5AJ3Q

Structure of the small subunit of the mammalian mitoribosome
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
109
structure length
109
Chain Sequence
SIARSSVHAKWVVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIIFKVGQVIDPVTGKPCAGTTYLESPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
total genus 9
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5aj3Q00
1IXRA 2JA6G 2JE6I 4OX9L 1L2FA 4QJFA 2D0PA 3OTOL 2ZTCA 3RN5A 2FXQA 4RMFA 4OONA 5IP7H 2A1AA 1PH5A 3JC66 1K9MC 1G6PA 2NVYH 1VQPA 2VQFL 1GD7A 1X3GA 2NZOA 5IYDG 4QL5A 3U50C 1QUQB 4DV3L 1KXLA 3JAMc 1DGSA 1FGUA 1E22A 4PG3A 5M3FH 4LNQA 2D0OA 3CP0A 4GN3B 4JCVE 3UDIA 2WP8J 5C0XJ 1SLJA 1Q8KA 2RCNA 3M9BA 5HY6A 5FJ8H 1VQ7A 4WJ4A 3UDFA 3CCEA 2YU9H 1G51A 4YHHL 1SFOH 4A3EG 4KHPL 1LUZA 3E9HA 2B3GA 2VY3A 1TWAH 1UWVA 1MKHA 3Q8DA 4A3BG 4DR5Q 5IYBH 4LFAQ 4A3DG 3KF8B 2MNAA 4OX9Q 2Z6KA 4GNXA 4Y52H 3K81C 2A8VA 3PV0A 4IJHA 3KJPA 3EBEA 3H3VH 3M7NA 4DK6C 2MO1A 2UXBL 2YV5A 2YTYA 1UEBA 2H5XA 1JE5A 3A0JA 5FLMG 3CC7A 4TQUS 2JA7G 1Q12A 2KCMA 2GVBA 4IPDA 1QVGA 4BY1H 4JI4L 3H3VI 3PO3H 5JJLA 1GO3E 3M4PA 3G6EA 2JQOA 1VQ4A 1IBML 2R7FA 1Q7YC 5JEAJ 2ASBA 2N8NA 2XTIA 2BH2A 1HNWL 1KHIA 3U4ZA 3GTGH 3ZJYC 4A3JH 2VW9A 1HZCA 4JI1L 1VCIA 4DR3L 5GAEC 4DR1L 1XPUA 1PYBA 1PH3A 2UUCL 1VQEA 2QGQA 1IBLL 3K0XA 4DV4L 3LGJA 3ULJA 3HOYG 3GTPH 4MZ9A 3W1BA 2ZJRA 1YITA 4GKJL 4BXXG 5IYCH 2UXBQ 2K52A 3DM3A 3A5UA 1EUJA 3CF5A 5E7NA 5IP9G 3KFUA 3STBC 1Y1WH 4LFBL 1IBKL 4DR7Q 1K0RA 5GADC 4DV0L 2Z6KC 4JI2L 3CXCA 4R4CA 2I5MX 4PZ6A 1VQNA 4BY7G 4QY7A 3KF6B 3CCVA 5GQOA 4YY3Q 5IWAQ 4OO1I 1Y14B 3I4MH 1CKMA 3E9IA 3U4VA 2OCEA 4JBWA 1LM0A 1D8LA 4Y7NH 3M85A 3CCJA 1FVIA 3CCMA 4DR2Q 2HIXA 2OQKA 4DUYQ 4A3MH 1NJIC 2AMCB 1P16A 3GTKH 1SRUA 1X65A 5HGQA 4IJLA 5BR8L 4HJ9A 3GTOH 4A3KG 1B7YB 1YVCA 1PV4A 1IYJB 2D62A 2BA1A 4LF8Q 2B63G 4LUOA 3KJOA 3CD6A 4GOPC 4HIDA 1GVPA 3M4QA 2NVXH 3G71A 4GKJQ 2CWAA 2KENA 3RLNA 1X3EA 2R7ZG 5AJ3L 4OWXB 1XJVA 3J81j 1U0LA 4LF7L 3CQZH 5M3MG 5IYDH 1TWCH 2XGTA 2UU9L 3HOUG 4ME3A 4A3LH 3BZKA 1KRTA 3CAMA 4DR4L 3T1HL 1VQFA 4DV0Q 4X66L 3CC4A 3STBD 1W2BA 2ZJQA 3A74A 4B3MQ 4R4IA 1MJCA 2AWNA 2KCTA 4GNXB 4XIGS 4DUZQ 3FP9A 2QA4A 3G48A 2NN6I 3KDFA 3ULLA 3TREA 2DUDA 1P8LA 1XMOQ 1VQ5A 1NTGA 3ULPA 2NVQH 2KHIA 4C3HH 3S16H 1HZBA 3J80c 2VL6A 5JJIA 4J15A 4GS3A 5ELOA 4GLAC 1WYDA 4GKKQ 3W5OA 1SR3A 2JA8G 4P71A 4A4IA 3M4OH 4YCUA 1Q1BA 2CFMA 4K0KQ 3GTLH 4P73A 2I0QA 2RF4A 3K7AH 1HNXQ 4AYBE 3GD7A 1HH2P 3PF4A 4DR5L 4LFAL 4JI6Q 1YEZA 3HOVG 4JOIC 1VQMA 2VNUD 4X6AH 2V1CC 4OXPA 3PF5A 2R93G 1PH8A 4DV7Q 5C4XG 4UY8C 1YBYA 3CPWA 4POFA 1M1KC 4DK3C 1UE5A 3PO2H 4JI3Q 3HOXH 3IRBA 3I7FA 4IO9A 3I4NH 3AYHB 3CW2C 3HOYH 1PH6A 1M90C 1VQ9A 4GN4B 3TEHB 4HJ8A 1MJEA 2Y0SG 4JC0A 2HQLA 3W1GA 3S1QH 2VZAA 3FKIG 1GM5A 2UUAQ 3CCRA 2R6GA 1AE3A 2PNHA 1K83H 4QQBX 4JG2A 3F2BA 3WWVA 3SGIA 2JA5H 4LF6L 3HOZG 1BVSA 1TWGH 1N34Q 4BBSG 1N33L 2EIFA 4UP9A 2Y0SE 3PUYA 1IZ6A 2UUBL 4KHZA 4P75A 4BA1I 1AE2A 2RHSB 1MIUA 1VQLA 1G291 3NEMA 2ATWA 3GTMH 1I3QH 3H0GH 4DR7L 2YTVA 1HNZQ 1OXVA 3PIPA 1CUKA 2ALYB 4DV1Q 2Q2TA 2UXCQ 5M5YH 2E8GA 2Q2HA 4YY3L 5IWAL 5LMNW 4GOPA 1YHQA 3AEVA 1KRSA 4A3GH 1VQ8A 2YTXA 1N8RC 4BBRH 1SROA 1UE1A 3PSIA 4DR2L 2I5LX 4DUYL 1X3FA 1JB7A 4A3CH 4B3RQ 5FLXc 4FDBA 3D0FA 4XTCS 4DV6Q 4HJ5A 4IOCA 4LF4Q 2VUMG 2LSSA 4DAYB 5C3EH 4LF6Q 3HOWH 3H15A 3GO5A 3GDEA 2IHEA 1N33Q 1A63A 2ES2A 4LF8L 2EQSA 4DAMA 1PH7A 5DLQE 1OXTA 4GLXA 4A3FG 2NZHA 2R92H 2UUBQ 2MQHA 4YCWA 1QVFA 1YIJA 1FL0A 2HIVA 1C0AA 3L2PA 1XNQQ 3B6YA 4L5QA 4X65Q 2WB1G 1PH1A 2CCZA 1L1OC 1WCMH 4LFCQ 2HT1A 1OXSC 3HKSA 4KI0A 3CPFA 1K73C 4NXNQ 4IFDI 1SMXA 5IP7G 5JJKA 1N32Q 3F1ZA 2YYZA 2K14A 1EOVA 4P74A 4B3ML 1L0WA 2BA0A 1WOCA 3MXNB 1VQ6A 3BZCA 1I5FA 4LF5Q 1OXUA 1PH4A 2KBNA 1J6QA 2N3SA 5M3FG 4DUZL 4JYAQ 1YZ6A 5LMNQ 1C9OA 4A3IH 4BA2I 4HJ7A 4JI8Q 1XMOL 2AWOA 3ER0A 3TS0A 3J81i 1VQDA 5IE8A 2JA6H 3HFZB 1HR0W 1PH2A 1QUQA 5FJ8G 2C35B 1ASYA 2ZJPA 1X9NA 4L5TA 4JOIA 2R93H 4POGA 4GKKL 2MO0A 1HJPA 1KL9A 3F8TA 1VQCA 3M3YH 3J7ZC 4PZ8A 1JJ2A 1A0IA 3OW2A 4K0KL 2E2HH 3CCSA 5C44G 3U58A 1HNXL 2IT1A 3K80C 1YJ9A 1T9HA 4LUVA 1EQRA 2OTLA 2NVTH 4JI6L 4LWCA 3NENA 1XPRA 1SE8A 4DV5Q 1EQQA 1VQJA 3S1NH 2WFWA 4GN5A 2ZM6Q 2LXJA 2F52A 4A76A 3S2HH 3FKIH 4JI0Q 3K8AA 1YJNA 1I50H 1X6OA 4DV7L 5M5WH 2PQAA 4BY1G 3PO3G 1GKHA 1A8VA 4A3EH 1E24A 3BJUA 4AQYQ 1JMCA 1JT8A 1PFSA 1YHAA 1I94Q 4JI3L 4A3BH 1S72A 2OWOA 4A3DH 4X64Q 4X62Q 3I55A 4L5SA 4IOAA 1XNRQ 5C0XG 3D31A 4IPGA 1N36Q 4JI5Q 4A3JG 1J5EQ 3PUVA 2ZTDA 1YI2A 3A5ZB 1QVCA 3KYHC 1HR0Q 2UUAL 1KAWA 1V9PA 4YWMA 4B3SQ 5FLMH 4LUZA 4O0AA 3TS2A 4GOPB 2JA7H 3GTQH 1V43A 2OTJA 1KC8C 1Y1VG 2N49A 2VS1A 4JBMA 5H1SE 3OYYA 1VQKA 1OXXK 1N34L 1NE3A 4LF9Q 3I4NG 5GAHC 5IYCG 2F4VQ 4HIOA 4OO1G 2N78A 4DNIA 3F2CA 4KLKA 2LXKA 4JV5Q 3DLLA 1Y1WG 3I4OA 4YWKA 1VQHA 3CMAA 3EIVA 4B3TQ 2QEXA 5IT9c 4R4OA 1Q1EA 5C4JH 1XTDA 3I4MG 1FJGQ 1PH9A 1HNZL 2R7DA 5JEAG 2BH8A 4DV1L 4YCVA 4A3MG 4P72A 1QZHA 2UXCL 1O7IA 3PGZA 4DV2Q 1I6HH 1CSPA 3UE0A 2HHHQ 4BXXH 2UXDQ 2OQ0A 2ID0A 3ERSX 1Q82C 1EWIA 4NPSA 3S17H 2RHQB 4B3RL 1YNXA 4NB3A 1HZAA 1Z9FA 4R4QA 5IP9H 5J3BA 4DV6L 1Z47A 2KHJA 4LF4L 1X54A 5K36G 1L1OA 1PVOA 4BY7H 4JI7Q 2E2IH 2K5VA 4IFDJ 1NBWA 2Z0SA 1HZ9A 5ELNA 1BBUA 1CKNA 1E7ZA 4MTNA 3F2DA 1WJJA 2JEBI 1PHJA 5EAYA 1YHBA 4A3LG 1E3PA 4H02A 3JAMi 1PYSB 3RZDH 1XNQL 4X65L 4IPCA 3T1YQ 4C3IH 3E0EA 2NN6G 4LFCL 2CKZB 1K8GA 4A3KH 4MNOA 4QIWE 4NXNL 2VQEQ 5LMUQ 3S1RH 2K50A 1BKBA 2B63H 4DR6Q 1TWFH 1N32L 2CQOA 4NXMQ 2Q2IA 3RZOH 2IY5B 3L0OA 1E1TA 3G4SA 2R7ZH 4LF5L 2JK8A 5M3MH 3HOUH 3OTOQ 3KLWA 3AFQA 5GROA 5LMNL 1VQOA 4JYAL 5C44H 4A93G 2DGYA 2IX0A 4JI8L 1LTLA 2PQAB 1EYGA 1Q46A 3KOJA 3CCLA 1EIFA 3KDFB 1IL2A 1KQSA 2VQFQ 1VQGA 2PI2E 4RG1A 3UE1A 4DV3Q 1BBWA 1TWHH 4AIMA 4GLVB 3S15H 2AHOB 1JJCB 4LW1A 4HIKA 2I5HA 3L7ZC 1XMQL 1VQAA 4PZ7A 3RLFA 4C2MH 1VQBA 2E2JH 4JBKA 2Q2UA 1ASZA 1NMGA 4YHHQ 4DV5L 2ZM6L 4KHPQ 2IHFA 4JI0L 2JA8H 3PO2G 1U5KA 3HOXG 4HIMA 1Q81C 3I56A 4DPGA 5C0XI 1C7YA 4UP8A 2WB1E 3MEFA 5M5XH 3VDYA 2PMZE 3TQYA 3RR5A 2K5HA 1Y1VH 4AQYL 3TRZA 1D7QA 4C3JH 1I94L 3J81c 1E1OA 4EQ5A 4X64L 3UDXA 4X62L 1EIYB 3HOVH 4AH6A 1XNRL 1UE6A 3BU2A 1N36L 4JI5L 1W3SA 2F3IA 4O2DA 1J5EL 2JJQA 4R1JA 1X56A 1X55A 1PA6A 3PUXA 4JI4Q 1V1QA 5C4XH 3K7UC 1HR0L 1NY4A 4A75A 4GNXC 1IBMQ 2JA5G 1AH9A 3PIOA 4B3SL 1H95A 3I2ZA 5IYBG 1OTCA 1K8AC 2ZTEA 1HNWQ 1TXYA 3PUZA 3S24A 2E5LL 1XMQQ 3RLOA 4WJ3M 3ICEA 1SN8A 3CMEA 4LF9L 2GVAA 1S3OA 4OWWB 3S14H 2F4VL 1KD1C 1L1OB 4JI1Q 4DR3Q 3RNUA 4DR1Q 4OWTB 4DKAC 3CCQA 5IY0A 4JV5L 2MFIA 3H0GG 4APVA 1NMFA 4JBJA 1IBLQ 3GTJH 4DV4Q 2UUCQ 1CKNB 1RIPA 4B3TL 2L15A 2WAQG 3EN2A 3PUWA 3HOZH 1K3RA 1JJGA 4BBSH 1RL2A 3UDGA 1FJGL 4A3GG 1B8AA 3S1MH 4IPHA 4HJAA 4BBRG 3RN2A 1CKOA 3HKZG 4TVAB 1QZGA 4A3CG 1WI5A 1Q86C 3NBHB 4DV2L 5GAGC 2HHHL 2UXDL 2PI2A 1IBKQ 3AQQA 4LFBQ 5C3EG 4JI2Q 3HOWG 1CSQA 4R4TA 1EFWA 2WAQE 3NELA 1VQIA 3CC2A 2E5LQ 2K75A 1A62A 4IFDG 4UP7A 2K5NA 3HKZE 4JI7L 2R92G 1N9WA 2EXDA 2JA9A 3AFPA 3CCUA 4QGUA 1YJWA 3S2DH 1UE7A 5BR8Q 1WFQA 1WCMG 2GN5A 2K4KA 1KIXA 3J7A5 3PCOB 4AYBG 2IX1A 4UPAA 2A19A 3J80i 1S40A 1LYLA 4A93H 2VUMH 3T1YL 1XPOA 1B70B 5LMUL 2VQEL 2B29A 3FHWA 4ALPA 5AJ3Q 4LF7Q 4YWLA 4DR6L 4NXML 2CWPA 4EX5A 4A3FH 1R9TH 2JEAI 1VS0A 4PMWA 3KF6A 2UU9Q 4A3IG 4L5RC 2AKWB 4DR4Q 3T1HQ 4X66Q
chains in the Genus database with same CATH superfamily
1IXRA 1BBXC 2FXQA 3HGBA 1PLFA 1WTPA 3C46A 1IW7C 4DN4M 4MTKA 2B2VA 4RKLA 2F0EA 5IYDG 3U50C 1LV9A 1O80A 1FGUA 5M3FH 4PG3A 4A3MB 4JCVE 4GN3B 2WP8J 5EKLA 4OHJA 2ZT9C 3R2IA 3M9BA 1VQ7A 1PXUA 3CCEA 3MEHA 1PZID 2VY3A 4HAEA 1UWVA 1TS3A 4CGYB 4GNXA 2Z1CA 2A8VA 4IJHA 1EEID 3M7NA 3H3VH 1WD1A 2MO1A 3VR5A 1UAPA 1UEBA 1JE5A 1Z7TA 4KY5A 4CHTB 2X6LA 1A6XA 2GVBA 4IPDA 1GO3E 1SMYC 3SK5A 2JQOA 1B3AA 2R7FA 1G91A 2F0VA 5JEAJ 4U673 2N8NA 5C3XA 1GJXA 3I8ZA 2CW0C 2GA4B 1Q90A 4WORA 3ZJYC 1D5MC 1TIID 4A93B 2VUMB 4JI1L 1VCIA 4M8AA 1XPUA 3I72A 4DNRB 1PH3A 1BDOA 2QGQA 1IBLL 2ZJRA 1STBA 3EA6A 3NP8A 3E0JA 1NSNS 2K52A 3PIP3 3D8GA 4PQXA 3KFUA 1Y1WH 4LFBL 3MHBA 1IBKL 2Z6KC 3CXCA 4R4CA 4BY7G 1VQNA 4OO1I 5EBDA 3I4MH 4HN7A 3PO2B 4Y7NH 1AEXA 3CCJA 5CC4A 1NJIC 2OQKA 1KDAA 3NTHA 1X65A 5CV4A 2C9OA 1YVCA 1PV4A 2D62A 2BA1A 2B63G 3KJOA 4GOPC 4HIDA 4N9PA 1K83B 2KENA 1PTOB 2FJ2A 3CKIB 2R7ZG 2JSOA 4N8X1 2HUGA 3CQZH 1LTTD 1TWCH 3HOUG 3A74A 5C4ZA 3NPPA 1LACA 2A6HC 1XTCD 3MA2B 1CQVA 4XIGS 1LT5D 3FP9A 2X6GA 2DUDA 1P8LA 1VQ5A 2F3WA 1NTGA 3ULPA 4F87A 1GUOA 4WFN3 5ELOA 1EYCA 1LTBD 2EYPA 4GKKQ 2OEOA 2RVLA 3SEBA 5LL6X 4OEMB 1QNKA 1ZYRD 3GTPB 4V0BA 3TSSA 3GD7A 4KKSA 4C3JG 2RDGA 1J8IA 4LFAL 1KDBA 2B2YC 1QOHA 4JOIC 3MAQA 4X6AH 5D14A 5C4XG 2V4DA 2EPBA 1YBYA 4RGMA 4IURA 2PCFB 2BE5C 1PFBA 3I4NH 5JJZA 4QUFA 3QJYA 4FNFA 1M90C 3GTKB 4GN4B 5KNBA 1YNNC 2VZAA 2XWBB 5JPNC 3GTOB 3CCRA 5E1FA 1CZWA 4JG2A 2NVXB 3SGIA 2ICIA 1CI3M 3HOZG 1TWGH 4BBSG 1SSOA 4UP9A 4NKLA 4IUVA 4BA1I 1AE2A 1K8MA 1MIUA 3MXGA 1VQLA 3GTMH 2A68D 5IWAL 2PW5A 1YHQA 1KRSA 4A3BB 1VQ8A 1EFID 2YTXA 4DR2L 1SROA 1UE1A 3K6OA 1PRTC 4KN4C 1X3FA 2Z6BA 1SNMA 3SK4A 5CBEE 4FDBA 4XTCS 4LF4Q 2NYZD 2ZXOA 4DAYB 3HOWH 3H15A 3GO5A 1ET9A 3GDEA 2I46A 1IYUA 3M4OB 4LF8L 4DAMA 4CKBA 1PH7A 2G5DA 5DLQE 2P5ZX 2R92H 2UUBQ 2MQHA 2QF7A 1FL0A 2HIVA 2KHSA 1XNQQ 4X65Q 3V05A 1WCMH 4LFCQ 1EY7A 1SMXA 1V8QA 4ZAIA 1H9MA 4P74A 1I4RA 1WOCA 2H1EA 2EOTA 3AU7A 1I5FA 3BZCA 4FO2A 5AFWA 3HOXB 1G6ZA 3N52A 3HG9A 4DUZL 3TN2A 5LMNQ 4A3IH 4BA2I 2J0TD 4HJ7A 3TS0A 4X3SA 1HR0W 1PH2A 1QUQA 2PQEA 3BVZA 1X9NA 4L5TA 2R93H 4POGA 2MO0A 1HJPA 1TY0A 3OW7A 3M3YH 4PZ8A 4K14A 1EZ6A 3K5MA 5T1IA 3OOCA 1ZEQX 1XPRA 4N8FA 4DV5Q 1EQQA 4MIUA 4A76A 2LXJA 1ONLA 3FKIH 3K8AA 1YJNA 3H0GB 1I50H 2CH4W 2F0SA 3J7AF 3PO3G 1C4QA 1GUWA 4K2KA 2WAQB 4AQYQ 5M5YB 1STAA 1PFSA 2ENBA 1S72A 4L5SA 1MGSA 3T13A 4IPGA 5KRUA 4A3JG 1MD2D 1O7LA 1STGA 3A55A 3Q22A 5COYA 4KHVA 3KYHC 2UUAL 1G8ZD 3GTQH 1V43A 4LJZC 4X3UA 2N49A 1DCZA 1NE3A 1S5FD 3E5SA 4DNIA 1ENAA 4KY7A 1XX8A 3CMAA 1KNEA 3D3RA 3LWEA 2H4OA 3J81E 1RTOA 3MTSA 1HA6A 4P72A 1QZHA 2CQAA 1I6HH 2SNMA 3H09A 1KLGD 5NUCA 2UXDQ 3ERSX 1EWIA 4NPSA 3BVMA 2L9HA 3BVGA 4FXKC 5J3BA 1T5XD 4DV6L 5K36G 1L1OA 3W3AA 4BY7H 1DOMA 1E7ZA 1PHJA 1WJJA 2B2TC 4C1NI 5EAYA 3C3LA 4A3LG 4MN3A 3S14B 4IPCA 1Q8IA 5IODA 3A56A 3Q23A 2NN6G 4XYOA 2CKZB 3T1YQ 1GOZA 4QIWE 5FO9B 4ZQ3A 2K32A 2AQ2B 2VQEQ 2B63H 1RKNA 2F0TA 3SVMA 2IY5B 2R7ZH 1NR2A 1G2SA 4FF2A 2O5IC 5J22A 4C3HG 3F2UA 3HOUH 1PMRA 1BR9A 5CV7A 1Q46A 2QCPX 2D5DA 3V2TA 1MSHA 5KYIA 1KQSA 3HZXA 2PI2E 3SE0A 1NNXA 5ELDA 5I4DA 1BBWA 3BS1A 4GLVB 2AHOB 4LW1A 5KNCA 1HFGA 3RLFA 5C0XH 1VQBA 3RUZA 2B2VC 1ASZA 2RBMA 2ZM6L 1EY9A 3A7LA 1LO5D 3R93A 2PMZE 3RR5A 1D7QA 4A3FB 1O78A 4C3JH 2F0LA 4DK0A 4X64L 4ZUJA 4X62L 1XNRL 2F0WA 1N36L 1STYA 3TDQA 1J5EL 5CV8A 1PA6A 1X56A 3FDTA 3PUXA 1V1QA 5C4XH 2JA5G 1HR0L 4GNXC 2F0HA 1H95A 1ML0D 1OTCA 1K8AC 3PUZA 2E5LL 1XMQQ 4OWWB 1FD7D 1KD1C 4IZ8A 4JI1Q 1EOTA 1B3QA 3CCQA 2MFIA 1IBLQ 2EYLA 3MZ5A 1BNZA 2L15A 5A35A 3EN2A 3HOZH 1K3RA 5A2QE 1JJGA 4BBSH 4A3GG 3S1MH 5M3MB 4BBRG 1M4VA 1JWSD 4TVAB 3MXPA 2PZUA 1Q86C 3H94A 2LY7A 2PI2A 2EYHA 1IBKQ 4LFBQ 3G6JB 4R4TA 1LTID 1ZKOA 4FXDA 5CORA 1ESRA 4I65A 4IFDG 2EXDA 2JA9A 3CCUA 1YJWA 1FNWA 1UE7A 2K4KA 1KIXA 4I7AA 2E2JB 5KYLA 4FVMA 1DJRD 1U4RA 4HTHA 3A7AB 5LMUL 2JA8B 1JB3A 1Y8NB 4XYQA 4ALPA 1B50A 1F2LA 1HQRD 4NXML 1SDFA 5D3IB 1VS0A 1Y1VB 5C4HA 3OIQA 5CR3A 2AKWB 4L6TB 2JA6G 3X3MA 3HOVB 2D2CC 5A2QL 4QJFA 2KA7A 3OTOL 2ZTCA 1JC7A 1SJED 4OONA 1UUPA 1SBBB 2A1AA 3QR8A 3BYYB 1K9MC 1A2UA 2NVYH 4KD3A 1U4PA 1LTAD 3QOLA 3KLSX 1QUQB 1D1IA 1DGSA 1EQVA 2L4NA 1E22A 4KJNA 3CP0A 3UDIA 3KLRA 2QILA 2F0FA 2K04A 3DWPA 2A69D 2JYOA 1G51A 1QB5D 2EY5A 4A3EG 4KHPL 1TWAH 1MKHA 3WOEA 5IYBH 4LFAQ 4PNYA 4F88A 4A3DG 4OX9Q 4JK1C 2BDNA 1W6KA 3K81C 3KJPA 3KK7A 2IX3A 1I4PA 5C5MA 4ODGA 3WDNA 1TS4A 1IW7D 2JA7G 3PO3H 4QB4A 3DEOA 1IBML 2ICEC 1RDPD 5L37A 5BN4A 3S2DB 2BH2A 1KHIA 1FGBD 3GTGH 4A3JH 4DR1L 4CJ1B 2UUCL 4DV4L 3LGJA 4MZ9A 3V96A 3W1BA 1R9TB 4GKJL 1TS2A 4QMGA 4BXXG 2UXBQ 4XQQA 4KD4A 3DM3A 2IWHA 3GQBA 2KJXA 4C56C 5IT9E 4I7ZC 5TSSA 3STBC 4F7XA 2MHVA 1JORA 1K0RA 4DV0L 3CCVA 3KF6B 1U4MA 1SMYD 5GQOA 5IWAQ 2SDFA 4DR2Q 5T1GA 1BCPB 1D5ZC 3I4NB 2AMCB 1P16A 2CW0D 1SRUA 1I4QA 1I4XA 1B7YB 2EZVA 4LF8Q 1CTMA 2WKCA 1Z6HA 1I6VC 5K36H 2IJ0A 1SFOB 1F9QA 1DD2A 3Q0AA 1TWGB 4OWXB 5AJ3L 4LF7L 1U0LA 1SNPA 2Z4HA 3QG1A 1SE2A 4A3LH 3BZKA 4DAPA 2DN8A 3CAMA 3T1HL 3CC4A 1W2BA 1ET6A 4LAAA 3VYSA 2NN6H 2XRSD 3K5OA 3GTMB 2AWNA 5IT9L 4BY1B 4UDUC 1EY4A 2KCTA 2JP1A 4DUZQ 3NTIA 3TREA 1V1PA 4QCLA 4FXGC 4C3HH 4EQPA 3S16H 5JJIA 4J15A 1EYAA 1F2YA 1WYDA 1F9RA 4P71A 1F2ZA 4YCUA 1Q1BA 2AUKA 3GTLH 4P73A 2I0QA 2RF4A 4KN7C 1D1KA 4OIJA 1FR3A 1YEZA 1VMPA 2RQXA 4RH6A 1F9PA 2V1CC 4OXPA 1TQOA 3PF5A 2R93G 1PH8A 3PQIA 2ZXRA 2A6HD 4POFA 2RSNA 4DK3C 1B4OA 2F0GA 4IO9A 1XYIA 1GUSA 3NE5B 3CW2C 3NQTA 3HOYH 4B9WA 1PH6A 1VQ9A 4A3IB 2Y0SG 3BDLA 3S1QH 3FKIG 2KCCA 4ZK9B 2UUAQ 1LT6D 2NTSA 2PNHA 4CDEC 3NWTA 3F2BA 3WWVA 2JA5H 4QIWB 2FFKB 1N33L 2HCIA 1AZPA 4NDXA 3U9SA 3NSWA 1WTXA 1IZ6A 2RHSB 1E0BA 3J7YW 2VB2X 3ND9A 1S5ED 3KLSA 3D4WA 3DM1A 1AN8A 3OWEB 3K58A 2PZTA 2MUYA 2BE5D 2Q2TA 3VYUA 3OMCA 3AEVA 4RGTA 4A3GH 1N8RC 4BBRH 3PSIA 1YNND 4G57A 1QCBD 3VR6A 4DV6Q 4HJ5A 2VUMG 2EYMA 4LF6Q 2IHEA 1D5XC 1A63A 2ES2A 2Q8RE 4RGOS 3WOFA 2F3VA 4IFDH 3K7AB 4YCWA 2PMZB 2WACA 1L0YB 1L1OC 3TMEA 1PH1A 5IGDA 1OXSC 4ULLA 1A15A 3M4YA 5IP7G 2A5HA 5JJKA 1JOQA 1L0WA 1OXUA 1HRJA 2KBNA 1J6QA 1S5BD 1PRTD 1I6HB 4ME5A 2AWOA 2JA6H 1LTSD 3MVVA 3MWYW 4ABNA 4DAVA 5FJ8G 2DNCA 2RA4A 2EJGC 4LK1C 2LFNA 1CQFA 1KL9A 1VQCA 1LT3D 1TY2A 3OW2A 4K0KL 2E2HH 4V190 5M9OA 3R3OA 3CCSA 3U58A 2L11A 2NVTH 2O2LD 4JI6L 4PMCA 3KF8A 5JOBA 2WFWA 2ZM6Q 3S2HH 3D6WA 4HSVA 3C2PA 2DNEA 5M5WH 2B63B 4RKBA 4A3EH 1D2BA 3BJUA 1JT8A 4A3DH 4X64Q 4X62Q 3I55A 3ITPA 4IOAA 1XNRQ 3EROA 5C0XG 1K28A 1N36Q 1J5EQ 2L0CA 2ZTDA 3A5ZB 1QVCA 1C8CA 2XSCA 4IN3A 1HR0Q 4LUZA 2JA7H 3I4LA 2VS1A 5CMDA 2Z4IA 1OXXK 1N34L 5IYCG 1STEA 3JAML 4OO1G 2TMPA 4AYBB 4YWKA 1VQHA 2RSOA 1K8OA 1GHJA 2QEXA 5IT9c 3OHXC 2NBFA 4HCSA 1XTDA 5C4JH 1RHPA 1QILA 1B9MA 1PH9A 1HNZL 4DV1L 3T56B 4YCVA 5FO7B 2KQ3A 4G4KA 2G9HD 4BXXH 1RD9D 2OQ0A 4Z9CB 3S17H 4B3RL 1HZAA 4DK1A 2N55A 4XT3B 1X54A 3C1FA 1DOLA 5C4XB 3H91A 2E2IH 2K5VA 2Q8TA 2Z0SA 1KAAA 4MTNA 1X3PA 3ERQA 1YHBA 3JAMi 4NMZA 3RZDH 4H0LC 4R9WA 4HSPA 3S1NB 2M00A 4NXNL 5LMUQ 3S1RH 2G9DA 1TWFH 4NXMQ 3RZOH 3L0OA 1E1TA 4LF5L 3X3NA 2F0IA 3OTOQ 3A8IE 3KLWA 3AFQA 5G3LD 1VQOA 5C44H 2R3ZA 2DGYA 1J9OA 1LTLA 1EYGA 3K0YA 1VQGA 1V1PB 3UE1A 1TWHH 1HQMC 4AIMA 2RDFA 1JJCB 2I5HA 4PZ7A 1EEFD 2WINB 4TRDA 4KHPQ 4JI0L 5FKAC 1PTOC 3A54A 3T51B 2ZXPA 3HOXG 1Q81C 3I56A 4DPGA 1WTRA 4UP8A 5M5XH 2E75C 3TQYA 4IUNA 3D4DA 1E1OA 3UDXA 4F8MA 1EIYB 4AH6A 1UE6A 4K5WA 2WKDA 3T53B 2F3IA 1HFNA 1EYDA 4R1JA 1X55A 1CK1A 2IW3A 5IGCA 4A75A 1IBMQ 3PMFA 3IKJA 3PIOA 3I2ZA 5IYBG 1WD0A 4RAUC 1ZXTA 2ZTEA 4RHRA 2SEBD 4G7HC 3ICEA 5JEAH 3D4RA 2GVAA 2F4VL 3GV3A 1B2TA 4WJWA 4OL7A 3RNUA 4C3IB 4DR1Q 3N6RA 2L12A 4NW2A 4A3KB 3CRLC 5I2XA 5IY0A 3H0GG 2UUCQ 1NMFA 4JBJA 2K7VA 4DV4Q 1RIPA 2WAQG 3UI2A 1RL2A 5E4XA 1FJGL 2B8FA 3T16A 1ZYRC 3HKZG 1JWMD 1II3A 1EIGA 4A3CG 3VR4A 5FO8B 3NBHB 4DV2L 1JR0D 5DM73 3AQQA 5C3EG 3NWSA 5CYUA 1CSQA 2NZ1D 1EFWA 1EL0A 1VQIA 1A62A 4JI7L 3IFTA 3NXWA 1HPCA 5FLXE 3S15B 4QGUA 2XIWA 1T5EA 2HDMA 3PCOB 4C2MB 2IX1A 1S40A 1H9KA 4A93H 2VUMH 1XPOA 5C6AA 1DYQA 2B29A 4O1NA 1QG7A 3QB3A 2KOLA 5AJ3Q 4LF7Q 1H9JA 1NAPA 2AQ1B 2JEAI 2RKSA 4PMWA 3KF6A 1PZJD 1K3BC 3T1HQ 3MXNA 2D0PA 1IHZA 2J4XA 2K5WA 1JICA 3RN5A 3DEPA 1W6JA 4FF4A 2BCOA 5IP7H 4K6DA 1PH5A 3JC66 1G6PA 4RWSC 1VQPA 4PMBA 1GD7A 1X3GA 2EXZA 4ID6A 3JAMc 4LNQA 5CBAE 1Q8KA 3VYRA 3ND8A 5FLXL 4X3TA 5HY6A 5FJ8H 2WIIB 4WJ4A 3UDFA 3GTJB 4YHHL 1RCVD 2B3GA 1PTOH 3Q8DA 4EGVA 3KF8B 2Z6KA 4Y52H 5EBCA 1ENCA 2SOBA 4K8IA 2YTYA 4NP5A 3NK9A 3A0JA 1LTRD 5FLMG 3CC7A 2MJ8A 1QVGA 1CHQD 2KCMA 4FF1A 4JI4L 3H3VI 5JJLA 3M4PA 2QKIC 5EKIA 3QWNA 1Q7YC 2FMMA 2Z8LA 2M2LA 2MPMA 1HNWL 1A2TA 2F1MA 1EQTA 3BDCA 3S16B 5I9OA 1S5DD 2VW9A 3DWQA 1SXTA 4RHSA 3ULJA 3HOYG 4U68A 3GTPH 1YITA 3MFGA 5IYCH 1SYDA 1STHA 2WB1B 4OO1H 1DOKA 3P75A 3URYA 3CF5A 5IP9G 2L1BA 5C5LA 5GADC 4L63B 4JI2L 2I5MX 4PZ6A 1RTNA 3MC0B 5ELCA 1Y14B 1CKMA 3U4VA 1LM0A 2EDGA 2BOSA 3CCMA 2NVQH 5ELFA 2HIXA 5M3FB 2DJFC 3GTKH 2PZWA 4B08A 3DUZA 3G7LA 5HGQA 1TKWB 5BR8L 2F4IA 4HMJA 4HJ9A 3GTOH 1SJHD 3S1QB 3CD6A 3TP8A 1GVPA 2B2YA 2NVXH 4RCNA 2B8GA 3BZDB 2M9VA 2CWAA 2JA5B 1X3EA 3DXJC 1PRTF 3J81j 2OT2A 5M3MG 1A3TA 2HCCA 2XGTA 2UU9L 1KRTA 4DR4L 1VQFA 5E3FA 4X66L 3STBD 2ZJQA 4R8IA 1E2ZA 1JWUD 2FHTA 4R4IA 1MJCA 4EQNA 2QA4A 3KDFA 3ULLA 2E76C 3TP7A 3DMUA 5IGFA 4ZLTF 1HZBA 1CM9A 4H13C 1PTOF 2AQ3B 2LKVA 1IL8A 4N9TA 1SR3A 3W5OA 2JA8G 4A4IA 4BWGB 1F9SA 2E74C 3M4OH 1S4ZA 2B39A 3M7GA 4K0KQ 1EWCA 1ESFA 4AYBE 1HH2P 4DR5L 1X3QA 4JI6Q 3HOVG 1VQMA 2A73B 4DA2A 5DAUA 1R4PB 1Y1WB 3L3OC 4DFAA 3I4MB 3HOXH 3I7FA 4Y7NB 2K03A 3AYHB 2LS01 4IUPA 3P1HA 1BXTA 4JC0A 2HQLA 4K8JA 2JA6B 1GM5A 1FYCA 2R6GA 1AE3A 1R4QB 1CA6A 4DXGA 1JCKB 1BVSA 4JVZA 1N34Q 2KECA 5IIFA 2Z9HA 3BDOA 3CQZB 4KKUA 1G2TA 3FEWX 2E2HB 3PUYA 1TWCB 2L55A 2UUBL 4KHZA 4ZCKA 3T4AC 4IUTA 2A6EC 2ATWA 2D9UA 1I3QH 3H0GH 3LX0A 4DR7L 2YTVA 1HNZQ 1OXVA 1CUKA 3SHLA 4Q0FA 5M5WB 4DV1Q 4DNTB 5M5YH 2E8GA 1GUTA 2Q2HA 4YY3L 2I5LX 4DUYL 1JB7A 4A3CH 4B3RQ 5FLXc 2K05A 3D0FA 2LSSA 5LL6S 5C3EH 4PV1C 1B1ZA 4TKOB 2JA7B 1OXTA 5EPLA 2NZHA 2KUMA 3DHQA 4ZRZA 1YIJA 1BF4A 1C0AA 3L2PA 3B6YA 5G3LF 1EY6A 2CCZA 3HKSA 4KI0A 3CPFA 4NXNQ 3E3XA 2YYZA 2K14A 3OPOA 4B3ML 2BA0A 2DJGC 3MXNB 4LF5Q 1PH4A 5I9PA 3C1EA 1UNSA 1YZ6A 4KMUC 1XMOL 2CVRA 2XRQD 4CDFC 3S17B 1SYGA 2JXMB 5J39A 2ZJPA 3NBIA 4XXEA 3F8TA 1WTHA 3J7ZC 5EKKA 2NB0A 5HURA 4G7OC 5C44G 1HNXL 1CHPD 5JVG3 1T9HA 3FRPB 1EQRA 4LUVA 3RZDB 2BDOA 3HP3A 3NENA 4LWCA 4GZYC 1GUNA 4JI0Q 3I73A 4J8QA 4DV7L 4BY1G 1GKHA 4K5XA 4JI3L 1EZ8A 2OWOA 2TSSA 2PO4A 3IL8A 4OELB 3VR2A 1YI2A 5CV5A 3HOWB 1KAWA 4YWMA 2HD3A 5FLMH 4O0AA 3TS2A 2F0MA 3NHHA 4GOPB 2OTJA 3P7JA 1KC8C 2R92B 1VQKA 5GAHC 2XNAC 2F4VQ 4ILWA 1WCMB 2N78A 3NUCA 2R61A 2IPKD 1O7ZA 3EIVA 1GUGA 1JOOA 3R2TA 3Q6SA 4HR7B 1FJGQ 3FPPA 1I4GA 2J7ZA 5JEAG 4A3MG 2UXCL 2QDBA 4DV2Q 4LMQD 1B44D 3UE0A 2VB3X 1A3UA 4QF4A 4NB3A 5CV9A 1Z9FA 5IP9H 2KHJA 5DM63 4G7ZC 2R93B 1QNUA 4RFBA 1PVOA 1CA5A 4JI7Q 2PNRC 3M3YB 1NBWA 1HZ9A 1BBUA 3F2DA 1GXDC 2PYKA 4H02A 4RGNA 1AFPA 3LWUA 2Y0SB 3OIPA 1K8GA 3A8KE 3FKIB 3NBHA 1E2WA 1I50B 1BKBA 3SK8A 4DF7A 1N32L 2CQOA 4CKEA 5I6WA 4S3SA 3EJIA 2JK8A 5M3MH 5GROA 4JYAL 4A93G 4JI8L 2PQAB 1BOSA 3KOJA 3KBGA 1EIFA 2B2WA 3KDFB 1IL2A 3GTQB 2F0DA 2OF1A 2Q8IB 2EE1A 2KEDA 4J6HA 1BCPC 3J80E 4ZKBB 1M8AA 1K0SA 4IQZA 3K5NA 4HIKA 2RDHA 4H7BA 4ZUIA 3L7ZC 1XMQL 1VQAA 3CRKC 2E2JH 2Q2UA 4YHHQ 2IHFA 2JA8H 3PO2G 4X3KA 5C0XI 2JN4A 2WB1E 3MEFA 2K5DA 1Y1VH 2K5HA 2RCFA 1I94L 1SYFA 3HOVH 1PRTB 3FVQA 3BU2A 1Y69U 4JI5L 2JJQA 2EY2A 4JI4Q 4UAIA 3K7UC 1PZKD 1NY4A 3JAME 4BY7B 1AH9A 3O13A 4B3SL 1AP0A 2F0PA 5IGGA 1HNWQ 3S24A 3RLOA 1YNJC 4LF9L 1FNUA 5ELBA 3BG3A 3J80L 1XXGA 4OWTB 4JV5L 1WTWA 1PTOD 1CKNB 4B3TL 3AB9A 2R7ZB 3IAYA 5DNFA 1HA5A 1B8AA 2QDLA 3S9WA 1CKOA 1PDQA 3HOUB 1WI5A 4IUQA 3EQLC 2HHHL 1LTGD 1S5CD 4JI2Q 2MGSA 5EPJA 1H9SB 2E5LQ 3GP7A 1EU3A 2K01A 4UP7A 4ZYSA 1N9WA 2QW7A 3I90A 3S2DH 5FOBB 2EY6A 1LT4D 1TVXA 5BR8Q 3TP5A 4AYBG 2A74C 2A19A 3J80i 1LYLA 5ELEA 1SNOA 1JE4A 3FHWA 2CHBD 4YWLA 1I4HA 5JPMC 4DR6L 3TZUA 2KVMA 1R9TH 2UU9Q 4C3JB 4L5RC 5D3DA 4DR4Q 4QUCA 4X66Q 2AUJD 2JE6I 4OX9L 1L2FA 4FF3A 1HTPA 4CDCC 1SE3A 4OGQC 4RMFA 5BN3A 2F0JA 2PW7A 1MI2A 2VQFL 2NZOA 4HMIA 2EYOA 1DXMA 4QL5A 4JPBW 4RA8A 4DV3L 1HHVA 2NVQB 2D0OA 5C0XJ 1SLJA 5LHY1 2RCNA 1EU4A 2F0NA 1AW7A 1SE4A 4R8NA 2YU9H 1SFOH 1LUZA 3E9HA 4HEDA 1X32A 3HOZB 4A3BG 3D6CA 4KV6A 5EPKA 4DR5Q 1KDCA 4BBSB 1IKMA 3S1MB 2MNAA 1Q3LA 1SNCA 4O42A 3PV0A 5F2DA 3ZYYX 3EBEA 1PFNA 4DK6C 2UXBL 2YV5A 2O4XA 4DXFA 2H5XA 1NR4A 4TQUS 4CBVA 1Q12A 1EWHA 4BY1H 4KTAA 3G6EA 1VQ4A 4XQNA 2ASBA 2XTIA 3R8BA 3BYTB 5IGBA 3I70A 3U4ZA 4CJ2C 1LABA 2I07B 1HZCA 4DR3L 5GAEC 1PYBA 1SAPA 1VQEA 3K0XA 4IALA 1ENFA 3AMUA 1EY0A 2L5TA 2K6AA 1TR5A 2PPBC 3A5UA 1E2VA 1EUJA 5E7NA 4DR7Q 2NVYB 4QY7A 1BO0A 4YY3Q 1TS5A 1WTQA 3MXUA 3E9IA 2OCEA 4JBWA 3M85A 1D8LA 4A3MH 1FVIA 4DUYQ 2B2UA 4M1UB 4IJLA 4C3IG 4A3KG 1SEBD 1IYVA 1IYJB 4LUOA 4K2LA 3M4QA 3Q24A 3G71A 4GKJQ 2C5CA 3RLNA 1TWAB 2LMCB 1XJVA 5IYDH 2HQEA 2EVBA 4ME3A 4XDXA 3SK6A 4DV0Q 2VXWA 1FNVA 2X69A 3OWFA 4TSSA 4B3MQ 2DY8A 1I3QB 3PO3B 4GNXB 1BCPF 3GV6A 4J1MA 5DEHA 3G48A 2NN6I 1Y8PB 1HUMA 1BQQT 1XMOQ 3OSOA 2KHIA 3HKZB 3J80c 2VL6A 1A3VA 3GTGB 4GS3A 4A3JB 4GLAC 1D6EC 3TP6A 4KKTA 5C3EB 1NCVA 3K57A 2CFMA 3HS0C 2MP1A 4L8JA 3K7AH 1HNXQ 5JAVA 3PF4A 4K5VA 3ONAB 1VMCA 4WRDA 2VNUD 1EY5A 2KCNA 2NWGA 3L9AX 4DV7Q 4K6LA 1V1OA 4UY8C 3CPWA 2A68C 1M1KC 1JOKA 4C1NK 1UE5A 1PYWD 3PO2H 4JI3Q 3IRBA 3TEHB 4HJ8A 1MJEA 4EVOA 3W1GA 5D65A 4XT1B 5IOCA 1K83H 2F0KA 4QQBX 2O5JC 4LF6L 3QOJA 3J7AV 3K5LA 2EIFA 2Y0SE 5EJWA 4MHEA 5I2YA 4P75A 5J1ZA 4DU9A 1G291 3NEMA 1RF2D 3VA5A 2NTTA 1HTLD 1UEAB 2ALYB 5EGTA 3PIPA 2XVSA 3I91A 2UXCQ 4FP5D 4P2CB 4XQJA 1PFMA 5LMNW 4GOPA 4UHVA 4C3HB 3J81L 5EQ0A 4BS9A 1TT2A 5IGEA 4IOCA 1BUVT 3NTKA 1JQYD 3RMHA 1N33Q 2EQSA 2HDLA 1L0XB 3GTLB 4GLXA 4A3FG 1OO9B 4OIKA 3OMGA 1QVFA 4ZKCB 3QIAA 2N88A 4L5QA 2WB1G 1TU2B 3EFXD 2HT1A 2A6ED 1K73C 4IFDI 1QE6A 3E6ZX 1N32Q 3F1ZA 1EOVA 3MFYA 1VQ6A 1STNA 3KBXA 2N3SA 4KK7A 5M3FG 3HOYB 4JYAQ 1VF5C 1VDZA 1C9OA 4JI8Q 3ER0A 3J81i 1VQDA 5IE8A 3HFZB 5ISRA 2C35B 1ASYA 1ILQA 2QEJC 4JOIA 1ICFB 4GKKL 1JJ2A 4RCOA 1A0IA 2OXPA 3TBIB 2IL8A 1RODA 3K59A 3SXHA 2IT1A 3K80C 1YJ9A 4B9XA 2B2WC 2OTLA 1SYCA 1SE8A 1U9RA 3A8JE 1VQJA 3S1NH 4GN5A 2K28A 2F52A 1X6OA 2FINB 2PQAA 2F03A 1A8VA 5E4WC 4CJ0B 5JVH3 1E24A 1JMCA 1YHAA 1I94Q 4A3BH 4A3GB 4HCEA 4BBRB 3D31A 5HGTA 4JI5Q 1LLRD 3PUVA 4FYDA 1SYBA 4DGZA 3HRZC 1V9PA 4B3SQ 3VR3A 3KUPA 3LNNA 2DY7A 1Y1VG 1EY8A 4EQOA 4JBMA 5H1SE 3OYYA 1KLUD 4LF9Q 1B53A 4E6IA 4HIOA 2CH4A 3F2CA 4KLKA 2LXKA 4JV5Q 3DLLA 1Y1WG 3I4OA 1DZ1A 5CV6A 1SNDA 1VF7A 4B3TQ 1SNQA 4R4OA 1Q1EA 1HXYD 1XWEA 5K5PA 3I4MG 3RD4A 2R7DA 2XWJB 3HEJA 2BH8A 1O7IA 3PGZA 1CSPA 2HHHQ 2XN9C 2ID0A 3QO2A 1Q82C 5CGKA 1IKLA 2RHQB 1YNXA 5I6YA 1NUCA 4R4QA 1HCZA 1Z47A 4LF4L 1QWYA 2EJMA 5KNDA 1WTOA 1WTVA 4IFDJ 5ELNA 4YIJA 1CKNA 2JEBI 1E3PA 2NVTB 1PYSB 3TZDA 2WV6D 2F0QA 1XNQL 3DWAA 5FK9C 4X65L 3IFDA 4C3IH 3E0EA 4LFCL 3S2HB 4A3KH 4MNOA 5BN5A 2K50A 1CFMA 5C3WA 4DR6Q 2Q2IA 4A3EB 3I3CA 2F0UA 3G4SA 1H9SA 4A3DB 3SDZA 3VA7A 5LMNL 1O7YA 1DONA 2IX0A 1QJOA 3CHBD 5KGUA 3CCLA 1MHWC 2VQFQ 4RG1A 3FPUB 4DV3Q 3SR1A 3EVQA 3S15H 4Q5VA 1CT1D 1ICWA 3H6MA 4C2MH 4JBKA 1RJTA 3VYTA 1GHKA 1NMGA 4DV5L 3NQIA 5C4JB 1U5KA 4JW0A 4HIMA 1C7YA 3I4NG 3VDYA 3TRZA 4AQYL 1KABA 3H3VC 3J81c 4EQ5A 1KTKA 1W3SA 1KNAA 4O2DA 4CDDC 2K33A 3FMCA 1KXLA 2SNSA 2E2IB 1BCPD 1TXYA 4WJ3M 1SN8A 3CMEA 2E2DC 4KY6A 3S14H 1S3OA 1DM0B 1F2MA 1ILPA 1L1OB 1WVLA 2EY1A 2EJFC 4DR3Q 4DKAC 4H44C 1U4LA 3U9OA 4APVA 3S1RB 3GTJH 3P20A 1TWFB 4CKCA 2YU9B 3RZOB 3PUWA 2EYJA 3UDGA 4IPHA 3W2DA 3PIO3 4HJAA 2K1BA 3RN2A 1QZGA 4KJOA 5GAGC 5C44B 2UXDL 2B2TA 2EYFA 3HOWG 1EIHA 2WAQE 3NELA 3CC2A 1B9NA 1MSGA 2K75A 1Y8OB 2KEEA 4DAYA 2R92G 2K5NA 3HKZE 1TWHB 3AFPA 1YNJD 5KEEA 1WFQA 1WCMG 2GN5A 1SYEA 3J7A5 4IUUA 4UPAA 1AZQA 2FMCA 1H9RA 3T1YL 2A69C 3CU7A 1B70B 2F0OA 1CZGA 2VQEL 2B2UC 1C48A 5M5XB 1F77A 2CWPA 2NUCA 4EX5A 4A3FH 1HUNA 4A3IG 2K5QA 5KIXA 1MBYA
chains in the Genus database with same CATH topology
1IXRA 2JA6G 2JE6I 4OX9L 1L2FA 4QJFA 2D0PA 3OTOL 2ZTCA 3RN5A 2FXQA 4RMFA 4OONA 5IP7H 2A1AA 1PH5A 3JC66 1K9MC 1G6PA 2NVYH 1VQPA 2VQFL 1GD7A 1X3GA 2NZOA 5IYDG 4QL5A 3U50C 1QUQB 4DV3L 1KXLA 3JAMc 1DGSA 1FGUA 1E22A 4PG3A 5M3FH 4LNQA 2D0OA 3CP0A 4GN3B 4JCVE 3UDIA 2WP8J 5C0XJ 1SLJA 1Q8KA 2RCNA 3M9BA 5HY6A 5FJ8H 1VQ7A 4WJ4A 3UDFA 3CCEA 2YU9H 1G51A 4YHHL 1SFOH 4A3EG 4KHPL 1LUZA 3E9HA 2B3GA 2VY3A 1TWAH 1UWVA 1MKHA 3Q8DA 4A3BG 4DR5Q 5IYBH 4LFAQ 4A3DG 3KF8B 2MNAA 4OX9Q 2Z6KA 4GNXA 4Y52H 3K81C 2A8VA 3PV0A 4IJHA 3KJPA 3EBEA 3H3VH 3M7NA 4DK6C 2MO1A 2UXBL 2YV5A 2YTYA 1UEBA 2H5XA 1JE5A 3A0JA 5FLMG 3CC7A 4TQUS 2JA7G 1Q12A 2KCMA 2GVBA 4IPDA 1QVGA 4BY1H 4JI4L 3H3VI 3PO3H 5JJLA 1GO3E 3M4PA 3G6EA 2JQOA 1VQ4A 1IBML 2R7FA 1Q7YC 5JEAJ 2ASBA 2N8NA 2XTIA 2BH2A 1HNWL 1KHIA 3U4ZA 3GTGH 3ZJYC 4A3JH 2VW9A 1HZCA 4JI1L 1VCIA 4DR3L 5GAEC 4DR1L 1XPUA 1PYBA 1PH3A 2UUCL 1VQEA 2QGQA 1IBLL 3K0XA 4DV4L 3LGJA 3ULJA 3HOYG 3GTPH 4MZ9A 3W1BA 2ZJRA 1YITA 4GKJL 4BXXG 5IYCH 2UXBQ 2K52A 3DM3A 3A5UA 1EUJA 3CF5A 5E7NA 5IP9G 3KFUA 3STBC 1Y1WH 4LFBL 1IBKL 4DR7Q 1K0RA 5GADC 4DV0L 2Z6KC 4JI2L 3CXCA 4R4CA 2I5MX 4PZ6A 1VQNA 4BY7G 4QY7A 3KF6B 3CCVA 5GQOA 4YY3Q 5IWAQ 4OO1I 1Y14B 3I4MH 1CKMA 3E9IA 3U4VA 2OCEA 4JBWA 1LM0A 1D8LA 4Y7NH 3M85A 3CCJA 1FVIA 3CCMA 4DR2Q 2HIXA 2OQKA 4DUYQ 4A3MH 1NJIC 2AMCB 1P16A 3GTKH 1SRUA 1X65A 5HGQA 4IJLA 5BR8L 4HJ9A 3GTOH 4A3KG 1B7YB 1YVCA 1PV4A 1IYJB 2D62A 2BA1A 4LF8Q 2B63G 4LUOA 3KJOA 3CD6A 4GOPC 4HIDA 1GVPA 3M4QA 2NVXH 3G71A 4GKJQ 2CWAA 2KENA 3RLNA 1X3EA 2R7ZG 5AJ3L 4OWXB 1XJVA 3J81j 1U0LA 4LF7L 3CQZH 5M3MG 5IYDH 1TWCH 2XGTA 2UU9L 3HOUG 4ME3A 4A3LH 3BZKA 1KRTA 3CAMA 4DR4L 3T1HL 1VQFA 4DV0Q 4X66L 3CC4A 3STBD 1W2BA 2ZJQA 3A74A 4B3MQ 4R4IA 1MJCA 2AWNA 2KCTA 4GNXB 4XIGS 4DUZQ 3FP9A 2QA4A 3G48A 2NN6I 3KDFA 3ULLA 3TREA 2DUDA 1P8LA 1XMOQ 1VQ5A 1NTGA 3ULPA 2NVQH 2KHIA 4C3HH 3S16H 1HZBA 3J80c 2VL6A 5JJIA 4J15A 4GS3A 5ELOA 4GLAC 1WYDA 4GKKQ 3W5OA 1SR3A 2JA8G 4P71A 4A4IA 3M4OH 4YCUA 1Q1BA 2CFMA 4K0KQ 3GTLH 4P73A 2I0QA 2RF4A 3K7AH 1HNXQ 4AYBE 3GD7A 1HH2P 3PF4A 4DR5L 4LFAL 4JI6Q 1YEZA 3HOVG 4JOIC 1VQMA 2VNUD 4X6AH 2V1CC 4OXPA 3PF5A 2R93G 1PH8A 4DV7Q 5C4XG 4UY8C 1YBYA 3CPWA 4POFA 1M1KC 4DK3C 1UE5A 3PO2H 4JI3Q 3HOXH 3IRBA 3I7FA 4IO9A 3I4NH 3AYHB 3CW2C 3HOYH 1PH6A 1M90C 1VQ9A 4GN4B 3TEHB 4HJ8A 1MJEA 2Y0SG 4JC0A 2HQLA 3W1GA 3S1QH 2VZAA 3FKIG 1GM5A 2UUAQ 3CCRA 2R6GA 1AE3A 2PNHA 1K83H 4QQBX 4JG2A 3F2BA 3WWVA 3SGIA 2JA5H 4LF6L 3HOZG 1BVSA 1TWGH 1N34Q 4BBSG 1N33L 2EIFA 4UP9A 2Y0SE 3PUYA 1IZ6A 2UUBL 4KHZA 4P75A 4BA1I 1AE2A 2RHSB 1MIUA 1VQLA 1G291 3NEMA 2ATWA 3GTMH 1I3QH 3H0GH 4DR7L 2YTVA 1HNZQ 1OXVA 3PIPA 1CUKA 2ALYB 4DV1Q 2Q2TA 2UXCQ 5M5YH 2E8GA 2Q2HA 4YY3L 5IWAL 5LMNW 4GOPA 1YHQA 3AEVA 1KRSA 4A3GH 1VQ8A 2YTXA 1N8RC 4BBRH 1SROA 1UE1A 3PSIA 4DR2L 2I5LX 4DUYL 1X3FA 1JB7A 4A3CH 4B3RQ 5FLXc 4FDBA 3D0FA 4XTCS 4DV6Q 4HJ5A 4IOCA 4LF4Q 2VUMG 2LSSA 4DAYB 5C3EH 4LF6Q 3HOWH 3H15A 3GO5A 3GDEA 2IHEA 1N33Q 1A63A 2ES2A 4LF8L 2EQSA 4DAMA 1PH7A 5DLQE 1OXTA 4GLXA 4A3FG 2NZHA 2R92H 2UUBQ 2MQHA 4YCWA 1QVFA 1YIJA 1FL0A 2HIVA 1C0AA 3L2PA 1XNQQ 3B6YA 4L5QA 4X65Q 2WB1G 1PH1A 2CCZA 1L1OC 1WCMH 4LFCQ 2HT1A 1OXSC 3HKSA 4KI0A 3CPFA 1K73C 4NXNQ 4IFDI 1SMXA 5IP7G 5JJKA 1N32Q 3F1ZA 2YYZA 2K14A 1EOVA 4P74A 4B3ML 1L0WA 2BA0A 1WOCA 3MXNB 1VQ6A 3BZCA 1I5FA 4LF5Q 1OXUA 1PH4A 2KBNA 1J6QA 2N3SA 5M3FG 4DUZL 4JYAQ 1YZ6A 5LMNQ 1C9OA 4A3IH 4BA2I 4HJ7A 4JI8Q 1XMOL 2AWOA 3ER0A 3TS0A 3J81i 1VQDA 5IE8A 2JA6H 3HFZB 1HR0W 1PH2A 1QUQA 5FJ8G 2C35B 1ASYA 2ZJPA 1X9NA 4L5TA 4JOIA 2R93H 4POGA 4GKKL 2MO0A 1HJPA 1KL9A 3F8TA 1VQCA 3M3YH 3J7ZC 4PZ8A 1JJ2A 1A0IA 3OW2A 4K0KL 2E2HH 3CCSA 5C44G 3U58A 1HNXL 2IT1A 3K80C 1YJ9A 1T9HA 4LUVA 1EQRA 2OTLA 2NVTH 4JI6L 4LWCA 3NENA 1XPRA 1SE8A 4DV5Q 1EQQA 1VQJA 3S1NH 2WFWA 4GN5A 2ZM6Q 2LXJA 2F52A 4A76A 3S2HH 3FKIH 4JI0Q 3K8AA 1YJNA 1I50H 1X6OA 4DV7L 5M5WH 2PQAA 4BY1G 3PO3G 1GKHA 1A8VA 4A3EH 1E24A 3BJUA 4AQYQ 1JMCA 1JT8A 1PFSA 1YHAA 1I94Q 4JI3L 4A3BH 1S72A 2OWOA 4A3DH 4X64Q 4X62Q 3I55A 4L5SA 4IOAA 1XNRQ 5C0XG 3D31A 4IPGA 1N36Q 4JI5Q 4A3JG 1J5EQ 3PUVA 2ZTDA 1YI2A 3A5ZB 1QVCA 3KYHC 1HR0Q 2UUAL 1KAWA 1V9PA 4YWMA 4B3SQ 5FLMH 4LUZA 4O0AA 3TS2A 4GOPB 2JA7H 3GTQH 1V43A 2OTJA 1KC8C 1Y1VG 2N49A 2VS1A 4JBMA 5H1SE 3OYYA 1VQKA 1OXXK 1N34L 1NE3A 4LF9Q 3I4NG 5GAHC 5IYCG 2F4VQ 4HIOA 4OO1G 2N78A 4DNIA 3F2CA 4KLKA 2LXKA 4JV5Q 3DLLA 1Y1WG 3I4OA 4YWKA 1VQHA 3CMAA 3EIVA 4B3TQ 2QEXA 5IT9c 4R4OA 1Q1EA 5C4JH 1XTDA 3I4MG 1FJGQ 1PH9A 1HNZL 2R7DA 5JEAG 2BH8A 4DV1L 4YCVA 4A3MG 4P72A 1QZHA 2UXCL 1O7IA 3PGZA 4DV2Q 1I6HH 1CSPA 3UE0A 2HHHQ 4BXXH 2UXDQ 2OQ0A 2ID0A 3ERSX 1Q82C 1EWIA 4NPSA 3S17H 2RHQB 4B3RL 1YNXA 4NB3A 1HZAA 1Z9FA 4R4QA 5IP9H 5J3BA 4DV6L 1Z47A 2KHJA 4LF4L 1X54A 5K36G 1L1OA 1PVOA 4BY7H 4JI7Q 2E2IH 2K5VA 4IFDJ 1NBWA 2Z0SA 1HZ9A 5ELNA 1BBUA 1CKNA 1E7ZA 4MTNA 3F2DA 1WJJA 2JEBI 1PHJA 5EAYA 1YHBA 4A3LG 1E3PA 4H02A 3JAMi 1PYSB 3RZDH 1XNQL 4X65L 4IPCA 3T1YQ 4C3IH 3E0EA 2NN6G 4LFCL 2CKZB 1K8GA 4A3KH 4MNOA 4QIWE 4NXNL 2VQEQ 5LMUQ 3S1RH 2K50A 1BKBA 2B63H 4DR6Q 1TWFH 1N32L 2CQOA 4NXMQ 2Q2IA 3RZOH 2IY5B 3L0OA 1E1TA 3G4SA 2R7ZH 4LF5L 2JK8A 5M3MH 3HOUH 3OTOQ 3KLWA 3AFQA 5GROA 5LMNL 1VQOA 4JYAL 5C44H 4A93G 2DGYA 2IX0A 4JI8L 1LTLA 2PQAB 1EYGA 1Q46A 3KOJA 3CCLA 1EIFA 3KDFB 1IL2A 1KQSA 2VQFQ 1VQGA 2PI2E 4RG1A 3UE1A 4DV3Q 1BBWA 1TWHH 4AIMA 4GLVB 3S15H 2AHOB 1JJCB 4LW1A 4HIKA 2I5HA 3L7ZC 1XMQL 1VQAA 4PZ7A 3RLFA 4C2MH 1VQBA 2E2JH 4JBKA 2Q2UA 1ASZA 1NMGA 4YHHQ 4DV5L 2ZM6L 4KHPQ 2IHFA 4JI0L 2JA8H 3PO2G 1U5KA 3HOXG 4HIMA 1Q81C 3I56A 4DPGA 5C0XI 1C7YA 4UP8A 2WB1E 3MEFA 5M5XH 3VDYA 2PMZE 3TQYA 3RR5A 2K5HA 1Y1VH 4AQYL 3TRZA 1D7QA 4C3JH 1I94L 3J81c 1E1OA 4EQ5A 4X64L 3UDXA 4X62L 1EIYB 3HOVH 4AH6A 1XNRL 1UE6A 3BU2A 1N36L 4JI5L 1W3SA 2F3IA 4O2DA 1J5EL 2JJQA 4R1JA 1X56A 1X55A 1PA6A 3PUXA 4JI4Q 1V1QA 5C4XH 3K7UC 1HR0L 1NY4A 4A75A 4GNXC 1IBMQ 2JA5G 1AH9A 3PIOA 4B3SL 1H95A 3I2ZA 5IYBG 1OTCA 1K8AC 2ZTEA 1HNWQ 1TXYA 3PUZA 3S24A 2E5LL 1XMQQ 3RLOA 4WJ3M 3ICEA 1SN8A 3CMEA 4LF9L 2GVAA 1S3OA 4OWWB 3S14H 2F4VL 1KD1C 1L1OB 4JI1Q 4DR3Q 3RNUA 4DR1Q 4OWTB 4DKAC 3CCQA 5IY0A 4JV5L 2MFIA 3H0GG 4APVA 1NMFA 4JBJA 1IBLQ 3GTJH 4DV4Q 2UUCQ 1CKNB 1RIPA 4B3TL 2L15A 2WAQG 3EN2A 3PUWA 3HOZH 1K3RA 1JJGA 4BBSH 1RL2A 3UDGA 1FJGL 4A3GG 1B8AA 3S1MH 4IPHA 4HJAA 4BBRG 3RN2A 1CKOA 3HKZG 4TVAB 1QZGA 4A3CG 1WI5A 1Q86C 3NBHB 4DV2L 5GAGC 2HHHL 2UXDL 2PI2A 1IBKQ 3AQQA 4LFBQ 5C3EG 4JI2Q 3HOWG 1CSQA 4R4TA 1EFWA 2WAQE 3NELA 1VQIA 3CC2A 2E5LQ 2K75A 1A62A 4IFDG 4UP7A 2K5NA 3HKZE 4JI7L 2R92G 1N9WA 2EXDA 2JA9A 3AFPA 3CCUA 4QGUA 1YJWA 3S2DH 1UE7A 5BR8Q 1WFQA 1WCMG 2GN5A 2K4KA 1KIXA 3J7A5 3PCOB 4AYBG 2IX1A 4UPAA 2A19A 3J80i 1S40A 1LYLA 4A93H 2VUMH 3T1YL 1XPOA 1B70B 5LMUL 2VQEL 2B29A 3FHWA 4ALPA 5AJ3Q 4LF7Q 4YWLA 4DR6L 4NXML 2CWPA 4EX5A 4A3FH 1R9TH 2JEAI 1VS0A 4PMWA 3KF6A 2UU9Q 4A3IG 4L5RC 2AKWB 4DR4Q 3T1HQ 4X66Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXR A;  2JA6 G;  2JE6 I;  4OX9 L;  1L2F A;  4QJF A;  2D0P A;  3OTO L;  2ZTC A;  3RN5 A;  2FXQ A;  4RMF A;  4OON A;  5IP7 H;  2A1A A;  1PH5 A;  3JC6 6;  1K9M C;  1G6P A;  2NVY H;  1VQP A;  2VQF L;  1GD7 A;  1X3G A;  2NZO A;  5IYD G;  4QL5 A;  3U50 C;  1QUQ B;  4DV3 L;  1KXL A;  3JAM c;  1DGS A;  1FGU A;  1E22 A;  4PG3 A;  5M3F H;  4LNQ A;  2D0O A;  3CP0 A;  4GN3 B;  4JCV E;  3UDI A;  2WP8 J;  5C0X J;  1SLJ A;  1Q8K A;  2RCN A;  3M9B A;  5HY6 A;  5FJ8 H;  1VQ7 A;  4WJ4 A;  3UDF A;  3CCE A;  2YU9 H;  1G51 A;  4YHH L;  1SFO H;  4A3E G;  4KHP L;  1LUZ A;  3E9H A;  2B3G A;  2VY3 A;  1TWA H;  1UWV A;  1MKH A;  3Q8D A;  4A3B G;  4DR5 Q;  5IYB H;  4LFA Q;  4A3D G;  3KF8 B;  2MNA A;  4OX9 Q;  2Z6K A;  4GNX A;  4Y52 H;  3K81 C;  2A8V A;  3PV0 A;  4IJH A;  3KJP A;  3EBE A;  3H3V H;  3M7N A;  4DK6 C;  2MO1 A;  2UXB L;  2YV5 A;  2YTY A;  1UEB A;  2H5X A;  1JE5 A;  3A0J A;  5FLM G;  3CC7 A;  4TQU S;  2JA7 G;  1Q12 A;  2KCM A;  2GVB A;  4IPD A;  1QVG A;  4BY1 H;  4JI4 L;  3H3V I;  3PO3 H;  5JJL A;  1GO3 E;  3M4P A;  3G6E A;  2JQO A;  1VQ4 A;  1IBM L;  2R7F A;  1Q7Y C;  5JEA J;  2ASB A;  2N8N A;  2XTI A;  2BH2 A;  1HNW L;  1KHI A;  3U4Z A;  3GTG H;  3ZJY C;  4A3J H;  2VW9 A;  1HZC A;  4JI1 L;  1VCI A;  4DR3 L;  5GAE C;  4DR1 L;  1XPU A;  1PYB A;  1PH3 A;  2UUC L;  1VQE A;  2QGQ A;  1IBL L;  3K0X A;  4DV4 L;  3LGJ A;  3ULJ A;  3HOY G;  3GTP H;  4MZ9 A;  3W1B A;  2ZJR A;  1YIT A;  4GKJ L;  4BXX G;  5IYC H;  2UXB Q;  2K52 A;  3DM3 A;  3A5U A;  1EUJ A;  3CF5 A;  5E7N A;  5IP9 G;  3KFU A;  3STB C;  1Y1W H;  4LFB L;  1IBK L;  4DR7 Q;  1K0R A;  5GAD C;  4DV0 L;  2Z6K C;  4JI2 L;  3CXC A;  4R4C A;  2I5M X;  4PZ6 A;  1VQN A;  4BY7 G;  4QY7 A;  3KF6 B;  3CCV A;  5GQO A;  4YY3 Q;  5IWA Q;  4OO1 I;  1Y14 B;  3I4M H;  1CKM A;  3E9I A;  3U4V A;  2OCE A;  4JBW A;  1LM0 A;  1D8L A;  4Y7N H;  3M85 A;  3CCJ A;  1FVI A;  3CCM A;  4DR2 Q;  2HIX A;  2OQK A;  4DUY Q;  4A3M H;  1NJI C;  2AMC B;  1P16 A;  3GTK H;  1SRU A;  1X65 A;  5HGQ A;  4IJL A;  5BR8 L;  4HJ9 A;  3GTO H;  4A3K G;  1B7Y B;  1YVC A;  1PV4 A;  1IYJ B;  2D62 A;  2BA1 A;  4LF8 Q;  2B63 G;  4LUO A;  3KJO A;  3CD6 A;  4GOP C;  4HID A;  1GVP A;  3M4Q A;  2NVX H;  3G71 A;  4GKJ Q;  2CWA A;  2KEN A;  3RLN A;  1X3E A;  2R7Z G;  5AJ3 L;  4OWX B;  1XJV A;  3J81 j;  1U0L A;  4LF7 L;  3CQZ H;  5M3M G;  5IYD H;  1TWC H;  2XGT A;  2UU9 L;  3HOU G;  4ME3 A;  4A3L H;  3BZK A;  1KRT A;  3CAM A;  4DR4 L;  3T1H L;  1VQF A;  4DV0 Q;  4X66 L;  3CC4 A;  3STB D;  1W2B A;  2ZJQ A;  3A74 A;  4B3M Q;  4R4I A;  1MJC A;  2AWN A;  2KCT A;  4GNX B;  4XIG S;  4DUZ Q;  3FP9 A;  2QA4 A;  3G48 A;  2NN6 I;  3KDF A;  3ULL A;  3TRE A;  2DUD A;  1P8L A;  1XMO Q;  1VQ5 A;  1NTG A;  3ULP A;  2NVQ H;  2KHI A;  4C3H H;  3S16 H;  1HZB A;  3J80 c;  2VL6 A;  5JJI A;  4J15 A;  4GS3 A;  5ELO A;  4GLA C;  1WYD A;  4GKK Q;  3W5O A;  1SR3 A;  2JA8 G;  4P71 A;  4A4I A;  3M4O H;  4YCU A;  1Q1B A;  2CFM A;  4K0K Q;  3GTL H;  4P73 A;  2I0Q A;  2RF4 A;  3K7A H;  1HNX Q;  4AYB E;  3GD7 A;  1HH2 P;  3PF4 A;  4DR5 L;  4LFA L;  4JI6 Q;  1YEZ A;  3HOV G;  4JOI C;  1VQM A;  2VNU D;  4X6A H;  2V1C C;  4OXP A;  3PF5 A;  2R93 G;  1PH8 A;  4DV7 Q;  5C4X G;  4UY8 C;  1YBY A;  3CPW A;  4POF A;  1M1K C;  4DK3 C;  1UE5 A;  3PO2 H;  4JI3 Q;  3HOX H;  3IRB A;  3I7F A;  4IO9 A;  3I4N H;  3AYH B;  3CW2 C;  3HOY H;  1PH6 A;  1M90 C;  1VQ9 A;  4GN4 B;  3TEH B;  4HJ8 A;  1MJE A;  2Y0S G;  4JC0 A;  2HQL A;  3W1G A;  3S1Q H;  2VZA A;  3FKI G;  1GM5 A;  2UUA Q;  3CCR A;  2R6G A;  1AE3 A;  2PNH A;  1K83 H;  4QQB X;  4JG2 A;  3F2B A;  3WWV A;  3SGI A;  2JA5 H;  4LF6 L;  3HOZ G;  1BVS A;  1TWG H;  1N34 Q;  4BBS G;  1N33 L;  2EIF A;  4UP9 A;  2Y0S E;  3PUY A;  1IZ6 A;  2UUB L;  4KHZ A;  4P75 A;  4BA1 I;  1AE2 A;  2RHS B;  1MIU A;  1VQL A;  1G29 1;  3NEM A;  2ATW A;  3GTM H;  1I3Q H;  3H0G H;  4DR7 L;  2YTV A;  1HNZ Q;  1OXV A;  3PIP A;  1CUK A;  2ALY B;  4DV1 Q;  2Q2T A;  2UXC Q;  5M5Y H;  2E8G A;  2Q2H A;  4YY3 L;  5IWA L;  5LMN W;  4GOP A;  1YHQ A;  3AEV A;  1KRS A;  4A3G H;  1VQ8 A;  2YTX A;  1N8R C;  4BBR H;  1SRO A;  1UE1 A;  3PSI A;  4DR2 L;  2I5L X;  4DUY L;  1X3F A;  1JB7 A;  4A3C H;  4B3R Q;  5FLX c;  4FDB A;  3D0F A;  4XTC S;  4DV6 Q;  4HJ5 A;  4IOC A;  4LF4 Q;  2VUM G;  2LSS A;  4DAY B;  5C3E H;  4LF6 Q;  3HOW H;  3H15 A;  3GO5 A;  3GDE A;  2IHE A;  1N33 Q;  1A63 A;  2ES2 A;  4LF8 L;  2EQS A;  4DAM A;  1PH7 A;  5DLQ E;  1OXT A;  4GLX A;  4A3F G;  2NZH A;  2R92 H;  2UUB Q;  2MQH A;  4YCW A;  1QVF A;  1YIJ A;  1FL0 A;  2HIV A;  1C0A A;  3L2P A;  1XNQ Q;  3B6Y A;  4L5Q A;  4X65 Q;  2WB1 G;  1PH1 A;  2CCZ A;  1L1O C;  1WCM H;  4LFC Q;  2HT1 A;  1OXS C;  3HKS A;  4KI0 A;  3CPF A;  1K73 C;  4NXN Q;  4IFD I;  1SMX A;  5IP7 G;  5JJK A;  1N32 Q;  3F1Z A;  2YYZ A;  2K14 A;  1EOV A;  4P74 A;  4B3M L;  1L0W A;  2BA0 A;  1WOC A;  3MXN B;  1VQ6 A;  3BZC A;  1I5F A;  4LF5 Q;  1OXU A;  1PH4 A;  2KBN A;  1J6Q A;  2N3S A;  5M3F G;  4DUZ L;  4JYA Q;  1YZ6 A;  5LMN Q;  1C9O A;  4A3I H;  4BA2 I;  4HJ7 A;  4JI8 Q;  1XMO L;  2AWO A;  3ER0 A;  3TS0 A;  3J81 i;  1VQD A;  5IE8 A;  2JA6 H;  3HFZ B;  1HR0 W;  1PH2 A;  1QUQ A;  5FJ8 G;  2C35 B;  1ASY A;  2ZJP A;  1X9N A;  4L5T A;  4JOI A;  2R93 H;  4POG A;  4GKK L;  2MO0 A;  1HJP A;  1KL9 A;  3F8T A;  1VQC A;  3M3Y H;  3J7Z C;  4PZ8 A;  1JJ2 A;  1A0I A;  3OW2 A;  4K0K L;  2E2H H;  3CCS A;  5C44 G;  3U58 A;  1HNX L;  2IT1 A;  3K80 C;  1YJ9 A;  1T9H A;  4LUV A;  1EQR A;  2OTL A;  2NVT H;  4JI6 L;  4LWC A;  3NEN A;  1XPR A;  1SE8 A;  4DV5 Q;  1EQQ A;  1VQJ A;  3S1N H;  2WFW A;  4GN5 A;  2ZM6 Q;  2LXJ A;  2F52 A;  4A76 A;  3S2H H;  3FKI H;  4JI0 Q;  3K8A A;  1YJN A;  1I50 H;  1X6O A;  4DV7 L;  5M5W H;  2PQA A;  4BY1 G;  3PO3 G;  1GKH A;  1A8V A;  4A3E H;  1E24 A;  3BJU A;  4AQY Q;  1JMC A;  1JT8 A;  1PFS A;  1YHA A;  1I94 Q;  4JI3 L;  4A3B H;  1S72 A;  2OWO A;  4A3D H;  4X64 Q;  4X62 Q;  3I55 A;  4L5S A;  4IOA A;  1XNR Q;  5C0X G;  3D31 A;  4IPG A;  1N36 Q;  4JI5 Q;  4A3J G;  1J5E Q;  3PUV A;  2ZTD A;  1YI2 A;  3A5Z B;  1QVC A;  3KYH C;  1HR0 Q;  2UUA L;  1KAW A;  1V9P A;  4YWM A;  4B3S Q;  5FLM H;  4LUZ A;  4O0A A;  3TS2 A;  4GOP B;  2JA7 H;  3GTQ H;  1V43 A;  2OTJ A;  1KC8 C;  1Y1V G;  2N49 A;  2VS1 A;  4JBM A;  5H1S E;  3OYY A;  1VQK A;  1OXX K;  1N34 L;  1NE3 A;  4LF9 Q;  3I4N G;  5GAH C;  5IYC G;  2F4V Q;  4HIO A;  4OO1 G;  2N78 A;  4DNI A;  3F2C A;  4KLK A;  2LXK A;  4JV5 Q;  3DLL A;  1Y1W G;  3I4O A;  4YWK A;  1VQH A;  3CMA A;  3EIV A;  4B3T Q;  2QEX A;  5IT9 c;  4R4O A;  1Q1E A;  5C4J H;  1XTD A;  3I4M G;  1FJG Q;  1PH9 A;  1HNZ L;  2R7D A;  5JEA G;  2BH8 A;  4DV1 L;  4YCV A;  4A3M G;  4P72 A;  1QZH A;  2UXC L;  1O7I A;  3PGZ A;  4DV2 Q;  1I6H H;  1CSP A;  3UE0 A;  2HHH Q;  4BXX H;  2UXD Q;  2OQ0 A;  2ID0 A;  3ERS X;  1Q82 C;  1EWI A;  4NPS A;  3S17 H;  2RHQ B;  4B3R L;  1YNX A;  4NB3 A;  1HZA A;  1Z9F A;  4R4Q A;  5IP9 H;  5J3B A;  4DV6 L;  1Z47 A;  2KHJ A;  4LF4 L;  1X54 A;  5K36 G;  1L1O A;  1PVO A;  4BY7 H;  4JI7 Q;  2E2I H;  2K5V A;  4IFD J;  1NBW A;  2Z0S A;  1HZ9 A;  5ELN A;  1BBU A;  1CKN A;  1E7Z A;  4MTN A;  3F2D A;  1WJJ A;  2JEB I;  1PHJ A;  5EAY A;  1YHB A;  4A3L G;  1E3P A;  4H02 A;  3JAM i;  1PYS B;  3RZD H;  1XNQ L;  4X65 L;  4IPC A;  3T1Y Q;  4C3I H;  3E0E A;  2NN6 G;  4LFC L;  2CKZ B;  1K8G A;  4A3K H;  4MNO A;  4QIW E;  4NXN L;  2VQE Q;  5LMU Q;  3S1R H;  2K50 A;  1BKB A;  2B63 H;  4DR6 Q;  1TWF H;  1N32 L;  2CQO A;  4NXM Q;  2Q2I A;  3RZO H;  2IY5 B;  3L0O A;  1E1T A;  3G4S A;  2R7Z H;  4LF5 L;  2JK8 A;  5M3M H;  3HOU H;  3OTO Q;  3KLW A;  3AFQ A;  5GRO A;  5LMN L;  1VQO A;  4JYA L;  5C44 H;  4A93 G;  2DGY A;  2IX0 A;  4JI8 L;  1LTL A;  2PQA B;  1EYG A;  1Q46 A;  3KOJ A;  3CCL A;  1EIF A;  3KDF B;  1IL2 A;  1KQS A;  2VQF Q;  1VQG A;  2PI2 E;  4RG1 A;  3UE1 A;  4DV3 Q;  1BBW A;  1TWH H;  4AIM A;  4GLV B;  3S15 H;  2AHO B;  1JJC B;  4LW1 A;  4HIK A;  2I5H A;  3L7Z C;  1XMQ L;  1VQA A;  4PZ7 A;  3RLF A;  4C2M H;  1VQB A;  2E2J H;  4JBK A;  2Q2U A;  1ASZ A;  1NMG A;  4YHH Q;  4DV5 L;  2ZM6 L;  4KHP Q;  2IHF A;  4JI0 L;  2JA8 H;  3PO2 G;  1U5K A;  3HOX G;  4HIM A;  1Q81 C;  3I56 A;  4DPG A;  5C0X I;  1C7Y A;  4UP8 A;  2WB1 E;  3MEF A;  5M5X H;  3VDY A;  2PMZ E;  3TQY A;  3RR5 A;  2K5H A;  1Y1V H;  4AQY L;  3TRZ A;  1D7Q A;  4C3J H;  1I94 L;  3J81 c;  1E1O A;  4EQ5 A;  4X64 L;  3UDX A;  4X62 L;  1EIY B;  3HOV H;  4AH6 A;  1XNR L;  1UE6 A;  3BU2 A;  1N36 L;  4JI5 L;  1W3S A;  2F3I A;  4O2D A;  1J5E L;  2JJQ A;  4R1J A;  1X56 A;  1X55 A;  1PA6 A;  3PUX A;  4JI4 Q;  1V1Q A;  5C4X H;  3K7U C;  1HR0 L;  1NY4 A;  4A75 A;  4GNX C;  1IBM Q;  2JA5 G;  1AH9 A;  3PIO A;  4B3S L;  1H95 A;  3I2Z A;  5IYB G;  1OTC A;  1K8A C;  2ZTE A;  1HNW Q;  1TXY A;  3PUZ A;  3S24 A;  2E5L L;  1XMQ Q;  3RLO A;  4WJ3 M;  3ICE A;  1SN8 A;  3CME A;  4LF9 L;  2GVA A;  1S3O A;  4OWW B;  3S14 H;  2F4V L;  1KD1 C;  1L1O B;  4JI1 Q;  4DR3 Q;  3RNU A;  4DR1 Q;  4OWT B;  4DKA C;  3CCQ A;  5IY0 A;  4JV5 L;  2MFI A;  3H0G G;  4APV A;  1NMF A;  4JBJ A;  1IBL Q;  3GTJ H;  4DV4 Q;  2UUC Q;  1CKN B;  1RIP A;  4B3T L;  2L15 A;  2WAQ G;  3EN2 A;  3PUW A;  3HOZ H;  1K3R A;  1JJG A;  4BBS H;  1RL2 A;  3UDG A;  1FJG L;  4A3G G;  1B8A A;  3S1M H;  4IPH A;  4HJA A;  4BBR G;  3RN2 A;  1CKO A;  3HKZ G;  4TVA B;  1QZG A;  4A3C G;  1WI5 A;  1Q86 C;  3NBH B;  4DV2 L;  5GAG C;  2HHH L;  2UXD L;  2PI2 A;  1IBK Q;  3AQQ A;  4LFB Q;  5C3E G;  4JI2 Q;  3HOW G;  1CSQ A;  4R4T A;  1EFW A;  2WAQ E;  3NEL A;  1VQI A;  3CC2 A;  2E5L Q;  2K75 A;  1A62 A;  4IFD G;  4UP7 A;  2K5N A;  3HKZ E;  4JI7 L;  2R92 G;  1N9W A;  2EXD A;  2JA9 A;  3AFP A;  3CCU A;  4QGU A;  1YJW A;  3S2D H;  1UE7 A;  5BR8 Q;  1WFQ A;  1WCM G;  2GN5 A;  2K4K A;  1KIX A;  3J7A 5;  3PCO B;  4AYB G;  2IX1 A;  4UPA A;  2A19 A;  3J80 i;  1S40 A;  1LYL A;  4A93 H;  2VUM H;  3T1Y L;  1XPO A;  1B70 B;  5LMU L;  2VQE L;  2B29 A;  3FHW A;  4ALP A;  5AJ3 Q;  4LF7 Q;  4YWL A;  4DR6 L;  4NXM L;  2CWP A;  4EX5 A;  4A3F H;  1R9T H;  2JEA I;  1VS0 A;  4PMW A;  3KF6 A;  2UU9 Q;  4A3I G;  4L5R C;  2AKW B;  4DR4 Q;  3T1H Q;  4X66 Q; 
#chains in the Genus database with same CATH topology
 1IXR A;  1BBX C;  2FXQ A;  3HGB A;  1PLF A;  1WTP A;  3C46 A;  1IW7 C;  4DN4 M;  4MTK A;  2B2V A;  4RKL A;  2F0E A;  5IYD G;  3U50 C;  1LV9 A;  1O80 A;  1FGU A;  5M3F H;  4PG3 A;  4A3M B;  4JCV E;  4GN3 B;  2WP8 J;  5EKL A;  4OHJ A;  2ZT9 C;  3R2I A;  3M9B A;  1VQ7 A;  1PXU A;  3CCE A;  3MEH A;  1PZI D;  2VY3 A;  4HAE A;  1UWV A;  1TS3 A;  4CGY B;  4GNX A;  2Z1C A;  2A8V A;  4IJH A;  1EEI D;  3M7N A;  3H3V H;  1WD1 A;  2MO1 A;  3VR5 A;  1UAP A;  1UEB A;  1JE5 A;  1Z7T A;  4KY5 A;  4CHT B;  2X6L A;  1A6X A;  2GVB A;  4IPD A;  1GO3 E;  1SMY C;  3SK5 A;  2JQO A;  1B3A A;  2R7F A;  1G91 A;  2F0V A;  5JEA J;  4U67 3;  2N8N A;  5C3X A;  1GJX A;  3I8Z A;  2CW0 C;  2GA4 B;  1Q90 A;  4WOR A;  3ZJY C;  1D5M C;  1TII D;  4A93 B;  2VUM B;  4JI1 L;  1VCI A;  4M8A A;  1XPU A;  3I72 A;  4DNR B;  1PH3 A;  1BDO A;  2QGQ A;  1IBL L;  2ZJR A;  1STB A;  3EA6 A;  3NP8 A;  3E0J A;  1NSN S;  2K52 A;  3PIP 3;  3D8G A;  4PQX A;  3KFU A;  1Y1W H;  4LFB L;  3MHB A;  1IBK L;  2Z6K C;  3CXC A;  4R4C A;  4BY7 G;  1VQN A;  4OO1 I;  5EBD A;  3I4M H;  4HN7 A;  3PO2 B;  4Y7N H;  1AEX A;  3CCJ A;  5CC4 A;  1NJI C;  2OQK A;  1KDA A;  3NTH A;  1X65 A;  5CV4 A;  2C9O A;  1YVC A;  1PV4 A;  2D62 A;  2BA1 A;  2B63 G;  3KJO A;  4GOP C;  4HID A;  4N9P A;  1K83 B;  2KEN A;  1PTO B;  2FJ2 A;  3CKI B;  2R7Z G;  2JSO A;  4N8X 1;  2HUG A;  3CQZ H;  1LTT D;  1TWC H;  3HOU G;  3A74 A;  5C4Z A;  3NPP A;  1LAC A;  2A6H C;  1XTC D;  3MA2 B;  1CQV A;  4XIG S;  1LT5 D;  3FP9 A;  2X6G A;  2DUD A;  1P8L A;  1VQ5 A;  2F3W A;  1NTG A;  3ULP A;  4F87 A;  1GUO A;  4WFN 3;  5ELO A;  1EYC A;  1LTB D;  2EYP A;  4GKK Q;  2OEO A;  2RVL A;  3SEB A;  5LL6 X;  4OEM B;  1QNK A;  1ZYR D;  3GTP B;  4V0B A;  3TSS A;  3GD7 A;  4KKS A;  4C3J G;  2RDG A;  1J8I A;  4LFA L;  1KDB A;  2B2Y C;  1QOH A;  4JOI C;  3MAQ A;  4X6A H;  5D14 A;  5C4X G;  2V4D A;  2EPB A;  1YBY A;  4RGM A;  4IUR A;  2PCF B;  2BE5 C;  1PFB A;  3I4N H;  5JJZ A;  4QUF A;  3QJY A;  4FNF A;  1M90 C;  3GTK B;  4GN4 B;  5KNB A;  1YNN C;  2VZA A;  2XWB B;  5JPN C;  3GTO B;  3CCR A;  5E1F A;  1CZW A;  4JG2 A;  2NVX B;  3SGI A;  2ICI A;  1CI3 M;  3HOZ G;  1TWG H;  4BBS G;  1SSO A;  4UP9 A;  4NKL A;  4IUV A;  4BA1 I;  1AE2 A;  1K8M A;  1MIU A;  3MXG A;  1VQL A;  3GTM H;  2A68 D;  5IWA L;  2PW5 A;  1YHQ A;  1KRS A;  4A3B B;  1VQ8 A;  1EFI D;  2YTX A;  4DR2 L;  1SRO A;  1UE1 A;  3K6O A;  1PRT C;  4KN4 C;  1X3F A;  2Z6B A;  1SNM A;  3SK4 A;  5CBE E;  4FDB A;  4XTC S;  4LF4 Q;  2NYZ D;  2ZXO A;  4DAY B;  3HOW H;  3H15 A;  3GO5 A;  1ET9 A;  3GDE A;  2I46 A;  1IYU A;  3M4O B;  4LF8 L;  4DAM A;  4CKB A;  1PH7 A;  2G5D A;  5DLQ E;  2P5Z X;  2R92 H;  2UUB Q;  2MQH A;  2QF7 A;  1FL0 A;  2HIV A;  2KHS A;  1XNQ Q;  4X65 Q;  3V05 A;  1WCM H;  4LFC Q;  1EY7 A;  1SMX A;  1V8Q A;  4ZAI A;  1H9M A;  4P74 A;  1I4R A;  1WOC A;  2H1E A;  2EOT A;  3AU7 A;  1I5F A;  3BZC A;  4FO2 A;  5AFW A;  3HOX B;  1G6Z A;  3N52 A;  3HG9 A;  4DUZ L;  3TN2 A;  5LMN Q;  4A3I H;  4BA2 I;  2J0T D;  4HJ7 A;  3TS0 A;  4X3S A;  1HR0 W;  1PH2 A;  1QUQ A;  2PQE A;  3BVZ A;  1X9N A;  4L5T A;  2R93 H;  4POG A;  2MO0 A;  1HJP A;  1TY0 A;  3OW7 A;  3M3Y H;  4PZ8 A;  4K14 A;  1EZ6 A;  3K5M A;  5T1I A;  3OOC A;  1ZEQ X;  1XPR A;  4N8F A;  4DV5 Q;  1EQQ A;  4MIU A;  4A76 A;  2LXJ A;  1ONL A;  3FKI H;  3K8A A;  1YJN A;  3H0G B;  1I50 H;  2CH4 W;  2F0S A;  3J7A F;  3PO3 G;  1C4Q A;  1GUW A;  4K2K A;  2WAQ B;  4AQY Q;  5M5Y B;  1STA A;  1PFS A;  2ENB A;  1S72 A;  4L5S A;  1MGS A;  3T13 A;  4IPG A;  5KRU A;  4A3J G;  1MD2 D;  1O7L A;  1STG A;  3A55 A;  3Q22 A;  5COY A;  4KHV A;  3KYH C;  2UUA L;  1G8Z D;  3GTQ H;  1V43 A;  4LJZ C;  4X3U A;  2N49 A;  1DCZ A;  1NE3 A;  1S5F D;  3E5S A;  4DNI A;  1ENA A;  4KY7 A;  1XX8 A;  3CMA A;  1KNE A;  3D3R A;  3LWE A;  2H4O A;  3J81 E;  1RTO A;  3MTS A;  1HA6 A;  4P72 A;  1QZH A;  2CQA A;  1I6H H;  2SNM A;  3H09 A;  1KLG D;  5NUC A;  2UXD Q;  3ERS X;  1EWI A;  4NPS A;  3BVM A;  2L9H A;  3BVG A;  4FXK C;  5J3B A;  1T5X D;  4DV6 L;  5K36 G;  1L1O A;  3W3A A;  4BY7 H;  1DOM A;  1E7Z A;  1PHJ A;  1WJJ A;  2B2T C;  4C1N I;  5EAY A;  3C3L A;  4A3L G;  4MN3 A;  3S14 B;  4IPC A;  1Q8I A;  5IOD A;  3A56 A;  3Q23 A;  2NN6 G;  4XYO A;  2CKZ B;  3T1Y Q;  1GOZ A;  4QIW E;  5FO9 B;  4ZQ3 A;  2K32 A;  2AQ2 B;  2VQE Q;  2B63 H;  1RKN A;  2F0T A;  3SVM A;  2IY5 B;  2R7Z H;  1NR2 A;  1G2S A;  4FF2 A;  2O5I C;  5J22 A;  4C3H G;  3F2U A;  3HOU H;  1PMR A;  1BR9 A;  5CV7 A;  1Q46 A;  2QCP X;  2D5D A;  3V2T A;  1MSH A;  5KYI A;  1KQS A;  3HZX A;  2PI2 E;  3SE0 A;  1NNX A;  5ELD A;  5I4D A;  1BBW A;  3BS1 A;  4GLV B;  2AHO B;  4LW1 A;  5KNC A;  1HFG A;  3RLF A;  5C0X H;  1VQB A;  3RUZ A;  2B2V C;  1ASZ A;  2RBM A;  2ZM6 L;  1EY9 A;  3A7L A;  1LO5 D;  3R93 A;  2PMZ E;  3RR5 A;  1D7Q A;  4A3F B;  1O78 A;  4C3J H;  2F0L A;  4DK0 A;  4X64 L;  4ZUJ A;  4X62 L;  1XNR L;  2F0W A;  1N36 L;  1STY A;  3TDQ A;  1J5E L;  5CV8 A;  1PA6 A;  1X56 A;  3FDT A;  3PUX A;  1V1Q A;  5C4X H;  2JA5 G;  1HR0 L;  4GNX C;  2F0H A;  1H95 A;  1ML0 D;  1OTC A;  1K8A C;  3PUZ A;  2E5L L;  1XMQ Q;  4OWW B;  1FD7 D;  1KD1 C;  4IZ8 A;  4JI1 Q;  1EOT A;  1B3Q A;  3CCQ A;  2MFI A;  1IBL Q;  2EYL A;  3MZ5 A;  1BNZ A;  2L15 A;  5A35 A;  3EN2 A;  3HOZ H;  1K3R A;  5A2Q E;  1JJG A;  4BBS H;  4A3G G;  3S1M H;  5M3M B;  4BBR G;  1M4V A;  1JWS D;  4TVA B;  3MXP A;  2PZU A;  1Q86 C;  3H94 A;  2LY7 A;  2PI2 A;  2EYH A;  1IBK Q;  4LFB Q;  3G6J B;  4R4T A;  1LTI D;  1ZKO A;  4FXD A;  5COR A;  1ESR A;  4I65 A;  4IFD G;  2EXD A;  2JA9 A;  3CCU A;  1YJW A;  1FNW A;  1UE7 A;  2K4K A;  1KIX A;  4I7A A;  2E2J B;  5KYL A;  4FVM A;  1DJR D;  1U4R A;  4HTH A;  3A7A B;  5LMU L;  2JA8 B;  1JB3 A;  1Y8N B;  4XYQ A;  4ALP A;  1B50 A;  1F2L A;  1HQR D;  4NXM L;  1SDF A;  5D3I B;  1VS0 A;  1Y1V B;  5C4H A;  3OIQ A;  5CR3 A;  2AKW B;  4L6T B;  2JA6 G;  3X3M A;  3HOV B;  2D2C C;  5A2Q L;  4QJF A;  2KA7 A;  3OTO L;  2ZTC A;  1JC7 A;  1SJE D;  4OON A;  1UUP A;  1SBB B;  2A1A A;  3QR8 A;  3BYY B;  1K9M C;  1A2U A;  2NVY H;  4KD3 A;  1U4P A;  1LTA D;  3QOL A;  3KLS X;  1QUQ B;  1D1I A;  1DGS A;  1EQV A;  2L4N A;  1E22 A;  4KJN A;  3CP0 A;  3UDI A;  3KLR A;  2QIL A;  2F0F A;  2K04 A;  3DWP A;  2A69 D;  2JYO A;  1G51 A;  1QB5 D;  2EY5 A;  4A3E G;  4KHP L;  1TWA H;  1MKH A;  3WOE A;  5IYB H;  4LFA Q;  4PNY A;  4F88 A;  4A3D G;  4OX9 Q;  4JK1 C;  2BDN A;  1W6K A;  3K81 C;  3KJP A;  3KK7 A;  2IX3 A;  1I4P A;  5C5M A;  4ODG A;  3WDN A;  1TS4 A;  1IW7 D;  2JA7 G;  3PO3 H;  4QB4 A;  3DEO A;  1IBM L;  2ICE C;  1RDP D;  5L37 A;  5BN4 A;  3S2D B;  2BH2 A;  1KHI A;  1FGB D;  3GTG H;  4A3J H;  4DR1 L;  4CJ1 B;  2UUC L;  4DV4 L;  3LGJ A;  4MZ9 A;  3V96 A;  3W1B A;  1R9T B;  4GKJ L;  1TS2 A;  4QMG A;  4BXX G;  2UXB Q;  4XQQ A;  4KD4 A;  3DM3 A;  2IWH A;  3GQB A;  2KJX A;  4C56 C;  5IT9 E;  4I7Z C;  5TSS A;  3STB C;  4F7X A;  2MHV A;  1JOR A;  1K0R A;  4DV0 L;  3CCV A;  3KF6 B;  1U4M A;  1SMY D;  5GQO A;  5IWA Q;  2SDF A;  4DR2 Q;  5T1G A;  1BCP B;  1D5Z C;  3I4N B;  2AMC B;  1P16 A;  2CW0 D;  1SRU A;  1I4Q A;  1I4X A;  1B7Y B;  2EZV A;  4LF8 Q;  1CTM A;  2WKC A;  1Z6H A;  1I6V C;  5K36 H;  2IJ0 A;  1SFO B;  1F9Q A;  1DD2 A;  3Q0A A;  1TWG B;  4OWX B;  5AJ3 L;  4LF7 L;  1U0L A;  1SNP A;  2Z4H A;  3QG1 A;  1SE2 A;  4A3L H;  3BZK A;  4DAP A;  2DN8 A;  3CAM A;  3T1H L;  3CC4 A;  1W2B A;  1ET6 A;  4LAA A;  3VYS A;  2NN6 H;  2XRS D;  3K5O A;  3GTM B;  2AWN A;  5IT9 L;  4BY1 B;  4UDU C;  1EY4 A;  2KCT A;  2JP1 A;  4DUZ Q;  3NTI A;  3TRE A;  1V1P A;  4QCL A;  4FXG C;  4C3H H;  4EQP A;  3S16 H;  5JJI A;  4J15 A;  1EYA A;  1F2Y A;  1WYD A;  1F9R A;  4P71 A;  1F2Z A;  4YCU A;  1Q1B A;  2AUK A;  3GTL H;  4P73 A;  2I0Q A;  2RF4 A;  4KN7 C;  1D1K A;  4OIJ A;  1FR3 A;  1YEZ A;  1VMP A;  2RQX A;  4RH6 A;  1F9P A;  2V1C C;  4OXP A;  1TQO A;  3PF5 A;  2R93 G;  1PH8 A;  3PQI A;  2ZXR A;  2A6H D;  4POF A;  2RSN A;  4DK3 C;  1B4O A;  2F0G A;  4IO9 A;  1XYI A;  1GUS A;  3NE5 B;  3CW2 C;  3NQT A;  3HOY H;  4B9W A;  1PH6 A;  1VQ9 A;  4A3I B;  2Y0S G;  3BDL A;  3S1Q H;  3FKI G;  2KCC A;  4ZK9 B;  2UUA Q;  1LT6 D;  2NTS A;  2PNH A;  4CDE C;  3NWT A;  3F2B A;  3WWV A;  2JA5 H;  4QIW B;  2FFK B;  1N33 L;  2HCI A;  1AZP A;  4NDX A;  3U9S A;  3NSW A;  1WTX A;  1IZ6 A;  2RHS B;  1E0B A;  3J7Y W;  2VB2 X;  3ND9 A;  1S5E D;  3KLS A;  3D4W A;  3DM1 A;  1AN8 A;  3OWE B;  3K58 A;  2PZT A;  2MUY A;  2BE5 D;  2Q2T A;  3VYU A;  3OMC A;  3AEV A;  4RGT A;  4A3G H;  1N8R C;  4BBR H;  3PSI A;  1YNN D;  4G57 A;  1QCB D;  3VR6 A;  4DV6 Q;  4HJ5 A;  2VUM G;  2EYM A;  4LF6 Q;  2IHE A;  1D5X C;  1A63 A;  2ES2 A;  2Q8R E;  4RGO S;  3WOF A;  2F3V A;  4IFD H;  3K7A B;  4YCW A;  2PMZ B;  2WAC A;  1L0Y B;  1L1O C;  3TME A;  1PH1 A;  5IGD A;  1OXS C;  4ULL A;  1A15 A;  3M4Y A;  5IP7 G;  2A5H A;  5JJK A;  1JOQ A;  1L0W A;  1OXU A;  1HRJ A;  2KBN A;  1J6Q A;  1S5B D;  1PRT D;  1I6H B;  4ME5 A;  2AWO A;  2JA6 H;  1LTS D;  3MVV A;  3MWY W;  4ABN A;  4DAV A;  5FJ8 G;  2DNC A;  2RA4 A;  2EJG C;  4LK1 C;  2LFN A;  1CQF A;  1KL9 A;  1VQC A;  1LT3 D;  1TY2 A;  3OW2 A;  4K0K L;  2E2H H;  4V19 0;  5M9O A;  3R3O A;  3CCS A;  3U58 A;  2L11 A;  2NVT H;  2O2L D;  4JI6 L;  4PMC A;  3KF8 A;  5JOB A;  2WFW A;  2ZM6 Q;  3S2H H;  3D6W A;  4HSV A;  3C2P A;  2DNE A;  5M5W H;  2B63 B;  4RKB A;  4A3E H;  1D2B A;  3BJU A;  1JT8 A;  4A3D H;  4X64 Q;  4X62 Q;  3I55 A;  3ITP A;  4IOA A;  1XNR Q;  3ERO A;  5C0X G;  1K28 A;  1N36 Q;  1J5E Q;  2L0C A;  2ZTD A;  3A5Z B;  1QVC A;  1C8C A;  2XSC A;  4IN3 A;  1HR0 Q;  4LUZ A;  2JA7 H;  3I4L A;  2VS1 A;  5CMD A;  2Z4I A;  1OXX K;  1N34 L;  5IYC G;  1STE A;  3JAM L;  4OO1 G;  2TMP A;  4AYB B;  4YWK A;  1VQH A;  2RSO A;  1K8O A;  1GHJ A;  2QEX A;  5IT9 c;  3OHX C;  2NBF A;  4HCS A;  1XTD A;  5C4J H;  1RHP A;  1QIL A;  1B9M A;  1PH9 A;  1HNZ L;  4DV1 L;  3T56 B;  4YCV A;  5FO7 B;  2KQ3 A;  4G4K A;  2G9H D;  4BXX H;  1RD9 D;  2OQ0 A;  4Z9C B;  3S17 H;  4B3R L;  1HZA A;  4DK1 A;  2N55 A;  4XT3 B;  1X54 A;  3C1F A;  1DOL A;  5C4X B;  3H91 A;  2E2I H;  2K5V A;  2Q8T A;  2Z0S A;  1KAA A;  4MTN A;  1X3P A;  3ERQ A;  1YHB A;  3JAM i;  4NMZ A;  3RZD H;  4H0L C;  4R9W A;  4HSP A;  3S1N B;  2M00 A;  4NXN L;  5LMU Q;  3S1R H;  2G9D A;  1TWF H;  4NXM Q;  3RZO H;  3L0O A;  1E1T A;  4LF5 L;  3X3N A;  2F0I A;  3OTO Q;  3A8I E;  3KLW A;  3AFQ A;  5G3L D;  1VQO A;  5C44 H;  2R3Z A;  2DGY A;  1J9O A;  1LTL A;  1EYG A;  3K0Y A;  1VQG A;  1V1P B;  3UE1 A;  1TWH H;  1HQM C;  4AIM A;  2RDF A;  1JJC B;  2I5H A;  4PZ7 A;  1EEF D;  2WIN B;  4TRD A;  4KHP Q;  4JI0 L;  5FKA C;  1PTO C;  3A54 A;  3T51 B;  2ZXP A;  3HOX G;  1Q81 C;  3I56 A;  4DPG A;  1WTR A;  4UP8 A;  5M5X H;  2E75 C;  3TQY A;  4IUN A;  3D4D A;  1E1O A;  3UDX A;  4F8M A;  1EIY B;  4AH6 A;  1UE6 A;  4K5W A;  2WKD A;  3T53 B;  2F3I A;  1HFN A;  1EYD A;  4R1J A;  1X55 A;  1CK1 A;  2IW3 A;  5IGC A;  4A75 A;  1IBM Q;  3PMF A;  3IKJ A;  3PIO A;  3I2Z A;  5IYB G;  1WD0 A;  4RAU C;  1ZXT A;  2ZTE A;  4RHR A;  2SEB D;  4G7H C;  3ICE A;  5JEA H;  3D4R A;  2GVA A;  2F4V L;  3GV3 A;  1B2T A;  4WJW A;  4OL7 A;  3RNU A;  4C3I B;  4DR1 Q;  3N6R A;  2L12 A;  4NW2 A;  4A3K B;  3CRL C;  5I2X A;  5IY0 A;  3H0G G;  2UUC Q;  1NMF A;  4JBJ A;  2K7V A;  4DV4 Q;  1RIP A;  2WAQ G;  3UI2 A;  1RL2 A;  5E4X A;  1FJG L;  2B8F A;  3T16 A;  1ZYR C;  3HKZ G;  1JWM D;  1II3 A;  1EIG A;  4A3C G;  3VR4 A;  5FO8 B;  3NBH B;  4DV2 L;  1JR0 D;  5DM7 3;  3AQQ A;  5C3E G;  3NWS A;  5CYU A;  1CSQ A;  2NZ1 D;  1EFW A;  1EL0 A;  1VQI A;  1A62 A;  4JI7 L;  3IFT A;  3NXW A;  1HPC A;  5FLX E;  3S15 B;  4QGU A;  2XIW A;  1T5E A;  2HDM A;  3PCO B;  4C2M B;  2IX1 A;  1S40 A;  1H9K A;  4A93 H;  2VUM H;  1XPO A;  5C6A A;  1DYQ A;  2B29 A;  4O1N A;  1QG7 A;  3QB3 A;  2KOL A;  5AJ3 Q;  4LF7 Q;  1H9J A;  1NAP A;  2AQ1 B;  2JEA I;  2RKS A;  4PMW A;  3KF6 A;  1PZJ D;  1K3B C;  3T1H Q;  3MXN A;  2D0P A;  1IHZ A;  2J4X A;  2K5W A;  1JIC A;  3RN5 A;  3DEP A;  1W6J A;  4FF4 A;  2BCO A;  5IP7 H;  4K6D A;  1PH5 A;  3JC6 6;  1G6P A;  4RWS C;  1VQP A;  4PMB A;  1GD7 A;  1X3G A;  2EXZ A;  4ID6 A;  3JAM c;  4LNQ A;  5CBA E;  1Q8K A;  3VYR A;  3ND8 A;  5FLX L;  4X3T A;  5HY6 A;  5FJ8 H;  2WII B;  4WJ4 A;  3UDF A;  3GTJ B;  4YHH L;  1RCV D;  2B3G A;  1PTO H;  3Q8D A;  4EGV A;  3KF8 B;  2Z6K A;  4Y52 H;  5EBC A;  1ENC A;  2SOB A;  4K8I A;  2YTY A;  4NP5 A;  3NK9 A;  3A0J A;  1LTR D;  5FLM G;  3CC7 A;  2MJ8 A;  1QVG A;  1CHQ D;  2KCM A;  4FF1 A;  4JI4 L;  3H3V I;  5JJL A;  3M4P A;  2QKI C;  5EKI A;  3QWN A;  1Q7Y C;  2FMM A;  2Z8L A;  2M2L A;  2MPM A;  1HNW L;  1A2T A;  2F1M A;  1EQT A;  3BDC A;  3S16 B;  5I9O A;  1S5D D;  2VW9 A;  3DWQ A;  1SXT A;  4RHS A;  3ULJ A;  3HOY G;  4U68 A;  3GTP H;  1YIT A;  3MFG A;  5IYC H;  1SYD A;  1STH A;  2WB1 B;  4OO1 H;  1DOK A;  3P75 A;  3URY A;  3CF5 A;  5IP9 G;  2L1B A;  5C5L A;  5GAD C;  4L63 B;  4JI2 L;  2I5M X;  4PZ6 A;  1RTN A;  3MC0 B;  5ELC A;  1Y14 B;  1CKM A;  3U4V A;  1LM0 A;  2EDG A;  2BOS A;  3CCM A;  2NVQ H;  5ELF A;  2HIX A;  5M3F B;  2DJF C;  3GTK H;  2PZW A;  4B08 A;  3DUZ A;  3G7L A;  5HGQ A;  1TKW B;  5BR8 L;  2F4I A;  4HMJ A;  4HJ9 A;  3GTO H;  1SJH D;  3S1Q B;  3CD6 A;  3TP8 A;  1GVP A;  2B2Y A;  2NVX H;  4RCN A;  2B8G A;  3BZD B;  2M9V A;  2CWA A;  2JA5 B;  1X3E A;  3DXJ C;  1PRT F;  3J81 j;  2OT2 A;  5M3M G;  1A3T A;  2HCC A;  2XGT A;  2UU9 L;  1KRT A;  4DR4 L;  1VQF A;  5E3F A;  4X66 L;  3STB D;  2ZJQ A;  4R8I A;  1E2Z A;  1JWU D;  2FHT A;  4R4I A;  1MJC A;  4EQN A;  2QA4 A;  3KDF A;  3ULL A;  2E76 C;  3TP7 A;  3DMU A;  5IGF A;  4ZLT F;  1HZB A;  1CM9 A;  4H13 C;  1PTO F;  2AQ3 B;  2LKV A;  1IL8 A;  4N9T A;  1SR3 A;  3W5O A;  2JA8 G;  4A4I A;  4BWG B;  1F9S A;  2E74 C;  3M4O H;  1S4Z A;  2B39 A;  3M7G A;  4K0K Q;  1EWC A;  1ESF A;  4AYB E;  1HH2 P;  4DR5 L;  1X3Q A;  4JI6 Q;  3HOV G;  1VQM A;  2A73 B;  4DA2 A;  5DAU A;  1R4P B;  1Y1W B;  3L3O C;  4DFA A;  3I4M B;  3HOX H;  3I7F A;  4Y7N B;  2K03 A;  3AYH B;  2LS0 1;  4IUP A;  3P1H A;  1BXT A;  4JC0 A;  2HQL A;  4K8J A;  2JA6 B;  1GM5 A;  1FYC A;  2R6G A;  1AE3 A;  1R4Q B;  1CA6 A;  4DXG A;  1JCK B;  1BVS A;  4JVZ A;  1N34 Q;  2KEC A;  5IIF A;  2Z9H A;  3BDO A;  3CQZ B;  4KKU A;  1G2T A;  3FEW X;  2E2H B;  3PUY A;  1TWC B;  2L55 A;  2UUB L;  4KHZ A;  4ZCK A;  3T4A C;  4IUT A;  2A6E C;  2ATW A;  2D9U A;  1I3Q H;  3H0G H;  3LX0 A;  4DR7 L;  2YTV A;  1HNZ Q;  1OXV A;  1CUK A;  3SHL A;  4Q0F A;  5M5W B;  4DV1 Q;  4DNT B;  5M5Y H;  2E8G A;  1GUT A;  2Q2H A;  4YY3 L;  2I5L X;  4DUY L;  1JB7 A;  4A3C H;  4B3R Q;  5FLX c;  2K05 A;  3D0F A;  2LSS A;  5LL6 S;  5C3E H;  4PV1 C;  1B1Z A;  4TKO B;  2JA7 B;  1OXT A;  5EPL A;  2NZH A;  2KUM A;  3DHQ A;  4ZRZ A;  1YIJ A;  1BF4 A;  1C0A A;  3L2P A;  3B6Y A;  5G3L F;  1EY6 A;  2CCZ A;  3HKS A;  4KI0 A;  3CPF A;  4NXN Q;  3E3X A;  2YYZ A;  2K14 A;  3OPO A;  4B3M L;  2BA0 A;  2DJG C;  3MXN B;  4LF5 Q;  1PH4 A;  5I9P A;  3C1E A;  1UNS A;  1YZ6 A;  4KMU C;  1XMO L;  2CVR A;  2XRQ D;  4CDF C;  3S17 B;  1SYG A;  2JXM B;  5J39 A;  2ZJP A;  3NBI A;  4XXE A;  3F8T A;  1WTH A;  3J7Z C;  5EKK A;  2NB0 A;  5HUR A;  4G7O C;  5C44 G;  1HNX L;  1CHP D;  5JVG 3;  1T9H A;  3FRP B;  1EQR A;  4LUV A;  3RZD B;  2BDO A;  3HP3 A;  3NEN A;  4LWC A;  4GZY C;  1GUN A;  4JI0 Q;  3I73 A;  4J8Q A;  4DV7 L;  4BY1 G;  1GKH A;  4K5X A;  4JI3 L;  1EZ8 A;  2OWO A;  2TSS A;  2PO4 A;  3IL8 A;  4OEL B;  3VR2 A;  1YI2 A;  5CV5 A;  3HOW B;  1KAW A;  4YWM A;  2HD3 A;  5FLM H;  4O0A A;  3TS2 A;  2F0M A;  3NHH A;  4GOP B;  2OTJ A;  3P7J A;  1KC8 C;  2R92 B;  1VQK A;  5GAH C;  2XNA C;  2F4V Q;  4ILW A;  1WCM B;  2N78 A;  3NUC A;  2R61 A;  2IPK D;  1O7Z A;  3EIV A;  1GUG A;  1JOO A;  3R2T A;  3Q6S A;  4HR7 B;  1FJG Q;  3FPP A;  1I4G A;  2J7Z A;  5JEA G;  4A3M G;  2UXC L;  2QDB A;  4DV2 Q;  4LMQ D;  1B44 D;  3UE0 A;  2VB3 X;  1A3U A;  4QF4 A;  4NB3 A;  5CV9 A;  1Z9F A;  5IP9 H;  2KHJ A;  5DM6 3;  4G7Z C;  2R93 B;  1QNU A;  4RFB A;  1PVO A;  1CA5 A;  4JI7 Q;  2PNR C;  3M3Y B;  1NBW A;  1HZ9 A;  1BBU A;  3F2D A;  1GXD C;  2PYK A;  4H02 A;  4RGN A;  1AFP A;  3LWU A;  2Y0S B;  3OIP A;  1K8G A;  3A8K E;  3FKI B;  3NBH A;  1E2W A;  1I50 B;  1BKB A;  3SK8 A;  4DF7 A;  1N32 L;  2CQO A;  4CKE A;  5I6W A;  4S3S A;  3EJI A;  2JK8 A;  5M3M H;  5GRO A;  4JYA L;  4A93 G;  4JI8 L;  2PQA B;  1BOS A;  3KOJ A;  3KBG A;  1EIF A;  2B2W A;  3KDF B;  1IL2 A;  3GTQ B;  2F0D A;  2OF1 A;  2Q8I B;  2EE1 A;  2KED A;  4J6H A;  1BCP C;  3J80 E;  4ZKB B;  1M8A A;  1K0S A;  4IQZ A;  3K5N A;  4HIK A;  2RDH A;  4H7B A;  4ZUI A;  3L7Z C;  1XMQ L;  1VQA A;  3CRK C;  2E2J H;  2Q2U A;  4YHH Q;  2IHF A;  2JA8 H;  3PO2 G;  4X3K A;  5C0X I;  2JN4 A;  2WB1 E;  3MEF A;  2K5D A;  1Y1V H;  2K5H A;  2RCF A;  1I94 L;  1SYF A;  3HOV H;  1PRT B;  3FVQ A;  3BU2 A;  1Y69 U;  4JI5 L;  2JJQ A;  2EY2 A;  4JI4 Q;  4UAI A;  3K7U C;  1PZK D;  1NY4 A;  3JAM E;  4BY7 B;  1AH9 A;  3O13 A;  4B3S L;  1AP0 A;  2F0P A;  5IGG A;  1HNW Q;  3S24 A;  3RLO A;  1YNJ C;  4LF9 L;  1FNU A;  5ELB A;  3BG3 A;  3J80 L;  1XXG A;  4OWT B;  4JV5 L;  1WTW A;  1PTO D;  1CKN B;  4B3T L;  3AB9 A;  2R7Z B;  3IAY A;  5DNF A;  1HA5 A;  1B8A A;  2QDL A;  3S9W A;  1CKO A;  1PDQ A;  3HOU B;  1WI5 A;  4IUQ A;  3EQL C;  2HHH L;  1LTG D;  1S5C D;  4JI2 Q;  2MGS A;  5EPJ A;  1H9S B;  2E5L Q;  3GP7 A;  1EU3 A;  2K01 A;  4UP7 A;  4ZYS A;  1N9W A;  2QW7 A;  3I90 A;  3S2D H;  5FOB B;  2EY6 A;  1LT4 D;  1TVX A;  5BR8 Q;  3TP5 A;  4AYB G;  2A74 C;  2A19 A;  3J80 i;  1LYL A;  5ELE A;  1SNO A;  1JE4 A;  3FHW A;  2CHB D;  4YWL A;  1I4H A;  5JPM C;  4DR6 L;  3TZU A;  2KVM A;  1R9T H;  2UU9 Q;  4C3J B;  4L5R C;  5D3D A;  4DR4 Q;  4QUC A;  4X66 Q;  2AUJ D;  2JE6 I;  4OX9 L;  1L2F A;  4FF3 A;  1HTP A;  4CDC C;  1SE3 A;  4OGQ C;  4RMF A;  5BN3 A;  2F0J A;  2PW7 A;  1MI2 A;  2VQF L;  2NZO A;  4HMI A;  2EYO A;  1DXM A;  4QL5 A;  4JPB W;  4RA8 A;  4DV3 L;  1HHV A;  2NVQ B;  2D0O A;  5C0X J;  1SLJ A;  5LHY 1;  2RCN A;  1EU4 A;  2F0N A;  1AW7 A;  1SE4 A;  4R8N A;  2YU9 H;  1SFO H;  1LUZ A;  3E9H A;  4HED A;  1X32 A;  3HOZ B;  4A3B G;  3D6C A;  4KV6 A;  5EPK A;  4DR5 Q;  1KDC A;  4BBS B;  1IKM A;  3S1M B;  2MNA A;  1Q3L A;  1SNC A;  4O42 A;  3PV0 A;  5F2D A;  3ZYY X;  3EBE A;  1PFN A;  4DK6 C;  2UXB L;  2YV5 A;  2O4X A;  4DXF A;  2H5X A;  1NR4 A;  4TQU S;  4CBV A;  1Q12 A;  1EWH A;  4BY1 H;  4KTA A;  3G6E A;  1VQ4 A;  4XQN A;  2ASB A;  2XTI A;  3R8B A;  3BYT B;  5IGB A;  3I70 A;  3U4Z A;  4CJ2 C;  1LAB A;  2I07 B;  1HZC A;  4DR3 L;  5GAE C;  1PYB A;  1SAP A;  1VQE A;  3K0X A;  4IAL A;  1ENF A;  3AMU A;  1EY0 A;  2L5T A;  2K6A A;  1TR5 A;  2PPB C;  3A5U A;  1E2V A;  1EUJ A;  5E7N A;  4DR7 Q;  2NVY B;  4QY7 A;  1BO0 A;  4YY3 Q;  1TS5 A;  1WTQ A;  3MXU A;  3E9I A;  2OCE A;  4JBW A;  3M85 A;  1D8L A;  4A3M H;  1FVI A;  4DUY Q;  2B2U A;  4M1U B;  4IJL A;  4C3I G;  4A3K G;  1SEB D;  1IYV A;  1IYJ B;  4LUO A;  4K2L A;  3M4Q A;  3Q24 A;  3G71 A;  4GKJ Q;  2C5C A;  3RLN A;  1TWA B;  2LMC B;  1XJV A;  5IYD H;  2HQE A;  2EVB A;  4ME3 A;  4XDX A;  3SK6 A;  4DV0 Q;  2VXW A;  1FNV A;  2X69 A;  3OWF A;  4TSS A;  4B3M Q;  2DY8 A;  1I3Q B;  3PO3 B;  4GNX B;  1BCP F;  3GV6 A;  4J1M A;  5DEH A;  3G48 A;  2NN6 I;  1Y8P B;  1HUM A;  1BQQ T;  1XMO Q;  3OSO A;  2KHI A;  3HKZ B;  3J80 c;  2VL6 A;  1A3V A;  3GTG B;  4GS3 A;  4A3J B;  4GLA C;  1D6E C;  3TP6 A;  4KKT A;  5C3E B;  1NCV A;  3K57 A;  2CFM A;  3HS0 C;  2MP1 A;  4L8J A;  3K7A H;  1HNX Q;  5JAV A;  3PF4 A;  4K5V A;  3ONA B;  1VMC A;  4WRD A;  2VNU D;  1EY5 A;  2KCN A;  2NWG A;  3L9A X;  4DV7 Q;  4K6L A;  1V1O A;  4UY8 C;  3CPW A;  2A68 C;  1M1K C;  1JOK A;  4C1N K;  1UE5 A;  1PYW D;  3PO2 H;  4JI3 Q;  3IRB A;  3TEH B;  4HJ8 A;  1MJE A;  4EVO A;  3W1G A;  5D65 A;  4XT1 B;  5IOC A;  1K83 H;  2F0K A;  4QQB X;  2O5J C;  4LF6 L;  3QOJ A;  3J7A V;  3K5L A;  2EIF A;  2Y0S E;  5EJW A;  4MHE A;  5I2Y A;  4P75 A;  5J1Z A;  4DU9 A;  1G29 1;  3NEM A;  1RF2 D;  3VA5 A;  2NTT A;  1HTL D;  1UEA B;  2ALY B;  5EGT A;  3PIP A;  2XVS A;  3I91 A;  2UXC Q;  4FP5 D;  4P2C B;  4XQJ A;  1PFM A;  5LMN W;  4GOP A;  4UHV A;  4C3H B;  3J81 L;  5EQ0 A;  4BS9 A;  1TT2 A;  5IGE A;  4IOC A;  1BUV T;  3NTK A;  1JQY D;  3RMH A;  1N33 Q;  2EQS A;  2HDL A;  1L0X B;  3GTL B;  4GLX A;  4A3F G;  1OO9 B;  4OIK A;  3OMG A;  1QVF A;  4ZKC B;  3QIA A;  2N88 A;  4L5Q A;  2WB1 G;  1TU2 B;  3EFX D;  2HT1 A;  2A6E D;  1K73 C;  4IFD I;  1QE6 A;  3E6Z X;  1N32 Q;  3F1Z A;  1EOV A;  3MFY A;  1VQ6 A;  1STN A;  3KBX A;  2N3S A;  4KK7 A;  5M3F G;  3HOY B;  4JYA Q;  1VF5 C;  1VDZ A;  1C9O A;  4JI8 Q;  3ER0 A;  3J81 i;  1VQD A;  5IE8 A;  3HFZ B;  5ISR A;  2C35 B;  1ASY A;  1ILQ A;  2QEJ C;  4JOI A;  1ICF B;  4GKK L;  1JJ2 A;  4RCO A;  1A0I A;  2OXP A;  3TBI B;  2IL8 A;  1ROD A;  3K59 A;  3SXH A;  2IT1 A;  3K80 C;  1YJ9 A;  4B9X A;  2B2W C;  2OTL A;  1SYC A;  1SE8 A;  1U9R A;  3A8J E;  1VQJ A;  3S1N H;  4GN5 A;  2K28 A;  2F52 A;  1X6O A;  2FIN B;  2PQA A;  2F03 A;  1A8V A;  5E4W C;  4CJ0 B;  5JVH 3;  1E24 A;  1JMC A;  1YHA A;  1I94 Q;  4A3B H;  4A3G B;  4HCE A;  4BBR B;  3D31 A;  5HGT A;  4JI5 Q;  1LLR D;  3PUV A;  4FYD A;  1SYB A;  4DGZ A;  3HRZ C;  1V9P A;  4B3S Q;  3VR3 A;  3KUP A;  3LNN A;  2DY7 A;  1Y1V G;  1EY8 A;  4EQO A;  4JBM A;  5H1S E;  3OYY A;  1KLU D;  4LF9 Q;  1B53 A;  4E6I A;  4HIO A;  2CH4 A;  3F2C A;  4KLK A;  2LXK A;  4JV5 Q;  3DLL A;  1Y1W G;  3I4O A;  1DZ1 A;  5CV6 A;  1SND A;  1VF7 A;  4B3T Q;  1SNQ A;  4R4O A;  1Q1E A;  1HXY D;  1XWE A;  5K5P A;  3I4M G;  3RD4 A;  2R7D A;  2XWJ B;  3HEJ A;  2BH8 A;  1O7I A;  3PGZ A;  1CSP A;  2HHH Q;  2XN9 C;  2ID0 A;  3QO2 A;  1Q82 C;  5CGK A;  1IKL A;  2RHQ B;  1YNX A;  5I6Y A;  1NUC A;  4R4Q A;  1HCZ A;  1Z47 A;  4LF4 L;  1QWY A;  2EJM A;  5KND A;  1WTO A;  1WTV A;  4IFD J;  5ELN A;  4YIJ A;  1CKN A;  2JEB I;  1E3P A;  2NVT B;  1PYS B;  3TZD A;  2WV6 D;  2F0Q A;  1XNQ L;  3DWA A;  5FK9 C;  4X65 L;  3IFD A;  4C3I H;  3E0E A;  4LFC L;  3S2H B;  4A3K H;  4MNO A;  5BN5 A;  2K50 A;  1CFM A;  5C3W A;  4DR6 Q;  2Q2I A;  4A3E B;  3I3C A;  2F0U A;  3G4S A;  1H9S A;  4A3D B;  3SDZ A;  3VA7 A;  5LMN L;  1O7Y A;  1DON A;  2IX0 A;  1QJO A;  3CHB D;  5KGU A;  3CCL A;  1MHW C;  2VQF Q;  4RG1 A;  3FPU B;  4DV3 Q;  3SR1 A;  3EVQ A;  3S15 H;  4Q5V A;  1CT1 D;  1ICW A;  3H6M A;  4C2M H;  4JBK A;  1RJT A;  3VYT A;  1GHK A;  1NMG A;  4DV5 L;  3NQI A;  5C4J B;  1U5K A;  4JW0 A;  4HIM A;  1C7Y A;  3I4N G;  3VDY A;  3TRZ A;  4AQY L;  1KAB A;  3H3V C;  3J81 c;  4EQ5 A;  1KTK A;  1W3S A;  1KNA A;  4O2D A;  4CDD C;  2K33 A;  3FMC A;  1KXL A;  2SNS A;  2E2I B;  1BCP D;  1TXY A;  4WJ3 M;  1SN8 A;  3CME A;  2E2D C;  4KY6 A;  3S14 H;  1S3O A;  1DM0 B;  1F2M A;  1ILP A;  1L1O B;  1WVL A;  2EY1 A;  2EJF C;  4DR3 Q;  4DKA C;  4H44 C;  1U4L A;  3U9O A;  4APV A;  3S1R B;  3GTJ H;  3P20 A;  1TWF B;  4CKC A;  2YU9 B;  3RZO B;  3PUW A;  2EYJ A;  3UDG A;  4IPH A;  3W2D A;  3PIO 3;  4HJA A;  2K1B A;  3RN2 A;  1QZG A;  4KJO A;  5GAG C;  5C44 B;  2UXD L;  2B2T A;  2EYF A;  3HOW G;  1EIH A;  2WAQ E;  3NEL A;  3CC2 A;  1B9N A;  1MSG A;  2K75 A;  1Y8O B;  2KEE A;  4DAY A;  2R92 G;  2K5N A;  3HKZ E;  1TWH B;  3AFP A;  1YNJ D;  5KEE A;  1WFQ A;  1WCM G;  2GN5 A;  1SYE A;  3J7A 5;  4IUU A;  4UPA A;  1AZQ A;  2FMC A;  1H9R A;  3T1Y L;  2A69 C;  3CU7 A;  1B70 B;  2F0O A;  1CZG A;  2VQE L;  2B2U C;  1C48 A;  5M5X B;  1F77 A;  2CWP A;  2NUC A;  4EX5 A;  4A3F H;  1HUN A;  4A3I G;  2K5Q A;  5KIX A;  1MBY A; 
#chains in the Genus database with same CATH homology
 1IXR A;  2JA6 G;  2JE6 I;  4OX9 L;  1L2F A;  4QJF A;  2D0P A;  3OTO L;  2ZTC A;  3RN5 A;  2FXQ A;  4RMF A;  4OON A;  5IP7 H;  2A1A A;  1PH5 A;  3JC6 6;  1K9M C;  1G6P A;  2NVY H;  1VQP A;  2VQF L;  1GD7 A;  1X3G A;  2NZO A;  5IYD G;  4QL5 A;  3U50 C;  1QUQ B;  4DV3 L;  1KXL A;  3JAM c;  1DGS A;  1FGU A;  1E22 A;  4PG3 A;  5M3F H;  4LNQ A;  2D0O A;  3CP0 A;  4GN3 B;  4JCV E;  3UDI A;  2WP8 J;  5C0X J;  1SLJ A;  1Q8K A;  2RCN A;  3M9B A;  5HY6 A;  5FJ8 H;  1VQ7 A;  4WJ4 A;  3UDF A;  3CCE A;  2YU9 H;  1G51 A;  4YHH L;  1SFO H;  4A3E G;  4KHP L;  1LUZ A;  3E9H A;  2B3G A;  2VY3 A;  1TWA H;  1UWV A;  1MKH A;  3Q8D A;  4A3B G;  4DR5 Q;  5IYB H;  4LFA Q;  4A3D G;  3KF8 B;  2MNA A;  4OX9 Q;  2Z6K A;  4GNX A;  4Y52 H;  3K81 C;  2A8V A;  3PV0 A;  4IJH A;  3KJP A;  3EBE A;  3H3V H;  3M7N A;  4DK6 C;  2MO1 A;  2UXB L;  2YV5 A;  2YTY A;  1UEB A;  2H5X A;  1JE5 A;  3A0J A;  5FLM G;  3CC7 A;  4TQU S;  2JA7 G;  1Q12 A;  2KCM A;  2GVB A;  4IPD A;  1QVG A;  4BY1 H;  4JI4 L;  3H3V I;  3PO3 H;  5JJL A;  1GO3 E;  3M4P A;  3G6E A;  2JQO A;  1VQ4 A;  1IBM L;  2R7F A;  1Q7Y C;  5JEA J;  2ASB A;  2N8N A;  2XTI A;  2BH2 A;  1HNW L;  1KHI A;  3U4Z A;  3GTG H;  3ZJY C;  4A3J H;  2VW9 A;  1HZC A;  4JI1 L;  1VCI A;  4DR3 L;  5GAE C;  4DR1 L;  1XPU A;  1PYB A;  1PH3 A;  2UUC L;  1VQE A;  2QGQ A;  1IBL L;  3K0X A;  4DV4 L;  3LGJ A;  3ULJ A;  3HOY G;  3GTP H;  4MZ9 A;  3W1B A;  2ZJR A;  1YIT A;  4GKJ L;  4BXX G;  5IYC H;  2UXB Q;  2K52 A;  3DM3 A;  3A5U A;  1EUJ A;  3CF5 A;  5E7N A;  5IP9 G;  3KFU A;  3STB C;  1Y1W H;  4LFB L;  1IBK L;  4DR7 Q;  1K0R A;  5GAD C;  4DV0 L;  2Z6K C;  4JI2 L;  3CXC A;  4R4C A;  2I5M X;  4PZ6 A;  1VQN A;  4BY7 G;  4QY7 A;  3KF6 B;  3CCV A;  5GQO A;  4YY3 Q;  5IWA Q;  4OO1 I;  1Y14 B;  3I4M H;  1CKM A;  3E9I A;  3U4V A;  2OCE A;  4JBW A;  1LM0 A;  1D8L A;  4Y7N H;  3M85 A;  3CCJ A;  1FVI A;  3CCM A;  4DR2 Q;  2HIX A;  2OQK A;  4DUY Q;  4A3M H;  1NJI C;  2AMC B;  1P16 A;  3GTK H;  1SRU A;  1X65 A;  5HGQ A;  4IJL A;  5BR8 L;  4HJ9 A;  3GTO H;  4A3K G;  1B7Y B;  1YVC A;  1PV4 A;  1IYJ B;  2D62 A;  2BA1 A;  4LF8 Q;  2B63 G;  4LUO A;  3KJO A;  3CD6 A;  4GOP C;  4HID A;  1GVP A;  3M4Q A;  2NVX H;  3G71 A;  4GKJ Q;  2CWA A;  2KEN A;  3RLN A;  1X3E A;  2R7Z G;  5AJ3 L;  4OWX B;  1XJV A;  3J81 j;  1U0L A;  4LF7 L;  3CQZ H;  5M3M G;  5IYD H;  1TWC H;  2XGT A;  2UU9 L;  3HOU G;  4ME3 A;  4A3L H;  3BZK A;  1KRT A;  3CAM A;  4DR4 L;  3T1H L;  1VQF A;  4DV0 Q;  4X66 L;  3CC4 A;  3STB D;  1W2B A;  2ZJQ A;  3A74 A;  4B3M Q;  4R4I A;  1MJC A;  2AWN A;  2KCT A;  4GNX B;  4XIG S;  4DUZ Q;  3FP9 A;  2QA4 A;  3G48 A;  2NN6 I;  3KDF A;  3ULL A;  3TRE A;  2DUD A;  1P8L A;  1XMO Q;  1VQ5 A;  1NTG A;  3ULP A;  2NVQ H;  2KHI A;  4C3H H;  3S16 H;  1HZB A;  3J80 c;  2VL6 A;  5JJI A;  4J15 A;  4GS3 A;  5ELO A;  4GLA C;  1WYD A;  4GKK Q;  3W5O A;  1SR3 A;  2JA8 G;  4P71 A;  4A4I A;  3M4O H;  4YCU A;  1Q1B A;  2CFM A;  4K0K Q;  3GTL H;  4P73 A;  2I0Q A;  2RF4 A;  3K7A H;  1HNX Q;  4AYB E;  3GD7 A;  1HH2 P;  3PF4 A;  4DR5 L;  4LFA L;  4JI6 Q;  1YEZ A;  3HOV G;  4JOI C;  1VQM A;  2VNU D;  4X6A H;  2V1C C;  4OXP A;  3PF5 A;  2R93 G;  1PH8 A;  4DV7 Q;  5C4X G;  4UY8 C;  1YBY A;  3CPW A;  4POF A;  1M1K C;  4DK3 C;  1UE5 A;  3PO2 H;  4JI3 Q;  3HOX H;  3IRB A;  3I7F A;  4IO9 A;  3I4N H;  3AYH B;  3CW2 C;  3HOY H;  1PH6 A;  1M90 C;  1VQ9 A;  4GN4 B;  3TEH B;  4HJ8 A;  1MJE A;  2Y0S G;  4JC0 A;  2HQL A;  3W1G A;  3S1Q H;  2VZA A;  3FKI G;  1GM5 A;  2UUA Q;  3CCR A;  2R6G A;  1AE3 A;  2PNH A;  1K83 H;  4QQB X;  4JG2 A;  3F2B A;  3WWV A;  3SGI A;  2JA5 H;  4LF6 L;  3HOZ G;  1BVS A;  1TWG H;  1N34 Q;  4BBS G;  1N33 L;  2EIF A;  4UP9 A;  2Y0S E;  3PUY A;  1IZ6 A;  2UUB L;  4KHZ A;  4P75 A;  4BA1 I;  1AE2 A;  2RHS B;  1MIU A;  1VQL A;  1G29 1;  3NEM A;  2ATW A;  3GTM H;  1I3Q H;  3H0G H;  4DR7 L;  2YTV A;  1HNZ Q;  1OXV A;  3PIP A;  1CUK A;  2ALY B;  4DV1 Q;  2Q2T A;  2UXC Q;  5M5Y H;  2E8G A;  2Q2H A;  4YY3 L;  5IWA L;  5LMN W;  4GOP A;  1YHQ A;  3AEV A;  1KRS A;  4A3G H;  1VQ8 A;  2YTX A;  1N8R C;  4BBR H;  1SRO A;  1UE1 A;  3PSI A;  4DR2 L;  2I5L X;  4DUY L;  1X3F A;  1JB7 A;  4A3C H;  4B3R Q;  5FLX c;  4FDB A;  3D0F A;  4XTC S;  4DV6 Q;  4HJ5 A;  4IOC A;  4LF4 Q;  2VUM G;  2LSS A;  4DAY B;  5C3E H;  4LF6 Q;  3HOW H;  3H15 A;  3GO5 A;  3GDE A;  2IHE A;  1N33 Q;  1A63 A;  2ES2 A;  4LF8 L;  2EQS A;  4DAM A;  1PH7 A;  5DLQ E;  1OXT A;  4GLX A;  4A3F G;  2NZH A;  2R92 H;  2UUB Q;  2MQH A;  4YCW A;  1QVF A;  1YIJ A;  1FL0 A;  2HIV A;  1C0A A;  3L2P A;  1XNQ Q;  3B6Y A;  4L5Q A;  4X65 Q;  2WB1 G;  1PH1 A;  2CCZ A;  1L1O C;  1WCM H;  4LFC Q;  2HT1 A;  1OXS C;  3HKS A;  4KI0 A;  3CPF A;  1K73 C;  4NXN Q;  4IFD I;  1SMX A;  5IP7 G;  5JJK A;  1N32 Q;  3F1Z A;  2YYZ A;  2K14 A;  1EOV A;  4P74 A;  4B3M L;  1L0W A;  2BA0 A;  1WOC A;  3MXN B;  1VQ6 A;  3BZC A;  1I5F A;  4LF5 Q;  1OXU A;  1PH4 A;  2KBN A;  1J6Q A;  2N3S A;  5M3F G;  4DUZ L;  4JYA Q;  1YZ6 A;  5LMN Q;  1C9O A;  4A3I H;  4BA2 I;  4HJ7 A;  4JI8 Q;  1XMO L;  2AWO A;  3ER0 A;  3TS0 A;  3J81 i;  1VQD A;  5IE8 A;  2JA6 H;  3HFZ B;  1HR0 W;  1PH2 A;  1QUQ A;  5FJ8 G;  2C35 B;  1ASY A;  2ZJP A;  1X9N A;  4L5T A;  4JOI A;  2R93 H;  4POG A;  4GKK L;  2MO0 A;  1HJP A;  1KL9 A;  3F8T A;  1VQC A;  3M3Y H;  3J7Z C;  4PZ8 A;  1JJ2 A;  1A0I A;  3OW2 A;  4K0K L;  2E2H H;  3CCS A;  5C44 G;  3U58 A;  1HNX L;  2IT1 A;  3K80 C;  1YJ9 A;  1T9H A;  4LUV A;  1EQR A;  2OTL A;  2NVT H;  4JI6 L;  4LWC A;  3NEN A;  1XPR A;  1SE8 A;  4DV5 Q;  1EQQ A;  1VQJ A;  3S1N H;  2WFW A;  4GN5 A;  2ZM6 Q;  2LXJ A;  2F52 A;  4A76 A;  3S2H H;  3FKI H;  4JI0 Q;  3K8A A;  1YJN A;  1I50 H;  1X6O A;  4DV7 L;  5M5W H;  2PQA A;  4BY1 G;  3PO3 G;  1GKH A;  1A8V A;  4A3E H;  1E24 A;  3BJU A;  4AQY Q;  1JMC A;  1JT8 A;  1PFS A;  1YHA A;  1I94 Q;  4JI3 L;  4A3B H;  1S72 A;  2OWO A;  4A3D H;  4X64 Q;  4X62 Q;  3I55 A;  4L5S A;  4IOA A;  1XNR Q;  5C0X G;  3D31 A;  4IPG A;  1N36 Q;  4JI5 Q;  4A3J G;  1J5E Q;  3PUV A;  2ZTD A;  1YI2 A;  3A5Z B;  1QVC A;  3KYH C;  1HR0 Q;  2UUA L;  1KAW A;  1V9P A;  4YWM A;  4B3S Q;  5FLM H;  4LUZ A;  4O0A A;  3TS2 A;  4GOP B;  2JA7 H;  3GTQ H;  1V43 A;  2OTJ A;  1KC8 C;  1Y1V G;  2N49 A;  2VS1 A;  4JBM A;  5H1S E;  3OYY A;  1VQK A;  1OXX K;  1N34 L;  1NE3 A;  4LF9 Q;  3I4N G;  5GAH C;  5IYC G;  2F4V Q;  4HIO A;  4OO1 G;  2N78 A;  4DNI A;  3F2C A;  4KLK A;  2LXK A;  4JV5 Q;  3DLL A;  1Y1W G;  3I4O A;  4YWK A;  1VQH A;  3CMA A;  3EIV A;  4B3T Q;  2QEX A;  5IT9 c;  4R4O A;  1Q1E A;  5C4J H;  1XTD A;  3I4M G;  1FJG Q;  1PH9 A;  1HNZ L;  2R7D A;  5JEA G;  2BH8 A;  4DV1 L;  4YCV A;  4A3M G;  4P72 A;  1QZH A;  2UXC L;  1O7I A;  3PGZ A;  4DV2 Q;  1I6H H;  1CSP A;  3UE0 A;  2HHH Q;  4BXX H;  2UXD Q;  2OQ0 A;  2ID0 A;  3ERS X;  1Q82 C;  1EWI A;  4NPS A;  3S17 H;  2RHQ B;  4B3R L;  1YNX A;  4NB3 A;  1HZA A;  1Z9F A;  4R4Q A;  5IP9 H;  5J3B A;  4DV6 L;  1Z47 A;  2KHJ A;  4LF4 L;  1X54 A;  5K36 G;  1L1O A;  1PVO A;  4BY7 H;  4JI7 Q;  2E2I H;  2K5V A;  4IFD J;  1NBW A;  2Z0S A;  1HZ9 A;  5ELN A;  1BBU A;  1CKN A;  1E7Z A;  4MTN A;  3F2D A;  1WJJ A;  2JEB I;  1PHJ A;  5EAY A;  1YHB A;  4A3L G;  1E3P A;  4H02 A;  3JAM i;  1PYS B;  3RZD H;  1XNQ L;  4X65 L;  4IPC A;  3T1Y Q;  4C3I H;  3E0E A;  2NN6 G;  4LFC L;  2CKZ B;  1K8G A;  4A3K H;  4MNO A;  4QIW E;  4NXN L;  2VQE Q;  5LMU Q;  3S1R H;  2K50 A;  1BKB A;  2B63 H;  4DR6 Q;  1TWF H;  1N32 L;  2CQO A;  4NXM Q;  2Q2I A;  3RZO H;  2IY5 B;  3L0O A;  1E1T A;  3G4S A;  2R7Z H;  4LF5 L;  2JK8 A;  5M3M H;  3HOU H;  3OTO Q;  3KLW A;  3AFQ A;  5GRO A;  5LMN L;  1VQO A;  4JYA L;  5C44 H;  4A93 G;  2DGY A;  2IX0 A;  4JI8 L;  1LTL A;  2PQA B;  1EYG A;  1Q46 A;  3KOJ A;  3CCL A;  1EIF A;  3KDF B;  1IL2 A;  1KQS A;  2VQF Q;  1VQG A;  2PI2 E;  4RG1 A;  3UE1 A;  4DV3 Q;  1BBW A;  1TWH H;  4AIM A;  4GLV B;  3S15 H;  2AHO B;  1JJC B;  4LW1 A;  4HIK A;  2I5H A;  3L7Z C;  1XMQ L;  1VQA A;  4PZ7 A;  3RLF A;  4C2M H;  1VQB A;  2E2J H;  4JBK A;  2Q2U A;  1ASZ A;  1NMG A;  4YHH Q;  4DV5 L;  2ZM6 L;  4KHP Q;  2IHF A;  4JI0 L;  2JA8 H;  3PO2 G;  1U5K A;  3HOX G;  4HIM A;  1Q81 C;  3I56 A;  4DPG A;  5C0X I;  1C7Y A;  4UP8 A;  2WB1 E;  3MEF A;  5M5X H;  3VDY A;  2PMZ E;  3TQY A;  3RR5 A;  2K5H A;  1Y1V H;  4AQY L;  3TRZ A;  1D7Q A;  4C3J H;  1I94 L;  3J81 c;  1E1O A;  4EQ5 A;  4X64 L;  3UDX A;  4X62 L;  1EIY B;  3HOV H;  4AH6 A;  1XNR L;  1UE6 A;  3BU2 A;  1N36 L;  4JI5 L;  1W3S A;  2F3I A;  4O2D A;  1J5E L;  2JJQ A;  4R1J A;  1X56 A;  1X55 A;  1PA6 A;  3PUX A;  4JI4 Q;  1V1Q A;  5C4X H;  3K7U C;  1HR0 L;  1NY4 A;  4A75 A;  4GNX C;  1IBM Q;  2JA5 G;  1AH9 A;  3PIO A;  4B3S L;  1H95 A;  3I2Z A;  5IYB G;  1OTC A;  1K8A C;  2ZTE A;  1HNW Q;  1TXY A;  3PUZ A;  3S24 A;  2E5L L;  1XMQ Q;  3RLO A;  4WJ3 M;  3ICE A;  1SN8 A;  3CME A;  4LF9 L;  2GVA A;  1S3O A;  4OWW B;  3S14 H;  2F4V L;  1KD1 C;  1L1O B;  4JI1 Q;  4DR3 Q;  3RNU A;  4DR1 Q;  4OWT B;  4DKA C;  3CCQ A;  5IY0 A;  4JV5 L;  2MFI A;  3H0G G;  4APV A;  1NMF A;  4JBJ A;  1IBL Q;  3GTJ H;  4DV4 Q;  2UUC Q;  1CKN B;  1RIP A;  4B3T L;  2L15 A;  2WAQ G;  3EN2 A;  3PUW A;  3HOZ H;  1K3R A;  1JJG A;  4BBS H;  1RL2 A;  3UDG A;  1FJG L;  4A3G G;  1B8A A;  3S1M H;  4IPH A;  4HJA A;  4BBR G;  3RN2 A;  1CKO A;  3HKZ G;  4TVA B;  1QZG A;  4A3C G;  1WI5 A;  1Q86 C;  3NBH B;  4DV2 L;  5GAG C;  2HHH L;  2UXD L;  2PI2 A;  1IBK Q;  3AQQ A;  4LFB Q;  5C3E G;  4JI2 Q;  3HOW G;  1CSQ A;  4R4T A;  1EFW A;  2WAQ E;  3NEL A;  1VQI A;  3CC2 A;  2E5L Q;  2K75 A;  1A62 A;  4IFD G;  4UP7 A;  2K5N A;  3HKZ E;  4JI7 L;  2R92 G;  1N9W A;  2EXD A;  2JA9 A;  3AFP A;  3CCU A;  4QGU A;  1YJW A;  3S2D H;  1UE7 A;  5BR8 Q;  1WFQ A;  1WCM G;  2GN5 A;  2K4K A;  1KIX A;  3J7A 5;  3PCO B;  4AYB G;  2IX1 A;  4UPA A;  2A19 A;  3J80 i;  1S40 A;  1LYL A;  4A93 H;  2VUM H;  3T1Y L;  1XPO A;  1B70 B;  5LMU L;  2VQE L;  2B29 A;  3FHW A;  4ALP A;  5AJ3 Q;  4LF7 Q;  4YWL A;  4DR6 L;  4NXM L;  2CWP A;  4EX5 A;  4A3F H;  1R9T H;  2JEA I;  1VS0 A;  4PMW A;  3KF6 A;  2UU9 Q;  4A3I G;  4L5R C;  2AKW B;  4DR4 Q;  3T1H Q;  4X66 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...