1O7YA

Crystal structure of ip-10 m-form
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
LSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL INDUCIBLE CYTOKINE B10
publication title Crystal Structures of Oligomeric Forms of the Ip-10/Cxcl10 Chemokine
pubmed doi rcsb
molecule tags Chemokine
total genus 9
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1o7yA00
2B2YA 2FINB 4XT3B 3ONAB 5EQ0A 5JJZA 1WTWA 4QUFA 1MSHA 1ICWA 1WTQA 2MGSA 2VXWA 4X3UA 4CJ1B 1X3PA 2L11A 2B2WA 1NAPA 2EOTA 4XT1B 2RSNA 2IL8A 2KECA 1LV9A 2KEEA 5E4XA 1WTVA 2B2UA 1F9SA 2KOLA 4ZLTF 1WTXA 1U4PA 2JYOA 1BO0A 2B2VA 4RAUC 4HCSA 1MI2A 2NWGA 1B2TA 2B2WC 3G7LA 2EE1A 4OIKA 1IKLA 2FFKB 5AFWA 2HCIA 4OIJA 5CBEE 1AZQA 2HDLA 2B2UC 4ZKBB 1M8AA 1KNEA 1WTRA 1S4ZA 1SAPA 1HHVA 3KUPA 1CA5A 1F9RA 2B2VC 2M2LA 2FMMA 5T1GA 3I3CA 3QO2A 1BBXC 1HRJA 2RSOA 3P7JA 1C8CA 1G2TA 1U4MA 2JP1A 1U4RA 3F2UA 1HA6A 3IFDA 3MWYW 1VMCA 2FHTA 1QNKA 2NZ1D 1DONA 2B2TA 2X6LA 3N52A 2DY8A 1J8IA 1G6ZA 1B4OA 2CVRA 2HDMA 2KEDA 4ZKCB 1BF4A 1O7YA 1KNAA 5D65A 1O7ZA 1WTOA 5EPLA 1EQTA 2L9HA 2HUGA 2N88A 1X3QA 1AP0A 4X3TA 2B2TC 1RTOA 5CBAE 1WVLA 1BNZA 4CJ2C 1ILPA 1EOTA 1DOMA 1ML0D 4IUTA 5EJWA 3I8ZA 3TZDA 5D14A 4QUCA 1ZXTA 4ZK9B 5EPJA 1WD0A 1AZPA 3DEOA 3UI2A 2L4NA 4CJ0B 1JICA 2SDFA 1MGSA 4IURA 1PDQA 4IUVA 1X32A 4HEDA 4XDXA 1Q3LA 2XIWA 2K28A 1NR4A 1NCVA 2Q8RE 3SVMA 4X3KA 4R8IA 4IUQA 3LWEA 1F9PA 1B53A 1PLFA 2BDNA 5CMDA 1A15A 4ZAIA 2K1BA 1NR2A 2NYZD 1O80A 1ESRA 5E4WC 4O42A 3Q6SA 4U68A 3D6WA 3FDTA 2MPMA 4UAIA 1U4LA 4HAEA 5EKIA 1RHPA 5T1IA 1RTNA 3TN2A 2MJ8A 1J9OA 1EIGA 4R9WA 1DOKA 2MP1A 2Q8TA 1ILQA 2FJ2A 1DOLA 1IL8A 2KVMA 5EPKA 4HSVA 2RVLA 3FPUB 1XYIA 1JE4A 2K04A 5DNFA 4IUPA 1GUWA 1CM9A 4RWSC 1VMPA 2H1EA 2RA4A 2K05A 2L1BA 3GV3A 4MN3A 1PFMA 3GV6A 4MHEA 1SDFA 2L12A 1QG7A 1CA6A 1HFNA 2R3ZA 2DY7A 1PFNA 4RA8A 1F9QA 1MSGA 2B2YC 2D9UA 1HUMA 2K03A 1SSOA 3DEPA 4IUUA 5COYA 1G91A 3KBXA 1EIHA 3MTSA 3I90A 1DZ1A 1QE6A 1TVXA 3H91A 1WTPA 2X69A 4NW2A 1B50A 3DM1A 1RJTA 2K01A 1PFBA 3HP3A 4LMQD 2HCCA 2X6GA 1IKMA 1EL0A 1WD1A 3R93A 1HUNA 4DN4M 1E0BA 2EPBA 1G2SA 1XX8A 5CORA 2N55A 3I91A 3IL8A 1RODA 2KUMA 2J7ZA 1HFGA 4X3SA 1B3AA 1F2LA
chains in the Genus database with same CATH superfamily
2FINB 1JB7A 3HOWH 4X65Q 1L0XB 1SE8A 2EY1A 2EYMA 1MSHA 4LFAQ 4A3JG 3RD4A 3URYA 1NAPA 2R92G 2RSNA 1WTVA 5IYBG 3V96A 1BO0A 3CCJA 2OXPA 3TRZA 5IT9c 1EEFD 4OIKA 5GAHC 4A3CG 3D8GA 1NMFA 1LT4D 4AH6A 4ULLA 3K81C 1VQAA 4QL5A 1TY2A 1Y1VH 3H0GB 1GJXA 3NBIA 5LMUQ 2OTLA 1OTCA 4B3TQ 4K2LA 4FF3A 1WTOA 5LMNL 3CQZH 2HUGA 1X3QA 2IJ0A 5M3FB 4R1JA 1WYDA 4DV5L 1ENAA 3T1HQ 2B63G 1HZBA 3SK4A 1ML0D 1MHWC 4FF1A 4OWTB 1XPUA 3DEOA 4JVZA 1DJRD 3OTOQ 1X32A 2HIVA 2UUBL 1CQFA 1LTLA 4H44C 3S24A 2NUCA 5ELDA 1PZJD 2GN5A 4A3DB 3T1YQ 4YIJA 4DKAC 1S40A 2JA9A 4J1MA 3HRZC 2MO0A 5T1IA 2JA5G 2ZM6Q 1N9WA 4RGTA 1CKNA 3MXNB 2FJ2A 4DR2L 5M9OA 3S1NB 2F0KA 3AYHB 3HZXA 5FO9B 4KHVA 4K8IA 4YWLA 3SGIA 1VQ9A 2VB3X 3PMFA 2PMZB 1S72A 2DY7A 1H9RA 3SK6A 3FVQA 4ODGA 3M4YA 2YYZA 2XRSD 3HEJA 4JI3L 4DR4L 4EVOA 3HP3A 3MEFA 5M3FH 4DR6Q 4UDUC 1O7IA 2F0OA 5EKLA 2K6AA 3I91A 2EDGA 2Q2IA 3RLOA 4B3SL 2NVYB 3BZDB 4QUFA 3CCUA 1PH1A 1LM0A 4FXKC 4YCVA 1PTOF 4DU9A 3A5UA 4B08A 5C4XG 4CDEC 3HOUB 3TP7A 3AB9A 5IP7G 1LV9A 1K8OA 5HY6A 5BR8Q 1IW7D 4LF4Q 4A3DH 2ZJRA 2R92B 3PQIA 1UEBA 1F2YA 4JI4Q 4OIJA 1XPOA 1EYGA 2CFMA 3FRPB 3J81L 4DV0L 1BBWA 1HPCA 4P72A 4N9PA 4PG3A 2VQFQ 3MVVA 1BBXC 3S1NH 1CHQD 4RKLA 4JW0A 4CDCC 2BE5D 3RLFA 1VMCA 2RHQB 2GVBA 2NVQB 1VQ4A 1YEZA 1EY5A 3C46A 4ZKCB 3I2ZA 2Q2HA 2KCTA 1LTSD 2EYFA 1JJ2A 1NMGA 5JJIA 4JI1L 1RDPD 1UEAB 4KN4C 1VQMA 4XTCS 3TZDA 5EJWA 4A3IG 1IBMQ 1WD0A 2V1CC 4Z9CB 1SXTA 5F2DA 2PI2E 3UI2A 1Q81C 4BY1B 2B63B 5K36H 4R4OA 1MGSA 3NQTA 4CKCA 1OXSC 2XIWA 2Z4IA 4LFBQ 3SVMA 2B3GA 3D3RA 3HOUH 3OW7A 1U5KA 3A54A 1K9MC 1K83B 4KY5A 2NYZD 2ZT9C 4RH6A 2EVBA 1PZID 3J80c 4Q0FA 5FOBB 2NTSA 3G4SA 4R9WA 1ILQA 5IGGA 3K5LA 1D5XC 2KENA 1STNA 2ZTDA 2BH2A 3KFUA 1H9KA 2K50A 4IFDH 2CH4W 1HFNA 2NVQH 1PH6A 2P5ZX 5FK9C 1TS2A 1Z47A 4IFDI 2X69A 1QVGA 1RJTA 2K5VA 2WACA 2EXZA 4A3EG 1SLJA 4GN5A 4BXXG 1AE3A 5EGTA 1M4VA 1B3AA 4CJ1B 2JJQA 1CZWA 3OWFA 4JI5Q 2LXKA 1NE3A 2KOLA 4JI8L 1M1KC 2WB1B 2WIIB 1K83H 2B2VA 2OT2A 3HKSA 4KD4A 1MI2A 1B2TA 3G7LA 2EE1A 4ZKBB 2QDLA 4H02A 4YCWA 5ELEA 1X55A 1KXLA 3ITPA 3E0EA 4B9XA 5IGDA 1U4MA 1LO5D 2ICIA 1XTCD 4JK1C 4N9TA 1JB3A 3PUXA 3UE1A 4B9WA 5HURA 1A3UA 4C3HG 3A7LA 2M00A 1Y8OB 3HKZB 4P2CB 3S14B 1KHIA 1WVLA 1BNZA 2CW0C 2VW9A 1WI5A 4P75A 3EBEA 5C44B 1GVPA 1SJED 1PH9A 2NZOA 3O13A 3GTPB 4CJ0B 5I4DA 4JCVE 4R8IA 3U50C 5LMUL 2AQ1B 1D8LA 2BCOA 2K1BA 1EZ8A 2M9VA 5CV6A 1C7YA 1PV4A 1KTKA 1HZ9A 2K32A 1W3SA 4OGQC 3KYHC 4DV7Q 2V4DA 2VNUD 5DNFA 2IPKD 1IZ6A 1VMPA 2K33A 2UU9Q 2CW0D 3JAML 1KRSA 2WAQE 3SK8A 1HCZA 4A3BG 2B2YC 2N3SA 2XTIA 3KBXA 1A62A 3S15B 1JCKB 1PH3A 1XNQQ 1X3GA 3GTJB 1NY4A 1LLRD 2WKDA 3VDYA 2N55A 4G7HC 5C44H 2KUMA 4A3EB 4X3SA 3S16B 1KC8C 4C1NI 4P74A 4X66Q 3S9WA 3I4NG 1LT6D 4XYOA 2ID0A 2LXJA 4IFDJ 1OXUA 3WDNA 2JA6G 1WTXA 4Y52H 4CGYB 2UXDL 2E2JB 2R93G 1STGA 3MXNA 4DAMA 3H3VI 4HCEA 5IYDH 2E2IH 3TQYA 1MKHA 1S3OA 5CV7A 1A8VA 1WJJA 5C4HA 3BU2A 3BDCA 1Y1WH 1EOVA 3I3CA 4F88A 3D4WA 1BDOA 4PV1C 1PH8A 4NXNQ 1LTGD 4HJ8A 2N8NA 5DEHA 1D1IA 3W3AA 1EFWA 3A8IE 4LWCA 2DNCA 4KHPQ 3VYUA 1ZYRC 4KK7A 4DK1A 4JV5Q 5EAYA 1TS5A 3CHBD 1I4RA 1OXVA 2OCEA 3OHXC 1DOMA 4QIWB 3ERSX 4IZ8A 1AZPA 3I73A 2F0GA 3S16H 3QG1A 2L4NA 1CKNB 4RGNA 1JICA 1FYCA 4KY6A 1BCPF 2K28A 3AU7A 3LWEA 5A2QE 3CCEA 1STAA 4XYQA 3D6WA 2NN6H 4LAAA 5EKIA 4HR7B 1U4LA 5C3EB 2QEXA 4IOAA 2QDBA 4R4TA 2LMCB 3KDFB 1VQDA 1DOKA 3WOEA 2NN6I 1SFOH 2A6EC 1VQCA 4HSVA 4A3KG 4LF7L 3KJOA 4QF4A 1ZYRD 1XYIA 1LUZA 1N33Q 3S2DB 1RIPA 2K7VA 1IXRA 4DR5L 2A68D 4YY3Q 2NVXH 4LFBL 1VQGA 1SSOA 1R4PB 3KLRA 2A6HD 3H91A 1SJHD 1B44D 1LTRD 4C2MB 2CQAA 3G71A 2JSOA 3QR8A 2EYLA 1PYWD 3OIQA 5LMNW 4CBVA 2JA8B 5LHY1 1HFGA 3VR6A 1PYSB 1L1OA 1STHA 3K7AH 5JJZA 4O2DA 4KJOA 1PH5A 4JI2L 2VL6A 3NEMA 1WTQA 1QVCA 3OW2A 3HG9A 4OL7A 3HOZB 2A6ED 1UE1A 3CC7A 1CT1D 4X64Q 1A3TA 5G3LD 1GOZA 3PGZA 4DV4L 2MUYA 2NWGA 4X62L 5C3EH 4FXGC 5M5XB 1V8QA 2R93B 1XJVA 1HHVA 3S1QH 4HIOA 5IYCG 1BCPD 1CKMA 1YHBA 4A3FG 2OQ0A 1SYBA 1FJGQ 5M3MB 3PIP3 3S2DH 4DV2L 1HA6A 1QNKA 4DXFA 4JI5L 3VYSA 1HR0Q 2BDOA 2CWPA 4A3LH 5KRUA 2NVTB 1X3FA 3IAYA 2UXCQ 3MHBA 2Q2TA 3PUZA 4BY7H 3ERQA 1B7YB 5JEAH 4LFCQ 1D1KA 3PO3H 1CZGA 3UDFA 2JA8H 4A3MG 2QA4A 1Q8KA 5C4JH 1DCZA 1K28A 2E5LL 3SXHA 1F77A 1VQBA 5H1SE 5IP9H 2Q8RE 1NR4A 1VQ5A 3HOZH 1JQYD 2EYPA 4DFAA 3A56A 4KLKA 4POFA 4HIKA 4Y7NB 2IT1A 3F2CA 2R7ZG 1NR2A 3I70A 4LW1A 3H6MA 2PQEA 5CV5A 5FLMH 5E4WC 4U68A 4C56C 1YBYA 2ZXPA 4PMCA 3GTQB 3SK5A 1I94L 3T13A 4DV1L 2K5DA 1D5ZC 5M5XH 2D5DA 1ZEQX 3RUZA 2EY5A 2HQLA 3KOJA 3M9BA 3LX0A 2IX0A 4NKLA 1D7QA 5M3MH 1WCMB 1GM5A 1PFNA 1KABA 4JI7L 3G48A 1JOOA 1Q8IA 2YU9B 5IWAQ 4A93G 2NVTH 4NW2A 1JWSD 2K01A 3N6RA 2UXBQ 2WFWA 2X6GA 4DN4M 5CGKA 1R9TB 1E0BA 1DXMA 2LS01 2B2YA 4DV7L 3ONAB 1E7ZA 4K2KA 4C1NK 2IWHA 3K5NA 2B2WA 4JG2A 3NTIA 2OEOA 1PRTD 3RR5A 1EY6A 1OO9B 4NXMQ 2MO1A 1LYLA 1EQVA 4YWKA 2EJMA 1ASYA 1JR0D 3MFYA 5CBEE 4LF9L 3GTQH 3P20A 2HDLA 2KCNA 4C3IB 1WTRA 4GZYC 1RL2A 1STEA 1F9RA 2B2VC 4KI0A 3P7JA 2YTXA 1H9MA 4UP7A 2NZ1D 3H94A 4MNOA 1WCMH 2VUMG 3QB3A 4R8NA 1S5CD 1B4OA 2UUAQ 2HT1A 4A3GB 1B70B 1FNUA 5D65A 2PMZE 5EPLA 1SMYC 5GAEC 4B3MQ 2K5HA 3A7AB 1S5FD 3MAQA 4B3RL 3H15A 2O4XA 3PF5A 3J81i 3S17B 1R9TH 1EOTA 1EYCA 4QUCA 3ICEA 4DR3L 3CRKC 2MFIA 2EY6A 1B9MA 2UUCL 2QEJC 5IGEA 1EY0A 4XDXA 2F0IA 4CKEA 4UP9A 4JI0Q 4AQYL 1S5BD 4EQ5A 2IX1A 1A2UA 2R7FA 2NTTA 2CQOA 5DAUA 2JQOA 1NSNS 1EIFA 2HD3A 1SRUA 4UAIA 4GN4B 1V1QA 1VQ7A 2F0TA 4TSSA 1E1OA 5JEAJ 4C3IH 3K5OA 1WTHA 1SMYD 4LF8Q 1ET6A 1NTGA 2D0OA 2K04A 2PQAB 4IUPA 1EYAA 1MD2D 2I5LX 4PMBA 2BH8A 2E76C 5CV4A 3CC4A 2Y0SB 3D6CA 4AYBB 3I4MB 3I56A 3PCOB 1BVSA 5C0XH 1LACA 2AHOB 1Y69U 3STBC 3BS1A 2C5CA 4IUNA 3NXWA 5ELCA 1KRTA 4IN3A 3SR1A 5C0XI 5NUCA 5DLQE 4A3GH 1EIHA 2C35B 3I72A 3HOYB 5I6YA 1PFBA 2I5HA 3NWSA 1JT8A 2B8GA 5IE8A 4KKTA 3S17H 3FP9A 2BDNA 4H0LC 1DGSA 2F0VA 4BA2I 1BUVT 1I50B 3U4ZA 3NTHA 3BDLA 2VXWA 1N33L 4FXDA 4CDDC 3H0GH 3TS0A 3QOLA 2QW7A 2F0PA 1HNZQ 2B2UA 4ZLTF 3U9SA 3HFZB 3R8BA 2VQEL 2EQSA 3KDFA 3CAMA 5JOBA 5M5YB 1VQFA 2N78A 2HCIA 2K14A 1RKNA 4DV3Q 1SNOA 5JVG3 3T4AC 4RMFA 5FLXL 1FGBD 5IT9E 3H09A 1QOHA 1SN8A 3I4MH 3MXPA 4MZ9A 1DONA 3W5OA 1K8MA 2X6LA 1NBWA 3QOJA 2KEDA 4A3JB 1O7YA 1FL0A 2F4IA 1N36Q 1GUOA 3HOYH 4A4IA 4DR1L 3CCRA 3M3YB 2BA0A 1ILPA 1SR3A 2ICEC 4HJ5A 2XVSA 1VCIA 2SDFA 1G6PA 3B6YA 4LF6Q 3CXCA 4RGOS 1EWCA 3EJIA 1H9SB 4WJ4A 1PTOB 1KLGD 5CMDA 3LGJA 3OYYA 4DR7L 1DD2A 2KA7A 4XQQA 4OO1H 2JXMB 4LUZA 1HNXL 2J0TD 2BOSA 2QGQA 3PUWA 1RHPA 1I6HB 4Q5VA 1VQKA 3K0XA 4RKBA 4OWWB 1IHZA 2MJ8A 4OO1I 5CYUA 2K52A 5EPKA 3E5SA 5TSSA 1B3QA 4GKKQ 3Q23A 3FPPA 5FJ8H 2NVYH 5I6WA 3GTLB 4EGVA 2FMCA 1GUNA 1L1OB 5EBCA 3PO2G 2FXQA 3NHHA 1F9QA 2JEBI 2RDHA 2F0UA 5JJKA 4A3JH 3FMCA 5E7NA 4OXPA 1PTOC 2R92H 4LMQD 3DXJC 2ZTEA 1KAAA 1XMQL 1YNJC 2EYJA 3OMGA 5IYBH 4GKJQ 1XX8A 3PIPA 3BVGA 1HQRD 2JA5B 3HKZE 3HOVG 1WTWA 1YITA 3EIVA 4A3CH 4JC0A 3V05A 4LF5L 4POGA 4DNRB 3JAMi 2PO4A 5C0XJ 4K0KL 2IL8A 2QCPX 1UE7A 3KF8A 3IFTA 3CKIB 2N49A 5E4XA 2TMPA 1A0IA 3F2DA 1L1OC 2PZWA 2PZTA 1XMOL 1G291 1SYEA 5AJ3L 4RAUC 1SYFA 3KLSX 3ULLA 4DV6Q 1IBKQ 1I6HH 3CMEA 1N32L 1KQSA 1CKOA 1KNEA 4WRDA 3U9OA 5GADC 4ME3A 5BN3A 4FVMA 1XNRQ 1BR9A 1J5EL 4ID6A 4BY1H 2B63H 4KY7A 4OX9Q 1NNXA 3CCLA 1L0YB 3CC2A 4NB3A 5C4XB 3C1FA 1QUQA 2F3WA 3J7AV 1VQ8A 3PSIA 3S1RB 3RNUA 4GOPB 3E9HA 2RDFA 1EEID 2F4VL 4K14A 1GXDC 2JA5H 4JI6Q 2RF4A 5E1FA 5CV8A 4IURA 4IUVA 4X65L 4FYDA 1NCVA 3VA5A 4LFAL 2F1MA 3K7UC 1VQPA 2DJGC 4QJFA 5IIFA 2KHSA 1B8AA 1EY7A 2UUAL 2LSSA 2MQHA 1HTLD 3NBHA 1IYJB 2ZJQA 3OIPA 2D62A 4GLAC 3ND9A 3BJUA 1EUJA 2A69C 4UPAA 3DUZA 2EZVA 2RVLA 4I7AA 4GOPC 3QJYA 1H9JA 3L0OA 3J80E 4A3IB 2F0HA 5KYLA 4N8X1 1SDFA 1IBLQ 1D2BA 1TWFB 2AWNA 3MXUA 3EN2A 2O5IC 1C0AA 1FGUA 1VQJA 3PO2B 3NPPA 4B3TL 4M1UB 5JJLA 5C4XH 1SE2A 3F2BA 3J7YW 5IP7H 1SNQA 5FLXc 1PH7A 3DWPA 2WAQG 1WD1A 3R93A 1C48A 5KEEA 3DHQA 3NP8A 1GD7A 3T1HL 4UHVA 4C3JG 4XT3B 1YHQA 4LF8L 3FEWX 4K5VA 4M8AA 4QIWE 4YHHQ 3OTOL 1X3PA 1F2MA 3Q8DA 3GO5A 1TWCB 3M4QA 3J81c 4DUYQ 2JA7G 3T1YL 2Z6KA 2B2WC 1Y14B 1ET9A 2XWBB 2OF1A 4FF2A 3DM3A 2PQAA 2ENBA 3S14H 3KUPA 2ZM6L 2VY3A 1RF2D 1HNWQ 3TDQA 2FMMA 4PNYA 1K3BC 2KCCA 2PCFB 4LJZC 1IYUA 1Q90A 1Z6HA 2JP1A 4L6TB 4WJWA 3RN5A 1VQLA 4JYAQ 4GS3A 3GTPH 4A3IH 3CD6A 2D0PA 4DAYA 1G6ZA 1TWFH 1YZ6A 2HHHQ 1Q1BA 1Q46A 1BF4A 3TBIB 1HNZL 4ZCKA 2L0CA 3MZ5A 2L9HA 2N88A 4CDFC 2WP8J 3PIO3 5IOCA 2PZUA 2H5XA 4I7ZC 1L2FA 4ZYSA 4DR6L 1F2ZA 3I8ZA 1CTMA 1V1PB 3K59A 1PHJA 2ES2A 1P8LA 2A74C 3NSWA 4KKUA 4IPHA 1YNXA 2VZAA 4X3KA 2RQXA 4KJNA 3E0JA 1EYDA 4KKSA 4JBKA 5BR8L 1GUTA 4DXGA 2KCMA 4MTNA 1KAWA 3HOXG 4LF4L 3S15H 4HAEA 3SEBA 5G3LF 1SYDA 4C3HB 4JI4L 4ZUJA 1TWGB 3GTJH 3UDXA 2KVMA 4PQXA 4KMUC 4XXEA 4A3EH 1A63A 4YCUA 4CHTB 3DLLA 1I4XA 2F52A 1STBA 2K05A 3VR4A 2VQFL 1PFMA 4DNIA 5ISRA 2XWJB 4BBRG 4LF6L 5KGUA 4A75A 5KNBA 1G91A 5LMNQ 1N8RC 1YI2A 4NP5A 1EU3A 1YNNC 4GNXA 4DV5Q 4S3SA 1Q82C 2E2JH 1QILA 4OONA 2EPBA 1AH9A 1U0LA 2WAQB 2Q8TA 2J7ZA 3J81E 1CA5A 5C4ZA 1IBML 2ZTCA 1E2ZA 1I6VC 1H9SA 2E75C 2UUBQ 2J4XA 4WORA 1EZ6A 3AFPA 2IX3A 1HZCA 2A5HA 4BBSG 2E74C 3D4DA 4L63B 3FKIG 3A55A 2YTVA 4V190 2A8VA 4A3BB 3F1ZA 4CKBA 3HOWG 2LKVA 4IALA 2B2UC 4DR2Q 1M8AA 4C3HH 2JA7B 1SAPA 3EVQA 4H13C 4TKOB 1EY9A 1TWGH 1V9PA 2WINB 1VQOA 1N34Q 1LTID 1YHAA 3CW2C 5T1GA 2R6GA 1PYBA 5L37A 2Z0SA 3D0FA 3IRBA 2D2CC 2G9DA 1JORA 1JOKA 1YIJA 2WKCA 4JI3Q 3FHWA 4DR4Q 4JBMA 3J81j 3I4NB 1II3A 4OHJA 1V1OA 1Y8PB 3T56B 5JVH3 3L9AX 2JA6B 1Y1VG 5CBAE 4AIMA 3I4OA 5GAGC 1BQQT 2VB2X 5M5WB 5BN4A 4QB4A 1FD7D 4JBJA 1PA6A 2GVAA 1E22A 1CSQA 1QB5D 2F0FA 1KDAA 4IPCA 5KNDA 2E2DC 4OX9L 5J1ZA 1PZKD 1G51A 1KDCA 4HMIA 1ESRA 1SBBB 3R2IA 1I4PA 1K8GA 4DV0Q 4A3BH 1PRTF 5IODA 4C2MH 2F3VA 1X9NA 3JAMc 1Q12A 3KLSA 1IL2A 3RLNA 4FF4A 2PYKA 2QILA 2O2LD 1HH2P 5C3XA 1ENCA 1PVOA 4RA8A 3NUCA 3PUYA 4G57A 4HIDA 4JI1Q 1GO3E 4L5QA 3MTSA 3DWQA 3I90A 1DZ1A 4BBRB 1TVXA 3ND8A 3KF8B 4GOPA 2JA6H 4IO9A 1XPRA 4TVAB 1G2SA 3ZYYX 2R93H 1VQIA 1T5XD 4NDXA 1E3PA 2EYOA 2Z6BA 5J39A 3PUVA 1ICWA 1B9NA 4A3KB 3HGBA 5CV9A 1X65A 1RD9D 1IBLL 1E24A 5M3FG 2PI2A 3L7ZC 1EQRA 1KLUD 1R4QB 1OXTA 3K80C 2AUKA 5C5MA 2G9HD 1ONLA 4PZ7A 3A0JA 1QUQB 4LK1C 5GROA 4DPGA 2I5MX 1UNSA 3AEVA 4PZ6A 4IOCA 3QO2A 3E6ZX 2K5WA 3OWEB 4A3DG 3F2UA 2CCZA 2UU9L 2DY8A 4LNQA 2SOBA 1QWYA 3EFXD 4AYBE 4GLXA 1PFSA 1KNAA 5DM73 3OOCA 3VR2A 1RCVD 2HQEA 4Y7NH 2RCFA 5IGBA 2F0JA 2EYHA 4CJ2C 3NBHB 3J7AF 1SEBD 1OXXK 4J8QA 1XNQL 4K6DA 1M90C 1ZXTA 4HJAA 2B39A 1TS3A 4A3KH 1SNPA 1I4QA 4X66L 3NE5B 4A3FB 4JI8Q 1TY0A 3JAME 4FDBA 1J6QA 4L5SA 1A15A 4O1NA 2YU9H 3FDTA 3GQBA 3A5ZB 1VQNA 5K36G 3KK7A 2KJXA 5J22A 3BVZA 3DMUA 2O5JC 3HOUG 1GUWA 3QWNA 2L1BA 5C3WA 4MN3A 1UWVA 4TQUS 4A3MB 1NUCA 4RCNA 3C3LA 3EQLC 1JWUD 1MSGA 4NXNL 1HUMA 3L2PA 3BYYB 3J7A5 5DM63 1QE6A 1HA5A 4RGMA 3GTGB 5HGTA 2F03A 4R4QA 4KHPL 2EJGC 1XXGA 2R7ZB 1AE2A 1V1PA 3M7NA 4JV5L 3VYRA 1PXUA 4IPGA 4HN7A 4IFDG 3NELA 4ZUIA 1FNVA 2IY5B 2IHEA 4HJ9A 3BVMA 5IYCH 3S1MB 2Z4HA 4XT1B 2KECA 4KTAA 4G4KA 4A3FH 1EQQA 1SNDA 1U4PA 2JYOA 3W1BA 5IGFA 3UDIA 1ESFA 3PIOA 2F0SA 2Q2UA 4MIUA 4DAYB 4HCSA 4DK3C 1PH2A 2EY2A 2ZXOA 3TS2A 3G6JB 4BY1G 4O0AA 4A93B 1UAPA 1I3QB 4BWGB 5FKAC 4H7BA 1A2TA 1VF5C 4TRDA 4F87A 1CFMA 5D3DA 2Z6KC 4APVA 2IW3A 4DAPA 4A3MH 2B2TA 4YY3L 2CVRA 3A8JE 3V2TA 2K75A 1FNWA 1XTDA 4DA2A 3M4OB 1KDBA 4DUZQ 3AQQA 3GTGH 5C5LA 2L15A 1YJNA 3STBD 3MA2B 2R7ZH 2XSCA 4ZK9B 1EWIA 5IY0A 1G8ZD 5LL6X 4DAVA 1N34L 3TSSA 1IW7C 3TREA 3T16A 1SNCA 1L0WA 3C1EA 3S1MH 3LWUA 2KQ3A 2UXDQ 3GP7A 4DK6C 5FO8B 4X64L 2F0DA 1K73C 4EQPA 1O80A 5ELOA 4R4IA 2Q8IB 1VQ6A 2VUMB 1I4HA 2MPMA 1GKHA 3Q24A 1YJWA 1TKWB 3PF4A 5JAVA 2BE5C 4GNXB 1LTTD 3RN2A 4A93H 1I3QH 4YWMA 3FPUB 4ZQ3A 4PMWA 4ILWA 1Z9FA 1JMCA 1LT5D 2LY7A 1CM9A 2LFNA 2H1EA 2RA4A 2OTJA 1ZKOA 1I50H 3GV3A 4J15A 1SROA 3KF6B 2WB1G 2L12A 5A2QL 3NQIA 1FJGL 1EU4A 1JJCB 4BS9A 4IUUA 5I2XA 1T9HA 2GA4B 2I0QA 1KIXA 3CMAA 1EWHA 5FO7B 1WTPA 4K5WA 1HR0L 3M4OH 4E6IA 5M5YH 2UXCL 2AQ3B 4HSPA 2WB1E 2HIXA 3PV0A 4LFCL 4L5TA 4GNXC 1K8AC 1F2LA 4GN3B 5EQ0A 3CCMA 1SYCA 2MGSA 2NBFA 2L11A 3TZUA 1F9SA 1U9RA 1EY4A 3I7FA 2K5QA 1QVFA 4PZ8A 3HKZG 1P16A 1JWMD 2RDGA 1K3RA 4EX5A 4QY7A 5C44G 2VUMH 3GTKB 5AFWA 2KHIA 2SNSA 3LNNA 3Q22A 3K5MA 2CHBD 4LF7Q 3M3YH 4EQOA 1QCBD 4RHRA 3DWAA 2F0EA 4BA1I 4DR5Q 1PH4A 2EIFA 1TWAB 3JC66 3RZDB 2EJFC 3KLWA 1J8IA 1I4GA 5IYDG 3OPOA 1QZHA 1JOQA 3MXGA 1PTOH 1AEXA 3W2DA 4DNTB 5JPNC 1UE5A 5IWAL 4WFN3 1Y1WG 2UXBL 3K58A 1X6OA 1CI3M 2AKWB 1EIYB 1PTOD 4JI2Q 1AN8A 3SDZA 2DUDA 1SNMA 2PW7A 1VDZA 2C9OA 1YNJD 1MJEA 3GTLH 1HXYD 1TU2B 5ELBA 1B53A 3P1HA 4DV4Q 4OWXB 4KHZA 4X62Q 2XNAC 3GTOB 4NXML 3GTKH 3J7ZC 1W6JA 1IL8A 3U4VA 3MC0B 3A8KE 2F0NA 4DV2Q 4RG1A 1JC7A 3KBGA 1I5FA 4JOIA 1TWAH 1A3VA 3RZDH 1IYVA 2NN6G 3MFGA 2XN9C 5ELFA 3WWVA 4V0BA 3A74A 1Q1EA 3CCVA 1E1TA 1MIUA 2F3IA 1B50A 2ATWA 1Z7TA 3T53B 4K5XA 4P71A 4IJLA 2XGTA 1HUNA 4B3ML 1PMRA 3IL8A 4WJ3M 2E5LQ 1HQMC 1VQHA 3D4RA 5D3IB 3W1GA 2KEEA 2ASBA 1UE6A 1C4QA 1LABA 3GDEA 4JI0L 4IQZA 2JN4A 2QF7A 1I94Q 3GTOH 4DV1Q 3I55A 3E3XA 5JPMC 1EFID 3S1RH 2YTYA 3RZOB 1AFPA 4ALPA 2M2LA 2JEAI 2EXDA 2H4OA 2WV6D 3X3NA 1LTBD 1X3EA 4K8JA 4N8FA 2A69D 4JI7Q 4I65A 3HOVB 5I9OA 3K6OA 5C3EG 3C2PA 2I46A 4F7XA 2OQKA 2F0MA 2AUJD 1TIID 2E2IB 1QJOA 1AP0A 3VYTA 1RTOA 4HIMA 1QZGA 2SNMA 4J6HA 4NMZA 1YVCA 1Y1WB 5D14A 5KNCA 5EPJA 1HTPA 1STYA 3TP8A 4A3LG 1Y8NB 5E3FA 4IUQA 4DF7A 2ZXRA 3S2HB 4G7OC 3K57A 4BY7G 3BDOA 1S5DD 1E2VA 2A73B 5JEAG 3H3VC 2DGYA 2NZHA 2Z9HA 4LF9Q 1E2WA 3K8AA 3Q6SA 4O42A 2JA8G 3PO3G 3PO2H 4MTKA 5ELNA 2ZJPA 4DUZL 3RMHA 2IHFA 3BZCA 2PNRC 3RZOH 5IP9G 3HOZG 4KV6A 4DV3L 3AFQA 1Q86C 5HGQA 2Z8LA 3F8TA 1CK1A 4P73A 1FR3A 3BZKA 5FLMG 5EKKA 1QG7A 4LUOA 3VR5A 1CA6A 2L5TA 2R3ZA 3HOVH 2KHJA 3CPFA 2D9UA 3NTKA 1T5EA 2DN8A 3H3VH 1QNUA 3CF5A 4X6AH 1TWCH 2DJFC 4DK0A 4B3RQ 1YJ9A 1N36L 4F8MA 4ABNA 1MBYA 1TWHB 5A35A 1IKMA 5K5PA 1SFOB 2L55A 2XRQD 4DR3Q 1HZAA 2K4KA 5M3MG 4A76A 1KD1C 3CU7A 2MNAA 2UUCQ 1GHJA 2K5NA 1K0RA 1BOSA 4XQJA 5FLXE 2PPBC 4BXXH 4AQYQ 2NVXB 2RKSA 4OELB 3K0YA 5KIXA 2E2HB 1TXYA 5I2YA 1D5MC 3S2HH 4FP5D 5J3BA 1ASZA 2FFKB 4NPSA 2A68C 1S4ZA 3ER0A 1V43A 3K7AB 3EROA 3CCSA 1WFQA 3KF6A 4QQBX 1K0SA 1BBUA 1G2TA 5KYIA 4GKKL 2A6HC 3UE0A 2SEBD 3IFDA 3MWYW 2F0QA 2FHTA 3CP0A 1S5ED 4C3JB 1D6EC 2AWOA 1BCPB 3ULPA 1EY8A 2CKZB 2PW5A 1Q7YC 2A1AA 1TQOA 4HTHA 3Q0AA 3VA7A 4X3TA 2B2TC 3WOFA 3I4LA 1H95A 1CQVA 4IJHA 1TWHH 3S1QB 4XQNA 4IUTA 3G6EA 4GKJL 1YNND 3OSOA 5BN5A 1WCMG 5IT9L 3CCQA 4KN7C 1PDQA 4HEDA 4HMJA 1Q3LA 1XWEA 3MEHA 2I07B 2AQ2B 3R3OA 4FO2A 3HS0C 2VQEQ 1KL9A 3GD7A 1F9PA 2E2HH 3TMEA 2G5DA 1BCPC 2CH4A 4DGZA 4BY7B 1O7LA 1J9OA 3SHLA 3PO3B 2MP1A 3EA6A 4DV6L 1IBKL 1A6XA 2ALYB 3TP5A 5C4JB 3SE0A 4B3SQ 1O78A 1GUGA 2B29A 4RWSC 1DYQA 3VR3A 4ZRZA 1CHPD 1XNRL 4LUVA 1NJIC 2JE6I 4C3JH 2K03A 3DEPA 3NENA 2JK8A 1TS4A 1TR5A 3AMUA 5GQOA 4C3IG 4DR1Q 2QKIC 4RFBA 3U58A 4OEMB 1C9OA 2CWAA 2TSSA 3UDGA 1BKBA 2VS1A 4JBWA 3HOXB 2JA7H 3TP6A 2OWOA 3QIAA 4UP8A 5C0XG 3J80i 5LL6S 1SE3A 4QMGA 4U673 1UUPA 2E8GA 2NB0A 2BA1A 4JI6L 2MHVA 4X3UA 4A3GG 1SYGA 2YV5A 2KBNA 3M4PA 2EOTA 2F0WA 4RCOA 1VQEA 4DR7Q 3BG3A 2R61A 1HNXQ 1CUKA 5I9PA 3I4NH 2AMCB 1SE4A 3M7GA 1ICFB 1AZQA 1IKLA 2R7DA 3M85A 3X3MA 2RHSB 1ENFA 3OMCA 1PRTB 3H0GG 1X54A 2F0LA 1VF7A 4QGUA 1HRJA 5M5WH 2RSOA 4K6LA 1C8CA 1WOCA 5CR3A 3NK9A 1X56A 1U4RA 2RCNA 4R4CA 1GHKA 1FVIA 3NWTA 4FNFA 3L3OC 3N52A 2HDMA 4ME5A 3CPWA 1O7ZA 1EQTA 3CRLC 1XMQQ 4RHSA 1SMXA 5CC4A 4GLVB 4IPDA 4BBSB 3BYTB 3FKIB 3GTMB 2PNHA 2Y0SG 4AYBG 1HR0W 3HOXH 3I4MG 4LF5Q 1PRTC 5EBDA 3HOWB 2A19A 4K0KQ 3P75A 3HOYG 1B1ZA 4XIGS 4YHHL 1W6KA 3TEHB 1XMOQ 3E9IA 1PLFA 3D31A 5AJ3Q 2RBMA 4KD3A 2Y0SE 3T51B 1JE5A 1VS0A 4L5RC 4DUYL 4BBRH 1N32Q 1HJPA 1RTNA 2Z1CA 3TN2A 1EIGA 4G7ZC 1LTAD 5C6AA 1DOLA 4L8JA 1J5EQ 3IKJA 1BXTA 1JE4A 1Y1VB 1HNWL 2B8FA 1JJGA 1TT2A 1AW7A 3GV6A 4MHEA 3ULJA 3ZJYC 4JYAL 4OO1G 1MJCA 2DNEA 5COYA 3KJPA 3R2TA 2HHHL 1DM0B 4UY8C 3CQZB 4JOIC 4EQNA 3DM1A 1W2BA 4HJ7A 1LT3D 2HCCA 1EL0A 4QCLA 5IGCA 1CSPA 4BBSH 5FJ8G 1GUSA 2F4VQ 3FKIH 5CORA 3GTMH 1RODA 3J80L 4JPBW 4ZAIA
chains in the Genus database with same CATH topology
2FINB 1L0XB 2EY1A 2EYMA 1MSHA 3RD4A 3URYA 1NAPA 2RSNA 1WTVA 3V96A 1BO0A 2OXPA 1EEFD 4OIKA 3D8GA 1LT4D 4ULLA 1TY2A 3H0GB 1GJXA 3NBIA 4K2LA 4FF3A 1WTOA 2HUGA 1X3QA 2IJ0A 5M3FB 1ENAA 3SK4A 1ML0D 4FF1A 3DEOA 1DJRD 1X32A 1CQFA 4H44C 2NUCA 5ELDA 1PZJD 4A3DB 4YIJA 4J1MA 3HRZC 5T1IA 4RGTA 2FJ2A 5M9OA 3S1NB 2F0KA 3HZXA 5FO9B 4KHVA 4K8IA 2VB3X 3PMFA 2PMZB 2DY7A 1H9RA 3SK6A 3FVQA 4ODGA 3M4YA 2YYZA 2XRSD 3HEJA 4EVOA 3HP3A 4UDUC 2F0OA 5EKLA 2K6AA 3I91A 2EDGA 2NVYB 3BZDB 4QUFA 4FXKC 1PTOF 4DU9A 4B08A 3HOUB 3TP7A 3AB9A 1LV9A 1K8OA 1IW7D 2R92B 1F2YA 4OIJA 3J81L 3FRPB 1HPCA 4N9PA 3MVVA 1BBXC 1CHQD 4RKLA 2BE5D 3RLFA 1VMCA 2NVQB 1EY5A 3C46A 4ZKCB 1LTSD 2EYFA 1RDPD 1UEAB 4KN4C 4XTCS 3TZDA 5EJWA 1WD0A 4Z9CB 1SXTA 5F2DA 3UI2A 4BY1B 2B63B 5K36H 1MGSA 3NQTA 4CKCA 1OXSC 2XIWA 2Z4IA 3SVMA 3D3RA 3OW7A 3A54A 1K83B 4KY5A 2NYZD 2ZT9C 4RH6A 2EVBA 1PZID 4Q0FA 5FOBB 2NTSA 4R9WA 1ILQA 5IGGA 3K5LA 1D5XC 1STNA 1H9KA 4IFDH 1HFNA 5FK9C 1TS2A 1Z47A 4IFDI 2X69A 1RJTA 2WACA 2EXZA 5EGTA 1M4VA 1B3AA 4CJ1B 1CZWA 3OWFA 2KOLA 2WB1B 2WIIB 2B2VA 2OT2A 4KD4A 1MI2A 1B2TA 3G7LA 2EE1A 4ZKBB 5ELEA 3ITPA 4B9XA 5IGDA 1U4MA 1LO5D 2ICIA 1XTCD 4JK1C 4N9TA 1JB3A 3PUXA 4B9WA 5HURA 1A3UA 4C3HG 3A7LA 2M00A 1Y8OB 3HKZB 4P2CB 3S14B 1WVLA 1BNZA 2CW0C 5C44B 1SJED 3O13A 3GTPB 4CJ0B 5I4DA 4R8IA 2AQ1B 2BCOA 2K1BA 1EZ8A 2M9VA 5CV6A 1KTKA 2K32A 4OGQC 2V4DA 2VNUD 5DNFA 2IPKD 1VMPA 2K33A 2CW0D 3JAML 3SK8A 1HCZA 2B2YC 3KBXA 3S15B 1JCKB 3GTJB 1LLRD 2WKDA 2N55A 4G7HC 4A3EB 2KUMA 4X3SA 3S16B 4C1NI 3S9WA 1LT6D 4XYOA 2ID0A 4IFDJ 1OXUA 3WDNA 1WTXA 4CGYB 2E2JB 1STGA 3MXNA 4HCEA 5CV7A 5C4HA 3BDCA 3I3CA 4F88A 3D4WA 1BDOA 4PV1C 1LTGD 5DEHA 1D1IA 3W3AA 3A8IE 2DNCA 3VYUA 1ZYRC 4KK7A 4DK1A 1TS5A 3CHBD 1I4RA 1OXVA 3OHXC 1DOMA 4QIWB 4IZ8A 1AZPA 3I73A 2F0GA 3QG1A 2L4NA 4RGNA 1JICA 1FYCA 4KY6A 1BCPF 2K28A 3AU7A 3LWEA 5A2QE 1STAA 4XYQA 3D6WA 2NN6H 4LAAA 5EKIA 4HR7B 1U4LA 5C3EB 2QDBA 2LMCB 1DOKA 3WOEA 2NN6I 2A6EC 4HSVA 4QF4A 1ZYRD 1XYIA 3S2DB 2K7VA 2A68D 1SSOA 1R4PB 3KLRA 2A6HD 3H91A 1SJHD 1B44D 1LTRD 4C2MB 2CQAA 2JSOA 2EYLA 1PYWD 3OIQA 2JA8B 4CBVA 5LHY1 3VR6A 1HFGA 1STHA 5JJZA 4KJOA 1WTQA 3HG9A 4OL7A 3HOZB 2A6ED 1CT1D 1A3TA 5G3LD 1GOZA 2MUYA 2NWGA 4FXGC 5M5XB 1V8QA 2R93B 1HHVA 1BCPD 1SYBA 5M3MB 3PIP3 1HA6A 1QNKA 4DXFA 3VYSA 2BDOA 5KRUA 2NVTB 3IAYA 3MHBA 3PUZA 3ERQA 5JEAH 1D1KA 1CZGA 1DCZA 3SXHA 1F77A 2Q8RE 1NR4A 1JQYD 2EYPA 4DFAA 3A56A 4Y7NB 2IT1A 1NR2A 3I70A 3H6MA 2PQEA 5CV5A 5E4WC 4U68A 4C56C 2ZXPA 4PMCA 3GTQB 3SK5A 3T13A 2K5DA 1D5ZC 2D5DA 1ZEQX 3RUZA 2EY5A 3LX0A 2IX0A 4NKLA 1WCMB 1PFNA 1KABA 1JOOA 1Q8IA 2YU9B 4NW2A 1JWSD 2K01A 3N6RA 2X6GA 4DN4M 5CGKA 1R9TB 1E0BA 1DXMA 2LS01 2B2YA 3ONAB 4K2KA 4C1NK 2IWHA 3K5NA 2B2WA 3NTIA 2OEOA 1PRTD 1EY6A 1OO9B 1EQVA 2EJMA 1JR0D 3MFYA 5CBEE 3P20A 2HDLA 2KCNA 4C3IB 1WTRA 4GZYC 1STEA 1F9RA 2B2VC 4KI0A 3P7JA 1H9MA 2NZ1D 3H94A 3QB3A 4R8NA 1S5CD 1B4OA 4A3GB 1FNUA 5D65A 5EPLA 1SMYC 3A7AB 1S5FD 3MAQA 2O4XA 3S17B 1EOTA 1EYCA 4QUCA 3CRKC 2EY6A 1B9MA 5IGEA 2QEJC 1EY0A 4XDXA 2F0IA 4CKEA 1S5BD 2IX1A 1A2UA 2NTTA 5DAUA 1NSNS 4UAIA 2F0TA 4TSSA 5JEAJ 3K5OA 1SMYD 1ET6A 2K04A 4IUPA 1EYAA 1MD2D 4PMBA 2E76C 5CV4A 2Y0SB 3D6CA 4AYBB 3I4MB 5C0XH 1LACA 1Y69U 3BS1A 2C5CA 4IUNA 3NXWA 5ELCA 4IN3A 3SR1A 5C0XI 5NUCA 1EIHA 3I72A 3HOYB 5I6YA 1PFBA 3NWSA 2B8GA 4KKTA 2BDNA 4H0LC 2F0VA 4BA2I 1BUVT 1I50B 3NTHA 3BDLA 2VXWA 4FXDA 3QOLA 2F0PA 2B2UA 4ZLTF 3U9SA 3R8BA 5JOBA 5M5YB 2HCIA 1RKNA 1SNOA 5JVG3 3T4AC 5FLXL 1FGBD 5IT9E 3H09A 1QOHA 3MXPA 1DONA 1K8MA 2X6LA 3QOJA 2KEDA 4A3JB 1O7YA 2F4IA 1GUOA 3M3YB 2BA0A 1ILPA 2ICEC 2XVSA 1VCIA 2SDFA 4RGOS 1EWCA 3EJIA 1H9SB 1PTOB 1KLGD 5CMDA 1DD2A 2KA7A 4XQQA 4OO1H 2JXMB 2J0TD 2BOSA 3PUWA 1RHPA 1I6HB 4Q5VA 4RKBA 1IHZA 2MJ8A 4OO1I 5CYUA 5EPKA 3E5SA 5TSSA 3Q23A 3FPPA 5I6WA 3GTLB 4EGVA 2FMCA 1GUNA 5EBCA 3NHHA 1F9QA 2JEBI 2RDHA 2F0UA 3FMCA 1PTOC 4LMQD 3DXJC 1KAAA 1YNJC 2EYJA 3OMGA 1XX8A 3BVGA 1HQRD 2JA5B 1WTWA 3V05A 4DNRB 2PO4A 5C0XJ 2IL8A 2QCPX 3KF8A 5E4XA 3IFTA 3CKIB 2TMPA 2PZWA 2PZTA 1G291 1SYEA 4RAUC 1SYFA 3KLSX 1KNEA 4WRDA 3U9OA 5BN3A 4FVMA 1BR9A 4ID6A 4KY7A 1L0YB 5C4XB 3C1FA 2F3WA 3J7AV 3S1RB 2RDFA 1EEID 4K14A 1GXDC 5E1FA 5CV8A 4IURA 4IUVA 4FYDA 1NCVA 3VA5A 2F1MA 5IIFA 2KHSA 1EY7A 1HTLD 3NBHA 3OIPA 2D62A 3ND9A 2A69C 3DUZA 2EZVA 2RVLA 3QJYA 1H9JA 3J80E 4A3IB 2F0HA 5KYLA 1SDFA 1D2BA 1TWFB 2AWNA 3MXUA 2O5IC 3PO2B 3NPPA 4M1UB 1SE2A 3J7YW 1SNQA 3DWPA 1WD1A 3R93A 1C48A 5KEEA 3DHQA 3NP8A 4C3JG 4XT3B 3FEWX 4K5VA 4M8AA 1X3PA 1F2MA 3GO5A 1TWCB 2B2WC 1ET9A 2XWBB 2OF1A 4FF2A 2ENBA 3KUPA 1RF2D 3TDQA 2FMMA 4PNYA 2KCCA 2PCFB 4LJZC 1IYUA 1Q90A 1Z6HA 2JP1A 4L6TB 4WJWA 4DAYA 1G6ZA 1Q1BA 1BF4A 3TBIB 2L0CA 3MZ5A 2L9HA 2N88A 2WP8J 3PIO3 5IOCA 2PZUA 4I7ZC 4ZYSA 1F2ZA 3I8ZA 1CTMA 1V1PB 3K59A 2A74C 3NSWA 4KKUA 4X3KA 2RQXA 4KJNA 3E0JA 1EYDA 4KKSA 1GUTA 4DXGA 4HAEA 3SEBA 5G3LF 1SYDA 4C3HB 4ZUJA 1TWGB 2KVMA 4PQXA 4KMUC 4XXEA 4CHTB 1I4XA 2K05A 1STBA 3VR4A 1PFMA 5ISRA 2XWJB 5KGUA 5KNBA 1G91A 4NP5A 1EU3A 1YNNC 4S3SA 1QILA 2EPBA 3J81E 2WAQB 2Q8TA 2J7ZA 1CA5A 5C4ZA 1E2ZA 1I6VC 1H9SA 2E75C 2J4XA 4WORA 1EZ6A 2IX3A 2A5HA 2E74C 3D4DA 4L63B 3A55A 4A3BB 4V190 4CKBA 2LKVA 4IALA 2B2UC 2JA7B 1M8AA 1SAPA 3EVQA 4H13C 4TKOB 1EY9A 2WINB 1LTID 5T1GA 2R6GA 2D2CC 2G9DA 1JORA 1JOKA 2WKCA 3I4NB 1II3A 4OHJA 1V1OA 1Y8PB 3T56B 5JVH3 3L9AX 2JA6B 5CBAE 1BQQT 2VB2X 5M5WB 5BN4A 4QB4A 1FD7D 1QB5D 2F0FA 1KDAA 5KNDA 2E2DC 5J1ZA 1PZKD 1KDCA 4HMIA 1ESRA 1SBBB 3R2IA 1I4PA 1PRTF 5IODA 2F3VA 1Q12A 3KLSA 4FF4A 2PYKA 2QILA 2O2LD 5C3XA 1ENCA 4RA8A 3NUCA 3PUYA 4G57A 3MTSA 3DWQA 3I90A 1DZ1A 4BBRB 1TVXA 3ND8A 1G2SA 3ZYYX 1T5XD 4NDXA 2EYOA 5J39A 3PUVA 1ICWA 1B9NA 4A3KB 3HGBA 5CV9A 1RD9D 3L7ZC 1KLUD 1R4QB 1OXTA 5C5MA 2AUKA 2G9HD 1ONLA 4LK1C 1UNSA 3QO2A 3E6ZX 2K5WA 3OWEB 3F2UA 2DY8A 2SOBA 1QWYA 3EFXD 5DM73 1KNAA 3OOCA 3VR2A 1RCVD 2HQEA 5IGBA 2F0JA 2EYHA 4CJ2C 3J7AF 1SEBD 1OXXK 4J8QA 4K6DA 1ZXTA 2B39A 1TS3A 1SNPA 1I4QA 3NE5B 4A3FB 1TY0A 3JAME 1A15A 4O1NA 3FDTA 3GQBA 5K36G 3KK7A 2KJXA 5J22A 3BVZA 3DMUA 2O5JC 1GUWA 3QWNA 2L1BA 5C3WA 4MN3A 4TQUS 4A3MB 1NUCA 4RCNA 3C3LA 3EQLC 1JWUD 1MSGA 1HUMA 3BYYB 5DM63 1QE6A 1HA5A 4RGMA 3GTGB 5HGTA 2F03A 2EJGC 1XXGA 2R7ZB 1V1PA 3M7NA 3VYRA 1PXUA 4HN7A 4IFDG 4ZUIA 1FNVA 3BVMA 3S1MB 2Z4HA 4XT1B 2KECA 4KTAA 4G4KA 1SNDA 1U4PA 2JYOA 5IGFA 1ESFA 2F0SA 4MIUA 4HCSA 2EY2A 2ZXOA 3G6JB 4A93B 1UAPA 1I3QB 4BWGB 5FKAC 4H7BA 1A2TA 1VF5C 4TRDA 4F87A 1CFMA 5D3DA 2IW3A 4DAPA 2B2TA 2CVRA 3A8JE 3V2TA 1FNWA 4DA2A 3M4OB 1KDBA 5C5LA 3MA2B 2XSCA 4ZK9B 1G8ZD 5LL6X 4DAVA 3TSSA 1IW7C 3T16A 1SNCA 3C1EA 3LWUA 2KQ3A 3GP7A 5FO8B 2F0DA 4EQPA 1O80A 2Q8IB 2VUMB 1I4HA 2MPMA 3Q24A 1TKWB 5JAVA 2BE5C 1LTTD 3FPUB 4ZQ3A 4PMWA 4ILWA 1LT5D 2LY7A 1CM9A 2LFNA 2H1EA 2RA4A 1ZKOA 3GV3A 2L12A 5A2QL 3NQIA 1EU4A 4BS9A 4IUUA 5I2XA 2GA4B 1EWHA 5FO7B 1WTPA 4K5WA 4E6IA 2AQ3B 4HSPA 3PV0A 1F2LA 5EQ0A 1SYCA 2MGSA 2NBFA 2L11A 3TZUA 1F9SA 1U9RA 1EY4A 2K5QA 1JWMD 2RDGA 3GTKB 5AFWA 2SNSA 3LNNA 3Q22A 3K5MA 2CHBD 4EQOA 1QCBD 4RHRA 3DWAA 2F0EA 4BA1I 1TWAB 3RZDB 2EJFC 1J8IA 1I4GA 3OPOA 1JOQA 3MXGA 1PTOH 1AEXA 3W2DA 4DNTB 5JPNC 4WFN3 3K58A 1CI3M 1PTOD 1AN8A 3SDZA 1SNMA 2PW7A 1VDZA 2C9OA 1YNJD 1HXYD 1TU2B 5ELBA 1B53A 3P1HA 4KHZA 2XNAC 3GTOB 1W6JA 1IL8A 3MC0B 3A8KE 2F0NA 1JC7A 3KBGA 1A3VA 1IYVA 2NN6G 3MFGA 2XN9C 5ELFA 4V0BA 1Q1EA 1B50A 1Z7TA 3T53B 4K5XA 1HUNA 1PMRA 3IL8A 1HQMC 3D4RA 5D3IB 2KEEA 1C4QA 1LABA 4IQZA 2QF7A 5JPMC 1EFID 3RZOB 1AFPA 2M2LA 2JEAI 2H4OA 2WV6D 3X3NA 1LTBD 4K8JA 2A69D 4I65A 3HOVB 5I9OA 3K6OA 3C2PA 2I46A 4F7XA 2F0MA 2AUJD 1TIID 2E2IB 1QJOA 1AP0A 3VYTA 1RTOA 2SNMA 4J6HA 4NMZA 1Y1WB 5D14A 5KNCA 5EPJA 1HTPA 1STYA 3TP8A 1Y8NB 5E3FA 4IUQA 4DF7A 2ZXRA 3S2HB 4G7OC 3K57A 3BDOA 1S5DD 1E2VA 2A73B 5JEAG 3H3VC 1E2WA 3Q6SA 4O42A 3RMHA 2PNRC 4KV6A 2Z8LA 1CK1A 1FR3A 5EKKA 1QG7A 1CA6A 3VR5A 2L5TA 2R3ZA 3NTKA 2D9UA 1T5EA 2DN8A 1QNUA 4DK0A 4F8MA 4ABNA 1MBYA 1TWHB 5A35A 1IKMA 5K5PA 1SFOB 2L55A 2XRQD 3CU7A 1GHJA 1BOSA 4XQJA 5FLXE 2PPBC 2NVXB 2RKSA 3K0YA 5KIXA 2E2HB 5I2YA 1D5MC 4FP5D 2FFKB 2A68C 1S4ZA 1V43A 3K7AB 3EROA 1G2TA 5KYIA 2A6HC 2SEBD 3IFDA 3MWYW 2F0QA 2FHTA 1S5ED 4C3JB 1D6EC 2AWOA 1BCPB 1EY8A 2PW5A 1TQOA 4HTHA 3Q0AA 3VA7A 4X3TA 2B2TC 3WOFA 3I4LA 1CQVA 3S1QB 4XQNA 4IUTA 1YNND 3OSOA 5BN5A 5IT9L 4KN7C 1PDQA 4HEDA 4HMJA 1Q3LA 1XWEA 3MEHA 2I07B 2AQ2B 3R3OA 4FO2A 3HS0C 3GD7A 1F9PA 3TMEA 1BCPC 4DGZA 4BY7B 1O7LA 1J9OA 3SHLA 3PO3B 2MP1A 3EA6A 1A6XA 3TP5A 5C4JB 3SE0A 1O78A 1GUGA 4RWSC 1DYQA 3VR3A 4ZRZA 1CHPD 2JE6I 2K03A 3DEPA 1TS4A 1TR5A 3AMUA 4C3IG 2QKIC 4RFBA 2TSSA 4JBWA 3HOXB 3TP6A 3QIAA 5C0XG 5LL6S 1SE3A 4QMGA 4U673 1UUPA 2NB0A 2BA1A 2MHVA 4X3UA 1SYGA 2EOTA 2F0WA 4RCOA 3BG3A 2R61A 5I9PA 3M7GA 1SE4A 1AZQA 1IKLA 3M85A 3X3MA 1ENFA 3OMCA 1PRTB 2F0LA 1VF7A 1HRJA 2RSOA 4K6LA 1C8CA 5CR3A 3NK9A 1U4RA 1GHKA 3NWTA 4FNFA 3L3OC 3N52A 2HDMA 4ME5A 1O7ZA 1EQTA 3CRLC 4RHSA 5CC4A 4BBSB 3BYTB 3FKIB 3GTMB 1PRTC 5EBDA 3HOWB 3P75A 1B1ZA 4XIGS 1W6KA 1PLFA 3D31A 2RBMA 4KD3A 3T51B 1RTNA 2Z1CA 3TN2A 1EIGA 4G7ZC 1LTAD 5C6AA 1DOLA 4L8JA 3IKJA 1BXTA 1JE4A 1Y1VB 2B8FA 1TT2A 1AW7A 3GV6A 4MHEA 4OO1G 2DNEA 5COYA 3R2TA 1DM0B 3CQZB 4EQNA 3DM1A 1LT3D 2HCCA 1EL0A 4QCLA 5IGCA 1GUSA 5CORA 1RODA 3J80L 4ZAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2Y A;  2FIN B;  4XT3 B;  3ONA B;  5EQ0 A;  5JJZ A;  1WTW A;  4QUF A;  1MSH A;  1ICW A;  1WTQ A;  2MGS A;  2VXW A;  4X3U A;  4CJ1 B;  1X3P A;  2L11 A;  2B2W A;  1NAP A;  2EOT A;  4XT1 B;  2RSN A;  2IL8 A;  2KEC A;  1LV9 A;  2KEE A;  5E4X A;  1WTV A;  2B2U A;  1F9S A;  2KOL A;  4ZLT F;  1WTX A;  1U4P A;  2JYO A;  1BO0 A;  2B2V A;  4RAU C;  4HCS A;  1MI2 A;  2NWG A;  1B2T A;  2B2W C;  3G7L A;  2EE1 A;  4OIK A;  1IKL A;  2FFK B;  5AFW A;  2HCI A;  4OIJ A;  5CBE E;  1AZQ A;  2HDL A;  2B2U C;  4ZKB B;  1M8A A;  1KNE A;  1WTR A;  1S4Z A;  1SAP A;  1HHV A;  3KUP A;  1CA5 A;  1F9R A;  2B2V C;  2M2L A;  2FMM A;  5T1G A;  3I3C A;  3QO2 A;  1BBX C;  1HRJ A;  2RSO A;  3P7J A;  1C8C A;  1G2T A;  1U4M A;  2JP1 A;  1U4R A;  3F2U A;  1HA6 A;  3IFD A;  3MWY W;  1VMC A;  2FHT A;  1QNK A;  2NZ1 D;  1DON A;  2B2T A;  2X6L A;  3N52 A;  2DY8 A;  1J8I A;  1G6Z A;  1B4O A;  2CVR A;  2HDM A;  2KED A;  4ZKC B;  1BF4 A;  1O7Y A;  1KNA A;  5D65 A;  1O7Z A;  1WTO A;  5EPL A;  1EQT A;  2L9H A;  2HUG A;  2N88 A;  1X3Q A;  1AP0 A;  4X3T A;  2B2T C;  1RTO A;  5CBA E;  1WVL A;  1BNZ A;  4CJ2 C;  1ILP A;  1EOT A;  1DOM A;  1ML0 D;  4IUT A;  5EJW A;  3I8Z A;  3TZD A;  5D14 A;  4QUC A;  1ZXT A;  4ZK9 B;  5EPJ A;  1WD0 A;  1AZP A;  3DEO A;  3UI2 A;  2L4N A;  4CJ0 B;  1JIC A;  2SDF A;  1MGS A;  4IUR A;  1PDQ A;  4IUV A;  1X32 A;  4HED A;  4XDX A;  1Q3L A;  2XIW A;  2K28 A;  1NR4 A;  1NCV A;  2Q8R E;  3SVM A;  4X3K A;  4R8I A;  4IUQ A;  3LWE A;  1F9P A;  1B53 A;  1PLF A;  2BDN A;  5CMD A;  1A15 A;  4ZAI A;  2K1B A;  1NR2 A;  2NYZ D;  1O80 A;  1ESR A;  5E4W C;  4O42 A;  3Q6S A;  4U68 A;  3D6W A;  3FDT A;  2MPM A;  4UAI A;  1U4L A;  4HAE A;  5EKI A;  1RHP A;  5T1I A;  1RTN A;  3TN2 A;  2MJ8 A;  1J9O A;  1EIG A;  4R9W A;  1DOK A;  2MP1 A;  2Q8T A;  1ILQ A;  2FJ2 A;  1DOL A;  1IL8 A;  2KVM A;  5EPK A;  4HSV A;  2RVL A;  3FPU B;  1XYI A;  1JE4 A;  2K04 A;  5DNF A;  4IUP A;  1GUW A;  1CM9 A;  4RWS C;  1VMP A;  2H1E A;  2RA4 A;  2K05 A;  2L1B A;  3GV3 A;  4MN3 A;  1PFM A;  3GV6 A;  4MHE A;  1SDF A;  2L12 A;  1QG7 A;  1CA6 A;  1HFN A;  2R3Z A;  2DY7 A;  1PFN A;  4RA8 A;  1F9Q A;  1MSG A;  2B2Y C;  2D9U A;  1HUM A;  2K03 A;  1SSO A;  3DEP A;  4IUU A;  5COY A;  1G91 A;  3KBX A;  1EIH A;  3MTS A;  3I90 A;  1DZ1 A;  1QE6 A;  1TVX A;  3H91 A;  1WTP A;  2X69 A;  4NW2 A;  1B50 A;  3DM1 A;  1RJT A;  2K01 A;  1PFB A;  3HP3 A;  4LMQ D;  2HCC A;  2X6G A;  1IKM A;  1EL0 A;  1WD1 A;  3R93 A;  1HUN A;  4DN4 M;  1E0B A;  2EPB A;  1G2S A;  1XX8 A;  5COR A;  2N55 A;  3I91 A;  3IL8 A;  1ROD A;  2KUM A;  2J7Z A;  1HFG A;  4X3S A;  1B3A A;  1F2L A; 
#chains in the Genus database with same CATH topology
 2FIN B;  1JB7 A;  3HOW H;  4X65 Q;  1L0X B;  1SE8 A;  2EY1 A;  2EYM A;  1MSH A;  4LFA Q;  4A3J G;  3RD4 A;  3URY A;  1NAP A;  2R92 G;  2RSN A;  1WTV A;  5IYB G;  3V96 A;  1BO0 A;  3CCJ A;  2OXP A;  3TRZ A;  5IT9 c;  1EEF D;  4OIK A;  5GAH C;  4A3C G;  3D8G A;  1NMF A;  1LT4 D;  4AH6 A;  4ULL A;  3K81 C;  1VQA A;  4QL5 A;  1TY2 A;  1Y1V H;  3H0G B;  1GJX A;  3NBI A;  5LMU Q;  2OTL A;  1OTC A;  4B3T Q;  4K2L A;  4FF3 A;  1WTO A;  5LMN L;  3CQZ H;  2HUG A;  1X3Q A;  2IJ0 A;  5M3F B;  4R1J A;  1WYD A;  4DV5 L;  1ENA A;  3T1H Q;  2B63 G;  1HZB A;  3SK4 A;  1ML0 D;  1MHW C;  4FF1 A;  4OWT B;  1XPU A;  3DEO A;  4JVZ A;  1DJR D;  3OTO Q;  1X32 A;  2HIV A;  2UUB L;  1CQF A;  1LTL A;  4H44 C;  3S24 A;  2NUC A;  5ELD A;  1PZJ D;  2GN5 A;  4A3D B;  3T1Y Q;  4YIJ A;  4DKA C;  1S40 A;  2JA9 A;  4J1M A;  3HRZ C;  2MO0 A;  5T1I A;  2JA5 G;  2ZM6 Q;  1N9W A;  4RGT A;  1CKN A;  3MXN B;  2FJ2 A;  4DR2 L;  5M9O A;  3S1N B;  2F0K A;  3AYH B;  3HZX A;  5FO9 B;  4KHV A;  4K8I A;  4YWL A;  3SGI A;  1VQ9 A;  2VB3 X;  3PMF A;  2PMZ B;  1S72 A;  2DY7 A;  1H9R A;  3SK6 A;  3FVQ A;  4ODG A;  3M4Y A;  2YYZ A;  2XRS D;  3HEJ A;  4JI3 L;  4DR4 L;  4EVO A;  3HP3 A;  3MEF A;  5M3F H;  4DR6 Q;  4UDU C;  1O7I A;  2F0O A;  5EKL A;  2K6A A;  3I91 A;  2EDG A;  2Q2I A;  3RLO A;  4B3S L;  2NVY B;  3BZD B;  4QUF A;  3CCU A;  1PH1 A;  1LM0 A;  4FXK C;  4YCV A;  1PTO F;  4DU9 A;  3A5U A;  4B08 A;  5C4X G;  4CDE C;  3HOU B;  3TP7 A;  3AB9 A;  5IP7 G;  1LV9 A;  1K8O A;  5HY6 A;  5BR8 Q;  1IW7 D;  4LF4 Q;  4A3D H;  2ZJR A;  2R92 B;  3PQI A;  1UEB A;  1F2Y A;  4JI4 Q;  4OIJ A;  1XPO A;  1EYG A;  2CFM A;  3FRP B;  3J81 L;  4DV0 L;  1BBW A;  1HPC A;  4P72 A;  4N9P A;  4PG3 A;  2VQF Q;  3MVV A;  1BBX C;  3S1N H;  1CHQ D;  4RKL A;  4JW0 A;  4CDC C;  2BE5 D;  3RLF A;  1VMC A;  2RHQ B;  2GVB A;  2NVQ B;  1VQ4 A;  1YEZ A;  1EY5 A;  3C46 A;  4ZKC B;  3I2Z A;  2Q2H A;  2KCT A;  1LTS D;  2EYF A;  1JJ2 A;  1NMG A;  5JJI A;  4JI1 L;  1RDP D;  1UEA B;  4KN4 C;  1VQM A;  4XTC S;  3TZD A;  5EJW A;  4A3I G;  1IBM Q;  1WD0 A;  2V1C C;  4Z9C B;  1SXT A;  5F2D A;  2PI2 E;  3UI2 A;  1Q81 C;  4BY1 B;  2B63 B;  5K36 H;  4R4O A;  1MGS A;  3NQT A;  4CKC A;  1OXS C;  2XIW A;  2Z4I A;  4LFB Q;  3SVM A;  2B3G A;  3D3R A;  3HOU H;  3OW7 A;  1U5K A;  3A54 A;  1K9M C;  1K83 B;  4KY5 A;  2NYZ D;  2ZT9 C;  4RH6 A;  2EVB A;  1PZI D;  3J80 c;  4Q0F A;  5FOB B;  2NTS A;  3G4S A;  4R9W A;  1ILQ A;  5IGG A;  3K5L A;  1D5X C;  2KEN A;  1STN A;  2ZTD A;  2BH2 A;  3KFU A;  1H9K A;  2K50 A;  4IFD H;  2CH4 W;  1HFN A;  2NVQ H;  1PH6 A;  2P5Z X;  5FK9 C;  1TS2 A;  1Z47 A;  4IFD I;  2X69 A;  1QVG A;  1RJT A;  2K5V A;  2WAC A;  2EXZ A;  4A3E G;  1SLJ A;  4GN5 A;  4BXX G;  1AE3 A;  5EGT A;  1M4V A;  1B3A A;  4CJ1 B;  2JJQ A;  1CZW A;  3OWF A;  4JI5 Q;  2LXK A;  1NE3 A;  2KOL A;  4JI8 L;  1M1K C;  2WB1 B;  2WII B;  1K83 H;  2B2V A;  2OT2 A;  3HKS A;  4KD4 A;  1MI2 A;  1B2T A;  3G7L A;  2EE1 A;  4ZKB B;  2QDL A;  4H02 A;  4YCW A;  5ELE A;  1X55 A;  1KXL A;  3ITP A;  3E0E A;  4B9X A;  5IGD A;  1U4M A;  1LO5 D;  2ICI A;  1XTC D;  4JK1 C;  4N9T A;  1JB3 A;  3PUX A;  3UE1 A;  4B9W A;  5HUR A;  1A3U A;  4C3H G;  3A7L A;  2M00 A;  1Y8O B;  3HKZ B;  4P2C B;  3S14 B;  1KHI A;  1WVL A;  1BNZ A;  2CW0 C;  2VW9 A;  1WI5 A;  4P75 A;  3EBE A;  5C44 B;  1GVP A;  1SJE D;  1PH9 A;  2NZO A;  3O13 A;  3GTP B;  4CJ0 B;  5I4D A;  4JCV E;  4R8I A;  3U50 C;  5LMU L;  2AQ1 B;  1D8L A;  2BCO A;  2K1B A;  1EZ8 A;  2M9V A;  5CV6 A;  1C7Y A;  1PV4 A;  1KTK A;  1HZ9 A;  2K32 A;  1W3S A;  4OGQ C;  3KYH C;  4DV7 Q;  2V4D A;  2VNU D;  5DNF A;  2IPK D;  1IZ6 A;  1VMP A;  2K33 A;  2UU9 Q;  2CW0 D;  3JAM L;  1KRS A;  2WAQ E;  3SK8 A;  1HCZ A;  4A3B G;  2B2Y C;  2N3S A;  2XTI A;  3KBX A;  1A62 A;  3S15 B;  1JCK B;  1PH3 A;  1XNQ Q;  1X3G A;  3GTJ B;  1NY4 A;  1LLR D;  2WKD A;  3VDY A;  2N55 A;  4G7H C;  5C44 H;  2KUM A;  4A3E B;  4X3S A;  3S16 B;  1KC8 C;  4C1N I;  4P74 A;  4X66 Q;  3S9W A;  3I4N G;  1LT6 D;  4XYO A;  2ID0 A;  2LXJ A;  4IFD J;  1OXU A;  3WDN A;  2JA6 G;  1WTX A;  4Y52 H;  4CGY B;  2UXD L;  2E2J B;  2R93 G;  1STG A;  3MXN A;  4DAM A;  3H3V I;  4HCE A;  5IYD H;  2E2I H;  3TQY A;  1MKH A;  1S3O A;  5CV7 A;  1A8V A;  1WJJ A;  5C4H A;  3BU2 A;  3BDC A;  1Y1W H;  1EOV A;  3I3C A;  4F88 A;  3D4W A;  1BDO A;  4PV1 C;  1PH8 A;  4NXN Q;  1LTG D;  4HJ8 A;  2N8N A;  5DEH A;  1D1I A;  3W3A A;  1EFW A;  3A8I E;  4LWC A;  2DNC A;  4KHP Q;  3VYU A;  1ZYR C;  4KK7 A;  4DK1 A;  4JV5 Q;  5EAY A;  1TS5 A;  3CHB D;  1I4R A;  1OXV A;  2OCE A;  3OHX C;  1DOM A;  4QIW B;  3ERS X;  4IZ8 A;  1AZP A;  3I73 A;  2F0G A;  3S16 H;  3QG1 A;  2L4N A;  1CKN B;  4RGN A;  1JIC A;  1FYC A;  4KY6 A;  1BCP F;  2K28 A;  3AU7 A;  3LWE A;  5A2Q E;  3CCE A;  1STA A;  4XYQ A;  3D6W A;  2NN6 H;  4LAA A;  5EKI A;  4HR7 B;  1U4L A;  5C3E B;  2QEX A;  4IOA A;  2QDB A;  4R4T A;  2LMC B;  3KDF B;  1VQD A;  1DOK A;  3WOE A;  2NN6 I;  1SFO H;  2A6E C;  1VQC A;  4HSV A;  4A3K G;  4LF7 L;  3KJO A;  4QF4 A;  1ZYR D;  1XYI A;  1LUZ A;  1N33 Q;  3S2D B;  1RIP A;  2K7V A;  1IXR A;  4DR5 L;  2A68 D;  4YY3 Q;  2NVX H;  4LFB L;  1VQG A;  1SSO A;  1R4P B;  3KLR A;  2A6H D;  3H91 A;  1SJH D;  1B44 D;  1LTR D;  4C2M B;  2CQA A;  3G71 A;  2JSO A;  3QR8 A;  2EYL A;  1PYW D;  3OIQ A;  5LMN W;  4CBV A;  2JA8 B;  5LHY 1;  1HFG A;  3VR6 A;  1PYS B;  1L1O A;  1STH A;  3K7A H;  5JJZ A;  4O2D A;  4KJO A;  1PH5 A;  4JI2 L;  2VL6 A;  3NEM A;  1WTQ A;  1QVC A;  3OW2 A;  3HG9 A;  4OL7 A;  3HOZ B;  2A6E D;  1UE1 A;  3CC7 A;  1CT1 D;  4X64 Q;  1A3T A;  5G3L D;  1GOZ A;  3PGZ A;  4DV4 L;  2MUY A;  2NWG A;  4X62 L;  5C3E H;  4FXG C;  5M5X B;  1V8Q A;  2R93 B;  1XJV A;  1HHV A;  3S1Q H;  4HIO A;  5IYC G;  1BCP D;  1CKM A;  1YHB A;  4A3F G;  2OQ0 A;  1SYB A;  1FJG Q;  5M3M B;  3PIP 3;  3S2D H;  4DV2 L;  1HA6 A;  1QNK A;  4DXF A;  4JI5 L;  3VYS A;  1HR0 Q;  2BDO A;  2CWP A;  4A3L H;  5KRU A;  2NVT B;  1X3F A;  3IAY A;  2UXC Q;  3MHB A;  2Q2T A;  3PUZ A;  4BY7 H;  3ERQ A;  1B7Y B;  5JEA H;  4LFC Q;  1D1K A;  3PO3 H;  1CZG A;  3UDF A;  2JA8 H;  4A3M G;  2QA4 A;  1Q8K A;  5C4J H;  1DCZ A;  1K28 A;  2E5L L;  3SXH A;  1F77 A;  1VQB A;  5H1S E;  5IP9 H;  2Q8R E;  1NR4 A;  1VQ5 A;  3HOZ H;  1JQY D;  2EYP A;  4DFA A;  3A56 A;  4KLK A;  4POF A;  4HIK A;  4Y7N B;  2IT1 A;  3F2C A;  2R7Z G;  1NR2 A;  3I70 A;  4LW1 A;  3H6M A;  2PQE A;  5CV5 A;  5FLM H;  5E4W C;  4U68 A;  4C56 C;  1YBY A;  2ZXP A;  4PMC A;  3GTQ B;  3SK5 A;  1I94 L;  3T13 A;  4DV1 L;  2K5D A;  1D5Z C;  5M5X H;  2D5D A;  1ZEQ X;  3RUZ A;  2EY5 A;  2HQL A;  3KOJ A;  3M9B A;  3LX0 A;  2IX0 A;  4NKL A;  1D7Q A;  5M3M H;  1WCM B;  1GM5 A;  1PFN A;  1KAB A;  4JI7 L;  3G48 A;  1JOO A;  1Q8I A;  2YU9 B;  5IWA Q;  4A93 G;  2NVT H;  4NW2 A;  1JWS D;  2K01 A;  3N6R A;  2UXB Q;  2WFW A;  2X6G A;  4DN4 M;  5CGK A;  1R9T B;  1E0B A;  1DXM A;  2LS0 1;  2B2Y A;  4DV7 L;  3ONA B;  1E7Z A;  4K2K A;  4C1N K;  2IWH A;  3K5N A;  2B2W A;  4JG2 A;  3NTI A;  2OEO A;  1PRT D;  3RR5 A;  1EY6 A;  1OO9 B;  4NXM Q;  2MO1 A;  1LYL A;  1EQV A;  4YWK A;  2EJM A;  1ASY A;  1JR0 D;  3MFY A;  5CBE E;  4LF9 L;  3GTQ H;  3P20 A;  2HDL A;  2KCN A;  4C3I B;  1WTR A;  4GZY C;  1RL2 A;  1STE A;  1F9R A;  2B2V C;  4KI0 A;  3P7J A;  2YTX A;  1H9M A;  4UP7 A;  2NZ1 D;  3H94 A;  4MNO A;  1WCM H;  2VUM G;  3QB3 A;  4R8N A;  1S5C D;  1B4O A;  2UUA Q;  2HT1 A;  4A3G B;  1B70 B;  1FNU A;  5D65 A;  2PMZ E;  5EPL A;  1SMY C;  5GAE C;  4B3M Q;  2K5H A;  3A7A B;  1S5F D;  3MAQ A;  4B3R L;  3H15 A;  2O4X A;  3PF5 A;  3J81 i;  3S17 B;  1R9T H;  1EOT A;  1EYC A;  4QUC A;  3ICE A;  4DR3 L;  3CRK C;  2MFI A;  2EY6 A;  1B9M A;  2UUC L;  2QEJ C;  5IGE A;  1EY0 A;  4XDX A;  2F0I A;  4CKE A;  4UP9 A;  4JI0 Q;  4AQY L;  1S5B D;  4EQ5 A;  2IX1 A;  1A2U A;  2R7F A;  2NTT A;  2CQO A;  5DAU A;  2JQO A;  1NSN S;  1EIF A;  2HD3 A;  1SRU A;  4UAI A;  4GN4 B;  1V1Q A;  1VQ7 A;  2F0T A;  4TSS A;  1E1O A;  5JEA J;  4C3I H;  3K5O A;  1WTH A;  1SMY D;  4LF8 Q;  1ET6 A;  1NTG A;  2D0O A;  2K04 A;  2PQA B;  4IUP A;  1EYA A;  1MD2 D;  2I5L X;  4PMB A;  2BH8 A;  2E76 C;  5CV4 A;  3CC4 A;  2Y0S B;  3D6C A;  4AYB B;  3I4M B;  3I56 A;  3PCO B;  1BVS A;  5C0X H;  1LAC A;  2AHO B;  1Y69 U;  3STB C;  3BS1 A;  2C5C A;  4IUN A;  3NXW A;  5ELC A;  1KRT A;  4IN3 A;  3SR1 A;  5C0X I;  5NUC A;  5DLQ E;  4A3G H;  1EIH A;  2C35 B;  3I72 A;  3HOY B;  5I6Y A;  1PFB A;  2I5H A;  3NWS A;  1JT8 A;  2B8G A;  5IE8 A;  4KKT A;  3S17 H;  3FP9 A;  2BDN A;  4H0L C;  1DGS A;  2F0V A;  4BA2 I;  1BUV T;  1I50 B;  3U4Z A;  3NTH A;  3BDL A;  2VXW A;  1N33 L;  4FXD A;  4CDD C;  3H0G H;  3TS0 A;  3QOL A;  2QW7 A;  2F0P A;  1HNZ Q;  2B2U A;  4ZLT F;  3U9S A;  3HFZ B;  3R8B A;  2VQE L;  2EQS A;  3KDF A;  3CAM A;  5JOB A;  5M5Y B;  1VQF A;  2N78 A;  2HCI A;  2K14 A;  1RKN A;  4DV3 Q;  1SNO A;  5JVG 3;  3T4A C;  4RMF A;  5FLX L;  1FGB D;  5IT9 E;  3H09 A;  1QOH A;  1SN8 A;  3I4M H;  3MXP A;  4MZ9 A;  1DON A;  3W5O A;  1K8M A;  2X6L A;  1NBW A;  3QOJ A;  2KED A;  4A3J B;  1O7Y A;  1FL0 A;  2F4I A;  1N36 Q;  1GUO A;  3HOY H;  4A4I A;  4DR1 L;  3CCR A;  3M3Y B;  2BA0 A;  1ILP A;  1SR3 A;  2ICE C;  4HJ5 A;  2XVS A;  1VCI A;  2SDF A;  1G6P A;  3B6Y A;  4LF6 Q;  3CXC A;  4RGO S;  1EWC A;  3EJI A;  1H9S B;  4WJ4 A;  1PTO B;  1KLG D;  5CMD A;  3LGJ A;  3OYY A;  4DR7 L;  1DD2 A;  2KA7 A;  4XQQ A;  4OO1 H;  2JXM B;  4LUZ A;  1HNX L;  2J0T D;  2BOS A;  2QGQ A;  3PUW A;  1RHP A;  1I6H B;  4Q5V A;  1VQK A;  3K0X A;  4RKB A;  4OWW B;  1IHZ A;  2MJ8 A;  4OO1 I;  5CYU A;  2K52 A;  5EPK A;  3E5S A;  5TSS A;  1B3Q A;  4GKK Q;  3Q23 A;  3FPP A;  5FJ8 H;  2NVY H;  5I6W A;  3GTL B;  4EGV A;  2FMC A;  1GUN A;  1L1O B;  5EBC A;  3PO2 G;  2FXQ A;  3NHH A;  1F9Q A;  2JEB I;  2RDH A;  2F0U A;  5JJK A;  4A3J H;  3FMC A;  5E7N A;  4OXP A;  1PTO C;  2R92 H;  4LMQ D;  3DXJ C;  2ZTE A;  1KAA A;  1XMQ L;  1YNJ C;  2EYJ A;  3OMG A;  5IYB H;  4GKJ Q;  1XX8 A;  3PIP A;  3BVG A;  1HQR D;  2JA5 B;  3HKZ E;  3HOV G;  1WTW A;  1YIT A;  3EIV A;  4A3C H;  4JC0 A;  3V05 A;  4LF5 L;  4POG A;  4DNR B;  3JAM i;  2PO4 A;  5C0X J;  4K0K L;  2IL8 A;  2QCP X;  1UE7 A;  3KF8 A;  3IFT A;  3CKI B;  2N49 A;  5E4X A;  2TMP A;  1A0I A;  3F2D A;  1L1O C;  2PZW A;  2PZT A;  1XMO L;  1G29 1;  1SYE A;  5AJ3 L;  4RAU C;  1SYF A;  3KLS X;  3ULL A;  4DV6 Q;  1IBK Q;  1I6H H;  3CME A;  1N32 L;  1KQS A;  1CKO A;  1KNE A;  4WRD A;  3U9O A;  5GAD C;  4ME3 A;  5BN3 A;  4FVM A;  1XNR Q;  1BR9 A;  1J5E L;  4ID6 A;  4BY1 H;  2B63 H;  4KY7 A;  4OX9 Q;  1NNX A;  3CCL A;  1L0Y B;  3CC2 A;  4NB3 A;  5C4X B;  3C1F A;  1QUQ A;  2F3W A;  3J7A V;  1VQ8 A;  3PSI A;  3S1R B;  3RNU A;  4GOP B;  3E9H A;  2RDF A;  1EEI D;  2F4V L;  4K14 A;  1GXD C;  2JA5 H;  4JI6 Q;  2RF4 A;  5E1F A;  5CV8 A;  4IUR A;  4IUV A;  4X65 L;  4FYD A;  1NCV A;  3VA5 A;  4LFA L;  2F1M A;  3K7U C;  1VQP A;  2DJG C;  4QJF A;  5IIF A;  2KHS A;  1B8A A;  1EY7 A;  2UUA L;  2LSS A;  2MQH A;  1HTL D;  3NBH A;  1IYJ B;  2ZJQ A;  3OIP A;  2D62 A;  4GLA C;  3ND9 A;  3BJU A;  1EUJ A;  2A69 C;  4UPA A;  3DUZ A;  2EZV A;  2RVL A;  4I7A A;  4GOP C;  3QJY A;  1H9J A;  3L0O A;  3J80 E;  4A3I B;  2F0H A;  5KYL A;  4N8X 1;  1SDF A;  1IBL Q;  1D2B A;  1TWF B;  2AWN A;  3MXU A;  3EN2 A;  2O5I C;  1C0A A;  1FGU A;  1VQJ A;  3PO2 B;  3NPP A;  4B3T L;  4M1U B;  5JJL A;  5C4X H;  1SE2 A;  3F2B A;  3J7Y W;  5IP7 H;  1SNQ A;  5FLX c;  1PH7 A;  3DWP A;  2WAQ G;  1WD1 A;  3R93 A;  1C48 A;  5KEE A;  3DHQ A;  3NP8 A;  1GD7 A;  3T1H L;  4UHV A;  4C3J G;  4XT3 B;  1YHQ A;  4LF8 L;  3FEW X;  4K5V A;  4M8A A;  4QIW E;  4YHH Q;  3OTO L;  1X3P A;  1F2M A;  3Q8D A;  3GO5 A;  1TWC B;  3M4Q A;  3J81 c;  4DUY Q;  2JA7 G;  3T1Y L;  2Z6K A;  2B2W C;  1Y14 B;  1ET9 A;  2XWB B;  2OF1 A;  4FF2 A;  3DM3 A;  2PQA A;  2ENB A;  3S14 H;  3KUP A;  2ZM6 L;  2VY3 A;  1RF2 D;  1HNW Q;  3TDQ A;  2FMM A;  4PNY A;  1K3B C;  2KCC A;  2PCF B;  4LJZ C;  1IYU A;  1Q90 A;  1Z6H A;  2JP1 A;  4L6T B;  4WJW A;  3RN5 A;  1VQL A;  4JYA Q;  4GS3 A;  3GTP H;  4A3I H;  3CD6 A;  2D0P A;  4DAY A;  1G6Z A;  1TWF H;  1YZ6 A;  2HHH Q;  1Q1B A;  1Q46 A;  1BF4 A;  3TBI B;  1HNZ L;  4ZCK A;  2L0C A;  3MZ5 A;  2L9H A;  2N88 A;  4CDF C;  2WP8 J;  3PIO 3;  5IOC A;  2PZU A;  2H5X A;  4I7Z C;  1L2F A;  4ZYS A;  4DR6 L;  1F2Z A;  3I8Z A;  1CTM A;  1V1P B;  3K59 A;  1PHJ A;  2ES2 A;  1P8L A;  2A74 C;  3NSW A;  4KKU A;  4IPH A;  1YNX A;  2VZA A;  4X3K A;  2RQX A;  4KJN A;  3E0J A;  1EYD A;  4KKS A;  4JBK A;  5BR8 L;  1GUT A;  4DXG A;  2KCM A;  4MTN A;  1KAW A;  3HOX G;  4LF4 L;  3S15 H;  4HAE A;  3SEB A;  5G3L F;  1SYD A;  4C3H B;  4JI4 L;  4ZUJ A;  1TWG B;  3GTJ H;  3UDX A;  2KVM A;  4PQX A;  4KMU C;  4XXE A;  4A3E H;  1A63 A;  4YCU A;  4CHT B;  3DLL A;  1I4X A;  2F52 A;  1STB A;  2K05 A;  3VR4 A;  2VQF L;  1PFM A;  4DNI A;  5ISR A;  2XWJ B;  4BBR G;  4LF6 L;  5KGU A;  4A75 A;  5KNB A;  1G91 A;  5LMN Q;  1N8R C;  1YI2 A;  4NP5 A;  1EU3 A;  1YNN C;  4GNX A;  4DV5 Q;  4S3S A;  1Q82 C;  2E2J H;  1QIL A;  4OON A;  2EPB A;  1AH9 A;  1U0L A;  2WAQ B;  2Q8T A;  2J7Z A;  3J81 E;  1CA5 A;  5C4Z A;  1IBM L;  2ZTC A;  1E2Z A;  1I6V C;  1H9S A;  2E75 C;  2UUB Q;  2J4X A;  4WOR A;  1EZ6 A;  3AFP A;  2IX3 A;  1HZC A;  2A5H A;  4BBS G;  2E74 C;  3D4D A;  4L63 B;  3FKI G;  3A55 A;  2YTV A;  4V19 0;  2A8V A;  4A3B B;  3F1Z A;  4CKB A;  3HOW G;  2LKV A;  4IAL A;  2B2U C;  4DR2 Q;  1M8A A;  4C3H H;  2JA7 B;  1SAP A;  3EVQ A;  4H13 C;  4TKO B;  1EY9 A;  1TWG H;  1V9P A;  2WIN B;  1VQO A;  1N34 Q;  1LTI D;  1YHA A;  3CW2 C;  5T1G A;  2R6G A;  1PYB A;  5L37 A;  2Z0S A;  3D0F A;  3IRB A;  2D2C C;  2G9D A;  1JOR A;  1JOK A;  1YIJ A;  2WKC A;  4JI3 Q;  3FHW A;  4DR4 Q;  4JBM A;  3J81 j;  3I4N B;  1II3 A;  4OHJ A;  1V1O A;  1Y8P B;  3T56 B;  5JVH 3;  3L9A X;  2JA6 B;  1Y1V G;  5CBA E;  4AIM A;  3I4O A;  5GAG C;  1BQQ T;  2VB2 X;  5M5W B;  5BN4 A;  4QB4 A;  1FD7 D;  4JBJ A;  1PA6 A;  2GVA A;  1E22 A;  1CSQ A;  1QB5 D;  2F0F A;  1KDA A;  4IPC A;  5KND A;  2E2D C;  4OX9 L;  5J1Z A;  1PZK D;  1G51 A;  1KDC A;  4HMI A;  1ESR A;  1SBB B;  3R2I A;  1I4P A;  1K8G A;  4DV0 Q;  4A3B H;  1PRT F;  5IOD A;  4C2M H;  2F3V A;  1X9N A;  3JAM c;  1Q12 A;  3KLS A;  1IL2 A;  3RLN A;  4FF4 A;  2PYK A;  2QIL A;  2O2L D;  1HH2 P;  5C3X A;  1ENC A;  1PVO A;  4RA8 A;  3NUC A;  3PUY A;  4G57 A;  4HID A;  4JI1 Q;  1GO3 E;  4L5Q A;  3MTS A;  3DWQ A;  3I90 A;  1DZ1 A;  4BBR B;  1TVX A;  3ND8 A;  3KF8 B;  4GOP A;  2JA6 H;  4IO9 A;  1XPR A;  4TVA B;  1G2S A;  3ZYY X;  2R93 H;  1VQI A;  1T5X D;  4NDX A;  1E3P A;  2EYO A;  2Z6B A;  5J39 A;  3PUV A;  1ICW A;  1B9N A;  4A3K B;  3HGB A;  5CV9 A;  1X65 A;  1RD9 D;  1IBL L;  1E24 A;  5M3F G;  2PI2 A;  3L7Z C;  1EQR A;  1KLU D;  1R4Q B;  1OXT A;  3K80 C;  2AUK A;  5C5M A;  2G9H D;  1ONL A;  4PZ7 A;  3A0J A;  1QUQ B;  4LK1 C;  5GRO A;  4DPG A;  2I5M X;  1UNS A;  3AEV A;  4PZ6 A;  4IOC A;  3QO2 A;  3E6Z X;  2K5W A;  3OWE B;  4A3D G;  3F2U A;  2CCZ A;  2UU9 L;  2DY8 A;  4LNQ A;  2SOB A;  1QWY A;  3EFX D;  4AYB E;  4GLX A;  1PFS A;  1KNA A;  5DM7 3;  3OOC A;  3VR2 A;  1RCV D;  2HQE A;  4Y7N H;  2RCF A;  5IGB A;  2F0J A;  2EYH A;  4CJ2 C;  3NBH B;  3J7A F;  1SEB D;  1OXX K;  4J8Q A;  1XNQ L;  4K6D A;  1M90 C;  1ZXT A;  4HJA A;  2B39 A;  1TS3 A;  4A3K H;  1SNP A;  1I4Q A;  4X66 L;  3NE5 B;  4A3F B;  4JI8 Q;  1TY0 A;  3JAM E;  4FDB A;  1J6Q A;  4L5S A;  1A15 A;  4O1N A;  2YU9 H;  3FDT A;  3GQB A;  3A5Z B;  1VQN A;  5K36 G;  3KK7 A;  2KJX A;  5J22 A;  3BVZ A;  3DMU A;  2O5J C;  3HOU G;  1GUW A;  3QWN A;  2L1B A;  5C3W A;  4MN3 A;  1UWV A;  4TQU S;  4A3M B;  1NUC A;  4RCN A;  3C3L A;  3EQL C;  1JWU D;  1MSG A;  4NXN L;  1HUM A;  3L2P A;  3BYY B;  3J7A 5;  5DM6 3;  1QE6 A;  1HA5 A;  4RGM A;  3GTG B;  5HGT A;  2F03 A;  4R4Q A;  4KHP L;  2EJG C;  1XXG A;  2R7Z B;  1AE2 A;  1V1P A;  3M7N A;  4JV5 L;  3VYR A;  1PXU A;  4IPG A;  4HN7 A;  4IFD G;  3NEL A;  4ZUI A;  1FNV A;  2IY5 B;  2IHE A;  4HJ9 A;  3BVM A;  5IYC H;  3S1M B;  2Z4H A;  4XT1 B;  2KEC A;  4KTA A;  4G4K A;  4A3F H;  1EQQ A;  1SND A;  1U4P A;  2JYO A;  3W1B A;  5IGF A;  3UDI A;  1ESF A;  3PIO A;  2F0S A;  2Q2U A;  4MIU A;  4DAY B;  4HCS A;  4DK3 C;  1PH2 A;  2EY2 A;  2ZXO A;  3TS2 A;  3G6J B;  4BY1 G;  4O0A A;  4A93 B;  1UAP A;  1I3Q B;  4BWG B;  5FKA C;  4H7B A;  1A2T A;  1VF5 C;  4TRD A;  4F87 A;  1CFM A;  5D3D A;  2Z6K C;  4APV A;  2IW3 A;  4DAP A;  4A3M H;  2B2T A;  4YY3 L;  2CVR A;  3A8J E;  3V2T A;  2K75 A;  1FNW A;  1XTD A;  4DA2 A;  3M4O B;  1KDB A;  4DUZ Q;  3AQQ A;  3GTG H;  5C5L A;  2L15 A;  1YJN A;  3STB D;  3MA2 B;  2R7Z H;  2XSC A;  4ZK9 B;  1EWI A;  5IY0 A;  1G8Z D;  5LL6 X;  4DAV A;  1N34 L;  3TSS A;  1IW7 C;  3TRE A;  3T16 A;  1SNC A;  1L0W A;  3C1E A;  3S1M H;  3LWU A;  2KQ3 A;  2UXD Q;  3GP7 A;  4DK6 C;  5FO8 B;  4X64 L;  2F0D A;  1K73 C;  4EQP A;  1O80 A;  5ELO A;  4R4I A;  2Q8I B;  1VQ6 A;  2VUM B;  1I4H A;  2MPM A;  1GKH A;  3Q24 A;  1YJW A;  1TKW B;  3PF4 A;  5JAV A;  2BE5 C;  4GNX B;  1LTT D;  3RN2 A;  4A93 H;  1I3Q H;  4YWM A;  3FPU B;  4ZQ3 A;  4PMW A;  4ILW A;  1Z9F A;  1JMC A;  1LT5 D;  2LY7 A;  1CM9 A;  2LFN A;  2H1E A;  2RA4 A;  2OTJ A;  1ZKO A;  1I50 H;  3GV3 A;  4J15 A;  1SRO A;  3KF6 B;  2WB1 G;  2L12 A;  5A2Q L;  3NQI A;  1FJG L;  1EU4 A;  1JJC B;  4BS9 A;  4IUU A;  5I2X A;  1T9H A;  2GA4 B;  2I0Q A;  1KIX A;  3CMA A;  1EWH A;  5FO7 B;  1WTP A;  4K5W A;  1HR0 L;  3M4O H;  4E6I A;  5M5Y H;  2UXC L;  2AQ3 B;  4HSP A;  2WB1 E;  2HIX A;  3PV0 A;  4LFC L;  4L5T A;  4GNX C;  1K8A C;  1F2L A;  4GN3 B;  5EQ0 A;  3CCM A;  1SYC A;  2MGS A;  2NBF A;  2L11 A;  3TZU A;  1F9S A;  1U9R A;  1EY4 A;  3I7F A;  2K5Q A;  1QVF A;  4PZ8 A;  3HKZ G;  1P16 A;  1JWM D;  2RDG A;  1K3R A;  4EX5 A;  4QY7 A;  5C44 G;  2VUM H;  3GTK B;  5AFW A;  2KHI A;  2SNS A;  3LNN A;  3Q22 A;  3K5M A;  2CHB D;  4LF7 Q;  3M3Y H;  4EQO A;  1QCB D;  4RHR A;  3DWA A;  2F0E A;  4BA1 I;  4DR5 Q;  1PH4 A;  2EIF A;  1TWA B;  3JC6 6;  3RZD B;  2EJF C;  3KLW A;  1J8I A;  1I4G A;  5IYD G;  3OPO A;  1QZH A;  1JOQ A;  3MXG A;  1PTO H;  1AEX A;  3W2D A;  4DNT B;  5JPN C;  1UE5 A;  5IWA L;  4WFN 3;  1Y1W G;  2UXB L;  3K58 A;  1X6O A;  1CI3 M;  2AKW B;  1EIY B;  1PTO D;  4JI2 Q;  1AN8 A;  3SDZ A;  2DUD A;  1SNM A;  2PW7 A;  1VDZ A;  2C9O A;  1YNJ D;  1MJE A;  3GTL H;  1HXY D;  1TU2 B;  5ELB A;  1B53 A;  3P1H A;  4DV4 Q;  4OWX B;  4KHZ A;  4X62 Q;  2XNA C;  3GTO B;  4NXM L;  3GTK H;  3J7Z C;  1W6J A;  1IL8 A;  3U4V A;  3MC0 B;  3A8K E;  2F0N A;  4DV2 Q;  4RG1 A;  1JC7 A;  3KBG A;  1I5F A;  4JOI A;  1TWA H;  1A3V A;  3RZD H;  1IYV A;  2NN6 G;  3MFG A;  2XN9 C;  5ELF A;  3WWV A;  4V0B A;  3A74 A;  1Q1E A;  3CCV A;  1E1T A;  1MIU A;  2F3I A;  1B50 A;  2ATW A;  1Z7T A;  3T53 B;  4K5X A;  4P71 A;  4IJL A;  2XGT A;  1HUN A;  4B3M L;  1PMR A;  3IL8 A;  4WJ3 M;  2E5L Q;  1HQM C;  1VQH A;  3D4R A;  5D3I B;  3W1G A;  2KEE A;  2ASB A;  1UE6 A;  1C4Q A;  1LAB A;  3GDE A;  4JI0 L;  4IQZ A;  2JN4 A;  2QF7 A;  1I94 Q;  3GTO H;  4DV1 Q;  3I55 A;  3E3X A;  5JPM C;  1EFI D;  3S1R H;  2YTY A;  3RZO B;  1AFP A;  4ALP A;  2M2L A;  2JEA I;  2EXD A;  2H4O A;  2WV6 D;  3X3N A;  1LTB D;  1X3E A;  4K8J A;  4N8F A;  2A69 D;  4JI7 Q;  4I65 A;  3HOV B;  5I9O A;  3K6O A;  5C3E G;  3C2P A;  2I46 A;  4F7X A;  2OQK A;  2F0M A;  2AUJ D;  1TII D;  2E2I B;  1QJO A;  1AP0 A;  3VYT A;  1RTO A;  4HIM A;  1QZG A;  2SNM A;  4J6H A;  4NMZ A;  1YVC A;  1Y1W B;  5D14 A;  5KNC A;  5EPJ A;  1HTP A;  1STY A;  3TP8 A;  4A3L G;  1Y8N B;  5E3F A;  4IUQ A;  4DF7 A;  2ZXR A;  3S2H B;  4G7O C;  3K57 A;  4BY7 G;  3BDO A;  1S5D D;  1E2V A;  2A73 B;  5JEA G;  3H3V C;  2DGY A;  2NZH A;  2Z9H A;  4LF9 Q;  1E2W A;  3K8A A;  3Q6S A;  4O42 A;  2JA8 G;  3PO3 G;  3PO2 H;  4MTK A;  5ELN A;  2ZJP A;  4DUZ L;  3RMH A;  2IHF A;  3BZC A;  2PNR C;  3RZO H;  5IP9 G;  3HOZ G;  4KV6 A;  4DV3 L;  3AFQ A;  1Q86 C;  5HGQ A;  2Z8L A;  3F8T A;  1CK1 A;  4P73 A;  1FR3 A;  3BZK A;  5FLM G;  5EKK A;  1QG7 A;  4LUO A;  3VR5 A;  1CA6 A;  2L5T A;  2R3Z A;  3HOV H;  2KHJ A;  3CPF A;  2D9U A;  3NTK A;  1T5E A;  2DN8 A;  3H3V H;  1QNU A;  3CF5 A;  4X6A H;  1TWC H;  2DJF C;  4DK0 A;  4B3R Q;  1YJ9 A;  1N36 L;  4F8M A;  4ABN A;  1MBY A;  1TWH B;  5A35 A;  1IKM A;  5K5P A;  1SFO B;  2L55 A;  2XRQ D;  4DR3 Q;  1HZA A;  2K4K A;  5M3M G;  4A76 A;  1KD1 C;  3CU7 A;  2MNA A;  2UUC Q;  1GHJ A;  2K5N A;  1K0R A;  1BOS A;  4XQJ A;  5FLX E;  2PPB C;  4BXX H;  4AQY Q;  2NVX B;  2RKS A;  4OEL B;  3K0Y A;  5KIX A;  2E2H B;  1TXY A;  5I2Y A;  1D5M C;  3S2H H;  4FP5 D;  5J3B A;  1ASZ A;  2FFK B;  4NPS A;  2A68 C;  1S4Z A;  3ER0 A;  1V43 A;  3K7A B;  3ERO A;  3CCS A;  1WFQ A;  3KF6 A;  4QQB X;  1K0S A;  1BBU A;  1G2T A;  5KYI A;  4GKK L;  2A6H C;  3UE0 A;  2SEB D;  3IFD A;  3MWY W;  2F0Q A;  2FHT A;  3CP0 A;  1S5E D;  4C3J B;  1D6E C;  2AWO A;  1BCP B;  3ULP A;  1EY8 A;  2CKZ B;  2PW5 A;  1Q7Y C;  2A1A A;  1TQO A;  4HTH A;  3Q0A A;  3VA7 A;  4X3T A;  2B2T C;  3WOF A;  3I4L A;  1H95 A;  1CQV A;  4IJH A;  1TWH H;  3S1Q B;  4XQN A;  4IUT A;  3G6E A;  4GKJ L;  1YNN D;  3OSO A;  5BN5 A;  1WCM G;  5IT9 L;  3CCQ A;  4KN7 C;  1PDQ A;  4HED A;  4HMJ A;  1Q3L A;  1XWE A;  3MEH A;  2I07 B;  2AQ2 B;  3R3O A;  4FO2 A;  3HS0 C;  2VQE Q;  1KL9 A;  3GD7 A;  1F9P A;  2E2H H;  3TME A;  2G5D A;  1BCP C;  2CH4 A;  4DGZ A;  4BY7 B;  1O7L A;  1J9O A;  3SHL A;  3PO3 B;  2MP1 A;  3EA6 A;  4DV6 L;  1IBK L;  1A6X A;  2ALY B;  3TP5 A;  5C4J B;  3SE0 A;  4B3S Q;  1O78 A;  1GUG A;  2B29 A;  4RWS C;  1DYQ A;  3VR3 A;  4ZRZ A;  1CHP D;  1XNR L;  4LUV A;  1NJI C;  2JE6 I;  4C3J H;  2K03 A;  3DEP A;  3NEN A;  2JK8 A;  1TS4 A;  1TR5 A;  3AMU A;  5GQO A;  4C3I G;  4DR1 Q;  2QKI C;  4RFB A;  3U58 A;  4OEM B;  1C9O A;  2CWA A;  2TSS A;  3UDG A;  1BKB A;  2VS1 A;  4JBW A;  3HOX B;  2JA7 H;  3TP6 A;  2OWO A;  3QIA A;  4UP8 A;  5C0X G;  3J80 i;  5LL6 S;  1SE3 A;  4QMG A;  4U67 3;  1UUP A;  2E8G A;  2NB0 A;  2BA1 A;  4JI6 L;  2MHV A;  4X3U A;  4A3G G;  1SYG A;  2YV5 A;  2KBN A;  3M4P A;  2EOT A;  2F0W A;  4RCO A;  1VQE A;  4DR7 Q;  3BG3 A;  2R61 A;  1HNX Q;  1CUK A;  5I9P A;  3I4N H;  2AMC B;  1SE4 A;  3M7G A;  1ICF B;  1AZQ A;  1IKL A;  2R7D A;  3M85 A;  3X3M A;  2RHS B;  1ENF A;  3OMC A;  1PRT B;  3H0G G;  1X54 A;  2F0L A;  1VF7 A;  4QGU A;  1HRJ A;  5M5W H;  2RSO A;  4K6L A;  1C8C A;  1WOC A;  5CR3 A;  3NK9 A;  1X56 A;  1U4R A;  2RCN A;  4R4C A;  1GHK A;  1FVI A;  3NWT A;  4FNF A;  3L3O C;  3N52 A;  2HDM A;  4ME5 A;  3CPW A;  1O7Z A;  1EQT A;  3CRL C;  1XMQ Q;  4RHS A;  1SMX A;  5CC4 A;  4GLV B;  4IPD A;  4BBS B;  3BYT B;  3FKI B;  3GTM B;  2PNH A;  2Y0S G;  4AYB G;  1HR0 W;  3HOX H;  3I4M G;  4LF5 Q;  1PRT C;  5EBD A;  3HOW B;  2A19 A;  4K0K Q;  3P75 A;  3HOY G;  1B1Z A;  4XIG S;  4YHH L;  1W6K A;  3TEH B;  1XMO Q;  3E9I A;  1PLF A;  3D31 A;  5AJ3 Q;  2RBM A;  4KD3 A;  2Y0S E;  3T51 B;  1JE5 A;  1VS0 A;  4L5R C;  4DUY L;  4BBR H;  1N32 Q;  1HJP A;  1RTN A;  2Z1C A;  3TN2 A;  1EIG A;  4G7Z C;  1LTA D;  5C6A A;  1DOL A;  4L8J A;  1J5E Q;  3IKJ A;  1BXT A;  1JE4 A;  1Y1V B;  1HNW L;  2B8F A;  1JJG A;  1TT2 A;  1AW7 A;  3GV6 A;  4MHE A;  3ULJ A;  3ZJY C;  4JYA L;  4OO1 G;  1MJC A;  2DNE A;  5COY A;  3KJP A;  3R2T A;  2HHH L;  1DM0 B;  4UY8 C;  3CQZ B;  4JOI C;  4EQN A;  3DM1 A;  1W2B A;  4HJ7 A;  1LT3 D;  2HCC A;  1EL0 A;  4QCL A;  5IGC A;  1CSP A;  4BBS H;  5FJ8 G;  1GUS A;  2F4V Q;  3FKI H;  5COR A;  3GTM H;  1ROD A;  3J80 L;  4JPB W;  4ZAI A; 
#chains in the Genus database with same CATH homology
 2FIN B;  1L0X B;  2EY1 A;  2EYM A;  1MSH A;  3RD4 A;  3URY A;  1NAP A;  2RSN A;  1WTV A;  3V96 A;  1BO0 A;  2OXP A;  1EEF D;  4OIK A;  3D8G A;  1LT4 D;  4ULL A;  1TY2 A;  3H0G B;  1GJX A;  3NBI A;  4K2L A;  4FF3 A;  1WTO A;  2HUG A;  1X3Q A;  2IJ0 A;  5M3F B;  1ENA A;  3SK4 A;  1ML0 D;  4FF1 A;  3DEO A;  1DJR D;  1X32 A;  1CQF A;  4H44 C;  2NUC A;  5ELD A;  1PZJ D;  4A3D B;  4YIJ A;  4J1M A;  3HRZ C;  5T1I A;  4RGT A;  2FJ2 A;  5M9O A;  3S1N B;  2F0K A;  3HZX A;  5FO9 B;  4KHV A;  4K8I A;  2VB3 X;  3PMF A;  2PMZ B;  2DY7 A;  1H9R A;  3SK6 A;  3FVQ A;  4ODG A;  3M4Y A;  2YYZ A;  2XRS D;  3HEJ A;  4EVO A;  3HP3 A;  4UDU C;  2F0O A;  5EKL A;  2K6A A;  3I91 A;  2EDG A;  2NVY B;  3BZD B;  4QUF A;  4FXK C;  1PTO F;  4DU9 A;  4B08 A;  3HOU B;  3TP7 A;  3AB9 A;  1LV9 A;  1K8O A;  1IW7 D;  2R92 B;  1F2Y A;  4OIJ A;  3J81 L;  3FRP B;  1HPC A;  4N9P A;  3MVV A;  1BBX C;  1CHQ D;  4RKL A;  2BE5 D;  3RLF A;  1VMC A;  2NVQ B;  1EY5 A;  3C46 A;  4ZKC B;  1LTS D;  2EYF A;  1RDP D;  1UEA B;  4KN4 C;  4XTC S;  3TZD A;  5EJW A;  1WD0 A;  4Z9C B;  1SXT A;  5F2D A;  3UI2 A;  4BY1 B;  2B63 B;  5K36 H;  1MGS A;  3NQT A;  4CKC A;  1OXS C;  2XIW A;  2Z4I A;  3SVM A;  3D3R A;  3OW7 A;  3A54 A;  1K83 B;  4KY5 A;  2NYZ D;  2ZT9 C;  4RH6 A;  2EVB A;  1PZI D;  4Q0F A;  5FOB B;  2NTS A;  4R9W A;  1ILQ A;  5IGG A;  3K5L A;  1D5X C;  1STN A;  1H9K A;  4IFD H;  1HFN A;  5FK9 C;  1TS2 A;  1Z47 A;  4IFD I;  2X69 A;  1RJT A;  2WAC A;  2EXZ A;  5EGT A;  1M4V A;  1B3A A;  4CJ1 B;  1CZW A;  3OWF A;  2KOL A;  2WB1 B;  2WII B;  2B2V A;  2OT2 A;  4KD4 A;  1MI2 A;  1B2T A;  3G7L A;  2EE1 A;  4ZKB B;  5ELE A;  3ITP A;  4B9X A;  5IGD A;  1U4M A;  1LO5 D;  2ICI A;  1XTC D;  4JK1 C;  4N9T A;  1JB3 A;  3PUX A;  4B9W A;  5HUR A;  1A3U A;  4C3H G;  3A7L A;  2M00 A;  1Y8O B;  3HKZ B;  4P2C B;  3S14 B;  1WVL A;  1BNZ A;  2CW0 C;  5C44 B;  1SJE D;  3O13 A;  3GTP B;  4CJ0 B;  5I4D A;  4R8I A;  2AQ1 B;  2BCO A;  2K1B A;  1EZ8 A;  2M9V A;  5CV6 A;  1KTK A;  2K32 A;  4OGQ C;  2V4D A;  2VNU D;  5DNF A;  2IPK D;  1VMP A;  2K33 A;  2CW0 D;  3JAM L;  3SK8 A;  1HCZ A;  2B2Y C;  3KBX A;  3S15 B;  1JCK B;  3GTJ B;  1LLR D;  2WKD A;  2N55 A;  4G7H C;  4A3E B;  2KUM A;  4X3S A;  3S16 B;  4C1N I;  3S9W A;  1LT6 D;  4XYO A;  2ID0 A;  4IFD J;  1OXU A;  3WDN A;  1WTX A;  4CGY B;  2E2J B;  1STG A;  3MXN A;  4HCE A;  5CV7 A;  5C4H A;  3BDC A;  3I3C A;  4F88 A;  3D4W A;  1BDO A;  4PV1 C;  1LTG D;  5DEH A;  1D1I A;  3W3A A;  3A8I E;  2DNC A;  3VYU A;  1ZYR C;  4KK7 A;  4DK1 A;  1TS5 A;  3CHB D;  1I4R A;  1OXV A;  3OHX C;  1DOM A;  4QIW B;  4IZ8 A;  1AZP A;  3I73 A;  2F0G A;  3QG1 A;  2L4N A;  4RGN A;  1JIC A;  1FYC A;  4KY6 A;  1BCP F;  2K28 A;  3AU7 A;  3LWE A;  5A2Q E;  1STA A;  4XYQ A;  3D6W A;  2NN6 H;  4LAA A;  5EKI A;  4HR7 B;  1U4L A;  5C3E B;  2QDB A;  2LMC B;  1DOK A;  3WOE A;  2NN6 I;  2A6E C;  4HSV A;  4QF4 A;  1ZYR D;  1XYI A;  3S2D B;  2K7V A;  2A68 D;  1SSO A;  1R4P B;  3KLR A;  2A6H D;  3H91 A;  1SJH D;  1B44 D;  1LTR D;  4C2M B;  2CQA A;  2JSO A;  2EYL A;  1PYW D;  3OIQ A;  2JA8 B;  4CBV A;  5LHY 1;  3VR6 A;  1HFG A;  1STH A;  5JJZ A;  4KJO A;  1WTQ A;  3HG9 A;  4OL7 A;  3HOZ B;  2A6E D;  1CT1 D;  1A3T A;  5G3L D;  1GOZ A;  2MUY A;  2NWG A;  4FXG C;  5M5X B;  1V8Q A;  2R93 B;  1HHV A;  1BCP D;  1SYB A;  5M3M B;  3PIP 3;  1HA6 A;  1QNK A;  4DXF A;  3VYS A;  2BDO A;  5KRU A;  2NVT B;  3IAY A;  3MHB A;  3PUZ A;  3ERQ A;  5JEA H;  1D1K A;  1CZG A;  1DCZ A;  3SXH A;  1F77 A;  2Q8R E;  1NR4 A;  1JQY D;  2EYP A;  4DFA A;  3A56 A;  4Y7N B;  2IT1 A;  1NR2 A;  3I70 A;  3H6M A;  2PQE A;  5CV5 A;  5E4W C;  4U68 A;  4C56 C;  2ZXP A;  4PMC A;  3GTQ B;  3SK5 A;  3T13 A;  2K5D A;  1D5Z C;  2D5D A;  1ZEQ X;  3RUZ A;  2EY5 A;  3LX0 A;  2IX0 A;  4NKL A;  1WCM B;  1PFN A;  1KAB A;  1JOO A;  1Q8I A;  2YU9 B;  4NW2 A;  1JWS D;  2K01 A;  3N6R A;  2X6G A;  4DN4 M;  5CGK A;  1R9T B;  1E0B A;  1DXM A;  2LS0 1;  2B2Y A;  3ONA B;  4K2K A;  4C1N K;  2IWH A;  3K5N A;  2B2W A;  3NTI A;  2OEO A;  1PRT D;  1EY6 A;  1OO9 B;  1EQV A;  2EJM A;  1JR0 D;  3MFY A;  5CBE E;  3P20 A;  2HDL A;  2KCN A;  4C3I B;  1WTR A;  4GZY C;  1STE A;  1F9R A;  2B2V C;  4KI0 A;  3P7J A;  1H9M A;  2NZ1 D;  3H94 A;  3QB3 A;  4R8N A;  1S5C D;  1B4O A;  4A3G B;  1FNU A;  5D65 A;  5EPL A;  1SMY C;  3A7A B;  1S5F D;  3MAQ A;  2O4X A;  3S17 B;  1EOT A;  1EYC A;  4QUC A;  3CRK C;  2EY6 A;  1B9M A;  5IGE A;  2QEJ C;  1EY0 A;  4XDX A;  2F0I A;  4CKE A;  1S5B D;  2IX1 A;  1A2U A;  2NTT A;  5DAU A;  1NSN S;  4UAI A;  2F0T A;  4TSS A;  5JEA J;  3K5O A;  1SMY D;  1ET6 A;  2K04 A;  4IUP A;  1EYA A;  1MD2 D;  4PMB A;  2E76 C;  5CV4 A;  2Y0S B;  3D6C A;  4AYB B;  3I4M B;  5C0X H;  1LAC A;  1Y69 U;  3BS1 A;  2C5C A;  4IUN A;  3NXW A;  5ELC A;  4IN3 A;  3SR1 A;  5C0X I;  5NUC A;  1EIH A;  3I72 A;  3HOY B;  5I6Y A;  1PFB A;  3NWS A;  2B8G A;  4KKT A;  2BDN A;  4H0L C;  2F0V A;  4BA2 I;  1BUV T;  1I50 B;  3NTH A;  3BDL A;  2VXW A;  4FXD A;  3QOL A;  2F0P A;  2B2U A;  4ZLT F;  3U9S A;  3R8B A;  5JOB A;  5M5Y B;  2HCI A;  1RKN A;  1SNO A;  5JVG 3;  3T4A C;  5FLX L;  1FGB D;  5IT9 E;  3H09 A;  1QOH A;  3MXP A;  1DON A;  1K8M A;  2X6L A;  3QOJ A;  2KED A;  4A3J B;  1O7Y A;  2F4I A;  1GUO A;  3M3Y B;  2BA0 A;  1ILP A;  2ICE C;  2XVS A;  1VCI A;  2SDF A;  4RGO S;  1EWC A;  3EJI A;  1H9S B;  1PTO B;  1KLG D;  5CMD A;  1DD2 A;  2KA7 A;  4XQQ A;  4OO1 H;  2JXM B;  2J0T D;  2BOS A;  3PUW A;  1RHP A;  1I6H B;  4Q5V A;  4RKB A;  1IHZ A;  2MJ8 A;  4OO1 I;  5CYU A;  5EPK A;  3E5S A;  5TSS A;  3Q23 A;  3FPP A;  5I6W A;  3GTL B;  4EGV A;  2FMC A;  1GUN A;  5EBC A;  3NHH A;  1F9Q A;  2JEB I;  2RDH A;  2F0U A;  3FMC A;  1PTO C;  4LMQ D;  3DXJ C;  1KAA A;  1YNJ C;  2EYJ A;  3OMG A;  1XX8 A;  3BVG A;  1HQR D;  2JA5 B;  1WTW A;  3V05 A;  4DNR B;  2PO4 A;  5C0X J;  2IL8 A;  2QCP X;  3KF8 A;  5E4X A;  3IFT A;  3CKI B;  2TMP A;  2PZW A;  2PZT A;  1G29 1;  1SYE A;  4RAU C;  1SYF A;  3KLS X;  1KNE A;  4WRD A;  3U9O A;  5BN3 A;  4FVM A;  1BR9 A;  4ID6 A;  4KY7 A;  1L0Y B;  5C4X B;  3C1F A;  2F3W A;  3J7A V;  3S1R B;  2RDF A;  1EEI D;  4K14 A;  1GXD C;  5E1F A;  5CV8 A;  4IUR A;  4IUV A;  4FYD A;  1NCV A;  3VA5 A;  2F1M A;  5IIF A;  2KHS A;  1EY7 A;  1HTL D;  3NBH A;  3OIP A;  2D62 A;  3ND9 A;  2A69 C;  3DUZ A;  2EZV A;  2RVL A;  3QJY A;  1H9J A;  3J80 E;  4A3I B;  2F0H A;  5KYL A;  1SDF A;  1D2B A;  1TWF B;  2AWN A;  3MXU A;  2O5I C;  3PO2 B;  3NPP A;  4M1U B;  1SE2 A;  3J7Y W;  1SNQ A;  3DWP A;  1WD1 A;  3R93 A;  1C48 A;  5KEE A;  3DHQ A;  3NP8 A;  4C3J G;  4XT3 B;  3FEW X;  4K5V A;  4M8A A;  1X3P A;  1F2M A;  3GO5 A;  1TWC B;  2B2W C;  1ET9 A;  2XWB B;  2OF1 A;  4FF2 A;  2ENB A;  3KUP A;  1RF2 D;  3TDQ A;  2FMM A;  4PNY A;  2KCC A;  2PCF B;  4LJZ C;  1IYU A;  1Q90 A;  1Z6H A;  2JP1 A;  4L6T B;  4WJW A;  4DAY A;  1G6Z A;  1Q1B A;  1BF4 A;  3TBI B;  2L0C A;  3MZ5 A;  2L9H A;  2N88 A;  2WP8 J;  3PIO 3;  5IOC A;  2PZU A;  4I7Z C;  4ZYS A;  1F2Z A;  3I8Z A;  1CTM A;  1V1P B;  3K59 A;  2A74 C;  3NSW A;  4KKU A;  4X3K A;  2RQX A;  4KJN A;  3E0J A;  1EYD A;  4KKS A;  1GUT A;  4DXG A;  4HAE A;  3SEB A;  5G3L F;  1SYD A;  4C3H B;  4ZUJ A;  1TWG B;  2KVM A;  4PQX A;  4KMU C;  4XXE A;  4CHT B;  1I4X A;  2K05 A;  1STB A;  3VR4 A;  1PFM A;  5ISR A;  2XWJ B;  5KGU A;  5KNB A;  1G91 A;  4NP5 A;  1EU3 A;  1YNN C;  4S3S A;  1QIL A;  2EPB A;  3J81 E;  2WAQ B;  2Q8T A;  2J7Z A;  1CA5 A;  5C4Z A;  1E2Z A;  1I6V C;  1H9S A;  2E75 C;  2J4X A;  4WOR A;  1EZ6 A;  2IX3 A;  2A5H A;  2E74 C;  3D4D A;  4L63 B;  3A55 A;  4A3B B;  4V19 0;  4CKB A;  2LKV A;  4IAL A;  2B2U C;  2JA7 B;  1M8A A;  1SAP A;  3EVQ A;  4H13 C;  4TKO B;  1EY9 A;  2WIN B;  1LTI D;  5T1G A;  2R6G A;  2D2C C;  2G9D A;  1JOR A;  1JOK A;  2WKC A;  3I4N B;  1II3 A;  4OHJ A;  1V1O A;  1Y8P B;  3T56 B;  5JVH 3;  3L9A X;  2JA6 B;  5CBA E;  1BQQ T;  2VB2 X;  5M5W B;  5BN4 A;  4QB4 A;  1FD7 D;  1QB5 D;  2F0F A;  1KDA A;  5KND A;  2E2D C;  5J1Z A;  1PZK D;  1KDC A;  4HMI A;  1ESR A;  1SBB B;  3R2I A;  1I4P A;  1PRT F;  5IOD A;  2F3V A;  1Q12 A;  3KLS A;  4FF4 A;  2PYK A;  2QIL A;  2O2L D;  5C3X A;  1ENC A;  4RA8 A;  3NUC A;  3PUY A;  4G57 A;  3MTS A;  3DWQ A;  3I90 A;  1DZ1 A;  4BBR B;  1TVX A;  3ND8 A;  1G2S A;  3ZYY X;  1T5X D;  4NDX A;  2EYO A;  5J39 A;  3PUV A;  1ICW A;  1B9N A;  4A3K B;  3HGB A;  5CV9 A;  1RD9 D;  3L7Z C;  1KLU D;  1R4Q B;  1OXT A;  5C5M A;  2AUK A;  2G9H D;  1ONL A;  4LK1 C;  1UNS A;  3QO2 A;  3E6Z X;  2K5W A;  3OWE B;  3F2U A;  2DY8 A;  2SOB A;  1QWY A;  3EFX D;  5DM7 3;  1KNA A;  3OOC A;  3VR2 A;  1RCV D;  2HQE A;  5IGB A;  2F0J A;  2EYH A;  4CJ2 C;  3J7A F;  1SEB D;  1OXX K;  4J8Q A;  4K6D A;  1ZXT A;  2B39 A;  1TS3 A;  1SNP A;  1I4Q A;  3NE5 B;  4A3F B;  1TY0 A;  3JAM E;  1A15 A;  4O1N A;  3FDT A;  3GQB A;  5K36 G;  3KK7 A;  2KJX A;  5J22 A;  3BVZ A;  3DMU A;  2O5J C;  1GUW A;  3QWN A;  2L1B A;  5C3W A;  4MN3 A;  4TQU S;  4A3M B;  1NUC A;  4RCN A;  3C3L A;  3EQL C;  1JWU D;  1MSG A;  1HUM A;  3BYY B;  5DM6 3;  1QE6 A;  1HA5 A;  4RGM A;  3GTG B;  5HGT A;  2F03 A;  2EJG C;  1XXG A;  2R7Z B;  1V1P A;  3M7N A;  3VYR A;  1PXU A;  4HN7 A;  4IFD G;  4ZUI A;  1FNV A;  3BVM A;  3S1M B;  2Z4H A;  4XT1 B;  2KEC A;  4KTA A;  4G4K A;  1SND A;  1U4P A;  2JYO A;  5IGF A;  1ESF A;  2F0S A;  4MIU A;  4HCS A;  2EY2 A;  2ZXO A;  3G6J B;  4A93 B;  1UAP A;  1I3Q B;  4BWG B;  5FKA C;  4H7B A;  1A2T A;  1VF5 C;  4TRD A;  4F87 A;  1CFM A;  5D3D A;  2IW3 A;  4DAP A;  2B2T A;  2CVR A;  3A8J E;  3V2T A;  1FNW A;  4DA2 A;  3M4O B;  1KDB A;  5C5L A;  3MA2 B;  2XSC A;  4ZK9 B;  1G8Z D;  5LL6 X;  4DAV A;  3TSS A;  1IW7 C;  3T16 A;  1SNC A;  3C1E A;  3LWU A;  2KQ3 A;  3GP7 A;  5FO8 B;  2F0D A;  4EQP A;  1O80 A;  2Q8I B;  2VUM B;  1I4H A;  2MPM A;  3Q24 A;  1TKW B;  5JAV A;  2BE5 C;  1LTT D;  3FPU B;  4ZQ3 A;  4PMW A;  4ILW A;  1LT5 D;  2LY7 A;  1CM9 A;  2LFN A;  2H1E A;  2RA4 A;  1ZKO A;  3GV3 A;  2L12 A;  5A2Q L;  3NQI A;  1EU4 A;  4BS9 A;  4IUU A;  5I2X A;  2GA4 B;  1EWH A;  5FO7 B;  1WTP A;  4K5W A;  4E6I A;  2AQ3 B;  4HSP A;  3PV0 A;  1F2L A;  5EQ0 A;  1SYC A;  2MGS A;  2NBF A;  2L11 A;  3TZU A;  1F9S A;  1U9R A;  1EY4 A;  2K5Q A;  1JWM D;  2RDG A;  3GTK B;  5AFW A;  2SNS A;  3LNN A;  3Q22 A;  3K5M A;  2CHB D;  4EQO A;  1QCB D;  4RHR A;  3DWA A;  2F0E A;  4BA1 I;  1TWA B;  3RZD B;  2EJF C;  1J8I A;  1I4G A;  3OPO A;  1JOQ A;  3MXG A;  1PTO H;  1AEX A;  3W2D A;  4DNT B;  5JPN C;  4WFN 3;  3K58 A;  1CI3 M;  1PTO D;  1AN8 A;  3SDZ A;  1SNM A;  2PW7 A;  1VDZ A;  2C9O A;  1YNJ D;  1HXY D;  1TU2 B;  5ELB A;  1B53 A;  3P1H A;  4KHZ A;  2XNA C;  3GTO B;  1W6J A;  1IL8 A;  3MC0 B;  3A8K E;  2F0N A;  1JC7 A;  3KBG A;  1A3V A;  1IYV A;  2NN6 G;  3MFG A;  2XN9 C;  5ELF A;  4V0B A;  1Q1E A;  1B50 A;  1Z7T A;  3T53 B;  4K5X A;  1HUN A;  1PMR A;  3IL8 A;  1HQM C;  3D4R A;  5D3I B;  2KEE A;  1C4Q A;  1LAB A;  4IQZ A;  2QF7 A;  5JPM C;  1EFI D;  3RZO B;  1AFP A;  2M2L A;  2JEA I;  2H4O A;  2WV6 D;  3X3N A;  1LTB D;  4K8J A;  2A69 D;  4I65 A;  3HOV B;  5I9O A;  3K6O A;  3C2P A;  2I46 A;  4F7X A;  2F0M A;  2AUJ D;  1TII D;  2E2I B;  1QJO A;  1AP0 A;  3VYT A;  1RTO A;  2SNM A;  4J6H A;  4NMZ A;  1Y1W B;  5D14 A;  5KNC A;  5EPJ A;  1HTP A;  1STY A;  3TP8 A;  1Y8N B;  5E3F A;  4IUQ A;  4DF7 A;  2ZXR A;  3S2H B;  4G7O C;  3K57 A;  3BDO A;  1S5D D;  1E2V A;  2A73 B;  5JEA G;  3H3V C;  1E2W A;  3Q6S A;  4O42 A;  3RMH A;  2PNR C;  4KV6 A;  2Z8L A;  1CK1 A;  1FR3 A;  5EKK A;  1QG7 A;  1CA6 A;  3VR5 A;  2L5T A;  2R3Z A;  3NTK A;  2D9U A;  1T5E A;  2DN8 A;  1QNU A;  4DK0 A;  4F8M A;  4ABN A;  1MBY A;  1TWH B;  5A35 A;  1IKM A;  5K5P A;  1SFO B;  2L55 A;  2XRQ D;  3CU7 A;  1GHJ A;  1BOS A;  4XQJ A;  5FLX E;  2PPB C;  2NVX B;  2RKS A;  3K0Y A;  5KIX A;  2E2H B;  5I2Y A;  1D5M C;  4FP5 D;  2FFK B;  2A68 C;  1S4Z A;  1V43 A;  3K7A B;  3ERO A;  1G2T A;  5KYI A;  2A6H C;  2SEB D;  3IFD A;  3MWY W;  2F0Q A;  2FHT A;  1S5E D;  4C3J B;  1D6E C;  2AWO A;  1BCP B;  1EY8 A;  2PW5 A;  1TQO A;  4HTH A;  3Q0A A;  3VA7 A;  4X3T A;  2B2T C;  3WOF A;  3I4L A;  1CQV A;  3S1Q B;  4XQN A;  4IUT A;  1YNN D;  3OSO A;  5BN5 A;  5IT9 L;  4KN7 C;  1PDQ A;  4HED A;  4HMJ A;  1Q3L A;  1XWE A;  3MEH A;  2I07 B;  2AQ2 B;  3R3O A;  4FO2 A;  3HS0 C;  3GD7 A;  1F9P A;  3TME A;  1BCP C;  4DGZ A;  4BY7 B;  1O7L A;  1J9O A;  3SHL A;  3PO3 B;  2MP1 A;  3EA6 A;  1A6X A;  3TP5 A;  5C4J B;  3SE0 A;  1O78 A;  1GUG A;  4RWS C;  1DYQ A;  3VR3 A;  4ZRZ A;  1CHP D;  2JE6 I;  2K03 A;  3DEP A;  1TS4 A;  1TR5 A;  3AMU A;  4C3I G;  2QKI C;  4RFB A;  2TSS A;  4JBW A;  3HOX B;  3TP6 A;  3QIA A;  5C0X G;  5LL6 S;  1SE3 A;  4QMG A;  4U67 3;  1UUP A;  2NB0 A;  2BA1 A;  2MHV A;  4X3U A;  1SYG A;  2EOT A;  2F0W A;  4RCO A;  3BG3 A;  2R61 A;  5I9P A;  3M7G A;  1SE4 A;  1AZQ A;  1IKL A;  3M85 A;  3X3M A;  1ENF A;  3OMC A;  1PRT B;  2F0L A;  1VF7 A;  1HRJ A;  2RSO A;  4K6L A;  1C8C A;  5CR3 A;  3NK9 A;  1U4R A;  1GHK A;  3NWT A;  4FNF A;  3L3O C;  3N52 A;  2HDM A;  4ME5 A;  1O7Z A;  1EQT A;  3CRL C;  4RHS A;  5CC4 A;  4BBS B;  3BYT B;  3FKI B;  3GTM B;  1PRT C;  5EBD A;  3HOW B;  3P75 A;  1B1Z A;  4XIG S;  1W6K A;  1PLF A;  3D31 A;  2RBM A;  4KD3 A;  3T51 B;  1RTN A;  2Z1C A;  3TN2 A;  1EIG A;  4G7Z C;  1LTA D;  5C6A A;  1DOL A;  4L8J A;  3IKJ A;  1BXT A;  1JE4 A;  1Y1V B;  2B8F A;  1TT2 A;  1AW7 A;  3GV6 A;  4MHE A;  4OO1 G;  2DNE A;  5COY A;  3R2T A;  1DM0 B;  3CQZ B;  4EQN A;  3DM1 A;  1LT3 D;  2HCC A;  1EL0 A;  4QCL A;  5IGC A;  1GUS A;  5COR A;  1ROD A;  3J80 L;  4ZAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...