5AJ3Q

Structure of the small subunit of the mammalian mitoribosome
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
109
structure length
109
Chain Sequence
b'SIARSSVHAKWVVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIIFKVGQVIDPVTGKPCAGTTYLESPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5aj3Q00
3J80i 2JEAI 3HFZB 4RMFA 3GTKH 3CCMA 1WCMG 1NJIC 4LF6Q 3WWVA 2AHOB 4LW1A 3NBHB 4R4IA 2Q2TA 4R4OA 3PF5A 4K0KL 2VW9A 1XMOQ 5C4JH 2LSSA 1K0RA 1Q86C 3S2HH 3T1HQ 1X3FA 2VY3A 2WAQG 4DV5L 1PH7A 1HZ9A 1Q12A 5LMNQ 5ELOA 3U50C 5C0XG 3ULPA 1VQGA 4OO1I 1SLJA 4GN4B 1JT8A 4JCVE 1K73C 1CKMA 3M85A 3CXCA 1XPUA 4QL5A 1L1OC 2K50A 2D0OA 2VQFQ 4HIMA 5BR8Q 5IP7H 4A3EG 3PIOA 4MTNA 1Q1EA 3Q8DA 1SN8A 4PZ8A 1PH9A 3CD6A 4DAYB 2K52A 3BZCA 4LF7Q 4KHPL 3I4NH 1GVPA 1VQJA 1PVOA 3E9IA 1N34Q 4P72A 2VQEQ 3T1YQ 4JI2L 4LFBQ 1K3RA 4GNXC 3E9HA 1BBWA 3HKZE 3HOVH 1Q82C 1CKOA 4BBSH 3PUYA 4IFDG 4XIGS 3H0GG 1IBMQ 3S24A 1HR0Q 2HHHL 2OTJA 1N32L 1JJCB 2WB1G 1GD7A 2KBNA 4OXPA 5LMNW 1KD1C 4BBRG 2F4VQ 4A3CG 3IRBA 2C35B 5IP9H 3KOJA 2JA7H 1J5EL 3ZJYC 4OWXB 4BY1G 3DM3A 4C2MH 1WCMH 2ID0A 4YY3L 1IBLL 2OWOA 5HGQA 1HNZL 1N33L 4GOPA 2KHJA 3GO5A 1B7YB 1I5FA 2JEBI 1MJCA 1X55A 5DLQE 2R92H 5IWAQ 2UUBL 5LMUL 4WJ4A 4DV7Q 3A5UA 1PH4A 4LF8Q 4QQBX 1GO3E 5IYDG 2E2IH 4QIWE 4DV4Q 4LUZA 1N9WA 4R4CA 1PH6A 1DGSA 3TEHB 3RLNA 3J81c 1JMCA 2Q2HA 3UDXA 3M4OH 2ALYB 4X65L 4JI3L 5GADC 3MXNB 4X64Q 5M3FG 4DV0L 3FKIG 4GLXA 4H02A 4A3EH 2NVXH 4C3IH 4JI7Q 3HOUH 3HOYH 4DR3L 2JA6G 4BA2I 2WFWA 4P75A 3DLLA 1IXRA 3F8TA 3UDFA 3J7ZC 1K9MC 4DUZQ 3CMAA 1U5KA 4AYBG 1NY4A 3F2CA 4OWTB 1E1TA 1VQOA 4GKKQ 3I2ZA 4DV2Q 1I50H 3H3VI 4C3JH 1Q1BA 4NPSA 3I56A 1GKHA 2NZOA 2K5HA 2OQKA 1N36L 1QUQA 1XMQL 2JK8A 4BBRH 1KIXA 2LXJA 2MO0A 4A3CH 4DR7L 2FXQA 2R7ZG 4BY7H 2CFMA 4YHHL 3OTOL 3PUXA 2Y0SG 3HOXG 3AQQA 3K81C 1Q7YC 4BY1H 1HNWL 1Z47A 1VQHA 4HJ8A 1VQMA 4A76A 4IPGA 5M3MG 4B3SQ 2R93H 2OQ0A 1TXYA 4B3RQ 4KHZA 4LF6L 3M9BA 1VQ8A 2PI2A 3HOZG 5GAGC 4P74A 1TWAH 3GD7A 4AIMA 2F52A 1XMOL 4JI8Q 4GS3A 5C3EG 3S1QH 1TWGH 5IYDH 5EAYA 3T1HL 1X3EA 4B3TQ 1PHJA 3GTOH 5LMNL 1VQIA 1R9TH 5IYBH 1D7QA 5M3FH 2I5MX 1QVFA 3CQZH 2VZAA 3FKIH 1PH8A 3J80c 1PA6A 2NVTH 4DR4Q 2JA6H 4LF5Q 3CPFA 1Q46A 2EQSA 5GAHC 2VQFL 5BR8L 1SR3A 3J7A5 1VQLA 4A3DH 5IY0A 5AJ3Q 3K7AH 1PH1A 3CCQA 4BXXH 4LF7L 4NXNQ 1Y1VG 2A1AA 3CC2A 3KJPA 4TQUS 1N34L 4LFBL 1A63A 4POGA 1JJ2A 1KXLA 3A74A 2JQOA 2E2JH 3L2PA 1IBML 3CMEA 4PZ7A 3G48A 1XNRQ 2R7ZH 4JI6Q 1X65A 2JE6I 4GOPB 2QEXA 1HR0L 1YHAA 1UE6A 3PUVA 3HOXH 2K75A 2ASBA 1I6HH 2F4VL 2R7DA 4YCVA 1X6OA 4L5QA 1TWFH 1YVCA 2Q2IA 3S1RH 1UE5A 2XGTA 1W3SA 2JA5H 4DK6C 1HZCA 1E7ZA 3PUZA 5IYCG 1XTDA 4A3MG 3HOZH 1YHQA 5IE8A 5C3EH 1KQSA 5J3BA 3S14H 4PMWA 2DGYA 4JYAQ 5IWAL 4J15A 4DV7L 5E7NA 4L5SA 3PIPA 4LF8L 5GAEC 4YCWA 2CQOA 1PH5A 4DV4L 1L1OA 3AYHB 1EIFA 4LWCA 1PH2A 3CAMA 1WFQA 4MZ9A 1VQPA 1SE8A 1YEZA 4DV6Q 1VQEA 3A0JA 4Y52H 4UP7A 2KCTA 3PO2H 4X64L 4P71A 1AE2A 2F3IA 2YU9H 3JAMc 4JV5Q 4JI7L 1BKBA 2HQLA 3H15A 1FL0A 2KENA 1Y1VH 5ELNA 4DR1Q 4GNXA 4A3GG 4AQYQ 1QUQB 1HZBA 2A8VA 3KF6A 3CCRA 4DUZL 4QY7A 5C44G 3S16H 4DV3Q 2QGQA 4R4QA 1FVIA 4GKKL 4RG1A 2UU9Q 3E0EA 1XJVA 2E2HH 4DV2L 4LFAQ 4A3BG 2N8NA 2ES2A 1MJEA 3S17H 2ZTCA 3RLFA 3PSIA 1U0LA 3GTLH 1A0IA 1YJWA 2Z6KA 4IPDA 4B3MQ 2E8GA 1VQ9A 1E22A 2DUDA 4AH6A 3U4VA 1QVGA 1IZ6A 4A3FG 4OX9Q 3G4SA 1VQCA 1CKNA 1HH2P 1EOVA 3RN5A 5IYCH 5JEAJ 4A3MH 4B3SL 1LM0A 3HKZG 4HJ7A 4B3RL 3HOWG 3AFPA 1YJ9A 4JI4Q 1UE7A 2B3GA 4A93G 4C3HH 2GVBA 1QZGA 1EYGA 4XTCS 4JI8L 4DV1Q 3UE1A 4GN3B 3RZOH 1KAWA 1C7YA 1E24A 4B3TL 4JBKA 4Y7NH 4HJ9A 1HR0W 3H3VH 2NVYH 2I5HA 2BH2A 3D0FA 1AE3A 4WJ3M 1AH9A 2HIVA 2UXBQ 3CPWA 4DR4L 4LF5L 4DR2Q 2PNHA 3RZDH 2VS1A 2AWNA 4DK3C 3B6YA 2KCMA 1WI5A 4KLKA 4DR6Q 4A3GH 2ZM6Q 3U4ZA 3K8AA 2N3SA 5AJ3L 3CCSA 4OONA 1L0WA 4A75A 2BA1A 2UXCQ 4X6AH 1HNXQ 2YTXA 2NN6I 2D0PA 3H0GH 3KF8B 2VNUD 2YYZA 4JBWA 2L15A 5JEAG 1VQBA 4A3BH 3GTQH 1FGUA 3M4PA 5M5XH 3PF4A 1IBKQ 1XNRL 1E3PA 4JI6L 4DKAC 4LNQA 1NBWA 1Q8KA 4A3FH 2B63G 4X66L 4JI2Q 3VDYA 1V1QA 2CWPA 3K0XA 1JE5A 2UUAQ 1YJNA 1EWIA 1K83H 2GN5A 1YI2A 4GKJQ 1YBYA 1Y1WG 1L1OB 4A3LG 4UPAA 3GTPH 4QJFA 3HOWH 1UE1A 5FJ8G 2IY5B 3PCOB 4A93H 1VQNA 3BZKA 4PZ6A 5FLMG 5JJKA 4LUOA 4APVA 1SROA 2JA9A 5M5WH 1J5EQ 3S2DH 4JYAL 3GTGH 2H5XA 4A3KG 1X9NA 1VQ4A 2LXKA 4JBJA 1XPOA 1PH3A 4YWKA 1YZ6A 4GNXB 1WYDA 3CF5A 4GLAC 1FJGQ 1N33Q 2OCEA 3EN2A 3NEMA 4HIKA 3KF6B 1B8AA 3FHWA 4EQ5A 3UDIA 4DV6L 1YIJA 3AEVA 1QZHA 1KC8C 4JV5L 3CCVA 4YWLA 3F2BA 2BA0A 4EX5A 1N8RC 1XNQQ 3CC4A 5FLXc 3LGJA 3L7ZC 1S40A 2VQEL 1VQ5A 4AQYL 4JOIC 4IJHA 3T1YL 1RL2A 1EUJA 1G6PA 3W1BA 4DV3L 4JBMA 4IPCA 3S1NH 4JI5Q 1SMXA 3S1MH 1W2BA 2UU9L 2IHEA 1CKNB 4LFAL 1VS0A 2WP8J 4HIDA 5M5YH 4JI0Q 4R1JA 2B63H 3W1GA 2YTVA 5M3MH 1LTLA 2VUMG 3I4MG 1VCIA 3JC66 1OXVA 5K36G 3KJOA 3KDFA 1ASZA 2ZJRA 1PV4A 5C0XJ 2I5LX 4OX9L 1S72A 4O2DA 4X62Q 3STBD 1Y1WH 1GM5A 2WAQE 4A3LH 4NB3A 1JJGA 3OW2A 4BBSG 5FJ8H 1UEBA 3M3YH 5FLMH 2ATWA 4YHHQ 4IJLA 4A3KH 1K8GA 4JI4L 3U58A 3KYHC 4KI0A 4PG3A 1KRSA 4DV1L 4TVAB 3M4QA 2JA7G 2A19A 2NN6G 4DUYQ 3EBEA 1K8AC 2E5LQ 1VQ7A 3GTJH 3AFQA 3F1ZA 3F2DA 2PQAA 4DR5Q 1SRUA 4IFDJ 3K80C 4IOCA 2UXBL 3RLOA 3G71A 1OXUA 1O7IA 3BJUA 4DR2L 3PGZA 4DR6L 2R92G 1NTGA 2ZM6L 1EQQA 2AMCB 1LUZA 3TQYA 2Q2UA 2D62A 3GDEA 1B70B 2UXCL 4L5RC 1HNXL 2NZHA 3A5ZB 2I0QA 2WB1E 1YHBA 4JG2A 4LFCQ 2QA4A 1WJJA 2N78A 1LYLA 4L5TA 2MNAA 3HOYG 3K7UC 5HY6A 3ULJA 4ME3A 1EQRA 1T9HA 1ASYA 2V1CC 2UUCQ 3HOUG 3CCUA 1IBKL 2VUMH 4LF4Q 3I4MH 4IOAA 1NMGA 1JB7A 2IX1A 1I3QH 1X56A 2UXDQ 3RN2A 1PYBA 3PO3G 4LF9Q 1G51A 3FP9A 1OTCA 4A3JG 1NMFA 2UUAL 1YNXA 3CW2C 4JI1Q 2K14A 3I4OA 3STBC 4GKJL 2ZTEA 1A62A 2MO1A 4DPGA 2CKZB 1TWCH 2RHQB 1EIYB 2AWOA 3NENA 1Y14B 1I94Q 1EFWA 4NXMQ 2MFIA 5GQOA 2ZJPA 4BY7G 2HT1A 3M7NA 4UP9A 1OXSC 1XPRA 3GTMH 2RHSB 2Z6KC 4K0KQ 1G291 1M1KC 1FJGL 4B3ML 3JAMi 2CWAA 2IHFA 2R93G 4DV5Q 4GOPC 4LUVA 4AYBE 4YCUA 2CCZA 3ER0A 5C44H 1CUKA 3TS0A 4NXNL 1L2FA 1XNQL 2BH8A 1IL2A 3ULLA 2HIXA 1KL9A 3TS2A 5IYBG 4UY8C 1HZAA 3KDFB 2Y0SE 4JI5L 3TREA 1BBUA 1QVCA 1H95A 1UWVA 1CSPA 1Z9FA 3TRZA 5GROA 4KHPQ 1S3OA 5C0XI 1OXXK 2K5VA 2EIFA 3CP0A 3CC7A 3PUWA 4A3DG 4JI0L 1BVSA 4DAMA 1VQDA 3PO3H 3KLWA 4BXXG 5H1SE 2GVAA 1MKHA 2RF4A 3MEFA 4A3JH 3L0OA 2JA8G 2K4KA 4HJ5A 1KHIA 2JJQA 1C9OA 1PYSB 2HHHQ 1X3GA 2R7FA 4X62L 3CCEA 3RNUA 2RCNA 3G6EA 1OXTA 2B29A 3BU2A 1SFOH 1N32Q 5C4XG 4MNOA 2ZJQA 1V9PA 4DNIA 4R4TA 1V43A 4A4IA 2PQAB 4A3IG 1VQFA 1P8LA 3J81i 1IBLQ 1TWHH 4BA1I 4YY3Q 2NVQH 1PFSA 1HNZQ 3RR5A 2ZTDA 4IFDI 1NE3A 1KRTA 4OO1G 3SGIA 2Z0SA 4DUYL 3EIVA 4JC0A 1C0AA 1J6QA 3UE0A 5IT9c 4GN5A 2E5LL 2JA5G 2UUBQ 5LMUQ 5JJIA 1VQ6A 4DR5L 2IT1A 3KFUA 1E1OA 1P16A 1YITA 5JJLA 4JOIA 2PMZE 4DR1L 3J81j 4YWMA 1M90C 2YV5A 4FDBA 3ICEA 4DV0Q 4X65Q 3D31A 4ALPA 1HJPA 3PV0A 3I55A 4JI3Q 3OYYA 4DR3Q 1Q81C 4IPHA 4IO9A 4LFCL 5IP7G 1A8VA 2K5NA 3I7FA 3PO2G 3W5OA 2UUCL 3UDGA 4HIOA 1WOCA 1VQKA 3I4NG 3ERSX 2R6GA 4LF4L 4GLVB 2JA8H 2IX0A 4P73A 1IYJB 1CSQA 4HJAA 2UXDL 4LF9L 3HOVG 2OTLA 1N36Q 1XMQQ 3CCLA 5C4XH 4O0AA 2KHIA 1RIPA 4DR7Q 4OWWB 1X54A 2XTIA 1MIUA 2MQHA 2VL6A 4JI1L 3OTOQ 4A3IH 3S15H 3HKSA 2PI2E 2EXDA 4POFA 3CCJA 1HNWQ 2YTYA 1D8LA 4QGUA 3NELA 2AKWB 1I94L 5IP9G 4X66Q 1VQAA 2N49A 4UP8A 4NXML
chains in the Genus database with same CATH superfamily
4FYDA 5KYLA 3GTKH 2XWBB 2A6ED 4LF6Q 4PQXA 4LW1A 3NBHB 1TT2A 2XNAC 5TSSA 3AMUA 2CW0C 1KLGD 2NWGA 5C0XG 1EU4A 1SLJA 1O7YA 4GN4B 2CQAA 3N6RA 4ILWA 1CT1D 4QL5A 5IT9E 4HIMA 1LTTD 1Q1EA 3Q8DA 4DU9A 2XVSA 3BZCA 5JJZA 3E9IA 2VQEQ 2H1EA 4C2MB 1WCMB 4GNXC 1Q82C 3L3OC 3VYTA 1IBMQ 3S24A 2OXPA 2RDFA 2NB0A 3ERQA 3IL8A 4C3JG 1D1IA 1DJRD 2R92B 2OTJA 2WAQB 4OXPA 1GD7A 1KD1C 4X3KA 2X69A 2C35B 3IRBA 5IP9H 1HPCA 2JA7H 3ZJYC 1J9OA 4OWXB 1ILQA 1IKLA 3DM3A 4BY1G 5I4DA 1SNDA 4A3EB 1I4HA 1SNQA 4DA2A 4KD3A 5ELEA 1X55A 3DWPA 4DV7Q 4LF8Q 2RCFA 4QIWE 4DV4Q 2K04A 4XQQA 1EQTA 3M4OH 4DV0L 3MXNB 3MEHA 4GLXA 2C9OA 4FP5D 4BA2I 4C3IH 3HOUH 2JA6G 1DD2A 4P75A 3DLLA 3F8TA 4BBRB 1PTOC 3J7ZC 2PZWA 4KK7A 1Y8PB 2EPBA 1U5KA 2F0UA 2D2CC 4GKKQ 2EYFA 5KNCA 2Q8IB 3DWAA 5I2XA 1WD0A 1SDFA 5T1GA 3I56A 2OQKA 4N9TA 1N36L 1S5FD 1TWAB 2VXWA 2FXQA 4YHHL 1K8MA 1E2VA 5IIFA 1Q7YC 1GOZA 3AQQA 3K81C 2KVMA 3NE5B 2N88A 2A6HC 5EPJA 3CQZB 5CV4A 2CH4A 3A7LA 2AQ3B 1B1ZA 3X3MA 2KOLA 5IODA 5FKAC 4A3DB 1SEBD 3GD7A 4BS9A 1XMOL 4JI8Q 5IYDH 5C3EG 1TWGH 2MP1A 1X3EA 2PNRC 3BVZA 4AYBB 1QG7A 1S5ED 1PHJA 2QF7A 4K8JA 1R9TH 1D7QA 2K28A 2Z8LA 3VYRA 3FKIH 2R3ZA 2VZAA 3NHHA 5FOBB 3A56A 1CA5A 4RGMA 3ONAB 2VB3X 5FO8B 1OO9B 3T4AC 2D9UA 5GAHC 1SR3A 3J7A5 4DAPA 3OWEB 3CCQA 4BXXH 1I6HB 3KJPA 4G7OC 1KDAA 3WOEA 5EKIA 1WTPA 3VYSA 1RTNA 4XQJA 4I7AA 2E2JH 3HOZB 3CMEA 3K57A 4O42A 4ABNA 2JN4A 3NTHA 4JI6Q 1X65A 2JE6I 1HR0L 1YHAA 3HOXH 1LTSD 2KEDA 2F4VL 4HEDA 4L5QA 1YVCA 3S1RH 4RWSC 5DAUA 2O2LD 2F0DA 4S3SA 4XYOA 5I9PA 1RJTA 2I07B 3W2DA 1XTDA 4V190 1KDBA 5IWAL 4J15A 4I65A 4L5SA 5GAEC 1PH5A 2CQOA 3SR1A 1L1OA 3S16B 2DY7A 4RA8A 3CAMA 1PH2A 1YEZA 1VQEA 4Y52H 4JV5Q 2KCTA 4X64L 2EY5A 4X3SA 2ZXPA 4TSSA 2K03A 5E1FA 1LABA 3H15A 2B2YA 1CK1A 1FL0A 4IUVA 1I4RA 1Y1VH 2HDLA 4DR1Q 4AQYQ 1QUQB 3MA2B 5JAVA 3CCRA 4DUZL 4QY7A 3TSSA 1AP0A 4R4QA 5JVH3 4ZKBB 3D4RA 4A3BG 2N8NA 2ES2A 1E2ZA 1EIGA 3R2IA 1U0LA 4G4KA 1YJWA 4IPDA 2E8GA 2DUDA 1IZ6A 4A3FG 2EYMA 1VQCA 1ENFA 1Z6HA 1HH2P 2NVYB 4ZRZA 1TVXA 1ZYRD 3HKZG 3RZDB 2B2WC 4K5VA 2EJGC 3P1HA 4K6LA 4R8IA 3RZOH 3J7AF 1SE4A 4QB4A 4G57A 4R9WA 3D0FA 2HIVA 3CPWA 4DR2Q 2AWNA 3VA7A 3I73A 4IZ8A 3K8AA 1EY7A 4DGZA 4ZYSA 4X6AH 1HNXQ 2VNUD 2HQEA 1Y69U 3A8IE 5COYA 1KNEA 1K83B 4HCSA 3M4PA 1B50A 5FK9C 1HFNA 1PFNA 3HOWB 2F3VA 2BCOA 3PF4A 1U4PA 1IBKQ 4X66L 3M4YA 3K0XA 1JE5A 5J22A 1MSHA 5EKKA 1YBYA 3SK6A 3OMGA 1UE1A 3TDQA 5FJ8G 4A93H 1VQNA 3BZKA 4PZ6A 1SROA 5M5WH 1K0SA 3GTGH 4A3KG 1VQ4A 2LXKA 4ZK9B 2KHSA 3EVQA 4JBJA 1XPOA 3EJIA 4YWKA 4CJ1B 2MGSA 4HIKA 1K9MC 1NR4A 4B3MQ 4F7XA 3UDIA 4IUPA 4DV6L 3AEVA 2Y0SB 3F2BA 4EX5A 2EVBA 2CW0D 1XNQQ 5FLXc 2VQEL 1DONA 3I4LA 1K8OA 1SMXA 4KKTA 2UU9L 4HMJA 2E74C 4CDDC 1CKNB 1VS0A 1KTKA 1ESFA 5M5YH 3FPPA 4R1JA 3W1GA 4DK0A 1LTLA 1OXVA 3KDFA 2B8GA 1ASZA 3LNNA 5C0XJ 1GUNA 4X62Q 1Y1WH 2WAQE 2WACA 4ZCKA 1RCVD 4NB3A 1QILA 1EY4A 3M3YH 2ATWA 4IJLA 3IFDA 3U58A 4PG3A 1KAAA 3QJYA 2A19A 3K5OA 2PCFB 2SDFA 4C1NI 1VQ7A 3AFQA 4DR5Q 3BDCA 4UHVA 2UXBL 4IOCA 2NBFA 4HSVA 4CDEC 4N8FA 4XDXA 3I4MB 2R92G 4DR6L 1ILPA 1EQQA 2Q2UA 3BYTB 1GUTA 1RF2D 4L5RC 3I8ZA 3W3AA 2NZHA 1YHBA 3S9WA 1Z7TA 3TN2A 2QA4A 2N78A 3V05A 1LYLA 1DOLA 4L5TA 1AZPA 1PTOD 4LAAA 4ME3A 1T9HA 2V1CC 4IOAA 3CCUA 4JK1C 4LF4Q 3TZUA 4K8IA 1JB7A 1JCKB 1I3QH 1STAA 3GV6A 2UXDQ 3KBGA 3FP9A 4OHJA 1Y8OB 1OTCA 4A3JG 2UUAL 3CW2C 1VMCA 4JI1Q 3I4OA 5KNBA 2CKZB 5FO9B 4K5XA 2Z6BA 5LL6S 2L5TA 1NSNS 2ZJPA 5C3XA 2A6HD 1OXSC 1C48A 1X3QA 3HOYB 4XQNA 3JAMi 3R3OA 4DN4M 2R93G 4AYBE 2CCZA 1WTHA 3HEJA 3PO3B 1NR2A 3ULLA 4H13C 3TS2A 5IYBG 4B08A 1HZAA 1SFOB 4JI5L 4IUNA 2QKIC 1S3OA 1PYWD 5C0XI 2K5VA 1EEFD 3G6JB 2E2DC 1EQVA 4A3DG 4JI0L 1BVSA 1LTID 5H1SE 1A3VA 3L0OA 4OEMB 3TP7A 4DAYA 3VA5A 1C9OA 1PYSB 2JXMB 4WORA 3CCEA 2RCNA 3FRPB 2ZJQA 2HCIA 2CHBD 1V43A 4R4TA 1X32A 4A3IG 1VQFA 1EIHA 2EY1A 2FHTA 4MHEA 3EIVA 1QNKA 1C0AA 1SYBA 4K5WA 2IT1A 1P16A 4Q5VA 4DR1L 3J81j 4YWMA 3PMFA 2YV5A 3MC0B 3E3XA 4DV0Q 1M8AA 1HJPA 4ALPA 3I55A 4H44C 2F0GA 2F03A 4M8AA 4LFCL 2AUJD 2L1BA 3C1FA 3I7FA 4HMIA 4HIOA 1WOCA 1VQKA 3ERSX 2JA8H 5ISRA 1F9RA 1PRTB 4P73A 4G7ZC 3GTKB 1GJXA 4KY7A 1N36Q 1H9SB 1EYDA 1RIPA 1X54A 4R8NA 2PI2E 2EXDA 2ICIA 1R4QB 2OT2A 1S72A 3BZDB 3J80i 1FGBD 2L55A 5FLXL 3CCMA 1NJIC 3A54A 4R4IA 4JVZA 3CU7A 2B2TA 4K0KL 2VW9A 1XMOQ 1Q86C 4RHSA 1T5EA 3MXUA 2VY3A 1PH7A 4CKBA 3VR4A 3U50C 3ULPA 4OO1I 1DXMA 1S5BD 1HFGA 1K73C 3CXCA 1XPUA 3PIO3 2DNEA 2D0OA 1EY6A 3FPUB 5IP7H 2E2HB 1SN8A 2K52A 3RUZA 4LMQD 1GVPA 1VQJA 3I4NH 1LV9A 4HN7A 2A69D 2JA7B 4P72A 3KLRA 1C8CA 5HGTA 1K3RA 1S4ZA 4KJNA 3E9HA 3HOVH 3NXWA 1CKOA 3GV3A 5EQ0A 1A3UA 1HR0Q 1EL0A 2WB1G 2KBNA 4RH6A 5D65A 3CHBD 5E3FA 2F4VQ 3KOJA 3J7AV 5JPMC 3FDTA 1IBLL 2OWOA 2ID0A 4YY3L 3M4OB 4HR7B 4C3IB 3HOUB 1GUWA 1EY5A 1MJCA 5IWAQ 5LMUL 5C0XH 2HD3A 2HCCA 4DK1A 4R4CA 2KECA 3H0GB 2ALYB 4X65L 5M3FG 4X64Q 3HOYH 5EJWA 2WFWA 3VR6A 3UDFA 4DUZQ 2EYHA 2F0LA 5I2YA 3HS0C 2MJ8A 1ZXTA 2WINB 1I50H 4C3JH 1Q1BA 1GKHA 3KBXA 2JK8A 5KGUA 4DR7L 3LWUA 2R7ZG 1TWGB 3PUXA 4UAIA 2Y0SG 4BY1H 1VQHA 4HJ8A 1R9TB 3FKIB 1GHJA 1BBXC 1SSOA 3OSOA 1VQ8A 1LLRD 4EQOA 5I6WA 4JPBW 3T1HL 4KHVA 1H9KA 3GTOH 1BUVT 5LMNL 1VQIA 5IGCA 3J80c 4PNYA 2JA6H 1KLUD 5IOCA 2K7VA 2PW5A 5BR8L 3S1MB 3ND8A 5F2DA 5IY0A 3HOXB 4MTKA 3OW7A 4NXNQ 5IGGA 2M9VA 3J81E 5I6YA 3S1RB 4TQUS 5CV9A 1A63A 1WTVA 4HSPA 1JJ2A 3H09A 3L2PA 1CM9A 4PZ7A 2J4XA 1UE6A 2F0OA 2K75A 3DM1A 2R7DA 4OO1H 2Q2IA 1SJHD 1HZCA 3PUZA 5IYCG 4A3MG 1ESRA 5E4XA 5C3EH 5J3BA 3S14H 1Y1VB 5EPKA 3OOCA 1O7ZA 2F0MA 4C3HG 5JVG3 4ME5A 4LWCA 3F2UA 1VQPA 1SE8A 4F87A 4DV6Q 3A0JA 4P71A 2F3IA 2YU9H 4JI7L 3QOLA 2EE1A 4DNRB 2HQLA 4WJWA 4DXGA 2OEOA 4KY6A 2A5HA 5ELNA 4A3GG 2PYKA 2B2TC 2A8VA 3ND9A 3I72A 2UU9Q 3E0EA 2E2HH 5K5PA 3GTLH 2PW7A 3WDNA 1A0IA 2Z6KA 2J0TD 5FLXE 1VQ9A 2K6AA 3RZOB 1TU2B 3U4VA 1SNPA 2I46A 1TR5A 3D8GA 4ID6A 2J7ZA 2EXZA 4RFBA 3LX0A 5JEAJ 5D14A 1LM0A 2E76C 4B3RL 2B3GA 1EZ8A 1QZGA 1SAPA 1KAWA 1C7YA 1E24A 1PRTC 4B3TL 3QR8A 5IGDA 2EY2A 1AE3A 2RDHA 1AH9A 2UXBQ 4DR4L 2LY7A 2VS1A 3MTSA 2KCMA 1WI5A 3B6YA 4KLKA 3V96A 4DR6Q 3U4ZA 2N3SA 5AJ3L 2BA1A 1MD2D 2Z4IA 2D0PA 3H0GH 4HTHA 1MSGA 3TMEA 1VQBA 4A3BH 1H9MA 3T53B 5M5XH 4A93B 1E3PA 2BDOA 4DKAC 5M5WB 4LNQA 1NBWA 1Q8KA 4A3FH 3GTGB 2B63G 2X6GA 2UUAQ 1YJNA 4GZYC 2GN5A 1L1OB 3T51B 2IY5B 5JJKA 4APVA 5D3DA 3S2DH 1EY8A 2H5XA 1X9NA 1B53A 2LS01 2O5IC 1WYDA 2MHVA 1CI3M 4RGTA 4ULLA 4K14A 4X3TA 4YWLA 2K01A 5M5YB 1U4RA 4IUUA 3LGJA 2XWJB 1S40A 1Q3LA 1RDPD 1QWYA 4NP5A 4CKCA 1RL2A 1Y1WB 3NTIA 4DV3L 1RD9D 3S1NH 4JI5Q 3AB9A 3S1MH 1W2BA 3M3YB 2BE5C 1BCPB 1ENCA 4HIDA 1VF5C 1EFID 3VR2A 4JI0Q 2YTVA 5M3MH 4EQPA 2VUMG 5K36G 1VCIA 2A74C 3MFGA 3MHBA 3SVMA 1GM5A 1CZGA 4MN3A 5FJ8H 3J80L 5J39A 4RHRA 4FVMA 4MIUA 1DYQA 4A3KH 4JI4L 3KYHC 4KI0A 1KRSA 4TVAB 3M4QA 2JA7G 1K8AC 1HHVA 3RLOA 1CHQD 1U4MA 1OXUA 1HRJA 4IUQA 4C56C 1LUZA 2XRSD 1I3QB 4H7BA 2A68C 2UXCL 4JG2A 4LFCQ 4BBSB 5IGBA 5E4WC 4HCEA 2MNAA 3K7UC 5HY6A 3HOUG 3SEBA 1ASYA 5ELDA 3VR3A 1SYGA 3M7GA 2IX1A 1Q8IA 3CKIB 5A2QL 1S5DD 2PZTA 3STBC 2ZTEA 1EIYB 1TWCH 2AWOA 1Y14B 1EFWA 1XYIA 3OPOA 4H0LC 3M7NA 4UP9A 4EQNA 1XPRA 3GTMH 2RHSB 1F9PA 2Z6KC 1UAPA 3EROA 2D5DA 4K0KQ 1G291 3U9SA 1TQOA 2Z9HA 2CWAA 3A8KE 3GQBA 2SEBD 3R93A 2EJFC 4K2KA 4IUTA 1SYEA 5C44H 4KN4C 3TS0A 4NXNL 2F1MA 5CBEE 3K5NA 2HIXA 5CMDA 1STEA 3QG1A 5KYIA 4UY8C 3KDFB 2NTSA 3CRKC 1AZQA 1QJOA 2XIWA 3TREA 3P20A 1DOKA 1CSPA 3BDOA 5GROA 1OXXK 1YNJC 4CDCC 4RGNA 4DAMA 4BXXG 2GVAA 1MKHA 4A3JH 1LTRD 4HJ5A 2F0FA 4QCLA 4CJ0B 1OXTA 5C4XG 4A4IA 1H9JA 1I4GA 1JOQA 1IBLQ 4YY3Q 1EYAA 2L4NA 1PXUA 2Z0SA 4DUYL 4JC0A 5IT9c 5LMUQ 1IYVA 2F0EA 5JJLA 4KKUA 4JOIA 5DM73 5KRUA 5JEAH 3ICEA 2JA8B 4X65Q 3PV0A 2F0KA 5CV5A 1Q81C 5DEHA 1WTWA 1A8VA 2TMPA 3D4DA 3W5OA 1TY0A 3MXPA 3UDGA 2DNCA 4IN3A 2IX0A 3U9OA 1CSQA 3D3RA 4HJAA 1K28A 2OTLA 4XT1B 4DR7Q 1MIUA 2MQHA 3S15H 4A3IH 3HKSA 3NWSA 5C6AA 2YTYA 4QGUA 2B39A 2AKWB 2G9DA 3E6ZX 4UP8A 3O13A 2WKDA 5D3IB 1R4PB 1WCMG 1O78A 3WWVA 1JWMD 2AHOB 2Q2TA 1S5CD 4R4OA 2FFKB 1PTOF 3S2HH 3T1HQ 2WAQG 5EKLA 3I4NB 1Q12A 5LMNQ 5ELOA 1PRTD 4P2CB 3DEOA 1STBA 3HOVB 1STGA 5BN4A 1EWCA 1HTLD 1L1OC 1PFMA 5BR8Q 4CHTB 4A3EG 4MTNA 2BDNA 4PZ8A 4DAYB 1D5MC 4KKSA 2B2YC 3SK8A 1PVOA 2F0QA 5DNFA 4BBSH 1T5XD 4IFDG 1NNXA 3I90A 3J80E 4NMZA 3A55A 1N32L 1JJCB 5LMNW 4BBRG 4A3CG 1LACA 3NQTA 1FNUA 1IKMA 3FMCA 1HNZL 1JOKA 1BF4A 5C5LA 4GOPA 2KEEA 3GO5A 1B7YB 5EBCA 2P5ZX 1I5FA 2A6EC 2JEBI 5DLQE 1BCPC 5IGEA 2LFNA 3OWFA 2E2IH 4LUZA 2PO4A 3C3LA 1DGSA 1RKNA 3TEHB 1JMCA 2Q2HA 1JR0D 5GADC 1I50B 2NVXH 4C3JB 4JI7Q 4F88A 4DXFA 3NK9A 1IXRA 5HURA 2NUCA 1ZEQX 3NUCA 3V2TA 3T16A 4FXGC 4BY1B 4L8JA 4AYBG 3D6CA 4OWTB 1E1TA 4V0BA 2Q8TA 3H3VI 2NZOA 2BE5D 1RTOA 2LXJA 2MO0A 3SDZA 4KY5A 4PV1C 1HA5A 4BY7H 3OTOL 2XN9C 3GTOB 1HNWL 4A76A 4IPGA 1TS2A 2JA6B 1PZID 1TXYA 4B3RQ 3M9BA 4LK1C 3HOZG 2ZT9C 5GAGC 1I4PA 3S1QH 4KD4A 4GS3A 2O5JC 4DAVA 4IURA 4B3TQ 4ZQ3A 3Q23A 1WTQA 3K6OA 5M3FH 2I5MX 1SBBB 1PH8A 1PA6A 2NVTH 4DR4Q 3H6MA 3BS1A 1LO5D 1Q46A 3CPFA 4QMGA 5KNDA 3KK7A 2VQFL 3FEWX 5AJ3Q 3K7AH 2K1BA 1DCZA 4LF7L 2A1AA 3CC2A 1STHA 3E0JA 3Q22A 2A68D 1N34L 4LFBL 4FF1A 1LTBD 2F0IA 1KXLA 3A74A 3H94A 2B2UA 1A3TA 1E2WA 3G48A 2R7ZH 4N9PA 2JSOA 5C3EB 3S14B 3KF8A 2ASBA 1JORA 1B3AA 2DY8A 1X6OA 1TWFH 1V1PA 2XGTA 1DOMA 1W3SA 2XRQD 2JA5H 3D4WA 4CGYB 4DK6C 1E7ZA 2Q8RE 2YU9B 4NDXA 5G3LD 5IE8A 1KQSA 1SYCA 2B2VA 4PMWA 2DGYA 3R8BA 1EWHA 3IAYA 1ICWA 4RCNA 3QO2A 1G8ZD 1WTRA 2IW3A 3PIPA 4YCWA 1J8IA 1LTAD 1EIFA 2RSOA 4MZ9A 3RMHA 3PO2H 1AE2A 3JAMc 2CVRA 5FO7B 3GTLB 4M1UB 3NTKA 2IX3A 2EY6A 4GNXA 1HZBA 1FNVA 2WIIB 3E5SA 3KF6A 4DV3Q 2QGQA 1FVIA 2CH4W 3K5LA 4KTAA 1XJVA 1BQQT 4DV2L 4U673 1NAPA 2RA4A 1MJEA 3S17H 1XWEA 2ZXOA 3RLFA 3PSIA 1CHPD 2EYOA 1E22A 3OMCA 1MBYA 2K5WA 1RHPA 3RN5A 5IYCH 4A3MH 4B3SL 4OELB 2ICEC 5DM63 1HTPA 3HOWG 1QNUA 1JWUD 3AFPA 1YJ9A 4JI4Q 4C3HH 4XTCS 1VF7A 4GN3B 3UE1A 3DHQA 1W6KA 1FYCA 3SXHA 1HR0W 1BNZA 3H3VH 4A3BB 2BH2A 4LF5L 5M5XB 2TSSA 2PNHA 1AFPA 5CV6A 4DK3C 3NWTA 1F77A 4A3GH 2Z4HA 4A3FB 2EYLA 1ONLA 2MPMA 4A75A 2UXCQ 2YTXA 1F2LA 2YYZA 4JBWA 2L0CA 4FF2A 4TKOB 3GTQH 1FGUA 3HKZB 3DEPA 1EY0A 1XNRL 1XXGA 2G9HD 3I70A 2FINB 3S2DB 4K6DA 4JI2Q 4WFN3 1V1QA 1TWHB 2CWPA 2E75C 3SHLA 5CC4A 1VDZA 2F0TA 1YI2A 4FNFA 4A3LG 2LKVA 3GTPH 4QJFA 1WVLA 3PCOB 5FLMG 1QE6A 4LUOA 3A8JE 2ZXRA 2JA9A 1J5EQ 4JYAL 1SMYC 3K0YA 1B9NA 4ZKCB 1N33Q 4GLAC 2OCEA 3EN2A 1YIJA 3S1NB 3FHWA 4EQ5A 3T13A 3CCVA 2BA0A 1N8RC 1MHWC 4HAEA 4IQZA 5M3MB 4IJHA 3RD4A 4CBVA 3L9AX 2F0JA 1G6PA 2KJXA 3W1BA 3H3VC 3HG9A 1GUSA 5L37A 4XYQA 4LFAL 2F4IA 2WP8J 3CRLC 3HRZC 1YNNC 2ENBA 4A3KB 1NUCA 2B63H 3IKJA 3I4MG 3KJOA 4J8QA 1B4OA 3KUPA 2ZJRA 2I5LX 4OX9L 2EJMA 4O2DA 1STNA 3OW2A 1UEBA 2QW7A 3K5MA 4N8X1 3DXJC 1BCPF 1K8GA 2B2UC 4DV1L 2L12A 1A6XA 2NN6G 4DUYQ 5C4ZA 2L11A 1W6JA 3GTJH 3F1ZA 2KQ3A 2PQAA 1SRUA 4F8MA 2K5DA 1BCPD 4IFDJ 2OF1A 2KA7A 3G71A 1UUPA 1O7IA 3IFTA 1PTOH 2ZM6L 1B2TA 1ZKOA 2MUYA 3GDEA 2B2VC 2I0QA 1B44D 3TBIB 3HP3A 3HOYG 1TWCB 3ULJA 1EQRA 3QB3A 2IPKD 2VUMH 5K36H 1G6ZA 5EGTA 1X56A 1PYBA 3PO3G 3GTMB 1G51A 1IW7C 1TKWB 2B2WA 2K14A 3EQLC 3P75A 1KDCA 3R2TA 4GKJL 1A62A 2MO1A 4ZUIA 4DPGA 1WTXA 2RHQB 3NENA 3JAML 5C44B 5A35A 4ZLTF 5GQOA 1SE2A 1JQYD 3T56B 3TP6A 3NPPA 1V1OA 1M1KC 1FJGL 2IHFA 1PLFA 4LUVA 3QIAA 1PMRA 1G2SA 2WKCA 1CUKA 1CZWA 4NW2A 1L2FA 2BH8A 3NBHA 1IL2A 4QUFA 2JP1A 4A3JB 1KL9A 1BBUA 1QVCA 2BOSA 4O1NA 3P7JA 1WTOA 1AEXA 3CP0A 1HUNA 3PUWA 2WV6D 4FF4A 4DFAA 2RF4A 3MEFA 1CTMA 1KHIA 1V8QA 2JJQA 1X3GA 3RNUA 1N32Q 2R93B 3G6EA 4KN7C 3BU2A 3EA6A 4OIJA 1X3PA 4DNIA 4RKLA 3J81i 1TWHH 2NVQH 1CFMA 1HNZQ 1B3QA 1F9QA 1A15A 2F0NA 2ZTDA 3RR5A 4RAUC 1EZ6A 5C5MA 1KRTA 4IFDI 4ZAIA 4OO1G 1EOTA 1J6QA 2E5LL 4GN5A 5JJIA 1VQ6A 1B9MA 3KFUA 1F2MA 1YITA 2N55A 4FDBA 5EPLA 1EEID 1SNCA 3OYYA 4IPHA 5CYUA 4IO9A 2PPBC 3GP7A 1BOSA 1ML0D 3J7YW 1MI2A 2K5NA 3S15B 4A3IB 3TP5A 3NP8A 2UUCL 3MXNA 1ET6A 2R6GA 2NZ1D 4GLVB 2DJFC 1EYCA 2H4OA 1IYJB 1PZJD 4LF9L 4E6IA 1M4VA 1D2BA 3CCLA 5C4XH 4O0AA 2KHIA 4OWWB 2XTIA 5IGFA 3OTOQ 3Q0AA 3S2HB 1PDQA 3CCJA 5CV8A 1HNWQ 1I94L 5IP9G 1VQAA 2N49A 3TQYA 1QZHA 4NXML 3KLSA 3DUZA 2JEAI 3HFZB 4RMFA 1TS3A 1CA6A 3PQIA 3PF5A 4G7HC 3NBIA 5C4JH 2LSSA 1K0RA 1L0XB 3DWQA 1X3FA 4DV5L 1HZ9A 1VQGA 3PIP3 1JT8A 3C46A 2VB2X 4JCVE 2PQEA 5AFWA 3UI2A 1CKMA 3M85A 2K50A 2VQFQ 3OHXC 3PIOA 3H91A 4B9XA 4C3IG 1PH9A 3CD6A 1IL8A 4LF7Q 1A2TA 4KHPL 1IHZA 2EOTA 1N34Q 4JI2L 4LFBQ 3T1YQ 1BBWA 3HKZE 2NYZD 2HUGA 3PUYA 3KLSX 4XIGS 3H0GG 3MFYA 1CQVA 1NCVA 1UEAB 2HHHL 3URYA 1SYFA 5NUCA 2E2IB 3BG3A 1J5EL 1FR3A 5ELBA 4FXKC 5J1ZA 4C2MH 4CKEA 1WCMH 1G2TA 2QILA 2RBMA 5HGQA 4Y7NB 1N33L 2NVXB 4KMUC 2DN8A 2KHJA 1TS4A 1JE4A 1GXDC 2K05A 4OL7A 5C4HA 2R92H 1EY9A 4I7ZC 2UUBL 3N52A 4WRDA 5I9OA 2Z1CA 3A5UA 1PH4A 4QQBX 1GO3E 5IYDG 1SMYD 1N9WA 5C3WA 1PH6A 3RLNA 3J81c 3UDXA 4JI3L 1JWSD 4A3EH 3FKIG 4H02A 4DR3L 2WB1B 1SJED 4YIJA 4BY7B 3CMAA 1GUOA 2KCCA 1QCBD 2IWHA 1NY4A 5BN3A 3F2CA 2A69C 2FMCA 4IFDH 1VQOA 3I2ZA 4DV2Q 4L63B 4NPSA 2K5HA 2R61A 1QUQA 4RCOA 1XMQL 3JAME 4BBRH 1KIXA 3A7AB 1YNND 4A3CH 3S1QB 2A73B 2CFMA 3HOXG 3BYYB 1Z47A 5M3FB 1VQMA 1FD7D 3LWEA 5M3MG 4B3SQ 2NVTB 2R93H 2OQ0A 4KHZA 4LF6L 2EZVA 2PI2A 4P74A 1SNOA 1TWAH 4AIMA 2F52A 5CBAE 3K7AB 3X3NA 5EAYA 5IYBH 1QVFA 1I6VC 1KABA 3CQZH 1BDOA 4L6TB 4LF5Q 2EQSA 2R7ZB 1LTGD 1RODA 1VQLA 4A3DH 4PMBA 1ENAA 1PH1A 5ELCA 1JC7A 1PZKD 1Y1VG 1TWFB 3VR5A 1AN8A 2JA5B 3Q24A 3G7LA 4POGA 3TP8A 2JQOA 3NQIA 1IBML 1XNRQ 1WD1A 4GOPB 2QEXA 1F9SA 3PUVA 1D5XC 2QDBA 2F0VA 1I6HH 1HCZA 1TY2A 4YCVA 1PRTF 3NSWA 1UE5A 1IW7D 2M00A 5CV7A 5ELFA 3PO2B 2EYPA 3BVMA 3HOZH 3MVVA 1YHQA 2QDLA 2QEJC 1HA6A 4JYAQ 2V4DA 1D6EC 4DV7L 5E7NA 3BVGA 1JB3A 4LF8L 4UDUC 2PMZB 4DV4L 1I4QA 3AYHB 1WFQA 2XSCA 4UP7A 4QUCA 3S17B 2F0WA 1BKBA 3DMUA 3BDLA 2KENA 2PZUA 2IJ0A 5C44G 3S16H 3QOJA 1FNWA 4A3MB 4RG1A 4GKKL 4LFAQ 2KUMA 4Z9CB 2ZTCA 1LT4D 2F3WA 4C3HB 4FO2A 4EGVA 3K59A 1HUMA 1TS5A 4AH6A 1QVGA 4OX9Q 1D5ZC 4KJOA 3G4SA 1CKNA 2FMMA 3I3CA 4EVOA 1EOVA 4FF3A 1IYUA 3K58A 3WOFA 5M9OA 4LJZC 4HJ7A 1LT5D 3SK4A 4A3GB 1UE7A 4A93G 2X6LA 2GVBA 1EYGA 4TRDA 4JI8L 4K2LA 4DV1Q 1U4LA 4JBKA 4Y7NH 1F2YA 4DNTB 4HJ9A 5BN5A 2NVYH 2I5HA 3GTQB 4WJ3M 4ODGA 3HZXA 1HQMC 3RZDH 1HXYD 2ZM6Q 2K33A 4OGQC 2K5QA 3CCSA 4OONA 1L0WA 5A2QE 2NN6I 3KF8B 2AQ1B 2L15A 3MWYW 3OIPA 4U68A 5JEAG 1MGSA 2RVLA 1V1PB 3GTPB 2L9HA 4RGOS 4JI6L 2AUKA 5JOBA 3C2PA 3VDYA 2EDGA 1EWIA 1K83H 4GKJQ 3J81L 1Y1WG 1JOOA 4UPAA 3HOWH 2JYOA 2M2LA 2NTTA 4J6HA 2QCPX 4X3UA 2LMCB 2IL8A 3I91A 1CQFA 4QIWB 1PH3A 1YZ6A 4GNXB 4BWGB 3CF5A 1FJGQ 4WJ4A 3NEMA 2GA4B 3KF6B 1B8AA 1BO0A 4Q0FA 1LT6D 1KC8C 4JV5L 4XT3B 5KEEA 3CC4A 2B63B 3L7ZC 4AQYL 4JOIC 3T1YL 3D6WA 1EUJA 4JBMA 4IPCA 5CR3A 1GUGA 5IT9L 2IHEA 5G3LF 4RKBA 4JW0A 2RDGA 3SK5A 5KIXA 3JC66 3MXGA 2KCNA 2SNSA 1PV4A 3STBD 3GTJB 4A3LH 3Q6SA 4CDFC 1JJGA 5LL6X 4BBSG 3AU7A 1AW7A 1XX8A 5FLMH 1PTOB 4YHHQ 4FXDA 2RKSA 3TZDA 1TIID 2RQXA 5CORA 2HDMA 3EFXD 3EBEA 3VYUA 2E5LQ 3F2DA 2RSNA 3FVQA 3K80C 5LHY1 2F0HA 3QWNA 2DJGC 3BJUA 4DR2L 3PGZA 2VUMB 3ZYYX 1NTGA 2AMCB 3ITPA 1D1KA 2D62A 5T1IA 1BXTA 1B70B 3SE0A 1HNXL 3A5ZB 2WB1E 1UNSA 1WJJA 1YNJD 2UUCQ 1SNMA 1IBKL 3I4MH 4DF7A 1NMGA 2FJ2A 3RN2A 1ICFB 4LF9Q 1K3BC 1NMFA 1SE3A 1YNXA 1VMPA 1I94Q 1O80A 4NXMQ 2MFIA 2SNMA 1I4XA 1H9SA 2B8FA 2NN6H 4BY7G 2HT1A 2AQ2B 4QF4A 4CJ2C 3HGBA 2SOBA 4OIKA 1C4QA 4B3ML 4DV5Q 4GOPC 1HQRD 4XXEA 4YCUA 1QB5D 3ER0A 1XNQL 1EU3A 1SYDA 5JPNC 1BR9A 1II3A 2Y0SE 1DZ1A 1H95A 1UWVA 4KHPQ 1Z9FA 3TRZA 2C5CA 2EIFA 3CC7A 2NVQB 4IALA 2EYJA 4PMCA 1VQDA 3PO3H 3KLWA 2JA8G 4KV6A 2K4KA 1XTCD 2HHHQ 4X62L 2R7FA 1SFOH 2B29A 1E0BA 3MZ5A 1ZYRC 4MNOA 1SXTA 2G5DA 1V9PA 1Q90A 2PQAB 1DM0B 1U9RA 1P8LA 3OIQA 4BA1I 1PFSA 1ET9A 1NE3A 3SGIA 3UE0A 2JA5G 3C1EA 5CGKA 2UUBQ 1LT3D 1PFBA 4DR5L 2F0PA 1E1OA 2F0SA 4B9WA 1H9RA 2PMZE 2O4XA 1GHKA 1M90C 1JICA 1L0YB 3D31A 4JI3Q 4C1NK 4DR3Q 5C4XB 1Y8NB 2E2JB 5IP7G 3PO2G 1A2UA 1KNAA 4J1MA 3I4NG 3MAQA 4LF4L 4ZUJA 1QOHA 5EBDA 2UXDL 3HOVG 1XMQQ 1STYA 1G91A 4NKLA 5C4JB 4JI1L 2VL6A 1O7LA 2K32A 4POFA 1D8LA 3NELA 1VQ5A 4X66Q 1F2ZA
chains in the Genus database with same CATH topology
3J80i 2JEAI 3HFZB 4RMFA 3GTKH 3CCMA 1WCMG 1NJIC 4LF6Q 3WWVA 2AHOB 4LW1A 3NBHB 4R4IA 2Q2TA 4R4OA 3PF5A 4K0KL 2VW9A 1XMOQ 5C4JH 2LSSA 1K0RA 1Q86C 3S2HH 3T1HQ 1X3FA 2VY3A 2WAQG 4DV5L 1PH7A 1HZ9A 1Q12A 5LMNQ 5ELOA 3U50C 5C0XG 3ULPA 1VQGA 4OO1I 1SLJA 4GN4B 1JT8A 4JCVE 1K73C 1CKMA 3M85A 3CXCA 1XPUA 4QL5A 1L1OC 2K50A 2D0OA 2VQFQ 4HIMA 5BR8Q 5IP7H 4A3EG 3PIOA 4MTNA 1Q1EA 3Q8DA 1SN8A 4PZ8A 1PH9A 3CD6A 4DAYB 2K52A 3BZCA 4LF7Q 4KHPL 3I4NH 1GVPA 1VQJA 1PVOA 3E9IA 1N34Q 4P72A 2VQEQ 3T1YQ 4JI2L 4LFBQ 1K3RA 4GNXC 3E9HA 1BBWA 3HKZE 3HOVH 1Q82C 1CKOA 4BBSH 3PUYA 4IFDG 4XIGS 3H0GG 1IBMQ 3S24A 1HR0Q 2HHHL 2OTJA 1N32L 1JJCB 2WB1G 1GD7A 2KBNA 4OXPA 5LMNW 1KD1C 4BBRG 2F4VQ 4A3CG 3IRBA 2C35B 5IP9H 3KOJA 2JA7H 1J5EL 3ZJYC 4OWXB 4BY1G 3DM3A 4C2MH 1WCMH 2ID0A 4YY3L 1IBLL 2OWOA 5HGQA 1HNZL 1N33L 4GOPA 2KHJA 3GO5A 1B7YB 1I5FA 2JEBI 1MJCA 1X55A 5DLQE 2R92H 5IWAQ 2UUBL 5LMUL 4WJ4A 4DV7Q 3A5UA 1PH4A 4LF8Q 4QQBX 1GO3E 5IYDG 2E2IH 4QIWE 4DV4Q 4LUZA 1N9WA 4R4CA 1PH6A 1DGSA 3TEHB 3RLNA 3J81c 1JMCA 2Q2HA 3UDXA 3M4OH 2ALYB 4X65L 4JI3L 5GADC 3MXNB 4X64Q 5M3FG 4DV0L 3FKIG 4GLXA 4H02A 4A3EH 2NVXH 4C3IH 4JI7Q 3HOUH 3HOYH 4DR3L 2JA6G 4BA2I 2WFWA 4P75A 3DLLA 1IXRA 3F8TA 3UDFA 3J7ZC 1K9MC 4DUZQ 3CMAA 1U5KA 4AYBG 1NY4A 3F2CA 4OWTB 1E1TA 1VQOA 4GKKQ 3I2ZA 4DV2Q 1I50H 3H3VI 4C3JH 1Q1BA 4NPSA 3I56A 1GKHA 2NZOA 2K5HA 2OQKA 1N36L 1QUQA 1XMQL 2JK8A 4BBRH 1KIXA 2LXJA 2MO0A 4A3CH 4DR7L 2FXQA 2R7ZG 4BY7H 2CFMA 4YHHL 3OTOL 3PUXA 2Y0SG 3HOXG 3AQQA 3K81C 1Q7YC 4BY1H 1HNWL 1Z47A 1VQHA 4HJ8A 1VQMA 4A76A 4IPGA 5M3MG 4B3SQ 2R93H 2OQ0A 1TXYA 4B3RQ 4KHZA 4LF6L 3M9BA 1VQ8A 2PI2A 3HOZG 5GAGC 4P74A 1TWAH 3GD7A 4AIMA 2F52A 1XMOL 4JI8Q 4GS3A 5C3EG 3S1QH 1TWGH 5IYDH 5EAYA 3T1HL 1X3EA 4B3TQ 1PHJA 3GTOH 5LMNL 1VQIA 1R9TH 5IYBH 1D7QA 5M3FH 2I5MX 1QVFA 3CQZH 2VZAA 3FKIH 1PH8A 3J80c 1PA6A 2NVTH 4DR4Q 2JA6H 4LF5Q 3CPFA 1Q46A 2EQSA 5GAHC 2VQFL 5BR8L 1SR3A 3J7A5 1VQLA 4A3DH 5IY0A 5AJ3Q 3K7AH 1PH1A 3CCQA 4BXXH 4LF7L 4NXNQ 1Y1VG 2A1AA 3CC2A 3KJPA 4TQUS 1N34L 4LFBL 1A63A 4POGA 1JJ2A 1KXLA 3A74A 2JQOA 2E2JH 3L2PA 1IBML 3CMEA 4PZ7A 3G48A 1XNRQ 2R7ZH 4JI6Q 1X65A 2JE6I 4GOPB 2QEXA 1HR0L 1YHAA 1UE6A 3PUVA 3HOXH 2K75A 2ASBA 1I6HH 2F4VL 2R7DA 4YCVA 1X6OA 4L5QA 1TWFH 1YVCA 2Q2IA 3S1RH 1UE5A 2XGTA 1W3SA 2JA5H 4DK6C 1HZCA 1E7ZA 3PUZA 5IYCG 1XTDA 4A3MG 3HOZH 1YHQA 5IE8A 5C3EH 1KQSA 5J3BA 3S14H 4PMWA 2DGYA 4JYAQ 5IWAL 4J15A 4DV7L 5E7NA 4L5SA 3PIPA 4LF8L 5GAEC 4YCWA 2CQOA 1PH5A 4DV4L 1L1OA 3AYHB 1EIFA 4LWCA 1PH2A 3CAMA 1WFQA 4MZ9A 1VQPA 1SE8A 1YEZA 4DV6Q 1VQEA 3A0JA 4Y52H 4UP7A 2KCTA 3PO2H 4X64L 4P71A 1AE2A 2F3IA 2YU9H 3JAMc 4JV5Q 4JI7L 1BKBA 2HQLA 3H15A 1FL0A 2KENA 1Y1VH 5ELNA 4DR1Q 4GNXA 4A3GG 4AQYQ 1QUQB 1HZBA 2A8VA 3KF6A 3CCRA 4DUZL 4QY7A 5C44G 3S16H 4DV3Q 2QGQA 4R4QA 1FVIA 4GKKL 4RG1A 2UU9Q 3E0EA 1XJVA 2E2HH 4DV2L 4LFAQ 4A3BG 2N8NA 2ES2A 1MJEA 3S17H 2ZTCA 3RLFA 3PSIA 1U0LA 3GTLH 1A0IA 1YJWA 2Z6KA 4IPDA 4B3MQ 2E8GA 1VQ9A 1E22A 2DUDA 4AH6A 3U4VA 1QVGA 1IZ6A 4A3FG 4OX9Q 3G4SA 1VQCA 1CKNA 1HH2P 1EOVA 3RN5A 5IYCH 5JEAJ 4A3MH 4B3SL 1LM0A 3HKZG 4HJ7A 4B3RL 3HOWG 3AFPA 1YJ9A 4JI4Q 1UE7A 2B3GA 4A93G 4C3HH 2GVBA 1QZGA 1EYGA 4XTCS 4JI8L 4DV1Q 3UE1A 4GN3B 3RZOH 1KAWA 1C7YA 1E24A 4B3TL 4JBKA 4Y7NH 4HJ9A 1HR0W 3H3VH 2NVYH 2I5HA 2BH2A 3D0FA 1AE3A 4WJ3M 1AH9A 2HIVA 2UXBQ 3CPWA 4DR4L 4LF5L 4DR2Q 2PNHA 3RZDH 2VS1A 2AWNA 4DK3C 3B6YA 2KCMA 1WI5A 4KLKA 4DR6Q 4A3GH 2ZM6Q 3U4ZA 3K8AA 2N3SA 5AJ3L 3CCSA 4OONA 1L0WA 4A75A 2BA1A 2UXCQ 4X6AH 1HNXQ 2YTXA 2NN6I 2D0PA 3H0GH 3KF8B 2VNUD 2YYZA 4JBWA 2L15A 5JEAG 1VQBA 4A3BH 3GTQH 1FGUA 3M4PA 5M5XH 3PF4A 1IBKQ 1XNRL 1E3PA 4JI6L 4DKAC 4LNQA 1NBWA 1Q8KA 4A3FH 2B63G 4X66L 4JI2Q 3VDYA 1V1QA 2CWPA 3K0XA 1JE5A 2UUAQ 1YJNA 1EWIA 1K83H 2GN5A 1YI2A 4GKJQ 1YBYA 1Y1WG 1L1OB 4A3LG 4UPAA 3GTPH 4QJFA 3HOWH 1UE1A 5FJ8G 2IY5B 3PCOB 4A93H 1VQNA 3BZKA 4PZ6A 5FLMG 5JJKA 4LUOA 4APVA 1SROA 2JA9A 5M5WH 1J5EQ 3S2DH 4JYAL 3GTGH 2H5XA 4A3KG 1X9NA 1VQ4A 2LXKA 4JBJA 1XPOA 1PH3A 4YWKA 1YZ6A 4GNXB 1WYDA 3CF5A 4GLAC 1FJGQ 1N33Q 2OCEA 3EN2A 3NEMA 4HIKA 3KF6B 1B8AA 3FHWA 4EQ5A 3UDIA 4DV6L 1YIJA 3AEVA 1QZHA 1KC8C 4JV5L 3CCVA 4YWLA 3F2BA 2BA0A 4EX5A 1N8RC 1XNQQ 3CC4A 5FLXc 3LGJA 3L7ZC 1S40A 2VQEL 1VQ5A 4AQYL 4JOIC 4IJHA 3T1YL 1RL2A 1EUJA 1G6PA 3W1BA 4DV3L 4JBMA 4IPCA 3S1NH 4JI5Q 1SMXA 3S1MH 1W2BA 2UU9L 2IHEA 1CKNB 4LFAL 1VS0A 2WP8J 4HIDA 5M5YH 4JI0Q 4R1JA 2B63H 3W1GA 2YTVA 5M3MH 1LTLA 2VUMG 3I4MG 1VCIA 3JC66 1OXVA 5K36G 3KJOA 3KDFA 1ASZA 2ZJRA 1PV4A 5C0XJ 2I5LX 4OX9L 1S72A 4O2DA 4X62Q 3STBD 1Y1WH 1GM5A 2WAQE 4A3LH 4NB3A 1JJGA 3OW2A 4BBSG 5FJ8H 1UEBA 3M3YH 5FLMH 2ATWA 4YHHQ 4IJLA 4A3KH 1K8GA 4JI4L 3U58A 3KYHC 4KI0A 4PG3A 1KRSA 4DV1L 4TVAB 3M4QA 2JA7G 2A19A 2NN6G 4DUYQ 3EBEA 1K8AC 2E5LQ 1VQ7A 3GTJH 3AFQA 3F1ZA 3F2DA 2PQAA 4DR5Q 1SRUA 4IFDJ 3K80C 4IOCA 2UXBL 3RLOA 3G71A 1OXUA 1O7IA 3BJUA 4DR2L 3PGZA 4DR6L 2R92G 1NTGA 2ZM6L 1EQQA 2AMCB 1LUZA 3TQYA 2Q2UA 2D62A 3GDEA 1B70B 2UXCL 4L5RC 1HNXL 2NZHA 3A5ZB 2I0QA 2WB1E 1YHBA 4JG2A 4LFCQ 2QA4A 1WJJA 2N78A 1LYLA 4L5TA 2MNAA 3HOYG 3K7UC 5HY6A 3ULJA 4ME3A 1EQRA 1T9HA 1ASYA 2V1CC 2UUCQ 3HOUG 3CCUA 1IBKL 2VUMH 4LF4Q 3I4MH 4IOAA 1NMGA 1JB7A 2IX1A 1I3QH 1X56A 2UXDQ 3RN2A 1PYBA 3PO3G 4LF9Q 1G51A 3FP9A 1OTCA 4A3JG 1NMFA 2UUAL 1YNXA 3CW2C 4JI1Q 2K14A 3I4OA 3STBC 4GKJL 2ZTEA 1A62A 2MO1A 4DPGA 2CKZB 1TWCH 2RHQB 1EIYB 2AWOA 3NENA 1Y14B 1I94Q 1EFWA 4NXMQ 2MFIA 5GQOA 2ZJPA 4BY7G 2HT1A 3M7NA 4UP9A 1OXSC 1XPRA 3GTMH 2RHSB 2Z6KC 4K0KQ 1G291 1M1KC 1FJGL 4B3ML 3JAMi 2CWAA 2IHFA 2R93G 4DV5Q 4GOPC 4LUVA 4AYBE 4YCUA 2CCZA 3ER0A 5C44H 1CUKA 3TS0A 4NXNL 1L2FA 1XNQL 2BH8A 1IL2A 3ULLA 2HIXA 1KL9A 3TS2A 5IYBG 4UY8C 1HZAA 3KDFB 2Y0SE 4JI5L 3TREA 1BBUA 1QVCA 1H95A 1UWVA 1CSPA 1Z9FA 3TRZA 5GROA 4KHPQ 1S3OA 5C0XI 1OXXK 2K5VA 2EIFA 3CP0A 3CC7A 3PUWA 4A3DG 4JI0L 1BVSA 4DAMA 1VQDA 3PO3H 3KLWA 4BXXG 5H1SE 2GVAA 1MKHA 2RF4A 3MEFA 4A3JH 3L0OA 2JA8G 2K4KA 4HJ5A 1KHIA 2JJQA 1C9OA 1PYSB 2HHHQ 1X3GA 2R7FA 4X62L 3CCEA 3RNUA 2RCNA 3G6EA 1OXTA 2B29A 3BU2A 1SFOH 1N32Q 5C4XG 4MNOA 2ZJQA 1V9PA 4DNIA 4R4TA 1V43A 4A4IA 2PQAB 4A3IG 1VQFA 1P8LA 3J81i 1IBLQ 1TWHH 4BA1I 4YY3Q 2NVQH 1PFSA 1HNZQ 3RR5A 2ZTDA 4IFDI 1NE3A 1KRTA 4OO1G 3SGIA 2Z0SA 4DUYL 3EIVA 4JC0A 1C0AA 1J6QA 3UE0A 5IT9c 4GN5A 2E5LL 2JA5G 2UUBQ 5LMUQ 5JJIA 1VQ6A 4DR5L 2IT1A 3KFUA 1E1OA 1P16A 1YITA 5JJLA 4JOIA 2PMZE 4DR1L 3J81j 4YWMA 1M90C 2YV5A 4FDBA 3ICEA 4DV0Q 4X65Q 3D31A 4ALPA 1HJPA 3PV0A 3I55A 4JI3Q 3OYYA 4DR3Q 1Q81C 4IPHA 4IO9A 4LFCL 5IP7G 1A8VA 2K5NA 3I7FA 3PO2G 3W5OA 2UUCL 3UDGA 4HIOA 1WOCA 1VQKA 3I4NG 3ERSX 2R6GA 4LF4L 4GLVB 2JA8H 2IX0A 4P73A 1IYJB 1CSQA 4HJAA 2UXDL 4LF9L 3HOVG 2OTLA 1N36Q 1XMQQ 3CCLA 5C4XH 4O0AA 2KHIA 1RIPA 4DR7Q 4OWWB 1X54A 2XTIA 1MIUA 2MQHA 2VL6A 4JI1L 3OTOQ 4A3IH 3S15H 3HKSA 2PI2E 2EXDA 4POFA 3CCJA 1HNWQ 2YTYA 1D8LA 4QGUA 3NELA 2AKWB 1I94L 5IP9G 4X66Q 1VQAA 2N49A 4UP8A 4NXML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 i;  2JEA I;  3HFZ B;  4RMF A;  3GTK H;  3CCM A;  1WCM G;  1NJI C;  4LF6 Q;  3WWV A;  2AHO B;  4LW1 A;  3NBH B;  4R4I A;  2Q2T A;  4R4O A;  3PF5 A;  4K0K L;  2VW9 A;  1XMO Q;  5C4J H;  2LSS A;  1K0R A;  1Q86 C;  3S2H H;  3T1H Q;  1X3F A;  2VY3 A;  2WAQ G;  4DV5 L;  1PH7 A;  1HZ9 A;  1Q12 A;  5LMN Q;  5ELO A;  3U50 C;  5C0X G;  3ULP A;  1VQG A;  4OO1 I;  1SLJ A;  4GN4 B;  1JT8 A;  4JCV E;  1K73 C;  1CKM A;  3M85 A;  3CXC A;  1XPU A;  4QL5 A;  1L1O C;  2K50 A;  2D0O A;  2VQF Q;  4HIM A;  5BR8 Q;  5IP7 H;  4A3E G;  3PIO A;  4MTN A;  1Q1E A;  3Q8D A;  1SN8 A;  4PZ8 A;  1PH9 A;  3CD6 A;  4DAY B;  2K52 A;  3BZC A;  4LF7 Q;  4KHP L;  3I4N H;  1GVP A;  1VQJ A;  1PVO A;  3E9I A;  1N34 Q;  4P72 A;  2VQE Q;  3T1Y Q;  4JI2 L;  4LFB Q;  1K3R A;  4GNX C;  3E9H A;  1BBW A;  3HKZ E;  3HOV H;  1Q82 C;  1CKO A;  4BBS H;  3PUY A;  4IFD G;  4XIG S;  3H0G G;  1IBM Q;  3S24 A;  1HR0 Q;  2HHH L;  2OTJ A;  1N32 L;  1JJC B;  2WB1 G;  1GD7 A;  2KBN A;  4OXP A;  5LMN W;  1KD1 C;  4BBR G;  2F4V Q;  4A3C G;  3IRB A;  2C35 B;  5IP9 H;  3KOJ A;  2JA7 H;  1J5E L;  3ZJY C;  4OWX B;  4BY1 G;  3DM3 A;  4C2M H;  1WCM H;  2ID0 A;  4YY3 L;  1IBL L;  2OWO A;  5HGQ A;  1HNZ L;  1N33 L;  4GOP A;  2KHJ A;  3GO5 A;  1B7Y B;  1I5F A;  2JEB I;  1MJC A;  1X55 A;  5DLQ E;  2R92 H;  5IWA Q;  2UUB L;  5LMU L;  4WJ4 A;  4DV7 Q;  3A5U A;  1PH4 A;  4LF8 Q;  4QQB X;  1GO3 E;  5IYD G;  2E2I H;  4QIW E;  4DV4 Q;  4LUZ A;  1N9W A;  4R4C A;  1PH6 A;  1DGS A;  3TEH B;  3RLN A;  3J81 c;  1JMC A;  2Q2H A;  3UDX A;  3M4O H;  2ALY B;  4X65 L;  4JI3 L;  5GAD C;  3MXN B;  4X64 Q;  5M3F G;  4DV0 L;  3FKI G;  4GLX A;  4H02 A;  4A3E H;  2NVX H;  4C3I H;  4JI7 Q;  3HOU H;  3HOY H;  4DR3 L;  2JA6 G;  4BA2 I;  2WFW A;  4P75 A;  3DLL A;  1IXR A;  3F8T A;  3UDF A;  3J7Z C;  1K9M C;  4DUZ Q;  3CMA A;  1U5K A;  4AYB G;  1NY4 A;  3F2C A;  4OWT B;  1E1T A;  1VQO A;  4GKK Q;  3I2Z A;  4DV2 Q;  1I50 H;  3H3V I;  4C3J H;  1Q1B A;  4NPS A;  3I56 A;  1GKH A;  2NZO A;  2K5H A;  2OQK A;  1N36 L;  1QUQ A;  1XMQ L;  2JK8 A;  4BBR H;  1KIX A;  2LXJ A;  2MO0 A;  4A3C H;  4DR7 L;  2FXQ A;  2R7Z G;  4BY7 H;  2CFM A;  4YHH L;  3OTO L;  3PUX A;  2Y0S G;  3HOX G;  3AQQ A;  3K81 C;  1Q7Y C;  4BY1 H;  1HNW L;  1Z47 A;  1VQH A;  4HJ8 A;  1VQM A;  4A76 A;  4IPG A;  5M3M G;  4B3S Q;  2R93 H;  2OQ0 A;  1TXY A;  4B3R Q;  4KHZ A;  4LF6 L;  3M9B A;  1VQ8 A;  2PI2 A;  3HOZ G;  5GAG C;  4P74 A;  1TWA H;  3GD7 A;  4AIM A;  2F52 A;  1XMO L;  4JI8 Q;  4GS3 A;  5C3E G;  3S1Q H;  1TWG H;  5IYD H;  5EAY A;  3T1H L;  1X3E A;  4B3T Q;  1PHJ A;  3GTO H;  5LMN L;  1VQI A;  1R9T H;  5IYB H;  1D7Q A;  5M3F H;  2I5M X;  1QVF A;  3CQZ H;  2VZA A;  3FKI H;  1PH8 A;  3J80 c;  1PA6 A;  2NVT H;  4DR4 Q;  2JA6 H;  4LF5 Q;  3CPF A;  1Q46 A;  2EQS A;  5GAH C;  2VQF L;  5BR8 L;  1SR3 A;  3J7A 5;  1VQL A;  4A3D H;  5IY0 A;  5AJ3 Q;  3K7A H;  1PH1 A;  3CCQ A;  4BXX H;  4LF7 L;  4NXN Q;  1Y1V G;  2A1A A;  3CC2 A;  3KJP A;  4TQU S;  1N34 L;  4LFB L;  1A63 A;  4POG A;  1JJ2 A;  1KXL A;  3A74 A;  2JQO A;  2E2J H;  3L2P A;  1IBM L;  3CME A;  4PZ7 A;  3G48 A;  1XNR Q;  2R7Z H;  4JI6 Q;  1X65 A;  2JE6 I;  4GOP B;  2QEX A;  1HR0 L;  1YHA A;  1UE6 A;  3PUV A;  3HOX H;  2K75 A;  2ASB A;  1I6H H;  2F4V L;  2R7D A;  4YCV A;  1X6O A;  4L5Q A;  1TWF H;  1YVC A;  2Q2I A;  3S1R H;  1UE5 A;  2XGT A;  1W3S A;  2JA5 H;  4DK6 C;  1HZC A;  1E7Z A;  3PUZ A;  5IYC G;  1XTD A;  4A3M G;  3HOZ H;  1YHQ A;  5IE8 A;  5C3E H;  1KQS A;  5J3B A;  3S14 H;  4PMW A;  2DGY A;  4JYA Q;  5IWA L;  4J15 A;  4DV7 L;  5E7N A;  4L5S A;  3PIP A;  4LF8 L;  5GAE C;  4YCW A;  2CQO A;  1PH5 A;  4DV4 L;  1L1O A;  3AYH B;  1EIF A;  4LWC A;  1PH2 A;  3CAM A;  1WFQ A;  4MZ9 A;  1VQP A;  1SE8 A;  1YEZ A;  4DV6 Q;  1VQE A;  3A0J A;  4Y52 H;  4UP7 A;  2KCT A;  3PO2 H;  4X64 L;  4P71 A;  1AE2 A;  2F3I A;  2YU9 H;  3JAM c;  4JV5 Q;  4JI7 L;  1BKB A;  2HQL A;  3H15 A;  1FL0 A;  2KEN A;  1Y1V H;  5ELN A;  4DR1 Q;  4GNX A;  4A3G G;  4AQY Q;  1QUQ B;  1HZB A;  2A8V A;  3KF6 A;  3CCR A;  4DUZ L;  4QY7 A;  5C44 G;  3S16 H;  4DV3 Q;  2QGQ A;  4R4Q A;  1FVI A;  4GKK L;  4RG1 A;  2UU9 Q;  3E0E A;  1XJV A;  2E2H H;  4DV2 L;  4LFA Q;  4A3B G;  2N8N A;  2ES2 A;  1MJE A;  3S17 H;  2ZTC A;  3RLF A;  3PSI A;  1U0L A;  3GTL H;  1A0I A;  1YJW A;  2Z6K A;  4IPD A;  4B3M Q;  2E8G A;  1VQ9 A;  1E22 A;  2DUD A;  4AH6 A;  3U4V A;  1QVG A;  1IZ6 A;  4A3F G;  4OX9 Q;  3G4S A;  1VQC A;  1CKN A;  1HH2 P;  1EOV A;  3RN5 A;  5IYC H;  5JEA J;  4A3M H;  4B3S L;  1LM0 A;  3HKZ G;  4HJ7 A;  4B3R L;  3HOW G;  3AFP A;  1YJ9 A;  4JI4 Q;  1UE7 A;  2B3G A;  4A93 G;  4C3H H;  2GVB A;  1QZG A;  1EYG A;  4XTC S;  4JI8 L;  4DV1 Q;  3UE1 A;  4GN3 B;  3RZO H;  1KAW A;  1C7Y A;  1E24 A;  4B3T L;  4JBK A;  4Y7N H;  4HJ9 A;  1HR0 W;  3H3V H;  2NVY H;  2I5H A;  2BH2 A;  3D0F A;  1AE3 A;  4WJ3 M;  1AH9 A;  2HIV A;  2UXB Q;  3CPW A;  4DR4 L;  4LF5 L;  4DR2 Q;  2PNH A;  3RZD H;  2VS1 A;  2AWN A;  4DK3 C;  3B6Y A;  2KCM A;  1WI5 A;  4KLK A;  4DR6 Q;  4A3G H;  2ZM6 Q;  3U4Z A;  3K8A A;  2N3S A;  5AJ3 L;  3CCS A;  4OON A;  1L0W A;  4A75 A;  2BA1 A;  2UXC Q;  4X6A H;  1HNX Q;  2YTX A;  2NN6 I;  2D0P A;  3H0G H;  3KF8 B;  2VNU D;  2YYZ A;  4JBW A;  2L15 A;  5JEA G;  1VQB A;  4A3B H;  3GTQ H;  1FGU A;  3M4P A;  5M5X H;  3PF4 A;  1IBK Q;  1XNR L;  1E3P A;  4JI6 L;  4DKA C;  4LNQ A;  1NBW A;  1Q8K A;  4A3F H;  2B63 G;  4X66 L;  4JI2 Q;  3VDY A;  1V1Q A;  2CWP A;  3K0X A;  1JE5 A;  2UUA Q;  1YJN A;  1EWI A;  1K83 H;  2GN5 A;  1YI2 A;  4GKJ Q;  1YBY A;  1Y1W G;  1L1O B;  4A3L G;  4UPA A;  3GTP H;  4QJF A;  3HOW H;  1UE1 A;  5FJ8 G;  2IY5 B;  3PCO B;  4A93 H;  1VQN A;  3BZK A;  4PZ6 A;  5FLM G;  5JJK A;  4LUO A;  4APV A;  1SRO A;  2JA9 A;  5M5W H;  1J5E Q;  3S2D H;  4JYA L;  3GTG H;  2H5X A;  4A3K G;  1X9N A;  1VQ4 A;  2LXK A;  4JBJ A;  1XPO A;  1PH3 A;  4YWK A;  1YZ6 A;  4GNX B;  1WYD A;  3CF5 A;  4GLA C;  1FJG Q;  1N33 Q;  2OCE A;  3EN2 A;  3NEM A;  4HIK A;  3KF6 B;  1B8A A;  3FHW A;  4EQ5 A;  3UDI A;  4DV6 L;  1YIJ A;  3AEV A;  1QZH A;  1KC8 C;  4JV5 L;  3CCV A;  4YWL A;  3F2B A;  2BA0 A;  4EX5 A;  1N8R C;  1XNQ Q;  3CC4 A;  5FLX c;  3LGJ A;  3L7Z C;  1S40 A;  2VQE L;  1VQ5 A;  4AQY L;  4JOI C;  4IJH A;  3T1Y L;  1RL2 A;  1EUJ A;  1G6P A;  3W1B A;  4DV3 L;  4JBM A;  4IPC A;  3S1N H;  4JI5 Q;  1SMX A;  3S1M H;  1W2B A;  2UU9 L;  2IHE A;  1CKN B;  4LFA L;  1VS0 A;  2WP8 J;  4HID A;  5M5Y H;  4JI0 Q;  4R1J A;  2B63 H;  3W1G A;  2YTV A;  5M3M H;  1LTL A;  2VUM G;  3I4M G;  1VCI A;  3JC6 6;  1OXV A;  5K36 G;  3KJO A;  3KDF A;  1ASZ A;  2ZJR A;  1PV4 A;  5C0X J;  2I5L X;  4OX9 L;  1S72 A;  4O2D A;  4X62 Q;  3STB D;  1Y1W H;  1GM5 A;  2WAQ E;  4A3L H;  4NB3 A;  1JJG A;  3OW2 A;  4BBS G;  5FJ8 H;  1UEB A;  3M3Y H;  5FLM H;  2ATW A;  4YHH Q;  4IJL A;  4A3K H;  1K8G A;  4JI4 L;  3U58 A;  3KYH C;  4KI0 A;  4PG3 A;  1KRS A;  4DV1 L;  4TVA B;  3M4Q A;  2JA7 G;  2A19 A;  2NN6 G;  4DUY Q;  3EBE A;  1K8A C;  2E5L Q;  1VQ7 A;  3GTJ H;  3AFQ A;  3F1Z A;  3F2D A;  2PQA A;  4DR5 Q;  1SRU A;  4IFD J;  3K80 C;  4IOC A;  2UXB L;  3RLO A;  3G71 A;  1OXU A;  1O7I A;  3BJU A;  4DR2 L;  3PGZ A;  4DR6 L;  2R92 G;  1NTG A;  2ZM6 L;  1EQQ A;  2AMC B;  1LUZ A;  3TQY A;  2Q2U A;  2D62 A;  3GDE A;  1B70 B;  2UXC L;  4L5R C;  1HNX L;  2NZH A;  3A5Z B;  2I0Q A;  2WB1 E;  1YHB A;  4JG2 A;  4LFC Q;  2QA4 A;  1WJJ A;  2N78 A;  1LYL A;  4L5T A;  2MNA A;  3HOY G;  3K7U C;  5HY6 A;  3ULJ A;  4ME3 A;  1EQR A;  1T9H A;  1ASY A;  2V1C C;  2UUC Q;  3HOU G;  3CCU A;  1IBK L;  2VUM H;  4LF4 Q;  3I4M H;  4IOA A;  1NMG A;  1JB7 A;  2IX1 A;  1I3Q H;  1X56 A;  2UXD Q;  3RN2 A;  1PYB A;  3PO3 G;  4LF9 Q;  1G51 A;  3FP9 A;  1OTC A;  4A3J G;  1NMF A;  2UUA L;  1YNX A;  3CW2 C;  4JI1 Q;  2K14 A;  3I4O A;  3STB C;  4GKJ L;  2ZTE A;  1A62 A;  2MO1 A;  4DPG A;  2CKZ B;  1TWC H;  2RHQ B;  1EIY B;  2AWO A;  3NEN A;  1Y14 B;  1I94 Q;  1EFW A;  4NXM Q;  2MFI A;  5GQO A;  2ZJP A;  4BY7 G;  2HT1 A;  3M7N A;  4UP9 A;  1OXS C;  1XPR A;  3GTM H;  2RHS B;  2Z6K C;  4K0K Q;  1G29 1;  1M1K C;  1FJG L;  4B3M L;  3JAM i;  2CWA A;  2IHF A;  2R93 G;  4DV5 Q;  4GOP C;  4LUV A;  4AYB E;  4YCU A;  2CCZ A;  3ER0 A;  5C44 H;  1CUK A;  3TS0 A;  4NXN L;  1L2F A;  1XNQ L;  2BH8 A;  1IL2 A;  3ULL A;  2HIX A;  1KL9 A;  3TS2 A;  5IYB G;  4UY8 C;  1HZA A;  3KDF B;  2Y0S E;  4JI5 L;  3TRE A;  1BBU A;  1QVC A;  1H95 A;  1UWV A;  1CSP A;  1Z9F A;  3TRZ A;  5GRO A;  4KHP Q;  1S3O A;  5C0X I;  1OXX K;  2K5V A;  2EIF A;  3CP0 A;  3CC7 A;  3PUW A;  4A3D G;  4JI0 L;  1BVS A;  4DAM A;  1VQD A;  3PO3 H;  3KLW A;  4BXX G;  5H1S E;  2GVA A;  1MKH A;  2RF4 A;  3MEF A;  4A3J H;  3L0O A;  2JA8 G;  2K4K A;  4HJ5 A;  1KHI A;  2JJQ A;  1C9O A;  1PYS B;  2HHH Q;  1X3G A;  2R7F A;  4X62 L;  3CCE A;  3RNU A;  2RCN A;  3G6E A;  1OXT A;  2B29 A;  3BU2 A;  1SFO H;  1N32 Q;  5C4X G;  4MNO A;  2ZJQ A;  1V9P A;  4DNI A;  4R4T A;  1V43 A;  4A4I A;  2PQA B;  4A3I G;  1VQF A;  1P8L A;  3J81 i;  1IBL Q;  1TWH H;  4BA1 I;  4YY3 Q;  2NVQ H;  1PFS A;  1HNZ Q;  3RR5 A;  2ZTD A;  4IFD I;  1NE3 A;  1KRT A;  4OO1 G;  3SGI A;  2Z0S A;  4DUY L;  3EIV A;  4JC0 A;  1C0A A;  1J6Q A;  3UE0 A;  5IT9 c;  4GN5 A;  2E5L L;  2JA5 G;  2UUB Q;  5LMU Q;  5JJI A;  1VQ6 A;  4DR5 L;  2IT1 A;  3KFU A;  1E1O A;  1P16 A;  1YIT A;  5JJL A;  4JOI A;  2PMZ E;  4DR1 L;  3J81 j;  4YWM A;  1M90 C;  2YV5 A;  4FDB A;  3ICE A;  4DV0 Q;  4X65 Q;  3D31 A;  4ALP A;  1HJP A;  3PV0 A;  3I55 A;  4JI3 Q;  3OYY A;  4DR3 Q;  1Q81 C;  4IPH A;  4IO9 A;  4LFC L;  5IP7 G;  1A8V A;  2K5N A;  3I7F A;  3PO2 G;  3W5O A;  2UUC L;  3UDG A;  4HIO A;  1WOC A;  1VQK A;  3I4N G;  3ERS X;  2R6G A;  4LF4 L;  4GLV B;  2JA8 H;  2IX0 A;  4P73 A;  1IYJ B;  1CSQ A;  4HJA A;  2UXD L;  4LF9 L;  3HOV G;  2OTL A;  1N36 Q;  1XMQ Q;  3CCL A;  5C4X H;  4O0A A;  2KHI A;  1RIP A;  4DR7 Q;  4OWW B;  1X54 A;  2XTI A;  1MIU A;  2MQH A;  2VL6 A;  4JI1 L;  3OTO Q;  4A3I H;  3S15 H;  3HKS A;  2PI2 E;  2EXD A;  4POF A;  3CCJ A;  1HNW Q;  2YTY A;  1D8L A;  4QGU A;  3NEL A;  2AKW B;  1I94 L;  5IP9 G;  4X66 Q;  1VQA A;  2N49 A;  4UP8 A;  4NXM L; 
#chains in the Genus database with same CATH topology
 4FYD A;  5KYL A;  3GTK H;  2XWB B;  2A6E D;  4LF6 Q;  4PQX A;  4LW1 A;  3NBH B;  1TT2 A;  2XNA C;  5TSS A;  3AMU A;  2CW0 C;  1KLG D;  2NWG A;  5C0X G;  1EU4 A;  1SLJ A;  1O7Y A;  4GN4 B;  2CQA A;  3N6R A;  4ILW A;  1CT1 D;  4QL5 A;  5IT9 E;  4HIM A;  1LTT D;  1Q1E A;  3Q8D A;  4DU9 A;  2XVS A;  3BZC A;  5JJZ A;  3E9I A;  2VQE Q;  2H1E A;  4C2M B;  1WCM B;  4GNX C;  1Q82 C;  3L3O C;  3VYT A;  1IBM Q;  3S24 A;  2OXP A;  2RDF A;  2NB0 A;  3ERQ A;  3IL8 A;  4C3J G;  1D1I A;  1DJR D;  2R92 B;  2OTJ A;  2WAQ B;  4OXP A;  1GD7 A;  1KD1 C;  4X3K A;  2X69 A;  2C35 B;  3IRB A;  5IP9 H;  1HPC A;  2JA7 H;  3ZJY C;  1J9O A;  4OWX B;  1ILQ A;  1IKL A;  3DM3 A;  4BY1 G;  5I4D A;  1SND A;  4A3E B;  1I4H A;  1SNQ A;  4DA2 A;  4KD3 A;  5ELE A;  1X55 A;  3DWP A;  4DV7 Q;  4LF8 Q;  2RCF A;  4QIW E;  4DV4 Q;  2K04 A;  4XQQ A;  1EQT A;  3M4O H;  4DV0 L;  3MXN B;  3MEH A;  4GLX A;  2C9O A;  4FP5 D;  4BA2 I;  4C3I H;  3HOU H;  2JA6 G;  1DD2 A;  4P75 A;  3DLL A;  3F8T A;  4BBR B;  1PTO C;  3J7Z C;  2PZW A;  4KK7 A;  1Y8P B;  2EPB A;  1U5K A;  2F0U A;  2D2C C;  4GKK Q;  2EYF A;  5KNC A;  2Q8I B;  3DWA A;  5I2X A;  1WD0 A;  1SDF A;  5T1G A;  3I56 A;  2OQK A;  4N9T A;  1N36 L;  1S5F D;  1TWA B;  2VXW A;  2FXQ A;  4YHH L;  1K8M A;  1E2V A;  5IIF A;  1Q7Y C;  1GOZ A;  3AQQ A;  3K81 C;  2KVM A;  3NE5 B;  2N88 A;  2A6H C;  5EPJ A;  3CQZ B;  5CV4 A;  2CH4 A;  3A7L A;  2AQ3 B;  1B1Z A;  3X3M A;  2KOL A;  5IOD A;  5FKA C;  4A3D B;  1SEB D;  3GD7 A;  4BS9 A;  1XMO L;  4JI8 Q;  5IYD H;  5C3E G;  1TWG H;  2MP1 A;  1X3E A;  2PNR C;  3BVZ A;  4AYB B;  1QG7 A;  1S5E D;  1PHJ A;  2QF7 A;  4K8J A;  1R9T H;  1D7Q A;  2K28 A;  2Z8L A;  3VYR A;  3FKI H;  2R3Z A;  2VZA A;  3NHH A;  5FOB B;  3A56 A;  1CA5 A;  4RGM A;  3ONA B;  2VB3 X;  5FO8 B;  1OO9 B;  3T4A C;  2D9U A;  5GAH C;  1SR3 A;  3J7A 5;  4DAP A;  3OWE B;  3CCQ A;  4BXX H;  1I6H B;  3KJP A;  4G7O C;  1KDA A;  3WOE A;  5EKI A;  1WTP A;  3VYS A;  1RTN A;  4XQJ A;  4I7A A;  2E2J H;  3HOZ B;  3CME A;  3K57 A;  4O42 A;  4ABN A;  2JN4 A;  3NTH A;  4JI6 Q;  1X65 A;  2JE6 I;  1HR0 L;  1YHA A;  3HOX H;  1LTS D;  2KED A;  2F4V L;  4HED A;  4L5Q A;  1YVC A;  3S1R H;  4RWS C;  5DAU A;  2O2L D;  2F0D A;  4S3S A;  4XYO A;  5I9P A;  1RJT A;  2I07 B;  3W2D A;  1XTD A;  4V19 0;  1KDB A;  5IWA L;  4J15 A;  4I65 A;  4L5S A;  5GAE C;  1PH5 A;  2CQO A;  3SR1 A;  1L1O A;  3S16 B;  2DY7 A;  4RA8 A;  3CAM A;  1PH2 A;  1YEZ A;  1VQE A;  4Y52 H;  4JV5 Q;  2KCT A;  4X64 L;  2EY5 A;  4X3S A;  2ZXP A;  4TSS A;  2K03 A;  5E1F A;  1LAB A;  3H15 A;  2B2Y A;  1CK1 A;  1FL0 A;  4IUV A;  1I4R A;  1Y1V H;  2HDL A;  4DR1 Q;  4AQY Q;  1QUQ B;  3MA2 B;  5JAV A;  3CCR A;  4DUZ L;  4QY7 A;  3TSS A;  1AP0 A;  4R4Q A;  5JVH 3;  4ZKB B;  3D4R A;  4A3B G;  2N8N A;  2ES2 A;  1E2Z A;  1EIG A;  3R2I A;  1U0L A;  4G4K A;  1YJW A;  4IPD A;  2E8G A;  2DUD A;  1IZ6 A;  4A3F G;  2EYM A;  1VQC A;  1ENF A;  1Z6H A;  1HH2 P;  2NVY B;  4ZRZ A;  1TVX A;  1ZYR D;  3HKZ G;  3RZD B;  2B2W C;  4K5V A;  2EJG C;  3P1H A;  4K6L A;  4R8I A;  3RZO H;  3J7A F;  1SE4 A;  4QB4 A;  4G57 A;  4R9W A;  3D0F A;  2HIV A;  3CPW A;  4DR2 Q;  2AWN A;  3VA7 A;  3I73 A;  4IZ8 A;  3K8A A;  1EY7 A;  4DGZ A;  4ZYS A;  4X6A H;  1HNX Q;  2VNU D;  2HQE A;  1Y69 U;  3A8I E;  5COY A;  1KNE A;  1K83 B;  4HCS A;  3M4P A;  1B50 A;  5FK9 C;  1HFN A;  1PFN A;  3HOW B;  2F3V A;  2BCO A;  3PF4 A;  1U4P A;  1IBK Q;  4X66 L;  3M4Y A;  3K0X A;  1JE5 A;  5J22 A;  1MSH A;  5EKK A;  1YBY A;  3SK6 A;  3OMG A;  1UE1 A;  3TDQ A;  5FJ8 G;  4A93 H;  1VQN A;  3BZK A;  4PZ6 A;  1SRO A;  5M5W H;  1K0S A;  3GTG H;  4A3K G;  1VQ4 A;  2LXK A;  4ZK9 B;  2KHS A;  3EVQ A;  4JBJ A;  1XPO A;  3EJI A;  4YWK A;  4CJ1 B;  2MGS A;  4HIK A;  1K9M C;  1NR4 A;  4B3M Q;  4F7X A;  3UDI A;  4IUP A;  4DV6 L;  3AEV A;  2Y0S B;  3F2B A;  4EX5 A;  2EVB A;  2CW0 D;  1XNQ Q;  5FLX c;  2VQE L;  1DON A;  3I4L A;  1K8O A;  1SMX A;  4KKT A;  2UU9 L;  4HMJ A;  2E74 C;  4CDD C;  1CKN B;  1VS0 A;  1KTK A;  1ESF A;  5M5Y H;  3FPP A;  4R1J A;  3W1G A;  4DK0 A;  1LTL A;  1OXV A;  3KDF A;  2B8G A;  1ASZ A;  3LNN A;  5C0X J;  1GUN A;  4X62 Q;  1Y1W H;  2WAQ E;  2WAC A;  4ZCK A;  1RCV D;  4NB3 A;  1QIL A;  1EY4 A;  3M3Y H;  2ATW A;  4IJL A;  3IFD A;  3U58 A;  4PG3 A;  1KAA A;  3QJY A;  2A19 A;  3K5O A;  2PCF B;  2SDF A;  4C1N I;  1VQ7 A;  3AFQ A;  4DR5 Q;  3BDC A;  4UHV A;  2UXB L;  4IOC A;  2NBF A;  4HSV A;  4CDE C;  4N8F A;  4XDX A;  3I4M B;  2R92 G;  4DR6 L;  1ILP A;  1EQQ A;  2Q2U A;  3BYT B;  1GUT A;  1RF2 D;  4L5R C;  3I8Z A;  3W3A A;  2NZH A;  1YHB A;  3S9W A;  1Z7T A;  3TN2 A;  2QA4 A;  2N78 A;  3V05 A;  1LYL A;  1DOL A;  4L5T A;  1AZP A;  1PTO D;  4LAA A;  4ME3 A;  1T9H A;  2V1C C;  4IOA A;  3CCU A;  4JK1 C;  4LF4 Q;  3TZU A;  4K8I A;  1JB7 A;  1JCK B;  1I3Q H;  1STA A;  3GV6 A;  2UXD Q;  3KBG A;  3FP9 A;  4OHJ A;  1Y8O B;  1OTC A;  4A3J G;  2UUA L;  3CW2 C;  1VMC A;  4JI1 Q;  3I4O A;  5KNB A;  2CKZ B;  5FO9 B;  4K5X A;  2Z6B A;  5LL6 S;  2L5T A;  1NSN S;  2ZJP A;  5C3X A;  2A6H D;  1OXS C;  1C48 A;  1X3Q A;  3HOY B;  4XQN A;  3JAM i;  3R3O A;  4DN4 M;  2R93 G;  4AYB E;  2CCZ A;  1WTH A;  3HEJ A;  3PO3 B;  1NR2 A;  3ULL A;  4H13 C;  3TS2 A;  5IYB G;  4B08 A;  1HZA A;  1SFO B;  4JI5 L;  4IUN A;  2QKI C;  1S3O A;  1PYW D;  5C0X I;  2K5V A;  1EEF D;  3G6J B;  2E2D C;  1EQV A;  4A3D G;  4JI0 L;  1BVS A;  1LTI D;  5H1S E;  1A3V A;  3L0O A;  4OEM B;  3TP7 A;  4DAY A;  3VA5 A;  1C9O A;  1PYS B;  2JXM B;  4WOR A;  3CCE A;  2RCN A;  3FRP B;  2ZJQ A;  2HCI A;  2CHB D;  1V43 A;  4R4T A;  1X32 A;  4A3I G;  1VQF A;  1EIH A;  2EY1 A;  2FHT A;  4MHE A;  3EIV A;  1QNK A;  1C0A A;  1SYB A;  4K5W A;  2IT1 A;  1P16 A;  4Q5V A;  4DR1 L;  3J81 j;  4YWM A;  3PMF A;  2YV5 A;  3MC0 B;  3E3X A;  4DV0 Q;  1M8A A;  1HJP A;  4ALP A;  3I55 A;  4H44 C;  2F0G A;  2F03 A;  4M8A A;  4LFC L;  2AUJ D;  2L1B A;  3C1F A;  3I7F A;  4HMI A;  4HIO A;  1WOC A;  1VQK A;  3ERS X;  2JA8 H;  5ISR A;  1F9R A;  1PRT B;  4P73 A;  4G7Z C;  3GTK B;  1GJX A;  4KY7 A;  1N36 Q;  1H9S B;  1EYD A;  1RIP A;  1X54 A;  4R8N A;  2PI2 E;  2EXD A;  2ICI A;  1R4Q B;  2OT2 A;  1S72 A;  3BZD B;  3J80 i;  1FGB D;  2L55 A;  5FLX L;  3CCM A;  1NJI C;  3A54 A;  4R4I A;  4JVZ A;  3CU7 A;  2B2T A;  4K0K L;  2VW9 A;  1XMO Q;  1Q86 C;  4RHS A;  1T5E A;  3MXU A;  2VY3 A;  1PH7 A;  4CKB A;  3VR4 A;  3U50 C;  3ULP A;  4OO1 I;  1DXM A;  1S5B D;  1HFG A;  1K73 C;  3CXC A;  1XPU A;  3PIO 3;  2DNE A;  2D0O A;  1EY6 A;  3FPU B;  5IP7 H;  2E2H B;  1SN8 A;  2K52 A;  3RUZ A;  4LMQ D;  1GVP A;  1VQJ A;  3I4N H;  1LV9 A;  4HN7 A;  2A69 D;  2JA7 B;  4P72 A;  3KLR A;  1C8C A;  5HGT A;  1K3R A;  1S4Z A;  4KJN A;  3E9H A;  3HOV H;  3NXW A;  1CKO A;  3GV3 A;  5EQ0 A;  1A3U A;  1HR0 Q;  1EL0 A;  2WB1 G;  2KBN A;  4RH6 A;  5D65 A;  3CHB D;  5E3F A;  2F4V Q;  3KOJ A;  3J7A V;  5JPM C;  3FDT A;  1IBL L;  2OWO A;  2ID0 A;  4YY3 L;  3M4O B;  4HR7 B;  4C3I B;  3HOU B;  1GUW A;  1EY5 A;  1MJC A;  5IWA Q;  5LMU L;  5C0X H;  2HD3 A;  2HCC A;  4DK1 A;  4R4C A;  2KEC A;  3H0G B;  2ALY B;  4X65 L;  5M3F G;  4X64 Q;  3HOY H;  5EJW A;  2WFW A;  3VR6 A;  3UDF A;  4DUZ Q;  2EYH A;  2F0L A;  5I2Y A;  3HS0 C;  2MJ8 A;  1ZXT A;  2WIN B;  1I50 H;  4C3J H;  1Q1B A;  1GKH A;  3KBX A;  2JK8 A;  5KGU A;  4DR7 L;  3LWU A;  2R7Z G;  1TWG B;  3PUX A;  4UAI A;  2Y0S G;  4BY1 H;  1VQH A;  4HJ8 A;  1R9T B;  3FKI B;  1GHJ A;  1BBX C;  1SSO A;  3OSO A;  1VQ8 A;  1LLR D;  4EQO A;  5I6W A;  4JPB W;  3T1H L;  4KHV A;  1H9K A;  3GTO H;  1BUV T;  5LMN L;  1VQI A;  5IGC A;  3J80 c;  4PNY A;  2JA6 H;  1KLU D;  5IOC A;  2K7V A;  2PW5 A;  5BR8 L;  3S1M B;  3ND8 A;  5F2D A;  5IY0 A;  3HOX B;  4MTK A;  3OW7 A;  4NXN Q;  5IGG A;  2M9V A;  3J81 E;  5I6Y A;  3S1R B;  4TQU S;  5CV9 A;  1A63 A;  1WTV A;  4HSP A;  1JJ2 A;  3H09 A;  3L2P A;  1CM9 A;  4PZ7 A;  2J4X A;  1UE6 A;  2F0O A;  2K75 A;  3DM1 A;  2R7D A;  4OO1 H;  2Q2I A;  1SJH D;  1HZC A;  3PUZ A;  5IYC G;  4A3M G;  1ESR A;  5E4X A;  5C3E H;  5J3B A;  3S14 H;  1Y1V B;  5EPK A;  3OOC A;  1O7Z A;  2F0M A;  4C3H G;  5JVG 3;  4ME5 A;  4LWC A;  3F2U A;  1VQP A;  1SE8 A;  4F87 A;  4DV6 Q;  3A0J A;  4P71 A;  2F3I A;  2YU9 H;  4JI7 L;  3QOL A;  2EE1 A;  4DNR B;  2HQL A;  4WJW A;  4DXG A;  2OEO A;  4KY6 A;  2A5H A;  5ELN A;  4A3G G;  2PYK A;  2B2T C;  2A8V A;  3ND9 A;  3I72 A;  2UU9 Q;  3E0E A;  2E2H H;  5K5P A;  3GTL H;  2PW7 A;  3WDN A;  1A0I A;  2Z6K A;  2J0T D;  5FLX E;  1VQ9 A;  2K6A A;  3RZO B;  1TU2 B;  3U4V A;  1SNP A;  2I46 A;  1TR5 A;  3D8G A;  4ID6 A;  2J7Z A;  2EXZ A;  4RFB A;  3LX0 A;  5JEA J;  5D14 A;  1LM0 A;  2E76 C;  4B3R L;  2B3G A;  1EZ8 A;  1QZG A;  1SAP A;  1KAW A;  1C7Y A;  1E24 A;  1PRT C;  4B3T L;  3QR8 A;  5IGD A;  2EY2 A;  1AE3 A;  2RDH A;  1AH9 A;  2UXB Q;  4DR4 L;  2LY7 A;  2VS1 A;  3MTS A;  2KCM A;  1WI5 A;  3B6Y A;  4KLK A;  3V96 A;  4DR6 Q;  3U4Z A;  2N3S A;  5AJ3 L;  2BA1 A;  1MD2 D;  2Z4I A;  2D0P A;  3H0G H;  4HTH A;  1MSG A;  3TME A;  1VQB A;  4A3B H;  1H9M A;  3T53 B;  5M5X H;  4A93 B;  1E3P A;  2BDO A;  4DKA C;  5M5W B;  4LNQ A;  1NBW A;  1Q8K A;  4A3F H;  3GTG B;  2B63 G;  2X6G A;  2UUA Q;  1YJN A;  4GZY C;  2GN5 A;  1L1O B;  3T51 B;  2IY5 B;  5JJK A;  4APV A;  5D3D A;  3S2D H;  1EY8 A;  2H5X A;  1X9N A;  1B53 A;  2LS0 1;  2O5I C;  1WYD A;  2MHV A;  1CI3 M;  4RGT A;  4ULL A;  4K14 A;  4X3T A;  4YWL A;  2K01 A;  5M5Y B;  1U4R A;  4IUU A;  3LGJ A;  2XWJ B;  1S40 A;  1Q3L A;  1RDP D;  1QWY A;  4NP5 A;  4CKC A;  1RL2 A;  1Y1W B;  3NTI A;  4DV3 L;  1RD9 D;  3S1N H;  4JI5 Q;  3AB9 A;  3S1M H;  1W2B A;  3M3Y B;  2BE5 C;  1BCP B;  1ENC A;  4HID A;  1VF5 C;  1EFI D;  3VR2 A;  4JI0 Q;  2YTV A;  5M3M H;  4EQP A;  2VUM G;  5K36 G;  1VCI A;  2A74 C;  3MFG A;  3MHB A;  3SVM A;  1GM5 A;  1CZG A;  4MN3 A;  5FJ8 H;  3J80 L;  5J39 A;  4RHR A;  4FVM A;  4MIU A;  1DYQ A;  4A3K H;  4JI4 L;  3KYH C;  4KI0 A;  1KRS A;  4TVA B;  3M4Q A;  2JA7 G;  1K8A C;  1HHV A;  3RLO A;  1CHQ D;  1U4M A;  1OXU A;  1HRJ A;  4IUQ A;  4C56 C;  1LUZ A;  2XRS D;  1I3Q B;  4H7B A;  2A68 C;  2UXC L;  4JG2 A;  4LFC Q;  4BBS B;  5IGB A;  5E4W C;  4HCE A;  2MNA A;  3K7U C;  5HY6 A;  3HOU G;  3SEB A;  1ASY A;  5ELD A;  3VR3 A;  1SYG A;  3M7G A;  2IX1 A;  1Q8I A;  3CKI B;  5A2Q L;  1S5D D;  2PZT A;  3STB C;  2ZTE A;  1EIY B;  1TWC H;  2AWO A;  1Y14 B;  1EFW A;  1XYI A;  3OPO A;  4H0L C;  3M7N A;  4UP9 A;  4EQN A;  1XPR A;  3GTM H;  2RHS B;  1F9P A;  2Z6K C;  1UAP A;  3ERO A;  2D5D A;  4K0K Q;  1G29 1;  3U9S A;  1TQO A;  2Z9H A;  2CWA A;  3A8K E;  3GQB A;  2SEB D;  3R93 A;  2EJF C;  4K2K A;  4IUT A;  1SYE A;  5C44 H;  4KN4 C;  3TS0 A;  4NXN L;  2F1M A;  5CBE E;  3K5N A;  2HIX A;  5CMD A;  1STE A;  3QG1 A;  5KYI A;  4UY8 C;  3KDF B;  2NTS A;  3CRK C;  1AZQ A;  1QJO A;  2XIW A;  3TRE A;  3P20 A;  1DOK A;  1CSP A;  3BDO A;  5GRO A;  1OXX K;  1YNJ C;  4CDC C;  4RGN A;  4DAM A;  4BXX G;  2GVA A;  1MKH A;  4A3J H;  1LTR D;  4HJ5 A;  2F0F A;  4QCL A;  4CJ0 B;  1OXT A;  5C4X G;  4A4I A;  1H9J A;  1I4G A;  1JOQ A;  1IBL Q;  4YY3 Q;  1EYA A;  2L4N A;  1PXU A;  2Z0S A;  4DUY L;  4JC0 A;  5IT9 c;  5LMU Q;  1IYV A;  2F0E A;  5JJL A;  4KKU A;  4JOI A;  5DM7 3;  5KRU A;  5JEA H;  3ICE A;  2JA8 B;  4X65 Q;  3PV0 A;  2F0K A;  5CV5 A;  1Q81 C;  5DEH A;  1WTW A;  1A8V A;  2TMP A;  3D4D A;  3W5O A;  1TY0 A;  3MXP A;  3UDG A;  2DNC A;  4IN3 A;  2IX0 A;  3U9O A;  1CSQ A;  3D3R A;  4HJA A;  1K28 A;  2OTL A;  4XT1 B;  4DR7 Q;  1MIU A;  2MQH A;  3S15 H;  4A3I H;  3HKS A;  3NWS A;  5C6A A;  2YTY A;  4QGU A;  2B39 A;  2AKW B;  2G9D A;  3E6Z X;  4UP8 A;  3O13 A;  2WKD A;  5D3I B;  1R4P B;  1WCM G;  1O78 A;  3WWV A;  1JWM D;  2AHO B;  2Q2T A;  1S5C D;  4R4O A;  2FFK B;  1PTO F;  3S2H H;  3T1H Q;  2WAQ G;  5EKL A;  3I4N B;  1Q12 A;  5LMN Q;  5ELO A;  1PRT D;  4P2C B;  3DEO A;  1STB A;  3HOV B;  1STG A;  5BN4 A;  1EWC A;  1HTL D;  1L1O C;  1PFM A;  5BR8 Q;  4CHT B;  4A3E G;  4MTN A;  2BDN A;  4PZ8 A;  4DAY B;  1D5M C;  4KKS A;  2B2Y C;  3SK8 A;  1PVO A;  2F0Q A;  5DNF A;  4BBS H;  1T5X D;  4IFD G;  1NNX A;  3I90 A;  3J80 E;  4NMZ A;  3A55 A;  1N32 L;  1JJC B;  5LMN W;  4BBR G;  4A3C G;  1LAC A;  3NQT A;  1FNU A;  1IKM A;  3FMC A;  1HNZ L;  1JOK A;  1BF4 A;  5C5L A;  4GOP A;  2KEE A;  3GO5 A;  1B7Y B;  5EBC A;  2P5Z X;  1I5F A;  2A6E C;  2JEB I;  5DLQ E;  1BCP C;  5IGE A;  2LFN A;  3OWF A;  2E2I H;  4LUZ A;  2PO4 A;  3C3L A;  1DGS A;  1RKN A;  3TEH B;  1JMC A;  2Q2H A;  1JR0 D;  5GAD C;  1I50 B;  2NVX H;  4C3J B;  4JI7 Q;  4F88 A;  4DXF A;  3NK9 A;  1IXR A;  5HUR A;  2NUC A;  1ZEQ X;  3NUC A;  3V2T A;  3T16 A;  4FXG C;  4BY1 B;  4L8J A;  4AYB G;  3D6C A;  4OWT B;  1E1T A;  4V0B A;  2Q8T A;  3H3V I;  2NZO A;  2BE5 D;  1RTO A;  2LXJ A;  2MO0 A;  3SDZ A;  4KY5 A;  4PV1 C;  1HA5 A;  4BY7 H;  3OTO L;  2XN9 C;  3GTO B;  1HNW L;  4A76 A;  4IPG A;  1TS2 A;  2JA6 B;  1PZI D;  1TXY A;  4B3R Q;  3M9B A;  4LK1 C;  3HOZ G;  2ZT9 C;  5GAG C;  1I4P A;  3S1Q H;  4KD4 A;  4GS3 A;  2O5J C;  4DAV A;  4IUR A;  4B3T Q;  4ZQ3 A;  3Q23 A;  1WTQ A;  3K6O A;  5M3F H;  2I5M X;  1SBB B;  1PH8 A;  1PA6 A;  2NVT H;  4DR4 Q;  3H6M A;  3BS1 A;  1LO5 D;  1Q46 A;  3CPF A;  4QMG A;  5KND A;  3KK7 A;  2VQF L;  3FEW X;  5AJ3 Q;  3K7A H;  2K1B A;  1DCZ A;  4LF7 L;  2A1A A;  3CC2 A;  1STH A;  3E0J A;  3Q22 A;  2A68 D;  1N34 L;  4LFB L;  4FF1 A;  1LTB D;  2F0I A;  1KXL A;  3A74 A;  3H94 A;  2B2U A;  1A3T A;  1E2W A;  3G48 A;  2R7Z H;  4N9P A;  2JSO A;  5C3E B;  3S14 B;  3KF8 A;  2ASB A;  1JOR A;  1B3A A;  2DY8 A;  1X6O A;  1TWF H;  1V1P A;  2XGT A;  1DOM A;  1W3S A;  2XRQ D;  2JA5 H;  3D4W A;  4CGY B;  4DK6 C;  1E7Z A;  2Q8R E;  2YU9 B;  4NDX A;  5G3L D;  5IE8 A;  1KQS A;  1SYC A;  2B2V A;  4PMW A;  2DGY A;  3R8B A;  1EWH A;  3IAY A;  1ICW A;  4RCN A;  3QO2 A;  1G8Z D;  1WTR A;  2IW3 A;  3PIP A;  4YCW A;  1J8I A;  1LTA D;  1EIF A;  2RSO A;  4MZ9 A;  3RMH A;  3PO2 H;  1AE2 A;  3JAM c;  2CVR A;  5FO7 B;  3GTL B;  4M1U B;  3NTK A;  2IX3 A;  2EY6 A;  4GNX A;  1HZB A;  1FNV A;  2WII B;  3E5S A;  3KF6 A;  4DV3 Q;  2QGQ A;  1FVI A;  2CH4 W;  3K5L A;  4KTA A;  1XJV A;  1BQQ T;  4DV2 L;  4U67 3;  1NAP A;  2RA4 A;  1MJE A;  3S17 H;  1XWE A;  2ZXO A;  3RLF A;  3PSI A;  1CHP D;  2EYO A;  1E22 A;  3OMC A;  1MBY A;  2K5W A;  1RHP A;  3RN5 A;  5IYC H;  4A3M H;  4B3S L;  4OEL B;  2ICE C;  5DM6 3;  1HTP A;  3HOW G;  1QNU A;  1JWU D;  3AFP A;  1YJ9 A;  4JI4 Q;  4C3H H;  4XTC S;  1VF7 A;  4GN3 B;  3UE1 A;  3DHQ A;  1W6K A;  1FYC A;  3SXH A;  1HR0 W;  1BNZ A;  3H3V H;  4A3B B;  2BH2 A;  4LF5 L;  5M5X B;  2TSS A;  2PNH A;  1AFP A;  5CV6 A;  4DK3 C;  3NWT A;  1F77 A;  4A3G H;  2Z4H A;  4A3F B;  2EYL A;  1ONL A;  2MPM A;  4A75 A;  2UXC Q;  2YTX A;  1F2L A;  2YYZ A;  4JBW A;  2L0C A;  4FF2 A;  4TKO B;  3GTQ H;  1FGU A;  3HKZ B;  3DEP A;  1EY0 A;  1XNR L;  1XXG A;  2G9H D;  3I70 A;  2FIN B;  3S2D B;  4K6D A;  4JI2 Q;  4WFN 3;  1V1Q A;  1TWH B;  2CWP A;  2E75 C;  3SHL A;  5CC4 A;  1VDZ A;  2F0T A;  1YI2 A;  4FNF A;  4A3L G;  2LKV A;  3GTP H;  4QJF A;  1WVL A;  3PCO B;  5FLM G;  1QE6 A;  4LUO A;  3A8J E;  2ZXR A;  2JA9 A;  1J5E Q;  4JYA L;  1SMY C;  3K0Y A;  1B9N A;  4ZKC B;  1N33 Q;  4GLA C;  2OCE A;  3EN2 A;  1YIJ A;  3S1N B;  3FHW A;  4EQ5 A;  3T13 A;  3CCV A;  2BA0 A;  1N8R C;  1MHW C;  4HAE A;  4IQZ A;  5M3M B;  4IJH A;  3RD4 A;  4CBV A;  3L9A X;  2F0J A;  1G6P A;  2KJX A;  3W1B A;  3H3V C;  3HG9 A;  1GUS A;  5L37 A;  4XYQ A;  4LFA L;  2F4I A;  2WP8 J;  3CRL C;  3HRZ C;  1YNN C;  2ENB A;  4A3K B;  1NUC A;  2B63 H;  3IKJ A;  3I4M G;  3KJO A;  4J8Q A;  1B4O A;  3KUP A;  2ZJR A;  2I5L X;  4OX9 L;  2EJM A;  4O2D A;  1STN A;  3OW2 A;  1UEB A;  2QW7 A;  3K5M A;  4N8X 1;  3DXJ C;  1BCP F;  1K8G A;  2B2U C;  4DV1 L;  2L12 A;  1A6X A;  2NN6 G;  4DUY Q;  5C4Z A;  2L11 A;  1W6J A;  3GTJ H;  3F1Z A;  2KQ3 A;  2PQA A;  1SRU A;  4F8M A;  2K5D A;  1BCP D;  4IFD J;  2OF1 A;  2KA7 A;  3G71 A;  1UUP A;  1O7I A;  3IFT A;  1PTO H;  2ZM6 L;  1B2T A;  1ZKO A;  2MUY A;  3GDE A;  2B2V C;  2I0Q A;  1B44 D;  3TBI B;  3HP3 A;  3HOY G;  1TWC B;  3ULJ A;  1EQR A;  3QB3 A;  2IPK D;  2VUM H;  5K36 H;  1G6Z A;  5EGT A;  1X56 A;  1PYB A;  3PO3 G;  3GTM B;  1G51 A;  1IW7 C;  1TKW B;  2B2W A;  2K14 A;  3EQL C;  3P75 A;  1KDC A;  3R2T A;  4GKJ L;  1A62 A;  2MO1 A;  4ZUI A;  4DPG A;  1WTX A;  2RHQ B;  3NEN A;  3JAM L;  5C44 B;  5A35 A;  4ZLT F;  5GQO A;  1SE2 A;  1JQY D;  3T56 B;  3TP6 A;  3NPP A;  1V1O A;  1M1K C;  1FJG L;  2IHF A;  1PLF A;  4LUV A;  3QIA A;  1PMR A;  1G2S A;  2WKC A;  1CUK A;  1CZW A;  4NW2 A;  1L2F A;  2BH8 A;  3NBH A;  1IL2 A;  4QUF A;  2JP1 A;  4A3J B;  1KL9 A;  1BBU A;  1QVC A;  2BOS A;  4O1N A;  3P7J A;  1WTO A;  1AEX A;  3CP0 A;  1HUN A;  3PUW A;  2WV6 D;  4FF4 A;  4DFA A;  2RF4 A;  3MEF A;  1CTM A;  1KHI A;  1V8Q A;  2JJQ A;  1X3G A;  3RNU A;  1N32 Q;  2R93 B;  3G6E A;  4KN7 C;  3BU2 A;  3EA6 A;  4OIJ A;  1X3P A;  4DNI A;  4RKL A;  3J81 i;  1TWH H;  2NVQ H;  1CFM A;  1HNZ Q;  1B3Q A;  1F9Q A;  1A15 A;  2F0N A;  2ZTD A;  3RR5 A;  4RAU C;  1EZ6 A;  5C5M A;  1KRT A;  4IFD I;  4ZAI A;  4OO1 G;  1EOT A;  1J6Q A;  2E5L L;  4GN5 A;  5JJI A;  1VQ6 A;  1B9M A;  3KFU A;  1F2M A;  1YIT A;  2N55 A;  4FDB A;  5EPL A;  1EEI D;  1SNC A;  3OYY A;  4IPH A;  5CYU A;  4IO9 A;  2PPB C;  3GP7 A;  1BOS A;  1ML0 D;  3J7Y W;  1MI2 A;  2K5N A;  3S15 B;  4A3I B;  3TP5 A;  3NP8 A;  2UUC L;  3MXN A;  1ET6 A;  2R6G A;  2NZ1 D;  4GLV B;  2DJF C;  1EYC A;  2H4O A;  1IYJ B;  1PZJ D;  4LF9 L;  4E6I A;  1M4V A;  1D2B A;  3CCL A;  5C4X H;  4O0A A;  2KHI A;  4OWW B;  2XTI A;  5IGF A;  3OTO Q;  3Q0A A;  3S2H B;  1PDQ A;  3CCJ A;  5CV8 A;  1HNW Q;  1I94 L;  5IP9 G;  1VQA A;  2N49 A;  3TQY A;  1QZH A;  4NXM L;  3KLS A;  3DUZ A;  2JEA I;  3HFZ B;  4RMF A;  1TS3 A;  1CA6 A;  3PQI A;  3PF5 A;  4G7H C;  3NBI A;  5C4J H;  2LSS A;  1K0R A;  1L0X B;  3DWQ A;  1X3F A;  4DV5 L;  1HZ9 A;  1VQG A;  3PIP 3;  1JT8 A;  3C46 A;  2VB2 X;  4JCV E;  2PQE A;  5AFW A;  3UI2 A;  1CKM A;  3M85 A;  2K50 A;  2VQF Q;  3OHX C;  3PIO A;  3H91 A;  4B9X A;  4C3I G;  1PH9 A;  3CD6 A;  1IL8 A;  4LF7 Q;  1A2T A;  4KHP L;  1IHZ A;  2EOT A;  1N34 Q;  4JI2 L;  4LFB Q;  3T1Y Q;  1BBW A;  3HKZ E;  2NYZ D;  2HUG A;  3PUY A;  3KLS X;  4XIG S;  3H0G G;  3MFY A;  1CQV A;  1NCV A;  1UEA B;  2HHH L;  3URY A;  1SYF A;  5NUC A;  2E2I B;  3BG3 A;  1J5E L;  1FR3 A;  5ELB A;  4FXK C;  5J1Z A;  4C2M H;  4CKE A;  1WCM H;  1G2T A;  2QIL A;  2RBM A;  5HGQ A;  4Y7N B;  1N33 L;  2NVX B;  4KMU C;  2DN8 A;  2KHJ A;  1TS4 A;  1JE4 A;  1GXD C;  2K05 A;  4OL7 A;  5C4H A;  2R92 H;  1EY9 A;  4I7Z C;  2UUB L;  3N52 A;  4WRD A;  5I9O A;  2Z1C A;  3A5U A;  1PH4 A;  4QQB X;  1GO3 E;  5IYD G;  1SMY D;  1N9W A;  5C3W A;  1PH6 A;  3RLN A;  3J81 c;  3UDX A;  4JI3 L;  1JWS D;  4A3E H;  3FKI G;  4H02 A;  4DR3 L;  2WB1 B;  1SJE D;  4YIJ A;  4BY7 B;  3CMA A;  1GUO A;  2KCC A;  1QCB D;  2IWH A;  1NY4 A;  5BN3 A;  3F2C A;  2A69 C;  2FMC A;  4IFD H;  1VQO A;  3I2Z A;  4DV2 Q;  4L63 B;  4NPS A;  2K5H A;  2R61 A;  1QUQ A;  4RCO A;  1XMQ L;  3JAM E;  4BBR H;  1KIX A;  3A7A B;  1YNN D;  4A3C H;  3S1Q B;  2A73 B;  2CFM A;  3HOX G;  3BYY B;  1Z47 A;  5M3F B;  1VQM A;  1FD7 D;  3LWE A;  5M3M G;  4B3S Q;  2NVT B;  2R93 H;  2OQ0 A;  4KHZ A;  4LF6 L;  2EZV A;  2PI2 A;  4P74 A;  1SNO A;  1TWA H;  4AIM A;  2F52 A;  5CBA E;  3K7A B;  3X3N A;  5EAY A;  5IYB H;  1QVF A;  1I6V C;  1KAB A;  3CQZ H;  1BDO A;  4L6T B;  4LF5 Q;  2EQS A;  2R7Z B;  1LTG D;  1ROD A;  1VQL A;  4A3D H;  4PMB A;  1ENA A;  1PH1 A;  5ELC A;  1JC7 A;  1PZK D;  1Y1V G;  1TWF B;  3VR5 A;  1AN8 A;  2JA5 B;  3Q24 A;  3G7L A;  4POG A;  3TP8 A;  2JQO A;  3NQI A;  1IBM L;  1XNR Q;  1WD1 A;  4GOP B;  2QEX A;  1F9S A;  3PUV A;  1D5X C;  2QDB A;  2F0V A;  1I6H H;  1HCZ A;  1TY2 A;  4YCV A;  1PRT F;  3NSW A;  1UE5 A;  1IW7 D;  2M00 A;  5CV7 A;  5ELF A;  3PO2 B;  2EYP A;  3BVM A;  3HOZ H;  3MVV A;  1YHQ A;  2QDL A;  2QEJ C;  1HA6 A;  4JYA Q;  2V4D A;  1D6E C;  4DV7 L;  5E7N A;  3BVG A;  1JB3 A;  4LF8 L;  4UDU C;  2PMZ B;  4DV4 L;  1I4Q A;  3AYH B;  1WFQ A;  2XSC A;  4UP7 A;  4QUC A;  3S17 B;  2F0W A;  1BKB A;  3DMU A;  3BDL A;  2KEN A;  2PZU A;  2IJ0 A;  5C44 G;  3S16 H;  3QOJ A;  1FNW A;  4A3M B;  4RG1 A;  4GKK L;  4LFA Q;  2KUM A;  4Z9C B;  2ZTC A;  1LT4 D;  2F3W A;  4C3H B;  4FO2 A;  4EGV A;  3K59 A;  1HUM A;  1TS5 A;  4AH6 A;  1QVG A;  4OX9 Q;  1D5Z C;  4KJO A;  3G4S A;  1CKN A;  2FMM A;  3I3C A;  4EVO A;  1EOV A;  4FF3 A;  1IYU A;  3K58 A;  3WOF A;  5M9O A;  4LJZ C;  4HJ7 A;  1LT5 D;  3SK4 A;  4A3G B;  1UE7 A;  4A93 G;  2X6L A;  2GVB A;  1EYG A;  4TRD A;  4JI8 L;  4K2L A;  4DV1 Q;  1U4L A;  4JBK A;  4Y7N H;  1F2Y A;  4DNT B;  4HJ9 A;  5BN5 A;  2NVY H;  2I5H A;  3GTQ B;  4WJ3 M;  4ODG A;  3HZX A;  1HQM C;  3RZD H;  1HXY D;  2ZM6 Q;  2K33 A;  4OGQ C;  2K5Q A;  3CCS A;  4OON A;  1L0W A;  5A2Q E;  2NN6 I;  3KF8 B;  2AQ1 B;  2L15 A;  3MWY W;  3OIP A;  4U68 A;  5JEA G;  1MGS A;  2RVL A;  1V1P B;  3GTP B;  2L9H A;  4RGO S;  4JI6 L;  2AUK A;  5JOB A;  3C2P A;  3VDY A;  2EDG A;  1EWI A;  1K83 H;  4GKJ Q;  3J81 L;  1Y1W G;  1JOO A;  4UPA A;  3HOW H;  2JYO A;  2M2L A;  2NTT A;  4J6H A;  2QCP X;  4X3U A;  2LMC B;  2IL8 A;  3I91 A;  1CQF A;  4QIW B;  1PH3 A;  1YZ6 A;  4GNX B;  4BWG B;  3CF5 A;  1FJG Q;  4WJ4 A;  3NEM A;  2GA4 B;  3KF6 B;  1B8A A;  1BO0 A;  4Q0F A;  1LT6 D;  1KC8 C;  4JV5 L;  4XT3 B;  5KEE A;  3CC4 A;  2B63 B;  3L7Z C;  4AQY L;  4JOI C;  3T1Y L;  3D6W A;  1EUJ A;  4JBM A;  4IPC A;  5CR3 A;  1GUG A;  5IT9 L;  2IHE A;  5G3L F;  4RKB A;  4JW0 A;  2RDG A;  3SK5 A;  5KIX A;  3JC6 6;  3MXG A;  2KCN A;  2SNS A;  1PV4 A;  3STB D;  3GTJ B;  4A3L H;  3Q6S A;  4CDF C;  1JJG A;  5LL6 X;  4BBS G;  3AU7 A;  1AW7 A;  1XX8 A;  5FLM H;  1PTO B;  4YHH Q;  4FXD A;  2RKS A;  3TZD A;  1TII D;  2RQX A;  5COR A;  2HDM A;  3EFX D;  3EBE A;  3VYU A;  2E5L Q;  3F2D A;  2RSN A;  3FVQ A;  3K80 C;  5LHY 1;  2F0H A;  3QWN A;  2DJG C;  3BJU A;  4DR2 L;  3PGZ A;  2VUM B;  3ZYY X;  1NTG A;  2AMC B;  3ITP A;  1D1K A;  2D62 A;  5T1I A;  1BXT A;  1B70 B;  3SE0 A;  1HNX L;  3A5Z B;  2WB1 E;  1UNS A;  1WJJ A;  1YNJ D;  2UUC Q;  1SNM A;  1IBK L;  3I4M H;  4DF7 A;  1NMG A;  2FJ2 A;  3RN2 A;  1ICF B;  4LF9 Q;  1K3B C;  1NMF A;  1SE3 A;  1YNX A;  1VMP A;  1I94 Q;  1O80 A;  4NXM Q;  2MFI A;  2SNM A;  1I4X A;  1H9S A;  2B8F A;  2NN6 H;  4BY7 G;  2HT1 A;  2AQ2 B;  4QF4 A;  4CJ2 C;  3HGB A;  2SOB A;  4OIK A;  1C4Q A;  4B3M L;  4DV5 Q;  4GOP C;  1HQR D;  4XXE A;  4YCU A;  1QB5 D;  3ER0 A;  1XNQ L;  1EU3 A;  1SYD A;  5JPN C;  1BR9 A;  1II3 A;  2Y0S E;  1DZ1 A;  1H95 A;  1UWV A;  4KHP Q;  1Z9F A;  3TRZ A;  2C5C A;  2EIF A;  3CC7 A;  2NVQ B;  4IAL A;  2EYJ A;  4PMC A;  1VQD A;  3PO3 H;  3KLW A;  2JA8 G;  4KV6 A;  2K4K A;  1XTC D;  2HHH Q;  4X62 L;  2R7F A;  1SFO H;  2B29 A;  1E0B A;  3MZ5 A;  1ZYR C;  4MNO A;  1SXT A;  2G5D A;  1V9P A;  1Q90 A;  2PQA B;  1DM0 B;  1U9R A;  1P8L A;  3OIQ A;  4BA1 I;  1PFS A;  1ET9 A;  1NE3 A;  3SGI A;  3UE0 A;  2JA5 G;  3C1E A;  5CGK A;  2UUB Q;  1LT3 D;  1PFB A;  4DR5 L;  2F0P A;  1E1O A;  2F0S A;  4B9W A;  1H9R A;  2PMZ E;  2O4X A;  1GHK A;  1M90 C;  1JIC A;  1L0Y B;  3D31 A;  4JI3 Q;  4C1N K;  4DR3 Q;  5C4X B;  1Y8N B;  2E2J B;  5IP7 G;  3PO2 G;  1A2U A;  1KNA A;  4J1M A;  3I4N G;  3MAQ A;  4LF4 L;  4ZUJ A;  1QOH A;  5EBD A;  2UXD L;  3HOV G;  1XMQ Q;  1STY A;  1G91 A;  4NKL A;  5C4J B;  4JI1 L;  2VL6 A;  1O7L A;  2K32 A;  4POF A;  1D8L A;  3NEL A;  1VQ5 A;  4X66 Q;  1F2Z A; 
#chains in the Genus database with same CATH homology
 3J80 i;  2JEA I;  3HFZ B;  4RMF A;  3GTK H;  3CCM A;  1WCM G;  1NJI C;  4LF6 Q;  3WWV A;  2AHO B;  4LW1 A;  3NBH B;  4R4I A;  2Q2T A;  4R4O A;  3PF5 A;  4K0K L;  2VW9 A;  1XMO Q;  5C4J H;  2LSS A;  1K0R A;  1Q86 C;  3S2H H;  3T1H Q;  1X3F A;  2VY3 A;  2WAQ G;  4DV5 L;  1PH7 A;  1HZ9 A;  1Q12 A;  5LMN Q;  5ELO A;  3U50 C;  5C0X G;  3ULP A;  1VQG A;  4OO1 I;  1SLJ A;  4GN4 B;  1JT8 A;  4JCV E;  1K73 C;  1CKM A;  3M85 A;  3CXC A;  1XPU A;  4QL5 A;  1L1O C;  2K50 A;  2D0O A;  2VQF Q;  4HIM A;  5BR8 Q;  5IP7 H;  4A3E G;  3PIO A;  4MTN A;  1Q1E A;  3Q8D A;  1SN8 A;  4PZ8 A;  1PH9 A;  3CD6 A;  4DAY B;  2K52 A;  3BZC A;  4LF7 Q;  4KHP L;  3I4N H;  1GVP A;  1VQJ A;  1PVO A;  3E9I A;  1N34 Q;  4P72 A;  2VQE Q;  3T1Y Q;  4JI2 L;  4LFB Q;  1K3R A;  4GNX C;  3E9H A;  1BBW A;  3HKZ E;  3HOV H;  1Q82 C;  1CKO A;  4BBS H;  3PUY A;  4IFD G;  4XIG S;  3H0G G;  1IBM Q;  3S24 A;  1HR0 Q;  2HHH L;  2OTJ A;  1N32 L;  1JJC B;  2WB1 G;  1GD7 A;  2KBN A;  4OXP A;  5LMN W;  1KD1 C;  4BBR G;  2F4V Q;  4A3C G;  3IRB A;  2C35 B;  5IP9 H;  3KOJ A;  2JA7 H;  1J5E L;  3ZJY C;  4OWX B;  4BY1 G;  3DM3 A;  4C2M H;  1WCM H;  2ID0 A;  4YY3 L;  1IBL L;  2OWO A;  5HGQ A;  1HNZ L;  1N33 L;  4GOP A;  2KHJ A;  3GO5 A;  1B7Y B;  1I5F A;  2JEB I;  1MJC A;  1X55 A;  5DLQ E;  2R92 H;  5IWA Q;  2UUB L;  5LMU L;  4WJ4 A;  4DV7 Q;  3A5U A;  1PH4 A;  4LF8 Q;  4QQB X;  1GO3 E;  5IYD G;  2E2I H;  4QIW E;  4DV4 Q;  4LUZ A;  1N9W A;  4R4C A;  1PH6 A;  1DGS A;  3TEH B;  3RLN A;  3J81 c;  1JMC A;  2Q2H A;  3UDX A;  3M4O H;  2ALY B;  4X65 L;  4JI3 L;  5GAD C;  3MXN B;  4X64 Q;  5M3F G;  4DV0 L;  3FKI G;  4GLX A;  4H02 A;  4A3E H;  2NVX H;  4C3I H;  4JI7 Q;  3HOU H;  3HOY H;  4DR3 L;  2JA6 G;  4BA2 I;  2WFW A;  4P75 A;  3DLL A;  1IXR A;  3F8T A;  3UDF A;  3J7Z C;  1K9M C;  4DUZ Q;  3CMA A;  1U5K A;  4AYB G;  1NY4 A;  3F2C A;  4OWT B;  1E1T A;  1VQO A;  4GKK Q;  3I2Z A;  4DV2 Q;  1I50 H;  3H3V I;  4C3J H;  1Q1B A;  4NPS A;  3I56 A;  1GKH A;  2NZO A;  2K5H A;  2OQK A;  1N36 L;  1QUQ A;  1XMQ L;  2JK8 A;  4BBR H;  1KIX A;  2LXJ A;  2MO0 A;  4A3C H;  4DR7 L;  2FXQ A;  2R7Z G;  4BY7 H;  2CFM A;  4YHH L;  3OTO L;  3PUX A;  2Y0S G;  3HOX G;  3AQQ A;  3K81 C;  1Q7Y C;  4BY1 H;  1HNW L;  1Z47 A;  1VQH A;  4HJ8 A;  1VQM A;  4A76 A;  4IPG A;  5M3M G;  4B3S Q;  2R93 H;  2OQ0 A;  1TXY A;  4B3R Q;  4KHZ A;  4LF6 L;  3M9B A;  1VQ8 A;  2PI2 A;  3HOZ G;  5GAG C;  4P74 A;  1TWA H;  3GD7 A;  4AIM A;  2F52 A;  1XMO L;  4JI8 Q;  4GS3 A;  5C3E G;  3S1Q H;  1TWG H;  5IYD H;  5EAY A;  3T1H L;  1X3E A;  4B3T Q;  1PHJ A;  3GTO H;  5LMN L;  1VQI A;  1R9T H;  5IYB H;  1D7Q A;  5M3F H;  2I5M X;  1QVF A;  3CQZ H;  2VZA A;  3FKI H;  1PH8 A;  3J80 c;  1PA6 A;  2NVT H;  4DR4 Q;  2JA6 H;  4LF5 Q;  3CPF A;  1Q46 A;  2EQS A;  5GAH C;  2VQF L;  5BR8 L;  1SR3 A;  3J7A 5;  1VQL A;  4A3D H;  5IY0 A;  5AJ3 Q;  3K7A H;  1PH1 A;  3CCQ A;  4BXX H;  4LF7 L;  4NXN Q;  1Y1V G;  2A1A A;  3CC2 A;  3KJP A;  4TQU S;  1N34 L;  4LFB L;  1A63 A;  4POG A;  1JJ2 A;  1KXL A;  3A74 A;  2JQO A;  2E2J H;  3L2P A;  1IBM L;  3CME A;  4PZ7 A;  3G48 A;  1XNR Q;  2R7Z H;  4JI6 Q;  1X65 A;  2JE6 I;  4GOP B;  2QEX A;  1HR0 L;  1YHA A;  1UE6 A;  3PUV A;  3HOX H;  2K75 A;  2ASB A;  1I6H H;  2F4V L;  2R7D A;  4YCV A;  1X6O A;  4L5Q A;  1TWF H;  1YVC A;  2Q2I A;  3S1R H;  1UE5 A;  2XGT A;  1W3S A;  2JA5 H;  4DK6 C;  1HZC A;  1E7Z A;  3PUZ A;  5IYC G;  1XTD A;  4A3M G;  3HOZ H;  1YHQ A;  5IE8 A;  5C3E H;  1KQS A;  5J3B A;  3S14 H;  4PMW A;  2DGY A;  4JYA Q;  5IWA L;  4J15 A;  4DV7 L;  5E7N A;  4L5S A;  3PIP A;  4LF8 L;  5GAE C;  4YCW A;  2CQO A;  1PH5 A;  4DV4 L;  1L1O A;  3AYH B;  1EIF A;  4LWC A;  1PH2 A;  3CAM A;  1WFQ A;  4MZ9 A;  1VQP A;  1SE8 A;  1YEZ A;  4DV6 Q;  1VQE A;  3A0J A;  4Y52 H;  4UP7 A;  2KCT A;  3PO2 H;  4X64 L;  4P71 A;  1AE2 A;  2F3I A;  2YU9 H;  3JAM c;  4JV5 Q;  4JI7 L;  1BKB A;  2HQL A;  3H15 A;  1FL0 A;  2KEN A;  1Y1V H;  5ELN A;  4DR1 Q;  4GNX A;  4A3G G;  4AQY Q;  1QUQ B;  1HZB A;  2A8V A;  3KF6 A;  3CCR A;  4DUZ L;  4QY7 A;  5C44 G;  3S16 H;  4DV3 Q;  2QGQ A;  4R4Q A;  1FVI A;  4GKK L;  4RG1 A;  2UU9 Q;  3E0E A;  1XJV A;  2E2H H;  4DV2 L;  4LFA Q;  4A3B G;  2N8N A;  2ES2 A;  1MJE A;  3S17 H;  2ZTC A;  3RLF A;  3PSI A;  1U0L A;  3GTL H;  1A0I A;  1YJW A;  2Z6K A;  4IPD A;  4B3M Q;  2E8G A;  1VQ9 A;  1E22 A;  2DUD A;  4AH6 A;  3U4V A;  1QVG A;  1IZ6 A;  4A3F G;  4OX9 Q;  3G4S A;  1VQC A;  1CKN A;  1HH2 P;  1EOV A;  3RN5 A;  5IYC H;  5JEA J;  4A3M H;  4B3S L;  1LM0 A;  3HKZ G;  4HJ7 A;  4B3R L;  3HOW G;  3AFP A;  1YJ9 A;  4JI4 Q;  1UE7 A;  2B3G A;  4A93 G;  4C3H H;  2GVB A;  1QZG A;  1EYG A;  4XTC S;  4JI8 L;  4DV1 Q;  3UE1 A;  4GN3 B;  3RZO H;  1KAW A;  1C7Y A;  1E24 A;  4B3T L;  4JBK A;  4Y7N H;  4HJ9 A;  1HR0 W;  3H3V H;  2NVY H;  2I5H A;  2BH2 A;  3D0F A;  1AE3 A;  4WJ3 M;  1AH9 A;  2HIV A;  2UXB Q;  3CPW A;  4DR4 L;  4LF5 L;  4DR2 Q;  2PNH A;  3RZD H;  2VS1 A;  2AWN A;  4DK3 C;  3B6Y A;  2KCM A;  1WI5 A;  4KLK A;  4DR6 Q;  4A3G H;  2ZM6 Q;  3U4Z A;  3K8A A;  2N3S A;  5AJ3 L;  3CCS A;  4OON A;  1L0W A;  4A75 A;  2BA1 A;  2UXC Q;  4X6A H;  1HNX Q;  2YTX A;  2NN6 I;  2D0P A;  3H0G H;  3KF8 B;  2VNU D;  2YYZ A;  4JBW A;  2L15 A;  5JEA G;  1VQB A;  4A3B H;  3GTQ H;  1FGU A;  3M4P A;  5M5X H;  3PF4 A;  1IBK Q;  1XNR L;  1E3P A;  4JI6 L;  4DKA C;  4LNQ A;  1NBW A;  1Q8K A;  4A3F H;  2B63 G;  4X66 L;  4JI2 Q;  3VDY A;  1V1Q A;  2CWP A;  3K0X A;  1JE5 A;  2UUA Q;  1YJN A;  1EWI A;  1K83 H;  2GN5 A;  1YI2 A;  4GKJ Q;  1YBY A;  1Y1W G;  1L1O B;  4A3L G;  4UPA A;  3GTP H;  4QJF A;  3HOW H;  1UE1 A;  5FJ8 G;  2IY5 B;  3PCO B;  4A93 H;  1VQN A;  3BZK A;  4PZ6 A;  5FLM G;  5JJK A;  4LUO A;  4APV A;  1SRO A;  2JA9 A;  5M5W H;  1J5E Q;  3S2D H;  4JYA L;  3GTG H;  2H5X A;  4A3K G;  1X9N A;  1VQ4 A;  2LXK A;  4JBJ A;  1XPO A;  1PH3 A;  4YWK A;  1YZ6 A;  4GNX B;  1WYD A;  3CF5 A;  4GLA C;  1FJG Q;  1N33 Q;  2OCE A;  3EN2 A;  3NEM A;  4HIK A;  3KF6 B;  1B8A A;  3FHW A;  4EQ5 A;  3UDI A;  4DV6 L;  1YIJ A;  3AEV A;  1QZH A;  1KC8 C;  4JV5 L;  3CCV A;  4YWL A;  3F2B A;  2BA0 A;  4EX5 A;  1N8R C;  1XNQ Q;  3CC4 A;  5FLX c;  3LGJ A;  3L7Z C;  1S40 A;  2VQE L;  1VQ5 A;  4AQY L;  4JOI C;  4IJH A;  3T1Y L;  1RL2 A;  1EUJ A;  1G6P A;  3W1B A;  4DV3 L;  4JBM A;  4IPC A;  3S1N H;  4JI5 Q;  1SMX A;  3S1M H;  1W2B A;  2UU9 L;  2IHE A;  1CKN B;  4LFA L;  1VS0 A;  2WP8 J;  4HID A;  5M5Y H;  4JI0 Q;  4R1J A;  2B63 H;  3W1G A;  2YTV A;  5M3M H;  1LTL A;  2VUM G;  3I4M G;  1VCI A;  3JC6 6;  1OXV A;  5K36 G;  3KJO A;  3KDF A;  1ASZ A;  2ZJR A;  1PV4 A;  5C0X J;  2I5L X;  4OX9 L;  1S72 A;  4O2D A;  4X62 Q;  3STB D;  1Y1W H;  1GM5 A;  2WAQ E;  4A3L H;  4NB3 A;  1JJG A;  3OW2 A;  4BBS G;  5FJ8 H;  1UEB A;  3M3Y H;  5FLM H;  2ATW A;  4YHH Q;  4IJL A;  4A3K H;  1K8G A;  4JI4 L;  3U58 A;  3KYH C;  4KI0 A;  4PG3 A;  1KRS A;  4DV1 L;  4TVA B;  3M4Q A;  2JA7 G;  2A19 A;  2NN6 G;  4DUY Q;  3EBE A;  1K8A C;  2E5L Q;  1VQ7 A;  3GTJ H;  3AFQ A;  3F1Z A;  3F2D A;  2PQA A;  4DR5 Q;  1SRU A;  4IFD J;  3K80 C;  4IOC A;  2UXB L;  3RLO A;  3G71 A;  1OXU A;  1O7I A;  3BJU A;  4DR2 L;  3PGZ A;  4DR6 L;  2R92 G;  1NTG A;  2ZM6 L;  1EQQ A;  2AMC B;  1LUZ A;  3TQY A;  2Q2U A;  2D62 A;  3GDE A;  1B70 B;  2UXC L;  4L5R C;  1HNX L;  2NZH A;  3A5Z B;  2I0Q A;  2WB1 E;  1YHB A;  4JG2 A;  4LFC Q;  2QA4 A;  1WJJ A;  2N78 A;  1LYL A;  4L5T A;  2MNA A;  3HOY G;  3K7U C;  5HY6 A;  3ULJ A;  4ME3 A;  1EQR A;  1T9H A;  1ASY A;  2V1C C;  2UUC Q;  3HOU G;  3CCU A;  1IBK L;  2VUM H;  4LF4 Q;  3I4M H;  4IOA A;  1NMG A;  1JB7 A;  2IX1 A;  1I3Q H;  1X56 A;  2UXD Q;  3RN2 A;  1PYB A;  3PO3 G;  4LF9 Q;  1G51 A;  3FP9 A;  1OTC A;  4A3J G;  1NMF A;  2UUA L;  1YNX A;  3CW2 C;  4JI1 Q;  2K14 A;  3I4O A;  3STB C;  4GKJ L;  2ZTE A;  1A62 A;  2MO1 A;  4DPG A;  2CKZ B;  1TWC H;  2RHQ B;  1EIY B;  2AWO A;  3NEN A;  1Y14 B;  1I94 Q;  1EFW A;  4NXM Q;  2MFI A;  5GQO A;  2ZJP A;  4BY7 G;  2HT1 A;  3M7N A;  4UP9 A;  1OXS C;  1XPR A;  3GTM H;  2RHS B;  2Z6K C;  4K0K Q;  1G29 1;  1M1K C;  1FJG L;  4B3M L;  3JAM i;  2CWA A;  2IHF A;  2R93 G;  4DV5 Q;  4GOP C;  4LUV A;  4AYB E;  4YCU A;  2CCZ A;  3ER0 A;  5C44 H;  1CUK A;  3TS0 A;  4NXN L;  1L2F A;  1XNQ L;  2BH8 A;  1IL2 A;  3ULL A;  2HIX A;  1KL9 A;  3TS2 A;  5IYB G;  4UY8 C;  1HZA A;  3KDF B;  2Y0S E;  4JI5 L;  3TRE A;  1BBU A;  1QVC A;  1H95 A;  1UWV A;  1CSP A;  1Z9F A;  3TRZ A;  5GRO A;  4KHP Q;  1S3O A;  5C0X I;  1OXX K;  2K5V A;  2EIF A;  3CP0 A;  3CC7 A;  3PUW A;  4A3D G;  4JI0 L;  1BVS A;  4DAM A;  1VQD A;  3PO3 H;  3KLW A;  4BXX G;  5H1S E;  2GVA A;  1MKH A;  2RF4 A;  3MEF A;  4A3J H;  3L0O A;  2JA8 G;  2K4K A;  4HJ5 A;  1KHI A;  2JJQ A;  1C9O A;  1PYS B;  2HHH Q;  1X3G A;  2R7F A;  4X62 L;  3CCE A;  3RNU A;  2RCN A;  3G6E A;  1OXT A;  2B29 A;  3BU2 A;  1SFO H;  1N32 Q;  5C4X G;  4MNO A;  2ZJQ A;  1V9P A;  4DNI A;  4R4T A;  1V43 A;  4A4I A;  2PQA B;  4A3I G;  1VQF A;  1P8L A;  3J81 i;  1IBL Q;  1TWH H;  4BA1 I;  4YY3 Q;  2NVQ H;  1PFS A;  1HNZ Q;  3RR5 A;  2ZTD A;  4IFD I;  1NE3 A;  1KRT A;  4OO1 G;  3SGI A;  2Z0S A;  4DUY L;  3EIV A;  4JC0 A;  1C0A A;  1J6Q A;  3UE0 A;  5IT9 c;  4GN5 A;  2E5L L;  2JA5 G;  2UUB Q;  5LMU Q;  5JJI A;  1VQ6 A;  4DR5 L;  2IT1 A;  3KFU A;  1E1O A;  1P16 A;  1YIT A;  5JJL A;  4JOI A;  2PMZ E;  4DR1 L;  3J81 j;  4YWM A;  1M90 C;  2YV5 A;  4FDB A;  3ICE A;  4DV0 Q;  4X65 Q;  3D31 A;  4ALP A;  1HJP A;  3PV0 A;  3I55 A;  4JI3 Q;  3OYY A;  4DR3 Q;  1Q81 C;  4IPH A;  4IO9 A;  4LFC L;  5IP7 G;  1A8V A;  2K5N A;  3I7F A;  3PO2 G;  3W5O A;  2UUC L;  3UDG A;  4HIO A;  1WOC A;  1VQK A;  3I4N G;  3ERS X;  2R6G A;  4LF4 L;  4GLV B;  2JA8 H;  2IX0 A;  4P73 A;  1IYJ B;  1CSQ A;  4HJA A;  2UXD L;  4LF9 L;  3HOV G;  2OTL A;  1N36 Q;  1XMQ Q;  3CCL A;  5C4X H;  4O0A A;  2KHI A;  1RIP A;  4DR7 Q;  4OWW B;  1X54 A;  2XTI A;  1MIU A;  2MQH A;  2VL6 A;  4JI1 L;  3OTO Q;  4A3I H;  3S15 H;  3HKS A;  2PI2 E;  2EXD A;  4POF A;  3CCJ A;  1HNW Q;  2YTY A;  1D8L A;  4QGU A;  3NEL A;  2AKW B;  1I94 L;  5IP9 G;  4X66 Q;  1VQA A;  2N49 A;  4UP8 A;  4NXM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...