5AJ3Q

Structure of the small subunit of the mammalian mitoribosome
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
109
structure length
109
Chain Sequence
SIARSSVHAKWVVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIIFKVGQVIDPVTGKPCAGTTYLESPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5aj3Q00
1GD7A 3U4ZA 1MIUA 2K5HA 1KRSA 4LF7Q 3E9IA 1E3PA 4TVAB 1IYJB 4X6AH 4AQYQ 1I50H 4YHHL 1OTCA 3HOXH 2Z0SA 5JEAJ 2I0QA 2ID0A 3CQZH 3HOUH 1VQAA 4IPDA 3HOYH 4YY3Q 3M4PA 1KXLA 4JV5L 3G48A 1FL0A 1CKOA 4P72A 4X66L 1NJIC 2DGYA 4R4OA 1MJEA 3FP9A 3ERSX 3J81i 4DR1L 3S24A 5ELNA 1NMFA 1WFQA 5LMUQ 1JT8A 4OONA 1IXRA 4ME3A 4NB3A 1GVPA 3KF8B 1I6HH 1X56A 4DR6Q 2AHOB 4LFBQ 1KIXA 4PZ7A 1E1OA 1R9TH 2IT1A 4LF4Q 2K5VA 2LXJA 4MNOA 4A3LH 1NY4A 4DR7L 2JA8G 4A3DG 2RCNA 2R7DA 3KF6B 4DR5L 1T9HA 2IHEA 1PHJA 1EWIA 4OXPA 4UP7A 5C3EH 3CC2A 4B3TL 1FGUA 1UE5A 1M90C 1QZHA 1I5FA 2K50A 3A5UA 1DGSA 3HKZG 1Q12A 1JJ2A 2A19A 2K5NA 1IBML 2ZTEA 4A3KH 1G51A 4A3FH 1Y1VH 2UXBQ 5JJIA 3F1ZA 2JJQA 3HOWH 2MNAA 5C0XI 2RHSB 3CMEA 4DV5L 4A3IG 5IE8A 4X64L 1NMGA 1U5KA 1VQ9A 2CKZB 1YBYA 1CUKA 2H5XA 4R4QA 4BBSH 4DV0L 2E2JH 3GTKH 2ES2A 1YNXA 3BJUA 3EBEA 2B3GA 3J80c 4R1JA 2PI2A 3K7AH 4ALPA 2ZM6L 1TWCH 4NXML 2JEAI 2DUDA 4LF9L 4OO1G 4YHHQ 4LF6L 1ASYA 5C4XG 1WYDA 2QGQA 5IYCG 1A63A 1HZCA 5E7NA 2R6GA 4JC0A 3ZJYC 2OCEA 4PZ6A 2KENA 1SLJA 3PUVA 1Z47A 4JV5Q 1PVOA 1HNXL 1TWAH 4YCVA 4JI5L 2Y0SG 3PCOB 3M3YH 2WB1E 4R4CA 4DR1Q 4A3BG 3T1YL 1W2BA 2K52A 3K8AA 4JI1L 4Y7NH 4BY7G 1VQLA 1CSQA 3JAMc 3CCQA 2NN6G 3CPFA 4HIDA 2CWAA 3KLWA 4JI4L 3CCLA 2D0OA 4A93H 3CCRA 1K3RA 1Q8KA 1YHAA 1A0IA 2R7ZH 2E8GA 4GN5A 1SROA 1N34L 1FJGL 1VQ6A 5BR8L 2Q2TA 2VNUD 2PI2E 2B63H 4A75A 4X65L 4UY8C 4B3TQ 1VQ8A 2NVQH 4PG3A 1VQ5A 2OTLA 4AYBE 1N32L 2Q2HA 2F4VL 2JA7H 3CP0A 4XTCS 1EIYB 3K0XA 4DV5Q 5FLMG 3S15H 4X64Q 2PNHA 3GD7A 1M1KC 2CQOA 4JI3L 3PO2G 4A76A 1XTDA 4QY7A 2IX1A 2UXCQ 4WJ3M 3L7ZC 1P16A 2PQAB 1GKHA 2I5HA 2HIXA 2N3SA 4LF9Q 1SRUA 3W1GA 4QGUA 1XNQQ 2YYZA 4GKJL 4LF6Q 3UDFA 1RIPA 4PMWA 1X6OA 3BZKA 2K14A 2RHQB 3JC66 3CCJA 2EXDA 2IHFA 4DNIA 2ZJQA 3BZCA 1WCMG 1XMOL 4L5RC 4HJ8A 1KAWA 1I3QH 1HZ9A 3GO5A 3CF5A 1VQKA 1JB7A 4JI5Q 4DR2Q 3G4SA 3T1YQ 5DLQE 1SFOH 2UXDL 1MJCA 3S17H 1L0WA 4JI1Q 4DAYB 3PO3H 4LW1A 3A74A 2N8NA 2E5LL 4Y52H 2JA8H 1Q1BA 5AJ3L 1X55A 1U0LA 4LFAQ 1V9PA 1K9MC 1GO3E 3J81c 1PH3A 4JI7L 2OQ0A 3HKZE 4DUZL 3H0GH 3I2ZA 1D7QA 1N34Q 5GADC 1GM5A 5BR8Q 4BBRH 1XNRL 1HNWL 4P71A 3GTMH 1X9NA 1EQRA 3M4QA 4X65Q 2VS1A 2VQFQ 3KOJA 1PH4A 3I7FA 3TEHB 1L1OB 1E24A 4O2DA 5GAEC 4DR4L 3RN2A 2UUCL 1UE7A 3RR5A 2R92G 2LXKA 1KL9A 2YTYA 4P74A 5H1SE 3CC7A 4HJAA 3PSIA 3HOVH 4A3EG 5HGQA 3PO3G 4LUZA 5C0XG 1AH9A 4RMFA 1EYGA 3H3VI 4JI8L 2K4KA 3FKIH 4JI3Q 1HJPA 2JE6I 4A3GG 1G6PA 2R7FA 3I4OA 4A4IA 1HNZL 2ATWA 2CCZA 1J6QA 5C4XH 1XMQL 5IYCH 2Y0SE 3RNUA 4GKJQ 4BXXG 3PGZA 2NZOA 1VQCA 1Q81C 5FJ8G 2QA4A 5IYBG 4EX5A 4LWCA 4YWLA 2MFIA 4L5QA 4YWKA 4DK3C 2D0PA 2PQAA 2JQOA 3S2DH 3D31A 1SE8A 5C44G 1TWHH 1XMOQ 3PF4A 4NXNQ 3MEFA 3RLOA 4HIOA 4RG1A 2JA6H 2N49A 3K80C 1Q82C 1JE5A 4FDBA 2K75A 1AE3A 4KHZA 1I94L 2HT1A 4GNXB 3K7UC 2UXDQ 1YEZA 4GKKL 3AEVA 4A3CG 3ULLA 4JYAL 4HJ9A 1BVSA 2E5LQ 4A3MG 1CKNB 1QVCA 4APVA 3UDGA 5AJ3Q 4IPHA 1YJNA 2ZTCA 3KDFB 4BY1G 4JI7Q 2F52A 4JBKA 3U58A 2R93G 4TQUS 2F3IA 4DUZQ 1NTGA 2YTVA 2Z6KA 4GN4B 1YZ6A 3KJPA 4DV4L 2OWOA 4IOAA 1BBWA 1HZBA 1VCIA 4UP9A 1V1QA 2D62A 5M3MG 1XNRQ 3GTPH 4LFCL 1XPRA 3AYHB 4LF5L 3HOXG 4C3IH 3HOUG 4C3HH 1J5EL 4P75A 5IY0A 4IFDI 3PUWA 5GROA 1PH2A 2E2HH 3OTOL 4X66Q 1QUQB 4PZ8A 5FLMH 4DR4Q 2UUCQ 1YJ9A 3GTLH 4KHPL 1KQSA 1Z9FA 4DK6C 1TWFH 2VL6A 3G71A 5C0XJ 4DV3L 1X3GA 3PUZA 4HIMA 1L1OA 1G291 2KHIA 4JI8Q 5IP7G 1HNZQ 5J3BA 4OX9L 1OXXK 3HFZB 1PH1A 2ASBA 4DV1L 1XMQQ 4DR7Q 1XPOA 4A3LG 4GLVB 3GTQH 5EAYA 5IYDH 4DKAC 1FVIA 1OXSC 4DR3L 4DUYL 3CCUA 3L0OA 4DR5Q 4IJLA 4LF8L 1YHQA 1CSPA 1S3OA 1VQMA 2EIFA 4NPSA 4GOPB 1E7ZA 1VQPA 1Q7YC 5IT9c 4POGA 2WFWA 2UU9L 2ALYB 1OXUA 2OQKA 1E22A 3NEMA 3KF6A 3WWVA 3G6EA 5M3FH 4A3JH 1PH9A 1CKMA 1IBMQ 1PA6A 4YCUA 3RZDH 1YI2A 1LUZA 1I94Q 3A0JA 4GKKQ 5M5XH 1PFSA 2GVAA 2JA5H 4L5TA 1IBLL 4JYAQ 4X62L 2Q2IA 4B3ML 2NVYH 1H95A 4C2MH 4DV0Q 3TRZA 2MO0A 3CAMA 4GNXA 4LF7L 4BBSG 3MXNB 3F2BA 2VW9A 2L15A 4NXMQ 4DV4Q 2ZM6Q 4QJFA 5IP9G 4AIMA 3JAMi 2AKWB 2VZAA 4L5SA 4LFCQ 2JA9A 1QVFA 2ZJPA 4LF5Q 1D8LA 3CCMA 1X3FA 1J5EQ 4DAMA 3LGJA 1EIFA 4LUOA 4DV2L 1YHBA 1YIJA 3OTOQ 1S72A 3I4MG 4H02A 1HNXQ 4A3EH 3IRBA 3OYYA 3T1HL 1IL2A 5GQOA 4K0KL 3PUYA 2RF4A 2Z6KC 1XJVA 4DV7L 1HR0W 2KCTA 5LMNW 2HHHL 1HH2P 2Q2UA 4DV3Q 4A3GH 1QUQA 4LF4L 1PV4A 2AMCB 4JI4Q 4BXXH 4IPGA 5ELOA 4BA1I 1Y1WG 2MO1A 4OX9Q 4A3DH 3RZOH 1EFWA 4DV1Q 5C4JH 1X65A 1JJCB 1TXYA 4A93G 5GAHC 3UDIA 1VS0A 3I55A 5C44H 4DR3Q 4LF8Q 1FJGQ 2R7ZG 3CW2C 1AE2A 2FXQA 4JBJA 1UE1A 1L1OC 2JK8A 4JI0L 2B63G 4R4IA 4HIKA 1A8VA 1N32Q 3AFPA 3U50C 3M4OH 1P8LA 4IO9A 4IOCA 4A3CH 2F4VQ 1VQDA 3RN5A 1KRTA 4A3IH 4GLAC 4GOPA 2JA7G 3SGIA 1LYLA 5GAGC 1QZGA 1IBKL 3S14H 1IBLQ 4X62Q 4BY1H 4MZ9A 4JOIA 1N36L 1K8AC 4B3MQ 2VUMG 1PYBA 4GLXA 2ZTDA 3HOZG 1VQNA 1B7YB 5M3MH 1K0RA 2XGTA 3KFUA 2YU9H 1KD1C 3ULJA 3I4NG 2GVBA 2WP8J 2QEXA 1L2FA 2PMZE 3CD6A 1BKBA 3M85A 4JI2L 1WOCA 4POFA 5JJLA 5FLXc 1E1TA 2HIVA 4A3BH 1NBWA 3GTJH 1X3EA 4DV2Q 4IFDG 1KC8C 1W3SA 4GNXC 1VQOA 4BY7H 3W1BA 3T1HQ 2UXCL 3UDXA 1YJWA 3TS2A 1N9WA 3D0FA 3NELA 2BA0A 4DV7Q 2HHHQ 3UE0A 1YVCA 1C7YA 5IP7H 3EN2A 2E2IH 3STBC 3GDEA 4EQ5A 3CCSA 1VQBA 3OW2A 2UUAL 5M5YH 1SN8A 2WAQG 1VQIA 3B6YA 4KLKA 3S1NH 1S40A 5IYDG 3CXCA 2V1CC 1Q46A 3GTOH 2NVXH 3AQQA 3H0GG 2CFMA 4KI0A 4MTNA 4YCWA 3J81j 4C3JH 1HNWQ 1PH8A 4BBRG 3A5ZB 1ASZA 3KJOA 1K8GA 4LNQA 1JMCA 4JI0Q 4B3RL 1NE3A 1EUJA 5JJKA 1RL2A 3HOYG 1C0AA 1UEBA 4K0KQ 2XTIA 4IJHA 1N33L 1V43A 2EQSA 3AFQA 3FHWA 3RLNA 3J7ZC 3TQYA 4OWWB 2YTXA 3KYHC 1IBKQ 3PO2H 2A1AA 2VQEL 2I5MX 1JJGA 3PV0A 1VQHA 3HOVG 1N36Q 2IX0A 2AWNA 2KCMA 4DV6L 5IP9H 1EOVA 3K81C 4JG2A 3FKIG 2UUBL 3CMAA 4O0AA 1XNQL 3ICEA 1PYSB 2KHJA 5IWAL 3VDYA 3DM3A 1B8AA 4J15A 5HY6A 3HKSA 4OWXB 1N8RC 4QIWE 4GOPC 4JI6L 4AH6A 1VQGA 1WCMH 3CC4A 3I4MH 2VY3A 4JI2Q 3GTGH 1Q1EA 4HJ7A 2YV5A 3RLFA 1Y14B 4JOIC 4IFDJ 5K36G 4JCVE 3J80i 4DR2L 2AWOA 5C3EG 3CCVA 3I56A 1VQEA 2JEBI 3F2CA 1VQFA 1VQJA 1PH5A 1C9OA 1A62A 1KHIA 4XIGS 1LTLA 2JA6G 3NENA 1QVGA 1BBUA 4A3KG 2I5LX 4A3FG 1Y1VG 3M9BA 1Y1WH 2LSSA 4GN3B 4B3SL 3UE1A 3H3VH 1B70B 3HOWG 2OTJA 3Q8DA 3PIPA 4LFAL 1HR0L 2GN5A 5LMNL 1UE6A 4OO1I 2UUAQ 3S16H 4AQYL 3W5OA 3S1MH 3STBD 1SMXA 1CKNA 2BH8A 2NZHA 3F2DA 1TWGH 3DLLA 2MQHA 3BU2A 5JEAG 3KDFA 2VQFL 1VQ4A 2C35B 4BA2I 1PH7A 3PUXA 4YY3L 3TS0A 2R93H 4YWMA 4B3RQ 1YITA 2NVTH 3M7NA 2A8VA 4P73A 1PH6A 4OWTB 3J7A5 2R92H 4GS3A 1N33Q 1Q86C 1WI5A 4UP8A 5LMUL 4IPCA 2NN6I 1OXVA 2KBNA 1O7IA 4JBWA 4R4TA 3PIOA 3H15A 3PF5A 1K73C 2BA1A 2VUMH 4KHPQ 2ZJRA 4DPGA 2VQEQ 3HOZH 1HZAA 4UPAA 4DR6L 4LFBL 4QL5A 3U4VA 3TREA 1SR3A 3ER0A 4DV6Q 2WB1G 3F8TA 3I4NH 5M5WH 3CPWA 2UUBQ 5FJ8H 3EIVA 5IYBH 1EQQA 2CWPA 2B29A 5IWAQ 1VQ7A 1OXTA 2N78A 4DUYQ 3S1RH 4JI6Q 1K83H 3CCEA 3S1QH 3S2HH 3E9HA 4NXNL 2IY5B 4JBMA 3L2PA 3ULPA 1WJJA 4LUVA 2UU9Q 1XPUA 2UXBL 1LM0A 2WAQE 4QQBX 5M3FG 4A3JG 3NBHB 2HQLA 4A3MH 4HJ5A 1IZ6A 2BH2A 4WJ4A 4B3SQ 4AYBG 2JA5G 1UWVA 1X54A 3E0EA 1MKHA 1HR0Q 5LMNQ
chains in the Genus database with same CATH superfamily
3QO2A 5EKKA 3ERQA 4TVAB 1I50H 4JPBW 4YHHL 3E5SA 2Z0SA 1AFPA 2ID0A 1STEA 1BQQT 4IPDA 1PFMA 3VR2A 2EDGA 1KXLA 3G48A 2B2TA 2DGYA 5EJWA 3ND8A 1MJEA 2O5JC 2KEDA 4MTKA 2CHBD 4ME3A 3IKJA 1X56A 1EY6A 2I46A 4PZ7A 1PFBA 4LF4Q 3P75A 1NY4A 4ZRZA 4A3LH 4HMIA 5DM73 3KF6B 4M1UB 1T9HA 1EWIA 4OXPA 3HS0C 3CC2A 1M90C 1QZHA 1DGSA 1JOKA 1IBML 2RSOA 2WINB 2UXBQ 2JJQA 5C0XI 3CMEA 4A3IB 3MFYA 2H5XA 4R4QA 4BBSH 4RAUC 3WOEA 5KEEA 3S14B 5ELBA 2QDBA 3EBEA 1MSGA 1TWCH 1WD1A 4OHJA 4DXFA 4IUVA 4LF9L 1WYDA 3KBGA 3C46A 1HZCA 4NW2A 1K3BC 2KENA 1Z47A 2MP1A 1HNXL 2EY2A 2HDLA 4RGOS 2Y0SB 1S4ZA 5CV6A 3T1YL 1W2BA 4V0BA 1PTOB 5F2DA 2K52A 1ZEQX 4BY7G 2K04A 1WTPA 3R2TA 2CWAA 1QWYA 5CYUA 4KTAA 2EY5A 4IQZA 4MIUA 3CCRA 2G9HD 1YHAA 2B2TC 2XN9C 1SROA 5M5YB 3VYTA 4B3TQ 1SDFA 4ID6A 1Q90A 1SAPA 4NKLA 1CTMA 4C3IG 4XTCS 1SE4A 3OHXC 3MC0B 1EIYB 2F0HA 3S15H 1D1KA 1HR0Q 5DM63 4BS9A 4A76A 1XTDA 4QY7A 2IX1A 1HXYD 4ZLTF 1GKHA 4OGQC 1TIID 1SRUA 2YYZA 4H13C 2L55A 5IGDA 1O78A 4PMWA 1X6OA 2K14A 3GTQB 5G3LD 5NUCA 1D5MC 3ND9A 1I3QH 1F2LA 3G4SA 5KIXA 3S17H 1L0WA 4JI1Q 4LW1A 1LABA 4XT3B 1EEFD 3T13A 1EU3A 4Y52H 1PTOF 1EL0A 2JA8H 5M5XB 5FO7B 3MXGA 3HKZE 2NVYB 4C2MB 1N34Q 5BR8Q 4BBRH 4I7AA 4P71A 1EQRA 3I7FA 4F7XA 3NP8A 2OEOA 2KVMA 1E24A 1A15A 4IUQA 5I6WA 3OWEB 5C3WA 2A6HC 2R92G 2NUCA 3PSIA 1F9SA 4DXGA 4RMFA 1EYGA 1EQTA 1HJPA 3FDTA 5IGFA 4A3GB 3I4OA 2F0GA 4L63B 3TP8A 2ATWA 3X3NA 4FP5D 5C4XH 3ONAB 5IYCH 3RNUA 4C1NK 3PGZA 5C6AA 1IYUA 2WKCA 2QA4A 3EROA 4DK3C 2BE5D 1U9RA 2D0PA 1SE8A 4ABNA 1SYGA 3S1RB 2QDLA 2F0OA 1AE3A 2HT1A 1QNKA 1M8AA 4JYAL 1BVSA 2F0TA 5CORA 1L0XB 4IPHA 3KLSX 2F52A 4FVMA 4JVZA 4TQUS 4DUZQ 1NTGA 4IOAA 1YZ6A 5CBAE 1HZBA 1XNRQ 2E75C 3GTPH 2A6ED 5LL6X 1XPRA 3AYHB 3SR1A 1NCVA 4LF5L 2YU9B 3TN2A 5GROA 2EYOA 3OTOL 4DR4Q 2BDNA 3Q0AA 3GTLH 3A7AB 2VL6A 5C0XJ 4DV3L 3PUZA 4FXDA 4BY7B 3WDNA 1V8QA 4X3TA 2Q8RE 5J3BA 1HNZQ 3HFZB 2ASBA 1PH1A 1SXTA 4BWGB 1XMQQ 1R9TB 4A3LG 4DKAC 4DUYL 3EJIA 1KTKA 4NPSA 4NMZA 1VQPA 1Q7YC 3PQIA 5IT9c 4POGA 2WFWA 3GTOB 2VB3X 3G6EA 2FMMA 3KF6A 5M3FH 1PH9A 1CKMA 1YI2A 1KDBA 3A0JA 4GKKQ 5KNDA 4L5TA 2Q2IA 1SJHD 3TRZA 5TSSA 4BBSG 1LT3D 2VW9A 2L15A 2F0KA 1ENCA 1QVFA 1D8LA 1X3FA 4RKBA 1EIFA 4LUOA 4DV2L 1YIJA 1PXUA 2EYPA 4A3EH 3IRBA 1V1PB 3T1HL 2D2CC 5JPMC 4DV7L 2HQEA 2KCTA 2IL8A 5A35A 1PTOD 2KCNA 3T16A 4LF4L 4JI4Q 4BA1I 1C48A 1SSOA 4NDXA 4DV1Q 1X65A 1JJCB 5GAHC 3I55A 5C44H 2E2DC 3CW2C 1AE2A 2BCOA 4JBJA 1UE1A 2JK8A 2VB2X 1DONA 1M4VA 4DU9A 2Z8LA 4ZCKA 3J7YW 3M4OH 1CHQD 4A3IH 5IODA 1X3QA 5I2YA 4GOPA 5GAGC 1F2YA 3S14H 4X62Q 4ME5A 4B3MQ 4DGZA 2EXZA 2VUMB 1DXMA 3HOZG 1LO5D 1HHVA 4HR7B 4ZUIA 2QEXA 2L11A 3FEWX 4O1NA 4KD3A 3M85A 3MXNA 2B2VA 4S3SA 3MVVA 1KLGD 2HIVA 3KK7A 3SHLA 3DWAA 2F0SA 1VQOA 4RCNA 1EY7A 3CU7A 5C5MA 2ZXRA 3DM1A 1C7YA 5IP7H 2I07B 4EQ5A 1VQBA 3SEBA 4QB4A 1TY0A 5M5YH 1SN8A 3B6YA 1SYEA 4FYDA 3AQQA 3H0GB 4C3JH 3J7AF 4BBRG 1I50B 1JMCA 2K28A 1I4XA 2TSSA 5L37A 2XTIA 4DF7A 2FINB 1V43A 5IGCA 3J7ZC 3TQYA 4OWWB 4G57A 2DJFC 1HCZA 2L0CA 4ZQ3A 3IFTA 1N36Q 3HOVB 2AWNA 4DV6L 5IP9H 1EOVA 3IFDA 3FKIB 4O0AA 5J39A 4Z9CB 1GUTA 2EJMA 4J15A 5HY6A 3HKSA 4OWXB 4GOPC 4JI6L 5CV5A 1VQGA 3CC4A 3I4MH 2VY3A 2PZWA 1Q1EA 3RLFA 1SNDA 1QE6A 5CV7A 3K5OA 1NAPA 2ENBA 1KHIA 1A62A 1S5CD 4MHEA 3NENA 4A3KG 1LT6D 1Y1VG 1Y1WH 2FJ2A 2F0VA 4GN3B 4B3SL 3HOWG 2B2VC 1R4QB 1GHJA 1AZPA 3S1MH 1GUWA 3F2DA 2X69A 3DLLA 3D4DA 2HCCA 3D4WA 1TWCB 2B8FA 3BU2A 3K6OA 1JCKB 4G7HC 1VQ4A 4BA2I 1JORA 3SK6A 5T1GA 1YITA 3EA6A 1JOQA 1PH6A 1JWUD 4C3HB 1EYCA 1HQMC 5LMUL 4RHSA 1KQSA 2KBNA 1O7IA 5IIFA 1K73C 4R9WA 1B44D 1HZAA 5BN3A 4DK1A 3OIQA 1RHPA 2C5CA 4K6LA 1EYAA 4ILWA 3F8TA 1SNQA 3I4NH 4K5XA 4K8JA 5IYBH 1T5XD 5IWAQ 4N8X1 1VQ7A 1HPCA 2N78A 2LKVA 3OW7A 3S1RH 1DOKA 3CCEA 1AN8A 3S1QH 1RDPD 1WTRA 3NQTA 3E9HA 3U9SA 2K05A 3DUZA 4JBMA 3L2PA 3ULPA 4LUVA 2UU9Q 4OELB 1L0YB 1LM0A 1QB5D 5M3FG 3NBHB 4A3JB 1STHA 1UWVA 2JA5B 1MKHA 5IYDH 1SYCA 5LMNQ 2R93H 1GD7A 1CK1A 2K5HA 4DA2A 4LF7Q 3E9IA 1IYJB 2NBFA 1EIGA 1F9PA 1O7ZA 3HOYH 4JV5L 4P72A 4H0LC 2ICEC 3ERSX 5LHY1 4UHVA 4N9TA 2MHVA 2EYHA 1KIXA 3S17B 1CM9A 1E1OA 1UEAB 3BVZA 1R9TH 3UI2A 3OSOA 1V1PA 5DEHA 2Z6BA 2JA8B 4A3DB 2RCNA 2IHEA 1CI3M 1GUNA 4TRDA 5C3EH 4CJ2C 1XX8A 1LTAD 1I5FA 1STNA 3A5UA 2A19A 3HKZB 4XQNA 3SK8A 1FGBD 5DNFA 4DV5L 4A3IG 1NMGA 4K2LA 3CHBD 4IALA 2E2JH 2M2LA 2ES2A 3TBIB 4B9XA 1CZGA 2B39A 3E3XA 3R3OA 2DUDA 1VMCA 3K5NA 5ELDA 3Q24A 4HN7A 4LF6L 1X3PA 2QGQA 5C4XB 2L5TA 4K8IA 3ZJYC 4PZ6A 1AEXA 2OXPA 3LWEA 1BR9A 4JI5L 2NZ1D 2Y0SG 4DR1Q 4A3BB 1B4OA 4QUCA 3OPOA 1VQLA 1CSQA 3NE5B 4CHTB 3CCQA 3CPFA 4HIDA 1GUSA 3N6RA 4JI4L 5IGBA 3A8JE 2E2IB 1K3RA 1K8MA 1K28A 3KF8A 1FYCA 3A8IE 4GN5A 3S1NB 4RCOA 2O5IC 1S5DD 4X65L 1VQ8A 2NVXB 4PG3A 4QF4A 4DNRB 3Q6SA 4AYBE 3CP0A 1FNVA 5BN4A 3NTIA 3K0XA 4X64Q 3GD7A 1E0BA 1GXDC 4JI3L 4WJ3M 3PO2B 1O7LA 3L7ZC 1HA5A 4G7ZC 5IGGA 2HIXA 2N3SA 4GKJL 4QGUA 3QIAA 3UDFA 1UAPA 2Z4HA 2EVBA 2RHQB 2ZJQA 4L5RC 1I4HA 2IHFA 3V2TA 4DNIA 1XMOL 2K6AA 1WCMB 1HZ9A 3CF5A 1VQKA 5I2XA 3A74A 1WVLA 2RSNA 5AJ3L 1X55A 4LFAQ 1V9PA 1K9MC 1GO3E 1GUOA 3H0GH 5E4XA 3I2ZA 1D7QA 5GADC 3GTMH 3SDZA 1X9NA 1PH4A 2VQFQ 4B08A 4ZKBB 1CA6A 3PIP3 3TEHB 5GAEC 3RN2A 2UUCL 3RR5A 2YTYA 1ZYRC 2J7ZA 1DZ1A 4HJAA 3HOVH 5HGQA 5KRUA 4A3EB 5C0XG 2F03A 4JI8L 3FKIH 1G6PA 4A3GG 2CCZA 2LY7A 1J6QA 3NBIA 1PLFA 1TT2A 4UDUC 1VQCA 4X3KA 5M5WB 5IYBG 4YWLA 4YWKA 2PQAA 1B1ZA 5CV8A 3PF4A 5C44B 3W2DA 4ZYSA 4NXNQ 1DD2A 3E6ZX 3Q22A 3K80C 1ESRA 4FDBA 2NN6H 5I9OA 2K75A 2UXDQ 3NXWA 1PZKD 2SDFA 3M4OB 2E5LQ 1MSHA 2JXMB 4LJZC 1Y69U 4DAYA 2AUJD 3NBHA 4JI7Q 4FXKC 2R93G 4DV4L 4GN4B 2Z6KA 1QG7A 5EPLA 1BBWA 1VCIA 2D62A 3HOXB 4C3HH 1J5EL 4P75A 5IY0A 3CQZB 3HOUB 3PUWA 1PH2A 4X66Q 5J22A 5FLMH 1Z9FA 2QF7A 3G71A 1QILA 1X3GA 1B53A 1G291 2A69C 5AFWA 2A6HD 1I6HB 3OMGA 1F2ZA 3MZ5A 1NUCA 3G6JB 4DR7Q 2IWHA 1QJOA 4QMGA 1JOOA 4ZAIA 4EQNA 3CCUA 4DR5Q 2AQ2B 4I65A 1D1IA 4HAEA 4GOPB 1E7ZA 2E76C 3H91A 3SXHA 2UU9L 1OXUA 3LNNA 3AU7A 4C3JB 4A3JH 1LUZA 1I94Q 1UUPA 5FK9C 2JA5H 4CDCC 1IBLL 1GUGA 4DV0Q 3D3RA 4LF7L 2HDMA 3MXNB 3MXPA 3NSWA 4NXMQ 1A2TA 2ZM6Q 4QJFA 1EWHA 2AKWB 3JAMi 4LFCQ 4X3SA 3OMCA 1WTXA 3CCMA 1HTPA 4GZYC 2G9DA 3I4MB 4FF2A 1HQRD 2RF4A 1LV9A 2Z6KC 3O13A 1XJVA 1HR0W 1HH2P 2XIWA 4RGNA 4Y7NB 1PV4A 2CQAA 4BXXH 1J9OA 4A3DH 4OX9Q 1CFMA 3VR5A 1Y1WB 5JJZA 4A93B 4DR3Q 4LF8Q 4KY7A 1BOSA 2R7ZB 3S1MB 1H9MA 4JI0L 2DNCA 4RA8A 4R8IA 4HIKA 1A8VA 4RH6A 1AP0A 4K0KL 2NVQB 3H94A 4A3CH 4GLAC 2JA7B 1LYLA 4X3UA 1QZGA 1ET9A 4BY1H 3URYA 2VUMG 1K8AC 4JK1C 1Z6HA 1PYBA 4KMUC 2SEBD 5M3MH 3HRZC 5CR3A 2B2UA 3I4NB 5JVG3 2GA4B 1WOCA 5JJLA 1SNCA 1Y8OB 1E1TA 4A3BH 5IT9E 1XWEA 3S1QB 3K59A 3R2IA 2UXCL 1D6EC 1XXGA 4KY5A 1BUVT 3NELA 2HHHQ 2PW5A 3UE0A 1LTRD 2F3VA 1SFOB 3EN2A 2E2IH 3STBC 1KNAA 4OEMB 3G7LA 5IT9L 4KKTA 1B3AA 3I72A 2UUAL 3S1NH 3SK5A 1S40A 2XNAC 3MWYW 2H1EA 2R93B 4HSVA 4KKSA 2NVXH 3H0GG 2CFMA 4YCWA 3J81j 1HNWQ 2N88A 3MTSA 3A5ZB 4B3RL 1NE3A 1C0AA 1UEBA 3HOYB 3T56B 1N33L 5ELCA 3FHWA 1SYFA 3AFQA 4IURA 2JSOA 1IBKQ 3PO2H 3HOVG 4ULLA 4CGYB 1GJXA 1S5FD 3K81C 3DEOA 3FKIG 2EY6A 2UUBL 3ICEA 2KHJA 3VDYA 3DM3A 1B8AA 2F0LA 1WCMH 1R4PB 4JI2Q 1STGA 1DOMA 3E0JA 4JCVE 2NTTA 1TWHB 2JEBI 5C3EB 3F2CA 1PH5A 1NNXA 1C9OA 1QNUA 2E74C 4XDXA 4LAAA 1QVGA 2A73B 2RDGA 2B2UC 3UE1A 3H3VH 3PIPA 4LFAL 1U4PA 5FKAC 1HR0L 4FF4A 2GN5A 1S5BD 4OO1I 1YNNC 3S16H 1A6XA 2N55A 4PMBA 3W5OA 2E2JB 3DMUA 2K1BA 4CKCA 2NZHA 1TWGH 3FVQA 2FHTA 2VQFL 2C35B 1PH7A 3TS0A 4R8NA 2SOBA 1MHWC 3BYTB 4C3HG 4RWSC 1I4GA 1A2UA 4JW0A 4IPCA 2NN6I 3H15A 2E2HB 1HFNA 1LT4D 2WIIB 2VQEQ 4UPAA 4QL5A 2Z9HA 4HSPA 1SEBD 3TREA 3H3VC 2MUYA 3I8ZA 1IKMA 3KBXA 3H6MA 5M5WH 5FJ8H 2V4DA 2PPBC 2IJ0A 1OXTA 2RDHA 4IFDH 2F0PA 4NXNL 4RFBA 3D8GA 1V1OA 1PZJD 2UXBL 2WAQE 4A3JG 2HQLA 3RZDB 4WJ4A 1LTTD 2D9UA 3VR4A 2JA5G 4AYBB 1LT5D 3U4ZA 1MIUA 1RTOA 4AQYQ 3GQBA 3HP3A 3HOXH 1OTCA 1I6VC 3HOUH 3CQZH 1WTQA 1VQAA 2MGSA 4YY3Q 2PW7A 3M4PA 1SMYC 1FL0A 1CKOA 4X66L 1NJIC 1JE4A 3FP9A 2EPBA 1HRJA 1PDQA 2PZUA 1NMFA 5ELNA 1JT8A 1CHPD 4NB3A 1GVPA 3KF8B 3JAME 1I6HH 2JYOA 4DR6Q 2AHOB 4LFBQ 3RD4A 3BVMA 2K5VA 2LXJA 1GHKA 1LTBD 2K5QA 4FO2A 4DR7L 2JA8G 4A3DG 1Y8NB 3I3CA 1Q8IA 4DR5L 2JP1A 4PMCA 5K36H 1ESFA 4B3TL 1FGUA 1UE5A 4L6TB 3QB3A 5A2QE 2K50A 3HKZG 3GTMB 2Q8IB 1G51A 4A3FH 5JJIA 2F0UA 3F1ZA 2AQ1B 1TR5A 1GOZA 5IE8A 3VA7A 1VQ9A 4IN3A 1YBYA 2NYZD 3A8KE 3S9WA 4DV0L 5A2QL 3GTKH 5C4HA 3BJUA 5EBDA 3J80c 3AB9A 4R1JA 4NXML 3NTHA 2ZM6L 5EPJA 2JEAI 4G7OC 4YHHQ 2RBMA 1ASYA 1FNUA 5C4XG 5IYCG 2CW0C 5T1IA 1STAA 5CBEE 2OCEA 2A68C 1SLJA 3PUVA 1PVOA 4YCVA 5COYA 1BBXC 1RF2D 3M3YH 1RODA 2WB1E 3EFXD 4A3BG 2PMZB 2K33A 4JI1L 4Y7NH 3L9AX 4B9WA 3JAMc 4CKBA 2F1MA 3KLWA 2FFKB 2D0OA 4A93H 1H9KA 1NSNS 2Z4IA 2R7ZH 4K5WA 3GV6A 2L12A 1N34L 5BR8L 2Q2TA 1YNJC 4UY8C 2NVQH 2EJGC 1TQOA 4H44C 1NR2A 4C56C 2JA7H 3SK4A 3MHBA 2NTSA 1SYBA 1ZXTA 1FR3A 1KNEA 3PO2G 5KNCA 1IW7C 4XT1B 2PQAB 3QWNA 3KLRA 4LF9Q 3W1GA 1BXTA 2QKIC 4FNFA 1KLUD 1JWMD 1KABA 1RIPA 1HA6A 3BZKA 1MGSA 3CCJA 1WCMG 4KN4C 1BNZA 1JB7A 4DR2Q 3T1YQ 1TU2B 5BN5A 1G6ZA 4QIWB 1SFOH 4XQQA 1CA5A 2KJXA 4DAYB 4HCEA 4TKOB 5K5PA 5IOCA 1Q1BA 2X6LA 2PNRC 3J81c 4G4KA 4DUZL 4J1MA 1XNRL 5HGTA 1HNWL 1PRTC 4PQXA 4XXEA 2HD3A 3M4QA 2VS1A 2L1BA 3KOJA 4KY6A 3IAYA 1LTGD 5FOBB 2JN4A 5D3DA 2SNSA 4O2DA 2EYMA 3C3LA 4DR4L 3I73A 1UE7A 4F8MA 2LXKA 1KL9A 3CC7A 4A3EG 4LUZA 3H3VI 2K4KA 1BCPC 2JE6I 3BZDB 2KEEA 4A4IA 1HNZL 1B2TA 1XMQL 4IUNA 2NZOA 1Q81C 5FJ8G 4EX5A 4U673 2MFIA 1HUMA 4L5QA 1VMPA 2JQOA 3S2DH 5C44G 2LMCB 1TWHH 2M00A 3MEFA 4HIOA 4RG1A 2N49A 3S2HB 1Q82C 2L4NA 1I4RA 1FNWA 4OIKA 4KHZA 3K7UC 2RKSA 5CV9A 4GKKL 3FPPA 4DNTB 3ULLA 1X32A 1CKNB 1PZID 4A3MB 1QVCA 4APVA 3UDGA 2ZTCA 4UAIA 4BY1B 1DM0B 5KYIA 5ELEA 1TS5A 2YTVA 3FMCA 3KJPA 1O7YA 1EZ8A 1EU4A 1V1QA 5M3MB 2B8GA 3HOXG 4C3IH 3HOUG 4IFDI 3NWSA 3TZUA 2E2HH 4HTHA 4PZ8A 4K2KA 4LK1C 4DK6C 4KN7C 4HIMA 1IKLA 1L1OA 1ONLA 2F0JA 2B2YA 4QUFA 3R8BA 5IP7G 3NK9A 1ZYRD 1OXXK 3MA2B 4DV1L 5E3FA 5EAYA 1FVIA 1ML0D 3OWFA 3L0OA 4IUPA 2WKDA 1YHQA 4F87A 1CSPA 5HURA 2EIFA 5D3IB 1TY2A 2G5DA 4C3JG 3D4RA 3RZDH 2GVAA 1Z7TA 3KUPA 4JYAQ 4X62L 5FO8B 3H09A 1F2MA 4B3ML 1JC7A 2PYKA 2MO0A 4GNXA 4HMJA 3F2BA 5IP9G 3K7AB 4AIMA 2FMCA 2HCIA 4LF5Q 1HTLD 5EKIA 4NP5A 4DAMA 2WACA 5FLXE 3I4MG 3OTOQ 2OT2A 1IYVA 2RVLA 5JVH3 5GQOA 1SNMA 1TWAB 4MN3A 5LMNW 1CT1D 4DV3Q 2Q2UA 1CQVA 1QUQA 1MD2D 2K03A 5ELOA 1Y1WG 2MO1A 1F9QA 1EFWA 1TXYA 4A93G 3HZXA 1VS0A 2A69D 3S16B 3TSSA 1FJGQ 2R7ZG 1EFID 2K01A 2FXQA 3RMHA 1L1OC 2LS01 1NR4A 5I6YA 4FF1A 2B2YC 1TWGB 1EY0A 1N32Q 2DY7A 3AFPA 2WV6D 4IO9A 4IOCA 2F4VQ 3RN5A 1KRTA 1A3VA 2JA7G 4IUTA 2OF1A 3C2PA 4DN4M 2RCFA 2ZXPA 4MZ9A 2KOLA 3BS1A 1N36L 4OO1H 3FRPB 3HEJA 3NUCA 1VDZA 1U4RA 1B7YB 3Q23A 1VQNA 3KFUA 4RKLA 1KD1C 3ULJA 3I4NG 2GVBA 1L2FA 4PNYA 2PMZE 3CD6A 1BKBA 2KUMA 2TMPA 1II3A 2XWJB 2EE1A 5FLXc 5KNBA 1NBWA 2P5ZX 1X3EA 3GTJH 4DV2Q 2F0EA 1W3SA 4GNXC 3W1BA 2F0IA 4IZ8A 3T1HQ 3UDXA 3X3MA 1YJWA 1N9WA 3D0FA 2BA0A 3MAQA 4DV7Q 5IGEA 1XTCD 2F0NA 3CCSA 1DJRD 3OW2A 1EEID 4KLKA 1VQIA 2WAQB 5IYDG 1MBYA 1Q46A 1RCVD 1ENAA 4KI0A 3DWPA 5EBCA 1PH8A 3PMFA 1ASZA 3KJOA 3ITPA 4U68A 1EUJA 5JJKA 3HOYG 4IJHA 4ZUJA 3M7GA 3RLNA 3A7LA 1CZWA 2YTXA 3KYHC 1S5ED 2DJGC 2F0QA 2KCMA 1STYA 3CMAA 1PYSB 5IWAL 2R3ZA 1N8RC 4KK7A 4QIWE 1H9SB 1EWCA 3GTGH 1AW7A 4HJ7A 2YV5A 4IFDJ 3J80i 4DR2L 2AWOA 5C3EG 3CCVA 5I4DA 4WJWA 2K5DA 4XIGS 1LTLA 2JA6B 2QCPX 1BBUA 2I5LX 1HUNA 3M9BA 4A3FB 2KCCA 1B70B 4E6IA 1EY5A 3Q8DA 5LMNL 2EYFA 4DFAA 5JOBA 3GTKB 3STBD 1SMXA 1CKNA 1I4PA 2KHSA 2MQHA 1IL8A 3PUXA 3P7JA 4YWMA 2K7VA 3GV3A 3M7NA 4P73A 4OWTB 1PFNA 2O2LD 1TVXA 1DOLA 1WI5A 1OXVA 3PO3H 4KHPQ 2BA1A 4QCLA 3M3YB 3T53B 3U9OA 3HOZH 1JWSD 1TWFB 4DV6Q 4WORA 2WB1B 1G8ZD 2IX3A 5EKLA 1WTOA 3CPWA 1EQQA 2CWPA 2B29A 2J0TD 3HG9A 2J4XA 4JI6Q 2XWBB 3RUZA 4KKUA 3S2HH 2IY5B 1SBBB 2F0WA 3VYUA 3FPUB 1SE2A 4QQBX 4A3MH 4HJ5A 3TP5A 4B3SQ 4AYBG 2KA7A 3SVMA 1X54A 1B50A 1K0SA 3E0EA 1RD9D 5EGTA 4DAPA 4M8AA 3OOCA 1KRSA 5E1FA 1E3PA 4X6AH 1Q3LA 2ICIA 3M4YA 3SE0A 5JEAJ 2I0QA 3TZDA 3J7AV 2F0MA 1YNND 1PRTB 4R4OA 3J81i 4DR1L 3S24A 5LMUQ 1WFQA 2BDOA 1ZKOA 4OONA 1IXRA 4XYOA 3BYYB 2H4OA 4KHVA 2IT1A 3BDCA 4MNOA 1BCPB 4J6HA 3R93A 1FD7D 1PMRA 3W3AA 2R7DA 3RZOB 1U4LA 5C4JB 5KGUA 1LACA 1PHJA 4UP7A 3QJYA 3TMEA 2A74C 2BOSA 1JJ2A 1Q12A 1WTHA 2K5NA 2XRQD 2ZTEA 5E4WC 4A3KH 1Y1VH 1SJED 1D5ZC 2DY8A 3HOWH 5JPNC 2MNAA 2RHSB 1BDOA 4C1NI 3IL8A 4X64L 1U5KA 2CKZB 3QOLA 1CUKA 3NWTA 1YNXA 2B3GA 4ALPA 2PI2A 3K7AH 1WTWA 1BF4A 4OO1G 3C1FA 1EY8A 2IW3A 1ENFA 1A63A 5E7NA 2R6GA 4JC0A 3V05A 3TP6A 3VR6A 4JV5Q 2EJFC 1J8IA 1TWAH 1G2SA 3PCOB 3D6WA 3I90A 4R4CA 3S2DB 1PRTF 1WD0A 1EYDA 4TSSA 3K8AA 2NWGA 1SMYD 2NN6G 2XVSA 5KYLA 1LLRD 3CCLA 4FXGC 1JICA 1Q8KA 1A0IA 2E8GA 1FJGL 1VQ6A 1BCPF 1W6JA 2VNUD 4N8FA 2PI2E 2B63H 4A75A 4H7BA 3VYSA 3C1EA 3NPPA 1VQ5A 2OTLA 1N32L 2Q2HA 2K5WA 2F4VL 4C3IB 5C5LA 4K5VA 1JR0D 4DV5Q 5FLMG 1TKWB 2PNHA 1M1KC 2CQOA 4P2CB 4CDDC 2BE5C 1P16A 2I5HA 4WFN3 1XNQQ 2XRSD 4LF6Q 3P20A 3NQIA 3BDOA 4RGTA 3JC66 2F4IA 2EXDA 2EY1A 3BZCA 1TS3A 4CDEC 4HJ8A 1KAWA 3GP7A 3GO5A 4JI5Q 2CH4W 2CW0D 1H9SA 5DLQE 2PZTA 2UXDL 1MJCA 2A68D 2K32A 1UNSA 4EVOA 3HGBA 2N8NA 2E5LL 2L9HA 5C4ZA 2A6EC 1U0LA 1PH3A 4JI7L 3J80E 2OQ0A 3VA5A 3WOFA 3EQLC 4Q0FA 4EGVA 2XSCA 1TS4A 1GM5A 3F2UA 5DAUA 1QCBD 1B9NA 1K8OA 1SNPA 2C9OA 4X65Q 2O4XA 3BG3A 3TP7A 3K58A 3J80L 1L1OB 1YNJD 2NVTB 3BVGA 3EVQA 1VF5C 4P74A 5H1SE 2R92B 2R61A 1G2TA 4WRDA 3PO3G 1B3QA 1AH9A 3DHQA 1ICFB 4JI3Q 2R7FA 4DAVA 1PYWD 1ILQA 1XYIA 2Y0SE 2KECA 1D5XC 4BXXG 4GKJQ 3PIO3 1H9RA 2VXWA 4LWCA 3JAML 1IW7D 3DXJC 3AMUA 3D31A 4CJ1B 4CBVA 1XMOQ 1PTOH 5M9OA 1K83B 3BDLA 3RLOA 2QILA 2JA6H 3NTKA 1JE5A 4ZK9B 1I94L 4GNXB 1YEZA 3AEVA 1RTNA 4A3CG 4HJ9A 4A3MG 5ISRA 2NB0A 1CQFA 5AJ3Q 1YJNA 3KDFB 3V96A 4F88A 4BY1G 1Y8PB 4JBKA 3U58A 2CH4A 3QG1A 2F3IA 2OWOA 4V190 5CV4A 5JEAH 1KAAA 4UP9A 4XYQA 5M3MG 4LFCL 1T5EA 3CRKC 1LTID 1EY9A 1E2WA 1O80A 1PTOC 1C4QA 1QUQB 1PRTD 1SE3A 2UUCQ 1RKNA 1YJ9A 4KHPL 3GTJB 4K6DA 1TWFH 4L8JA 2ZXOA 2KHIA 4JI8Q 3LWUA 1G91A 4N9PA 4OX9L 2RA4A 1XPOA 1BO0A 3J81E 4GLVB 3GTQH 1OXSC 1DYQA 4J8QA 4DR3L 1BCPD 4IJLA 4LF8L 1S3OA 1VQMA 2ALYB 2OQKA 3NHHA 1EOTA 1RJTA 1E22A 2Z1CA 1ICWA 3NEMA 3WWVA 3J81L 1IBMQ 1PA6A 4YCUA 4EQOA 5M5XH 1PFSA 3P1HA 2LFNA 3OIPA 2NVYH 1H95A 4C2MH 4Q5VA 3CAMA 2QEJC 2MJ8A 3MFGA 4BBSB 1LTSD 4RGMA 4DV4Q 2VZAA 4L5SA 2JA9A 3D6CA 2ZJPA 2ZT9C 1J5EQ 2SNMA 2Q8TA 3LGJA 4KJNA 1YHBA 1S72A 1OO9B 4H02A 1HNXQ 3GTGB 1ILPA 2EOTA 3OYYA 3VR3A 1IL2A 3PUYA 5C0XH 2HHHL 4A3GH 2RDFA 2KQ3A 2PQEA 5D14A 2AMCB 1EQVA 4IPGA 1F77A 3RZOH 5C4JH 1W6KA 2AUKA 3UDIA 1EIHA 2DN8A 2X6GA 2B63G 4R4IA 5CC4A 3U50C 1P8LA 1VQDA 3MEHA 3SGIA 1IBKL 4I7ZC 1IBLQ 1VF7A 2EYJA 4JOIA 3PO3B 3TDQA 3S15B 4CJ0B 2ZTDA 4GLXA 3K5LA 3HOZB 1B9MA 3N52A 1K0RA 2XGTA 2YU9H 2WP8J 3QOJA 4RHRA 2DNEA 4JI2L 2F0FA 1JQYD 2HUGA 4POFA 1F9RA 1AZQA 1D2BA 4IFDG 5LL6S 1KC8C 5FO9B 4BY7H 1I3QB 2IPKD 4YIJA 3TS2A 4ODGA 4PV1C 1YVCA 2F0DA 1E2ZA 3GDEA 1EY4A 2WAQG 5JAVA 3I70A 4CKEA 3CXCA 2V1CC 3GTOH 4MTNA 3A55A 1K8GA 4BBRB 4LNQA 4JI0Q 1RL2A 1SNOA 4IUUA 4K0KQ 1JB3A 2EQSA 1STBA 1QOHA 4HEDA 3VYRA 2A1AA 2B2WA 2VQEL 2I5MX 1JJGA 3PV0A 1VQHA 3A56A 2D5DA 2IX0A 4HCSA 4OIJA 5CMDA 4JG2A 5D65A 2RQXA 1XNQL 1SYDA 1A3UA 3I91A 4FF3A 3A54A 4AH6A 1I4QA 4KV6A 2F3WA 3CRLC 1Y14B 4JOIC 5K36G 3I56A 1VQEA 2UXCQ 1VQFA 1VQJA 2JA6G 5EPKA 1MI2A 1IHZA 3K0YA 4EQPA 5I9PA 4A3FG 5C3XA 4LMQD 4A3KB 2LSSA 1Y1VB 3HOWB 2OTJA 1EZ6A 1UE6A 5J1ZA 3T51B 2UUAQ 2QW7A 4ZKCB 1C8CA 4AQYL 2BH8A 1A3TA 2AQ3B 3CKIB 1H9JA 5JEAG 3DWQA 3KDFA 4YY3L 4B3RQ 2CVRA 1ET6A 3ZYYX 3KLSA 3GTPB 2NVTH 2A8VA 3J7A5 2A5HA 5EQ0A 2EZVA 2R92H 4GS3A 3DEPA 1N33Q 3I4LA 1Q86C 4UP8A 4OL7A 4CDFC 1U4MA 4JBWA 4R4TA 3PIOA 3K5MA 3PF5A 2VUMH 3L3OC 5CGKA 1E2VA 3T4AC 2ZJRA 4DPGA 3GTLB 4DR6L 4LFBL 3U4VA 3LX0A 2M9VA 3MXUA 4K14A 5FLXL 1SR3A 3ER0A 2WB1G 2PCFB 2UUBQ 1KDAA 3EIVA 4KD4A 4DUYQ 1K83H 5ELFA 1TS2A 3K57A 1WTVA 1KDCA 2B2WC 5G3LF 1WJJA 2MPMA 2EYLA 1HFGA 4KJOA 2B63B 1XPUA 2PO4A 4O42A 5M3FB 4DK0A 1IZ6A 2BH2A 4XQJA 1DCZA 3QR8A
chains in the Genus database with same CATH topology
1GD7A 3U4ZA 1MIUA 2K5HA 1KRSA 4LF7Q 3E9IA 1E3PA 4TVAB 1IYJB 4X6AH 4AQYQ 1I50H 4YHHL 1OTCA 3HOXH 2Z0SA 5JEAJ 2I0QA 2ID0A 3CQZH 3HOUH 1VQAA 4IPDA 3HOYH 4YY3Q 3M4PA 1KXLA 4JV5L 3G48A 1FL0A 1CKOA 4P72A 4X66L 1NJIC 2DGYA 4R4OA 1MJEA 3FP9A 3ERSX 3J81i 4DR1L 3S24A 5ELNA 1NMFA 1WFQA 5LMUQ 1JT8A 4OONA 1IXRA 4ME3A 4NB3A 1GVPA 3KF8B 1I6HH 1X56A 4DR6Q 2AHOB 4LFBQ 1KIXA 4PZ7A 1E1OA 1R9TH 2IT1A 4LF4Q 2K5VA 2LXJA 4MNOA 4A3LH 1NY4A 4DR7L 2JA8G 4A3DG 2RCNA 2R7DA 3KF6B 4DR5L 1T9HA 2IHEA 1PHJA 1EWIA 4OXPA 4UP7A 5C3EH 3CC2A 4B3TL 1FGUA 1UE5A 1M90C 1QZHA 1I5FA 2K50A 3A5UA 1DGSA 3HKZG 1Q12A 1JJ2A 2A19A 2K5NA 1IBML 2ZTEA 4A3KH 1G51A 4A3FH 1Y1VH 2UXBQ 5JJIA 3F1ZA 2JJQA 3HOWH 2MNAA 5C0XI 2RHSB 3CMEA 4DV5L 4A3IG 5IE8A 4X64L 1NMGA 1U5KA 1VQ9A 2CKZB 1YBYA 1CUKA 2H5XA 4R4QA 4BBSH 4DV0L 2E2JH 3GTKH 2ES2A 1YNXA 3BJUA 3EBEA 2B3GA 3J80c 4R1JA 2PI2A 3K7AH 4ALPA 2ZM6L 1TWCH 4NXML 2JEAI 2DUDA 4LF9L 4OO1G 4YHHQ 4LF6L 1ASYA 5C4XG 1WYDA 2QGQA 5IYCG 1A63A 1HZCA 5E7NA 2R6GA 4JC0A 3ZJYC 2OCEA 4PZ6A 2KENA 1SLJA 3PUVA 1Z47A 4JV5Q 1PVOA 1HNXL 1TWAH 4YCVA 4JI5L 2Y0SG 3PCOB 3M3YH 2WB1E 4R4CA 4DR1Q 4A3BG 3T1YL 1W2BA 2K52A 3K8AA 4JI1L 4Y7NH 4BY7G 1VQLA 1CSQA 3JAMc 3CCQA 2NN6G 3CPFA 4HIDA 2CWAA 3KLWA 4JI4L 3CCLA 2D0OA 4A93H 3CCRA 1K3RA 1Q8KA 1YHAA 1A0IA 2R7ZH 2E8GA 4GN5A 1SROA 1N34L 1FJGL 1VQ6A 5BR8L 2Q2TA 2VNUD 2PI2E 2B63H 4A75A 4X65L 4UY8C 4B3TQ 1VQ8A 2NVQH 4PG3A 1VQ5A 2OTLA 4AYBE 1N32L 2Q2HA 2F4VL 2JA7H 3CP0A 4XTCS 1EIYB 3K0XA 4DV5Q 5FLMG 3S15H 4X64Q 2PNHA 3GD7A 1M1KC 2CQOA 4JI3L 3PO2G 4A76A 1XTDA 4QY7A 2IX1A 2UXCQ 4WJ3M 3L7ZC 1P16A 2PQAB 1GKHA 2I5HA 2HIXA 2N3SA 4LF9Q 1SRUA 3W1GA 4QGUA 1XNQQ 2YYZA 4GKJL 4LF6Q 3UDFA 1RIPA 4PMWA 1X6OA 3BZKA 2K14A 2RHQB 3JC66 3CCJA 2EXDA 2IHFA 4DNIA 2ZJQA 3BZCA 1WCMG 1XMOL 4L5RC 4HJ8A 1KAWA 1I3QH 1HZ9A 3GO5A 3CF5A 1VQKA 1JB7A 4JI5Q 4DR2Q 3G4SA 3T1YQ 5DLQE 1SFOH 2UXDL 1MJCA 3S17H 1L0WA 4JI1Q 4DAYB 3PO3H 4LW1A 3A74A 2N8NA 2E5LL 4Y52H 2JA8H 1Q1BA 5AJ3L 1X55A 1U0LA 4LFAQ 1V9PA 1K9MC 1GO3E 3J81c 1PH3A 4JI7L 2OQ0A 3HKZE 4DUZL 3H0GH 3I2ZA 1D7QA 1N34Q 5GADC 1GM5A 5BR8Q 4BBRH 1XNRL 1HNWL 4P71A 3GTMH 1X9NA 1EQRA 3M4QA 4X65Q 2VS1A 2VQFQ 3KOJA 1PH4A 3I7FA 3TEHB 1L1OB 1E24A 4O2DA 5GAEC 4DR4L 3RN2A 2UUCL 1UE7A 3RR5A 2R92G 2LXKA 1KL9A 2YTYA 4P74A 5H1SE 3CC7A 4HJAA 3PSIA 3HOVH 4A3EG 5HGQA 3PO3G 4LUZA 5C0XG 1AH9A 4RMFA 1EYGA 3H3VI 4JI8L 2K4KA 3FKIH 4JI3Q 1HJPA 2JE6I 4A3GG 1G6PA 2R7FA 3I4OA 4A4IA 1HNZL 2ATWA 2CCZA 1J6QA 5C4XH 1XMQL 5IYCH 2Y0SE 3RNUA 4GKJQ 4BXXG 3PGZA 2NZOA 1VQCA 1Q81C 5FJ8G 2QA4A 5IYBG 4EX5A 4LWCA 4YWLA 2MFIA 4L5QA 4YWKA 4DK3C 2D0PA 2PQAA 2JQOA 3S2DH 3D31A 1SE8A 5C44G 1TWHH 1XMOQ 3PF4A 4NXNQ 3MEFA 3RLOA 4HIOA 4RG1A 2JA6H 2N49A 3K80C 1Q82C 1JE5A 4FDBA 2K75A 1AE3A 4KHZA 1I94L 2HT1A 4GNXB 3K7UC 2UXDQ 1YEZA 4GKKL 3AEVA 4A3CG 3ULLA 4JYAL 4HJ9A 1BVSA 2E5LQ 4A3MG 1CKNB 1QVCA 4APVA 3UDGA 5AJ3Q 4IPHA 1YJNA 2ZTCA 3KDFB 4BY1G 4JI7Q 2F52A 4JBKA 3U58A 2R93G 4TQUS 2F3IA 4DUZQ 1NTGA 2YTVA 2Z6KA 4GN4B 1YZ6A 3KJPA 4DV4L 2OWOA 4IOAA 1BBWA 1HZBA 1VCIA 4UP9A 1V1QA 2D62A 5M3MG 1XNRQ 3GTPH 4LFCL 1XPRA 3AYHB 4LF5L 3HOXG 4C3IH 3HOUG 4C3HH 1J5EL 4P75A 5IY0A 4IFDI 3PUWA 5GROA 1PH2A 2E2HH 3OTOL 4X66Q 1QUQB 4PZ8A 5FLMH 4DR4Q 2UUCQ 1YJ9A 3GTLH 4KHPL 1KQSA 1Z9FA 4DK6C 1TWFH 2VL6A 3G71A 5C0XJ 4DV3L 1X3GA 3PUZA 4HIMA 1L1OA 1G291 2KHIA 4JI8Q 5IP7G 1HNZQ 5J3BA 4OX9L 1OXXK 3HFZB 1PH1A 2ASBA 4DV1L 1XMQQ 4DR7Q 1XPOA 4A3LG 4GLVB 3GTQH 5EAYA 5IYDH 4DKAC 1FVIA 1OXSC 4DR3L 4DUYL 3CCUA 3L0OA 4DR5Q 4IJLA 4LF8L 1YHQA 1CSPA 1S3OA 1VQMA 2EIFA 4NPSA 4GOPB 1E7ZA 1VQPA 1Q7YC 5IT9c 4POGA 2WFWA 2UU9L 2ALYB 1OXUA 2OQKA 1E22A 3NEMA 3KF6A 3WWVA 3G6EA 5M3FH 4A3JH 1PH9A 1CKMA 1IBMQ 1PA6A 4YCUA 3RZDH 1YI2A 1LUZA 1I94Q 3A0JA 4GKKQ 5M5XH 1PFSA 2GVAA 2JA5H 4L5TA 1IBLL 4JYAQ 4X62L 2Q2IA 4B3ML 2NVYH 1H95A 4C2MH 4DV0Q 3TRZA 2MO0A 3CAMA 4GNXA 4LF7L 4BBSG 3MXNB 3F2BA 2VW9A 2L15A 4NXMQ 4DV4Q 2ZM6Q 4QJFA 5IP9G 4AIMA 3JAMi 2AKWB 2VZAA 4L5SA 4LFCQ 2JA9A 1QVFA 2ZJPA 4LF5Q 1D8LA 3CCMA 1X3FA 1J5EQ 4DAMA 3LGJA 1EIFA 4LUOA 4DV2L 1YHBA 1YIJA 3OTOQ 1S72A 3I4MG 4H02A 1HNXQ 4A3EH 3IRBA 3OYYA 3T1HL 1IL2A 5GQOA 4K0KL 3PUYA 2RF4A 2Z6KC 1XJVA 4DV7L 1HR0W 2KCTA 5LMNW 2HHHL 1HH2P 2Q2UA 4DV3Q 4A3GH 1QUQA 4LF4L 1PV4A 2AMCB 4JI4Q 4BXXH 4IPGA 5ELOA 4BA1I 1Y1WG 2MO1A 4OX9Q 4A3DH 3RZOH 1EFWA 4DV1Q 5C4JH 1X65A 1JJCB 1TXYA 4A93G 5GAHC 3UDIA 1VS0A 3I55A 5C44H 4DR3Q 4LF8Q 1FJGQ 2R7ZG 3CW2C 1AE2A 2FXQA 4JBJA 1UE1A 1L1OC 2JK8A 4JI0L 2B63G 4R4IA 4HIKA 1A8VA 1N32Q 3AFPA 3U50C 3M4OH 1P8LA 4IO9A 4IOCA 4A3CH 2F4VQ 1VQDA 3RN5A 1KRTA 4A3IH 4GLAC 4GOPA 2JA7G 3SGIA 1LYLA 5GAGC 1QZGA 1IBKL 3S14H 1IBLQ 4X62Q 4BY1H 4MZ9A 4JOIA 1N36L 1K8AC 4B3MQ 2VUMG 1PYBA 4GLXA 2ZTDA 3HOZG 1VQNA 1B7YB 5M3MH 1K0RA 2XGTA 3KFUA 2YU9H 1KD1C 3ULJA 3I4NG 2GVBA 2WP8J 2QEXA 1L2FA 2PMZE 3CD6A 1BKBA 3M85A 4JI2L 1WOCA 4POFA 5JJLA 5FLXc 1E1TA 2HIVA 4A3BH 1NBWA 3GTJH 1X3EA 4DV2Q 4IFDG 1KC8C 1W3SA 4GNXC 1VQOA 4BY7H 3W1BA 3T1HQ 2UXCL 3UDXA 1YJWA 3TS2A 1N9WA 3D0FA 3NELA 2BA0A 4DV7Q 2HHHQ 3UE0A 1YVCA 1C7YA 5IP7H 3EN2A 2E2IH 3STBC 3GDEA 4EQ5A 3CCSA 1VQBA 3OW2A 2UUAL 5M5YH 1SN8A 2WAQG 1VQIA 3B6YA 4KLKA 3S1NH 1S40A 5IYDG 3CXCA 2V1CC 1Q46A 3GTOH 2NVXH 3AQQA 3H0GG 2CFMA 4KI0A 4MTNA 4YCWA 3J81j 4C3JH 1HNWQ 1PH8A 4BBRG 3A5ZB 1ASZA 3KJOA 1K8GA 4LNQA 1JMCA 4JI0Q 4B3RL 1NE3A 1EUJA 5JJKA 1RL2A 3HOYG 1C0AA 1UEBA 4K0KQ 2XTIA 4IJHA 1N33L 1V43A 2EQSA 3AFQA 3FHWA 3RLNA 3J7ZC 3TQYA 4OWWB 2YTXA 3KYHC 1IBKQ 3PO2H 2A1AA 2VQEL 2I5MX 1JJGA 3PV0A 1VQHA 3HOVG 1N36Q 2IX0A 2AWNA 2KCMA 4DV6L 5IP9H 1EOVA 3K81C 4JG2A 3FKIG 2UUBL 3CMAA 4O0AA 1XNQL 3ICEA 1PYSB 2KHJA 5IWAL 3VDYA 3DM3A 1B8AA 4J15A 5HY6A 3HKSA 4OWXB 1N8RC 4QIWE 4GOPC 4JI6L 4AH6A 1VQGA 1WCMH 3CC4A 3I4MH 2VY3A 4JI2Q 3GTGH 1Q1EA 4HJ7A 2YV5A 3RLFA 1Y14B 4JOIC 4IFDJ 5K36G 4JCVE 3J80i 4DR2L 2AWOA 5C3EG 3CCVA 3I56A 1VQEA 2JEBI 3F2CA 1VQFA 1VQJA 1PH5A 1C9OA 1A62A 1KHIA 4XIGS 1LTLA 2JA6G 3NENA 1QVGA 1BBUA 4A3KG 2I5LX 4A3FG 1Y1VG 3M9BA 1Y1WH 2LSSA 4GN3B 4B3SL 3UE1A 3H3VH 1B70B 3HOWG 2OTJA 3Q8DA 3PIPA 4LFAL 1HR0L 2GN5A 5LMNL 1UE6A 4OO1I 2UUAQ 3S16H 4AQYL 3W5OA 3S1MH 3STBD 1SMXA 1CKNA 2BH8A 2NZHA 3F2DA 1TWGH 3DLLA 2MQHA 3BU2A 5JEAG 3KDFA 2VQFL 1VQ4A 2C35B 4BA2I 1PH7A 3PUXA 4YY3L 3TS0A 2R93H 4YWMA 4B3RQ 1YITA 2NVTH 3M7NA 2A8VA 4P73A 1PH6A 4OWTB 3J7A5 2R92H 4GS3A 1N33Q 1Q86C 1WI5A 4UP8A 5LMUL 4IPCA 2NN6I 1OXVA 2KBNA 1O7IA 4JBWA 4R4TA 3PIOA 3H15A 3PF5A 1K73C 2BA1A 2VUMH 4KHPQ 2ZJRA 4DPGA 2VQEQ 3HOZH 1HZAA 4UPAA 4DR6L 4LFBL 4QL5A 3U4VA 3TREA 1SR3A 3ER0A 4DV6Q 2WB1G 3F8TA 3I4NH 5M5WH 3CPWA 2UUBQ 5FJ8H 3EIVA 5IYBH 1EQQA 2CWPA 2B29A 5IWAQ 1VQ7A 1OXTA 2N78A 4DUYQ 3S1RH 4JI6Q 1K83H 3CCEA 3S1QH 3S2HH 3E9HA 4NXNL 2IY5B 4JBMA 3L2PA 3ULPA 1WJJA 4LUVA 2UU9Q 1XPUA 2UXBL 1LM0A 2WAQE 4QQBX 5M3FG 4A3JG 3NBHB 2HQLA 4A3MH 4HJ5A 1IZ6A 2BH2A 4WJ4A 4B3SQ 4AYBG 2JA5G 1UWVA 1X54A 3E0EA 1MKHA 1HR0Q 5LMNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD7 A;  3U4Z A;  1MIU A;  2K5H A;  1KRS A;  4LF7 Q;  3E9I A;  1E3P A;  4TVA B;  1IYJ B;  4X6A H;  4AQY Q;  1I50 H;  4YHH L;  1OTC A;  3HOX H;  2Z0S A;  5JEA J;  2I0Q A;  2ID0 A;  3CQZ H;  3HOU H;  1VQA A;  4IPD A;  3HOY H;  4YY3 Q;  3M4P A;  1KXL A;  4JV5 L;  3G48 A;  1FL0 A;  1CKO A;  4P72 A;  4X66 L;  1NJI C;  2DGY A;  4R4O A;  1MJE A;  3FP9 A;  3ERS X;  3J81 i;  4DR1 L;  3S24 A;  5ELN A;  1NMF A;  1WFQ A;  5LMU Q;  1JT8 A;  4OON A;  1IXR A;  4ME3 A;  4NB3 A;  1GVP A;  3KF8 B;  1I6H H;  1X56 A;  4DR6 Q;  2AHO B;  4LFB Q;  1KIX A;  4PZ7 A;  1E1O A;  1R9T H;  2IT1 A;  4LF4 Q;  2K5V A;  2LXJ A;  4MNO A;  4A3L H;  1NY4 A;  4DR7 L;  2JA8 G;  4A3D G;  2RCN A;  2R7D A;  3KF6 B;  4DR5 L;  1T9H A;  2IHE A;  1PHJ A;  1EWI A;  4OXP A;  4UP7 A;  5C3E H;  3CC2 A;  4B3T L;  1FGU A;  1UE5 A;  1M90 C;  1QZH A;  1I5F A;  2K50 A;  3A5U A;  1DGS A;  3HKZ G;  1Q12 A;  1JJ2 A;  2A19 A;  2K5N A;  1IBM L;  2ZTE A;  4A3K H;  1G51 A;  4A3F H;  1Y1V H;  2UXB Q;  5JJI A;  3F1Z A;  2JJQ A;  3HOW H;  2MNA A;  5C0X I;  2RHS B;  3CME A;  4DV5 L;  4A3I G;  5IE8 A;  4X64 L;  1NMG A;  1U5K A;  1VQ9 A;  2CKZ B;  1YBY A;  1CUK A;  2H5X A;  4R4Q A;  4BBS H;  4DV0 L;  2E2J H;  3GTK H;  2ES2 A;  1YNX A;  3BJU A;  3EBE A;  2B3G A;  3J80 c;  4R1J A;  2PI2 A;  3K7A H;  4ALP A;  2ZM6 L;  1TWC H;  4NXM L;  2JEA I;  2DUD A;  4LF9 L;  4OO1 G;  4YHH Q;  4LF6 L;  1ASY A;  5C4X G;  1WYD A;  2QGQ A;  5IYC G;  1A63 A;  1HZC A;  5E7N A;  2R6G A;  4JC0 A;  3ZJY C;  2OCE A;  4PZ6 A;  2KEN A;  1SLJ A;  3PUV A;  1Z47 A;  4JV5 Q;  1PVO A;  1HNX L;  1TWA H;  4YCV A;  4JI5 L;  2Y0S G;  3PCO B;  3M3Y H;  2WB1 E;  4R4C A;  4DR1 Q;  4A3B G;  3T1Y L;  1W2B A;  2K52 A;  3K8A A;  4JI1 L;  4Y7N H;  4BY7 G;  1VQL A;  1CSQ A;  3JAM c;  3CCQ A;  2NN6 G;  3CPF A;  4HID A;  2CWA A;  3KLW A;  4JI4 L;  3CCL A;  2D0O A;  4A93 H;  3CCR A;  1K3R A;  1Q8K A;  1YHA A;  1A0I A;  2R7Z H;  2E8G A;  4GN5 A;  1SRO A;  1N34 L;  1FJG L;  1VQ6 A;  5BR8 L;  2Q2T A;  2VNU D;  2PI2 E;  2B63 H;  4A75 A;  4X65 L;  4UY8 C;  4B3T Q;  1VQ8 A;  2NVQ H;  4PG3 A;  1VQ5 A;  2OTL A;  4AYB E;  1N32 L;  2Q2H A;  2F4V L;  2JA7 H;  3CP0 A;  4XTC S;  1EIY B;  3K0X A;  4DV5 Q;  5FLM G;  3S15 H;  4X64 Q;  2PNH A;  3GD7 A;  1M1K C;  2CQO A;  4JI3 L;  3PO2 G;  4A76 A;  1XTD A;  4QY7 A;  2IX1 A;  2UXC Q;  4WJ3 M;  3L7Z C;  1P16 A;  2PQA B;  1GKH A;  2I5H A;  2HIX A;  2N3S A;  4LF9 Q;  1SRU A;  3W1G A;  4QGU A;  1XNQ Q;  2YYZ A;  4GKJ L;  4LF6 Q;  3UDF A;  1RIP A;  4PMW A;  1X6O A;  3BZK A;  2K14 A;  2RHQ B;  3JC6 6;  3CCJ A;  2EXD A;  2IHF A;  4DNI A;  2ZJQ A;  3BZC A;  1WCM G;  1XMO L;  4L5R C;  4HJ8 A;  1KAW A;  1I3Q H;  1HZ9 A;  3GO5 A;  3CF5 A;  1VQK A;  1JB7 A;  4JI5 Q;  4DR2 Q;  3G4S A;  3T1Y Q;  5DLQ E;  1SFO H;  2UXD L;  1MJC A;  3S17 H;  1L0W A;  4JI1 Q;  4DAY B;  3PO3 H;  4LW1 A;  3A74 A;  2N8N A;  2E5L L;  4Y52 H;  2JA8 H;  1Q1B A;  5AJ3 L;  1X55 A;  1U0L A;  4LFA Q;  1V9P A;  1K9M C;  1GO3 E;  3J81 c;  1PH3 A;  4JI7 L;  2OQ0 A;  3HKZ E;  4DUZ L;  3H0G H;  3I2Z A;  1D7Q A;  1N34 Q;  5GAD C;  1GM5 A;  5BR8 Q;  4BBR H;  1XNR L;  1HNW L;  4P71 A;  3GTM H;  1X9N A;  1EQR A;  3M4Q A;  4X65 Q;  2VS1 A;  2VQF Q;  3KOJ A;  1PH4 A;  3I7F A;  3TEH B;  1L1O B;  1E24 A;  4O2D A;  5GAE C;  4DR4 L;  3RN2 A;  2UUC L;  1UE7 A;  3RR5 A;  2R92 G;  2LXK A;  1KL9 A;  2YTY A;  4P74 A;  5H1S E;  3CC7 A;  4HJA A;  3PSI A;  3HOV H;  4A3E G;  5HGQ A;  3PO3 G;  4LUZ A;  5C0X G;  1AH9 A;  4RMF A;  1EYG A;  3H3V I;  4JI8 L;  2K4K A;  3FKI H;  4JI3 Q;  1HJP A;  2JE6 I;  4A3G G;  1G6P A;  2R7F A;  3I4O A;  4A4I A;  1HNZ L;  2ATW A;  2CCZ A;  1J6Q A;  5C4X H;  1XMQ L;  5IYC H;  2Y0S E;  3RNU A;  4GKJ Q;  4BXX G;  3PGZ A;  2NZO A;  1VQC A;  1Q81 C;  5FJ8 G;  2QA4 A;  5IYB G;  4EX5 A;  4LWC A;  4YWL A;  2MFI A;  4L5Q A;  4YWK A;  4DK3 C;  2D0P A;  2PQA A;  2JQO A;  3S2D H;  3D31 A;  1SE8 A;  5C44 G;  1TWH H;  1XMO Q;  3PF4 A;  4NXN Q;  3MEF A;  3RLO A;  4HIO A;  4RG1 A;  2JA6 H;  2N49 A;  3K80 C;  1Q82 C;  1JE5 A;  4FDB A;  2K75 A;  1AE3 A;  4KHZ A;  1I94 L;  2HT1 A;  4GNX B;  3K7U C;  2UXD Q;  1YEZ A;  4GKK L;  3AEV A;  4A3C G;  3ULL A;  4JYA L;  4HJ9 A;  1BVS A;  2E5L Q;  4A3M G;  1CKN B;  1QVC A;  4APV A;  3UDG A;  5AJ3 Q;  4IPH A;  1YJN A;  2ZTC A;  3KDF B;  4BY1 G;  4JI7 Q;  2F52 A;  4JBK A;  3U58 A;  2R93 G;  4TQU S;  2F3I A;  4DUZ Q;  1NTG A;  2YTV A;  2Z6K A;  4GN4 B;  1YZ6 A;  3KJP A;  4DV4 L;  2OWO A;  4IOA A;  1BBW A;  1HZB A;  1VCI A;  4UP9 A;  1V1Q A;  2D62 A;  5M3M G;  1XNR Q;  3GTP H;  4LFC L;  1XPR A;  3AYH B;  4LF5 L;  3HOX G;  4C3I H;  3HOU G;  4C3H H;  1J5E L;  4P75 A;  5IY0 A;  4IFD I;  3PUW A;  5GRO A;  1PH2 A;  2E2H H;  3OTO L;  4X66 Q;  1QUQ B;  4PZ8 A;  5FLM H;  4DR4 Q;  2UUC Q;  1YJ9 A;  3GTL H;  4KHP L;  1KQS A;  1Z9F A;  4DK6 C;  1TWF H;  2VL6 A;  3G71 A;  5C0X J;  4DV3 L;  1X3G A;  3PUZ A;  4HIM A;  1L1O A;  1G29 1;  2KHI A;  4JI8 Q;  5IP7 G;  1HNZ Q;  5J3B A;  4OX9 L;  1OXX K;  3HFZ B;  1PH1 A;  2ASB A;  4DV1 L;  1XMQ Q;  4DR7 Q;  1XPO A;  4A3L G;  4GLV B;  3GTQ H;  5EAY A;  5IYD H;  4DKA C;  1FVI A;  1OXS C;  4DR3 L;  4DUY L;  3CCU A;  3L0O A;  4DR5 Q;  4IJL A;  4LF8 L;  1YHQ A;  1CSP A;  1S3O A;  1VQM A;  2EIF A;  4NPS A;  4GOP B;  1E7Z A;  1VQP A;  1Q7Y C;  5IT9 c;  4POG A;  2WFW A;  2UU9 L;  2ALY B;  1OXU A;  2OQK A;  1E22 A;  3NEM A;  3KF6 A;  3WWV A;  3G6E A;  5M3F H;  4A3J H;  1PH9 A;  1CKM A;  1IBM Q;  1PA6 A;  4YCU A;  3RZD H;  1YI2 A;  1LUZ A;  1I94 Q;  3A0J A;  4GKK Q;  5M5X H;  1PFS A;  2GVA A;  2JA5 H;  4L5T A;  1IBL L;  4JYA Q;  4X62 L;  2Q2I A;  4B3M L;  2NVY H;  1H95 A;  4C2M H;  4DV0 Q;  3TRZ A;  2MO0 A;  3CAM A;  4GNX A;  4LF7 L;  4BBS G;  3MXN B;  3F2B A;  2VW9 A;  2L15 A;  4NXM Q;  4DV4 Q;  2ZM6 Q;  4QJF A;  5IP9 G;  4AIM A;  3JAM i;  2AKW B;  2VZA A;  4L5S A;  4LFC Q;  2JA9 A;  1QVF A;  2ZJP A;  4LF5 Q;  1D8L A;  3CCM A;  1X3F A;  1J5E Q;  4DAM A;  3LGJ A;  1EIF A;  4LUO A;  4DV2 L;  1YHB A;  1YIJ A;  3OTO Q;  1S72 A;  3I4M G;  4H02 A;  1HNX Q;  4A3E H;  3IRB A;  3OYY A;  3T1H L;  1IL2 A;  5GQO A;  4K0K L;  3PUY A;  2RF4 A;  2Z6K C;  1XJV A;  4DV7 L;  1HR0 W;  2KCT A;  5LMN W;  2HHH L;  1HH2 P;  2Q2U A;  4DV3 Q;  4A3G H;  1QUQ A;  4LF4 L;  1PV4 A;  2AMC B;  4JI4 Q;  4BXX H;  4IPG A;  5ELO A;  4BA1 I;  1Y1W G;  2MO1 A;  4OX9 Q;  4A3D H;  3RZO H;  1EFW A;  4DV1 Q;  5C4J H;  1X65 A;  1JJC B;  1TXY A;  4A93 G;  5GAH C;  3UDI A;  1VS0 A;  3I55 A;  5C44 H;  4DR3 Q;  4LF8 Q;  1FJG Q;  2R7Z G;  3CW2 C;  1AE2 A;  2FXQ A;  4JBJ A;  1UE1 A;  1L1O C;  2JK8 A;  4JI0 L;  2B63 G;  4R4I A;  4HIK A;  1A8V A;  1N32 Q;  3AFP A;  3U50 C;  3M4O H;  1P8L A;  4IO9 A;  4IOC A;  4A3C H;  2F4V Q;  1VQD A;  3RN5 A;  1KRT A;  4A3I H;  4GLA C;  4GOP A;  2JA7 G;  3SGI A;  1LYL A;  5GAG C;  1QZG A;  1IBK L;  3S14 H;  1IBL Q;  4X62 Q;  4BY1 H;  4MZ9 A;  4JOI A;  1N36 L;  1K8A C;  4B3M Q;  2VUM G;  1PYB A;  4GLX A;  2ZTD A;  3HOZ G;  1VQN A;  1B7Y B;  5M3M H;  1K0R A;  2XGT A;  3KFU A;  2YU9 H;  1KD1 C;  3ULJ A;  3I4N G;  2GVB A;  2WP8 J;  2QEX A;  1L2F A;  2PMZ E;  3CD6 A;  1BKB A;  3M85 A;  4JI2 L;  1WOC A;  4POF A;  5JJL A;  5FLX c;  1E1T A;  2HIV A;  4A3B H;  1NBW A;  3GTJ H;  1X3E A;  4DV2 Q;  4IFD G;  1KC8 C;  1W3S A;  4GNX C;  1VQO A;  4BY7 H;  3W1B A;  3T1H Q;  2UXC L;  3UDX A;  1YJW A;  3TS2 A;  1N9W A;  3D0F A;  3NEL A;  2BA0 A;  4DV7 Q;  2HHH Q;  3UE0 A;  1YVC A;  1C7Y A;  5IP7 H;  3EN2 A;  2E2I H;  3STB C;  3GDE A;  4EQ5 A;  3CCS A;  1VQB A;  3OW2 A;  2UUA L;  5M5Y H;  1SN8 A;  2WAQ G;  1VQI A;  3B6Y A;  4KLK A;  3S1N H;  1S40 A;  5IYD G;  3CXC A;  2V1C C;  1Q46 A;  3GTO H;  2NVX H;  3AQQ A;  3H0G G;  2CFM A;  4KI0 A;  4MTN A;  4YCW A;  3J81 j;  4C3J H;  1HNW Q;  1PH8 A;  4BBR G;  3A5Z B;  1ASZ A;  3KJO A;  1K8G A;  4LNQ A;  1JMC A;  4JI0 Q;  4B3R L;  1NE3 A;  1EUJ A;  5JJK A;  1RL2 A;  3HOY G;  1C0A A;  1UEB A;  4K0K Q;  2XTI A;  4IJH A;  1N33 L;  1V43 A;  2EQS A;  3AFQ A;  3FHW A;  3RLN A;  3J7Z C;  3TQY A;  4OWW B;  2YTX A;  3KYH C;  1IBK Q;  3PO2 H;  2A1A A;  2VQE L;  2I5M X;  1JJG A;  3PV0 A;  1VQH A;  3HOV G;  1N36 Q;  2IX0 A;  2AWN A;  2KCM A;  4DV6 L;  5IP9 H;  1EOV A;  3K81 C;  4JG2 A;  3FKI G;  2UUB L;  3CMA A;  4O0A A;  1XNQ L;  3ICE A;  1PYS B;  2KHJ A;  5IWA L;  3VDY A;  3DM3 A;  1B8A A;  4J15 A;  5HY6 A;  3HKS A;  4OWX B;  1N8R C;  4QIW E;  4GOP C;  4JI6 L;  4AH6 A;  1VQG A;  1WCM H;  3CC4 A;  3I4M H;  2VY3 A;  4JI2 Q;  3GTG H;  1Q1E A;  4HJ7 A;  2YV5 A;  3RLF A;  1Y14 B;  4JOI C;  4IFD J;  5K36 G;  4JCV E;  3J80 i;  4DR2 L;  2AWO A;  5C3E G;  3CCV A;  3I56 A;  1VQE A;  2JEB I;  3F2C A;  1VQF A;  1VQJ A;  1PH5 A;  1C9O A;  1A62 A;  1KHI A;  4XIG S;  1LTL A;  2JA6 G;  3NEN A;  1QVG A;  1BBU A;  4A3K G;  2I5L X;  4A3F G;  1Y1V G;  3M9B A;  1Y1W H;  2LSS A;  4GN3 B;  4B3S L;  3UE1 A;  3H3V H;  1B70 B;  3HOW G;  2OTJ A;  3Q8D A;  3PIP A;  4LFA L;  1HR0 L;  2GN5 A;  5LMN L;  1UE6 A;  4OO1 I;  2UUA Q;  3S16 H;  4AQY L;  3W5O A;  3S1M H;  3STB D;  1SMX A;  1CKN A;  2BH8 A;  2NZH A;  3F2D A;  1TWG H;  3DLL A;  2MQH A;  3BU2 A;  5JEA G;  3KDF A;  2VQF L;  1VQ4 A;  2C35 B;  4BA2 I;  1PH7 A;  3PUX A;  4YY3 L;  3TS0 A;  2R93 H;  4YWM A;  4B3R Q;  1YIT A;  2NVT H;  3M7N A;  2A8V A;  4P73 A;  1PH6 A;  4OWT B;  3J7A 5;  2R92 H;  4GS3 A;  1N33 Q;  1Q86 C;  1WI5 A;  4UP8 A;  5LMU L;  4IPC A;  2NN6 I;  1OXV A;  2KBN A;  1O7I A;  4JBW A;  4R4T A;  3PIO A;  3H15 A;  3PF5 A;  1K73 C;  2BA1 A;  2VUM H;  4KHP Q;  2ZJR A;  4DPG A;  2VQE Q;  3HOZ H;  1HZA A;  4UPA A;  4DR6 L;  4LFB L;  4QL5 A;  3U4V A;  3TRE A;  1SR3 A;  3ER0 A;  4DV6 Q;  2WB1 G;  3F8T A;  3I4N H;  5M5W H;  3CPW A;  2UUB Q;  5FJ8 H;  3EIV A;  5IYB H;  1EQQ A;  2CWP A;  2B29 A;  5IWA Q;  1VQ7 A;  1OXT A;  2N78 A;  4DUY Q;  3S1R H;  4JI6 Q;  1K83 H;  3CCE A;  3S1Q H;  3S2H H;  3E9H A;  4NXN L;  2IY5 B;  4JBM A;  3L2P A;  3ULP A;  1WJJ A;  4LUV A;  2UU9 Q;  1XPU A;  2UXB L;  1LM0 A;  2WAQ E;  4QQB X;  5M3F G;  4A3J G;  3NBH B;  2HQL A;  4A3M H;  4HJ5 A;  1IZ6 A;  2BH2 A;  4WJ4 A;  4B3S Q;  4AYB G;  2JA5 G;  1UWV A;  1X54 A;  3E0E A;  1MKH A;  1HR0 Q;  5LMN Q; 
#chains in the Genus database with same CATH topology
 3QO2 A;  5EKK A;  3ERQ A;  4TVA B;  1I50 H;  4JPB W;  4YHH L;  3E5S A;  2Z0S A;  1AFP A;  2ID0 A;  1STE A;  1BQQ T;  4IPD A;  1PFM A;  3VR2 A;  2EDG A;  1KXL A;  3G48 A;  2B2T A;  2DGY A;  5EJW A;  3ND8 A;  1MJE A;  2O5J C;  2KED A;  4MTK A;  2CHB D;  4ME3 A;  3IKJ A;  1X56 A;  1EY6 A;  2I46 A;  4PZ7 A;  1PFB A;  4LF4 Q;  3P75 A;  1NY4 A;  4ZRZ A;  4A3L H;  4HMI A;  5DM7 3;  3KF6 B;  4M1U B;  1T9H A;  1EWI A;  4OXP A;  3HS0 C;  3CC2 A;  1M90 C;  1QZH A;  1DGS A;  1JOK A;  1IBM L;  2RSO A;  2WIN B;  2UXB Q;  2JJQ A;  5C0X I;  3CME A;  4A3I B;  3MFY A;  2H5X A;  4R4Q A;  4BBS H;  4RAU C;  3WOE A;  5KEE A;  3S14 B;  5ELB A;  2QDB A;  3EBE A;  1MSG A;  1TWC H;  1WD1 A;  4OHJ A;  4DXF A;  4IUV A;  4LF9 L;  1WYD A;  3KBG A;  3C46 A;  1HZC A;  4NW2 A;  1K3B C;  2KEN A;  1Z47 A;  2MP1 A;  1HNX L;  2EY2 A;  2HDL A;  4RGO S;  2Y0S B;  1S4Z A;  5CV6 A;  3T1Y L;  1W2B A;  4V0B A;  1PTO B;  5F2D A;  2K52 A;  1ZEQ X;  4BY7 G;  2K04 A;  1WTP A;  3R2T A;  2CWA A;  1QWY A;  5CYU A;  4KTA A;  2EY5 A;  4IQZ A;  4MIU A;  3CCR A;  2G9H D;  1YHA A;  2B2T C;  2XN9 C;  1SRO A;  5M5Y B;  3VYT A;  4B3T Q;  1SDF A;  4ID6 A;  1Q90 A;  1SAP A;  4NKL A;  1CTM A;  4C3I G;  4XTC S;  1SE4 A;  3OHX C;  3MC0 B;  1EIY B;  2F0H A;  3S15 H;  1D1K A;  1HR0 Q;  5DM6 3;  4BS9 A;  4A76 A;  1XTD A;  4QY7 A;  2IX1 A;  1HXY D;  4ZLT F;  1GKH A;  4OGQ C;  1TII D;  1SRU A;  2YYZ A;  4H13 C;  2L55 A;  5IGD A;  1O78 A;  4PMW A;  1X6O A;  2K14 A;  3GTQ B;  5G3L D;  5NUC A;  1D5M C;  3ND9 A;  1I3Q H;  1F2L A;  3G4S A;  5KIX A;  3S17 H;  1L0W A;  4JI1 Q;  4LW1 A;  1LAB A;  4XT3 B;  1EEF D;  3T13 A;  1EU3 A;  4Y52 H;  1PTO F;  1EL0 A;  2JA8 H;  5M5X B;  5FO7 B;  3MXG A;  3HKZ E;  2NVY B;  4C2M B;  1N34 Q;  5BR8 Q;  4BBR H;  4I7A A;  4P71 A;  1EQR A;  3I7F A;  4F7X A;  3NP8 A;  2OEO A;  2KVM A;  1E24 A;  1A15 A;  4IUQ A;  5I6W A;  3OWE B;  5C3W A;  2A6H C;  2R92 G;  2NUC A;  3PSI A;  1F9S A;  4DXG A;  4RMF A;  1EYG A;  1EQT A;  1HJP A;  3FDT A;  5IGF A;  4A3G B;  3I4O A;  2F0G A;  4L63 B;  3TP8 A;  2ATW A;  3X3N A;  4FP5 D;  5C4X H;  3ONA B;  5IYC H;  3RNU A;  4C1N K;  3PGZ A;  5C6A A;  1IYU A;  2WKC A;  2QA4 A;  3ERO A;  4DK3 C;  2BE5 D;  1U9R A;  2D0P A;  1SE8 A;  4ABN A;  1SYG A;  3S1R B;  2QDL A;  2F0O A;  1AE3 A;  2HT1 A;  1QNK A;  1M8A A;  4JYA L;  1BVS A;  2F0T A;  5COR A;  1L0X B;  4IPH A;  3KLS X;  2F52 A;  4FVM A;  4JVZ A;  4TQU S;  4DUZ Q;  1NTG A;  4IOA A;  1YZ6 A;  5CBA E;  1HZB A;  1XNR Q;  2E75 C;  3GTP H;  2A6E D;  5LL6 X;  1XPR A;  3AYH B;  3SR1 A;  1NCV A;  4LF5 L;  2YU9 B;  3TN2 A;  5GRO A;  2EYO A;  3OTO L;  4DR4 Q;  2BDN A;  3Q0A A;  3GTL H;  3A7A B;  2VL6 A;  5C0X J;  4DV3 L;  3PUZ A;  4FXD A;  4BY7 B;  3WDN A;  1V8Q A;  4X3T A;  2Q8R E;  5J3B A;  1HNZ Q;  3HFZ B;  2ASB A;  1PH1 A;  1SXT A;  4BWG B;  1XMQ Q;  1R9T B;  4A3L G;  4DKA C;  4DUY L;  3EJI A;  1KTK A;  4NPS A;  4NMZ A;  1VQP A;  1Q7Y C;  3PQI A;  5IT9 c;  4POG A;  2WFW A;  3GTO B;  2VB3 X;  3G6E A;  2FMM A;  3KF6 A;  5M3F H;  1PH9 A;  1CKM A;  1YI2 A;  1KDB A;  3A0J A;  4GKK Q;  5KND A;  4L5T A;  2Q2I A;  1SJH D;  3TRZ A;  5TSS A;  4BBS G;  1LT3 D;  2VW9 A;  2L15 A;  2F0K A;  1ENC A;  1QVF A;  1D8L A;  1X3F A;  4RKB A;  1EIF A;  4LUO A;  4DV2 L;  1YIJ A;  1PXU A;  2EYP A;  4A3E H;  3IRB A;  1V1P B;  3T1H L;  2D2C C;  5JPM C;  4DV7 L;  2HQE A;  2KCT A;  2IL8 A;  5A35 A;  1PTO D;  2KCN A;  3T16 A;  4LF4 L;  4JI4 Q;  4BA1 I;  1C48 A;  1SSO A;  4NDX A;  4DV1 Q;  1X65 A;  1JJC B;  5GAH C;  3I55 A;  5C44 H;  2E2D C;  3CW2 C;  1AE2 A;  2BCO A;  4JBJ A;  1UE1 A;  2JK8 A;  2VB2 X;  1DON A;  1M4V A;  4DU9 A;  2Z8L A;  4ZCK A;  3J7Y W;  3M4O H;  1CHQ D;  4A3I H;  5IOD A;  1X3Q A;  5I2Y A;  4GOP A;  5GAG C;  1F2Y A;  3S14 H;  4X62 Q;  4ME5 A;  4B3M Q;  4DGZ A;  2EXZ A;  2VUM B;  1DXM A;  3HOZ G;  1LO5 D;  1HHV A;  4HR7 B;  4ZUI A;  2QEX A;  2L11 A;  3FEW X;  4O1N A;  4KD3 A;  3M85 A;  3MXN A;  2B2V A;  4S3S A;  3MVV A;  1KLG D;  2HIV A;  3KK7 A;  3SHL A;  3DWA A;  2F0S A;  1VQO A;  4RCN A;  1EY7 A;  3CU7 A;  5C5M A;  2ZXR A;  3DM1 A;  1C7Y A;  5IP7 H;  2I07 B;  4EQ5 A;  1VQB A;  3SEB A;  4QB4 A;  1TY0 A;  5M5Y H;  1SN8 A;  3B6Y A;  1SYE A;  4FYD A;  3AQQ A;  3H0G B;  4C3J H;  3J7A F;  4BBR G;  1I50 B;  1JMC A;  2K28 A;  1I4X A;  2TSS A;  5L37 A;  2XTI A;  4DF7 A;  2FIN B;  1V43 A;  5IGC A;  3J7Z C;  3TQY A;  4OWW B;  4G57 A;  2DJF C;  1HCZ A;  2L0C A;  4ZQ3 A;  3IFT A;  1N36 Q;  3HOV B;  2AWN A;  4DV6 L;  5IP9 H;  1EOV A;  3IFD A;  3FKI B;  4O0A A;  5J39 A;  4Z9C B;  1GUT A;  2EJM A;  4J15 A;  5HY6 A;  3HKS A;  4OWX B;  4GOP C;  4JI6 L;  5CV5 A;  1VQG A;  3CC4 A;  3I4M H;  2VY3 A;  2PZW A;  1Q1E A;  3RLF A;  1SND A;  1QE6 A;  5CV7 A;  3K5O A;  1NAP A;  2ENB A;  1KHI A;  1A62 A;  1S5C D;  4MHE A;  3NEN A;  4A3K G;  1LT6 D;  1Y1V G;  1Y1W H;  2FJ2 A;  2F0V A;  4GN3 B;  4B3S L;  3HOW G;  2B2V C;  1R4Q B;  1GHJ A;  1AZP A;  3S1M H;  1GUW A;  3F2D A;  2X69 A;  3DLL A;  3D4D A;  2HCC A;  3D4W A;  1TWC B;  2B8F A;  3BU2 A;  3K6O A;  1JCK B;  4G7H C;  1VQ4 A;  4BA2 I;  1JOR A;  3SK6 A;  5T1G A;  1YIT A;  3EA6 A;  1JOQ A;  1PH6 A;  1JWU D;  4C3H B;  1EYC A;  1HQM C;  5LMU L;  4RHS A;  1KQS A;  2KBN A;  1O7I A;  5IIF A;  1K73 C;  4R9W A;  1B44 D;  1HZA A;  5BN3 A;  4DK1 A;  3OIQ A;  1RHP A;  2C5C A;  4K6L A;  1EYA A;  4ILW A;  3F8T A;  1SNQ A;  3I4N H;  4K5X A;  4K8J A;  5IYB H;  1T5X D;  5IWA Q;  4N8X 1;  1VQ7 A;  1HPC A;  2N78 A;  2LKV A;  3OW7 A;  3S1R H;  1DOK A;  3CCE A;  1AN8 A;  3S1Q H;  1RDP D;  1WTR A;  3NQT A;  3E9H A;  3U9S A;  2K05 A;  3DUZ A;  4JBM A;  3L2P A;  3ULP A;  4LUV A;  2UU9 Q;  4OEL B;  1L0Y B;  1LM0 A;  1QB5 D;  5M3F G;  3NBH B;  4A3J B;  1STH A;  1UWV A;  2JA5 B;  1MKH A;  5IYD H;  1SYC A;  5LMN Q;  2R93 H;  1GD7 A;  1CK1 A;  2K5H A;  4DA2 A;  4LF7 Q;  3E9I A;  1IYJ B;  2NBF A;  1EIG A;  1F9P A;  1O7Z A;  3HOY H;  4JV5 L;  4P72 A;  4H0L C;  2ICE C;  3ERS X;  5LHY 1;  4UHV A;  4N9T A;  2MHV A;  2EYH A;  1KIX A;  3S17 B;  1CM9 A;  1E1O A;  1UEA B;  3BVZ A;  1R9T H;  3UI2 A;  3OSO A;  1V1P A;  5DEH A;  2Z6B A;  2JA8 B;  4A3D B;  2RCN A;  2IHE A;  1CI3 M;  1GUN A;  4TRD A;  5C3E H;  4CJ2 C;  1XX8 A;  1LTA D;  1I5F A;  1STN A;  3A5U A;  2A19 A;  3HKZ B;  4XQN A;  3SK8 A;  1FGB D;  5DNF A;  4DV5 L;  4A3I G;  1NMG A;  4K2L A;  3CHB D;  4IAL A;  2E2J H;  2M2L A;  2ES2 A;  3TBI B;  4B9X A;  1CZG A;  2B39 A;  3E3X A;  3R3O A;  2DUD A;  1VMC A;  3K5N A;  5ELD A;  3Q24 A;  4HN7 A;  4LF6 L;  1X3P A;  2QGQ A;  5C4X B;  2L5T A;  4K8I A;  3ZJY C;  4PZ6 A;  1AEX A;  2OXP A;  3LWE A;  1BR9 A;  4JI5 L;  2NZ1 D;  2Y0S G;  4DR1 Q;  4A3B B;  1B4O A;  4QUC A;  3OPO A;  1VQL A;  1CSQ A;  3NE5 B;  4CHT B;  3CCQ A;  3CPF A;  4HID A;  1GUS A;  3N6R A;  4JI4 L;  5IGB A;  3A8J E;  2E2I B;  1K3R A;  1K8M A;  1K28 A;  3KF8 A;  1FYC A;  3A8I E;  4GN5 A;  3S1N B;  4RCO A;  2O5I C;  1S5D D;  4X65 L;  1VQ8 A;  2NVX B;  4PG3 A;  4QF4 A;  4DNR B;  3Q6S A;  4AYB E;  3CP0 A;  1FNV A;  5BN4 A;  3NTI A;  3K0X A;  4X64 Q;  3GD7 A;  1E0B A;  1GXD C;  4JI3 L;  4WJ3 M;  3PO2 B;  1O7L A;  3L7Z C;  1HA5 A;  4G7Z C;  5IGG A;  2HIX A;  2N3S A;  4GKJ L;  4QGU A;  3QIA A;  3UDF A;  1UAP A;  2Z4H A;  2EVB A;  2RHQ B;  2ZJQ A;  4L5R C;  1I4H A;  2IHF A;  3V2T A;  4DNI A;  1XMO L;  2K6A A;  1WCM B;  1HZ9 A;  3CF5 A;  1VQK A;  5I2X A;  3A74 A;  1WVL A;  2RSN A;  5AJ3 L;  1X55 A;  4LFA Q;  1V9P A;  1K9M C;  1GO3 E;  1GUO A;  3H0G H;  5E4X A;  3I2Z A;  1D7Q A;  5GAD C;  3GTM H;  3SDZ A;  1X9N A;  1PH4 A;  2VQF Q;  4B08 A;  4ZKB B;  1CA6 A;  3PIP 3;  3TEH B;  5GAE C;  3RN2 A;  2UUC L;  3RR5 A;  2YTY A;  1ZYR C;  2J7Z A;  1DZ1 A;  4HJA A;  3HOV H;  5HGQ A;  5KRU A;  4A3E B;  5C0X G;  2F03 A;  4JI8 L;  3FKI H;  1G6P A;  4A3G G;  2CCZ A;  2LY7 A;  1J6Q A;  3NBI A;  1PLF A;  1TT2 A;  4UDU C;  1VQC A;  4X3K A;  5M5W B;  5IYB G;  4YWL A;  4YWK A;  2PQA A;  1B1Z A;  5CV8 A;  3PF4 A;  5C44 B;  3W2D A;  4ZYS A;  4NXN Q;  1DD2 A;  3E6Z X;  3Q22 A;  3K80 C;  1ESR A;  4FDB A;  2NN6 H;  5I9O A;  2K75 A;  2UXD Q;  3NXW A;  1PZK D;  2SDF A;  3M4O B;  2E5L Q;  1MSH A;  2JXM B;  4LJZ C;  1Y69 U;  4DAY A;  2AUJ D;  3NBH A;  4JI7 Q;  4FXK C;  2R93 G;  4DV4 L;  4GN4 B;  2Z6K A;  1QG7 A;  5EPL A;  1BBW A;  1VCI A;  2D62 A;  3HOX B;  4C3H H;  1J5E L;  4P75 A;  5IY0 A;  3CQZ B;  3HOU B;  3PUW A;  1PH2 A;  4X66 Q;  5J22 A;  5FLM H;  1Z9F A;  2QF7 A;  3G71 A;  1QIL A;  1X3G A;  1B53 A;  1G29 1;  2A69 C;  5AFW A;  2A6H D;  1I6H B;  3OMG A;  1F2Z A;  3MZ5 A;  1NUC A;  3G6J B;  4DR7 Q;  2IWH A;  1QJO A;  4QMG A;  1JOO A;  4ZAI A;  4EQN A;  3CCU A;  4DR5 Q;  2AQ2 B;  4I65 A;  1D1I A;  4HAE A;  4GOP B;  1E7Z A;  2E76 C;  3H91 A;  3SXH A;  2UU9 L;  1OXU A;  3LNN A;  3AU7 A;  4C3J B;  4A3J H;  1LUZ A;  1I94 Q;  1UUP A;  5FK9 C;  2JA5 H;  4CDC C;  1IBL L;  1GUG A;  4DV0 Q;  3D3R A;  4LF7 L;  2HDM A;  3MXN B;  3MXP A;  3NSW A;  4NXM Q;  1A2T A;  2ZM6 Q;  4QJF A;  1EWH A;  2AKW B;  3JAM i;  4LFC Q;  4X3S A;  3OMC A;  1WTX A;  3CCM A;  1HTP A;  4GZY C;  2G9D A;  3I4M B;  4FF2 A;  1HQR D;  2RF4 A;  1LV9 A;  2Z6K C;  3O13 A;  1XJV A;  1HR0 W;  1HH2 P;  2XIW A;  4RGN A;  4Y7N B;  1PV4 A;  2CQA A;  4BXX H;  1J9O A;  4A3D H;  4OX9 Q;  1CFM A;  3VR5 A;  1Y1W B;  5JJZ A;  4A93 B;  4DR3 Q;  4LF8 Q;  4KY7 A;  1BOS A;  2R7Z B;  3S1M B;  1H9M A;  4JI0 L;  2DNC A;  4RA8 A;  4R8I A;  4HIK A;  1A8V A;  4RH6 A;  1AP0 A;  4K0K L;  2NVQ B;  3H94 A;  4A3C H;  4GLA C;  2JA7 B;  1LYL A;  4X3U A;  1QZG A;  1ET9 A;  4BY1 H;  3URY A;  2VUM G;  1K8A C;  4JK1 C;  1Z6H A;  1PYB A;  4KMU C;  2SEB D;  5M3M H;  3HRZ C;  5CR3 A;  2B2U A;  3I4N B;  5JVG 3;  2GA4 B;  1WOC A;  5JJL A;  1SNC A;  1Y8O B;  1E1T A;  4A3B H;  5IT9 E;  1XWE A;  3S1Q B;  3K59 A;  3R2I A;  2UXC L;  1D6E C;  1XXG A;  4KY5 A;  1BUV T;  3NEL A;  2HHH Q;  2PW5 A;  3UE0 A;  1LTR D;  2F3V A;  1SFO B;  3EN2 A;  2E2I H;  3STB C;  1KNA A;  4OEM B;  3G7L A;  5IT9 L;  4KKT A;  1B3A A;  3I72 A;  2UUA L;  3S1N H;  3SK5 A;  1S40 A;  2XNA C;  3MWY W;  2H1E A;  2R93 B;  4HSV A;  4KKS A;  2NVX H;  3H0G G;  2CFM A;  4YCW A;  3J81 j;  1HNW Q;  2N88 A;  3MTS A;  3A5Z B;  4B3R L;  1NE3 A;  1C0A A;  1UEB A;  3HOY B;  3T56 B;  1N33 L;  5ELC A;  3FHW A;  1SYF A;  3AFQ A;  4IUR A;  2JSO A;  1IBK Q;  3PO2 H;  3HOV G;  4ULL A;  4CGY B;  1GJX A;  1S5F D;  3K81 C;  3DEO A;  3FKI G;  2EY6 A;  2UUB L;  3ICE A;  2KHJ A;  3VDY A;  3DM3 A;  1B8A A;  2F0L A;  1WCM H;  1R4P B;  4JI2 Q;  1STG A;  1DOM A;  3E0J A;  4JCV E;  2NTT A;  1TWH B;  2JEB I;  5C3E B;  3F2C A;  1PH5 A;  1NNX A;  1C9O A;  1QNU A;  2E74 C;  4XDX A;  4LAA A;  1QVG A;  2A73 B;  2RDG A;  2B2U C;  3UE1 A;  3H3V H;  3PIP A;  4LFA L;  1U4P A;  5FKA C;  1HR0 L;  4FF4 A;  2GN5 A;  1S5B D;  4OO1 I;  1YNN C;  3S16 H;  1A6X A;  2N55 A;  4PMB A;  3W5O A;  2E2J B;  3DMU A;  2K1B A;  4CKC A;  2NZH A;  1TWG H;  3FVQ A;  2FHT A;  2VQF L;  2C35 B;  1PH7 A;  3TS0 A;  4R8N A;  2SOB A;  1MHW C;  3BYT B;  4C3H G;  4RWS C;  1I4G A;  1A2U A;  4JW0 A;  4IPC A;  2NN6 I;  3H15 A;  2E2H B;  1HFN A;  1LT4 D;  2WII B;  2VQE Q;  4UPA A;  4QL5 A;  2Z9H A;  4HSP A;  1SEB D;  3TRE A;  3H3V C;  2MUY A;  3I8Z A;  1IKM A;  3KBX A;  3H6M A;  5M5W H;  5FJ8 H;  2V4D A;  2PPB C;  2IJ0 A;  1OXT A;  2RDH A;  4IFD H;  2F0P A;  4NXN L;  4RFB A;  3D8G A;  1V1O A;  1PZJ D;  2UXB L;  2WAQ E;  4A3J G;  2HQL A;  3RZD B;  4WJ4 A;  1LTT D;  2D9U A;  3VR4 A;  2JA5 G;  4AYB B;  1LT5 D;  3U4Z A;  1MIU A;  1RTO A;  4AQY Q;  3GQB A;  3HP3 A;  3HOX H;  1OTC A;  1I6V C;  3HOU H;  3CQZ H;  1WTQ A;  1VQA A;  2MGS A;  4YY3 Q;  2PW7 A;  3M4P A;  1SMY C;  1FL0 A;  1CKO A;  4X66 L;  1NJI C;  1JE4 A;  3FP9 A;  2EPB A;  1HRJ A;  1PDQ A;  2PZU A;  1NMF A;  5ELN A;  1JT8 A;  1CHP D;  4NB3 A;  1GVP A;  3KF8 B;  3JAM E;  1I6H H;  2JYO A;  4DR6 Q;  2AHO B;  4LFB Q;  3RD4 A;  3BVM A;  2K5V A;  2LXJ A;  1GHK A;  1LTB D;  2K5Q A;  4FO2 A;  4DR7 L;  2JA8 G;  4A3D G;  1Y8N B;  3I3C A;  1Q8I A;  4DR5 L;  2JP1 A;  4PMC A;  5K36 H;  1ESF A;  4B3T L;  1FGU A;  1UE5 A;  4L6T B;  3QB3 A;  5A2Q E;  2K50 A;  3HKZ G;  3GTM B;  2Q8I B;  1G51 A;  4A3F H;  5JJI A;  2F0U A;  3F1Z A;  2AQ1 B;  1TR5 A;  1GOZ A;  5IE8 A;  3VA7 A;  1VQ9 A;  4IN3 A;  1YBY A;  2NYZ D;  3A8K E;  3S9W A;  4DV0 L;  5A2Q L;  3GTK H;  5C4H A;  3BJU A;  5EBD A;  3J80 c;  3AB9 A;  4R1J A;  4NXM L;  3NTH A;  2ZM6 L;  5EPJ A;  2JEA I;  4G7O C;  4YHH Q;  2RBM A;  1ASY A;  1FNU A;  5C4X G;  5IYC G;  2CW0 C;  5T1I A;  1STA A;  5CBE E;  2OCE A;  2A68 C;  1SLJ A;  3PUV A;  1PVO A;  4YCV A;  5COY A;  1BBX C;  1RF2 D;  3M3Y H;  1ROD A;  2WB1 E;  3EFX D;  4A3B G;  2PMZ B;  2K33 A;  4JI1 L;  4Y7N H;  3L9A X;  4B9W A;  3JAM c;  4CKB A;  2F1M A;  3KLW A;  2FFK B;  2D0O A;  4A93 H;  1H9K A;  1NSN S;  2Z4I A;  2R7Z H;  4K5W A;  3GV6 A;  2L12 A;  1N34 L;  5BR8 L;  2Q2T A;  1YNJ C;  4UY8 C;  2NVQ H;  2EJG C;  1TQO A;  4H44 C;  1NR2 A;  4C56 C;  2JA7 H;  3SK4 A;  3MHB A;  2NTS A;  1SYB A;  1ZXT A;  1FR3 A;  1KNE A;  3PO2 G;  5KNC A;  1IW7 C;  4XT1 B;  2PQA B;  3QWN A;  3KLR A;  4LF9 Q;  3W1G A;  1BXT A;  2QKI C;  4FNF A;  1KLU D;  1JWM D;  1KAB A;  1RIP A;  1HA6 A;  3BZK A;  1MGS A;  3CCJ A;  1WCM G;  4KN4 C;  1BNZ A;  1JB7 A;  4DR2 Q;  3T1Y Q;  1TU2 B;  5BN5 A;  1G6Z A;  4QIW B;  1SFO H;  4XQQ A;  1CA5 A;  2KJX A;  4DAY B;  4HCE A;  4TKO B;  5K5P A;  5IOC A;  1Q1B A;  2X6L A;  2PNR C;  3J81 c;  4G4K A;  4DUZ L;  4J1M A;  1XNR L;  5HGT A;  1HNW L;  1PRT C;  4PQX A;  4XXE A;  2HD3 A;  3M4Q A;  2VS1 A;  2L1B A;  3KOJ A;  4KY6 A;  3IAY A;  1LTG D;  5FOB B;  2JN4 A;  5D3D A;  2SNS A;  4O2D A;  2EYM A;  3C3L A;  4DR4 L;  3I73 A;  1UE7 A;  4F8M A;  2LXK A;  1KL9 A;  3CC7 A;  4A3E G;  4LUZ A;  3H3V I;  2K4K A;  1BCP C;  2JE6 I;  3BZD B;  2KEE A;  4A4I A;  1HNZ L;  1B2T A;  1XMQ L;  4IUN A;  2NZO A;  1Q81 C;  5FJ8 G;  4EX5 A;  4U67 3;  2MFI A;  1HUM A;  4L5Q A;  1VMP A;  2JQO A;  3S2D H;  5C44 G;  2LMC B;  1TWH H;  2M00 A;  3MEF A;  4HIO A;  4RG1 A;  2N49 A;  3S2H B;  1Q82 C;  2L4N A;  1I4R A;  1FNW A;  4OIK A;  4KHZ A;  3K7U C;  2RKS A;  5CV9 A;  4GKK L;  3FPP A;  4DNT B;  3ULL A;  1X32 A;  1CKN B;  1PZI D;  4A3M B;  1QVC A;  4APV A;  3UDG A;  2ZTC A;  4UAI A;  4BY1 B;  1DM0 B;  5KYI A;  5ELE A;  1TS5 A;  2YTV A;  3FMC A;  3KJP A;  1O7Y A;  1EZ8 A;  1EU4 A;  1V1Q A;  5M3M B;  2B8G A;  3HOX G;  4C3I H;  3HOU G;  4IFD I;  3NWS A;  3TZU A;  2E2H H;  4HTH A;  4PZ8 A;  4K2K A;  4LK1 C;  4DK6 C;  4KN7 C;  4HIM A;  1IKL A;  1L1O A;  1ONL A;  2F0J A;  2B2Y A;  4QUF A;  3R8B A;  5IP7 G;  3NK9 A;  1ZYR D;  1OXX K;  3MA2 B;  4DV1 L;  5E3F A;  5EAY A;  1FVI A;  1ML0 D;  3OWF A;  3L0O A;  4IUP A;  2WKD A;  1YHQ A;  4F87 A;  1CSP A;  5HUR A;  2EIF A;  5D3I B;  1TY2 A;  2G5D A;  4C3J G;  3D4R A;  3RZD H;  2GVA A;  1Z7T A;  3KUP A;  4JYA Q;  4X62 L;  5FO8 B;  3H09 A;  1F2M A;  4B3M L;  1JC7 A;  2PYK A;  2MO0 A;  4GNX A;  4HMJ A;  3F2B A;  5IP9 G;  3K7A B;  4AIM A;  2FMC A;  2HCI A;  4LF5 Q;  1HTL D;  5EKI A;  4NP5 A;  4DAM A;  2WAC A;  5FLX E;  3I4M G;  3OTO Q;  2OT2 A;  1IYV A;  2RVL A;  5JVH 3;  5GQO A;  1SNM A;  1TWA B;  4MN3 A;  5LMN W;  1CT1 D;  4DV3 Q;  2Q2U A;  1CQV A;  1QUQ A;  1MD2 D;  2K03 A;  5ELO A;  1Y1W G;  2MO1 A;  1F9Q A;  1EFW A;  1TXY A;  4A93 G;  3HZX A;  1VS0 A;  2A69 D;  3S16 B;  3TSS A;  1FJG Q;  2R7Z G;  1EFI D;  2K01 A;  2FXQ A;  3RMH A;  1L1O C;  2LS0 1;  1NR4 A;  5I6Y A;  4FF1 A;  2B2Y C;  1TWG B;  1EY0 A;  1N32 Q;  2DY7 A;  3AFP A;  2WV6 D;  4IO9 A;  4IOC A;  2F4V Q;  3RN5 A;  1KRT A;  1A3V A;  2JA7 G;  4IUT A;  2OF1 A;  3C2P A;  4DN4 M;  2RCF A;  2ZXP A;  4MZ9 A;  2KOL A;  3BS1 A;  1N36 L;  4OO1 H;  3FRP B;  3HEJ A;  3NUC A;  1VDZ A;  1U4R A;  1B7Y B;  3Q23 A;  1VQN A;  3KFU A;  4RKL A;  1KD1 C;  3ULJ A;  3I4N G;  2GVB A;  1L2F A;  4PNY A;  2PMZ E;  3CD6 A;  1BKB A;  2KUM A;  2TMP A;  1II3 A;  2XWJ B;  2EE1 A;  5FLX c;  5KNB A;  1NBW A;  2P5Z X;  1X3E A;  3GTJ H;  4DV2 Q;  2F0E A;  1W3S A;  4GNX C;  3W1B A;  2F0I A;  4IZ8 A;  3T1H Q;  3UDX A;  3X3M A;  1YJW A;  1N9W A;  3D0F A;  2BA0 A;  3MAQ A;  4DV7 Q;  5IGE A;  1XTC D;  2F0N A;  3CCS A;  1DJR D;  3OW2 A;  1EEI D;  4KLK A;  1VQI A;  2WAQ B;  5IYD G;  1MBY A;  1Q46 A;  1RCV D;  1ENA A;  4KI0 A;  3DWP A;  5EBC A;  1PH8 A;  3PMF A;  1ASZ A;  3KJO A;  3ITP A;  4U68 A;  1EUJ A;  5JJK A;  3HOY G;  4IJH A;  4ZUJ A;  3M7G A;  3RLN A;  3A7L A;  1CZW A;  2YTX A;  3KYH C;  1S5E D;  2DJG C;  2F0Q A;  2KCM A;  1STY A;  3CMA A;  1PYS B;  5IWA L;  2R3Z A;  1N8R C;  4KK7 A;  4QIW E;  1H9S B;  1EWC A;  3GTG H;  1AW7 A;  4HJ7 A;  2YV5 A;  4IFD J;  3J80 i;  4DR2 L;  2AWO A;  5C3E G;  3CCV A;  5I4D A;  4WJW A;  2K5D A;  4XIG S;  1LTL A;  2JA6 B;  2QCP X;  1BBU A;  2I5L X;  1HUN A;  3M9B A;  4A3F B;  2KCC A;  1B70 B;  4E6I A;  1EY5 A;  3Q8D A;  5LMN L;  2EYF A;  4DFA A;  5JOB A;  3GTK B;  3STB D;  1SMX A;  1CKN A;  1I4P A;  2KHS A;  2MQH A;  1IL8 A;  3PUX A;  3P7J A;  4YWM A;  2K7V A;  3GV3 A;  3M7N A;  4P73 A;  4OWT B;  1PFN A;  2O2L D;  1TVX A;  1DOL A;  1WI5 A;  1OXV A;  3PO3 H;  4KHP Q;  2BA1 A;  4QCL A;  3M3Y B;  3T53 B;  3U9O A;  3HOZ H;  1JWS D;  1TWF B;  4DV6 Q;  4WOR A;  2WB1 B;  1G8Z D;  2IX3 A;  5EKL A;  1WTO A;  3CPW A;  1EQQ A;  2CWP A;  2B29 A;  2J0T D;  3HG9 A;  2J4X A;  4JI6 Q;  2XWB B;  3RUZ A;  4KKU A;  3S2H H;  2IY5 B;  1SBB B;  2F0W A;  3VYU A;  3FPU B;  1SE2 A;  4QQB X;  4A3M H;  4HJ5 A;  3TP5 A;  4B3S Q;  4AYB G;  2KA7 A;  3SVM A;  1X54 A;  1B50 A;  1K0S A;  3E0E A;  1RD9 D;  5EGT A;  4DAP A;  4M8A A;  3OOC A;  1KRS A;  5E1F A;  1E3P A;  4X6A H;  1Q3L A;  2ICI A;  3M4Y A;  3SE0 A;  5JEA J;  2I0Q A;  3TZD A;  3J7A V;  2F0M A;  1YNN D;  1PRT B;  4R4O A;  3J81 i;  4DR1 L;  3S24 A;  5LMU Q;  1WFQ A;  2BDO A;  1ZKO A;  4OON A;  1IXR A;  4XYO A;  3BYY B;  2H4O A;  4KHV A;  2IT1 A;  3BDC A;  4MNO A;  1BCP B;  4J6H A;  3R93 A;  1FD7 D;  1PMR A;  3W3A A;  2R7D A;  3RZO B;  1U4L A;  5C4J B;  5KGU A;  1LAC A;  1PHJ A;  4UP7 A;  3QJY A;  3TME A;  2A74 C;  2BOS A;  1JJ2 A;  1Q12 A;  1WTH A;  2K5N A;  2XRQ D;  2ZTE A;  5E4W C;  4A3K H;  1Y1V H;  1SJE D;  1D5Z C;  2DY8 A;  3HOW H;  5JPN C;  2MNA A;  2RHS B;  1BDO A;  4C1N I;  3IL8 A;  4X64 L;  1U5K A;  2CKZ B;  3QOL A;  1CUK A;  3NWT A;  1YNX A;  2B3G A;  4ALP A;  2PI2 A;  3K7A H;  1WTW A;  1BF4 A;  4OO1 G;  3C1F A;  1EY8 A;  2IW3 A;  1ENF A;  1A63 A;  5E7N A;  2R6G A;  4JC0 A;  3V05 A;  3TP6 A;  3VR6 A;  4JV5 Q;  2EJF C;  1J8I A;  1TWA H;  1G2S A;  3PCO B;  3D6W A;  3I90 A;  4R4C A;  3S2D B;  1PRT F;  1WD0 A;  1EYD A;  4TSS A;  3K8A A;  2NWG A;  1SMY D;  2NN6 G;  2XVS A;  5KYL A;  1LLR D;  3CCL A;  4FXG C;  1JIC A;  1Q8K A;  1A0I A;  2E8G A;  1FJG L;  1VQ6 A;  1BCP F;  1W6J A;  2VNU D;  4N8F A;  2PI2 E;  2B63 H;  4A75 A;  4H7B A;  3VYS A;  3C1E A;  3NPP A;  1VQ5 A;  2OTL A;  1N32 L;  2Q2H A;  2K5W A;  2F4V L;  4C3I B;  5C5L A;  4K5V A;  1JR0 D;  4DV5 Q;  5FLM G;  1TKW B;  2PNH A;  1M1K C;  2CQO A;  4P2C B;  4CDD C;  2BE5 C;  1P16 A;  2I5H A;  4WFN 3;  1XNQ Q;  2XRS D;  4LF6 Q;  3P20 A;  3NQI A;  3BDO A;  4RGT A;  3JC6 6;  2F4I A;  2EXD A;  2EY1 A;  3BZC A;  1TS3 A;  4CDE C;  4HJ8 A;  1KAW A;  3GP7 A;  3GO5 A;  4JI5 Q;  2CH4 W;  2CW0 D;  1H9S A;  5DLQ E;  2PZT A;  2UXD L;  1MJC A;  2A68 D;  2K32 A;  1UNS A;  4EVO A;  3HGB A;  2N8N A;  2E5L L;  2L9H A;  5C4Z A;  2A6E C;  1U0L A;  1PH3 A;  4JI7 L;  3J80 E;  2OQ0 A;  3VA5 A;  3WOF A;  3EQL C;  4Q0F A;  4EGV A;  2XSC A;  1TS4 A;  1GM5 A;  3F2U A;  5DAU A;  1QCB D;  1B9N A;  1K8O A;  1SNP A;  2C9O A;  4X65 Q;  2O4X A;  3BG3 A;  3TP7 A;  3K58 A;  3J80 L;  1L1O B;  1YNJ D;  2NVT B;  3BVG A;  3EVQ A;  1VF5 C;  4P74 A;  5H1S E;  2R92 B;  2R61 A;  1G2T A;  4WRD A;  3PO3 G;  1B3Q A;  1AH9 A;  3DHQ A;  1ICF B;  4JI3 Q;  2R7F A;  4DAV A;  1PYW D;  1ILQ A;  1XYI A;  2Y0S E;  2KEC A;  1D5X C;  4BXX G;  4GKJ Q;  3PIO 3;  1H9R A;  2VXW A;  4LWC A;  3JAM L;  1IW7 D;  3DXJ C;  3AMU A;  3D31 A;  4CJ1 B;  4CBV A;  1XMO Q;  1PTO H;  5M9O A;  1K83 B;  3BDL A;  3RLO A;  2QIL A;  2JA6 H;  3NTK A;  1JE5 A;  4ZK9 B;  1I94 L;  4GNX B;  1YEZ A;  3AEV A;  1RTN A;  4A3C G;  4HJ9 A;  4A3M G;  5ISR A;  2NB0 A;  1CQF A;  5AJ3 Q;  1YJN A;  3KDF B;  3V96 A;  4F88 A;  4BY1 G;  1Y8P B;  4JBK A;  3U58 A;  2CH4 A;  3QG1 A;  2F3I A;  2OWO A;  4V19 0;  5CV4 A;  5JEA H;  1KAA A;  4UP9 A;  4XYQ A;  5M3M G;  4LFC L;  1T5E A;  3CRK C;  1LTI D;  1EY9 A;  1E2W A;  1O80 A;  1PTO C;  1C4Q A;  1QUQ B;  1PRT D;  1SE3 A;  2UUC Q;  1RKN A;  1YJ9 A;  4KHP L;  3GTJ B;  4K6D A;  1TWF H;  4L8J A;  2ZXO A;  2KHI A;  4JI8 Q;  3LWU A;  1G91 A;  4N9P A;  4OX9 L;  2RA4 A;  1XPO A;  1BO0 A;  3J81 E;  4GLV B;  3GTQ H;  1OXS C;  1DYQ A;  4J8Q A;  4DR3 L;  1BCP D;  4IJL A;  4LF8 L;  1S3O A;  1VQM A;  2ALY B;  2OQK A;  3NHH A;  1EOT A;  1RJT A;  1E22 A;  2Z1C A;  1ICW A;  3NEM A;  3WWV A;  3J81 L;  1IBM Q;  1PA6 A;  4YCU A;  4EQO A;  5M5X H;  1PFS A;  3P1H A;  2LFN A;  3OIP A;  2NVY H;  1H95 A;  4C2M H;  4Q5V A;  3CAM A;  2QEJ C;  2MJ8 A;  3MFG A;  4BBS B;  1LTS D;  4RGM A;  4DV4 Q;  2VZA A;  4L5S A;  2JA9 A;  3D6C A;  2ZJP A;  2ZT9 C;  1J5E Q;  2SNM A;  2Q8T A;  3LGJ A;  4KJN A;  1YHB A;  1S72 A;  1OO9 B;  4H02 A;  1HNX Q;  3GTG B;  1ILP A;  2EOT A;  3OYY A;  3VR3 A;  1IL2 A;  3PUY A;  5C0X H;  2HHH L;  4A3G H;  2RDF A;  2KQ3 A;  2PQE A;  5D14 A;  2AMC B;  1EQV A;  4IPG A;  1F77 A;  3RZO H;  5C4J H;  1W6K A;  2AUK A;  3UDI A;  1EIH A;  2DN8 A;  2X6G A;  2B63 G;  4R4I A;  5CC4 A;  3U50 C;  1P8L A;  1VQD A;  3MEH A;  3SGI A;  1IBK L;  4I7Z C;  1IBL Q;  1VF7 A;  2EYJ A;  4JOI A;  3PO3 B;  3TDQ A;  3S15 B;  4CJ0 B;  2ZTD A;  4GLX A;  3K5L A;  3HOZ B;  1B9M A;  3N52 A;  1K0R A;  2XGT A;  2YU9 H;  2WP8 J;  3QOJ A;  4RHR A;  2DNE A;  4JI2 L;  2F0F A;  1JQY D;  2HUG A;  4POF A;  1F9R A;  1AZQ A;  1D2B A;  4IFD G;  5LL6 S;  1KC8 C;  5FO9 B;  4BY7 H;  1I3Q B;  2IPK D;  4YIJ A;  3TS2 A;  4ODG A;  4PV1 C;  1YVC A;  2F0D A;  1E2Z A;  3GDE A;  1EY4 A;  2WAQ G;  5JAV A;  3I70 A;  4CKE A;  3CXC A;  2V1C C;  3GTO H;  4MTN A;  3A55 A;  1K8G A;  4BBR B;  4LNQ A;  4JI0 Q;  1RL2 A;  1SNO A;  4IUU A;  4K0K Q;  1JB3 A;  2EQS A;  1STB A;  1QOH A;  4HED A;  3VYR A;  2A1A A;  2B2W A;  2VQE L;  2I5M X;  1JJG A;  3PV0 A;  1VQH A;  3A56 A;  2D5D A;  2IX0 A;  4HCS A;  4OIJ A;  5CMD A;  4JG2 A;  5D65 A;  2RQX A;  1XNQ L;  1SYD A;  1A3U A;  3I91 A;  4FF3 A;  3A54 A;  4AH6 A;  1I4Q A;  4KV6 A;  2F3W A;  3CRL C;  1Y14 B;  4JOI C;  5K36 G;  3I56 A;  1VQE A;  2UXC Q;  1VQF A;  1VQJ A;  2JA6 G;  5EPK A;  1MI2 A;  1IHZ A;  3K0Y A;  4EQP A;  5I9P A;  4A3F G;  5C3X A;  4LMQ D;  4A3K B;  2LSS A;  1Y1V B;  3HOW B;  2OTJ A;  1EZ6 A;  1UE6 A;  5J1Z A;  3T51 B;  2UUA Q;  2QW7 A;  4ZKC B;  1C8C A;  4AQY L;  2BH8 A;  1A3T A;  2AQ3 B;  3CKI B;  1H9J A;  5JEA G;  3DWQ A;  3KDF A;  4YY3 L;  4B3R Q;  2CVR A;  1ET6 A;  3ZYY X;  3KLS A;  3GTP B;  2NVT H;  2A8V A;  3J7A 5;  2A5H A;  5EQ0 A;  2EZV A;  2R92 H;  4GS3 A;  3DEP A;  1N33 Q;  3I4L A;  1Q86 C;  4UP8 A;  4OL7 A;  4CDF C;  1U4M A;  4JBW A;  4R4T A;  3PIO A;  3K5M A;  3PF5 A;  2VUM H;  3L3O C;  5CGK A;  1E2V A;  3T4A C;  2ZJR A;  4DPG A;  3GTL B;  4DR6 L;  4LFB L;  3U4V A;  3LX0 A;  2M9V A;  3MXU A;  4K14 A;  5FLX L;  1SR3 A;  3ER0 A;  2WB1 G;  2PCF B;  2UUB Q;  1KDA A;  3EIV A;  4KD4 A;  4DUY Q;  1K83 H;  5ELF A;  1TS2 A;  3K57 A;  1WTV A;  1KDC A;  2B2W C;  5G3L F;  1WJJ A;  2MPM A;  2EYL A;  1HFG A;  4KJO A;  2B63 B;  1XPU A;  2PO4 A;  4O42 A;  5M3F B;  4DK0 A;  1IZ6 A;  2BH2 A;  4XQJ A;  1DCZ A;  3QR8 A; 
#chains in the Genus database with same CATH homology
 1GD7 A;  3U4Z A;  1MIU A;  2K5H A;  1KRS A;  4LF7 Q;  3E9I A;  1E3P A;  4TVA B;  1IYJ B;  4X6A H;  4AQY Q;  1I50 H;  4YHH L;  1OTC A;  3HOX H;  2Z0S A;  5JEA J;  2I0Q A;  2ID0 A;  3CQZ H;  3HOU H;  1VQA A;  4IPD A;  3HOY H;  4YY3 Q;  3M4P A;  1KXL A;  4JV5 L;  3G48 A;  1FL0 A;  1CKO A;  4P72 A;  4X66 L;  1NJI C;  2DGY A;  4R4O A;  1MJE A;  3FP9 A;  3ERS X;  3J81 i;  4DR1 L;  3S24 A;  5ELN A;  1NMF A;  1WFQ A;  5LMU Q;  1JT8 A;  4OON A;  1IXR A;  4ME3 A;  4NB3 A;  1GVP A;  3KF8 B;  1I6H H;  1X56 A;  4DR6 Q;  2AHO B;  4LFB Q;  1KIX A;  4PZ7 A;  1E1O A;  1R9T H;  2IT1 A;  4LF4 Q;  2K5V A;  2LXJ A;  4MNO A;  4A3L H;  1NY4 A;  4DR7 L;  2JA8 G;  4A3D G;  2RCN A;  2R7D A;  3KF6 B;  4DR5 L;  1T9H A;  2IHE A;  1PHJ A;  1EWI A;  4OXP A;  4UP7 A;  5C3E H;  3CC2 A;  4B3T L;  1FGU A;  1UE5 A;  1M90 C;  1QZH A;  1I5F A;  2K50 A;  3A5U A;  1DGS A;  3HKZ G;  1Q12 A;  1JJ2 A;  2A19 A;  2K5N A;  1IBM L;  2ZTE A;  4A3K H;  1G51 A;  4A3F H;  1Y1V H;  2UXB Q;  5JJI A;  3F1Z A;  2JJQ A;  3HOW H;  2MNA A;  5C0X I;  2RHS B;  3CME A;  4DV5 L;  4A3I G;  5IE8 A;  4X64 L;  1NMG A;  1U5K A;  1VQ9 A;  2CKZ B;  1YBY A;  1CUK A;  2H5X A;  4R4Q A;  4BBS H;  4DV0 L;  2E2J H;  3GTK H;  2ES2 A;  1YNX A;  3BJU A;  3EBE A;  2B3G A;  3J80 c;  4R1J A;  2PI2 A;  3K7A H;  4ALP A;  2ZM6 L;  1TWC H;  4NXM L;  2JEA I;  2DUD A;  4LF9 L;  4OO1 G;  4YHH Q;  4LF6 L;  1ASY A;  5C4X G;  1WYD A;  2QGQ A;  5IYC G;  1A63 A;  1HZC A;  5E7N A;  2R6G A;  4JC0 A;  3ZJY C;  2OCE A;  4PZ6 A;  2KEN A;  1SLJ A;  3PUV A;  1Z47 A;  4JV5 Q;  1PVO A;  1HNX L;  1TWA H;  4YCV A;  4JI5 L;  2Y0S G;  3PCO B;  3M3Y H;  2WB1 E;  4R4C A;  4DR1 Q;  4A3B G;  3T1Y L;  1W2B A;  2K52 A;  3K8A A;  4JI1 L;  4Y7N H;  4BY7 G;  1VQL A;  1CSQ A;  3JAM c;  3CCQ A;  2NN6 G;  3CPF A;  4HID A;  2CWA A;  3KLW A;  4JI4 L;  3CCL A;  2D0O A;  4A93 H;  3CCR A;  1K3R A;  1Q8K A;  1YHA A;  1A0I A;  2R7Z H;  2E8G A;  4GN5 A;  1SRO A;  1N34 L;  1FJG L;  1VQ6 A;  5BR8 L;  2Q2T A;  2VNU D;  2PI2 E;  2B63 H;  4A75 A;  4X65 L;  4UY8 C;  4B3T Q;  1VQ8 A;  2NVQ H;  4PG3 A;  1VQ5 A;  2OTL A;  4AYB E;  1N32 L;  2Q2H A;  2F4V L;  2JA7 H;  3CP0 A;  4XTC S;  1EIY B;  3K0X A;  4DV5 Q;  5FLM G;  3S15 H;  4X64 Q;  2PNH A;  3GD7 A;  1M1K C;  2CQO A;  4JI3 L;  3PO2 G;  4A76 A;  1XTD A;  4QY7 A;  2IX1 A;  2UXC Q;  4WJ3 M;  3L7Z C;  1P16 A;  2PQA B;  1GKH A;  2I5H A;  2HIX A;  2N3S A;  4LF9 Q;  1SRU A;  3W1G A;  4QGU A;  1XNQ Q;  2YYZ A;  4GKJ L;  4LF6 Q;  3UDF A;  1RIP A;  4PMW A;  1X6O A;  3BZK A;  2K14 A;  2RHQ B;  3JC6 6;  3CCJ A;  2EXD A;  2IHF A;  4DNI A;  2ZJQ A;  3BZC A;  1WCM G;  1XMO L;  4L5R C;  4HJ8 A;  1KAW A;  1I3Q H;  1HZ9 A;  3GO5 A;  3CF5 A;  1VQK A;  1JB7 A;  4JI5 Q;  4DR2 Q;  3G4S A;  3T1Y Q;  5DLQ E;  1SFO H;  2UXD L;  1MJC A;  3S17 H;  1L0W A;  4JI1 Q;  4DAY B;  3PO3 H;  4LW1 A;  3A74 A;  2N8N A;  2E5L L;  4Y52 H;  2JA8 H;  1Q1B A;  5AJ3 L;  1X55 A;  1U0L A;  4LFA Q;  1V9P A;  1K9M C;  1GO3 E;  3J81 c;  1PH3 A;  4JI7 L;  2OQ0 A;  3HKZ E;  4DUZ L;  3H0G H;  3I2Z A;  1D7Q A;  1N34 Q;  5GAD C;  1GM5 A;  5BR8 Q;  4BBR H;  1XNR L;  1HNW L;  4P71 A;  3GTM H;  1X9N A;  1EQR A;  3M4Q A;  4X65 Q;  2VS1 A;  2VQF Q;  3KOJ A;  1PH4 A;  3I7F A;  3TEH B;  1L1O B;  1E24 A;  4O2D A;  5GAE C;  4DR4 L;  3RN2 A;  2UUC L;  1UE7 A;  3RR5 A;  2R92 G;  2LXK A;  1KL9 A;  2YTY A;  4P74 A;  5H1S E;  3CC7 A;  4HJA A;  3PSI A;  3HOV H;  4A3E G;  5HGQ A;  3PO3 G;  4LUZ A;  5C0X G;  1AH9 A;  4RMF A;  1EYG A;  3H3V I;  4JI8 L;  2K4K A;  3FKI H;  4JI3 Q;  1HJP A;  2JE6 I;  4A3G G;  1G6P A;  2R7F A;  3I4O A;  4A4I A;  1HNZ L;  2ATW A;  2CCZ A;  1J6Q A;  5C4X H;  1XMQ L;  5IYC H;  2Y0S E;  3RNU A;  4GKJ Q;  4BXX G;  3PGZ A;  2NZO A;  1VQC A;  1Q81 C;  5FJ8 G;  2QA4 A;  5IYB G;  4EX5 A;  4LWC A;  4YWL A;  2MFI A;  4L5Q A;  4YWK A;  4DK3 C;  2D0P A;  2PQA A;  2JQO A;  3S2D H;  3D31 A;  1SE8 A;  5C44 G;  1TWH H;  1XMO Q;  3PF4 A;  4NXN Q;  3MEF A;  3RLO A;  4HIO A;  4RG1 A;  2JA6 H;  2N49 A;  3K80 C;  1Q82 C;  1JE5 A;  4FDB A;  2K75 A;  1AE3 A;  4KHZ A;  1I94 L;  2HT1 A;  4GNX B;  3K7U C;  2UXD Q;  1YEZ A;  4GKK L;  3AEV A;  4A3C G;  3ULL A;  4JYA L;  4HJ9 A;  1BVS A;  2E5L Q;  4A3M G;  1CKN B;  1QVC A;  4APV A;  3UDG A;  5AJ3 Q;  4IPH A;  1YJN A;  2ZTC A;  3KDF B;  4BY1 G;  4JI7 Q;  2F52 A;  4JBK A;  3U58 A;  2R93 G;  4TQU S;  2F3I A;  4DUZ Q;  1NTG A;  2YTV A;  2Z6K A;  4GN4 B;  1YZ6 A;  3KJP A;  4DV4 L;  2OWO A;  4IOA A;  1BBW A;  1HZB A;  1VCI A;  4UP9 A;  1V1Q A;  2D62 A;  5M3M G;  1XNR Q;  3GTP H;  4LFC L;  1XPR A;  3AYH B;  4LF5 L;  3HOX G;  4C3I H;  3HOU G;  4C3H H;  1J5E L;  4P75 A;  5IY0 A;  4IFD I;  3PUW A;  5GRO A;  1PH2 A;  2E2H H;  3OTO L;  4X66 Q;  1QUQ B;  4PZ8 A;  5FLM H;  4DR4 Q;  2UUC Q;  1YJ9 A;  3GTL H;  4KHP L;  1KQS A;  1Z9F A;  4DK6 C;  1TWF H;  2VL6 A;  3G71 A;  5C0X J;  4DV3 L;  1X3G A;  3PUZ A;  4HIM A;  1L1O A;  1G29 1;  2KHI A;  4JI8 Q;  5IP7 G;  1HNZ Q;  5J3B A;  4OX9 L;  1OXX K;  3HFZ B;  1PH1 A;  2ASB A;  4DV1 L;  1XMQ Q;  4DR7 Q;  1XPO A;  4A3L G;  4GLV B;  3GTQ H;  5EAY A;  5IYD H;  4DKA C;  1FVI A;  1OXS C;  4DR3 L;  4DUY L;  3CCU A;  3L0O A;  4DR5 Q;  4IJL A;  4LF8 L;  1YHQ A;  1CSP A;  1S3O A;  1VQM A;  2EIF A;  4NPS A;  4GOP B;  1E7Z A;  1VQP A;  1Q7Y C;  5IT9 c;  4POG A;  2WFW A;  2UU9 L;  2ALY B;  1OXU A;  2OQK A;  1E22 A;  3NEM A;  3KF6 A;  3WWV A;  3G6E A;  5M3F H;  4A3J H;  1PH9 A;  1CKM A;  1IBM Q;  1PA6 A;  4YCU A;  3RZD H;  1YI2 A;  1LUZ A;  1I94 Q;  3A0J A;  4GKK Q;  5M5X H;  1PFS A;  2GVA A;  2JA5 H;  4L5T A;  1IBL L;  4JYA Q;  4X62 L;  2Q2I A;  4B3M L;  2NVY H;  1H95 A;  4C2M H;  4DV0 Q;  3TRZ A;  2MO0 A;  3CAM A;  4GNX A;  4LF7 L;  4BBS G;  3MXN B;  3F2B A;  2VW9 A;  2L15 A;  4NXM Q;  4DV4 Q;  2ZM6 Q;  4QJF A;  5IP9 G;  4AIM A;  3JAM i;  2AKW B;  2VZA A;  4L5S A;  4LFC Q;  2JA9 A;  1QVF A;  2ZJP A;  4LF5 Q;  1D8L A;  3CCM A;  1X3F A;  1J5E Q;  4DAM A;  3LGJ A;  1EIF A;  4LUO A;  4DV2 L;  1YHB A;  1YIJ A;  3OTO Q;  1S72 A;  3I4M G;  4H02 A;  1HNX Q;  4A3E H;  3IRB A;  3OYY A;  3T1H L;  1IL2 A;  5GQO A;  4K0K L;  3PUY A;  2RF4 A;  2Z6K C;  1XJV A;  4DV7 L;  1HR0 W;  2KCT A;  5LMN W;  2HHH L;  1HH2 P;  2Q2U A;  4DV3 Q;  4A3G H;  1QUQ A;  4LF4 L;  1PV4 A;  2AMC B;  4JI4 Q;  4BXX H;  4IPG A;  5ELO A;  4BA1 I;  1Y1W G;  2MO1 A;  4OX9 Q;  4A3D H;  3RZO H;  1EFW A;  4DV1 Q;  5C4J H;  1X65 A;  1JJC B;  1TXY A;  4A93 G;  5GAH C;  3UDI A;  1VS0 A;  3I55 A;  5C44 H;  4DR3 Q;  4LF8 Q;  1FJG Q;  2R7Z G;  3CW2 C;  1AE2 A;  2FXQ A;  4JBJ A;  1UE1 A;  1L1O C;  2JK8 A;  4JI0 L;  2B63 G;  4R4I A;  4HIK A;  1A8V A;  1N32 Q;  3AFP A;  3U50 C;  3M4O H;  1P8L A;  4IO9 A;  4IOC A;  4A3C H;  2F4V Q;  1VQD A;  3RN5 A;  1KRT A;  4A3I H;  4GLA C;  4GOP A;  2JA7 G;  3SGI A;  1LYL A;  5GAG C;  1QZG A;  1IBK L;  3S14 H;  1IBL Q;  4X62 Q;  4BY1 H;  4MZ9 A;  4JOI A;  1N36 L;  1K8A C;  4B3M Q;  2VUM G;  1PYB A;  4GLX A;  2ZTD A;  3HOZ G;  1VQN A;  1B7Y B;  5M3M H;  1K0R A;  2XGT A;  3KFU A;  2YU9 H;  1KD1 C;  3ULJ A;  3I4N G;  2GVB A;  2WP8 J;  2QEX A;  1L2F A;  2PMZ E;  3CD6 A;  1BKB A;  3M85 A;  4JI2 L;  1WOC A;  4POF A;  5JJL A;  5FLX c;  1E1T A;  2HIV A;  4A3B H;  1NBW A;  3GTJ H;  1X3E A;  4DV2 Q;  4IFD G;  1KC8 C;  1W3S A;  4GNX C;  1VQO A;  4BY7 H;  3W1B A;  3T1H Q;  2UXC L;  3UDX A;  1YJW A;  3TS2 A;  1N9W A;  3D0F A;  3NEL A;  2BA0 A;  4DV7 Q;  2HHH Q;  3UE0 A;  1YVC A;  1C7Y A;  5IP7 H;  3EN2 A;  2E2I H;  3STB C;  3GDE A;  4EQ5 A;  3CCS A;  1VQB A;  3OW2 A;  2UUA L;  5M5Y H;  1SN8 A;  2WAQ G;  1VQI A;  3B6Y A;  4KLK A;  3S1N H;  1S40 A;  5IYD G;  3CXC A;  2V1C C;  1Q46 A;  3GTO H;  2NVX H;  3AQQ A;  3H0G G;  2CFM A;  4KI0 A;  4MTN A;  4YCW A;  3J81 j;  4C3J H;  1HNW Q;  1PH8 A;  4BBR G;  3A5Z B;  1ASZ A;  3KJO A;  1K8G A;  4LNQ A;  1JMC A;  4JI0 Q;  4B3R L;  1NE3 A;  1EUJ A;  5JJK A;  1RL2 A;  3HOY G;  1C0A A;  1UEB A;  4K0K Q;  2XTI A;  4IJH A;  1N33 L;  1V43 A;  2EQS A;  3AFQ A;  3FHW A;  3RLN A;  3J7Z C;  3TQY A;  4OWW B;  2YTX A;  3KYH C;  1IBK Q;  3PO2 H;  2A1A A;  2VQE L;  2I5M X;  1JJG A;  3PV0 A;  1VQH A;  3HOV G;  1N36 Q;  2IX0 A;  2AWN A;  2KCM A;  4DV6 L;  5IP9 H;  1EOV A;  3K81 C;  4JG2 A;  3FKI G;  2UUB L;  3CMA A;  4O0A A;  1XNQ L;  3ICE A;  1PYS B;  2KHJ A;  5IWA L;  3VDY A;  3DM3 A;  1B8A A;  4J15 A;  5HY6 A;  3HKS A;  4OWX B;  1N8R C;  4QIW E;  4GOP C;  4JI6 L;  4AH6 A;  1VQG A;  1WCM H;  3CC4 A;  3I4M H;  2VY3 A;  4JI2 Q;  3GTG H;  1Q1E A;  4HJ7 A;  2YV5 A;  3RLF A;  1Y14 B;  4JOI C;  4IFD J;  5K36 G;  4JCV E;  3J80 i;  4DR2 L;  2AWO A;  5C3E G;  3CCV A;  3I56 A;  1VQE A;  2JEB I;  3F2C A;  1VQF A;  1VQJ A;  1PH5 A;  1C9O A;  1A62 A;  1KHI A;  4XIG S;  1LTL A;  2JA6 G;  3NEN A;  1QVG A;  1BBU A;  4A3K G;  2I5L X;  4A3F G;  1Y1V G;  3M9B A;  1Y1W H;  2LSS A;  4GN3 B;  4B3S L;  3UE1 A;  3H3V H;  1B70 B;  3HOW G;  2OTJ A;  3Q8D A;  3PIP A;  4LFA L;  1HR0 L;  2GN5 A;  5LMN L;  1UE6 A;  4OO1 I;  2UUA Q;  3S16 H;  4AQY L;  3W5O A;  3S1M H;  3STB D;  1SMX A;  1CKN A;  2BH8 A;  2NZH A;  3F2D A;  1TWG H;  3DLL A;  2MQH A;  3BU2 A;  5JEA G;  3KDF A;  2VQF L;  1VQ4 A;  2C35 B;  4BA2 I;  1PH7 A;  3PUX A;  4YY3 L;  3TS0 A;  2R93 H;  4YWM A;  4B3R Q;  1YIT A;  2NVT H;  3M7N A;  2A8V A;  4P73 A;  1PH6 A;  4OWT B;  3J7A 5;  2R92 H;  4GS3 A;  1N33 Q;  1Q86 C;  1WI5 A;  4UP8 A;  5LMU L;  4IPC A;  2NN6 I;  1OXV A;  2KBN A;  1O7I A;  4JBW A;  4R4T A;  3PIO A;  3H15 A;  3PF5 A;  1K73 C;  2BA1 A;  2VUM H;  4KHP Q;  2ZJR A;  4DPG A;  2VQE Q;  3HOZ H;  1HZA A;  4UPA A;  4DR6 L;  4LFB L;  4QL5 A;  3U4V A;  3TRE A;  1SR3 A;  3ER0 A;  4DV6 Q;  2WB1 G;  3F8T A;  3I4N H;  5M5W H;  3CPW A;  2UUB Q;  5FJ8 H;  3EIV A;  5IYB H;  1EQQ A;  2CWP A;  2B29 A;  5IWA Q;  1VQ7 A;  1OXT A;  2N78 A;  4DUY Q;  3S1R H;  4JI6 Q;  1K83 H;  3CCE A;  3S1Q H;  3S2H H;  3E9H A;  4NXN L;  2IY5 B;  4JBM A;  3L2P A;  3ULP A;  1WJJ A;  4LUV A;  2UU9 Q;  1XPU A;  2UXB L;  1LM0 A;  2WAQ E;  4QQB X;  5M3F G;  4A3J G;  3NBH B;  2HQL A;  4A3M H;  4HJ5 A;  1IZ6 A;  2BH2 A;  4WJ4 A;  4B3S Q;  4AYB G;  2JA5 G;  1UWV A;  1X54 A;  3E0E A;  1MKH A;  1HR0 Q;  5LMN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...