3EVQA

Crystal structure of staphylococcal nuclease variant delta+phs l25e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKEMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of D+PHS L25E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3evqA00
1NUCA 4KY5A 1KABA 1SNPA 3SK8A 1A3TA 4N9PA 4KJNA 4WORA 3NP8A 1EY4A 2F0UA 2F0KA 1JOOA 3H6MA 4KY6A 5JAVA 1A3VA 5NUCA 5KGUA 5CV6A 2PQEA 2SOBA 2PYKA 5DAUA 3DHQA 3SK4A 3SHLA 1TQOA 1TT2A 3S9WA 1SYBA 3TP6A 1NSNS 1EY6A 4S3SA 4K2LA 2EYMA 2EYLA 4KJOA 3TP8A 5HGTA 5CV5A 4ME5A 4EQPA 1A2TA 4PMCA 4LAAA 4B9XA 5CGKA 1SNCA 5CR3A 5C5MA 5I9PA 5IGEA 2EY5A 5IGFA 1JOQA 5IODA 1STHA 3MEHA 2F0SA 4HTHA 5ISRA 5KYLA 1SNMA 4ZQ3A 3MVVA 1SNOA 2M00A 3HZXA 5JOBA 2PZWA 4K5XA 1EQVA 3RUZA 1STYA 2F0DA 2F0PA 2LKVA 4K14A 3ITPA 3T13A 2OEOA 1KDAA 5CV4A 4DGZA 1EZ8A 2F0OA 1STNA 5CV9A 1F2YA 1EYDA 1EY0A 4MIUA 3MHBA 1EY7A 4NDXA 2F0FA 1A2UA 3T16A 5KRUA 4QF4A 5C5LA 2EYOA 1RKNA 1STAA 2F0JA 5C4HA 5KEEA 5CV7A 2F0WA 3D8GA 4K6DA 1SNQA 3DMUA 4K5VA 5C6AA 5HURA 2RDFA 3NXWA 4KV6A 5J22A 4PMBA 1ENCA 3E5SA 2F0EA 2HQEA 1SYEA 4DU9A 4K5WA 1SYGA 1F2MA 3C1FA 5I6YA 4IUNA 1IHZA 4PNYA 4R8NA 3SR1A 2RKSA 1SYCA 3PMFA 5IGDA 1SNDA 2PZUA 4G57A 5E1FA 2PW7A 3EJIA 4ID6A 2SNMA 4RKBA 5EGTA 2EYHA 1A3UA 1EYCA 2EY1A 1JOKA 5EKLA 3SK5A 5IGCA 5K5PA 4HMIA 2F0QA 3BDCA 3P1HA 5I9OA 4KD4A 2F0MA 3HEJA 2OF1A 1F2ZA 4NKLA 4IALA 5J1ZA 1KDBA 5EKKA 2EYPA 1EYAA 1KDCA 3D6CA 4KHVA 4WRDA 5C3WA 1AEXA 5CC4A 4QB4A 4B9WA 3LX0A 2NUCA 3TP7A 2O4XA 2F0LA 5I6WA 5C4ZA 1EY8A 4NP5A 1JORA 4F7XA 3U9OA 4YIJA 2RBMA 3MZ5A 3OMCA 3TMEA 2KHSA 2F0TA 4ODGA 2EY6A 4EQOA 2F0IA 5C3XA 5KIXA 5J39A 4H7BA 4DF7A 1SYFA 3QOJA 3NQTA 3NK9A 3OWFA 3R3OA 4K8JA 4EVOA 5IGBA 1ENAA 2QDBA 4KD3A 4KTAA 3SXHA 4F8MA 3QOLA 3ERQA 1U9RA 4J1MA 1EZ6A 2F0HA 5IGGA 4IZ8A 4ZUIA 1KAAA 4J6HA 2F0VA 2EY2A 4KY7A 4NMZA 5E3FA 2SNSA 4QMGA 2F3VA 4HMJA 3OMGA 5DEHA 1II3A 1EY5A 5F2DA 2KQ3A 3NUCA 2EYJA 2WACA 3BDLA 3EROA 4K2KA 3TP5A 1STGA 5IOCA 4RKLA 4DFAA 1SYDA 3OSOA 4I65A 3D4DA 3MXPA 3SK6A 5IIFA 5M9OA 3D4WA 3EVQA 1STBA 4N9TA 3NHHA 4OL7A 4EQNA 5KYIA 2OXPA 2ENBA 2EXZA 2PW5A 2PZTA 3C1EA 3P75A 3V2TA 2F3WA 3QB3A 4K8IA 5CV8A 4ZUJA 4E6IA 2EYFA 2F0GA 2F0NA 4TRDA 1TR5A 3VA5A 1EY9A
chains in the Genus database with same CATH superfamily
4OO1H 2EXDA 1KABA 4CKBA 5IP7G 4N9PA 3CU7A 1PYWD 1Z6HA 4A3BG 1UAPA 3K7UC 4RA8A 5JAVA 1H9KA 1VQPA 2HHHQ 1TS5A 4JW0A 1PRTD 3PO3H 4OWXB 3F2CA 2GVBA 1L0WA 3S1MB 3T1HL 3BG3A 4A93G 2EYLA 3MC0B 1ENFA 2MO1A 5C3EH 4HIDA 4IOAA 3HOWB 5IGEA 4JI4L 1LO5D 3K7AB 2JA6H 1EQRA 4X64L 4R9WA 1TWFB 2WFWA 3S17B 2LS01 2ZTCA 2LKVA 1WTXA 4QGUA 3E0EA 2K04A 3KF6A 1PH4A 1M4VA 3KYHC 5EBCA 1QG7A 1SNQA 3DMUA 2YU9B 4DV4L 3E5SA 1H9JA 4C1NI 1MJCA 4JI1L 3PO3B 2SEBD 2RKSA 4A3KH 2EJGC 2PMZE 4G57A 2RSNA 2CHBD 1RCVD 2DY8A 1VQIA 1NMGA 1EYCA 2EYHA 2EY1A 3J80i 4JI3Q 5M3FG 1RL2A 5HY6A 3P1HA 5I9OA 1BCPC 4DV3Q 4M8AA 1F2ZA 2N49A 4N8FA 3GTKB 1V8QA 4QB4A 1LTID 2F0LA 2BCOA 3I4NB 3V96A 1SMYD 1N36L 4F7XA 1MD2D 3OMCA 1LT3D 2NZOA 4H44C 3TEHB 3PO2B 3FVQA 4R4OA 3O13A 4XIGS 3ZJYC 4A4IA 2B63G 4XYOA 4KD3A 1N32Q 4QCLA 4P2CB 5IT9E 1C8CA 3S2DH 4J1MA 4LF8L 2G9DA 1XNQQ 1YJ9A 4C3IH 4NMZA 2SNSA 1Q3LA 4BBSG 4NB3A 1II3A 3L9AX 3EROA 3CCEA 4LK1C 1IBLQ 5M5YB 1Q46A 1AE3A 2EXZA 2IWHA 3C1EA 3BZKA 2R93B 1BKBA 1CK1A 1LUZA 3G48A 1DXMA 2UUAL 1YEZA 4DAVA 3H6MA 4KY6A 4X66L 4A3JB 1RTNA 1BVSA 1TWHB 3VA7A 4GOPB 3TS2A 2F52A 1SYBA 1EIYB 4JI8L 3J7YW 2RQXA 4RFBA 4ME5A 1SJED 1R4PB 3RN2A 1I4QA 1IYJB 2B2WC 1LT4D 2K5QA 1EQVA 2WB1G 4DR6Q 1PV4A 2MHVA 4GLAC 1GUGA 4L63B 4DV7L 4A3IB 1G6ZA 1EYDA 3HOYH 1JR0D 1N9WA 5M3MB 3MAQA 1STAA 4IUQA 2A69C 5FO9B 5C4XB 4PG3A 1BOSA 4AQYQ 3SEBA 1I94Q 5HURA 2C5CA 2OCEA 2CH4W 1EUJA 2E2DC 2H4OA 4PV1C 2R61A 4H0LC 1QZGA 2I0QA 1C48A 2BH8A 2JEBI 1CSQA 5JEAJ 3CRLC 1ZXTA 1YIJA 3BVGA 4UHVA 4X62L 1DJRD 2HUGA 1KLUD 2EJMA 2L5TA 2NUCA 5M5XB 5C44G 2NVTH 4CDCC 3HOYB 2IX0A 2B39A 1Q1BA 1Q1EA 4FF4A 1BR9A 1KNAA 3WWVA 5IE8A 2F0TA 2OTLA 1C7YA 1EWHA 2ZTEA 4NXMQ 2B2VC 3E6ZX 4DF7A 4KKUA 2Q8TA 4LF4Q 3RMHA 2A1AA 1PH2A 3G6EA 4DK0A 2Z6KA 1X3QA 4OONA 1PH3A 1MHWC 3CD6A 4RGOS 1A6XA 5DEHA 4OIKA 1VQJA 2KEDA 3VR4A 5D3DA 1JCKB 1O7LA 2KHJA 3D6WA 2NN6H 2C35B 3TRZA 3CP0A 1HZ9A 4DV5L 4OL7A 3Q6SA 1H9MA 4JBWA 1MSGA 1YZ6A 1NJIC 4A3EH 2N88A 2Z1CA 1PDQA 2EPBA 2L12A 5JVG3 4DR1Q 1A3TA 4BXXG 4A3GH 1JOOA 3KBGA 4DR4Q 5DAUA 4JI2Q 2ZJRA 2NZ1D 1C9OA 3OHXC 4J8QA 2K6AA 4V0BA 1EOVA 3CAMA 3UE0A 2JA7G 2UUAQ 1A2TA 1NY4A 2Q2IA 4LAAA 3NE5B 3AU7A 2UUCQ 3DWPA 1QVFA 5KYLA 4IUVA 1PZKD 3A55A 1A15A 1KC8C 2EDGA 2D0OA 3FMCA 4LF5Q 3PF4A 3GD7A 5FLMG 5KRUA 1GUTA 4QF4A 3MXUA 5JPMC 4IUUA 4X65Q 4A3KB 3TREA 4DR6L 2BDOA 3RLOA 3GTPB 5BR8L 2PNHA 1JMCA 4OO1I 4Z9CB 2PZUA 3FKIG 4IJHA 3VYTA 1F9RA 5EGTA 3I56A 1A3UA 3F8TA 3I90A 5C0XI 1Y8NB 1SE8A 2Z0SA 3CCQA 1KHIA 4C3JB 1K9MC 2Q8RE 2NVYH 5I2XA 3I4MB 4B9WA 1S5FD 5M5YH 5DM63 3PGZA 1JORA 3MXNA 1TY0A 1GKHA 3R93A 5IY0A 4V190 2ZJQA 5IT9L 4HJ9A 2NBFA 1VQLA 4RWSC 3S24A 3NQTA 1B53A 4HIOA 2F4VQ 4B3ML 4GKKQ 1K8AC 4P75A 4ZUIA 2KVMA 1SN8A 3K6OA 3DEOA 4QMGA 1TVXA 5GROA 2NN6I 1EY5A 2KQ3A 1VQCA 1W6JA 2J4XA 2WACA 4K2KA 4RGTA 4DFAA 1U4MA 3D4DA 2CFMA 5ELOA 3GV6A 1STEA 1D2BA 4ZLTF 1CSPA 5IWAQ 4A3DH 1RTOA 2RDHA 3A5UA 3HOZH 4KY5A 1P8LA 2KBNA 4YCWA 3ULJA 1V1QA 2O2LD 5I2YA 3J7A5 1AZPA 4OIJA 5C0XJ 3BVZA 1SLJA 2B2UC 1J6QA 2PQAA 1O80A 3ERSX 3CCUA 4POGA 2NVQB 1MIUA 1AFPA 3NBIA 5CGKA 5CR3A 4BBRH 4DR2Q 1CI3M 3A0JA 4KHPL 1RD9D 3NWSA 3PUXA 3OTOQ 5GADC 3U4VA 1RODA 3HOYG 4JYAL 3T13A 1I4XA 3EIVA 1F2YA 3GTJH 1X6OA 1N34L 2UUCL 2F0JA 1VS0A 2QDLA 3S14H 1I4HA 3W1GA 2A73B 2HQEA 4DU9A 4OGQC 2D5DA 4DV0Q 4BBRB 1T5XD 2XGTA 4DV2Q 1SNDA 2NVQH 1WCMG 2F1MA 1J5EL 2A68D 2PI2A 4RKBA 5JJZA 3JC66 3S1RH 4CKEA 4C3IB 4UPAA 5C4XG 1EEID 2FHTA 2K01A 5BR8Q 1PH9A 2QGQA 3I70A 4L8JA 2K7VA 3I4OA 3QO2A 4OELB 3W1BA 3U9SA 5EAYA 1IBKQ 1Z9FA 4RGMA 1N8RC 5JEAG 4OHJA 3URYA 1S3OA 3NQIA 5KIXA 2A69D 1YNJD 4FYDA 5CORA 4NW2A 1O7YA 2QDBA 3SXHA 3K59A 3DWQA 1X65A 1HR0L 2F0HA 3BVMA 4JBMA 2HDLA 2R7FA 1Y1VB 1PLFA 3WOFA 4A3FB 3PIP3 1CKNA 4IPHA 4KN7C 4AQYL 4IOCA 3SDZA 1JICA 2E75C 4N9TA 4WJ4A 4DV4Q 2PW5A 3FKIB 3UE1A 1S72A 3M3YH 4TKOB 1TS3A 4IFDH 1IXRA 1LTAD 2B3GA 1CHQD 2JA8B 2LXJA 2HIVA 4YWLA 4I7AA 2DN8A 5AJ3Q 4FXKC 3BYTB 1A0IA 3DXJC 4XYQA 3CPWA 1XPRA 5IWAL 2Y0SE 3HKZE 3SHLA 5IYBG 3NWTA 3CCJA 2ALYB 2HCCA 2Q8IB 1ZEQX 4KJOA 3UI2A 1N36Q 1CKMA 4PMCA 2NTTA 3M7GA 1EL0A 5KNBA 1Y14B 1O7ZA 1Z7TA 2Z4IA 1JJGA 1STYA 2ZXPA 4HJ7A 2JA7B 4HSPA 4B3MQ 1EZ8A 2F0OA 3OW7A 1HNZL 1I4GA 3MHBA 2F0FA 1UE5A 4K6LA 4TSSA 1IYVA 1RKNA 1S5DD 3G4SA 2IHEA 4QUFA 1X32A 2A6HC 3QJYA 1YNXA 2Z6KC 2CW0C 3AB9A 5J22A 4DV2L 4A93H 2UXCL 5C44H 1SYGA 1K3RA 1H9RA 1IHZA 4C3JH 4G7ZC 3KLRA 3B6YA 3NTHA 2EJFC 4CJ2C 2Y0SG 3HKZG 1FVIA 1G291 3SK5A 1SEBD 1B4OA 1AW7A 3R2IA 5CMDA 1HUMA 3PIO3 1JB3A 1OXUA 1E1OA 4KD4A 3NBHB 4IFDG 1TWFH 3W5OA 3ICEA 4WRDA 5C3WA 2FXQA 3OIQA 4MN3A 3KF8A 1YI2A 1Y1WG 2K50A 1CTMA 2YU9H 1CFMA 1KAWA 2A74C 2QCPX 3M3YB 1R4QB 1F77A 2E2HH 1X3PA 3TBIB 1WTPA 5J39A 1SMYC 4GN4B 4UAIA 3CC7A 3HOWG 3NK9A 2E2IH 2R92H 3VYSA 4GNXA 2L55A 4F8MA 1U9RA 2YV5A 3GTLH 5E3FA 2EY2A 1K73C 4LF7Q 2CWPA 2IW3A 1HR0Q 2PPBC 2KEEA 3D3RA 2UUBL 1IZ6A 4RKLA 4MTNA 1U4LA 1STBA 2K5HA 2K03A 4EQNA 4X64Q 4IUTA 3TQYA 4CJ1B 1ZKOA 4EQ5A 1PVOA 5ELDA 1NR4A 2EYFA 1HJPA 1X56A 1IBKL 1WOCA 4LFCL 5D3IB 5FKAC 3J7AV 1BXTA 1W6KA 5FLXE 2R3ZA 4A3MG 2N3SA 1E0BA 3GTGB 2V1CC 3VDYA 2FMCA 4O1NA 4A3IG 3STBD 2UU9Q 3N6RA 2HDMA 1LM0A 1FJGL 4HJAA 4O42A 1L1OC 1M8AA 3KF8B 1CZWA 3MVVA 1U0LA 4JI4Q 2OEOA 5K36H 1F2LA 1I6VC 2EZVA 1YITA 2YYZA 1A2UA 2V4DA 2EYOA 5C5LA 4DNRB 3QG1A 5JPNC 5K36G 3A56A 4A3MB 4K5VA 4ZAIA 1KTKA 3VYRA 1VQ5A 5HGQA 1DOMA 1GOZA 1B3AA 3EN2A 2RSOA 3I2ZA 3S2HB 2XRQD 1QUQB 3NTIA 1LTLA 3HOXB 2JA9A 1WTQA 2HQLA 1NNXA 3H15A 1ESFA 3LNNA 5LMNW 3EA6A 2KCTA 3J80L 1QVCA 1U5KA 3K0XA 5J1ZA 3L0OA 4IPDA 1WVLA 1N33Q 1PTOC 4HCSA 2NVXB 1E1TA 2MNAA 3LX0A 2X69A 1VQBA 1YNND 1KLGD 1X3GA 5C4XH 1NTGA 4NP5A 2L4NA 3U9OA 3MWYW 3PIPA 2K5WA 4OXPA 2AQ1B 3S2HH 2AQ3B 2IPKD 4EQOA 5C3XA 3GTQB 2Z8LA 5IP9H 1CUKA 2VQEQ 3QOJA 2PI2E 5IGBA 4EVOA 1C4QA 4JV5L 1I4RA 1Y1WB 3I4NG 3HP3A 2YTYA 2F3VA 2K05A 1E7ZA 2VQFL 2K32A 4GLXA 3KFUA 3HS0C 4X65L 5M3FB 3CPFA 2SDFA 1N32L 3D4RA 4UDUC 2KCMA 3J80E 3PO3G 3ZYYX 4DPGA 1K8MA 1EY9A 1WD1A 3A8JE 2B2UA 3GV3A 1VMCA 2BOSA 5NUCA 5KGUA 5IP7H 3K5NA 4G7OC 2P5ZX 1G8ZD 2RHQB 3JAMi 4BY1B 1E3PA 2SOBA 4CBVA 4IFDI 3KDFB 4ZKCB 3BZDB 4L5RC 1PYBA 4A75A 1ZYRD 5C0XH 4YWMA 1JOQA 2XVSA 2F0SA 1WCMH 2EIFA 4A3DG 4IPGA 2F4VL 2F0PA 5M5WH 2XTIA 1PH7A 5CV9A 3J81c 4G4KA 5ELBA 1UE1A 1HCZA 3T16A 4FF2A 1UEAB 3A54A 5EKIA 3PO2H 4A3BB 3R8BA 4ME3A 4LUOA 2QF7A 2Y0SB 3HKZB 3C46A 3DEPA 4B3RL 4JI0L 1SRUA 1IBMQ 5IGDA 3RZOH 1PXUA 1L2FA 2C9OA 1EEFD 4HIKA 4A3KG 4LWCA 3HEJA 2DNCA 4FVMA 2Z4HA 2HD3A 1I4PA 4KHVA 2R93H 1AEXA 1YHBA 1EY8A 4C1NK 2KENA 2MO0A 2MGSA 1TWHH 2LFNA 2QILA 1QCBD 4GNXB 3A8KE 4LF4L 1PMRA 1CA6A 4Y52H 2E2IB 3DWAA 3BDLA 2D62A 5ELEA 2BH2A 5IIFA 4ULLA 3HOWH 3GTLB 1OXSC 3LWUA 1Q8KA 3NHHA 4HEDA 5LMNL 4DV6L 3PUWA 3ND9A 3HOXG 3GTKH 4AYBG 3NBHA 2MJ8A 3TN2A 5JEAH 2AUKA 1YNNC 1HQRD 4TVAB 3HOUB 1ICWA 1KQSA 3VR5A 3GDEA 1BBXC 2VQEL 2IX3A 3CRKC 5J3BA 1Y1VG 1HNWQ 1PTOH 2K75A 4JI5L 2AQ2B 4RMFA 4P71A 3WDNA 1STHA 2ZXRA 3TDQA 4XXEA 3FKIH 5ISRA 3VR3A 3L7ZC 1ILPA 3HOVB 1BBWA 1VQAA 2WAQG 1TKWB 3HKSA 4DAPA 3F2DA 1STNA 2VY3A 2AMCB 2K28A 2ICIA 1Q7YC 5KNCA 2WB1E 3JAME 3ULPA 2J0TD 1YJNA 2DUDA 5FLMH 1CA5A 3CXCA 2B2VA 4LUZA 4K5WA 1KD1C 4IUNA 1CKOA 4PNYA 4BBRG 1JB7A 3GTOH 3Q8DA 1IKLA 4DXFA 3S1QB 1VQDA 2SNMA 4A3CG 3KLSX 1ONLA 2K1BA 3KJPA 3VYUA 2ZM6Q 1V43A 3FPPA 1K3BC 2EYPA 3T51B 3KK7A 5M3MG 3AQQA 3TP7A 3KBXA 2O4XA 2L0CA 2AWNA 4K0KQ 3T1HQ 4GKKL 5M3MH 3KOJA 2WAQE 3BU2A 3I55A 2AKWB 3TMEA 4A3GB 2I07B 1S5ED 2DGYA 1XTDA 4G7HC 2MQHA 1Q82C 1SXTA 1UUPA 3QWNA 4RGNA 4KTAA 5G3LF 1WD0A 2BA1A 2XRSD 1I3QB 3I8ZA 1EZ6A 4UY8C 1LT5D 4A76A 2DNEA 3H09A 4IZ8A 4DNTB 2NN6G 4EX5A 2R6GA 3TSSA 3L3OC 1RDPD 4A3JG 1S4ZA 1X3FA 2VXWA 5CBAE 3BJUA 2GA4B 4FF3A 3J81j 2X6LA 2I5MX 2PZTA 2XWJB 4B3SQ 1EU3A 4FXGC 4K8IA 3GTMB 1VQHA 2CQOA 4QL5A 1B50A 3J81L 4GOPA 4YWKA 1Q12A 3NELA 3FP9A 4A3LH 1HZBA 4WORA 1IBLL 3BDOA 2HCIA 1EYGA 1K8OA 3FHWA 3S9WA 4Q5VA 4A3MH 1ICFB 3IRBA 1FNUA 5BN4A 4DV0L 1XNQL 5C0XG 2JQOA 1SMXA 4AH6A 1G2SA 1SNCA 1JJ2A 1Y1VH 1EFWA 5IGFA 4OO1G 3MEHA 1BBUA 2I5LX 3RZOB 2BE5C 3S1NB 5JOBA 4K5XA 4UP7A 2F0DA 3I4MH 1EIHA 2K5NA 2XSCA 1YHAA 1QJOA 1HA5A 5EQ0A 3CQZB 2MP1A 2JA8H 1XWEA 1K28A 5DM73 2YTVA 1FL0A 2Q2HA 4C3JG 1VQ6A 1FNVA 2D0PA 1M90C 4JI6Q 1CKNB 4R4CA 4KV6A 1WTRA 2H1EA 1SYEA 1BUVT 3X3MA 2JA8G 1TS2A 3SR1A 5L37A 1D5ZC 4ID6A 5E4XA 1L0YB 1G6PA 4NPSA 3EFXD 2DJFC 3CQZH 3MFGA 5IP9G 1KDCA 2E2HB 2QEJC 1AH9A 3R2TA 1E22A 1PH1A 4BXXH 4ALPA 2X6GA 2QA4A 2N55A 4MTKA 2JYOA 2EY6A 2E8GA 4JBJA 1DCZA 2G5DA 3CKIB 4RAUC 2LMCB 4A3LG 4IO9A 4R4TA 4K8JA 1BQQT 4A93B 4N8X1 4JVZA 1X3EA 2QKIC 4CGYB 4J6HA 4LFAL 1EIFA 1I5FA 4CKCA 1D5MC 4HMJA 4JK1C 5GAGC 1BNZA 1S5CD 4IN3A 4L5QA 5IYCG 4C3IG 4DK6C 5M9OA 3W3AA 4P73A 1Q81C 2Z9HA 1KNEA 3GO5A 3S15B 2NVYB 2RCFA 1GO3E 1NCVA 2F3WA 3QB3A 1IBML 1JWMD 5CV8A 4ZUJA 4TRDA 4BY7B 2B2YA 4CJ0B 3OOCA 4LNQA 3PIOA 1YVCA 3ER0A 5M5WB 4FDBA 5C3EG 1XMQQ 4KJNA 1EY4A 1HFGA 2CKZB 5A35A 3G6JB 5DLQE 4GLVB 1BCPF 1N33L 1ET6A 1TT2A 2UXCQ 1NSNS 3HOUH 4QQBX 5BN5A 1PZID 4NXNQ 4HSVA 1LTTD 2PQAB 2PO4A 3TP8A 3CCRA 4EQPA 4DR1L 4MNOA 2OWOA 2RVLA 4A3IH 1CQVA 2R7DA 1PTOB 4GKJQ 2A6ED 2K52A 2ZXOA 3K5OA 2M00A 4A3CH 2L1BA 1HNZQ 4ABNA 4DGZA 2HIXA 1EIGA 2UXBL 4DV1L 1EY0A 2A6EC 1IYUA 1RHPA 1B8AA 2ZJPA 1SAPA 3HOVH 3M7NA 1I6HH 3Q24A 1O7IA 2MUYA 3M4PA 5EBDA 3S16B 4Y7NB 1OO9B 3A7AB 3BZCA 3I73A 1LTRD 3MTSA 4AYBB 1GUWA 1MI2A 1LT6D 1SYCA 1XJVA 1FGUA 4H13C 5IGCA 4C3HB 2A6HD 3DUZA 1WTHA 1K0RA 4DAYB 2F0MA 3HGBA 4NKLA 1KL9A 1L1OB 1M1KC 4EGVA 4DK1A 2LY7A 1I6HB 1O78A 5IYDG 1LTBD 1HH2P 5I6WA 3K5MA 3C3LA 4Q0FA 5C4ZA 3NENA 1KRTA 4A3BH 2B63B 1Y1WH 4LFCQ 2GVAA 1VDZA 1QZHA 3H3VC 2JJQA 2JP1A 1PHJA 3DLLA 3RLFA 1MGSA 3BS1A 1VQMA 1TIID 2RF4A 2ATWA 1E2WA 2MPMA 1KAAA 1OXXK 3HOXH 4LMQD 3NUCA 4XQQA 4IUPA 4DR3L 1SBBB 5IOCA 4KHZA 1J9OA 1RJTA 3PUZA 5GAEC 5KYIA 1DOKA 4R4QA 4GN3B 2B63H 4I7ZC 3V2TA 1L1OA 1VQ9A 2F0GA 2F0NA 4WJ3M 1TR5A 3VA5A 1IL2A 2JA7H 1NBWA 2KOLA 3SK8A 1CT1D 2E74C 1H95A 4O2DA 3STBC 1TS4A 2Q2TA 3S2DB 1C0AA 5FJ8H 4BBSB 2A68C 5AFWA 3S14B 2JA5B 3HOZG 4K2LA 4KKTA 2O5JC 5HGTA 5M3FH 1VQKA 2TSSA 4ZRZA 2B29A 1WTOA 1HTLD 2IY5B 4NXML 3IFTA 4ZQ3A 2WKCA 2XIWA 1IW7C 3HZXA 3KJOA 3RUZA 2NB0A 4YY3L 5C4JB 3OW2A 3S1RB 1I94L 1SR3A 4K14A 1GUSA 3ITPA 2UU9L 1EQTA 4PMWA 1SDFA 4MIUA 3SGIA 3PUVA 1PFSA 3N52A 1EY7A 4RCNA 1R9TH 4PZ8A 3GTPH 1V1PB 3AMUA 1EU4A 4ZK9B 2UXBQ 3K81C 4DA2A 1JQYD 5KEEA 2F0WA 3D8GA 5EJWA 4JOIC 3X3NA 1LTSD 4XTCS 4O0AA 4KK7A 2F0EA 4DR5L 2DJGC 1KRSA 4X3TA 1AN8A 1MSHA 5A2QE 3PMFA 2YTXA 4QY7A 4B3TL 3K8AA 3M4QA 1UE6A 5LL6X 5C4JH 3NSWA 1GVPA 4JG2A 2B2TA 3G7LA 1E24A 2OF1A 4FF1A 1HA6A 3D6CA 1EYAA 1HNWL 1NE3A 4YCVA 4HJ5A 4DV1Q 1LV9A 4F88A 1LLRD 5T1GA 4PQXA 1SE2A 2F0IA 4DAYA 4GKJL 1K0SA 1FNWA 4H02A 1GUOA 5LMUQ 2D9UA 2OTJA 2LXKA 5FO8B 2WINB 2CQAA 2VQFQ 3H91A 4KY7A 5FLXL 1QOHA 2NTSA 2VB2X 1VQEA 2Q2UA 1TWAB 1G2TA 3P20A 1T5EA 2D2CC 1STGA 1YJWA 3GP7A 1PYSB 2IHFA 4RG1A 3M9BA 4ZYSA 4DR3Q 2ES2A 1SE3A 1XYIA 1BCPB 4APVA 2L9HA 3E0JA 1VQNA 1JE4A 5JJIA 3K57A 3I4NH 4FXDA 1LYLA 4TQUS 4DN4M 2AUJD 4JPBW 3E9HA 4A3FG 1ZYRC 2PQEA 2R92B 1Y69U 1PRTB 4JCVE 1XTCD 1IW7D 2AHOB 2EYMA 4PZ6A 4GNXC 4A3EG 2E5LL 1MKHA 5IYBH 2WB1B 1B9MA 1FD7D 2EY5A 2M9VA 1TWAH 1LABA 1J8IA 1ML0D 1PH6A 3I91A 4ILWA 4LW1A 2E2JB 5LL6S 3M4YA 1X54A 4HCEA 2GN5A 4YY3Q 4JI0Q 2A5HA 5AJ3L 4LFBQ 1CZGA 3M85A 4X3UA 4KKSA 1WFQA 5GAHC 1VQOA 3QIAA 3BYYB 3GTJB 3U4ZA 5EPLA 2L15A 1ENCA 4DUZL 1XPOA 2AWOA 2BA0A 1PRTF 1GUNA 1F2MA 4RHSA 2VZAA 1Y8PB 3RR5A 5IT9c 4GOPC 5LHY1 1WYDA 4JI1Q 2VUMB 1HNXL 1L0XB 3D0FA 1GM5A 3JAMc 3L2PA 2F0QA 2CW0D 1FR3A 1VMPA 1PA6A 1CHPD 1Y8OB 1U4PA 2PMZB 4DR5Q 3HFZB 1KDBA 1NAPA 2VS1A 3T56B 3VR6A 4C56C 3ONAB 1TWCH 2CH4A 1VQ4A 2IL8A 5COYA 1QILA 4PZ7A 1PTOF 3T53B 3MZ5A 3WOEA 1JE5A 3KDFA 2K5DA 1GHJA 4FP5D 3GTOB 1TWGB 4JYAQ 1OTCA 3RD4A 3ERQA 3H0GH 3KLSA 4JI5Q 4B3TQ 2F0VA 1K83B 2WV6D 4AYBE 3J7ZC 2VNUD 1UEBA 1EWIA 1H9SA 3OSOA 3NTKA 3RZDH 4CDEC 5C3EB 3J81i 1HXYD 2EOTA 4X6AH 1ESRA 2JA6G 4XDXA 3KF6B 3IKJA 4BBSH 2KHIA 5LMNQ 4DV6Q 1N34Q 2ZT9C 3ND8A 1SNPA 4BWGB 3NP8A 3LGJA 1JT8A 4ZCKA 3GTQH 4JI7Q 2OQKA 2PYKA 3HG9A 4UP9A 4QIWB 4HR7B 3OTOL 3CCMA 4BS9A 3S16H 2QW7A 3RZDB 4B9XA 5C5MA 3T1YL 4XQNA 2CVRA 4X66Q 5EPJA 4HTHA 4DR7Q 1SNMA 1SFOH 3GQBA 3G71A 5FLXc 4DV7Q 1OXTA 2FJ2A 1B2TA 2E5LQ 1KDAA 3HOZB 1EWCA 2JA5G 5T1IA 3CCSA 2WIIB 3I4MG 3TZDA 3MA2B 4LFAQ 3DM1A 4JC0A 2ICEC 4DUZQ 5CV7A 2KA7A 2I46A 5DNFA 2RDFA 4CDDC 2XN9C 1JC7A 3PCOB 4X62Q 1Q86C 1PH5A 3A8IE 1D1IA 4LFBL 5IYDH 4R8NA 4WFN3 2EVBA 1QWYA 5E1FA 4BA1I 5K5PA 4AIMA 1XMQL 4HMIA 1WI5A 1XX8A 1PFBA 2VW9A 2DY7A 2K14A 2JN4A 1JWUD 1X55A 2KECA 3I7FA 3Q22A 1V1OA 4J15A 1GD7A 2KHSA 3ULLA 3U58A 3DM3A 1XXGA 4KLKA 4A3JH 4L5TA 5D65A 3R3OA 4POFA 1ENAA 3J80c 4DV5Q 4K0KL 4GS3A 1OXVA 4BY1H 4C3HH 1BDOA 5TSSA 4L6TB 3MXGA 4X3SA 1K8GA 2A19A 2UXDL 2BE5D 3Q23A 3J7AF 4B3SL 3SK6A 2A8VA 3AEVA 3D4WA 4C3HG 1I50H 4P72A 1LTGD 1WCMB 3P7JA 3UDXA 4JI2L 3S17H 2CCZA 2FMMA 3U50C 4JI3L 1D6EC 4UP8A 2F0UA 4L5SA 3PUYA 3K0YA 1ASZA 3FPUB 2G9HD 4CHTB 1GJXA 4LUVA 1XMOL 3OWEB 4A3FH 1SJHD 1VQ7A 2ASBA 2RCNA 1ET9A 2O5IC 5IODA 4GN5A 2TMPA 2ZTDA 2LSSA 3NPPA 4OX9Q 1PTOD 4LF5L 1GXDC 2EE1A 1IL8A 4A3GG 2R7ZB 4BY7H 5I4DA 4QJFA 5CV4A 4Y7NH 1F9SA 4NDXA 1A8VA 1HPCA 3F2BA 2E2JH 1JJCB 4IPCA 5C4HA 4FNFA 1V9PA 2VUMH 5C6AA 4LJZC 2OT2A 4BY7G 1T9HA 4F87A 3M4OH 5I6YA 4BA2I 5JVH3 2VB3X 3KUPA 1JWSD 4CDFC 1DONA 4JOIA 3EJIA 3J81E 3T1YQ 4LF6Q 1PRTC 4JI6L 3BDCA 2KUMA 2PCFB 4XQJA 4IALA 2K5VA 3IFDA 1B44D 1Q8IA 3GTMH 1SSOA 3LWEA 1EQQA 2RHSB 1MJEA 2RBMA 3RNUA 1XNRL 2B2YC 1NR2A 1B7YB 1TWCB 4H7BA 3CMAA 3PSIA 4FO2A 3W2DA 3OWFA 1S5BD 4R1JA 1RIPA 5GQOA 3QOLA 4DK3C 3M4OB 2NWGA 2IT1A 3PF5A 1TY2A 1DOLA 2KCCA 3KLWA 3SE0A 2N8NA 5F2DA 2EYJA 4M1UB 1TWGH 1B9NA 3CC4A 2IX1A 1X9NA 1SYDA 5ELNA 1RF2D 5FO7B 1UWVA 3E3XA 1HHVA 3A5ZB 3CC2A 1DD2A 1TXYA 1W2BA 4QUCA 3CMEA 2ID0A 1HZAA 2M2LA 4X3KA 1MBYA 1VF7A 1UE7A 1FJGQ 2F0KA 4P74A 1A3VA 1IKMA 1S40A 5CV6A 3PQIA 5CBEE 3DHQA 1TQOA 1EY6A 2B2TC 3JAML 1D8LA 1VQGA 2JK8A 5CV5A 5EPKA 5E4WC 5IYCH 3NEMA 4R4IA 2Z6BA 1XMOQ 3EQLC 1HUNA 1HNXQ 1CQFA 1R9TB 1AE2A 3PO2G 1VCIA 2B2WA 1ASYA 1SNOA 4DUYL 3V05A 3FRPB 5LMUL 4JV5Q 4NXNL 1G51A 2WP8J 2NZHA 1AZQA 2EQSA 3K5LA 1B1ZA 2JE6I 3K7AH 1PH8A 1SFOB 2IJ0A 1DZ1A 4XT1B 3AFQA 4OX9L 4K6DA 1F9PA 2JA5H 4DNIA 4GZYC 3NXWA 3S1MH 4PMBA 4QIWE 1HRJA 3VR2A 2KCNA 1HTPA 5FJ8G 2QEXA 4MZ9A 2JA6B 1SROA 4LF9L 3K58A 3OPOA 4DR2L 1PFNA 3FDTA 1D7QA 5EKLA 1JOKA 3T4AC 1HZCA 2WKDA 2B8GA 1YHQA 3UDFA 3S1NH 5E7NA 4R8IA 3E9IA 5G3LD 1GHKA 2L11A 3TS0A 2H5XA 1J5EQ 1HFNA 4XT3B 3OIPA 4A3DB 3SVMA 2MFIA 3AYHB 4ODGA 2ZM6L 4IQZA 1EOTA 1NMFA 2I5HA 3F2UA 2HT1A 5KNDA 1V1PA 1XNRQ 1SYFA 1EFID 3K80C 1TU2B 4MHEA 5C44B 2F4IA 1HQMC 1I50B 3QR8A 4LF6L 1A62A 4KI0A 1QUQA 4RCOA 1F9QA 2NYZD 4BY1G 1QE6A 4YHHQ 1CM9A 4IJLA 1WTVA 1KIXA 4I65A 3MXPA 5D14A 1QB5D 3EVQA 3EBEA 4YCUA 5JJKA 1DGSA 2ENBA 3CF5A 4U68A 2NVTB 1DM0B 1BF4A 1A63A 4DAMA 3H94A 4E6IA 4HN7A 2HHHL 1NUCA 1Z47A 4KMUC 3H0GB 3SK4A 2BDNA 1YNJC 3A74A 3I3CA 5ELFA 3TP6A 3FEWX 4B3RQ 2R7ZH 1HR0W 4S3SA 3CCLA 1E2VA 2XNAC 2WAQB 3MXNB 4DKAC 1BO0A 4U673 2RA4A 5I9PA 2R7ZG 3HOVG 3IL8A 4DXGA 3PV0A 4KN4C 5FOBB 1QNKA 3MEFA 2F03A 2PZWA 2K4KA 3CW2C 5BN3A 4OEMB 1KXLA 2JSOA 4A3EB 5CYUA 4DUYQ 2B8FA 1FGBD 1W3SA 3I4LA 3TZUA 4ZKBB 1SE4A 4HIMA 3GTGH 2PNRC 2JEAI 4DR4L 1YBYA 4C2MH 5A2QL 1PFMA 3HOUG 3CCVA 1PZJD 2RDGA 2VUMG 1WJJA 2KJXA 3C1FA 3MFYA 3RN5A 5ELCA 1VQ8A 3OYYA 2R93G 1LACA 5JJLA 1AP0A 4OWWB 2PW7A 3I72A 4HAEA 2FINB 2K33A 2UXDQ 1FYCA 4IFDJ 1QNUA 2J7ZA 4JI7L 5EKKA 5CC4A 3S1QH 1B3QA 4DV3L 1D5XC 1B70B 1P16A 4JBKA 1WTWA 3IAYA 3RLNA 1D1KA 2CWAA 3S15H 1H9SB 4YIJA 1I3QH 3A7LA 1VF5C 2FFKB 3D31A 5FK9C 4LF7L 4KHPQ 4DR7L 1E2ZA 1K83H 5H1SE 4C2MB 3C2PA 5M5XH 4WJWA 3UDIA 3Q0AA 3F1ZA 1U4RA 1ILQA 5IGGA 1XPUA 4YHHL 4JI8Q 4LF9Q 3H3VH 2R92G 1G91A 3H3VI 4RH6A 1Q90A 1UNSA 3AFPA 3OMGA 3H0GG 4LF8Q 1QVGA 2XWBB 3UDGA 3TP5A 1DYQA 2NVXH 2JXMB 3CHBD 4IURA 1VQFA 4B08A 4HJ8A 2N78A 1BCPD 2E76C 2OXPA 2UUBQ 2OQ0A 2F3IA 3P75A 4RHRA 3HRZC 2VL6A 4OWTB
chains in the Genus database with same CATH topology
4OO1H 1KABA 4CKBA 4N9PA 3CU7A 1PYWD 1Z6HA 1UAPA 4RA8A 5JAVA 1H9KA 1TS5A 1PRTD 3S1MB 3BG3A 2EYLA 3MC0B 1ENFA 3HOWB 5IGEA 1LO5D 3K7AB 4R9WA 1TWFB 3S17B 2LS01 2LKVA 1WTXA 2K04A 1M4VA 5EBCA 1QG7A 1SNQA 3DMUA 2YU9B 3E5SA 1H9JA 4C1NI 3PO3B 2SEBD 2RKSA 2EJGC 4G57A 2RSNA 2CHBD 1RCVD 2DY8A 2EYHA 1EYCA 2EY1A 3P1HA 5I9OA 1BCPC 4M8AA 1F2ZA 3GTKB 1V8QA 4QB4A 1LTID 2F0LA 2BCOA 3I4NB 3V96A 1SMYD 4F7XA 1MD2D 3OMCA 1LT3D 4H44C 3PO2B 3FVQA 3O13A 4XIGS 4XYOA 4KD3A 4QCLA 4P2CB 5IT9E 1C8CA 4J1MA 2G9DA 4NMZA 2SNSA 1Q3LA 1II3A 3L9AX 3EROA 4LK1C 5M5YB 2EXZA 2IWHA 3C1EA 2R93B 1CK1A 1DXMA 4DAVA 3H6MA 4KY6A 4A3JB 1RTNA 1TWHB 3VA7A 1SYBA 3J7YW 2RQXA 4RFBA 4ME5A 1SJED 1R4PB 1I4QA 2B2WC 1LT4D 2K5QA 1EQVA 2MHVA 1GUGA 4L63B 4A3IB 1G6ZA 1EYDA 1JR0D 5M3MB 3MAQA 1STAA 4IUQA 2A69C 5FO9B 5C4XB 1BOSA 3SEBA 5HURA 2C5CA 2E2DC 2H4OA 4PV1C 2R61A 4H0LC 1C48A 2JEBI 5JEAJ 3CRLC 1ZXTA 3BVGA 1DJRD 2HUGA 1KLUD 2EJMA 2L5TA 2NUCA 5M5XB 3HOYB 2IX0A 2B39A 1Q1BA 1Q1EA 4FF4A 1BR9A 1KNAA 2F0TA 1EWHA 2B2VC 3E6ZX 4DF7A 4KKUA 2Q8TA 3RMHA 4DK0A 1X3QA 4RGOS 1A6XA 5DEHA 4OIKA 2KEDA 3VR4A 5D3DA 1JCKB 1O7LA 3D6WA 2NN6H 4OL7A 3Q6SA 1H9MA 4JBWA 1MSGA 2N88A 2Z1CA 1PDQA 2EPBA 2L12A 5JVG3 1A3TA 1JOOA 3KBGA 5DAUA 2NZ1D 3OHXC 4J8QA 2K6AA 4V0BA 1A2TA 4LAAA 3NE5B 3AU7A 3DWPA 5KYLA 4IUVA 1PZKD 3A55A 1A15A 2EDGA 3FMCA 3GD7A 5KRUA 1GUTA 4QF4A 3MXUA 5JPMC 4IUUA 4A3KB 2BDOA 3GTPB 4OO1I 4Z9CB 2PZUA 3VYTA 1F9RA 5EGTA 1A3UA 3I90A 5C0XI 1Y8NB 4C3JB 2Q8RE 5I2XA 3I4MB 4B9WA 1S5FD 5DM63 1JORA 3MXNA 1TY0A 3R93A 4V190 5IT9L 2NBFA 4RWSC 3NQTA 1B53A 4ZUIA 2KVMA 3K6OA 3DEOA 4QMGA 1TVXA 1EY5A 2NN6I 2KQ3A 1W6JA 2J4XA 2WACA 4K2KA 4RGTA 4DFAA 1U4MA 3D4DA 3GV6A 1STEA 1D2BA 4ZLTF 1RTOA 2RDHA 4KY5A 2O2LD 5I2YA 1AZPA 4OIJA 5C0XJ 3BVZA 2B2UC 1O80A 2NVQB 1AFPA 3NBIA 5CGKA 5CR3A 1CI3M 1RD9D 3NWSA 3PUXA 1RODA 3T13A 1I4XA 1F2YA 2F0JA 1I4HA 2A73B 2HQEA 4DU9A 4OGQC 2D5DA 4BBRB 1T5XD 1SNDA 2F1MA 2A68D 4RKBA 5JJZA 4CKEA 4C3IB 1EEID 2FHTA 2K01A 3I70A 4L8JA 2K7VA 3QO2A 3U9SA 4RGMA 5JEAG 4OHJA 3URYA 3NQIA 5KIXA 2A69D 1YNJD 4FYDA 5CORA 4NW2A 1O7YA 2QDBA 3SXHA 3K59A 3DWQA 2F0HA 3BVMA 2HDLA 1Y1VB 1PLFA 3WOFA 4A3FB 3PIP3 4KN7C 3SDZA 1JICA 2E75C 4N9TA 2PW5A 3FKIB 4TKOB 1TS3A 4IFDH 1LTAD 1CHQD 2JA8B 2DN8A 4FXKC 3BYTB 3DXJC 4XYQA 3SHLA 3NWTA 2HCCA 2Q8IB 1ZEQX 4KJOA 3UI2A 4PMCA 2NTTA 3M7GA 1EL0A 5KNBA 1O7ZA 1Z7TA 2Z4IA 1STYA 2ZXPA 2JA7B 4HSPA 1EZ8A 2F0OA 3OW7A 1I4GA 3MHBA 2F0FA 4K6LA 4TSSA 1IYVA 1RKNA 1S5DD 4QUFA 1X32A 2A6HC 3QJYA 2CW0C 3AB9A 5J22A 1SYGA 1H9RA 1IHZA 4G7ZC 3KLRA 3NTHA 2EJFC 4CJ2C 1G291 3SK5A 1SEBD 1B4OA 1AW7A 3R2IA 5CMDA 1HUMA 3PIO3 1JB3A 1OXUA 4KD4A 4IFDG 4WRDA 5C3WA 3OIQA 4MN3A 3KF8A 1CTMA 1CFMA 2A74C 2QCPX 3M3YB 1R4QB 1F77A 1X3PA 3TBIB 1WTPA 5J39A 1SMYC 4UAIA 3NK9A 3VYSA 2L55A 4F8MA 1U9RA 5E3FA 2EY2A 2IW3A 2PPBC 2KEEA 3D3RA 4RKLA 1U4LA 1STBA 2K03A 4EQNA 4IUTA 4CJ1B 1ZKOA 5ELDA 1NR4A 2EYFA 5D3IB 5FKAC 3J7AV 1BXTA 1W6KA 5FLXE 2R3ZA 1E0BA 3GTGB 2FMCA 4O1NA 3N6RA 2HDMA 4O42A 1M8AA 1CZWA 3MVVA 2OEOA 5K36H 1F2LA 2EZVA 1I6VC 2YYZA 1A2UA 2V4DA 2EYOA 5C5LA 4DNRB 3QG1A 5JPNC 5K36G 3A56A 4A3MB 4K5VA 4ZAIA 1KTKA 3VYRA 1DOMA 1GOZA 1B3AA 2RSOA 3S2HB 2XRQD 3NTIA 3HOXB 1WTQA 1ESFA 3LNNA 3EA6A 3J80L 5J1ZA 1WVLA 1PTOC 4HCSA 2NVXB 3LX0A 2X69A 1YNND 1KLGD 4NP5A 2L4NA 3U9OA 3MWYW 2K5WA 2AQ1B 2AQ3B 2IPKD 4EQOA 5C3XA 3GTQB 2Z8LA 3QOJA 5IGBA 4EVOA 1C4QA 1I4RA 1Y1WB 3HP3A 2F3VA 2K05A 2K32A 3HS0C 5M3FB 2SDFA 3D4RA 4UDUC 3J80E 3ZYYX 1K8MA 1EY9A 1WD1A 3A8JE 2B2UA 3GV3A 1VMCA 2BOSA 5NUCA 5KGUA 3K5NA 4G7OC 1G8ZD 4BY1B 2SOBA 4CBVA 4IFDI 4ZKCB 3BZDB 1ZYRD 5C0XH 1JOQA 2XVSA 2F0SA 2F0PA 5CV9A 4G4KA 5ELBA 3T16A 4FF2A 1HCZA 1UEAB 3A54A 5EKIA 4A3BB 3R8BA 2QF7A 2Y0SB 3HKZB 3C46A 3DEPA 5IGDA 1PXUA 2C9OA 1EEFD 3HEJA 2DNCA 4FVMA 2Z4HA 1I4PA 4KHVA 1AEXA 1EY8A 4C1NK 2MGSA 2LFNA 2QILA 1QCBD 3A8KE 1PMRA 1CA6A 2E2IB 3DWAA 3BDLA 2D62A 5ELEA 5IIFA 4ULLA 3GTLB 1OXSC 3LWUA 3NHHA 4HEDA 3PUWA 3ND9A 3NBHA 2MJ8A 3TN2A 5JEAH 2AUKA 1YNNC 1HQRD 3HOUB 1ICWA 3VR5A 1BBXC 2IX3A 3CRKC 1PTOH 2AQ2B 3WDNA 1STHA 2ZXRA 3TDQA 4XXEA 5ISRA 3VR3A 3L7ZC 1ILPA 3HOVB 4DAPA 1TKWB 1STNA 2K28A 2ICIA 5KNCA 3JAME 2J0TD 1CA5A 2B2VA 4K5WA 4IUNA 4PNYA 1IKLA 4DXFA 3S1QB 2SNMA 3KLSX 1ONLA 2K1BA 3VYUA 1V43A 3FPPA 2EYPA 3T51B 3KK7A 3TP7A 3KBXA 2O4XA 2L0CA 2AWNA 3TMEA 4A3GB 2I07B 1S5ED 4G7HC 1SXTA 1UUPA 3QWNA 4RGNA 4KTAA 1WD0A 5G3LF 2BA1A 2XRSD 1I3QB 3I8ZA 1EZ6A 1LT5D 4DNTB 2DNEA 3H09A 4IZ8A 2NN6G 2R6GA 3TSSA 3L3OC 1RDPD 1S4ZA 2VXWA 5CBAE 2GA4B 4FF3A 2X6LA 2PZTA 2XWJB 1EU3A 4FXGC 4K8IA 3GTMB 1B50A 3J81L 1Q12A 4WORA 3BDOA 2HCIA 1K8OA 3S9WA 4Q5VA 1FNUA 5BN4A 5C0XG 1G2SA 1SNCA 5IGFA 4OO1G 3MEHA 3RZOB 2BE5C 3S1NB 5JOBA 4K5XA 2F0DA 1EIHA 2XSCA 1QJOA 1HA5A 5EQ0A 3CQZB 2MP1A 1XWEA 5DM73 4C3JG 1FNVA 4KV6A 1WTRA 2H1EA 1SYEA 1BUVT 3X3MA 1TS2A 3SR1A 1D5ZC 4ID6A 5E4XA 1L0YB 3EFXD 3MFGA 1KDCA 2E2HB 2QEJC 3R2TA 2X6GA 2N55A 2JYOA 2EY6A 1DCZA 3CKIB 4RAUC 2LMCB 4K8JA 1BQQT 4A93B 2QKIC 4CGYB 4J6HA 4CKCA 1D5MC 4HMJA 4JK1C 1BNZA 1S5CD 4IN3A 4C3IG 5M9OA 3W3AA 1KNEA 3GO5A 3S15B 2NVYB 1NCVA 2F3WA 3QB3A 1JWMD 5CV8A 4ZUJA 4TRDA 4BY7B 2B2YA 4CJ0B 3OOCA 5M5WB 4KJNA 1EY4A 1HFGA 5A35A 3G6JB 1BCPF 1ET6A 1TT2A 1NSNS 5BN5A 1PZID 4HSVA 1LTTD 2PO4A 3TP8A 4EQPA 2RVLA 1CQVA 1PTOB 2A6ED 2ZXOA 3K5OA 2M00A 2L1BA 4ABNA 4DGZA 1EIGA 1EY0A 2A6EC 1IYUA 1RHPA 1SAPA 3M7NA 3Q24A 2MUYA 5EBDA 3S16B 4Y7NB 1OO9B 3A7AB 3I73A 1LTRD 3MTSA 4AYBB 1GUWA 1MI2A 1LT6D 1SYCA 4H13C 5IGCA 4C3HB 2A6HD 3DUZA 2F0MA 3HGBA 4NKLA 4EGVA 4DK1A 2LY7A 1I6HB 1O78A 1LTBD 5I6WA 3K5MA 3C3LA 4Q0FA 5C4ZA 2B63B 1VDZA 3H3VC 2JP1A 3RLFA 1MGSA 3BS1A 1TIID 1E2WA 2MPMA 1KAAA 1OXXK 4LMQD 3NUCA 4XQQA 4IUPA 1SBBB 5IOCA 4KHZA 1J9OA 1RJTA 3PUZA 5KYIA 1DOKA 4I7ZC 3V2TA 2F0GA 2F0NA 1TR5A 3VA5A 2KOLA 3SK8A 1CT1D 2E74C 1TS4A 3S2DB 4BBSB 2A68C 5AFWA 3S14B 2JA5B 4K2LA 4KKTA 2O5JC 5HGTA 2TSSA 4ZRZA 1WTOA 1HTLD 3IFTA 4ZQ3A 2WKCA 2XIWA 1IW7C 3HZXA 3RUZA 2NB0A 5C4JB 3S1RB 4K14A 1GUSA 3ITPA 1EQTA 4PMWA 1SDFA 4MIUA 3PUVA 3N52A 1EY7A 4RCNA 1V1PB 3AMUA 1EU4A 4ZK9B 4DA2A 1JQYD 5KEEA 2F0WA 3D8GA 5EJWA 3X3NA 1LTSD 4XTCS 4KK7A 2F0EA 4X3TA 1AN8A 1MSHA 5A2QE 3PMFA 5LL6X 3NSWA 2B2TA 3G7LA 2OF1A 4FF1A 1HA6A 3D6CA 1EYAA 1LV9A 4F88A 1LLRD 5T1GA 4PQXA 1SE2A 2F0IA 4DAYA 1FNWA 1GUOA 2D9UA 5FO8B 2WINB 2CQAA 3H91A 4KY7A 5FLXL 1QOHA 2NTSA 2VB2X 1TWAB 1G2TA 3P20A 1T5EA 2D2CC 1STGA 3GP7A 4ZYSA 1SE3A 1XYIA 1BCPB 2L9HA 3E0JA 1JE4A 3K57A 4FXDA 4TQUS 4DN4M 2AUJD 1ZYRC 2PQEA 2R92B 1Y69U 1PRTB 1XTCD 1IW7D 2EYMA 2WB1B 1B9MA 1FD7D 2EY5A 2M9VA 1LABA 1J8IA 1ML0D 3I91A 4ILWA 2E2JB 5LL6S 3M4YA 4HCEA 2A5HA 1CZGA 3M85A 4X3UA 4KKSA 3QIAA 3BYYB 3GTJB 5EPLA 1ENCA 2AWOA 2BA0A 1PRTF 1GUNA 1F2MA 4RHSA 1Y8PB 5LHY1 2VUMB 1L0XB 2F0QA 2CW0D 1FR3A 1VMPA 1CHPD 1Y8OB 1U4PA 2PMZB 1KDBA 1NAPA 4C56C 3T56B 3VR6A 3ONAB 2IL8A 5COYA 1QILA 3T53B 1PTOF 3MZ5A 3WOEA 2K5DA 1GHJA 4FP5D 3GTOB 1TWGB 3RD4A 3ERQA 3KLSA 2F0VA 1K83B 2WV6D 2VNUD 1H9SA 3OSOA 3NTKA 5C3EB 1HXYD 2EOTA 1ESRA 4XDXA 3IKJA 2ZT9C 3ND8A 1SNPA 4BWGB 3NP8A 2PYKA 3HG9A 4QIWB 4HR7B 4BS9A 3RZDB 4B9XA 5C5MA 4XQNA 2CVRA 5EPJA 4HTHA 1SNMA 3GQBA 1OXTA 2FJ2A 1B2TA 1KDAA 3HOZB 1EWCA 5T1IA 2WIIB 3TZDA 3MA2B 3DM1A 2ICEC 5CV7A 2KA7A 2I46A 5DNFA 2RDFA 2XN9C 1JC7A 3A8IE 1D1IA 4R8NA 4WFN3 2EVBA 1QWYA 5E1FA 4BA1I 5K5PA 4HMIA 1XX8A 1PFBA 2DY7A 1JWUD 2KECA 3Q22A 1V1OA 2KHSA 1XXGA 5D65A 3R3OA 1ENAA 1OXVA 1BDOA 5TSSA 4L6TB 3MXGA 4X3SA 2BE5D 3Q23A 3J7AF 3SK6A 3D4WA 4C3HG 1LTGD 1WCMB 3P7JA 2FMMA 1D6EC 2F0UA 3PUYA 3K0YA 3FPUB 2G9HD 4CHTB 1GJXA 3OWEB 1SJHD 1ET9A 2O5IC 5IODA 2TMPA 3NPPA 1PTOD 1GXDC 2EE1A 1IL8A 2R7ZB 5I4DA 5CV4A 1F9SA 4NDXA 1HPCA 5C4HA 4FNFA 5C6AA 4LJZC 2OT2A 4F87A 5I6YA 4BA2I 5JVH3 2VB3X 3KUPA 1JWSD 1DONA 3EJIA 3J81E 1PRTC 3BDCA 2KUMA 2PCFB 4XQJA 4IALA 3IFDA 1B44D 1Q8IA 1SSOA 3LWEA 2RBMA 2B2YC 1NR2A 1TWCB 4H7BA 4FO2A 3W2DA 3OWFA 1S5BD 3QOLA 3M4OB 2NWGA 2IT1A 1TY2A 1DOLA 2KCCA 3SE0A 5F2DA 2EYJA 4M1UB 1B9NA 2IX1A 1SYDA 1RF2D 5FO7B 1HHVA 1DD2A 4QUCA 2ID0A 2M2LA 4X3KA 1MBYA 1VF7A 2F0KA 1A3VA 1IKMA 5CV6A 5CBEE 3DHQA 1TQOA 1EY6A 2B2TC 3JAML 5CV5A 5EPKA 5E4WC 3EQLC 1HUNA 1CQFA 1R9TB 1VCIA 2B2WA 1SNOA 3V05A 3FRPB 1AZQA 2WP8J 3K5LA 1B1ZA 2JE6I 1SFOB 2IJ0A 1DZ1A 4XT1B 4K6DA 1F9PA 4GZYC 3NXWA 4PMBA 1HRJA 3VR2A 2KCNA 1HTPA 2JA6B 3K58A 3OPOA 1PFNA 3FDTA 5EKLA 1JOKA 3T4AC 2WKDA 2B8GA 4R8IA 5G3LD 1GHKA 2L11A 1HFNA 4XT3B 3OIPA 4A3DB 3SVMA 4ODGA 4IQZA 1EOTA 3F2UA 5KNDA 1V1PA 1SYFA 1EFID 1TU2B 4MHEA 5C44B 2F4IA 1HQMC 1I50B 4KI0A 4RCOA 1F9QA 2NYZD 1QE6A 1CM9A 1WTVA 4I65A 3MXPA 5D14A 1QB5D 3EVQA 2ENBA 4U68A 2NVTB 1DM0B 1BF4A 3H94A 4E6IA 4HN7A 1NUCA 1Z47A 4KMUC 3H0GB 3SK4A 2BDNA 1YNJC 3I3CA 5ELFA 3TP6A 3FEWX 4S3SA 1E2VA 2XNAC 2WAQB 1BO0A 4U673 2RA4A 5I9PA 3IL8A 4DXGA 3PV0A 4KN4C 5FOBB 1QNKA 2F03A 2PZWA 5BN3A 2JSOA 4A3EB 5CYUA 2B8FA 1FGBD 3I4LA 3TZUA 4ZKBB 1SE4A 2PNRC 2JEAI 5A2QL 1PFMA 1PZJD 2RDGA 2KJXA 3C1FA 3MFYA 5ELCA 1LACA 1AP0A 2PW7A 3I72A 4HAEA 2FINB 2K33A 1FYCA 4IFDJ 1QNUA 2J7ZA 5EKKA 5CC4A 1D5XC 1WTWA 3IAYA 1D1KA 1H9SB 4YIJA 3A7LA 1VF5C 2FFKB 3D31A 5FK9C 1E2ZA 4C2MB 3C2PA 4WJWA 3Q0AA 1U4RA 1ILQA 5IGGA 1G91A 4RH6A 1Q90A 1UNSA 3OMGA 2XWBB 3TP5A 1DYQA 2JXMB 3CHBD 4IURA 4B08A 1BCPD 2E76C 2OXPA 3P75A 4RHRA 3HRZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUC A;  4KY5 A;  1KAB A;  1SNP A;  3SK8 A;  1A3T A;  4N9P A;  4KJN A;  4WOR A;  3NP8 A;  1EY4 A;  2F0U A;  2F0K A;  1JOO A;  3H6M A;  4KY6 A;  5JAV A;  1A3V A;  5NUC A;  5KGU A;  5CV6 A;  2PQE A;  2SOB A;  2PYK A;  5DAU A;  3DHQ A;  3SK4 A;  3SHL A;  1TQO A;  1TT2 A;  3S9W A;  1SYB A;  3TP6 A;  1NSN S;  1EY6 A;  4S3S A;  4K2L A;  2EYM A;  2EYL A;  4KJO A;  3TP8 A;  5HGT A;  5CV5 A;  4ME5 A;  4EQP A;  1A2T A;  4PMC A;  4LAA A;  4B9X A;  5CGK A;  1SNC A;  5CR3 A;  5C5M A;  5I9P A;  5IGE A;  2EY5 A;  5IGF A;  1JOQ A;  5IOD A;  1STH A;  3MEH A;  2F0S A;  4HTH A;  5ISR A;  5KYL A;  1SNM A;  4ZQ3 A;  3MVV A;  1SNO A;  2M00 A;  3HZX A;  5JOB A;  2PZW A;  4K5X A;  1EQV A;  3RUZ A;  1STY A;  2F0D A;  2F0P A;  2LKV A;  4K14 A;  3ITP A;  3T13 A;  2OEO A;  1KDA A;  5CV4 A;  4DGZ A;  1EZ8 A;  2F0O A;  1STN A;  5CV9 A;  1F2Y A;  1EYD A;  1EY0 A;  4MIU A;  3MHB A;  1EY7 A;  4NDX A;  2F0F A;  1A2U A;  3T16 A;  5KRU A;  4QF4 A;  5C5L A;  2EYO A;  1RKN A;  1STA A;  2F0J A;  5C4H A;  5KEE A;  5CV7 A;  2F0W A;  3D8G A;  4K6D A;  1SNQ A;  3DMU A;  4K5V A;  5C6A A;  5HUR A;  2RDF A;  3NXW A;  4KV6 A;  5J22 A;  4PMB A;  1ENC A;  3E5S A;  2F0E A;  2HQE A;  1SYE A;  4DU9 A;  4K5W A;  1SYG A;  1F2M A;  3C1F A;  5I6Y A;  4IUN A;  1IHZ A;  4PNY A;  4R8N A;  3SR1 A;  2RKS A;  1SYC A;  3PMF A;  5IGD A;  1SND A;  2PZU A;  4G57 A;  5E1F A;  2PW7 A;  3EJI A;  4ID6 A;  2SNM A;  4RKB A;  5EGT A;  2EYH A;  1A3U A;  1EYC A;  2EY1 A;  1JOK A;  5EKL A;  3SK5 A;  5IGC A;  5K5P A;  4HMI A;  2F0Q A;  3BDC A;  3P1H A;  5I9O A;  4KD4 A;  2F0M A;  3HEJ A;  2OF1 A;  1F2Z A;  4NKL A;  4IAL A;  5J1Z A;  1KDB A;  5EKK A;  2EYP A;  1EYA A;  1KDC A;  3D6C A;  4KHV A;  4WRD A;  5C3W A;  1AEX A;  5CC4 A;  4QB4 A;  4B9W A;  3LX0 A;  2NUC A;  3TP7 A;  2O4X A;  2F0L A;  5I6W A;  5C4Z A;  1EY8 A;  4NP5 A;  1JOR A;  4F7X A;  3U9O A;  4YIJ A;  2RBM A;  3MZ5 A;  3OMC A;  3TME A;  2KHS A;  2F0T A;  4ODG A;  2EY6 A;  4EQO A;  2F0I A;  5C3X A;  5KIX A;  5J39 A;  4H7B A;  4DF7 A;  1SYF A;  3QOJ A;  3NQT A;  3NK9 A;  3OWF A;  3R3O A;  4K8J A;  4EVO A;  5IGB A;  1ENA A;  2QDB A;  4KD3 A;  4KTA A;  3SXH A;  4F8M A;  3QOL A;  3ERQ A;  1U9R A;  4J1M A;  1EZ6 A;  2F0H A;  5IGG A;  4IZ8 A;  4ZUI A;  1KAA A;  4J6H A;  2F0V A;  2EY2 A;  4KY7 A;  4NMZ A;  5E3F A;  2SNS A;  4QMG A;  2F3V A;  4HMJ A;  3OMG A;  5DEH A;  1II3 A;  1EY5 A;  5F2D A;  2KQ3 A;  3NUC A;  2EYJ A;  2WAC A;  3BDL A;  3ERO A;  4K2K A;  3TP5 A;  1STG A;  5IOC A;  4RKL A;  4DFA A;  1SYD A;  3OSO A;  4I65 A;  3D4D A;  3MXP A;  3SK6 A;  5IIF A;  5M9O A;  3D4W A;  3EVQ A;  1STB A;  4N9T A;  3NHH A;  4OL7 A;  4EQN A;  5KYI A;  2OXP A;  2ENB A;  2EXZ A;  2PW5 A;  2PZT A;  3C1E A;  3P75 A;  3V2T A;  2F3W A;  3QB3 A;  4K8I A;  5CV8 A;  4ZUJ A;  4E6I A;  2EYF A;  2F0G A;  2F0N A;  4TRD A;  1TR5 A;  3VA5 A;  1EY9 A; 
#chains in the Genus database with same CATH topology
 4OO1 H;  2EXD A;  1KAB A;  4CKB A;  5IP7 G;  4N9P A;  3CU7 A;  1PYW D;  1Z6H A;  4A3B G;  1UAP A;  3K7U C;  4RA8 A;  5JAV A;  1H9K A;  1VQP A;  2HHH Q;  1TS5 A;  4JW0 A;  1PRT D;  3PO3 H;  4OWX B;  3F2C A;  2GVB A;  1L0W A;  3S1M B;  3T1H L;  3BG3 A;  4A93 G;  2EYL A;  3MC0 B;  1ENF A;  2MO1 A;  5C3E H;  4HID A;  4IOA A;  3HOW B;  5IGE A;  4JI4 L;  1LO5 D;  3K7A B;  2JA6 H;  1EQR A;  4X64 L;  4R9W A;  1TWF B;  2WFW A;  3S17 B;  2LS0 1;  2ZTC A;  2LKV A;  1WTX A;  4QGU A;  3E0E A;  2K04 A;  3KF6 A;  1PH4 A;  1M4V A;  3KYH C;  5EBC A;  1QG7 A;  1SNQ A;  3DMU A;  2YU9 B;  4DV4 L;  3E5S A;  1H9J A;  4C1N I;  1MJC A;  4JI1 L;  3PO3 B;  2SEB D;  2RKS A;  4A3K H;  2EJG C;  2PMZ E;  4G57 A;  2RSN A;  2CHB D;  1RCV D;  2DY8 A;  1VQI A;  1NMG A;  1EYC A;  2EYH A;  2EY1 A;  3J80 i;  4JI3 Q;  5M3F G;  1RL2 A;  5HY6 A;  3P1H A;  5I9O A;  1BCP C;  4DV3 Q;  4M8A A;  1F2Z A;  2N49 A;  4N8F A;  3GTK B;  1V8Q A;  4QB4 A;  1LTI D;  2F0L A;  2BCO A;  3I4N B;  3V96 A;  1SMY D;  1N36 L;  4F7X A;  1MD2 D;  3OMC A;  1LT3 D;  2NZO A;  4H44 C;  3TEH B;  3PO2 B;  3FVQ A;  4R4O A;  3O13 A;  4XIG S;  3ZJY C;  4A4I A;  2B63 G;  4XYO A;  4KD3 A;  1N32 Q;  4QCL A;  4P2C B;  5IT9 E;  1C8C A;  3S2D H;  4J1M A;  4LF8 L;  2G9D A;  1XNQ Q;  1YJ9 A;  4C3I H;  4NMZ A;  2SNS A;  1Q3L A;  4BBS G;  4NB3 A;  1II3 A;  3L9A X;  3ERO A;  3CCE A;  4LK1 C;  1IBL Q;  5M5Y B;  1Q46 A;  1AE3 A;  2EXZ A;  2IWH A;  3C1E A;  3BZK A;  2R93 B;  1BKB A;  1CK1 A;  1LUZ A;  3G48 A;  1DXM A;  2UUA L;  1YEZ A;  4DAV A;  3H6M A;  4KY6 A;  4X66 L;  4A3J B;  1RTN A;  1BVS A;  1TWH B;  3VA7 A;  4GOP B;  3TS2 A;  2F52 A;  1SYB A;  1EIY B;  4JI8 L;  3J7Y W;  2RQX A;  4RFB A;  4ME5 A;  1SJE D;  1R4P B;  3RN2 A;  1I4Q A;  1IYJ B;  2B2W C;  1LT4 D;  2K5Q A;  1EQV A;  2WB1 G;  4DR6 Q;  1PV4 A;  2MHV A;  4GLA C;  1GUG A;  4L63 B;  4DV7 L;  4A3I B;  1G6Z A;  1EYD A;  3HOY H;  1JR0 D;  1N9W A;  5M3M B;  3MAQ A;  1STA A;  4IUQ A;  2A69 C;  5FO9 B;  5C4X B;  4PG3 A;  1BOS A;  4AQY Q;  3SEB A;  1I94 Q;  5HUR A;  2C5C A;  2OCE A;  2CH4 W;  1EUJ A;  2E2D C;  2H4O A;  4PV1 C;  2R61 A;  4H0L C;  1QZG A;  2I0Q A;  1C48 A;  2BH8 A;  2JEB I;  1CSQ A;  5JEA J;  3CRL C;  1ZXT A;  1YIJ A;  3BVG A;  4UHV A;  4X62 L;  1DJR D;  2HUG A;  1KLU D;  2EJM A;  2L5T A;  2NUC A;  5M5X B;  5C44 G;  2NVT H;  4CDC C;  3HOY B;  2IX0 A;  2B39 A;  1Q1B A;  1Q1E A;  4FF4 A;  1BR9 A;  1KNA A;  3WWV A;  5IE8 A;  2F0T A;  2OTL A;  1C7Y A;  1EWH A;  2ZTE A;  4NXM Q;  2B2V C;  3E6Z X;  4DF7 A;  4KKU A;  2Q8T A;  4LF4 Q;  3RMH A;  2A1A A;  1PH2 A;  3G6E A;  4DK0 A;  2Z6K A;  1X3Q A;  4OON A;  1PH3 A;  1MHW C;  3CD6 A;  4RGO S;  1A6X A;  5DEH A;  4OIK A;  1VQJ A;  2KED A;  3VR4 A;  5D3D A;  1JCK B;  1O7L A;  2KHJ A;  3D6W A;  2NN6 H;  2C35 B;  3TRZ A;  3CP0 A;  1HZ9 A;  4DV5 L;  4OL7 A;  3Q6S A;  1H9M A;  4JBW A;  1MSG A;  1YZ6 A;  1NJI C;  4A3E H;  2N88 A;  2Z1C A;  1PDQ A;  2EPB A;  2L12 A;  5JVG 3;  4DR1 Q;  1A3T A;  4BXX G;  4A3G H;  1JOO A;  3KBG A;  4DR4 Q;  5DAU A;  4JI2 Q;  2ZJR A;  2NZ1 D;  1C9O A;  3OHX C;  4J8Q A;  2K6A A;  4V0B A;  1EOV A;  3CAM A;  3UE0 A;  2JA7 G;  2UUA Q;  1A2T A;  1NY4 A;  2Q2I A;  4LAA A;  3NE5 B;  3AU7 A;  2UUC Q;  3DWP A;  1QVF A;  5KYL A;  4IUV A;  1PZK D;  3A55 A;  1A15 A;  1KC8 C;  2EDG A;  2D0O A;  3FMC A;  4LF5 Q;  3PF4 A;  3GD7 A;  5FLM G;  5KRU A;  1GUT A;  4QF4 A;  3MXU A;  5JPM C;  4IUU A;  4X65 Q;  4A3K B;  3TRE A;  4DR6 L;  2BDO A;  3RLO A;  3GTP B;  5BR8 L;  2PNH A;  1JMC A;  4OO1 I;  4Z9C B;  2PZU A;  3FKI G;  4IJH A;  3VYT A;  1F9R A;  5EGT A;  3I56 A;  1A3U A;  3F8T A;  3I90 A;  5C0X I;  1Y8N B;  1SE8 A;  2Z0S A;  3CCQ A;  1KHI A;  4C3J B;  1K9M C;  2Q8R E;  2NVY H;  5I2X A;  3I4M B;  4B9W A;  1S5F D;  5M5Y H;  5DM6 3;  3PGZ A;  1JOR A;  3MXN A;  1TY0 A;  1GKH A;  3R93 A;  5IY0 A;  4V19 0;  2ZJQ A;  5IT9 L;  4HJ9 A;  2NBF A;  1VQL A;  4RWS C;  3S24 A;  3NQT A;  1B53 A;  4HIO A;  2F4V Q;  4B3M L;  4GKK Q;  1K8A C;  4P75 A;  4ZUI A;  2KVM A;  1SN8 A;  3K6O A;  3DEO A;  4QMG A;  1TVX A;  5GRO A;  2NN6 I;  1EY5 A;  2KQ3 A;  1VQC A;  1W6J A;  2J4X A;  2WAC A;  4K2K A;  4RGT A;  4DFA A;  1U4M A;  3D4D A;  2CFM A;  5ELO A;  3GV6 A;  1STE A;  1D2B A;  4ZLT F;  1CSP A;  5IWA Q;  4A3D H;  1RTO A;  2RDH A;  3A5U A;  3HOZ H;  4KY5 A;  1P8L A;  2KBN A;  4YCW A;  3ULJ A;  1V1Q A;  2O2L D;  5I2Y A;  3J7A 5;  1AZP A;  4OIJ A;  5C0X J;  3BVZ A;  1SLJ A;  2B2U C;  1J6Q A;  2PQA A;  1O80 A;  3ERS X;  3CCU A;  4POG A;  2NVQ B;  1MIU A;  1AFP A;  3NBI A;  5CGK A;  5CR3 A;  4BBR H;  4DR2 Q;  1CI3 M;  3A0J A;  4KHP L;  1RD9 D;  3NWS A;  3PUX A;  3OTO Q;  5GAD C;  3U4V A;  1ROD A;  3HOY G;  4JYA L;  3T13 A;  1I4X A;  3EIV A;  1F2Y A;  3GTJ H;  1X6O A;  1N34 L;  2UUC L;  2F0J A;  1VS0 A;  2QDL A;  3S14 H;  1I4H A;  3W1G A;  2A73 B;  2HQE A;  4DU9 A;  4OGQ C;  2D5D A;  4DV0 Q;  4BBR B;  1T5X D;  2XGT A;  4DV2 Q;  1SND A;  2NVQ H;  1WCM G;  2F1M A;  1J5E L;  2A68 D;  2PI2 A;  4RKB A;  5JJZ A;  3JC6 6;  3S1R H;  4CKE A;  4C3I B;  4UPA A;  5C4X G;  1EEI D;  2FHT A;  2K01 A;  5BR8 Q;  1PH9 A;  2QGQ A;  3I70 A;  4L8J A;  2K7V A;  3I4O A;  3QO2 A;  4OEL B;  3W1B A;  3U9S A;  5EAY A;  1IBK Q;  1Z9F A;  4RGM A;  1N8R C;  5JEA G;  4OHJ A;  3URY A;  1S3O A;  3NQI A;  5KIX A;  2A69 D;  1YNJ D;  4FYD A;  5COR A;  4NW2 A;  1O7Y A;  2QDB A;  3SXH A;  3K59 A;  3DWQ A;  1X65 A;  1HR0 L;  2F0H A;  3BVM A;  4JBM A;  2HDL A;  2R7F A;  1Y1V B;  1PLF A;  3WOF A;  4A3F B;  3PIP 3;  1CKN A;  4IPH A;  4KN7 C;  4AQY L;  4IOC A;  3SDZ A;  1JIC A;  2E75 C;  4N9T A;  4WJ4 A;  4DV4 Q;  2PW5 A;  3FKI B;  3UE1 A;  1S72 A;  3M3Y H;  4TKO B;  1TS3 A;  4IFD H;  1IXR A;  1LTA D;  2B3G A;  1CHQ D;  2JA8 B;  2LXJ A;  2HIV A;  4YWL A;  4I7A A;  2DN8 A;  5AJ3 Q;  4FXK C;  3BYT B;  1A0I A;  3DXJ C;  4XYQ A;  3CPW A;  1XPR A;  5IWA L;  2Y0S E;  3HKZ E;  3SHL A;  5IYB G;  3NWT A;  3CCJ A;  2ALY B;  2HCC A;  2Q8I B;  1ZEQ X;  4KJO A;  3UI2 A;  1N36 Q;  1CKM A;  4PMC A;  2NTT A;  3M7G A;  1EL0 A;  5KNB A;  1Y14 B;  1O7Z A;  1Z7T A;  2Z4I A;  1JJG A;  1STY A;  2ZXP A;  4HJ7 A;  2JA7 B;  4HSP A;  4B3M Q;  1EZ8 A;  2F0O A;  3OW7 A;  1HNZ L;  1I4G A;  3MHB A;  2F0F A;  1UE5 A;  4K6L A;  4TSS A;  1IYV A;  1RKN A;  1S5D D;  3G4S A;  2IHE A;  4QUF A;  1X32 A;  2A6H C;  3QJY A;  1YNX A;  2Z6K C;  2CW0 C;  3AB9 A;  5J22 A;  4DV2 L;  4A93 H;  2UXC L;  5C44 H;  1SYG A;  1K3R A;  1H9R A;  1IHZ A;  4C3J H;  4G7Z C;  3KLR A;  3B6Y A;  3NTH A;  2EJF C;  4CJ2 C;  2Y0S G;  3HKZ G;  1FVI A;  1G29 1;  3SK5 A;  1SEB D;  1B4O A;  1AW7 A;  3R2I A;  5CMD A;  1HUM A;  3PIO 3;  1JB3 A;  1OXU A;  1E1O A;  4KD4 A;  3NBH B;  4IFD G;  1TWF H;  3W5O A;  3ICE A;  4WRD A;  5C3W A;  2FXQ A;  3OIQ A;  4MN3 A;  3KF8 A;  1YI2 A;  1Y1W G;  2K50 A;  1CTM A;  2YU9 H;  1CFM A;  1KAW A;  2A74 C;  2QCP X;  3M3Y B;  1R4Q B;  1F77 A;  2E2H H;  1X3P A;  3TBI B;  1WTP A;  5J39 A;  1SMY C;  4GN4 B;  4UAI A;  3CC7 A;  3HOW G;  3NK9 A;  2E2I H;  2R92 H;  3VYS A;  4GNX A;  2L55 A;  4F8M A;  1U9R A;  2YV5 A;  3GTL H;  5E3F A;  2EY2 A;  1K73 C;  4LF7 Q;  2CWP A;  2IW3 A;  1HR0 Q;  2PPB C;  2KEE A;  3D3R A;  2UUB L;  1IZ6 A;  4RKL A;  4MTN A;  1U4L A;  1STB A;  2K5H A;  2K03 A;  4EQN A;  4X64 Q;  4IUT A;  3TQY A;  4CJ1 B;  1ZKO A;  4EQ5 A;  1PVO A;  5ELD A;  1NR4 A;  2EYF A;  1HJP A;  1X56 A;  1IBK L;  1WOC A;  4LFC L;  5D3I B;  5FKA C;  3J7A V;  1BXT A;  1W6K A;  5FLX E;  2R3Z A;  4A3M G;  2N3S A;  1E0B A;  3GTG B;  2V1C C;  3VDY A;  2FMC A;  4O1N A;  4A3I G;  3STB D;  2UU9 Q;  3N6R A;  2HDM A;  1LM0 A;  1FJG L;  4HJA A;  4O42 A;  1L1O C;  1M8A A;  3KF8 B;  1CZW A;  3MVV A;  1U0L A;  4JI4 Q;  2OEO A;  5K36 H;  1F2L A;  1I6V C;  2EZV A;  1YIT A;  2YYZ A;  1A2U A;  2V4D A;  2EYO A;  5C5L A;  4DNR B;  3QG1 A;  5JPN C;  5K36 G;  3A56 A;  4A3M B;  4K5V A;  4ZAI A;  1KTK A;  3VYR A;  1VQ5 A;  5HGQ A;  1DOM A;  1GOZ A;  1B3A A;  3EN2 A;  2RSO A;  3I2Z A;  3S2H B;  2XRQ D;  1QUQ B;  3NTI A;  1LTL A;  3HOX B;  2JA9 A;  1WTQ A;  2HQL A;  1NNX A;  3H15 A;  1ESF A;  3LNN A;  5LMN W;  3EA6 A;  2KCT A;  3J80 L;  1QVC A;  1U5K A;  3K0X A;  5J1Z A;  3L0O A;  4IPD A;  1WVL A;  1N33 Q;  1PTO C;  4HCS A;  2NVX B;  1E1T A;  2MNA A;  3LX0 A;  2X69 A;  1VQB A;  1YNN D;  1KLG D;  1X3G A;  5C4X H;  1NTG A;  4NP5 A;  2L4N A;  3U9O A;  3MWY W;  3PIP A;  2K5W A;  4OXP A;  2AQ1 B;  3S2H H;  2AQ3 B;  2IPK D;  4EQO A;  5C3X A;  3GTQ B;  2Z8L A;  5IP9 H;  1CUK A;  2VQE Q;  3QOJ A;  2PI2 E;  5IGB A;  4EVO A;  1C4Q A;  4JV5 L;  1I4R A;  1Y1W B;  3I4N G;  3HP3 A;  2YTY A;  2F3V A;  2K05 A;  1E7Z A;  2VQF L;  2K32 A;  4GLX A;  3KFU A;  3HS0 C;  4X65 L;  5M3F B;  3CPF A;  2SDF A;  1N32 L;  3D4R A;  4UDU C;  2KCM A;  3J80 E;  3PO3 G;  3ZYY X;  4DPG A;  1K8M A;  1EY9 A;  1WD1 A;  3A8J E;  2B2U A;  3GV3 A;  1VMC A;  2BOS A;  5NUC A;  5KGU A;  5IP7 H;  3K5N A;  4G7O C;  2P5Z X;  1G8Z D;  2RHQ B;  3JAM i;  4BY1 B;  1E3P A;  2SOB A;  4CBV A;  4IFD I;  3KDF B;  4ZKC B;  3BZD B;  4L5R C;  1PYB A;  4A75 A;  1ZYR D;  5C0X H;  4YWM A;  1JOQ A;  2XVS A;  2F0S A;  1WCM H;  2EIF A;  4A3D G;  4IPG A;  2F4V L;  2F0P A;  5M5W H;  2XTI A;  1PH7 A;  5CV9 A;  3J81 c;  4G4K A;  5ELB A;  1UE1 A;  1HCZ A;  3T16 A;  4FF2 A;  1UEA B;  3A54 A;  5EKI A;  3PO2 H;  4A3B B;  3R8B A;  4ME3 A;  4LUO A;  2QF7 A;  2Y0S B;  3HKZ B;  3C46 A;  3DEP A;  4B3R L;  4JI0 L;  1SRU A;  1IBM Q;  5IGD A;  3RZO H;  1PXU A;  1L2F A;  2C9O A;  1EEF D;  4HIK A;  4A3K G;  4LWC A;  3HEJ A;  2DNC A;  4FVM A;  2Z4H A;  2HD3 A;  1I4P A;  4KHV A;  2R93 H;  1AEX A;  1YHB A;  1EY8 A;  4C1N K;  2KEN A;  2MO0 A;  2MGS A;  1TWH H;  2LFN A;  2QIL A;  1QCB D;  4GNX B;  3A8K E;  4LF4 L;  1PMR A;  1CA6 A;  4Y52 H;  2E2I B;  3DWA A;  3BDL A;  2D62 A;  5ELE A;  2BH2 A;  5IIF A;  4ULL A;  3HOW H;  3GTL B;  1OXS C;  3LWU A;  1Q8K A;  3NHH A;  4HED A;  5LMN L;  4DV6 L;  3PUW A;  3ND9 A;  3HOX G;  3GTK H;  4AYB G;  3NBH A;  2MJ8 A;  3TN2 A;  5JEA H;  2AUK A;  1YNN C;  1HQR D;  4TVA B;  3HOU B;  1ICW A;  1KQS A;  3VR5 A;  3GDE A;  1BBX C;  2VQE L;  2IX3 A;  3CRK C;  5J3B A;  1Y1V G;  1HNW Q;  1PTO H;  2K75 A;  4JI5 L;  2AQ2 B;  4RMF A;  4P71 A;  3WDN A;  1STH A;  2ZXR A;  3TDQ A;  4XXE A;  3FKI H;  5ISR A;  3VR3 A;  3L7Z C;  1ILP A;  3HOV B;  1BBW A;  1VQA A;  2WAQ G;  1TKW B;  3HKS A;  4DAP A;  3F2D A;  1STN A;  2VY3 A;  2AMC B;  2K28 A;  2ICI A;  1Q7Y C;  5KNC A;  2WB1 E;  3JAM E;  3ULP A;  2J0T D;  1YJN A;  2DUD A;  5FLM H;  1CA5 A;  3CXC A;  2B2V A;  4LUZ A;  4K5W A;  1KD1 C;  4IUN A;  1CKO A;  4PNY A;  4BBR G;  1JB7 A;  3GTO H;  3Q8D A;  1IKL A;  4DXF A;  3S1Q B;  1VQD A;  2SNM A;  4A3C G;  3KLS X;  1ONL A;  2K1B A;  3KJP A;  3VYU A;  2ZM6 Q;  1V43 A;  3FPP A;  1K3B C;  2EYP A;  3T51 B;  3KK7 A;  5M3M G;  3AQQ A;  3TP7 A;  3KBX A;  2O4X A;  2L0C A;  2AWN A;  4K0K Q;  3T1H Q;  4GKK L;  5M3M H;  3KOJ A;  2WAQ E;  3BU2 A;  3I55 A;  2AKW B;  3TME A;  4A3G B;  2I07 B;  1S5E D;  2DGY A;  1XTD A;  4G7H C;  2MQH A;  1Q82 C;  1SXT A;  1UUP A;  3QWN A;  4RGN A;  4KTA A;  5G3L F;  1WD0 A;  2BA1 A;  2XRS D;  1I3Q B;  3I8Z A;  1EZ6 A;  4UY8 C;  1LT5 D;  4A76 A;  2DNE A;  3H09 A;  4IZ8 A;  4DNT B;  2NN6 G;  4EX5 A;  2R6G A;  3TSS A;  3L3O C;  1RDP D;  4A3J G;  1S4Z A;  1X3F A;  2VXW A;  5CBA E;  3BJU A;  2GA4 B;  4FF3 A;  3J81 j;  2X6L A;  2I5M X;  2PZT A;  2XWJ B;  4B3S Q;  1EU3 A;  4FXG C;  4K8I A;  3GTM B;  1VQH A;  2CQO A;  4QL5 A;  1B50 A;  3J81 L;  4GOP A;  4YWK A;  1Q12 A;  3NEL A;  3FP9 A;  4A3L H;  1HZB A;  4WOR A;  1IBL L;  3BDO A;  2HCI A;  1EYG A;  1K8O A;  3FHW A;  3S9W A;  4Q5V A;  4A3M H;  1ICF B;  3IRB A;  1FNU A;  5BN4 A;  4DV0 L;  1XNQ L;  5C0X G;  2JQO A;  1SMX A;  4AH6 A;  1G2S A;  1SNC A;  1JJ2 A;  1Y1V H;  1EFW A;  5IGF A;  4OO1 G;  3MEH A;  1BBU A;  2I5L X;  3RZO B;  2BE5 C;  3S1N B;  5JOB A;  4K5X A;  4UP7 A;  2F0D A;  3I4M H;  1EIH A;  2K5N A;  2XSC A;  1YHA A;  1QJO A;  1HA5 A;  5EQ0 A;  3CQZ B;  2MP1 A;  2JA8 H;  1XWE A;  1K28 A;  5DM7 3;  2YTV A;  1FL0 A;  2Q2H A;  4C3J G;  1VQ6 A;  1FNV A;  2D0P A;  1M90 C;  4JI6 Q;  1CKN B;  4R4C A;  4KV6 A;  1WTR A;  2H1E A;  1SYE A;  1BUV T;  3X3M A;  2JA8 G;  1TS2 A;  3SR1 A;  5L37 A;  1D5Z C;  4ID6 A;  5E4X A;  1L0Y B;  1G6P A;  4NPS A;  3EFX D;  2DJF C;  3CQZ H;  3MFG A;  5IP9 G;  1KDC A;  2E2H B;  2QEJ C;  1AH9 A;  3R2T A;  1E22 A;  1PH1 A;  4BXX H;  4ALP A;  2X6G A;  2QA4 A;  2N55 A;  4MTK A;  2JYO A;  2EY6 A;  2E8G A;  4JBJ A;  1DCZ A;  2G5D A;  3CKI B;  4RAU C;  2LMC B;  4A3L G;  4IO9 A;  4R4T A;  4K8J A;  1BQQ T;  4A93 B;  4N8X 1;  4JVZ A;  1X3E A;  2QKI C;  4CGY B;  4J6H A;  4LFA L;  1EIF A;  1I5F A;  4CKC A;  1D5M C;  4HMJ A;  4JK1 C;  5GAG C;  1BNZ A;  1S5C D;  4IN3 A;  4L5Q A;  5IYC G;  4C3I G;  4DK6 C;  5M9O A;  3W3A A;  4P73 A;  1Q81 C;  2Z9H A;  1KNE A;  3GO5 A;  3S15 B;  2NVY B;  2RCF A;  1GO3 E;  1NCV A;  2F3W A;  3QB3 A;  1IBM L;  1JWM D;  5CV8 A;  4ZUJ A;  4TRD A;  4BY7 B;  2B2Y A;  4CJ0 B;  3OOC A;  4LNQ A;  3PIO A;  1YVC A;  3ER0 A;  5M5W B;  4FDB A;  5C3E G;  1XMQ Q;  4KJN A;  1EY4 A;  1HFG A;  2CKZ B;  5A35 A;  3G6J B;  5DLQ E;  4GLV B;  1BCP F;  1N33 L;  1ET6 A;  1TT2 A;  2UXC Q;  1NSN S;  3HOU H;  4QQB X;  5BN5 A;  1PZI D;  4NXN Q;  4HSV A;  1LTT D;  2PQA B;  2PO4 A;  3TP8 A;  3CCR A;  4EQP A;  4DR1 L;  4MNO A;  2OWO A;  2RVL A;  4A3I H;  1CQV A;  2R7D A;  1PTO B;  4GKJ Q;  2A6E D;  2K52 A;  2ZXO A;  3K5O A;  2M00 A;  4A3C H;  2L1B A;  1HNZ Q;  4ABN A;  4DGZ A;  2HIX A;  1EIG A;  2UXB L;  4DV1 L;  1EY0 A;  2A6E C;  1IYU A;  1RHP A;  1B8A A;  2ZJP A;  1SAP A;  3HOV H;  3M7N A;  1I6H H;  3Q24 A;  1O7I A;  2MUY A;  3M4P A;  5EBD A;  3S16 B;  4Y7N B;  1OO9 B;  3A7A B;  3BZC A;  3I73 A;  1LTR D;  3MTS A;  4AYB B;  1GUW A;  1MI2 A;  1LT6 D;  1SYC A;  1XJV A;  1FGU A;  4H13 C;  5IGC A;  4C3H B;  2A6H D;  3DUZ A;  1WTH A;  1K0R A;  4DAY B;  2F0M A;  3HGB A;  4NKL A;  1KL9 A;  1L1O B;  1M1K C;  4EGV A;  4DK1 A;  2LY7 A;  1I6H B;  1O78 A;  5IYD G;  1LTB D;  1HH2 P;  5I6W A;  3K5M A;  3C3L A;  4Q0F A;  5C4Z A;  3NEN A;  1KRT A;  4A3B H;  2B63 B;  1Y1W H;  4LFC Q;  2GVA A;  1VDZ A;  1QZH A;  3H3V C;  2JJQ A;  2JP1 A;  1PHJ A;  3DLL A;  3RLF A;  1MGS A;  3BS1 A;  1VQM A;  1TII D;  2RF4 A;  2ATW A;  1E2W A;  2MPM A;  1KAA A;  1OXX K;  3HOX H;  4LMQ D;  3NUC A;  4XQQ A;  4IUP A;  4DR3 L;  1SBB B;  5IOC A;  4KHZ A;  1J9O A;  1RJT A;  3PUZ A;  5GAE C;  5KYI A;  1DOK A;  4R4Q A;  4GN3 B;  2B63 H;  4I7Z C;  3V2T A;  1L1O A;  1VQ9 A;  2F0G A;  2F0N A;  4WJ3 M;  1TR5 A;  3VA5 A;  1IL2 A;  2JA7 H;  1NBW A;  2KOL A;  3SK8 A;  1CT1 D;  2E74 C;  1H95 A;  4O2D A;  3STB C;  1TS4 A;  2Q2T A;  3S2D B;  1C0A A;  5FJ8 H;  4BBS B;  2A68 C;  5AFW A;  3S14 B;  2JA5 B;  3HOZ G;  4K2L A;  4KKT A;  2O5J C;  5HGT A;  5M3F H;  1VQK A;  2TSS A;  4ZRZ A;  2B29 A;  1WTO A;  1HTL D;  2IY5 B;  4NXM L;  3IFT A;  4ZQ3 A;  2WKC A;  2XIW A;  1IW7 C;  3HZX A;  3KJO A;  3RUZ A;  2NB0 A;  4YY3 L;  5C4J B;  3OW2 A;  3S1R B;  1I94 L;  1SR3 A;  4K14 A;  1GUS A;  3ITP A;  2UU9 L;  1EQT A;  4PMW A;  1SDF A;  4MIU A;  3SGI A;  3PUV A;  1PFS A;  3N52 A;  1EY7 A;  4RCN A;  1R9T H;  4PZ8 A;  3GTP H;  1V1P B;  3AMU A;  1EU4 A;  4ZK9 B;  2UXB Q;  3K81 C;  4DA2 A;  1JQY D;  5KEE A;  2F0W A;  3D8G A;  5EJW A;  4JOI C;  3X3N A;  1LTS D;  4XTC S;  4O0A A;  4KK7 A;  2F0E A;  4DR5 L;  2DJG C;  1KRS A;  4X3T A;  1AN8 A;  1MSH A;  5A2Q E;  3PMF A;  2YTX A;  4QY7 A;  4B3T L;  3K8A A;  3M4Q A;  1UE6 A;  5LL6 X;  5C4J H;  3NSW A;  1GVP A;  4JG2 A;  2B2T A;  3G7L A;  1E24 A;  2OF1 A;  4FF1 A;  1HA6 A;  3D6C A;  1EYA A;  1HNW L;  1NE3 A;  4YCV A;  4HJ5 A;  4DV1 Q;  1LV9 A;  4F88 A;  1LLR D;  5T1G A;  4PQX A;  1SE2 A;  2F0I A;  4DAY A;  4GKJ L;  1K0S A;  1FNW A;  4H02 A;  1GUO A;  5LMU Q;  2D9U A;  2OTJ A;  2LXK A;  5FO8 B;  2WIN B;  2CQA A;  2VQF Q;  3H91 A;  4KY7 A;  5FLX L;  1QOH A;  2NTS A;  2VB2 X;  1VQE A;  2Q2U A;  1TWA B;  1G2T A;  3P20 A;  1T5E A;  2D2C C;  1STG A;  1YJW A;  3GP7 A;  1PYS B;  2IHF A;  4RG1 A;  3M9B A;  4ZYS A;  4DR3 Q;  2ES2 A;  1SE3 A;  1XYI A;  1BCP B;  4APV A;  2L9H A;  3E0J A;  1VQN A;  1JE4 A;  5JJI A;  3K57 A;  3I4N H;  4FXD A;  1LYL A;  4TQU S;  4DN4 M;  2AUJ D;  4JPB W;  3E9H A;  4A3F G;  1ZYR C;  2PQE A;  2R92 B;  1Y69 U;  1PRT B;  4JCV E;  1XTC D;  1IW7 D;  2AHO B;  2EYM A;  4PZ6 A;  4GNX C;  4A3E G;  2E5L L;  1MKH A;  5IYB H;  2WB1 B;  1B9M A;  1FD7 D;  2EY5 A;  2M9V A;  1TWA H;  1LAB A;  1J8I A;  1ML0 D;  1PH6 A;  3I91 A;  4ILW A;  4LW1 A;  2E2J B;  5LL6 S;  3M4Y A;  1X54 A;  4HCE A;  2GN5 A;  4YY3 Q;  4JI0 Q;  2A5H A;  5AJ3 L;  4LFB Q;  1CZG A;  3M85 A;  4X3U A;  4KKS A;  1WFQ A;  5GAH C;  1VQO A;  3QIA A;  3BYY B;  3GTJ B;  3U4Z A;  5EPL A;  2L15 A;  1ENC A;  4DUZ L;  1XPO A;  2AWO A;  2BA0 A;  1PRT F;  1GUN A;  1F2M A;  4RHS A;  2VZA A;  1Y8P B;  3RR5 A;  5IT9 c;  4GOP C;  5LHY 1;  1WYD A;  4JI1 Q;  2VUM B;  1HNX L;  1L0X B;  3D0F A;  1GM5 A;  3JAM c;  3L2P A;  2F0Q A;  2CW0 D;  1FR3 A;  1VMP A;  1PA6 A;  1CHP D;  1Y8O B;  1U4P A;  2PMZ B;  4DR5 Q;  3HFZ B;  1KDB A;  1NAP A;  2VS1 A;  3T56 B;  3VR6 A;  4C56 C;  3ONA B;  1TWC H;  2CH4 A;  1VQ4 A;  2IL8 A;  5COY A;  1QIL A;  4PZ7 A;  1PTO F;  3T53 B;  3MZ5 A;  3WOE A;  1JE5 A;  3KDF A;  2K5D A;  1GHJ A;  4FP5 D;  3GTO B;  1TWG B;  4JYA Q;  1OTC A;  3RD4 A;  3ERQ A;  3H0G H;  3KLS A;  4JI5 Q;  4B3T Q;  2F0V A;  1K83 B;  2WV6 D;  4AYB E;  3J7Z C;  2VNU D;  1UEB A;  1EWI A;  1H9S A;  3OSO A;  3NTK A;  3RZD H;  4CDE C;  5C3E B;  3J81 i;  1HXY D;  2EOT A;  4X6A H;  1ESR A;  2JA6 G;  4XDX A;  3KF6 B;  3IKJ A;  4BBS H;  2KHI A;  5LMN Q;  4DV6 Q;  1N34 Q;  2ZT9 C;  3ND8 A;  1SNP A;  4BWG B;  3NP8 A;  3LGJ A;  1JT8 A;  4ZCK A;  3GTQ H;  4JI7 Q;  2OQK A;  2PYK A;  3HG9 A;  4UP9 A;  4QIW B;  4HR7 B;  3OTO L;  3CCM A;  4BS9 A;  3S16 H;  2QW7 A;  3RZD B;  4B9X A;  5C5M A;  3T1Y L;  4XQN A;  2CVR A;  4X66 Q;  5EPJ A;  4HTH A;  4DR7 Q;  1SNM A;  1SFO H;  3GQB A;  3G71 A;  5FLX c;  4DV7 Q;  1OXT A;  2FJ2 A;  1B2T A;  2E5L Q;  1KDA A;  3HOZ B;  1EWC A;  2JA5 G;  5T1I A;  3CCS A;  2WII B;  3I4M G;  3TZD A;  3MA2 B;  4LFA Q;  3DM1 A;  4JC0 A;  2ICE C;  4DUZ Q;  5CV7 A;  2KA7 A;  2I46 A;  5DNF A;  2RDF A;  4CDD C;  2XN9 C;  1JC7 A;  3PCO B;  4X62 Q;  1Q86 C;  1PH5 A;  3A8I E;  1D1I A;  4LFB L;  5IYD H;  4R8N A;  4WFN 3;  2EVB A;  1QWY A;  5E1F A;  4BA1 I;  5K5P A;  4AIM A;  1XMQ L;  4HMI A;  1WI5 A;  1XX8 A;  1PFB A;  2VW9 A;  2DY7 A;  2K14 A;  2JN4 A;  1JWU D;  1X55 A;  2KEC A;  3I7F A;  3Q22 A;  1V1O A;  4J15 A;  1GD7 A;  2KHS A;  3ULL A;  3U58 A;  3DM3 A;  1XXG A;  4KLK A;  4A3J H;  4L5T A;  5D65 A;  3R3O A;  4POF A;  1ENA A;  3J80 c;  4DV5 Q;  4K0K L;  4GS3 A;  1OXV A;  4BY1 H;  4C3H H;  1BDO A;  5TSS A;  4L6T B;  3MXG A;  4X3S A;  1K8G A;  2A19 A;  2UXD L;  2BE5 D;  3Q23 A;  3J7A F;  4B3S L;  3SK6 A;  2A8V A;  3AEV A;  3D4W A;  4C3H G;  1I50 H;  4P72 A;  1LTG D;  1WCM B;  3P7J A;  3UDX A;  4JI2 L;  3S17 H;  2CCZ A;  2FMM A;  3U50 C;  4JI3 L;  1D6E C;  4UP8 A;  2F0U A;  4L5S A;  3PUY A;  3K0Y A;  1ASZ A;  3FPU B;  2G9H D;  4CHT B;  1GJX A;  4LUV A;  1XMO L;  3OWE B;  4A3F H;  1SJH D;  1VQ7 A;  2ASB A;  2RCN A;  1ET9 A;  2O5I C;  5IOD A;  4GN5 A;  2TMP A;  2ZTD A;  2LSS A;  3NPP A;  4OX9 Q;  1PTO D;  4LF5 L;  1GXD C;  2EE1 A;  1IL8 A;  4A3G G;  2R7Z B;  4BY7 H;  5I4D A;  4QJF A;  5CV4 A;  4Y7N H;  1F9S A;  4NDX A;  1A8V A;  1HPC A;  3F2B A;  2E2J H;  1JJC B;  4IPC A;  5C4H A;  4FNF A;  1V9P A;  2VUM H;  5C6A A;  4LJZ C;  2OT2 A;  4BY7 G;  1T9H A;  4F87 A;  3M4O H;  5I6Y A;  4BA2 I;  5JVH 3;  2VB3 X;  3KUP A;  1JWS D;  4CDF C;  1DON A;  4JOI A;  3EJI A;  3J81 E;  3T1Y Q;  4LF6 Q;  1PRT C;  4JI6 L;  3BDC A;  2KUM A;  2PCF B;  4XQJ A;  4IAL A;  2K5V A;  3IFD A;  1B44 D;  1Q8I A;  3GTM H;  1SSO A;  3LWE A;  1EQQ A;  2RHS B;  1MJE A;  2RBM A;  3RNU A;  1XNR L;  2B2Y C;  1NR2 A;  1B7Y B;  1TWC B;  4H7B A;  3CMA A;  3PSI A;  4FO2 A;  3W2D A;  3OWF A;  1S5B D;  4R1J A;  1RIP A;  5GQO A;  3QOL A;  4DK3 C;  3M4O B;  2NWG A;  2IT1 A;  3PF5 A;  1TY2 A;  1DOL A;  2KCC A;  3KLW A;  3SE0 A;  2N8N A;  5F2D A;  2EYJ A;  4M1U B;  1TWG H;  1B9N A;  3CC4 A;  2IX1 A;  1X9N A;  1SYD A;  5ELN A;  1RF2 D;  5FO7 B;  1UWV A;  3E3X A;  1HHV A;  3A5Z B;  3CC2 A;  1DD2 A;  1TXY A;  1W2B A;  4QUC A;  3CME A;  2ID0 A;  1HZA A;  2M2L A;  4X3K A;  1MBY A;  1VF7 A;  1UE7 A;  1FJG Q;  2F0K A;  4P74 A;  1A3V A;  1IKM A;  1S40 A;  5CV6 A;  3PQI A;  5CBE E;  3DHQ A;  1TQO A;  1EY6 A;  2B2T C;  3JAM L;  1D8L A;  1VQG A;  2JK8 A;  5CV5 A;  5EPK A;  5E4W C;  5IYC H;  3NEM A;  4R4I A;  2Z6B A;  1XMO Q;  3EQL C;  1HUN A;  1HNX Q;  1CQF A;  1R9T B;  1AE2 A;  3PO2 G;  1VCI A;  2B2W A;  1ASY A;  1SNO A;  4DUY L;  3V05 A;  3FRP B;  5LMU L;  4JV5 Q;  4NXN L;  1G51 A;  2WP8 J;  2NZH A;  1AZQ A;  2EQS A;  3K5L A;  1B1Z A;  2JE6 I;  3K7A H;  1PH8 A;  1SFO B;  2IJ0 A;  1DZ1 A;  4XT1 B;  3AFQ A;  4OX9 L;  4K6D A;  1F9P A;  2JA5 H;  4DNI A;  4GZY C;  3NXW A;  3S1M H;  4PMB A;  4QIW E;  1HRJ A;  3VR2 A;  2KCN A;  1HTP A;  5FJ8 G;  2QEX A;  4MZ9 A;  2JA6 B;  1SRO A;  4LF9 L;  3K58 A;  3OPO A;  4DR2 L;  1PFN A;  3FDT A;  1D7Q A;  5EKL A;  1JOK A;  3T4A C;  1HZC A;  2WKD A;  2B8G A;  1YHQ A;  3UDF A;  3S1N H;  5E7N A;  4R8I A;  3E9I A;  5G3L D;  1GHK A;  2L11 A;  3TS0 A;  2H5X A;  1J5E Q;  1HFN A;  4XT3 B;  3OIP A;  4A3D B;  3SVM A;  2MFI A;  3AYH B;  4ODG A;  2ZM6 L;  4IQZ A;  1EOT A;  1NMF A;  2I5H A;  3F2U A;  2HT1 A;  5KND A;  1V1P A;  1XNR Q;  1SYF A;  1EFI D;  3K80 C;  1TU2 B;  4MHE A;  5C44 B;  2F4I A;  1HQM C;  1I50 B;  3QR8 A;  4LF6 L;  1A62 A;  4KI0 A;  1QUQ A;  4RCO A;  1F9Q A;  2NYZ D;  4BY1 G;  1QE6 A;  4YHH Q;  1CM9 A;  4IJL A;  1WTV A;  1KIX A;  4I65 A;  3MXP A;  5D14 A;  1QB5 D;  3EVQ A;  3EBE A;  4YCU A;  5JJK A;  1DGS A;  2ENB A;  3CF5 A;  4U68 A;  2NVT B;  1DM0 B;  1BF4 A;  1A63 A;  4DAM A;  3H94 A;  4E6I A;  4HN7 A;  2HHH L;  1NUC A;  1Z47 A;  4KMU C;  3H0G B;  3SK4 A;  2BDN A;  1YNJ C;  3A74 A;  3I3C A;  5ELF A;  3TP6 A;  3FEW X;  4B3R Q;  2R7Z H;  1HR0 W;  4S3S A;  3CCL A;  1E2V A;  2XNA C;  2WAQ B;  3MXN B;  4DKA C;  1BO0 A;  4U67 3;  2RA4 A;  5I9P A;  2R7Z G;  3HOV G;  3IL8 A;  4DXG A;  3PV0 A;  4KN4 C;  5FOB B;  1QNK A;  3MEF A;  2F03 A;  2PZW A;  2K4K A;  3CW2 C;  5BN3 A;  4OEM B;  1KXL A;  2JSO A;  4A3E B;  5CYU A;  4DUY Q;  2B8F A;  1FGB D;  1W3S A;  3I4L A;  3TZU A;  4ZKB B;  1SE4 A;  4HIM A;  3GTG H;  2PNR C;  2JEA I;  4DR4 L;  1YBY A;  4C2M H;  5A2Q L;  1PFM A;  3HOU G;  3CCV A;  1PZJ D;  2RDG A;  2VUM G;  1WJJ A;  2KJX A;  3C1F A;  3MFY A;  3RN5 A;  5ELC A;  1VQ8 A;  3OYY A;  2R93 G;  1LAC A;  5JJL A;  1AP0 A;  4OWW B;  2PW7 A;  3I72 A;  4HAE A;  2FIN B;  2K33 A;  2UXD Q;  1FYC A;  4IFD J;  1QNU A;  2J7Z A;  4JI7 L;  5EKK A;  5CC4 A;  3S1Q H;  1B3Q A;  4DV3 L;  1D5X C;  1B70 B;  1P16 A;  4JBK A;  1WTW A;  3IAY A;  3RLN A;  1D1K A;  2CWA A;  3S15 H;  1H9S B;  4YIJ A;  1I3Q H;  3A7L A;  1VF5 C;  2FFK B;  3D31 A;  5FK9 C;  4LF7 L;  4KHP Q;  4DR7 L;  1E2Z A;  1K83 H;  5H1S E;  4C2M B;  3C2P A;  5M5X H;  4WJW A;  3UDI A;  3Q0A A;  3F1Z A;  1U4R A;  1ILQ A;  5IGG A;  1XPU A;  4YHH L;  4JI8 Q;  4LF9 Q;  3H3V H;  2R92 G;  1G91 A;  3H3V I;  4RH6 A;  1Q90 A;  1UNS A;  3AFP A;  3OMG A;  3H0G G;  4LF8 Q;  1QVG A;  2XWB B;  3UDG A;  3TP5 A;  1DYQ A;  2NVX H;  2JXM B;  3CHB D;  4IUR A;  1VQF A;  4B08 A;  4HJ8 A;  2N78 A;  1BCP D;  2E76 C;  2OXP A;  2UUB Q;  2OQ0 A;  2F3I A;  3P75 A;  4RHR A;  3HRZ C;  2VL6 A;  4OWT B; 
#chains in the Genus database with same CATH homology
 4OO1 H;  1KAB A;  4CKB A;  4N9P A;  3CU7 A;  1PYW D;  1Z6H A;  1UAP A;  4RA8 A;  5JAV A;  1H9K A;  1TS5 A;  1PRT D;  3S1M B;  3BG3 A;  2EYL A;  3MC0 B;  1ENF A;  3HOW B;  5IGE A;  1LO5 D;  3K7A B;  4R9W A;  1TWF B;  3S17 B;  2LS0 1;  2LKV A;  1WTX A;  2K04 A;  1M4V A;  5EBC A;  1QG7 A;  1SNQ A;  3DMU A;  2YU9 B;  3E5S A;  1H9J A;  4C1N I;  3PO3 B;  2SEB D;  2RKS A;  2EJG C;  4G57 A;  2RSN A;  2CHB D;  1RCV D;  2DY8 A;  2EYH A;  1EYC A;  2EY1 A;  3P1H A;  5I9O A;  1BCP C;  4M8A A;  1F2Z A;  3GTK B;  1V8Q A;  4QB4 A;  1LTI D;  2F0L A;  2BCO A;  3I4N B;  3V96 A;  1SMY D;  4F7X A;  1MD2 D;  3OMC A;  1LT3 D;  4H44 C;  3PO2 B;  3FVQ A;  3O13 A;  4XIG S;  4XYO A;  4KD3 A;  4QCL A;  4P2C B;  5IT9 E;  1C8C A;  4J1M A;  2G9D A;  4NMZ A;  2SNS A;  1Q3L A;  1II3 A;  3L9A X;  3ERO A;  4LK1 C;  5M5Y B;  2EXZ A;  2IWH A;  3C1E A;  2R93 B;  1CK1 A;  1DXM A;  4DAV A;  3H6M A;  4KY6 A;  4A3J B;  1RTN A;  1TWH B;  3VA7 A;  1SYB A;  3J7Y W;  2RQX A;  4RFB A;  4ME5 A;  1SJE D;  1R4P B;  1I4Q A;  2B2W C;  1LT4 D;  2K5Q A;  1EQV A;  2MHV A;  1GUG A;  4L63 B;  4A3I B;  1G6Z A;  1EYD A;  1JR0 D;  5M3M B;  3MAQ A;  1STA A;  4IUQ A;  2A69 C;  5FO9 B;  5C4X B;  1BOS A;  3SEB A;  5HUR A;  2C5C A;  2E2D C;  2H4O A;  4PV1 C;  2R61 A;  4H0L C;  1C48 A;  2JEB I;  5JEA J;  3CRL C;  1ZXT A;  3BVG A;  1DJR D;  2HUG A;  1KLU D;  2EJM A;  2L5T A;  2NUC A;  5M5X B;  3HOY B;  2IX0 A;  2B39 A;  1Q1B A;  1Q1E A;  4FF4 A;  1BR9 A;  1KNA A;  2F0T A;  1EWH A;  2B2V C;  3E6Z X;  4DF7 A;  4KKU A;  2Q8T A;  3RMH A;  4DK0 A;  1X3Q A;  4RGO S;  1A6X A;  5DEH A;  4OIK A;  2KED A;  3VR4 A;  5D3D A;  1JCK B;  1O7L A;  3D6W A;  2NN6 H;  4OL7 A;  3Q6S A;  1H9M A;  4JBW A;  1MSG A;  2N88 A;  2Z1C A;  1PDQ A;  2EPB A;  2L12 A;  5JVG 3;  1A3T A;  1JOO A;  3KBG A;  5DAU A;  2NZ1 D;  3OHX C;  4J8Q A;  2K6A A;  4V0B A;  1A2T A;  4LAA A;  3NE5 B;  3AU7 A;  3DWP A;  5KYL A;  4IUV A;  1PZK D;  3A55 A;  1A15 A;  2EDG A;  3FMC A;  3GD7 A;  5KRU A;  1GUT A;  4QF4 A;  3MXU A;  5JPM C;  4IUU A;  4A3K B;  2BDO A;  3GTP B;  4OO1 I;  4Z9C B;  2PZU A;  3VYT A;  1F9R A;  5EGT A;  1A3U A;  3I90 A;  5C0X I;  1Y8N B;  4C3J B;  2Q8R E;  5I2X A;  3I4M B;  4B9W A;  1S5F D;  5DM6 3;  1JOR A;  3MXN A;  1TY0 A;  3R93 A;  4V19 0;  5IT9 L;  2NBF A;  4RWS C;  3NQT A;  1B53 A;  4ZUI A;  2KVM A;  3K6O A;  3DEO A;  4QMG A;  1TVX A;  1EY5 A;  2NN6 I;  2KQ3 A;  1W6J A;  2J4X A;  2WAC A;  4K2K A;  4RGT A;  4DFA A;  1U4M A;  3D4D A;  3GV6 A;  1STE A;  1D2B A;  4ZLT F;  1RTO A;  2RDH A;  4KY5 A;  2O2L D;  5I2Y A;  1AZP A;  4OIJ A;  5C0X J;  3BVZ A;  2B2U C;  1O80 A;  2NVQ B;  1AFP A;  3NBI A;  5CGK A;  5CR3 A;  1CI3 M;  1RD9 D;  3NWS A;  3PUX A;  1ROD A;  3T13 A;  1I4X A;  1F2Y A;  2F0J A;  1I4H A;  2A73 B;  2HQE A;  4DU9 A;  4OGQ C;  2D5D A;  4BBR B;  1T5X D;  1SND A;  2F1M A;  2A68 D;  4RKB A;  5JJZ A;  4CKE A;  4C3I B;  1EEI D;  2FHT A;  2K01 A;  3I70 A;  4L8J A;  2K7V A;  3QO2 A;  3U9S A;  4RGM A;  5JEA G;  4OHJ A;  3URY A;  3NQI A;  5KIX A;  2A69 D;  1YNJ D;  4FYD A;  5COR A;  4NW2 A;  1O7Y A;  2QDB A;  3SXH A;  3K59 A;  3DWQ A;  2F0H A;  3BVM A;  2HDL A;  1Y1V B;  1PLF A;  3WOF A;  4A3F B;  3PIP 3;  4KN7 C;  3SDZ A;  1JIC A;  2E75 C;  4N9T A;  2PW5 A;  3FKI B;  4TKO B;  1TS3 A;  4IFD H;  1LTA D;  1CHQ D;  2JA8 B;  2DN8 A;  4FXK C;  3BYT B;  3DXJ C;  4XYQ A;  3SHL A;  3NWT A;  2HCC A;  2Q8I B;  1ZEQ X;  4KJO A;  3UI2 A;  4PMC A;  2NTT A;  3M7G A;  1EL0 A;  5KNB A;  1O7Z A;  1Z7T A;  2Z4I A;  1STY A;  2ZXP A;  2JA7 B;  4HSP A;  1EZ8 A;  2F0O A;  3OW7 A;  1I4G A;  3MHB A;  2F0F A;  4K6L A;  4TSS A;  1IYV A;  1RKN A;  1S5D D;  4QUF A;  1X32 A;  2A6H C;  3QJY A;  2CW0 C;  3AB9 A;  5J22 A;  1SYG A;  1H9R A;  1IHZ A;  4G7Z C;  3KLR A;  3NTH A;  2EJF C;  4CJ2 C;  1G29 1;  3SK5 A;  1SEB D;  1B4O A;  1AW7 A;  3R2I A;  5CMD A;  1HUM A;  3PIO 3;  1JB3 A;  1OXU A;  4KD4 A;  4IFD G;  4WRD A;  5C3W A;  3OIQ A;  4MN3 A;  3KF8 A;  1CTM A;  1CFM A;  2A74 C;  2QCP X;  3M3Y B;  1R4Q B;  1F77 A;  1X3P A;  3TBI B;  1WTP A;  5J39 A;  1SMY C;  4UAI A;  3NK9 A;  3VYS A;  2L55 A;  4F8M A;  1U9R A;  5E3F A;  2EY2 A;  2IW3 A;  2PPB C;  2KEE A;  3D3R A;  4RKL A;  1U4L A;  1STB A;  2K03 A;  4EQN A;  4IUT A;  4CJ1 B;  1ZKO A;  5ELD A;  1NR4 A;  2EYF A;  5D3I B;  5FKA C;  3J7A V;  1BXT A;  1W6K A;  5FLX E;  2R3Z A;  1E0B A;  3GTG B;  2FMC A;  4O1N A;  3N6R A;  2HDM A;  4O42 A;  1M8A A;  1CZW A;  3MVV A;  2OEO A;  5K36 H;  1F2L A;  2EZV A;  1I6V C;  2YYZ A;  1A2U A;  2V4D A;  2EYO A;  5C5L A;  4DNR B;  3QG1 A;  5JPN C;  5K36 G;  3A56 A;  4A3M B;  4K5V A;  4ZAI A;  1KTK A;  3VYR A;  1DOM A;  1GOZ A;  1B3A A;  2RSO A;  3S2H B;  2XRQ D;  3NTI A;  3HOX B;  1WTQ A;  1ESF A;  3LNN A;  3EA6 A;  3J80 L;  5J1Z A;  1WVL A;  1PTO C;  4HCS A;  2NVX B;  3LX0 A;  2X69 A;  1YNN D;  1KLG D;  4NP5 A;  2L4N A;  3U9O A;  3MWY W;  2K5W A;  2AQ1 B;  2AQ3 B;  2IPK D;  4EQO A;  5C3X A;  3GTQ B;  2Z8L A;  3QOJ A;  5IGB A;  4EVO A;  1C4Q A;  1I4R A;  1Y1W B;  3HP3 A;  2F3V A;  2K05 A;  2K32 A;  3HS0 C;  5M3F B;  2SDF A;  3D4R A;  4UDU C;  3J80 E;  3ZYY X;  1K8M A;  1EY9 A;  1WD1 A;  3A8J E;  2B2U A;  3GV3 A;  1VMC A;  2BOS A;  5NUC A;  5KGU A;  3K5N A;  4G7O C;  1G8Z D;  4BY1 B;  2SOB A;  4CBV A;  4IFD I;  4ZKC B;  3BZD B;  1ZYR D;  5C0X H;  1JOQ A;  2XVS A;  2F0S A;  2F0P A;  5CV9 A;  4G4K A;  5ELB A;  3T16 A;  4FF2 A;  1HCZ A;  1UEA B;  3A54 A;  5EKI A;  4A3B B;  3R8B A;  2QF7 A;  2Y0S B;  3HKZ B;  3C46 A;  3DEP A;  5IGD A;  1PXU A;  2C9O A;  1EEF D;  3HEJ A;  2DNC A;  4FVM A;  2Z4H A;  1I4P A;  4KHV A;  1AEX A;  1EY8 A;  4C1N K;  2MGS A;  2LFN A;  2QIL A;  1QCB D;  3A8K E;  1PMR A;  1CA6 A;  2E2I B;  3DWA A;  3BDL A;  2D62 A;  5ELE A;  5IIF A;  4ULL A;  3GTL B;  1OXS C;  3LWU A;  3NHH A;  4HED A;  3PUW A;  3ND9 A;  3NBH A;  2MJ8 A;  3TN2 A;  5JEA H;  2AUK A;  1YNN C;  1HQR D;  3HOU B;  1ICW A;  3VR5 A;  1BBX C;  2IX3 A;  3CRK C;  1PTO H;  2AQ2 B;  3WDN A;  1STH A;  2ZXR A;  3TDQ A;  4XXE A;  5ISR A;  3VR3 A;  3L7Z C;  1ILP A;  3HOV B;  4DAP A;  1TKW B;  1STN A;  2K28 A;  2ICI A;  5KNC A;  3JAM E;  2J0T D;  1CA5 A;  2B2V A;  4K5W A;  4IUN A;  4PNY A;  1IKL A;  4DXF A;  3S1Q B;  2SNM A;  3KLS X;  1ONL A;  2K1B A;  3VYU A;  1V43 A;  3FPP A;  2EYP A;  3T51 B;  3KK7 A;  3TP7 A;  3KBX A;  2O4X A;  2L0C A;  2AWN A;  3TME A;  4A3G B;  2I07 B;  1S5E D;  4G7H C;  1SXT A;  1UUP A;  3QWN A;  4RGN A;  4KTA A;  1WD0 A;  5G3L F;  2BA1 A;  2XRS D;  1I3Q B;  3I8Z A;  1EZ6 A;  1LT5 D;  4DNT B;  2DNE A;  3H09 A;  4IZ8 A;  2NN6 G;  2R6G A;  3TSS A;  3L3O C;  1RDP D;  1S4Z A;  2VXW A;  5CBA E;  2GA4 B;  4FF3 A;  2X6L A;  2PZT A;  2XWJ B;  1EU3 A;  4FXG C;  4K8I A;  3GTM B;  1B50 A;  3J81 L;  1Q12 A;  4WOR A;  3BDO A;  2HCI A;  1K8O A;  3S9W A;  4Q5V A;  1FNU A;  5BN4 A;  5C0X G;  1G2S A;  1SNC A;  5IGF A;  4OO1 G;  3MEH A;  3RZO B;  2BE5 C;  3S1N B;  5JOB A;  4K5X A;  2F0D A;  1EIH A;  2XSC A;  1QJO A;  1HA5 A;  5EQ0 A;  3CQZ B;  2MP1 A;  1XWE A;  5DM7 3;  4C3J G;  1FNV A;  4KV6 A;  1WTR A;  2H1E A;  1SYE A;  1BUV T;  3X3M A;  1TS2 A;  3SR1 A;  1D5Z C;  4ID6 A;  5E4X A;  1L0Y B;  3EFX D;  3MFG A;  1KDC A;  2E2H B;  2QEJ C;  3R2T A;  2X6G A;  2N55 A;  2JYO A;  2EY6 A;  1DCZ A;  3CKI B;  4RAU C;  2LMC B;  4K8J A;  1BQQ T;  4A93 B;  2QKI C;  4CGY B;  4J6H A;  4CKC A;  1D5M C;  4HMJ A;  4JK1 C;  1BNZ A;  1S5C D;  4IN3 A;  4C3I G;  5M9O A;  3W3A A;  1KNE A;  3GO5 A;  3S15 B;  2NVY B;  1NCV A;  2F3W A;  3QB3 A;  1JWM D;  5CV8 A;  4ZUJ A;  4TRD A;  4BY7 B;  2B2Y A;  4CJ0 B;  3OOC A;  5M5W B;  4KJN A;  1EY4 A;  1HFG A;  5A35 A;  3G6J B;  1BCP F;  1ET6 A;  1TT2 A;  1NSN S;  5BN5 A;  1PZI D;  4HSV A;  1LTT D;  2PO4 A;  3TP8 A;  4EQP A;  2RVL A;  1CQV A;  1PTO B;  2A6E D;  2ZXO A;  3K5O A;  2M00 A;  2L1B A;  4ABN A;  4DGZ A;  1EIG A;  1EY0 A;  2A6E C;  1IYU A;  1RHP A;  1SAP A;  3M7N A;  3Q24 A;  2MUY A;  5EBD A;  3S16 B;  4Y7N B;  1OO9 B;  3A7A B;  3I73 A;  1LTR D;  3MTS A;  4AYB B;  1GUW A;  1MI2 A;  1LT6 D;  1SYC A;  4H13 C;  5IGC A;  4C3H B;  2A6H D;  3DUZ A;  2F0M A;  3HGB A;  4NKL A;  4EGV A;  4DK1 A;  2LY7 A;  1I6H B;  1O78 A;  1LTB D;  5I6W A;  3K5M A;  3C3L A;  4Q0F A;  5C4Z A;  2B63 B;  1VDZ A;  3H3V C;  2JP1 A;  3RLF A;  1MGS A;  3BS1 A;  1TII D;  1E2W A;  2MPM A;  1KAA A;  1OXX K;  4LMQ D;  3NUC A;  4XQQ A;  4IUP A;  1SBB B;  5IOC A;  4KHZ A;  1J9O A;  1RJT A;  3PUZ A;  5KYI A;  1DOK A;  4I7Z C;  3V2T A;  2F0G A;  2F0N A;  1TR5 A;  3VA5 A;  2KOL A;  3SK8 A;  1CT1 D;  2E74 C;  1TS4 A;  3S2D B;  4BBS B;  2A68 C;  5AFW A;  3S14 B;  2JA5 B;  4K2L A;  4KKT A;  2O5J C;  5HGT A;  2TSS A;  4ZRZ A;  1WTO A;  1HTL D;  3IFT A;  4ZQ3 A;  2WKC A;  2XIW A;  1IW7 C;  3HZX A;  3RUZ A;  2NB0 A;  5C4J B;  3S1R B;  4K14 A;  1GUS A;  3ITP A;  1EQT A;  4PMW A;  1SDF A;  4MIU A;  3PUV A;  3N52 A;  1EY7 A;  4RCN A;  1V1P B;  3AMU A;  1EU4 A;  4ZK9 B;  4DA2 A;  1JQY D;  5KEE A;  2F0W A;  3D8G A;  5EJW A;  3X3N A;  1LTS D;  4XTC S;  4KK7 A;  2F0E A;  4X3T A;  1AN8 A;  1MSH A;  5A2Q E;  3PMF A;  5LL6 X;  3NSW A;  2B2T A;  3G7L A;  2OF1 A;  4FF1 A;  1HA6 A;  3D6C A;  1EYA A;  1LV9 A;  4F88 A;  1LLR D;  5T1G A;  4PQX A;  1SE2 A;  2F0I A;  4DAY A;  1FNW A;  1GUO A;  2D9U A;  5FO8 B;  2WIN B;  2CQA A;  3H91 A;  4KY7 A;  5FLX L;  1QOH A;  2NTS A;  2VB2 X;  1TWA B;  1G2T A;  3P20 A;  1T5E A;  2D2C C;  1STG A;  3GP7 A;  4ZYS A;  1SE3 A;  1XYI A;  1BCP B;  2L9H A;  3E0J A;  1JE4 A;  3K57 A;  4FXD A;  4TQU S;  4DN4 M;  2AUJ D;  1ZYR C;  2PQE A;  2R92 B;  1Y69 U;  1PRT B;  1XTC D;  1IW7 D;  2EYM A;  2WB1 B;  1B9M A;  1FD7 D;  2EY5 A;  2M9V A;  1LAB A;  1J8I A;  1ML0 D;  3I91 A;  4ILW A;  2E2J B;  5LL6 S;  3M4Y A;  4HCE A;  2A5H A;  1CZG A;  3M85 A;  4X3U A;  4KKS A;  3QIA A;  3BYY B;  3GTJ B;  5EPL A;  1ENC A;  2AWO A;  2BA0 A;  1PRT F;  1GUN A;  1F2M A;  4RHS A;  1Y8P B;  5LHY 1;  2VUM B;  1L0X B;  2F0Q A;  2CW0 D;  1FR3 A;  1VMP A;  1CHP D;  1Y8O B;  1U4P A;  2PMZ B;  1KDB A;  1NAP A;  4C56 C;  3T56 B;  3VR6 A;  3ONA B;  2IL8 A;  5COY A;  1QIL A;  3T53 B;  1PTO F;  3MZ5 A;  3WOE A;  2K5D A;  1GHJ A;  4FP5 D;  3GTO B;  1TWG B;  3RD4 A;  3ERQ A;  3KLS A;  2F0V A;  1K83 B;  2WV6 D;  2VNU D;  1H9S A;  3OSO A;  3NTK A;  5C3E B;  1HXY D;  2EOT A;  1ESR A;  4XDX A;  3IKJ A;  2ZT9 C;  3ND8 A;  1SNP A;  4BWG B;  3NP8 A;  2PYK A;  3HG9 A;  4QIW B;  4HR7 B;  4BS9 A;  3RZD B;  4B9X A;  5C5M A;  4XQN A;  2CVR A;  5EPJ A;  4HTH A;  1SNM A;  3GQB A;  1OXT A;  2FJ2 A;  1B2T A;  1KDA A;  3HOZ B;  1EWC A;  5T1I A;  2WII B;  3TZD A;  3MA2 B;  3DM1 A;  2ICE C;  5CV7 A;  2KA7 A;  2I46 A;  5DNF A;  2RDF A;  2XN9 C;  1JC7 A;  3A8I E;  1D1I A;  4R8N A;  4WFN 3;  2EVB A;  1QWY A;  5E1F A;  4BA1 I;  5K5P A;  4HMI A;  1XX8 A;  1PFB A;  2DY7 A;  1JWU D;  2KEC A;  3Q22 A;  1V1O A;  2KHS A;  1XXG A;  5D65 A;  3R3O A;  1ENA A;  1OXV A;  1BDO A;  5TSS A;  4L6T B;  3MXG A;  4X3S A;  2BE5 D;  3Q23 A;  3J7A F;  3SK6 A;  3D4W A;  4C3H G;  1LTG D;  1WCM B;  3P7J A;  2FMM A;  1D6E C;  2F0U A;  3PUY A;  3K0Y A;  3FPU B;  2G9H D;  4CHT B;  1GJX A;  3OWE B;  1SJH D;  1ET9 A;  2O5I C;  5IOD A;  2TMP A;  3NPP A;  1PTO D;  1GXD C;  2EE1 A;  1IL8 A;  2R7Z B;  5I4D A;  5CV4 A;  1F9S A;  4NDX A;  1HPC A;  5C4H A;  4FNF A;  5C6A A;  4LJZ C;  2OT2 A;  4F87 A;  5I6Y A;  4BA2 I;  5JVH 3;  2VB3 X;  3KUP A;  1JWS D;  1DON A;  3EJI A;  3J81 E;  1PRT C;  3BDC A;  2KUM A;  2PCF B;  4XQJ A;  4IAL A;  3IFD A;  1B44 D;  1Q8I A;  1SSO A;  3LWE A;  2RBM A;  2B2Y C;  1NR2 A;  1TWC B;  4H7B A;  4FO2 A;  3W2D A;  3OWF A;  1S5B D;  3QOL A;  3M4O B;  2NWG A;  2IT1 A;  1TY2 A;  1DOL A;  2KCC A;  3SE0 A;  5F2D A;  2EYJ A;  4M1U B;  1B9N A;  2IX1 A;  1SYD A;  1RF2 D;  5FO7 B;  1HHV A;  1DD2 A;  4QUC A;  2ID0 A;  2M2L A;  4X3K A;  1MBY A;  1VF7 A;  2F0K A;  1A3V A;  1IKM A;  5CV6 A;  5CBE E;  3DHQ A;  1TQO A;  1EY6 A;  2B2T C;  3JAM L;  5CV5 A;  5EPK A;  5E4W C;  3EQL C;  1HUN A;  1CQF A;  1R9T B;  1VCI A;  2B2W A;  1SNO A;  3V05 A;  3FRP B;  1AZQ A;  2WP8 J;  3K5L A;  1B1Z A;  2JE6 I;  1SFO B;  2IJ0 A;  1DZ1 A;  4XT1 B;  4K6D A;  1F9P A;  4GZY C;  3NXW A;  4PMB A;  1HRJ A;  3VR2 A;  2KCN A;  1HTP A;  2JA6 B;  3K58 A;  3OPO A;  1PFN A;  3FDT A;  5EKL A;  1JOK A;  3T4A C;  2WKD A;  2B8G A;  4R8I A;  5G3L D;  1GHK A;  2L11 A;  1HFN A;  4XT3 B;  3OIP A;  4A3D B;  3SVM A;  4ODG A;  4IQZ A;  1EOT A;  3F2U A;  5KND A;  1V1P A;  1SYF A;  1EFI D;  1TU2 B;  4MHE A;  5C44 B;  2F4I A;  1HQM C;  1I50 B;  4KI0 A;  4RCO A;  1F9Q A;  2NYZ D;  1QE6 A;  1CM9 A;  1WTV A;  4I65 A;  3MXP A;  5D14 A;  1QB5 D;  3EVQ A;  2ENB A;  4U68 A;  2NVT B;  1DM0 B;  1BF4 A;  3H94 A;  4E6I A;  4HN7 A;  1NUC A;  1Z47 A;  4KMU C;  3H0G B;  3SK4 A;  2BDN A;  1YNJ C;  3I3C A;  5ELF A;  3TP6 A;  3FEW X;  4S3S A;  1E2V A;  2XNA C;  2WAQ B;  1BO0 A;  4U67 3;  2RA4 A;  5I9P A;  3IL8 A;  4DXG A;  3PV0 A;  4KN4 C;  5FOB B;  1QNK A;  2F03 A;  2PZW A;  5BN3 A;  2JSO A;  4A3E B;  5CYU A;  2B8F A;  1FGB D;  3I4L A;  3TZU A;  4ZKB B;  1SE4 A;  2PNR C;  2JEA I;  5A2Q L;  1PFM A;  1PZJ D;  2RDG A;  2KJX A;  3C1F A;  3MFY A;  5ELC A;  1LAC A;  1AP0 A;  2PW7 A;  3I72 A;  4HAE A;  2FIN B;  2K33 A;  1FYC A;  4IFD J;  1QNU A;  2J7Z A;  5EKK A;  5CC4 A;  1D5X C;  1WTW A;  3IAY A;  1D1K A;  1H9S B;  4YIJ A;  3A7L A;  1VF5 C;  2FFK B;  3D31 A;  5FK9 C;  1E2Z A;  4C2M B;  3C2P A;  4WJW A;  3Q0A A;  1U4R A;  1ILQ A;  5IGG A;  1G91 A;  4RH6 A;  1Q90 A;  1UNS A;  3OMG A;  2XWB B;  3TP5 A;  1DYQ A;  2JXM B;  3CHB D;  4IUR A;  4B08 A;  1BCP D;  2E76 C;  2OXP A;  3P75 A;  4RHR A;  3HRZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...