1O7YA

Crystal structure of ip-10 m-form
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
b'LSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL INDUCIBLE CYTOKINE B10
publication title Crystal Structures of Oligomeric Forms of the Ip-10/Cxcl10 Chemokine
pubmed doi rcsb
molecule tags Chemokine
total genus 9
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1o7yA00
1Q3LA 2RVLA 1F9QA 2KOLA 3I3CA 2N88A 1CM9A 1TVXA 1E0BA 1QE6A 1EL0A 4CJ2C 2JP1A 3N52A 4OIJA 2B2YA 4RA8A 1BNZA 1X32A 3DEPA 2B2YC 2FINB 2KUMA 4ZKCB 5T1GA 4CJ0B 1MSGA 1RTNA 4XT1B 1DOMA 2J7ZA 4IURA 3TN2A 1WTWA 1BBXC 1J9OA 2RSNA 1G6ZA 1ICWA 4QUFA 4X3UA 2FJ2A 3GV3A 2B2WA 3H91A 1BO0A 4HCSA 4MN3A 4RAUC 4U68A 1B50A 2B2WC 5CMDA 2R3ZA 1U4MA 1C8CA 3IFDA 5CBAE 1DZ1A 1HUNA 3I90A 4HSVA 4R8IA 1VMPA 3Q6SA 3I8ZA 4DN4M 5T1IA 1EQTA 1RHPA 1WD0A 2Q8TA 2MGSA 5E4WC 1WTOA 1PLFA 1S4ZA 1B53A 4ZLTF 2K05A 1JE4A 1X3PA 2MPMA 4O42A 2KECA 4XDXA 4X3TA 5AFWA 2K1BA 2L12A 4X3SA 5D14A 4IUPA 5EPKA 2B2UA 1MI2A 2IL8A 2N55A 1IKLA 1DOLA 2MP1A 2B2UC 2NZ1D 1U4LA 2XIWA 3DM1A 1WTRA 1DONA 4HAEA 2K28A 1O7YA 1ZXTA 2MJ8A 4UAIA 2RSOA 1SDFA 2X6LA 4CJ1B 1G91A 4ZKBB 3I91A 2DY8A 5EPJA 2B2VA 2HCCA 1RTOA 4IUQA 2KVMA 2HUGA 4IUVA 1PFBA 2B2VC 1WTQA 1XYIA 1AZPA 1X3QA 3DEOA 3FPUB 1EOTA 2FFKB 3D6WA 1ML0D 1LV9A 1DOKA 1RJTA 1ILPA 2M2LA 5EKIA 1AZQA 1G2SA 2SDFA 1CA5A 3MTSA 1HFNA 1VMCA 2HDLA 5EPLA 3UI2A 1IKMA 1WVLA 4RWSC 2Q8RE 1EIHA 1O80A 1B3AA 4OIKA 1NAPA 2HCIA 1SSOA 1JICA 4ZK9B 3ONAB 3LWEA 2EPBA 1HUMA 2VXWA 3QO2A 4NW2A 5JJZA 3HP3A 2FHTA 2EOTA 3P7JA 1RODA 2BDNA 2CVRA 4XT3B 1WTVA 1F9SA 4MHEA 2KEDA 3GV6A 2NYZD 5COYA 3TZDA 1ESRA 1NCVA 1CA6A 5D65A 1HRJA 1GUWA 1HA6A 1XX8A 2K04A 4X3KA 2DY7A 1J8IA 3IL8A 2NWGA 3F2UA 2L9HA 2K03A 2K01A 1B2TA 1M8AA 3FDTA 5DNFA 3KBXA 2L1BA 1F9RA 1KNAA 1U4PA 4QUCA 1HFGA 2JYOA 2KEEA 2X69A 5EQ0A 1ILQA 2X6GA 3G7LA 1WTXA 1AP0A 4HEDA 1QG7A 2RA4A 1SAPA 4LMQD 1EIGA 1WTPA 1HHVA 2HDMA 1G2TA 4IUUA 5CORA 1A15A 2L11A 2H1EA 1NR2A 1U4RA 1KNEA 1PFMA 3KUPA 3MWYW 5EJWA 2FMMA 4R9WA 4ZAIA 1O7ZA 1BF4A 2D9UA 2L4NA 1PFNA 2B2TA 1PDQA 2EE1A 3SVMA 1WD1A 1IL8A 1QNKA 2B2TC 5CBEE 1MGSA 1F9PA 4IUTA 1B4OA 3R93A 1NR4A 5E4XA 1MSHA 1F2LA
chains in the Genus database with same CATH superfamily
1NJIC 3N6RA 1LTRD 2WP8J 3ERQA 2LFNA 2EVBA 1I4PA 1JQYD 1FYCA 4L5SA 1MIUA 3CRKC 1VQ4A 1OXXK 1LT5D 2A73B 4DNIA 1V9PA 1CK1A 3Q23A 4JI3L 3KFUA 1FD7D 3TQYA 1ET6A 5JEAG 1E24A 3CCUA 5CV6A 4K0KQ 1YNXA 3HFZB 3O13A 1B53A 4ODGA 2R93B 4HMIA 2D0PA 4XDXA 4DV1Q 1Y1WH 3NWSA 3BZDB 4A3BG 2HT1A 1ONLA 3CQZB 1EY6A 4AYBG 1B9NA 4KI0A 1STHA 5FKAC 3IKJA 1VQNA 1CQVA 4LFCQ 3L9AX 3D4WA 4O1NA 2QA4A 2RDHA 1TU2B 1JC7A 1Y69U 1KLGD 4DA2A 2N78A 1HA5A 2YU9H 1WVLA 2PQEA 1SBBB 4LF8L 2OWOA 3EIVA 1FVIA 3KBGA 3RD4A 5M3MG 3HP3A 3K5LA 1LT3D 3I4OA 3J7YW 3UDFA 2KEDA 4OO1H 3HOYH 1VDZA 5COYA 3OWFA 1Y1WB 3FHWA 5KGUA 5FLXE 2J0TD 4A3EB 1B1ZA 4LF4L 1Q46A 3FDTA 3SGIA 4JI7L 2Z1CA 1EU3A 2L1BA 4FO2A 1PRTC 1ENFA 3K8AA 1E2VA 2HIVA 3BDCA 1JOKA 2KEEA 4OWTB 1E3PA 4HJ7A 2EZVA 2EY2A 1YEZA 2YU9B 3BVGA 1SJED 2D5DA 3D4DA 2EYJA 4CDEC 4C2MH 3VDYA 3UDXA 2GA4B 4LF8Q 4CDDC 4KY5A 1MGSA 3L2PA 4NXNL 2AQ2B 2ZXRA 3HOWH 5IT9c 2RVLA 1B44D 3E6ZX 5KIXA 4Y7NH 1QZGA 1E1TA 1TVXA 4P74A 3HOYB 1EWHA 2B63G 1FL0A 2CW0C 2YV5A 3SEBA 3TN2A 1A62A 1G6ZA 4CKEA 1BO0A 1I3QH 4LF4Q 2F4VL 4JI7Q 1Q8KA 4KY6A 2PMZE 4JOIA 2NB0A 4ZLTF 1VS0A 3U58A 2K05A 2WAQE 3H3VH 3Q22A 4NDXA 2M00A 1R4PB 2EYOA 2LXKA 3KYHC 2IT1A 2MP1A 3DM1A 5J3BA 2E2JH 1YNJC 2XWBB 3J81E 5KNCA 1ZXTA 1XNRL 1UEAB 3K81C 3HOWB 2XWJB 4Y7NB 1AZPA 1JORA 3AFQA 4FDBA 3M85A 3K59A 3RLOA 1JWUD 1HFNA 5CGKA 5IWAL 4A3BB 3UI2A 3PV0A 4C3IH 4AYBB 4E6IA 4C3HG 2F0TA 3AFPA 3CCVA 1XMQL 4UY8C 2HCIA 2ID0A 2VUMG 1QVGA 2P5ZX 4K8JA 1I3QB 4IPDA 2EPBA 1VQMA 4QJFA 1U5KA 1NUCA 4ABNA 5J1ZA 2HIXA 3I55A 3S2DH 1BR9A 1LM0A 4XT3B 2O4XA 1K8MA 3TZDA 3MXUA 1M4VA 4QMGA 5E7NA 1PHJA 4A75A 4DNTB 4IFDI 1IZ6A 5KYLA 2E2JB 3F2UA 3DWAA 2Q2HA 1RF2D 3T13A 1XNRQ 1VQ8A 1E1OA 1FJGL 3V2TA 2E8GA 5IOCA 2Q2UA 2HDMA 2D0OA 1SNQA 4IUUA 3PF4A 2H1EA 5IWAQ 4A3IG 4C3IB 2C9OA 1YBYA 4LF7Q 4Y52H 3K80C 4A3MH 1PDQA 1R4QB 3DXJC 2XRQD 1SYGA 3STBC 2KOLA 1HZCA 4XQNA 2ZXOA 3CXCA 1JCKB 2B2YA 4RA8A 5ISRA 1BNZA 1NSNS 1PYSB 2KUMA 3D4RA 3SE0A 1GXDC 5D3DA 4GNXA 4XT1B 4L5RC 5BN4A 1GUSA 5C4JB 1SYDA 2AWNA 1PRTD 4R1JA 4X3UA 1G91A 5IT9E 2LSSA 2IY5B 4XQQA 4DN4M 1XJVA 3CCLA 2B63B 1CHPD 3TREA 1KAAA 2K32A 4JPBW 5AFWA 1JWMD 4Q0FA 2RCNA 2UUCL 1C9OA 3NHHA 5HY6A 2VZAA 4A3MB 1S5FD 3HS0C 1VQPA 1SDFA 2CH4W 4CJ1B 3AB9A 2L15A 1RTOA 1C7YA 4LF9Q 2B2VC 4PG3A 3RN2A 2K50A 1X3QA 1J5EL 4KHPL 2CW0D 4DR2Q 2F4IA 4LFBL 3A56A 1OXTA 2WKDA 4KKUA 1UUPA 1IKMA 4KJNA 4I65A 1KAWA 4OIKA 3CC2A 2WKCA 4A3FH 4KY7A 1SNOA 1HUMA 5HGTA 1Q12A 3HOVG 4R4OA 1F9SA 1PH8A 2NVQH 3M9BA 1CA6A 1YNJD 3OIQA 1BUVT 1I4RA 1PZKD 4CDCC 3CD6A 3EN2A 3BYYB 3IL8A 1NTGA 3EFXD 3ULLA 4B08A 2K01A 1PTOF 4H02A 3CCJA 3S1NH 3HRZC 3HKZG 4QUCA 2JA5G 4HJ5A 2RA4A 1EIGA 5GAEC 4KHPQ 4Q5VA 4KKTA 4DPGA 2IW3A 1RIPA 2BH8A 2L11A 4U673 1KNEA 1PFMA 2M9VA 4A3LH 5FO9B 1SXTA 1VQAA 3OW2A 4JI6L 4IUNA 5CBEE 1FGUA 3MXNB 1FNWA 4IN3A 1PTOH 3HKSA 1F2LA 1E22A 1Q3LA 1E0BA 2YTXA 4UPAA 2F0LA 1K3RA 3KJOA 1X32A 2EXDA 2I0QA 1LTSD 1GD7A 1EZ6A 4A3KG 1EIFA 1F2ZA 3OPOA 1BBXC 1N34L 1VQLA 1UEBA 4J6HA 1HHVA 1B50A 1KLUD 4FF2A 4YWKA 3WDNA 1HUNA 3Q6SA 1Q90A 1LT4D 1HCZA 5ELDA 4KTAA 3OW7A 3PIO3 2PQAB 2E75C 4Z9CB 1O7IA 5M3FG 5IP9G 2IL8A 2N55A 1DONA 4JI6Q 2NVYH 2AQ3B 5CV4A 3STBD 4QL5A 1EY4A 2Z6KA 2JA7G 1IBLQ 1PTOB 3NTIA 4DF7A 1BKBA 2KCNA 1WTQA 4F88A 5C3EG 1YVCA 1CA5A 1NY4A 1HXYD 5IYDG 4JYAL 3CMEA 1EIHA 1O80A 2EDGA 4JI8L 5JJLA 2ZM6L 4ZK9B 1N34Q 3ONAB 4JI5Q 2A68D 1SYCA 2WINB 2F0SA 1PRTF 1WTVA 3I73A 1AE2A 1YHQA 5EKKA 3HOUG 3D3RA 2AMCB 1HQMC 3TBIB 3FKIG 3PMFA 4KV6A 4A93H 1IL2A 4DK3C 4DK6C 3RZDH 2NVYB 1IBKL 2UUBL 3A74A 4J8QA 1YZ6A 3E9IA 3NENA 4X64L 2F0FA 3A8IE 2IWHA 1XWEA 2SNSA 2IHFA 2JA6G 1DM0B 1EQQA 1G2TA 1SLJA 5JPNC 4DR1L 2H5XA 3GTQH 4X6AH 5M5XH 2QILA 5I2XA 4DR7L 3RR5A 5K36G 1YNNC 3SVMA 2EE1A 4JI8Q 1IL8A 1QUQA 3C1EA 1S5DD 3D31A 3HOXG 4NW2A 5E4XA 1Y8NB 1V1PA 1F9QA 5EAYA 1CM9A 3MXGA 4RHRA 2ES2A 1V8QA 2AUKA 1MSGA 4LUVA 1TWHH 5M3FH 4LF6Q 1Q1EA 4A93B 3DWPA 2XGTA 2JA7H 5F2DA 1ICWA 1JJGA 2FJ2A 1TWCB 4DV0L 1IBKQ 1SJHD 4WJWA 2UUBQ 3CCQA 1P8LA 2R7ZH 5H1SE 4K6LA 2ALYB 2YTYA 4X64Q 3W1GA 1MKHA 1TY2A 4P72A 2BDOA 4KN7C 1PLFA 1S4ZA 3I4MG 3GTQB 4HJ8A 1PRTB 3FRPB 1SYFA 1MBYA 1UE7A 2F52A 5EPKA 2A69D 4DR7Q 4IZ8A 4LF5L 1H9RA 5A2QE 2B2UC 2RKSA 1U4LA 1WTRA 4IFDG 4A3CH 2R93G 1K73C 4QB4A 3VA7A 2KCCA 4R4CA 4J15A 3G6JB 2Z6BA 4NMZA 1VQBA 1A2UA 1EY7A 1D2BA 3HOUH 1G2SA 2UXBQ 3Q0AA 2UXDL 3DUZA 5M3FB 1TWHB 1EIYB 1GJXA 2N8NA 4JG2A 2JA7B 4HJAA 2NUCA 5A35A 2KHSA 2PI2A 3ER0A 3JC66 3QO2A 4DV0Q 1JE5A 1EU4A 2R7ZB 1TWGH 1RODA 1W3SA 3WOEA 1LTLA 1X65A 4GLXA 3BDLA 4AYBE 4PMWA 1NCVA 4RH6A 2CHBD 2O5JC 4X3KA 4LF5Q 3S16H 1PYWD 3E0EA 1Y1WG 3VR5A 5JJIA 2A6ED 1SN8A 1KNAA 1U4PA 4GN4B 3RUZA 3GTLH 2AWOA 4IJLA 3TS0A 1ILQA 4HEDA 4GOPB 2UXBL 3HOUB 1KQSA 2TMPA 1IHZA 5FO7B 2KHIA 2UXDQ 2RQXA 2L4NA 2QEJC 3B6YA 1WD1A 5GQOA 4DAYB 3D6CA 2PPBC 1VQFA 1QWYA 4M8AA 3U9OA 1HQRD 2B39A 1QOHA 3SHLA 4CJ2C 1GUOA 1VQEA 3AMUA 2DJGC 2JK8A 1ASZA 3X3MA 4OO1G 3HOYG 3PIP3 3S16B 2QDLA 2NN6H 1ENAA 4ME5A 1CZGA 4ME3A 1BQQT 2PI2E 3NXWA 1FR3A 2VQEQ 1QJOA 4DUZL 4L5TA 1VMPA 3I8ZA 1XPOA 4WRDA 3SK8A 3ICEA 4KJOA 3PUVA 1NBWA 4LFCL 1YNND 3S2HB 4DK0A 1X3GA 2F0VA 4QF4A 4RGOS 1EYCA 4UAIA 1YHBA 1AN8A 4RMFA 4IUVA 1I4QA 2KVMA 3J81c 3QG1A 3FPUB 4B3SL 3I4MB 2F3IA 2B8FA 4B9WA 3MTSA 3HOWG 5ELFA 4HIOA 3MXNA 1KXLA 3S1MB 4OL7A 4PV1C 1CKOA 5LHY1 4RHSA 1ICFB 1SSOA 3S17H 1JICA 1TR5A 5DAUA 2F0JA 4MIUA 1KDAA 5K5PA 3GP7A 3P7JA 4DUYL 1PH7A 4DUZQ 1C4QA 3HOZH 3K5OA 4GKKQ 5C4ZA 2OEOA 3CHBD 1SMYC 1ESRA 3URYA 1ASYA 1TS4A 2K7VA 3H94A 4MTKA 1T5XD 2H4OA 5KEEA 3PIOA 3VR6A 2E76C 2WB1G 1GVPA 3MVVA 4XYOA 3NBIA 3WOFA 2OQ0A 4EQ5A 1L0WA 2PCFB 3BU2A 1F9RA 2F0MA 3QOLA 4L5QA 4H44C 1HFGA 1TIID 3F8TA 5D3IB 3K0YA 3NUCA 3MEHA 4OXPA 3GTKH 1W6JA 4ZYSA 3NTKA 3QR8A 1SRUA 4B3SQ 2D2CC 4X62Q 2LS01 1G8ZD 1SE2A 4KD4A 2K6AA 4R9WA 2D62A 1K3BC 3D8GA 3S17B 4WJ3M 1KABA 1WYDA 2B2TC 2KQ3A 4IUTA 3CC7A 2F1MA 4C3IG 3S9WA 3C3LA 5C4HA 4HCEA 2ZJPA 3HOZB 4DUYQ 2RDGA 1QE6A 1JJCB 4UDUC 1OXVA 3ND9A 1ZYRD 2PW5A 3E9HA 4R4TA 4DV3L 4G7OC 2K5NA 4FP5D 2Z0SA 1D5XC 3SK4A 3R8BA 3VYSA 4EQOA 1K9MC 5CMDA 2R3ZA 3IFDA 4DNRB 4DR6L 3GTKB 1EQTA 2CWPA 3TP7A 4G57A 4BA1I 3FPPA 3FVQA 4PZ8A 4IUPA 5CR3A 3CPWA 1HTPA 1PXUA 3M4PA 3PQIA 2K28A 3J80i 2RSOA 4ZUJA 1PYBA 3I56A 1UE1A 1K0RA 1X55A 4ZKBB 5C4XH 3M3YH 1PVOA 1SNPA 1GHJA 1TQOA 1Y14B 4DR3L 4A3MG 4PMBA 1A2TA 3F1ZA 4AQYL 1AW7A 4BY1H 2VS1A 1BBWA 1WCMH 3I2ZA 1G6PA 4G7HC 4DV3Q 2Q8RE 2UXCL 3KDFB 2I46A 5E1FA 1PTOD 4IQZA 4YWLA 3GD7A 1ET9A 1X3FA 4C2MB 5IE8A 4DV5L 2FHTA 2YYZA 3G71A 1N32Q 2CVRA 2SNMA 4GOPC 4DR6Q 2ZTEA 4CKCA 3K6OA 1OTCA 4EVOA 1GUWA 2ZT9C 2E2HH 3DMUA 3A54A 1LYLA 2ZXPA 1STYA 2JEAI 1I4XA 3KBXA 1HR0L 3IFTA 4LF7L 3M3YB 1M90C 4P2CB 1K0SA 2F0PA 3JAMi 3NEMA 3HEJA 4DR3Q 4BY1B 4V0BA 4AQYQ 1EY8A 2BOSA 3M4OH 4IOCA 4K5VA 4N8X1 3LGJA 1CKNA 1Z7TA 4DXGA 1GM5A 5I2YA 4TKOB 2WB1B 4GKJL 2UXCQ 1O7ZA 1I4HA 2PYKA 1X3EA 2I07B 4JBJA 1RL2A 2I5HA 1F9PA 3TRZA 2O2LD 1Y8OB 3GTJH 4DV5Q 1LTBD 1EY0A 2NN6I 4A3FG 4N9TA 3M7GA 1GUNA 1F77A 1SE8A 2JP1A 4MNOA 2FINB 2OT2A 4KMUC 1A3VA 1E7ZA 3HKZE 4RCNA 1ENCA 3V05A 2E2HB 1N8RC 3UE0A 1WTWA 1EYAA 1VQIA 2Y0SG 1QB5D 4FXDA 5IIFA 2IJ0A 5C3XA 1EQRA 2EYFA 2B2WC 2F0EA 2B8GA 1HR0Q 3KK7A 5J22A 4HTHA 1VQ7A 4CGYB 2L0CA 3J7AV 4IOAA 2Q2TA 3BG3A 4LF9L 3M4OB 3M7NA 1X3PA 1B3QA 4DR4Q 3S2DB 5D14A 2L12A 4X3SA 4DR2L 2LKVA 4GKJQ 1JOOA 1EWIA 3J80L 2G9HD 1W2BA 4A3LG 3GTJB 5GROA 2F0WA 4DK1A 5IGFA 1Z9FA 2IX1A 1HZAA 3ULPA 1Q86C 1E2ZA 4DAYA 2L55A 2K5QA 5JAVA 5C5MA 4P75A 4BS9A 3GTMH 1NAPA 3S1RH 4PZ6A 2LMCB 1MHWC 3PUYA 5FJ8H 5C0XI 1EFID 5JJZA 2K4KA 5LL6X 5IGCA 4LUOA 1NNXA 4NXML 3CW2C 1SYEA 4MHEA 3ITPA 1TS2A 4ALPA 2SEBD 3MHBA 2C5CA 2XTIA 1PZJD 1TXYA 1B8AA 3DLLA 1HH2P 2KCMA 4UP8A 2CCZA 2DY7A 2MFIA 4HR7B 1D5ZC 2XRSD 5JPMC 1Q1BA 1KC8C 2OXPA 1YJWA 3JAML 3C2PA 3ERSX 1DCZA 3A8KE 2JSOA 3E3XA 5G3LD 4QY7A 4OX9L 3EA6A 1VQGA 3GTMB 4EQNA 2JE6I 3SK6A 3LWUA 3OIPA 3S1RB 3EVQA 4C1NI 1F2YA 5ELOA 2F0OA 3SK5A 1MSHA 1GHKA 1CHQD 1NR4A 2EQSA 1JOQA 1X6OA 4BBSG 2N88A 1SFOH 4NXMQ 1J6QA 4PNYA 3U50C 1T5EA 1A6XA 3Q24A 2WIIB 4LUZA 5IGGA 5IY0A 1Y8PB 4KK7A 3I72A 3T1HL 2I5LX 1O78A 3T53B 4K8IA 3VYTA 4OWWB 4A93G 4HSVA 1C0AA 1XPRA 4A3FB 1LLRD 1IBLL 3S1QH 4HJ9A 1G291 4HSPA 2TSSA 1QVFA 2KCTA 4OX9Q 1N36Q 1MD2D 2VY3A 1GUGA 2F03A 2K52A 1DYQA 2Y0SB 5EBCA 2AHOB 2NVQB 2A6HC 4UHVA 1EEFD 2A1AA 3TSSA 2OTJA 2R7DA 3EQLC 1P16A 2DY8A 3A5UA 2B2VA 4JI5L 1PFBA 1SFOB 3S1NB 1X54A 1LV9A 3KLSA 3NP8A 1DOKA 2WV6D 1SE4A 1I94L 2Z8LA 5GAGC 3A5ZB 4RWSC 2E2IH 3CC4A 4BWGB 5FK9C 3W1BA 5ELBA 1CUKA 1L1OC 4UP9A 3T1HQ 3W5OA 3S1QB 2Z4HA 2MHVA 4RGTA 2NTSA 3GV6A 1RD9D 4JBWA 3U4VA 1PV4A 5IP7H 1OXSC 5JVG3 2DNEA 2R7ZG 4DR5L 3BVMA 4LFAL 1U0LA 5IGEA 1PH6A 1H9JA 3MFGA 5FOBB 2DN8A 4LAAA 1MJEA 4A3GH 2XVSA 3CU7A 1AEXA 2A74C 4BBSH 4A3CG 1HNWL 3RN5A 5LMNL 1HJPA 1HPCA 2PMZB 2R7FA 3GO5A 1LTAD 1A15A 3TP5A 1I94Q 1RCVD 2E2IB 1TS3A 5ELEA 2QGQA 4LF6L 4IFDJ 5I6WA 1TWFH 2K5WA 4GN3B 4R4IA 4C3JH 3R93A 1WD0A 3W3AA 1D5MC 4K5XA 2PW7A 3KDFA 2JN4A 4X65Q 5BR8Q 4A3DH 3MFYA 3F2CA 5BN3A 4DR5Q 1EOVA 4LFAQ 1JT8A 2RF4A 4DAPA 1VCIA 1L0YB 1LABA 2PZTA 4A3GB 1IYUA 5KNDA 5CBAE 4QCLA 1WTHA 3EBEA 4R8IA 4BBSB 2ENBA 3I70A 1HNWQ 3TEHB 5HGQA 1D6EC 5LMNQ 1VQJA 2JXMB 1S5BD 1BCPB 2KECA 1TT2A 3G48A 4X3TA 2K14A 2HD3A 4FXGC 1U9RA 4MTNA 1Q7YC 3GTOH 1UE6A 3K0XA 4I7ZC 2WACA 2HHHQ 1K8OA 2A19A 2ICIA 5G3LF 2K33A 2EY5A 4C3JB 5KNBA 5EPJA 3RZDB 1KDBA 1SROA 1V1OA 1GKHA 1K8GA 3DEOA 3MAQA 3D6WA 3K5NA 1ML0D 3K7UC 2KHJA 5EKIA 4A3DB 1HZBA 3RMHA 2R61A 1LACA 2ZTDA 1LUZA 1K83H 4OWXB 4JI2Q 3F2DA 1CSQA 4LW1A 5CV9A 3CCMA 5M5XB 3LNNA 4BBRH 3LWEA 1GO3E 2QKIC 3NTHA 2KENA 3QIAA 2F0NA 2R92H 2E74C 2NN6G 3U9SA 2F3WA 4GS3A 4GZYC 1CZWA 3A55A 3MC0B 3GTOB 2FMCA 2A6HD 1S72A 5CYUA 1HRJA 3CKIB 2BH2A 5FLMH 3BZCA 4K14A 2NWGA 1JWSD 4EQPA 3NE5B 5IYCH 1PFSA 1A3TA 4JV5L 2HQLA 3HG9A 2E2DC 3G7LA 1QG7A 3A7LA 3C1FA 3F2BA 3RNUA 2F0DA 5NUCA 1NMFA 5CORA 2F0IA 1K83B 1UAPA 4R8NA 1WOCA 4QGUA 3KUPA 2J4XA 3J7ZC 5CV7A 4DV4Q 1BF4A 4JBMA 1K8AC 4RFBA 2GVBA 5CC4A 5C5LA 4DAMA 4FYDA 2JEBI 4FNFA 2VL6A 1STNA 1AH9A 1ESFA 4KHZA 4DV7L 1TS5A 3PUXA 5M9OA 3P1HA 2WB1E 2VQEL 2OTLA 2EY1A 3I4LA 3CAMA 3E0JA 4H7BA 3P75A 3HOZG 3NBHB 4IPCA 4JI1L 2BE5C 4MZ9A 1HNZL 2GVAA 3OOCA 1DZ1A 3CRLC 4B3MQ 3T16A 1S5ED 4JV5Q 1N9WA 4IALA 1SMXA 2Q8TA 1BBUA 1I6HH 1TWGB 1JB3A 3CCSA 3QJYA 3X3NA 2B2UA 1MI2A 1M1KC 5IODA 1TWAH 4ILWA 3VYUA 1VQ9A 2K75A 3ULJA 3MEFA 1FNVA 4NPSA 2PZWA 2FFKB 4DV7Q 2NVXH 4L63B 1D7QA 2AQ1B 2M2LA 3GTLB 1PH2A 2EYHA 4GKKL 3SDZA 4FF1A 5ELCA 4IJHA 4IO9A 1VF5C 4JI1Q 3RZOH 2VXWA 1HNZQ 1EY5A 5M5YH 3GTGH 1DJRD 4O2DA 1KTKA 4JI0L 1I6HB 2PZUA 4N9PA 1QILA 3TP8A 5L37A 4RG1A 1A8VA 3T4AC 4X62L 2MO1A 1J8IA 3KLWA 2EIFA 2K03A 4GLAC 4QIWB 1TWAB 1V43A 3KF8B 4RKBA 3T1YL 1S40A 1SYBA 2X69A 4BY7H 2JA8G 2NVXB 1KDCA 5C4XG 5IGDA 2NZOA 1VQ5A 4ZCKA 3DM3A 5IYBG 4BXXH 1G51A 4BY1G 5C0XH 1WCMG 3RZOB 3J81i 5M5YB 4FVMA 3GTGB 2DJFC 2XN9C 1EL0A 4S3SA 2PQAA 4JI0Q 3GQBA 3IRBA 4PQXA 5AJ3L 1STEA 3K57A 1BCPC 1BVSA 4GN5A 5T1GA 4A3EH 1B70B 4WFN3 4FF3A 1VQDA 3MZ5A 3J7A5 1L0XB 2Z4IA 5C44H 2EJFC 1ZEQX 2OF1A 4NB3A 1C8CA 2QW7A 3PSIA 2F0UA 3T1YQ 4BY7B 1WTOA 4JOIC 3I4NH 4J1MA 2F0QA 3BS1A 1JMCA 3DHQA 4JI3Q 3KLRA 3GTPH 1H95A 5EGTA 5FLXL 4HAEA 4JBKA 2X6LA 4B3TL 1VQOA 5JJKA 2HUGA 1XPUA 1SNMA 2BCOA 2WFWA 3KLSX 4DKAC 1H9MA 2Y0SE 3HGBA 1ILPA 1N32L 2BE5D 5AJ3Q 4HIKA 1PA6A 1SE3A 3H0GH 2A8VA 4P73A 1B3AA 1CSPA 3OMCA 3J80c 5C44B 3NPPA 5I4DA 1W6KA 1EYGA 1IXRA 1B9MA 2JA8H 3U4ZA 2IX3A 4HIMA 4QQBX 2I5MX 2OQKA 1YHAA 3I4NB 5DM73 2EYMA 1L2FA 3SR1A 5IYBH 2K04A 1TY0A 2AKWB 2RCFA 3OHXC 5JEAH 3GTPB 2R6GA 3FEWX 2UU9L 3PUWA 3KF6B 4B3TQ 5JOBA 3ND8A 2QCPX 3OWEB 1CFMA 4LNQA 1I50H 4A3BH 4LMQD 2VQFL 1FNUA 1EYDA 2ASBA 1YIJA 1XTDA 3H0GB 3A7AB 4RGNA 3BZKA 3OYYA 4LWCA 1QNUA 1HR0W 1WI5A 1CI3M 4CBVA 2B2TA 3K5MA 3GDEA 3J81L 1SR3A 1D8LA 1B4OA 2NTTA 1RDPD 3JAMc 2NZ1D 3QOJA 4OELB 3W2DA 3I3CA 3K7AH 2JA8B 3H6MA 5FJ8G 3CCEA 1KRTA 5M5WH 5C4XB 1L1OB 3DEPA 2B2YC 3VR4A 4CJ0B 5M3MH 4GNXC 4DR4L 4NXNQ 1WCMB 1J9OA 3BJUA 3H91A 2UU9Q 1QUQB 1Z6HA 4KKSA 4XTCS 1IYJB 2CKZB 4WORA 3AEVA 1I50B 1FGBD 3S14H 1V1PB 2MGSA 5E4WC 2VQFQ 4A76A 2GN5A 1JE4A 4LK1C 2MPMA 1YITA 1SMYD 3J7AF 4K2LA 4DV6L 2O5IC 5LMUL 2FXQA 4RKLA 4POGA 2F4VQ 1S5CD 5CV5A 2E5LL 1IYVA 2MO0A 4JW0A 4PMCA 1X9NA 3QB3A 1EY9A 1Y1VG 3I91A 4AIMA 1WFQA 2HCCA 2XNAC 3K7AB 1XYIA 2ZJQA 1BCPD 3Q8DA 5M5WB 1Z47A 3KJPA 3TS2A 4OGQC 1QVCA 1RJTA 3S15H 3H09A 1VMCA 5EPLA 5EBDA 5M3MB 5C4JH 3AQQA 2UUAL 2CFMA 2NBFA 2BA0A 4O0AA 4X66L 5J39A 2B63H 1Q81C 2EYLA 1HZ9A 1UNSA 3IAYA 4GOPA 3NBHA 3S14B 2IPKD 5HURA 1EFWA 3T56B 1PZID 2NYZD 4L6TB 2K5VA 4LJZC 1H9SB 1KHIA 1XMQQ 4A3JG 3RLFA 4C1NK 1XX8A 4PZ7A 1KRSA 4DV6Q 3PGZA 5LMUQ 1HNXL 1C48A 1AE3A 2ATWA 2V1CC 3J80E 2CH4A 2L9HA 4FXKC 2V4DA 2E5LQ 3NQTA 4OONA 1KL9A 4JCVE 3ZJYC 2JYOA 5DM63 1AP0A 2X6GA 2IX0A 1II3A 5IT9L 3PIPA 2ZJRA 1LT6D 2K5HA 4V190 3S15B 1O7LA 1IBML 3CCRA 1NR2A 1PMRA 4NKLA 5EJWA 4ZAIA 2UUAQ 2YTVA 1H9KA 2Q2IA 4DFAA 1XNQL 2WAQG 1A3UA 1FJGQ 1I4GA 2A68C 4X66Q 2DNCA 4TRDA 3OMGA 5C6AA 5TSSA 4C3HH 3H15A 2JQOA 4OIJA 2VUMH 4ZKCB 2BA1A 1D1IA 1RTNA 4N8FA 4FF4A 1DOMA 4AH6A 1SNCA 2J7ZA 4IURA 4YHHL 3PO3G 3M4QA 5IP7G 1N36L 3L3OC 1EUJA 1HNXQ 4QUFA 3GV3A 2B2WA 3T51B 3DWQA 1Y1VH 2KBNA 4A4IA 1EEID 1RKNA 3JAME 3I90A 3PCOB 2MNAA 1N33L 1VF7A 5T1IA 3P20A 1HTLD 1SEBD 4OO1I 1AFPA 3AYHB 4A3GG 2JJQA 3KF8A 2VNUD 1QCBD 1IBMQ 1BXTA 4KN4C 4EX5A 5GADC 1IKLA 1DOLA 4BA2I 4XYQA 1E2WA 1V1QA 2JA9A 3NQIA 1XNQQ 1O7YA 4K6DA 3TMEA 3KOJA 2Z6KC 1Q82C 2G9DA 1LTGD 4POFA 1TKWB 1I6VC 1K28A 1LTTD 3G6EA 4A3IH 1NMGA 1EOTA 4C3HB 3TP6A 4C3JG 2UUCQ 2VUMB 2RHSB 2HDLA 4A3JH 2RHQB 4KHVA 5CV8A 2OCEA 4XXEA 3V96A 4YHHQ 2ICEC 4A3DG 4CHTB 1JJ2A 3S24A 1Y1VB 1J5EQ 3CPFA 3VR2A 4B9XA 4LFBQ 4H0LC 3NELA 1N33Q 3BVZA 1JB7A 2VB2X 3BYTB 4TQUS 2EYPA 2RDFA 5D65A 2A69C 1ZKOA 4TSSA 1QZHA 1YI2A 4EGVA 4F7XA 4YWMA 3A8JE 1WJJA 3WWVA 1STAA 2PNHA 4YCWA 3AU7A 5DNFA 5I9PA 1X56A 2EJGC 4OEMB 5JVH3 5EQ0A 3UDIA 4A3IB 1WTXA 2F3VA 4YCUA 3K58A 3VYRA 4R4QA 1UWVA 3EJIA 2XSCA 4A3JB 1PH5A 3H3VI 4QIWE 3MA2B 2MQHA 4B3RL 1BCPF 2NZHA 4X65L 1CTMA 2DGYA 5BR8L 2FMMA 3NK9A 3PO3H 3VR3A 4K2KA 1QNKA 3L0OA 1NE3A 4YCVA 5LMNW 2NVTH 4JC0A 4H13C 2EJMA 3FP9A 2B3GA 4BBRG 5IGBA 4L8JA 4YIJA 1A63A 1STGA 5DLQE 2R92G 5KYIA 2CWAA 1LO5D 1GUTA 3HOVH 3PUZA 2MUYA 2WAQB 2A6EC 4U68A 4MN3A 2HHHL 4HCSA 1IW7C 1CQFA 2N3SA 1YJ9A 1R9TH 1GOZA 4DGZA 5FLMG 4APVA 3H3VC 4F87A 1KIXA 1BOSA 5IYCG 1RHPA 4M1UB 3UDGA 1VQKA 3RLNA 4KD3A 1DXMA 2LY7A 4OHJA 2K1BA 3KF6A 4B3RQ 3PO3B 2XIWA 2JA5H 2NVTB 1B7YB 4JI2L 2F0HA 4IUQA 4DV2L 4IPHA 1PH4A 1BDOA 4CKBA 1T9HA 2SDFA 4HMJA 1VQHA 1CKMA 1TWCH 3HOVB 4F8MA 2LXJA 2VB3X 4HN7A 1SNDA 1CT1D 4WJ4A 1L1OA 1R9TB 1Q8IA 3A0JA 3C46A 2EOTA 4G7ZC 1TWFB 2BDNA 4HIDA 4JYAQ 4A3KH 1EQVA 2EY6A 1F2MA 5I9OA 1PH3A 3OTOL 2PNRC 2ZM6Q 1HA6A 3HKZB 5E3FA 1UE5A 3G4SA 2VW9A 2JA5B 4IPGA 3ZYYX 3PO2G 3D0FA 4DV4L 2ZTCA 5C0XJ 3EROA 2L5TA 2PO4A 3CP0A 4DV2Q 2CQOA 5IP9H 4ULLA 2F0GA 3NSWA 4RCOA 4UP7A 4CDFC 1DD2A 1JR0D 1DGSA 2QDBA 4DU9A 2KJXA 2CQAA 3MWYW 5FO8B 1KD1C 1PFNA 4GLVB 5C3EH 5A2QL 3L7ZC 4KLKA 3CMAA 4YY3L 5IYDH 2EXZA 4DR1Q 4A3KB 4B3ML 4DAVA 4ZUIA 3N52A 2F0KA 3R2IA 4NP5A 1CKNB 3TZUA 4XIGS 3OTOQ 4G4KA 3HZXA 1PH1A 2Q8IB 2RSNA 2SOBA 5EKLA 5C3WA 2C35B 3M4YA 4RAUC 1XMOL 1S3OA 1H9SA 1U4MA 2A5HA 4BBRB 3FKIH 4ID6A 3VA5A 4O42A 2R92B 5GAHC 4BY7G 3NWTA 4JK1C 4DXFA 5I6YA 5KRUA 4ZRZA 4JI4L 3UE1A 2Z9HA 5C3EB 3SXHA 2MJ8A 3E5SA 3J81j 2JA6H 1EZ8A 4BXXG 4ZQ3A 4YY3Q 2QF7A 5C0XG 5K36H 2QEXA 4TVAB 5ELNA 5LL6S 1ZYRC 1AZQA 1STBA 4C56C 3HOXH 5FLXc 1IW7D 2G5DA 1OO9B 3R2TA 2AUJD 3PO2H 4A3EG 5JEAJ 3TDQA 2RBMA 4GNXB 1XMOQ 3I7FA 1D1KA 3FKIB 2KA7A 2DUDA 5C44G 3S2HH 1LTID 1XXGA 3CF5A 1XTCD 4K5WA 3LX0A 2IHEA 2B29A 4RGMA 4JVZA 3R3OA 1OXUA 1PH9A 2N49A 1A0IA 4JI4Q 1B2TA 1M8AA 4I7AA 3OSOA 1VQCA 3I4NG 3FMCA 2JA6B 3I4MH 3PF5A 1I5FA 4K0KL 1YJNA 3QWNA 4XQJA 3S1MH 1WTPA 1SAPA 2HQEA 5DEHA 4DV1L 4IFDH 2R93H 1MJCA 5BN5A 4P71A 1U4RA 3HOXB 1PTOC 3CQZH 2D9UA 2K5DA 3MXPA 1VQ6A 3PO2B 3H0GG 3BDOA 1EWCA
chains in the Genus database with same CATH topology
3N6RA 1LTRD 2WP8J 3ERQA 2LFNA 2EVBA 1I4PA 1JQYD 1FYCA 3CRKC 1OXXK 1LT5D 2A73B 1CK1A 3Q23A 1FD7D 1ET6A 5JEAG 5CV6A 3O13A 1B53A 4ODGA 2R93B 4HMIA 4XDXA 3NWSA 3BZDB 1ONLA 3CQZB 1EY6A 1B9NA 4KI0A 1STHA 5FKAC 3IKJA 1CQVA 3L9AX 3D4WA 4O1NA 2RDHA 1TU2B 1JC7A 1Y69U 1KLGD 4DA2A 1HA5A 1WVLA 2PQEA 1SBBB 3KBGA 3RD4A 3HP3A 3K5LA 1LT3D 3J7YW 2KEDA 4OO1H 1VDZA 5COYA 3OWFA 1Y1WB 5KGUA 5FLXE 2J0TD 4A3EB 1B1ZA 3FDTA 2Z1CA 1EU3A 2L1BA 4FO2A 1PRTC 1ENFA 1E2VA 3BDCA 1JOKA 2KEEA 2EZVA 2EY2A 2YU9B 3BVGA 1SJED 2D5DA 3D4DA 2EYJA 2GA4B 4KY5A 1MGSA 2AQ2B 2ZXRA 2RVLA 1B44D 3E6ZX 5KIXA 1TVXA 3HOYB 1EWHA 2CW0C 3SEBA 3TN2A 1G6ZA 4CKEA 1BO0A 4KY6A 2NB0A 4ZLTF 2K05A 3Q22A 4NDXA 2M00A 1R4PB 2EYOA 2IT1A 2MP1A 3DM1A 1YNJC 2XWBB 3J81E 5KNCA 1ZXTA 1UEAB 3HOWB 2XWJB 4Y7NB 1AZPA 1JORA 3M85A 3K59A 1JWUD 1HFNA 5CGKA 4A3BB 3UI2A 3PV0A 4AYBB 4E6IA 4C3HG 2F0TA 2HCIA 2ID0A 4K8JA 1I3QB 2EPBA 1NUCA 4ABNA 5J1ZA 1BR9A 4XT3B 2O4XA 1K8MA 3TZDA 3MXUA 1M4VA 4QMGA 4DNTB 4IFDI 5KYLA 2E2JB 3F2UA 3DWAA 1RF2D 3T13A 3V2TA 5IOCA 2HDMA 1SNQA 4IUUA 2H1EA 4C3IB 2C9OA 1PDQA 1R4QB 3DXJC 2XRQD 1SYGA 2KOLA 4XQNA 2ZXOA 1JCKB 2B2YA 4RA8A 5ISRA 1BNZA 1NSNS 3D4RA 2KUMA 3SE0A 1GXDC 5D3DA 4XT1B 5BN4A 1GUSA 5C4JB 1SYDA 2AWNA 1PRTD 4X3UA 1G91A 5IT9E 4XQQA 4DN4M 2B63B 1CHPD 1KAAA 2K32A 5AFWA 1JWMD 4Q0FA 3NHHA 4A3MB 1S5FD 3HS0C 1SDFA 4CJ1B 3AB9A 1RTOA 2B2VC 1X3QA 2CW0D 2F4IA 3A56A 1OXTA 2WKDA 4KKUA 1UUPA 1IKMA 4KJNA 4I65A 4OIKA 2WKCA 4KY7A 1SNOA 1HUMA 5HGTA 1Q12A 1F9SA 1CA6A 1YNJD 3OIQA 1BUVT 1I4RA 1PZKD 3BYYB 3IL8A 3EFXD 4B08A 2K01A 1PTOF 3HRZC 4QUCA 2RA4A 1EIGA 4Q5VA 4KKTA 2IW3A 2L11A 4U673 1KNEA 1PFMA 2M9VA 5FO9B 1SXTA 4IUNA 5CBEE 1FNWA 4IN3A 1PTOH 1F2LA 1Q3LA 1E0BA 2F0LA 1X32A 1LTSD 1EZ6A 1F2ZA 3OPOA 1BBXC 4J6HA 1HHVA 1B50A 1KLUD 4FF2A 3WDNA 1HUNA 3Q6SA 1Q90A 1LT4D 1HCZA 5ELDA 4KTAA 3OW7A 3PIO3 2E75C 4Z9CB 2IL8A 2N55A 1DONA 2AQ3B 5CV4A 1EY4A 1PTOB 3NTIA 4DF7A 2KCNA 1WTQA 4F88A 1CA5A 1HXYD 1EIHA 1O80A 2EDGA 4ZK9B 3ONAB 2A68D 1SYCA 2WINB 2F0SA 1PRTF 1WTVA 3I73A 5EKKA 3D3RA 1HQMC 3TBIB 3PMFA 4KV6A 2NVYB 4J8QA 2F0FA 3A8IE 2IWHA 1XWEA 2SNSA 1G2TA 1DM0B 5JPNC 2QILA 5I2XA 5K36G 1YNNC 3SVMA 2EE1A 1IL8A 3C1EA 1S5DD 3D31A 4NW2A 5E4XA 1Y8NB 1V1PA 1F9QA 1CM9A 3MXGA 4RHRA 1V8QA 2AUKA 1MSGA 1Q1EA 4A93B 3DWPA 5F2DA 1ICWA 2FJ2A 1TWCB 1SJHD 4WJWA 4K6LA 1TY2A 2BDOA 4KN7C 1PLFA 1S4ZA 3GTQB 1PRTB 3FRPB 1SYFA 1MBYA 5EPKA 2A69D 4IZ8A 1H9RA 5A2QE 2B2UC 2RKSA 1U4LA 1WTRA 4IFDG 4QB4A 3VA7A 2KCCA 3G6JB 4NMZA 1A2UA 1EY7A 1D2BA 1G2SA 3Q0AA 3DUZA 5M3FB 1TWHB 1GJXA 2JA7B 2NUCA 5A35A 2KHSA 3QO2A 1EU4A 2R7ZB 1RODA 3WOEA 3BDLA 4PMWA 1NCVA 4RH6A 2CHBD 2O5JC 4X3KA 1PYWD 3VR5A 2A6ED 1KNAA 1U4PA 3RUZA 2AWOA 1ILQA 4HEDA 3HOUB 2TMPA 1IHZA 5FO7B 2RQXA 2L4NA 2QEJC 1WD1A 3D6CA 2PPBC 1QWYA 4M8AA 3U9OA 1HQRD 2B39A 1QOHA 3SHLA 4CJ2C 1GUOA 3AMUA 3X3MA 4OO1G 3PIP3 3S16B 2NN6H 1ENAA 4ME5A 1CZGA 1BQQT 3NXWA 1FR3A 1QJOA 1VMPA 3I8ZA 4WRDA 3SK8A 4KJOA 3PUVA 1YNND 3S2HB 4DK0A 2F0VA 4QF4A 4RGOS 1EYCA 4UAIA 1AN8A 4IUVA 1I4QA 2KVMA 3QG1A 3FPUB 3I4MB 2B8FA 4B9WA 3MTSA 5ELFA 3MXNA 3S1MB 4OL7A 4PV1C 5LHY1 4RHSA 1SSOA 1JICA 1TR5A 5DAUA 2F0JA 4MIUA 1KDAA 5K5PA 3GP7A 3P7JA 1C4QA 3K5OA 5C4ZA 2OEOA 3CHBD 1SMYC 1ESRA 3URYA 1TS4A 2K7VA 3H94A 1T5XD 2H4OA 5KEEA 3VR6A 2E76C 3MVVA 4XYOA 3NBIA 3WOFA 2PCFB 1F9RA 2F0MA 3QOLA 4H44C 1HFGA 1TIID 5D3IB 3K0YA 3NUCA 3MEHA 1W6JA 4ZYSA 3NTKA 2D2CC 2LS01 1G8ZD 1SE2A 4KD4A 2K6AA 4R9WA 2D62A 3D8GA 3S17B 1KABA 2B2TC 2KQ3A 4IUTA 2F1MA 4C3IG 3S9WA 3C3LA 5C4HA 4HCEA 3HOZB 2RDGA 1QE6A 4UDUC 1OXVA 3ND9A 1ZYRD 2PW5A 4G7OC 4FP5D 1D5XC 3SK4A 3R8BA 3VYSA 4EQOA 5CMDA 2R3ZA 3IFDA 4DNRB 3GTKB 1EQTA 3TP7A 4G57A 4BA1I 3FPPA 3FVQA 4IUPA 5CR3A 1HTPA 1PXUA 2K28A 2RSOA 4ZUJA 4ZKBB 1SNPA 1GHJA 1TQOA 4PMBA 1A2TA 1AW7A 4G7HC 2Q8RE 2I46A 5E1FA 1PTOD 4IQZA 3GD7A 1ET9A 4C2MB 2FHTA 2YYZA 2CVRA 2SNMA 4CKCA 3K6OA 4EVOA 1GUWA 2ZT9C 3DMUA 3A54A 2ZXPA 1STYA 2JEAI 1I4XA 3KBXA 3M3YB 3IFTA 4P2CB 2F0PA 3HEJA 4BY1B 4V0BA 1EY8A 2BOSA 4K5VA 1Z7TA 4DXGA 5I2YA 4TKOB 2WB1B 1O7ZA 1I4HA 2PYKA 2I07B 1F9PA 2O2LD 1Y8OB 1LTBD 1EY0A 2NN6I 4N9TA 3M7GA 1GUNA 1F77A 2JP1A 2FINB 2OT2A 4KMUC 1A3VA 4RCNA 1ENCA 3V05A 2E2HB 1WTWA 1EYAA 1QB5D 4FXDA 5IIFA 2IJ0A 5C3XA 2F0EA 2EYFA 2B2WC 2B8GA 3KK7A 5J22A 4HTHA 4CGYB 2L0CA 3J7AV 3M4OB 3BG3A 3M7NA 1X3PA 3S2DB 5D14A 2L12A 4X3SA 2LKVA 1JOOA 3J80L 2G9HD 3GTJB 2F0WA 4DK1A 5IGFA 2IX1A 1E2ZA 4DAYA 2L55A 2K5QA 5JAVA 5C5MA 4BS9A 1NAPA 2LMCB 3PUYA 5C0XI 1EFID 5JJZA 5LL6X 5IGCA 1SYEA 4MHEA 3ITPA 1TS2A 2SEBD 3MHBA 2C5CA 1PZJD 2DY7A 4HR7B 1D5ZC 2XRSD 5JPMC 1Q1BA 2OXPA 3JAML 3C2PA 1DCZA 3A8KE 2JSOA 5G3LD 3EA6A 3GTMB 4EQNA 2JE6I 3SK6A 3LWUA 3OIPA 3S1RB 3EVQA 4C1NI 1F2YA 3SK5A 2F0OA 1MSHA 1GHKA 1CHQD 1NR4A 1JOQA 2N88A 4PNYA 1T5EA 1A6XA 3Q24A 2WIIB 5IGGA 1Y8PB 4KK7A 3I72A 1O78A 3T53B 4K8IA 3VYTA 4HSVA 4A3FB 1LLRD 1G291 4HSPA 2TSSA 1MD2D 1GUGA 2F03A 1DYQA 2Y0SB 5EBCA 2NVQB 2A6HC 1EEFD 3TSSA 3EQLC 2DY8A 2B2VA 1PFBA 1SFOB 3S1NB 1LV9A 3KLSA 3NP8A 1DOKA 2WV6D 1SE4A 2Z8LA 4RWSC 4BWGB 5FK9C 5ELBA 3S1QB 2Z4HA 2MHVA 4RGTA 2NTSA 3GV6A 1RD9D 4JBWA 1OXSC 5JVG3 2DNEA 3BVMA 5IGEA 1H9JA 3MFGA 5FOBB 2DN8A 4LAAA 2XVSA 3CU7A 1AEXA 2A74C 1HPCA 2PMZB 3GO5A 1LTAD 1A15A 3TP5A 1RCVD 2E2IB 1TS3A 5ELEA 4IFDJ 5I6WA 2K5WA 3R93A 1WD0A 3W3AA 1D5MC 4K5XA 2PW7A 3MFYA 5BN3A 4DAPA 1VCIA 1L0YB 1LABA 2PZTA 4A3GB 1IYUA 5KNDA 5CBAE 4QCLA 4R8IA 4BBSB 2ENBA 3I70A 1D6EC 2JXMB 1S5BD 1BCPB 2KECA 1TT2A 4X3TA 4FXGC 1U9RA 4I7ZC 2WACA 1K8OA 2ICIA 5G3LF 2K33A 2EY5A 4C3JB 5KNBA 5EPJA 3RZDB 1KDBA 1V1OA 3DEOA 3MAQA 3D6WA 3K5NA 1ML0D 5EKIA 4A3DB 3RMHA 2R61A 1LACA 5CV9A 5M5XB 3LNNA 3LWEA 2QKIC 3NTHA 3QIAA 2F0NA 2E74C 2NN6G 3U9SA 2F3WA 4GZYC 1CZWA 3A55A 3MC0B 3GTOB 2FMCA 2A6HD 5CYUA 1HRJA 3CKIB 4K14A 2NWGA 1JWSD 4EQPA 3NE5B 1A3TA 3HG9A 2E2DC 3G7LA 1QG7A 3A7LA 3C1FA 2F0DA 5NUCA 5CORA 2F0IA 1K83B 1UAPA 4R8NA 3KUPA 2J4XA 5CV7A 1BF4A 4RFBA 5CC4A 5C5LA 4FYDA 2JEBI 4FNFA 1STNA 1ESFA 4KHZA 1TS5A 3PUXA 5M9OA 3P1HA 2EY1A 3I4LA 3E0JA 4H7BA 3P75A 2BE5C 3OOCA 1DZ1A 3CRLC 3T16A 1S5ED 4IALA 2Q8TA 1TWGB 1JB3A 3QJYA 3X3NA 2B2UA 1MI2A 5IODA 4ILWA 3VYUA 1FNVA 2PZWA 2FFKB 4L63B 2AQ1B 2M2LA 3GTLB 2EYHA 3SDZA 4FF1A 5ELCA 1VF5C 2VXWA 1EY5A 1DJRD 1KTKA 1I6HB 2PZUA 4N9PA 1QILA 3TP8A 3T4AC 1J8IA 2K03A 4QIWB 1TWAB 1V43A 4RKBA 1SYBA 2X69A 2NVXB 1KDCA 5IGDA 5C0XH 3RZOB 5M5YB 4FVMA 3GTGB 2XN9C 1EL0A 4S3SA 3GQBA 4PQXA 3K57A 1STEA 1BCPC 5T1GA 4WFN3 4FF3A 3MZ5A 1L0XB 2Z4IA 2EJFC 1ZEQX 2OF1A 1C8CA 2F0UA 4BY7B 1WTOA 4J1MA 2F0QA 3BS1A 3DHQA 3KLRA 5EGTA 5FLXL 4HAEA 2X6LA 2HUGA 1SNMA 2BCOA 3KLSX 1H9MA 3HGBA 1ILPA 2BE5D 1SE3A 1B3AA 3OMCA 5C44B 3NPPA 5I4DA 1W6KA 1B9MA 2IX3A 3I4NB 5DM73 2EYMA 3SR1A 2K04A 1TY0A 3GTPB 3OHXC 5JEAH 2R6GA 3FEWX 3PUWA 5JOBA 3ND8A 2QCPX 3OWEB 1CFMA 4LMQD 1FNUA 1EYDA 3H0GB 3A7AB 4RGNA 1QNUA 4CBVA 1CI3M 2B2TA 3K5MA 3J81L 1B4OA 2NTTA 1RDPD 2NZ1D 3QOJA 3W2DA 3I3CA 2JA8B 3H6MA 5C4XB 3DEPA 2B2YC 3VR4A 4CJ0B 1WCMB 1J9OA 3H91A 1Z6HA 4KKSA 4XTCS 4WORA 1I50B 1FGBD 1V1PB 2MGSA 5E4WC 1JE4A 4LK1C 2MPMA 1SMYD 3J7AF 4K2LA 2O5IC 4RKLA 1S5CD 5CV5A 1IYVA 4PMCA 3QB3A 1EY9A 3I91A 2HCCA 2XNAC 3K7AB 1XYIA 1BCPD 5M5WB 1Z47A 4OGQC 1RJTA 3H09A 1VMCA 5EPLA 5EBDA 5M3MB 2NBFA 2BA0A 5J39A 2EYLA 1UNSA 3IAYA 3NBHA 3S14B 2IPKD 5HURA 3T56B 1PZID 2NYZD 4L6TB 4LJZC 1H9SB 3RLFA 4C1NK 1XX8A 1C48A 3J80E 2L9HA 4FXKC 2V4DA 3NQTA 2JYOA 5DM63 1AP0A 2X6GA 2IX0A 1II3A 5IT9L 1LT6D 4V190 3S15B 1O7LA 1NR2A 1PMRA 4NKLA 5EJWA 4ZAIA 1H9KA 4DFAA 1A3UA 1I4GA 2A68C 2DNCA 4TRDA 3OMGA 5C6AA 5TSSA 4OIJA 4ZKCB 2BA1A 1D1IA 1RTNA 4FF4A 1DOMA 1SNCA 2J7ZA 4IURA 3L3OC 4QUFA 3GV3A 2B2WA 3T51B 3DWQA 1EEID 1RKNA 3JAME 3I90A 1VF7A 5T1IA 3P20A 1HTLD 1SEBD 4OO1I 1AFPA 3KF8A 2VNUD 1QCBD 1BXTA 4KN4C 1IKLA 1DOLA 4BA2I 4XYQA 1E2WA 3NQIA 1O7YA 4K6DA 3TMEA 2G9DA 1LTGD 1TKWB 1I6VC 1LTTD 1EOTA 4C3HB 3TP6A 4C3JG 2VUMB 2HDLA 4KHVA 5CV8A 4XXEA 3V96A 2ICEC 4CHTB 1Y1VB 3VR2A 4B9XA 4H0LC 3BVZA 2VB2X 3BYTB 4TQUS 2EYPA 2RDFA 5D65A 2A69C 1ZKOA 4TSSA 4EGVA 4F7XA 3A8JE 1STAA 3AU7A 5DNFA 5I9PA 2EJGC 5JVH3 5EQ0A 4A3IB 1WTXA 2F3VA 3K58A 3VYRA 3EJIA 2XSCA 4A3JB 3MA2B 1BCPF 1CTMA 2FMMA 3NK9A 3VR3A 4K2KA 1QNKA 4H13C 2EJMA 5IGBA 4L8JA 4YIJA 1STGA 5KYIA 1LO5D 1GUTA 3PUZA 2MUYA 2WAQB 2A6EC 4U68A 4MN3A 4HCSA 1IW7C 1CQFA 1GOZA 4DGZA 3H3VC 4F87A 1BOSA 1RHPA 4M1UB 4KD3A 1DXMA 2LY7A 4OHJA 2K1BA 3PO3B 2XIWA 2NVTB 2F0HA 4IUQA 1BDOA 4CKBA 2SDFA 4HMJA 3HOVB 4F8MA 2VB3X 4HN7A 1SNDA 1CT1D 1R9TB 1Q8IA 3C46A 2EOTA 4G7ZC 1TWFB 2BDNA 1EQVA 2EY6A 1F2MA 5I9OA 2PNRC 1HA6A 3HKZB 5E3FA 2JA5B 3ZYYX 5C0XJ 3EROA 2L5TA 2PO4A 4ULLA 2F0GA 3NSWA 4RCOA 1DD2A 1JR0D 2QDBA 4DU9A 2KJXA 2CQAA 3MWYW 5FO8B 1PFNA 5A2QL 3L7ZC 2EXZA 4A3KB 4DAVA 4ZUIA 3N52A 2F0KA 3R2IA 4NP5A 3TZUA 4XIGS 4G4KA 3HZXA 2Q8IB 2RSNA 2SOBA 5EKLA 5C3WA 3M4YA 4RAUC 1H9SA 1U4MA 2A5HA 4BBRB 4ID6A 3VA5A 4O42A 2R92B 3NWTA 4JK1C 4DXFA 5I6YA 5KRUA 4ZRZA 5C3EB 3SXHA 2MJ8A 3E5SA 1EZ8A 4ZQ3A 2QF7A 5C0XG 5K36H 5LL6S 1ZYRC 1AZQA 1STBA 4C56C 1IW7D 1OO9B 3R2TA 2AUJD 5JEAJ 3TDQA 2RBMA 1D1KA 3FKIB 2KA7A 1LTID 1XXGA 1XTCD 4K5WA 3LX0A 4RGMA 3R3OA 1OXUA 1B2TA 1M8AA 3OSOA 3FMCA 2JA6B 3QWNA 4XQJA 1WTPA 1SAPA 2HQEA 5DEHA 4IFDH 5BN5A 1U4RA 3HOXB 1PTOC 2D9UA 2K5DA 3MXPA 3PO2B 3BDOA 1EWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3L A;  2RVL A;  1F9Q A;  2KOL A;  3I3C A;  2N88 A;  1CM9 A;  1TVX A;  1E0B A;  1QE6 A;  1EL0 A;  4CJ2 C;  2JP1 A;  3N52 A;  4OIJ A;  2B2Y A;  4RA8 A;  1BNZ A;  1X32 A;  3DEP A;  2B2Y C;  2FIN B;  2KUM A;  4ZKC B;  5T1G A;  4CJ0 B;  1MSG A;  1RTN A;  4XT1 B;  1DOM A;  2J7Z A;  4IUR A;  3TN2 A;  1WTW A;  1BBX C;  1J9O A;  2RSN A;  1G6Z A;  1ICW A;  4QUF A;  4X3U A;  2FJ2 A;  3GV3 A;  2B2W A;  3H91 A;  1BO0 A;  4HCS A;  4MN3 A;  4RAU C;  4U68 A;  1B50 A;  2B2W C;  5CMD A;  2R3Z A;  1U4M A;  1C8C A;  3IFD A;  5CBA E;  1DZ1 A;  1HUN A;  3I90 A;  4HSV A;  4R8I A;  1VMP A;  3Q6S A;  3I8Z A;  4DN4 M;  5T1I A;  1EQT A;  1RHP A;  1WD0 A;  2Q8T A;  2MGS A;  5E4W C;  1WTO A;  1PLF A;  1S4Z A;  1B53 A;  4ZLT F;  2K05 A;  1JE4 A;  1X3P A;  2MPM A;  4O42 A;  2KEC A;  4XDX A;  4X3T A;  5AFW A;  2K1B A;  2L12 A;  4X3S A;  5D14 A;  4IUP A;  5EPK A;  2B2U A;  1MI2 A;  2IL8 A;  2N55 A;  1IKL A;  1DOL A;  2MP1 A;  2B2U C;  2NZ1 D;  1U4L A;  2XIW A;  3DM1 A;  1WTR A;  1DON A;  4HAE A;  2K28 A;  1O7Y A;  1ZXT A;  2MJ8 A;  4UAI A;  2RSO A;  1SDF A;  2X6L A;  4CJ1 B;  1G91 A;  4ZKB B;  3I91 A;  2DY8 A;  5EPJ A;  2B2V A;  2HCC A;  1RTO A;  4IUQ A;  2KVM A;  2HUG A;  4IUV A;  1PFB A;  2B2V C;  1WTQ A;  1XYI A;  1AZP A;  1X3Q A;  3DEO A;  3FPU B;  1EOT A;  2FFK B;  3D6W A;  1ML0 D;  1LV9 A;  1DOK A;  1RJT A;  1ILP A;  2M2L A;  5EKI A;  1AZQ A;  1G2S A;  2SDF A;  1CA5 A;  3MTS A;  1HFN A;  1VMC A;  2HDL A;  5EPL A;  3UI2 A;  1IKM A;  1WVL A;  4RWS C;  2Q8R E;  1EIH A;  1O80 A;  1B3A A;  4OIK A;  1NAP A;  2HCI A;  1SSO A;  1JIC A;  4ZK9 B;  3ONA B;  3LWE A;  2EPB A;  1HUM A;  2VXW A;  3QO2 A;  4NW2 A;  5JJZ A;  3HP3 A;  2FHT A;  2EOT A;  3P7J A;  1ROD A;  2BDN A;  2CVR A;  4XT3 B;  1WTV A;  1F9S A;  4MHE A;  2KED A;  3GV6 A;  2NYZ D;  5COY A;  3TZD A;  1ESR A;  1NCV A;  1CA6 A;  5D65 A;  1HRJ A;  1GUW A;  1HA6 A;  1XX8 A;  2K04 A;  4X3K A;  2DY7 A;  1J8I A;  3IL8 A;  2NWG A;  3F2U A;  2L9H A;  2K03 A;  2K01 A;  1B2T A;  1M8A A;  3FDT A;  5DNF A;  3KBX A;  2L1B A;  1F9R A;  1KNA A;  1U4P A;  4QUC A;  1HFG A;  2JYO A;  2KEE A;  2X69 A;  5EQ0 A;  1ILQ A;  2X6G A;  3G7L A;  1WTX A;  1AP0 A;  4HED A;  1QG7 A;  2RA4 A;  1SAP A;  4LMQ D;  1EIG A;  1WTP A;  1HHV A;  2HDM A;  1G2T A;  4IUU A;  5COR A;  1A15 A;  2L11 A;  2H1E A;  1NR2 A;  1U4R A;  1KNE A;  1PFM A;  3KUP A;  3MWY W;  5EJW A;  2FMM A;  4R9W A;  4ZAI A;  1O7Z A;  1BF4 A;  2D9U A;  2L4N A;  1PFN A;  2B2T A;  1PDQ A;  2EE1 A;  3SVM A;  1WD1 A;  1IL8 A;  1QNK A;  2B2T C;  5CBE E;  1MGS A;  1F9P A;  4IUT A;  1B4O A;  3R93 A;  1NR4 A;  5E4X A;  1MSH A;  1F2L A; 
#chains in the Genus database with same CATH topology
 1NJI C;  3N6R A;  1LTR D;  2WP8 J;  3ERQ A;  2LFN A;  2EVB A;  1I4P A;  1JQY D;  1FYC A;  4L5S A;  1MIU A;  3CRK C;  1VQ4 A;  1OXX K;  1LT5 D;  2A73 B;  4DNI A;  1V9P A;  1CK1 A;  3Q23 A;  4JI3 L;  3KFU A;  1FD7 D;  3TQY A;  1ET6 A;  5JEA G;  1E24 A;  3CCU A;  5CV6 A;  4K0K Q;  1YNX A;  3HFZ B;  3O13 A;  1B53 A;  4ODG A;  2R93 B;  4HMI A;  2D0P A;  4XDX A;  4DV1 Q;  1Y1W H;  3NWS A;  3BZD B;  4A3B G;  2HT1 A;  1ONL A;  3CQZ B;  1EY6 A;  4AYB G;  1B9N A;  4KI0 A;  1STH A;  5FKA C;  3IKJ A;  1VQN A;  1CQV A;  4LFC Q;  3L9A X;  3D4W A;  4O1N A;  2QA4 A;  2RDH A;  1TU2 B;  1JC7 A;  1Y69 U;  1KLG D;  4DA2 A;  2N78 A;  1HA5 A;  2YU9 H;  1WVL A;  2PQE A;  1SBB B;  4LF8 L;  2OWO A;  3EIV A;  1FVI A;  3KBG A;  3RD4 A;  5M3M G;  3HP3 A;  3K5L A;  1LT3 D;  3I4O A;  3J7Y W;  3UDF A;  2KED A;  4OO1 H;  3HOY H;  1VDZ A;  5COY A;  3OWF A;  1Y1W B;  3FHW A;  5KGU A;  5FLX E;  2J0T D;  4A3E B;  1B1Z A;  4LF4 L;  1Q46 A;  3FDT A;  3SGI A;  4JI7 L;  2Z1C A;  1EU3 A;  2L1B A;  4FO2 A;  1PRT C;  1ENF A;  3K8A A;  1E2V A;  2HIV A;  3BDC A;  1JOK A;  2KEE A;  4OWT B;  1E3P A;  4HJ7 A;  2EZV A;  2EY2 A;  1YEZ A;  2YU9 B;  3BVG A;  1SJE D;  2D5D A;  3D4D A;  2EYJ A;  4CDE C;  4C2M H;  3VDY A;  3UDX A;  2GA4 B;  4LF8 Q;  4CDD C;  4KY5 A;  1MGS A;  3L2P A;  4NXN L;  2AQ2 B;  2ZXR A;  3HOW H;  5IT9 c;  2RVL A;  1B44 D;  3E6Z X;  5KIX A;  4Y7N H;  1QZG A;  1E1T A;  1TVX A;  4P74 A;  3HOY B;  1EWH A;  2B63 G;  1FL0 A;  2CW0 C;  2YV5 A;  3SEB A;  3TN2 A;  1A62 A;  1G6Z A;  4CKE A;  1BO0 A;  1I3Q H;  4LF4 Q;  2F4V L;  4JI7 Q;  1Q8K A;  4KY6 A;  2PMZ E;  4JOI A;  2NB0 A;  4ZLT F;  1VS0 A;  3U58 A;  2K05 A;  2WAQ E;  3H3V H;  3Q22 A;  4NDX A;  2M00 A;  1R4P B;  2EYO A;  2LXK A;  3KYH C;  2IT1 A;  2MP1 A;  3DM1 A;  5J3B A;  2E2J H;  1YNJ C;  2XWB B;  3J81 E;  5KNC A;  1ZXT A;  1XNR L;  1UEA B;  3K81 C;  3HOW B;  2XWJ B;  4Y7N B;  1AZP A;  1JOR A;  3AFQ A;  4FDB A;  3M85 A;  3K59 A;  3RLO A;  1JWU D;  1HFN A;  5CGK A;  5IWA L;  4A3B B;  3UI2 A;  3PV0 A;  4C3I H;  4AYB B;  4E6I A;  4C3H G;  2F0T A;  3AFP A;  3CCV A;  1XMQ L;  4UY8 C;  2HCI A;  2ID0 A;  2VUM G;  1QVG A;  2P5Z X;  4K8J A;  1I3Q B;  4IPD A;  2EPB A;  1VQM A;  4QJF A;  1U5K A;  1NUC A;  4ABN A;  5J1Z A;  2HIX A;  3I55 A;  3S2D H;  1BR9 A;  1LM0 A;  4XT3 B;  2O4X A;  1K8M A;  3TZD A;  3MXU A;  1M4V A;  4QMG A;  5E7N A;  1PHJ A;  4A75 A;  4DNT B;  4IFD I;  1IZ6 A;  5KYL A;  2E2J B;  3F2U A;  3DWA A;  2Q2H A;  1RF2 D;  3T13 A;  1XNR Q;  1VQ8 A;  1E1O A;  1FJG L;  3V2T A;  2E8G A;  5IOC A;  2Q2U A;  2HDM A;  2D0O A;  1SNQ A;  4IUU A;  3PF4 A;  2H1E A;  5IWA Q;  4A3I G;  4C3I B;  2C9O A;  1YBY A;  4LF7 Q;  4Y52 H;  3K80 C;  4A3M H;  1PDQ A;  1R4Q B;  3DXJ C;  2XRQ D;  1SYG A;  3STB C;  2KOL A;  1HZC A;  4XQN A;  2ZXO A;  3CXC A;  1JCK B;  2B2Y A;  4RA8 A;  5ISR A;  1BNZ A;  1NSN S;  1PYS B;  2KUM A;  3D4R A;  3SE0 A;  1GXD C;  5D3D A;  4GNX A;  4XT1 B;  4L5R C;  5BN4 A;  1GUS A;  5C4J B;  1SYD A;  2AWN A;  1PRT D;  4R1J A;  4X3U A;  1G91 A;  5IT9 E;  2LSS A;  2IY5 B;  4XQQ A;  4DN4 M;  1XJV A;  3CCL A;  2B63 B;  1CHP D;  3TRE A;  1KAA A;  2K32 A;  4JPB W;  5AFW A;  1JWM D;  4Q0F A;  2RCN A;  2UUC L;  1C9O A;  3NHH A;  5HY6 A;  2VZA A;  4A3M B;  1S5F D;  3HS0 C;  1VQP A;  1SDF A;  2CH4 W;  4CJ1 B;  3AB9 A;  2L15 A;  1RTO A;  1C7Y A;  4LF9 Q;  2B2V C;  4PG3 A;  3RN2 A;  2K50 A;  1X3Q A;  1J5E L;  4KHP L;  2CW0 D;  4DR2 Q;  2F4I A;  4LFB L;  3A56 A;  1OXT A;  2WKD A;  4KKU A;  1UUP A;  1IKM A;  4KJN A;  4I65 A;  1KAW A;  4OIK A;  3CC2 A;  2WKC A;  4A3F H;  4KY7 A;  1SNO A;  1HUM A;  5HGT A;  1Q12 A;  3HOV G;  4R4O A;  1F9S A;  1PH8 A;  2NVQ H;  3M9B A;  1CA6 A;  1YNJ D;  3OIQ A;  1BUV T;  1I4R A;  1PZK D;  4CDC C;  3CD6 A;  3EN2 A;  3BYY B;  3IL8 A;  1NTG A;  3EFX D;  3ULL A;  4B08 A;  2K01 A;  1PTO F;  4H02 A;  3CCJ A;  3S1N H;  3HRZ C;  3HKZ G;  4QUC A;  2JA5 G;  4HJ5 A;  2RA4 A;  1EIG A;  5GAE C;  4KHP Q;  4Q5V A;  4KKT A;  4DPG A;  2IW3 A;  1RIP A;  2BH8 A;  2L11 A;  4U67 3;  1KNE A;  1PFM A;  2M9V A;  4A3L H;  5FO9 B;  1SXT A;  1VQA A;  3OW2 A;  4JI6 L;  4IUN A;  5CBE E;  1FGU A;  3MXN B;  1FNW A;  4IN3 A;  1PTO H;  3HKS A;  1F2L A;  1E22 A;  1Q3L A;  1E0B A;  2YTX A;  4UPA A;  2F0L A;  1K3R A;  3KJO A;  1X32 A;  2EXD A;  2I0Q A;  1LTS D;  1GD7 A;  1EZ6 A;  4A3K G;  1EIF A;  1F2Z A;  3OPO A;  1BBX C;  1N34 L;  1VQL A;  1UEB A;  4J6H A;  1HHV A;  1B50 A;  1KLU D;  4FF2 A;  4YWK A;  3WDN A;  1HUN A;  3Q6S A;  1Q90 A;  1LT4 D;  1HCZ A;  5ELD A;  4KTA A;  3OW7 A;  3PIO 3;  2PQA B;  2E75 C;  4Z9C B;  1O7I A;  5M3F G;  5IP9 G;  2IL8 A;  2N55 A;  1DON A;  4JI6 Q;  2NVY H;  2AQ3 B;  5CV4 A;  3STB D;  4QL5 A;  1EY4 A;  2Z6K A;  2JA7 G;  1IBL Q;  1PTO B;  3NTI A;  4DF7 A;  1BKB A;  2KCN A;  1WTQ A;  4F88 A;  5C3E G;  1YVC A;  1CA5 A;  1NY4 A;  1HXY D;  5IYD G;  4JYA L;  3CME A;  1EIH A;  1O80 A;  2EDG A;  4JI8 L;  5JJL A;  2ZM6 L;  4ZK9 B;  1N34 Q;  3ONA B;  4JI5 Q;  2A68 D;  1SYC A;  2WIN B;  2F0S A;  1PRT F;  1WTV A;  3I73 A;  1AE2 A;  1YHQ A;  5EKK A;  3HOU G;  3D3R A;  2AMC B;  1HQM C;  3TBI B;  3FKI G;  3PMF A;  4KV6 A;  4A93 H;  1IL2 A;  4DK3 C;  4DK6 C;  3RZD H;  2NVY B;  1IBK L;  2UUB L;  3A74 A;  4J8Q A;  1YZ6 A;  3E9I A;  3NEN A;  4X64 L;  2F0F A;  3A8I E;  2IWH A;  1XWE A;  2SNS A;  2IHF A;  2JA6 G;  1DM0 B;  1EQQ A;  1G2T A;  1SLJ A;  5JPN C;  4DR1 L;  2H5X A;  3GTQ H;  4X6A H;  5M5X H;  2QIL A;  5I2X A;  4DR7 L;  3RR5 A;  5K36 G;  1YNN C;  3SVM A;  2EE1 A;  4JI8 Q;  1IL8 A;  1QUQ A;  3C1E A;  1S5D D;  3D31 A;  3HOX G;  4NW2 A;  5E4X A;  1Y8N B;  1V1P A;  1F9Q A;  5EAY A;  1CM9 A;  3MXG A;  4RHR A;  2ES2 A;  1V8Q A;  2AUK A;  1MSG A;  4LUV A;  1TWH H;  5M3F H;  4LF6 Q;  1Q1E A;  4A93 B;  3DWP A;  2XGT A;  2JA7 H;  5F2D A;  1ICW A;  1JJG A;  2FJ2 A;  1TWC B;  4DV0 L;  1IBK Q;  1SJH D;  4WJW A;  2UUB Q;  3CCQ A;  1P8L A;  2R7Z H;  5H1S E;  4K6L A;  2ALY B;  2YTY A;  4X64 Q;  3W1G A;  1MKH A;  1TY2 A;  4P72 A;  2BDO A;  4KN7 C;  1PLF A;  1S4Z A;  3I4M G;  3GTQ B;  4HJ8 A;  1PRT B;  3FRP B;  1SYF A;  1MBY A;  1UE7 A;  2F52 A;  5EPK A;  2A69 D;  4DR7 Q;  4IZ8 A;  4LF5 L;  1H9R A;  5A2Q E;  2B2U C;  2RKS A;  1U4L A;  1WTR A;  4IFD G;  4A3C H;  2R93 G;  1K73 C;  4QB4 A;  3VA7 A;  2KCC A;  4R4C A;  4J15 A;  3G6J B;  2Z6B A;  4NMZ A;  1VQB A;  1A2U A;  1EY7 A;  1D2B A;  3HOU H;  1G2S A;  2UXB Q;  3Q0A A;  2UXD L;  3DUZ A;  5M3F B;  1TWH B;  1EIY B;  1GJX A;  2N8N A;  4JG2 A;  2JA7 B;  4HJA A;  2NUC A;  5A35 A;  2KHS A;  2PI2 A;  3ER0 A;  3JC6 6;  3QO2 A;  4DV0 Q;  1JE5 A;  1EU4 A;  2R7Z B;  1TWG H;  1ROD A;  1W3S A;  3WOE A;  1LTL A;  1X65 A;  4GLX A;  3BDL A;  4AYB E;  4PMW A;  1NCV A;  4RH6 A;  2CHB D;  2O5J C;  4X3K A;  4LF5 Q;  3S16 H;  1PYW D;  3E0E A;  1Y1W G;  3VR5 A;  5JJI A;  2A6E D;  1SN8 A;  1KNA A;  1U4P A;  4GN4 B;  3RUZ A;  3GTL H;  2AWO A;  4IJL A;  3TS0 A;  1ILQ A;  4HED A;  4GOP B;  2UXB L;  3HOU B;  1KQS A;  2TMP A;  1IHZ A;  5FO7 B;  2KHI A;  2UXD Q;  2RQX A;  2L4N A;  2QEJ C;  3B6Y A;  1WD1 A;  5GQO A;  4DAY B;  3D6C A;  2PPB C;  1VQF A;  1QWY A;  4M8A A;  3U9O A;  1HQR D;  2B39 A;  1QOH A;  3SHL A;  4CJ2 C;  1GUO A;  1VQE A;  3AMU A;  2DJG C;  2JK8 A;  1ASZ A;  3X3M A;  4OO1 G;  3HOY G;  3PIP 3;  3S16 B;  2QDL A;  2NN6 H;  1ENA A;  4ME5 A;  1CZG A;  4ME3 A;  1BQQ T;  2PI2 E;  3NXW A;  1FR3 A;  2VQE Q;  1QJO A;  4DUZ L;  4L5T A;  1VMP A;  3I8Z A;  1XPO A;  4WRD A;  3SK8 A;  3ICE A;  4KJO A;  3PUV A;  1NBW A;  4LFC L;  1YNN D;  3S2H B;  4DK0 A;  1X3G A;  2F0V A;  4QF4 A;  4RGO S;  1EYC A;  4UAI A;  1YHB A;  1AN8 A;  4RMF A;  4IUV A;  1I4Q A;  2KVM A;  3J81 c;  3QG1 A;  3FPU B;  4B3S L;  3I4M B;  2F3I A;  2B8F A;  4B9W A;  3MTS A;  3HOW G;  5ELF A;  4HIO A;  3MXN A;  1KXL A;  3S1M B;  4OL7 A;  4PV1 C;  1CKO A;  5LHY 1;  4RHS A;  1ICF B;  1SSO A;  3S17 H;  1JIC A;  1TR5 A;  5DAU A;  2F0J A;  4MIU A;  1KDA A;  5K5P A;  3GP7 A;  3P7J A;  4DUY L;  1PH7 A;  4DUZ Q;  1C4Q A;  3HOZ H;  3K5O A;  4GKK Q;  5C4Z A;  2OEO A;  3CHB D;  1SMY C;  1ESR A;  3URY A;  1ASY A;  1TS4 A;  2K7V A;  3H94 A;  4MTK A;  1T5X D;  2H4O A;  5KEE A;  3PIO A;  3VR6 A;  2E76 C;  2WB1 G;  1GVP A;  3MVV A;  4XYO A;  3NBI A;  3WOF A;  2OQ0 A;  4EQ5 A;  1L0W A;  2PCF B;  3BU2 A;  1F9R A;  2F0M A;  3QOL A;  4L5Q A;  4H44 C;  1HFG A;  1TII D;  3F8T A;  5D3I B;  3K0Y A;  3NUC A;  3MEH A;  4OXP A;  3GTK H;  1W6J A;  4ZYS A;  3NTK A;  3QR8 A;  1SRU A;  4B3S Q;  2D2C C;  4X62 Q;  2LS0 1;  1G8Z D;  1SE2 A;  4KD4 A;  2K6A A;  4R9W A;  2D62 A;  1K3B C;  3D8G A;  3S17 B;  4WJ3 M;  1KAB A;  1WYD A;  2B2T C;  2KQ3 A;  4IUT A;  3CC7 A;  2F1M A;  4C3I G;  3S9W A;  3C3L A;  5C4H A;  4HCE A;  2ZJP A;  3HOZ B;  4DUY Q;  2RDG A;  1QE6 A;  1JJC B;  4UDU C;  1OXV A;  3ND9 A;  1ZYR D;  2PW5 A;  3E9H A;  4R4T A;  4DV3 L;  4G7O C;  2K5N A;  4FP5 D;  2Z0S A;  1D5X C;  3SK4 A;  3R8B A;  3VYS A;  4EQO A;  1K9M C;  5CMD A;  2R3Z A;  3IFD A;  4DNR B;  4DR6 L;  3GTK B;  1EQT A;  2CWP A;  3TP7 A;  4G57 A;  4BA1 I;  3FPP A;  3FVQ A;  4PZ8 A;  4IUP A;  5CR3 A;  3CPW A;  1HTP A;  1PXU A;  3M4P A;  3PQI A;  2K28 A;  3J80 i;  2RSO A;  4ZUJ A;  1PYB A;  3I56 A;  1UE1 A;  1K0R A;  1X55 A;  4ZKB B;  5C4X H;  3M3Y H;  1PVO A;  1SNP A;  1GHJ A;  1TQO A;  1Y14 B;  4DR3 L;  4A3M G;  4PMB A;  1A2T A;  3F1Z A;  4AQY L;  1AW7 A;  4BY1 H;  2VS1 A;  1BBW A;  1WCM H;  3I2Z A;  1G6P A;  4G7H C;  4DV3 Q;  2Q8R E;  2UXC L;  3KDF B;  2I46 A;  5E1F A;  1PTO D;  4IQZ A;  4YWL A;  3GD7 A;  1ET9 A;  1X3F A;  4C2M B;  5IE8 A;  4DV5 L;  2FHT A;  2YYZ A;  3G71 A;  1N32 Q;  2CVR A;  2SNM A;  4GOP C;  4DR6 Q;  2ZTE A;  4CKC A;  3K6O A;  1OTC A;  4EVO A;  1GUW A;  2ZT9 C;  2E2H H;  3DMU A;  3A54 A;  1LYL A;  2ZXP A;  1STY A;  2JEA I;  1I4X A;  3KBX A;  1HR0 L;  3IFT A;  4LF7 L;  3M3Y B;  1M90 C;  4P2C B;  1K0S A;  2F0P A;  3JAM i;  3NEM A;  3HEJ A;  4DR3 Q;  4BY1 B;  4V0B A;  4AQY Q;  1EY8 A;  2BOS A;  3M4O H;  4IOC A;  4K5V A;  4N8X 1;  3LGJ A;  1CKN A;  1Z7T A;  4DXG A;  1GM5 A;  5I2Y A;  4TKO B;  2WB1 B;  4GKJ L;  2UXC Q;  1O7Z A;  1I4H A;  2PYK A;  1X3E A;  2I07 B;  4JBJ A;  1RL2 A;  2I5H A;  1F9P A;  3TRZ A;  2O2L D;  1Y8O B;  3GTJ H;  4DV5 Q;  1LTB D;  1EY0 A;  2NN6 I;  4A3F G;  4N9T A;  3M7G A;  1GUN A;  1F77 A;  1SE8 A;  2JP1 A;  4MNO A;  2FIN B;  2OT2 A;  4KMU C;  1A3V A;  1E7Z A;  3HKZ E;  4RCN A;  1ENC A;  3V05 A;  2E2H B;  1N8R C;  3UE0 A;  1WTW A;  1EYA A;  1VQI A;  2Y0S G;  1QB5 D;  4FXD A;  5IIF A;  2IJ0 A;  5C3X A;  1EQR A;  2EYF A;  2B2W C;  2F0E A;  2B8G A;  1HR0 Q;  3KK7 A;  5J22 A;  4HTH A;  1VQ7 A;  4CGY B;  2L0C A;  3J7A V;  4IOA A;  2Q2T A;  3BG3 A;  4LF9 L;  3M4O B;  3M7N A;  1X3P A;  1B3Q A;  4DR4 Q;  3S2D B;  5D14 A;  2L12 A;  4X3S A;  4DR2 L;  2LKV A;  4GKJ Q;  1JOO A;  1EWI A;  3J80 L;  2G9H D;  1W2B A;  4A3L G;  3GTJ B;  5GRO A;  2F0W A;  4DK1 A;  5IGF A;  1Z9F A;  2IX1 A;  1HZA A;  3ULP A;  1Q86 C;  1E2Z A;  4DAY A;  2L55 A;  2K5Q A;  5JAV A;  5C5M A;  4P75 A;  4BS9 A;  3GTM H;  1NAP A;  3S1R H;  4PZ6 A;  2LMC B;  1MHW C;  3PUY A;  5FJ8 H;  5C0X I;  1EFI D;  5JJZ A;  2K4K A;  5LL6 X;  5IGC A;  4LUO A;  1NNX A;  4NXM L;  3CW2 C;  1SYE A;  4MHE A;  3ITP A;  1TS2 A;  4ALP A;  2SEB D;  3MHB A;  2C5C A;  2XTI A;  1PZJ D;  1TXY A;  1B8A A;  3DLL A;  1HH2 P;  2KCM A;  4UP8 A;  2CCZ A;  2DY7 A;  2MFI A;  4HR7 B;  1D5Z C;  2XRS D;  5JPM C;  1Q1B A;  1KC8 C;  2OXP A;  1YJW A;  3JAM L;  3C2P A;  3ERS X;  1DCZ A;  3A8K E;  2JSO A;  3E3X A;  5G3L D;  4QY7 A;  4OX9 L;  3EA6 A;  1VQG A;  3GTM B;  4EQN A;  2JE6 I;  3SK6 A;  3LWU A;  3OIP A;  3S1R B;  3EVQ A;  4C1N I;  1F2Y A;  5ELO A;  2F0O A;  3SK5 A;  1MSH A;  1GHK A;  1CHQ D;  1NR4 A;  2EQS A;  1JOQ A;  1X6O A;  4BBS G;  2N88 A;  1SFO H;  4NXM Q;  1J6Q A;  4PNY A;  3U50 C;  1T5E A;  1A6X A;  3Q24 A;  2WII B;  4LUZ A;  5IGG A;  5IY0 A;  1Y8P B;  4KK7 A;  3I72 A;  3T1H L;  2I5L X;  1O78 A;  3T53 B;  4K8I A;  3VYT A;  4OWW B;  4A93 G;  4HSV A;  1C0A A;  1XPR A;  4A3F B;  1LLR D;  1IBL L;  3S1Q H;  4HJ9 A;  1G29 1;  4HSP A;  2TSS A;  1QVF A;  2KCT A;  4OX9 Q;  1N36 Q;  1MD2 D;  2VY3 A;  1GUG A;  2F03 A;  2K52 A;  1DYQ A;  2Y0S B;  5EBC A;  2AHO B;  2NVQ B;  2A6H C;  4UHV A;  1EEF D;  2A1A A;  3TSS A;  2OTJ A;  2R7D A;  3EQL C;  1P16 A;  2DY8 A;  3A5U A;  2B2V A;  4JI5 L;  1PFB A;  1SFO B;  3S1N B;  1X54 A;  1LV9 A;  3KLS A;  3NP8 A;  1DOK A;  2WV6 D;  1SE4 A;  1I94 L;  2Z8L A;  5GAG C;  3A5Z B;  4RWS C;  2E2I H;  3CC4 A;  4BWG B;  5FK9 C;  3W1B A;  5ELB A;  1CUK A;  1L1O C;  4UP9 A;  3T1H Q;  3W5O A;  3S1Q B;  2Z4H A;  2MHV A;  4RGT A;  2NTS A;  3GV6 A;  1RD9 D;  4JBW A;  3U4V A;  1PV4 A;  5IP7 H;  1OXS C;  5JVG 3;  2DNE A;  2R7Z G;  4DR5 L;  3BVM A;  4LFA L;  1U0L A;  5IGE A;  1PH6 A;  1H9J A;  3MFG A;  5FOB B;  2DN8 A;  4LAA A;  1MJE A;  4A3G H;  2XVS A;  3CU7 A;  1AEX A;  2A74 C;  4BBS H;  4A3C G;  1HNW L;  3RN5 A;  5LMN L;  1HJP A;  1HPC A;  2PMZ B;  2R7F A;  3GO5 A;  1LTA D;  1A15 A;  3TP5 A;  1I94 Q;  1RCV D;  2E2I B;  1TS3 A;  5ELE A;  2QGQ A;  4LF6 L;  4IFD J;  5I6W A;  1TWF H;  2K5W A;  4GN3 B;  4R4I A;  4C3J H;  3R93 A;  1WD0 A;  3W3A A;  1D5M C;  4K5X A;  2PW7 A;  3KDF A;  2JN4 A;  4X65 Q;  5BR8 Q;  4A3D H;  3MFY A;  3F2C A;  5BN3 A;  4DR5 Q;  1EOV A;  4LFA Q;  1JT8 A;  2RF4 A;  4DAP A;  1VCI A;  1L0Y B;  1LAB A;  2PZT A;  4A3G B;  1IYU A;  5KND A;  5CBA E;  4QCL A;  1WTH A;  3EBE A;  4R8I A;  4BBS B;  2ENB A;  3I70 A;  1HNW Q;  3TEH B;  5HGQ A;  1D6E C;  5LMN Q;  1VQJ A;  2JXM B;  1S5B D;  1BCP B;  2KEC A;  1TT2 A;  3G48 A;  4X3T A;  2K14 A;  2HD3 A;  4FXG C;  1U9R A;  4MTN A;  1Q7Y C;  3GTO H;  1UE6 A;  3K0X A;  4I7Z C;  2WAC A;  2HHH Q;  1K8O A;  2A19 A;  2ICI A;  5G3L F;  2K33 A;  2EY5 A;  4C3J B;  5KNB A;  5EPJ A;  3RZD B;  1KDB A;  1SRO A;  1V1O A;  1GKH A;  1K8G A;  3DEO A;  3MAQ A;  3D6W A;  3K5N A;  1ML0 D;  3K7U C;  2KHJ A;  5EKI A;  4A3D B;  1HZB A;  3RMH A;  2R61 A;  1LAC A;  2ZTD A;  1LUZ A;  1K83 H;  4OWX B;  4JI2 Q;  3F2D A;  1CSQ A;  4LW1 A;  5CV9 A;  3CCM A;  5M5X B;  3LNN A;  4BBR H;  3LWE A;  1GO3 E;  2QKI C;  3NTH A;  2KEN A;  3QIA A;  2F0N A;  2R92 H;  2E74 C;  2NN6 G;  3U9S A;  2F3W A;  4GS3 A;  4GZY C;  1CZW A;  3A55 A;  3MC0 B;  3GTO B;  2FMC A;  2A6H D;  1S72 A;  5CYU A;  1HRJ A;  3CKI B;  2BH2 A;  5FLM H;  3BZC A;  4K14 A;  2NWG A;  1JWS D;  4EQP A;  3NE5 B;  5IYC H;  1PFS A;  1A3T A;  4JV5 L;  2HQL A;  3HG9 A;  2E2D C;  3G7L A;  1QG7 A;  3A7L A;  3C1F A;  3F2B A;  3RNU A;  2F0D A;  5NUC A;  1NMF A;  5COR A;  2F0I A;  1K83 B;  1UAP A;  4R8N A;  1WOC A;  4QGU A;  3KUP A;  2J4X A;  3J7Z C;  5CV7 A;  4DV4 Q;  1BF4 A;  4JBM A;  1K8A C;  4RFB A;  2GVB A;  5CC4 A;  5C5L A;  4DAM A;  4FYD A;  2JEB I;  4FNF A;  2VL6 A;  1STN A;  1AH9 A;  1ESF A;  4KHZ A;  4DV7 L;  1TS5 A;  3PUX A;  5M9O A;  3P1H A;  2WB1 E;  2VQE L;  2OTL A;  2EY1 A;  3I4L A;  3CAM A;  3E0J A;  4H7B A;  3P75 A;  3HOZ G;  3NBH B;  4IPC A;  4JI1 L;  2BE5 C;  4MZ9 A;  1HNZ L;  2GVA A;  3OOC A;  1DZ1 A;  3CRL C;  4B3M Q;  3T16 A;  1S5E D;  4JV5 Q;  1N9W A;  4IAL A;  1SMX A;  2Q8T A;  1BBU A;  1I6H H;  1TWG B;  1JB3 A;  3CCS A;  3QJY A;  3X3N A;  2B2U A;  1MI2 A;  1M1K C;  5IOD A;  1TWA H;  4ILW A;  3VYU A;  1VQ9 A;  2K75 A;  3ULJ A;  3MEF A;  1FNV A;  4NPS A;  2PZW A;  2FFK B;  4DV7 Q;  2NVX H;  4L63 B;  1D7Q A;  2AQ1 B;  2M2L A;  3GTL B;  1PH2 A;  2EYH A;  4GKK L;  3SDZ A;  4FF1 A;  5ELC A;  4IJH A;  4IO9 A;  1VF5 C;  4JI1 Q;  3RZO H;  2VXW A;  1HNZ Q;  1EY5 A;  5M5Y H;  3GTG H;  1DJR D;  4O2D A;  1KTK A;  4JI0 L;  1I6H B;  2PZU A;  4N9P A;  1QIL A;  3TP8 A;  5L37 A;  4RG1 A;  1A8V A;  3T4A C;  4X62 L;  2MO1 A;  1J8I A;  3KLW A;  2EIF A;  2K03 A;  4GLA C;  4QIW B;  1TWA B;  1V43 A;  3KF8 B;  4RKB A;  3T1Y L;  1S40 A;  1SYB A;  2X69 A;  4BY7 H;  2JA8 G;  2NVX B;  1KDC A;  5C4X G;  5IGD A;  2NZO A;  1VQ5 A;  4ZCK A;  3DM3 A;  5IYB G;  4BXX H;  1G51 A;  4BY1 G;  5C0X H;  1WCM G;  3RZO B;  3J81 i;  5M5Y B;  4FVM A;  3GTG B;  2DJF C;  2XN9 C;  1EL0 A;  4S3S A;  2PQA A;  4JI0 Q;  3GQB A;  3IRB A;  4PQX A;  5AJ3 L;  1STE A;  3K57 A;  1BCP C;  1BVS A;  4GN5 A;  5T1G A;  4A3E H;  1B70 B;  4WFN 3;  4FF3 A;  1VQD A;  3MZ5 A;  3J7A 5;  1L0X B;  2Z4I A;  5C44 H;  2EJF C;  1ZEQ X;  2OF1 A;  4NB3 A;  1C8C A;  2QW7 A;  3PSI A;  2F0U A;  3T1Y Q;  4BY7 B;  1WTO A;  4JOI C;  3I4N H;  4J1M A;  2F0Q A;  3BS1 A;  1JMC A;  3DHQ A;  4JI3 Q;  3KLR A;  3GTP H;  1H95 A;  5EGT A;  5FLX L;  4HAE A;  4JBK A;  2X6L A;  4B3T L;  1VQO A;  5JJK A;  2HUG A;  1XPU A;  1SNM A;  2BCO A;  2WFW A;  3KLS X;  4DKA C;  1H9M A;  2Y0S E;  3HGB A;  1ILP A;  1N32 L;  2BE5 D;  5AJ3 Q;  4HIK A;  1PA6 A;  1SE3 A;  3H0G H;  2A8V A;  4P73 A;  1B3A A;  1CSP A;  3OMC A;  3J80 c;  5C44 B;  3NPP A;  5I4D A;  1W6K A;  1EYG A;  1IXR A;  1B9M A;  2JA8 H;  3U4Z A;  2IX3 A;  4HIM A;  4QQB X;  2I5M X;  2OQK A;  1YHA A;  3I4N B;  5DM7 3;  2EYM A;  1L2F A;  3SR1 A;  5IYB H;  2K04 A;  1TY0 A;  2AKW B;  2RCF A;  3OHX C;  5JEA H;  3GTP B;  2R6G A;  3FEW X;  2UU9 L;  3PUW A;  3KF6 B;  4B3T Q;  5JOB A;  3ND8 A;  2QCP X;  3OWE B;  1CFM A;  4LNQ A;  1I50 H;  4A3B H;  4LMQ D;  2VQF L;  1FNU A;  1EYD A;  2ASB A;  1YIJ A;  1XTD A;  3H0G B;  3A7A B;  4RGN A;  3BZK A;  3OYY A;  4LWC A;  1QNU A;  1HR0 W;  1WI5 A;  1CI3 M;  4CBV A;  2B2T A;  3K5M A;  3GDE A;  3J81 L;  1SR3 A;  1D8L A;  1B4O A;  2NTT A;  1RDP D;  3JAM c;  2NZ1 D;  3QOJ A;  4OEL B;  3W2D A;  3I3C A;  3K7A H;  2JA8 B;  3H6M A;  5FJ8 G;  3CCE A;  1KRT A;  5M5W H;  5C4X B;  1L1O B;  3DEP A;  2B2Y C;  3VR4 A;  4CJ0 B;  5M3M H;  4GNX C;  4DR4 L;  4NXN Q;  1WCM B;  1J9O A;  3BJU A;  3H91 A;  2UU9 Q;  1QUQ B;  1Z6H A;  4KKS A;  4XTC S;  1IYJ B;  2CKZ B;  4WOR A;  3AEV A;  1I50 B;  1FGB D;  3S14 H;  1V1P B;  2MGS A;  5E4W C;  2VQF Q;  4A76 A;  2GN5 A;  1JE4 A;  4LK1 C;  2MPM A;  1YIT A;  1SMY D;  3J7A F;  4K2L A;  4DV6 L;  2O5I C;  5LMU L;  2FXQ A;  4RKL A;  4POG A;  2F4V Q;  1S5C D;  5CV5 A;  2E5L L;  1IYV A;  2MO0 A;  4JW0 A;  4PMC A;  1X9N A;  3QB3 A;  1EY9 A;  1Y1V G;  3I91 A;  4AIM A;  1WFQ A;  2HCC A;  2XNA C;  3K7A B;  1XYI A;  2ZJQ A;  1BCP D;  3Q8D A;  5M5W B;  1Z47 A;  3KJP A;  3TS2 A;  4OGQ C;  1QVC A;  1RJT A;  3S15 H;  3H09 A;  1VMC A;  5EPL A;  5EBD A;  5M3M B;  5C4J H;  3AQQ A;  2UUA L;  2CFM A;  2NBF A;  2BA0 A;  4O0A A;  4X66 L;  5J39 A;  2B63 H;  1Q81 C;  2EYL A;  1HZ9 A;  1UNS A;  3IAY A;  4GOP A;  3NBH A;  3S14 B;  2IPK D;  5HUR A;  1EFW A;  3T56 B;  1PZI D;  2NYZ D;  4L6T B;  2K5V A;  4LJZ C;  1H9S B;  1KHI A;  1XMQ Q;  4A3J G;  3RLF A;  4C1N K;  1XX8 A;  4PZ7 A;  1KRS A;  4DV6 Q;  3PGZ A;  5LMU Q;  1HNX L;  1C48 A;  1AE3 A;  2ATW A;  2V1C C;  3J80 E;  2CH4 A;  2L9H A;  4FXK C;  2V4D A;  2E5L Q;  3NQT A;  4OON A;  1KL9 A;  4JCV E;  3ZJY C;  2JYO A;  5DM6 3;  1AP0 A;  2X6G A;  2IX0 A;  1II3 A;  5IT9 L;  3PIP A;  2ZJR A;  1LT6 D;  2K5H A;  4V19 0;  3S15 B;  1O7L A;  1IBM L;  3CCR A;  1NR2 A;  1PMR A;  4NKL A;  5EJW A;  4ZAI A;  2UUA Q;  2YTV A;  1H9K A;  2Q2I A;  4DFA A;  1XNQ L;  2WAQ G;  1A3U A;  1FJG Q;  1I4G A;  2A68 C;  4X66 Q;  2DNC A;  4TRD A;  3OMG A;  5C6A A;  5TSS A;  4C3H H;  3H15 A;  2JQO A;  4OIJ A;  2VUM H;  4ZKC B;  2BA1 A;  1D1I A;  1RTN A;  4N8F A;  4FF4 A;  1DOM A;  4AH6 A;  1SNC A;  2J7Z A;  4IUR A;  4YHH L;  3PO3 G;  3M4Q A;  5IP7 G;  1N36 L;  3L3O C;  1EUJ A;  1HNX Q;  4QUF A;  3GV3 A;  2B2W A;  3T51 B;  3DWQ A;  1Y1V H;  2KBN A;  4A4I A;  1EEI D;  1RKN A;  3JAM E;  3I90 A;  3PCO B;  2MNA A;  1N33 L;  1VF7 A;  5T1I A;  3P20 A;  1HTL D;  1SEB D;  4OO1 I;  1AFP A;  3AYH B;  4A3G G;  2JJQ A;  3KF8 A;  2VNU D;  1QCB D;  1IBM Q;  1BXT A;  4KN4 C;  4EX5 A;  5GAD C;  1IKL A;  1DOL A;  4BA2 I;  4XYQ A;  1E2W A;  1V1Q A;  2JA9 A;  3NQI A;  1XNQ Q;  1O7Y A;  4K6D A;  3TME A;  3KOJ A;  2Z6K C;  1Q82 C;  2G9D A;  1LTG D;  4POF A;  1TKW B;  1I6V C;  1K28 A;  1LTT D;  3G6E A;  4A3I H;  1NMG A;  1EOT A;  4C3H B;  3TP6 A;  4C3J G;  2UUC Q;  2VUM B;  2RHS B;  2HDL A;  4A3J H;  2RHQ B;  4KHV A;  5CV8 A;  2OCE A;  4XXE A;  3V96 A;  4YHH Q;  2ICE C;  4A3D G;  4CHT B;  1JJ2 A;  3S24 A;  1Y1V B;  1J5E Q;  3CPF A;  3VR2 A;  4B9X A;  4LFB Q;  4H0L C;  3NEL A;  1N33 Q;  3BVZ A;  1JB7 A;  2VB2 X;  3BYT B;  4TQU S;  2EYP A;  2RDF A;  5D65 A;  2A69 C;  1ZKO A;  4TSS A;  1QZH A;  1YI2 A;  4EGV A;  4F7X A;  4YWM A;  3A8J E;  1WJJ A;  3WWV A;  1STA A;  2PNH A;  4YCW A;  3AU7 A;  5DNF A;  5I9P A;  1X56 A;  2EJG C;  4OEM B;  5JVH 3;  5EQ0 A;  3UDI A;  4A3I B;  1WTX A;  2F3V A;  4YCU A;  3K58 A;  3VYR A;  4R4Q A;  1UWV A;  3EJI A;  2XSC A;  4A3J B;  1PH5 A;  3H3V I;  4QIW E;  3MA2 B;  2MQH A;  4B3R L;  1BCP F;  2NZH A;  4X65 L;  1CTM A;  2DGY A;  5BR8 L;  2FMM A;  3NK9 A;  3PO3 H;  3VR3 A;  4K2K A;  1QNK A;  3L0O A;  1NE3 A;  4YCV A;  5LMN W;  2NVT H;  4JC0 A;  4H13 C;  2EJM A;  3FP9 A;  2B3G A;  4BBR G;  5IGB A;  4L8J A;  4YIJ A;  1A63 A;  1STG A;  5DLQ E;  2R92 G;  5KYI A;  2CWA A;  1LO5 D;  1GUT A;  3HOV H;  3PUZ A;  2MUY A;  2WAQ B;  2A6E C;  4U68 A;  4MN3 A;  2HHH L;  4HCS A;  1IW7 C;  1CQF A;  2N3S A;  1YJ9 A;  1R9T H;  1GOZ A;  4DGZ A;  5FLM G;  4APV A;  3H3V C;  4F87 A;  1KIX A;  1BOS A;  5IYC G;  1RHP A;  4M1U B;  3UDG A;  1VQK A;  3RLN A;  4KD3 A;  1DXM A;  2LY7 A;  4OHJ A;  2K1B A;  3KF6 A;  4B3R Q;  3PO3 B;  2XIW A;  2JA5 H;  2NVT B;  1B7Y B;  4JI2 L;  2F0H A;  4IUQ A;  4DV2 L;  4IPH A;  1PH4 A;  1BDO A;  4CKB A;  1T9H A;  2SDF A;  4HMJ A;  1VQH A;  1CKM A;  1TWC H;  3HOV B;  4F8M A;  2LXJ A;  2VB3 X;  4HN7 A;  1SND A;  1CT1 D;  4WJ4 A;  1L1O A;  1R9T B;  1Q8I A;  3A0J A;  3C46 A;  2EOT A;  4G7Z C;  1TWF B;  2BDN A;  4HID A;  4JYA Q;  4A3K H;  1EQV A;  2EY6 A;  1F2M A;  5I9O A;  1PH3 A;  3OTO L;  2PNR C;  2ZM6 Q;  1HA6 A;  3HKZ B;  5E3F A;  1UE5 A;  3G4S A;  2VW9 A;  2JA5 B;  4IPG A;  3ZYY X;  3PO2 G;  3D0F A;  4DV4 L;  2ZTC A;  5C0X J;  3ERO A;  2L5T A;  2PO4 A;  3CP0 A;  4DV2 Q;  2CQO A;  5IP9 H;  4ULL A;  2F0G A;  3NSW A;  4RCO A;  4UP7 A;  4CDF C;  1DD2 A;  1JR0 D;  1DGS A;  2QDB A;  4DU9 A;  2KJX A;  2CQA A;  3MWY W;  5FO8 B;  1KD1 C;  1PFN A;  4GLV B;  5C3E H;  5A2Q L;  3L7Z C;  4KLK A;  3CMA A;  4YY3 L;  5IYD H;  2EXZ A;  4DR1 Q;  4A3K B;  4B3M L;  4DAV A;  4ZUI A;  3N52 A;  2F0K A;  3R2I A;  4NP5 A;  1CKN B;  3TZU A;  4XIG S;  3OTO Q;  4G4K A;  3HZX A;  1PH1 A;  2Q8I B;  2RSN A;  2SOB A;  5EKL A;  5C3W A;  2C35 B;  3M4Y A;  4RAU C;  1XMO L;  1S3O A;  1H9S A;  1U4M A;  2A5H A;  4BBR B;  3FKI H;  4ID6 A;  3VA5 A;  4O42 A;  2R92 B;  5GAH C;  4BY7 G;  3NWT A;  4JK1 C;  4DXF A;  5I6Y A;  5KRU A;  4ZRZ A;  4JI4 L;  3UE1 A;  2Z9H A;  5C3E B;  3SXH A;  2MJ8 A;  3E5S A;  3J81 j;  2JA6 H;  1EZ8 A;  4BXX G;  4ZQ3 A;  4YY3 Q;  2QF7 A;  5C0X G;  5K36 H;  2QEX A;  4TVA B;  5ELN A;  5LL6 S;  1ZYR C;  1AZQ A;  1STB A;  4C56 C;  3HOX H;  5FLX c;  1IW7 D;  2G5D A;  1OO9 B;  3R2T A;  2AUJ D;  3PO2 H;  4A3E G;  5JEA J;  3TDQ A;  2RBM A;  4GNX B;  1XMO Q;  3I7F A;  1D1K A;  3FKI B;  2KA7 A;  2DUD A;  5C44 G;  3S2H H;  1LTI D;  1XXG A;  3CF5 A;  1XTC D;  4K5W A;  3LX0 A;  2IHE A;  2B29 A;  4RGM A;  4JVZ A;  3R3O A;  1OXU A;  1PH9 A;  2N49 A;  1A0I A;  4JI4 Q;  1B2T A;  1M8A A;  4I7A A;  3OSO A;  1VQC A;  3I4N G;  3FMC A;  2JA6 B;  3I4M H;  3PF5 A;  1I5F A;  4K0K L;  1YJN A;  3QWN A;  4XQJ A;  3S1M H;  1WTP A;  1SAP A;  2HQE A;  5DEH A;  4DV1 L;  4IFD H;  2R93 H;  1MJC A;  5BN5 A;  4P71 A;  1U4R A;  3HOX B;  1PTO C;  3CQZ H;  2D9U A;  2K5D A;  3MXP A;  1VQ6 A;  3PO2 B;  3H0G G;  3BDO A;  1EWC A; 
#chains in the Genus database with same CATH homology
 3N6R A;  1LTR D;  2WP8 J;  3ERQ A;  2LFN A;  2EVB A;  1I4P A;  1JQY D;  1FYC A;  3CRK C;  1OXX K;  1LT5 D;  2A73 B;  1CK1 A;  3Q23 A;  1FD7 D;  1ET6 A;  5JEA G;  5CV6 A;  3O13 A;  1B53 A;  4ODG A;  2R93 B;  4HMI A;  4XDX A;  3NWS A;  3BZD B;  1ONL A;  3CQZ B;  1EY6 A;  1B9N A;  4KI0 A;  1STH A;  5FKA C;  3IKJ A;  1CQV A;  3L9A X;  3D4W A;  4O1N A;  2RDH A;  1TU2 B;  1JC7 A;  1Y69 U;  1KLG D;  4DA2 A;  1HA5 A;  1WVL A;  2PQE A;  1SBB B;  3KBG A;  3RD4 A;  3HP3 A;  3K5L A;  1LT3 D;  3J7Y W;  2KED A;  4OO1 H;  1VDZ A;  5COY A;  3OWF A;  1Y1W B;  5KGU A;  5FLX E;  2J0T D;  4A3E B;  1B1Z A;  3FDT A;  2Z1C A;  1EU3 A;  2L1B A;  4FO2 A;  1PRT C;  1ENF A;  1E2V A;  3BDC A;  1JOK A;  2KEE A;  2EZV A;  2EY2 A;  2YU9 B;  3BVG A;  1SJE D;  2D5D A;  3D4D A;  2EYJ A;  2GA4 B;  4KY5 A;  1MGS A;  2AQ2 B;  2ZXR A;  2RVL A;  1B44 D;  3E6Z X;  5KIX A;  1TVX A;  3HOY B;  1EWH A;  2CW0 C;  3SEB A;  3TN2 A;  1G6Z A;  4CKE A;  1BO0 A;  4KY6 A;  2NB0 A;  4ZLT F;  2K05 A;  3Q22 A;  4NDX A;  2M00 A;  1R4P B;  2EYO A;  2IT1 A;  2MP1 A;  3DM1 A;  1YNJ C;  2XWB B;  3J81 E;  5KNC A;  1ZXT A;  1UEA B;  3HOW B;  2XWJ B;  4Y7N B;  1AZP A;  1JOR A;  3M85 A;  3K59 A;  1JWU D;  1HFN A;  5CGK A;  4A3B B;  3UI2 A;  3PV0 A;  4AYB B;  4E6I A;  4C3H G;  2F0T A;  2HCI A;  2ID0 A;  4K8J A;  1I3Q B;  2EPB A;  1NUC A;  4ABN A;  5J1Z A;  1BR9 A;  4XT3 B;  2O4X A;  1K8M A;  3TZD A;  3MXU A;  1M4V A;  4QMG A;  4DNT B;  4IFD I;  5KYL A;  2E2J B;  3F2U A;  3DWA A;  1RF2 D;  3T13 A;  3V2T A;  5IOC A;  2HDM A;  1SNQ A;  4IUU A;  2H1E A;  4C3I B;  2C9O A;  1PDQ A;  1R4Q B;  3DXJ C;  2XRQ D;  1SYG A;  2KOL A;  4XQN A;  2ZXO A;  1JCK B;  2B2Y A;  4RA8 A;  5ISR A;  1BNZ A;  1NSN S;  3D4R A;  2KUM A;  3SE0 A;  1GXD C;  5D3D A;  4XT1 B;  5BN4 A;  1GUS A;  5C4J B;  1SYD A;  2AWN A;  1PRT D;  4X3U A;  1G91 A;  5IT9 E;  4XQQ A;  4DN4 M;  2B63 B;  1CHP D;  1KAA A;  2K32 A;  5AFW A;  1JWM D;  4Q0F A;  3NHH A;  4A3M B;  1S5F D;  3HS0 C;  1SDF A;  4CJ1 B;  3AB9 A;  1RTO A;  2B2V C;  1X3Q A;  2CW0 D;  2F4I A;  3A56 A;  1OXT A;  2WKD A;  4KKU A;  1UUP A;  1IKM A;  4KJN A;  4I65 A;  4OIK A;  2WKC A;  4KY7 A;  1SNO A;  1HUM A;  5HGT A;  1Q12 A;  1F9S A;  1CA6 A;  1YNJ D;  3OIQ A;  1BUV T;  1I4R A;  1PZK D;  3BYY B;  3IL8 A;  3EFX D;  4B08 A;  2K01 A;  1PTO F;  3HRZ C;  4QUC A;  2RA4 A;  1EIG A;  4Q5V A;  4KKT A;  2IW3 A;  2L11 A;  4U67 3;  1KNE A;  1PFM A;  2M9V A;  5FO9 B;  1SXT A;  4IUN A;  5CBE E;  1FNW A;  4IN3 A;  1PTO H;  1F2L A;  1Q3L A;  1E0B A;  2F0L A;  1X32 A;  1LTS D;  1EZ6 A;  1F2Z A;  3OPO A;  1BBX C;  4J6H A;  1HHV A;  1B50 A;  1KLU D;  4FF2 A;  3WDN A;  1HUN A;  3Q6S A;  1Q90 A;  1LT4 D;  1HCZ A;  5ELD A;  4KTA A;  3OW7 A;  3PIO 3;  2E75 C;  4Z9C B;  2IL8 A;  2N55 A;  1DON A;  2AQ3 B;  5CV4 A;  1EY4 A;  1PTO B;  3NTI A;  4DF7 A;  2KCN A;  1WTQ A;  4F88 A;  1CA5 A;  1HXY D;  1EIH A;  1O80 A;  2EDG A;  4ZK9 B;  3ONA B;  2A68 D;  1SYC A;  2WIN B;  2F0S A;  1PRT F;  1WTV A;  3I73 A;  5EKK A;  3D3R A;  1HQM C;  3TBI B;  3PMF A;  4KV6 A;  2NVY B;  4J8Q A;  2F0F A;  3A8I E;  2IWH A;  1XWE A;  2SNS A;  1G2T A;  1DM0 B;  5JPN C;  2QIL A;  5I2X A;  5K36 G;  1YNN C;  3SVM A;  2EE1 A;  1IL8 A;  3C1E A;  1S5D D;  3D31 A;  4NW2 A;  5E4X A;  1Y8N B;  1V1P A;  1F9Q A;  1CM9 A;  3MXG A;  4RHR A;  1V8Q A;  2AUK A;  1MSG A;  1Q1E A;  4A93 B;  3DWP A;  5F2D A;  1ICW A;  2FJ2 A;  1TWC B;  1SJH D;  4WJW A;  4K6L A;  1TY2 A;  2BDO A;  4KN7 C;  1PLF A;  1S4Z A;  3GTQ B;  1PRT B;  3FRP B;  1SYF A;  1MBY A;  5EPK A;  2A69 D;  4IZ8 A;  1H9R A;  5A2Q E;  2B2U C;  2RKS A;  1U4L A;  1WTR A;  4IFD G;  4QB4 A;  3VA7 A;  2KCC A;  3G6J B;  4NMZ A;  1A2U A;  1EY7 A;  1D2B A;  1G2S A;  3Q0A A;  3DUZ A;  5M3F B;  1TWH B;  1GJX A;  2JA7 B;  2NUC A;  5A35 A;  2KHS A;  3QO2 A;  1EU4 A;  2R7Z B;  1ROD A;  3WOE A;  3BDL A;  4PMW A;  1NCV A;  4RH6 A;  2CHB D;  2O5J C;  4X3K A;  1PYW D;  3VR5 A;  2A6E D;  1KNA A;  1U4P A;  3RUZ A;  2AWO A;  1ILQ A;  4HED A;  3HOU B;  2TMP A;  1IHZ A;  5FO7 B;  2RQX A;  2L4N A;  2QEJ C;  1WD1 A;  3D6C A;  2PPB C;  1QWY A;  4M8A A;  3U9O A;  1HQR D;  2B39 A;  1QOH A;  3SHL A;  4CJ2 C;  1GUO A;  3AMU A;  3X3M A;  4OO1 G;  3PIP 3;  3S16 B;  2NN6 H;  1ENA A;  4ME5 A;  1CZG A;  1BQQ T;  3NXW A;  1FR3 A;  1QJO A;  1VMP A;  3I8Z A;  4WRD A;  3SK8 A;  4KJO A;  3PUV A;  1YNN D;  3S2H B;  4DK0 A;  2F0V A;  4QF4 A;  4RGO S;  1EYC A;  4UAI A;  1AN8 A;  4IUV A;  1I4Q A;  2KVM A;  3QG1 A;  3FPU B;  3I4M B;  2B8F A;  4B9W A;  3MTS A;  5ELF A;  3MXN A;  3S1M B;  4OL7 A;  4PV1 C;  5LHY 1;  4RHS A;  1SSO A;  1JIC A;  1TR5 A;  5DAU A;  2F0J A;  4MIU A;  1KDA A;  5K5P A;  3GP7 A;  3P7J A;  1C4Q A;  3K5O A;  5C4Z A;  2OEO A;  3CHB D;  1SMY C;  1ESR A;  3URY A;  1TS4 A;  2K7V A;  3H94 A;  1T5X D;  2H4O A;  5KEE A;  3VR6 A;  2E76 C;  3MVV A;  4XYO A;  3NBI A;  3WOF A;  2PCF B;  1F9R A;  2F0M A;  3QOL A;  4H44 C;  1HFG A;  1TII D;  5D3I B;  3K0Y A;  3NUC A;  3MEH A;  1W6J A;  4ZYS A;  3NTK A;  2D2C C;  2LS0 1;  1G8Z D;  1SE2 A;  4KD4 A;  2K6A A;  4R9W A;  2D62 A;  3D8G A;  3S17 B;  1KAB A;  2B2T C;  2KQ3 A;  4IUT A;  2F1M A;  4C3I G;  3S9W A;  3C3L A;  5C4H A;  4HCE A;  3HOZ B;  2RDG A;  1QE6 A;  4UDU C;  1OXV A;  3ND9 A;  1ZYR D;  2PW5 A;  4G7O C;  4FP5 D;  1D5X C;  3SK4 A;  3R8B A;  3VYS A;  4EQO A;  5CMD A;  2R3Z A;  3IFD A;  4DNR B;  3GTK B;  1EQT A;  3TP7 A;  4G57 A;  4BA1 I;  3FPP A;  3FVQ A;  4IUP A;  5CR3 A;  1HTP A;  1PXU A;  2K28 A;  2RSO A;  4ZUJ A;  4ZKB B;  1SNP A;  1GHJ A;  1TQO A;  4PMB A;  1A2T A;  1AW7 A;  4G7H C;  2Q8R E;  2I46 A;  5E1F A;  1PTO D;  4IQZ A;  3GD7 A;  1ET9 A;  4C2M B;  2FHT A;  2YYZ A;  2CVR A;  2SNM A;  4CKC A;  3K6O A;  4EVO A;  1GUW A;  2ZT9 C;  3DMU A;  3A54 A;  2ZXP A;  1STY A;  2JEA I;  1I4X A;  3KBX A;  3M3Y B;  3IFT A;  4P2C B;  2F0P A;  3HEJ A;  4BY1 B;  4V0B A;  1EY8 A;  2BOS A;  4K5V A;  1Z7T A;  4DXG A;  5I2Y A;  4TKO B;  2WB1 B;  1O7Z A;  1I4H A;  2PYK A;  2I07 B;  1F9P A;  2O2L D;  1Y8O B;  1LTB D;  1EY0 A;  2NN6 I;  4N9T A;  3M7G A;  1GUN A;  1F77 A;  2JP1 A;  2FIN B;  2OT2 A;  4KMU C;  1A3V A;  4RCN A;  1ENC A;  3V05 A;  2E2H B;  1WTW A;  1EYA A;  1QB5 D;  4FXD A;  5IIF A;  2IJ0 A;  5C3X A;  2F0E A;  2EYF A;  2B2W C;  2B8G A;  3KK7 A;  5J22 A;  4HTH A;  4CGY B;  2L0C A;  3J7A V;  3M4O B;  3BG3 A;  3M7N A;  1X3P A;  3S2D B;  5D14 A;  2L12 A;  4X3S A;  2LKV A;  1JOO A;  3J80 L;  2G9H D;  3GTJ B;  2F0W A;  4DK1 A;  5IGF A;  2IX1 A;  1E2Z A;  4DAY A;  2L55 A;  2K5Q A;  5JAV A;  5C5M A;  4BS9 A;  1NAP A;  2LMC B;  3PUY A;  5C0X I;  1EFI D;  5JJZ A;  5LL6 X;  5IGC A;  1SYE A;  4MHE A;  3ITP A;  1TS2 A;  2SEB D;  3MHB A;  2C5C A;  1PZJ D;  2DY7 A;  4HR7 B;  1D5Z C;  2XRS D;  5JPM C;  1Q1B A;  2OXP A;  3JAM L;  3C2P A;  1DCZ A;  3A8K E;  2JSO A;  5G3L D;  3EA6 A;  3GTM B;  4EQN A;  2JE6 I;  3SK6 A;  3LWU A;  3OIP A;  3S1R B;  3EVQ A;  4C1N I;  1F2Y A;  3SK5 A;  2F0O A;  1MSH A;  1GHK A;  1CHQ D;  1NR4 A;  1JOQ A;  2N88 A;  4PNY A;  1T5E A;  1A6X A;  3Q24 A;  2WII B;  5IGG A;  1Y8P B;  4KK7 A;  3I72 A;  1O78 A;  3T53 B;  4K8I A;  3VYT A;  4HSV A;  4A3F B;  1LLR D;  1G29 1;  4HSP A;  2TSS A;  1MD2 D;  1GUG A;  2F03 A;  1DYQ A;  2Y0S B;  5EBC A;  2NVQ B;  2A6H C;  1EEF D;  3TSS A;  3EQL C;  2DY8 A;  2B2V A;  1PFB A;  1SFO B;  3S1N B;  1LV9 A;  3KLS A;  3NP8 A;  1DOK A;  2WV6 D;  1SE4 A;  2Z8L A;  4RWS C;  4BWG B;  5FK9 C;  5ELB A;  3S1Q B;  2Z4H A;  2MHV A;  4RGT A;  2NTS A;  3GV6 A;  1RD9 D;  4JBW A;  1OXS C;  5JVG 3;  2DNE A;  3BVM A;  5IGE A;  1H9J A;  3MFG A;  5FOB B;  2DN8 A;  4LAA A;  2XVS A;  3CU7 A;  1AEX A;  2A74 C;  1HPC A;  2PMZ B;  3GO5 A;  1LTA D;  1A15 A;  3TP5 A;  1RCV D;  2E2I B;  1TS3 A;  5ELE A;  4IFD J;  5I6W A;  2K5W A;  3R93 A;  1WD0 A;  3W3A A;  1D5M C;  4K5X A;  2PW7 A;  3MFY A;  5BN3 A;  4DAP A;  1VCI A;  1L0Y B;  1LAB A;  2PZT A;  4A3G B;  1IYU A;  5KND A;  5CBA E;  4QCL A;  4R8I A;  4BBS B;  2ENB A;  3I70 A;  1D6E C;  2JXM B;  1S5B D;  1BCP B;  2KEC A;  1TT2 A;  4X3T A;  4FXG C;  1U9R A;  4I7Z C;  2WAC A;  1K8O A;  2ICI A;  5G3L F;  2K33 A;  2EY5 A;  4C3J B;  5KNB A;  5EPJ A;  3RZD B;  1KDB A;  1V1O A;  3DEO A;  3MAQ A;  3D6W A;  3K5N A;  1ML0 D;  5EKI A;  4A3D B;  3RMH A;  2R61 A;  1LAC A;  5CV9 A;  5M5X B;  3LNN A;  3LWE A;  2QKI C;  3NTH A;  3QIA A;  2F0N A;  2E74 C;  2NN6 G;  3U9S A;  2F3W A;  4GZY C;  1CZW A;  3A55 A;  3MC0 B;  3GTO B;  2FMC A;  2A6H D;  5CYU A;  1HRJ A;  3CKI B;  4K14 A;  2NWG A;  1JWS D;  4EQP A;  3NE5 B;  1A3T A;  3HG9 A;  2E2D C;  3G7L A;  1QG7 A;  3A7L A;  3C1F A;  2F0D A;  5NUC A;  5COR A;  2F0I A;  1K83 B;  1UAP A;  4R8N A;  3KUP A;  2J4X A;  5CV7 A;  1BF4 A;  4RFB A;  5CC4 A;  5C5L A;  4FYD A;  2JEB I;  4FNF A;  1STN A;  1ESF A;  4KHZ A;  1TS5 A;  3PUX A;  5M9O A;  3P1H A;  2EY1 A;  3I4L A;  3E0J A;  4H7B A;  3P75 A;  2BE5 C;  3OOC A;  1DZ1 A;  3CRL C;  3T16 A;  1S5E D;  4IAL A;  2Q8T A;  1TWG B;  1JB3 A;  3QJY A;  3X3N A;  2B2U A;  1MI2 A;  5IOD A;  4ILW A;  3VYU A;  1FNV A;  2PZW A;  2FFK B;  4L63 B;  2AQ1 B;  2M2L A;  3GTL B;  2EYH A;  3SDZ A;  4FF1 A;  5ELC A;  1VF5 C;  2VXW A;  1EY5 A;  1DJR D;  1KTK A;  1I6H B;  2PZU A;  4N9P A;  1QIL A;  3TP8 A;  3T4A C;  1J8I A;  2K03 A;  4QIW B;  1TWA B;  1V43 A;  4RKB A;  1SYB A;  2X69 A;  2NVX B;  1KDC A;  5IGD A;  5C0X H;  3RZO B;  5M5Y B;  4FVM A;  3GTG B;  2XN9 C;  1EL0 A;  4S3S A;  3GQB A;  4PQX A;  3K57 A;  1STE A;  1BCP C;  5T1G A;  4WFN 3;  4FF3 A;  3MZ5 A;  1L0X B;  2Z4I A;  2EJF C;  1ZEQ X;  2OF1 A;  1C8C A;  2F0U A;  4BY7 B;  1WTO A;  4J1M A;  2F0Q A;  3BS1 A;  3DHQ A;  3KLR A;  5EGT A;  5FLX L;  4HAE A;  2X6L A;  2HUG A;  1SNM A;  2BCO A;  3KLS X;  1H9M A;  3HGB A;  1ILP A;  2BE5 D;  1SE3 A;  1B3A A;  3OMC A;  5C44 B;  3NPP A;  5I4D A;  1W6K A;  1B9M A;  2IX3 A;  3I4N B;  5DM7 3;  2EYM A;  3SR1 A;  2K04 A;  1TY0 A;  3GTP B;  3OHX C;  5JEA H;  2R6G A;  3FEW X;  3PUW A;  5JOB A;  3ND8 A;  2QCP X;  3OWE B;  1CFM A;  4LMQ D;  1FNU A;  1EYD A;  3H0G B;  3A7A B;  4RGN A;  1QNU A;  4CBV A;  1CI3 M;  2B2T A;  3K5M A;  3J81 L;  1B4O A;  2NTT A;  1RDP D;  2NZ1 D;  3QOJ A;  3W2D A;  3I3C A;  2JA8 B;  3H6M A;  5C4X B;  3DEP A;  2B2Y C;  3VR4 A;  4CJ0 B;  1WCM B;  1J9O A;  3H91 A;  1Z6H A;  4KKS A;  4XTC S;  4WOR A;  1I50 B;  1FGB D;  1V1P B;  2MGS A;  5E4W C;  1JE4 A;  4LK1 C;  2MPM A;  1SMY D;  3J7A F;  4K2L A;  2O5I C;  4RKL A;  1S5C D;  5CV5 A;  1IYV A;  4PMC A;  3QB3 A;  1EY9 A;  3I91 A;  2HCC A;  2XNA C;  3K7A B;  1XYI A;  1BCP D;  5M5W B;  1Z47 A;  4OGQ C;  1RJT A;  3H09 A;  1VMC A;  5EPL A;  5EBD A;  5M3M B;  2NBF A;  2BA0 A;  5J39 A;  2EYL A;  1UNS A;  3IAY A;  3NBH A;  3S14 B;  2IPK D;  5HUR A;  3T56 B;  1PZI D;  2NYZ D;  4L6T B;  4LJZ C;  1H9S B;  3RLF A;  4C1N K;  1XX8 A;  1C48 A;  3J80 E;  2L9H A;  4FXK C;  2V4D A;  3NQT A;  2JYO A;  5DM6 3;  1AP0 A;  2X6G A;  2IX0 A;  1II3 A;  5IT9 L;  1LT6 D;  4V19 0;  3S15 B;  1O7L A;  1NR2 A;  1PMR A;  4NKL A;  5EJW A;  4ZAI A;  1H9K A;  4DFA A;  1A3U A;  1I4G A;  2A68 C;  2DNC A;  4TRD A;  3OMG A;  5C6A A;  5TSS A;  4OIJ A;  4ZKC B;  2BA1 A;  1D1I A;  1RTN A;  4FF4 A;  1DOM A;  1SNC A;  2J7Z A;  4IUR A;  3L3O C;  4QUF A;  3GV3 A;  2B2W A;  3T51 B;  3DWQ A;  1EEI D;  1RKN A;  3JAM E;  3I90 A;  1VF7 A;  5T1I A;  3P20 A;  1HTL D;  1SEB D;  4OO1 I;  1AFP A;  3KF8 A;  2VNU D;  1QCB D;  1BXT A;  4KN4 C;  1IKL A;  1DOL A;  4BA2 I;  4XYQ A;  1E2W A;  3NQI A;  1O7Y A;  4K6D A;  3TME A;  2G9D A;  1LTG D;  1TKW B;  1I6V C;  1LTT D;  1EOT A;  4C3H B;  3TP6 A;  4C3J G;  2VUM B;  2HDL A;  4KHV A;  5CV8 A;  4XXE A;  3V96 A;  2ICE C;  4CHT B;  1Y1V B;  3VR2 A;  4B9X A;  4H0L C;  3BVZ A;  2VB2 X;  3BYT B;  4TQU S;  2EYP A;  2RDF A;  5D65 A;  2A69 C;  1ZKO A;  4TSS A;  4EGV A;  4F7X A;  3A8J E;  1STA A;  3AU7 A;  5DNF A;  5I9P A;  2EJG C;  5JVH 3;  5EQ0 A;  4A3I B;  1WTX A;  2F3V A;  3K58 A;  3VYR A;  3EJI A;  2XSC A;  4A3J B;  3MA2 B;  1BCP F;  1CTM A;  2FMM A;  3NK9 A;  3VR3 A;  4K2K A;  1QNK A;  4H13 C;  2EJM A;  5IGB A;  4L8J A;  4YIJ A;  1STG A;  5KYI A;  1LO5 D;  1GUT A;  3PUZ A;  2MUY A;  2WAQ B;  2A6E C;  4U68 A;  4MN3 A;  4HCS A;  1IW7 C;  1CQF A;  1GOZ A;  4DGZ A;  3H3V C;  4F87 A;  1BOS A;  1RHP A;  4M1U B;  4KD3 A;  1DXM A;  2LY7 A;  4OHJ A;  2K1B A;  3PO3 B;  2XIW A;  2NVT B;  2F0H A;  4IUQ A;  1BDO A;  4CKB A;  2SDF A;  4HMJ A;  3HOV B;  4F8M A;  2VB3 X;  4HN7 A;  1SND A;  1CT1 D;  1R9T B;  1Q8I A;  3C46 A;  2EOT A;  4G7Z C;  1TWF B;  2BDN A;  1EQV A;  2EY6 A;  1F2M A;  5I9O A;  2PNR C;  1HA6 A;  3HKZ B;  5E3F A;  2JA5 B;  3ZYY X;  5C0X J;  3ERO A;  2L5T A;  2PO4 A;  4ULL A;  2F0G A;  3NSW A;  4RCO A;  1DD2 A;  1JR0 D;  2QDB A;  4DU9 A;  2KJX A;  2CQA A;  3MWY W;  5FO8 B;  1PFN A;  5A2Q L;  3L7Z C;  2EXZ A;  4A3K B;  4DAV A;  4ZUI A;  3N52 A;  2F0K A;  3R2I A;  4NP5 A;  3TZU A;  4XIG S;  4G4K A;  3HZX A;  2Q8I B;  2RSN A;  2SOB A;  5EKL A;  5C3W A;  3M4Y A;  4RAU C;  1H9S A;  1U4M A;  2A5H A;  4BBR B;  4ID6 A;  3VA5 A;  4O42 A;  2R92 B;  3NWT A;  4JK1 C;  4DXF A;  5I6Y A;  5KRU A;  4ZRZ A;  5C3E B;  3SXH A;  2MJ8 A;  3E5S A;  1EZ8 A;  4ZQ3 A;  2QF7 A;  5C0X G;  5K36 H;  5LL6 S;  1ZYR C;  1AZQ A;  1STB A;  4C56 C;  1IW7 D;  1OO9 B;  3R2T A;  2AUJ D;  5JEA J;  3TDQ A;  2RBM A;  1D1K A;  3FKI B;  2KA7 A;  1LTI D;  1XXG A;  1XTC D;  4K5W A;  3LX0 A;  4RGM A;  3R3O A;  1OXU A;  1B2T A;  1M8A A;  3OSO A;  3FMC A;  2JA6 B;  3QWN A;  4XQJ A;  1WTP A;  1SAP A;  2HQE A;  5DEH A;  4IFD H;  5BN5 A;  1U4R A;  3HOX B;  1PTO C;  2D9U A;  2K5D A;  3MXP A;  3PO2 B;  3BDO A;  1EWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...