4O42A

Tandem chromodomains of human chd1 in complex with influenza ns1 c-terminal tail dimethylated at k229
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
b'EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/viral protein
total genus 53
structure length 173
sequence length 173
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4o42A02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4o42A01
1B2TA 1CA5A 3TN2A 3R93A 3Q6SA 2J7ZA 2HDMA 2Q8RE 2RSOA 1LV9A 4ZK9B 1AP0A 3SVMA 3I8ZA 1AZQA 1HFGA 1U4LA 1G2SA 1IKMA 4MN3A 4HEDA 4X3KA 4X3SA 5CBEE 1MSGA 1KNAA 2RVLA 5T1IA 1C8CA 1RODA 2KOLA 2KUMA 2FFKB 1HHVA 2FMMA 2K05A 1SDFA 2K03A 2FJ2A 1MSHA 4IUUA 3MTSA 3D6WA 1F2LA 3I3CA 4OIKA 1X32A 1G91A 1WTRA 1E0BA 4HCSA 1DONA 1HFNA 2B2WC 1U4MA 2K28A 1J8IA 4HSVA 1EIHA 1RJTA 2N55A 3LWEA 5EPJA 5EQ0A 4CJ0B 2MPMA 1U4PA 4IUTA 4XT1B 2DY8A 5JJZA 2B2TA 3I90A 1WTXA 4R9WA 2KECA 1F9PA 4IURA 1BBXC 4QUCA 2IL8A 2NWGA 2BDNA 1O7YA 1MI2A 2R3ZA 3UI2A 2L9HA 4DN4M 1F9RA 2L11A 4IUVA 1NR4A 1JICA 3QO2A 1ILQA 3ONAB 4QUFA 2B2YC 1O80A 1VMPA 1EL0A 1MGSA 2DY7A 5E4XA 1SAPA 1F9SA 2K01A 1U4RA 5EPLA 1B50A 4RAUC 5EJWA 1WTVA 1ML0D 5AFWA 1SSOA 2B2TC 1VMCA 1QG7A 4LMQD 1PFNA 1DOLA 2B2VA 3TZDA 1A15A 4CJ1B 3GV6A 1WVLA 1ESRA 2N88A 1CM9A 2X6LA 5CORA 4R8IA 2L1BA 1WTOA 1WD1A 1X3QA 1NAPA 4ZKBB 5CMDA 2HUGA 2NYZD 1WTPA 5DNFA 4XDXA 2L12A 5CBAE 1G2TA 2Q8TA 1ZXTA 1NR2A 2RA4A 1EQTA 1GUWA 2FHTA 3FPUB 3I91A 3IL8A 4RWSC 1WTWA 3KUPA 1HRJA 2B2VC 4HAEA 1EIGA 2X69A 4X3TA 1O7ZA 4O42A 5EPKA 1QNKA 1PFBA 2FINB 2D9UA 1HUNA 1EOTA 2JP1A 2L4NA 4XT3B 2KEDA 2B2UA 2HCIA 2X6GA 3N52A 5E4WC 1G6ZA 2MJ8A 4X3UA 1DOMA 1ILPA 1S4ZA 1RHPA 2VXWA 2EPBA 2MGSA 1IKLA 1IL8A 1BO0A 5COYA 4ZKCB 4IUPA 2CVRA 1J9OA 2KVMA 1DOKA 3F2UA 5EKIA 5D14A 1PFMA 2K1BA 1NCVA 3KBXA 4UAIA 1WD0A 1DZ1A 3P7JA 4RA8A 4CJ2C 1PDQA 1PLFA 1B3AA 1RTOA 2B2WA 2SDFA 3DEOA 1ICWA 4MHEA 1KNEA 2HDLA 2B2UC 1F9QA 4IUQA 1AZPA 1HA6A 3MWYW 1B53A 1BNZA 2HCCA 2EOTA 4NW2A 1RTNA 5T1GA 1XYIA 1CA6A 1XX8A 2JYOA 3HP3A 1HUMA 1WTQA 2K04A 1QE6A 4ZAIA 4U68A 4ZLTF 2MP1A 3DEPA 4OIJA 1X3PA 1B4OA 2NZ1D 2H1EA 2KEEA 3FDTA 2B2YA 1M8AA 2M2LA 2XIWA 3IFDA 1JE4A 1TVXA 5D65A 3GV3A 1BF4A 2RSNA 1Q3LA 3G7LA 2EE1A 3H91A 3DM1A
chains in the Genus database with same CATH superfamily
4K5VA 3R93A 4RKLA 4Y7NH 2OTLA 5EKLA 5IGBA 1BDOA 2F0JA 2K14A 4POFA 5A35A 2NBFA 1Y1VG 3S14H 4DFAA 1SYDA 2E76C 2K5NA 5AJ3Q 2IX3A 3DWAA 4LF5Q 3ZYYX 4BY7G 1F2LA 3OMGA 5C4XB 3W2DA 4KK7A 4H0LC 2PQAB 1TWFH 1SNDA 2MPMA 1YNND 2NVQB 2VQEQ 2RF4A 3HFZB 4A3BH 1SBBB 1RL2A 4HN7A 2NWGA 3QR8A 3STBD 3D8GA 2F0VA 2JA5B 5FKAC 1O80A 4B3RQ 4BY1B 1EY6A 1JMCA 3A5ZB 4C2MH 1JWMD 1TWAB 2EJMA 1SXTA 4JVZA 2ENBA 1A3TA 2FMCA 3TP6A 2QA4A 5I2YA 2EZVA 4LF6Q 4L5TA 4YCVA 2K7VA 1GD7A 5JPNC 4DPGA 3KLWA 5FLMH 2PQAA 4F87A 2L12A 4KN7C 1HNZL 1ZXTA 2CWPA 1Q90A 1VQ6A 1C9OA 3D31A 4A3KH 2E5LQ 5FO8B 1M1KC 1II3A 2WB1G 3CRLC 2R92B 1J5EQ 1N33Q 3JAMi 4DR2L 4PMWA 4A3DG 1B7YB 2GVAA 4LF4L 4OHJA 1EFID 3LX0A 2B63B 2CH4A 1QVGA 5I9PA 1CQFA 1NNXA 2YTXA 5C5LA 3MEHA 1RTOA 2SDFA 1HA6A 3CAMA 4K8JA 3KLSX 1DM0B 1A2TA 3HOYG 4JBWA 4BBRB 3BDCA 3KF8A 5M5YB 4DR6Q 1STHA 3PIP3 4FXDA 3T1HL 1EWCA 4GNXB 3E9HA 4FF1A 1YJNA 1MHWC 3HKZE 1BF4A 2RSNA 1JWUD 3PO3B 1VQ9A 5J3BA 1SNCA 1YNJD 1N36L 1CA5A 5ELEA 3TN2A 1X55A 3K7AB 4JOIC 1R9TH 3S24A 1LT5D 2UXCQ 1D8LA 3TP5A 5GROA 4A3MB 3AQQA 1VQJA 5T1IA 4K2LA 4B3ML 2R92H 2PW5A 2AKWB 1PTOD 1SDFA 1DCZA 1I4XA 4TSSA 2LS01 1SR3A 4BS9A 4KLKA 3A54A 1VQ5A 3SE0A 2F3VA 1JE5A 2B63H 1LUZA 1SFOB 1I94L 4R4IA 4DK1A 1PRTF 5IGFA 1LTAD 1S5CD 1CZGA 1HNXL 5K5PA 5KIXA 1F9PA 1TWGH 4GNXA 4ULLA 4Y52H 4K6LA 1MJCA 1X9NA 4B3TQ 1FVIA 1XNQQ 3H0GH 3L2PA 3JAML 1PRTC 5M5YH 1IBML 4YY3Q 3GTPH 4FF3A 1PH8A 3PMFA 1HR0W 3RLOA 4JV5Q 1R4PB 3S16B 1Y1WB 2CWAA 3FPPA 1OXTA 1IYUA 1EU3A 1UEBA 1SNPA 2O2LD 2IHEA 2N8NA 3CPWA 2Q8TA 3I55A 4DAPA 1XPUA 1YJ9A 4DV2Q 3HOVG 3T1YL 1KL9A 1VF5C 3RN5A 2VQFQ 2OXPA 1VQ7A 3GTMB 2Z6KA 2G9HD 2HCIA 1S40A 1WCMH 1U0LA 5FO9B 1SE3A 2RCNA 5L37A 1ILPA 1AN8A 2ZM6Q 2VXWA 3OSOA 4QF4A 2PQEA 3S1MB 1FNUA 4X66L 2K5WA 3VR6A 4CDFC 1XMOQ 5C0XH 3D3RA 1S5ED 4HCEA 4PNYA 2HCCA 3E9IA 2HD3A 1XX8A 1HUMA 1VQDA 3MZ5A 4FP5D 4X64L 3AEVA 2AQ3B 2I5LX 4JPBW 4ME3A 4DNRB 2VL6A 5JAVA 4A3JG 2QCPX 3S15B 1L1OC 2HHHL 1H95A 2F52A 1SYEA 4OONA 2ZTCA 1NBWA 4DUZL 3I4OA 2C35B 2CH4W 3SVMA 1VDZA 4IPHA 1O78A 3KF6B 3S2DB 1TS4A 1KNAA 2JA7H 1V8QA 5M5WH 5C44H 3TREA 4O0AA 3TP7A 4RHRA 5FOBB 3I3CA 4OIKA 1IBKQ 2XN9C 4HCSA 1I6VC 3NHHA 4IFDH 5EQ0A 4JI2L 4RMFA 4UP9A 3HKSA 1O7YA 1ZYRD 1I4HA 1ILQA 3ICEA 4LFBQ 1G51A 1STEA 1VMPA 3GDEA 4NPSA 3TSSA 1Q81C 2DGYA 4J1MA 3NBHA 4C56C 4DV3Q 5LMUQ 3SGIA 1YZ6A 2QILA 3S15H 4QGUA 1VCIA 1GOZA 2NVYB 3VYUA 5C6AA 5C3EG 3K5LA 1XNRQ 4AQYQ 1D5MC 2E2DC 2TMPA 3GV6A 2IHFA 3GD7A 4A76A 3KOJA 2NYZD 5KNBA 3HOXH 1WTPA 3E0EA 2F0IA 1K8AC 4PMCA 4DXFA 5CR3A 1VQBA 4JI7Q 2R93H 3A8JE 5LMNQ 2B2VC 4LFAQ 1QWYA 4RHSA 4BBSB 2NTSA 1PFBA 1BBWA 5GAHC 1MBYA 2JP1A 2L4NA 2NZOA 4JYAQ 4C3IG 2K32A 1PYBA 2WB1E 1RD9D 3HOZB 1HR0L 1CFMA 5IY0A 2MJ8A 2IT1A 1S4ZA 3T51B 4KTAA 4ZKCB 3E0JA 4JI1Q 4YWMA 5ELCA 2ICIA 1DZ1A 1R4QB 4DAVA 4APVA 4A3FH 2K5QA 3NQTA 1K0RA 2EOTA 1PXUA 3A5UA 1S3OA 1VQCA 3IRBA 2VW9A 4OWWB 1CA6A 3VR3A 2JA9A 3DUZA 3T53B 5KYLA 3RZDH 2KA7A 2F0KA 1SE2A 1SNOA 4H7BA 4E6IA 3NP8A 5LL6S 3NTHA 1JORA 3HOUB 3M4YA 3BYYB 1JB3A 4A3BG 4GOPB 1MJEA 1A62A 3RZOH 1XPRA 3URYA 2BH2A 2XSCA 1U4LA 5FLXE 3CCLA 1JOKA 1CSPA 4BBSH 4DK6C 2F03A 1C8CA 4DR5L 1HNWQ 3CC2A 1LTID 4TVAB 4JI6L 4QQBX 2CQOA 3NTIA 3MVVA 4DF7A 5JVH3 3I7FA 1K73C 3Q0AA 1VQNA 2FXQA 1PH2A 1X32A 2F3IA 4DR7L 1DYQA 3WOEA 2UUCQ 1B1ZA 2ZJQA 2JA6B 1LYLA 1KQSA 5FLMG 3SK6A 2VY3A 4X62L 1XMQQ 3I90A 3OTOL 4DA2A 4CKCA 1C48A 1F2ZA 2F1MA 4PQXA 1CHPD 5FK9C 1Y8OB 4GOPA 4A3KG 3ONAB 1VQLA 2OCEA 1SAPA 5BR8Q 4Z9CB 1Y8PB 3BJUA 3NEMA 5JOBA 4DV6L 2LXJA 2EDGA 3U9OA 1YHBA 3K57A 4KKSA 1D6EC 1IW7D 4YWLA 1SRUA 1A6XA 1YITA 2L1BA 3PGZA 4R8NA 1I50H 5IGGA 5KNDA 1X3FA 5DNFA 1PH4A 2E2HB 4DR4L 2DNEA 4JBMA 2X69A 2PZWA 4O42A 4WJ4A 3J81i 4LJZC 1BKBA 1M90C 3C1FA 4C3JB 5JEAJ 4GN3B 4JBKA 1BQQT 3SEBA 3E6ZX 3CCQA 2JA6H 4XXEA 4N8X1 3CMEA 4FF4A 1I4GA 2KVMA 1DOKA 3OPOA 2K1BA 4UAIA 1WD0A 2H5XA 3OOCA 1DJRD 1SJED 1IL2A 1L0YB 2HDLA 2N3SA 1N34Q 3QIAA 3GTLH 2R92G 5G3LD 1WI5A 2JYOA 1OO9B 5EBDA 2K52A 4GKKQ 2KEEA 2UXBL 2B63G 1I4RA 2MFIA 1YVCA 2BE5C 4JI5Q 1HJPA 4LFCQ 3KYHC 3J7YW 5HY6A 1B2TA 5BN3A 1E22A 3QOJA 3H0GG 1TY0A 1TR5A 1VQ4A 1EU4A 4RFBA 3I56A 4DR1L 3CP0A 1X3GA 2QDBA 4C3JH 3A7LA 4HJ8A 4XQQA 1TU2B 1SYBA 3ER0A 1IHZA 3VR2A 1Z47A 3NELA 4ZYSA 3VYRA 4HSVA 4GLXA 1AFPA 2IWHA 3T16A 4XQNA 4KHPQ 1Z7TA 3QOLA 3UE1A 2M9VA 2JA8B 2D2CC 3F1ZA 2BDNA 4DXGA 1JR0D 3Q24A 1P8LA 3J81L 4YCUA 4DUYQ 5CC4A 2EY1A 4IJLA 5EPLA 3OMCA 4DK3C 1WCMG 1TS3A 1EZ8A 1K8MA 4DV4Q 1VMCA 5GQOA 3CPFA 3DWQA 1I3QB 4A3JH 4UDUC 3HRZC 3J80i 5I4DA 2E2JH 1RCVD 2KJXA 5C0XG 2F0PA 4DKAC 2OEOA 1TWCB 1EYGA 1LT3D 3NE5B 3AU7A 4RG1A 3F2BA 1K83H 3KUPA 1XPOA 4JOIA 1J6QA 1N8RC 1OXVA 5M5XB 3IKJA 5IYDH 1HUNA 1EOTA 1Y1WG 1A2UA 1PFSA 1YBYA 5TSSA 4NXMQ 4B3SQ 4X3UA 1XWEA 1RHPA 4HIDA 2WAQB 2B3GA 1QILA 1LABA 1D7QA 1LTSD 5IYCH 4HSPA 1K3BC 4RGOS 3J7A5 2CHBD 1UE1A 4DV1Q 5D3IB 5HURA 1KNEA 4CBVA 2QW7A 3M3YH 4NW2A 4WORA 2BCOA 5C44G 1UE7A 2A68D 2PMZE 4ZAIA 1ET6A 3PO2B 1SYGA 2HQLA 4C3HH 1EQQA 4A4IA 4DGZA 4IFDG 1A63A 2BH8A 4R4CA 3R8BA 1X65A 3RD4A 3Q23A 5KNCA 1PZJD 1VQHA 1BXTA 3QB3A 1I4PA 2Q8IB 2A5HA 2PO4A 4JK1C 4DK0A 1LLRD 1H9SA 3BZCA 3TQYA 5M5XH 3LWUA 1KRSA 2R7ZB 1WOCA 4GZYC 3A74A 1KD1C 1DONA 1U4MA 3J80L 2G5DA 4BA2I 2VUMB 1V1PB 1L1OB 1U4PA 3HOXG 4PV1C 1IYVA 2OQ0A 1S72A 1CZWA 1N32L 3ERQA 1BBXC 2R93G 4R4TA 5C4JH 4JCVE 1LT4D 2R7DA 4V0BA 1KABA 1HTLD 3CRKC 1I6HH 4K0KL 1VQ8A 1ML0D 4OXPA 2F4IA 1PH9A 5E3FA 1L0WA 3I4NB 4OX9L 1B3QA 1Q1EA 4A3EB 1C7YA 1EY8A 3PUZA 4A3IB 3MC0B 4JI0L 4JI8Q 1K8OA 5IP9H 2VZAA 1TWHH 5J39A 1BCPD 2QDLA 2UXDL 1LO5D 1RDPD 4ZUJA 4A3FG 4LUVA 1PTOH 3TBIB 3QG1A 1V1PA 1L1OA 1H9KA 2LXKA 4GN5A 5GADC 1I5FA 2FINB 1F2MA 1SMXA 3QWNA 3R2IA 3GTKB 1V43A 2XVSA 3RN2A 1G6ZA 1GUGA 5AJ3L 4QY7A 1PMRA 1HNZQ 2EPBA 3A56A 2D5DA 2A8VA 3JAMc 5M3FB 1QJOA 5CGKA 4DV0Q 1NMGA 1PH1A 1PDQA 5EKKA 4MHEA 3K59A 4PZ7A 4BBSG 3KF8B 2VQEL 3EQLC 1NMFA 2SNSA 4LF4Q 1X6OA 2RDGA 2RQXA 3CU7A 2RBMA 4B3RL 5C4XH 2A6HD 2F0OA 1EEID 1KAAA 1V9PA 3S2HB 2CQAA 1Q82C 2NVQH 2Z1CA 4K6DA 4OO1I 3I2ZA 4P74A 3BU2A 4X3KA 2Q2UA 2JA5H 3CCVA 2L15A 4CKBA 4BWGB 3T1HQ 4BY1H 2AUKA 1JQYD 1ASZA 5GAEC 1TWAH 3G6EA 3FKIB 4Q5VA 4IUUA 4HMJA 1N36Q 2E5LL 1E0BA 1GHJA 5FO7B 1J5EL 2N55A 1Z6HA 4I7ZC 4UY8C 1ENFA 1BCPF 2Z4IA 5JJZA 2B2TA 2JE6I 1D1IA 4I7AA 3GTGB 3VYTA 2A19A 4QUCA 4XYOA 2Z8LA 1TXYA 4DN4M 1Z9FA 1NR4A 1PA6A 1SYCA 3BG3A 1MGSA 1SJHD 2CW0D 4FVMA 1YNNC 5C5MA 2YTVA 1B44D 1I94Q 1A0IA 1FGBD 2JA6G 3HKZB 3L0OA 1DOLA 3TZDA 1EYCA 4I65A 2PNRC 4DR6L 4AYBG 1EZ6A 5CORA 2OF1A 2YU9B 4ZKBB 3DMUA 4FYDA 2HUGA 4A3GB 1TIID 1G291 5CBAE 4EQNA 3OHXC 1IBMQ 1NSNS 2QKIC 1O7ZA 3M9BA 4BBRH 5JVG3 2HIVA 2J4XA 1E2WA 1Y14B 3U9SA 4XT3B 3CC7A 4RCOA 3BZDB 3J81E 3N52A 5E4WC 4M8AA 3F2CA 4C1NK 4KHVA 2V4DA 2MGSA 4RKBA 3PO3H 4J15A 1C4QA 2GA4B 3L7ZC 2CVRA 5FJ8H 3K7AH 3K5MA 1PHJA 3G48A 2EYOA 2YV5A 2RDHA 4A3MH 4G7OC 2VB3X 3E5SA 4NXNQ 4BXXH 4C3JG 2KCCA 4F8MA 3D4WA 3VR5A 1SYFA 4LF7L 4MZ9A 5LMNW 2NB0A 3W3AA 1XNQL 2OTJA 2IX1A 3FDTA 4X66Q 4L63B 1JE4A 3FHWA 5D65A 1SFOH 3CD6A 4FXKC 4GLAC 3GTOB 2EE1A 4A93B 1UE6A 2RHSB 2EYJA 5EGTA 2PI2E 3BDLA 3NWSA 4F88A 1O7LA 2E2IB 4CGYB 1G2SA 4HEDA 3OW7A 1W2BA 3CC4A 3IFTA 2L5TA 5A2QE 4LUZA 4IJHA 1YNJC 2HHHQ 1PTOF 1E3PA 4LF9L 2L0CA 3T4AC 1VQOA 3TZUA 2XNAC 4F7XA 3S16H 1Y1WH 2B2WC 1HFNA 1EIFA 1J8IA 3BVZA 4DNIA 2O4XA 3CMAA 4IUTA 4XT1B 4U673 1SLJA 2AHOB 4XYQA 1PTOC 1YHAA 4GKJQ 2D62A 2ZM6L 2IL8A 3GO5A 4JI3L 3NBHB 2ICEC 2EYLA 2Y0SG 3R2TA 4KJNA 1A8VA 1XMOL 1L0XB 3W1GA 2K01A 1LT6D 5IYDG 2UU9Q 1WTVA 4JI2Q 3GTMH 4IN3A 3S17B 4AH6A 1A15A 2IY5B 4B9WA 5IYCG 1STNA 1WTOA 3S1MH 2K6AA 4FDBA 1FR3A 2N78A 4H02A 1G2TA 5BN5A 1IBLQ 5DM73 3CCMA 4RWSC 3J80E 1QNUA 2NVTB 3BVMA 1Y1VB 3O13A 2JQOA 2QEXA 4K14A 3PIOA 4C3HG 4R4QA 1STBA 2F0WA 4H44C 1PV4A 2B2UA 3TDQA 4BY7B 2A74C 4MIUA 1LTRD 1XXGA 1WFQA 1BO0A 1IL8A 3WDNA 3PCOB 1IBKL 2AQ1B 3OYYA 3HGBA 4CJ2C 4EQPA 1OTCA 4HR7B 5I6WA 3S2DH 1BNZA 1LACA 5T1GA 1BVSA 3D6CA 2A69D 1QE6A 2I07B 1GKHA 3T56B 4LFBL 1JT8A 5IP7H 2NZ1D 2K50A 1KDCA 2WAQG 2I0QA 3GQBA 3A55A 4DV3L 3GTJB 5LMUL 3S1RB 3D4RA 3OWEB 1FJGQ 3H09A 1EY7A 1B9NA 5IYBH 2P5ZX 4AQYL 1YNXA 2PCFB 1TKWB 1AP0A 2ZXRA 3OIQA 2NVTH 4M1UB 3JC66 3LGJA 2JXMB 2RVLA 4G7HC 1PH7A 1GM5A 3SDZA 4B08A 1OXUA 4JI7L 5C3WA 1CK1A 1SNQA 2B39A 3MFGA 4ZQ3A 1QVFA 1STGA 2WB1B 5LMNL 1BBUA 4NKLA 3D6WA 4DNTB 1P16A 2NVYH 1EY5A 1H9MA 3E3XA 3I72A 3UDIA 2A6ED 2F0MA 1E1OA 3ULJA 2K28A 4A3DB 5IP9G 4JYAL 3LWEA 1AE3A 3H15A 2JEAI 3CCJA 1JOQA 4RCNA 1BUVT 2L9HA 4JI1L 1F9RA 3MXPA 3MEFA 4DV5Q 2LKVA 3M4OB 3HOYB 1D5XC 1GUOA 5KYIA 3HOZH 1QG7A 2XWJB 3GTJH 2PW7A 3GTQB 1ZYRC 4TQUS 1EWHA 1LTBD 2F0HA 5HGTA 1NUCA 4P73A 4AYBE 1PYWD 1IZ6A 1NR2A 3MXUA 3IL8A 4HAEA 2WACA 4A75A 4LW1A 2WFWA 5CV4A 5C4XG 4WFN3 1Q1BA 5CV7A 4A3EG 1FNVA 3J81c 1S5FD 3HOUH 4OWXB 3UDXA 4DR4Q 5EKIA 3V96A 2O5JC 1NCVA 1UNSA 1BR9A 3U50C 3G71A 3DHQA 4EX5A 5C4ZA 1KDBA 2JA5G 1XMQL 4BY1G 1EEFD 5H1SE 4HIKA 2ASBA 4QCLA 3U4VA 1KRTA 2UUBQ 5BR8L 2H1EA 4DR3L 2C9OA 3RR5A 4L6TB 3NBIA 1XJVA 3G7LA 3OIPA 5EBCA 3JAME 3DM1A 4K2KA 1K28A 1NJIC 2ZXPA 2WKDA 3I4MB 1LTLA 4MN3A 4X3SA 4DV7Q 2F0EA 3D0FA 3OW2A 4HIMA 3HEJA 3AFQA 1KIXA 1YIJA 3K8AA 5IWAL 3V2TA 4FO2A 2QEJC 1EYDA 1EIHA 1RJTA 1S5DD 4HJ5A 4RGMA 3CW2C 2IW3A 1E7ZA 2E2HH 1OXXK 1DGSA 2EY5A 4BBRG 2ID0A 3F8TA 1HQMC 1VQFA 3SK4A 5E4XA 4XQJA 4MNOA 4OWTB 2Y0SE 5M3MB 2EYFA 1N34L 2K5HA 1VQGA 4DAYA 1PFNA 1ICFB 1NE3A 1X56A 3FEWX 3PO3G 3S1NB 2N88A 2PZTA 2X6LA 5FJ8G 4P72A 1SMYD 3EA6A 2WP8J 3AYHB 4L5SA 3C46A 1NTGA 3I4MH 2KHIA 1STYA 4IQZA 4JI5L 3QJYA 1CTMA 3MA2B 2RA4A 4A3MG 4BXXG 1TS2A 3J80c 3R3OA 2B8FA 5JEAH 2YYZA 1JB7A 1IW7C 1E2ZA 5KGUA 4JI4Q 4A3LG 5DM63 3ERSX 4OL7A 1T9HA 1Y8NB 2F0FA 1QB5D 2KCTA 3HOWB 4RA8A 2CCZA 1B3AA 2LMCB 4KY7A 3CQZB 1JC7A 1LTGD 2EIFA 3VR4A 5G3LF 1K3RA 1WTQA 1E24A 5M3MH 2SOBA 3MHBA 1PRTB 1KHIA 4DUYL 1B4OA 5NUCA 2ATWA 4KY6A 4LF8Q 3VDYA 3D4DA 3S1NH 3T13A 5C3EB 2WAQE 2DNCA 3PUVA 4DV4L 2EYPA 3EFXD 1H9SB 2JA8H 1V1OA 1TQOA 5DEHA 1MIUA 4YCWA 4HIOA 1JWSD 5DLQE 2MUYA 2CKZB 2F3WA 5C3XA 3EN2A 1YHQA 1WYDA 2K75A 2NUCA 2AUJD 2AWNA 4YHHQ 1X54A 3TS2A 4X65L 5CV9A 1I3QH 3VA5A 3PIPA 2K33A 2DY8A 2Q2HA 4J8QA 3K58A 4B3SL 4NXML 3HOWH 1I4QA 3J81j 2ZJPA 5IT9L 2BA0A 4NDXA 1TWCH 2B29A 4Y7NB 4HJ9A 3S14B 4DV1L 4QIWE 1B50A 4OEMB 4WRDA 5EJWA 2H4OA 1TY2A 1FNWA 2Z4HA 1TS5A 4P75A 5JJKA 3K0XA 3NXWA 2NN6I 4GOPC 1TWFB 4L8JA 1LM0A 4JW0A 3OWFA 4PZ8A 4R8IA 5CMDA 1EYAA 2PYKA 3WWVA 1Q12A 3J7AV 2K5DA 4EVOA 4FXGC 1K8GA 1GUWA 3I91A 2C5CA 1EIGA 1T5EA 1HXYD 2UUAL 4NMZA 4C2MB 3PO2H 2D9UA 2OQKA 5IP7G 2QGQA 3VYSA 2UXDQ 4QB4A 4PG3A 2AQ2B 5ISRA 1A3VA 2F4VL 3I4LA 1DOMA 1CKMA 1PZID 5IYBG 4RH6A 5D14A 3KBXA 1MKHA 4KHZA 5F2DA 4N8FA 3P7JA 2Z0SA 3TMEA 2B2WA 3DEOA 2EXDA 5I2XA 1EY9A 1F9QA 1AZPA 3MWYW 1T5XD 5CV8A 3K6OA 4A3KB 4KKUA 4U68A 2R7ZH 1KDAA 3EJIA 1D5ZC 4LNQA 3VA7A 4YIJA 2XIWA 3V05A 3TRZA 1SNMA 1HZ9A 1PZKD 2VUMH 3C2PA 4LF5L 3L3OC 1UE5A 2A68C 3NUCA 3Q6SA 3CCUA 4K8IA 5J1ZA 4V190 4JI8L 4DU9A 1NY4A 1IKMA 4GN4B 1HZAA 5K36H 2B8GA 4DR2Q 3P20A 4ZUIA 3AB9A 2FMMA 5CYUA 2AWOA 2VS1A 4K5WA 4Q0FA 3HOZG 2HQEA 1OXSC 3I4NH 1RF2D 4A3EH 4A3IH 1H9JA 1PRTD 2ES2A 5EPJA 5CV6A 3H3VI 3KBGA 2SEBD 4FNFA 4LF6L 1R9TB 5C0XI 3TS0A 1LTTD 3NK9A 5ELDA 5BN4A 2LY7A 4IUVA 3IAYA 2DJFC 2KCMA 4DV0L 2B2YC 5LL6X 2VNUD 4RAUC 2EY2A 3W1BA 3NWTA 2KHSA 1VF7A 2I5MX 3ITPA 3GTKH 5FLXL 4HTHA 3U58A 2B2VA 2DUDA 3HOUG 3AMUA 1N33L 2EYMA 4OELB 1EY0A 1CM9A 1WD1A 5M3FH 3UDGA 3K5OA 3K81C 1TWGB 1XTDA 4B3MQ 2RDFA 2E74C 4S3SA 1EQTA 3PQIA 5EAYA 2ZTEA 1SE4A 3H0GB 1IXRA 2AMCB 4KD3A 1BCPC 5I6YA 1MD2D 4RGNA 3GTPB 1GXDC 2I5HA 2K5VA 2BOSA 1HNXQ 3S2HH 4KMUC 4IFDI 1PH6A 3BS1A 5COYA 2NN6H 3STBC 3K5NA 3LNNA 2MNAA 4IUPA 3FP9A 1YJWA 1CKNB 4TRDA 1QUQB 1HCZA 3X3MA 1HQRD 3A8KE 1ICWA 3P1HA 1B53A 3CKIB 5C0XJ 3CCSA 4HMIA 3RLFA 2MP1A 2QF7A 3FKIH 4OGQC 2UXCL 1CT1D 3PF4A 2K4KA 1WCMB 1V1QA 2LSSA 4ID6A 1Q3LA 5E1FA 3P75A 3SXHA 4G57A 4N9TA 3GTGH 2HDMA 1JJCB 3TP8A 3T1YQ 5JJLA 1HFGA 4LF7Q 2A6HC 1CKNA 1TT2A 1QUQA 1UAPA 2KUMA 2FFKB 2K03A 1AEXA 2KQ3A 5J22A 3UDFA 5LHY1 1Q86C 4B3TL 1G91A 2XRSD 3TEHB 3RUZA 4A3LH 1FL0A 3KDFB 4YY3L 2KCNA 2YU9H 2EXZA 3I4MG 3M7GA 2ZTDA 1Q7YC 5ELNA 3KK7A 2WKCA 4IFDJ 3F2DA 1WTXA 4A3GH 4JV5L 3N6RA 3RMHA 1MI2A 3UI2A 4X64Q 2L11A 4LF9Q 4QUFA 5JEAG 2JA7B 1EL0A 5I9OA 3KJOA 1KTKA 2HT1A 4IPGA 2M00A 1U4RA 5M5WB 5C44B 1WTHA 3X3NA 5JJIA 4AIMA 2E8GA 2PNHA 1FD7D 4NXNL 1F2YA 1EY4A 4DV2L 1FYCA 4NB3A 4DUZQ 2VQFL 1ESRA 2MO0A 3PUXA 1EOVA 4JI3Q 3H3VH 1N9WA 2CW0C 4IO9A 4PZ6A 1O7IA 2GVBA 4OO1H 1S5BD 2EQSA 4H13C 4CHTB 3KDFA 4ABNA 3GP7A 3UE0A 2FHTA 3FPUB 2OWOA 4KKTA 2YTYA 1XTCD 3K0YA 5M3MG 5ELBA 4KI0A 1C0AA 1CUKA 1HZCA 4IUNA 5IT9E 3BVGA 2GN5A 4CDCC 3DWPA 3J7AF 4PMBA 3GTOH 4A93H 3F2UA 2JA8G 1ESFA 1PFMA 3HOXB 3U4ZA 3MAQA 3B6YA 2E2IH 2PI2A 2R93B 2MHVA 4R1JA 2I46A 4GKJL 3KLSA 5D3DA 3ND8A 2K04A 2ALYB 2JJQA 4ZLTF 1X3PA 3J7ZC 1CHQD 5ELOA 1M8AA 2UU9L 5IGEA 1VQPA 4YWKA 3GV3A 4A3CG 2EJGC 2R7FA 2L55A 3HOWG 3RNUA 5IOCA 3I73A 1VQEA 4G7ZC 2J7ZA 5GAGC 2KBNA 2Q8RE 1B9MA 4ZK9B 3MXGA 3I8ZA 4A3FB 4POGA 1HHVA 2G9DA 4B9XA 1HR0Q 1B70B 4WJWA 1IBLL 4ILWA 2EYHA 3KF6A 4IPCA 1HPCA 3RZDB 1ONLA 3PF5A 3ND9A 4CKEA 1SE8A 1ENAA 2R61A 1CQVA 2F0LA 3S17H 3M4QA 2MO1A 4CJ0B 3HZXA 4ME5A 2VB2X 2PZUA 4L5RC 3KJPA 3BZKA 2KHJA 3RZOB 1XNRL 2BA1A 1Q46A 3QO2A 1KC8C 1Y69U 1Y1VH 2DY7A 1K0SA 3PO2G 1F9SA 2NVXB 3BYTB 1HH2P 2B2TC 3FMCA 2BDOA 2F0UA 4LFAL 4BY7H 1U9RA 4KD4A 1VS0A 3DLLA 1WVLA 1H9RA 2ZJRA 1Q8IA 1E1TA 2N49A 3EIVA 4DR5Q 1GVPA 4NP5A 4MTKA 1PYSB 2JSOA 4JI6Q 1FJGL 4UPAA 3WOFA 5KEEA 4O1NA 1PH5A 1EQVA 2JK8A 3G6JB 4P71A 1W6KA 4R4OA 4X3TA 4DR7Q 5EPKA 2R7ZG 1QNKA 4LUOA 4TKOB 5ELFA 3S1QB 4QJFA 4QMGA 4X62Q 2X6GA 4GNXC 2VUMG 4XTCS 1GO3E 2F0TA 4KY5A 3OTOQ 3C1EA 3Q8DA 2RCFA 3M85A 3S1RH 2J0TD 1I50B 4JC0A 4KV6A 2PPBC 4FF2A 2EY6A 2XTIA 1PLFA 5K36G 2BE5D 2SNMA 3PV0A 4DV6Q 1SEBD 5E7NA 1XYIA 3HP3A 2NVXH 3MFYA 3ULPA 2EJFC 1EQRA 1G8ZD 1DXMA 4OIJA 3I4NG 2OT2A 2F0NA 3G4SA 2LFNA 2M2LA 2D0OA 5IIFA 4DV5L 4A3IG 1HNWL 4A3DH 2D0PA 2WV6D 2JN4A 4ZRZA 3H91A 4AYBB 2IPKD 1F77A 2DJGC 2A69C 2UUCL 1QVCA 4DAMA 1HZBA 5CBEE 2Z6KC 1MSGA 3GTLB 4DR3Q 4X6AH 2KOLA 1QZGA 1ASYA 3M4OH 4IOCA 3HOYH 3S1QH 2WINB 1ENCA 3SK5A 1EUJA 3GTQH 1AW7A 3ZJYC 1RIPA 4KN4C 3SR1A 2Q2TA 5M3FG 1K9MC 3H3VC 2MQHA 3I70A 1GHKA 3NENA 4R9WA 4CDDC 3A0JA 3M4PA 2ZT9C 5HGQA 2DN8A 2HIXA 3PIO3 2TSSA 4O2DA 1JICA 2A6EC 5IWAQ 4BA1I 4DAYB 2O5IC 3K7UC 2RHQB 2UXBQ 1G6PA 4HJ7A 3HOVB 1HA5A 1PH3A 4GLVB 3CCRA 2IJ0A 5DAUA 1VQKA 2NN6G 4CJ1B 2CFMA 4L5QA 4CDEC 2UUBL 3FVQA 1X3QA 1NAPA 3DM3A 4XDXA 3NPPA 1HTPA 4DR1Q 4EQ5A 2F0DA 1GUSA 1UWVA 3Q22A 1CI3M 1WTWA 1HRJA 1YI2A 2V1CC 1Q8KA 3CHBD 3DXJC 1YEZA 3FKIG 5IGDA 4DV7L 3KLRA 3A7AB 2KEDA 4IZ8A 4UP7A 5IT9c 1W6JA 1DD2A 4A3JB 4GKKL 1GUTA 3EVQA 1B8AA 1UUPA 1JOOA 2A73B 1QOHA 2A1AA 1VQIA 2E2JB 1EWIA 3W5OA 1CKOA 2B2UC 4LFCL 4IUQA 3A8IE 1ET9A 1K83B 4ODGA 1RTNA 3EBEA 2Y0SB 4IALA 1SN8A 3EROA 3RLNA 3HOVH 1CSQA 1FGUA 1JJGA 3DEPA 1BCPB 3HKZG 2ZXOA 4J6HA 2F0SA 3ULLA 2B2YA 4EGVA 1TVXA 3CCEA 4IPDA 4JG2A 1D2BA 1VQMA 5C4HA 4A3GG 4JBJA 4P2CB 1D1KA 4QL5A 2RSOA 1LV9A 1AZQA 4ALPA 4N9PA 5IGCA 4KHPL 3M3YB 1RODA 4HJAA 1VQAA 2K05A 1QZHA 2FJ2A 2NTTA 1MSHA 4LAAA 4LK1C 3MTSA 4C3HB 4WJ3M 1ZKOA 3SK8A 5CV5A 2KENA 1WTRA 4UP8A 4KJOA 2F0GA 3SHLA 4RGTA 2Z6BA 4G4KA 1M4VA 4JI4L 2XWBB 3AFPA 4UHVA 4OO1G 5JPMC 3CF5A 2KECA 1KXLA 1EFWA 3H6MA 4IURA 2R3ZA 1RKNA 3NQIA 4GS3A 1JJ2A 3M7NA 3NTKA 3KFUA 1KLGD 4ZCKA 3H94A 4EQOA 4X65Q 3MXNB 5AFWA 1SSOA 4K5XA 2R6GA 4LMQD 2F0QA 1EIYB 1A3UA 4C3IB 4A93G 4IOAA 5A2QL 2XRQD 5KRUA 2Z9HA 4LF8L 3PUWA 5M9OA 4A3CH 1GJXA 3PUYA 1KAWA 5IODA 5IE8A 1PVOA 2JA7G 3CQZH 2NZHA 5C4JB 1E2VA 1W3SA 2XGTA 2PMZB 1I6HB 2IX0A 1GUNA 4MTNA 1SMYC 3HG9A 1U5KA 3CXCA 1IYJB 1BOSA 5C3EH 1N32Q 3HS0C 1IKLA 3MXNA 1TWHB 2RKSA 1J9OA 1WJJA 4YHHL 2UUAQ 4A3BB 1PTOB 1UEAB 2WIIB 3K80C 3L9AX 4XIGS 5FLXc 4K0KQ 2JEBI 2E75C 4QIWB 1X3EA 1AE2A 3BDOA 1ZEQX 2Q2IA 2F4VQ 4OX9Q 3FRPB 4C1NI 3C3LA 1L2FA 4JI0Q 2EVBA 3NSWA 4C3IH 1JCKB 1QCBD 3IFDA 3PSIA 1KLUD 3S9WA 1AH9A 1STAA 4LWCA 1SROA
chains in the Genus database with same CATH topology
4K5VA 3R93A 4RKLA 5EKLA 5IGBA 1BDOA 2F0JA 5A35A 2NBFA 4DFAA 1SYDA 2E76C 2IX3A 3DWAA 3ZYYX 1F2LA 3OMGA 5C4XB 3W2DA 4KK7A 4H0LC 1SNDA 2MPMA 1YNND 2NVQB 1SBBB 4HN7A 2NWGA 3D8GA 2F0VA 2JA5B 5FKAC 1O80A 4BY1B 1EY6A 1JWMD 1TWAB 2EJMA 1SXTA 2ENBA 1A3TA 2FMCA 3TP6A 5I2YA 2EZVA 2K7VA 5JPNC 4F87A 2L12A 4KN7C 1ZXTA 1Q90A 3D31A 5FO8B 1II3A 3CRLC 2R92B 4PMWA 4OHJA 1EFID 3LX0A 2B63B 5I9PA 1CQFA 5C5LA 3MEHA 1RTOA 2SDFA 1HA6A 4K8JA 3KLSX 1DM0B 1A2TA 4JBWA 4BBRB 3BDCA 3KF8A 5M5YB 1STHA 3PIP3 4FXDA 1EWCA 4FF1A 1BF4A 2RSNA 1JWUD 3PO3B 1SNCA 1YNJD 1CA5A 5ELEA 3TN2A 3K7AB 1LT5D 3TP5A 4A3MB 5T1IA 4K2LA 2PW5A 1PTOD 1SDFA 1DCZA 1I4XA 4TSSA 2LS01 4BS9A 3A54A 3SE0A 2F3VA 1SFOB 4DK1A 1PRTF 5IGFA 1LTAD 1S5CD 1CZGA 5K5PA 5KIXA 1F9PA 4ULLA 4K6LA 3JAML 1PRTC 4FF3A 3PMFA 1R4PB 3S16B 1Y1WB 3FPPA 1OXTA 1IYUA 1EU3A 1SNPA 2O2LD 2Q8TA 4DAPA 1VF5C 2OXPA 3GTMB 2G9HD 2HCIA 5FO9B 1SE3A 1ILPA 1AN8A 2VXWA 3OSOA 4QF4A 2PQEA 3S1MB 1FNUA 2K5WA 3VR6A 5C0XH 3D3RA 1S5ED 4HCEA 4PNYA 2HCCA 1XX8A 1HUMA 3MZ5A 4FP5D 2AQ3B 4DNRB 5JAVA 3S15B 2QCPX 1SYEA 3SVMA 1VDZA 1O78A 3S2DB 1TS4A 1KNAA 1V8QA 3TP7A 4RHRA 5FOBB 3I3CA 4OIKA 2XN9C 4HCSA 1I6VC 3NHHA 4IFDH 5EQ0A 1O7YA 1ZYRD 1I4HA 1ILQA 1STEA 1VMPA 3TSSA 4J1MA 3NBHA 4C56C 2QILA 1VCIA 1GOZA 2NVYB 3VYUA 5C6AA 3K5LA 1D5MC 2E2DC 2TMPA 3GV6A 3GD7A 2NYZD 5KNBA 1WTPA 2F0IA 4PMCA 4DXFA 5CR3A 3A8JE 2B2VC 1QWYA 4RHSA 4BBSB 2NTSA 1PFBA 1MBYA 2JP1A 2L4NA 4C3IG 2K32A 1RD9D 3HOZB 1CFMA 2MJ8A 2IT1A 1S4ZA 3T51B 4KTAA 4ZKCB 3E0JA 5ELCA 2ICIA 1DZ1A 1R4QB 4DAVA 2K5QA 3NQTA 2EOTA 1PXUA 1CA6A 3VR3A 3DUZA 3T53B 5KYLA 2KA7A 2F0KA 1SE2A 1SNOA 4H7BA 4E6IA 3NP8A 5LL6S 3NTHA 1JORA 3HOUB 3M4YA 3BYYB 1JB3A 3URYA 2XSCA 1U4LA 5FLXE 1JOKA 2F03A 1C8CA 1LTID 3NTIA 3MVVA 4DF7A 5JVH3 3Q0AA 1X32A 1DYQA 3WOEA 1B1ZA 2JA6B 3SK6A 3I90A 4DA2A 4CKCA 1C48A 1F2ZA 2F1MA 4PQXA 1CHPD 5FK9C 1Y8OB 3ONAB 1SAPA 4Z9CB 1Y8PB 5JOBA 2EDGA 3U9OA 3K57A 4KKSA 1D6EC 1IW7D 1A6XA 2L1BA 4R8NA 5IGGA 5KNDA 5DNFA 2E2HB 2DNEA 2X69A 2PZWA 4O42A 4LJZC 3C1FA 4C3JB 5JEAJ 1BQQT 3SEBA 3E6ZX 4XXEA 4FF4A 1I4GA 2KVMA 1DOKA 3OPOA 2K1BA 4UAIA 1WD0A 3OOCA 1DJRD 1SJED 1L0YB 2HDLA 3QIAA 5G3LD 2JYOA 1OO9B 5EBDA 2KEEA 1I4RA 2BE5C 3J7YW 1B2TA 5BN3A 3QOJA 1TY0A 1TR5A 1EU4A 4RFBA 2QDBA 3A7LA 4XQQA 1TU2B 1SYBA 1IHZA 3VR2A 1Z47A 4ZYSA 3VYRA 4HSVA 1AFPA 2IWHA 3T16A 4XQNA 1Z7TA 3QOLA 2M9VA 2JA8B 2D2CC 2BDNA 4DXGA 1JR0D 3Q24A 3J81L 5CC4A 2EY1A 5EPLA 3OMCA 1TS3A 1EZ8A 1K8MA 1VMCA 3DWQA 1I3QB 4UDUC 3HRZC 5I4DA 1RCVD 2KJXA 5C0XG 2F0PA 2OEOA 1TWCB 1LT3D 3NE5B 3AU7A 3KUPA 1OXVA 5M5XB 3IKJA 1HUNA 1EOTA 1A2UA 5TSSA 4X3UA 1XWEA 1RHPA 2WAQB 1QILA 1LABA 1LTSD 4HSPA 4RGOS 2CHBD 5D3IB 5HURA 1KNEA 4CBVA 4NW2A 4WORA 2BCOA 2A68D 4ZAIA 1ET6A 3PO2B 1SYGA 4DGZA 4IFDG 3R8BA 3RD4A 3Q23A 5KNCA 1PZJD 1BXTA 3QB3A 1I4PA 2Q8IB 2A5HA 2PO4A 4JK1C 4DK0A 1LLRD 1H9SA 3LWUA 2R7ZB 4GZYC 1DONA 1U4MA 3J80L 4BA2I 2VUMB 1V1PB 1U4PA 4PV1C 1IYVA 1CZWA 3ERQA 1BBXC 1LT4D 4V0BA 1KABA 1HTLD 3CRKC 1ML0D 2F4IA 5E3FA 3I4NB 1Q1EA 4A3EB 1EY8A 3PUZA 4A3IB 3MC0B 1K8OA 5J39A 1BCPD 1LO5D 1RDPD 4ZUJA 1PTOH 3TBIB 3QG1A 1V1PA 1H9KA 2FINB 1F2MA 3QWNA 3R2IA 3GTKB 1V43A 2XVSA 1G6ZA 1GUGA 1PMRA 2EPBA 3A56A 2D5DA 5M3FB 1QJOA 5CGKA 1PDQA 5EKKA 4MHEA 3K59A 3EQLC 2SNSA 2RDGA 2RQXA 3CU7A 2RBMA 2A6HD 2F0OA 1EEID 1KAAA 3S2HB 2CQAA 2Z1CA 4K6DA 4OO1I 4X3KA 4CKBA 4BWGB 2AUKA 1JQYD 3FKIB 4Q5VA 4IUUA 4HMJA 1E0BA 1GHJA 5FO7B 2N55A 1Z6HA 4I7ZC 1ENFA 1BCPF 2Z4IA 5JJZA 2B2TA 2JE6I 1D1IA 3GTGB 3VYTA 4QUCA 4XYOA 2Z8LA 4DN4M 1NR4A 1SYCA 3BG3A 1MGSA 1SJHD 2CW0D 4FVMA 1YNNC 5C5MA 1B44D 1FGBD 3HKZB 1DOLA 3TZDA 1EYCA 4I65A 2PNRC 1EZ6A 5CORA 2OF1A 2YU9B 4ZKBB 3DMUA 4FYDA 2HUGA 4A3GB 1TIID 1G291 5CBAE 4EQNA 3OHXC 1NSNS 2QKIC 1O7ZA 5JVG3 2J4XA 1E2WA 3U9SA 4XT3B 4RCOA 3BZDB 3J81E 3N52A 5E4WC 4M8AA 4C1NK 4KHVA 2V4DA 2MGSA 4RKBA 1C4QA 2GA4B 3L7ZC 2CVRA 3K5MA 2EYOA 2RDHA 4G7OC 2VB3X 3E5SA 4C3JG 2KCCA 4F8MA 3D4WA 3VR5A 1SYFA 2NB0A 3W3AA 2IX1A 3FDTA 4L63B 1JE4A 5D65A 4FXKC 3GTOB 2EE1A 4A93B 2EYJA 5EGTA 3BDLA 3NWSA 4F88A 1O7LA 2E2IB 4CGYB 1G2SA 4HEDA 3OW7A 3IFTA 2L5TA 5A2QE 1YNJC 1PTOF 2L0CA 3T4AC 3TZUA 2XNAC 4F7XA 1HFNA 2B2WC 1J8IA 3BVZA 2O4XA 4IUTA 4XT1B 4U673 4XYQA 1PTOC 2D62A 2IL8A 3GO5A 2ICEC 2EYLA 3R2TA 4KJNA 1L0XB 2K01A 1LT6D 1WTVA 4IN3A 3S17B 1A15A 4B9WA 1STNA 1WTOA 2K6AA 1FR3A 1G2TA 5BN5A 5DM73 4RWSC 3J80E 1QNUA 2NVTB 3BVMA 1Y1VB 3O13A 4K14A 4C3HG 1STBA 2F0WA 4H44C 2B2UA 3TDQA 4BY7B 2A74C 4MIUA 1LTRD 1XXGA 1BO0A 1IL8A 3WDNA 2AQ1B 3HGBA 4CJ2C 4EQPA 4HR7B 5I6WA 1BNZA 1LACA 5T1GA 3D6CA 2A69D 1QE6A 2I07B 3T56B 2NZ1D 1KDCA 3GQBA 3A55A 3GTJB 3S1RB 3D4RA 3OWEB 3H09A 1EY7A 1B9NA 2PCFB 1TKWB 1AP0A 2ZXRA 3OIQA 4M1UB 2JXMB 2RVLA 4G7HC 3SDZA 4B08A 1OXUA 5C3WA 1CK1A 1SNQA 2B39A 3MFGA 4ZQ3A 1STGA 2WB1B 4NKLA 4DNTB 3D6WA 1EY5A 1H9MA 3I72A 2A6ED 2F0MA 2K28A 4A3DB 3LWEA 2JEAI 1JOQA 4RCNA 1BUVT 2L9HA 1F9RA 3MXPA 2LKVA 3M4OB 3HOYB 1D5XC 1GUOA 5KYIA 1QG7A 2XWJB 2PW7A 3GTQB 1ZYRC 4TQUS 1EWHA 1LTBD 2F0HA 5HGTA 1NUCA 1PYWD 1NR2A 3MXUA 3IL8A 4HAEA 2WACA 5CV4A 4WFN3 1Q1BA 5CV7A 1FNVA 1S5FD 5EKIA 3V96A 2O5JC 1NCVA 1UNSA 1BR9A 3DHQA 5C4ZA 1KDBA 1EEFD 4QCLA 2H1EA 2C9OA 4L6TB 3NBIA 3G7LA 3OIPA 5EBCA 3JAME 3DM1A 4K2KA 2ZXPA 2WKDA 3I4MB 4MN3A 4X3SA 2F0EA 3HEJA 3V2TA 4FO2A 2QEJC 1EYDA 1EIHA 1RJTA 1S5DD 4RGMA 2IW3A 1OXXK 2EY5A 2ID0A 1HQMC 3SK4A 5E4XA 4XQJA 5M3MB 2EYFA 4DAYA 1PFNA 3FEWX 3S1NB 2N88A 2PZTA 2X6LA 1SMYD 3EA6A 2WP8J 3C46A 1STYA 4IQZA 3QJYA 1CTMA 3MA2B 2RA4A 1TS2A 3R3OA 2B8FA 5JEAH 2YYZA 1IW7C 1E2ZA 5KGUA 5DM63 4OL7A 1Y8NB 2F0FA 1QB5D 3HOWB 4RA8A 1B3AA 2LMCB 4KY7A 3CQZB 1JC7A 1LTGD 3VR4A 5G3LF 1WTQA 2SOBA 3MHBA 1PRTB 1B4OA 5NUCA 4KY6A 3D4DA 3T13A 5C3EB 2DNCA 3PUVA 2EYPA 3EFXD 1H9SB 1V1OA 1TQOA 5DEHA 1JWSD 2MUYA 2F3WA 5C3XA 2NUCA 2AUJD 2AWNA 5CV9A 3VA5A 2K33A 2DY8A 4J8QA 3K58A 1I4QA 5IT9L 2BA0A 4NDXA 4Y7NB 3S14B 1B50A 4WRDA 5EJWA 2H4OA 1TY2A 1FNWA 2Z4HA 1TS5A 3NXWA 2NN6I 1TWFB 4L8JA 3OWFA 4R8IA 5CMDA 1EYAA 2PYKA 1Q12A 3J7AV 2K5DA 4EVOA 4FXGC 1GUWA 3I91A 2C5CA 1EIGA 1T5EA 1HXYD 4NMZA 4C2MB 2D9UA 3VYSA 4QB4A 2AQ2B 5ISRA 1A3VA 3I4LA 1DOMA 1PZID 4RH6A 5D14A 3KBXA 4KHZA 5F2DA 3P7JA 3TMEA 2B2WA 3DEOA 5I2XA 1EY9A 1F9QA 1AZPA 3MWYW 1T5XD 5CV8A 3K6OA 4A3KB 4KKUA 4U68A 1KDAA 3EJIA 1D5ZC 3VA7A 4YIJA 2XIWA 3V05A 1SNMA 1PZKD 3C2PA 3L3OC 2A68C 3NUCA 3Q6SA 4K8IA 5J1ZA 4V190 4DU9A 1IKMA 5K36H 2B8GA 3P20A 4ZUIA 3AB9A 2FMMA 5CYUA 2AWOA 4K5WA 4Q0FA 2HQEA 1OXSC 1RF2D 1H9JA 1PRTD 5EPJA 5CV6A 3KBGA 2SEBD 4FNFA 1R9TB 5C0XI 1LTTD 3NK9A 5ELDA 5BN4A 2LY7A 4IUVA 3IAYA 2B2YC 5LL6X 2VNUD 4RAUC 2EY2A 3NWTA 2KHSA 1VF7A 3ITPA 5FLXL 4HTHA 2B2VA 3AMUA 2EYMA 1EY0A 1CM9A 1WD1A 3K5OA 1TWGB 2RDFA 2E74C 4S3SA 1EQTA 1SE4A 3H0GB 4KD3A 1BCPC 5I6YA 1MD2D 4RGNA 3GTPB 1GXDC 2BOSA 4KMUC 4IFDI 3BS1A 5COYA 2NN6H 3K5NA 3LNNA 4IUPA 4TRDA 1HCZA 3X3MA 1HQRD 3A8KE 1ICWA 3P1HA 1B53A 3CKIB 5C0XJ 4HMIA 3RLFA 2MP1A 2QF7A 4OGQC 1CT1D 1WCMB 4ID6A 1Q3LA 5E1FA 3P75A 3SXHA 4G57A 4N9TA 2HDMA 3TP8A 1HFGA 2A6HC 1TT2A 1UAPA 2KUMA 2FFKB 2K03A 1AEXA 2KQ3A 5J22A 5LHY1 1G91A 2XRSD 3RUZA 2KCNA 2EXZA 3M7GA 3KK7A 2WKCA 4IFDJ 1WTXA 3N6RA 3RMHA 1MI2A 3UI2A 2L11A 4QUFA 5JEAG 2JA7B 1EL0A 5I9OA 1KTKA 2M00A 1U4RA 5M5WB 5C44B 3X3NA 1FD7D 1F2YA 1EY4A 1FYCA 1ESRA 3PUXA 2CW0C 4OO1H 1S5BD 4H13C 4CHTB 4ABNA 3GP7A 2FHTA 3FPUB 4KKTA 1XTCD 3K0YA 5ELBA 4KI0A 4IUNA 5IT9E 3BVGA 3DWPA 3J7AF 4PMBA 3F2UA 1ESFA 1PFMA 3HOXB 3MAQA 2R93B 2MHVA 2I46A 3KLSA 5D3DA 3ND8A 2K04A 4ZLTF 1X3PA 1CHQD 1M8AA 5IGEA 3GV3A 2EJGC 2L55A 5IOCA 3I73A 4G7ZC 2J7ZA 2Q8RE 1B9MA 4ZK9B 3MXGA 3I8ZA 4A3FB 1HHVA 2G9DA 4B9XA 4WJWA 4ILWA 2EYHA 1HPCA 3RZDB 1ONLA 3ND9A 4CKEA 2R61A 1ENAA 1CQVA 2F0LA 4CJ0B 3HZXA 4ME5A 2VB2X 2PZUA 3RZOB 2BA1A 3QO2A 1Y69U 2DY7A 1F9SA 2NVXB 3BYTB 2B2TC 3FMCA 2BDOA 2F0UA 1U9RA 4KD4A 1WVLA 1H9RA 1Q8IA 4NP5A 2JSOA 3WOFA 5KEEA 4O1NA 1EQVA 3G6JB 1W6KA 4X3TA 5EPKA 1QNKA 4TKOB 5ELFA 3S1QB 4QMGA 2X6GA 4XTCS 2F0TA 4KY5A 3C1EA 3M85A 2J0TD 1I50B 4KV6A 2PPBC 4FF2A 2EY6A 1PLFA 5K36G 2BE5D 2SNMA 3PV0A 1SEBD 1XYIA 3HP3A 3MFYA 2EJFC 4OIJA 1G8ZD 1DXMA 2OT2A 2F0NA 2LFNA 2M2LA 5IIFA 2WV6D 4ZRZA 3H91A 4AYBB 2IPKD 1F77A 2A69C 5CBEE 1MSGA 3GTLB 2KOLA 2WINB 1ENCA 3SK5A 1AW7A 3H3VC 4KN4C 3SR1A 3I70A 1GHKA 4R9WA 2ZT9C 2DN8A 3PIO3 2TSSA 1JICA 2A6EC 4BA1I 2O5IC 3HOVB 1HA5A 2IJ0A 5DAUA 2NN6G 4CJ1B 3FVQA 1X3QA 1NAPA 4XDXA 3NPPA 1HTPA 2F0DA 1GUSA 3Q22A 1CI3M 1WTWA 1HRJA 3CHBD 3DXJC 5IGDA 3KLRA 3A7AB 2KEDA 4IZ8A 1W6JA 1DD2A 4A3JB 1GUTA 3EVQA 1UUPA 1JOOA 2A73B 1QOHA 2E2JB 2B2UC 4IUQA 3A8IE 1ET9A 1K83B 4ODGA 1RTNA 4IALA 2Y0SB 3EROA 3DEPA 1BCPB 2ZXOA 4J6HA 2F0SA 2B2YA 4EGVA 1TVXA 1D2BA 5C4HA 4P2CB 1D1KA 2RSOA 1LV9A 1AZQA 4N9PA 5IGCA 3M3YB 1RODA 2K05A 2FJ2A 2NTTA 1MSHA 4LAAA 4LK1C 3MTSA 4C3HB 1ZKOA 3SK8A 5CV5A 1WTRA 4KJOA 2F0GA 3SHLA 4RGTA 4G4KA 1M4VA 2XWBB 4OO1G 5JPMC 2KECA 3H6MA 4IURA 2R3ZA 1RKNA 3NQIA 3M7NA 3NTKA 1KLGD 4EQOA 3H94A 5AFWA 1SSOA 4K5XA 2R6GA 4LMQD 2F0QA 1A3UA 4C3IB 5A2QL 2XRQD 5KRUA 3PUWA 5M9OA 1GJXA 3PUYA 5IODA 5C4JB 1E2VA 2PMZB 1I6HB 2IX0A 1GUNA 1SMYC 3HG9A 1BOSA 3HS0C 1IKLA 3MXNA 1TWHB 2RKSA 1J9OA 4A3BB 1PTOB 1UEAB 2WIIB 3L9AX 4XIGS 2JEBI 2E75C 4QIWB 3BDOA 1ZEQX 3FRPB 4C1NI 3C3LA 2EVBA 3NSWA 1JCKB 1QCBD 3IFDA 1KLUD 3S9WA 1STAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2T A;  1CA5 A;  3TN2 A;  3R93 A;  3Q6S A;  2J7Z A;  2HDM A;  2Q8R E;  2RSO A;  1LV9 A;  4ZK9 B;  1AP0 A;  3SVM A;  3I8Z A;  1AZQ A;  1HFG A;  1U4L A;  1G2S A;  1IKM A;  4MN3 A;  4HED A;  4X3K A;  4X3S A;  5CBE E;  1MSG A;  1KNA A;  2RVL A;  5T1I A;  1C8C A;  1ROD A;  2KOL A;  2KUM A;  2FFK B;  1HHV A;  2FMM A;  2K05 A;  1SDF A;  2K03 A;  2FJ2 A;  1MSH A;  4IUU A;  3MTS A;  3D6W A;  1F2L A;  3I3C A;  4OIK A;  1X32 A;  1G91 A;  1WTR A;  1E0B A;  4HCS A;  1DON A;  1HFN A;  2B2W C;  1U4M A;  2K28 A;  1J8I A;  4HSV A;  1EIH A;  1RJT A;  2N55 A;  3LWE A;  5EPJ A;  5EQ0 A;  4CJ0 B;  2MPM A;  1U4P A;  4IUT A;  4XT1 B;  2DY8 A;  5JJZ A;  2B2T A;  3I90 A;  1WTX A;  4R9W A;  2KEC A;  1F9P A;  4IUR A;  1BBX C;  4QUC A;  2IL8 A;  2NWG A;  2BDN A;  1O7Y A;  1MI2 A;  2R3Z A;  3UI2 A;  2L9H A;  4DN4 M;  1F9R A;  2L11 A;  4IUV A;  1NR4 A;  1JIC A;  3QO2 A;  1ILQ A;  3ONA B;  4QUF A;  2B2Y C;  1O80 A;  1VMP A;  1EL0 A;  1MGS A;  2DY7 A;  5E4X A;  1SAP A;  1F9S A;  2K01 A;  1U4R A;  5EPL A;  1B50 A;  4RAU C;  5EJW A;  1WTV A;  1ML0 D;  5AFW A;  1SSO A;  2B2T C;  1VMC A;  1QG7 A;  4LMQ D;  1PFN A;  1DOL A;  2B2V A;  3TZD A;  1A15 A;  4CJ1 B;  3GV6 A;  1WVL A;  1ESR A;  2N88 A;  1CM9 A;  2X6L A;  5COR A;  4R8I A;  2L1B A;  1WTO A;  1WD1 A;  1X3Q A;  1NAP A;  4ZKB B;  5CMD A;  2HUG A;  2NYZ D;  1WTP A;  5DNF A;  4XDX A;  2L12 A;  5CBA E;  1G2T A;  2Q8T A;  1ZXT A;  1NR2 A;  2RA4 A;  1EQT A;  1GUW A;  2FHT A;  3FPU B;  3I91 A;  3IL8 A;  4RWS C;  1WTW A;  3KUP A;  1HRJ A;  2B2V C;  4HAE A;  1EIG A;  2X69 A;  4X3T A;  1O7Z A;  4O42 A;  5EPK A;  1QNK A;  1PFB A;  2FIN B;  2D9U A;  1HUN A;  1EOT A;  2JP1 A;  2L4N A;  4XT3 B;  2KED A;  2B2U A;  2HCI A;  2X6G A;  3N52 A;  5E4W C;  1G6Z A;  2MJ8 A;  4X3U A;  1DOM A;  1ILP A;  1S4Z A;  1RHP A;  2VXW A;  2EPB A;  2MGS A;  1IKL A;  1IL8 A;  1BO0 A;  5COY A;  4ZKC B;  4IUP A;  2CVR A;  1J9O A;  2KVM A;  1DOK A;  3F2U A;  5EKI A;  5D14 A;  1PFM A;  2K1B A;  1NCV A;  3KBX A;  4UAI A;  1WD0 A;  1DZ1 A;  3P7J A;  4RA8 A;  4CJ2 C;  1PDQ A;  1PLF A;  1B3A A;  1RTO A;  2B2W A;  2SDF A;  3DEO A;  1ICW A;  4MHE A;  1KNE A;  2HDL A;  2B2U C;  1F9Q A;  4IUQ A;  1AZP A;  1HA6 A;  3MWY W;  1B53 A;  1BNZ A;  2HCC A;  2EOT A;  4NW2 A;  1RTN A;  5T1G A;  1XYI A;  1CA6 A;  1XX8 A;  2JYO A;  3HP3 A;  1HUM A;  1WTQ A;  2K04 A;  1QE6 A;  4ZAI A;  4U68 A;  4ZLT F;  2MP1 A;  3DEP A;  4OIJ A;  1X3P A;  1B4O A;  2NZ1 D;  2H1E A;  2KEE A;  3FDT A;  2B2Y A;  1M8A A;  2M2L A;  2XIW A;  3IFD A;  1JE4 A;  1TVX A;  5D65 A;  3GV3 A;  1BF4 A;  2RSN A;  1Q3L A;  3G7L A;  2EE1 A;  3H91 A;  3DM1 A; 
#chains in the Genus database with same CATH topology
 4K5V A;  3R93 A;  4RKL A;  4Y7N H;  2OTL A;  5EKL A;  5IGB A;  1BDO A;  2F0J A;  2K14 A;  4POF A;  5A35 A;  2NBF A;  1Y1V G;  3S14 H;  4DFA A;  1SYD A;  2E76 C;  2K5N A;  5AJ3 Q;  2IX3 A;  3DWA A;  4LF5 Q;  3ZYY X;  4BY7 G;  1F2L A;  3OMG A;  5C4X B;  3W2D A;  4KK7 A;  4H0L C;  2PQA B;  1TWF H;  1SND A;  2MPM A;  1YNN D;  2NVQ B;  2VQE Q;  2RF4 A;  3HFZ B;  4A3B H;  1SBB B;  1RL2 A;  4HN7 A;  2NWG A;  3QR8 A;  3STB D;  3D8G A;  2F0V A;  2JA5 B;  5FKA C;  1O80 A;  4B3R Q;  4BY1 B;  1EY6 A;  1JMC A;  3A5Z B;  4C2M H;  1JWM D;  1TWA B;  2EJM A;  1SXT A;  4JVZ A;  2ENB A;  1A3T A;  2FMC A;  3TP6 A;  2QA4 A;  5I2Y A;  2EZV A;  4LF6 Q;  4L5T A;  4YCV A;  2K7V A;  1GD7 A;  5JPN C;  4DPG A;  3KLW A;  5FLM H;  2PQA A;  4F87 A;  2L12 A;  4KN7 C;  1HNZ L;  1ZXT A;  2CWP A;  1Q90 A;  1VQ6 A;  1C9O A;  3D31 A;  4A3K H;  2E5L Q;  5FO8 B;  1M1K C;  1II3 A;  2WB1 G;  3CRL C;  2R92 B;  1J5E Q;  1N33 Q;  3JAM i;  4DR2 L;  4PMW A;  4A3D G;  1B7Y B;  2GVA A;  4LF4 L;  4OHJ A;  1EFI D;  3LX0 A;  2B63 B;  2CH4 A;  1QVG A;  5I9P A;  1CQF A;  1NNX A;  2YTX A;  5C5L A;  3MEH A;  1RTO A;  2SDF A;  1HA6 A;  3CAM A;  4K8J A;  3KLS X;  1DM0 B;  1A2T A;  3HOY G;  4JBW A;  4BBR B;  3BDC A;  3KF8 A;  5M5Y B;  4DR6 Q;  1STH A;  3PIP 3;  4FXD A;  3T1H L;  1EWC A;  4GNX B;  3E9H A;  4FF1 A;  1YJN A;  1MHW C;  3HKZ E;  1BF4 A;  2RSN A;  1JWU D;  3PO3 B;  1VQ9 A;  5J3B A;  1SNC A;  1YNJ D;  1N36 L;  1CA5 A;  5ELE A;  3TN2 A;  1X55 A;  3K7A B;  4JOI C;  1R9T H;  3S24 A;  1LT5 D;  2UXC Q;  1D8L A;  3TP5 A;  5GRO A;  4A3M B;  3AQQ A;  1VQJ A;  5T1I A;  4K2L A;  4B3M L;  2R92 H;  2PW5 A;  2AKW B;  1PTO D;  1SDF A;  1DCZ A;  1I4X A;  4TSS A;  2LS0 1;  1SR3 A;  4BS9 A;  4KLK A;  3A54 A;  1VQ5 A;  3SE0 A;  2F3V A;  1JE5 A;  2B63 H;  1LUZ A;  1SFO B;  1I94 L;  4R4I A;  4DK1 A;  1PRT F;  5IGF A;  1LTA D;  1S5C D;  1CZG A;  1HNX L;  5K5P A;  5KIX A;  1F9P A;  1TWG H;  4GNX A;  4ULL A;  4Y52 H;  4K6L A;  1MJC A;  1X9N A;  4B3T Q;  1FVI A;  1XNQ Q;  3H0G H;  3L2P A;  3JAM L;  1PRT C;  5M5Y H;  1IBM L;  4YY3 Q;  3GTP H;  4FF3 A;  1PH8 A;  3PMF A;  1HR0 W;  3RLO A;  4JV5 Q;  1R4P B;  3S16 B;  1Y1W B;  2CWA A;  3FPP A;  1OXT A;  1IYU A;  1EU3 A;  1UEB A;  1SNP A;  2O2L D;  2IHE A;  2N8N A;  3CPW A;  2Q8T A;  3I55 A;  4DAP A;  1XPU A;  1YJ9 A;  4DV2 Q;  3HOV G;  3T1Y L;  1KL9 A;  1VF5 C;  3RN5 A;  2VQF Q;  2OXP A;  1VQ7 A;  3GTM B;  2Z6K A;  2G9H D;  2HCI A;  1S40 A;  1WCM H;  1U0L A;  5FO9 B;  1SE3 A;  2RCN A;  5L37 A;  1ILP A;  1AN8 A;  2ZM6 Q;  2VXW A;  3OSO A;  4QF4 A;  2PQE A;  3S1M B;  1FNU A;  4X66 L;  2K5W A;  3VR6 A;  4CDF C;  1XMO Q;  5C0X H;  3D3R A;  1S5E D;  4HCE A;  4PNY A;  2HCC A;  3E9I A;  2HD3 A;  1XX8 A;  1HUM A;  1VQD A;  3MZ5 A;  4FP5 D;  4X64 L;  3AEV A;  2AQ3 B;  2I5L X;  4JPB W;  4ME3 A;  4DNR B;  2VL6 A;  5JAV A;  4A3J G;  2QCP X;  3S15 B;  1L1O C;  2HHH L;  1H95 A;  2F52 A;  1SYE A;  4OON A;  2ZTC A;  1NBW A;  4DUZ L;  3I4O A;  2C35 B;  2CH4 W;  3SVM A;  1VDZ A;  4IPH A;  1O78 A;  3KF6 B;  3S2D B;  1TS4 A;  1KNA A;  2JA7 H;  1V8Q A;  5M5W H;  5C44 H;  3TRE A;  4O0A A;  3TP7 A;  4RHR A;  5FOB B;  3I3C A;  4OIK A;  1IBK Q;  2XN9 C;  4HCS A;  1I6V C;  3NHH A;  4IFD H;  5EQ0 A;  4JI2 L;  4RMF A;  4UP9 A;  3HKS A;  1O7Y A;  1ZYR D;  1I4H A;  1ILQ A;  3ICE A;  4LFB Q;  1G51 A;  1STE A;  1VMP A;  3GDE A;  4NPS A;  3TSS A;  1Q81 C;  2DGY A;  4J1M A;  3NBH A;  4C56 C;  4DV3 Q;  5LMU Q;  3SGI A;  1YZ6 A;  2QIL A;  3S15 H;  4QGU A;  1VCI A;  1GOZ A;  2NVY B;  3VYU A;  5C6A A;  5C3E G;  3K5L A;  1XNR Q;  4AQY Q;  1D5M C;  2E2D C;  2TMP A;  3GV6 A;  2IHF A;  3GD7 A;  4A76 A;  3KOJ A;  2NYZ D;  5KNB A;  3HOX H;  1WTP A;  3E0E A;  2F0I A;  1K8A C;  4PMC A;  4DXF A;  5CR3 A;  1VQB A;  4JI7 Q;  2R93 H;  3A8J E;  5LMN Q;  2B2V C;  4LFA Q;  1QWY A;  4RHS A;  4BBS B;  2NTS A;  1PFB A;  1BBW A;  5GAH C;  1MBY A;  2JP1 A;  2L4N A;  2NZO A;  4JYA Q;  4C3I G;  2K32 A;  1PYB A;  2WB1 E;  1RD9 D;  3HOZ B;  1HR0 L;  1CFM A;  5IY0 A;  2MJ8 A;  2IT1 A;  1S4Z A;  3T51 B;  4KTA A;  4ZKC B;  3E0J A;  4JI1 Q;  4YWM A;  5ELC A;  2ICI A;  1DZ1 A;  1R4Q B;  4DAV A;  4APV A;  4A3F H;  2K5Q A;  3NQT A;  1K0R A;  2EOT A;  1PXU A;  3A5U A;  1S3O A;  1VQC A;  3IRB A;  2VW9 A;  4OWW B;  1CA6 A;  3VR3 A;  2JA9 A;  3DUZ A;  3T53 B;  5KYL A;  3RZD H;  2KA7 A;  2F0K A;  1SE2 A;  1SNO A;  4H7B A;  4E6I A;  3NP8 A;  5LL6 S;  3NTH A;  1JOR A;  3HOU B;  3M4Y A;  3BYY B;  1JB3 A;  4A3B G;  4GOP B;  1MJE A;  1A62 A;  3RZO H;  1XPR A;  3URY A;  2BH2 A;  2XSC A;  1U4L A;  5FLX E;  3CCL A;  1JOK A;  1CSP A;  4BBS H;  4DK6 C;  2F03 A;  1C8C A;  4DR5 L;  1HNW Q;  3CC2 A;  1LTI D;  4TVA B;  4JI6 L;  4QQB X;  2CQO A;  3NTI A;  3MVV A;  4DF7 A;  5JVH 3;  3I7F A;  1K73 C;  3Q0A A;  1VQN A;  2FXQ A;  1PH2 A;  1X32 A;  2F3I A;  4DR7 L;  1DYQ A;  3WOE A;  2UUC Q;  1B1Z A;  2ZJQ A;  2JA6 B;  1LYL A;  1KQS A;  5FLM G;  3SK6 A;  2VY3 A;  4X62 L;  1XMQ Q;  3I90 A;  3OTO L;  4DA2 A;  4CKC A;  1C48 A;  1F2Z A;  2F1M A;  4PQX A;  1CHP D;  5FK9 C;  1Y8O B;  4GOP A;  4A3K G;  3ONA B;  1VQL A;  2OCE A;  1SAP A;  5BR8 Q;  4Z9C B;  1Y8P B;  3BJU A;  3NEM A;  5JOB A;  4DV6 L;  2LXJ A;  2EDG A;  3U9O A;  1YHB A;  3K57 A;  4KKS A;  1D6E C;  1IW7 D;  4YWL A;  1SRU A;  1A6X A;  1YIT A;  2L1B A;  3PGZ A;  4R8N A;  1I50 H;  5IGG A;  5KND A;  1X3F A;  5DNF A;  1PH4 A;  2E2H B;  4DR4 L;  2DNE A;  4JBM A;  2X69 A;  2PZW A;  4O42 A;  4WJ4 A;  3J81 i;  4LJZ C;  1BKB A;  1M90 C;  3C1F A;  4C3J B;  5JEA J;  4GN3 B;  4JBK A;  1BQQ T;  3SEB A;  3E6Z X;  3CCQ A;  2JA6 H;  4XXE A;  4N8X 1;  3CME A;  4FF4 A;  1I4G A;  2KVM A;  1DOK A;  3OPO A;  2K1B A;  4UAI A;  1WD0 A;  2H5X A;  3OOC A;  1DJR D;  1SJE D;  1IL2 A;  1L0Y B;  2HDL A;  2N3S A;  1N34 Q;  3QIA A;  3GTL H;  2R92 G;  5G3L D;  1WI5 A;  2JYO A;  1OO9 B;  5EBD A;  2K52 A;  4GKK Q;  2KEE A;  2UXB L;  2B63 G;  1I4R A;  2MFI A;  1YVC A;  2BE5 C;  4JI5 Q;  1HJP A;  4LFC Q;  3KYH C;  3J7Y W;  5HY6 A;  1B2T A;  5BN3 A;  1E22 A;  3QOJ A;  3H0G G;  1TY0 A;  1TR5 A;  1VQ4 A;  1EU4 A;  4RFB A;  3I56 A;  4DR1 L;  3CP0 A;  1X3G A;  2QDB A;  4C3J H;  3A7L A;  4HJ8 A;  4XQQ A;  1TU2 B;  1SYB A;  3ER0 A;  1IHZ A;  3VR2 A;  1Z47 A;  3NEL A;  4ZYS A;  3VYR A;  4HSV A;  4GLX A;  1AFP A;  2IWH A;  3T16 A;  4XQN A;  4KHP Q;  1Z7T A;  3QOL A;  3UE1 A;  2M9V A;  2JA8 B;  2D2C C;  3F1Z A;  2BDN A;  4DXG A;  1JR0 D;  3Q24 A;  1P8L A;  3J81 L;  4YCU A;  4DUY Q;  5CC4 A;  2EY1 A;  4IJL A;  5EPL A;  3OMC A;  4DK3 C;  1WCM G;  1TS3 A;  1EZ8 A;  1K8M A;  4DV4 Q;  1VMC A;  5GQO A;  3CPF A;  3DWQ A;  1I3Q B;  4A3J H;  4UDU C;  3HRZ C;  3J80 i;  5I4D A;  2E2J H;  1RCV D;  2KJX A;  5C0X G;  2F0P A;  4DKA C;  2OEO A;  1TWC B;  1EYG A;  1LT3 D;  3NE5 B;  3AU7 A;  4RG1 A;  3F2B A;  1K83 H;  3KUP A;  1XPO A;  4JOI A;  1J6Q A;  1N8R C;  1OXV A;  5M5X B;  3IKJ A;  5IYD H;  1HUN A;  1EOT A;  1Y1W G;  1A2U A;  1PFS A;  1YBY A;  5TSS A;  4NXM Q;  4B3S Q;  4X3U A;  1XWE A;  1RHP A;  4HID A;  2WAQ B;  2B3G A;  1QIL A;  1LAB A;  1D7Q A;  1LTS D;  5IYC H;  4HSP A;  1K3B C;  4RGO S;  3J7A 5;  2CHB D;  1UE1 A;  4DV1 Q;  5D3I B;  5HUR A;  1KNE A;  4CBV A;  2QW7 A;  3M3Y H;  4NW2 A;  4WOR A;  2BCO A;  5C44 G;  1UE7 A;  2A68 D;  2PMZ E;  4ZAI A;  1ET6 A;  3PO2 B;  1SYG A;  2HQL A;  4C3H H;  1EQQ A;  4A4I A;  4DGZ A;  4IFD G;  1A63 A;  2BH8 A;  4R4C A;  3R8B A;  1X65 A;  3RD4 A;  3Q23 A;  5KNC A;  1PZJ D;  1VQH A;  1BXT A;  3QB3 A;  1I4P A;  2Q8I B;  2A5H A;  2PO4 A;  4JK1 C;  4DK0 A;  1LLR D;  1H9S A;  3BZC A;  3TQY A;  5M5X H;  3LWU A;  1KRS A;  2R7Z B;  1WOC A;  4GZY C;  3A74 A;  1KD1 C;  1DON A;  1U4M A;  3J80 L;  2G5D A;  4BA2 I;  2VUM B;  1V1P B;  1L1O B;  1U4P A;  3HOX G;  4PV1 C;  1IYV A;  2OQ0 A;  1S72 A;  1CZW A;  1N32 L;  3ERQ A;  1BBX C;  2R93 G;  4R4T A;  5C4J H;  4JCV E;  1LT4 D;  2R7D A;  4V0B A;  1KAB A;  1HTL D;  3CRK C;  1I6H H;  4K0K L;  1VQ8 A;  1ML0 D;  4OXP A;  2F4I A;  1PH9 A;  5E3F A;  1L0W A;  3I4N B;  4OX9 L;  1B3Q A;  1Q1E A;  4A3E B;  1C7Y A;  1EY8 A;  3PUZ A;  4A3I B;  3MC0 B;  4JI0 L;  4JI8 Q;  1K8O A;  5IP9 H;  2VZA A;  1TWH H;  5J39 A;  1BCP D;  2QDL A;  2UXD L;  1LO5 D;  1RDP D;  4ZUJ A;  4A3F G;  4LUV A;  1PTO H;  3TBI B;  3QG1 A;  1V1P A;  1L1O A;  1H9K A;  2LXK A;  4GN5 A;  5GAD C;  1I5F A;  2FIN B;  1F2M A;  1SMX A;  3QWN A;  3R2I A;  3GTK B;  1V43 A;  2XVS A;  3RN2 A;  1G6Z A;  1GUG A;  5AJ3 L;  4QY7 A;  1PMR A;  1HNZ Q;  2EPB A;  3A56 A;  2D5D A;  2A8V A;  3JAM c;  5M3F B;  1QJO A;  5CGK A;  4DV0 Q;  1NMG A;  1PH1 A;  1PDQ A;  5EKK A;  4MHE A;  3K59 A;  4PZ7 A;  4BBS G;  3KF8 B;  2VQE L;  3EQL C;  1NMF A;  2SNS A;  4LF4 Q;  1X6O A;  2RDG A;  2RQX A;  3CU7 A;  2RBM A;  4B3R L;  5C4X H;  2A6H D;  2F0O A;  1EEI D;  1KAA A;  1V9P A;  3S2H B;  2CQA A;  1Q82 C;  2NVQ H;  2Z1C A;  4K6D A;  4OO1 I;  3I2Z A;  4P74 A;  3BU2 A;  4X3K A;  2Q2U A;  2JA5 H;  3CCV A;  2L15 A;  4CKB A;  4BWG B;  3T1H Q;  4BY1 H;  2AUK A;  1JQY D;  1ASZ A;  5GAE C;  1TWA H;  3G6E A;  3FKI B;  4Q5V A;  4IUU A;  4HMJ A;  1N36 Q;  2E5L L;  1E0B A;  1GHJ A;  5FO7 B;  1J5E L;  2N55 A;  1Z6H A;  4I7Z C;  4UY8 C;  1ENF A;  1BCP F;  2Z4I A;  5JJZ A;  2B2T A;  2JE6 I;  1D1I A;  4I7A A;  3GTG B;  3VYT A;  2A19 A;  4QUC A;  4XYO A;  2Z8L A;  1TXY A;  4DN4 M;  1Z9F A;  1NR4 A;  1PA6 A;  1SYC A;  3BG3 A;  1MGS A;  1SJH D;  2CW0 D;  4FVM A;  1YNN C;  5C5M A;  2YTV A;  1B44 D;  1I94 Q;  1A0I A;  1FGB D;  2JA6 G;  3HKZ B;  3L0O A;  1DOL A;  3TZD A;  1EYC A;  4I65 A;  2PNR C;  4DR6 L;  4AYB G;  1EZ6 A;  5COR A;  2OF1 A;  2YU9 B;  4ZKB B;  3DMU A;  4FYD A;  2HUG A;  4A3G B;  1TII D;  1G29 1;  5CBA E;  4EQN A;  3OHX C;  1IBM Q;  1NSN S;  2QKI C;  1O7Z A;  3M9B A;  4BBR H;  5JVG 3;  2HIV A;  2J4X A;  1E2W A;  1Y14 B;  3U9S A;  4XT3 B;  3CC7 A;  4RCO A;  3BZD B;  3J81 E;  3N52 A;  5E4W C;  4M8A A;  3F2C A;  4C1N K;  4KHV A;  2V4D A;  2MGS A;  4RKB A;  3PO3 H;  4J15 A;  1C4Q A;  2GA4 B;  3L7Z C;  2CVR A;  5FJ8 H;  3K7A H;  3K5M A;  1PHJ A;  3G48 A;  2EYO A;  2YV5 A;  2RDH A;  4A3M H;  4G7O C;  2VB3 X;  3E5S A;  4NXN Q;  4BXX H;  4C3J G;  2KCC A;  4F8M A;  3D4W A;  3VR5 A;  1SYF A;  4LF7 L;  4MZ9 A;  5LMN W;  2NB0 A;  3W3A A;  1XNQ L;  2OTJ A;  2IX1 A;  3FDT A;  4X66 Q;  4L63 B;  1JE4 A;  3FHW A;  5D65 A;  1SFO H;  3CD6 A;  4FXK C;  4GLA C;  3GTO B;  2EE1 A;  4A93 B;  1UE6 A;  2RHS B;  2EYJ A;  5EGT A;  2PI2 E;  3BDL A;  3NWS A;  4F88 A;  1O7L A;  2E2I B;  4CGY B;  1G2S A;  4HED A;  3OW7 A;  1W2B A;  3CC4 A;  3IFT A;  2L5T A;  5A2Q E;  4LUZ A;  4IJH A;  1YNJ C;  2HHH Q;  1PTO F;  1E3P A;  4LF9 L;  2L0C A;  3T4A C;  1VQO A;  3TZU A;  2XNA C;  4F7X A;  3S16 H;  1Y1W H;  2B2W C;  1HFN A;  1EIF A;  1J8I A;  3BVZ A;  4DNI A;  2O4X A;  3CMA A;  4IUT A;  4XT1 B;  4U67 3;  1SLJ A;  2AHO B;  4XYQ A;  1PTO C;  1YHA A;  4GKJ Q;  2D62 A;  2ZM6 L;  2IL8 A;  3GO5 A;  4JI3 L;  3NBH B;  2ICE C;  2EYL A;  2Y0S G;  3R2T A;  4KJN A;  1A8V A;  1XMO L;  1L0X B;  3W1G A;  2K01 A;  1LT6 D;  5IYD G;  2UU9 Q;  1WTV A;  4JI2 Q;  3GTM H;  4IN3 A;  3S17 B;  4AH6 A;  1A15 A;  2IY5 B;  4B9W A;  5IYC G;  1STN A;  1WTO A;  3S1M H;  2K6A A;  4FDB A;  1FR3 A;  2N78 A;  4H02 A;  1G2T A;  5BN5 A;  1IBL Q;  5DM7 3;  3CCM A;  4RWS C;  3J80 E;  1QNU A;  2NVT B;  3BVM A;  1Y1V B;  3O13 A;  2JQO A;  2QEX A;  4K14 A;  3PIO A;  4C3H G;  4R4Q A;  1STB A;  2F0W A;  4H44 C;  1PV4 A;  2B2U A;  3TDQ A;  4BY7 B;  2A74 C;  4MIU A;  1LTR D;  1XXG A;  1WFQ A;  1BO0 A;  1IL8 A;  3WDN A;  3PCO B;  1IBK L;  2AQ1 B;  3OYY A;  3HGB A;  4CJ2 C;  4EQP A;  1OTC A;  4HR7 B;  5I6W A;  3S2D H;  1BNZ A;  1LAC A;  5T1G A;  1BVS A;  3D6C A;  2A69 D;  1QE6 A;  2I07 B;  1GKH A;  3T56 B;  4LFB L;  1JT8 A;  5IP7 H;  2NZ1 D;  2K50 A;  1KDC A;  2WAQ G;  2I0Q A;  3GQB A;  3A55 A;  4DV3 L;  3GTJ B;  5LMU L;  3S1R B;  3D4R A;  3OWE B;  1FJG Q;  3H09 A;  1EY7 A;  1B9N A;  5IYB H;  2P5Z X;  4AQY L;  1YNX A;  2PCF B;  1TKW B;  1AP0 A;  2ZXR A;  3OIQ A;  2NVT H;  4M1U B;  3JC6 6;  3LGJ A;  2JXM B;  2RVL A;  4G7H C;  1PH7 A;  1GM5 A;  3SDZ A;  4B08 A;  1OXU A;  4JI7 L;  5C3W A;  1CK1 A;  1SNQ A;  2B39 A;  3MFG A;  4ZQ3 A;  1QVF A;  1STG A;  2WB1 B;  5LMN L;  1BBU A;  4NKL A;  3D6W A;  4DNT B;  1P16 A;  2NVY H;  1EY5 A;  1H9M A;  3E3X A;  3I72 A;  3UDI A;  2A6E D;  2F0M A;  1E1O A;  3ULJ A;  2K28 A;  4A3D B;  5IP9 G;  4JYA L;  3LWE A;  1AE3 A;  3H15 A;  2JEA I;  3CCJ A;  1JOQ A;  4RCN A;  1BUV T;  2L9H A;  4JI1 L;  1F9R A;  3MXP A;  3MEF A;  4DV5 Q;  2LKV A;  3M4O B;  3HOY B;  1D5X C;  1GUO A;  5KYI A;  3HOZ H;  1QG7 A;  2XWJ B;  3GTJ H;  2PW7 A;  3GTQ B;  1ZYR C;  4TQU S;  1EWH A;  1LTB D;  2F0H A;  5HGT A;  1NUC A;  4P73 A;  4AYB E;  1PYW D;  1IZ6 A;  1NR2 A;  3MXU A;  3IL8 A;  4HAE A;  2WAC A;  4A75 A;  4LW1 A;  2WFW A;  5CV4 A;  5C4X G;  4WFN 3;  1Q1B A;  5CV7 A;  4A3E G;  1FNV A;  3J81 c;  1S5F D;  3HOU H;  4OWX B;  3UDX A;  4DR4 Q;  5EKI A;  3V96 A;  2O5J C;  1NCV A;  1UNS A;  1BR9 A;  3U50 C;  3G71 A;  3DHQ A;  4EX5 A;  5C4Z A;  1KDB A;  2JA5 G;  1XMQ L;  4BY1 G;  1EEF D;  5H1S E;  4HIK A;  2ASB A;  4QCL A;  3U4V A;  1KRT A;  2UUB Q;  5BR8 L;  2H1E A;  4DR3 L;  2C9O A;  3RR5 A;  4L6T B;  3NBI A;  1XJV A;  3G7L A;  3OIP A;  5EBC A;  3JAM E;  3DM1 A;  4K2K A;  1K28 A;  1NJI C;  2ZXP A;  2WKD A;  3I4M B;  1LTL A;  4MN3 A;  4X3S A;  4DV7 Q;  2F0E A;  3D0F A;  3OW2 A;  4HIM A;  3HEJ A;  3AFQ A;  1KIX A;  1YIJ A;  3K8A A;  5IWA L;  3V2T A;  4FO2 A;  2QEJ C;  1EYD A;  1EIH A;  1RJT A;  1S5D D;  4HJ5 A;  4RGM A;  3CW2 C;  2IW3 A;  1E7Z A;  2E2H H;  1OXX K;  1DGS A;  2EY5 A;  4BBR G;  2ID0 A;  3F8T A;  1HQM C;  1VQF A;  3SK4 A;  5E4X A;  4XQJ A;  4MNO A;  4OWT B;  2Y0S E;  5M3M B;  2EYF A;  1N34 L;  2K5H A;  1VQG A;  4DAY A;  1PFN A;  1ICF B;  1NE3 A;  1X56 A;  3FEW X;  3PO3 G;  3S1N B;  2N88 A;  2PZT A;  2X6L A;  5FJ8 G;  4P72 A;  1SMY D;  3EA6 A;  2WP8 J;  3AYH B;  4L5S A;  3C46 A;  1NTG A;  3I4M H;  2KHI A;  1STY A;  4IQZ A;  4JI5 L;  3QJY A;  1CTM A;  3MA2 B;  2RA4 A;  4A3M G;  4BXX G;  1TS2 A;  3J80 c;  3R3O A;  2B8F A;  5JEA H;  2YYZ A;  1JB7 A;  1IW7 C;  1E2Z A;  5KGU A;  4JI4 Q;  4A3L G;  5DM6 3;  3ERS X;  4OL7 A;  1T9H A;  1Y8N B;  2F0F A;  1QB5 D;  2KCT A;  3HOW B;  4RA8 A;  2CCZ A;  1B3A A;  2LMC B;  4KY7 A;  3CQZ B;  1JC7 A;  1LTG D;  2EIF A;  3VR4 A;  5G3L F;  1K3R A;  1WTQ A;  1E24 A;  5M3M H;  2SOB A;  3MHB A;  1PRT B;  1KHI A;  4DUY L;  1B4O A;  5NUC A;  2ATW A;  4KY6 A;  4LF8 Q;  3VDY A;  3D4D A;  3S1N H;  3T13 A;  5C3E B;  2WAQ E;  2DNC A;  3PUV A;  4DV4 L;  2EYP A;  3EFX D;  1H9S B;  2JA8 H;  1V1O A;  1TQO A;  5DEH A;  1MIU A;  4YCW A;  4HIO A;  1JWS D;  5DLQ E;  2MUY A;  2CKZ B;  2F3W A;  5C3X A;  3EN2 A;  1YHQ A;  1WYD A;  2K75 A;  2NUC A;  2AUJ D;  2AWN A;  4YHH Q;  1X54 A;  3TS2 A;  4X65 L;  5CV9 A;  1I3Q H;  3VA5 A;  3PIP A;  2K33 A;  2DY8 A;  2Q2H A;  4J8Q A;  3K58 A;  4B3S L;  4NXM L;  3HOW H;  1I4Q A;  3J81 j;  2ZJP A;  5IT9 L;  2BA0 A;  4NDX A;  1TWC H;  2B29 A;  4Y7N B;  4HJ9 A;  3S14 B;  4DV1 L;  4QIW E;  1B50 A;  4OEM B;  4WRD A;  5EJW A;  2H4O A;  1TY2 A;  1FNW A;  2Z4H A;  1TS5 A;  4P75 A;  5JJK A;  3K0X A;  3NXW A;  2NN6 I;  4GOP C;  1TWF B;  4L8J A;  1LM0 A;  4JW0 A;  3OWF A;  4PZ8 A;  4R8I A;  5CMD A;  1EYA A;  2PYK A;  3WWV A;  1Q12 A;  3J7A V;  2K5D A;  4EVO A;  4FXG C;  1K8G A;  1GUW A;  3I91 A;  2C5C A;  1EIG A;  1T5E A;  1HXY D;  2UUA L;  4NMZ A;  4C2M B;  3PO2 H;  2D9U A;  2OQK A;  5IP7 G;  2QGQ A;  3VYS A;  2UXD Q;  4QB4 A;  4PG3 A;  2AQ2 B;  5ISR A;  1A3V A;  2F4V L;  3I4L A;  1DOM A;  1CKM A;  1PZI D;  5IYB G;  4RH6 A;  5D14 A;  3KBX A;  1MKH A;  4KHZ A;  5F2D A;  4N8F A;  3P7J A;  2Z0S A;  3TME A;  2B2W A;  3DEO A;  2EXD A;  5I2X A;  1EY9 A;  1F9Q A;  1AZP A;  3MWY W;  1T5X D;  5CV8 A;  3K6O A;  4A3K B;  4KKU A;  4U68 A;  2R7Z H;  1KDA A;  3EJI A;  1D5Z C;  4LNQ A;  3VA7 A;  4YIJ A;  2XIW A;  3V05 A;  3TRZ A;  1SNM A;  1HZ9 A;  1PZK D;  2VUM H;  3C2P A;  4LF5 L;  3L3O C;  1UE5 A;  2A68 C;  3NUC A;  3Q6S A;  3CCU A;  4K8I A;  5J1Z A;  4V19 0;  4JI8 L;  4DU9 A;  1NY4 A;  1IKM A;  4GN4 B;  1HZA A;  5K36 H;  2B8G A;  4DR2 Q;  3P20 A;  4ZUI A;  3AB9 A;  2FMM A;  5CYU A;  2AWO A;  2VS1 A;  4K5W A;  4Q0F A;  3HOZ G;  2HQE A;  1OXS C;  3I4N H;  1RF2 D;  4A3E H;  4A3I H;  1H9J A;  1PRT D;  2ES2 A;  5EPJ A;  5CV6 A;  3H3V I;  3KBG A;  2SEB D;  4FNF A;  4LF6 L;  1R9T B;  5C0X I;  3TS0 A;  1LTT D;  3NK9 A;  5ELD A;  5BN4 A;  2LY7 A;  4IUV A;  3IAY A;  2DJF C;  2KCM A;  4DV0 L;  2B2Y C;  5LL6 X;  2VNU D;  4RAU C;  2EY2 A;  3W1B A;  3NWT A;  2KHS A;  1VF7 A;  2I5M X;  3ITP A;  3GTK H;  5FLX L;  4HTH A;  3U58 A;  2B2V A;  2DUD A;  3HOU G;  3AMU A;  1N33 L;  2EYM A;  4OEL B;  1EY0 A;  1CM9 A;  1WD1 A;  5M3F H;  3UDG A;  3K5O A;  3K81 C;  1TWG B;  1XTD A;  4B3M Q;  2RDF A;  2E74 C;  4S3S A;  1EQT A;  3PQI A;  5EAY A;  2ZTE A;  1SE4 A;  3H0G B;  1IXR A;  2AMC B;  4KD3 A;  1BCP C;  5I6Y A;  1MD2 D;  4RGN A;  3GTP B;  1GXD C;  2I5H A;  2K5V A;  2BOS A;  1HNX Q;  3S2H H;  4KMU C;  4IFD I;  1PH6 A;  3BS1 A;  5COY A;  2NN6 H;  3STB C;  3K5N A;  3LNN A;  2MNA A;  4IUP A;  3FP9 A;  1YJW A;  1CKN B;  4TRD A;  1QUQ B;  1HCZ A;  3X3M A;  1HQR D;  3A8K E;  1ICW A;  3P1H A;  1B53 A;  3CKI B;  5C0X J;  3CCS A;  4HMI A;  3RLF A;  2MP1 A;  2QF7 A;  3FKI H;  4OGQ C;  2UXC L;  1CT1 D;  3PF4 A;  2K4K A;  1WCM B;  1V1Q A;  2LSS A;  4ID6 A;  1Q3L A;  5E1F A;  3P75 A;  3SXH A;  4G57 A;  4N9T A;  3GTG H;  2HDM A;  1JJC B;  3TP8 A;  3T1Y Q;  5JJL A;  1HFG A;  4LF7 Q;  2A6H C;  1CKN A;  1TT2 A;  1QUQ A;  1UAP A;  2KUM A;  2FFK B;  2K03 A;  1AEX A;  2KQ3 A;  5J22 A;  3UDF A;  5LHY 1;  1Q86 C;  4B3T L;  1G91 A;  2XRS D;  3TEH B;  3RUZ A;  4A3L H;  1FL0 A;  3KDF B;  4YY3 L;  2KCN A;  2YU9 H;  2EXZ A;  3I4M G;  3M7G A;  2ZTD A;  1Q7Y C;  5ELN A;  3KK7 A;  2WKC A;  4IFD J;  3F2D A;  1WTX A;  4A3G H;  4JV5 L;  3N6R A;  3RMH A;  1MI2 A;  3UI2 A;  4X64 Q;  2L11 A;  4LF9 Q;  4QUF A;  5JEA G;  2JA7 B;  1EL0 A;  5I9O A;  3KJO A;  1KTK A;  2HT1 A;  4IPG A;  2M00 A;  1U4R A;  5M5W B;  5C44 B;  1WTH A;  3X3N A;  5JJI A;  4AIM A;  2E8G A;  2PNH A;  1FD7 D;  4NXN L;  1F2Y A;  1EY4 A;  4DV2 L;  1FYC A;  4NB3 A;  4DUZ Q;  2VQF L;  1ESR A;  2MO0 A;  3PUX A;  1EOV A;  4JI3 Q;  3H3V H;  1N9W A;  2CW0 C;  4IO9 A;  4PZ6 A;  1O7I A;  2GVB A;  4OO1 H;  1S5B D;  2EQS A;  4H13 C;  4CHT B;  3KDF A;  4ABN A;  3GP7 A;  3UE0 A;  2FHT A;  3FPU B;  2OWO A;  4KKT A;  2YTY A;  1XTC D;  3K0Y A;  5M3M G;  5ELB A;  4KI0 A;  1C0A A;  1CUK A;  1HZC A;  4IUN A;  5IT9 E;  3BVG A;  2GN5 A;  4CDC C;  3DWP A;  3J7A F;  4PMB A;  3GTO H;  4A93 H;  3F2U A;  2JA8 G;  1ESF A;  1PFM A;  3HOX B;  3U4Z A;  3MAQ A;  3B6Y A;  2E2I H;  2PI2 A;  2R93 B;  2MHV A;  4R1J A;  2I46 A;  4GKJ L;  3KLS A;  5D3D A;  3ND8 A;  2K04 A;  2ALY B;  2JJQ A;  4ZLT F;  1X3P A;  3J7Z C;  1CHQ D;  5ELO A;  1M8A A;  2UU9 L;  5IGE A;  1VQP A;  4YWK A;  3GV3 A;  4A3C G;  2EJG C;  2R7F A;  2L55 A;  3HOW G;  3RNU A;  5IOC A;  3I73 A;  1VQE A;  4G7Z C;  2J7Z A;  5GAG C;  2KBN A;  2Q8R E;  1B9M A;  4ZK9 B;  3MXG A;  3I8Z A;  4A3F B;  4POG A;  1HHV A;  2G9D A;  4B9X A;  1HR0 Q;  1B70 B;  4WJW A;  1IBL L;  4ILW A;  2EYH A;  3KF6 A;  4IPC A;  1HPC A;  3RZD B;  1ONL A;  3PF5 A;  3ND9 A;  4CKE A;  1SE8 A;  1ENA A;  2R61 A;  1CQV A;  2F0L A;  3S17 H;  3M4Q A;  2MO1 A;  4CJ0 B;  3HZX A;  4ME5 A;  2VB2 X;  2PZU A;  4L5R C;  3KJP A;  3BZK A;  2KHJ A;  3RZO B;  1XNR L;  2BA1 A;  1Q46 A;  3QO2 A;  1KC8 C;  1Y69 U;  1Y1V H;  2DY7 A;  1K0S A;  3PO2 G;  1F9S A;  2NVX B;  3BYT B;  1HH2 P;  2B2T C;  3FMC A;  2BDO A;  2F0U A;  4LFA L;  4BY7 H;  1U9R A;  4KD4 A;  1VS0 A;  3DLL A;  1WVL A;  1H9R A;  2ZJR A;  1Q8I A;  1E1T A;  2N49 A;  3EIV A;  4DR5 Q;  1GVP A;  4NP5 A;  4MTK A;  1PYS B;  2JSO A;  4JI6 Q;  1FJG L;  4UPA A;  3WOF A;  5KEE A;  4O1N A;  1PH5 A;  1EQV A;  2JK8 A;  3G6J B;  4P71 A;  1W6K A;  4R4O A;  4X3T A;  4DR7 Q;  5EPK A;  2R7Z G;  1QNK A;  4LUO A;  4TKO B;  5ELF A;  3S1Q B;  4QJF A;  4QMG A;  4X62 Q;  2X6G A;  4GNX C;  2VUM G;  4XTC S;  1GO3 E;  2F0T A;  4KY5 A;  3OTO Q;  3C1E A;  3Q8D A;  2RCF A;  3M85 A;  3S1R H;  2J0T D;  1I50 B;  4JC0 A;  4KV6 A;  2PPB C;  4FF2 A;  2EY6 A;  2XTI A;  1PLF A;  5K36 G;  2BE5 D;  2SNM A;  3PV0 A;  4DV6 Q;  1SEB D;  5E7N A;  1XYI A;  3HP3 A;  2NVX H;  3MFY A;  3ULP A;  2EJF C;  1EQR A;  1G8Z D;  1DXM A;  4OIJ A;  3I4N G;  2OT2 A;  2F0N A;  3G4S A;  2LFN A;  2M2L A;  2D0O A;  5IIF A;  4DV5 L;  4A3I G;  1HNW L;  4A3D H;  2D0P A;  2WV6 D;  2JN4 A;  4ZRZ A;  3H91 A;  4AYB B;  2IPK D;  1F77 A;  2DJG C;  2A69 C;  2UUC L;  1QVC A;  4DAM A;  1HZB A;  5CBE E;  2Z6K C;  1MSG A;  3GTL B;  4DR3 Q;  4X6A H;  2KOL A;  1QZG A;  1ASY A;  3M4O H;  4IOC A;  3HOY H;  3S1Q H;  2WIN B;  1ENC A;  3SK5 A;  1EUJ A;  3GTQ H;  1AW7 A;  3ZJY C;  1RIP A;  4KN4 C;  3SR1 A;  2Q2T A;  5M3F G;  1K9M C;  3H3V C;  2MQH A;  3I70 A;  1GHK A;  3NEN A;  4R9W A;  4CDD C;  3A0J A;  3M4P A;  2ZT9 C;  5HGQ A;  2DN8 A;  2HIX A;  3PIO 3;  2TSS A;  4O2D A;  1JIC A;  2A6E C;  5IWA Q;  4BA1 I;  4DAY B;  2O5I C;  3K7U C;  2RHQ B;  2UXB Q;  1G6P A;  4HJ7 A;  3HOV B;  1HA5 A;  1PH3 A;  4GLV B;  3CCR A;  2IJ0 A;  5DAU A;  1VQK A;  2NN6 G;  4CJ1 B;  2CFM A;  4L5Q A;  4CDE C;  2UUB L;  3FVQ A;  1X3Q A;  1NAP A;  3DM3 A;  4XDX A;  3NPP A;  1HTP A;  4DR1 Q;  4EQ5 A;  2F0D A;  1GUS A;  1UWV A;  3Q22 A;  1CI3 M;  1WTW A;  1HRJ A;  1YI2 A;  2V1C C;  1Q8K A;  3CHB D;  3DXJ C;  1YEZ A;  3FKI G;  5IGD A;  4DV7 L;  3KLR A;  3A7A B;  2KED A;  4IZ8 A;  4UP7 A;  5IT9 c;  1W6J A;  1DD2 A;  4A3J B;  4GKK L;  1GUT A;  3EVQ A;  1B8A A;  1UUP A;  1JOO A;  2A73 B;  1QOH A;  2A1A A;  1VQI A;  2E2J B;  1EWI A;  3W5O A;  1CKO A;  2B2U C;  4LFC L;  4IUQ A;  3A8I E;  1ET9 A;  1K83 B;  4ODG A;  1RTN A;  3EBE A;  2Y0S B;  4IAL A;  1SN8 A;  3ERO A;  3RLN A;  3HOV H;  1CSQ A;  1FGU A;  1JJG A;  3DEP A;  1BCP B;  3HKZ G;  2ZXO A;  4J6H A;  2F0S A;  3ULL A;  2B2Y A;  4EGV A;  1TVX A;  3CCE A;  4IPD A;  4JG2 A;  1D2B A;  1VQM A;  5C4H A;  4A3G G;  4JBJ A;  4P2C B;  1D1K A;  4QL5 A;  2RSO A;  1LV9 A;  1AZQ A;  4ALP A;  4N9P A;  5IGC A;  4KHP L;  3M3Y B;  1ROD A;  4HJA A;  1VQA A;  2K05 A;  1QZH A;  2FJ2 A;  2NTT A;  1MSH A;  4LAA A;  4LK1 C;  3MTS A;  4C3H B;  4WJ3 M;  1ZKO A;  3SK8 A;  5CV5 A;  2KEN A;  1WTR A;  4UP8 A;  4KJO A;  2F0G A;  3SHL A;  4RGT A;  2Z6B A;  4G4K A;  1M4V A;  4JI4 L;  2XWB B;  3AFP A;  4UHV A;  4OO1 G;  5JPM C;  3CF5 A;  2KEC A;  1KXL A;  1EFW A;  3H6M A;  4IUR A;  2R3Z A;  1RKN A;  3NQI A;  4GS3 A;  1JJ2 A;  3M7N A;  3NTK A;  3KFU A;  1KLG D;  4ZCK A;  3H94 A;  4EQO A;  4X65 Q;  3MXN B;  5AFW A;  1SSO A;  4K5X A;  2R6G A;  4LMQ D;  2F0Q A;  1EIY B;  1A3U A;  4C3I B;  4A93 G;  4IOA A;  5A2Q L;  2XRQ D;  5KRU A;  2Z9H A;  4LF8 L;  3PUW A;  5M9O A;  4A3C H;  1GJX A;  3PUY A;  1KAW A;  5IOD A;  5IE8 A;  1PVO A;  2JA7 G;  3CQZ H;  2NZH A;  5C4J B;  1E2V A;  1W3S A;  2XGT A;  2PMZ B;  1I6H B;  2IX0 A;  1GUN A;  4MTN A;  1SMY C;  3HG9 A;  1U5K A;  3CXC A;  1IYJ B;  1BOS A;  5C3E H;  1N32 Q;  3HS0 C;  1IKL A;  3MXN A;  1TWH B;  2RKS A;  1J9O A;  1WJJ A;  4YHH L;  2UUA Q;  4A3B B;  1PTO B;  1UEA B;  2WII B;  3K80 C;  3L9A X;  4XIG S;  5FLX c;  4K0K Q;  2JEB I;  2E75 C;  4QIW B;  1X3E A;  1AE2 A;  3BDO A;  1ZEQ X;  2Q2I A;  2F4V Q;  4OX9 Q;  3FRP B;  4C1N I;  3C3L A;  1L2F A;  4JI0 Q;  2EVB A;  3NSW A;  4C3I H;  1JCK B;  1QCB D;  3IFD A;  3PSI A;  1KLU D;  3S9W A;  1AH9 A;  1STA A;  4LWC A;  1SRO A; 
#chains in the Genus database with same CATH homology
 4K5V A;  3R93 A;  4RKL A;  5EKL A;  5IGB A;  1BDO A;  2F0J A;  5A35 A;  2NBF A;  4DFA A;  1SYD A;  2E76 C;  2IX3 A;  3DWA A;  3ZYY X;  1F2L A;  3OMG A;  5C4X B;  3W2D A;  4KK7 A;  4H0L C;  1SND A;  2MPM A;  1YNN D;  2NVQ B;  1SBB B;  4HN7 A;  2NWG A;  3D8G A;  2F0V A;  2JA5 B;  5FKA C;  1O80 A;  4BY1 B;  1EY6 A;  1JWM D;  1TWA B;  2EJM A;  1SXT A;  2ENB A;  1A3T A;  2FMC A;  3TP6 A;  5I2Y A;  2EZV A;  2K7V A;  5JPN C;  4F87 A;  2L12 A;  4KN7 C;  1ZXT A;  1Q90 A;  3D31 A;  5FO8 B;  1II3 A;  3CRL C;  2R92 B;  4PMW A;  4OHJ A;  1EFI D;  3LX0 A;  2B63 B;  5I9P A;  1CQF A;  5C5L A;  3MEH A;  1RTO A;  2SDF A;  1HA6 A;  4K8J A;  3KLS X;  1DM0 B;  1A2T A;  4JBW A;  4BBR B;  3BDC A;  3KF8 A;  5M5Y B;  1STH A;  3PIP 3;  4FXD A;  1EWC A;  4FF1 A;  1BF4 A;  2RSN A;  1JWU D;  3PO3 B;  1SNC A;  1YNJ D;  1CA5 A;  5ELE A;  3TN2 A;  3K7A B;  1LT5 D;  3TP5 A;  4A3M B;  5T1I A;  4K2L A;  2PW5 A;  1PTO D;  1SDF A;  1DCZ A;  1I4X A;  4TSS A;  2LS0 1;  4BS9 A;  3A54 A;  3SE0 A;  2F3V A;  1SFO B;  4DK1 A;  1PRT F;  5IGF A;  1LTA D;  1S5C D;  1CZG A;  5K5P A;  5KIX A;  1F9P A;  4ULL A;  4K6L A;  3JAM L;  1PRT C;  4FF3 A;  3PMF A;  1R4P B;  3S16 B;  1Y1W B;  3FPP A;  1OXT A;  1IYU A;  1EU3 A;  1SNP A;  2O2L D;  2Q8T A;  4DAP A;  1VF5 C;  2OXP A;  3GTM B;  2G9H D;  2HCI A;  5FO9 B;  1SE3 A;  1ILP A;  1AN8 A;  2VXW A;  3OSO A;  4QF4 A;  2PQE A;  3S1M B;  1FNU A;  2K5W A;  3VR6 A;  5C0X H;  3D3R A;  1S5E D;  4HCE A;  4PNY A;  2HCC A;  1XX8 A;  1HUM A;  3MZ5 A;  4FP5 D;  2AQ3 B;  4DNR B;  5JAV A;  3S15 B;  2QCP X;  1SYE A;  3SVM A;  1VDZ A;  1O78 A;  3S2D B;  1TS4 A;  1KNA A;  1V8Q A;  3TP7 A;  4RHR A;  5FOB B;  3I3C A;  4OIK A;  2XN9 C;  4HCS A;  1I6V C;  3NHH A;  4IFD H;  5EQ0 A;  1O7Y A;  1ZYR D;  1I4H A;  1ILQ A;  1STE A;  1VMP A;  3TSS A;  4J1M A;  3NBH A;  4C56 C;  2QIL A;  1VCI A;  1GOZ A;  2NVY B;  3VYU A;  5C6A A;  3K5L A;  1D5M C;  2E2D C;  2TMP A;  3GV6 A;  3GD7 A;  2NYZ D;  5KNB A;  1WTP A;  2F0I A;  4PMC A;  4DXF A;  5CR3 A;  3A8J E;  2B2V C;  1QWY A;  4RHS A;  4BBS B;  2NTS A;  1PFB A;  1MBY A;  2JP1 A;  2L4N A;  4C3I G;  2K32 A;  1RD9 D;  3HOZ B;  1CFM A;  2MJ8 A;  2IT1 A;  1S4Z A;  3T51 B;  4KTA A;  4ZKC B;  3E0J A;  5ELC A;  2ICI A;  1DZ1 A;  1R4Q B;  4DAV A;  2K5Q A;  3NQT A;  2EOT A;  1PXU A;  1CA6 A;  3VR3 A;  3DUZ A;  3T53 B;  5KYL A;  2KA7 A;  2F0K A;  1SE2 A;  1SNO A;  4H7B A;  4E6I A;  3NP8 A;  5LL6 S;  3NTH A;  1JOR A;  3HOU B;  3M4Y A;  3BYY B;  1JB3 A;  3URY A;  2XSC A;  1U4L A;  5FLX E;  1JOK A;  2F03 A;  1C8C A;  1LTI D;  3NTI A;  3MVV A;  4DF7 A;  5JVH 3;  3Q0A A;  1X32 A;  1DYQ A;  3WOE A;  1B1Z A;  2JA6 B;  3SK6 A;  3I90 A;  4DA2 A;  4CKC A;  1C48 A;  1F2Z A;  2F1M A;  4PQX A;  1CHP D;  5FK9 C;  1Y8O B;  3ONA B;  1SAP A;  4Z9C B;  1Y8P B;  5JOB A;  2EDG A;  3U9O A;  3K57 A;  4KKS A;  1D6E C;  1IW7 D;  1A6X A;  2L1B A;  4R8N A;  5IGG A;  5KND A;  5DNF A;  2E2H B;  2DNE A;  2X69 A;  2PZW A;  4O42 A;  4LJZ C;  3C1F A;  4C3J B;  5JEA J;  1BQQ T;  3SEB A;  3E6Z X;  4XXE A;  4FF4 A;  1I4G A;  2KVM A;  1DOK A;  3OPO A;  2K1B A;  4UAI A;  1WD0 A;  3OOC A;  1DJR D;  1SJE D;  1L0Y B;  2HDL A;  3QIA A;  5G3L D;  2JYO A;  1OO9 B;  5EBD A;  2KEE A;  1I4R A;  2BE5 C;  3J7Y W;  1B2T A;  5BN3 A;  3QOJ A;  1TY0 A;  1TR5 A;  1EU4 A;  4RFB A;  2QDB A;  3A7L A;  4XQQ A;  1TU2 B;  1SYB A;  1IHZ A;  3VR2 A;  1Z47 A;  4ZYS A;  3VYR A;  4HSV A;  1AFP A;  2IWH A;  3T16 A;  4XQN A;  1Z7T A;  3QOL A;  2M9V A;  2JA8 B;  2D2C C;  2BDN A;  4DXG A;  1JR0 D;  3Q24 A;  3J81 L;  5CC4 A;  2EY1 A;  5EPL A;  3OMC A;  1TS3 A;  1EZ8 A;  1K8M A;  1VMC A;  3DWQ A;  1I3Q B;  4UDU C;  3HRZ C;  5I4D A;  1RCV D;  2KJX A;  5C0X G;  2F0P A;  2OEO A;  1TWC B;  1LT3 D;  3NE5 B;  3AU7 A;  3KUP A;  1OXV A;  5M5X B;  3IKJ A;  1HUN A;  1EOT A;  1A2U A;  5TSS A;  4X3U A;  1XWE A;  1RHP A;  2WAQ B;  1QIL A;  1LAB A;  1LTS D;  4HSP A;  4RGO S;  2CHB D;  5D3I B;  5HUR A;  1KNE A;  4CBV A;  4NW2 A;  4WOR A;  2BCO A;  2A68 D;  4ZAI A;  1ET6 A;  3PO2 B;  1SYG A;  4DGZ A;  4IFD G;  3R8B A;  3RD4 A;  3Q23 A;  5KNC A;  1PZJ D;  1BXT A;  3QB3 A;  1I4P A;  2Q8I B;  2A5H A;  2PO4 A;  4JK1 C;  4DK0 A;  1LLR D;  1H9S A;  3LWU A;  2R7Z B;  4GZY C;  1DON A;  1U4M A;  3J80 L;  4BA2 I;  2VUM B;  1V1P B;  1U4P A;  4PV1 C;  1IYV A;  1CZW A;  3ERQ A;  1BBX C;  1LT4 D;  4V0B A;  1KAB A;  1HTL D;  3CRK C;  1ML0 D;  2F4I A;  5E3F A;  3I4N B;  1Q1E A;  4A3E B;  1EY8 A;  3PUZ A;  4A3I B;  3MC0 B;  1K8O A;  5J39 A;  1BCP D;  1LO5 D;  1RDP D;  4ZUJ A;  1PTO H;  3TBI B;  3QG1 A;  1V1P A;  1H9K A;  2FIN B;  1F2M A;  3QWN A;  3R2I A;  3GTK B;  1V43 A;  2XVS A;  1G6Z A;  1GUG A;  1PMR A;  2EPB A;  3A56 A;  2D5D A;  5M3F B;  1QJO A;  5CGK A;  1PDQ A;  5EKK A;  4MHE A;  3K59 A;  3EQL C;  2SNS A;  2RDG A;  2RQX A;  3CU7 A;  2RBM A;  2A6H D;  2F0O A;  1EEI D;  1KAA A;  3S2H B;  2CQA A;  2Z1C A;  4K6D A;  4OO1 I;  4X3K A;  4CKB A;  4BWG B;  2AUK A;  1JQY D;  3FKI B;  4Q5V A;  4IUU A;  4HMJ A;  1E0B A;  1GHJ A;  5FO7 B;  2N55 A;  1Z6H A;  4I7Z C;  1ENF A;  1BCP F;  2Z4I A;  5JJZ A;  2B2T A;  2JE6 I;  1D1I A;  3GTG B;  3VYT A;  4QUC A;  4XYO A;  2Z8L A;  4DN4 M;  1NR4 A;  1SYC A;  3BG3 A;  1MGS A;  1SJH D;  2CW0 D;  4FVM A;  1YNN C;  5C5M A;  1B44 D;  1FGB D;  3HKZ B;  1DOL A;  3TZD A;  1EYC A;  4I65 A;  2PNR C;  1EZ6 A;  5COR A;  2OF1 A;  2YU9 B;  4ZKB B;  3DMU A;  4FYD A;  2HUG A;  4A3G B;  1TII D;  1G29 1;  5CBA E;  4EQN A;  3OHX C;  1NSN S;  2QKI C;  1O7Z A;  5JVG 3;  2J4X A;  1E2W A;  3U9S A;  4XT3 B;  4RCO A;  3BZD B;  3J81 E;  3N52 A;  5E4W C;  4M8A A;  4C1N K;  4KHV A;  2V4D A;  2MGS A;  4RKB A;  1C4Q A;  2GA4 B;  3L7Z C;  2CVR A;  3K5M A;  2EYO A;  2RDH A;  4G7O C;  2VB3 X;  3E5S A;  4C3J G;  2KCC A;  4F8M A;  3D4W A;  3VR5 A;  1SYF A;  2NB0 A;  3W3A A;  2IX1 A;  3FDT A;  4L63 B;  1JE4 A;  5D65 A;  4FXK C;  3GTO B;  2EE1 A;  4A93 B;  2EYJ A;  5EGT A;  3BDL A;  3NWS A;  4F88 A;  1O7L A;  2E2I B;  4CGY B;  1G2S A;  4HED A;  3OW7 A;  3IFT A;  2L5T A;  5A2Q E;  1YNJ C;  1PTO F;  2L0C A;  3T4A C;  3TZU A;  2XNA C;  4F7X A;  1HFN A;  2B2W C;  1J8I A;  3BVZ A;  2O4X A;  4IUT A;  4XT1 B;  4U67 3;  4XYQ A;  1PTO C;  2D62 A;  2IL8 A;  3GO5 A;  2ICE C;  2EYL A;  3R2T A;  4KJN A;  1L0X B;  2K01 A;  1LT6 D;  1WTV A;  4IN3 A;  3S17 B;  1A15 A;  4B9W A;  1STN A;  1WTO A;  2K6A A;  1FR3 A;  1G2T A;  5BN5 A;  5DM7 3;  4RWS C;  3J80 E;  1QNU A;  2NVT B;  3BVM A;  1Y1V B;  3O13 A;  4K14 A;  4C3H G;  1STB A;  2F0W A;  4H44 C;  2B2U A;  3TDQ A;  4BY7 B;  2A74 C;  4MIU A;  1LTR D;  1XXG A;  1BO0 A;  1IL8 A;  3WDN A;  2AQ1 B;  3HGB A;  4CJ2 C;  4EQP A;  4HR7 B;  5I6W A;  1BNZ A;  1LAC A;  5T1G A;  3D6C A;  2A69 D;  1QE6 A;  2I07 B;  3T56 B;  2NZ1 D;  1KDC A;  3GQB A;  3A55 A;  3GTJ B;  3S1R B;  3D4R A;  3OWE B;  3H09 A;  1EY7 A;  1B9N A;  2PCF B;  1TKW B;  1AP0 A;  2ZXR A;  3OIQ A;  4M1U B;  2JXM B;  2RVL A;  4G7H C;  3SDZ A;  4B08 A;  1OXU A;  5C3W A;  1CK1 A;  1SNQ A;  2B39 A;  3MFG A;  4ZQ3 A;  1STG A;  2WB1 B;  4NKL A;  4DNT B;  3D6W A;  1EY5 A;  1H9M A;  3I72 A;  2A6E D;  2F0M A;  2K28 A;  4A3D B;  3LWE A;  2JEA I;  1JOQ A;  4RCN A;  1BUV T;  2L9H A;  1F9R A;  3MXP A;  2LKV A;  3M4O B;  3HOY B;  1D5X C;  1GUO A;  5KYI A;  1QG7 A;  2XWJ B;  2PW7 A;  3GTQ B;  1ZYR C;  4TQU S;  1EWH A;  1LTB D;  2F0H A;  5HGT A;  1NUC A;  1PYW D;  1NR2 A;  3MXU A;  3IL8 A;  4HAE A;  2WAC A;  5CV4 A;  4WFN 3;  1Q1B A;  5CV7 A;  1FNV A;  1S5F D;  5EKI A;  3V96 A;  2O5J C;  1NCV A;  1UNS A;  1BR9 A;  3DHQ A;  5C4Z A;  1KDB A;  1EEF D;  4QCL A;  2H1E A;  2C9O A;  4L6T B;  3NBI A;  3G7L A;  3OIP A;  5EBC A;  3JAM E;  3DM1 A;  4K2K A;  2ZXP A;  2WKD A;  3I4M B;  4MN3 A;  4X3S A;  2F0E A;  3HEJ A;  3V2T A;  4FO2 A;  2QEJ C;  1EYD A;  1EIH A;  1RJT A;  1S5D D;  4RGM A;  2IW3 A;  1OXX K;  2EY5 A;  2ID0 A;  1HQM C;  3SK4 A;  5E4X A;  4XQJ A;  5M3M B;  2EYF A;  4DAY A;  1PFN A;  3FEW X;  3S1N B;  2N88 A;  2PZT A;  2X6L A;  1SMY D;  3EA6 A;  2WP8 J;  3C46 A;  1STY A;  4IQZ A;  3QJY A;  1CTM A;  3MA2 B;  2RA4 A;  1TS2 A;  3R3O A;  2B8F A;  5JEA H;  2YYZ A;  1IW7 C;  1E2Z A;  5KGU A;  5DM6 3;  4OL7 A;  1Y8N B;  2F0F A;  1QB5 D;  3HOW B;  4RA8 A;  1B3A A;  2LMC B;  4KY7 A;  3CQZ B;  1JC7 A;  1LTG D;  3VR4 A;  5G3L F;  1WTQ A;  2SOB A;  3MHB A;  1PRT B;  1B4O A;  5NUC A;  4KY6 A;  3D4D A;  3T13 A;  5C3E B;  2DNC A;  3PUV A;  2EYP A;  3EFX D;  1H9S B;  1V1O A;  1TQO A;  5DEH A;  1JWS D;  2MUY A;  2F3W A;  5C3X A;  2NUC A;  2AUJ D;  2AWN A;  5CV9 A;  3VA5 A;  2K33 A;  2DY8 A;  4J8Q A;  3K58 A;  1I4Q A;  5IT9 L;  2BA0 A;  4NDX A;  4Y7N B;  3S14 B;  1B50 A;  4WRD A;  5EJW A;  2H4O A;  1TY2 A;  1FNW A;  2Z4H A;  1TS5 A;  3NXW A;  2NN6 I;  1TWF B;  4L8J A;  3OWF A;  4R8I A;  5CMD A;  1EYA A;  2PYK A;  1Q12 A;  3J7A V;  2K5D A;  4EVO A;  4FXG C;  1GUW A;  3I91 A;  2C5C A;  1EIG A;  1T5E A;  1HXY D;  4NMZ A;  4C2M B;  2D9U A;  3VYS A;  4QB4 A;  2AQ2 B;  5ISR A;  1A3V A;  3I4L A;  1DOM A;  1PZI D;  4RH6 A;  5D14 A;  3KBX A;  4KHZ A;  5F2D A;  3P7J A;  3TME A;  2B2W A;  3DEO A;  5I2X A;  1EY9 A;  1F9Q A;  1AZP A;  3MWY W;  1T5X D;  5CV8 A;  3K6O A;  4A3K B;  4KKU A;  4U68 A;  1KDA A;  3EJI A;  1D5Z C;  3VA7 A;  4YIJ A;  2XIW A;  3V05 A;  1SNM A;  1PZK D;  3C2P A;  3L3O C;  2A68 C;  3NUC A;  3Q6S A;  4K8I A;  5J1Z A;  4V19 0;  4DU9 A;  1IKM A;  5K36 H;  2B8G A;  3P20 A;  4ZUI A;  3AB9 A;  2FMM A;  5CYU A;  2AWO A;  4K5W A;  4Q0F A;  2HQE A;  1OXS C;  1RF2 D;  1H9J A;  1PRT D;  5EPJ A;  5CV6 A;  3KBG A;  2SEB D;  4FNF A;  1R9T B;  5C0X I;  1LTT D;  3NK9 A;  5ELD A;  5BN4 A;  2LY7 A;  4IUV A;  3IAY A;  2B2Y C;  5LL6 X;  2VNU D;  4RAU C;  2EY2 A;  3NWT A;  2KHS A;  1VF7 A;  3ITP A;  5FLX L;  4HTH A;  2B2V A;  3AMU A;  2EYM A;  1EY0 A;  1CM9 A;  1WD1 A;  3K5O A;  1TWG B;  2RDF A;  2E74 C;  4S3S A;  1EQT A;  1SE4 A;  3H0G B;  4KD3 A;  1BCP C;  5I6Y A;  1MD2 D;  4RGN A;  3GTP B;  1GXD C;  2BOS A;  4KMU C;  4IFD I;  3BS1 A;  5COY A;  2NN6 H;  3K5N A;  3LNN A;  4IUP A;  4TRD A;  1HCZ A;  3X3M A;  1HQR D;  3A8K E;  1ICW A;  3P1H A;  1B53 A;  3CKI B;  5C0X J;  4HMI A;  3RLF A;  2MP1 A;  2QF7 A;  4OGQ C;  1CT1 D;  1WCM B;  4ID6 A;  1Q3L A;  5E1F A;  3P75 A;  3SXH A;  4G57 A;  4N9T A;  2HDM A;  3TP8 A;  1HFG A;  2A6H C;  1TT2 A;  1UAP A;  2KUM A;  2FFK B;  2K03 A;  1AEX A;  2KQ3 A;  5J22 A;  5LHY 1;  1G91 A;  2XRS D;  3RUZ A;  2KCN A;  2EXZ A;  3M7G A;  3KK7 A;  2WKC A;  4IFD J;  1WTX A;  3N6R A;  3RMH A;  1MI2 A;  3UI2 A;  2L11 A;  4QUF A;  5JEA G;  2JA7 B;  1EL0 A;  5I9O A;  1KTK A;  2M00 A;  1U4R A;  5M5W B;  5C44 B;  3X3N A;  1FD7 D;  1F2Y A;  1EY4 A;  1FYC A;  1ESR A;  3PUX A;  2CW0 C;  4OO1 H;  1S5B D;  4H13 C;  4CHT B;  4ABN A;  3GP7 A;  2FHT A;  3FPU B;  4KKT A;  1XTC D;  3K0Y A;  5ELB A;  4KI0 A;  4IUN A;  5IT9 E;  3BVG A;  3DWP A;  3J7A F;  4PMB A;  3F2U A;  1ESF A;  1PFM A;  3HOX B;  3MAQ A;  2R93 B;  2MHV A;  2I46 A;  3KLS A;  5D3D A;  3ND8 A;  2K04 A;  4ZLT F;  1X3P A;  1CHQ D;  1M8A A;  5IGE A;  3GV3 A;  2EJG C;  2L55 A;  5IOC A;  3I73 A;  4G7Z C;  2J7Z A;  2Q8R E;  1B9M A;  4ZK9 B;  3MXG A;  3I8Z A;  4A3F B;  1HHV A;  2G9D A;  4B9X A;  4WJW A;  4ILW A;  2EYH A;  1HPC A;  3RZD B;  1ONL A;  3ND9 A;  4CKE A;  2R61 A;  1ENA A;  1CQV A;  2F0L A;  4CJ0 B;  3HZX A;  4ME5 A;  2VB2 X;  2PZU A;  3RZO B;  2BA1 A;  3QO2 A;  1Y69 U;  2DY7 A;  1F9S A;  2NVX B;  3BYT B;  2B2T C;  3FMC A;  2BDO A;  2F0U A;  1U9R A;  4KD4 A;  1WVL A;  1H9R A;  1Q8I A;  4NP5 A;  2JSO A;  3WOF A;  5KEE A;  4O1N A;  1EQV A;  3G6J B;  1W6K A;  4X3T A;  5EPK A;  1QNK A;  4TKO B;  5ELF A;  3S1Q B;  4QMG A;  2X6G A;  4XTC S;  2F0T A;  4KY5 A;  3C1E A;  3M85 A;  2J0T D;  1I50 B;  4KV6 A;  2PPB C;  4FF2 A;  2EY6 A;  1PLF A;  5K36 G;  2BE5 D;  2SNM A;  3PV0 A;  1SEB D;  1XYI A;  3HP3 A;  3MFY A;  2EJF C;  4OIJ A;  1G8Z D;  1DXM A;  2OT2 A;  2F0N A;  2LFN A;  2M2L A;  5IIF A;  2WV6 D;  4ZRZ A;  3H91 A;  4AYB B;  2IPK D;  1F77 A;  2A69 C;  5CBE E;  1MSG A;  3GTL B;  2KOL A;  2WIN B;  1ENC A;  3SK5 A;  1AW7 A;  3H3V C;  4KN4 C;  3SR1 A;  3I70 A;  1GHK A;  4R9W A;  2ZT9 C;  2DN8 A;  3PIO 3;  2TSS A;  1JIC A;  2A6E C;  4BA1 I;  2O5I C;  3HOV B;  1HA5 A;  2IJ0 A;  5DAU A;  2NN6 G;  4CJ1 B;  3FVQ A;  1X3Q A;  1NAP A;  4XDX A;  3NPP A;  1HTP A;  2F0D A;  1GUS A;  3Q22 A;  1CI3 M;  1WTW A;  1HRJ A;  3CHB D;  3DXJ C;  5IGD A;  3KLR A;  3A7A B;  2KED A;  4IZ8 A;  1W6J A;  1DD2 A;  4A3J B;  1GUT A;  3EVQ A;  1UUP A;  1JOO A;  2A73 B;  1QOH A;  2E2J B;  2B2U C;  4IUQ A;  3A8I E;  1ET9 A;  1K83 B;  4ODG A;  1RTN A;  4IAL A;  2Y0S B;  3ERO A;  3DEP A;  1BCP B;  2ZXO A;  4J6H A;  2F0S A;  2B2Y A;  4EGV A;  1TVX A;  1D2B A;  5C4H A;  4P2C B;  1D1K A;  2RSO A;  1LV9 A;  1AZQ A;  4N9P A;  5IGC A;  3M3Y B;  1ROD A;  2K05 A;  2FJ2 A;  2NTT A;  1MSH A;  4LAA A;  4LK1 C;  3MTS A;  4C3H B;  1ZKO A;  3SK8 A;  5CV5 A;  1WTR A;  4KJO A;  2F0G A;  3SHL A;  4RGT A;  4G4K A;  1M4V A;  2XWB B;  4OO1 G;  5JPM C;  2KEC A;  3H6M A;  4IUR A;  2R3Z A;  1RKN A;  3NQI A;  3M7N A;  3NTK A;  1KLG D;  4EQO A;  3H94 A;  5AFW A;  1SSO A;  4K5X A;  2R6G A;  4LMQ D;  2F0Q A;  1A3U A;  4C3I B;  5A2Q L;  2XRQ D;  5KRU A;  3PUW A;  5M9O A;  1GJX A;  3PUY A;  5IOD A;  5C4J B;  1E2V A;  2PMZ B;  1I6H B;  2IX0 A;  1GUN A;  1SMY C;  3HG9 A;  1BOS A;  3HS0 C;  1IKL A;  3MXN A;  1TWH B;  2RKS A;  1J9O A;  4A3B B;  1PTO B;  1UEA B;  2WII B;  3L9A X;  4XIG S;  2JEB I;  2E75 C;  4QIW B;  3BDO A;  1ZEQ X;  3FRP B;  4C1N I;  3C3L A;  2EVB A;  3NSW A;  1JCK B;  1QCB D;  3IFD A;  1KLU D;  3S9W A;  1STA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...