3EVQA

Crystal structure of staphylococcal nuclease variant delta+phs l25e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKEMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal Structure of D+PHS L25E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3evqA00
1EZ6A 3NXWA 5J39A 1SNCA 1SYFA 3NQTA 5CV4A 4EQOA 3QOLA 1RKNA 4ID6A 1SYCA 2F0WA 3MXPA 4KJNA 4HTHA 4ZUJA 1STHA 4N9PA 3TP8A 4DF7A 5CV9A 5KRUA 1A2UA 2F0FA 4IUNA 2KQ3A 1EY9A 2F0MA 4ODGA 1KABA 2EY5A 2PZTA 5IGFA 4RKLA 1JOQA 4NDXA 2F0SA 1U9RA 2PW5A 2OXPA 1EYCA 4KY7A 3C1FA 2EYJA 4QF4A 2SNMA 2M00A 3ITPA 4NP5A 5C4HA 4K5VA 3NHHA 4S3SA 3TMEA 4KHVA 1SNDA 1TQOA 4NKLA 1EQVA 5IODA 1EY0A 1SYBA 5KIXA 3RUZA 3VA5A 2KHSA 2EYFA 1SNPA 2EY2A 3HEJA 3MEHA 4EQPA 2F0DA 3ERQA 5HGTA 4TRDA 4NMZA 3SR1A 1TT2A 4DU9A 2EYLA 1STBA 4K2KA 3U9OA 4ZUIA 1II3A 1SNOA 2F0EA 4DFAA 4K8JA 1SYGA 1EY8A 2F3WA 2PQEA 3DHQA 1F2YA 4RKBA 4PMCA 2OF1A 2PYKA 3V2TA 3OWFA 4WORA 3SK4A 3TP6A 5C5MA 4KY5A 5ISRA 2F0TA 2SNSA 4OL7A 2EYOA 4K5WA 5C3XA 2F0NA 2RBMA 3NP8A 3MZ5A 5CV5A 5E1FA 3EJIA 4KJOA 4E6IA 5I9PA 2QDBA 4B9XA 4EQNA 4HMJA 3MHBA 4K5XA 4LAAA 1STNA 2F3VA 3TP5A 4IALA 3QB3A 4ME5A 5CV7A 2OEOA 2LKVA 4KTAA 5JAVA 3NUCA 3MVVA 5E3FA 5JOBA 5C3WA 5J22A 5CR3A 1EY6A 3NK9A 1EZ8A 4G57A 4K14A 3QOJA 4YIJA 1F2MA 1EYDA 1EY4A 5C5LA 3BDCA 2ENBA 2F0VA 3D6CA 3OMCA 4J1MA 1SYDA 5M9OA 4MIUA 5IGCA 4N9TA 1ENAA 1KDBA 1ENCA 2F0UA 4H7BA 2EYPA 1F2ZA 2HQEA 2NUCA 2F0OA 3E5SA 4KY6A 5I9OA 5IOCA 5IGBA 5K5PA 2F0GA 3EROA 4KV6A 4HMIA 4WRDA 3S9WA 3OMGA 1A2TA 5CV8A 2EYHA 4IZ8A 5CV6A 5I6YA 5KEEA 1TR5A 3PMFA 5F2DA 2EYMA 5I6WA 5KGUA 4QB4A 1KDCA 1JOKA 4PNYA 3D4DA 4F8MA 3SK6A 1EYAA 3SHLA 3SK5A 2F0KA 3HZXA 4K8IA 4KD3A 4PMBA 4QMGA 3T16A 4KD4A 4DGZA 2F0IA 5KYLA 1SNQA 5DEHA 2F0LA 2O4XA 1EY7A 2EY1A 1JOOA 1EY5A 1STYA 2RKSA 1NSNS 2F0JA 2RDFA 3C1EA 3LX0A 2WACA 4ZQ3A 5CGKA 5IGEA 4I65A 5CC4A 5DAUA 4K6DA 3TP7A 4F7XA 3OSOA 2PW7A 4EVOA 1AEXA 2F0PA 4B9WA 1NUCA 2F0QA 2PZUA 5KYIA 3T13A 3EVQA 1KDAA 2EXZA 5C6AA 5J1ZA 1JORA 4J6HA 1KAAA 1STAA 1SYEA 3P75A 3DMUA 2SOBA 3BDLA 2F0HA 2EY6A 5EKKA 5HURA 5IGDA 5EGTA 5EKLA 3SXHA 5NUCA 1A3VA 1A3TA 1IHZA 3P1HA 3R3OA 4R8NA 3SK8A 5IGGA 3D4WA 5IIFA 1SNMA 5C4ZA 1A3UA 2PZWA 4K2LA 1STGA 3D8GA 3H6MA
chains in the Genus database with same CATH superfamily
1EZ6A 1VQMA 1XMQL 1HNXQ 3D0FA 4EQOA 5CV4A 4DR1Q 4FF3A 4ID6A 4CKEA 3GTPH 3KOJA 5LHY1 5ELDA 1JJ2A 2K32A 3TDQA 1HFNA 1NY4A 1A6XA 2J7ZA 1HUNA 1J8IA 2VQEL 4XDXA 1ML0D 4U68A 3GTMB 2QGQA 3OIQA 4BBSH 1EQVA 1EY0A 4AH6A 3I3CA 4YCUA 4X6AH 3T51B 4DU9A 4CDCC 2EYLA 1EEFD 4ZUIA 1UE1A 1TU2B 2K75A 3A55A 2CKZB 4LFCL 1TS2A 5C4JH 4AYBE 3NE5B 4FXKC 1S5FD 1C48A 2F0NA 3CW2C 1TWCH 4U673 1QILA 5CV5A 2OWOA 1FL0A 5I9PA 3BZCA 5IE8A 3OYYA 1A0IA 5LL6S 1F77A 3BZDB 5CV7A 3GTOH 5K36H 1MKHA 2ZTDA 4IOCA 4RH6A 1TWHB 2PNRC 3QO2A 2NVXB 1GUSA 3HOYH 2R7FA 5M5XH 5IYDG 2EYPA 3DUZA 1CZWA 2CHBD 1HH2P 4BA2I 2Z6BA 2ZXOA 1ZXTA 1JQYD 4DAPA 1Z6HA 2XVSA 2EIFA 2DY7A 1QCBD 2IPKD 3H3VH 4DV7Q 1Q1BA 1B70B 4X3TA 2HQLA 4L63B 4K6DA 1B1ZA 3A7AB 4RAUC 1CA5A 4WJ4A 2E74C 4B9WA 3FKIH 4V190 5JJKA 4A3MH 2AQ2B 3K5NA 1CM9A 1DM0B 1WTOA 1LABA 1LO5D 1G8ZD 2BDNA 3U50C 2F4VL 3UE0A 5NUCA 1GUWA 1Y8NB 4J8QA 4R8NA 4A93G 5EQ0A 2EJMA 2I5HA 3CQZB 3I73A 3HOUB 2KHIA 1RKNA 1UWVA 1R4PB 1Y8PB 5C0XH 4ODGA 4PZ7A 1WOCA 3PIO3 4LFBL 4RKLA 2B63B 3C1FA 4G7HC 1KLUD 2ZTCA 1Y1VH 2WINB 2HT1A 2WV6D 1GM5A 2N78A 3I91A 4A3FG 1PFNA 1QVGA 3MEHA 3KLSX 4EQPA 1JMCA 2DGYA 3TEHB 1I6HB 1V9PA 4JBWA 1II3A 1I94L 1SYGA 3I4MB 4A3KB 1I3QB 4A3DB 3IKJA 3X3NA 3W5OA 1YNND 2FFKB 1GVPA 3T1HL 2WB1G 2UUBQ 2FMCA 2JYOA 4OO1I 3GP7A 2BH2A 3MHBA 3JC66 4K5XA 2UU9L 1B3AA 2B8FA 1PTOF 2OEOA 5C3WA 3LNNA 1HCZA 4C3JG 1WVLA 4OEMB 3UE1A 4DV3L 1V1PB 4JPBW 4H0LC 2VW9A 4O0AA 5ELNA 1XX8A 4A3JB 2H5XA 1TS4A 3KUPA 3MC0B 5HGQA 2BA0A 3BG3A 1Q90A 3GTJH 1GXDC 4POFA 3CCMA 4B3ML 4DR5L 3T4AC 1H9SB 2J4XA 1H9SA 4JI5Q 1CHQD 3MFYA 4DPGA 5I6WA 4ZCKA 5IYCH 1ASZA 1SLJA 1EYAA 5M5WH 1PH4A 3EBEA 4H44C 4QMGA 4PMBA 1OO9B 3HOVB 5DEHA 2D0PA 1EOVA 2UUCL 4KLKA 3C1EA 3LX0A 5IWAL 3JAMi 1GJXA 2ZJPA 3H15A 1SRUA 3CCQA 3DLLA 1PLFA 5E4WC 2L5TA 1XJVA 3BDLA 3GTPB 5EKKA 1AN8A 1G291 2DNCA 4JYAQ 5AFWA 1J5EL 2JA7G 3IFTA 5C3EB 3DWPA 5L37A 5M3FG 2Y0SE 3H94A 4BBSB 5IYBG 3NQTA 4O2DA 1E7ZA 1B4OA 3MXPA 4DF7A 3Q0AA 4N9PA 1D5XC 3J80i 2DJFC 1XPRA 3S1NB 3OW7A 2L12A 3Q24A 2IW3A 2KOLA 3FHWA 4DR4L 2PQAB 2R7ZG 1SNDA 5C4JB 2P5ZX 4JI3L 3HRZC 1TWFH 2QKIC 1TWCB 4HIDA 1K3RA 1HR0L 4TRDA 3CU7A 3J7ZC 5GAHC 2EVBA 4K8JA 3G6EA 3E9IA 4QQBX 3D31A 1OXSC 3GTOB 2AHOB 4C1NI 2L11A 3S15H 4KY5A 4KI0A 4LUZA 3HOYB 1TY2A 4KJOA 4E6IA 4B9XA 1DGSA 3TP5A 2XTIA 2A19A 3NENA 3QB3A 4LJZC 1PTOH 3I90A 5GADC 1YNJD 4IPGA 4ZK9B 1SDFA 4LF5Q 1E2VA 2NTTA 3T1YQ 2ZTEA 1V43A 1A63A 4DR1L 2GVBA 1EIGA 1YHAA 3T53B 1BO0A 3S9WA 2ZXPA 1A2TA 5CV8A 2LS01 4J15A 5I6YA 1CSPA 1TR5A 5F2DA 1XNQQ 5KGUA 4YWMA 3FKIB 1VF5C 2A6HC 4DAYB 2AUKA 3HOZG 4DAYA 1KHIA 1LT5D 1ENFA 1A8VA 1VF7A 1N8RC 3EN2A 3ND8A 1STYA 2WAQE 2F0JA 1TS3A 5ELCA 2IWHA 5CC4A 2XWJB 3E0JA 3OSOA 3V96A 4RGMA 5KYIA 1HFGA 4BY7G 1X3GA 4PZ6A 1Y14B 4FF4A 2F0HA 5LMNQ 1SJHD 3BVGA 4JCVE 3H0GH 2JJQA 1G91A 1PRTF 5C4ZA 3HOWG 4DNIA 3DEOA 2PZWA 4A3BH 3G48A 4JI6Q 1Y1VB 3CC4A 1N33L 2ICEC 4CJ1B 5GQOA 3QOLA 4ZUJA 1TVXA 4DV6L 1U5KA 4MN3A 3UDGA 4ME3A 4JI0L 4RCNA 4DUZQ 4NDXA 1Q12A 1FYCA 2R61A 2M00A 4IFDG 1TS5A 3NHHA 1SAPA 2QEJC 1TQOA 1K8AC 2K33A 1FNVA 1U4RA 3RUZA 1K83B 1DCZA 3W3AA 1SNPA 1CQVA 2N3SA 3S2HB 3S2DH 3R2TA 4LW1A 1XTDA 4DV5L 1MJEA 1ESFA 2IHFA 4L5SA 4DFAA 3KFUA 2F3WA 1LTTD 2L1BA 1VQ9A 1CKOA 1EWIA 5FKAC 2EJGC 3V2TA 1QOHA 2JA5B 2I07B 3KLWA 4R9WA 1Z47A 1PH2A 5M3MH 3GTJB 1X65A 3NBHA 3NQIA 1MGSA 1RCVD 1H9RA 2FMMA 2ES2A 4BA1I 1V8QA 2HDLA 1VQDA 2NN6G 4V0BA 2NYZD 5CMDA 2F0VA 4GN3B 1WTQA 4JC0A 5M5WB 3H91A 4GKKL 1SMYD 4N9TA 4QY7A 1LYLA 1T5XD 3BYYB 5FJ8G 4WRDA 4DR2Q 4FXGC 5KEEA 4A3GH 1F2LA 4AIMA 1LTSD 2K14A 4BBRB 2D0OA 3SK6A 3SK5A 2F0KA 3GTKH 1HNWQ 1H95A 1F9QA 3HKZG 1YZ6A 1SE4A 3NSWA 4L5TA 1B50A 2ICIA 1NR4A 4RFBA 2K4KA 2PI2E 4HSPA 4OWTB 3MEFA 2E75C 4X66L 3FP9A 4YY3L 5C4XB 1VQJA 3DXJC 2K52A 4X3UA 2JA8G 3UDFA 1UAPA 3LWUA 4NXNL 4B3TL 1ESRA 5IIFA 3QIAA 3CCSA 2QF7A 3M4YA 3D8GA 3TBIB 2QA4A 4PV1C 1FNWA 5IT9E 2MJ8A 1QZGA 4HIOA 2B2UC 4P71A 1SFOB 1TWFB 1KRSA 1ET9A 3IFDA 1CTMA 2N8NA 2K7VA 3K0XA 4NXMQ 1EIFA 2RDHA 4JI5L 3SDZA 2R93B 3I4NB 4C3HG 2OCEA 3UI2A 2UXCL 5M5YH 3G71A 3S15B 1D1KA 3IL8A 4P2CB 2QDLA 2D62A 1HNZL 1E0BA 3KBGA 3SR1A 4OO1G 4ZKCB 2I46A 1SNOA 3K58A 4JI2Q 3HOXB 1AP0A 3OWFA 4WORA 1IBLQ 3K6OA 3IAYA 1PXUA 3A56A 5C3XA 4Y52H 1WYDA 2RCFA 3PO3G 2WB1E 4LWCA 1NR2A 1VQ8A 4HCEA 1NMFA 1VQNA 3RD4A 3U9SA 4JYAL 1D6EC 3Q22A 4IJLA 1K8GA 3K5LA 2Z4HA 4DV0L 3S1MB 1PH5A 3ULJA 1XXGA 5EKIA 1YEZA 1IYUA 5JEAG 3GTQH 3E5SA 1EL0A 1JJGA 4DUYQ 1SR3A 4KV6A 1F9SA 4A93H 1S5BD 4KK7A 3RZOH 1X56A 4QUFA 4QB4A 3SVMA 3SHLA 4DGZA 2XWBB 3KK7A 4A76A 4IJHA 1K0SA 1QUQA 4DR3L 2B2TC 4DNRB 3H0GB 4RGOS 1NUCA 3TZUA 1S3OA 1FVIA 2B2YA 5LL6X 3TQYA 1HUMA 1PH6A 1NBWA 1WCMG 1N36L 3H3VI 1AE3A 2E5LL 4BY1H 1A62A 2KBNA 2M9VA 4KMUC 2AWNA 3RMHA 4IURA 4RWSC 4HJ7A 1IBKQ 1RHPA 3T1YL 2NZOA 2I5LX 4A75A 1NE3A 4IUNA 3F8TA 2F0MA 3S2DB 3E9HA 3CCJA 1I5FA 1U9RA 3PO2G 2EYJA 5GAEC 1VS0A 2KCMA 1WD0A 4K5VA 5A2QE 4GZYC 4C3JH 4EQ5A 4G7OC 1NCVA 3RLFA 1BF4A 4X65L 1KC8C 1V1QA 3MAQA 2EYFA 1FR3A 3OTOQ 2R6GA 4A3EH 4MTKA 4B3RQ 1TIID 2XSCA 3HS0C 1WTXA 5C0XI 4LF7Q 1BUVT 2L4NA 2F0EA 4HJ9A 5FO9B 1WTPA 3KYHC 1K0RA 1XWEA 3URYA 2HHHQ 1F2YA 3FVQA 3TP6A 4JOIC 2XN9C 4JI4Q 1PYSB 3GTLH 3A8JE 1BCPF 1SSOA 3EIVA 4LUVA 4CGYB 2F3VA 4IALA 2MFIA 3A54A 4KTAA 3S14H 4A3CG 4G4KA 1W6JA 2VS1A 1N34Q 4LF8Q 4A3GB 3QOJA 3GV6A 4YIJA 1EYDA 2PNHA 1SROA 4JI6L 3BDCA 1LT4D 5EPKA 3GTKB 2A69D 5I9OA 2OT2A 5IGBA 3K5OA 1ONLA 1LM0A 4IZ8A 2WKDA 3GO5A 2E2HH 2Z9HA 1QNKA 2LY7A 3D4DA 1LTID 4K8IA 5HY6A 4BXXG 5DM73 2WFWA 1RF2D 3AQQA 1SXTA 3X3MA 4AQYQ 1EY5A 3FRPB 1NSNS 4XQNA 2N55A 4P72A 1EU3A 4QUCA 1J9OA 2VY3A 1DJRD 1IBML 4F7XA 4DV1Q 5IP7G 1N9WA 2CQOA 2NVTH 1YVCA 1CQFA 1EYGA 3JAME 1R4QB 1B2TA 3S1RH 1XPOA 2MHVA 1LT3D 1PV4A 3E3XA 4F87A 4OWXB 3NEMA 2B2UA 4HAEA 3S1QH 4JV5L 1DYQA 4K2LA 2VL6A 1WFQA 3H3VC 2JSOA 4GLXA 1I50H 3R93A 3CP0A 4M8AA 2AKWB 1B44D 5LMUL 5M5YB 4JI1L 2Z4IA 3BYTB 4X64L 5EBCA 2D5DA 5KRUA 1D2BA 1IXRA 3BDOA 1GUNA 4UHVA 2MPMA 2PZTA 2UUAQ 1L1OA 2PW5A 1EYCA 3J80E 2K04A 4QIWE 2X6GA 4GKJL 2EZVA 2KJXA 2KHJA 4QCLA 1KXLA 3HOUG 1EEID 4DKAC 4UDUC 3PCOB 1D7QA 1VQ7A 1VQGA 3I70A 4K2KA 2XGTA 1IZ6A 1U0LA 2DNEA 2PI2A 4RGTA 1BBUA 3L2PA 4GLVB 4Q5VA 1OXTA 5DM63 1EFWA 2B63G 3QJYA 3W1BA 4OX9Q 2KVMA 3NP8A 3PIOA 2R92H 3UDXA 1LACA 3GTQB 2KEEA 1EZ8A 3RZOB 5EJWA 3I4MG 4A3KG 4FF2A 4A3DG 3DEPA 5M9OA 4BY7H 2DJGC 1Q8IA 3DWAA 3MXNB 1CFMA 3MXNA 2AUJD 5BN5A 2PMZE 2CH4A 1ENCA 1WTWA 1HR0W 5JJZA 1SE3A 3C46A 2XIWA 4HMIA 1FGBD 1Q1EA 3S16B 3A7LA 2B2TA 4B3SQ 1VQ4A 4HJAA 5IT9L 1L0WA 1EY7A 4A3JG 3FEWX 3M9BA 1TWAH 2GN5A 4ZQ3A 3QWNA 1LT6D 5DAUA 1TWGH 1WJJA 3M3YH 1HZAA 4A3IH 1TXYA 1CUKA 4JI2L 4BY1B 3HKZE 2F0QA 5IP9H 4IFDH 3CF5A 4CJ2C 1IBLL 1K8MA 2I0QA 4JI7Q 2SOBA 2OTLA 3PGZA 3KJOA 4DV4Q 4DN4M 1FJGQ 3HOVG 3PF4A 3TS2A 1CKMA 2L0CA 1CT1D 3KLSA 4ULLA 3E0EA 4DV2L 2SEBD 1D1IA 1SJED 1UE7A 2NZ1D 1STHA 1N32Q 3R8BA 1HQMC 4A3EB 5C0XJ 1EY9A 4YHHL 2VUMB 1KABA 2XRQD 3QR8A 2E2IH 2JA6B 3NWTA 4TVAB 5ISRA 1XMOL 4DUYL 1G2SA 1H9KA 4Y7NH 1Y1WH 4K0KL 3PQIA 4RGNA 4NKLA 3AEVA 5C3EG 3ER0A 4UAIA 4HIKA 2NN6H 2NBFA 2KHSA 4RG1A 4FF1A 4JOIA 2F0DA 3GTLB 2CW0C 4P74A 3W2DA 2KEDA 1ET6A 1KQSA 2UXDL 1QVFA 1PVOA 4EGVA 1GKHA 1VCIA 4LF6Q 5G3LF 5FJ8H 4PZ8A 2DY8A 3V05A 3S14B 5ELBA 4DA2A 4PG3A 3SK4A 1X3EA 3ND9A 1HQRD 2SNSA 1H9JA 1GUTA 2RHSB 4A3LH 3CMAA 4ALPA 1UE5A 1PDQA 3RR5A 4XT3B 2CWAA 2C35B 1YITA 2Q2HA 4XYQA 5C44H 3TREA 3MA2B 2QW7A 1QZHA 3MTSA 3VDYA 2E2HB 1XTCD 4XYOA 5C5LA 5K36G 3D6CA 5AJ3L 1G51A 4CDEC 4G7ZC 2ID0A 1PHJA 1OXUA 4LUOA 3HOYG 3L7ZC 3OMGA 4CKBA 3PF5A 2A8VA 5GROA 2EDGA 5H1SE 5M5XB 1JOKA 2K5WA 2ZM6Q 3J81L 2NVTB 1PTOC 4KD3A 1XPUA 1T5EA 2LXJA 3S1RB 1O7LA 1ILPA 5I2XA 3B6YA 3OWEB 1EFID 3VR6A 2D9UA 4JW0A 3S1QB 2MNAA 4DR6Q 1HNXL 5IT9c 2PCFB 2PW7A 2JN4A 3A0JA 2F0PA 4ZKBB 4C3HH 1I50B 1KAAA 3I7FA 3VYUA 4IQZA 1JB3A 3FKIG 4CDFC 3M7GA 2ATWA 5HURA 3P20A 4IUQA 1VQ6A 1SMXA 5JJLA 4A3MB 4ILWA 3G4SA 3CXCA 1WTHA 1HZCA 1D5ZC 1C9OA 1NJIC 4OHJA 4DR7Q 4DK0A 1SYFA 1N34L 4DNTB 2F0WA 4LF4Q 2K5QA 1H9MA 1I4PA 4AYBB 3CCRA 1G6ZA 1Z7TA 4YCWA 5TSSA 1AH9A 3F2CA 4HN7A 2DN8A 4IUPA 4TQUS 3CCEA 3NPPA 4JI8Q 1JICA 4NPSA 2JK8A 3KLRA 1GHKA 2K5DA 1Y1VG 2B2WA 3VA5A 1LTRD 2VQFQ 2K28A 1ICWA 2B2YC 5JVH3 4LNQA 2R92B 4XTCS 4C2MH 5JEAH 4AQYL 5CORA 2EQSA 1M90C 3N52A 2WP8J 2VQEQ 2G9HD 4XQJA 4GOPB 4OL7A 4GOPA 3I8ZA 1NAPA 4BY7B 3VYTA 2LSSA 2VB2X 3EJIA 2QDBA 1S40A 3DWQA 1B53A 1CI3M 4QGUA 5BR8Q 5J22A 2MP1A 4K14A 2G9DA 5E4XA 4TKOB 2K01A 1YBYA 3GTGH 1EY4A 2ENBA 3OMCA 2JA5G 3A74A 2YYZA 4DV7L 1KDBA 3WDNA 3K7UC 1MBYA 4KY6A 5K5PA 2F0OA 1WCMH 2Q8IB 4OWWB 1ILQA 1OTCA 2EE1A 5D3DA 1JJCB 2UUAL 4C3IH 3PMFA 2EYMA 3M3YB 3RNUA 4F8MA 4A3IB 1LLRD 2K5HA 3NBHB 1SNQA 5IYCG 1CZGA 3A8KE 3PUWA 2VNUD 3J81c 1LUZA 1VQLA 3CHBD 3TP7A 2KECA 1UNSA 2K05A 1VQBA 3EVQA 2EXZA 3T56B 5I4DA 3WOEA 1B3QA 1YNXA 4L5QA 4HJ5A 2AMCB 4BBRG 1KLGD 1EIHA 5EKLA 3P1HA 1W2BA 4RCOA 2E2IB 1RTOA 2AQ1B 2KUMA 1STGA 1ZEQX 5ELEA 4Y7NB 3AB9A 3R2IA 5J39A 1Y1WB 2MO0A 3CC7A 1X3PA 4APVA 2LFNA 3F2BA 1ICFB 2DUDA 5C4XG 2FXQA 2EY5A 2F4VQ 5IGFA 3K59A 5E1FA 4KY7A 3G6JB 5C4HA 4NP5A 2A1AA 2UUBL 3CCLA 2BE5C 1YNJC 2EXDA 5KIXA 1J6QA 2E2JH 4H02A 4B3SL 4FVMA 1PRTC 3HEJA 4X3KA 1AE2A 2WKCA 2JP1A 3NBIA 4R1JA 2HCCA 4QJFA 1WD1A 4R4QA 5EPJA 5C44B 4LFBQ 1HZ9A 2PYKA 2Q8RE 4P75A 5T1GA 4B08A 2N88A 1BXTA 3I4LA 4K5WA 2R93G 3I4NG 1PYWD 4FP5D 1SN8A 2NVXH 4EQNA 1VQPA 4FDBA 1BOSA 2IX0A 1Q86C 1FJGL 3FPPA 3NK9A 4G57A 1I94Q 1L1OC 1CHPD 1IKLA 5IYDH 3Q23A 2SDFA 1DOMA 3HOXG 3T1HQ 2IJ0A 1RL2A 5IGCA 2CVRA 2VB3X 2F0UA 1PTOB 4H7BA 1N32L 5IOCA 2V1CC 3STBC 3RLNA 1K28A 2UU9Q 3M7NA 1RD9D 2HCIA 2RSOA 3CMEA 3TS0A 4GNXB 4GN4B 4GNXA 1OXXK 4OXPA 3HZXA 4DV3Q 2Y0SB 3PIP3 2F0LA 3K0YA 5CBAE 3H09A 4K6LA 1U4MA 1KTKA 1MSHA 1F9PA 1UE6A 4B3MQ 2J0TD 4YWKA 4DR5Q 3PUXA 1B8AA 2G5DA 2KENA 1E2WA 1RJTA 2EY6A 3AFQA 1IHZA 2UUCQ 1SNMA 5IWAQ 3J7AF 5CGKA 4YCVA 1SNCA 3H0GG 4DXFA 1QUQB 2O2LD 1I4GA 4GLAC 1B7YB 4ZLTF 1W3SA 4M1UB 1E1OA 3VR2A 2F52A 2B8GA 1E22A 3ONAB 4FXDA 4A3BB 2GA4B 1JOQA 4C2MB 4X62Q 4QF4A 5FK9C 2F3IA 1YI2A 1J5EQ 3CCVA 1JWMD 4OGQC 4A3FH 1MHWC 4S3SA 1QVCA 3RLOA 1O78A 1OXVA 1VMCA 3AMUA 2R7DA 4POGA 3NTHA 1FGUA 3TZDA 4I7AA 1K9MC 5JJIA 4LF5L 5FLXE 5EPLA 1HJPA 1X3FA 3K80C 3KF6A 1IKMA 4OELB 1FNUA 1JWSD 3NTIA 1EUJA 1VQIA 3CAMA 3GTGB 3MZ5A 2Q2UA 4NW2A 4JI3Q 4FNFA 1HR0Q 1IW7C 1S5ED 2EJFC 2B3GA 1XNQL 4PMWA 1A15A 1EY6A 2BCOA 2WAQB 1O7IA 3KDFB 1ZYRC 4C3IB 3KDFA 4LK1C 4FO2A 3Q8DA 5M3MB 3KF8B 5EAYA 3KF8A 1WI5A 2B2VA 2OQKA 4H13C 5CBEE 4EX5A 2RSNA 4IUTA 4O1NA 2NB0A 1VQOA 1X6OA 4R4OA 1GUGA 4KHPQ 3SEBA 3T16A 3VR5A 3FPUB 5LMNL 3LGJA 4A3GG 1S4ZA 2F0IA 3HP3A 1KRTA 1RDPD 1P8LA 2VQFL 2RDFA 2VZAA 3OIPA 3VR4A 1EQQA 3I55A 3K7AH 3K8AA 4DK6C 2Q2TA 4EVOA 1DZ1A 4OIKA 2KA7A 2RDGA 3Q6SA 3I56A 4MTNA 5C3EH 2HIVA 2I5MX 1W6KA 1NMGA 1PFSA 2JA7H 4IUUA 1YHBA 4DUZL 4N8X1 3KBXA 3L9AX 3W1GA 5M3FH 1E1TA 1L2FA 4YWLA 4QL5A 3R3OA 3PV0A 1DOLA 1SE8A 3S1NH 2EOTA 3D4WA 3NWSA 5IYBH 1KNAA 1KIXA 5BR8L 4UPAA 4IFDI 5FLMG 3U4ZA 4IOAA 3DM3A 2HIXA 2IX1A 3TP8A 2E2JB 4UY8C 3VA7A 1PZKD 4CDDC 1Z9FA 1PRTB 2UXBQ 2R7ZH 2CH4W 2F0SA 1DONA 1EU4A 2SNMA 4IPCA 1JWUD 4KHVA 3RZDH 5A35A 1SYBA 3J7AV 1N33Q 4GN5A 4NB3A 2O5IC 4DV6Q 2A68C 2YTXA 3RN2A 2HDMA 1STBA 3U9OA 1L0YB 2CW0D 2PQEA 3BVMA 4JI0Q 3OPOA 4RMFA 2OF1A 2Z0SA 2MGSA 1L1OB 4X3SA 2A6EC 1DXMA 2NN6I 5J3BA 2V4DA 3S17H 2IHEA 1STNA 2YTYA 3FMCA 4DR2L 1M1KC 2LXKA 4ME5A 4MHEA 1YHQA 2RA4A 2A5HA 1GO3E 4JK1C 5CR3A 4DV5Q 1V1OA 1HNWL 2E8GA 1KAWA 4J1MA 1VMPA 4MIUA 1S72A 5ELOA 1KNEA 2HUGA 5BN4A 1TKWB 2HQEA 2B2WC 2NUCA 1UEBA 1U4PA 2JXMB 2GVAA 1ZKOA 3EROA 5E7NA 1YJ9A 3HOZH 1Q46A 2FINB 2TMPA 3J81i 4CBVA 1BCPC 3U58A 1KDCA 1PMRA 3OHXC 1YIJA 4GOPC 2KCNA 5JPMC 4A93B 2QEXA 1PTOD 5DLQE 4WJ3M 2E76C 5I2YA 4GKKQ 1CA6A 1GHJA 2BDOA 1HRJA 4C1NK 4I65A 4HIMA 1PFBA 2RQXA 4KKSA 4IPDA 2LMCB 4RA8A 4IPHA 4R4IA 1QJOA 4L6TB 3I4OA 3KJPA 1HTPA 4R4TA 3HOWH 5IGDA 2C9OA 4L8JA 5EGTA 4NXML 1A3VA 1I4XA 3S24A 2JA9A 5IGGA 5D65A 2XRSD 1L0XB 4ZRZA 1R9TH 2XNAC 2A6HD 4A3FB 3H6MA 3NXWA 4BS9A 2C5CA 4BY1G 1JCKB 4LF9Q 4I7ZC 1K3BC 1PZJD 4X66Q 1E2ZA 2F0FA 4YY3Q 1K83H 1M8AA 1D8LA 2NTSA 2WB1B 3S2HH 4NXNQ 4B3TQ 3ITPA 2YTVA 2IY5B 1MSGA 3A8IE 2ZT9C 1QE6A 3NELA 2H4OA 3PUYA 5FO7B 4DAVA 2JA5H 3D3RA 5HGTA 3BS1A 1QB5D 1TT2A 2NVQH 2B39A 2A69C 1V1PA 1EOTA 2K50A 1LTBD 4C3JB 4UP9A 1U4LA 1EY8A 3M4QA 4A3EG 1X3QA 2VUMG 2F4IA 4RKBA 2JA6G 5G3LD 3I72A 4UP7A 3I2ZA 2EYOA 5IY0A 4C56C 2UXCQ 1RODA 3J7A5 4HSVA 4L5RC 3C3LA 3BU2A 3CC2A 2N49A 3CKIB 1HNZQ 2IX3A 1LTLA 2BOSA 1X32A 4BBSG 3HG9A 4LFAQ 1M4VA 1PH8A 1I4RA 3F2UA 2YU9H 1F2MA 5BN3A 3F2DA 2CQAA 3N6RA 3M4PA 1BR9A 2Q8TA 1ENAA 1I6VC 3PUVA 3EQLC 4BBRH 2K03A 1F2ZA 3CD6A 3ULLA 1TY0A 4ABNA 3K7AB 3A5UA 2JE6I 4X62L 1BNZA 3MXGA 5CYUA 1DD2A 1MIUA 2X69A 4DV0Q 1LTAD 2JA7B 1GD7A 3VYSA 1XNRQ 1JOOA 2NVYH 4MZ9A 5C4XH 3L0OA 1PH1A 5M3FB 1IL8A 1AZPA 1MI2A 1AW7A 2AWOA 4IUVA 1JE5A 1IBKL 3L3OC 4IFDJ 1JT8A 5C6AA 2JA8H 3GQBA 5J1ZA 4ZYSA 2ALYB 1BBWA 1AZQA 4Q0FA 2PQAA 1C8CA 3U4VA 1EWCA 3NTKA 1SFOH 1CSQA 3RN5A 1VQFA 5DNFA 4JVZA 2R7ZB 1YJWA 2BA1A 3HKSA 4DR3Q 3VR3A 5FLXL 1HA6A 3OW2A 4XT1B 1S5CD 1GOZA 3OTOL 3RZDB 2O5JC 1I4QA 4KJNA 4B3RL 2R93H 4GNXC 1C7YA 3I4NH 5CV9A 1MJCA 4LF7L 2D2CC 1PA6A 1MD2D 1PZID 2HHHL 1O80A 5A2QL 1UUPA 2RVLA 1EWHA 1N36Q 3FDTA 2RF4A 4A3MG 2E5LQ 4JI4L 5IODA 3HOXH 4OO1H 5FO8B 2JQOA 3P7JA 2BE5D 4KHPL 4CKCA 1Y8OB 3MWYW 2A74C 4NMZA 1VQHA 3K5MA 1JC7A 1IL2A 1YNNC 3S17B 1PRTD 4AYBG 3ICEA 4OONA 4LF8L 3DHQA 1FD7D 3PO3H 4FYDA 3LWEA 1BKBA 4O42A 1PH3A 1NTGA 4X65Q 5C0XG 1PH7A 3S1MH 2MQHA 4LAAA 4DK1A 4A4IA 2R92G 3MVVA 1EIYB 3GD7A 5JOBA 1E24A 1XMQQ 3HOZB 1AFPA 3BZKA 1BCPB 1SYDA 3TSSA 4JBKA 2ZJQA 1VQEA 3GDEA 4RHSA 4OIJA 3CPFA 2F0GA 4WJWA 3ZYYX 4DV1L 5CV6A 3C2PA 2UXBL 3UDIA 3STBD 4F88A 3MXUA 4JBJA 1SE2A 4XIGS 3CCUA 3M4OH 3HFZB 5IGEA 5KYLA 3HOWB 2WACA 3DM1A 4LFCQ 2YV5A 3J81j 3OOCA 3VYRA 1CKNB 1CKNA 3SE0A 1R9TB 5ELFA 3JAML 2QCPX 1LTGD 4J6HA 1IYJB 4A3IG 1TWAB 3EA6A 4QIWB 5IP9G 1QNUA 5FOBB 1E3PA 1TWGB 1PFMA 2B2VC 1K8OA 5JVG3 3QG1A 1EQTA 2NZHA 1IBMQ 4HTHA 2NWGA 1WTVA 3HGBA 1HA5A 3PO2H 4R8IA 5FLXc 2Z6KC 3J80L 2NVQB 2OXPA 4KN7C 3K81C 2RHQB 1ASYA 3PUZA 4OX9L 4JV5Q 4TSSA 3AYHB 4HJ8A 2F03A 1P16A 2A73B 4CJ0B 1Y1WG 2EY2A 4P73A 5LMUQ 1BBXC 3ERQA 4JI1Q 4X64Q 3E6ZX 1HZBA 1IYVA 5JEAJ 2PMZB 3GTMH 3F1ZA 1EQRA 3BVZA 2JEAI 4RHRA 5C5MA 2YU9B 2Q2IA 4KKUA 1T9HA 1KL9A 2HD3A 4GKJQ 2OTJA 2JEBI 1DOKA 2KCTA 3A5ZB 4A3CH 1Q8KA 4A3LG 4Z9CB 5GAGC 2LKVA 2Z1CA 3NUCA 3GV3A 2E2DC 2L9HA 3G7LA 1Y69U 1IW7D 1B9NA 2QILA 4HEDA 1CK1A 3EFXD 1JB7A 5C44G 1HXYD 2VXWA 4DAMA 1ZYRD 3HKZB 4LF9L 4WFN3 2B29A 2NVYB 2CFMA 2MUYA 3MFGA 2OQ0A 2EYHA 4BXXH 1G2TA 1TWHH 1Q7YC 3ULPA 4PNYA 1WTRA 4JI7L 1O7ZA 2JA8B 5FLMH 4KD4A 4DV4L 2Z8LA 4KKTA 2O4XA 4LMQD 2EY1A 1VQKA 2RKSA 4XQQA 5IP7H 2ZXRA 2MO1A 2CCZA 1SEBD 2L15A 2PZUA 3T13A 4IN3A 3CPWA 3P75A 1YJNA 1B9MA 1JR0D 2Y0SG 3JAMc 3M85A 1A3TA 2ZJRA 1VQAA 3BJUA 4C3HB 2TSSA 1PYBA 2PPBC 3SXHA 3PIPA 2WIIB 1NNXA 2IL8A 3D4RA 4LFAL 1C0AA 1S5DD 5LMNW 1KD1C 1SYCA 1QG7A 1VQCA 3PSIA 1RTNA 1K73C 2RCNA 1Q82C 1A2UA 5KNBA 4LF6L 2KQ3A 2K6AA 2L55A 3CRLC 1RIPA 3CQZH 2FHTA 3HOUH 5EBDA 3TMEA 4KHZA 1Q3LA 3PO3B 3WOFA 3J80c 3D6WA 2CWPA 4DV2Q 5D14A 1JE4A 4R4CA 1UEAB 4JBMA 4ZAIA 1XNRL 2B63H 2M2LA 1D5MC 2H1EA 2A68D 4YHHQ 4A3BG 4DK3C 4PMCA 1BQQT 3ERSX 1XMOQ 1VQ5A 2BH8A 2EPBA 2ASBA 1I4HA 2F0TA 1QWYA 4K0KQ 5JPNC 4HR7B 3TN2A 2RBMA 5T1IA 1I6HH 1GUOA 4KN4C 4HMJA 2FJ2A 4MNOA 1STEA 3J7YW 2A6ED 3I4MH 3SGIA 1I3QH 4A3KH 4A3DH 5JAVA 5E3FA 2UXDQ 2ZM6L 1F9RA 3IRBA 1SMYC 3AFPA 3S16H 3WWVA 1X9NA 1O7YA 3O13A 4N8FA 3AU7A 2K5NA 3M4OB 1G6PA 3KF6B 4DR6L 3CRKC 4CHTB 1PH9A 4DR4Q 1HHVA 2IT1A 1SBBB 2F1MA 4HCSA 3TRZA 1VDZA 4DXGA 2WAQG 1BCPD 4A3JH 4C3IG 3J81E 1WCMB 4BWGB 5AJ3Q 5M3MG 2K5VA 2KCCA 1BDOA 4IO9A 4DR7L 2R3ZA 1XYIA 1C4QA 1AEXA 1X54A 2PO4A 1JORA 4LF4L 1BVSA 1KDAA 3K57A 4GS3A 1STAA 1SYEA 3HOVH 4JG2A 4XXEA 2AQ3B 3DMUA 5KNCA 5KNDA 5COYA 3PO2B 1HPCA 3ZJYC 2X6LA 1X55A 4PQXA 1HTLD 3SK8A 2K1BA 4UP8A 4JI8L 1A3UA 1LV9A 5D3IB 2VUMH 2Z6KA 1Q81C 2JA6H
chains in the Genus database with same CATH topology
1EZ6A 4EQOA 4FF3A 5CV4A 4ID6A 4CKEA 5LHY1 5ELDA 2K32A 3TDQA 1HFNA 1A6XA 2J7ZA 1HUNA 1J8IA 4XDXA 1ML0D 4U68A 3GTMB 3OIQA 1EQVA 1EY0A 3I3CA 3T51B 4DU9A 2EYLA 1EEFD 4ZUIA 1TU2B 3A55A 1TS2A 3NE5B 4FXKC 1S5FD 1C48A 2F0NA 4U673 1QILA 5CV5A 5I9PA 5LL6S 1F77A 3BZDB 5CV7A 5K36H 4RH6A 1TWHB 2PNRC 3QO2A 2NVXB 1GUSA 2EYPA 3DUZA 1CZWA 2CHBD 4BA2I 2ZXOA 1ZXTA 1JQYD 4DAPA 1Z6HA 2XVSA 2DY7A 1QCBD 2IPKD 1Q1BA 4X3TA 4L63B 4K6DA 1B1ZA 3A7AB 4RAUC 1CA5A 2E74C 4B9WA 4V190 2AQ2B 3K5NA 1CM9A 1DM0B 1WTOA 1LABA 1LO5D 1G8ZD 2BDNA 5NUCA 1GUWA 1Y8NB 4J8QA 4R8NA 5EQ0A 2EJMA 3CQZB 3I73A 3HOUB 1RKNA 1R4PB 1Y8PB 5C0XH 4ODGA 3PIO3 4RKLA 2B63B 3C1FA 4G7HC 1KLUD 2WINB 2WV6D 3I91A 1PFNA 3MEHA 4EQPA 3KLSX 1I6HB 4JBWA 1II3A 1SYGA 3I4MB 4A3KB 1I3QB 4A3DB 3IKJA 3X3NA 1YNND 2FFKB 2FMCA 2JYOA 4OO1I 3GP7A 3MHBA 4K5XA 1B3AA 2B8FA 1PTOF 2OEOA 5C3WA 3LNNA 1HCZA 4C3JG 1WVLA 1V1PB 4H0LC 1XX8A 4A3JB 1TS4A 3KUPA 3MC0B 2BA0A 3BG3A 1Q90A 1GXDC 3T4AC 1H9SB 2J4XA 1H9SA 1CHQD 3MFYA 5I6WA 1EYAA 4H44C 4QMGA 4PMBA 1OO9B 3HOVB 5DEHA 3C1EA 3LX0A 1GJXA 1PLFA 5E4WC 2L5TA 3BDLA 3GTPB 5EKKA 1AN8A 1G291 2DNCA 5AFWA 3IFTA 5C3EB 3DWPA 3H94A 4BBSB 3NQTA 1B4OA 3MXPA 4DF7A 3Q0AA 4N9PA 1D5XC 3S1NB 3OW7A 2L12A 3Q24A 2IW3A 2KOLA 1SNDA 5C4JB 3HRZC 2QKIC 1TWCB 4TRDA 3CU7A 2EVBA 4K8JA 3D31A 1OXSC 3GTOB 4C1NI 2L11A 4KY5A 4KI0A 3HOYB 1TY2A 4KJOA 4E6IA 4B9XA 3TP5A 3QB3A 4LJZC 1PTOH 3I90A 1YNJD 4ZK9B 1SDFA 1E2VA 2NTTA 1V43A 1EIGA 3T53B 1BO0A 3S9WA 2ZXPA 1A2TA 5CV8A 2LS01 5I6YA 1TR5A 5F2DA 5KGUA 3FKIB 1VF5C 2A6HC 2AUKA 4DAYA 1LT5D 1ENFA 1VF7A 3ND8A 1STYA 2F0JA 1TS3A 5ELCA 2IWHA 5CC4A 2XWJB 3E0JA 3OSOA 3V96A 4RGMA 5KYIA 1HFGA 4FF4A 2F0HA 1SJHD 3BVGA 1G91A 1PRTF 5C4ZA 3DEOA 2PZWA 1Y1VB 2ICEC 4CJ1B 3QOLA 4ZUJA 1TVXA 4MN3A 4RCNA 4NDXA 1Q12A 1FYCA 2R61A 2M00A 4IFDG 1TS5A 3NHHA 1SAPA 2QEJC 1TQOA 2K33A 1FNVA 1U4RA 3RUZA 1K83B 1DCZA 3W3AA 1SNPA 1CQVA 3S2HB 3R2TA 1ESFA 4DFAA 2F3WA 1LTTD 2L1BA 5FKAC 3V2TA 2EJGC 1QOHA 2JA5B 2I07B 4R9WA 1Z47A 3GTJB 3NBHA 3NQIA 1MGSA 1RCVD 1H9RA 2FMMA 4BA1I 1V8QA 2HDLA 2NN6G 4V0BA 2NYZD 5CMDA 2F0VA 1WTQA 5M5WB 3H91A 1SMYD 4N9TA 1T5XD 3BYYB 4WRDA 4FXGC 5KEEA 1F2LA 1LTSD 4BBRB 3SK6A 3SK5A 2F0KA 1F9QA 1SE4A 3NSWA 1B50A 2ICIA 1NR4A 4RFBA 4HSPA 2E75C 5C4XB 3DXJC 4X3UA 1UAPA 3LWUA 1ESRA 5IIFA 3QIAA 2QF7A 3M4YA 3D8GA 3TBIB 4PV1C 1FNWA 5IT9E 2MJ8A 2B2UC 1SFOB 1TWFB 1ET9A 3IFDA 1CTMA 2K7VA 2RDHA 3SDZA 2R93B 3I4NB 4C3HG 3UI2A 3S15B 1D1KA 3IL8A 4P2CB 2D62A 1E0BA 3KBGA 3SR1A 4OO1G 4ZKCB 2I46A 1SNOA 3K58A 3HOXB 1AP0A 3OWFA 4WORA 3K6OA 3IAYA 1PXUA 3A56A 5C3XA 1NR2A 4HCEA 3RD4A 3U9SA 1D6EC 3Q22A 3K5LA 2Z4HA 3S1MB 1XXGA 5EKIA 1IYUA 5JEAG 3E5SA 1EL0A 4KV6A 1F9SA 1S5BD 4KK7A 4QUFA 4QB4A 3SVMA 3SHLA 4DGZA 2XWBB 3KK7A 2B2TC 4DNRB 3H0GB 4RGOS 1NUCA 3TZUA 2B2YA 5LL6X 1HUMA 2M9VA 4KMUC 2AWNA 3RMHA 4IURA 4RWSC 1RHPA 4IUNA 2F0MA 3S2DB 1U9RA 2EYJA 1WD0A 4K5VA 5A2QE 4GZYC 4G7OC 1NCVA 3RLFA 1BF4A 3MAQA 2EYFA 1FR3A 2R6GA 1TIID 2XSCA 3HS0C 1WTXA 5C0XI 1BUVT 2L4NA 2F0EA 5FO9B 1WTPA 3URYA 1XWEA 1F2YA 3FVQA 3TP6A 2XN9C 3A8JE 1BCPF 1SSOA 4CGYB 2F3VA 4IALA 3A54A 4KTAA 4G4KA 1W6JA 4A3GB 3QOJA 3GV6A 4YIJA 1EYDA 3BDCA 1LT4D 5EPKA 3GTKB 2A69D 5I9OA 2OT2A 5IGBA 3K5OA 1ONLA 4IZ8A 2WKDA 3GO5A 1QNKA 2LY7A 3D4DA 1LTID 4K8IA 5DM73 1RF2D 1SXTA 3X3MA 1EY5A 3FRPB 1NSNS 4XQNA 2N55A 1EU3A 4QUCA 1J9OA 1DJRD 4F7XA 1CQFA 3JAME 1R4QB 1B2TA 2MHVA 1LT3D 4F87A 2B2UA 4HAEA 1DYQA 4K2LA 3H3VC 2JSOA 3R93A 4M8AA 1B44D 5M5YB 2Z4IA 3BYTB 5EBCA 2D5DA 5KRUA 1D2BA 3BDOA 1GUNA 2MPMA 2PZTA 2PW5A 1EYCA 3J80E 2K04A 2X6GA 2EZVA 2KJXA 4QCLA 1EEID 4UDUC 3I70A 4K2KA 2DNEA 4RGTA 4Q5VA 1OXTA 5DM63 3QJYA 2KVMA 3NP8A 1LACA 3GTQB 2KEEA 1EZ8A 3RZOB 5EJWA 4FF2A 3DEPA 5M9OA 1Q8IA 3DWAA 5BN5A 1CFMA 3MXNA 2AUJD 1ENCA 1WTWA 5JJZA 1SE3A 3C46A 4HMIA 2XIWA 1FGBD 1Q1EA 3S16B 3A7LA 2B2TA 5IT9L 1EY7A 3FEWX 4ZQ3A 3QWNA 1LT6D 5DAUA 4BY1B 4IFDH 2F0QA 4CJ2C 1K8MA 2SOBA 4DN4M 2L0CA 1CT1D 3KLSA 4ULLA 2SEBD 1D1IA 1SJED 2NZ1D 1STHA 3R8BA 1HQMC 4A3EB 5C0XJ 1EY9A 2VUMB 1KABA 2XRQD 2JA6B 3NWTA 5ISRA 1G2SA 1H9KA 4RGNA 4NKLA 4UAIA 2NN6H 2NBFA 2KHSA 4FF1A 3GTLB 2F0DA 2CW0C 3W2DA 2KEDA 1ET6A 4EGVA 1VCIA 5G3LF 2DY8A 3V05A 3S14B 5ELBA 4DA2A 3SK4A 3ND9A 1HQRD 2SNSA 1H9JA 1GUTA 1PDQA 4XT3B 4XYQA 3MA2B 3MTSA 2E2HB 1XTCD 4XYOA 5C5LA 5K36G 3D6CA 4G7ZC 2ID0A 1OXUA 3L7ZC 3OMGA 4CKBA 2EDGA 5M5XB 1JOKA 2K5WA 3J81L 2NVTB 1PTOC 4KD3A 1T5EA 3S1RB 1O7LA 1ILPA 5I2XA 3OWEB 1EFID 3VR6A 2D9UA 3S1QB 2PCFB 2PW7A 2F0PA 4ZKBB 1I50B 1KAAA 3VYUA 4IQZA 1JB3A 3M7GA 5HURA 3P20A 4IUQA 4A3MB 4ILWA 1D5ZC 4OHJA 4DK0A 1SYFA 4DNTB 2F0WA 2K5QA 1H9MA 1I4PA 4AYBB 1G6ZA 1Z7TA 5TSSA 4HN7A 2DN8A 4IUPA 4TQUS 3NPPA 1JICA 3KLRA 1GHKA 2K5DA 2B2WA 3VA5A 1LTRD 2K28A 1ICWA 2B2YC 5JVH3 2R92B 4XTCS 5JEAH 5CORA 3N52A 2WP8J 2G9HD 4XQJA 4OL7A 3I8ZA 1NAPA 4BY7B 3VYTA 2VB2X 3EJIA 2QDBA 3DWQA 1B53A 1CI3M 5J22A 2MP1A 4K14A 2G9DA 5E4XA 4TKOB 2K01A 1EY4A 2ENBA 3OMCA 2YYZA 1KDBA 3WDNA 1MBYA 4KY6A 5K5PA 2F0OA 2Q8IB 1ILQA 2EE1A 5D3DA 3PMFA 2EYMA 3M3YB 4F8MA 4A3IB 1LLRD 1SNQA 1CZGA 3A8KE 3PUWA 2VNUD 3CHBD 3TP7A 2KECA 1UNSA 2K05A 3EVQA 2EXZA 3T56B 5I4DA 3WOEA 1KLGD 1EIHA 5EKLA 3P1HA 4RCOA 2E2IB 1RTOA 2AQ1B 2KUMA 1STGA 1ZEQX 5ELEA 4Y7NB 3AB9A 3R2IA 5J39A 1Y1WB 1X3PA 2LFNA 2EY5A 5IGFA 3K59A 5E1FA 4KY7A 3G6JB 5C4HA 4NP5A 2BE5C 1YNJC 5KIXA 4FVMA 1PRTC 3HEJA 4X3KA 2WKCA 2JP1A 3NBIA 2HCCA 1WD1A 5EPJA 5C44B 2PYKA 2Q8RE 5T1GA 4B08A 2N88A 1BXTA 3I4LA 4K5WA 1PYWD 4FP5D 4EQNA 1BOSA 2IX0A 3FPPA 3NK9A 4G57A 1CHPD 1IKLA 3Q23A 2SDFA 1DOMA 2IJ0A 5IGCA 2CVRA 2VB3X 2F0UA 1PTOB 4H7BA 5IOCA 3M7NA 1RD9D 2HCIA 2RSOA 1OXXK 3HZXA 2Y0SB 3PIP3 2F0LA 3K0YA 5CBAE 3H09A 4K6LA 1U4MA 1KTKA 1MSHA 1F9PA 2J0TD 3PUXA 1E2WA 1RJTA 2EY6A 1IHZA 1SNMA 3J7AF 5CGKA 1SNCA 4DXFA 2O2LD 1I4GA 4ZLTF 4M1UB 3VR2A 2B8GA 3ONAB 4FXDA 4A3BB 2GA4B 1JOQA 4C2MB 4QF4A 5FK9C 1JWMD 4OGQC 4S3SA 1O78A 1OXVA 1VMCA 3AMUA 3NTHA 3TZDA 5FLXE 5EPLA 1IKMA 1FNUA 1JWSD 3NTIA 3GTGB 3MZ5A 4NW2A 4FNFA 1IW7C 1S5ED 2EJFC 4PMWA 1A15A 1EY6A 2BCOA 2WAQB 1ZYRC 4C3IB 4LK1C 4FO2A 5M3MB 3KF8A 2B2VA 4H13C 5CBEE 2RSNA 4IUTA 4O1NA 2NB0A 1GUGA 3SEBA 3T16A 3VR5A 3FPUB 1S4ZA 2F0IA 3HP3A 1RDPD 2RDFA 3OIPA 3VR4A 4EVOA 1DZ1A 4OIKA 2KA7A 2RDGA 3Q6SA 1W6KA 4IUUA 3KBXA 3L9AX 3R3OA 3PV0A 1DOLA 2EOTA 3D4WA 3NWSA 1KNAA 4IFDI 2IX1A 3TP8A 2E2JB 3VA7A 1PZKD 1PRTB 2F0SA 1DONA 1EU4A 2SNMA 1JWUD 4KHVA 5A35A 1SYBA 3J7AV 2O5IC 2A68C 2HDMA 1STBA 3U9OA 1L0YB 2CW0D 2PQEA 3BVMA 3OPOA 2OF1A 2MGSA 4X3SA 2A6EC 1DXMA 2NN6I 2V4DA 1STNA 3FMCA 4ME5A 4MHEA 2RA4A 2A5HA 4JK1C 5CR3A 1V1OA 4J1MA 1VMPA 4MIUA 1KNEA 2HUGA 5BN4A 1TKWB 2HQEA 2B2WC 2NUCA 1U4PA 2JXMB 1ZKOA 3EROA 2FINB 2TMPA 4CBVA 1BCPC 1KDCA 1PMRA 3OHXC 2KCNA 5JPMC 4A93B 1PTOD 2E76C 5I2YA 1CA6A 1GHJA 2BDOA 1HRJA 4C1NK 4I65A 1PFBA 2RQXA 4KKSA 2LMCB 4RA8A 1QJOA 4L6TB 1HTPA 5IGDA 2C9OA 4L8JA 5EGTA 1A3VA 1I4XA 5IGGA 5D65A 2XRSD 1L0XB 4ZRZA 2XNAC 2A6HD 4A3FB 3H6MA 3NXWA 4BS9A 2C5CA 1JCKB 4I7ZC 1PZJD 1E2ZA 2F0FA 1M8AA 2NTSA 2WB1B 3ITPA 1MSGA 3A8IE 2ZT9C 1QE6A 2H4OA 3PUYA 5FO7B 4DAVA 3D3RA 5HGTA 3BS1A 1QB5D 1TT2A 2B39A 2A69C 1V1PA 1EOTA 1LTBD 4C3JB 1U4LA 1EY8A 1X3QA 2F4IA 4RKBA 5G3LD 3I72A 2EYOA 4C56C 1RODA 4HSVA 3C3LA 3CKIB 2IX3A 2BOSA 1X32A 3HG9A 1M4VA 1I4RA 3F2UA 1F2MA 5BN3A 2CQAA 3N6RA 1BR9A 2Q8TA 1ENAA 1I6VC 3PUVA 3EQLC 2K03A 1F2ZA 1TY0A 4ABNA 3K7AB 2JE6I 1BNZA 3MXGA 5CYUA 1DD2A 2X69A 1LTAD 2JA7B 3VYSA 1JOOA 5M3FB 1IL8A 1AZPA 1MI2A 1AW7A 2AWOA 4IUVA 3L3OC 4IFDJ 5C6AA 3GQBA 5J1ZA 4ZYSA 1AZQA 4Q0FA 1C8CA 1EWCA 3NTKA 5DNFA 2R7ZB 2BA1A 3VR3A 5FLXL 1HA6A 4XT1B 1S5CD 1GOZA 3RZDB 2O5JC 1I4QA 4KJNA 5CV9A 2D2CC 1MD2D 1PZID 1O80A 5A2QL 1UUPA 2RVLA 1EWHA 3FDTA 5IODA 4OO1H 5FO8B 3P7JA 2BE5D 4CKCA 1Y8OB 3MWYW 2A74C 4NMZA 3K5MA 1JC7A 1YNNC 3S17B 1PRTD 3DHQA 1FD7D 4FYDA 3LWEA 4O42A 5C0XG 4LAAA 4DK1A 3MVVA 3GD7A 5JOBA 3HOZB 1AFPA 1BCPB 1SYDA 3TSSA 4RHSA 4OIJA 3ZYYX 2F0GA 4WJWA 5CV6A 3C2PA 4F88A 3MXUA 1SE2A 4XIGS 5IGEA 5KYLA 3HOWB 2WACA 3DM1A 3OOCA 3VYRA 3SE0A 1R9TB 5ELFA 3JAML 2QCPX 1LTGD 4J6HA 1TWAB 3EA6A 4QIWB 1QNUA 5FOBB 1TWGB 1PFMA 2B2VC 1K8OA 5JVG3 3QG1A 1EQTA 4HTHA 2NWGA 1WTVA 3HGBA 1HA5A 4R8IA 3J80L 2NVQB 2OXPA 4KN7C 3PUZA 4TSSA 2F03A 4CJ0B 2A73B 2EY2A 1BBXC 3ERQA 3E6ZX 1IYVA 5JEAJ 2PMZB 3BVZA 2JEAI 4RHRA 5C5MA 2YU9B 4KKUA 2JEBI 1DOKA 4Z9CB 2LKVA 2Z1CA 3NUCA 3GV3A 2E2DC 2L9HA 3G7LA 1Y69U 1IW7D 1B9NA 2QILA 4HEDA 1CK1A 3EFXD 1HXYD 2VXWA 1ZYRD 3HKZB 4WFN3 2NVYB 2MUYA 3MFGA 2EYHA 1G2TA 4PNYA 1WTRA 1O7ZA 2JA8B 4KD4A 2Z8LA 4KKTA 2O4XA 4LMQD 2EY1A 2RKSA 4XQQA 2ZXRA 1SEBD 2PZUA 3T13A 4IN3A 3P75A 1B9MA 1JR0D 3M85A 1A3TA 4C3HB 2TSSA 2PPBC 3SXHA 2WIIB 3D4RA 2IL8A 1S5DD 1SYCA 1QG7A 1RTNA 1A2UA 5KNBA 2KQ3A 2K6AA 2L55A 3CRLC 2FHTA 5EBDA 3TMEA 4KHZA 1Q3LA 3PO3B 3WOFA 3D6WA 5D14A 1JE4A 1UEAB 4ZAIA 2M2LA 1D5MC 2H1EA 2A68D 4PMCA 1BQQT 2EPBA 1I4HA 2F0TA 1QWYA 5JPNC 4HR7B 3TN2A 2RBMA 5T1IA 1GUOA 4KN4C 4HMJA 2FJ2A 1STEA 3J7YW 2A6ED 5JAVA 5E3FA 1F9RA 1SMYC 1O7YA 3O13A 3AU7A 3M4OB 3CRKC 4CHTB 1HHVA 2IT1A 1SBBB 2F1MA 4HCSA 1VDZA 4DXGA 1BCPD 4C3IG 3J81E 1WCMB 4BWGB 2KCCA 1BDOA 2R3ZA 1XYIA 1C4QA 1AEXA 2PO4A 1JORA 1KDAA 3K57A 1STAA 1SYEA 4XXEA 2AQ3B 3DMUA 5KNCA 3PO2B 5COYA 1HPCA 2X6LA 4PQXA 1HTLD 3SK8A 2K1BA 1A3UA 1LV9A 5D3IB 5KNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZ6 A;  3NXW A;  5J39 A;  1SNC A;  1SYF A;  3NQT A;  5CV4 A;  4EQO A;  3QOL A;  1RKN A;  4ID6 A;  1SYC A;  2F0W A;  3MXP A;  4KJN A;  4HTH A;  4ZUJ A;  1STH A;  4N9P A;  3TP8 A;  4DF7 A;  5CV9 A;  5KRU A;  1A2U A;  2F0F A;  4IUN A;  2KQ3 A;  1EY9 A;  2F0M A;  4ODG A;  1KAB A;  2EY5 A;  2PZT A;  5IGF A;  4RKL A;  1JOQ A;  4NDX A;  2F0S A;  1U9R A;  2PW5 A;  2OXP A;  1EYC A;  4KY7 A;  3C1F A;  2EYJ A;  4QF4 A;  2SNM A;  2M00 A;  3ITP A;  4NP5 A;  5C4H A;  4K5V A;  3NHH A;  4S3S A;  3TME A;  4KHV A;  1SND A;  1TQO A;  4NKL A;  1EQV A;  5IOD A;  1EY0 A;  1SYB A;  5KIX A;  3RUZ A;  3VA5 A;  2KHS A;  2EYF A;  1SNP A;  2EY2 A;  3HEJ A;  3MEH A;  4EQP A;  2F0D A;  3ERQ A;  5HGT A;  4TRD A;  4NMZ A;  3SR1 A;  1TT2 A;  4DU9 A;  2EYL A;  1STB A;  4K2K A;  3U9O A;  4ZUI A;  1II3 A;  1SNO A;  2F0E A;  4DFA A;  4K8J A;  1SYG A;  1EY8 A;  2F3W A;  2PQE A;  3DHQ A;  1F2Y A;  4RKB A;  4PMC A;  2OF1 A;  2PYK A;  3V2T A;  3OWF A;  4WOR A;  3SK4 A;  3TP6 A;  5C5M A;  4KY5 A;  5ISR A;  2F0T A;  2SNS A;  4OL7 A;  2EYO A;  4K5W A;  5C3X A;  2F0N A;  2RBM A;  3NP8 A;  3MZ5 A;  5CV5 A;  5E1F A;  3EJI A;  4KJO A;  4E6I A;  5I9P A;  2QDB A;  4B9X A;  4EQN A;  4HMJ A;  3MHB A;  4K5X A;  4LAA A;  1STN A;  2F3V A;  3TP5 A;  4IAL A;  3QB3 A;  4ME5 A;  5CV7 A;  2OEO A;  2LKV A;  4KTA A;  5JAV A;  3NUC A;  3MVV A;  5E3F A;  5JOB A;  5C3W A;  5J22 A;  5CR3 A;  1EY6 A;  3NK9 A;  1EZ8 A;  4G57 A;  4K14 A;  3QOJ A;  4YIJ A;  1F2M A;  1EYD A;  1EY4 A;  5C5L A;  3BDC A;  2ENB A;  2F0V A;  3D6C A;  3OMC A;  4J1M A;  1SYD A;  5M9O A;  4MIU A;  5IGC A;  4N9T A;  1ENA A;  1KDB A;  1ENC A;  2F0U A;  4H7B A;  2EYP A;  1F2Z A;  2HQE A;  2NUC A;  2F0O A;  3E5S A;  4KY6 A;  5I9O A;  5IOC A;  5IGB A;  5K5P A;  2F0G A;  3ERO A;  4KV6 A;  4HMI A;  4WRD A;  3S9W A;  3OMG A;  1A2T A;  5CV8 A;  2EYH A;  4IZ8 A;  5CV6 A;  5I6Y A;  5KEE A;  1TR5 A;  3PMF A;  5F2D A;  2EYM A;  5I6W A;  5KGU A;  4QB4 A;  1KDC A;  1JOK A;  4PNY A;  3D4D A;  4F8M A;  3SK6 A;  1EYA A;  3SHL A;  3SK5 A;  2F0K A;  3HZX A;  4K8I A;  4KD3 A;  4PMB A;  4QMG A;  3T16 A;  4KD4 A;  4DGZ A;  2F0I A;  5KYL A;  1SNQ A;  5DEH A;  2F0L A;  2O4X A;  1EY7 A;  2EY1 A;  1JOO A;  1EY5 A;  1STY A;  2RKS A;  1NSN S;  2F0J A;  2RDF A;  3C1E A;  3LX0 A;  2WAC A;  4ZQ3 A;  5CGK A;  5IGE A;  4I65 A;  5CC4 A;  5DAU A;  4K6D A;  3TP7 A;  4F7X A;  3OSO A;  2PW7 A;  4EVO A;  1AEX A;  2F0P A;  4B9W A;  1NUC A;  2F0Q A;  2PZU A;  5KYI A;  3T13 A;  3EVQ A;  1KDA A;  2EXZ A;  5C6A A;  5J1Z A;  1JOR A;  4J6H A;  1KAA A;  1STA A;  1SYE A;  3P75 A;  3DMU A;  2SOB A;  3BDL A;  2F0H A;  2EY6 A;  5EKK A;  5HUR A;  5IGD A;  5EGT A;  5EKL A;  3SXH A;  5NUC A;  1A3V A;  1A3T A;  1IHZ A;  3P1H A;  3R3O A;  4R8N A;  3SK8 A;  5IGG A;  3D4W A;  5IIF A;  1SNM A;  5C4Z A;  1A3U A;  2PZW A;  4K2L A;  1STG A;  3D8G A;  3H6M A; 
#chains in the Genus database with same CATH topology
 1EZ6 A;  1VQM A;  1XMQ L;  1HNX Q;  3D0F A;  4EQO A;  5CV4 A;  4DR1 Q;  4FF3 A;  4ID6 A;  4CKE A;  3GTP H;  3KOJ A;  5LHY 1;  5ELD A;  1JJ2 A;  2K32 A;  3TDQ A;  1HFN A;  1NY4 A;  1A6X A;  2J7Z A;  1HUN A;  1J8I A;  2VQE L;  4XDX A;  1ML0 D;  4U68 A;  3GTM B;  2QGQ A;  3OIQ A;  4BBS H;  1EQV A;  1EY0 A;  4AH6 A;  3I3C A;  4YCU A;  4X6A H;  3T51 B;  4DU9 A;  4CDC C;  2EYL A;  1EEF D;  4ZUI A;  1UE1 A;  1TU2 B;  2K75 A;  3A55 A;  2CKZ B;  4LFC L;  1TS2 A;  5C4J H;  4AYB E;  3NE5 B;  4FXK C;  1S5F D;  1C48 A;  2F0N A;  3CW2 C;  1TWC H;  4U67 3;  1QIL A;  5CV5 A;  2OWO A;  1FL0 A;  5I9P A;  3BZC A;  5IE8 A;  3OYY A;  1A0I A;  5LL6 S;  1F77 A;  3BZD B;  5CV7 A;  3GTO H;  5K36 H;  1MKH A;  2ZTD A;  4IOC A;  4RH6 A;  1TWH B;  2PNR C;  3QO2 A;  2NVX B;  1GUS A;  3HOY H;  2R7F A;  5M5X H;  5IYD G;  2EYP A;  3DUZ A;  1CZW A;  2CHB D;  1HH2 P;  4BA2 I;  2Z6B A;  2ZXO A;  1ZXT A;  1JQY D;  4DAP A;  1Z6H A;  2XVS A;  2EIF A;  2DY7 A;  1QCB D;  2IPK D;  3H3V H;  4DV7 Q;  1Q1B A;  1B70 B;  4X3T A;  2HQL A;  4L63 B;  4K6D A;  1B1Z A;  3A7A B;  4RAU C;  1CA5 A;  4WJ4 A;  2E74 C;  4B9W A;  3FKI H;  4V19 0;  5JJK A;  4A3M H;  2AQ2 B;  3K5N A;  1CM9 A;  1DM0 B;  1WTO A;  1LAB A;  1LO5 D;  1G8Z D;  2BDN A;  3U50 C;  2F4V L;  3UE0 A;  5NUC A;  1GUW A;  1Y8N B;  4J8Q A;  4R8N A;  4A93 G;  5EQ0 A;  2EJM A;  2I5H A;  3CQZ B;  3I73 A;  3HOU B;  2KHI A;  1RKN A;  1UWV A;  1R4P B;  1Y8P B;  5C0X H;  4ODG A;  4PZ7 A;  1WOC A;  3PIO 3;  4LFB L;  4RKL A;  2B63 B;  3C1F A;  4G7H C;  1KLU D;  2ZTC A;  1Y1V H;  2WIN B;  2HT1 A;  2WV6 D;  1GM5 A;  2N78 A;  3I91 A;  4A3F G;  1PFN A;  1QVG A;  3MEH A;  3KLS X;  4EQP A;  1JMC A;  2DGY A;  3TEH B;  1I6H B;  1V9P A;  4JBW A;  1II3 A;  1I94 L;  1SYG A;  3I4M B;  4A3K B;  1I3Q B;  4A3D B;  3IKJ A;  3X3N A;  3W5O A;  1YNN D;  2FFK B;  1GVP A;  3T1H L;  2WB1 G;  2UUB Q;  2FMC A;  2JYO A;  4OO1 I;  3GP7 A;  2BH2 A;  3MHB A;  3JC6 6;  4K5X A;  2UU9 L;  1B3A A;  2B8F A;  1PTO F;  2OEO A;  5C3W A;  3LNN A;  1HCZ A;  4C3J G;  1WVL A;  4OEM B;  3UE1 A;  4DV3 L;  1V1P B;  4JPB W;  4H0L C;  2VW9 A;  4O0A A;  5ELN A;  1XX8 A;  4A3J B;  2H5X A;  1TS4 A;  3KUP A;  3MC0 B;  5HGQ A;  2BA0 A;  3BG3 A;  1Q90 A;  3GTJ H;  1GXD C;  4POF A;  3CCM A;  4B3M L;  4DR5 L;  3T4A C;  1H9S B;  2J4X A;  1H9S A;  4JI5 Q;  1CHQ D;  3MFY A;  4DPG A;  5I6W A;  4ZCK A;  5IYC H;  1ASZ A;  1SLJ A;  1EYA A;  5M5W H;  1PH4 A;  3EBE A;  4H44 C;  4QMG A;  4PMB A;  1OO9 B;  3HOV B;  5DEH A;  2D0P A;  1EOV A;  2UUC L;  4KLK A;  3C1E A;  3LX0 A;  5IWA L;  3JAM i;  1GJX A;  2ZJP A;  3H15 A;  1SRU A;  3CCQ A;  3DLL A;  1PLF A;  5E4W C;  2L5T A;  1XJV A;  3BDL A;  3GTP B;  5EKK A;  1AN8 A;  1G29 1;  2DNC A;  4JYA Q;  5AFW A;  1J5E L;  2JA7 G;  3IFT A;  5C3E B;  3DWP A;  5L37 A;  5M3F G;  2Y0S E;  3H94 A;  4BBS B;  5IYB G;  3NQT A;  4O2D A;  1E7Z A;  1B4O A;  3MXP A;  4DF7 A;  3Q0A A;  4N9P A;  1D5X C;  3J80 i;  2DJF C;  1XPR A;  3S1N B;  3OW7 A;  2L12 A;  3Q24 A;  2IW3 A;  2KOL A;  3FHW A;  4DR4 L;  2PQA B;  2R7Z G;  1SND A;  5C4J B;  2P5Z X;  4JI3 L;  3HRZ C;  1TWF H;  2QKI C;  1TWC B;  4HID A;  1K3R A;  1HR0 L;  4TRD A;  3CU7 A;  3J7Z C;  5GAH C;  2EVB A;  4K8J A;  3G6E A;  3E9I A;  4QQB X;  3D31 A;  1OXS C;  3GTO B;  2AHO B;  4C1N I;  2L11 A;  3S15 H;  4KY5 A;  4KI0 A;  4LUZ A;  3HOY B;  1TY2 A;  4KJO A;  4E6I A;  4B9X A;  1DGS A;  3TP5 A;  2XTI A;  2A19 A;  3NEN A;  3QB3 A;  4LJZ C;  1PTO H;  3I90 A;  5GAD C;  1YNJ D;  4IPG A;  4ZK9 B;  1SDF A;  4LF5 Q;  1E2V A;  2NTT A;  3T1Y Q;  2ZTE A;  1V43 A;  1A63 A;  4DR1 L;  2GVB A;  1EIG A;  1YHA A;  3T53 B;  1BO0 A;  3S9W A;  2ZXP A;  1A2T A;  5CV8 A;  2LS0 1;  4J15 A;  5I6Y A;  1CSP A;  1TR5 A;  5F2D A;  1XNQ Q;  5KGU A;  4YWM A;  3FKI B;  1VF5 C;  2A6H C;  4DAY B;  2AUK A;  3HOZ G;  4DAY A;  1KHI A;  1LT5 D;  1ENF A;  1A8V A;  1VF7 A;  1N8R C;  3EN2 A;  3ND8 A;  1STY A;  2WAQ E;  2F0J A;  1TS3 A;  5ELC A;  2IWH A;  5CC4 A;  2XWJ B;  3E0J A;  3OSO A;  3V96 A;  4RGM A;  5KYI A;  1HFG A;  4BY7 G;  1X3G A;  4PZ6 A;  1Y14 B;  4FF4 A;  2F0H A;  5LMN Q;  1SJH D;  3BVG A;  4JCV E;  3H0G H;  2JJQ A;  1G91 A;  1PRT F;  5C4Z A;  3HOW G;  4DNI A;  3DEO A;  2PZW A;  4A3B H;  3G48 A;  4JI6 Q;  1Y1V B;  3CC4 A;  1N33 L;  2ICE C;  4CJ1 B;  5GQO A;  3QOL A;  4ZUJ A;  1TVX A;  4DV6 L;  1U5K A;  4MN3 A;  3UDG A;  4ME3 A;  4JI0 L;  4RCN A;  4DUZ Q;  4NDX A;  1Q12 A;  1FYC A;  2R61 A;  2M00 A;  4IFD G;  1TS5 A;  3NHH A;  1SAP A;  2QEJ C;  1TQO A;  1K8A C;  2K33 A;  1FNV A;  1U4R A;  3RUZ A;  1K83 B;  1DCZ A;  3W3A A;  1SNP A;  1CQV A;  2N3S A;  3S2H B;  3S2D H;  3R2T A;  4LW1 A;  1XTD A;  4DV5 L;  1MJE A;  1ESF A;  2IHF A;  4L5S A;  4DFA A;  3KFU A;  2F3W A;  1LTT D;  2L1B A;  1VQ9 A;  1CKO A;  1EWI A;  5FKA C;  2EJG C;  3V2T A;  1QOH A;  2JA5 B;  2I07 B;  3KLW A;  4R9W A;  1Z47 A;  1PH2 A;  5M3M H;  3GTJ B;  1X65 A;  3NBH A;  3NQI A;  1MGS A;  1RCV D;  1H9R A;  2FMM A;  2ES2 A;  4BA1 I;  1V8Q A;  2HDL A;  1VQD A;  2NN6 G;  4V0B A;  2NYZ D;  5CMD A;  2F0V A;  4GN3 B;  1WTQ A;  4JC0 A;  5M5W B;  3H91 A;  4GKK L;  1SMY D;  4N9T A;  4QY7 A;  1LYL A;  1T5X D;  3BYY B;  5FJ8 G;  4WRD A;  4DR2 Q;  4FXG C;  5KEE A;  4A3G H;  1F2L A;  4AIM A;  1LTS D;  2K14 A;  4BBR B;  2D0O A;  3SK6 A;  3SK5 A;  2F0K A;  3GTK H;  1HNW Q;  1H95 A;  1F9Q A;  3HKZ G;  1YZ6 A;  1SE4 A;  3NSW A;  4L5T A;  1B50 A;  2ICI A;  1NR4 A;  4RFB A;  2K4K A;  2PI2 E;  4HSP A;  4OWT B;  3MEF A;  2E75 C;  4X66 L;  3FP9 A;  4YY3 L;  5C4X B;  1VQJ A;  3DXJ C;  2K52 A;  4X3U A;  2JA8 G;  3UDF A;  1UAP A;  3LWU A;  4NXN L;  4B3T L;  1ESR A;  5IIF A;  3QIA A;  3CCS A;  2QF7 A;  3M4Y A;  3D8G A;  3TBI B;  2QA4 A;  4PV1 C;  1FNW A;  5IT9 E;  2MJ8 A;  1QZG A;  4HIO A;  2B2U C;  4P71 A;  1SFO B;  1TWF B;  1KRS A;  1ET9 A;  3IFD A;  1CTM A;  2N8N A;  2K7V A;  3K0X A;  4NXM Q;  1EIF A;  2RDH A;  4JI5 L;  3SDZ A;  2R93 B;  3I4N B;  4C3H G;  2OCE A;  3UI2 A;  2UXC L;  5M5Y H;  3G71 A;  3S15 B;  1D1K A;  3IL8 A;  4P2C B;  2QDL A;  2D62 A;  1HNZ L;  1E0B A;  3KBG A;  3SR1 A;  4OO1 G;  4ZKC B;  2I46 A;  1SNO A;  3K58 A;  4JI2 Q;  3HOX B;  1AP0 A;  3OWF A;  4WOR A;  1IBL Q;  3K6O A;  3IAY A;  1PXU A;  3A56 A;  5C3X A;  4Y52 H;  1WYD A;  2RCF A;  3PO3 G;  2WB1 E;  4LWC A;  1NR2 A;  1VQ8 A;  4HCE A;  1NMF A;  1VQN A;  3RD4 A;  3U9S A;  4JYA L;  1D6E C;  3Q22 A;  4IJL A;  1K8G A;  3K5L A;  2Z4H A;  4DV0 L;  3S1M B;  1PH5 A;  3ULJ A;  1XXG A;  5EKI A;  1YEZ A;  1IYU A;  5JEA G;  3GTQ H;  3E5S A;  1EL0 A;  1JJG A;  4DUY Q;  1SR3 A;  4KV6 A;  1F9S A;  4A93 H;  1S5B D;  4KK7 A;  3RZO H;  1X56 A;  4QUF A;  4QB4 A;  3SVM A;  3SHL A;  4DGZ A;  2XWB B;  3KK7 A;  4A76 A;  4IJH A;  1K0S A;  1QUQ A;  4DR3 L;  2B2T C;  4DNR B;  3H0G B;  4RGO S;  1NUC A;  3TZU A;  1S3O A;  1FVI A;  2B2Y A;  5LL6 X;  3TQY A;  1HUM A;  1PH6 A;  1NBW A;  1WCM G;  1N36 L;  3H3V I;  1AE3 A;  2E5L L;  4BY1 H;  1A62 A;  2KBN A;  2M9V A;  4KMU C;  2AWN A;  3RMH A;  4IUR A;  4RWS C;  4HJ7 A;  1IBK Q;  1RHP A;  3T1Y L;  2NZO A;  2I5L X;  4A75 A;  1NE3 A;  4IUN A;  3F8T A;  2F0M A;  3S2D B;  3E9H A;  3CCJ A;  1I5F A;  1U9R A;  3PO2 G;  2EYJ A;  5GAE C;  1VS0 A;  2KCM A;  1WD0 A;  4K5V A;  5A2Q E;  4GZY C;  4C3J H;  4EQ5 A;  4G7O C;  1NCV A;  3RLF A;  1BF4 A;  4X65 L;  1KC8 C;  1V1Q A;  3MAQ A;  2EYF A;  1FR3 A;  3OTO Q;  2R6G A;  4A3E H;  4MTK A;  4B3R Q;  1TII D;  2XSC A;  3HS0 C;  1WTX A;  5C0X I;  4LF7 Q;  1BUV T;  2L4N A;  2F0E A;  4HJ9 A;  5FO9 B;  1WTP A;  3KYH C;  1K0R A;  1XWE A;  3URY A;  2HHH Q;  1F2Y A;  3FVQ A;  3TP6 A;  4JOI C;  2XN9 C;  4JI4 Q;  1PYS B;  3GTL H;  3A8J E;  1BCP F;  1SSO A;  3EIV A;  4LUV A;  4CGY B;  2F3V A;  4IAL A;  2MFI A;  3A54 A;  4KTA A;  3S14 H;  4A3C G;  4G4K A;  1W6J A;  2VS1 A;  1N34 Q;  4LF8 Q;  4A3G B;  3QOJ A;  3GV6 A;  4YIJ A;  1EYD A;  2PNH A;  1SRO A;  4JI6 L;  3BDC A;  1LT4 D;  5EPK A;  3GTK B;  2A69 D;  5I9O A;  2OT2 A;  5IGB A;  3K5O A;  1ONL A;  1LM0 A;  4IZ8 A;  2WKD A;  3GO5 A;  2E2H H;  2Z9H A;  1QNK A;  2LY7 A;  3D4D A;  1LTI D;  4K8I A;  5HY6 A;  4BXX G;  5DM7 3;  2WFW A;  1RF2 D;  3AQQ A;  1SXT A;  3X3M A;  4AQY Q;  1EY5 A;  3FRP B;  1NSN S;  4XQN A;  2N55 A;  4P72 A;  1EU3 A;  4QUC A;  1J9O A;  2VY3 A;  1DJR D;  1IBM L;  4F7X A;  4DV1 Q;  5IP7 G;  1N9W A;  2CQO A;  2NVT H;  1YVC A;  1CQF A;  1EYG A;  3JAM E;  1R4Q B;  1B2T A;  3S1R H;  1XPO A;  2MHV A;  1LT3 D;  1PV4 A;  3E3X A;  4F87 A;  4OWX B;  3NEM A;  2B2U A;  4HAE A;  3S1Q H;  4JV5 L;  1DYQ A;  4K2L A;  2VL6 A;  1WFQ A;  3H3V C;  2JSO A;  4GLX A;  1I50 H;  3R93 A;  3CP0 A;  4M8A A;  2AKW B;  1B44 D;  5LMU L;  5M5Y B;  4JI1 L;  2Z4I A;  3BYT B;  4X64 L;  5EBC A;  2D5D A;  5KRU A;  1D2B A;  1IXR A;  3BDO A;  1GUN A;  4UHV A;  2MPM A;  2PZT A;  2UUA Q;  1L1O A;  2PW5 A;  1EYC A;  3J80 E;  2K04 A;  4QIW E;  2X6G A;  4GKJ L;  2EZV A;  2KJX A;  2KHJ A;  4QCL A;  1KXL A;  3HOU G;  1EEI D;  4DKA C;  4UDU C;  3PCO B;  1D7Q A;  1VQ7 A;  1VQG A;  3I70 A;  4K2K A;  2XGT A;  1IZ6 A;  1U0L A;  2DNE A;  2PI2 A;  4RGT A;  1BBU A;  3L2P A;  4GLV B;  4Q5V A;  1OXT A;  5DM6 3;  1EFW A;  2B63 G;  3QJY A;  3W1B A;  4OX9 Q;  2KVM A;  3NP8 A;  3PIO A;  2R92 H;  3UDX A;  1LAC A;  3GTQ B;  2KEE A;  1EZ8 A;  3RZO B;  5EJW A;  3I4M G;  4A3K G;  4FF2 A;  4A3D G;  3DEP A;  5M9O A;  4BY7 H;  2DJG C;  1Q8I A;  3DWA A;  3MXN B;  1CFM A;  3MXN A;  2AUJ D;  5BN5 A;  2PMZ E;  2CH4 A;  1ENC A;  1WTW A;  1HR0 W;  5JJZ A;  1SE3 A;  3C46 A;  2XIW A;  4HMI A;  1FGB D;  1Q1E A;  3S16 B;  3A7L A;  2B2T A;  4B3S Q;  1VQ4 A;  4HJA A;  5IT9 L;  1L0W A;  1EY7 A;  4A3J G;  3FEW X;  3M9B A;  1TWA H;  2GN5 A;  4ZQ3 A;  3QWN A;  1LT6 D;  5DAU A;  1TWG H;  1WJJ A;  3M3Y H;  1HZA A;  4A3I H;  1TXY A;  1CUK A;  4JI2 L;  4BY1 B;  3HKZ E;  2F0Q A;  5IP9 H;  4IFD H;  3CF5 A;  4CJ2 C;  1IBL L;  1K8M A;  2I0Q A;  4JI7 Q;  2SOB A;  2OTL A;  3PGZ A;  3KJO A;  4DV4 Q;  4DN4 M;  1FJG Q;  3HOV G;  3PF4 A;  3TS2 A;  1CKM A;  2L0C A;  1CT1 D;  3KLS A;  4ULL A;  3E0E A;  4DV2 L;  2SEB D;  1D1I A;  1SJE D;  1UE7 A;  2NZ1 D;  1STH A;  1N32 Q;  3R8B A;  1HQM C;  4A3E B;  5C0X J;  1EY9 A;  4YHH L;  2VUM B;  1KAB A;  2XRQ D;  3QR8 A;  2E2I H;  2JA6 B;  3NWT A;  4TVA B;  5ISR A;  1XMO L;  4DUY L;  1G2S A;  1H9K A;  4Y7N H;  1Y1W H;  4K0K L;  3PQI A;  4RGN A;  4NKL A;  3AEV A;  5C3E G;  3ER0 A;  4UAI A;  4HIK A;  2NN6 H;  2NBF A;  2KHS A;  4RG1 A;  4FF1 A;  4JOI A;  2F0D A;  3GTL B;  2CW0 C;  4P74 A;  3W2D A;  2KED A;  1ET6 A;  1KQS A;  2UXD L;  1QVF A;  1PVO A;  4EGV A;  1GKH A;  1VCI A;  4LF6 Q;  5G3L F;  5FJ8 H;  4PZ8 A;  2DY8 A;  3V05 A;  3S14 B;  5ELB A;  4DA2 A;  4PG3 A;  3SK4 A;  1X3E A;  3ND9 A;  1HQR D;  2SNS A;  1H9J A;  1GUT A;  2RHS B;  4A3L H;  3CMA A;  4ALP A;  1UE5 A;  1PDQ A;  3RR5 A;  4XT3 B;  2CWA A;  2C35 B;  1YIT A;  2Q2H A;  4XYQ A;  5C44 H;  3TRE A;  3MA2 B;  2QW7 A;  1QZH A;  3MTS A;  3VDY A;  2E2H B;  1XTC D;  4XYO A;  5C5L A;  5K36 G;  3D6C A;  5AJ3 L;  1G51 A;  4CDE C;  4G7Z C;  2ID0 A;  1PHJ A;  1OXU A;  4LUO A;  3HOY G;  3L7Z C;  3OMG A;  4CKB A;  3PF5 A;  2A8V A;  5GRO A;  2EDG A;  5H1S E;  5M5X B;  1JOK A;  2K5W A;  2ZM6 Q;  3J81 L;  2NVT B;  1PTO C;  4KD3 A;  1XPU A;  1T5E A;  2LXJ A;  3S1R B;  1O7L A;  1ILP A;  5I2X A;  3B6Y A;  3OWE B;  1EFI D;  3VR6 A;  2D9U A;  4JW0 A;  3S1Q B;  2MNA A;  4DR6 Q;  1HNX L;  5IT9 c;  2PCF B;  2PW7 A;  2JN4 A;  3A0J A;  2F0P A;  4ZKB B;  4C3H H;  1I50 B;  1KAA A;  3I7F A;  3VYU A;  4IQZ A;  1JB3 A;  3FKI G;  4CDF C;  3M7G A;  2ATW A;  5HUR A;  3P20 A;  4IUQ A;  1VQ6 A;  1SMX A;  5JJL A;  4A3M B;  4ILW A;  3G4S A;  3CXC A;  1WTH A;  1HZC A;  1D5Z C;  1C9O A;  1NJI C;  4OHJ A;  4DR7 Q;  4DK0 A;  1SYF A;  1N34 L;  4DNT B;  2F0W A;  4LF4 Q;  2K5Q A;  1H9M A;  1I4P A;  4AYB B;  3CCR A;  1G6Z A;  1Z7T A;  4YCW A;  5TSS A;  1AH9 A;  3F2C A;  4HN7 A;  2DN8 A;  4IUP A;  4TQU S;  3CCE A;  3NPP A;  4JI8 Q;  1JIC A;  4NPS A;  2JK8 A;  3KLR A;  1GHK A;  2K5D A;  1Y1V G;  2B2W A;  3VA5 A;  1LTR D;  2VQF Q;  2K28 A;  1ICW A;  2B2Y C;  5JVH 3;  4LNQ A;  2R92 B;  4XTC S;  4C2M H;  5JEA H;  4AQY L;  5COR A;  2EQS A;  1M90 C;  3N52 A;  2WP8 J;  2VQE Q;  2G9H D;  4XQJ A;  4GOP B;  4OL7 A;  4GOP A;  3I8Z A;  1NAP A;  4BY7 B;  3VYT A;  2LSS A;  2VB2 X;  3EJI A;  2QDB A;  1S40 A;  3DWQ A;  1B53 A;  1CI3 M;  4QGU A;  5BR8 Q;  5J22 A;  2MP1 A;  4K14 A;  2G9D A;  5E4X A;  4TKO B;  2K01 A;  1YBY A;  3GTG H;  1EY4 A;  2ENB A;  3OMC A;  2JA5 G;  3A74 A;  2YYZ A;  4DV7 L;  1KDB A;  3WDN A;  3K7U C;  1MBY A;  4KY6 A;  5K5P A;  2F0O A;  1WCM H;  2Q8I B;  4OWW B;  1ILQ A;  1OTC A;  2EE1 A;  5D3D A;  1JJC B;  2UUA L;  4C3I H;  3PMF A;  2EYM A;  3M3Y B;  3RNU A;  4F8M A;  4A3I B;  1LLR D;  2K5H A;  3NBH B;  1SNQ A;  5IYC G;  1CZG A;  3A8K E;  3PUW A;  2VNU D;  3J81 c;  1LUZ A;  1VQL A;  3CHB D;  3TP7 A;  2KEC A;  1UNS A;  2K05 A;  1VQB A;  3EVQ A;  2EXZ A;  3T56 B;  5I4D A;  3WOE A;  1B3Q A;  1YNX A;  4L5Q A;  4HJ5 A;  2AMC B;  4BBR G;  1KLG D;  1EIH A;  5EKL A;  3P1H A;  1W2B A;  4RCO A;  2E2I B;  1RTO A;  2AQ1 B;  2KUM A;  1STG A;  1ZEQ X;  5ELE A;  4Y7N B;  3AB9 A;  3R2I A;  5J39 A;  1Y1W B;  2MO0 A;  3CC7 A;  1X3P A;  4APV A;  2LFN A;  3F2B A;  1ICF B;  2DUD A;  5C4X G;  2FXQ A;  2EY5 A;  2F4V Q;  5IGF A;  3K59 A;  5E1F A;  4KY7 A;  3G6J B;  5C4H A;  4NP5 A;  2A1A A;  2UUB L;  3CCL A;  2BE5 C;  1YNJ C;  2EXD A;  5KIX A;  1J6Q A;  2E2J H;  4H02 A;  4B3S L;  4FVM A;  1PRT C;  3HEJ A;  4X3K A;  1AE2 A;  2WKC A;  2JP1 A;  3NBI A;  4R1J A;  2HCC A;  4QJF A;  1WD1 A;  4R4Q A;  5EPJ A;  5C44 B;  4LFB Q;  1HZ9 A;  2PYK A;  2Q8R E;  4P75 A;  5T1G A;  4B08 A;  2N88 A;  1BXT A;  3I4L A;  4K5W A;  2R93 G;  3I4N G;  1PYW D;  4FP5 D;  1SN8 A;  2NVX H;  4EQN A;  1VQP A;  4FDB A;  1BOS A;  2IX0 A;  1Q86 C;  1FJG L;  3FPP A;  3NK9 A;  4G57 A;  1I94 Q;  1L1O C;  1CHP D;  1IKL A;  5IYD H;  3Q23 A;  2SDF A;  1DOM A;  3HOX G;  3T1H Q;  2IJ0 A;  1RL2 A;  5IGC A;  2CVR A;  2VB3 X;  2F0U A;  1PTO B;  4H7B A;  1N32 L;  5IOC A;  2V1C C;  3STB C;  3RLN A;  1K28 A;  2UU9 Q;  3M7N A;  1RD9 D;  2HCI A;  2RSO A;  3CME A;  3TS0 A;  4GNX B;  4GN4 B;  4GNX A;  1OXX K;  4OXP A;  3HZX A;  4DV3 Q;  2Y0S B;  3PIP 3;  2F0L A;  3K0Y A;  5CBA E;  3H09 A;  4K6L A;  1U4M A;  1KTK A;  1MSH A;  1F9P A;  1UE6 A;  4B3M Q;  2J0T D;  4YWK A;  4DR5 Q;  3PUX A;  1B8A A;  2G5D A;  2KEN A;  1E2W A;  1RJT A;  2EY6 A;  3AFQ A;  1IHZ A;  2UUC Q;  1SNM A;  5IWA Q;  3J7A F;  5CGK A;  4YCV A;  1SNC A;  3H0G G;  4DXF A;  1QUQ B;  2O2L D;  1I4G A;  4GLA C;  1B7Y B;  4ZLT F;  1W3S A;  4M1U B;  1E1O A;  3VR2 A;  2F52 A;  2B8G A;  1E22 A;  3ONA B;  4FXD A;  4A3B B;  2GA4 B;  1JOQ A;  4C2M B;  4X62 Q;  4QF4 A;  5FK9 C;  2F3I A;  1YI2 A;  1J5E Q;  3CCV A;  1JWM D;  4OGQ C;  4A3F H;  1MHW C;  4S3S A;  1QVC A;  3RLO A;  1O78 A;  1OXV A;  1VMC A;  3AMU A;  2R7D A;  4POG A;  3NTH A;  1FGU A;  3TZD A;  4I7A A;  1K9M C;  5JJI A;  4LF5 L;  5FLX E;  5EPL A;  1HJP A;  1X3F A;  3K80 C;  3KF6 A;  1IKM A;  4OEL B;  1FNU A;  1JWS D;  3NTI A;  1EUJ A;  1VQI A;  3CAM A;  3GTG B;  3MZ5 A;  2Q2U A;  4NW2 A;  4JI3 Q;  4FNF A;  1HR0 Q;  1IW7 C;  1S5E D;  2EJF C;  2B3G A;  1XNQ L;  4PMW A;  1A15 A;  1EY6 A;  2BCO A;  2WAQ B;  1O7I A;  3KDF B;  1ZYR C;  4C3I B;  3KDF A;  4LK1 C;  4FO2 A;  3Q8D A;  5M3M B;  3KF8 B;  5EAY A;  3KF8 A;  1WI5 A;  2B2V A;  2OQK A;  4H13 C;  5CBE E;  4EX5 A;  2RSN A;  4IUT A;  4O1N A;  2NB0 A;  1VQO A;  1X6O A;  4R4O A;  1GUG A;  4KHP Q;  3SEB A;  3T16 A;  3VR5 A;  3FPU B;  5LMN L;  3LGJ A;  4A3G G;  1S4Z A;  2F0I A;  3HP3 A;  1KRT A;  1RDP D;  1P8L A;  2VQF L;  2RDF A;  2VZA A;  3OIP A;  3VR4 A;  1EQQ A;  3I55 A;  3K7A H;  3K8A A;  4DK6 C;  2Q2T A;  4EVO A;  1DZ1 A;  4OIK A;  2KA7 A;  2RDG A;  3Q6S A;  3I56 A;  4MTN A;  5C3E H;  2HIV A;  2I5M X;  1W6K A;  1NMG A;  1PFS A;  2JA7 H;  4IUU A;  1YHB A;  4DUZ L;  4N8X 1;  3KBX A;  3L9A X;  3W1G A;  5M3F H;  1E1T A;  1L2F A;  4YWL A;  4QL5 A;  3R3O A;  3PV0 A;  1DOL A;  1SE8 A;  3S1N H;  2EOT A;  3D4W A;  3NWS A;  5IYB H;  1KNA A;  1KIX A;  5BR8 L;  4UPA A;  4IFD I;  5FLM G;  3U4Z A;  4IOA A;  3DM3 A;  2HIX A;  2IX1 A;  3TP8 A;  2E2J B;  4UY8 C;  3VA7 A;  1PZK D;  4CDD C;  1Z9F A;  1PRT B;  2UXB Q;  2R7Z H;  2CH4 W;  2F0S A;  1DON A;  1EU4 A;  2SNM A;  4IPC A;  1JWU D;  4KHV A;  3RZD H;  5A35 A;  1SYB A;  3J7A V;  1N33 Q;  4GN5 A;  4NB3 A;  2O5I C;  4DV6 Q;  2A68 C;  2YTX A;  3RN2 A;  2HDM A;  1STB A;  3U9O A;  1L0Y B;  2CW0 D;  2PQE A;  3BVM A;  4JI0 Q;  3OPO A;  4RMF A;  2OF1 A;  2Z0S A;  2MGS A;  1L1O B;  4X3S A;  2A6E C;  1DXM A;  2NN6 I;  5J3B A;  2V4D A;  3S17 H;  2IHE A;  1STN A;  2YTY A;  3FMC A;  4DR2 L;  1M1K C;  2LXK A;  4ME5 A;  4MHE A;  1YHQ A;  2RA4 A;  2A5H A;  1GO3 E;  4JK1 C;  5CR3 A;  4DV5 Q;  1V1O A;  1HNW L;  2E8G A;  1KAW A;  4J1M A;  1VMP A;  4MIU A;  1S72 A;  5ELO A;  1KNE A;  2HUG A;  5BN4 A;  1TKW B;  2HQE A;  2B2W C;  2NUC A;  1UEB A;  1U4P A;  2JXM B;  2GVA A;  1ZKO A;  3ERO A;  5E7N A;  1YJ9 A;  3HOZ H;  1Q46 A;  2FIN B;  2TMP A;  3J81 i;  4CBV A;  1BCP C;  3U58 A;  1KDC A;  1PMR A;  3OHX C;  1YIJ A;  4GOP C;  2KCN A;  5JPM C;  4A93 B;  2QEX A;  1PTO D;  5DLQ E;  4WJ3 M;  2E76 C;  5I2Y A;  4GKK Q;  1CA6 A;  1GHJ A;  2BDO A;  1HRJ A;  4C1N K;  4I65 A;  4HIM A;  1PFB A;  2RQX A;  4KKS A;  4IPD A;  2LMC B;  4RA8 A;  4IPH A;  4R4I A;  1QJO A;  4L6T B;  3I4O A;  3KJP A;  1HTP A;  4R4T A;  3HOW H;  5IGD A;  2C9O A;  4L8J A;  5EGT A;  4NXM L;  1A3V A;  1I4X A;  3S24 A;  2JA9 A;  5IGG A;  5D65 A;  2XRS D;  1L0X B;  4ZRZ A;  1R9T H;  2XNA C;  2A6H D;  4A3F B;  3H6M A;  3NXW A;  4BS9 A;  2C5C A;  4BY1 G;  1JCK B;  4LF9 Q;  4I7Z C;  1K3B C;  1PZJ D;  4X66 Q;  1E2Z A;  2F0F A;  4YY3 Q;  1K83 H;  1M8A A;  1D8L A;  2NTS A;  2WB1 B;  3S2H H;  4NXN Q;  4B3T Q;  3ITP A;  2YTV A;  2IY5 B;  1MSG A;  3A8I E;  2ZT9 C;  1QE6 A;  3NEL A;  2H4O A;  3PUY A;  5FO7 B;  4DAV A;  2JA5 H;  3D3R A;  5HGT A;  3BS1 A;  1QB5 D;  1TT2 A;  2NVQ H;  2B39 A;  2A69 C;  1V1P A;  1EOT A;  2K50 A;  1LTB D;  4C3J B;  4UP9 A;  1U4L A;  1EY8 A;  3M4Q A;  4A3E G;  1X3Q A;  2VUM G;  2F4I A;  4RKB A;  2JA6 G;  5G3L D;  3I72 A;  4UP7 A;  3I2Z A;  2EYO A;  5IY0 A;  4C56 C;  2UXC Q;  1ROD A;  3J7A 5;  4HSV A;  4L5R C;  3C3L A;  3BU2 A;  3CC2 A;  2N49 A;  3CKI B;  1HNZ Q;  2IX3 A;  1LTL A;  2BOS A;  1X32 A;  4BBS G;  3HG9 A;  4LFA Q;  1M4V A;  1PH8 A;  1I4R A;  3F2U A;  2YU9 H;  1F2M A;  5BN3 A;  3F2D A;  2CQA A;  3N6R A;  3M4P A;  1BR9 A;  2Q8T A;  1ENA A;  1I6V C;  3PUV A;  3EQL C;  4BBR H;  2K03 A;  1F2Z A;  3CD6 A;  3ULL A;  1TY0 A;  4ABN A;  3K7A B;  3A5U A;  2JE6 I;  4X62 L;  1BNZ A;  3MXG A;  5CYU A;  1DD2 A;  1MIU A;  2X69 A;  4DV0 Q;  1LTA D;  2JA7 B;  1GD7 A;  3VYS A;  1XNR Q;  1JOO A;  2NVY H;  4MZ9 A;  5C4X H;  3L0O A;  1PH1 A;  5M3F B;  1IL8 A;  1AZP A;  1MI2 A;  1AW7 A;  2AWO A;  4IUV A;  1JE5 A;  1IBK L;  3L3O C;  4IFD J;  1JT8 A;  5C6A A;  2JA8 H;  3GQB A;  5J1Z A;  4ZYS A;  2ALY B;  1BBW A;  1AZQ A;  4Q0F A;  2PQA A;  1C8C A;  3U4V A;  1EWC A;  3NTK A;  1SFO H;  1CSQ A;  3RN5 A;  1VQF A;  5DNF A;  4JVZ A;  2R7Z B;  1YJW A;  2BA1 A;  3HKS A;  4DR3 Q;  3VR3 A;  5FLX L;  1HA6 A;  3OW2 A;  4XT1 B;  1S5C D;  1GOZ A;  3OTO L;  3RZD B;  2O5J C;  1I4Q A;  4KJN A;  4B3R L;  2R93 H;  4GNX C;  1C7Y A;  3I4N H;  5CV9 A;  1MJC A;  4LF7 L;  2D2C C;  1PA6 A;  1MD2 D;  1PZI D;  2HHH L;  1O80 A;  5A2Q L;  1UUP A;  2RVL A;  1EWH A;  1N36 Q;  3FDT A;  2RF4 A;  4A3M G;  2E5L Q;  4JI4 L;  5IOD A;  3HOX H;  4OO1 H;  5FO8 B;  2JQO A;  3P7J A;  2BE5 D;  4KHP L;  4CKC A;  1Y8O B;  3MWY W;  2A74 C;  4NMZ A;  1VQH A;  3K5M A;  1JC7 A;  1IL2 A;  1YNN C;  3S17 B;  1PRT D;  4AYB G;  3ICE A;  4OON A;  4LF8 L;  3DHQ A;  1FD7 D;  3PO3 H;  4FYD A;  3LWE A;  1BKB A;  4O42 A;  1PH3 A;  1NTG A;  4X65 Q;  5C0X G;  1PH7 A;  3S1M H;  2MQH A;  4LAA A;  4DK1 A;  4A4I A;  2R92 G;  3MVV A;  1EIY B;  3GD7 A;  5JOB A;  1E24 A;  1XMQ Q;  3HOZ B;  1AFP A;  3BZK A;  1BCP B;  1SYD A;  3TSS A;  4JBK A;  2ZJQ A;  1VQE A;  3GDE A;  4RHS A;  4OIJ A;  3CPF A;  2F0G A;  4WJW A;  3ZYY X;  4DV1 L;  5CV6 A;  3C2P A;  2UXB L;  3UDI A;  3STB D;  4F88 A;  3MXU A;  4JBJ A;  1SE2 A;  4XIG S;  3CCU A;  3M4O H;  3HFZ B;  5IGE A;  5KYL A;  3HOW B;  2WAC A;  3DM1 A;  4LFC Q;  2YV5 A;  3J81 j;  3OOC A;  3VYR A;  1CKN B;  1CKN A;  3SE0 A;  1R9T B;  5ELF A;  3JAM L;  2QCP X;  1LTG D;  4J6H A;  1IYJ B;  4A3I G;  1TWA B;  3EA6 A;  4QIW B;  5IP9 G;  1QNU A;  5FOB B;  1E3P A;  1TWG B;  1PFM A;  2B2V C;  1K8O A;  5JVG 3;  3QG1 A;  1EQT A;  2NZH A;  1IBM Q;  4HTH A;  2NWG A;  1WTV A;  3HGB A;  1HA5 A;  3PO2 H;  4R8I A;  5FLX c;  2Z6K C;  3J80 L;  2NVQ B;  2OXP A;  4KN7 C;  3K81 C;  2RHQ B;  1ASY A;  3PUZ A;  4OX9 L;  4JV5 Q;  4TSS A;  3AYH B;  4HJ8 A;  2F03 A;  1P16 A;  2A73 B;  4CJ0 B;  1Y1W G;  2EY2 A;  4P73 A;  5LMU Q;  1BBX C;  3ERQ A;  4JI1 Q;  4X64 Q;  3E6Z X;  1HZB A;  1IYV A;  5JEA J;  2PMZ B;  3GTM H;  3F1Z A;  1EQR A;  3BVZ A;  2JEA I;  4RHR A;  5C5M A;  2YU9 B;  2Q2I A;  4KKU A;  1T9H A;  1KL9 A;  2HD3 A;  4GKJ Q;  2OTJ A;  2JEB I;  1DOK A;  2KCT A;  3A5Z B;  4A3C H;  1Q8K A;  4A3L G;  4Z9C B;  5GAG C;  2LKV A;  2Z1C A;  3NUC A;  3GV3 A;  2E2D C;  2L9H A;  3G7L A;  1Y69 U;  1IW7 D;  1B9N A;  2QIL A;  4HED A;  1CK1 A;  3EFX D;  1JB7 A;  5C44 G;  1HXY D;  2VXW A;  4DAM A;  1ZYR D;  3HKZ B;  4LF9 L;  4WFN 3;  2B29 A;  2NVY B;  2CFM A;  2MUY A;  3MFG A;  2OQ0 A;  2EYH A;  4BXX H;  1G2T A;  1TWH H;  1Q7Y C;  3ULP A;  4PNY A;  1WTR A;  4JI7 L;  1O7Z A;  2JA8 B;  5FLM H;  4KD4 A;  4DV4 L;  2Z8L A;  4KKT A;  2O4X A;  4LMQ D;  2EY1 A;  1VQK A;  2RKS A;  4XQQ A;  5IP7 H;  2ZXR A;  2MO1 A;  2CCZ A;  1SEB D;  2L15 A;  2PZU A;  3T13 A;  4IN3 A;  3CPW A;  3P75 A;  1YJN A;  1B9M A;  1JR0 D;  2Y0S G;  3JAM c;  3M85 A;  1A3T A;  2ZJR A;  1VQA A;  3BJU A;  4C3H B;  2TSS A;  1PYB A;  2PPB C;  3SXH A;  3PIP A;  2WII B;  1NNX A;  2IL8 A;  3D4R A;  4LFA L;  1C0A A;  1S5D D;  5LMN W;  1KD1 C;  1SYC A;  1QG7 A;  1VQC A;  3PSI A;  1RTN A;  1K73 C;  2RCN A;  1Q82 C;  1A2U A;  5KNB A;  4LF6 L;  2KQ3 A;  2K6A A;  2L55 A;  3CRL C;  1RIP A;  3CQZ H;  2FHT A;  3HOU H;  5EBD A;  3TME A;  4KHZ A;  1Q3L A;  3PO3 B;  3WOF A;  3J80 c;  3D6W A;  2CWP A;  4DV2 Q;  5D14 A;  1JE4 A;  4R4C A;  1UEA B;  4JBM A;  4ZAI A;  1XNR L;  2B63 H;  2M2L A;  1D5M C;  2H1E A;  2A68 D;  4YHH Q;  4A3B G;  4DK3 C;  4PMC A;  1BQQ T;  3ERS X;  1XMO Q;  1VQ5 A;  2BH8 A;  2EPB A;  2ASB A;  1I4H A;  2F0T A;  1QWY A;  4K0K Q;  5JPN C;  4HR7 B;  3TN2 A;  2RBM A;  5T1I A;  1I6H H;  1GUO A;  4KN4 C;  4HMJ A;  2FJ2 A;  4MNO A;  1STE A;  3J7Y W;  2A6E D;  3I4M H;  3SGI A;  1I3Q H;  4A3K H;  4A3D H;  5JAV A;  5E3F A;  2UXD Q;  2ZM6 L;  1F9R A;  3IRB A;  1SMY C;  3AFP A;  3S16 H;  3WWV A;  1X9N A;  1O7Y A;  3O13 A;  4N8F A;  3AU7 A;  2K5N A;  3M4O B;  1G6P A;  3KF6 B;  4DR6 L;  3CRK C;  4CHT B;  1PH9 A;  4DR4 Q;  1HHV A;  2IT1 A;  1SBB B;  2F1M A;  4HCS A;  3TRZ A;  1VDZ A;  4DXG A;  2WAQ G;  1BCP D;  4A3J H;  4C3I G;  3J81 E;  1WCM B;  4BWG B;  5AJ3 Q;  5M3M G;  2K5V A;  2KCC A;  1BDO A;  4IO9 A;  4DR7 L;  2R3Z A;  1XYI A;  1C4Q A;  1AEX A;  1X54 A;  2PO4 A;  1JOR A;  4LF4 L;  1BVS A;  1KDA A;  3K57 A;  4GS3 A;  1STA A;  1SYE A;  3HOV H;  4JG2 A;  4XXE A;  2AQ3 B;  3DMU A;  5KNC A;  5KND A;  5COY A;  3PO2 B;  1HPC A;  3ZJY C;  2X6L A;  1X55 A;  4PQX A;  1HTL D;  3SK8 A;  2K1B A;  4UP8 A;  4JI8 L;  1A3U A;  1LV9 A;  5D3I B;  2VUM H;  2Z6K A;  1Q81 C;  2JA6 H; 
#chains in the Genus database with same CATH homology
 1EZ6 A;  4EQO A;  4FF3 A;  5CV4 A;  4ID6 A;  4CKE A;  5LHY 1;  5ELD A;  2K32 A;  3TDQ A;  1HFN A;  1A6X A;  2J7Z A;  1HUN A;  1J8I A;  4XDX A;  1ML0 D;  4U68 A;  3GTM B;  3OIQ A;  1EQV A;  1EY0 A;  3I3C A;  3T51 B;  4DU9 A;  2EYL A;  1EEF D;  4ZUI A;  1TU2 B;  3A55 A;  1TS2 A;  3NE5 B;  4FXK C;  1S5F D;  1C48 A;  2F0N A;  4U67 3;  1QIL A;  5CV5 A;  5I9P A;  5LL6 S;  1F77 A;  3BZD B;  5CV7 A;  5K36 H;  4RH6 A;  1TWH B;  2PNR C;  3QO2 A;  2NVX B;  1GUS A;  2EYP A;  3DUZ A;  1CZW A;  2CHB D;  4BA2 I;  2ZXO A;  1ZXT A;  1JQY D;  4DAP A;  1Z6H A;  2XVS A;  2DY7 A;  1QCB D;  2IPK D;  1Q1B A;  4X3T A;  4L63 B;  4K6D A;  1B1Z A;  3A7A B;  4RAU C;  1CA5 A;  2E74 C;  4B9W A;  4V19 0;  2AQ2 B;  3K5N A;  1CM9 A;  1DM0 B;  1WTO A;  1LAB A;  1LO5 D;  1G8Z D;  2BDN A;  5NUC A;  1GUW A;  1Y8N B;  4J8Q A;  4R8N A;  5EQ0 A;  2EJM A;  3CQZ B;  3I73 A;  3HOU B;  1RKN A;  1R4P B;  1Y8P B;  5C0X H;  4ODG A;  3PIO 3;  4RKL A;  2B63 B;  3C1F A;  4G7H C;  1KLU D;  2WIN B;  2WV6 D;  3I91 A;  1PFN A;  3MEH A;  4EQP A;  3KLS X;  1I6H B;  4JBW A;  1II3 A;  1SYG A;  3I4M B;  4A3K B;  1I3Q B;  4A3D B;  3IKJ A;  3X3N A;  1YNN D;  2FFK B;  2FMC A;  2JYO A;  4OO1 I;  3GP7 A;  3MHB A;  4K5X A;  1B3A A;  2B8F A;  1PTO F;  2OEO A;  5C3W A;  3LNN A;  1HCZ A;  4C3J G;  1WVL A;  1V1P B;  4H0L C;  1XX8 A;  4A3J B;  1TS4 A;  3KUP A;  3MC0 B;  2BA0 A;  3BG3 A;  1Q90 A;  1GXD C;  3T4A C;  1H9S B;  2J4X A;  1H9S A;  1CHQ D;  3MFY A;  5I6W A;  1EYA A;  4H44 C;  4QMG A;  4PMB A;  1OO9 B;  3HOV B;  5DEH A;  3C1E A;  3LX0 A;  1GJX A;  1PLF A;  5E4W C;  2L5T A;  3BDL A;  3GTP B;  5EKK A;  1AN8 A;  1G29 1;  2DNC A;  5AFW A;  3IFT A;  5C3E B;  3DWP A;  3H94 A;  4BBS B;  3NQT A;  1B4O A;  3MXP A;  4DF7 A;  3Q0A A;  4N9P A;  1D5X C;  3S1N B;  3OW7 A;  2L12 A;  3Q24 A;  2IW3 A;  2KOL A;  1SND A;  5C4J B;  3HRZ C;  2QKI C;  1TWC B;  4TRD A;  3CU7 A;  2EVB A;  4K8J A;  3D31 A;  1OXS C;  3GTO B;  4C1N I;  2L11 A;  4KY5 A;  4KI0 A;  3HOY B;  1TY2 A;  4KJO A;  4E6I A;  4B9X A;  3TP5 A;  3QB3 A;  4LJZ C;  1PTO H;  3I90 A;  1YNJ D;  4ZK9 B;  1SDF A;  1E2V A;  2NTT A;  1V43 A;  1EIG A;  3T53 B;  1BO0 A;  3S9W A;  2ZXP A;  1A2T A;  5CV8 A;  2LS0 1;  5I6Y A;  1TR5 A;  5F2D A;  5KGU A;  3FKI B;  1VF5 C;  2A6H C;  2AUK A;  4DAY A;  1LT5 D;  1ENF A;  1VF7 A;  3ND8 A;  1STY A;  2F0J A;  1TS3 A;  5ELC A;  2IWH A;  5CC4 A;  2XWJ B;  3E0J A;  3OSO A;  3V96 A;  4RGM A;  5KYI A;  1HFG A;  4FF4 A;  2F0H A;  1SJH D;  3BVG A;  1G91 A;  1PRT F;  5C4Z A;  3DEO A;  2PZW A;  1Y1V B;  2ICE C;  4CJ1 B;  3QOL A;  4ZUJ A;  1TVX A;  4MN3 A;  4RCN A;  4NDX A;  1Q12 A;  1FYC A;  2R61 A;  2M00 A;  4IFD G;  1TS5 A;  3NHH A;  1SAP A;  2QEJ C;  1TQO A;  2K33 A;  1FNV A;  1U4R A;  3RUZ A;  1K83 B;  1DCZ A;  3W3A A;  1SNP A;  1CQV A;  3S2H B;  3R2T A;  1ESF A;  4DFA A;  2F3W A;  1LTT D;  2L1B A;  5FKA C;  3V2T A;  2EJG C;  1QOH A;  2JA5 B;  2I07 B;  4R9W A;  1Z47 A;  3GTJ B;  3NBH A;  3NQI A;  1MGS A;  1RCV D;  1H9R A;  2FMM A;  4BA1 I;  1V8Q A;  2HDL A;  2NN6 G;  4V0B A;  2NYZ D;  5CMD A;  2F0V A;  1WTQ A;  5M5W B;  3H91 A;  1SMY D;  4N9T A;  1T5X D;  3BYY B;  4WRD A;  4FXG C;  5KEE A;  1F2L A;  1LTS D;  4BBR B;  3SK6 A;  3SK5 A;  2F0K A;  1F9Q A;  1SE4 A;  3NSW A;  1B50 A;  2ICI A;  1NR4 A;  4RFB A;  4HSP A;  2E75 C;  5C4X B;  3DXJ C;  4X3U A;  1UAP A;  3LWU A;  1ESR A;  5IIF A;  3QIA A;  2QF7 A;  3M4Y A;  3D8G A;  3TBI B;  4PV1 C;  1FNW A;  5IT9 E;  2MJ8 A;  2B2U C;  1SFO B;  1TWF B;  1ET9 A;  3IFD A;  1CTM A;  2K7V A;  2RDH A;  3SDZ A;  2R93 B;  3I4N B;  4C3H G;  3UI2 A;  3S15 B;  1D1K A;  3IL8 A;  4P2C B;  2D62 A;  1E0B A;  3KBG A;  3SR1 A;  4OO1 G;  4ZKC B;  2I46 A;  1SNO A;  3K58 A;  3HOX B;  1AP0 A;  3OWF A;  4WOR A;  3K6O A;  3IAY A;  1PXU A;  3A56 A;  5C3X A;  1NR2 A;  4HCE A;  3RD4 A;  3U9S A;  1D6E C;  3Q22 A;  3K5L A;  2Z4H A;  3S1M B;  1XXG A;  5EKI A;  1IYU A;  5JEA G;  3E5S A;  1EL0 A;  4KV6 A;  1F9S A;  1S5B D;  4KK7 A;  4QUF A;  4QB4 A;  3SVM A;  3SHL A;  4DGZ A;  2XWB B;  3KK7 A;  2B2T C;  4DNR B;  3H0G B;  4RGO S;  1NUC A;  3TZU A;  2B2Y A;  5LL6 X;  1HUM A;  2M9V A;  4KMU C;  2AWN A;  3RMH A;  4IUR A;  4RWS C;  1RHP A;  4IUN A;  2F0M A;  3S2D B;  1U9R A;  2EYJ A;  1WD0 A;  4K5V A;  5A2Q E;  4GZY C;  4G7O C;  1NCV A;  3RLF A;  1BF4 A;  3MAQ A;  2EYF A;  1FR3 A;  2R6G A;  1TII D;  2XSC A;  3HS0 C;  1WTX A;  5C0X I;  1BUV T;  2L4N A;  2F0E A;  5FO9 B;  1WTP A;  3URY A;  1XWE A;  1F2Y A;  3FVQ A;  3TP6 A;  2XN9 C;  3A8J E;  1BCP F;  1SSO A;  4CGY B;  2F3V A;  4IAL A;  3A54 A;  4KTA A;  4G4K A;  1W6J A;  4A3G B;  3QOJ A;  3GV6 A;  4YIJ A;  1EYD A;  3BDC A;  1LT4 D;  5EPK A;  3GTK B;  2A69 D;  5I9O A;  2OT2 A;  5IGB A;  3K5O A;  1ONL A;  4IZ8 A;  2WKD A;  3GO5 A;  1QNK A;  2LY7 A;  3D4D A;  1LTI D;  4K8I A;  5DM7 3;  1RF2 D;  1SXT A;  3X3M A;  1EY5 A;  3FRP B;  1NSN S;  4XQN A;  2N55 A;  1EU3 A;  4QUC A;  1J9O A;  1DJR D;  4F7X A;  1CQF A;  3JAM E;  1R4Q B;  1B2T A;  2MHV A;  1LT3 D;  4F87 A;  2B2U A;  4HAE A;  1DYQ A;  4K2L A;  3H3V C;  2JSO A;  3R93 A;  4M8A A;  1B44 D;  5M5Y B;  2Z4I A;  3BYT B;  5EBC A;  2D5D A;  5KRU A;  1D2B A;  3BDO A;  1GUN A;  2MPM A;  2PZT A;  2PW5 A;  1EYC A;  3J80 E;  2K04 A;  2X6G A;  2EZV A;  2KJX A;  4QCL A;  1EEI D;  4UDU C;  3I70 A;  4K2K A;  2DNE A;  4RGT A;  4Q5V A;  1OXT A;  5DM6 3;  3QJY A;  2KVM A;  3NP8 A;  1LAC A;  3GTQ B;  2KEE A;  1EZ8 A;  3RZO B;  5EJW A;  4FF2 A;  3DEP A;  5M9O A;  1Q8I A;  3DWA A;  5BN5 A;  1CFM A;  3MXN A;  2AUJ D;  1ENC A;  1WTW A;  5JJZ A;  1SE3 A;  3C46 A;  4HMI A;  2XIW A;  1FGB D;  1Q1E A;  3S16 B;  3A7L A;  2B2T A;  5IT9 L;  1EY7 A;  3FEW X;  4ZQ3 A;  3QWN A;  1LT6 D;  5DAU A;  4BY1 B;  4IFD H;  2F0Q A;  4CJ2 C;  1K8M A;  2SOB A;  4DN4 M;  2L0C A;  1CT1 D;  3KLS A;  4ULL A;  2SEB D;  1D1I A;  1SJE D;  2NZ1 D;  1STH A;  3R8B A;  1HQM C;  4A3E B;  5C0X J;  1EY9 A;  2VUM B;  1KAB A;  2XRQ D;  2JA6 B;  3NWT A;  5ISR A;  1G2S A;  1H9K A;  4RGN A;  4NKL A;  4UAI A;  2NN6 H;  2NBF A;  2KHS A;  4FF1 A;  3GTL B;  2F0D A;  2CW0 C;  3W2D A;  2KED A;  1ET6 A;  4EGV A;  1VCI A;  5G3L F;  2DY8 A;  3V05 A;  3S14 B;  5ELB A;  4DA2 A;  3SK4 A;  3ND9 A;  1HQR D;  2SNS A;  1H9J A;  1GUT A;  1PDQ A;  4XT3 B;  4XYQ A;  3MA2 B;  3MTS A;  2E2H B;  1XTC D;  4XYO A;  5C5L A;  5K36 G;  3D6C A;  4G7Z C;  2ID0 A;  1OXU A;  3L7Z C;  3OMG A;  4CKB A;  2EDG A;  5M5X B;  1JOK A;  2K5W A;  3J81 L;  2NVT B;  1PTO C;  4KD3 A;  1T5E A;  3S1R B;  1O7L A;  1ILP A;  5I2X A;  3OWE B;  1EFI D;  3VR6 A;  2D9U A;  3S1Q B;  2PCF B;  2PW7 A;  2F0P A;  4ZKB B;  1I50 B;  1KAA A;  3VYU A;  4IQZ A;  1JB3 A;  3M7G A;  5HUR A;  3P20 A;  4IUQ A;  4A3M B;  4ILW A;  1D5Z C;  4OHJ A;  4DK0 A;  1SYF A;  4DNT B;  2F0W A;  2K5Q A;  1H9M A;  1I4P A;  4AYB B;  1G6Z A;  1Z7T A;  5TSS A;  4HN7 A;  2DN8 A;  4IUP A;  4TQU S;  3NPP A;  1JIC A;  3KLR A;  1GHK A;  2K5D A;  2B2W A;  3VA5 A;  1LTR D;  2K28 A;  1ICW A;  2B2Y C;  5JVH 3;  2R92 B;  4XTC S;  5JEA H;  5COR A;  3N52 A;  2WP8 J;  2G9H D;  4XQJ A;  4OL7 A;  3I8Z A;  1NAP A;  4BY7 B;  3VYT A;  2VB2 X;  3EJI A;  2QDB A;  3DWQ A;  1B53 A;  1CI3 M;  5J22 A;  2MP1 A;  4K14 A;  2G9D A;  5E4X A;  4TKO B;  2K01 A;  1EY4 A;  2ENB A;  3OMC A;  2YYZ A;  1KDB A;  3WDN A;  1MBY A;  4KY6 A;  5K5P A;  2F0O A;  2Q8I B;  1ILQ A;  2EE1 A;  5D3D A;  3PMF A;  2EYM A;  3M3Y B;  4F8M A;  4A3I B;  1LLR D;  1SNQ A;  1CZG A;  3A8K E;  3PUW A;  2VNU D;  3CHB D;  3TP7 A;  2KEC A;  1UNS A;  2K05 A;  3EVQ A;  2EXZ A;  3T56 B;  5I4D A;  3WOE A;  1KLG D;  1EIH A;  5EKL A;  3P1H A;  4RCO A;  2E2I B;  1RTO A;  2AQ1 B;  2KUM A;  1STG A;  1ZEQ X;  5ELE A;  4Y7N B;  3AB9 A;  3R2I A;  5J39 A;  1Y1W B;  1X3P A;  2LFN A;  2EY5 A;  5IGF A;  3K59 A;  5E1F A;  4KY7 A;  3G6J B;  5C4H A;  4NP5 A;  2BE5 C;  1YNJ C;  5KIX A;  4FVM A;  1PRT C;  3HEJ A;  4X3K A;  2WKC A;  2JP1 A;  3NBI A;  2HCC A;  1WD1 A;  5EPJ A;  5C44 B;  2PYK A;  2Q8R E;  5T1G A;  4B08 A;  2N88 A;  1BXT A;  3I4L A;  4K5W A;  1PYW D;  4FP5 D;  4EQN A;  1BOS A;  2IX0 A;  3FPP A;  3NK9 A;  4G57 A;  1CHP D;  1IKL A;  3Q23 A;  2SDF A;  1DOM A;  2IJ0 A;  5IGC A;  2CVR A;  2VB3 X;  2F0U A;  1PTO B;  4H7B A;  5IOC A;  3M7N A;  1RD9 D;  2HCI A;  2RSO A;  1OXX K;  3HZX A;  2Y0S B;  3PIP 3;  2F0L A;  3K0Y A;  5CBA E;  3H09 A;  4K6L A;  1U4M A;  1KTK A;  1MSH A;  1F9P A;  2J0T D;  3PUX A;  1E2W A;  1RJT A;  2EY6 A;  1IHZ A;  1SNM A;  3J7A F;  5CGK A;  1SNC A;  4DXF A;  2O2L D;  1I4G A;  4ZLT F;  4M1U B;  3VR2 A;  2B8G A;  3ONA B;  4FXD A;  4A3B B;  2GA4 B;  1JOQ A;  4C2M B;  4QF4 A;  5FK9 C;  1JWM D;  4OGQ C;  4S3S A;  1O78 A;  1OXV A;  1VMC A;  3AMU A;  3NTH A;  3TZD A;  5FLX E;  5EPL A;  1IKM A;  1FNU A;  1JWS D;  3NTI A;  3GTG B;  3MZ5 A;  4NW2 A;  4FNF A;  1IW7 C;  1S5E D;  2EJF C;  4PMW A;  1A15 A;  1EY6 A;  2BCO A;  2WAQ B;  1ZYR C;  4C3I B;  4LK1 C;  4FO2 A;  5M3M B;  3KF8 A;  2B2V A;  4H13 C;  5CBE E;  2RSN A;  4IUT A;  4O1N A;  2NB0 A;  1GUG A;  3SEB A;  3T16 A;  3VR5 A;  3FPU B;  1S4Z A;  2F0I A;  3HP3 A;  1RDP D;  2RDF A;  3OIP A;  3VR4 A;  4EVO A;  1DZ1 A;  4OIK A;  2KA7 A;  2RDG A;  3Q6S A;  1W6K A;  4IUU A;  3KBX A;  3L9A X;  3R3O A;  3PV0 A;  1DOL A;  2EOT A;  3D4W A;  3NWS A;  1KNA A;  4IFD I;  2IX1 A;  3TP8 A;  2E2J B;  3VA7 A;  1PZK D;  1PRT B;  2F0S A;  1DON A;  1EU4 A;  2SNM A;  1JWU D;  4KHV A;  5A35 A;  1SYB A;  3J7A V;  2O5I C;  2A68 C;  2HDM A;  1STB A;  3U9O A;  1L0Y B;  2CW0 D;  2PQE A;  3BVM A;  3OPO A;  2OF1 A;  2MGS A;  4X3S A;  2A6E C;  1DXM A;  2NN6 I;  2V4D A;  1STN A;  3FMC A;  4ME5 A;  4MHE A;  2RA4 A;  2A5H A;  4JK1 C;  5CR3 A;  1V1O A;  4J1M A;  1VMP A;  4MIU A;  1KNE A;  2HUG A;  5BN4 A;  1TKW B;  2HQE A;  2B2W C;  2NUC A;  1U4P A;  2JXM B;  1ZKO A;  3ERO A;  2FIN B;  2TMP A;  4CBV A;  1BCP C;  1KDC A;  1PMR A;  3OHX C;  2KCN A;  5JPM C;  4A93 B;  1PTO D;  2E76 C;  5I2Y A;  1CA6 A;  1GHJ A;  2BDO A;  1HRJ A;  4C1N K;  4I65 A;  1PFB A;  2RQX A;  4KKS A;  2LMC B;  4RA8 A;  1QJO A;  4L6T B;  1HTP A;  5IGD A;  2C9O A;  4L8J A;  5EGT A;  1A3V A;  1I4X A;  5IGG A;  5D65 A;  2XRS D;  1L0X B;  4ZRZ A;  2XNA C;  2A6H D;  4A3F B;  3H6M A;  3NXW A;  4BS9 A;  2C5C A;  1JCK B;  4I7Z C;  1PZJ D;  1E2Z A;  2F0F A;  1M8A A;  2NTS A;  2WB1 B;  3ITP A;  1MSG A;  3A8I E;  2ZT9 C;  1QE6 A;  2H4O A;  3PUY A;  5FO7 B;  4DAV A;  3D3R A;  5HGT A;  3BS1 A;  1QB5 D;  1TT2 A;  2B39 A;  2A69 C;  1V1P A;  1EOT A;  1LTB D;  4C3J B;  1U4L A;  1EY8 A;  1X3Q A;  2F4I A;  4RKB A;  5G3L D;  3I72 A;  2EYO A;  4C56 C;  1ROD A;  4HSV A;  3C3L A;  3CKI B;  2IX3 A;  2BOS A;  1X32 A;  3HG9 A;  1M4V A;  1I4R A;  3F2U A;  1F2M A;  5BN3 A;  2CQA A;  3N6R A;  1BR9 A;  2Q8T A;  1ENA A;  1I6V C;  3PUV A;  3EQL C;  2K03 A;  1F2Z A;  1TY0 A;  4ABN A;  3K7A B;  2JE6 I;  1BNZ A;  3MXG A;  5CYU A;  1DD2 A;  2X69 A;  1LTA D;  2JA7 B;  3VYS A;  1JOO A;  5M3F B;  1IL8 A;  1AZP A;  1MI2 A;  1AW7 A;  2AWO A;  4IUV A;  3L3O C;  4IFD J;  5C6A A;  3GQB A;  5J1Z A;  4ZYS A;  1AZQ A;  4Q0F A;  1C8C A;  1EWC A;  3NTK A;  5DNF A;  2R7Z B;  2BA1 A;  3VR3 A;  5FLX L;  1HA6 A;  4XT1 B;  1S5C D;  1GOZ A;  3RZD B;  2O5J C;  1I4Q A;  4KJN A;  5CV9 A;  2D2C C;  1MD2 D;  1PZI D;  1O80 A;  5A2Q L;  1UUP A;  2RVL A;  1EWH A;  3FDT A;  5IOD A;  4OO1 H;  5FO8 B;  3P7J A;  2BE5 D;  4CKC A;  1Y8O B;  3MWY W;  2A74 C;  4NMZ A;  3K5M A;  1JC7 A;  1YNN C;  3S17 B;  1PRT D;  3DHQ A;  1FD7 D;  4FYD A;  3LWE A;  4O42 A;  5C0X G;  4LAA A;  4DK1 A;  3MVV A;  3GD7 A;  5JOB A;  3HOZ B;  1AFP A;  1BCP B;  1SYD A;  3TSS A;  4RHS A;  4OIJ A;  3ZYY X;  2F0G A;  4WJW A;  5CV6 A;  3C2P A;  4F88 A;  3MXU A;  1SE2 A;  4XIG S;  5IGE A;  5KYL A;  3HOW B;  2WAC A;  3DM1 A;  3OOC A;  3VYR A;  3SE0 A;  1R9T B;  5ELF A;  3JAM L;  2QCP X;  1LTG D;  4J6H A;  1TWA B;  3EA6 A;  4QIW B;  1QNU A;  5FOB B;  1TWG B;  1PFM A;  2B2V C;  1K8O A;  5JVG 3;  3QG1 A;  1EQT A;  4HTH A;  2NWG A;  1WTV A;  3HGB A;  1HA5 A;  4R8I A;  3J80 L;  2NVQ B;  2OXP A;  4KN7 C;  3PUZ A;  4TSS A;  2F03 A;  4CJ0 B;  2A73 B;  2EY2 A;  1BBX C;  3ERQ A;  3E6Z X;  1IYV A;  5JEA J;  2PMZ B;  3BVZ A;  2JEA I;  4RHR A;  5C5M A;  2YU9 B;  4KKU A;  2JEB I;  1DOK A;  4Z9C B;  2LKV A;  2Z1C A;  3NUC A;  3GV3 A;  2E2D C;  2L9H A;  3G7L A;  1Y69 U;  1IW7 D;  1B9N A;  2QIL A;  4HED A;  1CK1 A;  3EFX D;  1HXY D;  2VXW A;  1ZYR D;  3HKZ B;  4WFN 3;  2NVY B;  2MUY A;  3MFG A;  2EYH A;  1G2T A;  4PNY A;  1WTR A;  1O7Z A;  2JA8 B;  4KD4 A;  2Z8L A;  4KKT A;  2O4X A;  4LMQ D;  2EY1 A;  2RKS A;  4XQQ A;  2ZXR A;  1SEB D;  2PZU A;  3T13 A;  4IN3 A;  3P75 A;  1B9M A;  1JR0 D;  3M85 A;  1A3T A;  4C3H B;  2TSS A;  2PPB C;  3SXH A;  2WII B;  3D4R A;  2IL8 A;  1S5D D;  1SYC A;  1QG7 A;  1RTN A;  1A2U A;  5KNB A;  2KQ3 A;  2K6A A;  2L55 A;  3CRL C;  2FHT A;  5EBD A;  3TME A;  4KHZ A;  1Q3L A;  3PO3 B;  3WOF A;  3D6W A;  5D14 A;  1JE4 A;  1UEA B;  4ZAI A;  2M2L A;  1D5M C;  2H1E A;  2A68 D;  4PMC A;  1BQQ T;  2EPB A;  1I4H A;  2F0T A;  1QWY A;  5JPN C;  4HR7 B;  3TN2 A;  2RBM A;  5T1I A;  1GUO A;  4KN4 C;  4HMJ A;  2FJ2 A;  1STE A;  3J7Y W;  2A6E D;  5JAV A;  5E3F A;  1F9R A;  1SMY C;  1O7Y A;  3O13 A;  3AU7 A;  3M4O B;  3CRK C;  4CHT B;  1HHV A;  2IT1 A;  1SBB B;  2F1M A;  4HCS A;  1VDZ A;  4DXG A;  1BCP D;  4C3I G;  3J81 E;  1WCM B;  4BWG B;  2KCC A;  1BDO A;  2R3Z A;  1XYI A;  1C4Q A;  1AEX A;  2PO4 A;  1JOR A;  1KDA A;  3K57 A;  1STA A;  1SYE A;  4XXE A;  2AQ3 B;  3DMU A;  5KNC A;  3PO2 B;  5COY A;  1HPC A;  2X6L A;  4PQX A;  1HTL D;  3SK8 A;  2K1B A;  1A3U A;  1LV9 A;  5D3I B;  5KND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...