 A;  3H91 A;  1A8V A;  4FXD A;  3M7G A;  1B70 B;  4DV2 L;  1SYB A;  2Q8R E;  4A76 A;  4UP7 A;  4JYA L;  4OHJ A;  2L5T A;  2B2Y A;  1STY A;  1X56 A;  2Q8T A;  3P20 A;  5KRU A;  1Z7T A;  3VR3 A;  1BF4 A;  4HN7 A;  1XMQ Q;  1HA5 A;  2RA4 A;  4YIJ A;  2K33 A;  1F9S A;  2ID0 A;  2B2T A;  1MSG A;  2ZXR A;  5EKK A;  2EJG C;  4HCE A;  1V1Q A;  1QVC A;  1VQG A;  1H9S B;  2CH4 A;  1B3A A;  4QB4 A;  3SE0 A;  3W2D A;  4BBR G;  3PGZ A;  1S5F D;  2I5H A;  4IO9 A;  1SYC A;  3GTK B;  4YWM A;  1C0A A;  1E24 A;  4GNX C;  4Y7N B;  5AFW A;  1SE2 A;  3TZD A;  4DV0 L;  1RF2 D;  4L8J A;  5DM6 3;  1LTL A;  1PFS A;  3F1Z A;  1H9K A;  3ULP A;  1WTQ A;  1BCP B;  4KK7 A;  2UUB L;  4IOA A;  2OXP A;  1D5Z C;  4YWK A;  4KTA A;  5M5X B;  2UU9 Q;  4B3R Q;  1WOC A;  4P74 A;  4B9X A;  2YV5 A;  3LGJ A;  3T1Y Q;  1BCP D;  3M4O H;  2MGS A;  4GKK L;  2TMP A;  3HKS A;  4BXX H;  3CC2 A;  3D31 A;  1D1I A;  4NXN Q;  1GUT A;  5CV8 A;  2NVY H;  1WD0 A;  2RDH A;  1TS2 A;  2AQ1 B;  5EAY A;  4OEM B;  3VYS A;  4POF A;  1TWF H;  4X3T A;  4IJL A;  3CRL C;  2F3W A;  3DEP A;  4LF5 Q;  1SMX A;  3VR6 A;  2VW9 A;  1I3Q H;  1STE A;  2PPB C;  5CMD A;  3CCQ A;  3GTJ H;  2ASB A;  1SMY D;  5C4H A;  5L37 A;  3KBG A;  3K59 A;  4BY7 B;  2X69 A;  5IYB G;  1HHV A;  2Z0S A;  4DNI A;  3C3L A;  2DY7 A;  2MFI A;  3ONA B;  5KEE A;  2EZV A;  3H3V H;  3K8A A;  4G4K A;  2DNE A;  4RCN A;  4HJ9 A;  1B9M A;  1ET6 A;  4UP8 A;  3PIO A;  1ENC A;  4YY3 L;  4DV6 L;  1DJR D;  3WOF A;  4DAY B;  3EBE A;  2ENB A;  2I46 A;  4DR3 Q;  5JJK A;  3DHQ A;  3DM3 A;  3DWP A;  2RSO A;  3ND8 A;  4A3E H;  3STB D;  3KJO A;  2H1E A;  2IW3 A;  1CKN A;  4RMF A;  2XIW A;  2ZXP A;  2Y0S E;  1CA6 A;  3PCO B;  3PUX A;  1J5E L;  4QL5 A;  1K0S A;  4BY7 G;  1IYV A;  4DR1 Q;  1FNU A;  1J6Q A;  2B8F A;  1B50 A;  3I7F A;  2M2L A;  5I6Y A;  2XRQ D;  1GUN A;  5C0X H;  4PZ6 A;  4LMQ D;  1Q8I A;  3J81 L;  4C3J H;  3ULL A;  3R2T A;  4MTK A;  1R4P B;  1CM9 A;  2PZU A;  1H9R A;  1ICW A;  1VQD A;  2Z8L A;  1X9N A;  2F4V Q;  4A3L H;  4LF9 L;  1VS0 A;  1IYJ B;  3MXP A;  2OT2 A;  3OIP A;  1JC7 A;  1HJP A;  4X66 L;  3CCM A;  1LTI D;  2A6H D;  3UE0 A;  1VQ4 A;  3F2U A;  3L9A X;  1PXU A;  1ZEQ X;  3OHX C;  3PQI A;  1FJG Q;  4KD4 A;  1Y1V B;  3I4M B;  1IL8 A;  4C3H B;  2JXM B;  3HKZ B;  4GOP B;  1LTS D;  3CPF A;  4TRD A;  1G2T A;  4MHE A;  3O13 A;  2ZT9 C;  2R7Z B;  1H9S A;  3IFT A;  3KF8 B;  5JPN C;  3T16 A;  2K1B A;  5LMN Q;  4IUN A;  1S3O A;  2KVM A;  3S16 H;  2A1A A;  2YU9 B;  1EU3 A;  1A3U A;  3ULJ A;  1DON A;  2F0W A;  1QZH A;  2PCF B;  4PMB A;  4JI2 L;  1KIX A;  1Y1V G;  2XWJ B;  2VNU D;  3I4M G;  3OMC A;  4ZQ3 A;  4C3H G;  3HKZ G; 
#chains in the Genus database with same CATH homology
 1Y8O B;  1D5M C;  2F0F A;  4X3K A;  2K01 A;  4N9P A;  3P75 A;  4A3B B;  5C4X B;  4IFD G;  5ISR A;  5D3D A;  1G8Z D;  4ZK9 B;  2XWB B;  1KDA A;  3FKI B;  3E0J A;  5KNB A;  4IUT A;  3SHL A;  1GUW A;  2E2J B;  4RA8 A;  4RGM A;  1RTO A;  4KKT A;  4H13 C;  5IT9 E;  1S5C D;  3TSS A;  4AYB B;  1K8O A;  5FO9 B;  2CQA A;  2R6G A;  4PMW A;  4C1N K;  4Q0F A;  3MC0 B;  2ICE C;  1WTW A;  1KNA A;  3TBI B;  2Q8I B;  1D2B A;  3G6J B;  1HFN A;  4HTH A;  1IKL A;  2IX1 A;  3QWN A;  4UDU C;  2NYZ D;  4WRD A;  2XN9 C;  5JOB A;  4L63 B;  1SE3 A;  3KLS X;  2EVB A;  1M4V A;  1D6E C;  1NCV A;  1HTL D;  2NTS A;  4HED A;  2OF1 A;  1SE4 A;  3N52 A;  3SVM A;  4XT1 B;  3A8J E;  3NK9 A;  2L11 A;  3MA2 B;  5KNC A;  5G3L D;  1PFM A;  3CQZ B;  5A2Q E;  2Z4H A;  5C6A A;  2PYK A;  2NVX B;  2M9V A;  1WTP A;  2A69 D;  4Q5V A;  3GV3 A;  2R61 A;  1MD2 D;  2GA4 B;  2K04 A;  1A2T A;  2D2C C;  4KMU C;  1STN A;  2EE1 A;  3J80 E;  3J7Y W;  3VA7 A;  3OOC A;  3A56 A;  4H7B A;  5LL6 X;  2K5Q A;  4XT3 B;  2KHS A;  3GTM B;  4OO1 G;  4RAU C;  3K58 A;  3JAM L;  4CHT B;  1UNS A;  1TU2 B;  5DM7 3;  3LNN A;  1LV9 A;  5CR3 A;  5FLX L;  4IUV A;  3NWT A;  1U9R A;  4DGZ A;  1HRJ A;  2AWN A;  5IGE A;  1RJT A;  2J7Z A;  5LL6 S;  4A3K B;  5JAV A;  4XQJ A;  1PFN A;  2NN6 H;  2CW0 C;  4CKB A;  3OMG A;  3NXW A;  5JEA G;  4RGO S;  4CGY B;  4MIU A;  1SFO B;  3OWF A;  4ODG A;  3Q0A A;  1G91 A;  1UAP A;  1RCV D;  3OIQ A;  1STB A;  4ZUI A;  4H44 C;  5JEA J;  4EQO A;  4FP5 D;  2F03 A;  2JEA I;  3NTK A;  1NR4 A;  3BVG A;  3L7Z C;  5KND A;  1DXM A;  5CC4 A;  1EQT A;  2FIN B;  5COY A;  2K32 A;  2K03 A;  4TKO B;  4KY5 A;  3N6R A;  3ERO A;  1EY9 A;  2A69 C;  2WAQ B;  4A93 B;  1I4G A;  2FJ2 A;  3BYT B;  2LKV A;  4IFD H;  2F4I A;  5LHY 1;  1II3 A;  4OL7 A;  5JVG 3;  5IOD A;  1KDB A;  4R8N A;  3IL8 A;  3DMU A;  1EWH A;  2B2U A;  4NKL A;  4X3S A;  1TY2 A;  2TSS A;  2XNA C;  1I4R A;  3RUZ A;  1ROD A;  5IGF A;  4HMI A;  3I73 A;  4KY7 A;  1S5D D;  2KJX A;  1XWE A;  4KJN A;  3KUP A;  2EYL A;  1PZJ D;  1JOR A;  1RD9 D;  2F0N A;  4U68 A;  3NBH A;  3PUZ A;  2KUM A;  2E2H B;  4KY6 A;  3EQL C;  3HOZ B;  1ML0 D;  1U4L A;  3RZO B;  3EVQ A;  4C2M B;  1IW7 D;  3SK8 A;  4O42 A;  1F77 A;  5KYL A;  4ZKC B;  3SK6 A;  4C1N I;  1OXX K;  3QOJ A;  2FFK B;  3PUY A;  5CBA E;  5ELF A;  4V0B A;  3DM1 A;  1QNK A;  3FEW X;  2MUY A;  2K5W A;  1NUC A;  3TP8 A;  3TP5 A;  4HR7 B;  1RTN A;  5E3F A;  3I3C A;  1SAP A;  4HCS A;  1JB3 A;  2WII B;  1Y69 U;  1R9T B;  1LT6 D;  5T1G A;  1HA6 A;  5I9O A;  5J22 A;  1QE6 A;  3S14 B;  5JPM C;  3T53 B;  3KLR A;  4JBW A;  1CHP D;  4K2L A;  2DY8 A;  1BDO A;  4FXG C;  1KLU D;  1BUV T;  3VA5 A;  3QIA A;  1EFI D;  2LFN A;  1EY5 A;  3CU7 A;  4IN3 A;  3IKJ A;  1YNN D;  3Q23 A;  3H94 A;  3HZX A;  4ILW A;  3PIO 3;  2AUK A;  2JA8 B;  2F0O A;  3T56 B;  4Z9C B;  1HPC A;  1A15 A;  1TWA B;  1B1Z A;  2IL8 A;  1CQF A;  2QDB A;  1IW7 C;  2QF7 A;  3PMF A;  3HS0 C;  2FMC A;  2A74 C;  5IGC A;  3BS1 A;  4KKU A;  3R3O A;  5EPJ A;  1PTO B;  2RDF A;  1LTA D;  2EYM A;  1PDQ A;  1SNQ A;  3V96 A;  3S1Q B;  1PTO D;  3SK5 A;  1FR3 A;  2F0V A;  1KDC A;  3IAY A;  4RFB A;  1X32 A;  3T51 B;  4NDX A;  2DNC A;  3P7J A;  1U4P A;  2JA5 B;  5IOC A;  1H9M A;  4S3S A;  2EXZ A;  4I7Z C;  4BWG B;  4DK0 A;  4XXE A;  5I4D A;  2A6E D;  2HQE A;  4K6D A;  3HRZ C;  3H6M A;  1L0Y B;  5F2D A;  5KGU A;  4KD3 A;  5G3L F;  4WFN 3;  1DYQ A;  5EGT A;  1SXT A;  5IGD A;  1CA5 A;  2EY1 A;  4K6L A;  1STG A;  3NTI A;  2HUG A;  1KNE A;  1YNN C;  3BDO A;  3FPP A;  4QUC A;  2F0U A;  1K8M A;  2X6L A;  1ZYR D;  1JOO A;  1S5B D;  2KED A;  2F0E A;  3VYU A;  4BBS B;  2NN6 I;  3HOX B;  1LTG D;  3PO3 B;  2E2I B;  1AEX A;  5EPL A;  4FXK C;  3E6Z X;  1V43 A;  1LT5 D;  2BOS A;  2G9D A;  1EWC A;  2PZW A;  1F2Z A;  1GHK A;  5I6W A;  2KQ3 A;  3NP8 A;  2HCC A;  4DXG A;  3DWA A;  3TME A;  1WD1 A;  1HTP A;  2EY6 A;  5M3M B;  2F0G A;  4J8Q A;  2JP1 A;  1EEF D;  1SNP A;  1TVX A;  2F0D A;  4N9T A;  4ULL A;  2D5D A;  1I50 B;  1FD7 D;  1DM0 B;  2A6E C;  1LTR D;  1NSN S;  4KJO A;  1XXG A;  1YNJ D;  3DUZ A;  1EYD A;  5M3F B;  1ZXT A;  5D14 A;  4IFD I;  1SSO A;  3TP7 A;  3J81 E;  4OIK A;  1JQY D;  1O80 A;  1BCP C;  2NBF A;  2AWO A;  2KOL A;  1FGB D;  1O7Y A;  4QIW B;  3NTH A;  4LK1 C;  2IX3 A;  3S1N B;  3TN2 A;  5I2Y A;  1I4Q A;  3URY A;  3SK4 A;  1Q3L A;  1S5E D;  2MPM A;  2H4O A;  1SMY C;  4J1M A;  4RHR A;  1AP0 A;  1T5E A;  2B2V A;  5BN4 A;  1SJE D;  1TS4 A;  3GTL B;  2YYZ A;  4ZYS A;  4IQZ A;  4NMZ A;  1J9O A;  3BZD B;  2SEB D;  1SDF A;  2EJF C;  4K8J A;  5FO7 B;  2FMM A;  2PO4 A;  1XX8 A;  3D4D A;  3CKI B;  2NVQ B;  4IUQ A;  1FNV A;  2IX0 A;  5ELB A;  4G57 A;  4RWS C;  4EQP A;  1HXY D;  1B9N A;  1Q12 A;  1GOZ A;  2B2W A;  3MFG A;  3OWE B;  1F9R A;  3U9S A;  1E2V A;  1YNJ C;  2HDM A;  2F1M A;  1QCB D;  1PTO H;  3OW7 A;  1F2M A;  5D3I B;  4F88 A;  1T5X D;  2A6H C;  5JJZ A;  2QKI C;  2QIL A;  3VR5 A;  1LAC A;  4EVO A;  3BVZ A;  2WKD A;  2EDG A;  1JWM D;  2XVS A;  5E4X A;  1GUS A;  2MHV A;  4GZY C;  4FVM A;  2O4X A;  5T1I A;  5HUR A;  2F3V A;  1PRT B;  2PW7 A;  4K2K A;  1AN8 A;  1EY8 A;  1PFB A;  5K5P A;  4RKB A;  3DXJ C;  1PRT D;  4P2C B;  3D4R A;  2PQE A;  4FYD A;  3D3R A;  5A2Q L;  1DOL A;  5EQ0 A;  3E5S A;  5C44 B;  3T13 A;  2PMZ B;  1CZG A;  2F0S A;  2A5H A;  1A2U A;  3QOL A;  1Y8N B;  1B4O A;  4K14 A;  1KTK A;  4PMC A;  1V1P A;  3HOU B;  5DAU A;  4F8M A;  3MEH A;  4DA2 A;  1SNO A;  1TT2 A;  3SEB A;  4RGT A;  3ITP A;  2A73 B;  5BN5 A;  2KA7 A;  2VB2 X;  2WV6 D;  1MBY A;  2IJ0 A;  2RBM A;  4WOR A;  4EQN A;  3WOE A;  2NB0 A;  4XYQ A;  4XTC S;  1K83 B;  1SNM A;  1ILQ A;  3JAM E;  3HEJ A;  5C5M A;  3EFX D;  5C3X A;  1OXS C;  3MVV A;  1SEB D;  1X3P A;  1UEA B;  1TQO A;  2JA7 B;  5FLX E;  1SND A;  2LY7 A;  5E4W C;  5JVH 3;  2EY2 A;  1SYE A;  4ME5 A;  4ABN A;  1TKW B;  3AU7 A;  1G29 1;  3EJI A;  5CV4 A;  1AZP A;  2EOT A;  4CKE A;  3R8B A;  2L12 A;  2BDN A;  2DN8 A;  2R93 B;  4B9W A;  1D5X C;  4A3M B;  4BA1 I;  3ERQ A;  2K6A A;  4G7O C;  1PRT C;  2WP8 J;  1BCP F;  2R92 B;  1E2Z A;  1QIL A;  2EJM A;  5EBD A;  4XQQ A;  4CBV A;  1AZQ A;  5J1Z A;  2B2U C;  1SYF A;  4FO2 A;  2SDF A;  2IWH A;  5KIX A;  3SR1 A;  4PV1 C;  3I70 A;  2QEJ C;  3IFD A;  2E74 C;  2VXW A;  2JSO A;  1CHQ D;  5C5L A;  1BNZ A;  1DCZ A;  4DN4 M;  1CQV A;  3S9W A;  1LO5 D;  2B39 A;  2VB3 X;  1JOQ A;  5C0X I;  3MXN A;  3MXG A;  5CYU A;  1NR2 A;  3OPO A;  5TSS A;  1I4X A;  2F0P A;  2O5J C;  1B2T A;  2D62 A;  2SNS A;  4C3I B;  3BVM A;  2BE5 D;  1BBX C;  2O5I C;  4PNY A;  1VMC A;  4KV6 A;  1PZK D;  5C3E B;  5EJW A;  2NZ1 D;  4L6T B;  1TS3 A;  1B53 A;  4CJ0 B;  2NTT A;  3K5M A;  1Q1B A;  3HGB A;  4KN4 C;  4C3I G;  2WKC A;  3PO2 B;  4M1U B;  3QJY A;  3Q6S A;  4A3G B;  1MGS A;  4DXF A;  1CI3 M;  5EBC A;  3R93 A;  4M8A A;  1JE4 A;  3GTG B;  4A3F B;  4RKL A;  3MXU A;  2XRS D;  3BDL A;  5EKL A;  1OXU A;  1WVL A;  1TY0 A;  1CK1 A;  1EIG A;  1EYC A;  2QCP X;  2J0T D;  1JCK B;  4RHS A;  4OO1 H;  2K5D A;  5C0X J;  3S1M B;  5FKA C;  1EY4 A;  3BG3 A;  5ELE A;  1F2Y A;  2L4N A;  4ZLT F;  4LAA A;  1OO9 B;  3Q24 A;  1U4M A;  1AW7 A;  4NW2 A;  2A68 D;  4KKS A;  2BE5 C;  1G6Z A;  2K05 A;  1HFG A;  5JEA H;  5COR A;  2K7V A;  2AQ3 B;  5EKI A;  2BA0 A;  2F0K A;  3GO5 A;  4DAV A;  5IGG A;  5I9P A;  2CHB D;  3G7L A;  3HG9 A;  3UI2 A;  1S4Z A;  4CKC A;  1RDP D;  4DK1 A;  2C9O A;  3M7N A;  4QF4 A;  1SBB B;  3EA6 A;  3HOY B;  1SYD A;  5EPK A;  1QOH A;  3GV6 A;  1LT3 D;  1TWH B;  2LS0 1;  3R2I A;  5HGT A;  4A3D B;  5ELC A;  3P1H A;  1PRT F;  4XDX A;  1DOM A;  3QG1 A;  4QMG A;  4JK1 C;  1F9Q A;  2F0T A;  2JA6 B;  1QNU A;  1IYU A;  3K5O A;  3I90 A;  1XYI A;  1WTO A;  1JWU D;  3S2D B;  3K5L A;  1BO0 A;  2NVT B;  3LWE A;  1JIC A;  4ZAI A;  3J7A F;  4A3J B;  5E1F A;  4WJW A;  3U9O A;  1C48 A;  2A68 C;  3DWQ A;  1QWY A;  5FK9 C;  1EZ8 A;  5BN3 A;  1EYA A;  1DD2 A;  3NSW A;  2SNM A;  1TWC B;  4DFA A;  1GXD C;  1VF7 A;  5J39 A;  4ZKB B;  1ENF A;  2AUJ D;  1SJH D;  3KLS A;  5A35 A;  1M8A A;  3QB3 A;  1PTO C;  4XYO A;  5M5Y B;  4K5X A;  2EYH A;  1C4Q A;  3FRP B;  1Y8P B;  1ESR A;  3AB9 A;  1FYC A;  3D8G A;  4C56 C;  2F0I A;  3C46 A;  3RMH A;  1KAA A;  3S2H B;  4A3I B;  5M9O A;  2V4D A;  1LAB A;  4HSV A;  5ELD A;  1Z47 A;  1W6K A;  4RH6 A;  2VUM B;  3QO2 A;  3GTO B;  3A8I E;  4K8I A;  4DNT B;  3NQI A;  1H9J A;  1A6X A;  1SYG A;  4HAE A;  2B2V C;  1QG7 A;  3ND9 A;  5CGK A;  1GHJ A;  2NN6 G;  1V1P B;  1ZYR C;  5NUC A;  3I8Z A;  2R3Z A;  3FVQ A;  3T4A C;  4QUF A;  3C1F A;  1EZ6 A;  3C1E A;  5D65 A;  3V2T A;  1CZW A;  3W3A A;  3SDZ A;  4CJ2 C;  1ILP A;  4G7H C;  3A55 A;  1TWG B;  1WTX A;  4KHV A;  4RGN A;  1WTV A;  1E2W A;  1NAP A;  4ZRZ A;  3A54 A;  1LTB D;  4OIJ A;  3S15 B;  2B2W C;  3V05 A;  2EYO A;  4KN7 C;  1STA A;  4NP5 A;  4BY1 B;  3MZ5 A;  2JYO A;  3S17 B;  3I72 A;  2D9U A;  3PUW A;  4O1N A;  4E6I A;  1WCM B;  4DAP A;  4CJ1 B;  1B44 D;  2NUC A;  4XQN A;  1ET9 A;  2LMC B;  3H0G B;  3K5N A;  5IT9 L;  1JWS D;  4IFD J;  2F0J A;  5CV6 A;  3GD7 A;  3RZD B;  1BR9 A;  5KYI A;  2RKS A;  2F0Q A;  5K36 G;  3MHB A;  3A8K E;  2O2L D;  1CFM A;  3GTP B;  1L0X B;  4OO1 I;  1GJX A;  5M5W B;  1F2L A;  3K0Y A;  3H09 A;  1E0B A;  4PQX A;  3HOV B;  4DAY A;  3PV0 A;  2CW0 D;  1G2S A;  2F0L A;  2IT1 A;  3CHB D;  4BS9 A;  2F0H A;  2E2D C;  4IUP A;  1A3T A;  3NPP A;  1QB5 D;  1JR0 D;  1PMR A;  4DNR B;  1O78 A;  1AFP A;  1I6H B;  2EYP A;  1V8Q A;  2I07 B;  2WAC A;  1I6V C;  4BA2 I;  4XIG S;  1BXT A;  2RDG A;  1TR5 A;  2OEO A;  2Y0S B;  3D6W A;  3M4Y A;  3NQT A;  4UAI A;  3ZYY X;  3NBI A;  2AQ2 B;  2PNR C;  2MJ8 A;  3HOW B;  3K6O A;  4HSP A;  2EY5 A;  4MN3 A;  3J80 L;  4RCO A;  2RQX A;  5C4J B;  1ESF A;  3NHH A;  3WDN A;  2J4X A;  3VYT A;  2L0C A;  5CV7 A;  2L1B A;  3M85 A;  1EQV A;  1Y1W B;  4FF4 A;  3KF8 A;  3MFY A;  1I4P A;  3K7A B;  2NWG A;  3GTQ B;  3D6C A;  4FF3 A;  5FO8 B;  1D1K A;  5DEH A;  1XTC D;  4U67 3;  1PYW D;  2CVR A;  2ICI A;  2C5C A;  1EY7 A;  4F7X A;  1PTO F;  3DEO A;  1A3V A;  4DU9 A;  3RD4 A;  4TQU S;  3X3M A;  4QCL A;  1MI2 A;  4H0L C;  3TDQ A;  1JOK A;  3PIP 3;  2ZXO A;  1EY6 A;  2FHT A;  1LTT D;  1RKN A;  2F0M A;  3LX0 A;  1HQR D;  1O7Z A;  5C4Z A;  2E75 C;  4X3U A;  3NE5 B;  2B63 B;  3LWU A;  1Q90 A;  3NUC A;  1HCZ A;  3OSO A;  2IPK D;  2B8G A;  3A7A B;  2BDO A;  1STH A;  4FF2 A;  3K57 A;  4FF1 A;  3VYR A;  2L9H A;  1W6J A;  1HUN A;  1Z6H A;  1V1O A;  1VMP A;  2PW5 A;  4HMJ A;  4IUR A;  2G9H D;  2SOB A;  1ZKO A;  3M4O B;  1HQM C;  5DNF A;  1ONL A;  2N88 A;  2E76 C;  3FMC A;  2NVY B;  2RVL A;  1UUP A;  3I4L A;  1TWF B;  1VCI A;  4R8I A;  1WTR A;  1O7L A;  4K5W A;  1GUO A;  2HDL A;  1I3Q B;  5C3W A;  2KEC A;  3I91 A;  3J7A V;  3GTJ B;  5CV5 A;  1OXV A;  1PLF A;  4EGV A;  4LJZ C;  3AMU A;  1QJO A;  1SNC A;  1EIH A;  1EU4 A;  1GUG A;  5K36 H;  2MP1 A;  1CTM A;  3MAQ A;  1VDZ A;  1J8I A;  1MSH A;  2HCI A;  2BA1 A;  4IZ8 A;  5CV9 A;  3GP7 A;  4A3E B;  1X3Q A;  3D4W A;  1HUM A;  1IKM A;  4B08 A;  2KCN A;  1BQQ T;  3CRK C;  2WB1 B;  3VR2 A;  1EY0 A;  3BYY B;  4FNF A;  4G7Z C;  2Z1C A;  4C3J B;  3FDT A;  1ENA A;  3KK7 A;  3NWS A;  4KI0 A;  1U4R A;  2N55 A;  2X6G A;  4IAL A;  1DOK A;  2EYJ A;  5CBE E;  1FNW A;  2Z4I A;  4ID6 A;  5IIF A;  5C0X G;  1R4Q B;  2KCC A;  3RLF A;  4C3J G;  1LT4 D;  2BCO A;  4KHZ A;  2EYF A;  4DF7 A;  1EEI D;  1Q1E A;  4ZUJ A;  1VF5 C;  3S16 B;  1OXT A;  3MWY W;  2PZT A;  3FPU B;  3TZU A;  2WIN B;  1CT1 D;  3HP3 A;  3BDC A;  4J6H A;  3SXH A;  1TS5 A;  4F87 A;  1EL0 A;  1I4H A;  2JEB I;  2RSN A;  4I65 A;  1C8C A;  1KAB A;  3A7L A;  4IUU A;  3VR4 A;  4OGQ C;  5IGB A;  4V19 0;  3H3V C;  3I4N B;  5I2X A;  2JE6 I;  3GQB A;  2L55 A;  3KBX A;  4K5V A;  3MTS A;  1IHZ A;  2B2Y C;  2XSC A;  4R9W A;  1RHP A;  1EOT A;  1F9P A;  3X3N A;  1PZI D;  3L3O C;  1BOS A;  3PUV A;  1KLG D;  2B2T C;  4TSS A;  3S1R B;  2M00 A;  1TII D;  1LLR D;  5FOB B;  3M3Y B;  3C2P A;  2KEE A;  2EPB A;  3TP6 A;  1DZ1 A;  4BBR B;  3Q22 A;  2K28 A;  3H91 A;  4FXD A;  3M7G A;  1SYB A;  2Q8R E;  4OHJ A;  2L5T A;  2B2Y A;  1STY A;  5KRU A;  3P20 A;  2Q8T A;  1Z7T A;  3VR3 A;  1BF4 A;  4HN7 A;  1HA5 A;  2RA4 A;  4YIJ A;  2K33 A;  1F9S A;  2ID0 A;  2B2T A;  1MSG A;  2ZXR A;  5EKK A;  2EJG C;  4HCE A;  1H9S B;  1B3A A;  4QB4 A;  3SE0 A;  3W2D A;  1S5F D;  1SYC A;  3GTK B;  4Y7N B;  5AFW A;  1SE2 A;  3TZD A;  1RF2 D;  4L8J A;  5DM6 3;  1H9K A;  1WTQ A;  1BCP B;  4KK7 A;  2OXP A;  1D5Z C;  4KTA A;  5M5X B;  4B9X A;  1BCP D;  2MGS A;  2TMP A;  3D31 A;  1D1I A;  1GUT A;  5CV8 A;  1WD0 A;  2RDH A;  1TS2 A;  2AQ1 B;  3VYS A;  4X3T A;  3CRL C;  2F3W A;  3DEP A;  3VR6 A;  1STE A;  2PPB C;  5CMD A;  1SMY D;  5C4H A;  3KBG A;  3K59 A;  4BY7 B;  2X69 A;  1HHV A;  3C3L A;  2DY7 A;  3ONA B;  2EZV A;  5KEE A;  4G4K A;  2DNE A;  4RCN A;  1B9M A;  1ET6 A;  1ENC A;  1DJR D;  3WOF A;  2ENB A;  2I46 A;  3DHQ A;  3DWP A;  2RSO A;  3ND8 A;  2H1E A;  2IW3 A;  1CA6 A;  2XIW A;  2ZXP A;  3PUX A;  1IYV A;  1FNU A;  2B8F A;  1B50 A;  2M2L A;  5I6Y A;  2XRQ D;  1GUN A;  5C0X H;  4LMQ D;  1Q8I A;  3J81 L;  3R2T A;  1R4P B;  1CM9 A;  2PZU A;  1H9R A;  1ICW A;  2Z8L A;  3MXP A;  2OT2 A;  3OIP A;  1JC7 A;  1LTI D;  2A6H D;  3F2U A;  3L9A X;  1PXU A;  1ZEQ X;  3OHX C;  4KD4 A;  1Y1V B;  3I4M B;  1IL8 A;  4C3H B;  2JXM B;  3HKZ B;  1LTS D;  4TRD A;  1G2T A;  4MHE A;  3O13 A;  2ZT9 C;  2R7Z B;  1H9S A;  3IFT A;  5JPN C;  3T16 A;  2K1B A;  4IUN A;  2KVM A;  2YU9 B;  1EU3 A;  1A3U A;  1DON A;  2F0W A;  2PCF B;  4PMB A;  2XWJ B;  2VNU D;  3OMC A;  4ZQ3 A;  4C3H G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...