4O42A

Tandem chromodomains of human chd1 in complex with influenza ns1 c-terminal tail dimethylated at k229
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/viral protein
total genus 53
structure length 173
sequence length 173
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4o42A02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4o42A01
4ZKCB 1WD1A 4X3KA 1NR2A 1J8IA 1CA5A 1B50A 1PFMA 4IURA 1F9PA 1HUMA 3UI2A 4MN3A 2B2YA 2SDFA 2B2WA 3P7JA 4X3SA 2L11A 4ZAIA 4QUFA 5CMDA 1ML0D 3HP3A 5EJWA 1U4MA 3SVMA 5COYA 3TZDA 1EL0A 1JE4A 1WD0A 4R8IA 2X6LA 1KNEA 1RODA 2B2UA 2FJ2A 5CBEE 1C8CA 1NAPA 2L4NA 4HEDA 1AZPA 3KUPA 1PLFA 2KUMA 1X3QA 2K1BA 4RA8A 5EKIA 1F9RA 3QO2A 1TVXA 2RSNA 1B4OA 1QG7A 3I3CA 5EPLA 1DOKA 1EQTA 1HA6A 2MP1A 3I91A 3ONAB 4IUPA 2IL8A 2FFKB 4OIKA 5E4XA 1XYIA 1HFGA 1MSHA 2KEEA 3H91A 2B2TC 4CJ0B 4HSVA 2H1EA 5CBAE 3DM1A 2R3ZA 3DEOA 4QUCA 1SSOA 3F2UA 3LWEA 1WTOA 1ZXTA 1CM9A 4ZKBB 4CJ1B 4IUVA 1BBXC 3DEPA 2VXWA 1ILPA 5EPKA 4HCSA 1AP0A 1PFNA 2B2VC 3IFDA 1EIHA 1PFBA 4RWSC 3TN2A 1J9OA 1WTRA 3MTSA 1HHVA 1IKMA 1O80A 4MHEA 5EQ0A 1ILQA 4DN4M 2KVMA 1SDFA 4OIJA 2Q8TA 1B2TA 2B2YC 2HUGA 2L12A 2B2WC 2M2LA 3GV6A 1DOMA 3KBXA 4NW2A 4IUTA 1IKLA 3R93A 1WTWA 1CA6A 5D65A 4ZLTF 1QE6A 1G6ZA 5EPJA 2K04A 1ICWA 5AFWA 1Q3LA 2MGSA 2B2UC 4UAIA 1RTNA 2DY8A 2NZ1D 4XDXA 4HAEA 2HCIA 1B3AA 1HRJA 1A15A 4RAUC 2RA4A 1O7YA 5T1IA 1S4ZA 1HUNA 1X3PA 1X32A 3Q6SA 3FDTA 2XIWA 2L9HA 1RHPA 3I8ZA 1G2SA 1MGSA 2Q8RE 1O7ZA 3G7LA 4CJ2C 1HFNA 2NWGA 5DNFA 1LV9A 1XX8A 1WTVA 1U4PA 4IUQA 2KECA 4O42A 1WTXA 4XT3B 3I90A 4X3UA 1BO0A 2N88A 3FPUB 1F2LA 1E0BA 1SAPA 4XT1B 1F9QA 1U4LA 2JYOA 2HDMA 1WTQA 2CVRA 2K28A 1QNKA 2J7ZA 2N55A 4R9WA 5JJZA 2NYZD 1VMCA 5CORA 1G91A 2FMMA 1IL8A 1U4RA 1MSGA 2RSOA 2EE1A 1EOTA 1M8AA 1F9SA 1WTPA 1PDQA 2JP1A 2X69A 2EOTA 2HCCA 2L1BA 4X3TA 1BNZA 2MJ8A 3GV3A 2MPMA 2BDNA 2K03A 1NCVA 1RTOA 1DOLA 2X6GA 1G2TA 5T1GA 5D14A 1AZQA 1B53A 1DONA 2FHTA 2KOLA 4ZK9B 5E4WC 1VMPA 1EIGA 2K01A 1MI2A 1BF4A 2B2TA 2D9UA 1JICA 2DY7A 2K05A 2RVLA 1KNAA 3N52A 1ESRA 4LMQD 1RJTA 2KEDA 3IL8A 3MWYW 4U68A 2FINB 1WVLA 1GUWA 2EPBA 1NR4A 1DZ1A 2HDLA 2B2VA 3D6WA 4IUUA
chains in the Genus database with same CATH superfamily
4EQ5A 5FK9C 1HTLD 1PFMA 2KCMA 1PYBA 2B39A 4ME5A 4MN3A 1KABA 4X3SA 5E1FA 1ML0D 4BA1I 4F87A 4H13C 1TS4A 4P71A 5K36H 4OWXB 1PZID 2L4NA 5C6AA 4JI3Q 3PUYA 3C2PA 1KRTA 5IT9c 4X64Q 1Q82C 4DR1Q 4APVA 2HQLA 3BDLA 1A62A 3BS1A 3RLOA 2I5HA 5FJ8G 4IUPA 2VUMH 5E4XA 4K2LA 5I6WA 3S16B 5M5XB 4R4OA 2R7ZH 1B8AA 3P1HA 2CKZB 2F0LA 2UUAL 4IUVA 2RF4A 2VXWA 1Z47A 1K28A 5EPKA 4UPAA 2K6AA 1HHVA 3BU2A 2Z4IA 1HPCA 2WV6D 3GTJH 3AB9A 4ZRZA 1VQ9A 3HGBA 3J7AF 2OCEA 1C7YA 5FKAC 1D5XC 1ET6A 5KNBA 4DR5Q 4UAIA 2ZXPA 2DY8A 5EAYA 1IBLQ 4C56C 3R3OA 2KBNA 4BY7H 1AE3A 3W1BA 4WFN3 1GD7A 2F0UA 2SNSA 4YCVA 1RHPA 3S16H 1VQGA 1Z6HA 5M5XH 1PTOF 3JAMi 4DV4L 5BN4A 1WTVA 1RIPA 4H7BA 5C3XA 2B8FA 3EA6A 1BO0A 1E0BA 3PCOB 1YNJC 2NZHA 3CCMA 2IX0A 2CVRA 3ERQA 2HHHL 3ZYYX 2DNEA 1FJGQ 5CC4A 1CI3M 3GTQB 2UXCQ 2HCCA 2L1BA 3S2DH 2G5DA 2QEJC 3SHLA 1BCPB 2VQEL 1I4QA 1XTCD 5IGDA 2AKWB 1QVGA 4JI4Q 4A3JG 3I7FA 5LL6S 4IOAA 4A76A 1KNAA 2R61A 3MWYW 4RMFA 4XQJA 4LF6Q 1DZ1A 1B70B 2PI2A 3SGIA 4EQOA 3HOUG 4J1MA 1GUNA 1KHIA 1SMYC 1S5CD 2EY2A 1IBKQ 1LTSD 4LF5Q 2R93G 1U4MA 2AQ2B 5C5LA 2VS1A 4A3KG 1YBYA 3K6OA 5IT9L 2ZJPA 2FJ2A 2EYFA 1IHZA 4DGZA 3SXHA 3CF5A 3GTOB 4LF4Q 4F8MA 1GVPA 3U58A 1YHQA 2KCNA 3A56A 1VQKA 1LTAD 3MHBA 1DOKA 1LTTD 4WRDA 1EQRA 1V43A 2KEEA 5ELFA 4Q0FA 3TP8A 3ER0A 2JEAI 5C5MA 1LT5D 4RCNA 1BXTA 3LWEA 1I50B 1TWGB 5J1ZA 4XYQA 2A6EC 3TN2A 4YY3Q 3PO3G 3GO5A 4X65L 3JAME 4LF9L 1WTHA 4RGOS 1X3EA 4ZUIA 1CZWA 4DNRB 2B2YC 1B9MA 2K33A 1DOMA 1VQBA 3I2ZA 3D4WA 1PTOC 1UAPA 1ICWA 3Q24A 3GTOH 2SEBD 1B3AA 4MTNA 2IW3A 2ZXRA 3VYRA 3CMEA 5LMUQ 3H09A 4Y7NH 4ALPA 1XMQL 1VQ8A 1GUGA 4C3IG 4QQBX 4KLKA 3MXPA 2WIIB 4ULLA 1STAA 1G2SA 1L1OC 3RMHA 5GAHC 3S14B 2YTVA 1BOSA 4CJ2C 4DV7L 1G51A 3PIP3 3S1RB 1HNZL 3B6YA 4K5WA 1CKOA 4OX9L 4HIKA 4QMGA 1QVFA 3OHXC 1HZ9A 3E5SA 1D1IA 3VYTA 2TMPA 1WTQA 4OELB 1YIJA 2J7ZA 1I4HA 2NYZD 2FMMA 1EU4A 3AU7A 1Y1VG 2NN6H 4C3HB 1HA5A 5IYDH 5C3EG 2JP1A 2IT1A 1N36Q 4O2DA 1BNZA 3BZKA 2F0NA 5CV9A 5C0XJ 3S14H 3RZDB 1WCMB 2OF1A 3S1RH 4A3GB 1PYWD 4ZK9B 2F0DA 4NXNQ 5C0XG 3NWTA 4A93G 1YJNA 3H3VC 4DNTB 1Y14B 1CQVA 3S1NB 4KI0A 1TXYA 4JYAL 1YJWA 3W3AA 5DAUA 4HIMA 2EPBA 3UDGA 3GP7A 3HKZB 2KCCA 4ZAIA 3IFTA 1I5FA 1QVCA 1B50A 4O1NA 4C3HH 1EYCA 2F4IA 5GAEC 2A6HD 1XPUA 2B2YA 4JI8L 3DWPA 2RDFA 1GOZA 3CC7A 3G71A 1PV4A 4HEDA 4C1NK 4IFDJ 2K1BA 4RA8A 4GN5A 1OO9B 2RHQB 1H9SA 1N32Q 2QA4A 4HJ8A 1L1OA 2XN9C 4IFDG 2XVSA 2NB0A 5JEAH 3GQBA 3KLRA 3SK6A 2XNAC 4JBKA 1BBXC 4KV6A 1M4VA 1BUVT 4DAVA 5TSSA 4IJLA 4A3BB 4DR7Q 4OEMB 4HJAA 5C4JH 5C4HA 1WTRA 2K5HA 3MTSA 1O80A 1KDBA 4PNYA 3DM3A 3GV6A 2JA6H 1LACA 1Q3LA 2MGSA 1RTNA 2F0MA 3K5LA 4FYDA 4H02A 1EYDA 2HD3A 1DGSA 4BBSH 4IPCA 1HUNA 2F0PA 1B44D 4KK7A 2E5LL 4V190 1O7ZA 3OIQA 3J81j 2ZTDA 4LWCA 1UE7A 2KECA 4A3BH 3L7ZC 1LTBD 3K7AH 1AE2A 2JEBI 3BDOA 1PA6A 1F9QA 2JYOA 2JA5B 3K57A 1E7ZA 3VR4A 3A7AB 2ZTCA 5M5WB 2EYHA 1D6EC 1PH1A 1PH6A 1D8LA 1Q7YC 2I5MX 4KHVA 2L5TA 4F88A 3MA2B 4A3CH 2UUBQ 3NXWA 3DUZA 3FKIH 3M3YB 1E22A 5F2DA 3NHHA 4OWTB 3S1MB 2I07B 1STYA 2CCZA 1BQQT 2DY7A 3SK8A 4DV2L 2RVLA 5KYIA 2JA5H 3UDXA 1ICFB 2AQ1B 2Z9HA 1E1TA 3K0YA 4DUZQ 5IYBG 2D0OA 1J8IA 1CA5A 1TWFB 1TS2A 4B9XA 4QUFA 2L11A 3A0JA 4XYOA 2JQOA 3M3YH 1MJEA 1WD0A 4RGMA 4L8JA 2WB1G 4LJZC 3S1MH 2NZOA 3CKIB 1F9RA 3I3CA 1HA6A 4S3SA 4EQPA 1JE5A 2ICIA 3KDFB 1HFGA 3I70A 5CBAE 5G3LF 1V9PA 5CYUA 3DEPA 4B3RL 1BCPD 2B3GA 1ILPA 2R92H 4AQYQ 1EIHA 1PFBA 4RG1A 2M9VA 1J9OA 1V1OA 3NUCA 3QG1A 3OIPA 1V1PA 5LHY1 3E9IA 2L12A 1JWSD 3MXUA 1FL0A 4FO2A 3M85A 2VB3X 4A3IG 2XWBB 1CHPD 1P16A 4JVZA 5AJ3L 3CCVA 4P74A 4GKKL 4H0LC 4RGTA 2OT2A 2CH4W 2XIWA 5JEAJ 4HMIA 2VQFL 1X56A 2QCPX 3A55A 1XX8A 4ZCKA 1SBBB 3E9HA 4OO1I 3UDIA 5JEAG 4GOPC 4LNQA 4CDEC 1XMOQ 1O7IA 4ID6A 1UE6A 4AIMA 2F4VQ 1T5EA 3PQIA 4XT1B 3KLWA 1GUTA 3D6CA 5I2XA 3PO2G 5JJZA 1G91A 1STGA 3GTLB 4OGQC 1EWHA 3VR6A 4DAPA 3DXJC 2PYKA 3BZDB 2F0SA 3HOXG 4BXXH 4DV1L 2UXDL 3H15A 2JXMB 1IW7D 1XNRQ 1PZJD 4B9WA 4FF4A 3JAMc 2YU9B 3T51B 4EVOA 4JBWA 1NUCA 1B9NA 1SNCA 5KYLA 5I2YA 1XPRA 3PIOA 4GN3B 4YWMA 1S72A 2DN8A 3GTLH 2OEOA 5CGKA 1I4RA 1NR2A 4EX5A 1VQHA 2A6HC 1EOVA 1ONLA 4JI0L 1VF7A 1FNUA 2F03A 4MTKA 3CCUA 5FJ8H 3SDZA 4HJ5A 3RD4A 3BVMA 1F2MA 4R4QA 2YU9H 1EZ8A 3GTKH 1JWMD 1CKNA 2WB1E 3NEMA 3I55A 1HNWL 3KK7A 3I4LA 5NUCA 5BN3A 2IL8A 5J39A 3T1HL 3CCSA 1B3QA 5I4DA 5KRUA 3A5ZB 4GOPA 2B29A 5ELOA 1VQ6A 1QB5D 4C3JB 1W6JA 1EY6A 1XWEA 2Z1CA 1EU3A 5LMNL 4BY1B 5C44G 4P75A 4DN4M 1JR0D 1SYFA 3NQIA 4OIJA 4NMZA 5IYCG 3MXNB 4NP5A 3CCLA 4A3MG 3H0GB 4Y52H 1VDZA 1EQQA 5M3FG 3R8BA 1K0SA 1CZGA 3IKJA 4A3JB 1S4ZA 4JI2L 3CQZB 4B3ML 2L15A 1M1KC 1XPOA 4JV5L 3ULPA 1A2TA 5C0XI 4YCWA 1WTXA 1OXSC 3A8IE 3VYSA 4DR2L 4X3UA 3OPOA 3HOUB 4H44C 4GKJL 2B63B 2E2HH 5KIXA 1AW7A 5LMNW 4JI1Q 3C46A 3U9SA 5C3WA 1Y1WG 3NQTA 2R93B 3HKZE 4DAYA 5EKLA 1VQPA 1ZYRD 4L5QA 4DR6L 1EY4A 3OWFA 2WFWA 4A3JH 2C9OA 3JAML 3CQZH 2Q2UA 3RZOB 3EIVA 3N6RA 4EQNA 1VQNA 5HURA 1TY0A 4OHJA 1RKNA 2RHSB 3NENA 1U5KA 2ZM6Q 1VQ5A 1MI2A 3HOUH 4Z9CB 4DV3Q 4IFDI 1N33Q 3KOJA 3PO3B 1K8OA 5IY0A 2R93H 4A3KH 3GTGB 2ASBA 3MEFA 5IGGA 1HUMA 3P7JA 2RQXA 4I7AA 4A75A 3HP3A 4PZ8A 1R9TB 1IL2A 4HIOA 3RZOH 1JB7A 1PRTB 4R8IA 5IWAQ 4C3IB 4AYBG 3D4RA 1HNXQ 5EKIA 3EBEA 1K8GA 4KD3A 2JK8A 1LTLA 1RCVD 3SEBA 1YVCA 5I6YA 1OXVA 3J80c 3PO3H 4DV5L 1TQOA 3TREA 3I4MH 4HN7A 2N78A 2F0WA 4DAMA 1DXMA 3GTGH 1BCPC 2P5ZX 2MO1A 4KHPQ 1L2FA 4KMUC 1Y1VB 5CV4A 1R9TH 3GTJB 1GKHA 1QJOA 1XTDA 5C3EB 4FF3A 3TRZA 4NW2A 3K58A 4C3IH 5D65A 1WOCA 1DD2A 3S15B 1DCZA 1UNSA 3BDCA 1IBML 2Z8LA 2EQSA 4HAEA 4B3TL 4BY7B 3Q22A 1C48A 4A93B 2YYZA 5C4XG 1MGSA 1G6PA 4P2CB 2I5LX 1YEZA 1TY2A 2WAQE 1FNWA 4G7OC 1T9HA 3FPUB 1F2LA 2K4KA 5M3MG 1Y1VH 5C3EH 2E74C 3FHWA 3CP0A 3S15H 4WJ3M 5FO7B 5BN5A 2UUAQ 4IJHA 3AMUA 3S2DB 2ZT9C 3A74A 5C0XH 4A93H 2UUCL 2ZJRA 3GV3A 2NN6I 4A3FG 1DOLA 1QNUA 1S5DD 1IW7C 3EQLC 1EWIA 5ELBA 5CV5A 1EYGA 1BF4A 4KKUA 2HIXA 1PH5A 1JOQA 2KCTA 3TP6A 4JG2A 2ALYB 2HDLA 4K0KL 4DV4Q 1VQMA 3TBIB 2E2IH 1I4GA 3F2CA 2J0TD 2MO0A 3NBIA 4ZYSA 1D2BA 3HS0C 1HJPA 1HZAA 2ES2A 2JA7G 3QB3A 1VQ7A 4F7XA 4IFDH 2HHHQ 3WWVA 3J80L 2JA8G 3KUPA 2N49A 4OWWB 1H9RA 3K7UC 1A8VA 4AYBE 1SEBD 4C1NI 1SYBA 3TZUA 1AFPA 2VQEQ 2KHJA 3VR5A 2GN5A 2A5HA 4QIWE 3IFDA 2Y0SG 2Z6BA 1TU2B 4A3DG 4GNXB 5EQ0A 1YJ9A 2Z0SA 3PUXA 1SMXA 2HUGA 5H1SE 2SNMA 2PZWA 1SYCA 4RKLA 1WTWA 4ZLTF 1PH9A 1WYDA 4Y7NB 3CXCA 4DV0L 3CCEA 2RCNA 5CR3A 4JOIC 1X32A 3I8ZA 4FXDA 4IO9A 1LV9A 1KD1C 1F2ZA 4PMBA 2IPKD 1QZHA 3MZ5A 2GVBA 3I4MG 2ENBA 5ELCA 3URYA 5E7NA 1SR3A 4DR3L 1ET9A 1SJED 2KJXA 3HOVG 1ZYRC 1SNDA 4FF2A 1SNOA 2WP8J 3Q0AA 2WB1B 2BA1A 4X3TA 4X65Q 5A35A 1NMFA 4LF9Q 3NTIA 4ILWA 4TVAB 5IOCA 1S3OA 1DONA 2KOLA 4YWKA 3TS2A 3KF6A 4FVMA 1PH2A 4DV6L 1MHWC 2L0CA 1A3TA 5IYBH 2NVQB 3HOYG 1XMQQ 5JAVA 4NB3A 3PV0A 1TWCB 1RJTA 3IL8A 4KY7A 1HQMC 3HEJA 2A19A 3Q23A 1KDCA 4LUOA 1GUOA 4DV7Q 4KY6A 1UEBA 1HNZQ 1F2YA 1X55A 4OX9Q 4A3IB 2SDFA 5EKKA 2CWAA 3D4DA 1LT3D 2EYMA 1B7YB 1SE2A 2EJMA 1PFSA 2V1CC 3I4OA 4NPSA 5JPMC 3J80i 4JOIA 4IZ8A 4UP8A 1B4OA 2NVQH 2VY3A 4JI5L 1MSHA 1TWCH 2B2TC 1Z9FA 4CJ0B 2H1EA 3L2PA 3QIAA 1JB3A 3NK9A 2AUJD 1ASYA 1ZXTA 2AUKA 3PO2B 5C4JB 1SN8A 3R2TA 4A3IH 1CKMA 2Q2HA 2CQOA 3UE0A 2BH8A 1Y8OB 4TQUS 2Q8TA 1ESFA 4JYAQ 2B2WC 3HOXB 2JA6B 2V4DA 1D7QA 1G291 1VS0A 3GDEA 2NZ1D 3M7NA 2CH4A 1N34L 1A15A 4BBSB 4QL5A 3V96A 2QILA 4G57A 4A3EG 4JI8Q 1GM5A 1F77A 2Q8RE 3CC4A 1EY0A 1S40A 1K83B 1PRTD 4LF8L 3PO2H 4DUYL 1IXRA 1UEAB 3K7AB 4KHZA 4IN3A 1PTOB 2K28A 3HOXH 3D8GA 1KDAA 3G48A 3V2TA 3J81i 4CDCC 4NDXA 2EE1A 4UDUC 2E76C 3MVVA 4K5VA 2X69A 1GO3E 1L1OB 3FKIB 3WOEA 2MPMA 2NVTB 1G2TA 4L5SA 3HOWG 2BE5D 3FP9A 2LMCB 1UE5A 1K83H 1KRSA 1VMPA 2B2TA 1SE3A 1JICA 2LS01 5L37A 1NJIC 1YITA 2HIVA 1ASZA 1PTOH 2FINB 4PV1C 2E5LQ 3J80E 1QCBD 1WD1A 3GTMB 3KLSX 2B2WA 5CMDA 5FLMG 1C0AA 4QGUA 2EVBA 4K6LA 1GUSA 3O13A 5M3FB 2NVTH 2UU9L 4LF7L 1B1ZA 2WAQB 1H9MA 1BVSA 2OQ0A 1JT8A 4I65A 3T13A 3QO2A 3OW7A 2EYPA 4ABNA 1EQTA 2MP1A 3OOCA 3MFYA 2CW0D 3E6ZX 4LK1C 3F2BA 5C44H 3M4YA 5IGBA 2D5DA 2MFIA 5IYCH 3NTHA 4ZKBB 1NY4A 5CV8A 2QEXA 1M90C 3GTMH 3M4PA 2R92B 3MAQA 1Y1WB 4A3MH 1KLUD 1D5MC 3CAMA 1IKMA 2K5DA 3T1YL 1ILQA 2K7VA 1Q12A 4DV2Q 1JQYD 5M3FH 3E0JA 3KDFA 1GJXA 1E24A 5IP7G 1TWHB 3W2DA 1TWAB 4LFBL 2KHSA 4GLXA 1O7YA 5DLQE 3BZCA 3K5OA 1H9JA 1LTRD 3J81E 4L5RC 1JOKA 3DHQA 3QR8A 3NE5B 4DKAC 3RN5A 2NWGA 3CW2C 1Y1WH 4XT3B 1VQJA 3VA7A 1HQRD 2A1AA 2D0PA 2Q2TA 2AQ3B 2GA4B 2G9HD 3H94A 4LFAL 1UWVA 4POFA 4UHVA 5HGQA 1TWHH 3EROA 2CHBD 5CORA 4WJ4A 4DXFA 1IYJB 1Q90A 2QW7A 4XQQA 4B3RQ 1TWAH 2UXBL 2K52A 4X66L 3OWEB 4AYBB 4TKOB 1STEA 4X62L 4RKBA 1ZKOA 5T1GA 1B53A 3KJPA 3TS0A 1BR9A 2FMCA 5GQOA 1RD9D 4QIWB 1CK1A 5AJ3Q 1PH3A 3AQQA 3P75A 4JK1C 3ICEA 1A2UA 5K5PA 3C1EA 4LMQD 4GKKQ 1WCMG 1EQVA 4A3GG 2VW9A 2VQFQ 3K5NA 4A3LG 3ZJYC 4QY7A 4X3KA 1LLRD 1CUKA 1HR0L 1SE4A 5BR8L 1L0XB 1SFOB 5EJWA 3VA5A 5FOBB 3G6EA 4V0BA 1FNVA 5COYA 5GAGC 4CKBA 1RODA 1R4QB 2VL6A 2F3WA 4CKEA 3GTKB 5D3DA 1X3QA 3T4AC 3KFUA 1X6OA 3M7GA 1H95A 1QG7A 5EPLA 4JBMA 3S24A 3K59A 4DV1Q 2UXDQ 2AHOB 5M3MB 4CBVA 4TRDA 4HCEA 1YZ6A 4QB4A 2PI2E 3NBHB 4HJ9A 4M8AA 3BJUA 3KF8B 4EGVA 2B2VC 1LUZA 3NTKA 2SOBA 2F0TA 1SFOH 1J5EL 1SNQA 4HR7B 1HR0W 3S9WA 3R93A 1K3BC 2F0IA 1QE6A 4FNFA 2K04A 3D0FA 5C4XH 1I6HB 1UE1A 3UE1A 2B2UC 1PVOA 2K5QA 4O0AA 4B3SL 5T1IA 5ISRA 4FF1A 3LWUA 1O7LA 1HTPA 4JI0Q 5M3MH 3MXNA 1SNMA 1NMGA 3P20A 1PRTC 4JI7L 1YHBA 2E2HB 1EEFD 2N3SA 4XXEA 4NXML 1HNWQ 3EFXD 3T1HQ 4JCVE 5GADC 1BCPF 4BA2I 1II3A 1YHAA 2JA7B 1I6HH 1SNPA 4A3FH 1HZBA 3DWAA 1QUQA 2PW5A 1WTPA 1PH4A 1V1QA 4KY5A 1A0IA 2JA8B 5LMNQ 5KEEA 5J22A 1C4QA 2DJFC 3L0OA 4MZ9A 2BE5C 1E1OA 5GROA 3PIPA 2IX3A 4PZ7A 2O2LD 2FHTA 1HCZA 4LFCL 1WFQA 3WOFA 4TSSA 1ENCA 4R4IA 1Q86C 2R7FA 4P73A 5C4ZA 4YHHL 2K05A 2Y0SB 2BA0A 4CDFC 3MC0B 2LFNA 4JI2Q 3PUWA 4A3DB 1GUWA 4B3MQ 5IP9G 4A3KB 2KENA 2B2VA 4GLVB 3VR2A 3D6WA 3W5OA 2JA7H 1I3QH 4JV5Q 2PQAB 3SK4A 1VQEA 4DR2Q 3OTOL 1VQDA 2A68D 1X3GA 3ITPA 2JA8H 1K0RA 5HGTA 3A8JE 4GKJQ 4YWLA 3EN2A 1LT4D 3X3MA 5E3FA 4JI6L 2F0EA 2B2UA 4ZUJA 2NTTA 1MJCA 4RHSA 3C3LA 5ELDA 4DR6Q 1KQSA 1NNXA 5FO8B 1EFID 2NVYH 4DR4L 3ONAB 2IX1A 2CW0C 4A4IA 1EWCA 4A3DH 3I4MB 1XNQL 1LM0A 4QUCA 4DAYB 4HJ7A 4AH6A 1E2VA 1I94L 4R8NA 3HOVB 1EZ6A 2WACA 4C2MB 2E2DC 4DFAA 4FP5D 1DJRD 1E2WA 4IUTA 2VZAA 3HKSA 5AFWA 4GS3A 3HOZG 1WI5A 2PNHA 4GLAC 1LT6D 2E2JB 4R4TA 2PCFB 2EDGA 2QDLA 1GHKA 3CRLC 1Q1EA 5JPNC 1K8AC 3HOYB 4DA2A 1U0LA 1X54A 1UUPA 4IUQA 4QF4A 5HY6A 1HH2P 3HOVH 2EYJA 2D2CC 1LABA 1FYCA 2R6GA 4C2MH 4BWGB 1E2ZA 3RLFA 4DV5Q 2Q2IA 4N9PA 4XTCS 4JI3L 3VYUA 1SYEA 1IL8A 2WKCA 4X64L 4DR1L 2E2JH 4IPHA 3DWQA 2EOTA 2NBFA 1CT1D 2BDNA 2K03A 1RTOA 2EYLA 3ULLA 3HOYH 2MHVA 2C35B 1BDOA 1MBYA 2H4OA 4GNXC 5EGTA 4RH6A 3STBD 2YTXA 1IBMQ 1GHJA 3PF4A 3BG3A 2DUDA 4B3TQ 3NELA 1VQIA 5KNCA 1JOOA 1KAWA 1KIXA 2DGYA 1TIID 2KQ3A 1DM0B 1JWUD 2KEDA 3CD6A 2NVXB 3J7YW 2PQEA 5J3BA 2E2IB 1KTKA 2IJ0A 1V8QA 3X3NA 1OTCA 4DR5L 3J81c 1IBLL 4RHRA 3RR5A 1KLGD 4IURA 1L0WA 3SVMA 1LO5D 1JMCA 4A3EB 3MFGA 1STHA 2EXDA 4DPGA 1EIFA 4DK1A 4R4CA 3FEWX 3CU7A 1IZ6A 1PMRA 1BBWA 5ELNA 3EJIA 1K3RA 5FLXc 2UUCQ 2NVXH 4DK6C 5A2QE 2F52A 1FJGL 3KBGA 2RCFA 4YCUA 2Z4HA 2UXCL 3J7ZC 2AWNA 1JC7A 1QOHA 2PZTA 4KJNA 2PW7A 4FXGC 2WINB 4DNIA 5IGCA 1R4PB 4PG3A 4A3EH 1VQFA 3RUZA 4C3JG 3U4VA 1ENAA 4LUVA 3OW2A 3U4ZA 3VDYA 4K0KQ 3F1ZA 5JJKA 2XRSD 1S5BD 2OWOA 4JI4L 3HOWB 3EVQA 4BY1G 1SROA 1OXTA 2HCIA 3BYYB 4YIJA 1S5ED 4GNXA 2CFMA 4IPGA 2MNAA 3K80C 4LF6L 3H0GG 2K14A 4DK0A 3I4NG 1SYDA 4QJFA 3FMCA 1VF5C 3PMFA 3CPWA 3ERSX 3HG9A 4N8FA 3TP5A 4FXKC 2IHEA 4LF5L 1IBKL 4OO1G 2ZXOA 3I56A 2O5JC 3PIO3 1FR3A 1PYSB 3BVZA 5DM63 3A54A 3G6JB 4LF4L 2TSSA 3HOWH 3UDFA 3IRBA 1MSGA 1VQ4A 1QZGA 1F9SA 4PZ6A 5JOBA 2B63G 3GTQH 4L5TA 2XWJB 1S5FD 1PZKD 2XSCA 1NCVA 5IGEA 4BBRG 4LUZA 4G7HC 1D5ZC 3JC66 3RN2A 4WJWA 3TQYA 1FGBD 3D3RA 4YY3L 2PPBC 2F0KA 3HRZC 4DV0Q 1W2BA 4B08A 3J81L 1WVLA 1ESRA 5FLMH 4KKSA 2NTSA 1T5XD 3Q8DA 1QWYA 3MXGA 2ATWA 2OTJA 2A68C 4MNOA 1LYLA 5LMUL 1FGUA 3MEHA 2EY5A 1EL0A 5FO9B 1JE4A 2PNRC 2X6LA 4DF7A 4KKTA 4DR3Q 4E6IA 1EY9A 5FLXL 3V05A 4PMCA 1BKBA 3NWSA 1RL2A 4DU9A 1YNXA 3I91A 4K6DA 4HMJA 5K36G 1IYUA 3H91A 3RLNA 3M9BA 1A63A 1MD2D 1Q8IA 2A69D 1WTOA 1CM9A 5JVH3 5IP7H 1G8ZD 1ENFA 1PFNA 2VUMG 1I50H 5EBDA 1TWGH 4DV6Q 1Q81C 2JA9A 1W3SA 2K5NA 1N36L 1Q1BA 2F1MA 1SDFA 2XRQD 3F2DA 3TEHB 2R7ZG 1B2TA 2AWOA 3SK5A 2M2LA 4P72A 3CC2A 2PMZB 1SE8A 1LTGD 1CA6A 3WDNA 5M9OA 3LNNA 4NXNL 3KF6B 1BBUA 3S2HB 2CQAA 4K5XA 4RAUC 1CSQA 1E3PA 2F0OA 3H3VI 3QOLA 5JJLA 1X3PA 1AN8A 4HSPA 3QOJA 1VQLA 4QCLA 1A3VA 1U4PA 1FD7D 4BY7G 4KTAA 4UY8C 1XXGA 2EXZA 1YNND 3W1GA 3L3OC 3TMEA 2Y0SE 1CSPA 1EEID 1PH7A 3SE0A 4JI5Q 2HDMA 2K32A 2C5CA 1FVIA 4R9WA 3RNUA 1TR5A 1M8AA 1N32L 3S2HH 1PDQA 4UP7A 4ZQ3A 2VNUD 3KLSA 4N8X1 1SRUA 2MQHA 4OL7A 2EZVA 1JCKB 1VQCA 5DEHA 2LKVA 3FPPA 2A73B 4PMWA 1EFWA 2B8GA 2OTLA 4CHTB 1KL9A 3A5UA 3RZDH 1WCMH 5G3LD 3STBC 4DR7L 4A3GH 3OMGA 4A3LH 2FXQA 5M5YB 1N34Q 2K5WA 2N8NA 3BYTB 1GXDC 3S1NH 1CHQD 2KHIA 4HIDA 4L6TB 4POGA 4PQXA 2BCOA 1VQOA 3VR3A 1H9SB 3C1FA 4LF8Q 4DUYQ 2HT1A 1I4XA 1F9PA 3TDQA 3T53B 3AYHB 2IY5B 2HQEA 5CV7A 2OQKA 5KGUA 3AEVA 2JSOA 1AZPA 1PLFA 2EIFA 2R7DA 5M5YH 1X9NA 1TVXA 2RSNA 2JN4A 2IWHA 5C44B 1TKWB 2LXJA 4HSVA 2F0JA 3DM1A 3NSWA 4A3MB 2OXPA 4K2KA 3QWNA 3CHBD 5D3IB 2QDBA 2UUBL 3K5MA 3S17B 3E3XA 4WORA 2KVMA 1IYVA 2BH2A 3A7LA 1IKLA 3LX0A 2ZTEA 3PUVA 1SYGA 4RCOA 4R1JA 4XDXA 5KNDA 1D1KA 3K81C 5JVG3 1Y8PB 2NUCA 2RA4A 1EYAA 1OXXK 4KN7C 1JJ2A 2UU9Q 4LF7Q 2DJGC 3FVQA 4DUZL 2RBMA 3I90A 2EJGC 4M1UB 1EY8A 3S17H 2F0VA 5IT9E 3H3VH 5M5WH 1PHJA 2XTIA 1QILA 1VCIA 1MKHA 3K0XA 4J15A 2ICEC 3TSSA 2LSSA 3T1YQ 2ID0A 4IOCA 1JORA 3M4OB 3I72A 1CFMA 4N9TA 3IAYA 2EY6A 5D14A 1AZQA 4CGYB 2NN6G 1L0YB 5IYDG 1JJCB 5IP9H 2QGQA 4AQYL 4LFBQ 2D9UA 2F0FA 3CCQA 3U50C 1P8LA 1HXYD 1NSNS 2PO4A 1PRTF 4CKCA 5FLXE 2F3VA 1I4PA 5I9OA 1NBWA 4HTHA 2E8GA 4ZKCB 2O5IC 1J6QA 1STBA 5IODA 1ZEQX 2O4XA 1TWFH 3HOZB 3M4OH 2GVAA 4LFAQ 1O78A 4RFBA 3U9OA 4XQNA 1KNEA 2JE6I 1EY7A 3K8AA 2EY1A 1NAPA 4C3HG 4J8QA 2IHFA 1LTID 1XMOL 3GTPB 2UXBQ 4X66Q 2F4VL 4X62Q 1V1PB 4K8JA 2F3IA 4OONA 4CDDC 2FFKB 1XYIA 2F0GA 2I0QA 3H6MA 1SXTA 4JPBW 2A69C 1X3FA 3F2UA 4X6AH 4GN4B 4CJ1B 1K8MA 2A8VA 2RKSA 1X65A 3CRKC 2EYOA 2BOSA 4MHEA 3HOZH 4JBJA 1NTGA 3AFQA 3HKZG 1EUJA 4IUNA 1N8RC 4DK3C 3KBXA 5C4XB 1XNRL 3CMAA 1G6ZA 5EPJA 3NBHA 3HZXA 3CCRA 2Q8IB 4J6HA 3KF8A 2MUYA 3GTPH 5IE8A 1HR0Q 3SR1A 2K50A 1C9OA 2Z6KC 3ND8A 3OYYA 5BR8Q 2JA6G 3Q6SA 4L63B 3J7A5 3FDTA 3G7LA 4OXPA 3A8KE 1Q8KA 2LXKA 3T16A 4BS9A 4O42A 4BBSG 2G9DA 2N88A 4U673 1YNNC 1YNJD 3PUZA 2LY7A 3FRPB 1U4LA 4MIUA 1HZCA 2XGTA 1CTMA 5A2QL 5I9PA 2N55A 4JW0A 4A3FB 4A3BG 1PH8A 3I73A 2WKDA 3KJOA 1EOTA 5EBCA 1TS5A 1NE3A 2YV5A 4K8IA 2MJ8A 4KD4A 1Y8NB 1A3UA 1SLJA 1J5EQ 2X6GA 3PF5A 2J4XA 4LAAA 3DLLA 4A3CG 2AMCB 3F8TA 2K01A 1PXUA 1Z7TA 4FDBA 3FKIG 4IPDA 3TP7A 4B3SQ 5JJIA 4U68A 4IALA 1Q46A 1I3QB 4KN4C 2CWPA 1RF2D 3GD7A 2DNCA 4G4KA 1CKNB 3HFZB 4JI7Q 2JA5G 1SMYD 1AH9A 3E0EA 3UI2A 3D31A 4NXMQ 1W6KA 4ME3A 3TZDA 4GOPB 2PMZE 2E75C 3OMCA 3LGJA 5CBEE 1C8CA 1Y69U 1YI2A 2ZJQA 2KUMA 1TT2A 4LW1A 2PQAA 5IGFA 3KYHC 3I4NB 2Z6KA 1OXUA 2NVYB 2K75A 3PGZA 3ULJA 5IIFA 3CCJA 3S1QB 5DM73 1SJHD 4OIKA 1K73C 4JC0A 3J7AV 4JI1L 4KJOA 2QF7A 2WAQG 2EJFC 2R3ZA 3DEOA 3DMUA 4Q5VA 4UP9A 1TS3A 3L9AX 1SSOA 4XIGS 2QKIC 4C3JH 3T56B 4HCSA 4LFCQ 1AP0A 1QUQB 2K5VA 2L55A 2VB2X 2A6ED 4RWSC 3NP8A 3G4SA 4BY1H 3CPFA 4YHHQ 4IQZA 2F0QA 1KAAA 2A74C 4K14A 2R92G 1KXLA 1PTOD 2ZM6L 3H0GH 4BBRB 3I4NH 1HRJA 3M4QA 5LL6X 3OTOQ 3QJYA 4DV3L 2BDOA 1N33L 3S1QH 4G7ZC 3AFPA 2I46A 4OO1H 3OSOA 2L9HA 4JI6Q 2H5XA 2KA7A 1N9WA 1EIYB 1HFNA 5ELEA 5DNFA 2M00A 4NKLA 2YTYA 2RDGA 3NPPA 1KC8C 1K9MC 1WJJA 1SAPA 2JJQA 1VQAA 4DR4Q 1JJGA 2B63H 3R2IA 4I7ZC 1A6XA 3ND9A 1QNKA 1DYQA 5IWAL 2PZUA 1XNQQ 1EY5A 1HNXL 1VMCA 2RDHA 1MIUA 1U4RA 4BBRH 1AEXA 2RSOA 1I94Q 4GZYC 3BVGA 3PSIA 4RGNA 5E4WC 1I6VC 4BXXG 1EIGA 5CV6A 4KHPL 1H9KA 1U9RA 2VUMB 3N52A 1CQFA 2D62A 1XJVA 1RDPD 4DXGA 1NR4A 2F0HA 1STNA 4ODGA 2R7ZB 4IUUA
chains in the Genus database with same CATH topology
5FK9C 1HTLD 1PFMA 2B39A 4ME5A 4MN3A 1KABA 4X3SA 5E1FA 1ML0D 4BA1I 4F87A 4H13C 1TS4A 5K36H 1PZID 2L4NA 5C6AA 3PUYA 3C2PA 3BDLA 3BS1A 4IUPA 5E4XA 4K2LA 5I6WA 3S16B 5M5XB 3P1HA 2F0LA 4IUVA 2VXWA 1Z47A 5EPKA 2K6AA 1HHVA 2Z4IA 1HPCA 2WV6D 3AB9A 4ZRZA 3HGBA 3J7AF 5FKAC 1D5XC 1ET6A 5KNBA 4UAIA 2ZXPA 2DY8A 4C56C 3R3OA 4WFN3 2F0UA 2SNSA 1RHPA 1Z6HA 1PTOF 5BN4A 1WTVA 4H7BA 5C3XA 2B8FA 3EA6A 1BO0A 1E0BA 1YNJC 2IX0A 2CVRA 3ERQA 3ZYYX 2DNEA 5CC4A 1CI3M 3GTQB 2HCCA 2L1BA 3SHLA 2QEJC 1BCPB 1I4QA 1XTCD 5IGDA 5LL6S 1KNAA 2R61A 3MWYW 4XQJA 1DZ1A 4EQOA 4J1MA 1GUNA 1SMYC 1S5CD 2EY2A 1LTSD 1U4MA 2AQ2B 5C5LA 3K6OA 5IT9L 2FJ2A 2EYFA 1IHZA 4DGZA 3SXHA 3GTOB 4F8MA 2KCNA 3A56A 1LTAD 3MHBA 1DOKA 1LTTD 4WRDA 1V43A 2KEEA 5ELFA 4Q0FA 3TP8A 2JEAI 5C5MA 1LT5D 4RCNA 1BXTA 3LWEA 1I50B 1TWGB 5J1ZA 4XYQA 2A6EC 3TN2A 3GO5A 3JAME 4RGOS 4ZUIA 1CZWA 4DNRB 2B2YC 1B9MA 2K33A 1DOMA 3D4WA 1PTOC 1UAPA 1ICWA 3Q24A 2SEBD 1B3AA 2IW3A 2ZXRA 3VYRA 3H09A 1GUGA 4C3IG 3MXPA 2WIIB 4ULLA 1STAA 1G2SA 3RMHA 3S14B 1BOSA 4CJ2C 3PIP3 3S1RB 4K5WA 4QMGA 3OHXC 3E5SA 1D1IA 3VYTA 2TMPA 1WTQA 2J7ZA 1I4HA 2NYZD 2FMMA 1EU4A 3AU7A 2NN6H 4C3HB 1HA5A 2JP1A 2IT1A 1BNZA 2F0NA 5CV9A 5C0XJ 3RZDB 1WCMB 2OF1A 4A3GB 1PYWD 4ZK9B 2F0DA 5C0XG 3NWTA 3H3VC 4DNTB 1CQVA 3S1NB 4KI0A 3W3AA 5DAUA 2EPBA 3GP7A 3HKZB 2KCCA 4ZAIA 3IFTA 1B50A 4O1NA 1EYCA 2F4IA 2A6HD 2B2YA 3DWPA 2RDFA 1GOZA 4HEDA 4C1NK 4IFDJ 2K1BA 4RA8A 1OO9B 1H9SA 2XN9C 4IFDG 2XVSA 2NB0A 5JEAH 3GQBA 3KLRA 3SK6A 2XNAC 1BBXC 4KV6A 1M4VA 1BUVT 4DAVA 5TSSA 4A3BB 5C4HA 1WTRA 3MTSA 1O80A 1KDBA 4PNYA 3GV6A 1LACA 1Q3LA 2MGSA 1RTNA 2F0MA 3K5LA 4FYDA 1EYDA 1HUNA 2F0PA 1B44D 4KK7A 4V190 1O7ZA 3OIQA 2KECA 3L7ZC 1LTBD 2JEBI 3BDOA 1F9QA 2JYOA 2JA5B 3K57A 3VR4A 3A7AB 5M5WB 2EYHA 1D6EC 4KHVA 2L5TA 4F88A 3MA2B 3NXWA 3DUZA 3M3YB 5F2DA 3NHHA 3S1MB 2I07B 1STYA 1BQQT 2DY7A 3SK8A 2RVLA 5KYIA 2AQ1B 3K0YA 1J8IA 1CA5A 1TWFB 1TS2A 4B9XA 4QUFA 2L11A 4XYOA 1WD0A 4RGMA 4L8JA 4LJZC 3CKIB 1F9RA 3I3CA 1HA6A 4S3SA 4EQPA 2ICIA 1HFGA 3I70A 5CBAE 5G3LF 5CYUA 3DEPA 1ILPA 1BCPD 1EIHA 1PFBA 2M9VA 1J9OA 1V1OA 3NUCA 3QG1A 3OIPA 1V1PA 5LHY1 2L12A 1JWSD 3MXUA 4FO2A 3M85A 2VB3X 2XWBB 1CHPD 4H0LC 4RGTA 2OT2A 2XIWA 5JEAJ 4HMIA 2QCPX 3A55A 1XX8A 1SBBB 4OO1I 5JEAG 4ID6A 1T5EA 4XT1B 1GUTA 3D6CA 5I2XA 5JJZA 1G91A 1STGA 3GTLB 4OGQC 1EWHA 3VR6A 4DAPA 3DXJC 2PYKA 3BZDB 2F0SA 2JXMB 1IW7D 1PZJD 4B9WA 4FF4A 2YU9B 3T51B 4EVOA 4JBWA 1NUCA 1B9NA 1SNCA 5KYLA 5I2YA 2DN8A 2OEOA 5CGKA 1I4RA 1NR2A 2A6HC 1ONLA 1VF7A 1FNUA 2F03A 3SDZA 3RD4A 3BVMA 1F2MA 1EZ8A 1JWMD 3KK7A 3I4LA 5NUCA 5BN3A 2IL8A 5J39A 5I4DA 5KRUA 1QB5D 4C3JB 1W6JA 1EY6A 1XWEA 2Z1CA 1EU3A 4BY1B 4DN4M 1JR0D 1SYFA 3NQIA 4OIJA 4NMZA 4NP5A 3H0GB 1VDZA 3R8BA 1CZGA 3IKJA 4A3JB 1S4ZA 3CQZB 1A2TA 5C0XI 1WTXA 1OXSC 3A8IE 3VYSA 4X3UA 3OPOA 3HOUB 4H44C 2B63B 5KIXA 1AW7A 3C46A 3U9SA 5C3WA 3NQTA 2R93B 4DAYA 5EKLA 1ZYRD 1EY4A 3OWFA 2C9OA 3JAML 3RZOB 3N6RA 4EQNA 5HURA 1TY0A 4OHJA 1RKNA 1MI2A 4Z9CB 4IFDI 3PO3B 1K8OA 3GTGB 5IGGA 1HUMA 3P7JA 2RQXA 3HP3A 1R9TB 1PRTB 4R8IA 4C3IB 3D4RA 5EKIA 4KD3A 1RCVD 3SEBA 5I6YA 1OXVA 1TQOA 4HN7A 2F0WA 1DXMA 1BCPC 4KMUC 1Y1VB 5CV4A 3GTJB 1QJOA 5C3EB 4FF3A 4NW2A 3K58A 5D65A 1DD2A 3S15B 1DCZA 1UNSA 3BDCA 2Z8LA 4HAEA 4BY7B 3Q22A 1C48A 4A93B 2YYZA 1MGSA 4P2CB 1TY2A 1FNWA 4G7OC 3FPUB 1F2LA 2E74C 5FO7B 5BN5A 3AMUA 3S2DB 2ZT9C 5C0XH 3GV3A 2NN6I 1DOLA 1QNUA 1S5DD 1IW7C 3EQLC 5ELBA 5CV5A 1BF4A 4KKUA 1JOQA 3TP6A 2HDLA 3TBIB 1I4GA 2J0TD 3NBIA 4ZYSA 1D2BA 3HS0C 3QB3A 4F7XA 4IFDH 3J80L 3KUPA 1H9RA 1SEBD 4C1NI 1SYBA 3TZUA 1AFPA 3VR5A 2A5HA 3IFDA 1TU2B 5EQ0A 3PUXA 2HUGA 2SNMA 2PZWA 1SYCA 4RKLA 1WTWA 4ZLTF 4Y7NB 5CR3A 1X32A 3I8ZA 4FXDA 1LV9A 1F2ZA 4PMBA 2IPKD 3MZ5A 2ENBA 5ELCA 3URYA 1ET9A 1SJED 2KJXA 1ZYRC 1SNDA 4FF2A 1SNOA 2WP8J 3Q0AA 2WB1B 2BA1A 4X3TA 5A35A 3NTIA 4ILWA 5IOCA 1DONA 2KOLA 4FVMA 2L0CA 1A3TA 2NVQB 5JAVA 3PV0A 1TWCB 1RJTA 3IL8A 4KY7A 1HQMC 3HEJA 3Q23A 1KDCA 1GUOA 4KY6A 1F2YA 4A3IB 2SDFA 5EKKA 3D4DA 1LT3D 2EYMA 1SE2A 2EJMA 5JPMC 4IZ8A 1B4OA 1MSHA 2B2TC 4CJ0B 2H1EA 3QIAA 1JB3A 3NK9A 2AUJD 1ZXTA 2AUKA 3PO2B 5C4JB 3R2TA 1Y8OB 4TQUS 2Q8TA 1ESFA 2B2WC 3HOXB 2JA6B 2V4DA 1G291 3M7NA 2NZ1D 1A15A 4BBSB 3V96A 2QILA 4G57A 1F77A 2Q8RE 1EY0A 1K83B 1PRTD 1UEAB 3K7AB 4KHZA 4IN3A 1PTOB 2K28A 3D8GA 1KDAA 3V2TA 4NDXA 2EE1A 4UDUC 2E76C 3MVVA 4K5VA 2X69A 3FKIB 3WOEA 2MPMA 2NVTB 1G2TA 2BE5D 2LMCB 1VMPA 2B2TA 1SE3A 1JICA 2LS01 1PTOH 2FINB 4PV1C 3J80E 1QCBD 1WD1A 3GTMB 3KLSX 2B2WA 5CMDA 2EVBA 4K6LA 1GUSA 3O13A 5M3FB 1B1ZA 2WAQB 1H9MA 4I65A 3T13A 3QO2A 3OW7A 2EYPA 4ABNA 1EQTA 2MP1A 3OOCA 3MFYA 2CW0D 3E6ZX 4LK1C 3M4YA 5IGBA 2D5DA 3NTHA 4ZKBB 5CV8A 2R92B 3MAQA 1Y1WB 1KLUD 1D5MC 1IKMA 2K5DA 1ILQA 2K7VA 1Q12A 1JQYD 3E0JA 1GJXA 1TWHB 3W2DA 1TWAB 2KHSA 1O7YA 3K5OA 1H9JA 1LTRD 3J81E 1JOKA 3DHQA 3NE5B 2NWGA 4XT3B 3VA7A 1HQRD 2AQ3B 2GA4B 2G9HD 3H94A 3EROA 2CHBD 5CORA 4DXFA 1Q90A 4XQQA 3OWEB 4AYBB 4TKOB 1STEA 4RKBA 1ZKOA 5T1GA 1B53A 1BR9A 2FMCA 1RD9D 4QIWB 1CK1A 3P75A 4JK1C 1A2UA 5K5PA 3C1EA 4LMQD 1EQVA 3K5NA 4X3KA 1LLRD 1SE4A 1L0XB 1SFOB 5EJWA 3VA5A 5FOBB 4V0BA 1FNVA 5COYA 4CKBA 1RODA 1R4QB 2F3WA 4CKEA 3GTKB 5D3DA 1X3QA 3T4AC 3M7GA 1QG7A 5EPLA 3K59A 5M3MB 4CBVA 4TRDA 4HCEA 4QB4A 4M8AA 4EGVA 2B2VC 3NTKA 2SOBA 2F0TA 1SNQA 4HR7B 3S9WA 3R93A 2F0IA 1QE6A 4FNFA 2K04A 1I6HB 2B2UC 2K5QA 5T1IA 5ISRA 4FF1A 3LWUA 1O7LA 1HTPA 3MXNA 1SNMA 3P20A 1PRTC 2E2HB 1EEFD 4XXEA 3EFXD 1BCPF 4BA2I 1II3A 2JA7B 1SNPA 3DWAA 2PW5A 1WTPA 4KY5A 2JA8B 5KEEA 5J22A 1C4QA 2BE5C 2IX3A 2O2LD 2FHTA 1HCZA 3WOFA 4TSSA 1ENCA 5C4ZA 2K05A 2Y0SB 2BA0A 3MC0B 2LFNA 3PUWA 4A3DB 1GUWA 4A3KB 2B2VA 3VR2A 3D6WA 3SK4A 2A68D 3ITPA 5HGTA 3A8JE 1LT4D 3X3MA 5E3FA 2F0EA 2B2UA 4ZUJA 2NTTA 4RHSA 3C3LA 5ELDA 5FO8B 1EFID 3ONAB 2IX1A 2CW0C 1EWCA 3I4MB 4QUCA 1E2VA 4R8NA 3HOVB 1EZ6A 2WACA 4C2MB 2E2DC 4DFAA 4FP5D 1DJRD 1E2WA 4IUTA 5AFWA 2E2JB 1LT6D 2PCFB 2EDGA 1GHKA 3CRLC 1Q1EA 5JPNC 3HOYB 4DA2A 1UUPA 4IUQA 4QF4A 2EYJA 2D2CC 1LABA 1FYCA 2R6GA 4BWGB 1E2ZA 3RLFA 4XTCS 4N9PA 3VYUA 1SYEA 1IL8A 2WKCA 3DWQA 2EOTA 2NBFA 1CT1D 2BDNA 2K03A 1RTOA 2EYLA 2MHVA 1BDOA 1MBYA 2H4OA 5EGTA 4RH6A 1GHJA 3BG3A 5KNCA 1JOOA 1TIID 2KQ3A 1DM0B 1JWUD 2KEDA 2NVXB 3J7YW 2PQEA 2E2IB 1KTKA 2IJ0A 1V8QA 3X3NA 4RHRA 1KLGD 4IURA 3SVMA 1LO5D 4A3EB 3MFGA 1STHA 4DK1A 3FEWX 3CU7A 1PMRA 3EJIA 5A2QE 3KBGA 2Z4HA 2AWNA 1JC7A 1QOHA 2PZTA 4KJNA 2PW7A 2WINB 4FXGC 5IGCA 1R4PB 3RUZA 4C3JG 1ENAA 2XRSD 1S5BD 3HOWB 3EVQA 1OXTA 2HCIA 3BYYB 4YIJA 1S5ED 4DK0A 1SYDA 3FMCA 1VF5C 3PMFA 3HG9A 3TP5A 4FXKC 4OO1G 2ZXOA 2O5JC 3PIO3 1FR3A 3BVZA 5DM63 3A54A 3G6JB 2TSSA 1MSGA 1F9SA 5JOBA 2XWJB 1S5FD 1PZKD 2XSCA 1NCVA 5IGEA 4G7HC 1D5ZC 4WJWA 1FGBD 3D3RA 2PPBC 2F0KA 3HRZC 4B08A 3J81L 1WVLA 1ESRA 4KKSA 2NTSA 1T5XD 1QWYA 3MXGA 2A68C 3MEHA 2EY5A 1EL0A 5FO9B 1JE4A 2PNRC 2X6LA 4DF7A 4KKTA 4E6IA 1EY9A 5FLXL 3V05A 4PMCA 3NWSA 4DU9A 3I91A 4K6DA 4HMJA 5K36G 1IYUA 3H91A 1MD2D 1Q8IA 2A69D 1WTOA 1CM9A 5JVH3 1G8ZD 1ENFA 1PFNA 5EBDA 1Q1BA 2F1MA 1SDFA 2XRQD 1B2TA 2AWOA 3SK5A 2M2LA 2PMZB 1LTGD 1CA6A 3WDNA 5M9OA 3LNNA 3S2HB 2CQAA 4K5XA 4RAUC 2F0OA 3QOLA 1X3PA 1AN8A 4HSPA 3QOJA 4QCLA 1A3VA 1U4PA 1FD7D 4KTAA 1XXGA 2EXZA 1YNND 3L3OC 3TMEA 1EEID 3SE0A 2HDMA 2K32A 2C5CA 4R9WA 1TR5A 1M8AA 1PDQA 4ZQ3A 2VNUD 3KLSA 4OL7A 2EZVA 1JCKB 5DEHA 2LKVA 3FPPA 2A73B 4PMWA 2B8GA 4CHTB 5G3LD 3OMGA 5M5YB 2K5WA 3BYTB 1GXDC 1CHQD 4L6TB 4PQXA 2BCOA 3VR3A 1H9SB 3C1FA 1I4XA 1F9PA 3TDQA 3T53B 2HQEA 5CV7A 5KGUA 2JSOA 1AZPA 1PLFA 1TVXA 2RSNA 2IWHA 5C44B 1TKWB 4HSVA 2F0JA 3DM1A 3NSWA 4A3MB 2OXPA 4K2KA 3QWNA 3CHBD 5D3IB 2QDBA 3K5MA 3S17B 4WORA 2KVMA 1IYVA 3A7LA 1IKLA 3LX0A 3PUVA 1SYGA 4RCOA 4XDXA 5KNDA 1D1KA 5JVG3 1Y8PB 2NUCA 2RA4A 1EYAA 1OXXK 4KN7C 3FVQA 2RBMA 3I90A 2EJGC 4M1UB 1EY8A 2F0VA 5IT9E 1QILA 1VCIA 2ICEC 3TSSA 2ID0A 1JORA 3M4OB 3I72A 1CFMA 4N9TA 3IAYA 2EY6A 5D14A 1AZQA 4CGYB 2NN6G 1L0YB 2D9UA 2F0FA 1HXYD 1NSNS 2PO4A 1PRTF 4CKCA 5FLXE 2F3VA 1I4PA 5I9OA 4HTHA 4ZKCB 2O5IC 1STBA 5IODA 1ZEQX 2O4XA 3HOZB 1O78A 4RFBA 3U9OA 4XQNA 1KNEA 2JE6I 1EY7A 2EY1A 1NAPA 4C3HG 4J8QA 1LTID 3GTPB 1V1PB 4K8JA 2FFKB 1XYIA 2F0GA 3H6MA 1SXTA 2A69C 3F2UA 4CJ1B 1K8MA 2RKSA 3CRKC 2EYOA 2BOSA 4MHEA 4IUNA 3KBXA 5C4XB 1G6ZA 5EPJA 3NBHA 3HZXA 2Q8IB 4J6HA 3KF8A 2MUYA 3SR1A 3ND8A 3Q6SA 4L63B 3FDTA 3G7LA 3A8KE 3T16A 4BS9A 4O42A 2G9DA 2N88A 4U673 1YNNC 1YNJD 2LY7A 3PUZA 3FRPB 1U4LA 4MIUA 1CTMA 5A2QL 5I9PA 2N55A 4A3FB 3I73A 2WKDA 1EOTA 5EBCA 1TS5A 4K8IA 2MJ8A 4KD4A 1Y8NB 1A3UA 2X6GA 2J4XA 4LAAA 2K01A 1PXUA 1Z7TA 3TP7A 4U68A 4IALA 1I3QB 4KN4C 1RF2D 3GD7A 2DNCA 4G4KA 1SMYD 3UI2A 3D31A 1W6KA 3TZDA 2E75C 3OMCA 5CBEE 1C8CA 1Y69U 2KUMA 1TT2A 3I4NB 5IGFA 1OXUA 2NVYB 5IIFA 3S1QB 5DM73 1SJHD 4OIKA 3J7AV 4KJOA 2QF7A 2EJFC 2R3ZA 3DEOA 3DMUA 4Q5VA 1TS3A 3L9AX 1SSOA 4XIGS 2QKIC 3T56B 4HCSA 1AP0A 2VB2X 2L55A 2A6ED 4RWSC 3NP8A 4IQZA 2F0QA 1KAAA 2A74C 4K14A 1PTOD 4BBRB 1HRJA 5LL6X 3QJYA 2BDOA 4G7ZC 2I46A 4OO1H 3OSOA 2L9HA 2KA7A 1HFNA 5ELEA 5DNFA 2M00A 4NKLA 2RDGA 3NPPA 1SAPA 3R2IA 4I7ZC 1A6XA 3ND9A 1QNKA 1DYQA 2PZUA 1EY5A 1VMCA 2RDHA 1U4RA 1AEXA 2RSOA 4GZYC 3BVGA 4RGNA 5E4WC 1I6VC 1EIGA 5CV6A 1H9KA 1U9RA 2VUMB 3N52A 1CQFA 2D62A 1RDPD 4DXGA 1NR4A 2F0HA 1STNA 4ODGA 2R7ZB 4IUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKC B;  1WD1 A;  4X3K A;  1NR2 A;  1J8I A;  1CA5 A;  1B50 A;  1PFM A;  4IUR A;  1F9P A;  1HUM A;  3UI2 A;  4MN3 A;  2B2Y A;  2SDF A;  2B2W A;  3P7J A;  4X3S A;  2L11 A;  4ZAI A;  4QUF A;  5CMD A;  1ML0 D;  3HP3 A;  5EJW A;  1U4M A;  3SVM A;  5COY A;  3TZD A;  1EL0 A;  1JE4 A;  1WD0 A;  4R8I A;  2X6L A;  1KNE A;  1ROD A;  2B2U A;  2FJ2 A;  5CBE E;  1C8C A;  1NAP A;  2L4N A;  4HED A;  1AZP A;  3KUP A;  1PLF A;  2KUM A;  1X3Q A;  2K1B A;  4RA8 A;  5EKI A;  1F9R A;  3QO2 A;  1TVX A;  2RSN A;  1B4O A;  1QG7 A;  3I3C A;  5EPL A;  1DOK A;  1EQT A;  1HA6 A;  2MP1 A;  3I91 A;  3ONA B;  4IUP A;  2IL8 A;  2FFK B;  4OIK A;  5E4X A;  1XYI A;  1HFG A;  1MSH A;  2KEE A;  3H91 A;  2B2T C;  4CJ0 B;  4HSV A;  2H1E A;  5CBA E;  3DM1 A;  2R3Z A;  3DEO A;  4QUC A;  1SSO A;  3F2U A;  3LWE A;  1WTO A;  1ZXT A;  1CM9 A;  4ZKB B;  4CJ1 B;  4IUV A;  1BBX C;  3DEP A;  2VXW A;  1ILP A;  5EPK A;  4HCS A;  1AP0 A;  1PFN A;  2B2V C;  3IFD A;  1EIH A;  1PFB A;  4RWS C;  3TN2 A;  1J9O A;  1WTR A;  3MTS A;  1HHV A;  1IKM A;  1O80 A;  4MHE A;  5EQ0 A;  1ILQ A;  4DN4 M;  2KVM A;  1SDF A;  4OIJ A;  2Q8T A;  1B2T A;  2B2Y C;  2HUG A;  2L12 A;  2B2W C;  2M2L A;  3GV6 A;  1DOM A;  3KBX A;  4NW2 A;  4IUT A;  1IKL A;  3R93 A;  1WTW A;  1CA6 A;  5D65 A;  4ZLT F;  1QE6 A;  1G6Z A;  5EPJ A;  2K04 A;  1ICW A;  5AFW A;  1Q3L A;  2MGS A;  2B2U C;  4UAI A;  1RTN A;  2DY8 A;  2NZ1 D;  4XDX A;  4HAE A;  2HCI A;  1B3A A;  1HRJ A;  1A15 A;  4RAU C;  2RA4 A;  1O7Y A;  5T1I A;  1S4Z A;  1HUN A;  1X3P A;  1X32 A;  3Q6S A;  3FDT A;  2XIW A;  2L9H A;  1RHP A;  3I8Z A;  1G2S A;  1MGS A;  2Q8R E;  1O7Z A;  3G7L A;  4CJ2 C;  1HFN A;  2NWG A;  5DNF A;  1LV9 A;  1XX8 A;  1WTV A;  1U4P A;  4IUQ A;  2KEC A;  4O42 A;  1WTX A;  4XT3 B;  3I90 A;  4X3U A;  1BO0 A;  2N88 A;  3FPU B;  1F2L A;  1E0B A;  1SAP A;  4XT1 B;  1F9Q A;  1U4L A;  2JYO A;  2HDM A;  1WTQ A;  2CVR A;  2K28 A;  1QNK A;  2J7Z A;  2N55 A;  4R9W A;  5JJZ A;  2NYZ D;  1VMC A;  5COR A;  1G91 A;  2FMM A;  1IL8 A;  1U4R A;  1MSG A;  2RSO A;  2EE1 A;  1EOT A;  1M8A A;  1F9S A;  1WTP A;  1PDQ A;  2JP1 A;  2X69 A;  2EOT A;  2HCC A;  2L1B A;  4X3T A;  1BNZ A;  2MJ8 A;  3GV3 A;  2MPM A;  2BDN A;  2K03 A;  1NCV A;  1RTO A;  1DOL A;  2X6G A;  1G2T A;  5T1G A;  5D14 A;  1AZQ A;  1B53 A;  1DON A;  2FHT A;  2KOL A;  4ZK9 B;  5E4W C;  1VMP A;  1EIG A;  2K01 A;  1MI2 A;  1BF4 A;  2B2T A;  2D9U A;  1JIC A;  2DY7 A;  2K05 A;  2RVL A;  1KNA A;  3N52 A;  1ESR A;  4LMQ D;  1RJT A;  2KED A;  3IL8 A;  3MWY W;  4U68 A;  2FIN B;  1WVL A;  1GUW A;  2EPB A;  1NR4 A;  1DZ1 A;  2HDL A;  2B2V A;  3D6W A;  4IUU A; 
#chains in the Genus database with same CATH topology
 4EQ5 A;  5FK9 C;  1HTL D;  1PFM A;  2KCM A;  1PYB A;  2B39 A;  4ME5 A;  4MN3 A;  1KAB A;  4X3S A;  5E1F A;  1ML0 D;  4BA1 I;  4F87 A;  4H13 C;  1TS4 A;  4P71 A;  5K36 H;  4OWX B;  1PZI D;  2L4N A;  5C6A A;  4JI3 Q;  3PUY A;  3C2P A;  1KRT A;  5IT9 c;  4X64 Q;  1Q82 C;  4DR1 Q;  4APV A;  2HQL A;  3BDL A;  1A62 A;  3BS1 A;  3RLO A;  2I5H A;  5FJ8 G;  4IUP A;  2VUM H;  5E4X A;  4K2L A;  5I6W A;  3S16 B;  5M5X B;  4R4O A;  2R7Z H;  1B8A A;  3P1H A;  2CKZ B;  2F0L A;  2UUA L;  4IUV A;  2RF4 A;  2VXW A;  1Z47 A;  1K28 A;  5EPK A;  4UPA A;  2K6A A;  1HHV A;  3BU2 A;  2Z4I A;  1HPC A;  2WV6 D;  3GTJ H;  3AB9 A;  4ZRZ A;  1VQ9 A;  3HGB A;  3J7A F;  2OCE A;  1C7Y A;  5FKA C;  1D5X C;  1ET6 A;  5KNB A;  4DR5 Q;  4UAI A;  2ZXP A;  2DY8 A;  5EAY A;  1IBL Q;  4C56 C;  3R3O A;  2KBN A;  4BY7 H;  1AE3 A;  3W1B A;  4WFN 3;  1GD7 A;  2F0U A;  2SNS A;  4YCV A;  1RHP A;  3S16 H;  1VQG A;  1Z6H A;  5M5X H;  1PTO F;  3JAM i;  4DV4 L;  5BN4 A;  1WTV A;  1RIP A;  4H7B A;  5C3X A;  2B8F A;  3EA6 A;  1BO0 A;  1E0B A;  3PCO B;  1YNJ C;  2NZH A;  3CCM A;  2IX0 A;  2CVR A;  3ERQ A;  2HHH L;  3ZYY X;  2DNE A;  1FJG Q;  5CC4 A;  1CI3 M;  3GTQ B;  2UXC Q;  2HCC A;  2L1B A;  3S2D H;  2G5D A;  2QEJ C;  3SHL A;  1BCP B;  2VQE L;  1I4Q A;  1XTC D;  5IGD A;  2AKW B;  1QVG A;  4JI4 Q;  4A3J G;  3I7F A;  5LL6 S;  4IOA A;  4A76 A;  1KNA A;  2R61 A;  3MWY W;  4RMF A;  4XQJ A;  4LF6 Q;  1DZ1 A;  1B70 B;  2PI2 A;  3SGI A;  4EQO A;  3HOU G;  4J1M A;  1GUN A;  1KHI A;  1SMY C;  1S5C D;  2EY2 A;  1IBK Q;  1LTS D;  4LF5 Q;  2R93 G;  1U4M A;  2AQ2 B;  5C5L A;  2VS1 A;  4A3K G;  1YBY A;  3K6O A;  5IT9 L;  2ZJP A;  2FJ2 A;  2EYF A;  1IHZ A;  4DGZ A;  3SXH A;  3CF5 A;  3GTO B;  4LF4 Q;  4F8M A;  1GVP A;  3U58 A;  1YHQ A;  2KCN A;  3A56 A;  1VQK A;  1LTA D;  3MHB A;  1DOK A;  1LTT D;  4WRD A;  1EQR A;  1V43 A;  2KEE A;  5ELF A;  4Q0F A;  3TP8 A;  3ER0 A;  2JEA I;  5C5M A;  1LT5 D;  4RCN A;  1BXT A;  3LWE A;  1I50 B;  1TWG B;  5J1Z A;  4XYQ A;  2A6E C;  3TN2 A;  4YY3 Q;  3PO3 G;  3GO5 A;  4X65 L;  3JAM E;  4LF9 L;  1WTH A;  4RGO S;  1X3E A;  4ZUI A;  1CZW A;  4DNR B;  2B2Y C;  1B9M A;  2K33 A;  1DOM A;  1VQB A;  3I2Z A;  3D4W A;  1PTO C;  1UAP A;  1ICW A;  3Q24 A;  3GTO H;  2SEB D;  1B3A A;  4MTN A;  2IW3 A;  2ZXR A;  3VYR A;  3CME A;  5LMU Q;  3H09 A;  4Y7N H;  4ALP A;  1XMQ L;  1VQ8 A;  1GUG A;  4C3I G;  4QQB X;  4KLK A;  3MXP A;  2WII B;  4ULL A;  1STA A;  1G2S A;  1L1O C;  3RMH A;  5GAH C;  3S14 B;  2YTV A;  1BOS A;  4CJ2 C;  4DV7 L;  1G51 A;  3PIP 3;  3S1R B;  1HNZ L;  3B6Y A;  4K5W A;  1CKO A;  4OX9 L;  4HIK A;  4QMG A;  1QVF A;  3OHX C;  1HZ9 A;  3E5S A;  1D1I A;  3VYT A;  2TMP A;  1WTQ A;  4OEL B;  1YIJ A;  2J7Z A;  1I4H A;  2NYZ D;  2FMM A;  1EU4 A;  3AU7 A;  1Y1V G;  2NN6 H;  4C3H B;  1HA5 A;  5IYD H;  5C3E G;  2JP1 A;  2IT1 A;  1N36 Q;  4O2D A;  1BNZ A;  3BZK A;  2F0N A;  5CV9 A;  5C0X J;  3S14 H;  3RZD B;  1WCM B;  2OF1 A;  3S1R H;  4A3G B;  1PYW D;  4ZK9 B;  2F0D A;  4NXN Q;  5C0X G;  3NWT A;  4A93 G;  1YJN A;  3H3V C;  4DNT B;  1Y14 B;  1CQV A;  3S1N B;  4KI0 A;  1TXY A;  4JYA L;  1YJW A;  3W3A A;  5DAU A;  4HIM A;  2EPB A;  3UDG A;  3GP7 A;  3HKZ B;  2KCC A;  4ZAI A;  3IFT A;  1I5F A;  1QVC A;  1B50 A;  4O1N A;  4C3H H;  1EYC A;  2F4I A;  5GAE C;  2A6H D;  1XPU A;  2B2Y A;  4JI8 L;  3DWP A;  2RDF A;  1GOZ A;  3CC7 A;  3G71 A;  1PV4 A;  4HED A;  4C1N K;  4IFD J;  2K1B A;  4RA8 A;  4GN5 A;  1OO9 B;  2RHQ B;  1H9S A;  1N32 Q;  2QA4 A;  4HJ8 A;  1L1O A;  2XN9 C;  4IFD G;  2XVS A;  2NB0 A;  5JEA H;  3GQB A;  3KLR A;  3SK6 A;  2XNA C;  4JBK A;  1BBX C;  4KV6 A;  1M4V A;  1BUV T;  4DAV A;  5TSS A;  4IJL A;  4A3B B;  4DR7 Q;  4OEM B;  4HJA A;  5C4J H;  5C4H A;  1WTR A;  2K5H A;  3MTS A;  1O80 A;  1KDB A;  4PNY A;  3DM3 A;  3GV6 A;  2JA6 H;  1LAC A;  1Q3L A;  2MGS A;  1RTN A;  2F0M A;  3K5L A;  4FYD A;  4H02 A;  1EYD A;  2HD3 A;  1DGS A;  4BBS H;  4IPC A;  1HUN A;  2F0P A;  1B44 D;  4KK7 A;  2E5L L;  4V19 0;  1O7Z A;  3OIQ A;  3J81 j;  2ZTD A;  4LWC A;  1UE7 A;  2KEC A;  4A3B H;  3L7Z C;  1LTB D;  3K7A H;  1AE2 A;  2JEB I;  3BDO A;  1PA6 A;  1F9Q A;  2JYO A;  2JA5 B;  3K57 A;  1E7Z A;  3VR4 A;  3A7A B;  2ZTC A;  5M5W B;  2EYH A;  1D6E C;  1PH1 A;  1PH6 A;  1D8L A;  1Q7Y C;  2I5M X;  4KHV A;  2L5T A;  4F88 A;  3MA2 B;  4A3C H;  2UUB Q;  3NXW A;  3DUZ A;  3FKI H;  3M3Y B;  1E22 A;  5F2D A;  3NHH A;  4OWT B;  3S1M B;  2I07 B;  1STY A;  2CCZ A;  1BQQ T;  2DY7 A;  3SK8 A;  4DV2 L;  2RVL A;  5KYI A;  2JA5 H;  3UDX A;  1ICF B;  2AQ1 B;  2Z9H A;  1E1T A;  3K0Y A;  4DUZ Q;  5IYB G;  2D0O A;  1J8I A;  1CA5 A;  1TWF B;  1TS2 A;  4B9X A;  4QUF A;  2L11 A;  3A0J A;  4XYO A;  2JQO A;  3M3Y H;  1MJE A;  1WD0 A;  4RGM A;  4L8J A;  2WB1 G;  4LJZ C;  3S1M H;  2NZO A;  3CKI B;  1F9R A;  3I3C A;  1HA6 A;  4S3S A;  4EQP A;  1JE5 A;  2ICI A;  3KDF B;  1HFG A;  3I70 A;  5CBA E;  5G3L F;  1V9P A;  5CYU A;  3DEP A;  4B3R L;  1BCP D;  2B3G A;  1ILP A;  2R92 H;  4AQY Q;  1EIH A;  1PFB A;  4RG1 A;  2M9V A;  1J9O A;  1V1O A;  3NUC A;  3QG1 A;  3OIP A;  1V1P A;  5LHY 1;  3E9I A;  2L12 A;  1JWS D;  3MXU A;  1FL0 A;  4FO2 A;  3M85 A;  2VB3 X;  4A3I G;  2XWB B;  1CHP D;  1P16 A;  4JVZ A;  5AJ3 L;  3CCV A;  4P74 A;  4GKK L;  4H0L C;  4RGT A;  2OT2 A;  2CH4 W;  2XIW A;  5JEA J;  4HMI A;  2VQF L;  1X56 A;  2QCP X;  3A55 A;  1XX8 A;  4ZCK A;  1SBB B;  3E9H A;  4OO1 I;  3UDI A;  5JEA G;  4GOP C;  4LNQ A;  4CDE C;  1XMO Q;  1O7I A;  4ID6 A;  1UE6 A;  4AIM A;  2F4V Q;  1T5E A;  3PQI A;  4XT1 B;  3KLW A;  1GUT A;  3D6C A;  5I2X A;  3PO2 G;  5JJZ A;  1G91 A;  1STG A;  3GTL B;  4OGQ C;  1EWH A;  3VR6 A;  4DAP A;  3DXJ C;  2PYK A;  3BZD B;  2F0S A;  3HOX G;  4BXX H;  4DV1 L;  2UXD L;  3H15 A;  2JXM B;  1IW7 D;  1XNR Q;  1PZJ D;  4B9W A;  4FF4 A;  3JAM c;  2YU9 B;  3T51 B;  4EVO A;  4JBW A;  1NUC A;  1B9N A;  1SNC A;  5KYL A;  5I2Y A;  1XPR A;  3PIO A;  4GN3 B;  4YWM A;  1S72 A;  2DN8 A;  3GTL H;  2OEO A;  5CGK A;  1I4R A;  1NR2 A;  4EX5 A;  1VQH A;  2A6H C;  1EOV A;  1ONL A;  4JI0 L;  1VF7 A;  1FNU A;  2F03 A;  4MTK A;  3CCU A;  5FJ8 H;  3SDZ A;  4HJ5 A;  3RD4 A;  3BVM A;  1F2M A;  4R4Q A;  2YU9 H;  1EZ8 A;  3GTK H;  1JWM D;  1CKN A;  2WB1 E;  3NEM A;  3I55 A;  1HNW L;  3KK7 A;  3I4L A;  5NUC A;  5BN3 A;  2IL8 A;  5J39 A;  3T1H L;  3CCS A;  1B3Q A;  5I4D A;  5KRU A;  3A5Z B;  4GOP A;  2B29 A;  5ELO A;  1VQ6 A;  1QB5 D;  4C3J B;  1W6J A;  1EY6 A;  1XWE A;  2Z1C A;  1EU3 A;  5LMN L;  4BY1 B;  5C44 G;  4P75 A;  4DN4 M;  1JR0 D;  1SYF A;  3NQI A;  4OIJ A;  4NMZ A;  5IYC G;  3MXN B;  4NP5 A;  3CCL A;  4A3M G;  3H0G B;  4Y52 H;  1VDZ A;  1EQQ A;  5M3F G;  3R8B A;  1K0S A;  1CZG A;  3IKJ A;  4A3J B;  1S4Z A;  4JI2 L;  3CQZ B;  4B3M L;  2L15 A;  1M1K C;  1XPO A;  4JV5 L;  3ULP A;  1A2T A;  5C0X I;  4YCW A;  1WTX A;  1OXS C;  3A8I E;  3VYS A;  4DR2 L;  4X3U A;  3OPO A;  3HOU B;  4H44 C;  4GKJ L;  2B63 B;  2E2H H;  5KIX A;  1AW7 A;  5LMN W;  4JI1 Q;  3C46 A;  3U9S A;  5C3W A;  1Y1W G;  3NQT A;  2R93 B;  3HKZ E;  4DAY A;  5EKL A;  1VQP A;  1ZYR D;  4L5Q A;  4DR6 L;  1EY4 A;  3OWF A;  2WFW A;  4A3J H;  2C9O A;  3JAM L;  3CQZ H;  2Q2U A;  3RZO B;  3EIV A;  3N6R A;  4EQN A;  1VQN A;  5HUR A;  1TY0 A;  4OHJ A;  1RKN A;  2RHS B;  3NEN A;  1U5K A;  2ZM6 Q;  1VQ5 A;  1MI2 A;  3HOU H;  4Z9C B;  4DV3 Q;  4IFD I;  1N33 Q;  3KOJ A;  3PO3 B;  1K8O A;  5IY0 A;  2R93 H;  4A3K H;  3GTG B;  2ASB A;  3MEF A;  5IGG A;  1HUM A;  3P7J A;  2RQX A;  4I7A A;  4A75 A;  3HP3 A;  4PZ8 A;  1R9T B;  1IL2 A;  4HIO A;  3RZO H;  1JB7 A;  1PRT B;  4R8I A;  5IWA Q;  4C3I B;  4AYB G;  3D4R A;  1HNX Q;  5EKI A;  3EBE A;  1K8G A;  4KD3 A;  2JK8 A;  1LTL A;  1RCV D;  3SEB A;  1YVC A;  5I6Y A;  1OXV A;  3J80 c;  3PO3 H;  4DV5 L;  1TQO A;  3TRE A;  3I4M H;  4HN7 A;  2N78 A;  2F0W A;  4DAM A;  1DXM A;  3GTG H;  1BCP C;  2P5Z X;  2MO1 A;  4KHP Q;  1L2F A;  4KMU C;  1Y1V B;  5CV4 A;  1R9T H;  3GTJ B;  1GKH A;  1QJO A;  1XTD A;  5C3E B;  4FF3 A;  3TRZ A;  4NW2 A;  3K58 A;  4C3I H;  5D65 A;  1WOC A;  1DD2 A;  3S15 B;  1DCZ A;  1UNS A;  3BDC A;  1IBM L;  2Z8L A;  2EQS A;  4HAE A;  4B3T L;  4BY7 B;  3Q22 A;  1C48 A;  4A93 B;  2YYZ A;  5C4X G;  1MGS A;  1G6P A;  4P2C B;  2I5L X;  1YEZ A;  1TY2 A;  2WAQ E;  1FNW A;  4G7O C;  1T9H A;  3FPU B;  1F2L A;  2K4K A;  5M3M G;  1Y1V H;  5C3E H;  2E74 C;  3FHW A;  3CP0 A;  3S15 H;  4WJ3 M;  5FO7 B;  5BN5 A;  2UUA Q;  4IJH A;  3AMU A;  3S2D B;  2ZT9 C;  3A74 A;  5C0X H;  4A93 H;  2UUC L;  2ZJR A;  3GV3 A;  2NN6 I;  4A3F G;  1DOL A;  1QNU A;  1S5D D;  1IW7 C;  3EQL C;  1EWI A;  5ELB A;  5CV5 A;  1EYG A;  1BF4 A;  4KKU A;  2HIX A;  1PH5 A;  1JOQ A;  2KCT A;  3TP6 A;  4JG2 A;  2ALY B;  2HDL A;  4K0K L;  4DV4 Q;  1VQM A;  3TBI B;  2E2I H;  1I4G A;  3F2C A;  2J0T D;  2MO0 A;  3NBI A;  4ZYS A;  1D2B A;  3HS0 C;  1HJP A;  1HZA A;  2ES2 A;  2JA7 G;  3QB3 A;  1VQ7 A;  4F7X A;  4IFD H;  2HHH Q;  3WWV A;  3J80 L;  2JA8 G;  3KUP A;  2N49 A;  4OWW B;  1H9R A;  3K7U C;  1A8V A;  4AYB E;  1SEB D;  4C1N I;  1SYB A;  3TZU A;  1AFP A;  2VQE Q;  2KHJ A;  3VR5 A;  2GN5 A;  2A5H A;  4QIW E;  3IFD A;  2Y0S G;  2Z6B A;  1TU2 B;  4A3D G;  4GNX B;  5EQ0 A;  1YJ9 A;  2Z0S A;  3PUX A;  1SMX A;  2HUG A;  5H1S E;  2SNM A;  2PZW A;  1SYC A;  4RKL A;  1WTW A;  4ZLT F;  1PH9 A;  1WYD A;  4Y7N B;  3CXC A;  4DV0 L;  3CCE A;  2RCN A;  5CR3 A;  4JOI C;  1X32 A;  3I8Z A;  4FXD A;  4IO9 A;  1LV9 A;  1KD1 C;  1F2Z A;  4PMB A;  2IPK D;  1QZH A;  3MZ5 A;  2GVB A;  3I4M G;  2ENB A;  5ELC A;  3URY A;  5E7N A;  1SR3 A;  4DR3 L;  1ET9 A;  1SJE D;  2KJX A;  3HOV G;  1ZYR C;  1SND A;  4FF2 A;  1SNO A;  2WP8 J;  3Q0A A;  2WB1 B;  2BA1 A;  4X3T A;  4X65 Q;  5A35 A;  1NMF A;  4LF9 Q;  3NTI A;  4ILW A;  4TVA B;  5IOC A;  1S3O A;  1DON A;  2KOL A;  4YWK A;  3TS2 A;  3KF6 A;  4FVM A;  1PH2 A;  4DV6 L;  1MHW C;  2L0C A;  1A3T A;  5IYB H;  2NVQ B;  3HOY G;  1XMQ Q;  5JAV A;  4NB3 A;  3PV0 A;  1TWC B;  1RJT A;  3IL8 A;  4KY7 A;  1HQM C;  3HEJ A;  2A19 A;  3Q23 A;  1KDC A;  4LUO A;  1GUO A;  4DV7 Q;  4KY6 A;  1UEB A;  1HNZ Q;  1F2Y A;  1X55 A;  4OX9 Q;  4A3I B;  2SDF A;  5EKK A;  2CWA A;  3D4D A;  1LT3 D;  2EYM A;  1B7Y B;  1SE2 A;  2EJM A;  1PFS A;  2V1C C;  3I4O A;  4NPS A;  5JPM C;  3J80 i;  4JOI A;  4IZ8 A;  4UP8 A;  1B4O A;  2NVQ H;  2VY3 A;  4JI5 L;  1MSH A;  1TWC H;  2B2T C;  1Z9F A;  4CJ0 B;  2H1E A;  3L2P A;  3QIA A;  1JB3 A;  3NK9 A;  2AUJ D;  1ASY A;  1ZXT A;  2AUK A;  3PO2 B;  5C4J B;  1SN8 A;  3R2T A;  4A3I H;  1CKM A;  2Q2H A;  2CQO A;  3UE0 A;  2BH8 A;  1Y8O B;  4TQU S;  2Q8T A;  1ESF A;  4JYA Q;  2B2W C;  3HOX B;  2JA6 B;  2V4D A;  1D7Q A;  1G29 1;  1VS0 A;  3GDE A;  2NZ1 D;  3M7N A;  2CH4 A;  1N34 L;  1A15 A;  4BBS B;  4QL5 A;  3V96 A;  2QIL A;  4G57 A;  4A3E G;  4JI8 Q;  1GM5 A;  1F77 A;  2Q8R E;  3CC4 A;  1EY0 A;  1S40 A;  1K83 B;  1PRT D;  4LF8 L;  3PO2 H;  4DUY L;  1IXR A;  1UEA B;  3K7A B;  4KHZ A;  4IN3 A;  1PTO B;  2K28 A;  3HOX H;  3D8G A;  1KDA A;  3G48 A;  3V2T A;  3J81 i;  4CDC C;  4NDX A;  2EE1 A;  4UDU C;  2E76 C;  3MVV A;  4K5V A;  2X69 A;  1GO3 E;  1L1O B;  3FKI B;  3WOE A;  2MPM A;  2NVT B;  1G2T A;  4L5S A;  3HOW G;  2BE5 D;  3FP9 A;  2LMC B;  1UE5 A;  1K83 H;  1KRS A;  1VMP A;  2B2T A;  1SE3 A;  1JIC A;  2LS0 1;  5L37 A;  1NJI C;  1YIT A;  2HIV A;  1ASZ A;  1PTO H;  2FIN B;  4PV1 C;  2E5L Q;  3J80 E;  1QCB D;  1WD1 A;  3GTM B;  3KLS X;  2B2W A;  5CMD A;  5FLM G;  1C0A A;  4QGU A;  2EVB A;  4K6L A;  1GUS A;  3O13 A;  5M3F B;  2NVT H;  2UU9 L;  4LF7 L;  1B1Z A;  2WAQ B;  1H9M A;  1BVS A;  2OQ0 A;  1JT8 A;  4I65 A;  3T13 A;  3QO2 A;  3OW7 A;  2EYP A;  4ABN A;  1EQT A;  2MP1 A;  3OOC A;  3MFY A;  2CW0 D;  3E6Z X;  4LK1 C;  3F2B A;  5C44 H;  3M4Y A;  5IGB A;  2D5D A;  2MFI A;  5IYC H;  3NTH A;  4ZKB B;  1NY4 A;  5CV8 A;  2QEX A;  1M90 C;  3GTM H;  3M4P A;  2R92 B;  3MAQ A;  1Y1W B;  4A3M H;  1KLU D;  1D5M C;  3CAM A;  1IKM A;  2K5D A;  3T1Y L;  1ILQ A;  2K7V A;  1Q12 A;  4DV2 Q;  1JQY D;  5M3F H;  3E0J A;  3KDF A;  1GJX A;  1E24 A;  5IP7 G;  1TWH B;  3W2D A;  1TWA B;  4LFB L;  2KHS A;  4GLX A;  1O7Y A;  5DLQ E;  3BZC A;  3K5O A;  1H9J A;  1LTR D;  3J81 E;  4L5R C;  1JOK A;  3DHQ A;  3QR8 A;  3NE5 B;  4DKA C;  3RN5 A;  2NWG A;  3CW2 C;  1Y1W H;  4XT3 B;  1VQJ A;  3VA7 A;  1HQR D;  2A1A A;  2D0P A;  2Q2T A;  2AQ3 B;  2GA4 B;  2G9H D;  3H94 A;  4LFA L;  1UWV A;  4POF A;  4UHV A;  5HGQ A;  1TWH H;  3ERO A;  2CHB D;  5COR A;  4WJ4 A;  4DXF A;  1IYJ B;  1Q90 A;  2QW7 A;  4XQQ A;  4B3R Q;  1TWA H;  2UXB L;  2K52 A;  4X66 L;  3OWE B;  4AYB B;  4TKO B;  1STE A;  4X62 L;  4RKB A;  1ZKO A;  5T1G A;  1B53 A;  3KJP A;  3TS0 A;  1BR9 A;  2FMC A;  5GQO A;  1RD9 D;  4QIW B;  1CK1 A;  5AJ3 Q;  1PH3 A;  3AQQ A;  3P75 A;  4JK1 C;  3ICE A;  1A2U A;  5K5P A;  3C1E A;  4LMQ D;  4GKK Q;  1WCM G;  1EQV A;  4A3G G;  2VW9 A;  2VQF Q;  3K5N A;  4A3L G;  3ZJY C;  4QY7 A;  4X3K A;  1LLR D;  1CUK A;  1HR0 L;  1SE4 A;  5BR8 L;  1L0X B;  1SFO B;  5EJW A;  3VA5 A;  5FOB B;  3G6E A;  4V0B A;  1FNV A;  5COY A;  5GAG C;  4CKB A;  1ROD A;  1R4Q B;  2VL6 A;  2F3W A;  4CKE A;  3GTK B;  5D3D A;  1X3Q A;  3T4A C;  3KFU A;  1X6O A;  3M7G A;  1H95 A;  1QG7 A;  5EPL A;  4JBM A;  3S24 A;  3K59 A;  4DV1 Q;  2UXD Q;  2AHO B;  5M3M B;  4CBV A;  4TRD A;  4HCE A;  1YZ6 A;  4QB4 A;  2PI2 E;  3NBH B;  4HJ9 A;  4M8A A;  3BJU A;  3KF8 B;  4EGV A;  2B2V C;  1LUZ A;  3NTK A;  2SOB A;  2F0T A;  1SFO H;  1J5E L;  1SNQ A;  4HR7 B;  1HR0 W;  3S9W A;  3R93 A;  1K3B C;  2F0I A;  1QE6 A;  4FNF A;  2K04 A;  3D0F A;  5C4X H;  1I6H B;  1UE1 A;  3UE1 A;  2B2U C;  1PVO A;  2K5Q A;  4O0A A;  4B3S L;  5T1I A;  5ISR A;  4FF1 A;  3LWU A;  1O7L A;  1HTP A;  4JI0 Q;  5M3M H;  3MXN A;  1SNM A;  1NMG A;  3P20 A;  1PRT C;  4JI7 L;  1YHB A;  2E2H B;  1EEF D;  2N3S A;  4XXE A;  4NXM L;  1HNW Q;  3EFX D;  3T1H Q;  4JCV E;  5GAD C;  1BCP F;  4BA2 I;  1II3 A;  1YHA A;  2JA7 B;  1I6H H;  1SNP A;  4A3F H;  1HZB A;  3DWA A;  1QUQ A;  2PW5 A;  1WTP A;  1PH4 A;  1V1Q A;  4KY5 A;  1A0I A;  2JA8 B;  5LMN Q;  5KEE A;  5J22 A;  1C4Q A;  2DJF C;  3L0O A;  4MZ9 A;  2BE5 C;  1E1O A;  5GRO A;  3PIP A;  2IX3 A;  4PZ7 A;  2O2L D;  2FHT A;  1HCZ A;  4LFC L;  1WFQ A;  3WOF A;  4TSS A;  1ENC A;  4R4I A;  1Q86 C;  2R7F A;  4P73 A;  5C4Z A;  4YHH L;  2K05 A;  2Y0S B;  2BA0 A;  4CDF C;  3MC0 B;  2LFN A;  4JI2 Q;  3PUW A;  4A3D B;  1GUW A;  4B3M Q;  5IP9 G;  4A3K B;  2KEN A;  2B2V A;  4GLV B;  3VR2 A;  3D6W A;  3W5O A;  2JA7 H;  1I3Q H;  4JV5 Q;  2PQA B;  3SK4 A;  1VQE A;  4DR2 Q;  3OTO L;  1VQD A;  2A68 D;  1X3G A;  3ITP A;  2JA8 H;  1K0R A;  5HGT A;  3A8J E;  4GKJ Q;  4YWL A;  3EN2 A;  1LT4 D;  3X3M A;  5E3F A;  4JI6 L;  2F0E A;  2B2U A;  4ZUJ A;  2NTT A;  1MJC A;  4RHS A;  3C3L A;  5ELD A;  4DR6 Q;  1KQS A;  1NNX A;  5FO8 B;  1EFI D;  2NVY H;  4DR4 L;  3ONA B;  2IX1 A;  2CW0 C;  4A4I A;  1EWC A;  4A3D H;  3I4M B;  1XNQ L;  1LM0 A;  4QUC A;  4DAY B;  4HJ7 A;  4AH6 A;  1E2V A;  1I94 L;  4R8N A;  3HOV B;  1EZ6 A;  2WAC A;  4C2M B;  2E2D C;  4DFA A;  4FP5 D;  1DJR D;  1E2W A;  4IUT A;  2VZA A;  3HKS A;  5AFW A;  4GS3 A;  3HOZ G;  1WI5 A;  2PNH A;  4GLA C;  1LT6 D;  2E2J B;  4R4T A;  2PCF B;  2EDG A;  2QDL A;  1GHK A;  3CRL C;  1Q1E A;  5JPN C;  1K8A C;  3HOY B;  4DA2 A;  1U0L A;  1X54 A;  1UUP A;  4IUQ A;  4QF4 A;  5HY6 A;  1HH2 P;  3HOV H;  2EYJ A;  2D2C C;  1LAB A;  1FYC A;  2R6G A;  4C2M H;  4BWG B;  1E2Z A;  3RLF A;  4DV5 Q;  2Q2I A;  4N9P A;  4XTC S;  4JI3 L;  3VYU A;  1SYE A;  1IL8 A;  2WKC A;  4X64 L;  4DR1 L;  2E2J H;  4IPH A;  3DWQ A;  2EOT A;  2NBF A;  1CT1 D;  2BDN A;  2K03 A;  1RTO A;  2EYL A;  3ULL A;  3HOY H;  2MHV A;  2C35 B;  1BDO A;  1MBY A;  2H4O A;  4GNX C;  5EGT A;  4RH6 A;  3STB D;  2YTX A;  1IBM Q;  1GHJ A;  3PF4 A;  3BG3 A;  2DUD A;  4B3T Q;  3NEL A;  1VQI A;  5KNC A;  1JOO A;  1KAW A;  1KIX A;  2DGY A;  1TII D;  2KQ3 A;  1DM0 B;  1JWU D;  2KED A;  3CD6 A;  2NVX B;  3J7Y W;  2PQE A;  5J3B A;  2E2I B;  1KTK A;  2IJ0 A;  1V8Q A;  3X3N A;  1OTC A;  4DR5 L;  3J81 c;  1IBL L;  4RHR A;  3RR5 A;  1KLG D;  4IUR A;  1L0W A;  3SVM A;  1LO5 D;  1JMC A;  4A3E B;  3MFG A;  1STH A;  2EXD A;  4DPG A;  1EIF A;  4DK1 A;  4R4C A;  3FEW X;  3CU7 A;  1IZ6 A;  1PMR A;  1BBW A;  5ELN A;  3EJI A;  1K3R A;  5FLX c;  2UUC Q;  2NVX H;  4DK6 C;  5A2Q E;  2F52 A;  1FJG L;  3KBG A;  2RCF A;  4YCU A;  2Z4H A;  2UXC L;  3J7Z C;  2AWN A;  1JC7 A;  1QOH A;  2PZT A;  4KJN A;  2PW7 A;  4FXG C;  2WIN B;  4DNI A;  5IGC A;  1R4P B;  4PG3 A;  4A3E H;  1VQF A;  3RUZ A;  4C3J G;  3U4V A;  1ENA A;  4LUV A;  3OW2 A;  3U4Z A;  3VDY A;  4K0K Q;  3F1Z A;  5JJK A;  2XRS D;  1S5B D;  2OWO A;  4JI4 L;  3HOW B;  3EVQ A;  4BY1 G;  1SRO A;  1OXT A;  2HCI A;  3BYY B;  4YIJ A;  1S5E D;  4GNX A;  2CFM A;  4IPG A;  2MNA A;  3K80 C;  4LF6 L;  3H0G G;  2K14 A;  4DK0 A;  3I4N G;  1SYD A;  4QJF A;  3FMC A;  1VF5 C;  3PMF A;  3CPW A;  3ERS X;  3HG9 A;  4N8F A;  3TP5 A;  4FXK C;  2IHE A;  4LF5 L;  1IBK L;  4OO1 G;  2ZXO A;  3I56 A;  2O5J C;  3PIO 3;  1FR3 A;  1PYS B;  3BVZ A;  5DM6 3;  3A54 A;  3G6J B;  4LF4 L;  2TSS A;  3HOW H;  3UDF A;  3IRB A;  1MSG A;  1VQ4 A;  1QZG A;  1F9S A;  4PZ6 A;  5JOB A;  2B63 G;  3GTQ H;  4L5T A;  2XWJ B;  1S5F D;  1PZK D;  2XSC A;  1NCV A;  5IGE A;  4BBR G;  4LUZ A;  4G7H C;  1D5Z C;  3JC6 6;  3RN2 A;  4WJW A;  3TQY A;  1FGB D;  3D3R A;  4YY3 L;  2PPB C;  2F0K A;  3HRZ C;  4DV0 Q;  1W2B A;  4B08 A;  3J81 L;  1WVL A;  1ESR A;  5FLM H;  4KKS A;  2NTS A;  1T5X D;  3Q8D A;  1QWY A;  3MXG A;  2ATW A;  2OTJ A;  2A68 C;  4MNO A;  1LYL A;  5LMU L;  1FGU A;  3MEH A;  2EY5 A;  1EL0 A;  5FO9 B;  1JE4 A;  2PNR C;  2X6L A;  4DF7 A;  4KKT A;  4DR3 Q;  4E6I A;  1EY9 A;  5FLX L;  3V05 A;  4PMC A;  1BKB A;  3NWS A;  1RL2 A;  4DU9 A;  1YNX A;  3I91 A;  4K6D A;  4HMJ A;  5K36 G;  1IYU A;  3H91 A;  3RLN A;  3M9B A;  1A63 A;  1MD2 D;  1Q8I A;  2A69 D;  1WTO A;  1CM9 A;  5JVH 3;  5IP7 H;  1G8Z D;  1ENF A;  1PFN A;  2VUM G;  1I50 H;  5EBD A;  1TWG H;  4DV6 Q;  1Q81 C;  2JA9 A;  1W3S A;  2K5N A;  1N36 L;  1Q1B A;  2F1M A;  1SDF A;  2XRQ D;  3F2D A;  3TEH B;  2R7Z G;  1B2T A;  2AWO A;  3SK5 A;  2M2L A;  4P72 A;  3CC2 A;  2PMZ B;  1SE8 A;  1LTG D;  1CA6 A;  3WDN A;  5M9O A;  3LNN A;  4NXN L;  3KF6 B;  1BBU A;  3S2H B;  2CQA A;  4K5X A;  4RAU C;  1CSQ A;  1E3P A;  2F0O A;  3H3V I;  3QOL A;  5JJL A;  1X3P A;  1AN8 A;  4HSP A;  3QOJ A;  1VQL A;  4QCL A;  1A3V A;  1U4P A;  1FD7 D;  4BY7 G;  4KTA A;  4UY8 C;  1XXG A;  2EXZ A;  1YNN D;  3W1G A;  3L3O C;  3TME A;  2Y0S E;  1CSP A;  1EEI D;  1PH7 A;  3SE0 A;  4JI5 Q;  2HDM A;  2K32 A;  2C5C A;  1FVI A;  4R9W A;  3RNU A;  1TR5 A;  1M8A A;  1N32 L;  3S2H H;  1PDQ A;  4UP7 A;  4ZQ3 A;  2VNU D;  3KLS A;  4N8X 1;  1SRU A;  2MQH A;  4OL7 A;  2EZV A;  1JCK B;  1VQC A;  5DEH A;  2LKV A;  3FPP A;  2A73 B;  4PMW A;  1EFW A;  2B8G A;  2OTL A;  4CHT B;  1KL9 A;  3A5U A;  3RZD H;  1WCM H;  5G3L D;  3STB C;  4DR7 L;  4A3G H;  3OMG A;  4A3L H;  2FXQ A;  5M5Y B;  1N34 Q;  2K5W A;  2N8N A;  3BYT B;  1GXD C;  3S1N H;  1CHQ D;  2KHI A;  4HID A;  4L6T B;  4POG A;  4PQX A;  2BCO A;  1VQO A;  3VR3 A;  1H9S B;  3C1F A;  4LF8 Q;  4DUY Q;  2HT1 A;  1I4X A;  1F9P A;  3TDQ A;  3T53 B;  3AYH B;  2IY5 B;  2HQE A;  5CV7 A;  2OQK A;  5KGU A;  3AEV A;  2JSO A;  1AZP A;  1PLF A;  2EIF A;  2R7D A;  5M5Y H;  1X9N A;  1TVX A;  2RSN A;  2JN4 A;  2IWH A;  5C44 B;  1TKW B;  2LXJ A;  4HSV A;  2F0J A;  3DM1 A;  3NSW A;  4A3M B;  2OXP A;  4K2K A;  3QWN A;  3CHB D;  5D3I B;  2QDB A;  2UUB L;  3K5M A;  3S17 B;  3E3X A;  4WOR A;  2KVM A;  1IYV A;  2BH2 A;  3A7L A;  1IKL A;  3LX0 A;  2ZTE A;  3PUV A;  1SYG A;  4RCO A;  4R1J A;  4XDX A;  5KND A;  1D1K A;  3K81 C;  5JVG 3;  1Y8P B;  2NUC A;  2RA4 A;  1EYA A;  1OXX K;  4KN7 C;  1JJ2 A;  2UU9 Q;  4LF7 Q;  2DJG C;  3FVQ A;  4DUZ L;  2RBM A;  3I90 A;  2EJG C;  4M1U B;  1EY8 A;  3S17 H;  2F0V A;  5IT9 E;  3H3V H;  5M5W H;  1PHJ A;  2XTI A;  1QIL A;  1VCI A;  1MKH A;  3K0X A;  4J15 A;  2ICE C;  3TSS A;  2LSS A;  3T1Y Q;  2ID0 A;  4IOC A;  1JOR A;  3M4O B;  3I72 A;  1CFM A;  4N9T A;  3IAY A;  2EY6 A;  5D14 A;  1AZQ A;  4CGY B;  2NN6 G;  1L0Y B;  5IYD G;  1JJC B;  5IP9 H;  2QGQ A;  4AQY L;  4LFB Q;  2D9U A;  2F0F A;  3CCQ A;  3U50 C;  1P8L A;  1HXY D;  1NSN S;  2PO4 A;  1PRT F;  4CKC A;  5FLX E;  2F3V A;  1I4P A;  5I9O A;  1NBW A;  4HTH A;  2E8G A;  4ZKC B;  2O5I C;  1J6Q A;  1STB A;  5IOD A;  1ZEQ X;  2O4X A;  1TWF H;  3HOZ B;  3M4O H;  2GVA A;  4LFA Q;  1O78 A;  4RFB A;  3U9O A;  4XQN A;  1KNE A;  2JE6 I;  1EY7 A;  3K8A A;  2EY1 A;  1NAP A;  4C3H G;  4J8Q A;  2IHF A;  1LTI D;  1XMO L;  3GTP B;  2UXB Q;  4X66 Q;  2F4V L;  4X62 Q;  1V1P B;  4K8J A;  2F3I A;  4OON A;  4CDD C;  2FFK B;  1XYI A;  2F0G A;  2I0Q A;  3H6M A;  1SXT A;  4JPB W;  2A69 C;  1X3F A;  3F2U A;  4X6A H;  4GN4 B;  4CJ1 B;  1K8M A;  2A8V A;  2RKS A;  1X65 A;  3CRK C;  2EYO A;  2BOS A;  4MHE A;  3HOZ H;  4JBJ A;  1NTG A;  3AFQ A;  3HKZ G;  1EUJ A;  4IUN A;  1N8R C;  4DK3 C;  3KBX A;  5C4X B;  1XNR L;  3CMA A;  1G6Z A;  5EPJ A;  3NBH A;  3HZX A;  3CCR A;  2Q8I B;  4J6H A;  3KF8 A;  2MUY A;  3GTP H;  5IE8 A;  1HR0 Q;  3SR1 A;  2K50 A;  1C9O A;  2Z6K C;  3ND8 A;  3OYY A;  5BR8 Q;  2JA6 G;  3Q6S A;  4L63 B;  3J7A 5;  3FDT A;  3G7L A;  4OXP A;  3A8K E;  1Q8K A;  2LXK A;  3T16 A;  4BS9 A;  4O42 A;  4BBS G;  2G9D A;  2N88 A;  4U67 3;  1YNN C;  1YNJ D;  3PUZ A;  2LY7 A;  3FRP B;  1U4L A;  4MIU A;  1HZC A;  2XGT A;  1CTM A;  5A2Q L;  5I9P A;  2N55 A;  4JW0 A;  4A3F B;  4A3B G;  1PH8 A;  3I73 A;  2WKD A;  3KJO A;  1EOT A;  5EBC A;  1TS5 A;  1NE3 A;  2YV5 A;  4K8I A;  2MJ8 A;  4KD4 A;  1Y8N B;  1A3U A;  1SLJ A;  1J5E Q;  2X6G A;  3PF5 A;  2J4X A;  4LAA A;  3DLL A;  4A3C G;  2AMC B;  3F8T A;  2K01 A;  1PXU A;  1Z7T A;  4FDB A;  3FKI G;  4IPD A;  3TP7 A;  4B3S Q;  5JJI A;  4U68 A;  4IAL A;  1Q46 A;  1I3Q B;  4KN4 C;  2CWP A;  1RF2 D;  3GD7 A;  2DNC A;  4G4K A;  1CKN B;  3HFZ B;  4JI7 Q;  2JA5 G;  1SMY D;  1AH9 A;  3E0E A;  3UI2 A;  3D31 A;  4NXM Q;  1W6K A;  4ME3 A;  3TZD A;  4GOP B;  2PMZ E;  2E75 C;  3OMC A;  3LGJ A;  5CBE E;  1C8C A;  1Y69 U;  1YI2 A;  2ZJQ A;  2KUM A;  1TT2 A;  4LW1 A;  2PQA A;  5IGF A;  3KYH C;  3I4N B;  2Z6K A;  1OXU A;  2NVY B;  2K75 A;  3PGZ A;  3ULJ A;  5IIF A;  3CCJ A;  3S1Q B;  5DM7 3;  1SJH D;  4OIK A;  1K73 C;  4JC0 A;  3J7A V;  4JI1 L;  4KJO A;  2QF7 A;  2WAQ G;  2EJF C;  2R3Z A;  3DEO A;  3DMU A;  4Q5V A;  4UP9 A;  1TS3 A;  3L9A X;  1SSO A;  4XIG S;  2QKI C;  4C3J H;  3T56 B;  4HCS A;  4LFC Q;  1AP0 A;  1QUQ B;  2K5V A;  2L55 A;  2VB2 X;  2A6E D;  4RWS C;  3NP8 A;  3G4S A;  4BY1 H;  3CPF A;  4YHH Q;  4IQZ A;  2F0Q A;  1KAA A;  2A74 C;  4K14 A;  2R92 G;  1KXL A;  1PTO D;  2ZM6 L;  3H0G H;  4BBR B;  3I4N H;  1HRJ A;  3M4Q A;  5LL6 X;  3OTO Q;  3QJY A;  4DV3 L;  2BDO A;  1N33 L;  3S1Q H;  4G7Z C;  3AFP A;  2I46 A;  4OO1 H;  3OSO A;  2L9H A;  4JI6 Q;  2H5X A;  2KA7 A;  1N9W A;  1EIY B;  1HFN A;  5ELE A;  5DNF A;  2M00 A;  4NKL A;  2YTY A;  2RDG A;  3NPP A;  1KC8 C;  1K9M C;  1WJJ A;  1SAP A;  2JJQ A;  1VQA A;  4DR4 Q;  1JJG A;  2B63 H;  3R2I A;  4I7Z C;  1A6X A;  3ND9 A;  1QNK A;  1DYQ A;  5IWA L;  2PZU A;  1XNQ Q;  1EY5 A;  1HNX L;  1VMC A;  2RDH A;  1MIU A;  1U4R A;  4BBR H;  1AEX A;  2RSO A;  1I94 Q;  4GZY C;  3BVG A;  3PSI A;  4RGN A;  5E4W C;  1I6V C;  4BXX G;  1EIG A;  5CV6 A;  4KHP L;  1H9K A;  1U9R A;  2VUM B;  3N52 A;  1CQF A;  2D62 A;  1XJV A;  1RDP D;  4DXG A;  1NR4 A;  2F0H A;  1STN A;  4ODG A;  2R7Z B;  4IUU A; 
#chains in the Genus database with same CATH homology
 5FK9 C;  1HTL D;  1PFM A;  2B39 A;  4ME5 A;  4MN3 A;  1KAB A;  4X3S A;  5E1F A;  1ML0 D;  4BA1 I;  4F87 A;  4H13 C;  1TS4 A;  5K36 H;  1PZI D;  2L4N A;  5C6A A;  3PUY A;  3C2P A;  3BDL A;  3BS1 A;  4IUP A;  5E4X A;  4K2L A;  5I6W A;  3S16 B;  5M5X B;  3P1H A;  2F0L A;  4IUV A;  2VXW A;  1Z47 A;  5EPK A;  2K6A A;  1HHV A;  2Z4I A;  1HPC A;  2WV6 D;  3AB9 A;  4ZRZ A;  3HGB A;  3J7A F;  5FKA C;  1D5X C;  1ET6 A;  5KNB A;  4UAI A;  2ZXP A;  2DY8 A;  4C56 C;  3R3O A;  4WFN 3;  2F0U A;  2SNS A;  1RHP A;  1Z6H A;  1PTO F;  5BN4 A;  1WTV A;  4H7B A;  5C3X A;  2B8F A;  3EA6 A;  1BO0 A;  1E0B A;  1YNJ C;  2IX0 A;  2CVR A;  3ERQ A;  3ZYY X;  2DNE A;  5CC4 A;  1CI3 M;  3GTQ B;  2HCC A;  2L1B A;  3SHL A;  2QEJ C;  1BCP B;  1I4Q A;  1XTC D;  5IGD A;  5LL6 S;  1KNA A;  2R61 A;  3MWY W;  4XQJ A;  1DZ1 A;  4EQO A;  4J1M A;  1GUN A;  1SMY C;  1S5C D;  2EY2 A;  1LTS D;  1U4M A;  2AQ2 B;  5C5L A;  3K6O A;  5IT9 L;  2FJ2 A;  2EYF A;  1IHZ A;  4DGZ A;  3SXH A;  3GTO B;  4F8M A;  2KCN A;  3A56 A;  1LTA D;  3MHB A;  1DOK A;  1LTT D;  4WRD A;  1V43 A;  2KEE A;  5ELF A;  4Q0F A;  3TP8 A;  2JEA I;  5C5M A;  1LT5 D;  4RCN A;  1BXT A;  3LWE A;  1I50 B;  1TWG B;  5J1Z A;  4XYQ A;  2A6E C;  3TN2 A;  3GO5 A;  3JAM E;  4RGO S;  4ZUI A;  1CZW A;  4DNR B;  2B2Y C;  1B9M A;  2K33 A;  1DOM A;  3D4W A;  1PTO C;  1UAP A;  1ICW A;  3Q24 A;  2SEB D;  1B3A A;  2IW3 A;  2ZXR A;  3VYR A;  3H09 A;  1GUG A;  4C3I G;  3MXP A;  2WII B;  4ULL A;  1STA A;  1G2S A;  3RMH A;  3S14 B;  1BOS A;  4CJ2 C;  3PIP 3;  3S1R B;  4K5W A;  4QMG A;  3OHX C;  3E5S A;  1D1I A;  3VYT A;  2TMP A;  1WTQ A;  2J7Z A;  1I4H A;  2NYZ D;  2FMM A;  1EU4 A;  3AU7 A;  2NN6 H;  4C3H B;  1HA5 A;  2JP1 A;  2IT1 A;  1BNZ A;  2F0N A;  5CV9 A;  5C0X J;  3RZD B;  1WCM B;  2OF1 A;  4A3G B;  1PYW D;  4ZK9 B;  2F0D A;  5C0X G;  3NWT A;  3H3V C;  4DNT B;  1CQV A;  3S1N B;  4KI0 A;  3W3A A;  5DAU A;  2EPB A;  3GP7 A;  3HKZ B;  2KCC A;  4ZAI A;  3IFT A;  1B50 A;  4O1N A;  1EYC A;  2F4I A;  2A6H D;  2B2Y A;  3DWP A;  2RDF A;  1GOZ A;  4HED A;  4C1N K;  4IFD J;  2K1B A;  4RA8 A;  1OO9 B;  1H9S A;  2XN9 C;  4IFD G;  2XVS A;  2NB0 A;  5JEA H;  3GQB A;  3KLR A;  3SK6 A;  2XNA C;  1BBX C;  4KV6 A;  1M4V A;  1BUV T;  4DAV A;  5TSS A;  4A3B B;  5C4H A;  1WTR A;  3MTS A;  1O80 A;  1KDB A;  4PNY A;  3GV6 A;  1LAC A;  1Q3L A;  2MGS A;  1RTN A;  2F0M A;  3K5L A;  4FYD A;  1EYD A;  1HUN A;  2F0P A;  1B44 D;  4KK7 A;  4V19 0;  1O7Z A;  3OIQ A;  2KEC A;  3L7Z C;  1LTB D;  2JEB I;  3BDO A;  1F9Q A;  2JYO A;  2JA5 B;  3K57 A;  3VR4 A;  3A7A B;  5M5W B;  2EYH A;  1D6E C;  4KHV A;  2L5T A;  4F88 A;  3MA2 B;  3NXW A;  3DUZ A;  3M3Y B;  5F2D A;  3NHH A;  3S1M B;  2I07 B;  1STY A;  1BQQ T;  2DY7 A;  3SK8 A;  2RVL A;  5KYI A;  2AQ1 B;  3K0Y A;  1J8I A;  1CA5 A;  1TWF B;  1TS2 A;  4B9X A;  4QUF A;  2L11 A;  4XYO A;  1WD0 A;  4RGM A;  4L8J A;  4LJZ C;  3CKI B;  1F9R A;  3I3C A;  1HA6 A;  4S3S A;  4EQP A;  2ICI A;  1HFG A;  3I70 A;  5CBA E;  5G3L F;  5CYU A;  3DEP A;  1ILP A;  1BCP D;  1EIH A;  1PFB A;  2M9V A;  1J9O A;  1V1O A;  3NUC A;  3QG1 A;  3OIP A;  1V1P A;  5LHY 1;  2L12 A;  1JWS D;  3MXU A;  4FO2 A;  3M85 A;  2VB3 X;  2XWB B;  1CHP D;  4H0L C;  4RGT A;  2OT2 A;  2XIW A;  5JEA J;  4HMI A;  2QCP X;  3A55 A;  1XX8 A;  1SBB B;  4OO1 I;  5JEA G;  4ID6 A;  1T5E A;  4XT1 B;  1GUT A;  3D6C A;  5I2X A;  5JJZ A;  1G91 A;  1STG A;  3GTL B;  4OGQ C;  1EWH A;  3VR6 A;  4DAP A;  3DXJ C;  2PYK A;  3BZD B;  2F0S A;  2JXM B;  1IW7 D;  1PZJ D;  4B9W A;  4FF4 A;  2YU9 B;  3T51 B;  4EVO A;  4JBW A;  1NUC A;  1B9N A;  1SNC A;  5KYL A;  5I2Y A;  2DN8 A;  2OEO A;  5CGK A;  1I4R A;  1NR2 A;  2A6H C;  1ONL A;  1VF7 A;  1FNU A;  2F03 A;  3SDZ A;  3RD4 A;  3BVM A;  1F2M A;  1EZ8 A;  1JWM D;  3KK7 A;  3I4L A;  5NUC A;  5BN3 A;  2IL8 A;  5J39 A;  5I4D A;  5KRU A;  1QB5 D;  4C3J B;  1W6J A;  1EY6 A;  1XWE A;  2Z1C A;  1EU3 A;  4BY1 B;  4DN4 M;  1JR0 D;  1SYF A;  3NQI A;  4OIJ A;  4NMZ A;  4NP5 A;  3H0G B;  1VDZ A;  3R8B A;  1CZG A;  3IKJ A;  4A3J B;  1S4Z A;  3CQZ B;  1A2T A;  5C0X I;  1WTX A;  1OXS C;  3A8I E;  3VYS A;  4X3U A;  3OPO A;  3HOU B;  4H44 C;  2B63 B;  5KIX A;  1AW7 A;  3C46 A;  3U9S A;  5C3W A;  3NQT A;  2R93 B;  4DAY A;  5EKL A;  1ZYR D;  1EY4 A;  3OWF A;  2C9O A;  3JAM L;  3RZO B;  3N6R A;  4EQN A;  5HUR A;  1TY0 A;  4OHJ A;  1RKN A;  1MI2 A;  4Z9C B;  4IFD I;  3PO3 B;  1K8O A;  3GTG B;  5IGG A;  1HUM A;  3P7J A;  2RQX A;  3HP3 A;  1R9T B;  1PRT B;  4R8I A;  4C3I B;  3D4R A;  5EKI A;  4KD3 A;  1RCV D;  3SEB A;  5I6Y A;  1OXV A;  1TQO A;  4HN7 A;  2F0W A;  1DXM A;  1BCP C;  4KMU C;  1Y1V B;  5CV4 A;  3GTJ B;  1QJO A;  5C3E B;  4FF3 A;  4NW2 A;  3K58 A;  5D65 A;  1DD2 A;  3S15 B;  1DCZ A;  1UNS A;  3BDC A;  2Z8L A;  4HAE A;  4BY7 B;  3Q22 A;  1C48 A;  4A93 B;  2YYZ A;  1MGS A;  4P2C B;  1TY2 A;  1FNW A;  4G7O C;  3FPU B;  1F2L A;  2E74 C;  5FO7 B;  5BN5 A;  3AMU A;  3S2D B;  2ZT9 C;  5C0X H;  3GV3 A;  2NN6 I;  1DOL A;  1QNU A;  1S5D D;  1IW7 C;  3EQL C;  5ELB A;  5CV5 A;  1BF4 A;  4KKU A;  1JOQ A;  3TP6 A;  2HDL A;  3TBI B;  1I4G A;  2J0T D;  3NBI A;  4ZYS A;  1D2B A;  3HS0 C;  3QB3 A;  4F7X A;  4IFD H;  3J80 L;  3KUP A;  1H9R A;  1SEB D;  4C1N I;  1SYB A;  3TZU A;  1AFP A;  3VR5 A;  2A5H A;  3IFD A;  1TU2 B;  5EQ0 A;  3PUX A;  2HUG A;  2SNM A;  2PZW A;  1SYC A;  4RKL A;  1WTW A;  4ZLT F;  4Y7N B;  5CR3 A;  1X32 A;  3I8Z A;  4FXD A;  1LV9 A;  1F2Z A;  4PMB A;  2IPK D;  3MZ5 A;  2ENB A;  5ELC A;  3URY A;  1ET9 A;  1SJE D;  2KJX A;  1ZYR C;  1SND A;  4FF2 A;  1SNO A;  2WP8 J;  3Q0A A;  2WB1 B;  2BA1 A;  4X3T A;  5A35 A;  3NTI A;  4ILW A;  5IOC A;  1DON A;  2KOL A;  4FVM A;  2L0C A;  1A3T A;  2NVQ B;  5JAV A;  3PV0 A;  1TWC B;  1RJT A;  3IL8 A;  4KY7 A;  1HQM C;  3HEJ A;  3Q23 A;  1KDC A;  1GUO A;  4KY6 A;  1F2Y A;  4A3I B;  2SDF A;  5EKK A;  3D4D A;  1LT3 D;  2EYM A;  1SE2 A;  2EJM A;  5JPM C;  4IZ8 A;  1B4O A;  1MSH A;  2B2T C;  4CJ0 B;  2H1E A;  3QIA A;  1JB3 A;  3NK9 A;  2AUJ D;  1ZXT A;  2AUK A;  3PO2 B;  5C4J B;  3R2T A;  1Y8O B;  4TQU S;  2Q8T A;  1ESF A;  2B2W C;  3HOX B;  2JA6 B;  2V4D A;  1G29 1;  3M7N A;  2NZ1 D;  1A15 A;  4BBS B;  3V96 A;  2QIL A;  4G57 A;  1F77 A;  2Q8R E;  1EY0 A;  1K83 B;  1PRT D;  1UEA B;  3K7A B;  4KHZ A;  4IN3 A;  1PTO B;  2K28 A;  3D8G A;  1KDA A;  3V2T A;  4NDX A;  2EE1 A;  4UDU C;  2E76 C;  3MVV A;  4K5V A;  2X69 A;  3FKI B;  3WOE A;  2MPM A;  2NVT B;  1G2T A;  2BE5 D;  2LMC B;  1VMP A;  2B2T A;  1SE3 A;  1JIC A;  2LS0 1;  1PTO H;  2FIN B;  4PV1 C;  3J80 E;  1QCB D;  1WD1 A;  3GTM B;  3KLS X;  2B2W A;  5CMD A;  2EVB A;  4K6L A;  1GUS A;  3O13 A;  5M3F B;  1B1Z A;  2WAQ B;  1H9M A;  4I65 A;  3T13 A;  3QO2 A;  3OW7 A;  2EYP A;  4ABN A;  1EQT A;  2MP1 A;  3OOC A;  3MFY A;  2CW0 D;  3E6Z X;  4LK1 C;  3M4Y A;  5IGB A;  2D5D A;  3NTH A;  4ZKB B;  5CV8 A;  2R92 B;  3MAQ A;  1Y1W B;  1KLU D;  1D5M C;  1IKM A;  2K5D A;  1ILQ A;  2K7V A;  1Q12 A;  1JQY D;  3E0J A;  1GJX A;  1TWH B;  3W2D A;  1TWA B;  2KHS A;  1O7Y A;  3K5O A;  1H9J A;  1LTR D;  3J81 E;  1JOK A;  3DHQ A;  3NE5 B;  2NWG A;  4XT3 B;  3VA7 A;  1HQR D;  2AQ3 B;  2GA4 B;  2G9H D;  3H94 A;  3ERO A;  2CHB D;  5COR A;  4DXF A;  1Q90 A;  4XQQ A;  3OWE B;  4AYB B;  4TKO B;  1STE A;  4RKB A;  1ZKO A;  5T1G A;  1B53 A;  1BR9 A;  2FMC A;  1RD9 D;  4QIW B;  1CK1 A;  3P75 A;  4JK1 C;  1A2U A;  5K5P A;  3C1E A;  4LMQ D;  1EQV A;  3K5N A;  4X3K A;  1LLR D;  1SE4 A;  1L0X B;  1SFO B;  5EJW A;  3VA5 A;  5FOB B;  4V0B A;  1FNV A;  5COY A;  4CKB A;  1ROD A;  1R4Q B;  2F3W A;  4CKE A;  3GTK B;  5D3D A;  1X3Q A;  3T4A C;  3M7G A;  1QG7 A;  5EPL A;  3K59 A;  5M3M B;  4CBV A;  4TRD A;  4HCE A;  4QB4 A;  4M8A A;  4EGV A;  2B2V C;  3NTK A;  2SOB A;  2F0T A;  1SNQ A;  4HR7 B;  3S9W A;  3R93 A;  2F0I A;  1QE6 A;  4FNF A;  2K04 A;  1I6H B;  2B2U C;  2K5Q A;  5T1I A;  5ISR A;  4FF1 A;  3LWU A;  1O7L A;  1HTP A;  3MXN A;  1SNM A;  3P20 A;  1PRT C;  2E2H B;  1EEF D;  4XXE A;  3EFX D;  1BCP F;  4BA2 I;  1II3 A;  2JA7 B;  1SNP A;  3DWA A;  2PW5 A;  1WTP A;  4KY5 A;  2JA8 B;  5KEE A;  5J22 A;  1C4Q A;  2BE5 C;  2IX3 A;  2O2L D;  2FHT A;  1HCZ A;  3WOF A;  4TSS A;  1ENC A;  5C4Z A;  2K05 A;  2Y0S B;  2BA0 A;  3MC0 B;  2LFN A;  3PUW A;  4A3D B;  1GUW A;  4A3K B;  2B2V A;  3VR2 A;  3D6W A;  3SK4 A;  2A68 D;  3ITP A;  5HGT A;  3A8J E;  1LT4 D;  3X3M A;  5E3F A;  2F0E A;  2B2U A;  4ZUJ A;  2NTT A;  4RHS A;  3C3L A;  5ELD A;  5FO8 B;  1EFI D;  3ONA B;  2IX1 A;  2CW0 C;  1EWC A;  3I4M B;  4QUC A;  1E2V A;  4R8N A;  3HOV B;  1EZ6 A;  2WAC A;  4C2M B;  2E2D C;  4DFA A;  4FP5 D;  1DJR D;  1E2W A;  4IUT A;  5AFW A;  2E2J B;  1LT6 D;  2PCF B;  2EDG A;  1GHK A;  3CRL C;  1Q1E A;  5JPN C;  3HOY B;  4DA2 A;  1UUP A;  4IUQ A;  4QF4 A;  2EYJ A;  2D2C C;  1LAB A;  1FYC A;  2R6G A;  4BWG B;  1E2Z A;  3RLF A;  4XTC S;  4N9P A;  3VYU A;  1SYE A;  1IL8 A;  2WKC A;  3DWQ A;  2EOT A;  2NBF A;  1CT1 D;  2BDN A;  2K03 A;  1RTO A;  2EYL A;  2MHV A;  1BDO A;  1MBY A;  2H4O A;  5EGT A;  4RH6 A;  1GHJ A;  3BG3 A;  5KNC A;  1JOO A;  1TII D;  2KQ3 A;  1DM0 B;  1JWU D;  2KED A;  2NVX B;  3J7Y W;  2PQE A;  2E2I B;  1KTK A;  2IJ0 A;  1V8Q A;  3X3N A;  4RHR A;  1KLG D;  4IUR A;  3SVM A;  1LO5 D;  4A3E B;  3MFG A;  1STH A;  4DK1 A;  3FEW X;  3CU7 A;  1PMR A;  3EJI A;  5A2Q E;  3KBG A;  2Z4H A;  2AWN A;  1JC7 A;  1QOH A;  2PZT A;  4KJN A;  2PW7 A;  2WIN B;  4FXG C;  5IGC A;  1R4P B;  3RUZ A;  4C3J G;  1ENA A;  2XRS D;  1S5B D;  3HOW B;  3EVQ A;  1OXT A;  2HCI A;  3BYY B;  4YIJ A;  1S5E D;  4DK0 A;  1SYD A;  3FMC A;  1VF5 C;  3PMF A;  3HG9 A;  3TP5 A;  4FXK C;  4OO1 G;  2ZXO A;  2O5J C;  3PIO 3;  1FR3 A;  3BVZ A;  5DM6 3;  3A54 A;  3G6J B;  2TSS A;  1MSG A;  1F9S A;  5JOB A;  2XWJ B;  1S5F D;  1PZK D;  2XSC A;  1NCV A;  5IGE A;  4G7H C;  1D5Z C;  4WJW A;  1FGB D;  3D3R A;  2PPB C;  2F0K A;  3HRZ C;  4B08 A;  3J81 L;  1WVL A;  1ESR A;  4KKS A;  2NTS A;  1T5X D;  1QWY A;  3MXG A;  2A68 C;  3MEH A;  2EY5 A;  1EL0 A;  5FO9 B;  1JE4 A;  2PNR C;  2X6L A;  4DF7 A;  4KKT A;  4E6I A;  1EY9 A;  5FLX L;  3V05 A;  4PMC A;  3NWS A;  4DU9 A;  3I91 A;  4K6D A;  4HMJ A;  5K36 G;  1IYU A;  3H91 A;  1MD2 D;  1Q8I A;  2A69 D;  1WTO A;  1CM9 A;  5JVH 3;  1G8Z D;  1ENF A;  1PFN A;  5EBD A;  1Q1B A;  2F1M A;  1SDF A;  2XRQ D;  1B2T A;  2AWO A;  3SK5 A;  2M2L A;  2PMZ B;  1LTG D;  1CA6 A;  3WDN A;  5M9O A;  3LNN A;  3S2H B;  2CQA A;  4K5X A;  4RAU C;  2F0O A;  3QOL A;  1X3P A;  1AN8 A;  4HSP A;  3QOJ A;  4QCL A;  1A3V A;  1U4P A;  1FD7 D;  4KTA A;  1XXG A;  2EXZ A;  1YNN D;  3L3O C;  3TME A;  1EEI D;  3SE0 A;  2HDM A;  2K32 A;  2C5C A;  4R9W A;  1TR5 A;  1M8A A;  1PDQ A;  4ZQ3 A;  2VNU D;  3KLS A;  4OL7 A;  2EZV A;  1JCK B;  5DEH A;  2LKV A;  3FPP A;  2A73 B;  4PMW A;  2B8G A;  4CHT B;  5G3L D;  3OMG A;  5M5Y B;  2K5W A;  3BYT B;  1GXD C;  1CHQ D;  4L6T B;  4PQX A;  2BCO A;  3VR3 A;  1H9S B;  3C1F A;  1I4X A;  1F9P A;  3TDQ A;  3T53 B;  2HQE A;  5CV7 A;  5KGU A;  2JSO A;  1AZP A;  1PLF A;  1TVX A;  2RSN A;  2IWH A;  5C44 B;  1TKW B;  4HSV A;  2F0J A;  3DM1 A;  3NSW A;  4A3M B;  2OXP A;  4K2K A;  3QWN A;  3CHB D;  5D3I B;  2QDB A;  3K5M A;  3S17 B;  4WOR A;  2KVM A;  1IYV A;  3A7L A;  1IKL A;  3LX0 A;  3PUV A;  1SYG A;  4RCO A;  4XDX A;  5KND A;  1D1K A;  5JVG 3;  1Y8P B;  2NUC A;  2RA4 A;  1EYA A;  1OXX K;  4KN7 C;  3FVQ A;  2RBM A;  3I90 A;  2EJG C;  4M1U B;  1EY8 A;  2F0V A;  5IT9 E;  1QIL A;  1VCI A;  2ICE C;  3TSS A;  2ID0 A;  1JOR A;  3M4O B;  3I72 A;  1CFM A;  4N9T A;  3IAY A;  2EY6 A;  5D14 A;  1AZQ A;  4CGY B;  2NN6 G;  1L0Y B;  2D9U A;  2F0F A;  1HXY D;  1NSN S;  2PO4 A;  1PRT F;  4CKC A;  5FLX E;  2F3V A;  1I4P A;  5I9O A;  4HTH A;  4ZKC B;  2O5I C;  1STB A;  5IOD A;  1ZEQ X;  2O4X A;  3HOZ B;  1O78 A;  4RFB A;  3U9O A;  4XQN A;  1KNE A;  2JE6 I;  1EY7 A;  2EY1 A;  1NAP A;  4C3H G;  4J8Q A;  1LTI D;  3GTP B;  1V1P B;  4K8J A;  2FFK B;  1XYI A;  2F0G A;  3H6M A;  1SXT A;  2A69 C;  3F2U A;  4CJ1 B;  1K8M A;  2RKS A;  3CRK C;  2EYO A;  2BOS A;  4MHE A;  4IUN A;  3KBX A;  5C4X B;  1G6Z A;  5EPJ A;  3NBH A;  3HZX A;  2Q8I B;  4J6H A;  3KF8 A;  2MUY A;  3SR1 A;  3ND8 A;  3Q6S A;  4L63 B;  3FDT A;  3G7L A;  3A8K E;  3T16 A;  4BS9 A;  4O42 A;  2G9D A;  2N88 A;  4U67 3;  1YNN C;  1YNJ D;  2LY7 A;  3PUZ A;  3FRP B;  1U4L A;  4MIU A;  1CTM A;  5A2Q L;  5I9P A;  2N55 A;  4A3F B;  3I73 A;  2WKD A;  1EOT A;  5EBC A;  1TS5 A;  4K8I A;  2MJ8 A;  4KD4 A;  1Y8N B;  1A3U A;  2X6G A;  2J4X A;  4LAA A;  2K01 A;  1PXU A;  1Z7T A;  3TP7 A;  4U68 A;  4IAL A;  1I3Q B;  4KN4 C;  1RF2 D;  3GD7 A;  2DNC A;  4G4K A;  1SMY D;  3UI2 A;  3D31 A;  1W6K A;  3TZD A;  2E75 C;  3OMC A;  5CBE E;  1C8C A;  1Y69 U;  2KUM A;  1TT2 A;  3I4N B;  5IGF A;  1OXU A;  2NVY B;  5IIF A;  3S1Q B;  5DM7 3;  1SJH D;  4OIK A;  3J7A V;  4KJO A;  2QF7 A;  2EJF C;  2R3Z A;  3DEO A;  3DMU A;  4Q5V A;  1TS3 A;  3L9A X;  1SSO A;  4XIG S;  2QKI C;  3T56 B;  4HCS A;  1AP0 A;  2VB2 X;  2L55 A;  2A6E D;  4RWS C;  3NP8 A;  4IQZ A;  2F0Q A;  1KAA A;  2A74 C;  4K14 A;  1PTO D;  4BBR B;  1HRJ A;  5LL6 X;  3QJY A;  2BDO A;  4G7Z C;  2I46 A;  4OO1 H;  3OSO A;  2L9H A;  2KA7 A;  1HFN A;  5ELE A;  5DNF A;  2M00 A;  4NKL A;  2RDG A;  3NPP A;  1SAP A;  3R2I A;  4I7Z C;  1A6X A;  3ND9 A;  1QNK A;  1DYQ A;  2PZU A;  1EY5 A;  1VMC A;  2RDH A;  1U4R A;  1AEX A;  2RSO A;  4GZY C;  3BVG A;  4RGN A;  5E4W C;  1I6V C;  1EIG A;  5CV6 A;  1H9K A;  1U9R A;  2VUM B;  3N52 A;  1CQF A;  2D62 A;  1RDP D;  4DXG A;  1NR4 A;  2F0H A;  1STN A;  4ODG A;  2R7Z B;  4IUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...