3EVQA

Crystal structure of staphylococcal nuclease variant delta+phs l25e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKEMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal Structure of D+PHS L25E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3evqA00
5C5MA 1SNDA 1SNPA 1SYCA 1STNA 1A3VA 1U9RA 3H6MA 3TP6A 4DF7A 4F8MA 5CC4A 1EYCA 3T16A 5C3XA 2RDFA 2WACA 4EQOA 1AEXA 4F7XA 2EYMA 5K5PA 2SNSA 3NHHA 2OF1A 4K5WA 4G57A 3VA5A 1KABA 2F0VA 2PYKA 2F0QA 1F2MA 5CV6A 3SK8A 1EY0A 4KY5A 4KD3A 4KV6A 1ENAA 3OMGA 4B9XA 4K6DA 1STGA 4NMZA 3TP7A 1A2TA 4EVOA 4ID6A 5KGUA 1JORA 4K2KA 1EZ8A 2EY5A 3OMCA 3C1FA 3D6CA 4IUNA 4ZQ3A 3EJIA 4S3SA 5J1ZA 5J22A 5DEHA 1EY6A 4HMJA 2F0MA 3NP8A 4KY7A 3RUZA 1RKNA 4KHVA 5CV7A 5CV9A 3SR1A 1JOKA 1EY7A 1SYEA 2EYJA 2LKVA 4B9WA 3SXHA 5IGEA 2EYHA 2RKSA 2F0JA 1SYFA 2F0DA 5DAUA 3SHLA 3QOJA 4RKLA 1IHZA 4TRDA 3QOLA 3TMEA 5IGDA 1A3TA 4E6IA 5C5LA 1SNCA 4J6HA 4H7BA 1KDCA 2EY6A 3MEHA 5I6WA 3BDCA 3TP5A 1KDBA 3NK9A 4NDXA 3D8GA 3U9OA 1KAAA 4ODGA 1A2UA 2F0IA 3MHBA 4WORA 5IGBA 5KIXA 5I6YA 2O4XA 2F0KA 5IODA 1KDAA 5CV5A 5KYLA 5KYIA 1STAA 5E1FA 3SK4A 1TQOA 4QF4A 2M00A 3P75A 1STBA 4WRDA 4KTAA 1SNQA 5KEEA 4K8IA 5CV4A 3SK6A 1EY4A 2SNMA 1SYGA 1EYDA 4LAAA 5C6AA 3D4DA 2NUCA 3ITPA 3MZ5A 1TR5A 2F0SA 3ERQA 2F0UA 5IGGA 1EZ6A 5JAVA 3R3OA 4MIUA 1STYA 2F3VA 4K5XA 5IGFA 4PNYA 2F0OA 2EY1A 2F0FA 4J1MA 3QB3A 2F0EA 4KJNA 2PW7A 3DHQA 1A3UA 1F2YA 1EYAA 3EVQA 5HGTA 4KD4A 4DFAA 5I9OA 4NKLA 2EYOA 2EXZA 2SOBA 1SNMA 2EYPA 4ZUIA 1SYDA 5IIFA 2ENBA 1F2ZA 5J39A 1STHA 3BDLA 1JOQA 3MXPA 1EY9A 4DGZA 2QDBA 2OXPA 5EGTA 3NUCA 3HEJA 4K14A 2F3WA 4PMCA 5CR3A 2RBMA 4KJOA 5EKLA 4EQPA 5E3FA 5I9PA 4N9PA 1SNOA 2F0NA 2PQEA 3HZXA 2PZTA 5CGKA 4ZUJA 2KHSA 1SYBA 5JOBA 5ISRA 1EY5A 5EKKA 2F0GA 1TT2A 4NP5A 4YIJA 3EROA 3OWFA 2F0HA 4IZ8A 3MVVA 1ENCA 2OEOA 2F0PA 5HURA 1EY8A 2F0LA 4KY6A 4RKBA 2HQEA 3T13A 5IOCA 2F0TA 2PW5A 5F2DA 3DMUA 3PMFA 3NXWA 3LX0A 3OSOA 3D4WA 3E5SA 4DU9A 2EYFA 2PZUA 1NUCA 4ME5A 3S9WA 2PZWA 4K8JA 4N9TA 4R8NA 5NUCA 3TP8A 3C1EA 1NSNS 4K5VA 4I65A 4OL7A 3SK5A 1JOOA 4K2LA 4EQNA 5C4HA 5IGCA 1II3A 5KRUA 4HTHA 3NQTA 4QMGA 2F0WA 5CV8A 4PMBA 4QB4A 4HMIA 4IALA 2EYLA 1EQVA 3V2TA 5C3WA 5C4ZA 5M9OA 2KQ3A 3P1HA 2EY2A
chains in the Genus database with same CATH superfamily
3UE0A 1EWIA 1PTOB 3TQYA 3CPWA 1Y8NB 4HCEA 4EQOA 3S1MH 4JI5L 3FKIH 2Q8RE 4MZ9A 3H15A 1EIGA 1Q1EA 4RGNA 2GVAA 1AH9A 3PIPA 3K0XA 3D6WA 3BZKA 4KV6A 2UUCQ 3CCLA 4C3HB 1Y1VH 2JA8H 1PZID 3CCRA 1GXDC 4IUUA 3NPPA 1N33L 4M1UB 4LFBQ 1TXYA 3T1HL 2NVQB 4QY7A 1LACA 3KFUA 3R2TA 1IZ6A 1VQGA 5DM73 3PIOA 1Y69U 4V190 3BYTB 4LFCL 1K28A 1WOCA 4A3JH 1FNUA 1U0LA 4PZ6A 2A8VA 2B8GA 4L5SA 1YI2A 1KQSA 3D4RA 3P7JA 4X62L 3BDCA 1IKMA 4FXGC 4KKUA 4FF1A 4FP5D 3STBD 4A3IH 1NE3A 2Z1CA 2O4XA 4ZAIA 1BCPD 3CU7A 2DJFC 3QJYA 1HRJA 2Z9HA 1GJXA 2K1BA 3RNUA 4RAUC 1TWHB 2H4OA 1FVIA 3CCVA 3I4NH 2EE1A 2L11A 1DXMA 1FR3A 4LF7Q 2BH2A 3I91A 2F0SA 5JAVA 2KVMA 4NB3A 1X65A 4YWLA 2F0FA 1TWGB 1VQOA 4YY3Q 2KOLA 5C4JH 1I4RA 1C48A 5J39A 2VNUD 1PTOF 2NN6H 2JEAI 2QDBA 1H95A 2UU9L 1GVPA 4DV3L 1SROA 3Q23A 1UAPA 5I9PA 2ZXOA 4U673 2F4IA 4Y52H 1Y8OB 2K5VA 3MXNB 4OX9Q 1VQDA 1BOSA 1B2TA 2R92H 4BY7G 1VF7A 3NXWA 5LHY1 3LX0A 2Y0SE 2PZUA 4JI6L 1T9HA 2C5CA 5C4XB 1II3A 1PA6A 3S1NB 5C3WA 2O2LD 2VQEQ 3P1HA 1IW7C 1H9JA 3CC7A 1VQKA 1S5DD 3E9HA 4QIWB 5BR8Q 3A55A 1HZ9A 2IPKD 2RVLA 3OHXC 2N55A 4YCVA 2OTLA 2OQKA 1EIHA 4ZRZA 5GADC 4G57A 4P71A 3B6YA 4BXXG 1HCZA 4IUVA 3KDFB 1G6PA 3S14B 2D0PA 4ID6A 1WI5A 2RSNA 4DUYQ 3URYA 1J5EL 3L2PA 5KNDA 3M9BA 1KXLA 1HUNA 3NP8A 3SR1A 3NE5B 4LF9L 3OTOL 2LKVA 4HR7B 4C3IG 1YBYA 5DAUA 4YWMA 2G5DA 1IBLQ 2BDNA 1PRTB 2IW3A 1A3TA 3KJPA 5E4WC 4GS3A 1KDCA 1D1KA 4IUPA 1VQIA 4NXML 4L63B 4AIMA 3NTIA 1QNUA 1BCPC 4DR1Q 4B3ML 2UXCL 1V1OA 4DAVA 2O5JC 4GN4B 3ULJA 5H1SE 4LWCA 3Q0AA 3DWQA 4HSVA 3U58A 5JJIA 1RHPA 4P72A 1R9TB 1B1ZA 1TR5A 1WCMB 1XPRA 2EJMA 3QG1A 4CDCC 2EY1A 3D3RA 4J1MA 2HHHQ 5CBEE 4KKSA 4XQNA 3EVQA 3WOFA 1Q8KA 2KHIA 3CP0A 4ZUIA 4Y7NH 1CT1D 3GO5A 2JA8B 3U50C 1N36L 3HEJA 3G6JB 3CC4A 2NN6I 2NYZD 1LT4D 2JK8A 2F0NA 4UAIA 1WFQA 1SYBA 1X32A 2R3ZA 1RD9D 5CMDA 1IKLA 2WV6D 3HKZB 2J0TD 3TS2A 4GZYC 3T13A 2VB2X 4A3JB 4R4IA 5M5WB 5C3EG 2LXJA 4DV2Q 4DR4L 3NEMA 4DU9A 4GN3B 3S9WA 3G71A 1FJGQ 1DOMA 4HTHA 1IBKL 1PRTF 3EIVA 3VDYA 4EGVA 2UXBQ 4AYBE 3EBEA 3SVMA 2MO1A 4L5QA 3VYTA 5C3XA 3CQZB 4UY8C 3I4NB 1A0IA 3NTHA 1S5FD 4BXXH 1ET6A 3A8KE 4A3EG 2EVBA 2YTVA 1HQRD 1AE3A 4K6DA 5FLMG 3BS1A 2PO4A 1AZQA 2HIVA 2PPBC 3OMCA 5C4JB 1ZXTA 2UUCL 2RDHA 2Z6BA 4PZ8A 4ZYSA 1SFOH 4DN4M 1NY4A 2F3IA 1RTNA 1GUOA 1BF4A 5C44B 4LFBL 1PYSB 2AWOA 1K3RA 1XJVA 3QO2A 3CC2A 1QG7A 1EWHA 1VQ6A 4Q0FA 3PV0A 3U9OA 2F0IA 2YU9B 4N8FA 1FL0A 2Z6KC 1E1TA 1X3PA 1PH2A 1O80A 4IFDG 5CV5A 3JAML 5E1FA 3I70A 4CJ0B 2K33A 2L0CA 2OTJA 1HH2P 3FPUB 1JQYD 1CHPD 2CQAA 1E24A 3FP9A 1L1OB 4OHJA 3OWEB 2BA0A 4UP9A 4MIUA 1YHAA 3CF5A 3VR6A 4DK3C 5M5YB 4LF7L 3BDOA 1VQPA 1A3UA 1CA5A 3FMCA 1Z7TA 2EYOA 2EXZA 1SNMA 2EYPA 1C7YA 2Q2TA 5IIFA 1KNAA 1STHA 1GHJA 3J80c 4YY3L 5EGTA 1LT6D 2K28A 3IFTA 3HOYH 3G6EA 1YITA 1D5ZC 4BWGB 4IOCA 1SN8A 4OWTB 1HNXQ 4DXGA 1HJPA 1B8AA 2QGQA 2CQOA 4LW1A 1GUTA 4HEDA 1JR0D 5C3EH 1GOZA 5IOCA 2UXDQ 2Z4IA 1ESRA 3W1GA 3PUWA 2JA5B 1CKOA 1NUCA 1PTOC 1Q90A 4A3GH 2GN5A 2N3SA 4OX9L 4OL7A 3BYYB 1LTGD 2B39A 5DNFA 1DCZA 1Z9FA 3GTKH 2CW0C 1E1OA 1MJCA 2FINB 3KYHC 1IL2A 2Q8IB 5CC4A 3PO3B 1EYCA 1XNQL 4A3EH 5EBCA 2SNSA 3R2IA 4G7OC 1HXYD 5JEAJ 2F0QA 4X64Q 2RF4A 5BR8L 5FLMH 4HJAA 4GNXB 4P2CB 1XXGA 1N9WA 2FMMA 3TP7A 3HOXG 1A2TA 2M2LA 4DA2A 1DOLA 2WAQE 2IWHA 4C1NI 2FXQA 4IUQA 3GQBA 3H91A 3FPPA 2KJXA 1S5CD 4DUYL 2NVXH 1S5BD 3SXHA 2RKSA 1J8IA 1YVCA 2F0JA 4A76A 5G3LF 4JVZA 1XPUA 3OW7A 5LL6X 2CH4W 4FXDA 1V9PA 4GOPB 1WD1A 2EXDA 3H0GG 2E75C 4LNQA 5D3IB 1YNJD 1N33Q 2ASBA 4IFDH 1JB7A 2KEDA 5FOBB 3L0OA 2MO0A 4DAYA 5GAEC 3LNNA 1TS4A 1IYVA 1XWEA 1D5XC 2R7FA 2B2WA 3I8ZA 5EQ0A 4KJNA 4FYDA 3HOVB 1M8AA 2BE5D 2RA4A 2PQAA 1YZ6A 4L6TB 2ENBA 1V8QA 3F1ZA 3WWVA 1R4PB 1JOQA 2E2IH 1RL2A 1DM0B 2PMZB 4HN7A 5CR3A 1M90C 1LUZA 1VQ7A 4PMWA 3AU7A 2ZM6Q 4QGUA 4UDUC 1JWSD 2J4XA 2F0GA 1ZEQX 1K83H 1I5FA 1LTSD 3CAMA 2OEOA 1VQNA 3Q8DA 2XIWA 1PFBA 2EJGC 3BJUA 3D4WA 3PF5A 3FEWX 4K8JA 4N9TA 1I4QA 4ME3A 4KN4C 1VQLA 1B7YB 3K57A 3M7GA 4DR3Q 3V05A 2TMPA 4HJ9A 5JJZA 5JJLA 3T56B 4LF4L 1FJGL 3E6ZX 3TP6A 1KD1C 3UDXA 3I2ZA 1LTBD 1EWCA 2RDFA 3NWSA 1GUGA 1QZGA 4BBSG 3HOXH 2A73B 5COYA 1ICWA 3IFDA 3UDGA 2EDGA 1QZHA 1PRTC 1JORA 3VR4A 1EUJA 5EAYA 5J1ZA 1K9MC 2E2HH 1PHJA 3R8BA 5BN5A 2Q2IA 1IL8A 3J7AV 5E4XA 3J7YW 5IGEA 3HOYB 4C56C 1GM5A 2HD3A 1BBXC 3H0GH 4V0BA 4A93G 4DPGA 3M3YB 2VB3X 2JA7G 3D8GA 4XT1B 3OPOA 1X9NA 2UUAQ 3M7NA 5JVG3 4A3GB 3X3NA 4IFDI 4LF9Q 1ILQA 1GD7A 1HZAA 1RTOA 4IJHA 2D9UA 4KTAA 1RF2D 2IT1A 1B53A 2K5NA 3BVMA 3I4OA 4JBMA 4I7ZC 5ELOA 3S15H 4GN5A 3VR3A 2F03A 2F0OA 1TS2A 4ZKBB 4OO1G 2AWNA 2ZJRA 2WINB 4ZKCB 1QVCA 4OIKA 4NKLA 3T53B 5IT9E 1H9KA 3S1QH 2PNRC 3VR2A 1PZJD 4K14A 1JJ2A 3TZDA 5E3FA 1PH4A 4DR6Q 3A5UA 5C0XG 4XDXA 1OTCA 3EROA 3J81i 2VY3A 3GTMB 4JBKA 5FLXc 1G2TA 2HQEA 4C2MB 4WFN3 1F9SA 2RHQB 5TSSA 4DV5L 3S17H 1SMYD 3RZOB 3J81c 2UXDL 1QVGA 5FLXE 4CDDC 3GV3A 1CUKA 1JCKB 1TWAB 1NCVA 5C4ZA 3HP3A 4KK7A 4QIWE 3MA2B 1STNA 1VDZA 1HPCA 4IPHA 4R4QA 1PH6A 3UDFA 2F1MA 2OF1A 4BBSH 1L0YB 1F9QA 4X66Q 3SK8A 2KENA 1TWCB 2AKWB 2KUMA 2FFKB 3VYSA 5KGUA 4ULLA 5M3MB 1EZ8A 1W3SA 4ZQ3A 5JPNC 2IX0A 1F77A 4HMJA 4XXEA 2E2JH 3I4MB 2E2IB 3RUZA 4BBRG 3IAYA 2B2YC 2K14A 2RHSB 4DR7Q 4O42A 2N78A 4A93H 2YTYA 1BQQT 2JA7H 1TIID 1A8VA 4ILWA 2JA6B 1L1OC 1Q82C 4JBJA 3W1BA 1WVLA 4LF5L 1ASYA 1KAAA 2CWPA 1K3BC 1HA5A 5KYLA 5KYIA 2C35B 5FO7B 1WTXA 1EIFA 2K75A 1SJED 4ZCKA 4N8X1 3DM3A 4A4IA 1CM9A 1M1KC 3BZCA 4OELB 3ITPA 4PG3A 2GA4B 3TDQA 2KCMA 1EYGA 3GTPH 4P75A 4IJLA 1CZWA 3HOXB 2SOBA 2L55A 1WTRA 4B3SQ 2KEEA 4KI0A 1G51A 1GKHA 3GTJH 2B2UC 1LV9A 5E7NA 3PIP3 5C0XH 1CFMA 1ESFA 1TWFB 4EX5A 2FMCA 3CCUA 1CQVA 2ZM6L 4HIMA 1JE4A 1SMYC 1ET9A 3PIO3 2RSOA 3HOUG 3KF8A 3S2DH 1PH3A 1KIXA 3TP8A 4K5VA 5K36G 1PFNA 5C0XJ 2A68C 4B3RL 3K0YA 1CK1A 4ALPA 1WYDA 5ELEA 2Z0SA 4FNFA 5GQOA 4CGYB 4GNXC 4HIKA 3DEOA 2A6HC 3ND8A 5JPMC 4F8MA 4DF7A 3HOZG 4RCOA 4DR3L 3SGIA 1N34Q 4QCLA 2JN4A 2K6AA 1HHVA 5K5PA 3T1YQ 4K5WA 3K5MA 1NMFA 1SE2A 3D31A 1I6HH 4J15A 3HOWG 4A3FH 5GAHC 1ENAA 3ICEA 3NELA 1CKNA 1RCVD 4APVA 4GOPC 4L5RC 1QOHA 2OWOA 4S3SA 5DEHA 1X6OA 4BBRH 2H1EA 1XNQQ 3CMAA 1VQ9A 4JBWA 4RG1A 4UHVA 3G48A 4YHHQ 1G6ZA 2XRQD 4O1NA 1O7YA 4AYBG 4C3JG 3K8AA 1IHZA 2IHFA 5EKIA 1PYBA 3L9AX 3NTKA 1AZPA 3M4QA 2ZTCA 2Z6KA 1I3QH 1K8GA 1SNCA 4JOIC 1Y14B 2NZHA 1UUPA 5L37A 4DV1L 5T1IA 1CI3M 3NBHA 5IGBA 3QR8A 2AQ2B 4ZLTF 3OIPA 3KF6B 5IY0A 2WIIB 4LF6Q 2K5DA 4OWXB 2KA7A 1W6KA 4G4KA 4DV0Q 1SE3A 4QF4A 4BY1B 2UUAL 4UP8A 2N88A 2F4VQ 2EOTA 3SK6A 3I7FA 3H3VH 1SYGA 1HZBA 2E5LQ 4A3MG 2PCFB 2QEXA 4L8JA 3PQIA 1K73C 3GD7A 4RH6A 3STBC 1W6JA 3UDIA 2QA4A 5LMNQ 1EFWA 3CHBD 3KLRA 1E3PA 5LL6S 2K5QA 3DXJC 2OT2A 1S4ZA 3PGZA 1JICA 2I5HA 2PQEA 2XWJB 3HKSA 4LJZC 2KHSA 1F9PA 1XTDA 3TEHB 2QF7A 3ULLA 3MVVA 4F87A 3S1RH 4DR6L 4KHPL 4K0KQ 1AP0A 3HOUH 4A93B 4M8AA 5DM63 4J8QA 3S1MB 1NR4A 2VL6A 4K6LA 3FKIB 4DK6C 5K36H 1U4PA 1L2FA 4TQUS 5C4HA 1PH8A 3NBIA 2K05A 1Y1VB 2JP1A 2WP8J 2BCOA 3EFXD 3DUZA 3HOZH 1GHKA 3J81j 4XYOA 2UUBQ 1FNWA 1I4GA 3CCMA 4BY7H 1VQMA 1IBMQ 1YNND 3HOWH 4IUTA 3ULPA 2K4KA 3X3MA 4KY5A 1PH7A 1X3EA 3RMHA 5IE8A 2QW7A 3OOCA 3HFZB 2Q8TA 3LWUA 4X66L 4LF4Q 1AN8A 5JEAG 4A3IB 3DWPA 2PNHA 3GTJB 2F0MA 3M4YA 3ER0A 3T4AC 1D8LA 2NVYH 1B9NA 2F0DA 3SHLA 2A6ED 3QOJA 4TRDA 2CH4A 4FF3A 4E6IA 1Y8PB 4DNRB 1UE7A 2EY6A 3MEHA 4DR7L 3TP5A 1V1PB 3AFPA 5HGQA 1JWUD 1TVXA 5LMUQ 4Q5VA 3LGJA 3PUXA 5BN4A 1G291 1OXVA 2I46A 4OEMB 1VQBA 4JI2Q 1HFNA 1DYQA 2WAQG 4FF2A 1STBA 4C3IH 4K8IA 5CV4A 2R93G 4A3MH 3A7LA 1PXUA 3H3VI 5A35A 2F0UA 2K03A 3R3OA 3MXNA 4DNTB 4DAMA 3DLLA 4PNYA 3J80L 2WB1B 4XQQA 4CKEA 1KC8C 4R9WA 2ZJQA 1C9OA 2K32A 3DHQA 1I6HB 1PYWD 2B2VC 3ONAB 1F9RA 3GTOH 2R92B 4DKAC 4DAPA 2Y0SB 4A3FB 1B3AA 1TS5A 1SLJA 1VQJA 1CA6A 1SYDA 4JYAL 4JI3L 2EJFC 1EY9A 3K5NA 4QL5A 1S3OA 1D1IA 3MEFA 4B3SL 2ID0A 3AMUA 4BBRB 1I4HA 2QCPX 2L15A 3HZXA 1UE1A 5FO8B 1O7LA 1VMPA 4RWSC 4JG2A 5ISRA 2A19A 1TT2A 2HUGA 3R93A 2F0HA 1C4QA 1YNXA 4ABNA 1LYLA 4KY6A 4KMUC 4IN3A 2XVSA 2XTIA 3PMFA 2BOSA 2EPBA 1F2LA 3EA6A 1CSPA 3HG9A 4DXFA 3SK5A 1AE2A 3KDFA 5FO9B 2E76C 1I4PA 5I2XA 3VR5A 2O5IC 1YHBA 2KQ3A 1X3GA 2EY2A 1U9RA 4XTCS 1L0XB 1X56A 3T16A 1HNZQ 2WACA 2HQLA 1QNKA 4X3SA 3VA5A 4DV5Q 4HIOA 1N34L 1E2ZA 1EY0A 4FDBA 4MNOA 2D2CC 4XT3B 5J3BA 1ZKOA 3T1YL 2ICEC 5JEAH 3GTLH 2D62A 3QIAA 1FYCA 1QUQB 1C0AA 3A56A 1FGBD 1G2SA 3F8TA 4UP7A 1XNRQ 1RKNA 5CV7A 1ML0D 5CV9A 3CCQA 1MIUA 1Z47A 2EYHA 3CCSA 2JYOA 1B9MA 2DUDA 1V43A 2I07B 3TMEA 3S16H 3K5OA 4H02A 4YHHL 2IL8A 2C9OA 4KN7C 4C3HG 3DM1A 3JAME 5A2QL 5EPLA 1Y1WG 4RHSA 3GTGH 1X3FA 2B29A 3DWAA 2HCCA 3N52A 1BO0A 1STAA 5HY6A 1DOKA 4Y7NB 3CCEA 4WJ3M 2R93H 2VXWA 1VQCA 3A5ZB 2K7VA 5ELBA 4CBVA 4LF6L 5IYDG 4DUZQ 4OWWB 4DV0L 3MZ5A 2MP1A 5ELCA 4FF4A 4LF5Q 2F4VL 5JJKA 4NXNL 4IPCA 1SXTA 3SDZA 2EZVA 4BY7B 3HOWB 3K7AH 3T51B 2E5LL 1EYAA 5HGTA 3HRZC 2ZXPA 3KLSA 1IYJB 1EEID 1MJEA 1ZYRD 2YV5A 4X65Q 4R8IA 1VS0A 1EU4A 3F2BA 5KRUA 4EQPA 5LMNL 1RIPA 1VQ4A 4KHZA 1J6QA 2SEBD 1UWVA 4QUFA 4AYBB 3OWFA 1NAPA 1QJOA 4A75A 3PUZA 5EBDA 1VMCA 1H9RA 1X55A 1EU3A 1GUSA 2DY8A 3OSOA 4DNIA 2HCIA 5NUCA 4K0KL 1H9SB 1WJJA 4K2LA 3SE0A 2CCZA 4HJ5A 2R7DA 4GLXA 2VS1A 4JI8Q 4FXKC 5FK9C 3C46A 2A69D 4DK1A 1SFOB 3A74A 4C3IB 4BS9A 1CKMA 1PFMA 5D3DA 1MHWC 3TRZA 1BDOA 1F2MA 1KRTA 2UUBL 4B3RQ 1B4OA 4X6AH 5FKAC 4FO2A 3KBXA 1IBML 3EQLC 1SEBD 2HDLA 2B2YA 4KKTA 4LFAL 3M85A 3D6CA 4IUNA 3UI2A 1PTOH 2JXMB 4CJ1B 4DV7Q 4QUCA 1OXSC 2R61A 1L1OA 1YIJA 3QOLA 3AQQA 2PI2A 1EQQA 1CQFA 2KBNA 4JW0A 1MSHA 4HAEA 4C3HH 5I6WA 1Y1WH 2AQ1B 3K5LA 5IWAQ 1STEA 3MHBA 1BBWA 2ES2A 2NVQH 2F0KA 4CDFC 2JEBI 1WTOA 1TQOA 5ELFA 3P75A 3A54A 5LMUL 5KEEA 1T5EA 2Z8LA 1EY4A 2SNMA 5ELDA 4JI2L 2CFMA 1Q1BA 2NUCA 5IGGA 2IHEA 1TY2A 4DV1Q 1N32Q 1QVFA 1A63A 1YNJC 2H5XA 3HS0C 2F0EA 5C3EB 1YJWA 1XMOQ 2B2UA 1B70B 4C1NK 1HR0L 2LY7A 3BU2A 1MI2A 2OQ0A 3VA7A 1PH1A 3RD4A 1DD2A 4OIJA 1TWHH 5FLXL 1MGSA 2X6GA 2RBMA 1Z6HA 2KCTA 3N6RA 4N9PA 3GTKB 4A3KG 3OYYA 4ZUJA 2ALYB 1Q3LA 5JOBA 1SE4A 1S40A 4MTNA 1WCMG 3QWNA 3J81L 3MXGA 1TWGH 1EY8A 1V1QA 2B8FA 5IT9c 4RGTA 3S16B 4A3EB 2BE5C 2EIFA 4OGQC 3I55A 5BN3A 2NWGA 4GNXA 1PLFA 3Q24A 2AMCB 2AUKA 3E0JA 2JA8G 3GTGB 1XX8A 4IPDA 2A69C 1WTQA 4IALA 2EYLA 1EQVA 1VQHA 1GUNA 1I50H 5C5MA 4LUVA 4IPGA 5IP9G 4KHPQ 3RLNA 2R93B 5AJ3Q 1PH9A 2NTTA 2NVXB 3NHHA 2IJ0A 1SRUA 4RGMA 2ZTDA 1JC7A 1HNZL 2ICIA 4GOPA 1T5XD 3ZYYX 1HTPA 3S1NH 1GUWA 3EN2A 3I73A 5JVH3 1U4RA 1EY6A 4CKCA 1N8RC 1NTGA 2YTXA 1JOKA 2B2TC 4I7AA 3S24A 2DGYA 2ZT9C 1E7ZA 1LTRD 4JOIA 1EFID 3I4NG 3DEPA 1CHQD 4LF8L 3CKIB 1XNRL 4JV5Q 2CHBD 2D0OA 3S14H 5C5LA 4J6HA 4H7BA 1ILPA 4R4OA 3UE1A 5D65A 4LUOA 4JI1Q 1KDBA 1VQAA 3NK9A 1K8MA 3K58A 2DNCA 3TN2A 2I5MX 2B3GA 2VUMG 3F2CA 1I94Q 2M00A 2SDFA 2AUJD 5C44G 4A3BG 4OONA 4X3TA 1O7ZA 4LAAA 1Q7YC 2BDOA 4XYQA 1K83B 4K5XA 4P73A 5IP7G 4DR5Q 2MPMA 4DUZL 2NBFA 1XTCD 3RR5A 2A1AA 1F2ZA 2QILA 5DLQE 3C2PA 1BBUA 4A3KH 1R9TH 2PZTA 4TKOB 1WCMH 4X65L 1IW7D 1ENCA 2F0LA 4RKBA 1TS3A 4OO1H 5F2DA 3AYHB 2Z4HA 1WTPA 4JYAQ 3CPFA 4JI3Q 1DGSA 4R8NA 3I56A 1RODA 1Y1WB 3H3VC 4B08A 3AFQA 4RGOS 1PFSA 4DV4Q 4A3DG 1Q46A 4PMBA 3FVQA 5M9OA 5IP9H 4BA2I 2KCNA 2E2HB 1JJGA 1K8OA 3HKZE 5FJ8G 4OXPA 1A6XA 4JI8L 1E0BA 1LLRD 5M5WH 4AH6A 5D14A 4JPBW 1IYUA 5GAGC 1KABA 2JA5G 2PYKA 1FNVA 3H0GB 1YHQA 4B9XA 1QE6A 2WKCA 1SBBB 4EVOA 1XMQQ 4RHRA 4K2KA 1BNZA 3C1FA 3TBIB 1QWYA 2IX1A 2KECA 3CQZH 3G7LA 1I6VC 3PO3G 1EY7A 1SYEA 1RJTA 3HGBA 3Q6SA 5IYBG 4RA8A 4POFA 4TSSA 2LMCB 4DV7L 1A15A 5EJWA 3H09A 4TVAB 1LABA 3S15B 4L5TA 4FVMA 1FD7D 2BH8A 2E8GA 2VUMH 1EOTA 1CSQA 5IWAL 4EQ5A 5C44H 4A3BH 2QDLA 1EQRA 3CW2C 1P16A 1SNQA 3S1QB 1I50B 2OCEA 3KOJA 4DV6Q 2RDGA 4MTKA 1OXTA 5IP7H 2WB1E 2B2VA 2L12A 1WD0A 4GKKQ 1STYA 2DY7A 4G7ZC 2YU9H 2MNAA 5I9OA 4KD4A 4B3TQ 1JWMD 1UEBA 1N32L 2YYZA 2FHTA 3MXPA 3S17B 1XMOL 1LTAD 1U4MA 2KHJA 2DNEA 4CHTB 4PMCA 2F3WA 3VYUA 5M5XH 3WDNA 1SNOA 4JI0L 2PI2E 3Q22A 4NXNQ 1PMRA 1M4VA 1EY5A 1JJCB 1YEZA 4IZ8A 5M5YH 3MAQA 3OW2A 2F0PA 1B3QA 1JT8A 1PVOA 1D7QA 3HOVG 4BBSB 4OO1I 2JQOA 3RLFA 2I0QA 3PO2G 4A3DH 2E74C 2MQHA 3NQTA 1D5MC 1LTLA 1UE6A 2B63G 4QMGA 2F0WA 3U4VA 2VQFQ 4QJFA 2LFNA 4R1JA 5FJ8H 3MFGA 1WTVA 1SYCA 4H13C 2E2JB 5C0XI 3NQIA 4F7XA 2JA5H 2QEJC 1PDQA 1SMXA 1NNXA 1NR2A 5AJ3L 3IKJA 1JMCA 4KD3A 2JA7B 1HA6A 2EY5A 1K8AC 4NW2A 3NENA 3PO3H 3MWYW 4GKJQ 3LWEA 3W3AA 5IYBH 4A3KB 1O78A 4YCUA 4YWKA 1E2VA 4U68A 1UNSA 4DR2Q 1AW7A 1Q12A 5M3FG 1U5KA 3PSIA 2K01A 4JK1C 2XSCA 4LFAQ 4UPAA 4JV5L 4WORA 3GTPB 2XRSD 5KIXA 4O2DA 3S2HH 1KL9A 1KHIA 1KDAA 1SDFA 4JI1L 2X6LA 2L1BA 5KNBA 1HUMA 4WRDA 3HOYG 4LUZA 4C3JH 2L5TA 1E22A 3J7AF 1I94L 1W2BA 2G9HD 3I90A 1EZ6A 2MJ8A 3JC66 4HSPA 1MD2D 4GLAC 1Q81C 1QCBD 2R7ZG 3A7AB 1BVSA 1MBYA 1J9OA 3P20A 4DFAA 1U4LA 1LTID 1PTOD 4A3GG 3S2DB 4DR5L 1OO9B 4JC0A 2J7ZA 4HJ8A 1H9MA 2OXPA 1BKBA 4DAYB 3NUCA 4POGA 1KAWA 5EKLA 2ZXRA 3FRPB 1BR9A 3PUVA 1Q86C 1PZKD 2CW0D 3VYRA 4WJ4A 2AHOB 1ONLA 5EKKA 4NP5A 2A5HA 5HURA 1EIYB 1VF5C 3IRBA 3TZUA 3HOVH 1HR0Q 3DMUA 3MXUA 4ME5A 1B44D 3PO2H 1LM0A 2PQAB 1G8ZD 4X3UA 3F2DA 3BZDB 2B63H 4Z9CB 4EQNA 2R6GA 3U9SA 2PMZE 3A0JA 1NJIC 2VUMB 1SE8A 1WTWA 1NMGA 3J7ZC 4JI7Q 1EEFD 3MFYA 4CDEC 1UEAB 1CZGA 3M4PA 1SNDA 1SNPA 4A3BB 4DV4L 1HZCA 2DJGC 3K81C 3F2UA 1O7IA 2EYMA 1TY0A 2XNAC 4PZ7A 4JI4Q 3RN2A 3TS0A 2F0VA 2HDMA 1RDPD 1D6EC 4O0AA 2HIXA 1MKHA 3KBGA 2FJ2A 4AQYQ 1I3QB 1KNEA 3AB9A 2NVTH 5KNCA 3OIQA 4R4TA 3G4SA 1JE5A 1KLUD 4IOAA 3WOEA 3NSWA 2MGSA 2K04A 1XMQL 1D2BA 3KF6A 4KY7A 2K5HA 4KHVA 4P74A 5M5XB 3CMEA 1SYFA 1YNNC 4RKLA 1PH5A 2Q2HA 3J80i 5M3FH 4A3CG 3KJOA 3CRLC 2CWAA 5ELNA 4RCNA 4PV1C 3E0EA 4XIGS 1HNWQ 3PUYA 4HJ7A 1A2UA 5M3MG 5I6YA 3JAMi 1AFPA 4A3DB 2CKZB 1LO5D 3I4MG 3SK4A 2M9VA 2GVBA 4LF8Q 1XPOA 2A6EC 4IURA 1EL0A 1EYDA 4NPSA 3MTSA 1R4QB 3JAMc 3J80E 5LMNW 3M3YH 3M4OH 3ERQA 1VQEA 2K50A 2R7ZH 2JA6G 2IX3A 1TU2B 4DV6L 3NWTA 3S1RB 3QB3A 1MSGA 3HOUB 1CTMA 3E9IA 3C3LA 4GKKL 4RMFA 3GTQH 1DZ1A 4B3TL 4H0LC 1X54A 1UE5A 2LXKA 2IY5B 1KRSA 1SR3A 3HOZB 2VQEL 3PF4A 2I5LX 2WKDA 3O13A 1ASZA 4BA1I 1KTKA 3E3XA 2JA9A 1OXXK 5T1GA 2PW5A 2L9HA 3C1EA 3K6OA 1QILA 2NZ1D 1PRTD 3S2HB 5EPJA 1IXRA 3I3CA 4QB4A 4JI5Q 2PZWA 4MN3A 2E2DC 3GTMH 5AFWA 1BXTA 4C2MH 2VQFL 3RZDH 4C3JB 1AEXA 2NVYB 2CVRA 2QKIC 1IBLL 2ZJPA 1DONA 3RZOH 3T1HQ 3OMGA 3GP7A 3ERSX 4NMZA 3D0FA 1V1PA 3TREA 2V1CC 1K0RA 1TWAH 2B2TA 5J22A 3RN5A 4DR1L 4LFCQ 3KUPA 1FGUA 2MHVA 1VQ8A 1WTHA 4B9WA 2VW9A 2EYJA 2WFWA 4X62Q 2Q2UA 4A3CH 1GO3E 3CRKC 2KCCA 3ZJYC 4CJ2C 5IGDA 4GKJL 4A3MB 1S5ED 1EQTA 4IFDJ 1TWCH 5I2YA 2MFIA 3BVZA 1L0WA 5A2QE 1SAPA 5M3MH 4NDXA 1EOVA 3PO2B 1OXUA 2HHHL 5C4XG 4DR2L 3MC0B 4CKBA 3I4MH 2B63B 5IODA 3GTOB 1HR0W 5CYUA 2N8NA 3RLOA 2L4NA 4LMQD 5C6AA 3SEBA 1JB3A 1BCPB 2JA6H 2JE6I 5IGFA 3CD6A 1ENFA 3BG3A 2D5DA 2PW7A 2RCNA 4DK0A 4X3KA 4IQZA 2K5WA 2UU9Q 4A3LG 4DV3Q 1XYIA 4DV2L 3BVGA 3W5OA 2TSSA 3BDLA 2NVTB 3K80C 2LS01 4DGZA 2HT1A 3J7A5 4BY1G 2LSSA 5IT9L 1Q8IA 3ND9A 3AEVA 2RCFA 5IYDH 4RFBA 2ATWA 1P8LA 3W2DA 4YIJA 4HIDA 2VZAA 4JI6Q 2UXBL 2V4DA 3IL8A 4PQXA 1K0SA 2K52A 3FHWA 5M3FB 1QB5D 2XWBB 3E5SA 4HCSA 2EYFA 4KLKA 4WJWA 2N49A 4I65A 1ZYRC 4IO9A 3CCJA 4JI0Q 5GROA 3V96A 1YJ9A 3GTLB 1TWFH 3V2TA 1QUQA 4XQJA 3I4LA 1VCIA 5IYCG 2XGTA 2JSOA 2AQ3B 3GDEA 3L7ZC 1HFGA 1A3VA 3H6MA 1C8CA 1X3QA 3K7UC 4JI7L 5CBAE 3M4OB 1PV4A 3KF8B 3KLSX 4R4CA 5CV6A 2R7ZB 3FKIG 4GLVB 1S72A 1J5EQ 1KLGD 1STGA 4JI4L 1VQFA 3A8JE 1NBWA 3OTOQ 1Y1VG 3EJIA 4AQYL 3GTQB 1BCPF 2ZTEA 5CORA 2WAQB 2NTSA 4H44C 2A74C 2XN9C 5G3LD 3K59A 1SSOA 4JCVE 4NXMQ 3HKZG 4G7HC 4LK1C 4A3JG 4B3MQ 2G9DA 2UXCQ 1ICFB 3GV6A 1CKNB 5C4XH 2X69A 4ODGA 1E2WA 2EQSA 3K7AB 2BA1A 3KLWA 4A3IG 1G91A 1A62A 1HNWL 1DJRD 3L3OC 3CXCA 1YJNA 3U4ZA 3D4DA 2JJQA 3RZDB 1HNXL 2F3VA 4F88A 3KK7A 4A3LH 2DN8A 1F2YA 3NBHB 2B2WC 1N36Q 1HQMC 5EPKA 1TKWB 1HTLD 1LT5D 1B50A 4BY1H 1H9SA 2RQXA 3FDTA 1BUVT 1I4XA 2A68D 3I72A 2NN6G 2P5ZX 4KJOA 5CGKA 3J81E 2A6HD 2F52A 3PCOB 4DR4Q 2NZOA 1LTTD 4YCWA 3A8IE 1LT3D 4MHEA 2WB1G 2F0TA 1IBKQ 2R92G 2Y0SG 4A3FG 1NSNS 5IGCA 5I4DA 1JOOA 4X64L 3TSSA 5IYCH 5CV8A 4QQBX 2MUYA 4ZK9B 1VQ5A 1SJHD 4HMIA 2NB0A 3H94A
chains in the Genus database with same CATH topology
1PTOB 1Y8NB 4HCEA 4EQOA 2Q8RE 1EIGA 1Q1EA 4RGNA 3D6WA 4KV6A 4C3HB 1PZID 1GXDC 4IUUA 3NPPA 4M1UB 2NVQB 1LACA 3R2TA 5DM73 1Y69U 4V190 3BYTB 1FNUA 2B8GA 3D4RA 3P7JA 3BDCA 1IKMA 4FXGC 4KKUA 4FF1A 4FP5D 2Z1CA 2O4XA 4ZAIA 1BCPD 3CU7A 3QJYA 1HRJA 1GJXA 2K1BA 4RAUC 1TWHB 2H4OA 2EE1A 2L11A 1DXMA 1FR3A 3I91A 2F0SA 5JAVA 2KVMA 2F0FA 1TWGB 2KOLA 1I4RA 1C48A 5J39A 2VNUD 1PTOF 2NN6H 2JEAI 2QDBA 3Q23A 1UAPA 5I9PA 2ZXOA 4U673 2F4IA 1Y8OB 1BOSA 1B2TA 1VF7A 3NXWA 5LHY1 3LX0A 2PZUA 2C5CA 5C4XB 1II3A 3S1NB 5C3WA 2O2LD 3P1HA 1IW7C 1H9JA 1S5DD 4QIWB 3A55A 2RVLA 2IPKD 3OHXC 2N55A 1EIHA 4ZRZA 4G57A 1HCZA 4IUVA 3S14B 4ID6A 2RSNA 3URYA 5KNDA 1HUNA 3NP8A 3SR1A 3NE5B 2LKVA 4HR7B 4C3IG 5DAUA 2BDNA 1PRTB 2IW3A 1A3TA 5E4WC 1KDCA 1D1KA 4IUPA 4L63B 3NTIA 1QNUA 1BCPC 1V1OA 4DAVA 2O5JC 3Q0AA 3DWQA 4HSVA 1RHPA 1R9TB 1B1ZA 1TR5A 1WCMB 2EJMA 3QG1A 2EY1A 3D3RA 4J1MA 5CBEE 4KKSA 4XQNA 3EVQA 3WOFA 4ZUIA 1CT1D 3GO5A 2JA8B 3G6JB 3HEJA 2NN6I 2NYZD 1LT4D 2F0NA 4UAIA 1SYBA 1X32A 2R3ZA 1RD9D 5CMDA 1IKLA 2WV6D 3HKZB 2J0TD 4GZYC 3T13A 2VB2X 4A3JB 5M5WB 4DU9A 3S9WA 1DOMA 4HTHA 1PRTF 4EGVA 3SVMA 3VYTA 5C3XA 3CQZB 3I4NB 3NTHA 1S5FD 1ET6A 3A8KE 2EVBA 1HQRD 4K6DA 3BS1A 2PO4A 1AZQA 2PPBC 3OMCA 5C4JB 1ZXTA 2RDHA 4ZYSA 4DN4M 1RTNA 1GUOA 1BF4A 5C44B 2AWOA 3QO2A 1QG7A 1EWHA 4Q0FA 3PV0A 3U9OA 2F0IA 2YU9B 1X3PA 1O80A 4IFDG 5CV5A 3JAML 5E1FA 3I70A 4CJ0B 2K33A 2L0CA 1JQYD 3FPUB 1CHPD 2CQAA 4OHJA 3OWEB 2BA0A 4MIUA 3VR6A 5M5YB 3BDOA 1A3UA 1CA5A 3FMCA 1Z7TA 2EYOA 2EXZA 1SNMA 2EYPA 5IIFA 1KNAA 1STHA 1GHJA 5EGTA 1LT6D 2K28A 3IFTA 1D5ZC 4BWGB 4DXGA 1GUTA 4HEDA 1JR0D 1GOZA 5IOCA 2Z4IA 1ESRA 3PUWA 2JA5B 1NUCA 1PTOC 1Q90A 4OL7A 3BYYB 1LTGD 2B39A 5DNFA 1DCZA 2CW0C 2FINB 2Q8IB 5CC4A 3PO3B 1EYCA 5EBCA 2SNSA 3R2IA 4G7OC 1HXYD 5JEAJ 2F0QA 4P2CB 1XXGA 2FMMA 3TP7A 1A2TA 2M2LA 4DA2A 1DOLA 2IWHA 4C1NI 4IUQA 3GQBA 3H91A 3FPPA 2KJXA 1S5CD 1S5BD 3SXHA 2RKSA 1J8IA 2F0JA 5G3LF 3OW7A 5LL6X 4FXDA 1WD1A 2E75C 5D3IB 1YNJD 4IFDH 2KEDA 5FOBB 4DAYA 3LNNA 1TS4A 1IYVA 1XWEA 1D5XC 2B2WA 3I8ZA 5EQ0A 4KJNA 4FYDA 3HOVB 1M8AA 2BE5D 2RA4A 4L6TB 2ENBA 1V8QA 1R4PB 1JOQA 1DM0B 2PMZB 4HN7A 5CR3A 4PMWA 3AU7A 4UDUC 1JWSD 2J4XA 2F0GA 1ZEQX 1LTSD 2OEOA 2XIWA 1PFBA 2EJGC 3D4WA 3FEWX 4K8JA 4N9TA 1I4QA 4KN4C 3K57A 3M7GA 3V05A 2TMPA 5JJZA 3T56B 3E6ZX 3TP6A 1LTBD 1EWCA 2RDFA 3NWSA 1GUGA 2A73B 5COYA 1ICWA 3IFDA 2EDGA 1PRTC 1JORA 3VR4A 5J1ZA 3R8BA 5BN5A 1IL8A 3J7AV 5E4XA 3J7YW 5IGEA 3HOYB 4C56C 1BBXC 4V0BA 3M3YB 2VB3X 3D8GA 4XT1B 3OPOA 3M7NA 5JVG3 4A3GB 3X3NA 4IFDI 1ILQA 1RTOA 2D9UA 4KTAA 1RF2D 2IT1A 1B53A 3BVMA 4I7ZC 3VR3A 2F03A 2F0OA 1TS2A 4ZKBB 4OO1G 2AWNA 2WINB 4ZKCB 4OIKA 4NKLA 3T53B 5IT9E 1H9KA 2PNRC 3VR2A 1PZJD 4K14A 3TZDA 5E3FA 5C0XG 4XDXA 3EROA 3GTMB 1G2TA 2HQEA 4C2MB 4WFN3 1F9SA 5TSSA 1SMYD 3RZOB 5FLXE 3GV3A 1JCKB 1TWAB 1NCVA 5C4ZA 3HP3A 4KK7A 3MA2B 1STNA 1VDZA 1HPCA 2F1MA 2OF1A 1L0YB 1F9QA 3SK8A 1TWCB 2KUMA 2FFKB 3VYSA 5KGUA 4ULLA 5M3MB 1EZ8A 4ZQ3A 5JPNC 2IX0A 1F77A 4HMJA 4XXEA 3I4MB 2E2IB 3RUZA 3IAYA 2B2YC 4O42A 1BQQT 1TIID 4ILWA 2JA6B 1WVLA 1KAAA 1HA5A 5KYLA 5KYIA 5FO7B 1WTXA 1SJED 1CM9A 3ITPA 2GA4B 3TDQA 1CZWA 3HOXB 2SOBA 2L55A 1WTRA 2KEEA 4KI0A 2B2UC 1LV9A 3PIP3 5C0XH 1CFMA 1ESFA 1TWFB 2FMCA 1CQVA 1JE4A 1SMYC 1ET9A 3PIO3 2RSOA 3KF8A 3TP8A 4K5VA 5K36G 1PFNA 5C0XJ 2A68C 3K0YA 1CK1A 5ELEA 4FNFA 4CGYB 3DEOA 2A6HC 3ND8A 5JPMC 4F8MA 4DF7A 4RCOA 4QCLA 2K6AA 1HHVA 5K5PA 4K5WA 3K5MA 1SE2A 3D31A 1ENAA 1RCVD 1QOHA 4S3SA 5DEHA 2H1EA 4JBWA 1G6ZA 2XRQD 4O1NA 1O7YA 4C3JG 1IHZA 5EKIA 3L9AX 3NTKA 1AZPA 1SNCA 1UUPA 5T1IA 1CI3M 3NBHA 5IGBA 2AQ2B 4ZLTF 3OIPA 2WIIB 2K5DA 2KA7A 1W6KA 4G4KA 4BY1B 1SE3A 4QF4A 2N88A 2EOTA 3SK6A 1SYGA 2PCFB 4L8JA 3GD7A 4RH6A 1W6JA 3CHBD 3KLRA 5LL6S 2K5QA 3DXJC 2OT2A 1S4ZA 1JICA 2PQEA 2XWJB 4LJZC 2KHSA 1F9PA 2QF7A 3MVVA 4F87A 1AP0A 4A93B 4M8AA 5DM63 4J8QA 3S1MB 1NR4A 4K6LA 3FKIB 5K36H 1U4PA 4TQUS 5C4HA 3NBIA 2K05A 1Y1VB 2JP1A 2WP8J 2BCOA 3EFXD 3DUZA 1GHKA 4XYOA 1FNWA 1I4GA 1YNND 4IUTA 3X3MA 4KY5A 3RMHA 3OOCA 2Q8TA 3LWUA 1AN8A 5JEAG 4A3IB 3DWPA 3GTJB 2F0MA 3M4YA 3T4AC 1B9NA 2F0DA 3SHLA 2A6ED 3QOJA 4TRDA 4FF3A 4E6IA 1Y8PB 4DNRB 2EY6A 3MEHA 3TP5A 1V1PB 1JWUD 1TVXA 4Q5VA 3PUXA 5BN4A 1G291 1OXVA 2I46A 1HFNA 1DYQA 4FF2A 1STBA 4K8IA 5CV4A 3A7LA 1PXUA 5A35A 2F0UA 2K03A 3R3OA 3MXNA 4DNTB 4PNYA 3J80L 2WB1B 4XQQA 4CKEA 4R9WA 2K32A 3DHQA 1I6HB 1PYWD 2B2VC 3ONAB 1F9RA 2R92B 4DAPA 2Y0SB 4A3FB 1B3AA 1TS5A 1CA6A 1SYDA 2EJFC 1EY9A 3K5NA 1D1IA 2ID0A 3AMUA 4BBRB 1I4HA 2QCPX 3HZXA 5FO8B 4RWSC 1O7LA 1VMPA 5ISRA 1TT2A 2HUGA 3R93A 2F0HA 1C4QA 4ABNA 4KMUC 4KY6A 4IN3A 2XVSA 3PMFA 2BOSA 2EPBA 1F2LA 3EA6A 3HG9A 4DXFA 3SK5A 5FO9B 2E76C 1I4PA 5I2XA 3VR5A 2O5IC 2KQ3A 2EY2A 1U9RA 4XTCS 1L0XB 3T16A 2WACA 1QNKA 4X3SA 3VA5A 1E2ZA 1EY0A 2D2CC 4XT3B 1ZKOA 2ICEC 5JEAH 2D62A 3QIAA 1FYCA 3A56A 1FGBD 1G2SA 1RKNA 5CV7A 1ML0D 5CV9A 1Z47A 2EYHA 2JYOA 1B9MA 1V43A 2I07B 3TMEA 3K5OA 2IL8A 2C9OA 4KN7C 4C3HG 3DM1A 3JAME 5A2QL 5EPLA 4RHSA 3N52A 3DWAA 2HCCA 1BO0A 1STAA 1DOKA 4Y7NB 2VXWA 2K7VA 5ELBA 4CBVA 3MZ5A 2MP1A 5ELCA 4FF4A 1SXTA 3SDZA 2EZVA 4BY7B 3HOWB 3T51B 1EYAA 5HGTA 3HRZC 2ZXPA 3KLSA 1EEID 1ZYRD 4R8IA 1EU4A 5KRUA 4EQPA 4KHZA 2SEBD 4QUFA 4AYBB 3OWFA 1NAPA 1QJOA 3PUZA 5EBDA 1VMCA 1H9RA 1EU3A 1GUSA 2DY8A 3OSOA 2HCIA 5NUCA 1H9SB 4K2LA 3SE0A 4FXKC 5FK9C 3C46A 2A69D 4DK1A 1SFOB 4C3IB 4BS9A 1PFMA 5D3DA 1BDOA 1F2MA 1B4OA 5FKAC 4FO2A 3KBXA 3EQLC 1SEBD 2HDLA 2B2YA 4KKTA 3M85A 3D6CA 4IUNA 3UI2A 1PTOH 2JXMB 4CJ1B 4QUCA 1OXSC 2R61A 3QOLA 1CQFA 1MSHA 4HAEA 5I6WA 2AQ1B 3K5LA 1STEA 3MHBA 2F0KA 2JEBI 1WTOA 1TQOA 5ELFA 3P75A 3A54A 5KEEA 1T5EA 2Z8LA 1EY4A 2SNMA 5ELDA 1Q1BA 2NUCA 5IGGA 1TY2A 1YNJC 3HS0C 2F0EA 5C3EB 2B2UA 4C1NK 2LY7A 1MI2A 3VA7A 3RD4A 1DD2A 4OIJA 5FLXL 1MGSA 2X6GA 2RBMA 1Z6HA 3N6RA 4N9PA 3GTKB 4ZUJA 5JOBA 1Q3LA 1SE4A 3QWNA 3J81L 3MXGA 1EY8A 2B8FA 4RGTA 3S16B 4A3EB 2BE5C 4OGQC 5BN3A 2NWGA 1PLFA 3Q24A 2AUKA 3E0JA 3GTGB 1XX8A 2A69C 1WTQA 4IALA 2EYLA 1EQVA 1GUNA 5C5MA 2R93B 2NTTA 2NVXB 3NHHA 2IJ0A 4RGMA 1JC7A 2ICIA 1T5XD 3ZYYX 1HTPA 1GUWA 3I73A 5JVH3 1U4RA 1EY6A 4CKCA 1JOKA 2B2TC 2ZT9C 1LTRD 1EFID 3DEPA 1CHQD 3CKIB 2CHBD 5C5LA 4J6HA 4H7BA 1ILPA 5D65A 1KDBA 3NK9A 1K8MA 3K58A 2DNCA 3TN2A 2M00A 2SDFA 2AUJD 4X3TA 1O7ZA 4LAAA 2BDOA 4XYQA 1K83B 4K5XA 2MPMA 2NBFA 1XTCD 1F2ZA 2QILA 3C2PA 2PZTA 4TKOB 1IW7D 1ENCA 2F0LA 4RKBA 1TS3A 4OO1H 5F2DA 2Z4HA 1WTPA 4R8NA 1RODA 1Y1WB 3H3VC 4B08A 4RGOS 4PMBA 3FVQA 5M9OA 4BA2I 2KCNA 2E2HB 1K8OA 1A6XA 1E0BA 1LLRD 5D14A 1IYUA 1KABA 2PYKA 1FNVA 3H0GB 4B9XA 1QE6A 2WKCA 1SBBB 4EVOA 4RHRA 4K2KA 1BNZA 3C1FA 3TBIB 1QWYA 2IX1A 2KECA 3G7LA 1I6VC 1EY7A 1SYEA 1RJTA 3HGBA 3Q6SA 4RA8A 4TSSA 2LMCB 1A15A 5EJWA 3H09A 3S15B 1LABA 4FVMA 1FD7D 1EOTA 1SNQA 3S1QB 1I50B 2RDGA 1OXTA 2B2VA 2L12A 1WD0A 1STYA 2DY7A 4G7ZC 5I9OA 4KD4A 1JWMD 2YYZA 2FHTA 3MXPA 3S17B 1LTAD 1U4MA 2DNEA 4CHTB 4PMCA 2F3WA 3VYUA 3WDNA 1SNOA 3Q22A 1PMRA 1M4VA 1EY5A 4IZ8A 3MAQA 2F0PA 4BBSB 4OO1I 3RLFA 2E74C 3NQTA 1D5MC 4QMGA 2F0WA 2LFNA 3MFGA 1WTVA 1SYCA 4H13C 2E2JB 5C0XI 3NQIA 4F7XA 2QEJC 1PDQA 1NR2A 3IKJA 4KD3A 2JA7B 1HA6A 2EY5A 4NW2A 3MWYW 3LWEA 3W3AA 4A3KB 1O78A 1E2VA 4U68A 1UNSA 1AW7A 1Q12A 2K01A 4JK1C 2XSCA 4WORA 3GTPB 2XRSD 5KIXA 1KDAA 1SDFA 2X6LA 2L1BA 5KNBA 1HUMA 4WRDA 2L5TA 3J7AF 2G9HD 3I90A 1EZ6A 2MJ8A 4HSPA 1MD2D 1QCBD 3A7AB 1MBYA 1J9OA 3P20A 4DFAA 1U4LA 1LTID 1PTOD 3S2DB 1OO9B 2J7ZA 1H9MA 2OXPA 3NUCA 5EKLA 2ZXRA 3FRPB 1BR9A 3PUVA 1PZKD 2CW0D 3VYRA 1ONLA 5EKKA 4NP5A 2A5HA 5HURA 1VF5C 3TZUA 3DMUA 3MXUA 4ME5A 1B44D 1G8ZD 4X3UA 3BZDB 4Z9CB 4EQNA 2R6GA 3U9SA 2VUMB 1WTWA 1EEFD 3MFYA 1UEAB 1CZGA 1SNDA 1SNPA 4A3BB 3F2UA 2EYMA 1TY0A 2XNAC 2F0VA 2HDMA 1RDPD 1D6EC 3KBGA 2FJ2A 1I3QB 1KNEA 3AB9A 5KNCA 3OIQA 1KLUD 3WOEA 3NSWA 2MGSA 2K04A 1D2BA 4KY7A 4KHVA 5M5XB 1SYFA 1YNNC 4RKLA 3CRLC 4RCNA 4PV1C 4XIGS 3PUYA 1A2UA 5I6YA 1AFPA 4A3DB 1LO5D 3SK4A 2M9VA 2A6EC 4IURA 1EL0A 1EYDA 3MTSA 1R4QB 3J80E 3ERQA 2IX3A 1TU2B 3NWTA 3S1RB 3QB3A 1MSGA 3HOUB 1CTMA 3C3LA 1DZ1A 4H0LC 3HOZB 2WKDA 3O13A 4BA1I 1KTKA 1OXXK 5T1GA 2PW5A 2L9HA 3C1EA 3K6OA 1QILA 2NZ1D 1PRTD 3S2HB 5EPJA 3I3CA 4QB4A 2PZWA 4MN3A 2E2DC 5AFWA 1BXTA 4C3JB 1AEXA 2NVYB 2CVRA 2QKIC 1DONA 3OMGA 3GP7A 4NMZA 1V1PA 2B2TA 5J22A 3KUPA 2MHVA 4B9WA 2EYJA 3CRKC 2KCCA 4CJ2C 5IGDA 4A3MB 1S5ED 1EQTA 4IFDJ 5I2YA 3BVZA 5A2QE 1SAPA 4NDXA 3PO2B 1OXUA 3MC0B 4CKBA 2B63B 5IODA 3GTOB 5CYUA 2L4NA 4LMQD 5C6AA 3SEBA 1JB3A 1BCPB 2JE6I 5IGFA 1ENFA 3BG3A 2D5DA 2PW7A 4DK0A 4X3KA 4IQZA 2K5WA 1XYIA 3BVGA 2TSSA 3BDLA 2NVTB 2LS01 4DGZA 5IT9L 1Q8IA 3ND9A 4RFBA 3W2DA 4YIJA 2V4DA 3IL8A 4PQXA 5M3FB 1QB5D 2XWBB 3E5SA 4HCSA 2EYFA 4WJWA 4I65A 1ZYRC 3GTLB 3V96A 3V2TA 4XQJA 3I4LA 1VCIA 2JSOA 2AQ3B 3L7ZC 1HFGA 1A3VA 3H6MA 1C8CA 1X3QA 5CBAE 3M4OB 3KLSX 5CV6A 2R7ZB 1KLGD 1STGA 3A8JE 3EJIA 3GTQB 1BCPF 5CORA 2WAQB 2NTSA 4H44C 2A74C 2XN9C 5G3LD 3K59A 1SSOA 4G7HC 4LK1C 2G9DA 3GV6A 2X69A 4ODGA 1E2WA 3K7AB 2BA1A 1G91A 1DJRD 3L3OC 3D4DA 3RZDB 2F3VA 4F88A 3KK7A 2DN8A 1F2YA 2B2WC 1HQMC 5EPKA 1TKWB 1HTLD 1LT5D 1B50A 1H9SA 2RQXA 3FDTA 1BUVT 1I4XA 2A68D 3I72A 2NN6G 4KJOA 5CGKA 3J81E 2A6HD 1LTTD 3A8IE 1LT3D 4MHEA 2F0TA 1NSNS 5IGCA 5I4DA 1JOOA 3TSSA 5CV8A 2MUYA 4ZK9B 1SJHD 4HMIA 2NB0A 3H94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5M A;  1SND A;  1SNP A;  1SYC A;  1STN A;  1A3V A;  1U9R A;  3H6M A;  3TP6 A;  4DF7 A;  4F8M A;  5CC4 A;  1EYC A;  3T16 A;  5C3X A;  2RDF A;  2WAC A;  4EQO A;  1AEX A;  4F7X A;  2EYM A;  5K5P A;  2SNS A;  3NHH A;  2OF1 A;  4K5W A;  4G57 A;  3VA5 A;  1KAB A;  2F0V A;  2PYK A;  2F0Q A;  1F2M A;  5CV6 A;  3SK8 A;  1EY0 A;  4KY5 A;  4KD3 A;  4KV6 A;  1ENA A;  3OMG A;  4B9X A;  4K6D A;  1STG A;  4NMZ A;  3TP7 A;  1A2T A;  4EVO A;  4ID6 A;  5KGU A;  1JOR A;  4K2K A;  1EZ8 A;  2EY5 A;  3OMC A;  3C1F A;  3D6C A;  4IUN A;  4ZQ3 A;  3EJI A;  4S3S A;  5J1Z A;  5J22 A;  5DEH A;  1EY6 A;  4HMJ A;  2F0M A;  3NP8 A;  4KY7 A;  3RUZ A;  1RKN A;  4KHV A;  5CV7 A;  5CV9 A;  3SR1 A;  1JOK A;  1EY7 A;  1SYE A;  2EYJ A;  2LKV A;  4B9W A;  3SXH A;  5IGE A;  2EYH A;  2RKS A;  2F0J A;  1SYF A;  2F0D A;  5DAU A;  3SHL A;  3QOJ A;  4RKL A;  1IHZ A;  4TRD A;  3QOL A;  3TME A;  5IGD A;  1A3T A;  4E6I A;  5C5L A;  1SNC A;  4J6H A;  4H7B A;  1KDC A;  2EY6 A;  3MEH A;  5I6W A;  3BDC A;  3TP5 A;  1KDB A;  3NK9 A;  4NDX A;  3D8G A;  3U9O A;  1KAA A;  4ODG A;  1A2U A;  2F0I A;  3MHB A;  4WOR A;  5IGB A;  5KIX A;  5I6Y A;  2O4X A;  2F0K A;  5IOD A;  1KDA A;  5CV5 A;  5KYL A;  5KYI A;  1STA A;  5E1F A;  3SK4 A;  1TQO A;  4QF4 A;  2M00 A;  3P75 A;  1STB A;  4WRD A;  4KTA A;  1SNQ A;  5KEE A;  4K8I A;  5CV4 A;  3SK6 A;  1EY4 A;  2SNM A;  1SYG A;  1EYD A;  4LAA A;  5C6A A;  3D4D A;  2NUC A;  3ITP A;  3MZ5 A;  1TR5 A;  2F0S A;  3ERQ A;  2F0U A;  5IGG A;  1EZ6 A;  5JAV A;  3R3O A;  4MIU A;  1STY A;  2F3V A;  4K5X A;  5IGF A;  4PNY A;  2F0O A;  2EY1 A;  2F0F A;  4J1M A;  3QB3 A;  2F0E A;  4KJN A;  2PW7 A;  3DHQ A;  1A3U A;  1F2Y A;  1EYA A;  3EVQ A;  5HGT A;  4KD4 A;  4DFA A;  5I9O A;  4NKL A;  2EYO A;  2EXZ A;  2SOB A;  1SNM A;  2EYP A;  4ZUI A;  1SYD A;  5IIF A;  2ENB A;  1F2Z A;  5J39 A;  1STH A;  3BDL A;  1JOQ A;  3MXP A;  1EY9 A;  4DGZ A;  2QDB A;  2OXP A;  5EGT A;  3NUC A;  3HEJ A;  4K14 A;  2F3W A;  4PMC A;  5CR3 A;  2RBM A;  4KJO A;  5EKL A;  4EQP A;  5E3F A;  5I9P A;  4N9P A;  1SNO A;  2F0N A;  2PQE A;  3HZX A;  2PZT A;  5CGK A;  4ZUJ A;  2KHS A;  1SYB A;  5JOB A;  5ISR A;  1EY5 A;  5EKK A;  2F0G A;  1TT2 A;  4NP5 A;  4YIJ A;  3ERO A;  3OWF A;  2F0H A;  4IZ8 A;  3MVV A;  1ENC A;  2OEO A;  2F0P A;  5HUR A;  1EY8 A;  2F0L A;  4KY6 A;  4RKB A;  2HQE A;  3T13 A;  5IOC A;  2F0T A;  2PW5 A;  5F2D A;  3DMU A;  3PMF A;  3NXW A;  3LX0 A;  3OSO A;  3D4W A;  3E5S A;  4DU9 A;  2EYF A;  2PZU A;  1NUC A;  4ME5 A;  3S9W A;  2PZW A;  4K8J A;  4N9T A;  4R8N A;  5NUC A;  3TP8 A;  3C1E A;  1NSN S;  4K5V A;  4I65 A;  4OL7 A;  3SK5 A;  1JOO A;  4K2L A;  4EQN A;  5C4H A;  5IGC A;  1II3 A;  5KRU A;  4HTH A;  3NQT A;  4QMG A;  2F0W A;  5CV8 A;  4PMB A;  4QB4 A;  4HMI A;  4IAL A;  2EYL A;  1EQV A;  3V2T A;  5C3W A;  5C4Z A;  5M9O A;  2KQ3 A;  3P1H A;  2EY2 A; 
#chains in the Genus database with same CATH topology
 3UE0 A;  1EWI A;  1PTO B;  3TQY A;  3CPW A;  1Y8N B;  4HCE A;  4EQO A;  3S1M H;  4JI5 L;  3FKI H;  2Q8R E;  4MZ9 A;  3H15 A;  1EIG A;  1Q1E A;  4RGN A;  2GVA A;  1AH9 A;  3PIP A;  3K0X A;  3D6W A;  3BZK A;  4KV6 A;  2UUC Q;  3CCL A;  4C3H B;  1Y1V H;  2JA8 H;  1PZI D;  3CCR A;  1GXD C;  4IUU A;  3NPP A;  1N33 L;  4M1U B;  4LFB Q;  1TXY A;  3T1H L;  2NVQ B;  4QY7 A;  1LAC A;  3KFU A;  3R2T A;  1IZ6 A;  1VQG A;  5DM7 3;  3PIO A;  1Y69 U;  4V19 0;  3BYT B;  4LFC L;  1K28 A;  1WOC A;  4A3J H;  1FNU A;  1U0L A;  4PZ6 A;  2A8V A;  2B8G A;  4L5S A;  1YI2 A;  1KQS A;  3D4R A;  3P7J A;  4X62 L;  3BDC A;  1IKM A;  4FXG C;  4KKU A;  4FF1 A;  4FP5 D;  3STB D;  4A3I H;  1NE3 A;  2Z1C A;  2O4X A;  4ZAI A;  1BCP D;  3CU7 A;  2DJF C;  3QJY A;  1HRJ A;  2Z9H A;  1GJX A;  2K1B A;  3RNU A;  4RAU C;  1TWH B;  2H4O A;  1FVI A;  3CCV A;  3I4N H;  2EE1 A;  2L11 A;  1DXM A;  1FR3 A;  4LF7 Q;  2BH2 A;  3I91 A;  2F0S A;  5JAV A;  2KVM A;  4NB3 A;  1X65 A;  4YWL A;  2F0F A;  1TWG B;  1VQO A;  4YY3 Q;  2KOL A;  5C4J H;  1I4R A;  1C48 A;  5J39 A;  2VNU D;  1PTO F;  2NN6 H;  2JEA I;  2QDB A;  1H95 A;  2UU9 L;  1GVP A;  4DV3 L;  1SRO A;  3Q23 A;  1UAP A;  5I9P A;  2ZXO A;  4U67 3;  2F4I A;  4Y52 H;  1Y8O B;  2K5V A;  3MXN B;  4OX9 Q;  1VQD A;  1BOS A;  1B2T A;  2R92 H;  4BY7 G;  1VF7 A;  3NXW A;  5LHY 1;  3LX0 A;  2Y0S E;  2PZU A;  4JI6 L;  1T9H A;  2C5C A;  5C4X B;  1II3 A;  1PA6 A;  3S1N B;  5C3W A;  2O2L D;  2VQE Q;  3P1H A;  1IW7 C;  1H9J A;  3CC7 A;  1VQK A;  1S5D D;  3E9H A;  4QIW B;  5BR8 Q;  3A55 A;  1HZ9 A;  2IPK D;  2RVL A;  3OHX C;  2N55 A;  4YCV A;  2OTL A;  2OQK A;  1EIH A;  4ZRZ A;  5GAD C;  4G57 A;  4P71 A;  3B6Y A;  4BXX G;  1HCZ A;  4IUV A;  3KDF B;  1G6P A;  3S14 B;  2D0P A;  4ID6 A;  1WI5 A;  2RSN A;  4DUY Q;  3URY A;  1J5E L;  3L2P A;  5KND A;  3M9B A;  1KXL A;  1HUN A;  3NP8 A;  3SR1 A;  3NE5 B;  4LF9 L;  3OTO L;  2LKV A;  4HR7 B;  4C3I G;  1YBY A;  5DAU A;  4YWM A;  2G5D A;  1IBL Q;  2BDN A;  1PRT B;  2IW3 A;  1A3T A;  3KJP A;  5E4W C;  4GS3 A;  1KDC A;  1D1K A;  4IUP A;  1VQI A;  4NXM L;  4L63 B;  4AIM A;  3NTI A;  1QNU A;  1BCP C;  4DR1 Q;  4B3M L;  2UXC L;  1V1O A;  4DAV A;  2O5J C;  4GN4 B;  3ULJ A;  5H1S E;  4LWC A;  3Q0A A;  3DWQ A;  4HSV A;  3U58 A;  5JJI A;  1RHP A;  4P72 A;  1R9T B;  1B1Z A;  1TR5 A;  1WCM B;  1XPR A;  2EJM A;  3QG1 A;  4CDC C;  2EY1 A;  3D3R A;  4J1M A;  2HHH Q;  5CBE E;  4KKS A;  4XQN A;  3EVQ A;  3WOF A;  1Q8K A;  2KHI A;  3CP0 A;  4ZUI A;  4Y7N H;  1CT1 D;  3GO5 A;  2JA8 B;  3U50 C;  1N36 L;  3HEJ A;  3G6J B;  3CC4 A;  2NN6 I;  2NYZ D;  1LT4 D;  2JK8 A;  2F0N A;  4UAI A;  1WFQ A;  1SYB A;  1X32 A;  2R3Z A;  1RD9 D;  5CMD A;  1IKL A;  2WV6 D;  3HKZ B;  2J0T D;  3TS2 A;  4GZY C;  3T13 A;  2VB2 X;  4A3J B;  4R4I A;  5M5W B;  5C3E G;  2LXJ A;  4DV2 Q;  4DR4 L;  3NEM A;  4DU9 A;  4GN3 B;  3S9W A;  3G71 A;  1FJG Q;  1DOM A;  4HTH A;  1IBK L;  1PRT F;  3EIV A;  3VDY A;  4EGV A;  2UXB Q;  4AYB E;  3EBE A;  3SVM A;  2MO1 A;  4L5Q A;  3VYT A;  5C3X A;  3CQZ B;  4UY8 C;  3I4N B;  1A0I A;  3NTH A;  1S5F D;  4BXX H;  1ET6 A;  3A8K E;  4A3E G;  2EVB A;  2YTV A;  1HQR D;  1AE3 A;  4K6D A;  5FLM G;  3BS1 A;  2PO4 A;  1AZQ A;  2HIV A;  2PPB C;  3OMC A;  5C4J B;  1ZXT A;  2UUC L;  2RDH A;  2Z6B A;  4PZ8 A;  4ZYS A;  1SFO H;  4DN4 M;  1NY4 A;  2F3I A;  1RTN A;  1GUO A;  1BF4 A;  5C44 B;  4LFB L;  1PYS B;  2AWO A;  1K3R A;  1XJV A;  3QO2 A;  3CC2 A;  1QG7 A;  1EWH A;  1VQ6 A;  4Q0F A;  3PV0 A;  3U9O A;  2F0I A;  2YU9 B;  4N8F A;  1FL0 A;  2Z6K C;  1E1T A;  1X3P A;  1PH2 A;  1O80 A;  4IFD G;  5CV5 A;  3JAM L;  5E1F A;  3I70 A;  4CJ0 B;  2K33 A;  2L0C A;  2OTJ A;  1HH2 P;  3FPU B;  1JQY D;  1CHP D;  2CQA A;  1E24 A;  3FP9 A;  1L1O B;  4OHJ A;  3OWE B;  2BA0 A;  4UP9 A;  4MIU A;  1YHA A;  3CF5 A;  3VR6 A;  4DK3 C;  5M5Y B;  4LF7 L;  3BDO A;  1VQP A;  1A3U A;  1CA5 A;  3FMC A;  1Z7T A;  2EYO A;  2EXZ A;  1SNM A;  2EYP A;  1C7Y A;  2Q2T A;  5IIF A;  1KNA A;  1STH A;  1GHJ A;  3J80 c;  4YY3 L;  5EGT A;  1LT6 D;  2K28 A;  3IFT A;  3HOY H;  3G6E A;  1YIT A;  1D5Z C;  4BWG B;  4IOC A;  1SN8 A;  4OWT B;  1HNX Q;  4DXG A;  1HJP A;  1B8A A;  2QGQ A;  2CQO A;  4LW1 A;  1GUT A;  4HED A;  1JR0 D;  5C3E H;  1GOZ A;  5IOC A;  2UXD Q;  2Z4I A;  1ESR A;  3W1G A;  3PUW A;  2JA5 B;  1CKO A;  1NUC A;  1PTO C;  1Q90 A;  4A3G H;  2GN5 A;  2N3S A;  4OX9 L;  4OL7 A;  3BYY B;  1LTG D;  2B39 A;  5DNF A;  1DCZ A;  1Z9F A;  3GTK H;  2CW0 C;  1E1O A;  1MJC A;  2FIN B;  3KYH C;  1IL2 A;  2Q8I B;  5CC4 A;  3PO3 B;  1EYC A;  1XNQ L;  4A3E H;  5EBC A;  2SNS A;  3R2I A;  4G7O C;  1HXY D;  5JEA J;  2F0Q A;  4X64 Q;  2RF4 A;  5BR8 L;  5FLM H;  4HJA A;  4GNX B;  4P2C B;  1XXG A;  1N9W A;  2FMM A;  3TP7 A;  3HOX G;  1A2T A;  2M2L A;  4DA2 A;  1DOL A;  2WAQ E;  2IWH A;  4C1N I;  2FXQ A;  4IUQ A;  3GQB A;  3H91 A;  3FPP A;  2KJX A;  1S5C D;  4DUY L;  2NVX H;  1S5B D;  3SXH A;  2RKS A;  1J8I A;  1YVC A;  2F0J A;  4A76 A;  5G3L F;  4JVZ A;  1XPU A;  3OW7 A;  5LL6 X;  2CH4 W;  4FXD A;  1V9P A;  4GOP B;  1WD1 A;  2EXD A;  3H0G G;  2E75 C;  4LNQ A;  5D3I B;  1YNJ D;  1N33 Q;  2ASB A;  4IFD H;  1JB7 A;  2KED A;  5FOB B;  3L0O A;  2MO0 A;  4DAY A;  5GAE C;  3LNN A;  1TS4 A;  1IYV A;  1XWE A;  1D5X C;  2R7F A;  2B2W A;  3I8Z A;  5EQ0 A;  4KJN A;  4FYD A;  3HOV B;  1M8A A;  2BE5 D;  2RA4 A;  2PQA A;  1YZ6 A;  4L6T B;  2ENB A;  1V8Q A;  3F1Z A;  3WWV A;  1R4P B;  1JOQ A;  2E2I H;  1RL2 A;  1DM0 B;  2PMZ B;  4HN7 A;  5CR3 A;  1M90 C;  1LUZ A;  1VQ7 A;  4PMW A;  3AU7 A;  2ZM6 Q;  4QGU A;  4UDU C;  1JWS D;  2J4X A;  2F0G A;  1ZEQ X;  1K83 H;  1I5F A;  1LTS D;  3CAM A;  2OEO A;  1VQN A;  3Q8D A;  2XIW A;  1PFB A;  2EJG C;  3BJU A;  3D4W A;  3PF5 A;  3FEW X;  4K8J A;  4N9T A;  1I4Q A;  4ME3 A;  4KN4 C;  1VQL A;  1B7Y B;  3K57 A;  3M7G A;  4DR3 Q;  3V05 A;  2TMP A;  4HJ9 A;  5JJZ A;  5JJL A;  3T56 B;  4LF4 L;  1FJG L;  3E6Z X;  3TP6 A;  1KD1 C;  3UDX A;  3I2Z A;  1LTB D;  1EWC A;  2RDF A;  3NWS A;  1GUG A;  1QZG A;  4BBS G;  3HOX H;  2A73 B;  5COY A;  1ICW A;  3IFD A;  3UDG A;  2EDG A;  1QZH A;  1PRT C;  1JOR A;  3VR4 A;  1EUJ A;  5EAY A;  5J1Z A;  1K9M C;  2E2H H;  1PHJ A;  3R8B A;  5BN5 A;  2Q2I A;  1IL8 A;  3J7A V;  5E4X A;  3J7Y W;  5IGE A;  3HOY B;  4C56 C;  1GM5 A;  2HD3 A;  1BBX C;  3H0G H;  4V0B A;  4A93 G;  4DPG A;  3M3Y B;  2VB3 X;  2JA7 G;  3D8G A;  4XT1 B;  3OPO A;  1X9N A;  2UUA Q;  3M7N A;  5JVG 3;  4A3G B;  3X3N A;  4IFD I;  4LF9 Q;  1ILQ A;  1GD7 A;  1HZA A;  1RTO A;  4IJH A;  2D9U A;  4KTA A;  1RF2 D;  2IT1 A;  1B53 A;  2K5N A;  3BVM A;  3I4O A;  4JBM A;  4I7Z C;  5ELO A;  3S15 H;  4GN5 A;  3VR3 A;  2F03 A;  2F0O A;  1TS2 A;  4ZKB B;  4OO1 G;  2AWN A;  2ZJR A;  2WIN B;  4ZKC B;  1QVC A;  4OIK A;  4NKL A;  3T53 B;  5IT9 E;  1H9K A;  3S1Q H;  2PNR C;  3VR2 A;  1PZJ D;  4K14 A;  1JJ2 A;  3TZD A;  5E3F A;  1PH4 A;  4DR6 Q;  3A5U A;  5C0X G;  4XDX A;  1OTC A;  3ERO A;  3J81 i;  2VY3 A;  3GTM B;  4JBK A;  5FLX c;  1G2T A;  2HQE A;  4C2M B;  4WFN 3;  1F9S A;  2RHQ B;  5TSS A;  4DV5 L;  3S17 H;  1SMY D;  3RZO B;  3J81 c;  2UXD L;  1QVG A;  5FLX E;  4CDD C;  3GV3 A;  1CUK A;  1JCK B;  1TWA B;  1NCV A;  5C4Z A;  3HP3 A;  4KK7 A;  4QIW E;  3MA2 B;  1STN A;  1VDZ A;  1HPC A;  4IPH A;  4R4Q A;  1PH6 A;  3UDF A;  2F1M A;  2OF1 A;  4BBS H;  1L0Y B;  1F9Q A;  4X66 Q;  3SK8 A;  2KEN A;  1TWC B;  2AKW B;  2KUM A;  2FFK B;  3VYS A;  5KGU A;  4ULL A;  5M3M B;  1EZ8 A;  1W3S A;  4ZQ3 A;  5JPN C;  2IX0 A;  1F77 A;  4HMJ A;  4XXE A;  2E2J H;  3I4M B;  2E2I B;  3RUZ A;  4BBR G;  3IAY A;  2B2Y C;  2K14 A;  2RHS B;  4DR7 Q;  4O42 A;  2N78 A;  4A93 H;  2YTY A;  1BQQ T;  2JA7 H;  1TII D;  1A8V A;  4ILW A;  2JA6 B;  1L1O C;  1Q82 C;  4JBJ A;  3W1B A;  1WVL A;  4LF5 L;  1ASY A;  1KAA A;  2CWP A;  1K3B C;  1HA5 A;  5KYL A;  5KYI A;  2C35 B;  5FO7 B;  1WTX A;  1EIF A;  2K75 A;  1SJE D;  4ZCK A;  4N8X 1;  3DM3 A;  4A4I A;  1CM9 A;  1M1K C;  3BZC A;  4OEL B;  3ITP A;  4PG3 A;  2GA4 B;  3TDQ A;  2KCM A;  1EYG A;  3GTP H;  4P75 A;  4IJL A;  1CZW A;  3HOX B;  2SOB A;  2L55 A;  1WTR A;  4B3S Q;  2KEE A;  4KI0 A;  1G51 A;  1GKH A;  3GTJ H;  2B2U C;  1LV9 A;  5E7N A;  3PIP 3;  5C0X H;  1CFM A;  1ESF A;  1TWF B;  4EX5 A;  2FMC A;  3CCU A;  1CQV A;  2ZM6 L;  4HIM A;  1JE4 A;  1SMY C;  1ET9 A;  3PIO 3;  2RSO A;  3HOU G;  3KF8 A;  3S2D H;  1PH3 A;  1KIX A;  3TP8 A;  4K5V A;  5K36 G;  1PFN A;  5C0X J;  2A68 C;  4B3R L;  3K0Y A;  1CK1 A;  4ALP A;  1WYD A;  5ELE A;  2Z0S A;  4FNF A;  5GQO A;  4CGY B;  4GNX C;  4HIK A;  3DEO A;  2A6H C;  3ND8 A;  5JPM C;  4F8M A;  4DF7 A;  3HOZ G;  4RCO A;  4DR3 L;  3SGI A;  1N34 Q;  4QCL A;  2JN4 A;  2K6A A;  1HHV A;  5K5P A;  3T1Y Q;  4K5W A;  3K5M A;  1NMF A;  1SE2 A;  3D31 A;  1I6H H;  4J15 A;  3HOW G;  4A3F H;  5GAH C;  1ENA A;  3ICE A;  3NEL A;  1CKN A;  1RCV D;  4APV A;  4GOP C;  4L5R C;  1QOH A;  2OWO A;  4S3S A;  5DEH A;  1X6O A;  4BBR H;  2H1E A;  1XNQ Q;  3CMA A;  1VQ9 A;  4JBW A;  4RG1 A;  4UHV A;  3G48 A;  4YHH Q;  1G6Z A;  2XRQ D;  4O1N A;  1O7Y A;  4AYB G;  4C3J G;  3K8A A;  1IHZ A;  2IHF A;  5EKI A;  1PYB A;  3L9A X;  3NTK A;  1AZP A;  3M4Q A;  2ZTC A;  2Z6K A;  1I3Q H;  1K8G A;  1SNC A;  4JOI C;  1Y14 B;  2NZH A;  1UUP A;  5L37 A;  4DV1 L;  5T1I A;  1CI3 M;  3NBH A;  5IGB A;  3QR8 A;  2AQ2 B;  4ZLT F;  3OIP A;  3KF6 B;  5IY0 A;  2WII B;  4LF6 Q;  2K5D A;  4OWX B;  2KA7 A;  1W6K A;  4G4K A;  4DV0 Q;  1SE3 A;  4QF4 A;  4BY1 B;  2UUA L;  4UP8 A;  2N88 A;  2F4V Q;  2EOT A;  3SK6 A;  3I7F A;  3H3V H;  1SYG A;  1HZB A;  2E5L Q;  4A3M G;  2PCF B;  2QEX A;  4L8J A;  3PQI A;  1K73 C;  3GD7 A;  4RH6 A;  3STB C;  1W6J A;  3UDI A;  2QA4 A;  5LMN Q;  1EFW A;  3CHB D;  3KLR A;  1E3P A;  5LL6 S;  2K5Q A;  3DXJ C;  2OT2 A;  1S4Z A;  3PGZ A;  1JIC A;  2I5H A;  2PQE A;  2XWJ B;  3HKS A;  4LJZ C;  2KHS A;  1F9P A;  1XTD A;  3TEH B;  2QF7 A;  3ULL A;  3MVV A;  4F87 A;  3S1R H;  4DR6 L;  4KHP L;  4K0K Q;  1AP0 A;  3HOU H;  4A93 B;  4M8A A;  5DM6 3;  4J8Q A;  3S1M B;  1NR4 A;  2VL6 A;  4K6L A;  3FKI B;  4DK6 C;  5K36 H;  1U4P A;  1L2F A;  4TQU S;  5C4H A;  1PH8 A;  3NBI A;  2K05 A;  1Y1V B;  2JP1 A;  2WP8 J;  2BCO A;  3EFX D;  3DUZ A;  3HOZ H;  1GHK A;  3J81 j;  4XYO A;  2UUB Q;  1FNW A;  1I4G A;  3CCM A;  4BY7 H;  1VQM A;  1IBM Q;  1YNN D;  3HOW H;  4IUT A;  3ULP A;  2K4K A;  3X3M A;  4KY5 A;  1PH7 A;  1X3E A;  3RMH A;  5IE8 A;  2QW7 A;  3OOC A;  3HFZ B;  2Q8T A;  3LWU A;  4X66 L;  4LF4 Q;  1AN8 A;  5JEA G;  4A3I B;  3DWP A;  2PNH A;  3GTJ B;  2F0M A;  3M4Y A;  3ER0 A;  3T4A C;  1D8L A;  2NVY H;  1B9N A;  2F0D A;  3SHL A;  2A6E D;  3QOJ A;  4TRD A;  2CH4 A;  4FF3 A;  4E6I A;  1Y8P B;  4DNR B;  1UE7 A;  2EY6 A;  3MEH A;  4DR7 L;  3TP5 A;  1V1P B;  3AFP A;  5HGQ A;  1JWU D;  1TVX A;  5LMU Q;  4Q5V A;  3LGJ A;  3PUX A;  5BN4 A;  1G29 1;  1OXV A;  2I46 A;  4OEM B;  1VQB A;  4JI2 Q;  1HFN A;  1DYQ A;  2WAQ G;  4FF2 A;  1STB A;  4C3I H;  4K8I A;  5CV4 A;  2R93 G;  4A3M H;  3A7L A;  1PXU A;  3H3V I;  5A35 A;  2F0U A;  2K03 A;  3R3O A;  3MXN A;  4DNT B;  4DAM A;  3DLL A;  4PNY A;  3J80 L;  2WB1 B;  4XQQ A;  4CKE A;  1KC8 C;  4R9W A;  2ZJQ A;  1C9O A;  2K32 A;  3DHQ A;  1I6H B;  1PYW D;  2B2V C;  3ONA B;  1F9R A;  3GTO H;  2R92 B;  4DKA C;  4DAP A;  2Y0S B;  4A3F B;  1B3A A;  1TS5 A;  1SLJ A;  1VQJ A;  1CA6 A;  1SYD A;  4JYA L;  4JI3 L;  2EJF C;  1EY9 A;  3K5N A;  4QL5 A;  1S3O A;  1D1I A;  3MEF A;  4B3S L;  2ID0 A;  3AMU A;  4BBR B;  1I4H A;  2QCP X;  2L15 A;  3HZX A;  1UE1 A;  5FO8 B;  1O7L A;  1VMP A;  4RWS C;  4JG2 A;  5ISR A;  2A19 A;  1TT2 A;  2HUG A;  3R93 A;  2F0H A;  1C4Q A;  1YNX A;  4ABN A;  1LYL A;  4KY6 A;  4KMU C;  4IN3 A;  2XVS A;  2XTI A;  3PMF A;  2BOS A;  2EPB A;  1F2L A;  3EA6 A;  1CSP A;  3HG9 A;  4DXF A;  3SK5 A;  1AE2 A;  3KDF A;  5FO9 B;  2E76 C;  1I4P A;  5I2X A;  3VR5 A;  2O5I C;  1YHB A;  2KQ3 A;  1X3G A;  2EY2 A;  1U9R A;  4XTC S;  1L0X B;  1X56 A;  3T16 A;  1HNZ Q;  2WAC A;  2HQL A;  1QNK A;  4X3S A;  3VA5 A;  4DV5 Q;  4HIO A;  1N34 L;  1E2Z A;  1EY0 A;  4FDB A;  4MNO A;  2D2C C;  4XT3 B;  5J3B A;  1ZKO A;  3T1Y L;  2ICE C;  5JEA H;  3GTL H;  2D62 A;  3QIA A;  1FYC A;  1QUQ B;  1C0A A;  3A56 A;  1FGB D;  1G2S A;  3F8T A;  4UP7 A;  1XNR Q;  1RKN A;  5CV7 A;  1ML0 D;  5CV9 A;  3CCQ A;  1MIU A;  1Z47 A;  2EYH A;  3CCS A;  2JYO A;  1B9M A;  2DUD A;  1V43 A;  2I07 B;  3TME A;  3S16 H;  3K5O A;  4H02 A;  4YHH L;  2IL8 A;  2C9O A;  4KN7 C;  4C3H G;  3DM1 A;  3JAM E;  5A2Q L;  5EPL A;  1Y1W G;  4RHS A;  3GTG H;  1X3F A;  2B29 A;  3DWA A;  2HCC A;  3N52 A;  1BO0 A;  1STA A;  5HY6 A;  1DOK A;  4Y7N B;  3CCE A;  4WJ3 M;  2R93 H;  2VXW A;  1VQC A;  3A5Z B;  2K7V A;  5ELB A;  4CBV A;  4LF6 L;  5IYD G;  4DUZ Q;  4OWW B;  4DV0 L;  3MZ5 A;  2MP1 A;  5ELC A;  4FF4 A;  4LF5 Q;  2F4V L;  5JJK A;  4NXN L;  4IPC A;  1SXT A;  3SDZ A;  2EZV A;  4BY7 B;  3HOW B;  3K7A H;  3T51 B;  2E5L L;  1EYA A;  5HGT A;  3HRZ C;  2ZXP A;  3KLS A;  1IYJ B;  1EEI D;  1MJE A;  1ZYR D;  2YV5 A;  4X65 Q;  4R8I A;  1VS0 A;  1EU4 A;  3F2B A;  5KRU A;  4EQP A;  5LMN L;  1RIP A;  1VQ4 A;  4KHZ A;  1J6Q A;  2SEB D;  1UWV A;  4QUF A;  4AYB B;  3OWF A;  1NAP A;  1QJO A;  4A75 A;  3PUZ A;  5EBD A;  1VMC A;  1H9R A;  1X55 A;  1EU3 A;  1GUS A;  2DY8 A;  3OSO A;  4DNI A;  2HCI A;  5NUC A;  4K0K L;  1H9S B;  1WJJ A;  4K2L A;  3SE0 A;  2CCZ A;  4HJ5 A;  2R7D A;  4GLX A;  2VS1 A;  4JI8 Q;  4FXK C;  5FK9 C;  3C46 A;  2A69 D;  4DK1 A;  1SFO B;  3A74 A;  4C3I B;  4BS9 A;  1CKM A;  1PFM A;  5D3D A;  1MHW C;  3TRZ A;  1BDO A;  1F2M A;  1KRT A;  2UUB L;  4B3R Q;  1B4O A;  4X6A H;  5FKA C;  4FO2 A;  3KBX A;  1IBM L;  3EQL C;  1SEB D;  2HDL A;  2B2Y A;  4KKT A;  4LFA L;  3M85 A;  3D6C A;  4IUN A;  3UI2 A;  1PTO H;  2JXM B;  4CJ1 B;  4DV7 Q;  4QUC A;  1OXS C;  2R61 A;  1L1O A;  1YIJ A;  3QOL A;  3AQQ A;  2PI2 A;  1EQQ A;  1CQF A;  2KBN A;  4JW0 A;  1MSH A;  4HAE A;  4C3H H;  5I6W A;  1Y1W H;  2AQ1 B;  3K5L A;  5IWA Q;  1STE A;  3MHB A;  1BBW A;  2ES2 A;  2NVQ H;  2F0K A;  4CDF C;  2JEB I;  1WTO A;  1TQO A;  5ELF A;  3P75 A;  3A54 A;  5LMU L;  5KEE A;  1T5E A;  2Z8L A;  1EY4 A;  2SNM A;  5ELD A;  4JI2 L;  2CFM A;  1Q1B A;  2NUC A;  5IGG A;  2IHE A;  1TY2 A;  4DV1 Q;  1N32 Q;  1QVF A;  1A63 A;  1YNJ C;  2H5X A;  3HS0 C;  2F0E A;  5C3E B;  1YJW A;  1XMO Q;  2B2U A;  1B70 B;  4C1N K;  1HR0 L;  2LY7 A;  3BU2 A;  1MI2 A;  2OQ0 A;  3VA7 A;  1PH1 A;  3RD4 A;  1DD2 A;  4OIJ A;  1TWH H;  5FLX L;  1MGS A;  2X6G A;  2RBM A;  1Z6H A;  2KCT A;  3N6R A;  4N9P A;  3GTK B;  4A3K G;  3OYY A;  4ZUJ A;  2ALY B;  1Q3L A;  5JOB A;  1SE4 A;  1S40 A;  4MTN A;  1WCM G;  3QWN A;  3J81 L;  3MXG A;  1TWG H;  1EY8 A;  1V1Q A;  2B8F A;  5IT9 c;  4RGT A;  3S16 B;  4A3E B;  2BE5 C;  2EIF A;  4OGQ C;  3I55 A;  5BN3 A;  2NWG A;  4GNX A;  1PLF A;  3Q24 A;  2AMC B;  2AUK A;  3E0J A;  2JA8 G;  3GTG B;  1XX8 A;  4IPD A;  2A69 C;  1WTQ A;  4IAL A;  2EYL A;  1EQV A;  1VQH A;  1GUN A;  1I50 H;  5C5M A;  4LUV A;  4IPG A;  5IP9 G;  4KHP Q;  3RLN A;  2R93 B;  5AJ3 Q;  1PH9 A;  2NTT A;  2NVX B;  3NHH A;  2IJ0 A;  1SRU A;  4RGM A;  2ZTD A;  1JC7 A;  1HNZ L;  2ICI A;  4GOP A;  1T5X D;  3ZYY X;  1HTP A;  3S1N H;  1GUW A;  3EN2 A;  3I73 A;  5JVH 3;  1U4R A;  1EY6 A;  4CKC A;  1N8R C;  1NTG A;  2YTX A;  1JOK A;  2B2T C;  4I7A A;  3S24 A;  2DGY A;  2ZT9 C;  1E7Z A;  1LTR D;  4JOI A;  1EFI D;  3I4N G;  3DEP A;  1CHQ D;  4LF8 L;  3CKI B;  1XNR L;  4JV5 Q;  2CHB D;  2D0O A;  3S14 H;  5C5L A;  4J6H A;  4H7B A;  1ILP A;  4R4O A;  3UE1 A;  5D65 A;  4LUO A;  4JI1 Q;  1KDB A;  1VQA A;  3NK9 A;  1K8M A;  3K58 A;  2DNC A;  3TN2 A;  2I5M X;  2B3G A;  2VUM G;  3F2C A;  1I94 Q;  2M00 A;  2SDF A;  2AUJ D;  5C44 G;  4A3B G;  4OON A;  4X3T A;  1O7Z A;  4LAA A;  1Q7Y C;  2BDO A;  4XYQ A;  1K83 B;  4K5X A;  4P73 A;  5IP7 G;  4DR5 Q;  2MPM A;  4DUZ L;  2NBF A;  1XTC D;  3RR5 A;  2A1A A;  1F2Z A;  2QIL A;  5DLQ E;  3C2P A;  1BBU A;  4A3K H;  1R9T H;  2PZT A;  4TKO B;  1WCM H;  4X65 L;  1IW7 D;  1ENC A;  2F0L A;  4RKB A;  1TS3 A;  4OO1 H;  5F2D A;  3AYH B;  2Z4H A;  1WTP A;  4JYA Q;  3CPF A;  4JI3 Q;  1DGS A;  4R8N A;  3I56 A;  1ROD A;  1Y1W B;  3H3V C;  4B08 A;  3AFQ A;  4RGO S;  1PFS A;  4DV4 Q;  4A3D G;  1Q46 A;  4PMB A;  3FVQ A;  5M9O A;  5IP9 H;  4BA2 I;  2KCN A;  2E2H B;  1JJG A;  1K8O A;  3HKZ E;  5FJ8 G;  4OXP A;  1A6X A;  4JI8 L;  1E0B A;  1LLR D;  5M5W H;  4AH6 A;  5D14 A;  4JPB W;  1IYU A;  5GAG C;  1KAB A;  2JA5 G;  2PYK A;  1FNV A;  3H0G B;  1YHQ A;  4B9X A;  1QE6 A;  2WKC A;  1SBB B;  4EVO A;  1XMQ Q;  4RHR A;  4K2K A;  1BNZ A;  3C1F A;  3TBI B;  1QWY A;  2IX1 A;  2KEC A;  3CQZ H;  3G7L A;  1I6V C;  3PO3 G;  1EY7 A;  1SYE A;  1RJT A;  3HGB A;  3Q6S A;  5IYB G;  4RA8 A;  4POF A;  4TSS A;  2LMC B;  4DV7 L;  1A15 A;  5EJW A;  3H09 A;  4TVA B;  1LAB A;  3S15 B;  4L5T A;  4FVM A;  1FD7 D;  2BH8 A;  2E8G A;  2VUM H;  1EOT A;  1CSQ A;  5IWA L;  4EQ5 A;  5C44 H;  4A3B H;  2QDL A;  1EQR A;  3CW2 C;  1P16 A;  1SNQ A;  3S1Q B;  1I50 B;  2OCE A;  3KOJ A;  4DV6 Q;  2RDG A;  4MTK A;  1OXT A;  5IP7 H;  2WB1 E;  2B2V A;  2L12 A;  1WD0 A;  4GKK Q;  1STY A;  2DY7 A;  4G7Z C;  2YU9 H;  2MNA A;  5I9O A;  4KD4 A;  4B3T Q;  1JWM D;  1UEB A;  1N32 L;  2YYZ A;  2FHT A;  3MXP A;  3S17 B;  1XMO L;  1LTA D;  1U4M A;  2KHJ A;  2DNE A;  4CHT B;  4PMC A;  2F3W A;  3VYU A;  5M5X H;  3WDN A;  1SNO A;  4JI0 L;  2PI2 E;  3Q22 A;  4NXN Q;  1PMR A;  1M4V A;  1EY5 A;  1JJC B;  1YEZ A;  4IZ8 A;  5M5Y H;  3MAQ A;  3OW2 A;  2F0P A;  1B3Q A;  1JT8 A;  1PVO A;  1D7Q A;  3HOV G;  4BBS B;  4OO1 I;  2JQO A;  3RLF A;  2I0Q A;  3PO2 G;  4A3D H;  2E74 C;  2MQH A;  3NQT A;  1D5M C;  1LTL A;  1UE6 A;  2B63 G;  4QMG A;  2F0W A;  3U4V A;  2VQF Q;  4QJF A;  2LFN A;  4R1J A;  5FJ8 H;  3MFG A;  1WTV A;  1SYC A;  4H13 C;  2E2J B;  5C0X I;  3NQI A;  4F7X A;  2JA5 H;  2QEJ C;  1PDQ A;  1SMX A;  1NNX A;  1NR2 A;  5AJ3 L;  3IKJ A;  1JMC A;  4KD3 A;  2JA7 B;  1HA6 A;  2EY5 A;  1K8A C;  4NW2 A;  3NEN A;  3PO3 H;  3MWY W;  4GKJ Q;  3LWE A;  3W3A A;  5IYB H;  4A3K B;  1O78 A;  4YCU A;  4YWK A;  1E2V A;  4U68 A;  1UNS A;  4DR2 Q;  1AW7 A;  1Q12 A;  5M3F G;  1U5K A;  3PSI A;  2K01 A;  4JK1 C;  2XSC A;  4LFA Q;  4UPA A;  4JV5 L;  4WOR A;  3GTP B;  2XRS D;  5KIX A;  4O2D A;  3S2H H;  1KL9 A;  1KHI A;  1KDA A;  1SDF A;  4JI1 L;  2X6L A;  2L1B A;  5KNB A;  1HUM A;  4WRD A;  3HOY G;  4LUZ A;  4C3J H;  2L5T A;  1E22 A;  3J7A F;  1I94 L;  1W2B A;  2G9H D;  3I90 A;  1EZ6 A;  2MJ8 A;  3JC6 6;  4HSP A;  1MD2 D;  4GLA C;  1Q81 C;  1QCB D;  2R7Z G;  3A7A B;  1BVS A;  1MBY A;  1J9O A;  3P20 A;  4DFA A;  1U4L A;  1LTI D;  1PTO D;  4A3G G;  3S2D B;  4DR5 L;  1OO9 B;  4JC0 A;  2J7Z A;  4HJ8 A;  1H9M A;  2OXP A;  1BKB A;  4DAY B;  3NUC A;  4POG A;  1KAW A;  5EKL A;  2ZXR A;  3FRP B;  1BR9 A;  3PUV A;  1Q86 C;  1PZK D;  2CW0 D;  3VYR A;  4WJ4 A;  2AHO B;  1ONL A;  5EKK A;  4NP5 A;  2A5H A;  5HUR A;  1EIY B;  1VF5 C;  3IRB A;  3TZU A;  3HOV H;  1HR0 Q;  3DMU A;  3MXU A;  4ME5 A;  1B44 D;  3PO2 H;  1LM0 A;  2PQA B;  1G8Z D;  4X3U A;  3F2D A;  3BZD B;  2B63 H;  4Z9C B;  4EQN A;  2R6G A;  3U9S A;  2PMZ E;  3A0J A;  1NJI C;  2VUM B;  1SE8 A;  1WTW A;  1NMG A;  3J7Z C;  4JI7 Q;  1EEF D;  3MFY A;  4CDE C;  1UEA B;  1CZG A;  3M4P A;  1SND A;  1SNP A;  4A3B B;  4DV4 L;  1HZC A;  2DJG C;  3K81 C;  3F2U A;  1O7I A;  2EYM A;  1TY0 A;  2XNA C;  4PZ7 A;  4JI4 Q;  3RN2 A;  3TS0 A;  2F0V A;  2HDM A;  1RDP D;  1D6E C;  4O0A A;  2HIX A;  1MKH A;  3KBG A;  2FJ2 A;  4AQY Q;  1I3Q B;  1KNE A;  3AB9 A;  2NVT H;  5KNC A;  3OIQ A;  4R4T A;  3G4S A;  1JE5 A;  1KLU D;  4IOA A;  3WOE A;  3NSW A;  2MGS A;  2K04 A;  1XMQ L;  1D2B A;  3KF6 A;  4KY7 A;  2K5H A;  4KHV A;  4P74 A;  5M5X B;  3CME A;  1SYF A;  1YNN C;  4RKL A;  1PH5 A;  2Q2H A;  3J80 i;  5M3F H;  4A3C G;  3KJO A;  3CRL C;  2CWA A;  5ELN A;  4RCN A;  4PV1 C;  3E0E A;  4XIG S;  1HNW Q;  3PUY A;  4HJ7 A;  1A2U A;  5M3M G;  5I6Y A;  3JAM i;  1AFP A;  4A3D B;  2CKZ B;  1LO5 D;  3I4M G;  3SK4 A;  2M9V A;  2GVB A;  4LF8 Q;  1XPO A;  2A6E C;  4IUR A;  1EL0 A;  1EYD A;  4NPS A;  3MTS A;  1R4Q B;  3JAM c;  3J80 E;  5LMN W;  3M3Y H;  3M4O H;  3ERQ A;  1VQE A;  2K50 A;  2R7Z H;  2JA6 G;  2IX3 A;  1TU2 B;  4DV6 L;  3NWT A;  3S1R B;  3QB3 A;  1MSG A;  3HOU B;  1CTM A;  3E9I A;  3C3L A;  4GKK L;  4RMF A;  3GTQ H;  1DZ1 A;  4B3T L;  4H0L C;  1X54 A;  1UE5 A;  2LXK A;  2IY5 B;  1KRS A;  1SR3 A;  3HOZ B;  2VQE L;  3PF4 A;  2I5L X;  2WKD A;  3O13 A;  1ASZ A;  4BA1 I;  1KTK A;  3E3X A;  2JA9 A;  1OXX K;  5T1G A;  2PW5 A;  2L9H A;  3C1E A;  3K6O A;  1QIL A;  2NZ1 D;  1PRT D;  3S2H B;  5EPJ A;  1IXR A;  3I3C A;  4QB4 A;  4JI5 Q;  2PZW A;  4MN3 A;  2E2D C;  3GTM H;  5AFW A;  1BXT A;  4C2M H;  2VQF L;  3RZD H;  4C3J B;  1AEX A;  2NVY B;  2CVR A;  2QKI C;  1IBL L;  2ZJP A;  1DON A;  3RZO H;  3T1H Q;  3OMG A;  3GP7 A;  3ERS X;  4NMZ A;  3D0F A;  1V1P A;  3TRE A;  2V1C C;  1K0R A;  1TWA H;  2B2T A;  5J22 A;  3RN5 A;  4DR1 L;  4LFC Q;  3KUP A;  1FGU A;  2MHV A;  1VQ8 A;  1WTH A;  4B9W A;  2VW9 A;  2EYJ A;  2WFW A;  4X62 Q;  2Q2U A;  4A3C H;  1GO3 E;  3CRK C;  2KCC A;  3ZJY C;  4CJ2 C;  5IGD A;  4GKJ L;  4A3M B;  1S5E D;  1EQT A;  4IFD J;  1TWC H;  5I2Y A;  2MFI A;  3BVZ A;  1L0W A;  5A2Q E;  1SAP A;  5M3M H;  4NDX A;  1EOV A;  3PO2 B;  1OXU A;  2HHH L;  5C4X G;  4DR2 L;  3MC0 B;  4CKB A;  3I4M H;  2B63 B;  5IOD A;  3GTO B;  1HR0 W;  5CYU A;  2N8N A;  3RLO A;  2L4N A;  4LMQ D;  5C6A A;  3SEB A;  1JB3 A;  1BCP B;  2JA6 H;  2JE6 I;  5IGF A;  3CD6 A;  1ENF A;  3BG3 A;  2D5D A;  2PW7 A;  2RCN A;  4DK0 A;  4X3K A;  4IQZ A;  2K5W A;  2UU9 Q;  4A3L G;  4DV3 Q;  1XYI A;  4DV2 L;  3BVG A;  3W5O A;  2TSS A;  3BDL A;  2NVT B;  3K80 C;  2LS0 1;  4DGZ A;  2HT1 A;  3J7A 5;  4BY1 G;  2LSS A;  5IT9 L;  1Q8I A;  3ND9 A;  3AEV A;  2RCF A;  5IYD H;  4RFB A;  2ATW A;  1P8L A;  3W2D A;  4YIJ A;  4HID A;  2VZA A;  4JI6 Q;  2UXB L;  2V4D A;  3IL8 A;  4PQX A;  1K0S A;  2K52 A;  3FHW A;  5M3F B;  1QB5 D;  2XWB B;  3E5S A;  4HCS A;  2EYF A;  4KLK A;  4WJW A;  2N49 A;  4I65 A;  1ZYR C;  4IO9 A;  3CCJ A;  4JI0 Q;  5GRO A;  3V96 A;  1YJ9 A;  3GTL B;  1TWF H;  3V2T A;  1QUQ A;  4XQJ A;  3I4L A;  1VCI A;  5IYC G;  2XGT A;  2JSO A;  2AQ3 B;  3GDE A;  3L7Z C;  1HFG A;  1A3V A;  3H6M A;  1C8C A;  1X3Q A;  3K7U C;  4JI7 L;  5CBA E;  3M4O B;  1PV4 A;  3KF8 B;  3KLS X;  4R4C A;  5CV6 A;  2R7Z B;  3FKI G;  4GLV B;  1S72 A;  1J5E Q;  1KLG D;  1STG A;  4JI4 L;  1VQF A;  3A8J E;  1NBW A;  3OTO Q;  1Y1V G;  3EJI A;  4AQY L;  3GTQ B;  1BCP F;  2ZTE A;  5COR A;  2WAQ B;  2NTS A;  4H44 C;  2A74 C;  2XN9 C;  5G3L D;  3K59 A;  1SSO A;  4JCV E;  4NXM Q;  3HKZ G;  4G7H C;  4LK1 C;  4A3J G;  4B3M Q;  2G9D A;  2UXC Q;  1ICF B;  3GV6 A;  1CKN B;  5C4X H;  2X69 A;  4ODG A;  1E2W A;  2EQS A;  3K7A B;  2BA1 A;  3KLW A;  4A3I G;  1G91 A;  1A62 A;  1HNW L;  1DJR D;  3L3O C;  3CXC A;  1YJN A;  3U4Z A;  3D4D A;  2JJQ A;  3RZD B;  1HNX L;  2F3V A;  4F88 A;  3KK7 A;  4A3L H;  2DN8 A;  1F2Y A;  3NBH B;  2B2W C;  1N36 Q;  1HQM C;  5EPK A;  1TKW B;  1HTL D;  1LT5 D;  1B50 A;  4BY1 H;  1H9S A;  2RQX A;  3FDT A;  1BUV T;  1I4X A;  2A68 D;  3I72 A;  2NN6 G;  2P5Z X;  4KJO A;  5CGK A;  3J81 E;  2A6H D;  2F52 A;  3PCO B;  4DR4 Q;  2NZO A;  1LTT D;  4YCW A;  3A8I E;  1LT3 D;  4MHE A;  2WB1 G;  2F0T A;  1IBK Q;  2R92 G;  2Y0S G;  4A3F G;  1NSN S;  5IGC A;  5I4D A;  1JOO A;  4X64 L;  3TSS A;  5IYC H;  5CV8 A;  4QQB X;  2MUY A;  4ZK9 B;  1VQ5 A;  1SJH D;  4HMI A;  2NB0 A;  3H94 A; 
#chains in the Genus database with same CATH homology
 1PTO B;  1Y8N B;  4HCE A;  4EQO A;  2Q8R E;  1EIG A;  1Q1E A;  4RGN A;  3D6W A;  4KV6 A;  4C3H B;  1PZI D;  1GXD C;  4IUU A;  3NPP A;  4M1U B;  2NVQ B;  1LAC A;  3R2T A;  5DM7 3;  1Y69 U;  4V19 0;  3BYT B;  1FNU A;  2B8G A;  3D4R A;  3P7J A;  3BDC A;  1IKM A;  4FXG C;  4KKU A;  4FF1 A;  4FP5 D;  2Z1C A;  2O4X A;  4ZAI A;  1BCP D;  3CU7 A;  3QJY A;  1HRJ A;  1GJX A;  2K1B A;  4RAU C;  1TWH B;  2H4O A;  2EE1 A;  2L11 A;  1DXM A;  1FR3 A;  3I91 A;  2F0S A;  5JAV A;  2KVM A;  2F0F A;  1TWG B;  2KOL A;  1I4R A;  1C48 A;  5J39 A;  2VNU D;  1PTO F;  2NN6 H;  2JEA I;  2QDB A;  3Q23 A;  1UAP A;  5I9P A;  2ZXO A;  4U67 3;  2F4I A;  1Y8O B;  1BOS A;  1B2T A;  1VF7 A;  3NXW A;  5LHY 1;  3LX0 A;  2PZU A;  2C5C A;  5C4X B;  1II3 A;  3S1N B;  5C3W A;  2O2L D;  3P1H A;  1IW7 C;  1H9J A;  1S5D D;  4QIW B;  3A55 A;  2RVL A;  2IPK D;  3OHX C;  2N55 A;  1EIH A;  4ZRZ A;  4G57 A;  1HCZ A;  4IUV A;  3S14 B;  4ID6 A;  2RSN A;  3URY A;  5KND A;  1HUN A;  3NP8 A;  3SR1 A;  3NE5 B;  2LKV A;  4HR7 B;  4C3I G;  5DAU A;  2BDN A;  1PRT B;  2IW3 A;  1A3T A;  5E4W C;  1KDC A;  1D1K A;  4IUP A;  4L63 B;  3NTI A;  1QNU A;  1BCP C;  1V1O A;  4DAV A;  2O5J C;  3Q0A A;  3DWQ A;  4HSV A;  1RHP A;  1R9T B;  1B1Z A;  1TR5 A;  1WCM B;  2EJM A;  3QG1 A;  2EY1 A;  3D3R A;  4J1M A;  5CBE E;  4KKS A;  4XQN A;  3EVQ A;  3WOF A;  4ZUI A;  1CT1 D;  3GO5 A;  2JA8 B;  3G6J B;  3HEJ A;  2NN6 I;  2NYZ D;  1LT4 D;  2F0N A;  4UAI A;  1SYB A;  1X32 A;  2R3Z A;  1RD9 D;  5CMD A;  1IKL A;  2WV6 D;  3HKZ B;  2J0T D;  4GZY C;  3T13 A;  2VB2 X;  4A3J B;  5M5W B;  4DU9 A;  3S9W A;  1DOM A;  4HTH A;  1PRT F;  4EGV A;  3SVM A;  3VYT A;  5C3X A;  3CQZ B;  3I4N B;  3NTH A;  1S5F D;  1ET6 A;  3A8K E;  2EVB A;  1HQR D;  4K6D A;  3BS1 A;  2PO4 A;  1AZQ A;  2PPB C;  3OMC A;  5C4J B;  1ZXT A;  2RDH A;  4ZYS A;  4DN4 M;  1RTN A;  1GUO A;  1BF4 A;  5C44 B;  2AWO A;  3QO2 A;  1QG7 A;  1EWH A;  4Q0F A;  3PV0 A;  3U9O A;  2F0I A;  2YU9 B;  1X3P A;  1O80 A;  4IFD G;  5CV5 A;  3JAM L;  5E1F A;  3I70 A;  4CJ0 B;  2K33 A;  2L0C A;  1JQY D;  3FPU B;  1CHP D;  2CQA A;  4OHJ A;  3OWE B;  2BA0 A;  4MIU A;  3VR6 A;  5M5Y B;  3BDO A;  1A3U A;  1CA5 A;  3FMC A;  1Z7T A;  2EYO A;  2EXZ A;  1SNM A;  2EYP A;  5IIF A;  1KNA A;  1STH A;  1GHJ A;  5EGT A;  1LT6 D;  2K28 A;  3IFT A;  1D5Z C;  4BWG B;  4DXG A;  1GUT A;  4HED A;  1JR0 D;  1GOZ A;  5IOC A;  2Z4I A;  1ESR A;  3PUW A;  2JA5 B;  1NUC A;  1PTO C;  1Q90 A;  4OL7 A;  3BYY B;  1LTG D;  2B39 A;  5DNF A;  1DCZ A;  2CW0 C;  2FIN B;  2Q8I B;  5CC4 A;  3PO3 B;  1EYC A;  5EBC A;  2SNS A;  3R2I A;  4G7O C;  1HXY D;  5JEA J;  2F0Q A;  4P2C B;  1XXG A;  2FMM A;  3TP7 A;  1A2T A;  2M2L A;  4DA2 A;  1DOL A;  2IWH A;  4C1N I;  4IUQ A;  3GQB A;  3H91 A;  3FPP A;  2KJX A;  1S5C D;  1S5B D;  3SXH A;  2RKS A;  1J8I A;  2F0J A;  5G3L F;  3OW7 A;  5LL6 X;  4FXD A;  1WD1 A;  2E75 C;  5D3I B;  1YNJ D;  4IFD H;  2KED A;  5FOB B;  4DAY A;  3LNN A;  1TS4 A;  1IYV A;  1XWE A;  1D5X C;  2B2W A;  3I8Z A;  5EQ0 A;  4KJN A;  4FYD A;  3HOV B;  1M8A A;  2BE5 D;  2RA4 A;  4L6T B;  2ENB A;  1V8Q A;  1R4P B;  1JOQ A;  1DM0 B;  2PMZ B;  4HN7 A;  5CR3 A;  4PMW A;  3AU7 A;  4UDU C;  1JWS D;  2J4X A;  2F0G A;  1ZEQ X;  1LTS D;  2OEO A;  2XIW A;  1PFB A;  2EJG C;  3D4W A;  3FEW X;  4K8J A;  4N9T A;  1I4Q A;  4KN4 C;  3K57 A;  3M7G A;  3V05 A;  2TMP A;  5JJZ A;  3T56 B;  3E6Z X;  3TP6 A;  1LTB D;  1EWC A;  2RDF A;  3NWS A;  1GUG A;  2A73 B;  5COY A;  1ICW A;  3IFD A;  2EDG A;  1PRT C;  1JOR A;  3VR4 A;  5J1Z A;  3R8B A;  5BN5 A;  1IL8 A;  3J7A V;  5E4X A;  3J7Y W;  5IGE A;  3HOY B;  4C56 C;  1BBX C;  4V0B A;  3M3Y B;  2VB3 X;  3D8G A;  4XT1 B;  3OPO A;  3M7N A;  5JVG 3;  4A3G B;  3X3N A;  4IFD I;  1ILQ A;  1RTO A;  2D9U A;  4KTA A;  1RF2 D;  2IT1 A;  1B53 A;  3BVM A;  4I7Z C;  3VR3 A;  2F03 A;  2F0O A;  1TS2 A;  4ZKB B;  4OO1 G;  2AWN A;  2WIN B;  4ZKC B;  4OIK A;  4NKL A;  3T53 B;  5IT9 E;  1H9K A;  2PNR C;  3VR2 A;  1PZJ D;  4K14 A;  3TZD A;  5E3F A;  5C0X G;  4XDX A;  3ERO A;  3GTM B;  1G2T A;  2HQE A;  4C2M B;  4WFN 3;  1F9S A;  5TSS A;  1SMY D;  3RZO B;  5FLX E;  3GV3 A;  1JCK B;  1TWA B;  1NCV A;  5C4Z A;  3HP3 A;  4KK7 A;  3MA2 B;  1STN A;  1VDZ A;  1HPC A;  2F1M A;  2OF1 A;  1L0Y B;  1F9Q A;  3SK8 A;  1TWC B;  2KUM A;  2FFK B;  3VYS A;  5KGU A;  4ULL A;  5M3M B;  1EZ8 A;  4ZQ3 A;  5JPN C;  2IX0 A;  1F77 A;  4HMJ A;  4XXE A;  3I4M B;  2E2I B;  3RUZ A;  3IAY A;  2B2Y C;  4O42 A;  1BQQ T;  1TII D;  4ILW A;  2JA6 B;  1WVL A;  1KAA A;  1HA5 A;  5KYL A;  5KYI A;  5FO7 B;  1WTX A;  1SJE D;  1CM9 A;  3ITP A;  2GA4 B;  3TDQ A;  1CZW A;  3HOX B;  2SOB A;  2L55 A;  1WTR A;  2KEE A;  4KI0 A;  2B2U C;  1LV9 A;  3PIP 3;  5C0X H;  1CFM A;  1ESF A;  1TWF B;  2FMC A;  1CQV A;  1JE4 A;  1SMY C;  1ET9 A;  3PIO 3;  2RSO A;  3KF8 A;  3TP8 A;  4K5V A;  5K36 G;  1PFN A;  5C0X J;  2A68 C;  3K0Y A;  1CK1 A;  5ELE A;  4FNF A;  4CGY B;  3DEO A;  2A6H C;  3ND8 A;  5JPM C;  4F8M A;  4DF7 A;  4RCO A;  4QCL A;  2K6A A;  1HHV A;  5K5P A;  4K5W A;  3K5M A;  1SE2 A;  3D31 A;  1ENA A;  1RCV D;  1QOH A;  4S3S A;  5DEH A;  2H1E A;  4JBW A;  1G6Z A;  2XRQ D;  4O1N A;  1O7Y A;  4C3J G;  1IHZ A;  5EKI A;  3L9A X;  3NTK A;  1AZP A;  1SNC A;  1UUP A;  5T1I A;  1CI3 M;  3NBH A;  5IGB A;  2AQ2 B;  4ZLT F;  3OIP A;  2WII B;  2K5D A;  2KA7 A;  1W6K A;  4G4K A;  4BY1 B;  1SE3 A;  4QF4 A;  2N88 A;  2EOT A;  3SK6 A;  1SYG A;  2PCF B;  4L8J A;  3GD7 A;  4RH6 A;  1W6J A;  3CHB D;  3KLR A;  5LL6 S;  2K5Q A;  3DXJ C;  2OT2 A;  1S4Z A;  1JIC A;  2PQE A;  2XWJ B;  4LJZ C;  2KHS A;  1F9P A;  2QF7 A;  3MVV A;  4F87 A;  1AP0 A;  4A93 B;  4M8A A;  5DM6 3;  4J8Q A;  3S1M B;  1NR4 A;  4K6L A;  3FKI B;  5K36 H;  1U4P A;  4TQU S;  5C4H A;  3NBI A;  2K05 A;  1Y1V B;  2JP1 A;  2WP8 J;  2BCO A;  3EFX D;  3DUZ A;  1GHK A;  4XYO A;  1FNW A;  1I4G A;  1YNN D;  4IUT A;  3X3M A;  4KY5 A;  3RMH A;  3OOC A;  2Q8T A;  3LWU A;  1AN8 A;  5JEA G;  4A3I B;  3DWP A;  3GTJ B;  2F0M A;  3M4Y A;  3T4A C;  1B9N A;  2F0D A;  3SHL A;  2A6E D;  3QOJ A;  4TRD A;  4FF3 A;  4E6I A;  1Y8P B;  4DNR B;  2EY6 A;  3MEH A;  3TP5 A;  1V1P B;  1JWU D;  1TVX A;  4Q5V A;  3PUX A;  5BN4 A;  1G29 1;  1OXV A;  2I46 A;  1HFN A;  1DYQ A;  4FF2 A;  1STB A;  4K8I A;  5CV4 A;  3A7L A;  1PXU A;  5A35 A;  2F0U A;  2K03 A;  3R3O A;  3MXN A;  4DNT B;  4PNY A;  3J80 L;  2WB1 B;  4XQQ A;  4CKE A;  4R9W A;  2K32 A;  3DHQ A;  1I6H B;  1PYW D;  2B2V C;  3ONA B;  1F9R A;  2R92 B;  4DAP A;  2Y0S B;  4A3F B;  1B3A A;  1TS5 A;  1CA6 A;  1SYD A;  2EJF C;  1EY9 A;  3K5N A;  1D1I A;  2ID0 A;  3AMU A;  4BBR B;  1I4H A;  2QCP X;  3HZX A;  5FO8 B;  4RWS C;  1O7L A;  1VMP A;  5ISR A;  1TT2 A;  2HUG A;  3R93 A;  2F0H A;  1C4Q A;  4ABN A;  4KMU C;  4KY6 A;  4IN3 A;  2XVS A;  3PMF A;  2BOS A;  2EPB A;  1F2L A;  3EA6 A;  3HG9 A;  4DXF A;  3SK5 A;  5FO9 B;  2E76 C;  1I4P A;  5I2X A;  3VR5 A;  2O5I C;  2KQ3 A;  2EY2 A;  1U9R A;  4XTC S;  1L0X B;  3T16 A;  2WAC A;  1QNK A;  4X3S A;  3VA5 A;  1E2Z A;  1EY0 A;  2D2C C;  4XT3 B;  1ZKO A;  2ICE C;  5JEA H;  2D62 A;  3QIA A;  1FYC A;  3A56 A;  1FGB D;  1G2S A;  1RKN A;  5CV7 A;  1ML0 D;  5CV9 A;  1Z47 A;  2EYH A;  2JYO A;  1B9M A;  1V43 A;  2I07 B;  3TME A;  3K5O A;  2IL8 A;  2C9O A;  4KN7 C;  4C3H G;  3DM1 A;  3JAM E;  5A2Q L;  5EPL A;  4RHS A;  3N52 A;  3DWA A;  2HCC A;  1BO0 A;  1STA A;  1DOK A;  4Y7N B;  2VXW A;  2K7V A;  5ELB A;  4CBV A;  3MZ5 A;  2MP1 A;  5ELC A;  4FF4 A;  1SXT A;  3SDZ A;  2EZV A;  4BY7 B;  3HOW B;  3T51 B;  1EYA A;  5HGT A;  3HRZ C;  2ZXP A;  3KLS A;  1EEI D;  1ZYR D;  4R8I A;  1EU4 A;  5KRU A;  4EQP A;  4KHZ A;  2SEB D;  4QUF A;  4AYB B;  3OWF A;  1NAP A;  1QJO A;  3PUZ A;  5EBD A;  1VMC A;  1H9R A;  1EU3 A;  1GUS A;  2DY8 A;  3OSO A;  2HCI A;  5NUC A;  1H9S B;  4K2L A;  3SE0 A;  4FXK C;  5FK9 C;  3C46 A;  2A69 D;  4DK1 A;  1SFO B;  4C3I B;  4BS9 A;  1PFM A;  5D3D A;  1BDO A;  1F2M A;  1B4O A;  5FKA C;  4FO2 A;  3KBX A;  3EQL C;  1SEB D;  2HDL A;  2B2Y A;  4KKT A;  3M85 A;  3D6C A;  4IUN A;  3UI2 A;  1PTO H;  2JXM B;  4CJ1 B;  4QUC A;  1OXS C;  2R61 A;  3QOL A;  1CQF A;  1MSH A;  4HAE A;  5I6W A;  2AQ1 B;  3K5L A;  1STE A;  3MHB A;  2F0K A;  2JEB I;  1WTO A;  1TQO A;  5ELF A;  3P75 A;  3A54 A;  5KEE A;  1T5E A;  2Z8L A;  1EY4 A;  2SNM A;  5ELD A;  1Q1B A;  2NUC A;  5IGG A;  1TY2 A;  1YNJ C;  3HS0 C;  2F0E A;  5C3E B;  2B2U A;  4C1N K;  2LY7 A;  1MI2 A;  3VA7 A;  3RD4 A;  1DD2 A;  4OIJ A;  5FLX L;  1MGS A;  2X6G A;  2RBM A;  1Z6H A;  3N6R A;  4N9P A;  3GTK B;  4ZUJ A;  5JOB A;  1Q3L A;  1SE4 A;  3QWN A;  3J81 L;  3MXG A;  1EY8 A;  2B8F A;  4RGT A;  3S16 B;  4A3E B;  2BE5 C;  4OGQ C;  5BN3 A;  2NWG A;  1PLF A;  3Q24 A;  2AUK A;  3E0J A;  3GTG B;  1XX8 A;  2A69 C;  1WTQ A;  4IAL A;  2EYL A;  1EQV A;  1GUN A;  5C5M A;  2R93 B;  2NTT A;  2NVX B;  3NHH A;  2IJ0 A;  4RGM A;  1JC7 A;  2ICI A;  1T5X D;  3ZYY X;  1HTP A;  1GUW A;  3I73 A;  5JVH 3;  1U4R A;  1EY6 A;  4CKC A;  1JOK A;  2B2T C;  2ZT9 C;  1LTR D;  1EFI D;  3DEP A;  1CHQ D;  3CKI B;  2CHB D;  5C5L A;  4J6H A;  4H7B A;  1ILP A;  5D65 A;  1KDB A;  3NK9 A;  1K8M A;  3K58 A;  2DNC A;  3TN2 A;  2M00 A;  2SDF A;  2AUJ D;  4X3T A;  1O7Z A;  4LAA A;  2BDO A;  4XYQ A;  1K83 B;  4K5X A;  2MPM A;  2NBF A;  1XTC D;  1F2Z A;  2QIL A;  3C2P A;  2PZT A;  4TKO B;  1IW7 D;  1ENC A;  2F0L A;  4RKB A;  1TS3 A;  4OO1 H;  5F2D A;  2Z4H A;  1WTP A;  4R8N A;  1ROD A;  1Y1W B;  3H3V C;  4B08 A;  4RGO S;  4PMB A;  3FVQ A;  5M9O A;  4BA2 I;  2KCN A;  2E2H B;  1K8O A;  1A6X A;  1E0B A;  1LLR D;  5D14 A;  1IYU A;  1KAB A;  2PYK A;  1FNV A;  3H0G B;  4B9X A;  1QE6 A;  2WKC A;  1SBB B;  4EVO A;  4RHR A;  4K2K A;  1BNZ A;  3C1F A;  3TBI B;  1QWY A;  2IX1 A;  2KEC A;  3G7L A;  1I6V C;  1EY7 A;  1SYE A;  1RJT A;  3HGB A;  3Q6S A;  4RA8 A;  4TSS A;  2LMC B;  1A15 A;  5EJW A;  3H09 A;  3S15 B;  1LAB A;  4FVM A;  1FD7 D;  1EOT A;  1SNQ A;  3S1Q B;  1I50 B;  2RDG A;  1OXT A;  2B2V A;  2L12 A;  1WD0 A;  1STY A;  2DY7 A;  4G7Z C;  5I9O A;  4KD4 A;  1JWM D;  2YYZ A;  2FHT A;  3MXP A;  3S17 B;  1LTA D;  1U4M A;  2DNE A;  4CHT B;  4PMC A;  2F3W A;  3VYU A;  3WDN A;  1SNO A;  3Q22 A;  1PMR A;  1M4V A;  1EY5 A;  4IZ8 A;  3MAQ A;  2F0P A;  4BBS B;  4OO1 I;  3RLF A;  2E74 C;  3NQT A;  1D5M C;  4QMG A;  2F0W A;  2LFN A;  3MFG A;  1WTV A;  1SYC A;  4H13 C;  2E2J B;  5C0X I;  3NQI A;  4F7X A;  2QEJ C;  1PDQ A;  1NR2 A;  3IKJ A;  4KD3 A;  2JA7 B;  1HA6 A;  2EY5 A;  4NW2 A;  3MWY W;  3LWE A;  3W3A A;  4A3K B;  1O78 A;  1E2V A;  4U68 A;  1UNS A;  1AW7 A;  1Q12 A;  2K01 A;  4JK1 C;  2XSC A;  4WOR A;  3GTP B;  2XRS D;  5KIX A;  1KDA A;  1SDF A;  2X6L A;  2L1B A;  5KNB A;  1HUM A;  4WRD A;  2L5T A;  3J7A F;  2G9H D;  3I90 A;  1EZ6 A;  2MJ8 A;  4HSP A;  1MD2 D;  1QCB D;  3A7A B;  1MBY A;  1J9O A;  3P20 A;  4DFA A;  1U4L A;  1LTI D;  1PTO D;  3S2D B;  1OO9 B;  2J7Z A;  1H9M A;  2OXP A;  3NUC A;  5EKL A;  2ZXR A;  3FRP B;  1BR9 A;  3PUV A;  1PZK D;  2CW0 D;  3VYR A;  1ONL A;  5EKK A;  4NP5 A;  2A5H A;  5HUR A;  1VF5 C;  3TZU A;  3DMU A;  3MXU A;  4ME5 A;  1B44 D;  1G8Z D;  4X3U A;  3BZD B;  4Z9C B;  4EQN A;  2R6G A;  3U9S A;  2VUM B;  1WTW A;  1EEF D;  3MFY A;  1UEA B;  1CZG A;  1SND A;  1SNP A;  4A3B B;  3F2U A;  2EYM A;  1TY0 A;  2XNA C;  2F0V A;  2HDM A;  1RDP D;  1D6E C;  3KBG A;  2FJ2 A;  1I3Q B;  1KNE A;  3AB9 A;  5KNC A;  3OIQ A;  1KLU D;  3WOE A;  3NSW A;  2MGS A;  2K04 A;  1D2B A;  4KY7 A;  4KHV A;  5M5X B;  1SYF A;  1YNN C;  4RKL A;  3CRL C;  4RCN A;  4PV1 C;  4XIG S;  3PUY A;  1A2U A;  5I6Y A;  1AFP A;  4A3D B;  1LO5 D;  3SK4 A;  2M9V A;  2A6E C;  4IUR A;  1EL0 A;  1EYD A;  3MTS A;  1R4Q B;  3J80 E;  3ERQ A;  2IX3 A;  1TU2 B;  3NWT A;  3S1R B;  3QB3 A;  1MSG A;  3HOU B;  1CTM A;  3C3L A;  1DZ1 A;  4H0L C;  3HOZ B;  2WKD A;  3O13 A;  4BA1 I;  1KTK A;  1OXX K;  5T1G A;  2PW5 A;  2L9H A;  3C1E A;  3K6O A;  1QIL A;  2NZ1 D;  1PRT D;  3S2H B;  5EPJ A;  3I3C A;  4QB4 A;  2PZW A;  4MN3 A;  2E2D C;  5AFW A;  1BXT A;  4C3J B;  1AEX A;  2NVY B;  2CVR A;  2QKI C;  1DON A;  3OMG A;  3GP7 A;  4NMZ A;  1V1P A;  2B2T A;  5J22 A;  3KUP A;  2MHV A;  4B9W A;  2EYJ A;  3CRK C;  2KCC A;  4CJ2 C;  5IGD A;  4A3M B;  1S5E D;  1EQT A;  4IFD J;  5I2Y A;  3BVZ A;  5A2Q E;  1SAP A;  4NDX A;  3PO2 B;  1OXU A;  3MC0 B;  4CKB A;  2B63 B;  5IOD A;  3GTO B;  5CYU A;  2L4N A;  4LMQ D;  5C6A A;  3SEB A;  1JB3 A;  1BCP B;  2JE6 I;  5IGF A;  1ENF A;  3BG3 A;  2D5D A;  2PW7 A;  4DK0 A;  4X3K A;  4IQZ A;  2K5W A;  1XYI A;  3BVG A;  2TSS A;  3BDL A;  2NVT B;  2LS0 1;  4DGZ A;  5IT9 L;  1Q8I A;  3ND9 A;  4RFB A;  3W2D A;  4YIJ A;  2V4D A;  3IL8 A;  4PQX A;  5M3F B;  1QB5 D;  2XWB B;  3E5S A;  4HCS A;  2EYF A;  4WJW A;  4I65 A;  1ZYR C;  3GTL B;  3V96 A;  3V2T A;  4XQJ A;  3I4L A;  1VCI A;  2JSO A;  2AQ3 B;  3L7Z C;  1HFG A;  1A3V A;  3H6M A;  1C8C A;  1X3Q A;  5CBA E;  3M4O B;  3KLS X;  5CV6 A;  2R7Z B;  1KLG D;  1STG A;  3A8J E;  3EJI A;  3GTQ B;  1BCP F;  5COR A;  2WAQ B;  2NTS A;  4H44 C;  2A74 C;  2XN9 C;  5G3L D;  3K59 A;  1SSO A;  4G7H C;  4LK1 C;  2G9D A;  3GV6 A;  2X69 A;  4ODG A;  1E2W A;  3K7A B;  2BA1 A;  1G91 A;  1DJR D;  3L3O C;  3D4D A;  3RZD B;  2F3V A;  4F88 A;  3KK7 A;  2DN8 A;  1F2Y A;  2B2W C;  1HQM C;  5EPK A;  1TKW B;  1HTL D;  1LT5 D;  1B50 A;  1H9S A;  2RQX A;  3FDT A;  1BUV T;  1I4X A;  2A68 D;  3I72 A;  2NN6 G;  4KJO A;  5CGK A;  3J81 E;  2A6H D;  1LTT D;  3A8I E;  1LT3 D;  4MHE A;  2F0T A;  1NSN S;  5IGC A;  5I4D A;  1JOO A;  3TSS A;  5CV8 A;  2MUY A;  4ZK9 B;  1SJH D;  4HMI A;  2NB0 A;  3H94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...