1O7YA

Crystal structure of ip-10 m-form
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
LSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemokine
molecule keywords SMALL INDUCIBLE CYTOKINE B10
publication title Crystal Structures of Oligomeric Forms of the Ip-10/Cxcl10 Chemokine
pubmed doi rcsb
total genus 9
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1o7yA00
4HAEA 4UAIA 3I8ZA 5CORA 2RSOA 4O42A 2K03A 3MWYW 5EPLA 2Q8TA 2EOTA 3DM1A 5COYA 2MGSA 3I91A 5AFWA 4IURA 1HHVA 2KOLA 2N55A 5CBEE 1CM9A 1B3AA 4R8IA 1IKLA 3N52A 1PFBA 4HEDA 1F9RA 2Q8RE 2L4NA 3GV6A 4HCSA 2K1BA 3GV3A 2J7ZA 1SDFA 4QUFA 3Q6SA 4MHEA 4NW2A 2HDLA 1MGSA 1RODA 2X6LA 4ZLTF 2B2UC 5CBAE 1G6ZA 1TVXA 2B2UA 3IFDA 2L11A 1ZXTA 1J9OA 2B2VA 1WVLA 4LMQD 2EE1A 1MI2A 3IL8A 2K04A 4RAUC 2K01A 1HRJA 1NR4A 1ILQA 1G2TA 5EQ0A 1DOKA 4X3TA 3UI2A 1WTOA 1M8AA 1EIGA 2L9HA 1RTOA 2N88A 3QO2A 2DY7A 2NZ1D 3H91A 4IUQA 1NCVA 2FMMA 4DN4M 1ESRA 1DONA 1HUNA 2B2WC 1EL0A 2FJ2A 2VXWA 4CJ2C 2B2WA 1VMCA 4HSVA 3FDTA 5EKIA 2HUGA 5D14A 4ZK9B 1Q3LA 2KEDA 2NYZD 4IUUA 5DNFA 3SVMA 1F9PA 1BNZA 1ICWA 1DZ1A 3ONAB 1U4PA 1WTRA 1XYIA 1CA5A 1KNAA 3D6WA 1PDQA 1GUWA 2FHTA 4XT1B 2MP1A 2SDFA 1IKMA 2L12A 1X3QA 1ML0D 1HA6A 3DEPA 1PFMA 3I3CA 2CVRA 1SSOA 1HUMA 3I90A 1C8CA 1MSGA 1B4OA 3LWEA 1JE4A 3KUPA 4ZKCB 5JJZA 2NWGA 2L1BA 3G7LA 2FFKB 2X69A 2XIWA 3KBXA 5CMDA 1WD1A 1DOMA 1RHPA 2RSNA 2K05A 1U4RA 2MPMA 1S4ZA 2R3ZA 2JYOA 1A15A 1NR2A 3TZDA 1CA6A 4IUTA 1F9QA 1RJTA 2IL8A 4MN3A 1AP0A 1B2TA 2H1EA 2B2TC 1WTWA 1HFNA 1WTXA 1AZQA 4CJ0B 2D9UA 3P7JA 1BO0A 2HDMA 1SAPA 1X3PA 1HFGA 1E0BA 1PLFA 1WD0A 1B53A 1EOTA 2HCCA 3R93A 1BF4A 4X3KA 2RA4A 2DY8A 2K28A 3DEOA 3FPUB 5EPJA 5EPKA 1B50A 1F2LA 4CJ1B 2B2YC 2EPBA 1O80A 2FINB 1JICA 2B2YA 1G2SA 1ILPA 2BDNA 4QUCA 1WTVA 1G91A 1MSHA 3F2UA 4RWSC 1WTQA 4OIKA 3TN2A 2KEEA 2MJ8A 2RVLA 1NAPA 2KECA 4ZAIA 2KVMA 1VMPA 4X3UA 5T1GA 2M2LA 1F9SA 1WTPA 1QG7A 4X3SA 5D65A 1O7YA 1QE6A 1QNKA 4U68A 1U4LA 1EIHA 2B2VC 1LV9A 3HP3A 1BBXC 1DOLA 4R9WA 2B2TA 1O7ZA 1RTNA 1X32A 4XT3B 1XX8A 2JP1A 1IL8A 4IUVA 5E4WC 2KUMA 1PFNA 1KNEA 1U4MA 2HCIA 3MTSA 4OIJA 4RA8A 2X6GA 4XDXA 5EJWA 4IUPA 5T1IA 1EQTA 1AZPA 5E4XA 4ZKBB 1J8IA
chains in the Genus database with same CATH superfamily
2RSOA 4IFDJ 3D4WA 1BCPD 2CW0D 1TKWB 3CP0A 2N55A 4LF9Q 1KXLA 1IKLA 1B9MA 1WJJA 3QB3A 4ULLA 2PI2E 2WAQG 4OXPA 4DR4L 3SK6A 1A2UA 3K57A 1Q8IA 1UE7A 3CC2A 4RG1A 1ZYRC 3KF6B 2NN6H 2F0FA 3C46A 5J1ZA 4JV5L 1RKNA 5D3IB 2OTLA 2AHOB 5FK9C 1R4QB 4AYBE 2K01A 5L37A 2QILA 3RZDH 1G8ZD 5EQ0A 4AYBG 1K3RA 4JI1Q 3H91A 4DR1L 1SEBD 2UU9Q 4HCEA 1LTLA 3J81L 1EQQA 3NBHB 2IX3A 4N8X1 1N9WA 3RMHA 4XTCS 1SNMA 4F7XA 2EQSA 1F9PA 3D0FA 1QCBD 2QEJC 1TR5A 5M3MB 1KNAA 4ABNA 1PVOA 4DR4Q 3MEHA 5M5YH 3M4OB 3HOUG 5FLMH 2PW7A 4TQUS 4TVAB 5ELCA 3KLSA 1JE4A 2R61A 2A73B 4JV5Q 2KBNA 4ZRZA 5EKLA 3HOYG 1GUGA 3KJPA 2A74C 3PQIA 5C44B 1WTWA 4YHHL 1CI3M 1S3OA 3T1YL 4DR1Q 1T9HA 2JN4A 1SAPA 3MXNA 1KLUD 4K2KA 3K7AH 2EYOA 3T16A 4CDCC 1Y1WG 1PLFA 1TWCH 1YNXA 4X3KA 5DEHA 1EY5A 1GHKA 1J5EL 3F8TA 1EY4A 1D6EC 1TS4A 1YITA 1IW7D 1A6XA 5JPMC 4RGMA 5K5PA 4JI5Q 3F2DA 4A3EH 2B63G 1PTOC 4A3KB 4K6DA 5GAEC 1VQPA 1PH6A 1QE6A 2MQHA 2QF7A 2B2VC 3K0YA 3W5OA 3GTGH 2A68D 1PYBA 3J81j 1ESFA 3HRZC 1RF2D 5EJWA 4RA8A 4OX9L 1QNUA 3NQTA 1K73C 3J80L 3PSIA 1U5KA 2K5NA 1MKHA 4DPGA 5IYCG 4FF1A 3T1YQ 4FDBA 2MGSA 3GTJB 5FOBB 3TP7A 1I3QB 1SLJA 2PMZE 5CV6A 4FF3A 3W1GA 1E2WA 4DV1L 1J5EQ 2E74C 1LTRD 2JA8B 1HZBA 1UE5A 5CBAE 4K5VA 4ALPA 1MJEA 1MBYA 3HOXH 3OOCA 3K6OA 3KF8A 5TSSA 2FXQA 2CQAA 4RAUC 1TQOA 2PZUA 3MXNB 3SHLA 4FYDA 5BN5A 5IP7G 5M3FH 4ZQ3A 2BCOA 5C4ZA 1X55A 2E2IB 4R4CA 2NN6I 4FXDA 2ZTEA 3ER0A 1KTKA 1VF7A 3PO2G 1NCVA 2FMMA 1IYUA 3KLRA 4OX9Q 2KJXA 2DNCA 3LWUA 1EL0A 2PQAB 4CJ2C 1X3FA 4KY6A 1QZHA 4EQPA 2JA6G 4A93H 5D14A 4UPAA 3QWNA 1A62A 3SVMA 3VDYA 3GTOB 2JSOA 3UE1A 3M9BA 3JAMc 3MZ5A 4Z9CB 3HGBA 5LMNL 4K14A 4DV1Q 4WJWA 3I4NH 3DEPA 5I2XA 1SE4A 1TWGH 2N78A 1KIXA 3W1BA 4XXEA 1ONLA 4JW0A 1D5ZC 4GOPC 2GVAA 4NXNQ 1NMGA 2FFKB 4K5WA 3L3OC 1CA6A 1N32L 3IFTA 2H1EA 2B2TC 1YVCA 1PHJA 2H5XA 3HZXA 1X3PA 2I5HA 1LTID 4GZYC 4LF5L 4XQQA 1KQSA 3KF8B 1UWVA 3NENA 3CRLC 3G71A 1Q12A 1VQKA 2FINB 2I07B 1MD2D 4RWSC 1JB3A 3I2ZA 1NUCA 1XTCD 4B3RL 5LMNQ 4LF6L 2NZOA 4PZ7A 3EQLC 4A75A 1YEZA 2BA1A 1EIHA 1SR3A 4BY1G 3T13A 5F2DA 4ME5A 5IGEA 3V96A 3VR5A 3JAMi 4L5QA 1IYVA 1IL8A 1D5XC 4EVOA 2HCIA 5C6AA 4C3HG 1N32Q 3CCSA 4FF2A 1UE6A 3KOJA 3M7NA 3GTLB 4Q0FA 1F2MA 4OWWB 4IPHA 2UUCL 2F4VL 2ICEC 2A1AA 4LF5Q 1PFBA 3S17H 1PFSA 3ULPA 4HTHA 3HG9A 4O0AA 2B3GA 4HN7A 2IY5B 2L15A 4MHEA 4NW2A 3RZOH 1TVXA 3OSOA 1WVLA 3I4LA 4B3RQ 4LF6Q 4A3DG 5C3XA 2EXDA 4DV4L 2CWAA 4R1JA 3NHHA 4DGZA 1AN8A 2F0MA 3AMUA 3TRZA 4LF8L 3NUCA 2VXWA 3D31A 1HTPA 3KLWA 5J22A 1A3TA 1KAWA 2UUCQ 2F4VQ 1SMYD 2Z6KC 3D6WA 1TWHB 4DR5L 4X65Q 1PZID 3GTKH 4G7HC 4KKTA 2BOSA 3TMEA 3M85A 1EY7A 2VL6A 5KIXA 3S9WA 1PRTC 2QGQA 3KUPA 5I9PA 1W3SA 2VUMG 3BG3A 5J3BA 2LMCB 1B44D 4DV4Q 3X3NA 1F9QA 2BH2A 2VY3A 2E2JH 3I7FA 3OIPA 3K81C 4KY5A 4DXGA 1YJNA 1B70B 3PO3B 1Y8NB 1PH7A 3FP9A 1EOTA 1OXSC 1HA5A 3DEOA 3NXWA 2PPBC 1EZ8A 3HOWB 1YZ6A 1SNOA 2BE5D 3MXUA 4QY7A 3J7ZC 1N33Q 2JA7G 3HOUH 5K36G 1G91A 4DR5Q 3JC66 2VW9A 4LW1A 3S1QH 1UE1A 2E5LQ 4ZAIA 4X3UA 4DNIA 2N3SA 2PMZB 3RNUA 1YNJC 5CV5A 4DK6C 3CCLA 3Q23A 2ENBA 2LXKA 4DXFA 1JOOA 1BBXC 3HOYH 4BBSH 2AQ2B 2JEBI 4X62L 3H09A 3U9SA 1JWMD 3DHQA 3EA6A 3VR3A 3K5NA 2ZJRA 1XMQL 1SYDA 1Y1WH 2R7DA 4O42A 2K03A 3SR1A 3SK5A 4ZUIA 2KOLA 1PYWD 5FJ8G 4KMUC 5CYUA 2BDOA 1LT5D 4DR3L 4P72A 4C2MB 1SDFA 5HGQA 4A3FB 2X6LA 1KDCA 4JI0L 1G6ZA 2B63H 2KHJA 3RR5A 5IY0A 3CHBD 1A3VA 1BOSA 3WOFA 1I4HA 1YNNC 5I4DA 1PA6A 4FXKC 1EY6A 4X3TA 1I6HH 3P20A 1XJVA 2O2LD 3X3MA 2XWBB 3LNNA 1B9NA 2N88A 5J39A 1CZGA 2HHHL 1SRUA 4C3IG 3KK7A 1AW7A 5IYCH 1VMCA 3GTQB 3S16B 1LT6D 1K8MA 4OEMB 1XMQQ 1GD7A 1PXUA 2RKSA 1FNUA 4RGNA 4DAPA 1JB7A 5HGTA 5C4JB 3CC4A 4DR3Q 4KTAA 4UHVA 4NP5A 2TSSA 2R92B 1Z9FA 1TY0A 2A5HA 4JI0Q 3I72A 1FD7D 4MNOA 3M4PA 5IP7H 3KBXA 3NWSA 3CQZB 1D1KA 2JYOA 1A15A 2UXCQ 4JCVE 3PO2H 4LFAL 4TKOB 4POGA 5C0XI 3H15A 2HHHQ 2JA6H 1VQNA 3RN2A 1CFMA 4F8MA 2CQOA 1E7ZA 3SEBA 2DY8A 2DUDA 3U9OA 2K28A 4C3HB 1VQDA 5IT9L 1MHWC 3D4RA 2EYLA 1JICA 4UY8C 1G2SA 2F0HA 1WTVA 3D6CA 5FLXL 3S2DB 3TN2A 1PH1A 2F0UA 2CCZA 3F2CA 4JI3L 1WTPA 4U68A 1O7LA 1DOLA 4R9WA 3UDXA 5M3MG 4OONA 4APVA 1KNEA 2VB2X 4XDXA 3D4DA 4LFAQ 3I8ZA 1VQOA 3ND8A 1Y14B 1GJXA 3L2PA 2VNUD 1HHVA 4JI2L 1D2BA 1FGUA 1HQRD 4JI7Q 1ASYA 4EQOA 2SOBA 4MTKA 3TBIB 4LF7L 3ITPA 1EEID 2CWPA 2Z0SA 5C44G 1XTDA 4AIMA 2K5VA 3QJYA 3ICEA 2NVQB 5E3FA 2NVYB 4E6IA 4BY1H 2PYKA 2D2CC 5EBCA 2F3VA 4EQ5A 2Q2IA 3MXPA 2YU9B 4JI3Q 3VA5A 1LUZA 1OXUA 4GLVB 4P75A 2L9HA 3QO2A 1W6KA 3SGIA 4YCWA 2GVBA 4IUQA 4HJ5A 1TIID 4JI8L 2IJ0A 4A3KG 2ZJQA 4KHVA 4HMJA 1Y1VG 1E2ZA 4Y7NB 2V4DA 4DAVA 4JI2Q 1GHJA 2YTXA 2R7ZH 4G7OC 2XWJB 4BA1I 1PDQA 4P74A 3F2BA 4LF7Q 1TWAB 2PNHA 4PZ8A 2F0PA 2UUBQ 4PMBA 3I90A 1MSGA 3BJUA 3G6JB 3LWEA 4A3DH 3ERSX 4IUNA 3HEJA 3BS1A 2XIWA 3MFGA 5IE8A 4B9WA 4BWGB 2EY5A 3DMUA 2AUKA 1RJTA 4FXGC 5ELOA 3H3VC 3S14H 3S1NB 2A6HD 2JA8G 2NUCA 3ERQA 3ZYYX 2XRQD 2EXZA 4N9PA 4A3GB 3LX0A 1DYQA 2CHBD 4JI8Q 4C3JB 1FGBD 3STBC 4DR2Q 3I73A 4K2LA 2B2YC 1JJCB 1V1OA 4A3CG 2A6EC 1KDBA 1EWCA 3AFQA 4RHSA 4OIKA 5ELNA 4IJLA 2ALYB 2KEEA 1NSNS 2MJ8A 2F0JA 3NP8A 1VMPA 2VUMH 2M2LA 4YY3Q 5IYBG 1Q1BA 1VCIA 4MIUA 1PH3A 4JI4L 3CCEA 1R9TH 3PIPA 1F77A 1EQTA 1PH2A 2LKVA 3L7ZC 1AE3A 1EY0A 3MWYW 5IIFA 5AFWA 4L5SA 1K83H 1KHIA 2EY2A 1B3AA 3Q8DA 2K1BA 1GKHA 5K36H 2F0WA 2JA7H 1J6QA 1ET6A 4I7ZC 3PUZA 1I5FA 2L11A 2F3IA 3TDQA 1CKOA 2KQ3A 4B3ML 3P75A 2KHIA 3PF4A 4PMCA 1SYEA 2K52A 3A55A 1IBKQ 1R4PB 5LHY1 1CTMA 1BCPC 1HPCA 2CW0C 4JI4Q 3TREA 1W6JA 1ESRA 1LYLA 3P1HA 5C3EB 3DWQA 1QILA 3V05A 3RLOA 1VQHA 1A2TA 5FJ8H 2ZJPA 4GNXB 4WFN3 3FHWA 1BNZA 1PH5A 1F2YA 1CSPA 1GUTA 2J4XA 2XN9C 2CH4A 1P16A 3HS0C 2L12A 2IHFA 5C0XG 1VQ6A 1HNXL 4OGQC 1HNWQ 1SSOA 2MHVA 5FO7B 1X65A 1EYCA 1D1IA 3Q22A 4FF4A 2UUAQ 4GN3B 1ZEQX 1DOMA 3U58A 4B3MQ 2RSNA 1U4RA 1UNSA 3TZDA 3CCMA 1DGSA 1ZYRD 2IL8A 1RDPD 4C3IH 4YCVA 1XPOA 5M5XH 5G3LD 2R93B 3OHXC 2RA4A 4JI5L 5LL6S 4DV5L 1BR9A 3BZKA 5LL6X 4CJ1B 1QVFA 1SBBB 2F0EA 2BDNA 2RCFA 5BN4A 4LK1C 4B3TL 3SK8A 4LUVA 1KAAA 1EU3A 4JI6L 1HNXQ 2XGTA 3AB9A 2EZVA 1VQ7A 1PZKD 3HP3A 3GD7A 5IGCA 5GADC 4IUVA 1EU4A 3TQYA 2NVXB 4H0LC 2I0QA 2QCPX 1V9PA 2F0IA 1F2ZA 5EPLA 4K6LA 1EY8A 1TWFB 2I46A 4IURA 1VQ5A 1GOZA 5CBEE 4RCNA 1IW7C 1NY4A 3J80c 2OQ0A 4RCOA 4GN4B 4DV5Q 4WJ4A 1C4QA 3GV3A 1SYGA 3RLFA 1Y1VB 1YBYA 3ULLA 2JJQA 1MGSA 2XNAC 3O13A 1STHA 4B3TQ 3PO3G 2EE1A 4HJAA 2A68C 1S72A 4JI6Q 4DR6Q 1A63A 5M3MH 4KK7A 2BH8A 1QZGA 1KRSA 1H9JA 3M4YA 3M4OH 3HOWG 2EYFA 4L63B 4TRDA 3RUZA 2ID0A 2HUGA 2JXMB 5IGGA 3JAME 2RF4A 5DNFA 1EUJA 3CCUA 3PGZA 4IO9A 3F1ZA 2Z4IA 1XYIA 4NXNL 1LTTD 5C44H 1LT4D 5DLQE 1VDZA 3C3LA 3I3CA 5CV8A 4KD4A 2O5JC 3V2TA 1FNWA 2VB3X 4NB3A 1GUSA 2F0GA 4IZ8A 1BQQT 2AQ1B 3J80i 2NB0A 3E9IA 1LLRD 2DN8A 1FVIA 5CV7A 1OXTA 1PH8A 3I4OA 1XPUA 3B6YA 2EYMA 3OPOA 4A3FG 1DM0B 1B2TA 1P8LA 4H7BA 2IHEA 1NJIC 4A3KH 1BO0A 2HDMA 5M9OA 3M3YB 4KLKA 4RGTA 2ZXRA 1SFOB 1B50A 4CGYB 1F2LA 3NE5B 2B2YA 1ENAA 4BY7B 4A3BG 3QOJA 3WWVA 2G9HD 2M9VA 1VQLA 4NKLA 3PUXA 2YTVA 2KVMA 3GTJH 1QG7A 1I3QH 4LFCQ 3H0GB 3TP8A 1O7ZA 1BDOA 1X32A 1DXMA 5E4WC 2KUMA 5CR3A 1SNDA 2JA8H 4P71A 5E4XA 2R92G 4EGVA 1IHZA 4OWXB 5CV9A 2F0SA 1BVSA 3K7UC 4UP9A 2EOTA 3DM1A 1QWYA 2AWOA 2E2IH 4A3CH 1SYCA 3JAML 3GV6A 4KD3A 3HKZE 4KY7A 4OL7A 1E2VA 3C1FA 2E2DC 1Z7TA 1ZXTA 3A7LA 3IL8A 3K5MA 4CKBA 5IYBH 2K04A 3GTOH 1A0IA 1JT8A 2KA7A 3MXGA 1STAA 3A56A 1KD1C 2MUYA 4J15A 4X64L 1RTOA 1EWHA 4JK1C 3S24A 3EIVA 4IFDI 4X65L 4S3SA 1KDAA 4JBJA 4RKBA 1X3GA 3FKIB 3D3RA 1LTBD 1IKMA 1IBML 1VQ4A 1CKMA 2Y0SE 1HUMA 5G3LF 1K0SA 1EYGA 1Z6HA 2JQOA 3R8BA 3CW2C 4DAMA 3G7LA 2X69A 5CV4A 4NPSA 4JC0A 4BXXG 3CRKC 1E1OA 2F0QA 3VA7A 2F0TA 3C1EA 1JWUD 1AP0A 4X64Q 4I7AA 4LNQA 3S1MB 4LUOA 2D5DA 1JOKA 1SMYC 1N33L 1WD0A 1N36L 3DWAA 1EFID 4ZYSA 4DUYL 5HURA 2E5LL 1IZ6A 3KDFA 5D3DA 1LM0A 3CXCA 5C0XH 1PMRA 3NEMA 1N34L 1TY2A 1WTQA 3VYTA 2GA4B 1B3QA 1IBMQ 2JA5B 4C1NI 1NAPA 3GTLH 2OEOA 1DCZA 1TS5A 1YHQA 5ELFA 1WYDA 5JOBA 5IP9G 1I4GA 3N6RA 3W3AA 4WORA 1I4PA 1E1TA 3PCOB 4OIJA 5C4HA 1KLGD 1RCVD 4UAIA 1HZ9A 2PNRC 2XVSA 1SNQA 2OWOA 5KYLA 3G6EA 2K14A 5M5WB 4A3LG 1CSQA 1TU2B 2BE5C 3G4SA 3S1RB 1N36Q 1OXXK 2PW5A 5KNBA 4DUYQ 1O7IA 1LO5D 1C0AA 2K5HA 3A8IE 2HDLA 5KGUA 4K5XA 4PG3A 4A3GG 1N34Q 2B2VA 1J9OA 1ET9A 4LMQD 1G291 5KRUA 2I5LX 4C3JG 4WJ3M 2K33A 2HIXA 1OTCA 4L8JA 1YHAA 4U673 1Q81C 1E24A 3CF5A 2QDLA 2C5CA 1TWHH 2O4XA 3H94A 4DAYA 3IKJA 3KDFB 1NNXA 3SXHA 1QB5D 2K5DA 5GAHC 4H02A 4DN4M 3S15B 1DONA 5A2QE 1FL0A 3M4QA 1LT3D 1VQAA 2KEDA 3NTHA 2SNMA 1STYA 5ELEA 4YWMA 3KYHC 4XT1B 1CT1D 5GAGC 5C5LA 3A5UA 1WCMB 3PO3H 1EIFA 3J7AF 2UXCL 2I5MX 5IWAL 1BBWA 3PV0A 4KV6A 1L0XB 3AU7A 2AUJD 3OMCA 4YWKA 3EFXD 2CH4W 4A3BB 2EIFA 1U9RA 5C4XB 4IPDA 3HOWH 4YIJA 3TS0A 4IUTA 5GQOA 3BVGA 4MN3A 5GROA 4RKLA 1WTXA 1H9MA 1PTOB 3R3OA 3DUZA 2MNAA 2CFMA 2IWHA 1VQCA 3R93A 1XXGA 5JEAG 3GTMB 3GTPH 2RDHA 3S2HB 1E3PA 1ILPA 1FNVA 4RHRA 3F2UA 2WV6D 4DAYB 4GOPA 1QUQA 5C3EG 3FRPB 2RVLA 4DV0L 2KECA 1JJ2A 2DGYA 1AFPA 5FLXc 1FR3A 5IWAQ 4Q5VA 5A35A 5IYDG 1G6PA 2B2TA 3HKZB 4C2MH 4A3FH 1B8AA 4R4OA 4JI7L 3HOZB 3T53B 5JJKA 1UUPA 5I2YA 3K5LA 2F0NA 2YTYA 5CORA 1XWEA 4KKSA 5A2QL 2WP8J 1VF5C 3OW7A 2AMCB 2WKCA 1UAPA 3S16H 3GTQH 2R93G 4IFDG 2PO4A 4DV0Q 2K4KA 4BBRB 1G2TA 1JE5A 5C4JH 1UEBA 4IOAA 1LTGD 4F87A 2ZM6Q 3MVVA 2N49A 2Y0SB 5EBDA 1Q82C 3BZDB 1HR0W 2R92H 1Q90A 4ME3A 1M90C 1M4VA 2B2WC 4V190 4GOPB 5LMUL 4KHZA 3L9AX 1Q3LA 3FVQA 4KJNA 3Q0AA 3HOVB 3ZJYC 5E7NA 2UUBL 3CQZH 3UDIA 4BS9A 3NPPA 1OXVA 4JPBW 3GQBA 4DA2A 1AE2A 1GUWA 4IJHA 2WB1E 4XIGS 3KBGA 3TEHB 5IGDA 3PIO3 1HXYD 2KCMA 3A74A 4A3IB 2G9DA 2QA4A 3VYRA 4J6HA 3RN5A 4C3HH 1C9OA 1WD1A 2MPMA 1AEXA 3CCQA 2DJFC 3S2DH 4DR2L 2D0OA 1CQVA 2F0DA 3P7JA 4DV2L 2Z6KA 1HFGA 4OO1I 1PV4A 2E76C 4X6AH 1B53A 5LMUQ 2IT1A 4YCUA 1PH4A 2B29A 3RLNA 2NVTB 3FEWX 3CD6A 4CBVA 5JJLA 4YY3L 3UDFA 1UEAB 4R4QA 2LY7A 1H9SA 2PQEA 2HT1A 3PIOA 1PRTF 2N8NA 4PNYA 1U4LA 3NTKA 1I50B 4BXXH 1NMFA 1G51A 2A6HC 3AFPA 4KHPL 1XX8A 1STBA 2A69D 4KI0A 3EROA 1JOQA 4JOIC 2E2HB 2KCNA 1J8IA 1HZAA 4B3SL 1WTHA 2NVQH 5KNDA 2NVYH 1CHQD 2LFNA 5COYA 1CUKA 3I4MB 1EQVA 2YU9H 3CCRA 1DD2A 4DV2Q 1K9MC 4A3JB 3N52A 1IYJB 2ZXPA 2VQFQ 4HJ7A 4DF7A 2LXJA 4ZCKA 3EVQA 2F0OA 3CMAA 3Q6SA 2VS1A 4A3MB 2Q2TA 1RODA 2BA0A 3A54A 1ZKOA 4PMWA 4DFAA 2PZWA 1IBKL 3E5SA 1XNQL 4Y7NH 1XMOL 4RFBA 5IP9H 1BUVT 4EX5A 2WACA 1K28A 1DOKA 1M1KC 3CU7A 3KFUA 2QEXA 1EIGA 4KHPQ 4BY7G 1DJRD 1TWAH 4JBWA 1VQBA 3E6ZX 3K8AA 1IBLL 3PUWA 1Q46A 1WI5A 3A5ZB 1PRTB 2FJ2A 4A3LH 1GM5A 4B3SQ 3KF6A 4IUUA 3W2DA 3H0GG 1HNWL 1RL2A 2RDFA 3RZDB 2QKIC 1ICWA 4K8JA 1WTRA 4PV1C 1H9KA 1LTSD 3S1NH 2SDFA 4DV3Q 2UUAL 2EJFC 4A3GH 5EAYA 3A8JE 4QGUA 1YIJA 2Q2HA 4C3JH 4GKJL 4LFBQ 1MJCA 3K58A 1C8CA 3TP6A 3TS2A 1ICFB 2L1BA 1XNQQ 1XMOQ 2EYHA 3CC7A 1AH9A 1SYFA 4MTNA 4H13C 5IOCA 2R3ZA 1S4ZA 2ES2A 4FNFA 4C56C 5IGBA 3E9HA 3SE0A 4IPCA 1Q86C 1VQJA 2DNEA 1AZQA 4XQNA 5M5YB 4N8FA 2TMPA 2Q8IB 2PZTA 3AYHB 1IBLQ 4NXML 4ID6A 4OWTB 4JBMA 3J81c 3ND9A 1A3UA 2HCCA 2K75A 4QIWE 3J7YW 4UP8A 3CKIB 2EJMA 4M1UB 2KCCA 2WAQE 4QUCA 1MSHA 3A7AB 4C1NK 2IW3A 5JVG3 2OCEA 1PH9A 4WRDA 1SJED 2WINB 5T1GA 5I9OA 1F9SA 4GKJQ 3K7AB 4IPGA 1TWCB 2LS01 4G7ZC 2YYZA 2F0LA 2HIVA 1HR0L 3NELA 1I4RA 3FKIG 3MTSA 5T1IA 3MA2B 1S5DD 3U50C 5KYIA 5AJ3L 1L2FA 4DV6L 2F03A 3J80E 4LF4Q 4A3EB 4NXMQ 5JEAH 4OELB 1BKBA 2L4NA 3GTGB 1EYAA 2F1MA 4DR6L 3K80C 4HR7B 4ILWA 5C3EH 5JPNC 2F3WA 4DNRB 1ASZA 3TP5A 3J81i 1LACA 5KEEA 1SJHD 1HRJA 5IYDH 1NR4A 1V1PA 3HKSA 1JC7A 2B39A 1WTOA 2WB1B 1O78A 1HR0Q 4BA2I 2PCFB 2F4IA 3I56A 1JWSD 3K59A 4BBSG 3OW2A 4QCLA 2JA5G 2B2WA 3HOXB 4CDDC 3PF5A 3EN2A 5AJ3Q 4DV6Q 2D0PA 4L6TB 1KL9A 5M3FB 3CAMA 4FVMA 2FHTA 2R93H 4IFDH 3DXJC 1RIPA 1K3BC 1EY9A 4OO1G 1Y8PB 1GUOA 2K6AA 2PQAA 1D7QA 4A93B 5ISRA 1KRTA 1PTOD 3MC0B 1U0LA 3IAYA 1NR2A 1TXYA 4POFA 2JK8A 1H9RA 3VR4A 2EYJA 4B08A 3I4NB 1TWGB 5JAVA 4HJ9A 1E0BA 4LAAA 2A19A 2ZXOA 1EQRA 4HIKA 4MZ9A 2E75C 3CPFA 2K50A 5FKAC 4YHHQ 5EPJA 1JJGA 4J1MA 2MO1A 3BVZA 2AQ3B 2EPBA 5DAUA 1V1PB 2NVXH 4FP5D 2WFWA 5EGTA 4LFCL 1HQMC 4V0BA 4PZ6A 5C3WA 1HNZL 1TWFH 2RHSB 2NTSA 3EBEA 4GKKL 1BBUA 1I6VC 1S5ED 3I55A 3MAQA 4IQZA 4AQYL 1SXTA 3QOLA 1CHPD 1Y1VH 1CQFA 4HSPA 3BU2A 3TZUA 1BXTA 1I4QA 2GN5A 1AZPA 1IL2A 2EY6A 4JBKA 2J0TD 1II3A 4JOIA 1WCMG 4L5TA 5FO8B 1VQ8A 4LJZC 2ZT9C 3KLSX 4L5RC 2RDGA 4DU9A 3QG1A 2PI2A 1LABA 3M7GA 5C4XG 2SNSA 4HCSA 5CC4A 3AEVA 3OMGA 1ENFA 2CKZB 2C35B 4ZLTF 2B2UC 4K0KL 1GXDC 5C5MA 1HNZQ 2HQLA 4GKKQ 4KJOA 4KN4C 5BN3A 1STGA 3S17B 1TS2A 3BVMA 5DM63 4AQYQ 1V43A 2DY7A 1K0RA 3RZOB 5C0XJ 1HUNA 3K0XA 2ZTDA 1PZJD 4DK0A 4IALA 2DJGC 3UDGA 1DZ1A 3ONAB 4HIOA 3HKZG 1SMXA 2R7FA 2L5TA 4GLAC 1RD9D 2SEBD 1XPRA 3HOZG 2RHQB 3MFYA 2CVRA 2VQEL 4UDUC 1VQGA 3M3YH 4QL5A 4XYOA 1KC8C 4DNTB 4QIWB 2XTIA 5JJZA 4K0KQ 1W2BA 1SFOH 3IRBA 1HTLD 1OO9B 2VZAA 1S5CD 1CZWA 2WAQB 2H4OA 4BY7H 4IOCA 1BCPF 2Z8LA 3FMCA 1QOHA 3GTKB 2JEAI 3URYA 2LSSA 3BZCA 3H0GH 4YWLA 4BBRG 2EDGA 3FPUB 1S5FD 4AYBB 2ICIA 4TSSA 4ODGA 1O80A 5JVH3 4GN5A 2AWNA 4XYQA 3VYSA 2Y0SG 3PUVA 3E0JA 2E2JB 1EWIA 2R7ZG 4DV7L 4JYAL 1SN8A 2VQEQ 1VQIA 1SNPA 3HOVG 1JCKB 1JR0D 2IX0A 4HIMA 4DKAC 4XT3B 1YJ9A 3AQQA 3SK4A 4A76A 1VS0A 4JVZA 1L1OC 4IUPA 1K8GA 3HOUB 1N8RC 3H3VH 1SE8A 2IX1A 4HAEA 2OT2A 4A3IG 4A4IA 3S1QB 2M00A 3MEFA 1TS3A 1HZCA 2Q8RE 1HCZA 2Z6BA 3HOYB 4QJFA 4BBSB 1PYSB 1SNCA 4QUFA 1BCPB 2EVBA 3OIQA 2F0VA 3R2IA 1YI2A 1YJWA 1Y1WB 4JYAQ 4DV7Q 4KKUA 2WKDA 4HMIA 4XQJA 1C7YA 1ILQA 1PRTD 3FKIH 3UI2A 4LUZA 4K8IA 3NK9A 3KJOA 2AKWB 4CDFC 2NZ1D 2P5ZX 1X56A 2B63B 4NDXA 3OTOL 3PUYA 5EKIA 2ATWA 3OYYA 4ZK9B 1VQMA 2NYZD 4PQXA 3E3XA 2JA9A 2QW7A 2B8GA 1A8VA 2XSCA 3D8GA 4G4KA 1S40A 1PTOF 2E8GA 4LF8Q 2UXDL 1SE2A 3GO5A 1I6HB 4N9TA 3WDNA 2K32A 1X3QA 4JG2A 3S1MH 1E22A 1C48A 1ENCA 4RGOS 3J7AV 1B4OA 3BDCA 2KENA 3I4MG 1Y8OB 3L0OA 1B1ZA 3CPWA 4A3JG 1Q7YC 4GNXC 1CKNA 1YNJD 2K05A 4GLXA 3ULJA 2HD3A 3HFZB 4A3MG 3GTPB 2JA5H 1X6OA 3R2TA 1YHBA 1WOCA 1Z47A 3NTIA 5IGFA 3T56B 3OTOQ 3H6MA 1D5MC 1STEA 4R4IA 1EOVA 1Q8KA 4OHJA 4G57A 3J7A5 5IT9E 2UXDQ 1K8AC 1VQEA 4QMGA 5FLXE 3PO2B 2V1CC 3QIAA 3K5OA 4DR7L 2C9OA 2NN6G 2Z1CA 5M5WH 4OO1H 2JA6B 3BDOA 3C2PA 4X3SA 1O7YA 1QNKA 2L0CA 2Q2UA 3S1RH 3U4VA 1X9NA 2JP1A 3QR8A 3BDLA 2YV5A 1U4MA 4UP7A 2QDBA 1YNND 4QB4A 3G48A 1NBWA 5I6WA 3Q24A 3TSSA 5EKKA 4X62Q 3NQIA 2OF1A 4R8IA 4CHTB 1F9RA 5IT9c 4LWCA 2O5IC 5H1SE 3H3VI 2J7ZA 1CKNB 4FO2A 3S15H 3FPPA 2B2UA 3IFDA 5IODA 5FLMG 2ZM6L 1WFQA 2Z9HA 4DR7Q 1NE3A 2G5DA 1K8OA 4P73A 1M8AA 2F0KA 3CMEA 1IXRA 4CKCA 1WCMH 4F88A 4QQBX 3NWTA 4HSVA 4R8NA 1SE3A 3BYYB 4I65A 4CDEC 2MFIA 4A3BH 5CGKA 4BY1B 1JMCA 5C4XH 1V1QA 1U4PA 2RCNA 1Y69U 1I94L 1CA5A 1T5XD 2MP1A 1PTOH 1HA6A 1PFMA 1EYDA 2NBFA 2K5WA 1STNA 3EJIA 1H95A 4A3EG 4GS3A 2NWGA 3GTMH 3S2HH 5CMDA 1GUNA 1FJGL 2R7ZB 3T51B 1QUQB 1VQFA 4B9XA 2FMCA 2NTTA 1EIYB 4CJ0B 3OWEB 2D9UA 2KHSA 3RD4A 5KNCA 2KCTA 1Q1EA 3VR6A 4RH6A 2Z4HA 1BF4A 4A3DB 2D62A 5ELBA 5EPKA 2OQKA 2WIIB 1D8LA 2WB1G 2L55A 3HOZH 1I4XA 1L0YB 1I94Q 2EY1A 2UXBL 1T5EA 3S14B 1FYCA 1CK1A 3NBIA 3HOXG 2IPKD 3A0JA 4P2CB 4DK3C 4DK1A 4M8AA 2XRSD 1RTNA 5M3FG 4ZUJA 1JORA 1SYBA 4H44C 1PFNA 1EEFD 1FJGQ 1B7YB 2X6GA 1L1OA 2VQFL 3OWFA 3VYUA 1NTGA 2MO0A 2Q8TA 1JQYD 5BR8L 3I91A 4BBRH 2VUMB 3GDEA 2ASBA 4A93G 1CM9A 4X66L 3DLLA 4HEDA 2OTJA 1TT2A 3BYTB 1HJPA 2A8VA 5FO9B 3T1HL 1R9TB 3I4NG 4O2DA 1QVCA 2UXBQ 1MI2A 4DUZL 3HOVH 5ELDA 3GP7A 2F52A 4O1NA 2RBMA 4Y52H 2A69C 1K83B 1L0WA 3MHBA 4EQNA 1EFWA 2JA7B 1KABA 2ZTCA 4A3IH 1LTAD 3A8KE 4NMZA 4HIDA 3LGJA 1XNRL 3FDTA 4QF4A 5NUCA 4DV3L 3PIP3 1GO3E 2EJGC 2HQEA 3T4AC 4HJ8A 5BR8Q 3DM3A 4LFBL 3E0EA 5DM73 4X66Q 3STBD 2R6GA 3PMFA 3I70A 1ML0D 2A6ED 3DWPA 1L1OB 2NZHA 3T1HQ 1EZ6A 4ZKCB 2OXPA 4DUZQ 2K5QA 3CCJA 2NVTH 5JEAJ 1HH2P 1MIUA 1X3EA 3U4ZA 1X54A 1RHPA 5I6YA 1QJOA 4GNXA 1H9SB 1V8QA 2EYPA 3J81E 1HFNA 1S5BD 4J8QA 4LF9L 1XNRQ 1QVGA 3NSWA 1I50H 3SDZA 2JE6I 4KN7C 5JJIA 3WOEA 5HY6A 2RQXA 2E2HH 4R4TA 5E1FA 4C3IB 3NBHA 5M5XB 5LMNW 3I4MH 4AH6A 1GVPA 5D65A 3UE0A 1VQ9A 4A3JH 4RMFA 1LV9A 4LF4L 2B8FA 3CCVA 1SROA 4CKEA 4JI1L 4A3MH 3VR2A 2UU9L 4IN3A 2K7VA 4ZKBB
chains in the Genus database with same CATH topology
2RSOA 4IFDJ 3D4WA 1BCPD 2CW0D 1TKWB 2N55A 1IKLA 1B9MA 3QB3A 4ULLA 3SK6A 1A2UA 3K57A 1Q8IA 1ZYRC 2NN6H 2F0FA 3C46A 5J1ZA 1RKNA 5D3IB 5FK9C 1R4QB 2K01A 2QILA 1G8ZD 5EQ0A 3H91A 1SEBD 4HCEA 3J81L 2IX3A 3RMHA 4XTCS 1SNMA 4F7XA 1F9PA 1QCBD 2QEJC 1TR5A 5M3MB 1KNAA 4ABNA 3MEHA 3M4OB 2PW7A 4TQUS 5ELCA 3KLSA 1JE4A 2R61A 2A73B 4ZRZA 5EKLA 1GUGA 2A74C 5C44B 1WTWA 1CI3M 4K2KA 3MXNA 1SAPA 1KLUD 2EYOA 3T16A 1PLFA 4X3KA 5DEHA 1EY5A 1GHKA 1EY4A 1D6EC 1TS4A 1IW7D 1A6XA 5JPMC 4RGMA 5K5PA 1PTOC 4A3KB 4K6DA 1QE6A 2QF7A 2B2VC 3K0YA 2A68D 1ESFA 3HRZC 1RF2D 5EJWA 4RA8A 1QNUA 3NQTA 3J80L 4FF1A 2MGSA 3GTJB 5FOBB 3TP7A 1I3QB 5CV6A 4FF3A 1E2WA 2E74C 1LTRD 2JA8B 5CBAE 4K5VA 1MBYA 3OOCA 3K6OA 3KF8A 5TSSA 2CQAA 4RAUC 1TQOA 2PZUA 3SHLA 4FYDA 5BN5A 4ZQ3A 2BCOA 5C4ZA 2E2IB 2NN6I 4FXDA 1KTKA 1VF7A 1NCVA 2FMMA 1IYUA 3KLRA 2KJXA 2DNCA 3LWUA 1EL0A 4CJ2C 4KY6A 4EQPA 5D14A 3QWNA 3SVMA 3GTOB 2JSOA 3MZ5A 4Z9CB 3HGBA 4K14A 4WJWA 3DEPA 5I2XA 1SE4A 4XXEA 1ONLA 1D5ZC 2FFKB 4K5WA 3L3OC 1CA6A 3IFTA 2H1EA 2B2TC 3HZXA 1X3PA 1LTID 4GZYC 4XQQA 3CRLC 1Q12A 2FINB 2I07B 1MD2D 4RWSC 1JB3A 1NUCA 1XTCD 3EQLC 2BA1A 1EIHA 3T13A 5F2DA 4ME5A 5IGEA 3V96A 3VR5A 1IYVA 1IL8A 1D5XC 4EVOA 2HCIA 5C6AA 4C3HG 4FF2A 3M7NA 3GTLB 4Q0FA 1F2MA 2ICEC 1PFBA 4HTHA 3HG9A 4HN7A 4MHEA 4NW2A 1TVXA 3OSOA 1WVLA 3I4LA 5C3XA 3NHHA 4DGZA 1AN8A 2F0MA 3AMUA 3NUCA 2VXWA 3D31A 1HTPA 5J22A 1A3TA 1SMYD 3D6WA 1TWHB 1PZID 4G7HC 4KKTA 2BOSA 3TMEA 3M85A 1EY7A 5KIXA 3S9WA 1PRTC 5I9PA 3KUPA 3BG3A 2LMCB 1B44D 3X3NA 1F9QA 3OIPA 4KY5A 4DXGA 3PO3B 1Y8NB 1EOTA 1OXSC 1HA5A 3DEOA 3NXWA 2PPBC 1EZ8A 3HOWB 1SNOA 2BE5D 3MXUA 1G91A 5K36G 4ZAIA 4X3UA 2PMZB 1YNJC 5CV5A 3Q23A 2ENBA 4DXFA 1BBXC 1JOOA 2AQ2B 2JEBI 3H09A 3U9SA 1JWMD 3DHQA 3EA6A 3VR3A 3K5NA 1SYDA 4O42A 2K03A 3SR1A 3SK5A 4ZUIA 2KOLA 1PYWD 4KMUC 5CYUA 2BDOA 1LT5D 4C2MB 1SDFA 4A3FB 2X6LA 1KDCA 1G6ZA 3CHBD 1A3VA 1BOSA 3WOFA 1I4HA 1YNNC 5I4DA 4FXKC 1EY6A 4X3TA 3P20A 2O2LD 3X3MA 2XWBB 3LNNA 1B9NA 2N88A 5J39A 1CZGA 4C3IG 3KK7A 1AW7A 3S16B 1VMCA 3GTQB 1LT6D 1K8MA 1PXUA 2RKSA 1FNUA 4RGNA 4DAPA 5HGTA 5C4JB 4KTAA 4NP5A 2TSSA 2R92B 1TY0A 2A5HA 3I72A 1FD7D 3KBXA 3NWSA 1D1KA 3CQZB 2JYOA 1A15A 4TKOB 5C0XI 1CFMA 4F8MA 3SEBA 2DY8A 3U9OA 2K28A 4C3HB 5IT9L 3D4RA 2EYLA 1JICA 1G2SA 2F0HA 1WTVA 3D6CA 5FLXL 3S2DB 3TN2A 2F0UA 1WTPA 4U68A 1O7LA 1DOLA 4R9WA 1KNEA 2VB2X 4XDXA 3D4DA 3I8ZA 3ND8A 1GJXA 2VNUD 1HHVA 1D2BA 1HQRD 4EQOA 2SOBA 3TBIB 3ITPA 1EEID 3QJYA 2NVQB 5E3FA 2NVYB 4E6IA 2PYKA 2D2CC 5EBCA 2F3VA 3MXPA 2YU9B 3VA5A 1OXUA 2L9HA 3QO2A 1W6KA 4IUQA 1TIID 2IJ0A 4KHVA 4HMJA 1E2ZA 4Y7NB 2V4DA 4DAVA 1GHJA 4G7OC 2XWJB 4BA1I 1PDQA 1TWAB 2F0PA 4PMBA 3I90A 1MSGA 3G6JB 3LWEA 4IUNA 3HEJA 3BS1A 2XIWA 3MFGA 4B9WA 4BWGB 2EY5A 3DMUA 2AUKA 1RJTA 4FXGC 3H3VC 3S1NB 2A6HD 2NUCA 3ERQA 3ZYYX 2XRQD 2EXZA 4N9PA 4A3GB 3LX0A 1DYQA 2CHBD 4C3JB 1FGBD 3I73A 4K2LA 2B2YC 1V1OA 2A6EC 1KDBA 1EWCA 4RHSA 4OIKA 2KEEA 1NSNS 2MJ8A 2F0JA 3NP8A 1VMPA 2M2LA 1Q1BA 1VCIA 4MIUA 1F77A 1EQTA 2LKVA 3L7ZC 1EY0A 3MWYW 5IIFA 5AFWA 2EY2A 1B3AA 2K1BA 5K36H 2F0WA 1ET6A 4I7ZC 3PUZA 2L11A 3TDQA 2KQ3A 3P75A 4PMCA 1SYEA 3A55A 1R4PB 5LHY1 1CTMA 1BCPC 1HPCA 2CW0C 5C3EB 1W6JA 1ESRA 3P1HA 3DWQA 1QILA 3V05A 1A2TA 4WFN3 1BNZA 1F2YA 1GUTA 2J4XA 2XN9C 3HS0C 2L12A 5C0XG 4OGQC 1SSOA 2MHVA 5FO7B 1EYCA 1D1IA 3Q22A 4FF4A 1ZEQX 1DOMA 2RSNA 1U4RA 1UNSA 3TZDA 1ZYRD 2IL8A 1RDPD 5G3LD 2R93B 3OHXC 2RA4A 5LL6S 1BR9A 5LL6X 4CJ1B 1SBBB 2F0EA 2BDNA 5BN4A 4LK1C 3SK8A 1KAAA 1EU3A 3AB9A 2EZVA 1PZKD 3HP3A 3GD7A 5IGCA 4IUVA 1EU4A 2NVXB 4H0LC 2QCPX 2F0IA 1F2ZA 5EPLA 4K6LA 1EY8A 1TWFB 2I46A 4IURA 1GOZA 5CBEE 4RCNA 1IW7C 4RCOA 1C4QA 3GV3A 1SYGA 3RLFA 1Y1VB 1MGSA 2XNAC 3O13A 1STHA 2EE1A 2A68C 4KK7A 1H9JA 3M4YA 2EYFA 4L63B 4TRDA 3RUZA 2ID0A 2HUGA 2JXMB 5IGGA 3JAME 5DNFA 2Z4IA 1XYIA 1LTTD 1LT4D 1VDZA 3C3LA 3I3CA 5CV8A 4KD4A 2O5JC 3V2TA 1FNWA 2VB3X 1GUSA 2F0GA 4IZ8A 1BQQT 2AQ1B 2NB0A 1LLRD 2DN8A 5CV7A 1OXTA 2EYMA 3OPOA 1B2TA 1DM0B 4H7BA 1BO0A 2HDMA 5M9OA 3M3YB 4RGTA 2ZXRA 1SFOB 1B50A 4CGYB 1F2LA 3NE5B 2B2YA 1ENAA 4BY7B 3QOJA 2G9HD 2M9VA 4NKLA 3PUXA 2KVMA 1QG7A 3H0GB 3TP8A 1O7ZA 1BDOA 1X32A 1DXMA 5E4WC 2KUMA 5CR3A 1SNDA 5E4XA 4EGVA 1IHZA 5CV9A 2F0SA 2EOTA 3DM1A 1QWYA 2AWOA 1SYCA 3JAML 3GV6A 4KD3A 4KY7A 4OL7A 1E2VA 3C1FA 2E2DC 1Z7TA 1ZXTA 3A7LA 3IL8A 3K5MA 4CKBA 2K04A 2KA7A 3MXGA 1STAA 3A56A 2MUYA 1RTOA 1EWHA 4JK1C 4IFDI 4S3SA 1KDAA 4RKBA 3FKIB 3D3RA 1LTBD 1IKMA 1HUMA 5G3LF 1Z6HA 3R8BA 3G7LA 2X69A 5CV4A 3CRKC 3VA7A 2F0QA 2F0TA 3C1EA 1JWUD 1AP0A 3S1MB 2D5DA 1JOKA 1SMYC 1WD0A 3DWAA 1EFID 4ZYSA 5HURA 5D3DA 5C0XH 1PMRA 1TY2A 1WTQA 3VYTA 2GA4B 2JA5B 4C1NI 1NAPA 2OEOA 1DCZA 1TS5A 5ELFA 5JOBA 1I4GA 3N6RA 3W3AA 4WORA 1I4PA 5C4HA 4OIJA 1KLGD 1RCVD 4UAIA 2PNRC 2XVSA 1SNQA 5KYLA 5M5WB 1TU2B 2BE5C 3S1RB 1OXXK 2PW5A 5KNBA 1LO5D 3A8IE 2HDLA 5KGUA 4K5XA 2B2VA 1J9OA 1ET9A 4LMQD 1G291 5KRUA 4C3JG 2K33A 4L8JA 4U673 3H94A 2C5CA 2O4XA 4DAYA 3IKJA 3SXHA 1QB5D 2K5DA 4DN4M 3S15B 1DONA 5A2QE 1LT3D 2KEDA 3NTHA 2SNMA 1STYA 5ELEA 4XT1B 1CT1D 5C5LA 1WCMB 3J7AF 3PV0A 4KV6A 1L0XB 3AU7A 2AUJD 3OMCA 4A3BB 3EFXD 1U9RA 5C4XB 4YIJA 4IUTA 3BVGA 4MN3A 4RKLA 1WTXA 1H9MA 1PTOB 3R3OA 3DUZA 2IWHA 3R93A 1XXGA 5JEAG 3GTMB 2RDHA 3S2HB 1ILPA 1FNVA 4RHRA 3F2UA 2WV6D 3FRPB 2RVLA 2KECA 1AFPA 1FR3A 4Q5VA 5A35A 2B2TA 3HKZB 3HOZB 3T53B 1UUPA 5I2YA 3K5LA 2F0NA 5CORA 1XWEA 4KKSA 5A2QL 2WP8J 1VF5C 3OW7A 2WKCA 1UAPA 4IFDG 2PO4A 4BBRB 1G2TA 1LTGD 4F87A 3MVVA 2Y0SB 5EBDA 3BZDB 1Q90A 1M4VA 2B2WC 4V190 4KHZA 3L9AX 1Q3LA 3FVQA 4KJNA 3Q0AA 3HOVB 4BS9A 3NPPA 1OXVA 3GQBA 4DA2A 1GUWA 4XIGS 3KBGA 5IGDA 3PIO3 1HXYD 4A3IB 2G9DA 3VYRA 4J6HA 1WD1A 2MPMA 1AEXA 1CQVA 2F0DA 3P7JA 1HFGA 4OO1I 2E76C 1B53A 2IT1A 2NVTB 3FEWX 4CBVA 1UEAB 2LY7A 1H9SA 2PQEA 1PRTF 4PNYA 1U4LA 3NTKA 1I50B 2A6HC 1XX8A 1STBA 2A69D 4KI0A 3EROA 1JOQA 2E2HB 2KCNA 1J8IA 5KNDA 1CHQD 2LFNA 5COYA 3I4MB 1DD2A 1EQVA 4A3JB 3N52A 2ZXPA 4DF7A 3EVQA 2F0OA 3Q6SA 4A3MB 1RODA 2BA0A 3A54A 1ZKOA 4PMWA 4DFAA 2PZWA 3E5SA 4RFBA 1BUVT 2WACA 1DOKA 3CU7A 1EIGA 1DJRD 4JBWA 3E6ZX 3PUWA 1PRTB 2FJ2A 4IUUA 3W2DA 2RDFA 3RZDB 2QKIC 1ICWA 4K8JA 1WTRA 4PV1C 1H9KA 1LTSD 2SDFA 2EJFC 3A8JE 3K58A 1C8CA 3TP6A 2L1BA 2EYHA 1SYFA 4H13C 5IOCA 2R3ZA 1S4ZA 4FNFA 4C56C 5IGBA 3SE0A 2DNEA 1AZQA 4XQNA 5M5YB 2TMPA 2Q8IB 2PZTA 4ID6A 3ND9A 1A3UA 2HCCA 3J7YW 3CKIB 2EJMA 4M1UB 2KCCA 4QUCA 1MSHA 3A7AB 4C1NK 2IW3A 5JVG3 4WRDA 1SJED 2WINB 5T1GA 5I9OA 1F9SA 3K7AB 1TWCB 2LS01 4G7ZC 2YYZA 2F0LA 1I4RA 3MTSA 5T1IA 3MA2B 1S5DD 5KYIA 2F03A 3J80E 4A3EB 5JEAH 2L4NA 3GTGB 1EYAA 2F1MA 4HR7B 4ILWA 5JPNC 2F3WA 4DNRB 3TP5A 1LACA 5KEEA 1SJHD 1HRJA 1NR4A 1V1PA 1JC7A 2B39A 1WTOA 2WB1B 1O78A 4BA2I 2PCFB 2F4IA 1JWSD 3K59A 4QCLA 2B2WA 3HOXB 4L6TB 5M3FB 4FVMA 2FHTA 4IFDH 3DXJC 1EY9A 4OO1G 1Y8PB 1GUOA 2K6AA 4A93B 5ISRA 1PTOD 3MC0B 3IAYA 1NR2A 1H9RA 3VR4A 2EYJA 4B08A 3I4NB 1TWGB 5JAVA 1E0BA 4LAAA 2ZXOA 2E75C 5FKAC 5EPJA 4J1MA 5DAUA 3BVZA 2AQ3B 2EPBA 1V1PB 4FP5D 5EGTA 1HQMC 4V0BA 5C3WA 2NTSA 1I6VC 1S5ED 3MAQA 4IQZA 1SXTA 3QOLA 1CHPD 1CQFA 4HSPA 3TZUA 1BXTA 1I4QA 1AZPA 2EY6A 2J0TD 1II3A 5FO8B 4LJZC 2ZT9C 3KLSX 2RDGA 4DU9A 3QG1A 1LABA 3M7GA 2SNSA 4HCSA 5CC4A 3OMGA 1ENFA 4ZLTF 2B2UC 1GXDC 5C5MA 4KJOA 4KN4C 5BN3A 1STGA 3S17B 1TS2A 3BVMA 5DM63 1V43A 2DY7A 3RZOB 5C0XJ 1HUNA 1PZJD 4DK0A 4IALA 1DZ1A 3ONAB 2L5TA 1RD9D 2SEBD 3MFYA 2CVRA 4UDUC 4XYOA 4DNTB 4QIWB 5JJZA 1HTLD 1OO9B 1S5CD 1CZWA 2WAQB 2H4OA 1BCPF 2Z8LA 3FMCA 1QOHA 3GTKB 2JEAI 3URYA 2EDGA 3FPUB 1S5FD 4AYBB 2ICIA 4TSSA 4ODGA 1O80A 5JVH3 2AWNA 4XYQA 3VYSA 3PUVA 3E0JA 2E2JB 1SNPA 1JCKB 1JR0D 2IX0A 4XT3B 3SK4A 4IUPA 3HOUB 2IX1A 4HAEA 2OT2A 3S1QB 2M00A 1TS3A 2Q8RE 1HCZA 3HOYB 4BBSB 1SNCA 4QUFA 1BCPB 2EVBA 3OIQA 2F0VA 3R2IA 1Y1WB 4KKUA 2WKDA 4HMIA 4XQJA 1ILQA 1PRTD 3UI2A 4K8IA 3NK9A 2NZ1D 2B63B 4NDXA 3PUYA 5EKIA 4ZK9B 2NYZD 4PQXA 2B8GA 2XSCA 3D8GA 4G4KA 1PTOF 1SE2A 3GO5A 1I6HB 4N9TA 3WDNA 2K32A 1X3QA 1C48A 1ENCA 4RGOS 3J7AV 1B4OA 3BDCA 1Y8OB 1B1ZA 1YNJD 2K05A 3GTPB 3R2TA 1Z47A 3NTIA 5IGFA 3T56B 3H6MA 1D5MC 1STEA 4OHJA 4G57A 5IT9E 4QMGA 5FLXE 3PO2B 3QIAA 3K5OA 4OO1H 2C9OA 2NN6G 2Z1CA 2JA6B 3BDOA 3C2PA 4X3SA 1O7YA 1QNKA 2L0CA 2JP1A 3BDLA 1U4MA 2QDBA 1YNND 4QB4A 5I6WA 3Q24A 3TSSA 5EKKA 3NQIA 2OF1A 4R8IA 4CHTB 1F9RA 2O5IC 2J7ZA 4FO2A 3FPPA 2B2UA 3IFDA 5IODA 1K8OA 1M8AA 2F0KA 4CKCA 4F88A 3NWTA 4HSVA 4R8NA 1SE3A 3BYYB 4I65A 5CGKA 4BY1B 1U4PA 1Y69U 1CA5A 1T5XD 2MP1A 1PTOH 1HA6A 1PFMA 1EYDA 2NBFA 2K5WA 1STNA 3EJIA 2NWGA 5CMDA 1GUNA 2R7ZB 3T51B 4B9XA 2FMCA 2NTTA 4CJ0B 3OWEB 2D9UA 2KHSA 3RD4A 5KNCA 1Q1EA 3VR6A 4RH6A 2Z4HA 1BF4A 4A3DB 2D62A 5ELBA 5EPKA 2WIIB 2L55A 1I4XA 1L0YB 2EY1A 1T5EA 3S14B 1FYCA 1CK1A 3NBIA 2IPKD 4P2CB 4DK1A 4M8AA 2XRSD 1RTNA 1JORA 4ZUJA 1SYBA 4H44C 1PFNA 1EEFD 2X6GA 3OWFA 3VYUA 2Q8TA 1JQYD 3I91A 2VUMB 1CM9A 4HEDA 1TT2A 3BYTB 5FO9B 1R9TB 1MI2A 5ELDA 3GP7A 4O1NA 2RBMA 2A69C 1K83B 3MHBA 4EQNA 2JA7B 1KABA 1LTAD 3A8KE 4NMZA 3FDTA 4QF4A 5NUCA 3PIP3 2EJGC 2HQEA 3T4AC 5DM73 2R6GA 3PMFA 3I70A 1ML0D 2A6ED 3DWPA 1EZ6A 4ZKCB 2OXPA 2K5QA 5JEAJ 1RHPA 5I6YA 1QJOA 1H9SB 1V8QA 2EYPA 3J81E 1HFNA 1S5BD 4J8QA 3NSWA 3SDZA 2JE6I 4KN7C 3WOEA 2RQXA 5E1FA 4C3IB 3NBHA 5M5XB 5D65A 1LV9A 2B8FA 4CKEA 3VR2A 4IN3A 2K7VA 4ZKBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAE A;  4UAI A;  3I8Z A;  5COR A;  2RSO A;  4O42 A;  2K03 A;  3MWY W;  5EPL A;  2Q8T A;  2EOT A;  3DM1 A;  5COY A;  2MGS A;  3I91 A;  5AFW A;  4IUR A;  1HHV A;  2KOL A;  2N55 A;  5CBE E;  1CM9 A;  1B3A A;  4R8I A;  1IKL A;  3N52 A;  1PFB A;  4HED A;  1F9R A;  2Q8R E;  2L4N A;  3GV6 A;  4HCS A;  2K1B A;  3GV3 A;  2J7Z A;  1SDF A;  4QUF A;  3Q6S A;  4MHE A;  4NW2 A;  2HDL A;  1MGS A;  1ROD A;  2X6L A;  4ZLT F;  2B2U C;  5CBA E;  1G6Z A;  1TVX A;  2B2U A;  3IFD A;  2L11 A;  1ZXT A;  1J9O A;  2B2V A;  1WVL A;  4LMQ D;  2EE1 A;  1MI2 A;  3IL8 A;  2K04 A;  4RAU C;  2K01 A;  1HRJ A;  1NR4 A;  1ILQ A;  1G2T A;  5EQ0 A;  1DOK A;  4X3T A;  3UI2 A;  1WTO A;  1M8A A;  1EIG A;  2L9H A;  1RTO A;  2N88 A;  3QO2 A;  2DY7 A;  2NZ1 D;  3H91 A;  4IUQ A;  1NCV A;  2FMM A;  4DN4 M;  1ESR A;  1DON A;  1HUN A;  2B2W C;  1EL0 A;  2FJ2 A;  2VXW A;  4CJ2 C;  2B2W A;  1VMC A;  4HSV A;  3FDT A;  5EKI A;  2HUG A;  5D14 A;  4ZK9 B;  1Q3L A;  2KED A;  2NYZ D;  4IUU A;  5DNF A;  3SVM A;  1F9P A;  1BNZ A;  1ICW A;  1DZ1 A;  3ONA B;  1U4P A;  1WTR A;  1XYI A;  1CA5 A;  1KNA A;  3D6W A;  1PDQ A;  1GUW A;  2FHT A;  4XT1 B;  2MP1 A;  2SDF A;  1IKM A;  2L12 A;  1X3Q A;  1ML0 D;  1HA6 A;  3DEP A;  1PFM A;  3I3C A;  2CVR A;  1SSO A;  1HUM A;  3I90 A;  1C8C A;  1MSG A;  1B4O A;  3LWE A;  1JE4 A;  3KUP A;  4ZKC B;  5JJZ A;  2NWG A;  2L1B A;  3G7L A;  2FFK B;  2X69 A;  2XIW A;  3KBX A;  5CMD A;  1WD1 A;  1DOM A;  1RHP A;  2RSN A;  2K05 A;  1U4R A;  2MPM A;  1S4Z A;  2R3Z A;  2JYO A;  1A15 A;  1NR2 A;  3TZD A;  1CA6 A;  4IUT A;  1F9Q A;  1RJT A;  2IL8 A;  4MN3 A;  1AP0 A;  1B2T A;  2H1E A;  2B2T C;  1WTW A;  1HFN A;  1WTX A;  1AZQ A;  4CJ0 B;  2D9U A;  3P7J A;  1BO0 A;  2HDM A;  1SAP A;  1X3P A;  1HFG A;  1E0B A;  1PLF A;  1WD0 A;  1B53 A;  1EOT A;  2HCC A;  3R93 A;  1BF4 A;  4X3K A;  2RA4 A;  2DY8 A;  2K28 A;  3DEO A;  3FPU B;  5EPJ A;  5EPK A;  1B50 A;  1F2L A;  4CJ1 B;  2B2Y C;  2EPB A;  1O80 A;  2FIN B;  1JIC A;  2B2Y A;  1G2S A;  1ILP A;  2BDN A;  4QUC A;  1WTV A;  1G91 A;  1MSH A;  3F2U A;  4RWS C;  1WTQ A;  4OIK A;  3TN2 A;  2KEE A;  2MJ8 A;  2RVL A;  1NAP A;  2KEC A;  4ZAI A;  2KVM A;  1VMP A;  4X3U A;  5T1G A;  2M2L A;  1F9S A;  1WTP A;  1QG7 A;  4X3S A;  5D65 A;  1O7Y A;  1QE6 A;  1QNK A;  4U68 A;  1U4L A;  1EIH A;  2B2V C;  1LV9 A;  3HP3 A;  1BBX C;  1DOL A;  4R9W A;  2B2T A;  1O7Z A;  1RTN A;  1X32 A;  4XT3 B;  1XX8 A;  2JP1 A;  1IL8 A;  4IUV A;  5E4W C;  2KUM A;  1PFN A;  1KNE A;  1U4M A;  2HCI A;  3MTS A;  4OIJ A;  4RA8 A;  2X6G A;  4XDX A;  5EJW A;  4IUP A;  5T1I A;  1EQT A;  1AZP A;  5E4X A;  4ZKB B;  1J8I A; 
#chains in the Genus database with same CATH topology
 2RSO A;  4IFD J;  3D4W A;  1BCP D;  2CW0 D;  1TKW B;  3CP0 A;  2N55 A;  4LF9 Q;  1KXL A;  1IKL A;  1B9M A;  1WJJ A;  3QB3 A;  4ULL A;  2PI2 E;  2WAQ G;  4OXP A;  4DR4 L;  3SK6 A;  1A2U A;  3K57 A;  1Q8I A;  1UE7 A;  3CC2 A;  4RG1 A;  1ZYR C;  3KF6 B;  2NN6 H;  2F0F A;  3C46 A;  5J1Z A;  4JV5 L;  1RKN A;  5D3I B;  2OTL A;  2AHO B;  5FK9 C;  1R4Q B;  4AYB E;  2K01 A;  5L37 A;  2QIL A;  3RZD H;  1G8Z D;  5EQ0 A;  4AYB G;  1K3R A;  4JI1 Q;  3H91 A;  4DR1 L;  1SEB D;  2UU9 Q;  4HCE A;  1LTL A;  3J81 L;  1EQQ A;  3NBH B;  2IX3 A;  4N8X 1;  1N9W A;  3RMH A;  4XTC S;  1SNM A;  4F7X A;  2EQS A;  1F9P A;  3D0F A;  1QCB D;  2QEJ C;  1TR5 A;  5M3M B;  1KNA A;  4ABN A;  1PVO A;  4DR4 Q;  3MEH A;  5M5Y H;  3M4O B;  3HOU G;  5FLM H;  2PW7 A;  4TQU S;  4TVA B;  5ELC A;  3KLS A;  1JE4 A;  2R61 A;  2A73 B;  4JV5 Q;  2KBN A;  4ZRZ A;  5EKL A;  3HOY G;  1GUG A;  3KJP A;  2A74 C;  3PQI A;  5C44 B;  1WTW A;  4YHH L;  1CI3 M;  1S3O A;  3T1Y L;  4DR1 Q;  1T9H A;  2JN4 A;  1SAP A;  3MXN A;  1KLU D;  4K2K A;  3K7A H;  2EYO A;  3T16 A;  4CDC C;  1Y1W G;  1PLF A;  1TWC H;  1YNX A;  4X3K A;  5DEH A;  1EY5 A;  1GHK A;  1J5E L;  3F8T A;  1EY4 A;  1D6E C;  1TS4 A;  1YIT A;  1IW7 D;  1A6X A;  5JPM C;  4RGM A;  5K5P A;  4JI5 Q;  3F2D A;  4A3E H;  2B63 G;  1PTO C;  4A3K B;  4K6D A;  5GAE C;  1VQP A;  1PH6 A;  1QE6 A;  2MQH A;  2QF7 A;  2B2V C;  3K0Y A;  3W5O A;  3GTG H;  2A68 D;  1PYB A;  3J81 j;  1ESF A;  3HRZ C;  1RF2 D;  5EJW A;  4RA8 A;  4OX9 L;  1QNU A;  3NQT A;  1K73 C;  3J80 L;  3PSI A;  1U5K A;  2K5N A;  1MKH A;  4DPG A;  5IYC G;  4FF1 A;  3T1Y Q;  4FDB A;  2MGS A;  3GTJ B;  5FOB B;  3TP7 A;  1I3Q B;  1SLJ A;  2PMZ E;  5CV6 A;  4FF3 A;  3W1G A;  1E2W A;  4DV1 L;  1J5E Q;  2E74 C;  1LTR D;  2JA8 B;  1HZB A;  1UE5 A;  5CBA E;  4K5V A;  4ALP A;  1MJE A;  1MBY A;  3HOX H;  3OOC A;  3K6O A;  3KF8 A;  5TSS A;  2FXQ A;  2CQA A;  4RAU C;  1TQO A;  2PZU A;  3MXN B;  3SHL A;  4FYD A;  5BN5 A;  5IP7 G;  5M3F H;  4ZQ3 A;  2BCO A;  5C4Z A;  1X55 A;  2E2I B;  4R4C A;  2NN6 I;  4FXD A;  2ZTE A;  3ER0 A;  1KTK A;  1VF7 A;  3PO2 G;  1NCV A;  2FMM A;  1IYU A;  3KLR A;  4OX9 Q;  2KJX A;  2DNC A;  3LWU A;  1EL0 A;  2PQA B;  4CJ2 C;  1X3F A;  4KY6 A;  1QZH A;  4EQP A;  2JA6 G;  4A93 H;  5D14 A;  4UPA A;  3QWN A;  1A62 A;  3SVM A;  3VDY A;  3GTO B;  2JSO A;  3UE1 A;  3M9B A;  3JAM c;  3MZ5 A;  4Z9C B;  3HGB A;  5LMN L;  4K14 A;  4DV1 Q;  4WJW A;  3I4N H;  3DEP A;  5I2X A;  1SE4 A;  1TWG H;  2N78 A;  1KIX A;  3W1B A;  4XXE A;  1ONL A;  4JW0 A;  1D5Z C;  4GOP C;  2GVA A;  4NXN Q;  1NMG A;  2FFK B;  4K5W A;  3L3O C;  1CA6 A;  1N32 L;  3IFT A;  2H1E A;  2B2T C;  1YVC A;  1PHJ A;  2H5X A;  3HZX A;  1X3P A;  2I5H A;  1LTI D;  4GZY C;  4LF5 L;  4XQQ A;  1KQS A;  3KF8 B;  1UWV A;  3NEN A;  3CRL C;  3G71 A;  1Q12 A;  1VQK A;  2FIN B;  2I07 B;  1MD2 D;  4RWS C;  1JB3 A;  3I2Z A;  1NUC A;  1XTC D;  4B3R L;  5LMN Q;  4LF6 L;  2NZO A;  4PZ7 A;  3EQL C;  4A75 A;  1YEZ A;  2BA1 A;  1EIH A;  1SR3 A;  4BY1 G;  3T13 A;  5F2D A;  4ME5 A;  5IGE A;  3V96 A;  3VR5 A;  3JAM i;  4L5Q A;  1IYV A;  1IL8 A;  1D5X C;  4EVO A;  2HCI A;  5C6A A;  4C3H G;  1N32 Q;  3CCS A;  4FF2 A;  1UE6 A;  3KOJ A;  3M7N A;  3GTL B;  4Q0F A;  1F2M A;  4OWW B;  4IPH A;  2UUC L;  2F4V L;  2ICE C;  2A1A A;  4LF5 Q;  1PFB A;  3S17 H;  1PFS A;  3ULP A;  4HTH A;  3HG9 A;  4O0A A;  2B3G A;  4HN7 A;  2IY5 B;  2L15 A;  4MHE A;  4NW2 A;  3RZO H;  1TVX A;  3OSO A;  1WVL A;  3I4L A;  4B3R Q;  4LF6 Q;  4A3D G;  5C3X A;  2EXD A;  4DV4 L;  2CWA A;  4R1J A;  3NHH A;  4DGZ A;  1AN8 A;  2F0M A;  3AMU A;  3TRZ A;  4LF8 L;  3NUC A;  2VXW A;  3D31 A;  1HTP A;  3KLW A;  5J22 A;  1A3T A;  1KAW A;  2UUC Q;  2F4V Q;  1SMY D;  2Z6K C;  3D6W A;  1TWH B;  4DR5 L;  4X65 Q;  1PZI D;  3GTK H;  4G7H C;  4KKT A;  2BOS A;  3TME A;  3M85 A;  1EY7 A;  2VL6 A;  5KIX A;  3S9W A;  1PRT C;  2QGQ A;  3KUP A;  5I9P A;  1W3S A;  2VUM G;  3BG3 A;  5J3B A;  2LMC B;  1B44 D;  4DV4 Q;  3X3N A;  1F9Q A;  2BH2 A;  2VY3 A;  2E2J H;  3I7F A;  3OIP A;  3K81 C;  4KY5 A;  4DXG A;  1YJN A;  1B70 B;  3PO3 B;  1Y8N B;  1PH7 A;  3FP9 A;  1EOT A;  1OXS C;  1HA5 A;  3DEO A;  3NXW A;  2PPB C;  1EZ8 A;  3HOW B;  1YZ6 A;  1SNO A;  2BE5 D;  3MXU A;  4QY7 A;  3J7Z C;  1N33 Q;  2JA7 G;  3HOU H;  5K36 G;  1G91 A;  4DR5 Q;  3JC6 6;  2VW9 A;  4LW1 A;  3S1Q H;  1UE1 A;  2E5L Q;  4ZAI A;  4X3U A;  4DNI A;  2N3S A;  2PMZ B;  3RNU A;  1YNJ C;  5CV5 A;  4DK6 C;  3CCL A;  3Q23 A;  2ENB A;  2LXK A;  4DXF A;  1JOO A;  1BBX C;  3HOY H;  4BBS H;  2AQ2 B;  2JEB I;  4X62 L;  3H09 A;  3U9S A;  1JWM D;  3DHQ A;  3EA6 A;  3VR3 A;  3K5N A;  2ZJR A;  1XMQ L;  1SYD A;  1Y1W H;  2R7D A;  4O42 A;  2K03 A;  3SR1 A;  3SK5 A;  4ZUI A;  2KOL A;  1PYW D;  5FJ8 G;  4KMU C;  5CYU A;  2BDO A;  1LT5 D;  4DR3 L;  4P72 A;  4C2M B;  1SDF A;  5HGQ A;  4A3F B;  2X6L A;  1KDC A;  4JI0 L;  1G6Z A;  2B63 H;  2KHJ A;  3RR5 A;  5IY0 A;  3CHB D;  1A3V A;  1BOS A;  3WOF A;  1I4H A;  1YNN C;  5I4D A;  1PA6 A;  4FXK C;  1EY6 A;  4X3T A;  1I6H H;  3P20 A;  1XJV A;  2O2L D;  3X3M A;  2XWB B;  3LNN A;  1B9N A;  2N88 A;  5J39 A;  1CZG A;  2HHH L;  1SRU A;  4C3I G;  3KK7 A;  1AW7 A;  5IYC H;  1VMC A;  3GTQ B;  3S16 B;  1LT6 D;  1K8M A;  4OEM B;  1XMQ Q;  1GD7 A;  1PXU A;  2RKS A;  1FNU A;  4RGN A;  4DAP A;  1JB7 A;  5HGT A;  5C4J B;  3CC4 A;  4DR3 Q;  4KTA A;  4UHV A;  4NP5 A;  2TSS A;  2R92 B;  1Z9F A;  1TY0 A;  2A5H A;  4JI0 Q;  3I72 A;  1FD7 D;  4MNO A;  3M4P A;  5IP7 H;  3KBX A;  3NWS A;  3CQZ B;  1D1K A;  2JYO A;  1A15 A;  2UXC Q;  4JCV E;  3PO2 H;  4LFA L;  4TKO B;  4POG A;  5C0X I;  3H15 A;  2HHH Q;  2JA6 H;  1VQN A;  3RN2 A;  1CFM A;  4F8M A;  2CQO A;  1E7Z A;  3SEB A;  2DY8 A;  2DUD A;  3U9O A;  2K28 A;  4C3H B;  1VQD A;  5IT9 L;  1MHW C;  3D4R A;  2EYL A;  1JIC A;  4UY8 C;  1G2S A;  2F0H A;  1WTV A;  3D6C A;  5FLX L;  3S2D B;  3TN2 A;  1PH1 A;  2F0U A;  2CCZ A;  3F2C A;  4JI3 L;  1WTP A;  4U68 A;  1O7L A;  1DOL A;  4R9W A;  3UDX A;  5M3M G;  4OON A;  4APV A;  1KNE A;  2VB2 X;  4XDX A;  3D4D A;  4LFA Q;  3I8Z A;  1VQO A;  3ND8 A;  1Y14 B;  1GJX A;  3L2P A;  2VNU D;  1HHV A;  4JI2 L;  1D2B A;  1FGU A;  1HQR D;  4JI7 Q;  1ASY A;  4EQO A;  2SOB A;  4MTK A;  3TBI B;  4LF7 L;  3ITP A;  1EEI D;  2CWP A;  2Z0S A;  5C44 G;  1XTD A;  4AIM A;  2K5V A;  3QJY A;  3ICE A;  2NVQ B;  5E3F A;  2NVY B;  4E6I A;  4BY1 H;  2PYK A;  2D2C C;  5EBC A;  2F3V A;  4EQ5 A;  2Q2I A;  3MXP A;  2YU9 B;  4JI3 Q;  3VA5 A;  1LUZ A;  1OXU A;  4GLV B;  4P75 A;  2L9H A;  3QO2 A;  1W6K A;  3SGI A;  4YCW A;  2GVB A;  4IUQ A;  4HJ5 A;  1TII D;  4JI8 L;  2IJ0 A;  4A3K G;  2ZJQ A;  4KHV A;  4HMJ A;  1Y1V G;  1E2Z A;  4Y7N B;  2V4D A;  4DAV A;  4JI2 Q;  1GHJ A;  2YTX A;  2R7Z H;  4G7O C;  2XWJ B;  4BA1 I;  1PDQ A;  4P74 A;  3F2B A;  4LF7 Q;  1TWA B;  2PNH A;  4PZ8 A;  2F0P A;  2UUB Q;  4PMB A;  3I90 A;  1MSG A;  3BJU A;  3G6J B;  3LWE A;  4A3D H;  3ERS X;  4IUN A;  3HEJ A;  3BS1 A;  2XIW A;  3MFG A;  5IE8 A;  4B9W A;  4BWG B;  2EY5 A;  3DMU A;  2AUK A;  1RJT A;  4FXG C;  5ELO A;  3H3V C;  3S14 H;  3S1N B;  2A6H D;  2JA8 G;  2NUC A;  3ERQ A;  3ZYY X;  2XRQ D;  2EXZ A;  4N9P A;  4A3G B;  3LX0 A;  1DYQ A;  2CHB D;  4JI8 Q;  4C3J B;  1FGB D;  3STB C;  4DR2 Q;  3I73 A;  4K2L A;  2B2Y C;  1JJC B;  1V1O A;  4A3C G;  2A6E C;  1KDB A;  1EWC A;  3AFQ A;  4RHS A;  4OIK A;  5ELN A;  4IJL A;  2ALY B;  2KEE A;  1NSN S;  2MJ8 A;  2F0J A;  3NP8 A;  1VMP A;  2VUM H;  2M2L A;  4YY3 Q;  5IYB G;  1Q1B A;  1VCI A;  4MIU A;  1PH3 A;  4JI4 L;  3CCE A;  1R9T H;  3PIP A;  1F77 A;  1EQT A;  1PH2 A;  2LKV A;  3L7Z C;  1AE3 A;  1EY0 A;  3MWY W;  5IIF A;  5AFW A;  4L5S A;  1K83 H;  1KHI A;  2EY2 A;  1B3A A;  3Q8D A;  2K1B A;  1GKH A;  5K36 H;  2F0W A;  2JA7 H;  1J6Q A;  1ET6 A;  4I7Z C;  3PUZ A;  1I5F A;  2L11 A;  2F3I A;  3TDQ A;  1CKO A;  2KQ3 A;  4B3M L;  3P75 A;  2KHI A;  3PF4 A;  4PMC A;  1SYE A;  2K52 A;  3A55 A;  1IBK Q;  1R4P B;  5LHY 1;  1CTM A;  1BCP C;  1HPC A;  2CW0 C;  4JI4 Q;  3TRE A;  1W6J A;  1ESR A;  1LYL A;  3P1H A;  5C3E B;  3DWQ A;  1QIL A;  3V05 A;  3RLO A;  1VQH A;  1A2T A;  5FJ8 H;  2ZJP A;  4GNX B;  4WFN 3;  3FHW A;  1BNZ A;  1PH5 A;  1F2Y A;  1CSP A;  1GUT A;  2J4X A;  2XN9 C;  2CH4 A;  1P16 A;  3HS0 C;  2L12 A;  2IHF A;  5C0X G;  1VQ6 A;  1HNX L;  4OGQ C;  1HNW Q;  1SSO A;  2MHV A;  5FO7 B;  1X65 A;  1EYC A;  1D1I A;  3Q22 A;  4FF4 A;  2UUA Q;  4GN3 B;  1ZEQ X;  1DOM A;  3U58 A;  4B3M Q;  2RSN A;  1U4R A;  1UNS A;  3TZD A;  3CCM A;  1DGS A;  1ZYR D;  2IL8 A;  1RDP D;  4C3I H;  4YCV A;  1XPO A;  5M5X H;  5G3L D;  2R93 B;  3OHX C;  2RA4 A;  4JI5 L;  5LL6 S;  4DV5 L;  1BR9 A;  3BZK A;  5LL6 X;  4CJ1 B;  1QVF A;  1SBB B;  2F0E A;  2BDN A;  2RCF A;  5BN4 A;  4LK1 C;  4B3T L;  3SK8 A;  4LUV A;  1KAA A;  1EU3 A;  4JI6 L;  1HNX Q;  2XGT A;  3AB9 A;  2EZV A;  1VQ7 A;  1PZK D;  3HP3 A;  3GD7 A;  5IGC A;  5GAD C;  4IUV A;  1EU4 A;  3TQY A;  2NVX B;  4H0L C;  2I0Q A;  2QCP X;  1V9P A;  2F0I A;  1F2Z A;  5EPL A;  4K6L A;  1EY8 A;  1TWF B;  2I46 A;  4IUR A;  1VQ5 A;  1GOZ A;  5CBE E;  4RCN A;  1IW7 C;  1NY4 A;  3J80 c;  2OQ0 A;  4RCO A;  4GN4 B;  4DV5 Q;  4WJ4 A;  1C4Q A;  3GV3 A;  1SYG A;  3RLF A;  1Y1V B;  1YBY A;  3ULL A;  2JJQ A;  1MGS A;  2XNA C;  3O13 A;  1STH A;  4B3T Q;  3PO3 G;  2EE1 A;  4HJA A;  2A68 C;  1S72 A;  4JI6 Q;  4DR6 Q;  1A63 A;  5M3M H;  4KK7 A;  2BH8 A;  1QZG A;  1KRS A;  1H9J A;  3M4Y A;  3M4O H;  3HOW G;  2EYF A;  4L63 B;  4TRD A;  3RUZ A;  2ID0 A;  2HUG A;  2JXM B;  5IGG A;  3JAM E;  2RF4 A;  5DNF A;  1EUJ A;  3CCU A;  3PGZ A;  4IO9 A;  3F1Z A;  2Z4I A;  1XYI A;  4NXN L;  1LTT D;  5C44 H;  1LT4 D;  5DLQ E;  1VDZ A;  3C3L A;  3I3C A;  5CV8 A;  4KD4 A;  2O5J C;  3V2T A;  1FNW A;  2VB3 X;  4NB3 A;  1GUS A;  2F0G A;  4IZ8 A;  1BQQ T;  2AQ1 B;  3J80 i;  2NB0 A;  3E9I A;  1LLR D;  2DN8 A;  1FVI A;  5CV7 A;  1OXT A;  1PH8 A;  3I4O A;  1XPU A;  3B6Y A;  2EYM A;  3OPO A;  4A3F G;  1DM0 B;  1B2T A;  1P8L A;  4H7B A;  2IHE A;  1NJI C;  4A3K H;  1BO0 A;  2HDM A;  5M9O A;  3M3Y B;  4KLK A;  4RGT A;  2ZXR A;  1SFO B;  1B50 A;  4CGY B;  1F2L A;  3NE5 B;  2B2Y A;  1ENA A;  4BY7 B;  4A3B G;  3QOJ A;  3WWV A;  2G9H D;  2M9V A;  1VQL A;  4NKL A;  3PUX A;  2YTV A;  2KVM A;  3GTJ H;  1QG7 A;  1I3Q H;  4LFC Q;  3H0G B;  3TP8 A;  1O7Z A;  1BDO A;  1X32 A;  1DXM A;  5E4W C;  2KUM A;  5CR3 A;  1SND A;  2JA8 H;  4P71 A;  5E4X A;  2R92 G;  4EGV A;  1IHZ A;  4OWX B;  5CV9 A;  2F0S A;  1BVS A;  3K7U C;  4UP9 A;  2EOT A;  3DM1 A;  1QWY A;  2AWO A;  2E2I H;  4A3C H;  1SYC A;  3JAM L;  3GV6 A;  4KD3 A;  3HKZ E;  4KY7 A;  4OL7 A;  1E2V A;  3C1F A;  2E2D C;  1Z7T A;  1ZXT A;  3A7L A;  3IL8 A;  3K5M A;  4CKB A;  5IYB H;  2K04 A;  3GTO H;  1A0I A;  1JT8 A;  2KA7 A;  3MXG A;  1STA A;  3A56 A;  1KD1 C;  2MUY A;  4J15 A;  4X64 L;  1RTO A;  1EWH A;  4JK1 C;  3S24 A;  3EIV A;  4IFD I;  4X65 L;  4S3S A;  1KDA A;  4JBJ A;  4RKB A;  1X3G A;  3FKI B;  3D3R A;  1LTB D;  1IKM A;  1IBM L;  1VQ4 A;  1CKM A;  2Y0S E;  1HUM A;  5G3L F;  1K0S A;  1EYG A;  1Z6H A;  2JQO A;  3R8B A;  3CW2 C;  4DAM A;  3G7L A;  2X69 A;  5CV4 A;  4NPS A;  4JC0 A;  4BXX G;  3CRK C;  1E1O A;  2F0Q A;  3VA7 A;  2F0T A;  3C1E A;  1JWU D;  1AP0 A;  4X64 Q;  4I7A A;  4LNQ A;  3S1M B;  4LUO A;  2D5D A;  1JOK A;  1SMY C;  1N33 L;  1WD0 A;  1N36 L;  3DWA A;  1EFI D;  4ZYS A;  4DUY L;  5HUR A;  2E5L L;  1IZ6 A;  3KDF A;  5D3D A;  1LM0 A;  3CXC A;  5C0X H;  1PMR A;  3NEM A;  1N34 L;  1TY2 A;  1WTQ A;  3VYT A;  2GA4 B;  1B3Q A;  1IBM Q;  2JA5 B;  4C1N I;  1NAP A;  3GTL H;  2OEO A;  1DCZ A;  1TS5 A;  1YHQ A;  5ELF A;  1WYD A;  5JOB A;  5IP9 G;  1I4G A;  3N6R A;  3W3A A;  4WOR A;  1I4P A;  1E1T A;  3PCO B;  4OIJ A;  5C4H A;  1KLG D;  1RCV D;  4UAI A;  1HZ9 A;  2PNR C;  2XVS A;  1SNQ A;  2OWO A;  5KYL A;  3G6E A;  2K14 A;  5M5W B;  4A3L G;  1CSQ A;  1TU2 B;  2BE5 C;  3G4S A;  3S1R B;  1N36 Q;  1OXX K;  2PW5 A;  5KNB A;  4DUY Q;  1O7I A;  1LO5 D;  1C0A A;  2K5H A;  3A8I E;  2HDL A;  5KGU A;  4K5X A;  4PG3 A;  4A3G G;  1N34 Q;  2B2V A;  1J9O A;  1ET9 A;  4LMQ D;  1G29 1;  5KRU A;  2I5L X;  4C3J G;  4WJ3 M;  2K33 A;  2HIX A;  1OTC A;  4L8J A;  1YHA A;  4U67 3;  1Q81 C;  1E24 A;  3CF5 A;  2QDL A;  2C5C A;  1TWH H;  2O4X A;  3H94 A;  4DAY A;  3IKJ A;  3KDF B;  1NNX A;  3SXH A;  1QB5 D;  2K5D A;  5GAH C;  4H02 A;  4DN4 M;  3S15 B;  1DON A;  5A2Q E;  1FL0 A;  3M4Q A;  1LT3 D;  1VQA A;  2KED A;  3NTH A;  2SNM A;  1STY A;  5ELE A;  4YWM A;  3KYH C;  4XT1 B;  1CT1 D;  5GAG C;  5C5L A;  3A5U A;  1WCM B;  3PO3 H;  1EIF A;  3J7A F;  2UXC L;  2I5M X;  5IWA L;  1BBW A;  3PV0 A;  4KV6 A;  1L0X B;  3AU7 A;  2AUJ D;  3OMC A;  4YWK A;  3EFX D;  2CH4 W;  4A3B B;  2EIF A;  1U9R A;  5C4X B;  4IPD A;  3HOW H;  4YIJ A;  3TS0 A;  4IUT A;  5GQO A;  3BVG A;  4MN3 A;  5GRO A;  4RKL A;  1WTX A;  1H9M A;  1PTO B;  3R3O A;  3DUZ A;  2MNA A;  2CFM A;  2IWH A;  1VQC A;  3R93 A;  1XXG A;  5JEA G;  3GTM B;  3GTP H;  2RDH A;  3S2H B;  1E3P A;  1ILP A;  1FNV A;  4RHR A;  3F2U A;  2WV6 D;  4DAY B;  4GOP A;  1QUQ A;  5C3E G;  3FRP B;  2RVL A;  4DV0 L;  2KEC A;  1JJ2 A;  2DGY A;  1AFP A;  5FLX c;  1FR3 A;  5IWA Q;  4Q5V A;  5A35 A;  5IYD G;  1G6P A;  2B2T A;  3HKZ B;  4C2M H;  4A3F H;  1B8A A;  4R4O A;  4JI7 L;  3HOZ B;  3T53 B;  5JJK A;  1UUP A;  5I2Y A;  3K5L A;  2F0N A;  2YTY A;  5COR A;  1XWE A;  4KKS A;  5A2Q L;  2WP8 J;  1VF5 C;  3OW7 A;  2AMC B;  2WKC A;  1UAP A;  3S16 H;  3GTQ H;  2R93 G;  4IFD G;  2PO4 A;  4DV0 Q;  2K4K A;  4BBR B;  1G2T A;  1JE5 A;  5C4J H;  1UEB A;  4IOA A;  1LTG D;  4F87 A;  2ZM6 Q;  3MVV A;  2N49 A;  2Y0S B;  5EBD A;  1Q82 C;  3BZD B;  1HR0 W;  2R92 H;  1Q90 A;  4ME3 A;  1M90 C;  1M4V A;  2B2W C;  4V19 0;  4GOP B;  5LMU L;  4KHZ A;  3L9A X;  1Q3L A;  3FVQ A;  4KJN A;  3Q0A A;  3HOV B;  3ZJY C;  5E7N A;  2UUB L;  3CQZ H;  3UDI A;  4BS9 A;  3NPP A;  1OXV A;  4JPB W;  3GQB A;  4DA2 A;  1AE2 A;  1GUW A;  4IJH A;  2WB1 E;  4XIG S;  3KBG A;  3TEH B;  5IGD A;  3PIO 3;  1HXY D;  2KCM A;  3A74 A;  4A3I B;  2G9D A;  2QA4 A;  3VYR A;  4J6H A;  3RN5 A;  4C3H H;  1C9O A;  1WD1 A;  2MPM A;  1AEX A;  3CCQ A;  2DJF C;  3S2D H;  4DR2 L;  2D0O A;  1CQV A;  2F0D A;  3P7J A;  4DV2 L;  2Z6K A;  1HFG A;  4OO1 I;  1PV4 A;  2E76 C;  4X6A H;  1B53 A;  5LMU Q;  2IT1 A;  4YCU A;  1PH4 A;  2B29 A;  3RLN A;  2NVT B;  3FEW X;  3CD6 A;  4CBV A;  5JJL A;  4YY3 L;  3UDF A;  1UEA B;  4R4Q A;  2LY7 A;  1H9S A;  2PQE A;  2HT1 A;  3PIO A;  1PRT F;  2N8N A;  4PNY A;  1U4L A;  3NTK A;  1I50 B;  4BXX H;  1NMF A;  1G51 A;  2A6H C;  3AFP A;  4KHP L;  1XX8 A;  1STB A;  2A69 D;  4KI0 A;  3ERO A;  1JOQ A;  4JOI C;  2E2H B;  2KCN A;  1J8I A;  1HZA A;  4B3S L;  1WTH A;  2NVQ H;  5KND A;  2NVY H;  1CHQ D;  2LFN A;  5COY A;  1CUK A;  3I4M B;  1EQV A;  2YU9 H;  3CCR A;  1DD2 A;  4DV2 Q;  1K9M C;  4A3J B;  3N52 A;  1IYJ B;  2ZXP A;  2VQF Q;  4HJ7 A;  4DF7 A;  2LXJ A;  4ZCK A;  3EVQ A;  2F0O A;  3CMA A;  3Q6S A;  2VS1 A;  4A3M B;  2Q2T A;  1ROD A;  2BA0 A;  3A54 A;  1ZKO A;  4PMW A;  4DFA A;  2PZW A;  1IBK L;  3E5S A;  1XNQ L;  4Y7N H;  1XMO L;  4RFB A;  5IP9 H;  1BUV T;  4EX5 A;  2WAC A;  1K28 A;  1DOK A;  1M1K C;  3CU7 A;  3KFU A;  2QEX A;  1EIG A;  4KHP Q;  4BY7 G;  1DJR D;  1TWA H;  4JBW A;  1VQB A;  3E6Z X;  3K8A A;  1IBL L;  3PUW A;  1Q46 A;  1WI5 A;  3A5Z B;  1PRT B;  2FJ2 A;  4A3L H;  1GM5 A;  4B3S Q;  3KF6 A;  4IUU A;  3W2D A;  3H0G G;  1HNW L;  1RL2 A;  2RDF A;  3RZD B;  2QKI C;  1ICW A;  4K8J A;  1WTR A;  4PV1 C;  1H9K A;  1LTS D;  3S1N H;  2SDF A;  4DV3 Q;  2UUA L;  2EJF C;  4A3G H;  5EAY A;  3A8J E;  4QGU A;  1YIJ A;  2Q2H A;  4C3J H;  4GKJ L;  4LFB Q;  1MJC A;  3K58 A;  1C8C A;  3TP6 A;  3TS2 A;  1ICF B;  2L1B A;  1XNQ Q;  1XMO Q;  2EYH A;  3CC7 A;  1AH9 A;  1SYF A;  4MTN A;  4H13 C;  5IOC A;  2R3Z A;  1S4Z A;  2ES2 A;  4FNF A;  4C56 C;  5IGB A;  3E9H A;  3SE0 A;  4IPC A;  1Q86 C;  1VQJ A;  2DNE A;  1AZQ A;  4XQN A;  5M5Y B;  4N8F A;  2TMP A;  2Q8I B;  2PZT A;  3AYH B;  1IBL Q;  4NXM L;  4ID6 A;  4OWT B;  4JBM A;  3J81 c;  3ND9 A;  1A3U A;  2HCC A;  2K75 A;  4QIW E;  3J7Y W;  4UP8 A;  3CKI B;  2EJM A;  4M1U B;  2KCC A;  2WAQ E;  4QUC A;  1MSH A;  3A7A B;  4C1N K;  2IW3 A;  5JVG 3;  2OCE A;  1PH9 A;  4WRD A;  1SJE D;  2WIN B;  5T1G A;  5I9O A;  1F9S A;  4GKJ Q;  3K7A B;  4IPG A;  1TWC B;  2LS0 1;  4G7Z C;  2YYZ A;  2F0L A;  2HIV A;  1HR0 L;  3NEL A;  1I4R A;  3FKI G;  3MTS A;  5T1I A;  3MA2 B;  1S5D D;  3U50 C;  5KYI A;  5AJ3 L;  1L2F A;  4DV6 L;  2F03 A;  3J80 E;  4LF4 Q;  4A3E B;  4NXM Q;  5JEA H;  4OEL B;  1BKB A;  2L4N A;  3GTG B;  1EYA A;  2F1M A;  4DR6 L;  3K80 C;  4HR7 B;  4ILW A;  5C3E H;  5JPN C;  2F3W A;  4DNR B;  1ASZ A;  3TP5 A;  3J81 i;  1LAC A;  5KEE A;  1SJH D;  1HRJ A;  5IYD H;  1NR4 A;  1V1P A;  3HKS A;  1JC7 A;  2B39 A;  1WTO A;  2WB1 B;  1O78 A;  1HR0 Q;  4BA2 I;  2PCF B;  2F4I A;  3I56 A;  1JWS D;  3K59 A;  4BBS G;  3OW2 A;  4QCL A;  2JA5 G;  2B2W A;  3HOX B;  4CDD C;  3PF5 A;  3EN2 A;  5AJ3 Q;  4DV6 Q;  2D0P A;  4L6T B;  1KL9 A;  5M3F B;  3CAM A;  4FVM A;  2FHT A;  2R93 H;  4IFD H;  3DXJ C;  1RIP A;  1K3B C;  1EY9 A;  4OO1 G;  1Y8P B;  1GUO A;  2K6A A;  2PQA A;  1D7Q A;  4A93 B;  5ISR A;  1KRT A;  1PTO D;  3MC0 B;  1U0L A;  3IAY A;  1NR2 A;  1TXY A;  4POF A;  2JK8 A;  1H9R A;  3VR4 A;  2EYJ A;  4B08 A;  3I4N B;  1TWG B;  5JAV A;  4HJ9 A;  1E0B A;  4LAA A;  2A19 A;  2ZXO A;  1EQR A;  4HIK A;  4MZ9 A;  2E75 C;  3CPF A;  2K50 A;  5FKA C;  4YHH Q;  5EPJ A;  1JJG A;  4J1M A;  2MO1 A;  3BVZ A;  2AQ3 B;  2EPB A;  5DAU A;  1V1P B;  2NVX H;  4FP5 D;  2WFW A;  5EGT A;  4LFC L;  1HQM C;  4V0B A;  4PZ6 A;  5C3W A;  1HNZ L;  1TWF H;  2RHS B;  2NTS A;  3EBE A;  4GKK L;  1BBU A;  1I6V C;  1S5E D;  3I55 A;  3MAQ A;  4IQZ A;  4AQY L;  1SXT A;  3QOL A;  1CHP D;  1Y1V H;  1CQF A;  4HSP A;  3BU2 A;  3TZU A;  1BXT A;  1I4Q A;  2GN5 A;  1AZP A;  1IL2 A;  2EY6 A;  4JBK A;  2J0T D;  1II3 A;  4JOI A;  1WCM G;  4L5T A;  5FO8 B;  1VQ8 A;  4LJZ C;  2ZT9 C;  3KLS X;  4L5R C;  2RDG A;  4DU9 A;  3QG1 A;  2PI2 A;  1LAB A;  3M7G A;  5C4X G;  2SNS A;  4HCS A;  5CC4 A;  3AEV A;  3OMG A;  1ENF A;  2CKZ B;  2C35 B;  4ZLT F;  2B2U C;  4K0K L;  1GXD C;  5C5M A;  1HNZ Q;  2HQL A;  4GKK Q;  4KJO A;  4KN4 C;  5BN3 A;  1STG A;  3S17 B;  1TS2 A;  3BVM A;  5DM6 3;  4AQY Q;  1V43 A;  2DY7 A;  1K0R A;  3RZO B;  5C0X J;  1HUN A;  3K0X A;  2ZTD A;  1PZJ D;  4DK0 A;  4IAL A;  2DJG C;  3UDG A;  1DZ1 A;  3ONA B;  4HIO A;  3HKZ G;  1SMX A;  2R7F A;  2L5T A;  4GLA C;  1RD9 D;  2SEB D;  1XPR A;  3HOZ G;  2RHQ B;  3MFY A;  2CVR A;  2VQE L;  4UDU C;  1VQG A;  3M3Y H;  4QL5 A;  4XYO A;  1KC8 C;  4DNT B;  4QIW B;  2XTI A;  5JJZ A;  4K0K Q;  1W2B A;  1SFO H;  3IRB A;  1HTL D;  1OO9 B;  2VZA A;  1S5C D;  1CZW A;  2WAQ B;  2H4O A;  4BY7 H;  4IOC A;  1BCP F;  2Z8L A;  3FMC A;  1QOH A;  3GTK B;  2JEA I;  3URY A;  2LSS A;  3BZC A;  3H0G H;  4YWL A;  4BBR G;  2EDG A;  3FPU B;  1S5F D;  4AYB B;  2ICI A;  4TSS A;  4ODG A;  1O80 A;  5JVH 3;  4GN5 A;  2AWN A;  4XYQ A;  3VYS A;  2Y0S G;  3PUV A;  3E0J A;  2E2J B;  1EWI A;  2R7Z G;  4DV7 L;  4JYA L;  1SN8 A;  2VQE Q;  1VQI A;  1SNP A;  3HOV G;  1JCK B;  1JR0 D;  2IX0 A;  4HIM A;  4DKA C;  4XT3 B;  1YJ9 A;  3AQQ A;  3SK4 A;  4A76 A;  1VS0 A;  4JVZ A;  1L1O C;  4IUP A;  1K8G A;  3HOU B;  1N8R C;  3H3V H;  1SE8 A;  2IX1 A;  4HAE A;  2OT2 A;  4A3I G;  4A4I A;  3S1Q B;  2M00 A;  3MEF A;  1TS3 A;  1HZC A;  2Q8R E;  1HCZ A;  2Z6B A;  3HOY B;  4QJF A;  4BBS B;  1PYS B;  1SNC A;  4QUF A;  1BCP B;  2EVB A;  3OIQ A;  2F0V A;  3R2I A;  1YI2 A;  1YJW A;  1Y1W B;  4JYA Q;  4DV7 Q;  4KKU A;  2WKD A;  4HMI A;  4XQJ A;  1C7Y A;  1ILQ A;  1PRT D;  3FKI H;  3UI2 A;  4LUZ A;  4K8I A;  3NK9 A;  3KJO A;  2AKW B;  4CDF C;  2NZ1 D;  2P5Z X;  1X56 A;  2B63 B;  4NDX A;  3OTO L;  3PUY A;  5EKI A;  2ATW A;  3OYY A;  4ZK9 B;  1VQM A;  2NYZ D;  4PQX A;  3E3X A;  2JA9 A;  2QW7 A;  2B8G A;  1A8V A;  2XSC A;  3D8G A;  4G4K A;  1S40 A;  1PTO F;  2E8G A;  4LF8 Q;  2UXD L;  1SE2 A;  3GO5 A;  1I6H B;  4N9T A;  3WDN A;  2K32 A;  1X3Q A;  4JG2 A;  3S1M H;  1E22 A;  1C48 A;  1ENC A;  4RGO S;  3J7A V;  1B4O A;  3BDC A;  2KEN A;  3I4M G;  1Y8O B;  3L0O A;  1B1Z A;  3CPW A;  4A3J G;  1Q7Y C;  4GNX C;  1CKN A;  1YNJ D;  2K05 A;  4GLX A;  3ULJ A;  2HD3 A;  3HFZ B;  4A3M G;  3GTP B;  2JA5 H;  1X6O A;  3R2T A;  1YHB A;  1WOC A;  1Z47 A;  3NTI A;  5IGF A;  3T56 B;  3OTO Q;  3H6M A;  1D5M C;  1STE A;  4R4I A;  1EOV A;  1Q8K A;  4OHJ A;  4G57 A;  3J7A 5;  5IT9 E;  2UXD Q;  1K8A C;  1VQE A;  4QMG A;  5FLX E;  3PO2 B;  2V1C C;  3QIA A;  3K5O A;  4DR7 L;  2C9O A;  2NN6 G;  2Z1C A;  5M5W H;  4OO1 H;  2JA6 B;  3BDO A;  3C2P A;  4X3S A;  1O7Y A;  1QNK A;  2L0C A;  2Q2U A;  3S1R H;  3U4V A;  1X9N A;  2JP1 A;  3QR8 A;  3BDL A;  2YV5 A;  1U4M A;  4UP7 A;  2QDB A;  1YNN D;  4QB4 A;  3G48 A;  1NBW A;  5I6W A;  3Q24 A;  3TSS A;  5EKK A;  4X62 Q;  3NQI A;  2OF1 A;  4R8I A;  4CHT B;  1F9R A;  5IT9 c;  4LWC A;  2O5I C;  5H1S E;  3H3V I;  2J7Z A;  1CKN B;  4FO2 A;  3S15 H;  3FPP A;  2B2U A;  3IFD A;  5IOD A;  5FLM G;  2ZM6 L;  1WFQ A;  2Z9H A;  4DR7 Q;  1NE3 A;  2G5D A;  1K8O A;  4P73 A;  1M8A A;  2F0K A;  3CME A;  1IXR A;  4CKC A;  1WCM H;  4F88 A;  4QQB X;  3NWT A;  4HSV A;  4R8N A;  1SE3 A;  3BYY B;  4I65 A;  4CDE C;  2MFI A;  4A3B H;  5CGK A;  4BY1 B;  1JMC A;  5C4X H;  1V1Q A;  1U4P A;  2RCN A;  1Y69 U;  1I94 L;  1CA5 A;  1T5X D;  2MP1 A;  1PTO H;  1HA6 A;  1PFM A;  1EYD A;  2NBF A;  2K5W A;  1STN A;  3EJI A;  1H95 A;  4A3E G;  4GS3 A;  2NWG A;  3GTM H;  3S2H H;  5CMD A;  1GUN A;  1FJG L;  2R7Z B;  3T51 B;  1QUQ B;  1VQF A;  4B9X A;  2FMC A;  2NTT A;  1EIY B;  4CJ0 B;  3OWE B;  2D9U A;  2KHS A;  3RD4 A;  5KNC A;  2KCT A;  1Q1E A;  3VR6 A;  4RH6 A;  2Z4H A;  1BF4 A;  4A3D B;  2D62 A;  5ELB A;  5EPK A;  2OQK A;  2WII B;  1D8L A;  2WB1 G;  2L55 A;  3HOZ H;  1I4X A;  1L0Y B;  1I94 Q;  2EY1 A;  2UXB L;  1T5E A;  3S14 B;  1FYC A;  1CK1 A;  3NBI A;  3HOX G;  2IPK D;  3A0J A;  4P2C B;  4DK3 C;  4DK1 A;  4M8A A;  2XRS D;  1RTN A;  5M3F G;  4ZUJ A;  1JOR A;  1SYB A;  4H44 C;  1PFN A;  1EEF D;  1FJG Q;  1B7Y B;  2X6G A;  1L1O A;  2VQF L;  3OWF A;  3VYU A;  1NTG A;  2MO0 A;  2Q8T A;  1JQY D;  5BR8 L;  3I91 A;  4BBR H;  2VUM B;  3GDE A;  2ASB A;  4A93 G;  1CM9 A;  4X66 L;  3DLL A;  4HED A;  2OTJ A;  1TT2 A;  3BYT B;  1HJP A;  2A8V A;  5FO9 B;  3T1H L;  1R9T B;  3I4N G;  4O2D A;  1QVC A;  2UXB Q;  1MI2 A;  4DUZ L;  3HOV H;  5ELD A;  3GP7 A;  2F52 A;  4O1N A;  2RBM A;  4Y52 H;  2A69 C;  1K83 B;  1L0W A;  3MHB A;  4EQN A;  1EFW A;  2JA7 B;  1KAB A;  2ZTC A;  4A3I H;  1LTA D;  3A8K E;  4NMZ A;  4HID A;  3LGJ A;  1XNR L;  3FDT A;  4QF4 A;  5NUC A;  4DV3 L;  3PIP 3;  1GO3 E;  2EJG C;  2HQE A;  3T4A C;  4HJ8 A;  5BR8 Q;  3DM3 A;  4LFB L;  3E0E A;  5DM7 3;  4X66 Q;  3STB D;  2R6G A;  3PMF A;  3I70 A;  1ML0 D;  2A6E D;  3DWP A;  1L1O B;  2NZH A;  3T1H Q;  1EZ6 A;  4ZKC B;  2OXP A;  4DUZ Q;  2K5Q A;  3CCJ A;  2NVT H;  5JEA J;  1HH2 P;  1MIU A;  1X3E A;  3U4Z A;  1X54 A;  1RHP A;  5I6Y A;  1QJO A;  4GNX A;  1H9S B;  1V8Q A;  2EYP A;  3J81 E;  1HFN A;  1S5B D;  4J8Q A;  4LF9 L;  1XNR Q;  1QVG A;  3NSW A;  1I50 H;  3SDZ A;  2JE6 I;  4KN7 C;  5JJI A;  3WOE A;  5HY6 A;  2RQX A;  2E2H H;  4R4T A;  5E1F A;  4C3I B;  3NBH A;  5M5X B;  5LMN W;  3I4M H;  4AH6 A;  1GVP A;  5D65 A;  3UE0 A;  1VQ9 A;  4A3J H;  4RMF A;  1LV9 A;  4LF4 L;  2B8F A;  3CCV A;  1SRO A;  4CKE A;  4JI1 L;  4A3M H;  3VR2 A;  2UU9 L;  4IN3 A;  2K7V A;  4ZKB B; 
#chains in the Genus database with same CATH homology
 2RSO A;  4IFD J;  3D4W A;  1BCP D;  2CW0 D;  1TKW B;  2N55 A;  1IKL A;  1B9M A;  3QB3 A;  4ULL A;  3SK6 A;  1A2U A;  3K57 A;  1Q8I A;  1ZYR C;  2NN6 H;  2F0F A;  3C46 A;  5J1Z A;  1RKN A;  5D3I B;  5FK9 C;  1R4Q B;  2K01 A;  2QIL A;  1G8Z D;  5EQ0 A;  3H91 A;  1SEB D;  4HCE A;  3J81 L;  2IX3 A;  3RMH A;  4XTC S;  1SNM A;  4F7X A;  1F9P A;  1QCB D;  2QEJ C;  1TR5 A;  5M3M B;  1KNA A;  4ABN A;  3MEH A;  3M4O B;  2PW7 A;  4TQU S;  5ELC A;  3KLS A;  1JE4 A;  2R61 A;  2A73 B;  4ZRZ A;  5EKL A;  1GUG A;  2A74 C;  5C44 B;  1WTW A;  1CI3 M;  4K2K A;  3MXN A;  1SAP A;  1KLU D;  2EYO A;  3T16 A;  1PLF A;  4X3K A;  5DEH A;  1EY5 A;  1GHK A;  1EY4 A;  1D6E C;  1TS4 A;  1IW7 D;  1A6X A;  5JPM C;  4RGM A;  5K5P A;  1PTO C;  4A3K B;  4K6D A;  1QE6 A;  2QF7 A;  2B2V C;  3K0Y A;  2A68 D;  1ESF A;  3HRZ C;  1RF2 D;  5EJW A;  4RA8 A;  1QNU A;  3NQT A;  3J80 L;  4FF1 A;  2MGS A;  3GTJ B;  5FOB B;  3TP7 A;  1I3Q B;  5CV6 A;  4FF3 A;  1E2W A;  2E74 C;  1LTR D;  2JA8 B;  5CBA E;  4K5V A;  1MBY A;  3OOC A;  3K6O A;  3KF8 A;  5TSS A;  2CQA A;  4RAU C;  1TQO A;  2PZU A;  3SHL A;  4FYD A;  5BN5 A;  4ZQ3 A;  2BCO A;  5C4Z A;  2E2I B;  2NN6 I;  4FXD A;  1KTK A;  1VF7 A;  1NCV A;  2FMM A;  1IYU A;  3KLR A;  2KJX A;  2DNC A;  3LWU A;  1EL0 A;  4CJ2 C;  4KY6 A;  4EQP A;  5D14 A;  3QWN A;  3SVM A;  3GTO B;  2JSO A;  3MZ5 A;  4Z9C B;  3HGB A;  4K14 A;  4WJW A;  3DEP A;  5I2X A;  1SE4 A;  4XXE A;  1ONL A;  1D5Z C;  2FFK B;  4K5W A;  3L3O C;  1CA6 A;  3IFT A;  2H1E A;  2B2T C;  3HZX A;  1X3P A;  1LTI D;  4GZY C;  4XQQ A;  3CRL C;  1Q12 A;  2FIN B;  2I07 B;  1MD2 D;  4RWS C;  1JB3 A;  1NUC A;  1XTC D;  3EQL C;  2BA1 A;  1EIH A;  3T13 A;  5F2D A;  4ME5 A;  5IGE A;  3V96 A;  3VR5 A;  1IYV A;  1IL8 A;  1D5X C;  4EVO A;  2HCI A;  5C6A A;  4C3H G;  4FF2 A;  3M7N A;  3GTL B;  4Q0F A;  1F2M A;  2ICE C;  1PFB A;  4HTH A;  3HG9 A;  4HN7 A;  4MHE A;  4NW2 A;  1TVX A;  3OSO A;  1WVL A;  3I4L A;  5C3X A;  3NHH A;  4DGZ A;  1AN8 A;  2F0M A;  3AMU A;  3NUC A;  2VXW A;  3D31 A;  1HTP A;  5J22 A;  1A3T A;  1SMY D;  3D6W A;  1TWH B;  1PZI D;  4G7H C;  4KKT A;  2BOS A;  3TME A;  3M85 A;  1EY7 A;  5KIX A;  3S9W A;  1PRT C;  5I9P A;  3KUP A;  3BG3 A;  2LMC B;  1B44 D;  3X3N A;  1F9Q A;  3OIP A;  4KY5 A;  4DXG A;  3PO3 B;  1Y8N B;  1EOT A;  1OXS C;  1HA5 A;  3DEO A;  3NXW A;  2PPB C;  1EZ8 A;  3HOW B;  1SNO A;  2BE5 D;  3MXU A;  1G91 A;  5K36 G;  4ZAI A;  4X3U A;  2PMZ B;  1YNJ C;  5CV5 A;  3Q23 A;  2ENB A;  4DXF A;  1BBX C;  1JOO A;  2AQ2 B;  2JEB I;  3H09 A;  3U9S A;  1JWM D;  3DHQ A;  3EA6 A;  3VR3 A;  3K5N A;  1SYD A;  4O42 A;  2K03 A;  3SR1 A;  3SK5 A;  4ZUI A;  2KOL A;  1PYW D;  4KMU C;  5CYU A;  2BDO A;  1LT5 D;  4C2M B;  1SDF A;  4A3F B;  2X6L A;  1KDC A;  1G6Z A;  3CHB D;  1A3V A;  1BOS A;  3WOF A;  1I4H A;  1YNN C;  5I4D A;  4FXK C;  1EY6 A;  4X3T A;  3P20 A;  2O2L D;  3X3M A;  2XWB B;  3LNN A;  1B9N A;  2N88 A;  5J39 A;  1CZG A;  4C3I G;  3KK7 A;  1AW7 A;  3S16 B;  1VMC A;  3GTQ B;  1LT6 D;  1K8M A;  1PXU A;  2RKS A;  1FNU A;  4RGN A;  4DAP A;  5HGT A;  5C4J B;  4KTA A;  4NP5 A;  2TSS A;  2R92 B;  1TY0 A;  2A5H A;  3I72 A;  1FD7 D;  3KBX A;  3NWS A;  1D1K A;  3CQZ B;  2JYO A;  1A15 A;  4TKO B;  5C0X I;  1CFM A;  4F8M A;  3SEB A;  2DY8 A;  3U9O A;  2K28 A;  4C3H B;  5IT9 L;  3D4R A;  2EYL A;  1JIC A;  1G2S A;  2F0H A;  1WTV A;  3D6C A;  5FLX L;  3S2D B;  3TN2 A;  2F0U A;  1WTP A;  4U68 A;  1O7L A;  1DOL A;  4R9W A;  1KNE A;  2VB2 X;  4XDX A;  3D4D A;  3I8Z A;  3ND8 A;  1GJX A;  2VNU D;  1HHV A;  1D2B A;  1HQR D;  4EQO A;  2SOB A;  3TBI B;  3ITP A;  1EEI D;  3QJY A;  2NVQ B;  5E3F A;  2NVY B;  4E6I A;  2PYK A;  2D2C C;  5EBC A;  2F3V A;  3MXP A;  2YU9 B;  3VA5 A;  1OXU A;  2L9H A;  3QO2 A;  1W6K A;  4IUQ A;  1TII D;  2IJ0 A;  4KHV A;  4HMJ A;  1E2Z A;  4Y7N B;  2V4D A;  4DAV A;  1GHJ A;  4G7O C;  2XWJ B;  4BA1 I;  1PDQ A;  1TWA B;  2F0P A;  4PMB A;  3I90 A;  1MSG A;  3G6J B;  3LWE A;  4IUN A;  3HEJ A;  3BS1 A;  2XIW A;  3MFG A;  4B9W A;  4BWG B;  2EY5 A;  3DMU A;  2AUK A;  1RJT A;  4FXG C;  3H3V C;  3S1N B;  2A6H D;  2NUC A;  3ERQ A;  3ZYY X;  2XRQ D;  2EXZ A;  4N9P A;  4A3G B;  3LX0 A;  1DYQ A;  2CHB D;  4C3J B;  1FGB D;  3I73 A;  4K2L A;  2B2Y C;  1V1O A;  2A6E C;  1KDB A;  1EWC A;  4RHS A;  4OIK A;  2KEE A;  1NSN S;  2MJ8 A;  2F0J A;  3NP8 A;  1VMP A;  2M2L A;  1Q1B A;  1VCI A;  4MIU A;  1F77 A;  1EQT A;  2LKV A;  3L7Z C;  1EY0 A;  3MWY W;  5IIF A;  5AFW A;  2EY2 A;  1B3A A;  2K1B A;  5K36 H;  2F0W A;  1ET6 A;  4I7Z C;  3PUZ A;  2L11 A;  3TDQ A;  2KQ3 A;  3P75 A;  4PMC A;  1SYE A;  3A55 A;  1R4P B;  5LHY 1;  1CTM A;  1BCP C;  1HPC A;  2CW0 C;  5C3E B;  1W6J A;  1ESR A;  3P1H A;  3DWQ A;  1QIL A;  3V05 A;  1A2T A;  4WFN 3;  1BNZ A;  1F2Y A;  1GUT A;  2J4X A;  2XN9 C;  3HS0 C;  2L12 A;  5C0X G;  4OGQ C;  1SSO A;  2MHV A;  5FO7 B;  1EYC A;  1D1I A;  3Q22 A;  4FF4 A;  1ZEQ X;  1DOM A;  2RSN A;  1U4R A;  1UNS A;  3TZD A;  1ZYR D;  2IL8 A;  1RDP D;  5G3L D;  2R93 B;  3OHX C;  2RA4 A;  5LL6 S;  1BR9 A;  5LL6 X;  4CJ1 B;  1SBB B;  2F0E A;  2BDN A;  5BN4 A;  4LK1 C;  3SK8 A;  1KAA A;  1EU3 A;  3AB9 A;  2EZV A;  1PZK D;  3HP3 A;  3GD7 A;  5IGC A;  4IUV A;  1EU4 A;  2NVX B;  4H0L C;  2QCP X;  2F0I A;  1F2Z A;  5EPL A;  4K6L A;  1EY8 A;  1TWF B;  2I46 A;  4IUR A;  1GOZ A;  5CBE E;  4RCN A;  1IW7 C;  4RCO A;  1C4Q A;  3GV3 A;  1SYG A;  3RLF A;  1Y1V B;  1MGS A;  2XNA C;  3O13 A;  1STH A;  2EE1 A;  2A68 C;  4KK7 A;  1H9J A;  3M4Y A;  2EYF A;  4L63 B;  4TRD A;  3RUZ A;  2ID0 A;  2HUG A;  2JXM B;  5IGG A;  3JAM E;  5DNF A;  2Z4I A;  1XYI A;  1LTT D;  1LT4 D;  1VDZ A;  3C3L A;  3I3C A;  5CV8 A;  4KD4 A;  2O5J C;  3V2T A;  1FNW A;  2VB3 X;  1GUS A;  2F0G A;  4IZ8 A;  1BQQ T;  2AQ1 B;  2NB0 A;  1LLR D;  2DN8 A;  5CV7 A;  1OXT A;  2EYM A;  3OPO A;  1B2T A;  1DM0 B;  4H7B A;  1BO0 A;  2HDM A;  5M9O A;  3M3Y B;  4RGT A;  2ZXR A;  1SFO B;  1B50 A;  4CGY B;  1F2L A;  3NE5 B;  2B2Y A;  1ENA A;  4BY7 B;  3QOJ A;  2G9H D;  2M9V A;  4NKL A;  3PUX A;  2KVM A;  1QG7 A;  3H0G B;  3TP8 A;  1O7Z A;  1BDO A;  1X32 A;  1DXM A;  5E4W C;  2KUM A;  5CR3 A;  1SND A;  5E4X A;  4EGV A;  1IHZ A;  5CV9 A;  2F0S A;  2EOT A;  3DM1 A;  1QWY A;  2AWO A;  1SYC A;  3JAM L;  3GV6 A;  4KD3 A;  4KY7 A;  4OL7 A;  1E2V A;  3C1F A;  2E2D C;  1Z7T A;  1ZXT A;  3A7L A;  3IL8 A;  3K5M A;  4CKB A;  2K04 A;  2KA7 A;  3MXG A;  1STA A;  3A56 A;  2MUY A;  1RTO A;  1EWH A;  4JK1 C;  4IFD I;  4S3S A;  1KDA A;  4RKB A;  3FKI B;  3D3R A;  1LTB D;  1IKM A;  1HUM A;  5G3L F;  1Z6H A;  3R8B A;  3G7L A;  2X69 A;  5CV4 A;  3CRK C;  3VA7 A;  2F0Q A;  2F0T A;  3C1E A;  1JWU D;  1AP0 A;  3S1M B;  2D5D A;  1JOK A;  1SMY C;  1WD0 A;  3DWA A;  1EFI D;  4ZYS A;  5HUR A;  5D3D A;  5C0X H;  1PMR A;  1TY2 A;  1WTQ A;  3VYT A;  2GA4 B;  2JA5 B;  4C1N I;  1NAP A;  2OEO A;  1DCZ A;  1TS5 A;  5ELF A;  5JOB A;  1I4G A;  3N6R A;  3W3A A;  4WOR A;  1I4P A;  5C4H A;  4OIJ A;  1KLG D;  1RCV D;  4UAI A;  2PNR C;  2XVS A;  1SNQ A;  5KYL A;  5M5W B;  1TU2 B;  2BE5 C;  3S1R B;  1OXX K;  2PW5 A;  5KNB A;  1LO5 D;  3A8I E;  2HDL A;  5KGU A;  4K5X A;  2B2V A;  1J9O A;  1ET9 A;  4LMQ D;  1G29 1;  5KRU A;  4C3J G;  2K33 A;  4L8J A;  4U67 3;  3H94 A;  2C5C A;  2O4X A;  4DAY A;  3IKJ A;  3SXH A;  1QB5 D;  2K5D A;  4DN4 M;  3S15 B;  1DON A;  5A2Q E;  1LT3 D;  2KED A;  3NTH A;  2SNM A;  1STY A;  5ELE A;  4XT1 B;  1CT1 D;  5C5L A;  1WCM B;  3J7A F;  3PV0 A;  4KV6 A;  1L0X B;  3AU7 A;  2AUJ D;  3OMC A;  4A3B B;  3EFX D;  1U9R A;  5C4X B;  4YIJ A;  4IUT A;  3BVG A;  4MN3 A;  4RKL A;  1WTX A;  1H9M A;  1PTO B;  3R3O A;  3DUZ A;  2IWH A;  3R93 A;  1XXG A;  5JEA G;  3GTM B;  2RDH A;  3S2H B;  1ILP A;  1FNV A;  4RHR A;  3F2U A;  2WV6 D;  3FRP B;  2RVL A;  2KEC A;  1AFP A;  1FR3 A;  4Q5V A;  5A35 A;  2B2T A;  3HKZ B;  3HOZ B;  3T53 B;  1UUP A;  5I2Y A;  3K5L A;  2F0N A;  5COR A;  1XWE A;  4KKS A;  5A2Q L;  2WP8 J;  1VF5 C;  3OW7 A;  2WKC A;  1UAP A;  4IFD G;  2PO4 A;  4BBR B;  1G2T A;  1LTG D;  4F87 A;  3MVV A;  2Y0S B;  5EBD A;  3BZD B;  1Q90 A;  1M4V A;  2B2W C;  4V19 0;  4KHZ A;  3L9A X;  1Q3L A;  3FVQ A;  4KJN A;  3Q0A A;  3HOV B;  4BS9 A;  3NPP A;  1OXV A;  3GQB A;  4DA2 A;  1GUW A;  4XIG S;  3KBG A;  5IGD A;  3PIO 3;  1HXY D;  4A3I B;  2G9D A;  3VYR A;  4J6H A;  1WD1 A;  2MPM A;  1AEX A;  1CQV A;  2F0D A;  3P7J A;  1HFG A;  4OO1 I;  2E76 C;  1B53 A;  2IT1 A;  2NVT B;  3FEW X;  4CBV A;  1UEA B;  2LY7 A;  1H9S A;  2PQE A;  1PRT F;  4PNY A;  1U4L A;  3NTK A;  1I50 B;  2A6H C;  1XX8 A;  1STB A;  2A69 D;  4KI0 A;  3ERO A;  1JOQ A;  2E2H B;  2KCN A;  1J8I A;  5KND A;  1CHQ D;  2LFN A;  5COY A;  3I4M B;  1DD2 A;  1EQV A;  4A3J B;  3N52 A;  2ZXP A;  4DF7 A;  3EVQ A;  2F0O A;  3Q6S A;  4A3M B;  1ROD A;  2BA0 A;  3A54 A;  1ZKO A;  4PMW A;  4DFA A;  2PZW A;  3E5S A;  4RFB A;  1BUV T;  2WAC A;  1DOK A;  3CU7 A;  1EIG A;  1DJR D;  4JBW A;  3E6Z X;  3PUW A;  1PRT B;  2FJ2 A;  4IUU A;  3W2D A;  2RDF A;  3RZD B;  2QKI C;  1ICW A;  4K8J A;  1WTR A;  4PV1 C;  1H9K A;  1LTS D;  2SDF A;  2EJF C;  3A8J E;  3K58 A;  1C8C A;  3TP6 A;  2L1B A;  2EYH A;  1SYF A;  4H13 C;  5IOC A;  2R3Z A;  1S4Z A;  4FNF A;  4C56 C;  5IGB A;  3SE0 A;  2DNE A;  1AZQ A;  4XQN A;  5M5Y B;  2TMP A;  2Q8I B;  2PZT A;  4ID6 A;  3ND9 A;  1A3U A;  2HCC A;  3J7Y W;  3CKI B;  2EJM A;  4M1U B;  2KCC A;  4QUC A;  1MSH A;  3A7A B;  4C1N K;  2IW3 A;  5JVG 3;  4WRD A;  1SJE D;  2WIN B;  5T1G A;  5I9O A;  1F9S A;  3K7A B;  1TWC B;  2LS0 1;  4G7Z C;  2YYZ A;  2F0L A;  1I4R A;  3MTS A;  5T1I A;  3MA2 B;  1S5D D;  5KYI A;  2F03 A;  3J80 E;  4A3E B;  5JEA H;  2L4N A;  3GTG B;  1EYA A;  2F1M A;  4HR7 B;  4ILW A;  5JPN C;  2F3W A;  4DNR B;  3TP5 A;  1LAC A;  5KEE A;  1SJH D;  1HRJ A;  1NR4 A;  1V1P A;  1JC7 A;  2B39 A;  1WTO A;  2WB1 B;  1O78 A;  4BA2 I;  2PCF B;  2F4I A;  1JWS D;  3K59 A;  4QCL A;  2B2W A;  3HOX B;  4L6T B;  5M3F B;  4FVM A;  2FHT A;  4IFD H;  3DXJ C;  1EY9 A;  4OO1 G;  1Y8P B;  1GUO A;  2K6A A;  4A93 B;  5ISR A;  1PTO D;  3MC0 B;  3IAY A;  1NR2 A;  1H9R A;  3VR4 A;  2EYJ A;  4B08 A;  3I4N B;  1TWG B;  5JAV A;  1E0B A;  4LAA A;  2ZXO A;  2E75 C;  5FKA C;  5EPJ A;  4J1M A;  5DAU A;  3BVZ A;  2AQ3 B;  2EPB A;  1V1P B;  4FP5 D;  5EGT A;  1HQM C;  4V0B A;  5C3W A;  2NTS A;  1I6V C;  1S5E D;  3MAQ A;  4IQZ A;  1SXT A;  3QOL A;  1CHP D;  1CQF A;  4HSP A;  3TZU A;  1BXT A;  1I4Q A;  1AZP A;  2EY6 A;  2J0T D;  1II3 A;  5FO8 B;  4LJZ C;  2ZT9 C;  3KLS X;  2RDG A;  4DU9 A;  3QG1 A;  1LAB A;  3M7G A;  2SNS A;  4HCS A;  5CC4 A;  3OMG A;  1ENF A;  4ZLT F;  2B2U C;  1GXD C;  5C5M A;  4KJO A;  4KN4 C;  5BN3 A;  1STG A;  3S17 B;  1TS2 A;  3BVM A;  5DM6 3;  1V43 A;  2DY7 A;  3RZO B;  5C0X J;  1HUN A;  1PZJ D;  4DK0 A;  4IAL A;  1DZ1 A;  3ONA B;  2L5T A;  1RD9 D;  2SEB D;  3MFY A;  2CVR A;  4UDU C;  4XYO A;  4DNT B;  4QIW B;  5JJZ A;  1HTL D;  1OO9 B;  1S5C D;  1CZW A;  2WAQ B;  2H4O A;  1BCP F;  2Z8L A;  3FMC A;  1QOH A;  3GTK B;  2JEA I;  3URY A;  2EDG A;  3FPU B;  1S5F D;  4AYB B;  2ICI A;  4TSS A;  4ODG A;  1O80 A;  5JVH 3;  2AWN A;  4XYQ A;  3VYS A;  3PUV A;  3E0J A;  2E2J B;  1SNP A;  1JCK B;  1JR0 D;  2IX0 A;  4XT3 B;  3SK4 A;  4IUP A;  3HOU B;  2IX1 A;  4HAE A;  2OT2 A;  3S1Q B;  2M00 A;  1TS3 A;  2Q8R E;  1HCZ A;  3HOY B;  4BBS B;  1SNC A;  4QUF A;  1BCP B;  2EVB A;  3OIQ A;  2F0V A;  3R2I A;  1Y1W B;  4KKU A;  2WKD A;  4HMI A;  4XQJ A;  1ILQ A;  1PRT D;  3UI2 A;  4K8I A;  3NK9 A;  2NZ1 D;  2B63 B;  4NDX A;  3PUY A;  5EKI A;  4ZK9 B;  2NYZ D;  4PQX A;  2B8G A;  2XSC A;  3D8G A;  4G4K A;  1PTO F;  1SE2 A;  3GO5 A;  1I6H B;  4N9T A;  3WDN A;  2K32 A;  1X3Q A;  1C48 A;  1ENC A;  4RGO S;  3J7A V;  1B4O A;  3BDC A;  1Y8O B;  1B1Z A;  1YNJ D;  2K05 A;  3GTP B;  3R2T A;  1Z47 A;  3NTI A;  5IGF A;  3T56 B;  3H6M A;  1D5M C;  1STE A;  4OHJ A;  4G57 A;  5IT9 E;  4QMG A;  5FLX E;  3PO2 B;  3QIA A;  3K5O A;  4OO1 H;  2C9O A;  2NN6 G;  2Z1C A;  2JA6 B;  3BDO A;  3C2P A;  4X3S A;  1O7Y A;  1QNK A;  2L0C A;  2JP1 A;  3BDL A;  1U4M A;  2QDB A;  1YNN D;  4QB4 A;  5I6W A;  3Q24 A;  3TSS A;  5EKK A;  3NQI A;  2OF1 A;  4R8I A;  4CHT B;  1F9R A;  2O5I C;  2J7Z A;  4FO2 A;  3FPP A;  2B2U A;  3IFD A;  5IOD A;  1K8O A;  1M8A A;  2F0K A;  4CKC A;  4F88 A;  3NWT A;  4HSV A;  4R8N A;  1SE3 A;  3BYY B;  4I65 A;  5CGK A;  4BY1 B;  1U4P A;  1Y69 U;  1CA5 A;  1T5X D;  2MP1 A;  1PTO H;  1HA6 A;  1PFM A;  1EYD A;  2NBF A;  2K5W A;  1STN A;  3EJI A;  2NWG A;  5CMD A;  1GUN A;  2R7Z B;  3T51 B;  4B9X A;  2FMC A;  2NTT A;  4CJ0 B;  3OWE B;  2D9U A;  2KHS A;  3RD4 A;  5KNC A;  1Q1E A;  3VR6 A;  4RH6 A;  2Z4H A;  1BF4 A;  4A3D B;  2D62 A;  5ELB A;  5EPK A;  2WII B;  2L55 A;  1I4X A;  1L0Y B;  2EY1 A;  1T5E A;  3S14 B;  1FYC A;  1CK1 A;  3NBI A;  2IPK D;  4P2C B;  4DK1 A;  4M8A A;  2XRS D;  1RTN A;  1JOR A;  4ZUJ A;  1SYB A;  4H44 C;  1PFN A;  1EEF D;  2X6G A;  3OWF A;  3VYU A;  2Q8T A;  1JQY D;  3I91 A;  2VUM B;  1CM9 A;  4HED A;  1TT2 A;  3BYT B;  5FO9 B;  1R9T B;  1MI2 A;  5ELD A;  3GP7 A;  4O1N A;  2RBM A;  2A69 C;  1K83 B;  3MHB A;  4EQN A;  2JA7 B;  1KAB A;  1LTA D;  3A8K E;  4NMZ A;  3FDT A;  4QF4 A;  5NUC A;  3PIP 3;  2EJG C;  2HQE A;  3T4A C;  5DM7 3;  2R6G A;  3PMF A;  3I70 A;  1ML0 D;  2A6E D;  3DWP A;  1EZ6 A;  4ZKC B;  2OXP A;  2K5Q A;  5JEA J;  1RHP A;  5I6Y A;  1QJO A;  1H9S B;  1V8Q A;  2EYP A;  3J81 E;  1HFN A;  1S5B D;  4J8Q A;  3NSW A;  3SDZ A;  2JE6 I;  4KN7 C;  3WOE A;  2RQX A;  5E1F A;  4C3I B;  3NBH A;  5M5X B;  5D65 A;  1LV9 A;  2B8F A;  4CKE A;  3VR2 A;  4IN3 A;  2K7V A;  4ZKB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...